2ZJQF

Interaction of l7 with l11 induced by microccocin binding to the deinococcus radiodurans 50s subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
144
structure length
144
Chain Sequence
MKKVAGIVKLQLPAGKATPAPPVGPALGQYGANIMEFTKAFNAQTADKGDAIIPVEITIYADRSFTFITKTPPMSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords ribosomal 23S RNA
publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
total genus 14
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2zjqF02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 2zjqF01
1YHQI 1YITI 5GAEJ 1VQKI 3CCVI 5JVGF 3CC7I 3CJSB 2OTLI 2FOWA 3DLLF 5GADJ 3CC2I 3CCJI 1VQOI 3CD6I 5DM6F 2OTJI 1FOXA 1YI2I 1YJ9I 2ZJPF 1WIBA 3CJTB 4IO9F 1Y39A 1VQPI 3CCMI 1VQ7I 5GAHJ 1VQMI 3J7ZI 1VQ6I 4IOAF 1YJNI 2JQ7A 1HC8A 2QA4I 4UY8I 5GAGJ 2QEXI 2H8WA 3CCEI 1MMSA 3CCQI 3I55I 3PIPF 2ZJRF 3CCSI 3CCLI 1YIJI 4IOCF 2E34A 3CJRB 2K3FA 1VQ8I 3G71I 3G6EI 1VQ4I 3J7YJ 2E35A 1VQNI 1S72I 1FOWA 2NXNB 4V19K 3G4SI 1YJWI 3CMEI 3CC4I 3CF5F 1VQLI 1ACIA 3I56I 3EGVB 3CCRI 1QA6A 3CCUI 3CJQB 2E36A 3CMAI 1FOYA 1VQ5I 3PIOF 2ZJQF 1VQ9I 5DM7F
chains in the Genus database with same CATH superfamily
4A6EA 1LPQA 4H4KC 1UG2A 1EH8A 1KQ0A 1Q1HA 1LQ1A 2MLKA 3DPUA 1IDYA 3W6KB 1TQPA 4IQJA 1OJLA 1T98A 2STWA 2KHMA 1ZG3A 3OIPA 4HX8A 1EF4A 3EQLF 2NOJB 3GZ5A 1O3TA 4HW0A 2VL8A 3HL2A 1ZTRA 4RGUA 1FMVA 4ON0A 3Q9VA 4OINF 4DZPA 3K4LA 3U2RA 4BHCA 3EYIA 2VC0A 4P9UA 2X0LA 1SD6A 1TNSA 4RB3C 4C9YA 5A2QK 3I0TA 3J80K 5C4JJ 4KIFA 1DGRM 1T95A 1ULYA 1JJ8C 2PJRB 2M8EA 3H1CA 3RI4A 3EETA 1FC3A 2W24A 1DPUA 2KPMA 3TOBA 3SEZA 3GWZA 3FHNA 4ESBA 5FROA 1FY7A 2CG4A 1Y0UA 3OS0A 1ZG1A 2IS1A 1G3WA 4G12A 5EGOA 1MBEA 5FJ8J 1FMWA 1USTA 4HSTA 4QLCU 2OQRA 3ZQGA 1P4XA 4MHGA 2PG4A 3C3WA 3WGGA 1MMSA 4OAZA 4RS8A 2MBFA 4W97A 1WH7A 2MH9A 2FBIA 4G6TB 4E7SA 3CCSI 3IWFA 3W2WA 2VLAA 2HKOA 3DQVC 4G6DA 3GBGA 1X1DA 2RDPA 4FISA 3MN2A 2DPDA 1R4MB 2OBPA 2WB1N 3WGHA 5TJJA 2ECBA 1Y8QB 2FMYA 4E7JA 2KZVA 3VFZA 3HOWJ 2NNYA 1QHHD 4TV7A 5KHDA 3G3ZA 1X2NA 2GQQA 3GX4X 2I10A 2H1KA 3IH3A 2R7XA 3I59A 4LK0F 1KYWA 3K70D 2CV1A 2X6WA 2HR3A 4UHTA 3CC4I 1R1VA 1OCTC 1ZKGA 2QCOA 2ETHA 4B43A 3HM5A 1JHHA 3HPHA 2ADUA 1IW7F 4DNCA 4HV6A 3CMAI 4X1EA 2LH9A 3F23A 2XPWA 3HOUJ 4DZJA 2XGEA 3L2UA 4I2OA 1XX5A 2M5WA 3ZMDA 4QSHA 4LGWA 3P9CA 1BJAA 3OYGA 4CH7A 3RCOA 3F72A 4GXOA 3JRFA 1PYVA 3DLLF 1V5EA 2CFXA 1BI3A 4BXXJ 1MMNA 1LUJB 2FQ4A 4BJ5C 3T8RA 3BG7A 5EJCA 4A3CJ 4M6VA 3HG9A 3S16J 1MZBA 2F4IA 1I5ZA 4IQ4A 1WGXA 2LBFB 2OTJI 4JX5A 3OIOA 1JGGA 4LJZF 4BE1A 3P9KA 3FXLA 2AHQA 2O9LA 2L4MA 3OYDA 2P5KA 4IPAA 5D6EA 3CCMI 3DTEA 1YX3A 1SMTA 1LEAA 2HQ5A 2YX4A 1E0EA 4KT6A 1D8KA 1VQ6I 4XLCA 2CUZA 3A01A 2QLZA 1YRNA 1KONA 2IEKA 3RKYA 4IRIA 5LGUA 2X6OA 2DA4A 2R4GA 3AL0C 2Q2EA 3H5AA 4IHWA 3LSTA 2HFHA 3R60A 3RSNA 2EV5A 1O57A 1FWZA 4W1UA 1TTYA 4FASD 2XF5A 1BJZA 2EZHA 2YR2A 3GTPJ 2L4AA 2FRHA 3K4MA 4HF0A 1JTXA 4XLHA 4XRSG 2MW8A 2CS3A 4CCMA 4YFNF 3JRIA 4I6ZA 1ZGWA 2DQRA 2DMNA 5L3FA 4N9IA 1WI3A 1XMXA 4HDUA 2ZFWA 1XMKA 3GZ6A 5DCMA 5E8GA 2KLOA 1U5TC 2A6HF 4H0EA 4MEXF 5CYVA 3RZOJ 5AIQA 1VQNI 4GYGA 5TRDA 1EH7A 4N4OB 1K4SA 3IV5A 1BIBA 3I58A 1A5JA 2CUFA 1JUSA 4I02A 2CWEA 1X4OA 2XAJA 4HAMA 4O6JA 4O5VA 2WADA 5LRSA 4G7OF 4B48A 2VPRA 2EH3A 2ZSIB 3LA3A 4WF2A 5AONA 4JYKA 3BC8A 3OYNA 1IRFA 1UB9A 2LTPA 4CCKA 4LMYA 5KVRA 1OR7C 3ELKA 4YFXF 1FP2A 2Y9ZA 1T8IA 5GAEJ 2PJRA 1DU6A 3ZMVA 3GFJA 2EWNA 3K1NA 1ZRFA 1QZYA 4QIWN 4HSRA 5HLTA 2L7FP 2QQBA 2D45A 4LLLA 5E20A 1ETYA 4FTHA 1UHMA 2HU9A 2WB1A 4EM0B 3L2RA 1WJAA 3N4MA 3OYEA 2IXSA 4AVZA 5L3EA 4FHTA 5FD6A 5GPAA 2XKOA 2XV4S 4RM3A 4EM2A 1SFKA 4YEJA 5ERIA 5K5RA 3MD2A 2E2IJ 2ME6A 2WV0A 4I0BA 4UVAA 2TCTA 2QGUA 4FX0A 1X1BA 3FKIJ 2RV8A 4IF4A 3HC7A 1FBQA 3CMYA 3BY6A 3HSRA 3HOVJ 3FKJA 3MWMA 2L9VA 5JI6A 2XUBA 4IEJA 2OAZA 2QM3A 4D7MA 4B1RA 4AIDA 1MSFC 2W48A 2EIMH 2TDXA 3E6MA 1H9TA 4NC7A 4LOCA 2L2OA 1U8BA 2VXZA 2XKPA 1WHUA 5D5VB 2BHZA 1NHAA 1WVRA 3S15J 1ONVA 3O8GA 1RKWA 4GFBA 2EQRA 4KN7X 1UMQA 4PSXA 3FXOA 1MH4A 1XGOA 1YIJI 2E34A 1W5TA 3HKZA 4HPQA 3OR1C 4A0ZA 2D2WA 4Y15A 3RKXA 4XRMA 3MKLA 4KMUX 3ISPA 4JQFA 3TP0A 3G71I 2BY0A 2L02A 2X6XA 2LMDA 2OV7A 3NWSA 3HRTA 3RYRA 1IF1A 4JBAA 4G7HF 1FYKA 2XC7A 4PJ0C 1FYMA 4Y17A 1FPQA 4M9SA 1D3YA 2OZ6A 4BJ6C 3RZDJ 2LK2A 5H6RA 2VBXA 4ZYEA 4A3IJ 4KMFA 2VOOA 5K5QA 1GXQA 3SZPA 5HDNA 2L7KA 1J0RA 3JTHA 2XIGA 2V9PA 5GP9A 1OCOH 2KDOA 4OAYA 3ERED 2BE5F 3EGVB 1AHDP 4V2FA 4RB2C 2OZUA 4Q48A 3WTWC 1WJCA 2MC4A 4ZZLA 1IJWC 2IP2A 5LBQA 1ETKA 4LG0B 2YUSA 5KNLA 2QBYA 3Q0WA 1AOYA 4Y4RA 2VT2A 1VQ9I 5FKOA 2O5RA 1I50J 2HPIA 3CP2A 1PP8F 3DU6A 3VSKA 5C4XJ 1KGSA 3ABUA 1N78A 4E4HA 1V3FA 2HDWA 2YU3A 1EV7A 3BJ6A 3K2ZA 1YYVA 3DFGA 3HBLA 1ETQA 1B72A 1LVAA 3O8HA 1VZ0A 3OOUA 2EFWA 3C18A 2P7VB 4HQEA 4KYWA 1S3JA 3H3UA 1OMIA 3CDIA 3W6VA 3LSKA 3C1DA 4IHXA 5B66C 3LQRA 1TW3A 1TWGJ 2H6CA 4M3GA 2QWWA 2BBYA 1R1TA 3C2GA 1Z7UA 1R58A 2Z2SB 3TQNA 2F2EA 2F5VA 3J80Z 3S1NJ 2QSGX 3HIFA 4RAFA 4ASNA 3DXJF 2XSDC 3ONQA 1Z21A 4UUSA 3HRUA 3PNTA 2LKXA 3GO5A 5CJ9A 4HF1A 1V55H 5K7FA 3OS2A 5EYRA 3L2VA 1O7LA 3F21A 1YTYA 4HF2A 2P8TA 1RIOH 1R7JA 4CYCA 1W36C 3RPUA 2PQ8A 2XAUA 4AWXB 2ZMEB 1O3RA 4R1HA 2H8WA 5J1RA 3F8CA 4GGGA 2RKHA 3RDIA 3CCEI 4E7KA 3TL4X 2K9QA 3ASNH 5EDNA 1Q1VA 4MQVA 2IGMA 2P5LC 2FA5A 2Y69H 3G2BA 1D0XA 4XN3A 2VONA 4BBSJ 2F4OB 4AIHA 2XROA 4A3EJ 2BXZA 2K02A 2R7OA 3ZPLA 3KLOA 3G6EI 3AG1H 4PFOA 3RJPA 3SZTA 4RAGA 1S7AA 3HZJA 3WG9A 1JXSA 3I3LA 1TT0A 1MMAA 1YO5C 1XDSA 2FD5A 3DKXA 2M7BA 4V19K 2OC6A 3JRBA 1F9NA 1LNWA 5CKTA 3S14J 4ZJZA 2A5YB 4B3AA 2FBKA 3UR3C 1J59A 3BQZA 5IPAA 2JA2A 2P0WA 1WJ5A 1B8IB 1JGSA 5CPRB 4L18B 3ZQLA 2FSWA 3CUQC 2CYYA 2J5PA 5EGOB 5BS6A 1FOYA 3ZQQA 1IRXA 3HSFA 3ZQ7A 1Z9CA 1XS9A 3HPGA 2O61A 4EMSA 2O0YA 4XORA 3TMOA 3B02A 3OYIA 2X1EA 2O03A 1IC8A 5EZHA 5F0HA 3VWBA 3GZNB 5IOZA 3BG6A 3S2DJ 5HNFA 1SVOA 2PN6A 3U21A 5H2FC 3IRQA 1IN8A 1BR1A 4YFKF 1B4AA 3GTOJ 3CP8A 4YRVA 4I09A 2HNHA 5KK1A 3DP7A 3V7RA 1VTNC 3GTJJ 1QVUA 2C6YA 3DBHB 3KP2A 2IGNA 4HLYA 4ITVA 1FZPB 5TGTA 4ZDLA 2K9MA 2IA1A 5DM6F 4EQQA 3SHFA 4P55A 2K40A 2MD0A 3SEQA 2X48A 2DQLA 2XRNA 1C0WA 3SQNA 2F4MB 4IVNA 3W2AA 5DDGA 4DQ2A 1PP7U 1ZHFA 4R79A 2O6GE 4PCQA 3I54A 5E1WA 3W3CA 2RQQA 1VQ7I 2JA7J 3I9V2 3IKTA 3H3VK 1R5ID 2TRTA 3I59B 1TLHB 1YS7A 3MKZA 3CUOA 2UXXA 4YELA 1KZHA 1O3SA 2H8RA 1LFPA 2BEOA 4B3XA 2DT5A 2HYGD 5HS7A 2M2EA 5ED4A 3HUGA 4UNOA 3TEDA 2FX0A 3W6JB 5GAGJ 2FNPA 2DA5A 3SFZA 3KFWX 4A3DJ 2RNJA 3CDHA 4E7ZA 1TWCJ 1BBYA 2V1XA 