2NVXJ

Rna polymerase ii elongation complex in 5 mm mg+2 with 2'-dutp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2nvxJ00
1X2NA 1FJLA 2H1KA 2CJJA 2DA4A 3FISA 3M3YJ 2VUMJ 1AKHB 3GBGA 5FKOA 3Q0VA 2CRGA 2HOAA 3JRDA 4CYCB 4I6ZA 3OIOA 5EG0B 1X2MA 1APLC 4J19A 1JUSA 3K2AA 4NDLA 2LTPA 9ANTA 2NOGA 2TRTA 5F1JA 3HBLA 2JK3A 3SDGA 3S2HJ 3ZQCA 4V2GA 1GUUA 2MG4A 4W1UA 2Y0SN 1POGA 1H88C 1JT0A 1IC8A 1QRYA 3E7LA 2L0KA 3HM5A 1IDYA 1X58A 2XB5A 4A3GJ 2LFBA 2GBYA 2NVTJ 3HOYJ 1JJ6C 1ETKA 5FLVA 4XIDA 2QCOA 3GTQJ 4S0HB 5IP9J 1HF0A 2DMTA 3ZQGA 3LSGA 5JLWA 3ZQHA 1MBJA 5IOZA 4C3HJ 1HDPA 3S1QJ 1QVTA 3BQYA 5EYRA 1GT0C 1ZTRA 1FEXA 3HOVJ 1IG7A 4FE4A 1B72A 3UKGA 3RKQA 2ID6A 1BA5A 2HYJA 1ZR4A 2Y9YA 1GVDA 2QF7A 5M5YJ 1UMQA 1JT6A 1IJWC 2CUEA 2NVXJ 2LR8A 3GTOJ 1LFUP 1LFBA 4XRSA 1VI0A 1DU0A 4IHYA 1WI3A 2LLKA 4BKXA 1RESA 3JRAA 3H0GJ 4A3JJ 2HXOA 2MW8A 3HOXJ 1YRNB 3BR5A 1P7JA 1MBKA 3Q3SA 1S7EA 3PO2J 1TWGJ 1MBGA 4IHXA 4A3MJ 3GTJJ 3OOUA 3CMYA 1ETQA 5IP6A 1TWFJ 3MVPA 3GTGJ 2ME0A 1I6HJ 2NVQJ 4MO7A 2XPWA 1XS9A 1BW5A 4M3EA 5GPCA 2YS9A 1BL0A 1K83J 5EZGA 2JWTA 1PUFA 4UUSA 2FQ4A 3PM1A 3BG9A 3OSFA 3S16J 3S1RJ 4DYRA 1Q1VA 5EZHA 3BR1A 1ZR2A 1AKHA 3HDDA 3BTLA 1ETXA 3DCFA 4CYCA 5EG0A 2E2IJ 3GTPJ 1SFOJ 2B63J 3A01B 5DS9A 2O8KA 1OJLA 2XRLA 3S2DJ 4QTRA 3O8GA 4A3KJ 3MN2A 5C44J 2E2JJ 1VNDA 1ZGWA 4XRMA 1PUFB 1JTXA 3FK7A 3QPLA 3JRHA 3H3VK 1BJZA 1WGXA 5FKMA 2LD5A 5GP9A 4MFDA 4DZJA 2JJ7A 4BBSJ 3Q0WA 2L7FP 5F0CA 2DA2A 5J3LA 1MBEA 2NVYJ 1JUPA 2EZIA 3IH3A 2I10A 3RZOJ 2ME6A 3JRFA 1R9TJ 5M3FJ 1B8IB 4X6AJ 3C2BA 1XG1A 5EDNA 5FJ8J 3JRGA 2YU9J 1G2HA 2X48A 1RPWA 5IOYA 1NK2P 4DYCA 2DMUA 2DA5A 2IEKA 4C2MJ 1U9NA 3LSPA 1IV6A 4B1RA 3M4OJ 1GDTA 3RQIA 4D5CA 1K61A 5M3MJ 1P7IA 3JRBA 3LOCA 2XGDA 2XPVA 2RAEA 3CQZJ 2XB0X 2Y31A 1W0UA 2COBA 2X9DA 4D5FA 4QSHA 4BY7J 4M3FA 2R5YB 1AU7A 1GV2A 2M34A 1YRNA 4X1EA 3WHCA 3S17J 3PO3J 2XPUA 5F0HA 2JA7J 1DU6A 4AYBN 1ZK8A 1VFCA 5K7HA 2LKXA 5DTDA 4A3DJ 1MBFA 3ZQIA 2G0EA 3BR0A 1ETWA 1JKPC 5J1RA 3O8HA 1FTZA 2FX0A 4HNVA 1JKQC 2JA5J 4EEFG 1HCRA 1RETA 4A3EJ 5GPAA 1MH4A 2LK2A 2HOTA 4FISA 3L1PA 1OFCX 4LOCA 4GFBA 1U9OA 3TW6A 4BBRJ 5IPAA 1JJ8C 2L7ZA 1TWHJ 3LSRA 4RDUA 2MGQA 4A3LJ 4AUXA 2HXIA 4A3FJ 1WH7A 4MIMA 1Y1VJ 4A3CJ 1U8BA 4IHVA 3SFIA 3BR3A 3JR9A 3B6AA 2R0QC 1MH3A 3LSJA 1O4XA 3G1LA 3A01A 2JMWA 4IHWA 1A6IA 4A3BJ 2CQXA 3BR6A 5IP7J 4V2FA 2XSDC 2D5VA 4FCYA 1ETVA 4BY1J 4Y7NJ 2KT0A 4M6VA 3NARA 3S14J 1JKOC 4Y52J 3HKZN 3JRIA 1I50J 1JTYA 3S15J 1RR7A 2AO9A 4M3BA 4A69C 1HDDC 2LP0A 3B6CA 1QPIA 2DMQA 2K40A 4QIWN 5FLMJ 2XGCA 1H8AC 4AC0A 1T56A 1CQTA 3I4MJ 2Y30A 3I4NJ 2CQQA 2P81A 3HOUJ 1B8IA 2PMZN 4M3DA 2E19A 2N8GA 3CDLA 1WCMJ 4MLOA 2ID3A 3NAUA 3BTCA 4I76A 1HOMA 3TP3A 2YUSA 2DA6A 3BQZA 3ZOBA 2M9HA 1FIPA 5BNGA 2GLOA 2DA7A 5E3LA 2L9RA 4JYKA 1IGNA 5FKKA 3G1OA 5F08A 1AHDP 5M5WJ 1WH5A 1XC5A 1A5JA 2R5ZB 2EZLA 5M5XJ 1T33A 5E3MA 2CU7A 2R5YA 5EEAA 4B4CA 1IRZA 2JA6J 4M3GA 2VKVA 5IYCJ 1QVUA 3IH2A 1RKWA 1H89C 1JUMA 5J1YA 3RZDJ 1LE8B 5F04A 5F0FA 1BW6A 2ELKA 2XGEA 2DN0A 4G12A 3GTLJ 4FE7A 5EGOB 1E3OC 2VKEA 1ITYA 1ZKGA 3HB9A 3TEDA 3IH4A 2ECCA 2WV1A 1HLVA 2R93J 3FK6A 2E2HJ 3HOWJ 5FKLA 2HQ5A 1NK3P 3BTIA 3W6VA 4FTHA 3JREA 2IAIA 4A3IJ 5E3OA 3G1MA 5C4XJ 2R7ZJ 2WB1N 3JRCA 2ECBA 2LVSA 3QPSA 2DA1A 1EF4A 2M2EA 2TCTA 2WAQN 4JX5A 1FTTA 1RKTA 4JP0A 2HI3A 2DMPA 1JKRC 1D5YA 1ZQ3P 1I3QJ 5K7ZA 3HGYA 2H8RA 1ORKA 1TC3C 3S1NJ 1VF9A 5E3NA 2Y9ZA 3BT9A 1TWCJ 2E1OA 3Q0UA 5IYDJ 4BXXJ 3OSGA 2VPRA 2GM4A 3ZQFA 1NTCA 2AHQA 4IEJA 1ENHA 3TP0A 2OPTA 2Y2ZA 2EZHA 2K9QA 2L7MP 1MSFC 1MSEC 5FKNA 1GV5A 2NS8A 2JN6A 2OF7A 2HDDA 3LNQA 3SJMA 1TWAJ 4JX6A 4D7NA 4XK4A 3BTJA 1Y1WJ 3FKIJ 3ZQLA 2CUFA 2ZB9A 3IV5A 5JLXA 5J1UA 3CCYA 3GTKJ 1F36A 2W48A 3BG5A 3VPRA 4W97A 3F0CA 2EBIA 1W0TA 1FIAA 2O9LA 1JGGA 2M0CA 3TW7A 1B72B 2R92J 3A03A 2JA8J 5K7FA 2DMNA 4C3IJ 3HGGA 1IDZA 1Z77A 2M8GX 3FIWA 5EF6A 5C3EJ 1UG2A 3HEFA 2FJ1A 2DA3A 4JX4A 1Z0XA 3WHBA 4XRSG 4RBOA 2NS7A 2O7OA 1WPKA 2EZKA 1MBHA 3GTMJ 4DW6A 4B3AA 1MNMC 5IYBJ 5F27A 2KDZA 5C4JJ 2R5ZA 2LY9A 1F43A 2K9NA 1OCPA 2MSYA 4L5EA 2HOSA 3A02A 2K9SA 4A93J 5HODA 4ABZA 3S1MJ 3K7AJ 2X6OA 3BR2A 2IBDA 4DZPA 3D1NI 2DTZA 3BG3A 3QQAA 4UUTA 4D7MA 1U78A 1OCTC 1IUFA 3HOZJ 2EH3A 1SANA 1LE8A 4DYQA 1UHSA 2VI6A 4XICA 2DJNA 2EQRA 4C3JJ 2FD5A 5EGOA 3MKLA 4MFEA 4UUSB 1ETOA 3DEWA 1ETYA
chains in the Genus database with same CATH superfamily
1FJLA 2H1KA 3QU3A 4N9IA 2CJJA 2RNJA 4M72A 3FISA 2HGCA 4OWRB 1Y8RB 1TQMA 2JRTA 2KFDA 2Y0MA 4RAYA 1IRGA 4I6ZA 3OIOA 3WU2C 2UUZA 3DF8A 2FOKA 3K2AA 2XC7A 1BIAA 4ENMA 3CCUI 1JHFA 3ULQB 2ZFWA 3TDUC 2VQHA 2GXAA 3HBLA 1WJAA 1S5LC 1XDSA 1TW2A 3WTYC 3KEOA 4BHCA 2DI3A 3ROUA 4KA4A 2PQ8A 4W1UA 1QU3A 2CH0A 1H88C 1R6RA 2WADA 1JT0A 5D8LB 3TMOA 3KYLA 1IC8A 5LGUA 2HDCA 5FGMA 2HTSA 2QENA 4KJZA 5FB2A 2DFIA 2NVTJ 3D5LA 3DPTA 5A2QZ 3G2BA 1TZLA 3FXOA 2R7SA 1JE8A 3HL2A 4P96A 1U5TB 4CCKA 1HF0A 2DMTA 4UUVA 3HSRA 3RPUA 3LSGA 3EUHC 3IRRA 3H9GA 3ZQHA 4EMSA 5IOZA 2RREA 1HDPA 2FE3A 3RSNA 6PAXA 3MZYA 1WJDA 4B09A 2JQ7A 1UHWA 3Q5FA 3F22A 4BGDA 3DKWA 1G3YA 3BPXA 1B72A 3EUKL 2ID6A 2HYJA 1F1ZA 3RIRA 3F8FA 1JT6A 3GTOJ 4FX0A 1AA7A 2VBYA 4XRSA 2OV7A 1J75A 3HPHA 3RQ4A 5BPDA 2EFWA 2KHMA 4P55A 3GW2A 3BR5A 3ZMUA 1P92A 4RLQA 4EJUA 1V5EA 1P7JA 3Q3SA 5ICFA 5JFRA 3MCZA 3SEQA 2ZXHA 1G8XA 2BW3B 4IHXA 3GTJJ 4KICA 4Q4ZF 2AXTC 2KJBA 3G4SI 2STTA 4HNTA 2VQGA 2DBBA 3KP7A 2P7CB 2QSGX 3KLOA 1MMSA 1I6HJ 2NVQJ 5F1RA 4MO7A 1JI8A 2RKHA 4G6QA 4RM3A 3BCAA 3K0LA 4M3EA 4YELA 1YI2I 2WWYA 1LPQA 2QEXI 3UNGC 3FM5A 3PNYA 3Q9SA 3CCQI 1XTAA 1K83J 3LA7A 5EZGA 3PM1A 4XSXF 1G4DA 2XVCA 3M8EA 2FSWA 1DPRA 4ENKA 1Q1VA 3HDDA 4M9XA 2JPCA 3BTLA 3FZVA 5BMZA 5L3EA 3SZPA 2MC3A 2PEXA 4M9SA 1Y0UA 2ELJA 1J0RA 1TLHB 3PL8A 4EGYA 1R36A 3FWEA 3A01B 2VOOA 5J40A 1OJLA 2VT3A 4LITA 3CUQB 4D0PA 2B9SA 2CV1A 4A3KJ 2E2JJ 5D5VB 2W00A 2K27A 1HW2A 1R1UA 4XRMA 2ZFUA 2F2EA 3IHUA 5ED4A 5IT9K 1MMNA 1X3WB 1BR2A 5TISC 1WGXA 4D1QA 4AVPA 3OYDA 3TO7A 3Q0WA 3ZMDA 2IP2A 1MMGA 2EV6A 5J3LA 1CF7A 2WB1A 3F3XA 1MBEA 2KIFA 2FNAA 1WVRA 2HQNA 3M07A 3VB2A 4AIHA 5CKTA 1XMKA 2CFOA 2WY7Q 4LK0F 3VSLA 2E34A 4QPOA 3C2BA 2E5ZA 3W2VA 3C7JA 5EDNA 1OPCA 5FJ8J 1NH3A 3GYHX 2DMUA 4RAZA 1B6AA 2L3DA 5DYMA 4B1RA 5E1XA 3M4OJ 2HYGD 1GDTA 3HOSA 1IUYA 5HDGA 3RQIA 1K4TA 2IGNA 4KUMA 1CF7B 3JRBA 2XPVA 2RAEA 2XB0X 4M6XA 3KLNA 1X1BA 2E7WA 1W0UA 3DLAA 1HW1A 3ZXSA 4BY7J 4M3FA 3TL4X 4IPAA 2R5YB 1GV2A 5CVUA 1IAWA 1YRNA 3KE2A 1S29A 2DAOA 4B44A 2DU9A 5F0HA 3FMSA 2ZJQF 3IL2A 1VFCA 3H5NA 2VODA 4M73A 1S3JA 1D0YA 1OKRA 1IO2A 3FMQA 3GMEA 3LWFA 2Z99A 2BBYA 3K9TA 1MJAA 3R0AA 4RAGA 5HDKA 3AL0B 2ZC2A 3CC4I 1ODDA 1RETA 4EVIA 5K5OA 1V54H 3F9KA 4A3EJ 3MZHA 3GFJA 2OZUA 3UR3C 3JSOA 2R7QA 2HOTA 4LOCA 4ITVA 1G59A 1RI7A 2DFHA 4KIGA 3W2AA 4NC8A 4HX7A 2DLLA 4XLHA 4CICA 2L7ZA 4XR6A 3HRTA 1WJCA 1TTYA 4RDUA 4A3LJ 2HXIA 3I58A 3FXJA 4A3FJ 2CW0F 2ZMEB 4OAZA 4A3CJ 2CQ7A 2A3SA 2V1UA 4RB3C 4ON0A 3ASOH 3K1MA 1LVAA 2NOJB 3CJRB 3G1LA 4KIBA 2JMWA 3QP6A 3CZ6A 1Y56A 3TDZC 3ABUA 1E3HA 2LBFB 4V2FA 3OYLA 1DPUA 2FQ3A 4CYDA 2D5VA 4FCYA 4CGZA 2K85A 3F72A 4UY8I 2CSOA 3NRVA 1Z7LA 2KT0A 1I1GA 3IC7A 4M6VA 4XOPA 4XLPF 2JPBA 2W1OA 3OMYA 3HUGA 3HKZN 2XIGA 1KYZA 2PN6A 3KFWX 4LLLA 4PFOA 1I50J 2KL4A 5JR3A 1RR7A 2AO9A 3QWLA 2CFXA 4M3BA 1HDDC 4NB5A 2LP0A 1PP7U 4IHSA 1D1BA 3F8BA 5FLMJ 4UV8A 2H1LA 4AC0A 1XN7A 3I4MJ 2Y30A 2P81A 2KRCA 1EH8A 4L9TA 4EATA 1DQUA 1VQPI 1D3YA 4NQWA 3CDLA 3U1KA 3M7GA 3FF5A 4U0WA 4L9JA 1DGRM 3O2PE 3TP3A 3QOEA 1RUOA 4ZDPA 2YUSA 3L9FA 4MTDA 4D9JA 2XF6A 4PDKA 2L9NA 4HYEA 4MEXF 4Y15A 4ESFA 3CLOA 2IGKA 1E2XA 5HS7A 3D0SA 1YFHA 3CESA 2GLOA 4JYKA 5GTIC 2NVUB 1TNSA 2C6YA 3QPTA 2O8XA 2ZSIB 2XRNA 3U9GA 4DNCA 5HLHA 4BL0B 1LDJA 4ZTJA 3TOAA 1IRZA 3DTIA 4BYYA 1QHGA 2LY1A 5IYCJ 4HSTA 1QPMA 1QVUA 2QSHX 2K4JA 3IKVA 5F0FA 1ONVA 2L54A 2ELKA 2H8WA 3ZN1A 4IXAA 2E1MC 2IXSA 5HOOA 2DN0A 4HPQA 1EJ9A 4YFXF 4FE7A 1E3OC 2L02A 2KMUA 5E8GA 1XPXA 3S8PA 2R7UA 2OC6A 1ZKGA 2RNGA 3HB9A 3V7CA 5BOXA 4OIOF 3M1CA 2WV1A 2G7HA 3SYTA 2OTJI 1R1VA 2KISA 4I98B 2FBKA 2O03A 1TT5B 3ML6A 3IAS2 1KU7A 2CW7A 4FTHA 2F48A 5E3OA 5EJCA 2VOPA 2MD5A 3B73A 1MIJA 2MH9A 2ECBA 4G7ZF 3KZZA 2M2EA 3V8LA 1EF4A 4ENJA 3ELKA 4F91B 1ZQ3P 5CVRA 1TT0A 2BGCA 4S05A 1OQYA 1TC3C 1KQ9A 1FBUA 5E3NA 5DCMB 1I1SA 1TWCJ 2E1OA 2HWVA 1D0ZA 3K4MA 4KN7X 5BPIA 3ZPLA 3T8RA 4E7LA 2GM4A 4NHJA 4F52A 4MGRA 2K4BA 1Z1DA 2EV0A 1R4NB 1ENHA 4N0BA 1VQLI 1VTNC 1XDUA 1TQIA 2L9VA 2XAGA 2X6WA 5DDGA 3ZP5A 2XASA 3MAJA 4CHUA 4JOMA 4Y17A 1YLFA 2NS8A 2HDDA 2EPFA 1B9NA 1H9GA 2K7LA 3OY9A 4KDPA 4XK4A 2EFOA 3BTJA 4BQOA 2BXYA 4L0ZB 1SD4A 3ZQLA 3WGGA 3F21A 5D6EA 3OYFA 3K70C 4PUSA 1FWZA 3VPRA 3F0CA 1WFXA 3GX4X 3VDXA 2VPLA 2CS3A 2DMNA 5F64A 5LBQA 3HGGA 3G6EI 2ACJA 