2V1NA

Solution structure of the region 51-160 of human kin17 reveals a winged helix fold
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
111
structure length
111
Chain Sequence
GQRQLLLASENPQQFMDYFSEEFRNDFLELLRRRFGTKRVHNNIVYNEYISHREHIHMNATQWETLTDFTKWLGREGLCKVDETPKGWYIQYIDRDPETIRRQLELEKKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords PROTEIN KIN HOMOLOG
publication title Solution Structure of the Region 51-160 of Human Kin17 Reveals an Atypical Winged Helix Domain
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2007-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2030 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2v1nA01
2V1NA
chains in the Genus database with same CATH superfamily
5L3CA 5EG0A 3QYFA 3F8FA 1IN4A 3C1DA 4Y15A 4G94A 2FOKA 3BR6A 1HW5A 4XMYA 1FJLA 2RC4A 4OIRF 1O57A 2VOOA 3ABUA 5D4SA 3K6GA 5FRMA 5LGUA 1VQPI 4LB5A 2BZTA 3R60A 1IN7A 3N05A 5D5XB 4OU0A 5L3GA 2FF4A 1OQYA 2YSRA 1J75A 1HA8A 4CO8A 2IXSA 5KAFC 4G7ZF 1UHMA 4BJ5C 5DEQA 1HKSA 3FK7A 1V5EA 3Q9VA 3C3WA 1X19A 1V5GA 1ZLJA 2LK2A 1S7EA 4NC6A 4BAYA 1Z0XA 4IL6C 4KISA 3GZ6A 3GBGA 3GZNB 4KIGA 1AWCA 4HV6A 2O8XA 4XOPA 2IGNA 4C2UA 1X3ZB 2MSYA 1ITYA 1K6OA 5HDGA 3NWSA 5J1RA 2IVMA 4BNCA 5JLWA 1JI8A 4Q5SF 4A2UA 3PIOF 1PDNC 3NARA 2DT6A 2H27A 1SD6A 2KIMA 3LSMA 4E7HA 1VFCA 2A6EF 3VSLA 5HNHA 3HKZA 2DMUA 3KYLA 4BXUA 1FOWA 2EZKA 2CW7A 5GADJ 5IOYA 5IOZA 3MZHA 4LG0B 1OYIA 4PJ0C 2CG4A 2OCCH 4KJZA 2R7TA 1UZCA 2HKXA 2M87A 5DD8A 1D5YA 2OV7A 4U7BA 4LG0A 4K2EA 3G3ZA 5CVIA 1X2MA 4IOAF 4LFUA 3CDLA 5ICEA 2DA5A 2J5PA 2XPWA 2XPUA 3LSHA 1P4AA 1WQ2A 3FKIJ 3V7RA 3CTAA 2F48A 4XQFA 1YW9A 2FA5A 3E6DA 1VQMI 3ML6A 5GPAA 3V8KA 5F27A 3BG3A 3K4BA 5D8KB 3FXMA 1CQTA 1Y1WJ 1F5TA 3BCAA 5E3NA 2EPFA 1HW1A 5EZHA 4J00A 3G2BA 5TISC 2AXTC 1Y0NA 2VQHA 3AG2H 2K9MA 4BEHB 1OYWA 4KMFA 2W48A 1POGA 1FTTA 2QSHX 3S2DJ 5EZGA 3WGGA 2QLZA 1S5LC 4ESJA 3NAUA 5CQEA 4DGWB 3KETA 1KQ8A 2XGXA 4AUXA 4BEHA 4XLAA 4EM0B 1JUPA 3S17J 2EJRA 1LEAA 3IAS2 1OMIA 2DK5A 2OZUA 3KEYA 1XGMA 4QIWN 4A3GJ 2M7BA 5EEAA 2R7OA 2CUZA 3AG3H 1X1DA 1ODDA 1MNDA 4CCNA 3HEFA 3J81K 1ZR4A 3WODF 4PGGA 1S8NA 5D6EA 1SC7A 3T0YA 4DYCA 2QKLB 3LSTA 2K3PA 4A5NA 3DXJF 2L4MA 2CQNA 2G9WA 4I0AA 3GMEA 3VYRB 4G8XA 2D2WA 2JUGA 2LF8A 2ZSHB 4BQOA 5AIPA 2ZNYA 3W6JB 3VYUB 3OY9A 5E18F 4C3IJ 4BQNA 4G7HF 1DGWY 2ZFWA 1TWHJ 2XB5A 3TDUC 4EJUA 3IC7A 1X3UA 2JMWA 4HW0A 4C2MJ 4RA2A 2DOEA 2IW5A 3RIRA 4L5IA 4JBAA 4XRSA 2ZJ2A 3DBLB 2HOAA 1TWFJ 5IT9Z 2PLYA 2H1KA 4J19A 1ZHFA 2OTLI 4ZYDA 2QZ8A 2RNGA 2G0EA 3S3NA 4Y17A 4V2FA 2E5ZA 4LG3A 1DP7P 4W1UA 1QZYA 2XPVA 3PSIA 4ZDLA 3FXQA 4WCGA 2IAIA 3ABLH 1RZ4A 4CYCB 4AM3A 1X58A 2H09A 2H1LA 3U2RA 2VLAA 4ETSA 1DPUA 5E79C 1L0OC 3H3UA 3GEZA 3M9AA 1X1AA 3BG6A 1ZARA 1YS6A 4DJAA 4A3KJ 2L3DA 3CUOA 2BXZA 2DK8A 4L0ZB 2L02A 4CYCA 1JGSA 4A12A 5H6QA 3BTCA 5DUKA 2MA3A 2D1HA 1G3WA 4MO7A 2HKOA 1G4DA 1WH5A 2HZDA 2JZYA 2F2EA 2RAEA 4Q48A 2X6OA 3EUAA 1MNEA 3K7AJ 1USSA 3EUHC 3IHUA 3SXYA 2NVUB 3TDZC 5D5WB 3PSFA 1TQMA 2PMZN 2XB0X 3G1LA 3RKWA 2VASA 2EV0A 1BW6A 3PUBA 2Y75A 1J2XA 2IGKA 1XCBA 4RLFA 2CUJA 3WU1B 2BEOA 5FO5A 1S6LA 3KYCB 1SD4A 2HXOA 4RBOA 3ZN1A 3DU6A 4DZJA 3QOEA 4DW6A 2CQXA 1B8IB 1SFXA 3GF2A 5ILSA 1ZRFA 2E5NA 1I27A 1XB4A 3DEWA 3DLAA 3OMYA 1ETQA 1LKXA 4JX6A 1C0WA 4XRMA 2EFPA 1E3HA 3K1PA 3I4MJ 3ULQB 1HF0A 3R0JA 1FMWA 2KIUA 3FMQA 1HBXG 2KDOA 3I55I 2R7WA 4XONA 1PUFB 3F22A 2LNBA 2XAFA 4HX4A 2P5LC 3RJPA 4EEFG 3OS1A 2UUZA 3HUGA 3OS0A 3RI4A 2QUFA 5J3LA 3TBIA 5HOOA 3RKYA 3R4KA 4IVNA 3L2WA 2GXGA 1S9HA 2RREA 1PUFA 3HTSB 3I53A 4RGSA 3VB2A 1B4AA 3AG1H 4M73A 2V1DA 2XAJA 3I0TA 1APLC 2QYOA 3BTLA 2R7UA 2KHMA 2BW3B 2Q2EB 3P9KA 2PN6A 2VODA 4JX4A 1FSEA 1W0TA 3FBNB 3ZQHA 5HODA 1SFEA 5A2QK 2HGCA 3T8TA 1SFUA 2OD5A 3C7JA 4HA8A 1SAXA 2STWA 1MBKA 3DTIA 2BW3A 2Q2EA 4ZZDA 3BP8A 1AOYA 4TV7A 3JRBA 1OISA 1JGGA 4HNVA 4IHXA 1T39A 3UR3C 2JPCA 3RYRA 3GYHX 2LDUA 1AKHA 1QA6A 4L9VA 4WXCA 2ZMEC 4EJWA 3AAFA 4IHTA 5C4XJ 3IV5A 3JTGA 2B0LA 2LRDA 4NB5A 1KONA 1IC8A 5D5VB 2ID3A 2LREA 3CCUI 2HEOA 3FXKA 4JQFA 1YW7A 4GDFA 2PFBA 1WI9A 4E7JA 1Y6IA 4DNCA 1MMNA 2VKEA 4IJAA 4AIJA 1XN7A 2OPTA 4I2OA 3HZJA 5L3BA 3OL3A 5EDNA 1CF7B 5FKMA 1QRYA 4ESBA 2KRFA 3KLOA 3OYGA 3FHNA 3CP2A 2DXIA 3M7GA 4OAYA 4EM2A 1CF7A 2GA1A 5DTDA 3BROA 4XSXF 3CJNA 2YX7A 4PSWA 1DDNA 3QPLA 3ZQQA 4NC8A 3SZPA 4CGZA 2NNNA 2DJIA 3F23A 5F1RA 1Q1HA 3BJAA 3LAPA 5HLGA 2IBDA 4MNUA 3E7LA 3LAJA 1M1EB 2HVQA 5L3DA 3I56I 1TWAJ 1EKEA 2VBZA 5AONA 1FC3A 2WAFA 4HPQA 4NBQA 4CCMA 1I6HJ 4AYBN 1ORKA 2XDVA 1IZ1A 4XLFA 2JA6J 3JRDA 3MKLA 2CQKA 2WV1A 4XKCA 1OCZH 4BJ6C 3MN2A 4LOCA 5L3FA 1I1GA 4P9FA 4A3JJ 1HSTA 2OC6A 3HHHA 3HSFA 4XKWA 4KNYA 3GFIA 1N77A 1YJ9I 2K9QA 4BDYA 3AL0B 4RMNA 4L9JA 2NNYA 2NRAC 1SD7A 5JVTA 5KVRA 5M5YJ 4EJTA 3ASOH 2ISYA 4C3HJ 3IH2A 4HF2A 2L5QA 1MDMB 1MMAA 1D8KA 3DWLE 3OWTA 3ZMDA 4S05A 3RKQA 3JTHA 2I8DA 1EJ9A 2FBKA 3DP7A 2MC3A 1YIOA 2P6SA 5J1YA 4CZZA 2O03A 3V4GA 1MDMA 4HF1A 3S16J 1RNLA 1I50J 3H5NA 4Z6YA 2LG4A 4HDUA 1RPWA 5LRSA 4OIPF 2MLGA 2DODA 3KP7A 4A3EJ 1X1BA 3WTSC 3O6BB 5KHDA 3KX2A 1P7JA 2CFXA 5F0CA 1X1CA 1WFXA 2STTA 1QZZA 2ZBKA 2JVGA 2K27A 2GOXB 1A36A 1B59A 3LWFA 4UHTA 2R4GA 1T0FC 1MBFA 4ESFA 3WTYC 1B9NA 3LSKA 2W84A 4KUMA 2WWYA 1GVJA 3HKZN 3WU0A 2DA1A 3DBRB 2DA7A 3MVPA 4Y52J 3KP3A 1FTZA 2CQQA 4FX4A 1MNMC 1H8AC 2DAOA 4BHCA 4F93B 2IP2A 2KQRA 1T56A 1JKPC 5CKTA 5E3OA 1IUYA 4ENNA 2K86A 2QKMB 4G9YA 1R00A 4M9XA 3JW4A 2QGUA 4RAFA 1UHSA 1XTAA 3QP6A 2AHQA 2HYFA 1R1VA 4A6DA 1ZAOA 1U5TC 2N8GA 2E1MC 2MG4A 3OV8A 4WF2A 3ZOBA 4YFNF 5LGTA 3LOCA 4IO9F 2E1OA 5HLTA 1GV5A 1ZELA 2R7DA 3VODA 1LPQA 1OJLA 4GYGA 2F4MB 3CO7C 2LVSA 2DYSH 1FPQA 1FX7A 1RUOA 5DCMB 1MBGA 4KICA 2B63J 2XIGA 2P7CB 1TBXA 2F5EA 3HB9A 3J81Z 2OF7A 1ZRDA 1RR7A 1LDKB 3W2AA 4MQ9F 1JKRC 1IV8A 4IHWA 4GGGA 4BE0A 5DCMA 1PP7U 5E20A 4H4KC 2Y69H 2MYSA 3Q9SA 2Z1DA 2OU2A 4XLNF 5J4YA 2V4JC 3E5UA 1K4SA 3HSRA 3M8EA 5TJJA 2DOFA 3DBHB 3I9V2 5GAGJ 5H20A 4ZJZA 1TP4A 2LBFB 2E1NA 3HM5A 4RS8A 4D7MA 4CHUA 3HOUJ 1DP3A 2D5VA 2EQRA 2XV4S 4FX0A 5IY5H 1YRNB 2ZO4A 1BBYA 3BOQA 5BPIA 3DKXA 2UZKA 4UXNA 2LBFA 2IS2A 2LLKA 1FEXA 4A0XA 3G71I 2BHZA 2F4IA 1JHHA 3H35A 3Q0WA 4A3IJ 2E35A 2WY7Q 1U8RA 1A04A 4KN7X 2LYCA 2QQ8A 9ANTA 5K7FA 2O3FA 4CXFA 3NEUA 2XKOA 3WHCA 2DMTA 4RM2A 4FT8A 3GTKJ 3BG9A 4XLHA 1D1CA 1KQ9A 3FISA 4H0EA 4ENMA 1Z91A 1H0MA 4LD5A 1U6GA 1R4MB 2FMLA 2CH0A 1Z7LA 1NG7A 2GOMA 4Z2YA 3SDGA 5B66C 2XGCA 3GUDA 5E8GA 3QOPA 2DQLA 5CYVA 1IF1A 5BS6A 4IX7A 2YX4A 3OR1C 2R93J 1K79A 3ZMVA 3FM5A 2A05A 1G2HA 2L7KA 1ZGJA 5JFRA 3OYAA 4JK1X 4CICA 2OQRA 3A03A 2JA7J 3C2GA 1MSEC 2V9PA 1B6AA 2DFFA 2Y9ZA 5GPCA 1LEBA 1XD7A 3EUKL 1ETKA 2A69F 1J0RA 3OYNA 1OFCX 3MCZA 3DF8A 1KU7A 3BY6A 1W1WE 3BZ6A 3OYJA 1NG6A 2L9VA 5KK1A 1BI2A 4PJMA 3SEZA 2KL4A 3CMYA 3T5XA 3MQ0A 4YG2F 1KGSA 4JX5A 4C3JJ 5K7HA 2VONA 4WXHA 3HOXJ 5E3MA 4A0YA 4CCKA 1Z05A 3VSKA 1XGNA 1Z67A 3T8RA 2M45A 3MKWB 2QVOA 4IRHA 2OJED 4MLOA 2X6XA 4L5JA 2O0YA 2O9LA 2JA5J 2V1NA 2JTVA 4HYEA 3K10A 2NOJB 5GTIC 5JHUA 1QHGA 4UNOA 2WBMA 2XGDA 2XAGA 2P8TA 4HOBA 2F5FA 1XDSA 2Z99A 2ME6A 3H36A 5M5WJ 3CDIA 2COBA 4HF0A 1PJRA 1QNTA 1Z7UA 3IKVA 4M6VA 5J8CA 1ZG1A 1KYZA 2WB1N 4JP0A 3PO3J 2IPQX 3H92A 1BJZA 1MKMA 3SYTA 3BQYA 4DYQA 4M3BA 3BR3A 3PM1A 1REPC 2DMNA 2L54A 5A2QZ 2A6HF 2GXAA 4XKBA 1FLIA 4HZFA 3HPGA 3V7CA 2A5WA 2VQGA 4O6JA 4HNTA 4N4NB 2HQAA 2DCEA 3OYBA 3OYIA 4BQQA 2KIFA 2CJJA 4M3GA 2X6YA 4FE4A 1R1UA 2IS1A 1P4XA 3LA3A 3CCSI 2DBBA 2MC4A 3F21A 1BOBA 3CCRI 4HBLA 4QWQA 4HX7A 5LEKA 2A68F 4G6QA 