4L9TA

Crystal structure of mepr f27l mutant from multidrug resistant s. aureus clinical isolate
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
140
structure length
140
Chain Sequence
MEFTYSYLFRMISHEMKQKADQKLEQLDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MepR
publication title The molecular mechanisms of allosteric mutations impairing MepR repressor function in multidrug-resistant strains of Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 54
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4l9tA00
4MEYF 2H27A 5CVVA 3FF5A 5LLQA 5LGUA 3WU1B 1SD5A 4LD5A 2DTRA 3GEZA 4PCQA 3OV8A 4N9IA 4RS8A 5LEKA 4Y17A 5CVUA 1IUYA 2QQBA 2IJLA 1QNTA 3TO9A 1U2WA 4JK1X 1KYZA 2OA4A 5LGTA 3F21A 4LGWA 5HOOA 4U7BA 2DFIA 3KE2A 2TDXA 5E17F 1U5TC 2ADUA 4HZFA 1IRGA 4Q4ZF 3E6MA 2Y75A 3F6VA 3GZ5A 1B9MA 4KIBA 3LQRA 1Y0UA 4M72A 4Q47A 1HKTA 5ICGA 3EYYA 3RJPA 1Q1HA 4HF1A 4LMYA 2VOPA 2LNBA 2EA4A 3RDIA 2IP2A 3LAPA 4F7ZA 1HSTA 2GXGA 4ZYDA 5TRDA 4FX0A 1SFXA 3TQNA 4P96A 3CDHA 5AIQA 5F64A 5AONA 2XAGA 2M87A 1XCVA 4ZYGA 2OZ6A 4UXNA 3BPXA 3HUGA 2EK5A 1PP8F 3I59B 4WX9A 1O57A 1FSHA 3IKTA 2F5FA 2YSRA 2CFXA 3PQKA 4HDVA 1J75A 2ZKZA 2CQKA 5D6EA 3IC7A 2BEOA 3L09A 4N9HA 1TQPA 1W5SA 2X4HA 3J80K 1WWXA 3QPTA 5L3DA 1Z1DA 4UUVA 2GA1A 4N0BA 3CLOA 1SD4A 1ZGJA 4EJOA 2JRTA 3M8FA 3FWEA 3BOQA 4HAMA 3WODF 4EVIA 2A3SA 4UVBA 4IRIA 5J8CA 2O03A 1E2XA 2VONA 1R1TA 4OIRF 1F1ZA 2NS0A 5A2QZ 1FX7A 1GHCA 4L9TA 2JPBA 1X3UA 2ESNA 2CYYA 3M7GA 4AVPA 3KETA 5IT9Z 4EJTA 2NRAC 3QU3A 3KZYA 5BQTA 1P2FA 1HBXG 2DLLA 5L3EA 1BBYA 4KIFA 4G6DA 3H3UA 4JBAA 2JZYA 4U7DA 3GO5A 3F23A 1YO5C 2QWWA 1STZA 1OMIA 5CVJA 3JTGA 1KU9A 3HHGA 3KCCA 1KQ9A 2RN7A 2J5PA 3BROA 2EFWA 4IF4A 4ASNA 2A5YB 3EQLF 3ABTA 1BN5A 1QBJA 3K2ZA 1YS7A 1XN7A 2B0LA 4Z2YA 5HLIA 2Z5UA 2FE3A 4CHUA 1T39A 2LSOA 3JAMK 4RGXA 5ICCA 2P5VA 4G7HF 4EM2A 5DUKA 4G9YA 3LA2A 4LG0A 2GA2A 2L01A 3ZN0A 3RPQA 3K1NA 1BJAA 1I1GA 4D0PA 2MD5A 1TQMA 3VFZA 4L5IA 1ZYRF 4WXCA 4P9UA 2FRHA 3NRVA 5JVTA 1O3SA 2VBWA 2KKOA 3R61A 1MGTA 2OD5A 3F3XA 2P7CB 3SZPA 2HOEA 1HKQA 3MWMA 2XKPA 4ESBA 1LVAA 2DPDA 4A5MA 4HF0A 3I54A 6PAXA 3FM5A 4HV6A 3C7JA 1T2KA 1AOYA 1ZH5A 3ROUA 1FP1D 4I09A 1FYMA 5L3FA 3NQOA 1G6NA 4RB2C 3EUHA 5JFRA 2QYOA 4YIFA 2HQNA 4KN7X 2HDCA 3DKWA 4P9FA 4M74A 1SD7A 5FD5A 2DK8A 3TGNA 4NHJA 4M6XA 1EH8A 1LDDA 2QQAA 4AIHA 3F8MA 2ZFWA 4UVCA 1JE8A 1FLIA 1D8JA 4ZH4F 3TO6A 3VOEA 4L0ZB 2W25A 2YR2A 5FLXK 4H0EA 4Y15A 1HW5A 4HOBA 2PMUA 1T38A 2HWVA 2UXXA 1XD7A 3IL2A 2FXAA 1O7LA 3P7NA 2OQRA 3F8CA 2ZCWA 3MAJA 1TQIA 3RI4A 4L18B 3MZYA 2HZTA 5KK1A 2KRFA 3RKWA 1K6OA 4A6EA 3ZPLA 3FXQA 2XGXA 1JXSA 4Q48A 3E3VA 1IN5A 2IA0A 4ENKA 2P8TA 2M1BA 1K78B 1PDNC 4IJAA 3Q9VA 3V4GA 3JSOA 2YX7A 2H09A 2W85A 3ZMZA 3HIFA 5ILSA 3RKXA 2HR3A 1SMYF 3T0YA 3P9CA 4OIOF 2XIGA 1D3YA 3OOPA 3KLNA 2BYVE 5ICEA 4A12A 2UWMA 4PZJA 1WSUA 2EV0A 4WXDA 1Z6TA 3JTHA 3GXOA 1Z6RA 3FXUA 5L3GA 4BHBA 1XGOA 2FSWA 2XVCA 5H6QA 3N97A 1G3YA 1V4RA 4MQ9F 3HRSA 3S2WA 1YTYA 4MQVA 1ODDA 2F5CA 5BS6A 3QP5A 1DPRA 1PUEE 3IKVA 4LFUA 2ISZA 5FB2A 2L54A 4CDGA 5F1RA 3U9GA 5CLSA 2H94A 1QQIA 3RIRA 2IPQX 2IA2A 3E5UA 5LHHA 3Q5FA 1IN4A 2ZNYA 3ZQ7A 4AIJA 2ZXJA 2QUFA 2JSCA 3KEOA 2V1UA 4RB1A 4ENMA 1LEBA 2P5KA 3WTUC 4LG0B 3FMQA 2MH9A 1YIOA 3GFLA 4A0ZA 3WTWC 2E1CA 1L3LA 1IF1A 1LEAA 1HW2A 1QPMA 1R5HA 3COAC 3KP4A 1USSA 4OMZA 4KA4A 1YW8A 4PGGA 1IXCA 5L3BA 1C0WA 2A61A 2HGCA 3C18A 4KIGA 4QLCU 1PP7U 1XGMA 1LJ9A 2O0YA 2PEXA 1FNNA 1QZYA 4OU0A 1O3RA 2DW4A 3FMRA 4HW0A 3WE3A 1I1SA 1A04A 1U3EM 2O6GE 2XAQA 3HSFA 3HRUA 1W4MA 3R0JA 2V6CA 1EV7A 2QBYA 5H20A 1FBQA 2L02A 3SHFA 3L2CA 2BV6A 2Q2EA 3V8JA 2XAHA 3ZMTA 2BE5F 1KQ8A 4I98B 1F9NA 1BI0A 2ZNZA 5FO5A 2RGVA 2XAFA 1HXDA 3ZMDA 5A2QK 3BJAA 2COMA 4YG2F 2L3DA 2EFNA 2A6EF 5IT9K 3RPUA 4GO1A 3G3ZA 4S05A 4OIPF 5DEQA 1U8RA 1FZPB 1J5YA 5HS9A 1JGSA 2Z3YA 3B02A 4I0BA 4CZZA 1T98A 1TLHB 5EEHA 2EFOA 1Z05A 3DP7A 3ELKA 1ZRCA 5DUIA 3F72A 3GW2A 2NYXA 3M8EA 3RYPA 2CSOA 2EJRA 2HKXA 5HLHA 3H3ZA 4OOIA 4LB5A 1SFEA 2FOKA 4RGUA 3VEPA 5TJJA 1F4KA 1MKMA 2JPCA 1MJAA 2MBFA 2RC4A 4O6JA 3G73A 2LF7A 4G8XA 4LLNA 2ZMEA 1REPC 1ZRDA 3BJ6A 5CVRA 3T5XA 2M5WA 2FMLA 1QGPA 2GWRA 1FSEA 1F5TA 2DPUA 5ILUA 1WRJA 1ZLJA 5JHUA 1QZZA 2HKOA 2D45A 2DBBA 1VTNC 3K69A 3N4MA 5D4SA 1YQAA 4UVAA 1KU3A 2V1XA 3HTUA 3I4PA 4NB5A 1XMKA 3KP2A 1CGPA 1Z9CA 1J2XA 1KQ0A 2DQRA 4HX4A 4I2OA 3K9TA 1K79A 4U88A 1CF7A 1ONVA 2ACJA 3R60A 4R8HA 3LA7A 5FFXA 2DI3A 3F22A 2FF4A 2MA3A 3HOSA 1UCRA 4IHSA 4HA8A 4OIQF 1YLFA 4GXOA 4U0WA 2WC2A 1LNWA 4EJUA 3ERED 3MCZA 1RZ4A 2Y48A 2PLYA 1TW3A 5E20A 2GQQA 1FT9A 2ISYA 3QAHA 4I02A 1RI7A 3R4KA 5F6FA 1G4DA 4M73A 4CYDA 1DUXC 4BHCA 3IRRA 2FEZA 1I5ZA 4E70A 4A6DA 5D5VB 3U1DA 2VE9A 4TV7A 2CGPA 1XGSA 1UHMA 2ZO4A 4A5NA 2IW5A 3J81K 3SZTA 4I01A 1ZHFA 5E1ZB 2K7LA 1BM9A 2HTJA 2QVOA 3QOPA 1J0RA 4ZZLA 3O6BB 2OU2A 1TTYA 1KU7A 4BXUA 1BIAA 4M9ZA 1B9NA 2P5LC 2W84A 3SQNA 3FX3A 5E1XA 1B1BA 1FC3A 1FBSA 4DQ2A 5E1WA 1HW1A 4Y13A 1P92A 2H6BA 2BGCA 5LEJA 3TKYA 4KUMA 1BC7C 2PI0A 5CYVA 3QRFF 3BWGA 2O3FA 5CJ9A 1ZREA 2E1NA 3LQQA 4IVNA 2QBYB 3CUOA 4A2UA 4Q5SF 4ENNA 3F8BA 2DQLA 4MEXF 3BJOA 5HS8A 3GYHX 2C6YA 3E97A 5CVIA 3HSRA 5LHIA 4WCGA 1YYVA 3HRMA 1XSXA 1R7JA 1ZAOA 2W57A 1YFHA 2D1HA 2WTEA 1YG2A 4IRHA 2J5OA 1OYYA 5D6FA 5HLGA 2KJBA 2NNYA 2FBIA 4GCVA 5L3CA 4BH9A 4P5OA 1S8NA 1HQCA 2HQRA 3W6JB 3TOBA 3DFGA 4GGGA 2YPRA 5DD4A 4CGZA 4FT8A 3KP3A 1MZBA 3QP6A 3ABUA 2ETHA 5D5WB 2R7DA 1KYWA 1LQ1A 1I27A 3IWZA 2WV0A 4WF2A 1JHFA 4KMFA 1Z7UA 1HKSA 1AWCA 4MTEA 1R23A 3KP7A 4HQMA 2PG4A 4BHPA 3TDZC 2HS5A 3CUQA 2QM3A 4ZZDA 2VT2A 5HVQC 2UZKA 4OINF 4KNYA 4RGSA 3H92A 4CXFA 4EV0A 1H9GA 3ECHA 1RUNA 4PGHA 3GF2A 3DQVC 3HYIA 1Z91A 2FBKA 4LLGF 3C1DA 4RAYA 5J6XA 4DNCA 3KP6A 4LLLA 1ZG1A 1YW9A 3VODA 1FOKA 4LB6B 3DEUA 5JR3A 2V1DA 3LSTA 1CF7B 3BPVA 3EYIA 4WXHA 1BI1A 4XRFA 4HX7A 3REOA 4BAYA 2Z9OA 1NHAA 4YFKF 5K5QA 1B4AA 5E8IA 4BNCA 5DV5A 2FBHA 3B73A 3LFKA 2XV4S 4KYWA 3KZZA 2L4MA 3ISPA 3DPLC 4G7OF 2G9WA 3ZN1A 3IHUA 4ESFA 2RVCA 4AD9A 2E7WA 3GVAA 1W7PD 2NAZA 1R22A 1W7PA 1UB9A 1T0FA 2EA2A 1FYKA 2VC1A 3V7CA 3Q9SA 3WTXC 3HSEA 1ZN2A 4UV9A 1O7FA 2W24A 2K27A 1B6AA 3E6CC 5HDKA 2K4BA 1BC8C 1DP7P 4EMSA 4KMUX 1OPCA 1IXSB 4HLXA 4KN4X 2NNNA 2PJPA 5FLXZ 2ELHA 2Z33A 4EM1A 3E6DA 3C3WA 4XSZF 2VBZA 1ZLKA 2G7UA 4HQEA 5LRSA 2EFPA 1R36A 2Q8KA 2F2EA 4LK1F 5D5UB 3KFWX 3LWFA 1GXPA 3V7SA 1QO0D 3ZP5A 3QPHA 1EH7A 4GYIA 1RNLA 3E5XA 2JT1A 1R5GA 1O3TA 1YS6A 3E6BA 2HYGD 1XDSA 1JHHA 3K1PA 1ZG3A 2V9VA 2EFQA 2BBYA 1J9IA 2FNAA 4KT5C 4L5JA 1UFMA 2VBYA 2HFHA 2EB7A 3MZHA 4EJVA 2QENA 5EEGA 3M1EA 2ZJ2A 1USTA 1W5TA 1UHWA 2XROA 3BY6A 1IN8A 3KP5A 5E18F 4IXAA 2DO7A 3GFJA 4G94A 1RUOA 2JTVA 1TNTA 1MJ9A 4JQFA 2MH2A 1FP2A 1HSJA 5LBQA 3GX4X 2A68F 4RB3C 2K86A 4M71A 3D5LA 2A6HF 4KDPA 5HDNA 2VC0A 5HDGA 4ESJA 4ETSA 1S7AA 3CO7C 3DPTA 4U0VA 2CWEA 5AIPA 4L9VA 3FXRA 4U0YA 4NQWA 1E17A 2STTA 4HYEA 4MTDA 4QWQA 2M30A 4GYGA 4R1HA 5FD6A 3WTYC 3CO6C 3BP8A 4WK8F 2K02A 1WI9A 2DU9A 1SMTA 3P9IA 1WQ2A 2FNPA 3LAJA 2IRFG 3CJNA 1XCBA 2PBIA 2O61A 3CUQB 3HHHA 2RNJA 4RGRA 2K4JA 1H9TA 4BYYA 1XSVA 1OR7A 4B09A 3O3KA 5IT3A 3I71A 2QZ8A 5DCMA 4M9SA 2HTSA 3R6SA 2KJCA 2GXBA 2F5EA 2GAUA 1L0OC 3ZMSA 2EWNA 4HX8A 5D8KB 1R1VA 3WTZA 4HLYA 5BPIA 3ZMUA 3L7WA 2KIMA 1SAXA 5DCFA 3HOTA 2OBPA 1OKRA 1XDUA 4IHTA 1U5TA 3WGIA 2IVMA 2ESHA 1S7OA 1K78A 1WKMA 2WWYA 5ED4A 4MGRA 5ILVA 2AS5F 3FHZA 2UXNA 2E7XA 3SXYA 2Y0MA 4RB0A 2FU4A 2P6SA 1DDNA 1IN7A 5FFZA 5D8LB 3WTTC 3EETA 2L4AA 1W7PB 5K5RA 5DDGA 1J7KA 2MLGA 5E8GA 3I0TA 1TBXA 3GUDA 5BMZA 4G7ZF 1I6XA 2LF8A 3SFZA 3WE2A 3TDUC 2VODA 2VBXA 3TO7A 1LDKB 2QQ9A 1P6RA 1IZ1A 1FPQA 4B8XA 3ML6A 4UHTA 3I5UA 4EM0B 1ZGAA 3PQJA 4PDKA 4OMYA 1G3SA 3ECOA 1IAWA 3F8NA 5BOXA 2MC3A 4UV8A 1IRFA 4ENJA 1MDMA 1KGSA 4M9XA 4S04A 1YW7A 1J59A 3IWFA 4XSXF 4A0XA 3I53A 1FBUA 1T6SA 1ULYA 2RV8A 2F5DA 4FX4A 5KVRA 1K7AA 2PQ8A 1H0MA 2H6CA 4UNOA 1O3QA 4L0YB 1S6LA 3J80Z 4K2EA 5DYMA 2VT3A 2LDUA 3HRTA 3VB2A 1R1UA 2EV6A 3FMSA 4MHGA 5LHGA 5FGMA 1ZRFA 3HTSB 2XHKA 2FMYA 4RAZA 3PFIA 3K1MA 4A0YA 2PN6A 2XRNA 3M9AA 4HV5A 1SFUA 4KFCA 5DD8A 1OYIA 2VN2A 5HS7A 1ZARA 2IT0A 3BDDA 4WWCA 4HBLA 4CO8A 2V79A 1DPUA 3CUQC 1U78A 4I0AA 1XSDA 3V8LA 3ZMVA 1LDJA 2A07F 2O8XA 1B59A 4M6YA 2M45A 2ZBKA 3FZVA 4XBFA 2P4WA 5BPDA 1XGNA 5D4RA 4R79A 3CTAA 1G3TA 4EJWA 1FWZA 3ULQB 4FHTA 3JW4A 4O3MA 3RTRA 1GVJA 2R7FA 3D0SA 4AIKA 3GFIA 2P6TA 1BOAA 3U2RA 1KU2A 1BI2A 2Q0OA 4EQQA 4BQAA 4AWXB 2GZWA 3J81Z 3BZ6A 3MEXA 3RYRA 2STWA 2CO5A 2XASA 2XAJA 2KIFA 3JAMZ 5K1YA 3WGGA 2XKOA 3JSPA 3WGHA 5JI6A 1FYLA 3GLXA 5DCMB 3AAFA 4ON0A 3V8KA 1P4WA 1XMAA 2M8EA 1S29A 2ZMEB 3L00A 5ICFA 2VXZA 2OAZA 2QLZA 2LKPA 5ERIA 2AXLA 3DV8A 1U6GA 2XUBA 4LK0F 3I59A 3E5QA 1P4AA 2PFBA 2D1VA 1ZG5A 1U5TB 1R58A 2CG4A 1TNSA 3T1BA 3MQ0A 2YU3A 2FA5A 2CW0F 3DXJF 2Z99A 1ON2A 3R0AA 3TOAA 1EH6A 1D8KA 1S3JA 4YIIA 3QU6A 3L9FA 4MNUA 2G7HA 3KEQA 4HF2A 1IW7F 2KIUA 2A69F 1XB4A 3FM3A 3GFMA 1IN6A 3T8RA 4ZYEA 4YFNF 4KICA 4I7HA 3I64A 2D2WA 2HYFA 3F8FA 3LA3A 1BI3A 2OZUA 3F6OA 4O5VA 2DT5A 2DK5A 2DAOA 4LJZF 3MFKA 4IRGA 2R3SA 2VOOA 3I58A 4L9JA 1P4XA 1BIBA 2OQGA 5LGNA 1GXQA 1V3FA 2MLKA 1MDMB 4G6QA 3NEUA 1R00A 2VE8A 4CICA 3W6KB 4IPAA 4L9NA 5J8FA 1FY7A 2HEOA 3WG9A 4HDUA 1G3WA 3WTSC 4EGYA 1OYWA 3O2PE 1MJBA 3WU0A 3T8TA 2X0LA 4EGZA 2YX4A 3V7RA 5K5OA 2FQ3A 3K0LA 4XLNF 4YFXF 4P55A 1D5VA 2IA1A 3P9KA 3WTVC 1LB2A 3DF8A 5LRRA 1MD0A 2GIVA 2RQPA 4ZYHA 3IRQA 1IXRC 1TW2A 3GZ6A 2P7VB 1ON1A 2EV5A 4XLPF 3RKYA 1KA8A 3EDPA 2PMHA 1RIOH 5D5XB 3KLOA 3J7AO 5H6RA 2RDPA 3GWZA 2RKHA 1SD6A
chains in the Genus database with same CATH superfamily
1TT5B 4MEYF 2H27A 5CVVA 3FF5A 2COBA 2JSPA 5LLQA 5LGUA 1Z3XA 2X51A 1IGNA 3NWTA 5EZGA 4CYCB 1S5LC 2MFZA 3LSIA 3WU1B 1ACIA 1SD5A 3BR2A 4LD5A 2DA6A 1OR7C 2VKHA 1BJZA 2DTRA 5BNGA 2ZJQF 2VPLA 3GEZA 4PCQA 5GTIC 3OV8A 1K4SA 4N9IA 4RS8A 5LEKA 4Y17A 5CVUA 1IUYA 2QQBA 3M3YJ 1G8XA 2LG4A 3ZQHA 2IJLA 1QNTA 4MFEA 3TO9A 1U2WA 5EJCA 1R4MB 2BHZA 1WZ2A 4JK1X 1GDTA 1KYZA 1A6QA 2OA4A 5LGTA 3F21A 3PO2J 4LGWA 5HOOA 4U7BA 2DFIA 3KE2A 2LY2A 3B6AA 4XNFA 2TDXA 5J1YA 2XB0X 3CP2A 5IYBJ 2K85A 2OJED 2PJRA 3BQYA 5E17F 1U5TC 1RR8C 2ADUA 4XKWA 4HZFA 3VWBA 1IRGA 2CW8A 4Q4ZF 3E6MA 2Y75A 2EZIA 3F6VA 3GZ5A 1B9MA 1MBKA 4KIBA 1GV5A 3LQRA 4NUBA 1TP4A 1Y0UA 4M72A 4Q47A 4UY8I 3FKJA 1HKTA 3OS0A 1M1EB 4XMYA 5ICGA 3EYYA 1A35A 2JA2A 4D5CA 1JJ6C 3TEDA 3SYTA 3RJPA 1MBFA 1I6HJ 1Q1HA 4HF1A 4LMYA 4QPOA 3FHNA 4E7IA 2Y9ZA 2VOPA 1KZHA 5IOYA 2E60A 2LNBA 5J40A 2EA4A 1GLNA 2R7WA 3RDIA 2IP2A 3LAPA 4F7ZA 1HSTA 2GXGA 3SJMA 4HPQA 2E35A 4IOAF 4ZYDA 5TRDA 3HEFA 4FX0A 2B7EA 3HC7A 1SFXA 1LE8B 3ERMA 3TQNA 3OS2A 4P96A 2JA8J 1BR2A 3CDHA 5AIQA 3JRIA 5F64A 5AONA 2XAGA 5M5YJ 2M87A 3CCYA 3H3VK 5GP9A 3AFHA 1XCVA 4ZYGA 2OZ6A 4UXNA 3BPXA 3HUGA 2EK5A 1PP8F 3I59B 3S2DJ 5C3EJ 2ID6A 3QQAA 4KT6A 4WX9A 1O57A 1FSHA 4RAGA 3DKXA 4BU2A 3IKTA 2F5FA 1XC5A 2YSRA 1QU3A 2CFXA 3PQKA 4HDVA 1J75A 2E19A 2ZKZA 1HF0A 2CQKA 2XGDA 3PSFA 5D6EA 4BQQA 4PK4A 3HPHA 1EF4A 4MLOA 1Z67A 3IC7A 2K5CA 2BEOA 1NG7A 4XKCA 5E3NA 3L09A 4N9HA 1TQPA 1IDYA 1W5SA 2X48A 2X4HA 3J80K 2DA4A 3CCSI 3A1YA 1WWXA 3ABMH 5F0CA 3ZRGA 3HOZJ 3QPTA 5L3DA 1OCTC 1Z1DA 4UUVA 2GA1A 4ZDPA 4AIDA 4BDZA 4N0BA 3C2HA 4BBSJ 2O7OA 3CLOA 4C9YA 1SD4A 1ZGJA 4EJOA 2HU9A 1X1DA 2JRTA 2ZSIB 5GTHC 2Y0SN 3M8FA 1FOWA 1P7IA 3FWEA 5IYCJ 3BOQA 4HAMA 4E7ZA 3WODF 3OYMA 3M4OJ 4EVIA 3K70C 3CJQB 2A3SA 2IGKA 1A6IA 4UVBA 1TWHJ 2XC7A 4IRIA 2OC6A 5J8CA 2O03A 3DTIA 1E2XA 2LTPA 4X0GA 5K7ZA 2VONA 4B47A 1R1TA 2NVTJ 4OIRF 4HNVA 1YJWI 4NC7A 3JRAA 1F1ZA 2NS0A 4BY1J 1BR4A 5A2QZ 1FX7A 1U0JA 4DOZA 2DXIA 1GHCA 4L9TA 2JPBA 1X3UA 2ESNA 2CYYA 1TWAJ 3M7GA 4AVPA 3NARA 3MN2A 3KETA 3HGGA 5IT9Z 4HRIA 5JHFA 4EJTA 2NRAC 3QU3A 3I55I 1Y8RB 2V7FA 2QKLB 4B4CA 3ZQLA 3KZYA 