2NVXJ

Rna polymerase ii elongation complex in 5 mm mg+2 with 2'-dutp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2nvxJ00
2FJ1A 1ENHA 1X2NA 2R5ZB 1EF4A 2M8GX 1IV6A 4QTRA 2Y31A 2DA3A 2VI6A 3PM1A 4A3KJ 1R9TJ 1GUUA 5C44J 2N8GA 1TWCJ 4DW6A 2Y9ZA 1MBFA 1W0TA 3ZQLA 2DMTA 3BTIA 3ZQHA 2HXIA 1U8BA 1JKQC 3HOUJ 2X9DA 3FISA 1BA5A 1LFUP 1MBHA 1OJLA 3HGYA 3FK7A 3CQZJ 1HDPA 2EZIA 2ME6A 3LSJA 2E19A 4XK4A 2GM4A 3HOYJ 5J3LA 4JX4A 4D5CA 1POGA 4Y52J 3ZQCA 4V2GA 1IDZA 1JUMA 2LK2A 5DTDA 1RKTA 4FE4A 1QPIA 2NVQJ 1JGGA 1GV2A 3S17J 3CMYA 1ETYA 2MGQA 1W0UA 5FKOA 3JRGA 2NS7A 2H8RA 5C3EJ 1TWFJ 4UUSA 3L1PA 1ZGWA 2R7ZJ 1MBEA 2HI3A 1ZTRA 1F36A 1S7EA 1GV5A 2XPWA 5J1UA 3TP0A 4RBOA 1P7JA 2K9NA 1ZR4A 4UUSB 4XRMA 1IG7A 4J19A 4C3IJ 1JT0A 5EGOA 1ORKA 5IYBJ 1A6IA 2G0EA 1NTCA 3BR1A 4EEFG 3H3VK 2DA7A 2DMPA 4FTHA 3BR6A 1BW6A 2IEKA 4IHXA 3GTLJ 3S14J 5IYDJ 1QVUA 4HNVA 5EGOB 1IJWC 1RKWA 2D5VA 5IP9J 3BR3A 3IH2A 3UKGA 3LSGA 3S2HJ 5FLMJ 3NARA 5FKMA 3LNQA 3W6VA 4A3EJ 4AYBN 1MBJA 3G1MA 3BG9A 2FQ4A 3BTLA 5M5XJ 2VPRA 5IOYA 3HEFA 2E2JJ 1Y1VJ 1G2HA 1GVDA 1OCTC 3IV5A 3PO2J 5C4JJ 3JRBA 2ME0A 3Q0WA 2DN0A 1GT0C 2GBYA 5GPAA 1ITYA 3MVPA 1JT6A 5EG0A 1MNMC 1FTZA 3TW7A 5GP9A 2KDZA 2WB1N 5K7FA 2M34A 2YU9J 2LVSA 3IH3A 5FJ8J 2YUSA 3QPLA 3BTCA 3FK6A 4B4CA 4D5FA 5EG0B 3S15J 2K9QA 4B1RA 2WAQN 3ZQGA 4M3DA 5M3MJ 1T56A 2VKEA 3RZOJ 2ELKA 3GTGJ 2FD5A 2JMWA 5DS9A 1RETA 2K9SA 1JTXA 4D7NA 2DA2A 3K7AJ 1T33A 2O9LA 4XRSG 3JRIA 1BW5A 2JK3A 4A3GJ 1JKRC 1JUSA 2DA6A 2CUEA 2M0CA 3H0GJ 4IHVA 4DZJA 2LTPA 4AUXA 1XS9A 3VPRA 2DMNA 4W97A 4FE7A 3OIOA 5K7HA 1FEXA 3B6AA 1HF0A 2H1KA 3BQZA 3M4OJ 2I10A 4X6AJ 1TWGJ 2DJNA 2HOAA 4BXXJ 3BQYA 1VNDA 3JRFA 2FX0A 2Y2ZA 2M2EA 1ETKA 3LSRA 1H89C 2W48A 1QVTA 1MSEC 2RAEA 2LLKA 5BNGA 4G12A 1IC8A 2HOTA 3O8HA 4C2MJ 3HM5A 1YRNA 3HGGA 5F04A 3GTQJ 2DA1A 1CQTA 4XICA 3WHBA 1AHDP 2JA7J 3CDLA 1B72A 1Z0XA 1I50J 5J1RA 2NVTJ 2LR8A 3G1OA 3S1RJ 1U78A 1YRNB 2JWTA 3S1MJ 1MSFC 3ZOBA 4Y7NJ 2CQXA 1B72B 1DU0A 2EBIA 2E2HJ 4IEJA 2XGEA 1FIPA 1ZQ3P 5FLVA 1NK3P 3SJMA 3S16J 3B6CA 2VUMJ 3I4NJ 3BR2A 3GTJJ 3NAUA 4I76A 3GBGA 2P81A 2DA4A 2LY9A 1X2MA 2CU7A 2IBDA 2AO9A 5EF6A 1K61A 1ETVA 2E1OA 4DYQA 5M5WJ 1AKHA 1IGNA 5F08A 4QSHA 2EQRA 2HYJA 3FIWA 3HB9A 1WH5A 2ECBA 5IP7J 2R0QC 1UMQA 1A5JA 1AKHB 1AU7A 2XGDA 4JYKA 5GPCA 5EEAA 2R92J 1HDDC 1ETOA 4CYCA 4A93J 1PUFA 1MBGA 3ZQIA 4A3MJ 2JN6A 1NK2P 1WI3A 2DMUA 4A3DJ 3OSGA 4CYCB 4NDLA 5E3MA 4MFEA 1FTTA 1TC3C 1PUFB 1I3QJ 1MH4A 1ZR2A 4GFBA 2JA8J 1HLVA 4FISA 4DZPA 5J1YA 1IDYA 4ABZA 4L5EA 3A02A 3E7LA 2WV1A 2ID3A 1JKOC 3I4MJ 4A3FJ 3HOVJ 1WGXA 4D7MA 1JJ6C 3HOXJ 3Q0VA 4BY7J 2ECCA 5E3NA 2R5YA 2HDDA 1H88C 3LSPA 2MG4A 2O8KA 3BR0A 1JJ8C 3BR5A 5F1JA 4IHWA 4A3CJ 5FKNA 2R5YB 3HBLA 2K40A 5F0CA 1QRYA 4XRSA 1VI0A 2XPVA 2CJJA 1TWHJ 2YS9A 3HKZN 3HOWJ 1HOMA 1FJLA 3PO3J 4RDUA 1MH3A 4M3GA 1LE8A 2DA5A 1XC5A 3FKIJ 1TWAJ 4MO7A 5F27A 3LOCA 2EH3A 4FCYA 2L0KA 3BG3A 1LE8B 2NVXJ 5HODA 4BY1J 2MW8A 2Y30A 3MN2A 5FKLA 2LKXA 4IHYA 5EDNA 2L7FP 2ZB9A 3Q0UA 2XB5A 2Y9YA 4X1EA 2NS8A 3HOZJ 3BT9A 2NVYJ 1SANA 3BTJA 5F0FA 2COBA 5FKKA 1APLC 2HQ5A 1RR7A 2PMZN 3QQAA 3QPSA 5IPAA 2IAIA 3A01A 1VFCA 2EZHA 3D1NI 3Q3SA 4M3FA 1JUPA 1H8AC 3OOUA 4A69C 2HXOA 3SDGA 2LP0A 4BKXA 2QCOA 2X48A 4B3AA 5E3OA 3JREA 2NOGA 3A01B 2JA5J 4DYCA 1IUFA 4BBRJ 5M5YJ 2XSDC 2X6OA 3MKLA 3CCYA 4M3EA 1UHSA 1ZKGA 3JRHA 4UUTA 3ZQFA 3IH4A 2OF7A 1MBKA 4QIWN 4BBSJ 1D5YA 1RESA 2CRGA 1Y1WJ 5E3LA 5EZHA 3RZDJ 3GTMJ 2TCTA 2XB0X 5EYRA 2O7OA 5JLWA 1ZK8A 4MIMA 1OCPA 2CQQA 2ID6A 4A3JJ 2AHQA 1U9OA 2LD5A 1WCMJ 3C2BA 4JX6A 4AC0A 1FIAA 3S2DJ 3TP3A 2R93J 2EZLA 1OFCX 1UG2A 1U9NA 3F0CA 1JTYA 1BJZA 3WHCA 2OPTA 2L7MP 1JKPC 2M9HA 4LOCA 5F0HA 1Z77A 1WPKA 2XRLA 4MLOA 4DYRA 2QF7A 3RKQA 3HDDA 1VF9A 5M3FJ 3M3YJ 1LFBA 5JLXA 3JRCA 4M3BA 1E3OC 3S1QJ 5IP6A 1ETWA 3JR9A 2HOSA 5IYCJ 1I6HJ 2CUFA 2XGCA 3GTKJ 2MSYA 4V2FA 3DCFA 1O4XA 3GTOJ 2TRTA 3DEWA 4A3BJ 4C3JJ 3TEDA 3A03A 5EZGA 3S1NJ 3GTPJ 3JRDA 1B8IA 4S0HB 1F43A 2GLOA 4XIDA 4MFDA 1DU6A 1BL0A 2VKVA 4JX5A 2JA6J 4A3IJ 4JP0A 2L9RA 1B8IB 1GDTA 3SFIA 3JRAA 1X58A 2DMQA 3TW6A 1ETXA 1SFOJ 2EZKA 4A3LJ 3OSFA 1K83J 2DTZA 1ETQA 2KT0A 5IOZA 3O8GA 2LFBA 5K7ZA 2L7ZA 3BG5A 2E2IJ 2B63J 4W1UA 5C4XJ 1IRZA 2JJ7A 2Y0SN 4M6VA 3RQIA 9ANTA 3G1LA 3K2AA 4C3HJ 1WH7A 1Q1VA 1HCRA 2R5ZA 1XG1A 2XPUA 4I6ZA 1P7IA 1RPWA
chains in the Genus database with same CATH superfamily
4ZYEA 3J7ZI 3OYGA 3QYEA 3K4BA 4UV9A 1X2NA 1Z05A 1BI1A 1SFEA 2X85A 3OYIA 5IT9K 3VFZA 4BJ6C 3O3KA 1BIBA 2OA4A 3VYUB 3ASOH 3KX2A 1R9TJ 5C44J 2BEOA 4XOTA 2LBFB 2P4WA 3H92A 5FO5A 1IRFA 3BTIA 3ZQHA 4RGRA 4Q5SF 4YFNF 3EUHA 1U8BA 1D0ZA 3I9V2 1JKQC 4NB5A 2RN7A 2EFOA 2ZFWA 3F22A 2E1MB 2VOOA 4HA8A 3FK7A 3HGYA 3CQZJ 2GA2A 3OS0A 1HKQA 2EZIA 2HOEA 3LSJA 4XK4A 3F8NA 2GM4A 3HOYJ 3A0HC 2JVHA 3F23A 1POGA 2CFOA 3AG1H 3LA7A 2KRCA 1IN4A 2LK2A 2D2WA 3E6BA 2HTJA 2BHZA 2L3DA 5L3BA 1JGGA 1O7FA 2K7LA 3CO7C 1I3AA 3VYTB 3ELKA 2RQQA 2R7RA 2YPRA 2FF4A 2EFNA 4LB6B 1VQ6I 3CP8A 1SFUA 1SMTA 2DAOA 1YJWI 4G8XA 4IHTA 2CW7A 1S7EA 3A1YA 4B09A 2YU3A 1UG0A 4I0AA 4BDYA 3R61A 2MH9A 2W82A 4C3IJ 1FY7A 3FXUA 2XV4S 1MGTA 1TT0A 2WTEA 4HLXA 3H3VK 1N25A 5B1AH 4FTHA 2CUJA 4LITA 3FHZA 2ZJQF 5IYDJ 3FM3A 2A61A 2H09A 5EGOB 5CVIA 1Y56A 2A6EF 2D5VA 4M9ZA 3MCZA 2PJPA 3DV8A 3U9GA 2WWYA 5CVUA 4EATA 3UKGA 3H9QA 2J5OA 3HRSA 3WE3A 3W6VA 3KP4A 4CO8A 3BG6A 3G73A 2UUZA 4KIFA 5HDNA 3DBRB 4Z6YA 1YX3A 4A5NA 3R6SA 4WF2A 2A5WA 1NHAA 2VPRA 5JR3A 3U21A 4Q48A 1ZRDA 1GVDA 2Z1DA 1OCTC 3PO2J 1BI3A 3FBIB 5FLXK 1E3PA 1Z6RA 1Z91A 3JRBA 2ME0A 3Q0WA 1BOAA 2F4IA 2HQAA 5EEGA 4BEHB 1FC3A 5J4VA 4AYBA 5A2QK 3MVPA 2LYCA 5B5EC 2DJIA 4ESFA 3FXOA 4I01A 2F5CA 2FA5A 2R7QA 3GZNB 3S3OA 1I1SA 1IAWA 1H9GA 4QPOA 4CICA 2BXYA 2LVSA 3ESWB 2W24A 4KDPA 1FYKA 2VL8A 2OBPA 2YUSA 3CCJI 3KP7A 4EJVA 5KNLA 3OYDA 2K9QA 4CYDA 2PFBA 1HW2A 2WB1A 3RPUD 2ELKA 2OTJI 2IA0A 1JTXA 3NRVA 2DA2A 4KN4X 4N4NB 1T33A 2O9LA 3ZCOA 1DPUA 1BW5A 3JSOA 2JK3A 3R0AA 2DT5A 1I1GA 1JKRC 2DA6A 2DT7B 4IOAF 2M0CA 4AUXA 5GAEJ 1XS9A 1XPXA 2HYGD 2UV1A 3FHNA 2EV6A 1PYVA 3OIOA 5K7HA 1O3RA 2CS3A 2QYOA 1MIJA 1ZG3A 2HFHA 2I10A 3LSHA 3MQ0A 4BXFA 4J01A 4RAGA 2COMA 3PL8A 1I39A 2DJNA 3ZRGA 4F92B 4BXXJ 2FNAA 3MKYB 1EH7A 2P0WA 1ETKA 2KRHA 1ZG1A 1Z3XA 1USSA 1H89C 3OYHA 2W48A 2CMPA 2KL4A 3ZGKA 2HDWA 2QQAA 1QHHD 2ACJA 1YRNA 4U7DA 4CSWA 5DEQA 2R3SA 1AHDP 2XSJC 3HXLA 5IY5H 2VJIA 4E4HA 4IF4A 1I50J 2NVTJ 1ZAOA 3G1OA 5JVGF 2JWTA 3VYSB 2QA4I 2M7BA 1KYWA 2QQBA 3QOEA 2FBHA 2I8DA 2P5KA 1LNWA 5D5VB 1B72B 3CDHA 1R58A 3K1PA 2EBIA 2V1DA 3CCSI 1GXPA 4HSTA 3L00A 3PQKA 1XSDA 1DQUA 1R6RA 4E7ZA 2XIGA 1ZQ3P 2Z5UA 2MD0A 4XLEA 3SJMA 1QZEA 2VLAA 3I5UA 2VUMJ 3PJRA 2G7HA 4I76A 3GW2A 1MDMA 1VQLI 3EDPA 2CU7A 2IBDA 4AIHA 5EF6A 1W5TA 2EK5A 4XLHA 3ZN0A 3IRQA 4ZDLA 1T98A 3GEZA 4DYQA 3JTHA 1F4KA 3ZMZA 5DDGA 2EQRA 4ZYGA 4UXNA 2DI3A 1YJNI 1EJ9A 2ECBA 3TKYA 1T2KA 2R0QC 5B1BH 1TP4A 1UMQA 1A5JA 5FFXA 3A0BC 1JI8A 4PUSA 1WRJA 2UWMA 4ZTFA 2R92J 3ABMH 1HDDC 4CYCA 1SVOA 3C18A 2YX4A 3CCEI 1MBGA 4HSRA 4E7LA 3KZYA 2DMUA 5D5WB 3F8FA 3HSEA 4MFEA 2E1CA 2AQFA 3T1BA 5J4YA 4EQQA 4LMYA 1HLVA 3AG4H 5J1YA 5E20A 3K4LA 4FQGA 3O2PE 1A6QA 3A02A 4LK0F 4UB8C 4XLNF 3BPVA 4L5IA 2WV1A 1QGPA 1WJDA 1X4PA 1RNLA 1K79A 2ISYA 1TL8A 4A3FJ 1V5FA 1XDSA 3HOXJ 4M9SA 4PSXA 4BY7J 4KICA 2D1VA 2M8EA 1YIJI 1ZH5A 3BR0A 2L9NA 1JJ8C 4HYEA 2AXLA 2ZXHA 1D0XA 5F1JA 3QU6A 4IHWA 3RJPA 1ZN2A 2JVGA 3HBLA 4BHBA 1TW2A 1FYMA 2FOKA 2CJJA 2YS9A 2R7WA 3HKZN 3HOWJ 4OIOF 3IRRA 3KP5A 3PIOF 3PO3J 3DPLC 4RDUA 1MH3A 5LEJA 1WJFA 5LGNA 3VODA 5FGMA 1ZELA 3GZ6A 1LE8A 3W2AA 3BG7A 1Z7LA 3DTIA 3WG9A 4G7OF 3UNGC 2K3PA 2LOOA 2FUG2 2P6SA 4FCYA 2L0KA 3BG3A 5AONA 3CF5F 4KNYA 3E5UA 2NVXJ 2DK5A 5HODA 1S7OA 1U5TA 4BY1J 2LSOA 1XSVA 1TQIA 1LJ9A 3KP2A 4IQ4A 4NQWB 2LKXA 4IHYA 1YIOA 3KIOA 5ILSA 3L9FA 2Y9YA 2I5UA 1RR8C 1DP7P 3HOZJ 3BT9A 1SANA 1FOXA 1BI2A 3L2VA 1K6OA 2PMZN 4RM2A 4ENMA 3P9KA 3OV8A 2M45A 3HIFA 2JSPA 1WHUA 1XN7A 2E60A 3OY9A 5DM7F 3GLXA 3ZXSA 1WI9A 2V9KA 4L5JA 3SDGA 1W1WE 3LSKA 4B3AA 1OQYA 4P1WA 2JUCA 4BU2A 2MABA 3JREA 2Q2EA 1O57A 5DD4A 2Q0OA 1W7PD 3L2UA 4BBRJ 2A05A 4DBQA 4F52A 3CCYA 4XLCA 4UVCA 3AAFA 1V5EA 1ZKGA 3JRHA 3FX3A 3QP5A 3ZQFA 5LEKA 1MBKA 4LJZF 4BBSJ 2AXTC 4AIKA 3ZMDA 4X0GA 4ENJA 2A5YB 4OOIA 4XM3A 4EJTA 3D5RC 5JLWA 4MIMA 2CQQA 1O3QA 1U9OA 4L0YB 4LG0B 2LC2A 2V26A 3C2BA 4IZZA 4JX6A 2KJCA 2IT0A 3SQNA 2Y0MA 4N9HA 2STWA 1YE9A 4XBFA 2ISZA 4IL6C 2HVQA 2BGCA 4UY8I 1JTYA 2KJBA 3GYHX 1ZLJA 4OIPF 3A2KA 2M0MA 2IA1A 4PJLA 1I27A 2IP2A 1Z77A 4TV7A 5DCMA 5J40A 3IL2A 1FYLA 4O5VA 3I53A 4A5MA 1T95A 2CWEA 2V1NA 1HW1A 3RKQA 3S3MA 2O6GE 1VF9A 1XMXA 3WU2C 3M3YJ 1V5GA 3FXKA 1LFPA 4L9TA 2WADA 3DPTA 4M3BA 1R71A 1VQ4I 4RGSA 3DTEA 2PBIA 5IP6A 2PLYA 