4L9TA

Crystal structure of mepr f27l mutant from multidrug resistant s. aureus clinical isolate
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
140
structure length
140
Chain Sequence
MEFTYSYLFRMISHEMKQKADQKLEQLDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular mechanisms of allosteric mutations impairing MepR repressor function in multidrug-resistant strains of Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords MepR
total genus 54
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4l9tA00
2W57A 4RGUA 3ELKA 4WXDA 1U2WA 2Z99A 3GFLA 3ECOA 1FBUA 2ZMEB 2V9VA 1V3FA 2KJCA 2RC4A 3ZMUA 3CO7C 5DCMA 4KA4A 3DXJF 3QOPA 1WRJA 1H9GA 3EYIA 4HLXA 4I7HA 4KMUX 1Q1HA 3CUOA 3CUQA 4S05A 2LSOA 3I59A 4DQ2A 2FU4A 2RVCA 1IN5A 4ON0A 1FBSA 4YFXF 2HKXA 4FX4A 1ZG3A 2VT2A 1SD5A 4IRIA 2V1XA 1V4RA 2VBZA 1X3UA 4LK1F 4Y13A 5LGNA 3SFZA 3QP6A 2CQKA 2XAGA 5JFRA 4P5OA 1NHAA 4M6YA 5L3DA 3ZMSA 1YW9A 1HBXG 1U5TB 3E5QA 2DFIA 3IWZA 1SFEA 3DQVC 1SD4A 2DQLA 2HR3A 4ZH4F 3MZHA 3E6BA 4G8XA 4LK0F 2VXZA 3HRSA 2P4WA 3RDIA 4AVPA 1IN7A 1I27A 2JPBA 3TDZC 4HF0A 3LAPA 4L9VA 2D1VA 3TO9A 1UFMA 2D45A 1ZLJA 2O61A 5D4RA 1R1TA 2M5WA 5LBQA 1O7LA 2J5PA 1YW8A 4LG0B 4LB6B 1RIOH 4EJTA 1VTNC 2ADUA 2OZUA 1E2XA 4IVNA 1LDJA 1KYZA 1U8RA 4P55A 4G6DA 2XHKA 1O3QA 4MNUA 2JRTA 3KLNA 3COAC 1ZN2A 4OOIA 4PZJA 2OA4A 4U7DA 1L0OC 4M74A 3SQNA 1A04A 2NAZA 2PEXA 2XASA 3GLXA 1B4AA 4AIHA 4RB0A 4ZYEA 2GXBA 3C1DA 3M7GA 4ZZDA 1KYWA 5D8KB 5ILSA 1QGPA 2E7XA 1D8KA 4KUMA 1ZAOA 2RQPA 1XGMA 3K1PA 1SFUA 1IN6A 5BMZA 1P2FA 1P4XA 1P4AA 2FRHA 4O3MA 2H94A 3IWFA 2CO5A 1R36A 2M30A 1U78A 2P6SA 3D0SA 1XGNA 4P9FA 2DPDA 1IN4A 4HX8A 1ODDA 3V8KA 1HW2A 2HS5A 2ELHA 4BXUA 5LGUA 2Q8KA 4WCGA 2JPCA 1G6NA 3L9FA 1FOKA 2XAHA 3ABUA 4KIBA 2XAJA 2ZO4A 3IHUA 1FNNA 4CDGA 2FE3A 4L0YB 3EUHA 2P8TA 1WSUA 1USTA 1XN7A 1OMIA 5D5VB 2HTSA 5LRRA 4HOBA 1JXSA 4A6DA 1FSHA 4A12A 4I02A 5FO5A 1G3SA 2ZMEA 1ON2A 2QUFA 1R1VA 3QPTA 4XRFA 4CICA 3K1NA 5CYVA 4I01A 5DV5A 5ICGA 2AXLA 2GA2A 4EMSA 2GA1A 1KQ8A 1XMAA 3EQLF 3DKWA 1WWXA 2DK8A 2M45A 1ZG1A 3NQOA 2UXNA 1LB2A 5HLIA 1TQMA 2FMLA 3R4KA 4KFCA 2PG4A 2H27A 2J5OA 3T5XA 2VT3A 3R0JA 1DPRA 4O5VA 3HSRA 1KU7A 2EJRA 5ILUA 1S8NA 2E7WA 2A69F 4OMYA 3WGGA 4UVCA 3ECHA 3U2RA 3SXYA 2DLLA 3EDPA 1HKQA 2ISZA 3GX4X 1RI7A 2EV5A 5LHGA 4UUVA 2KIMA 2L4MA 3IKTA 2W85A 3F8NA 2RNJA 2BEOA 1LDKB 3KLOA 4MQ9F 5DYMA 1G3YA 2EFOA 3ZPLA 3WE2A 4JBAA 3ISPA 1BC8C 1JHHA 2ZJ2A 3GEZA 4LJZF 3BWGA 1T38A 2HWVA 3BOQA 1IXSB 2K4JA 3E3VA 3PQKA 5AONA 2OQGA 1YS7A 3F8FA 1MDMA 4G7OF 4UVBA 4Y17A 3MZYA 2UWMA 1K7AA 5JHUA 2PMUA 4B8XA 3FWEA 2B0LA 2LNBA 1LJ9A 3WGHA 1XDSA 2L4AA 3E6DA 1B59A 1DUXC 3GVAA 4I0AA 2QQAA 1IW7F 2Q0OA 4L9NA 4CO8A 4YG2F 4WXHA 1T6SA 3VODA 3HRMA 1MGTA 3W6KB 1W7PB 1FYKA 1OYYA 2Z9OA 5E8GA 1QO0D 5ICFA 1I5ZA 1LQ1A 2BBYA 5EEGA 4DNCA 1CGPA 3M8EA 2TDXA 2DBBA 4ESBA 4PCQA 3HTSB 3V7CA 4ENMA 1ZH5A 1ZGJA 1H0MA 2XKPA 1B6AA 5K5OA 1J2XA 1TLHB 3PFIA 3F6OA 1GXQA 2ZBKA 1K79A 2NNNA 1U5TA 4ASNA 2MH2A 2IP2A 2QZ8A 5BS6A 3TO6A 4L5JA 1ZYRF 1T98A 4KT5C 2FMYA 3FZVA 2VOPA 4HX7A 2MD5A 1D5VA 3IKVA 1FZPB 1IN8A 2NS0A 5HDGA 1ZRDA 2XUBA 5LRSA 1FPQA 2DT5A 3FMRA 3BY6A 3P9CA 3KP5A 4ZZLA 2P6TA 3C18A 1IF1A 2A68F 3T8RA 4JQFA 2IPQX 2PN6A 1IRGA 2R7FA 2Z5UA 3GYHX 1DP7P 3J80K 2H09A 1WQ2A 1XMKA 3J81Z 2DW4A 2IA0A 1UHMA 5IT9Z 4L18B 4OINF 4HDVA 3WTZA 3REOA 5LEKA 1DDNA 2QBYA 2PQ8A 3FMQA 2ZFWA 3FXQA 3IRRA 2D2WA 3QP5A 2RN7A 4R8HA 5E1WA 2YX4A 5JR3A 2X4HA 4NB5A 1Z9CA 1R5HA 1YTYA 5BOXA 1PDNC 1EH6A 2WWYA 4KN4X 2EFQA 1R7JA 4OU0A 2YU3A 3F21A 3DF8A 4FT8A 2WV0A 5HS7A 4IRGA 4RGXA 3T1BA 1ZG5A 3K1MA 4AD9A 2IA2A 2VOOA 5D5WB 2HKOA 2K02A 3RIRA 2EK5A 1QNTA 1FSEA 1OYIA 5L3BA 4XBFA 1YFHA 3F22A 4UHTA 3IL2A 3F8BA 3KEOA 3RJPA 3SZTA 1P4WA 5D5XB 4XSZF 2A07F 5FLXK 1WKMA 3FXRA 4BNCA 1SD6A 4PGHA 1XB4A 2Z33A 3TOBA 3U1DA 3VOEA 3EYYA 3IC7A 1BOAA 4RAZA 4D0PA 2QM3A 4CYDA 1WI9A 4EJOA 4RB3C 3V7RA 1QBJA 2L01A 3CLOA 4BYYA 3TDUC 2ACJA 2QVOA 5F64A 5DCMB 2PMHA 4HV6A 3LA2A 1SAXA 3FHZA 4UVAA 3LSTA 2FQ3A 1I6XA 2DO7A 2K27A 2MC3A 3PQJA 1IUYA 1TQIA 3QRFF 1W5SA 2KRFA 3HSFA 1MDMB 2OQRA 2IT0A 5DCFA 1ONVA 3V8JA 4KNYA 1J0RA 5CVUA 3G3ZA 3WTVC 2HOEA 2P7VB 2CSOA 2Y0MA 3J81K 5HLGA 3HUGA 2K7LA 1F9NA 4M72A 1S3JA 2PBIA 1FBQA 3ZMTA 1S6LA 3NEUA 3P9KA 1G3WA 2H6CA 4HA8A 4A5MA 1JHFA 2YR2A 4A6EA 3L00A 2QENA 1OPCA 2EA4A 5KVRA 4MGRA 4RGSA 1GHCA 4QWQA 4A0YA 1R00A 2X0LA 1R1UA 3DPLC 3VB2A 3R61A 2COMA 3LFKA 3N4MA 2XIGA 2MBFA 4G6QA 5TRDA 3BJ6A 5IT3A 3LQRA 3GFMA 3QU3A 3V8LA 2ETHA 1MJAA 1FC3A 2Y48A 5H20A 1LNWA 1O3TA 1TBXA 2D1HA 4GO1A 4G9YA 2ESNA 5D8LB 2IVMA 1KA8A 4IJAA 1BIBA 1IAWA 2FNPA 4TV7A 3GO5A 4M73A 4U7BA 2UXXA 5D5UB 1I1SA 1USSA 4ESFA 4GYIA 3CUQB 4IXAA 1CF7B 1G4DA 3O6BB 3ERED 4LD5A 1ZHFA 4YFKF 2JSCA 4A2UA 2EFPA 4KN7X 2MH9A 3CO6C 3BJOA 5HLHA 5E20A 4HV5A 5CJ9A 4NHJA 1XSDA 2VN2A 2ZNYA 1JE8A 2JT1A 3U9GA 4LLLA 1HW1A 3BPVA 4KIGA 5CVJA 2LF7A 3WTWC 2ZCWA 2G9WA 3QPHA 3I59B 3KZZA 1IZ1A 2O3FA 3BP8A 2OU2A 3WG9A 3IRQA 5CVVA 4LMYA 3QU6A 2L02A 2P5KA 4N9HA 2FSWA 2LF8A 3F8MA 5FD6A 5L3GA 2FXAA 3ZQ7A 1HKSA 5D6EA 1HKTA 2VC0A 5HS9A 1E17A 3LA7A 1T2KA 3JTGA 1EV7A 3KETA 1H9TA 3D5LA 3BDDA 3I4PA 3I54A 4P9UA 4U0WA 2EB7A 3KCCA 3HYIA 2VBYA 1OR7A 2QYOA 1DPUA 2XVCA 3WODF 2IA1A 4Q48A 4OIOF 3T0YA 3JSPA 1W5TA 1RUOA 4EJUA 5BPIA 5K1YA 4KIFA 2A6EF 1MZBA 2W84A 3FX3A 1Z7UA 5FFZA 3Q5FA 3C7JA 3I71A 4WX9A 5HDNA 5HVQC 3K0LA 2BV6A 4L9JA 4RAYA 4BH9A 4I2OA 1LEAA 4I09A 4HW0A 4OMZA 2IW5A 4BHPA 2VBWA 4GCVA 3ULQB 4LLNA 2OAZA 2GXGA 2CG4A 3B73A 4BHBA 4A0XA 3WU0A 1HXDA 2W24A 3VFZA 3NRVA 2UZKA 3K2ZA 1YLFA 4QLCU 4IF4A 3JAMK 5LLQA 2HTJA 5J8CA 1Y0UA 2VONA 4ENKA 2BGCA 4BQAA 5J6XA 5E18F 2IRFG 3I58A 5DD4A 4HX4A 1S7OA 3KP3A 3I0TA 2HFHA 4N0BA 4H0EA 3F72A 4LLGF 2FBKA 2QWWA 3QAHA 5F6FA 3N97A 1B9MA 2PI0A 2A61A 1P92A 4HQMA 5ERIA 3Q9SA 3OV8A 3L09A 3TOAA 2F2EA 2GAUA 2CWEA 4HF2A 2GWRA 4K2EA 2ZNZA 2DU9A 4RB2C 1P6RA 1MJ9A 4PGGA 2P7CB 2F5CA 5D4SA 2L54A 1F1ZA 3O2PE 2V79A 3HIFA 3ROUA 5JI6A 4KICA 2ESHA 4ZYDA 1MD0A 1BBYA 1R5GA 3E6CC 1XGOA 2DTRA 2KJBA 3RTRA 2FBIA 3L2CA 4EM0B 1FWZA 4FHTA 4M6XA 2CW0F 4HLYA 1TTYA 1FYLA 2M87A 4YIFA 2BE5F 2FEZA 1RZ4A 3GUDA 3GZ5A 1R23A 4I0BA 3V7SA 1ULYA 3M1EA 5TJJA 1O57A 5EEHA 2BYVE 3FM5A 3TO7A 3JSOA 1KU9A 4EV0A 4RGRA 4EJVA 5DEQA 1SMTA 4LB5A 1U5TC 3Q9VA 4L0ZB 3HHGA 3F23A 4LGWA 3L7WA 3GWZA 3DPTA 1O7FA 1CF7A 1J7KA 1FY7A 2YX7A 3SHFA 2FBHA 4EQQA 2V1UA 4YFNF 3J7AO 3CJNA 3P9IA 2WC2A 4M9XA 1QPMA 3HTUA 5DDGA 2DK5A 1AOYA 4U88A 3ZN1A 2HDCA 1LVAA 4ENNA 3ZN0A 1RUNA 5L3FA 4KMFA 1D8JA 3RPUA 3AAFA 2JTVA 3RPQA 2P5LC 4E70A 3K9TA 5L3EA 2STTA 4U0YA 1KU2A 4ENJA 3R0AA 4ZYHA 4EGYA 1UHWA 5LEJA 4UV8A 3ZP5A 1MKMA 2EV0A 5JVTA 2FF4A 1D3YA 4MEXF 5FGMA 1PP7U 4L9TA 5DD8A 2FNAA 3GW2A 3RKWA 2LKPA 3KP4A 1ON1A 1J9IA 4HQEA 2E1NA 1ZLKA 1PP8F 3I5UA 3HRTA 3RYRA 1YW7A 5E8IA 1HSTA 3ZMZA 1BIAA 2ZXJA 2QBYB 1SMYF 2FA5A 3C3WA 4Z2YA 4XLPF 4LFUA 1OYWA 5CLSA 2DAOA 1YO5C 2F5DA 1HQCA 2KIFA 2A6HF 4RS8A 3JW4A 1FP1D 5CVIA 1YG2A 3E97A 2VE8A 5AIPA 3JAMZ 4CHUA 2C6YA 5AIQA 5LGTA 2ISYA 1FYMA 5FB2A 3FM3A 1REPC 3WE3A 2P5VA 4JK1X 5HOOA 3RYPA 1Z05A 3GFIA 1HW5A 5E1ZB 3E6MA 3BROA 3MFKA 2XROA 4I98B 3KP2A 3LAJA 3P7NA 1TW2A 4R1HA 1FT9A 1I1GA 4MHGA 2XV4S 2O0YA 4Q5SF 1UCRA 1BI2A 2DQRA 2MLGA 2Y75A 3H3UA 3MEXA 2R3SA 3WTSC 5ICCA 5K5RA 1T39A 4WK8F 1F5TA 4HYEA 2HEOA 5A2QK 2MA3A 1Z6TA 3KE2A 1T0FA 5IT9K 5E1XA 2W25A 3JTHA 1TNSA 1W7PA 2RKHA 2DI3A 4EJWA 3TQNA 2EFWA 3F8CA 2A5YB 1IRFA 5ED4A 4IHTA 5E17F 2NNYA 1STZA 1YYVA 4S04A 5FFXA 2DPUA 2CFXA 3R6SA 3GF2A 2O03A 5KK1A 4RB1A 1ZARA 4UV9A 4WWCA 4PDKA 1J59A 2VE9A 1B9NA 1YS6A 3WGIA 1FLIA 4Q4ZF 3ZMDA 1MJBA 1BC7C 3F3XA 2XGXA 3KZYA 3DV8A 1QZZA 4CGZA 4HBLA 1BI0A 2Z3YA 3FMSA 4MQVA 1FP2A 3WTYC 4AIKA 4EM1A 4AIJA 2RGVA 2LDUA 1Z1DA 2GZWA 4L5IA 3BPXA 3RI4A 3ML6A 1TQPA 1R58A 3EETA 3E5XA 5BQTA 3J80Z 5FLXZ 4ESJA 2G7HA 4MTDA 4OIQF 1IXCA 3MQ0A 3CTAA 3B02A 5BPDA 3DFGA 3MCZA 1XD7A 2HYFA 4IPAA 3VEPA 3ABTA 3M8FA 5FD5A 5K5QA 3HOSA 3BZ6A 1YQAA 4KDPA 3R60A 1GXPA 1UB9A 4B09A 3M9AA 3LQQA 4U0VA 1K6OA 4XLNF 4HDUA 4KYWA 1L3LA 3TKYA 2EFNA 3WTTC 3KP6A 3I64A 4GYGA 2Q2EA 4P96A 2VBXA 4MEYF 4UNOA 1U6GA 4GGGA 1BM9A 2FOKA 1S7AA 2WTEA 1XSXA 4O6JA 4GXOA 4CZZA 4HAMA 3SZPA 3S2WA 4BHCA 2CGPA 3HOTA 5J8FA 1AWCA 2F5FA 2HQNA 2JZYA 3RKXA 1G3TA 1XSVA 3LWFA 4OIRF 5L3CA 4Y15A 3I53A 3GFJA 4MTEA 1K78A 1HSJA 1IXRC 2RDPA 2QQ9A 1QZYA 1XCBA 2IJLA 1ZREA 2EV6A 2STWA 2L3DA 2NRAC 2A3SA 3G73A 3GXOA 2K86A 4ZYGA 2XKOA 2KIUA 5ILVA 1J75A 1ZRCA 3CDHA 1O3SA 5HDKA 2HQRA 1OKRA 5ICEA 4HZFA 1BJAA 4IRHA 2M8EA 4WXCA 2KKOA 5CVRA 3T8TA 3HRUA 4A5NA 4M9ZA 3GZ6A 1LEBA 1XGSA 2PFBA 3BJAA 1EH7A 2GIVA 2QQBA 4LG0A 2H6BA 2V1DA 2OD5A 5H6RA 4IHSA 2MLKA 4NQWA 4YIIA 3V4GA 1KQ0A 1XCVA 1BI3A 2F5EA 2HYGD 2QLZA 3H92A 2R7DA 4G7HF 2RV8A 3LA3A 2XAQA 4Q47A 1QQIA 1FX7A 1F4KA 2VC1A 1W7PD 2PLYA 1KU3A 4WF2A 2YPRA 1Z91A 2OBPA 4UXNA 1KQ9A 5LHIA 2K4BA 3HHHA 1U3EM 1W4MA 2EA2A 2OZ6A 1B1BA 3E5UA 1TW3A 1C0WA 4HF1A 2XAFA 3WTUC 4A0ZA 4M71A 4CXFA 1JGSA 1LDDA 2VODA 2NYXA 2HGCA 2ZKZA 3MAJA 3CUQC 2HZTA 1KGSA 1J5YA 2V6CA 4XSXF 3DP7A 3TGNA 4AWXB 1EH8A 5H6QA 2XRNA 3KP7A 3DEUA 2EWNA 3K69A 2M1BA 1RNLA 2O8XA 2AS5F 4BAYA 5F1RA 1ZRFA 3KEQA 3MWMA 3HSEA 2PJPA 3KFWX 5DUKA 4EGZA 3OOPA 3FXUA 5DUIA 4R79A 4EM2A 4ETSA 1XDUA 4EVIA 5HS8A 3WU1B 1YIOA 3O3KA 2GQQA 1SFXA 1GVJA 1ZGAA 3WTXC 2YSRA 1TNTA 5D6FA 5A2QZ 5LHHA 1K78B 2CYYA 2O6GE 1BI1A 2G7UA 1SD7A 1S29A 4G94A 1Z6RA 4OIPF 3ZMVA 3H3ZA 4FX0A 1R22A 2E1CA 3W6JB 1O3RA 4F7ZA 3RKYA 3FF5A 1BN5A 4M9SA 4N9IA 4G7ZF 3F6VA 1PUEE 6PAXA
chains in the Genus database with same CATH superfamily
2X1DA 3EUAA 2LBFA 2QF7A 2W57A 2WADA 3PUFA 4RGUA 3ELKA 4WXDA 1U2WA 2Z99A 3GFLA 1ZGWA 3ECOA 4GRIA 1FBUA 2ZMEB 2V9VA 1V3FA 2KP6A 5GPCA 2LY2A 2ID3A 2KJCA 3CMEI 2RREA 3GTJJ 2RC4A 3ZMUA 3CO7C 1R4NB 5DCMA 2JN6A 1MNEA 4ABZA 1BW5A 4KA4A 5F0FA 1W0UA 3DXJF 3QOPA 1WRJA 3S2HJ 1H9GA 1N25A 3EYIA 4HLXA 4I7HA 3BCBA 4KMUX 2Y31A 1Q1HA 3CUOA 3CUQA 3V42A 1G2HA 4FE4A 4S05A 4BBRJ 2LSOA 3I59A 4DQ2A 2FU4A 2RVCA 2BHZA 2K3PA 1IN5A 3VYTB 3J7ZI 1HDDC 4ON0A 1FBSA 4A3KJ 3K70D 4YFXF 3CJQB 2HKXA 4FX4A 1ZG3A 2VT2A 5F0HA 1FOXA 1SD5A 1ETXA 4IRIA 1Y39A 2V1XA 2FJ1A 1V4RA 2IS1A 2IS6A 2VBZA 4YEJA 4BQOA 1X3UA 4LK1F 4Y13A 5LGNA 2HYJA 3SFZA 3I56I 4BY1J 1HDPA 3QP6A 2CQKA 3BR6A 3IH2A 2K9QA 2XAGA 5DM7F 1EJ9A 4F93B 5JFRA 4P5OA 3KEYA 1NHAA 5FKKA 2K40A 3OIQA 2LG4A 4XK4A 4B47A 4M6YA 5L3DA 3ZMSA 3K4KA 1JT0A 4BUPA 2COBA 4FETA 1YW9A 2KQRA 1IC8A 2FX0A 2AQEA 1WJDA 1HBXG 3Q0WA 1V54H 1U5TB 3E5QA 1G59A 2W1OA 5J1UA 2DFIA 3IWZA 2NVTJ 4AYBA 1SFEA 4DZJA 3DQVC 1LE8B 1SD4A 3MKZA 2DQLA 2HOTA 2HR3A 4ZH4F 3MZHA 2XB0X 3E6BA 4G8XA 4LK0F 2VXZA 3HRSA 2P4WA 2V9PA 3RDIA 2OV7A 3C2BA 4AVPA 3PIOF 1IN7A 1ZK8A 1I27A 4C3JJ 2QSHX 1FIPA 5KHDA 2JPBA 4KJZA 3TDZC 2W48A 4HF0A 3LAPA 4L9VA 3CF2A 2D1VA 2ZXIA 3TO9A 2L5QA 1UFMA 2D45A 1ZLJA 2O61A 5D4RA 1R1TA 2M5WA 1YIJI 4II2A 5LBQA 1O7LA 2J5PA 2XF7A 3SFIA 4FASD 1YW8A 1V5GA 4ZTFA 4LG0B 2LREA 2LP0A 4LB6B 1RIOH 2V26A 4EJTA 1ZKGA 4X0GA 2E5NA 1VTNC 2ADUA 3LSKA 3PSFA 1DP3A 1UAAA 2OZUA 2VQGA 1E2XA 4IVNA 1LDJA 3WHCA 1KYZA 1U8RA 2NS7A 3HXLA 4P55A 1F43A 4G6DA 2PJRA 5B66C 3FXJA 2XHKA 4E7ZA 5DS9A 2CW8A 4DGWB 2DJIA 1O3QA 2DFEA 2JRTA 4MNUA 3KLNA 3COAC 2NS8A 1ZN2A 4OOIA 4PZJA 2OA4A 1D1AA 4PJLA 4U7DA 1L0OC 4M74A 3SQNA 1VQ5I 4E7SA 1A04A 3ASNH 3AKZA 3FISA 2NAZA 1K6YA 2PEXA 2XASA 3GLXA 1B4AA 4AIHA 4RB0A 4ZYEA 4RLQA 4D5CA 2GXBA 3L2WA 2X1CA 3C1DA 3M7GA 2JMWA 1WCMJ 1NH3A 4ZZDA 1VZ0A 1KYWA 5D8KB 5GADJ 2NVQJ 2CUFA 5ILSA 1QGPA 4I99C 4XMYA 4YRVA 2E7XA 2W4SA 4J00A 1D8KA 3BG9A 4KUMA 3K6GA 5GPAA 4E6KG 1ZAOA 1MMDA 2RQPA 2RNGA 5JLXA 3DPUA 2VJIA 1XGMA 2BW3B 3JRDA 3CC2I 3K1PA 1SFUA 1IN6A 1D5YA 5BMZA 4QPQA 1YX5A 2K5CA 4QSHA 1P2FA 2Y69H 1JUSA 2EBIA 4XOTA 1P4XA 