4L9TA

Crystal structure of mepr f27l mutant from multidrug resistant s. aureus clinical isolate
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
140
structure length
140
Chain Sequence
MEFTYSYLFRMISHEMKQKADQKLEQLDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords MepR
publication title The molecular mechanisms of allosteric mutations impairing MepR repressor function in multidrug-resistant strains of Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 54
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4l9tA00
3EYIA 1W5TA 2V1XA 1J5YA 3K2ZA 3HRMA 4GXOA 3T1BA 4ESBA 3V8LA 5BOXA 3F72A 1Z9CA 3W6JB 1MDMB 4RS8A 2UWMA 2C6YA 5FD6A 2HYFA 1FBUA 2P8TA 5HOOA 3IC7A 4XSZF 5FFXA 4ZZLA 3EUHA 1TLHB 5D4SA 4QLCU 1KU2A 1HW5A 2PMHA 2UXNA 1FT9A 1W7PA 2M45A 4Y17A 3SXYA 4Y15A 3HSRA 2A69F 3IKVA 2XUBA 2HTJA 3V8KA 4I09A 2E1NA 1P2FA 3LA2A 3KETA 3E5QA 2A07F 1S8NA 4UVAA 4UVCA 1WWXA 5LRSA 2FEZA 2M30A 1R23A 2HOEA 5CJ9A 3HHHA 4IPAA 2OBPA 4IXAA 1H9TA 1TNSA 2MBFA 1W4MA 1BI0A 4UVBA 4HDUA 2DO7A 2L4MA 4P9FA 4G8XA 2L3DA 2EK5A 2RDPA 1U5TC 2G9WA 3AAFA 4IRGA 3VEPA 3MEXA 4I01A 2K4JA 2FMYA 2DPUA 2K02A 3IRQA 1JXSA 2F5DA 3JSOA 3F21A 1U5TB 1SMYF 2GWRA 1T39A 2OQRA 3BPXA 4ENMA 1XN7A 3Q9SA 4HZFA 3T0YA 4RB3C 5CVUA 1XSDA 3V4GA 3TOAA 4KMFA 1AOYA 1V3FA 4U0YA 3SQNA 3GX4X 1YFHA 5H6RA 2VT3A 3FZVA 5LHIA 3QPHA 4GYGA 4FT8A 1B59A 3SFZA 2HWVA 5D4RA 2GA2A 2D1VA 1R1UA 1QNTA 5FLXK 1ZRDA 4BH9A 1R5HA 2NRAC 3E5XA 5E1XA 3WE3A 4PDKA 2EV5A 3L00A 4KIBA 2K7LA 3I71A 4MNUA 4IJAA 1SAXA 2PEXA 2ACJA 1V4RA 1UB9A 5J8FA 3WG9A 1Z6TA 3LSTA 2EV0A 3PQJA 1G3WA 1HW2A 4IHTA 2DW4A 1FOKA 3MQ0A 1AWCA 4HV6A 1J9IA 4E70A 4WXDA 2A68F 1BIAA 3GEZA 4G6QA 2HQNA 4S04A 1HQCA 2VOPA 3F8FA 4I2OA 4HF2A 1F1ZA 5ICGA 3BWGA 3WTUC 4P96A 3DPLC 1BI3A 2HEOA 3P9KA 2K4BA 1HSTA 1R22A 2P5VA 4K2EA 1R36A 1S7AA 4RAYA 1LEBA 4ZZDA 1XDSA 2GQQA 3BP8A 5HDGA 2DI3A 1G3YA 2OQGA 2O0YA 3IL2A 2DT5A 4I02A 4OIOF 3R60A 4AD9A 1TQIA 4AIHA 3RI4A 2XAFA 2J5PA 4GCVA 4ON0A 1LQ1A 1KYWA 4EJWA 1UCRA 4OINF 5DCFA 4AIJA 2PLYA 2LF8A 4RB0A 4WF2A 1B4AA 1ONVA 5CVVA 1L3LA 3QU3A 3LFKA 2X4HA 4AWXB 3WTZA 2A6EF 1KU3A 4KDPA 3TDUC 2GAUA 5F1RA 2E7XA 1KQ8A 4L9JA 3FXUA 3DQVC 3F8CA 3M1EA 3RKXA 4HDVA 2Q0OA 4EJUA 1CF7B 2HKXA 1GXPA 2EJRA 5E8GA 2DAOA 2FRHA 1P92A 5JVTA 4ESJA 3H3UA 3ZPLA 2Z9OA 1BC7C 3I59A 1UHWA 1O3TA 2JPCA 3RYPA 1W5SA 3I54A 3I53A 5CVJA 3GUDA 4ENKA 2QENA 2NYXA 1QZYA 4IRHA 1J75A 2O61A 5LGNA 3L09A 2XVCA 4RGSA 1FPQA 2H09A 4ZYGA 3I59B 3LAPA 1FNNA 4ENJA 3TQNA 3I64A 3DFGA 4O5VA 3WGGA 3L7WA 3F8MA 2XAQA 2OZ6A 1GHCA 4Y13A 3RJPA 4A2UA 1FYLA 5JI6A 2QQ9A 4EV0A 4R8HA 1OR7A 2Z5UA 3E6CC 3WTXC 4AIKA 5D8LB 1YG2A 1OKRA 1XGMA 3CO6C 4HYEA 3Q5FA 3KZZA 3VFZA 1O7FA 4CYDA 1F5TA 2L4AA 3P7NA 1PP7U 3JSPA 2ZXJA 2VBWA 2IVMA 3BPVA 2BV6A 1XCVA 2F2EA 5K5RA 4KIGA 1ZLKA 3RPQA 2EFWA 3R4KA 1U78A 1MZBA 5DCMB 1PP8F 3BJOA 5DEQA 1IRGA 1WI9A 1KGSA 4U0WA 1LDDA 2O8XA 2FF4A 5BQTA 1VTNC 5H20A 2OU2A 3KLNA 5BPDA 2VT2A 1UFMA 1RZ4A 1WKMA 4N9IA 1TQPA 1EH8A 4ZYHA 5L3EA 3CO7C 5A2QK 2V79A 3SZPA 4CO8A 3RYRA 3ZMSA 5D5UB 3ZN1A 3KP2A 1HSJA 4M71A 4L9NA 4EM1A 4FHTA 1J7KA 3U2RA 4UV8A 3WTSC 3ZMVA 4CICA 1A04A 2F5EA 4RB1A 1YIOA 1D5VA 5LEJA 2LF7A 1KQ9A 2NNYA 2K86A 4M74A 5AONA 3KCCA 3FWEA 4L9TA 4EJTA 3ZP5A 3BJ6A 4G7HF 2OAZA 2Q2EA 4BAYA 5LHGA 1WRJA 5ILSA 4DNCA 4IHSA 2JSCA 2LKPA 1BOAA 4M6YA 1GXQA 4HX7A 1YW7A 3B73A 3O2PE 4Q47A 4LFUA 2QYOA 1L0OC 4HX8A 3MZYA 3FF5A 3KFWX 2FOKA 1IN7A 1F9NA 2H6BA 5HS8A 3BY6A 2Z33A 4WWCA 3FHZA 3V8JA 4N0BA 3WGHA 1KA8A 5K1YA 4AVPA 2E1CA 2BE5F 5E1WA 1I27A 4EJOA 2HYGD 3ULQB 1C0WA 1K79A 1T0FA 2GXBA 5HLHA 4LGWA 2V1UA 1FP2A 1OYIA 5ILUA 3J81Z 5F64A 5DUIA 2CSOA 2TDXA 4MQ9F 4YFKF 2R7DA 3Q9VA 4KIFA 2QWWA 1XGNA 3ECOA 4RGUA 2YX7A 2DK8A 4HA8A 1B6AA 3H92A 3M9AA 4OOIA 4MTDA 4A5NA 2UZKA 2M8EA 3OOPA 4ASNA 2EA4A 3GLXA 3DKWA 1QGPA 1Z1DA 1U5TA 4QWQA 1USSA 1IN6A 2ISZA 4UNOA 2ZNYA 3MCZA 1FWZA 2HKOA 4IF4A 5EEGA 4WCGA 3L2CA 4WXHA 3QOPA 3GZ6A 1EH6A 2PQ8A 2VXZA 1O3QA 1IN8A 1O3SA 4KN7X 2W84A 2CWEA 4U7DA 3TO9A 3WU0A 3J7AO 1J59A 1KU7A 3QPTA 2P5LC 4LK1F 3E6DA 3CUOA 5CYVA 1GVJA 2FMLA 2VONA 3ISPA 4KFCA 2VBXA 3S2WA 2O03A 4YG2F 1DUXC 1LEAA 1G4DA 4UV9A 4BNCA 4HF1A 3HOTA 2UXXA 3T8RA 4NQWA 5J6XA 3RKYA 1IUYA 4LB5A 2ZNZA 4HW0A 3JTHA 2DQLA 5TJJA 2QM3A 4G7ZF 4LLLA 2QQBA 3F23A 3WODF 2O6GE 4KMUX 4HOBA 4L9VA 2XIGA 3MAJA 1WQ2A 4YFNF 1TBXA 2JPBA 2IA0A 4LJZF 2Z99A 1HKTA 5DV5A 5KVRA 1NHAA 4G94A 2PFBA 4A0XA 2XV4S 3KLOA 3TGNA 1XSXA 2F5FA 4G6DA 4N9HA 3RIRA 1MJ9A 3RKWA 2CG4A 4MGRA 5K5QA 2ZBKA 1BI1A 3F3XA 2KIFA 2GXGA 2WV0A 1RUOA 4XRFA 2DLLA 2P4WA 3T8TA 3TDZC 1YYVA 2LNBA 3J80Z 1QPMA 1ZGJA 5DD8A 3WTYC 5D6EA 2YU3A 4U7BA 3IKTA 5BPIA 1JGSA 2F5CA 1SD7A 3ZN0A 2HQRA 4L18B 4MHGA 3HRUA 1IN4A 3K1PA 4PGHA 4CHUA 1YQAA 1ZRCA 3FXRA 4Q5SF 4CXFA 3LA3A 5HS9A 2D2WA 5AIQA 1CF7A 2V6CA 5JR3A 2EWNA 2IW5A 4A6DA 3T5XA 4OIPF 4Z2YA 3MZHA 3C18A 2W24A 4YIFA 2EFOA 4DQ2A 2ESNA 2B0LA 1XSVA 4O3MA 4MQVA 3FX3A 2L54A 2FQ3A 4BHCA 3ELKA 2VBZA 5FFZA 1G3SA 1U8RA 3ERED 3HYIA 5FD5A 1SMTA 2OZUA 4XLNF 2PMUA 3EETA 3ZMDA 2YSRA 2L01A 1D8KA 1R5GA 5IT3A 2VE9A 4H0EA 1SFUA 1IXSB 3E6MA 2CFXA 2DU9A 2WTEA 3VB2A 3ZMZA 1B9MA 4P9UA 5LRRA 4M9ZA 1ZN2A 4MEXF 2STWA 2JZYA 2M5WA 1ZG3A 2ZJ2A 2J5OA 2MLGA 4EM2A 4ENNA 4ZYEA 1YO5C 2HGCA 3E6BA 2FNPA 4OIRF 2BYVE 2HR3A 3I4PA 2P7VB 2P6TA 5D5XB 3K9TA 3PFIA 3BDDA 1O57A 2PJPA 2Y48A 4OU0A 4OMZA 4BQAA 4NHJA 2HFHA 4EQQA 4HQMA 1O7LA 3JAMK 1DDNA 3HRTA 1HKSA 2LDUA 1ON1A 1OPCA 5ERIA 5E17F 3WGIA 1MJBA 2M87A 4EGZA 1BBYA 1FBQA 2PN6A 1XGSA 1J2XA 4EVIA 4UUVA 4B09A 3ZMTA 3QP6A 2DQRA 4R1HA 1IF1A 1XB4A 1XMKA 5JHUA 5DCMA 1YS7A 4KT5C 4NB5A 4RB2C 5K5OA 2ISYA 1LDJA 4LLGF 2FBIA 3FMRA 1BJAA 1FBSA 3C1DA 4UXNA 4JK1X 4I7HA 4A0ZA 5FB2A 4HF0A 1CGPA 3FM3A 1ON2A 1TW3A 4OIQF 1MGTA 2MLKA 1YLFA 2FE3A 4BHBA 4L5IA 5HDNA 2WWYA 4OMYA 2EA2A 3K1NA 2W85A 2XAHA 1LVAA 1IAWA 2L02A 5D6FA 4F7ZA 3OV8A 1XMAA 1RI7A 2AS5F 2MC3A 3HHGA 1QBJA 4A12A 1Y0UA 2RC4A 1XDUA 2DTRA 1FP1D 4KNYA 2GIVA 3U1DA 1TNTA 4GO1A 4LMYA 4ETSA 2ZMEA 3RDIA 3DPTA 4B8XA 3FMQA 2DK5A 5HLGA 4LK0F 2PI0A 3E5UA 3GFJA 3LWFA 1QO0D 1ZH5A 2YX4A 3R61A 3BZ6A 4GGGA 3TO6A 4LD5A 3WTTC 4A6EA 4O6JA 1KU9A 1T6SA 4WX9A 3GXOA 3IWZA 2G7UA 2CQKA 1IXRC 1R00A 1EV7A 2VE8A 2ZMEB 1ZARA 5L3GA 1JHHA 4M73A 3KE2A 2D1HA 4IRIA 1X3UA 4ZH4F 5IT9Z 2FBHA 2VODA 2FNAA 5D5VB 2EFQA 3CUQB 1IRFA 3DXJF 1U3EM 3REOA 3SHFA 2HS5A 1B1BA 2P5KA 1YS6A 5E20A 1E2XA 1Q1HA 3I0TA 2Y75A 3COAC 3KEOA 4U0VA 3JW4A 2IRFG 3QAHA 4HLYA 1R58A 5LBQA 3R6SA 3FXQA 1T2KA 2QZ8A 3TKYA 2BEOA 2MH2A 3LQRA 3B02A 2XROA 1K7AA 4KA4A 4GYIA 2COMA 4G9YA 1ZHFA 1Z05A 2KJCA 3ZMUA 5LLQA 2RQPA 4RGRA 3HTSB 3L9FA 2OD5A 2ZO4A 1DPRA 3HSFA 4P55A 2EFNA 3K0LA 5LHHA 1REPC 2YR2A 1BI2A 1FC3A 3ML6A 5LEKA 4LG0B 4L5JA 2H6CA 2IA1A 2KKOA 5CVRA 1TTYA 5L3BA 2KRFA 1BIBA 2A5YB 3KP5A 4M6XA 2V9VA 3TO7A 4MTEA 2QQAA 1SFEA 5F6FA 2ETHA 1I6XA 2XKPA 4YIIA 1FLIA 3IWFA 1R1VA 3TOBA 1STZA 1ZG1A 4EJVA 1LDKB 2XAJA 3JTGA 2VC0A 2EFPA 1D8JA 2VOOA 2R3SA 1IN5A 3I5UA 3EQLF 1P4WA 3EDPA 1USTA 2CO5A 3DP7A 4U88A 3KP7A 4P5OA 2ELHA 2MA3A 2P7CB 1BC8C 2P6SA 4PGGA 4BXUA 2XASA 2Y0MA 1IZ1A 1RNLA 3GFLA 3GO5A 2H27A 3F6OA 2GA1A 3R0AA 1KYZA 4HAMA 5HVQC 1F4KA 3BJAA 1W7PB 1ZAOA 4A5MA 1LJ9A 3QU6A 2IPQX 5ED4A 4JQFA 5CLSA 3NRVA 4BHPA 2PG4A 3P9IA 1OYWA 1HW1A 1SFXA 1Z7UA 2NS0A 2A6HF 5BMZA 2CYYA 3H3ZA 1FSHA 2DBBA 4G7OF 1R1TA 1S3JA 1WSUA 4HQEA 3C7JA 2YPRA 3GW2A 3MFKA 1RUNA 5LGUA 1ZREA 4IVNA 1MD0A 2A61A 1EH7A 4RAZA 1FSEA 2D45A 3KP3A 1SD4A 2X0LA 3CLOA 3WTVC 3F8BA 4WXCA 3M7GA 5AIPA 5HS7A 1S7OA 4HBLA 1JE8A 4Q48A 4MEYF 2PBIA 2H94A 2BGCA 1FX7A 4M72A 3HUGA 2XHKA 1H9GA 2FXAA 1W7PD 2VN2A 1G6NA 1FZPB 1Z91A 3J80K 2XGXA 2RN7A 2W25A 2HZTA 5BS6A 5ILVA 3D5LA 1YW8A 2STTA 4R79A 5L3DA 2LSOA 3IRRA 4KUMA 1Z6RA 3RTRA 1FYMA 1TQMA 4PCQA 4I0BA 5FLXZ 3F6VA 1TW2A 1YTYA 4LLNA 3LQQA 5EEHA 5ICCA 2IP2A 2AXLA 2R7FA 1S6LA 3HIFA 3HTUA 1P4XA 4ESFA 2JTVA 2VC1A 3G3ZA 3WE2A 4A0YA 1MJAA 4HV5A 3ABTA 4LB6B 3E3VA 3E97A 1HBXG 1H0MA 4CDGA 5L3CA 4S05A 2EB7A 1ODDA 1RIOH 1BN5A 3BOQA 4CZZA 2ZCWA 2A3SA 1K78A 2KIUA 3V7SA 3CTAA 1DPUA 4I0AA 2G7HA 2ZFWA 4YFXF 1XD7A 1U2WA 2QVOA 2ESHA 3DF8A 2HDCA 2V1DA 3K1MA 2CGPA 2DPDA 1FYKA 5CVIA 3HOSA 1ZLJA 3GFMA 1YW9A 1XCBA 4WK8F 1K78B 5ICFA 2FU4A 3GVAA 1FY7A 2VBYA 3M8FA 3GYHX 3GZ5A 3P9CA 4BYYA 3N4MA 2NAZA 2MD5A 4Q4ZF 3C3WA 2BBYA 1R7JA 5TRDA 4KN4X 4XLPF 1LNWA 5L3FA 4EM0B 3KZYA 3ECHA 2OA4A 4PZJA 1ZRFA 1J0RA 2DFIA 2MH9A 3F22A 2Q8KA 3FM5A 4L0ZB 1SD6A 4HX4A 2RVCA 5H6QA 3QRFF 3BROA 3V7CA 3SZTA 1ZGAA 5DD4A 4L0YB 2HTSA 2RKHA 1IXCA 1ULYA 3QP5A 2RGVA 3VOEA 2NNNA 6PAXA 4ZYDA 4HLXA 3KP6A 2FA5A 5ICEA 3IHUA 2FSWA 3U9GA 3HSEA 5HLIA 4JBAA 2IT0A 4KYWA 4XBFA 2IJLA 3PQKA 2QLZA 3NEUA 2E7WA 1D3YA 1JHFA 4XSXF 1I1SA 2CW0F 2JRTA 3RPUA 3JAMZ 1U6GA 1S29A 3WTWC 1PUEE 2ADUA 3K69A 4FX4A 5FGMA 5J8CA 1ZYRF 3DV8A 3NQOA 3W6KB 1MKMA 3ABUA 1KQ0A 3GFIA 4RGXA 2M1BA 5D5WB 3ZQ7A 1ZG5A 1I1GA 2EV6A 1OMIA 3WU1B 4FX0A 5DUKA 3N97A 2QUFA 3EYYA 5E18F 1OYYA 5E8IA 5IT9K 2RNJA 3CUQA 4CGZA 3FMSA 3GWZA 1LB2A 1XGOA 5JFRA 5DYMA 2XRNA 3MWMA 3ROUA 3CUQC 2KIMA 3O6BB 1B9NA 1HKQA 1I5ZA 2K27A 1DP7P 4TV7A 3I58A 3R0JA 5HDKA 3G73A 3CDHA 5FO5A 1K6OA 2QBYA 3KEQA 2ZKZA 4M9SA 3GF2A 5E1ZB 1BM9A 4KICA 2W57A 5A2QZ 4D0PA 5DDGA 3M8EA 1QQIA 4EGYA 3HRSA 1IW7F 2WC2A 3O3KA 4M9XA 3LAJA 5KK1A 3V7RA 3J81K 4UHTA 4LG0A 2JT1A 1PDNC 2QBYB 2RV8A 1SD5A 2GZWA 4EMSA 1G3TA 2Z3YA 1T38A 3D0SA 1MDMA 1P4AA 3LA7A 2O3FA 1P6RA 3CJNA 2IA2A 3VODA 3F8NA 5LGTA 1E17A 4I98B 2XAGA 1QZZA 2FBKA 3DEUA 1O3RA 2XKOA 5D8KB 1UHMA 1HXDA 2KJBA 3KP4A 1T98A
chains in the Genus database with same CATH superfamily
3EUAA 3EYIA 2DMNA 3CJTB 2DJNA 1W5TA 2V1XA 5FRMA 1J5YA 3K2ZA 3HRMA 4GXOA 3T1BA 2QKMB 4ESBA 5HNHA 3V8LA 5BOXA 3F72A 1VQ9I 1Z9CA 2I10A 3W6JB 3FXLA 2AQFA 1MDMB 4RS8A 4B1RA 2UWMA 4CCOA 5B5EC 2HVQA 3ESWB 3RKQA 2C6YA 4D7NA 1A6IA 3K6GA 2LREA 5FD6A 3AG2H 2HYFA 1A35A 2VQHA 1FBUA 2P8TA 5HOOA 2E19A 3IC7A 4XSZF 5FFXA 5B1BH 2IS6A 2L7ZA 3CZ6A 3BG9A 5KAFC 5J40A 4ZZLA 3EUHA 2NXNB 1TLHB 3BQZA 3TEDA 5D4SA 4QLCU 2L2OA 3J7AY 1KU2A 2IGNA 2EZIA 3HEFA 1P7JA 4IHWA 1HW5A 2PMHA 2UXNA 3WG7H 2LH9A 1BW6A 1AKHA 1VF9A 1FT9A 1W7PA 2M45A 4NC7A 4Y17A 2XPUA 1M1EB 3SXYA 4Y15A 1POGA 3HSRA 2A69F 2FUG2 3IKVA 4E7JA 2XUBA 4UB6C 2HTJA 1YITI 4JOMA 3V8KA 4I09A 2E1NA 1P2FA 3LA2A 2I5UA 4RM2A 3KETA 3E5QA 3FIWA 1FEXA 2R4GA 1EKEA 2A07F 1S8NA 4UVAA 4UVCA 1WWXA 5LRSA 2FEZA 2M30A 3J7ZI 3RQ4A 1SVOA 1D5YA 3PSIA 1R23A 2HOEA 1IO2A 1UJ8A 1TWFJ 1WJFA 5CJ9A 3VPRA 3HHHA 4IPAA 2OBPA 1HCRA 2B9SA 4PJ0C 4IXAA 1H9TA 2W1OA 1TNSA 1JKPC 2MBFA 2V1NA 1W4MA 1BI0A 1Z67A 2VPRA 1ETQA 3TL4X 3K7AJ 1AKHB 3OYAA 4UVBA 4HDUA 2DO7A 2L4MA 3KPHA 4P9FA 3NWTA 2IS1A 4G8XA 2L3DA 1QVTA 2EK5A 1OFCX 1U5TC 2RDPA 4AYBN 2KZVA 9ANTA 2G9WA 2M34A 3AAFA 4IRGA 3VEPA 3MEXA 1X4OA 4I01A 4B47A 2K4JA 2FMYA 2DPUA 3H5AA 2NOGA 2K02A 2AHQA 3IRQA 4B4CA 1JXSA 2ZFUA 2CUFA 2F5DA 3JSOA 3F21A 1U5TB 1SMYF 2GWRA 1T39A 1TP4A 4B44A 2OQRA 2VASA 3BPXA 4ENMA 1XN7A 2DA7A 3Q9SA 2VKHA 4HZFA 3EUKL 3T0YA 4RB3C 5CVUA 1XSDA 3V4GA 2JA5J 1V55H 1X1DA 1Y1VJ 2K3PA 1IV6A 3TOAA 4C2TA 4KMFA 1AOYA 3LSIA 4E7LA 1V3FA 4U0YA 3SQNA 3GX4X 1YFHA 5H6RA 2W82A 2VT3A 3FZVA 3LMMA 1JKOC 1JJ6C 3AL0C 2HYJA 5LHIA 1KONA 3QPHA 4GYGA 1XC5A 4FT8A 1B59A 2LBFA 3SFZA 1GT0C 3K70C 2HWVA 1YX3A 5D4RA 3JRGA 2NVYJ 2GA2A 2CV2A 2D1VA 3JRAA 1R1UA 1QNTA 3FK7A 3OWTA 5FLXK 3OYLA 4BH9A 1ZRDA 4IOAF 3E0JB 1R5HA 1D0YA 2NRAC 2JVHA 3E5XA 5E1XA 3WE3A 4PDKA 2EV5A 4E7HA 3AL0B 3L00A 4KIBA 1HDDC 1ZK8A 2Q1ZB 2K7LA 1XS9A 5J1YA 3I71A 4MNUA 4XMYA 2ZXWH 4IJAA 1SAXA 1B72A 2PEXA 2ACJA 4N4OB 1V4RA 1UB9A 3BQYA 3BTJA 4LITA 3C2HA 5J8FA 3WG9A 1Z6TA 3LSTA 1ETVA 2O8KA 2EV0A 2HU9A 2BHYA 2CV1A 3PQJA 1TWCJ 3W2AA 1N75A 3BT9A 3OYIA 2LBFB 1G3WA 1HW2A 4IHTA 2DW4A 3ASOH 3MQ0A 