4L9TA

Crystal structure of mepr f27l mutant from multidrug resistant s. aureus clinical isolate
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
140
structure length
140
Chain Sequence
MEFTYSYLFRMISHEMKQKADQKLEQLDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MepR
publication title The molecular mechanisms of allosteric mutations impairing MepR repressor function in multidrug-resistant strains of Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 54
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4l9tA00
1T98A 4IPAA 2DW4A 1TQMA 1YLFA 2LF8A 4EM2A 3WGGA 4MQ9F 3QP6A 4JBAA 5D6EA 3V7CA 1YW7A 4HF2A 4KICA 5JR3A 2FBHA 4P96A 2OBPA 3Q9SA 1BIAA 3L9FA 4A5NA 2D45A 3TOBA 2EFQA 1U3EM 2L02A 4AWXB 1YW8A 1IN5A 5H6RA 1D8JA 5DCFA 2Z5UA 4WXHA 3GYHX 5FFZA 2HWVA 2FQ3A 4I0BA 2Z33A 2QM3A 5HDKA 2L01A 1R1TA 1XSDA 1L3LA 2KRFA 5JHUA 2EFOA 2JPCA 4LLNA 3CJNA 5E8IA 2QQBA 2ZBKA 1KU3A 3JSOA 4XSZF 1R58A 4LG0A 1SFEA 2FBKA 4ZYEA 3VODA 2NYXA 3WGHA 2OQGA 5LBQA 3J80K 4Z2YA 4LG0B 4PDKA 4DNCA 3H92A 3ML6A 1X3UA 4OIPF 1BN5A 4EJOA 1IN8A 3D5LA 3ZPLA 3HOSA 4A0XA 5HDNA 1P2FA 5FFXA 1S7AA 4ESFA 3CTAA 2IVMA 1ZH5A 2NS0A 2QWWA 2QLZA 1XCVA 1T0FA 1W5TA 4TV7A 5ICGA 3IWZA 2ZNZA 3R61A 1HKSA 3KP4A 2RC4A 4HA8A 3RTRA 3DF8A 2F2EA 1Y0UA 3J81Z 2EV0A 2MLKA 1SMYF 4EJUA 4GYIA 2GWRA 1TLHB 2JSCA 2WWYA 3G73A 3I54A 1YFHA 2ISYA 4GO1A 3O6BB 2IW5A 3ABUA 2OU2A 2W24A 5H20A 5JVTA 4BQAA 1QZZA 3U1DA 1VTNC 3EDPA 2HYGD 3ECOA 2BEOA 4DQ2A 4L5IA 1XSVA 4EMSA 2M45A 4BH9A 3EQLF 4M6XA 4ENMA 1O3QA 1LDDA 4PCQA 1DDNA 3QOPA 2FNAA 1SD6A 1ZLJA 3CDHA 3W6JB 4BHPA 4UV9A 1F1ZA 3REOA 1FT9A 5EEGA 1B1BA 4LLLA 5HDGA 4IF4A 1XMKA 2VOPA 2ZJ2A 3B02A 3HIFA 1ZAOA 1XDUA 1O7LA 4U0WA 1P92A 3K9TA 5HLHA 2A6HF 4BHBA 5DDGA 2DQLA 4EJTA 2RDPA 3NRVA 2O61A 3DV8A 5LHIA 2H09A 2VC1A 4HOBA 2PEXA 2C6YA 3GF2A 1FBSA 2J5PA 3FMRA 2HQNA 2STTA 2HKOA 3RIRA 1YYVA 1I27A 1UHWA 5J6XA 3HRUA 4RGSA 4LK0F 3WTYC 5HLGA 1L0OC 4WF2A 2BYVE 2DPDA 3I0TA 3HHHA 1IUYA 4A2UA 2Z3YA 1WWXA 4P55A 1T6SA 2M1BA 3LQRA 4LLGF 4MEYF 4ESJA 2MH2A 5A2QK 1YS7A 4QLCU 3ZMTA 1KQ0A 5ICCA 5F1RA 1DPUA 3FXQA 4RB3C 1IZ1A 2ZXJA 1BIBA 3HHGA 1YG2A 1U5TB 1FOKA 1S3JA 1IN7A 3EYYA 4EV0A 4ZZLA 2EFPA 3ZMZA 1S6LA 1RUNA 1R23A 1YW9A 4L9VA 5E1WA 2LSOA 4L0ZB 1G3TA 1BC8C 1XGNA 3F72A 1OMIA 3GXOA 4L18B 5L3DA 1LEAA 2R7FA 4G9YA 3FXRA 2JZYA 3PQJA 3K2ZA 4WX9A 2R7DA 4G7OF 3ZP5A 4UXNA 4XBFA 2HR3A 2F5DA 3OOPA 2RV8A 5D6FA 5E18F 2F5FA 2DU9A 1IN4A 4XRFA 4U0VA 1U78A 1FYLA 4GYGA 2FXAA 2ACJA 3GFMA 4HX7A 1G3YA 2MLGA 1HKTA 4OMZA 4OMYA 2DBBA 4YG2F 2DK5A 3LWFA 5K5QA 5LHHA 3Q9VA 1FBUA 4CICA 4HV5A 1TNTA 3MZYA 2W84A 3GZ6A 3DPTA 3SXYA 3GEZA 5ILSA 4GXOA 4ETSA 3TO9A 3KP5A 1FSHA 1Z9CA 2K4JA 2Q2EA 4B8XA 4YIIA 1MJAA 2YX4A 3SZPA 2QUFA 2H6CA 5LGUA 4RB2C 1LVAA 2K7LA 2VE8A 5CVJA 5BPDA 4CZZA 2EFNA 2XAGA 3AAFA 1TQIA 5CVRA 3HYIA 1K79A 3N4MA 3TKYA 3IC7A 1HW1A 2O0YA 5L3CA 3F8FA 2QENA 2DPUA 1USTA 4K2EA 2H94A 3GFIA 4A6DA 2EA4A 3J81K 4HF1A 4A12A 1QO0D 1XSXA 2V6CA 3SHFA 2ETHA 5ILVA 2V1DA 3ISPA 2ZNYA 2MC3A 4AIJA 3JAMZ 1UCRA 2P8TA 2HKXA 2K27A 2XASA 1FX7A 4G94A 1AWCA 5IT3A 1S7OA 5DEQA 4ON0A 3GLXA 3DXJF 3BJ6A 1PP8F 4YFNF 2EV5A 2PG4A 4LK1F 5D4RA 2CWEA 1U5TC 3EYIA 3F21A 3N97A 3EUHA 2RQPA 2DO7A 3I71A 5H6QA 1HKQA 3RPUA 1P6RA 5LGTA 3ZN1A 1CF7B 1CGPA 4MGRA 1UHMA 2YPRA 2P7CB 4WK8F 1PUEE 2UWMA 4KIFA 4EM1A 2A5YB 1K78A 2GIVA 4I01A 2EA2A 4N9HA 3F6OA 1ZG3A 3V8KA 4R79A 4RGRA 3WTTC 4HZFA 4WCGA 4I2OA 4XLNF 1BI1A 3BJAA 2CQKA 1S8NA 5CVVA 3IRRA 1GVJA 2BE5F 5D8LB 4MQVA 3F22A 4B09A 2IP2A 3SFZA 2QYOA 3WGIA 1FP1D 1SD5A 4KDPA 1BI0A 3LQQA 1F9NA 4KMUX 1R5HA 5K5RA 4H0EA 3KFWX 2P6SA 5LLQA 5BPIA 2EK5A 3V4GA 2DTRA 2V79A 1I1SA 5L3FA 1SAXA 3GW2A 4NHJA 3GVAA 4RAZA 4YIFA 1D3YA 2ZKZA 2KJBA 1W7PD 3CUOA 2JTVA 4Y13A 3V8LA 1KQ8A 1IF1A 2MH9A 3WG9A 2FMLA 4HQEA 3OV8A 2VONA 2Q0OA 3LA2A 2VBWA 2V9VA 4JQFA 4PGGA 4Q5SF 3T1BA 1J0RA 2B0LA 5CVIA 3GFLA 1J59A 2X4HA 5L3GA 2XKPA 3C1DA 1P4WA 5J8FA 3J7AO 4CYDA 1ZGAA 4ESBA 4AD9A 4IXAA 5HLIA 3R6SA 3M7GA 5BMZA 3WTSC 1MDMB 3QU6A 2YR2A 3WTZA 2BV6A 1B9MA 1HQCA 4IRHA 1XGOA 1IRFA 4M72A 3P9IA 2ZMEB 5LRRA 2DQRA 1ON2A 3KCCA 4ENNA 5DCMB 3TQNA 2EFWA 1U8RA 1ODDA 1XCBA 2KIFA 4A5MA 3P7NA 3WTWC 4CO8A 1WSUA 2Y48A 2JPBA 3KZZA 1KYWA 5TJJA 5DUKA 3LAPA 1QQIA 1DUXC 4OOIA 2QQ9A 2HS5A 1KQ9A 3SZTA 3I53A 1I5ZA 4UVCA 4CHUA 1YS6A 2EJRA 2K86A 3K1MA 3LSTA 5FD6A 2IA1A 1G3SA 4WXCA 1LQ1A 3M8FA 2HQRA 1T38A 3L7WA 2IA2A 5FB2A 2ESNA 1OR7A 2IJLA 3BDDA 3WODF 3V7RA 1JHHA 4UVBA 3M8EA 4U7DA 1U2WA 2EWNA 1A04A 3VEPA 4WWCA 4RS8A 2PQ8A 3PQKA 4R1HA 1ONVA 1Z91A 4A6EA 1XN7A 1G4DA 2P5KA 1USSA 1YO5C 3F6VA 5E20A 1PDNC 3C3WA 4G7ZF 1HSJA 2M5WA 2GQQA 4RB0A 4BXUA 3FM5A 3CLOA 1JE8A 3GO5A 3K1NA 4GGGA 2VN2A 2L54A 2M8EA 1LJ9A 2JT1A 3NEUA 4AVPA 3JAMK 3BPVA 2JRTA 3QU3A 1FBQA 3ERED 5CYVA 3FX3A 2D1VA 3FMSA 3KETA 4NB5A 2F5CA 3E6CC 5DD8A 1W4MA 2E1NA 3DQVC 3WU1B 4L9TA 2XRNA 4L5JA 4I09A 3WTVC 2H27A 4KMFA 3MQ0A 2UXNA 3IL2A 3HOTA 2YU3A 3D0SA 4ENJA 1MZBA 3BPXA 3E5XA 4Q48A 3T8TA 4NQWA 2KIMA 5AIQA 4KT5C 4MNUA 2QVOA 2VC0A 5BOXA 3KP3A 1U5TA 4P9FA 4M9ZA 3L09A 5E17F 2HYFA 3KZYA 3O3KA 3GX4X 3EETA 1ULYA 3P9CA 1TBXA 2OQRA 4S04A 2XKOA 3ZMUA 5LRSA 1U6GA 2CFXA 2EB7A 4HYEA 3GZ5A 1H0MA 3KLOA 3T0YA 4XLPF 3V8JA 4KFCA 2VT2A 4CGZA 2QZ8A 3M9AA 3U2RA 2F5EA 4HQMA 3L2CA 4KNYA 3MEXA 2BBYA 2PBIA 2VT3A 1QZYA 4YFXF 2ELHA 2X0LA 3FMQA 1REPC 5D5VB 5FLXZ 3ZMVA 2KJCA 1IXCA 2HDCA 4UV8A 1K7AA 2HEOA 1P4AA 3BJOA 4ZH4F 2PLYA 2XAQA 2V1UA 4OU0A 1BM9A 1W5SA 2BGCA 2DI3A 1I6XA 4LGWA 1ZG1A 1B6AA 3KEQA 1XMAA 3RI4A 2GA2A 4ENKA 4LMYA 2Z9OA 1BOAA 1Z7UA 3BWGA 4KYWA 2GXGA 2XHKA 3DFGA 1EH8A 1FYMA 1GHCA 3I59B 3VOEA 2AXLA 1MGTA 3BY6A 4KIBA 2P7VB 5D4SA 5LEJA 4FHTA 4IHTA 1R5GA 2V1XA 1OYYA 4EM0B 2RN7A 3MCZA 1IXSB 3KLNA 4EVIA 1IW7F 2PI0A 1XGMA 4I0AA 4E70A 1MJBA 3B73A 2ADUA 4HF0A 3M1EA 3MZHA 5JFRA 5D5XB 1EH7A 2LKPA 4I7HA 2P4WA 1O7FA 5CVUA 4G8XA 1IXRC 4G7HF 1F4KA 3PFIA 1J7KA 2K02A 3Q5FA 4IHSA 1BC7C 3F8NA 3WTUC 2PMHA 2FRHA 3HRSA 4EQQA 4UHTA 5D8KB 2OAZA 2XV4S 3F8CA 1S29A 1T2KA 5IT9Z 1B9NA 2PFBA 2QQAA 2FSWA 2VOOA 2QBYA 1CF7A 2LNBA 4WXDA 2E1CA 1W7PB 4LJZF 1ZLKA 1EH6A 5F64A 3H3UA 2G7UA 2RKHA 2QBYB 2COMA 2XGXA 1TQPA 1HSTA 5K5OA 2XAHA 1OYWA 1BI3A 2VE9A 1ZYRF 4IRIA 2KIUA 2XROA 5F6FA 1BJAA 2Z99A 3KEOA 2HFHA 3LAJA 5ERIA 2CW0F 1LB2A 4G6QA 3KE2A 3E5QA 1WKMA 1ZHFA 1QBJA 5HS8A 2G7HA 4HDUA 2MD5A 3CUQB 4I98B 1B4AA 4R8HA 3E5UA 1FWZA 5BS6A 3O2PE 5LEKA 3C7JA 3E6DA 4F7ZA 3JTGA 1TTYA 2L3DA 4KUMA 1LDJA 2W25A 1D8KA 3HSFA 3I5UA 2OZ6A 3WE3A 2PMUA 1XGSA 4ZZDA 4N9IA 1O57A 2P5LC 3RKYA 1KYZA 3DP7A 4XSXF 1K6OA 2FBIA 3TDZC 4MTEA 1KU2A 5E1ZB 1STZA 1QGPA 4QWQA 4BAYA 4P5OA 1YQAA 4G6DA 4MEXF 3U9GA 2D1HA 1RIOH 4ZYDA 5FD5A 3CO7C 1FC3A 2A6EF 3T5XA 1C0WA 3ECHA 4M9XA 4LB6B 1JHFA 1FZPB 2ZCWA 4HDVA 4KN4X 1ZARA 4CDGA 4U0YA 3WU0A 3SQNA 4PGHA 4LFUA 4LD5A 1G3WA 3F23A 3GFJA 5ILUA 1V3FA 3F8MA 1TNSA 2P5VA 3C18A 3T8RA 5FO5A 5D5UB 2ESHA 1IAWA 5HS9A 1KU9A 3IKTA 1GXPA 4LB5A 3FXUA 5BQTA 4A0ZA 3VFZA 3DPLC 3ULQB 3HRMA 1K78B 2VODA 2YSRA 3FZVA 1E2XA 1FSEA 3K0LA 4Y15A 4A0YA 1AOYA 1MDMA 4HLXA 3FM3A 2XAJA 1O3SA 1FY7A 2ZMEA 2D2WA 2A3SA 5DCMA 4HX4A 1DP7P 4KN7X 3RYPA 3TO7A 3QPHA 1SD7A 5FLXK 3MFKA 2RVCA 3CO6C 1WRJA 3HTUA 1J9IA 3TGNA 1FYKA 2CYYA 3QRFF 2L4AA 3NQOA 2K4BA 3RJPA 5DD4A 3TO6A 5E1XA 3ROUA 3L00A 3ZMSA 2VBXA 2LF7A 1IN6A 1RNLA 2HOEA 2HTSA 1J5YA 2A61A 4P9UA 3DKWA 2ZFWA 1V4RA 1SFUA 3E3VA 3CUQC 2R3SA 5L3EA 1MKMA 3HRTA 3KP2A 2RNJA 2NAZA 4OINF 2A07F 2IPQX 3I4PA 2DFIA 1I1GA 5DV5A 1SFXA 3R4KA 4BNCA 1LNWA 2VXZA 3F3XA 5FGMA 4OIOF 1JXSA 4ZYGA 3BP8A 3ZQ7A 1UFMA 2NNNA 1TW2A 4EJVA 4O6JA 1HBXG 3IHUA 3E6BA 1Z1DA 2P6TA 2KKOA 1DPRA 4RAYA 2PJPA 2OA4A 4KIGA 2NRAC 2STWA 3RKWA 4UVAA 1IRGA 4M73A 2O6GE 2LDUA 2FA5A 5CJ9A 3R0JA 5D5WB 4HX8A 5DYMA 1R1VA 1EV7A 3S2WA 5AONA 3E97A 5TRDA 2L4MA 2FEZA 1HW2A 3LFKA 1Z6RA 1ZRFA 3TOAA 3WTXC 2VBYA 4L0YB 2Q8KA 5AIPA 2CGPA 5IT9K 3BROA 4Y17A 3MAJA 1J2XA 1TW3A 4UUVA 3ZN0A 3V7SA 4HW0A 5EEHA 4O3MA 2AS5F 2WTEA 3I64A 2CG4A 2A69F 1RI7A 4RB1A 1H9TA 3H3ZA 4PZJA 3P9KA 3ELKA 1XB4A 2WC2A 2WV0A 2RGVA 1E17A 3DEUA 1SMTA 2O8XA 2IA0A 4Q4ZF 1PP7U 2YX7A 1KU7A 2FU4A 4BHCA 3J80Z 4HBLA 2GAUA 4ZYHA 4KA4A 1NHAA 5L3BA 5ICEA 4MTDA 1QPMA 1FP2A 4I02A 2FE3A 3FWEA 5KK1A 4O5VA 5CLSA 2NNYA 4U7BA 3VB2A 3FF5A 1HXDA 2O03A 2M30A 2E7XA 1ZG5A 1FLIA 4OIRF 2DT5A 4EJWA 2ZO4A 1O3TA 1KA8A 2IT0A 1MD0A 4EGYA 2PN6A 4MHGA 1B59A 1ON1A 1RUOA 1LDKB 4M9SA 3W6KB 3LA7A 3JW4A 3BZ6A 2MBFA 3G3ZA 3LA3A 4JK1X 5HOOA 4D0PA 4L9JA 1FPQA 3KP7A 1J75A 1WQ2A 2W85A 3I59A 3IKVA 1SD4A 1RZ4A 1D5VA 3TDUC 2GZWA 3IWFA 4Q47A 3COAC 4UNOA 3MWMA 4GCVA 5LHGA 3JTHA 2TDXA 5J8CA 2MA3A 3GWZA 1YTYA 1OKRA 2E7WA 3ABTA 4FX4A 3K69A 4S05A 3I58A 2OD5A 1R00A 3HSRA 4FT8A 4M71A 4EGZA 2G9WA 1ZREA 4HAMA 4AIKA 3WE2A 1OYIA 2HTJA 3K1PA 1R22A 2J5OA 3KP6A 2UZKA 4RGXA 1O3RA 1BI2A 2IRFG 5HVQC 5K1YA 1WI9A 1HW5A 2XAFA 3RPQA 1F5TA 3IRQA 3QP5A 2Y75A 1GXQA 4N0BA 4FX0A 5JI6A 1P4XA 1YIOA 3FHZA 4AIHA 2XIGA 3RYRA 4BYYA 4M6YA 1JGSA 2FMYA 3QAHA 2GXBA 1XD7A 1W7PA 1T39A 2CO5A 2VBZA 2W57A 1QNTA 3ZMDA 2FNPA 3JSPA 2GA1A 2FOKA 1ZRDA 2FF4A 3F8BA 2DLLA 2DK8A 4IRGA 4L9NA 2A68F 2XUBA 4YFKF 3RDIA 3GUDA 5ED4A 1R36A 1UB9A 2HZTA 3R60A 1R1UA 1OPCA 5HS7A 2M87A 2ISZA 1ZRCA 3BOQA 1LEBA 1KGSA 3CUQA 6PAXA 1BBYA 5DUIA 1Z6TA 5E8GA 1H9GA 2DAOA 4IVNA 1MJ9A 1Z05A 3RKXA 1XDSA 2Y0MA 3HUGA 1ZN2A 3HTSB 3QPTA 4ASNA 4HV6A 1ZGJA 4HLYA 5A2QZ 5KVRA 1G6NA 4RGUA 2EV6A 3R0AA 2H6BA 2OZUA 5ICFA 1R7JA 4OIQF 2XVCA 2CSOA 2HGCA 4M74A 2O3FA 4U88A 1FNNA 5LGNA 1Q1HA 4IJAA 4CXFA 2UXXA 3E6MA 3HSEA
chains in the Genus database with same CATH superfamily
2K40A 1T98A 4IPAA 2DW4A 1TQMA 1YLFA 2LF8A 4EM2A 1JI8A 3WGGA 5IYCJ 4MQ9F 3QP6A 4JBAA 5D6EA 3V7CA 1BJZA 1YW7A 4HF2A 2VB6A 4KICA 5JR3A 2LD5A 2EPFA 2FBHA 3ONQA 1MNMC 4P96A 4KITB 3CMEI 3ZQHA 3OOUA 2OBPA 3Q9SA 1BIAA 3L9FA 4A5NA 2D45A 3TOBA 4RDUA 2EFQA 1U3EM 2L02A 4AWXB 2VJJA 2LG4A 3A1YA 4AYBA 5IOYA 1YW8A 2K3PA 1IN5A 5H6RA 1D8JA 5DCFA 2I8DA 1W36C 2Z5UA 4WXHA 3OYEA 3GYHX 5FFZA 2HWVA 2FQ3A 1X1PA 2L2OA 3BG5A 3L2QA 3ASNH 4I0BA 2W1OA 2HVSA 4XLEA 5GPAA 2Z33A 3WU2C 2M0MA 4ZJZA 3DTEA 4IO9F 2QM3A 2RQQA 5HDKA 3J7ZI 2L01A 1R1TA 1XSDA 1VQ5I 4QSHA 1L3LA 2KRFA 2VI6A 5JHUA 2YS9A 2EFOA 2JPCA 3IH4A 4LLNA 3CJNA 3A2KA 2Y0SA 5E8IA 2QQBA 2FUG2 2ZBKA 3CC4I 1KU3A 3JSOA 4XSZF 1R58A 2EIJH 4LG0A 1SFEA 1VNDA 1VQ4I 2FBKA 4ZYEA 2TRTA 3GLLA 3VODA 2HI3A 2XSDC 2E5ZA 2NYXA 1VI0A 3ZQFA 4E7JA 2R7UA 1N78A 3WGHA 4IZZA 2DODA 2OQGA 2OCEA 4OWRB 2R7RA 2DMQA 1WJFA 5LBQA 3PM1A 3J80K 1V5EA 2E36A 2E5NA 2BY1A 4Z2YA 4LG0B 2ID3A 1BW5A 4PDKA 4DNCA 3H92A 3ML6A 5J40A 1XC5A 1MH3A 1X3UA 4OIPF 1BN5A 4EJOA 1IN8A 3H3VK 3UR3C 3IUOA 3D5LA 1DGRM 3ZPLA 3HOSA 2BVMA 4A0XA 5HDNA 2DT6A 2CUJA 4N4NB 1U0JA 4JX5A 1K6YA 1P2FA 2HOTA 3C2HA 3FISA 2XF7A 5FFXA 1S7AA 5FKMA 4AIDA 2W48A 2R5YA 4ESFA 1E3HA 3CTAA 2IVMA 1ZH5A 1VQPI 2NS0A 1QVTA 2QWWA 2QLZA 1UELB 5K7ZA 1XCVA 1T0FA 1W5TA 3VYRB 4TV7A 5ICGA 3IWZA 2ZNZA 4XLCA 2QKMB 3ASOH 3I4MJ 3AG2H 1MH4A 3R61A 1G59A 1HKSA 3KP4A 4RLQA 1W0UA 2RC4A 4HA8A 3RTRA 4OAZA 3DF8A 4OAYA 4IOCF 5JLWA 5BNGA 2F2EA 5HODA 2ELKA 2W4SA 3U21A 4D1QA 3CCLI 1Y0UA 1MNDA 3K4MA 3J81Z 2EV0A 2MLKA 1SMYF 4EJUA 4GYIA 2GWRA 3K10A 5C4XJ 1OCZH 1TLHB 2FD5A 1UZCA 1V5FA 3OMYA 2IGOA 3FXKA 3PNTA 5HNFA 2JSCA 2HPIA 2WWYA 2WB1N 1ZK8A 3G73A 3MZ8A 4D7NA 3I54A 3BZCA 3EUHC 3H0DA 3RCOA 2L9VA 4AU7A 1YFHA 2ISYA 2ZJQF 2ZXHA 3K4BA 4PFOA 4GO1A 3O6BB 2IW5A 3ABUA 2OU2A 1MSEC 2M4KA 2W24A 4CCJA 5H20A 5JVTA 2F5VA 4XOTA 4BQAA 2GM4A 1QZZA 3U1DA 3BTIA 1VTNC 3EDPA 2HYGD 3ECOA 4EEFG 4ZDLA 2BEOA 2K3FA 4DQ2A 4L5IA 4ZC3A 4HNUA 1XSVA 4EMSA 2M45A 4BH9A 1SVOA 3EQLF 1P7IA 4M6XA 1VQMI 1K4SA 3M4OJ 4ENMA 5FLVA 1O3QA 1D5YA 2NS7A 1LDDA 1T08B 4PCQA 1DDNA 3QOPA 1RETA 4QIWN 4E7IA 2ECCA 1NTCA 3FXMA 