2YUSA 1BA5A 5IY5H 1P4AA 2IGNA 2FRHA 2H94A 4O3MA 3IWFA 3A0BC 2CO5A 3OYBA 1T95A 3WHBA 1AU7A 1R36A 2M30A 3HUGB 1U78A 2P6SA 3D0SA 1IJWC 2XRLA 4XORA 5B1BH 3ZGKA 1XGNA 3PJRA 2DDBA 4P9FA 2DPDA 1WZ2A 1IN4A 2CUJA 4HX8A 1ODDA 2BXYA 3V8KA 1HW2A 1YE9A 2LC2A 4HPQA 2CUZA 4HEA2 2HS5A 2EIKH 2ELHA 3E1SA 4BXUA 2RAEA 4D7NA 3A02A 3H5AA 3NAUA 4JYKA 4RMNA 5LGUA 2Q8KA 4WCGA 2M8GX 2L2OA 4I76A 2JPCA 3ZQGA 1G6NA 3QPLA 2L9NA 3L9FA 1FOKA 2OF7A 2R7RA 4DYCA 2XAHA 2LY1A 2H8RA 3RZOJ 3ABUA 4Y4RA 3CCMI 4UUTA 2QSGX 1K4SA 2VI6A 2XAJA 4KIBA 4UY8I 3W2VA 2ZO4A 2HQAA 3IHUA 3LSRA 1X1DA 1FNNA 1ENHA 4CDGA 2FE3A 2M9HA 4L0YB 2E71A 2VLAA 3EUHA 3S32A 2P8TA 1MBJA 1WSUA 1USTA 1XN7A 2V1NA 1V5FA 1LFPA 1OMIA 5D5VB 3JR9A 2HTSA 5LRRA 3OYMA 4HOBA 1JXSA 4A6DA 1FSHA 4A12A 2VPLA 4I02A 5FO5A 2KFDA 4N4OB 4BKXA 3A4CA 1G3SA 2VQHA 2ZMEA 1V55H 1ON2A 3CC4I 2QUFA 1R1VA 3QPTA 4XRFA 3U21A 5HODA 2KT0A 4CICA 3IV5A 3K1NA 5CYVA 3FK6A 4I01A 5DV5A 5ICGA 2AXLA 2GA2A 4EMSA 2DA3A 3MZ8A 3CCUI 2GA1A 1KQ8A 4PJJA 2EH3A 1XMAA 3EQLF 3DKWA 4PJMA 3TBIA 1WWXA 2L9RA 4B3AA 2DK8A 4MIMA 1GV5A 1JJ6C 2M45A 5J1RA 2IXSA 1ZG1A 1FJLA 3NQOA 2UXNA 1LB2A 1QHGA 1P7JA 5HLIA 2XDVA 1JKRC 3FKIJ 1TQMA 2CRGA 4BE0A 2FMLA 3R4KA 4C2MJ 4KFCA 4CCJA 2PG4A 2H27A 1IV8A 2LY9A 1Y0NA 2J5OA 2YU9J 4HNUA 3T5XA 2VT3A 3E7LA 3HDDA 1W5CC 3A01A 2K85A 3R0JA 2W7NA 3KYLA 3ZR8X 1DPRA 3H36A 2DMQA 4O5VA 3HSRA 2I8DA 2QKLB 2FUG2 1KU7A 4II3A 3HOWJ 4A93J 2EJRA 1HCRA 5ILUA 1S8NA 2E7WA 2A69F 4OMYA 3VSKA 3WGGA 2BXZA 3ECHA 4UVCA 2LD5A 1IDYA 3U2RA 1HOMA 3SXYA 2DA5A 2DLLA 3EDPA 1FMWA 3CF5F 3HBLA 3ZQFA 1HKQA 3OYDA 3OYHA 2ISZA 3GX4X 1RI7A 2EV5A 3G1LA 3RZDJ 2EZKA 1AKHA 5LHGA 4UUVA 3A03A 2KIMA 2L4MA 2FQ4A 3IKTA 2W85A 3F8NA 1XX5A 2RNJA 2BEOA 1LDKB 3KLOA 4MQ9F 3ZCOA 5DYMA 1G3YA 3AL0C 2EFOA 3DKYA 3FXOA 1NK2P 3QOEA 3ZPLA 1E3HA 3WE2A 4XL9A 2KRHA 3ISPA 4JBAA 1BC8C 1JHHA 2ZJ2A 5B3SH 2DA4A 3HM5A 3GEZA 4BY7J 4LJZF 3BWGA 1T38A 2GXAA 2HWVA 3BOQA 1ETWA 1IXSB 2K4JA 3E3VA 4V19K 5FKMA 1M1EB 2DODA 2DMPA 3PQKA 5AONA 1ETYA 2OQGA 2R7WA 1YS7A 4C30A 3F8FA 2Y2ZA 1MDMA 4G7OF 5LFAA 1T8IA 4UVBA 4Y17A 3MZYA 2XSDC 2UWMA 2VASA 1K7AA 5JHUA 2PMUA 1HF0A 5IP6A 1WJ5A 2OCEA 3IH3A 3FBNB 1FEXA 4B8XA 3FWEA 1OCTC 5K7ZA 1P7IA 2B0LA 1JUPA 2LNBA 1TWCJ 1LJ9A 1UG0A 3F0CA 3WGHA 1IG7A 2JVHA 2ME6A 3HOVJ 1XDSA 1E3OC 2L4AA 3E6DA 1B59A 1DUXC 3GVAA 3G6EI 4I0AA 2QQAA 1XMXA 1IW7F 2Q0OA 3OYCA 4L9NA 3JRHA 4CO8A 4YG2F 1JJ8C 3KYCB 4WXHA 1T6SA 2LTPA 3BT9A 1MGTA 3HRMA 3VODA 3W6KB 1LFUP 4FISA 2WB1A 4HNTA 3MD2A 1W7PB 5IYCJ 2ZSHB 1WJFA 1FYKA 1OYYA 3HGGA 2Z9OA 5E8GA 3DTEA 3NARA 1QO0D 3QWLA 2KDOA 1VQOI 1TWHJ 5ICFA 1U9OA 3D1NI 1I5ZA 1LQ1A 2BBYA 2E1MB 2ZXHA 3LSJA 5EEGA 3TW6A 2QKMB 4DNCA 5J4VA 1CGPA 4F91B 3M8EA 2JA8J 2TDXA 2KLOA 3A1YA 3TL4X 5HNHA 2DBBA 4ESBA 2EZLA 2VKEA 4PCQA 4XLHA 3HTSB 3V7CA 4ENMA 3RQIA 3LSPA 1ZH5A 1ZGJA 2K9SA 1H0MA 1OQYA 2XKPA 1B6AA 5K5OA 1J2XA 2XSJC 5DM6F 2OUMA 1TLHB 2BY3A 1LE8A 1SVMA 1FTTA 1TZLA 3PFIA 3F6OA 1GXQA 2ZBKA 3RPUD 1K79A 2NNNA 2JA6J 1U5TA 2ID6A 2MH2A 4ASNA 1H89C 4F52A 2IP2A 2QZ8A 5BS6A 3TO6A 2ELKA 4M6VA 4L5JA 5JLWA 1ZYRF 5J47A 1T98A 4F3QA 4KT5C 2FMYA 3FZVA 4ANJA 2BY1A 3OS0A 2VOPA 3OYFA 4HX7A 5IP9J 2MD5A 4M3FA 5M3FJ 4Y52J 2HDWA 3IKVA 5FRMA 1D5VA 1FZPB 1IN8A 2HXIA 2NS0A 3KPHA 3OYGA 5HDGA 1ZRDA 2XUBA 5LRSA 4DJAA 2ZSIB 3CQZJ 1X2MA 1FPQA 1QU3A 3DBLB 1QA6A 2DT5A 3FMRA 1YJWI 4F55A 3DKXA 1JKPC 3BY6A 3P9CA 3KP5A 4ZZLA 1ERDA 2P6TA 3C18A 1IF1A 4E7IA 3FDYA 3CCSI 2F5VA 2Q2EB 1V5EA 2A68F 3T8RA 4JQFA 2IPQX 1SANA 2PN6A 4FQGA 1IRGA 2R7FA 4OAYA 4DIQA 4MLOA 2Z5UA 3GYHX 1I3QJ 1DP7P 3J80K 5F27A 3BR5A 2H09A 3BG3A 4XKBA 4UUSA 2XF6A 1WQ2A 1XMKA 4AVZA 1K4TA 3S16J 4IZZA 4BBSJ 1ACIA 3J81Z 2DW4A 2K9MA 2IA0A 2VJ5A 4JP0A 1UHMA 5IT9Z 1D1BA 4B4CA 3EUHC 4L18B 4OINF 5J4YA 4HDVA 2DOAA 3WTZA 3GTQJ 4B48A 2CMPA 3REOA 5LEKA 4Y33A 1MNDA 1DDNA 3DLLF 2QBYA 2PQ8A 2PX9A 3FMQA 2RQQA 2ZFWA 3SDGA 3FXQA 4BJ5C 3IRRA 1AKHB 1LFBA 2D2WA 1ORKA 3QP5A 2RN7A 1X1BA 4R8HA 5E1WA 2YX4A 5EEAA 3HB9A 5JR3A 2X4HA 4NB5A 1Z9CA 3BTLA 4LIVA 1I3AA 1WVRA 1R5HA 1YTYA 5BOXA 4AU7A 1PDNC 1EH6A 2WWYA 4BXXJ 3CP2A 5EZGA 3CCLI 1IV6A 4HG2A 4KN4X 5M3MJ 2EFQA 1R7JA 4OU0A 4E4HA 1N75A 2M34A 2E19A 3CCJI 3CZ6A 2YU3A 1SFOJ 3F21A 3DF8A 2DT7B 4FT8A 2WV0A 5HS7A 4IRGA 2Z1DA 1UELB 1Y1VJ 4RGXA 3T1BA 2AXTC 3MKYB 3MMYB 4NNJA 5EYRA 1ZG5A 3K1MA 3MVPA 4AD9A 1B8IA 2IA2A 5IYDJ 3OL3A 4I6ZA 2VOOA 2X6WA 5D5WB 3MKLA 5EF6A 2HKOA 1WPKA 3RQ4A 2K9NA 4DOZA 2K02A 3RIRA 1Z3YA 1QPIA 2EK5A 1X4PA 1QNTA 4C2TA 1FSEA 1OYIA 5L3BA 1N77A 4XBFA 1S9HA 1YFHA 3OS1A 1RESA 4ITVA 3F22A 2BW3A 1W36D 4UHTA 3IL2A 3F8BA 5E3MA 2R7VA 3KEOA 3RJPA 3SZTA 1EF4A 2UV1A 1P4WA 5D5XB 3ABMH 4XSZF 5C3EJ 2A07F 2XB5A 1WKMA 5FLXK 3FXRA 1Z3XA 4BNCA 3OOUA 1YOVB 1SD6A 2JUCA 4PGHA 1XB4A 2HQ5A 2O8KA 4CYCA 4BE1A 1I6HJ 2Z33A 1VF9A 2JA7J 3H3VK 3K2AA 1FOWA 3TOBA 3U1DA 3VOEA 3ZQHA 1MNMC 4A3DJ 3EYYA 3IC7A 1PYVA 1BOAA 4UB8C 3CMAI 2L7MP 5K7HA 4RAZA 1R4MB 4D0PA 2QM3A 4CYDA 1WI9A 4EJOA 4RB3C 3V7RA 1VNDA 1QBJA 4NDLA 3S3NA 2L01A 3CLOA 3O8HA 3PFYA 3A0HC 1W36C 4BYYA 3TDUC 2ACJA 2QVOA 5F64A 5DCMB 3BG5A 2PMHA 2ZB9A 1VFCA 4HV6A 4A69C 2DJNA 3LA2A 5J1YA 1SAXA 3FHZA 3FHNA 1JUMA 4UVAA 3QYEA 3LSTA 5FRNA 2E2HJ 2FQ3A 4NC7A 1I6XA 2DO7A 2LVSA 2K27A 2MC3A 4LIUA 3OY9A 3PQJA 3CCQI 1PUFB 1IUYA 1TQIA 3QRFF 2E36A 1W5SA 2KRFA 3HSFA 1MDMB 2OQRA 2CQNA 4Y3OA 3M07A 2IT0A 2VUMJ 5DCFA 1ONVA 3V8JA 2AO9A 1X1AA 4KNYA 1Q1VA 1J0RA 5CVUA 2NVYJ 2BY0A 3G3ZA 3OYIA 3WTVC 2HOEA 3HPGA 3PL8A 1GVDA 2P7VB 2A05A 2OJED 2CSOA 4P1WA 1Z67A 3K70C 5FKOA 4FCYA 2Y0MA 3J81K 3BQZA 5HLGA 1MH4A 4EATA 3HUGA 2K7LA 1F9NA 3FBIB 3OMYA 2HVSA 3FKJA 1S3JA 4M72A 2PBIA 3BR2A 3OYNA 4JX5A 1FBQA 3ZMTA 1JGGA 1S6LA 5FLMJ 2B9SA 2DMTA 1VI0A 3NEUA 1T08B 3P9KA 1G3WA 2H6CA 4HA8A 4A5MA 2DA2A 4F92B 1JHFA 2YR2A 3LSGA 4A6EA 3L00A 4BE2A 2QENA 1OPCA 4CCNA 2EA4A 4AUXA 3GCMA 2NOJB 1TWGJ 1BOBA 5KVRA 4MGRA 1X2NA 4RGSA 3OWTA 1GHCA 3CLQA 1ITYA 2QGUA 1DU6A 2L9SA 4BU2A 3IUOA 5E79C 1MSEC 4QWQA 5F08A 2IS4A 4OWRB 4A0YA 1R00A 2X0LA 1R1UA 3DPLC 3VB2A 5FROA 3R61A 2COMA 3LFKA 5FLVA 2A5WA 5EGOA 2X48A 4C3IJ 3N4MA 2XIGA 2MBFA 5J3LA 4G6QA 3LL7A 5GAHJ 5TRDA 4IHWA 3BJ6A 1X4OA 5CQGA 5IT3A 3LQRA 3GFMA 3QU3A 4U87A 3V8LA 4BL0B 2DCEA 3BG6A 3BR0A 2ETHA 1FC3A 1MJAA 2Y48A 3CP8A 4PFPA 5H20A 2XC7A 2NOGA 3LFUA 1MMSA 1LNWA 2F4OB 3I4NJ 3KZIC 2HOSA 3AL0B 1ZR4A 1O3TA 1TBXA 4XLFA 2D1HA 4GO1A 4GFBA 1HA8A 2DA1A 2ESNA 4G9YA 1JTXA 5D8LB 1D0XA 5E3NA 2R93J 1IO2A 3JRIA 2IVMA 1KA8A 4IJAA 4IO9F 3SEQA 3BG7A 1BIBA 4Z6YA 1IAWA 2FNPA 2WV1A 2P81A 1X3ZB 4V2FA 4TV7A 3B6CA 3GO5A 4M73A 2CQXA 3W3CA 4U7BA 3FXKA 2UXXA 1UJ8A 5D5UB 3TP0A 4RM2A 3PSIA 3G1MA 1USSA 1I1SA 4ESFA 1R49A 4GYIA 2Y9ZA 3CUQB 4IXAA 3D5RC 1CF7B 3HOZJ 1G4DA 3DCFA 3O6BB 1YITI 1UZCA 4A3GJ 2DN0A 4IEJA 5TISC 5F0CA 3ERED 3PM1A 4LD5A 5FKNA 3JCUC 1ZHFA 3L2QA 4YFKF 1X1PA 1FTZA 2CW7A 2JSCA 3BR3A 4A2UA 2EFPA 4KN7X 2MH9A 3CO6C 3BJOA 5HLHA 4A3JJ 5E20A 3GTGJ 3BZKA 5GP9A 2R7QA 4HV5A 1G8XA 5CJ9A 4NHJA 3S8PA 1WGXA 1XSDA 2VN2A 2JUGA 5JVGF 2NVXJ 1J09A 2ZNYA 1JE8A 5C4XJ 2JT1A 4DYQA 2OTJI 3U9GA 4LLLA 1HW1A 3BPVA 3H1CA 1HLVA 1ETVA 4KIGA 4H4KC 5CVJA 2GLOA 3BR1A 5EJCA 2LF7A 3WTWC 2X9DA 2ZCWA 4QTRA 3LMMA 3WU2C 4CSWA 2G9WA 2ZJPF 3QPHA 3I59B 1DGWY 1ETQA 2F6CA 3KZZA 2EPFA 4XKWA 3VDXA 1IZ1A 2O3FA 1R9TJ 5E3OA 3BP8A 5GTIC 1LVKA 1XTAA 2OU2A 3WG9A 3IRQA 3SZGA 2XGEA 1FIAA 5CVVA 1T56A 3QU6A 4LMYA 4OAZA 1RKWA 2L02A 3NWTA 2P5KA 4KT6A 4N9HA 2FSWA 4BJ6C 1XG1A 2LF8A 3EPZA 3F8MA 3DWLE 1OLTA 5FD6A 5L3GA 2HZDA 1JKOC 4XKVA 2FXAA 5KCMA 4CYCB 3ZQ7A 1HKSA 5D6EA 2EQRA 1OJLA 4M3EA 4C2UA 2H1LA 3PNVA 2VC0A 5HS9A 3FXMA 1HKTA 4CCMA 3K4CA 1E17A 3LA7A 3CCVI 1ETKA 1T2KA 3FXLA 2E34A 1TWFJ 4IKFA 3CD6I 3S1MJ 3JTGA 1EV7A 2DA6A 2E35A 3KETA 3H0GJ 1H9TA 3D5LA 3BDDA 3CJTB 4CCOA 2LK2A 3I4PA 3I54A 4P9UA 4U0WA 3RKQA 2EB7A 3KCCA 1N78A 1POGA 2DT6A 3CDIA 3KYDB 3G4SI 3HYIA 3DTIA 1ZTRA 2VBYA 1A36A 1OR7A 2QYOA 1DPUA 2XVCA 1TP4A 3WODF 4IHVA 2IA1A 4V2GA 2V4JC 2ZXWH 4A3BJ 2F48A 3QYFA 3HKZA 4Q48A 4OIOF 1T33A 3T0YA 1R6RA 3JSPA 5EG0A 1W5TA 4B1RA 1RUOA 4EJUA 5KAFC 4W1UA 1VQ9I 5F1JA 1UHSA 2R5YB 4AIDA 5K1YA 5BPIA 4A3MJ 1RPWA 1OCPA 1QVTA 1RRJA 4KIFA 3JRCA 2A6EF 1MZBA 5C4JJ 3ABKH 2LFBA 2MSYA 1Y6IA 2HXOA 2W84A 3FX3A 3I3LA 1Z7UA 4LG3A 2I5UA 5FFZA 4XR6A 3GMEA 1WH7A 3Q5FA 3C7JA 3I71A 3CC7I 2E1MC 5HDNA 5HVQC 2LH9A 4WX9A 3HPHA 3K0LA 4BGDA 2BV6A 4L9JA 4RAYA 4BH9A 2R7TA 1VQPI 4I2OA 3I9V2 3CESA 1LEAA 4RAGA 4I09A 4HW0A 3BZCA 4OMZA 3GZNB 2IW5A 3QQAA 4BHPA 3SEZA 2VBWA 3PNTA 3CMYA 1VQMI 4DBRA 4GCVA 2CV2A 3ULQB 1Y8RB 4LLNA 2OAZA 2GXGA 2CG4A 3B73A 4BHBA 2BY2A 4A0XA 4BDYA 2P0WA 5IYBJ 3WU0A 3S15J 2E5ZA 2R4GA 1VQ8I 1HXDA 2W24A 4ZJZA 3HOXJ 3VFZA 3NRVA 3E0JB 2UZKA 3ASOH 2L0KA 3BTIA 3VWBA 3QODA 3K2ZA 2OTLI 1YLFA 4QLCU 3HJEA 2E60A 4IF4A 3JAMK 5LLQA 4FE7A 1UMQA 2CV0A 2HTJA 1LPQA 5J8CA 1Y0UA 1TC3C 2VONA 4ENKA 1IUFA 2BGCA 3FK7A 3O8GA 4RLFA 4BQNA 3LNQA 3CCRI 4BQAA 5J6XA 5E18F 2IRFG 3L1PA 3I58A 1EA3A 2DFHA 5DD4A 2KZGA 2CFOA 1YJNI 4HX4A 4BACA 1S7OA 3KP3A 5IPAA 1Y56A 3I0TA 2HFHA 1QRYA 3OR2C 4N0BA 4C9YA 4J01A 4H0EA 3JREA 3F72A 4LLGF 2FBKA 5CQEA 2MG4A 1HC8A 2QWWA 3QAHA 5F6FA 1WHUA 4B3XA 3N97A 1B9MA 4RM3A 4XLEA 2R7SA 2PI0A 3BTCA 1D1CA 2W00A 2A61A 2JRMA 1P92A 4HQMA 5ERIA 1NK3P 1WJCA 4XN3A 1QHHD 3Q9SA 3LSHA 1WI3A 3OV8A 3L09A 3EUKL 3TOAA 2O9LA 3HKZN 1QZEA 2HU9A 1RR8C 1TT0A 3K4MA 2F2EA 2GAUA 2CWEA 4HF2A 2GWRA 4K2EA 5GTHC 2ZNZA 2DU9A 4XRSA 1VQNI 1DQUA 4D7MA 4UB6C 4RB2C 4XLAA 2QQ8A 2XAUA 1P6RA 1MJ9A 1AHDP 4PGGA 2EILH 2P7CB 2F5CA 3AG4H 2I10A 5D4SA 2L54A 1F1ZA 3O2PE 1AA7A 2XPVA 5M5YJ 1K61A 2M4KA 2V79A 3DBHB 3JRGA 3HIFA 3ROUA 5JI6A 4KICA 2ESHA 4ZYDA 2IGOA 3HOUJ 1NG7A 1MD0A 2H8WA 1BBYA 1R5GA 2ZC2A 2KPMA 3E6CC 1XGOA 3ZQIA 5EDNA 2CQQA 2DTRA 2KJBA 3OIPA 2FBIA 3RTRA 3L2CA 1IGNA 4JOMA 2R7ZJ 1MBFA 4EM0B 1FWZA 4FHTA 1Z0XA 4BJTA 2VKHA 4RBOA 4NUBA 4M6XA 2CW0F 1R71A 4HLYA 1TTYA 1FYLA 2M87A 4YIFA 3S93A 1XPXA 2BE5F 3H9QA 1YRNA 2FEZA 2H1KA 2VQLA 4XRMA 1X19A 3OYAA 2LYCA 4XNFA 1RZ4A 2L9VA 3ABLH 3GUDA 3GZ5A 4IQ4A 1OCCH 4RAFA 1PUFA 1R23A 4I0BA 3V7SA 2HPMA 2JA5J 2ICWG 4XM3A 2E2IJ 2K3FA 2KISA 1ULYA 2WB1N 3M1EA 1D0YA 1O57A 5EEHA 5TJJA 2BYVE 3FM5A 3S1QJ 3TO7A 2R0QC 3RSNA 5M5WJ 3G71I 3IH4A 2O7OA 5CKTA 4CH7A 3JSOA 1BL0A 2X51A 1KU9A 4EV0A 1I39A 2EZIA 4RGRA 2JA2A 4PK4A 1VQ6I 4EJVA 5DEQA 2OC6A 1SMTA 2KIQA 2E1OA 3DTKA 1A31A 4LB5A 1U5TC 3Q9VA 4L0ZB 2Q1ZB 1KONA 3HHGA 3F23A 3HZJA 4LGWA 3L7WA 3GWZA 2IEKA 3DPTA 1O7FA 4JX6A 1CF7A 1J7KA 2YX7A 1FY7A 3SHFA 2FBHA 4DW6A 4KISA 4EQQA 1YHQI 2V1UA 4YFNF 2VPRA 2HVRA 3K4JA 3J7AO 3S17J 2EIMH 2VIXA 3CJNA 3P9IA 4XOPA 2WC2A 1U8BA 1KZHA 4M9XA 2LKXA 1QPMA 4DYRA 1WFXA 4HNVA 1LUJB 3HTUA 5DDGA 4PJNA 3VSLA 2DK5A 1OCZH 1AOYA 1Z21A 4U88A 3ZN1A 1OCRH 4PSXA 3C2HA 1XS9A 2HDCA 2GBYA 2VKVA 1LVAA 1DU0A 4ENNA 3OSGA 5H2FC 2VL8A 3ZN0A 5L3FA 1RUNA 4KMFA 1D8JA 1P9QC 3RPUA 5KNLA 2QCOA 3HG9A 5BNGA 3AAFA 2JTVA 3RPQA 2P5LC 4E70A 3K9TA 5L3EA 2R92J 3W2AA 3OSFA 2UUZA 2Y0SA 2STTA 2ME0A 5KAIC 3KX2A 4U0YA 1KU2A 2WY8Q 4IX7A 4ENJA 2IBDA 4IL6C 2KMUA 3R0AA 1OR7C 1FMVA 1WJAA 4ZYHA 4EGYA 5E3LA 3Q0UA 1GDTA 1BR2A 1UHWA 4XLCA 4G6TB 4IOAF 4BS9A 5LEJA 4UV8A 3ZP5A 1MKMA 3TMOA 3S14J 2EV0A 2R5ZA 3GTPJ 4S0HB 5JVTA 2FF4A 2ZJQF 2BVMA 4E7LA 1D3YA 4MEXF 5FGMA 1PP7U 4L9TA 5DD8A 4BXFA 2FNAA 3GW2A 3M1CA 3S2DJ 3RKWA 3QPSA 3UNGC 1TL8A 2LKPA 1A6QA 3C2GA 1YRNB 4C3HJ 3DU6A 3KP4A 2M4GA 2TRTA 1ON1A 4HQEA 1J9IA 2E1NA 1NTCA 1PJRA 2LRDA 1ZLKA 2L7FP 1PP8F 5EG0B 1VQKI 3I5UA 3HRTA 3H0DA 3RYRA 2VQCA 1YW7A 3SJMA 2DMNA 5E8IA 2GM4A 3IAM2 1HSTA 3ZMZA 3OYLA 4UUSB 1BIAA 2ZXJA 3HGYA 2QBYB 2OPTA 4AC0A 1A5JA 2GOXB 3S3OA 5IOZA 1SMYF 2FA5A 2JJ7A 4BQQA 3C3WA 3G2BA 3I4MJ 4Z2YA 2VXDA 4XLPF 4LFUA 1OYWA 5CLSA 2DAOA 5C44J 1YO5C 5TGTA 2DMUA 4HSRA 2F5DA 4FTHA 1HQCA 2B63J 4N4NB 1IRZA 2KIFA 4XONA 