4BQQA 2A69F 2DPDA 3LSIA 4KITB 3GX4X 4KUMA 1D1AA 4ON0A 3T8TA 2QBYB 4O3MA 1I6HJ 2VQCA 1E3HA 1KA8A 3ECOA 3G2BA 1G59A 3PUFA 4L18B 1O4XA 1XCVA 3GTOJ 5GAHJ 1Q1HA 3A03A 5K5OA 2KRFA 5EZGA 3RI4A 3GTPJ 2GOXB 1M1EB 1YYVA 2HPIA 2JPCA 1F43A 2DPUA 2OQRA 4XIDA 4D1QA 1OYYA 1Y0UA 5L3CA 3FF5A 1A31A 4JX5A 4XOPA 3RIRA 4ENKA 4A0YA 2H8WA 1U3EM 5DUKA 4FETA 1X1DA 2K27A 2IXSA 1TTYA 2W85A 2NS0A 5HS9A 2KIFA 3WTXC 2EFQA 4M9XA 2EV0A 2DMQA 1L0OC 1T6SA 4HQEA 2EZKA 5CVVA 1IZ1A 2VQHA 2ESHA 2XAHA 3AG3H 3RYPA 1K83J 2DTZA 5L3GA 2P6TA 5IOZA 2LFBA 2UZKA 2L7ZA 5C4XJ 2ZXJA 4M6VA 4XLFA 4HAMA 3M8JA 4C3HJ 3CC2I 5E1ZB 2JSCA 3G6EI 1EH8A 2WY7Q 3BP8A 1X4OA 3S32A 4DQ2A 4I6ZA 1RZ4A 2OZ6A 1P9QC 1QZZA 4UV8A 4U0YA 1VQ5I 2FJ1A 1ENHA 2LBFA 2R5ZB 4PDKA 1W7PB 5HNHA 2IPQX 2L2OA 4U87A 2M8GX 1IV6A 2X1DA 2Y31A 2VI6A 3BCBA 4I7HA 2EINH 2N8GA 1SAUA 1DGRM 2BOLA 5LD2C 4EGZA 1YOVB 2DMTA 4F3QA 2TDXA 1YW7A 4RLFA 5LGUA 2M87A 2HXIA 3HOUJ 1WJAA 1BA5A 5L3EA 4H0EA 1F9NA 4ANJA 1LEAA 1R49A 4IQJA 5LFAA 2EWNA 2OCEA 2ZFUA 5J3LA 2CQKA 1WZ2A 5ICCA 4ESJA 1QO0D 4Y52J 4NC6A 4V2GA 1JUMA 2CYYA 3DTKA 4ZDPA 2NVQJ 1NH3A 2B0LA 2CQNA 1GV2A 1PJRA 4R8HA 2V7FA 2VBZA 1WJEA 3CMYA 2GA1A 2JZYA 2E1NA 2XROA 1Z1DA 2ZBKA 5KAIC 3VYRB 2NS7A 4HNUA 2KZGA 2HYFA 5C3EJ 2B9SA 2DFHA 3L1PA 2R7ZJ 2WBMA 1PDNC 3WGHA 4Y33A 2F48A 3EETA 1F36A 4RBOA 3PIPF 5D5XB 1ZR4A 1J0RA 1R36A 2R7OA 4UUSB 2C6YA 4J19A 4IJAA 5EGOA 1ORKA 1A6IA 3WTVC 4EEFG 1LDKB 4BGDA 1FBUA 2DA7A 1YW9A 2AQEA 2OD5A 4MHGA 3BR6A 3GTLJ 3S14J 2BXZA 4IHXA 3L7WA 1D0YA 4OU0A 1IJWC 2EJRA 3CJTB 1MMDA 1UHMA 5D5UB 1O7LA 3SZTA 1KU9A 1FWZA 3LWFA 4GDFA 2VQLA 4DJAA 5FKMA 3CZ6A 2K9LA 3KP3A 1X3ZB 2OZUA 1XGNA 5HS7A 4BEHA 5LGTA 3PQJA 2XRNA 1F5TA 2KIUA 3FKJA 1B1BA 2NRAC 3IV5A 2FOWA 3CP2A 2EB7A 2GOMA 2R7XA 1X1BA 3VSKA 2GBYA 1ITYA 5J8CA 3VB2A 2CO5A 1FOWA 4UVBA 1MNMC 5GP9A 4OAYA 5KK1A 3TGNA 2FU4A 3KLOA 1FP1D 2PI0A 4D5FA 5EG0B 4LGWA 3KPHA 4WXDA 4M3DA 4N4OB 3N4MA 1LUJB 3SFZA 2VQGA 4ZZLA 2FD5A 2JMWA 2F4MB 2P7VB 4KA4A 4WXCA 3WTUC 4M6XA 4CDGA 4XRSG 3JRIA 1ODDA 1YI2I 4A3GJ 1R4NB 3V8KA 4XRFA 2CUEA 2Z99A 3FXMA 4DZJA 5JI6A 2DMNA 3Q9VA 3TBIA 4KIGA 2CQ7A 3OIPA 1HBXG 3LFUA 4YIIA 1MMGA 4Y17A 4X6AJ 1VQPI 1T0FC 1OCOH 3DBLB 3KEOA 2GXBA 3U1KA 3GMEA 5CVJA 2HPMA 2HEOA 1EA3A 2RAEA 2LLKA 2QGUA 1IC8A 2BV6A 2LH9A 4GRIA 3HM5A 5ICEA 1ERDA 3GTQJ 2KMUA 2H6BA 5DUIA 2XASA 3JW4A 3CDLA 3R0JA 3CMEI 2JA7J 4HX8A 1B72A 1Z0XA 1BOBA 1ULYA 5J1RA 2IS4A 4M71A 2LR8A 3S1RJ 1UCRA 4BQNA 2XHKA 3FDYA 1Z3YA 4MEYF 4XNFA 1MSFC 1V3FA 4ITVA 1HKTA 1E17A 3ZOBA 4RB0A 4Y7NJ 4HZFA 4BL0B 1DU0A 1ZARA 2K02A 4BJTA 2ESNA 5J6XA 3HPGA 3QP6A 1LDJA 1FMVA 4IEJA 1ZG5A 1NK3P 4IXAA 1WVRA 3ML6A 2XF6A 2ZXIA 1J9IA 3I4NJ 4Y15A 3BR2A 1VQNI 4BHPA 4BQOA 2L7KA 1HXDA 5ILUA 4RMNA 2AO9A 4ZDOA 1XB4A 1ETVA 2PX9A 3E1SA 4DBRA 2BY0A 4XSXF 5F08A 3HHGA 4ESBA 1MJAA 3FXRA 1J59A 1UFMA 2HYJA 2OUMA 3FIWA 3HUGB 5DYMA 2WAFA 3H5AA 2L9VA 1AKHB 1AU7A 1O3TA 4A93J 1UB9A 3ZQIA 2EPFA 1KU3A 4YFKF 3Q5FA 2BE5F 4P96A 3MKZA 3OSGA 1A35A 3CLQA 3ABTA 4WK8F 3K4KA 1MH4A 4LIVA 3RPUA 3GO5A 3ONQA 4ZH4F 3WU1B 1IDYA 3T5XA 4ZYAA 5FB2A 4AIJA 2IS6A 3CJNA 1MMSA 1JKOC 1WGXA 4D7MA 2W4SA 3GLLA 3HHHA 3VWBA 3W2WA 2ECCA 1FP2A 2ZNZA 5FROA 1H88C 2DCEA 4HRIA 3GFIA 2V79A 1KQ0A 3BOQA 5D8LB 3BR5A 2LDUA 3HOSA 2AS5F 4HV6A 1WWXA 4PZJA 3C1DA 5FKNA 2R5YB 4RAYA 5F0CA 1QRYA 1TNSA 3IWZA 3ULQB 3MD2A 2BVMA 2W25A 4YIRX 1TWHJ 3M9AA 1T08B 2L9SA 3OR2C 3ZP5A 5GADJ 1D1CA 1HOMA 3E5XA 3CDIA 1ZLKA 5DM6F 1VZ0A 2F5FA 4LFUA 1OCRH 4CZZA 1I6XA 5E79C 2XUBA 2DA5A 5F1RA 3ABUA 4OIQF 3FKIJ 1TWAJ 4MO7A 2O5RA 1FSHA 2IJLA 3HKZA 3GCMA 3LOCA 5F27A 1IN5A 1XTAA 4BXUA 2F2EA 4XKVA 4BAYA 1QNTA 2K5CA 1DPRA 3Q9SA 2LF7A 2KISA 2ZB9A 3K4JA 2KLOA 2NS8A 4XONA 4D9JA 2NVYJ 2VBWA 1KU7A 2BYVE 3BTJA 2MFZA 2QEXI 4AM3A 5FKKA 3TOAA 1APLC 2A07F 2DFEA 1G4DA 5BS6A 1LKXA 1OCZH 4OMYA 2E35A 4MTEA 1VQOI 3Q3SA 4M3FA 1ON1A 3J7AY 2HS5A 2R7FA 2Y75A 2DOFA 4C30A 4PJMA 2PMZA 4XN0A 2X48A 4A69C 3SDBA 5B3SH 2VODA 2M7AA 2QQ8A 3OYEA 4HW0A 1H0MA 1W5CC 4QWQA 2JA5J 4DYCA 2VBXA 4HX7A 4I02A 1JHHA 1WJBA 3I54A 2ZSIB 3ZN1A 2XSDC 2X6OA 3E0JB 2QVOA 4JK1X 1FNNA 5D4RA 4GYGA 4UUTA 1O3SA 2J5PA 2QSGX 2FSWA 1LVAA 1HSTA 2HZDA 4XQFA 1Z9CA 4LG0A 1MD0A 5J8FA 1RESA 4Y13A 2CRGA 2E71A 4RA2A 1UELB 3KYDB 3GTMJ 3I59B 1MJBA 2TCTA 2IS1A 5EYRA 2XKPA 2D1HA 2KDOA 2L01A 1BR4A 4YEJA 5K5RA 5CLSA 4IKFA 1UZCA 1FIAA 2EZLA 1U9NA 3F0CA 2ETHA 3LA3A 3WHCA 1D8JA 4EVIA 4IO9F 1TW3A 4EV0A 2ZO4A 5F0HA 1J09A 2KPMA 3FWEA 3GFJA 2XRLA 1ONVA 3NWSA 2QBYA 2QF7A 5D8KB 2Y69H 5M3FJ 1G3YA 2CSOA 1Y8RB 4G7HF 4E70A 1X1PA 3S1QJ 3CTAA 1J7KA 3TL4X 1OKRA 2RDPA 1Z67A 3KETA 2G9WA 1S9HA 2HOSA 3DEEA 2CUFA 1NG7A 3K70C 5KVRA 2XGCA 4PGHA 4RB3C 1LPQA 5H20A 2X1CA 3GZ5A 4LLNA 2TRTA 4A3BJ 3TEDA 2FXAA 2HQRA 3MAJA 2OJED 4RGXA 5HLHA 4GYIA 4Z2YA 3DBHB 3NEUA 2GLOA 1OISA 1IXSB 1X1CA 1BL0A 4G94A 1SD4A 2JA6J 4AVPA 4UNOA 1SD7A 3LAJA 4JP0A 1U6GA 2DQRA 1MNEA 2MLKA 2L9RA 3K4CA 3OWTA 4HX4A 4B48A 4CCOA 1B8IB 1GDTA 4N0BA 3L2CA 3TW6A 1R4MB 2HNHA 2GXGA 2RVCA 4ZYDA 3MZYA 2V4JC 3OYFA 3OSFA 3MWMA 1XX5A 3FMSA 1ETQA 4XORA 4BE0A 1YFHA 3U1DA 3RPQA 2WAEA 3GFMA 2E2IJ 3TO6A 1EKEA 2VE8A 2CH0A 3D5LA 4CCNA 3LL7A 3OL4A 2NXNB 2GWRA 3HZJA 1Q1VA 3E6DA 1HCRA 2R5ZA 3V42A 3IUOA 1W7PA 2EA2A 1ZRCA 5E1WA 1P7IA 4YELA 4BQAA 3RKWA 4GXOA 2M1BA 2FNPA 2FQ3A 3M07A 3RQ4A 3I55I 1G3TA 2VKDA 4PJNA 4YG2F 3W2VA 2IGNA 3V7RA 3GVAA 1EF4A 1ZYRF 4OWRB 3ZR8X 2DOAA 4LB5A 3CC7I 3G3ZA 3PM1A 4PJJA 2XC7A 4A3KJ 2VIXA 3CUQC 2Y9ZA 1R23A 1W0TA 1R5GA 3OS1A 3F21A 2CW8A 1WQ2A 2X9DA 3FISA 4RLQA 5JVTA 1QHGA 3DU6A 3FZVA 3J80Z 2W7NA 1DDNA 3MFKA 1MBHA 3IAS2 1SD5A 1LFUP 2K3FA 1HDPA 1BN5A 2ME6A 2ZMEC 1R1UA 3DWLE 4LLGF 2PJRB 1TQPA 2LRDA 3OYNA 2E19A 1OYWA 3QYFA 3VEPA 4JX4A 1S72I 4S04A 1CF7B 4MQVA 2X0LA 4EM0B 1DP3A 3HJEA 3CCLI 3KEYA 4QPQA 5DTDA 1RKTA 4OINF 1DGWY 1QPIA 4LIUA 4I99C 2QKLB 3IAM2 3S17J 4CCKA 2CV0A 2EV5A 1W0UA 5FKOA 1E0EA 2QENA 4U88A 5D4SA 3CUOA 2M3AA 1XMKA 1W5SA 2H8RA 4UUSA 3VSLA 3E5QA 3RKXA 1ZGWA 3WE2A 2VN2A 1P4XA 2ELHA 1BC7C 3M8FA 1S7AA 2HI3A 1ZTRA 3FXLA 2Z9OA 4LLLA 5HVQC 1P7JA 4L9NA 2K9NA 3H3ZA 4IRIA 5E8IA 2KP6A 2FE3A 1EV7A 4XRMA 4LD5A 3IKVA 2EIMH 1JT0A 1X3WB 5IYBJ 4UVAA 2CG4A 4L9JA 2PMHA 3T0YA 4FX4A 1KQ8A 2BBYA 2L5QA 1G3SA 4DOZA 2IEKA 4UHTA 2MBFA 4XKWA 4ZC3A 1STZA 2A6TA 1RKWA 2DO7A 4I09A 2E34A 2DYRH 1D5VA 2FMYA 3DP7A 2KQRA 3CO6C 4KIBA 3LSGA 2NNYA 3S2HJ 2EA4A 5FLMJ 3SZPA 3BCAA 4RB1A 2ZNYA 3LNQA 3TDUC 2RNJA 3C7JA 3F9KA 1MBJA 3V8JA 3BTLA 2FQ4A 5M5XJ 2V1XA 1ZGJA 5CPRB 1L3LA 3HEFA 2E2JJ 1Y1VJ 4Q47A 3I3LA 3PNYA 3QODA 3NQOA 3F6OA 3HSRA 5C4JJ 3LAPA 2QUFA 2IGOA 2XGXA 4B3XA 2LG4A 1N75A 4G6DA 1JT6A 5EG0A 1QU3A 5D6EA 5K7FA 2M34A 2YU9J 1A36A 3IH3A 4CZCA 5FJ8J 3R60A 2DBBA 3QPLA 2ZJ2A 2DFIA 3FK6A 3OYJA 3S15J 3CUQB 4B1RA 2WAQN 4H4KC 2NYXA 3ZQGA 2MC4A 2PMUA 5M3MJ 1U0JA 3RZOJ 1R00A 1OR7C 1ZHFA 1RETA 4O6JA 2K9SA 4AWXB 4D7NA 2M4GA 3QYBA 3K7AJ 3O6BB 3WGIA 1VQ8I 2H94A 1JUSA 2ZMEB 3OOPA 5HOOA 3H0GJ 2VKHA 2LTPA 2X51A 1IN6A 2QKMB 4BH9A 3PSFA 3VPRA 4W97A 4AVZA 3J80K 4FE7A 1HF0A 4CXFA 2H1KA 1USTA 1X19A 2XDVA 3L09A 4FASD 4NHJA 2JA2A 1Y39A 1TWGJ 1S29A 2P7CB 1FOKA 5KHDA 2W84A 3BQYA 1VNDA 1FSEA 3OYKA 2M2EA 3HTSB 1F1ZA 3CCVI 5GAGJ 1WSUA 4G12A 2HOTA 2B7EA 1R7JA 3KE2A 4A6DA 4C2MJ 1J2XA 2OV7A 1P2FA 4ETSA 5HLTA 3HG9A 3BJ6A 3WTTC 3WHBA 2E36A 2RNGA 1VQ7I 1AOYA 2A68F 1HQCA 2VXZA 4A2UA 3K4NA 2VJ4A 1U78A 3SXYA 5GTHC 2GQQA 2F5DA 3S1MJ 1K78B 4OIRF 3PFYA 1WJCA 2LREA 2Z16A 3CJRB 3F8BA 2CQXA 2DFFA 2VB6A 6PAXA 1S8NA 2IGKA 4HV5A 4DNCA 3IWFA 5FLVA 2WY8Q 2KIQA 2WV0A 4UUVA 3S16J 3B6CA 1SD6A 3NAUA 2P81A 2R7DA 2LY9A 4BNCA 2VT3A 4HF2A 4AU7A 1X2MA 4RM3A 2L54A 3OIQA 1FMWA 4BHCA 2KKOA 4CCJA 1K61A 4XKBA 3I4PA 2E1OA 4HPQA 1AKHA 1TNTA 2CFXA 5ED4A 1IGNA 3V7SA 4M6YA 2ICWG 2XAGA 2HU9A 2V9VA 2BY2A 2CUZA 3K2ZA 5HNFA 3PNVA 3HB9A 5F64A 5HLIA 5FRMA 1IW7F 1K6YA 1R1VA 3GXOA 4XMYA 1XMAA 4JYKA 5GPCA 5EEAA 1YO5C 3DLLF 4E7KA 1BR2A 4A3MJ 3G4SI 1NK2P 3B02A 5H6QA 3WODF 3HRMA 2PG4A 1JE8A 4GGGA 4A3DJ 4P9UA 4HF0A 4NDLA 1IO2A 2F5EA 1V54H 3FXJA 3QU3A 1PUFB 1ZR2A 4GFBA 3PUBA 2STTA 4I2OA 2MYSA 1TZLA 2V1UA 2RREA 1MKMA 3CCUI 2H27A 4NNJA 3E7LA 2QSHX 3BZ6A 5HDGA 2ID3A 4P5OA 4BE2A 1T0FA 3FMRA 4KT5C 3I4MJ 4BE1A 1N77A 2LKSA 3MZHA 3F6VA 2R5YA 2BVLA 2O8KA 2MG4A 4RS8A 5E18F 1MZBA 2HKXA 5LBQA 1X1AA 4C9YA 2R4GA 2R7UA 2GIZA 3NWTA 1B9NA 2W00A 4XLAA 4AIDA 2Q8KA 4A3CJ 4LK1F 4WCGA 1HA8A 2K40A 4HG2A 4XRSA 2DDBA 1ZRFA 5BPDA 4F55A 2X6YA 3BZCA 4FX0A 4XSZF 3I0TA 3KZIC 1FJLA 2XKOA 5LHHA 3L2WA 3BROA 4M3GA 1A04A 3HL2A 4CHUA 2DYSH 1B6AA 3ZMVA 3MZ8A 4U0VA 3DQVC 2EH3A 5DD8A 3CC4I 1GXQA 1FT9A 2HQNA 4KYWA 1HW5A 2Y30A 1X3UA 1Z6TA 4F93B 3WG7H 4X1EA 4J00A 3IC7A 2VBYA 4G6TB 4CA0A 5F0FA 2COBA 3U2RA 2K85A 1WFXA 2HQ5A 