4L9TA

Crystal structure of mepr f27l mutant from multidrug resistant s. aureus clinical isolate
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
140
structure length
140
Chain Sequence
b'MEFTYSYLFRMISHEMKQKADQKLEQLDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MepR
publication title The molecular mechanisms of allosteric mutations impairing MepR repressor function in multidrug-resistant strains of Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 54
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4l9tA00
1GVJA 4KMUX 4PZJA 5HS8A 1DPUA 2OU2A 2Z33A 1Q1HA 2JPBA 3LAJA 4M71A 1KU3A 2Q0OA 2FBIA 4ZZDA 1TBXA 3V7RA 2A68F 2K86A 4LLLA 1ZH5A 3FM5A 2MA3A 3W6KB 1LQ1A 3TDUC 3BJOA 1C0WA 4OIOF 3ZMDA 2KIFA 1BI0A 2YX4A 1MJBA 4HV6A 4PDKA 1T98A 1ZGJA 3CUQC 1CGPA 1U8RA 1ZRFA 3HSRA 4ZYEA 2XIGA 2P6SA 3DXJF 5ED4A 2DQLA 4ENJA 2XVCA 2RQPA 2HQNA 1IRFA 2YPRA 2VXZA 3MZHA 1KGSA 1R5GA 2HQRA 2PEXA 1IZ1A 2PJPA 2ZKZA 4RAYA 2XHKA 5BPIA 1W4MA 3ECHA 1SFEA 3J80Z 4D0PA 2D1HA 3FHZA 1ZYRF 5TJJA 1KYWA 2A6EF 5F1RA 4M9ZA 1D5VA 4U0WA 4RB2C 1LDJA 3R60A 2KIMA 2M30A 1BIAA 2W85A 4OIRF 4OMYA 4RGRA 3MAJA 2VN2A 5IT9K 1SMTA 5HLGA 2VODA 1HW1A 2E7WA 4S04A 2HR3A 3E5UA 2KIUA 4HV5A 4LB5A 2QBYA 5D5UB 3CLOA 2PQ8A 2QZ8A 2ESHA 2FQ3A 2AXLA 4N9HA 3F6OA 2LSOA 2CYYA 4YG2F 3T0YA 3M9AA 4I02A 2CWEA 1ZAOA 1ZG1A 1PP8F 3K2ZA 3GW2A 3F22A 3CUOA 4MEXF 2XKPA 2L4MA 4GYGA 1IN6A 1KYZA 4RAZA 4IVNA 2DTRA 2QM3A 3NQOA 4MNUA 3BZ6A 3U2RA 5AIPA 2P8TA 3TO6A 2JSCA 1K6OA 4HF2A 3J81Z 4GYIA 1JHHA 2FA5A 5BMZA 3MCZA 3HIFA 3F72A 2RNJA 3ML6A 2P5LC 1BN5A 1KQ9A 4I01A 5F6FA 4Y15A 5CVVA 3GZ6A 1VTNC 3REOA 1B6AA 1H0MA 1ZG5A 2D45A 4UV9A 3F8MA 1O7LA 4A2UA 3RKXA 3HTSB 2EFWA 1SD4A 1Z1DA 4EM0B 4CXFA 2DO7A 1KA8A 3P9CA 1FC3A 3DQVC 3GXOA 1B59A 2CQKA 4U0VA 2IA2A 2K4JA 3FMSA 4L5JA 1ZN2A 5CVIA 3EUHA 4U7BA 3OOPA 2IA1A 5HS7A 3ABTA 1XDUA 4UNOA 1D8JA 3WTWC 3ZMSA 1X3UA 1I27A 3DF8A 5CVRA 2O0YA 3BPXA 4GO1A 3RDIA 4OIQF 4ZYDA 3V7CA 2VC0A 4M6XA 4KMFA 4L0ZB 2ZMEB 2QBYB 1KQ0A 1Z7UA 3RYRA 3I58A 1HXDA 1PDNC 4G8XA 3E6MA 1XD7A 4N0BA 5LHGA 4HF1A 2HTJA 2X0LA 5EEGA 3V4GA 3VB2A 3SZTA 1FSHA 3HSFA 4GGGA 1I1GA 3O6BB 2Y0MA 3CO6C 1HSTA 3HTUA 3MEXA 1BOAA 4EJUA 2YU3A 3PQKA 3BPVA 3L00A 1T39A 5IT3A 2C6YA 1YO5C 3E97A 2B0LA 1FT9A 1IF1A 2HGCA 2ISYA 5LGTA 1XGOA 3PFIA 5BS6A 2OQGA 3WG9A 1XGMA 2HKXA 3GUDA 1MD0A 1U6GA 2PN6A 4MHGA 1FLIA 5HVQC 1V3FA 3KP5A 4L9VA 5FD6A 2WV0A 2K02A 1J75A 2GAUA 1J7KA 1USTA 3C3WA 4RB3C 2O8XA 3T1BA 2L4AA 4MEYF 2EV5A 1TNSA 5FD5A 5LBQA 3LA2A 4LLGF 1OYIA 2NAZA 4P9UA 5A2QZ 3VEPA 1O3TA 2J5PA 1U5TA 5AIQA 1OPCA 3DPTA 5HLIA 3FWEA 5DD8A 3B73A 1IN7A 2OZUA 2CFXA 1AWCA 1FPQA 1XSVA 2ZNZA 2UXXA 3O3KA 2G9WA 3D0SA 1XN7A 1F9NA 3KP4A 4B09A 3K1NA 4L5IA 3KFWX 3H92A 1QPMA 4Y13A 3IWZA 1DP7P 2F5DA 1R23A 5DCFA 1P4XA 1XMAA 2LDUA 1Z91A 4I7HA 2E1NA 3JSPA 3C18A 5TRDA 1F4KA 2OZ6A 2ZNYA 4R1HA 1R7JA 4FX4A 4M72A 1RZ4A 1YYVA 2XRNA 3B02A 2XAGA 2ZJ2A 4IHTA 1J9IA 4S05A 2NS0A 3T5XA 3KEQA 2FXAA 1JXSA 4EJOA 5D4RA 1S6LA 2W57A 1G6NA 4AVPA 1HKTA 4ESFA 4IRHA 2XGXA 1RI7A 1MGTA 3F3XA 4WXHA 1XB4A 1OYWA 3F8FA 1K7AA 3BWGA 1R00A 2KJCA 1UCRA 4GXOA 1U78A 1OR7A 2EFOA 2DW4A 1HKSA 5HOOA 2XUBA 4I98B 2HEOA 2DPDA 4M73A 4RB1A 4UXNA 4UVAA 5D5XB 1FX7A 3G3ZA 2V79A 1HKQA 1XCVA 4RGSA 5K5QA 5LLQA 4ZYGA 2L3DA 4Q47A 3IHUA 3VODA 1QZZA 1XDSA 4XRFA 1GXPA 1XSXA 3GX4X 4ETSA 1U5TB 2MD5A 3GF2A 2IRFG 3ABUA 5K5OA 2V1DA 2YR2A 6PAXA 4IHSA 1YG2A 3SHFA 2X4HA 2OQRA 4MGRA 5FO5A 3OV8A 4CGZA 1U2WA 2GZWA 5FLXZ 2EFNA 3FX3A 4AIKA 1GXQA 1B1BA 2HTSA 4L9JA 2NNYA 5E8IA 5JR3A 4KDPA 3EYIA 4Q4ZF 3QU3A 3I0TA 3FXUA 4JBAA 3GFMA 1IN8A 2ESNA 2VBYA 5LHIA 4OU0A 3GO5A 4KYWA 3LAPA 1ONVA 4XSXF 2RN7A 2IT0A 4HDVA 3C1DA 3RIRA 1BC7C 1QZYA 2HYGD 5CLSA 2F5CA 2QQ9A 4RB0A 2A5YB 2AS5F 3W6JB 1I5ZA 5D8LB 2XAHA 1F5TA 4KIGA 2VC1A 1J59A 3BJAA 2HOEA 5L3DA 2H94A 5AONA 3KLNA 4P5OA 1EH7A 1FYMA 1K78A 1R5HA 2EWNA 5BQTA 3BY6A 3JAMK 3F23A 2EK5A 3HUGA 1FBQA 2JTVA 3DEUA 4U7DA 4G7HF 2UXNA 3WTYC 2A3SA 2K4BA 1XSDA 5LGUA 2IPQX 3D5LA 5ICGA 3L2CA 5HDKA 2Z3YA 3LQQA 3FF5A 3M8FA 1ZG3A 4LMYA 4L18B 3HOTA 5K5RA 3FMRA 3J81K 1FYLA 5JVTA 3QRFF 2P7CB 1V4RA 3DFGA 3R0JA 3DPLC 4HLXA 2YSRA 2DK8A 4HDUA 3R61A 3I5UA 2ZMEA 4G7OF 4A0XA 1ZLKA 2DLLA 3GWZA 3FXRA 4KUMA 4I2OA 5HS9A 3ERED 4KIFA 1K79A 2MH9A 1Z6RA 2PG4A 2KJBA 1EH8A 1B4AA 3WGHA 1MZBA 4CICA 4IF4A 1YFHA 3WU0A 4IRIA 2LF7A 3SFZA 1BC8C 1D3YA 2XAFA 2ACJA 5DEQA 1U5TC 1BI2A 3TOAA 2M1BA 3V8LA 3TGNA 1I6XA 1R22A 1R1TA 3R0AA 4YFXF 2STWA 3BOQA 4HZFA 5H20A 3E5XA 2GQQA 4AWXB 2VE8A 5L3EA 4R8HA 2GXBA 1O3QA 3R4KA 2V6CA 4HF0A 4MTDA 4A6DA 1FBSA 4XSZF 4ENNA 4U0YA 4A6EA 5D8KB 3J7AO 2F2EA 2BE5F 5E8GA 5IT9Z 3IC7A 3TQNA 4YIIA 3JSOA 2E7XA 3P9IA 1K78B 2BV6A 4H0EA 3IRRA 3QPTA 1O3SA 3ZQ7A 2XAQA 3LFKA 2O6GE 4EQQA 4RGXA 5HDGA 2HFHA 2PMUA 2QWWA 4A5MA 5LEKA 4O5VA 1A04A 1YTYA 3QOPA 2RKHA 1E2XA 2FBHA 1FYKA 4P9FA 3FZVA 4ZH4F 1PP7U 2ZXJA 4O3MA 3Q5FA 5JHUA 2RC4A 4G6QA 2A61A 4CHUA 1S8NA 2MLGA 5JI6A 3LSTA 5L3FA 4KT5C 3Q9SA 1OYYA 2PBIA 2F5FA 4TV7A 2VOPA 1EH6A 3K9TA 3ELKA 3N4MA 3T8TA 5KVRA 3K0LA 3RPUA 4A12A 4LG0B 1ZLJA 2K27A 2GIVA 1TQPA 3KETA 1USSA 1NHAA 2Y48A 2F5EA 1S29A 2EA2A 5DUKA 4GCVA 3CJNA 2D1VA 4LGWA 3O2PE 3HHHA 4LJZF 5LHHA 2GA2A 1YW8A 4L0YB 3BP8A 1FY7A 2FOKA 4LB6B 4WX9A 4UHTA 4G7ZF 1XGSA 2QQBA 1LNWA 4N9IA 2WC2A 4UVBA 2ELHA 5F64A 4FX0A 1BI3A 5JFRA 5E1WA 4HQMA 4EMSA 2FU4A 3LA3A 5K1YA 1LVAA 5CYVA 3JW4A 5D5VB 2QYOA 2OD5A 4AIJA 3GLXA 2ZCWA 3WTTC 5ILVA 1QBJA 3F6VA 2JPCA 2XKOA 3E6BA 2O03A 3TOBA 3E6DA 3U1DA 2GWRA 1Y0UA 3HRMA 2P5VA 2A69F 4EJVA 2V1XA 1FNNA 4NQWA 1ODDA 1WRJA 2VBZA 4XLPF 2MLKA 1G3TA 3DKWA 2W24A 4G6DA 3ISPA 4HX4A 1I1SA 1IW7F 1YQAA 1H9TA 2PMHA 1STZA 2P6TA 1P2FA 1G3YA 2Q8KA 3WTUC 1YW7A 1D8KA 1MKMA 1S7AA 3KEOA 1KQ8A 3BDDA 1KU7A 4EJTA 2MH2A 5LEJA 2BGCA 1YW9A 1R1UA 1Z9CA 1YLFA 1UFMA 1WWXA 2D2WA 2P7VB 3HRTA 4IJAA 2ADUA 2DAOA 1U3EM 2RDPA 5EEHA 2HWVA 5J8FA 2COMA 5CJ9A 3BROA 1L0OC 4A0YA 2L01A 2H27A 4CZZA 1R1VA 2OA4A 4A0ZA 3GFIA 2BYVE 4BNCA 1RIOH 3RKYA 5FFXA 4HLYA 3HHGA 1BI1A 2H09A 3GEZA 4M74A 1Z05A 3RKWA 3I64A 1E17A 1TQMA 1IN5A 1FP1D 1YS6A 4RGUA 3SXYA 1XMKA 3AAFA 2P4WA 1LEAA 2EFQA 5E20A 4ENKA 2BBYA 3HRSA 2LF8A 2G7HA 3KP2A 3QAHA 4YFNF 1P6RA 1IAWA 3QP5A 2XAJA 1FSEA 4NHJA 2RGVA 5D6EA 3E3VA 2ETHA 2R7DA 1O57A 3ZMUA 1JHFA 1W7PA 3V8JA 2NNNA 2VE9A 1TW3A 4KNYA 3GYHX 3P9KA 4JK1X 4Y17A 3N97A 2FBKA 3C7JA 1BIBA 1OKRA 2IP2A 2IJLA 2K7LA 3H3UA 3K1PA 5BOXA 4RS8A 3J80K 2FSWA 3KP7A 1W5SA 3VOEA 2HS5A 1HQCA 4I09A 3BJ6A 4BXUA 2Z5UA 1SD5A 3ZN1A 2PLYA 3ZP5A 4QLCU 4UUVA 4OINF 4F7ZA 2LNBA 1RUOA 3GFLA 2STTA 2V1UA 3WGIA 1LB2A 2DFIA 1TNTA 1RUNA 2Z99A 2CSOA 3FMQA 5E1XA 5FGMA 1BM9A 4EJWA 3HRUA 3KP3A 4WXCA 2ISZA 2FMLA 5DCMA 5L3BA 3K69A 3RTRA 3CO7C 1W5TA 3G73A 2L54A 1O3RA 1FBUA 1WSUA 1S3JA 1B9MA 3WE3A 3DV8A 1SMYF 1FP2A 4HA8A 3KE2A 3LWFA 2FF4A 2ZO4A 3FXQA 2WTEA 3I54A 3KZYA 1ULYA 3GVAA 3EYYA 3MZYA 4Q48A 2L02A 2EA4A 2Z9OA 2GA1A 1JE8A 2NRAC 4JQFA 4PGHA 4HBLA 2WWYA 4G94A 5E17F 3V8KA 2CW0F 4A5NA 1WI9A 4MQVA 5HDNA 1ZHFA 2JRTA 1GHCA 3K1MA 1R36A 1W7PD 4IXAA 4Z2YA 2M5WA 1W7PB 1B9NA 5ERIA 2LKPA 2YX7A 3CDHA 4BAYA 3TO7A 3ZPLA 2DK5A 3ZMZA 2H6CA 4E70A 1WKMA 1ZGAA 4LG0A 2EFPA 3QP6A 4LD5A 1QGPA 2V9VA 2P5KA 4KA4A 2O3FA 3RI4A 1TQIA 1REPC 5E18F 1XGNA 2MC3A 3NEUA 5KK1A 1T38A 3EQLF 1WQ2A 3L09A 4HOBA 3WODF 4HYEA 4WWCA 3HOSA 3COAC 2VT3A 4BHCA 1AOYA 1R58A 1P92A 4KICA 2PFBA 1OMIA 4ON0A 2DU9A 1J0RA 1F1ZA 3JAMZ 5CVJA 5FB2A 3Q9VA 4EGYA 3M8EA 5J6XA 1IXCA 3ZMTA 2FEZA 2IW5A 4ENMA 3HYIA 1DUXC 4HX8A 5CVUA 3F8NA 1HBXG 4QWQA 3E6CC 2QUFA 5D4SA 4HQEA 5DYMA 1LDKB 3LA7A 3SZPA 3T8RA 3WGGA 3JTGA 4PGGA 5DCMB 1KU9A 3QU6A 1SFXA 1ON1A 5D5WB 1DDNA 2EJRA 4CYDA 3M1EA 4B8XA 4BHPA 4O6JA 4WK8F 4ESBA 3F8BA 1J2XA 1SD6A 2G7UA 5DV5A 1IXSB 1G3WA 4R79A 4AIHA 3ROUA 4L9NA 3MWMA 4YFKF 2HZTA 5D6FA 1XCBA 2RV8A 4M9XA 2OBPA 3L9FA 4CO8A 2FNPA 1RNLA 2H6BA 2IA0A 2DPUA 1YS7A 1ZREA 2O61A 1EV7A 1P4WA 3ZN0A 2E1CA 1LDDA 2R7FA 3KP6A 2VT2A 3CUQA 2M8EA 2RVCA 3M7GA 1QO0D 2DT5A 2DQRA 2CGPA 3MQ0A 3JTHA 4YIFA 1L3LA 3KCCA 5A2QK 2Y75A 1SAXA 4FT8A 1IUYA 4XBFA 1TLHB 2QENA 2J5OA 2Q2EA 4PCQA 4BHBA 3IKVA 4EM1A 3RYPA 2M87A 3R6SA 1MDMA 3QPHA 1SD7A 4DQ2A 5E1ZB 1KU2A 1O7FA 4EM2A 4AD9A 2A6HF 4BYYA 3WTZA 1ON2A 2R3SA 1HSJA 5DDGA 1HW2A 1UB9A 1HW5A 4CDGA 2GXGA 2QLZA 5J8CA 2VBWA 5H6QA 1CF7A 1MJ9A 1QQIA 3WTSC 2W84A 3E5QA 3IKTA 3I59A 4FHTA 4I0AA 5ICFA 4LLNA 2JT1A 4P55A 2VOOA 1BJAA 3L7WA 5LRSA 2A07F 3IRQA 3LQRA 1MJAA 1FOKA 5H6RA 2UZKA 3KZZA 3P7NA 1G3SA 5DUIA 3EDPA 1TTYA 2ZFWA 3DP7A 2CO5A 4WXDA 5L3GA 1H9GA 4U88A 4I0BA 4OOIA 4ZYHA 1IN4A 4WF2A 2MBFA 2XROA 1DPRA 4P96A 1S7OA 3I53A 2HYFA 3CTAA 3TO9A 4HAMA 5ICCA 5LGNA 3WTXC 1IRGA 5L3CA 4K2EA 3WTVC 2QQAA 4EGZA 5ILSA 1LJ9A 4L9TA 4ZZLA 1PUEE 3GZ5A 4LFUA 1IXRC 4NB5A 2W25A 2OAZA 2TDXA 4KN7X 3CUQB 4BQAA 4HX7A 4OIPF 2HKOA 1FZPB 1ZRDA 3I71A 3IL2A 2VONA 1UHMA 4Q5SF 2FRHA 4IRGA 3KLOA 4LK1F 3SQNA 5ICEA 1LEBA 4M6YA 5ILUA 3TKYA 5HLHA 2FE3A 4IPAA 5BPDA 2QVOA 3WE2A 2IVMA 4BH9A 1JGSA 3V7SA 1QNTA 2DI3A 1MDMB 3TDZC 1ZRCA 2VBXA 5LRRA 1P4AA 2NYXA 4DNCA 1BBYA 3RPQA 3VFZA 5FLXK 3GFJA 1ZARA 2ZBKA 4KFCA 4ESJA 3H3ZA 3I4PA 3PQJA 1TW2A 1T6SA 2KRFA 2KKOA 4LK0F 1YIOA 1CF7B 3ZMVA 3F21A 4UVCA 3MFKA 5DD4A 1T0FA 3I59B 3IWFA 3HSEA 3EETA 2PI0A 4UV8A 4HW0A 3RJPA 2CG4A 2EV0A 2UWMA 1J5YA 3ECOA 2M45A 3WU1B 5FFZA 3S2WA 3U9GA 4KIBA 4MQ9F 4EVIA 2EV6A 4G9YA 2FMYA 3FM3A 2JZYA 4MTEA 1SFUA 1G4DA 4KN4X 4OMZA 2BEOA 3F8CA 2XV4S 4M9SA 2EB7A 4WCGA 1T2KA 1UHWA 4EV0A 1FWZA 3ULQB 2DBBA 4ASNA 2FNAA 1Z6TA 2XASA 3NRVA 2HDCA 4XLNF
chains in the Genus database with same CATH superfamily
2ZFUA 1GVJA 4XRMA 2A6TA 4KMUX 4W1UA 4PZJA 2VPLA 2XPVA 1AKHA 5HS8A 1DPUA 2OU2A 2Z33A 1RKTA 1Q1HA 3GMEA 1UELB 1X4PA 2EQRA 1LPQA 2JPBA 3LAJA 2FUG2 4P1WA 1MBFA 3LSMA 4Y4RA 3CCQI 4XOTA 4M71A 2R5ZB 4PUSA 1KU3A 2Q0OA 1WHUA 2FBIA 4BJ5C 4ZZDA 1TBXA 2GLOA 1EA3A 2AO9A 3V7RA 1BJZA 5KAIC 4ZTJA 2A68F 2K86A 4NNJA 1H89C 5M5WJ 4LLLA 1ZH5A 1GUUA 1ZK8A 3FM5A 2MA3A 2OPTA 4I99C 2HNHA 4DZJA 1GT0C 3W6KB 1LQ1A 3TDUC 2VKEA 3BJOA 3WHBA 3DU6A 2NOGA 1C0WA 4A3JJ 4OIOF 3ZQQA 3ZMDA 3S17J 2Y31A 1VQ5I 2KIFA 1BI0A 1I39A 3LSIA 2IS4A 2YX4A 4E7IA 1UZCA 1MJBA 4YIRX 3FKIJ 4HV6A 4PDKA 1E3PA 1T98A 2K9SA 1LFUP 1ZGJA 3CUQC 3U1KA 1CGPA 1U8RA 1ZRFA 3HSRA 3EUHC 4ZYEA 3DBLB 2NXNB 2XIGA 5CQGA 2P6SA 3DXJF 1TC3C 4KISA 5ED4A 2DQLA 3K6GA 4ENJA 3G71I 5EZGA 2X1CA 2JVHA 2RQPA 2XVCA 2HQNA 3OWTA 1IRFA 3D1NI 2YPRA 2ZXHA 4DJAA 2VXZA 3KIOA 4NC8A 3MZHA 1KGSA 1QA6A 1R5GA 2HQRA 3H9JA 3PUFA 3A2KA 2PEXA 1IZ1A 3CJQB 5HODA 2PJPA 5J1UA 3MKYB 2JA7J 2ZKZA 2M3AA 4JX5A 3CCJI 2LKXA 4RAYA 2XHKA 5IYBJ 5BPIA 3LL7A 1W4MA 3K4KA 4ZC3A 3ECHA 1SFEA 4RA2A 2DA6A 3J80Z 4D0PA 2WB1A 5DM6F 2D1HA 3FHZA 1ZYRF 4RAFA 5TJJA 1KYWA 3K2AA 2A6EF 4PSXA 1BOBA 5F1RA 4IQJA 2XGEA 3OOUA 4M9ZA 1D5VA 1V5EA 5B5EC 2HPMA 4U0WA 4RB2C 1LDJA 3R60A 4BY7J 2KIMA 4DBQA 2IGNA 2M30A 5J1YA 4BQOA 1ERDA 3ZXSA 2KFDA 1BIAA 3K4JA 1TWCJ 2W85A 3PNTA 4HNUA 1H88C 1VQ7I 4OIRF 4C30A 4OMYA 1GV5A 4RGRA 4HG2A 3PSFA 3MAJA 2VN2A 5IT9K 2XGCA 1SMTA 5HLGA 3CCLI 2VODA 1HW1A 5IOZA 3HL2A 1PJRA 4IO9F 3S1NJ 2Y69H 5HNFA 2E7WA 3KYLA 4S04A 3K70C 3CCMI 2HR3A 2RREA 3E5UA 3GTMJ 2KIUA 4X6AJ 4HV5A 4DYRA 1XS9A 4XL9A 2EIJH 4LB5A 2QBYA 1MNDA 5D5UB 2DYSH 3CLOA 3M07A 5EZHA 2PQ8A 3OIQA 1QVTA 1MMAA 3OYFA 2QZ8A 2PMZN 2ESHA 2FQ3A 2AXLA 4HSTA 2M0CA 4N9HA 3F6OA 2LSOA 1HF0A 2CYYA 4YG2F 2DA5A 3G1OA 4OWRB 1KZHA 3T0YA 3M9AA 4I02A 2CWEA 2DJNA 1AKHB 1MBKA 1I50J 1ZAOA 3VYSB 1EKEA 1MMDA 1V5GA 4GFBA 1ETKA 1QVUA 1RRJA 1ZG1A 1PP8F 3K2ZA 2R7VA 3GW2A 3F22A 5TGTA 3CUOA 4MEXF 2XKPA 2L4MA 1XG1A 2ZJRF 4GYGA 5FKLA 1IN6A 1D0YA 1KYZA 4RAZA 4IVNA 2HOAA 2DTRA 2QM3A 3NQOA 2BXZA 4MNUA 2G0EA 5J4VA 4V2FA 3HC7A 3BZ6A 4RDUA 3U2RA 5AIPA 3G6EI 2P8TA 1Y56A 2MFZA 3TO6A 