1R5GA 4RGRA 3BPXA 4BBRJ 2QWWA 4II2A 5TGTA 1RIOH 2CW8A 1IDZA 3L00A 2EWNA 4PUSA 1MMSA 3I71A 4I09A 1MH3A 1ZG5A 2M7AA 3GTMJ 3UKGA 2RV8A 1YOVB 2XAQA 1VQ9I 4OMZA 1HLVA 2OCEA 3W6KB 4YIFA 1W4MA 5H6RA 4EJOA 2K85A 5J47A 3WGHA 4KDPA 2K9SA 2H8WA 2CGPA 1SMTA 4ZTFA 3F8BA 2O7OA 1KU9A 5DV5A 1R36A 2VKDA 3REOA 1VQ6I 1YG2A 2KMUA 1IG7A 2MH2A 3WTXC 4QPQA 1V54H 5HS8A 1R9TJ 1HQCA 3RPUD 1LFUP 4ZZLA 1T8IA 4A3MJ 2EIMH 1IN8A 3CQZJ 1ULYA 4E7ZA 3F8NA 3P9CA 3DPLC 5GP9A 1EH6A 4EQQA 4M3EA 2LP0A 3OYMA 2D1VA 3M8FA 3ZQFA 3ZR8X 3WU2C 5FLXZ 1FP1D 3WE3A 3IUOA 3OIOA 3CCYA 3CJRB 3ISPA 1GV2A 2EA2A 2M0MA 4RB3C 2Y0SA 4XOTA 3TEDA 4Y3OA 4DOZA 2BY3A 3K9TA 5FKKA 2JUCA 1VQ5I 3E6CC 3HPHA 2Y31A 3MKYB 4BS9A 3KZYA 2XVCA 5LBQA 3LA7A 4LLNA 3LSRA 3WTUC 1KZHA 4MQVA 4MFDA 2L0KA 1WJFA 4R79A 4HQEA 2CV1A 4HV5A 4QPOA 3E0JB 2EH3A 1YITI 4ENJA 4OMYA 2YU3A 1WGXA 2R7ZJ 3LSIA 1OR7A 2KLOA 1VQKI 1WJDA 3CF2A 5GAHJ 2UXNA 2BVMA 2E1CA 2KJCA 2DJNA 2LKPA 2JN6A 1TWCJ 3R6SA 5IYBJ 4D7NA 3GLLA 3IH3A 3HGGA 1W36C 1BN5A 3CD6I 1IGNA 4E4HA 3K4MA 3LL7A 1QU3A 1HKTA 4BH9A 1D8JA 2ELJA 3H3VK 1IN5A 1MIJA 3SHFA 3TO6A 4IHYA 2TRTA 1LUJB 2KPMA 3L1PA 2R7VA 3CLQA 2E34A 2EIJH 1XSVA 2MD5A 2ELKA 1RRJA 2MBFA 1SVLA 4A5MA 4RGUA 4LMYA 1NK3P 2NVXJ 1LJ9A 3A1YA 3HRTA 2JVHA 2ETHA 1WSUA 4M72A 3AFHA 3HRSA 1ACIA 1I1SA 3GFLA 4DBQA 2VC1A 3QPTA 4HEA2 3PL8A 4I7HA 1VQNI 1YJWI 2K9LA 2DT5A 4N9IA 3ZMTA 2GAUA 3S93A 4XICA 1Y1VJ 1R7JA 2E60A 4Y4RA 2A07F 1WPKA 4QSHA 3JSOA 2W57A 1HW2A 3FXUA 5IPAA 3RZOJ 1Y39A 2MH9A 3KP6A 1HDPA 1FYMA 2WADA 3O8HA 1EH8A 2FMYA 2HR3A 3DPUA 3KPHA 2PMUA 3BR5A 5BPDA 1E3OC 2R3SA 1A5JA 4E7IA 2K40A 4BY1J 2EA4A 5E1XA 1R4NB 4IEJA 3DEUA 3OYDA 1S3JA 4D5FA 4AIHA 1BC7C 4P1WA 4U0VA 5JLXA 4BL0B 2EZIA 4PJNA 2VKVA 1I39A 3RPQA 1E3PA 3P5JA 3CESA 3PJRA 1ZTRA 1WVRA 5K5QA 2E2IJ 3CCJI 1FBQA 4BE1A 2VPRA 3FKJA 4L18B 3GXOA 4HAMA 2FX0A 2Z9OA 1O4XA 3CCMI 2UWMA 2BBYA 2W7NA 2R7XA 3CJTB 2CS3A 4HLXA 1HKQA 3IRRA 1U3EM 3V7SA 3H5RA 3MZYA 4PSXA 4XNFA 1GUUA 1HXDA 3FF5A 1UB9A 3K4CA 2ACJA 2WAQN 3W3CA 2E7XA 2ME0A 2RGVA 3K2AA 4GO1A 2IGMA 3F8CA 2F4OB 4M71A 1YO5C 1OCOH 5IYCJ 3KYDB 5F04A 5IP9J 3ROUA 1G6NA 3MAJA 4WWCA 3IWFA 3PNTA 4WXDA 2V6EA 5D4RA 4BU2A 3ESWB 5IT3A 2JRTA 4UY8I 3RZDJ 3JRHA 2FBIA 1B8IA 3J7AY 3B6CA 1ON2A 2CMPA 3LA2A 2C6YA 1K6YA 3GW2A 3ABMH 2PMHA 5M5XJ 5KAIC 4HX8A 1JKQC 2TDXA 2WA0A 2GBYA 1H88C 1WWXA 4CA0A 5FRNA 4FE7A 1DUXC 3DPTA 3ZQGA 1YX3A 1QVTA 4XSZF 4CZCA 4RM3A 4BQAA 3S8PA 1O3TA 5DS9A 1KYWA 1Y8QB 3HIFA 2ZJPF 2NOGA 5FLMJ 2LF7A 2KZGA 1JTYA 1LB2A 1FY7A 2Z2SB 1W5SA 1QBJA 1JHFA 4BHPA 3U9GA 1FWZA 1OCTC 2W82A 4M74A 3GVAA 3A2KA 3AL0C 1A6QA 2HOTA 3D5SC 4R8HA 3MEXA 4IXAA 2LFBA 4FISA 3QRFF 3A0HC 4B48A 1Z21A 3DTKA 4G12A 3HGYA 5E8IA 2CWEA 2DO7A 4A3FJ 3PQKA 1UCRA 2NS0A 4PCQA 5LLQA 2BY2A 3G1MA 3CMEI 4DZPA 3FK6A 2Q0OA 1X2NA 5FKNA 2GM4A 1D1BA 3OR2C 4CCOA 4OOIA 2JQ7A 4UB6C 3S2HJ 1RI7A 1D0XA 2RKHA 2VBYA 3L9FA 3QODA 4M3FA 2LY9A 3LFKA 3V42A 2H94A 4LIUA 2HU9A 2LMDA 4UV8A 5ICFA 3QQAA 3BDDA 5B1AH 2P5VA 3CO6C 2M34A 2CO5A 1R5ID 1ETOA 1MJ9A 2JJ7A 3EDPA 3CCEI 1I3QJ 2DYRH 2NYXA 1YYVA 2CW0F 3F0CA 3OYKA 2JA2A 2X9DA 3ZCOA 4F91B 4XKVA 5F08A 2DA4A 3WG9A 1VTNC 4KN4X 1IV6A 1ENHA 2ISZA 1BIAA 3CMMA 3QPSA 5J40A 2OZ6A 2VJ5A 2EV5A 5M3MJ 1HC8A 4UV9A 3L2CA 2B9SA 4MIMA 5LFAA 3DQVC 2XRNA 1LVAA 2X4HA 5JHFA 4MHGA 5D8LB 1JE8A 5FLXK 5F0FA 2X85A 2CU7A 1ZREA 3NRVA 3HL2A 1IJWC 1J09A 3ABTA 1Q1VA 1IRXA 1IXSB 2FD5A 3O3KA 3WTTC 1O7FA 1T6SA 3K70D 1TQPA 4XM3A 4BKXA 2FQ3A 4XRFA 5CJ9A 3GTQJ 1BL0A 1T08B 4LK0F 2NVTJ 2TCTA 3GCMA 3E3VA 2BE5F 1X4PA 2M9HA 2ZXWH 1Z77A 1W5CC 4B3AA 2OUMA 1P4WA 2ECBA 3I59B 2IS6A 2P7VB 2ZJRF 2HVSA 2DFHA 1LE8B 4ZDOA 3V8LA 2DA3A 3CC2I 3SJMA 2R7QA 1GVDA 2P81A 2X0LA 5DM6F 2B7EA 3ZQ7A 3H0GJ 5CVVA 4XIDA 1WJAA 3K2ZA 3I59A 3RTRA 2P6TA 1VI0A 3QU6A 2LY1A 3OYEA 1LE8A 3VWBA 2LD5A 4EGYA 3HOYJ 3ZQCA 3R61A 1JT0A 1KU3A 2VT3A 5EEGA 3VYTB 1P6RA 2NS8A 1E17A 4W97A 4OAZA 4U0YA 3QYBA 2HTSA 4ANJA 3OYLA 1G59A 1QO0D 4XR6A 5BNGA 1RUNA 2XRLA 4LB6B 1VQLI 2EB7A 2VT2A 3FXLA 4HSRA 4B44A 3J80K 2ZB9A 3FM3A 1JTXA 4N0BA 4IQ4A 1MMDA 4BBSJ 1X3WB 4BE2A 3E6MA 4OIOF 2LR8A 2EILH 2EFWA 1XMXA 3ABKH 2JSPA 1UG0A 5E17F 2DTRA 4A0ZA 1A6IA 5LEJA 2V79A 2R7SA 3B02A 2MW8A 4MTDA 4DIQA 2RVCA 1U8BA 3KZZA 1FBUA 5CVJA 2DT7B 3GX4X 1D5VA 2BHYA 4UVAA 1DU6A 4F7ZA 2F5VA 4BXXJ 3CUQB 2Z3YA 3VOEA 3W6VA 4RB2C 2HYJA 4LGWA 5B5EC 1H89C 1MSFC 4I01A 3KLNA 4ZYEA 3I58A 2XF6A 1OYYA 5EEHA 2GIVA 1ZK8A 3HRMA 4WX9A 2PMZA 4XRSG 2EIKH 3HRUA 1F1ZA 2K4BA 1MJAA 2YS9A 1TWGJ 2Y0SN 3CUQA 3OOUA 4Y13A 1XSDA 2QBYB 2ADUA 2L7ZA 3K4NA 3TP3A 2IGOA 4IRGA 2CV2A 3M1CA 1LDJA 4HQMA 3QPHA 4AC0A 5FD6A 4C30A 2QBYA 1ONVA 1K7AA 2CRGA 1P92A 5CLSA 3BZKA 4LLGF 4QTRA 1EA3A 4KYWA 4XBFA 2W00A 2Y48A 3KZIC 3S1NJ 4NHJA 4BHBA 4I98B 3FXOA 2HDCA 3K4LA 4ZTJA 3B73A 1ZR2A 1J9IA 3ZP5A 4IF4A 2MFZA 2AQEA 3WTVC 5IP6A 3RPUA 1GXPA 4LIVA 4HLYA 3TMOA 4ZDPA 3D1NI 3QWLA 4CCJA 2XF5A 3G6EI 5E1WA 1VNDA 4EV0A 4UVCA 1YRNA 1ZGWA 1R5HA 2ZJQF 1OCCH 4PFPA 2YR2A 5DYMA 3GFMA 2BY1A 1WJBA 1VQ7I 1Z9CA 4B47A 2PG4A 1HOMA 1FMVA 2NS7A 3S3OA 2IA0A 1FBSA 1RC9A 3S1QJ 4HNUA 2DOAA 4E7KA 1YFHA 4XL9A 4EMSA 4PGHA 1D3YA 3QYEA 3COAC 1VQ8I 3TO9A 3TW7A 1NH3A 1MD0A 1XMKA 1I3AA 4A3DJ 5LD2C 2A61A 5J6XA 5LHIA 2HPIA 1GXQA 1XDUA 4AD9A 1TNTA 3G73A 5B1BH 4A3LJ 2NVYJ 3M07A 2OBPA 1F4KA 4KIFA 3S1MJ 3E97A 4YIRX 1XGSA 3ZMUA 3GTJJ 1FP2A 3NWTA 4CCLA 3OYHA 1UELB 3HOSA 1QPMA 1V4RA 2EFQA 3GTPJ 1FT9A 3CLOA 4YELA 1HCRA 2FUG2 2KIQA 2VKHA 1ETXA 2CYYA 1ETYA 2R5ZB 1JUMA 4GXOA 2ESHA 2VQCA 5J1UA 3F8MA 3DCFA 4ITVA 3KP4A 1XCVA 3IAM2 2VN2A 2VOPA 2F5DA 2ELHA 1FYKA 4B09A 1LVKA 2PJRB 2PQ8A 1D0YA 5F0HA 3OL4A 2R5ZA 5K7ZA 1KA8A 2V9VA 2ZCWA 5B3SH 4AU7A 4M9ZA 1R58A 1WJEA 3RKXA 1HDDC 2RQQA 4L9NA 2PJRA 1IRFA 3GTOJ 2RQPA 3D5RC 3CDHA 2WTEA 1S29A 3S1RJ 3OIPA 2VXZA 1FOXA 4AYBA 1QQIA 1O7LA 3H3ZA 4NDLA 5J8FA 1XPXA 1WI3A 1OR7C 2FJ1A 2XC7A 5TRDA 1A31A 4U0WA 3GO5A 2KZVA 1P9QC 4BACA 5FLVA 2W85A 4II3A 4M6XA 1R23A 5CQGA 3RQIA 5ILVA 2GA2A 2KRHA 3U1DA 3F6VA 5D5UB 4Q4ZF 3VDXA 3BLYA 3ZN0A 3WTWC 1K78B 1LFPA 2FNPA 2DFIA 1DPRA 1PP8F 5IP7J 1Z6TA 5EJCA 4LLLA 3LFUA 1JT6A 2HOSA 4LK1F 2E2JJ 1WZ2A 1SFKA 5C44J 1RETA 1K78A 4MEYF 3RSNA 3CP8A 4UUSB 4RAZA 4CH7A 2KRCA 2CQ7A 2W24A 4V2GA 2KFDA 4Y33A 3LNQA 5KNLA 4Q47A 5LRRA 4FETA 4AVPA 3M4OJ 5D6FA 2EZHA 3BG5A 5BOXA 5DCFA 2K9NA 5DDGA 1IXRC 2UXXA 3I54A 3SFIA 4UUSA 3Q0UA 2IS4A 4X0GA 3H9QA 4MGRA 4D0PA 1ETVA 2FBHA 4I99C 3RDIA 2R7FA 3IL2A 1SEUA 1AHDP 2IT0A 2G7HA 1Y56A 4MTEA 2IA1A 3IKTA 4IKFA 2VUMJ 2HQRA 2ZFUA 3BC8A 3ONQA 5ILUA 2JK3A 3E5QA 1I6XA 2L2OA 3C2BA 4PK4A 2V1UA 3A4CA 1YE9A 2ICWG 1H9GA 4A93J 3H5AA 4NUBA 3KP5A 2A5YB 4O3MA 2L01A 4XORA 3ERED 2V26A 4KMUX 1TZLA 2BGCA 4ASNA 2K3FA 4N4OB 3Q0VA 2GIZA 2V9KA 2VXDA 4CDGA 4HRIA 1R22A 3JSPA 2I10A 4PJJA 3UNGC 2EBIA 4F52A 1U78A 1GDTA 2HQ5A 5F1JA 3VEPA 3K70C 2HTJA 3I3LA 1SMYF 3RQ4A 1ERDA 4NNJA 2YPRA 5K1YA 3RYPA 1WJ5A 1J5YA 3DKWA 2VQLA 3FWEA 5FKOA 1LNWA 1SFOJ 4M9SA 2K7LA 3M8JA 2XUBA 1PYVA 2O61A 1BA5A 3GZ5A 3DTEA 2L4AA 4EGZA 1SD5A 4E7LA 3MZ8A 4IRIA 1QPIA 1U0JA 2EFNA 3U21A 1BOAA 1RKWA 1YIJI 1XSXA 4KT5C 1BIBA 5EYRA 1G3YA 4R1HA 1FOYA 2X6WA 5AIQA 5EGOB 5C4JJ 4PDKA 4ZYGA 2Z16A 1O3SA 2EINH 2R92J 5FB2A 4I02A 2PBIA 3SZTA 3K4KA 3O8GA 3BCBA 1OLTA 3EYYA 2WC2A 4MFEA 3HOWJ 4RAYA 2AO9A 3BWGA 5EGOA 2FNAA 2DU9A 4BGDA 4NC7A 4BXFA 3ZXSA 3PFYA 4YIIA 4KIBA 4E6KG 1IW7F 1V55H 3HOVJ 2P5KA 1P2FA 1BI1A 4XN0A 2DDAA 2DI3A 2K02A 2Y2ZA 3D5LA 1V3FA 2VJJA 1GT0C 1UG2A 3GWZA 3J80Z 5C3EJ 6PAXA 3DKYA 2L9SA 4ZH4F 1W0UA 1G8XA 2DN0A 1J59A 1ETWA 3ZMSA 