4JQFA 1RR7A 4I98B 2LNBA 2OQGA 4WWCA 5IPAA 1IRXA 2IAIA 3ASNH 3ABKH 2QWWA 4IPAA 1VFCA 2EZHA 2UXNA 4DGWB 2IGMA 5K5QA 3OOUA 2HXOA 4BKXA 4HDUA 2QCOA 3RKYA 5E3OA 2NOGA 2NVUB 3A01B 3QPHA 2BZTA 4NBQA 1G3WA 3E97A 1JHFA 3MKLA 4CGZA 3I59A 4S05A 1YS7A 3S8PA 4YFXF 1D3YA 3CMMA 3DEUA 1YG2A 1PUEE 1D5YA 2R7SA 4JOMA 2A6HF 2E5ZA 3HTUA 3FMQA 4E7IA 4C2TA 2XB0X 3WTWC 3AG2H 3WU0A 3OYCA 1OCPA 4E7JA 2ID6A 4U0WA 4R79A 4Q4ZF 2LD5A 3WTSC 2LY2A 1BBYA 4XL9A 2QLZA 3TP3A 2R93J 2PEXA 3KEQA 3H9JA 3ZMTA 2XAUA 4G9YA 3V4GA 4PK4A 1BJZA 1IXRC 2L7MP 1JKPC 1JXSA 2M9HA 3RTRA 1ON2A 3C2HA 2QQ9A 3OYLA 2MC3A 2F6CA 4MLOA 3M1EA 1LEBA 4IVNA 4DYRA 3EUHC 4II2A 1UJ8A 4EJWA 4PJ0C 3H36A 3JRCA 3K6GA 1OPCA 1E3OC 2E5NA 1ETWA 5AIPA 3AKZA 2RKHA 4NC8A 1SVMA 1QZYA 4EJUA 3IKTA 2JQ7A 5IYCJ 5BPIA 3CF2A 1U2WA 1MNDA 2MSYA 4B43A 4RGUA 3DCFA 1R22A 3SZGA 2EIKH 3DEWA 4C3JJ 2HGCA 4B44A 1B8IA 4L9VA 5IT3A 3DF8A 4S0HB 1DUXC 2VKVA 3JAMZ 1REPC 4XR6A 5TGTA 4A3IJ 3AL0C 2VJ5A 3TMOA 3F3XA 1SFOJ 3BDDA 1ETXA 3OL3A 4HF1A 1HSJA 1HKSA 2JUGA 4WX9A 4BJ5C 2VXDA 5J47A 2P8TA 3H0DA 2E7WA 1KZHA 3O8GA 4A0XA 3HSFA 4Y4RA 1K7AA 5K7ZA 3BG5A 1NG6A 1P92A 2BW3B 2W1OA 5BQTA 1IUYA 4KFCA 4NQWA 2Y0SN 4BDZA 3CLOA 3EQLF 3RQIA 4EM2A 3LFKA 3G1LA 3P7NA 5CQEA 3W3CA 2RV8A 3COAC 1SEUA 4KMUX 2ZJPF 4BS9A 2IS2A 3CJQB 3KLNA 3QPTA 2M4KA 3K1MA 3WTYC 2XPUA 1WJ5A 4D5CA 1ZGAA 4LG3A 2ZC2A 4CCLA 1Y8QB 3RCOA 1KU2A 3LSTA 2BY1A 3B73A 3H5RA 3QOPA 1XCBA 2FRHA 2ELJA 2VC0A 1XD7A 4HNTA 5KAFC 4MEXF 4QTRA 2CW0F 2DA3A 2PQ8A 3C3WA 1GUUA 1TWCJ 4ZTJA 2LKPA 4DW6A 3WTZA 1MBFA 3ZQLA 5KCMA 2PJRA 3SYTA 5F6FA 1J5YA 3WGGA 5CVRA 2XAFA 1T38A 1CF7A 5H6RA 4U7BA 1Z21A 3M1CA 3TOBA 2V6EA 3ROUA 1OJLA 1FBQA 1CGPA 2LMDA 4V19K 1N78A 3X2QH 4ENNA 3H1CA 5B66C 2K4JA 1R5ID 1TBXA 3ZQCA 1IDZA 4FE4A 1YLFA 5BOXA 2KZVA 3DLAA 3BC8A 1SFKA 1VTNC 4JBAA 3DU5A 1ETYA 3F8CA 3UR3C 3SEZA 3MEXA 2ZSHB 2MGQA 2VT2A 1FLIA 2XF5A 4PGGA 3GUDA 4MGRA 4M72A 2VC1A 1YQAA 1UHWA 3JRGA 1TWFJ 4C2UA 2X1EA 2VPLA 1W36D 1MBEA 1RUNA 3M7GA 1AWCA 2CV1A 2DTRA 2OC6A 1GV5A 2XPWA 5J1UA 3TP0A 1RIOH 2HDCA 4HLYA 1TT5B 1YS6A 2WC2A 4A12A 1P4WA 1OMIA 3K70D 1IG7A 3DKXA 2G0EA 1NTCA 3BR1A 4KN7X 3H5NA 2DMPA 1W36C 2EIJH 3AL0B 1BW6A 3CCRI 3TQNA 1QVUA 4HNVA 3IHUA 4II3A 2MA3A 2ZKZA 3K9TA 3E3VA 3JAMK 5CYVA 5IP9J 3CESA 1FZPB 3BR3A 3K4MA 3IH2A 3CCMI 5E8GA 1S5LC 2RGVA 3EYIA 1LVKA 3NARA 2V6CA 2OTLI 4CCMA 4XLPF 1HC8A 3H9GA 4A3EJ 3BLYA 3LSMA 4AYBN 3G71I 3G1MA 3BG9A 2MH2A 2L4MA 2YX7A 1BM9A 4E7HA 5IOYA 3ZPLA 1G2HA 1SVLA 2P5VA 1B9MA 3S93A 4NC7A 4ZZDA 3EPZA 4WXHA 2DN0A 4A0ZA 4BUPA 1GT0C 5GPAA 1R5HA 2KIMA 2OAZA 1MMNA 2DLLA 1SFXA 2EFPA 1FTZA 1MMAA 3CUQA 3TW7A 2KDZA 2WB1N 3EUAA 4YIFA 2F5VA 1RI7A 1V4RA 3DKWA 2CGPA 1QQIA 2IRFG 3BTCA 1B4AA 4HQMA 4EM1A 1IF1A 2HWVA 4B4CA 2FBIA 2Z2SB 5JFRA 4KT6A 2ZMEA 3I56I 2MD5A 1S6LA 1T56A 2K4BA 2VKEA 3GTGJ 5DS9A 2E7XA 3KCCA 2G7UA 3TO9A 2YSRA 3RDIA 3RYRA 3BJOA 3TO7A 3ZMUA 2WAQA 4A6EA 3R4KA 3RSNA 2P5LC 4IHVA 4B8XA 2ADUA 3ERMA 2CV2A 4ZJZA 1FEXA 3B6AA 1KQ9A 1J75A 5D6FA 4XKCA 1QPMA 3BQZA 3M4OJ 2F4OB 1PP7U 2HVSA 3JTGA 3T8RA 5L3DA 4IHSA 1IN7A 3CD6I 4PFOA 4HBLA 2HOAA 1W4MA 5LLQA 3JRFA 2RC4A 5LHIA 2FX0A 2Y2ZA 5BMZA 2XVCA 1YITI 3LSRA 1QVTA 1MSEC 4ZYHA 2VASA 2GZWA 5BNGA 4MQ9F 4PCQA 3P9CA 3O8HA 5FRNA 1B59A 2GIVA 3HGGA 3H3UA 5F04A 2DA1A 3H35A 3L2RA 1K78A 4XICA 1CQTA 5H2FC 3D0SA 2VONA 3ISPA 3S3NA 2V9PA 5CKTA 1U8RA 2KFDA 1WKMA 3KP6A 1YRNB 3QWLA 1H9TA 2MLGA 2UXXA 2VOPA 4N9IA 2QSFX 2E2HJ 2XGEA 1FIPA 1OYIA 2OCCH 3I71A 3OMYA 3QRFF 1YX5A 4BACA 3GTJJ 2O3FA 1K4TA 5L3FA 3GBGA 1VQ9I 2DA4A 1XDUA 4IX7A 1U5TC 3KYLA 3LMMA 5ERIA 3VDXA 1LB2A 3GF2A 1LDDA 4MTDA 3BJAA 3KFWX 5M5WJ 1Z7UA 1MDMB 3PFIA 4RAZA 4QSHA 2QZ8A 2XF7A 3K1NA 1YTYA 3CCQI 3M8EA 2NOJB 1WH5A 2JRTA 4P55A 1XGMA 5IP7J 1R1TA 2O8XA 3BPXA 3V8LA 2XGDA 1ETOA 4EJOA 4KJZA 2QM3A 1OR7A 4F7ZA 2HKOA 1PUFA 3JSPA 2JN6A 4YRVA 5LRSA 3HPHA 1WI3A 1G6NA 2DU9A 3W6JB 2Y48A 5AIQA 2GAUA 1GVJA 1BJAA 1YJ9I 3I58A 4CYCB 1S3JA 5E3MA 2O61A 2H1LA 4UB6C 5CJ9A 2K86A 1FTTA 1TC3C 2X6XA 1I3QJ 2JA8J 1XGSA 5HS8A 3ZQ7A 1OLTA 1Y0NA 4IRHA 4FISA 2FMLA 4DZPA 1EH6A 3K10A 4ABZA 4L5EA 3LQRA 4M73A 4EMSA 4XN3A 4F91B 3J81Z 2O03A 3PNTA 3HOVJ 3FM5A 1JJ6C 4HDVA 3Q0VA 3V7CA 3ECHA 5E3NA 2K9MA 2IVMA 2HDDA 2H6CA 2L4AA 3S2WA 3LSPA 4G7ZF 3LQQA 1IRGA 5E17F 2L02A 2HVRA 1SAXA 4OAZA 1FPQA 3P9IA 1V55H 1I5ZA 5ICFA 3HRTA 1VI0A 2XPVA 4M74A 3I64A 2FBKA 2VJJA 3ABLH 3LA2A 2DXIA 1VQMI 2VE9A 4CH7A 4EGYA 1XC5A 5ILVA 5DCFA 3J7AO 2WA0A 2Z33A 1LE8B 1T8IA 3IP4B 4RAFA 3FXQA 1D1BA 2X4HA 2DDAA 5K1YA 2MW8A 2EILH 5LHGA 3MN2A 4PSWA 2LF8A 5FKLA 5EDNA 2Q1ZB 2L7FP 3KZZA 1BI0A 2XB5A 3Q0UA 2XAJA 4HEA2 1BIAA 1MW7A 2X6WA 3ZMSA 1VQKI 1U5TB 1JGSA 3QQAA 3CMAI 5TRDA 1KONA 3QPSA 2EFWA 1BC8C 1PP8F 1ACIA 4D0PA 4R1HA 5HDKA 3A01A 3EUKL 1XGOA 3D1NI 4MNUA 1JUPA 1P6RA 1Y6IA 1H8AC 2R7VA 2LP0A 2D45A 4P9FA 4B47A 1RC9A 2JRMA 1TLHB 1IUFA 2KHMA 3GFLA 2GXAA 3OYMA 3F8MA 5M5YJ 3ZQQA 1BR1A 3VOEA 5IT9Z 3W6KB 4RB2C 1G8XA 1LQ1A 3PSIA 5JHUA 4M3EA 1UHSA 2Q2EB 1FBSA 2OU2A 3SEQA 1E2XA 1P4AA 3IH4A 2OF7A 5TJJA 3ERED 4I0BA 1QBJA 4ASNA 4QIWN 1AA7A 1GLNA 3N97A 1MJ9A 2NAZA 3D5SC 2LY1A 1Y1WJ 3HUGA 3GWZA 5E3LA 5EZHA 5TISC 1GHCA 3RZDJ 5CQGA 3QAHA 2O7OA 1ZK8A 4HOBA 2ZCWA 4A3JJ 2AHQA 3HRUA 1IN8A 1FX7A 1WCMJ 3K0LA 4AD9A 4PFPA 2HTSA 5ICGA 4AC0A 3S2DJ 3C2GA 5EJCA 3SHFA 1OFCX 1ZREA 1UG2A 1XSXA 2E1MC 2HR3A 4BYYA 3DKYA 2JTVA 2OPTA 2W57A 1UAAA 3BZKA 4LOCA 2DK8A 3OYAA 1WPKA 4IOCF 3J81K 3AFHA 2A3SA 3DPUA 5LRRA 3HDDA 4GO1A 4Y3OA 5JHFA 1LFBA 2BY3A 5JLXA 5FFZA 1K4SA 1PVEA 3OYBA 2R7TA 5DCMB 3JR9A 4NUBA 4QLCU 4KISA 2HZTA 4E6KG 3FBNB 3GTKJ 1IV8A 1D8KA 3DFGA 2DODA 2ZXWH 2Z3YA 4V2FA 4CUGA 1YHQI 3REOA 3HOTA 2JT1A 2RQPA 1C0WA 4FT8A 5HLGA 3S1NJ 3TDZC 5FD6A 2FEZA 3JRDA 3BWGA 3EYYA 1YW8A 4MFDA 2IW5A 4G6QA 1DU6A 5FD5A 1T39A 1QA6A 1KGSA 1RRJA 3DXJF 1TQMA 2PN6A 3N05A 4GCVA 3HYIA 4K2EA 4IRGA 2YR2A 2NNNA 1SMYF 3SFIA 3JRAA 3MKWB 1X58A 1FOYA 5GTIC 3JCUC 2BW3A 5EEHA 2O0YA 3BY6A 4A3LJ 3MMYB 3P5JA 2IA2A 3OR1C 2KT0A 2DQLA 5E1XA 1SC7A 2JPBA 4L0ZB 3L2QA 5FLXZ 4E7SA 2XAQA 2B63J 2BHYA 4W1UA 2DW4A 5A2QZ 1IRZA 2JJ7A 3J7YJ 9ANTA 3K2AA 2M30A 3E6MA 1IXCA 1RUOA 1WH7A 1OCCH 5DV5A 3HC7A 4DIQA 2ZJRF 1XG1A 1KYZA 4OMZA 3E6CC 4KMFA 3A4CA 2Y0SA 3KYCB 3OS2A 2DT6A 2M5WA 2DOEA 3F72A 1RPWA 3K69A 4FHTA
chains in the Genus database with same CATH topology
2FJ1A 1ENHA 1X2NA 2R5ZB 1EF4A 2M8GX 1IV6A 4QTRA 2Y31A 2DA3A 2VI6A 3PM1A 4A3KJ 1R9TJ 1GUUA 5C44J 2N8GA 1TWCJ 4DW6A 2Y9ZA 1MBFA 1W0TA 3ZQLA 2DMTA 3BTIA 3ZQHA 2HXIA 1U8BA 1JKQC 3HOUJ 2X9DA 3FISA 1BA5A 1LFUP 1MBHA 1OJLA 3HGYA 3FK7A 3CQZJ 1HDPA 2EZIA 2ME6A 3LSJA 2E19A 4XK4A 2GM4A 3HOYJ 5J3LA 4JX4A 4D5CA 1POGA 4Y52J 3ZQCA 4V2GA 1IDZA 1JUMA 2LK2A 5DTDA 1RKTA 4FE4A 1QPIA 2NVQJ 1JGGA 1GV2A 3S17J 3CMYA 1ETYA 2MGQA 1W0UA 5FKOA 3JRGA 2NS7A 2H8RA 5C3EJ 1TWFJ 4UUSA 3L1PA 1ZGWA 2R7ZJ 1MBEA 2HI3A 1ZTRA 1F36A 1S7EA 1GV5A 2XPWA 5J1UA 3TP0A 4RBOA 1P7JA 2K9NA 1ZR4A 4UUSB 4XRMA 1IG7A 4J19A 4C3IJ 1JT0A 5EGOA 1ORKA 5IYBJ 1A6IA 2G0EA 1NTCA 3BR1A 4EEFG 3H3VK 2DA7A 2DMPA 4FTHA 3BR6A 1BW6A 2IEKA 4IHXA 3GTLJ 3S14J 5IYDJ 1QVUA 4HNVA 5EGOB 1IJWC 1RKWA 2D5VA 5IP9J 3BR3A 3IH2A 3UKGA 3LSGA 3S2HJ 5FLMJ 3NARA 5FKMA 3LNQA 3W6VA 4A3EJ 4AYBN 1MBJA 3G1MA 3BG9A 2FQ4A 3BTLA 5M5XJ 2VPRA 5IOYA 3HEFA 2E2JJ 1Y1VJ 1G2HA 1GVDA 1OCTC 3IV5A 3PO2J 5C4JJ 3JRBA 2ME0A 3Q0WA 2DN0A 1GT0C 2GBYA 5GPAA 1ITYA 3MVPA 1JT6A 5EG0A 1MNMC 1FTZA 3TW7A 5GP9A 2KDZA 2WB1N 5K7FA 2M34A 2YU9J 2LVSA 3IH3A 5FJ8J 2YUSA 3QPLA 3BTCA 3FK6A 4B4CA 4D5FA 5EG0B 3S15J 2K9QA 4B1RA 2WAQN 3ZQGA 4M3DA 5M3MJ 1T56A 2VKEA 3RZOJ 2ELKA 3GTGJ 2FD5A 2JMWA 5DS9A 1RETA 2K9SA 1JTXA 4D7NA 2DA2A 3K7AJ 1T33A 2O9LA 4XRSG 3JRIA 1BW5A 2JK3A 4A3GJ 1JKRC 1JUSA 2DA6A 2CUEA 2M0CA 3H0GJ 4IHVA 4DZJA 2LTPA 4AUXA 1XS9A 3VPRA 2DMNA 4W97A 4FE7A 3OIOA 5K7HA 1FEXA 3B6AA 1HF0A 2H1KA 3BQZA 3M4OJ 2I10A 4X6AJ 1TWGJ 2DJNA 2HOAA 4BXXJ 3BQYA 1VNDA 3JRFA 2FX0A 2Y2ZA 2M2EA 1ETKA 3LSRA 1H89C 2W48A 1QVTA 1MSEC 2RAEA 2LLKA 5BNGA 4G12A 1IC8A 2HOTA 3O8HA 4C2MJ 3HM5A 1YRNA 3HGGA 5F04A 3GTQJ 2DA1A 1CQTA 4XICA 3WHBA 1AHDP 2JA7J 3CDLA 1B72A 1Z0XA 1I50J 5J1RA 2NVTJ 2LR8A 3G1OA 3S1RJ 1U78A 1YRNB 2JWTA 3S1MJ 1MSFC 3ZOBA 4Y7NJ 2CQXA 1B72B 1DU0A 2EBIA 2E2HJ 4IEJA 2XGEA 1FIPA 1ZQ3P 5FLVA 1NK3P 3SJMA 3S16J 3B6CA 2VUMJ 3I4NJ 3BR2A 3GTJJ 3NAUA 4I76A 3GBGA 2P81A 2DA4A 2LY9A 1X2MA 2CU7A 2IBDA 2AO9A 5EF6A 1K61A 1ETVA 2E1OA 4DYQA 5M5WJ 1AKHA 1IGNA 5F08A 4QSHA 2EQRA 2HYJA 3FIWA 3HB9A 1WH5A 2ECBA 5IP7J 2R0QC 1UMQA 1A5JA 1AKHB 1AU7A 2XGDA 4JYKA 5GPCA 5EEAA 2R92J 1HDDC 1ETOA 4CYCA 4A93J 1PUFA 1MBGA 3ZQIA 4A3MJ 2JN6A 1NK2P 1WI3A 2DMUA 4A3DJ 3OSGA 4CYCB 4NDLA 5E3MA 4MFEA 1FTTA 1TC3C 1PUFB 1I3QJ 1MH4A 1ZR2A 4GFBA 2JA8J 1HLVA 4FISA 4DZPA 