5J4VA 4HF1A 3KEQA 5LGTA 4HG2A 2Z9OA 3J7AO 2HOEA 1IN7A 2LDUA 3LA3A 4HV5A 4JX4A 5EEGA 1R23A 1G3TA 2DQLA 1ULYA 4OMZA 1WPKA 4QWQA 4KFCA 3R6SA 3S2WA 1KQ8A 1VQOI 5AIPA 5C4JJ 2QKMB 1PDNC 3J81Z 1VQ5I 3CTAA 3WE2A 1PJRA 2RGVA 2XAJA 4ABZA 4C2UA 3D1NI 4DZPA 3OYAA 2DTZA 2EINH 2YR2A 1HKQA 3HOZJ 2EWNA 4L9NA 1LE8A 4HDVA 3SDBA 3J80K 4M6YA 1E17A 2VJ4A 2DJIA 4XICA 4JQFA 3CP2A 1SC7A 1VQ9I 3H36A 1OCCH 2EQRA 4Y33A 5D6FA 4C3JJ 2MH2A 5LRSA 3OYNA 4O3MA 2P7VB 3AG3H 5L3CA 3JAMZ 1T8IA 2IS4A 3CO7C 5FD5A 5B5EC 3ERED 2KZGA 2VC1A 3D5RC 5FKOA 3OWTA 1FY7A 4CYCB 2KIQA 4CSWA 1HA8A 4NDLA 2LTPA 5IT3A 3I4PA 4IO9F 2KIUA 3DTEA 1D8KA 3RKXA 1OR7A 2BV6A 3CCLI 4XN3A 2UV1A 2W82A 2P5KA 4RMNA 3RCOA 2JK3A 1QBJA 3FXUA 3M1EA 2K3PA 3S2HJ 4V2GA 2MG4A 1LUJB 4A2UA 5D4SA 2HZDA 2Y0SN 3H3UA 1YIOA 1YTYA 3ZMVA 3E7LA 2L0KA 1IDYA 2Z2SB 3ABMH 3I53A 3LQRA 2CW8A 2Q0OA 3HXLA 3M9AA 3TO9A 3HRMA 1JJ6C 1ETKA 3P9CA 5FLVA 1IV8A 4S04A 3QOPA 2ZSHB 2HPMA 3GTQJ 2WY8Q 3BJAA 5JVGF 3F8CA 3ZQGA 5JLWA 5BQTA 2RVCA 4C3HJ 1HXDA 2AXLA 3R61A 1QVTA 2HQAA 3SXYA 4IX7A 4XNFA 3BQYA 2PFBA 3DQVC 4CCLA 3HOVJ 5CVIA 4C30A 3BLYA 1Z3YA 3O3KA 4QPQA 3NEUA 1ZR4A 4E7IA 3TBIA 3V7SA 2BY3A 5K5QA 1GVDA 2FRHA 3DU5A 5M5YJ 4XLNF 4BS9A 5BS6A 3J7YJ 2LR8A 2OJED 3O6BB 2ZBKA 5HNHA 2VJIA 4EM0B 1M1EB 2E35A 4XSZF 1WI3A 2VBXA 4RLFA 2BYVE 3QYEA 4YIRX 2HYFA 2F5FA 2W85A 4E7SA 1RESA 1SVMA 2DFEA 5AONA 5A2QK 1LVKA 4HNUA 3JRAA 1K78B 2HXOA 4EJOA 2G9WA 3H9JA 2HU9A 2KQRA 1W7PD 1FZPB 2OD5A 2JSPA 1TWGJ 3QPHA 2CV2A 3V4GA 4IRHA 4NBQA 3T8TA 4KMUX 4A3MJ 2F5VA 1WQ2A 5CVVA 4AD9A 4ZH4F 3FXRA 3AG4H 4BEHA 2HPIA 3JCUC 3CDHA 1DGWY 3MVPA 2F6CA 3REOA 4BACA 4G6TB 1D8JA 3MMYB 4J01A 5B3SH 2YS9A 1PUFA 4UUSA 3KEYA 4A6EA 3OSFA 3S16J 1W1WE 5F6FA 1AOYA 2V1XA 1RR8C 3GFLA 2PMUA 4ZDOA 2E2IJ 2BY1A 1ZRDA 2YU3A 4L5JA 5L3GA 2JVHA 1SFOJ 2LMDA 5DM7F 2XAFA 1YW7A 4IKFA 3S2DJ 3O8GA 3MN2A 4DOZA 3FHNA 3HHHA 4Y4RA 4A12A 1ZN2A 4U0YA 1N78A 1W4MA 4I0BA 1BJAA 2YSRA 4BAYA 1PUFB 2OQGA 4GGGA 2E36A 1HSJA 5LHIA 3JRHA 5LRRA 2IT0A 1BJZA 2MFZA 5FRNA 2Y0SA 1X1AA 5GP9A 5TRDA 2Y69H 4DZJA 1E0EA 4XLCA 3OS0A 1X4PA 2WA0A 1SMYF 4P9UA 2L7FP 1XCVA 1T0FC 2HS5A 2V9KA 2JUGA 1OLTA 4EJWA 1N75A 3DEUA 5KAIC 2EZIA 3AG2H 1UG0A 1UELB 1SFEA 2ME6A 3HSEA 2K02A 5CYVA 3JRFA 1FOKA 1U5TA 3G3ZA 2XHKA 5FO5A 2MABA 1B8IB 4UNOA 4TV7A 3RPQA 4U7BA 3L2WA 1XG1A 2QQ9A 1EV7A 1TL8A 3JRGA 2EIJH 2NNYA 2YU9J 1UCRA 2FF4A 1G2HA 4BU2A 2XKOA 1NK2P 4HW0A 3HZJA 4DYCA 4C2MJ 1U3EM 1U9NA 1R1TA 1IV6A 3I3LA 3KYCB 1K4SA 4WXCA 1XCBA 3QP5A 2DCEA 4D5CA 1LDKB 1WJ5A 1K61A 2R4GA 4R8HA 4KITB 3CQZJ 2FXAA 2CMPA 2VJ5A 1FOWA 1R5HA 3HJEA 2COBA 2A5WA 1ZRFA 2ZJ2A 4IHTA 1P6RA 5CJ9A 2AS5F 1KYWA 3WHCA 1ZGJA 3VOEA 3WG9A 3LMMA 3WTWC 3A0BC 3TKYA 4BE2A 2BW3A 3VYSB 5K7HA 4XKVA 1J9IA 2VKHA 3RKWA 4F55A 3ZQIA 2G0EA 4RA2A 1ZGAA 1ETWA 3CJQB 1TP4A 1O3TA 2HKOA 3O8HA 4HNVA 2JA5J 4E4HA 3BCBA 1OMIA 3NQOA 2WAEA 3ZR8X 1YW9A 2LK2A 3ASNH 4FISA 3L1PA 4N9HA 4GFBA 2M4KA 3BC8A 4MNUA 4HA8A 1A35A 1BI2A 2VIXA 4HLXA 3K70D 1FLIA 3RDIA 1BR4A 3GZ5A 4BE1A 5K1YA 1WH7A 3LFKA 3WTUC 1WJEA 4ZTFA 4IHVA 2ZNZA 2OA4A 1GXPA 1YW8A 2M45A 3H92A 3BPVA 1R7JA 4E7HA 3B6AA 4UVBA 1STZA 3F23A 2D1VA 2LH9A 4U0VA 1O4XA 3A01A 2Z16A 3BG7A 1N77A 2ZCWA 3CUQA 1D1CA 2CQXA 2IPQX 3T0YA 5IP7J 1R58A 2YX7A 4B48A 2KLOA 3R4KA 1ETVA 4BY1J 2GZWA 4Y7NJ 1XMXA 3NARA 3OS2A 4Y52J 4OU0A 4FETA 3JRIA 4L0YB 5KNLA 4GDFA 2JSCA 5ILUA 4LLNA 2P6TA 2PJPA 5FROA 4A69C 3EETA 5E18F 3AKZA 2DFFA 5GAGJ 2DMQA 4PJNA 4F3QA 1VQ7I 4PSWA 3IAM2 3V42A 2PMZN 4M3DA 2E19A 2NXNB 3S3OA 3EUAA 4JBAA 1FSHA 3IUOA 3V8KA 3I0TA 2QLZA 3BTCA 4I76A 3GO5A 3E5QA 4Y13A 3C1DA 2ZJPF 4BDYA 1HOMA 1FMWA 3BQZA 4PGHA 2BVMA 2QYOA 1AWCA 2M7BA 3GEZA 4LD5A 2X1DA 1U2WA 4GXOA 1QZYA 3G1OA 4IZZA 5J4YA 1XC5A 1A5JA 2R5ZB 1MW7A 2CU7A 3V7RA 1BOBA 4ZYHA 3NWSA 2R5YA 2OU2A 1D0XA 4B4CA 2OQRA 3FBIB 5EEAA 1G6NA 1EA3A 4M3GA 3HC7A 3CCVI 3LFUA 2DODA 1RKWA 2E60A 3CP8A 5J1YA 3RZDJ 3BZCA 1W7PB 1BW6A 1R4MB 4ZYEA 1JHHA 4G12A 3ZMTA 2Q2EB 5EGOB 2VKEA 5B66C 2DT6A 3ZMZA 1FYKA 5IY5H 4RS8A 2EV5A 4MEYF 2JTVA 2ICWG 2GXBA 2R93J 1H9TA 4HEA2 2PJRB 4E7JA 3HOWJ 3WTSC 5FKLA 3PJRA 1NG7A 5LHGA 3BP8A 1U8RA 4KISA 4PSXA 2IAIA 4A3IJ 4V19K 1R00A 3E6DA 2WBMA 2JA2A 4B43A 3FXQA 2ZMEA 2M3AA 4EM2A 3JRCA 2LVSA 2WAQN 2X1EA 3EYIA 1KA8A 1SVLA 4WK8F 1BOAA 1I3QJ 2FU4A 2QQAA 5ICCA 3EYYA 4BE0A 3HGYA 3FM3A 1OYIA 2DT7B 1VF9A 2R7XA 4XM3A 3COAC 1EKEA 2EA4A 3BT9A 1L0OC 3Q0UA 2LBFA 4IOAF 4XLFA 5KHDA 4ZC3A 4LFUA 4RM2A 3HTSB 2M87A 2QA4I 1S6LA 2LF8A 3LSKA 5HLTA 3TP0A 2OPTA 1I5ZA 1MZBA 1HSTA 2L7MP 2OUMA 4A0ZA 3C2HA 2V4JC 1OCRH 1IN6A 1BN5A 3PNVA 3CC2I 3E6BA 2DOFA 3JW4A 1TWAJ 4GCVA 4D7NA 2O61A 4M71A 1X4OA 3I71A 3JTHA 1R71A 3CCYA 3DKYA 3ISPA 1PYVA 4NUBA 1W0TA 2RN7A 1FIAA 5CQGA 1Z9CA 1SVOA 1FBSA 2ZXIA 2M0CA 2XV4S 3OR1C 1FX7A 2JA8J 3FXKA 5K7FA 1I27A 2E1MB 3KZYA 2XDVA 1ON1A 1P9QC 1Z6RA 1Z77A 2LC2A 2M8GX 3FIWA 2VKDA 4DQ2A 2K86A 2FJ1A 1J7KA 3GF2A 4LB5A 4FT8A 2KP6A 4XRSG 1Z0XA 5DV5A 3WHBA 2XROA 5IT9Z 2EFPA 3GLXA 4MTEA 5ILSA 2EZKA 4I7HA 1MBHA 3FXLA 4XRFA 1OYYA 1S72I 2IW5A 1XSVA 1PVEA 1ZARA 5IYBJ 2F5DA 5GAEJ 2LY9A 1F43A 2K9NA 1T39A 2B0LA 4A5MA 3A02A 1YQAA 2K9SA 2KRFA 3DP7A 3S1MJ 2H6BA 4AU7A 2IBDA 3I59B 1U78A 1Z05A 3BG3A 3MKWB 4D7MA 4G6DA 2OCCH 4GO1A 5JI6A 2V6EA 2VI6A 4RGUA 4IOCF 3HHGA 2L01A 5FLXK 1RZ4A 1SD7A 2EB7A 1WWXA 1ETOA 3SZGA 1ETYA 3BZ6A 2DA4A 2CQKA 5GTHC 3M3YJ 2OTLI 1K6YA 1ZHFA 3MKZA 1AKHB 3Q0VA 1VQ6I 2CRGA 2HVQA 1VQKI 2DK5A 2CUJA 5EG0B 1K6OA 4CCOA 2IJLA 1K7AA 2KPMA 1X2MA 1APLC 2GOMA 4XL9A 1JUSA 3LA2A 3C18A 5EEHA 1Z91A 3Q9VA 1XGNA 9ANTA 2NOGA 2TRTA 3CCSI 1Z21A 3E5UA 4L5IA 3RYRA 4RGRA 1GHCA 2IGMA 3SDGA 4CCJA 1Y8QB 2M1BA 1Q1HA 3ZQCA 5DCMA 2XSJC 1POGA 3DBLB 1NHAA 1ZELA 2ETHA 4XBFA 3KETA 4H4KC 4XLAA 1RNLA 3CCRI 2XAHA 1X58A 2P6SA 1UHMA 3LSHA 2QBYB 2COMA 4A3GJ 3H3ZA 2UWMA 2QQBA 3HOYJ 4MQ9F 4OIPF 3E0JB 4GYGA 2FOWA 5DCFA 4S0HB 1BC7C 5IP9J 3HRSA 3CF2A 1USSA 4PJ0C 3SZTA 1HC8A 3KX2A 4II2A 4LK1F 4AIDA 1FOYA 3IP4B 4J00A 2BVLA 1YG2A 1GT0C 2CV0A 1J59A 4PZJA 1KU9A 4FE4A 1XD7A 4L18B 2TDXA 1OYWA 4XMYA 4CO8A 3RKQA 3KP5A 2QF7A 1IJWC 1UMQA 2NVXJ 1I6XA 4HLYA 5GADJ 1LFBA 4IF4A 1FP1D 1VI0A 3DPLC 1TBXA 3FBNB 3HKZA 2NAZA 2VJJA 1DU0A 2LLKA 2BY2A 4BKXA 1MMAA 3P5JA 4ZZDA 2QVOA 3H0GJ 4A3JJ 2MW8A 4A5NA 4MQVA 4CZCA 2VQCA 3K4LA 2DYRH 1MBKA 4P1WA 1S7EA 4RB1A 3PO2J 1YS7A 2UXNA 1MBGA 3SEZA 5HS8A 1WHUA 2VE8A 1W5SA 1ETQA 5IP6A 2X6XA 1TWFJ 3TO6A 5D5UB 3KPHA 2V1NA 1A04A 1HQCA 1BW5A 5H6RA 1V5FA 1MKMA 2X85A 5CVJA 5L3DA 1TQPA 1FOXA 2NNNA 3C2GA 1ZAOA 4N4NB 2JWTA 4Z6YA 4LGWA 1W36D 3OL3A 2L5QA 1I3AA 4E6KG 3S1RJ 3CC7I 2X0LA 3KP6A 3ZRGA 4DYRA 2B7EA 3BR1A 1ZR2A 3GVAA 1Y0NA 4BQQA 2MYSA 1REPC 2LKPA 3DBRB 3LL7A 2XF5A 4CYCA 4ESJA 2VC0A 2X51A 2ZJRF 4CCNA 3CD6I 1VQNI 5J8FA 2A68F 2B63J 2LYCA 4XQFA 1ZLKA 5L3FA 3BJOA 5DS9A 3OYBA 1BBYA 3ZCOA 1SFKA 3A1YA 3OIPA 2A07F 2HKXA 1VNDA 1KZHA 1YS6A 5D5WB 3BY6A 1JTXA 5E8IA 3CCMI 3FK7A 3H3VK 2EIKH 1KGSA 5FKMA 3BROA 3RPUD 5TJJA 2DDAA 1V5GA 2X4HA 5H6QA 4YFKF 4BBSJ 3GZNB 3I55I 2DA2A 4WX9A 2R7FA 3SQNA 3N05A 4BJ5C 4UXNA 1XX5A 5DD4A 1JUPA 3IH3A 1R9TJ 2HNHA 3FMRA 4I09A 1UB9A 3OYHA 3WE3A 1RPWA 2ZXJA 2P4WA 3WU0A 5IOYA 2HVRA 2DA5A 1MMDA 2IEKA 4A0YA 4BXUA 1XSDA 3LSPA 1ZG5A 3E97A 3EDPA 2VXZA 4WF2A 2ISZA 3E3VA 3L09A 3T5XA 5M3MJ 3DFGA 2XGDA 2O0YA 3LOCA 2LF7A 5FRMA 2P8TA 2PLYA 1BI1A 3ZQ7A 1IN4A 3K1NA 4KN4X 3MEXA 4CH7A 2X9DA 3OV8A 4YG2F 1VQ8I 5FD6A 3U2RA 2ZO4A 4FASD 1K78A 4HQMA 4RB2C 4X1EA 3S17J 2JA7J 4R1HA 4AYBN 4R79A 2LKXA 2JVGA 5DTDA 5J47A 2EFNA 4A3DJ 1MBFA 1S7OA 1IXRC 3BR0A 3L00A 4ETSA 1DDNA 4G7OF 5J1RA 2L2OA 1A6QA 1FTZA 1MDMB 1T95A 1ZLJA 3PSIA 4EEFG 1HCRA 2DPUA 2D1HA 3L2VA 3HSFA 2X1CA 3W6JB 2JT1A 5GPAA 2A5YB 2P0WA 1OFCX 1MNDA 2YPRA 2OBPA 2ZXWH 2DXIA 3T1BA 2CO5A 4WXHA 1U0JA 1TWHJ 3LSRA 3OOPA 3JTGA 2MGQA 3P9KA 4AUXA 1UFMA 2FEZA 4NC7A 1Y1VJ 1B1BA 2IS6A 2KZVA 4I01A 1U8BA 1YHQI 1Z6TA 4I2OA 3JR9A 1HKTA 2F5CA 2QQ8A 2R0QC 3C3WA 3EUHA 1HKSA 1I39A 3AFHA 2VB6A 3MWMA 3OYMA 2F4MB 2PG4A 3HRUA 2A69F 4HX4A 4HBLA 1LEBA 3PFYA 1XMAA 1T98A 2V9PA 2XKPA 5D8KB 2UZKA 4JK1X 3S14J 2K5CA 2BE5F 1B4AA 1PP8F 5HLIA 3CJTB 2EILH 1JTYA 2DT5A 3PUFA 4YRVA 3M8FA 3F8NA 3U21A 3K4NA 4ZDLA 1QPIA 3KZIC 2ZNYA 4QIWN 1H8AC 2XGCA 3I4NJ 5KCMA 4XLEA 4AIJA 2CQQA 1OR7C 2KRHA 3CMEI 1B8IA 4DJAA 1G3SA 4LG0B 2N8GA 3M8JA 5ERIA 4OAYA 1VZ0A 4BQNA 2ID3A 4IQ4A 3NAUA 4GYIA 2CG4A 1WSUA 2EJRA 3MZ8A 2DA6A 3L7WA 3BDDA 1SMTA 3WTXC 3HIFA 1SAUA 1XSXA 2DDBA 2M4GA 3N97A 4X0GA 5BNGA 3AG1H 2E5NA 2DA7A 3OYCA 5E3LA 4A0XA 4OINF 2PMHA 2G7UA 5FKKA 5H20A 1G3WA 5F08A 2VQLA 1AHDP 3I9V2 2E1NA 4Q5SF 3PFIA 2EZLA 5M5XJ 5E3MA 3ECOA 3I54A 4U87A 2BHZA 2OZ6A 3KP3A 1JXSA 2IVMA 2J5PA 2VKVA 4HF0A 3WU1B 4G94A 4AM3A 2VLAA 4ZYDA 4AYBA 3IH2A 2LOOA 3IWFA 