2ZJQF

Interaction of l7 with l11 induced by microccocin binding to the deinococcus radiodurans 50s subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
144
structure length
144
Chain Sequence
MKKVAGIVKLQLPAGKATPAPPVGPALGQYGANIMEFTKAFNAQTADKGDAIIPVEITIYADRSFTFITKTPPMSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribosomal 23S RNA
publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2zjqF02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 2zjqF01
1VQOI 1HC8A 5GAHJ 5GADJ 1S72I 3CMAI 3CCVI 2E36A 2ZJQF 1FOYA 4UY8I 5GAEJ 1VQLI 2JQ7A 1WIBA 3CCMI 3CC2I 3DLLF 3CCEI 1YJNI 4V19K 3CCRI 3CMEI 1VQ8I 2ZJRF 3CC7I 1VQ5I 3CJRB 2OTLI 3I56I 1ACIA 3CC4I 1VQMI 3CD6I 3CCQI 3J7YJ 3G6EI 1YHQI 3CCJI 3PIPF 3G4SI 3PIOF 4IOAF 1YITI 1VQNI 5GAGJ 3CJTB 1VQKI 1VQ4I 2H8WA 3CF5F 1QA6A 2NXNB 2FOWA 1VQPI 1FOXA 3I55I 2ZJPF 1MMSA 2QEXI 5JVGF 3EGVB 1VQ6I 2E34A 3CCLI 4IO9F 1Y39A 1VQ7I 1VQ9I 1YJWI 3CJSB 2E35A 1YJ9I 3CJQB 2QA4I 1FOWA 3CCUI 1YI2I 4IOCF 2K3FA 3CCSI 3G71I 5DM7F 3J7ZI 1YIJI 5DM6F 2OTJI
chains in the Genus database with same CATH superfamily
4ENJA 4OU0A 1ODDA 3QQAA 1POGA 2V4JC 1MMAA 3HOXJ 5KHDA 3TOAA 2HS5A 3VDXA 2IS2A 2H6CA 1W5CC 1V5EA 1BI1A 3PQKA 3HYIA 3MMYB 1WGXA 1T56A 3ZMDA 3QOPA 5E20A 4DJAA 1B8IA 3WE3A 4C2UA 3C3WA 4BS9A 1XGNA 3HUGB 1D5VA 1OMIA 3SJMA 3DWLE 1XG1A 3U1DA 1OCPA 4FISA 1ZK8A 3FXJA 4UB8C 5LRRA 3E0JB 5JVTA 3M8JA 4UUSA 1MBFA 2F4MB 1JTXA 5EGOB 4L5IA 1V4RA 5E79C 2X6XA 2GAUA 1WPKA 2LY9A 3KP4A 4MEXF 2BEOA 2LKSA 4LG0B 3LSHA 2V6CA 4LLNA 3HOTA 1UMQA 3WU2C 3KP3A 4XRMA 5E1ZB 2K9NA 1DGRM 1YYVA 2YR2A 2OZUA 2DA3A 3K4MA 3HSFA 2O5RA 3K2ZA 3OL4A 3OSFA 2K40A 2NVYJ 2UXNA 2XVCA 4XKBA 2FSWA 3HOVJ 1MBHA 2WTEA 2VBXA 1TWAJ 