1OFCX 2JSCA 1VQPI 1K6OA 3L2VA 2QEXI 2ECCA 4HF2A 5JLXA 1X1DA 2LY1A 4MLOA 1WJ5A 1OCCH 3J81Z 3G2BA 4GYIA 1JHHA 2FA5A 1OCZH 1A6IA 3FBNB 1MW7A 5BMZA 3MCZA 3HIFA 2QSGX 3CP2A 1IO2A 3F72A 1Z67A 2RNJA 4E4HA 2K9NA 3ML6A 2P5LC 4DGWB 1BN5A 1KQ9A 4I01A 2E2HJ 4D1QA 1IV8A 2JA2A 4Y15A 5F6FA 5CVVA 2E60A 4IOCF 3GZ6A 4CYCA 2ECBA 1VTNC 3REOA 1B6AA 1H0MA 1ZG5A 3VSKA 3OYIA 2D45A 4NBQA 4UV9A 3F8MA 3O8HA 1O7LA 4A2UA 3RKXA 3HTSB 2EFWA 1SD4A 3OIOA 2QQ8A 1Y1WJ 1Z1DA 2VQGA 4EM0B 4CXFA 2JUGA 2R7ZJ 3H0GJ 3S8PA 2DO7A 4QIWN 1APLC 1KA8A 2DFHA 3P9CA 2JA8J 1FC3A 2E36A 3DQVC 3GXOA 1B59A 2CQKA 4U0VA 2XC7A 2IA2A 2K4JA 3ERMA 3FMSA 4L5JA 1ZN2A 5CVIA 2XSJC 3EUHA 3DEWA 2VQLA 4U7BA 3B6CA 3OOPA 2IA1A 3W3CA 4ITVA 1MSFC 5HS7A 3S16J 2ME6A 3ABTA 1XDUA 4UNOA 4RMNA 1D8JA 2KIQA 3WTWC 3E7LA 1KONA 1H8AC 3ZMSA 1X3UA 4NC6A 3GTPJ 1I27A 3DF8A 5CVRA 3VYTB 1ETXA 3MD2A 5DTDA 1X2NA 3BR0A 2O0YA 4II2A 3BPXA 4GO1A 3RDIA 3SDBA 4OIQF 4DYQA 4ZYDA 1FTZA 5IOYA 3V7CA 1T0FC 2VC0A 2X85A 4M6XA 4ZDLA 2IGMA 3QWLA 2ZMEB 5F27A 1R71A 1R49A 2QBYB 4L0ZB 1KQ0A 1MBGA 1Z7UA 1OR7C 2Z16A 3RYRA 3I58A 3CC4I 4BBSJ 1DQUA 1HXDA 3L2WA 4U87A 1PDNC 3MKWB 4G8XA 3E6MA 1XD7A 4N0BA 5C44J 5LHGA 4HF1A 2HTJA 3RZDJ 2VKVA 3S1RJ 2X0LA 1T33A 5EEGA 1FOXA 1ETQA 3V4GA 3VB2A 1LE8A 2R0QC 3SZTA 1FSHA 3HSFA 2MGQA 1YX3A 1I1GA 3O6BB 2Y0MA 4GGGA 3CC7I 3CO6C 2VJIA 1HSTA 1MMNA 2JRMA 3HTUA 1SFKA 2M4KA 3MEXA 1BOAA 1VNDA 2DMPA 4EJUA 3BZCA 1IG7A 2YU3A 1ZGWA 3PQKA 3BPVA 3L00A 4PJJA 3DBRB 1T39A 1BR2A 3OR1C 5IT3A 5M5YJ 5GPCA 2C6YA 1YO5C 3E97A 3TW7A 2B0LA 3ZQIA 1FT9A 2CH0A 2HI3A 4HEA2 4CA0A 1IF1A 2HGCA 2ISYA 2Z2SB 3W2AA 2I5UA 1NK3P 5LGTA 1XGOA 3C2HA 3PFIA 5BS6A 1W0UA 1JKQC 2OQGA 3TW6A 3S2HJ 2DT7B 1UHSA 3WG9A 1XGMA 2B7EA 4ZTFA 2IS1A 2HKXA 3GUDA 1MD0A 1U6GA 2CV0A 2PN6A 4MHGA 1FLIA 5FROA 5HVQC 5IP7J 2X51A 1V3FA 3HGYA 3KP5A 4L9VA 4F93B 1WVRA 5FD6A 2WV0A 1ZKGA 1MBEA 2K02A 1J75A 2GAUA 3K4LA 1YE9A 1J7KA 1USTA 3C3WA 2ID3A 1X19A 4PJMA 2KT0A 4RB3C 2O8XA 3T1BA 1V5FA 2L4AA 4MEYF 2IXSA 3WHCA 2EV5A 1TNSA 2L9RA 5FD5A 5LBQA 3LA2A 4E7HA 2HU9A 4LLGF 1OYIA 4CCOA 1U9OA 2NAZA 4P9UA 5GTHC 5A2QZ 3VEPA 1O3TA 2P81A 2J5PA 3Q0WA 4CYCB 1U5TA 3QOEA 5AIQA 1OPCA 3DPTA 5HLIA 3FWEA 5DD8A 1A5JA 2XF5A 2E35A 3B73A 4JYKA 3JRBA 5M3MJ 4RBOA 2W7NA 2KLOA 1IN7A 3E1SA 5GPAA 1R6RA 3S3OA 2KISA 2GXAA 3DPUA 3MKZA 2OZUA 2CFXA 3S1QJ 1AWCA 1FPQA 1XSVA 1WH7A 2ZNZA 5C4XJ 2QKLB 3I56I 2UXXA 3SJMA 1WI3A 3AG4H 3O3KA 3FXMA 2L0KA 1B8IA 1WJDA 3PIPF 2G9WA 3K4CA 4B3AA 3D0SA 1XN7A 1F9NA 3KP4A 1YJ9I 3O8GA 3K1NA 4B09A 4L5IA 3I4NJ 2AXTC 2HOTA 3KFWX 3H92A 1QPMA 4Y13A 3ZGKA 3IWZA 4EEFG 3DTKA 3HB9A 1DP7P 2F5DA 5JHFA 1R23A 2BXYA 3SFIA 5DCFA 1POGA 1P4XA 3DLAA 4HPQA 2EILH 4BJTA 5JLWA 2EPFA 1XMAA 3HXLA 2LDUA 4CCMA 1Z91A 3CLQA 4XLCA 4I7HA 2E1NA 3JSPA 3C18A 4ZYAA 1A6QA 1IRXA 2QCOA 4CCNA 5GP9A 5TRDA 3G1LA 1F4KA 2OZ6A 2ZNYA 3SDGA 4R1HA 1R7JA 4FX4A 4M72A 1RZ4A 3K4BA 3HOYJ 1YYVA 4B4CA 2H1LA 2XRNA 1OLTA 3B02A 4XKCA 2XAGA 2ZJ2A 4IHTA 2ZB9A 3RPUD 1J9IA 1V54H 3VDXA 4S05A 2NS0A 4X1EA 3T5XA 3KEQA 1DGWY 3RQIA 2E1MB 2FXAA 1JXSA 1K6YA 4EJOA 5D4RA 3OMYA 1S6LA 2W57A 1G6NA 2JK3A 1WZ2A 2WB1N 4AVPA 1HKTA 4GDFA 4ESFA 2WAQA 3FKJA 1HDDC 4IRHA 2WA0A 2XGXA 3MKLA 1RI7A 1MGTA 1QRYA 2MSYA 3F3XA 3FIWA 4WXHA 1WGXA 1MIJA 1S5LC 2VJ5A 1XB4A 1OYWA 3F8FA 1K7AA 3BWGA 4G6TB 2XSDC 2LMDA 1R00A 2KJCA 1IJWC 4F3QA 1JI8A 3VSLA 2Y9YA 4PK4A 1UCRA 3UKGA 3NARA 4GXOA 2ZMEC 1U78A 4II3A 1OR7A 2EFOA 3IAS2 2DW4A 2R7OA 4KJZA 5JVGF 1HKSA 1WPKA 4FETA 5HOOA 2XUBA 4I98B 5K7HA 2HEOA 2DPDA 3KYDB 2EZLA 4J00A 4M73A 3PJRA 2L2OA 4RB1A 1SVOA 4CH7A 4UXNA 3WU2C 2LG4A 4UVAA 1JTXA 5D5XB 3FXLA 3HPGA 3Q0UA 3S3NA 1FX7A 3G3ZA 2V79A 1HKQA 1LVKA 2NVXJ 5BNGA 3LSPA 2XPUA 1XCVA 2KP6A 3ZOBA 2A05A 1G2HA 4RGSA 5K5QA 3D5RC 5LLQA 4ZYGA 1T08B 2CUZA 1OCOH 2L3DA 3IHUA 3IUOA 4Q47A 3VODA 1QZZA 1UAAA 1XDSA 4XRFA 1GXPA 3OYGA 4LIVA 1XSXA 3DBHB 3GX4X 4ETSA 4LOCA 3CCRI 3BQZA 2DMQA 2I10A 5EG0A 2EZIA 1U5TB 2MD5A 2IGKA 4Y7NJ 4AVZA 1TP4A 1JKPC 5IP6A 2VASA 3OYHA 2E34A 3DWLE 3GF2A 1IGNA 2IRFG 5M5XJ 2NS8A 4MIMA 2K3FA 3VYRB 2M9HA 3ABUA 5K5OA 3V42A 1D5YA 1VZ0A 2V1DA 2YR2A 6PAXA 4IHSA 1YG2A 3SHFA 4CUGA 4ANJA 3CF2A 1X1PA 4IL6C 2R7WA 2GOMA 2X4HA 2OQRA 1ITYA 1B8IB 4MGRA 5FO5A 2CV1A 3OV8A 3P5JA 4HSRA 2QA4I 4CGZA 3J7AY 1U2WA 2GZWA 5FLXZ 2EFNA 2JJ7A 3FX3A 4AIKA 1GXQA 2VQHA 1B1BA 4BQNA 3N05A 2HTSA 3KYCB 2GBYA 4L9JA 2R93J 2NNYA 1GVDA 5E8IA 4NDLA 3HDDA 2L9SA 5JR3A 4KDPA 1E3OC 3DKYA 2K85A 3EYIA 1D1CA 3VPRA 4Q4ZF 3QU3A 4M3DA 3C2BA 3I0TA 3FXUA 1VQNI 3BTJA 4JBAA 3GFMA 1Z3XA 1IN8A 2ESNA 2VBYA 5LHIA 4DOZA 4OU0A 3GTKJ 4IHWA 3GO5A 4KYWA 3QPLA 3LAPA 1ONVA 4XSXF 2RN7A 2IT0A 9ANTA 3FXOA 2CRGA 3L2RA 4HDVA 3C1DA 3RIRA 1BC7C 1QZYA 2HYGD 5CLSA 2OV7A 2F5CA 2QQ9A 2V9PA 3EPZA 4RB0A 2A5YB 2AS5F 3W6JB 1G8XA 1I5ZA 2ZJPF 3BG3A 1LUJB 5D8LB 4E7ZA 2XAHA 3H5NA 1F5TA 2M34A 2E71A 4BUPA 4KIGA 2IEKA 2VC1A 2DA3A 1J59A 3JRGA 4QSHA 2MG4A 1ZQ3P 5J3LA 3BJAA 2HOEA 5L3DA 3BG6A 3OS1A 2H94A 5AONA 3KLNA 2DA7A 4P5OA 1EH7A 4A3CJ 2DN0A 2QGUA 1FYMA 1XC5A 1K78A 1R5HA 2H1KA 2CS3A 2EWNA 1PUFA 5BQTA 3BY6A 2CV2A 3JAMK 3BR6A 1JUMA 2LBFB 2Y9ZA 3F23A 3OYDA 3S15J 3CF5F 2DCEA 2M8GX 2EK5A 3HUGA 1FBQA 2JTVA 3VYUB 3DEUA 4IEJA 4U7DA 2WY7Q 3HOVJ 4FASD 1IUFA 4G7HF 1MBHA 2V1NA 2UXNA 3NAUA 4KT6A 3WTYC 3DTIA 1X2MA 2A3SA 2K4BA 1XSDA 3H9GA 5LGUA 1HLVA 2IPQX 3U21A 1Y1VJ 3KEYA 3PFYA 3ABLH 3D5LA 2E1MC 3SEQA 5ICGA 3L2CA 2HPIA 5HDKA 2Z3YA 4YELA 3GCMA 3LQQA 3FF5A 3M8FA 1ZG3A 4LMYA 2BOLA 2ELJA 4L18B 3GTOJ 3HOTA 3JRDA 5K5RA 1VI0A 3FMRA 3J81K 1FYLA 5JVTA 3QRFF 4A3DJ 3FK7A 2P7CB 3BC8A 1V4RA 3DFGA 2TCTA 2DMUA 3R0JA 3DPLC 5E79C 1F36A 4HLXA 3ZQFA 4GRIA 2YSRA 2DK8A 3CQZJ 3W2VA 2ID6A 4HDUA 3R61A 3I5UA 5EG0B 2OTJI 4A3BJ 2ZMEA 2R7RA 4G7OF 2CUEA 2NOJB 4A0XA 4PJLA 1BR4A 1MMSA 3F9KA 1ZLKA 4BY1J 1T8IA 2X1EA 2EBIA 2M2EA 2DLLA 2DODA 2GOXB 1BL0A 1VQKI 4C3IJ 1JKRC 3GWZA 2LY9A 3IV5A 3FXRA 4AU7A 3OSGA 4KUMA 4I2OA 3PNYA 5HS9A 1T56A 4A3LJ 3ERED 4KIFA 3GBGA 4LITA 2LH9A 1YI2I 4UUSA 1D1AA 1K79A 1N77A 2MH9A 2E2JJ 4XLHA 1Z6RA 2HZDA 2PG4A 2KJBA 2QF7A 1EH8A 3OYEA 1B4AA 3WGHA 1MZBA 4CICA 3CCYA 4IF4A 1YFHA 2EZHA 5F04A 3WU0A 4IRIA 2WV1A 1I3QJ 2LF7A 4LG3A 4BE2A 1MH4A 1RETA 3SFZA 1BC8C 1D3YA 2XAFA 2ACJA 2KDZA 5DEQA 1U5TC 1NTCA 4E6KG 1BI2A 3TOAA 2M1BA 3SEZA 3V8LA 4BE1A 4E7SA 3TGNA 3QYBA 1I6XA 1R22A 1R1TA 3DU5A 3BR5A 4D7NA 3R0AA 4YFXF 2STWA 3MVPA 3CMYA 2K9LA 3BOQA 1Z0XA 3HOUJ 4HZFA 3UNGC 5HLTA 5H20A 3E5XA 2GQQA 4XQFA 1ZTRA 4E7LA 4AWXB 3GTLJ 2VE8A 2UV1A 4A3FJ 3CJTB 1TT5B 5L3EA 4R8HA 4F92B 3L2UA 2GXBA 5EJCA 3BR3A 4UUTA 5FRMA 2KRCA 5KCMA 4J19A 2KMUA 3LSHA 1O3QA 3R4KA 2V6CA 4HF0A 4MTDA 4A6DA 1FBSA 4BBRJ 4XSZF 2BVMA 3DCFA 4ENNA 3BQYA 4D7MA 3NWSA 4U0YA 4A6EA 5D8KB 5EDNA 5B1AH 3OYMA 3GLLA 3J7AO 2F2EA 2BE5F 5E8GA 2BW3A 5IT9Z 3IC7A 5F1JA 4IX7A 3E0JB 3TQNA 4YIIA 3JSOA 2NS7A 4NC7A 2EIMH 2E7XA 3P9IA 1QHHD 2P0WA 1K78B 2BV6A 4H0EA 3IRRA 3QPTA 1PUFB 3LSJA 2PJRA 1O3SA 3ZQ7A 3DEEA 2XAQA 3LFKA 2O6GE 3CESA 4EQQA 4RGXA 5HDGA 2LRDA 2K5CA 2WAEA 4YEJA 5FKOA 2XB5A 2HFHA 2PMUA 3PUBA 2QWWA 3HUGB 4A5MA 5LEKA 2LY2A 4O5VA 3A4CA 1A04A 1YTYA 2X9DA 3H5AA 3QOPA 2RKHA 1DU0A 1E2XA 3CCEI 2FBHA 1VQ6I 1FYKA 1MSEC 3PO3J 4P9FA 3FZVA 4ZH4F 1PP7U 1Y8QB 2ZXJA 4O3MA 1NG7A 2BHZA 3S14J 2F5VA 3Q5FA 5JHUA 4DIQA 2MD0A 2RC4A 3LOCA 3PO2J 4G6QA 1Z7LA 2A61A 4Z6YA 1S8NA 4CHUA 3L1PA 2ZJQF 1FMVA 4XRSG 1X1AA 2MLGA 3LSTA 2WAQN 5GAEJ 5JI6A 5L3FA 4KT5C 3Q9SA 1OQYA 3OYCA 5EF6A 3NWTA 1OYYA 4PJ0C 1FIPA 2PBIA 2F5FA 3HKZA 4BXFA 2LVSA 2LD5A 2CU7A 4TV7A 2VOPA 1EH6A 3K9TA 2ZC2A 3ELKA 2ELKA 5HNHA 3GZNB 3N4MA 3ZQGA 2W00A 2XF7A 3T8TA 1Z21A 3JRIA 5KVRA 5IYDJ 3I4MJ 3K0LA 3RSNA 3RPUA 3FBIB 4Y3OA 3RZOJ 4A12A 4BEHA 2ME0A 1VF9A 2EH3A 3CCUI 1YRNB 4LG0B 2D5VA 1ZLJA 2K27A 2GIVA 3ASOH 1TQPA 3KETA 1USSA 4UUSB 1SFOJ 1NHAA 3JRHA 1IC8A 4Y33A 5GADJ 2Y48A 3W2WA 2YS9A 1XTAA 3DLLF 2F5EA 1S29A 2EA2A 5DUKA 1MMGA 3BG5A 4GCVA 3CJNA 2D1VA 4LGWA 3O2PE 4AYBA 3LNQA 3HHHA 3ZCOA 4LJZF 5LHHA 2GA2A 4CZCA 1YW8A 2LLKA 2WAFA 3IAM2 4L0YB 1A35A 3BP8A 1FY7A 2OF7A 2FOKA 5F0FA 4D5FA 4LB6B 4WX9A 3TP3A 1ACIA 1DGRM 3KZIC 4UHTA 4W97A 2F4MB 3I3LA 2V26A 4YRVA 3OS0A 4G7ZF 1XGSA 2QQBA 1LNWA 4N9IA 1OISA 4BQQA 2WC2A 4UVBA 2EIKH 4CCKA 2ELHA 3EUAA 2PMZA 5J47A 1MH3A 4C2UA 1GDTA 5F64A 4FX0A 1BI3A 5JFRA 3CDIA 5E1WA 2JSPA 3HGGA 2HVQA 4HQMA 1WJEA 2YUSA 4EMSA 2FU4A 2X6YA 2DTZA 4PFPA 3LA3A 5K1YA 2DMNA 3BTLA 4LIUA 1LVAA 5CYVA 4AM3A 2W1OA 3JW4A 5KHDA 5D5VB 2QYOA 2OD5A 2QSHX 3AL0B 4AIJA 1MNEA 3Q0VA 3GLXA 3IP4B 5TISC 3LFUA 1AHDP 1I6HJ 4XOPA 2ZCWA 2RNGA 3WTTC 5ILVA 1JTYA 3OS2A 2BW3B 1QBJA 3F6VA 1J09A 2LR8A 2JPCA 2XKOA 2L7MP 3E6BA 1EF4A 2PX9A 2O03A 1V55H 3BCAA 2CQQA 3TOBA 2XB0X 3E6DA 2QSFX 3U1DA 2PJRB 2GWRA 1Y0UA 3HRMA 1RKWA 2P5VA 2A69F 1R9TJ 1W1WE 3RQ4A 4JOMA 4EJVA 2V1XA 5K7FA 1FNNA 3OYBA 1K61A 1TZLA 2F4IA 2IGOA 3WG7H 2O9LA 2OC6A 1X3WB 4NQWA 3A0HC 1ODDA 1WRJA 2VBZA 4RM2A 2HXIA 5LFAA 4XLPF 5KNLA 2MLKA 1BW5A 1G3TA 2Y30A 1W36D 3DKWA 1U9NA 2W24A 4G6DA 3HZJA 3ISPA 4HX4A 1I1SA 1N25A 2K40A 1IW7F 1PVEA 4UB8C 1YQAA 4UB6C 1H9TA 2PMHA 1STZA 5DS9A 2DT6A 2P6TA 3CC2I 1S72I 1P2FA 2O8KA 4ZJZA 1G3YA 3HG9A 2Q8KA 2LK2A 3WTUC 1YW7A 4V19K 1D8KA 1SVLA 1MKMA 1S7AA 3K10A 3KEOA 1KQ8A 3BDDA 1KU7A 4EJTA 2MH2A 5CPRB 2UUZA 5LEJA 2BGCA 2EZKA 1YW9A 3H5RA 4QTRA 1R1UA 1Z9CA 2FD5A 2IS6A 1YLFA 1UFMA 1WWXA 2CMPA 2D2WA 2P7VB 2RQQA 2VKHA 3HRTA 4IJAA 4F55A 2ADUA 3CMEI 2DAOA 2O5RA 3HJEA 3AFHA 2LFBA 1U3EM 4IHXA 4E7JA 4JX4A 2RDPA 5EEHA 3RKQA 2HWVA 5J8FA 2FJ1A 3OYJA 2COMA 1HC8A 5CJ9A 2BZTA 3BROA 1L0OC 1UG0A 4A0YA 1IRZA 3HM5A 2L01A 3FHNA 2H27A 4CZZA 2NVQJ 3BZKA 4XM3A 4CSWA 1R1VA 2OA4A 4A0ZA 4BEHB 2N8GA 3GFIA 2BYVE 4D9JA 2KZGA 5IPAA 4BNCA 3IH4A 2XGDA 2F48A 2V6EA 1RIOH 2FOWA 3RKYA 1ZR4A 5FFXA 3IH2A 2X1DA 1YOVB 4HLYA 2WY8Q 3HHGA 3IH3A 3PL8A 4BXXJ 1BI1A 2CFOA 2H09A 3GEZA 4M74A 1Z05A 3RKWA 3I64A 3TMOA 1E17A 1TQMA 1IN5A 1FP1D 5E3NA 1YS6A 2A5WA 3ASNH 1HCRA 2JVGA 2WADA 2VUMJ 4CCJA 2LBFA 4H4KC 4RGUA 1SC7A 4XN3A 3SXYA 3CZ6A 4OAZA 1XMKA 4B3XA 3AAFA 2P4WA 1LEAA 2EFQA 1UMQA 2VQCA 2X48A 4OAYA 5E20A 4ENKA 2BBYA 1K4TA 3HRSA 2KL4A 2LF8A 4MFDA 5FLVA 2G7HA 2NVTJ 3KP2A 1MBJA 5EEAA 2LP0A 3FDYA 1XX5A 4ZDOA 3QAHA 3CCSI 4YFNF 1E0EA 1P6RA 2NVUB 3J7ZI 1IAWA 3QP5A 2L9VA 4FCYA 2BY1A 2XAJA 1FSEA 4NHJA 3CD6I 1VFCA 1XMXA 2V4JC 2RGVA 5D6EA 2OTLI 5F0CA 3E3VA 4BGDA 2ETHA 2E1OA 2R7DA 1O57A 3ZMUA 3ZRGA 2R7TA 1JHFA 2MYSA 2R7UA 2HVRA 2QKMB 3MN2A 4A93J 1NH3A 1WJFA 4BKXA 3OSFA 1W7PA 3V8JA 1Z3YA 4A3MJ 4M3FA 2NNNA 4XK4A 2VE9A 3BLYA 1YHQI 1TW3A 3X2QH 1B72A 4KNYA 1D1BA 2HQ5A 3GYHX 2VJ4A 3P9KA 4JK1X 4Y17A 1FOYA 3N97A 2FBKA 2VB6A 3C7JA 4NQWB 1BIBA 4XRSA 1OKRA 1ETOA 2IP2A 4B44A 2IJLA 1BA5A 2K7LA 3H3UA 3K1PA 2F6CA 2HDWA 4PSWA 2VLAA 5BOXA 4RS8A 3J80K 1ZR2A 2FSWA 3QYEA 2L9NA 3JRCA 3KP7A 3AL0C 1W5SA 3VOEA 2HS5A 3A03A 1HQCA 4I09A 3BJ6A 1T95A 4BXUA 2W48A 2Z5UA 5IY5H 1SD5A 3ZN1A 2PLYA 1CQTA 2R4GA 3ZP5A 1EJ9A 4B48A 4QLCU 4XR6A 5FLMJ 3JR9A 4UUVA 3LMMA 4OINF 2KRHA 4F7ZA 2B9SA 2HQAA 1F43A 2LNBA 1JJ8C 1RUOA 4IHYA 3GFLA 2STTA 1IV6A 2H8WA 3MZ8A 2V1UA 2XDVA 3WGIA 1LB2A 2LTPA 2DFIA 1TNTA 2Y2ZA 3BR1A 4XONA 3OL3A 4BDZA 2OCCH 1LFPA 3LSGA 3OYAA 1X4OA 2ZSIB 1RUNA 3RCOA 2JMWA 1P9QC 2Z99A 2CSOA 1FJLA 3FMQA 1WJAA 5E1XA 5FGMA 2X6OA 1BM9A 3OR2C 1VQLI 1W36C 1P7IA 4DYCA 5C3EJ 2BY3A 4EJWA 3H3VK 3HRUA 4CCLA 3KP3A 4DBRA 4WXCA 2ISZA 3OY9A 2FMLA 3S3MA 5DCMA 5L3BA 4XIDA 1IDYA 2LOOA 3K69A 1X1CA 3RTRA 2FQ4A 1Z77A 4XNFA 3CO7C 1W5TA 3A01B 2L54A 3G73A 1O3RA 3FXJA 2DOAA 2LC2A 2MC4A 1ETVA 1FBUA 1WSUA 1S3JA 4XICA 1B9MA 5EGOB 3WE3A 4AUXA 1BW6A 3AG3H 2BY0A 4C2MJ 4KMFA 4FQGA 5E3MA 3DV8A 2BVLA 3CJRB 4JX6A 1SMYF 3ZQCA 3AG1H 3S1MJ 1FP2A 2L7KA 4HA8A 3KE2A 3LWFA 2FF4A 2ZO4A 1K4SA 3FXQA 2WBMA 2WTEA 3I54A 1RC9A 4C9YA 3JCUC 3KZYA 1ULYA 1SVMA 1YX5A 3L2QA 3HKZN 