3TO9A 2ZJRF 2ZXJA 1HBXG 3DEEA 4I0AA 2CO5A 5FFXA 3GTKJ 5HDKA 1SD4A 2ESHA 4A3JJ 2F5CA 4EJVA 5ILSA 4YIRX 2X6YA 2LVSA 2X51A 3OWTA 3F8FA 4LG0A 3L09A 5JLWA 5GTIC 2D1HA 3RPUD 4KN4X 2V79A 1MSEC 3V8JA 3ZMTA 1DQUA 1YW7A 1FYLA 2OPTA 1YX5A 1PUFA 2MLGA 2IPQX 3Q9SA 5CVIA 3I71A 1ZRCA 2EINH 2HTSA 1K61A 3S2WA 2EFOA 2GOXB 4ZDOA 3F22A 3V42A 2Y48A 2GBYA 1QZEA 1WZ2A 2LREA 1YOVB 5FRNA 3A01B 1V54H 2Z5UA 3LWFA 1GDTA 1X3ZB 1RR8C 3M1EA 1IXSB 1EA3A 2XSJC 2ZJQF 4S05A 1W0TA 2KIQA 3HYIA 1RI7A 5IP6A 3S2HJ 4MQ9F 3VODA 4ENKA 4LG3A 2Q2EB 3J7AY 4RDUA 4MIMA 1XG1A 2EK5A 4BXUA 1BC8C 1W5SA 2OTLI 4L9TA 1R49A 2FOWA 3ABMH 3K4NA 5IY5H 1Y1WJ 1DU0A 1KU9A 1MW7A 2F5EA 2IS4A 1TP4A 3D0SA 3IC7A 3JRDA 2LFBA 2RN7A 4HOBA 3MFKA 1XC5A 4NQWB 2DU9A 4KICA 4K2EA 3IL2A 1L3LA 5EF6A 2HOTA 3HOXJ 3CO7C 3ZMSA 1MKMA 4OU0A 5J6XA 2JZYA 2UZKA 2DOFA 3MZYA 4M6XA 4UXNA 1WCMJ 2L5QA 5DCMB 3S3NA 2NVTJ 2B0LA 4A3GJ 2L3DA 4BDZA 1HQCA 1OCRH 5H20A 3DWLE 4ZC3A 2P4WA 3SXYA 5K5OA 2DA1A 2LKPA 2VI6A 1WJEA 2QVOA 3HSEA 3JCUC 3L2QA 4BKXA 1U9OA 1T39A 4XRSA 5KAFC 4CA0A 1P6RA 1PUEE 3GTLJ 3KP4A 3VSLA 4JX4A 5BPDA 5DD4A 2W82A 1J5YA 1X1PA 4AUXA 1MD0A 3I55I 1A6IA 4JP0A 3KP7A 1HSTA 1S9HA 1OCZH 2IVMA 1H0MA 3QPTA 1I1SA 4BH9A 1B8IA 1T6SA 2BHYA 2QSFX 4PGHA 4XOTA 4ETSA 3GLXA 1A31A 1I6HJ 5E17F 9ANTA 2JA6J 1IDZA 3ZQCA 3QPSA 1YG2A 2G7HA 3ZQHA 4CYDA 3LSHA 2VQHA 1D0YA 3PQKA 4WXHA 3DBLB 1ZRDA 4U0VA 3G4SI 4NUBA 4AIJA 1M1EB 1SVMA 2XGXA 3FDYA 4XLPF 1TQIA 2P81A 1XD7A 3IRRA 3ZQIA 2ELHA 5HNHA 3CO6C 5L3DA 1XDUA 2MGQA 1ZG5A 1MBJA 1HKTA 3WTSC 3AG2H 1H9GA 1AU7A 3JTGA 4U88A 1MJ9A 1WJDA 3EUHA 3ZN1A 3GVAA 1IN5A 4Q4ZF 3FM5A 1FIAA 5DUKA 4A3KJ 1LB2A 1AA7A 1YFHA 2LKSA 2XGDA 1O7FA 4HX7A 2A68F 4C2MJ 3N05A 3FXRA 3DKWA 1XMAA 2JUGA 3KEQA 3PNVA 1Y1VJ 3IP4B 2DA6A 4KUMA 5ILVA 1TZLA 1G4DA 3CC2I 2DMUA 3M1CA 2IAIA 3LSJA 2WV1A 3QYBA 1TBXA 2CQKA 2DFIA 3BG9A 3RQ4A 3IAS2 4LFUA 4EVIA 2BY3A 2QZ8A 3FZVA 5M5YJ 2ME0A 4DBQA 4A3LJ 3P7NA 3WE2A 3J7AO 2ZXIA 4B44A 5L3GA 1OFCX 3CD6I 3ABLH 1B59A 5IP7J 3G1LA 2JA5J 2K3PA 4L5IA 4J19A 3K9TA 3QP5A 4IZZA 3IUOA 2H6BA 4F93B 1I1GA 1B1BA 2I8DA 1FBSA 2XASA 2FXAA 2CUJA 2GXGA 2QKMB 1SFEA 3DCFA 4RGXA 1Z3XA 3BPXA 1U78A 2WC2A 2XHKA 3HKZN 2V4JC 1JKQC 4XLAA 2MH2A 4L9NA 2QQ8A 1YLFA 2HYJA 1USSA 1LVKA 2M30A 2EV0A 3OMYA 3QQAA 4A69C 3OYMA 2VOPA 1YJNI 5E3OA 5DS9A 2DT6A 3KPHA 4XBFA 4EJWA 2DTZA 2YU9J 1IN6A 4A12A 4BEHA 2DODA 3WG7H 2K9NA 2JWTA 2QEXI 3WGIA 1GV5A 4NC6A 2QBYB 2EFQA 4WCGA 3FXQA 3BTJA 1LFBA 1DPRA 4QTRA 3H9QA 3EPZA 4BE2A 2RVCA 5L3BA 1SAXA 2VKDA 1XCBA 1X4PA 1ITYA 3CTAA 4RLFA 3LSGA 1B72B 1VQ8I 1A6QA 1MMGA 1TNTA 1XB4A 2CJJA 2ESNA 1UHSA 3BZKA 3DTIA 3E6DA 4RGSA 3A0BC 3HHHA 3COAC 1S7EA 5J1YA 2BW3A 2E1MC 1HSJA 1DUXC 1TT5B 1MMDA 2RQPA 2EFNA 2CMPA 3R4KA 1MJAA 2A6EF 2EJRA 1HA8A 3K1PA 3T0YA 3KP5A 2KRCA 3VYUB 4BJTA 3S32A 4C30A 2XAQA 4ZZDA 3MMYB 4KNYA 1K83J 4II2A 2EA2A 1MBKA 1FX7A 5D4SA 1T38A 3M8FA 4NQWA 4UUSB 5M5XJ 3T5XA 3PO3J 3KP6A 1ZH5A 1G2HA 1G3TA 3CJNA 2VBWA 3GF2A 2DMTA 1T2KA 1O4XA 1VQ5I 4CYCB 1SFUA 3TGNA 4MO7A 3DF8A 4PGGA 4AC0A 4OMYA 1MBGA 1WJFA 2JPCA 3PL8A 4XSXF 1NH3A 2GOMA 1B6AA 1YS6A 2Y75A 1LKXA 1Z67A 3VB2A 1GVJA 3KZIC 3O6BB 2A61A 4F91B 5HLGA 4CGZA 2E7WA 4Q5SF 1V4RA 3ERMA 3B6CA 2V1NA 1GHCA 1FP1D 2QKLB 2EA4A 5B1AH 1RR7A 1R5HA 4DYCA 4EV0A 1BC7C 2HEOA 4IHVA 3BTCA 2CW7A 4GRIA 5EZGA 5FLXZ 4BAYA 1I27A 3T1BA 3CESA 2A6TA 4OMZA 5DTDA 1WFXA 2E60A 5BPIA 1IGNA 1T0FC 4JK1X 3FHZA 1F43A 1WIBA 4XR6A 4UB6C 3SZGA 4JX6A 4DW6A 2NAZA 2XF7A 2WAEA 4LLNA 3V7SA 5EEHA 4HNUA 4HX4A 2CSOA 3MKYB 1N77A 4CSWA 2JTVA 3FWEA 4HV5A 1TC3C 4GDFA 4PDKA 4ZH4F 4IJAA 4ABZA 3E6BA 1LE8A 3A0HC 3MKWB 2ZB9A 3HHGA 1HC8A 4OIRF 4IRGA 3PM1A 2KIUA 2F5FA 2IGKA 4BBRJ 2WWYA 2M0CA 3ASOH 3D5SC 5L3CA 4RAZA 4P5OA 2G7UA 3ZP5A 1HW5A 3CCQI 1Z7LA 2DT7B 3R6SA 4A93J 3PIPF 3R0JA 5CVUA 2V9KA 2YPRA 3REOA 3H5NA 4WWCA 2KQRA 4XMYA 3V8KA 3MCZA 1POGA 2XF6A 4HEA2 1S6LA 3VOEA 1JI8A 1FSHA 2XB0X 2CGPA 4FE7A 1VQ4I 1HKSA 3NQOA 5F27A 4ZTJA 2ACJA 3S1MJ 5E8IA 3LAPA 2ZFUA 2H1LA 1WSUA 5B1BH 2A07F 2QSHX 5K7HA 2K4JA 3OYFA 2KDZA 1P7IA 4A0XA 4CO8A 4A3MJ 1XSXA 2KZGA 2KFDA 4GYIA 3CMEI 1WRJA 1P4AA 2VN2A 1MNMC 1HCRA 2O7OA 4HYEA 2E2JJ 1KA8A 1ZGAA 2DJIA 2JPBA 4LITA 3W2VA 3GMEA 3QWLA 1G8XA 2KJBA 1GUUA 5DYMA 2F5DA 2X4HA 3L9FA 2W4SA 5FLVA 4CXFA 2WAQN 3CJQB 2E36A 3I53A 3N97A 4OWRB 3HUGB 4XONA 2LRDA 2VQLA 5FKLA 3FXMA 1X1AA 4ANJA 4P96A 3GTMJ 1X58A 2AQFA 3OL4A 1BA5A 4A5MA 2XAGA 2KRFA 3LSRA 4B8XA 1X2MA 4M6YA 1OYIA 4MNUA 1APLC 1S5LC 4XL9A 5GADJ 4NDLA 2ZSHB 3PNYA 2LDUA 2M0MA 2VASA 4BXFA 3L1PA 4FCYA 2Z9OA 1SAUA 3TBIA 1BI0A 2DOEA 2L7ZA 4UUVA 3DKYA 5F64A 2F6CA 3M8EA 4S04A 2V9VA 3DEUA 3L2WA 3HGYA 1ZN2A 2OUMA 3BG3A 3H0DA 1U9NA 2HVSA 2V1UA 4KIGA 2DMPA 1DGWY 2DOAA 3K1MA 3JR9A 1PUFB 3S8PA 4IO9F 4D9JA 1Y39A 1K78A 2E2HJ 4BQQA 3F8MA 1E3PA 1JT0A 1VQMI 3ECHA 1E3HA 2R0QC 1U5TA 5IT3A 4L0YB 2L9SA 2MYSA 1R71A 2R7SA 2IRFG 2DN0A 3MEXA 3QOEA 4M3DA 2JQ7A 3JRGA 3WHCA 2MSYA 1EH6A 2JSPA 2NVQJ 3VPRA 5DEQA 4LB5A 4Z2YA 1W7PA 3I5UA 4M9ZA 1XSDA 1Y8RB 2XAFA 2HPMA 4XM3A 3WU2C 3O2PE 5D5WB 4KFCA 3DPLC 1SFOJ 1P9QC 1IV8A 4PJNA 3K0LA 6PAXA 2MD5A 2Z99A 1G59A 2BXYA 3QPLA 3HJEA 2DYRH 3FBNB 1Z91A 1OR7A 4CDGA 1ON2A 5HLIA 2KRHA 3M8JA 4NB5A 3ZGKA 1OYYA 1CF7B 5D8KB 4KT5C 4HLXA 2XAHA 4XOPA 1I39A 4HG2A 4D1QA 2VODA 1UZCA 3K69A 4IRHA 1BL0A 2Q8KA 1YJWI 3A03A 4XRFA 3HOYJ 2R7TA 1SD7A 3C2HA 1LDJA 1P92A 3CUQB 4G7ZF 3CF5F 2BVMA 1A36A 3I64A 5E3NA 1IXRC 3RPQA 2O3FA 3K70C 3S17J 3KZZA 2QQ9A 2HKXA 3OSGA 3PIOF 1BOBA 3TDUC 2FU4A 5FLMJ 4PJMA 1AKHA 1YITI 2NOGA 3TO7A 1I3AA 2HWVA 3KEOA 2X9DA 5JVGF 1CGPA 1NK2P 2OU2A 2P6SA 3CJSB 3M4OJ 2Y0SN 1BM9A 2Z3YA 2VBZA 5ICGA 1BW5A 1BR2A 3OV8A 1SEUA 4EJUA 3KYLA 2HDDA 1RNLA 3FMRA 2CFOA 1Z05A 3WHBA 4AM3A 4WXDA 2EZKA 1TW2A 3HDDA 3QODA 3ZCOA 1QPIA 4RLQA 4DJAA 4IHTA 1K6YA 3PUBA 1B9NA 1HW2A 2GLOA 3GFLA 1FOXA 2XGCA 1CQTA 3FF5A 5FKMA 4RB1A 2V6CA 3FMSA 4N9HA 1JKRC 1U2WA 2ZMEC 3B6AA 2GZWA 2V1DA 2JT1A 4M3EA 2ZNYA 4N4NB 1UFMA 3H36A 1RRJA 4FX4A 5J47A 4B4CA 2H09A 5LHGA 4EJOA 1IV6A 4KISA 4LIVA 3BZCA 3RKWA 4CCOA 4M71A 1X19A 4IHSA 2JN6A 4YG2F 4LB6B 4D5FA 2WAQA 3E3VA 1GT0C 5FLXK 4Y7NJ 2UV1A 2E1CA 3C7JA 2HZTA 1FT9A 3F6OA 5FD5A 1JUPA 5J4VA 3JRHA 3ML6A 2M8GX 5HDGA 1ZYRF 4JOMA 4A6DA 3MZ8A 3IKVA 2RNGA 4RBOA 2LSOA 2IS2A 1ZR2A 2D5VA 3K10A 1TWFJ 3P5JA 4YIIA 4O3MA 3SDGA 3MZHA 4FQGA 3OYJA 2VUMJ 3LQQA 2GWRA 3E7LA 3WTTC 2DXIA 2MFZA 5F08A 4AU7A 5FFZA 1FEXA 1HXDA 3GLLA 1K6OA 2CU7A 1I6XA 2X1CA 2NNNA 3LFUA 5BMZA 1BR4A 2CW0F 1D8JA 4LLGF 4UVBA 3K4JA 