1CQTA 4IOCF 2A6HF 4RS8A 3JW4A 1FP1D 5CVIA 1YG2A 3E97A 2VE8A 5AIPA 3JAMZ 2JVGA 2WAEA 4CHUA 2XPWA 3WG7H 2CS3A 1S72I 2JWTA 2C6YA 5AIQA 4MO7A 4XN0A 5LGTA 2ISYA 4XIDA 1FYMA 3M8JA 5FB2A 3AG1H 2Y9YA 3FM3A 1APLC 3WE3A 1REPC 4AYBN 2P5VA 4JK1X 2BVLA 2PJRB 5HOOA 3ONQA 3RYPA 1Z05A 3GFIA 1HW5A 4M3DA 5E1ZB 3E6MA 3TP3A 2PMZA 2DOFA 3DBRB 3BROA 3MFKA 1O4XA 5B5EC 1B72A 4A3LJ 1PVEA 1FOYA 4X1EA 1VQ7I 3GTKJ 2XROA 4I98B 4CCLA 1H8AC 3KP2A 3LAJA 2WAQN 3P7NA 4HSTA 1TW2A 4R1HA 1FT9A 1I1GA 3L2VA 4MHGA 2XV4S 2O0YA 2M0CA 1Z77A 4Q5SF 1RETA 3OL4A 1UCRA 1BI2A 2DQRA 2MLGA 2Y75A 1SC7A 4BDZA 2QA4I 3H3UA 3MEXA 3L2RA 1SVLA 3M3YJ 2R3SA 3BQYA 3WTSC 3H35A 5ICCA 3H9JA 3LSMA 1Y1WJ 1MBEA 5K5RA 1T39A 1K83J 2DFFA 4WK8F 3CMMA 1F5TA 5IOYA 3AFHA 4HYEA 3VYUB 2HEOA 5A2QK 1BJZA 1BR4A 3PO2J 2MA3A 1Z6TA 3K7AJ 4PFOA 3KE2A 1IDZA 1T0FA 3TEDA 3BC8A 5IT9K 5E1XA 2W25A 3JTHA 1SFKA 2XGCA 3SDBA 3VYRB 1TNSA 1W7PA 2MD0A 2X6YA 2MFZA 2RKHA 4G12A 1RR7A 3PNYA 2W82A 2DI3A 4EJWA 3TQNA 2R7XA 2X85A 4X6AJ 2EFWA 2F4MB 3F8CA 5FJ8J 2A5YB 1W0TA 3DLAA 1IRFA 2WAFA 1UG2A 5ED4A 4IHTA 1XC5A 5E17F 2NNYA 1STZA 2WAQA 1YYVA 4S04A 2BZTA 5FFXA 2DPUA 2CFXA 1IRXA 3R6SA 3GF2A 2O03A 5KK1A 4ZDOA 3OYKA 1ETOA 4RB1A 1ZARA 4UV9A 4WWCA 2R5YA 3QYBA 4PDKA 3BLYA 2MABA 3ZQLA 2VJJA 1YI2I 3S1RJ 2OCCH 1B9NA 1YS6A 2GOMA 4NC8A 3WGIA 2VE9A 1J59A 1FLIA 4Q4ZF 3RCOA 2DYRH 3ZMDA 2M3AA 3CJRB 5EGOB 4ZC3A 2NXNB 1MJBA 1BC7C 3F3XA 2Z2SB 2XGXA 3GBGA 2VJ4A 1JT6A 4BEHA 3ZQCA 1ZR2A 3KZYA 2VKDA 3X2QH 3AG3H 3DV8A 1QZZA 4CGZA 4HBLA 3FMSA 1BI0A 2Z3YA 2ELJA 3CDLA 3K10A 4W97A 3N05A 4MQVA 2PMZN 1FP2A 3FIWA 3WTYC 4AIKA 4EM1A 3TW7A 4AIJA 2RGVA 2LDUA 1Z1DA 2GZWA 4L5IA 3BPXA 3MN2A 5B1AH 4NQWB 1SVOA 3RI4A 2EZHA 3ML6A 1TQPA 1ZQ3P 1R58A 3EETA 2AQFA 3E5XA 5BQTA 5CPRB 3J80Z 2MYSA 3MKWB 3K4BA 4B44A 4B43A 5FLXZ 1MBKA 4ESJA 2G7HA 4MTDA 2A6TA 2KDZA 2KZVA 4OIQF 1F36A 2TCTA 4DZPA 4IQJA 3SYTA 3NWSA 1IXCA 3MQ0A 3CTAA 3B02A 4KITB 2ZJRF 5LD2C 2X1EA 5BPDA 1U9NA 1GLNA 3DFGA 4PJ0C 1YX3A 2R5ZB 3MCZA 1XD7A 2HYFA 3P5JA 4D9JA 4IPAA 3VEPA 4PUSA 3ZOBA 4YELA 3ABTA 2LOOA 1GV2A 1EKEA 1Z7LA 3M8FA 5FD5A 3Q0VA 5K5QA 3HOSA 3BZ6A 1YQAA 2ECBA 1A6IA 4KDPA 2V6EA 3AG2H 3R60A 1X3WB 1GXPA 1UB9A 1LKXA 2EIJH 4B09A 3GTLJ 3M9AA 3LQQA 1DGRM 4U0VA 4Y7NJ 1K6OA 4XLNF 4HDUA 1W1WE 4KYWA 1L3LA 2ZFUA 2ZMEC 3TKYA 1TWAJ 2KL4A 2M7AA 1A35A 2X6XA 3ZXSA 4QIWN 4E7KA 2EFNA 4HRIA 2DYSH 3WTTC 1X58A 3KP6A 3I64A 4GYGA 2BHYA 3J7AY 4M3BA 3F9KA 4L5EA 3L2UA 2DDAA 2Q2EA 3IP4B 4P96A 2VBXA 4MEYF 2QSFX 2L7ZA 4UNOA 1U6GA 4GGGA 1BM9A 5FKLA 3H9GA 2FOKA 1S7AA 2AHQA 2WTEA 1XSXA 4E7JA 2MC4A 4O6JA 4GXOA 4CZZA 4XKCA 4HAMA 3SZPA 3S2WA 4BHCA 4IHYA 1MMGA 2CGPA 2MW8A 3HOTA 5J8FA 1AWCA 2V7FA 1SEUA 3M4OJ 5JHFA 1Y8QB 2F5FA 3Q3SA 2XGDA 2BOLA 3OS2A 1GUUA 4ZTJA 1MBGA 2DA7A 2HQNA 2JZYA 3RKXA 1G3TA 1XSVA 3LWFA 4OIRF 5L3CA 3CCYA 2KHMA 4Y15A 3I53A 3GFJA 4MTEA 1K78A 1HSJA 1IXRC 2RDPA 2HOAA 2QQ9A 1QZYA 1XCBA 2IJLA 3JRFA 3LSIA 1ZREA 2EV6A 2STWA 3H5RA 2L3DA 3CCEI 2NRAC 1ZELA 2A3SA 3B6AA 3ERMA 3G73A 3GXOA 2HI3A 1RC9A 2K86A 2Z16A 3GLLA 4XICA 4ZYGA 2XKOA 2KIUA 5ILVA 2LLKA 4J19A 4ZDPA 2CH0A 1J75A 1ZRCA 2HVQA 4ZDLA 1T0FC 2GIZA 4JX4A 3CDHA 2ECCA 4D5FA 4LOCA 3K4LA 1O3SA 4XRSG 5HDKA 3I55I 5HNFA 2HQRA 1OKRA 3H5NA 5ICEA 3DU5A 4A3CJ 4HZFA 1BJAA 1OISA 2IGKA 1MIJA 3DEWA 1OFCX 2HPIA 4IRHA 2M8EA 4WXCA 3GTOJ 2JSPA 4MFEA 3PO3J 2KKOA 2M0MA 1MMAA 5CVRA 2IGMA 2Y30A 3T8TA 3HRUA 1MMNA 4A5NA 3A2KA 1SAUA 2JQ7A 4M9ZA 4RDUA 3GZ6A 1LEBA 4CUGA 1XGSA 2PFBA 3BJAA 4NC6A 1EH7A 3S3MA 2GIVA 2QQBA 4LG0A 4CZCA 2H6BA 2V1DA 2OD5A 2Y0SN 3UKGA 1RKTA 5M5XJ 5H6RA 4IHSA 2MLKA 4NQWA 3LOCA 4YIIA 1X1CA 2FOWA 3V4GA 5IP7J 5GAEJ 1KQ0A 4A3IJ 4A3EJ 1XCVA 1QVUA 3W6VA 2M7BA 3BCAA 1BI3A 2F5EA 2HYGD 2QLZA 1I50J 3H92A 2R7DA 2DOEA 4G7HF 2RV8A 2LR8A 3LA3A 2XAQA 4Q47A 1QQIA 3IAS2 1FX7A 3OR1C 2WBMA 1F4KA 2VC1A 2WY7Q 2K9LA 1W7PD 2PLYA 1B72B 1KU3A 4NBQA 4WF2A 4ZYAA 2YPRA 1JTYA 1Z91A 2OBPA 4UXNA 3HEFA 1KQ9A 5LHIA 1NG6A 5EZHA 3BTJA 2K4BA 3ZRGA 2YS9A 3PIPF 1MSFC 3HHHA 5K7FA 3HC7A 4CCKA 2CQ7A 1U3EM 9ANTA 1W4MA 2LMDA 2EA2A 2OZ6A 3JRAA 1B1BA 3E5UA 3G1OA 1TW3A 3D5SC 1C0WA 2X6OA 2DXIA 1U0JA 4HF1A 1BR1A 2XAFA 4EEFG 2IS2A 3WTUC 2XF5A 4A0ZA 1S7EA 4M71A 4CXFA 1S5LC 1JGSA 2G0EA 5F04A 3PUBA 1LDDA 3DEEA 4YIRX 2NYXA 3U1KA 1VQLI 2DTZA 2N8GA 2HGCA 2VODA 2F4IA 2HDDA 1OCOH 2ZKZA 1GT0C 4E7HA 4GDFA 5J40A 3MAJA 1E3PA 2B7EA 2HZTA 3CUQC 1KGSA 5HLTA 1J5YA 2NVUB 2V6CA 4XSXF 3DP7A 3TGNA 4AWXB 2CV1A 4DBQA 2D5VA 1WH5A 1EH8A 5H6QA 2XRNA 3OIOA 3HL2A 1WJEA 3UR3C 3J7YJ 3KP7A 3DEUA 2EWNA 3K69A 1D0ZA 2CUEA 2HNHA 2M1BA 2V9KA 4IHXA 1RNLA 2IAIA 2O8XA 1H88C 2AS5F 2CJJA 2R7OA 3S1NJ 4BAYA 1JKQC 2FD5A 1R5ID 5F1RA 2O5RA 1MW7A 1B8IB 3OYJA 1ZRFA 4RA2A 3W2WA 1WJBA 3KEQA 4CA0A 3MWMA 3HSEA 2PJPA 3KFWX 4LITA 5DUKA 4EGZA 3JRBA 3OOPA 2QEXI 2L7KA 1MBHA 2LKSA 2M2EA 3FXUA 3GTMJ 5DUIA 4R79A 1MH3A 4EM2A 4ETSA 1XDUA 4EVIA 1VQ4I 2E2JJ 5HS8A 3WU1B 2CU7A 1YIOA 3O3KA 2VB6A 4XQFA 2GQQA 4A3FJ 2LBFB 2XPUA 2R7UA 1SFXA 1GVJA 1ZGAA 3ZQQA 4D1QA 3WTXC 2YSRA 1TNTA 5D6FA 2MGQA 5A2QZ 5LHHA 3A01B 5DTDA 2EINH 2CYYA 3VYSB 1K78B 3HOYJ 1YJ9I 2O6GE 1BI1A 2G7UA 1SD7A 1BW6A 1S29A 4G94A 2JK3A 1Z6RA 4OIPF 3ZMVA 4QPOA 3H3ZA 3OYEA 4PSWA 3KIOA 4FX0A 1R22A 2E1CA 1TT5B 3W6JB 1JI8A 1O3RA 4F7ZA 4BEHB 3K4NA 3RKYA 3FF5A 4M3GA 2WA0A 1BN5A 4M9SA 4N9IA 4AM3A 3ESWB 4G7ZF 4MFDA 1E0EA 3F6VA 1PUEE 2KRCA 3VPRA 5GAGJ 6PAXA
chains in the Genus database with same CATH topology
2W57A 4RGUA 3ELKA 4WXDA 1U2WA 2Z99A 3GFLA 3ECOA 1FBUA 2ZMEB 2V9VA 1V3FA 2KJCA 2RC4A 3ZMUA 3CO7C 5DCMA 4KA4A 3DXJF 3QOPA 1WRJA 1H9GA 3EYIA 4HLXA 4I7HA 4KMUX 1Q1HA 3CUOA 3CUQA 4S05A 2LSOA 3I59A 4DQ2A 2FU4A 2RVCA 1IN5A 4ON0A 1FBSA 4YFXF 2HKXA 4FX4A 1ZG3A 2VT2A 1SD5A 4IRIA 2V1XA 1V4RA 2VBZA 1X3UA 4LK1F 4Y13A 5LGNA 3SFZA 3QP6A 2CQKA 2XAGA 5JFRA 4P5OA 1NHAA 4M6YA 5L3DA 3ZMSA 1YW9A 1HBXG 1U5TB 3E5QA 2DFIA 3IWZA 1SFEA 3DQVC 1SD4A 2DQLA 2HR3A 4ZH4F 3MZHA 3E6BA 4G8XA 4LK0F 2VXZA 3HRSA 2P4WA 3RDIA 4AVPA 1IN7A 1I27A 2JPBA 3TDZC 4HF0A 3LAPA 4L9VA 2D1VA 3TO9A 1UFMA 2D45A 1ZLJA 2O61A 5D4RA 1R1TA 2M5WA 5LBQA 1O7LA 2J5PA 1YW8A 4LG0B 4LB6B 1RIOH 4EJTA 1VTNC 2ADUA 2OZUA 1E2XA 4IVNA 1LDJA 1KYZA 1U8RA 4P55A 4G6DA 2XHKA 1O3QA 4MNUA 2JRTA 3KLNA 3COAC 1ZN2A 4OOIA 4PZJA 2OA4A 4U7DA 1L0OC 4M74A 3SQNA 1A04A 2NAZA 2PEXA 2XASA 3GLXA 1B4AA 4AIHA 4RB0A 4ZYEA 2GXBA 3C1DA 3M7GA 4ZZDA 1KYWA 5D8KB 5ILSA 1QGPA 2E7XA 1D8KA 4KUMA 1ZAOA 2RQPA 1XGMA 3K1PA 1SFUA 1IN6A 5BMZA 1P2FA 1P4XA 1P4AA 2FRHA 4O3MA 2H94A 3IWFA 2CO5A 1R36A 2M30A 1U78A 2P6SA 3D0SA 1XGNA 4P9FA 2DPDA 1IN4A 4HX8A 1ODDA 3V8KA 1HW2A 2HS5A 2ELHA 4BXUA 5LGUA 2Q8KA 4WCGA 2JPCA 1G6NA 3L9FA 1FOKA 2XAHA 3ABUA 4KIBA 2XAJA 2ZO4A 3IHUA 1FNNA 4CDGA 2FE3A 4L0YB 3EUHA 2P8TA 1WSUA 1USTA 1XN7A 1OMIA 5D5VB 2HTSA 5LRRA 4HOBA 1JXSA 4A6DA 1FSHA 4A12A 4I02A 5FO5A 1G3SA 2ZMEA 1ON2A 2QUFA 1R1VA 3QPTA 4XRFA 4CICA 3K1NA 5CYVA 4I01A 5DV5A 5ICGA 2AXLA 2GA2A 4EMSA 2GA1A 1KQ8A 1XMAA 3EQLF 3DKWA 1WWXA 2DK8A 2M45A 1ZG1A 3NQOA 2UXNA 1LB2A 5HLIA 1TQMA 2FMLA 3R4KA 4KFCA 2PG4A 2H27A 2J5OA 3T5XA 2VT3A 3R0JA 1DPRA 4O5VA 3HSRA 1KU7A 2EJRA 5ILUA 1S8NA 2E7WA 2A69F 4OMYA 3WGGA 4UVCA 3ECHA 3U2RA 3SXYA 2DLLA 3EDPA 1HKQA 2ISZA 3GX4X 1RI7A 2EV5A 5LHGA 4UUVA 2KIMA 2L4MA 3IKTA 2W85A 3F8NA 2RNJA 2BEOA 1LDKB 3KLOA 4MQ9F 5DYMA 1G3YA 2EFOA 3ZPLA 3WE2A 4JBAA 3ISPA 1BC8C 1JHHA 2ZJ2A 3GEZA 4LJZF 3BWGA 1T38A 2HWVA 3BOQA 1IXSB 2K4JA 3E3VA 3PQKA 5AONA 2OQGA 1YS7A 3F8FA 1MDMA 4G7OF 4UVBA 4Y17A 3MZYA 2UWMA 1K7AA 5JHUA 2PMUA 4B8XA 3FWEA 2B0LA 2LNBA 1LJ9A 3WGHA 1XDSA 2L4AA 3E6DA 1B59A 1DUXC 3GVAA 4I0AA 2QQAA 1IW7F 2Q0OA 4L9NA 4CO8A 4YG2F 4WXHA 1T6SA 3VODA 3HRMA 1MGTA 3W6KB 1W7PB 1FYKA 1OYYA 2Z9OA 5E8GA 1QO0D 5ICFA 1I5ZA 1LQ1A 2BBYA 5EEGA 4DNCA 1CGPA 3M8EA 2TDXA 2DBBA 4ESBA 4PCQA 3HTSB 3V7CA 4ENMA 1ZH5A 1ZGJA 1H0MA 2XKPA 1B6AA 5K5OA 1J2XA 1TLHB 3PFIA 3F6OA 1GXQA 2ZBKA 1K79A 2NNNA 1U5TA 4ASNA 2MH2A 2IP2A 2QZ8A 5BS6A 3TO6A 4L5JA 1ZYRF 1T98A 4KT5C 2FMYA 3FZVA 2VOPA 4HX7A 2MD5A 1D5VA 3IKVA 1FZPB 1IN8A 2NS0A 5HDGA 1ZRDA 2XUBA 5LRSA 1FPQA 2DT5A 3FMRA 3BY6A 3P9CA 3KP5A 4ZZLA 2P6TA 3C18A 1IF1A 2A68F 3T8RA 4JQFA 2IPQX 2PN6A 1IRGA 2R7FA 2Z5UA 3GYHX 1DP7P 3J80K 2H09A 1WQ2A 1XMKA 3J81Z 2DW4A 2IA0A 1UHMA 5IT9Z 4L18B 4OINF 4HDVA 3WTZA 3REOA 5LEKA 1DDNA 2QBYA 2PQ8A 3FMQA 2ZFWA 3FXQA 3IRRA 2D2WA 3QP5A 2RN7A 4R8HA 5E1WA 2YX4A 5JR3A 2X4HA 4NB5A 1Z9CA 1R5HA 1YTYA 5BOXA 1PDNC 1EH6A 2WWYA 4KN4X 2EFQA 1R7JA 4OU0A 2YU3A 3F21A 3DF8A 4FT8A 2WV0A 5HS7A 4IRGA 4RGXA 3T1BA 1ZG5A 3K1MA 4AD9A 2IA2A 2VOOA 5D5WB 2HKOA 2K02A 3RIRA 2EK5A 1QNTA 1FSEA 1OYIA 5L3BA 4XBFA 1YFHA 3F22A 4UHTA 3IL2A 3F8BA 3KEOA 3RJPA 3SZTA 1P4WA 5D5XB 4XSZF 2A07F 5FLXK 1WKMA 3FXRA 4BNCA 1SD6A 4PGHA 1XB4A 2Z33A 3TOBA 3U1DA 3VOEA 3EYYA 3IC7A 1BOAA 4RAZA 4D0PA 2QM3A 4CYDA 1WI9A 4EJOA 4RB3C 3V7RA 1QBJA 2L01A 3CLOA 4BYYA 3TDUC 2ACJA 2QVOA 5F64A 5DCMB 2PMHA 4HV6A 3LA2A 1SAXA 3FHZA 4UVAA 3LSTA 2FQ3A 1I6XA 2DO7A 2K27A 2MC3A 3PQJA 1IUYA 1TQIA 3QRFF 1W5SA 2KRFA 3HSFA 1MDMB 2OQRA 2IT0A 5DCFA 1ONVA 3V8JA 4KNYA 1J0RA 5CVUA 3G3ZA 3WTVC 2HOEA 2P7VB 2CSOA 2Y0MA 3J81K 5HLGA 3HUGA 2K7LA 1F9NA 4M72A 1S3JA 2PBIA 1FBQA 3ZMTA 1S6LA 3NEUA 3P9KA 1G3WA 2H6CA 4HA8A 4A5MA 1JHFA 2YR2A 4A6EA 3L00A 2QENA 1OPCA 2EA4A 5KVRA 4MGRA 4RGSA 1GHCA 4QWQA 4A0YA 1R00A 2X0LA 1R1UA 3DPLC 3VB2A 3R61A 2COMA 3LFKA 3N4MA 2XIGA 2MBFA 4G6QA 5TRDA 3BJ6A 5IT3A 3LQRA 3GFMA 3QU3A 3V8LA 2ETHA 1MJAA 1FC3A 2Y48A 5H20A 1LNWA 1O3TA 1TBXA 2D1HA 4GO1A 4G9YA 2ESNA 5D8LB 2IVMA 1KA8A 4IJAA 1BIBA 1IAWA 2FNPA 4TV7A 3GO5A 4M73A 4U7BA 2UXXA 5D5UB 1I1SA 1USSA 4ESFA 4GYIA 3CUQB 4IXAA 1CF7B 1G4DA 3O6BB 3ERED 4LD5A 1ZHFA 4YFKF 2JSCA 4A2UA 2EFPA 4KN7X 2MH9A 3CO6C 3BJOA 5HLHA 5E20A 4HV5A 5CJ9A 4NHJA 1XSDA 2VN2A 2ZNYA 1JE8A 2JT1A 3U9GA 4LLLA 1HW1A 3BPVA 4KIGA 5CVJA 2LF7A 3WTWC 2ZCWA 2G9WA 3QPHA 3I59B 3KZZA 1IZ1A 2O3FA 3BP8A 2OU2A 3WG9A 3IRQA 5CVVA 4LMYA 3QU6A 2L02A 2P5KA 4N9HA 2FSWA 2LF8A 3F8MA 5FD6A 5L3GA 2FXAA 3ZQ7A 1HKSA 5D6EA 1HKTA 2VC0A 5HS9A 1E17A 3LA7A 1T2KA 3JTGA 1EV7A 3KETA 1H9TA 3D5LA 3BDDA 3I4PA 3I54A 4P9UA 4U0WA 2EB7A 3KCCA 3HYIA 2VBYA 1OR7A 2QYOA 1DPUA 2XVCA 3WODF 2IA1A 4Q48A 4OIOF 3T0YA 3JSPA 1W5TA 1RUOA 4EJUA 5BPIA 5K1YA 4KIFA 2A6EF 1MZBA 2W84A 3FX3A 1Z7UA 5FFZA 3Q5FA 3C7JA 3I71A 4WX9A 5HDNA 5HVQC 3K0LA 2BV6A 4L9JA 4RAYA 4BH9A 4I2OA 1LEAA 4I09A 4HW0A 4OMZA 2IW5A 4BHPA 2VBWA 4GCVA 3ULQB 4LLNA 2OAZA 2GXGA 2CG4A 3B73A 4BHBA 4A0XA 3WU0A 1HXDA 2W24A 3VFZA 3NRVA 2UZKA 3K2ZA 1YLFA 4QLCU 4IF4A 3JAMK 5LLQA 2HTJA 5J8CA 1Y0UA 2VONA 4ENKA 2BGCA 4BQAA 5J6XA 5E18F 2IRFG 3I58A 5DD4A 4HX4A 1S7OA 3KP3A 3I0TA 2HFHA 4N0BA 4H0EA 3F72A 4LLGF 2FBKA 2QWWA 3QAHA 5F6FA 3N97A 1B9MA 2PI0A 2A61A 1P92A 4HQMA 5ERIA 3Q9SA 3OV8A 3L09A 3TOAA 2F2EA 2GAUA 2CWEA 4HF2A 2GWRA 4K2EA 2ZNZA 2DU9A 4RB2C 1P6RA 1MJ9A 4PGGA 2P7CB 2F5CA 5D4SA 2L54A 1F1ZA 3O2PE 2V79A 3HIFA 3ROUA 5JI6A 4KICA 2ESHA 4ZYDA 1MD0A 1BBYA 1R5GA 3E6CC 1XGOA 2DTRA 2KJBA 3RTRA 2FBIA 3L2CA 4EM0B 1FWZA 4FHTA 4M6XA 2CW0F 4HLYA 1TTYA 1FYLA 2M87A 4YIFA 2BE5F 2FEZA 1RZ4A 3GUDA 3GZ5A 1R23A 4I0BA 3V7SA 1ULYA 3M1EA 5TJJA 1O57A 5EEHA 2BYVE 3FM5A 3TO7A 3JSOA 1KU9A 4EV0A 4RGRA 4EJVA 5DEQA 1SMTA 4LB5A 1U5TC 3Q9VA 4L0ZB 3HHGA 3F23A 4LGWA 3L7WA 3GWZA 3DPTA 1O7FA 1CF7A 1J7KA 1FY7A 2YX7A 3SHFA 2FBHA 4EQQA 2V1UA 4YFNF 3J7AO 3CJNA 3P9IA 2WC2A 4M9XA 1QPMA 3HTUA 5DDGA 2DK5A 1AOYA 4U88A 3ZN1A 2HDCA 1LVAA 4ENNA 3ZN0A 1RUNA 5L3FA 4KMFA 1D8JA 3RPUA 3AAFA 2JTVA 3RPQA 2P5LC 4E70A 3K9TA 5L3EA 2STTA 4U0YA 1KU2A 4ENJA 3R0AA 4ZYHA 4EGYA 1UHWA 5LEJA 4UV8A 3ZP5A 1MKMA 2EV0A 5JVTA 2FF4A 1D3YA 4MEXF 5FGMA 1PP7U 4L9TA 5DD8A 2FNAA 3GW2A 3RKWA 2LKPA 3KP4A 1ON1A 1J9IA 4HQEA 2E1NA 1ZLKA 1PP8F 3I5UA 3HRTA 3RYRA 1YW7A 5E8IA 1HSTA 3ZMZA 1BIAA 2ZXJA 2QBYB 1SMYF 