1U3EM 3ZMSA 4M3EA 2OCCH 2MABA 2AXTC 2LG4A 3HKZN 2LD5A 4HSTA 4ENNA 5D5WB 4G8XA 2PJRA 2H8WA 4XN0A 2UV1A 4XLCA 4II3A 3F72A 2MGQA 2XAGA 2L4MA 2W57A 2B0LA 5FLMJ 1EH7A 3OYDA 5D5XB 2C6YA 1SD4A 2G7HA 2XGDA 2GQQA 2QSFX 3S2DJ 1JT0A 1IJWC 3OYNA 2VT3A 2CQQA 4BYYA 2IP2A 1WFXA 2A5WA 2KMUA 3WHCA 4A5MA 5LEJA 4ZZLA 2FRHA 1G3TA 3QRFF 2EWNA 1IUFA 1I6HJ 2ELHA 1TQPA 1B9NA 1YRNA 2R5YA 1BW5A 3PFIA 1MNEA 5D6FA 2M87A 3A4CA 1YJ9I 2FA5A 1QU3A 3MKZA 2BYVE 4XM3A 4H4KC 4L9TA 3BTJA 1RPWA 2QLZA 2JSPA 3TMOA 4B8XA 1OISA 1ZKGA 5L3GA 4AIJA 4GDFA 1DGWY 2BVMA 2HKOA 5BQTA 3JRBA 2WV0A 2O6GE 3GEZA 5JI6A 2NS0A 2OBPA 2VT2A 1SAXA 3SDBA 3A03A 5CVIA 2QM3A 1FOYA 1S8NA 2OA4A 5KVRA 1J9IA 2VC0A 1I5ZA 2FF4A 4PGHA 2P6SA 3MAJA 1XGMA 1R36A 1R5GA 4ZYDA 4G7HF 2VPRA 1MJAA 2X1DA 3O2PE 2XKPA 2VKDA 4OOIA 3IKTA 1TTYA 4KMFA 3CMEI 2XASA 5BMZA 2ZB9A 3Q5FA 1PUEE 4O5VA 1OYIA 5ILUA 4ZH4F 1OKRA 4HW0A 2QQ9A 2Y0SA 4A3JJ 1ZG5A 1EH6A 2CW0F 4YFXF 2BE5F 3K0LA 2JA8J 4XLEA 1IN4A 4KA4A 3K70C 3RJPA 3JSPA 2CRGA 3K2AA 2LLKA 1Y6IA 3IWFA 5IOYA 2DFIA 2EILH 3GZ6A 2IGKA 2FXAA 1JKQC 3SEZA 5C4JJ 5FKOA 1OPCA 4MO7A 1YHQI 3PIPF 2L02A 5TGTA 1RUNA 4LIVA 3ERED 2OQGA 3DTKA 2KLOA 3O8GA 4L9NA 3TP3A 4WF2A 3HRTA 3PIOF 3JRAA 1HDDC 2ME0A 2Z5UA 1VQKI 1G3SA 3K1NA 3LL7A 2LKXA 4BXXJ 1U9OA 3DKWA 3T5XA 5DS9A 2W84A 2MD5A 2QYOA 2NS8A 5JHFA 5J8CA 1JKPC 1DU0A 2M1BA 1A35A 2P6TA 4A5NA 1U5TB 3KEOA 2ZMEB 4N4NB 3JAMK 3ZN1A 1R00A 1X4PA 2M9HA 1FSHA 3DU6A 4F93B 4BJTA 2YU3A 2H1KA 1QZZA 3IHUA 1L3LA 1FBQA 5F64A 4IQ4A 3JRGA 2JA6J 3E6BA 1X3UA 3TW6A 2F5CA 3LSGA 1FJLA 1X3WB 2WY7Q 4M6YA 3HC7A 3TW7A 1P4XA 2L7KA 2STWA 3FXQA 5EEAA 3VYUB 5J6XA 2LVSA 5F1JA 2DODA 1MH3A 3F8FA 3LA7A 1E3PA 2LK2A 4RM3A 4XL9A 3LSKA 4LLGF 4M9SA 5M5XJ 