1FOKA 1HOMA 4E7ZA 2P81A 1AWCA 4HV6A 2ICWG 1J9IA 4E70A 4WXDA 2A68F 1BIAA 3GEZA 3A03A 4G6QA 5FROA 4C2UA 2HQNA 1OQYA 4S04A 1HQCA 2VOPA 3F8FA 4I2OA 4HF2A 1F1ZA 1EJ9A 2VJJA 1N25A 5IP7J 2W4SA 5ICGA 3BWGA 2RNGA 3WTUC 1B72B 4P96A 3DPLC 1BI3A 4HPQA 2HEOA 1NK2P 3P9KA 1Z21A 2CH0A 2K4BA 1HSTA 2KIQA 2BW3B 1R22A 2P5VA 3M07A 2P0WA 4QSHA 3CC2I 4K2EA 1R36A 2X6WA 3IP4B 1OCTC 1S7AA 4RAYA 1R6RA 1LEBA 4ZZDA 1XDSA 2GQQA 2VJ4A 3BP8A 5HDGA 3LSKA 3L2RA 2DI3A 1G3YA 2OQGA 1FOXA 5IYDJ 2O0YA 3IL2A 2DT5A 4I02A 4OIOF 4KITB 3R60A 1WPKA 5J4VA 4BACA 4AD9A 1ITYA 1TQIA 5M3MJ 2ZJQF 4AIHA 3RI4A 2XAFA 2J5PA 4GCVA 4ON0A 2OUMA 4BDZA 1NH3A 1LQ1A 3H9GA 3UKGA 4QIWN 2EBIA 2NVXJ 2BZTA 5CKTA 1UHSA 1KYWA 4EJWA 3S2DJ 1UCRA 2OF7A 4OINF 1SAUA 2VQLA 5DCFA 4AIJA 2PLYA 2LF8A 4QPOA 4RB0A 4WF2A 1X19A 1RKWA 1B4AA 1ONVA 5CVVA 1L3LA 3HPGA 1Y6IA 3QU3A 3LFKA 2QA4I 1WJ5A 2X4HA 3KZIC 4AWXB 3A01A 2GXAA 5KCMA 3WTZA 1N77A 2ID6A 1HC8A 4BUPA 2ZJRF 2A6EF 1GVDA 1KU3A 5IY5H 5M5WJ 4A3MJ 4KDPA 3TDUC 2VIXA 3BR6A 2GAUA 1YJNI 2AXTC 4DBRA 1YJWI 5F08A 4XLHA 5F1RA 2E7XA 1KQ8A 3L2WA 4L9JA 3FXUA 3DQVC 3F8CA 3M1EA 3RKXA 4HDVA 2Q0OA 4EJUA 2HQ5A 4ITVA 1CF7B 2HKXA 4DZPA 1GXPA 3S1NJ 2EJRA 3O8GA 4JP0A 5E8GA 2DAOA 2FRHA 1P92A 3KYLA 2Z16A 4EEFG 5JVTA 4ESJA 1U8BA 3A1YA 3H3UA 3ZPLA 3W6VA 2QF7A 2Z9OA 3BR2A 2E5ZA 3I59A 1BC7C 1UHWA 1JUSA 1O3TA 2JPCA 3RYPA 1W5SA 5FKKA 1TZLA 3I54A 3I53A 1FIAA 2LMDA 3GUDA 5CVJA 1IG7A 2K9QA 5IP6A 4D9JA 4ENKA 2QENA 3WHBA 4Y52J 2NYXA 2EINH 1QZYA 1Y0NA 4IRHA 2K9LA 1J75A 2L7KA 1VFCA 2YS9A 2O61A 4QTRA 4F3QA 5LGNA 3L09A 2XVCA 4BQNA 3OL3A 4RGSA 2CFOA 1FPQA 2DA1A 2H09A 3PJRA 4D1QA 2Y31A 4CCLA 4ZYGA 4XK4A 3GTMJ 3LSGA 3I59B 2Z1DA 1JUPA 1WH7A 2JRMA 3LAPA 2E1OA 4F52A 1FNNA 2JN6A 3IV5A 1D0ZA 2DFFA 3I64A 3TQNA 4M3GA 3DFGA 4ENJA 2DXIA 2WADA 4O5VA 5FLMJ 3WGGA 2KQRA 3L7WA 3CC7I 1K83J 3F8MA 3U1KA 4S0HB 4MFDA 2XAQA 2R5YA 2OZ6A 3OYCA 2BXZA 1GHCA 4V2GA 4Y13A 2KT0A 4BY1J 1LKXA 3RJPA 4A2UA 1FYLA 5JI6A 1YE9A 4B3XA 2QQ9A 4EV0A 4R8HA 4JYKA 1OR7A 2Z5UA 2X6YA 3CCYA 3E6CC 3WTXC 4AIKA 2W00A 1A31A 2UV1A 2XF5A 3IAS2 5D8LB 4IQ4A 1YG2A 5IYCJ 1OKRA 3KYCB 3BG7A 1XGMA 3CO6C 1G2HA 3OMYA 4HYEA 4DOZA 1UG0A 3Q5FA 3KZZA 3VFZA 1O7FA 4CYDA 1F5TA 2L4AA 1VZ0A 3HKZA 1OR7C 3P7NA 4YEJA 1OCOH 1IV8A 2GOMA 1PP7U 3GZNB 4PFOA 3JSPA 1MH3A 4DIQA 2ZXJA 4RM3A 2VBWA 2IVMA 3BPVA 2VKEA 2BV6A 1XCVA 2F2EA 5F27A 4DW6A 5K5RA 4FE7A 2R5YB 4KIGA 1ZLKA 3BTCA 4FETA 3RPQA 3JRIA 3JRBA 2EFWA 5EDNA 3R4KA 2Y30A 1H89C 1U78A 4AUXA 1MZBA 1U0JA 5DCMB 3K4BA 2WAQA 4A3IJ 1PP8F 4IQJA 4X0GA 2HXIA 3BJOA 5F0HA 3DLLF 5DEQA 2K40A 1IRGA 1WI9A 1KGSA 4U0WA 1LDDA 2Y0SN 3CJQB 1JTYA 2O8XA 1LVKA 2FF4A 5BQTA 4PFPA 3G1MA 2LG4A 3S8PA 1MNEA 1VTNC 1JUMA 4F91B 5KNLA 1PUFB 1UG2A 4HEA2 5H20A 2OU2A 1V5GA 3KLNA 5BPDA 2MD0A 2VT2A 1W1WE 1UFMA 1RZ4A 3WU2C 1WKMA 1X2MA 4NC8A 4N9IA 3S15J 1BR1A 1TQPA 1EH8A 4ZYHA 5L3EA 3CO7C 3HL2A 4I99C 5A2QK 2KDOA 2V79A 3SZPA 4CO8A 3RYRA 1JTXA 1DU0A 3BG5A 3QWLA 3ZMSA 5D5UB 5E3MA 3EPZA 3ABMH 2KZGA 2WAFA 3ZN1A 4BU2A 4NNJA 2R7VA 3K4LA 3OR2C 3KP2A 2DA6A 4Y4RA 1HSJA 4M71A 4L9NA 3ZOBA 1MBGA 1SVMA 4EM1A 1FTTA 4FHTA 3S1QJ 1J7KA 3U2RA 2CS3A 4UV8A 3GBGA 4B3AA 2QSFX 4YRVA 1TL8A 5FKMA 3WTSC 3ZMVA 4CICA 1ORKA 1A04A 2F5EA 2N8GA 4RB1A 4G6TB 3TBIA 3OYDA 1YIOA 1WZ2A 1RKTA 3KEYA 4GFBA 1D5VA 2HPMA 5LEJA 1XPXA 2XC7A 3CMYA 2QSGX 2LF7A 1KQ9A 2NNYA 2K86A 4M74A 5IOYA 5AONA 3KCCA 3FWEA 2F4MB 4D7MA 3L1PA 2R93J 4L9TA 1YI2I 3HGYA 3SDBA 2IEKA 4EJTA 5F1JA 3ZP5A 3BJ6A 4G7HF 2FX0A 3SZGA 1DU6A 3MKZA 2OAZA 3SDGA 2Q2EA 2DYSH 2K9NA 4BAYA 3LFUA 5LHGA 1WRJA 5DM6F 2JA6J 1MBJA 1T95A 5ILSA 5B66C 4DNCA 2WBMA 4IHSA 3H1CA 2JSCA 2LKPA 1BOAA 3K4MA 4M6YA 1GXQA 4HX7A 2NS7A 1YW7A 4LG3A 3B73A 2LVSA 3O2PE 4Q47A 1YOVB 4LFUA 2QYOA 5K7FA 1L0OC 1WFXA 3DCFA 1I3AA 3HOYJ 1FOWA 3S1MJ 1JI8A 4LOCA 4HX8A 3FXJA 3MZYA 3FF5A 3KFWX 2FOKA 1RPWA 1IN7A 1F9NA 2DYRH 1DQUA 2F4IA 2H6BA 4BE1A 1TWGJ 5CQGA 2F4OB 5HS8A 3BY6A 2Z33A 4WWCA 4XIDA 3FHZA 2XF6A 4PJLA 3V8JA 4N0BA 2LY9A 1E3PA 3ABLH 2M8GX 3WGHA 1UAAA 1HDPA 1KA8A 2Y2ZA 5K1YA 4AVPA 2E1CA 2BE5F 4AYBA 2X1DA 5E1WA 1I27A 3E7LA 4EJOA 2HYGD 2GOXB 3ULQB 1C0WA 2LP0A 1NTCA 1K79A 1W0TA 1T0FA 2K85A 2LY1A 1D0XA 2GXBA 4AU7A 4PJMA 5HLHA 4LGWA 2V1UA 1FP2A 1OYIA 5ILUA 3J81Z 3CDIA 2CV0A 3BC8A 5F64A 5DUIA 1X3ZB 2CSOA 4BBRJ 4QPQA 1QA6A 2TDXA 4ZDLA 1T0FC 2DFHA 4MQ9F 4YFKF 3CP2A 2VXDA 4PK4A 1FTZA 2R7DA 3Q9VA 4KIFA 2QWWA 1XGNA 1D1AA 3ECOA 3QPLA 4RGUA 1R4NB 4JX4A 2YX7A 4XRSA 2DK8A 1OISA 3OR1C 4XOPA 3PNYA 3K4CA 2QGUA 4HA8A 1MSFC 3DBHB 1B6AA 3ZQFA 4ZTJA 5J1UA 3H92A 3M9AA 4OOIA 3H5RA 4MTDA 3HM5A 4FQGA 3TP0A 4A5NA 2KRCA 2UZKA 2XGEA 4XORA 4UUSA 2M8EA 3OOPA 4ASNA 5HNFA 1BR2A 4J01A 2LOOA 2WB1N 2QKLB 2V9PA 4IEJA 2EA4A 2VB6A 3GLXA 1J09A 3DKWA 1QGPA 2LKSA 1Z1DA 2JUGA 5M5XJ 4NDLA 2COBA 1E0EA 1I6HJ 1Y39A 3M8JA 1U5TA 4QWQA 1USSA 2F5VA 2LRDA 1IN6A 3TW7A 2R7XA 4PSWA 2ISZA 4UNOA 2ZNYA 3MCZA 2DMPA 1FWZA 4IKFA 2HKOA 4IF4A 1LFBA 5EEGA 3FKIJ 3MVPA 4XN3A 4WCGA 3L2CA 4WXHA 3QOPA 3AG4H 2MG4A 4E4HA 3GZ6A 1EH6A 2PQ8A 2X1CA 3OIQA 2VXZA 3W2VA 1IN8A 1FMVA 4UUSB 1O3QA 4BXXJ 1O3SA 1TT5B 2W84A 4KN7X 1D1BA 1WHUA 2W48A 2CWEA 2LFBA 3TO9A 3UNGC 4Z6YA 5H2FC 3WU0A 4U7DA 3Q0WA 1J59A 3J7AO 1KU7A 1MH4A 3X2QH 1ETOA 3QPTA 2P5LC 4RA2A 4LK1F 3PO3J 3E6DA 3BLYA 3HPHA 2EIMH 2DT7B 4J19A 4M3EA 4Y7NJ 1S7EA 3CUOA 5CYVA 3J7YJ 3S14J 1BW5A 1GVJA 2FMLA 2VONA 2BY0A 3ISPA 5EGOA 4C3IJ 4KFCA 2HI3A 2L9RA 2HVSA 2VBXA 1OCCH 3FBIB 3S2WA 2R7UA 1ZR4A 3OOUA 2CUZA 2O03A 4OAZA 4YG2F 3FKJA 1FJLA 5GPAA 1DUXC 1LEAA 2L7MP 1G4DA 4UV9A 4BNCA 4HF1A 1VQPI 3HOTA 4CH7A 2UXXA 3T8RA 2ZSIB 4NQWA 1Y8RB 5J6XA 2HPIA 3RKYA 1IUYA 5TGTA 2V4JC 2VKVA 1VQ7I 1NG6A 2V9KA 4DBQA 4LB5A 2JVGA 3ZQCA 2ZNZA 4HW0A 3JTHA 2DQLA 3RZDJ 5TJJA 4J00A 2QM3A 3MMYB 4G7ZF 1X4PA 5EGOB 3ZQQA 2GIZA 4LLLA 2ELKA 4E7SA 4A3EJ 1JJ8C 3VSLA 2OJED 2QQBA 3F23A 3WODF 3ZQLA 2O6GE 2WY7Q 3I4NJ 2VLAA 4KMUX 5J3LA 2LC2A 1H8AC 1D1CA 4XICA 4HOBA 2DA4A 4L9VA 1RRJA 2GBYA 2XIGA 3MAJA 1WQ2A 4YFNF 3RCOA 4BE0A 4A3KJ 4CUGA 3BTLA 3NARA 1TBXA 2B7EA 2BW3A 2JPBA 2HOTA 1XTAA 2IA0A 4LJZF 2Z99A 1HKTA 2BVLA 2EZHA 4NQWB 2CMPA 5DV5A 5KVRA 2M4KA 1MW7A 1NHAA 4G94A 2HVRA 2DODA 4B48A 5EEAA 3IUOA 4UB8C 2BXYA 3CCQI 2PFBA 4A0XA 4II3A 2XV4S 4PJNA 1OJLA 5FJ8J 2LY2A 3LSRA 3S93A 3OS1A 4HNVA 3KLOA 3CCVI 3TGNA 1XSXA 4F55A 2F5FA 4G6DA 4XLEA 4BL0B 4N9HA 3RIRA 4KT6A 4V2FA 2R5ZB 1MJ9A 3RKWA 2R7RA 2V6EA 2CG4A 2B63J 1RR7A 4MGRA 4DYRA 5K5QA 2ZBKA 1BI1A 3BTIA 3LL7A 3CCSI 2Y9ZA 5B1AH 3GTPJ 3F3XA 1IRZA 2KIFA 3VYRB 2GXGA 3AG1H 2L7FP 3GTKJ 2WV0A 1RUOA 3N05A 4XRFA 3OL4A 2DLLA 2P4WA 3PNTA 3T8TA 3TDZC 5K7HA 3JR9A 3OYKA 3HOXJ 1YYVA 4NBQA 3LSJA 2LNBA 3J80Z 1QPMA 3K4KA 1ZGJA 2FOWA 5DD8A 3WTYC 5D6EA 2LD5A 3FXMA 2YU3A 3W2WA 4U7BA 3IKTA 5BPIA 4PJJA 2DOEA 1JGSA 4XLCA 2F5CA 1SD7A 3ZN0A 5K7ZA 2HQRA 2X6OA 5KAIC 4L18B 4MHGA 3QOEA 4BJ6C 3G6EI 2HDDA 2DTZA 1IN4A 3HRUA 3K1PA 1QZEA 4PGHA 4CHUA 1WGXA 1YQAA 2R7ZJ 1X3WB 2KMUA 3FXRA 1ZRCA 4Q5SF 4CXFA 1A36A 3PUFA 1OLTA 3LA3A 5HS9A 4EATA 3QYFA 2D2WA 5AIQA 4BQOA 3HJEA 1LE8A 1CF7A 2V6CA 3DBLB 2VKDA 1X1CA 5JR3A 3GTOJ 2ELJA 2BY3A 2EWNA 2IW5A 5J1RA 3DKXA 4A6DA 3T5XA 2QSHX 2LKXA 2CJJA 2KDZA 5GAHJ 4LIUA 4OIPF 3A2KA 2IS4A 2HOSA 2PJRA 5FRNA 4KISA 2MYSA 4Z2YA 3MZHA 1ETWA 3C18A 2W24A 2X1EA 4YIFA 1IC8A 3HOZJ 2WA0A 2KP6A 2EFOA 4DQ2A 2ESNA 4B43A 3AKZA 2B0LA 1XSVA 4O3MA 4PSXA 4MQVA 3FX3A 1AHDP 2L54A 1QVUA 2WV1A 2FQ3A 2I8DA 4BHCA 3HOWJ 3ELKA 5GAEJ 2XGDA 2OPTA 1V54H 2VBZA 5FFZA 1G3SA 1U8RA 3ERED 1SANA 2CRGA 3HYIA 5FD5A 1SMTA 2OZUA 4XLNF 4E6KG 2PMUA 3EETA 1UELB 2YSRA 1Z3XA 3ZMDA 1LE8B 2L01A 2MABA 4RMNA 3FXKA 2HXOA 4GRIA 1ENHA 1D8KA 4CA0A 2X9DA 1R5GA 3HZJA 4DYQA 5IT3A 2VE9A 1S5LC 4H0EA 1WI3A 1SFUA 1GV2A 2PJRB 4ZC3A 1IXSB 3E6MA 2CFXA 2DU9A 2WTEA 3VB2A 3BR0A 3ZMZA 1B9MA 4P9UA 5LRRA 2O9LA 2VQCA 2HOAA 4M9ZA 2IS2A 1WVRA 1ZN2A 4MEXF 3ABKH 3CF2A 2IXSA 2STWA 1GLNA 2JZYA 2M5WA 3LSPA 1LFUP 4M6VA 1ZG3A 2GLOA 2ZJ2A 2J5OA 2MLGA 3OYJA 4EM2A 4FE4A 4ENNA 4ZYEA 1YO5C 2HGCA 3E6BA 2FNPA 4UY8I 4OIRF 2BYVE 2HR3A 1WJBA 3I4PA 2P7VB 4C3HJ 4RAGA 1MMSA 4AVZA 4RBOA 2P6TA 5D5XB 2O5RA 1MNMC 3K9TA 4AIDA 2Y0SA 3PFIA 3BDDA 1O57A 2PJPA 3M4OJ 5DS9A 3H36A 3KX2A 2LLKA 2Y48A 2F48A 4OU0A 4OMZA 4BQAA 4NHJA 2MC4A 2HFHA 4EQQA 4HQMA 1O7LA 3JAMK 1DDNA 2DN0A 3HRTA 1HKSA 2LDUA 1ON1A 1OPCA 1WCMJ 5J4YA 5ERIA 5E17F 4MIMA 2H1LA 2MGQA 4BKXA 3CCRI 3WGIA 1SVLA 1H88C 3L2UA 1MJBA 2M87A 4EGZA 1BBYA 1FBQA 2PN6A 3PL8A 2MSYA 1XGSA 1J2XA 1T33A 4EVIA 4UUVA 4B09A 3ZMTA 2IGOA 3QP6A 1K4SA 2DQRA 2OCEA 4R1HA 4XLAA 1SC7A 1IF1A 1ZTRA 2QEXI 2BOLA 1XB4A 4XONA 1XMKA 2DDBA 5JHUA 5M3FJ 5DCMA 1YS7A 5KHDA 2KISA 2XB5A 4KT5C 1KZHA 3I4MJ 4NB5A 3RZOJ 1OCPA 4RB2C 2CQQA 5K5OA 4A3JJ 3OY9A 1APLC 1MMGA 1QRYA 2ISYA 3UR3C 1LDJA 4LLGF 1T8IA 1JKRC 2R7SA 2FBIA 2BY1A 3ZQHA 4XQFA 1PUFA 3FMRA 3LSHA 1BJAA 2HNHA 1FBSA 3C1DA 2X85A 4UXNA 1AU7A 4JK1X 4I7HA 1VQ4I 1P9QC 4W97A 4NC6A 4A0ZA 3DLAA 3IH2A 5FB2A 3VWBA 4HF0A 3L2VA 1HA8A 1CGPA 3FM3A 1ON2A 3BG3A 3PUBA 2RAEA 1TW3A 4OIQF 1VQ5I 1MGTA 2MLKA 1MMNA 1YLFA 2FE3A 4BHBA 5GAGJ 4L5IA 1VQOI 5HDNA 3NAUA 1MBFA 3SFIA 1I39A 2WWYA 4OMYA 4OAYA 2EA2A 3K1NA 5FKOA 3FK6A 2W85A 5C3EJ 5F0FA 1Y1WJ 2XAHA 3H3VK 1LVAA 3VYTB 3RQIA 1IAWA 2L02A 5D6FA 2MW8A 4F7ZA 1VQNI 3IAM2 2KPMA 3W3CA 3OV8A 1MIJA 1XMAA 1RI7A 4CYCA 2AS5F 3OYMA 3L2QA 2AO9A 3VDXA 2OC6A 4C3JJ 5EZHA 2MC3A 3HHGA 1QBJA 4A12A 4MO7A 4X6AJ 1Y0UA 2RC4A 1XDUA 2DTRA 1FP1D 4KNYA 2GIVA 3U1DA 4XL9A 1TNTA 4GO1A 5E3LA 4A3GJ 4LMYA 5EF6A 4ETSA 2ZMEA 2D5VA 3RDIA 3DPTA 5TISC 4B8XA 4IZZA 3CQZJ 2HDWA 2DK5A 3FMQA 5HLGA 2VL8A 3PFYA 4CCMA 4LK0F 2PI0A 2X48A 3E5UA 2ZXIA 3GFJA 3LWFA 5CQEA 1QO0D 1ZH5A 2YX4A 1ETXA 2VPLA 2ZMEC 5J47A 3R61A 3BZ6A 4GGGA 3KYDB 3CCEI 3TO6A 4LD5A 1W5CC 3WTTC 4A6EA 1TWAJ 1XMXA 4XM3A 4A3CJ 1A5JA 1RC9A 3LNQA 4O6JA 4CYCB 1KU9A 1P7IA 3F9KA 5F04A 1T6SA 1DGRM 4WX9A 2ZJPF 2L9SA 3GXOA 3IWZA 2G7UA 2DA5A 3IH4A 2CQKA 1IXRC 1BJZA 2W7NA 1R00A 3OYFA 1EV7A 2VE8A 2ZMEB 1ZARA 5L3GA 3OYBA 1SFOJ 1JHHA 1R4MB 4M73A 3CC4I 4FISA 5JHFA 3Q0VA 3KE2A 2D1HA 2DT6A 4IRIA 1N78A 1X3UA 4ZH4F 5IT9Z 2FBHA 4XN0A 2VODA 3PM1A 2FNAA 5D5VB 3CUQB 2EFQA 5B3SH 1QHGA 1IRFA 2BVMA 3DXJF 4UUTA 4BJTA 1U3EM 4IO9F 1HF0A 1F36A 3S2HJ 2M9HA 3REOA 2HS5A 1B1BA 2P5KA 3SHFA 1YS6A 3HXLA 1E2XA 3D5SC 5E20A 3GTJJ 1TC3C 1Q1HA 3I0TA 2ECCA 2Y75A 3COAC 5DTDA 3AG3H 3KEOA 2ZXHA 3GLLA 4U0VA 3I3LA 2XSDC 3JW4A 5C4XJ 3GTQJ 2JA2A 4HNUA 2IRFG 3QAHA 2WB1A 3G71I 3RPUD 4HLYA 2GM4A 1R58A 3B6CA 1IDZA 5LBQA 3QYEA 3R6SA 5M5YJ 3FXQA 1T2KA 2E60A 3S3OA 2QZ8A 4C2MJ 3TKYA 2BEOA 4BXFA 2MH2A 3LQRA 3B02A 2XROA 2ECBA 1VQLI 2R7QA 3S1RJ 1YRNB 1K7AA 2YU9J 4MLOA 4KA4A 4GYIA 3BR1A 2DCEA 3AFHA 2COMA 1IDYA 3FXOA 3KIOA 4G9YA 1ZHFA 3I9V2 5GP9A 1YHQI 1Z05A 2DOFA 3VYSB 2KJCA 3ZMUA 2WAEA 3CMAI 5LLQA 2RQPA 4RGRA 3G1OA 2VUMJ 3GTLJ 3HTSB 3L9FA 2OD5A 1U9OA 2ZO4A 1DPRA 3HSFA 4P55A 1I50J 1MBKA 2EFNA 3K0LA 5LHHA 1REPC 2YR2A 2JA7J 1BI2A 2QCOA 1ZKGA 1FC3A 3ML6A 3OIPA 5LEKA 4LG0B 4L5JA 2JSPA 1E3HA 3MKYB 2H6CA 1PVEA 2IA1A 3CCMI 3S16J 3DKYA 2KKOA 1ETYA 1R5ID 2H8RA 4A3BJ 4LIVA 3MD2A 2OV7A 1BL0A 2A6TA 3M3YJ 3OYNA 5IPAA 5CVRA 2PMZN 3ZQGA 1TTYA 2LYCA 5L3BA 1VQ8I 1WJDA 2KRFA 1BIBA 4DGWB 4H4KC 2A5YB 2VJIA 3KP5A 3DEEA 4M6XA 2V9VA 5FLVA 3TO7A 4MTEA 2QQAA 1SFEA 2R92J 4BBSJ 5F6FA 2ETHA 1I6XA 2XKPA 4YIIA 1FLIA 3BCAA 3IWFA 5DM7F 5EG0A 3E1SA 1R1VA 3TOBA 1STZA 1ZG1A 1CQTA 4AC0A 4EJVA 2EZKA 4JX6A 1LDKB 2XAJA 3DU6A 3JTGA 2VC0A 3C2BA 2RREA 3EUHC 4XR6A 2EFPA 1D8JA 3CMEI 3IH3A 2VOOA 2R3SA 4YIRX 4G12A 2A05A 1YX5A 2XPWA 1IN5A 3I5UA 3EQLF 1P4WA 4M3DA 3EDPA 1USTA 2CO5A 3DP7A 4A93J 2L5QA 2BY2A 4U88A 3SYTA 4AM3A 3KP7A 4P5OA 2ELHA 2MA3A 2P7CB 1BC8C 3GMEA 5HLTA 2P6SA 2DFEA 4P1WA 4XKCA 4PGGA 3DTEA 1MSEC 4BXUA 2XASA 2Y0MA 1IZ1A 1RNLA 3GFLA 2IAIA 3G2BA 4CCJA 2R7TA 3GO5A 3QYBA 3I56I 