1P4XA 1C0WA 1Z67A 1KQ0A 2R3SA 3DKXA 2LY2A 4F7ZA 4B3XA 2NRAC 3I5UA 4Q47A 2VBWA 3GTLJ 2EIMH 2XUBA 2M8EA 5DUKA 5LGNA 1LDDA 4XN0A 1UZCA 3B02A 3IH4A 2L9SA 2RDPA 4UVAA 1HLVA 4MHGA 3FK6A 2CYYA 4BXFA 4BJ6C 3GCMA 2HVSA 4M9ZA 3MFKA 3TGNA 1NK3P 3BTIA 3W6VA 3JREA 1GVJA 4N4OB 2O3FA 1P2FA 5C4XJ 2HZTA 2WB1N 3KCCA 3LSIA 3IWZA 1L3LA 1FTTA 4OIQF 4JP0A 2HI3A 2MA3A 1ERDA 1JKRC 2V7FA 4IJAA 3E5XA 5B1BH 1ORKA 1J5YA 1W5CC 5IYDJ 4IVNA 4CDGA 3QAHA 3TQNA 3FXMA 4BXXJ 5FFXA 2XGXA 2EFQA 4CA0A 2R7OA 2W84A 3ZQFA 1T6SA 2M30A 2STWA 2CQNA 4WWCA 4IL6C 4B8XA 2Y2ZA 2EZHA 1ZH5A 2K9QA 4Z2YA 1MSFC 2IS2A 1QA6A 3LAJA 1GV5A 1XB4A 4H0EA 2JN6A 2OF7A 2A61A 2MD0A 3ONQA 3LNQA 1IF1A 1CGPA 4C2TA 2Z33A 2W7NA 4WCGA 1Y1WJ 4RGXA 2CUFA 1OCZH 1IN5A 2QZ8A 3S32A 5JLXA 2MLKA 3H5AA 4BDZA 1F36A 1P4AA 3BG5A 4WXDA 4W97A 2O9LA 4PJLA 5K5RA 4RB0A 3CF5F 3TW7A 1B72B 3A03A 3K4CA 3VSKA 3IKTA 4C3IJ 1J2XA 3WODF 1IDZA 1V4RA 1Z7UA 1UG2A 2LSOA 2D45A 1PUEE 1BC8C 1E3PA 2RQPA 4BQAA 3H5RA 2BOLA 1OCOH 1B59A 5LEKA 3PQKA 4RAFA 1SD6A 3PQJA 2QSFX 4DIQA 2O7OA 5B1AH 1W36C 4I99C 1WI9A 1LQ1A 3GTMJ 3OYIA 4DW6A 1MNMC 5LEJA 3GUDA 1X1DA 2K9MA 2X6YA 3LSTA 5F27A 1U5TC 2L4MA 1X19A 4HZFA 4CCMA 5ILVA 2GOXB 2R5ZA 4L5EA 1WJFA 1YX3A 2HOSA 1MNEA 3DU6A 3K7AJ 1XGSA 2R7WA 1JGGA 4UUTA 1D5VA 4I0AA 1IUFA 3K4KA 2R7VA 4I02A 1SANA 1IXCA 1DUXC 4DYQA 1EH6A 1KU3A 1W7PA 3EPZA 3K10A 3K2ZA 4ASNA 4F92B 3RJPA 2GXGA 2F5EA 1S8NA 2Q2EA 2ISYA 1TNTA 5EGOA 1FMVA 4BJTA 4EM1A 4MFEA 4XKWA 4FHTA 2GQQA 3DEWA 3CUOA 1X2NA 1KONA 4O5VA 5E79C 2A6HF 2LNBA 3VFZA 2PJRA 2VASA 4Q48A 4ZYGA 2VUMJ 3GBGA 4II3A 2KKOA 3KP2A 2HQRA 2HOAA 4HAMA 3JRDA 4EJTA 5JHFA 4U88A 3WGIA 2W4SA 4J19A 3GXOA 2DPDA 2NS0A 2BZTA 2ADUA 5F1JA 1O3RA 1YE9A 2F4IA 2VN2A 2H94A 1SFXA 3J7ZI 4C9YA 3L2UA 1GUUA 3RKYA 3ABKH 2Y48A 1V55H 3ABTA 2H27A 4KNYA 2J5OA 1YOVB 2E7XA 2LRDA 1NG6A 1QRYA 2DOEA 4BHBA 3PSFA 3HM5A 3QODA 4IRIA 2XB5A 3H9QA 1S7AA 2LFBA 2M5WA 2GBYA 3FHZA 2FBIA 5KAFC 3GWZA 1YJWI 4XIDA 5D4RA 3S93A 1B9MA 2QCOA 2R7DA 4PCQA 4B47A 2IRFG 4EQQA 2A6EF 3VEPA 1MBJA 2H09A 1XGOA 1X3ZB 3K69A 3S1QJ 3BZKA 3CUQC 4FQGA 5EYRA 1ZTRA 1FEXA 2KDOA 1IG7A 3QYFA 2VE9A 1ZG1A 1Z3XA 3DV8A 3L2QA 3UKGA 2W25A 1X1CA 1BA5A 1UAAA 1YO5C 2Y9YA 4AIKA 4AWXB 2BXZA 2L4AA 1Y39A 3RI4A 2CUEA 1JGSA 1LFUP 2DTRA 1HW5A 4XORA 1R5ID 2K3FA 3E1SA 3P7NA 4HX8A 3OYGA 5KK1A 4IHYA 3L2RA 2Y75A 4ANJA 4DBRA 3HOXJ 1YRNB 3DXJF 2P5VA 4G7HF 4HV6A 1LNWA 2V9VA 4UB6C 2K9LA 2AQFA 3BWGA 3OR2C 2PMZA 3R0JA 3OOUA 2HEOA 1U6GA 2Q8KA 5CQEA 3EQLF 3SFZA 3BJ6A 3VYUB 3CMYA 3A2KA 3I59A 2IA0A 2O5RA 4U7DA 4EGZA 3GTGJ 2ME0A 3KP4A 2W24A 2XPWA 1XS9A 1J09A 5GPCA 1F5TA 2WAFA 1SEUA 5LFAA 1BL0A 2HDWA 1IN8A 2LG4A 5JHUA 2FQ4A 2Q1ZB 4BHPA 3BG9A 2CWEA 1YJNI 3G73A 4F93B 2V26A 4P9FA 1IW7F 5EZHA 4ENNA 3OIQA 1AKHA 3PNTA 3OL4A 5KVRA 1ETXA 3DCFA 3K6GA 2MC4A 3PUBA 5EG0A 2VT2A 2E1CA 3GTPJ 3NWTA 3AAFA 3OYEA 4HDUA 2O8KA 2XRLA 2OAZA 3CCEI 4QTRA 5C44J 2KJCA 1WRJA 1FYLA 3AL0C 1ZGWA 4XONA 1LFPA 4P5OA 2QGUA 3K4BA 4BH9A 3K4JA 3QPLA 2E71A 3LAPA 3TOBA 2LD5A 4M74A 2FBHA 4ESBA 3HUGB 2V1DA 3A4CA 4MFDA 3CMAI 2JJ7A 3L2CA 4HF2A 1YX5A 2GIZA 2IA1A 5F0CA 2QBYA 1ACIA 2ESHA 2V79A 3J81K 2JUCA 4OIRF 1QQIA 1RUNA 5HNFA 2NVYJ 2ZMEC 2QKLB 2WAQA 3ZQQA 2I10A 5HVQC 3RZOJ 1YJ9I 4K2EA 4HRIA 3ABLH 3OYKA 5M3FJ 2CGPA 3DEEA 4X6AJ 1O57A 5CLSA 1F9NA 2RQQA 3J7AY 2I8DA 1USTA 3A0HC 3P9IA 4NQWB 1BI3A 2X48A 1QO0D 1IRFA 3FX3A 1F4KA 5ICGA 4DGWB 1MD0A 3JAMK 3VYTB 1BM9A 1V3FA 1MJ9A 2R7TA 2DYSH 3H35A 4EJVA 1P7IA 2ZKZA 2M7AA 1FT9A 2Y31A 3GFIA 4KIFA 1QZZA 4QSHA 4D5FA 3WTTC 3SHFA 1AU7A 2JZYA 4LB6B 2M34A 1LEAA 2EA2A 3G71I 4UHTA 2RC4A 4Y3OA 2XPUA 4FX4A 3PO3J 1BIBA 1FP2A 3D5SC 1DP3A 5E20A 1DU6A 4XKCA 2VONA 1ZK8A 5E1ZB 2Z5UA 3LSMA 1MGTA 1W5TA 2KIMA 1WKMA 4PFPA 1JKPC 1EH7A 4PJJA 3W2WA 2FX0A 1JKQC 5AIQA 3RTRA 2HFHA 5H2FC 3U1DA 3MKYB 1OISA 1MH4A 1A31A 1U9OA 3TW6A 4BBRJ 5IPAA 1JJ8C 4OOIA 3WGHA 1FBQA 3JSPA 3V8JA 1X1PA 1ZG3A 3R60A 4MIMA 5LLQA 3DLLF 3ECHA 4YEJA 5DD8A 3E6CC 3SFIA 3BR3A 4HOBA 4LG3A 2DW4A 3F8MA 1MH3A 3HG9A 3QU6A 3LSJA 3LQQA 1Y6IA 2CUZA 4IHWA 1ON2A 4LLGF 1A6IA 4A3BJ 2JRMA 3BR6A 1YITI 1XGMA 1QZEA 1O7LA 2FA5A 2GWRA 3KIOA 4HQEA 2IS1A 3GFMA 2XSDC 3FDYA 3DPUA 5ICEA 3IRQA 1R22A 1UJ8A 3RYPA 1BR1A 1X3UA 1FPQA 1JKOC 2I5UA 2IGOA 4E70A 5FLXZ 4OMYA 2P5LC 1QNTA 3BG6A 3S15J 3CLQA 1QHHD 1KU2A 3B6CA 1IXSB 1T2KA 3CDIA 3KYDB 4PJMA 2K40A 1CQTA 1FC3A 1WZ2A 4YIFA 1T56A 1P4WA 2MLGA 4DBQA 2AQEA 3VYRB 3HOUJ 1LJ9A 3WTZA 2EK5A 4NNJA 2PI0A 1O7FA 1HBXG 1QGPA 1WCMJ 2XF7A 4MLOA 1R49A 2LKSA 2F4OB 1IRXA 4EV0A 3GZ6A 4ZYAA 4E7KA 4LIVA 2QM3A 3ZOBA 2M9HA 4PK4A 4YIIA 4AVZA 1FIPA 2M0MA 3I64A 2MBFA 2VXDA 2UXXA 2XAUA 1A36A 2WV0A 4KMFA 2L9RA 3ERMA 1IGNA 2HR3A 2O6GE 4A6DA 4PGGA 3E6MA 1WJBA 5M5WJ 3VODA 4G9YA 1WH5A 2BY0A 4ZJZA 5DM6F 1T33A 3CCJI 5JVTA 3ESWB 2JA6J 3HTUA 5LHHA 2VBZA 1FYMA 4GRIA 3K1PA 4UB8C 1H89C 1JUMA 1LE8B 4HSRA 5F04A 2DQRA 1RIOH 2NYXA 3PIOF 3HOTA 3BOQA 5FFZA 3S3NA 2XGEA 2HTJA 2DO7A 4YFNF 1MDMA 2V6CA 4BNCA 1LKXA 3DWLE 1ITYA 1BI0A 1YYVA 4LIUA 3TEDA 2ECCA 5HLGA 1GLNA 4QLCU 5E17F 1FNNA 2E2HJ 2IA2A 2HQ5A 5TGTA 1H0MA 2RV8A 2D2WA 1T08B 1T0FA 3DBHB 2ELHA 3G1MA 2R7ZJ 3W3CA 2Z3YA 3QPSA 2DA1A 2FMLA 2TCTA 4JX5A 2A6TA 1RKTA 5L3BA 1SD5A 2DMPA 1D5YA 5K7ZA 1YIJI 1K79A 2H8RA 4LJZF 3S1NJ 3QRFF 2LREA 2Y9ZA 5HS9A 3OSGA 2BEOA 2BHYA 2VPRA 5CPRB 1RC9A 1ZYRF 2H6CA 2L7KA 4KYWA 2Z1DA 5J8CA 1NTCA 4KT5C 2AHQA 4IEJA 2XAQA 3FKJA 4LMYA 1O3QA 2GAUA 1R5GA 3F6OA 3H1CA 3PIPF 2PBIA 1MSEC 5FKNA 2PX9A 3QYBA 2DK8A 3GLLA 4G8XA 3SJMA 4E7ZA 4JX6A 3WTVC 3ZGKA 1D1AA 2FUG2 5DEQA 3FKIJ 4XKBA 1IZ1A 5J6XA 2ZB9A 5HDNA 1GXQA 3IV5A 2YX4A 5J1UA 3GTKJ 1FSEA 2W48A 4KT6A 3WG7H 4CUGA 3DTKA 2EBIA 3ZMSA 1VQMI 1RRJA 1ZRCA 4CZZA 4UV9A 5E1WA 2W57A 1TW3A 2GA1A 4LG0A 3OS1A 3J80Z 3CO6C 1SFUA 2R92J 1MJBA 1LB2A 5EF6A 2A05A 2ESNA 5C3EJ 3HEFA 3I56I 2DA3A 2WTEA 3CJNA 3CMMA 3W6KB 3N4MA 3X2QH 4ZZLA 5LD2C 4RBOA 4UVCA 4RGSA 3OYJA 2NS7A 5DUIA 2GA2A 3S3MA 4XOTA 4B3AA 4O6JA 2FNPA 2GIVA 2KDZA 2WC2A 1ZREA 1OCPA 2MSYA 4CXFA 2QWWA 3VWBA 4IQJA 4A93J 5HODA 1VQ4I 4NC6A 4BUPA 3H0DA 3MQ0A 3BR2A 2DOAA 2VL8A 2X6OA 5GAHJ 4BEHB 3QQAA 1OCTC 4IRGA 2EH3A 2FMYA 3ZN0A 1UHSA 3HPGA 3MD2A 1S9HA 2OCEA 1DP7P 2DJNA 2QUFA 3F6VA 3HYIA 2R7RA 1N25A 5D5XB 2FD5A 3MKLA 1O3SA 4UUSB 1SAXA 1T38A 4L9VA
chains in the Genus database with same CATH topology
1X2NA 1FJLA 2H1KA 2CJJA 2DA4A 3FISA 3M3YJ 2VUMJ 1AKHB 3GBGA 5FKOA 3Q0VA 2CRGA 2HOAA 3JRDA 4CYCB 4I6ZA 3OIOA 5EG0B 1X2MA 1APLC 4J19A 1JUSA 3K2AA 4NDLA 2LTPA 9ANTA 2NOGA 2TRTA 5F1JA 3HBLA 2JK3A 3SDGA 3S2HJ 3ZQCA 4V2GA 1GUUA 2MG4A 4W1UA 2Y0SN 1POGA 1H88C 1JT0A 1IC8A 1QRYA 3E7LA 2L0KA 3HM5A 1IDYA 1X58A 2XB5A 4A3GJ 2LFBA 2GBYA 2NVTJ 3HOYJ 1JJ6C 1ETKA 5FLVA 4XIDA 2QCOA 3GTQJ 4S0HB 5IP9J 1HF0A 2DMTA 3ZQGA 3LSGA 5JLWA 3ZQHA 1MBJA 5IOZA 4C3HJ 1HDPA 3S1QJ 1QVTA 3BQYA 5EYRA 1GT0C 1ZTRA 1FEXA 3HOVJ 1IG7A 4FE4A 1B72A 3UKGA 3RKQA 2ID6A 1BA5A 2HYJA 1ZR4A 2Y9YA 1GVDA 2QF7A 5M5YJ 1UMQA 1JT6A 1IJWC 2CUEA 2NVXJ 2LR8A 3GTOJ 1LFUP 1LFBA 4XRSA 1VI0A 1DU0A 4IHYA 1WI3A 2LLKA 4BKXA 1RESA 3JRAA 3H0GJ 4A3JJ 2HXOA 2MW8A 3HOXJ 1YRNB 3BR5A 1P7JA 1MBKA 3Q3SA 1S7EA 3PO2J 1TWGJ 1MBGA 4IHXA 4A3MJ 3GTJJ 3OOUA 3CMYA 1ETQA 5IP6A 1TWFJ 3MVPA 3GTGJ 2ME0A 1I6HJ 2NVQJ 4MO7A 2XPWA 1XS9A 1BW5A 4M3EA 5GPCA 2YS9A 1BL0A 1K83J 5EZGA 2JWTA 1PUFA 4UUSA 2FQ4A 3PM1A 3BG9A 3OSFA 3S16J 3S1RJ 4DYRA 1Q1VA 5EZHA 3BR1A 1ZR2A 1AKHA 3HDDA 3BTLA 1ETXA 3DCFA 4CYCA 5EG0A 2E2IJ 3GTPJ 1SFOJ 2B63J 3A01B 5DS9A 2O8KA 1OJLA 2XRLA 3S2DJ 4QTRA 3O8GA 4A3KJ 3MN2A 5C44J 2E2JJ 1VNDA 1ZGWA 4XRMA 1PUFB 1JTXA 3FK7A 3QPLA 3JRHA 3H3VK 1BJZA 1WGXA 5FKMA 2LD5A 5GP9A 4MFDA 4DZJA 2JJ7A 4BBSJ 3Q0WA 2L7FP 5F0CA 2DA2A 5J3LA 1MBEA 2NVYJ 1JUPA 2EZIA 3IH3A 2I10A 3RZOJ 2ME6A 3JRFA 1R9TJ 5M3FJ 1B8IB 4X6AJ 3C2BA 1XG1A 5EDNA 5FJ8J 3JRGA 2YU9J 1G2HA 2X48A 1RPWA 5IOYA 1NK2P 4DYCA 2DMUA 2DA5A 2IEKA 4C2MJ 1U9NA 3LSPA 1IV6A 4B1RA 3M4OJ 1GDTA 3RQIA 4D5CA 1K61A 5M3MJ 1P7IA 3JRBA 3LOCA 2XGDA 2XPVA 2RAEA 3CQZJ 2XB0X 2Y31A 1W0UA 2COBA 2X9DA 4D5FA 4QSHA 4BY7J 4M3FA 2R5YB 1AU7A 1GV2A 2M34A 1YRNA 4X1EA 3WHCA 3S17J 3PO3J 2XPUA 5F0HA 2JA7J 1DU6A 4AYBN 1ZK8A 1VFCA 5K7HA 2LKXA 5DTDA 4A3DJ 1MBFA 3ZQIA 2G0EA 3BR0A 1ETWA 1JKPC 5J1RA 3O8HA 1FTZA 2FX0A 4HNVA 1JKQC 2JA5J 4EEFG 1HCRA 1RETA 4A3EJ 5GPAA 1MH4A 2LK2A 2HOTA 4FISA 3L1PA 1OFCX 4LOCA 4GFBA 1U9OA 3TW6A 4BBRJ 5IPAA 1JJ8C 2L7ZA 1TWHJ 3LSRA 4RDUA 2MGQA 4A3LJ 4AUXA 2HXIA 4A3FJ 1WH7A 4MIMA 1Y1VJ 4A3CJ 1U8BA 4IHVA 3SFIA 3BR3A 3JR9A 3B6AA 2R0QC 1MH3A 3LSJA 1O4XA 3G1LA 3A01A 2JMWA 4IHWA 1A6IA 4A3BJ 2CQXA 3BR6A 5IP7J 4V2FA 2XSDC 2D5VA 4FCYA 1ETVA 4BY1J 4Y7NJ 2KT0A 4M6VA 3NARA 3S14J 1JKOC 4Y52J 3HKZN 3JRIA 1I50J 1JTYA 3S15J 1RR7A 2AO9A 4M3BA 4A69C 1HDDC 2LP0A 