5J1YA 1IDYA 4ABZA 4L5EA 3A02A 3E7LA 2WV1A 2ID3A 1JKOC 3I4MJ 4A3FJ 3HOVJ 1WGXA 4D7MA 1JJ6C 3HOXJ 3Q0VA 4BY7J 2ECCA 5E3NA 2R5YA 2HDDA 1H88C 3LSPA 2MG4A 2O8KA 3BR0A 1JJ8C 3BR5A 5F1JA 4IHWA 4A3CJ 5FKNA 2R5YB 3HBLA 2K40A 5F0CA 1QRYA 4XRSA 1VI0A 2XPVA 2CJJA 1TWHJ 2YS9A 3HKZN 3HOWJ 1HOMA 1FJLA 3PO3J 4RDUA 1MH3A 4M3GA 1LE8A 2DA5A 1XC5A 3FKIJ 1TWAJ 4MO7A 5F27A 3LOCA 2EH3A 4FCYA 2L0KA 3BG3A 1LE8B 2NVXJ 5HODA 4BY1J 2MW8A 2Y30A 3MN2A 5FKLA 2LKXA 4IHYA 5EDNA 2L7FP 2ZB9A 3Q0UA 2XB5A 2Y9YA 4X1EA 2NS8A 3HOZJ 3BT9A 2NVYJ 1SANA 3BTJA 5F0FA 2COBA 5FKKA 1APLC 2HQ5A 1RR7A 2PMZN 3QQAA 3QPSA 5IPAA 2IAIA 3A01A 1VFCA 2EZHA 3D1NI 3Q3SA 4M3FA 1JUPA 1H8AC 3OOUA 4A69C 2HXOA 3SDGA 2LP0A 4BKXA 2QCOA 2X48A 4B3AA 5E3OA 3JREA 2NOGA 3A01B 2JA5J 4DYCA 1IUFA 4BBRJ 5M5YJ 2XSDC 2X6OA 3MKLA 3CCYA 4M3EA 1UHSA 1ZKGA 3JRHA 4UUTA 3ZQFA 3IH4A 2OF7A 1MBKA 4QIWN 4BBSJ 1D5YA 1RESA 2CRGA 1Y1WJ 5E3LA 5EZHA 3RZDJ 3GTMJ 2TCTA 2XB0X 5EYRA 2O7OA 5JLWA 1ZK8A 4MIMA 1OCPA 2CQQA 2ID6A 4A3JJ 2AHQA 1U9OA 2LD5A 1WCMJ 3C2BA 4JX6A 4AC0A 1FIAA 3S2DJ 3TP3A 2R93J 2EZLA 1OFCX 1UG2A 1U9NA 3F0CA 1JTYA 1BJZA 3WHCA 2OPTA 2L7MP 1JKPC 2M9HA 4LOCA 5F0HA 1Z77A 1WPKA 2XRLA 4MLOA 4DYRA 2QF7A 3RKQA 3HDDA 1VF9A 5M3FJ 3M3YJ 1LFBA 5JLXA 3JRCA 4M3BA 1E3OC 3S1QJ 5IP6A 1ETWA 3JR9A 2HOSA 5IYCJ 1I6HJ 2CUFA 2XGCA 3GTKJ 2MSYA 4V2FA 3DCFA 1O4XA 3GTOJ 2TRTA 3DEWA 4A3BJ 4C3JJ 3TEDA 3A03A 5EZGA 3S1NJ 3GTPJ 3JRDA 1B8IA 4S0HB 1F43A 2GLOA 4XIDA 4MFDA 1DU6A 1BL0A 2VKVA 4JX5A 2JA6J 4A3IJ 4JP0A 2L9RA 1B8IB 1GDTA 3SFIA 3JRAA 1X58A 2DMQA 3TW6A 1ETXA 1SFOJ 2EZKA 4A3LJ 3OSFA 1K83J 2DTZA 1ETQA 2KT0A 5IOZA 3O8GA 2LFBA 5K7ZA 2L7ZA 3BG5A 2E2IJ 2B63J 4W1UA 5C4XJ 1IRZA 2JJ7A 2Y0SN 4M6VA 3RQIA 9ANTA 3G1LA 3K2AA 4C3HJ 1WH7A 1Q1VA 1HCRA 2R5ZA 1XG1A 2XPUA 4I6ZA 1P7IA 1RPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJ1 A;  1ENH A;  1X2N A;  2R5Z B;  1EF4 A;  2M8G X;  1IV6 A;  4QTR A;  2Y31 A;  2DA3 A;  2VI6 A;  3PM1 A;  4A3K J;  1R9T J;  1GUU A;  5C44 J;  2N8G A;  1TWC J;  4DW6 A;  2Y9Z A;  1MBF A;  1W0T A;  3ZQL A;  2DMT A;  3BTI A;  3ZQH A;  2HXI A;  1U8B A;  1JKQ C;  3HOU J;  2X9D A;  3FIS A;  1BA5 A;  1LFU P;  1MBH A;  1OJL A;  3HGY A;  3FK7 A;  3CQZ J;  1HDP A;  2EZI A;  2ME6 A;  3LSJ A;  2E19 A;  4XK4 A;  2GM4 A;  3HOY J;  5J3L A;  4JX4 A;  4D5C A;  1POG A;  4Y52 J;  3ZQC A;  4V2G A;  1IDZ A;  1JUM A;  2LK2 A;  5DTD A;  1RKT A;  4FE4 A;  1QPI A;  2NVQ J;  1JGG A;  1GV2 A;  3S17 J;  3CMY A;  1ETY A;  2MGQ A;  1W0U A;  5FKO A;  3JRG A;  2NS7 A;  2H8R A;  5C3E J;  1TWF J;  4UUS A;  3L1P A;  1ZGW A;  2R7Z J;  1MBE A;  2HI3 A;  1ZTR A;  1F36 A;  1S7E A;  1GV5 A;  2XPW A;  5J1U A;  3TP0 A;  4RBO A;  1P7J A;  2K9N A;  1ZR4 A;  4UUS B;  4XRM A;  1IG7 A;  4J19 A;  4C3I J;  1JT0 A;  5EGO A;  1ORK A;  5IYB J;  1A6I A;  2G0E A;  1NTC A;  3BR1 A;  4EEF G;  3H3V K;  2DA7 A;  2DMP A;  4FTH A;  3BR6 A;  1BW6 A;  2IEK A;  4IHX A;  3GTL J;  3S14 J;  5IYD J;  1QVU A;  4HNV A;  5EGO B;  1IJW C;  1RKW A;  2D5V A;  5IP9 J;  3BR3 A;  3IH2 A;  3UKG A;  3LSG A;  3S2H J;  5FLM J;  3NAR A;  5FKM A;  3LNQ A;  3W6V A;  4A3E J;  4AYB N;  1MBJ A;  3G1M A;  3BG9 A;  2FQ4 A;  3BTL A;  5M5X J;  2VPR A;  5IOY A;  3HEF A;  2E2J J;  1Y1V J;  1G2H A;  1GVD A;  1OCT C;  3IV5 A;  3PO2 J;  5C4J J;  3JRB A;  2ME0 A;  3Q0W A;  2DN0 A;  1GT0 C;  2GBY A;  5GPA A;  1ITY A;  3MVP A;  1JT6 A;  5EG0 A;  1MNM C;  1FTZ A;  3TW7 A;  5GP9 A;  2KDZ A;  2WB1 N;  5K7F A;  2M34 A;  2YU9 J;  2LVS A;  3IH3 A;  5FJ8 J;  2YUS A;  3QPL A;  3BTC A;  3FK6 A;  4B4C A;  4D5F A;  5EG0 B;  3S15 J;  2K9Q A;  4B1R A;  2WAQ N;  3ZQG A;  4M3D A;  5M3M J;  1T56 A;  2VKE A;  3RZO J;  2ELK A;  3GTG J;  2FD5 A;  2JMW A;  5DS9 A;  1RET A;  2K9S A;  1JTX A;  4D7N A;  2DA2 A;  3K7A J;  1T33 A;  2O9L A;  4XRS G;  3JRI A;  1BW5 A;  2JK3 A;  4A3G J;  1JKR C;  1JUS A;  2DA6 A;  2CUE A;  2M0C A;  3H0G J;  4IHV A;  4DZJ A;  2LTP A;  4AUX A;  1XS9 A;  3VPR A;  2DMN A;  4W97 A;  4FE7 A;  3OIO A;  5K7H A;  1FEX A;  3B6A A;  1HF0 A;  2H1K A;  3BQZ A;  3M4O J;  2I10 A;  4X6A J;  1TWG J;  2DJN A;  2HOA A;  4BXX J;  3BQY A;  1VND A;  3JRF A;  2FX0 A;  2Y2Z A;  2M2E A;  1ETK A;  3LSR A;  1H89 C;  2W48 A;  1QVT A;  1MSE C;  2RAE A;  2LLK A;  5BNG A;  4G12 A;  1IC8 A;  2HOT A;  3O8H A;  4C2M J;  3HM5 A;  1YRN A;  3HGG A;  5F04 A;  3GTQ J;  2DA1 A;  1CQT A;  4XIC A;  3WHB A;  1AHD P;  2JA7 J;  3CDL A;  1B72 A;  1Z0X A;  1I50 J;  5J1R A;  2NVT J;  2LR8 A;  3G1O A;  3S1R J;  1U78 A;  1YRN B;  2JWT A;  3S1M J;  1MSF C;  3ZOB A;  4Y7N J;  2CQX A;  1B72 B;  1DU0 A;  2EBI A;  2E2H J;  4IEJ A;  2XGE A;  1FIP A;  1ZQ3 P;  5FLV A;  1NK3 P;  3SJM A;  3S16 J;  3B6C A;  2VUM J;  3I4N J;  3BR2 A;  3GTJ J;  3NAU A;  4I76 A;  3GBG A;  2P81 A;  2DA4 A;  2LY9 A;  1X2M A;  2CU7 A;  2IBD A;  2AO9 A;  5EF6 A;  1K61 A;  1ETV A;  2E1O A;  4DYQ A;  5M5W J;  1AKH A;  1IGN A;  5F08 A;  4QSH A;  2EQR A;  2HYJ A;  3FIW A;  3HB9 A;  1WH5 A;  2ECB A;  5IP7 J;  2R0Q C;  1UMQ A;  1A5J A;  1AKH B;  1AU7 A;  2XGD A;  4JYK A;  5GPC A;  5EEA A;  2R92 J;  1HDD C;  1ETO A;  4CYC A;  4A93 J;  1PUF A;  1MBG A;  3ZQI A;  4A3M J;  2JN6 A;  1NK2 P;  1WI3 A;  2DMU A;  4A3D J;  3OSG A;  4CYC B;  4NDL A;  5E3M A;  4MFE A;  1FTT A;  1TC3 C;  1PUF B;  1I3Q J;  1MH4 A;  1ZR2 A;  4GFB A;  2JA8 J;  1HLV A;  4FIS A;  4DZP A;  5J1Y A;  1IDY A;  4ABZ A;  4L5E A;  3A02 A;  3E7L A;  2WV1 A;  2ID3 A;  1JKO C;  3I4M J;  4A3F J;  3HOV J;  1WGX A;  4D7M A;  1JJ6 C;  3HOX J;  3Q0V A;  4BY7 J;  2ECC A;  5E3N A;  2R5Y A;  2HDD A;  1H88 C;  3LSP A;  2MG4 A;  2O8K A;  3BR0 A;  1JJ8 C;  3BR5 A;  5F1J A;  4IHW A;  4A3C J;  5FKN A;  2R5Y B;  3HBL A;  2K40 A;  5F0C A;  1QRY A;  4XRS A;  1VI0 A;  2XPV A;  2CJJ A;  1TWH J;  2YS9 A;  3HKZ N;  3HOW J;  1HOM A;  1FJL A;  3PO3 J;  4RDU A;  1MH3 A;  4M3G A;  1LE8 A;  2DA5 A;  1XC5 A;  3FKI J;  1TWA J;  4MO7 A;  5F27 A;  3LOC A;  2EH3 A;  4FCY A;  2L0K A;  3BG3 A;  1LE8 B;  2NVX J;  5HOD A;  4BY1 J;  2MW8 A;  2Y30 A;  3MN2 A;  5FKL A;  2LKX A;  4IHY A;  5EDN A;  2L7F P;  2ZB9 A;  3Q0U A;  2XB5 A;  2Y9Y A;  4X1E A;  2NS8 A;  3HOZ J;  3BT9 A;  2NVY J;  1SAN A;  3BTJ A;  5F0F A;  2COB A;  5FKK A;  1APL C;  2HQ5 A;  1RR7 A;  2PMZ N;  3QQA A;  3QPS A;  5IPA A;  2IAI A;  3A01 A;  1VFC A;  2EZH A;  3D1N I;  3Q3S A;  4M3F A;  1JUP A;  1H8A C;  3OOU A;  4A69 C;  2HXO A;  3SDG A;  2LP0 A;  4BKX A;  2QCO A;  2X48 A;  4B3A A;  5E3O A;  3JRE A;  2NOG A;  3A01 B;  2JA5 J;  4DYC A;  1IUF A;  4BBR J;  5M5Y J;  2XSD C;  2X6O A;  3MKL A;  3CCY A;  4M3E A;  1UHS A;  1ZKG A;  3JRH A;  4UUT A;  3ZQF A;  3IH4 A;  2OF7 A;  1MBK A;  4QIW N;  4BBS J;  1D5Y A;  1RES A;  2CRG A;  1Y1W J;  5E3L A;  5EZH A;  3RZD J;  3GTM J;  2TCT A;  2XB0 X;  5EYR A;  2O7O A;  5JLW A;  1ZK8 A;  4MIM A;  1OCP A;  2CQQ A;  2ID6 A;  4A3J J;  2AHQ A;  1U9O A;  2LD5 A;  1WCM J;  3C2B A;  4JX6 A;  4AC0 A;  1FIA A;  3S2D J;  3TP3 A;  2R93 J;  2EZL A;  1OFC X;  1UG2 A;  1U9N A;  3F0C A;  1JTY A;  1BJZ A;  3WHC A;  2OPT A;  2L7M P;  1JKP C;  2M9H A;  4LOC A;  5F0H A;  1Z77 A;  1WPK A;  2XRL A;  4MLO A;  4DYR A;  2QF7 A;  3RKQ A;  3HDD A;  1VF9 A;  5M3F J;  3M3Y J;  1LFB A;  5JLX A;  3JRC A;  4M3B A;  1E3O C;  3S1Q J;  5IP6 A;  1ETW A;  3JR9 A;  2HOS A;  5IYC J;  1I6H J;  2CUF A;  2XGC A;  3GTK J;  2MSY A;  4V2F A;  3DCF A;  1O4X A;  3GTO J;  2TRT A;  3DEW A;  4A3B J;  4C3J J;  3TED A;  3A03 A;  5EZG A;  3S1N J;  3GTP J;  3JRD A;  1B8I A;  4S0H B;  1F43 A;  2GLO A;  4XID A;  4MFD A;  1DU6 A;  1BL0 A;  2VKV A;  4JX5 A;  2JA6 J;  4A3I J;  4JP0 A;  2L9R A;  1B8I B;  1GDT A;  3SFI A;  3JRA A;  1X58 A;  2DMQ A;  3TW6 A;  1ETX A;  1SFO J;  2EZK A;  4A3L J;  3OSF A;  1K83 J;  2DTZ A;  1ETQ A;  2KT0 A;  5IOZ A;  3O8G A;  2LFB A;  5K7Z A;  2L7Z A;  3BG5 A;  2E2I J;  2B63 J;  4W1U A;  5C4X J;  1IRZ A;  2JJ7 A;  2Y0S N;  4M6V A;  3RQI A;  9ANT A;  3G1L A;  3K2A A;  4C3H J;  1WH7 A;  1Q1V A;  1HCR A;  2R5Z A;  1XG1 A;  2XPU A;  4I6Z A;  1P7I A;  1RPW A; 
#chains in the Genus database with same CATH topology