2MFZA 3ZCOA 5CPRB 5EG0B 1ZGWA 1NG7A 1GUUA 2H27A 3A02A 3F6OA 2GA1A 1WJAA 3R0AA 1HLVA 1LUJB 2E5NA 2DMUA 5JLWA 1KYZA 1QHHD 4ZDOA 1LFPA 1WJEA 4HAMA 5HVQC 5HODA 3OSFA 3CLQA 3BJAA 1W7PB 1ZAOA 2AQEA 4BQQA 1F4KA 4XNFA 3BR5A 4A5MA 3K4NA 5EJCA 1LJ9A 3QU6A 1Z3YA 2IPQX 4F93B 5ED4A 4HNTA 4JQFA 1GV5A 2R7OA 3BR3A 1PYVA 5CLSA 3NRVA 2XSJC 1JT0A 2Z2SB 2E2JJ 3FISA 2KLOA 4BHPA 5E79C 2PG4A 3A4CA 3P9IA 2L9VA 1OYWA 4I76A 1HW1A 4U87A 1Z0XA 1BOBA 1UMQA 1SFXA 1Z7UA 2NS0A 2A6HF 5BMZA 2CYYA 3H3ZA 2V26A 1FSHA 4IOCF 1MBHA 2DDAA 1V5EA 2DBBA 4IX7A 2KFDA 3HDDA 3HOUJ 4G7OF 3ZXSA 1R1TA 1S3JA 1U9NA 3G4SI 1WSUA 4HSTA 4HQEA 3C7JA 2YPRA 3GW2A 3HGGA 1R71A 3MFKA 1RUNA 5LGUA 1ZREA 3SEQA 4BDYA 4CCNA 4DZJA 4BE2A 4ZJZA 4IVNA 1MD0A 2A61A 1MBEA 1EH7A 2ID3A 4FASD 4RAZA 1ZELA 1FSEA 2D45A 2VI6A 3KP3A 5BNGA 1SD4A 4IHXA 3B6AA 2X0LA 2JA8J 4XKVA 3CLOA 3WTVC 3F8BA 4WXCA 3Q3SA 3M7GA 5AIPA 5HS7A 1S7OA 4HBLA 1BR4A 3TMOA 1JE8A 1I3QJ 2FQ4A 1RETA 4Q48A 1X58A 4Y3OA 2R5ZA 2JUCA 4MEYF 2LTPA 2JWTA 2M0MA 3LSMA 2E1MC 3OYEA 2PBIA 3QODA 2ZC2A 2H94A 2BGCA 1FX7A 4M72A 2H1KA 3HUGA 2XHKA 3VSKA 3CD6I 3OYGA 1H9GA 2FXAA 3OS0A 1W7PD 2VN2A 4CCKA 4OWRB 1G6NA 3ZR8X 1FZPB 3MKLA 1Z91A 3A0BC 3K10A 3PNVA 2F6CA 3J80K 1SEUA 2XGXA 2RN7A 2W25A 2HZTA 5BS6A 5ILVA 1S72I 3D5LA 1YW8A 3H0GJ 2E2IJ 2STTA 2JMWA 2E71A 4R79A 5L3DA 1OCRH 2LSOA 3IRRA 1IJWC 2CUEA 2E1MB 4GDFA 4KUMA 4HSRA 1JT6A 1W36C 3DEWA 1ZQ3P 1Z6RA 2IGMA 2UUZA 2TCTA 3JRHA 2CW7A 3RTRA 1FYMA 3LOCA 1TQMA 4PCQA 2CW8A 2M4GA 4I0BA 3F6VA 5FLXZ 3CCLI 1TW2A 1YTYA 4LLNA 2XDVA 3LQQA 4BY7J 3OIOA 5EEHA 3HUGB 1X2NA 4L5EA 4F92B 5ICCA 3DPUA 2IP2A 2AXLA 2K9MA 2R7FA 1OCZH 1S6LA 3HIFA 3HTUA 4A3FJ 1P4XA 4ESFA 2X6XA 1TT0A 2X51A 3K4JA 2K3FA 3HBLA 3PO2J 1RESA 4C9YA 2KHMA 4MFEA 2JTVA 2VC1A 3G3ZA 3WE2A 4A0YA 1MJAA 4HV5A 3ABTA 4ZDPA 2DA3A 4D5CA 4LB6B 2EZLA 3E3VA 3E97A 3GCMA 2FJ1A 1HBXG 1X1BA 4W1UA 1H0MA 2XPVA 4CDGA 5L3CA 4S05A 2EB7A 3QPSA 1ODDA 1RIOH 1BN5A 3CMMA 2DMQA 4PUSA 4M3FA 3CCUI 3BOQA 4A3DJ 3O8HA 4CZZA 1E3OC 2CQ7A 3K70D 2ZCWA 1ACIA 3H35A 2CUJA 2A3SA 1K78A 3Q0UA 1Z7LA 2KIUA 3V7SA 3CTAA 1VQMI 4IHYA 1XX5A 1DPUA 4I0AA 2G7HA 2NVUB 4BS9A 3DBRB 3V42A 3JRDA 4ANJA 3M1CA 2K9SA 2ZFWA 3DTIA 4YFXF 1WH5A 1XD7A 2BHZA 5JLXA 4IHVA 1U2WA 2QVOA 2ESHA 1VNDA 3DF8A 4E7KA 5E3NA 1BA5A 2HDCA 2V1DA 1R9TJ 1MNDA 3K1MA 2CGPA 3I55I 4FCYA 1R49A 2DPDA 1FYKA 5CVIA 3HOSA 1W36D 3H9QA 1ZLJA 1XG1A 2CU7A 4ABZA 3GFMA 1YW9A 1XCBA 3CP8A 4WK8F 1K78B 5ICFA 3HB9A 2E2HJ 2FU4A 5E3OA 1LPQA 3D5RC 2CQNA 3ZQIA 5C44J 1ZR2A 1EF4A 3GVAA 1FY7A 2VBYA 3M8FA 5GTHC 1Y56A 1EA3A 3GYHX 3GZ5A 4JX5A 4XKWA 3P9CA 4BYYA 3N4MA 5GTIC 2NAZA 1FOYA 1Z77A 2MD5A 4Q4ZF 3C3WA 1B8IA 2BBYA 1R7JA 1S9HA 2JK3A 5TRDA 4RDUA 4KN4X 4XLPF 1LNWA 1ETKA 2LK2A 5GPCA 5L3FA 4Y33A 3A01B 3C2GA 4EM0B 2M2EA 2R0QC 3KZYA 5LD2C 2DMTA 3DU5A 1TWHJ 3ECHA 2OA4A 4PZJA 1ZRFA 1J0RA 2M0CA 2DFIA 2MH9A 3HOVJ 3F22A 2EIJH 2Q8KA 3DTKA 1Q1VA 4HRIA 1Y8QB 3FM5A 1SD6A 3F0CA 4L0ZB 4HX4A 1X1PA 2RVCA 2VQGA 5H6QA 4C30A 4HG2A 2HZDA 2ZSHB 3BROA 5FKNA 4XKBA 3V7CA 3QRFF 4ZTFA 3GTGJ 5F0CA 3SZTA 1ZGAA 5DD4A 2OTJI 1WJCA 1B8IB 2OCCH 2Y9YA 2M7AA 3PSFA 3JREA 4L0YB 2HTSA 2RKHA 1IXCA 5IP9J 1ULYA 4V19K 3BCBA 1V5FA 3QP5A 3HG9A 1K61A 2DA2A 1PJRA 3MN2A 4RAFA 2RGVA 2KL4A 5LFAA 3ASNH 2JQ7A 3VOEA 2NNNA 6PAXA 3HC7A 3NWSA 2HQAA 1MMDA 4ZYDA 2E36A 2YUSA 4HLXA 2LR8A 3KP6A 2DOAA 2FA5A 4IL6C 5ICEA 3IHUA 2FSWA 3U9GA 1QPIA 2XGCA 3D1NI 3WHCA 2ZB9A 3HSEA 5HLIA 1AA7A 1T08B 3DWLE 1SFKA 4JBAA 2ME6A 2IT0A 4KYWA 3VYUB 4XBFA 3ZGKA 2IJLA 3PQKA 2QLZA 3NEUA 2E7WA 1D3YA 1JHFA 4XSXF 4BGDA 1I1SA 5JVGF 2EPFA 1T56A 2CW0F 3SJMA 2JRTA 3RPUA 3JCUC 3JAMZ 1U6GA 1S29A 3WTWC 1PUEE 2VJ5A 2ADUA 2NS8A 2XF7A 3K69A 4FX4A 5FGMA 5J8CA 1ZYRF 2EILH 1W0UA 3DV8A 1VI0A 3NQOA 3W6KB 2WY8Q 3TP3A 3CESA 3U21A 1G59A 1MKMA 1VQ6I 1X1AA 4XRSG 3ABUA 4YELA 3PIPF 1FMWA 2K5CA 1KQ0A 1JKQC 3GFIA 1MMAA 3RSNA 2V7FA 2QQ8A 1UZCA 4RGXA 2M1BA 5D5WB 3ZQ7A 3S3MA 1ZG5A 1I1GA 2EV6A 2XB0X 1GDTA 1OMIA 3WU1B 4I6ZA 4II2A 3PIOF 2PX9A 2DJIA 4FX0A 4E7IA 5DUKA 3N97A 2O7OA 2QUFA 3EYYA 5E18F 1OYYA 2H8WA 3JRFA 4NUBA 1JGGA 5E8IA 5IT9K 2RNJA 3SEZA 3CUQA 4CGZA 3ZRGA 3FMSA 3GWZA 3H5NA 2NVQJ 3FBNB 1LB2A 3MKWB 1XGOA 5JFRA 3FDYA 2JJ7A 5DYMA 2E35A 1YIJI 2R7WA 2IBDA 1DP3A 4XLFA 2XRNA 3CDLA 5EYRA 3MWMA 4A3LJ 3ROUA 3CUQC 5GADJ 2KIMA 3O6BB 1B9NA 1HKQA 1I5ZA 2K27A 4A69C 4CZCA 1DP7P 2XRLA 4TV7A 3I58A 3R0JA 4DJAA 5HDKA 3G73A 2ME0A 2KRHA 2L9NA 1K6YA 3CDHA 5IOZA 3A0HC 4N4NB 5FO5A 4CSWA 4RLFA 3BZKA 3CJRB 1K6OA 4BEHA 1K4TA 2IGKA 2EQRA 4FTHA 2QBYA 3KEQA 2OTLI 2M3AA 3JRCA 2M7BA 4KJZA 3HKZN 3BG6A 1NK3P 2PMZA 1YRNA 2ZKZA 4M9SA 3GF2A 3S32A 5E1ZB 1BM9A 2EIKH 4KICA 3K2AA 2W57A 2XAUA 4X1EA 5A2QZ 4D0PA 3CF5F 5DDGA 1A6QA 3M8EA 5C4JJ 5IYBJ 1QQIA 4EGYA 3HRSA 1IW7F 5FKLA 1IUFA 2G0EA 3P5JA 1RR8C 2WC2A 3BZCA 3O3KA 1ERDA 2WAQN 4M9XA 1YJ9I 1FIPA 3LAJA 5KK1A 2E34A 3V7RA 3TW6A 3J81K 3H0DA 4DYCA 1QU3A 3OSGA 4M3BA 3FHNA 4UHTA 4BEHB 4LG0A 2TRTA 3QQAA 2NOJB 2JT1A 1PDNC 2QBYB 2RV8A 2L0KA 1SD5A 2GZWA 4RLQA 2RQQA 1G3TA 4EMSA 2Z3YA 2EH3A 4BJ5C 3D0SA 1T38A 1MDMA 2CQXA 4ZYAA 1P4AA 3LA7A 2NVTJ 2O3FA 2A5WA 1P6RA 1G8XA 3CJNA 2IA2A 3VODA 3F8NA 3H9JA 2FD5A 5LGTA 1E17A 4I98B 2XAGA 1QZZA 2FBKA 3DEUA 1O3RA 1O4XA 3ERMA 2XKOA 5D8KB 4XOTA 1UHMA 1IRXA 3MZ8A 1HXDA 3S3NA 2KJBA 5EZGA 3OYHA 3CCJI 3G1LA 3OS2A 3KP4A 4D5FA 1F43A 2Q2EB 1DGWY 4XRMA 1IGNA 1T98A 1VQKI 3S17J 3ONQA 2Y69H
chains in the Genus database with same CATH topology
3EYIA 1W5TA 2V1XA 1J5YA 3K2ZA 3HRMA 4GXOA 3T1BA 4ESBA 3V8LA 5BOXA 3F72A 1Z9CA 3W6JB 1MDMB 4RS8A 2UWMA 2C6YA 5FD6A 2HYFA 1FBUA 2P8TA 5HOOA 3IC7A 4XSZF 5FFXA 4ZZLA 3EUHA 1TLHB 5D4SA 4QLCU 1KU2A 1HW5A 2PMHA 2UXNA 1FT9A 1W7PA 2M45A 4Y17A 3SXYA 4Y15A 3HSRA 2A69F 3IKVA 2XUBA 2HTJA 3V8KA 4I09A 2E1NA 1P2FA 3LA2A 3KETA 3E5QA 2A07F 1S8NA 4UVAA 4UVCA 1WWXA 5LRSA 2FEZA 2M30A 1R23A 2HOEA 5CJ9A 3HHHA 4IPAA 2OBPA 4IXAA 1H9TA 1TNSA 2MBFA 1W4MA 1BI0A 4UVBA 4HDUA 2DO7A 2L4MA 4P9FA 4G8XA 2L3DA 2EK5A 2RDPA 1U5TC 2G9WA 3AAFA 4IRGA 3VEPA 3MEXA 4I01A 2K4JA 2FMYA 2DPUA 2K02A 3IRQA 1JXSA 2F5DA 3JSOA 3F21A 1U5TB 1SMYF 2GWRA 1T39A 2OQRA 3BPXA 4ENMA 1XN7A 3Q9SA 4HZFA 3T0YA 4RB3C 5CVUA 1XSDA 3V4GA 3TOAA 4KMFA 1AOYA 1V3FA 4U0YA 3SQNA 3GX4X 1YFHA 5H6RA 2VT3A 3FZVA 5LHIA 3QPHA 4GYGA 4FT8A 1B59A 3SFZA 2HWVA 5D4RA 2GA2A 2D1VA 1R1UA 1QNTA 5FLXK 1ZRDA 4BH9A 1R5HA 2NRAC 3E5XA 5E1XA 3WE3A 4PDKA 2EV5A 3L00A 4KIBA 2K7LA 3I71A 4MNUA 4IJAA 1SAXA 2PEXA 2ACJA 1V4RA 1UB9A 5J8FA 3WG9A 1Z6TA 3LSTA 2EV0A 3PQJA 1G3WA 1HW2A 4IHTA 2DW4A 1FOKA 3MQ0A 1AWCA 4HV6A 1J9IA 4E70A 4WXDA 2A68F 1BIAA 3GEZA 4G6QA 2HQNA 4S04A 1HQCA 2VOPA 3F8FA 4I2OA 4HF2A 1F1ZA 5ICGA 3BWGA 3WTUC 4P96A 3DPLC 1BI3A 2HEOA 3P9KA 2K4BA 1HSTA 1R22A 2P5VA 4K2EA 1R36A 1S7AA 4RAYA 1LEBA 4ZZDA 1XDSA 2GQQA 3BP8A 5HDGA 2DI3A 1G3YA 2OQGA 2O0YA 3IL2A 2DT5A 4I02A 4OIOF 3R60A 4AD9A 1TQIA 4AIHA 3RI4A 2XAFA 2J5PA 4GCVA 4ON0A 1LQ1A 1KYWA 4EJWA 1UCRA 4OINF 5DCFA 4AIJA 2PLYA 2LF8A 4RB0A 4WF2A 1B4AA 1ONVA 5CVVA 1L3LA 3QU3A 3LFKA 2X4HA 4AWXB 3WTZA 2A6EF 1KU3A 4KDPA 3TDUC 2GAUA 5F1RA 2E7XA 1KQ8A 4L9JA 3FXUA 3DQVC 3F8CA 3M1EA 3RKXA 4HDVA 2Q0OA 4EJUA 1CF7B 2HKXA 1GXPA 2EJRA 5E8GA 2DAOA 2FRHA 1P92A 5JVTA 4ESJA 3H3UA 3ZPLA 2Z9OA 1BC7C 3I59A 1UHWA 1O3TA 2JPCA 3RYPA 1W5SA 3I54A 3I53A 5CVJA 3GUDA 4ENKA 2QENA 2NYXA 1QZYA 4IRHA 1J75A 2O61A 5LGNA 3L09A 2XVCA 4RGSA 1FPQA 2H09A 4ZYGA 3I59B 3LAPA 1FNNA 4ENJA 3TQNA 3I64A 3DFGA 4O5VA 3WGGA 3L7WA 3F8MA 2XAQA 2OZ6A 1GHCA 4Y13A 3RJPA 4A2UA 1FYLA 5JI6A 2QQ9A 4EV0A 4R8HA 1OR7A 2Z5UA 3E6CC 3WTXC 4AIKA 5D8LB 1YG2A 1OKRA 1XGMA 3CO6C 4HYEA 3Q5FA 3KZZA 3VFZA 1O7FA 4CYDA 1F5TA 2L4AA 3P7NA 1PP7U 3JSPA 2ZXJA 2VBWA 2IVMA 3BPVA 2BV6A 1XCVA 2F2EA 5K5RA 4KIGA 1ZLKA 3RPQA 2EFWA 3R4KA 1U78A 1MZBA 5DCMB 1PP8F 3BJOA 5DEQA 1IRGA 1WI9A 1KGSA 4U0WA 1LDDA 2O8XA 2FF4A 5BQTA 1VTNC 5H20A 2OU2A 3KLNA 5BPDA 2VT2A 1UFMA 1RZ4A 1WKMA 4N9IA 1TQPA 1EH8A 4ZYHA 5L3EA 3CO7C 5A2QK 2V79A 3SZPA 4CO8A 3RYRA 3ZMSA 5D5UB 3ZN1A 3KP2A 1HSJA 4M71A 4L9NA 4EM1A 4FHTA 1J7KA 3U2RA 4UV8A 3WTSC 3ZMVA 4CICA 1A04A 2F5EA 4RB1A 1YIOA 1D5VA 5LEJA 2LF7A 1KQ9A 2NNYA 2K86A 4M74A 5AONA 3KCCA 3FWEA 4L9TA 4EJTA 3ZP5A 3BJ6A 4G7HF 2OAZA 2Q2EA 4BAYA 5LHGA 1WRJA 5ILSA 4DNCA 4IHSA 2JSCA 2LKPA 1BOAA 4M6YA 1GXQA 4HX7A 1YW7A 3B73A 3O2PE 4Q47A 4LFUA 2QYOA 1L0OC 4HX8A 3MZYA 3FF5A 3KFWX 2FOKA 1IN7A 1F9NA 2H6BA 5HS8A 3BY6A 2Z33A 4WWCA 3FHZA 3V8JA 4N0BA 3WGHA 1KA8A 5K1YA 4AVPA 2E1CA 2BE5F 5E1WA 1I27A 4EJOA 2HYGD 3ULQB 1C0WA 1K79A 1T0FA 2GXBA 5HLHA 4LGWA 2V1UA 1FP2A 1OYIA 5ILUA 3J81Z 5F64A 5DUIA 2CSOA 2TDXA 4MQ9F 4YFKF 2R7DA 3Q9VA 4KIFA 2QWWA 1XGNA 3ECOA 4RGUA 2YX7A 2DK8A 4HA8A 1B6AA 3H92A 3M9AA 4OOIA 4MTDA 4A5NA 2UZKA 2M8EA 3OOPA 4ASNA 2EA4A 3GLXA 3DKWA 1QGPA 1Z1DA 1U5TA 4QWQA 1USSA 1IN6A 2ISZA 4UNOA 2ZNYA 3MCZA 1FWZA 2HKOA 4IF4A 5EEGA 4WCGA 3L2CA 4WXHA 3QOPA 3GZ6A 1EH6A 2PQ8A 2VXZA 1O3QA 1IN8A 1O3SA 4KN7X 2W84A 2CWEA 4U7DA 3TO9A 3WU0A 3J7AO 1J59A 1KU7A 3QPTA 2P5LC 4LK1F 3E6DA 3CUOA 5CYVA 1GVJA 2FMLA 2VONA 3ISPA 4KFCA 2VBXA 3S2WA 2O03A 4YG2F 1DUXC 1LEAA 1G4DA 4UV9A 4BNCA 4HF1A 3HOTA 2UXXA 3T8RA 4NQWA 5J6XA 3RKYA 1IUYA 4LB5A 2ZNZA 4HW0A 3JTHA 2DQLA 5TJJA 2QM3A 4G7ZF 4LLLA 2QQBA 3F23A 3WODF 2O6GE 4KMUX 4HOBA 4L9VA 2XIGA 3MAJA 1WQ2A 4YFNF 1TBXA 2JPBA 2IA0A 4LJZF 2Z99A 1HKTA 5DV5A 5KVRA 1NHAA 4G94A 2PFBA 4A0XA 2XV4S 3KLOA 3TGNA 1XSXA 2F5FA 4G6DA 4N9HA 3RIRA 1MJ9A 3RKWA 2CG4A 4MGRA 5K5QA 2ZBKA 1BI1A 3F3XA 2KIFA 2GXGA 2WV0A 1RUOA 4XRFA 2DLLA 2P4WA 3T8TA 3TDZC 1YYVA 2LNBA 3J80Z 1QPMA 1ZGJA 5DD8A 3WTYC 5D6EA 2YU3A 4U7BA 3IKTA 5BPIA 1JGSA 2F5CA 1SD7A 3ZN0A 2HQRA 4L18B 4MHGA 3HRUA 1IN4A 3K1PA 4PGHA 4CHUA 1YQAA 1ZRCA 3FXRA 4Q5SF 4CXFA 3LA3A 5HS9A 2D2WA 5AIQA 1CF7A 2V6CA 5JR3A 2EWNA 2IW5A 4A6DA 3T5XA 4OIPF 4Z2YA 3MZHA 3C18A 2W24A 4YIFA 2EFOA 4DQ2A 2ESNA 2B0LA 1XSVA 4O3MA 4MQVA 3FX3A 2L54A 2FQ3A 4BHCA 3ELKA 2VBZA 5FFZA 1G3SA 1U8RA 3ERED 3HYIA 5FD5A 1SMTA 2OZUA 4XLNF 2PMUA 3EETA 3ZMDA 2YSRA 2L01A 1D8KA 1R5GA 5IT3A 2VE9A 4H0EA 1SFUA 1IXSB 3E6MA 2CFXA 2DU9A 2WTEA 3VB2A 3ZMZA 1B9MA 4P9UA 5LRRA 4M9ZA 1ZN2A 4MEXF 2STWA 2JZYA 2M5WA 1ZG3A 2ZJ2A 2J5OA 2MLGA 4EM2A 4ENNA 4ZYEA 1YO5C 2HGCA 3E6BA 2FNPA 4OIRF 2BYVE 2HR3A 3I4PA 2P7VB 2P6TA 5D5XB 3K9TA 3PFIA 3BDDA 1O57A 2PJPA 2Y48A 4OU0A 4OMZA 4BQAA 4NHJA 2HFHA 4EQQA 4HQMA 1O7LA 3JAMK 1DDNA 3HRTA 1HKSA 2LDUA 1ON1A 1OPCA 5ERIA 5E17F 3WGIA 1MJBA 2M87A 4EGZA 1BBYA 1FBQA 2PN6A 1XGSA 1J2XA 4EVIA 4UUVA 4B09A 3ZMTA 3QP6A 2DQRA 4R1HA 1IF1A 1XB4A 1XMKA 5JHUA 5DCMA 1YS7A 4KT5C 4NB5A 4RB2C 5K5OA 2ISYA 1LDJA 4LLGF 2FBIA 3FMRA 1BJAA 1FBSA 3C1DA 4UXNA 4JK1X 4I7HA 4A0ZA 5FB2A 4HF0A 1CGPA 3FM3A 1ON2A 1TW3A 4OIQF 1MGTA 2MLKA 1YLFA 2FE3A 4BHBA 4L5IA 5HDNA 2WWYA 4OMYA 2EA2A 3K1NA 2W85A 2XAHA 1LVAA 1IAWA 2L02A 5D6FA 4F7ZA 3OV8A 1XMAA 1RI7A 2AS5F 2MC3A 3HHGA 1QBJA 4A12A 1Y0UA 2RC4A 1XDUA 2DTRA 1FP1D 4KNYA 2GIVA 3U1DA 1TNTA 4GO1A 4LMYA 4ETSA 2ZMEA 3RDIA 3DPTA 4B8XA 3FMQA 2DK5A 5HLGA 4LK0F 2PI0A 3E5UA 3GFJA 3LWFA 1QO0D 1ZH5A 2YX4A 3R61A 3BZ6A 4GGGA 3TO6A 4LD5A 3WTTC 4A6EA 4O6JA 1KU9A 1T6SA 4WX9A 3GXOA 3IWZA 2G7UA 2CQKA 1IXRC 1R00A 1EV7A 2VE8A 2ZMEB 1ZARA 5L3GA 1JHHA 4M73A 3KE2A 2D1HA 4IRIA 1X3UA 4ZH4F 5IT9Z 2FBHA 2VODA 2FNAA 5D5VB 2EFQA 3CUQB 1IRFA 3DXJF 1U3EM 3REOA 3SHFA 2HS5A 1B1BA 2P5KA 1YS6A 5E20A 1E2XA 1Q1HA 3I0TA 2Y75A 3COAC 3KEOA 4U0VA 3JW4A 2IRFG 3QAHA 4HLYA 1R58A 5LBQA 3R6SA 3FXQA 1T2KA 2QZ8A 3TKYA 2BEOA 2MH2A 3LQRA 3B02A 2XROA 1K7AA 4KA4A 4GYIA 2COMA 4G9YA 1ZHFA 1Z05A 2KJCA 3ZMUA 5LLQA 2RQPA 4RGRA 3HTSB 3L9FA 2OD5A 2ZO4A 1DPRA 3HSFA 4P55A 2EFNA 3K0LA 5LHHA 1REPC 2YR2A 1BI2A 1FC3A 3ML6A 5LEKA 4LG0B 4L5JA 2H6CA 2IA1A 2KKOA 5CVRA 1TTYA 5L3BA 2KRFA 1BIBA 2A5YB 3KP5A 4M6XA 2V9VA 3TO7A 4MTEA 2QQAA 1SFEA 5F6FA 2ETHA 1I6XA 