3B6CA 1QPIA 2DMQA 2K40A 4QIWN 5FLMJ 2XGCA 1H8AC 4AC0A 1T56A 1CQTA 3I4MJ 2Y30A 3I4NJ 2CQQA 2P81A 3HOUJ 1B8IA 2PMZN 4M3DA 2E19A 2N8GA 3CDLA 1WCMJ 4MLOA 2ID3A 3NAUA 3BTCA 4I76A 1HOMA 3TP3A 2YUSA 2DA6A 3BQZA 3ZOBA 2M9HA 1FIPA 5BNGA 2GLOA 2DA7A 5E3LA 2L9RA 4JYKA 1IGNA 5FKKA 3G1OA 5F08A 1AHDP 5M5WJ 1WH5A 1XC5A 1A5JA 2R5ZB 2EZLA 5M5XJ 1T33A 5E3MA 2CU7A 2R5YA 5EEAA 4B4CA 1IRZA 2JA6J 4M3GA 2VKVA 5IYCJ 1QVUA 3IH2A 1RKWA 1H89C 1JUMA 5J1YA 3RZDJ 1LE8B 5F04A 5F0FA 1BW6A 2ELKA 2XGEA 2DN0A 4G12A 3GTLJ 4FE7A 5EGOB 1E3OC 2VKEA 1ITYA 1ZKGA 3HB9A 3TEDA 3IH4A 2ECCA 2WV1A 1HLVA 2R93J 3FK6A 2E2HJ 3HOWJ 5FKLA 2HQ5A 1NK3P 3BTIA 3W6VA 4FTHA 3JREA 2IAIA 4A3IJ 5E3OA 3G1MA 5C4XJ 2R7ZJ 2WB1N 3JRCA 2ECBA 2LVSA 3QPSA 2DA1A 1EF4A 2M2EA 2TCTA 2WAQN 4JX5A 1FTTA 1RKTA 4JP0A 2HI3A 2DMPA 1JKRC 1D5YA 1ZQ3P 1I3QJ 5K7ZA 3HGYA 2H8RA 1ORKA 1TC3C 3S1NJ 1VF9A 5E3NA 2Y9ZA 3BT9A 1TWCJ 2E1OA 3Q0UA 5IYDJ 4BXXJ 3OSGA 2VPRA 2GM4A 3ZQFA 1NTCA 2AHQA 4IEJA 1ENHA 3TP0A 2OPTA 2Y2ZA 2EZHA 2K9QA 2L7MP 1MSFC 1MSEC 5FKNA 1GV5A 2NS8A 2JN6A 2OF7A 2HDDA 3LNQA 3SJMA 1TWAJ 4JX6A 4D7NA 4XK4A 3BTJA 1Y1WJ 3FKIJ 3ZQLA 2CUFA 2ZB9A 3IV5A 5JLXA 5J1UA 3CCYA 3GTKJ 1F36A 2W48A 3BG5A 3VPRA 4W97A 3F0CA 2EBIA 1W0TA 1FIAA 2O9LA 1JGGA 2M0CA 3TW7A 1B72B 2R92J 3A03A 2JA8J 5K7FA 2DMNA 4C3IJ 3HGGA 1IDZA 1Z77A 2M8GX 3FIWA 5EF6A 5C3EJ 1UG2A 3HEFA 2FJ1A 2DA3A 4JX4A 1Z0XA 3WHBA 4XRSG 4RBOA 2NS7A 2O7OA 1WPKA 2EZKA 1MBHA 3GTMJ 4DW6A 4B3AA 1MNMC 5IYBJ 5F27A 2KDZA 5C4JJ 2R5ZA 2LY9A 1F43A 2K9NA 1OCPA 2MSYA 4L5EA 2HOSA 3A02A 2K9SA 4A93J 5HODA 4ABZA 3S1MJ 3K7AJ 2X6OA 3BR2A 2IBDA 4DZPA 3D1NI 2DTZA 3BG3A 3QQAA 4UUTA 4D7MA 1U78A 1OCTC 1IUFA 3HOZJ 2EH3A 1SANA 1LE8A 4DYQA 1UHSA 2VI6A 4XICA 2DJNA 2EQRA 4C3JJ 2FD5A 5EGOA 3MKLA 4MFEA 4UUSB 1ETOA 3DEWA 1ETYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X2N A;  1FJL A;  2H1K A;  2CJJ A;  2DA4 A;  3FIS A;  3M3Y J;  2VUM J;  1AKH B;  3GBG A;  5FKO A;  3Q0V A;  2CRG A;  2HOA A;  3JRD A;  4CYC B;  4I6Z A;  3OIO A;  5EG0 B;  1X2M A;  1APL C;  4J19 A;  1JUS A;  3K2A A;  4NDL A;  2LTP A;  9ANT A;  2NOG A;  2TRT A;  5F1J A;  3HBL A;  2JK3 A;  3SDG A;  3S2H J;  3ZQC A;  4V2G A;  1GUU A;  2MG4 A;  4W1U A;  2Y0S N;  1POG A;  1H88 C;  1JT0 A;  1IC8 A;  1QRY A;  3E7L A;  2L0K A;  3HM5 A;  1IDY A;  1X58 A;  2XB5 A;  4A3G J;  2LFB A;  2GBY A;  2NVT J;  3HOY J;  1JJ6 C;  1ETK A;  5FLV A;  4XID A;  2QCO A;  3GTQ J;  4S0H B;  5IP9 J;  1HF0 A;  2DMT A;  3ZQG A;  3LSG A;  5JLW A;  3ZQH A;  1MBJ A;  5IOZ A;  4C3H J;  1HDP A;  3S1Q J;  1QVT A;  3BQY A;  5EYR A;  1GT0 C;  1ZTR A;  1FEX A;  3HOV J;  1IG7 A;  4FE4 A;  1B72 A;  3UKG A;  3RKQ A;  2ID6 A;  1BA5 A;  2HYJ A;  1ZR4 A;  2Y9Y A;  1GVD A;  2QF7 A;  5M5Y J;  1UMQ A;  1JT6 A;  1IJW C;  2CUE A;  2NVX J;  2LR8 A;  3GTO J;  1LFU P;  1LFB A;  4XRS A;  1VI0 A;  1DU0 A;  4IHY A;  1WI3 A;  2LLK A;  4BKX A;  1RES A;  3JRA A;  3H0G J;  4A3J J;  2HXO A;  2MW8 A;  3HOX J;  1YRN B;  3BR5 A;  1P7J A;  1MBK A;  3Q3S A;  1S7E A;  3PO2 J;  1TWG J;  1MBG A;  4IHX A;  4A3M J;  3GTJ J;  3OOU A;  3CMY A;  1ETQ A;  5IP6 A;  1TWF J;  3MVP A;  3GTG J;  2ME0 A;  1I6H J;  2NVQ J;  4MO7 A;  2XPW A;  1XS9 A;  1BW5 A;  4M3E A;  5GPC A;  2YS9 A;  1BL0 A;  1K83 J;  5EZG A;  2JWT A;  1PUF A;  4UUS A;  2FQ4 A;  3PM1 A;  3BG9 A;  3OSF A;  3S16 J;  3S1R J;  4DYR A;  1Q1V A;  5EZH A;  3BR1 A;  1ZR2 A;  1AKH A;  3HDD A;  3BTL A;  1ETX A;  3DCF A;  4CYC A;  5EG0 A;  2E2I J;  3GTP J;  1SFO J;  2B63 J;  3A01 B;  5DS9 A;  2O8K A;  1OJL A;  2XRL A;  3S2D J;  4QTR A;  3O8G A;  4A3K J;  3MN2 A;  5C44 J;  2E2J J;  1VND A;  1ZGW A;  4XRM A;  1PUF B;  1JTX A;  3FK7 A;  3QPL A;  3JRH A;  3H3V K;  1BJZ A;  1WGX A;  5FKM A;  2LD5 A;  5GP9 A;  4MFD A;  4DZJ A;  2JJ7 A;  4BBS J;  3Q0W A;  2L7F P;  5F0C A;  2DA2 A;  5J3L A;  1MBE A;  2NVY J;  1JUP A;  2EZI A;  3IH3 A;  2I10 A;  3RZO J;  2ME6 A;  3JRF A;  1R9T J;  5M3F J;  1B8I B;  4X6A J;  3C2B A;  1XG1 A;  5EDN A;  5FJ8 J;  3JRG A;  2YU9 J;  1G2H A;  2X48 A;  1RPW A;  5IOY A;  1NK2 P;  4DYC A;  2DMU A;  2DA5 A;  2IEK A;  4C2M J;  1U9N A;  3LSP A;  1IV6 A;  4B1R A;  3M4O J;  1GDT A;  3RQI A;  4D5C A;  1K61 A;  5M3M J;  1P7I A;  3JRB A;  3LOC A;  2XGD A;  2XPV A;  2RAE A;  3CQZ J;  2XB0 X;  2Y31 A;  1W0U A;  2COB A;  2X9D A;  4D5F A;  4QSH A;  4BY7 J;  4M3F A;  2R5Y B;  1AU7 A;  1GV2 A;  2M34 A;  1YRN A;  4X1E A;  3WHC A;  3S17 J;  3PO3 J;  2XPU A;  5F0H A;  2JA7 J;  1DU6 A;  4AYB N;  1ZK8 A;  1VFC A;  5K7H A;  2LKX A;  5DTD A;  4A3D J;  1MBF A;  3ZQI A;  2G0E A;  3BR0 A;  1ETW A;  1JKP C;  5J1R A;  3O8H A;  1FTZ A;  2FX0 A;  4HNV A;  1JKQ C;  2JA5 J;  4EEF G;  1HCR A;  1RET A;  4A3E J;  5GPA A;  1MH4 A;  2LK2 A;  2HOT A;  4FIS A;  3L1P A;  1OFC X;  4LOC A;  4GFB A;  1U9O A;  3TW6 A;  4BBR J;  5IPA A;  1JJ8 C;  2L7Z A;  1TWH J;  3LSR A;  4RDU A;  2MGQ A;  4A3L J;  4AUX A;  2HXI A;  4A3F J;  1WH7 A;  4MIM A;  1Y1V J;  4A3C J;  1U8B A;  4IHV A;  3SFI A;  3BR3 A;  3JR9 A;  3B6A A;  2R0Q C;  1MH3 A;  3LSJ A;  1O4X A;  3G1L A;  3A01 A;  2JMW A;  4IHW A;  1A6I A;  4A3B J;  2CQX A;  3BR6 A;  5IP7 J;  4V2F A;  2XSD C;  2D5V A;  4FCY A;  1ETV A;  4BY1 J;  4Y7N J;  2KT0 A;  4M6V A;  3NAR A;  3S14 J;  1JKO C;  4Y52 J;  3HKZ N;  3JRI A;  1I50 J;  1JTY A;  3S15 J;  1RR7 A;  2AO9 A;  4M3B A;  4A69 C;  1HDD C;  2LP0 A;  3B6C A;  1QPI A;  2DMQ A;  2K40 A;  4QIW N;  5FLM J;  2XGC A;  1H8A C;  4AC0 A;  1T56 A;  1CQT A;  3I4M J;  2Y30 A;  3I4N J;  2CQQ A;  2P81 A;  3HOU J;  1B8I A;  2PMZ N;  4M3D A;  2E19 A;  2N8G A;  3CDL A;  1WCM J;  4MLO A;  2ID3 A;  3NAU A;  3BTC A;  4I76 A;  1HOM A;  3TP3 A;  2YUS A;  2DA6 A;  3BQZ A;  3ZOB A;  2M9H A;  1FIP A;  5BNG A;  2GLO A;  2DA7 A;  5E3L A;  2L9R A;  4JYK A;  1IGN A;  5FKK A;  3G1O A;  5F08 A;  1AHD P;  5M5W J;  1WH5 A;  1XC5 A;  1A5J A;  2R5Z B;  2EZL A;  5M5X J;  1T33 A;  5E3M A;  2CU7 A;  2R5Y A;  5EEA A;  4B4C A;  1IRZ A;  2JA6 J;  4M3G A;  2VKV A;  5IYC J;  1QVU A;  3IH2 A;  1RKW A;  1H89 C;  1JUM A;  5J1Y A;  3RZD J;  1LE8 B;  5F04 A;  5F0F A;  1BW6 A;  2ELK A;  2XGE A;  2DN0 A;  4G12 A;  3GTL J;  4FE7 A;  5EGO B;  1E3O C;  2VKE A;  1ITY A;  1ZKG A;  3HB9 A;  3TED A;  3IH4 A;  2ECC A;  2WV1 A;  1HLV A;  2R93 J;  3FK6 A;  2E2H J;  3HOW J;  5FKL A;  2HQ5 A;  1NK3 P;  3BTI A;  3W6V A;  4FTH A;  3JRE A;  2IAI A;  4A3I J;  5E3O A;  3G1M A;  5C4X J;  2R7Z J;  2WB1 N;  3JRC A;  2ECB A;  2LVS A;  3QPS A;  2DA1 A;  1EF4 A;  2M2E A;  2TCT A;  2WAQ N;  4JX5 A;  1FTT A;  1RKT A;  4JP0 A;  2HI3 A;  2DMP A;  1JKR C;  1D5Y A;  1ZQ3 P;  1I3Q J;  5K7Z A;  3HGY A;  2H8R A;  1ORK A;  1TC3 C;  3S1N J;  1VF9 A;  5E3N A;  2Y9Z A;  3BT9 A;  1TWC J;  2E1O A;  3Q0U A;  5IYD J;  4BXX J;  3OSG A;  2VPR A;  2GM4 A;  3ZQF A;  1NTC A;  2AHQ A;  4IEJ A;  1ENH A;  3TP0 A;  2OPT A;  2Y2Z A;  2EZH A;  2K9Q A;  2L7M P;  1MSF C;  1MSE C;  5FKN A;  1GV5 A;  2NS8 A;  2JN6 A;  2OF7 A;  2HDD A;  3LNQ A;  3SJM A;  1TWA J;  4JX6 A;  4D7N A;  4XK4 A;  3BTJ A;  1Y1W J;  3FKI J;  3ZQL A;  2CUF A;  2ZB9 A;  3IV5 A;  5JLX A;  5J1U A;  3CCY A;  3GTK J;  1F36 A;  2W48 A;  3BG5 A;  3VPR A;  4W97 A;  3F0C A;  2EBI A;  1W0T A;  1FIA A;  2O9L A;  1JGG A;  2M0C A;  3TW7 A;  1B72 B;  2R92 J;  3A03 A;  2JA8 J;  5K7F A;  2DMN A;  4C3I J;  3HGG A;  1IDZ A;  1Z77 A;  2M8G X;  3FIW A;  5EF6 A;  5C3E J;  1UG2 A;  3HEF A;  2FJ1 A;  2DA3 A;  4JX4 A;  1Z0X A;  3WHB A;  4XRS G;  4RBO A;  2NS7 A;  2O7O A;  1WPK A;  2EZK A;  1MBH A;  3GTM J;  4DW6 A;  4B3A A;  1MNM C;  5IYB J;  5F27 A;  2KDZ A;  5C4J J;  2R5Z A;  2LY9 A;  1F43 A;  2K9N A;  1OCP A;  2MSY A;  4L5E A;  2HOS A;  3A02 A;  2K9S A;  4A93 J;  5HOD A;  4ABZ A;  3S1M J;  3K7A J;  2X6O A;  3BR2 A;  2IBD A;  4DZP A;  3D1N I;  2DTZ A;  3BG3 A;  3QQA A;  4UUT A;  4D7M A;  1U78 A;  1OCT C;  1IUF A;  3HOZ J;  2EH3 A;  1SAN A;  1LE8 A;  4DYQ A;  1UHS A;  2VI6 A;  4XIC A;  2DJN A;  2EQR A;  4C3J J;  2FD5 A;  5EGO A;  3MKL A;  4MFE A;  4UUS B;  1ETO A;  3DEW A;  1ETY A; 
#chains in the Genus database with same CATH topology