3H0GJ 1WSUA 3VFZA 5DD4A 2DFEA 1YOVB 2XAHA 3GW2A 2A69F 2XAQA 3F0CA 1GDTA 1YX5A 4OAYA 1MBGA 2IW5A 4Y4RA 3SZPA 2KQRA 2P0WA 4M9XA 3H35A 2DJNA 3BP8A 5DDGA 3IRQA 1WJ5A 1KQ8A 4KDPA 2DT6A 1VNDA 4B43A 1Y56A 2R7OA 3BG3A 4EGZA 4B47A 4ZDPA 5A2QK 3ZQCA 2NNNA 3PO3J 2IS1A 2HYGD 3WE2A 3CJRB 2GWRA 2RV8A 3KLOA 4UUTA 2M5WA 3RQ4A 2QF7A 2EV6A 4XN3A 4OINF 2PLYA 1YW7A 4LOCA 4RS8A 5M3MJ 4QLCU 2EZIA 3PUBA 1SFEA 3TP0A 3TEDA 4LB6B 3OYJA 1IRFA 3A0HC 3CJNA 2JK3A 5IP6A 2COBA 1U8BA 4YEJA 3GTQJ 3S1QJ 4S0HB 3KYDB 1RI7A 4HEA2 4MFDA 5B5EC 1ZGWA 1TT5B 3WHBA 1DU6A 1MD0A 3A01A 1IG7A 2BBYA 2ZXJA 3S93A 3F21A 2DMTA 2Y2ZA 3GVAA 4U7DA 2M8EA 1RR8C 3NWTA 3FZVA 2DXIA 1OR7A 3A0BC 1E3OC 4AYBA 2KPMA 2VJ5A 3K10A 3K69A 4D7NA 1O3SA 1B9MA 4L9JA 2FOWA 5ED4A 2HQNA 1JHFA 1TBXA 2LFBA 2L0KA 1MDMA 4DZJA 2Y75A 4CYCB 1JJ8C 4Y7NJ 3H5RA 5D5UB 1N75A 5ICFA 2AHQA 1AOYA 5D5VB 4E7HA 4M3DA 2K02A 2YX7A 4E4HA 1VQ7I 1FMVA 2VE8A 2V26A 3GTOJ 1I1SA 2HQAA 3F8MA 4Q48A 2IEKA 2ECBA 5LHHA 1ETKA 2E35A 1JUPA 1KGSA 2K9SA 4P55A 2X0LA 2RGVA 1U5TC 2ZMEC 4EEFG 2KL4A 1ZREA 5D4SA 1YS7A 4NUBA 4IXAA 4KISA 3ZQIA 2PN6A 2I10A 1B8IB 5K7HA 5C3EJ 3GFIA 1QBJA 5LEKA 2L54A 5IP7J 2PFBA 2HDWA 1JUMA 4BY7J 3KETA 2GA2A 4UUVA 4A93J 1R1TA 5HS7A 2KKOA 5HDKA 3JRDA 1ZHFA 1X1DA 2HTSA 2ZXHA 4S05A 2M7BA 4IKFA 4RB2C 3IH4A 4A6EA 2HXOA 5EZGA 2JTVA 4KUMA 2OJED 3GYHX 1BIBA 3MZ8A 4KICA 1OQYA 4BU2A 2G0EA 4MTEA 2ME6A 4A3LJ 1VQ5I 2P4WA 1VI0A 2A61A 2Z33A 3W6KB 4D7MA 3DEWA 1U9NA 1T6SA 1W7PB 2OPTA 4Z2YA 2JA7J 3F6OA 2OZ6A 4IF4A 3OYAA 2VKHA 1J59A 4HX8A 2OTLI 1PJRA 5CVVA 4ITVA 2KIFA 3O8HA 3CMYA 3G1OA 3H5NA 5E18F 1TC3C 2DW4A 1TNTA 4JYKA 2PJRB 1T8IA 2KZVA 3E6MA 2XAUA 3EUAA 1CQTA 2YU9J 2PQ8A 1WCMJ 1K7AA 4BEHA 1D0ZA 4C3IJ 1O7FA 