2XKPA 4YIIA 1FLIA 3IWFA 1R1VA 3TOBA 1STZA 1ZG1A 4EJVA 1LDKB 2XAJA 3JTGA 2VC0A 2EFPA 1D8JA 2VOOA 2R3SA 1IN5A 3I5UA 3EQLF 1P4WA 3EDPA 1USTA 2CO5A 3DP7A 4U88A 3KP7A 4P5OA 2ELHA 2MA3A 2P7CB 1BC8C 2P6SA 4PGGA 4BXUA 2XASA 2Y0MA 1IZ1A 1RNLA 3GFLA 3GO5A 2H27A 3F6OA 2GA1A 3R0AA 1KYZA 4HAMA 5HVQC 1F4KA 3BJAA 1W7PB 1ZAOA 4A5MA 1LJ9A 3QU6A 2IPQX 5ED4A 4JQFA 5CLSA 3NRVA 4BHPA 2PG4A 3P9IA 1OYWA 1HW1A 1SFXA 1Z7UA 2NS0A 2A6HF 5BMZA 2CYYA 3H3ZA 1FSHA 2DBBA 4G7OF 1R1TA 1S3JA 1WSUA 4HQEA 3C7JA 2YPRA 3GW2A 3MFKA 1RUNA 5LGUA 1ZREA 4IVNA 1MD0A 2A61A 1EH7A 4RAZA 1FSEA 2D45A 3KP3A 1SD4A 2X0LA 3CLOA 3WTVC 3F8BA 4WXCA 3M7GA 5AIPA 5HS7A 1S7OA 4HBLA 1JE8A 4Q48A 4MEYF 2PBIA 2H94A 2BGCA 1FX7A 4M72A 3HUGA 2XHKA 1H9GA 2FXAA 1W7PD 2VN2A 1G6NA 1FZPB 1Z91A 3J80K 2XGXA 2RN7A 2W25A 2HZTA 5BS6A 5ILVA 3D5LA 1YW8A 2STTA 4R79A 5L3DA 2LSOA 3IRRA 4KUMA 1Z6RA 3RTRA 1FYMA 1TQMA 4PCQA 4I0BA 5FLXZ 3F6VA 1TW2A 1YTYA 4LLNA 3LQQA 5EEHA 5ICCA 2IP2A 2AXLA 2R7FA 1S6LA 3HIFA 3HTUA 1P4XA 4ESFA 2JTVA 2VC1A 3G3ZA 3WE2A 4A0YA 1MJAA 4HV5A 3ABTA 4LB6B 3E3VA 3E97A 1HBXG 1H0MA 4CDGA 5L3CA 4S05A 2EB7A 1ODDA 1RIOH 1BN5A 3BOQA 4CZZA 2ZCWA 2A3SA 1K78A 2KIUA 3V7SA 3CTAA 1DPUA 4I0AA 2G7HA 2ZFWA 4YFXF 1XD7A 1U2WA 2QVOA 2ESHA 3DF8A 2HDCA 2V1DA 3K1MA 2CGPA 2DPDA 1FYKA 5CVIA 3HOSA 1ZLJA 3GFMA 1YW9A 1XCBA 4WK8F 1K78B 5ICFA 2FU4A 3GVAA 1FY7A 2VBYA 3M8FA 3GYHX 3GZ5A 3P9CA 4BYYA 3N4MA 2NAZA 2MD5A 4Q4ZF 3C3WA 2BBYA 1R7JA 5TRDA 4KN4X 4XLPF 1LNWA 5L3FA 4EM0B 3KZYA 3ECHA 2OA4A 4PZJA 1ZRFA 1J0RA 2DFIA 2MH9A 3F22A 2Q8KA 3FM5A 4L0ZB 1SD6A 4HX4A 2RVCA 5H6QA 3QRFF 3BROA 3V7CA 3SZTA 1ZGAA 5DD4A 4L0YB 2HTSA 2RKHA 1IXCA 1ULYA 3QP5A 2RGVA 3VOEA 2NNNA 6PAXA 4ZYDA 4HLXA 3KP6A 2FA5A 5ICEA 3IHUA 2FSWA 3U9GA 3HSEA 5HLIA 4JBAA 2IT0A 4KYWA 4XBFA 2IJLA 3PQKA 2QLZA 3NEUA 2E7WA 1D3YA 1JHFA 4XSXF 1I1SA 2CW0F 2JRTA 3RPUA 3JAMZ 1U6GA 1S29A 3WTWC 1PUEE 2ADUA 3K69A 4FX4A 5FGMA 5J8CA 1ZYRF 3DV8A 3NQOA 3W6KB 1MKMA 3ABUA 1KQ0A 3GFIA 4RGXA 2M1BA 5D5WB 3ZQ7A 1ZG5A 1I1GA 2EV6A 1OMIA 3WU1B 4FX0A 5DUKA 3N97A 2QUFA 3EYYA 5E18F 1OYYA 5E8IA 5IT9K 2RNJA 3CUQA 4CGZA 3FMSA 3GWZA 1LB2A 1XGOA 5JFRA 5DYMA 2XRNA 3MWMA 3ROUA 3CUQC 2KIMA 3O6BB 1B9NA 1HKQA 1I5ZA 2K27A 1DP7P 4TV7A 3I58A 3R0JA 5HDKA 3G73A 3CDHA 5FO5A 1K6OA 2QBYA 3KEQA 2ZKZA 4M9SA 3GF2A 5E1ZB 1BM9A 4KICA 2W57A 5A2QZ 4D0PA 5DDGA 3M8EA 1QQIA 4EGYA 3HRSA 1IW7F 2WC2A 3O3KA 4M9XA 3LAJA 5KK1A 3V7RA 3J81K 4UHTA 4LG0A 2JT1A 1PDNC 2QBYB 2RV8A 1SD5A 2GZWA 4EMSA 1G3TA 2Z3YA 1T38A 3D0SA 1MDMA 1P4AA 3LA7A 2O3FA 1P6RA 3CJNA 2IA2A 3VODA 3F8NA 5LGTA 1E17A 4I98B 2XAGA 1QZZA 2FBKA 3DEUA 1O3RA 2XKOA 5D8KB 1UHMA 1HXDA 2KJBA 3KP4A 1T98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EYI A;  1W5T A;  2V1X A;  1J5Y A;  3K2Z A;  3HRM A;  4GXO A;  3T1B A;  4ESB A;  3V8L A;  5BOX A;  3F72 A;  1Z9C A;  3W6J B;  1MDM B;  4RS8 A;  2UWM A;  2C6Y A;  5FD6 A;  2HYF A;  1FBU A;  2P8T A;  5HOO A;  3IC7 A;  4XSZ F;  5FFX A;  4ZZL A;  3EUH A;  1TLH B;  5D4S A;  4QLC U;  1KU2 A;  1HW5 A;  2PMH A;  2UXN A;  1FT9 A;  1W7P A;  2M45 A;  4Y17 A;  3SXY A;  4Y15 A;  3HSR A;  2A69 F;  3IKV A;  2XUB A;  2HTJ A;  3V8K A;  4I09 A;  2E1N A;  1P2F A;  3LA2 A;  3KET A;  3E5Q A;  2A07 F;  1S8N A;  4UVA A;  4UVC A;  1WWX A;  5LRS A;  2FEZ A;  2M30 A;  1R23 A;  2HOE A;  5CJ9 A;  3HHH A;  4IPA A;  2OBP A;  4IXA A;  1H9T A;  1TNS A;  2MBF A;  1W4M A;  1BI0 A;  4UVB A;  4HDU A;  2DO7 A;  2L4M A;  4P9F A;  4G8X A;  2L3D A;  2EK5 A;  2RDP A;  1U5T C;  2G9W A;  3AAF A;  4IRG A;  3VEP A;  3MEX A;  4I01 A;  2K4J A;  2FMY A;  2DPU A;  2K02 A;  3IRQ A;  1JXS A;  2F5D A;  3JSO A;  3F21 A;  1U5T B;  1SMY F;  2GWR A;  1T39 A;  2OQR A;  3BPX A;  4ENM A;  1XN7 A;  3Q9S A;  4HZF A;  3T0Y A;  4RB3 C;  5CVU A;  1XSD A;  3V4G A;  3TOA A;  4KMF A;  1AOY A;  1V3F A;  4U0Y A;  3SQN A;  3GX4 X;  1YFH A;  5H6R A;  2VT3 A;  3FZV A;  5LHI A;  3QPH A;  4GYG A;  4FT8 A;  1B59 A;  3SFZ A;  2HWV A;  5D4R A;  2GA2 A;  2D1V A;  1R1U A;  1QNT A;  5FLX K;  1ZRD A;  4BH9 A;  1R5H A;  2NRA C;  3E5X A;  5E1X A;  3WE3 A;  4PDK A;  2EV5 A;  3L00 A;  4KIB A;  2K7L A;  3I71 A;  4MNU A;  4IJA A;  1SAX A;  2PEX A;  2ACJ A;  1V4R A;  1UB9 A;  5J8F A;  3WG9 A;  1Z6T A;  3LST A;  2EV0 A;  3PQJ A;  1G3W A;  1HW2 A;  4IHT A;  2DW4 A;  1FOK A;  3MQ0 A;  1AWC A;  4HV6 A;  1J9I A;  4E70 A;  4WXD A;  2A68 F;  1BIA A;  3GEZ A;  4G6Q A;  2HQN A;  4S04 A;  1HQC A;  2VOP A;  3F8F A;  4I2O A;  4HF2 A;  1F1Z A;  5ICG A;  3BWG A;  3WTU C;  4P96 A;  3DPL C;  1BI3 A;  2HEO A;  3P9K A;  2K4B A;  1HST A;  1R22 A;  2P5V A;  4K2E A;  1R36 A;  1S7A A;  4RAY A;  1LEB A;  4ZZD A;  1XDS A;  2GQQ A;  3BP8 A;  5HDG A;  2DI3 A;  1G3Y A;  2OQG A;  2O0Y A;  3IL2 A;  2DT5 A;  4I02 A;  4OIO F;  3R60 A;  4AD9 A;  1TQI A;  4AIH A;  3RI4 A;  2XAF A;  2J5P A;  4GCV A;  4ON0 A;  1LQ1 A;  1KYW A;  4EJW A;  1UCR A;  4OIN F;  5DCF A;  4AIJ A;  2PLY A;  2LF8 A;  4RB0 A;  4WF2 A;  1B4A A;  1ONV A;  5CVV A;  1L3L A;  3QU3 A;  3LFK A;  2X4H A;  4AWX B;  3WTZ A;  2A6E F;  1KU3 A;  4KDP A;  3TDU C;  2GAU A;  5F1R A;  2E7X A;  1KQ8 A;  4L9J A;  3FXU A;  3DQV C;  3F8C A;  3M1E A;  3RKX A;  4HDV A;  2Q0O A;  4EJU A;  1CF7 B;  2HKX A;  1GXP A;  2EJR A;  5E8G A;  2DAO A;  2FRH A;  1P92 A;  5JVT A;  4ESJ A;  3H3U A;  3ZPL A;  2Z9O A;  1BC7 C;  3I59 A;  1UHW A;  1O3T A;  2JPC A;  3RYP A;  1W5S A;  3I54 A;  3I53 A;  5CVJ A;  3GUD A;  4ENK A;  2QEN A;  2NYX A;  1QZY A;  4IRH A;  1J75 A;  2O61 A;  5LGN A;  3L09 A;  2XVC A;  4RGS A;  1FPQ A;  2H09 A;  4ZYG A;  3I59 B;  3LAP A;  1FNN A;  4ENJ A;  3TQN A;  3I64 A;  3DFG A;  4O5V A;  3WGG A;  3L7W A;  3F8M A;  2XAQ A;  2OZ6 A;  1GHC A;  4Y13 A;  3RJP A;  4A2U A;  1FYL A;  5JI6 A;  2QQ9 A;  4EV0 A;  4R8H A;  1OR7 A;  2Z5U A;  3E6C C;  3WTX C;  4AIK A;  5D8L B;  1YG2 A;  1OKR A;  1XGM A;  3CO6 C;  4HYE A;  3Q5F A;  3KZZ A;  3VFZ A;  1O7F A;  4CYD A;  1F5T A;  2L4A A;  3P7N A;  1PP7 U;  3JSP A;  2ZXJ A;  2VBW A;  2IVM A;  3BPV A;  2BV6 A;  1XCV A;  2F2E A;  5K5R A;  4KIG A;  1ZLK A;  3RPQ A;  2EFW A;  3R4K A;  1U78 A;  1MZB A;  5DCM B;  1PP8 F;  3BJO A;  5DEQ A;  1IRG A;  1WI9 A;  1KGS A;  4U0W A;  1LDD A;  2O8X A;  2FF4 A;  5BQT A;  1VTN C;  5H20 A;  2OU2 A;  3KLN A;  5BPD A;  2VT2 A;  1UFM A;  1RZ4 A;  1WKM A;  4N9I A;  1TQP A;  1EH8 A;  4ZYH A;  5L3E A;  3CO7 C;  5A2Q K;  2V79 A;  3SZP A;  4CO8 A;  3RYR A;  3ZMS A;  5D5U B;  3ZN1 A;  3KP2 A;  1HSJ A;  4M71 A;  4L9N A;  4EM1 A;  4FHT A;  1J7K A;  3U2R A;  4UV8 A;  3WTS C;  3ZMV A;  4CIC A;  1A04 A;  2F5E A;  4RB1 A;  1YIO A;  1D5V A;  5LEJ A;  2LF7 A;  1KQ9 A;  2NNY A;  2K86 A;  4M74 A;  5AON A;  3KCC A;  3FWE A;  4L9T A;  4EJT A;  3ZP5 A;  3BJ6 A;  4G7H F;  2OAZ A;  2Q2E A;  4BAY A;  5LHG A;  1WRJ A;  5ILS A;  4DNC A;  4IHS A;  2JSC A;  2LKP A;  1BOA A;  4M6Y A;  1GXQ A;  4HX7 A;  1YW7 A;  3B73 A;  3O2P E;  4Q47 A;  4LFU A;  2QYO A;  1L0O C;  4HX8 A;  3MZY A;  3FF5 A;  3KFW X;  2FOK A;  1IN7 A;  1F9N A;  2H6B A;  5HS8 A;  3BY6 A;  2Z33 A;  4WWC A;  3FHZ A;  3V8J A;  4N0B A;  3WGH A;  1KA8 A;  5K1Y A;  4AVP A;  2E1C A;  2BE5 F;  5E1W A;  1I27 A;  4EJO A;  2HYG D;  3ULQ B;  1C0W A;  1K79 A;  1T0F A;  2GXB A;  5HLH A;  4LGW A;  2V1U A;  1FP2 A;  1OYI A;  5ILU A;  3J81 Z;  5F64 A;  5DUI A;  2CSO A;  2TDX A;  4MQ9 F;  4YFK F;  2R7D A;  3Q9V A;  4KIF A;  2QWW A;  1XGN A;  3ECO A;  4RGU A;  2YX7 A;  2DK8 A;  4HA8 A;  1B6A A;  3H92 A;  3M9A A;  4OOI A;  4MTD A;  4A5N A;  2UZK A;  2M8E A;  3OOP A;  4ASN A;  2EA4 A;  3GLX A;  3DKW A;  1QGP A;  1Z1D A;  1U5T A;  4QWQ A;  1USS A;  1IN6 A;  2ISZ A;  4UNO A;  2ZNY A;  3MCZ A;  1FWZ A;  2HKO A;  4IF4 A;  5EEG A;  4WCG A;  3L2C A;  4WXH A;  3QOP A;  3GZ6 A;  1EH6 A;  2PQ8 A;  2VXZ A;  1O3Q A;  1IN8 A;  1O3S A;  4KN7 X;  2W84 A;  2CWE A;  4U7D A;  3TO9 A;  3WU0 A;  3J7A O;  1J59 A;  1KU7 A;  3QPT A;  2P5L C;  4LK1 F;  3E6D A;  3CUO A;  5CYV A;  1GVJ A;  2FML A;  2VON A;  3ISP A;  4KFC A;  2VBX A;  3S2W A;  2O03 A;  4YG2 F;  1DUX C;  1LEA A;  1G4D A;  4UV9 A;  4BNC A;  4HF1 A;  3HOT A;  2UXX A;  3T8R A;  4NQW A;  5J6X A;  3RKY A;  1IUY A;  4LB5 A;  2ZNZ A;  4HW0 A;  3JTH A;  2DQL A;  5TJJ A;  2QM3 A;  4G7Z F;  4LLL A;  2QQB A;  3F23 A;  3WOD F;  2O6G E;  4KMU X;  4HOB A;  4L9V A;  2XIG A;  3MAJ A;  1WQ2 A;  4YFN F;  1TBX A;  2JPB A;  2IA0 A;  4LJZ F;  2Z99 A;  1HKT A;  5DV5 A;  5KVR A;  1NHA A;  4G94 A;  2PFB A;  4A0X A;  2XV4 S;  3KLO A;  3TGN A;  1XSX A;  2F5F A;  4G6D A;  4N9H A;  3RIR A;  1MJ9 A;  3RKW A;  2CG4 A;  4MGR A;  5K5Q A;  2ZBK A;  1BI1 A;  3F3X A;  2KIF A;  2GXG A;  2WV0 A;  1RUO A;  4XRF A;  2DLL A;  2P4W A;  3T8T A;  3TDZ C;  1YYV A;  2LNB A;  3J80 Z;  1QPM A;  1ZGJ A;  5DD8 A;  3WTY C;  5D6E A;  2YU3 A;  4U7B A;  3IKT A;  5BPI A;  1JGS A;  2F5C A;  1SD7 A;  3ZN0 A;  2HQR A;  4L18 B;  4MHG A;  3HRU A;  1IN4 A;  3K1P A;  4PGH A;  4CHU A;  1YQA A;  1ZRC A;  3FXR A;  4Q5S F;  4CXF A;  3LA3 A;  5HS9 A;  2D2W A;  5AIQ A;  1CF7 A;  2V6C A;  5JR3 A;  2EWN A;  2IW5 A;  4A6D A;  3T5X A;  4OIP F;  4Z2Y A;  3MZH A;  3C18 A;  2W24 A;  4YIF A;  2EFO A;  4DQ2 A;  2ESN A;  2B0L A;  1XSV A;  4O3M A;  4MQV A;  3FX3 A;  2L54 A;  2FQ3 A;  4BHC A;  3ELK A;  2VBZ A;  5FFZ A;  1G3S A;  1U8R A;  3ERE D;  3HYI A;  5FD5 A;  1SMT A;  2OZU A;  4XLN F;  2PMU A;  3EET A;  3ZMD A;  2YSR A;  2L01 A;  1D8K A;  1R5G A;  5IT3 A;  2VE9 A;  4H0E A;  1SFU A;  1IXS B;  3E6M A;  2CFX A;  2DU9 A;  2WTE A;  3VB2 A;  3ZMZ A;  1B9M A;  4P9U A;  5LRR A;  4M9Z A;  1ZN2 A;  4MEX F;  2STW A;  2JZY A;  2M5W A;  1ZG3 A;  2ZJ2 A;  2J5O A;  2MLG A;  4EM2 A;  4ENN A;  4ZYE A;  1YO5 C;  2HGC A;  3E6B A;  2FNP A;  4OIR F;  2BYV E;  2HR3 A;  3I4P A;  2P7V B;  2P6T A;  5D5X B;  3K9T A;  3PFI A;  3BDD A;  1O57 A;  2PJP A;  2Y48 A;  4OU0 A;  4OMZ A;  4BQA A;  4NHJ A;  2HFH A;  4EQQ A;  4HQM A;  1O7L A;  3JAM K;  1DDN A;  3HRT A;  1HKS A;  2LDU A;  1ON1 A;  1OPC A;  5ERI A;  5E17 F;  3WGI A;  1MJB A;  2M87 A;  4EGZ A;  1BBY A;  1FBQ A;  2PN6 A;  1XGS A;  1J2X A;  4EVI A;  4UUV A;  4B09 A;  3ZMT A;  3QP6 A;  2DQR A;  4R1H A;  1IF1 A;  1XB4 A;  1XMK A;  5JHU A;  5DCM A;  1YS7 A;  4KT5 C;  4NB5 A;  4RB2 C;  5K5O A;  2ISY A;  1LDJ A;  4LLG F;  2FBI A;  3FMR A;  1BJA A;  1FBS A;  3C1D A;  4UXN A;  4JK1 X;  4I7H A;  4A0Z A;  5FB2 A;  4HF0 A;  1CGP A;  3FM3 A;  1ON2 A;  1TW3 A;  4OIQ F;  1MGT A;  2MLK A;  1YLF A;  2FE3 A;  4BHB A;  4L5I A;  5HDN A;  2WWY A;  4OMY A;  2EA2 A;  3K1N A;  2W85 A;  2XAH A;  1LVA A;  1IAW A;  2L02 A;  5D6F A;  4F7Z A;  3OV8 A;  1XMA A;  1RI7 A;  2AS5 F;  2MC3 A;  3HHG A;  1QBJ A;  4A12 A;  1Y0U A;  2RC4 A;  1XDU A;  2DTR A;  1FP1 D;  4KNY A;  2GIV A;  3U1D A;  1TNT A;  4GO1 A;  4LMY A;  4ETS A;  2ZME A;  3RDI A;  3DPT A;  4B8X A;  3FMQ A;  2DK5 A;  5HLG A;  4LK0 F;  2PI0 A;  3E5U A;  3GFJ A;  3LWF A;  1QO0 D;  1ZH5 A;  2YX4 A;  3R61 A;  3BZ6 A;  4GGG A;  3TO6 A;  4LD5 A;  3WTT C;  4A6E A;  4O6J A;  1KU9 A;  1T6S A;  4WX9 A;  3GXO A;  3IWZ A;  2G7U A;  2CQK A;  1IXR C;  1R00 A;  1EV7 A;  2VE8 A;  2ZME B;  1ZAR A;  5L3G A;  1JHH A;  4M73 A;  3KE2 A;  2D1H A;  4IRI A;  1X3U A;  4ZH4 F;  5IT9 Z;  2FBH A;  2VOD A;  2FNA A;  5D5V B;  2EFQ A;  3CUQ B;  1IRF A;  3DXJ F;  1U3E M;  3REO A;  3SHF A;  2HS5 A;  1B1B A;  2P5K A;  1YS6 A;  5E20 A;  1E2X A;  1Q1H A;  3I0T A;  2Y75 A;  3COA C;  3KEO A;  4U0V A;  3JW4 A;  2IRF G;  3QAH A;  4HLY A;  1R58 A;  5LBQ A;  3R6S A;  3FXQ A;  1T2K A;  2QZ8 A;  3TKY A;  2BEO A;  2MH2 A;  3LQR A;  3B02 A;  2XRO A;  1K7A A;  4KA4 A;  4GYI A;  2COM A;  4G9Y A;  