2L9NA 3TKYA 1T33A 1ZN2A 3P7NA 1E2XA 3LMMA 1O3RA 4KFCA 4BY7J 3RCOA 3CC7I 3W2VA 1SANA 3ZRGA 5LGNA 3ZPLA 1R6RA 4F92B 4LITA 2GWRA 4UB8C 1W5TA 2Y30A 2QSGX 3C18A 2VJIA 3I4NJ 2DLLA 3OIQA 1TLHB 3ZQIA 2LH9A 5ICCA 4XLPF 2R5YB 1BR2A 2CUEA 2P0WA 2OAZA 3PNVA 3EPZA 3TGNA 4P9UA 3L2QA 2PEXA 5LHHA 3OSGA 3CJQB 5K5RA 3WE2A 2XHKA 3HOTA 4D1QA 4Y7NJ 2BVLA 2R5YA 4AWXB 1A35A 4P55A 4GYIA 2W1OA 4B4CA 1AA7A 3C2HA 4AVZA 1YTYA 2XAHA 2ZC2A 3S15J 3WG7H 5ICGA 3BTIA 5DM7F 3BJOA 2KISA 4GRIA 2L7FP 1IAWA 1F9NA 3HOZJ 3VYSB 1WHUA 1UFMA 3JREA 1XX5A 4A69C 3CCLI 4B3XA 3BTJA 3HDDA 3SZGA 4E7SA 3OS2A 1OKRA 1Z3YA 5FFZA 2BY0A 1MH4A 3BG7A 1JKOC 1BC8C 2H6CA 2HYGD 5LHGA 1QZEA 1K4TA 5JR3A 3HG9A 1BM9A 1TTYA 3NQOA 3H0DA 4IOCF 4RAGA 1LFBA 1TQIA 1VQOI 3B6AA 1K83J 5GTHC 1ZRCA 4G7OF 3KEOA 4CUGA 2DFEA 2KJBA 2NAZA 4X1EA 1B9MA 4OINF 3JRCA 2XGEA 4JYKA 3U1KA 1FIPA 3HHGA 3F72A 4L5EA 3A0BC 4XLEA 2VJ4A 3OOPA 2WB1A 4HG2A 3SEQA 1B72B 4O5VA 3QAHA 2CUFA 4ZYHA 4S0HB 2QM3A 1TC3C 2AS5F 1EF4A 3A02A 3J7YJ 2BYVE 2L7MP 2W4SA 2WV0A 3JRGA 3CZ6A 1TT5B 3BR2A 4E70A 1EH7A 1G3SA 2QQBA 2E71A 5CPRB 1X4OA 4WK8F 1B72A 1YHQI 2X48A 2HNHA 2R7RA 2ECCA 3WTZA 3IP4B 1H9TA 3HUGB 3CC4I 2NVQJ 3O2PE 5F6FA 2LOOA 2M0CA 2I5UA 1R1TA 2QQAA 3MKZA 1DGRM 1OPCA 2OQGA 1X1PA 3LSJA 2HOEA 4XLCA 5EF6A 4KA4A 3JRIA 3TOBA 2ZXHA 4F55A 2VPLA 4DQ2A 5FROA 2Z33A 1KU2A 3L2UA 1IRGA 1NHAA 1IN6A 2PX9A 1ZGAA 2QQ9A 2MLKA 1IDYA 4QLCU 2Q1ZB 3K0LA 3KEQA 1IRZA 3LSGA 4BYYA 2HWVA 4ABZA 1S72I 2FEZA 4IPAA 2HDDA 3E5XA 2F6CA 3K1NA 1J7KA 1TNSA 2VI6A 3IH4A 2AXLA 5HDNA 3DU5A 2R0QC 2DTZA 3MMYB 1TW3A 3FXRA 2M5WA 2D45A 3FIWA 1AKHB 3HSEA 2G7UA 3GTLJ 1F36A 2MABA 4KT6A 3CMAI 3BR0A 2KKOA 1R49A 2FXAA 3ECHA 1U9OA 2M1BA 2QCOA 5FD5A 3N4MA 3BPVA 2HDWA 5F64A 2X51A 1JUSA 1RKTA 3JAMZ 1XGOA 2ZXJA 4B8XA 3VPRA 2VB6A 2JA8J 4LJZF 1GLNA 5HLHA 3S3MA 4M6YA 2YU9J 3SQNA 2Y0MA 4IZZA 1BR1A 1XC5A 2LY2A 2WY8Q 4F3QA 5HS9A 1Z6RA 1VQ4I 3SFZA 4OIQF 3HXLA 3BT9A 1S7OA 1YQAA 1LDDA 2M3AA 4HDVA 3H9GA 2DMPA 3N97A 1WJCA 5H2FC 3EUHA 3Q3SA 1ZG3A 3F6OA 1R71A 2XSJC 2V1XA 3K4JA 5FGMA 4RB1A 4P5OA 1SVMA 2VC0A 2JT1A 2M8GX 4IHSA 4A3CJ 2GLOA 1IUFA 1Y0UA 1UAAA 5DD4A 4KITB 2XROA 3VFZA 3BQZA 3KE2A 4UVBA 1EV7A 3F9KA 2DA6A 4BJTA 1ZLKA 3ERMA 2DW4A 1MJBA 4RGXA 1XMAA 4B1RA 3A01B 2H6BA 1MGTA 2FOWA 3PIPF 5HVQC 2VIXA 4DYRA 3CUQC 3HJEA 5KCMA 1QHHD 4P96A 3TO7A 4YFKF 1OCPA 2HZTA 3L2RA 1UHWA 3A01A 4EM1A 4FTHA 1TW2A 3HYIA 4L9TA 1T38A 2VBWA 1USTA 4D9JA 2FU4A 1T95A 3LSPA 3GFJA 1JJ8C 3E6BA 4S04A 2HQNA 5E1ZB 2EFOA 2JRMA 4X6AJ 4UUTA 3DEEA 3EYIA 1RR8C 3BZCA 2HXIA 2X1CA 1WKMA 2XASA 2Y9YA 3ECOA 4I0BA 2UV1A 2VE8A 2L9RA 1Y8RB 1FZPB 1FIAA 2EV6A 2M4GA 4XK4A 2DQRA 2GQQA 3T1BA 1AU7A 2P4WA 3W2WA 4I6ZA 2XAUA 2ZNZA 2HVRA 4L0YB 2MGQA 4B43A 3OSFA 2CV0A 4HSTA 3L7WA 3AKZA 2O8KA 3MFKA 4G6DA 2QEXI 3LQQA 2QA4I 4FQGA 1W7PB 1WH7A 2XKPA 1PVEA 1CGPA 4DBRA 3FHZA 2ESNA 2ZMEB 3DLLF 4U88A 1ON1A 4U7DA 1TL8A 3PQJA 5K5OA 3TOAA 3G4SI 4ENKA 2A3SA 2FQ4A 1ZYRF 1MBJA 4J01A 1W7PA 1JJ6C 2CFOA 3IRQA 1MBHA 2JSCA 3M3YJ 5FKLA 1E0EA 2ZMEA 1P7IA 1VZ0A 2IA2A 3WGIA 5CVUA 2DPDA 1W36D 2X1EA 4BUPA 3FDYA 5HLIA 4D5CA 2HS5A 2HPMA 1IXCA 4FASD 1FNNA 2EK5A 3CCVI 4UUVA 1JXSA 4BDZA 2GZWA 1TT0A 4NQWB 1G3TA 5JVGF 1I5ZA 4OWRB 2Z5UA 3JCUC 3J7AO 3EQLF 2K5CA 1NTCA 4A3BJ 4M3DA 1ZH5A 2V6CA 2VBXA 4RB0A 4YRVA 1L3LA 3X2QH 2VE9A 5BMZA 4CSWA 4RDUA 4NQWA 1T2KA 5BQTA 1S7AA 5E3LA 4MEXF 1WCMJ 4PJLA 3PO2J 5IT9K 3GLXA 2FSWA 3H1CA 3FXJA 2KDZA 2FRHA 4XN3A 2FE3A 1UJ8A 4A6EA 3IWZA 4GCVA 2ZSIB 4IQJA 2BOLA 5DUIA 3S32A 1O3QA 3ZGKA 3I5UA 1N78A 2V7FA 2M4KA 2WAQA 2J5OA 2RN7A 3K69A 2BV6A 3TW6A 2IJLA 3TP0A 5GAEJ 3TL4X 2H8RA 2GXBA 2MD0A 4PFOA 2XSDC 1YX5A 3P9IA 2RDPA 3J7ZI 1FOKA 2ID6A 5HDKA 3KIOA 3PFIA 4FCYA 1GHCA 1BR4A 2O5RA 5J4VA 3E1SA 1OCRH 2DDBA 2WAEA 3SDBA 2ZXIA 1DU0A 1DQUA 2E19A 1N75A 4I76A 3JRFA 1YLFA 3BR1A 4G6TB 1BI3A 1B1BA 1U9NA 2DMQA 3QP5A 2YUSA 2E36A 1LQ1A 2HI3A 4PZJA 3MD2A 3L2VA 2QF7A 2M8EA 1ZKGA 4ZC3A 3KCCA 2EZLA 2Q8KA 2F5CA 5ED4A 4ZYAA 2LKSA 2A6TA 1Z3XA 2OA4A 3Q5FA 1FYLA 5L3EA 2IRFG 4C9YA 3K1MA 1RESA 2IEKA 1U2WA 5ERIA 1MW7A 2LSOA 2M30A 3PNYA 2COMA 1D1AA 1NK2P 1YW8A 3PUFA 2OTJI 1MBEA 3H9JA 1D0ZA 3CCQI 2ZKZA 5M3FJ 4N9HA 1YS7A 4YEJA 2JWTA 4C2TA 3CF5F 3M1EA 3G1OA 2NXNB 3ZQLA 1XG1A 2DPUA 1QGPA 4AIKA 1YI2I 1PUEE 2JPBA 5HNFA 1T98A 2KP6A 1BI0A 1IO2A 3DFGA 1T0FA 3F3XA 3HC7A 2W25A 1BW5A 1V5FA 3KFWX 1QVUA 2PJPA 2X1DA 3MWMA 1FSHA 3FX3A 1XS9A 3L09A 1Z1DA 4YFXF 3I4PA 1U5TB 2E1MB 3ZMZA 2CSOA 2M2EA 3D0SA 3QU3A 3BJ6A 2QENA 3KP2A 2HFHA 1MZBA 2E2HJ 3FMRA 3GTGJ 3S14J 4EJVA 3OYCA 3ASNH 1U5TA 5FJ8J 2O6GE 1VF9A 2AQFA 1WRJA 3ELKA 1ZQ3P 1SAUA 3JRAA 2PI0A 3FZVA 3LQRA 3HTUA 2LC2A 2VL8A 1SVOA 1F43A 1HSJA 2BXYA 2KT0A 2E7WA 2RNJA 3S2WA 2XF7A 4CYDA 3HBLA 3JAMK 3TQNA 5JI6A 5IYDJ 3FMSA 4AIDA 1MMGA 2LKXA 3DV8A 4GFBA 2DA2A 1W7PD 5HS7A 3R0AA 2QSFX 4IHVA 4V19K 4RLQA 4EVIA 2LTPA 5EG0B 5CVRA 1YJNI 1BJAA 3FBIB 4U87A 3EETA 4FHTA 3JR9A 3WHBA 1UMQA 4ON0A 1K61A 1KQ0A 4EATA 1STZA 4JOMA 3OYFA 3AG4H 3I64A 1N25A 5FFXA 2K4JA 3V8JA
chains in the Genus database with same CATH topology
2L9SA 2E1MC 1G8XA 3QYFA 2L9NA 5HLTA 1D1BA 1ZELA 3LMMA 3OR2C 4CCOA 3RCOA 3W2VA 1D0XA 3ZRGA 1R6RA 4F92B 4XMYA 3QODA 4LITA 3V42A 2VJIA 3OIQA 4LIUA 3K6GA 5FRMA 2HU9A 2LH9A 1BR2A 2P0WA 1LDKB 3N05A 3PNVA 3EPZA 3W2AA 3L2QA 1HA8A 3CJQB 4BE0A 2IXSA 4H4KC 3OYKA 2JA2A 3HOTA 2MYSA 4D1QA 4BJ5C 3ZCOA 2Z1DA 2BVLA 2V4JC 4F91B 4XKVA 1V5EA 2W1OA 1X19A 1V5GA 3I9V2 4ZJZA 1AA7A 3C2HA 4AVZA 3CMMA 2LBFB 4KISA 3GBGA 2VJ5A 1DP3A 4XOPA 2IGNA 4C2UA 4GRIA 3NWSA 5LFAA 3DQVC 3DKXA 1JI8A 3VYSB 2LBFA 2IS2A 5JHFA 2DT6A 2X85A 3LSMA 4E7HA 2F4IA 4B3XA 3VSLA 3H35A 5HNHA 3SZGA 3HKZA 4E7SA 3OS2A 3HL2A 1J09A 2WY7Q 1IRXA 3KYLA 1Z3YA 2LYCA 2CW7A 3BG7A 3K70D 3HG9A 4XM3A 3H0DA 4RM2A 4XLHA 1D1CA 2R7TA 4KJZA 4CUGA 2CH0A 1X4PA 1Z7LA 2OV7A 4U7BA 1NG7A 2GOMA 2OUMA 2IS6A 2HVSA 4XLEA 2VJ4A 4ZDOA 2WB1A 4IX7A 4HG2A 3OR1C 3SEQA 3LSHA 2R7QA 2W4SA 4XQFA 2L7KA 3CZ6A 1WJAA 3OYAA 3RTRA 3OYEA 2LY1A 5CPRB 3VWBA 3K4BA 1X4OA 3C2GA 3BCAA 2R7RA 2HNHA 3IP4B 3HUGB 3VYTB 2LOOA 3EUKL 3G2BA 4J00A 3OYNA 3MKZA 3OYJA 1DGRM 4OAZA 1NG6A 2VQHA 3QYBA 4ANJA 3OYLA 1G59A 4XLCA 2K9MA 4BEHB 4PJMA 4XR6A 3SEZA 2KL4A 4F55A 2ZXHA 4HSRA 2VPLA 4B44A 5FROA 3L2UA 4IQ4A 1MMDA 5CQEA 4DGWB 4BE2A 4CCKA 2Q1ZB 3VSKA 4BEHA 4XLAA 3IAS2 3LSGA 3MKWB 2JSPA 1UG0A 3KEYA 2X6XA 4MLOA 2F6CA 2M7BA 2V1NA 3K10A 2NOJB 2R7OA 2R7SA 1QHGA 2WBMA 2CUZA 4DIQA 1X1DA 3DU5A 2DT7B 1MNDA 4CCNA 3MMYB 1PJRA 2MABA 4KT6A 2F5VA 2QKLB 2K3PA 3VYRB 2JUGA 2ZSHB 2HDWA 3SYTA 4BQOA 2X51A 2XF6A 2VB6A 2PMZA 3VYUB 1GLNA 3S3MA 3OY9A 3OOUA 4XKBA 1DGWY 4BQNA 4IZZA 1BR1A 3HPGA 2LY2A 2WY8Q 4F3QA 2A5WA 2VQGA 4HNTA 4N4NB 2HQAA 3HXLA 2DCEA 3K4NA 2IGOA 3OYBA 3OYIA 4BQQA 2CV2A 2M3AA 2X6YA 3M1CA 3H9GA 2IS1A 1WJCA 2MC4A 2RNGA 4C30A 3S3NA 1BOBA 2E5ZA 2XSJC 3K4JA 4LG3A 4P5OA 1EA3A 3PSIA 4ZDLA 1UAAA 4II2A 2W00A 4KITB 5TGTA 2CW8A 2VLAA 4PUSA 3K4LA 3F9KA 4ZTJA 1X1AA 3BG6A 4BJTA 2MFZA 2M7AA 2AQEA 4DJAA 4LIVA 3TMOA 4ZDPA 2VIXA 5HVQC 4CCJA 2XF5A 5KCMA 1QHHD 2HZDA 4PFPA 3L2RA 1WJBA 3EUAA 1MNEA 4B47A 4ZTFA 1FMVA 4D9JA 3EUHC 1T95A 3S3OA 2VKDA 3PSFA 2KMUA 4QPQA 4HNUA 2VASA 3DEEA 2DOAA 4E7KA 3RPUD 3PUBA 2X1CA 4XL9A 2IGKA 3QYEA 4E7ZA 2UV1A 3DPLC 4RLFA 2CUJA 2M4GA 3OYMA 5LD2C 3W2WA 3ZR8X 2XAUA 3DU6A 2HPIA 3QOEA 2HVRA 4B43A 3IUOA 3CJRB 2CV0A 2E5NA 2M0MA 3DLAA 3OMYA 4HSTA 3AKZA 1LKXA 2Y0SA 4XOTA 4Y3OA 4DOZA 3HPHA 4DBRA 3MKYB 4BS9A 3NWTA 4CCLA 1FMWA 1UELB 3OYHA 3HOSA 2KDOA 2R7WA 4XONA 4R79A 1WJFA 4J01A 4YELA 3OS1A 