 1FJL A;  2H1K A;  3QU3 A;  4N9I A;  2CJJ A;  2RNJ A;  4M72 A;  3FIS A;  2HGC A;  4OWR B;  1Y8R B;  1TQM A;  2JRT A;  2KFD A;  2Y0M A;  4RAY A;  1IRG A;  4I6Z A;  3OIO A;  3WU2 C;  2UUZ A;  3DF8 A;  2FOK A;  3K2A A;  2XC7 A;  1BIA A;  4ENM A;  3CCU I;  1JHF A;  3ULQ B;  2ZFW A;  3TDU C;  2VQH A;  2GXA A;  3HBL A;  1WJA A;  1S5L C;  1XDS A;  1TW2 A;  3WTY C;  3KEO A;  4BHC A;  2DI3 A;  3ROU A;  4KA4 A;  2PQ8 A;  4W1U A;  1QU3 A;  2CH0 A;  1H88 C;  1R6R A;  2WAD A;  1JT0 A;  5D8L B;  3TMO A;  3KYL A;  1IC8 A;  5LGU A;  2HDC A;  5FGM A;  2HTS A;  2QEN A;  4KJZ A;  5FB2 A;  2DFI A;  2NVT J;  3D5L A;  3DPT A;  5A2Q Z;  3G2B A;  1TZL A;  3FXO A;  2R7S A;  1JE8 A;  3HL2 A;  4P96 A;  1U5T B;  4CCK A;  1HF0 A;  2DMT A;  4UUV A;  3HSR A;  3RPU A;  3LSG A;  3EUH C;  3IRR A;  3H9G A;  3ZQH A;  4EMS A;  5IOZ A;  2RRE A;  1HDP A;  2FE3 A;  3RSN A;  6PAX A;  3MZY A;  1WJD A;  4B09 A;  2JQ7 A;  1UHW A;  3Q5F A;  3F22 A;  4BGD A;  3DKW A;  1G3Y A;  3BPX A;  1B72 A;  3EUK L;  2ID6 A;  2HYJ A;  1F1Z A;  3RIR A;  3F8F A;  1JT6 A;  3GTO J;  4FX0 A;  1AA7 A;  2VBY A;  4XRS A;  2OV7 A;  1J75 A;  3HPH A;  3RQ4 A;  5BPD A;  2EFW A;  2KHM A;  4P55 A;  3GW2 A;  3BR5 A;  3ZMU A;  1P92 A;  4RLQ A;  4EJU A;  1V5E A;  1P7J A;  3Q3S A;  5ICF A;  5JFR A;  3MCZ A;  3SEQ A;  2ZXH A;  1G8X A;  2BW3 B;  4IHX A;  3GTJ J;  4KIC A;  4Q4Z F;  2AXT C;  2KJB A;  3G4S I;  2STT A;  4HNT A;  2VQG A;  2DBB A;  3KP7 A;  2P7C B;  2QSG X;  3KLO A;  1MMS A;  1I6H J;  2NVQ J;  5F1R A;  4MO7 A;  1JI8 A;  2RKH A;  4G6Q A;  4RM3 A;  3BCA A;  3K0L A;  4M3E A;  4YEL A;  1YI2 I;  2WWY A;  1LPQ A;  2QEX I;  3UNG C;  3FM5 A;  3PNY A;  3Q9S A;  3CCQ I;  1XTA A;  1K83 J;  3LA7 A;  5EZG A;  3PM1 A;  4XSX F;  1G4D A;  2XVC A;  3M8E A;  2FSW A;  1DPR A;  4ENK A;  1Q1V A;  3HDD A;  4M9X A;  2JPC A;  3BTL A;  3FZV A;  5BMZ A;  5L3E A;  3SZP A;  2MC3 A;  2PEX A;  4M9S A;  1Y0U A;  2ELJ A;  1J0R A;  1TLH B;  3PL8 A;  4EGY A;  1R36 A;  3FWE A;  3A01 B;  2VOO A;  5J40 A;  1OJL A;  2VT3 A;  4LIT A;  3CUQ B;  4D0P A;  2B9S A;  2CV1 A;  4A3K J;  2E2J J;  5D5V B;  2W00 A;  2K27 A;  1HW2 A;  1R1U A;  4XRM A;  2ZFU A;  2F2E A;  3IHU A;  5ED4 A;  5IT9 K;  1MMN A;  1X3W B;  1BR2 A;  5TIS C;  1WGX A;  4D1Q A;  4AVP A;  3OYD A;  3TO7 A;  3Q0W A;  3ZMD A;  2IP2 A;  1MMG A;  2EV6 A;  5J3L A;  1CF7 A;  2WB1 A;  3F3X A;  1MBE A;  2KIF A;  2FNA A;  1WVR A;  2HQN A;  3M07 A;  3VB2 A;  4AIH A;  5CKT A;  1XMK A;  2CFO A;  2WY7 Q;  4LK0 F;  3VSL A;  2E34 A;  4QPO A;  3C2B A;  2E5Z A;  3W2V A;  3C7J A;  5EDN A;  1OPC A;  5FJ8 J;  1NH3 A;  3GYH X;  2DMU A;  4RAZ A;  1B6A A;  2L3D A;  5DYM A;  4B1R A;  5E1X A;  3M4O J;  2HYG D;  1GDT A;  3HOS A;  1IUY A;  5HDG A;  3RQI A;  1K4T A;  2IGN A;  4KUM A;  1CF7 B;  3JRB A;  2XPV A;  2RAE A;  2XB0 X;  4M6X A;  3KLN A;  1X1B A;  2E7W A;  1W0U A;  3DLA A;  1HW1 A;  3ZXS A;  4BY7 J;  4M3F A;  3TL4 X;  4IPA A;  2R5Y B;  1GV2 A;  5CVU A;  1IAW A;  1YRN A;  3KE2 A;  1S29 A;  2DAO A;  4B44 A;  2DU9 A;  5F0H A;  3FMS A;  2ZJQ F;  3IL2 A;  1VFC A;  3H5N A;  2VOD A;  4M73 A;  1S3J A;  1D0Y A;  1OKR A;  1IO2 A;  3FMQ A;  3GME A;  3LWF A;  2Z99 A;  2BBY A;  3K9T A;  1MJA A;  3R0A A;  4RAG A;  5HDK A;  3AL0 B;  2ZC2 A;  3CC4 I;  1ODD A;  1RET A;  4EVI A;  5K5O A;  1V54 H;  3F9K A;  4A3E J;  3MZH A;  3GFJ A;  2OZU A;  3UR3 C;  3JSO A;  2R7Q A;  2HOT A;  4LOC A;  4ITV A;  1G59 A;  1RI7 A;  2DFH A;  4KIG A;  3W2A A;  4NC8 A;  4HX7 A;  2DLL A;  4XLH A;  4CIC A;  2L7Z A;  4XR6 A;  3HRT A;  1WJC A;  1TTY A;  4RDU A;  4A3L J;  2HXI A;  3I58 A;  3FXJ A;  4A3F J;  2CW0 F;  2ZME B;  4OAZ A;  4A3C J;  2CQ7 A;  2A3S A;  2V1U A;  4RB3 C;  4ON0 A;  3ASO H;  3K1M A;  1LVA A;  2NOJ B;  3CJR B;  3G1L A;  4KIB A;  2JMW A;  3QP6 A;  3CZ6 A;  1Y56 A;  3TDZ C;  3ABU A;  1E3H A;  2LBF B;  4V2F A;  3OYL A;  1DPU A;  2FQ3 A;  4CYD A;  2D5V A;  4FCY A;  4CGZ A;  2K85 A;  3F72 A;  4UY8 I;  2CSO A;  3NRV A;  1Z7L A;  2KT0 A;  1I1G A;  3IC7 A;  4M6V A;  4XOP A;  4XLP F;  2JPB A;  2W1O A;  3OMY A;  3HUG A;  3HKZ N;  2XIG A;  1KYZ A;  2PN6 A;  3KFW X;  4LLL A;  4PFO A;  1I50 J;  2KL4 A;  5JR3 A;  1RR7 A;  2AO9 A;  3QWL A;  2CFX A;  4M3B A;  1HDD C;  4NB5 A;  2LP0 A;  1PP7 U;  4IHS A;  1D1B A;  3F8B A;  5FLM J;  4UV8 A;  2H1L A;  4AC0 A;  1XN7 A;  3I4M J;  2Y30 A;  2P81 A;  2KRC A;  1EH8 A;  4L9T A;  4EAT A;  1DQU A;  1VQP I;  1D3Y A;  4NQW A;  3CDL A;  3U1K A;  3M7G A;  3FF5 A;  4U0W A;  4L9J A;  1DGR M;  3O2P E;  3TP3 A;  3QOE A;  1RUO A;  4ZDP A;  2YUS A;  3L9F A;  4MTD A;  4D9J A;  2XF6 A;  4PDK A;  2L9N A;  4HYE A;  4MEX F;  4Y15 A;  4ESF A;  3CLO A;  2IGK A;  1E2X A;  5HS7 A;  3D0S A;  1YFH A;  3CES A;  2GLO A;  4JYK A;  5GTI C;  2NVU B;  1TNS A;  2C6Y A;  3QPT A;  2O8X A;  2ZSI B;  2XRN A;  3U9G A;  4DNC A;  5HLH A;  4BL0 B;  1LDJ A;  4ZTJ A;  3TOA A;  1IRZ A;  3DTI A;  4BYY A;  1QHG A;  2LY1 A;  5IYC J;  4HST A;  1QPM A;  1QVU A;  2QSH X;  2K4J A;  3IKV A;  5F0F A;  1ONV A;  2L54 A;  2ELK A;  2H8W A;  3ZN1 A;  4IXA A;  2E1M C;  2IXS A;  5HOO A;  2DN0 A;  4HPQ A;  1EJ9 A;  4YFX F;  4FE7 A;  1E3O C;  2L02 A;  2KMU A;  5E8G A;  1XPX A;  3S8P A;  2R7U A;  2OC6 A;  1ZKG A;  2RNG A;  3HB9 A;  3V7C A;  5BOX A;  4OIO F;  3M1C A;  2WV1 A;  2G7H A;  3SYT A;  2OTJ I;  1R1V A;  2KIS A;  4I98 B;  2FBK A;  2O03 A;  1TT5 B;  3ML6 A;  3IAS 2;  1KU7 A;  2CW7 A;  4FTH A;  2F48 A;  5E3O A;  5EJC A;  2VOP A;  2MD5 A;  3B73 A;  1MIJ A;  2MH9 A;  2ECB A;  4G7Z F;  3KZZ A;  2M2E A;  3V8L A;  1EF4 A;  4ENJ A;  3ELK A;  4F91 B;  1ZQ3 P;  5CVR A;  1TT0 A;  2BGC A;  4S05 A;  1OQY A;  1TC3 C;  1KQ9 A;  1FBU A;  5E3N A;  5DCM B;  1I1S A;  1TWC J;  2E1O A;  2HWV A;  1D0Z A;  3K4M A;  4KN7 X;  5BPI A;  3ZPL A;  3T8R A;  4E7L A;  2GM4 A;  4NHJ A;  4F52 A;  4MGR A;  2K4B A;  1Z1D A;  2EV0 A;  1R4N B;  1ENH A;  4N0B A;  1VQL I;  1VTN C;  1XDU A;  1TQI A;  2L9V A;  2XAG A;  2X6W A;  5DDG A;  3ZP5 A;  2XAS A;  3MAJ A;  4CHU A;  4JOM A;  4Y17 A;  1YLF A;  2NS8 A;  2HDD A;  2EPF A;  1B9N A;  1H9G A;  2K7L A;  3OY9 A;  4KDP A;  4XK4 A;  2EFO A;  3BTJ A;  4BQO A;  2BXY A;  4L0Z B;  1SD4 A;  3ZQL A;  3WGG A;  3F21 A;  5D6E A;  3OYF A;  3K70 C;  4PUS A;  1FWZ A;  3VPR A;  3F0C A;  1WFX A;  3GX4 X;  3VDX A;  2VPL A;  2CS3 A;  2DMN A;  5F64 A;  5LBQ A;  3HGG A;  3G6E I;  2ACJ A;  5J4V A;  4HF1 A;  3KEQ A;  5LGT A;  4HG2 A;  2Z9O A;  3J7A O;  2HOE A;  1IN7 A;  2LDU A;  3LA3 A;  4HV5 A;  4JX4 A;  5EEG A;  1R23 A;  1G3T A;  2DQL A;  1ULY A;  4OMZ A;  1WPK A;  4QWQ A;  4KFC A;  3R6S A;  3S2W A;  1KQ8 A;  1VQO I;  5AIP A;  5C4J J;  2QKM B;  1PDN C;  3J81 Z;  1VQ5 I;  3CTA A;  3WE2 A;  1PJR A;  2RGV A;  2XAJ A;  4ABZ A;  4C2U A;  3D1N I;  4DZP A;  3OYA A;  2DTZ A;  2EIN H;  2YR2 A;  1HKQ A;  3HOZ J;  2EWN A;  4L9N A;  1LE8 A;  4HDV A;  3SDB A;  3J80 K;  4M6Y A;  1E17 A;  2VJ4 A;  2DJI A;  4XIC A;  4JQF A;  3CP2 A;  1SC7 A;  1VQ9 I;  3H36 A;  1OCC H;  2EQR A;  4Y33 A;  5D6F A;  4C3J J;  2MH2 A;  5LRS A;  3OYN A;  4O3M A;  2P7V B;  3AG3 H;  5L3C A;  3JAM Z;  1T8I A;  2IS4 A;  3CO7 C;  5FD5 A;  5B5E C;  3ERE D;  2KZG A;  2VC1 A;  3D5R C;  5FKO A;  3OWT A;  1FY7 A;  4CYC B;  2KIQ A;  4CSW A;  1HA8 A;  4NDL A;  2LTP A;  5IT3 A;  3I4P A;  4IO9 F;  2KIU A;  3DTE A;  1D8K A;  3RKX A;  1OR7 A;  2BV6 A;  3CCL I;  4XN3 A;  2UV1 A;  2W82 A;  2P5K A;  4RMN A;  3RCO A;  2JK3 A;  1QBJ A;  3FXU A;  3M1E A;  2K3P A;  3S2H J;  4V2G A;  2MG4 A;  1LUJ B;  4A2U A;  5D4S A;  2HZD A;  2Y0S N;  3H3U A;  1YIO A;  1YTY A;  3ZMV A;  3E7L A;  2L0K A;  1IDY A;  2Z2S B;  3ABM H;  3I53 A;  3LQR A;  2CW8 A;  2Q0O A;  3HXL A;  3M9A A;  3TO9 A;  3HRM A;  1JJ6 C;  1ETK A;  3P9C A;  5FLV A;  1IV8 A;  4S04 A;  3QOP A;  2ZSH B;  2HPM A;  3GTQ J;  2WY8 Q;  3BJA A;  5JVG F;  3F8C A;  3ZQG A;  5JLW A;  5BQT A;  2RVC A;  4C3H J;  1HXD A;  2AXL A;  3R61 A;  1QVT A;  2HQA A;  3SXY A;  4IX7 A;  4XNF A;  3BQY A;  2PFB A;  3DQV C;  4CCL A;  3HOV J;  5CVI A;  4C30 A;  3BLY A;  1Z3Y A;  3O3K A;  4QPQ A;  3NEU A;  1ZR4 A;  4E7I A;  3TBI A;  3V7S A;  2BY3 A;  5K5Q A;  1GVD A;  2FRH A;  3DU5 A;  5M5Y J;  4XLN F;  4BS9 A;  5BS6 A;  3J7Y J;  2LR8 A;  2OJE D;  3O6B B;  2ZBK A;  5HNH A;  2VJI A;  4EM0 B;  1M1E B;  2E35 A;  4XSZ F;  1WI3 A;  2VBX A;  4RLF A;  2BYV E;  3QYE A;  4YIR X;  2HYF A;  2F5F A;  2W85 A;  4E7S A;  1RES A;  1SVM A;  2DFE A;  5AON A;  5A2Q K;  1LVK A;  4HNU A;  3JRA A;  1K78 B;  2HXO A;  4EJO A;  2G9W A;  3H9J A;  2HU9 A;  2KQR A;  1W7P D;  1FZP B;  2OD5 A;  2JSP A;  1TWG J;  3QPH A;  2CV2 A;  3V4G A;  4IRH A;  4NBQ A;  3T8T A;  4KMU X;  4A3M J;  2F5V A;  1WQ2 A;  5CVV A;  4AD9 A;  4ZH4 F;  3FXR A;  3AG4 H;  4BEH A;  2HPI A;  3JCU C;  3CDH A;  1DGW Y;  3MVP A;  2F6C A;  3REO A;  4BAC A;  4G6T B;  1D8J A;  3MMY B;  4J01 A;  5B3S H;  2YS9 A;  1PUF A;  4UUS A;  3KEY A;  4A6E A;  3OSF A;  3S16 J;  1W1W E;  5F6F A;  1AOY A;  2V1X A;  1RR8 C;  3GFL A;  2PMU A;  4ZDO A;  2E2I J;  2BY1 A;  1ZRD A;  2YU3 A;  4L5J A;  5L3G A;  2JVH A;  