1ZHF A;  1Z05 A;  2KJC A;  3ZMU A;  5LLQ A;  2RQP A;  4RGR A;  3HTS B;  3L9F A;  2OD5 A;  2ZO4 A;  1DPR A;  3HSF A;  4P55 A;  2EFN A;  3K0L A;  5LHH A;  1REP C;  2YR2 A;  1BI2 A;  1FC3 A;  3ML6 A;  5LEK A;  4LG0 B;  4L5J A;  2H6C A;  2IA1 A;  2KKO A;  5CVR A;  1TTY A;  5L3B A;  2KRF A;  1BIB A;  2A5Y B;  3KP5 A;  4M6X A;  2V9V A;  3TO7 A;  4MTE A;  2QQA A;  1SFE A;  5F6F A;  2ETH A;  1I6X A;  2XKP A;  4YII A;  1FLI A;  3IWF A;  1R1V A;  3TOB A;  1STZ A;  1ZG1 A;  4EJV A;  1LDK B;  2XAJ A;  3JTG A;  2VC0 A;  2EFP A;  1D8J A;  2VOO A;  2R3S A;  1IN5 A;  3I5U A;  3EQL F;  1P4W A;  3EDP A;  1UST A;  2CO5 A;  3DP7 A;  4U88 A;  3KP7 A;  4P5O A;  2ELH A;  2MA3 A;  2P7C B;  1BC8 C;  2P6S A;  4PGG A;  4BXU A;  2XAS A;  2Y0M A;  1IZ1 A;  1RNL A;  3GFL A;  3GO5 A;  2H27 A;  3F6O A;  2GA1 A;  3R0A A;  1KYZ A;  4HAM A;  5HVQ C;  1F4K A;  3BJA A;  1W7P B;  1ZAO A;  4A5M A;  1LJ9 A;  3QU6 A;  2IPQ X;  5ED4 A;  4JQF A;  5CLS A;  3NRV A;  4BHP A;  2PG4 A;  3P9I A;  1OYW A;  1HW1 A;  1SFX A;  1Z7U A;  2NS0 A;  2A6H F;  5BMZ A;  2CYY A;  3H3Z A;  1FSH A;  2DBB A;  4G7O F;  1R1T A;  1S3J A;  1WSU A;  4HQE A;  3C7J A;  2YPR A;  3GW2 A;  3MFK A;  1RUN A;  5LGU A;  1ZRE A;  4IVN A;  1MD0 A;  2A61 A;  1EH7 A;  4RAZ A;  1FSE A;  2D45 A;  3KP3 A;  1SD4 A;  2X0L A;  3CLO A;  3WTV C;  3F8B A;  4WXC A;  3M7G A;  5AIP A;  5HS7 A;  1S7O A;  4HBL A;  1JE8 A;  4Q48 A;  4MEY F;  2PBI A;  2H94 A;  2BGC A;  1FX7 A;  4M72 A;  3HUG A;  2XHK A;  1H9G A;  2FXA A;  1W7P D;  2VN2 A;  1G6N A;  1FZP B;  1Z91 A;  3J80 K;  2XGX A;  2RN7 A;  2W25 A;  2HZT A;  5BS6 A;  5ILV A;  3D5L A;  1YW8 A;  2STT A;  4R79 A;  5L3D A;  2LSO A;  3IRR A;  4KUM A;  1Z6R A;  3RTR A;  1FYM A;  1TQM A;  4PCQ A;  4I0B A;  5FLX Z;  3F6V A;  1TW2 A;  1YTY A;  4LLN A;  3LQQ A;  5EEH A;  5ICC A;  2IP2 A;  2AXL A;  2R7F A;  1S6L A;  3HIF A;  3HTU A;  1P4X A;  4ESF A;  2JTV A;  2VC1 A;  3G3Z A;  3WE2 A;  4A0Y A;  1MJA A;  4HV5 A;  3ABT A;  4LB6 B;  3E3V A;  3E97 A;  1HBX G;  1H0M A;  4CDG A;  5L3C A;  4S05 A;  2EB7 A;  1ODD A;  1RIO H;  1BN5 A;  3BOQ A;  4CZZ A;  2ZCW A;  2A3S A;  1K78 A;  2KIU A;  3V7S A;  3CTA A;  1DPU A;  4I0A A;  2G7H A;  2ZFW A;  4YFX F;  1XD7 A;  1U2W A;  2QVO A;  2ESH A;  3DF8 A;  2HDC A;  2V1D A;  3K1M A;  2CGP A;  2DPD A;  1FYK A;  5CVI A;  3HOS A;  1ZLJ A;  3GFM A;  1YW9 A;  1XCB A;  4WK8 F;  1K78 B;  5ICF A;  2FU4 A;  3GVA A;  1FY7 A;  2VBY A;  3M8F A;  3GYH X;  3GZ5 A;  3P9C A;  4BYY A;  3N4M A;  2NAZ A;  2MD5 A;  4Q4Z F;  3C3W A;  2BBY A;  1R7J A;  5TRD A;  4KN4 X;  4XLP F;  1LNW A;  5L3F A;  4EM0 B;  3KZY A;  3ECH A;  2OA4 A;  4PZJ A;  1ZRF A;  1J0R A;  2DFI A;  2MH9 A;  3F22 A;  2Q8K A;  3FM5 A;  4L0Z B;  1SD6 A;  4HX4 A;  2RVC A;  5H6Q A;  3QRF F;  3BRO A;  3V7C A;  3SZT A;  1ZGA A;  5DD4 A;  4L0Y B;  2HTS A;  2RKH A;  1IXC A;  1ULY A;  3QP5 A;  2RGV A;  3VOE A;  2NNN A;  6PAX A;  4ZYD A;  4HLX A;  3KP6 A;  2FA5 A;  5ICE A;  3IHU A;  2FSW A;  3U9G A;  3HSE A;  5HLI A;  4JBA A;  2IT0 A;  4KYW A;  4XBF A;  2IJL A;  3PQK A;  2QLZ A;  3NEU A;  2E7W A;  1D3Y A;  1JHF A;  4XSX F;  1I1S A;  2CW0 F;  2JRT A;  3RPU A;  3JAM Z;  1U6G A;  1S29 A;  3WTW C;  1PUE E;  2ADU A;  3K69 A;  4FX4 A;  5FGM A;  5J8C A;  1ZYR F;  3DV8 A;  3NQO A;  3W6K B;  1MKM A;  3ABU A;  1KQ0 A;  3GFI A;  4RGX A;  2M1B A;  5D5W B;  3ZQ7 A;  1ZG5 A;  1I1G A;  2EV6 A;  1OMI A;  3WU1 B;  4FX0 A;  5DUK A;  3N97 A;  2QUF A;  3EYY A;  5E18 F;  1OYY A;  5E8I A;  5IT9 K;  2RNJ A;  3CUQ A;  4CGZ A;  3FMS A;  3GWZ A;  1LB2 A;  1XGO A;  5JFR A;  5DYM A;  2XRN A;  3MWM A;  3ROU A;  3CUQ C;  2KIM A;  3O6B B;  1B9N A;  1HKQ A;  1I5Z A;  2K27 A;  1DP7 P;  4TV7 A;  3I58 A;  3R0J A;  5HDK A;  3G73 A;  3CDH A;  5FO5 A;  1K6O A;  2QBY A;  3KEQ A;  2ZKZ A;  4M9S A;  3GF2 A;  5E1Z B;  1BM9 A;  4KIC A;  2W57 A;  5A2Q Z;  4D0P A;  5DDG A;  3M8E A;  1QQI A;  4EGY A;  3HRS A;  1IW7 F;  2WC2 A;  3O3K A;  4M9X A;  3LAJ A;  5KK1 A;  3V7R A;  3J81 K;  4UHT A;  4LG0 A;  2JT1 A;  1PDN C;  2QBY B;  2RV8 A;  1SD5 A;  2GZW A;  4EMS A;  1G3T A;  2Z3Y A;  1T38 A;  3D0S A;  1MDM A;  1P4A A;  3LA7 A;  2O3F A;  1P6R A;  3CJN A;  2IA2 A;  3VOD A;  3F8N A;  5LGT A;  1E17 A;  4I98 B;  2XAG A;  1QZZ A;  2FBK A;  3DEU A;  1O3R A;  2XKO A;  5D8K B;  1UHM A;  1HXD A;  2KJB A;  3KP4 A;  1T98 A; 
#chains in the Genus database with same CATH topology
 3EUA A;  3EYI A;  2DMN A;  3CJT B;  2DJN A;  1W5T A;  2V1X A;  5FRM A;  1J5Y A;  3K2Z A;  3HRM A;  4GXO A;  3T1B A;  2QKM B;  4ESB A;  5HNH A;  3V8L A;  5BOX A;  3F72 A;  1VQ9 I;  1Z9C A;  2I10 A;  3W6J B;  3FXL A;  2AQF A;  1MDM B;  4RS8 A;  4B1R A;  2UWM A;  4CCO A;  5B5E C;  2HVQ A;  3ESW B;  3RKQ A;  2C6Y A;  4D7N A;  1A6I A;  3K6G A;  2LRE A;  5FD6 A;  3AG2 H;  2HYF A;  1A35 A;  2VQH A;  1FBU A;  2P8T A;  5HOO A;  2E19 A;  3IC7 A;  4XSZ F;  5FFX A;  5B1B H;  2IS6 A;  2L7Z A;  3CZ6 A;  3BG9 A;  5KAF C;  5J40 A;  4ZZL A;  3EUH A;  2NXN B;  1TLH B;  3BQZ A;  3TED A;  5D4S A;  4QLC U;  2L2O A;  3J7A Y;  1KU2 A;  2IGN A;  2EZI A;  3HEF A;  1P7J A;  4IHW A;  1HW5 A;  2PMH A;  2UXN A;  3WG7 H;  2LH9 A;  1BW6 A;  1AKH A;  1VF9 A;  1FT9 A;  1W7P A;  2M45 A;  4NC7 A;  4Y17 A;  2XPU A;  1M1E B;  3SXY A;  4Y15 A;  1POG A;  3HSR A;  2A69 F;  2FUG 2;  3IKV A;  4E7J A;  2XUB A;  4UB6 C;  2HTJ A;  1YIT I;  4JOM A;  3V8K A;  4I09 A;  2E1N A;  1P2F A;  3LA2 A;  2I5U A;  4RM2 A;  3KET A;  3E5Q A;  3FIW A;  1FEX A;  2R4G A;  1EKE A;  2A07 F;  1S8N A;  4UVA A;  4UVC A;  1WWX A;  5LRS A;  2FEZ A;  2M30 A;  3J7Z I;  3RQ4 A;  1SVO A;  1D5Y A;  3PSI A;  1R23 A;  2HOE A;  1IO2 A;  1UJ8 A;  1TWF J;  1WJF A;  5CJ9 A;  3VPR A;  3HHH A;  4IPA A;  2OBP A;  1HCR A;  2B9S A;  4PJ0 C;  4IXA A;  1H9T A;  2W1O A;  1TNS A;  1JKP C;  2MBF A;  2V1N A;  1W4M A;  1BI0 A;  1Z67 A;  2VPR A;  1ETQ A;  3TL4 X;  3K7A J;  1AKH B;  3OYA A;  4UVB A;  4HDU A;  2DO7 A;  2L4M A;  3KPH A;  4P9F A;  3NWT A;  2IS1 A;  4G8X A;  2L3D A;  1QVT A;  2EK5 A;  1OFC X;  1U5T C;  2RDP A;  4AYB N;  2KZV A;  9ANT A;  2G9W A;  2M34 A;  3AAF A;  4IRG A;  3VEP A;  3MEX A;  1X4O A;  4I01 A;  4B47 A;  2K4J A;  2FMY A;  2DPU A;  3H5A A;  2NOG A;  2K02 A;  2AHQ A;  3IRQ A;  4B4C A;  1JXS A;  2ZFU A;  2CUF A;  2F5D A;  3JSO A;  3F21 A;  1U5T B;  1SMY F;  2GWR A;  1T39 A;  1TP4 A;  4B44 A;  2OQR A;  2VAS A;  3BPX A;  4ENM A;  1XN7 A;  2DA7 A;  3Q9S A;  2VKH A;  4HZF A;  3EUK L;  3T0Y A;  4RB3 C;  5CVU A;  1XSD A;  3V4G A;  2JA5 J;  1V55 H;  1X1D A;  1Y1V J;  2K3P A;  1IV6 A;  3TOA A;  4C2T A;  4KMF A;  1AOY A;  3LSI A;  4E7L A;  1V3F A;  4U0Y A;  3SQN A;  3GX4 X;  1YFH A;  5H6R A;  2W82 A;  2VT3 A;  3FZV A;  3LMM A;  1JKO C;  1JJ6 C;  3AL0 C;  2HYJ A;  5LHI A;  1KON A;  3QPH A;  4GYG A;  1XC5 A;  4FT8 A;  1B59 A;  2LBF A;  3SFZ A;  1GT0 C;  3K70 C;  2HWV A;  1YX3 A;  5D4R A;  3JRG A;  2NVY J;  2GA2 A;  2CV2 A;  2D1V A;  3JRA A;  1R1U A;  1QNT A;  3FK7 A;  3OWT A;  5FLX K;  3OYL A;  4BH9 A;  1ZRD A;  4IOA F;  3E0J B;  1R5H A;  1D0Y A;  2NRA C;  2JVH A;  3E5X A;  5E1X A;  3WE3 A;  4PDK A;  2EV5 A;  4E7H A;  3AL0 B;  3L00 A;  4KIB A;  1HDD C;  1ZK8 A;  2Q1Z B;  2K7L A;  1XS9 A;  5J1Y A;  3I71 A;  4MNU A;  4XMY A;  2ZXW H;  4IJA A;  1SAX A;  1B72 A;  2PEX A;  2ACJ A;  4N4O B;  1V4R A;  1UB9 A;  3BQY A;  3BTJ A;  4LIT A;  3C2H A;  5J8F A;  3WG9 A;  1Z6T A;  3LST A;  1ETV A;  2O8K A;  2EV0 A;  2HU9 A;  2BHY A;  2CV1 A;  3PQJ A;  1TWC J;  3W2A A;  1N75 A;  3BT9 A;  3OYI A;  2LBF B;  1G3W A;  1HW2 A;  4IHT A;  2DW4 A;  3ASO H;  3MQ0 A;  1FOK A;  1HOM A;  4E7Z A;  2P81 A;  1AWC A;  4HV6 A;  2ICW G;  1J9I A;  4E70 A;  4WXD A;  2A68 F;  1BIA A;  3GEZ A;  3A03 A;  4G6Q A;  5FRO A;  4C2U A;  2HQN A;  1OQY A;  4S04 A;  1HQC A;  2VOP A;  3F8F A;  4I2O A;  4HF2 A;  1F1Z A;  1EJ9 A;  2VJJ A;  1N25 A;  5IP7 J;  2W4S A;  5ICG A;  3BWG A;  2RNG A;  3WTU C;  1B72 B;  4P96 A;  3DPL C;  1BI3 A;  4HPQ A;  2HEO A;  1NK2 P;  3P9K A;  1Z21 A;  2CH0 A;  2K4B A;  1HST A;  2KIQ A;  2BW3 B;  1R22 A;  2P5V A;  3M07 A;  2P0W A;  4QSH A;  3CC2 I;  4K2E A;  1R36 A;  2X6W A;  3IP4 B;  1OCT C;  1S7A A;  4RAY A;  1R6R A;  1LEB A;  4ZZD A;  1XDS A;  2GQQ A;  2VJ4 A;  3BP8 A;  5HDG A;  3LSK A;  3L2R A;  2DI3 A;  1G3Y A;  2OQG A;  1FOX A;  5IYD J;  2O0Y A;  3IL2 A;  2DT5 A;  4I02 A;  4OIO F;  4KIT B;  3R60 A;  1WPK A;  5J4V A;  4BAC A;  4AD9 A;  1ITY A;  1TQI A;  5M3M J;  2ZJQ F;  4AIH A;  3RI4 A;  2XAF A;  2J5P A;  4GCV A;  4ON0 A;  2OUM A;  4BDZ A;  1NH3 A;  1LQ1 A;  3H9G A;  3UKG A;  4QIW N;  2EBI A;  2NVX J;  2BZT A;  5CKT A;  1UHS A;  1KYW A;  4EJW A;  3S2D J;  1UCR A;  2OF7 A;  4OIN F;  1SAU A;  2VQL A;  5DCF A;  4AIJ A;  2PLY A;  2LF8 A;  4QPO A;  4RB0 A;  4WF2 A;  1X19 A;  1RKW A;  1B4A A;  1ONV A;  5CVV A;  1L3L A;  3HPG A;  1Y6I A;  3QU3 A;  3LFK A;  2QA4 I;  1WJ5 A;  2X4H A;  3KZI C;  4AWX B;  3A01 A;  2GXA A;  5KCM A;  3WTZ A;  1N77 A;  2ID6 A;  1HC8 A;  4BUP A;  2ZJR F;  2A6E F;  1GVD A;  1KU3 A;  5IY5 H;  5M5W J;  4A3M J;  4KDP A;  3TDU C;  2VIX A;  3BR6 A;  2GAU A;  1YJN I;  2AXT C;  4DBR A;  1YJW I;  5F08 A;  4XLH A;  5F1R A;  2E7X A;  1KQ8 A;  3L2W A;  4L9J A;  3FXU A;  3DQV C;  3F8C A;  3M1E A;  3RKX A;  4HDV A;  2Q0O A;  4EJU A;  2HQ5 A;  4ITV A;  1CF7 B;  2HKX A;  4DZP A;  1GXP A;  3S1N J;  2EJR A;  3O8G A;  4JP0 A;  5E8G A;  2DAO A;  2FRH A;  1P92 A;  3KYL A;  2Z16 A;  4EEF G;  5JVT A;  4ESJ A;  1U8B A;  3A1Y A;  3H3U A;  3ZPL A;  3W6V A;  2QF7 A;  2Z9O A;  3BR2 A;  2E5Z A;  3I59 A;  1BC7 C;  1UHW A;  1JUS A;  1O3T A;  2JPC A;  3RYP A;  1W5S A;  5FKK A;  1TZL A;  3I54 A;  3I53 A;  1FIA A;  2LMD A;  3GUD A;  5CVJ A;  1IG7 A;  2K9Q A;  5IP6 A;  4D9J A;  4ENK A;  2QEN A;  3WHB A;  4Y52 J;  2NYX A;  2EIN H;  1QZY A;  1Y0N A;  4IRH A;  2K9L A;  1J75 A;  2L7K A;  1VFC A;  2YS9 A;  2O61 A;  4QTR A;  4F3Q A;  5LGN A;  3L09 A;  2XVC A;  4BQN A;  3OL3 A;  4RGS A;  2CFO A;  1FPQ A;  2DA1 A;  2H09 A;  3PJR A;  4D1Q A;  2Y31 A;  4CCL A;  4ZYG A;  4XK4 A;  3GTM J;  3LSG A;  3I59 B;  2Z1D A;  1JUP A;  1WH7 A;  2JRM A;  3LAP A;  2E1O A;  4F52 A;  1FNN A;  2JN6 A;  3IV5 A;  1D0Z A;  2DFF A;  3I64 A;  3TQN A;  4M3G A;  3DFG A;  4ENJ A;  2DXI A;  2WAD A;  4O5V A;  5FLM J;  3WGG A;  2KQR A;  3L7W A;  3CC7 I;  1K83 J;  3F8M A;  3U1K A;  4S0H B;  4MFD A;  2XAQ A;  2R5Y A;  2OZ6 A;  3OYC A;  2BXZ A;  1GHC A;  4V2G A;  4Y13 A;  2KT0 A;  4BY1 J;  1LKX A;  3RJP A;  4A2U A;  1FYL A;  5JI6 A;  1YE9 A;  4B3X A;  2QQ9 A;  4EV0 A;  4R8H A;  4JYK A;  1OR7 A;  2Z5U A;  2X6Y A;  3CCY A;  3E6C C;  3WTX C;  4AIK A;  2W00 A;  1A31 A;  2UV1 A;  2XF5 A;  3IAS 2;  5D8L B;  4IQ4 A;  1YG2 A;  5IYC J;  1OKR A;  3KYC B;  3BG7 A;  1XGM A;  3CO6 C;  1G2H A;  3OMY A;  4HYE A;  4DOZ A;  1UG0 A;  3Q5F A;  3KZZ A;  3VFZ A;  1O7F A;  4CYD A;  1F5T A;  2L4A A;  1VZ0 A;  3HKZ A;  1OR7 C;  3P7N A;  4YEJ A;  1OCO H;  1IV8 A;  2GOM A;  1PP7 U;  3GZN B;  4PFO A;  3JSP A;  1MH3 A;  4DIQ A;  2ZXJ A;  4RM3 A;  2VBW A;  2IVM A;  3BPV A;  2VKE A;  2BV6 A;  1XCV A;  2F2E A;  5F27 A;  4DW6 A;  5K5R A;  4FE7 A;  2R5Y B;  4KIG A;  1ZLK A;  3BTC A;  4FET A;  3RPQ A;  3JRI A;  3JRB A;  2EFW A;  5EDN A;  3R4K A;  2Y30 A;  1H89 C;  1U78 A;  4AUX A;  1MZB A;  1U0J A;  5DCM B;  3K4B A;  2WAQ A;  4A3I J;  1PP8 F;  4IQJ A;  4X0G A;  2HXI A;  3BJO A;  5F0H A;  3DLL F;  5DEQ A;  2K40 A;  1IRG A;  1WI9 A;  1KGS A;  4U0W A;  1LDD A;  2Y0S N;  3CJQ B;  1JTY A;  2O8X A;  1LVK A;  2FF4 A;  5BQT A;  4PFP A;  3G1M A;  2LG4 A;  3S8P A;  