3CESA 2EZIA 2FNAA 3L1PA 1LFUP 4F91B 4M3FA 2CFOA 1SD6A 1ZLJA 3CDHA 3W6JB 3HPGA 4YRVA 3L2RA 4BHPA 1UAAA 4UV9A 1F1ZA 3REOA 2F4MB 2XGCA 1NG6A 2VQCA 1FT9A 5EEGA 1B1BA 2QSHX 3KIOA 4HSTA 5E3MA 3WHCA 4LLLA 5HDGA 2PMZA 4IF4A 2R5ZB 1XMKA 3W2VA 3AG1H 4NNJA 5GAGJ 4FE7A 4C3IJ 3OYMA 2VOPA 2ZJ2A 3B02A 3HIFA 1ZAOA 1XDUA 5FKLA 5JLXA 2R7QA 1O7LA 2L7KA 4U0WA 1P92A 2ME0A 2DDAA 3K9TA 5HLHA 3F0CA 2A6HF 4FASD 4BHBA 4GRIA 5DDGA 3C2GA 3IV5A 3AG4H 2DQLA 4EJTA 2RDPA 3NRVA 5J4VA 2O61A 3DV8A 5LHIA 2H09A 3FIWA 5HNHA 2OCCH 3ZQQA 2VC1A 4PSWA 4J01A 4HOBA 2PEXA 2C6YA 3GF2A 1FBSA 2J5PA 3FMRA 4X6AJ 3PSFA 2HQNA 2NOJB 3K4JA 4FCYA 2STTA 2L9RA 1MMNA 2HKOA 4BJTA 3RIRA 2KRHA 1ZQ3P 1YYVA 1I27A 4XL9A 4GFBA 3KX2A 1UHWA 1X3WB 5J6XA 3HRUA 1QZEA 4RGSA 1Q1VA 2R7SA 4LK0F 3WTYC 5HLGA 3KYLA 1L0OC 4II2A 4WF2A 2BYVE 3HGGA 1DP3A 2WAEA 2DPDA 1JUMA 4E7SA 3BR0A 1R9TJ 1EKEA 1WJCA 4C2UA 2HVRA 3I0TA 3UKGA 3HHHA 4U87A 4XRMA 2P0WA 2XPUA 1AHDP 4FE4A 1IUYA 4A2UA 2Z3YA 1WWXA 3L2VA 4P55A 2LY9A 2M4GA 3DKYA 3OYJA 2WY7Q 1T6SA 2M1BA 2F4IA 4D9JA 5KHDA 2IS2A 3LQRA 4HG2A 4LLGF 4MEYF 4A3EJ 2WADA 4ESJA 3FHNA 3GTJJ 4NQWB 2MH2A 5A2QK 9ANTA 1YS7A 3CMYA 4RMNA 4QLCU 4IX7A 3ERMA 3ZMTA 1KQ0A 5ICCA 3JCUC 4XRSA 5F1RA 2OUMA 3GTQJ 1DPUA 3FXQA 3GTMJ 1YJNI 4RB3C 4B3XA 1R71A 2E1MB 1IZ1A 2ZXJA 1BIBA 3LSHA 3HHGA 2NVUB 1YG2A 1U5TB 1FOKA 2F6CA 1S3JA 2BVLA 3BR1A 2OTJI 1IN7A 3I4NJ 2E2IJ 4CA0A 1MW7A 3EYYA 4EV0A 4ZZLA 2EFPA 3ZMZA 5LFAA 1S6LA 1OQYA 1R23A 3OL4A 1RUNA 1YW9A 3V42A 1ZTRA 2VKVA 4L9VA 2PJRA 5E1WA 2LSOA 4L0ZB 2H1LA 1X4PA 1G3TA 2WA0A 4BKXA 2HPMA 4D5FA 1MMGA 1XGNA 3F72A 3H35A 4PJMA 1BC8C 1OMIA 1PVEA 2B63J 3GXOA 4L18B 1IRXA 5L3DA 3K70C 1XS9A 2DDBA 1LEAA 2R7FA 4G9YA 4I6ZA 5J3LA 3FXRA 2JZYA 3CJQB 2CS3A 3PQJA 3K2ZA 3U1KA 4NDLA 4WX9A 2ELJA 2R7DA 4G7OF 1V55H 3ZP5A 4BQOA 2JN6A 3PIOF 2W7NA 4UXNA 4XBFA 2HR3A 4DYCA 3DLLF 2F5DA 4H4KC 3OOPA 2DTZA 2RV8A 3HC7A 5D6FA 4IHYA 2ZXWH 5E18F 3RZDJ 1JTYA 2M8GX 2F5FA 2DU9A 2DA4A 1IN4A 4I76A 2X51A 4XRFA 4U0VA 1U78A 4LG3A 1VZ0A 3FXOA 1FYLA 3DBHB 4GYGA 3MKLA 2FXAA 3LOCA 3MKYB 2ACJA 3PO3J 2B7EA 2DMUA 3GFMA 4HX7A 1G3YA 2MLGA 2IGMA 2V26A 1Y56A 1HKTA 4OMZA 2K85A 3I3LA 4OMYA 2DBBA 3JREA 4YG2F 1TZLA 4BJ5C 2GBYA 2DK5A 1BR4A 3LWFA 2M2EA 3HKZA 3OWTA 5K5QA 5LHHA 1OR7C 4F92B 3Q9VA 2QEXI 1FBUA 3TP0A 4CICA 4HV5A 3B6CA 1TNTA 3MZYA 1X1CA 4Y52J 2W84A 5FLMJ 3GZ6A 3PUBA 1X1AA 5EZGA 3DPTA 3SXYA 1IG7A 3KYDB 3GEZA 4M6VA 4W97A 4BJ6C 2JQ7A 5ILSA 3UNGC 2ZFUA 5GP9A 2LKSA 4GXOA 4ETSA 4HPQA 3TO9A 3KP5A 4XICA 1FSHA 2KIQA 1Z9CA 2K4JA 2Q2EA 4IQJA 2NXNB 1PJRA 3EUKL 3GBGA 4B8XA 4PK4A 4YIIA 1MJAA 2HQAA 3BT9A 3H5AA 2YX4A 1QU3A 3SZPA 2I5UA 1HDPA 2QUFA 3B6AA 5KNLA 2H6CA 3IH3A 3K4NA 5J1YA 1VQOI 2X6XA 2KL4A 4BE0A 4NBQA 5C3EJ 5LGUA 4RB2C 1LVAA 1MBJA 3S8PA 2X85A 1MMSA 2K7LA 2VE8A 5CVJA 3W3CA 3JRHA 5BPDA 5CQGA 2X1DA 4F52A 1E3OC 1U9NA 4MLOA 4CZZA 2EFNA 2O9LA 3ZCOA 1GLNA 1IJWC 2XAGA 2NOGA 4D5CA 3AAFA 1TQIA 2WAQA 5CVRA 3HYIA 4M3EA 4XMYA 1K79A 2KFDA 1JT6A 3N05A 5K7HA 3N4MA 3G71I 3TKYA 1S7EA 1DQUA 3CCYA 3VYTB 3IC7A 1HW1A 2O0YA 5L3CA 4BUPA 3F8FA 2V9PA 3DBLB 2QENA 2DPUA 1USTA 4K2EA 2H94A 3GFIA 2ZJPF 4A6DA 3OYCA 2EA4A 3BR5A 3J81K 4HF1A 1R4NB 4A12A 1QO0D 2BY3A 3ESWB 2CV2A 1XSXA 2V6CA 3SHFA 2ETHA 5ILVA 2V1DA 4AYBN 3ISPA 2ZNYA 2MC3A 3LSKA 4AIJA 2LLKA 5IYDJ 3JAMZ 3JRDA 1UCRA 2P8TA 2HKXA 2Y69H 3IH2A 2X6YA 2K27A 2XASA 1FX7A 1ZR4A 3CP8A 4G94A 3CCMI 3CDLA 1AWCA 5IT3A 5B5EC 3I9V2 1S7OA 1I6HJ 5DEQA 3X2QH 4ON0A 1X3ZB 4B44A 3GLXA 3DXJF 1S72I 2XRLA 3BJ6A 1PP8F 3EPZA 2Y0SN 4YFNF 3PNVA 3FBIB 2EV5A 2PG4A 4LK1F 2JA7J 5D4RA 2E1MC 2CWEA 1U5TC 3EYIA 1BW6A 1VF9A 3E0JB 1D0XA 3F21A 3N97A 1F43A 3EUHA 2RQPA 5GTIC 2DO7A 4BY1J 1Y6IA 3I71A 5IYBJ 5H6QA 4LIVA 1MBFA 2OTLI 1HKQA 4PUSA 3RPUA 4UUSA 1RR7A 1P6RA 3HM5A 4BBRJ 5LGTA 2IS6A 3ZN1A 3OYFA 2KISA 1CF7B 1IDYA 3FKIJ 2KDZA 1CGPA 3OYAA 4BEHA 4MGRA 1UHMA 2Q1ZB 2K9MA 2YPRA 2NVXJ 2P7CB 4WK8F 4BGDA 1PUEE 3O8HA 2UWMA 4KIFA 3TP3A 4EM1A 1G2HA 2A5YB 2E35A 2V7FA 4B3AA 4DYRA 1FIAA 1FIPA 1K78A 2GIVA 4I01A 2EA2A 1B72B 1AU7A 4N9HA 3F6OA 3K4CA 1ZG3A 1VQ8I 3V8KA 2R7VA 4R79A 4RGRA 1B8IB 2LFBA 3WTTC 2G0EA 3LNQA 2JA5J 2XGDA 2EQRA 1K61A 4HZFA 3GTOJ 2RREA 2AO9A 1APLC 4UUTA 4DOZA 5IOZA 4HRIA 4WCGA 1UMQA 2O7OA 4I2OA 2HVQA 4XLNF 2GLOA 1BI1A 3BJAA 2Y30A 1D1AA 1R49A 2CQKA 4C9YA 1S8NA 2CQNA 4AC0A 4BY7J 5CVVA 5LD2C 3BTLA 3IRRA 3MMYB 1GVJA 2BE5F 2Y2ZA 5D8LB 1M1EB 2HNHA 4BBSJ 2DFFA 4MQVA 2ID6A 1EA3A 2A5WA 3QYEA 3F22A 4B09A 2IP2A 3SFZA 4UB8C 2QYOA 3WGIA 1FP1D 2VUMJ 1SD5A 2N8GA 4KDPA 4CUGA 2LKXA 1BI0A 3LQQA 1F9NA 2GOMA 4KMUX 1R5HA 1UHSA 2L9SA 4A3DJ 1ETYA 5B1AH 5K5RA 4H0EA 3M1CA 2L7ZA 3KFWX 2OF7A 2DA6A 4ZTFA 3CZ6A 2QKLB 3IAM2 2P6SA 2WY8Q 5LLQA 5BPIA 2EK5A 3V4GA 3LSGA 3S2DJ 4FTHA 1P9QC 2DTRA 2R7ZJ 2V79A 1I1SA 4A93J 5L3FA 2M3AA 2Y9ZA 2V9KA 3BZKA 2R0QC 1SAXA 3DEWA 3GW2A 1SFKA 3ABKH 4NHJA 1OISA 1U8BA 3H5RA 3GVAA 4A3FJ 5IP9J 2DA7A 4RAZA 1UJ8A 4YIFA 3S16J 1D3YA 3JRCA 1YRNB 2LRDA 2ZKZA 2KJBA 1W7PD 3LSMA 3CUOA 2JTVA 4Y13A 4IQ4A 3V8LA 1KQ8A 1IF1A 2MH9A 3WG9A 1IGNA 2FMLA 3GTKJ 4HQEA 3OV8A 2VONA 2Q0OA 2Y9YA 3LA2A 1KONA 2V9VA 2VBWA 1ZKGA 2BY2A 4E7LA 1N77A 1SAUA 4P1WA 4XLAA 2CW7A 1TWGJ 4JQFA 3CJRB 4PGGA 4CCMA 3T1BA 4Q5SF 3LSJA 3Q0WA 3W6VA 2DYRH 1YI2I 2NVYJ 1J0RA 2B0LA 2CW8A 2HOSA 5CVIA 3GFLA 1H88C 1J59A 2X4HA 1GV2A 5L3GA 1VQKI 3VYSB 2XKPA 1HDDC 5F04A 4A69C 2XGEA 3C1DA 3G4SI 1P4WA 4CSWA 5J8FA 1MMAA 4CYDA 3J7AO 5CQEA 1ZGAA 2L7MP 2LC2A 2OPTA 2PMZN 4ESBA 1AKHB 4AD9A 5EGOB 4IXAA 5HLIA 2CUZA 3R6SA 5M3MJ 3OYIA 3M7GA 1K4TA 5BMZA 3WTSC 1X1DA 2LREA 1HC8A 4Y33A 4RA2A 1MDMB 3QU6A 2YR2A 1IUFA 3WTZA 2BV6A 3A4CA 1B9MA 1HQCA 1XGOA 4IRHA 1IRFA 4M72A 4V19K 3P9IA 1HF0A 2ZMEB 5LRRA 5B3SH 2ME6A 2DQRA 3H1CA 2HU9A 1ON2A 3H0GJ 4NC7A 4V2FA 2VQHA 3KCCA 4ENNA 5DCMB 3TQNA 1D1CA 3NWSA 2EFWA 1U8RA 3J7AY 4CYCB 3PNYA 4YEJA 4XKCA 1ODDA 1NG7A 1XCBA 3JRAA 2LP0A 2KIFA 4A5MA 3P7NA 2X1EA 4CO8A 3WTWC 1WSUA 2Y48A 4BE2A 1I50J 2DFEA 4L5EA 2JPBA 4B4CA 1ENHA 3GCMA 4M3BA 2DMTA 3KZZA 1KYWA 5TJJA 2R7OA 5DUKA 3LAPA 1T33A 1QQIA 1DUXC 4OOIA 3E7LA 2R7XA 2QQ9A 2FX0A 3OSFA 2HS5A 4PJJA 1KQ9A 3SZTA 1QHGA 3I53A 3DBRB 4RM2A 1I5ZA 4UVCA 1FOWA 4CHUA 1YS6A 1BL0A 3NAUA 1WGXA 2EJRA 2K86A 3FKJA 2VPRA 4PJNA 2JA8J 2QQ8A 2CU7A 3K1MA 3OSGA 3LSTA 5DTDA 5FD6A 4ZDPA 3TW7A 2IA1A 1TT0A 3DWLE 1XX5A 1G3SA 2Y31A 4WXCA 1LQ1A 3M8FA 2HQRA 5FKOA 1T38A 1RKTA 3L7WA 3SJMA 2IA2A 5FB2A 4BQQA 4II3A 1Z7LA 2TCTA 2ESNA 3BG7A 3WHBA 3KEYA 1OR7A 1CQTA 4IEJA 2IJLA 3BDDA 2VPLA 3WODF 4E7ZA 3V7RA 1JHHA 4UVBA 4IHWA 3M8EA 4ZDOA 4U7DA 1U2WA 2EWNA 1SFOJ 4J00A 2R5ZA 2HXIA 1A04A 3VEPA 4WWCA 4RS8A 3D5SC 2KRCA 2LH9A 2PQ8A 2X6OA 3PQKA 4A3MJ 1T95A 4R1HA 1RRJA 1ONVA 1Z91A 4A6EA 3ZGKA 1MBHA 1XN7A 1G4DA 2P5KA 1USSA 1YO5C 2H8WA 1LKXA 3VYUB 3F6VA 5E20A 1PDNC 3QQAA 3C3WA 4G7ZF 2BXZA 2LR8A 1HSJA 3P5JA 4IOAF 2M5WA 2GQQA 4RB0A 3VWBA 2OJED 4BXUA 3FM5A 2LY1A 3CLOA 3SEQA 1JE8A 3GO5A 1X19A 3CCVI 3K1NA 4GGGA 3Q0VA 2E2HJ 1TT5B 4XM3A 3OIPA 2VN2A 3CCJI 2JA6J 1AA7A 5F0FA 2L54A 2M8EA 1LJ9A 2F48A 2JT1A 3NEUA 4AVPA 3JAMK 3BPVA 2JRTA 3QU3A 3CLQA 1FBQA 3ERED 4NUBA 5CYVA 4C2TA 3FX3A 2D1VA 3FMSA 2EH3A 4NB5A 4XLFA 3KETA 1FOYA 2DN0A 2F5CA 3E6CC 5DD8A 1W4MA 2E1NA 3DQVC 3WU1B 4L9TA 1MBGA 4XKWA 4QPQA 2XRNA 4L5JA 4I09A 3WTVC 2H27A 4KMFA 3HOXJ 1WH5A 3MQ0A 3HKZN 2UXNA 1ZELA 3IL2A 1RESA 4E6KG 1A35A 1ACIA 3OYKA 3HOTA 2CQXA 2YU3A 3D0SA 4ENJA 1SANA 1EF4A 2HQ5A 1ETXA 2K9NA 2LK2A 1MZBA 3BPXA 2VQGA 4C3JJ 3E5XA 3OYHA 2DMNA 4Q48A 3T8TA 4NQWA 5B66C 3S14J 2KIMA 2JK3A 1YJWI 5AIQA 3TEDA 3BC8A 4UB6C 1Z3YA 3JRIA 3CF5F 1MBKA 4KT5C 4MNUA 2QVOA 3K70D 1QA6A 3F9KA 2VC0A 5BOXA 2M34A 1ETWA 2BXYA 3HOWJ 3KP3A 1OCPA 1U5TA 2ZB9A 3A02A 4M9ZA 4P9FA 3L09A 2ZMEC 5E17F 2YU9J 1Z21A 1S9HA 1YIJI 2HYFA 3KZYA 3O3KA 3ZQCA 3PJRA 1R6RA 3GX4X 3EETA 4RBOA 5E3NA 2XSJC 1ULYA 3LMMA 4XQFA 1YJ9I 5C44J 1G8XA 3P9CA 1TBXA 2VLAA 2OQRA 4S04A 4ZYAA 3VDXA 2XKOA 3G1MA 3ZMUA 5LRSA 1U6GA 2CFXA 2EB7A 1BA5A 1ORKA 2EINH 1OFCX 2LY2A 4HYEA 2WAQN 3GZ5A 1H0MA 3KLOA 2MC4A 1H8AC 3T0YA 4XLPF 1T56A 3V8JA 2XF5A 4A3LJ 2ZSIB 1IC8A 5HLTA 4KFCA 2KMUA 4YIRX 2GOXB 2VT2A 2OV7A 4HSRA 4N4OB 5M5WJ 2R93J 2JUGA 4CGZA 2VL8A 4B47A 3HB9A 4MFDA 4XKVA 1SEUA 2QZ8A 3M9AA 3U2RA 2F5EA 4HQMA 3AKZA 3L2CA 3CCSI 1QPIA 4KNYA 3MEXA 2MD0A 2LMDA 2BBYA 2PBIA 3PSIA 2P81A 2VT3A 1QZYA 4YFXF 2ELHA 4HNTA 2X0LA 3FMQA 1REPC 5D5VB 5FLXZ 1MSFC 2B9SA 4XONA 5E3LA 3ZMVA 3ZQGA 2KJCA 1IXCA 2HDCA 1GUUA 4UV8A 1K7AA 2HEOA 2RAEA 1FMWA 3PO2J 1WJAA 1P4AA 1XTAA 2IAIA 3BJOA 4ZH4F 4J19A 2PLYA 3VSKA 2XAQA 2GXAA 2V1UA 3S2HJ 4OU0A 1BM9A 1W5SA 2BGCA 2DI3A 5F1JA 1I6XA 1WJ5A 4LGWA 1IRZA 2IXSA 4A3CJ 2AXTC 3OYLA 1ZG1A 1B6AA 3H9GA 3Q3SA 3KEQA 1RC9A 1XMAA 3RI4A 1HCRA 3DCFA 2GA2A 4ENKA 1I3AA 3H9JA 4LMYA 4Y4RA 4KJZA 1QHHD 2Z9OA 1BOAA 1Z7UA 3CMMA 4BDZA 3BWGA 4KYWA 3Q0UA 3HOYJ 2GXGA 4X1EA 5M3FJ 3FK7A 2XHKA 3DFGA 4XNFA 3OS0A 2JJ7A 2ZXIA 2VKEA 1EH8A 1A6IA 3LSRA 1D0ZA 4V2GA 2Z1DA 1JJ6C 1FYMA 1GHCA 1Z3XA 3I59B 3VOEA 2AXLA 1MGTA 2XPVA 3BY6A 5TISC 1ETKA 4KIBA 2P7VB 5D4SA 5LEJA 4FHTA 4IHTA 4DBQA 1R5GA 1A36A 1T8IA 2V1XA 1V54H 2KDOA 1OYYA 3TL4X 4EM0B 2RN7A 1OCCH 4XN3A 3MCZA 1IXSB 3KLNA 4EVIA 2EZKA 1IW7F 3RSNA 3SZGA 2PI0A 1VQLI 1XGMA 3DU6A 4A3BJ 2VKHA 2IS4A 4I0AA 4NC6A 4E70A 1MJBA 3B73A 2VJ4A 3VSLA 2ADUA 4RAGA 4HF0A 3M1EA 3MZHA 5JFRA 4NC8A 5FRNA 5D5XB 1EH7A 2DA2A 2LKPA 4E4HA 2KLOA 3ABLH 4I7HA 1NK3P 2QSFX 2MGQA 2P4WA 2MABA 1O7FA 3OIQA 2YUSA 2UV1A 4AM3A 2EZLA 3BG6A 1XPXA 5CVUA 2M9HA 2X6WA 3S15J 4G8XA 1IXRC 2IGNA 4CZCA 1JKOC 4G7HF 1F4KA 1OCOH 1WFXA 1TWCJ 4FETA 3SFIA 4MO7A 3PFIA 1J7KA 2K02A 3Q5FA 3ZR8X 3BTCA 3BCBA 4IHSA 3CCRI 4C2MJ 3PFYA 1Y1WJ 3F8NA 1BC7C 3WTUC 2PMHA 2FRHA 3OY9A 3HRSA 3M07A 1FMVA 4EQQA 5DM7F 4UHTA 1V5GA 5D8KB 2QCOA 2OAZA 2XV4S 3F8CA 1S29A 2H1KA 2AQFA 1BR2A 1T2KA 1VQ9I 5IT9Z 3HOVJ 1B9NA 1JGGA 3K7AJ 2PFBA 1X2NA 2QQAA 4JP0A 4IL6C 1QVUA 5CKTA 2FSWA 3OYBA 2VOOA 5C4JJ 2QBYA 4FQGA 1CF7A 2LNBA 3S93A 4WXDA 2E1CA 1W7PB 2CUFA 2IBDA 4LJZF 1ZLKA 1EH6A 5F64A 3H3UA 3H5NA 2G7UA 2RKHA 2QBYB 2COMA 2JA2A 3S1QJ 2XGXA 1TQPA 1HSTA 5K5OA 1B72A 4MIMA 2XAHA 1OYWA 2XF6A 1BI3A 2VE9A 2AQEA 5IP6A 1ZYRF 1B8IA 4CCOA 4IRIA 2KIUA 2XROA 3CCUI 5F6FA 3MKZA 1BJAA 1XMXA 2Z99A 3KEOA 2HFHA 3JRFA 3JRGA 3LAJA 5ERIA 1Y8RB 2CW0F 2BHYA 1LB2A 4G6QA 3KE2A 3E5QA 1P7JA 2CQQA 1W36D 3A0HC 1TWHJ 1WKMA 1ZHFA 1QBJA 5HS8A 4DZPA 1LUJB 2G7HA 4LITA 4HDUA 2MD5A 3CUQB 4I98B 1B4AA 3OL3A 4R8HA 1X1BA 2QSGX 3E5UA 3VPRA 1RPWA 2MW8A 4ZTJA 2BW3B 2IGKA 2X48A 2KZVA 3HUGB 4PFPA 5EG0A 3HOUJ 1FWZA 5BS6A 3O2PE 5LEKA 3C7JA 3E6DA 2WV1A 4F7ZA 3JTGA 1A6QA 1TTYA 1TWFJ 3FDYA 2L3DA 4KUMA 1LDJA 2QGUA 1YHQI 2W25A 1D8KA 4DJAA 3HSFA 3I5UA 2OZ6A 3NWTA 3WE3A 4XR6A 5EG0B 4X0GA 2PMUA 1XGSA 4ZZDA 3AG3H 4BACA 5J1UA 1GDTA 3K2AA 4N9IA 3ZOBA 1DGWY 1O57A 4XOPA 2P5LC 3RKYA 1KYZA 3DP7A 4XSXF 1K6OA 2FBIA 3TDZC 4MTEA 5H2FC 1KU2A 5E1ZB 3I56I 3A01A 1STZA 1HA8A 1QGPA 4QWQA 4BAYA 3CMAI 4P5OA 3CC2I 1D0YA 1YQAA 4G6DA 3HBLA 1TL8A 5J47A 2X9DA 4MEXF 2COBA 3U9GA 2D1HA 3S1RJ 4ZYDA 1RIOH 3GZNB 1YRNA 5FD5A 3CO7C 1JUSA 1FC3A 4PJ0C 1OJLA 2A6EF 3T5XA 4BU2A 1C0WA 3ECHA 3A01B 4M9XA 1HLVA 2E71A 3DTKA 4F93B 4LB6B 1JHFA 1FZPB 2X1CA 2ZCWA 4HDVA 4KN4X 1ZARA 4CDGA 4U0YA 3WU0A 3SQNA 3AL0B 4PGHA 2JRMA 3GMEA 3QYBA 4LFUA 1G3WA 4LD5A 3F23A 1WZ2A 2VXDA 3GFJA 2JUCA 2CMPA 5ILUA 1V3FA 3F8MA 1TNSA 2P5VA 1Y8QB 2W82A 3C18A 3T8RA 5GAEJ 5FO5A 5D5UB 3J7YJ 2ESHA 1IAWA 5HS9A 2CRGA 1KU9A 3IKTA 1GXPA 4LB5A 1N75A 3FXUA 4CCLA 1TC3C 5BQTA 2Z16A 4A0ZA 3S32A 3VFZA 3BR3A 3DPLC 5GPCA 3ULQB 1D1BA 3OYNA 1POGA 3HRMA 5EDNA 3L2UA 2K9QA 1K78B 2R4GA 2XC7A 2YSRA 5EGOA 1E3PA 4F3QA 2VODA 3FZVA 4DIQA 4ITVA 4S0HB 1WJEA 4BXFA 3CC7I 2A6TA 1E2XA 1RR8C 1FSEA 3K0LA 4Y15A 2UUZA 4A0YA 1AOYA 1MDMA 4HLXA 3FXLA 3FM3A 2XAJA 3OYDA 1O3SA 1FY7A 5EF6A 3RPUD 