2FA5A 3C3WA 4Z2YA 4XLPF 4LFUA 1OYWA 5CLSA 2DAOA 1YO5C 2F5DA 1HQCA 2KIFA 2A6HF 4RS8A 3JW4A 1FP1D 5CVIA 1YG2A 3E97A 2VE8A 5AIPA 3JAMZ 4CHUA 2C6YA 5AIQA 5LGTA 2ISYA 1FYMA 5FB2A 3FM3A 1REPC 3WE3A 2P5VA 4JK1X 5HOOA 3RYPA 1Z05A 3GFIA 1HW5A 5E1ZB 3E6MA 3BROA 3MFKA 2XROA 4I98B 3KP2A 3LAJA 3P7NA 1TW2A 4R1HA 1FT9A 1I1GA 4MHGA 2XV4S 2O0YA 4Q5SF 1UCRA 1BI2A 2DQRA 2MLGA 2Y75A 3H3UA 3MEXA 2R3SA 3WTSC 5ICCA 5K5RA 1T39A 4WK8F 1F5TA 4HYEA 2HEOA 5A2QK 2MA3A 1Z6TA 3KE2A 1T0FA 5IT9K 5E1XA 2W25A 3JTHA 1TNSA 1W7PA 2RKHA 2DI3A 4EJWA 3TQNA 2EFWA 3F8CA 2A5YB 1IRFA 5ED4A 4IHTA 5E17F 2NNYA 1STZA 1YYVA 4S04A 5FFXA 2DPUA 2CFXA 3R6SA 3GF2A 2O03A 5KK1A 4RB1A 1ZARA 4UV9A 4WWCA 4PDKA 1J59A 2VE9A 1B9NA 1YS6A 3WGIA 1FLIA 4Q4ZF 3ZMDA 1MJBA 1BC7C 3F3XA 2XGXA 3KZYA 3DV8A 1QZZA 4CGZA 4HBLA 1BI0A 2Z3YA 3FMSA 4MQVA 1FP2A 3WTYC 4AIKA 4EM1A 4AIJA 2RGVA 2LDUA 1Z1DA 2GZWA 4L5IA 3BPXA 3RI4A 3ML6A 1TQPA 1R58A 3EETA 3E5XA 5BQTA 3J80Z 5FLXZ 4ESJA 2G7HA 4MTDA 4OIQF 1IXCA 3MQ0A 3CTAA 3B02A 5BPDA 3DFGA 3MCZA 1XD7A 2HYFA 4IPAA 3VEPA 3ABTA 3M8FA 5FD5A 5K5QA 3HOSA 3BZ6A 1YQAA 4KDPA 3R60A 1GXPA 1UB9A 4B09A 3M9AA 3LQQA 4U0VA 1K6OA 4XLNF 4HDUA 4KYWA 1L3LA 3TKYA 2EFNA 3WTTC 3KP6A 3I64A 4GYGA 2Q2EA 4P96A 2VBXA 4MEYF 4UNOA 1U6GA 4GGGA 1BM9A 2FOKA 1S7AA 2WTEA 1XSXA 4O6JA 4GXOA 4CZZA 4HAMA 3SZPA 3S2WA 4BHCA 2CGPA 3HOTA 5J8FA 1AWCA 2F5FA 2HQNA 2JZYA 3RKXA 1G3TA 1XSVA 3LWFA 4OIRF 5L3CA 4Y15A 3I53A 3GFJA 4MTEA 1K78A 1HSJA 1IXRC 2RDPA 2QQ9A 1QZYA 1XCBA 2IJLA 1ZREA 2EV6A 2STWA 2L3DA 2NRAC 2A3SA 3G73A 3GXOA 2K86A 4ZYGA 2XKOA 2KIUA 5ILVA 1J75A 1ZRCA 3CDHA 1O3SA 5HDKA 2HQRA 1OKRA 5ICEA 4HZFA 1BJAA 4IRHA 2M8EA 4WXCA 2KKOA 5CVRA 3T8TA 3HRUA 4A5NA 4M9ZA 3GZ6A 1LEBA 1XGSA 2PFBA 3BJAA 1EH7A 2GIVA 2QQBA 4LG0A 2H6BA 2V1DA 2OD5A 5H6RA 4IHSA 2MLKA 4NQWA 4YIIA 3V4GA 1KQ0A 1XCVA 1BI3A 2F5EA 2HYGD 2QLZA 3H92A 2R7DA 4G7HF 2RV8A 3LA3A 2XAQA 4Q47A 1QQIA 1FX7A 1F4KA 2VC1A 1W7PD 2PLYA 1KU3A 4WF2A 2YPRA 1Z91A 2OBPA 4UXNA 1KQ9A 5LHIA 2K4BA 3HHHA 1U3EM 1W4MA 2EA2A 2OZ6A 1B1BA 3E5UA 1TW3A 1C0WA 4HF1A 2XAFA 3WTUC 4A0ZA 4M71A 4CXFA 1JGSA 1LDDA 2VODA 2NYXA 2HGCA 2ZKZA 3MAJA 3CUQC 2HZTA 1KGSA 1J5YA 2V6CA 4XSXF 3DP7A 3TGNA 4AWXB 1EH8A 5H6QA 2XRNA 3KP7A 3DEUA 2EWNA 3K69A 2M1BA 1RNLA 2O8XA 2AS5F 4BAYA 5F1RA 1ZRFA 3KEQA 3MWMA 3HSEA 2PJPA 3KFWX 5DUKA 4EGZA 3OOPA 3FXUA 5DUIA 4R79A 4EM2A 4ETSA 1XDUA 4EVIA 5HS8A 3WU1B 1YIOA 3O3KA 2GQQA 1SFXA 1GVJA 1ZGAA 3WTXC 2YSRA 1TNTA 5D6FA 5A2QZ 5LHHA 1K78B 2CYYA 2O6GE 1BI1A 2G7UA 1SD7A 1S29A 4G94A 1Z6RA 4OIPF 3ZMVA 3H3ZA 4FX0A 1R22A 2E1CA 3W6JB 1O3RA 4F7ZA 3RKYA 3FF5A 1BN5A 4M9SA 4N9IA 4G7ZF 3F6VA 1PUEE 6PAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W57 A;  4RGU A;  3ELK A;  4WXD A;  1U2W A;  2Z99 A;  3GFL A;  3ECO A;  1FBU A;  2ZME B;  2V9V A;  1V3F A;  2KJC A;  2RC4 A;  3ZMU A;  3CO7 C;  5DCM A;  4KA4 A;  3DXJ F;  3QOP A;  1WRJ A;  1H9G A;  3EYI A;  4HLX A;  4I7H A;  4KMU X;  1Q1H A;  3CUO A;  3CUQ A;  4S05 A;  2LSO A;  3I59 A;  4DQ2 A;  2FU4 A;  2RVC A;  1IN5 A;  4ON0 A;  1FBS A;  4YFX F;  2HKX A;  4FX4 A;  1ZG3 A;  2VT2 A;  1SD5 A;  4IRI A;  2V1X A;  1V4R A;  2VBZ A;  1X3U A;  4LK1 F;  4Y13 A;  5LGN A;  3SFZ A;  3QP6 A;  2CQK A;  2XAG A;  5JFR A;  4P5O A;  1NHA A;  4M6Y A;  5L3D A;  3ZMS A;  1YW9 A;  1HBX G;  1U5T B;  3E5Q A;  2DFI A;  3IWZ A;  1SFE A;  3DQV C;  1SD4 A;  2DQL A;  2HR3 A;  4ZH4 F;  3MZH A;  3E6B A;  4G8X A;  4LK0 F;  2VXZ A;  3HRS A;  2P4W A;  3RDI A;  4AVP A;  1IN7 A;  1I27 A;  2JPB A;  3TDZ C;  4HF0 A;  3LAP A;  4L9V A;  2D1V A;  3TO9 A;  1UFM A;  2D45 A;  1ZLJ A;  2O61 A;  5D4R A;  1R1T A;  2M5W A;  5LBQ A;  1O7L A;  2J5P A;  1YW8 A;  4LG0 B;  4LB6 B;  1RIO H;  4EJT A;  1VTN C;  2ADU A;  2OZU A;  1E2X A;  4IVN A;  1LDJ A;  1KYZ A;  1U8R A;  4P55 A;  4G6D A;  2XHK A;  1O3Q A;  4MNU A;  2JRT A;  3KLN A;  3COA C;  1ZN2 A;  4OOI A;  4PZJ A;  2OA4 A;  4U7D A;  1L0O C;  4M74 A;  3SQN A;  1A04 A;  2NAZ A;  2PEX A;  2XAS A;  3GLX A;  1B4A A;  4AIH A;  4RB0 A;  4ZYE A;  2GXB A;  3C1D A;  3M7G A;  4ZZD A;  1KYW A;  5D8K B;  5ILS A;  1QGP A;  2E7X A;  1D8K A;  4KUM A;  1ZAO A;  2RQP A;  1XGM A;  3K1P A;  1SFU A;  1IN6 A;  5BMZ A;  1P2F A;  1P4X A;  1P4A A;  2FRH A;  4O3M A;  2H94 A;  3IWF A;  2CO5 A;  1R36 A;  2M30 A;  1U78 A;  2P6S A;  3D0S A;  1XGN A;  4P9F A;  2DPD A;  1IN4 A;  4HX8 A;  1ODD A;  3V8K A;  1HW2 A;  2HS5 A;  2ELH A;  4BXU A;  5LGU A;  2Q8K A;  4WCG A;  2JPC A;  1G6N A;  3L9F A;  1FOK A;  2XAH A;  3ABU A;  4KIB A;  2XAJ A;  2ZO4 A;  3IHU A;  1FNN A;  4CDG A;  2FE3 A;  4L0Y B;  3EUH A;  2P8T A;  1WSU A;  1UST A;  1XN7 A;  1OMI A;  5D5V B;  2HTS A;  5LRR A;  4HOB A;  1JXS A;  4A6D A;  1FSH A;  4A12 A;  4I02 A;  5FO5 A;  1G3S A;  2ZME A;  1ON2 A;  2QUF A;  1R1V A;  3QPT A;  4XRF A;  4CIC A;  3K1N A;  5CYV A;  4I01 A;  5DV5 A;  5ICG A;  2AXL A;  2GA2 A;  4EMS A;  2GA1 A;  1KQ8 A;  1XMA A;  3EQL F;  3DKW A;  1WWX A;  2DK8 A;  2M45 A;  1ZG1 A;  3NQO A;  2UXN A;  1LB2 A;  5HLI A;  1TQM A;  2FML A;  3R4K A;  4KFC A;  2PG4 A;  2H27 A;  2J5O A;  3T5X A;  2VT3 A;  3R0J A;  1DPR A;  4O5V A;  3HSR A;  1KU7 A;  2EJR A;  5ILU A;  1S8N A;  2E7W A;  2A69 F;  4OMY A;  3WGG A;  4UVC A;  3ECH A;  3U2R A;  3SXY A;  2DLL A;  3EDP A;  1HKQ A;  2ISZ A;  3GX4 X;  1RI7 A;  2EV5 A;  5LHG A;  4UUV A;  2KIM A;  2L4M A;  3IKT A;  2W85 A;  3F8N A;  2RNJ A;  2BEO A;  1LDK B;  3KLO A;  4MQ9 F;  5DYM A;  1G3Y A;  2EFO A;  3ZPL A;  3WE2 A;  4JBA A;  3ISP A;  1BC8 C;  1JHH A;  2ZJ2 A;  3GEZ A;  4LJZ F;  3BWG A;  1T38 A;  2HWV A;  3BOQ A;  1IXS B;  2K4J A;  3E3V A;  3PQK A;  5AON A;  2OQG A;  1YS7 A;  3F8F A;  1MDM A;  4G7O F;  4UVB A;  4Y17 A;  3MZY A;  2UWM A;  1K7A A;  5JHU A;  2PMU A;  4B8X A;  3FWE A;  2B0L A;  2LNB A;  1LJ9 A;  3WGH A;  1XDS A;  2L4A A;  3E6D A;  1B59 A;  1DUX C;  3GVA A;  4I0A A;  2QQA A;  1IW7 F;  2Q0O A;  4L9N A;  4CO8 A;  4YG2 F;  4WXH A;  1T6S A;  3VOD A;  3HRM A;  1MGT A;  3W6K B;  1W7P B;  1FYK A;  1OYY A;  2Z9O A;  5E8G A;  1QO0 D;  5ICF A;  1I5Z A;  1LQ1 A;  2BBY A;  5EEG A;  4DNC A;  1CGP A;  3M8E A;  2TDX A;  2DBB A;  4ESB A;  4PCQ A;  3HTS B;  3V7C A;  4ENM A;  1ZH5 A;  1ZGJ A;  1H0M A;  2XKP A;  1B6A A;  5K5O A;  1J2X A;  1TLH B;  3PFI A;  3F6O A;  1GXQ A;  2ZBK A;  1K79 A;  2NNN A;  1U5T A;  4ASN A;  2MH2 A;  2IP2 A;  2QZ8 A;  5BS6 A;  3TO6 A;  4L5J A;  1ZYR F;  1T98 A;  4KT5 C;  2FMY A;  3FZV A;  2VOP A;  4HX7 A;  2MD5 A;  1D5V A;  3IKV A;  1FZP B;  1IN8 A;  2NS0 A;  5HDG A;  1ZRD A;  2XUB A;  5LRS A;  1FPQ A;  2DT5 A;  3FMR A;  3BY6 A;  3P9C A;  3KP5 A;  4ZZL A;  2P6T A;  3C18 A;  1IF1 A;  2A68 F;  3T8R A;  4JQF A;  2IPQ X;  2PN6 A;  1IRG A;  2R7F A;  2Z5U A;  3GYH X;  1DP7 P;  3J80 K;  2H09 A;  1WQ2 A;  1XMK A;  3J81 Z;  2DW4 A;  2IA0 A;  1UHM A;  5IT9 Z;  4L18 B;  4OIN F;  4HDV A;  3WTZ A;  3REO A;  5LEK A;  1DDN A;  2QBY A;  2PQ8 A;  3FMQ A;  2ZFW A;  3FXQ A;  3IRR A;  2D2W A;  3QP5 A;  2RN7 A;  4R8H A;  5E1W A;  2YX4 A;  5JR3 A;  2X4H A;  4NB5 A;  1Z9C A;  1R5H A;  1YTY A;  5BOX A;  1PDN C;  1EH6 A;  2WWY A;  4KN4 X;  2EFQ A;  1R7J A;  4OU0 A;  2YU3 A;  3F21 A;  3DF8 A;  4FT8 A;  2WV0 A;  5HS7 A;  4IRG A;  4RGX A;  3T1B A;  1ZG5 A;  3K1M A;  4AD9 A;  2IA2 A;  2VOO A;  5D5W B;  2HKO A;  2K02 A;  3RIR A;  2EK5 A;  1QNT A;  1FSE A;  1OYI A;  5L3B A;  4XBF A;  1YFH A;  3F22 A;  4UHT A;  3IL2 A;  3F8B A;  3KEO A;  3RJP A;  3SZT A;  1P4W A;  5D5X B;  4XSZ F;  2A07 F;  5FLX K;  1WKM A;  3FXR A;  4BNC A;  1SD6 A;  4PGH A;  1XB4 A;  2Z33 A;  3TOB A;  3U1D A;  3VOE A;  3EYY A;  3IC7 A;  1BOA A;  4RAZ A;  4D0P A;  2QM3 A;  4CYD A;  1WI9 A;  4EJO A;  4RB3 C;  3V7R A;  1QBJ A;  2L01 A;  3CLO A;  4BYY A;  3TDU C;  2ACJ A;  2QVO A;  5F64 A;  5DCM B;  2PMH A;  4HV6 A;  3LA2 A;  1SAX A;  3FHZ A;  4UVA A;  3LST A;  2FQ3 A;  1I6X A;  2DO7 A;  2K27 A;  2MC3 A;  3PQJ A;  1IUY A;  1TQI A;  3QRF F;  1W5S A;  2KRF A;  3HSF A;  1MDM B;  2OQR A;  2IT0 A;  5DCF A;  1ONV A;  3V8J A;  4KNY A;  1J0R A;  5CVU A;  3G3Z A;  3WTV C;  2HOE A;  2P7V B;  2CSO A;  2Y0M A;  3J81 K;  5HLG A;  3HUG A;  2K7L A;  1F9N A;  4M72 A;  1S3J A;  2PBI A;  1FBQ A;  3ZMT A;  1S6L A;  3NEU A;  3P9K A;  1G3W A;  2H6C A;  4HA8 A;  4A5M A;  1JHF A;  2YR2 A;  4A6E A;  3L00 A;  2QEN A;  1OPC A;  2EA4 A;  5KVR A;  4MGR A;  4RGS A;  1GHC A;  4QWQ A;  4A0Y A;  1R00 A;  2X0L A;  1R1U A;  3DPL C;  3VB2 A;  3R61 A;  2COM A;  3LFK A;  3N4M A;  2XIG A;  2MBF A;  4G6Q A;  5TRD A;  3BJ6 A;  5IT3 A;  3LQR A;  3GFM A;  3QU3 A;  3V8L A;  2ETH A;  1MJA A;  1FC3 A;  2Y48 A;  5H20 A;  1LNW A;  1O3T A;  1TBX A;  2D1H A;  4GO1 A;  4G9Y A;  2ESN A;  5D8L B;  2IVM A;  1KA8 A;  4IJA A;  1BIB A;  1IAW A;  2FNP A;  4TV7 A;  3GO5 A;  4M73 A;  4U7B A;  2UXX A;  5D5U B;  1I1S A;  1USS A;  4ESF A;  4GYI A;  3CUQ B;  4IXA A;  1CF7 B;  1G4D A;  3O6B B;  3ERE D;  4LD5 A;  1ZHF A;  4YFK F;  2JSC A;  4A2U A;  2EFP A;  4KN7 X;  2MH9 A;  3CO6 C;  3BJO A;  5HLH A;  5E20 A;  4HV5 A;  5CJ9 A;  4NHJ A;  1XSD A;  2VN2 A;  2ZNY A;  1JE8 A;  2JT1 A;  3U9G A;  4LLL A;  1HW1 A;  3BPV A;  4KIG A;  5CVJ A;  2LF7 A;  3WTW C;  2ZCW A;  2G9W A;  3QPH A;  3I59 B;  3KZZ A;  1IZ1 A;  2O3F A;  3BP8 A;  2OU2 A;  3WG9 A;  3IRQ A;  5CVV A;  4LMY A;  3QU6 A;  2L02 A;  2P5K A;  4N9H A;  2FSW A;  2LF8 A;  3F8M A;  5FD6 A;  5L3G A;  2FXA A;  3ZQ7 A;  1HKS A;  5D6E A;  1HKT A;  2VC0 A;  5HS9 A;  1E17 A;  3LA7 A;  1T2K A;  3JTG A;  1EV7 A;  3KET A;  1H9T A;  3D5L A;  3BDD A;  3I4P A;  3I54 A;  4P9U A;  4U0W A;  2EB7 A;  3KCC A;  3HYI A;  2VBY A;  1OR7 A;  2QYO A;  1DPU A;  2XVC A;  3WOD F;  2IA1 A;  4Q48 A;  4OIO F;  3T0Y A;  3JSP A;  1W5T A;  1RUO A;  4EJU A;  5BPI A;  5K1Y A;  4KIF A;  2A6E F;  1MZB A;  2W84 A;  3FX3 A;  1Z7U A;  5FFZ A;  3Q5F A;  3C7J A;  3I71 A;  4WX9 A;  5HDN A;  5HVQ C;  3K0L A;  2BV6 A;  4L9J A;  4RAY A;  4BH9 A;  4I2O A;  1LEA A;  4I09 A;  4HW0 A;  4OMZ A;  2IW5 A;  4BHP A;  2VBW A;  4GCV A;  3ULQ B;  4LLN A;  2OAZ A;  2GXG A;  2CG4 A;  3B73 A;  4BHB A;  4A0X A;  3WU0 A;  1HXD A;  2W24 A;  3VFZ A;  3NRV A;  2UZK A;  3K2Z A;  1YLF A;  4QLC U;  4IF4 A;  3JAM K;  5LLQ A;  2HTJ A;  5J8C A;  1Y0U A;  2VON A;  4ENK A;  2BGC A;  4BQA A;  5J6X A;  5E18 F;  2IRF G;  3I58 A;  5DD4 A;  4HX4 A;  1S7O A;  3KP3 A;  3I0T A;  2HFH A;  4N0B A;  4H0E A;  3F72 A;  4LLG F;  2FBK A;  2QWW A;  3QAH A;  5F6F A;  3N97 A;  1B9M A;  2PI0 A;  2A61 A;  1P92 A;  4HQM A;  5ERI A;  3Q9S A;  3OV8 A;  3L09 A;  3TOA A;  2F2E A;  2GAU A;  2CWE A;  4HF2 A;  2GWR A;  4K2E A;  2ZNZ A;  2DU9 A;  4RB2 C;  1P6R A;  1MJ9 A;  4PGG A;  2P7C B;  2F5C A;  5D4S A;  2L54 A;  1F1Z A;  3O2P E;  2V79 A;  3HIF A;  3ROU A;  5JI6 A;  4KIC A;  2ESH A;  4ZYD A;  1MD0 A;  1BBY A;  1R5G A;  3E6C C;  1XGO A;  2DTR A;  2KJB A;  3RTR A;  2FBI A;  3L2C A;  4EM0 B;  1FWZ A;  4FHT A;  4M6X A;  2CW0 F;  4HLY A;  1TTY A;  1FYL A;  2M87 A;  4YIF A;  2BE5 F;  2FEZ A;  1RZ4 A;  3GUD A;  3GZ5 A;  1R23 A;  4I0B A;  3V7S A;  1ULY A;  3M1E A;  5TJJ A;  1O57 A;  5EEH A;  2BYV E;  3FM5 A;  3TO7 A;  3JSO A;  1KU9 A;  4EV0 A;  4RGR A;  4EJV A;  5DEQ A;  1SMT A;  4LB5 A;  1U5T C;  3Q9V A;  4L0Z B;  3HHG A;  3F23 A;  4LGW A;  3L7W A;  3GWZ A;  3DPT A;  1O7F A;  1CF7 A;  1J7K A;  1FY7 A;  2YX7 A;  3SHF A;  2FBH A;  4EQQ A;  2V1U A;  4YFN F;  3J7A O;  3CJN A;  3P9I A;  2WC2 A;  4M9X A;  1QPM A;  3HTU A;  5DDG A;  2DK5 A;  1AOY A;  4U88 A;  3ZN1 A;  2HDC A;  1LVA A;  4ENN A;  3ZN0 A;  1RUN A;  5L3F A;  4KMF A;  1D8J A;  3RPU A;  3AAF A;  2JTV A;  3RPQ A;  2P5L C;  4E70 A;  