1EH8A 2CMPA 4A0YA 3OSGA 5BOXA 3C2GA 4Y15A 5E8IA 3FM3A 3DBRB 1X1CA 3MN2A 3DP7A 2EQRA 3GZNB 3V42A 4HAMA 4CCLA 3VOEA 2B9SA 3B6AA 2JA5J 4QWQA 2PI0A 1TWHJ 2BW3A 2F5DA 5L3DA 2LOOA 3V8JA 2EB7A 5IYBJ 2FNAA 3V4GA 1YRNB 1N78A 3AG1H 3CQZJ 3ECOA 3DPUA 4BHCA 3E1SA 1AKHA 4PJNA 1GXPA 3BG9A 5L3CA 3CCLI 3KP6A 3LOCA 1MIJA 3CMMA 4FX0A 4AIDA 1FYLA 4A3FJ 4A3KJ 1Y0NA 1ITYA 1ZR2A 2X85A 5DUIA 5H2FC 4FT8A 1W5SA 3LSRA 2UZKA 1Y39A 2P5VA 2XKOA 2IS4A 1Z05A 3BQYA 3JRHA 2UXXA 2H1LA 3D5RC 1HW2A 4UVBA 3ASOH 2NS7A 1TT0A 4G6TB 2ICWG 5HLGA 3GTKJ 3CLOA 2ESNA 3PM1A 5IY5H 2I5UA 4I09A 3TGNA 2CO5A 1BOAA 3E6CC 2OV7A 4X6AJ 2WWYA 2OTJI 1LNWA 2VC1A 2JJ7A 3BG5A 2CH0A 1LUJB 2FBHA 4II2A 3SYTA 1F5TA 5M5WJ 1D3YA 3CDLA 3O6BB 5DCFA 1WIBA 4UXNA 4IHWA 4A3DJ 5K7FA 5LGUA 3WTZA 1GUUA 4BY1J 1O3TA 2KT0A 3BR3A 3I58A 4M71A 4ZDLA 2X6OA 3HBLA 5IT3A 3GTMJ 3TDZC 1DPUA 1W0TA 2VUMJ 4PJ0C 3R6SA 4I2OA 1PDNC 1QVUA 3QODA 1F4KA 3M7GA 4WXDA 2JA2A 3C2BA 4KT6A 2WB1N 3EDPA 4EMSA 3ZR8X 2JRMA 1ZGJA 2RN7A 1IZ1A 2F5FA 2LRDA 3BPXA 3FIWA 1UAAA 1KA8A 1XB4A 5TISC 4P9UA 3BQZA 2KRFA 3NWSA 3GTGJ 1WZ2A 3F8CA 3V7CA 5FRMA 4C30A 5L3FA 2M3AA 1VQMI 4EM0B 4R79A 1RZ4A 2X51A 2DK8A 2MLGA 3IWZA 1H88C 3WTSC 1KU3A 3ZQQA 1TQIA 4BUPA 1NG6A 3P9KA 3ROUA 3DU5A 2QKMB 5DEQA 1OCRH 2CGPA 1E3HA 4YG2F 3TKYA 3I71A 1P7IA 2D1HA 2LYCA 1D1CA 1Q1HA 2KDOA 3ESWB 1S7EA 5GAGJ 2Q0OA 3LA2A 3L00A 1T2KA 1QPMA 2Y30A 3R4KA 2DAOA 1R4MB 1FIAA 1JT6A 3S3OA 3AG3H 2EBIA 2DQLA 1O3RA 2HVSA 2MLKA 3KYCB 5HNFA 2WAQA 3IAM2 3D5SC 1QZYA 2BHYA 3DCFA 2IS6A 1ZAOA 5E3LA 4BDYA 2HI3A 4Y52J 2OUMA 3EYYA 1JKOC 1S5LC 2WY8Q 1IN5A 1Y1WJ 3J80Z 1YTYA 4YIRX 4XRSA 3I64A 3EYIA 3OV8A 4F52A 4FTHA 3BZCA 2MBFA 2KRHA 2PBIA 2QZ8A 2EZLA 3UKGA 1YI2I 1B59A 4A69C 