3CF2A 1W4MA 5DV5A 2CV2A 2Z16A 3QOPA 1W7PD 1QRYA 2FMLA 4FT8A 5LRRA 1ODDA 4BS9A 3IWZA 2JVHA 3BCAA 4A2UA 1JTYA 3JW4A 2EZIA 2RGVA 5LD2C 4FETA 4U0WA 3CCRI 2FNAA 1IN7A 3DEWA 3KZYA 3BOQA 1RKTA 3KEYA 4CCJA 1B9MA 2K9SA 1Y0NA 2J5OA 3VYRB 4BDYA 2BY2A 4BEHB 1LFUP 1KQ8A 1YW9A 1HDPA 3GCMA 2ZBKA 1QQIA 1MDMA 4PK4A 5E1XA 2K9LA 4WK8F 2K5CA 3U9GA 5M3FJ 1JT6A 3FM3A 4KDPA 2LNBA 1R00A 1P2FA 1MH3A 2KIFA 3ECOA 3KX2A 4U7DA 4L5JA 5E18F 2VJIA 3E5QA 4C3JJ 1ZGJA 3LFKA 1R1UA 3A4CA 2VKHA 2X85A 4XKCA 4PJJA 2M3AA 3JAMZ 3SDBA 2BW3B 4M73A 3HTSB 2DFEA 5IYDJ 5DD8A 3M07A 2V6EA 2XRLA 5KCMA 2COBA 4AYBN 3WTXC 3CDLA 5LHIA 1YJ9I 2LY9A 2OA4A 3R61A 2HOAA 3BR0A 3CJTB 5E79C 5K7ZA 4KA4A 5ILUA 4CUGA 3H92A 3FBIB 1UG0A 1ZARA 1PDNC 4IOAF 5EG0B 1LJ9A 2MABA 2OCEA 3GFIA 1ETVA 4CZZA 1CF7A 2M1BA 2Z33A 1MNDA 2GXBA 4M9XA 4P9FA 2HDCA 4KJZA 2BV6A 4G9YA 1ENHA 3AG4H 1ERDA 2CQQA 3BZ6A 1H88C 2W1OA 2Y9YA 4BACA 2DDAA 3ZR8X 5CLSA 1BN5A 4G94A 4J00A 1SMYF 3CUQA 1MNEA 1J75A 3LMMA 2Y0SA 3Q0UA 1OQYA 2R93J 1E17A 3KYCB 3RTRA 2EZLA 2EBIA 5E3MA 3ABTA 3A02A 2GXAA 2MA3A 5HOOA 3UKGA 4D5CA 4Y13A 3PJRA 1UELB 4DGWB 2LD5A 2K7LA 1RUNA 5F1RA 4N0BA 3TO6A 3MAJA 2DA7A 3J81K 2DTRA 5FKNA 1OISA 2ZXWH 4G6QA 5HODA 1K7AA 2OD5A 1QU3A 4ENMA 4OIOF 2UXNA 4BHPA 3BTIA 5B3SH 3R0AA 3IHUA 1IRZA 4ZYGA 1QPMA 2VKEA 3OYAA 1LE8B 4UVCA 1IXCA 1QO0D 1A35A 3S1QJ 2QYOA 2GIZA 1NTCA 3LL7A 2QQAA 4OIQF 2L0KA 1YHQI 2F48A 4F7ZA 1UJ8A 4WXCA 3X2QH 3CCVI 1VQKI 2B7EA 2W84A 2WY8Q 1Y56A 1HLVA 5ICEA 1XGMA 4EJTA 5HLHA 4DYRA 3EUAA 4UV8A 1FNNA 2DAOA 2E1OA 2WTEA 4NNJA 4BY7J 3K6GA 4RAYA 2FJ1A 5JHUA 3F0CA 4M3BA 2KJCA 2CQXA 4GCVA 1Y6IA 2VKVA 4XLEA 3E5XA 2VE8A 1KU7A 5C3EJ 4BL0B 1WPKA 3QAHA 3KP3A 4V2GA 2R7QA 3D5RC 1EKEA 2NS7A 4B09A 3J7ZI 4CCLA 2ISZA 2YS9A 2VBYA 3BR2A 4C3IJ 1W36D 3JSOA 1U3EM 1S8NA 4ESFA 2FEZA 4X0GA 3ZMZA 2HXOA 1V5GA 1T33A 5DUIA 1RETA 4I98B 4M72A 2L9RA 3BPVA 2L54A 3F6VA 4L0ZB 1FTZA 2O8KA 2AQEA 4XK4A 2LF7A 5FGMA 2ZXHA 1R22A 4QPOA 3L2CA 2BGCA 1XN7A 2DCEA 2GA1A 1A04A 3U1DA 5C44J 2JSCA 1X3WB 4D7NA 5JHFA 3LNQA 1JKOC 1IAWA 1J9IA 1IZ1A 1QNTA 4E7IA 2E1MB 3BTLA 3FISA 3T8TA 3ZN0A 2L01A 5E3LA 1QHGA 2R5YA 1WQ2A 4XIDA 3AL0B 3GTGJ 2Y31A 3JRAA 2K86A 4G8XA 5J4YA 3OR2C 1TL8A 3OSFA 2Y0MA 4EGZA 4AD9A 2DLLA 2WAFA 2DBBA 5HVQC 1FJLA 4E6KG 4PZJA 4EM1A 1IO2A 4Y3OA 2FF4A 4AYBA 4F3QA 1G3SA 5GPCA 4P1WA 2HYFA 4BUPA 5FB2A 5M3MJ 5CVRA 3H9JA 4IKFA 2WA0A 1RZ4A 5LEJA 1K78B 3CQZJ 1ETXA 2R5ZA 2STTA 2FQ3A 3G73A 1D5VA 3BP8A 1U5TB 2EILH 1N75A 3GYHX 1X1CA 1YIOA 2K4BA 1RESA 1KU2A 3F8BA 1NK3P 1S7OA 1YW8A 2Y30A 2W85A 2DPUA 2B9SA 2BOLA 2DA2A 1LEBA 4AVPA 1WH5A 2GIVA 2LP0A 4BQNA 3JREA 3NRVA 5DM7F 2ZNZA 1W7PB 3H9GA 2AO9A 3I4MJ 1Z6RA 1F36A 2DK8A 3KE2A 1MBHA 2E1NA 3E0JB 4BNCA 2CV0A 3GUDA 4CZCA 2Y2ZA 3OYKA 3D1NI 2M7AA 1FLIA 2NYXA 1STZA 4ZYAA 3TW7A 2BY1A 2FOKA 3A2KA 2BYVE 5EG0A 3HOZJ 2RAEA 1BI2A 1LDKB 2KMUA 2ZJ2A 4XKBA 4A5NA 4C3HJ 4ESJA 2KKOA 2CQNA 1W5CC 1RC9A 5CQEA 3GW2A 2HQAA 2PEXA 3VDXA 2R7WA 5FRMA 3UNGC 1PJRA 4ZTFA 4BQAA 5IT9K 5HS9A 1QVTA 2VQCA 3AKZA 2UWMA 3FXKA 4L5EA 2JUCA 4HZFA 2ZJPF 2COMA 1ZREA 3LSMA 5GAHJ 3WE3A 1X3UA 2DFFA 1BW6A 3OOPA 3ESWB 2L9NA 1W1WE 3ZQFA 3RQIA 2IT0A 4OIPF 1ZR4A 2YSRA 1D1CA 3MVPA 3FK7A 2E5NA 4RMNA 2ELKA 1GLNA 1FBUA 2DI3A 3JAMK 4UY8I 1BI1A 2NS0A 3S3OA 2Q0OA 5J3LA 2GAUA 4BE0A 1IUYA 1FSEA 1R36A 3EYYA 2E71A 2JRTA 4GO1A 1UCRA 2VB6A 3V8LA 2IGOA 2MG4A 1AKHB 3NWTA 3WTUC 2P7CB 4I01A 4X6AJ 3C2BA 3NEUA 3CJRB 2ISYA 1WKMA 3VYSB 4XNFA 2HZDA 3M7GA 2V26A 3RKQA 1D5YA 2M4GA 1XGSA 2R7FA 4YIFA 1P7JA 3EUKL 1SVLA 2RC4A 4QWQA 3B73A 2IA2A 2IBDA 1OYWA 2PMHA 4NHJA 3BCBA 2GM4A 4Q47A 1V5FA 2NVYJ 1NG6A 1J7KA 2NVUB 3KIOA 4MTDA 2A5WA 2O8XA 2ELJA 2E7XA 3P9IA 2D1VA 4BU2A 2HQRA 4MGRA 4IHYA 2HXIA 3OYLA 4PFPA 3LSPA 3WU1B 4R8HA 4EGYA 5HS8A 3FXJA 4CHUA 1RPWA 2IJLA 1OPCA 1F4KA 1R23A 3LOCA 3AAFA 4LIUA 2P5VA 4PJLA 1LDDA 5D8LB 3HOSA 1GXPA 1DDNA 1OLTA 1Z1DA 4EATA 4EEFG 4A3BJ 2HOSA 2VJJA 4Z6YA 1FOKA 3HOTA 2EIKH 3BJAA 4XLFA 3CC7I 3LA7A 3CMMA 1MGTA 2XDVA 4S0HB 3VEPA 3BJOA 3G1OA 3TDZC 1O3QA 4DOZA 4DIQA 2DYSH 4CICA 3SYTA 3BG5A 3I4NJ 2LLKA 2LG4A 1G6NA 2VJ5A 1FIPA 3FIWA 3BR1A 4A0YA 4ZYHA 2M87A 2Z1DA 4LD5A 1BIAA 5BQTA 1L0OC 2JK3A 2PMZN 4HBLA 3IH2A 3EDPA 1BOAA 2RREA 3H35A 1XTAA 4HDVA 1YI2I 4U0YA 2XVCA 2LC2A 2OQGA 2H27A 4PUSA 1QBJA 2HVRA 5IOYA 5F6FA 2HTJA 1SANA 2ZC2A 3DPTA 4IL6C 1JE8A 5F1JA 3WTZA 3DV8A 1G3YA 1D1BA 3K4CA 5JR3A 4MTEA 3E5UA 1E2XA 5CVVA 3WODF 1AWCA 2JRMA 2LF8A 4KIBA 5F0CA 1ZQ3P 4F52A 2CQ7A 3IH4A 3GEZA 3S3MA 1RUOA 3H3ZA 3I4PA 1E3OC 4C2TA 1S29A 2K85A 2PJPA 1SC7A 2HGCA 1MDMB 2LOOA 1HOMA 3K4BA 4NBQA 3PQJA 1ETWA 2NS8A 3BLYA 3BROA 4Y33A 2KISA 3HGGA 4IXAA 1T56A 4PSWA 5F0FA 4BYYA 5IYCJ 2HS5A 2DFHA 1R5GA 2HVQA 2AXLA 3L7WA 2B63J 2VQGA 2W25A 5F04A 5H6QA 3FXUA 3J7YJ 4DBRA 2EFPA 2LBFA 2R92J 2XPVA 1UAAA 2MC3A 4XICA 2PFBA 3OIQA 1I3QJ 2LYCA 2PLYA 1DP3A 2CRGA 1OKRA 1FOWA 3TOAA 2JJ7A 1D1AA 1GVDA 2K27A 3KETA 3KLNA 1ETOA 3BR3A 2VIXA 3J81Z 3M9AA 4DYQA 5DCFA 4L9JA 3FK6A 5BNGA 2DO7A 4ENNA 3TP3A 3LSIA 2VXDA 3ROUA 4HQMA 4XSZF 2LY2A 5D5UB 1ZAOA 1T0FA 2ID3A 3SFIA 1JUMA 4MFEA 4ZYDA 2H94A 1Z6TA 2EPFA 3JRCA 1R9TJ 2Q1ZB 1U6GA 1HF0A 2E19A 3S93A 3QYFA 5A2QZ 2PMUA 1D0ZA 2EV6A 5E1ZB 5EEGA 1ZLJA 2M9HA 1VNDA 4QPQA 2DMQA 2KL4A 1ON1A 2WY7Q 1JKPC 2R7DA 3BR6A 2AS5F 3CCJI 4HNVA 4ENJA 4L9VA 3Q5FA 5EEAA 2UUZA 4MFDA 4HNTA 3G1MA 1W0UA 1H8AC 2W57A 1TQMA 3D5LA 5AIPA 4C2UA 3TW6A 2QUFA 2LR8A 4BGDA 3GTQJ 3PSIA 5TISC 2VPLA 1MIJA 3DLAA 4XN0A 1VQPI 3OYHA 4A3FJ 4E70A 1ORKA 4HA8A 1EJ9A 3OL3A 4MLOA 3S1RJ 3A1YA 1P4WA 2GA2A 1IUFA 2OJED 2OCCH 2A69F 3QRFF 2QA4I 1N25A 4UUTA 2XPUA 3WTVC 2IW5A 5M5WJ 3SJMA 4ZDPA 3AFHA 4XLNF 3RYPA 2EIJH 1J2XA 5J1UA 2L7MP 2NVXJ 5FO5A 5LEKA 1WWXA 2ECCA 1YQAA 3K2AA 4F92B 2FUG2 5LFAA 3CCLI 1TWAJ 3PFIA 3ZOBA 1ZELA 4I7HA 4F55A 2K3FA 3KCCA 5D4RA 3QU3A 2NRAC 4M3FA 2PI0A 4RGRA 3QP6A 3H5RA 3HTUA 3E6CC 4BY1J 1QGPA 4D0PA 1VF9A 1OCPA 2PMZA 2CH0A 5D5XB 2R7UA 2NXNB 2I5UA 4XKVA 2ICWG 1F5TA 3PO2J 1H89C 4E7HA 2CUEA 3HB9A 3BWGA 4II3A 4OOIA 4M74A 5J8FA 2LY1A 4BHBA 4I99C 5JVTA 2M4KA 2DK5A 3PUFA 1K79A 1ZLKA 3CCUI 3ULQB 1KYZA 3HRMA 2M34A 3HXLA 3QPHA 5LGTA 2R7VA 5LGNA 3OYCA 3WTYC 2ZO4A 3PFYA 2X1DA 5IYBJ 2HI3A 3GXOA 4B47A 5BOXA 3WU0A 1QZZA 1SFXA 2JVGA 1XGNA 2ID6A 3VYTB 2VJ4A 2HOEA 2VT3A 1Z3YA 4U7BA 2AXTC 5FKKA 1R6RA 3DTKA 2W7NA 3K4KA 2R7ZJ 1Z0XA 2DJNA 1HDDC 2OF7A 3OY9A 3NARA 2JA8J 2R3SA 1VFCA 3NAUA 1XPXA 2ZCWA 2VE9A 3DBRB 3F3XA 3Q0VA 4BQOA 2R5YB 1VQOI 1TWHJ 2R7RA 3Q3SA 1YE9A 3OS1A 2BVLA 2PX9A 3CLOA 1KQ9A 