 4ZYE A;  3J7Z I;  3OYG A;  3QYE A;  3K4B A;  4UV9 A;  1X2N A;  1Z05 A;  1BI1 A;  1SFE A;  2X85 A;  3OYI A;  5IT9 K;  3VFZ A;  4BJ6 C;  3O3K A;  1BIB A;  2OA4 A;  3VYU B;  3ASO H;  3KX2 A;  1R9T J;  5C44 J;  2BEO A;  4XOT A;  2LBF B;  2P4W A;  3H92 A;  5FO5 A;  1IRF A;  3BTI A;  3ZQH A;  4RGR A;  4Q5S F;  4YFN F;  3EUH A;  1U8B A;  1D0Z A;  3I9V 2;  1JKQ C;  4NB5 A;  2RN7 A;  2EFO A;  2ZFW A;  3F22 A;  2E1M B;  2VOO A;  4HA8 A;  3FK7 A;  3HGY A;  3CQZ J;  2GA2 A;  3OS0 A;  1HKQ A;  2EZI A;  2HOE A;  3LSJ A;  4XK4 A;  3F8N A;  2GM4 A;  3HOY J;  3A0H C;  2JVH A;  3F23 A;  1POG A;  2CFO A;  3AG1 H;  3LA7 A;  2KRC A;  1IN4 A;  2LK2 A;  2D2W A;  3E6B A;  2HTJ A;  2BHZ A;  2L3D A;  5L3B A;  1JGG A;  1O7F A;  2K7L A;  3CO7 C;  1I3A A;  3VYT B;  3ELK A;  2RQQ A;  2R7R A;  2YPR A;  2FF4 A;  2EFN A;  4LB6 B;  1VQ6 I;  3CP8 A;  1SFU A;  1SMT A;  2DAO A;  1YJW I;  4G8X A;  4IHT A;  2CW7 A;  1S7E A;  3A1Y A;  4B09 A;  2YU3 A;  1UG0 A;  4I0A A;  4BDY A;  3R61 A;  2MH9 A;  2W82 A;  4C3I J;  1FY7 A;  3FXU A;  2XV4 S;  1MGT A;  1TT0 A;  2WTE A;  4HLX A;  3H3V K;  1N25 A;  5B1A H;  4FTH A;  2CUJ A;  4LIT A;  3FHZ A;  2ZJQ F;  5IYD J;  3FM3 A;  2A61 A;  2H09 A;  5EGO B;  5CVI A;  1Y56 A;  2A6E F;  2D5V A;  4M9Z A;  3MCZ A;  2PJP A;  3DV8 A;  3U9G A;  2WWY A;  5CVU A;  4EAT A;  3UKG A;  3H9Q A;  2J5O A;  3HRS A;  3WE3 A;  3W6V A;  3KP4 A;  4CO8 A;  3BG6 A;  3G73 A;  2UUZ A;  4KIF A;  5HDN A;  3DBR B;  4Z6Y A;  1YX3 A;  4A5N A;  3R6S A;  4WF2 A;  2A5W A;  1NHA A;  2VPR A;  5JR3 A;  3U21 A;  4Q48 A;  1ZRD A;  1GVD A;  2Z1D A;  1OCT C;  3PO2 J;  1BI3 A;  3FBI B;  5FLX K;  1E3P A;  1Z6R A;  1Z91 A;  3JRB A;  2ME0 A;  3Q0W A;  1BOA A;  2F4I A;  2HQA A;  5EEG A;  4BEH B;  1FC3 A;  5J4V A;  4AYB A;  5A2Q K;  3MVP A;  2LYC A;  5B5E C;  2DJI A;  4ESF A;  3FXO A;  4I01 A;  2F5C A;  2FA5 A;  2R7Q A;  3GZN B;  3S3O A;  1I1S A;  1IAW A;  1H9G A;  4QPO A;  4CIC A;  2BXY A;  2LVS A;  3ESW B;  2W24 A;  4KDP A;  1FYK A;  2VL8 A;  2OBP A;  2YUS A;  3CCJ I;  3KP7 A;  4EJV A;  5KNL A;  3OYD A;  2K9Q A;  4CYD A;  2PFB A;  1HW2 A;  2WB1 A;  3RPU D;  2ELK A;  2OTJ I;  2IA0 A;  1JTX A;  3NRV A;  2DA2 A;  4KN4 X;  4N4N B;  1T33 A;  2O9L A;  3ZCO A;  1DPU A;  1BW5 A;  3JSO A;  2JK3 A;  3R0A A;  2DT5 A;  1I1G A;  1JKR C;  2DA6 A;  2DT7 B;  4IOA F;  2M0C A;  4AUX A;  5GAE J;  1XS9 A;  1XPX A;  2HYG D;  2UV1 A;  3FHN A;  2EV6 A;  1PYV A;  3OIO A;  5K7H A;  1O3R A;  2CS3 A;  2QYO A;  1MIJ A;  1ZG3 A;  2HFH A;  2I10 A;  3LSH A;  3MQ0 A;  4BXF A;  4J01 A;  4RAG A;  2COM A;  3PL8 A;  1I39 A;  2DJN A;  3ZRG A;  4F92 B;  4BXX J;  2FNA A;  3MKY B;  1EH7 A;  2P0W A;  1ETK A;  2KRH A;  1ZG1 A;  1Z3X A;  1USS A;  1H89 C;  3OYH A;  2W48 A;  2CMP A;  2KL4 A;  3ZGK A;  2HDW A;  2QQA A;  1QHH D;  2ACJ A;  1YRN A;  4U7D A;  4CSW A;  5DEQ A;  2R3S A;  1AHD P;  2XSJ C;  3HXL A;  5IY5 H;  2VJI A;  4E4H A;  4IF4 A;  1I50 J;  2NVT J;  1ZAO A;  3G1O A;  5JVG F;  2JWT A;  3VYS B;  2QA4 I;  2M7B A;  1KYW A;  2QQB A;  3QOE A;  2FBH A;  2I8D A;  2P5K A;  1LNW A;  5D5V B;  1B72 B;  3CDH A;  1R58 A;  3K1P A;  2EBI A;  2V1D A;  3CCS I;  1GXP A;  4HST A;  3L00 A;  3PQK A;  1XSD A;  1DQU A;  1R6R A;  4E7Z A;  2XIG A;  1ZQ3 P;  2Z5U A;  2MD0 A;  4XLE A;  3SJM A;  1QZE A;  2VLA A;  3I5U A;  2VUM J;  3PJR A;  2G7H A;  4I76 A;  3GW2 A;  1MDM A;  1VQL I;  3EDP A;  2CU7 A;  2IBD A;  4AIH A;  5EF6 A;  1W5T A;  2EK5 A;  4XLH A;  3ZN0 A;  3IRQ A;  4ZDL A;  1T98 A;  3GEZ A;  4DYQ A;  3JTH A;  1F4K A;  3ZMZ A;  5DDG A;  2EQR A;  4ZYG A;  4UXN A;  2DI3 A;  1YJN I;  1EJ9 A;  2ECB A;  3TKY A;  1T2K A;  2R0Q C;  5B1B H;  1TP4 A;  1UMQ A;  1A5J A;  5FFX A;  3A0B C;  1JI8 A;  4PUS A;  1WRJ A;  2UWM A;  4ZTF A;  2R92 J;  3ABM H;  1HDD C;  4CYC A;  1SVO A;  3C18 A;  2YX4 A;  3CCE I;  1MBG A;  4HSR A;  4E7L A;  3KZY A;  2DMU A;  5D5W B;  3F8F A;  3HSE A;  4MFE A;  2E1C A;  2AQF A;  3T1B A;  5J4Y A;  4EQQ A;  4LMY A;  1HLV A;  3AG4 H;  5J1Y A;  5E20 A;  3K4L A;  4FQG A;  3O2P E;  1A6Q A;  3A02 A;  4LK0 F;  4UB8 C;  4XLN F;  3BPV A;  4L5I A;  2WV1 A;  1QGP A;  1WJD A;  1X4P A;  1RNL A;  1K79 A;  2ISY A;  1TL8 A;  4A3F J;  1V5F A;  1XDS A;  3HOX J;  4M9S A;  4PSX A;  4BY7 J;  4KIC A;  2D1V A;  2M8E A;  1YIJ I;  1ZH5 A;  3BR0 A;  2L9N A;  1JJ8 C;  4HYE A;  2AXL A;  2ZXH A;  1D0X A;  5F1J A;  3QU6 A;  4IHW A;  3RJP A;  1ZN2 A;  2JVG A;  3HBL A;  4BHB A;  1TW2 A;  1FYM A;  2FOK A;  2CJJ A;  2YS9 A;  2R7W A;  3HKZ N;  3HOW J;  4OIO F;  3IRR A;  3KP5 A;  3PIO F;  3PO3 J;  3DPL C;  4RDU A;  1MH3 A;  5LEJ A;  1WJF A;  5LGN A;  3VOD A;  5FGM A;  1ZEL A;  3GZ6 A;  1LE8 A;  3W2A A;  3BG7 A;  1Z7L A;  3DTI A;  3WG9 A;  4G7O F;  3UNG C;  2K3P A;  2LOO A;  2FUG 2;  2P6S A;  4FCY A;  2L0K A;  3BG3 A;  5AON A;  3CF5 F;  4KNY A;  3E5U A;  2NVX J;  2DK5 A;  5HOD A;  1S7O A;  1U5T A;  4BY1 J;  2LSO A;  1XSV A;  1TQI A;  1LJ9 A;  3KP2 A;  4IQ4 A;  4NQW B;  2LKX A;  4IHY A;  1YIO A;  3KIO A;  5ILS A;  3L9F A;  2Y9Y A;  2I5U A;  1RR8 C;  1DP7 P;  3HOZ J;  3BT9 A;  1SAN A;  1FOX A;  1BI2 A;  3L2V A;  1K6O A;  2PMZ N;  4RM2 A;  4ENM A;  3P9K A;  3OV8 A;  2M45 A;  3HIF A;  2JSP A;  1WHU A;  1XN7 A;  2E60 A;  3OY9 A;  5DM7 F;  3GLX A;  3ZXS A;  1WI9 A;  2V9K A;  4L5J A;  3SDG A;  1W1W E;  3LSK A;  4B3A A;  1OQY A;  4P1W A;  2JUC A;  4BU2 A;  2MAB A;  3JRE A;  2Q2E A;  1O57 A;  5DD4 A;  2Q0O A;  1W7P D;  3L2U A;  4BBR J;  2A05 A;  4DBQ A;  4F52 A;  3CCY A;  4XLC A;  4UVC A;  3AAF A;  1V5E A;  1ZKG A;  3JRH A;  3FX3 A;  3QP5 A;  3ZQF A;  5LEK A;  1MBK A;  4LJZ F;  4BBS J;  2AXT C;  4AIK A;  3ZMD A;  4X0G A;  4ENJ A;  2A5Y B;  4OOI A;  4XM3 A;  4EJT A;  3D5R C;  5JLW A;  4MIM A;  2CQQ A;  1O3Q A;  1U9O A;  4L0Y B;  4LG0 B;  2LC2 A;  2V26 A;  3C2B A;  4IZZ A;  4JX6 A;  2KJC A;  2IT0 A;  3SQN A;  2Y0M A;  4N9H A;  2STW A;  1YE9 A;  4XBF A;  2ISZ A;  4IL6 C;  2HVQ A;  2BGC A;  4UY8 I;  1JTY A;  2KJB A;  3GYH X;  1ZLJ A;  4OIP F;  3A2K A;  2M0M A;  2IA1 A;  4PJL A;  1I27 A;  2IP2 A;  1Z77 A;  4TV7 A;  5DCM A;  5J40 A;  3IL2 A;  1FYL A;  4O5V A;  3I53 A;  4A5M A;  1T95 A;  2CWE A;  2V1N A;  1HW1 A;  3RKQ A;  3S3M A;  2O6G E;  1VF9 A;  1XMX A;  3WU2 C;  3M3Y J;  1V5G A;  3FXK A;  1LFP A;  4L9T A;  2WAD A;  3DPT A;  4M3B A;  1R71 A;  1VQ4 I;  4RGS A;  3DTE A;  2PBI A;  5IP6 A;  2PLY A;  4BQQ A;  2A69 F;  2DPD A;  3LSI A;  4KIT B;  3GX4 X;  4KUM A;  1D1A A;  4ON0 A;  3T8T A;  2QBY B;  4O3M A;  1I6H J;  2VQC A;  1E3H A;  1KA8 A;  3ECO A;  3G2B A;  1G59 A;  3PUF A;  4L18 B;  1O4X A;  1XCV A;  3GTO J;  5GAH J;  1Q1H A;  3A03 A;  5K5O A;  2KRF A;  5EZG A;  3RI4 A;  3GTP J;  2GOX B;  1M1E B;  1YYV A;  2HPI A;  2JPC A;  1F43 A;  2DPU A;  2OQR A;  4XID A;  4D1Q A;  1OYY A;  1Y0U A;  5L3C A;  3FF5 A;  1A31 A;  4JX5 A;  4XOP A;  3RIR A;  4ENK A;  4A0Y A;  2H8W A;  1U3E M;  5DUK A;  4FET A;  1X1D A;  2K27 A;  2IXS A;  1TTY A;  2W85 A;  2NS0 A;  5HS9 A;  2KIF A;  3WTX C;  2EFQ A;  4M9X A;  2EV0 A;  2DMQ A;  1L0O C;  1T6S A;  4HQE A;  2EZK A;  5CVV A;  1IZ1 A;  2VQH A;  2ESH A;  2XAH A;  3AG3 H;  3RYP A;  1K83 J;  2DTZ A;  5L3G A;  2P6T A;  5IOZ A;  2LFB A;  2UZK A;  2L7Z A;  5C4X J;  2ZXJ A;  4M6V A;  4XLF A;  4HAM A;  3M8J A;  4C3H J;  3CC2 I;  5E1Z B;  2JSC A;  3G6E I;  1EH8 A;  2WY7 Q;  3BP8 A;  1X4O A;  3S32 A;  4DQ2 A;  4I6Z A;  1RZ4 A;  2OZ6 A;  1P9Q C;  1QZZ A;  4UV8 A;  4U0Y A;  1VQ5 I;  2FJ1 A;  1ENH A;  2LBF A;  2R5Z B;  4PDK A;  1W7P B;  5HNH A;  2IPQ X;  2L2O A;  4U87 A;  2M8G X;  1IV6 A;  2X1D A;  2Y31 A;  2VI6 A;  3BCB A;  4I7H A;  2EIN H;  2N8G A;  1SAU A;  1DGR M;  2BOL A;  5LD2 C;  4EGZ A;  1YOV B;  2DMT A;  4F3Q A;  2TDX A;  1YW7 A;  4RLF A;  5LGU A;  2M87 A;  2HXI A;  3HOU J;  1WJA A;  1BA5 A;  5L3E A;  4H0E A;  1F9N A;  4ANJ A;  1LEA A;  1R49 A;  4IQJ A;  5LFA A;  2EWN A;  2OCE A;  2ZFU A;  5J3L A;  2CQK A;  1WZ2 A;  5ICC A;  4ESJ A;  1QO0 D;  4Y52 J;  4NC6 A;  4V2G A;  1JUM A;  2CYY A;  3DTK A;  4ZDP A;  2NVQ J;  1NH3 A;  2B0L A;  2CQN A;  1GV2 A;  1PJR A;  4R8H A;  2V7F A;  2VBZ A;  1WJE A;  3CMY A;  2GA1 A;  2JZY A;  2E1N A;  2XRO A;  1Z1D A;  2ZBK A;  5KAI C;  3VYR B;  2NS7 A;  4HNU A;  2KZG A;  2HYF A;  5C3E J;  2B9S A;  2DFH A;  3L1P A;  2R7Z J;  2WBM A;  1PDN C;  3WGH A;  4Y33 A;  2F48 A;  3EET A;  1F36 A;  4RBO A;  3PIP F;  5D5X B;  1ZR4 A;  1J0R A;  1R36 A;  2R7O A;  4UUS B;  2C6Y A;  4J19 A;  4IJA A;  5EGO A;  1ORK A;  1A6I A;  3WTV C;  4EEF G;  1LDK B;  4BGD A;  1FBU A;  2DA7 A;  1YW9 A;  2AQE A;  2OD5 A;  4MHG A;  3BR6 A;  3GTL J;  3S14 J;  2BXZ A;  4IHX A;  3L7W A;  1D0Y A;  4OU0 A;  1IJW C;  2EJR A;  3CJT B;  1MMD A;  1UHM A;  5D5U B;  1O7L A;  3SZT A;  1KU9 A;  1FWZ A;  3LWF A;  4GDF A;  2VQL A;  4DJA A;  5FKM A;  3CZ6 A;  2K9L A;  3KP3 A;  1X3Z B;  2OZU A;  1XGN A;  5HS7 A;  4BEH A;  5LGT A;  3PQJ A;  2XRN A;  1F5T A;  2KIU A;  3FKJ A;  1B1B A;  2NRA C;  3IV5 A;  2FOW A;  3CP2 A;  2EB7 A;  2GOM A;  2R7X A;  1X1B A;  3VSK A;  2GBY A;  1ITY A;  5J8C A;  3VB2 A;  2CO5 A;  