2CV1A 2CFOA 2UUZA 4QPOA 3OS0A 2FUG2 2VKHA 3E0JB 3TBIA 5HOOA 1E0EA 1VZ0A 3L2WA 3LSIA 2KLOA 2RREA 1S9HA 2VQCA 2X1EA 4BUPA 3FDYA 1WJDA 1W36D 3CF2A 2HPMA 2BVMA 4FASD 4ITVA 3IAM2 4BDZA 1LVKA 1TT0A 2PJRB 2R7UA 2KHMA 2BW3B 4NQWB 2Q2EB 1W36C 4E4HA 1D0YA 3K4MA 3LL7A 3OL4A 4OWRB 1QU3A 2ELJA 3FBNB 2K5CA 2KPMA 4AU7A 2R7VA 4YRVA 1WJEA 2RQQA 2PJRA 4CSWA 3DTIA 2BW3A 3D5RC 3A1YA 4PJLA 2JVHA 3OIPA 2VXZA 3UR3C 4XN3A 3AFHA 4AYBA 4DBQA 2ZSIB 4HEA2 4IQJA 3PL8A 2BOLA 1OR7C 2XC7A 2LRDA 2K9LA 3S32A 2KZVA 1P9QC 4BACA 1KONA 4II3A 3S93A 3ZGKA 5CQGA 1N78A 2V7FA 2E60A 2M4KA 2WAQA 4Y4RA 2KRHA 2LREA 3VDXA 3BLYA 4JQFA 3TL4X 1LFPA 4E7JA 1Y6IA 2MD0A 4PFOA 1MMNA 1YX5A 3LFUA 2WADA 3DPUA 1BR4A 1SFKA 2O5RA 3OL3A 3E1SA 3RSNA 4E7IA 3CP8A 2WAEA 3SDBA 4CH7A 2KRCA 2ZXIA 3OYGA 1DQUA 4Y33A 3FHNA 5KNLA 1N75A 3CP2A 4FETA 3OYDA 2DXIA 4G6TB 4OAYA 4P1WA 4PSWA 4BL0B 3ZQQA 4NC8A 4PJNA 2IS4A 2DJIA 4X0GA 3CESA 3MD2A 3H9QA 3PJRA 3L2VA 4ZC3A 2HVQA 4BE1A 3FKJA 4ZYAA 2A6TA 1Z3XA 2UWMA 1Y56A 4C9YA 2WAFA 2W7NA 2R7XA 4HPQA 4CCMA 1MW7A 2CS3A 3PNYA 4IKFA 1D1AA 3H5RA 2XDVA 4XLFA 2ZFUA 4PSXA 3BC8A 4XNFA 3ONQA 4XKCA 3H9JA 4BJ6C 1D0ZA 2L2OA 4PK4A 3K4CA 3A4CA 1YE9A 4YEJA 3H5AA 2OC6A 3W3CA 4C2TA 4NUBA 4XKWA 2IGMA 4XORA 1N77A 2V26A 1TZLA 4BDYA 3AL0B 4N4OB 4RMNA 2V9KA 2VXDA 4HRIA 3PNTA 5HNFA 2KP6A 4PJJA 3UNGC 4F52A 3HC7A 2V6EA 3K70C 2L5QA 3I3LA 1MMAA 3RQ4A 4BU2A 1V5FA 1ERDA 4NNJA 3DWLE 3J7AY 1WJ5A 2X1DA 2VQLA 3OWTA 2CMPA 1K6YA 2I8DA 3M8JA 1PYVA 2E1MB 3DTEA 4E7LA 1U0JA 3H5NA 2WA0A 3U21A 4CA0A 5FRNA 2LG4A 3DPTA 1YX3A 3OYCA 4CZCA 4RM3A 3S8PA 2AQFA 1X1BA 2X6WA 1SAUA 5KHDA 3KX2A 1X1CA 1WFXA 2LC2A 2VL8A 2JVGA 2GOXB 2Z16A 2Z2SB 2R4GA 1T0FC 2XF7A 3K4KA 3BCBA 1OLTA 3LSKA 2W82A 1MMGA 4BGDA 3A2KA 3AL0C 4NC7A 4BXFA 3D5SC 3ZXSA 3PFYA 4RLQA 4E6KG 4B48A 1Z21A 3DTKA 4F93B 2KQRA 3FBIB 4XN0A 4U87A 5CKTA 3D5LA 2QKMB 4EATA 2VJJA 4JOMA 3OYFA 3DKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V1N A; 
#chains in the Genus database with same CATH topology
 5L3C A;  5EG0 A;  3QYF A;  3F8F A;  1IN4 A;  3C1D A;  4Y15 A;  4G94 A;  2FOK A;  3BR6 A;  1HW5 A;  4XMY A;  1FJL A;  2RC4 A;  4OIR F;  1O57 A;  2VOO A;  3ABU A;  5D4S A;  3K6G A;  5FRM A;  5LGU A;  1VQP I;  4LB5 A;  2BZT A;  3R60 A;  1IN7 A;  3N05 A;  5D5X B;  4OU0 A;  5L3G A;  2FF4 A;  1OQY A;  2YSR A;  1J75 A;  1HA8 A;  4CO8 A;  2IXS A;  5KAF C;  4G7Z F;  1UHM A;  4BJ5 C;  5DEQ A;  1HKS A;  3FK7 A;  1V5E A;  3Q9V A;  3C3W A;  1X19 A;  1V5G A;  1ZLJ A;  2LK2 A;  1S7E A;  4NC6 A;  4BAY A;  1Z0X A;  4IL6 C;  4KIS A;  3GZ6 A;  3GBG A;  3GZN B;  4KIG A;  1AWC A;  4HV6 A;  2O8X A;  4XOP A;  2IGN A;  4C2U A;  1X3Z B;  2MSY A;  1ITY A;  1K6O A;  5HDG A;  3NWS A;  5J1R A;  2IVM A;  4BNC A;  5JLW A;  1JI8 A;  4Q5S F;  4A2U A;  3PIO F;  1PDN C;  3NAR A;  2DT6 A;  2H27 A;  1SD6 A;  2KIM A;  3LSM A;  4E7H A;  1VFC A;  2A6E F;  3VSL A;  5HNH A;  3HKZ A;  2DMU A;  3KYL A;  4BXU A;  1FOW A;  2EZK A;  2CW7 A;  5GAD J;  5IOY A;  5IOZ A;  3MZH A;  4LG0 B;  1OYI A;  4PJ0 C;  2CG4 A;  2OCC H;  4KJZ A;  2R7T A;  1UZC A;  2HKX A;  2M87 A;  5DD8 A;  1D5Y A;  2OV7 A;  4U7B A;  4LG0 A;  4K2E A;  3G3Z A;  5CVI A;  1X2M A;  4IOA F;  4LFU A;  3CDL A;  5ICE A;  2DA5 A;  2J5P A;  2XPW A;  2XPU A;  3LSH A;  1P4A A;  1WQ2 A;  3FKI J;  3V7R A;  3CTA A;  2F48 A;  4XQF A;  1YW9 A;  2FA5 A;  3E6D A;  1VQM I;  3ML6 A;  5GPA A;  3V8K A;  5F27 A;  3BG3 A;  3K4B A;  5D8K B;  3FXM A;  1CQT A;  1Y1W J;  1F5T A;  3BCA A;  5E3N A;  2EPF A;  1HW1 A;  5EZH A;  4J00 A;  3G2B A;  5TIS C;  2AXT C;  1Y0N A;  2VQH A;  3AG2 H;  2K9M A;  4BEH B;  1OYW A;  4KMF A;  2W48 A;  1POG A;  1FTT A;  2QSH X;  3S2D J;  5EZG A;  3WGG A;  2QLZ A;  1S5L C;  4ESJ A;  3NAU A;  5CQE A;  4DGW B;  3KET A;  1KQ8 A;  2XGX A;  4AUX A;  4BEH A;  4XLA A;  4EM0 B;  1JUP A;  3S17 J;  2EJR A;  1LEA A;  3IAS 2;  1OMI A;  2DK5 A;  2OZU A;  3KEY A;  1XGM A;  4QIW N;  4A3G J;  2M7B A;  5EEA A;  2R7O A;  2CUZ A;  3AG3 H;  1X1D A;  1ODD A;  1MND A;  4CCN A;  3HEF A;  3J81 K;  1ZR4 A;  3WOD F;  4PGG A;  1S8N A;  5D6E A;  1SC7 A;  3T0Y A;  4DYC A;  2QKL B;  3LST A;  2K3P A;  4A5N A;  3DXJ F;  2L4M A;  2CQN A;  2G9W A;  4I0A A;  3GME A;  3VYR B;  4G8X A;  2D2W A;  2JUG A;  2LF8 A;  2ZSH B;  4BQO A;  5AIP A;  2ZNY A;  3W6J B;  3VYU B;  3OY9 A;  5E18 F;  4C3I J;  4BQN A;  4G7H F;  1DGW Y;  2ZFW A;  1TWH J;  2XB5 A;  3TDU C;  4EJU A;  3IC7 A;  1X3U A;  2JMW A;  4HW0 A;  4C2M J;  4RA2 A;  2DOE A;  2IW5 A;  3RIR A;  4L5I A;  4JBA A;  4XRS A;  2ZJ2 A;  3DBL B;  2HOA A;  1TWF J;  5IT9 Z;  2PLY A;  2H1K A;  4J19 A;  1ZHF A;  2OTL I;  4ZYD A;  2QZ8 A;  2RNG A;  2G0E A;  3S3N A;  4Y17 A;  4V2F A;  2E5Z A;  4LG3 A;  1DP7 P;  4W1U A;  1QZY A;  2XPV A;  3PSI A;  4ZDL A;  3FXQ A;  4WCG A;  2IAI A;  3ABL H;  1RZ4 A;  4CYC B;  4AM3 A;  1X58 A;  2H09 A;  2H1L A;  3U2R A;  2VLA A;  4ETS A;  1DPU A;  5E79 C;  1L0O C;  3H3U A;  3GEZ A;  3M9A A;  1X1A A;  3BG6 A;  1ZAR A;  1YS6 A;  4DJA A;  4A3K J;  2L3D A;  3CUO A;  2BXZ A;  2DK8 A;  4L0Z B;  2L02 A;  4CYC A;  1JGS A;  4A12 A;  5H6Q A;  3BTC A;  5DUK A;  2MA3 A;  2D1H A;  1G3W A;  4MO7 A;  2HKO A;  1G4D A;  1WH5 A;  2HZD A;  2JZY A;  2F2E A;  2RAE A;  4Q48 A;  2X6O A;  3EUA A;  1MNE A;  3K7A J;  1USS A;  3EUH C;  3IHU A;  3SXY A;  2NVU B;  3TDZ C;  5D5W B;  3PSF A;  1TQM A;  2PMZ N;  2XB0 X;  3G1L A;  3RKW A;  2VAS A;  2EV0 A;  1BW6 A;  3PUB A;  2Y75 A;  1J2X A;  2IGK A;  1XCB A;  4RLF A;  2CUJ A;  3WU1 B;  2BEO A;  5FO5 A;  1S6L A;  3KYC B;  1SD4 A;  2HXO A;  4RBO A;  3ZN1 A;  3DU6 A;  4DZJ A;  3QOE A;  4DW6 A;  2CQX A;  1B8I B;  1SFX A;  3GF2 A;  5ILS A;  1ZRF A;  2E5N A;  1I27 A;  1XB4 A;  3DEW A;  3DLA A;  3OMY A;  1ETQ A;  1LKX A;  4JX6 A;  1C0W A;  4XRM A;  2EFP A;  1E3H A;  3K1P A;  3I4M J;  3ULQ B;  1HF0 A;  3R0J A;  1FMW A;  2KIU A;  3FMQ A;  1HBX G;  2KDO A;  3I55 I;  2R7W A;  4XON A;  1PUF B;  3F22 A;  2LNB A;  2XAF A;  4HX4 A;  2P5L C;  3RJP A;  4EEF G;  3OS1 A;  2UUZ A;  3HUG A;  3OS0 A;  3RI4 A;  2QUF A;  5J3L A;  3TBI A;  5HOO A;  3RKY A;  3R4K A;  4IVN A;  3L2W A;  2GXG A;  1S9H A;  2RRE A;  1PUF A;  3HTS B;  3I53 A;  4RGS A;  3VB2 A;  1B4A A;  3AG1 H;  4M73 A;  2V1D A;  2XAJ A;  3I0T A;  1APL C;  2QYO A;  3BTL A;  2R7U A;  2KHM A;  2BW3 B;  2Q2E B;  3P9K A;  2PN6 A;  2VOD A;  4JX4 A;  1FSE A;  1W0T A;  3FBN B;  3ZQH A;  5HOD A;  1SFE A;  5A2Q K;  2HGC A;  3T8T A;  1SFU A;  2OD5 A;  3C7J A;  4HA8 A;  1SAX A;  2STW A;  1MBK A;  3DTI A;  2BW3 A;  2Q2E A;  4ZZD A;  3BP8 A;  1AOY A;  4TV7 A;  3JRB A;  1OIS A;  1JGG A;  4HNV A;  4IHX A;  1T39 A;  3UR3 C;  2JPC A;  3RYR A;  3GYH X;  2LDU A;  1AKH A;  1QA6 A;  4L9V A;  4WXC A;  2ZME C;  4EJW A;  3AAF A;  4IHT A;  5C4X J;  3IV5 A;  3JTG A;  2B0L A;  2LRD A;  4NB5 A;  1KON A;  1IC8 A;  5D5V B;  2ID3 A;  2LRE A;  3CCU I;  2HEO A;  3FXK A;  4JQF A;  1YW7 A;  4GDF A;  2PFB A;  1WI9 A;  4E7J A;  1Y6I A;  4DNC A;  1MMN A;  2VKE A;  4IJA A;  4AIJ A;  1XN7 A;  2OPT A;  4I2O A;  3HZJ A;  5L3B A;  3OL3 A;  5EDN A;  1CF7 B;  5FKM A;  1QRY A;  4ESB A;  2KRF A;  3KLO A;  3OYG A;  3FHN A;  3CP2 A;  2DXI A;  3M7G A;  4OAY A;  4EM2 A;  1CF7 A;  2GA1 A;  5DTD A;  3BRO A;  4XSX F;  3CJN A;  2YX7 A;  4PSW A;  1DDN A;  3QPL A;  3ZQQ A;  4NC8 A;  3SZP A;  4CGZ A;  2NNN A;  2DJI A;  3F23 A;  5F1R A;  1Q1H A;  3BJA A;  3LAP A;  5HLG A;  2IBD A;  4MNU A;  3E7L A;  