3CZ6A 4CCNA 3LAJA 2KIMA 5IP9J 2IS6A 3BDDA 1U8RA 1PVEA 1WJBA 3FMQA 4UB8C 3QYEA 5LHHA 5IT9Z 1R4NB 3BT9A 2E5ZA 3AG3H 2DA3A 2VC1A 3E97A 1IG7A 2YX7A 3DU5A 5JLXA 4I76A 3IAM2 3EUHC 4RM2A 3TKYA 5B5EC 2V7FA 3BQYA 5CVJA 1VI0A 5J40A 5LLQA 1OCCH 2R5ZB 2M45A 3ZXSA 1ZK8A 4KITB 3V4GA 2A3SA 5KAIC 1U0JA 3HEFA 1IRGA 4MEYF 4AIKA 4U87A 3F9KA 3H0GJ 2DW4A 2QF7A 4UV9A 2WBMA 2BZTA 4NC8A 3QU6A 1NG7A 1XCVA 3K7AJ 2N8GA 2G0EA 5CQGA 3RIRA 1MBFA 5ICCA 4LK1F 4E7LA 3O3KA 1T08B 2ZKZA 4WX9A 2XB5A 3MQ0A 1K4TA 3FX3A 3LA2A 3ZRGA 5GTHC 4IOCF 3CLQA 4Y52J 4J01A 4XQFA 1JHFA 1UHWA 5J8CA 3E1SA 2KT0A 3L00A 1JJ6C 1YRNB 3CCYA 3JSPA 1KU3A 2FBHA 1WI9A 2QENA 2A05A 2E35A 1XSVA 4RB0A 1DP7P 2W00A 2G9WA 1Z77A 3KYDB 1S72I 2JMWA 2DDBA 1J09A 2KP6A 1MJBA 1REPC 2CW8A 3GFMA 3OYBA 1SD5A 3F8NA 3HRSA 3M3YJ 3V7CA 4IX7A 1IN4A 2EB7A 2FE3A 4XKWA 1FTTA 2PBIA 2HQNA 1HW1A 5D6FA 1VQLI 1ACIA 3U1KA 3I56I 1F1ZA 4HRIA 1QA6A 3PSFA 2IA0A 3ZMUA 2ZMEA 1HKQA 5ICFA 2P6TA 4RA2A 5JFRA 3ABKH 3BR5A 4FE4A 5K1YA 1GV2A
chains in the Genus database with same CATH topology
1YHQI 1YITI 5GAEJ 1VQKI 3CCVI 5JVGF 3CC7I 3CJSB 2OTLI 2FOWA 3DLLF 5GADJ 3CC2I 3CCJI 1VQOI 3CD6I 5DM6F 2OTJI 1FOXA 1YI2I 1YJ9I 2ZJPF 1WIBA 3CJTB 4IO9F 1Y39A 1VQPI 3CCMI 1VQ7I 5GAHJ 1VQMI 3J7ZI 1VQ6I 4IOAF 1YJNI 2JQ7A 1HC8A 2QA4I 4UY8I 5GAGJ 2QEXI 2H8WA 3CCEI 1MMSA 3CCQI 3I55I 3PIPF 2ZJRF 3CCSI 3CCLI 1YIJI 4IOCF 2E34A 3CJRB 2K3FA 1VQ8I 3G71I 3G6EI 1VQ4I 3J7YJ 2E35A 1VQNI 1S72I 1FOWA 2NXNB 4V19K 3G4SI 1YJWI 3CMEI 3CC4I 3CF5F 1VQLI 1ACIA 3I56I 3EGVB 3CCRI 1QA6A 3CCUI 3CJQB 2E36A 3CMAI 1FOYA 1VQ5I 3PIOF 2ZJQF 1VQ9I 5DM7F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHQ I;  1YIT I;  5GAE J;  1VQK I;  3CCV I;  5JVG F;  3CC7 I;  3CJS B;  2OTL I;  2FOW A;  3DLL F;  5GAD J;  3CC2 I;  3CCJ I;  1VQO I;  3CD6 I;  5DM6 F;  2OTJ I;  1FOX A;  1YI2 I;  1YJ9 I;  2ZJP F;  1WIB A;  3CJT B;  4IO9 F;  1Y39 A;  1VQP I;  3CCM I;  1VQ7 I;  5GAH J;  1VQM I;  3J7Z I;  1VQ6 I;  4IOA F;  1YJN I;  2JQ7 A;  1HC8 A;  2QA4 I;  4UY8 I;  5GAG J;  2QEX I;  2H8W A;  3CCE I;  1MMS A;  3CCQ I;  3I55 I;  3PIP F;  2ZJR F;  3CCS I;  3CCL I;  1YIJ I;  4IOC F;  2E34 A;  3CJR B;  2K3F A;  1VQ8 I;  3G71 I;  3G6E I;  1VQ4 I;  3J7Y J;  2E35 A;  1VQN I;  1S72 I;  1FOW A;  2NXN B;  4V19 K;  3G4S I;  1YJW I;  3CME I;  3CC4 I;  3CF5 F;  1VQL I;  1ACI A;  3I56 I;  3EGV B;  3CCR I;  1QA6 A;  3CCU I;  3CJQ B;  2E36 A;  3CMA I;  1FOY A;  1VQ5 I;  3PIO F;  2ZJQ F;  1VQ9 I;  5DM7 F; 
#chains in the Genus database with same CATH topology
 4A6E A;  1LPQ A;  4H4K C;  1UG2 A;  1EH8 A;  1KQ0 A;  1Q1H A;  1LQ1 A;  2MLK A;  3DPU A;  1IDY A;  3W6K B;  1TQP A;  4IQJ A;  1OJL A;  1T98 A;  2STW A;  2KHM A;  1ZG3 A;  3OIP A;  4HX8 A;  1EF4 A;  3EQL F;  2NOJ B;  3GZ5 A;  1O3T A;  4HW0 A;  2VL8 A;  3HL2 A;  1ZTR A;  4RGU A;  1FMV A;  4ON0 A;  3Q9V A;  4OIN F;  4DZP A;  3K4L A;  3U2R A;  4BHC A;  3EYI A;  2VC0 A;  4P9U A;  2X0L A;  1SD6 A;  1TNS A;  4RB3 C;  4C9Y A;  5A2Q K;  3I0T A;  3J80 K;  5C4J J;  4KIF A;  1DGR M;  1T95 A;  1ULY A;  1JJ8 C;  2PJR B;  2M8E A;  3H1C A;  3RI4 A;  3EET A;  1FC3 A;  2W24 A;  1DPU A;  2KPM A;  3TOB A;  3SEZ A;  3GWZ A;  3FHN A;  4ESB A;  5FRO A;  1FY7 A;  2CG4 A;  1Y0U A;  3OS0 A;  1ZG1 A;  2IS1 A;  1G3W A;  4G12 A;  5EGO A;  1MBE A;  5FJ8 J;  1FMW A;  1UST A;  4HST A;  4QLC U;  2OQR A;  3ZQG A;  1P4X A;  4MHG A;  2PG4 A;  3C3W A;  3WGG A;  1MMS A;  4OAZ A;  4RS8 A;  2MBF A;  4W97 A;  1WH7 A;  2MH9 A;  2FBI A;  4G6T B;  4E7S A;  3CCS I;  3IWF A;  3W2W A;  2VLA A;  2HKO A;  3DQV C;  4G6D A;  3GBG A;  1X1D A;  2RDP A;  4FIS A;  3MN2 A;  2DPD A;  1R4M B;  2OBP A;  2WB1 N;  3WGH A;  5TJJ A;  2ECB A;  1Y8Q B;  2FMY A;  4E7J A;  2KZV A;  3VFZ A;  3HOW J;  2NNY A;  1QHH D;  4TV7 A;  5KHD A;  3G3Z A;  1X2N A;  2GQQ A;  3GX4 X;  2I10 A;  2H1K A;  3IH3 A;  2R7X A;  3I59 A;  4LK0 F;  1KYW A;  3K70 D;  2CV1 A;  2X6W A;  2HR3 A;  4UHT A;  3CC4 I;  1R1V A;  1OCT C;  1ZKG A;  2QCO A;  2ETH A;  4B43 A;  3HM5 A;  1JHH A;  3HPH A;  2ADU A;  1IW7 F;  4DNC A;  4HV6 A;  3CMA I;  4X1E A;  2LH9 A;  3F23 A;  2XPW A;  3HOU J;  4DZJ A;  2XGE A;  3L2U A;  4I2O A;  1XX5 A;  2M5W A;  3ZMD A;  4QSH A;  4LGW A;  3P9C A;  1BJA A;  3OYG A;  4CH7 A;  3RCO A;  3F72 A;  4GXO A;  3JRF A;  1PYV A;  3DLL F;  1V5E A;  2CFX A;  1BI3 A;  4BXX J;  1MMN A;  1LUJ B;  2FQ4 A;  4BJ5 C;  3T8R A;  3BG7 A;  5EJC A;  4A3C J;  4M6V A;  3HG9 A;  3S16 J;  1MZB A;  2F4I A;  1I5Z A;  4IQ4 A;  1WGX A;  2LBF B;  2OTJ I;  4JX5 A;  3OIO A;  1JGG A;  4LJZ F;  4BE1 A;  3P9K A;  3FXL A;  2AHQ A;  2O9L A;  2L4M A;  3OYD A;  2P5K A;  4IPA A;  5D6E A;  3CCM I;  3DTE A;  1YX3 A;  1SMT A;  1LEA A;  2HQ5 A;  2YX4 A;  1E0E A;  4KT6 A;  1D8K A;  1VQ6 I;  4XLC A;  2CUZ A;  3A01 A;  2QLZ A;  1YRN A;  1KON A;  2IEK A;  3RKY A;  4IRI A;  5LGU A;  2X6O A;  2DA4 A;  2R4G A;  3AL0 C;  2Q2E A;  3H5A A;  4IHW A;  3LST A;  2HFH A;  3R60 A;  3RSN A;  2EV5 A;  1O57 A;  1FWZ A;  4W1U A;  1TTY A;  4FAS D;  2XF5 A;  1BJZ A;  2EZH A;  2YR2 A;  3GTP J;  2L4A A;  2FRH A;  3K4M A;  4HF0 A;  1JTX A;  4XLH A;  4XRS G;  2MW8 A;  2CS3 A;  4CCM A;  4YFN F;  3JRI A;  4I6Z A;  1ZGW A;  2DQR A;  2DMN A;  5L3F A;  4N9I A;  1WI3 A;  1XMX A;  4HDU A;  2ZFW A;  1XMK A;  3GZ6 A;  5DCM A;  5E8G A;  2KLO A;  1U5T C;  2A6H F;  4H0E A;  4MEX F;  5CYV A;  3RZO J;  5AIQ A;  1VQN I;  4GYG A;  5TRD A;  1EH7 A;  4N4O B;  1K4S A;  3IV5 A;  1BIB A;  3I58 A;  1A5J A;  2CUF A;  1JUS A;  4I02 A;  2CWE A;  1X4O A;  2XAJ A;  4HAM A;  4O6J A;  4O5V A;  2WAD A;  5LRS A;  4G7O F;  4B48 A;  2VPR A;  2EH3 A;  2ZSI B;  3LA3 A;  4WF2 A;  5AON A;  4JYK A;  3BC8 A;  3OYN A;  1IRF A;  1UB9 A;  2LTP A;  4CCK A;  4LMY A;  5KVR A;  1OR7 C;  3ELK A;  4YFX F;  1FP2 A;  2Y9Z A;  1T8I A;  5GAE J;  2PJR A;  1DU6 A;  3ZMV A;  3GFJ A;  2EWN A;  3K1N A;  1ZRF A;  1QZY A;  4QIW N;  4HSR A;  5HLT A;  2L7F P;  2QQB A;  2D45 A;  4LLL A;  5E20 A;  1ETY A;  4FTH A;  1UHM A;  2HU9 A;  2WB1 A;  4EM0 B;  3L2R A;  1WJA A;  3N4M A;  3OYE A;  2IXS A;  4AVZ A;  5L3E A;  4FHT A;  5FD6 A;  5GPA A;  2XKO A;  2XV4 S;  4RM3 A;  4EM2 A;  1SFK A;  4YEJ A;  5ERI A;  5K5R A;  3MD2 A;  2E2I J;  2ME6 A;  2WV0 A;  4I0B A;  4UVA A;  2TCT A;  2QGU A;  4FX0 A;  1X1B A;  3FKI J;  2RV8 A;  4IF4 A;  3HC7 A;  1FBQ A;  3CMY A;  3BY6 A;  3HSR A;  3HOV J;  3FKJ A;  3MWM A;  2L9V A;  5JI6 A;  