1MNE A;  1VTN C;  1JUM A;  4F91 B;  5KNL A;  1PUF B;  1UG2 A;  4HEA 2;  5H20 A;  2OU2 A;  1V5G A;  3KLN A;  5BPD A;  2MD0 A;  2VT2 A;  1W1W E;  1UFM A;  1RZ4 A;  3WU2 C;  1WKM A;  1X2M A;  4NC8 A;  4N9I A;  3S15 J;  1BR1 A;  1TQP A;  1EH8 A;  4ZYH A;  5L3E A;  3CO7 C;  3HL2 A;  4I99 C;  5A2Q K;  2KDO A;  2V79 A;  3SZP A;  4CO8 A;  3RYR A;  1JTX A;  1DU0 A;  3BG5 A;  3QWL A;  3ZMS A;  5D5U B;  5E3M A;  3EPZ A;  3ABM H;  2KZG A;  2WAF A;  3ZN1 A;  4BU2 A;  4NNJ A;  2R7V A;  3K4L A;  3OR2 C;  3KP2 A;  2DA6 A;  4Y4R A;  1HSJ A;  4M71 A;  4L9N A;  3ZOB A;  1MBG A;  1SVM A;  4EM1 A;  1FTT A;  4FHT A;  3S1Q J;  1J7K A;  3U2R A;  2CS3 A;  4UV8 A;  3GBG A;  4B3A A;  2QSF X;  4YRV A;  1TL8 A;  5FKM A;  3WTS C;  3ZMV A;  4CIC A;  1ORK A;  1A04 A;  2F5E A;  2N8G A;  4RB1 A;  4G6T B;  3TBI A;  3OYD A;  1YIO A;  1WZ2 A;  1RKT A;  3KEY A;  4GFB A;  1D5V A;  2HPM A;  5LEJ A;  1XPX A;  2XC7 A;  3CMY A;  2QSG X;  2LF7 A;  1KQ9 A;  2NNY A;  2K86 A;  4M74 A;  5IOY A;  5AON A;  3KCC A;  3FWE A;  2F4M B;  4D7M A;  3L1P A;  2R93 J;  4L9T A;  1YI2 I;  3HGY A;  3SDB A;  2IEK A;  4EJT A;  5F1J A;  3ZP5 A;  3BJ6 A;  4G7H F;  2FX0 A;  3SZG A;  1DU6 A;  3MKZ A;  2OAZ A;  3SDG A;  2Q2E A;  2DYS H;  2K9N A;  4BAY A;  3LFU A;  5LHG A;  1WRJ A;  5DM6 F;  2JA6 J;  1MBJ A;  1T95 A;  5ILS A;  5B66 C;  4DNC A;  2WBM A;  4IHS A;  3H1C A;  2JSC A;  2LKP A;  1BOA A;  3K4M A;  4M6Y A;  1GXQ A;  4HX7 A;  2NS7 A;  1YW7 A;  4LG3 A;  3B73 A;  2LVS A;  3O2P E;  4Q47 A;  1YOV B;  4LFU A;  2QYO A;  5K7F A;  1L0O C;  1WFX A;  3DCF A;  1I3A A;  3HOY J;  1FOW A;  3S1M J;  1JI8 A;  4LOC A;  4HX8 A;  3FXJ A;  3MZY A;  3FF5 A;  3KFW X;  2FOK A;  1RPW A;  1IN7 A;  1F9N A;  2DYR H;  1DQU A;  2F4I A;  2H6B A;  4BE1 A;  1TWG J;  5CQG A;  2F4O B;  5HS8 A;  3BY6 A;  2Z33 A;  4WWC A;  4XID A;  3FHZ A;  2XF6 A;  4PJL A;  3V8J A;  4N0B A;  2LY9 A;  1E3P A;  3ABL H;  2M8G X;  3WGH A;  1UAA A;  1HDP A;  1KA8 A;  2Y2Z A;  5K1Y A;  4AVP A;  2E1C A;  2BE5 F;  4AYB A;  2X1D A;  5E1W A;  1I27 A;  3E7L A;  4EJO A;  2HYG D;  2GOX B;  3ULQ B;  1C0W A;  2LP0 A;  1NTC A;  1K79 A;  1W0T A;  1T0F A;  2K85 A;  2LY1 A;  1D0X A;  2GXB A;  4AU7 A;  4PJM A;  5HLH A;  4LGW A;  2V1U A;  1FP2 A;  1OYI A;  5ILU A;  3J81 Z;  3CDI A;  2CV0 A;  3BC8 A;  5F64 A;  5DUI A;  1X3Z B;  2CSO A;  4BBR J;  4QPQ A;  1QA6 A;  2TDX A;  4ZDL A;  1T0F C;  2DFH A;  4MQ9 F;  4YFK F;  3CP2 A;  2VXD A;  4PK4 A;  1FTZ A;  2R7D A;  3Q9V A;  4KIF A;  2QWW A;  1XGN A;  1D1A A;  3ECO A;  3QPL A;  4RGU A;  1R4N B;  4JX4 A;  2YX7 A;  4XRS A;  2DK8 A;  1OIS A;  3OR1 C;  4XOP A;  3PNY A;  3K4C A;  2QGU A;  4HA8 A;  1MSF C;  3DBH B;  1B6A A;  3ZQF A;  4ZTJ A;  5J1U A;  3H92 A;  3M9A A;  4OOI A;  3H5R A;  4MTD A;  3HM5 A;  4FQG A;  3TP0 A;  4A5N A;  2KRC A;  2UZK A;  2XGE A;  4XOR A;  4UUS A;  2M8E A;  3OOP A;  4ASN A;  5HNF A;  1BR2 A;  4J01 A;  2LOO A;  2WB1 N;  2QKL B;  2V9P A;  4IEJ A;  2EA4 A;  2VB6 A;  3GLX A;  1J09 A;  3DKW A;  1QGP A;  2LKS A;  1Z1D A;  2JUG A;  5M5X J;  4NDL A;  2COB A;  1E0E A;  1I6H J;  1Y39 A;  3M8J A;  1U5T A;  4QWQ A;  1USS A;  2F5V A;  2LRD A;  1IN6 A;  3TW7 A;  2R7X A;  4PSW A;  2ISZ A;  4UNO A;  2ZNY A;  3MCZ A;  2DMP A;  1FWZ A;  4IKF A;  2HKO A;  4IF4 A;  1LFB A;  5EEG A;  3FKI J;  3MVP A;  4XN3 A;  4WCG A;  3L2C A;  4WXH A;  3QOP A;  3AG4 H;  2MG4 A;  4E4H A;  3GZ6 A;  1EH6 A;  2PQ8 A;  2X1C A;  3OIQ A;  2VXZ A;  3W2V A;  1IN8 A;  1FMV A;  4UUS B;  1O3Q A;  4BXX J;  1O3S A;  1TT5 B;  2W84 A;  4KN7 X;  1D1B A;  1WHU A;  2W48 A;  2CWE A;  2LFB A;  3TO9 A;  3UNG C;  4Z6Y A;  5H2F C;  3WU0 A;  4U7D A;  3Q0W A;  1J59 A;  3J7A O;  1KU7 A;  1MH4 A;  3X2Q H;  1ETO A;  3QPT A;  2P5L C;  4RA2 A;  4LK1 F;  3PO3 J;  3E6D A;  3BLY A;  3HPH A;  2EIM H;  2DT7 B;  4J19 A;  4M3E A;  4Y7N J;  1S7E A;  3CUO A;  5CYV A;  3J7Y J;  3S14 J;  1BW5 A;  1GVJ A;  2FML A;  2VON A;  2BY0 A;  3ISP A;  5EGO A;  4C3I J;  4KFC A;  2HI3 A;  2L9R A;  2HVS A;  2VBX A;  1OCC H;  3FBI B;  3S2W A;  2R7U A;  1ZR4 A;  3OOU A;  2CUZ A;  2O03 A;  4OAZ A;  4YG2 F;  3FKJ A;  1FJL A;  5GPA A;  1DUX C;  1LEA A;  2L7M P;  1G4D A;  4UV9 A;  4BNC A;  4HF1 A;  1VQP I;  3HOT A;  4CH7 A;  2UXX A;  3T8R A;  2ZSI B;  4NQW A;  1Y8R B;  5J6X A;  2HPI A;  3RKY A;  1IUY A;  5TGT A;  2V4J C;  2VKV A;  1VQ7 I;  1NG6 A;  2V9K A;  4DBQ A;  4LB5 A;  2JVG A;  3ZQC A;  2ZNZ A;  4HW0 A;  3JTH A;  2DQL A;  3RZD J;  5TJJ A;  4J00 A;  2QM3 A;  3MMY B;  4G7Z F;  1X4P A;  5EGO B;  3ZQQ A;  2GIZ A;  4LLL A;  2ELK A;  4E7S A;  4A3E J;  1JJ8 C;  3VSL A;  2OJE D;  2QQB A;  3F23 A;  3WOD F;  3ZQL A;  2O6G E;  2WY7 Q;  3I4N J;  2VLA A;  4KMU X;  5J3L A;  2LC2 A;  1H8A C;  1D1C A;  4XIC A;  4HOB A;  2DA4 A;  4L9V A;  1RRJ A;  2GBY A;  2XIG A;  3MAJ A;  1WQ2 A;  4YFN F;  3RCO A;  4BE0 A;  4A3K J;  4CUG A;  3BTL A;  3NAR A;  1TBX A;  2B7E A;  2BW3 A;  2JPB A;  2HOT A;  1XTA A;  2IA0 A;  4LJZ F;  2Z99 A;  1HKT A;  2BVL A;  2EZH A;  4NQW B;  2CMP A;  5DV5 A;  5KVR A;  2M4K A;  1MW7 A;  1NHA A;  4G94 A;  2HVR A;  2DOD A;  4B48 A;  5EEA A;  3IUO A;  4UB8 C;  2BXY A;  3CCQ I;  2PFB A;  4A0X A;  4II3 A;  2XV4 S;  4PJN A;  1OJL A;  5FJ8 J;  2LY2 A;  3LSR A;  3S93 A;  3OS1 A;  4HNV A;  3KLO A;  3CCV I;  3TGN A;  1XSX A;  4F55 A;  2F5F A;  4G6D A;  4XLE A;  4BL0 B;  4N9H A;  3RIR A;  4KT6 A;  4V2F A;  2R5Z B;  1MJ9 A;  3RKW A;  2R7R A;  2V6E A;  2CG4 A;  2B63 J;  1RR7 A;  4MGR A;  4DYR A;  5K5Q A;  2ZBK A;  1BI1 A;  3BTI A;  3LL7 A;  3CCS I;  2Y9Z A;  5B1A H;  3GTP J;  3F3X A;  1IRZ A;  2KIF A;  3VYR B;  2GXG A;  3AG1 H;  2L7F P;  3GTK J;  2WV0 A;  1RUO A;  3N05 A;  4XRF A;  3OL4 A;  2DLL A;  2P4W A;  3PNT A;  3T8T A;  3TDZ C;  5K7H A;  3JR9 A;  3OYK A;  3HOX J;  1YYV A;  4NBQ A;  3LSJ A;  2LNB A;  3J80 Z;  1QPM A;  3K4K A;  1ZGJ A;  2FOW A;  5DD8 A;  3WTY C;  5D6E A;  2LD5 A;  3FXM A;  2YU3 A;  3W2W A;  4U7B A;  3IKT A;  5BPI A;  4PJJ A;  2DOE A;  1JGS A;  4XLC A;  2F5C A;  1SD7 A;  3ZN0 A;  5K7Z A;  2HQR A;  2X6O A;  5KAI C;  4L18 B;  4MHG A;  3QOE A;  4BJ6 C;  3G6E I;  2HDD A;  2DTZ A;  1IN4 A;  3HRU A;  3K1P A;  1QZE A;  4PGH A;  4CHU A;  1WGX A;  1YQA A;  2R7Z J;  1X3W B;  2KMU A;  3FXR A;  1ZRC A;  4Q5S F;  4CXF A;  1A36 A;  3PUF A;  1OLT A;  3LA3 A;  5HS9 A;  4EAT A;  3QYF A;  2D2W A;  5AIQ A;  4BQO A;  3HJE A;  1LE8 A;  1CF7 A;  2V6C A;  3DBL B;  2VKD A;  1X1C A;  5JR3 A;  3GTO J;  2ELJ A;  2BY3 A;  2EWN A;  2IW5 A;  5J1R A;  3DKX A;  4A6D A;  3T5X A;  2QSH X;  2LKX A;  2CJJ A;  2KDZ A;  5GAH J;  4LIU A;  4OIP F;  3A2K A;  2IS4 A;  2HOS A;  2PJR A;  5FRN A;  4KIS A;  2MYS A;  4Z2Y A;  3MZH A;  1ETW A;  3C18 A;  2W24 A;  2X1E A;  4YIF A;  1IC8 A;  3HOZ J;  2WA0 A;  2KP6 A;  2EFO A;  4DQ2 A;  2ESN A;  4B43 A;  3AKZ A;  2B0L A;  1XSV A;  4O3M A;  4PSX A;  4MQV A;  3FX3 A;  1AHD P;  2L54 A;  1QVU A;  2WV1 A;  2FQ3 A;  2I8D A;  4BHC A;  3HOW J;  3ELK A;  5GAE J;  2XGD A;  2OPT A;  1V54 H;  2VBZ A;  5FFZ A;  1G3S A;  1U8R A;  3ERE D;  1SAN A;  2CRG A;  3HYI A;  5FD5 A;  1SMT A;  2OZU A;  4XLN F;  4E6K G;  2PMU A;  3EET A;  1UEL B;  2YSR A;  1Z3X A;  3ZMD A;  1LE8 B;  2L01 A;  2MAB A;  4RMN A;  3FXK A;  2HXO A;  4GRI A;  1ENH A;  1D8K A;  4CA0 A;  2X9D A;  1R5G A;  3HZJ A;  4DYQ A;  5IT3 A;  2VE9 A;  1S5L C;  4H0E A;  1WI3 A;  1SFU A;  1GV2 A;  2PJR B;  4ZC3 A;  1IXS B;  3E6M A;  2CFX A;  2DU9 A;  2WTE A;  3VB2 A;  3BR0 A;  3ZMZ A;  1B9M A;  4P9U A;  5LRR A;  2O9L A;  2VQC A;  2HOA A;  4M9Z A;  2IS2 A;  1WVR A;  1ZN2 A;  4MEX F;  3ABK H;  3CF2 A;  2IXS A;  2STW A;  1GLN A;  2JZY A;  2M5W A;  3LSP A;  1LFU P;  4M6V A;  1ZG3 A;  2GLO A;  2ZJ2 A;  2J5O A;  2MLG A;  3OYJ A;  4EM2 A;  4FE4 A;  4ENN A;  4ZYE A;  1YO5 C;  2HGC A;  3E6B A;  2FNP A;  4UY8 I;  4OIR F;  2BYV E;  2HR3 A;  1WJB A;  3I4P A;  2P7V B;  4C3H J;  4RAG A;  1MMS A;  4AVZ A;  4RBO A;  2P6T A;  5D5X B;  2O5R A;  1MNM C;  3K9T A;  4AID A;  2Y0S A;  3PFI A;  3BDD A;  1O57 A;  2PJP A;  3M4O J;  5DS9 A;  3H36 A;  3KX2 A;  2LLK A;  2Y48 A;  2F48 A;  4OU0 A;  4OMZ A;  4BQA A;  4NHJ A;  2MC4 A;  2HFH A;  4EQQ A;  4HQM A;  1O7L A;  3JAM K;  1DDN A;  2DN0 A;  3HRT A;  1HKS A;  2LDU A;  1ON1 A;  1OPC A;  1WCM J;  5J4Y A;  5ERI A;  5E17 F;  4MIM A;  2H1L A;  2MGQ A;  4BKX A;  3CCR I;  3WGI A;  1SVL A;  1H88 C;  3L2U A;  1MJB A;  2M87 A;  4EGZ A;  1BBY A;  1FBQ A;  2PN6 A;  3PL8 A;  2MSY A;  1XGS A;  1J2X A;  1T33 A;  4EVI A;  4UUV A;  4B09 A;  3ZMT A;  2IGO A;  3QP6 A;  1K4S A;  2DQR A;  2OCE A;  4R1H A;  4XLA A;  1SC7 A;  1IF1 A;  1ZTR A;  2QEX I;  2BOL A;  1XB4 A;  4XON A;  1XMK A;  2DDB A;  5JHU A;  5M3F J;  5DCM A;  1YS7 A;  5KHD A;  2KIS A;  2XB5 A;  4KT5 C;  1KZH A;  3I4M J;  4NB5 A;  3RZO J;  1OCP A;  4RB2 C;  2CQQ A;  5K5O A;  4A3J J;  3OY9 A;  1APL C;  1MMG A;  1QRY A;  2ISY A;  3UR3 C;  1LDJ A;  4LLG F;  1T8I A;  1JKR C;  2R7S A;  2FBI A;  2BY1 A;  3ZQH A;  4XQF A;  1PUF A;  3FMR A;  3LSH A;  1BJA A;  2HNH A;  1FBS A;  3C1D A;  2X85 A;  4UXN A;  1AU7 A;  4JK1 X;  4I7H A;  1VQ4 I;  1P9Q C;  4W97 A;  4NC6 A;  4A0Z A;  3DLA A;  3IH2 A;  5FB2 A;  3VWB A;  4HF0 A;  3L2V A;  1HA8 A;  1CGP A;  3FM3 A;  1ON2 A;  3BG3 A;  3PUB A;  2RAE A;  1TW3 A;  4OIQ F;  1VQ5 I;  1MGT A;  2MLK A;  1MMN A;  1YLF A;  2FE3 A;  4BHB A;  5GAG J;  4L5I A;  1VQO I;  5HDN A;  3NAU A;  1MBF A;  3SFI A;  1I39 A;  2WWY A;  4OMY A;  4OAY A;  2EA2 A;  3K1N A;  5FKO A;  3FK6 A;  2W85 A;  5C3E J;  5F0F A;  1Y1W J;  2XAH A;  3H3V K;  1LVA A;  3VYT B;  3RQI A;  1IAW A;  2L02 A;  5D6F A;  2MW8 A;  4F7Z A;  1VQN I;  3IAM 2;  2KPM A;  3W3C A;  3OV8 A;  1MIJ A;  1XMA A;  1RI7 A;  4CYC A;  2AS5 F;  3OYM A;  3L2Q A;  2AO9 A;  3VDX A;  2OC6 A;  4C3J J;  5EZH A;  2MC3 A;  3HHG A;  1QBJ A;  4A12 A;  4MO7 A;  4X6A J;  1Y0U A;  2RC4 A;  1XDU A;  2DTR A;  1FP1 D;  4KNY A;  2GIV A;  3U1D A;  4XL9 A;  1TNT A;  4GO1 A;  5E3L A;  4A3G J;  4LMY A;  5EF6 A;  4ETS A;  2ZME A;  2D5V A;  3RDI A;  3DPT A;  5TIS C;  4B8X A;  4IZZ A;  3CQZ J;  2HDW A;  2DK5 A;  3FMQ A;  5HLG A;  2VL8 A;  3PFY A;  4CCM A;  4LK0 F;  2PI0 A;  2X48 A;  3E5U A;  2ZXI A;  3GFJ A;  3LWF A;  5CQE A;  1QO0 D;  1ZH5 A;  2YX4 A;  1ETX A;  2VPL A;  2ZME C;  5J47 A;  3R61 A;  3BZ6 A;  4GGG A;  3KYD B;  3CCE I;  3TO6 A;  4LD5 A;  1W5C C;  3WTT C;  4A6E A;  1TWA J;  1XMX A;  4XM3 A;  4A3C J;  1A5J A;  1RC9 A;  3LNQ A;  4O6J A;  4CYC B;  1KU9 A;  1P7I A;  3F9K A;  5F04 A;  1T6S A;  1DGR M;  4WX9 A;  2ZJP F;  2L9S A;  3GXO A;  3IWZ A;  2G7U A;  2DA5 A;  3IH4 A;  2CQK A;  1IXR C;  1BJZ A;  2W7N A;  1R00 A;  3OYF A;  1EV7 A;  2VE8 A;  2ZME B;  1ZAR A;  5L3G A;  3OYB A;  1SFO J;  1JHH A;  1R4M B;  4M73 A;  3CC4 I;  4FIS A;  5JHF A;  3Q0V A;  3KE2 A;  2D1H A;  2DT6 A;  4IRI A;  1N78 A;  1X3U A;  4ZH4 F;  5IT9 Z;  2FBH A;  4XN0 A;  2VOD A;  3PM1 A;  2FNA A;  5D5V B;  3CUQ B;  2EFQ A;  5B3S H;  1QHG A;  1IRF A;  2BVM A;  3DXJ F;  4UUT A;  4BJT A;  1U3E M;  4IO9 F;  1HF0 A;  1F36 A;  3S2H J;  2M9H A;  3REO A;  2HS5 A;  1B1B A;  2P5K A;  3SHF A;  1YS6 A;  3HXL A;  1E2X A;  3D5S C;  5E20 A;  3GTJ J;  1TC3 C;  1Q1H A;  3I0T A;  2ECC A;  2Y75 A;  3COA C;  5DTD A;  3AG3 H;  3KEO A;  2ZXH A;  3GLL A;  4U0V A;  3I3L A;  2XSD C;  3JW4 A;  5C4X J;  3GTQ J;  2JA2 A;  4HNU A;  2IRF G;  3QAH A;  2WB1 A;  3G71 I;  3RPU D;  4HLY A;  2GM4 A;  1R58 A;  3B6C A;  1IDZ A;  5LBQ A;  3QYE A;  3R6S A;  5M5Y J;  3FXQ A;  1T2K A;  2E60 A;  3S3O A;  2QZ8 A;  4C2M J;  3TKY A;  2BEO A;  4BXF A;  2MH2 A;  3LQR A;  3B02 