3LAJ A;  1M1E B;  2HVQ A;  5L3D A;  3I56 I;  1TWA J;  1EKE A;  2VBZ A;  5AON A;  1FC3 A;  2WAF A;  4HPQ A;  4NBQ A;  4CCM A;  1I6H J;  4AYB N;  1ORK A;  2XDV A;  1IZ1 A;  4XLF A;  2JA6 J;  3JRD A;  3MKL A;  2CQK A;  2WV1 A;  4XKC A;  1OCZ H;  4BJ6 C;  3MN2 A;  4LOC A;  5L3F A;  1I1G A;  4P9F A;  4A3J J;  1HST A;  2OC6 A;  3HHH A;  3HSF A;  4XKW A;  4KNY A;  3GFI A;  1N77 A;  1YJ9 I;  2K9Q A;  4BDY A;  3AL0 B;  4RMN A;  4L9J A;  2NNY A;  2NRA C;  1SD7 A;  5JVT A;  5KVR A;  5M5Y J;  4EJT A;  3ASO H;  2ISY A;  4C3H J;  3IH2 A;  4HF2 A;  2L5Q A;  1MDM B;  1MMA A;  1D8K A;  3DWL E;  3OWT A;  3ZMD A;  4S05 A;  3RKQ A;  3JTH A;  2I8D A;  1EJ9 A;  2FBK A;  3DP7 A;  2MC3 A;  1YIO A;  2P6S A;  5J1Y A;  4CZZ A;  2O03 A;  3V4G A;  1MDM A;  4HF1 A;  3S16 J;  1RNL A;  1I50 J;  3H5N A;  4Z6Y A;  2LG4 A;  4HDU A;  1RPW A;  5LRS A;  4OIP F;  2MLG A;  2DOD A;  3KP7 A;  4A3E J;  1X1B A;  3WTS C;  3O6B B;  5KHD A;  3KX2 A;  1P7J A;  2CFX A;  5F0C A;  1X1C A;  1WFX A;  2STT A;  1QZZ A;  2ZBK A;  2JVG A;  2K27 A;  2GOX B;  1A36 A;  1B59 A;  3LWF A;  4UHT A;  2R4G A;  1T0F C;  1MBF A;  4ESF A;  3WTY C;  1B9N A;  3LSK A;  2W84 A;  4KUM A;  2WWY A;  1GVJ A;  3HKZ N;  3WU0 A;  2DA1 A;  3DBR B;  2DA7 A;  3MVP A;  4Y52 J;  3KP3 A;  1FTZ A;  2CQQ A;  4FX4 A;  1MNM C;  1H8A C;  2DAO A;  4BHC A;  4F93 B;  2IP2 A;  2KQR A;  1T56 A;  1JKP C;  5CKT A;  5E3O A;  1IUY A;  4ENN A;  2K86 A;  2QKM B;  4G9Y A;  1R00 A;  4M9X A;  3JW4 A;  2QGU A;  4RAF A;  1UHS A;  1XTA A;  3QP6 A;  2AHQ A;  2HYF A;  1R1V A;  4A6D A;  1ZAO A;  1U5T C;  2N8G A;  2E1M C;  2MG4 A;  3OV8 A;  4WF2 A;  3ZOB A;  4YFN F;  5LGT A;  3LOC A;  4IO9 F;  2E1O A;  5HLT A;  1GV5 A;  1ZEL A;  2R7D A;  3VOD A;  1LPQ A;  1OJL A;  4GYG A;  2F4M B;  3CO7 C;  2LVS A;  2DYS H;  1FPQ A;  1FX7 A;  1RUO A;  5DCM B;  1MBG A;  4KIC A;  2B63 J;  2XIG A;  2P7C B;  1TBX A;  2F5E A;  3HB9 A;  3J81 Z;  2OF7 A;  1ZRD A;  1RR7 A;  1LDK B;  3W2A A;  4MQ9 F;  1JKR C;  1IV8 A;  4IHW A;  4GGG A;  4BE0 A;  5DCM A;  1PP7 U;  5E20 A;  4H4K C;  2Y69 H;  2MYS A;  3Q9S A;  2Z1D A;  2OU2 A;  4XLN F;  5J4Y A;  2V4J C;  3E5U A;  1K4S A;  3HSR A;  3M8E A;  5TJJ A;  2DOF A;  3DBH B;  3I9V 2;  5GAG J;  5H20 A;  4ZJZ A;  1TP4 A;  2LBF B;  2E1N A;  3HM5 A;  4RS8 A;  4D7M A;  4CHU A;  3HOU J;  1DP3 A;  2D5V A;  2EQR A;  2XV4 S;  4FX0 A;  5IY5 H;  1YRN B;  2ZO4 A;  1BBY A;  3BOQ A;  5BPI A;  3DKX A;  2UZK A;  4UXN A;  2LBF A;  2IS2 A;  2LLK A;  1FEX A;  4A0X A;  3G71 I;  2BHZ A;  2F4I A;  1JHH A;  3H35 A;  3Q0W A;  4A3I J;  2E35 A;  2WY7 Q;  1U8R A;  1A04 A;  4KN7 X;  2LYC A;  2QQ8 A;  9ANT A;  5K7F A;  2O3F A;  4CXF A;  3NEU A;  2XKO A;  3WHC A;  2DMT A;  4RM2 A;  4FT8 A;  3GTK J;  3BG9 A;  4XLH A;  1D1C A;  1KQ9 A;  3FIS A;  4H0E A;  4ENM A;  1Z91 A;  1H0M A;  4LD5 A;  1U6G A;  1R4M B;  2FML A;  2CH0 A;  1Z7L A;  1NG7 A;  2GOM A;  4Z2Y A;  3SDG A;  5B66 C;  2XGC A;  3GUD A;  5E8G A;  3QOP A;  2DQL A;  5CYV A;  1IF1 A;  5BS6 A;  4IX7 A;  2YX4 A;  3OR1 C;  2R93 J;  1K79 A;  3ZMV A;  3FM5 A;  2A05 A;  1G2H A;  2L7K A;  1ZGJ A;  5JFR A;  3OYA A;  4JK1 X;  4CIC A;  2OQR A;  3A03 A;  2JA7 J;  3C2G A;  1MSE C;  2V9P A;  1B6A A;  2DFF A;  2Y9Z A;  5GPC A;  1LEB A;  1XD7 A;  3EUK L;  1ETK A;  2A69 F;  1J0R A;  3OYN A;  1OFC X;  3MCZ A;  3DF8 A;  1KU7 A;  3BY6 A;  1W1W E;  3BZ6 A;  3OYJ A;  1NG6 A;  2L9V A;  5KK1 A;  1BI2 A;  4PJM A;  3SEZ A;  2KL4 A;  3CMY A;  3T5X A;  3MQ0 A;  4YG2 F;  1KGS A;  4JX5 A;  4C3J J;  5K7H A;  2VON A;  4WXH A;  3HOX J;  5E3M A;  4A0Y A;  4CCK A;  1Z05 A;  3VSK A;  1XGN A;  1Z67 A;  3T8R A;  2M45 A;  3MKW B;  2QVO A;  4IRH A;  2OJE D;  4MLO A;  2X6X A;  4L5J A;  2O0Y A;  2O9L A;  2JA5 J;  2V1N A;  2JTV A;  4HYE A;  3K10 A;  2NOJ B;  5GTI C;  5JHU A;  1QHG A;  4UNO A;  2WBM A;  2XGD A;  2XAG A;  2P8T A;  4HOB A;  2F5F A;  1XDS A;  2Z99 A;  2ME6 A;  3H36 A;  5M5W J;  3CDI A;  2COB A;  4HF0 A;  1PJR A;  1QNT A;  1Z7U A;  3IKV A;  4M6V A;  5J8C A;  1ZG1 A;  1KYZ A;  2WB1 N;  4JP0 A;  3PO3 J;  2IPQ X;  3H92 A;  1BJZ A;  1MKM A;  3SYT A;  3BQY A;  4DYQ A;  4M3B A;  3BR3 A;  3PM1 A;  1REP C;  2DMN A;  2L54 A;  5A2Q Z;  2A6H F;  2GXA A;  4XKB A;  1FLI A;  4HZF A;  3HPG A;  3V7C A;  2A5W A;  2VQG A;  4O6J A;  4HNT A;  4N4N B;  2HQA A;  2DCE A;  3OYB A;  3OYI A;  4BQQ A;  2KIF A;  2CJJ A;  4M3G A;  2X6Y A;  4FE4 A;  1R1U A;  2IS1 A;  1P4X A;  3LA3 A;  3CCS I;  2DBB A;  2MC4 A;  3F21 A;  1BOB A;  3CCR I;  4HBL A;  4QWQ A;  4HX7 A;  5LEK A;  2A68 F;  4G6Q A;  1R5G A;  4RGR A;  3BPX A;  4BBR J;  2QWW A;  4II2 A;  5TGT A;  1RIO H;  2CW8 A;  1IDZ A;  3L00 A;  2EWN A;  4PUS A;  1MMS A;  3I71 A;  4I09 A;  1MH3 A;  1ZG5 A;  2M7A A;  3GTM J;  3UKG A;  2RV8 A;  1YOV B;  2XAQ A;  1VQ9 I;  4OMZ A;  1HLV A;  2OCE A;  3W6K B;  4YIF A;  1W4M A;  5H6R A;  4EJO A;  2K85 A;  5J47 A;  3WGH A;  4KDP A;  2K9S A;  2H8W A;  2CGP A;  1SMT A;  4ZTF A;  3F8B A;  2O7O A;  1KU9 A;  5DV5 A;  1R36 A;  2VKD A;  3REO A;  1VQ6 I;  1YG2 A;  2KMU A;  1IG7 A;  2MH2 A;  3WTX C;  4QPQ A;  1V54 H;  5HS8 A;  1R9T J;  1HQC A;  3RPU D;  1LFU P;  4ZZL A;  1T8I A;  4A3M J;  2EIM H;  1IN8 A;  3CQZ J;  1ULY A;  4E7Z A;  3F8N A;  3P9C A;  3DPL C;  5GP9 A;  1EH6 A;  4EQQ A;  4M3E A;  2LP0 A;  3OYM A;  2D1V A;  3M8F A;  3ZQF A;  3ZR8 X;  3WU2 C;  5FLX Z;  1FP1 D;  3WE3 A;  3IUO A;  3OIO A;  3CCY A;  3CJR B;  3ISP A;  1GV2 A;  2EA2 A;  2M0M A;  4RB3 C;  2Y0S A;  4XOT A;  3TED A;  4Y3O A;  4DOZ A;  2BY3 A;  3K9T A;  5FKK A;  2JUC A;  1VQ5 I;  3E6C C;  3HPH A;  2Y31 A;  3MKY B;  4BS9 A;  3KZY A;  2XVC A;  5LBQ A;  3LA7 A;  4LLN A;  3LSR A;  3WTU C;  1KZH A;  4MQV A;  4MFD A;  2L0K A;  1WJF A;  4R79 A;  4HQE A;  2CV1 A;  4HV5 A;  4QPO A;  3E0J B;  2EH3 A;  1YIT I;  4ENJ A;  4OMY A;  2YU3 A;  1WGX A;  2R7Z J;  3LSI A;  1OR7 A;  2KLO A;  1VQK I;  1WJD A;  3CF2 A;  5GAH J;  2UXN A;  2BVM A;  2E1C A;  2KJC A;  2DJN A;  2LKP A;  2JN6 A;  1TWC J;  3R6S A;  5IYB J;  4D7N A;  3GLL A;  3IH3 A;  3HGG A;  1W36 C;  1BN5 A;  3CD6 I;  1IGN A;  4E4H A;  3K4M A;  3LL7 A;  1QU3 A;  1HKT A;  4BH9 A;  1D8J A;  2ELJ A;  3H3V K;  1IN5 A;  1MIJ A;  3SHF A;  3TO6 A;  4IHY A;  2TRT A;  1LUJ B;  2KPM A;  3L1P A;  2R7V A;  3CLQ A;  2E34 A;  2EIJ H;  1XSV A;  2MD5 A;  2ELK A;  1RRJ A;  2MBF A;  1SVL A;  4A5M A;  4RGU A;  4LMY A;  1NK3 P;  2NVX J;  1LJ9 A;  3A1Y A;  3HRT A;  2JVH A;  2ETH A;  1WSU A;  4M72 A;  3AFH A;  3HRS A;  1ACI A;  1I1S A;  3GFL A;  4DBQ A;  2VC1 A;  3QPT A;  4HEA 2;  3PL8 A;  4I7H A;  1VQN I;  1YJW I;  2K9L A;  2DT5 A;  4N9I A;  3ZMT A;  2GAU A;  3S93 A;  4XIC A;  1Y1V J;  1R7J A;  2E60 A;  4Y4R A;  2A07 F;  1WPK A;  4QSH A;  3JSO A;  2W57 A;  1HW2 A;  3FXU A;  5IPA A;  3RZO J;  1Y39 A;  2MH9 A;  3KP6 A;  1HDP A;  1FYM A;  2WAD A;  3O8H A;  1EH8 A;  2FMY A;  2HR3 A;  3DPU A;  3KPH A;  2PMU A;  3BR5 A;  5BPD A;  1E3O C;  2R3S A;  1A5J A;  4E7I A;  2K40 A;  4BY1 J;  2EA4 A;  5E1X A;  1R4N B;  4IEJ A;  3DEU A;  3OYD A;  1S3J A;  4D5F A;  4AIH A;  1BC7 C;  4P1W A;  4U0V A;  5JLX A;  4BL0 B;  2EZI A;  4PJN A;  2VKV A;  1I39 A;  3RPQ A;  1E3P A;  3P5J A;  3CES A;  3PJR A;  1ZTR A;  1WVR A;  5K5Q A;  2E2I J;  3CCJ I;  1FBQ A;  4BE1 A;  2VPR A;  3FKJ A;  4L18 B;  3GXO A;  4HAM A;  2FX0 A;  2Z9O A;  1O4X A;  3CCM I;  2UWM A;  2BBY A;  2W7N A;  2R7X A;  3CJT B;  2CS3 A;  4HLX