1SFO J;  2LMD A;  5DM7 F;  2XAF A;  1YW7 A;  4IKF A;  3S2D J;  3O8G A;  3MN2 A;  4DOZ A;  3FHN A;  3HHH A;  4Y4R A;  4A12 A;  1ZN2 A;  4U0Y A;  1N78 A;  1W4M A;  4I0B A;  1BJA A;  2YSR A;  4BAY A;  1PUF B;  2OQG A;  4GGG A;  2E36 A;  1HSJ A;  5LHI A;  3JRH A;  5LRR A;  2IT0 A;  1BJZ A;  2MFZ A;  5FRN A;  2Y0S A;  1X1A A;  5GP9 A;  5TRD A;  2Y69 H;  4DZJ A;  1E0E A;  4XLC A;  3OS0 A;  1X4P A;  2WA0 A;  1SMY F;  4P9U A;  2L7F P;  1XCV A;  1T0F C;  2HS5 A;  2V9K A;  2JUG A;  1OLT A;  4EJW A;  1N75 A;  3DEU A;  5KAI C;  2EZI A;  3AG2 H;  1UG0 A;  1UEL B;  1SFE A;  2ME6 A;  3HSE A;  2K02 A;  5CYV A;  3JRF A;  1FOK A;  1U5T A;  3G3Z A;  2XHK A;  5FO5 A;  2MAB A;  1B8I B;  4UNO A;  4TV7 A;  3RPQ A;  4U7B A;  3L2W A;  1XG1 A;  2QQ9 A;  1EV7 A;  1TL8 A;  3JRG A;  2EIJ H;  2NNY A;  2YU9 J;  1UCR A;  2FF4 A;  1G2H A;  4BU2 A;  2XKO A;  1NK2 P;  4HW0 A;  3HZJ A;  4DYC A;  4C2M J;  1U3E M;  1U9N A;  1R1T A;  1IV6 A;  3I3L A;  3KYC B;  1K4S A;  4WXC A;  1XCB A;  3QP5 A;  2DCE A;  4D5C A;  1LDK B;  1WJ5 A;  1K61 A;  2R4G A;  4R8H A;  4KIT B;  3CQZ J;  2FXA A;  2CMP A;  2VJ5 A;  1FOW A;  1R5H A;  3HJE A;  2COB A;  2A5W A;  1ZRF A;  2ZJ2 A;  4IHT A;  1P6R A;  5CJ9 A;  2AS5 F;  1KYW A;  3WHC A;  1ZGJ A;  3VOE A;  3WG9 A;  3LMM A;  3WTW C;  3A0B C;  3TKY A;  4BE2 A;  2BW3 A;  3VYS B;  5K7H A;  4XKV A;  1J9I A;  2VKH A;  3RKW A;  4F55 A;  3ZQI A;  2G0E A;  4RA2 A;  1ZGA A;  1ETW A;  3CJQ B;  1TP4 A;  1O3T A;  2HKO A;  3O8H A;  4HNV A;  2JA5 J;  4E4H A;  3BCB A;  1OMI A;  3NQO A;  2WAE A;  3ZR8 X;  1YW9 A;  2LK2 A;  3ASN H;  4FIS A;  3L1P A;  4N9H A;  4GFB A;  2M4K A;  3BC8 A;  4MNU A;  4HA8 A;  1A35 A;  1BI2 A;  2VIX A;  4HLX A;  3K70 D;  1FLI A;  3RDI A;  1BR4 A;  3GZ5 A;  4BE1 A;  5K1Y A;  1WH7 A;  3LFK A;  3WTU C;  1WJE A;  4ZTF A;  4IHV A;  2ZNZ A;  2OA4 A;  1GXP A;  1YW8 A;  2M45 A;  3H92 A;  3BPV A;  1R7J A;  4E7H A;  3B6A A;  4UVB A;  1STZ A;  3F23 A;  2D1V A;  2LH9 A;  4U0V A;  1O4X A;  3A01 A;  2Z16 A;  3BG7 A;  1N77 A;  2ZCW A;  3CUQ A;  1D1C A;  2CQX A;  2IPQ X;  3T0Y A;  5IP7 J;  1R58 A;  2YX7 A;  4B48 A;  2KLO A;  3R4K A;  1ETV A;  4BY1 J;  2GZW A;  4Y7N J;  1XMX A;  3NAR A;  3OS2 A;  4Y52 J;  4OU0 A;  4FET A;  3JRI A;  4L0Y B;  5KNL A;  4GDF A;  2JSC A;  5ILU A;  4LLN A;  2P6T A;  2PJP A;  5FRO A;  4A69 C;  3EET A;  5E18 F;  3AKZ A;  2DFF A;  5GAG J;  2DMQ A;  4PJN A;  4F3Q A;  1VQ7 I;  4PSW A;  3IAM 2;  3V42 A;  2PMZ N;  4M3D A;  2E19 A;  2NXN B;  3S3O A;  3EUA A;  4JBA A;  1FSH A;  3IUO A;  3V8K A;  3I0T A;  2QLZ A;  3BTC A;  4I76 A;  3GO5 A;  3E5Q A;  4Y13 A;  3C1D A;  2ZJP F;  4BDY A;  1HOM A;  1FMW A;  3BQZ A;  4PGH A;  2BVM A;  2QYO A;  1AWC A;  2M7B A;  3GEZ A;  4LD5 A;  2X1D A;  1U2W A;  4GXO A;  1QZY A;  3G1O A;  4IZZ A;  5J4Y A;  1XC5 A;  1A5J A;  2R5Z B;  1MW7 A;  2CU7 A;  3V7R A;  1BOB A;  4ZYH A;  3NWS A;  2R5Y A;  2OU2 A;  1D0X A;  4B4C A;  2OQR A;  3FBI B;  5EEA A;  1G6N A;  1EA3 A;  4M3G A;  3HC7 A;  3CCV I;  3LFU A;  2DOD A;  1RKW A;  2E60 A;  3CP8 A;  5J1Y A;  3RZD J;  3BZC A;  1W7P B;  1BW6 A;  1R4M B;  4ZYE A;  1JHH A;  4G12 A;  3ZMT A;  2Q2E B;  5EGO B;  2VKE A;  5B66 C;  2DT6 A;  3ZMZ A;  1FYK A;  5IY5 H;  4RS8 A;  2EV5 A;  4MEY F;  2JTV A;  2ICW G;  2GXB A;  2R93 J;  1H9T A;  4HEA 2;  2PJR B;  4E7J A;  3HOW J;  3WTS C;  5FKL A;  3PJR A;  1NG7 A;  5LHG A;  3BP8 A;  1U8R A;  4KIS A;  4PSX A;  2IAI A;  4A3I J;  4V19 K;  1R00 A;  3E6D A;  2WBM A;  2JA2 A;  4B43 A;  3FXQ A;  2ZME A;  2M3A A;  4EM2 A;  3JRC A;  2LVS A;  2WAQ N;  2X1E A;  3EYI A;  1KA8 A;  1SVL A;  4WK8 F;  1BOA A;  1I3Q J;  2FU4 A;  2QQA A;  5ICC A;  3EYY A;  4BE0 A;  3HGY A;  3FM3 A;  1OYI A;  2DT7 B;  1VF9 A;  2R7X A;  4XM3 A;  3COA C;  1EKE A;  2EA4 A;  3BT9 A;  1L0O C;  3Q0U A;  2LBF A;  4IOA F;  4XLF A;  5KHD A;  4ZC3 A;  4LFU A;  4RM2 A;  3HTS B;  2M87 A;  2QA4 I;  1S6L A;  2LF8 A;  3LSK A;  5HLT A;  3TP0 A;  2OPT A;  1I5Z A;  1MZB A;  1HST A;  2L7M P;  2OUM A;  4A0Z A;  3C2H A;  2V4J C;  1OCR H;  1IN6 A;  1BN5 A;  3PNV A;  3CC2 I;  3E6B A;  2DOF A;  3JW4 A;  1TWA J;  4GCV A;  4D7N A;  2O61 A;  4M71 A;  1X4O A;  3I71 A;  3JTH A;  1R71 A;  3CCY A;  3DKY A;  3ISP A;  1PYV A;  4NUB A;  1W0T A;  2RN7 A;  1FIA A;  5CQG A;  1Z9C A;  1SVO A;  1FBS A;  2ZXI A;  2M0C A;  2XV4 S;  3OR1 C;  1FX7 A;  2JA8 J;  3FXK A;  5K7F A;  1I27 A;  2E1M B;  3KZY A;  2XDV A;  1ON1 A;  1P9Q C;  1Z6R A;  1Z77 A;  2LC2 A;  2M8G X;  3FIW A;  2VKD A;  4DQ2 A;  2K86 A;  2FJ1 A;  1J7K A;  3GF2 A;  4LB5 A;  4FT8 A;  2KP6 A;  4XRS G;  1Z0X A;  5DV5 A;  3WHB A;  2XRO A;  5IT9 Z;  2EFP A;  3GLX A;  4MTE A;  5ILS A;  2EZK A;  4I7H A;  1MBH A;  3FXL A;  4XRF A;  1OYY A;  1S72 I;  2IW5 A;  1XSV A;  1PVE A;  1ZAR A;  5IYB J;  2F5D A;  5GAE J;  2LY9 A;  1F43 A;  2K9N A;  1T39 A;  2B0L A;  4A5M A;  3A02 A;  1YQA A;  2K9S A;  2KRF A;  3DP7 A;  3S1M J;  2H6B A;  4AU7 A;  2IBD A;  3I59 B;  1U78 A;  1Z05 A;  3BG3 A;  3MKW B;  4D7M A;  4G6D A;  2OCC H;  4GO1 A;  5JI6 A;  2V6E A;  2VI6 A;  4RGU A;  4IOC F;  3HHG A;  2L01 A;  5FLX K;  1RZ4 A;  1SD7 A;  2EB7 A;  1WWX A;  1ETO A;  3SZG A;  1ETY A;  3BZ6 A;  2DA4 A;  2CQK A;  5GTH C;  3M3Y J;  2OTL I;  1K6Y A;  1ZHF A;  3MKZ A;  1AKH B;  3Q0V A;  1VQ6 I;  2CRG A;  2HVQ A;  1VQK I;  2DK5 A;  2CUJ A;  5EG0 B;  1K6O A;  4CCO A;  2IJL A;  1K7A A;  2KPM A;  1X2M A;  1APL C;  2GOM A;  4XL9 A;  1JUS A;  3LA2 A;  3C18 A;  5EEH A;  1Z91 A;  3Q9V A;  1XGN A;  9ANT A;  2NOG A;  2TRT A;  3CCS I;  1Z21 A;  3E5U A;  4L5I A;  3RYR A;  4RGR A;  1GHC A;  2IGM A;  3SDG A;  4CCJ A;  1Y8Q B;  2M1B A;  1Q1H A;  3ZQC A;  5DCM A;  2XSJ C;  1POG A;  3DBL B;  1NHA A;  1ZEL A;  2ETH A;  4XBF A;  3KET A;  4H4K C;  4XLA A;  1RNL A;  3CCR I;  2XAH A;  1X58 A;  2P6S A;  1UHM A;  3LSH A;  2QBY B;  2COM A;  4A3G J;  3H3Z A;  2UWM A;  2QQB A;  3HOY J;  4MQ9 F;  4OIP F;  3E0J B;  4GYG A;  2FOW A;  5DCF A;  4S0H B;  1BC7 C;  5IP9 J;  3HRS A;  3CF2 A;  1USS A;  4PJ0 C;  3SZT A;  1HC8 A;  3KX2 A;  4II2 A;  4LK1 F;  4AID A;  1FOY A;  3IP4 B;  4J00 A;  2BVL A;  1YG2 A;  1GT0 C;  2CV0 A;  1J59 A;  4PZJ A;  1KU9 A;  4FE4 A;  1XD7 A;  4L18 B;  2TDX A;  1OYW A;  4XMY A;  4CO8 A;  3RKQ A;  3KP5 A;  2QF7 A;  1IJW C;  1UMQ A;  2NVX J;  1I6X A;  4HLY A;  5GAD J;  1LFB A;  4IF4 A;  1FP1 D;  1VI0 A;  3DPL C;  1TBX A;  3FBN B;  3HKZ A;  2NAZ A;  2VJJ A;  1DU0 A;  2LLK A;  2BY2 A;  4BKX A;  1MMA A;  3P5J A;  4ZZD A;  2QVO A;  3H0G J;  4A3J J;  2MW8 A;  4A5N A;  4MQV A;  4CZC A;  2VQC A;  3K4L A;  2DYR H;  1MBK A;  4P1W A;  1S7E A;  4RB1 A;  3PO2 J;  1YS7 A;  2UXN A;  1MBG A;  3SEZ A;  5HS8 A;  1WHU A;  2VE8 A;  1W5S A;  1ETQ A;  5IP6 A;  2X6X A;  1TWF J;  3TO6 A;  5D5U B;  3KPH A;  2V1N A;  1A04 A;  1HQC A;  1BW5 A;  5H6R A;  1V5F A;  1MKM A;  2X85 A;  5CVJ A;  5L3D A;  1TQP A;  1FOX A;  2NNN A;  3C2G A;  1ZAO A;  4N4N B;  2JWT A;  4Z6Y A;  4LGW A;  1W36 D;  3OL3 A;  2L5Q A;  1I3A A;  4E6K G;  3S1R J;  3CC7 I;  2X0L A;  3KP6 A;  3ZRG A;  4DYR A;  2B7E A;  3BR1 A;  1ZR2 A;  3GVA A;  1Y0N A;  4BQQ A;  2MYS A;  1REP C;  2LKP A;  3DBR B;  3LL7 A;  2XF5 A;  4CYC A;  4ESJ A;  2VC0 A;  2X51 A;  2ZJR F;  4CCN A;  3CD6 I;  1VQN I;  5J8F A;  2A68 F;  2B63 J;  2LYC A;  4XQF A;  1ZLK A;  5L3F A;  3BJO A;  5DS9 A;  3OYB A;  1BBY A;  3ZCO A;  1SFK A;  3A1Y A;  3OIP A;  2A07 F;  2HKX A;  1VND A;  1KZH A;  1YS6 A;  5D5W B;  3BY6 A;  1JTX A;  5E8I A;  3CCM I;  3FK7 A;  3H3V K;  2EIK H;  1KGS A;  5FKM A;  3BRO A;  3RPU D;  5TJJ A;  2DDA A;  1V5G A;  2X4H A;  5H6Q A;  4YFK F;  4BBS J;  3GZN B;  3I55 I;  2DA2 A;  4WX9 A;  2R7F A;  3SQN A;  3N05 A;  4BJ5 C;  4UXN A;  1XX5 A;  5DD4 A;  1JUP A;  3IH3 A;  1R9T J;  2HNH A;  3FMR A;  4I09 A;  1UB9 A;  3OYH A;  3WE3 A;  1RPW A;  2ZXJ A;  2P4W A;  3WU0 A;  5IOY A;  2HVR A;  2DA5 A;  1MMD A;  2IEK A;  4A0Y A;  4BXU A;  1XSD A;  3LSP A;  1ZG5 A;  3E97 A;  3EDP A;  2VXZ A;  4WF2 A;  2ISZ A;  3E3V A;  3L09 A;  3T5X A;  5M3M J;  3DFG A;  2XGD A;  2O0Y A;  3LOC A;  2LF7 A;  5FRM A;  2P8T A;  2PLY A;  1BI1 A;  3ZQ7 A;  1IN4 A;  3K1N A;  4KN4 X;  3MEX A;  4CH7 A;  2X9D A;  3OV8 A;  4YG2 F;  1VQ8 I;  5FD6 A;  3U2R A;  2ZO4 A;  4FAS D;  1K78 A;  4HQM A;  4RB2 C;  4X1E A;  3S17 J;  2JA7 J;  4R1H A;  4AYB N;  4R79 A;  2LKX A;  2JVG A;  5DTD A;  5J47 A;  2EFN A;  4A3D J;  1MBF A;  1S7O A;  1IXR C;  3BR0 A;  3L00 A;  4ETS A;  1DDN A;  4G7O F;  5J1R A;  2L2O A;  1A6Q A;  1FTZ A;  1MDM B;  1T95 A;  1ZLJ A;  3PSI A;  4EEF G;  1HCR A;  2DPU A;  2D1H A;  3L2V