3K9T A;  5L3E A;  2STT A;  4U0Y A;  1KU2 A;  4ENJ A;  3R0A A;  4ZYH A;  4EGY A;  1UHW A;  5LEJ A;  4UV8 A;  3ZP5 A;  1MKM A;  2EV0 A;  5JVT A;  2FF4 A;  1D3Y A;  4MEX F;  5FGM A;  1PP7 U;  4L9T A;  5DD8 A;  2FNA A;  3GW2 A;  3RKW A;  2LKP A;  3KP4 A;  1ON1 A;  1J9I A;  4HQE A;  2E1N A;  1ZLK A;  1PP8 F;  3I5U A;  3HRT A;  3RYR A;  1YW7 A;  5E8I A;  1HST A;  3ZMZ A;  1BIA A;  2ZXJ A;  2QBY B;  1SMY F;  2FA5 A;  3C3W A;  4Z2Y A;  4XLP F;  4LFU A;  1OYW A;  5CLS A;  2DAO A;  1YO5 C;  2F5D A;  1HQC A;  2KIF A;  2A6H F;  4RS8 A;  3JW4 A;  1FP1 D;  5CVI A;  1YG2 A;  3E97 A;  2VE8 A;  5AIP A;  3JAM Z;  4CHU A;  2C6Y A;  5AIQ A;  5LGT A;  2ISY A;  1FYM A;  5FB2 A;  3FM3 A;  1REP C;  3WE3 A;  2P5V A;  4JK1 X;  5HOO A;  3RYP A;  1Z05 A;  3GFI A;  1HW5 A;  5E1Z B;  3E6M A;  3BRO A;  3MFK A;  2XRO A;  4I98 B;  3KP2 A;  3LAJ A;  3P7N A;  1TW2 A;  4R1H A;  1FT9 A;  1I1G A;  4MHG A;  2XV4 S;  2O0Y A;  4Q5S F;  1UCR A;  1BI2 A;  2DQR A;  2MLG A;  2Y75 A;  3H3U A;  3MEX A;  2R3S A;  3WTS C;  5ICC A;  5K5R A;  1T39 A;  4WK8 F;  1F5T A;  4HYE A;  2HEO A;  5A2Q K;  2MA3 A;  1Z6T A;  3KE2 A;  1T0F A;  5IT9 K;  5E1X A;  2W25 A;  3JTH A;  1TNS A;  1W7P A;  2RKH A;  2DI3 A;  4EJW A;  3TQN A;  2EFW A;  3F8C A;  2A5Y B;  1IRF A;  5ED4 A;  4IHT A;  5E17 F;  2NNY A;  1STZ A;  1YYV A;  4S04 A;  5FFX A;  2DPU A;  2CFX A;  3R6S A;  3GF2 A;  2O03 A;  5KK1 A;  4RB1 A;  1ZAR A;  4UV9 A;  4WWC A;  4PDK A;  1J59 A;  2VE9 A;  1B9N A;  1YS6 A;  3WGI A;  1FLI A;  4Q4Z F;  3ZMD A;  1MJB A;  1BC7 C;  3F3X A;  2XGX A;  3KZY A;  3DV8 A;  1QZZ A;  4CGZ A;  4HBL A;  1BI0 A;  2Z3Y A;  3FMS A;  4MQV A;  1FP2 A;  3WTY C;  4AIK A;  4EM1 A;  4AIJ A;  2RGV A;  2LDU A;  1Z1D A;  2GZW A;  4L5I A;  3BPX A;  3RI4 A;  3ML6 A;  1TQP A;  1R58 A;  3EET A;  3E5X A;  5BQT A;  3J80 Z;  5FLX Z;  4ESJ A;  2G7H A;  4MTD A;  4OIQ F;  1IXC A;  3MQ0 A;  3CTA A;  3B02 A;  5BPD A;  3DFG A;  3MCZ A;  1XD7 A;  2HYF A;  4IPA A;  3VEP A;  3ABT A;  3M8F A;  5FD5 A;  5K5Q A;  3HOS A;  3BZ6 A;  1YQA A;  4KDP A;  3R60 A;  1GXP A;  1UB9 A;  4B09 A;  3M9A A;  3LQQ A;  4U0V A;  1K6O A;  4XLN F;  4HDU A;  4KYW A;  1L3L A;  3TKY A;  2EFN A;  3WTT C;  3KP6 A;  3I64 A;  4GYG A;  2Q2E A;  4P96 A;  2VBX A;  4MEY F;  4UNO A;  1U6G A;  4GGG A;  1BM9 A;  2FOK A;  1S7A A;  2WTE A;  1XSX A;  4O6J A;  4GXO A;  4CZZ A;  4HAM A;  3SZP A;  3S2W A;  4BHC A;  2CGP A;  3HOT A;  5J8F A;  1AWC A;  2F5F A;  2HQN A;  2JZY A;  3RKX A;  1G3T A;  1XSV A;  3LWF A;  4OIR F;  5L3C A;  4Y15 A;  3I53 A;  3GFJ A;  4MTE A;  1K78 A;  1HSJ A;  1IXR C;  2RDP A;  2QQ9 A;  1QZY A;  1XCB A;  2IJL A;  1ZRE A;  2EV6 A;  2STW A;  2L3D A;  2NRA C;  2A3S A;  3G73 A;  3GXO A;  2K86 A;  4ZYG A;  2XKO A;  2KIU A;  5ILV A;  1J75 A;  1ZRC A;  3CDH A;  1O3S A;  5HDK A;  2HQR A;  1OKR A;  5ICE A;  4HZF A;  1BJA A;  4IRH A;  2M8E A;  4WXC A;  2KKO A;  5CVR A;  3T8T A;  3HRU A;  4A5N A;  4M9Z A;  3GZ6 A;  1LEB A;  1XGS A;  2PFB A;  3BJA A;  1EH7 A;  2GIV A;  2QQB A;  4LG0 A;  2H6B A;  2V1D A;  2OD5 A;  5H6R A;  4IHS A;  2MLK A;  4NQW A;  4YII A;  3V4G A;  1KQ0 A;  1XCV A;  1BI3 A;  2F5E A;  2HYG D;  2QLZ A;  3H92 A;  2R7D A;  4G7H F;  2RV8 A;  3LA3 A;  2XAQ A;  4Q47 A;  1QQI A;  1FX7 A;  1F4K A;  2VC1 A;  1W7P D;  2PLY A;  1KU3 A;  4WF2 A;  2YPR A;  1Z91 A;  2OBP A;  4UXN A;  1KQ9 A;  5LHI A;  2K4B A;  3HHH A;  1U3E M;  1W4M A;  2EA2 A;  2OZ6 A;  1B1B A;  3E5U A;  1TW3 A;  1C0W A;  4HF1 A;  2XAF A;  3WTU C;  4A0Z A;  4M71 A;  4CXF A;  1JGS A;  1LDD A;  2VOD A;  2NYX A;  2HGC A;  2ZKZ A;  3MAJ A;  3CUQ C;  2HZT A;  1KGS A;  1J5Y A;  2V6C A;  4XSX F;  3DP7 A;  3TGN A;  4AWX B;  1EH8 A;  5H6Q A;  2XRN A;  3KP7 A;  3DEU A;  2EWN A;  3K69 A;  2M1B A;  1RNL A;  2O8X A;  2AS5 F;  4BAY A;  5F1R A;  1ZRF A;  3KEQ A;  3MWM A;  3HSE A;  2PJP A;  3KFW X;  5DUK A;  4EGZ A;  3OOP A;  3FXU A;  5DUI A;  4R79 A;  4EM2 A;  4ETS A;  1XDU A;  4EVI A;  5HS8 A;  3WU1 B;  1YIO A;  3O3K A;  2GQQ A;  1SFX A;  1GVJ A;  1ZGA A;  3WTX C;  2YSR A;  1TNT A;  5D6F A;  5A2Q Z;  5LHH A;  1K78 B;  2CYY A;  2O6G E;  1BI1 A;  2G7U A;  1SD7 A;  1S29 A;  4G94 A;  1Z6R A;  4OIP F;  3ZMV A;  3H3Z A;  4FX0 A;  1R22 A;  2E1C A;  3W6J B;  1O3R A;  4F7Z A;  3RKY A;  3FF5 A;  1BN5 A;  4M9S A;  4N9I A;  4G7Z F;  3F6V A;  1PUE E;  6PAX A; 
#chains in the Genus database with same CATH topology
 2X1D A;  3EUA A;  2LBF A;  2QF7 A;  2W57 A;  2WAD A;  3PUF A;  4RGU A;  3ELK A;  4WXD A;  1U2W A;  2Z99 A;  3GFL A;  1ZGW A;  3ECO A;  4GRI A;  1FBU A;  2ZME B;  2V9V A;  1V3F A;  2KP6 A;  5GPC A;  2LY2 A;  2ID3 A;  2KJC A;  3CME I;  2RRE A;  3GTJ J;  2RC4 A;  3ZMU A;  3CO7 C;  1R4N B;  5DCM A;  2JN6 A;  1MNE A;  4ABZ A;  1BW5 A;  4KA4 A;  5F0F A;  1W0U A;  3DXJ F;  3QOP A;  1WRJ A;  3S2H J;  1H9G A;  1N25 A;  3EYI A;  4HLX A;  4I7H A;  3BCB A;  4KMU X;  2Y31 A;  1Q1H A;  3CUO A;  3CUQ A;  3V42 A;  1G2H A;  4FE4 A;  4S05 A;  4BBR J;  2LSO A;  3I59 A;  4DQ2 A;  2FU4 A;  2RVC A;  2BHZ A;  2K3P A;  1IN5 A;  3VYT B;  3J7Z I;  1HDD C;  4ON0 A;  1FBS A;  4A3K J;  3K70 D;  4YFX F;  3CJQ B;  2HKX A;  4FX4 A;  1ZG3 A;  2VT2 A;  5F0H A;  1FOX A;  1SD5 A;  1ETX A;  4IRI A;  1Y39 A;  2V1X A;  2FJ1 A;  1V4R A;  2IS1 A;  2IS6 A;  2VBZ A;  4YEJ A;  4BQO A;  1X3U A;  4LK1 F;  4Y13 A;  5LGN A;  2HYJ A;  3SFZ A;  3I56 I;  4BY1 J;  1HDP A;  3QP6 A;  2CQK A;  3BR6 A;  3IH2 A;  2K9Q A;  2XAG A;  5DM7 F;  1EJ9 A;  4F93 B;  5JFR A;  4P5O A;  3KEY A;  1NHA A;  5FKK A;  2K40 A;  3OIQ A;  2LG4 A;  4XK4 A;  4B47 A;  4M6Y A;  5L3D A;  3ZMS A;  3K4K A;  1JT0 A;  4BUP A;  2COB A;  4FET A;  1YW9 A;  2KQR A;  1IC8 A;  2FX0 A;  2AQE A;  1WJD A;  1HBX G;  3Q0W A;  1V54 H;  1U5T B;  3E5Q A;  1G59 A;  2W1O A;  5J1U A;  2DFI A;  3IWZ A;  2NVT J;  4AYB A;  1SFE A;  4DZJ A;  3DQV C;  1LE8 B;  1SD4 A;  3MKZ A;  2DQL A;  2HOT A;  2HR3 A;  4ZH4 F;  3MZH A;  2XB0 X;  3E6B A;  4G8X A;  4LK0 F;  2VXZ A;  3HRS A;  2P4W A;  2V9P A;  3RDI A;  2OV7 A;  3C2B A;  4AVP A;  3PIO F;  1IN7 A;  1ZK8 A;  1I27 A;  4C3J J;  2QSH X;  1FIP A;  5KHD A;  2JPB A;  4KJZ A;  3TDZ C;  2W48 A;  4HF0 A;  3LAP A;  4L9V A;  3CF2 A;  2D1V A;  2ZXI A;  3TO9 A;  2L5Q A;  1UFM A;  2D45 A;  1ZLJ A;  2O61 A;  5D4R A;  1R1T A;  2M5W A;  1YIJ I;  4II2 A;  5LBQ A;  1O7L A;  2J5P A;  2XF7 A;  3SFI A;  4FAS D;  1YW8 A;  1V5G A;  4ZTF A;  4LG0 B;  2LRE A;  2LP0 A;  4LB6 B;  1RIO H;  2V26 A;  4EJT A;  1ZKG A;  4X0G A;  2E5N A;  1VTN C;  2ADU A;  3LSK A;  3PSF A;  1DP3 A;  1UAA A;  2OZU A;  2VQG A;  1E2X A;  4IVN A;  1LDJ A;  3WHC A;  1KYZ A;  1U8R A;  2NS7 A;  3HXL A;  4P55 A;  1F43 A;  4G6D A;  2PJR A;  5B66 C;  3FXJ A;  2XHK A;  4E7Z A;  5DS9 A;  2CW8 A;  4DGW B;  2DJI A;  1O3Q A;  2DFE A;  2JRT A;  4MNU A;  3KLN A;  3COA C;  2NS8 A;  1ZN2 A;  4OOI A;  4PZJ A;  2OA4 A;  1D1A A;  4PJL A;  4U7D A;  1L0O C;  4M74 A;  3SQN A;  1VQ5 I;  4E7S A;  1A04 A;  3ASN H;  3AKZ A;  3FIS A;  2NAZ A;  1K6Y A;  2PEX A;  2XAS A;  3GLX A;  1B4A A;  4AIH A;  4RB0 A;  4ZYE A;  4RLQ A;  4D5C A;  2GXB A;  3L2W A;  2X1C A;  3C1D A;  3M7G A;  2JMW A;  1WCM J;  1NH3 A;  4ZZD A;  1VZ0 A;  1KYW A;  5D8K B;  5GAD J;  2NVQ J;  2CUF A;  5ILS A;  1QGP A;  4I99 C;  4XMY A;  4YRV A;  2E7X A;  2W4S A;  4J00 A;  1D8K A;  3BG9 A;  4KUM A;  3K6G A;  5GPA A;  4E6K G;  1ZAO A;  1MMD A;  2RQP A;  2RNG A;  5JLX A;  3DPU A;  2VJI A;  1XGM A;  2BW3 B;  3JRD A;  3CC2 I;  3K1P A;  1SFU A;  1IN6 A;  1D5Y A;  5BMZ A;  4QPQ A;  1YX5 A;  2K5C A;  4QSH A;  1P2F A;  2Y69 H;  1JUS A;  2EBI A;  4XOT A;  1P4X A;  2YUS A;  1BA5 A;  5IY5 H;  1P4A A;  2IGN A;  2FRH A;  2H94 A;  4O3M A;  3IWF A;  3A0B C;  2CO5 A;  3OYB A;  1T95 A;  3WHB A;  1AU7 A;  1R36 A;  2M30 A;  3HUG B;  1U78 A;  2P6S A;  3D0S A;  1IJW C;  2XRL A;  4XOR A;  5B1B H;  3ZGK A;  1XGN A;  3PJR A;  2DDB A;  4P9F A;  2DPD A;  1WZ2 A;  1IN4 A;  2CUJ A;  4HX8 A;  1ODD A;  2BXY A;  3V8K A;  1HW2 A;  1YE9 A;  2LC2 A;  4HPQ A;  2CUZ A;  4HEA 2;  2HS5 A;  2EIK H;  2ELH A;  3E1S A;  4BXU A;  2RAE A;  4D7N A;  3A02 A;  3H5A A;  3NAU A;  4JYK A;  4RMN A;  5LGU A;  2Q8K A;  4WCG A;  2M8G X;  2L2O A;  4I76 A;  2JPC A;  3ZQG A;  1G6N A;  3QPL A;  2L9N A;  3L9F A;  1FOK A;  2OF7 A;  2R7R A;  4DYC A;  2XAH A;  2LY1 A;  2H8R A;  3RZO J;  3ABU A;  4Y4R A;  3CCM I;  4UUT A;  2QSG X;  1K4S A;  2VI6 A;  2XAJ A;  4KIB A;  4UY8 I;  3W2V A;  2ZO4 A;  2HQA A;  3IHU A;  3LSR A;  1X1D A;  1FNN A;  1ENH A;  4CDG A;  2FE3 A;  2M9H A;  4L0Y B;  2E71 A;  2VLA A;  3EUH A;  3S32 A;  2P8T A;  1MBJ A;  1WSU A;  1UST A;  1XN7 A;  2V1N A;  1V5F A;  1LFP A;  1OMI A;  5D5V B;  3JR9 A;  2HTS A;  5LRR A;  3OYM A;  4HOB A;  1JXS A;  4A6D A;  1FSH A;  4A12 A;  2VPL A;  4I02 A;  5FO5 A;  2KFD A;  4N4O B;  4BKX A;  3A4C A;  1G3S A;  2VQH A;  2ZME A;  1V55 H;  1ON2 A;  3CC4 I;  2QUF A;  1R1V A;  3QPT A;  4XRF A;  3U21 A;  5HOD A;  2KT0 A;  4CIC A;  3IV5 A;  3K1N A;  5CYV A;  3FK6 A;  4I01 A;  5DV5 A;  5ICG A;  2AXL A;  2GA2 A;  4EMS A;  2DA3 A;  3MZ8 A;  3CCU I;  2GA1 A;  1KQ8 A;  4PJJ A;  2EH3 A;  1XMA A;  3EQL F;  3DKW A;  4PJM A;  3TBI A;  1WWX A;  2L9R A;  4B3A A;  2DK8 A;  4MIM A;  1GV5 A;  1JJ6 C;  2M45 A;  5J1R A;  2IXS A;  1ZG1 A;  1FJL A;  3NQO A;  2UXN A;  1LB2 A;  1QHG A;  1P7J A;  5HLI A;  2XDV A;  1JKR C;  3FKI J;  1TQM A;  2CRG A;  4BE0 A;  2FML A;  3R4K A;  4C2M J;  4KFC A;  4CCJ A;  2PG4 A;  2H27 A;  1IV8 A;  2LY9 A;  1Y0N A;  2J5O A;  2YU9 J;  4HNU A;  3T5X A;  2VT3 A;  3E7L A;  3HDD A;  1W5C C;  3A01 A;  2K85 A;  3R0J A;  2W7N A;  3KYL A;  3ZR8 X;  1DPR A;  3H36 A;  2DMQ A;  4O5V A;  3HSR A;  2I8D A;  2QKL B;  2FUG 2;  1KU7 A;  4II3 A;  3HOW J;  4A93 J;  2EJR A;  1HCR A;  5ILU A;  1S8N A;  2E7W A;  2A69 F;  4OMY A;  3VSK A;  3WGG A;  2BXZ A;  3ECH A;  4UVC A;  2LD5 A;  1IDY A;  3U2R A;  1HOM A;  3SXY A;  2DA5 A;  2DLL A;  3EDP A;  1FMW A;  3CF5 F;  3HBL A;  3ZQF A;  1HKQ A;  3OYD A;  3OYH A;  2ISZ A;  3GX4 X;  1RI7 A;  2EV5 A;  3G1L A;  3RZD J;  2EZK A;  1AKH A;  5LHG A;  4UUV A;  3A03 A;  2KIM A;  2L4M A;  2FQ4 A;  3IKT A;  2W85 A;  3F8N A;  1XX5 A;  2RNJ A;  2BEO A;  1LDK B;  3KLO A;  4MQ9 F;  3ZCO A;  5DYM A;  1G3Y A;  3AL0 C;  2EFO A;  3DKY A;  3FXO A;  1NK2 P;  3QOE A;  3ZPL A;  1E3H A;  3WE2 A;  4XL9 A;  2KRH A;  3ISP A;  4JBA A;  1BC8 C;  1JHH A;  2ZJ2 A;  5B3S H;  2DA4 A;  3HM5 A;  3GEZ A;  4BY7 J;  4LJZ F;  3BWG A;  1T38 A;  2GXA A;  2HWV A;  3BOQ A;  1ETW A;  1IXS B;  2K4J A;  3E3V A;  4V19 K;  5FKM A;  1M1E B;  2DOD A;  2DMP A;  3PQK A;  5AON A;  1ETY A;  2OQG A;  2R7W A;  1YS7 A;  4C30 A;  3F8F A;  2Y2Z A;  1MDM A;  4G7O F;  5LFA A;  1T8I A;  4UVB A;  4Y17 A;  3MZY A;  2XSD C;  2UWM A;  2VAS A;  1K7A A;  5JHU A;  2PMU A;  1HF0 A;  5IP6 A;  1WJ5 A;  2OCE A;  3IH3 A;  3FBN B;  1FEX A;  4B8X A;  3FWE A;  1OCT C;  5K7Z A;  1P7I A;  2B0L A;  1JUP A;  2LNB A;  1TWC J;  1LJ9 A;  1UG0 A;  3F0C A;  3WGH A;  1IG7 A;  2JVH A;  2ME6 A;  3HOV J;  1XDS A;  1E3O C;  2L4A A;  3E6D A;  1B59 A;  1DUX C;  3GVA A;  3G6E I;  4I0A A;  2QQA A;  1XMX A;  1IW7 F;  2Q0O A;  3OYC A;  4L9N A;  3JRH A;  4CO8 A;  4YG2 F;  1JJ8 C;  3KYC B;  4WXH A;  1T6S A;  2LTP A;  3BT9 A;  1MGT A;  3HRM A;  3VOD A;  3W6K B;  1LFU P;  4FIS A;  2WB1 A;  4HNT A;  3MD2 A;  1W7P B;  5IYC J;  2ZSH B;  1WJF A;  1FYK A;  1OYY A;  3HGG A;  2Z9O A;  5E8G A;  3DTE A;  3NAR A;  1QO0 D;  3QWL A;  2KDO A;  1VQO I;  1TWH J;  5ICF A;  1U9O A;  3D1N I;  1I5Z A;  1LQ1 A;  2BBY A;  2E1M B;  2ZXH A;  3LSJ A;  5EEG A;  3TW6 