3SXYA 1AU7A 4R1HA 4NHJA 2OF7A 3C18A 2FMLA 1ZG1A 4CCMA 3WTWC 3RQIA 3G3ZA 1WWXA 5KCMA 3F3XA 3LNQA 1R6RA 5KAIC 1K4TA 3HOWJ 5JLXA 4B3XA 1GVDA 3Q9VA 4W1UA 2FBKA 4BXUA 1SVOA 1J2XA 4HLXA 1Z6TA 2HQRA 4NQWA 3J7AO 2DYRH 3ABTA 5HS9A 3H3UA 3K4CA 1ETQA 2KP6A 2ISZA 3RKQA 3H9QA 1A04A 4ESBA 5EDNA 4L18B 1FSEA 2D45A 6PAXA 2P7VB 2R7VA 3JTHA 3DPTA 2K27A 3JSOA 2VQCA 4E7KA 2CFXA 4K2EA 4BJ5C 1SFOJ 1LKXA 1IUYA 5K5OA 3QYBA 2DA4A 1LQ1A 5D6EA 2VL8A 4EGYA 3GLLA 1Z6RA 2FQ3A 2DT7B 2VQLA 4HDUA 3QOEA 1XMXA 2CV1A 2OCEA 1U78A 2HDCA 1J75A 1N77A 4OIOF 2OAZA 1TW2A 2ZKZA 3KP2A 3CO6C 3A01B 1T0FC 3OWTA 4ENKA 4A3GJ 2ZXWH 1VF9A 2E7XA 4HV5A 4UV8A 4OIRF 4KIGA 2XSJC 1TLHB 2F48A 3HHGA 1RESA 3W3CA 1BM9A 4EJVA 2MD0A 2RDPA 1FEXA 5LHIA 2R7SA 1R4NB 3LSIA 1XCVA 1ON1A 1MDMB 2H94A 2RKHA 2MC4A 2M34A 3EPZA 4XORA 3SEQA 1LE8A 1VQNI 2B63J 2E5NA 4BBRJ 5JFRA 2Y48A 3PO2J 2PX9A 1AA7A 1F36A 2TRTA 1OYWA 2EV5A 2A07F 3ZQGA 2H6BA 4QSHA 2UUZA 3FWEA 3S1RJ 3GZ5A 2VOPA 1VQPI 3FBIB 2HVQA 1N25A 3D1NI 4Q5SF 1MBKA 4KJZA 1EF4A 1J5YA 1HLVA 2F4IA 3S3NA 1XCBA 1FWZA 2B7EA 2F5VA 4I98B 1HOMA 5ILSA 2ZC2A 3DBHB 1O3QA 3IP4B 1X58A 2DMPA 1VFCA 3S17J 1FX7A 4UVAA 4XONA 3L1PA 2XF6A 2R7QA 3H9JA 4OMZA 2FBIA 2MYSA 1WKMA 1XGOA 2ADUA 1KU2A 2QUFA 3VYSB 3OYCA 1JHHA 2DPUA 3HOSA 4BACA 4D9JA 1LVAA 4DZPA 2NAZA 2VBYA 2HR3A 2BXYA 4O6JA 3VEPA 2JZYA 3FF5A 3LSTA 2JVGA 1BN5A 1SFXA 4Q47A 2X1CA 5D8LB 4A3CJ 4NC7A 3GXOA 3BC8A 1X4OA 4XLNF 4IEJA 1QZEA 2IT0A 2O8KA 3K4JA 4RLFA 2YX4A 2DA7A 2Z3YA 3EUHA 4L5EA 4AC0A 1TQMA 1XGSA 2XHKA 2QKLB 2V9PA 1IRXA 3L2UA 5FD6A 4JX6A 4M3FA 5FB2A 3J81Z 1VQLI 2JQ7A 3I0TA 1IRGA 2L4AA 2LBFB 4S04A 3RKYA 3TO6A 3PUFA 1YJNI 1Z3XA 2X6YA 1IRZA 3CCRI 2K9LA 5F08A 2XRNA 3H5AA 2ZJRF 1RR7A 2PMUA 4KN4X 