1POGA 5BQTA 1P2FA 1HBXG 1B8IA 2DLLA 5L3EA 1BBYA 2JJ7A 4KIFA 3A4CA 3IUOA 4OAZA 1FIPA 2DOEA 3PNYA 5F27A 4G6DA 3HKZN 3N05A 4D1QA 3H3UA 4JBAA 2DT7B 2JZYA 2QSHX 4U7DA 2VUMJ 1MH4A 2PMZA 3GO5A 3F23A 1YO5C 4XR6A 2HQ5A 5J3LA 4V19K 3ABLH 2QWWA 2VL8A 3E0JB 4AYBN 3S15J 2E1MC 1STZA 1OMIA 5CVJA 3JTGA 1KU9A 3CCRI 4IHVA 3HHGA 3KCCA 2HYJA 1KQ9A 2FJ1A 2RN7A 4A3IJ 2J5PA 3BROA 5E3LA 4PJNA 2EFWA 1SANA 4IF4A 4ASNA 2A5YB 4GFBA 3EQLF 3ABTA 1BN5A 3SEQA 5B1AH 1QBJA 3K2ZA 1YS7A 1XN7A 2B0LA 1V55H 4XN3A 1E3OC 4Z2YA 5HLIA 2Z5UA 2FE3A 4CHUA 4QTRA 3FISA 1T39A 2LSOA 1X2MA 3JAMK 4RGXA 5ICCA 5GAHJ 2P5VA 3I56I 4G7HF 4EM2A 1HCRA 1MMDA 5DUKA 3PUFA 4G9YA 3LA2A 4LG0A 5HLTA 3C2GA 2GA2A 2L01A 2LBFB 2DJNA 3JRGA 3ZN0A 3J7ZI 3RPQA 3K1NA 1BJAA 1PJRA 4HNTA 1I1GA 2IXSA 4D0PA 4C2TA 2MD5A 2KDOA 3GTQJ 1TQMA 3K7AJ 3DCFA 2BW3A 2DMNA 1SAUA 3VFZA 4L5IA 3KPHA 3DPUA 1ZYRF 1PUFA 4WXCA 2DFHA 2Z16A 4A69C 4P9UA 2FRHA 4C3IJ 4JOMA 3NRVA 5JVTA 2YU9J 1O3SA 1Z0XA 3H35A 4ZDOA 2VBWA 1ZKGA 2X6XA 2KKOA 3R61A 4FCYA 2MG4A 3QYFA 4BXFA 3I3LA 1A31A 1MGTA 2OD5A 3F3XA 4CCNA 2P7CB 5B1BH 3SZPA 2HOEA 3KYLA 1HKQA 3MWMA 3OYAA 2XKPA 4ESBA 4E4HA 1LVAA 1V5FA 5C4XJ 2DPDA 4A5MA 4HF0A 3I54A 5CKTA 6PAXA 3DBHB 3FM5A 4XKBA 4CH7A 4HV6A 4C2UA 3C7JA 1YX5A 1T2KA 1AOYA 3BTCA 1ZH5A 4B43A 2V6EA 1PYVA 2ZFUA 3K4MA 3ROUA 2R93J 4MIMA 1FP1D 1WH5A 4I09A 1FYMA 2CU7A 5L3FA 3NQOA 1G6NA 4RB2C 2CRGA 3U21A 1MMSA 3CMEI 4C30A 3EUHA 5JFRA 2QYOA 3TP0A 1W36C 4YIFA 5KHDA 2HQNA 4KN7X 2HDCA 3DKWA 1QVTA 4P9FA 3BT9A 3OR2C 4M74A 1SD7A 2LFBA 5FD5A 2HVQA 2B63J 2DK8A 1YHQI 3TGNA 3BQZA 1ETKA 1LVKA 4II2A 4NHJA 4IL6C 4M6XA 5B3SH 1EH8A 1LDDA 2QQAA 2R7QA 4AIHA 4D7NA 3JRHA 2EINH 2NVUB 3F8MA 3V42A 2ZFWA 4UVCA 2Y31A 4ABZA 4DYCA 4MFDA 1JE8A 1FLIA 1QPIA 4XK4A 5KAIC 1D8JA 4ZH4F 3TO6A 2VXDA 5F0FA 3VOEA 4L0ZB 1AKHA 2HOSA 2NVQJ 1UZCA 1ZK8A 4PJJA 2W25A 2YR2A 3CC2I 5FLXK 1YIJI 4H0EA 4Y15A 1HW5A 4HOBA 1IRZA 2PMUA 1T38A 1H89C 2HWVA 2UXXA 1XD7A 3BZCA 3IL2A 1Y1VJ 2FXAA 1O7LA 3P7NA 4ANJA 4PFOA 3G1LA 2OQRA 1UAAA 3F8CA 1UELB 3AG3H 4DIQA 2ZCWA 3MAJA 1UG2A 5K7FA 1TQIA 1FMWA 3RI4A 4L18B 3MZYA 2HZTA 5KK1A 1NK3P 5FKLA 1B72A 2KRFA 4NC6A 1HA8A 3DBRB 3RKWA 1N25A 1VQ4I 4BUPA 3KZIC 5GAGJ 4CCJA 1K6OA 4A6EA 3ZPLA 3FXQA 2XGXA 2IEKA 3CMYA 1JXSA 4Q48A 4ZC3A 3E3VA 3ASOH 4HG2A 3G71I 1IN5A 4XOPA 2WBMA 2IA0A 4UB6C 4ENKA 2KP6A 2P8TA 3LOCA 2M1BA 1K78B 3S17J 9ANTA 1WHUA 4FQGA 2L7FP 1PDNC 4IJAA 3Q9VA 3V4GA 3JSOA 3S14J 4C2MJ 1FTZA 2YX7A 3QYEA 2H09A 2W85A 3KYDB 1H8AC 5FLMJ 3IV5A 2KL4A 4M3FA 3ZMZA 3MD2A 4XOTA 3HIFA 3QPSA 5ILSA 3RKXA 3LMMA 1W0TA 4DYQA 4A93J 1H88C 2OV7A 3HOXJ 2HR3A 1SMYF 2UV1A 3T0YA 1XS9A 3P9CA 1ERDA 1RR7A 4OIOF 2XIGA 1D3YA 3OOPA 2VIXA 3ZQGA 4C3HJ 2BY0A 1V5GA 1XMXA 2CUFA 3KLNA 2ZC2A 3HM5A 2BYVE 1ZQ3P 1AU7A 5C4JJ 2QCOA 3LSRA 5ICEA 3RCOA 4A12A 3CCVI 4A3KJ 1I39A 4PZJA 2UWMA 1WSUA 2R7TA 2L9SA 2EV0A 4WXDA 3ZQFA 3UNGC 1Z6TA 3JTHA 4DBQA 3GXOA 2LK2A 2FQ4A 1Z6RA 3FXUA 2X9DA 1ETXA 2E34A 5L3GA 3OYIA 2DMQA 4BHBA 1B8IB 1XGOA 2FSWA 4DJAA 2E71A 1X3WB 2XVCA 5H6QA 3N97A 1G3YA 1V4RA 5F04A 4MQ9F 3HRSA 4AU7A 4PSWA 5EG0A 2LKSA 3K4KA 3S2WA 3BG3A 1YTYA 3GTOJ 4MQVA 1ODDA 2F5CA 5BS6A 3L2WA 2L7MP 3QP5A 1DPRA 1BW5A 4CCLA 4D5FA 1PUEE 2JWTA 3IKVA 2M0MA 2XPUA 3DEWA 4LFUA 2ISZA 5FB2A 2L54A 2NVYJ 4ITVA 5TGTA 4CDGA 4XRSG 2H8RA 1R71A 2AXTC 2VJ5A 2Y2ZA 1AA7A 3JCUC 5F1RA 3AG1H 2DA7A 4RM2A 3U9GA 5CLSA 1VQOI 2CV2A 1UJ8A 1QQIA 2H94A 1HOMA 3RIRA 3S32A 2IPQX 2IA2A 3DU5A 2LD5A 3E5UA 1QA6A 5LHHA 3Q5FA 1IN4A 3PIPF 1VNDA 2V4JC 2ZNYA 3ZQ7A 4XLHA 5KNLA 4AIJA 2ZXJA 1LKXA 2QUFA 2JSCA 3CMAI 3KEOA 2V1UA 1SFOJ 4LIVA 2NVXJ 4RB1A 3TL4X 4ENMA 1LEBA 2P5KA 3WTUC 4LG0B 1WJCA 3FMQA 3A03A 2MH9A 1YIOA 3GFLA 4A0ZA 3WTWC 3BR3A 2E1CA 1L3LA 4N4OB 1MNEA 1IF1A 2R5YA 1LEAA 2MC4A 4AVZA 4Y33A 1HW2A 1QPMA 2BW3B 1IG7A 1R5HA 5LFAA 3AG2H 3PL8A 4BY7J 2DJIA 1PUFB 3COAC 3KP4A 1WJFA 2IS1A 1USSA 4OMZA 2VASA 2CQ7A 1O4XA 4KA4A 3DEEA 3GTPJ 1YW8A 4PGGA 1IXCA 5L3BA 2KZGA 3PO3J 4PJ0C 1C0WA 2A61A 2HGCA 3C18A 4KIGA 4QLCU 1PP7U 4F3QA 1XGMA 1LJ9A 3OYBA 2O0YA 2PEXA 2KISA 5JVGF 4LIUA 3I4NJ 1FNNA 1QZYA 4E7JA 3K4NA 1OJLA 4OU0A 1O3RA 1DQUA 2DW4A 2E1MB 2VKVA 2Y0SA 3FMRA 2YUSA 2M3AA 1VQLI 3HOWJ 2X6YA 2LR8A 4HW0A 1T56A 3WE3A 5IPAA 1I1SA 1A04A 1U3EM 1MSEC 1HDDC 3HOVJ 4H4KC 3AG4H 2O6GE 1NG6A 2XAQA 3D5RC 3OYGA 4B1RA 4I99C 3SDGA 2KIQA 4BBRJ 3BR1A 3BR0A 2Q1ZB 3GTLJ 4W1UA 1UG0A 3HSFA 5FRNA 3HRUA 1JT6A 2R7ZJ 3BTIA 1W4MA 3R0JA 1ORKA 2HPIA 2V6CA 3S2HJ 1EV7A 2QBYA 5H20A 1FBQA 2HOAA 2L02A 3K4LA 3SHFA 3L2CA 2ELJA 2BV6A 1ETQA 4FE4A 2Q2EA 3V8JA 1X1PA 2XAHA 3ZMTA 2BE5F 2FOWA 1KQ8A 2EH3A 4I98B 1D0XA 3VDXA 1F9NA 1BI0A 2BZTA 2ZNZA 5FO5A 4J01A 3L2QA 2RGVA 2XAFA 2V9KA 1HXDA 1UHSA 2KFDA 5DS9A 3FXLA 3ZMDA 4XRMA 5A2QK 3HKZA 3BJAA 2COMA 3DWLE 4YG2F 2L3DA 3JRDA 2CMPA 2EFNA 1YX3A 2A6EF 3RPUD 4JYKA 1RETA 5IT9K 2EQRA 1G59A 3RPUA 4GO1A 3OSFA 4PFPA 2HXOA 2LVSA 3G3ZA 4S05A 4OIPF 1TWGJ 3ZCOA 1W5CC 4AYBA 5DEQA 3FDYA 1U8RA 1FZPB 2BY2A 1AKHB 1J5YA 5HS9A 1JGSA 2Z3YA 3B02A 4I0BA 3L2VA 2EZKA 3WG7H 4CZZA 1JJ8C 1T98A 4UUTA 1TLHB 5EYRA 1U8BA 1HC8A 5EEHA 2EFOA 3MZ8A 1Z05A 2R0QC 2GOXB 2JUCA 3DP7A 3ELKA 2F5VA 1ZRCA 5DUIA 1VQPI 4V2GA 4C3JJ 4IQJA 3F72A 3GW2A 2NYXA 1YRNA 1VI0A 2NS8A 3H9JA 4HSRA 3M8EA 5M3MJ 3CDIA 3RYPA 2CSOA 2BVLA 2EJRA 1B72B 2MGQA 2XF5A 3ABKH 4S0HB 1VQ6I 3OYEA 2HKXA 5HODA 2R7XA 1WH7A 5HLHA 3H3ZA 2H1LA 1ZELA 5F1JA 4Y4RA 2R7OA 4OOIA 4LB5A 1SFEA 2FOKA 4RGUA 3VEPA 5TJJA 5E79C 1F4KA 3OS1A 2N8GA 3GTJJ 2V9PA 1MKMA 2JPCA 1Z77A 1MJAA 3CESA 1TWFJ 1APLC 1A36A 2DA2A 2MBFA 2GLOA 3D5SC 2RC4A 4O6JA 5KCMA 4DGWB 3G73A 2LF7A 2QKMB 3OYFA 3LSKA 4G8XA 4XORA 4LLNA 5IP7J 2QSFX 4XLEA 3CJRB 1OCCH 2ZMEA 4RM3A 1REPC 1XG1A 1ZRDA 3BJ6A 3S3OA 5CVRA 3T5XA 2M5WA 1QHGA 1DU6A 4X1EA 2FMLA 2DOFA 2ME6A 1QGPA 1MMGA 2L2OA 2GWRA 1JUSA 1FSEA 1FMVA 2KZVA 1F5TA 2DPUA 1RRJA 5ILUA 1WRJA 1JTYA 1ZLJA 1QHHD 5JHUA 1QZZA 2HKOA 4GRIA 2R5ZA 4BKXA 2VKEA 2D45A 4A3CJ 2DBBA 4YELA 2EILH 3K69A 4G12A 5D4SA 1VTNC 5GPAA 3N4MA 1YQAA 2DA5A 4OWRB 4UB8C 4UVAA 1KU3A 2LY9A 1P9QC 2V1XA 2RQQA 3HTUA 3I4PA 4NB5A 2E5ZA 1XMKA 3KP2A 1CGPA 2CV1A 1Z9CA 1J2XA 2BOLA 1KQ0A 2DQRA 3EPZA 4HX4A 1T08B 3DKYA 4I2OA 1MBJA 3K9TA 5F08A 2EIKH 3QOEA 3S1NJ 1K79A 4U88A 2V26A 1CF7A 1J09A 1ONVA 2GOMA 3LSGA 2VQHA 4PSXA 2XSJC 4D9JA 4JX5A 2FUG2 3R60A 4R8HA 3LA7A 5FFXA 5EDNA 2ACJA 1SEUA 2LC2A 5EG0B 1FIAA 4IZZA 5C44J 2DI3A 1Z3YA 2QQ8A 4ZYAA 3W6VA 3F22A 2FF4A 1TZLA 2MA3A 3HOSA 3CCQI 2E2HJ 4DW6A 3IH2A 1UCRA 4IHSA 4HA8A 4OIQF 3LNQA 4B48A 1YLFA 4GXOA 2HOTA 4U0WA 5H2FC 2WC2A 1LNWA 4EJUA 3ERED 3MCZA 1RZ4A 3GTGJ 2Y48A 4XLAA 2PLYA 1TW3A 3PNVA 5E20A 2OTLI 2GQQA 1YJNI 1AHDP 1FT9A 2ISYA 2PX9A 3VYRB 3QAHA 4I02A 4IEJA 1RI7A 3R4KA 5F6FA 5JLWA 1G4DA 5J4VA 4M73A 4CYDA 1DUXC 4BHCA 2X1DA 1RKTA 1Y6IA 5IP9J 3BG9A 1OLTA 3IRRA 2FEZA 3GTMJ 1I5ZA 4E70A 4A6DA 5D5VB 2HVRA 4F92B 4M6VA 3U1DA 1YI2I 3J7AY 3OWTA 1YOVB 2VE9A 4TV7A 3K4JA 2CGPA 1F36A 3CC4I 1VFCA 1XGSA 1UHMA 3JRBA 2ZO4A 4A5NA 2IW5A 3J81K 3CD6I 1MNMC 3SZTA 4I01A 1ZHFA 5E1ZB 2K7LA 3FXKA 4A3LJ 1BM9A 2HTJA 2QVOA 2R5YB 1WJDA 2A05A 1NK2P 3QOPA 3IH3A 4DYRA 1J0RA 4ZZLA 3O6BB 2QEXI 2OU2A 1TTYA 2CQXA 5J4YA 1SFKA 1KU7A 2WB1N 4BGDA 3CQZJ 3O8HA 4BXUA 1MMAA 1BIAA 2KHMA 4M9ZA 1GV2A 2JA5J 1B9NA 1RKWA 3EUHC 5FKKA 2P5LC 3J7YJ 2W84A 3SQNA 3TW6A 3E1SA 2LKXA 3FX3A 5E1XA 2L9NA 2MYSA 1OISA 3H5NA 2JA7J 1B1BA 3OIQA 1U9OA 1FC3A 4GDFA 3W2AA 3LSJA 1FBSA 3H5RA 4DQ2A 2HDDA 5E1WA 2GXAA 3B6CA 1HW1A 2X1CA 4Y13A 1P92A 2W00A 2L7ZA 1XTAA 4JX4A 2K9LA 2LP0A 2M7AA 2H6BA 2BGCA 4XQFA 5LEJA 4RA2A 3TKYA 4KUMA 2L5QA 1BC7C 3I4MJ 4N4NB 2PI0A 5CYVA 3QRFF 3BWGA 1WI3A 2O3FA 5CJ9A 2DYSH 1ZREA 2K9QA 2F6CA 2E1NA 1JKOC 2IAIA 2ZJPF 1V54H 3LQQA 4IVNA 4Y3OA 1SVLA 2VQCA 2QBYB 3CUOA 2DMUA 4A2UA 4FASD 4Q5SF 2Q2EB 3HBLA 3F8BA 4ENNA 2DQLA 4MEXF 2ZSHB 3MKZA 3BJOA 1MBGA 5HS8A 2DA1A 3GYHX 2OTJI 2C6YA 3E97A 3RQ4A 1R9TJ 5CVIA 3HSRA 5LHIA 4WCGA 1YYVA 3HRMA 4XLCA 5DM7F 1TL8A 1R4NB 2PJRB 1XSXA 3PM1A 4RDUA 1R7JA 3VYSB 1ZAOA 2DODA 4BQOA 2NOGA 4ZDLA 2HNHA 2W57A 2EIMH 1Z7LA 1YFHA 2D1HA 2WTEA 3WU2C 1YG2A 2AHQA 4IRHA 1XPXA 1W0UA 2J5OA 1VQKI 1OYYA 4M3EA 2OF7A 3JRCA 5D6FA 2DMTA 1JKRC 1X4OA 5HLGA 2KJBA 2NNYA 4RMNA 2FBIA 4GCVA 5L3CA 4BH9A 4P5OA 1S8NA 1HQCA 2HQRA 3W6JB 1SVMA 3TOBA 3OYHA 3DFGA 2EZLA 4GGGA 2YPRA 1T8IA 5DD4A 4CGZA 4FT8A 3KP3A 1YRNB 1MZBA 3QP6A 3ABUA 2ETHA 3OR1C 3ZGKA 4CCOA 3G4SI 5D5WB 1WPKA 2QSGX 3GBGA 1VQ9I 2R7DA 1KYWA 1LQ1A 3HUGB 3OL4A 2WY8Q 1I27A 3IWZA 2WV0A 4WF2A 3H9GA 2WY7Q 1JHFA 3CP8A 4KMFA 1Z7UA 1HKSA 3UR3C 1YE9A 4BQNA 1K61A 1AWCA 2XRLA 2K9SA 2LREA 2DT6A 1E0EA 4MTEA 2IGOA 4BJ5C 1WJAA 2E2JJ 1R23A 3KP7A 4HQMA 2PG4A 1JT0A 4BHPA 3TDZC 4QIWN 4B3AA 2LOOA 2HS5A 5EEAA 3VYTB 3CUQA 3VSKA 3GCMA 2QM3A 4ZZDA 4XONA 4RBOA 4A3FJ 2D5VA 4M3DA 2VT2A 5HVQC 2UZKA 4OINF 4KNYA 4RGSA 2KPMA 1D1BA 3H92A 2K40A 3G2BA 4CXFA 4EV0A 1H9GA 3UKGA 3BCBA 1DP3A 1VF9A 3HGYA 1JGGA 3ECHA 3K10A 1RUNA 4PGHA 3SDBA 1ETYA 2Y69H 3GF2A 3DQVC 3HYIA 3L1PA 1Z91A 2FBKA 3P5JA 5F0HA 3A01A 4LLGF 3C1DA 1WFXA 2R5ZB 4RAYA 4BEHA 5J6XA 4RLFA 1A5JA 3S16J 4DNCA 2LY1A 4QPQA 3KP6A 4LLLA 2I8DA 1ZG1A 1YW9A 1HLVA 3VODA 1MBHA 3RQIA 1FOKA 3HOUJ 3SZGA 4LB6B 3DEUA 1FTTA 2MD0A 5JR3A 2V1DA 3L2UA 3OYNA 2CH0A 3LSTA 2B9SA 2BY1A 1CF7B 3BPVA 2XB5A 3A02A 3EYIA 1S9HA 4WXHA 1BI1A 1RPWA 4XRFA 4HX7A 1LFPA 3GLLA 3REOA 4BAYA 5E3OA 2Z9OA 1IUFA 1NHAA 4XICA 1UMQA 4NBQA 4YFKF 2DYRH 1B4AA 1EKEA 5K5QA 5E8IA 3RZDJ 4BNCA 5DV5A 2FBHA 1D1AA 2HI3A 2TCTA 3B73A 3LFKA 2XV4S 4HSTA 2F4OB 1IV6A 3KYCB 4DZPA 1LUJB 3FXJA 4OAYA 3OYCA 3PNTA 3ZR8X 4KYWA 3KZZA 1F43A 2L4MA 2JN6A 2ZJRF 2X6OA 3ISPA 2VJ4A 2O9LA 3BZKA 3DPLC 1ETVA 4G7OF 2G9WA 3ZN1A 2I10A 3IHUA 4ESFA 2RVCA 5HNFA 4AD9A 2E7WA 1VZ0A 3GVAA 3BC8A 5KAFC 1W7PD 4JP0A 2DOAA 3M07A 2NAZA 1R22A 2OCCH 1W7PA 1T0FA 1UB9A 2EA2A 4CA0A 3HOYJ 3FK7A 1FYKA 2VC1A 3V7CA 3Q9SA 3ZOBA 3CCLI 2VLAA 3WTXC 3HSEA 2XF7A 1ZN2A 4UV9A 1ZR2A 1O7FA 2W24A 3C2BA 2K27A 1X3ZB 2ZB9A 5M5WJ 2EZHA 2Z2SB 1B6AA 1VQ7I 3E6CC 5HDKA 2K4BA 1BC8C 1DP7P 4EMSA 2LRDA 4KMUX 1OPCA 1IXSB 4HLXA 4KN4X 2NNNA 3CCUI 2PJPA 5FLXZ 2IS4A 2ELHA 2Z33A 2O8KA 1VQNI 3ZQCA 4EM1A 3E6DA 3C3WA 4CZCA 4XSZF 3F9KA 2VBZA 2RREA 5M5XJ 1IJWC 2IS2A 1ZLKA 1KONA 2K3PA 2G7UA 5LRSA 2EFPA 2Q8KA 1R36A 3X2QH 4HQEA 1D5YA 2F2EA 3DBLB 4LK1F 5IYDJ 5D5UB 2E1OA 3KFWX 3LWFA 3Q3SA 4II3A 1JKQC 1GXPA 2M8GX 1QO0D 3V7SA 2L0KA 3I9V2 1T95A 5J1UA 3ZP5A 3QPHA 1EH7A 2HPMA 4GYIA 4X6AJ 1JUMA 1RNLA 3E5XA 2JT1A 2KLOA 1R5GA 1DU0A 1O3TA 1YS6A 2W1OA 4YEJA 1BA5A 3E6BA 2HYGD 1XDSA 1JHHA 3K1PA 1ZG3A 4M3GA 2V9VA 2EFQA 4E7SA 2BBYA 4BE0A 1X1BA 1J9IA 2FNAA 2V1NA 2UUZA 2XAUA 4KT5C 4L5JA 3CC7I 1UFMA 2XF6A 5GADJ 2VBYA 3EUKL 2HFHA 3OSGA 3ASNH 2EB7A 1V5EA 3MZHA 2WAQA 3LSHA 1JTXA 2M4KA 4EJVA 1IV8A 2QENA 5EEGA 3CF2A 1NTCA 3M1EA 2ZJ2A 4HEA2 4ZTJA 1MW7A 1GVDA 3EUAA 2DA3A 3OMYA 2OUMA 3H36A 1Q1VA 4E7LA 4A3DJ 2VJIA 1USTA 1W5TA 4YIRX 1UHWA 2XROA 3BY6A 1IN8A 5EGOA 2R7SA 2XDVA 1ITYA 3S3NA 2GM4A 3KP5A 5E18F 4Y52J 2Y30A 4IXAA 2DO7A 3GFJA 4G94A 1SC7A 1RUOA 2JTVA 3KIOA 2ZXHA 5J47A 1OCOH 1TNTA 2NXNB 1MJ9A 3AL0B 4JQFA 3HZJA 2MH2A 1FP2A 2X1EA 1HSJA 5LBQA 3GX4X 2M7BA 2ZXIA 3GMEA 3CCEI 2Z1DA 2A68F 4RB3C 4PJMA 2K86A 4M71A 3D5LA 2A6HF 4KDPA 5HDNA 2VC0A 2W82A 3MVPA 3OOUA 5HDGA 2QGUA 4ESJA 3GZNB 4ETSA 2ZMEC 1S7AA 3VYUB 2QF7A 3CO7C 1Y1WJ 2XSDC 4IKFA 3DPTA 1GUUA 4U0VA 1TWCJ 1X1CA 2CWEA 2H8WA 1ZR4A 1FJLA 1RC9A 5AIPA 4L9VA 3ZXSA 3FXRA 3JRFA 4U0YA 4XM3A 4NQWA 3O8GA 5LD2C 2XGCA 1E17A 3A0HC 2ECCA 4IQ4A 2STTA 4BXXJ 2L9VA 2L7KA 1QRYA 4CUGA 4HYEA 4MTDA 2M34A 3BR6A 5FRMA 4QWQA 3U1KA 2M30A 4GYGA 4R1HA 5FD6A 3WTYC 4XRSA 2HQAA 3A0BC 3BP8A 3KX2A 3QODA 3CO6C 2P81A 1EA3A 4WK8F 2K02A 1WI9A 1MSFC 2EIJH 2DU9A 4V2FA 1SMTA 3P9IA 2IGNA 1WQ2A 2FNPA 1P7JA 4BS9A 3LAJA 2IRFG 3CJNA 1XCBA 2HDWA 2Y9YA 2PBIA 