2XUB A;  4IEJ A;  2OAZ A;  2QM3 A;  4D7M A;  4B1R A;  4AID A;  1MSF C;  2W48 A;  2EIM H;  2TDX A;  3E6M A;  1H9T A;  4NC7 A;  4LOC A;  2L2O A;  1U8B A;  2VXZ A;  2XKP A;  1WHU A;  5D5V B;  2BHZ A;  1NHA A;  1WVR A;  3S15 J;  1ONV A;  3O8G A;  1RKW A;  4GFB A;  2EQR A;  4KN7 X;  1UMQ A;  4PSX A;  3FXO A;  1MH4 A;  1XGO A;  1YIJ I;  2E34 A;  1W5T A;  3HKZ A;  4HPQ A;  3OR1 C;  4A0Z A;  2D2W A;  4Y15 A;  3RKX A;  4XRM A;  3MKL A;  4KMU X;  3ISP A;  4JQF A;  3TP0 A;  3G71 I;  2BY0 A;  2L02 A;  2X6X A;  2LMD A;  2OV7 A;  3NWS A;  3HRT A;  3RYR A;  1IF1 A;  4JBA A;  4G7H F;  1FYK A;  2XC7 A;  4PJ0 C;  1FYM A;  4Y17 A;  1FPQ A;  4M9S A;  1D3Y A;  2OZ6 A;  4BJ6 C;  3RZD J;  2LK2 A;  5H6R A;  2VBX A;  4ZYE A;  4A3I J;  4KMF A;  2VOO A;  5K5Q A;  1GXQ A;  3SZP A;  5HDN A;  2L7K A;  1J0R A;  3JTH A;  2XIG A;  2V9P A;  5GP9 A;  1OCO H;  2KDO A;  4OAY A;  3ERE D;  2BE5 F;  3EGV B;  1AHD P;  4V2F A;  4RB2 C;  2OZU A;  4Q48 A;  3WTW C;  1WJC A;  2MC4 A;  4ZZL A;  1IJW C;  2IP2 A;  5LBQ A;  1ETK A;  4LG0 B;  2YUS A;  5KNL A;  2QBY A;  3Q0W A;  1AOY A;  4Y4R A;  2VT2 A;  1VQ9 I;  5FKO A;  2O5R A;  1I50 J;  2HPI A;  3CP2 A;  1PP8 F;  3DU6 A;  3VSK A;  5C4X J;  1KGS A;  3ABU A;  1N78 A;  4E4H A;  1V3F A;  2HDW A;  2YU3 A;  1EV7 A;  3BJ6 A;  3K2Z A;  1YYV A;  3DFG A;  3HBL A;  1ETQ A;  1B72 A;  1LVA A;  3O8H A;  1VZ0 A;  3OOU A;  2EFW A;  3C18 A;  2P7V B;  4HQE A;  4KYW A;  1S3J A;  3H3U A;  1OMI A;  3CDI A;  3W6V A;  3LSK A;  3C1D A;  4IHX A;  5B66 C;  3LQR A;  1TW3 A;  1TWG J;  2H6C A;  4M3G A;  2QWW A;  2BBY A;  1R1T A;  3C2G A;  1Z7U A;  1R58 A;  2Z2S B;  3TQN A;  2F2E A;  2F5V A;  3J80 Z;  3S1N J;  2QSG X;  3HIF A;  4RAF A;  4ASN A;  3DXJ F;  2XSD C;  3ONQ A;  1Z21 A;  4UUS A;  3HRU A;  3PNT A;  2LKX A;  3GO5 A;  5CJ9 A;  4HF1 A;  1V55 H;  5K7F A;  3OS2 A;  5EYR A;  3L2V A;  1O7L A;  3F21 A;  1YTY A;  4HF2 A;  2P8T A;  1RIO H;  1R7J A;  4CYC A;  1W36 C;  3RPU A;  2PQ8 A;  2XAU A;  4AWX B;  2ZME B;  1O3R A;  4R1H A;  2H8W A;  5J1R A;  3F8C A;  4GGG A;  2RKH A;  3RDI A;  3CCE I;  4E7K A;  3TL4 X;  2K9Q A;  3ASN H;  5EDN A;  1Q1V A;  4MQV A;  2IGM A;  2P5L C;  2FA5 A;  2Y69 H;  3G2B A;  1D0X A;  4XN3 A;  2VON A;  4BBS J;  2F4O B;  4AIH A;  2XRO A;  4A3E J;  2BXZ A;  2K02 A;  2R7O A;  3ZPL A;  3KLO A;  3G6E I;  3AG1 H;  4PFO A;  3RJP A;  3SZT A;  4RAG A;  1S7A A;  3HZJ A;  3WG9 A;  1JXS A;  3I3L A;  1TT0 A;  1MMA A;  1YO5 C;  1XDS A;  2FD5 A;  3DKX A;  2M7B A;  4V19 K;  2OC6 A;  3JRB A;  1F9N A;  1LNW A;  5CKT A;  3S14 J;  4ZJZ A;  2A5Y B;  4B3A A;  2FBK A;  3UR3 C;  1J59 A;  3BQZ A;  5IPA A;  2JA2 A;  2P0W A;  1WJ5 A;  1B8I B;  1JGS A;  5CPR B;  4L18 B;  3ZQL A;  2FSW A;  3CUQ C;  2CYY A;  2J5P A;  5EGO B;  5BS6 A;  1FOY A;  3ZQQ A;  1IRX A;  3HSF A;  3ZQ7 A;  1Z9C A;  1XS9 A;  3HPG A;  2O61 A;  4EMS A;  2O0Y A;  4XOR A;  3TMO A;  3B02 A;  3OYI A;  2X1E A;  2O03 A;  1IC8 A;  5EZH A;  5F0H A;  3VWB A;  3GZN B;  5IOZ A;  3BG6 A;  3S2D J;  5HNF A;  1SVO A;  2PN6 A;  3U21 A;  5H2F C;  3IRQ A;  1IN8 A;  1BR1 A;  4YFK F;  1B4A A;  3GTO J;  3CP8 A;  4YRV A;  4I09 A;  2HNH A;  5KK1 A;  3DP7 A;  3V7R A;  1VTN C;  3GTJ J;  1QVU A;  2C6Y A;  3DBH B;  3KP2 A;  2IGN A;  4HLY A;  4ITV A;  1FZP B;  5TGT A;  4ZDL A;  2K9M A;  2IA1 A;  5DM6 F;  4EQQ A;  3SHF A;  4P55 A;  2K40 A;  2MD0 A;  3SEQ A;  2X48 A;  2DQL A;  2XRN A;  1C0W A;  3SQN A;  2F4M B;  4IVN A;  3W2A A;  5DDG A;  4DQ2 A;  1PP7 U;  1ZHF A;  4R79 A;  2O6G E;  4PCQ A;  3I54 A;  5E1W A;  3W3C A;  2RQQ A;  1VQ7 I;  2JA7 J;  3I9V 2;  3IKT A;  3H3V K;  1R5I D;  2TRT A;  3I59 B;  1TLH B;  1YS7 A;  3MKZ A;  3CUO A;  2UXX A;  4YEL A;  1KZH A;  1O3S A;  2H8R A;  1LFP A;  2BEO A;  4B3X A;  2DT5 A;  2HYG D;  5HS7 A;  2M2E A;  5ED4 A;  3HUG A;  4UNO A;  3TED A;  2FX0 A;  3W6J B;  5GAG J;  2FNP A;  2DA5 A;  3SFZ A;  3KFW X;  4A3D J;  2RNJ A;  3CDH A;  4E7Z A;  1TWC J;  1BBY A;  2V1X A;  3TO9 A;  2ZJR F;  2ZXJ A;  1HBX G;  3DEE A;  4I0A A;  2CO5 A;  5FFX A;  3GTK J;  5HDK A;  1SD4 A;  2ESH A;  4A3J J;  2F5C A;  4EJV A;  5ILS A;  4YIR X;  2X6Y A;  2LVS A;  2X51 A;  3OWT A;  3F8F A;  4LG0 A;  3L09 A;  5JLW A;  5GTI C;  2D1H A;  3RPU D;  4KN4 X;  2V79 A;  1MSE C;  3V8J A;  3ZMT A;  1DQU A;  1YW7 A;  1FYL A;  2OPT A;  1YX5 A;  1PUF A;  2MLG A;  2IPQ X;  3Q9S A;  5CVI A;  3I71 A;  1ZRC A;  2EIN H;  2HTS A;  1K61 A;  3S2W A;  2EFO A;  2GOX B;  4ZDO A;  3F22 A;  3V42 A;  2Y48 A;  2GBY A;  1QZE A;  1WZ2 A;  2LRE A;  1YOV B;  5FRN A;  3A01 B;  1V54 H;  2Z5U A;  3LWF A;  1GDT A;  1X3Z B;  1RR8 C;  3M1E A;  1IXS B;  1EA3 A;  2XSJ C;  2ZJQ F;  4S05 A;  1W0T A;  2KIQ A;  3HYI A;  1RI7 A;  5IP6 A;  3S2H J;  4MQ9 F;  3VOD A;  4ENK A;  4LG3 A;  2Q2E B;  3J7A Y;  4RDU A;  4MIM A;  1XG1 A;  2EK5 A;  4BXU A;  1BC8 C;  1W5S A;  2OTL I;  4L9T A;  1R49 A;  2FOW A;  3ABM H;  3K4N A;  5IY5 H;  1Y1W J;  1DU0 A;  1KU9 A;  1MW7 A;  2F5E A;  2IS4 A;  1TP4 A;  3D0S A;  3IC7 A;  3JRD A;  2LFB A;  2RN7 A;  4HOB A;  3MFK A;  1XC5 A;  4NQW B;  2DU9 A;  4KIC A;  4K2E A;  3IL2 A;  1L3L A;  5EF6 A;  2HOT A;  3HOX J;  3CO7 C;  3ZMS A;  1MKM A;  4OU0 A;  5J6X A;  2JZY A;  2UZK A;  2DOF A;  3MZY A;  4M6X A;  4UXN A;  1WCM J;  2L5Q A;  5DCM B;  3S3N A;  2NVT J;  2B0L A;  4A3G J;  2L3D A;  4BDZ A;  1HQC A;  1OCR H;  5H20 A;  3DWL E;  4ZC3 A;  2P4W A;  3SXY A;  5K5O A;  2DA1 A;  2LKP A;  2VI6 A;  1WJE A;  2QVO A;  3HSE A;  3JCU C;  3L2Q A;  4BKX A;  1U9O A;  1T39 A;  4XRS A;  5KAF C;  4CA0 A;  1P6R A;  1PUE E;  3GTL J;  3KP4 A;  3VSL A;  4JX4 A;  5BPD A;  5DD4 A;  2W82 A;  1J5Y A;  1X1P A;  4AUX A;  1MD0 A;  3I55 I;  1A6I A;  4JP0 A;  3KP7 A;  1HST A;  1S9H A;  1OCZ H;  2IVM A;  1H0M A;  3QPT A;  1I1S A;  4BH9 A;  1B8I A;  1T6S A;  2BHY A;  2QSF X;  4PGH A;  4XOT A;  4ETS A;  3GLX A;  1A31 A;  1I6H J;  5E17 F;  9ANT A;  2JA6 J;  1IDZ A;  3ZQC A;  3QPS A;  1YG2 A;  2G7H A;  3ZQH A;  4CYD A;  3LSH A;  2VQH A;  1D0Y A;  3PQK A;  4WXH A;  3DBL B;  1ZRD A;  4U0V A;  3G4S I;  4NUB A;  4AIJ A;  1M1E B;  1SVM A;  2XGX A;  3FDY A;  4XLP F;  1TQI A;  2P81 A;  1XD7 A;  3IRR A;  3ZQI A;  2ELH A;  5HNH A;  3CO6 C;  5L3D A;  1XDU A;  2MGQ A;  1ZG5 A;  1MBJ A;  1HKT A;  3WTS C;  3AG2 H;  1H9G A;  1AU7 A;  3JTG A;  4U88 A;  1MJ9 A;  1WJD A;  3EUH A;  3ZN1 A;  3GVA A;  1IN5 A;  4Q4Z F;  3FM5 A;  1FIA A;  5DUK