A;  1HKQ A;  3IRR A;  1U3E M;  3V7S A;  3H5R A;  3MZY A;  4PSX A;  4XNF A;  1GUU A;  1HXD A;  3FF5 A;  1UB9 A;  3K4C A;  2ACJ A;  2WAQ N;  3W3C A;  2E7X A;  2ME0 A;  2RGV A;  3K2A A;  4GO1 A;  2IGM A;  3F8C A;  2F4O B;  4M71 A;  1YO5 C;  1OCO H;  5IYC J;  3KYD B;  5F04 A;  5IP9 J;  3ROU A;  1G6N A;  3MAJ A;  4WWC A;  3IWF A;  3PNT A;  4WXD A;  2V6E A;  5D4R A;  4BU2 A;  3ESW B;  5IT3 A;  2JRT A;  4UY8 I;  3RZD J;  3JRH A;  2FBI A;  1B8I A;  3J7A Y;  3B6C A;  1ON2 A;  2CMP A;  3LA2 A;  2C6Y A;  1K6Y A;  3GW2 A;  3ABM H;  2PMH A;  5M5X J;  5KAI C;  4HX8 A;  1JKQ C;  2TDX A;  2WA0 A;  2GBY A;  1H88 C;  1WWX A;  4CA0 A;  5FRN A;  4FE7 A;  1DUX C;  3DPT A;  3ZQG A;  1YX3 A;  1QVT A;  4XSZ F;  4CZC A;  4RM3 A;  4BQA A;  3S8P A;  1O3T A;  5DS9 A;  1KYW A;  1Y8Q B;  3HIF A;  2ZJP F;  2NOG A;  5FLM J;  2LF7 A;  2KZG A;  1JTY A;  1LB2 A;  1FY7 A;  2Z2S B;  1W5S A;  1QBJ A;  1JHF A;  4BHP A;  3U9G A;  1FWZ A;  1OCT C;  2W82 A;  4M74 A;  3GVA A;  3A2K A;  3AL0 C;  1A6Q A;  2HOT A;  3D5S C;  4R8H A;  3MEX A;  4IXA A;  2LFB A;  4FIS A;  3QRF F;  3A0H C;  4B48 A;  1Z21 A;  3DTK A;  4G12 A;  3HGY A;  5E8I A;  2CWE A;  2DO7 A;  4A3F J;  3PQK A;  1UCR A;  2NS0 A;  4PCQ A;  5LLQ A;  2BY2 A;  3G1M A;  3CME I;  4DZP A;  3FK6 A;  2Q0O A;  1X2N A;  5FKN A;  2GM4 A;  1D1B A;  3OR2 C;  4CCO A;  4OOI A;  2JQ7 A;  4UB6 C;  3S2H J;  1RI7 A;  1D0X A;  2RKH A;  2VBY A;  3L9F A;  3QOD A;  4M3F A;  2LY9 A;  3LFK A;  3V42 A;  2H94 A;  4LIU A;  2HU9 A;  2LMD A;  4UV8 A;  5ICF A;  3QQA A;  3BDD A;  5B1A H;  2P5V A;  3CO6 C;  2M34 A;  2CO5 A;  1R5I D;  1ETO A;  1MJ9 A;  2JJ7 A;  3EDP A;  3CCE I;  1I3Q J;  2DYR H;  2NYX A;  1YYV A;  2CW0 F;  3F0C A;  3OYK A;  2JA2 A;  2X9D A;  3ZCO A;  4F91 B;  4XKV A;  5F08 A;  2DA4 A;  3WG9 A;  1VTN C;  4KN4 X;  1IV6 A;  1ENH A;  2ISZ A;  1BIA A;  3CMM A;  3QPS A;  5J40 A;  2OZ6 A;  2VJ5 A;  2EV5 A;  5M3M J;  1HC8 A;  4UV9 A;  3L2C A;  2B9S A;  4MIM A;  5LFA A;  3DQV C;  2XRN A;  1LVA A;  2X4H A;  5JHF A;  4MHG A;  5D8L B;  1JE8 A;  5FLX K;  5F0F A;  2X85 A;  2CU7 A;  1ZRE A;  3NRV A;  3HL2 A;  1IJW C;  1J09 A;  3ABT A;  1Q1V A;  1IRX A;  1IXS B;  2FD5 A;  3O3K A;  3WTT C;  1O7F A;  1T6S A;  3K70 D;  1TQP A;  4XM3 A;  4BKX A;  2FQ3 A;  4XRF A;  5CJ9 A;  3GTQ J;  1BL0 A;  1T08 B;  4LK0 F;  2NVT J;  2TCT A;  3GCM A;  3E3V A;  2BE5 F;  1X4P A;  2M9H A;  2ZXW H;  1Z77 A;  1W5C C;  4B3A A;  2OUM A;  1P4W A;  2ECB A;  3I59 B;  2IS6 A;  2P7V B;  2ZJR F;  2HVS A;  2DFH A;  1LE8 B;  4ZDO A;  3V8L A;  2DA3 A;  3CC2 I;  3SJM A;  2R7Q A;  1GVD A;  2P81 A;  2X0L A;  5DM6 F;  2B7E A;  3ZQ7 A;  3H0G J;  5CVV A;  4XID A;  1WJA A;  3K2Z A;  3I59 A;  3RTR A;  2P6T A;  1VI0 A;  3QU6 A;  2LY1 A;  3OYE A;  1LE8 A;  3VWB A;  2LD5 A;  4EGY A;  3HOY J;  3ZQC A;  3R61 A;  1JT0 A;  1KU3 A;  2VT3 A;  5EEG A;  3VYT B;  1P6R A;  2NS8 A;  1E17 A;  4W97 A;  4OAZ A;  4U0Y A;  3QYB A;  2HTS A;  4ANJ A;  3OYL A;  1G59 A;  1QO0 D;  4XR6 A;  5BNG A;  1RUN A;  2XRL A;  4LB6 B;  1VQL I;  2EB7 A;  2VT2 A;  3FXL A;  4HSR A;  4B44 A;  3J80 K;  2ZB9 A;  3FM3 A;  1JTX A;  4N0B A;  4IQ4 A;  1MMD A;  4BBS J;  1X3W B;  4BE2 A;  3E6M A;  4OIO F;  2LR8 A;  2EIL H;  2EFW A;  1XMX A;  3ABK H;  2JSP A;  1UG0 A;  5E17 F;  2DTR A;  4A0Z A;  1A6I A;  5LEJ A;  2V79 A;  2R7S A;  3B02 A;  2MW8 A;  4MTD A;  4DIQ A;  2RVC A;  1U8B A;  3KZZ A;  1FBU A;  5CVJ A;  2DT7 B;  3GX4 X;  1D5V A;  2BHY A;  4UVA A;  1DU6 A;  4F7Z A;  2F5V A;  4BXX J;  3CUQ B;  2Z3Y A;  3VOE A;  3W6V A;  4RB2 C;  2HYJ A;  4LGW A;  5B5E C;  1H89 C;  1MSF C;  4I01 A;  3KLN A;  4ZYE A;  3I58 A;  2XF6 A;  1OYY A;  5EEH A;  2GIV A;  1ZK8 A;  3HRM A;  4WX9 A;  2PMZ A;  4XRS G;  2EIK H;  3HRU A;  1F1Z A;  2K4B A;  1MJA A;  2YS9 A;  1TWG J;  2Y0S N;  3CUQ A;  3OOU A;  4Y13 A;  1XSD A;  2QBY B;  2ADU A;  2L7Z A;  3K4N A;  3TP3 A;  2IGO A;  4IRG A;  2CV2 A;  3M1C A;  1LDJ A;  4HQM A;  3QPH A;  4AC0 A;  5FD6 A;  4C30 A;  2QBY A;  1ONV A;  1K7A A;  2CRG A;  1P92 A;  5CLS A;  3BZK A;  4LLG F;  4QTR A;  1EA3 A;  4KYW A;  4XBF A;  2W00 A;  2Y48 A;  3KZI C;  3S1N J;  4NHJ A;  4BHB A;  4I98 B;  3FXO A;  2HDC A;  3K4L A;  4ZTJ A;  3B73 A;  1ZR2 A;  1J9I A;  3ZP5 A;  4IF4 A;  2MFZ A;  2AQE A;  3WTV C;  5IP6 A;  3RPU A;  1GXP A;  4LIV A;  4HLY A;  3TMO A;  4ZDP A;  3D1N I;  3QWL A;  4CCJ A;  2XF5 A;  3G6E I;  5E1W A;  1VND A;  4EV0 A;  4UVC A;  1YRN A;  1ZGW A;  1R5H A;  2ZJQ F;  1OCC H;  4PFP A;  2YR2 A;  5DYM A;  3GFM A;  2BY1 A;  1WJB A;  1VQ7 I;  1Z9C A;  4B47 A;  2PG4 A;  1HOM A;  1FMV A;  2NS7 A;  3S3O A;  2IA0 A;  1FBS A;  1RC9 A;  3S1Q J;  4HNU A;  2DOA A;  4E7K A;  1YFH A;  4XL9 A;  4EMS A;  4PGH A;  1D3Y A;  3QYE A;  3COA C;  1VQ8 I;  3TO9 A;  3TW7 A;  1NH3 A;  1MD0 A;  1XMK A;  1I3A A;  4A3D J;  5LD2 C;  2A61 A;  5J6X A;  5LHI A;  2HPI A;  1GXQ A;  1XDU A;  4AD9 A;  1TNT A;  3G73 A;  5B1B H;  4A3L J;  2NVY J;  3M07 A;  2OBP A;  1F4K A;  4KIF A;  3S1M J;  3E97 A;  4YIR X;  1XGS A;  3ZMU A;  3GTJ J;  1FP2 A;  3NWT A;  4CCL A;  3OYH A;  1UEL B;  3HOS A;  1QPM A;  1V4R A;  2EFQ A;  3GTP J;  1FT9 A;  3CLO A;  4YEL A;  1HCR A;  2FUG 2;  2KIQ A;  2VKH A;  1ETX A;  2CYY A;  1ETY A;  2R5Z B;  1JUM A;  4GXO A;  2ESH A;  2VQC A;  5J1U A;  3F8M A;  3DCF A;  4ITV A;  3KP4 A;  1XCV A;  3IAM 2;  2VN2 A;  2VOP A;  2F5D A;  2ELH A;  1FYK A;  4B09 A;  1LVK A;  2PJR B;  2PQ8 A;  1D0Y A;  5F0H A;  3OL4 A;  2R5Z A;  5K7Z A;  1KA8 A;  2V9V A;  2ZCW A;  5B3S H;  4AU7 A;  4M9Z A;  1R58 A;  1WJE A;  3RKX A;  1HDD C;  2RQQ A;  4L9N A;  2PJR A;  1IRF A;  3GTO J;  2RQP A;  3D5R C;  3CDH A;  2WTE A;  1S29 A;  3S1R J;  3OIP A;  2VXZ A;  1FOX A;  4AYB A;  1QQI A;  1O7L A;  3H3Z A;  4NDL A;  5J8F A;  1XPX A;  1WI3 A;  1OR7 C;  2FJ1 A;  2XC7 A;  5TRD A;  1A31 A;  4U0W A;  3GO5 A;  2KZV A;  1P9Q C;  4BAC A;  5FLV A;  2W85 A;  4II3 A;  4M6X A;  1R23 A;  5CQG A;  3RQI A;  5ILV A;  2GA2 A;  2KRH A;  3U1D A;  3F6V A;  5D5U B;  4Q4Z F;  3VDX A;  3BLY A;  3ZN0 A;  3WTW C;  1K78 B;  1LFP A;  2FNP A;  2DFI A;  1DPR A;  1PP8 F;  5IP7 J;  1Z6T A;  5EJC A;  4LLL A;  3LFU A;  1JT6 A;  2HOS A;  4LK1 F;  2E2J J;  1WZ2 A;  1SFK A;  5C44 J;  1RET A;  1K78 A;  4MEY F;  3RSN A;  3CP8 A;  4UUS B;  4RAZ A;  4CH7 A;  2KRC A;  2CQ7 A;  2W24 A;  4V2G A;  2KFD A;  4Y33 A;  3LNQ A;  5KNL A;  4Q47 A;  5LRR A;  4FET A;  4AVP A;  3M4O J;  5D6F A;  2EZH A;  3BG5 A;  5BOX A;  5DCF A;  2K9N A;  5DDG A;  1IXR C;  2UXX A;  3I54 A;  3SFI A;  4UUS A;  3Q0U A;  2IS4 A;  4X0G A;  3H9Q A;  4MGR A;  4D0P A;  1ETV A;  2FBH A;  4I99 C;  3RDI A;  2R7F A;  3IL2 A;  1SEU A;  1AHD P;  2IT0 A;  2G7H A;  1Y56 A;  4MTE A;  2IA1 A;  3IKT A;  4IKF A;  2VUM J;  2HQR A;  2ZFU A;  3BC8 A;  3ONQ A;  5ILU A;  2JK3 A;  3E5Q A;  1I6X A;  2L2O A;  3C2B A;  4PK4 A;  2V1U A;  3A4C A;  1YE9 A;  2ICW G;  1H9G A;  4A93 J;  3H5A A;  4NUB A;  3KP5 A;  2A5Y B;  4O3M A;  2L01 A;  4XOR A;  3ERE D;  2V26 A;  4KMU X;  1TZL A;  2BGC A;  4ASN A;  2K3F A;  4N4O B;  3Q0V A;  2GIZ A;  2V9K A;  2VXD A;  4CDG A;  4HRI A;  1R22 A;  3JSP A;  2I10 A;  4PJJ A;  3UNG C;  2EBI A;  4F52 A;  1U78 A;  1GDT A;  2HQ5 A;  5F1J A;  3VEP A;  3K70 C;  2HTJ A;  3I3L A;  1SMY F;  3RQ4 A;  1ERD A;  4NNJ A;  2YPR A;  5K1Y A;  3RYP A;  1WJ5 A;  1J5Y A;  3DKW A;  2VQL A;  3FWE A;  5FKO A;  1LNW A;  1SFO J;  4M9S A;  2K7L A;  3M8J A;  