1N75A 3GVAA 3AG2H 4RM3A 2R92J 3EYYA 3MZYA 4Q48A 2L02A 3MMYB 2EA4A 2Z9OA 2XAUA 4BE0A 2VI6A 2GA1A 5K7ZA 3H35A 1JE8A 2NRAC 4JQFA 4PGHA 4HBLA 5FKNA 2WWYA 1Y6IA 3TBIA 4G94A 5E17F 3BTIA 3V8KA 1E3HA 2CW0F 4A5NA 2HOSA 1BR1A 1WI9A 4MQVA 5HDNA 1ZHFA 2JRTA 1GHCA 2DOFA 1JGGA 2W82A 4F52A 3K1MA 3A0BC 1R36A 5FKKA 1W7PD 2MABA 4IXAA 2R5YA 3GTQJ 4Z2YA 5J1RA 2M5WA 2AQEA 1W7PB 5H2FC 2GM4A 4PFOA 3BG9A 4AYBN 4DW6A 1B9NA 5GAHJ 5ERIA 4BU2A 2LKPA 2YX7A 3CDHA 3ZR8X 4BAYA 3TO7A 3ZPLA 2DK5A 3ZMZA 1B72B 2H6CA 5DM7F 4E70A 1WKMA 1YRNA 1ZGAA 4LG0A 2EFPA 2JQ7A 1FTTA 3QP6A 4LD5A 1VQ4I 4C3JJ 1QGPA 2V9VA 2DYRH 2M7BA 2P5KA 4KA4A 2O3FA 3RI4A 3EUKL 3ABMH 1TQIA 3OYNA 1REPC 1UJ8A 5E18F 2L7ZA 1XGNA 2MC3A 3NEUA 4FE4A 1JT6A 5F08A 5KK1A 1T38A 1ORKA 3G1MA 3EQLF 1WQ2A 3L09A 4HOBA 3WODF 2O7OA 4HYEA 3HPHA 4WWCA 5GTIC 2HYJA 3A02A 4IKFA 4IHVA 3HOSA 3COAC 2VT3A 4BHCA 3C2GA 1FMWA 1JUPA 1Y0NA 1AOYA 4DZPA 1R58A 4G12A 1P92A 2YU9J 4KICA 2PFBA 1OMIA 3DTEA 4ON0A 2DU9A 2OCEA 1J0RA 1F1ZA 1FEXA 3JAMZ 5CVJA 5FB2A 3Q9VA 4XMYA 4A3KJ 4I76A 4NUBA 1PYVA 4EGYA 3M8EA 2HDDA 5J6XA 1IXCA 2Y0SA 3ZMTA 1FOWA 2FEZA 2DFFA 4MFEA 2EINH 2E5ZA 2OUMA 2IW5A 4ENMA 1IDZA 3HYIA 2I8DA 3S93A 5E3OA 1DUXC 2VXDA 4HX8A 5CVUA 3F8NA 1HBXG 3G4SI 1HA8A 4QWQA 4M6VA 3E6CC 2QUFA 5D4SA 2CUFA 5DYMA 4HQEA 4C2TA 1LDKB 1WFXA 2DDAA 2JWTA 3LA7A 5FKMA 2Q1ZB 3SZPA 1U8BA 2ZSHB 3T8RA 3WGGA 3JTGA 4N4OB 5M3FJ 3M3YJ 4PGGA 1XPXA 5DCMB 1KU9A 2E19A 3QU6A 1SFXA 1ON1A 5D5WB 1DDNA 4A3GJ 4A3IJ 1R5ID 2EJRA 1VQ8I 2CQ7A 4B43A 1WJCA 4M3GA 3CMAI 4CYDA 3M1EA 4B8XA 1N78A 4Y52J 2DA4A 4BHPA 2OJED 3F0CA 4X0GA 4O6JA 4WK8F 4ESBA 2CUJA 1FIAA 3F8BA 3BR2A 1SEUA 1J2XA 2LREA 1SD6A 2G7UA 3PSIA 5DV5A 5GAGJ 1IXSB 1G3WA 2COBA 4R79A 4AIHA 3ROUA 4B1RA 4L9NA 1NK2P 4BACA 3MWMA 4YFKF 5IYCJ 2M0MA 1JJ6C 2X6XA 2HZTA 4J01A 4XKWA 2MW8A 1RR7A 3HBLA 5D6FA 1XCBA 2RV8A 4M9XA 1I3AA 2OBPA 4FTHA 3L9FA 4XKVA 1QU3A 2LKSA 2ZXWH 4CO8A 4M3EA 3Q3SA 2HXOA 2FNPA 3KX2A 2NVYJ 4MO7A 1RNLA 2H6BA 2IA0A 1Q1VA 3H36A 2DPUA 1YS7A 1ZREA 2O61A 1EV7A 1P4WA 1S7EA 3LSKA 3ZN0A 2E1CA 3D5SC 1LDDA 2R7FA 3KP6A 2VT2A 1TT0A 1R4MB 3BG7A 5CKTA 5KAFC 3M4OJ 3CUQA 4FISA 2M8EA 2RVCA 3M7GA 3JRFA 4UY8I 1QO0D 3OIPA 2Z1DA 2DT5A 2DQRA 2RAEA 2CGPA 1NG6A 3FXKA 3MQ0A 3JREA 3JTHA 2CW8A 2IBDA 2R5YB 4YIFA 1K83J 2M4GA 2DA1A 1L3LA 1TWHJ 3KCCA 3BCBA 1DP3A 3BT9A 3KPHA 5A2QK 1YJWI 2IS2A 1TWFJ 4JP0A 2Y75A 4S0HB 1SAXA 2DXIA 4FT8A 1IUYA 5LD2C 2VIXA 2XPWA 3I9V2 4XBFA 1TLHB 2QENA 3FISA 1O4XA 2J5OA 2Q2EA 1YJNI 2CJJA 3DKXA 1M1EB 4PCQA 2GIZA 4BHBA 4BS9A 3IKVA 1VQ9I 4EM1A 3PM1A 3RYPA 1LKXA 1RPWA 2M87A 3R6SA 1MDMA 3K4NA 1WH5A 3QPHA 1SD7A 3OYKA 4DQ2A 3J7YJ 5E1ZB 3HOXJ 1RR8C 3CMMA 1KU2A 1O7FA 4EM2A 4AD9A 2A6HF 4BYYA 3WTZA 1ON2A 2CQXA 2KZVA 2R3SA 3A1YA 4BL0B 4A3EJ 4XKBA 1HSJA 5DDGA 2BY2A 5E3LA 3ESWB 1HW2A 3TEDA 1OCRH 1UB9A 4QPOA 3LSRA 2XRLA 1HW5A 4CDGA 2B63J 5C4JJ 2GXGA 1Y8RB 2QLZA 3K7AJ 5J8CA 4V2GA 3SZGA 2VBWA 5H6QA 1CF7A 1QZEA 1MJ9A 2TRTA 1QQIA 3WTSC 3SYTA 2W84A 3E5QA 4BJ6C 3IKTA 3I59A 1SANA 2VKDA 4FHTA 4I0AA 1D0ZA 5ICFA 4I6ZA 4LLNA 2FX0A 2JT1A 3HOZJ 4P55A 3S32A 3H0DA 2VOOA 1BJAA 3L7WA 5B66C 5LRSA 2A07F 3IRQA 3HOWJ 3LQRA 1MJAA 2BHYA 4F91B 1X58A 1FOKA 5B1BH 3PNVA 2LYCA 2ZXIA 1QHGA 1RESA 2KDOA 3H1CA 5H6RA 2UZKA 3KZZA 3P7NA 1U0JA 1G3SA 5DUIA 1P7JA 3EDPA 1JUSA 1TTYA 1A31A 3QQAA 2ZFWA 3DP7A 2CO5A 4WXDA 2X6WA 5L3GA 1H9GA 4U88A 1TWGJ 4I0BA 1A36A 4OOIA 3GTGJ 2R7SA 4ZYHA 1VQOI 1IN4A 4WF2A 4ABZA 2MBFA 2XROA 1GLNA 1JKOC 1DPRA 3GTJJ 4P96A 3B6AA 1S7OA 4FE7A 5FRNA 3I53A 4PJNA 4E7KA 2HYFA 2AQFA 4HRIA 3CTAA 3TO9A 4HAMA 1JT0A 1ENHA 5ICCA 5LGNA 4QPQA 4IOAF 3CP8A 3M8JA 4IZZA 5J4YA 3WTXC 1IRGA 5L3CA 4K2EA 3WTVC 2QQAA 4EGZA 5ILSA 1LJ9A 4RLFA 4L9TA 4ZZLA 1PUEE 3GZ5A 4LFUA 1IXRC 4EATA 4NB5A 1WCMJ 2W25A 2OAZA 2TDXA 1D0XA 4KN7X 3CUQB 3PIOF 3CCVI 4BQAA 4HX7A 4OIPF 2R5ZA 3TL4X 4M3BA 2HKOA 1X1BA 1SAUA 1AU7A 1FZPB 1ZRDA 4BDYA 3I71A 3IL2A 2VONA 1UHMA 5EYRA 4Q5SF 2FRHA 3QYFA 3OL4A 1S9HA 4IRGA 3ZQHA 3KLOA 1W5CC 3M1CA 4ZDPA 4LK1F 3SQNA 5ICEA 1LEBA 4M6YA 4L5EA 5ILUA 2HVSA 3TKYA 5HLHA 2E2IJ 2KQRA 1OCPA 2Q2EB 3CDLA 2FE3A 2DOEA 2KPMA 2JA6J 2L7FP 4IPAA 3OYLA 2QVOA 3WE2A 5BPDA 2IVMA 2DA2A 1OJLA 1R4NB 1UG2A 4BH9A 1JGSA 1LFBA 1QNTA 3V7SA 1AA7A 2DJIA 2DI3A 1MDMB 4N4NB 3TDZC 2VBXA 1ZRCA 5LRRA 3A01A 1P4AA 2NYXA 1ETYA 2M7AA 4DNCA 1BBYA 5FJ8J 1Y39A 3RPQA 3VFZA 3S2DJ 4XORA 2IAIA 5FLXK 2JUCA 1ZARA 3GFJA 5J40A 4HNTA 2ZBKA 1WJBA 4KFCA 5B3SH 3H3ZA 2VPRA 4ESJA 1QPIA 3I4PA 5EGOA 3QPSA 1LE8B 3PQJA 2E5NA 3JRAA 1ETWA 2JA5J 1TW2A 4D5CA 1T6SA 4B47A 2CQNA 3ABKH 2KRFA 2KKOA 4KITB 2V7FA 4LK0F 2R7QA 4RLQA 5IP9J 1YIOA 4AIDA 1HDPA 3K70D 2V9KA 1CF7B 2K3PA 3ZMVA 3F21A 3VWBA 4UVCA 3HEFA 5CQEA 3MFKA 5DD4A 2DDBA 1T0FA 2XF6A 3I59B 3TP0A 2DMTA 3IWFA 4XLAA 1G59A 3HSEA 4C3HJ 3FK6A 2K9MA 3EETA 2AHQA 3I55I 3ZQLA 2KHMA 4UV8A 2PI0A 1X3ZB 4HW0A 1TL8A 3RJPA 2CG4A 2EV0A 2UWMA 1TWAJ 1J5YA 1OCTC 3K4MA 3ECOA 2M45A 3WU1B 1YITI 5FFZA 3S2WA 3U9GA 4KIBA 4MQ9F 2VL8A 1YIJI 4EVIA 2EV6A 4G9YA 2FMYA 2H8RA 3FM3A 2JZYA 4HNVA 1MNMC 4A69C 4MTEA 1SFUA 1G4DA 4KN4X 4AC0A 1VQMI 4OMZA 3ONQA 2BEOA 3F8CA 5F0HA 2XV4S 2VJJA 2EB7A 3BTCA 4M9SA 4WCGA 1T2KA 4XLEA 1UHWA 3QODA 2CW7A 2DFEA 1DU6A 4EV0A 2L5QA 2R7XA 2W4SA 1FWZA 3ULQB 2DBBA 3AKZA 4ASNA 3UR3C 2FNAA 1HOMA 4XLFA 4IQ4A 1Z6TA 2JN6A 1GV2A 2Y0SN 1ZELA 2XASA 3NRVA 2HDCA 4XN0A 1W0TA 2F4OB 2ICWG 2K9QA 4RAGA 3H9QA 4XLNF 3W6VA
chains in the Genus database with same CATH topology
1GVJA 4KMUX 4PZJA 5HS8A 1DPUA 2OU2A 2Z33A 1Q1HA 2JPBA 3LAJA 4M71A 1KU3A 2Q0OA 2FBIA 4ZZDA 1TBXA 3V7RA 2A68F 2K86A 4LLLA 1ZH5A 3FM5A 2MA3A 3W6KB 1LQ1A 3TDUC 3BJOA 1C0WA 4OIOF 3ZMDA 2KIFA 1BI0A 2YX4A 1MJBA 4HV6A 4PDKA 1T98A 1ZGJA 3CUQC 1CGPA 1U8RA 1ZRFA 3HSRA 4ZYEA 2XIGA 2P6SA 3DXJF 5ED4A 2DQLA 4ENJA 2XVCA 2RQPA 2HQNA 1IRFA 2YPRA 2VXZA 3MZHA 1KGSA 1R5GA 2HQRA 2PEXA 1IZ1A 2PJPA 2ZKZA 4RAYA 2XHKA 5BPIA 1W4MA 3ECHA 1SFEA 3J80Z 4D0PA 2D1HA 3FHZA 1ZYRF 5TJJA 1KYWA 2A6EF 5F1RA 4M9ZA 1D5VA 4U0WA 4RB2C 1LDJA 3R60A 2KIMA 2M30A 1BIAA 2W85A 4OIRF 4OMYA 4RGRA 3MAJA 2VN2A 5IT9K 1SMTA 5HLGA 2VODA 1HW1A 2E7WA 4S04A 2HR3A 3E5UA 2KIUA 4HV5A 4LB5A 2QBYA 5D5UB 3CLOA 2PQ8A 2QZ8A 2ESHA 2FQ3A 2AXLA 4N9HA 3F6OA 2LSOA 2CYYA 4YG2F 3T0YA 3M9AA 4I02A 2CWEA 1ZAOA 1ZG1A 1PP8F 3K2ZA 3GW2A 3F22A 3CUOA 4MEXF 2XKPA 2L4MA 4GYGA 1IN6A 1KYZA 4RAZA 4IVNA 2DTRA 2QM3A 3NQOA 4MNUA 3BZ6A 3U2RA 5AIPA 2P8TA 3TO6A 2JSCA 1K6OA 4HF2A 3J81Z 4GYIA 1JHHA 2FA5A 5BMZA 3MCZA 3HIFA 3F72A 2RNJA 3ML6A 2P5LC 1BN5A 1KQ9A 4I01A 5F6FA 4Y15A 5CVVA 3GZ6A 1VTNC 3REOA 1B6AA 1H0MA 1ZG5A 2D45A 4UV9A 3F8MA 1O7LA 4A2UA 3RKXA 3HTSB 2EFWA 1SD4A 1Z1DA 4EM0B 4CXFA 2DO7A 1KA8A 3P9CA 1FC3A 3DQVC 3GXOA 1B59A 2CQKA 4U0VA 2IA2A 2K4JA 3FMSA 4L5JA 1ZN2A 5CVIA 3EUHA 4U7BA 3OOPA 2IA1A 5HS7A 3ABTA 1XDUA 4UNOA 1D8JA 3WTWC 3ZMSA 1X3UA 1I27A 3DF8A 5CVRA 2O0YA 3BPXA 4GO1A 3RDIA 4OIQF 4ZYDA 3V7CA 2VC0A 4M6XA 4KMFA 4L0ZB 2ZMEB 2QBYB 1KQ0A 1Z7UA 3RYRA 3I58A 1HXDA 1PDNC 4G8XA 3E6MA 1XD7A 4N0BA 5LHGA 4HF1A 2HTJA 2X0LA 5EEGA 3V4GA 3VB2A 3SZTA 1FSHA 3HSFA 4GGGA 1I1GA 3O6BB 2Y0MA 3CO6C 1HSTA 3HTUA 3MEXA 1BOAA 4EJUA 2YU3A 3PQKA 3BPVA 3L00A 1T39A 5IT3A 2C6YA 1YO5C 3E97A 2B0LA 1FT9A 1IF1A 2HGCA 2ISYA 5LGTA 1XGOA 3PFIA 5BS6A 2OQGA 3WG9A 1XGMA 2HKXA 3GUDA 1MD0A 1U6GA 2PN6A 4MHGA 1FLIA 5HVQC 1V3FA 3KP5A 4L9VA 5FD6A 2WV0A 2K02A 1J75A 2GAUA 1J7KA 1USTA 3C3WA 4RB3C 2O8XA 3T1BA 2L4AA 4MEYF 2EV5A 1TNSA 5FD5A 5LBQA 3LA2A 4LLGF 1OYIA 2NAZA 4P9UA 5A2QZ 3VEPA 1O3TA 2J5PA 1U5TA 5AIQA 1OPCA 3DPTA 5HLIA 3FWEA 5DD8A 3B73A 1IN7A 2OZUA 2CFXA 1AWCA 1FPQA 1XSVA 2ZNZA 2UXXA 3O3KA 2G9WA 3D0SA 1XN7A 1F9NA 3KP4A 4B09A 3K1NA 4L5IA 3KFWX 3H92A 1QPMA 4Y13A 3IWZA 1DP7P 2F5DA 1R23A 5DCFA 1P4XA 1XMAA 2LDUA 1Z91A 4I7HA 2E1NA 3JSPA 3C18A 5TRDA 1F4KA 2OZ6A 2ZNYA 4R1HA 1R7JA 4FX4A 4M72A 1RZ4A 1YYVA 2XRNA 3B02A 2XAGA 2ZJ2A 4IHTA 1J9IA 4S05A 2NS0A 3T5XA 3KEQA 2FXAA 1JXSA 4EJOA 5D4RA 1S6LA 2W57A 1G6NA 4AVPA 1HKTA 4ESFA 4IRHA 2XGXA 1RI7A 1MGTA 3F3XA 4WXHA 1XB4A 1OYWA 3F8FA 1K7AA 3BWGA 1R00A 2KJCA 1UCRA 4GXOA 1U78A 1OR7A 2EFOA 2DW4A 1HKSA 5HOOA 2XUBA 4I98B 2HEOA 2DPDA 4M73A 4RB1A 4UXNA 4UVAA 5D5XB 1FX7A 3G3ZA 2V79A 1HKQA 1XCVA 4RGSA 5K5QA 5LLQA 4ZYGA 2L3DA 4Q47A 3IHUA 3VODA 1QZZA 1XDSA 4XRFA 1GXPA 1XSXA 3GX4X 4ETSA 1U5TB 2MD5A 3GF2A 2IRFG 3ABUA 5K5OA 2V1DA 2YR2A 6PAXA 4IHSA 1YG2A 3SHFA 2X4HA 2OQRA 4MGRA 5FO5A 3OV8A 4CGZA 1U2WA 2GZWA 5FLXZ 2EFNA 3FX3A 4AIKA 1GXQA 1B1BA 2HTSA 4L9JA 2NNYA 5E8IA 5JR3A 4KDPA 3EYIA 4Q4ZF 3QU3A 3I0TA 3FXUA 4JBAA 3GFMA 1IN8A 2ESNA 2VBYA 5LHIA 4OU0A 3GO5A 4KYWA 3LAPA 1ONVA 4XSXF 2RN7A 2IT0A 4HDVA 3C1DA 3RIRA 1BC7C 1QZYA 2HYGD 5CLSA 2F5CA 2QQ9A 4RB0A 2A5YB 2AS5F 3W6JB 1I5ZA 5D8LB 2XAHA 1F5TA 4KIGA 2VC1A 1J59A 3BJAA 2HOEA 5L3DA 2H94A 5AONA 3KLNA 4P5OA 1EH7A 1FYMA 1K78A 1R5HA 2EWNA 5BQTA 3BY6A 3JAMK 3F23A 2EK5A 3HUGA 1FBQA 2JTVA 3DEUA 4U7DA 4G7HF 2UXNA 3WTYC 2A3SA 2K4BA 1XSDA 5LGUA 2IPQX 3D5LA 5ICGA 3L2CA 5HDKA 2Z3YA 3LQQA 3FF5A 3M8FA 1ZG3A 4LMYA 4L18B 3HOTA 5K5RA 3FMRA 3J81K 1FYLA 5JVTA 3QRFF 2P7CB 1V4RA 3DFGA 3R0JA 3DPLC 4HLXA 2YSRA 2DK8A 4HDUA 3R61A 3I5UA 2ZMEA 4G7OF 4A0XA 1ZLKA 2DLLA 3GWZA 3FXRA 4KUMA 4I2OA 5HS9A 3ERED 4KIFA 1K79A 2MH9A 1Z6RA 2PG4A 2KJBA 1EH8A 1B4AA 3WGHA 1MZBA 4CICA 4IF4A 1YFHA 3WU0A 4IRIA 2LF7A 3SFZA 1BC8C 1D3YA 2XAFA 2ACJA 5DEQA 1U5TC 1BI2A 3TOAA 2M1BA 3V8LA 3TGNA 1I6XA 1R22A 1R1TA 3R0AA 4YFXF 2STWA 3BOQA 4HZFA 5H20A 3E5XA 2GQQA 4AWXB 2VE8A 5L3EA 4R8HA 2GXBA 1O3QA 3R4KA 2V6CA 4HF0A 4MTDA 4A6DA 1FBSA 4XSZF 4ENNA 4U0YA 4A6EA 5D8KB 3J7AO 2F2EA 2BE5F 5E8GA 5IT9Z 3IC7A 3TQNA 4YIIA 3JSOA 2E7XA 3P9IA 1K78B 2BV6A 4H0EA 3IRRA 3QPTA 1O3SA 3ZQ7A 2XAQA 3LFKA 2O6GE 4EQQA 4RGXA 5HDGA 2HFHA 2PMUA 2QWWA 4A5MA 5LEKA 4O5VA 1A04A 1YTYA 3QOPA 2RKHA 1E2XA 2FBHA 1FYKA 4P9FA 3FZVA 4ZH4F 1PP7U 2ZXJA 4O3MA 3Q5FA 5JHUA 2RC4A 4G6QA 2A61A 4CHUA 1S8NA 2MLGA 5JI6A 3LSTA 5L3FA 4KT5C 3Q9SA 1OYYA 2PBIA 2F5FA 4TV7A 2VOPA 1EH6A 3K9TA 3ELKA 3N4MA 3T8TA 5KVRA 3K0LA 3RPUA 4A12A 4LG0B 1ZLJA 2K27A 2GIVA 1TQPA 3KETA 1USSA 1NHAA 2Y48A 2F5EA 1S29A 2EA2A 5DUKA 4GCVA 3CJNA 2D1VA 4LGWA 3O2PE 3HHHA 4LJZF 5LHHA 2GA2A 1YW8A 4L0YB 3BP8A 1FY7A 2FOKA 4LB6B 4WX9A 4UHTA 4G7ZF 1XGSA 2QQBA 1LNWA 4N9IA 2WC2A 4UVBA 2ELHA 5F64A 4FX0A 1BI3A 5JFRA 5E1WA 4HQMA 4EMSA 2FU4A 3LA3A 5K1YA 1LVAA 5CYVA 3JW4A 5D5VB 2QYOA 2OD5A 4AIJA 3GLXA 2ZCWA 3WTTC 5ILVA 1QBJA 3F6VA 2JPCA 2XKOA 3E6BA 2O03A 3TOBA 3E6DA 3U1DA 2GWRA 1Y0UA 3HRMA 2P5VA 2A69F 4EJVA 2V1XA 1FNNA 4NQWA 1ODDA 1WRJA 2VBZA 4XLPF 2MLKA 1G3TA 3DKWA 2W24A 4G6DA 3ISPA 4HX4A 1I1SA 1IW7F 1YQAA 1H9TA 2PMHA 1STZA 2P6TA 1P2FA 1G3YA 2Q8KA 3WTUC 1YW7A 1D8KA 1MKMA 1S7AA 3KEOA 1KQ8A 3BDDA 1KU7A 4EJTA 2MH2A 5LEJA 2BGCA 1YW9A 1R1UA 1Z9CA 1YLFA 1UFMA 1WWXA 2D2WA 2P7VB 3HRTA 4IJAA 2ADUA 2DAOA 1U3EM 2RDPA 5EEHA 2HWVA 5J8FA 2COMA 5CJ9A 3BROA 1L0OC 4A0YA 2L01A 2H27A 4CZZA 1R1VA 2OA4A 4A0ZA 3GFIA 2BYVE 4BNCA 1RIOH 3RKYA 5FFXA 4HLYA 3HHGA 1BI1A 2H09A 3GEZA 4M74A 1Z05A 3RKWA 3I64A 1E17A 1TQMA 1IN5A 1FP1D 1YS6A 4RGUA 3SXYA 1XMKA 3AAFA 2P4WA 1LEAA 2EFQA 5E20A 4ENKA 2BBYA 3HRSA 2LF8A 2G7HA 3KP2A 3QAHA 4YFNF 1P6RA 1IAWA 3QP5A 2XAJA 1FSEA 4NHJA 2RGVA 5D6EA 3E3VA 2ETHA 2R7DA 1O57A 3ZMUA 1JHFA 1W7PA 3V8JA 2NNNA 2VE9A 1TW3A 4KNYA 3GYHX 3P9KA 4JK1X 4Y17A 3N97A 2FBKA 3C7JA 1BIBA 1OKRA 2IP2A 2IJLA 2K7LA 3H3UA 3K1PA 5BOXA 4RS8A 3J80K 2FSWA 3KP7A 1W5SA 3VOEA 2HS5A 1HQCA 4I09A 3BJ6A 4BXUA 2Z5UA 1SD5A 3ZN1A 2PLYA 3ZP5A 4QLCU 4UUVA 4OINF 4F7ZA 2LNBA 1RUOA 3GFLA 2STTA 2V1UA 3WGIA 1LB2A 2DFIA 1TNTA 1RUNA 2Z99A 2CSOA 3FMQA 5E1XA 5FGMA 1BM9A 4EJWA 3HRUA 3KP3A 4WXCA 2ISZA 2FMLA 5DCMA 5L3BA 3K69A 3RTRA 3CO7C 1W5TA 3G73A 2L54A 1O3RA 1FBUA 1WSUA 1S3JA 1B9MA 3WE3A 3DV8A 1SMYF 1FP2A 4HA8A 3KE2A 3LWFA 2FF4A 2ZO4A 3FXQA 2WTEA 3I54A 3KZYA 