2FD5A 2O61A 4A3GJ 2WB1A 3CUQB 3HHHA 4HNUA 2RNJA 1FOXA 3RKQA 4AM3A 4RGRA 3PIOF 2K4JA 1H9TA 2HZDA 4BYYA 5EF6A 2LMDA 1XSVA 3WHBA 1OCRH 1OR7A 4B09A 3O3KA 5IT3A 3BR5A 2QZ8A 3I71A 3CCJI 5DCMA 3FXOA 3PUBA 4M9SA 2HTSA 1X58A 1OCZH 1BW6A 2JVHA 3A01B 3R6SA 1QVUA 2KJCA 2GXBA 2F5EA 4BEHB 2GAUA 4XN0A 1I50J 5M3FJ 1L0OC 3ZMSA 2EWNA 4HX8A 2ME0A 5CQEA 1R1VA 3CMMA 3TMOA 2K3FA 5D8KB 4IHWA 3WTZA 4HLYA 3LSPA 4F93B 5BPIA 3WHCA 3GTKJ 3ZMUA 2W4SA 5FKOA 3L7WA 2KIMA 2WAQN 2M0CA 1SAXA 5DCFA 3HOTA 5FKMA 3NAUA 4AC0A 2OBPA 2KQRA 1OKRA 1XDUA 4XIDA 1U5TA 4IHTA 3TP3A 3WGIA 3HJEA 2IVMA 4KISA 2M9HA 2ESHA 3BLYA 4BE2A 1S7OA 3S8PA 4LOCA 1K78A 1WKMA 3BG5A 2VQGA 2WWYA 5ED4A 2GIZA 3CF5F 1N78A 1VQ8I 3Q0WA 4Y7NJ 3NWSA 3BCAA 1X1AA 5CPRB 3OY9A 4MGRA 5ILVA 2H1KA 3KEYA 4EATA 3HXLA 2AS5F 3FHZA 4RAFA 4CSWA 4I6ZA 4W97A 2UXNA 1K4TA 2E7XA 2IS6A 1I3QJ 3IH4A 3SXYA 2MABA 2Y0MA 4IX7A 2AQFA 4RB0A 1HDPA 2FU4A 2P6SA 4P1WA 1IN7A 2MW8A 1DDNA 5FFZA 5D8LB 3WTTC 2F48A 1CQTA 3EETA 2L4AA 5TISC 3DTEA 2BVMA 3MKYB 5CQGA 1W7PB 1ETWA 5K5RA 5DDGA 3HDDA 1J7KA 4KJZA 1T33A 2KRHA 2MLGA 4LG3A 5E8GA 3I0TA 4FE7A 1TBXA 3GUDA 2R7VA 5BMZA 3Q0VA 1I6XA 4G7ZF 2WAEA 2LF8A 1R49A 5HNHA 2CUJA 2IBDA 2JVGA 1MNDA 1Y56A 1TT0A 4YRVA 2CUEA 3BTJA 3OYJA 3SFZA 3WE2A 1YJ9I 4CCMA 4IHXA 5JLXA 3TDUC 1LPQA 2VODA 3CLQA 2VBXA 3TO7A 1LDKB 2QQ9A 1VQMI 1OQYA 4KITB 4ZTFA 1P6RA 1IZ1A 2VQLA 1FPQA 4UUSA 4B8XA 2X6WA 4FISA 5E3MA 3ML6A 5FJ8J 4PUSA 4UHTA 3BG6A 3I5UA 4EM0B 1MH3A 1ZGAA 3VPRA 3PQJA 3HB9A 4PDKA 3L2RA 1RESA 4MO7A 3CDLA 4OMYA 4EEFG 2EPFA 1G3SA 3ECOA 1IAWA 4DBRA 3F8NA 3OL3A 5BOXA 1Y0NA 1N77A 3LL7A 2MC3A 4UV8A 1IDZA 1IRFA 3AL0C 4ENJA 1MDMA 1KGSA 3G6EI 2IGMA 4M9XA 4NC8A 2HXIA 4S04A 1YW7A 5EZHA 1J59A 3IWFA 4XSXF 4A0XA 3I53A 1ENHA 1FBUA 1S72I 1T6SA 3IP4B 3K70D 1ULYA 2RV8A 2XGEA 4FETA 1LFBA 2F5DA 4FX4A 2CW7A 5B66C 5KVRA 3OIPA 1K7AA 2PQ8A 1H0MA 2H6CA 4UNOA 1O3QA 3ONQA 2KT0A 4E6KG 4L0YB 1S6LA 3MKLA 4U87A 3J80Z 2CQNA 4K2EA 1LFUP 5DYMA 2VT3A 1PVEA 2LDUA 3HRTA 4RLQA 3MKWB 3VB2A 2R4GA 1R1UA 2EV6A 3DTKA 1ZGWA 1JUPA 5FKNA 3FMSA 1R6RA 4MHGA 3BTLA 5LHGA 5FGMA 3TW7A 1ZRFA 2DTZA 3OYKA 5EGOB 3HTSB 2XHKA 2FMYA 4RAZA 3PFIA 2JA6J 2DFFA 3K1MA 3PJRA 1DGRM 4A0YA 3FIWA 2JUGA 2PN6A 2WA0A 2XRNA 3M9AA 3CZ6A 4HV5A 1SFUA 1SVOA 4KFCA 3SEZA 3K4CA 3HG9A 5B5EC 4Z6YA 5DD8A 2BXZA 1OYIA 2YS9A 1JKPC 4BDYA 2VN2A 3JREA 3H9QA 5HS7A 1ZARA 4L5EA 2WADA 2IT0A 3BDDA 4CCKA 4HBLA 4WWCA 4CO8A 2ID3A 2V79A 2CJJA 1K6YA 1DPUA 3CUQC 5IY5H 1U78A 2E5NA 4G6TB 2E2IJ 4CYCA 4I0AA 1XSDA 3V8LA 1R5ID 3K6GA 3ZMVA 1LDJA 2ELKA 2O8XA 1B59A 2A07F 4M6YA 4I76A 2M45A 1EJ9A 5K7HA 2ZBKA 4LITA 3FZVA 4XBFA 2P4WA 4E7KA 5BPDA 1XGNA 4NQWB 2DMPA 2OCEA 3DLAA 1D0ZA 5D4RA 2KRCA 3Q0UA 3LSMA 1BR1A 1FOYA 4R79A 3CTAA 4NNJA 3S1QJ 1G3TA 3IAM2 1JI8A 4EJWA 1FWZA 3HPGA 3QWLA 3ULQB 3IAS2 3FKIJ 4FHTA 1WCMJ 3JW4A 4O3MA 3BG7A 3RTRA 3S93A 1GVJA 2BHYA 4AUXA 2R7FA 4PJLA 3D0SA 4AIKA 3GFIA 2P6TA 1BOAA 1X4PA 3RSNA 2K9NA 3U2RA 1KU2A 1BI2A 2Q0OA 4EQQA 4BQAA 2DDBA 4AWXB 5GAEJ 2GZWA 3FBNB 1X2NA 3M1CA 2PMZN 3BZ6A 3ZQIA 3MEXA 3J81Z 3RYRA 1Z21A 3JR9A 1IO2A 2AQEA 2A6TA 2RNGA 4BJ6C 2STWA 2CO5A 2E36A 2XASA 2ICWG 2KIFA 2XAJA 3JAMZ 5GPCA 5K1YA 3WGGA 1I3AA 2XKOA 3PSIA 3JSPA 2KMUA 2VI6A 3WGHA 5JI6A 1FYLA 3GLXA 5DCMB 3AAFA 4ON0A 1VQ5I 1D1CA 1W1WE 3V8KA 3VSLA 5J1RA 1P4WA 1XMAA 3PFYA 1MMNA 2M8EA 1S29A 4FTHA 2ZMEB 1LE8A 1T0FC 3L00A 5ICFA 2QA4I 2VXZA 2OAZA 2QLZA 2LKPA 5ERIA 5DM6F 1NH3A 1IRXA 2ZXWH 2AXLA 3DV8A 1U6GA 1N75A 2XUBA 3I59A 4LK0F 3E5QA 3AKZA 1P4AA 2PFBA 2D1VA 1ZG5A 2DN0A 3G1MA 2NOJB 3FK6A 3W3CA 1U5TB 1R58A 2CG4A 3OYLA 3FBIB 5DTDA 3A2KA 1TNSA 3T1BA 1BOBA 3HL2A 2DCEA 1U9NA 3MQ0A 2YU3A 2R92J 2CFOA 1X19A 2FA5A 2CW0F 3DU6A 4ZJZA 1W36D 2OPTA 3DXJF 2Z99A 2L9RA 1K83J 1ON2A 3R0AA 1S7EA 2JMWA 3TOAA 2CS3A 1EH6A 1D8KA 1WGXA 1S3JA 4BACA 2JRMA 3QU6A 3LFUA 4YIIA 4JX6A 3DLLF 3L9FA 4MNUA 1GT0C 2X85A 3H1CA 1ZTRA 2G7HA 4BJTA 3G1OA 3S1MJ 4XLFA 3H5AA 2BY3A 3KEQA 3W2VA 1QZEA 1WJ5A 1OFCX 4NDLA 4HF2A 1IW7F 2KDZA 2KIUA 2A69F 1XB4A 1Y8QB 5FROA 3CJTB 3FM3A 3GFMA 1IN6A 3T8RA 1G2HA 2CQQA 1FEXA 1YITI 1WVRA 2R7UA 3FXMA 4ZYEA 3W2WA 2DFEA 4YFNF 5IP6A 4KICA 4I7HA 3I64A 2D2WA 2DDAA 2HYFA 2VJJA 3E7LA 3F8FA 2A5WA 3LA3A 4M3BA 1BI3A 2WV1A 2OZUA 4J19A 3F6OA 4O5VA 1OCPA 2DT5A 2DK5A 2CUZA 3S1RJ 2K9MA 1XX5A 2DAOA 2AO9A 2VB6A 2VKDA 4UUSB 4LJZF 3ESWB 4B44A 3MFKA 2WAFA 4IRGA 2R3SA 4A3EJ 2VOOA 1E3HA 3QPLA 2O5RA 4F55A 3I58A 4L9JA 4D7MA 5FLVA 1P4XA 1BIBA 2OQGA 5LGNA 3OYDA 1WJEA 4F91B 2JQ7A 2ECBA 1GXQA 1MIJA 1V3FA 1DGWY 2MLKA 1MDMB 4G6QA 3NEUA 2BXYA 1R00A 3OIOA 2VE8A 1ETOA 2TRTA 4DZJA 4CICA 3W6KB 4J00A 3F0CA 4IPAA 3CCMI 4L9NA 5J8FA 1FY7A 4E7HA 2LLKA 3RZOJ 2HEOA 2P0WA 4B3XA 3WG9A 3SFIA 4HDUA 4A3MJ 1G3WA 2M2EA 3WTSC 2XPVA 4EGYA 4A3JJ 1OYWA 3K4BA 3O2PE 3S3MA 1MJBA 2MSYA 3WU0A 4A3BJ 3T8TA 4IHYA 1WJBA 2CV0A 2RAEA 2NS7A 4XKVA 2EBIA 3H0DA 2R7RA 2X0LA 3M8JA 2YX4A 3MMYB 3V7RA 4EGZA 2HVSA 4BE1A 5K5OA 2FQ3A 3K0LA 4XLNF 4YFXF 4BL0B 4P55A 1D5VA 2I5UA 2IA1A 3P9KA 3WTVC 3ZQQA 1LB2A 3DF8A 5LRRA 1MD0A 4IOCF 1BL0A 2GIVA 4XL9A 3QYBA 2RQPA 2W48A 4QSHA 2FX0A 1D0YA 2VPRA 4ZYHA 3IRQA 1IXRC 5IOZA 1TW2A 3GZ6A 2P7VB 3D1NI 1ON1A 2XPWA 2EV5A 2GBYA 4F52A 2LH9A 2M4GA 2JK3A 3TBIA 4XLPF 3RKYA 4IO9F 2LBFA 1Y39A 2F4IA 1KA8A 3EDPA 2PMHA 1RIOH 5D5XB 3K2AA 1MBEA 3KLOA 1TC3C 3J7AO 2LYCA 1IC8A 1E3PA 2G0EA 2F4MB 5H6RA 2RDPA 3GWZA 2RKHA 2W7NA 1SD6A 3H0GJ
chains in the Genus database with same CATH topology
4MEYF 2H27A 5CVVA 3FF5A 5LLQA 5LGUA 3WU1B 1SD5A 4LD5A 2DTRA 3GEZA 4PCQA 3OV8A 4N9IA 4RS8A 5LEKA 4Y17A 5CVUA 1IUYA 2QQBA 2IJLA 1QNTA 3TO9A 1U2WA 4JK1X 1KYZA 2OA4A 5LGTA 3F21A 4LGWA 5HOOA 4U7BA 2DFIA 3KE2A 2TDXA 5E17F 1U5TC 2ADUA 4HZFA 1IRGA 4Q4ZF 3E6MA 2Y75A 3F6VA 3GZ5A 1B9MA 4KIBA 3LQRA 1Y0UA 4M72A 4Q47A 1HKTA 5ICGA 3EYYA 3RJPA 1Q1HA 4HF1A 4LMYA 2VOPA 2LNBA 2EA4A 3RDIA 2IP2A 3LAPA 4F7ZA 1HSTA 2GXGA 4ZYDA 5TRDA 4FX0A 1SFXA 3TQNA 4P96A 3CDHA 5AIQA 5F64A 5AONA 2XAGA 2M87A 1XCVA 4ZYGA 2OZ6A 4UXNA 3BPXA 3HUGA 2EK5A 1PP8F 3I59B 4WX9A 1O57A 1FSHA 3IKTA 2F5FA 2YSRA 2CFXA 3PQKA 4HDVA 1J75A 2ZKZA 2CQKA 5D6EA 3IC7A 2BEOA 3L09A 4N9HA 1TQPA 1W5SA 2X4HA 3J80K 1WWXA 3QPTA 5L3DA 1Z1DA 4UUVA 2GA1A 4N0BA 3CLOA 1SD4A 1ZGJA 4EJOA 2JRTA 3M8FA 3FWEA 3BOQA 4HAMA 3WODF 4EVIA 2A3SA 4UVBA 4IRIA 5J8CA 2O03A 1E2XA 2VONA 1R1TA 4OIRF 1F1ZA 2NS0A 5A2QZ 1FX7A 1GHCA 4L9TA 2JPBA 1X3UA 2ESNA 2CYYA 3M7GA 4AVPA 3KETA 5IT9Z 4EJTA 2NRAC 3QU3A 3KZYA 5BQTA 1P2FA 1HBXG 2DLLA 5L3EA 1BBYA 4KIFA 4G6DA 3H3UA 4JBAA 2JZYA 4U7DA 3GO5A 3F23A 1YO5C 2QWWA 1STZA 1OMIA 5CVJA 3JTGA 1KU9A 3HHGA 3KCCA 1KQ9A 2RN7A 2J5PA 3BROA 2EFWA 4IF4A 4ASNA 2A5YB 3EQLF 3ABTA 1BN5A 1QBJA 3K2ZA 1YS7A 1XN7A 2B0LA 4Z2YA 5HLIA 2Z5UA 2FE3A 4CHUA 1T39A 2LSOA 3JAMK 4RGXA 5ICCA 2P5VA 4G7HF 4EM2A 5DUKA 4G9YA 3LA2A 4LG0A 2GA2A 2L01A 3ZN0A 3RPQA 3K1NA 1BJAA 1I1GA 4D0PA 2MD5A 1TQMA 3VFZA 4L5IA 1ZYRF 4WXCA 4P9UA 2FRHA 3NRVA 5JVTA 1O3SA 2VBWA 2KKOA 3R61A 1MGTA 2OD5A 3F3XA 2P7CB 3SZPA 2HOEA 1HKQA 3MWMA 2XKPA 4ESBA 1LVAA 2DPDA 4A5MA 4HF0A 3I54A 6PAXA 3FM5A 4HV6A 3C7JA 1T2KA 1AOYA 1ZH5A 3ROUA 1FP1D 4I09A 1FYMA 5L3FA 3NQOA 1G6NA 4RB2C 3EUHA 5JFRA 2QYOA 4YIFA 2HQNA 4KN7X 2HDCA 3DKWA 4P9FA 4M74A 1SD7A 5FD5A 2DK8A 3TGNA 4NHJA 4M6XA 1EH8A 1LDDA 2QQAA 4AIHA 3F8MA 2ZFWA 4UVCA 1JE8A 1FLIA 1D8JA 4ZH4F 3TO6A 3VOEA 4L0ZB 2W25A 2YR2A 5FLXK 4H0EA 4Y15A 1HW5A 4HOBA 2PMUA 1T38A 2HWVA 2UXXA 1XD7A 3IL2A 2FXAA 1O7LA 3P7NA 2OQRA 3F8CA 2ZCWA 3MAJA 1TQIA 3RI4A 4L18B 3MZYA 2HZTA 5KK1A 2KRFA 3RKWA 1K6OA 4A6EA 3ZPLA 3FXQA 2XGXA 1JXSA 4Q48A 3E3VA 1IN5A 2IA0A 4ENKA 2P8TA 2M1BA 1K78B 1PDNC 4IJAA 3Q9VA 3V4GA 3JSOA 2YX7A 2H09A 2W85A 3ZMZA 3HIFA 5ILSA 3RKXA 2HR3A 1SMYF 3T0YA 3P9CA 4OIOF 2XIGA 1D3YA 3OOPA 3KLNA 2BYVE 5ICEA 4A12A 2UWMA 4PZJA 1WSUA 2EV0A 4WXDA 1Z6TA 3JTHA 3GXOA 1Z6RA 3FXUA 5L3GA 4BHBA 1XGOA 2FSWA 2XVCA 5H6QA 3N97A 1G3YA 1V4RA 4MQ9F 3HRSA 3S2WA 1YTYA 4MQVA 1ODDA 2F5CA 5BS6A 3QP5A 1DPRA 1PUEE 3IKVA 4LFUA 2ISZA 5FB2A 2L54A 4CDGA 5F1RA 3U9GA 5CLSA 2H94A 1QQIA 3RIRA 2IPQX 2IA2A 3E5UA 5LHHA 3Q5FA 1IN4A 2ZNYA 3ZQ7A 4AIJA 2ZXJA 2QUFA 2JSCA 3KEOA 2V1UA 4RB1A 4ENMA 1LEBA 2P5KA 3WTUC 4LG0B 3FMQA 2MH9A 1YIOA 3GFLA 4A0ZA 3WTWC 2E1CA 1L3LA 1IF1A 1LEAA 1HW2A 1QPMA 1R5HA 3COAC 3KP4A 1USSA 4OMZA 4KA4A 1YW8A 4PGGA 1IXCA 5L3BA 1C0WA 2A61A 2HGCA 3C18A 4KIGA 4QLCU 1PP7U 1XGMA 1LJ9A 2O0YA 2PEXA 1FNNA 1QZYA 4OU0A 1O3RA 2DW4A 3FMRA 4HW0A 3WE3A 1I1SA 1A04A 1U3EM 2O6GE 2XAQA 3HSFA 3HRUA 1W4MA 3R0JA 2V6CA 1EV7A 2QBYA 5H20A 1FBQA 2L02A 3SHFA 3L2CA 2BV6A 2Q2EA 3V8JA 2XAHA 3ZMTA 2BE5F 1KQ8A 4I98B 1F9NA 1BI0A 2ZNZA 5FO5A 2RGVA 2XAFA 1HXDA 3ZMDA 5A2QK 3BJAA 2COMA 4YG2F 2L3DA 2EFNA 2A6EF 5IT9K 3RPUA 4GO1A 3G3ZA 4S05A 4OIPF 5DEQA 1U8RA 1FZPB 1J5YA 5HS9A 1JGSA 2Z3YA 3B02A 4I0BA 4CZZA 1T98A 1TLHB 5EEHA 2EFOA 1Z05A 3DP7A 3ELKA 1ZRCA 5DUIA 3F72A 3GW2A 2NYXA 3M8EA 3RYPA 2CSOA 2EJRA 2HKXA 5HLHA 3H3ZA 4OOIA 4LB5A 1SFEA 2FOKA 4RGUA 3VEPA 5TJJA 1F4KA 1MKMA 2JPCA 1MJAA 2MBFA 2RC4A 4O6JA 3G73A 2LF7A 4G8XA 4LLNA 2ZMEA 1REPC 1ZRDA 3BJ6A 5CVRA 3T5XA 2M5WA 2FMLA 1QGPA 2GWRA 1FSEA 1F5TA 2DPUA 5ILUA 1WRJA 1ZLJA 5JHUA 1QZZA 2HKOA 2D45A 2DBBA 1VTNC 3K69A 3N4MA 5D4SA 1YQAA 4UVAA 1KU3A 2V1XA 3HTUA 3I4PA 4NB5A 1XMKA 3KP2A 1CGPA 1Z9CA 1J2XA 1KQ0A 2DQRA 4HX4A 4I2OA 3K9TA 1K79A 4U88A 1CF7A 1ONVA 2ACJA 3R60A 4R8HA 3LA7A 5FFXA 2DI3A 3F22A 2FF4A 2MA3A 3HOSA 1UCRA 4IHSA 4HA8A 4OIQF 1YLFA 4GXOA 4U0WA 2WC2A 1LNWA 4EJUA 3ERED 3MCZA 1RZ4A 2Y48A 2PLYA 1TW3A 5E20A 2GQQA 1FT9A 2ISYA 3QAHA 4I02A 1RI7A 3R4KA 5F6FA 1G4DA 4M73A 4CYDA 1DUXC 4BHCA 3IRRA 2FEZA 1I5ZA 4E70A 4A6DA 5D5VB 3U1DA 2VE9A 4TV7A 2CGPA 1XGSA 1UHMA 2ZO4A 4A5NA 2IW5A 3J81K 3SZTA 4I01A 1ZHFA 5E1ZB 2K7LA 1BM9A 2HTJA 2QVOA 3QOPA 1J0RA 4ZZLA 3O6BB 2OU2A 1TTYA 1KU7A 4BXUA 1BIAA 4M9ZA 1B9NA 2P5LC 2W84A 3SQNA 3FX3A 5E1XA 1B1BA 1FC3A 1FBSA 4DQ2A 5E1WA 1HW1A 4Y13A 1P92A 2H6BA 2BGCA 5LEJA 3TKYA 4KUMA 1BC7C 2PI0A 5CYVA 3QRFF 3BWGA 2O3FA 5CJ9A 1ZREA 2E1NA 3LQQA 4IVNA 2QBYB 3CUOA 4A2UA 4Q5SF 4ENNA 3F8BA 2DQLA 4MEXF 3BJOA 5HS8A 3GYHX 2C6YA 3E97A 5CVIA 3HSRA 5LHIA 4WCGA 1YYVA 3HRMA 1XSXA 1R7JA 1ZAOA 2W57A 1YFHA 2D1HA 2WTEA 1YG2A 4IRHA 2J5OA 1OYYA 5D6FA 5HLGA 2KJBA 2NNYA 2FBIA 4GCVA 5L3CA 4BH9A 4P5OA 1S8NA 1HQCA 2HQRA 3W6JB 3TOBA 3DFGA 4GGGA 2YPRA 5DD4A 4CGZA 4FT8A 3KP3A 1MZBA 3QP6A 3ABUA 2ETHA 5D5WB 2R7DA 1KYWA 1LQ1A 1I27A 3IWZA 2WV0A 4WF2A 1JHFA 4KMFA 1Z7UA 1HKSA 1AWCA 4MTEA 1R23A 3KP7A 4HQMA 2PG4A 4BHPA 3TDZC 2HS5A 3CUQA 2QM3A 4ZZDA 2VT2A 5HVQC 2UZKA 4OINF 4KNYA 4RGSA 3H92A 4CXFA 4EV0A 1H9GA 3ECHA 1RUNA 4PGHA 3GF2A 3DQVC 3HYIA 1Z91A 2FBKA 4LLGF 3C1DA 4RAYA 5J6XA 4DNCA 3KP6A 4LLLA 1ZG1A 1YW9A 3VODA 1FOKA 4LB6B 3DEUA 5JR3A 2V1DA 3LSTA 1CF7B 3BPVA 3EYIA 4WXHA 1BI1A 4XRFA 4HX7A 3REOA 4BAYA 2Z9OA 1NHAA 4YFKF 5K5QA 1B4AA 5E8IA 4BNCA 5DV5A 2FBHA 3B73A 3LFKA 2XV4S 4KYWA 3KZZA 2L4MA 3ISPA 3DPLC 4G7OF 2G9WA 3ZN1A 3IHUA 4ESFA 2RVCA 4AD9A 2E7WA 3GVAA 1W7PD 2NAZA 1R22A 1W7PA 1UB9A 1T0FA 2EA2A 1FYKA 2VC1A 3V7CA 3Q9SA 3WTXC 3HSEA 1ZN2A 4UV9A 1O7FA 2W24A 2K27A 1B6AA 3E6CC 5HDKA 2K4BA 1BC8C 1DP7P 4EMSA 4KMUX 1OPCA 1IXSB 4HLXA 4KN4X 2NNNA 2PJPA 5FLXZ 2ELHA 2Z33A 4EM1A 3E6DA 3C3WA 4XSZF 2VBZA 1ZLKA 2G7UA 4HQEA 5LRSA 2EFPA 1R36A 2Q8KA 2F2EA 4LK1F 5D5UB 3KFWX 3LWFA 1GXPA 3V7SA 1QO0D 3ZP5A 3QPHA 1EH7A 4GYIA 1RNLA 3E5XA 2JT1A 1R5GA 1O3TA 1YS6A 3E6BA 2HYGD 1XDSA 1JHHA 3K1PA 1ZG3A 2V9VA 2EFQA 2BBYA 1J9IA 2FNAA 4KT5C 4L5JA 1UFMA 2VBYA 2HFHA 2EB7A 3MZHA 4EJVA 2QENA 5EEGA 3M1EA 2ZJ2A 1USTA 1W5TA 1UHWA 2XROA 3BY6A 1IN8A 3KP5A 5E18F 4IXAA 2DO7A 3GFJA 4G94A 1RUOA 2JTVA 1TNTA 1MJ9A 4JQFA 2MH2A 1FP2A 1HSJA 5LBQA 3GX4X 2A68F 4RB3C 2K86A 4M71A 3D5LA 2A6HF 4KDPA 5HDNA 2VC0A 5HDGA 4ESJA 4ETSA 1S7AA 3CO7C 3DPTA 4U0VA 2CWEA 5AIPA 4L9VA 3FXRA 4U0YA 