A;  2QKM B;  4DNC A;  5J4V A;  1CGP A;  4F91 B;  3M8E A;  2JA8 J;  2TDX A;  2KLO A;  3A1Y A;  3TL4 X;  5HNH A;  2DBB A;  4ESB A;  2EZL A;  2VKE A;  4PCQ A;  4XLH A;  3HTS B;  3V7C A;  4ENM A;  3RQI A;  3LSP A;  1ZH5 A;  1ZGJ A;  2K9S A;  1H0M A;  1OQY A;  2XKP A;  1B6A A;  5K5O A;  1J2X A;  2XSJ C;  5DM6 F;  2OUM A;  1TLH B;  2BY3 A;  1LE8 A;  1SVM A;  1FTT A;  1TZL A;  3PFI A;  3F6O A;  1GXQ A;  2ZBK A;  3RPU D;  1K79 A;  2NNN A;  2JA6 J;  1U5T A;  2ID6 A;  2MH2 A;  4ASN A;  1H89 C;  4F52 A;  2IP2 A;  2QZ8 A;  5BS6 A;  3TO6 A;  2ELK A;  4M6V A;  4L5J A;  5JLW A;  1ZYR F;  5J47 A;  1T98 A;  4F3Q A;  4KT5 C;  2FMY A;  3FZV A;  4ANJ A;  2BY1 A;  3OS0 A;  2VOP A;  3OYF A;  4HX7 A;  5IP9 J;  2MD5 A;  4M3F A;  5M3F J;  4Y52 J;  2HDW A;  3IKV A;  5FRM A;  1D5V A;  1FZP B;  1IN8 A;  2HXI A;  2NS0 A;  3KPH A;  3OYG A;  5HDG A;  1ZRD A;  2XUB A;  5LRS A;  4DJA A;  2ZSI B;  3CQZ J;  1X2M A;  1FPQ A;  1QU3 A;  3DBL B;  1QA6 A;  2DT5 A;  3FMR A;  1YJW I;  4F55 A;  3DKX A;  1JKP C;  3BY6 A;  3P9C A;  3KP5 A;  4ZZL A;  1ERD A;  2P6T A;  3C18 A;  1IF1 A;  4E7I A;  3FDY A;  3CCS I;  2F5V A;  2Q2E B;  1V5E A;  2A68 F;  3T8R A;  4JQF A;  2IPQ X;  1SAN A;  2PN6 A;  4FQG A;  1IRG A;  2R7F A;  4OAY A;  4DIQ A;  4MLO A;  2Z5U A;  3GYH X;  1I3Q J;  1DP7 P;  3J80 K;  5F27 A;  3BR5 A;  2H09 A;  3BG3 A;  4XKB A;  4UUS A;  2XF6 A;  1WQ2 A;  1XMK A;  4AVZ A;  1K4T A;  3S16 J;  4IZZ A;  4BBS J;  1ACI A;  3J81 Z;  2DW4 A;  2K9M A;  2IA0 A;  2VJ5 A;  4JP0 A;  1UHM A;  5IT9 Z;  1D1B A;  4B4C A;  3EUH C;  4L18 B;  4OIN F;  5J4Y A;  4HDV A;  2DOA A;  3WTZ A;  3GTQ J;  4B48 A;  2CMP A;  3REO A;  5LEK A;  4Y33 A;  1MND A;  1DDN A;  3DLL F;  2QBY A;  2PQ8 A;  2PX9 A;  3FMQ A;  2RQQ A;  2ZFW A;  3SDG A;  3FXQ A;  4BJ5 C;  3IRR A;  1AKH B;  1LFB A;  2D2W A;  1ORK A;  3QP5 A;  2RN7 A;  1X1B A;  4R8H A;  5E1W A;  2YX4 A;  5EEA A;  3HB9 A;  5JR3 A;  2X4H A;  4NB5 A;  1Z9C A;  3BTL A;  4LIV A;  1I3A A;  1WVR A;  1R5H A;  1YTY A;  5BOX A;  4AU7 A;  1PDN C;  1EH6 A;  2WWY A;  4BXX J;  3CP2 A;  5EZG A;  3CCL I;  1IV6 A;  4HG2 A;  4KN4 X;  5M3M J;  2EFQ A;  1R7J A;  4OU0 A;  4E4H A;  1N75 A;  2M34 A;  2E19 A;  3CCJ I;  3CZ6 A;  2YU3 A;  1SFO J;  3F21 A;  3DF8 A;  2DT7 B;  4FT8 A;  2WV0 A;  5HS7 A;  4IRG A;  2Z1D A;  1UEL B;  1Y1V J;  4RGX A;  3T1B A;  2AXT C;  3MKY B;  3MMY B;  4NNJ A;  5EYR A;  1ZG5 A;  3K1M A;  3MVP A;  4AD9 A;  1B8I A;  2IA2 A;  5IYD J;  3OL3 A;  4I6Z A;  2VOO A;  2X6W A;  5D5W B;  3MKL A;  5EF6 A;  2HKO A;  1WPK A;  3RQ4 A;  2K9N A;  4DOZ A;  2K02 A;  3RIR A;  1Z3Y A;  1QPI A;  2EK5 A;  1X4P A;  1QNT A;  4C2T A;  1FSE A;  1OYI A;  5L3B A;  1N77 A;  4XBF A;  1S9H A;  1YFH A;  3OS1 A;  1RES A;  4ITV A;  3F22 A;  2BW3 A;  1W36 D;  4UHT A;  3IL2 A;  3F8B A;  5E3M A;  2R7V A;  3KEO A;  3RJP A;  3SZT A;  1EF4 A;  2UV1 A;  1P4W A;  5D5X B;  3ABM H;  4XSZ F;  5C3E J;  2A07 F;  2XB5 A;  1WKM A;  5FLX K;  3FXR A;  1Z3X A;  4BNC A;  3OOU A;  1YOV B;  1SD6 A;  2JUC A;  4PGH A;  1XB4 A;  2HQ5 A;  2O8K A;  4CYC A;  4BE1 A;  1I6H J;  2Z33 A;  1VF9 A;  2JA7 J;  3H3V K;  3K2A A;  1FOW A;  3TOB A;  3U1D A;  3VOE A;  3ZQH A;  1MNM C;  4A3D J;  3EYY A;  3IC7 A;  1PYV A;  1BOA A;  4UB8 C;  3CMA I;  2L7M P;  5K7H A;  4RAZ A;  1R4M B;  4D0P A;  2QM3 A;  4CYD A;  1WI9 A;  4EJO A;  4RB3 C;  3V7R A;  1VND A;  1QBJ A;  4NDL A;  3S3N A;  2L01 A;  3CLO A;  3O8H A;  3PFY A;  3A0H C;  1W36 C;  4BYY A;  3TDU C;  2ACJ A;  2QVO A;  5F64 A;  5DCM B;  3BG5 A;  2PMH A;  2ZB9 A;  1VFC A;  4HV6 A;  4A69 C;  2DJN A;  3LA2 A;  5J1Y A;  1SAX A;  3FHZ A;  3FHN A;  1JUM A;  4UVA A;  3QYE A;  3LST A;  5FRN A;  2E2H J;  2FQ3 A;  4NC7 A;  1I6X A;  2DO7 A;  2LVS A;  2K27 A;  2MC3 A;  4LIU A;  3OY9 A;  3PQJ A;  3CCQ I;  1PUF B;  1IUY A;  1TQI A;  3QRF F;  2E36 A;  1W5S A;  2KRF A;  3HSF A;  1MDM B;  2OQR A;  2CQN A;  4Y3O A;  3M07 A;  2IT0 A;  2VUM J;  5DCF A;  1ONV A;  3V8J A;  2AO9 A;  1X1A A;  4KNY A;  1Q1V A;  1J0R A;  5CVU A;  2NVY J;  2BY0 A;  3G3Z A;  3OYI A;  3WTV C;  2HOE A;  3HPG A;  3PL8 A;  1GVD A;  2P7V B;  2A05 A;  2OJE D;  2CSO A;  4P1W A;  1Z67 A;  3K70 C;  5FKO A;  4FCY A;  2Y0M A;  3J81 K;  3BQZ A;  5HLG A;  1MH4 A;  4EAT A;  3HUG A;  2K7L A;  1F9N A;  3FBI B;  3OMY A;  2HVS A;  3FKJ A;  1S3J A;  4M72 A;  2PBI A;  3BR2 A;  3OYN A;  4JX5 A;  1FBQ A;  3ZMT A;  1JGG A;  1S6L A;  5FLM J;  2B9S A;  2DMT A;  1VI0 A;  3NEU A;  1T08 B;  3P9K A;  1G3W A;  2H6C A;  4HA8 A;  4A5M A;  2DA2 A;  4F92 B;  1JHF A;  2YR2 A;  3LSG A;  4A6E A;  3L00 A;  4BE2 A;  2QEN A;  1OPC A;  4CCN A;  2EA4 A;  4AUX A;  3GCM A;  2NOJ B;  1TWG J;  1BOB A;  5KVR A;  4MGR A;  1X2N A;  4RGS A;  3OWT A;  1GHC A;  3CLQ A;  1ITY A;  2QGU A;  1DU6 A;  2L9S A;  4BU2 A;  3IUO A;  5E79 C;  1MSE C;  4QWQ A;  5F08 A;  2IS4 A;  4OWR B;  4A0Y A;  1R00 A;  2X0L A;  1R1U A;  3DPL C;  3VB2 A;  5FRO A;  3R61 A;  2COM A;  3LFK A;  5FLV A;  2A5W A;  5EGO A;  2X48 A;  4C3I J;  3N4M A;  2XIG A;  2MBF A;  5J3L A;  4G6Q A;  3LL7 A;  5GAH J;  5TRD A;  4IHW A;  3BJ6 A;  1X4O A;  5CQG A;  5IT3 A;  3LQR A;  3GFM A;  3QU3 A;  4U87 A;  3V8L A;  4BL0 B;  2DCE A;  3BG6 A;  3BR0 A;  2ETH A;  1FC3 A;  1MJA A;  2Y48 A;  3CP8 A;  4PFP A;  5H20 A;  2XC7 A;  2NOG A;  3LFU A;  1MMS A;  1LNW A;  2F4O B;  3I4N J;  3KZI C;  2HOS A;  3AL0 B;  1ZR4 A;  1O3T A;  1TBX A;  4XLF A;  2D1H A;  4GO1 A;  4GFB A;  1HA8 A;  2DA1 A;  2ESN A;  4G9Y A;  1JTX A;  5D8L B;  1D0X A;  5E3N A;  2R93 J;  1IO2 A;  3JRI A;  2IVM A;  1KA8 A;  4IJA A;  4IO9 F;  3SEQ A;  3BG7 A;  1BIB A;  4Z6Y A;  1IAW A;  2FNP A;  2WV1 A;  2P81 A;  1X3Z B;  4V2F A;  4TV7 A;  3B6C A;  3GO5 A;  4M73 A;  2CQX A;  3W3C A;  4U7B A;  3FXK A;  2UXX A;  1UJ8 A;  5D5U B;  3TP0 A;  4RM2 A;  3PSI A;  3G1M A;  1USS A;  1I1S A;  4ESF A;  1R49 A;  4GYI A;  2Y9Z A;  3CUQ B;  4IXA A;  3D5R C;  1CF7 B;  3HOZ J;  1G4D A;  3DCF A;  3O6B B;  1YIT I;  1UZC A;  4A3G J;  2DN0 A;  4IEJ A;  5TIS C;  5F0C A;  3ERE D;  3PM1 A;  4LD5 A;  5FKN A;  3JCU C;  1ZHF A;  3L2Q A;  4YFK F;  1X1P A;  1FTZ A;  2CW7 A;  2JSC A;  3BR3 A;  4A2U A;  2EFP A;  4KN7 X;  2MH9 A;  3CO6 C;  3BJO A;  5HLH A;  4A3J J;  5E20 A;  3GTG J;  3BZK A;  5GP9 A;  2R7Q A;  4HV5 A;  1G8X A;  5CJ9 A;  4NHJ A;  3S8P A;  1WGX A;  1XSD A;  2VN2 A;  2JUG A;  5JVG F;  2NVX J;  1J09 A;  2ZNY A;  1JE8 A;  5C4X J;  2JT1 A;  4DYQ A;  2OTJ I;  3U9G A;  4LLL A;  1HW1 A;  3BPV A;  3H1C A;  1HLV A;  1ETV A;  4KIG A;  4H4K C;  5CVJ A;  2GLO A;  3BR1 A;  5EJC A;  2LF7 A;  3WTW C;  2X9D A;  2ZCW A;  4QTR A;  3LMM A;  3WU2 C;  4CSW A;  2G9W A;  2ZJP F;  3QPH A;  3I59 B;  1DGW Y;  1ETQ A;  2F6C A;  3KZZ A;  2EPF A;  4XKW A;  3VDX A;  1IZ1 A;  2O3F A;  1R9T J;  5E3O A;  3BP8 A;  5GTI C;  1LVK A;  1XTA A;  2OU2 A;  3WG9 A;  3IRQ A;  3SZG A;  2XGE A;  1FIA A;  5CVV A;  1T56 A;  3QU6 A;  4LMY A;  4OAZ A;  1RKW A;  2L02 A;  3NWT A;  2P5K A;  4KT6 A;  4N9H A;  2FSW A;  4BJ6 C;  1XG1 A;  2LF8 A;  3EPZ A;  3F8M A;  3DWL E;  1OLT A;  5FD6 A;  5L3G A;  2HZD A;  1JKO C;  4XKV A;  2FXA A;  5KCM A;  4CYC B;  3ZQ7 A;  1HKS A;  5D6E A;  2EQR A;  1OJL A;  4M3E A;  4C2U A;  2H1L A;  3PNV A;  2VC0 A;  5HS9 A;  3FXM A;  1HKT A;  4CCM A;  3K4C A;  1E17 A;  3LA7 A;  3CCV I;  1ETK A;  1T2K A;  3FXL A;  2E34 A;  1TWF J;  4IKF A;  3CD6 I;  3S1M J;  3JTG A;  1EV7 A;  2DA6 A;  2E35 A;  3KET A;  3H0G J;  1H9T A;  3D5L A;  3BDD A;  3CJT B;  4CCO A;  2LK2 A;  3I4P A;  3I54 A;  4P9U A;  4U0W A;  3RKQ A;  2EB7 A;  3KCC A;  1N78 A;  1POG A;  2DT6 A;  3CDI A;  3KYD B;  3G4S I;  3HYI A;  3DTI A;  1ZTR A;  2VBY A;  1A36 A;  1OR7 A;  2QYO A;  1DPU A;  2XVC A;  1TP4 A;  3WOD F;  4IHV A;  2IA1 A;  4V2G A;  2V4J C;  2ZXW H;  4A3B J;  2F48 A;  3QYF A;  3HKZ A;  4Q48 A;  4OIO F;  1T33 A;  3T0Y A;  1R6R A;  3JSP A;  5EG0 A;  1W5T A;  4B1R A;  1RUO A;  4EJU A;  5KAF C;  4W1U A;  1VQ9 I;  5F1J A;  1UHS A;  2R5Y B;  4AID A;  5K1Y A;  5BPI A;  4A3M J;  1RPW A;  1OCP A;  1QVT A;  1RRJ A;  4KIF A;  3JRC A;  2A6E F;  1MZB A;  5C4J J;  3ABK H;  2LFB A;  2MSY A;  1Y6I A;  2HXO A;  2W84 A;  3FX3 A;  3I3L A;  1Z7U A;  4LG3 A;  2I5U A;  5FFZ A;  4XR6 A;  3GME A;  1WH7 A;  3Q5F A;  3C7J A;  3I71 A;  3CC7 I;  2E1M C;  5HDN A;  5HVQ C;  2LH9 A;  4WX9 A;  3HPH A;  3K0L A;  4BGD A;  2BV6 A;  4L9J A;  4RAY A;  4BH9 A;  2R7T A;  1VQP I;  4I2O A;  3I9V 2;  3CES A;  1LEA A;  4RAG A;  4I09 A;  4HW0 A;  3BZC A;  4OMZ A;  3GZN B;  2IW5 A;  3QQA A;  4BHP A;  3SEZ A;  2VBW A;  3PNT A;  3CMY A;  1VQM I;  4DBR A;  4GCV A;  2CV2 A;  3ULQ B;  1Y8R B;  4LLN A;  2OAZ A;  2GXG A;  2CG4 A;  3B73 A;  4BHB A;  2BY2 A;  4A0X A;  4BDY A;  2P0W A;  5IYB J;  3WU0 A;  3S15 J;  2E5Z A;  2R4G A;  1VQ8 I;  1HXD A;  2W24 A;  4ZJZ A;  3HOX J;  3VFZ A;  3NRV A;  3E0J B;  2UZK A;  3ASO H;  2L0K A;  3BTI A;  3VWB A;  3QOD A;  3K2Z A;  2OTL I;  1YLF A;  4QLC U;  3HJE A;  2E60 A;  4IF4 A;  3JAM K;  5LLQ A;  4FE7 A;  1UMQ A;  2CV0 A;  2HTJ A;  1LPQ A;  5J8C A;  1Y0U A;  1TC3 C;  2VON A;  4ENK A;  1IUF A;  2BGC A;  3FK7 A;  3O8G A;  4RLF A;  4BQN A;  3LNQ A;  3CCR I;  4BQA A;  5J6X A;  5E18 F;  2IRF G;  3L1P A;  3I58 A;  1EA3 A;  2DFH A;  5DD4 A;  2KZG A;  2CFO A;  1YJN I;  4HX4 A;  4BAC A;  1S7O A;  3KP3 A;  5IPA A;  1Y56 A;  3I0T A;  2HFH A;  1QRY A;  3OR2 C;  4N0B A;  4C9Y A;  4J01 A;  4H0E A;  3JRE A;  3F72 A;  4LLG F;  2FBK A;  5CQE A;  2MG4 A;  1HC8 A;  2QWW A;  3QAH A;  5F6F A;  1WHU A;  4B3X A;  3N97 A;  1B9M A;  4RM3 A;  4XLE A;  2R7S A;  2PI0 A;  3BTC A;  1D1C A;  2W00 A;  2A61 A;  2JRM A;  1P92 A;  4HQM A;  5ERI A;  1NK3 P;  1WJC A;  4XN3 A;  1QHH D;  3Q9S A;  3LSH A;  1WI3 A;  3OV8 A;  3L09 A;  3EUK L;  3TOA A;  2O9L A;  3HKZ N;  1QZE A;  2HU9 A;  1RR8 C;  1TT0 A;  3K4M A;  2F2E A;  2GAU A;  2CWE A;  4HF2 A;  2GWR A;  4K2E A;  5GTH C;  2ZNZ A;  2DU9 A;  4XRS A;  1VQN I;  1DQU A;  4D7M A;  4UB6 C;  4RB2 C;  4XLA A;  2QQ8 A;  2XAU A;  1P6R A;  1MJ9 A;  1AHD P;  4PGG A;  2EIL H;  2P7C B;  2F5C A;  3AG4 H;  2I10 A;  5D4S A;  2L54 A;  1F1Z A;  3O2P E;  1AA7 A;  2XPV A;  5M5Y J;  1K61 A;  2M4K A;  2V79 A;  3DBH B;  3JRG A;  3HIF A;  3ROU A;  5JI6 A;  4KIC A;  2ESH A;  4ZYD A;  2IGO A;  3HOU J;  1NG7 A;  1MD0 A;  2H8W A;  1BBY A;  1R5G A;  2ZC2 A;  2KPM A;  3E6C C;  1XGO A;  3ZQI A;  5EDN A;  2CQQ A;  2DTR A;  2KJB A;  3OIP A;  2FBI A;  3RTR A;  3L2C A;  1IGN A;  4JOM A;  2R7Z J;  1MBF A;  4EM0 B;  1FWZ A;  4FHT A;  1Z0X A;  4BJT A;  2VKH A;  4RBO A;  4NUB A;  4M6X A;  2CW0 F;  1R71 A;  4HLY A;  1TTY A;  1FYL A;  2M87 A;  4YIF A;  3S93 A;  1XPX A;  2BE5 F;  3H9Q A;  1YRN A;  2FEZ A;  2H1K A;  2VQL A;  4XRM A;  1X19 A;  3OYA A;  2LYC A;  4XNF A;  1RZ4 A;  2L9V A;  3ABL H;  3GUD A;  3GZ5 A;  4IQ4 A;  1OCC H;  4RAF A;  1PUF A;  1R23 A;  4I0B A;  3V7S A;  2HPM A;  2JA5 J;  2ICW G;  4XM3 A;  2E2I J;  2K3F A;  2KIS A;  1ULY A;  2WB1 N;  3M1E A;  1D0Y A;  1O57 A;  5EEH A;  5TJJ A;  2BYV E;  3FM5 A;  3S1Q J;  3TO7 A;  2R0Q C;  3RSN A;  5M5W J;  3G71 I;  3IH4 A;  2O7O A;  5CKT A;  4CH7 A;  3JSO A;  1BL0 A;  2X51 A;  1KU9 A;  4EV0 A;  1I39 A;  2EZI A;  4RGR A;  2JA2 A;  4PK4 A;  1VQ6 I;  4EJV A;  5DEQ A;  2OC6 A;  1SMT A;  2KIQ A;  2E1O A;  3DTK A;  1A31 A;  4LB5 A;  1U5T C;  3Q9V A;  4L0Z B;  2Q1Z B;  1KON A;  3HHG A;  3F23 A;  3HZJ A;  4LGW A;  3L7W A;  3GWZ A;  2IEK A;  3DPT A;  1O7F A;  4JX6 A;  1CF7 A;  1J7K A;  2YX7 A;  1FY7 A;  3SHF A;  2FBH A;  4DW6 A;  4KIS A;  4EQQ A;  1YHQ I;  2V1U A;  4YFN F;  2VPR A;  2HVR A;  3K4J A;  