2ZMEA 2D2WA 1I39A 2E34A 5JVGF 1ETQA 2W00A 3AFHA 2DFHA 2A3SA 5DCMA 4HX4A 4XIDA 4CYCA 1DP7P 5F27A 3OS2A 2DMPA 2DOAA 2OC6A 4KN7X 2LVSA 3RYPA 3WG7H 2M7BA 2XDVA 3A0BC 3TO7A 2GIZA 3FXJA 3DLAA 1VQ7I 3RZOJ 3QPHA 1SD7A 2VQLA 1QRYA 5FLXK 3MFKA 1ETVA 2CV0A 2RVCA 3CO6C 3CP2A 2DOFA 1WRJA 3HTUA 2E2JJ 4XN0A 2ECBA 4DW6A 3PUFA 1J9IA 3OIOA 3TGNA 1MIJA 2R5YB 5EJCA 1IDZA 2F4OB 3D5RC 4KT6A 3ABMH 5B1BH 4ABZA 1FYKA 2CYYA 5IY5H 1LVKA 3QRFF 2L4AA 5GADJ 1YE9A 3NQOA 2K4BA 2O8KA 2R7TA 1LFBA 2MFZA 5KAFC 3RJPA 5DD4A 3TO6A 3I55I 5E1XA 3ROUA 1OCRH 3L00A 3ZMSA 2VBXA 3HEFA 2LF7A 1LE8A 1IN6A 1RNLA 2HOEA 2HTSA 1J5YA 2DXIA 3QPSA 3E1SA 3FBNB 1J09A 3S1NJ 2A61A 4P9UA 4RM3A 3DKWA 1Y39A 2ZFWA 1V4RA 4BE1A 2EILH 3E3VA 1SFUA 1WH7A 3CUQC 2R3SA 1LE8B 5L3EA 3RKQA 1MKMA 3KPHA 3HRTA 1X58A 3KP2A 2V1NA 1JTXA 1XG1A 2NAZA 2RNJA 4PJLA 5KCMA 3S17J 4OINF 3W2WA 2A07F 2IPQX 1SC7A 2I10A 4DYQA 3I4PA 2DFIA 1I1GA 5DV5A 3CCEI 4JOMA 5DS9A 5E3OA 3CF2A 1SFXA 1W0TA 1FEXA 3HGYA 3BCAA 4I99C 3R4KA 4BL0B 1GT0C 4BNCA 1LNWA 3QODA 3MD2A 2K9SA 3SYTA 2VXZA 3F3XA 5FGMA 2E60A 2EBIA 3GTPJ 4OIOF 1JXSA 2MSYA 4ZYGA 1FTZA 3BP8A 3ZQ7A 1UFMA 3OS1A 2NNNA 1TW2A 4D7MA 4EJVA 4O6JA 4A3IJ 3S1MJ 2L7FP 1HBXG 3IHUA 1VFCA 1S5LC 3BG3A 2BZTA 3E6BA 5FKNA 2HYJA 1Z1DA 3GTGJ 4DGWB 2P6TA 1A31A 2CQ7A 2KKOA 4YELA 2DJIA 1DPRA 4RAYA 2PJPA 2WAFA 2OA4A 4KIGA 2NRAC 2STWA 3RKWA 3W2AA 5IPAA 2K9LA 4UVAA 1IRGA 2Z2SB 4M73A 2O6GE 1RKWA 1WI3A 2PX9A 2LDUA 2EIMH 5F0HA 3SDBA 2FA5A 5CJ9A 3R0JA 2KZGA 4B1RA 4HX8A 5D5WB 1O4XA 3EUAA 1BR1A 1I3QJ 4M3GA 2E19A 5DYMA 1R1VA 1EV7A 3S2WA 1LFPA 2FOWA 4Z6YA 5J1RA 5AONA 3AL0C 3LSPA 3E97A 5TRDA 2L4MA 2FEZA 1DU0A 1HW2A 3LFKA 5FROA 3D1NI 1MMDA 1Z6RA 4C30A 1ZRFA 5EZHA 3TOAA 3OR1C 1EJ9A 2HOAA 2VBYA 3WTXC 4L0YB 1WHUA 2Q8KA 3JRBA 3S3MA 4CH7A 1HOMA 5AIPA 2CGPA 4LIUA 4DBRA 3HDDA 5IT9K 3BROA 3NARA 4JX4A 2FJ1A 4Y17A 3BG9A 3MAJA 1Z0XA 4B43A 1J2XA 1TW3A 4UUVA 2EIKH 3CD6I 1N25A 4IHVA 3ZN0A 2XB5A 2DT7B 2WB1A 3V7SA 3CJTB 5EEAA 3DKXA 3TW6A 4BQNA 4HW0A 5EEHA 1PYVA 4O3MA 1JKRC 4Y7NJ 3LSIA 3SEZA 2AS5F 3O8GA 2WTEA 3I64A 3BR2A 1W1WE 2CG4A 5F08A 2A69F 2KP6A 1GVDA 4XORA 2A05A 4Y3OA 4AUXA 1F36A 1RI7A 3FK6A 4RB1A 1H9TA 3H3ZA 4PZJA 2NS8A 3P9KA 3ELKA 1AKHA 1NK2P 3KYCB 3SDGA 1XB4A 2HXOA 2WC2A 1TP4A 4HNVA 2JVGA 2WV0A 4XK4A 2K5CA 1ZGWA 2RGVA 1E17A 5M5YJ 2HDWA 3DEUA 1SMTA 3C2BA 2O8XA 3IAS2 2O5RA 1WCMJ 2IA0A 4HEA2 4Q4ZF 1PP7U 2YX7A 3DU5A 2KQRA 1KU7A 1OCTC 2M0CA 2FU4A 4BHCA 3J80Z 3HXLA 1FJLA 4HBLA 2GAUA 4ZYHA 4KA4A 1NHAA 2XAUA 2MYSA 5L3BA 5ICEA 2HDDA 3BQYA 5E79C 1JUPA 4MTDA 2IEKA 1T0FC 1QPMA 1FP2A 2VKDA 3LL7A 3H36A 4I02A 2FE3A 4M3DA 3FWEA 3HOZJ 1UG0A 5KK1A 4O5VA 5CLSA 2NNYA 4U7BA 3VB2A 3FF5A 1R4MB 1HXDA 4EATA 2O03A 3QOEA 2M30A 2E7XA 1ZG5A 4IHXA 1X4OA 4W1UA 3JR9A 1FLIA 4OIRF 1A5JA 2DT5A 2VJ5A 4EJWA 2ZO4A 3QWLA 1O3TA 1Y0NA 2DA5A 2LTPA 5JHFA 2R92J 1KA8A 2IT0A 2E1OA 1MD0A 4ANJA 4EGYA 2PJRB 3KZIC 1BOBA 2PN6A 4MHGA 3HPHA 1GV5A 1B59A 4A3JJ 1H89C 1ON1A 1JJ8C 1RUOA 2VASA 3MKWB 1LDKB 4M9SA 3W6KB 3LA7A 5CPRB 3G1LA 3JW4A 3BZ6A 1PUFA 2MBFA 3G3ZA 3LA3A 4LOCA 1Z67A 3RQ4A 2ICWG 4G12A 5KAIC 4JK1X 2DA1A 4CCKA 4D0PA 5HOOA 2V4JC 4L9JA 2L0KA 4E7HA 1FPQA 1VQ6I 3KP7A 1J75A 4KISA 3G2BA 1PUFB 5IP7J 5FKKA 1WQ2A 2W85A 3I59A 3QPLA 1UG2A 2QF7A 2VJIA 3IKVA 1SD4A 1JKPC 5DM6F 1RZ4A 4F55A 1D5VA 3TDUC 1IO2A 2RNGA 2GZWA 3IWFA 3LFUA 4Q47A 3G6EI 3RQIA 3COAC 4UNOA 3MWMA 4GCVA 5LHGA 2LBFA 1ZR2A 3JTHA 2TDXA 5J8CA 1SVLA 2MA3A 3GWZA 1FOXA 3M8JA 1YTYA 1OKRA 2E7WA 3ABTA 3PL8A 4FX4A 3K69A 4B48A 4S05A 3HJEA 1JKQC 3I58A 2OD5A 1YITI 5F0CA 1R00A 3TMOA 3HSRA 4FT8A 2LBFB 4M71A 4EGZA 4PSXA 3MN2A 3HL2A 2CH0A 2G9WA 1ITYA 1ZREA 4HAMA 4AIKA 1DU6A 4G6TB 1YOVB 1K83J 2NVTJ 3MVPA 4JX6A 2DA3A 1U9OA 2NVQJ 4JYKA 2XPWA 1OYIA 3A03A 3WE2A 4FISA 3OYGA 4C3HJ 4RAFA 2DCEA 2KHMA 2HTJA 2Q2EB 3K1PA 1R22A 2J5OA 2R7WA 3G1OA 3KP6A 2L9NA 1TWAJ 2UZKA 2IS1A 4RGXA 2BHZA 1O3RA 4CCNA 1Y1VJ 2DOEA 1BI2A 2IRFG 5HVQC 2LYCA 5K1YA 1WI9A 1HW5A 2D5VA 3ZQIA 2XAFA 4GDFA 3RPQA 2M7AA 1F5TA 5M5XJ 3IRQA 2KPMA 3QP5A 4XKBA 4E7KA 2Y75A 5EYRA 1GXQA 4XLHA 1MNEA 4N0BA 4FX0A 5FJ8J 3S3OA 5JI6A 3CCQI 1P4XA 3ZRGA 1YIOA 3QYFA 2KT0A 1WVRA 3S3NA 3OR2C 3K4KA 4AIHA 4AVZA 4MFEA 3FHZA 2XIGA 2JVHA 5GTHC 2JWTA 3RYRA 1OLTA 3TBIA 3K6GA 5K7FA 3L2WA 4BYYA 4M6YA 1YX3A 1JGSA 2H8RA 1FTTA 1X2MA 2JMWA 3BLYA 2FMYA 4BS9A 3QAHA 2GXBA 3CQZJ 2WBMA 1E0EA 5FRMA 1XD7A 3H9QA 1W7PA 1T39A 3DPUA 2CO5A 2VBZA 1W5CC 4IKFA 1WJBA 2DJNA 4QPOA 2W57A 1QNTA 1ETOA 3ZMDA 2FNPA 3JSPA 2L5QA 1WJDA 2GA1A 2FOKA 4RLFA 3BR6A 1VQNI 1MBEA 1ZRDA 2FF4A 3F8BA 2DLLA 2DYSH 2DK8A 1LPQA 1R5ID 4IRGA 4DZJA 3BTJA 4L9NA 2A68F 2XUBA 4YFKF 3RDIA 2CUEA 3ZQLA 3GUDA 2EZHA 5ED4A 1ERDA 1R36A 1UB9A 1YX5A 5TGTA 4XRSG 2HZTA 1JT0A 3R60A 2ZJRF 1R1UA 1Z77A 1OPCA 3DEEA 1WPKA 5HS7A 2M87A 2ZC2A 1ZRCA 3BOQA 2VIXA 2ISZA 1LEBA 1KGSA 3CUQA 3M3YJ 6PAXA 1BBYA 5DUIA 3IP4B 1Z6TA 2ZSHB 4QTRA 5E8GA 3CDIA 1KZHA 1H9GA 2MG4A 2DAOA 4IVNA 1MJ9A 1Z05A 2AHQA 3RKXA 1XDSA 2XB0X 2BW3A 2Y0MA 3HUGA 1NH3A 2FQ4A 2BOLA 2QA4I 2JSPA 1ZN2A 3HTSB 3QPTA 4ASNA 4HV6A 1IV6A 1ZGJA 4BDYA 4HLYA 3HG9A 4UUSB 3GTLJ 2BY0A 5KVRA 1IV8A 1G6NA 4RGUA 5GAHJ 2EV6A 3R0AA 5A2QZ 4A3GJ 2V6EA 4BXXJ 3BQZA 2H6BA 2OZUA 5ICFA 4A3KJ 1SVMA 1R7JA 4BEHB 4OIQF 4UY8I 2XVCA 2CSOA 3HZJA 2HGCA 3K4LA 4M74A 3PIPF 2CV1A 2LOOA 5J4YA 2CJJA 2O3FA 4U88A 1FNNA 5LGNA 1Q1HA 4IJAA 4CXFA 2UXXA 2HZDA 3DTIA 3E6MA 3HSEA 3ZXSA
chains in the Genus database with same CATH topology
1T98A 4IPAA 2DW4A 1TQMA 1YLFA 2LF8A 4EM2A 3WGGA 4MQ9F 3QP6A 4JBAA 5D6EA 3V7CA 1YW7A 4HF2A 4KICA 5JR3A 2FBHA 4P96A 2OBPA 3Q9SA 1BIAA 3L9FA 4A5NA 2D45A 3TOBA 2EFQA 1U3EM 2L02A 4AWXB 1YW8A 1IN5A 5H6RA 1D8JA 5DCFA 2Z5UA 4WXHA 3GYHX 5FFZA 2HWVA 2FQ3A 4I0BA 2Z33A 2QM3A 5HDKA 2L01A 1R1TA 1XSDA 1L3LA 2KRFA 5JHUA 2EFOA 2JPCA 4LLNA 3CJNA 5E8IA 2QQBA 2ZBKA 1KU3A 3JSOA 4XSZF 1R58A 4LG0A 1SFEA 2FBKA 4ZYEA 3VODA 2NYXA 3WGHA 2OQGA 5LBQA 3J80K 4Z2YA 4LG0B 4PDKA 4DNCA 3H92A 3ML6A 1X3UA 4OIPF 1BN5A 4EJOA 1IN8A 3D5LA 3ZPLA 3HOSA 4A0XA 5HDNA 1P2FA 5FFXA 1S7AA 4ESFA 3CTAA 2IVMA 1ZH5A 2NS0A 2QWWA 2QLZA 1XCVA 1T0FA 1W5TA 4TV7A 5ICGA 3IWZA 2ZNZA 3R61A 1HKSA 3KP4A 2RC4A 4HA8A 3RTRA 3DF8A 2F2EA 1Y0UA 3J81Z 2EV0A 2MLKA 1SMYF 4EJUA 4GYIA 2GWRA 1TLHB 2JSCA 2WWYA 3G73A 3I54A 1YFHA 2ISYA 4GO1A 3O6BB 2IW5A 3ABUA 2OU2A 2W24A 5H20A 5JVTA 4BQAA 1QZZA 3U1DA 1VTNC 3EDPA 2HYGD 3ECOA 2BEOA 4DQ2A 4L5IA 1XSVA 4EMSA 2M45A 4BH9A 3EQLF 4M6XA 4ENMA 1O3QA 1LDDA 4PCQA 1DDNA 3QOPA 2FNAA 1SD6A 1ZLJA 3CDHA 3W6JB 4BHPA 4UV9A 1F1ZA 3REOA 1FT9A 5EEGA 1B1BA 4LLLA 5HDGA 4IF4A 1XMKA 2VOPA 2ZJ2A 3B02A 3HIFA 1ZAOA 1XDUA 1O7LA 4U0WA 1P92A 3K9TA 5HLHA 2A6HF 4BHBA 5DDGA 2DQLA 4EJTA 2RDPA 3NRVA 2O61A 3DV8A 5LHIA 2H09A 2VC1A 4HOBA 2PEXA 2C6YA 3GF2A 1FBSA 2J5PA 3FMRA 2HQNA 2STTA 2HKOA 3RIRA 1YYVA 1I27A 1UHWA 5J6XA 3HRUA 4RGSA 4LK0F 3WTYC 5HLGA 1L0OC 4WF2A 2BYVE 2DPDA 3I0TA 3HHHA 1IUYA 4A2UA 2Z3YA 1WWXA 4P55A 1T6SA 2M1BA 3LQRA 4LLGF 4MEYF 4ESJA 2MH2A 5A2QK 1YS7A 4QLCU 3ZMTA 1KQ0A 5ICCA 5F1RA 1DPUA 3FXQA 4RB3C 1IZ1A 2ZXJA 1BIBA 3HHGA 1YG2A 1U5TB 1FOKA 1S3JA 1IN7A 3EYYA 4EV0A 4ZZLA 2EFPA 3ZMZA 1S6LA 1RUNA 1R23A 1YW9A 4L9VA 5E1WA 2LSOA 4L0ZB 1G3TA 1BC8C 1XGNA 3F72A 1OMIA 3GXOA 4L18B 5L3DA 1LEAA 2R7FA 4G9YA 3FXRA 2JZYA 3PQJA 3K2ZA 4WX9A 2R7DA 4G7OF 3ZP5A 4UXNA 4XBFA 2HR3A 2F5DA 3OOPA 2RV8A 5D6FA 5E18F 2F5FA 2DU9A 1IN4A 4XRFA 4U0VA 1U78A 1FYLA 4GYGA 2FXAA 2ACJA 3GFMA 4HX7A 1G3YA 2MLGA 1HKTA 4OMZA 4OMYA 2DBBA 4YG2F 2DK5A 3LWFA 5K5QA 5LHHA 3Q9VA 1FBUA 4CICA 4HV5A 1TNTA 3MZYA 2W84A 3GZ6A 3DPTA 3SXYA 3GEZA 5ILSA 4GXOA 4ETSA 3TO9A 3KP5A 1FSHA 1Z9CA 2K4JA 2Q2EA 4B8XA 4YIIA 1MJAA 2YX4A 3SZPA 2QUFA 2H6CA 5LGUA 4RB2C 1LVAA 2K7LA 2VE8A 5CVJA 5BPDA 4CZZA 2EFNA 2XAGA 3AAFA 1TQIA 5CVRA 3HYIA 1K79A 3N4MA 3TKYA 3IC7A 1HW1A 2O0YA 5L3CA 3F8FA 2QENA 2DPUA 1USTA 4K2EA 2H94A 3GFIA 4A6DA 2EA4A 3J81K 4HF1A 4A12A 1QO0D 1XSXA 2V6CA 3SHFA 2ETHA 5ILVA 2V1DA 3ISPA 2ZNYA 2MC3A 4AIJA 3JAMZ 1UCRA 2P8TA 2HKXA 2K27A 2XASA 1FX7A 4G94A 1AWCA 5IT3A 1S7OA 5DEQA 4ON0A 3GLXA 3DXJF 3BJ6A 1PP8F 4YFNF 2EV5A 2PG4A 4LK1F 5D4RA 2CWEA 1U5TC 3EYIA 3F21A 3N97A 3EUHA 2RQPA 2DO7A 3I71A 5H6QA 1HKQA 3RPUA 1P6RA 5LGTA 3ZN1A 1CF7B 1CGPA 4MGRA 1UHMA 2YPRA 2P7CB 4WK8F 1PUEE 2UWMA 4KIFA 4EM1A 2A5YB 1K78A 2GIVA 4I01A 2EA2A 4N9HA 3F6OA 1ZG3A 3V8KA 4R79A 4RGRA 3WTTC 4HZFA 4WCGA 4I2OA 4XLNF 1BI1A 3BJAA 2CQKA 1S8NA 5CVVA 3IRRA 1GVJA 2BE5F 5D8LB 4MQVA 3F22A 4B09A 2IP2A 3SFZA 2QYOA 3WGIA 1FP1D 1SD5A 4KDPA 1BI0A 3LQQA 1F9NA 4KMUX 1R5HA 5K5RA 4H0EA 3KFWX 2P6SA 5LLQA 5BPIA 2EK5A 3V4GA 2DTRA 2V79A 1I1SA 5L3FA 1SAXA 3GW2A 4NHJA 3GVAA 4RAZA 4YIFA 1D3YA 2ZKZA 2KJBA 1W7PD 3CUOA 2JTVA 4Y13A 3V8LA 1KQ8A 1IF1A 2MH9A 3WG9A 2FMLA 4HQEA 3OV8A 2VONA 2Q0OA 3LA2A 2VBWA 2V9VA 4JQFA 4PGGA 4Q5SF 3T1BA 1J0RA 2B0LA 5CVIA 3GFLA 1J59A 2X4HA 5L3GA 2XKPA 3C1DA 1P4WA 5J8FA 3J7AO 4CYDA 1ZGAA 4ESBA 4AD9A 4IXAA 5HLIA 3R6SA 3M7GA 5BMZA 3WTSC 1MDMB 3QU6A 2YR2A 3WTZA 2BV6A 1B9MA 1HQCA 4IRHA 1XGOA 1IRFA 4M72A 3P9IA 2ZMEB 5LRRA 2DQRA 1ON2A 3KCCA 4ENNA 5DCMB 3TQNA 2EFWA 1U8RA 1ODDA 1XCBA 2KIFA 4A5MA 3P7NA 3WTWC 4CO8A 1WSUA 2Y48A 2JPBA 3KZZA 1KYWA 5TJJA 5DUKA 3LAPA 1QQIA 1DUXC 4OOIA 2QQ9A 2HS5A 1KQ9A 3SZTA 3I53A 1I5ZA 4UVCA 4CHUA 1YS6A 2EJRA 2K86A 3K1MA 3LSTA 5FD6A 2IA1A 1G3SA 4WXCA 1LQ1A 3M8FA 2HQRA 1T38A 3L7WA 2IA2A 5FB2A 2ESNA 1OR7A 2IJLA 3BDDA 3WODF 3V7RA 1JHHA 4UVBA 3M8EA 4U7DA 1U2WA 2EWNA 1A04A 3VEPA 4WWCA 4RS8A 2PQ8A 3PQKA 4R1HA 1ONVA 1Z91A 4A6EA 1XN7A 1G4DA 2P5KA 1USSA 1YO5C 3F6VA 5E20A 1PDNC 3C3WA 4G7ZF 1HSJA 2M5WA 2GQQA 4RB0A 4BXUA 3FM5A 3CLOA 1JE8A 3GO5A 3K1NA 4GGGA 2VN2A 2L54A 2M8EA 1LJ9A 2JT1A 3NEUA 4AVPA 3JAMK 3BPVA 2JRTA 3QU3A 1FBQA 3ERED 5CYVA 3FX3A 2D1VA 3FMSA 3KETA 4NB5A 2F5CA 3E6CC 5DD8A 1W4MA 2E1NA 3DQVC 3WU1B 4L9TA 2XRNA 4L5JA 4I09A 3WTVC 2H27A 4KMFA 3MQ0A 2UXNA 3IL2A 3HOTA 2YU3A 3D0SA 4ENJA 1MZBA 3BPXA 3E5XA 4Q48A 3T8TA 4NQWA 2KIMA 5AIQA 4KT5C 4MNUA 2QVOA 2VC0A 5BOXA 3KP3A 1U5TA 4P9FA 4M9ZA 3L09A 5E17F 2HYFA 3KZYA 3O3KA 3GX4X 3EETA 1ULYA 3P9CA 1TBXA 2OQRA 4S04A 2XKOA 3ZMUA 5LRSA 1U6GA 2CFXA 2EB7A 4HYEA 3GZ5A 1H0MA 3KLOA 3T0YA 4XLPF 3V8JA 4KFCA 2VT2A 4CGZA 2QZ8A 3M9AA 3U2RA 2F5EA 4HQMA 3L2CA 4KNYA 3MEXA 2BBYA 2PBIA 2VT3A 1QZYA 4YFXF 2ELHA 2X0LA 3FMQA 1REPC 5D5VB 5FLXZ 3ZMVA 2KJCA 1IXCA 2HDCA 4UV8A 1K7AA 2HEOA 1P4AA 3BJOA 4ZH4F 2PLYA 2XAQA 2V1UA 4OU0A 1BM9A 1W5SA 2BGCA 2DI3A 1I6XA 4LGWA 1ZG1A 1B6AA 3KEQA 1XMAA 3RI4A 2GA2A 4ENKA 4LMYA 2Z9OA 1BOAA 1Z7UA 3BWGA 4KYWA 2GXGA 2XHKA 3DFGA 1EH8A 1FYMA 1GHCA 3I59B 3VOEA 2AXLA 1MGTA 3BY6A 4KIBA 2P7VB 5D4SA 5LEJA 4FHTA 4IHTA 1R5GA 2V1XA 1OYYA 4EM0B 2RN7A 3MCZA 1IXSB 3KLNA 4EVIA 1IW7F 2PI0A 1XGMA 4I0AA 4E70A 1MJBA 3B73A 2ADUA 4HF0A 3M1EA 3MZHA 5JFRA 5D5XB 1EH7A 2LKPA 4I7HA 2P4WA 1O7FA 5CVUA 4G8XA 1IXRC 4G7HF 1F4KA 3PFIA 1J7KA 2K02A 3Q5FA 4IHSA 1BC7C 3F8NA 3WTUC 2PMHA 2FRHA 3HRSA 4EQQA 4UHTA 5D8KB 2OAZA 2XV4S 3F8CA 1S29A 1T2KA 5IT9Z 1B9NA 2PFBA 2QQAA 2FSWA 2VOOA 2QBYA 1CF7A 2LNBA 4WXDA 2E1CA 1W7PB 4LJZF 1ZLKA 1EH6A 5F64A 3H3UA 2G7UA 2RKHA 2QBYB 2COMA 2XGXA 1TQPA 1HSTA 5K5OA 2XAHA 1OYWA 1BI3A 2VE9A 1ZYRF 4IRIA 2KIUA 2XROA 5F6FA 1BJAA 2Z99A 3KEOA 2HFHA 3LAJA 5ERIA 2CW0F 1LB2A 4G6QA 3KE2A 3E5QA 1WKMA 1ZHFA 1QBJA 5HS8A 2G7HA 4HDUA 2MD5A 3CUQB 4I98B 1B4AA 4R8HA 3E5UA 1FWZA 5BS6A 3O2PE 5LEKA 3C7JA 3E6DA 4F7ZA 3JTGA 1TTYA 2L3DA 4KUMA 1LDJA 2W25A 1D8KA 3HSFA 3I5UA 2OZ6A 3WE3A 2PMUA 1XGSA 4ZZDA 4N9IA 1O57A 2P5LC 3RKYA 1KYZA 3DP7A 4XSXF 1K6OA 2FBIA 3TDZC 4MTEA 1KU2A 5E1ZB 1STZA 1QGPA 4QWQA 4BAYA 4P5OA 1YQAA 4G6DA 4MEXF 3U9GA 2D1HA 1RIOH 4ZYDA 5FD5A 3CO7C 1FC3A 2A6EF 3T5XA 1C0WA 3ECHA 4M9XA 4LB6B 1JHFA 1FZPB 2ZCWA 4HDVA 4KN4X 1ZARA 4CDGA 4U0YA 3WU0A 3SQNA 4PGHA 4LFUA 4LD5A 1G3WA 3F23A 3GFJA 5ILUA 1V3FA 3F8MA 