4NQWA 1E17A 2STTA 4HYEA 4MTDA 4QWQA 2M30A 4GYGA 4R1HA 5FD6A 3WTYC 3CO6C 3BP8A 4WK8F 2K02A 1WI9A 2DU9A 1SMTA 3P9IA 1WQ2A 2FNPA 3LAJA 2IRFG 3CJNA 1XCBA 2PBIA 2O61A 3CUQB 3HHHA 2RNJA 4RGRA 2K4JA 1H9TA 4BYYA 1XSVA 1OR7A 4B09A 3O3KA 5IT3A 3I71A 2QZ8A 5DCMA 4M9SA 2HTSA 3R6SA 2KJCA 2GXBA 2F5EA 2GAUA 1L0OC 3ZMSA 2EWNA 4HX8A 5D8KB 1R1VA 3WTZA 4HLYA 5BPIA 3ZMUA 3L7WA 2KIMA 1SAXA 5DCFA 3HOTA 2OBPA 1OKRA 1XDUA 4IHTA 1U5TA 3WGIA 2IVMA 2ESHA 1S7OA 1K78A 1WKMA 2WWYA 5ED4A 4MGRA 5ILVA 2AS5F 3FHZA 2UXNA 2E7XA 3SXYA 2Y0MA 4RB0A 2FU4A 2P6SA 1DDNA 1IN7A 5FFZA 5D8LB 3WTTC 3EETA 2L4AA 1W7PB 5K5RA 5DDGA 1J7KA 2MLGA 5E8GA 3I0TA 1TBXA 3GUDA 5BMZA 4G7ZF 1I6XA 2LF8A 3SFZA 3WE2A 3TDUC 2VODA 2VBXA 3TO7A 1LDKB 2QQ9A 1P6RA 1IZ1A 1FPQA 4B8XA 3ML6A 4UHTA 3I5UA 4EM0B 1ZGAA 3PQJA 4PDKA 4OMYA 1G3SA 3ECOA 1IAWA 3F8NA 5BOXA 2MC3A 4UV8A 1IRFA 4ENJA 1MDMA 1KGSA 4M9XA 4S04A 1YW7A 1J59A 3IWFA 4XSXF 4A0XA 3I53A 1FBUA 1T6SA 1ULYA 2RV8A 2F5DA 4FX4A 5KVRA 1K7AA 2PQ8A 1H0MA 2H6CA 4UNOA 1O3QA 4L0YB 1S6LA 3J80Z 4K2EA 5DYMA 2VT3A 2LDUA 3HRTA 3VB2A 1R1UA 2EV6A 3FMSA 4MHGA 5LHGA 5FGMA 1ZRFA 3HTSB 2XHKA 2FMYA 4RAZA 3PFIA 3K1MA 4A0YA 2PN6A 2XRNA 3M9AA 4HV5A 1SFUA 4KFCA 5DD8A 1OYIA 2VN2A 5HS7A 1ZARA 2IT0A 3BDDA 4WWCA 4HBLA 4CO8A 2V79A 1DPUA 3CUQC 1U78A 4I0AA 1XSDA 3V8LA 3ZMVA 1LDJA 2A07F 2O8XA 1B59A 4M6YA 2M45A 2ZBKA 3FZVA 4XBFA 2P4WA 5BPDA 1XGNA 5D4RA 4R79A 3CTAA 1G3TA 4EJWA 1FWZA 3ULQB 4FHTA 3JW4A 4O3MA 3RTRA 1GVJA 2R7FA 3D0SA 4AIKA 3GFIA 2P6TA 1BOAA 3U2RA 1KU2A 1BI2A 2Q0OA 4EQQA 4BQAA 4AWXB 2GZWA 3J81Z 3BZ6A 3MEXA 3RYRA 2STWA 2CO5A 2XASA 2XAJA 2KIFA 3JAMZ 5K1YA 3WGGA 2XKOA 3JSPA 3WGHA 5JI6A 1FYLA 3GLXA 5DCMB 3AAFA 4ON0A 3V8KA 1P4WA 1XMAA 2M8EA 1S29A 2ZMEB 3L00A 5ICFA 2VXZA 2OAZA 2QLZA 2LKPA 5ERIA 2AXLA 3DV8A 1U6GA 2XUBA 4LK0F 3I59A 3E5QA 1P4AA 2PFBA 2D1VA 1ZG5A 1U5TB 1R58A 2CG4A 1TNSA 3T1BA 3MQ0A 2YU3A 2FA5A 2CW0F 3DXJF 2Z99A 1ON2A 3R0AA 3TOAA 1EH6A 1D8KA 1S3JA 4YIIA 3QU6A 3L9FA 4MNUA 2G7HA 3KEQA 4HF2A 1IW7F 2KIUA 2A69F 1XB4A 3FM3A 3GFMA 1IN6A 3T8RA 4ZYEA 4YFNF 4KICA 4I7HA 3I64A 2D2WA 2HYFA 3F8FA 3LA3A 1BI3A 2OZUA 3F6OA 4O5VA 2DT5A 2DK5A 2DAOA 4LJZF 3MFKA 4IRGA 2R3SA 2VOOA 3I58A 4L9JA 1P4XA 1BIBA 2OQGA 5LGNA 1GXQA 1V3FA 2MLKA 1MDMB 4G6QA 3NEUA 1R00A 2VE8A 4CICA 3W6KB 4IPAA 4L9NA 5J8FA 1FY7A 2HEOA 3WG9A 4HDUA 1G3WA 3WTSC 4EGYA 1OYWA 3O2PE 1MJBA 3WU0A 3T8TA 2X0LA 4EGZA 2YX4A 3V7RA 5K5OA 2FQ3A 3K0LA 4XLNF 4YFXF 4P55A 1D5VA 2IA1A 3P9KA 3WTVC 1LB2A 3DF8A 5LRRA 1MD0A 2GIVA 2RQPA 4ZYHA 3IRQA 1IXRC 1TW2A 3GZ6A 2P7VB 1ON1A 2EV5A 4XLPF 3RKYA 1KA8A 3EDPA 2PMHA 1RIOH 5D5XB 3KLOA 3J7AO 5H6RA 2RDPA 3GWZA 2RKHA 1SD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MEY F;  2H27 A;  5CVV A;  3FF5 A;  5LLQ A;  5LGU A;  3WU1 B;  1SD5 A;  4LD5 A;  2DTR A;  3GEZ A;  4PCQ A;  3OV8 A;  4N9I A;  4RS8 A;  5LEK A;  4Y17 A;  5CVU A;  1IUY A;  2QQB A;  2IJL A;  1QNT A;  3TO9 A;  1U2W A;  4JK1 X;  1KYZ A;  2OA4 A;  5LGT A;  3F21 A;  4LGW A;  5HOO A;  4U7B A;  2DFI A;  3KE2 A;  2TDX A;  5E17 F;  1U5T C;  2ADU A;  4HZF A;  1IRG A;  4Q4Z F;  3E6M A;  2Y75 A;  3F6V A;  3GZ5 A;  1B9M A;  4KIB A;  3LQR A;  1Y0U A;  4M72 A;  4Q47 A;  1HKT A;  5ICG A;  3EYY A;  3RJP A;  1Q1H A;  4HF1 A;  4LMY A;  2VOP A;  2LNB A;  2EA4 A;  3RDI A;  2IP2 A;  3LAP A;  4F7Z A;  1HST A;  2GXG A;  4ZYD A;  5TRD A;  4FX0 A;  1SFX A;  3TQN A;  4P96 A;  3CDH A;  5AIQ A;  5F64 A;  5AON A;  2XAG A;  2M87 A;  1XCV A;  4ZYG A;  2OZ6 A;  4UXN A;  3BPX A;  3HUG A;  2EK5 A;  1PP8 F;  3I59 B;  4WX9 A;  1O57 A;  1FSH A;  3IKT A;  2F5F A;  2YSR A;  2CFX A;  3PQK A;  4HDV A;  1J75 A;  2ZKZ A;  2CQK A;  5D6E A;  3IC7 A;  2BEO A;  3L09 A;  4N9H A;  1TQP A;  1W5S A;  2X4H A;  3J80 K;  1WWX A;  3QPT A;  5L3D A;  1Z1D A;  4UUV A;  2GA1 A;  4N0B A;  3CLO A;  1SD4 A;  1ZGJ A;  4EJO A;  2JRT A;  3M8F A;  3FWE A;  3BOQ A;  4HAM A;  3WOD F;  4EVI A;  2A3S A;  4UVB A;  4IRI A;  5J8C A;  2O03 A;  1E2X A;  2VON A;  1R1T A;  4OIR F;  1F1Z A;  2NS0 A;  5A2Q Z;  1FX7 A;  1GHC A;  4L9T A;  2JPB A;  1X3U A;  2ESN A;  2CYY A;  3M7G A;  4AVP A;  3KET A;  5IT9 Z;  4EJT A;  2NRA C;  3QU3 A;  3KZY A;  5BQT A;  1P2F A;  1HBX G;  2DLL A;  5L3E A;  1BBY A;  4KIF A;  4G6D A;  3H3U A;  4JBA A;  2JZY A;  4U7D A;  3GO5 A;  3F23 A;  1YO5 C;  2QWW A;  1STZ A;  1OMI A;  5CVJ A;  3JTG A;  1KU9 A;  3HHG A;  3KCC A;  1KQ9 A;  2RN7 A;  2J5P A;  3BRO A;  2EFW A;  4IF4 A;  4ASN A;  2A5Y B;  3EQL F;  3ABT A;  1BN5 A;  1QBJ A;  3K2Z A;  1YS7 A;  1XN7 A;  2B0L A;  4Z2Y A;  5HLI A;  2Z5U A;  2FE3 A;  4CHU A;  1T39 A;  2LSO A;  3JAM K;  4RGX A;  5ICC A;  2P5V A;  4G7H F;  4EM2 A;  5DUK A;  4G9Y A;  3LA2 A;  4LG0 A;  2GA2 A;  2L01 A;  3ZN0 A;  3RPQ A;  3K1N A;  1BJA A;  1I1G A;  4D0P A;  2MD5 A;  1TQM A;  3VFZ A;  4L5I A;  1ZYR F;  4WXC A;  4P9U A;  2FRH A;  3NRV A;  5JVT A;  1O3S A;  2VBW A;  2KKO A;  3R61 A;  1MGT A;  2OD5 A;  3F3X A;  2P7C B;  3SZP A;  2HOE A;  1HKQ A;  3MWM A;  2XKP A;  4ESB A;  1LVA A;  2DPD A;  4A5M A;  4HF0 A;  3I54 A;  6PAX A;  3FM5 A;  4HV6 A;  3C7J A;  1T2K A;  1AOY A;  1ZH5 A;  3ROU A;  1FP1 D;  4I09 A;  1FYM A;  5L3F A;  3NQO A;  1G6N A;  4RB2 C;  3EUH A;  5JFR A;  2QYO A;  4YIF A;  2HQN A;  4KN7 X;  2HDC A;  3DKW A;  4P9F A;  4M74 A;  1SD7 A;  5FD5 A;  2DK8 A;  3TGN A;  4NHJ A;  4M6X A;  1EH8 A;  1LDD A;  2QQA A;  4AIH A;  3F8M A;  2ZFW A;  4UVC A;  1JE8 A;  1FLI A;  1D8J A;  4ZH4 F;  3TO6 A;  3VOE A;  4L0Z B;  2W25 A;  2YR2 A;  5FLX K;  4H0E A;  4Y15 A;  1HW5 A;  4HOB A;  2PMU A;  1T38 A;  2HWV A;  2UXX A;  1XD7 A;  3IL2 A;  2FXA A;  1O7L A;  3P7N A;  2OQR A;  3F8C A;  2ZCW A;  3MAJ A;  1TQI A;  3RI4 A;  4L18 B;  3MZY A;  2HZT A;  5KK1 A;  2KRF A;  3RKW A;  1K6O A;  4A6E A;  3ZPL A;  3FXQ A;  2XGX A;  1JXS A;  4Q48 A;  3E3V A;  1IN5 A;  2IA0 A;  4ENK A;  2P8T A;  2M1B A;  1K78 B;  1PDN C;  4IJA A;  3Q9V A;  3V4G A;  3JSO A;  2YX7 A;  2H09 A;  2W85 A;  3ZMZ A;  3HIF A;  5ILS A;  3RKX A;  2HR3 A;  1SMY F;  3T0Y A;  3P9C A;  4OIO F;  2XIG A;  1D3Y A;  3OOP A;  3KLN A;  2BYV E;  5ICE A;  4A12 A;  2UWM A;  4PZJ A;  1WSU A;  2EV0 A;  4WXD A;  1Z6T A;  3JTH A;  3GXO A;  1Z6R A;  3FXU A;  5L3G A;  4BHB A;  1XGO A;  2FSW A;  2XVC A;  5H6Q A;  3N97 A;  1G3Y A;  1V4R A;  4MQ9 F;  3HRS A;  3S2W A;  1YTY A;  4MQV A;  1ODD A;  2F5C A;  5BS6 A;  3QP5 A;  1DPR A;  1PUE E;  3IKV A;  4LFU A;  2ISZ A;  5FB2 A;  2L54 A;  4CDG A;  5F1R A;  3U9G A;  5CLS A;  2H94 A;  1QQI A;  3RIR A;  2IPQ X;  2IA2 A;  3E5U A;  5LHH A;  3Q5F A;  1IN4 A;  2ZNY A;  3ZQ7 A;  4AIJ A;  2ZXJ A;  2QUF A;  2JSC A;  3KEO A;  2V1U A;  4RB1 A;  4ENM A;  1LEB A;  2P5K A;  3WTU C;  4LG0 B;  3FMQ A;  2MH9 A;  1YIO A;  3GFL A;  4A0Z A;  3WTW C;  2E1C A;  1L3L A;  1IF1 A;  1LEA A;  1HW2 A;  1QPM A;  1R5H A;  3COA C;  3KP4 A;  1USS A;  4OMZ A;  4KA4 A;  1YW8 A;  4PGG A;  1IXC A;  5L3B A;  1C0W A;  2A61 A;  2HGC A;  3C18 A;  4KIG A;  4QLC U;  1PP7 U;  1XGM A;  1LJ9 A;  2O0Y A;  2PEX A;  1FNN A;  1QZY A;  4OU0 A;  1O3R A;  2DW4 A;  3FMR A;  4HW0 A;  3WE3 A;  1I1S A;  1A04 A;  1U3E M;  2O6G E;  2XAQ A;  3HSF A;  3HRU A;  1W4M A;  3R0J A;  2V6C A;  1EV7 A;  2QBY A;  5H20 A;  1FBQ A;  2L02 A;  3SHF A;  3L2C A;  2BV6 A;  2Q2E A;  3V8J A;  2XAH A;  3ZMT A;  2BE5 F;  1KQ8 A;  4I98 B;  1F9N A;  1BI0 A;  2ZNZ A;  5FO5 A;  2RGV A;  2XAF A;  1HXD A;  3ZMD A;  5A2Q K;  3BJA A;  2COM A;  4YG2 F;  2L3D A;  2EFN A;  2A6E F;  5IT9 K;  3RPU A;  4GO1 A;  3G3Z A;  4S05 A;  4OIP F;  5DEQ A;  1U8R A;  1FZP B;  1J5Y A;  5HS9 A;  1JGS A;  2Z3Y A;  3B02 A;  4I0B A;  4CZZ A;  1T98 A;  1TLH B;  5EEH A;  2EFO A;  1Z05 A;  3DP7 A;  3ELK A;  1ZRC A;  5DUI A;  3F72 A;  3GW2 A;  2NYX A;  3M8E A;  3RYP A;  2CSO A;  2EJR A;  2HKX A;  5HLH A;  3H3Z A;  4OOI A;  4LB5 A;  1SFE A;  2FOK A;  4RGU A;  3VEP A;  5TJJ A;  1F4K A;  1MKM A;  2JPC A;  1MJA A;  2MBF A;  2RC4 A;  4O6J A;  3G73 A;  2LF7 A;  4G8X A;  4LLN A;  2ZME A;  1REP C;  1ZRD A;  3BJ6 A;  5CVR A;  3T5X A;  2M5W A;  2FML A;  1QGP A;  2GWR A;  1FSE A;  1F5T A;  2DPU A;  5ILU A;  1WRJ A;  1ZLJ A;  5JHU A;  1QZZ A;  2HKO A;  2D45 A;  2DBB A;  1VTN C;  3K69 A;  3N4M A;  5D4S A;  1YQA A;  4UVA A;  1KU3 A;  2V1X A;  3HTU A;  3I4P A;  4NB5 A;  1XMK A;  3KP2 A;  1CGP A;  1Z9C A;  1J2X A;  1KQ0 A;  2DQR A;  4HX4 A;  4I2O A;  3K9T A;  1K79 A;  4U88 A;  1CF7 A;  1ONV A;  2ACJ A;  3R60 A;  4R8H A;  3LA7 A;  5FFX A;  2DI3 A;  3F22 A;  2FF4 A;  2MA3 A;  3HOS A;  1UCR A;  4IHS A;  4HA8 A;  4OIQ F;  1YLF A;  4GXO A;  4U0W A;  2WC2 A;  1LNW A;  4EJU A;  3ERE D;  3MCZ A;  1RZ4 A;  2Y48 A;  2PLY A;  1TW3 A;  5E20 A;  2GQQ A;  1FT9 A;  2ISY A;  3QAH A;  4I02 A;  1RI7 A;  3R4K A;  5F6F A;  1G4D A;  4M73 A;  4CYD A;  1DUX C;  4BHC A;  3IRR A;  2FEZ A;  1I5Z A;  4E70 A;  4A6D A;  5D5V B;  3U1D A;  2VE9 A;  4TV7 A;  2CGP A;  1XGS A;  1UHM A;  2ZO4 A;  4A5N A;  2IW5 A;  3J81 K;  3SZT A;  4I01 A;  1ZHF A;  5E1Z B;  2K7L A;  1BM9 A;  2HTJ A;  2QVO A;  3QOP A;  1J0R A;  4ZZL A;  3O6B B;  2OU2 A;  1TTY A;  1KU7 A;  4BXU A;  1BIA A;  4M9Z A;  1B9N A;  2P5L C;  2W84 A;  3SQN A;  3FX3 A;  5E1X A;  1B1B A;  1FC3 A;  1FBS A;  4DQ2 A;  5E1W A;  1HW1 A;  4Y13 A;  1P92 A;  2H6B A;  2BGC A;  5LEJ A;  3TKY A;  4KUM A;  1BC7 C;  2PI0 A;  5CYV A;  3QRF F;  3BWG A;  2O3F A;  5CJ9 A;  1ZRE A;  2E1N A;  3LQQ A;  4IVN A;  2QBY B;  3CUO A;  4A2U A;  4Q5S F;  4ENN A;  3F8B A;  2DQL A;  4MEX F;  3BJO A;  5HS8 A;  3GYH X;  2C6Y A;  3E97 A;  5CVI A;  3HSR A;  5LHI A;  4WCG A;  1YYV A;  3HRM A;  1XSX A;  1R7J A;  1ZAO A;  2W57 A;  1YFH A;  2D1H A;  2WTE A;  1YG2 A;  4IRH A;  2J5O A;  1OYY A;  5D6F A;  5HLG A;  2KJB A;  2NNY A;  2FBI A;  4GCV A;  5L3C A;  4BH9 A;  4P5O A;  1S8N A;  1HQC A;  2HQR A;  3W6J B;  3TOB A;  3DFG A;  4GGG A;  2YPR A;  5DD4 A;  4CGZ A;  4FT8 A;  3KP3 A;  1MZB A;  3QP6 A;  3ABU A;  2ETH A;  5D5W B;  2R7D A;  1KYW A;  1LQ1 A;  1I27 A;  3IWZ A;  2WV0 A;  4WF2 A;  1JHF A;  4KMF A;  1Z7U A;  1HKS A;  1AWC A;  4MTE A;  1R23 A;  3KP7 A;  4HQM A;  2PG4 A;  4BHP A;  3TDZ C;  2HS5 A;  3CUQ A;  2QM3 A;  4ZZD A;  2VT2 A;  5HVQ C;  2UZK A;  4OIN F;  4KNY A;  4RGS A;  3H92 A;  4CXF A;  4EV0 A;  1H9G A;  3ECH A;  1RUN A;  4PGH A;  3GF2 A;  3DQV C;  3HYI A;  1Z91 A;  2FBK A;  4LLG F;  3C1D A;  4RAY A;  5J6X A;  4DNC A;  3KP6 A;  4LLL A;  1ZG1 A;  1YW9 A;  3VOD A;  1FOK A;  4LB6 B;  3DEU A;  5JR3 A;  2V1D A;  3LST A;  1CF7 B;  3BPV A;  3EYI A;  4WXH A;  1BI1 A;  4XRF A;  4HX7 A;  3REO A;  4BAY A;  2Z9O A;  1NHA A;  4YFK F;  5K5Q A;  1B4A A;  5E8I A;  4BNC A;  5DV5 A;  2FBH A;  3B73 A;  3LFK A;  2XV4 S;  4KYW A;  3KZZ A;  2L4M A;  3ISP A;  3DPL C;  4G7O F;  2G9W A;  3ZN1 A;  3IHU A;  4ESF A;  2RVC A;  4AD9 A;  2E7W A;  3GVA A;  1W7P D;  2NAZ A;  1R22 A;  1W7P A;  1UB9 A;  1T0F A;  2EA2 A;  1FYK A;  2VC1 A;  3V7C A;  3Q9S A;  3WTX C;  3HSE A;  1ZN2 A;  4UV9 A;  1O7F A;  2W24 A;  2K27 A;  1B6A A;  3E6C C;  5HDK A;  2K4B A;  1BC8 C;  1DP7 P;  4EMS A;  4KMU X;  1OPC A;  1IXS B;  4HLX A;  4KN4 X;  2NNN A;  2PJP A;  5FLX Z;  2ELH A;  2Z33 A;  4EM1 A;  3E6D A;  3C3W A;  4XSZ F;  2VBZ A;  1ZLK A;  2G7U A;  4HQE A;  5LRS A;  2EFP A;  1R36 A;  2Q8K A;  2F2E A;  4LK1 F;  5D5U B;  3KFW X;  3LWF A;  1GXP A;  3V7S A;  1QO0 D;  3ZP5 A;  3QPH A;  1EH7 A;  4GYI A;  1RNL A;  3E5X A;  2JT1 A;  1R5G A;  1O3T A;  1YS6 A;  3E6B A;  2HYG D;  1XDS A;  1JHH A;  3K1P A;  1ZG3 A;  2V9V A;  2EFQ A;  2BBY A;  1J9I A;  2FNA A;  4KT5 C;  4L5J A;  1UFM A;  2VBY A;  2HFH A;  2EB7 A;  3MZH A;  4EJV A;  2QEN A;  5EEG A;  3M1E