1ULYA 3GVAA 3EYYA 3MZYA 4Q48A 2L02A 2EA4A 2Z9OA 2GA1A 1JE8A 2NRAC 4JQFA 4PGHA 4HBLA 2WWYA 4G94A 5E17F 3V8KA 2CW0F 4A5NA 1WI9A 4MQVA 5HDNA 1ZHFA 2JRTA 1GHCA 3K1MA 1R36A 1W7PD 4IXAA 4Z2YA 2M5WA 1W7PB 1B9NA 5ERIA 2LKPA 2YX7A 3CDHA 4BAYA 3TO7A 3ZPLA 2DK5A 3ZMZA 2H6CA 4E70A 1WKMA 1ZGAA 4LG0A 2EFPA 3QP6A 4LD5A 1QGPA 2V9VA 2P5KA 4KA4A 2O3FA 3RI4A 1TQIA 1REPC 5E18F 1XGNA 2MC3A 3NEUA 5KK1A 1T38A 3EQLF 1WQ2A 3L09A 4HOBA 3WODF 4HYEA 4WWCA 3HOSA 3COAC 2VT3A 4BHCA 1AOYA 1R58A 1P92A 4KICA 2PFBA 1OMIA 4ON0A 2DU9A 1J0RA 1F1ZA 3JAMZ 5CVJA 5FB2A 3Q9VA 4EGYA 3M8EA 5J6XA 1IXCA 3ZMTA 2FEZA 2IW5A 4ENMA 3HYIA 1DUXC 4HX8A 5CVUA 3F8NA 1HBXG 4QWQA 3E6CC 2QUFA 5D4SA 4HQEA 5DYMA 1LDKB 3LA7A 3SZPA 3T8RA 3WGGA 3JTGA 4PGGA 5DCMB 1KU9A 3QU6A 1SFXA 1ON1A 5D5WB 1DDNA 2EJRA 4CYDA 3M1EA 4B8XA 4BHPA 4O6JA 4WK8F 4ESBA 3F8BA 1J2XA 1SD6A 2G7UA 5DV5A 1IXSB 1G3WA 4R79A 4AIHA 3ROUA 4L9NA 3MWMA 4YFKF 2HZTA 5D6FA 1XCBA 2RV8A 4M9XA 2OBPA 3L9FA 4CO8A 2FNPA 1RNLA 2H6BA 2IA0A 2DPUA 1YS7A 1ZREA 2O61A 1EV7A 1P4WA 3ZN0A 2E1CA 1LDDA 2R7FA 3KP6A 2VT2A 3CUQA 2M8EA 2RVCA 3M7GA 1QO0D 2DT5A 2DQRA 2CGPA 3MQ0A 3JTHA 4YIFA 1L3LA 3KCCA 5A2QK 2Y75A 1SAXA 4FT8A 1IUYA 4XBFA 1TLHB 2QENA 2J5OA 2Q2EA 4PCQA 4BHBA 3IKVA 4EM1A 3RYPA 2M87A 3R6SA 1MDMA 3QPHA 1SD7A 4DQ2A 5E1ZB 1KU2A 1O7FA 4EM2A 4AD9A 2A6HF 4BYYA 3WTZA 1ON2A 2R3SA 1HSJA 5DDGA 1HW2A 1UB9A 1HW5A 4CDGA 2GXGA 2QLZA 5J8CA 2VBWA 5H6QA 1CF7A 1MJ9A 1QQIA 3WTSC 2W84A 3E5QA 3IKTA 3I59A 4FHTA 4I0AA 5ICFA 4LLNA 2JT1A 4P55A 2VOOA 1BJAA 3L7WA 5LRSA 2A07F 3IRQA 3LQRA 1MJAA 1FOKA 5H6RA 2UZKA 3KZZA 3P7NA 1G3SA 5DUIA 3EDPA 1TTYA 2ZFWA 3DP7A 2CO5A 4WXDA 5L3GA 1H9GA 4U88A 4I0BA 4OOIA 4ZYHA 1IN4A 4WF2A 2MBFA 2XROA 1DPRA 4P96A 1S7OA 3I53A 2HYFA 3CTAA 3TO9A 4HAMA 5ICCA 5LGNA 3WTXC 1IRGA 5L3CA 4K2EA 3WTVC 2QQAA 4EGZA 5ILSA 1LJ9A 4L9TA 4ZZLA 1PUEE 3GZ5A 4LFUA 1IXRC 4NB5A 2W25A 2OAZA 2TDXA 4KN7X 3CUQB 4BQAA 4HX7A 4OIPF 2HKOA 1FZPB 1ZRDA 3I71A 3IL2A 2VONA 1UHMA 4Q5SF 2FRHA 4IRGA 3KLOA 4LK1F 3SQNA 5ICEA 1LEBA 4M6YA 5ILUA 3TKYA 5HLHA 2FE3A 4IPAA 5BPDA 2QVOA 3WE2A 2IVMA 4BH9A 1JGSA 3V7SA 1QNTA 2DI3A 1MDMB 3TDZC 1ZRCA 2VBXA 5LRRA 1P4AA 2NYXA 4DNCA 1BBYA 3RPQA 3VFZA 5FLXK 3GFJA 1ZARA 2ZBKA 4KFCA 4ESJA 3H3ZA 3I4PA 3PQJA 1TW2A 1T6SA 2KRFA 2KKOA 4LK0F 1YIOA 1CF7B 3ZMVA 3F21A 4UVCA 3MFKA 5DD4A 1T0FA 3I59B 3IWFA 3HSEA 3EETA 2PI0A 4UV8A 4HW0A 3RJPA 2CG4A 2EV0A 2UWMA 1J5YA 3ECOA 2M45A 3WU1B 5FFZA 3S2WA 3U9GA 4KIBA 4MQ9F 4EVIA 2EV6A 4G9YA 2FMYA 3FM3A 2JZYA 4MTEA 1SFUA 1G4DA 4KN4X 4OMZA 2BEOA 3F8CA 2XV4S 4M9SA 2EB7A 4WCGA 1T2KA 1UHWA 4EV0A 1FWZA 3ULQB 2DBBA 4ASNA 2FNAA 1Z6TA 2XASA 3NRVA 2HDCA 4XLNF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GVJ A;  4KMU X;  4PZJ A;  5HS8 A;  1DPU A;  2OU2 A;  2Z33 A;  1Q1H A;  2JPB A;  3LAJ A;  4M71 A;  1KU3 A;  2Q0O A;  2FBI A;  4ZZD A;  1TBX A;  3V7R A;  2A68 F;  2K86 A;  4LLL A;  1ZH5 A;  3FM5 A;  2MA3 A;  3W6K B;  1LQ1 A;  3TDU C;  3BJO A;  1C0W A;  4OIO F;  3ZMD A;  2KIF A;  1BI0 A;  2YX4 A;  1MJB A;  4HV6 A;  4PDK A;  1T98 A;  1ZGJ A;  3CUQ C;  1CGP A;  1U8R A;  1ZRF A;  3HSR A;  4ZYE A;  2XIG A;  2P6S A;  3DXJ F;  5ED4 A;  2DQL A;  4ENJ A;  2XVC A;  2RQP A;  2HQN A;  1IRF A;  2YPR A;  2VXZ A;  3MZH A;  1KGS A;  1R5G A;  2HQR A;  2PEX A;  1IZ1 A;  2PJP A;  2ZKZ A;  4RAY A;  2XHK A;  5BPI A;  1W4M A;  3ECH A;  1SFE A;  3J80 Z;  4D0P A;  2D1H A;  3FHZ A;  1ZYR F;  5TJJ A;  1KYW A;  2A6E F;  5F1R A;  4M9Z A;  1D5V A;  4U0W A;  4RB2 C;  1LDJ A;  3R60 A;  2KIM A;  2M30 A;  1BIA A;  2W85 A;  4OIR F;  4OMY A;  4RGR A;  3MAJ A;  2VN2 A;  5IT9 K;  1SMT A;  5HLG A;  2VOD A;  1HW1 A;  2E7W A;  4S04 A;  2HR3 A;  3E5U A;  2KIU A;  4HV5 A;  4LB5 A;  2QBY A;  5D5U B;  3CLO A;  2PQ8 A;  2QZ8 A;  2ESH A;  2FQ3 A;  2AXL A;  4N9H A;  3F6O A;  2LSO A;  2CYY A;  4YG2 F;  3T0Y A;  3M9A A;  4I02 A;  2CWE A;  1ZAO A;  1ZG1 A;  1PP8 F;  3K2Z A;  3GW2 A;  3F22 A;  3CUO A;  4MEX F;  2XKP A;  2L4M A;  4GYG A;  1IN6 A;  1KYZ A;  4RAZ A;  4IVN A;  2DTR A;  2QM3 A;  3NQO A;  4MNU A;  3BZ6 A;  3U2R A;  5AIP A;  2P8T A;  3TO6 A;  2JSC A;  1K6O A;  4HF2 A;  3J81 Z;  4GYI A;  1JHH A;  2FA5 A;  5BMZ A;  3MCZ A;  3HIF A;  3F72 A;  2RNJ A;  3ML6 A;  2P5L C;  1BN5 A;  1KQ9 A;  4I01 A;  5F6F A;  4Y15 A;  5CVV A;  3GZ6 A;  1VTN C;  3REO A;  1B6A A;  1H0M A;  1ZG5 A;  2D45 A;  4UV9 A;  3F8M A;  1O7L A;  4A2U A;  3RKX A;  3HTS B;  2EFW A;  1SD4 A;  1Z1D A;  4EM0 B;  4CXF A;  2DO7 A;  1KA8 A;  3P9C A;  1FC3 A;  3DQV C;  3GXO A;  1B59 A;  2CQK A;  4U0V A;  2IA2 A;  2K4J A;  3FMS A;  4L5J A;  1ZN2 A;  5CVI A;  3EUH A;  4U7B A;  3OOP A;  2IA1 A;  5HS7 A;  3ABT A;  1XDU A;  4UNO A;  1D8J A;  3WTW C;  3ZMS A;  1X3U A;  1I27 A;  3DF8 A;  5CVR A;  2O0Y A;  3BPX A;  4GO1 A;  3RDI A;  4OIQ F;  4ZYD A;  3V7C A;  2VC0 A;  4M6X A;  4KMF A;  4L0Z B;  2ZME B;  2QBY B;  1KQ0 A;  1Z7U A;  3RYR A;  3I58 A;  1HXD A;  1PDN C;  4G8X A;  3E6M A;  1XD7 A;  4N0B A;  5LHG A;  4HF1 A;  2HTJ A;  2X0L A;  5EEG A;  3V4G A;  3VB2 A;  3SZT A;  1FSH A;  3HSF A;  4GGG A;  1I1G A;  3O6B B;  2Y0M A;  3CO6 C;  1HST A;  3HTU A;  3MEX A;  1BOA A;  4EJU A;  2YU3 A;  3PQK A;  3BPV A;  3L00 A;  1T39 A;  5IT3 A;  2C6Y A;  1YO5 C;  3E97 A;  2B0L A;  1FT9 A;  1IF1 A;  2HGC A;  2ISY A;  5LGT A;  1XGO A;  3PFI A;  5BS6 A;  2OQG A;  3WG9 A;  1XGM A;  2HKX A;  3GUD A;  1MD0 A;  1U6G A;  2PN6 A;  4MHG A;  1FLI A;  5HVQ C;  1V3F A;  3KP5 A;  4L9V A;  5FD6 A;  2WV0 A;  2K02 A;  1J75 A;  2GAU A;  1J7K A;  1UST A;  3C3W A;  4RB3 C;  2O8X A;  3T1B A;  2L4A A;  4MEY F;  2EV5 A;  1TNS A;  5FD5 A;  5LBQ A;  3LA2 A;  4LLG F;  1OYI A;  2NAZ A;  4P9U A;  5A2Q Z;  3VEP A;  1O3T A;  2J5P A;  1U5T A;  5AIQ A;  1OPC A;  3DPT A;  5HLI A;  3FWE A;  5DD8 A;  3B73 A;  1IN7 A;  2OZU A;  2CFX A;  1AWC A;  1FPQ A;  1XSV A;  2ZNZ A;  2UXX A;  3O3K A;  2G9W A;  3D0S A;  1XN7 A;  1F9N A;  3KP4 A;  4B09 A;  3K1N A;  4L5I A;  3KFW X;  3H92 A;  1QPM A;  4Y13 A;  3IWZ A;  1DP7 P;  2F5D A;  1R23 A;  5DCF A;  1P4X A;  1XMA A;  2LDU A;  1Z91 A;  4I7H A;  2E1N A;  3JSP A;  3C18 A;  5TRD A;  1F4K A;  2OZ6 A;  2ZNY A;  4R1H A;  1R7J A;  4FX4 A;  4M72 A;  1RZ4 A;  1YYV A;  2XRN A;  3B02 A;  2XAG A;  2ZJ2 A;  4IHT A;  1J9I A;  4S05 A;  2NS0 A;  3T5X A;  3KEQ A;  2FXA A;  1JXS A;  4EJO A;  5D4R A;  1S6L A;  2W57 A;  1G6N A;  4AVP A;  1HKT A;  4ESF A;  4IRH A;  2XGX A;  1RI7 A;  1MGT A;  3F3X A;  4WXH A;  1XB4 A;  1OYW A;  3F8F A;  1K7A A;  3BWG A;  1R00 A;  2KJC A;  1UCR A;  4GXO A;  1U78 A;  1OR7 A;  2EFO A;  2DW4 A;  1HKS A;  5HOO A;  2XUB A;  4I98 B;  2HEO A;  2DPD A;  4M73 A;  4RB1 A;  4UXN A;  4UVA A;  5D5X B;  1FX7 A;  3G3Z A;  2V79 A;  1HKQ A;  1XCV A;  4RGS A;  5K5Q A;  5LLQ A;  4ZYG A;  2L3D A;  4Q47 A;  3IHU A;  3VOD A;  1QZZ A;  1XDS A;  4XRF A;  1GXP A;  1XSX A;  3GX4 X;  4ETS A;  1U5T B;  2MD5 A;  3GF2 A;  2IRF G;  3ABU A;  5K5O A;  2V1D A;  2YR2 A;  6PAX A;  4IHS A;  1YG2 A;  3SHF A;  2X4H A;  2OQR A;  4MGR A;  5FO5 A;  3OV8 A;  4CGZ A;  1U2W A;  2GZW A;  5FLX Z;  2EFN A;  3FX3 A;  4AIK A;  1GXQ A;  1B1B A;  2HTS A;  4L9J A;  2NNY A;  5E8I A;  5JR3 A;  4KDP A;  3EYI A;  4Q4Z F;  3QU3 A;  3I0T A;  3FXU A;  4JBA A;  3GFM A;  1IN8 A;  2ESN A;  2VBY A;  5LHI A;  4OU0 A;  3GO5 A;  4KYW A;  3LAP A;  1ONV A;  4XSX F;  2RN7 A;  2IT0 A;  4HDV A;  3C1D A;  3RIR A;  1BC7 C;  1QZY A;  2HYG D;  5CLS A;  2F5C A;  2QQ9 A;  4RB0 A;  2A5Y B;  2AS5 F;  3W6J B;  1I5Z A;  5D8L B;  2XAH A;  1F5T A;  4KIG A;  2VC1 A;  1J59 A;  3BJA A;  2HOE A;  5L3D A;  2H94 A;  5AON A;  3KLN A;  4P5O A;  1EH7 A;  1FYM A;  1K78 A;  1R5H A;  2EWN A;  5BQT A;  3BY6 A;  3JAM K;  3F23 A;  2EK5 A;  3HUG A;  1FBQ A;  2JTV A;  3DEU A;  4U7D A;  4G7H F;  2UXN A;  3WTY C;  2A3S A;  2K4B A;  1XSD A;  5LGU A;  2IPQ X;  3D5L A;  5ICG A;  3L2C A;  5HDK A;  2Z3Y A;  3LQQ A;  3FF5 A;  3M8F A;  1ZG3 A;  4LMY A;  4L18 B;  3HOT A;  5K5R A;  3FMR A;  3J81 K;  1FYL A;  5JVT A;  3QRF F;  2P7C B;  1V4R A;  3DFG A;  3R0J A;  3DPL C;  4HLX A;  2YSR A;  2DK8 A;  4HDU A;  3R61 A;  3I5U A;  2ZME A;  4G7O F;  4A0X A;  1ZLK A;  2DLL A;  3GWZ A;  3FXR A;  4KUM A;  4I2O A;  5HS9 A;  3ERE D;  4KIF A;  1K79 A;  2MH9 A;  1Z6R A;  2PG4 A;  2KJB A;  1EH8 A;  1B4A A;  3WGH A;  1MZB A;  4CIC A;  4IF4 A;  1YFH A;  3WU0 A;  4IRI A;  2LF7 A;  3SFZ A;  1BC8 C;  1D3Y A;  2XAF A;  2ACJ A;  5DEQ A;  1U5T C;  1BI2 A;  3TOA A;  2M1B A;  3V8L A;  3TGN A;  1I6X A;  1R22 A;  1R1T A;  3R0A A;  4YFX F;  2STW A;  3BOQ A;  4HZF A;  5H20 A;  3E5X A;  2GQQ A;  4AWX B;  2VE8 A;  5L3E A;  4R8H A;  2GXB A;  1O3Q A;  3R4K A;  2V6C A;  4HF0 A;  4MTD A;  4A6D A;  1FBS A;  4XSZ F;  4ENN A;  4U0Y A;  4A6E A;  5D8K B;  3J7A O;  2F2E A;  2BE5 F;  5E8G A;  5IT9 Z;  3IC7 A;  3TQN A;  4YII A;  3JSO A;  2E7X A;  3P9I A;  1K78 B;  2BV6 A;  4H0E A;  3IRR A;  3QPT A;  1O3S A;  3ZQ7 A;  2XAQ A;  3LFK A;  2O6G E;  4EQQ A;  4RGX A;  5HDG A;  2HFH A;  2PMU A;  2QWW A;  4A5M A;  5LEK A;  4O5V A;  1A04 A;  1YTY A;  3QOP A;  2RKH A;  1E2X A;  2FBH A;  1FYK A;  4P9F A;  3FZV A;  4ZH4 F;  1PP7 U;  2ZXJ A;  4O3M A;  3Q5F A;  5JHU A;  2RC4 A;  4G6Q A;  2A61 A;  4CHU A;  1S8N A;  2MLG A;  5JI6 A;  3LST A;  5L3F A;  4KT5 C;  3Q9S A;  1OYY A;  2PBI A;  2F5F A;  4TV7 A;  2VOP A;  1EH6 A;  3K9T A;  3ELK A;  3N4M A;  3T8T A;  5KVR A;  3K0L A;  3RPU A;  4A12 A;  4LG0 B;  1ZLJ A;  2K27 A;  2GIV A;  1TQP A;  3KET A;  1USS A;  1NHA A;  2Y48 A;  2F5E A;  1S29 A;  2EA2 A;  5DUK A;  4GCV A;  3CJN A;  2D1V A;  4LGW A;  3O2P E;  3HHH A;  4LJZ F;  5LHH A;  2GA2 A;  1YW8 A;  4L0Y B;  3BP8 A;  1FY7 A;  2FOK A;  4LB6 B;  4WX9 A;  4UHT A;  4G7Z F;  1XGS A;  2QQB A;  1LNW A;  4N9I A;  2WC2 A;  4UVB A;  2ELH A;  5F64 A;  4FX0 A;  1BI3 A;  5JFR A;  5E1W A;  4HQM A;  4EMS A;  2FU4 A;  3LA3 A;  5K1Y A;  1LVA A;  5CYV A;  3JW4 A;  5D5V B;  2QYO A;  2OD5 A;  4AIJ A;  3GLX A;  2ZCW A;  3WTT C;  5ILV A;  1QBJ A;  3F6V A;  2JPC A;  2XKO A;  3E6B A;  2O03 A;  3TOB A;  3E6D A;  3U1D A;  2GWR A;  1Y0U A;  3HRM A;  2P5V A;  2A69 F;  4EJV A;  2V1X A;  1FNN A;  4NQW A;  1ODD A;  1WRJ A;  2VBZ A;  4XLP F;  2MLK A;  1G3T A;  3DKW A;  2W24 A;  4G6D A;  3ISP A;  4HX4 A;  1I1S A;  1IW7 F;  1YQA A;  1H9T A;  2PMH A;  1STZ A;  2P6T A;  1P2F A;  1G3Y A;  2Q8K A;  3WTU C;  1YW7 A;  1D8K A;  1MKM A;  1S7A A;  3KEO A;  1KQ8 A;  3BDD A;  1KU7 A;  4EJT A;  2MH2 A;  5LEJ A;  2BGC A;  1YW9 A;  1R1U A;  1Z9C A;  1YLF A;  1UFM A;  1WWX A;  2D2W A;  2P7V B;  3HRT A;  4IJA A;  2ADU A;  2DAO A;  1U3E M;  2RDP A;  5EEH A;  2HWV A;  5J8F A;  2COM A;  5CJ9 A;  3BRO A;  1L0O C;  4A0Y A;  2L01 A;  2H27 A;  4CZZ A;  1R1V A;  2OA4 A;  4A0Z A;  3GFI A;  2BYV E;  4BNC A;  1RIO H;  3RKY A;  5FFX A;  4HLY A;  3HHG A;  1BI1 A;  2H09 A;  3GEZ A;  4M74 A;  1Z05 A;  3RKW A;  3I64 A;  1E17 A;  1TQM A;  1IN5 A;  1FP1 D;  1YS6 A;  4RGU A;  3SXY A;  1XMK A;  3AAF A;  2P4W A;  1LEA A;  2EFQ A;  5E20 A;  4ENK A;  2BBY A;  3HRS A;  2LF8 A;  2G7H A;  3KP2 A;  3QAH A;  4YFN F;  1P6R A;  1IAW A;  3QP5 A;  2XAJ A;  1FSE A;  4NHJ A;  2RGV A;  5D6E A;  3E3V A;  2ETH A;  2R7D A;  1O57 A;  3ZMU A;  1JHF A;  1W7P A;  3V8J A;  2NNN A;  2VE9 A;  1TW3 A;  4KNY A;  3GYH X;  3P9K A;  4JK1 X;  4Y17 A;  3N97 A;  2FBK A;  3C7J A;  1BIB A;  1OKR A;  2IP2 A;  2IJL A;  2K7L A;  3H3U A;  3K1P A;  5BOX A;  4RS8 A;  3J80 K;  2FSW A;  3KP7 A;  1W5S A;  3VOE A;  2HS5 A;  1HQC A;  4I09 A;  3BJ6 A;  4BXU A;  2Z5U A;  1SD5 A;  3ZN1 A;  2PLY A;  3ZP5 A;  4QLC U;  4UUV A;  4OIN F;  4F7Z A;  2LNB A;  1RUO A;  3GFL A;  2STT