3J7A O;  3S17 J;  2EIM H;  2VIX A;  3CJN A;  3P9I A;  4XOP A;  2WC2 A;  1U8B A;  1KZH A;  4M9X A;  2LKX A;  1QPM A;  4DYR A;  1WFX A;  4HNV A;  1LUJ B;  3HTU A;  5DDG A;  4PJN A;  3VSL A;  2DK5 A;  1OCZ H;  1AOY A;  1Z21 A;  4U88 A;  3ZN1 A;  1OCR H;  4PSX A;  3C2H A;  1XS9 A;  2HDC A;  2GBY A;  2VKV A;  1LVA A;  1DU0 A;  4ENN A;  3OSG A;  5H2F C;  2VL8 A;  3ZN0 A;  5L3F A;  1RUN A;  4KMF A;  1D8J A;  1P9Q C;  3RPU A;  5KNL A;  2QCO A;  3HG9 A;  5BNG A;  3AAF A;  2JTV A;  3RPQ A;  2P5L C;  4E70 A;  3K9T A;  5L3E A;  2R92 J;  3W2A A;  3OSF A;  2UUZ A;  2Y0S A;  2STT A;  2ME0 A;  5KAI C;  3KX2 A;  4U0Y A;  1KU2 A;  2WY8 Q;  4IX7 A;  4ENJ A;  2IBD A;  4IL6 C;  2KMU A;  3R0A A;  1OR7 C;  1FMV A;  1WJA A;  4ZYH A;  4EGY A;  5E3L A;  3Q0U A;  1GDT A;  1BR2 A;  1UHW A;  4XLC A;  4G6T B;  4IOA F;  4BS9 A;  5LEJ A;  4UV8 A;  3ZP5 A;  1MKM A;  3TMO A;  3S14 J;  2EV0 A;  2R5Z A;  3GTP J;  4S0H B;  5JVT A;  2FF4 A;  2ZJQ F;  2BVM A;  4E7L A;  1D3Y A;  4MEX F;  5FGM A;  1PP7 U;  4L9T A;  5DD8 A;  4BXF A;  2FNA A;  3GW2 A;  3M1C A;  3S2D J;  3RKW A;  3QPS A;  3UNG C;  1TL8 A;  2LKP A;  1A6Q A;  3C2G A;  1YRN B;  4C3H J;  3DU6 A;  3KP4 A;  2M4G A;  2TRT A;  1ON1 A;  4HQE A;  1J9I A;  2E1N A;  1NTC A;  1PJR A;  2LRD A;  1ZLK A;  2L7F P;  1PP8 F;  5EG0 B;  1VQK I;  3I5U A;  3HRT A;  3H0D A;  3RYR A;  2VQC A;  1YW7 A;  3SJM A;  2DMN A;  5E8I A;  2GM4 A;  3IAM 2;  1HST A;  3ZMZ A;  3OYL A;  4UUS B;  1BIA A;  2ZXJ A;  3HGY A;  2QBY B;  2OPT A;  4AC0 A;  1A5J A;  2GOX B;  3S3O A;  5IOZ A;  1SMY F;  2FA5 A;  2JJ7 A;  4BQQ A;  3C3W A;  3G2B A;  3I4M J;  4Z2Y A;  2VXD A;  4XLP F;  4LFU A;  1OYW A;  5CLS A;  2DAO A;  5C44 J;  1YO5 C;  5TGT A;  2DMU A;  4HSR A;  2F5D A;  4FTH A;  1HQC A;  2B63 J;  4N4N B;  1IRZ A;  2KIF A;  4XON A;  1CQT A;  4IOC F;  2A6H F;  4RS8 A;  3JW4 A;  1FP1 D;  5CVI A;  1YG2 A;  3E97 A;  2VE8 A;  5AIP A;  3JAM Z;  2JVG A;  2WAE A;  4CHU A;  2XPW A;  3WG7 H;  2CS3 A;  1S72 I;  2JWT A;  2C6Y A;  5AIQ A;  4MO7 A;  4XN0 A;  5LGT A;  2ISY A;  4XID A;  1FYM A;  3M8J A;  5FB2 A;  3AG1 H;  2Y9Y A;  3FM3 A;  1APL C;  3WE3 A;  1REP C;  4AYB N;  2P5V A;  4JK1 X;  2BVL A;  2PJR B;  5HOO A;  3ONQ A;  3RYP A;  1Z05 A;  3GFI A;  1HW5 A;  4M3D A;  5E1Z B;  3E6M A;  3TP3 A;  2PMZ A;  2DOF A;  3DBR B;  3BRO A;  3MFK A;  1O4X A;  5B5E C;  1B72 A;  4A3L J;  1PVE A;  1FOY A;  4X1E A;  1VQ7 I;  3GTK J;  2XRO A;  4I98 B;  4CCL A;  1H8A C;  3KP2 A;  3LAJ A;  2WAQ N;  3P7N A;  4HST A;  1TW2 A;  4R1H A;  1FT9 A;  1I1G A;  3L2V A;  4MHG A;  2XV4 S;  2O0Y A;  2M0C A;  1Z77 A;  4Q5S F;  1RET A;  3OL4 A;  1UCR A;  1BI2 A;  2DQR A;  2MLG A;  2Y75 A;  1SC7 A;  4BDZ A;  2QA4 I;  3H3U A;  3MEX A;  3L2R A;  1SVL A;  3M3Y J;  2R3S A;  3BQY A;  3WTS C;  3H35 A;  5ICC A;  3H9J A;  3LSM A;  1Y1W J;  1MBE A;  5K5R A;  1T39 A;  1K83 J;  2DFF A;  4WK8 F;  3CMM A;  1F5T A;  5IOY A;  3AFH A;  4HYE A;  3VYU B;  2HEO A;  5A2Q K;  1BJZ A;  1BR4 A;  3PO2 J;  2MA3 A;  1Z6T A;  3K7A J;  4PFO A;  3KE2 A;  1IDZ A;  1T0F A;  3TED A;  3BC8 A;  5IT9 K;  5E1X A;  2W25 A;  3JTH A;  1SFK A;  2XGC A;  3SDB A;  3VYR B;  1TNS A;  1W7P A;  2MD0 A;  2X6Y A;  2MFZ A;  2RKH A;  4G12 A;  1RR7 A;  3PNY A;  2W82 A;  2DI3 A;  4EJW A;  3TQN A;  2R7X A;  2X85 A;  4X6A J;  2EFW A;  2F4M B;  3F8C A;  5FJ8 J;  2A5Y B;  1W0T A;  3DLA A;  1IRF A;  2WAF A;  1UG2 A;  5ED4 A;  4IHT A;  1XC5 A;  5E17 F;  2NNY A;  1STZ A;  2WAQ A;  1YYV A;  4S04 A;  2BZT A;  5FFX A;  2DPU A;  2CFX A;  1IRX A;  3R6S A;  3GF2 A;  2O03 A;  5KK1 A;  4ZDO A;  3OYK A;  1ETO A;  4RB1 A;  1ZAR A;  4UV9 A;  4WWC A;  2R5Y A;  3QYB A;  4PDK A;  3BLY A;  2MAB A;  3ZQL A;  2VJJ A;  1YI2 I;  3S1R J;  2OCC H;  1B9N A;  1YS6 A;  2GOM A;  4NC8 A;  3WGI A;  2VE9 A;  1J59 A;  1FLI A;  4Q4Z F;  3RCO A;  2DYR H;  3ZMD A;  2M3A A;  3CJR B;  5EGO B;  4ZC3 A;  2NXN B;  1MJB A;  1BC7 C;  3F3X A;  2Z2S B;  2XGX A;  3GBG A;  2VJ4 A;  1JT6 A;  4BEH A;  3ZQC A;  1ZR2 A;  3KZY A;  2VKD A;  3X2Q H;  3AG3 H;  3DV8 A;  1QZZ A;  4CGZ A;  4HBL A;  3FMS A;  1BI0 A;  2Z3Y A;  2ELJ A;  3CDL A;  3K10 A;  4W97 A;  3N05 A;  4MQV A;  2PMZ N;  1FP2 A;  3FIW A;  3WTY C;  4AIK A;  4EM1 A;  3TW7 A;  4AIJ A;  2RGV A;  2LDU A;  1Z1D A;  2GZW A;  4L5I A;  3BPX A;  3MN2 A;  5B1A H;  4NQW B;  1SVO A;  3RI4 A;  2EZH A;  3ML6 A;  1TQP A;  1ZQ3 P;  1R58 A;  3EET A;  2AQF A;  3E5X A;  5BQT A;  5CPR B;  3J80 Z;  2MYS A;  3MKW B;  3K4B A;  4B44 A;  4B43 A;  5FLX Z;  1MBK A;  4ESJ A;  2G7H A;  4MTD A;  2A6T A;  2KDZ A;  2KZV A;  4OIQ F;  1F36 A;  2TCT A;  4DZP A;  4IQJ A;  3SYT A;  3NWS A;  1IXC A;  3MQ0 A;  3CTA A;  3B02 A;  4KIT B;  2ZJR F;  5LD2 C;  2X1E A;  5BPD A;  1U9N A;  1GLN A;  3DFG A;  4PJ0 C;  1YX3 A;  2R5Z B;  3MCZ A;  1XD7 A;  2HYF A;  3P5J A;  4D9J A;  4IPA A;  3VEP A;  4PUS A;  3ZOB A;  4YEL A;  3ABT A;  2LOO A;  1GV2 A;  1EKE A;  1Z7L A;  3M8F A;  5FD5 A;  3Q0V A;  5K5Q A;  3HOS A;  3BZ6 A;  1YQA A;  2ECB A;  1A6I A;  4KDP A;  2V6E A;  3AG2 H;  3R60 A;  1X3W B;  1GXP A;  1UB9 A;  1LKX A;  2EIJ H;  4B09 A;  3GTL J;  3M9A A;  3LQQ A;  1DGR M;  4U0V A;  4Y7N J;  1K6O A;  4XLN F;  4HDU A;  1W1W E;  4KYW A;  1L3L A;  2ZFU A;  2ZME C;  3TKY A;  1TWA J;  2KL4 A;  2M7A A;  1A35 A;  2X6X A;  3ZXS A;  4QIW N;  4E7K A;  2EFN A;  4HRI A;  2DYS H;  3WTT C;  1X58 A;  3KP6 A;  3I64 A;  4GYG A;  2BHY A;  3J7A Y;  4M3B A;  3F9K A;  4L5E A;  3L2U A;  2DDA A;  2Q2E A;  3IP4 B;  4P96 A;  2VBX A;  4MEY F;  2QSF X;  2L7Z A;  4UNO A;  1U6G A;  4GGG A;  1BM9 A;  5FKL A;  3H9G A;  2FOK A;  1S7A A;  2AHQ A;  2WTE A;  1XSX A;  4E7J A;  2MC4 A;  4O6J A;  4GXO A;  4CZZ A;  4XKC A;  4HAM A;  3SZP A;  3S2W A;  4BHC A;  4IHY A;  1MMG A;  2CGP A;  2MW8 A;  3HOT A;  5J8F A;  1AWC A;  2V7F A;  1SEU A;  3M4O J;  5JHF A;  1Y8Q B;  2F5F A;  3Q3S A;  2XGD A;  2BOL A;  3OS2 A;  1GUU A;  4ZTJ A;  1MBG A;  2DA7 A;  2HQN A;  2JZY A;  3RKX A;  1G3T A;  1XSV A;  3LWF A;  4OIR F;  5L3C A;  3CCY A;  2KHM A;  4Y15 A;  3I53 A;  3GFJ A;  4MTE A;  1K78 A;  1HSJ A;  1IXR C;  2RDP A;  2HOA A;  2QQ9 A;  1QZY A;  1XCB A;  2IJL A;  3JRF A;  3LSI A;  1ZRE A;  2EV6 A;  2STW A;  3H5R A;  2L3D A;  3CCE I;  2NRA C;  1ZEL A;  2A3S A;  3B6A A;  3ERM A;  3G73 A;  3GXO A;  2HI3 A;  1RC9 A;  2K86 A;  2Z16 A;  3GLL A;  4XIC A;  4ZYG A;  2XKO A;  2KIU A;  5ILV A;  2LLK A;  4J19 A;  4ZDP A;  2CH0 A;  1J75 A;  1ZRC A;  2HVQ A;  4ZDL A;  1T0F C;  2GIZ A;  4JX4 A;  3CDH A;  2ECC A;  4D5F A;  4LOC A;  3K4L A;  1O3S A;  4XRS G;  5HDK A;  3I55 I;  5HNF A;  2HQR A;  1OKR A;  3H5N A;  5ICE A;  3DU5 A;  4A3C J;  4HZF A;  1BJA A;  1OIS A;  2IGK A;  1MIJ A;  3DEW A;  1OFC X;  2HPI A;  4IRH A;  2M8E A;  4WXC A;  3GTO J;  2JSP A;  4MFE A;  3PO3 J;  2KKO A;  2M0M A;  1MMA A;  5CVR A;  2IGM A;  2Y30 A;  3T8T A;  3HRU A;  1MMN A;  4A5N A;  3A2K A;  1SAU A;  2JQ7 A;  4M9Z A;  4RDU A;  3GZ6 A;  1LEB A;  4CUG A;  1XGS A;  2PFB A;  3BJA A;  4NC6 A;  1EH7 A;  3S3M A;  2GIV A;  2QQB A;  4LG0 A;  4CZC A;  2H6B A;  2V1D A;  2OD5 A;  2Y0S N;  3UKG A;  1RKT A;  5M5X J;  5H6R A;  4IHS A;  2MLK A;  4NQW A;  3LOC A;  4YII A;  1X1C A;  2FOW A;  3V4G A;  5IP7 J;  5GAE J;  1KQ0 A;  4A3I J;  4A3E J;  1XCV A;  1QVU A;  3W6V A;  2M7B A;  3BCA A;  1BI3 A;  2F5E A;  2HYG D;  2QLZ A;  1I50 J;  3H92 A;  2R7D A;  2DOE A;  4G7H F;  2RV8 A;  2LR8 A;  3LA3 A;  2XAQ A;  4Q47 A;  1QQI A;  3IAS 2;  1FX7 A;  3OR1 C;  2WBM A;  1F4K A;  2VC1 A;  2WY7 Q;  2K9L A;  1W7P D;  2PLY A;  1B72 B;  1KU3 A;  4NBQ A;  4WF2 A;  4ZYA A;  2YPR A;  1JTY A;  1Z91 A;  2OBP A;  4UXN A;  3HEF A;  1KQ9 A;  5LHI A;  1NG6 A;  5EZH A;  3BTJ A;  2K4B A;  3ZRG A;  2YS9 A;  3PIP F;  1MSF C;  3HHH A;  5K7F A;  3HC7 A;  4CCK A;  2CQ7 A;  1U3E M;  9ANT A;  1W4M A;  2LMD A;  2EA2 A;  2OZ6 A;  3JRA A;  1B1B A;  3E5U A;  3G1O A;  1TW3 A;  3D5S C;  1C0W A;  2X6O A;  2DXI A;  1U0J A;  4HF1 A;  1BR1 A;  2XAF A;  4EEF G;  2IS2 A;  3WTU C;  2XF5 A;  4A0Z A;  1S7E A;  4M71 A;  4CXF A;  1S5L C;  1JGS A;  2G0E A;  5F04 A;  3PUB A;  1LDD A;  3DEE A;  4YIR X;  2NYX A;  3U1K A;  1VQL I;  2DTZ A;  2N8G A;  2HGC A;  2VOD A;  2F4I A;  2HDD A;  1OCO H;  2ZKZ A;  1GT0 C;  4E7H A;  4GDF A;  5J40 A;  3MAJ A;  1E3P A;  2B7E A;  2HZT A;  3CUQ C;  1KGS A;  5HLT A;  1J5Y A;  2NVU B;  2V6C A;  4XSX F;  3DP7 A;  3TGN A;  4AWX B;  2CV1 A;  4DBQ A;  2D5V A;  1WH5 A;  1EH8 A;  5H6Q A;  2XRN A;  3OIO A;  3HL2 A;  1WJE A;  3UR3 C;  3J7Y J;  3KP7 A;  3DEU A;  2EWN A;  3K69 A;  1D0Z A;  2CUE A;  2HNH A;  2M1B A;  2V9K A;  4IHX A;  1RNL A;  2IAI A;  2O8X A;  1H88 C;  2AS5 F;  2CJJ A;  2R7O A;  3S1N J;  4BAY A;  1JKQ C;  2FD5 A;  1R5I D;  5F1R A;  2O5R A;  1MW7 A;  1B8I B;  3OYJ A;  1ZRF A;  4RA2 A;  3W2W A;  1WJB A;  3KEQ A;  4CA0 A;  3MWM A;  3HSE A;  2PJP A;  3KFW X;  4LIT A;  5DUK A;  4EGZ A;  3JRB A;  3OOP A;  2QEX I;  2L7K A;  1MBH A;  2LKS A;  2M2E A;  3FXU A;  3GTM J;  5DUI A;  4R79 A;  1MH3 A;  4EM2 A;  4ETS A;  1XDU A;  4EVI A;  1VQ4 I;  2E2J J;  5HS8 A;  3WU1 B;  2CU7 A;  1YIO A;  3O3K A;  2VB6 A;  4XQF A;  2GQQ A;  4A3F J;  2LBF B;  2XPU A;  2R7U A;  1SFX A;  1GVJ A;  1ZGA A;  3ZQQ A;  4D1Q A;  3WTX C;  2YSR A;  1TNT A;  5D6F A;  2MGQ A;  5A2Q Z;  5LHH A;  3A01 B;  5DTD A;  2EIN H;  2CYY A;  3VYS B;  1K78 B;  3HOY J;  1YJ9 I;  2O6G E;  1BI1 A;  2G7U A;  1SD7 A;  1BW6 A;  1S29 A;  4G94 A;  2JK3 A;  1Z6R A;  4OIP F;  3ZMV A;  4QPO A;  3H3Z A;  3OYE A;  4PSW A;  3KIO A;  4FX0 A;  1R22 A;  2E1C A;  1TT5 B;  3W6J B;  1JI8 A;  1O3R A;  4F7Z A;  4BEH B;  3K4N A;  3RKY A;  3FF5 A;  4M3G A;  2WA0 A;  1BN5 A;  4M9S A;  4N9I A;  4AM3 A;  3ESW B;  4G7Z F;  4MFD A;  1E0E A;  3F6V A;  1PUE E;  2KRC A;  3VPR A;  5GAG J;  6PAX A; 
#chains in the Genus database with same CATH homology
 2W57 A;  4RGU A;  3ELK A;  4WXD A;  1U2W A;  2Z99 A;  3GFL A;  3ECO A;  1FBU A;  2ZME B;  2V9V A;  1V3F A;  2KJC A;  2RC4 A;  3ZMU A;  3CO7 C;  5DCM A;  4KA4 A;  3DXJ F;  3QOP A;  1WRJ A;  1H9G A;  3EYI A;  4HLX A;  4I7H A;  4KMU X;  1Q1H A;  3CUO A;  3CUQ A;  4S05 A;  2LSO A;  3I59 A;  4DQ2 A;  2FU4 A;  2RVC A;  1IN5 A;  4ON0 A;  1FBS A;  4YFX F;  2HKX A;  4FX4 A;  1ZG3 A;  2VT2 A;  1SD5 A;  4IRI A;  2V1X A;  1V4R A;  2VBZ A;  1X3U A;  4LK1 F;  4Y13 A;  5LGN A;  3SFZ A;  3QP6 A;  2CQK A;  2XAG A;  5JFR A;  4P5O A;  1NHA A;  4M6Y A;  5L3D A;  3ZMS A;  1YW9 A;  1HBX G;  1U5T B;  3E5Q A;  2DFI A;  3IWZ A;  1SFE A;  3DQV C;  1SD4 A;  2DQL A;  2HR3 A;  4ZH4 F;  3MZH A;  3E6B A;  4G8X A;  4LK0 F;  2VXZ A;  3HRS A;  2P4W A;  3RDI A;  4AVP A;  1IN7 A;  1I27 A;  2JPB A;  3TDZ C;  4HF0 A;  3LAP A;  4L9V A;  2D1V A;  3TO9 A;  1UFM A;  2D45 A;  1ZLJ A;  2O61 A;  5D4R A;  1R1T A;  2M5W A;  5LBQ A;  1O7L A;  2J5P A;  1YW8 A;  4LG0 B;  4LB6 B;  1RIO H;  4EJT A;  1VTN C;  2ADU A;  2OZU A;  1E2X A;  4IVN A;  1LDJ A;  1KYZ A;  1U8R A;  4P55 A;  4G6D A;  2XHK A;  1O3Q A;  4MNU A;  2JRT A;  3KLN A;  3COA C;  1ZN2 A;  4OOI A;  4PZJ A;  2OA4 A;  4U7D A;  1L0O C;  4M74 A;  3SQN A;  1A04 A;  2NAZ A;  2PEX A;  2XAS A;  3GLX A;  1B4A A;  4AIH A;  4RB0 A;  4ZYE A;  2GXB A;  3C1D A;  3M7G A;  4ZZD A;  1KYW A;  5D8K B;  5ILS A;  1QGP A;  2E7X A;  1D8K A;  4KUM A;  1ZAO A;  2RQP A;  1XGM A;  3K1P A;  1SFU A;  1IN6 A;  5BMZ A;  1P2F A;  1P4X A;  1P4A A;  2FRH A;  4O3M A;  2H94 A;  3IWF A;  2CO5 A;  1R36 A;  2M30 A;  1U78 A;  2P6S A;  3D0S A;  1XGN A;  4P9F A;  2DPD A;  1IN4 A;  4HX8 A;  1ODD A;  3V8K A;  1HW2 A;  2HS5 A;  2ELH A;  4BXU A;  5LGU A;  