1TNSA 2P5VA 3C18A 3T8RA 5FO5A 5D5UB 2ESHA 1IAWA 5HS9A 1KU9A 3IKTA 1GXPA 4LB5A 3FXUA 5BQTA 4A0ZA 3VFZA 3DPLC 3ULQB 3HRMA 1K78B 2VODA 2YSRA 3FZVA 1E2XA 1FSEA 3K0LA 4Y15A 4A0YA 1AOYA 1MDMA 4HLXA 3FM3A 2XAJA 1O3SA 1FY7A 2ZMEA 2D2WA 2A3SA 5DCMA 4HX4A 1DP7P 4KN7X 3RYPA 3TO7A 3QPHA 1SD7A 5FLXK 3MFKA 2RVCA 3CO6C 1WRJA 3HTUA 1J9IA 3TGNA 1FYKA 2CYYA 3QRFF 2L4AA 3NQOA 2K4BA 3RJPA 5DD4A 3TO6A 5E1XA 3ROUA 3L00A 3ZMSA 2VBXA 2LF7A 1IN6A 1RNLA 2HOEA 2HTSA 1J5YA 2A61A 4P9UA 3DKWA 2ZFWA 1V4RA 1SFUA 3E3VA 3CUQC 2R3SA 5L3EA 1MKMA 3HRTA 3KP2A 2RNJA 2NAZA 4OINF 2A07F 2IPQX 3I4PA 2DFIA 1I1GA 5DV5A 1SFXA 3R4KA 4BNCA 1LNWA 2VXZA 3F3XA 5FGMA 4OIOF 1JXSA 4ZYGA 3BP8A 3ZQ7A 1UFMA 2NNNA 1TW2A 4EJVA 4O6JA 1HBXG 3IHUA 3E6BA 1Z1DA 2P6TA 2KKOA 1DPRA 4RAYA 2PJPA 2OA4A 4KIGA 2NRAC 2STWA 3RKWA 4UVAA 1IRGA 4M73A 2O6GE 2LDUA 2FA5A 5CJ9A 3R0JA 5D5WB 4HX8A 5DYMA 1R1VA 1EV7A 3S2WA 5AONA 3E97A 5TRDA 2L4MA 2FEZA 1HW2A 3LFKA 1Z6RA 1ZRFA 3TOAA 3WTXC 2VBYA 4L0YB 2Q8KA 5AIPA 2CGPA 5IT9K 3BROA 4Y17A 3MAJA 1J2XA 1TW3A 4UUVA 3ZN0A 3V7SA 4HW0A 5EEHA 4O3MA 2AS5F 2WTEA 3I64A 2CG4A 2A69F 1RI7A 4RB1A 1H9TA 3H3ZA 4PZJA 3P9KA 3ELKA 1XB4A 2WC2A 2WV0A 2RGVA 1E17A 3DEUA 1SMTA 2O8XA 2IA0A 4Q4ZF 1PP7U 2YX7A 1KU7A 2FU4A 4BHCA 3J80Z 4HBLA 2GAUA 4ZYHA 4KA4A 1NHAA 5L3BA 5ICEA 4MTDA 1QPMA 1FP2A 4I02A 2FE3A 3FWEA 5KK1A 4O5VA 5CLSA 2NNYA 4U7BA 3VB2A 3FF5A 1HXDA 2O03A 2M30A 2E7XA 1ZG5A 1FLIA 4OIRF 2DT5A 4EJWA 2ZO4A 1O3TA 1KA8A 2IT0A 1MD0A 4EGYA 2PN6A 4MHGA 1B59A 1ON1A 1RUOA 1LDKB 4M9SA 3W6KB 3LA7A 3JW4A 3BZ6A 2MBFA 3G3ZA 3LA3A 4JK1X 5HOOA 4D0PA 4L9JA 1FPQA 3KP7A 1J75A 1WQ2A 2W85A 3I59A 3IKVA 1SD4A 1RZ4A 1D5VA 3TDUC 2GZWA 3IWFA 4Q47A 3COAC 4UNOA 3MWMA 4GCVA 5LHGA 3JTHA 2TDXA 5J8CA 2MA3A 3GWZA 1YTYA 1OKRA 2E7WA 3ABTA 4FX4A 3K69A 4S05A 3I58A 2OD5A 1R00A 3HSRA 4FT8A 4M71A 4EGZA 2G9WA 1ZREA 4HAMA 4AIKA 3WE2A 1OYIA 2HTJA 3K1PA 1R22A 2J5OA 3KP6A 2UZKA 4RGXA 1O3RA 1BI2A 2IRFG 5HVQC 5K1YA 1WI9A 1HW5A 2XAFA 3RPQA 1F5TA 3IRQA 3QP5A 2Y75A 1GXQA 4N0BA 4FX0A 5JI6A 1P4XA 1YIOA 3FHZA 4AIHA 2XIGA 3RYRA 4BYYA 4M6YA 1JGSA 2FMYA 3QAHA 2GXBA 1XD7A 1W7PA 1T39A 2CO5A 2VBZA 2W57A 1QNTA 3ZMDA 2FNPA 3JSPA 2GA1A 2FOKA 1ZRDA 2FF4A 3F8BA 2DLLA 2DK8A 4IRGA 4L9NA 2A68F 2XUBA 4YFKF 3RDIA 3GUDA 5ED4A 1R36A 1UB9A 2HZTA 3R60A 1R1UA 1OPCA 5HS7A 2M87A 2ISZA 1ZRCA 3BOQA 1LEBA 1KGSA 3CUQA 6PAXA 1BBYA 5DUIA 1Z6TA 5E8GA 1H9GA 2DAOA 4IVNA 1MJ9A 1Z05A 3RKXA 1XDSA 2Y0MA 3HUGA 1ZN2A 3HTSB 3QPTA 4ASNA 4HV6A 1ZGJA 4HLYA 5A2QZ 5KVRA 1G6NA 4RGUA 2EV6A 3R0AA 2H6BA 2OZUA 5ICFA 1R7JA 4OIQF 2XVCA 2CSOA 2HGCA 4M74A 2O3FA 4U88A 1FNNA 5LGNA 1Q1HA 4IJAA 4CXFA 2UXXA 3E6MA 3HSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T98 A;  4IPA A;  2DW4 A;  1TQM A;  1YLF A;  2LF8 A;  4EM2 A;  3WGG A;  4MQ9 F;  3QP6 A;  4JBA A;  5D6E A;  3V7C A;  1YW7 A;  4HF2 A;  4KIC A;  5JR3 A;  2FBH A;  4P96 A;  2OBP A;  3Q9S A;  1BIA A;  3L9F A;  4A5N A;  2D45 A;  3TOB A;  2EFQ A;  1U3E M;  2L02 A;  4AWX B;  1YW8 A;  1IN5 A;  5H6R A;  1D8J A;  5DCF A;  2Z5U A;  4WXH A;  3GYH X;  5FFZ A;  2HWV A;  2FQ3 A;  4I0B A;  2Z33 A;  2QM3 A;  5HDK A;  2L01 A;  1R1T A;  1XSD A;  1L3L A;  2KRF A;  5JHU A;  2EFO A;  2JPC A;  4LLN A;  3CJN A;  5E8I A;  2QQB A;  2ZBK A;  1KU3 A;  3JSO A;  4XSZ F;  1R58 A;  4LG0 A;  1SFE A;  2FBK A;  4ZYE A;  3VOD A;  2NYX A;  3WGH A;  2OQG A;  5LBQ A;  3J80 K;  4Z2Y A;  4LG0 B;  4PDK A;  4DNC A;  3H92 A;  3ML6 A;  1X3U A;  4OIP F;  1BN5 A;  4EJO A;  1IN8 A;  3D5L A;  3ZPL A;  3HOS A;  4A0X A;  5HDN A;  1P2F A;  5FFX A;  1S7A A;  4ESF A;  3CTA A;  2IVM A;  1ZH5 A;  2NS0 A;  2QWW A;  2QLZ A;  1XCV A;  1T0F A;  1W5T A;  4TV7 A;  5ICG A;  3IWZ A;  2ZNZ A;  3R61 A;  1HKS A;  3KP4 A;  2RC4 A;  4HA8 A;  3RTR A;  3DF8 A;  2F2E A;  1Y0U A;  3J81 Z;  2EV0 A;  2MLK A;  1SMY F;  4EJU A;  4GYI A;  2GWR A;  1TLH B;  2JSC A;  2WWY A;  3G73 A;  3I54 A;  1YFH A;  2ISY A;  4GO1 A;  3O6B B;  2IW5 A;  3ABU A;  2OU2 A;  2W24 A;  5H20 A;  5JVT A;  4BQA A;  1QZZ A;  3U1D A;  1VTN C;  3EDP A;  2HYG D;  3ECO A;  2BEO A;  4DQ2 A;  4L5I A;  1XSV A;  4EMS A;  2M45 A;  4BH9 A;  3EQL F;  4M6X A;  4ENM A;  1O3Q A;  1LDD A;  4PCQ A;  1DDN A;  3QOP A;  2FNA A;  1SD6 A;  1ZLJ A;  3CDH A;  3W6J B;  4BHP A;  4UV9 A;  1F1Z A;  3REO A;  1FT9 A;  5EEG A;  1B1B A;  4LLL A;  5HDG A;  4IF4 A;  1XMK A;  2VOP A;  2ZJ2 A;  3B02 A;  3HIF A;  1ZAO A;  1XDU A;  1O7L A;  4U0W A;  1P92 A;  3K9T A;  5HLH A;  2A6H F;  4BHB A;  5DDG A;  2DQL A;  4EJT A;  2RDP A;  3NRV A;  2O61 A;  3DV8 A;  5LHI A;  2H09 A;  2VC1 A;  4HOB A;  2PEX A;  2C6Y A;  3GF2 A;  1FBS A;  2J5P A;  3FMR A;  2HQN A;  2STT A;  2HKO A;  3RIR A;  1YYV A;  1I27 A;  1UHW A;  5J6X A;  3HRU A;  4RGS A;  4LK0 F;  3WTY C;  5HLG A;  1L0O C;  4WF2 A;  2BYV E;  2DPD A;  3I0T A;  3HHH A;  1IUY A;  4A2U A;  2Z3Y A;  1WWX A;  4P55 A;  1T6S A;  2M1B A;  3LQR A;  4LLG F;  4MEY F;  4ESJ A;  2MH2 A;  5A2Q K;  1YS7 A;  4QLC U;  3ZMT A;  1KQ0 A;  5ICC A;  5F1R A;  1DPU A;  3FXQ A;  4RB3 C;  1IZ1 A;  2ZXJ A;  1BIB A;  3HHG A;  1YG2 A;  1U5T B;  1FOK A;  1S3J A;  1IN7 A;  3EYY A;  4EV0 A;  4ZZL A;  2EFP A;  3ZMZ A;  1S6L A;  1RUN A;  1R23 A;  1YW9 A;  4L9V A;  5E1W A;  2LSO A;  4L0Z B;  1G3T A;  1BC8 C;  1XGN A;  3F72 A;  1OMI A;  3GXO A;  4L18 B;  5L3D A;  1LEA A;  2R7F A;  4G9Y A;  3FXR A;  2JZY A;  3PQJ A;  3K2Z A;  4WX9 A;  2R7D A;  4G7O F;  3ZP5 A;  4UXN A;  4XBF A;  2HR3 A;  2F5D A;  3OOP A;  2RV8 A;  5D6F A;  5E18 F;  2F5F A;  2DU9 A;  1IN4 A;  4XRF A;  4U0V A;  1U78 A;  1FYL A;  4GYG A;  2FXA A;  2ACJ A;  3GFM A;  4HX7 A;  1G3Y A;  2MLG A;  1HKT A;  4OMZ A;  4OMY A;  2DBB A;  4YG2 F;  2DK5 A;  3LWF A;  5K5Q A;  5LHH A;  3Q9V A;  1FBU A;  4CIC A;  4HV5 A;  1TNT A;  3MZY A;  2W84 A;  3GZ6 A;  3DPT A;  3SXY A;  3GEZ A;  5ILS A;  4GXO A;  4ETS A;  3TO9 A;  3KP5 A;  1FSH A;  1Z9C A;  2K4J A;  2Q2E A;  4B8X A;  4YII A;  1MJA A;  2YX4 A;  3SZP A;  2QUF A;  2H6C A;  5LGU A;  4RB2 C;  1LVA A;  2K7L A;  2VE8 A;  5CVJ A;  5BPD A;  4CZZ A;  2EFN A;  2XAG A;  3AAF A;  1TQI A;  5CVR A;  3HYI A;  1K79 A;  3N4M A;  3TKY A;  3IC7 A;  1HW1 A;  2O0Y A;  5L3C A;  3F8F A;  2QEN A;  2DPU A;  1UST A;  4K2E A;  2H94 A;  3GFI A;  4A6D A;  2EA4 A;  3J81 K;  4HF1 A;  4A12 A;  1QO0 D;  1XSX A;  2V6C A;  3SHF A;  2ETH A;  5ILV A;  2V1D A;  3ISP A;  2ZNY A;  2MC3 A;  4AIJ A;  3JAM Z;  1UCR A;  2P8T A;  2HKX A;  2K27 A;  2XAS A;  1FX7 A;  4G94 A;  1AWC A;  5IT3 A;  1S7O A;  5DEQ A;  4ON0 A;  3GLX A;  3DXJ F;  3BJ6 A;  1PP8 F;  4YFN F;  2EV5 A;  2PG4 A;  4LK1 F;  5D4R A;  2CWE A;  1U5T C;  3EYI A;  3F21 A;  3N97 A;  3EUH A;  2RQP A;  2DO7 A;  3I71 A;  5H6Q A;  1HKQ A;  3RPU A;  1P6R A;  5LGT A;  3ZN1 A;  1CF7 B;  1CGP A;  4MGR A;  1UHM A;  2YPR A;  2P7C B;  4WK8 F;  1PUE E;  2UWM A;  4KIF A;  4EM1 A;  2A5Y B;  1K78 A;  2GIV A;  4I01 A;  2EA2 A;  4N9H A;  3F6O A;  1ZG3 A;  3V8K A;  4R79 A;  4RGR A;  3WTT C;  4HZF A;  4WCG A;  4I2O A;  4XLN F;  1BI1 A;  3BJA A;  2CQK A;  1S8N A;  5CVV A;  3IRR A;  1GVJ A;  2BE5 F;  5D8L B;  4MQV A;  3F22 A;  4B09 A;  2IP2 A;  3SFZ A;  2QYO A;  3WGI A;  1FP1 D;  1SD5 A;  4KDP A;  1BI0 A;  3LQQ A;  1F9N A;  4KMU X;  1R5H A;  5K5R A;  4H0E A;  3KFW X;  2P6S A;  5LLQ A;  5BPI A;  2EK5 A;  3V4G A;  2DTR A;  2V79 A;  1I1S A;  5L3F A;  1SAX A;  3GW2 A;  4NHJ A;  3GVA A;  4RAZ A;  4YIF A;  1D3Y A;  2ZKZ A;  2KJB A;  1W7P D;  3CUO A;  2JTV A;  4Y13 A;  3V8L A;  1KQ8 A;  1IF1 A;  2MH9 A;  3WG9 A;  2FML A;  4HQE A;  3OV8 A;  2VON A;  2Q0O A;  3LA2 A;  2VBW A;  2V9V A;  4JQF A;  4PGG A;  4Q5S F;  3T1B A;  1J0R A;  2B0L A;  5CVI A;  3GFL A;  1J59 A;  2X4H A;  5L3G A;  2XKP A;  3C1D A;  1P4W A;  5J8F A;  3J7A O;  4CYD A;  1ZGA A;  4ESB A;  4AD9 A;  4IXA A;  5HLI A;  3R6S A;  3M7G A;  5BMZ A;  3WTS C;  1MDM B;  3QU6 A;  2YR2 A;  3WTZ A;  2BV6 A;  1B9M A;  1HQC A;  4IRH A;  1XGO A;  1IRF A;  4M72 A;  3P9I A;  2ZME B;  5LRR A;  2DQR A;  1ON2 A;  3KCC A;  4ENN A;  5DCM B;  3TQN A;  2EFW A;  1U8R A;  1ODD A;  1XCB A;  2KIF A;  4A5M A;  3P7N A;  3WTW C;  4CO8 A;  1WSU A;  2Y48 A;  2JPB A;  3KZZ A;  1KYW A;  5TJJ A;  5DUK A;  3LAP A;  1QQI A;  1DUX C;  4OOI A;  2QQ9 A;  2HS5 A;  1KQ9 A;  3SZT A;  3I53 A;  1I5Z A;  4UVC A;  4CHU A;  1YS6 A;  2EJR A;  2K86 A;  3K1M A;  3LST A;  5FD6 A;  2IA1 A;  1G3S A;  4WXC A;  1LQ1 A;  3M8F A;  2HQR A;  1T38 A;  3L7W A;  2IA2 A;  5FB2 A;  2ESN A;  1OR7 A;  2IJL A;  3BDD A;  3WOD F;  3V7R A;  1JHH A;  4UVB A;  3M8E A;  4U7D A;  1U2W A;  2EWN A;  1A04 A;  3VEP A;  4WWC A;  4RS8 A;  2PQ8 A;  3PQK A;  4R1H A;  1ONV A;  1Z91 A;  4A6E A;  1XN7 A;  1G4D A;  2P5K A;  1USS A;  1YO5 C;  3F6V A;  5E20 A;  1PDN C;  3C3W A;  4G7Z F;  1HSJ A;  2M5W A;  2GQQ A;  4RB0 A;  4BXU A;  3FM5 A;  3CLO A;  1JE8 A;  3GO5 A;  3K1N A;  4GGG A;  2VN2 A;  2L54 A;  2M8E A;  1LJ9 A;  2JT1 A;  3NEU A;  4AVP A;  3JAM K;  3BPV A;  2JRT A;  3QU3 A;  1FBQ A;  3ERE D;  5CYV A;  3FX3 A;  2D1V A;  3FMS A;  3KET A;  4NB5 A;  2F5C A;  3E6C C;  5DD8 A;  1W4M A;  2E1N A;  3DQV C;  3WU1 B;  4L9T A;  2XRN A;  4L5J A;  4I09 A;  3WTV C;  2H27 A;  4KMF A;  3MQ0 A;  2UXN A;  3IL2 A;  3HOT A;  2YU3 A;  3D0S A;  4ENJ A;  1MZB A;  3BPX A;  3E5X A;  4Q48 A;  3T8T A;  4NQW A;  2KIM A;  5AIQ A;  4KT5 C;  4MNU A;  2QVO A;  2VC0 A;  5BOX A;  3KP3 A;  1U5T A;  4P9F A;  4M9Z A;  3L09 A;  5E17 F;  2HYF A;  3KZY A;  3O3K A;  3GX4 X;  3EET A;  1ULY A;  3P9C A;  1TBX A;  2OQR A;  4S04 A;  2XKO A;  3ZMU A;  5LRS A;  1U6G A;  2CFX A;  2EB7 A;  4HYE A;  3GZ5 A;  1H0M A;  3KLO A;  3T0Y A;  4XLP F;  3V8J A;  4KFC A;  2VT2 A;  4CGZ A;  2QZ8 A;  3M9A A;  3U2R A;  2F5E A;  4HQM A;  3L2C A;  4KNY A;  3MEX A;  2BBY A;  2PBI A;  2VT3 A;  1QZY A;  4YFX F;  2ELH A;  2X0L A;  3FMQ A;  1REP C;  5D5V B;  5FLX Z;  3ZMV A;  2KJC A;  1IXC A;  2HDC A;  4UV8 A;  1K7A A;  2HEO A;  1P4A A;  3BJO A;  4ZH4 F;  2PLY A;  2XAQ A;  2V1U A;  4OU0 A;  1BM9 A;  1W5S A;  2BGC A;  2DI3 A;  1I6X A;  4LGW A;  1ZG1 A;  1B6A A;  3KEQ A;  1XMA A;  3RI4 A;  2GA2 A;  4ENK A;  4LMY A;  2Z9O A;  1BOA A;  1Z7U A;  3BWG A;  4KYW A;  2GXG A;  2XHK A;  3DFG A;  1EH8 A;  1FYM A;  1GHC A;  3I59 B;  3VOE A;  2AXL A;  1MGT A;  3BY6 A;  4KIB A;  2P7V B;  5D4S A;  5LEJ A;  4FHT A;  4IHT A;  1R5G A;  2V1X A;  1OYY A;  4EM0 B;  2RN7 A;  3MCZ A;  1IXS B;  3KLN A;  4EVI A;  1IW7 F;  2PI0 A;  1XGM A;  4I0A A;  4E70 A;  1MJB A;  3B73 A;  2ADU A;  4HF0 A;  3M1E A;  3MZH A;  5JFR A;  5D5X B;  1EH7 A;  2LKP A;  4I7H A;  2P4W A;  1O7F A;  5CVU A;  4G8X A;  1IXR C;  4G7H F;  1F4K A;  3PFI A;  1J7K A;  2K02 A;  3Q5F A;  4IHS A;  1BC7 C;  3F8N A;  3WTU C;  2PMH A;  2FRH A;  3HRS A;  4EQQ A;  4UHT A;  5D8K B;  2OAZ A;  2XV4 S;  3F8C A;  1S29 A;  1T2K A;  5IT9 Z;  1B9N A;  2PFB A;  2QQA A;  2FSW A;  2VOO A;  2QBY A;  1CF7 A;  2LNB A;  4WXD A;  2E1C A;  1W7P B;  4LJZ F;  1ZLK A;  1EH6 A;  5F64 A;  3H3U A;  2G7U A;  2RKH A;  2QBY B;  2COM A;  2XGX A;  1TQP A;  1HST A;  5K5O A;  2XAH A;  1OYW A;  1BI3 A;  2VE9 A;  1ZYR F;  4IRI A;  2KIU A;  2XRO A;  5F6F A;  1BJA A;  2Z99 A;  3KEO A;  2HFH A;  3LAJ A;  5ERI A;  2CW0 F;  1LB2 A;  4G6Q A;  3KE2 A;  3E5Q A;  1WKM A;  1ZHF A;  1QBJ A;  5HS8 A;  2G7H A;  4HDU A;  2MD5 A;  3CUQ B;  4I98 B;  1B4A A;  4R8H A;  3E5U A;  1FWZ A;  5BS6 A;  3O2P E;  5LEK A;  3C7J A;  3E6D A;  4F7Z A;  3JTG A;  1TTY A;  2L3D A;  4KUM A;  1LDJ A;  2W25 A;  1D8K A;  3HSF A;  3I5U A;  2OZ6 A;  3WE3 A;  2PMU A;  1XGS A;  4ZZD A;  4N9I A;  1O57 A;  2P5L C;  3RKY A;  1KYZ A;  3DP7 A;  4XSX F;  1K6O A;  2FBI