A;  2V1U A;  3WGI A;  1LB2 A;  2DFI A;  1TNT A;  1RUN A;  2Z99 A;  2CSO A;  3FMQ A;  5E1X A;  5FGM A;  1BM9 A;  4EJW A;  3HRU A;  3KP3 A;  4WXC A;  2ISZ A;  2FML A;  5DCM A;  5L3B A;  3K69 A;  3RTR A;  3CO7 C;  1W5T A;  3G73 A;  2L54 A;  1O3R A;  1FBU A;  1WSU A;  1S3J A;  1B9M A;  3WE3 A;  3DV8 A;  1SMY F;  1FP2 A;  4HA8 A;  3KE2 A;  3LWF A;  2FF4 A;  2ZO4 A;  3FXQ A;  2WTE A;  3I54 A;  3KZY A;  1ULY A;  3GVA A;  3EYY A;  3MZY A;  4Q48 A;  2L02 A;  2EA4 A;  2Z9O A;  2GA1 A;  1JE8 A;  2NRA C;  4JQF A;  4PGH A;  4HBL A;  2WWY A;  4G94 A;  5E17 F;  3V8K A;  2CW0 F;  4A5N A;  1WI9 A;  4MQV A;  5HDN A;  1ZHF A;  2JRT A;  1GHC A;  3K1M A;  1R36 A;  1W7P D;  4IXA A;  4Z2Y A;  2M5W A;  1W7P B;  1B9N A;  5ERI A;  2LKP A;  2YX7 A;  3CDH A;  4BAY A;  3TO7 A;  3ZPL A;  2DK5 A;  3ZMZ A;  2H6C A;  4E70 A;  1WKM A;  1ZGA A;  4LG0 A;  2EFP A;  3QP6 A;  4LD5 A;  1QGP A;  2V9V A;  2P5K A;  4KA4 A;  2O3F A;  3RI4 A;  1TQI A;  1REP C;  5E18 F;  1XGN A;  2MC3 A;  3NEU A;  5KK1 A;  1T38 A;  3EQL F;  1WQ2 A;  3L09 A;  4HOB A;  3WOD F;  4HYE A;  4WWC A;  3HOS A;  3COA C;  2VT3 A;  4BHC A;  1AOY A;  1R58 A;  1P92 A;  4KIC A;  2PFB A;  1OMI A;  4ON0 A;  2DU9 A;  1J0R A;  1F1Z A;  3JAM Z;  5CVJ A;  5FB2 A;  3Q9V A;  4EGY A;  3M8E A;  5J6X A;  1IXC A;  3ZMT A;  2FEZ A;  2IW5 A;  4ENM A;  3HYI A;  1DUX C;  4HX8 A;  5CVU A;  3F8N A;  1HBX G;  4QWQ A;  3E6C C;  2QUF A;  5D4S A;  4HQE A;  5DYM A;  1LDK B;  3LA7 A;  3SZP A;  3T8R A;  3WGG A;  3JTG A;  4PGG A;  5DCM B;  1KU9 A;  3QU6 A;  1SFX A;  1ON1 A;  5D5W B;  1DDN A;  2EJR A;  4CYD A;  3M1E A;  4B8X A;  4BHP A;  4O6J A;  4WK8 F;  4ESB A;  3F8B A;  1J2X A;  1SD6 A;  2G7U A;  5DV5 A;  1IXS B;  1G3W A;  4R79 A;  4AIH A;  3ROU A;  4L9N A;  3MWM A;  4YFK F;  2HZT A;  5D6F A;  1XCB A;  2RV8 A;  4M9X A;  2OBP A;  3L9F A;  4CO8 A;  2FNP A;  1RNL A;  2H6B A;  2IA0 A;  2DPU A;  1YS7 A;  1ZRE A;  2O61 A;  1EV7 A;  1P4W A;  3ZN0 A;  2E1C A;  1LDD A;  2R7F A;  3KP6 A;  2VT2 A;  3CUQ A;  2M8E A;  2RVC A;  3M7G A;  1QO0 D;  2DT5 A;  2DQR A;  2CGP A;  3MQ0 A;  3JTH A;  4YIF A;  1L3L A;  3KCC A;  5A2Q K;  2Y75 A;  1SAX A;  4FT8 A;  1IUY A;  4XBF A;  1TLH B;  2QEN A;  2J5O A;  2Q2E A;  4PCQ A;  4BHB A;  3IKV A;  4EM1 A;  3RYP A;  2M87 A;  3R6S A;  1MDM A;  3QPH A;  1SD7 A;  4DQ2 A;  5E1Z B;  1KU2 A;  1O7F A;  4EM2 A;  4AD9 A;  2A6H F;  4BYY A;  3WTZ A;  1ON2 A;  2R3S A;  1HSJ A;  5DDG A;  1HW2 A;  1UB9 A;  1HW5 A;  4CDG A;  2GXG A;  2QLZ A;  5J8C A;  2VBW A;  5H6Q A;  1CF7 A;  1MJ9 A;  1QQI A;  3WTS C;  2W84 A;  3E5Q A;  3IKT A;  3I59 A;  4FHT A;  4I0A A;  5ICF A;  4LLN A;  2JT1 A;  4P55 A;  2VOO A;  1BJA A;  3L7W A;  5LRS A;  2A07 F;  3IRQ A;  3LQR A;  1MJA A;  1FOK A;  5H6R A;  2UZK A;  3KZZ A;  3P7N A;  1G3S A;  5DUI A;  3EDP A;  1TTY A;  2ZFW A;  3DP7 A;  2CO5 A;  4WXD A;  5L3G A;  1H9G A;  4U88 A;  4I0B A;  4OOI A;  4ZYH A;  1IN4 A;  4WF2 A;  2MBF A;  2XRO A;  1DPR A;  4P96 A;  1S7O A;  3I53 A;  2HYF A;  3CTA A;  3TO9 A;  4HAM A;  5ICC A;  5LGN A;  3WTX C;  1IRG A;  5L3C A;  4K2E A;  3WTV C;  2QQA A;  4EGZ A;  5ILS A;  1LJ9 A;  4L9T A;  4ZZL A;  1PUE E;  3GZ5 A;  4LFU A;  1IXR C;  4NB5 A;  2W25 A;  2OAZ A;  2TDX A;  4KN7 X;  3CUQ B;  4BQA A;  4HX7 A;  4OIP F;  2HKO A;  1FZP B;  1ZRD A;  3I71 A;  3IL2 A;  2VON A;  1UHM A;  4Q5S F;  2FRH A;  4IRG A;  3KLO A;  4LK1 F;  3SQN A;  5ICE A;  1LEB A;  4M6Y A;  5ILU A;  3TKY A;  5HLH A;  2FE3 A;  4IPA A;  5BPD A;  2QVO A;  3WE2 A;  2IVM A;  4BH9 A;  1JGS A;  3V7S A;  1QNT A;  2DI3 A;  1MDM B;  3TDZ C;  1ZRC A;  2VBX A;  5LRR A;  1P4A A;  2NYX A;  4DNC A;  1BBY A;  3RPQ A;  3VFZ A;  5FLX K;  3GFJ A;  1ZAR A;  2ZBK A;  4KFC A;  4ESJ A;  3H3Z A;  3I4P A;  3PQJ A;  1TW2 A;  1T6S A;  2KRF A;  2KKO A;  4LK0 F;  1YIO A;  1CF7 B;  3ZMV A;  3F21 A;  4UVC A;  3MFK A;  5DD4 A;  1T0F A;  3I59 B;  3IWF A;  3HSE A;  3EET A;  2PI0 A;  4UV8 A;  4HW0 A;  3RJP A;  2CG4 A;  2EV0 A;  2UWM A;  1J5Y A;  3ECO A;  2M45 A;  3WU1 B;  5FFZ A;  3S2W A;  3U9G A;  4KIB A;  4MQ9 F;  4EVI A;  2EV6 A;  4G9Y A;  2FMY A;  3FM3 A;  2JZY A;  4MTE A;  1SFU A;  1G4D A;  4KN4 X;  4OMZ A;  2BEO A;  3F8C A;  2XV4 S;  4M9S A;  2EB7 A;  4WCG A;  1T2K A;  1UHW A;  4EV0 A;  1FWZ A;  3ULQ B;  2DBB A;  4ASN A;  2FNA A;  1Z6T A;  2XAS A;  3NRV A;  2HDC A;  4XLN F; 
#chains in the Genus database with same CATH topology
 2ZFU A;  1GVJ A;  4XRM A;  2A6T A;  4KMU X;  4W1U A;  4PZJ A;  2VPL A;  2XPV A;  1AKH A;  5HS8 A;  1DPU A;  2OU2 A;  2Z33 A;  1RKT A;  1Q1H A;  3GME A;  1UEL B;  1X4P A;  2EQR A;  1LPQ A;  2JPB A;  3LAJ A;  2FUG 2;  4P1W A;  1MBF A;  3LSM A;  4Y4R A;  3CCQ I;  4XOT A;  4M71 A;  2R5Z B;  4PUS A;  1KU3 A;  2Q0O A;  1WHU A;  2FBI A;  4BJ5 C;  4ZZD A;  1TBX A;  2GLO A;  1EA3 A;  2AO9 A;  3V7R A;  1BJZ A;  5KAI C;  4ZTJ A;  2A68 F;  2K86 A;  4NNJ A;  1H89 C;  5M5W J;  4LLL A;  1ZH5 A;  1GUU A;  1ZK8 A;  3FM5 A;  2MA3 A;  2OPT A;  4I99 C;  2HNH A;  4DZJ A;  1GT0 C;  3W6K B;  1LQ1 A;  3TDU C;  2VKE A;  3BJO A;  3WHB A;  3DU6 A;  2NOG A;  1C0W A;  4A3J J;  4OIO F;  3ZQQ A;  3ZMD A;  3S17 J;  2Y31 A;  1VQ5 I;  2KIF A;  1BI0 A;  1I39 A;  3LSI A;  2IS4 A;  2YX4 A;  4E7I A;  1UZC A;  1MJB A;  4YIR X;  3FKI J;  4HV6 A;  4PDK A;  1E3P A;  1T98 A;  2K9S A;  1LFU P;  1ZGJ A;  3CUQ C;  3U1K A;  1CGP A;  1U8R A;  1ZRF A;  3HSR A;  3EUH C;  4ZYE A;  3DBL B;  2NXN B;  2XIG A;  5CQG A;  2P6S A;  3DXJ F;  1TC3 C;  4KIS A;  5ED4 A;  2DQL A;  3K6G A;  4ENJ A;  3G71 I;  5EZG A;  2X1C A;  2JVH A;  2RQP A;  2XVC A;  2HQN A;  3OWT A;  1IRF A;  3D1N I;  2YPR A;  2ZXH A;  4DJA A;  2VXZ A;  3KIO A;  4NC8 A;  3MZH A;  1KGS A;  1QA6 A;  1R5G A;  2HQR A;  3H9J A;  3PUF A;  3A2K A;  2PEX A;  1IZ1 A;  3CJQ B;  5HOD A;  2PJP A;  5J1U A;  3MKY B;  2JA7 J;  2ZKZ A;  2M3A A;  4JX5 A;  3CCJ I;  2LKX A;  4RAY A;  2XHK A;  5IYB J;  5BPI A;  3LL7 A;  1W4M A;  3K4K A;  4ZC3 A;  3ECH A;  1SFE A;  4RA2 A;  2DA6 A;  3J80 Z;  4D0P A;  2WB1 A;  5DM6 F;  2D1H A;  3FHZ A;  1ZYR F;  4RAF A;  5TJJ A;  1KYW A;  3K2A A;  2A6E F;  4PSX A;  1BOB A;  5F1R A;  4IQJ A;  2XGE A;  3OOU A;  4M9Z A;  1D5V A;  1V5E A;  5B5E C;  2HPM A;  4U0W A;  4RB2 C;  1LDJ A;  3R60 A;  4BY7 J;  2KIM A;  4DBQ A;  2IGN A;  2M30 A;  5J1Y A;  4BQO A;  1ERD A;  3ZXS A;  2KFD A;  1BIA A;  3K4J A;  1TWC J;  2W85 A;  3PNT A;  4HNU A;  1H88 C;  1VQ7 I;  4OIR F;  4C30 A;  4OMY A;  1GV5 A;  4RGR A;  4HG2 A;  3PSF A;  3MAJ A;  2VN2 A;  5IT9 K;  2XGC A;  1SMT A;  5HLG A;  3CCL I;  2VOD A;  1HW1 A;  5IOZ A;  3HL2 A;  1PJR A;  4IO9 F;  3S1N J;  2Y69 H;  5HNF A;  2E7W A;  3KYL A;  4S04 A;  3K70 C;  3CCM I;  2HR3 A;  2RRE A;  3E5U A;  3GTM J;  2KIU A;  4X6A J;  4HV5 A;  4DYR A;  1XS9 A;  4XL9 A;  2EIJ H;  4LB5 A;  2QBY A;  1MND A;  5D5U B;  2DYS H;  3CLO A;  3M07 A;  5EZH A;  2PQ8 A;  3OIQ A;  1QVT A;  1MMA A;  3OYF A;  2QZ8 A;  2PMZ N;  2ESH A;  2FQ3 A;  2AXL A;  4HST A;  2M0C A;  4N9H A;  3F6O A;  2LSO A;  1HF0 A;  2CYY A;  4YG2 F;  2DA5 A;  3G1O A;  4OWR B;  1KZH A;  3T0Y A;  3M9A A;  4I02 A;  2CWE A;  2DJN A;  1AKH B;  1MBK A;  1I50 J;  1ZAO A;  3VYS B;  1EKE A;  1MMD A;  1V5G A;  4GFB A;  1ETK A;  1QVU A;  1RRJ A;  1ZG1 A;  1PP8 F;  3K2Z A;  2R7V A;  3GW2 A;  3F22 A;  5TGT A;  3CUO A;  4MEX F;  2XKP A;  2L4M A;  1XG1 A;  2ZJR F;  4GYG A;  5FKL A;  1IN6 A;  1D0Y A;  1KYZ A;  4RAZ A;  4IVN A;  2HOA A;  2DTR A;  2QM3 A;  3NQO A;  2BXZ A;  4MNU A;  2G0E A;  5J4V A;  4V2F A;  3HC7 A;  3BZ6 A;  4RDU A;  3U2R A;  5AIP A;  3G6E I;  2P8T A;  1Y56 A;  2MFZ A;  3TO6 A;  1OFC X;  2JSC A;  1VQP I;  1K6O A;  3L2V A;  2QEX I;  2ECC A;  4HF2 A;  5JLX A;  1X1D A;  2LY1 A;  4MLO A;  1WJ5 A;  1OCC H;  3J81 Z;  3G2B A;  4GYI A;  1JHH A;  2FA5 A;  1OCZ H;  1A6I A;  3FBN B;  1MW7 A;  5BMZ A;  3MCZ A;  3HIF A;  2QSG X;  3CP2 A;  1IO2 A;  3F72 A;  1Z67 A;  2RNJ A;  4E4H A;  2K9N A;  3ML6 A;  2P5L C;  4DGW B;  1BN5 A;  1KQ9 A;  4I01 A;  2E2H J;  4D1Q A;  1IV8 A;  2JA2 A;  4Y15 A;  5F6F A;  5CVV A;  2E60 A;  4IOC F;  3GZ6 A;  4CYC A;  2ECB A;  1VTN C;  3REO A;  1B6A A;  1H0M A;  1ZG5 A;  3VSK A;  3OYI A;  2D45 A;  4NBQ A;  4UV9 A;  3F8M A;  3O8H A;  1O7L A;  4A2U A;  3RKX A;  3HTS B;  2EFW A;  1SD4 A;  3OIO A;  2QQ8 A;  1Y1W J;  1Z1D A;  2VQG A;  4EM0 B;  4CXF A;  2JUG A;  2R7Z J;  3H0G J;  3S8P A;  2DO7 A;  4QIW N;  1APL C;  1KA8 A;  2DFH A;  3P9C A;  2JA8 J;  1FC3 A;  2E36 A;  3DQV C;  3GXO A;  1B59 A;  2CQK A;  4U0V A;  2XC7 A;  2IA2 A;  2K4J A;  3ERM A;  3FMS A;  4L5J A;  1ZN2 A;  5CVI A;  2XSJ C;  3EUH A;  3DEW A;  2VQL A;  4U7B A;  3B6C A;  3OOP A;  2IA1 A;  3W3C A;  4ITV A;  1MSF C;  5HS7 A;  3S16 J;  2ME6 A;  3ABT A;  1XDU A;  4UNO A;  4RMN A;  1D8J A;  2KIQ A;  3WTW C;  3E7L A;  1KON A;  1H8A C;  3ZMS A;  1X3U A;  4NC6 A;  3GTP J;  1I27 A;  3DF8 A;  5CVR A;  3VYT B;  1ETX A;  3MD2 A;  5DTD A;  1X2N A;  3BR0 A;  2O0Y A;  4II2 A;  3BPX A;  4GO1 A;  3RDI A;  3SDB A;  4OIQ F;  4DYQ A;  4ZYD A;  1FTZ A;  5IOY A;  3V7C A;  1T0F C;  2VC0 A;  2X85 A;  4M6X A;  4ZDL A;  2IGM A;  3QWL A;  2ZME B;  5F27 A;  1R71 A;  1R49 A;  2QBY B;  4L0Z B;  1KQ0 A;  1MBG A;  1Z7U A;  1OR7 C;  2Z16 A;  3RYR A;  3I58 A;  3CC4 I;  4BBS J;  1DQU A;  1HXD A;  3L2W A;  4U87 A;  1PDN C;  3MKW B;  4G8X A;  3E6M A;  1XD7 A;  4N0B A;  5C44 J;  5LHG A;  4HF1 A;  2HTJ A;  3RZD J;  2VKV A;  3S1R J;  2X0L A;  1T33 A;  5EEG A;  1FOX A;  1ETQ A;  3V4G A;  3VB2 A;  1LE8 A;  2R0Q C;  3SZT A;  1FSH A;  3HSF A;  2MGQ A;  1YX3 A;  1I1G A;  3O6B B;  2Y0M A;  4GGG A;  3CC7 I;  3CO6 C;  2VJI A;  1HST A;  1MMN A;  2JRM A;  3HTU A;  1SFK A;  2M4K A;  3MEX A;  1BOA A;  1VND A;  2DMP A;  4EJU A;  3BZC A;  1IG7 A;  2YU3 A;  1ZGW A;  3PQK A;  3BPV A;  3L00 A;  4PJJ A;  3DBR B;  1T39 A;  1BR2 A;  3OR1 C;  5IT3 A;  5M5Y J;  5GPC A;  2C6Y A;  1YO5 C;  3E97 A;  3TW7 A;  2B0L A;  3ZQI A;  1FT9 A;  2CH0 A;  2HI3 A;  4HEA 2;  4CA0 A;  1IF1 A;  2HGC A;  2ISY A;  2Z2S B;  3W2A A;  2I5U A;  1NK3 P;  5LGT A;  1XGO A;  3C2H A;  3PFI A;  5BS6 A;  1W0U A;  1JKQ C;  2OQG A;  3TW6 A;  3S2H J;  2DT7 B;  1UHS A;  3WG9 A;  1XGM A;  2B7E A;  4ZTF A;  2IS1 A;  2HKX A;  3GUD A;  1MD0 A;  1U6G A;  2CV0 A;  2PN6 A;  4MHG A;  1FLI A;  5FRO A;  5HVQ C;  5IP7 J;  2X51 A;  1V3F A;  3HGY A;  3KP5 A;  4L9V A;  4F93 B;  1WVR A;  5FD6 A;  2WV0 A;  1ZKG A;  1MBE A;  2K02 A;  1J75 A;  2GAU A;  3K4L A;  1YE9 A;  1J7K A;  1UST A;  3C3W A;  2ID3 A;  1X19 A;  4PJM A;  2KT0 A;  4RB3 C;  2O8X A;  3T1B A;  1V5F A;  2L4A A;  4MEY F;  2IXS A;  3WHC A;  2EV5 A;  1TNS A;  2L9R A;  5FD5 A;  5LBQ A;  3LA2 A;  4E7H A;  2HU9 A;  4LLG F;  1OYI A;  4CCO A;  1U9O A;  2NAZ A;  4P9U A;  5GTH C;  5A2Q Z;  3VEP A;  1O3T A;  2P81 A;  2J5P A;  3Q0W A;  4CYC B;  1U5T A;  3QOE A;  5AIQ A;  1OPC A;  3DPT A;  5HLI A;  3FWE A;  5DD8 A;  1A5J A;  2XF5 A;  2E35 A;  3B73 A;  4JYK A;  3JRB A;  5M3M J;  4RBO A;  2W7N A;  2KLO A;  1IN7 A;  3E1S A;  5GPA A;  1R6R A;  3S3O A;  2KIS A;  2GXA A;  3DPU A;  3MKZ A;  2OZU A;  2CFX A;  3S1Q J;  1AWC A;  1FPQ A;  1XSV A;  1WH7 A;  2ZNZ A;  5C4X J;  2QKL B;  3I56 I;  2UXX A;  3SJM A;  1WI3 A;  3AG4 H;  3O3K A;  3FXM A;  2L0K A;  1B8I A;  1WJD A;  3PIP F;  2G9W A;  3K4C A;  4B3A A;  3D0S A;  1XN7 A;  1F9N A;  3KP4 A;  1YJ9 I;  3O8G A;  3K1N A;  4B09 A;  4L5I A;  3I4N J;  2AXT C;  2HOT A;  3KFW X;  3H92 A;  1QPM A;  4Y13 A;  3ZGK A;  3IWZ A;  4EEF G;  3DTK A;  3HB9 A;  1DP7 P;  2F5D A;  5JHF A;  1R23 A;  2BXY A;  3SFI A;  5DCF A;  1POG A;  1P4X A;  3DLA A;  