A;  2ZJ2 A;  1UST A;  1W5T A;  1UHW A;  2XRO A;  3BY6 A;  1IN8 A;  3KP5 A;  5E18 F;  4IXA A;  2DO7 A;  3GFJ A;  4G94 A;  1RUO A;  2JTV A;  1TNT A;  1MJ9 A;  4JQF A;  2MH2 A;  1FP2 A;  1HSJ A;  5LBQ A;  3GX4 X;  2A68 F;  4RB3 C;  2K86 A;  4M71 A;  3D5L A;  2A6H F;  4KDP A;  5HDN A;  2VC0 A;  5HDG A;  4ESJ A;  4ETS A;  1S7A A;  3CO7 C;  3DPT A;  4U0V A;  2CWE A;  5AIP A;  4L9V A;  3FXR A;  4U0Y A;  4NQW A;  1E17 A;  2STT A;  4HYE A;  4MTD A;  4QWQ A;  2M30 A;  4GYG A;  4R1H A;  5FD6 A;  3WTY C;  3CO6 C;  3BP8 A;  4WK8 F;  2K02 A;  1WI9 A;  2DU9 A;  1SMT A;  3P9I A;  1WQ2 A;  2FNP A;  3LAJ A;  2IRF G;  3CJN A;  1XCB A;  2PBI A;  2O61 A;  3CUQ B;  3HHH A;  2RNJ A;  4RGR A;  2K4J A;  1H9T A;  4BYY A;  1XSV A;  1OR7 A;  4B09 A;  3O3K A;  5IT3 A;  3I71 A;  2QZ8 A;  5DCM A;  4M9S A;  2HTS A;  3R6S A;  2KJC A;  2GXB A;  2F5E A;  2GAU A;  1L0O C;  3ZMS A;  2EWN A;  4HX8 A;  5D8K B;  1R1V A;  3WTZ A;  4HLY A;  5BPI A;  3ZMU A;  3L7W A;  2KIM A;  1SAX A;  5DCF A;  3HOT A;  2OBP A;  1OKR A;  1XDU A;  4IHT A;  1U5T A;  3WGI A;  2IVM A;  2ESH A;  1S7O A;  1K78 A;  1WKM A;  2WWY A;  5ED4 A;  4MGR A;  5ILV A;  2AS5 F;  3FHZ A;  2UXN A;  2E7X A;  3SXY A;  2Y0M A;  4RB0 A;  2FU4 A;  2P6S A;  1DDN A;  1IN7 A;  5FFZ A;  5D8L B;  3WTT C;  3EET A;  2L4A A;  1W7P B;  5K5R A;  5DDG A;  1J7K A;  2MLG A;  5E8G A;  3I0T A;  1TBX A;  3GUD A;  5BMZ A;  4G7Z F;  1I6X A;  2LF8 A;  3SFZ A;  3WE2 A;  3TDU C;  2VOD A;  2VBX A;  3TO7 A;  1LDK B;  2QQ9 A;  1P6R A;  1IZ1 A;  1FPQ A;  4B8X A;  3ML6 A;  4UHT A;  3I5U A;  4EM0 B;  1ZGA A;  3PQJ A;  4PDK A;  4OMY A;  1G3S A;  3ECO A;  1IAW A;  3F8N A;  5BOX A;  2MC3 A;  4UV8 A;  1IRF A;  4ENJ A;  1MDM A;  1KGS A;  4M9X A;  4S04 A;  1YW7 A;  1J59 A;  3IWF A;  4XSX F;  4A0X A;  3I53 A;  1FBU A;  1T6S A;  1ULY A;  2RV8 A;  2F5D A;  4FX4 A;  5KVR A;  1K7A A;  2PQ8 A;  1H0M A;  2H6C A;  4UNO A;  1O3Q A;  4L0Y B;  1S6L A;  3J80 Z;  4K2E A;  5DYM A;  2VT3 A;  2LDU A;  3HRT A;  3VB2 A;  1R1U A;  2EV6 A;  3FMS A;  4MHG A;  5LHG A;  5FGM A;  1ZRF A;  3HTS B;  2XHK A;  2FMY A;  4RAZ A;  3PFI A;  3K1M A;  4A0Y A;  2PN6 A;  2XRN A;  3M9A A;  4HV5 A;  1SFU A;  4KFC A;  5DD8 A;  1OYI A;  2VN2 A;  5HS7 A;  1ZAR A;  2IT0 A;  3BDD A;  4WWC A;  4HBL A;  4CO8 A;  2V79 A;  1DPU A;  3CUQ C;  1U78 A;  4I0A A;  1XSD A;  3V8L A;  3ZMV A;  1LDJ A;  2A07 F;  2O8X A;  1B59 A;  4M6Y A;  2M45 A;  2ZBK A;  3FZV A;  4XBF A;  2P4W A;  5BPD A;  1XGN A;  5D4R A;  4R79 A;  3CTA A;  1G3T A;  4EJW A;  1FWZ A;  3ULQ B;  4FHT A;  3JW4 A;  4O3M A;  3RTR A;  1GVJ A;  2R7F A;  3D0S A;  4AIK A;  3GFI A;  2P6T A;  1BOA A;  3U2R A;  1KU2 A;  1BI2 A;  2Q0O A;  4EQQ A;  4BQA A;  4AWX B;  2GZW A;  3J81 Z;  3BZ6 A;  3MEX A;  3RYR A;  2STW A;  2CO5 A;  2XAS A;  2XAJ A;  2KIF A;  3JAM Z;  5K1Y A;  3WGG A;  2XKO A;  3JSP A;  3WGH A;  5JI6 A;  1FYL A;  3GLX A;  5DCM B;  3AAF A;  4ON0 A;  3V8K A;  1P4W A;  1XMA A;  2M8E A;  1S29 A;  2ZME B;  3L00 A;  5ICF A;  2VXZ A;  2OAZ A;  2QLZ A;  2LKP A;  5ERI A;  2AXL A;  3DV8 A;  1U6G A;  2XUB A;  4LK0 F;  3I59 A;  3E5Q A;  1P4A A;  2PFB A;  2D1V A;  1ZG5 A;  1U5T B;  1R58 A;  2CG4 A;  1TNS A;  3T1B A;  3MQ0 A;  2YU3 A;  2FA5 A;  2CW0 F;  3DXJ F;  2Z99 A;  1ON2 A;  3R0A A;  3TOA A;  1EH6 A;  1D8K A;  1S3J A;  4YII A;  3QU6 A;  3L9F A;  4MNU A;  2G7H A;  3KEQ A;  4HF2 A;  1IW7 F;  2KIU A;  2A69 F;  1XB4 A;  3FM3 A;  3GFM A;  1IN6 A;  3T8R A;  4ZYE A;  4YFN F;  4KIC A;  4I7H A;  3I64 A;  2D2W A;  2HYF A;  3F8F A;  3LA3 A;  1BI3 A;  2OZU A;  3F6O A;  4O5V A;  2DT5 A;  2DK5 A;  2DAO A;  4LJZ F;  3MFK A;  4IRG A;  2R3S A;  2VOO A;  3I58 A;  4L9J A;  1P4X A;  1BIB A;  2OQG A;  5LGN A;  1GXQ A;  1V3F A;  2MLK A;  1MDM B;  4G6Q A;  3NEU A;  1R00 A;  2VE8 A;  4CIC A;  3W6K B;  4IPA A;  4L9N A;  5J8F A;  1FY7 A;  2HEO A;  3WG9 A;  4HDU A;  1G3W A;  3WTS C;  4EGY A;  1OYW A;  3O2P E;  1MJB A;  3WU0 A;  3T8T A;  2X0L A;  4EGZ A;  2YX4 A;  3V7R A;  5K5O A;  2FQ3 A;  3K0L A;  4XLN F;  4YFX F;  4P55 A;  1D5V A;  2IA1 A;  3P9K A;  3WTV C;  1LB2 A;  3DF8 A;  5LRR A;  1MD0 A;  2GIV A;  2RQP A;  4ZYH A;  3IRQ A;  1IXR C;  1TW2 A;  3GZ6 A;  2P7V B;  1ON1 A;  2EV5 A;  4XLP F;  3RKY A;  1KA8 A;  3EDP A;  2PMH A;  1RIO H;  5D5X B;  3KLO A;  3J7A O;  5H6R A;  2RDP A;  3GWZ A;  2RKH A;  1SD6 A; 
#chains in the Genus database with same CATH topology
 1TT5 B;  4MEY F;  2H27 A;  5CVV A;  3FF5 A;  2COB A;  2JSP A;  5LLQ A;  5LGU A;  1Z3X A;  2X51 A;  1IGN A;  3NWT A;  5EZG A;  4CYC B;  1S5L C;  2MFZ A;  3LSI A;  3WU1 B;  1ACI A;  1SD5 A;  3BR2 A;  4LD5 A;  2DA6 A;  1OR7 C;  2VKH A;  1BJZ A;  2DTR A;  5BNG A;  2ZJQ F;  2VPL A;  3GEZ A;  4PCQ A;  5GTI C;  3OV8 A;  1K4S A;  4N9I A;  4RS8 A;  5LEK A;  4Y17 A;  5CVU A;  1IUY A;  2QQB A;  3M3Y J;  1G8X A;  2LG4 A;  3ZQH A;  2IJL A;  1QNT A;  4MFE A;  3TO9 A;  1U2W A;  5EJC A;  1R4M B;  2BHZ A;  1WZ2 A;  4JK1 X;  1GDT A;  1KYZ A;  1A6Q A;  2OA4 A;  5LGT A;  3F21 A;  3PO2 J;  4LGW A;  5HOO A;  4U7B A;  2DFI A;  3KE2 A;  2LY2 A;  3B6A A;  4XNF A;  2TDX A;  5J1Y A;  2XB0 X;  3CP2 A;  5IYB J;  2K85 A;  2OJE D;  2PJR A;  3BQY A;  5E17 F;  1U5T C;  1RR8 C;  2ADU A;  4XKW A;  4HZF A;  3VWB A;  1IRG A;  2CW8 A;  4Q4Z F;  3E6M A;  2Y75 A;  2EZI A;  3F6V A;  3GZ5 A;  1B9M A;  1MBK A;  4KIB A;  1GV5 A;  3LQR A;  4NUB A;  1TP4 A;  1Y0U A;  4M72 A;  4Q47 A;  4UY8 I;  3FKJ A;  1HKT A;  3OS0 A;  1M1E B;  4XMY A;  5ICG A;  3EYY A;  1A35 A;  2JA2 A;  4D5C A;  1JJ6 C;  3TED A;  3SYT A;  3RJP A;  1MBF A;  1I6H J;  1Q1H A;  4HF1 A;  4LMY A;  4QPO A;  3FHN A;  4E7I A;  2Y9Z A;  2VOP A;  1KZH A;  5IOY A;  2E60 A;  2LNB A;  5J40 A;  2EA4 A;  1GLN A;  2R7W A;  3RDI A;  2IP2 A;  3LAP A;  4F7Z A;  1HST A;  2GXG A;  3SJM A;  4HPQ A;  2E35 A;  4IOA F;  4ZYD A;  5TRD A;  3HEF A;  4FX0 A;  2B7E A;  3HC7 A;  1SFX A;  1LE8 B;  3ERM A;  3TQN A;  3OS2 A;  4P96 A;  2JA8 J;  1BR2 A;  3CDH A;  5AIQ A;  3JRI A;  5F64 A;  5AON A;  2XAG A;  5M5Y J;  2M87 A;  3CCY A;  3H3V K;  5GP9 A;  3AFH A;  1XCV A;  4ZYG A;  2OZ6 A;  4UXN A;  3BPX A;  3HUG A;  2EK5 A;  1PP8 F;  3I59 B;  3S2D J;  5C3E J;  2ID6 A;  3QQA A;  4KT6 A;  4WX9 A;  1O57 A;  1FSH A;  4RAG A;  3DKX A;  4BU2 A;  3IKT A;  2F5F A;  1XC5 A;  2YSR A;  1QU3 A;  2CFX A;  3PQK A;  4HDV A;  1J75 A;  2E19 A;  2ZKZ A;  1HF0 A;  2CQK A;  2XGD A;  3PSF A;  5D6E A;  4BQQ A;  4PK4 A;  3HPH A;  1EF4 A;  4MLO A;  1Z67 A;  3IC7 A;  2K5C A;  2BEO A;  1NG7 A;  4XKC A;  5E3N A;  3L09 A;  4N9H A;  1TQP A;  1IDY A;  1W5S A;  2X48 A;  2X4H A;  3J80 K;  2DA4 A;  3CCS I;  3A1Y A;  1WWX A;  3ABM H;  5F0C A;  3ZRG A;  3HOZ J;  3QPT A;  5L3D A;  1OCT C;  1Z1D A;  4UUV A;  2GA1 A;  4ZDP A;  4AID A;  4BDZ A;  4N0B A;  3C2H A;  4BBS J;  2O7O A;  3CLO A;  4C9Y A;  1SD4 A;  1ZGJ A;  4EJO A;  2HU9 A;  1X1D A;  2JRT A;  2ZSI B;  5GTH C;  2Y0S N;  3M8F A;  1FOW A;  1P7I A;  3FWE A;  5IYC J;  3BOQ A;  4HAM A;  4E7Z A;  3WOD F;  3OYM A;  3M4O J;  4EVI A;  3K70 C;  3CJQ B;  2A3S A;  2IGK A;  1A6I A;  4UVB A;  1TWH J;  2XC7 A;  4IRI A;  2OC6 A;  5J8C A;  2O03 A;  3DTI A;  1E2X A;  2LTP A;  4X0G A;  5K7Z A;  2VON A;  4B47 A;  1R1T A;  2NVT J;  4OIR F;  4HNV A;  1YJW I;  4NC7 A;  3JRA A;  1F1Z A;  2NS0 A;  4BY1 J;  1BR4 A;  5A2Q Z;  1FX7 A;  1U0J A;  4DOZ A;  2DXI A;  1GHC A;  4L9T A;  2JPB A;  1X3U A;  2ESN A;  2CYY A;  1TWA J;  3M7G A;  4AVP A;  3NAR A;  3MN2 A;  3KET A;  3HGG A;  5IT9 Z;  4HRI A;  5JHF A;  4EJT A;  2NRA C;  3QU3 A;  3I55 I;  1Y8R B;  2V7F A;  2QKL B;  4B4C A;  3ZQL A;  3KZY A;  1POG A;  5BQT A;  1P2F A;  1HBX G;  1B8I A;  2DLL A;  5L3E A;  1BBY A;  2JJ7 A;  4KIF A;  3A4C A;  3IUO A;  4OAZ A;  1FIP A;  2DOE A;  3PNY A;  5F27 A;  4G6D A;  3HKZ N;  3N05 A;  4D1Q A;  3H3U A;  4JBA A;  2DT7 B;  2JZY A;  2QSH X;  4U7D A;  2VUM J;  1MH4 A;  2PMZ A;  3GO5 A;  3F23 A;  1YO5 C;  4XR6 A;  2HQ5 A;  5J3L A;  4V19 K;  3ABL H;  2QWW A;  2VL8 A;  3E0J B;  4AYB N;  3S15 J;  2E1M C;  1STZ A;  1OMI A;  5CVJ A;  3JTG A;  1KU9 A;  3CCR I;  4IHV A;  3HHG A;  3KCC A;  2HYJ A;  1KQ9 A;  2FJ1 A;  2RN7 A;  4A3I J;  2J5P A;  3BRO A;  5E3L A;  4PJN A;  2EFW A;  1SAN A;  4IF4 A;  4ASN A;  2A5Y B;  4GFB A;  3EQL F;  3ABT A;  1BN5 A;  3SEQ A;  5B1A H;  1QBJ A;  3K2Z A;  1YS7 A;  1XN7 A;  2B0L A;  1V55 H;  4XN3 A;  1E3O C;  4Z2Y A;  5HLI A;  2Z5U A;  2FE3 A;  4CHU A;  4QTR A;  3FIS A;  1T39 A;  2LSO A;  1X2M A;  3JAM K;  4RGX A;  5ICC A;  5GAH J;  2P5V A;  3I56 I;  4G7H F;  4EM2 A;  1HCR A;  1MMD A;  5DUK A;  3PUF A;  4G9Y A;  3LA2 A;  4LG0 A;  5HLT A;  3C2G A;  2GA2 A;  2L01 A;  2LBF B;  2DJN A;  3JRG A;  3ZN0 A;  3J7Z I;  3RPQ A;  3K1N A;  1BJA A;  1PJR A;  4HNT A;  1I1G A;  2IXS A;  4D0P A;  4C2T A;  2MD5 A;  2KDO A;  3GTQ J;  1TQM A;  3K7A J;  3DCF A;  2BW3 A;  2DMN A;  1SAU A;  3VFZ A;  4L5I A;  3KPH A;  3DPU A;  1ZYR F;  1PUF A;  4WXC A;  2DFH A;  2Z16 A;  4A69 C;  4P9U A;  2FRH A;  4C3I J;  4JOM A;  3NRV A;  5JVT A;  2YU9 J;  1O3S A;  1Z0X A;  3H35 A;  4ZDO A;  2VBW A;  1ZKG A;  2X6X A;  2KKO A;  3R61 A;  4FCY A;  2MG4 A;  3QYF A;  4BXF A;  3I3L A;  1A31 A;  1MGT A;  2OD5 A;  3F3X A;  4CCN A;  2P7C B;  5B1B H;  3SZP A;  2HOE A;  3KYL A;  1HKQ A;  3MWM A;  3OYA A;  2XKP A;  4ESB A;  4E4H A;  1LVA A;  1V5F A;  5C4X J;  2DPD A;  4A5M A;  4HF0 A;  3I54 A;  5CKT A;  6PAX A;  3DBH B;  3FM5 A;  4XKB A;  4CH7 A;  4HV6 A;  4C2U A;  3C7J A;  1YX5 A;  1T2K A;  1AOY A;  3BTC A;  1ZH5 A;  4B43 A;  2V6E A;  1PYV A;  2ZFU A;  3K4M A;  3ROU A;  2R93 J;  4MIM A;  1FP1 D;  1WH5 A;  4I09 A;  1FYM A;  2CU7 A;  5L3F A;  3NQO A;  1G6N A;  4RB2 C;  2CRG A;  3U21 A;  1MMS A;  3CME I;  4C30 A;  3EUH A;  5JFR A;  2QYO A;  3TP0 A;  1W36 C;  4YIF A;  5KHD A;  2HQN A;  4KN7 X;  2HDC A;  3DKW A;  1QVT A;  4P9F A;  3BT9 A;  3OR2 C;  4M74 A;  1SD7 A;  2LFB A;  5FD5 A;  2HVQ A;  2B63 J;  2DK8 A;  1YHQ I;  3TGN A;  3BQZ A;  1ETK A;  1LVK A;  4II2 A;  4NHJ A;  4IL6 C;  4M6X A;  5B3S H;  1EH8 A;  1LDD A;  2QQA A;  2R7Q A;  4AIH A;  4D7N A;  3JRH A;  2EIN H;  2NVU B;  3F8M A;  3V42 A;  2ZFW A;  4UVC A;  2Y31 A;  4ABZ A;  4DYC A;  4MFD A;  1JE8 A;  1FLI A;  1QPI A;  4XK4 A;  5KAI C;  1D8J A;  4ZH4 F;  3TO6 A;  2VXD A;  5F0F A;  3VOE A;  4L0Z B;  1AKH A;  2HOS A;  2NVQ J;  1UZC A;  1ZK8 A;  4PJJ A;  2W25 A;  2YR2 A;  3CC2 I;  5FLX K;  1YIJ I;  4H0E A;  4Y15 A;  1HW5 A;  4HOB A;  1IRZ A;  2PMU A;  1T38 A;  1H89 C;  2HWV A;  2UXX A;  1XD7 A;  3BZC A;  3IL2 A;  1Y1V J;  2FXA A;  1O7L A;  3P7N A;  4ANJ A;  4PFO A;  3G1L A;  2OQR A;  1UAA A;  3F8C A;  1UEL B;  3AG3 H;  4DIQ A;  2ZCW A;  3MAJ A;  1UG2 A;  5K7F A;  1TQI A;  1FMW A;  3RI4 A;  4L18 B;  3MZY A;  2HZT A;  5KK1 A;  1NK3 P;  5FKL A;  1B72 A;  2KRF A;  4NC6 A;  1HA8 A;  3DBR B;  3RKW A;  1N25 A;  1VQ4 I;  4BUP A;  3KZI C;  5GAG J;  4CCJ A;  1K6O A;  4A6E A;  3ZPL A;  3FXQ A;  2XGX A;  2IEK A;  3CMY A;  1JXS A;  4Q48 A;  4ZC3 A;  3E3V A;  3ASO H;  4HG2 A;  3G71 I;  1IN5 A;  4XOP A;  2WBM A;  2IA0 A;  4UB6 C;  4ENK A;  2KP6 A;  2P8T A;  3LOC A;  2M1B A;  1K78 B;  3S17 J;  9ANT A;  1WHU A;  4FQG A;  2L7F P;  1PDN C;  4IJA A;  3Q9V A;  3V4G A;  3JSO A;  3S14 J;  4C2M J;  1FTZ A;  2YX7 A;  3QYE A;  2H09 A;  2W85 A;  3KYD B;  1H8A C;  5FLM J;  3IV5 A;  2KL4 A;  4M3F A;  3ZMZ A;  3MD2 A;  4XOT A;  3HIF A;  3QPS A;  5ILS A;  3RKX A;  3LMM A;  1W0T A;  4DYQ A;  4A93 J;  1H88 C;  2OV7 A;  3HOX J;  2HR3 A;  1SMY F;  2UV1 A;  3T0Y A;  1XS9 A;  3P9C A;  1ERD A;  1RR7 A;  4OIO F;  2XIG A;  1D3Y A;  