A;  2XRO A;  2ECB A;  1VQL I;  2R7Q A;  3S1R J;  1YRN B;  1K7A A;  2YU9 J;  4MLO A;  4KA4 A;  4GYI A;  3BR1 A;  2DCE A;  3AFH A;  2COM A;  1IDY A;  3FXO A;  3KIO A;  4G9Y A;  1ZHF A;  3I9V 2;  5GP9 A;  1YHQ I;  1Z05 A;  2DOF A;  3VYS B;  2KJC A;  3ZMU A;  2WAE A;  3CMA I;  5LLQ A;  2RQP A;  4RGR A;  3G1O A;  2VUM J;  3GTL J;  3HTS B;  3L9F A;  2OD5 A;  1U9O A;  2ZO4 A;  1DPR A;  3HSF A;  4P55 A;  1I50 J;  1MBK A;  2EFN A;  3K0L A;  5LHH A;  1REP C;  2YR2 A;  2JA7 J;  1BI2 A;  2QCO A;  1ZKG A;  1FC3 A;  3ML6 A;  3OIP A;  5LEK A;  4LG0 B;  4L5J A;  2JSP A;  1E3H A;  3MKY B;  2H6C A;  1PVE A;  2IA1 A;  3CCM I;  3S16 J;  3DKY A;  2KKO A;  1ETY A;  1R5I D;  2H8R A;  4A3B J;  4LIV A;  3MD2 A;  2OV7 A;  1BL0 A;  2A6T A;  3M3Y J;  3OYN A;  5IPA A;  5CVR A;  2PMZ N;  3ZQG A;  1TTY A;  2LYC A;  5L3B A;  1VQ8 I;  1WJD A;  2KRF A;  1BIB A;  4DGW B;  4H4K C;  2A5Y B;  2VJI A;  3KP5 A;  3DEE A;  4M6X A;  2V9V A;  5FLV A;  3TO7 A;  4MTE A;  2QQA A;  1SFE A;  2R92 J;  4BBS J;  5F6F A;  2ETH A;  1I6X A;  2XKP A;  4YII A;  1FLI A;  3BCA A;  3IWF A;  5DM7 F;  5EG0 A;  3E1S A;  1R1V A;  3TOB A;  1STZ A;  1ZG1 A;  1CQT A;  4AC0 A;  4EJV A;  2EZK A;  4JX6 A;  1LDK B;  2XAJ A;  3DU6 A;  3JTG A;  2VC0 A;  3C2B A;  2RRE A;  3EUH C;  4XR6 A;  2EFP A;  1D8J A;  3CME I;  3IH3 A;  2VOO A;  2R3S A;  4YIR X;  4G12 A;  2A05 A;  1YX5 A;  2XPW A;  1IN5 A;  3I5U A;  3EQL F;  1P4W A;  4M3D A;  3EDP A;  1UST A;  2CO5 A;  3DP7 A;  4A93 J;  2L5Q A;  2BY2 A;  4U88 A;  3SYT A;  4AM3 A;  3KP7 A;  4P5O A;  2ELH A;  2MA3 A;  2P7C B;  1BC8 C;  3GME A;  5HLT A;  2P6S A;  2DFE A;  4P1W A;  4XKC A;  4PGG A;  3DTE A;  1MSE C;  4BXU A;  2XAS A;  2Y0M A;  1IZ1 A;  1RNL A;  3GFL A;  2IAI A;  3G2B A;  4CCJ A;  2R7T A;  3GO5 A;  3QYB A;  3I56 I;  2MFZ A;  3ZCO A;  5CPR B;  5EG0 B;  1ZGW A;  1NG7 A;  1GUU A;  2H27 A;  3A02 A;  3F6O A;  2GA1 A;  1WJA A;  3R0A A;  1HLV A;  1LUJ B;  2E5N A;  2DMU A;  5JLW A;  1KYZ A;  1QHH D;  4ZDO A;  1LFP A;  1WJE A;  4HAM A;  5HVQ C;  5HOD A;  3OSF A;  3CLQ A;  3BJA A;  1W7P B;  1ZAO A;  2AQE A;  4BQQ A;  1F4K A;  4XNF A;  3BR5 A;  4A5M A;  3K4N A;  5EJC A;  1LJ9 A;  3QU6 A;  1Z3Y A;  2IPQ X;  4F93 B;  5ED4 A;  4HNT A;  4JQF A;  1GV5 A;  2R7O A;  3BR3 A;  1PYV A;  5CLS A;  3NRV A;  2XSJ C;  1JT0 A;  2Z2S B;  2E2J J;  3FIS A;  2KLO A;  4BHP A;  5E79 C;  2PG4 A;  3A4C A;  3P9I A;  2L9V A;  1OYW A;  4I76 A;  1HW1 A;  4U87 A;  1Z0X A;  1BOB A;  1UMQ A;  1SFX A;  1Z7U A;  2NS0 A;  2A6H F;  5BMZ A;  2CYY A;  3H3Z A;  2V26 A;  1FSH A;  4IOC F;  1MBH A;  2DDA A;  1V5E A;  2DBB A;  4IX7 A;  2KFD A;  3HDD A;  3HOU J;  4G7O F;  3ZXS A;  1R1T A;  1S3J A;  1U9N A;  3G4S I;  1WSU A;  4HST A;  4HQE A;  3C7J A;  2YPR A;  3GW2 A;  3HGG A;  1R71 A;  3MFK A;  1RUN A;  5LGU A;  1ZRE A;  3SEQ A;  4BDY A;  4CCN A;  4DZJ A;  4BE2 A;  4ZJZ A;  4IVN A;  1MD0 A;  2A61 A;  1MBE A;  1EH7 A;  2ID3 A;  4FAS D;  4RAZ A;  1ZEL A;  1FSE A;  2D45 A;  2VI6 A;  3KP3 A;  5BNG A;  1SD4 A;  4IHX A;  3B6A A;  2X0L A;  2JA8 J;  4XKV A;  3CLO A;  3WTV C;  3F8B A;  4WXC A;  3Q3S A;  3M7G A;  5AIP A;  5HS7 A;  1S7O A;  4HBL A;  1BR4 A;  3TMO A;  1JE8 A;  1I3Q J;  2FQ4 A;  1RET A;  4Q48 A;  1X58 A;  4Y3O A;  2R5Z A;  2JUC A;  4MEY F;  2LTP A;  2JWT A;  2M0M A;  3LSM A;  2E1M C;  3OYE A;  2PBI A;  3QOD A;  2ZC2 A;  2H94 A;  2BGC A;  1FX7 A;  4M72 A;  2H1K A;  3HUG A;  2XHK A;  3VSK A;  3CD6 I;  3OYG A;  1H9G A;  2FXA A;  3OS0 A;  1W7P D;  2VN2 A;  4CCK A;  4OWR B;  1G6N A;  3ZR8 X;  1FZP B;  3MKL A;  1Z91 A;  3A0B C;  3K10 A;  3PNV A;  2F6C A;  3J80 K;  1SEU A;  2XGX A;  2RN7 A;  2W25 A;  2HZT A;  5BS6 A;  5ILV A;  1S72 I;  3D5L A;  1YW8 A;  3H0G J;  2E2I J;  2STT A;  2JMW A;  2E71 A;  4R79 A;  5L3D A;  1OCR H;  2LSO A;  3IRR A;  1IJW C;  2CUE A;  2E1M B;  4GDF A;  4KUM A;  4HSR A;  1JT6 A;  1W36 C;  3DEW A;  1ZQ3 P;  1Z6R A;  2IGM A;  2UUZ A;  2TCT A;  3JRH A;  2CW7 A;  3RTR A;  1FYM A;  3LOC A;  1TQM A;  4PCQ A;  2CW8 A;  2M4G A;  4I0B A;  3F6V A;  5FLX Z;  3CCL I;  1TW2 A;  1YTY A;  4LLN A;  2XDV A;  3LQQ A;  4BY7 J;  3OIO A;  5EEH A;  3HUG B;  1X2N A;  4L5E A;  4F92 B;  5ICC A;  3DPU A;  2IP2 A;  2AXL A;  2K9M A;  2R7F A;  1OCZ H;  1S6L A;  3HIF A;  3HTU A;  4A3F J;  1P4X A;  4ESF A;  2X6X A;  1TT0 A;  2X51 A;  3K4J A;  2K3F A;  3HBL A;  3PO2 J;  1RES A;  4C9Y A;  2KHM A;  4MFE A;  2JTV A;  2VC1 A;  3G3Z A;  3WE2 A;  4A0Y A;  1MJA A;  4HV5 A;  3ABT A;  4ZDP A;  2DA3 A;  4D5C A;  4LB6 B;  2EZL A;  3E3V A;  3E97 A;  3GCM A;  2FJ1 A;  1HBX G;  1X1B A;  4W1U A;  1H0M A;  2XPV A;  4CDG A;  5L3C A;  4S05 A;  2EB7 A;  3QPS A;  1ODD A;  1RIO H;  1BN5 A;  3CMM A;  2DMQ A;  4PUS A;  4M3F A;  3CCU I;  3BOQ A;  4A3D J;  3O8H A;  4CZZ A;  1E3O C;  2CQ7 A;  3K70 D;  2ZCW A;  1ACI A;  3H35 A;  2CUJ A;  2A3S A;  1K78 A;  3Q0U A;  1Z7L A;  2KIU A;  3V7S A;  3CTA A;  1VQM I;  4IHY A;  1XX5 A;  1DPU A;  4I0A A;  2G7H A;  2NVU B;  4BS9 A;  3DBR B;  3V42 A;  3JRD A;  4ANJ A;  3M1C A;  2K9S A;  2ZFW A;  3DTI A;  4YFX F;  1WH5 A;  1XD7 A;  2BHZ A;  5JLX A;  4IHV A;  1U2W A;  2QVO A;  2ESH A;  1VND A;  3DF8 A;  4E7K A;  5E3N A;  1BA5 A;  2HDC A;  2V1D A;  1R9T J;  1MND A;  3K1M A;  2CGP A;  3I55 I;  4FCY A;  1R49 A;  2DPD A;  1FYK A;  5CVI A;  3HOS A;  1W36 D;  3H9Q A;  1ZLJ A;  1XG1 A;  2CU7 A;  4ABZ A;  3GFM A;  1YW9 A;  1XCB A;  3CP8 A;  4WK8 F;  1K78 B;  5ICF A;  3HB9 A;  2E2H J;  2FU4 A;  5E3O A;  1LPQ A;  3D5R C;  2CQN A;  3ZQI A;  5C44 J;  1ZR2 A;  1EF4 A;  3GVA A;  1FY7 A;  2VBY A;  3M8F A;  5GTH C;  1Y56 A;  1EA3 A;  3GYH X;  3GZ5 A;  4JX5 A;  4XKW A;  3P9C A;  4BYY A;  3N4M A;  5GTI C;  2NAZ A;  1FOY A;  1Z77 A;  2MD5 A;  4Q4Z F;  3C3W A;  1B8I A;  2BBY A;  1R7J A;  1S9H A;  2JK3 A;  5TRD A;  4RDU A;  4KN4 X;  4XLP F;  1LNW A;  1ETK A;  2LK2 A;  5GPC A;  5L3F A;  4Y33 A;  3A01 B;  3C2G A;  4EM0 B;  2M2E A;  2R0Q C;  3KZY A;  5LD2 C;  2DMT A;  3DU5 A;  1TWH J;  3ECH A;  2OA4 A;  4PZJ A;  1ZRF A;  1J0R A;  2M0C A;  2DFI A;  2MH9 A;  3HOV J;  3F22 A;  2EIJ H;  2Q8K A;  3DTK A;  1Q1V A;  4HRI A;  1Y8Q B;  3FM5 A;  1SD6 A;  3F0C A;  4L0Z B;  4HX4 A;  1X1P A;  2RVC A;  2VQG A;  5H6Q A;  4C30 A;  4HG2 A;  2HZD A;  2ZSH B;  3BRO A;  5FKN A;  4XKB A;  3V7C A;  3QRF F;  4ZTF A;  3GTG J;  5F0C A;  3SZT A;  1ZGA A;  5DD4 A;  2OTJ I;  1WJC A;  1B8I B;  2OCC H;  2Y9Y A;  2M7A A;  3PSF A;  3JRE A;  4L0Y B;  2HTS A;  2RKH A;  1IXC A;  5IP9 J;  1ULY A;  4V19 K;  3BCB A;  1V5F A;  3QP5 A;  3HG9 A;  1K61 A;  2DA2 A;  1PJR A;  3MN2 A;  4RAF A;  2RGV A;  2KL4 A;  5LFA A;  3ASN H;  2JQ7 A;  3VOE A;  2NNN A;  6PAX A;  3HC7 A;  3NWS A;  2HQA A;  1MMD A;  4ZYD A;  2E36 A;  2YUS A;  4HLX A;  2LR8 A;  3KP6 A;  2DOA A;  2FA5 A;  4IL6 C;  5ICE A;  3IHU A;  2FSW A;  3U9G A;  1QPI A;  2XGC A;  3D1N I;  3WHC A;  2ZB9 A;  3HSE A;  5HLI A;  1AA7 A;  1T08 B;  3DWL E;  1SFK A;  4JBA A;  2ME6 A;  2IT0 A;  4KYW A;  3VYU B;  4XBF A;  3ZGK A;  2IJL A;  3PQK A;  2QLZ A;  3NEU A;  2E7W A;  1D3Y A;  1JHF A;  4XSX F;  4BGD A;  1I1S A;  5JVG F;  2EPF A;  1T56 A;  2CW0 F;  3SJM A;  2JRT A;  3RPU A;  3JCU C;  3JAM Z;  1U6G A;  1S29 A;  3WTW C;  1PUE E;  2VJ5 A;  2ADU A;  2NS8 A;  2XF7 A;  3K69 A;  4FX4 A;  5FGM A;  5J8C A;  1ZYR F;  2EIL H;  1W0U A;  3DV8 A;  1VI0 A;  3NQO A;  3W6K B;  2WY8 Q;  3TP3 A;  3CES A;  3U21 A;  1G59 A;  1MKM A;  1VQ6 I;  1X1A A;  4XRS G;  3ABU A;  4YEL A;  3PIP F;  1FMW A;  2K5C A;  1KQ0 A;  1JKQ C;  3GFI A;  1MMA A;  3RSN A;  2V7F A;  2QQ8 A;  1UZC A;  4RGX A;  2M1B A;  5D5W B;  3ZQ7 A;  3S3M A;  1ZG5 A;  1I1G A;  2EV6 A;  2XB0 X;  1GDT A;  1OMI A;  3WU1 B;  4I6Z A;  4II2 A;  3PIO F;  2PX9 A;  2DJI A;  4FX0 A;  4E7I A;  5DUK A;  3N97 A;  2O7O A;  2QUF A;  3EYY A;  5E18 F;  1OYY A;  2H8W A;  3JRF A;  4NUB A;  1JGG A;  5E8I A;  5IT9 K;  2RNJ A;  3SEZ A;  3CUQ A;  4CGZ A;  3ZRG A;  3FMS A;  3GWZ A;  3H5N A;  2NVQ J;  3FBN B;  1LB2 A;  3MKW B;  1XGO A;  5JFR A;  3FDY A;  2JJ7 A;  5DYM A;  2E35 A;  1YIJ I;  2R7W A;  2IBD A;  1DP3 A;  4XLF A;  2XRN A;  3CDL A;  5EYR A;  3MWM A;  4A3L J;  3ROU A;  3CUQ C;  5GAD J;  2KIM A;  3O6B B;  1B9N A;  1HKQ A;  1I5Z A;  2K27 A;  4A69 C;  4CZC A;  1DP7 P;  2XRL A;  4TV7 A;  3I58 A;  3R0J A;  4DJA A;  5HDK A;  3G73 A;  2ME0 A;  2KRH A;  2L9N A;  1K6Y A;  3CDH A;  5IOZ A;  3A0H C;  4N4N B;  5FO5 A;  4CSW A;  4RLF A;  3BZK A;  3CJR B;  1K6O A;  4BEH A;  1K4T A;  2IGK A;  2EQR A;  4FTH A;  2QBY A;  3KEQ A;  2OTL I;  2M3A A;  3JRC A;  2M7B A;  4KJZ A;  3HKZ N;  3BG6 A;  1NK3 P;  2PMZ A;  1YRN A;  2ZKZ A;  4M9S A;  3GF2 A;  3S32 A;  5E1Z B;  1BM9 A;  2EIK H;  4KIC A;  3K2A A;  2W57 A;  2XAU A;  4X1E A;  5A2Q Z;  4D0P A;  3CF5 F;  5DDG A;  1A6Q A;  3M8E A;  5C4J J;  5IYB J;  1QQI A;  4EGY A;  3HRS A;  1IW7 F;  5FKL A;  1IUF A;  2G0E A;  3P5J A;  1RR8 C;  2WC2 A;  3BZC A;  3O3K A;  1ERD A;  2WAQ N;  4M9X A;  1YJ9 I;  1FIP A;  3LAJ A;  5KK1 A;  2E34 A;  3V7R A;  3TW6 A;  3J81 K;  3H0D A;  4DYC A;  1QU3 A;  3OSG A;  4M3B A;  3FHN A;  4UHT A;  4BEH B;  4LG0 A;  2TRT A;  3QQA A;  2NOJ B;  2JT1 A;  1PDN C;  2QBY B;  2RV8 A;  2L0K A;  1SD5 A;  2GZW A;  4RLQ A;  2RQQ A;  1G3T A;  4EMS A;  2Z3Y A;  2EH3 A;  4BJ5 C;  3D0S A;  1T38 A;  1MDM A;  2CQX A;  4ZYA A;  1P4A A;  3LA7 A;  2NVT J;  2O3F A;  2A5W A;  1P6R A;  1G8X A;  3CJN A;  2IA2 A;  3VOD A;  3F8N A;  3H9J A;  2FD5 A;  5LGT A;  1E17 A;  4I98 B;  2XAG A;  1QZZ A;  2FBK A;  3DEU A;  1O3R A;  1O4X A;  3ERM A;  2XKO A;  5D8K B;  4XOT A;  1UHM A;  1IRX A;  3MZ8 A;  1HXD A;  3S3N A;  2KJB A;  5EZG A;  3OYH A;  3CCJ I;  3G1L A;  3OS2 A;  3KP4 A;  4D5F A;  1F43 A;  2Q2E B;  1DGW Y;  4XRM A;  1IGN A;  1T98 A;  1VQK I;  3S17 J;  3ONQ A;  2Y69 H; 
#chains in the Genus database with same CATH homology