1FOW A;  4UVB A;  1MNM C;  5GP9 A;  4OAY A;  5KK1 A;  3TGN A;  2FU4 A;  3KLO A;  1FP1 D;  2PI0 A;  4D5F A;  5EG0 B;  4LGW A;  3KPH A;  4WXD A;  4M3D A;  4N4O B;  3N4M A;  1LUJ B;  3SFZ A;  2VQG A;  4ZZL A;  2FD5 A;  2JMW A;  2F4M B;  2P7V B;  4KA4 A;  4WXC A;  3WTU C;  4M6X A;  4CDG A;  4XRS G;  3JRI A;  1ODD A;  1YI2 I;  4A3G J;  1R4N B;  3V8K A;  4XRF A;  2CUE A;  2Z99 A;  3FXM A;  4DZJ A;  5JI6 A;  2DMN A;  3Q9V A;  3TBI A;  4KIG A;  2CQ7 A;  3OIP A;  1HBX G;  3LFU A;  4YII A;  1MMG A;  4Y17 A;  4X6A J;  1VQP I;  1T0F C;  1OCO H;  3DBL B;  3KEO A;  2GXB A;  3U1K A;  3GME A;  5CVJ A;  2HPM A;  2HEO A;  1EA3 A;  2RAE A;  2LLK A;  2QGU A;  1IC8 A;  2BV6 A;  2LH9 A;  4GRI A;  3HM5 A;  5ICE A;  1ERD A;  3GTQ J;  2KMU A;  2H6B A;  5DUI A;  2XAS A;  3JW4 A;  3CDL A;  3R0J A;  3CME I;  2JA7 J;  4HX8 A;  1B72 A;  1Z0X A;  1BOB A;  1ULY A;  5J1R A;  2IS4 A;  4M71 A;  2LR8 A;  3S1R J;  1UCR A;  4BQN A;  2XHK A;  3FDY A;  1Z3Y A;  4MEY F;  4XNF A;  1MSF C;  1V3F A;  4ITV A;  1HKT A;  1E17 A;  3ZOB A;  4RB0 A;  4Y7N J;  4HZF A;  4BL0 B;  1DU0 A;  1ZAR A;  2K02 A;  4BJT A;  2ESN A;  5J6X A;  3HPG A;  3QP6 A;  1LDJ A;  1FMV A;  4IEJ A;  1ZG5 A;  1NK3 P;  4IXA A;  1WVR A;  3ML6 A;  2XF6 A;  2ZXI A;  1J9I A;  3I4N J;  4Y15 A;  3BR2 A;  1VQN I;  4BHP A;  4BQO A;  2L7K A;  1HXD A;  5ILU A;  4RMN A;  2AO9 A;  4ZDO A;  1XB4 A;  1ETV A;  2PX9 A;  3E1S A;  4DBR A;  2BY0 A;  4XSX F;  5F08 A;  3HHG A;  4ESB A;  1MJA A;  3FXR A;  1J59 A;  1UFM A;  2HYJ A;  2OUM A;  3FIW A;  3HUG B;  5DYM A;  2WAF A;  3H5A A;  2L9V A;  1AKH B;  1AU7 A;  1O3T A;  4A93 J;  1UB9 A;  3ZQI A;  2EPF A;  1KU3 A;  4YFK F;  3Q5F A;  2BE5 F;  4P96 A;  3MKZ A;  3OSG A;  1A35 A;  3CLQ A;  3ABT A;  4WK8 F;  3K4K A;  1MH4 A;  4LIV A;  3RPU A;  3GO5 A;  3ONQ A;  4ZH4 F;  3WU1 B;  1IDY A;  3T5X A;  4ZYA A;  5FB2 A;  4AIJ A;  2IS6 A;  3CJN A;  1MMS A;  1JKO C;  1WGX A;  4D7M A;  2W4S A;  3GLL A;  3HHH A;  3VWB A;  3W2W A;  2ECC A;  1FP2 A;  2ZNZ A;  5FRO A;  1H88 C;  2DCE A;  4HRI A;  3GFI A;  2V79 A;  1KQ0 A;  3BOQ A;  5D8L B;  3BR5 A;  2LDU A;  3HOS A;  2AS5 F;  4HV6 A;  1WWX A;  4PZJ A;  3C1D A;  5FKN A;  2R5Y B;  4RAY A;  5F0C A;  1QRY A;  1TNS A;  3IWZ A;  3ULQ B;  3MD2 A;  2BVM A;  2W25 A;  4YIR X;  1TWH J;  3M9A A;  1T08 B;  2L9S A;  3OR2 C;  3ZP5 A;  5GAD J;  1D1C A;  1HOM A;  3E5X A;  3CDI A;  1ZLK A;  5DM6 F;  1VZ0 A;  2F5F A;  4LFU A;  1OCR H;  4CZZ A;  1I6X A;  5E79 C;  2XUB A;  2DA5 A;  5F1R A;  3ABU A;  4OIQ F;  3FKI J;  1TWA J;  4MO7 A;  2O5R A;  1FSH A;  2IJL A;  3HKZ A;  3GCM A;  3LOC A;  5F27 A;  1IN5 A;  1XTA A;  4BXU A;  2F2E A;  4XKV A;  4BAY A;  1QNT A;  2K5C A;  1DPR A;  3Q9S A;  2LF7 A;  2KIS A;  2ZB9 A;  3K4J A;  2KLO A;  2NS8 A;  4XON A;  4D9J A;  2NVY J;  2VBW A;  1KU7 A;  2BYV E;  3BTJ A;  2MFZ A;  2QEX I;  4AM3 A;  5FKK A;  3TOA A;  1APL C;  2A07 F;  2DFE A;  1G4D A;  5BS6 A;  1LKX A;  1OCZ H;  4OMY A;  2E35 A;  4MTE A;  1VQO I;  3Q3S A;  4M3F A;  1ON1 A;  3J7A Y;  2HS5 A;  2R7F A;  2Y75 A;  2DOF A;  4C30 A;  4PJM A;  2PMZ A;  4XN0 A;  2X48 A;  4A69 C;  3SDB A;  5B3S H;  2VOD A;  2M7A A;  2QQ8 A;  3OYE A;  4HW0 A;  1H0M A;  1W5C C;  4QWQ A;  2JA5 J;  4DYC A;  2VBX A;  4HX7 A;  4I02 A;  1JHH A;  1WJB A;  3I54 A;  2ZSI B;  3ZN1 A;  2XSD C;  2X6O A;  3E0J B;  2QVO A;  4JK1 X;  1FNN A;  5D4R A;  4GYG A;  4UUT A;  1O3S A;  2J5P A;  2QSG X;  2FSW A;  1LVA A;  1HST A;  2HZD A;  4XQF A;  1Z9C A;  4LG0 A;  1MD0 A;  5J8F A;  1RES A;  4Y13 A;  2CRG A;  2E71 A;  4RA2 A;  1UEL B;  3KYD B;  3GTM J;  3I59 B;  1MJB A;  2TCT A;  2IS1 A;  5EYR A;  2XKP A;  2D1H A;  2KDO A;  2L01 A;  1BR4 A;  4YEJ A;  5K5R A;  5CLS A;  4IKF A;  1UZC A;  1FIA A;  2EZL A;  1U9N A;  3F0C A;  2ETH A;  3LA3 A;  3WHC A;  1D8J A;  4EVI A;  4IO9 F;  1TW3 A;  4EV0 A;  2ZO4 A;  5F0H A;  1J09 A;  2KPM A;  3FWE A;  3GFJ A;  2XRL A;  1ONV A;  3NWS A;  2QBY A;  2QF7 A;  5D8K B;  2Y69 H;  5M3F J;  1G3Y A;  2CSO A;  1Y8R B;  4G7H F;  4E70 A;  1X1P A;  3S1Q J;  3CTA A;  1J7K A;  3TL4 X;  1OKR A;  2RDP A;  1Z67 A;  3KET A;  2G9W A;  1S9H A;  2HOS A;  3DEE A;  2CUF A;  1NG7 A;  3K70 C;  5KVR A;  2XGC A;  4PGH A;  4RB3 C;  1LPQ A;  5H20 A;  2X1C A;  3GZ5 A;  4LLN A;  2TRT A;  4A3B J;  3TED A;  2FXA A;  2HQR A;  3MAJ A;  2OJE D;  4RGX A;  5HLH A;  4GYI A;  4Z2Y A;  3DBH B;  3NEU A;  2GLO A;  1OIS A;  1IXS B;  1X1C A;  1BL0 A;  4G94 A;  1SD4 A;  2JA6 J;  4AVP A;  4UNO A;  1SD7 A;  3LAJ A;  4JP0 A;  1U6G A;  2DQR A;  1MNE A;  2MLK A;  2L9R A;  3K4C A;  3OWT A;  4HX4 A;  4B48 A;  4CCO A;  1B8I B;  1GDT A;  4N0B A;  3L2C A;  3TW6 A;  1R4M B;  2HNH A;  2GXG A;  2RVC A;  4ZYD A;  3MZY A;  2V4J C;  3OYF A;  3OSF A;  3MWM A;  1XX5 A;  3FMS A;  1ETQ A;  4XOR A;  4BE0 A;  1YFH A;  3U1D A;  3RPQ A;  2WAE A;  3GFM A;  2E2I J;  3TO6 A;  1EKE A;  2VE8 A;  2CH0 A;  3D5L A;  4CCN A;  3LL7 A;  3OL4 A;  2NXN B;  2GWR A;  3HZJ A;  1Q1V A;  3E6D A;  1HCR A;  2R5Z A;  3V42 A;  3IUO A;  1W7P A;  2EA2 A;  1ZRC A;  5E1W A;  1P7I A;  4YEL A;  4BQA A;  3RKW A;  4GXO A;  2M1B A;  2FNP A;  2FQ3 A;  3M07 A;  3RQ4 A;  3I55 I;  1G3T A;  2VKD A;  4PJN A;  4YG2 F;  3W2V A;  2IGN A;  3V7R A;  3GVA A;  1EF4 A;  1ZYR F;  4OWR B;  3ZR8 X;  2DOA A;  4LB5 A;  3CC7 I;  3G3Z A;  3PM1 A;  4PJJ A;  2XC7 A;  4A3K J;  2VIX A;  3CUQ C;  2Y9Z A;  1R23 A;  1W0T A;  1R5G A;  3OS1 A;  3F21 A;  2CW8 A;  1WQ2 A;  2X9D A;  3FIS A;  4RLQ A;  5JVT A;  1QHG A;  3DU6 A;  3FZV A;  3J80 Z;  2W7N A;  1DDN A;  3MFK A;  1MBH A;  3IAS 2;  1SD5 A;  1LFU P;  2K3F A;  1HDP A;  1BN5 A;  2ME6 A;  2ZME C;  1R1U A;  3DWL E;  4LLG F;  2PJR B;  1TQP A;  2LRD A;  3OYN A;  2E19 A;  1OYW A;  3QYF A;  3VEP A;  4JX4 A;  1S72 I;  4S04 A;  1CF7 B;  4MQV A;  2X0L A;  4EM0 B;  1DP3 A;  3HJE A;  3CCL I;  3KEY A;  4QPQ A;  5DTD A;  1RKT A;  4OIN F;  1DGW Y;  1QPI A;  4LIU A;  4I99 C;  2QKL B;  3IAM 2;  3S17 J;  4CCK A;  2CV0 A;  2EV5 A;  1W0U A;  5FKO A;  1E0E A;  2QEN A;  4U88 A;  5D4S A;  3CUO A;  2M3A A;  1XMK A;  1W5S A;  2H8R A;  4UUS A;  3VSL A;  3E5Q A;  3RKX A;  1ZGW A;  3WE2 A;  2VN2 A;  1P4X A;  2ELH A;  1BC7 C;  3M8F A;  1S7A A;  2HI3 A;  1ZTR A;  3FXL A;  2Z9O A;  4LLL A;  5HVQ C;  1P7J A;  4L9N A;  2K9N A;  3H3Z A;  4IRI A;  5E8I A;  2KP6 A;  2FE3 A;  1EV7 A;  4XRM A;  4LD5 A;  3IKV A;  2EIM H;  1JT0 A;  1X3W B;  5IYB J;  4UVA A;  2CG4 A;  4L9J A;  2PMH A;  3T0Y A;  4FX4 A;  1KQ8 A;  2BBY A;  2L5Q A;  1G3S A;  4DOZ A;  2IEK A;  4UHT A;  2MBF A;  4XKW A;  4ZC3 A;  1STZ A;  2A6T A;  1RKW A;  2DO7 A;  4I09 A;  2E34 A;  2DYR H;  1D5V A;  2FMY A;  3DP7 A;  2KQR A;  3CO6 C;  4KIB A;  3LSG A;  2NNY A;  3S2H J;  2EA4 A;  5FLM J;  3SZP A;  3BCA A;  4RB1 A;  2ZNY A;  3LNQ A;  3TDU C;  2RNJ A;  3C7J A;  3F9K A;  1MBJ A;  3V8J A;  3BTL A;  2FQ4 A;  5M5X J;  2V1X A;  1ZGJ A;  5CPR B;  1L3L A;  3HEF A;  2E2J J;  1Y1V J;  4Q47 A;  3I3L A;  3PNY A;  3QOD A;  3NQO A;  3F6O A;  3HSR A;  5C4J J;  3LAP A;  2QUF A;  2IGO A;  2XGX A;  4B3X A;  2LG4 A;  1N75 A;  4G6D A;  1JT6 A;  5EG0 A;  1QU3 A;  5D6E A;  5K7F A;  2M34 A;  2YU9 J;  1A36 A;  3IH3 A;  4CZC A;  5FJ8 J;  3R60 A;  2DBB A;  3QPL A;  2ZJ2 A;  2DFI A;  3FK6 A;  3OYJ A;  3S15 J;  3CUQ B;  4B1R A;  2WAQ N;  4H4K C;  2NYX A;  3ZQG A;  2MC4 A;  2PMU A;  5M3M J;  1U0J A;  3RZO J;  1R00 A;  1OR7 C;  1ZHF A;  1RET A;  4O6J A;  2K9S A;  4AWX B;  4D7N A;  2M4G A;  3QYB A;  3K7A J;  3O6B B;  3WGI A;  1VQ8 I;  2H94 A;  1JUS A;  2ZME B;  3OOP A;  5HOO A;  3H0G J;  2VKH A;  2LTP A;  2X51 A;  1IN6 A;  2QKM B;  4BH9 A;  3PSF A;  3VPR A;  4W97 A;  4AVZ A;  3J80 K;  4FE7 A;  1HF0 A;  4CXF A;  2H1K A;  1UST A;  1X19 A;  2XDV A;  3L09 A;  4FAS D;  4NHJ A;  2JA2 A;  1Y39 A;  1TWG J;  1S29 A;  2P7C B;  1FOK A;  5KHD A;  2W84 A;  3BQY A;  1VND A;  1FSE A;  3OYK A;  2M2E A;  3HTS B;  1F1Z A;  3CCV I;  5GAG J;  1WSU A;  4G12 A;  2HOT A;  2B7E A;  1R7J A;  3KE2 A;  4A6D A;  4C2M J;  1J2X A;  2OV7 A;  1P2F A;  4ETS A;  5HLT A;  3HG9 A;  3BJ6 A;  3WTT C;  3WHB A;  2E36 A;  2RNG A;  1VQ7 I;  1AOY A;  2A68 F;  1HQC A;  2VXZ A;  4A2U A;  3K4N A;  2VJ4 A;  1U78 A;  3SXY A;  5GTH C;  2GQQ A;  2F5D A;  3S1M J;  1K78 B;  4OIR F;  3PFY A;  1WJC A;  2LRE A;  2Z16 A;  3CJR B;  3F8B A;  2CQX A;  2DFF A;  2VB6 A;  6PAX A;  1S8N A;  2IGK A;  4HV5 A;  4DNC A;  3IWF A;  5FLV A;  2WY8 Q;  2KIQ A;  2WV0 A;  4UUV A;  3S16 J;  3B6C A;  1SD6 A;  3NAU A;  2P81 A;  2R7D A;  2LY9 A;  4BNC A;  2VT3 A;  4HF2 A;  4AU7 A;  1X2M A;  4RM3 A;  2L54 A;  3OIQ A;  1FMW