3OOP A;  2VIX A;  3ZQG A;  4C3H J;  2BY0 A;  1V5G A;  1XMX A;  2CUF A;  3KLN A;  2ZC2 A;  3HM5 A;  2BYV E;  1ZQ3 P;  1AU7 A;  5C4J J;  2QCO A;  3LSR A;  5ICE A;  3RCO A;  4A12 A;  3CCV I;  4A3K J;  1I39 A;  4PZJ A;  2UWM A;  1WSU A;  2R7T A;  2L9S A;  2EV0 A;  4WXD A;  3ZQF A;  3UNG C;  1Z6T A;  3JTH A;  4DBQ A;  3GXO A;  2LK2 A;  2FQ4 A;  1Z6R A;  3FXU A;  2X9D A;  1ETX A;  2E34 A;  5L3G A;  3OYI A;  2DMQ A;  4BHB A;  1B8I B;  1XGO A;  2FSW A;  4DJA A;  2E71 A;  1X3W B;  2XVC A;  5H6Q A;  3N97 A;  1G3Y A;  1V4R A;  5F04 A;  4MQ9 F;  3HRS A;  4AU7 A;  4PSW A;  5EG0 A;  2LKS A;  3K4K A;  3S2W A;  3BG3 A;  1YTY A;  3GTO J;  4MQV A;  1ODD A;  2F5C A;  5BS6 A;  3L2W A;  2L7M P;  3QP5 A;  1DPR A;  1BW5 A;  4CCL A;  4D5F A;  1PUE E;  2JWT A;  3IKV A;  2M0M A;  2XPU A;  3DEW A;  4LFU A;  2ISZ A;  5FB2 A;  2L54 A;  2NVY J;  4ITV A;  5TGT A;  4CDG A;  4XRS G;  2H8R A;  1R71 A;  2AXT C;  2VJ5 A;  2Y2Z A;  1AA7 A;  3JCU C;  5F1R A;  3AG1 H;  2DA7 A;  4RM2 A;  3U9G A;  5CLS A;  1VQO I;  2CV2 A;  1UJ8 A;  1QQI A;  2H94 A;  1HOM A;  3RIR A;  3S32 A;  2IPQ X;  2IA2 A;  3DU5 A;  2LD5 A;  3E5U A;  1QA6 A;  5LHH A;  3Q5F A;  1IN4 A;  3PIP F;  1VND A;  2V4J C;  2ZNY A;  3ZQ7 A;  4XLH A;  5KNL A;  4AIJ A;  2ZXJ A;  1LKX A;  2QUF A;  2JSC A;  3CMA I;  3KEO A;  2V1U A;  1SFO J;  4LIV A;  2NVX J;  4RB1 A;  3TL4 X;  4ENM A;  1LEB A;  2P5K A;  3WTU C;  4LG0 B;  1WJC A;  3FMQ A;  3A03 A;  2MH9 A;  1YIO A;  3GFL A;  4A0Z A;  3WTW C;  3BR3 A;  2E1C A;  1L3L A;  4N4O B;  1MNE A;  1IF1 A;  2R5Y A;  1LEA A;  2MC4 A;  4AVZ A;  4Y33 A;  1HW2 A;  1QPM A;  2BW3 B;  1IG7 A;  1R5H A;  5LFA A;  3AG2 H;  3PL8 A;  4BY7 J;  2DJI A;  1PUF B;  3COA C;  3KP4 A;  1WJF A;  2IS1 A;  1USS A;  4OMZ A;  2VAS A;  2CQ7 A;  1O4X A;  4KA4 A;  3DEE A;  3GTP J;  1YW8 A;  4PGG A;  1IXC A;  5L3B A;  2KZG A;  3PO3 J;  4PJ0 C;  1C0W A;  2A61 A;  2HGC A;  3C18 A;  4KIG A;  4QLC U;  1PP7 U;  4F3Q A;  1XGM A;  1LJ9 A;  3OYB A;  2O0Y A;  2PEX A;  2KIS A;  5JVG F;  4LIU A;  3I4N J;  1FNN A;  1QZY A;  4E7J A;  3K4N A;  1OJL A;  4OU0 A;  1O3R A;  1DQU A;  2DW4 A;  2E1M B;  2VKV A;  2Y0S A;  3FMR A;  2YUS A;  2M3A A;  1VQL I;  3HOW J;  2X6Y A;  2LR8 A;  4HW0 A;  1T56 A;  3WE3 A;  5IPA A;  1I1S A;  1A04 A;  1U3E M;  1MSE C;  1HDD C;  3HOV J;  4H4K C;  3AG4 H;  2O6G E;  1NG6 A;  2XAQ A;  3D5R C;  3OYG A;  4B1R A;  4I99 C;  3SDG A;  2KIQ A;  4BBR J;  3BR1 A;  3BR0 A;  2Q1Z B;  3GTL J;  4W1U A;  1UG0 A;  3HSF A;  5FRN A;  3HRU A;  1JT6 A;  2R7Z J;  3BTI A;  1W4M A;  3R0J A;  1ORK A;  2HPI A;  2V6C A;  3S2H J;  1EV7 A;  2QBY A;  5H20 A;  1FBQ A;  2HOA A;  2L02 A;  3K4L A;  3SHF A;  3L2C A;  2ELJ A;  2BV6 A;  1ETQ A;  4FE4 A;  2Q2E A;  3V8J A;  1X1P A;  2XAH A;  3ZMT A;  2BE5 F;  2FOW A;  1KQ8 A;  2EH3 A;  4I98 B;  1D0X A;  3VDX A;  1F9N A;  1BI0 A;  2BZT A;  2ZNZ A;  5FO5 A;  4J01 A;  3L2Q A;  2RGV A;  2XAF A;  2V9K A;  1HXD A;  1UHS A;  2KFD A;  5DS9 A;  3FXL A;  3ZMD A;  4XRM A;  5A2Q K;  3HKZ A;  3BJA A;  2COM A;  3DWL E;  4YG2 F;  2L3D A;  3JRD A;  2CMP A;  2EFN A;  1YX3 A;  2A6E F;  3RPU D;  4JYK A;  1RET A;  5IT9 K;  2EQR A;  1G59 A;  3RPU A;  4GO1 A;  3OSF A;  4PFP A;  2HXO A;  2LVS A;  3G3Z A;  4S05 A;  4OIP F;  1TWG J;  3ZCO A;  1W5C C;  4AYB A;  5DEQ A;  3FDY A;  1U8R A;  1FZP B;  2BY2 A;  1AKH B;  1J5Y A;  5HS9 A;  1JGS A;  2Z3Y A;  3B02 A;  4I0B A;  3L2V A;  2EZK A;  3WG7 H;  4CZZ A;  1JJ8 C;  1T98 A;  4UUT A;  1TLH B;  5EYR A;  1U8B A;  1HC8 A;  5EEH A;  2EFO A;  3MZ8 A;  1Z05 A;  2R0Q C;  2GOX B;  2JUC A;  3DP7 A;  3ELK A;  2F5V A;  1ZRC A;  5DUI A;  1VQP I;  4V2G A;  4C3J J;  4IQJ A;  3F72 A;  3GW2 A;  2NYX A;  1YRN A;  1VI0 A;  2NS8 A;  3H9J A;  4HSR A;  3M8E A;  5M3M J;  3CDI A;  3RYP A;  2CSO A;  2BVL A;  2EJR A;  1B72 B;  2MGQ A;  2XF5 A;  3ABK H;  4S0H B;  1VQ6 I;  3OYE A;  2HKX A;  5HOD A;  2R7X A;  1WH7 A;  5HLH A;  3H3Z A;  2H1L A;  1ZEL A;  5F1J A;  4Y4R A;  2R7O A;  4OOI A;  4LB5 A;  1SFE A;  2FOK A;  4RGU A;  3VEP A;  5TJJ A;  5E79 C;  1F4K A;  3OS1 A;  2N8G A;  3GTJ J;  2V9P A;  1MKM A;  2JPC A;  1Z77 A;  1MJA A;  3CES A;  1TWF J;  1APL C;  1A36 A;  2DA2 A;  2MBF A;  2GLO A;  3D5S C;  2RC4 A;  4O6J A;  5KCM A;  4DGW B;  3G73 A;  2LF7 A;  2QKM B;  3OYF A;  3LSK A;  4G8X A;  4XOR A;  4LLN A;  5IP7 J;  2QSF X;  4XLE A;  3CJR B;  1OCC H;  2ZME A;  4RM3 A;  1REP C;  1XG1 A;  1ZRD A;  3BJ6 A;  3S3O A;  5CVR A;  3T5X A;  2M5W A;  1QHG A;  1DU6 A;  4X1E A;  2FML A;  2DOF A;  2ME6 A;  1QGP A;  1MMG A;  2L2O A;  2GWR A;  1JUS A;  1FSE A;  1FMV A;  2KZV A;  1F5T A;  2DPU A;  1RRJ A;  5ILU A;  1WRJ A;  1JTY A;  1ZLJ A;  1QHH D;  5JHU A;  1QZZ A;  2HKO A;  4GRI A;  2R5Z A;  4BKX A;  2VKE A;  2D45 A;  4A3C J;  2DBB A;  4YEL A;  2EIL H;  3K69 A;  4G12 A;  5D4S A;  1VTN C;  5GPA A;  3N4M A;  1YQA A;  2DA5 A;  4OWR B;  4UB8 C;  4UVA A;  1KU3 A;  2LY9 A;  1P9Q C;  2V1X A;  2RQQ A;  3HTU A;  3I4P A;  4NB5 A;  2E5Z A;  1XMK A;  3KP2 A;  1CGP A;  2CV1 A;  1Z9C A;  1J2X A;  2BOL A;  1KQ0 A;  2DQR A;  3EPZ A;  4HX4 A;  1T08 B;  3DKY A;  4I2O A;  1MBJ A;  3K9T A;  5F08 A;  2EIK H;  3QOE A;  3S1N J;  1K79 A;  4U88 A;  2V26 A;  1CF7 A;  1J09 A;  1ONV A;  2GOM A;  3LSG A;  2VQH A;  4PSX A;  2XSJ C;  4D9J A;  4JX5 A;  2FUG 2;  3R60 A;  4R8H A;  3LA7 A;  5FFX A;  5EDN A;  2ACJ A;  1SEU A;  2LC2 A;  5EG0 B;  1FIA A;  4IZZ A;  5C44 J;  2DI3 A;  1Z3Y A;  2QQ8 A;  4ZYA A;  3W6V A;  3F22 A;  2FF4 A;  1TZL A;  2MA3 A;  3HOS A;  3CCQ I;  2E2H J;  4DW6 A;  3IH2 A;  1UCR A;  4IHS A;  4HA8 A;  4OIQ F;  3LNQ A;  4B48 A;  1YLF A;  4GXO A;  2HOT A;  4U0W A;  5H2F C;  2WC2 A;  1LNW A;  4EJU A;  3ERE D;  3MCZ A;  1RZ4 A;  3GTG J;  2Y48 A;  4XLA A;  2PLY A;  1TW3 A;  3PNV A;  5E20 A;  2OTL I;  2GQQ A;  1YJN I;  1AHD P;  1FT9 A;  2ISY A;  2PX9 A;  3VYR B;  3QAH A;  4I02 A;  4IEJ A;  1RI7 A;  3R4K A;  5F6F A;  5JLW A;  1G4D A;  5J4V A;  4M73 A;  4CYD A;  1DUX C;  4BHC A;  2X1D A;  1RKT A;  1Y6I A;  5IP9 J;  3BG9 A;  1OLT A;  3IRR A;  2FEZ A;  3GTM J;  1I5Z A;  4E70 A;  4A6D A;  5D5V B;  2HVR A;  4F92 B;  4M6V A;  3U1D A;  1YI2 I;  3J7A Y;  3OWT A;  1YOV B;  2VE9 A;  4TV7 A;  3K4J A;  2CGP A;  1F36 A;  3CC4 I;  1VFC A;  1XGS A;  1UHM A;  3JRB A;  2ZO4 A;  4A5N A;  2IW5 A;  3J81 K;  3CD6 I;  1MNM C;  3SZT A;  4I01 A;  1ZHF A;  5E1Z B;  2K7L A;  3FXK A;  4A3L J;  1BM9 A;  2HTJ A;  2QVO A;  2R5Y B;  1WJD A;  2A05 A;  1NK2 P;  3QOP A;  3IH3 A;  4DYR A;  1J0R A;  4ZZL A;  3O6B B;  2QEX I;  2OU2 A;  1TTY A;  2CQX A;  5J4Y A;  1SFK A;  1KU7 A;  2WB1 N;  4BGD A;  3CQZ J;  3O8H A;  4BXU A;  1MMA A;  1BIA A;  2KHM A;  4M9Z A;  1GV2 A;  2JA5 J;  1B9N A;  1RKW A;  3EUH C;  5FKK A;  2P5L C;  3J7Y J;  2W84 A;  3SQN A;  3TW6 A;  3E1S A;  2LKX A;  3FX3 A;  5E1X A;  2L9N A;  2MYS A;  1OIS A;  3H5N A;  2JA7 J;  1B1B A;  3OIQ A;  1U9O A;  1FC3 A;  4GDF A;  3W2A A;  3LSJ A;  1FBS A;  3H5R A;  4DQ2 A;  2HDD A;  5E1W A;  2GXA A;  3B6C A;  1HW1 A;  2X1C A;  4Y13 A;  1P92 A;  2W00 A;  2L7Z A;  1XTA A;  4JX4 A;  2K9L A;  2LP0 A;  2M7A A;  2H6B A;  2BGC A;  4XQF A;  5LEJ A;  4RA2 A;  3TKY A;  4KUM A;  2L5Q A;  1BC7 C;  3I4M J;  4N4N B;  2PI0 A;  5CYV A;  3QRF F;  3BWG A;  1WI3 A;  2O3F A;  5CJ9 A;  2DYS H;  1ZRE A;  2K9Q A;  2F6C A;  2E1N A;  1JKO C;  2IAI A;  2ZJP F;  1V54 H;  3LQQ A;  4IVN A;  4Y3O A;  1SVL A;  2VQC A;  2QBY B;  3CUO A;  2DMU A;  4A2U A;  4FAS D;  4Q5S F;  2Q2E B;  3HBL A;  3F8B A;  4ENN A;  2DQL A;  4MEX F;  2ZSH B;  3MKZ A;  3BJO A;  1MBG A;  5HS8 A;  2DA1 A;  3GYH X;  2OTJ I;  2C6Y A;  3E97 A;  3RQ4 A;  1R9T J;  5CVI A;  3HSR A;  5LHI A;  4WCG A;  1YYV A;  3HRM A;  4XLC A;  5DM7 F;  1TL8 A;  1R4N B;  2PJR B;  1XSX A;  3PM1 A;  4RDU A;  1R7J A;  3VYS B;  1ZAO A;  2DOD A;  4BQO A;  2NOG A;  4ZDL A;  2HNH A;  2W57 A;  2EIM H;  1Z7L A;  1YFH A;  2D1H A;  2WTE A;  3WU2 C;  1YG2 A;  2AHQ A;  4IRH A;  1XPX A;  1W0U A;  2J5O A;  1VQK I;  1OYY A;  4M3E A;  2OF7 A;  3JRC A;  5D6F A;  2DMT A;  1JKR C;  1X4O A;  5HLG A;  2KJB A;  2NNY A;  4RMN A;  2FBI A;  4GCV A;  5L3C A;  4BH9 A;  4P5O A;  1S8N A;  1HQC A;  2HQR A;  3W6J B;  1SVM A;  3TOB A;  3OYH A;  3DFG A;  2EZL A;  4GGG A;  2YPR A;  1T8I A;  5DD4 A;  4CGZ A;  4FT8 A;  3KP3 A;  1YRN B;  1MZB A;  3QP6 A;  3ABU A;  2ETH A;  3OR1 C;  3ZGK A;  4CCO A;  3G4S I;  5D5W B;  1WPK A;  2QSG X;  3GBG A;  1VQ9 I;  2R7D A;  1KYW A;  1LQ1 A;  3HUG B;  3OL4 A;  2WY8 Q;  1I27 A;  3IWZ A;  2WV0 A;  4WF2 A;  3H9G A;  2WY7 Q;  1JHF A;  3CP8 A;  4KMF A;  1Z7U A;  1HKS A;  3UR3 C;  1YE9 A;  4BQN A;  1K61 A;  1AWC A;  2XRL A;  2K9S A;  2LRE A;  2DT6 A;  1E0E A;  4MTE A;  2IGO A;  4BJ5 C;  1WJA A;  2E2J J;  1R23 A;  3KP7 A;  4HQM A;  2PG4 A;  1JT0 A;  4BHP A;  3TDZ C;  4QIW N;  4B3A A;  2LOO A;  2HS5 A;  5EEA A;  3VYT B;  3CUQ A;  3VSK A;  3GCM A;  2QM3 A;  4ZZD A;  4XON A;  4RBO A;  4A3F J;  2D5V A;  4M3D A;  2VT2 A;  5HVQ C;  2UZK A;  4OIN F;  4KNY A;  4RGS A;  2KPM A;  1D1B A;  3H92 A;  2K40 A;  3G2B A;  4CXF A;  4EV0 A;  1H9G A;  3UKG A;  3BCB A;  1DP3 A;  1VF9 A;  3HGY A;  1JGG A;  3ECH A;  3K10 A;  1RUN A;  4PGH A;  3SDB A;  1ETY A;  2Y69 H;  3GF2 A;  3DQV C;  3HYI A;  3L1P A;  1Z91 A;  2FBK A;  3P5J A;  5F0H A;  3A01 A;  4LLG F;  3C1D A;  1WFX A;  2R5Z B;  4RAY A;  4BEH A;  5J6X A;  4RLF A;  1A5J A;  3S16 J;  4DNC A;  2LY1 A;  4QPQ A;  3KP6 A;  4LLL A;  2I8D A;  1ZG1 A;  1YW9 A;  1HLV A;  3VOD A;  1MBH A;  3RQI A;  1FOK A;  3HOU J;  3SZG A;  4LB6 B;  3DEU A;  1FTT A;  2MD0 A;  5JR3 A;  2V1D A;  3L2U A;  3OYN A;  2CH0 A;  3LST A;  2B9S A;  2BY1 A;  1CF7 B;  3BPV A;  2XB5 A;  3A02 A;  3EYI A;  1S9H A;  4WXH A;  1BI1 A;  1RPW A;  4XRF A;  4HX7 A;  1LFP A;  3GLL A;  3REO A;  4BAY A;  5E3O A;  2Z9O A;  1IUF A;  1NHA A;  4XIC A;  1UMQ A;  4NBQ A;  4YFK F;  2DYR H;  1B4A A;  1EKE A;  5K5Q A;  5E8I A;  3RZD J;  4BNC A;  5DV5 A;  2FBH A;  1D1A A;  2HI3 A;  2TCT A;  3B73 A;  3LFK A;  2XV4 S;  4HST A;  2F4O B;  1IV6 A;  3KYC B;  4DZP A;  1LUJ B;  3FXJ A;  4OAY A;  3OYC A;  3PNT A;  3ZR8 X;  4KYW A;  3KZZ A;  1F43 A;  2L4M A;  2JN6 A;  2ZJR F;  2X6O A;  3ISP A;  2VJ4 A;  2O9L A;  3BZK A;  3DPL C;  1ETV A;  4G7O F;  2G9W A;  3ZN1 A;  2I10 A;  3IHU A;  4ESF A;  2RVC A;  5HNF A;  4AD9 A;  2E7W A;  1VZ0 A;  3GVA A;  3BC8 A;  5KAF C;  1W7P D;  4JP0 A;  2DOA A;  3M07 A;  2NAZ A;  1R22 A;  2OCC H;  1W7P A;  1T0F A;  1UB9 A;  2EA2 A;  4CA0 A;  3HOY J;  3FK7 A;  1FYK A;  2VC1 A;  3V7C A;  3Q9S A;  3ZOB A;  3CCL I;  2VLA A;  3WTX C;  3HSE A;  2XF7 A;  1ZN2 A;  4UV9 A;  1ZR2 A;  1O7F A;  2W24 A;  3C2B A;  2K27 A;  1X3Z B;  2ZB9 A;  5M5W J;  2EZH A;  2Z2S B;  1B6A A;  1VQ7 I;  3E6C C;  5HDK A;  2K4B A;  1BC8 C;  1DP7 P;  4EMS A;  2LRD A;  4KMU X;  1OPC A;  1IXS B;  4HLX A;  4KN4 X;  2NNN A;  3CCU I;  2PJP A;  5FLX Z;  2IS4 A;  2ELH A;  2Z33 A;  2O8K A;  1VQN I;  3ZQC A;  4EM1 A;  3E6D A;  3C3W A;  4CZC A;  4XSZ F;  3F9K A;  2VBZ A;  2RRE A;  5M5X J;  1IJW C;  2IS2 A;  1ZLK A;  1KON A;  2K3P A;  2G7U A;  5LRS A;  2EFP A;  2Q8K A;  1R36 A;  3X2Q H;  4HQE A;  1D5Y A;  2F2E A;  3DBL B;  4LK1 F;  5IYD J;  5D5U B;  2E1O A;  3KFW X;  3LWF A;  3Q3S A;  4II3 A;  1JKQ C;  1GXP A;  2M8G X;  1QO0 D;  3V7S A;  2L0K A;  3I9V 2;  1T95 A;  5J1U A;  3ZP5 A;  3QPH A;  1EH7 A;  2HPM A;  4GYI A;  4X6A J;  1JUM A;  1RNL A;  3E5X A;  2JT1 A;  2KLO A;  1R5G A;  1DU0 A;  1O3T A;  1YS6 A;  2W1O A;  4YEJ A;  1BA5 A;  3E6B A;  2HYG D;  1XDS A;  1JHH A;  3K1P A;  1ZG3 A;  4M3G A;  2V9V A;  2EFQ A;  4E7S