4HPQ A;  2EIL H;  4BJT A;  5JLW A;  2EPF A;  1XMA A;  3HXL A;  2LDU A;  4CCM A;  1Z91 A;  3CLQ A;  4XLC A;  4I7H A;  2E1N A;  3JSP A;  3C18 A;  4ZYA A;  1A6Q A;  1IRX A;  2QCO A;  4CCN A;  5GP9 A;  5TRD A;  3G1L A;  1F4K A;  2OZ6 A;  2ZNY A;  3SDG A;  4R1H A;  1R7J A;  4FX4 A;  4M72 A;  1RZ4 A;  3K4B A;  3HOY J;  1YYV A;  4B4C A;  2H1L A;  2XRN A;  1OLT A;  3B02 A;  4XKC A;  2XAG A;  2ZJ2 A;  4IHT A;  2ZB9 A;  3RPU D;  1J9I A;  1V54 H;  3VDX A;  4S05 A;  2NS0 A;  4X1E A;  3T5X A;  3KEQ A;  1DGW Y;  3RQI A;  2E1M B;  2FXA A;  1JXS A;  1K6Y A;  4EJO A;  5D4R A;  3OMY A;  1S6L A;  2W57 A;  1G6N A;  2JK3 A;  1WZ2 A;  2WB1 N;  4AVP A;  1HKT A;  4GDF A;  4ESF A;  2WAQ A;  3FKJ A;  1HDD C;  4IRH A;  2WA0 A;  2XGX A;  3MKL A;  1RI7 A;  1MGT A;  1QRY A;  2MSY A;  3F3X A;  3FIW A;  4WXH A;  1WGX A;  1MIJ A;  1S5L C;  2VJ5 A;  1XB4 A;  1OYW A;  3F8F A;  1K7A A;  3BWG A;  4G6T B;  2XSD C;  2LMD A;  1R00 A;  2KJC A;  1IJW C;  4F3Q A;  1JI8 A;  3VSL A;  2Y9Y A;  4PK4 A;  1UCR A;  3UKG A;  3NAR A;  4GXO A;  2ZME C;  1U78 A;  4II3 A;  1OR7 A;  2EFO A;  3IAS 2;  2DW4 A;  2R7O A;  4KJZ A;  5JVG F;  1HKS A;  1WPK A;  4FET A;  5HOO A;  2XUB A;  4I98 B;  5K7H A;  2HEO A;  2DPD A;  3KYD B;  2EZL A;  4J00 A;  4M73 A;  3PJR A;  2L2O A;  4RB1 A;  1SVO A;  4CH7 A;  4UXN A;  3WU2 C;  2LG4 A;  4UVA A;  1JTX A;  5D5X B;  3FXL A;  3HPG A;  3Q0U A;  3S3N A;  1FX7 A;  3G3Z A;  2V79 A;  1HKQ A;  1LVK A;  2NVX J;  5BNG A;  3LSP A;  2XPU A;  1XCV A;  2KP6 A;  3ZOB A;  2A05 A;  1G2H A;  4RGS A;  5K5Q A;  3D5R C;  5LLQ A;  4ZYG A;  1T08 B;  2CUZ A;  1OCO H;  2L3D A;  3IHU A;  3IUO A;  4Q47 A;  3VOD A;  1QZZ A;  1UAA A;  1XDS A;  4XRF A;  1GXP A;  3OYG A;  4LIV A;  1XSX A;  3DBH B;  3GX4 X;  4ETS A;  4LOC A;  3CCR I;  3BQZ A;  2DMQ A;  2I10 A;  5EG0 A;  2EZI A;  1U5T B;  2MD5 A;  2IGK A;  4Y7N J;  4AVZ A;  1TP4 A;  1JKP C;  5IP6 A;  2VAS A;  3OYH A;  2E34 A;  3DWL E;  3GF2 A;  1IGN A;  2IRF G;  5M5X J;  2NS8 A;  4MIM A;  2K3F A;  3VYR B;  2M9H A;  3ABU A;  5K5O A;  3V42 A;  1D5Y A;  1VZ0 A;  2V1D A;  2YR2 A;  6PAX A;  4IHS A;  1YG2 A;  3SHF A;  4CUG A;  4ANJ A;  3CF2 A;  1X1P A;  4IL6 C;  2R7W A;  2GOM A;  2X4H A;  2OQR A;  1ITY A;  1B8I B;  4MGR A;  5FO5 A;  2CV1 A;  3OV8 A;  3P5J A;  4HSR A;  2QA4 I;  4CGZ A;  3J7A Y;  1U2W A;  2GZW A;  5FLX Z;  2EFN A;  2JJ7 A;  3FX3 A;  4AIK A;  1GXQ A;  2VQH A;  1B1B A;  4BQN A;  3N05 A;  2HTS A;  3KYC B;  2GBY A;  4L9J A;  2R93 J;  2NNY A;  1GVD A;  5E8I A;  4NDL A;  3HDD A;  2L9S A;  5JR3 A;  4KDP A;  1E3O C;  3DKY A;  2K85 A;  3EYI A;  1D1C A;  3VPR A;  4Q4Z F;  3QU3 A;  4M3D A;  3C2B A;  3I0T A;  3FXU A;  1VQN I;  3BTJ A;  4JBA A;  3GFM A;  1Z3X A;  1IN8 A;  2ESN A;  2VBY A;  5LHI A;  4DOZ A;  4OU0 A;  3GTK J;  4IHW A;  3GO5 A;  4KYW A;  3QPL A;  3LAP A;  1ONV A;  4XSX F;  2RN7 A;  2IT0 A;  9ANT A;  3FXO A;  2CRG A;  3L2R A;  4HDV A;  3C1D A;  3RIR A;  1BC7 C;  1QZY A;  2HYG D;  5CLS A;  2OV7 A;  2F5C A;  2QQ9 A;  2V9P A;  3EPZ A;  4RB0 A;  2A5Y B;  2AS5 F;  3W6J B;  1G8X A;  1I5Z A;  2ZJP F;  3BG3 A;  1LUJ B;  5D8L B;  4E7Z A;  2XAH A;  3H5N A;  1F5T A;  2M34 A;  2E71 A;  4BUP A;  4KIG A;  2IEK A;  2VC1 A;  2DA3 A;  1J59 A;  3JRG A;  4QSH A;  2MG4 A;  1ZQ3 P;  5J3L A;  3BJA A;  2HOE A;  5L3D A;  3BG6 A;  3OS1 A;  2H94 A;  5AON A;  3KLN A;  2DA7 A;  4P5O A;  1EH7 A;  4A3C J;  2DN0 A;  2QGU A;  1FYM A;  1XC5 A;  1K78 A;  1R5H A;  2H1K A;  2CS3 A;  2EWN A;  1PUF A;  5BQT A;  3BY6 A;  2CV2 A;  3JAM K;  3BR6 A;  1JUM A;  2LBF B;  2Y9Z A;  3F23 A;  3OYD A;  3S15 J;  3CF5 F;  2DCE A;  2M8G X;  2EK5 A;  3HUG A;  1FBQ A;  2JTV A;  3VYU B;  3DEU A;  4IEJ A;  4U7D A;  2WY7 Q;  3HOV J;  4FAS D;  1IUF A;  4G7H F;  1MBH A;  2V1N A;  2UXN A;  3NAU A;  4KT6 A;  3WTY C;  3DTI A;  1X2M A;  2A3S A;  2K4B A;  1XSD A;  3H9G A;  5LGU A;  1HLV A;  2IPQ X;  3U21 A;  1Y1V J;  3KEY A;  3PFY A;  3ABL H;  3D5L A;  2E1M C;  3SEQ A;  5ICG A;  3L2C A;  2HPI A;  5HDK A;  2Z3Y A;  4YEL A;  3GCM A;  3LQQ A;  3FF5 A;  3M8F A;  1ZG3 A;  4LMY A;  2BOL A;  2ELJ A;  4L18 B;  3GTO J;  3HOT A;  3JRD A;  5K5R A;  1VI0 A;  3FMR A;  3J81 K;  1FYL A;  5JVT A;  3QRF F;  4A3D J;  3FK7 A;  2P7C B;  3BC8 A;  1V4R A;  3DFG A;  2TCT A;  2DMU A;  3R0J A;  3DPL C;  5E79 C;  1F36 A;  4HLX A;  3ZQF A;  4GRI A;  2YSR A;  2DK8 A;  3CQZ J;  3W2V A;  2ID6 A;  4HDU A;  3R61 A;  3I5U A;  5EG0 B;  2OTJ I;  4A3B J;  2ZME A;  2R7R A;  4G7O F;  2CUE A;  2NOJ B;  4A0X A;  4PJL A;  1BR4 A;  1MMS A;  3F9K A;  1ZLK A;  4BY1 J;  1T8I A;  2X1E A;  2EBI A;  2M2E A;  2DLL A;  2DOD A;  2GOX B;  1BL0 A;  1VQK I;  4C3I J;  1JKR C;  3GWZ A;  2LY9 A;  3IV5 A;  3FXR A;  4AU7 A;  3OSG A;  4KUM A;  4I2O A;  3PNY A;  5HS9 A;  1T56 A;  4A3L J;  3ERE D;  4KIF A;  3GBG A;  4LIT A;  2LH9 A;  1YI2 I;  4UUS A;  1D1A A;  1K79 A;  1N77 A;  2MH9 A;  2E2J J;  4XLH A;  1Z6R A;  2HZD A;  2PG4 A;  2KJB A;  2QF7 A;  1EH8 A;  3OYE A;  1B4A A;  3WGH A;  1MZB A;  4CIC A;  3CCY A;  4IF4 A;  1YFH A;  2EZH A;  5F04 A;  3WU0 A;  4IRI A;  2WV1 A;  1I3Q J;  2LF7 A;  4LG3 A;  4BE2 A;  1MH4 A;  1RET A;  3SFZ A;  1BC8 C;  1D3Y A;  2XAF A;  2ACJ A;  2KDZ A;  5DEQ A;  1U5T C;  1NTC A;  4E6K G;  1BI2 A;  3TOA A;  2M1B A;  3SEZ A;  3V8L A;  4BE1 A;  4E7S A;  3TGN A;  3QYB A;  1I6X A;  1R22 A;  1R1T A;  3DU5 A;  3BR5 A;  4D7N A;  3R0A A;  4YFX F;  2STW A;  3MVP A;  3CMY A;  2K9L A;  3BOQ A;  1Z0X A;  3HOU J;  4HZF A;  3UNG C;  5HLT A;  5H20 A;  3E5X A;  2GQQ A;  4XQF A;  1ZTR A;  4E7L A;  4AWX B;  3GTL J;  2VE8 A;  2UV1 A;  4A3F J;  3CJT B;  1TT5 B;  5L3E A;  4R8H A;  4F92 B;  3L2U A;  2GXB A;  5EJC A;  3BR3 A;  4UUT A;  5FRM A;  2KRC A;  5KCM A;  4J19 A;  2KMU A;  3LSH A;  1O3Q A;  3R4K A;  2V6C A;  4HF0 A;  4MTD A;  4A6D A;  1FBS A;  4BBR J;  4XSZ F;  2BVM A;  3DCF A;  4ENN A;  3BQY A;  4D7M A;  3NWS A;  4U0Y A;  4A6E A;  5D8K B;  5EDN A;  5B1A H;  3OYM A;  3GLL A;  3J7A O;  2F2E A;  2BE5 F;  5E8G A;  2BW3 A;  5IT9 Z;  3IC7 A;  5F1J A;  4IX7 A;  3E0J B;  3TQN A;  4YII A;  3JSO A;  2NS7 A;  4NC7 A;  2EIM H;  2E7X A;  3P9I A;  1QHH D;  2P0W A;  1K78 B;  2BV6 A;  4H0E A;  3IRR A;  3QPT A;  1PUF B;  3LSJ A;  2PJR A;  1O3S A;  3ZQ7 A;  3DEE A;  2XAQ A;  3LFK A;  2O6G E;  3CES A;  4EQQ A;  4RGX A;  5HDG A;  2LRD A;  2K5C A;  2WAE A;  4YEJ A;  5FKO A;  2XB5 A;  2HFH A;  2PMU A;  3PUB A;  2QWW A;  3HUG B;  4A5M A;  5LEK A;  2LY2 A;  4O5V A;  3A4C A;  1A04 A;  1YTY A;  2X9D A;  3H5A A;  3QOP A;  2RKH A;  1DU0 A;  1E2X A;  3CCE I;  2FBH A;  1VQ6 I;  1FYK A;  1MSE C;  3PO3 J;  4P9F A;  3FZV A;  4ZH4 F;  1PP7 U;  1Y8Q B;  2ZXJ A;  4O3M A;  1NG7 A;  2BHZ A;  3S14 J;  2F5V A;  3Q5F A;  5JHU A;  4DIQ A;  2MD0 A;  2RC4 A;  3LOC A;  3PO2 J;  4G6Q A;  1Z7L A;  2A61 A;  4Z6Y A;  1S8N A;  4CHU A;  3L1P A;  2ZJQ F;  1FMV A;  4XRS G;  1X1A A;  2MLG A;  3LST A;  2WAQ N;  5GAE J;  5JI6 A;  5L3F A;  4KT5 C;  3Q9S A;  1OQY A;  3OYC A;  5EF6 A;  3NWT A;  1OYY A;  4PJ0 C;  1FIP A;  2PBI A;  2F5F A;  3HKZ A;  4BXF A;  2LVS A;  2LD5 A;  2CU7 A;  4TV7 A;  2VOP A;  1EH6 A;  3K9T A;  2ZC2 A;  3ELK A;  2ELK A;  5HNH A;  3GZN B;  3N4M A;  3ZQG A;  2W00 A;  2XF7 A;  3T8T A;  1Z21 A;  3JRI A;  5KVR A;  5IYD J;  3I4M J;  3K0L A;  3RSN A;  3RPU A;  3FBI B;  4Y3O A;  3RZO J;  4A12 A;  4BEH A;  2ME0 A;  1VF9 A;  2EH3 A;  3CCU I;  1YRN B;  4LG0 B;  2D5V A;  1ZLJ A;  2K27 A;  2GIV A;  3ASO H;  1TQP A;  3KET A;  1USS A;  4UUS B;  1SFO J;  1NHA A;  3JRH A;  1IC8 A;  4Y33 A;  5GAD J;  2Y48 A;  3W2W A;  2YS9 A;  1XTA A;  3DLL F;  2F5E A;  1S29 A;  2EA2 A;  5DUK A;  1MMG A;  3BG5 A;  4GCV A;  3CJN A;  2D1V A;  4LGW A;  3O2P E;  4AYB A;  3LNQ A;  3HHH A;  3ZCO A;  4LJZ F;  5LHH A;  2GA2 A;  4CZC A;  1YW8 A;  2LLK A;  2WAF A;  3IAM 2;  4L0Y B;  1A35 A;  3BP8 A;  1FY7 A;  2OF7 A;  2FOK A;  5F0F A;  4D5F A;  4LB6 B;  4WX9 A;  3TP3 A;  1ACI A;  1DGR M;  3KZI C;  4UHT A;  4W97 A;  2F4M B;  3I3L A;  2V26 A;  4YRV A;  3OS0 A;  4G7Z F;  1XGS A;  2QQB A;  1LNW A;  4N9I A;  1OIS A;  4BQQ A;  2WC2 A;  4UVB A;  2EIK H;  4CCK A;  2ELH A;  3EUA A;  2PMZ A;  5J47 A;  1MH3 A;  4C2U A;  1GDT A;  5F64 A;  4FX0 A;  1BI3 A;  5JFR A;  3CDI A;  5E1W A;  2JSP A;  3HGG A;  2HVQ A;  4HQM A;  1WJE A;  2YUS A;  4EMS A;  2FU4 A;  2X6Y A;  2DTZ A;  4PFP A;  3LA3 A;  5K1Y A;  2DMN A;  3BTL A;  4LIU A;  1LVA A;  5CYV A;  4AM3 A;  2W1O A;  3JW4 A;  5KHD A;  5D5V B;  2QYO A;  2OD5 A;  2QSH X;  3AL0 B;  4AIJ A;  1MNE A;  3Q0V A;  3GLX A;  3IP4 B;  5TIS C;  3LFU A;  1AHD P;  1I6H J;  4XOP A;  2ZCW A;  2RNG A;  3WTT C;  5ILV A;  1JTY A;  3OS2 A;  2BW3 B;  1QBJ A;  3F6V A;  1J09 A;  2LR8 A;  2JPC A;  2XKO A;  2L7M P;  3E6B A;  1EF4 A;  2PX9 A;  2O03 A;  1V55 H;  3BCA A;  2CQQ A;  3TOB A;  2XB0 X;  3E6D A;  2QSF X;  3U1D A;  2PJR B;  2GWR A;  1Y0U A;  3HRM A;  1RKW A;  2P5V A;  2A69 F;  1R9T J;  1W1W E;  3RQ4 A;  4JOM A;  4EJV A;  2V1X A;  5K7F A;  1FNN A;  3OYB A;  1K61 A;  1TZL A;  2F4I A;  2IGO A;  3WG7 H;  2O9L A;  2OC6 A;  1X3W B;  4NQW A;  3A0H C;  1ODD A;  1WRJ A;  2VBZ A;  4RM2 A;  2HXI A;  5LFA A;  4XLP F;  5KNL A;  2MLK A;  1BW5 A;  1G3T A;  2Y30 A;  1W36 D;  3DKW A;  1U9N A;  2W24 A;  4G6D A;  3HZJ A;  3ISP A;  4HX4 A;  1I1S A;  1N25 A;  2K40 A;  1IW7 F;  1PVE A;  4UB8 C;  1YQA A;  4UB6 C;  1H9T A;  2PMH A;  1STZ A;  5DS9 A;  2DT6 A;  2P6T A;  3CC2 I;  1S72 I;  1P2F A;  2O8K A;  4ZJZ A;  1G3Y A;  3HG9 A;  2Q8K A;  2LK2 A;  3WTU C;  1YW7 A;  4V19 K;  1D8K A;  1SVL A;  1MKM A;  1S7A A;  3K10 A;  3KEO A;  1KQ8 A;  3BDD A;  1KU7 A;  4EJT A;  2MH2 A;  5CPR B;  2UUZ A;  5LEJ A;  2BGC A;  2EZK A;  1YW9 A;  3H5R A;  4QTR A;  1R1U A;  1Z9C A;  2FD5 A;  2IS6 A;  1YLF A;  1UFM A;  1WWX A;  2CMP A;  2D2W A;  2P7V B;  2RQQ A;  2VKH A;  3HRT A;  4IJA A;  4F55 A;  2ADU A;  3CME I;  2DAO A;  2O5R A;  3HJE A;  3AFH A;  2LFB A;  1U3E M;  4IHX A;  4E7J A;  4JX4 A;  2RDP A;  5EEH A;  3RKQ A;  2HWV A;  5J8F A;  2FJ1 A;  3OYJ A;  2COM A;  1HC8 A;  5CJ9 A;  2BZT A;  3BRO A;  1L0O C;  1UG0 A;  4A0Y A;  1IRZ A;  3HM5 A;  2L01 A;  3FHN A;  2H27 A;  4CZZ A;  2NVQ J;  3BZK A;  4XM3 A;  4CSW A;  1R1V A;  2OA4 A;  4A0Z A;  4BEH B;  2N8G A;  3GFI A;  2BYV E;  4D9J A;  2KZG A;  5IPA A;  4BNC A;  3IH4 A;  2XGD A;  2F48 A;  2V6E A;  1RIO H;  2FOW A;  3RKY A;  1ZR4 A;  5FFX A;  3IH2 A;  2X1D A;  1YOV B;  4HLY A;  2WY8 Q;  3HHG A;  3IH3 A;  3PL8 A;  4BXX J;  1BI1 A;  2CFO A;  2H09 A;  3GEZ A;  4M74 A;  1Z05 A;  3RKW A;  3I64 A;  3TMO A;  1E17 A;  1TQM A;  1IN5 A;  1FP1 D;  5E3N A;  1YS6 A;  2A5W A;  3ASN H;  1HCR A;  2JVG A;  2WAD A;  2VUM J;  4CCJ A;  2LBF A;  4H4K C;  4RGU A;  1SC7 A;  4XN3 A;  3SXY A;  3CZ6 A;  4OAZ A;  1XMK A;  4B3X A;  3AAF A;  2P4W A;  1LEA A;  2EFQ A;  1UMQ A;  2VQC A;  2X48 A;  4OAY A;  5E20 A;  4ENK A;  2BBY A;  1K4T A;  3HRS A;  2KL4 A;  2LF8 A;  4MFD A;  5FLV A;  2G7H A;  2NVT J;  3KP2 A;  1MBJ A;  5EEA A;  2LP0 A;  3FDY A;  1XX5 A;  4ZDO A;  3QAH A;  3CCS I;  4YFN F;  1E0E A;  1P6R A;  2NVU B;  3J7Z I;  1IAW A;  3QP5 A;  2L9V A;  4FCY A;  2BY1 A;  2XAJ A;  1FSE A;  4NHJ A;  3CD6 I;  1VFC A;  1XMX A;  2V4J C;  2RGV A;  5D6E A;  2OTL I;  5F0C A;  3E3V A;  4BGD A;  2ETH A;  2E1O A;  2R7D A;  1O57 A;  3ZMU A;  3ZRG A;  2R7T A;  1JHF A;  2MYS A;  2R7U A;  2HVR A;  2QKM B;  3MN2 A;  4A93 J;  1NH3 A;  1WJF A;  4BKX A;  3OSF A;  1W7P A;  3V8J A;  1Z3Y A;  4A3M J;  4M3F A;  2NNN A;  4XK4 A;  2VE9 A;  3BLY A;  1YHQ I;  1TW3 A;  3X2Q H;  1B72 A;  4KNY A;  1D1B A;  2HQ5 A;  3GYH