A;  3TDZ C;  4MTE A;  1KU2 A;  5E1Z B;  1STZ A;  1QGP A;  4QWQ A;  4BAY A;  4P5O A;  1YQA A;  4G6D A;  4MEX F;  3U9G A;  2D1H A;  1RIO H;  4ZYD A;  5FD5 A;  3CO7 C;  1FC3 A;  2A6E F;  3T5X A;  1C0W A;  3ECH A;  4M9X A;  4LB6 B;  1JHF A;  1FZP B;  2ZCW A;  4HDV A;  4KN4 X;  1ZAR A;  4CDG A;  4U0Y A;  3WU0 A;  3SQN A;  4PGH A;  4LFU A;  4LD5 A;  1G3W A;  3F23 A;  3GFJ A;  5ILU A;  1V3F A;  3F8M A;  1TNS A;  2P5V A;  3C18 A;  3T8R A;  5FO5 A;  5D5U B;  2ESH A;  1IAW A;  5HS9 A;  1KU9 A;  3IKT A;  1GXP A;  4LB5 A;  3FXU A;  5BQT A;  4A0Z A;  3VFZ A;  3DPL C;  3ULQ B;  3HRM A;  1K78 B;  2VOD A;  2YSR A;  3FZV A;  1E2X A;  1FSE A;  3K0L A;  4Y15 A;  4A0Y A;  1AOY A;  1MDM A;  4HLX A;  3FM3 A;  2XAJ A;  1O3S A;  1FY7 A;  2ZME A;  2D2W A;  2A3S A;  5DCM A;  4HX4 A;  1DP7 P;  4KN7 X;  3RYP A;  3TO7 A;  3QPH A;  1SD7 A;  5FLX K;  3MFK A;  2RVC A;  3CO6 C;  1WRJ A;  3HTU A;  1J9I A;  3TGN A;  1FYK A;  2CYY A;  3QRF F;  2L4A A;  3NQO A;  2K4B A;  3RJP A;  5DD4 A;  3TO6 A;  5E1X A;  3ROU A;  3L00 A;  3ZMS A;  2VBX A;  2LF7 A;  1IN6 A;  1RNL A;  2HOE A;  2HTS A;  1J5Y A;  2A61 A;  4P9U A;  3DKW A;  2ZFW A;  1V4R A;  1SFU A;  3E3V A;  3CUQ C;  2R3S A;  5L3E A;  1MKM A;  3HRT A;  3KP2 A;  2RNJ A;  2NAZ A;  4OIN F;  2A07 F;  2IPQ X;  3I4P A;  2DFI A;  1I1G A;  5DV5 A;  1SFX A;  3R4K A;  4BNC A;  1LNW A;  2VXZ A;  3F3X A;  5FGM A;  4OIO F;  1JXS A;  4ZYG A;  3BP8 A;  3ZQ7 A;  1UFM A;  2NNN A;  1TW2 A;  4EJV A;  4O6J A;  1HBX G;  3IHU A;  3E6B A;  1Z1D A;  2P6T A;  2KKO A;  1DPR A;  4RAY A;  2PJP A;  2OA4 A;  4KIG A;  2NRA C;  2STW A;  3RKW A;  4UVA A;  1IRG A;  4M73 A;  2O6G E;  2LDU A;  2FA5 A;  5CJ9 A;  3R0J A;  5D5W B;  4HX8 A;  5DYM A;  1R1V A;  1EV7 A;  3S2W A;  5AON A;  3E97 A;  5TRD A;  2L4M A;  2FEZ A;  1HW2 A;  3LFK A;  1Z6R A;  1ZRF A;  3TOA A;  3WTX C;  2VBY A;  4L0Y B;  2Q8K A;  5AIP A;  2CGP A;  5IT9 K;  3BRO A;  4Y17 A;  3MAJ A;  1J2X A;  1TW3 A;  4UUV A;  3ZN0 A;  3V7S A;  4HW0 A;  5EEH A;  4O3M A;  2AS5 F;  2WTE A;  3I64 A;  2CG4 A;  2A69 F;  1RI7 A;  4RB1 A;  1H9T A;  3H3Z A;  4PZJ A;  3P9K A;  3ELK A;  1XB4 A;  2WC2 A;  2WV0 A;  2RGV A;  1E17 A;  3DEU A;  1SMT A;  2O8X A;  2IA0 A;  4Q4Z F;  1PP7 U;  2YX7 A;  1KU7 A;  2FU4 A;  4BHC A;  3J80 Z;  4HBL A;  2GAU A;  4ZYH A;  4KA4 A;  1NHA A;  5L3B A;  5ICE A;  4MTD A;  1QPM A;  1FP2 A;  4I02 A;  2FE3 A;  3FWE A;  5KK1 A;  4O5V A;  5CLS A;  2NNY A;  4U7B A;  3VB2 A;  3FF5 A;  1HXD A;  2O03 A;  2M30 A;  2E7X A;  1ZG5 A;  1FLI A;  4OIR F;  2DT5 A;  4EJW A;  2ZO4 A;  1O3T A;  1KA8 A;  2IT0 A;  1MD0 A;  4EGY A;  2PN6 A;  4MHG A;  1B59 A;  1ON1 A;  1RUO A;  1LDK B;  4M9S A;  3W6K B;  3LA7 A;  3JW4 A;  3BZ6 A;  2MBF A;  3G3Z A;  3LA3 A;  4JK1 X;  5HOO A;  4D0P A;  4L9J A;  1FPQ A;  3KP7 A;  1J75 A;  1WQ2 A;  2W85 A;  3I59 A;  3IKV A;  1SD4 A;  1RZ4 A;  1D5V A;  3TDU C;  2GZW A;  3IWF A;  4Q47 A;  3COA C;  4UNO A;  3MWM A;  4GCV A;  5LHG A;  3JTH A;  2TDX A;  5J8C A;  2MA3 A;  3GWZ A;  1YTY A;  1OKR A;  2E7W A;  3ABT A;  4FX4 A;  3K69 A;  4S05 A;  3I58 A;  2OD5 A;  1R00 A;  3HSR A;  4FT8 A;  4M71 A;  4EGZ A;  2G9W A;  1ZRE A;  4HAM A;  4AIK A;  3WE2 A;  1OYI A;  2HTJ A;  3K1P A;  1R22 A;  2J5O A;  3KP6 A;  2UZK A;  4RGX A;  1O3R A;  1BI2 A;  2IRF G;  5HVQ C;  5K1Y A;  1WI9 A;  1HW5 A;  2XAF A;  3RPQ A;  1F5T A;  3IRQ A;  3QP5 A;  2Y75 A;  1GXQ A;  4N0B A;  4FX0 A;  5JI6 A;  1P4X A;  1YIO A;  3FHZ A;  4AIH A;  2XIG A;  3RYR A;  4BYY A;  4M6Y A;  1JGS A;  2FMY A;  3QAH A;  2GXB A;  1XD7 A;  1W7P A;  1T39 A;  2CO5 A;  2VBZ A;  2W57 A;  1QNT A;  3ZMD A;  2FNP A;  3JSP A;  2GA1 A;  2FOK A;  1ZRD A;  2FF4 A;  3F8B A;  2DLL A;  2DK8 A;  4IRG A;  4L9N A;  2A68 F;  2XUB A;  4YFK F;  3RDI A;  3GUD A;  5ED4 A;  1R36 A;  1UB9 A;  2HZT A;  3R60 A;  1R1U A;  1OPC A;  5HS7 A;  2M87 A;  2ISZ A;  1ZRC A;  3BOQ A;  1LEB A;  1KGS A;  3CUQ A;  6PAX A;  1BBY A;  5DUI A;  1Z6T A;  5E8G A;  1H9G A;  2DAO A;  4IVN A;  1MJ9 A;  1Z05 A;  3RKX A;  1XDS A;  2Y0M A;  3HUG A;  1ZN2 A;  3HTS B;  3QPT A;  4ASN A;  4HV6 A;  1ZGJ A;  4HLY A;  5A2Q Z;  5KVR A;  1G6N A;  4RGU A;  2EV6 A;  3R0A A;  2H6B A;  2OZU A;  5ICF A;  1R7J A;  4OIQ F;  2XVC A;  2CSO A;  2HGC A;  4M74 A;  2O3F A;  4U88 A;  1FNN A;  5LGN A;  1Q1H A;  4IJA A;  4CXF A;  2UXX A;  3E6M A;  3HSE A; 
#chains in the Genus database with same CATH topology
 2K40 A;  1T98 A;  4IPA A;  2DW4 A;  1TQM A;  1YLF A;  2LF8 A;  4EM2 A;  1JI8 A;  3WGG A;  5IYC J;  4MQ9 F;  3QP6 A;  4JBA A;  5D6E A;  3V7C A;  1BJZ A;  1YW7 A;  4HF2 A;  2VB6 A;  4KIC A;  5JR3 A;  2LD5 A;  2EPF A;  2FBH A;  3ONQ A;  1MNM C;  4P96 A;  4KIT B;  3CME I;  3ZQH A;  3OOU A;  2OBP A;  3Q9S A;  1BIA A;  3L9F A;  4A5N A;  2D45 A;  3TOB A;  4RDU A;  2EFQ A;  1U3E M;  2L02 A;  4AWX B;  2VJJ A;  2LG4 A;  3A1Y A;  4AYB A;  5IOY A;  1YW8 A;  2K3P A;  1IN5 A;  5H6R A;  1D8J A;  5DCF A;  2I8D A;  1W36 C;  2Z5U A;  4WXH A;  3OYE A;  3GYH X;  5FFZ A;  2HWV A;  2FQ3 A;  1X1P A;  2L2O A;  3BG5 A;  3L2Q A;  3ASN H;  4I0B A;  2W1O A;  2HVS A;  4XLE A;  5GPA A;  2Z33 A;  3WU2 C;  2M0M A;  4ZJZ A;  3DTE A;  4IO9 F;  2QM3 A;  2RQQ A;  5HDK A;  3J7Z I;  2L01 A;  1R1T A;  1XSD A;  1VQ5 I;  4QSH A;  1L3L A;  2KRF A;  2VI6 A;  5JHU A;  2YS9 A;  2EFO A;  2JPC A;  3IH4 A;  4LLN A;  3CJN A;  3A2K A;  2Y0S A;  5E8I A;  2QQB A;  2FUG 2;  2ZBK A;  3CC4 I;  1KU3 A;  3JSO A;  4XSZ F;  1R58 A;  2EIJ H;  4LG0 A;  1SFE A;  1VND A;  1VQ4 I;  2FBK A;  4ZYE A;  2TRT A;  3GLL A;  3VOD A;  2HI3 A;  2XSD C;  2E5Z A;  2NYX A;  1VI0 A;  3ZQF A;  4E7J A;  2R7U A;  1N78 A;  3WGH A;  4IZZ A;  2DOD A;  2OQG A;  2OCE A;  4OWR B;  2R7R A;  2DMQ A;  1WJF A;  5LBQ A;  3PM1 A;  3J80 K;  1V5E A;  2E36 A;  2E5N A;  2BY1 A;  4Z2Y A;  4LG0 B;  2ID3 A;  1BW5 A;  4PDK A;  4DNC A;  3H92 A;  3ML6 A;  5J40 A;  1XC5 A;  1MH3 A;  1X3U A;  4OIP F;  1BN5 A;  4EJO A;  1IN8 A;  3H3V K;  3UR3 C;  3IUO A;  3D5L A;  1DGR M;  3ZPL A;  3HOS A;  2BVM A;  4A0X A;  5HDN A;  2DT6 A;  2CUJ A;  4N4N B;  1U0J A;  4JX5 A;  1K6Y A;  1P2F A;  2HOT A;  3C2H A;  3FIS A;  2XF7 A;  5FFX A;  1S7A A;  5FKM A;  4AID A;  2W48 A;  2R5Y A;  4ESF A;  1E3H A;  3CTA A;  2IVM A;  1ZH5 A;  1VQP I;  2NS0 A;  1QVT A;  2QWW A;  2QLZ A;  1UEL B;  5K7Z A;  1XCV A;  1T0F A;  1W5T A;  3VYR B;  4TV7 A;  5ICG A;  3IWZ A;  2ZNZ A;  4XLC A;  2QKM B;  3ASO H;  3I4M J;  3AG2 H;  1MH4 A;  3R61 A;  1G59 A;  1HKS A;  3KP4 A;  4RLQ A;  1W0U A;  2RC4 A;  4HA8 A;  3RTR A;  4OAZ A;  3DF8 A;  4OAY A;  4IOC F;  5JLW A;  5BNG A;  2F2E A;  5HOD A;  2ELK A;  2W4S A;  3U21 A;  4D1Q A;  3CCL I;  1Y0U A;  1MND A;  3K4M A;  3J81 Z;  2EV0 A;  2MLK A;  1SMY F;  4EJU A;  4GYI A;  2GWR A;  3K10 A;  5C4X J;  1OCZ H;  1TLH B;  2FD5 A;  1UZC A;  1V5F A;  3OMY A;  2IGO A;  3FXK A;  3PNT A;  5HNF A;  2JSC A;  2HPI A;  2WWY A;  2WB1 N;  1ZK8 A;  3G73 A;  3MZ8 A;  4D7N A;  3I54 A;  3BZC A;  3EUH C;  3H0D A;  3RCO A;  2L9V A;  4AU7 A;  1YFH A;  2ISY A;  2ZJQ F;  2ZXH A;  3K4B A;  4PFO A;  4GO1 A;  3O6B B;  2IW5 A;  3ABU A;  2OU2 A;  1MSE C;  2M4K A;  2W24 A;  4CCJ A;  5H20 A;  5JVT A;  2F5V A;  4XOT A;  4BQA A;  2GM4 A;  1QZZ A;  3U1D A;  3BTI A;  1VTN C;  3EDP A;  2HYG D;  3ECO A;  4EEF G;  4ZDL A;  2BEO A;  2K3F A;  4DQ2 A;  4L5I A;  4ZC3 A;  4HNU A;  1XSV A;  4EMS A;  2M45 A;  4BH9 A;  1SVO A;  3EQL F;  1P7I A;  4M6X A;  1VQM I;  1K4S A;  3M4O J;  4ENM A;  5FLV A;  1O3Q A;  1D5Y A;  2NS7 A;  1LDD A;  1T08 B;  4PCQ A;  1DDN A;  3QOP A;  1RET A;  4QIW N;  4E7I A;  2ECC A;  1NTC A;  3FXM A;  3CES A;  2EZI A;  2FNA A;  3L1P A;  1LFU P;  4F91 B;  4M3F A;  2CFO A;  1SD6 A;  1ZLJ A;  3CDH A;  3W6J B;  3HPG A;  4YRV A;  3L2R A;  4BHP A;  1UAA A;  4UV9 A;  1F1Z A;  3REO A;  2F4M B;  2XGC A;  1NG6 A;  2VQC A;  1FT9 A;  5EEG A;  1B1B A;  2QSH X;  3KIO A;  4HST A;  5E3M A;  3WHC A;  4LLL A;  5HDG A;  2PMZ A;  4IF4 A;  2R5Z B;  1XMK A;  3W2V A;  3AG1 H;  4NNJ A;  5GAG J;  4FE7 A;  4C3I J;  3OYM A;  2VOP A;  2ZJ2 A;  3B02 A;  3HIF A;  1ZAO A;  1XDU A;  5FKL A;  5JLX A;  2R7Q A;  1O7L A;  2L7K A;  4U0W A;  1P92 A;  2ME0 A;  2DDA A;  3K9T A;  5HLH A;  3F0C A;  2A6H F;  4FAS D;  4BHB A;  4GRI A;  5DDG A;  3C2G A;  3IV5 A;  3AG4 H;  2DQL A;  4EJT A;  2RDP A;  3NRV A;  5J4V A;  2O61 A;  3DV8 A;  5LHI A;  2H09 A;  3FIW A;  5HNH A;  2OCC H;  3ZQQ A;  2VC1 A;  4PSW A;  4J01 A;  4HOB A;  2PEX A;  2C6Y A;  3GF2 A;  1FBS A;  2J5P A;  3FMR A;  4X6A J;  3PSF A;  2HQN A;  2NOJ B;  3K4J A;  4FCY A;  2STT A;  2L9R A;  1MMN A;  2HKO A;  4BJT A;  3RIR A;  2KRH A;  1ZQ3 P;  1YYV A;  1I27 A;  4XL9 A;  4GFB A;  3KX2 A;  1UHW A;  1X3W B;  5J6X A;  3HRU A;  1QZE A;  4RGS A;  1Q1V A;  2R7S A;  4LK0 F;  3WTY C;  5HLG A;  3KYL A;  1L0O C;  4II2 A;  4WF2 A;  2BYV E;  3HGG A;  1DP3 A;  2WAE A;  2DPD A;  1JUM A;  4E7S A;  3BR0 A;  1R9T J;  1EKE A;  1WJC A;  4C2U A;  2HVR A;  3I0T A;  3UKG A;  3HHH A;  4U87 A;  4XRM A;  2P0W A;  2XPU A;  1AHD P;  4FE4 A;  1IUY A;  4A2U A;  2Z3Y A;  1WWX A;  3L2V A;  4P55 A;  2LY9 A;  2M4G A;  3DKY A;  3OYJ A;  2WY7 Q;  1T6S A;  2M1B A;  2F4I A;  4D9J A;  5KHD A;  2IS2 A;  3LQR A;  4HG2 A;  4LLG F;  4MEY F;  4A3E J;  2WAD A;  4ESJ A;  3FHN A;  3GTJ J;  4NQW B;  2MH2 A;  5A2Q K;  9ANT A;  1YS7 A;  3CMY A;  4RMN A;  4QLC U;  4IX7 A;  3ERM A;  3ZMT A;  1KQ0 A;  5ICC A;  3JCU C;  4XRS A;  5F1R A;  2OUM A;  3GTQ J;  1DPU A;  3FXQ A;  3GTM J;  1YJN I;  4RB3 C;  4B3X A;  1R71 A;  2E1M B;  1IZ1 A;  2ZXJ A;  1BIB A;  3LSH A;  3HHG A;  2NVU B;  1YG2 A;  1U5T B;  1FOK A;  2F6C A;  1S3J A;  2BVL A;  3BR1 A;  2OTJ I;  1IN7 A;  3I4N J;  2E2I J;  4CA0 A;  1MW7 A;  3EYY A;  4EV0 A;  4ZZL A;  2EFP A;  3ZMZ A;  5LFA A;  1S6L A;  1OQY A;  1R23 A;  3OL4 A;  1RUN A;  1YW9 A;  3V42 A;  1ZTR A;  2VKV A;  4L9V A;  2PJR A;  5E1W A;  2LSO A;  4L0Z B;  2H1L A;  1X4P A;  1G3T A;  2WA0 A;  4BKX A;  2HPM A;  4D5F A;  1MMG A;  1XGN A;  3F72 A;  3H35 A;  4PJM A;  1BC8 C;  1OMI A;  1PVE A;  2B63 J;  3GXO A;  4L18 B;  1IRX A;  5L3D A;  3K70 C;  1XS9 A;  2DDB A;  1LEA A;  2R7F A;  4G9Y A;  4I6Z A;  5J3L A;  3FXR A;  2JZY A;  3CJQ B;  2CS3 A;  3PQJ A;  3K2Z A;  3U1K A;  4NDL A;  4WX9 A;  2ELJ A;  2R7D A;  4G7O F;  1V55 H;  3ZP5 A;  4BQO A;  2JN6 A;  3PIO F;  2W7N A;  4UXN A;  4XBF A;  2HR3 A;  4DYC A;  3DLL F;  2F5D A;  4H4K C;  3OOP A;  2DTZ A;  2RV8 A;  3HC7 A;  5D6F A;  4IHY A;  2ZXW H;  5E18 F;  3RZD J;  1JTY A;  2M8G X;  2F5F A;  2DU9 A;  2DA4 A;  1IN4 A;  4I76 A;  2X51 A;  4XRF A;  4U0V A;  1U78 A;  4LG3 A;  1VZ0 A;  3FXO A;  1FYL A;  3DBH B;  4GYG A;  3MKL A;  2FXA A;  3LOC A;  3MKY B;  2ACJ A;  3PO3 J;  2B7E A;  2DMU A;  3GFM A;  4HX7 A;  1G3Y A;  2MLG A;  2IGM A;  2V26 A;  1Y56 A;  1HKT A;  4OMZ A;  2K85 A;  3I3L A;  4OMY A;  2DBB A;  3JRE A;  4YG2 F;  1TZL A;  4BJ5 C;  2GBY A;  2DK5 A;  1BR4 A;  3LWF A;  2M2E A;  3HKZ A;  3OWT A;  5K5Q A;  5LHH A;  1OR7 C;  4F92 B;  3Q9V A;  2QEX I;  1FBU A;  3TP0 A;  4CIC A;  4HV5 A;  3B6C A;  1TNT A;  3MZY A;  1X1C A;  4Y52 J;  2W84 A;  5FLM J;  3GZ6 A;  3PUB A;  1X1A A;  5EZG A;  3DPT A;  3SXY A;  1IG7 A;  3KYD B;  3GEZ A;  4M6V A;  4W97 A;  4BJ6 C;  2JQ7 A;  5ILS A;  3UNG C;  2ZFU A;  5GP9 A;  2LKS A;  4GXO A;  4ETS A;  4HPQ A;  3TO9 A;  3KP5 A;  4XIC A;  1FSH A;  2KIQ A;  1Z9C A;  2K4J A;  2Q2E A;  4IQJ A;  2NXN B;  1PJR A;  3EUK L;  3GBG A;  4B8X A;  4PK4 A;  4YII A;  1MJA A;  2HQA A;  3BT9 A;  3H5A A;  2YX4 A;  1QU3 A;  3SZP A;  2I5U A;  1HDP A;  2QUF A;  3B6A A;  5KNL A;  2H6C A;  