2Q8K A;  4WCG A;  2JPC A;  1G6N A;  3L9F A;  1FOK A;  2XAH A;  3ABU A;  4KIB A;  2XAJ A;  2ZO4 A;  3IHU A;  1FNN A;  4CDG A;  2FE3 A;  4L0Y B;  3EUH A;  2P8T A;  1WSU A;  1UST A;  1XN7 A;  1OMI A;  5D5V B;  2HTS A;  5LRR A;  4HOB A;  1JXS A;  4A6D A;  1FSH A;  4A12 A;  4I02 A;  5FO5 A;  1G3S A;  2ZME A;  1ON2 A;  2QUF A;  1R1V A;  3QPT A;  4XRF A;  4CIC A;  3K1N A;  5CYV A;  4I01 A;  5DV5 A;  5ICG A;  2AXL A;  2GA2 A;  4EMS A;  2GA1 A;  1KQ8 A;  1XMA A;  3EQL F;  3DKW A;  1WWX A;  2DK8 A;  2M45 A;  1ZG1 A;  3NQO A;  2UXN A;  1LB2 A;  5HLI A;  1TQM A;  2FML A;  3R4K A;  4KFC A;  2PG4 A;  2H27 A;  2J5O A;  3T5X A;  2VT3 A;  3R0J A;  1DPR A;  4O5V A;  3HSR A;  1KU7 A;  2EJR A;  5ILU A;  1S8N A;  2E7W A;  2A69 F;  4OMY A;  3WGG A;  4UVC A;  3ECH A;  3U2R A;  3SXY A;  2DLL A;  3EDP A;  1HKQ A;  2ISZ A;  3GX4 X;  1RI7 A;  2EV5 A;  5LHG A;  4UUV A;  2KIM A;  2L4M A;  3IKT A;  2W85 A;  3F8N A;  2RNJ A;  2BEO A;  1LDK B;  3KLO A;  4MQ9 F;  5DYM A;  1G3Y A;  2EFO A;  3ZPL A;  3WE2 A;  4JBA A;  3ISP A;  1BC8 C;  1JHH A;  2ZJ2 A;  3GEZ A;  4LJZ F;  3BWG A;  1T38 A;  2HWV A;  3BOQ A;  1IXS B;  2K4J A;  3E3V A;  3PQK A;  5AON A;  2OQG A;  1YS7 A;  3F8F A;  1MDM A;  4G7O F;  4UVB A;  4Y17 A;  3MZY A;  2UWM A;  1K7A A;  5JHU A;  2PMU A;  4B8X A;  3FWE A;  2B0L A;  2LNB A;  1LJ9 A;  3WGH A;  1XDS A;  2L4A A;  3E6D A;  1B59 A;  1DUX C;  3GVA A;  4I0A A;  2QQA A;  1IW7 F;  2Q0O A;  4L9N A;  4CO8 A;  4YG2 F;  4WXH A;  1T6S A;  3VOD A;  3HRM A;  1MGT A;  3W6K B;  1W7P B;  1FYK A;  1OYY A;  2Z9O A;  5E8G A;  1QO0 D;  5ICF A;  1I5Z A;  1LQ1 A;  2BBY A;  5EEG A;  4DNC A;  1CGP A;  3M8E A;  2TDX A;  2DBB A;  4ESB A;  4PCQ A;  3HTS B;  3V7C A;  4ENM A;  1ZH5 A;  1ZGJ A;  1H0M A;  2XKP A;  1B6A A;  5K5O A;  1J2X A;  1TLH B;  3PFI A;  3F6O A;  1GXQ A;  2ZBK A;  1K79 A;  2NNN A;  1U5T A;  4ASN A;  2MH2 A;  2IP2 A;  2QZ8 A;  5BS6 A;  3TO6 A;  4L5J A;  1ZYR F;  1T98 A;  4KT5 C;  2FMY A;  3FZV A;  2VOP A;  4HX7 A;  2MD5 A;  1D5V A;  3IKV A;  1FZP B;  1IN8 A;  2NS0 A;  5HDG A;  1ZRD A;  2XUB A;  5LRS A;  1FPQ A;  2DT5 A;  3FMR A;  3BY6 A;  3P9C A;  3KP5 A;  4ZZL A;  2P6T A;  3C18 A;  1IF1 A;  2A68 F;  3T8R A;  4JQF A;  2IPQ X;  2PN6 A;  1IRG A;  2R7F A;  2Z5U A;  3GYH X;  1DP7 P;  3J80 K;  2H09 A;  1WQ2 A;  1XMK A;  3J81 Z;  2DW4 A;  2IA0 A;  1UHM A;  5IT9 Z;  4L18 B;  4OIN F;  4HDV A;  3WTZ A;  3REO A;  5LEK A;  1DDN A;  2QBY A;  2PQ8 A;  3FMQ A;  2ZFW A;  3FXQ A;  3IRR A;  2D2W A;  3QP5 A;  2RN7 A;  4R8H A;  5E1W A;  2YX4 A;  5JR3 A;  2X4H A;  4NB5 A;  1Z9C A;  1R5H A;  1YTY A;  5BOX A;  1PDN C;  1EH6 A;  2WWY A;  4KN4 X;  2EFQ A;  1R7J A;  4OU0 A;  2YU3 A;  3F21 A;  3DF8 A;  4FT8 A;  2WV0 A;  5HS7 A;  4IRG A;  4RGX A;  3T1B A;  1ZG5 A;  3K1M A;  4AD9 A;  2IA2 A;  2VOO A;  5D5W B;  2HKO A;  2K02 A;  3RIR A;  2EK5 A;  1QNT A;  1FSE A;  1OYI A;  5L3B A;  4XBF A;  1YFH A;  3F22 A;  4UHT A;  3IL2 A;  3F8B A;  3KEO A;  3RJP A;  3SZT A;  1P4W A;  5D5X B;  4XSZ F;  2A07 F;  5FLX K;  1WKM A;  3FXR A;  4BNC A;  1SD6 A;  4PGH A;  1XB4 A;  2Z33 A;  3TOB A;  3U1D A;  3VOE A;  3EYY A;  3IC7 A;  1BOA A;  4RAZ A;  4D0P A;  2QM3 A;  4CYD A;  1WI9 A;  4EJO A;  4RB3 C;  3V7R A;  1QBJ A;  2L01 A;  3CLO A;  4BYY A;  3TDU C;  2ACJ A;  2QVO A;  5F64 A;  5DCM B;  2PMH A;  4HV6 A;  3LA2 A;  1SAX A;  3FHZ A;  4UVA A;  3LST A;  2FQ3 A;  1I6X A;  2DO7 A;  2K27 A;  2MC3 A;  3PQJ A;  1IUY A;  1TQI A;  3QRF F;  1W5S A;  2KRF A;  3HSF A;  1MDM B;  2OQR A;  2IT0 A;  5DCF A;  1ONV A;  3V8J A;  4KNY A;  1J0R A;  5CVU A;  3G3Z A;  3WTV C;  2HOE A;  2P7V B;  2CSO A;  2Y0M A;  3J81 K;  5HLG A;  3HUG A;  2K7L A;  1F9N A;  4M72 A;  1S3J A;  2PBI A;  1FBQ A;  3ZMT A;  1S6L A;  3NEU A;  3P9K A;  1G3W A;  2H6C A;  4HA8 A;  4A5M A;  1JHF A;  2YR2 A;  4A6E A;  3L00 A;  2QEN A;  1OPC A;  2EA4 A;  5KVR A;  4MGR A;  4RGS A;  1GHC A;  4QWQ A;  4A0Y A;  1R00 A;  2X0L A;  1R1U A;  3DPL C;  3VB2 A;  3R61 A;  2COM A;  3LFK A;  3N4M A;  2XIG A;  2MBF A;  4G6Q A;  5TRD A;  3BJ6 A;  5IT3 A;  3LQR A;  3GFM A;  3QU3 A;  3V8L A;  2ETH A;  1MJA A;  1FC3 A;  2Y48 A;  5H20 A;  1LNW A;  1O3T A;  1TBX A;  2D1H A;  4GO1 A;  4G9Y A;  2ESN A;  5D8L B;  2IVM A;  1KA8 A;  4IJA A;  1BIB A;  1IAW A;  2FNP A;  4TV7 A;  3GO5 A;  4M73 A;  4U7B A;  2UXX A;  5D5U B;  1I1S A;  1USS A;  4ESF A;  4GYI A;  3CUQ B;  4IXA A;  1CF7 B;  1G4D A;  3O6B B;  3ERE D;  4LD5 A;  1ZHF A;  4YFK F;  2JSC A;  4A2U A;  2EFP A;  4KN7 X;  2MH9 A;  3CO6 C;  3BJO A;  5HLH A;  5E20 A;  4HV5 A;  5CJ9 A;  4NHJ A;  1XSD A;  2VN2 A;  2ZNY A;  1JE8 A;  2JT1 A;  3U9G A;  4LLL A;  1HW1 A;  3BPV A;  4KIG A;  5CVJ A;  2LF7 A;  3WTW C;  2ZCW A;  2G9W A;  3QPH A;  3I59 B;  3KZZ A;  1IZ1 A;  2O3F A;  3BP8 A;  2OU2 A;  3WG9 A;  3IRQ A;  5CVV A;  4LMY A;  3QU6 A;  2L02 A;  2P5K A;  4N9H A;  2FSW A;  2LF8 A;  3F8M A;  5FD6 A;  5L3G A;  2FXA A;  3ZQ7 A;  1HKS A;  5D6E A;  1HKT A;  2VC0 A;  5HS9 A;  1E17 A;  3LA7 A;  1T2K A;  3JTG A;  1EV7 A;  3KET A;  1H9T A;  3D5L A;  3BDD A;  3I4P A;  3I54 A;  4P9U A;  4U0W A;  2EB7 A;  3KCC A;  3HYI A;  2VBY A;  1OR7 A;  2QYO A;  1DPU A;  2XVC A;  3WOD F;  2IA1 A;  4Q48 A;  4OIO F;  3T0Y A;  3JSP A;  1W5T A;  1RUO A;  4EJU A;  5BPI A;  5K1Y A;  4KIF A;  2A6E F;  1MZB A;  2W84 A;  3FX3 A;  1Z7U A;  5FFZ A;  3Q5F A;  3C7J A;  3I71 A;  4WX9 A;  5HDN A;  5HVQ C;  3K0L A;  2BV6 A;  4L9J A;  4RAY A;  4BH9 A;  4I2O A;  1LEA A;  4I09 A;  4HW0 A;  4OMZ A;  2IW5 A;  4BHP A;  2VBW A;  4GCV A;  3ULQ B;  4LLN A;  2OAZ A;  2GXG A;  2CG4 A;  3B73 A;  4BHB A;  4A0X A;  3WU0 A;  1HXD A;  2W24 A;  3VFZ A;  3NRV A;  2UZK A;  3K2Z A;  1YLF A;  4QLC U;  4IF4 A;  3JAM K;  5LLQ A;  2HTJ A;  5J8C A;  1Y0U A;  2VON A;  4ENK A;  2BGC A;  4BQA A;  5J6X A;  5E18 F;  2IRF G;  3I58 A;  5DD4 A;  4HX4 A;  1S7O A;  3KP3 A;  3I0T A;  2HFH A;  4N0B A;  4H0E A;  3F72 A;  4LLG F;  2FBK A;  2QWW A;  3QAH A;  5F6F A;  3N97 A;  1B9M A;  2PI0 A;  2A61 A;  1P92 A;  4HQM A;  5ERI A;  3Q9S A;  3OV8 A;  3L09 A;  3TOA A;  2F2E A;  2GAU A;  2CWE A;  4HF2 A;  2GWR A;  4K2E A;  2ZNZ A;  2DU9 A;  4RB2 C;  1P6R A;  1MJ9 A;  4PGG A;  2P7C B;  2F5C A;  5D4S A;  2L54 A;  1F1Z A;  3O2P E;  2V79 A;  3HIF A;  3ROU A;  5JI6 A;  4KIC A;  2ESH A;  4ZYD A;  1MD0 A;  1BBY A;  1R5G A;  3E6C C;  1XGO A;  2DTR A;  2KJB A;  3RTR A;  2FBI A;  3L2C A;  4EM0 B;  1FWZ A;  4FHT A;  4M6X A;  2CW0 F;  4HLY A;  1TTY A;  1FYL A;  2M87 A;  4YIF A;  2BE5 F;  2FEZ A;  1RZ4 A;  3GUD A;  3GZ5 A;  1R23 A;  4I0B A;  3V7S A;  1ULY A;  3M1E A;  5TJJ A;  1O57 A;  5EEH A;  2BYV E;  3FM5 A;  3TO7 A;  3JSO A;  1KU9 A;  4EV0 A;  4RGR A;  4EJV A;  5DEQ A;  1SMT A;  4LB5 A;  1U5T C;  3Q9V A;  4L0Z B;  3HHG A;  3F23 A;  4LGW A;  3L7W A;  3GWZ A;  3DPT A;  1O7F A;  1CF7 A;  1J7K A;  1FY7 A;  2YX7 A;  3SHF A;  2FBH A;  4EQQ A;  2V1U A;  4YFN F;  3J7A O;  3CJN A;  3P9I A;  2WC2 A;  4M9X A;  1QPM A;  3HTU A;  5DDG A;  2DK5 A;  1AOY A;  4U88 A;  3ZN1 A;  2HDC A;  1LVA A;  4ENN A;  3ZN0 A;  1RUN A;  5L3F A;  4KMF A;  1D8J A;  3RPU A;  3AAF A;  2JTV A;  3RPQ A;  2P5L C;  4E70 A;  3K9T A;  5L3E A;  2STT A;  4U0Y A;  1KU2 A;  4ENJ A;  3R0A A;  4ZYH A;  4EGY A;  1UHW A;  5LEJ A;  4UV8 A;  3ZP5 A;  1MKM A;  2EV0 A;  5JVT A;  2FF4 A;  1D3Y A;  4MEX F;  5FGM A;  1PP7 U;  4L9T A;  5DD8 A;  2FNA A;  3GW2 A;  3RKW A;  2LKP A;  3KP4 A;  1ON1 A;  1J9I A;  4HQE A;  2E1N A;  1ZLK A;  1PP8 F;  3I5U A;  3HRT A;  3RYR A;  1YW7 A;  5E8I A;  1HST A;  3ZMZ A;  1BIA A;  2ZXJ A;  2QBY B;  1SMY F;  2FA5 A;  3C3W A;  4Z2Y A;  4XLP F;  4LFU A;  1OYW A;  5CLS A;  2DAO A;  1YO5 C;  2F5D A;  1HQC A;  2KIF A;  2A6H F;  4RS8 A;  3JW4 A;  1FP1 D;  5CVI A;  1YG2 A;  3E97 A;  2VE8 A;  5AIP A;  3JAM Z;  4CHU A;  2C6Y A;  5AIQ A;  5LGT A;  2ISY A;  1FYM A;  5FB2 A;  3FM3 A;  1REP C;  3WE3 A;  2P5V A;  4JK1 X;  5HOO A;  3RYP A;  1Z05 A;  3GFI A;  1HW5 A;  5E1Z B;  3E6M A;  3BRO A;  3MFK A;  2XRO A;  4I98 B;  3KP2 A;  3LAJ A;  3P7N A;  1TW2 A;  4R1H A;  1FT9 A;  1I1G A;  4MHG A;  2XV4 S;  2O0Y A;  4Q5S F;  1UCR A;  1BI2 A;  2DQR A;  2MLG A;  2Y75 A;  3H3U A;  3MEX A;  2R3S A;  3WTS C;  5ICC A;  5K5R A;  1T39 A;  4WK8 F;  1F5T A;  4HYE A;  2HEO A;  5A2Q K;  2MA3 A;  1Z6T A;  3KE2 A;  1T0F A;  5IT9 K;  5E1X A;  2W25 A;  3JTH A;  1TNS A;  1W7P A;  2RKH A;  2DI3 A;  4EJW A;  3TQN A;  2EFW A;  3F8C A;  2A5Y B;  1IRF A;  5ED4 A;  4IHT A;  5E17 F;  2NNY A;  1STZ A;  1YYV A;  4S04 A;  5FFX A;  2DPU A;  2CFX A;  3R6S A;  3GF2 A;  2O03 A;  5KK1 A;  4RB1 A;  1ZAR A;  4UV9 A;  4WWC A;  4PDK A;  1J59 A;  2VE9 A;  1B9N A;  1YS6 A;  3WGI A;  1FLI A;  4Q4Z F;  3ZMD A;  1MJB A;  1BC7 C;  3F3X A;  2XGX A;  3KZY A;  3DV8 A;  1QZZ A;  4CGZ A;  4HBL A;  1BI0 A;  2Z3Y A;  3FMS A;  4MQV A;  1FP2 A;  3WTY C;  4AIK A;  4EM1 A;  4AIJ A;  2RGV A;  2LDU A;  1Z1D A;  2GZW A;  4L5I A;  3BPX A;  3RI4 A;  3ML6 A;  1TQP A;  1R58 A;  3EET A;  3E5X A;  5BQT A;  3J80 Z;  5FLX Z;  4ESJ A;  2G7H A;  4MTD A;  4OIQ F;  1IXC A;  3MQ0 A;  3CTA A;  3B02 A;  5BPD A;  3DFG A;  3MCZ A;  1XD7 A;  2HYF A;  4IPA A;  3VEP A;  3ABT A;  3M8F A;  5FD5 A;  5K5Q A;  3HOS A;  3BZ6 A;  1YQA A;  4KDP A;  3R60 A;  1GXP A;  1UB9 A;  4B09 A;  3M9A A;  3LQQ A;  4U0V A;  1K6O A;  4XLN F;  4HDU A;  4KYW A;  1L3L A;  3TKY A;  2EFN A;  3WTT C;  3KP6 A;  3I64 A;  4GYG A;  2Q2E A;  4P96 A;  2VBX A;  4MEY F;  4UNO A;  1U6G A;  4GGG A;  1BM9 A;  2FOK A;  1S7A A;  2WTE A;  1XSX A;  4O6J A;  4GXO A;  4CZZ A;  4HAM A;  3SZP A;  3S2W A;  4BHC A;  2CGP A;  3HOT A;  5J8F A;  1AWC A;  2F5F A;  2HQN A;  2JZY A;  3RKX A;  1G3T A;  1XSV A;  3LWF A;  4OIR F;  5L3C A;  4Y15 A;  3I53 A;  3GFJ A;  4MTE A;  1K78 A;  1HSJ A;  1IXR C;  2RDP A;  2QQ9 A;  1QZY A;  1XCB A;  2IJL A;  1ZRE A;  2EV6 A;  2STW A;  2L3D A;  2NRA C;  2A3S A;  3G73 A;  3GXO A;  2K86 A;  4ZYG A;  2XKO A;  2KIU A;  5ILV A;  1J75 A;  1ZRC A;  3CDH A;  1O3S A;  5HDK A;  2HQR A;  1OKR A;  5ICE A;  4HZF A;  1BJA A;  4IRH A;  2M8E A;  4WXC A;  2KKO A;  5CVR A;  3T8T A;  3HRU A;  4A5N A;  4M9Z A;  3GZ6 A;  1LEB A;  1XGS A;  2PFB A;  3BJA A;  1EH7 A;  2GIV A;  2QQB A;  4LG0 A;  2H6B A;  2V1D A;  2OD5 A;  5H6R A;  4IHS A;  2MLK A;  4NQW A;  4YII A;  3V4G A;  1KQ0 A;  1XCV A;  1BI3 A;  2F5E A;  2HYG D;  2QLZ A;  3H92 A;  2R7D A;  4G7H F;  2RV8 A;  3LA3 A;  2XAQ A;  4Q47 A;  1QQI A;  1FX7 A;  1F4K A;  2VC1 A;  1W7P D;  2PLY A;  1KU3 A;  4WF2 A;  2YPR A;  1Z91 A;  2OBP A;  4UXN A;  1KQ9 A;  5LHI A;  2K4B A;  3HHH A;  1U3E M;  1W4M A;  2EA2 A;  2OZ6 A;  1B1B A;  3E5U A;  1TW3 A;  1C0W A;  4HF1 A;  2XAF A;  3WTU C;  4A0Z A;  4M71 A;  4CXF A;  1JGS A;  1LDD A;  2VOD A;  2NYX A;  2HGC A;  2ZKZ A;  3MAJ A;  3CUQ C;  2HZT A;  1KGS A;  1J5Y A;  2V6C A;  4XSX F;  3DP7 A;  3TGN A;  4AWX B;  1EH8 A;  5H6Q A;  2XRN A;  3KP7 A;  3DEU A;  2EWN A;  3K69 A;  2M1B A;  1RNL A;  2O8X A;  2AS5 F;  4BAY A;  5F1R A;  1ZRF A;  3KEQ A;  3MWM A;  3HSE A;  2PJP A;  3KFW X;  5DUK A;  4EGZ A;  3OOP A;  3FXU A;  5DUI A;  4R79 A;  4EM2 A;  4ETS A;  1XDU A;  4EVI A;  5HS8 A;  3WU1 B;  1YIO A;  3O3K A;  2GQQ A;  1SFX A;  1GVJ A;  1ZGA A;  3WTX C;  2YSR A;  1TNT A;  5D6F A;  5A2Q Z;  5LHH A;  1K78 B;  2CYY A;  2O6G E;  1BI1 A;  2G7U A;  1SD7 A;  1S29 A;  4G94 A;  1Z6R A;  4OIP F;  3ZMV A;  3H3Z A;  4FX0 A;  1R22 A;  2E1C A;  3W6J B;  1O3R A;  4F7Z A;  3RKY A;  3FF5 A;  1BN5 A;  4M9S A;  4N9I A;  4G7Z F;  3F6V A;  1PUE E;  6PAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...