A;  3HSF A;  2X1C A;  3W6J B;  2JT1 A;  5GPA A;  2A5Y B;  2P0W A;  1OFC X;  1MND A;  2YPR A;  2OBP A;  2ZXW H;  2DXI A;  3T1B A;  2CO5 A;  4WXH A;  1U0J A;  1TWH J;  3LSR A;  3OOP A;  3JTG A;  2MGQ A;  3P9K A;  4AUX A;  1UFM A;  2FEZ A;  4NC7 A;  1Y1V J;  1B1B A;  2IS6 A;  2KZV A;  4I01 A;  1U8B A;  1YHQ I;  1Z6T A;  4I2O A;  3JR9 A;  1HKT A;  2F5C A;  2QQ8 A;  2R0Q C;  3C3W A;  3EUH A;  1HKS A;  1I39 A;  3AFH A;  2VB6 A;  3MWM A;  3OYM A;  2F4M B;  2PG4 A;  3HRU A;  2A69 F;  4HX4 A;  4HBL A;  1LEB A;  3PFY A;  1XMA A;  1T98 A;  2V9P A;  2XKP A;  5D8K B;  2UZK A;  4JK1 X;  3S14 J;  2K5C A;  2BE5 F;  1B4A A;  1PP8 F;  5HLI A;  3CJT B;  2EIL H;  1JTY A;  2DT5 A;  3PUF A;  4YRV A;  3M8F A;  3F8N A;  3U21 A;  3K4N A;  4ZDL A;  1QPI A;  3KZI C;  2ZNY A;  4QIW N;  1H8A C;  2XGC A;  3I4N J;  5KCM A;  4XLE A;  4AIJ A;  2CQQ A;  1OR7 C;  2KRH A;  3CME I;  1B8I A;  4DJA A;  1G3S A;  4LG0 B;  2N8G A;  3M8J A;  5ERI A;  4OAY A;  1VZ0 A;  4BQN A;  2ID3 A;  4IQ4 A;  3NAU A;  4GYI A;  2CG4 A;  1WSU A;  2EJR A;  3MZ8 A;  2DA6 A;  3L7W A;  3BDD A;  1SMT A;  3WTX C;  3HIF A;  1SAU A;  1XSX A;  2DDB A;  2M4G A;  3N97 A;  4X0G A;  5BNG A;  3AG1 H;  2E5N A;  2DA7 A;  3OYC A;  5E3L A;  4A0X A;  4OIN F;  2PMH A;  2G7U A;  5FKK A;  5H20 A;  1G3W A;  5F08 A;  2VQL A;  1AHD P;  3I9V 2;  2E1N A;  4Q5S F;  3PFI A;  2EZL A;  5M5X J;  5E3M A;  3ECO A;  3I54 A;  4U87 A;  2BHZ A;  2OZ6 A;  3KP3 A;  1JXS A;  2IVM A;  2J5P A;  2VKV A;  4HF0 A;  3WU1 B;  4G94 A;  4AM3 A;  2VLA A;  4ZYD A;  4AYB A;  3IH2 A;  2LOO A;  3IWF A;  1P4X A;  1C0W A;  1Z67 A;  1KQ0 A;  2R3S A;  3DKX A;  2LY2 A;  4F7Z A;  4B3X A;  2NRA C;  3I5U A;  4Q47 A;  2VBW A;  3GTL J;  2EIM H;  2XUB A;  2M8E A;  5DUK A;  5LGN A;  1LDD A;  4XN0 A;  1UZC A;  3B02 A;  3IH4 A;  2L9S A;  2RDP A;  4UVA A;  1HLV A;  4MHG A;  3FK6 A;  2CYY A;  4BXF A;  4BJ6 C;  3GCM A;  2HVS A;  4M9Z A;  3MFK A;  3TGN A;  1NK3 P;  3BTI A;  3W6V A;  3JRE A;  1GVJ A;  4N4O B;  2O3F A;  1P2F A;  5C4X J;  2HZT A;  2WB1 N;  3KCC A;  3LSI A;  3IWZ A;  1L3L A;  1FTT A;  4OIQ F;  4JP0 A;  2HI3 A;  2MA3 A;  1ERD A;  1JKR C;  2V7F A;  4IJA A;  3E5X A;  5B1B H;  1ORK A;  1J5Y A;  1W5C C;  5IYD J;  4IVN A;  4CDG A;  3QAH A;  3TQN A;  3FXM A;  4BXX J;  5FFX A;  2XGX A;  2EFQ A;  4CA0 A;  2R7O A;  2W84 A;  3ZQF A;  1T6S A;  2M30 A;  2STW A;  2CQN A;  4WWC A;  4IL6 C;  4B8X A;  2Y2Z A;  2EZH A;  1ZH5 A;  2K9Q A;  4Z2Y A;  1MSF C;  2IS2 A;  1QA6 A;  3LAJ A;  1GV5 A;  1XB4 A;  4H0E A;  2JN6 A;  2OF7 A;  2A61 A;  2MD0 A;  3ONQ A;  3LNQ A;  1IF1 A;  1CGP A;  4C2T A;  2Z33 A;  2W7N A;  4WCG A;  1Y1W J;  4RGX A;  2CUF A;  1OCZ H;  1IN5 A;  2QZ8 A;  3S32 A;  5JLX A;  2MLK A;  3H5A A;  4BDZ A;  1F36 A;  1P4A A;  3BG5 A;  4WXD A;  4W97 A;  2O9L A;  4PJL A;  5K5R A;  4RB0 A;  3CF5 F;  3TW7 A;  1B72 B;  3A03 A;  3K4C A;  3VSK A;  3IKT A;  4C3I J;  1J2X A;  3WOD F;  1IDZ A;  1V4R A;  1Z7U A;  1UG2 A;  2LSO A;  2D45 A;  1PUE E;  1BC8 C;  1E3P A;  2RQP A;  4BQA A;  3H5R A;  2BOL A;  1OCO H;  1B59 A;  5LEK A;  3PQK A;  4RAF A;  1SD6 A;  3PQJ A;  2QSF X;  4DIQ A;  2O7O A;  5B1A H;  1W36 C;  4I99 C;  1WI9 A;  1LQ1 A;  3GTM J;  3OYI A;  4DW6 A;  1MNM C;  5LEJ A;  3GUD A;  1X1D A;  2K9M A;  2X6Y A;  3LST A;  5F27 A;  1U5T C;  2L4M A;  1X19 A;  4HZF A;  4CCM A;  5ILV A;  2GOX B;  2R5Z A;  4L5E A;  1WJF A;  1YX3 A;  2HOS A;  1MNE A;  3DU6 A;  3K7A J;  1XGS A;  2R7W A;  1JGG A;  4UUT A;  1D5V A;  4I0A A;  1IUF A;  3K4K A;  2R7V A;  4I02 A;  1SAN A;  1IXC A;  1DUX C;  4DYQ A;  1EH6 A;  1KU3 A;  1W7P A;  3EPZ A;  3K10 A;  3K2Z A;  4ASN A;  4F92 B;  3RJP A;  2GXG A;  2F5E A;  1S8N A;  2Q2E A;  2ISY A;  1TNT A;  5EGO A;  1FMV A;  4BJT A;  4EM1 A;  4MFE A;  4XKW A;  4FHT A;  2GQQ A;  3DEW A;  3CUO A;  1X2N A;  1KON A;  4O5V A;  5E79 C;  2A6H F;  2LNB A;  3VFZ A;  2PJR A;  2VAS A;  4Q48 A;  4ZYG A;  2VUM J;  3GBG A;  4II3 A;  2KKO A;  3KP2 A;  2HQR A;  2HOA A;  4HAM A;  3JRD A;  4EJT A;  5JHF A;  4U88 A;  3WGI A;  2W4S A;  4J19 A;  3GXO A;  2DPD A;  2NS0 A;  2BZT A;  2ADU A;  5F1J A;  1O3R A;  1YE9 A;  2F4I A;  2VN2 A;  2H94 A;  1SFX A;  3J7Z I;  4C9Y A;  3L2U A;  1GUU A;  3RKY A;  3ABK H;  2Y48 A;  1V55 H;  3ABT A;  2H27 A;  4KNY A;  2J5O A;  1YOV B;  2E7X A;  2LRD A;  1NG6 A;  1QRY A;  2DOE A;  4BHB A;  3PSF A;  3HM5 A;  3QOD A;  4IRI A;  2XB5 A;  3H9Q A;  1S7A A;  2LFB A;  2M5W A;  2GBY A;  3FHZ A;  2FBI A;  5KAF C;  3GWZ A;  1YJW I;  4XID A;  5D4R A;  3S93 A;  1B9M A;  2QCO A;  2R7D A;  4PCQ A;  4B47 A;  2IRF G;  4EQQ A;  2A6E F;  3VEP A;  1MBJ A;  2H09 A;  1XGO A;  1X3Z B;  3K69 A;  3S1Q J;  3BZK A;  3CUQ C;  4FQG A;  5EYR A;  1ZTR A;  1FEX A;  2KDO A;  1IG7 A;  3QYF A;  2VE9 A;  1ZG1 A;  1Z3X A;  3DV8 A;  3L2Q A;  3UKG A;  2W25 A;  1X1C A;  1BA5 A;  1UAA A;  1YO5 C;  2Y9Y A;  4AIK A;  4AWX B;  2BXZ A;  2L4A A;  1Y39 A;  3RI4 A;  2CUE A;  1JGS A;  1LFU P;  2DTR A;  1HW5 A;  4XOR A;  1R5I D;  2K3F A;  3E1S A;  3P7N A;  4HX8 A;  3OYG A;  5KK1 A;  4IHY A;  3L2R A;  2Y75 A;  4ANJ A;  4DBR A;  3HOX J;  1YRN B;  3DXJ F;  2P5V A;  4G7H F;  4HV6 A;  1LNW A;  2V9V A;  4UB6 C;  2K9L A;  2AQF A;  3BWG A;  3OR2 C;  2PMZ A;  3R0J A;  3OOU A;  2HEO A;  1U6G A;  2Q8K A;  5CQE A;  3EQL F;  3SFZ A;  3BJ6 A;  3VYU B;  3CMY A;  3A2K A;  3I59 A;  2IA0 A;  2O5R A;  4U7D A;  4EGZ A;  3GTG J;  2ME0 A;  3KP4 A;  2W24 A;  2XPW A;  1XS9 A;  1J09 A;  5GPC A;  1F5T A;  2WAF A;  1SEU A;  5LFA A;  1BL0 A;  2HDW A;  1IN8 A;  2LG4 A;  5JHU A;  2FQ4 A;  2Q1Z B;  4BHP A;  3BG9 A;  2CWE A;  1YJN I;  3G73 A;  4F93 B;  2V26 A;  4P9F A;  1IW7 F;  5EZH A;  4ENN A;  3OIQ A;  1AKH A;  3PNT A;  3OL4 A;  5KVR A;  1ETX A;  3DCF A;  3K6G A;  2MC4 A;  3PUB A;  5EG0 A;  2VT2 A;  2E1C A;  3GTP J;  3NWT A;  3AAF A;  3OYE A;  4HDU A;  2O8K A;  2XRL A;  2OAZ A;  3CCE I;  4QTR A;  5C44 J;  2KJC A;  1WRJ A;  1FYL A;  3AL0 C;  1ZGW A;  4XON A;  1LFP A;  4P5O A;  2QGU A;  3K4B A;  4BH9 A;  3K4J A;  3QPL A;  2E71 A;  3LAP A;  3TOB A;  2LD5 A;  4M74 A;  2FBH A;  4ESB A;  3HUG B;  2V1D A;  3A4C A;  4MFD A;  3CMA I;  2JJ7 A;  3L2C A;  4HF2 A;  1YX5 A;  2GIZ A;  2IA1 A;  5F0C A;  2QBY A;  1ACI A;  2ESH A;  2V79 A;  3J81 K;  2JUC A;  4OIR F;  1QQI A;  1RUN A;  5HNF A;  2NVY J;  2ZME C;  2QKL B;  2WAQ A;  3ZQQ A;  2I10 A;  5HVQ C;  3RZO J;  1YJ9 I;  4K2E A;  4HRI A;  3ABL H;  3OYK A;  5M3F J;  2CGP A;  3DEE A;  4X6A J;  1O57 A;  5CLS A;  1F9N A;  2RQQ A;  3J7A Y;  2I8D A;  1UST A;  3A0H C;  3P9I A;  4NQW B;  1BI3 A;  2X48 A;  1QO0 D;  1IRF A;  3FX3 A;  1F4K A;  5ICG A;  4DGW B;  1MD0 A;  3JAM K;  3VYT B;  1BM9 A;  1V3F A;  1MJ9 A;  2R7T A;  2DYS H;  3H35 A;  4EJV A;  1P7I A;  2ZKZ A;  2M7A A;  1FT9 A;  2Y31 A;  3GFI A;  4KIF A;  1QZZ A;  4QSH A;  4D5F A;  3WTT C;  3SHF A;  1AU7 A;  2JZY A;  4LB6 B;  2M34 A;  1LEA A;  2EA2 A;  3G71 I;  4UHT A;  2RC4 A;  4Y3O A;  2XPU A;  4FX4 A;  3PO3 J;  1BIB A;  1FP2 A;  3D5S C;  1DP3 A;  5E20 A;  1DU6 A;  4XKC A;  2VON A;  1ZK8 A;  5E1Z B;  2Z5U A;  3LSM A;  1MGT A;  1W5T A;  2KIM A;  1WKM A;  4PFP A;  1JKP C;  1EH7 A;  4PJJ A;  3W2W A;  2FX0 A;  1JKQ C;  5AIQ A;  3RTR A;  2HFH A;  5H2F C;  3U1D A;  3MKY B;  1OIS A;  1MH4 A;  1A31 A;  1U9O A;  3TW6 A;  4BBR J;  5IPA A;  1JJ8 C;  4OOI A;  3WGH A;  1FBQ A;  3JSP A;  3V8J A;  1X1P A;  1ZG3 A;  3R60 A;  4MIM A;  5LLQ A;  3DLL F;  3ECH A;  4YEJ A;  5DD8 A;  3E6C C;  3SFI A;  3BR3 A;  4HOB A;  4LG3 A;  2DW4 A;  3F8M A;  1MH3 A;  3HG9 A;  3QU6 A;  3LSJ A;  3LQQ A;  1Y6I A;  2CUZ A;  4IHW A;  1ON2 A;  4LLG F;  1A6I A;  4A3B J;  2JRM A;  3BR6 A;  1YIT I;  1XGM A;  1QZE A;  1O7L A;  2FA5 A;  2GWR A;  3KIO A;  4HQE A;  2IS1 A;  3GFM A;  2XSD C;  3FDY A;  3DPU A;  5ICE A;  3IRQ A;  1R22 A;  1UJ8 A;  3RYP A;  1BR1 A;  1X3U A;  1FPQ A;  1JKO C;  2I5U A;  2IGO A;  4E70 A;  5FLX Z;  4OMY A;  2P5L C;  1QNT A;  3BG6 A;  3S15 J;  3CLQ A;  1QHH D;  1KU2 A;  3B6C A;  1IXS B;  1T2K A;  3CDI A;  3KYD B;  4PJM A;  2K40 A;  1CQT A;  1FC3 A;  1WZ2 A;  4YIF A;  1T56 A;  1P4W A;  2MLG A;  4DBQ A;  2AQE A;  3VYR B;  3HOU J;  1LJ9 A;  3WTZ A;  2EK5 A;  4NNJ A;  2PI0 A;  1O7F A;  1HBX G;  1QGP A;  1WCM J;  2XF7 A;  4MLO A;  1R49 A;  2LKS A;  2F4O B;  1IRX A;  4EV0 A;  3GZ6 A;  4ZYA A;  4E7K A;  4LIV A;  2QM3 A;  3ZOB A;  2M9H A;  4PK4 A;  4YII A;  4AVZ A;  1FIP A;  2M0M A;  3I64 A;  2MBF A;  2VXD A;  2UXX A;  2XAU A;  1A36 A;  2WV0 A;  4KMF A;  2L9R A;  3ERM A;  1IGN A;  2HR3 A;  2O6G E;  4A6D A;  4PGG A;  3E6M A;  1WJB A;  5M5W