5J3LA 2EV0A 4Z6YA 4DBQA 4KT5C 2X48A 1MJBA 1FNNA 5CQGA 4C2MJ 3CZ6A 1BJAA 5E1WA 1YG2A 1BI0A 2GIZA 5F04A 2IA2A 2Y9YA 2IAIA 3JRCA 4BE0A 3IAS2 1WRJA 1SFKA 3WTYC 4BEHB 2M0CA 5FKLA 1HW1A 2HZDA 3GF2A 4KNYA 1FLIA 3QU3A 1O4XA 2P5KA 2ID6A 4G6QA 4NNJA 3S2HJ 4XICA 3DPLC 1DP3A 1U8RA 1NHAA 1IXCA 4BAYA 2CQXA 1FC3A 3GMEA 4PSXA 1ZLKA 2BW3B 2VQHA 4UHTA 4ZYGA 3KE2A 1BR4A 2W48A 2Z1DA 4B4CA 1I50J 1USSA 2AQEA 3CJTB 5E1XA 2DFHA 2OC6A 3WGHA 4YFNF 3ZP5A 3BR0A 2O3FA 3CLQA 3W6JB 4DW6A 1AKHB 3FHZA 3GWZA 1ORKA 1HQCA 3PNTA 4N0BA 4HZFA 1O7LA 4CCKA 4UV9A 2BXZA 2DTZA 2R5ZA 2ZJPF 1B1BA 2DFFA 4C3HJ 1D8JA 2OQRA 2R92J 3L09A 4R8HA 4JBAA 2E34A 2DU9A 3V8KA 5TRDA 1H8AC 5F6FA 3GTPJ 1MMNA 2M45A 4FASD 1FPQA 1WJCA 1SC7A 2DK5A 1GT0C 1PP8F 1YE9A 4LD5A 2F5EA 2AXLA 5LRSA 2XAFA 3OYEA 4NB5A 4F3QA 3I54A 5HLHA 2ZNYA 2P8TA 2LC2A 2VOOA 5E17F 2CQ7A 5FLXZ 3J7ZI 2ACJA 1MGTA 5DM6F 1XMKA 2HNHA 2WAFA 1XDSA 4AVZA 3S32A 5IPAA 1FTTA 5CVUA 2K5CA 3LFKA 3FXLA 1T08B 2K9MA 2DMQA 3L9FA 4V2GA 4JOMA 3CCVI 2Y0MA 1Z77A 3L7WA 3CDIA 1IO2A 3JRFA 2E36A 2RAEA 1XSXA 4A0ZA 1LEAA 2DOEA 2DDBA 3DKYA 1I39A 1QVTA 4M73A 4ETSA 1I6XA 4MQVA 5K5QA 2EZKA 1A6QA 4ASNA 1BR1A 1UG0A 1XN7A 4GYGA 1A31A 1KYZA 2M4GA 2QCOA 1CGPA 3H3ZA 3HXLA 1RETA 2L3DA 4RMNA 1T38A 1XSVA 4EV0A 1B4AA 2W25A 3KLNA 2O7OA 1S6LA 3WTUC 2GLOA 2FX0A 3FDYA 5FFZA 1TL8A 1T39A 1RNLA 2FE3A 2Z2SB 1S7OA 4C9YA 3ZRGA 3RZDJ 1B72A 4IL6C 5DUKA 2BY3A 2DJIA 2Q2EA 1YS6A 1VTNC 3T0YA 1H89C 2R7XA 3Q9SA 4D5CA 1SFUA 3HKZA 3RKWA 2BHZA 2FMYA 3BJAA 1HCRA 2E60A 2F4OB 2K86A 3O3KA 5FO5A 2DLLA 4BE1A 1K83J 2ZSIB 2LDUA 5B3SH 3DEEA 4ABZA 2CW8A 1UG2A 3OS0A 4LG3A 1HKSA 4P96A 3K1MA 3S14J 4XLPF 1WI9A 3FHNA 1V5GA 3BR6A 1Z7LA 2X4HA 2HU9A 3ZXSA 1LDDA 1RKTA 2M4KA 