A;  2BBY A;  4BE0 A;  1X1B A;  1J9I A;  2FNA A;  2V1N A;  2UUZ A;  2XAU A;  4KT5 C;  4L5J A;  3CC7 I;  1UFM A;  2XF6 A;  5GAD J;  2VBY A;  3EUK L;  2HFH A;  3OSG A;  3ASN H;  2EB7 A;  1V5E A;  3MZH A;  2WAQ A;  3LSH A;  1JTX A;  2M4K A;  4EJV A;  1IV8 A;  2QEN A;  5EEG A;  3CF2 A;  1NTC A;  3M1E A;  2ZJ2 A;  4HEA 2;  4ZTJ A;  1MW7 A;  1GVD A;  3EUA A;  2DA3 A;  3OMY A;  2OUM A;  3H36 A;  1Q1V A;  4E7L A;  4A3D J;  2VJI A;  1UST A;  1W5T A;  4YIR X;  1UHW A;  2XRO A;  3BY6 A;  1IN8 A;  5EGO A;  2R7S A;  2XDV A;  1ITY A;  3S3N A;  2GM4 A;  3KP5 A;  5E18 F;  4Y52 J;  2Y30 A;  4IXA A;  2DO7 A;  3GFJ A;  4G94 A;  1SC7 A;  1RUO A;  2JTV A;  3KIO A;  2ZXH A;  5J47 A;  1OCO H;  1TNT A;  2NXN B;  1MJ9 A;  3AL0 B;  4JQF A;  3HZJ A;  2MH2 A;  1FP2 A;  2X1E A;  1HSJ A;  5LBQ A;  3GX4 X;  2M7B A;  2ZXI A;  3GME A;  3CCE I;  2Z1D A;  2A68 F;  4RB3 C;  4PJM A;  2K86 A;  4M71 A;  3D5L A;  2A6H F;  4KDP A;  5HDN A;  2VC0 A;  2W82 A;  3MVP A;  3OOU A;  5HDG A;  2QGU A;  4ESJ A;  3GZN B;  4ETS A;  2ZME C;  1S7A A;  3VYU B;  2QF7 A;  3CO7 C;  1Y1W J;  2XSD C;  4IKF A;  3DPT A;  1GUU A;  4U0V A;  1TWC J;  1X1C A;  2CWE A;  2H8W A;  1ZR4 A;  1FJL A;  1RC9 A;  5AIP A;  4L9V A;  3ZXS A;  3FXR A;  3JRF A;  4U0Y A;  4XM3 A;  4NQW A;  3O8G A;  5LD2 C;  2XGC A;  1E17 A;  3A0H C;  2ECC A;  4IQ4 A;  2STT A;  4BXX J;  2L9V A;  2L7K A;  1QRY A;  4CUG A;  4HYE A;  4MTD A;  2M34 A;  3BR6 A;  5FRM A;  4QWQ A;  3U1K A;  2M30 A;  4GYG A;  4R1H A;  5FD6 A;  3WTY C;  4XRS A;  2HQA A;  3A0B C;  3BP8 A;  3KX2 A;  3QOD A;  3CO6 C;  2P81 A;  1EA3 A;  4WK8 F;  2K02 A;  1WI9 A;  1MSF C;  2EIJ H;  2DU9 A;  4V2F A;  1SMT A;  3P9I A;  2IGN A;  1WQ2 A;  2FNP A;  1P7J A;  4BS9 A;  3LAJ A;  2IRF G;  3CJN A;  1XCB A;  2HDW A;  2Y9Y A;  2PBI A;  2FD5 A;  2O61 A;  4A3G J;  2WB1 A;  3CUQ B;  3HHH A;  4HNU A;  2RNJ A;  1FOX A;  3RKQ A;  4AM3 A;  4RGR A;  3PIO F;  2K4J A;  1H9T A;  2HZD A;  4BYY A;  5EF6 A;  2LMD A;  1XSV A;  3WHB A;  1OCR H;  1OR7 A;  4B09 A;  3O3K A;  5IT3 A;  3BR5 A;  2QZ8 A;  3I71 A;  3CCJ I;  5DCM A;  3FXO A;  3PUB A;  4M9S A;  2HTS A;  1X58 A;  1OCZ H;  1BW6 A;  2JVH A;  3A01 B;  3R6S A;  1QVU A;  2KJC A;  2GXB A;  2F5E A;  4BEH B;  2GAU A;  4XN0 A;  1I50 J;  5M3F J;  1L0O C;  3ZMS A;  2EWN A;  4HX8 A;  2ME0 A;  5CQE A;  1R1V A;  3CMM A;  3TMO A;  2K3F A;  5D8K B;  4IHW A;  3WTZ A;  4HLY A;  3LSP A;  4F93 B;  5BPI A;  3WHC A;  3GTK J;  3ZMU A;  2W4S A;  5FKO A;  3L7W A;  2KIM A;  2WAQ N;  2M0C A;  1SAX A;  5DCF A;  3HOT A;  5FKM A;  3NAU A;  4AC0 A;  2OBP A;  2KQR A;  1OKR A;  1XDU A;  4XID A;  1U5T A;  4IHT A;  3TP3 A;  3WGI A;  3HJE A;  2IVM A;  4KIS A;  2M9H A;  2ESH A;  3BLY A;  4BE2 A;  1S7O A;  3S8P A;  4LOC A;  1K78 A;  1WKM A;  3BG5 A;  2VQG A;  2WWY A;  5ED4 A;  2GIZ A;  3CF5 F;  1N78 A;  1VQ8 I;  3Q0W A;  4Y7N J;  3NWS A;  3BCA A;  1X1A A;  5CPR B;  3OY9 A;  4MGR A;  5ILV A;  2H1K A;  3KEY A;  4EAT A;  3HXL A;  2AS5 F;  3FHZ A;  4RAF A;  4CSW A;  4I6Z A;  4W97 A;  2UXN A;  1K4T A;  2E7X A;  2IS6 A;  1I3Q J;  3IH4 A;  3SXY A;  2MAB A;  2Y0M A;  4IX7 A;  2AQF A;  4RB0 A;  1HDP A;  2FU4 A;  2P6S A;  4P1W A;  1IN7 A;  2MW8 A;  1DDN A;  5FFZ A;  5D8L B;  3WTT C;  2F48 A;  1CQT A;  3EET A;  2L4A A;  5TIS C;  3DTE A;  2BVM A;  3MKY B;  5CQG A;  1W7P B;  1ETW A;  5K5R A;  5DDG A;  3HDD A;  1J7K A;  4KJZ A;  1T33 A;  2KRH A;  2MLG A;  4LG3 A;  5E8G A;  3I0T A;  4FE7 A;  1TBX A;  3GUD A;  2R7V A;  5BMZ A;  3Q0V A;  1I6X A;  4G7Z F;  2WAE A;  2LF8 A;  1R49 A;  5HNH A;  2CUJ A;  2IBD A;  2JVG A;  1MND A;  1Y56 A;  1TT0 A;  4YRV A;  2CUE A;  3BTJ A;  3OYJ A;  3SFZ A;  3WE2 A;  1YJ9 I;  4CCM A;  4IHX A;  5JLX A;  3TDU C;  1LPQ A;  2VOD A;  3CLQ A;  2VBX A;  3TO7 A;  1LDK B;  2QQ9 A;  1VQM I;  1OQY A;  4KIT B;  4ZTF A;  1P6R A;  1IZ1 A;  2VQL A;  1FPQ A;  4UUS A;  4B8X A;  2X6W A;  4FIS A;  5E3M A;  3ML6 A;  5FJ8 J;  4PUS A;  4UHT A;  3BG6 A;  3I5U A;  4EM0 B;  1MH3 A;  1ZGA A;  3VPR A;  3PQJ A;  3HB9 A;  4PDK A;  3L2R A;  1RES A;  4MO7 A;  3CDL A;  4OMY A;  4EEF G;  2EPF A;  1G3S A;  3ECO A;  1IAW A;  4DBR A;  3F8N A;  3OL3 A;  5BOX A;  1Y0N A;  1N77 A;  3LL7 A;  2MC3 A;  4UV8 A;  1IDZ A;  1IRF A;  3AL0 C;  4ENJ A;  1MDM A;  1KGS A;  3G6E I;  2IGM A;  4M9X A;  4NC8 A;  2HXI A;  4S04 A;  1YW7 A;  5EZH A;  1J59 A;  3IWF A;  4XSX F;  4A0X A;  3I53 A;  1ENH A;  1FBU A;  1S72 I;  1T6S A;  3IP4 B;  3K70 D;  1ULY A;  2RV8 A;  2XGE A;  4FET A;  1LFB A;  2F5D A;  4FX4 A;  2CW7 A;  5B66 C;  5KVR A;  3OIP A;  1K7A A;  2PQ8 A;  1H0M A;  2H6C A;  4UNO A;  1O3Q A;  3ONQ A;  2KT0 A;  4E6K G;  4L0Y B;  1S6L A;  3MKL A;  4U87 A;  3J80 Z;  2CQN A;  4K2E A;  1LFU P;  5DYM A;  2VT3 A;  1PVE A;  2LDU A;  3HRT A;  4RLQ A;  3MKW B;  3VB2 A;  2R4G A;  1R1U A;  2EV6 A;  3DTK A;  1ZGW A;  1JUP A;  5FKN A;  3FMS A;  1R6R A;  4MHG A;  3BTL A;  5LHG A;  5FGM A;  3TW7 A;  1ZRF A;  2DTZ A;  3OYK A;  5EGO B;  3HTS B;  2XHK A;  2FMY A;  4RAZ A;  3PFI A;  2JA6 J;  2DFF A;  3K1M A;  3PJR A;  1DGR M;  4A0Y A;  3FIW A;  2JUG A;  2PN6 A;  2WA0 A;  2XRN A;  3M9A A;  3CZ6 A;  4HV5 A;  1SFU A;  1SVO A;  4KFC A;  3SEZ A;  3K4C A;  3HG9 A;  5B5E C;  4Z6Y A;  5DD8 A;  2BXZ A;  1OYI A;  2YS9 A;  1JKP C;  4BDY A;  2VN2 A;  3JRE A;  3H9Q A;  5HS7 A;  1ZAR A;  4L5E A;  2WAD A;  2IT0 A;  3BDD A;  4CCK A;  4HBL A;  4WWC A;  4CO8 A;  2ID3 A;  2V79 A;  2CJJ A;  1K6Y A;  1DPU A;  3CUQ C;  5IY5 H;  1U78 A;  2E5N A;  4G6T B;  2E2I J;  4CYC A;  4I0A A;  1XSD A;  3V8L A;  1R5I D;  3K6G A;  3ZMV A;  1LDJ A;  2ELK A;  2O8X A;  1B59 A;  2A07 F;  4M6Y A;  4I76 A;  2M45 A;  1EJ9 A;  5K7H A;  2ZBK A;  4LIT A;  3FZV A;  4XBF A;  2P4W A;  4E7K A;  5BPD A;  1XGN A;  4NQW B;  2DMP A;  2OCE A;  3DLA A;  1D0Z A;  5D4R A;  2KRC A;  3Q0U A;  3LSM A;  1BR1 A;  1FOY A;  4R79 A;  3CTA A;  4NNJ A;  3S1Q J;  1G3T A;  3IAM 2;  1JI8 A;  4EJW A;  1FWZ A;  3HPG A;  3QWL A;  3ULQ B;  3IAS 2;  3FKI J;  4FHT A;  1WCM J;  3JW4 A;  4O3M A;  3BG7 A;  3RTR A;  3S93 A;  1GVJ A;  2BHY A;  4AUX A;  2R7F A;  4PJL A;  3D0S A;  4AIK A;  3GFI A;  2P6T A;  1BOA A;  1X4P A;  3RSN A;  2K9N A;  3U2R A;  1KU2 A;  1BI2 A;  2Q0O A;  4EQQ A;  4BQA A;  2DDB A;  4AWX B;  5GAE J;  2GZW A;  3FBN B;  1X2N A;  3M1C A;  2PMZ N;  3BZ6 A;  3ZQI A;  3MEX A;  3J81 Z;  3RYR A;  1Z21 A;  3JR9 A;  1IO2 A;  2AQE A;  2A6T A;  2RNG A;  4BJ6 C;  2STW A;  2CO5 A;  2E36 A;  2XAS A;  2ICW G;  2KIF A;  2XAJ A;  3JAM Z;  5GPC A;  5K1Y A;  3WGG A;  1I3A A;  2XKO A;  3PSI A;  3JSP A;  2KMU A;  2VI6 A;  3WGH A;  5JI6 A;  1FYL A;  3GLX A;  5DCM B;  3AAF A;  4ON0 A;  1VQ5 I;  1D1C A;  1W1W E;  3V8K A;  3VSL A;  5J1R A;  1P4W A;  1XMA A;  3PFY A;  1MMN A;  2M8E A;  1S29 A;  4FTH A;  2ZME B;  1LE8 A;  1T0F C;  3L00 A;  5ICF A;  2QA4 I;  2VXZ A;  2OAZ A;  2QLZ A;  2LKP A;  5ERI A;  5DM6 F;  1NH3 A;  1IRX A;  2ZXW H;  2AXL A;  3DV8 A;  1U6G A;  1N75 A;  2XUB A;  3I59 A;  4LK0 F;  3E5Q A;  3AKZ A;  1P4A A;  2PFB A;  2D1V A;  1ZG5 A;  2DN0 A;  3G1M A;  2NOJ B;  3FK6 A;  3W3C A;  1U5T B;  1R58 A;  2CG4 A;  3OYL A;  3FBI B;  5DTD A;  3A2K A;  1TNS A;  3T1B A;  1BOB A;  3HL2 A;  2DCE A;  1U9N A;  3MQ0 A;  2YU3 A;  2R92 J;  2CFO A;  1X19 A;  2FA5 A;  2CW0 F;  3DU6 A;  4ZJZ A;  1W36 D;  2OPT A;  3DXJ F;  2Z99 A;  2L9R A;  1K83 J;  1ON2 A;  3R0A A;  1S7E A;  2JMW A;  3TOA A;  2CS3 A;  1EH6 A;  1D8K A;  1WGX A;  1S3J A;  4BAC A;  2JRM A;  3QU6 A;  3LFU A;  4YII A;  4JX6 A;  3DLL F;  3L9F A;  4MNU A;  1GT0 C;  2X85 A;  3H1C A;  1ZTR A;  2G7H A;  4BJT A;  3G1O A;  3S1M J;  4XLF A;  3H5A A;  2BY3 A;  3KEQ A;  3W2V A;  1QZE A;  1WJ5 A;  1OFC X;  4NDL A;  4HF2 A;  1IW7 F;  2KDZ A;  2KIU A;  2A69 F;  1XB4 A;  1Y8Q B;  5FRO A;  3CJT B;  3FM3 A;  3GFM A;  1IN6 A;  3T8R A;  1G2H A;  2CQQ A;  1FEX A;  1YIT I;  1WVR A;  2R7U A;  3FXM A;  4ZYE A;  3W2W A;  2DFE A;  4YFN F;  5IP6 A;  4KIC A;  4I7H A;  3I64 A;  2D2W A;  2DDA A;  2HYF A;  2VJJ A;  3E7L A;  3F8F A;  2A5W A;  3LA3 A;  4M3B A;  1BI3 A;  2WV1 A;  2OZU A;  4J19 A;  3F6O A;  4O5V A;  1OCP A;  2DT5 A;  2DK5 A;  2CUZ A;  3S1R J;  2K9M A;  1XX5 A;  2DAO A;  2AO9 A;  2VB6 A;  2VKD A;  4UUS B;  4LJZ F;  3ESW B;  4B44 A;  3MFK A;  2WAF A;  4IRG A;  2R3S A;  4A3E J;  2VOO A;  1E3H A;  3QPL A;  2O5R A;  4F55 A;  3I58 A;  4L9J A;  4D7M A;  5FLV A;  1P4X A;  1BIB A;  2OQG A;  5LGN A;  3OYD A;  1WJE A;  4F91 B;  2JQ7 A;  2ECB A;  1GXQ A;  1MIJ A;  1V3F A;  1DGW Y;  2MLK A;  1MDM B;  4G6Q A;  3NEU A;  2BXY A;  1R00 A;  3OIO A;  2VE8 A;  1ETO A;  2TRT A;  4DZJ A;  4CIC A;  3W6K B;  4J00 A;  3F0C A;  4IPA A;  3CCM I;  4L9N A;  5J8F A;  1FY7 A;  4E7H A;  2LLK A;  3RZO J;  2HEO A;  2P0W A;  4B3X A;  3WG9 A;  3SFI A;  4HDU A;  4A3M J;  1G3W A;  2M2E A;  3WTS C;  2XPV A;  4EGY A;  4A3J J;  1OYW A;  3K4B A;  3O2P E;  3S3M A;  1MJB A;  2MSY A;  3WU0 A;  4A3B J;  3T8T A;  4IHY A;  1WJB A;  2CV0 A;  2RAE A;  2NS7 A;  4XKV A;  2EBI A;  3H0D A;  2R7R A;  2X0L A;  3M8J A;  2YX4 A;  3MMY B;  3V7R A;  4EGZ A;  2HVS A;  4BE1 A;  5K5O A;  2FQ3 A;  3K0L A;  4XLN F;  4YFX F;  4BL0 B;  4P55 A;  1D5V A;  2I5U A;  2IA1 A;  3P9K A;  3WTV C;  3ZQQ A;  1LB2 A;  3DF8 A;  5LRR A;  1MD0 A;  4IOC F;  1BL0 A;  2GIV A;  4XL9 A;  3QYB A;  2RQP A;  2W48 A;  4QSH A;  2FX0 A;  1D0Y A;  2VPR A;  4ZYH A;  3IRQ A;  1IXR C;  5IOZ A;  1TW2 A;  3GZ6 A;  2P7V B;  3D1N I;  1ON1 A;  2XPW A;  2EV5 A;  2GBY A;  4F52 A;  2LH9 A;  2M4G A;  2JK3 A;  3TBI A;  4XLP F;  3RKY A;  4IO9 F;  2LBF A;  1Y39 A;  2F4I A;  1KA8 A;  3EDP A;  2PMH A;  1RIO H;  5D5X B;  3K2A A;  1MBE A;  3KLO A;  1TC3 C;  3J7A O;  2LYC A;  1IC8 A;  1E3P A;  2G0E A;  2F4M B;  5H6R A;  2RDP A;  3GWZ A;  2RKH A;  2W7N A;  1SD6 A;  3H0G J; 
#chains in the Genus database with same CATH homology