3IH3 A;  3K4N A;  5J1Y A;  1VQO I;  2X6X A;  2KL4 A;  4BE0 A;  4NBQ A;  5C3E J;  5LGU A;  4RB2 C;  1LVA A;  1MBJ A;  3S8P A;  2X85 A;  1MMS A;  2K7L A;  2VE8 A;  5CVJ A;  3W3C A;  3JRH A;  5BPD A;  5CQG A;  2X1D A;  4F52 A;  1E3O C;  1U9N A;  4MLO A;  4CZZ A;  2EFN A;  2O9L A;  3ZCO A;  1GLN A;  1IJW C;  2XAG A;  2NOG A;  4D5C A;  3AAF A;  1TQI A;  2WAQ A;  5CVR A;  3HYI A;  4M3E A;  4XMY A;  1K79 A;  2KFD A;  1JT6 A;  3N05 A;  5K7H A;  3N4M A;  3G71 I;  3TKY A;  1S7E A;  1DQU A;  3CCY A;  3VYT B;  3IC7 A;  1HW1 A;  2O0Y A;  5L3C A;  4BUP A;  3F8F A;  2V9P A;  3DBL B;  2QEN A;  2DPU A;  1UST A;  4K2E A;  2H94 A;  3GFI A;  2ZJP F;  4A6D A;  3OYC A;  2EA4 A;  3BR5 A;  3J81 K;  4HF1 A;  1R4N B;  4A12 A;  1QO0 D;  2BY3 A;  3ESW B;  2CV2 A;  1XSX A;  2V6C A;  3SHF A;  2ETH A;  5ILV A;  2V1D A;  4AYB N;  3ISP A;  2ZNY A;  2MC3 A;  3LSK A;  4AIJ A;  2LLK A;  5IYD J;  3JAM Z;  3JRD A;  1UCR A;  2P8T A;  2HKX A;  2Y69 H;  3IH2 A;  2X6Y A;  2K27 A;  2XAS A;  1FX7 A;  1ZR4 A;  3CP8 A;  4G94 A;  3CCM I;  3CDL A;  1AWC A;  5IT3 A;  5B5E C;  3I9V 2;  1S7O A;  1I6H J;  5DEQ A;  3X2Q H;  4ON0 A;  1X3Z B;  4B44 A;  3GLX A;  3DXJ F;  1S72 I;  2XRL A;  3BJ6 A;  1PP8 F;  3EPZ A;  2Y0S N;  4YFN F;  3PNV A;  3FBI B;  2EV5 A;  2PG4 A;  4LK1 F;  2JA7 J;  5D4R A;  2E1M C;  2CWE A;  1U5T C;  3EYI A;  1BW6 A;  1VF9 A;  3E0J B;  1D0X A;  3F21 A;  3N97 A;  1F43 A;  3EUH A;  2RQP A;  5GTI C;  2DO7 A;  4BY1 J;  1Y6I A;  3I71 A;  5IYB J;  5H6Q A;  4LIV A;  1MBF A;  2OTL I;  1HKQ A;  4PUS A;  3RPU A;  4UUS A;  1RR7 A;  1P6R A;  3HM5 A;  4BBR J;  5LGT A;  2IS6 A;  3ZN1 A;  3OYF A;  2KIS A;  1CF7 B;  1IDY A;  3FKI J;  2KDZ A;  1CGP A;  3OYA A;  4BEH A;  4MGR A;  1UHM A;  2Q1Z B;  2K9M A;  2YPR A;  2NVX J;  2P7C B;  4WK8 F;  4BGD A;  1PUE E;  3O8H A;  2UWM A;  4KIF A;  3TP3 A;  4EM1 A;  1G2H A;  2A5Y B;  2E35 A;  2V7F A;  4B3A A;  4DYR A;  1FIA A;  1FIP A;  1K78 A;  2GIV A;  4I01 A;  2EA2 A;  1B72 B;  1AU7 A;  4N9H A;  3F6O A;  3K4C A;  1ZG3 A;  1VQ8 I;  3V8K A;  2R7V A;  4R79 A;  4RGR A;  1B8I B;  2LFB A;  3WTT C;  2G0E A;  3LNQ A;  2JA5 J;  2XGD A;  2EQR A;  1K61 A;  4HZF A;  3GTO J;  2RRE A;  2AO9 A;  1APL C;  4UUT A;  4DOZ A;  5IOZ A;  4HRI A;  4WCG A;  1UMQ A;  2O7O A;  4I2O A;  2HVQ A;  4XLN F;  2GLO A;  1BI1 A;  3BJA A;  2Y30 A;  1D1A A;  1R49 A;  2CQK A;  4C9Y A;  1S8N A;  2CQN A;  4AC0 A;  4BY7 J;  5CVV A;  5LD2 C;  3BTL A;  3IRR A;  3MMY B;  1GVJ A;  2BE5 F;  2Y2Z A;  5D8L B;  1M1E B;  2HNH A;  4BBS J;  2DFF A;  4MQV A;  2ID6 A;  1EA3 A;  2A5W A;  3QYE A;  3F22 A;  4B09 A;  2IP2 A;  3SFZ A;  4UB8 C;  2QYO A;  3WGI A;  1FP1 D;  2VUM J;  1SD5 A;  2N8G A;  4KDP A;  4CUG A;  2LKX A;  1BI0 A;  3LQQ A;  1F9N A;  2GOM A;  4KMU X;  1R5H A;  1UHS A;  2L9S A;  4A3D J;  1ETY A;  5B1A H;  5K5R A;  4H0E A;  3M1C A;  2L7Z A;  3KFW X;  2OF7 A;  2DA6 A;  4ZTF A;  3CZ6 A;  2QKL B;  3IAM 2;  2P6S A;  2WY8 Q;  5LLQ A;  5BPI A;  2EK5 A;  3V4G A;  3LSG A;  3S2D J;  4FTH A;  1P9Q C;  2DTR A;  2R7Z J;  2V79 A;  1I1S A;  4A93 J;  5L3F A;  2M3A A;  2Y9Z A;  2V9K A;  3BZK A;  2R0Q C;  1SAX A;  3DEW A;  3GW2 A;  1SFK A;  3ABK H;  4NHJ A;  1OIS A;  1U8B A;  3H5R A;  3GVA A;  4A3F J;  5IP9 J;  2DA7 A;  4RAZ A;  1UJ8 A;  4YIF A;  3S16 J;  1D3Y A;  3JRC A;  1YRN B;  2LRD A;  2ZKZ A;  2KJB A;  1W7P D;  3LSM A;  3CUO A;  2JTV A;  4Y13 A;  4IQ4 A;  3V8L A;  1KQ8 A;  1IF1 A;  2MH9 A;  3WG9 A;  1IGN A;  2FML A;  3GTK J;  4HQE A;  3OV8 A;  2VON A;  2Q0O A;  2Y9Y A;  3LA2 A;  1KON A;  2V9V A;  2VBW A;  1ZKG A;  2BY2 A;  4E7L A;  1N77 A;  1SAU A;  4P1W A;  4XLA A;  2CW7 A;  1TWG J;  4JQF A;  3CJR B;  4PGG A;  4CCM A;  3T1B A;  4Q5S F;  3LSJ A;  3Q0W A;  3W6V A;  2DYR H;  1YI2 I;  2NVY J;  1J0R A;  2B0L A;  2CW8 A;  2HOS A;  5CVI A;  3GFL A;  1H88 C;  1J59 A;  2X4H A;  1GV2 A;  5L3G A;  1VQK I;  3VYS B;  2XKP A;  1HDD C;  5F04 A;  4A69 C;  2XGE A;  3C1D A;  3G4S I;  1P4W A;  4CSW A;  5J8F A;  1MMA A;  4CYD A;  3J7A O;  5CQE A;  1ZGA A;  2L7M P;  2LC2 A;  2OPT A;  2PMZ N;  4ESB A;  1AKH B;  4AD9 A;  5EGO B;  4IXA A;  5HLI A;  2CUZ A;  3R6S A;  5M3M J;  3OYI A;  3M7G A;  1K4T A;  5BMZ A;  3WTS C;  1X1D A;  2LRE A;  1HC8 A;  4Y33 A;  4RA2 A;  1MDM B;  3QU6 A;  2YR2 A;  1IUF A;  3WTZ A;  2BV6 A;  3A4C A;  1B9M A;  1HQC A;  1XGO A;  4IRH A;  1IRF A;  4M72 A;  4V19 K;  3P9I A;  1HF0 A;  2ZME B;  5LRR A;  5B3S H;  2ME6 A;  2DQR A;  3H1C A;  2HU9 A;  1ON2 A;  3H0G J;  4NC7 A;  4V2F A;  2VQH A;  3KCC A;  4ENN A;  5DCM B;  3TQN A;  1D1C A;  3NWS A;  2EFW A;  1U8R A;  3J7A Y;  4CYC B;  3PNY A;  4YEJ A;  4XKC A;  1ODD A;  1NG7 A;  1XCB A;  3JRA A;  2LP0 A;  2KIF A;  4A5M A;  3P7N A;  2X1E A;  4CO8 A;  3WTW C;  1WSU A;  2Y48 A;  4BE2 A;  1I50 J;  2DFE A;  4L5E A;  2JPB A;  4B4C A;  1ENH A;  3GCM A;  4M3B A;  2DMT A;  3KZZ A;  1KYW A;  5TJJ A;  2R7O A;  5DUK A;  3LAP A;  1T33 A;  1QQI A;  1DUX C;  4OOI A;  3E7L A;  2R7X A;  2QQ9 A;  2FX0 A;  3OSF A;  2HS5 A;  4PJJ A;  1KQ9 A;  3SZT A;  1QHG A;  3I53 A;  3DBR B;  4RM2 A;  1I5Z A;  4UVC A;  1FOW A;  4CHU A;  1YS6 A;  1BL0 A;  3NAU A;  1WGX A;  2EJR A;  2K86 A;  3FKJ A;  2VPR A;  4PJN A;  2JA8 J;  2QQ8 A;  2CU7 A;  3K1M A;  3OSG A;  3LST A;  5DTD A;  5FD6 A;  4ZDP A;  3TW7 A;  2IA1 A;  1TT0 A;  3DWL E;  1XX5 A;  1G3S A;  2Y31 A;  4WXC A;  1LQ1 A;  3M8F A;  2HQR A;  5FKO A;  1T38 A;  1RKT A;  3L7W A;  3SJM A;  2IA2 A;  5FB2 A;  4BQQ A;  4II3 A;  1Z7L A;  2TCT A;  2ESN A;  3BG7 A;  3WHB A;  3KEY A;  1OR7 A;  1CQT A;  4IEJ A;  2IJL A;  3BDD A;  2VPL A;  3WOD F;  4E7Z A;  3V7R A;  1JHH A;  4UVB A;  4IHW A;  3M8E A;  4ZDO A;  4U7D A;  1U2W A;  2EWN A;  1SFO J;  4J00 A;  2R5Z A;  2HXI A;  1A04 A;  3VEP A;  4WWC A;  4RS8 A;  3D5S C;  2KRC A;  2LH9 A;  2PQ8 A;  2X6O A;  3PQK A;  4A3M J;  1T95 A;  4R1H A;  1RRJ A;  1ONV A;  1Z91 A;  4A6E A;  3ZGK A;  1MBH A;  1XN7 A;  1G4D A;  2P5K A;  1USS A;  1YO5 C;  2H8W A;  1LKX A;  3VYU B;  3F6V A;  5E20 A;  1PDN C;  3QQA A;  3C3W A;  4G7Z F;  2BXZ A;  2LR8 A;  1HSJ A;  3P5J A;  4IOA F;  2M5W A;  2GQQ A;  4RB0 A;  3VWB A;  2OJE D;  4BXU A;  3FM5 A;  2LY1 A;  3CLO A;  3SEQ A;  1JE8 A;  3GO5 A;  1X19 A;  3CCV I;  3K1N A;  4GGG A;  3Q0V A;  2E2H J;  1TT5 B;  4XM3 A;  3OIP A;  2VN2 A;  3CCJ I;  2JA6 J;  1AA7 A;  5F0F A;  2L54 A;  2M8E A;  1LJ9 A;  2F48 A;  2JT1 A;  3NEU A;  4AVP A;  3JAM K;  3BPV A;  2JRT A;  3QU3 A;  3CLQ A;  1FBQ A;  3ERE D;  4NUB A;  5CYV A;  4C2T A;  3FX3 A;  2D1V A;  3FMS A;  2EH3 A;  4NB5 A;  4XLF A;  3KET A;  1FOY A;  2DN0 A;  2F5C A;  3E6C C;  5DD8 A;  1W4M A;  2E1N A;  3DQV C;  3WU1 B;  4L9T A;  1MBG A;  4XKW A;  4QPQ A;  2XRN A;  4L5J A;  4I09 A;  3WTV C;  2H27 A;  4KMF A;  3HOX J;  1WH5 A;  3MQ0 A;  3HKZ N;  2UXN A;  1ZEL A;  3IL2 A;  1RES A;  4E6K G;  1A35 A;  1ACI A;  3OYK A;  3HOT A;  2CQX A;  2YU3 A;  3D0S A;  4ENJ A;  1SAN A;  1EF4 A;  2HQ5 A;  1ETX A;  2K9N A;  2LK2 A;  1MZB A;  3BPX A;  2VQG A;  4C3J J;  3E5X A;  3OYH A;  2DMN A;  4Q48 A;  3T8T A;  4NQW A;  5B66 C;  3S14 J;  2KIM A;  2JK3 A;  1YJW I;  5AIQ A;  3TED A;  3BC8 A;  4UB6 C;  1Z3Y A;  3JRI A;  3CF5 F;  1MBK A;  4KT5 C;  4MNU A;  2QVO A;  3K70 D;  1QA6 A;  3F9K A;  2VC0 A;  5BOX A;  2M34 A;  1ETW A;  2BXY A;  3HOW J;  3KP3 A;  1OCP A;  1U5T A;  2ZB9 A;  3A02 A;  4M9Z A;  4P9F A;  3L09 A;  2ZME C;  5E17 F;  2YU9 J;  1Z21 A;  1S9H A;  1YIJ I;  2HYF A;  3KZY A;  3O3K A;  3ZQC A;  3PJR A;  1R6R A;  3GX4 X;  3EET A;  4RBO A;  5E3N A;  2XSJ C;  1ULY A;  3LMM A;  4XQF A;  1YJ9 I;  5C44 J;  1G8X A;  3P9C A;  1TBX A;  2VLA A;  2OQR A;  4S04 A;  4ZYA A;  3VDX A;  2XKO A;  3G1M A;  3ZMU A;  5LRS A;  1U6G A;  2CFX A;  2EB7 A;  1BA5 A;  1ORK A;  2EIN H;  1OFC X;  2LY2 A;  4HYE A;  2WAQ N;  3GZ5 A;  1H0M A;  3KLO A;  2MC4 A;  1H8A C;  3T0Y A;  4XLP F;  1T56 A;  3V8J A;  2XF5 A;  4A3L J;  2ZSI B;  1IC8 A;  5HLT A;  4KFC A;  2KMU A;  4YIR X;  2GOX B;  2VT2 A;  2OV7 A;  4HSR A;  4N4O B;  5M5W J;  2R93 J;  2JUG A;  4CGZ A;  2VL8 A;  4B47 A;  3HB9 A;  4MFD A;  4XKV A;  1SEU A;  2QZ8 A;  3M9A A;  3U2R A;  2F5E A;  4HQM A;  3AKZ A;  3L2C A;  3CCS I;  1QPI A;  4KNY A;  3MEX A;  2MD0 A;  2LMD A;  2BBY A;  2PBI A;  3PSI A;  2P81 A;  2VT3 A;  1QZY A;  4YFX F;  2ELH A;  4HNT A;  2X0L A;  3FMQ A;  1REP C;  5D5V B;  5FLX Z;  1MSF C;  2B9S A;  4XON A;  5E3L A;  3ZMV A;  3ZQG A;  2KJC A;  1IXC A;  2HDC A;  1GUU A;  4UV8 A;  1K7A A;  2HEO A;  2RAE A;  1FMW A;  3PO2 J;  1WJA A;  1P4A A;  1XTA A;  2IAI A;  3BJO A;  4ZH4 F;  4J19 A;  2PLY A;  3VSK A;  2XAQ A;  2GXA A;  2V1U A;  3S2H J;  4OU0 A;  1BM9 A;  1W5S A;  2BGC A;  2DI3 A;  5F1J A;  1I6X A;  1WJ5 A;  4LGW A;  1IRZ A;  2IXS A;  4A3C J;  2AXT C;  3OYL A;  1ZG1 A;  1B6A A;  3H9G A;  3Q3S A;  3KEQ A;  1RC9 A;  1XMA A;  3RI4 A;  1HCR A;  3DCF A;  2GA2 A;  4ENK A;  1I3A A;  3H9J A;  4LMY A;  4Y4R A;  4KJZ A;  1QHH D;  2Z9O A;  1BOA A;  1Z7U A;  3CMM A;  4BDZ A;  3BWG A;  4KYW A;  3Q0U A;  3HOY J;  2GXG A;  4X1E A;  5M3F J;  3FK7 A;  2XHK A;  3DFG A;  4XNF A;  3OS0 A;  2JJ7 A;  2ZXI A;  2VKE A;  1EH8 A;  1A6I A;  3LSR A;  1D0Z A;  4V2G A;  2Z1D A;  1JJ6 C;  1FYM A;  1GHC A;  1Z3X A;  3I59 B;  3VOE A;  2AXL A;  1MGT A;  2XPV A;  3BY6 A;  5TIS C;  1ETK A;  4KIB A;  2P7V B;  5D4S A;  5LEJ A;  4FHT A;  4IHT A;  4DBQ A;  1R5G A;  1A36 A;  1T8I A;  2V1X A;  1V54 H;  2KDO A;  1OYY A;  3TL4 X;  4EM0 B;  2RN7 A;  1OCC H;  4XN3 A;  3MCZ A;  1IXS B;  3KLN A;  4EVI A;  2EZK A;  1IW7 F;  3RSN A;  3SZG A;  2PI0 A;  1VQL I;  1XGM A;  3DU6 A;  4A3B J;  2VKH A;  2IS4 A;  4I0A A;  4NC6 A;  4E70 A;  1MJB A;  3B73 A;  2VJ4 A;  3VSL A;  2ADU A;  4RAG A;  4HF0 A;  3M1E A;  3MZH A;  5JFR A;  4NC8 A;  5FRN A;  5D5X B;  1EH7 A;  2DA2 A;  2LKP A;  4E4H A;  2KLO A;  3ABL H;  4I7H A;  1NK3 P;  2QSF X;  2MGQ A;  2P4W A;  2MAB A;  1O7F A;  3OIQ A;  2YUS A;  2UV1 A;  4AM3 A;  2EZL A;  3BG6 A;  1XPX A;  5CVU A;  2M9H A;  2X6W A;  3S15 J;  4G8X A;  1IXR C;  2IGN A;  4CZC A;  1JKO C;  4G7H F;  1F4K A;  1OCO H;  1WFX A;  1TWC J;  4FET A;  3SFI A;  4MO7 A;  3PFI A;  1J7K A;  2K02 A;  3Q5F A;  3ZR8 X;  3BTC A;  3BCB A;  4IHS A;  3CCR I;  4C2M J;  3PFY A;  1Y1W J;  3F8N A;  1BC7 C;  3WTU C;  2PMH A;  2FRH A;  3OY9 A;  3HRS A;  3M07 A;  1FMV A;  4EQQ A;  5DM7 F;  4UHT A;  1V5G A;  5D8K B;  2QCO A;  2OAZ A;  2XV4 S;  3F8C A;  1S29 A;  2H1K A;  2AQF A;  1BR2 A;  1T2K A;  1VQ9 I;  5IT9 Z;  3HOV J;  1B9N A;  1JGG A;  3K7A J;  2PFB A;  1X2N A;  2QQA A;  4JP0 A;  4IL6 C;  1QVU A;  5CKT A;  2FSW A;  3OYB A;  2VOO A;  5C4J J;  2QBY A;  4FQG A;  1CF7 A;  2LNB A;  3S93 A;  4WXD A;  2E1C A;  1W7P B;  2CUF A;  2IBD A;  4LJZ F;  1ZLK A;  1EH6 A;  5F64 A;  3H3U A;  3H5N A;  2G7U A;  2RKH A;  2QBY B;  2COM A;  2JA2 A;  3S1Q J;  2XGX A;  1TQP A;  1HST A;  5K5O A;  1B72 A;  4MIM A;  2XAH A;  1OYW A;  2XF6 A;  1BI3 A;  2VE9 A;  2AQE A;  5IP6 A;  1ZYR F;  1B8I A;  4CCO A;  4IRI A;  2KIU A;  2XRO A;  3CCU I;  5F6F A;  3MKZ A;  1BJA A;  1XMX A;  2Z99 A;  3KEO A;  2HFH A;  3JRF A;  3JRG A;  3LAJ A;  5ERI A;  1Y8R B;  2CW0 F;  2BHY A;  1LB2 A;  4G6Q A;  3KE2 A;  3E5Q A;  1P7J A;  2CQQ A;  1W36 D;  3A0H C;  1TWH J;  1WKM A;  1ZHF A;  1QBJ A;  5HS8 A;  4DZP A;  1LUJ B;  2G7H A;  4LIT A;  4HDU A;  2MD5 A;  3CUQ B;  4I98 B;  1B4A A;  3OL3 A;  4R8H A;  1X1B A;  2QSG X;  3E5U A;  3VPR A;  1RPW A;  2MW8 A;  4ZTJ A;  2BW3 B;  2IGK A;  2X48 A;  2KZV A;  3HUG B;  4PFP A;  5EG0 A;  3HOU J;  1FWZ A;  5BS6 A;  3O2P E;  5LEK A;  3C7J A;  3E6D A;  2WV1 