 3EYI A;  1W5T A;  2V1X A;  1J5Y A;  3K2Z A;  3HRM A;  4GXO A;  3T1B A;  4ESB A;  3V8L A;  5BOX A;  3F72 A;  1Z9C A;  3W6J B;  1MDM B;  4RS8 A;  2UWM A;  2C6Y A;  5FD6 A;  2HYF A;  1FBU A;  2P8T A;  5HOO A;  3IC7 A;  4XSZ F;  5FFX A;  4ZZL A;  3EUH A;  1TLH B;  5D4S A;  4QLC U;  1KU2 A;  1HW5 A;  2PMH A;  2UXN A;  1FT9 A;  1W7P A;  2M45 A;  4Y17 A;  3SXY A;  4Y15 A;  3HSR A;  2A69 F;  3IKV A;  2XUB A;  2HTJ A;  3V8K A;  4I09 A;  2E1N A;  1P2F A;  3LA2 A;  3KET A;  3E5Q A;  2A07 F;  1S8N A;  4UVA A;  4UVC A;  1WWX A;  5LRS A;  2FEZ A;  2M30 A;  1R23 A;  2HOE A;  5CJ9 A;  3HHH A;  4IPA A;  2OBP A;  4IXA A;  1H9T A;  1TNS A;  2MBF A;  1W4M A;  1BI0 A;  4UVB A;  4HDU A;  2DO7 A;  2L4M A;  4P9F A;  4G8X A;  2L3D A;  2EK5 A;  2RDP A;  1U5T C;  2G9W A;  3AAF A;  4IRG A;  3VEP A;  3MEX A;  4I01 A;  2K4J A;  2FMY A;  2DPU A;  2K02 A;  3IRQ A;  1JXS A;  2F5D A;  3JSO A;  3F21 A;  1U5T B;  1SMY F;  2GWR A;  1T39 A;  2OQR A;  3BPX A;  4ENM A;  1XN7 A;  3Q9S A;  4HZF A;  3T0Y A;  4RB3 C;  5CVU A;  1XSD A;  3V4G A;  3TOA A;  4KMF A;  1AOY A;  1V3F A;  4U0Y A;  3SQN A;  3GX4 X;  1YFH A;  5H6R A;  2VT3 A;  3FZV A;  5LHI A;  3QPH A;  4GYG A;  4FT8 A;  1B59 A;  3SFZ A;  2HWV A;  5D4R A;  2GA2 A;  2D1V A;  1R1U A;  1QNT A;  5FLX K;  1ZRD A;  4BH9 A;  1R5H A;  2NRA C;  3E5X A;  5E1X A;  3WE3 A;  4PDK A;  2EV5 A;  3L00 A;  4KIB A;  2K7L A;  3I71 A;  4MNU A;  4IJA A;  1SAX A;  2PEX A;  2ACJ A;  1V4R A;  1UB9 A;  5J8F A;  3WG9 A;  1Z6T A;  3LST A;  2EV0 A;  3PQJ A;  1G3W A;  1HW2 A;  4IHT A;  2DW4 A;  1FOK A;  3MQ0 A;  1AWC A;  4HV6 A;  1J9I A;  4E70 A;  4WXD A;  2A68 F;  1BIA A;  3GEZ A;  4G6Q A;  2HQN A;  4S04 A;  1HQC A;  2VOP A;  3F8F A;  4I2O A;  4HF2 A;  1F1Z A;  5ICG A;  3BWG A;  3WTU C;  4P96 A;  3DPL C;  1BI3 A;  2HEO A;  3P9K A;  2K4B A;  1HST A;  1R22 A;  2P5V A;  4K2E A;  1R36 A;  1S7A A;  4RAY A;  1LEB A;  4ZZD A;  1XDS A;  2GQQ A;  3BP8 A;  5HDG A;  2DI3 A;  1G3Y A;  2OQG A;  2O0Y A;  3IL2 A;  2DT5 A;  4I02 A;  4OIO F;  3R60 A;  4AD9 A;  1TQI A;  4AIH A;  3RI4 A;  2XAF A;  2J5P A;  4GCV A;  4ON0 A;  1LQ1 A;  1KYW A;  4EJW A;  1UCR A;  4OIN F;  5DCF A;  4AIJ A;  2PLY A;  2LF8 A;  4RB0 A;  4WF2 A;  1B4A A;  1ONV A;  5CVV A;  1L3L A;  3QU3 A;  3LFK A;  2X4H A;  4AWX B;  3WTZ A;  2A6E F;  1KU3 A;  4KDP A;  3TDU C;  2GAU A;  5F1R A;  2E7X A;  1KQ8 A;  4L9J A;  3FXU A;  3DQV C;  3F8C A;  3M1E A;  3RKX A;  4HDV A;  2Q0O A;  4EJU A;  1CF7 B;  2HKX A;  1GXP A;  2EJR A;  5E8G A;  2DAO A;  2FRH A;  1P92 A;  5JVT A;  4ESJ A;  3H3U A;  3ZPL A;  2Z9O A;  1BC7 C;  3I59 A;  1UHW A;  1O3T A;  2JPC A;  3RYP A;  1W5S A;  3I54 A;  3I53 A;  5CVJ A;  3GUD A;  4ENK A;  2QEN A;  2NYX A;  1QZY A;  4IRH A;  1J75 A;  2O61 A;  5LGN A;  3L09 A;  2XVC A;  4RGS A;  1FPQ A;  2H09 A;  4ZYG A;  3I59 B;  3LAP A;  1FNN A;  4ENJ A;  3TQN A;  3I64 A;  3DFG A;  4O5V A;  3WGG A;  3L7W A;  3F8M A;  2XAQ A;  2OZ6 A;  1GHC A;  4Y13 A;  3RJP A;  4A2U A;  1FYL A;  5JI6 A;  2QQ9 A;  4EV0 A;  4R8H A;  1OR7 A;  2Z5U A;  3E6C C;  3WTX C;  4AIK A;  5D8L B;  1YG2 A;  1OKR A;  1XGM A;  3CO6 C;  4HYE A;  3Q5F A;  3KZZ A;  3VFZ A;  1O7F A;  4CYD A;  1F5T A;  2L4A A;  3P7N A;  1PP7 U;  3JSP A;  2ZXJ A;  2VBW A;  2IVM A;  3BPV A;  2BV6 A;  1XCV A;  2F2E A;  5K5R A;  4KIG A;  1ZLK A;  3RPQ A;  2EFW A;  3R4K A;  1U78 A;  1MZB A;  5DCM B;  1PP8 F;  3BJO A;  5DEQ A;  1IRG A;  1WI9 A;  1KGS A;  4U0W A;  1LDD A;  2O8X A;  2FF4 A;  5BQT A;  1VTN C;  5H20 A;  2OU2 A;  3KLN A;  5BPD A;  2VT2 A;  1UFM A;  1RZ4 A;  1WKM A;  4N9I A;  1TQP A;  1EH8 A;  4ZYH A;  5L3E A;  3CO7 C;  5A2Q K;  2V79 A;  3SZP A;  4CO8 A;  3RYR A;  3ZMS A;  5D5U B;  3ZN1 A;  3KP2 A;  1HSJ A;  4M71 A;  4L9N A;  4EM1 A;  4FHT A;  1J7K A;  3U2R A;  4UV8 A;  3WTS C;  3ZMV A;  4CIC A;  1A04 A;  2F5E A;  4RB1 A;  1YIO A;  1D5V A;  5LEJ A;  2LF7 A;  1KQ9 A;  2NNY A;  2K86 A;  4M74 A;  5AON A;  3KCC A;  3FWE A;  4L9T A;  4EJT A;  3ZP5 A;  3BJ6 A;  4G7H F;  2OAZ A;  2Q2E A;  4BAY A;  5LHG A;  1WRJ A;  5ILS A;  4DNC A;  4IHS A;  2JSC A;  2LKP A;  1BOA A;  4M6Y A;  1GXQ A;  4HX7 A;  1YW7 A;  3B73 A;  3O2P E;  4Q47 A;  4LFU A;  2QYO A;  1L0O C;  4HX8 A;  3MZY A;  3FF5 A;  3KFW X;  2FOK A;  1IN7 A;  1F9N A;  2H6B A;  5HS8 A;  3BY6 A;  2Z33 A;  4WWC A;  3FHZ A;  3V8J A;  4N0B A;  3WGH A;  1KA8 A;  5K1Y A;  4AVP A;  2E1C A;  2BE5 F;  5E1W A;  1I27 A;  4EJO A;  2HYG D;  3ULQ B;  1C0W A;  1K79 A;  1T0F A;  2GXB A;  5HLH A;  4LGW A;  2V1U A;  1FP2 A;  1OYI A;  5ILU A;  3J81 Z;  5F64 A;  5DUI A;  2CSO A;  2TDX A;  4MQ9 F;  4YFK F;  2R7D A;  3Q9V A;  4KIF A;  2QWW A;  1XGN A;  3ECO A;  4RGU A;  2YX7 A;  2DK8 A;  4HA8 A;  1B6A A;  3H92 A;  3M9A A;  4OOI A;  4MTD A;  4A5N A;  2UZK A;  2M8E A;  3OOP A;  4ASN A;  2EA4 A;  3GLX A;  3DKW A;  1QGP A;  1Z1D A;  1U5T A;  4QWQ A;  1USS A;  1IN6 A;  2ISZ A;  4UNO A;  2ZNY A;  3MCZ A;  1FWZ A;  2HKO A;  4IF4 A;  5EEG A;  4WCG A;  3L2C A;  4WXH A;  3QOP A;  3GZ6 A;  1EH6 A;  2PQ8 A;  2VXZ A;  1O3Q A;  1IN8 A;  1O3S A;  4KN7 X;  2W84 A;  2CWE A;  4U7D A;  3TO9 A;  3WU0 A;  3J7A O;  1J59 A;  1KU7 A;  3QPT A;  2P5L C;  4LK1 F;  3E6D A;  3CUO A;  5CYV A;  1GVJ A;  2FML A;  2VON A;  3ISP A;  4KFC A;  2VBX A;  3S2W A;  2O03 A;  4YG2 F;  1DUX C;  1LEA A;  1G4D A;  4UV9 A;  4BNC A;  4HF1 A;  3HOT A;  2UXX A;  3T8R A;  4NQW A;  5J6X A;  3RKY A;  1IUY A;  4LB5 A;  2ZNZ A;  4HW0 A;  3JTH A;  2DQL A;  5TJJ A;  2QM3 A;  4G7Z F;  4LLL A;  2QQB A;  3F23 A;  3WOD F;  2O6G E;  4KMU X;  4HOB A;  4L9V A;  2XIG A;  3MAJ A;  1WQ2 A;  4YFN F;  1TBX A;  2JPB A;  2IA0 A;  4LJZ F;  2Z99 A;  1HKT A;  5DV5 A;  5KVR A;  1NHA A;  4G94 A;  2PFB A;  4A0X A;  2XV4 S;  3KLO A;  3TGN A;  1XSX A;  2F5F A;  4G6D A;  4N9H A;  3RIR A;  1MJ9 A;  3RKW A;  2CG4 A;  4MGR A;  5K5Q A;  2ZBK A;  1BI1 A;  3F3X A;  2KIF A;  2GXG A;  2WV0 A;  1RUO A;  4XRF A;  2DLL A;  2P4W A;  3T8T A;  3TDZ C;  1YYV A;  2LNB A;  3J80 Z;  1QPM A;  1ZGJ A;  5DD8 A;  3WTY C;  5D6E A;  2YU3 A;  4U7B A;  3IKT A;  5BPI A;  1JGS A;  2F5C A;  1SD7 A;  3ZN0 A;  2HQR A;  4L18 B;  4MHG A;  3HRU A;  1IN4 A;  3K1P A;  4PGH A;  4CHU A;  1YQA A;  1ZRC A;  3FXR A;  4Q5S F;  4CXF A;  3LA3 A;  5HS9 A;  2D2W A;  5AIQ A;  1CF7 A;  2V6C A;  5JR3 A;  2EWN A;  2IW5 A;  4A6D A;  3T5X A;  4OIP F;  4Z2Y A;  3MZH A;  3C18 A;  2W24 A;  4YIF A;  2EFO A;  4DQ2 A;  2ESN A;  2B0L A;  1XSV A;  4O3M A;  4MQV A;  3FX3 A;  2L54 A;  2FQ3 A;  4BHC A;  3ELK A;  2VBZ A;  5FFZ A;  1G3S A;  1U8R A;  3ERE D;  3HYI A;  5FD5 A;  1SMT A;  2OZU A;  4XLN F;  2PMU A;  3EET A;  3ZMD A;  2YSR A;  2L01 A;  1D8K A;  1R5G A;  5IT3 A;  2VE9 A;  4H0E A;  1SFU A;  1IXS B;  3E6M A;  2CFX A;  2DU9 A;  2WTE A;  3VB2 A;  3ZMZ A;  1B9M A;  4P9U A;  5LRR A;  4M9Z A;  1ZN2 A;  4MEX F;  2STW A;  2JZY A;  2M5W A;  1ZG3 A;  2ZJ2 A;  2J5O A;  2MLG A;  4EM2 A;  4ENN A;  4ZYE A;  1YO5 C;  2HGC A;  3E6B A;  2FNP A;  4OIR F;  2BYV E;  2HR3 A;  3I4P A;  2P7V B;  2P6T A;  5D5X B;  3K9T A;  3PFI A;  3BDD A;  1O57 A;  2PJP A;  2Y48 A;  4OU0 A;  4OMZ A;  4BQA A;  4NHJ A;  2HFH A;  4EQQ A;  4HQM A;  1O7L A;  3JAM K;  1DDN A;  3HRT A;  1HKS A;  2LDU A;  1ON1 A;  1OPC A;  5ERI A;  5E17 F;  3WGI A;  1MJB A;  2M87 A;  4EGZ A;  1BBY A;  1FBQ A;  2PN6 A;  1XGS A;  1J2X A;  4EVI A;  4UUV A;  4B09 A;  3ZMT A;  3QP6 A;  2DQR A;  4R1H A;  1IF1 A;  1XB4 A;  1XMK A;  5JHU A;  5DCM A;  1YS7 A;  4KT5 C;  4NB5 A;  4RB2 C;  5K5O A;  2ISY A;  1LDJ A;  4LLG F;  2FBI A;  3FMR A;  1BJA A;  1FBS A;  3C1D A;  4UXN A;  4JK1 X;  4I7H A;  4A0Z A;  5FB2 A;  4HF0 A;  1CGP A;  3FM3 A;  1ON2 A;  1TW3 A;  4OIQ F;  1MGT A;  2MLK A;  1YLF A;  2FE3 A;  4BHB A;  4L5I A;  5HDN A;  2WWY A;  4OMY A;  2EA2 A;  3K1N A;  2W85 A;  2XAH A;  1LVA A;  1IAW A;  2L02 A;  5D6F A;  4F7Z A;  3OV8 A;  1XMA A;  1RI7 A;  2AS5 F;  2MC3 A;  3HHG A;  1QBJ A;  4A12 A;  1Y0U A;  2RC4 A;  1XDU A;  2DTR A;  1FP1 D;  4KNY A;  2GIV A;  3U1D A;  1TNT A;  4GO1 A;  4LMY A;  4ETS A;  2ZME A;  3RDI A;  3DPT A;  4B8X A;  3FMQ A;  2DK5 A;  5HLG A;  4LK0 F;  2PI0 A;  3E5U A;  3GFJ A;  3LWF A;  1QO0 D;  1ZH5 A;  2YX4 A;  3R61 A;  3BZ6 A;  4GGG A;  3TO6 A;  4LD5 A;  3WTT C;  4A6E A;  4O6J A;  1KU9 A;  1T6S A;  4WX9 A;  3GXO A;  3IWZ A;  2G7U A;  2CQK A;  1IXR C;  1R00 A;  1EV7 A;  2VE8 A;  2ZME B;  1ZAR A;  5L3G A;  1JHH A;  4M73 A;  3KE2 A;  2D1H A;  4IRI A;  1X3U A;  4ZH4 F;  5IT9 Z;  2FBH A;  2VOD A;  2FNA A;  5D5V B;  2EFQ A;  3CUQ B;  1IRF A;  3DXJ F;  1U3E M;  3REO A;  3SHF A;  2HS5 A;  1B1B A;  2P5K A;  1YS6 A;  5E20 A;  1E2X A;  1Q1H A;  3I0T A;  2Y75 A;  3COA C;  3KEO A;  4U0V A;  3JW4 A;  2IRF G;  3QAH A;  4HLY A;  1R58 A;  5LBQ A;  3R6S A;  3FXQ A;  1T2K A;  2QZ8 A;  3TKY A;  2BEO A;  2MH2 A;  3LQR A;  3B02 A;  2XRO A;  1K7A A;  4KA4 A;  4GYI A;  2COM A;  4G9Y A;  1ZHF A;  1Z05 A;  2KJC A;  3ZMU A;  5LLQ A;  2RQP A;  4RGR A;  3HTS B;  3L9F A;  2OD5 A;  2ZO4 A;  1DPR A;  3HSF A;  4P55 A;  2EFN A;  3K0L A;  5LHH A;  1REP C;  2YR2 A;  1BI2 A;  1FC3 A;  3ML6 A;  5LEK A;  4LG0 B;  4L5J A;  2H6C A;  2IA1 A;  2KKO A;  5CVR A;  1TTY A;  5L3B A;  2KRF A;  1BIB A;  2A5Y B;  3KP5 A;  4M6X A;  2V9V A;  3TO7 A;  4MTE A;  2QQA A;  1SFE A;  5F6F A;  2ETH A;  1I6X A;  2XKP A;  4YII A;  1FLI A;  3IWF A;  1R1V A;  3TOB A;  1STZ A;  1ZG1 A;  4EJV A;  1LDK B;  2XAJ A;  3JTG A;  2VC0 A;  2EFP A;  1D8J A;  2VOO A;  2R3S A;  1IN5 A;  3I5U A;  3EQL F;  1P4W A;  3EDP A;  1UST A;  2CO5 A;  3DP7 A;  4U88 A;  3KP7 A;  4P5O A;  2ELH A;  2MA3 A;  2P7C B;  1BC8 C;  2P6S A;  4PGG A;  4BXU A;  2XAS A;  2Y0M A;  1IZ1 A;  1RNL A;  3GFL A;  3GO5 A;  2H27 A;  3F6O A;  2GA1 A;  3R0A A;  1KYZ A;  4HAM A;  5HVQ C;  1F4K A;  3BJA A;  1W7P B;  1ZAO A;  4A5M A;  1LJ9 A;  3QU6 A;  2IPQ X;  5ED4 A;  4JQF A;  5CLS A;  3NRV A;  4BHP A;  2PG4 A;  3P9I A;  1OYW A;  1HW1 A;  1SFX A;  1Z7U A;  2NS0 A;  2A6H F;  5BMZ A;  2CYY A;  3H3Z A;  1FSH A;  2DBB A;  4G7O F;  1R1T A;  1S3J A;  1WSU A;  4HQE A;  3C7J A;  2YPR A;  3GW2 A;  3MFK A;  1RUN A;  5LGU A;  1ZRE A;  4IVN A;  1MD0 A;  2A61 A;  1EH7 A;  4RAZ A;  1FSE A;  2D45 A;  3KP3 A;  1SD4 A;  2X0L A;  3CLO A;  3WTV C;  3F8B A;  4WXC A;  3M7G A;  5AIP A;  5HS7 A;  1S7O A;  4HBL A;  1JE8 A;  4Q48 A;  4MEY F;  2PBI A;  2H94 A;  2BGC A;  1FX7 A;  4M72 A;  3HUG A;  2XHK A;  1H9G A;  2FXA A;  1W7P D;  2VN2 A;  1G6N A;  1FZP B;  1Z91 A;  3J80 K;  2XGX A;  2RN7 A;  2W25 A;  2HZT A;  5BS6 A;  5ILV A;  3D5L A;  1YW8 A;  2STT A;  4R79 A;  5L3D A;  2LSO A;  3IRR A;  4KUM A;  1Z6R A;  3RTR A;  1FYM A;  1TQM A;  4PCQ A;  4I0B A;  5FLX Z;  3F6V A;  1TW2 A;  1YTY A;  4LLN A;  3LQQ A;  5EEH A;  5ICC A;  2IP2 A;  2AXL A;  2R7F A;  1S6L A;  3HIF A;  3HTU A;  1P4X A;  4ESF A;  2JTV A;  2VC1 A;  3G3Z A;  3WE2 A;  4A0Y A;  1MJA A;  4HV5 A;  3ABT A;  4LB6 B;  3E3V A;  3E97 A;  1HBX G;  1H0M A;  4CDG A;  5L3C A;  4S05 A;  2EB7 A;  1ODD A;  1RIO H;  1BN5 A;  3BOQ A;  4CZZ A;  2ZCW A;  2A3S A;  1K78 A;  2KIU A;  3V7S A;  3CTA A;  1DPU A;  4I0A A;  2G7H A;  2ZFW A;  4YFX F;  1XD7 A;  1U2W A;  2QVO A;  2ESH A;  3DF8 A;  2HDC A;  2V1D A;  3K1M A;  2CGP A;  2DPD A;  1FYK A;  5CVI A;  3HOS A;  1ZLJ A;  3GFM A;  1YW9 A;  1XCB A;  4WK8 F;  1K78 B;  5ICF A;  2FU4 A;  3GVA A;  1FY7 A;  2VBY A;  3M8F A;  3GYH X;  3GZ5 A;  3P9C A;  4BYY A;  3N4M A;  2NAZ A;  2MD5 A;  4Q4Z F;  3C3W A;  2BBY A;  1R7J A;  5TRD A;  4KN4 X;  4XLP F;  1LNW A;  5L3F A;  4EM0 B;  3KZY A;  3ECH A;  2OA4 A;  4PZJ A;  1ZRF A;  1J0R A;  2DFI A;  2MH9 A;  3F22 A;  2Q8K A;  3FM5 A;  4L0Z B;  1SD6 A;  4HX4 A;  2RVC A;  5H6Q A;  3QRF F;  3BRO A;  3V7C A;  3SZT A;  1ZGA A;  5DD4 A;  4L0Y B;  2HTS A;  2RKH A;  1IXC A;  1ULY A;  3QP5 A;  2RGV A;  3VOE A;  2NNN A;  6PAX A;  4ZYD A;  4HLX A;  3KP6 A;  2FA5 A;  5ICE A;  3IHU A;  2FSW A;  3U9G A;  3HSE A;  5HLI A;  4JBA A;  2IT0 A;  4KYW A;  4XBF A;  2IJL A;  3PQK A;  2QLZ A;  3NEU A;  2E7W A;  1D3Y A;  1JHF A;  4XSX F;  1I1S A;  2CW0 F;  2JRT A;  3RPU A;  3JAM Z;  1U6G A;  1S29 A;  3WTW C;  1PUE E;  2ADU A;  3K69 A;  4FX4 A;  5FGM A;  5J8C A;  1ZYR F;  3DV8 A;  3NQO A;  3W6K B;  1MKM A;  3ABU A;  1KQ0 A;  3GFI A;  4RGX A;  2M1B A;  5D5W B;  3ZQ7 A;  1ZG5 A;  1I1G A;  2EV6 A;  1OMI A;  3WU1 B;  4FX0 A;  5DUK A;  3N97 A;  2QUF A;  3EYY A;  5E18 F;  1OYY A;  5E8I A;  5IT9 K;  2RNJ A;  3CUQ A;  4CGZ A;  3FMS A;  3GWZ A;  1LB2 A;  1XGO A;  5JFR A;  5DYM A;  2XRN A;  3MWM A;  3ROU A;  3CUQ C;  2KIM A;  3O6B B;  1B9N A;  1HKQ A;  1I5Z A;  2K27 A;  1DP7 P;  4TV7 A;  3I58 A;  3R0J A;  5HDK A;  3G73 A;  3CDH A;  5FO5 A;  1K6O A;  2QBY A;  3KEQ A;  2ZKZ A;  4M9S A;  3GF2 A;  5E1Z B;  1BM9 A;  4KIC A;  2W57 A;  5A2Q Z;  4D0P A;  5DDG A;  3M8E A;  1QQI A;  4EGY A;  3HRS A;  1IW7 F;  2WC2 A;  3O3K A;  4M9X A;  3LAJ A;  5KK1 A;  3V7R A;  3J81 K;  4UHT A;  4LG0 A;  2JT1 A;  1PDN C;  2QBY B;  2RV8 A;  1SD5 A;  2GZW A;  4EMS A;  1G3T A;  2Z3Y A;  1T38 A;  3D0S A;  1MDM A;  1P4A A;  3LA7 A;  2O3F A;  1P6R A;  3CJN A;  2IA2 A;  3VOD A;  3F8N A;  5LGT A;  1E17 A;  4I98 B;  2XAG A;  1QZZ A;  2FBK A;  3DEU A;  1O3R A;  2XKO A;  5D8K B;  1UHM A;  1HXD A;  2KJB A;  3KP4 A;  1T98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...