A;  4A3K J;  1LB2 A;  1AA7 A;  1YFH A;  2LKS A;  2XGD A;  1O7F A;  4HX7 A;  2A68 F;  4C2M J;  3N05 A;  3FXR A;  3DKW A;  1XMA A;  2JUG A;  3KEQ A;  3PNV A;  1Y1V J;  3IP4 B;  2DA6 A;  4KUM A;  5ILV A;  1TZL A;  1G4D A;  3CC2 I;  2DMU A;  3M1C A;  2IAI A;  3LSJ A;  2WV1 A;  3QYB A;  1TBX A;  2CQK A;  2DFI A;  3BG9 A;  3RQ4 A;  3IAS 2;  4LFU A;  4EVI A;  2BY3 A;  2QZ8 A;  3FZV A;  5M5Y J;  2ME0 A;  4DBQ A;  4A3L J;  3P7N A;  3WE2 A;  3J7A O;  2ZXI A;  4B44 A;  5L3G A;  1OFC X;  3CD6 I;  3ABL H;  1B59 A;  5IP7 J;  3G1L A;  2JA5 J;  2K3P A;  4L5I A;  4J19 A;  3K9T A;  3QP5 A;  4IZZ A;  3IUO A;  2H6B A;  4F93 B;  1I1G A;  1B1B A;  2I8D A;  1FBS A;  2XAS A;  2FXA A;  2CUJ A;  2GXG A;  2QKM B;  1SFE A;  3DCF A;  4RGX A;  1Z3X A;  3BPX A;  1U78 A;  2WC2 A;  2XHK A;  3HKZ N;  2V4J C;  1JKQ C;  4XLA A;  2MH2 A;  4L9N A;  2QQ8 A;  1YLF A;  2HYJ A;  1USS A;  1LVK A;  2M30 A;  2EV0 A;  3OMY A;  3QQA A;  4A69 C;  3OYM A;  2VOP A;  1YJN I;  5E3O A;  5DS9 A;  2DT6 A;  3KPH A;  4XBF A;  4EJW A;  2DTZ A;  2YU9 J;  1IN6 A;  4A12 A;  4BEH A;  2DOD A;  3WG7 H;  2K9N A;  2JWT A;  2QEX I;  3WGI A;  1GV5 A;  4NC6 A;  2QBY B;  2EFQ A;  4WCG A;  3FXQ A;  3BTJ A;  1LFB A;  1DPR A;  4QTR A;  3H9Q A;  3EPZ A;  4BE2 A;  2RVC A;  5L3B A;  1SAX A;  2VKD A;  1XCB A;  1X4P A;  1ITY A;  3CTA A;  4RLF A;  3LSG A;  1B72 B;  1VQ8 I;  1A6Q A;  1MMG A;  1TNT A;  1XB4 A;  2CJJ A;  2ESN A;  1UHS A;  3BZK A;  3DTI A;  3E6D A;  4RGS A;  3A0B C;  3HHH A;  3COA C;  1S7E A;  5J1Y A;  2BW3 A;  2E1M C;  1HSJ A;  1DUX C;  1TT5 B;  1MMD A;  2RQP A;  2EFN A;  2CMP A;  3R4K A;  1MJA A;  2A6E F;  2EJR A;  1HA8 A;  3K1P A;  3T0Y A;  3KP5 A;  2KRC A;  3VYU B;  4BJT A;  3S32 A;  4C30 A;  2XAQ A;  4ZZD A;  3MMY B;  4KNY A;  1K83 J;  4II2 A;  2EA2 A;  1MBK A;  1FX7 A;  5D4S A;  1T38 A;  3M8F A;  4NQW A;  4UUS B;  5M5X J;  3T5X A;  3PO3 J;  3KP6 A;  1ZH5 A;  1G2H A;  1G3T A;  3CJN A;  2VBW A;  3GF2 A;  2DMT A;  1T2K A;  1O4X A;  1VQ5 I;  4CYC B;  1SFU A;  3TGN A;  4MO7 A;  3DF8 A;  4PGG A;  4AC0 A;  4OMY A;  1MBG A;  1WJF A;  2JPC A;  3PL8 A;  4XSX F;  1NH3 A;  2GOM A;  1B6A A;  1YS6 A;  2Y75 A;  1LKX A;  1Z67 A;  3VB2 A;  1GVJ A;  3KZI C;  3O6B B;  2A61 A;  4F91 B;  5HLG A;  4CGZ A;  2E7W A;  4Q5S F;  1V4R A;  3ERM A;  3B6C A;  2V1N A;  1GHC A;  1FP1 D;  2QKL B;  2EA4 A;  5B1A H;  1RR7 A;  1R5H A;  4DYC A;  4EV0 A;  1BC7 C;  2HEO A;  4IHV A;  3BTC A;  2CW7 A;  4GRI A;  5EZG A;  5FLX Z;  4BAY A;  1I27 A;  3T1B A;  3CES A;  2A6T A;  4OMZ A;  5DTD A;  1WFX A;  2E60 A;  5BPI A;  1IGN A;  1T0F C;  4JK1 X;  3FHZ A;  1F43 A;  1WIB A;  4XR6 A;  4UB6 C;  3SZG A;  4JX6 A;  4DW6 A;  2NAZ A;  2XF7 A;  2WAE A;  4LLN A;  3V7S A;  5EEH A;  4HNU A;  4HX4 A;  2CSO A;  3MKY B;  1N77 A;  4CSW A;  2JTV A;  3FWE A;  4HV5 A;  1TC3 C;  4GDF A;  4PDK A;  4ZH4 F;  4IJA A;  4ABZ A;  3E6B A;  1LE8 A;  3A0H C;  3MKW B;  2ZB9 A;  3HHG A;  1HC8 A;  4OIR F;  4IRG A;  3PM1 A;  2KIU A;  2F5F A;  2IGK A;  4BBR J;  2WWY A;  2M0C A;  3ASO H;  3D5S C;  5L3C A;  4RAZ A;  4P5O A;  2G7U A;  3ZP5 A;  1HW5 A;  3CCQ I;  1Z7L A;  2DT7 B;  3R6S A;  4A93 J;  3PIP F;  3R0J A;  5CVU A;  2V9K A;  2YPR A;  3REO A;  3H5N A;  4WWC A;  2KQR A;  4XMY A;  3V8K A;  3MCZ A;  1POG A;  2XF6 A;  4HEA 2;  1S6L A;  3VOE A;  1JI8 A;  1FSH A;  2XB0 X;  2CGP A;  4FE7 A;  1VQ4 I;  1HKS A;  3NQO A;  5F27 A;  4ZTJ A;  2ACJ A;  3S1M J;  5E8I A;  3LAP A;  2ZFU A;  2H1L A;  1WSU A;  5B1B H;  2A07 F;  2QSH X;  5K7H A;  2K4J A;  3OYF A;  2KDZ A;  1P7I A;  4A0X A;  4CO8 A;  4A3M J;  1XSX A;  2KZG A;  2KFD A;  4GYI A;  3CME I;  1WRJ A;  1P4A A;  2VN2 A;  1MNM C;  1HCR A;  2O7O A;  4HYE A;  2E2J J;  1KA8 A;  1ZGA A;  2DJI A;  2JPB A;  4LIT A;  3W2V A;  3GME A;  3QWL A;  1G8X A;  2KJB A;  1GUU A;  5DYM A;  2F5D A;  2X4H A;  3L9F A;  2W4S A;  5FLV A;  4CXF A;  2WAQ N;  3CJQ B;  2E36 A;  3I53 A;  3N97 A;  4OWR B;  3HUG B;  4XON A;  2LRD A;  2VQL A;  5FKL A;  3FXM A;  1X1A A;  4ANJ A;  4P96 A;  3GTM J;  1X58 A;  2AQF A;  3OL4 A;  1BA5 A;  4A5M A;  2XAG A;  2KRF A;  3LSR A;  4B8X A;  1X2M A;  4M6Y A;  1OYI A;  4MNU A;  1APL C;  1S5L C;  4XL9 A;  5GAD J;  4NDL A;  2ZSH B;  3PNY A;  2LDU A;  2M0M A;  2VAS A;  4BXF A;  3L1P A;  4FCY A;  2Z9O A;  1SAU A;  3TBI A;  1BI0 A;  2DOE A;  2L7Z A;  4UUV A;  3DKY A;  5F64 A;  2F6C A;  3M8E A;  4S04 A;  2V9V A;  3DEU A;  3L2W A;  3HGY A;  1ZN2 A;  2OUM A;  3BG3 A;  3H0D A;  1U9N A;  2HVS A;  2V1U A;  4KIG A;  2DMP A;  1DGW Y;  2DOA A;  3K1M A;  3JR9 A;  1PUF B;  3S8P A;  4IO9 F;  4D9J A;  1Y39 A;  1K78 A;  2E2H J;  4BQQ A;  3F8M A;  1E3P A;  1JT0 A;  1VQM I;  3ECH A;  1E3H A;  2R0Q C;  1U5T A;  5IT3 A;  4L0Y B;  2L9S A;  2MYS A;  1R71 A;  2R7S A;  2IRF G;  2DN0 A;  3MEX A;  3QOE A;  4M3D A;  2JQ7 A;  3JRG A;  3WHC A;  2MSY A;  1EH6 A;  2JSP A;  2NVQ J;  3VPR A;  5DEQ A;  4LB5 A;  4Z2Y A;  1W7P A;  3I5U A;  4M9Z A;  1XSD A;  1Y8R B;  2XAF A;  2HPM A;  4XM3 A;  3WU2 C;  3O2P E;  5D5W B;  4KFC A;  3DPL C;  1SFO J;  1P9Q C;  1IV8 A;  4PJN A;  3K0L A;  6PAX A;  2MD5 A;  2Z99 A;  1G59 A;  2BXY A;  3QPL A;  3HJE A;  2DYR H;  3FBN B;  1Z91 A;  1OR7 A;  4CDG A;  1ON2 A;  5HLI A;  2KRH A;  3M8J A;  4NB5 A;  3ZGK A;  1OYY A;  1CF7 B;  5D8K B;  4KT5 C;  4HLX A;  2XAH A;  4XOP A;  1I39 A;  4HG2 A;  4D1Q A;  2VOD A;  1UZC A;  3K69 A;  4IRH A;  1BL0 A;  2Q8K A;  1YJW I;  3A03 A;  4XRF A;  3HOY J;  2R7T A;  1SD7 A;  3C2H A;  1LDJ A;  1P92 A;  3CUQ B;  4G7Z F;  3CF5 F;  2BVM A;  1A36 A;  3I64 A;  5E3N A;  1IXR C;  3RPQ A;  2O3F A;  3K70 C;  3S17 J;  3KZZ A;  2QQ9 A;  2HKX A;  3OSG A;  3PIO F;  1BOB A;  3TDU C;  2FU4 A;  5FLM J;  4PJM A;  1AKH A;  1YIT I;  2NOG A;  3TO7 A;  1I3A A;  2HWV A;  3KEO A;  2X9D A;  5JVG F;  1CGP A;  1NK2 P;  2OU2 A;  2P6S A;  3CJS B;  3M4O J;  2Y0S N;  1BM9 A;  2Z3Y A;  2VBZ A;  5ICG A;  1BW5 A;  1BR2 A;  3OV8 A;  1SEU A;  4EJU A;  3KYL A;  2HDD A;  1RNL A;  3FMR A;  2CFO A;  1Z05 A;  3WHB A;  4AM3 A;  4WXD A;  2EZK A;  1TW2 A;  3HDD A;  3QOD A;  3ZCO A;  1QPI A;  4RLQ A;  4DJA A;  4IHT A;  1K6Y A;  3PUB A;  1B9N A;  1HW2 A;  2GLO A;  3GFL A;  1FOX A;  2XGC A;  1CQT A;  3FF5 A;  5FKM A;  4RB1 A;  2V6C A;  3FMS A;  4N9H A;  1JKR C;  1U2W A;  2ZME C;  3B6A A;  2GZW A;  2V1D A;  2JT1 A;  4M3E A;  2ZNY A;  4N4N B;  1UFM A;  3H36 A;  1RRJ A;  4FX4 A;  5J47 A;  4B4C