A;  4BHC A;  2KKO A;  4CCJ A;  1K61 A;  4XKB A;  3I4P A;  2E1O A;  4HPQ A;  1AKH A;  1TNT A;  2CFX A;  5ED4 A;  1IGN A;  3V7S A;  4M6Y A;  2ICW G;  2XAG A;  2HU9 A;  2V9V A;  2BY2 A;  2CUZ A;  3K2Z A;  5HNF A;  3PNV A;  3HB9 A;  5F64 A;  5HLI A;  5FRM A;  1IW7 F;  1K6Y A;  1R1V A;  3GXO A;  4XMY A;  1XMA A;  4JYK A;  5GPC A;  5EEA A;  1YO5 C;  3DLL F;  4E7K A;  1BR2 A;  4A3M J;  3G4S I;  1NK2 P;  3B02 A;  5H6Q A;  3WOD F;  3HRM A;  2PG4 A;  1JE8 A;  4GGG A;  4A3D J;  4P9U A;  4HF0 A;  4NDL A;  1IO2 A;  2F5E A;  1V54 H;  3FXJ A;  3QU3 A;  1PUF B;  1ZR2 A;  4GFB A;  3PUB A;  2STT A;  4I2O A;  2MYS A;  1TZL A;  2V1U A;  2RRE A;  1MKM A;  3CCU I;  2H27 A;  4NNJ A;  3E7L A;  2QSH X;  3BZ6 A;  5HDG A;  2ID3 A;  4P5O A;  4BE2 A;  1T0F A;  3FMR A;  4KT5 C;  3I4M J;  4BE1 A;  1N77 A;  2LKS A;  3MZH A;  3F6V A;  2R5Y A;  2BVL A;  2O8K A;  2MG4 A;  4RS8 A;  5E18 F;  1MZB A;  2HKX A;  5LBQ A;  1X1A A;  4C9Y A;  2R4G A;  2R7U A;  2GIZ A;  3NWT A;  1B9N A;  2W00 A;  4XLA A;  4AID A;  2Q8K A;  4A3C J;  4LK1 F;  4WCG A;  1HA8 A;  2K40 A;  4HG2 A;  4XRS A;  2DDB A;  1ZRF A;  5BPD A;  4F55 A;  2X6Y A;  3BZC A;  4FX0 A;  4XSZ F;  3I0T A;  3KZI C;  1FJL A;  2XKO A;  5LHH A;  3L2W A;  3BRO A;  4M3G A;  1A04 A;  3HL2 A;  4CHU A;  2DYS H;  1B6A A;  3ZMV A;  3MZ8 A;  4U0V A;  3DQV C;  2EH3 A;  5DD8 A;  3CC4 I;  1GXQ A;  1FT9 A;  2HQN A;  4KYW A;  1HW5 A;  2Y30 A;  1X3U A;  1Z6T A;  4F93 B;  3WG7 H;  4X1E A;  4J00 A;  3IC7 A;  2VBY A;  4G6T B;  4CA0 A;  5F0F A;  2COB A;  3U2R A;  2K85 A;  1WFX A;  2HQ5 A;  4JQF A;  1RR7 A;  4I98 B;  2LNB A;  2OQG A;  4WWC A;  5IPA A;  1IRX A;  2IAI A;  3ASN H;  3ABK H;  2QWW A;  4IPA A;  1VFC A;  2EZH A;  2UXN A;  4DGW B;  2IGM A;  5K5Q A;  3OOU A;  2HXO A;  4BKX A;  4HDU A;  2QCO A;  3RKY A;  5E3O A;  2NOG A;  2NVU B;  3A01 B;  3QPH A;  2BZT A;  4NBQ A;  1G3W A;  3E97 A;  1JHF A;  3MKL A;  4CGZ A;  3I59 A;  4S05 A;  1YS7 A;  3S8P A;  4YFX F;  1D3Y A;  3CMM A;  3DEU A;  1YG2 A;  1PUE E;  1D5Y A;  2R7S A;  4JOM A;  2A6H F;  2E5Z A;  3HTU A;  3FMQ A;  4E7I A;  4C2T A;  2XB0 X;  3WTW C;  3AG2 H;  3WU0 A;  3OYC A;  1OCP A;  4E7J A;  2ID6 A;  4U0W A;  4R79 A;  4Q4Z F;  2LD5 A;  3WTS C;  2LY2 A;  1BBY A;  4XL9 A;  2QLZ A;  3TP3 A;  2R93 J;  2PEX A;  3KEQ A;  3H9J A;  3ZMT A;  2XAU A;  4G9Y A;  3V4G A;  4PK4 A;  1BJZ A;  1IXR C;  2L7M P;  1JKP C;  1JXS A;  2M9H A;  3RTR A;  1ON2 A;  3C2H A;  2QQ9 A;  3OYL A;  2MC3 A;  2F6C A;  4MLO A;  3M1E A;  1LEB A;  4IVN A;  4DYR A;  3EUH C;  4II2 A;  1UJ8 A;  4EJW A;  4PJ0 C;  3H36 A;  3JRC A;  3K6G A;  1OPC A;  1E3O C;  2E5N A;  1ETW A;  5AIP A;  3AKZ A;  2RKH A;  4NC8 A;  1SVM A;  1QZY A;  4EJU A;  3IKT A;  2JQ7 A;  5IYC J;  5BPI A;  3CF2 A;  1U2W A;  1MND A;  2MSY A;  4B43 A;  4RGU A;  3DCF A;  1R22 A;  3SZG A;  2EIK H;  3DEW A;  4C3J J;  2HGC A;  4B44 A;  1B8I A;  4L9V A;  5IT3 A;  3DF8 A;  4S0H B;  1DUX C;  2VKV A;  3JAM Z;  1REP C;  4XR6 A;  5TGT A;  4A3I J;  3AL0 C;  2VJ5 A;  3TMO A;  3F3X A;  1SFO J;  3BDD A;  1ETX A;  3OL3 A;  4HF1 A;  1HSJ A;  1HKS A;  2JUG A;  4WX9 A;  4BJ5 C;  2VXD A;  5J47 A;  2P8T A;  3H0D A;  2E7W A;  1KZH A;  3O8G A;  4A0X A;  3HSF A;  4Y4R A;  1K7A A;  5K7Z A;  3BG5 A;  1NG6 A;  1P92 A;  2BW3 B;  2W1O A;  5BQT A;  1IUY A;  4KFC A;  4NQW A;  2Y0S N;  4BDZ A;  3CLO A;  3EQL F;  3RQI A;  4EM2 A;  3LFK A;  3G1L A;  3P7N A;  5CQE A;  3W3C A;  2RV8 A;  3COA C;  1SEU A;  4KMU X;  2ZJP F;  4BS9 A;  2IS2 A;  3CJQ B;  3KLN A;  3QPT A;  2M4K A;  3K1M A;  3WTY C;  2XPU A;  1WJ5 A;  4D5C A;  1ZGA A;  4LG3 A;  2ZC2 A;  4CCL A;  1Y8Q B;  3RCO A;  1KU2 A;  3LST A;  2BY1 A;  3B73 A;  3H5R A;  3QOP A;  1XCB A;  2FRH A;  2ELJ A;  2VC0 A;  1XD7 A;  4HNT A;  5KAF C;  4MEX F;  4QTR A;  2CW0 F;  2DA3 A;  2PQ8 A;  3C3W A;  1GUU A;  1TWC J;  4ZTJ A;  2LKP A;  4DW6 A;  3WTZ A;  1MBF A;  3ZQL A;  5KCM A;  2PJR A;  3SYT A;  5F6F A;  1J5Y A;  3WGG A;  5CVR A;  2XAF A;  1T38 A;  1CF7 A;  5H6R A;  4U7B A;  1Z21 A;  3M1C A;  3TOB A;  2V6E A;  3ROU A;  1OJL A;  1FBQ A;  1CGP A;  2LMD A;  4V19 K;  1N78 A;  3X2Q H;  4ENN A;  3H1C A;  5B66 C;  2K4J A;  1R5I D;  1TBX A;  3ZQC A;  1IDZ A;  4FE4 A;  1YLF A;  5BOX A;  2KZV A;  3DLA A;  3BC8 A;  1SFK A;  1VTN C;  4JBA A;  3DU5 A;  1ETY A;  3F8C A;  3UR3 C;  3SEZ A;  3MEX A;  2ZSH B;  2MGQ A;  2VT2 A;  1FLI A;  2XF5 A;  4PGG A;  3GUD A;  4MGR A;  4M72 A;  2VC1 A;  1YQA A;  1UHW A;  3JRG A;  1TWF J;  4C2U A;  2X1E A;  2VPL A;  1W36 D;  1MBE A;  1RUN A;  3M7G A;  1AWC A;  2CV1 A;  2DTR A;  2OC6 A;  1GV5 A;  2XPW A;  5J1U A;  3TP0 A;  1RIO H;  2HDC A;  4HLY A;  1TT5 B;  1YS6 A;  2WC2 A;  4A12 A;  1P4W A;  1OMI A;  3K70 D;  1IG7 A;  3DKX A;  2G0E A;  1NTC A;  3BR1 A;  4KN7 X;  3H5N A;  2DMP A;  1W36 C;  2EIJ H;  3AL0 B;  1BW6 A;  3CCR I;  3TQN A;  1QVU A;  4HNV A;  3IHU A;  4II3 A;  2MA3 A;  2ZKZ A;  3K9T A;  3E3V A;  3JAM K;  5CYV A;  5IP9 J;  3CES A;  1FZP B;  3BR3 A;  3K4M A;  3IH2 A;  3CCM I;  5E8G A;  1S5L C;  2RGV A;  3EYI A;  1LVK A;  3NAR A;  2V6C A;  2OTL I;  4CCM A;  4XLP F;  1HC8 A;  3H9G A;  4A3E J;  3BLY A;  3LSM A;  4AYB N;  3G71 I;  3G1M A;  3BG9 A;  2MH2 A;  2L4M A;  2YX7 A;  1BM9 A;  4E7H A;  5IOY A;  3ZPL A;  1G2H A;  1SVL A;  2P5V A;  1B9M A;  3S93 A;  4NC7 A;  4ZZD A;  3EPZ A;  4WXH A;  2DN0 A;  4A0Z A;  4BUP A;  1GT0 C;  5GPA A;  1R5H A;  2KIM A;  2OAZ A;  1MMN A;  2DLL A;  1SFX A;  2EFP A;  1FTZ A;  1MMA A;  3CUQ A;  3TW7 A;  2KDZ A;  2WB1 N;  3EUA A;  4YIF A;  2F5V A;  1RI7 A;  1V4R A;  3DKW A;  2CGP A;  1QQI A;  2IRF G;  3BTC A;  1B4A A;  4HQM A;  4EM1 A;  1IF1 A;  2HWV A;  4B4C A;  2FBI A;  2Z2S B;  5JFR A;  4KT6 A;  2ZME A;  3I56 I;  2MD5 A;  1S6L A;  1T56 A;  2K4B A;  2VKE A;  3GTG J;  5DS9 A;  2E7X A;  3KCC A;  2G7U A;  3TO9 A;  2YSR A;  3RDI A;  3RYR A;  3BJO A;  3TO7 A;  3ZMU A;  2WAQ A;  4A6E A;  3R4K A;  3RSN A;  2P5L C;  4IHV A;  4B8X A;  2ADU A;  3ERM A;  2CV2 A;  4ZJZ A;  1FEX A;  3B6A A;  1KQ9 A;  1J75 A;  5D6F A;  4XKC A;  1QPM A;  3BQZ A;  3M4O J;  2F4O B;  1PP7 U;  2HVS A;  3JTG A;  3T8R A;  5L3D A;  4IHS A;  1IN7 A;  3CD6 I;  4PFO A;  4HBL A;  2HOA A;  1W4M A;  5LLQ A;  3JRF A;  2RC4 A;  5LHI A;  2FX0 A;  2Y2Z A;  5BMZ A;  2XVC A;  1YIT I;  3LSR A;  1QVT A;  1MSE C;  4ZYH A;  2VAS A;  2GZW A;  5BNG A;  4MQ9 F;  4PCQ A;  3P9C A;  3O8H A;  5FRN A;  1B59 A;  2GIV A;  3HGG A;  3H3U A;  5F04 A;  2DA1 A;  3H35 A;  3L2R A;  1K78 A;  4XIC A;  1CQT A;  5H2F C;  3D0S A;  2VON A;  3ISP A;  3S3N A;  2V9P A;  5CKT A;  1U8R A;  2KFD A;  1WKM A;  3KP6 A;  1YRN B;  3QWL A;  1H9T A;  2MLG A;  2UXX A;  2VOP A;  4N9I A;  2QSF X;  2E2H J;  2XGE A;  1FIP A;  1OYI A;  2OCC H;  3I71 A;  3OMY A;  3QRF F;  1YX5 A;  4BAC A;  3GTJ J;  2O3F A;  1K4T A;  5L3F A;  3GBG A;  1VQ9 I;  2DA4 A;  1XDU A;  4IX7 A;  1U5T C;  3KYL A;  3LMM A;  5ERI A;  3VDX A;  1LB2 A;  3GF2 A;  1LDD A;  4MTD A;  3BJA A;  3KFW X;  5M5W J;  1Z7U A;  1MDM B;  3PFI A;  4RAZ A;  4QSH A;  2QZ8 A;  2XF7 A;  3K1N A;  1YTY A;  3CCQ I;  3M8E A;  2NOJ B;  1WH5 A;  2JRT A;  4P55 A;  1XGM A;  5IP7 J;  1R1T A;  2O8X A;  3BPX A;  3V8L A;  2XGD A;  1ETO A;  4EJO A;  4KJZ A;  2QM3 A;  1OR7 A;  4F7Z A;  2HKO A;  1PUF A;  3JSP A;  2JN6 A;  4YRV A;  5LRS A;  3HPH A;  1WI3 A;  1G6N A;  2DU9 A;  3W6J B;  2Y48 A;  5AIQ A;  2GAU A;  1GVJ A;  1BJA A;  1YJ9 I;  3I58 A;  4CYC B;  1S3J A;  5E3M A;  2O61 A;  2H1L A;  4UB6 C;  5CJ9 A;  2K86 A;  1FTT A;  1TC3 C;  2X6X A;  1I3Q J;  2JA8 J;  1XGS A;  5HS8 A;  3ZQ7 A;  1OLT A;  1Y0N A;  4IRH A;  4FIS A;  2FML A;  4DZP A;  1EH6 A;  3K10 A;  4ABZ A;  4L5E A;  3LQR A;  4M73 A;  4EMS A;  4XN3 A;  4F91 B;  3J81 Z;  2O03 A;  3PNT A;  3HOV J;  3FM5 A;  1JJ6 C;  4HDV A;  3Q0V A;  3V7C A;  3ECH A;  5E3N A;  2K9M A;  2IVM A;  2HDD A;  2H6C A;  2L4A A;  3S2W A;  3LSP A;  4G7Z F;  3LQQ A;  1IRG A;  5E17 F;  2L02 A;  2HVR A;  1SAX A;  4OAZ A;  1FPQ A;  3P9I A;  1V55 H;  1I5Z A;  5ICF A;  3HRT A;  1VI0 A;  2XPV A;  4M74 A;  3I64 A;  2FBK A;  2VJJ A;  3ABL H;  3LA2 A;  2DXI A;  1VQM I;  2VE9 A;  4CH7 A;  4EGY A;  1XC5 A;  5ILV A;  5DCF A;  3J7A O;  2WA0 A;  2Z33 A;  1LE8 B;  1T8I A;  3IP4 B;  4RAF A;  3FXQ A;  1D1B A;  2X4H A;  2DDA A;  5K1Y A;  2MW8 A;  2EIL H;  5LHG A;  3MN2 A;  4PSW A;  2LF8 A;  5FKL A;  5EDN A;  2Q1Z B;  2L7F P;  3KZZ A;  1BI0 A;  2XB5 A;  3Q0U A;  2XAJ A;  4HEA 2;  1BIA A;  1MW7 A;  2X6W A;  3ZMS A;  1VQK I;  1U5T B;  1JGS A;  3QQA A;  3CMA I;  5TRD A;  1KON A;  3QPS A;  2EFW A;  1BC8 C;  1PP8 F;  1ACI