A;  4F7Z A;  3JTG A;  1A6Q A;  1TTY A;  1TWF J;  3FDY A;  2L3D A;  4KUM A;  1LDJ A;  2QGU A;  1YHQ I;  2W25 A;  1D8K A;  4DJA A;  3HSF A;  3I5U A;  2OZ6 A;  3NWT A;  3WE3 A;  4XR6 A;  5EG0 B;  4X0G A;  2PMU A;  1XGS A;  4ZZD A;  3AG3 H;  4BAC A;  5J1U A;  1GDT A;  3K2A A;  4N9I A;  3ZOB A;  1DGW Y;  1O57 A;  4XOP A;  2P5L C;  3RKY A;  1KYZ A;  3DP7 A;  4XSX F;  1K6O A;  2FBI A;  3TDZ C;  4MTE A;  5H2F C;  1KU2 A;  5E1Z B;  3I56 I;  3A01 A;  1STZ A;  1HA8 A;  1QGP A;  4QWQ A;  4BAY A;  3CMA I;  4P5O A;  3CC2 I;  1D0Y A;  1YQA A;  4G6D A;  3HBL A;  1TL8 A;  5J47 A;  2X9D A;  4MEX F;  2COB A;  3U9G A;  2D1H A;  3S1R J;  4ZYD A;  1RIO H;  3GZN B;  1YRN A;  5FD5 A;  3CO7 C;  1JUS A;  1FC3 A;  4PJ0 C;  1OJL A;  2A6E F;  3T5X A;  4BU2 A;  1C0W A;  3ECH A;  3A01 B;  4M9X A;  1HLV A;  2E71 A;  3DTK A;  4F93 B;  4LB6 B;  1JHF A;  1FZP B;  2X1C A;  2ZCW A;  4HDV A;  4KN4 X;  1ZAR A;  4CDG A;  4U0Y A;  3WU0 A;  3SQN A;  3AL0 B;  4PGH A;  2JRM A;  3GME A;  3QYB A;  4LFU A;  1G3W A;  4LD5 A;  3F23 A;  1WZ2 A;  2VXD A;  3GFJ A;  2JUC A;  2CMP A;  5ILU A;  1V3F A;  3F8M A;  1TNS A;  2P5V A;  1Y8Q B;  2W82 A;  3C18 A;  3T8R A;  5GAE J;  5FO5 A;  5D5U B;  3J7Y J;  2ESH A;  1IAW A;  5HS9 A;  2CRG A;  1KU9 A;  3IKT A;  1GXP A;  4LB5 A;  1N75 A;  3FXU A;  4CCL A;  1TC3 C;  5BQT A;  2Z16 A;  4A0Z A;  3S32 A;  3VFZ A;  3BR3 A;  3DPL C;  5GPC A;  3ULQ B;  1D1B A;  3OYN A;  1POG A;  3HRM A;  5EDN A;  3L2U A;  2K9Q A;  1K78 B;  2R4G A;  2XC7 A;  2YSR A;  5EGO A;  1E3P A;  4F3Q A;  2VOD A;  3FZV A;  4DIQ A;  4ITV A;  4S0H B;  1WJE A;  4BXF A;  3CC7 I;  2A6T A;  1E2X A;  1RR8 C;  1FSE A;  3K0L A;  4Y15 A;  2UUZ A;  4A0Y A;  1AOY A;  1MDM A;  4HLX A;  3FXL A;  3FM3 A;  2XAJ A;  3OYD A;  1O3S A;  1FY7 A;  5EF6 A;  3RPU D;  2ZME A;  2D2W A;  1I39 A;  2E34 A;  5JVG F;  1ETQ A;  2W00 A;  3AFH A;  2DFH A;  2A3S A;  5DCM A;  4HX4 A;  4XID A;  4CYC A;  1DP7 P;  5F27 A;  3OS2 A;  2DMP A;  2DOA A;  2OC6 A;  4KN7 X;  2LVS A;  3RYP A;  3WG7 H;  2M7B A;  2XDV A;  3A0B C;  3TO7 A;  2GIZ A;  3FXJ A;  3DLA A;  1VQ7 I;  3RZO J;  3QPH A;  1SD7 A;  2VQL A;  1QRY A;  5FLX K;  3MFK A;  1ETV A;  2CV0 A;  2RVC A;  3CO6 C;  3CP2 A;  2DOF A;  1WRJ A;  3HTU A;  2E2J J;  4XN0 A;  2ECB A;  4DW6 A;  3PUF A;  1J9I A;  3OIO A;  3TGN A;  1MIJ A;  2R5Y B;  5EJC A;  1IDZ A;  2F4O B;  3D5R C;  4KT6 A;  3ABM H;  5B1B H;  4ABZ A;  1FYK A;  2CYY A;  5IY5 H;  1LVK A;  3QRF F;  2L4A A;  5GAD J;  1YE9 A;  3NQO A;  2K4B A;  2O8K A;  2R7T A;  1LFB A;  2MFZ A;  5KAF C;  3RJP A;  5DD4 A;  3TO6 A;  3I55 I;  5E1X A;  3ROU A;  1OCR H;  3L00 A;  3ZMS A;  2VBX A;  3HEF A;  2LF7 A;  1LE8 A;  1IN6 A;  1RNL A;  2HOE A;  2HTS A;  1J5Y A;  2DXI A;  3QPS A;  3E1S A;  3FBN B;  1J09 A;  3S1N J;  2A61 A;  4P9U A;  4RM3 A;  3DKW A;  1Y39 A;  2ZFW A;  1V4R A;  4BE1 A;  2EIL H;  3E3V A;  1SFU A;  1WH7 A;  3CUQ C;  2R3S A;  1LE8 B;  5L3E A;  3RKQ A;  1MKM A;  3KPH A;  3HRT A;  1X58 A;  3KP2 A;  2V1N A;  1JTX A;  1XG1 A;  2NAZ A;  2RNJ A;  4PJL A;  5KCM A;  3S17 J;  4OIN F;  3W2W A;  2A07 F;  2IPQ X;  1SC7 A;  2I10 A;  4DYQ A;  3I4P A;  2DFI A;  1I1G A;  5DV5 A;  3CCE I;  4JOM A;  5DS9 A;  5E3O A;  3CF2 A;  1SFX A;  1W0T A;  1FEX A;  3HGY A;  3BCA A;  4I99 C;  3R4K A;  4BL0 B;  1GT0 C;  4BNC A;  1LNW A;  3QOD A;  3MD2 A;  2K9S A;  3SYT A;  2VXZ A;  3F3X A;  5FGM A;  2E60 A;  2EBI A;  3GTP J;  4OIO F;  1JXS A;  2MSY A;  4ZYG A;  1FTZ A;  3BP8 A;  3ZQ7 A;  1UFM A;  3OS1 A;  2NNN A;  1TW2 A;  4D7M A;  4EJV A;  4O6J A;  4A3I J;  3S1M J;  2L7F P;  1HBX G;  3IHU A;  1VFC A;  1S5L C;  3BG3 A;  2BZT A;  3E6B A;  5FKN A;  2HYJ A;  1Z1D A;  3GTG J;  4DGW B;  2P6T A;  1A31 A;  2CQ7 A;  2KKO A;  4YEL A;  2DJI A;  1DPR A;  4RAY A;  2PJP A;  2WAF A;  2OA4 A;  4KIG A;  2NRA C;  2STW A;  3RKW A;  3W2A A;  5IPA A;  2K9L A;  4UVA A;  1IRG A;  2Z2S B;  4M73 A;  2O6G E;  1RKW A;  1WI3 A;  2PX9 A;  2LDU A;  2EIM H;  5F0H A;  3SDB A;  2FA5 A;  5CJ9 A;  3R0J A;  2KZG A;  4B1R A;  4HX8 A;  5D5W B;  1O4X A;  3EUA A;  1BR1 A;  1I3Q J;  4M3G A;  2E19 A;  5DYM A;  1R1V A;  1EV7 A;  3S2W A;  1LFP A;  2FOW A;  4Z6Y A;  5J1R A;  5AON A;  3AL0 C;  3LSP A;  3E97 A;  5TRD A;  2L4M A;  2FEZ A;  1DU0 A;  1HW2 A;  3LFK A;  5FRO A;  3D1N I;  1MMD A;  1Z6R A;  4C30 A;  1ZRF A;  5EZH A;  3TOA A;  3OR1 C;  1EJ9 A;  2HOA A;  2VBY A;  3WTX C;  4L0Y B;  1WHU A;  2Q8K A;  3JRB A;  3S3M A;  4CH7 A;  1HOM A;  5AIP A;  2CGP A;  4LIU A;  4DBR A;  3HDD A;  5IT9 K;  3BRO A;  3NAR A;  4JX4 A;  2FJ1 A;  4Y17 A;  3BG9 A;  3MAJ A;  1Z0X A;  4B43 A;  1J2X A;  1TW3 A;  4UUV A;  2EIK H;  3CD6 I;  1N25 A;  4IHV A;  3ZN0 A;  2XB5 A;  2DT7 B;  2WB1 A;  3V7S A;  3CJT B;  5EEA A;  3DKX A;  3TW6 A;  4BQN A;  4HW0 A;  5EEH A;  1PYV A;  4O3M A;  1JKR C;  4Y7N J;  3LSI A;  3SEZ A;  2AS5 F;  3O8G A;  2WTE A;  3I64 A;  3BR2 A;  1W1W E;  2CG4 A;  5F08 A;  2A69 F;  2KP6 A;  1GVD A;  4XOR A;  2A05 A;  4Y3O A;  4AUX A;  1F36 A;  1RI7 A;  3FK6 A;  4RB1 A;  1H9T A;  3H3Z A;  4PZJ A;  2NS8 A;  3P9K A;  3ELK A;  1AKH A;  1NK2 P;  3KYC B;  3SDG A;  1XB4 A;  2HXO A;  2WC2 A;  1TP4 A;  4HNV A;  2JVG A;  2WV0 A;  4XK4 A;  2K5C A;  1ZGW A;  2RGV A;  1E17 A;  5M5Y J;  2HDW A;  3DEU A;  1SMT A;  3C2B A;  2O8X A;  3IAS 2;  2O5R A;  1WCM J;  2IA0 A;  4HEA 2;  4Q4Z F;  1PP7 U;  2YX7 A;  3DU5 A;  2KQR A;  1KU7 A;  1OCT C;  2M0C A;  2FU4 A;  4BHC A;  3J80 Z;  3HXL A;  1FJL A;  4HBL A;  2GAU A;  4ZYH A;  4KA4 A;  1NHA A;  2XAU A;  2MYS A;  5L3B A;  5ICE A;  2HDD A;  3BQY A;  5E79 C;  1JUP A;  4MTD A;  2IEK A;  1T0F C;  1QPM A;  1FP2 A;  2VKD A;  3LL7 A;  3H36 A;  4I02 A;  2FE3 A;  4M3D A;  3FWE A;  3HOZ J;  1UG0 A;  5KK1 A;  4O5V A;  5CLS A;  2NNY A;  4U7B A;  3VB2 A;  3FF5 A;  1R4M B;  1HXD A;  4EAT A;  2O03 A;  3QOE A;  2M30 A;  2E7X A;  1ZG5 A;  4IHX A;  1X4O A;  4W1U A;  3JR9 A;  1FLI A;  4OIR F;  1A5J A;  2DT5 A;  2VJ5 A;  4EJW A;  2ZO4 A;  3QWL A;  1O3T A;  1Y0N A;  2DA5 A;  2LTP A;  5JHF A;  2R92 J;  1KA8 A;  2IT0 A;  2E1O A;  1MD0 A;  4ANJ A;  4EGY A;  2PJR B;  3KZI C;  1BOB A;  2PN6 A;  4MHG A;  3HPH A;  1GV5 A;  1B59 A;  4A3J J;  1H89 C;  1ON1 A;  1JJ8 C;  1RUO A;  2VAS A;  3MKW B;  1LDK B;  4M9S A;  3W6K B;  3LA7 A;  5CPR B;  3G1L A;  3JW4 A;  3BZ6 A;  1PUF A;  2MBF A;  3G3Z A;  3LA3 A;  4LOC A;  1Z67 A;  3RQ4 A;  2ICW G;  4G12 A;  5KAI C;  4JK1 X;  2DA1 A;  4CCK A;  4D0P A;  5HOO A;  2V4J C;  4L9J A;  2L0K A;  4E7H A;  1FPQ A;  1VQ6 I;  3KP7 A;  1J75 A;  4KIS A;  3G2B A;  1PUF B;  5IP7 J;  5FKK A;  1WQ2 A;  2W85 A;  3I59 A;  3QPL A;  1UG2 A;  2QF7 A;  2VJI A;  3IKV A;  1SD4 A;  1JKP C;  5DM6 F;  1RZ4 A;  4F55 A;  1D5V A;  3TDU C;  1IO2 A;  2RNG A;  2GZW A;  3IWF A;  3LFU A;  4Q47 A;  3G6E I;  3RQI A;  3COA C;  4UNO A;  3MWM A;  4GCV A;  5LHG A;  2LBF A;  1ZR2 A;  3JTH A;  2TDX A;  5J8C A;  1SVL A;  2MA3 A;  3GWZ A;  1FOX A;  3M8J A;  1YTY A;  1OKR A;  2E7W A;  3ABT A;  3PL8 A;  4FX4 A;  3K69 A;  4B48 A;  4S05 A;  3HJE A;  1JKQ C;  3I58 A;  2OD5 A;  1YIT I;  5F0C A;  1R00 A;  3TMO A;  3HSR A;  4FT8 A;  2LBF B;  4M71 A;  4EGZ A;  4PSX A;  3MN2 A;  3HL2 A;  2CH0 A;  2G9W A;  1ITY A;  1ZRE A;  4HAM A;  4AIK A;  1DU6 A;  4G6T B;  1YOV B;  1K83 J;  2NVT J;  3MVP A;  4JX6 A;  2DA3 A;  1U9O A;  2NVQ J;  4JYK A;  2XPW A;  1OYI A;  3A03 A;  3WE2 A;  4FIS A;  3OYG A;  4C3H J;  4RAF A;  2DCE A;  2KHM A;  2HTJ A;  2Q2E B;  3K1P A;  1R22 A;  2J5O A;  2R7W A;  3G1O A;  3KP6 A;  2L9N A;  1TWA J;  2UZK A;  2IS1 A;  4RGX A;  2BHZ A;  1O3R A;  4CCN A;  1Y1V J;  2DOE A;  1BI2 A;  2IRF G;  5HVQ C;  2LYC A;  5K1Y A;  1WI9 A;  1HW5 A;  2D5V A;  3ZQI A;  2XAF A;  4GDF A;  3RPQ A;  2M7A A;  1F5T A;  5M5X J;  3IRQ A;  2KPM A;  3QP5 A;  4XKB A;  4E7K A;  2Y75 A;  5EYR A;  1GXQ A;  4XLH A;  1MNE A;  4N0B A;  4FX0 A;  5FJ8 J;  3S3O A;  5JI6 A;  3CCQ I;  1P4X A;  3ZRG A;  1YIO A;  3QYF A;  2KT0 A;  1WVR A;  3S3N A;  3OR2 C;  3K4K A;  4AIH A;  4AVZ A;  4MFE A;  3FHZ A;  2XIG A;  2JVH A;  5GTH C;  2JWT A;  3RYR A;  1OLT A;  3TBI A;  3K6G A;  5K7F A;  3L2W A;  4BYY A;  4M6Y A;  1YX3 A;  1JGS A;  2H8R A;  1FTT A;  1X2M A;  2JMW A;  3BLY A;  2FMY A;  4BS9 A;  3QAH A;  2GXB A;  3CQZ J;  2WBM A;  1E0E A;  5FRM A;  1XD7 A;  3H9Q A;  1W7P A;  1T39 A;  3DPU A;  2CO5 A;  2VBZ A;  1W5C C;  4IKF A;  1WJB A;  2DJN A;  4QPO A;  2W57 A;  1QNT A;  1ETO A;  3ZMD A;  2FNP A;  3JSP A;  2L5Q A;  1WJD A;  2GA1 A;  2FOK A;  4RLF A;  3BR6 A;  1VQN I;  1MBE A;  1ZRD A;  2FF4 A;  3F8B A;  2DLL A;  2DYS H;  2DK8 A;  1LPQ A;  1R5I D;  4IRG A;  4DZJ A;  3BTJ A;  4L9N A;  2A68 F;  2XUB A;  4YFK F;  3RDI A;  2CUE A;  3ZQL A;  3GUD A;  2EZH A;  5ED4 A;  1ERD A;  1R36 A;  1UB9 A;  1YX5 A;  5TGT A;  4XRS G;  2HZT A;  1JT0 A;  3R60 A;  2ZJR F;  1R1U A;  1Z77 A;  1OPC A;  3DEE A;  1WPK A;  5HS7 A;  2M87 A;  2ZC2 A;  1ZRC A;  3BOQ A;  2VIX A;  2ISZ A;  1LEB A;  1KGS A;  3CUQ A;  3M3Y J;  6PAX A;  1BBY A;  5DUI A;  3IP4 B;  1Z6T A;  2ZSH B;  4QTR A;  5E8G A;  3CDI A;  1KZH A;  1H9G A;  2MG4 A;  2DAO A;  4IVN A;  1MJ9 A;  1Z05 A;  2AHQ A;  3RKX A;  1XDS A;  2XB0 X;  2BW3 A;  2Y0M A;  3HUG A;  1NH3 A;  2FQ4 A;  2BOL A;  2QA4 I;  2JSP A;  1ZN2 A;  3HTS B;  3QPT A;  4ASN A;  4HV6 A;  1IV6 A;  1ZGJ A;  4BDY A;  4HLY A;  3HG9 A;  4UUS B;  3GTL J;  2BY0 A;  5KVR A;  1IV8 A;  1G6N A;  4RGU A;  5GAH J;  2EV6 A;  3R0A A;  5A2Q Z;  4A3G J;  2V6E A;  4BXX J;  3BQZ A;  2H6B A;  2OZU A;  5ICF A;  4A3K J;  1SVM A;  1R7J A;  4BEH B;  4OIQ F;  4UY8 I;  2XVC A;  2CSO A;  3HZJ A;  2HGC A;  3K4L A;  4M74 A;  3PIP F;  2CV1 A;  2LOO A;  5J4Y A;  2CJJ A;  2O3F A;  4U88 A;  1FNN A;  5LGN A;  1Q1H A;  4IJA A;  4CXF A;  2UXX A;  2HZD A;  3DTI A;  3E6M A;  3HSE A;  3ZXS A; 
#chains in the Genus database with same CATH homology