A;  2H09 A;  5LHG A;  4EJO A;  1IV6 A;  4KIS A;  4LIV A;  3BZC A;  3RKW A;  4CCO A;  4M71 A;  1X19 A;  4IHS A;  2JN6 A;  4YG2 F;  4LB6 B;  4D5F A;  2WAQ A;  3E3V A;  1GT0 C;  5FLX K;  4Y7N J;  2UV1 A;  2E1C A;  3C7J A;  2HZT A;  1FT9 A;  3F6O A;  5FD5 A;  1JUP A;  5J4V A;  3JRH A;  3ML6 A;  2M8G X;  5HDG A;  1ZYR F;  4JOM A;  4A6D A;  3MZ8 A;  3IKV A;  2RNG A;  4RBO A;  2LSO A;  2IS2 A;  1ZR2 A;  2D5V A;  3K10 A;  1TWF J;  3P5J A;  4YII A;  4O3M A;  3SDG A;  3MZH A;  4FQG A;  3OYJ A;  2VUM J;  3LQQ A;  2GWR A;  3E7L A;  3WTT C;  2DXI A;  2MFZ A;  5F08 A;  4AU7 A;  5FFZ A;  1FEX A;  1HXD A;  3GLL A;  1K6O A;  2CU7 A;  1I6X A;  2X1C A;  2NNN A;  3LFU A;  5BMZ A;  1BR4 A;  2CW0 F;  1D8J A;  4LLG F;  4UVB A;  3K4J A;  3CF2 A;  1W4M A;  5DV5 A;  2CV2 A;  2Z16 A;  3QOP A;  1W7P D;  1QRY A;  2FML A;  4FT8 A;  5LRR A;  1ODD A;  4BS9 A;  3IWZ A;  2JVH A;  3BCA A;  4A2U A;  1JTY A;  3JW4 A;  2EZI A;  2RGV A;  5LD2 C;  4FET A;  4U0W A;  3CCR I;  2FNA A;  1IN7 A;  3DEW A;  3KZY A;  3BOQ A;  1RKT A;  3KEY A;  4CCJ A;  1B9M A;  2K9S A;  1Y0N A;  2J5O A;  3VYR B;  4BDY A;  2BY2 A;  4BEH B;  1LFU P;  1KQ8 A;  1YW9 A;  1HDP A;  3GCM A;  2ZBK A;  1QQI A;  1MDM A;  4PK4 A;  5E1X A;  2K9L A;  4WK8 F;  2K5C A;  3U9G A;  5M3F J;  1JT6 A;  3FM3 A;  4KDP A;  2LNB A;  1R00 A;  1P2F A;  1MH3 A;  2KIF A;  3ECO A;  3KX2 A;  4U7D A;  4L5J A;  5E18 F;  2VJI A;  3E5Q A;  4C3J J;  1ZGJ A;  3LFK A;  1R1U A;  3A4C A;  2VKH A;  2X85 A;  4XKC A;  4PJJ A;  2M3A A;  3JAM Z;  3SDB A;  2BW3 B;  4M73 A;  3HTS B;  2DFE A;  5IYD J;  5DD8 A;  3M07 A;  2V6E A;  2XRL A;  5KCM A;  2COB A;  4AYB N;  3WTX C;  3CDL A;  5LHI A;  1YJ9 I;  2LY9 A;  2OA4 A;  3R61 A;  2HOA A;  3BR0 A;  3CJT B;  5E79 C;  5K7Z A;  4KA4 A;  5ILU A;  4CUG A;  3H92 A;  3FBI B;  1UG0 A;  1ZAR A;  1PDN C;  4IOA F;  5EG0 B;  1LJ9 A;  2MAB A;  2OCE A;  3GFI A;  1ETV A;  4CZZ A;  1CF7 A;  2M1B A;  2Z33 A;  1MND A;  2GXB A;  4M9X A;  4P9F A;  2HDC A;  4KJZ A;  2BV6 A;  4G9Y A;  1ENH A;  3AG4 H;  1ERD A;  2CQQ A;  3BZ6 A;  1H88 C;  2W1O A;  2Y9Y A;  4BAC A;  2DDA A;  3ZR8 X;  5CLS A;  1BN5 A;  4G94 A;  4J00 A;  1SMY F;  3CUQ A;  1MNE A;  1J75 A;  3LMM A;  2Y0S A;  3Q0U A;  1OQY A;  2R93 J;  1E17 A;  3KYC B;  3RTR A;  2EZL A;  2EBI A;  5E3M A;  3ABT A;  3A02 A;  2GXA A;  2MA3 A;  5HOO A;  3UKG A;  4D5C A;  4Y13 A;  3PJR A;  1UEL B;  4DGW B;  2LD5 A;  2K7L A;  1RUN A;  5F1R A;  4N0B A;  3TO6 A;  3MAJ A;  2DA7 A;  3J81 K;  2DTR A;  5FKN A;  1OIS A;  2ZXW H;  4G6Q A;  5HOD A;  1K7A A;  2OD5 A;  1QU3 A;  4ENM A;  4OIO F;  2UXN A;  4BHP A;  3BTI A;  5B3S H;  3R0A A;  3IHU A;  1IRZ A;  4ZYG A;  1QPM A;  2VKE A;  3OYA A;  1LE8 B;  4UVC A;  1IXC A;  1QO0 D;  1A35 A;  3S1Q J;  2QYO A;  2GIZ A;  1NTC A;  3LL7 A;  2QQA A;  4OIQ F;  2L0K A;  1YHQ I;  2F48 A;  4F7Z A;  1UJ8 A;  4WXC A;  3X2Q H;  3CCV I;  1VQK I;  2B7E A;  2W84 A;  2WY8 Q;  1Y56 A;  1HLV A;  5ICE A;  1XGM A;  4EJT A;  5HLH A;  4DYR A;  3EUA A;  4UV8 A;  1FNN A;  2DAO A;  2E1O A;  2WTE A;  4NNJ A;  4BY7 J;  3K6G A;  4RAY A;  2FJ1 A;  5JHU A;  3F0C A;  4M3B A;  2KJC A;  2CQX A;  4GCV A;  1Y6I A;  2VKV A;  4XLE A;  3E5X A;  2VE8 A;  1KU7 A;  5C3E J;  4BL0 B;  1WPK A;  3QAH A;  3KP3 A;  4V2G A;  2R7Q A;  3D5R C;  1EKE A;  2NS7 A;  4B09 A;  3J7Z I;  4CCL A;  2ISZ A;  2YS9 A;  2VBY A;  3BR2 A;  4C3I J;  1W36 D;  3JSO A;  1U3E M;  1S8N A;  4ESF A;  2FEZ A;  4X0G A;  3ZMZ A;  2HXO A;  1V5G A;  1T33 A;  5DUI A;  1RET A;  4I98 B;  4M72 A;  2L9R A;  3BPV A;  2L54 A;  3F6V A;  4L0Z B;  1FTZ A;  2O8K A;  2AQE A;  4XK4 A;  2LF7 A;  5FGM A;  2ZXH A;  1R22 A;  4QPO A;  3L2C A;  2BGC A;  1XN7 A;  2DCE A;  2GA1 A;  1A04 A;  3U1D A;  5C44 J;  2JSC A;  1X3W B;  4D7N A;  5JHF A;  3LNQ A;  1JKO C;  1IAW A;  1J9I A;  1IZ1 A;  1QNT A;  4E7I A;  2E1M B;  3BTL A;  3FIS A;  3T8T A;  3ZN0 A;  2L01 A;  5E3L A;  1QHG A;  2R5Y A;  1WQ2 A;  4XID A;  3AL0 B;  3GTG J;  2Y31 A;  3JRA A;  2K86 A;  4G8X A;  5J4Y A;  3OR2 C;  1TL8 A;  3OSF A;  2Y0M A;  4EGZ A;  4AD9 A;  2DLL A;  2WAF A;  2DBB A;  5HVQ C;  1FJL A;  4E6K G;  4PZJ A;  4EM1 A;  1IO2 A;  4Y3O A;  2FF4 A;  4AYB A;  4F3Q A;  1G3S A;  5GPC A;  4P1W A;  2HYF A;  4BUP A;  5FB2 A;  5M3M J;  5CVR A;  3H9J A;  4IKF A;  2WA0 A;  1RZ4 A;  5LEJ A;  1K78 B;  3CQZ J;  1ETX A;  2R5Z A;  2STT A;  2FQ3 A;  3G73 A;  1D5V A;  3BP8 A;  1U5T B;  2EIL H;  1N75 A;  3GYH X;  1X1C A;  1YIO A;  2K4B A;  1RES A;  1KU2 A;  3F8B A;  1NK3 P;  1S7O A;  1YW8 A;  2Y30 A;  2W85 A;  2DPU A;  2B9S A;  2BOL A;  2DA2 A;  1LEB A;  4AVP A;  1WH5 A;  2GIV A;  2LP0 A;  4BQN A;  3JRE A;  3NRV A;  5DM7 F;  2ZNZ A;  1W7P B;  3H9G A;  2AO9 A;  3I4M J;  1Z6R A;  1F36 A;  2DK8 A;  3KE2 A;  1MBH A;  2E1N A;  3E0J B;  4BNC A;  2CV0 A;  3GUD A;  4CZC A;  2Y2Z A;  3OYK A;  3D1N I;  2M7A A;  1FLI A;  2NYX A;  1STZ A;  4ZYA A;  3TW7 A;  2BY1 A;  2FOK A;  3A2K A;  2BYV E;  5EG0 A;  3HOZ J;  2RAE A;  1BI2 A;  1LDK B;  2KMU A;  2ZJ2 A;  4XKB A;  4A5N A;  4C3H J;  4ESJ A;  2KKO A;  2CQN A;  1W5C C;  1RC9 A;  5CQE A;  3GW2 A;  2HQA A;  2PEX A;  3VDX A;  2R7W A;  5FRM A;  3UNG C;  1PJR A;  4ZTF A;  4BQA A;  5IT9 K;  5HS9 A;  1QVT A;  2VQC A;  3AKZ A;  2UWM A;  3FXK A;  4L5E A;  2JUC A;  4HZF A;  2ZJP F;  2COM A;  1ZRE A;  3LSM A;  5GAH J;  3WE3 A;  1X3U A;  2DFF A;  1BW6 A;  3OOP A;  3ESW B;  2L9N A;  1W1W E;  3ZQF A;  3RQI A;  2IT0 A;  4OIP F;  1ZR4 A;  2YSR A;  1D1C A;  3MVP A;  3FK7 A;  2E5N A;  4RMN A;  2ELK A;  1GLN A;  1FBU A;  2DI3 A;  3JAM K;  4UY8 I;  1BI1 A;  2NS0 A;  3S3O A;  2Q0O A;  5J3L A;  2GAU A;  4BE0 A;  1IUY A;  1FSE A;  1R36 A;  3EYY A;  2E71 A;  2JRT A;  4GO1 A;  1UCR A;  2VB6 A;  3V8L A;  2IGO A;  2MG4 A;  1AKH B;  3NWT A;  3WTU C;  2P7C B;  4I01 A;  4X6A J;  3C2B A;  3NEU A;  3CJR B;  2ISY A;  1WKM A;  3VYS B;  4XNF A;  2HZD A;  3M7G A;  2V26 A;  3RKQ A;  1D5Y A;  2M4G A;  1XGS A;  2R7F A;  4YIF A;  1P7J A;  3EUK L;  1SVL A;  2RC4 A;  4QWQ A;  3B73 A;  2IA2 A;  2IBD A;  1OYW A;  2PMH A;  4NHJ A;  3BCB A;  2GM4 A;  4Q47 A;  1V5F A;  2NVY J;  1NG6 A;  1J7K A;  2NVU B;  3KIO A;  4MTD A;  2A5W A;  2O8X A;  2ELJ A;  2E7X A;  3P9I A;  2D1V A;  4BU2 A;  2HQR A;  4MGR A;  4IHY A;  2HXI A;  3OYL A;  4PFP A;  3LSP A;  3WU1 B;  4R8H A;  4EGY A;  5HS8 A;  3FXJ A;  4CHU A;  1RPW A;  2IJL A;  1OPC A;  1F4K A;  1R23 A;  