A;  4D0P A;  4R1H A;  5HDK A;  3A01 A;  3EUK L;  1XGO A;  3D1N I;  4MNU A;  1JUP A;  1P6R A;  1Y6I A;  1H8A C;  2R7V A;  2LP0 A;  2D45 A;  4P9F A;  4B47 A;  1RC9 A;  2JRM A;  1TLH B;  1IUF A;  2KHM A;  3GFL A;  2GXA A;  3OYM A;  3F8M A;  5M5Y J;  3ZQQ A;  1BR1 A;  3VOE A;  5IT9 Z;  3W6K B;  4RB2 C;  1G8X A;  1LQ1 A;  3PSI A;  5JHU A;  4M3E A;  1UHS A;  2Q2E B;  1FBS A;  2OU2 A;  3SEQ A;  1E2X A;  1P4A A;  3IH4 A;  2OF7 A;  5TJJ A;  3ERE D;  4I0B A;  1QBJ A;  4ASN A;  4QIW N;  1AA7 A;  1GLN A;  3N97 A;  1MJ9 A;  2NAZ A;  3D5S C;  2LY1 A;  1Y1W J;  3HUG A;  3GWZ A;  5E3L A;  5EZH A;  5TIS C;  1GHC A;  3RZD J;  5CQG A;  3QAH A;  2O7O A;  1ZK8 A;  4HOB A;  2ZCW A;  4A3J J;  2AHQ A;  3HRU A;  1IN8 A;  1FX7 A;  1WCM J;  3K0L A;  4AD9 A;  4PFP A;  2HTS A;  5ICG A;  4AC0 A;  3S2D J;  3C2G A;  5EJC A;  3SHF A;  1OFC X;  1ZRE A;  1UG2 A;  1XSX A;  2E1M C;  2HR3 A;  4BYY A;  3DKY A;  2JTV A;  2OPT A;  2W57 A;  1UAA A;  3BZK A;  4LOC A;  2DK8 A;  3OYA A;  1WPK A;  4IOC F;  3J81 K;  3AFH A;  2A3S A;  3DPU A;  5LRR A;  3HDD A;  4GO1 A;  4Y3O A;  5JHF A;  1LFB A;  2BY3 A;  5JLX A;  5FFZ A;  1K4S A;  1PVE A;  3OYB A;  2R7T A;  5DCM B;  3JR9 A;  4NUB A;  4QLC U;  4KIS A;  2HZT A;  4E6K G;  3FBN B;  3GTK J;  1IV8 A;  1D8K A;  3DFG A;  2DOD A;  2ZXW H;  2Z3Y A;  4V2F A;  4CUG A;  1YHQ I;  3REO A;  3HOT A;  2JT1 A;  2RQP A;  1C0W A;  4FT8 A;  5HLG A;  3S1N J;  3TDZ C;  5FD6 A;  2FEZ A;  3JRD A;  3BWG A;  3EYY A;  1YW8 A;  4MFD A;  2IW5 A;  4G6Q A;  1DU6 A;  5FD5 A;  1T39 A;  1QA6 A;  1KGS A;  1RRJ A;  3DXJ F;  1TQM A;  2PN6 A;  3N05 A;  4GCV A;  3HYI A;  4K2E A;  4IRG A;  2YR2 A;  2NNN A;  1SMY F;  3SFI A;  3JRA A;  3MKW B;  1X58 A;  1FOY A;  5GTI C;  3JCU C;  2BW3 A;  5EEH A;  2O0Y A;  3BY6 A;  4A3L J;  3MMY B;  3P5J A;  2IA2 A;  3OR1 C;  2KT0 A;  2DQL A;  5E1X A;  1SC7 A;  2JPB A;  4L0Z B;  3L2Q A;  5FLX Z;  4E7S A;  2XAQ A;  2B63 J;  2BHY A;  4W1U A;  2DW4 A;  5A2Q Z;  1IRZ A;  2JJ7 A;  3J7Y J;  9ANT A;  3K2A A;  2M30 A;  3E6M A;  1IXC A;  1RUO A;  1WH7 A;  1OCC H;  5DV5 A;  3HC7 A;  4DIQ A;  2ZJR F;  1XG1 A;  1KYZ A;  4OMZ A;  3E6C C;  4KMF A;  3A4C A;  2Y0S A;  3KYC B;  3OS2 A;  2DT6 A;  2M5W A;  2DOE A;  3F72 A;  1RPW A;  3K69 A;  4FHT A; 
#chains in the Genus database with same CATH homology
 2FJ1 A;  1ENH A;  1X2N A;  2R5Z B;  1EF4 A;  2M8G X;  1IV6 A;  4QTR A;  2Y31 A;  2DA3 A;  2VI6 A;  3PM1 A;  4A3K J;  1R9T J;  1GUU A;  5C44 J;  2N8G A;  1TWC J;  4DW6 A;  2Y9Z A;  1MBF A;  1W0T A;  3ZQL A;  2DMT A;  3BTI A;  3ZQH A;  2HXI A;  1U8B A;  1JKQ C;  3HOU J;  2X9D A;  3FIS A;  1BA5 A;  1LFU P;  1MBH A;  1OJL A;  3HGY A;  3FK7 A;  3CQZ J;  1HDP A;  2EZI A;  2ME6 A;  3LSJ A;  2E19 A;  4XK4 A;  2GM4 A;  3HOY J;  5J3L A;  4JX4 A;  4D5C A;  1POG A;  4Y52 J;  3ZQC A;  4V2G A;  1IDZ A;  1JUM A;  2LK2 A;  5DTD A;  1RKT A;  4FE4 A;  1QPI A;  2NVQ J;  1JGG A;  1GV2 A;  3S17 J;  3CMY A;  1ETY A;  2MGQ A;  1W0U A;  5FKO A;  3JRG A;  2NS7 A;  2H8R A;  5C3E J;  1TWF J;  4UUS A;  3L1P A;  1ZGW A;  2R7Z J;  1MBE A;  2HI3 A;  1ZTR A;  1F36 A;  1S7E A;  1GV5 A;  2XPW A;  5J1U A;  3TP0 A;  4RBO A;  1P7J A;  2K9N A;  1ZR4 A;  4UUS B;  4XRM A;  1IG7 A;  4J19 A;  4C3I J;  1JT0 A;  5EGO A;  1ORK A;  5IYB J;  1A6I A;  2G0E A;  1NTC A;  3BR1 A;  4EEF G;  3H3V K;  2DA7 A;  2DMP A;  4FTH A;  3BR6 A;  1BW6 A;  2IEK A;  4IHX A;  3GTL J;  3S14 J;  5IYD J;  1QVU A;  4HNV A;  5EGO B;  1IJW C;  1RKW A;  2D5V A;  5IP9 J;  3BR3 A;  3IH2 A;  3UKG A;  3LSG A;  3S2H J;  5FLM J;  3NAR A;  5FKM A;  3LNQ A;  3W6V A;  4A3E J;  4AYB N;  1MBJ A;  3G1M A;  3BG9 A;  2FQ4 A;  3BTL A;  5M5X J;  2VPR A;  5IOY A;  3HEF A;  2E2J J;  1Y1V J;  1G2H A;  1GVD A;  1OCT C;  3IV5 A;  3PO2 J;  5C4J J;  3JRB A;  2ME0 A;  3Q0W A;  2DN0 A;  1GT0 C;  2GBY A;  5GPA A;  1ITY A;  3MVP A;  1JT6 A;  5EG0 A;  1MNM C;  1FTZ A;  3TW7 A;  5GP9 A;  2KDZ A;  2WB1 N;  5K7F A;  2M34 A;  2YU9 J;  2LVS A;  3IH3 A;  5FJ8 J;  2YUS A;  3QPL A;  3BTC A;  3FK6 A;  4B4C A;  4D5F A;  5EG0 B;  3S15 J;  2K9Q A;  4B1R A;  2WAQ N;  3ZQG A;  4M3D A;  5M3M J;  1T56 A;  2VKE A;  3RZO J;  2ELK A;  3GTG J;  2FD5 A;  2JMW A;  5DS9 A;  1RET A;  2K9S A;  1JTX A;  4D7N A;  2DA2 A;  3K7A J;  1T33 A;  2O9L A;  4XRS G;  3JRI A;  1BW5 A;  2JK3 A;  4A3G J;  1JKR C;  1JUS A;  2DA6 A;  2CUE A;  2M0C A;  3H0G J;  4IHV A;  4DZJ A;  2LTP A;  4AUX A;  1XS9 A;  3VPR A;  2DMN A;  4W97 A;  4FE7 A;  3OIO A;  5K7H A;  1FEX A;  3B6A A;  1HF0 A;  2H1K A;  3BQZ A;  3M4O J;  2I10 A;  4X6A J;  1TWG J;  2DJN A;  2HOA A;  4BXX J;  3BQY A;  1VND A;  3JRF A;  2FX0 A;  2Y2Z A;  2M2E A;  1ETK A;  3LSR A;  1H89 C;  2W48 A;  1QVT A;  1MSE C;  2RAE A;  2LLK A;  5BNG A;  4G12 A;  1IC8 A;  2HOT A;  3O8H A;  4C2M J;  3HM5 A;  1YRN A;  3HGG A;  5F04 A;  3GTQ J;  2DA1 A;  1CQT A;  4XIC A;  3WHB A;  1AHD P;  2JA7 J;  3CDL A;  1B72 A;  1Z0X A;  1I50 J;  5J1R A;  2NVT J;  2LR8 A;  3G1O A;  3S1R J;  1U78 A;  1YRN B;  2JWT A;  3S1M J;  1MSF C;  3ZOB A;  4Y7N J;  2CQX A;  1B72 B;  1DU0 A;  2EBI A;  2E2H J;  4IEJ A;  2XGE A;  1FIP A;  1ZQ3 P;  5FLV A;  1NK3 P;  3SJM A;  3S16 J;  3B6C A;  2VUM J;  3I4N J;  3BR2 A;  3GTJ J;  3NAU A;  4I76 A;  3GBG A;  2P81 A;  2DA4 A;  2LY9 A;  1X2M A;  2CU7 A;  2IBD A;  2AO9 A;  5EF6 A;  1K61 A;  1ETV A;  2E1O A;  4DYQ A;  5M5W J;  1AKH A;  1IGN A;  5F08 A;  4QSH A;  2EQR A;  2HYJ A;  3FIW A;  3HB9 A;  1WH5 A;  2ECB A;  5IP7 J;  2R0Q C;  1UMQ A;  1A5J A;  1AKH B;  1AU7 A;  2XGD A;  4JYK A;  5GPC A;  5EEA A;  2R92 J;  1HDD C;  1ETO A;  4CYC A;  4A93 J;  1PUF A;  1MBG A;  3ZQI A;  4A3M J;  2JN6 A;  1NK2 P;  1WI3 A;  2DMU A;  4A3D J;  3OSG A;  4CYC B;  4NDL A;  5E3M A;  4MFE A;  1FTT A;  1TC3 C;  1PUF B;  1I3Q J;  1MH4 A;  1ZR2 A;  4GFB A;  2JA8 J;  1HLV A;  4FIS A;  4DZP A;  5J1Y A;  1IDY A;  4ABZ A;  4L5E A;  3A02 A;  3E7L A;  2WV1 A;  2ID3 A;  1JKO C;  3I4M J;  4A3F J;  3HOV J;  1WGX A;  4D7M A;  1JJ6 C;  3HOX J;  3Q0V A;  4BY7 J;  2ECC A;  5E3N A;  2R5Y A;  2HDD A;  1H88 C;  3LSP A;  2MG4 A;  2O8K A;  3BR0 A;  1JJ8 C;  3BR5 A;  5F1J A;  4IHW A;  4A3C J;  5FKN A;  2R5Y B;  3HBL A;  2K40 A;  5F0C A;  1QRY A;  4XRS A;  1VI0 A;  2XPV A;  2CJJ A;  1TWH J;  2YS9 A;  3HKZ N;  3HOW J;  1HOM A;  1FJL A;  3PO3 J;  4RDU A;  1MH3 A;  4M3G A;  1LE8 A;  2DA5 A;  1XC5 A;  3FKI J;  1TWA J;  4MO7 A;  5F27 A;  3LOC A;  2EH3 A;  4FCY A;  2L0K A;  3BG3 A;  1LE8 B;  2NVX J;  5HOD A;  4BY1 J;  2MW8 A;  2Y30 A;  3MN2 A;  5FKL A;  2LKX A;  4IHY A;  5EDN A;  2L7F P;  2ZB9 A;  3Q0U A;  2XB5 A;  2Y9Y A;  4X1E A;  2NS8 A;  3HOZ J;  3BT9 A;  2NVY J;  1SAN A;  3BTJ A;  5F0F A;  2COB A;  5FKK A;  1APL C;  2HQ5 A;  1RR7 A;  2PMZ N;  3QQA A;  3QPS A;  5IPA A;  2IAI A;  3A01 A;  1VFC A;  2EZH A;  3D1N I;  3Q3S A;  4M3F A;  1JUP A;  1H8A C;  3OOU A;  4A69 C;  2HXO A;  3SDG A;  2LP0 A;  4BKX A;  2QCO A;  2X48 A;  4B3A A;  5E3O A;  3JRE A;  2NOG A;  3A01 B;  2JA5 J;  4DYC A;  1IUF A;  4BBR J;  5M5Y J;  2XSD C;  2X6O A;  3MKL A;  3CCY A;  4M3E A;  1UHS A;  1ZKG A;  3JRH A;  4UUT A;  3ZQF A;  3IH4 A;  2OF7 A;  1MBK A;  4QIW N;  4BBS J;  1D5Y A;  1RES A;  2CRG A;  1Y1W J;  5E3L A;  5EZH A;  3RZD J;  3GTM J;  2TCT A;  2XB0 X;  5EYR A;  2O7O A;  5JLW A;  1ZK8 A;  4MIM A;  1OCP A;  2CQQ A;  2ID6 A;  4A3J J;  2AHQ A;  1U9O A;  2LD5 A;  1WCM J;  3C2B A;  4JX6 A;  4AC0 A;  1FIA A;  3S2D J;  3TP3 A;  2R93 J;  2EZL A;  1OFC X;  1UG2 A;  1U9N A;  3F0C A;  1JTY A;  1BJZ A;  3WHC A;  2OPT A;  2L7M P;  1JKP C;  2M9H A;  4LOC A;  5F0H A;  1Z77 A;  1WPK A;  2XRL A;  4MLO A;  4DYR A;  2QF7 A;  3RKQ A;  3HDD A;  1VF9 A;  5M3F J;  3M3Y J;  1LFB A;  5JLX A;  3JRC A;  4M3B A;  1E3O C;  3S1Q J;  5IP6 A;  1ETW A;  3JR9 A;  2HOS A;  5IYC J;  1I6H J;  2CUF A;  2XGC A;  3GTK J;  2MSY A;  4V2F A;  3DCF A;  1O4X A;  3GTO J;  2TRT A;  3DEW A;  4A3B J;  4C3J J;  3TED A;  3A03 A;  5EZG A;  3S1N J;  3GTP J;  3JRD A;  1B8I A;  4S0H B;  1F43 A;  2GLO A;  4XID A;  4MFD A;  1DU6 A;  1BL0 A;  2VKV A;  4JX5 A;  2JA6 J;  4A3I J;  4JP0 A;  2L9R A;  1B8I B;  1GDT A;  3SFI A;  3JRA A;  1X58 A;  2DMQ A;  3TW6 A;  1ETX A;  1SFO J;  2EZK A;  4A3L J;  3OSF A;  1K83 J;  2DTZ A;  1ETQ A;  2KT0 A;  5IOZ A;  3O8G A;  2LFB A;  5K7Z A;  2L7Z A;  3BG5 A;  2E2I J;  2B63 J;  4W1U A;  5C4X J;  1IRZ A;  2JJ7 A;  2Y0S N;  4M6V A;  3RQI A;  9ANT A;  3G1L A;  3K2A A;  4C3H J;  1WH7 A;  1Q1V A;  1HCR A;  2R5Z A;  1XG1 A;  2XPU A;  4I6Z A;  1P7I A;  1RPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...