X;  2VJ4 A;  3P9K A;  4JK1 X;  4Y17 A;  1FOY A;  3N97 A;  2FBK A;  2VB6 A;  3C7J A;  4NQW B;  1BIB A;  4XRS A;  1OKR A;  1ETO A;  2IP2 A;  4B44 A;  2IJL A;  1BA5 A;  2K7L A;  3H3U A;  3K1P A;  2F6C A;  2HDW A;  4PSW A;  2VLA A;  5BOX A;  4RS8 A;  3J80 K;  1ZR2 A;  2FSW A;  3QYE A;  2L9N A;  3JRC A;  3KP7 A;  3AL0 C;  1W5S A;  3VOE A;  2HS5 A;  3A03 A;  1HQC A;  4I09 A;  3BJ6 A;  1T95 A;  4BXU A;  2W48 A;  2Z5U A;  5IY5 H;  1SD5 A;  3ZN1 A;  2PLY A;  1CQT A;  2R4G A;  3ZP5 A;  1EJ9 A;  4B48 A;  4QLC U;  4XR6 A;  5FLM J;  3JR9 A;  4UUV A;  3LMM A;  4OIN F;  2KRH A;  4F7Z A;  2B9S A;  2HQA A;  1F43 A;  2LNB A;  1JJ8 C;  1RUO A;  4IHY A;  3GFL A;  2STT A;  1IV6 A;  2H8W A;  3MZ8 A;  2V1U A;  2XDV A;  3WGI A;  1LB2 A;  2LTP A;  2DFI A;  1TNT A;  2Y2Z A;  3BR1 A;  4XON A;  3OL3 A;  4BDZ A;  2OCC H;  1LFP A;  3LSG A;  3OYA A;  1X4O A;  2ZSI B;  1RUN A;  3RCO A;  2JMW A;  1P9Q C;  2Z99 A;  2CSO A;  1FJL A;  3FMQ A;  1WJA A;  5E1X A;  5FGM A;  2X6O A;  1BM9 A;  3OR2 C;  1VQL I;  1W36 C;  1P7I A;  4DYC A;  5C3E J;  2BY3 A;  4EJW A;  3H3V K;  3HRU A;  4CCL A;  3KP3 A;  4DBR A;  4WXC A;  2ISZ A;  3OY9 A;  2FML A;  3S3M A;  5DCM A;  5L3B A;  4XID A;  1IDY A;  2LOO A;  3K69 A;  1X1C A;  3RTR A;  2FQ4 A;  1Z77 A;  4XNF A;  3CO7 C;  1W5T A;  3A01 B;  2L54 A;  3G73 A;  1O3R A;  3FXJ A;  2DOA A;  2LC2 A;  2MC4 A;  1ETV A;  1FBU A;  1WSU A;  1S3J A;  4XIC A;  1B9M A;  5EGO B;  3WE3 A;  4AUX A;  1BW6 A;  3AG3 H;  2BY0 A;  4C2M J;  4KMF A;  4FQG A;  5E3M A;  3DV8 A;  2BVL A;  3CJR B;  4JX6 A;  1SMY F;  3ZQC A;  3AG1 H;  3S1M J;  1FP2 A;  2L7K A;  4HA8 A;  3KE2 A;  3LWF A;  2FF4 A;  2ZO4 A;  1K4S A;  3FXQ A;  2WBM A;  2WTE A;  3I54 A;  1RC9 A;  4C9Y A;  3JCU C;  3KZY A;  1ULY A;  1SVM A;  1YX5 A;  3L2Q A;  3HKZ N;  1N75 A;  3GVA A;  3AG2 H;  4RM3 A;  2R92 J;  3EYY A;  3MZY A;  4Q48 A;  2L02 A;  3MMY B;  2EA4 A;  2Z9O A;  2XAU A;  4BE0 A;  2VI6 A;  2GA1 A;  5K7Z A;  3H35 A;  1JE8 A;  2NRA C;  4JQF A;  4PGH A;  4HBL A;  5FKN A;  2WWY A;  1Y6I A;  3TBI A;  4G94 A;  5E17 F;  3BTI A;  3V8K A;  1E3H A;  2CW0 F;  4A5N A;  2HOS A;  1BR1 A;  1WI9 A;  4MQV A;  5HDN A;  1ZHF A;  2JRT A;  1GHC A;  2DOF A;  1JGG A;  2W82 A;  4F52 A;  3K1M A;  3A0B C;  1R36 A;  5FKK A;  1W7P D;  2MAB A;  4IXA A;  2R5Y A;  3GTQ J;  4Z2Y A;  5J1R A;  2M5W A;  2AQE A;  1W7P B;  5H2F C;  2GM4 A;  4PFO A;  3BG9 A;  4AYB N;  4DW6 A;  1B9N A;  5GAH J;  5ERI A;  4BU2 A;  2LKP A;  2YX7 A;  3CDH A;  3ZR8 X;  4BAY A;  3TO7 A;  3ZPL A;  2DK5 A;  3ZMZ A;  1B72 B;  2H6C A;  5DM7 F;  4E70 A;  1WKM A;  1YRN A;  1ZGA A;  4LG0 A;  2EFP A;  2JQ7 A;  1FTT A;  3QP6 A;  4LD5 A;  1VQ4 I;  4C3J J;  1QGP A;  2V9V A;  2DYR H;  2M7B A;  2P5K A;  4KA4 A;  2O3F A;  3RI4 A;  3EUK L;  3ABM H;  1TQI A;  3OYN A;  1REP C;  1UJ8 A;  5E18 F;  2L7Z A;  1XGN A;  2MC3 A;  3NEU A;  4FE4 A;  1JT6 A;  5F08 A;  5KK1 A;  1T38 A;  1ORK A;  3G1M A;  3EQL F;  1WQ2 A;  3L09 A;  4HOB A;  3WOD F;  2O7O A;  4HYE A;  3HPH A;  4WWC A;  5GTI C;  2HYJ A;  3A02 A;  4IKF A;  4IHV A;  3HOS A;  3COA C;  2VT3 A;  4BHC A;  3C2G A;  1FMW A;  1JUP A;  1Y0N A;  1AOY A;  4DZP A;  1R58 A;  4G12 A;  1P92 A;  2YU9 J;  4KIC A;  2PFB A;  1OMI A;  3DTE A;  4ON0 A;  2DU9 A;  2OCE A;  1J0R A;  1F1Z A;  1FEX A;  3JAM Z;  5CVJ A;  5FB2 A;  3Q9V A;  4XMY A;  4A3K J;  4I76 A;  4NUB A;  1PYV A;  4EGY A;  3M8E A;  2HDD A;  5J6X A;  1IXC A;  2Y0S A;  3ZMT A;  1FOW A;  2FEZ A;  2DFF A;  4MFE A;  2EIN H;  2E5Z A;  2OUM A;  2IW5 A;  4ENM A;  1IDZ A;  3HYI A;  2I8D A;  3S93 A;  5E3O A;  1DUX C;  2VXD A;  4HX8 A;  5CVU A;  3F8N A;  1HBX G;  3G4S I;  1HA8 A;  4QWQ A;  4M6V A;  3E6C C;  2QUF A;  5D4S A;  2CUF A;  5DYM A;  4HQE A;  4C2T A;  1LDK B;  1WFX A;  2DDA A;  2JWT A;  3LA7 A;  5FKM A;  2Q1Z B;  3SZP A;  1U8B A;  2ZSH B;  3T8R A;  3WGG A;  3JTG A;  4N4O B;  5M3F J;  3M3Y J;  4PGG A;  1XPX A;  5DCM B;  1KU9 A;  2E19 A;  3QU6 A;  1SFX A;  1ON1 A;  5D5W B;  1DDN A;  4A3G J;  4A3I J;  1R5I D;  2EJR A;  1VQ8 I;  2CQ7 A;  4B43 A;  1WJC A;  4M3G A;  3CMA I;  4CYD A;  3M1E A;  4B8X A;  1N78 A;  4Y52 J;  2DA4 A;  4BHP A;  2OJE D;  3F0C A;  4X0G A;  4O6J A;  4WK8 F;  4ESB A;  2CUJ A;  1FIA A;  3F8B A;  3BR2 A;  1SEU A;  1J2X A;  2LRE A;  1SD6 A;  2G7U A;  3PSI A;  5DV5 A;  5GAG J;  1IXS B;  1G3W A;  2COB A;  4R79 A;  4AIH A;  3ROU A;  4B1R A;  4L9N A;  1NK2 P;  4BAC A;  3MWM A;  4YFK F;  5IYC J;  2M0M A;  1JJ6 C;  2X6X A;  2HZT A;  4J01 A;  4XKW A;  2MW8 A;  1RR7 A;  3HBL A;  5D6F A;  1XCB A;  2RV8 A;  4M9X A;  1I3A A;  2OBP A;  4FTH A;  3L9F A;  4XKV A;  1QU3 A;  2LKS A;  2ZXW H;  4CO8 A;  4M3E A;  3Q3S A;  2HXO A;  2FNP A;  3KX2 A;  2NVY J;  4MO7 A;  1RNL A;  2H6B A;  2IA0 A;  1Q1V A;  3H36 A;  2DPU A;  1YS7 A;  1ZRE A;  2O61 A;  1EV7 A;  1P4W A;  1S7E A;  3LSK A;  3ZN0 A;  2E1C A;  3D5S C;  1LDD A;  2R7F A;  3KP6 A;  2VT2 A;  1TT0 A;  1R4M B;  3BG7 A;  5CKT A;  5KAF C;  3M4O J;  3CUQ A;  4FIS A;  2M8E A;  2RVC A;  3M7G A;  3JRF A;  4UY8 I;  1QO0 D;  3OIP A;  2Z1D A;  2DT5 A;  2DQR A;  2RAE A;  2CGP A;  1NG6 A;  3FXK A;  3MQ0 A;  3JRE A;  3JTH A;  2CW8 A;  2IBD A;  2R5Y B;  4YIF A;  1K83 J;  2M4G A;  2DA1 A;  1L3L A;  1TWH J;  3KCC A;  3BCB A;  1DP3 A;  3BT9 A;  3KPH A;  5A2Q K;  1YJW I;  2IS2 A;  1TWF J;  4JP0 A;  2Y75 A;  4S0H B;  1SAX A;  2DXI A;  4FT8 A;  1IUY A;  5LD2 C;  2VIX A;  2XPW A;  3I9V 2;  4XBF A;  1TLH B;  2QEN A;  3FIS A;  1O4X A;  2J5O A;  2Q2E A;  1YJN I;  2CJJ A;  3DKX A;  1M1E B;  4PCQ A;  2GIZ A;  4BHB A;  4BS9 A;  3IKV A;  1VQ9 I;  4EM1 A;  3PM1 A;  3RYP A;  1LKX A;  1RPW A;  2M87 A;  3R6S A;  1MDM A;  3K4N A;  1WH5 A;  3QPH A;  1SD7 A;  3OYK A;  4DQ2 A;  3J7Y J;  5E1Z B;  3HOX J;  1RR8 C;  3CMM A;  1KU2 A;  1O7F A;  4EM2 A;  4AD9 A;  2A6H F;  4BYY A;  3WTZ A;  1ON2 A;  2CQX A;  2KZV A;  2R3S A;  3A1Y A;  4BL0 B;  4A3E J;  4XKB A;  1HSJ A;  5DDG A;  2BY2 A;  5E3L A;  3ESW B;  1HW2 A;  3TED A;  1OCR H;  1UB9 A;  4QPO A;  3LSR A;  2XRL A;  1HW5 A;  4CDG A;  2B63 J;  5C4J J;  2GXG A;  1Y8R B;  2QLZ A;  3K7A J;  5J8C A;  4V2G A;  3SZG A;  2VBW A;  5H6Q A;  1CF7 A;  1QZE A;  1MJ9 A;  2TRT A;  1QQI A;  3WTS C;  3SYT A;  2W84 A;  3E5Q A;  4BJ6 C;  3IKT A;  3I59 A;  1SAN A;  2VKD A;  4FHT A;  4I0A A;  1D0Z A;  5ICF A;  4I6Z A;  4LLN A;  2FX0 A;  2JT1 A;  3HOZ J;  4P55 A;  3S32 A;  3H0D A;  2VOO A;  1BJA A;  3L7W A;  5B66 C;  5LRS A;  2A07 F;  3IRQ A;  3HOW J;  3LQR A;  1MJA A;  2BHY A;  4F91 B;  1X58 A;  1FOK A;  5B1B H;  3PNV A;  2LYC A;  2ZXI A;  1QHG A;  1RES A;  2KDO A;  3H1C A;  5H6R A;  2UZK A;  3KZZ A;  3P7N A;  1U0J A;  1G3S A;  5DUI A;  1P7J A;  3EDP A;  1JUS A;  1TTY A;  1A31 A;  3QQA A;  2ZFW A;  3DP7 A;  2CO5 A;  4WXD A;  2X6W A;  5L3G A;  1H9G A;  4U88 A;  1TWG J;  4I0B A;  1A36 A;  4OOI A;  3GTG J;  2R7S A;  4ZYH A;  1VQO I;  1IN4 A;  4WF2 A;  4ABZ A;  2MBF A;  2XRO A;  1GLN A;  1JKO C;  1DPR A;  3GTJ J;  4P96 A;  3B6A A;  1S7O A;  4FE7 A;  5FRN A;  3I53 A;  4PJN A;  4E7K A;  2HYF A;  2AQF A;  4HRI A;  3CTA A;  3TO9 A;  4HAM A;  1JT0 A;  1ENH A;  5ICC A;  5LGN A;  4QPQ A;  4IOA F;  3CP8 A;  3M8J A;  4IZZ A;  5J4Y A;  3WTX C;  1IRG A;  5L3C A;  4K2E A;  3WTV C;  2QQA A;  4EGZ A;  5ILS A;  1LJ9 A;  4RLF A;  4L9T A;  4ZZL A;  1PUE E;  3GZ5 A;  4LFU A;  1IXR C;  4EAT A;  4NB5 A;  1WCM J;  2W25 A;  2OAZ A;  2TDX A;  1D0X A;  4KN7 X;  3CUQ B;  3PIO F;  3CCV I;  4BQA A;  4HX7 A;  4OIP F;  2R5Z A;  3TL4 X;  4M3B A;  2HKO A;  1X1B A;  1SAU A;  1AU7 A;  1FZP B;  1ZRD A;  4BDY A;  3I71 A;  3IL2 A;  2VON A;  1UHM A;  5EYR A;  4Q5S F;  2FRH A;  3QYF A;  3OL4 A;  1S9H A;  4IRG A;  3ZQH A;  3KLO A;  1W5C C;  3M1C A;  4ZDP A;  4LK1 F;  3SQN A;  5ICE A;  1LEB A;  4M6Y A;  4L5E A;  5ILU A;  2HVS A;  3TKY A;  5HLH A;  2E2I J;  2KQR A;  1OCP A;  2Q2E B;  3CDL A;  2FE3 A;  2DOE A;  2KPM A;  2JA6 J;  2L7F P;  4IPA A;  3OYL A;  2QVO A;  3WE2 A;  5BPD A;  2IVM A;  2DA2 A;  1OJL A;  1R4N B;  1UG2 A;  4BH9 A;  1JGS A;  1LFB A;  1QNT A;  3V7S A;  1AA7 A;  2DJI A;  2DI3 A;  1MDM B;  4N4N B;  3TDZ C;  2VBX A;  1ZRC A;  5LRR A;  3A01 A;  1P4A A;  2NYX A;  1ETY A;  2M7A A;  4DNC A;  1BBY A;  5FJ8 J;  1Y39 A;  3RPQ A;  3VFZ A;  3S2D J;  4XOR A;  2IAI A;  5FLX K;  2JUC A;  1ZAR A;  3GFJ A;  5J40 A;  4HNT A;  2ZBK A;  1WJB A;  4KFC A;  5B3S H;  3H3Z A;  2VPR A;  4ESJ A;  1QPI A;  3I4P A;  5EGO A;  3QPS A;  1LE8 B;  3PQJ A;  2E5N A;  3JRA A;  1ETW A;  2JA5 J;  1TW2 A;  4D5C A;  1T6S A;  4B47 A;  2CQN A;  3ABK H;  2KRF A;  2KKO A;  4KIT B;  2V7F A;  4LK0 F;  2R7Q A;  4RLQ A;  5IP9 J;  1YIO A;  4AID A;  1HDP A;  3K70 D;  2V9K A;  1CF7 B;  2K3P A;  3ZMV A;  3F21 A;  3VWB A;  4UVC A;  3HEF A;  5CQE A;  3MFK A;  5DD4 A;  2DDB A;  1T0F A;  2XF6 A;  3I59 B;  3TP0 A;  2DMT A;  3IWF A;  4XLA A;  1G59 A;  3HSE A;  4C3H J;  3FK6 A;  2K9M A;  3EET A;  2AHQ A;  3I55 I;  3ZQL A;  2KHM A;  4UV8 A;  2PI0 A;  1X3Z B;  4HW0 A;  1TL8 A;  3RJP A;  2CG4 A;  2EV0 A;  2UWM A;  1TWA J;  1J5Y A;  1OCT C;  3K4M A;  3ECO A;  2M45 A;  3WU1 B;  1YIT I;  5FFZ A;  3S2W A;  3U9G A;  4KIB A;  4MQ9 F;  2VL8 A;  1YIJ I;  4EVI A;  2EV6 A;  4G9Y A;  2FMY A;  2H8R A;  3FM3 A;  2JZY A;  4HNV A;  1MNM C;  4A69 C;  4MTE A;  1SFU A;  1G4D A;  4KN4 X;  4AC0 A;  1VQM I;  4OMZ A;  3ONQ A;  2BEO A;  3F8C A;  5F0H A;  2XV4 S;  2VJJ A;  2EB7 A;  3BTC A;  4M9S A;  4WCG A;  1T2K A;  4XLE A;  1UHW A;  3QOD A;  2CW7 A;  2DFE A;  1DU6 A;  4EV0 A;  2L5Q A;  2R7X A;  2W4S A;  1FWZ A;  3ULQ B;  2DBB A;  3AKZ A;  4ASN A;  3UR3 C;  2FNA A;  1HOM A;  4XLF A;  4IQ4 A;  1Z6T A;  2JN6 A;  1GV2 A;  2Y0S N;  1ZEL A;  2XAS A;  3NRV A;  2HDC A;  4XN0 A;  1W0T A;  2F4O B;  2ICW G;  2K9Q A;  4RAG A;  3H9Q A;  4XLN F;  3W6V A; 
#chains in the Genus database with same CATH homology
 1GVJ A;  4KMU X;  4PZJ A;  5HS8 A;  1DPU A;  2OU2 A;  2Z33 A;  1Q1H A;  2JPB A;  3LAJ A;  4M71 A;  1KU3 A;  2Q0O A;  2FBI A;  4ZZD A;  1TBX A;  3V7R A;  2A68 F;  2K86 A;  4LLL A;  1ZH5 A;  3FM5 A;  2MA3 A;  3W6K B;  1LQ1 A;  3TDU C;  3BJO A;  1C0W A;  4OIO F;  3ZMD A;  2KIF A;  1BI0 A;  2YX4 A;  1MJB A;  4HV6 A;  4PDK A;  1T98 A;  1ZGJ A;  3CUQ C;  1CGP A;  1U8R A;  1ZRF A;  3HSR A;  4ZYE A;  2XIG A;  2P6S A;  3DXJ F;  5ED4 A;  2DQL A;  4ENJ A;  2XVC A;  2RQP A;  2HQN A;  1IRF A;  2YPR A;  2VXZ A;  3MZH A;  1KGS A;  1R5G A;  2HQR A;  2PEX A;  1IZ1 A;  2PJP A;  2ZKZ A;  4RAY A;  2XHK A;  5BPI A;  1W4M A;  3ECH A;  1SFE A;  3J80 Z;  4D0P A;  2D1H A;  3FHZ A;  1ZYR F;  5TJJ A;  1KYW A;  2A6E F;  5F1R A;  4M9Z A;  1D5V A;  4U0W A;  4RB2 C;  1LDJ A;  3R60 A;  2KIM A;  2M30 A;  1BIA A;  2W85 A;  4OIR F;  4OMY A;  4RGR A;  3MAJ A;  2VN2 A;  5IT9 K;  1SMT A;  5HLG A;  2VOD A;  1HW1 A;  2E7W A;  4S04 A;  2HR3 A;  3E5U A;  2KIU A;  4HV5 A;  4LB5 A;  2QBY A;  5D5U B;  3CLO A;  2PQ8 A;  2QZ8 A;  2ESH A;  2FQ3 A;  2AXL A;  4N9H A;  3F6O A;  2LSO A;  2CYY A;  4YG2 F;  3T0Y A;  3M9A A;  4I02 A;  2CWE A;  1ZAO A;  1ZG1 A;  1PP8 F;  3K2Z A;  3GW2 A;  3F22 A;  3CUO A;  4MEX F;  2XKP A;  2L4M A;  4GYG A;  1IN6 A;  1KYZ A;  4RAZ A;  4IVN A;  2DTR A;  2QM3 A;  3NQO A;  4MNU A;  3BZ6 A;  3U2R A;  5AIP A;  2P8T A;  3TO6 A;  2JSC A;  1K6O A;  4HF2 A;  3J81 Z;  4GYI A;  1JHH A;  2FA5 A;  5BMZ A;  3MCZ A;  3HIF A;  3F72 A;  2RNJ A;  3ML6 A;  2P5L C;  1BN5 A;  1KQ9 A;  4I01 A;  5F6F A;  4Y15 A;  5CVV A;  3GZ6 A;  1VTN C;  3REO A;  1B6A A;  1H0M A;  1ZG5 A;  2D45 A;  4UV9 A;  3F8M A;  1O7L A;  4A2U A;  3RKX A;  3HTS B;  2EFW A;  1SD4 A;  1Z1D A;  