2XUB A;  1PYV A;  2O61 A;  1BA5 A;  3GZ5 A;  3DTE A;  2L4A A;  4EGZ A;  1SD5 A;  4E7L A;  3MZ8 A;  4IRI A;  1QPI A;  1U0J A;  2EFN A;  3U21 A;  1BOA A;  1RKW A;  1YIJ I;  1XSX A;  4KT5 C;  1BIB A;  5EYR A;  1G3Y A;  4R1H A;  1FOY A;  2X6W A;  5AIQ A;  5EGO B;  5C4J J;  4PDK A;  4ZYG A;  2Z16 A;  1O3S A;  2EIN H;  2R92 J;  5FB2 A;  4I02 A;  2PBI A;  3SZT A;  3K4K A;  3O8G A;  3BCB A;  1OLT A;  3EYY A;  2WC2 A;  4MFE A;  3HOW J;  4RAY A;  2AO9 A;  3BWG A;  5EGO A;  2FNA A;  2DU9 A;  4BGD A;  4NC7 A;  4BXF A;  3ZXS A;  3PFY A;  4YII A;  4KIB A;  4E6K G;  1IW7 F;  1V55 H;  3HOV J;  2P5K A;  1P2F A;  1BI1 A;  4XN0 A;  2DDA A;  2DI3 A;  2K02 A;  2Y2Z A;  3D5L A;  1V3F A;  2VJJ A;  1GT0 C;  1UG2 A;  3GWZ A;  3J80 Z;  5C3E J;  6PAX A;  3DKY A;  2L9S A;  4ZH4 F;  1W0U A;  1G8X A;  2DN0 A;  1J59 A;  1ETW A;  3ZMS A;  2L9N A;  3TKY A;  1T33 A;  1ZN2 A;  3P7N A;  1E2X A;  3LMM A;  1O3R A;  4KFC A;  4BY7 J;  3RCO A;  3CC7 I;  3W2V A;  1SAN A;  3ZRG A;  5LGN A;  3ZPL A;  1R6R A;  4F92 B;  4LIT A;  2GWR A;  4UB8 C;  1W5T A;  2Y30 A;  2QSG X;  3C18 A;  2VJI A;  3I4N J;  2DLL A;  3OIQ A;  1TLH B;  3ZQI A;  2LH9 A;  5ICC A;  4XLP F;  2R5Y B;  1BR2 A;  2CUE A;  2P0W A;  2OAZ A;  3PNV A;  3EPZ A;  3TGN A;  4P9U A;  3L2Q A;  2PEX A;  5LHH A;  3OSG A;  3CJQ B;  5K5R A;  3WE2 A;  2XHK A;  3HOT A;  4D1Q A;  4Y7N J;  2BVL A;  2R5Y A;  4AWX B;  1A35 A;  4P55 A;  4GYI A;  2W1O A;  4B4C A;  1AA7 A;  3C2H A;  4AVZ A;  1YTY A;  2XAH A;  2ZC2 A;  3S15 J;  3WG7 H;  5ICG A;  3BTI A;  5DM7 F;  3BJO A;  2KIS A;  4GRI A;  2L7F P;  1IAW A;  1F9N A;  3HOZ J;  3VYS B;  1WHU A;  1UFM A;  3JRE A;  1XX5 A;  4A69 C;  3CCL I;  4B3X A;  3BTJ A;  3HDD A;  3SZG A;  4E7S A;  3OS2 A;  1OKR A;  1Z3Y A;  5FFZ A;  2BY0 A;  1MH4 A;  3BG7 A;  1JKO C;  1BC8 C;  2H6C A;  2HYG D;  5LHG A;  1QZE A;  1K4T A;  5JR3 A;  3HG9 A;  1BM9 A;  1TTY A;  3NQO A;  3H0D A;  4IOC F;  4RAG A;  1LFB A;  1TQI A;  1VQO I;  3B6A A;  1K83 J;  5GTH C;  1ZRC A;  4G7O F;  3KEO A;  4CUG A;  2DFE A;  2KJB A;  2NAZ A;  4X1E A;  1B9M A;  4OIN F;  3JRC A;  2XGE A;  4JYK A;  3U1K A;  1FIP A;  3HHG A;  3F72 A;  4L5E A;  3A0B C;  4XLE A;  2VJ4 A;  3OOP A;  2WB1 A;  4HG2 A;  3SEQ A;  1B72 B;  4O5V A;  3QAH A;  2CUF A;  4ZYH A;  4S0H B;  2QM3 A;  1TC3 C;  2AS5 F;  1EF4 A;  3A02 A;  3J7Y J;  2BYV E;  2L7M P;  2W4S A;  2WV0 A;  3JRG A;  3CZ6 A;  1TT5 B;  3BR2 A;  4E70 A;  1EH7 A;  1G3S A;  2QQB A;  2E71 A;  5CPR B;  1X4O A;  4WK8 F;  1B72 A;  1YHQ I;  2X48 A;  2HNH A;  2R7R A;  2ECC A;  3WTZ A;  3IP4 B;  1H9T A;  3HUG B;  3CC4 I;  2NVQ J;  3O2P E;  5F6F A;  2LOO A;  2M0C A;  2I5U A;  1R1T A;  2QQA A;  3MKZ A;  1DGR M;  1OPC A;  2OQG A;  1X1P A;  3LSJ A;  2HOE A;  4XLC A;  5EF6 A;  4KA4 A;  3JRI A;  3TOB A;  2ZXH A;  4F55 A;  2VPL A;  4DQ2 A;  5FRO A;  2Z33 A;  1KU2 A;  3L2U A;  1IRG A;  1NHA A;  1IN6 A;  2PX9 A;  1ZGA A;  2QQ9 A;  2MLK A;  1IDY A;  4QLC U;  2Q1Z B;  3K0L A;  3KEQ A;  1IRZ A;  3LSG A;  4BYY A;  2HWV A;  4ABZ A;  1S72 I;  2FEZ A;  4IPA A;  2HDD A;  3E5X A;  2F6C A;  3K1N A;  1J7K A;  1TNS A;  2VI6 A;  3IH4 A;  2AXL A;  5HDN A;  3DU5 A;  2R0Q C;  2DTZ A;  3MMY B;  1TW3 A;  3FXR A;  2M5W A;  2D45 A;  3FIW A;  1AKH B;  3HSE A;  2G7U A;  3GTL J;  1F36 A;  2MAB A;  4KT6 A;  3CMA I;  3BR0 A;  2KKO A;  1R49 A;  2FXA A;  3ECH A;  1U9O A;  2M1B A;  2QCO A;  5FD5 A;  3N4M A;  3BPV A;  2HDW A;  5F64 A;  2X51 A;  1JUS A;  1RKT A;  3JAM Z;  1XGO A;  2ZXJ A;  4B8X A;  3VPR A;  2VB6 A;  2JA8 J;  4LJZ F;  1GLN A;  5HLH A;  3S3M A;  4M6Y A;  2YU9 J;  3SQN A;  2Y0M A;  4IZZ A;  1BR1 A;  1XC5 A;  2LY2 A;  2WY8 Q;  4F3Q A;  5HS9 A;  1Z6R A;  1VQ4 I;  3SFZ A;  4OIQ F;  3HXL A;  3BT9 A;  1S7O A;  1YQA A;  1LDD A;  2M3A A;  4HDV A;  3H9G A;  2DMP A;  3N97 A;  1WJC A;  5H2F C;  3EUH A;  3Q3S A;  1ZG3 A;  3F6O A;  1R71 A;  2XSJ C;  2V1X A;  3K4J A;  5FGM A;  4RB1 A;  4P5O A;  1SVM A;  2VC0 A;  2JT1 A;  2M8G X;  4IHS A;  4A3C J;  2GLO A;  1IUF A;  1Y0U A;  1UAA A;  5DD4 A;  4KIT B;  2XRO A;  3VFZ A;  3BQZ A;  3KE2 A;  4UVB A;  1EV7 A;  3F9K A;  2DA6 A;  4BJT A;  1ZLK A;  3ERM A;  2DW4 A;  1MJB A;  4RGX A;  1XMA A;  4B1R A;  3A01 B;  2H6B A;  1MGT A;  2FOW A;  3PIP F;  5HVQ C;  2VIX A;  4DYR A;  3CUQ C;  3HJE A;  5KCM A;  1QHH D;  4P96 A;  3TO7 A;  4YFK F;  1OCP A;  2HZT A;  3L2R A;  1UHW A;  3A01 A;  4EM1 A;  4FTH A;  1TW2 A;  3HYI A;  4L9T A;  1T38 A;  2VBW A;  1UST A;  4D9J A;  2FU4 A;  1T95 A;  3LSP A;  3GFJ A;  1JJ8 C;  3E6B A;  4S04 A;  2HQN A;  5E1Z B;  2EFO A;  2JRM A;  4X6A J;  4UUT A;  3DEE A;  3EYI A;  1RR8 C;  3BZC A;  2HXI A;  2X1C A;  1WKM A;  2XAS A;  2Y9Y A;  3ECO A;  4I0B A;  2UV1 A;  2VE8 A;  2L9R A;  1Y8R B;  1FZP B;  1FIA A;  2EV6 A;  2M4G A;  4XK4 A;  2DQR A;  2GQQ A;  3T1B A;  1AU7 A;  2P4W A;  3W2W A;  4I6Z A;  2XAU A;  2ZNZ A;  2HVR A;  4L0Y B;  2MGQ A;  4B43 A;  3OSF A;  2CV0 A;  4HST A;  3L7W A;  3AKZ A;  2O8K A;  3MFK A;  4G6D A;  2QEX I;  3LQQ A;  2QA4 I;  4FQG A;  1W7P B;  1WH7 A;  2XKP A;  1PVE A;  1CGP A;  4DBR A;  3FHZ A;  2ESN A;  2ZME B;  3DLL F;  4U88 A;  1ON1 A;  4U7D A;  1TL8 A;  3PQJ A;  5K5O A;  3TOA A;  3G4S I;  4ENK A;  2A3S A;  2FQ4 A;  1ZYR F;  1MBJ A;  4J01 A;  1W7P A;  1JJ6 C;  2CFO A;  3IRQ A;  1MBH A;  2JSC A;  3M3Y J;  5FKL A;  1E0E A;  2ZME A;  1P7I A;  1VZ0 A;  2IA2 A;  3WGI A;  5CVU A;  2DPD A;  1W36 D;  2X1E A;  4BUP A;  3FDY A;  5HLI A;  4D5C A;  2HS5 A;  2HPM A;  1IXC A;  4FAS D;  1FNN A;  2EK5 A;  3CCV I;  4UUV A;  1JXS A;  4BDZ A;  2GZW A;  1TT0 A;  4NQW B;  1G3T A;  5JVG F;  1I5Z A;  4OWR B;  2Z5U A;  3JCU C;  3J7A O;  3EQL F;  2K5C A;  1NTC A;  4A3B J;  4M3D A;  1ZH5 A;  2V6C A;  2VBX A;  4RB0 A;  4YRV A;  1L3L A;  3X2Q H;  2VE9 A;  5BMZ A;  4CSW A;  4RDU A;  4NQW A;  1T2K A;  5BQT A;  1S7A A;  5E3L A;  4MEX F;  1WCM J;  4PJL A;  3PO2 J;  5IT9 K;  3GLX A;  2FSW A;  3H1C A;  3FXJ A;  2KDZ A;  2FRH A;  4XN3 A;  2FE3 A;  1UJ8 A;  4A6E A;  3IWZ A;  4GCV A;  2ZSI B;  4IQJ A;  2BOL A;  5DUI A;  3S32 A;  1O3Q A;  3ZGK A;  3I5U A;  1N78 A;  2V7F A;  2M4K A;  2WAQ A;  2J5O A;  2RN7 A;  3K69 A;  2BV6 A;  3TW6 A;  2IJL A;  3TP0 A;  5GAE J;  3TL4 X;  2H8R A;  2GXB A;  2MD0 A;  4PFO A;  2XSD C;  1YX5 A;  3P9I A;  2RDP A;  3J7Z I;  1FOK A;  2ID6 A;  5HDK A;  3KIO A;  3PFI A;  4FCY A;  1GHC A;  1BR4 A;  2O5R A;  5J4V A;  3E1S A;  1OCR H;  2DDB A;  2WAE A;  3SDB A;  2ZXI A;  1DU0 A;  1DQU A;  2E19 A;  1N75 A;  4I76 A;  3JRF A;  1YLF A;  3BR1 A;  4G6T B;  1BI3 A;  1B1B A;  1U9N A;  2DMQ A;  3QP5 A;  2YUS A;  2E36 A;  1LQ1 A;  2HI3 A;  4PZJ A;  3MD2 A;  3L2V A;  2QF7 A;  2M8E A;  1ZKG A;  4ZC3 A;  3KCC A;  2EZL A;  2Q8K A;  2F5C A;  5ED4 A;  4ZYA A;  2LKS A;  2A6T A;  1Z3X A;  2OA4 A;  3Q5F A;  1FYL A;  5L3E A;  2IRF G;  4C9Y A;  3K1M A;  1RES A;  2IEK A;  1U2W A;  5ERI A;  1MW7 A;  2LSO A;  2M30 A;  3PNY A;  2COM A;  1D1A A;  1NK2 P;  1YW8 A;  3PUF A;  2OTJ I;  1MBE A;  3H9J A;  1D0Z A;  3CCQ I;  2ZKZ A;  5M3F J;  4N9H A;  1YS7 A;  4YEJ A;  2JWT A;  4C2T A;  3CF5 F;  3M1E A;  3G1O A;  2NXN B;  3ZQL A;  1XG1 A;  2DPU A;  1QGP A;  4AIK A;  1YI2 I;  1PUE E;  2JPB A;  5HNF A;  1T98 A;  2KP6 A;  1BI0 A;  1IO2 A;  3DFG A;  1T0F A;  3F3X A;  3HC7 A;  2W25 A;  1BW5 A;  1V5F A;  3KFW X;  1QVU A;  2PJP A;  2X1D A;  3MWM A;  1FSH A;  3FX3 A;  1XS9 A;  3L09 A;  1Z1D A;  4YFX F;  3I4P A;  1U5T B;  2E1M B;  3ZMZ A;  2CSO A;  2M2E A;  3D0S A;  3QU3 A;  3BJ6 A;  2QEN A;  3KP2 A;  2HFH A;  1MZB A;  2E2H J;  3FMR A;  3GTG J;  3S14 J;  4EJV A;  3OYC A;  3ASN H;  1U5T A;  5FJ8 J;  2O6G E;  1VF9 A;  2AQF A;  1WRJ A;  3ELK A;  1ZQ3 P;  1SAU A;  3JRA A;  2PI0 A;  3FZV A;  3LQR A;  3HTU A;  2LC2 A;  2VL8 A;  1SVO A;  1F43 A;  1HSJ A;  2BXY A;  2KT0 A;  2E7W A;  2RNJ A;  3S2W A;  2XF7 A;  4CYD A;  3HBL A;  3JAM K;  3TQN A;  5JI6 A;  5IYD J;  3FMS A;  4AID A;  1MMG A;  2LKX A;  3DV8 A;  4GFB A;  2DA2 A;  1W7P D;  5HS7 A;  3R0A A;  2QSF X;  4IHV A;  4V19 K;  4RLQ A;  4EVI A;  2LTP A;  5EG0 B;  5CVR A;  1YJN I;  1BJA A;  3FBI B;  4U87 A;  3EET A;  4FHT A;  3JR9 A;  3WHB A;  1UMQ A;  4ON0 A;  1K61 A;  1KQ0 A;  4EAT A;  1STZ A;  4JOM A;  3OYF A;  3AG4 H;  3I64 A;  1N25 A;  5FFX A;  2K4J A;  3V8J A; 