J;  3VOD A;  4G9Y A;  1WH5 A;  2BY0 A;  4ZJZ A;  5DM6 F;  1T33 A;  3CCJ I;  5JVT A;  3ESW B;  2JA6 J;  3HTU A;  5LHH A;  2VBZ A;  1FYM A;  4GRI A;  3K1P A;  4UB8 C;  1H89 C;  1JUM A;  1LE8 B;  4HSR A;  5F04 A;  2DQR A;  1RIO H;  2NYX A;  3PIO F;  3HOT A;  3BOQ A;  5FFZ A;  3S3N A;  2XGE A;  2HTJ A;  2DO7 A;  4YFN F;  1MDM A;  2V6C A;  4BNC A;  1LKX A;  3DWL E;  1ITY A;  1BI0 A;  1YYV A;  4LIU A;  3TED A;  2ECC A;  5HLG A;  1GLN A;  4QLC U;  5E17 F;  1FNN A;  2E2H J;  2IA2 A;  2HQ5 A;  5TGT A;  1H0M A;  2RV8 A;  2D2W A;  1T08 B;  1T0F A;  3DBH B;  2ELH A;  3G1M A;  2R7Z J;  3W3C A;  2Z3Y A;  3QPS A;  2DA1 A;  2FML A;  2TCT A;  4JX5 A;  2A6T A;  1RKT A;  5L3B A;  1SD5 A;  2DMP A;  1D5Y A;  5K7Z A;  1YIJ I;  1K79 A;  2H8R A;  4LJZ F;  3S1N J;  3QRF F;  2LRE A;  2Y9Z A;  5HS9 A;  3OSG A;  2BEO A;  2BHY A;  2VPR A;  5CPR B;  1RC9 A;  1ZYR F;  2H6C A;  2L7K A;  4KYW A;  2Z1D A;  5J8C A;  1NTC A;  4KT5 C;  2AHQ A;  4IEJ A;  2XAQ A;  3FKJ A;  4LMY A;  1O3Q A;  2GAU A;  1R5G A;  3F6O A;  3H1C A;  3PIP F;  2PBI A;  1MSE C;  5FKN A;  2PX9 A;  3QYB A;  2DK8 A;  3GLL A;  4G8X A;  3SJM A;  4E7Z A;  4JX6 A;  3WTV C;  3ZGK A;  1D1A A;  2FUG 2;  5DEQ A;  3FKI J;  4XKB A;  1IZ1 A;  5J6X A;  2ZB9 A;  5HDN A;  1GXQ A;  3IV5 A;  2YX4 A;  5J1U A;  3GTK J;  1FSE A;  2W48 A;  4KT6 A;  3WG7 H;  4CUG A;  3DTK A;  2EBI A;  3ZMS A;  1VQM I;  1RRJ A;  1ZRC A;  4CZZ A;  4UV9 A;  5E1W A;  2W57 A;  1TW3 A;  2GA1 A;  4LG0 A;  3OS1 A;  3J80 Z;  3CO6 C;  1SFU A;  2R92 J;  1MJB A;  1LB2 A;  5EF6 A;  2A05 A;  2ESN A;  5C3E J;  3HEF A;  3I56 I;  2DA3 A;  2WTE A;  3CJN A;  3CMM A;  3W6K B;  3N4M A;  3X2Q H;  4ZZL A;  5LD2 C;  4RBO A;  4UVC A;  4RGS A;  3OYJ A;  2NS7 A;  5DUI A;  2GA2 A;  3S3M A;  4XOT A;  4B3A A;  4O6J A;  2FNP A;  2GIV A;  2KDZ A;  2WC2 A;  1ZRE A;  1OCP A;  2MSY A;  4CXF A;  2QWW A;  3VWB A;  4IQJ A;  4A93 J;  5HOD A;  1VQ4 I;  4NC6 A;  4BUP A;  3H0D A;  3MQ0 A;  3BR2 A;  2DOA A;  2VL8 A;  2X6O A;  5GAH J;  4BEH B;  3QQA A;  1OCT C;  4IRG A;  2EH3 A;  2FMY A;  3ZN0 A;  1UHS A;  3HPG A;  3MD2 A;  1S9H A;  2OCE A;  1DP7 P;  2DJN A;  2QUF A;  3F6V A;  3HYI A;  2R7R A;  1N25 A;  5D5X B;  2FD5 A;  3MKL A;  1O3S A;  4UUS B;  1SAX A;  1T38 A;  4L9V A; 
#chains in the Genus database with same CATH homology
 1X2N A;  1FJL A;  2H1K A;  2CJJ A;  2DA4 A;  3FIS A;  3M3Y J;  2VUM J;  1AKH B;  3GBG A;  5FKO A;  3Q0V A;  2CRG A;  2HOA A;  3JRD A;  4CYC B;  4I6Z A;  3OIO A;  5EG0 B;  1X2M A;  1APL C;  4J19 A;  1JUS A;  3K2A A;  4NDL A;  2LTP A;  9ANT A;  2NOG A;  2TRT A;  5F1J A;  3HBL A;  2JK3 A;  3SDG A;  3S2H J;  3ZQC A;  4V2G A;  1GUU A;  2MG4 A;  4W1U A;  2Y0S N;  1POG A;  1H88 C;  1JT0 A;  1IC8 A;  1QRY A;  3E7L A;  2L0K A;  3HM5 A;  1IDY A;  1X58 A;  2XB5 A;  4A3G J;  2LFB A;  2GBY A;  2NVT J;  3HOY J;  1JJ6 C;  1ETK A;  5FLV A;  4XID A;  2QCO A;  3GTQ J;  4S0H B;  5IP9 J;  1HF0 A;  2DMT A;  3ZQG A;  3LSG A;  5JLW A;  3ZQH A;  1MBJ A;  5IOZ A;  4C3H J;  1HDP A;  3S1Q J;  1QVT A;  3BQY A;  5EYR A;  1GT0 C;  1ZTR A;  1FEX A;  3HOV J;  1IG7 A;  4FE4 A;  1B72 A;  3UKG A;  3RKQ A;  2ID6 A;  1BA5 A;  2HYJ A;  1ZR4 A;  2Y9Y A;  1GVD A;  2QF7 A;  5M5Y J;  1UMQ A;  1JT6 A;  1IJW C;  2CUE A;  2NVX J;  2LR8 A;  3GTO J;  1LFU P;  1LFB A;  4XRS A;  1VI0 A;  1DU0 A;  4IHY A;  1WI3 A;  2LLK A;  4BKX A;  1RES A;  3JRA A;  3H0G J;  4A3J J;  2HXO A;  2MW8 A;  3HOX J;  1YRN B;  3BR5 A;  1P7J A;  1MBK A;  3Q3S A;  1S7E A;  3PO2 J;  1TWG J;  1MBG A;  4IHX A;  4A3M J;  3GTJ J;  3OOU A;  3CMY A;  1ETQ A;  5IP6 A;  1TWF J;  3MVP A;  3GTG J;  2ME0 A;  1I6H J;  2NVQ J;  4MO7 A;  2XPW A;  1XS9 A;  1BW5 A;  4M3E A;  5GPC A;  2YS9 A;  1BL0 A;  1K83 J;  5EZG A;  2JWT A;  1PUF A;  4UUS A;  2FQ4 A;  3PM1 A;  3BG9 A;  3OSF A;  3S16 J;  3S1R J;  4DYR A;  1Q1V A;  5EZH A;  3BR1 A;  1ZR2 A;  1AKH A;  3HDD A;  3BTL A;  1ETX A;  3DCF A;  4CYC A;  5EG0 A;  2E2I J;  3GTP J;  1SFO J;  2B63 J;  3A01 B;  5DS9 A;  2O8K A;  1OJL A;  2XRL A;  3S2D J;  4QTR A;  3O8G A;  4A3K J;  3MN2 A;  5C44 J;  2E2J J;  1VND A;  1ZGW A;  4XRM A;  1PUF B;  1JTX A;  3FK7 A;  3QPL A;  3JRH A;  3H3V K;  1BJZ A;  1WGX A;  5FKM A;  2LD5 A;  5GP9 A;  4MFD A;  4DZJ A;  2JJ7 A;  4BBS J;  3Q0W A;  2L7F P;  5F0C A;  2DA2 A;  5J3L A;  1MBE A;  2NVY J;  1JUP A;  2EZI A;  3IH3 A;  2I10 A;  3RZO J;  2ME6 A;  3JRF A;  1R9T J;  5M3F J;  1B8I B;  4X6A J;  3C2B A;  1XG1 A;  5EDN A;  5FJ8 J;  3JRG A;  2YU9 J;  1G2H A;  2X48 A;  1RPW A;  5IOY A;  1NK2 P;  4DYC A;  2DMU A;  2DA5 A;  2IEK A;  4C2M J;  1U9N A;  3LSP A;  1IV6 A;  4B1R A;  3M4O J;  1GDT A;  3RQI A;  4D5C A;  1K61 A;  5M3M J;  1P7I A;  3JRB A;  3LOC A;  2XGD A;  2XPV A;  2RAE A;  3CQZ J;  2XB0 X;  2Y31 A;  1W0U A;  2COB A;  2X9D A;  4D5F A;  4QSH A;  4BY7 J;  4M3F A;  2R5Y B;  1AU7 A;  1GV2 A;  2M34 A;  1YRN A;  4X1E A;  3WHC A;  3S17 J;  3PO3 J;  2XPU A;  5F0H A;  2JA7 J;  1DU6 A;  4AYB N;  1ZK8 A;  1VFC A;  5K7H A;  2LKX A;  5DTD A;  4A3D J;  1MBF A;  3ZQI A;  2G0E A;  3BR0 A;  1ETW A;  1JKP C;  5J1R A;  3O8H A;  1FTZ A;  2FX0 A;  4HNV A;  1JKQ C;  2JA5 J;  4EEF G;  1HCR A;  1RET A;  4A3E J;  5GPA A;  1MH4 A;  2LK2 A;  2HOT A;  4FIS A;  3L1P A;  1OFC X;  4LOC A;  4GFB A;  1U9O A;  3TW6 A;  4BBR J;  5IPA A;  1JJ8 C;  2L7Z A;  1TWH J;  3LSR A;  4RDU A;  2MGQ A;  4A3L J;  4AUX A;  2HXI A;  4A3F J;  1WH7 A;  4MIM A;  1Y1V J;  4A3C J;  1U8B A;  4IHV A;  3SFI A;  3BR3 A;  3JR9 A;  3B6A A;  2R0Q C;  1MH3 A;  3LSJ A;  1O4X A;  3G1L A;  3A01 A;  2JMW A;  4IHW A;  1A6I A;  4A3B J;  2CQX A;  3BR6 A;  5IP7 J;  4V2F A;  2XSD C;  2D5V A;  4FCY A;  1ETV A;  4BY1 J;  4Y7N J;  2KT0 A;  4M6V A;  3NAR A;  3S14 J;  1JKO C;  4Y52 J;  3HKZ N;  3JRI A;  1I50 J;  1JTY A;  3S15 J;  1RR7 A;  2AO9 A;  4M3B A;  4A69 C;  1HDD C;  2LP0 A;  3B6C A;  1QPI A;  2DMQ A;  2K40 A;  4QIW N;  5FLM J;  2XGC A;  1H8A C;  4AC0 A;  1T56 A;  1CQT A;  3I4M J;  2Y30 A;  3I4N J;  2CQQ A;  2P81 A;  3HOU J;  1B8I A;  2PMZ N;  4M3D A;  2E19 A;  2N8G A;  3CDL A;  1WCM J;  4MLO A;  2ID3 A;  3NAU A;  3BTC A;  4I76 A;  1HOM A;  3TP3 A;  2YUS A;  2DA6 A;  3BQZ A;  3ZOB A;  2M9H A;  1FIP A;  5BNG A;  2GLO A;  2DA7 A;  5E3L A;  2L9R A;  4JYK A;  1IGN A;  5FKK A;  3G1O A;  5F08 A;  1AHD P;  5M5W J;  1WH5 A;  1XC5 A;  1A5J A;  2R5Z B;  2EZL A;  5M5X J;  1T33 A;  5E3M A;  2CU7 A;  2R5Y A;  5EEA A;  4B4C A;  1IRZ A;  2JA6 J;  4M3G A;  2VKV A;  5IYC J;  1QVU A;  3IH2 A;  1RKW A;  1H89 C;  1JUM A;  5J1Y A;  3RZD J;  1LE8 B;  5F04 A;  5F0F A;  1BW6 A;  2ELK A;  2XGE A;  2DN0 A;  4G12 A;  3GTL J;  4FE7 A;  5EGO B;  1E3O C;  2VKE A;  1ITY A;  1ZKG A;  3HB9 A;  3TED A;  3IH4 A;  2ECC A;  2WV1 A;  1HLV A;  2R93 J;  3FK6 A;  2E2H J;  3HOW J;  5FKL A;  2HQ5 A;  1NK3 P;  3BTI A;  3W6V A;  4FTH A;  3JRE A;  2IAI A;  4A3I J;  5E3O A;  3G1M A;  5C4X J;  2R7Z J;  2WB1 N;  3JRC A;  2ECB A;  2LVS A;  3QPS A;  2DA1 A;  1EF4 A;  2M2E A;  2TCT A;  2WAQ N;  4JX5 A;  1FTT A;  1RKT A;  4JP0 A;  2HI3 A;  2DMP A;  1JKR C;  1D5Y A;  1ZQ3 P;  1I3Q J;  5K7Z A;  3HGY A;  2H8R A;  1ORK A;  1TC3 C;  3S1N J;  1VF9 A;  5E3N A;  2Y9Z A;  3BT9 A;  1TWC J;  2E1O A;  3Q0U A;  5IYD J;  4BXX J;  3OSG A;  2VPR A;  2GM4 A;  3ZQF A;  1NTC A;  2AHQ A;  4IEJ A;  1ENH A;  3TP0 A;  2OPT A;  2Y2Z A;  2EZH A;  2K9Q A;  2L7M P;  1MSF C;  1MSE C;  5FKN A;  1GV5 A;  2NS8 A;  2JN6 A;  2OF7 A;  2HDD A;  3LNQ A;  3SJM A;  1TWA J;  4JX6 A;  4D7N A;  4XK4 A;  3BTJ A;  1Y1W J;  3FKI J;  3ZQL A;  2CUF A;  2ZB9 A;  3IV5 A;  5JLX A;  5J1U A;  3CCY A;  3GTK J;  1F36 A;  2W48 A;  3BG5 A;  3VPR A;  4W97 A;  3F0C A;  2EBI A;  1W0T A;  1FIA A;  2O9L A;  1JGG A;  2M0C A;  3TW7 A;  1B72 B;  2R92 J;  3A03 A;  2JA8 J;  5K7F A;  2DMN A;  4C3I J;  3HGG A;  1IDZ A;  1Z77 A;  2M8G X;  3FIW A;  5EF6 A;  5C3E J;  1UG2 A;  3HEF A;  2FJ1 A;  2DA3 A;  4JX4 A;  1Z0X A;  3WHB A;  4XRS G;  4RBO A;  2NS7 A;  2O7O A;  1WPK A;  2EZK A;  1MBH A;  3GTM J;  4DW6 A;  4B3A A;  1MNM C;  5IYB J;  5F27 A;  2KDZ A;  5C4J J;  2R5Z A;  2LY9 A;  1F43 A;  2K9N A;  1OCP A;  2MSY A;  4L5E A;  2HOS A;  3A02 A;  2K9S A;  4A93 J;  5HOD A;  4ABZ A;  3S1M J;  3K7A J;  2X6O A;  3BR2 A;  2IBD A;  4DZP A;  3D1N I;  2DTZ A;  3BG3 A;  3QQA A;  4UUT A;  4D7M A;  1U78 A;  1OCT C;  1IUF A;  3HOZ J;  2EH3 A;  1SAN A;  1LE8 A;  4DYQ A;  1UHS A;  2VI6 A;  4XIC A;  2DJN A;  2EQR A;  4C3J J;  2FD5 A;  5EGO A;  3MKL A;  4MFE A;  4UUS B;  1ETO A;  3DEW A;  1ETY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...