3LOC A;  3AAF A;  4LIU A;  2P5V A;  4PJL A;  1LDD A;  5D8L B;  3HOS A;  1GXP A;  1DDN A;  1OLT A;  1Z1D A;  4EAT A;  4EEF G;  4A3B J;  2HOS A;  2VJJ A;  4Z6Y A;  1FOK A;  3HOT A;  2EIK H;  3BJA A;  4XLF A;  3CC7 I;  3LA7 A;  3CMM A;  1MGT A;  2XDV A;  4S0H B;  3VEP A;  3BJO A;  3G1O A;  3TDZ C;  1O3Q A;  4DOZ A;  4DIQ A;  2DYS H;  4CIC A;  3SYT A;  3BG5 A;  3I4N J;  2LLK A;  2LG4 A;  1G6N A;  2VJ5 A;  1FIP A;  3FIW A;  3BR1 A;  4A0Y A;  4ZYH A;  2M87 A;  2Z1D A;  4LD5 A;  1BIA A;  5BQT A;  1L0O C;  2JK3 A;  2PMZ N;  4HBL A;  3IH2 A;  3EDP A;  1BOA A;  2RRE A;  3H35 A;  1XTA A;  4HDV A;  1YI2 I;  4U0Y A;  2XVC A;  2LC2 A;  2OQG A;  2H27 A;  4PUS A;  1QBJ A;  2HVR A;  5IOY A;  5F6F A;  2HTJ A;  1SAN A;  2ZC2 A;  3DPT A;  4IL6 C;  1JE8 A;  5F1J A;  3WTZ A;  3DV8 A;  1G3Y A;  1D1B A;  3K4C A;  5JR3 A;  4MTE A;  3E5U A;  1E2X A;  5CVV A;  3WOD F;  1AWC A;  2JRM A;  2LF8 A;  4KIB A;  5F0C A;  1ZQ3 P;  4F52 A;  2CQ7 A;  3IH4 A;  3GEZ A;  3S3M A;  1RUO A;  3H3Z A;  3I4P A;  1E3O C;  4C2T A;  1S29 A;  2K85 A;  2PJP A;  1SC7 A;  2HGC A;  1MDM B;  2LOO A;  1HOM A;  3K4B A;  4NBQ A;  3PQJ A;  1ETW A;  2NS8 A;  3BLY A;  3BRO A;  4Y33 A;  2KIS A;  3HGG A;  4IXA A;  1T56 A;  4PSW A;  5F0F A;  4BYY A;  5IYC J;  2HS5 A;  2DFH A;  1R5G A;  2HVQ A;  2AXL A;  3L7W A;  2B63 J;  2VQG A;  2W25 A;  5F04 A;  5H6Q A;  3FXU A;  3J7Y J;  4DBR A;  2EFP A;  2LBF A;  2R92 J;  2XPV A;  1UAA A;  2MC3 A;  4XIC A;  2PFB A;  3OIQ A;  1I3Q J;  2LYC A;  2PLY A;  1DP3 A;  2CRG A;  1OKR A;  1FOW A;  3TOA A;  2JJ7 A;  1D1A A;  1GVD A;  2K27 A;  3KET A;  3KLN A;  1ETO A;  3BR3 A;  2VIX A;  3J81 Z;  3M9A A;  4DYQ A;  5DCF A;  4L9J A;  3FK6 A;  5BNG A;  2DO7 A;  4ENN A;  3TP3 A;  3LSI A;  2VXD A;  3ROU A;  4HQM A;  4XSZ F;  2LY2 A;  5D5U B;  1ZAO A;  1T0F A;  2ID3 A;  3SFI A;  1JUM A;  4MFE A;  4ZYD A;  2H94 A;  1Z6T A;  2EPF A;  3JRC A;  1R9T J;  2Q1Z B;  1U6G A;  1HF0 A;  2E19 A;  3S93 A;  3QYF A;  5A2Q Z;  2PMU A;  1D0Z A;  2EV6 A;  5E1Z B;  5EEG A;  1ZLJ A;  2M9H A;  1VND A;  4QPQ A;  2DMQ A;  2KL4 A;  1ON1 A;  2WY7 Q;  1JKP C;  2R7D A;  3BR6 A;  2AS5 F;  3CCJ I;  4HNV A;  4ENJ A;  4L9V A;  3Q5F A;  5EEA A;  2UUZ A;  4MFD A;  4HNT A;  3G1M A;  1W0U A;  1H8A C;  2W57 A;  1TQM A;  3D5L A;  5AIP A;  4C2U A;  3TW6 A;  2QUF A;  2LR8 A;  4BGD A;  3GTQ J;  3PSI A;  5TIS C;  2VPL A;  1MIJ A;  3DLA A;  4XN0 A;  1VQP I;  3OYH A;  4A3F J;  4E70 A;  1ORK A;  4HA8 A;  1EJ9 A;  3OL3 A;  4MLO A;  3S1R J;  3A1Y A;  1P4W A;  2GA2 A;  1IUF A;  2OJE D;  2OCC H;  2A69 F;  3QRF F;  2QA4 I;  1N25 A;  4UUT A;  2XPU A;  3WTV C;  2IW5 A;  5M5W J;  3SJM A;  4ZDP A;  3AFH A;  4XLN F;  3RYP A;  2EIJ H;  1J2X A;  5J1U A;  2L7M P;  2NVX J;  5FO5 A;  5LEK A;  1WWX A;  2ECC A;  1YQA A;  3K2A A;  4F92 B;  2FUG 2;  5LFA A;  3CCL I;  1TWA J;  3PFI A;  3ZOB A;  1ZEL A;  4I7H A;  4F55 A;  2K3F A;  3KCC A;  5D4R A;  3QU3 A;  2NRA C;  4M3F A;  2PI0 A;  4RGR A;  3QP6 A;  3H5R A;  3HTU A;  3E6C C;  4BY1 J;  1QGP A;  4D0P A;  1VF9 A;  1OCP A;  2PMZ A;  2CH0 A;  5D5X B;  2R7U A;  2NXN B;  2I5U A;  4XKV A;  2ICW G;  1F5T A;  3PO2 J;  1H89 C;  4E7H A;  2CUE A;  3HB9 A;  3BWG A;  4II3 A;  4OOI A;  4M74 A;  5J8F A;  2LY1 A;  4BHB A;  4I99 C;  5JVT A;  2M4K A;  2DK5 A;  3PUF A;  1K79 A;  1ZLK A;  3CCU I;  3ULQ B;  1KYZ A;  3HRM A;  2M34 A;  3HXL A;  3QPH A;  5LGT A;  2R7V A;  5LGN A;  3OYC A;  3WTY C;  2ZO4 A;  3PFY A;  2X1D A;  5IYB J;  2HI3 A;  3GXO A;  4B47 A;  5BOX A;  3WU0 A;  1QZZ A;  1SFX A;  2JVG A;  1XGN A;  2ID6 A;  3VYT B;  2VJ4 A;  2HOE A;  2VT3 A;  1Z3Y A;  4U7B A;  2AXT C;  5FKK A;  1R6R A;  3DTK A;  2W7N A;  3K4K A;  2R7Z J;  1Z0X A;  2DJN A;  1HDD C;  2OF7 A;  3OY9 A;  3NAR A;  2JA8 J;  2R3S A;  1VFC A;  3NAU A;  1XPX A;  2ZCW A;  2VE9 A;  3DBR B;  3F3X A;  3Q0V A;  4BQO A;  2R5Y B;  1VQO I;  1TWH J;  2R7R A;  3Q3S A;  1YE9 A;  3OS1 A;  2BVL A;  2PX9 A;  3CLO A;  1KQ9 A;  3CZ6 A;  4CCN A;  3LAJ A;  2KIM A;  5IP9 J;  2IS6 A;  3BDD A;  1U8R A;  1PVE A;  1WJB A;  3FMQ A;  4UB8 C;  3QYE A;  5LHH A;  5IT9 Z;  1R4N B;  3BT9 A;  2E5Z A;  3AG3 H;  2DA3 A;  2VC1 A;  3E97 A;  1IG7 A;  2YX7 A;  3DU5 A;  5JLX A;  4I76 A;  3IAM 2;  3EUH C;  4RM2 A;  3TKY A;  5B5E C;  2V7F A;  3BQY A;  5CVJ A;  1VI0 A;  5J40 A;  5LLQ A;  1OCC H;  2R5Z B;  2M45 A;  3ZXS A;  1ZK8 A;  4KIT B;  3V4G A;  2A3S A;  5KAI C;  1U0J A;  3HEF A;  1IRG A;  4MEY F;  4AIK A;  4U87 A;  3F9K A;  3H0G J;  2DW4 A;  2QF7 A;  4UV9 A;  2WBM A;  2BZT A;  4NC8 A;  3QU6 A;  1NG7 A;  1XCV A;  3K7A J;  2N8G A;  2G0E A;  5CQG A;  3RIR A;  1MBF A;  5ICC A;  4LK1 F;  4E7L A;  3O3K A;  1T08 B;  2ZKZ A;  4WX9 A;  2XB5 A;  3MQ0 A;  1K4T A;  3FX3 A;  3LA2 A;  3ZRG A;  5GTH C;  4IOC F;  3CLQ A;  4Y52 J;  4J01 A;  4XQF A;  1JHF A;  1UHW A;  5J8C A;  3E1S A;  2KT0 A;  3L00 A;  1JJ6 C;  1YRN B;  3CCY A;  3JSP A;  1KU3 A;  2FBH A;  1WI9 A;  2QEN A;  2A05 A;  2E35 A;  1XSV A;  4RB0 A;  1DP7 P;  2W00 A;  2G9W A;  1Z77 A;  3KYD B;  1S72 I;  2JMW A;  2DDB A;  1J09 A;  2KP6 A;  1MJB A;  1REP C;  2CW8 A;  3GFM A;  3OYB A;  1SD5 A;  3F8N A;  3HRS A;  3M3Y J;  3V7C A;  4IX7 A;  1IN4 A;  2EB7 A;  2FE3 A;  4XKW A;  1FTT A;  2PBI A;  2HQN A;  1HW1 A;  5D6F A;  1VQL I;  1ACI A;  3U1K A;  3I56 I;  1F1Z A;  4HRI A;  1QA6 A;  3PSF A;  2IA0 A;  3ZMU A;  2ZME A;  1HKQ A;  5ICF A;  2P6T A;  4RA2 A;  5JFR A;  3ABK H;  3BR5 A;  4FE4 A;  5K1Y A;  1GV2 A; 
#chains in the Genus database with same CATH homology
 1YHQ I;  1YIT I;  5GAE J;  1VQK I;  3CCV I;  5JVG F;  3CC7 I;  3CJS B;  2OTL I;  2FOW A;  3DLL F;  5GAD J;  3CC2 I;  3CCJ I;  1VQO I;  3CD6 I;  5DM6 F;  2OTJ I;  1FOX A;  1YI2 I;  1YJ9 I;  2ZJP F;  1WIB A;  3CJT B;  4IO9 F;  1Y39 A;  1VQP I;  3CCM I;  1VQ7 I;  5GAH J;  1VQM I;  3J7Z I;  1VQ6 I;  4IOA F;  1YJN I;  2JQ7 A;  1HC8 A;  2QA4 I;  4UY8 I;  5GAG J;  2QEX I;  2H8W A;  3CCE I;  1MMS A;  3CCQ I;  3I55 I;  3PIP F;  2ZJR F;  3CCS I;  3CCL I;  1YIJ I;  4IOC F;  2E34 A;  3CJR B;  2K3F A;  1VQ8 I;  3G71 I;  3G6E I;  1VQ4 I;  3J7Y J;  2E35 A;  1VQN I;  1S72 I;  1FOW A;  2NXN B;  4V19 K;  3G4S I;  1YJW I;  3CME I;  3CC4 I;  3CF5 F;  1VQL I;  1ACI A;  3I56 I;  3EGV B;  3CCR I;  1QA6 A;  3CCU I;  3CJQ B;  2E36 A;  3CMA I;  1FOY A;  1VQ5 I;  3PIO F;  2ZJQ F;  1VQ9 I;  5DM7 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...