#chains in the Genus database with same CATH homology
 2L9S A;  2E1M C;  1G8X A;  3QYF A;  2L9N A;  5HLT A;  1D1B A;  1ZEL A;  3LMM A;  3OR2 C;  4CCO A;  3RCO A;  3W2V A;  1D0X A;  3ZRG A;  1R6R A;  4F92 B;  4XMY A;  3QOD A;  4LIT A;  3V42 A;  2VJI A;  3OIQ A;  4LIU A;  3K6G A;  5FRM A;  2HU9 A;  2LH9 A;  1BR2 A;  2P0W A;  1LDK B;  3N05 A;  3PNV A;  3EPZ A;  3W2A A;  3L2Q A;  1HA8 A;  3CJQ B;  4BE0 A;  2IXS A;  4H4K C;  3OYK A;  2JA2 A;  3HOT A;  2MYS A;  4D1Q A;  4BJ5 C;  3ZCO A;  2Z1D A;  2BVL A;  2V4J C;  4F91 B;  4XKV A;  1V5E A;  2W1O A;  1X19 A;  1V5G A;  3I9V 2;  4ZJZ A;  1AA7 A;  3C2H A;  4AVZ A;  3CMM A;  2LBF B;  4KIS A;  3GBG A;  2VJ5 A;  1DP3 A;  4XOP A;  2IGN A;  4C2U A;  4GRI A;  3NWS A;  5LFA A;  3DQV C;  3DKX A;  1JI8 A;  3VYS B;  2LBF A;  2IS2 A;  5JHF A;  2DT6 A;  2X85 A;  3LSM A;  4E7H A;  2F4I A;  4B3X A;  3VSL A;  3H35 A;  5HNH A;  3SZG A;  3HKZ A;  4E7S A;  3OS2 A;  3HL2 A;  1J09 A;  2WY7 Q;  1IRX A;  3KYL A;  1Z3Y A;  2LYC A;  2CW7 A;  3BG7 A;  3K70 D;  3HG9 A;  4XM3 A;  3H0D A;  4RM2 A;  4XLH A;  1D1C A;  2R7T A;  4KJZ A;  4CUG A;  2CH0 A;  1X4P A;  1Z7L A;  2OV7 A;  4U7B A;  1NG7 A;  2GOM A;  2OUM A;  2IS6 A;  2HVS A;  4XLE A;  2VJ4 A;  4ZDO A;  2WB1 A;  4IX7 A;  4HG2 A;  3OR1 C;  3SEQ A;  3LSH A;  2R7Q A;  2W4S A;  4XQF A;  2L7K A;  3CZ6 A;  1WJA A;  3OYA A;  3RTR A;  3OYE A;  2LY1 A;  5CPR B;  3VWB A;  3K4B A;  1X4O A;  3C2G A;  3BCA A;  2R7R A;  2HNH A;  3IP4 B;  3HUG B;  3VYT B;  2LOO A;  3EUK L;  3G2B A;  4J00 A;  3OYN A;  3MKZ A;  3OYJ A;  1DGR M;  4OAZ A;  1NG6 A;  2VQH A;  3QYB A;  4ANJ A;  3OYL A;  1G59 A;  4XLC A;  2K9M A;  4BEH B;  4PJM A;  4XR6 A;  3SEZ A;  2KL4 A;  4F55 A;  2ZXH A;  4HSR A;  2VPL A;  4B44 A;  5FRO A;  3L2U A;  4IQ4 A;  1MMD A;  5CQE A;  4DGW B;  4BE2 A;  4CCK A;  2Q1Z B;  3VSK A;  4BEH A;  4XLA A;  3IAS 2;  3LSG A;  3MKW B;  2JSP A;  1UG0 A;  3KEY A;  2X6X A;  4MLO A;  2F6C A;  2M7B A;  2V1N A;  3K10 A;  2NOJ B;  2R7O A;  2R7S A;  1QHG A;  2WBM A;  2CUZ A;  4DIQ A;  1X1D A;  3DU5 A;  2DT7 B;  1MND A;  4CCN A;  3MMY B;  1PJR A;  2MAB A;  4KT6 A;  2F5V A;  2QKL B;  2K3P A;  3VYR B;  2JUG A;  2ZSH B;  2HDW A;  3SYT A;  4BQO A;  2X51 A;  2XF6 A;  2VB6 A;  2PMZ A;  3VYU B;  1GLN A;  3S3M A;  3OY9 A;  3OOU A;  4XKB A;  1DGW Y;  4BQN A;  4IZZ A;  1BR1 A;  3HPG A;  2LY2 A;  2WY8 Q;  4F3Q A;  2A5W A;  2VQG A;  4HNT A;  4N4N B;  2HQA A;  3HXL A;  2DCE A;  3K4N A;  2IGO A;  3OYB A;  3OYI A;  4BQQ A;  2CV2 A;  2M3A A;  2X6Y A;  3M1C A;  3H9G A;  2IS1 A;  1WJC A;  2MC4 A;  2RNG A;  4C30 A;  3S3N A;  1BOB A;  2E5Z A;  2XSJ C;  3K4J A;  4LG3 A;  4P5O A;  1EA3 A;  3PSI A;  4ZDL A;  1UAA A;  4II2 A;  2W00 A;  4KIT B;  5TGT A;  2CW8 A;  2VLA A;  4PUS A;  3K4L A;  3F9K A;  4ZTJ A;  1X1A A;  3BG6 A;  4BJT A;  2MFZ A;  2M7A A;  2AQE A;  4DJA A;  4LIV A;  3TMO A;  4ZDP A;  2VIX A;  5HVQ C;  4CCJ A;  2XF5 A;  5KCM A;  1QHH D;  2HZD A;  4PFP A;  3L2R A;  1WJB A;  3EUA A;  1MNE A;  4B47 A;  4ZTF A;  1FMV A;  4D9J A;  3EUH C;  1T95 A;  3S3O A;  2VKD A;  3PSF A;  2KMU A;  4QPQ A;  4HNU A;  2VAS A;  3DEE A;  2DOA A;  4E7K A;  3RPU D;  3PUB A;  2X1C A;  4XL9 A;  2IGK A;  3QYE A;  4E7Z A;  2UV1 A;  3DPL C;  4RLF A;  2CUJ A;  2M4G A;  3OYM A;  5LD2 C;  3W2W A;  3ZR8 X;  2XAU A;  3DU6 A;  2HPI A;  3QOE A;  2HVR A;  4B43 A;  3IUO A;  3CJR B;  2CV0 A;  2E5N A;  2M0M A;  3DLA A;  3OMY A;  4HST A;  3AKZ A;  1LKX A;  2Y0S A;  4XOT A;  4Y3O A;  4DOZ A;  3HPH A;  4DBR A;  3MKY B;  4BS9 A;  3NWT A;  4CCL A;  1FMW A;  1UEL B;  3OYH A;  3HOS A;  2KDO A;  2R7W A;  4XON A;  4R79 A;  1WJF A;  4J01 A;  4YEL A;  3OS1 A;  2CV1 A;  2CFO A;  2UUZ A;  4QPO A;  3OS0 A;  2FUG 2;  2VKH A;  3E0J B;  3TBI A;  5HOO A;  1E0E A;  1VZ0 A;  3L2W A;  3LSI A;  2KLO A;  2RRE A;  1S9H A;  2VQC A;  2X1E A;  4BUP A;  3FDY A;  1WJD A;  1W36 D;  3CF2 A;  2HPM A;  2BVM A;  4FAS D;  4ITV A;  3IAM 2;  4BDZ A;  1LVK A;  1TT0 A;  2PJR B;  2R7U A;  2KHM A;  2BW3 B;  4NQW B;  2Q2E B;  1W36 C;  4E4H A;  1D0Y A;  3K4M A;  3LL7 A;  3OL4 A;  4OWR B;  1QU3 A;  2ELJ A;  3FBN B;  2K5C A;  2KPM A;  4AU7 A;  2R7V A;  4YRV A;  1WJE A;  2RQQ A;  2PJR A;  4CSW A;  3DTI A;  2BW3 A;  3D5R C;  3A1Y A;  4PJL A;  2JVH A;  3OIP A;  2VXZ A;  3UR3 C;  4XN3 A;  3AFH A;  4AYB A;  4DBQ A;  2ZSI B;  4HEA 2;  4IQJ A;  3PL8 A;  2BOL A;  1OR7 C;  2XC7 A;  2LRD A;  2K9L A;  3S32 A;  2KZV A;  1P9Q C;  4BAC A;  1KON A;  4II3 A;  3S93 A;  3ZGK A;  5CQG A;  1N78 A;  2V7F A;  2E60 A;  2M4K A;  2WAQ A;  4Y4R A;  2KRH A;  2LRE A;  3VDX A;  3BLY A;  4JQF A;  3TL4 X;  1LFP A;  4E7J A;  1Y6I A;  2MD0 A;  4PFO A;  1MMN A;  1YX5 A;  3LFU A;  2WAD A;  3DPU A;  1BR4 A;  1SFK A;  2O5R A;  3OL3 A;  3E1S A;  3RSN A;  4E7I A;  3CP8 A;  2WAE A;  3SDB A;  4CH7 A;  2KRC A;  2ZXI A;  3OYG A;  1DQU A;  4Y33 A;  3FHN A;  5KNL A;  1N75 A;  3CP2 A;  4FET A;  3OYD A;  2DXI A;  4G6T B;  4OAY A;  4P1W A;  4PSW A;  4BL0 B;  3ZQQ A;  4NC8 A;  4PJN A;  2IS4 A;  2DJI A;  4X0G A;  3CES A;  3MD2 A;  3H9Q A;  3PJR A;  3L2V A;  4ZC3 A;  2HVQ A;  4BE1 A;  3FKJ A;  4ZYA A;  2A6T A;  1Z3X A;  2UWM A;  1Y56 A;  4C9Y A;  2WAF A;  2W7N A;  2R7X A;  4HPQ A;  4CCM A;  1MW7 A;  2CS3 A;  3PNY A;  4IKF A;  1D1A A;  3H5R A;  2XDV A;  4XLF A;  2ZFU A;  4PSX A;  3BC8 A;  4XNF A;  3ONQ A;  4XKC A;  3H9J A;  4BJ6 C;  1D0Z A;  2L2O A;  4PK4 A;  3K4C A;  3A4C A;  1YE9 A;  4YEJ A;  3H5A A;  2OC6 A;  3W3C A;  4C2T A;  4NUB A;  4XKW A;  2IGM A;  4XOR A;  1N77 A;  2V26 A;  1TZL A;  4BDY A;  3AL0 B;  4N4O B;  4RMN A;  2V9K A;  2VXD A;  4HRI A;  3PNT A;  5HNF A;  2KP6 A;  4PJJ A;  3UNG C;  4F52 A;  3HC7 A;  2V6E A;  3K70 C;  2L5Q A;  3I3L A;  1MMA A;  3RQ4 A;  4BU2 A;  1V5F A;  1ERD A;  4NNJ A;  3DWL E;  3J7A Y;  1WJ5 A;  2X1D A;  2VQL A;  3OWT A;  2CMP A;  1K6Y A;  2I8D A;  3M8J A;  1PYV A;  2E1M B;  3DTE A;  4E7L A;  1U0J A;  3H5N A;  2WA0 A;  3U21 A;  4CA0 A;  5FRN A;  2LG4 A;  3DPT A;  1YX3 A;  3OYC A;  4CZC A;  4RM3 A;  3S8P A;  2AQF A;  1X1B A;  2X6W A;  1SAU A;  5KHD A;  3KX2 A;  1X1C A;  1WFX A;  2LC2 A;  2VL8 A;  2JVG A;  2GOX B;  2Z16 A;  2Z2S B;  2R4G A;  1T0F C;  2XF7 A;  3K4K A;  3BCB A;  1OLT A;  3LSK A;  2W82 A;  1MMG A;  4BGD A;  3A2K A;  3AL0 C;  4NC7 A;  4BXF A;  3D5S C;  3ZXS A;  3PFY A;  4RLQ A;  4E6K G;  4B48 A;  1Z21 A;  3DTK A;  4F93 B;  2KQR A;  3FBI B;  4XN0 A;  4U87 A;  5CKT A;  3D5L A;  2QKM B;  4EAT A;  2VJJ A;  4JOM A;  3OYF A;  3DKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...