 4MEY F;  2H27 A;  5CVV A;  3FF5 A;  5LLQ A;  5LGU A;  3WU1 B;  1SD5 A;  4LD5 A;  2DTR A;  3GEZ A;  4PCQ A;  3OV8 A;  4N9I A;  4RS8 A;  5LEK A;  4Y17 A;  5CVU A;  1IUY A;  2QQB A;  2IJL A;  1QNT A;  3TO9 A;  1U2W A;  4JK1 X;  1KYZ A;  2OA4 A;  5LGT A;  3F21 A;  4LGW A;  5HOO A;  4U7B A;  2DFI A;  3KE2 A;  2TDX A;  5E17 F;  1U5T C;  2ADU A;  4HZF A;  1IRG A;  4Q4Z F;  3E6M A;  2Y75 A;  3F6V A;  3GZ5 A;  1B9M A;  4KIB A;  3LQR A;  1Y0U A;  4M72 A;  4Q47 A;  1HKT A;  5ICG A;  3EYY A;  3RJP A;  1Q1H A;  4HF1 A;  4LMY A;  2VOP A;  2LNB A;  2EA4 A;  3RDI A;  2IP2 A;  3LAP A;  4F7Z A;  1HST A;  2GXG A;  4ZYD A;  5TRD A;  4FX0 A;  1SFX A;  3TQN A;  4P96 A;  3CDH A;  5AIQ A;  5F64 A;  5AON A;  2XAG A;  2M87 A;  1XCV A;  4ZYG A;  2OZ6 A;  4UXN A;  3BPX A;  3HUG A;  2EK5 A;  1PP8 F;  3I59 B;  4WX9 A;  1O57 A;  1FSH A;  3IKT A;  2F5F A;  2YSR A;  2CFX A;  3PQK A;  4HDV A;  1J75 A;  2ZKZ A;  2CQK A;  5D6E A;  3IC7 A;  2BEO A;  3L09 A;  4N9H A;  1TQP A;  1W5S A;  2X4H A;  3J80 K;  1WWX A;  3QPT A;  5L3D A;  1Z1D A;  4UUV A;  2GA1 A;  4N0B A;  3CLO A;  1SD4 A;  1ZGJ A;  4EJO A;  2JRT A;  3M8F A;  3FWE A;  3BOQ A;  4HAM A;  3WOD F;  4EVI A;  2A3S A;  4UVB A;  4IRI A;  5J8C A;  2O03 A;  1E2X A;  2VON A;  1R1T A;  4OIR F;  1F1Z A;  2NS0 A;  5A2Q Z;  1FX7 A;  1GHC A;  4L9T A;  2JPB A;  1X3U A;  2ESN A;  2CYY A;  3M7G A;  4AVP A;  3KET A;  5IT9 Z;  4EJT A;  2NRA C;  3QU3 A;  3KZY A;  5BQT A;  1P2F A;  1HBX G;  2DLL A;  5L3E A;  1BBY A;  4KIF A;  4G6D A;  3H3U A;  4JBA A;  2JZY A;  4U7D A;  3GO5 A;  3F23 A;  1YO5 C;  2QWW A;  1STZ A;  1OMI A;  5CVJ A;  3JTG A;  1KU9 A;  3HHG A;  3KCC A;  1KQ9 A;  2RN7 A;  2J5P A;  3BRO A;  2EFW A;  4IF4 A;  4ASN A;  2A5Y B;  3EQL F;  3ABT A;  1BN5 A;  1QBJ A;  3K2Z A;  1YS7 A;  1XN7 A;  2B0L A;  4Z2Y A;  5HLI A;  2Z5U A;  2FE3 A;  4CHU A;  1T39 A;  2LSO A;  3JAM K;  4RGX A;  5ICC A;  2P5V A;  4G7H F;  4EM2 A;  5DUK A;  4G9Y A;  3LA2 A;  4LG0 A;  2GA2 A;  2L01 A;  3ZN0 A;  3RPQ A;  3K1N A;  1BJA A;  1I1G A;  4D0P A;  2MD5 A;  1TQM A;  3VFZ A;  4L5I A;  1ZYR F;  4WXC A;  4P9U A;  2FRH A;  3NRV A;  5JVT A;  1O3S A;  2VBW A;  2KKO A;  3R61 A;  1MGT A;  2OD5 A;  3F3X A;  2P7C B;  3SZP A;  2HOE A;  1HKQ A;  3MWM A;  2XKP A;  4ESB A;  1LVA A;  2DPD A;  4A5M A;  4HF0 A;  3I54 A;  6PAX A;  3FM5 A;  4HV6 A;  3C7J A;  1T2K A;  1AOY A;  1ZH5 A;  3ROU A;  1FP1 D;  4I09 A;  1FYM A;  5L3F A;  3NQO A;  1G6N A;  4RB2 C;  3EUH A;  5JFR A;  2QYO A;  4YIF A;  2HQN A;  4KN7 X;  2HDC A;  3DKW A;  4P9F A;  4M74 A;  1SD7 A;  5FD5 A;  2DK8 A;  3TGN A;  4NHJ A;  4M6X A;  1EH8 A;  1LDD A;  2QQA A;  4AIH A;  3F8M A;  2ZFW A;  4UVC A;  1JE8 A;  1FLI A;  1D8J A;  4ZH4 F;  3TO6 A;  3VOE A;  4L0Z B;  2W25 A;  2YR2 A;  5FLX K;  4H0E A;  4Y15 A;  1HW5 A;  4HOB A;  2PMU A;  1T38 A;  2HWV A;  2UXX A;  1XD7 A;  3IL2 A;  2FXA A;  1O7L A;  3P7N A;  2OQR A;  3F8C A;  2ZCW A;  3MAJ A;  1TQI A;  3RI4 A;  4L18 B;  3MZY A;  2HZT A;  5KK1 A;  2KRF A;  3RKW A;  1K6O A;  4A6E A;  3ZPL A;  3FXQ A;  2XGX A;  1JXS A;  4Q48 A;  3E3V A;  1IN5 A;  2IA0 A;  4ENK A;  2P8T A;  2M1B A;  1K78 B;  1PDN C;  4IJA A;  3Q9V A;  3V4G A;  3JSO A;  2YX7 A;  2H09 A;  2W85 A;  3ZMZ A;  3HIF A;  5ILS A;  3RKX A;  2HR3 A;  1SMY F;  3T0Y A;  3P9C A;  4OIO F;  2XIG A;  1D3Y A;  3OOP A;  3KLN A;  2BYV E;  5ICE A;  4A12 A;  2UWM A;  4PZJ A;  1WSU A;  2EV0 A;  4WXD A;  1Z6T A;  3JTH A;  3GXO A;  1Z6R A;  3FXU A;  5L3G A;  4BHB A;  1XGO A;  2FSW A;  2XVC A;  5H6Q A;  3N97 A;  1G3Y A;  1V4R A;  4MQ9 F;  3HRS A;  3S2W A;  1YTY A;  4MQV A;  1ODD A;  2F5C A;  5BS6 A;  3QP5 A;  1DPR A;  1PUE E;  3IKV A;  4LFU A;  2ISZ A;  5FB2 A;  2L54 A;  4CDG A;  5F1R A;  3U9G A;  5CLS A;  2H94 A;  1QQI A;  3RIR A;  2IPQ X;  2IA2 A;  3E5U A;  5LHH A;  3Q5F A;  1IN4 A;  2ZNY A;  3ZQ7 A;  4AIJ A;  2ZXJ A;  2QUF A;  2JSC A;  3KEO A;  2V1U A;  4RB1 A;  4ENM A;  1LEB A;  2P5K A;  3WTU C;  4LG0 B;  3FMQ A;  2MH9 A;  1YIO A;  3GFL A;  4A0Z A;  3WTW C;  2E1C A;  1L3L A;  1IF1 A;  1LEA A;  1HW2 A;  1QPM A;  1R5H A;  3COA C;  3KP4 A;  1USS A;  4OMZ A;  4KA4 A;  1YW8 A;  4PGG A;  1IXC A;  5L3B A;  1C0W A;  2A61 A;  2HGC A;  3C18 A;  4KIG A;  4QLC U;  1PP7 U;  1XGM A;  1LJ9 A;  2O0Y A;  2PEX A;  1FNN A;  1QZY A;  4OU0 A;  1O3R A;  2DW4 A;  3FMR A;  4HW0 A;  3WE3 A;  1I1S A;  1A04 A;  1U3E M;  2O6G E;  2XAQ A;  3HSF A;  3HRU A;  1W4M A;  3R0J A;  2V6C A;  1EV7 A;  2QBY A;  5H20 A;  1FBQ A;  2L02 A;  3SHF A;  3L2C A;  2BV6 A;  2Q2E A;  3V8J A;  2XAH A;  3ZMT A;  2BE5 F;  1KQ8 A;  4I98 B;  1F9N A;  1BI0 A;  2ZNZ A;  5FO5 A;  2RGV A;  2XAF A;  1HXD A;  3ZMD A;  5A2Q K;  3BJA A;  2COM A;  4YG2 F;  2L3D A;  2EFN A;  2A6E F;  5IT9 K;  3RPU A;  4GO1 A;  3G3Z A;  4S05 A;  4OIP F;  5DEQ A;  1U8R A;  1FZP B;  1J5Y A;  5HS9 A;  1JGS A;  2Z3Y A;  3B02 A;  4I0B A;  4CZZ A;  1T98 A;  1TLH B;  5EEH A;  2EFO A;  1Z05 A;  3DP7 A;  3ELK A;  1ZRC A;  5DUI A;  3F72 A;  3GW2 A;  2NYX A;  3M8E A;  3RYP A;  2CSO A;  2EJR A;  2HKX A;  5HLH A;  3H3Z A;  4OOI A;  4LB5 A;  1SFE A;  2FOK A;  4RGU A;  3VEP A;  5TJJ A;  1F4K A;  1MKM A;  2JPC A;  1MJA A;  2MBF A;  2RC4 A;  4O6J A;  3G73 A;  2LF7 A;  4G8X A;  4LLN A;  2ZME A;  1REP C;  1ZRD A;  3BJ6 A;  5CVR A;  3T5X A;  2M5W A;  2FML A;  1QGP A;  2GWR A;  1FSE A;  1F5T A;  2DPU A;  5ILU A;  1WRJ A;  1ZLJ A;  5JHU A;  1QZZ A;  2HKO A;  2D45 A;  2DBB A;  1VTN C;  3K69 A;  3N4M A;  5D4S A;  1YQA A;  4UVA A;  1KU3 A;  2V1X A;  3HTU A;  3I4P A;  4NB5 A;  1XMK A;  3KP2 A;  1CGP A;  1Z9C A;  1J2X A;  1KQ0 A;  2DQR A;  4HX4 A;  4I2O A;  3K9T A;  1K79 A;  4U88 A;  1CF7 A;  1ONV A;  2ACJ A;  3R60 A;  4R8H A;  3LA7 A;  5FFX A;  2DI3 A;  3F22 A;  2FF4 A;  2MA3 A;  3HOS A;  1UCR A;  4IHS A;  4HA8 A;  4OIQ F;  1YLF A;  4GXO A;  4U0W A;  2WC2 A;  1LNW A;  4EJU A;  3ERE D;  3MCZ A;  1RZ4 A;  2Y48 A;  2PLY A;  1TW3 A;  5E20 A;  2GQQ A;  1FT9 A;  2ISY A;  3QAH A;  4I02 A;  1RI7 A;  3R4K A;  5F6F A;  1G4D A;  4M73 A;  4CYD A;  1DUX C;  4BHC A;  3IRR A;  2FEZ A;  1I5Z A;  4E70 A;  4A6D A;  5D5V B;  3U1D A;  2VE9 A;  4TV7 A;  2CGP A;  1XGS A;  1UHM A;  2ZO4 A;  4A5N A;  2IW5 A;  3J81 K;  3SZT A;  4I01 A;  1ZHF A;  5E1Z B;  2K7L A;  1BM9 A;  2HTJ A;  2QVO A;  3QOP A;  1J0R A;  4ZZL A;  3O6B B;  2OU2 A;  1TTY A;  1KU7 A;  4BXU A;  1BIA A;  4M9Z A;  1B9N A;  2P5L C;  2W84 A;  3SQN A;  3FX3 A;  5E1X A;  1B1B A;  1FC3 A;  1FBS A;  4DQ2 A;  5E1W A;  1HW1 A;  4Y13 A;  1P92 A;  2H6B A;  2BGC A;  5LEJ A;  3TKY A;  4KUM A;  1BC7 C;  2PI0 A;  5CYV A;  3QRF F;  3BWG A;  2O3F A;  5CJ9 A;  1ZRE A;  2E1N A;  3LQQ A;  4IVN A;  2QBY B;  3CUO A;  4A2U A;  4Q5S F;  4ENN A;  3F8B A;  2DQL A;  4MEX F;  3BJO A;  5HS8 A;  3GYH X;  2C6Y A;  3E97 A;  5CVI A;  3HSR A;  5LHI A;  4WCG A;  1YYV A;  3HRM A;  1XSX A;  1R7J A;  1ZAO A;  2W57 A;  1YFH A;  2D1H A;  2WTE A;  1YG2 A;  4IRH A;  2J5O A;  1OYY A;  5D6F A;  5HLG A;  2KJB A;  2NNY A;  2FBI A;  4GCV A;  5L3C A;  4BH9 A;  4P5O A;  1S8N A;  1HQC A;  2HQR A;  3W6J B;  3TOB A;  3DFG A;  4GGG A;  2YPR A;  5DD4 A;  4CGZ A;  4FT8 A;  3KP3 A;  1MZB A;  3QP6 A;  3ABU A;  2ETH A;  5D5W B;  2R7D A;  1KYW A;  1LQ1 A;  1I27 A;  3IWZ A;  2WV0 A;  4WF2 A;  1JHF A;  4KMF A;  1Z7U A;  1HKS A;  1AWC A;  4MTE A;  1R23 A;  3KP7 A;  4HQM A;  2PG4 A;  4BHP A;  3TDZ C;  2HS5 A;  3CUQ A;  2QM3 A;  4ZZD A;  2VT2 A;  5HVQ C;  2UZK A;  4OIN F;  4KNY A;  4RGS A;  3H92 A;  4CXF A;  4EV0 A;  1H9G A;  3ECH A;  1RUN A;  4PGH A;  3GF2 A;  3DQV C;  3HYI A;  1Z91 A;  2FBK A;  4LLG F;  3C1D A;  4RAY A;  5J6X A;  4DNC A;  3KP6 A;  4LLL A;  1ZG1 A;  1YW9 A;  3VOD A;  1FOK A;  4LB6 B;  3DEU A;  5JR3 A;  2V1D A;  3LST A;  1CF7 B;  3BPV A;  3EYI A;  4WXH A;  1BI1 A;  4XRF A;  4HX7 A;  3REO A;  4BAY A;  2Z9O A;  1NHA A;  4YFK F;  5K5Q A;  1B4A A;  5E8I A;  4BNC A;  5DV5 A;  2FBH A;  3B73 A;  3LFK A;  2XV4 S;  4KYW A;  3KZZ A;  2L4M A;  3ISP A;  3DPL C;  4G7O F;  2G9W A;  3ZN1 A;  3IHU A;  4ESF A;  2RVC A;  4AD9 A;  2E7W A;  3GVA A;  1W7P D;  2NAZ A;  1R22 A;  1W7P A;  1UB9 A;  1T0F A;  2EA2 A;  1FYK A;  2VC1 A;  3V7C A;  3Q9S A;  3WTX C;  3HSE A;  1ZN2 A;  4UV9 A;  1O7F A;  2W24 A;  2K27 A;  1B6A A;  3E6C C;  5HDK A;  2K4B A;  1BC8 C;  1DP7 P;  4EMS A;  4KMU X;  1OPC A;  1IXS B;  4HLX A;  4KN4 X;  2NNN A;  2PJP A;  5FLX Z;  2ELH A;  2Z33 A;  4EM1 A;  3E6D A;  3C3W A;  4XSZ F;  2VBZ A;  1ZLK A;  2G7U A;  4HQE A;  5LRS A;  2EFP A;  1R36 A;  2Q8K A;  2F2E A;  4LK1 F;  5D5U B;  3KFW X;  3LWF A;  1GXP A;  3V7S A;  1QO0 D;  3ZP5 A;  3QPH A;  1EH7 A;  4GYI A;  1RNL A;  3E5X A;  2JT1 A;  1R5G A;  1O3T A;  1YS6 A;  3E6B A;  2HYG D;  1XDS A;  1JHH A;  3K1P A;  1ZG3 A;  2V9V A;  2EFQ A;  2BBY A;  1J9I A;  2FNA A;  4KT5 C;  4L5J A;  1UFM A;  2VBY A;  2HFH A;  2EB7 A;  3MZH A;  4EJV A;  2QEN A;  5EEG A;  3M1E A;  2ZJ2 A;  1UST A;  1W5T A;  1UHW A;  2XRO A;  3BY6 A;  1IN8 A;  3KP5 A;  5E18 F;  4IXA A;  2DO7 A;  3GFJ A;  4G94 A;  1RUO A;  2JTV A;  1TNT A;  1MJ9 A;  4JQF A;  2MH2 A;  1FP2 A;  1HSJ A;  5LBQ A;  3GX4 X;  2A68 F;  4RB3 C;  2K86 A;  4M71 A;  3D5L A;  2A6H F;  4KDP A;  5HDN A;  2VC0 A;  5HDG A;  4ESJ A;  4ETS A;  1S7A A;  3CO7 C;  3DPT A;  4U0V A;  2CWE A;  5AIP A;  4L9V A;  3FXR A;  4U0Y A;  4NQW A;  1E17 A;  2STT A;  4HYE A;  4MTD A;  4QWQ A;  2M30 A;  4GYG A;  4R1H A;  5FD6 A;  3WTY C;  3CO6 C;  3BP8 A;  4WK8 F;  2K02 A;  1WI9 A;  2DU9 A;  1SMT A;  3P9I A;  1WQ2 A;  2FNP A;  3LAJ A;  2IRF G;  3CJN A;  1XCB A;  2PBI A;  2O61 A;  3CUQ B;  3HHH A;  2RNJ A;  4RGR A;  2K4J A;  1H9T A;  4BYY A;  1XSV A;  1OR7 A;  4B09 A;  3O3K A;  5IT3 A;  3I71 A;  2QZ8 A;  5DCM A;  4M9S A;  2HTS A;  3R6S A;  2KJC A;  2GXB A;  2F5E A;  2GAU A;  1L0O C;  3ZMS A;  2EWN A;  4HX8 A;  5D8K B;  1R1V A;  3WTZ A;  4HLY A;  5BPI A;  3ZMU A;  3L7W A;  2KIM A;  1SAX A;  5DCF A;  3HOT A;  2OBP A;  1OKR A;  1XDU A;  4IHT A;  1U5T A;  3WGI A;  2IVM A;  2ESH A;  1S7O A;  1K78 A;  1WKM A;  2WWY A;  5ED4 A;  4MGR A;  5ILV A;  2AS5 F;  3FHZ A;  2UXN A;  2E7X A;  3SXY A;  2Y0M A;  4RB0 A;  2FU4 A;  2P6S A;  1DDN A;  1IN7 A;  5FFZ A;  5D8L B;  3WTT C;  3EET A;  2L4A A;  1W7P B;  5K5R A;  5DDG A;  1J7K A;  2MLG A;  5E8G A;  3I0T A;  1TBX A;  3GUD A;  5BMZ A;  4G7Z F;  1I6X A;  2LF8 A;  3SFZ A;  3WE2 A;  3TDU C;  2VOD A;  2VBX A;  3TO7 A;  1LDK B;  2QQ9 A;  1P6R A;  1IZ1 A;  1FPQ A;  4B8X A;  3ML6 A;  4UHT A;  3I5U A;  4EM0 B;  1ZGA A;  3PQJ A;  4PDK A;  4OMY A;  1G3S A;  3ECO A;  1IAW A;  3F8N A;  5BOX A;  2MC3 A;  4UV8 A;  1IRF A;  4ENJ A;  1MDM A;  1KGS A;  4M9X A;  4S04 A;  1YW7 A;  1J59 A;  3IWF A;  4XSX F;  4A0X A;  3I53 A;  1FBU A;  1T6S A;  1ULY A;  2RV8 A;  2F5D A;  4FX4 A;  5KVR A;  1K7A A;  2PQ8 A;  1H0M A;  2H6C A;  4UNO A;  1O3Q A;  4L0Y B;  1S6L A;  3J80 Z;  4K2E A;  5DYM A;  2VT3 A;  2LDU A;  3HRT A;  3VB2 A;  1R1U A;  2EV6 A;  3FMS A;  4MHG A;  5LHG A;  5FGM A;  1ZRF A;  3HTS B;  2XHK A;  2FMY A;  4RAZ A;  3PFI A;  3K1M A;  4A0Y A;  2PN6 A;  2XRN A;  3M9A A;  4HV5 A;  1SFU A;  4KFC A;  5DD8 A;  1OYI A;  2VN2 A;  5HS7 A;  1ZAR A;  2IT0 A;  3BDD A;  4WWC A;  4HBL A;  4CO8 A;  2V79 A;  1DPU A;  3CUQ C;  1U78 A;  4I0A A;  1XSD A;  3V8L A;  3ZMV A;  1LDJ A;  2A07 F;  2O8X A;  1B59 A;  4M6Y A;  2M45 A;  2ZBK A;  3FZV A;  4XBF A;  2P4W A;  5BPD A;  1XGN A;  5D4R A;  4R79 A;  3CTA A;  1G3T A;  4EJW A;  1FWZ A;  3ULQ B;  4FHT A;  3JW4 A;  4O3M A;  3RTR A;  1GVJ A;  2R7F A;  3D0S A;  4AIK A;  3GFI A;  2P6T A;  1BOA A;  3U2R A;  1KU2 A;  1BI2 A;  2Q0O A;  4EQQ A;  4BQA A;  4AWX B;  2GZW A;  3J81 Z;  3BZ6 A;  3MEX A;  3RYR A;  2STW A;  2CO5 A;  2XAS A;  2XAJ A;  2KIF A;  3JAM Z;  5K1Y A;  3WGG A;  2XKO A;  3JSP A;  3WGH A;  5JI6 A;  1FYL A;  3GLX A;  5DCM B;  3AAF A;  4ON0 A;  3V8K A;  1P4W A;  1XMA A;  2M8E A;  1S29 A;  2ZME B;  3L00 A;  5ICF A;  2VXZ A;  2OAZ A;  2QLZ A;  2LKP A;  5ERI A;  2AXL A;  3DV8 A;  1U6G A;  2XUB A;  4LK0 F;  3I59 A;  3E5Q A;  1P4A A;  2PFB A;  2D1V A;  1ZG5 A;  1U5T B;  1R58 A;  2CG4 A;  1TNS A;  3T1B A;  3MQ0 A;  2YU3 A;  2FA5 A;  2CW0 F;  3DXJ F;  2Z99 A;  1ON2 A;  3R0A A;  3TOA A;  1EH6 A;  1D8K A;  1S3J A;  4YII A;  3QU6 A;  3L9F A;  4MNU A;  2G7H A;  3KEQ A;  4HF2 A;  1IW7 F;  2KIU A;  2A69 F;  1XB4 A;  3FM3 A;  3GFM A;  1IN6 A;  3T8R A;  4ZYE A;  4YFN F;  4KIC A;  4I7H A;  3I64 A;  2D2W A;  2HYF A;  3F8F A;  3LA3 A;  1BI3 A;  2OZU A;  3F6O A;  4O5V A;  2DT5 A;  2DK5 A;  2DAO A;  4LJZ F;  3MFK A;  4IRG A;  2R3S A;  2VOO A;  3I58 A;  4L9J A;  1P4X A;  1BIB A;  2OQG A;  5LGN A;  1GXQ A;  1V3F A;  2MLK A;  1MDM B;  4G6Q A;  3NEU A;  1R00 A;  2VE8 A;  4CIC A;  3W6K B;  4IPA A;  4L9N A;  5J8F A;  1FY7 A;  2HEO A;  3WG9 A;  4HDU A;  1G3W A;  3WTS C;  4EGY A;  1OYW A;  3O2P E;  1MJB A;  3WU0 A;  3T8T A;  2X0L A;  4EGZ A;  2YX4 A;  3V7R A;  5K5O A;  2FQ3 A;  3K0L A;  4XLN F;  4YFX F;  4P55 A;  1D5V A;  2IA1 A;  3P9K A;  3WTV C;  1LB2 A;  3DF8 A;  5LRR A;  1MD0 A;  2GIV A;  2RQP A;  4ZYH A;  3IRQ A;  1IXR C;  1TW2 A;  3GZ6 A;  2P7V B;  1ON1 A;  2EV5 A;  4XLP F;  3RKY A;  1KA8 A;  3EDP A;  2PMH A;  1RIO H;  5D5X B;  3KLO A;  3J7A O;  5H6R A;  2RDP A;  3GWZ A;  2RKH A;  1SD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...