 1T98 A;  4IPA A;  2DW4 A;  1TQM A;  1YLF A;  2LF8 A;  4EM2 A;  3WGG A;  4MQ9 F;  3QP6 A;  4JBA A;  5D6E A;  3V7C A;  1YW7 A;  4HF2 A;  4KIC A;  5JR3 A;  2FBH A;  4P96 A;  2OBP A;  3Q9S A;  1BIA A;  3L9F A;  4A5N A;  2D45 A;  3TOB A;  2EFQ A;  1U3E M;  2L02 A;  4AWX B;  1YW8 A;  1IN5 A;  5H6R A;  1D8J A;  5DCF A;  2Z5U A;  4WXH A;  3GYH X;  5FFZ A;  2HWV A;  2FQ3 A;  4I0B A;  2Z33 A;  2QM3 A;  5HDK A;  2L01 A;  1R1T A;  1XSD A;  1L3L A;  2KRF A;  5JHU A;  2EFO A;  2JPC A;  4LLN A;  3CJN A;  5E8I A;  2QQB A;  2ZBK A;  1KU3 A;  3JSO A;  4XSZ F;  1R58 A;  4LG0 A;  1SFE A;  2FBK A;  4ZYE A;  3VOD A;  2NYX A;  3WGH A;  2OQG A;  5LBQ A;  3J80 K;  4Z2Y A;  4LG0 B;  4PDK A;  4DNC A;  3H92 A;  3ML6 A;  1X3U A;  4OIP F;  1BN5 A;  4EJO A;  1IN8 A;  3D5L A;  3ZPL A;  3HOS A;  4A0X A;  5HDN A;  1P2F A;  5FFX A;  1S7A A;  4ESF A;  3CTA A;  2IVM A;  1ZH5 A;  2NS0 A;  2QWW A;  2QLZ A;  1XCV A;  1T0F A;  1W5T A;  4TV7 A;  5ICG A;  3IWZ A;  2ZNZ A;  3R61 A;  1HKS A;  3KP4 A;  2RC4 A;  4HA8 A;  3RTR A;  3DF8 A;  2F2E A;  1Y0U A;  3J81 Z;  2EV0 A;  2MLK A;  1SMY F;  4EJU A;  4GYI A;  2GWR A;  1TLH B;  2JSC A;  2WWY A;  3G73 A;  3I54 A;  1YFH A;  2ISY A;  4GO1 A;  3O6B B;  2IW5 A;  3ABU A;  2OU2 A;  2W24 A;  5H20 A;  5JVT A;  4BQA A;  1QZZ A;  3U1D A;  1VTN C;  3EDP A;  2HYG D;  3ECO A;  2BEO A;  4DQ2 A;  4L5I A;  1XSV A;  4EMS A;  2M45 A;  4BH9 A;  3EQL F;  4M6X A;  4ENM A;  1O3Q A;  1LDD A;  4PCQ A;  1DDN A;  3QOP A;  2FNA A;  1SD6 A;  1ZLJ A;  3CDH A;  3W6J B;  4BHP A;  4UV9 A;  1F1Z A;  3REO A;  1FT9 A;  5EEG A;  1B1B A;  4LLL A;  5HDG A;  4IF4 A;  1XMK A;  2VOP A;  2ZJ2 A;  3B02 A;  3HIF A;  1ZAO A;  1XDU A;  1O7L A;  4U0W A;  1P92 A;  3K9T A;  5HLH A;  2A6H F;  4BHB A;  5DDG A;  2DQL A;  4EJT A;  2RDP A;  3NRV A;  2O61 A;  3DV8 A;  5LHI A;  2H09 A;  2VC1 A;  4HOB A;  2PEX A;  2C6Y A;  3GF2 A;  1FBS A;  2J5P A;  3FMR A;  2HQN A;  2STT A;  2HKO A;  3RIR A;  1YYV A;  1I27 A;  1UHW A;  5J6X A;  3HRU A;  4RGS A;  4LK0 F;  3WTY C;  5HLG A;  1L0O C;  4WF2 A;  2BYV E;  2DPD A;  3I0T A;  3HHH A;  1IUY A;  4A2U A;  2Z3Y A;  1WWX A;  4P55 A;  1T6S A;  2M1B A;  3LQR A;  4LLG F;  4MEY F;  4ESJ A;  2MH2 A;  5A2Q K;  1YS7 A;  4QLC U;  3ZMT A;  1KQ0 A;  5ICC A;  5F1R A;  1DPU A;  3FXQ A;  4RB3 C;  1IZ1 A;  2ZXJ A;  1BIB A;  3HHG A;  1YG2 A;  1U5T B;  1FOK A;  1S3J A;  1IN7 A;  3EYY A;  4EV0 A;  4ZZL A;  2EFP A;  3ZMZ A;  1S6L A;  1RUN A;  1R23 A;  1YW9 A;  4L9V A;  5E1W A;  2LSO A;  4L0Z B;  1G3T A;  1BC8 C;  1XGN A;  3F72 A;  1OMI A;  3GXO A;  4L18 B;  5L3D A;  1LEA A;  2R7F A;  4G9Y A;  3FXR A;  2JZY A;  3PQJ A;  3K2Z A;  4WX9 A;  2R7D A;  4G7O F;  3ZP5 A;  4UXN A;  4XBF A;  2HR3 A;  2F5D A;  3OOP A;  2RV8 A;  5D6F A;  5E18 F;  2F5F A;  2DU9 A;  1IN4 A;  4XRF A;  4U0V A;  1U78 A;  1FYL A;  4GYG A;  2FXA A;  2ACJ A;  3GFM A;  4HX7 A;  1G3Y A;  2MLG A;  1HKT A;  4OMZ A;  4OMY A;  2DBB A;  4YG2 F;  2DK5 A;  3LWF A;  5K5Q A;  5LHH A;  3Q9V A;  1FBU A;  4CIC A;  4HV5 A;  1TNT A;  3MZY A;  2W84 A;  3GZ6 A;  3DPT A;  3SXY A;  3GEZ A;  5ILS A;  4GXO A;  4ETS A;  3TO9 A;  3KP5 A;  1FSH A;  1Z9C A;  2K4J A;  2Q2E A;  4B8X A;  4YII A;  1MJA A;  2YX4 A;  3SZP A;  2QUF A;  2H6C A;  5LGU A;  4RB2 C;  1LVA A;  2K7L A;  2VE8 A;  5CVJ A;  5BPD A;  4CZZ A;  2EFN A;  2XAG A;  3AAF A;  1TQI A;  5CVR A;  3HYI A;  1K79 A;  3N4M A;  3TKY A;  3IC7 A;  1HW1 A;  2O0Y A;  5L3C A;  3F8F A;  2QEN A;  2DPU A;  1UST A;  4K2E A;  2H94 A;  3GFI A;  4A6D A;  2EA4 A;  3J81 K;  4HF1 A;  4A12 A;  1QO0 D;  1XSX A;  2V6C A;  3SHF A;  2ETH A;  5ILV A;  2V1D A;  3ISP A;  2ZNY A;  2MC3 A;  4AIJ A;  3JAM Z;  1UCR A;  2P8T A;  2HKX A;  2K27 A;  2XAS A;  1FX7 A;  4G94 A;  1AWC A;  5IT3 A;  1S7O A;  5DEQ A;  4ON0 A;  3GLX A;  3DXJ F;  3BJ6 A;  1PP8 F;  4YFN F;  2EV5 A;  2PG4 A;  4LK1 F;  5D4R A;  2CWE A;  1U5T C;  3EYI A;  3F21 A;  3N97 A;  3EUH A;  2RQP A;  2DO7 A;  3I71 A;  5H6Q A;  1HKQ A;  3RPU A;  1P6R A;  5LGT A;  3ZN1 A;  1CF7 B;  1CGP A;  4MGR A;  1UHM A;  2YPR A;  2P7C B;  4WK8 F;  1PUE E;  2UWM A;  4KIF A;  4EM1 A;  2A5Y B;  1K78 A;  2GIV A;  4I01 A;  2EA2 A;  4N9H A;  3F6O A;  1ZG3 A;  3V8K A;  4R79 A;  4RGR A;  3WTT C;  4HZF A;  4WCG A;  4I2O A;  4XLN F;  1BI1 A;  3BJA A;  2CQK A;  1S8N A;  5CVV A;  3IRR A;  1GVJ A;  2BE5 F;  5D8L B;  4MQV A;  3F22 A;  4B09 A;  2IP2 A;  3SFZ A;  2QYO A;  3WGI A;  1FP1 D;  1SD5 A;  4KDP A;  1BI0 A;  3LQQ A;  1F9N A;  4KMU X;  1R5H A;  5K5R A;  4H0E A;  3KFW X;  2P6S A;  5LLQ A;  5BPI A;  2EK5 A;  3V4G A;  2DTR A;  2V79 A;  1I1S A;  5L3F A;  1SAX A;  3GW2 A;  4NHJ A;  3GVA A;  4RAZ A;  4YIF A;  1D3Y A;  2ZKZ A;  2KJB A;  1W7P D;  3CUO A;  2JTV A;  4Y13 A;  3V8L A;  1KQ8 A;  1IF1 A;  2MH9 A;  3WG9 A;  2FML A;  4HQE A;  3OV8 A;  2VON A;  2Q0O A;  3LA2 A;  2VBW A;  2V9V A;  4JQF A;  4PGG A;  4Q5S F;  3T1B A;  1J0R A;  2B0L A;  5CVI A;  3GFL A;  1J59 A;  2X4H A;  5L3G A;  2XKP A;  3C1D A;  1P4W A;  5J8F A;  3J7A O;  4CYD A;  1ZGA A;  4ESB A;  4AD9 A;  4IXA A;  5HLI A;  3R6S A;  3M7G A;  5BMZ A;  3WTS C;  1MDM B;  3QU6 A;  2YR2 A;  3WTZ A;  2BV6 A;  1B9M A;  1HQC A;  4IRH A;  1XGO A;  1IRF A;  4M72 A;  3P9I A;  2ZME B;  5LRR A;  2DQR A;  1ON2 A;  3KCC A;  4ENN A;  5DCM B;  3TQN A;  2EFW A;  1U8R A;  1ODD A;  1XCB A;  2KIF A;  4A5M A;  3P7N A;  3WTW C;  4CO8 A;  1WSU A;  2Y48 A;  2JPB A;  3KZZ A;  1KYW A;  5TJJ A;  5DUK A;  3LAP A;  1QQI A;  1DUX C;  4OOI A;  2QQ9 A;  2HS5 A;  1KQ9 A;  3SZT A;  3I53 A;  1I5Z A;  4UVC A;  4CHU A;  1YS6 A;  2EJR A;  2K86 A;  3K1M A;  3LST A;  5FD6 A;  2IA1 A;  1G3S A;  4WXC A;  1LQ1 A;  3M8F A;  2HQR A;  1T38 A;  3L7W A;  2IA2 A;  5FB2 A;  2ESN A;  1OR7 A;  2IJL A;  3BDD A;  3WOD F;  3V7R A;  1JHH A;  4UVB A;  3M8E A;  4U7D A;  1U2W A;  2EWN A;  1A04 A;  3VEP A;  4WWC A;  4RS8 A;  2PQ8 A;  3PQK A;  4R1H A;  1ONV A;  1Z91 A;  4A6E A;  1XN7 A;  1G4D A;  2P5K A;  1USS A;  1YO5 C;  3F6V A;  5E20 A;  1PDN C;  3C3W A;  4G7Z F;  1HSJ A;  2M5W A;  2GQQ A;  4RB0 A;  4BXU A;  3FM5 A;  3CLO A;  1JE8 A;  3GO5 A;  3K1N A;  4GGG A;  2VN2 A;  2L54 A;  2M8E A;  1LJ9 A;  2JT1 A;  3NEU A;  4AVP A;  3JAM K;  3BPV A;  2JRT A;  3QU3 A;  1FBQ A;  3ERE D;  5CYV A;  3FX3 A;  2D1V A;  3FMS A;  3KET A;  4NB5 A;  2F5C A;  3E6C C;  5DD8 A;  1W4M A;  2E1N A;  3DQV C;  3WU1 B;  4L9T A;  2XRN A;  4L5J A;  4I09 A;  3WTV C;  2H27 A;  4KMF A;  3MQ0 A;  2UXN A;  3IL2 A;  3HOT A;  2YU3 A;  3D0S A;  4ENJ A;  1MZB A;  3BPX A;  3E5X A;  4Q48 A;  3T8T A;  4NQW A;  2KIM A;  5AIQ A;  4KT5 C;  4MNU A;  2QVO A;  2VC0 A;  5BOX A;  3KP3 A;  1U5T A;  4P9F A;  4M9Z A;  3L09 A;  5E17 F;  2HYF A;  3KZY A;  3O3K A;  3GX4 X;  3EET A;  1ULY A;  3P9C A;  1TBX A;  2OQR A;  4S04 A;  2XKO A;  3ZMU A;  5LRS A;  1U6G A;  2CFX A;  2EB7 A;  4HYE A;  3GZ5 A;  1H0M A;  3KLO A;  3T0Y A;  4XLP F;  3V8J A;  4KFC A;  2VT2 A;  4CGZ A;  2QZ8 A;  3M9A A;  3U2R A;  2F5E A;  4HQM A;  3L2C A;  4KNY A;  3MEX A;  2BBY A;  2PBI A;  2VT3 A;  1QZY A;  4YFX F;  2ELH A;  2X0L A;  3FMQ A;  1REP C;  5D5V B;  5FLX Z;  3ZMV A;  2KJC A;  1IXC A;  2HDC A;  4UV8 A;  1K7A A;  2HEO A;  1P4A A;  3BJO A;  4ZH4 F;  2PLY A;  2XAQ A;  2V1U A;  4OU0 A;  1BM9 A;  1W5S A;  2BGC A;  2DI3 A;  1I6X A;  4LGW A;  1ZG1 A;  1B6A A;  3KEQ A;  1XMA A;  3RI4 A;  2GA2 A;  4ENK A;  4LMY A;  2Z9O A;  1BOA A;  1Z7U A;  3BWG A;  4KYW A;  2GXG A;  2XHK A;  3DFG A;  1EH8 A;  1FYM A;  1GHC A;  3I59 B;  3VOE A;  2AXL A;  1MGT A;  3BY6 A;  4KIB A;  2P7V B;  5D4S A;  5LEJ A;  4FHT A;  4IHT A;  1R5G A;  2V1X A;  1OYY A;  4EM0 B;  2RN7 A;  3MCZ A;  1IXS B;  3KLN A;  4EVI A;  1IW7 F;  2PI0 A;  1XGM A;  4I0A A;  4E70 A;  1MJB A;  3B73 A;  2ADU A;  4HF0 A;  3M1E A;  3MZH A;  5JFR A;  5D5X B;  1EH7 A;  2LKP A;  4I7H A;  2P4W A;  1O7F A;  5CVU A;  4G8X A;  1IXR C;  4G7H F;  1F4K A;  3PFI A;  1J7K A;  2K02 A;  3Q5F A;  4IHS A;  1BC7 C;  3F8N A;  3WTU C;  2PMH A;  2FRH A;  3HRS A;  4EQQ A;  4UHT A;  5D8K B;  2OAZ A;  2XV4 S;  3F8C A;  1S29 A;  1T2K A;  5IT9 Z;  1B9N A;  2PFB A;  2QQA A;  2FSW A;  2VOO A;  2QBY A;  1CF7 A;  2LNB A;  4WXD A;  2E1C A;  1W7P B;  4LJZ F;  1ZLK A;  1EH6 A;  5F64 A;  3H3U A;  2G7U A;  2RKH A;  2QBY B;  2COM A;  2XGX A;  1TQP A;  1HST A;  5K5O A;  2XAH A;  1OYW A;  1BI3 A;  2VE9 A;  1ZYR F;  4IRI A;  2KIU A;  2XRO A;  5F6F A;  1BJA A;  2Z99 A;  3KEO A;  2HFH A;  3LAJ A;  5ERI A;  2CW0 F;  1LB2 A;  4G6Q A;  3KE2 A;  3E5Q A;  1WKM A;  1ZHF A;  1QBJ A;  5HS8 A;  2G7H A;  4HDU A;  2MD5 A;  3CUQ B;  4I98 B;  1B4A A;  4R8H A;  3E5U A;  1FWZ A;  5BS6 A;  3O2P E;  5LEK A;  3C7J A;  3E6D A;  4F7Z A;  3JTG A;  1TTY A;  2L3D A;  4KUM A;  1LDJ A;  2W25 A;  1D8K A;  3HSF A;  3I5U A;  2OZ6 A;  3WE3 A;  2PMU A;  1XGS A;  4ZZD A;  4N9I A;  1O57 A;  2P5L C;  3RKY A;  1KYZ A;  3DP7 A;  4XSX F;  1K6O A;  2FBI A;  3TDZ C;  4MTE A;  1KU2 A;  5E1Z B;  1STZ A;  1QGP A;  4QWQ A;  4BAY A;  4P5O A;  1YQA A;  4G6D A;  4MEX F;  3U9G A;  2D1H A;  1RIO H;  4ZYD A;  5FD5 A;  3CO7 C;  1FC3 A;  2A6E F;  3T5X A;  1C0W A;  3ECH A;  4M9X A;  4LB6 B;  1JHF A;  1FZP B;  2ZCW A;  4HDV A;  4KN4 X;  1ZAR A;  4CDG A;  4U0Y A;  3WU0 A;  3SQN A;  4PGH A;  4LFU A;  4LD5 A;  1G3W A;  3F23 A;  3GFJ A;  5ILU A;  1V3F A;  3F8M A;  1TNS A;  2P5V A;  3C18 A;  3T8R A;  5FO5 A;  5D5U B;  2ESH A;  1IAW A;  5HS9 A;  1KU9 A;  3IKT A;  1GXP A;  4LB5 A;  3FXU A;  5BQT A;  4A0Z A;  3VFZ A;  3DPL C;  3ULQ B;  3HRM A;  1K78 B;  2VOD A;  2YSR A;  3FZV A;  1E2X A;  1FSE A;  3K0L A;  4Y15 A;  4A0Y A;  1AOY A;  1MDM A;  4HLX A;  3FM3 A;  2XAJ A;  1O3S A;  1FY7 A;  2ZME A;  2D2W A;  2A3S A;  5DCM A;  4HX4 A;  1DP7 P;  4KN7 X;  3RYP A;  3TO7 A;  3QPH A;  1SD7 A;  5FLX K;  3MFK A;  2RVC A;  3CO6 C;  1WRJ A;  3HTU A;  1J9I A;  3TGN A;  1FYK A;  2CYY A;  3QRF F;  2L4A A;  3NQO A;  2K4B A;  3RJP A;  5DD4 A;  3TO6 A;  5E1X A;  3ROU A;  3L00 A;  3ZMS A;  2VBX A;  2LF7 A;  1IN6 A;  1RNL A;  2HOE A;  2HTS A;  1J5Y A;  2A61 A;  4P9U A;  3DKW A;  2ZFW A;  1V4R A;  1SFU A;  3E3V A;  3CUQ C;  2R3S A;  5L3E A;  1MKM A;  3HRT A;  3KP2 A;  2RNJ A;  2NAZ A;  4OIN F;  2A07 F;  2IPQ X;  3I4P A;  2DFI A;  1I1G A;  5DV5 A;  1SFX A;  3R4K A;  4BNC A;  1LNW A;  2VXZ A;  3F3X A;  5FGM A;  4OIO F;  1JXS A;  4ZYG A;  3BP8 A;  3ZQ7 A;  1UFM A;  2NNN A;  1TW2 A;  4EJV A;  4O6J A;  1HBX G;  3IHU A;  3E6B A;  1Z1D A;  2P6T A;  2KKO A;  1DPR A;  4RAY A;  2PJP A;  2OA4 A;  4KIG A;  2NRA C;  2STW A;  3RKW A;  4UVA A;  1IRG A;  4M73 A;  2O6G E;  2LDU A;  2FA5 A;  5CJ9 A;  3R0J A;  5D5W B;  4HX8 A;  5DYM A;  1R1V A;  1EV7 A;  3S2W A;  5AON A;  3E97 A;  5TRD A;  2L4M A;  2FEZ A;  1HW2 A;  3LFK A;  1Z6R A;  1ZRF A;  3TOA A;  3WTX C;  2VBY A;  4L0Y B;  2Q8K A;  5AIP A;  2CGP A;  5IT9 K;  3BRO A;  4Y17 A;  3MAJ A;  1J2X A;  1TW3 A;  4UUV A;  3ZN0 A;  3V7S A;  4HW0 A;  5EEH A;  4O3M A;  2AS5 F;  2WTE A;  3I64 A;  2CG4 A;  2A69 F;  1RI7 A;  4RB1 A;  1H9T A;  3H3Z A;  4PZJ A;  3P9K A;  3ELK A;  1XB4 A;  2WC2 A;  2WV0 A;  2RGV A;  1E17 A;  3DEU A;  1SMT A;  2O8X A;  2IA0 A;  4Q4Z F;  1PP7 U;  2YX7 A;  1KU7 A;  2FU4 A;  4BHC A;  3J80 Z;  4HBL A;  2GAU A;  4ZYH A;  4KA4 A;  1NHA A;  5L3B A;  5ICE A;  4MTD A;  1QPM A;  1FP2 A;  4I02 A;  2FE3 A;  3FWE A;  5KK1 A;  4O5V A;  5CLS A;  2NNY A;  4U7B A;  3VB2 A;  3FF5 A;  1HXD A;  2O03 A;  2M30 A;  2E7X A;  1ZG5 A;  1FLI A;  4OIR F;  2DT5 A;  4EJW A;  2ZO4 A;  1O3T A;  1KA8 A;  2IT0 A;  1MD0 A;  4EGY A;  2PN6 A;  4MHG A;  1B59 A;  1ON1 A;  1RUO A;  1LDK B;  4M9S A;  3W6K B;  3LA7 A;  3JW4 A;  3BZ6 A;  2MBF A;  3G3Z A;  3LA3 A;  4JK1 X;  5HOO A;  4D0P A;  4L9J A;  1FPQ A;  3KP7 A;  1J75 A;  1WQ2 A;  2W85 A;  3I59 A;  3IKV A;  1SD4 A;  1RZ4 A;  1D5V A;  3TDU C;  2GZW A;  3IWF A;  4Q47 A;  3COA C;  4UNO A;  3MWM A;  4GCV A;  5LHG A;  3JTH A;  2TDX A;  5J8C A;  2MA3 A;  3GWZ A;  1YTY A;  1OKR A;  2E7W A;  3ABT A;  4FX4 A;  3K69 A;  4S05 A;  3I58 A;  2OD5 A;  1R00 A;  3HSR A;  4FT8 A;  4M71 A;  4EGZ A;  2G9W A;  1ZRE A;  4HAM A;  4AIK A;  3WE2 A;  1OYI A;  2HTJ A;  3K1P A;  1R22 A;  2J5O A;  3KP6 A;  2UZK A;  4RGX A;  1O3R A;  1BI2 A;  2IRF G;  5HVQ C;  5K1Y A;  1WI9 A;  1HW5 A;  2XAF A;  3RPQ A;  1F5T A;  3IRQ A;  3QP5 A;  2Y75 A;  1GXQ A;  4N0B A;  4FX0 A;  5JI6 A;  1P4X A;  1YIO A;  3FHZ A;  4AIH A;  2XIG A;  3RYR A;  4BYY A;  4M6Y A;  1JGS A;  2FMY A;  3QAH A;  2GXB A;  1XD7 A;  1W7P A;  1T39 A;  2CO5 A;  2VBZ A;  2W57 A;  1QNT A;  3ZMD A;  2FNP A;  3JSP A;  2GA1 A;  2FOK A;  1ZRD A;  2FF4 A;  3F8B A;  2DLL A;  2DK8 A;  4IRG A;  4L9N A;  2A68 F;  2XUB A;  4YFK F;  3RDI A;  3GUD A;  5ED4 A;  1R36 A;  1UB9 A;  2HZT A;  3R60 A;  1R1U A;  1OPC A;  5HS7 A;  2M87 A;  2ISZ A;  1ZRC A;  3BOQ A;  1LEB A;  1KGS A;  3CUQ A;  6PAX A;  1BBY A;  5DUI A;  1Z6T A;  5E8G A;  1H9G A;  2DAO A;  4IVN A;  1MJ9 A;  1Z05 A;  3RKX A;  1XDS A;  2Y0M A;  3HUG A;  1ZN2 A;  3HTS B;  3QPT A;  4ASN A;  4HV6 A;  1ZGJ A;  4HLY A;  5A2Q Z;  5KVR A;  1G6N A;  4RGU A;  2EV6 A;  3R0A A;  2H6B A;  2OZU A;  5ICF A;  1R7J A;  4OIQ F;  2XVC A;  2CSO A;  2HGC A;  4M74 A;  2O3F A;  4U88 A;  1FNN A;  5LGN A;  1Q1H A;  4IJA A;  4CXF A;  2UXX A;  3E6M A;  3HSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...