4EM0 B;  4CXF A;  2DO7 A;  1KA8 A;  3P9C A;  1FC3 A;  3DQV C;  3GXO A;  1B59 A;  2CQK A;  4U0V A;  2IA2 A;  2K4J A;  3FMS A;  4L5J A;  1ZN2 A;  5CVI A;  3EUH A;  4U7B A;  3OOP A;  2IA1 A;  5HS7 A;  3ABT A;  1XDU A;  4UNO A;  1D8J A;  3WTW C;  3ZMS A;  1X3U A;  1I27 A;  3DF8 A;  5CVR A;  2O0Y A;  3BPX A;  4GO1 A;  3RDI A;  4OIQ F;  4ZYD A;  3V7C A;  2VC0 A;  4M6X A;  4KMF A;  4L0Z B;  2ZME B;  2QBY B;  1KQ0 A;  1Z7U A;  3RYR A;  3I58 A;  1HXD A;  1PDN C;  4G8X A;  3E6M A;  1XD7 A;  4N0B A;  5LHG A;  4HF1 A;  2HTJ A;  2X0L A;  5EEG A;  3V4G A;  3VB2 A;  3SZT A;  1FSH A;  3HSF A;  4GGG A;  1I1G A;  3O6B B;  2Y0M A;  3CO6 C;  1HST A;  3HTU A;  3MEX A;  1BOA A;  4EJU A;  2YU3 A;  3PQK A;  3BPV A;  3L00 A;  1T39 A;  5IT3 A;  2C6Y A;  1YO5 C;  3E97 A;  2B0L A;  1FT9 A;  1IF1 A;  2HGC A;  2ISY A;  5LGT A;  1XGO A;  3PFI A;  5BS6 A;  2OQG A;  3WG9 A;  1XGM A;  2HKX A;  3GUD A;  1MD0 A;  1U6G A;  2PN6 A;  4MHG A;  1FLI A;  5HVQ C;  1V3F A;  3KP5 A;  4L9V A;  5FD6 A;  2WV0 A;  2K02 A;  1J75 A;  2GAU A;  1J7K A;  1UST A;  3C3W A;  4RB3 C;  2O8X A;  3T1B A;  2L4A A;  4MEY F;  2EV5 A;  1TNS A;  5FD5 A;  5LBQ A;  3LA2 A;  4LLG F;  1OYI A;  2NAZ A;  4P9U A;  5A2Q Z;  3VEP A;  1O3T A;  2J5P A;  1U5T A;  5AIQ A;  1OPC A;  3DPT A;  5HLI A;  3FWE A;  5DD8 A;  3B73 A;  1IN7 A;  2OZU A;  2CFX A;  1AWC A;  1FPQ A;  1XSV A;  2ZNZ A;  2UXX A;  3O3K A;  2G9W A;  3D0S A;  1XN7 A;  1F9N A;  3KP4 A;  4B09 A;  3K1N A;  4L5I A;  3KFW X;  3H92 A;  1QPM A;  4Y13 A;  3IWZ A;  1DP7 P;  2F5D A;  1R23 A;  5DCF A;  1P4X A;  1XMA A;  2LDU A;  1Z91 A;  4I7H A;  2E1N A;  3JSP A;  3C18 A;  5TRD A;  1F4K A;  2OZ6 A;  2ZNY A;  4R1H A;  1R7J A;  4FX4 A;  4M72 A;  1RZ4 A;  1YYV A;  2XRN A;  3B02 A;  2XAG A;  2ZJ2 A;  4IHT A;  1J9I A;  4S05 A;  2NS0 A;  3T5X A;  3KEQ A;  2FXA A;  1JXS A;  4EJO A;  5D4R A;  1S6L A;  2W57 A;  1G6N A;  4AVP A;  1HKT A;  4ESF A;  4IRH A;  2XGX A;  1RI7 A;  1MGT A;  3F3X A;  4WXH A;  1XB4 A;  1OYW A;  3F8F A;  1K7A A;  3BWG A;  1R00 A;  2KJC A;  1UCR A;  4GXO A;  1U78 A;  1OR7 A;  2EFO A;  2DW4 A;  1HKS A;  5HOO A;  2XUB A;  4I98 B;  2HEO A;  2DPD A;  4M73 A;  4RB1 A;  4UXN A;  4UVA A;  5D5X B;  1FX7 A;  3G3Z A;  2V79 A;  1HKQ A;  1XCV A;  4RGS A;  5K5Q A;  5LLQ A;  4ZYG A;  2L3D A;  4Q47 A;  3IHU A;  3VOD A;  1QZZ A;  1XDS A;  4XRF A;  1GXP A;  1XSX A;  3GX4 X;  4ETS A;  1U5T B;  2MD5 A;  3GF2 A;  2IRF G;  3ABU A;  5K5O A;  2V1D A;  2YR2 A;  6PAX A;  4IHS A;  1YG2 A;  3SHF A;  2X4H A;  2OQR A;  4MGR A;  5FO5 A;  3OV8 A;  4CGZ A;  1U2W A;  2GZW A;  5FLX Z;  2EFN A;  3FX3 A;  4AIK A;  1GXQ A;  1B1B A;  2HTS A;  4L9J A;  2NNY A;  5E8I A;  5JR3 A;  4KDP A;  3EYI A;  4Q4Z F;  3QU3 A;  3I0T A;  3FXU A;  4JBA A;  3GFM A;  1IN8 A;  2ESN A;  2VBY A;  5LHI A;  4OU0 A;  3GO5 A;  4KYW A;  3LAP A;  1ONV A;  4XSX F;  2RN7 A;  2IT0 A;  4HDV A;  3C1D A;  3RIR A;  1BC7 C;  1QZY A;  2HYG D;  5CLS A;  2F5C A;  2QQ9 A;  4RB0 A;  2A5Y B;  2AS5 F;  3W6J B;  1I5Z A;  5D8L B;  2XAH A;  1F5T A;  4KIG A;  2VC1 A;  1J59 A;  3BJA A;  2HOE A;  5L3D A;  2H94 A;  5AON A;  3KLN A;  4P5O A;  1EH7 A;  1FYM A;  1K78 A;  1R5H A;  2EWN A;  5BQT A;  3BY6 A;  3JAM K;  3F23 A;  2EK5 A;  3HUG A;  1FBQ A;  2JTV A;  3DEU A;  4U7D A;  4G7H F;  2UXN A;  3WTY C;  2A3S A;  2K4B A;  1XSD A;  5LGU A;  2IPQ X;  3D5L A;  5ICG A;  3L2C A;  5HDK A;  2Z3Y A;  3LQQ A;  3FF5 A;  3M8F A;  1ZG3 A;  4LMY A;  4L18 B;  3HOT A;  5K5R A;  3FMR A;  3J81 K;  1FYL A;  5JVT A;  3QRF F;  2P7C B;  1V4R A;  3DFG A;  3R0J A;  3DPL C;  4HLX A;  2YSR A;  2DK8 A;  4HDU A;  3R61 A;  3I5U A;  2ZME A;  4G7O F;  4A0X A;  1ZLK A;  2DLL A;  3GWZ A;  3FXR A;  4KUM A;  4I2O A;  5HS9 A;  3ERE D;  4KIF A;  1K79 A;  2MH9 A;  1Z6R A;  2PG4 A;  2KJB A;  1EH8 A;  1B4A A;  3WGH A;  1MZB A;  4CIC A;  4IF4 A;  1YFH A;  3WU0 A;  4IRI A;  2LF7 A;  3SFZ A;  1BC8 C;  1D3Y A;  2XAF A;  2ACJ A;  5DEQ A;  1U5T C;  1BI2 A;  3TOA A;  2M1B A;  3V8L A;  3TGN A;  1I6X A;  1R22 A;  1R1T A;  3R0A A;  4YFX F;  2STW A;  3BOQ A;  4HZF A;  5H20 A;  3E5X A;  2GQQ A;  4AWX B;  2VE8 A;  5L3E A;  4R8H A;  2GXB A;  1O3Q A;  3R4K A;  2V6C A;  4HF0 A;  4MTD A;  4A6D A;  1FBS A;  4XSZ F;  4ENN A;  4U0Y A;  4A6E A;  5D8K B;  3J7A O;  2F2E A;  2BE5 F;  5E8G A;  5IT9 Z;  3IC7 A;  3TQN A;  4YII A;  3JSO A;  2E7X A;  3P9I A;  1K78 B;  2BV6 A;  4H0E A;  3IRR A;  3QPT A;  1O3S A;  3ZQ7 A;  2XAQ A;  3LFK A;  2O6G E;  4EQQ A;  4RGX A;  5HDG A;  2HFH A;  2PMU A;  2QWW A;  4A5M A;  5LEK A;  4O5V A;  1A04 A;  1YTY A;  3QOP A;  2RKH A;  1E2X A;  2FBH A;  1FYK A;  4P9F A;  3FZV A;  4ZH4 F;  1PP7 U;  2ZXJ A;  4O3M A;  3Q5F A;  5JHU A;  2RC4 A;  4G6Q A;  2A61 A;  4CHU A;  1S8N A;  2MLG A;  5JI6 A;  3LST A;  5L3F A;  4KT5 C;  3Q9S A;  1OYY A;  2PBI A;  2F5F A;  4TV7 A;  2VOP A;  1EH6 A;  3K9T A;  3ELK A;  3N4M A;  3T8T A;  5KVR A;  3K0L A;  3RPU A;  4A12 A;  4LG0 B;  1ZLJ A;  2K27 A;  2GIV A;  1TQP A;  3KET A;  1USS A;  1NHA A;  2Y48 A;  2F5E A;  1S29 A;  2EA2 A;  5DUK A;  4GCV A;  3CJN A;  2D1V A;  4LGW A;  3O2P E;  3HHH A;  4LJZ F;  5LHH A;  2GA2 A;  1YW8 A;  4L0Y B;  3BP8 A;  1FY7 A;  2FOK A;  4LB6 B;  4WX9 A;  4UHT A;  4G7Z F;  1XGS A;  2QQB A;  1LNW A;  4N9I A;  2WC2 A;  4UVB A;  2ELH A;  5F64 A;  4FX0 A;  1BI3 A;  5JFR A;  5E1W A;  4HQM A;  4EMS A;  2FU4 A;  3LA3 A;  5K1Y A;  1LVA A;  5CYV A;  3JW4 A;  5D5V B;  2QYO A;  2OD5 A;  4AIJ A;  3GLX A;  2ZCW A;  3WTT C;  5ILV A;  1QBJ A;  3F6V A;  2JPC A;  2XKO A;  3E6B A;  2O03 A;  3TOB A;  3E6D A;  3U1D A;  2GWR A;  1Y0U A;  3HRM A;  2P5V A;  2A69 F;  4EJV A;  2V1X A;  1FNN A;  4NQW A;  1ODD A;  1WRJ A;  2VBZ A;  4XLP F;  2MLK A;  1G3T A;  3DKW A;  2W24 A;  4G6D A;  3ISP A;  4HX4 A;  1I1S A;  1IW7 F;  1YQA A;  1H9T A;  2PMH A;  1STZ A;  2P6T A;  1P2F A;  1G3Y A;  2Q8K A;  3WTU C;  1YW7 A;  1D8K A;  1MKM A;  1S7A A;  3KEO A;  1KQ8 A;  3BDD A;  1KU7 A;  4EJT A;  2MH2 A;  5LEJ A;  2BGC A;  1YW9 A;  1R1U A;  1Z9C A;  1YLF A;  1UFM A;  1WWX A;  2D2W A;  2P7V B;  3HRT A;  4IJA A;  2ADU A;  2DAO A;  1U3E M;  2RDP A;  5EEH A;  2HWV A;  5J8F A;  2COM A;  5CJ9 A;  3BRO A;  1L0O C;  4A0Y A;  2L01 A;  2H27 A;  4CZZ A;  1R1V A;  2OA4 A;  4A0Z A;  3GFI A;  2BYV E;  4BNC A;  1RIO H;  3RKY A;  5FFX A;  4HLY A;  3HHG A;  1BI1 A;  2H09 A;  3GEZ A;  4M74 A;  1Z05 A;  3RKW A;  3I64 A;  1E17 A;  1TQM A;  1IN5 A;  1FP1 D;  1YS6 A;  4RGU A;  3SXY A;  1XMK A;  3AAF A;  2P4W A;  1LEA A;  2EFQ A;  5E20 A;  4ENK A;  2BBY A;  3HRS A;  2LF8 A;  2G7H A;  3KP2 A;  3QAH A;  4YFN F;  1P6R A;  1IAW A;  3QP5 A;  2XAJ A;  1FSE A;  4NHJ A;  2RGV A;  5D6E A;  3E3V A;  2ETH A;  2R7D A;  1O57 A;  3ZMU A;  1JHF A;  1W7P A;  3V8J A;  2NNN A;  2VE9 A;  1TW3 A;  4KNY A;  3GYH X;  3P9K A;  4JK1 X;  4Y17 A;  3N97 A;  2FBK A;  3C7J A;  1BIB A;  1OKR A;  2IP2 A;  2IJL A;  2K7L A;  3H3U A;  3K1P A;  5BOX A;  4RS8 A;  3J80 K;  2FSW A;  3KP7 A;  1W5S A;  3VOE A;  2HS5 A;  1HQC A;  4I09 A;  3BJ6 A;  4BXU A;  2Z5U A;  1SD5 A;  3ZN1 A;  2PLY A;  3ZP5 A;  4QLC U;  4UUV A;  4OIN F;  4F7Z A;  2LNB A;  1RUO A;  3GFL A;  2STT A;  2V1U A;  3WGI A;  1LB2 A;  2DFI A;  1TNT A;  1RUN A;  2Z99 A;  2CSO A;  3FMQ A;  5E1X A;  5FGM A;  1BM9 A;  4EJW A;  3HRU A;  3KP3 A;  4WXC A;  2ISZ A;  2FML A;  5DCM A;  5L3B A;  3K69 A;  3RTR A;  3CO7 C;  1W5T A;  3G73 A;  2L54 A;  1O3R A;  1FBU A;  1WSU A;  1S3J A;  1B9M A;  3WE3 A;  3DV8 A;  1SMY F;  1FP2 A;  4HA8 A;  3KE2 A;  3LWF A;  2FF4 A;  2ZO4 A;  3FXQ A;  2WTE A;  3I54 A;  3KZY A;  1ULY A;  3GVA A;  3EYY A;  3MZY A;  4Q48 A;  2L02 A;  2EA4 A;  2Z9O A;  2GA1 A;  1JE8 A;  2NRA C;  4JQF A;  4PGH A;  4HBL A;  2WWY A;  4G94 A;  5E17 F;  3V8K A;  2CW0 F;  4A5N A;  1WI9 A;  4MQV A;  5HDN A;  1ZHF A;  2JRT A;  1GHC A;  3K1M A;  1R36 A;  1W7P D;  4IXA A;  4Z2Y A;  2M5W A;  1W7P B;  1B9N A;  5ERI A;  2LKP A;  2YX7 A;  3CDH A;  4BAY A;  3TO7 A;  3ZPL A;  2DK5 A;  3ZMZ A;  2H6C A;  4E70 A;  1WKM A;  1ZGA A;  4LG0 A;  2EFP A;  3QP6 A;  4LD5 A;  1QGP A;  2V9V A;  2P5K A;  4KA4 A;  2O3F A;  3RI4 A;  1TQI A;  1REP C;  5E18 F;  1XGN A;  2MC3 A;  3NEU A;  5KK1 A;  1T38 A;  3EQL F;  1WQ2 A;  3L09 A;  4HOB A;  3WOD F;  4HYE A;  4WWC A;  3HOS A;  3COA C;  2VT3 A;  4BHC A;  1AOY A;  1R58 A;  1P92 A;  4KIC A;  2PFB A;  1OMI A;  4ON0 A;  2DU9 A;  1J0R A;  1F1Z A;  3JAM Z;  5CVJ A;  5FB2 A;  3Q9V A;  4EGY A;  3M8E A;  5J6X A;  1IXC A;  3ZMT A;  2FEZ A;  2IW5 A;  4ENM A;  3HYI A;  1DUX C;  4HX8 A;  5CVU A;  3F8N A;  1HBX G;  4QWQ A;  3E6C C;  2QUF A;  5D4S A;  4HQE A;  5DYM A;  1LDK B;  3LA7 A;  3SZP A;  3T8R A;  3WGG A;  3JTG A;  4PGG A;  5DCM B;  1KU9 A;  3QU6 A;  1SFX A;  1ON1 A;  5D5W B;  1DDN A;  2EJR A;  4CYD A;  3M1E A;  4B8X A;  4BHP A;  4O6J A;  4WK8 F;  4ESB A;  3F8B A;  1J2X A;  1SD6 A;  2G7U A;  5DV5 A;  1IXS B;  1G3W A;  4R79 A;  4AIH A;  3ROU A;  4L9N A;  3MWM A;  4YFK F;  2HZT A;  5D6F A;  1XCB A;  2RV8 A;  4M9X A;  2OBP A;  3L9F A;  4CO8 A;  2FNP A;  1RNL A;  2H6B A;  2IA0 A;  2DPU A;  1YS7 A;  1ZRE A;  2O61 A;  1EV7 A;  1P4W A;  3ZN0 A;  2E1C A;  1LDD A;  2R7F A;  3KP6 A;  2VT2 A;  3CUQ A;  2M8E A;  2RVC A;  3M7G A;  1QO0 D;  2DT5 A;  2DQR A;  2CGP A;  3MQ0 A;  3JTH A;  4YIF A;  1L3L A;  3KCC A;  5A2Q K;  2Y75 A;  1SAX A;  4FT8 A;  1IUY A;  4XBF A;  1TLH B;  2QEN A;  2J5O A;  2Q2E A;  4PCQ A;  4BHB A;  3IKV A;  4EM1 A;  3RYP A;  2M87 A;  3R6S A;  1MDM A;  3QPH A;  1SD7 A;  4DQ2 A;  5E1Z B;  1KU2 A;  1O7F A;  4EM2 A;  4AD9 A;  2A6H F;  4BYY A;  3WTZ A;  1ON2 A;  2R3S A;  1HSJ A;  5DDG A;  1HW2 A;  1UB9 A;  1HW5 A;  4CDG A;  2GXG A;  2QLZ A;  5J8C A;  2VBW A;  5H6Q A;  1CF7 A;  1MJ9 A;  1QQI A;  3WTS C;  2W84 A;  3E5Q A;  3IKT A;  3I59 A;  4FHT A;  4I0A A;  5ICF A;  4LLN A;  2JT1 A;  4P55 A;  2VOO A;  1BJA A;  3L7W A;  5LRS A;  2A07 F;  3IRQ A;  3LQR A;  1MJA A;  1FOK A;  5H6R A;  2UZK A;  3KZZ A;  3P7N A;  1G3S A;  5DUI A;  3EDP A;  1TTY A;  2ZFW A;  3DP7 A;  2CO5 A;  4WXD A;  5L3G A;  1H9G A;  4U88 A;  4I0B A;  4OOI A;  4ZYH A;  1IN4 A;  4WF2 A;  2MBF A;  2XRO A;  1DPR A;  4P96 A;  1S7O A;  3I53 A;  2HYF A;  3CTA A;  3TO9 A;  4HAM A;  5ICC A;  5LGN A;  3WTX C;  1IRG A;  5L3C A;  4K2E A;  3WTV C;  2QQA A;  4EGZ A;  5ILS A;  1LJ9 A;  4L9T A;  4ZZL A;  1PUE E;  3GZ5 A;  4LFU A;  1IXR C;  4NB5 A;  2W25 A;  2OAZ A;  2TDX A;  4KN7 X;  3CUQ B;  4BQA A;  4HX7 A;  4OIP F;  2HKO A;  1FZP B;  1ZRD A;  3I71 A;  3IL2 A;  2VON A;  1UHM A;  4Q5S F;  2FRH A;  4IRG A;  3KLO A;  4LK1 F;  3SQN A;  5ICE A;  1LEB A;  4M6Y A;  5ILU A;  3TKY A;  5HLH A;  2FE3 A;  4IPA A;  5BPD A;  2QVO A;  3WE2 A;  2IVM A;  4BH9 A;  1JGS A;  3V7S A;  1QNT A;  2DI3 A;  1MDM B;  3TDZ C;  1ZRC A;  2VBX A;  5LRR A;  1P4A A;  2NYX A;  4DNC A;  1BBY A;  3RPQ A;  3VFZ A;  5FLX K;  3GFJ A;  1ZAR A;  2ZBK A;  4KFC A;  4ESJ A;  3H3Z A;  3I4P A;  3PQJ A;  1TW2 A;  1T6S A;  2KRF A;  2KKO A;  4LK0 F;  1YIO A;  1CF7 B;  3ZMV A;  3F21 A;  4UVC A;  3MFK A;  5DD4 A;  1T0F A;  3I59 B;  3IWF A;  3HSE A;  3EET A;  2PI0 A;  4UV8 A;  4HW0 A;  3RJP A;  2CG4 A;  2EV0 A;  2UWM A;  1J5Y A;  3ECO A;  2M45 A;  3WU1 B;  5FFZ A;  3S2W A;  3U9G A;  4KIB A;  4MQ9 F;  4EVI A;  2EV6 A;  4G9Y A;  2FMY A;  3FM3 A;  2JZY A;  4MTE A;  1SFU A;  1G4D A;  4KN4 X;  4OMZ A;  2BEO A;  3F8C A;  2XV4 S;  4M9S A;  2EB7 A;  4WCG A;  1T2K A;  1UHW A;  4EV0 A;  1FWZ A;  3ULQ B;  2DBB A;  4ASN A;  2FNA A;  1Z6T A;  2XAS A;  3NRV A;  2HDC A;  4XLN F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...