2HQ5A 4GCVA 1LDKB 2M0MA 4RAZA 5BS6A 3K4NA 2A6EF 3ABMH 2O8XA 3J7AY 5HS8A 3RDIA 4YIFA 4CGZA 3ZN0A 3ONQA 1TWFJ 3P7NA 4EJWA 1TWGJ 2W4SA 1P4WA 2O61A 2A6TA 2GA1A 3FXOA 4AU7A 4M6VA 3G2BA 1ZRCA 2LNBA 3CDHA 4BE2A 1R1VA 2L7MP 2XDVA 3HRUA 4M9ZA 4RB0A 3MFKA 2R7RA 3AL0B 1W5TA 3L2VA 2BZTA 4F91B 2LF7A 2FU4A 4DOZA 5GPAA 1X2MA 5GTIC 3V7SA 4NQWB 1DQUA 5DCMA 4E7LA 4LFUA 1YQAA 3G1LA 3FBNB 1Z9CA 1D1BA 4CUGA 2X1EA 4CHUA 4N9IA 3BG7A 1Q1VA 3SHFA 3OYFA 2NOJB 4J00A 5BPIA 2VXDA 2L01A 4PSWA 3HUGA 3S2WA 3GUDA 3HIFA 3CMAI 2DN0A 2D2WA 3A1YA 4U88A 4XKVA 4OWRB 3J80K 1C0WA 3GFLA 3MCZA 2IRFG 4IHTA 3CTAA 5GPCA 2HOAA 3K4BA 2OD5A 1S29A 4CSWA 1XSDA 3M3YJ 3NAUA 2K4JA 1Z91A 3KZIC 2KHMA 2XGCA 4AM3A 1DPRA 4AIHA 4TV7A 4J19A 4IQJA 3MKYB 4FE4A 3CC7I 4HF2A 4B44A 2V9VA 2DMUA 2XGXA 3P9CA 5F27A 3TOBA 1SAUA 4I6ZA 3JCUC 2L9NA 3M1CA 1R49A 3BR5A 2GOMA 3R61A 3BT9A 4XSZF 3BTCA 1MKMA 1UZCA 1YO5C 2NVQJ 5CKTA 5LD2C 5ILVA 4UUSB 2MC3A 2E1MB 3CESA 4WXHA 3ULQB 2HOTA 1LE8B 1D5YA 5EYRA 1UELB 2XC7A 3RYRA 4HOBA 2VIXA 4BQOA 4JX5A 4PDKA 2E2JJ 3WG9A 5KAFC 3I59A 2RVCA 3R0JA 4XIDA 1ZGAA 5M3FJ 3AFHA 3ABUA 1D0YA 2JN6A 4RAGA 2XRLA 5J4YA 5K1YA 2N8GA 3PNYA 1K78A 1U6GA 2V1XA 2E1NA 5F0CA 4HQEA 2V1UA 3FMSA 1K79A 1BR2A 4RA2A 3GTLJ 2XPVA 2XB0X 4RGUA 4Y17A 1EV7A 4HDVA 2M7AA 1RIOH 4UNOA 4LK1F 2KZGA 4ON0A 2HYJA 2QVOA 3MZYA 3DKXA 3W6VA 3BPVA 2DYSH 1DP7P 1FYKA 2WAEA 4I7HA 3RPQA 1B6AA 5FKNA 3DF8A 2WBMA 1A36A 1IF1A 1UHSA 1L0OC 2BOLA 3IUOA 1H9TA 1P6RA 1W0UA 1MBEA 2X9DA 2R5YB 3FKIJ 3BTIA 1ZYRF 2XUBA 2DA1A 1BI3A 1KONA 1Y1VJ 2W00A 2QQBA 3FXUA 5K7ZA 5D8KB 2G9WA 1BI2A 4LGWA 2QBYA 3AL0C 3I4MJ 3KIOA 1V5FA 1ZR4A 5LBQA 1V55H 3QPLA 4IPAA 3HRMA 4U0WA 2RREA 4DYCA 1JJ6C 2R3SA 1FTZA 1NTCA 4CYDA 2FNPA 3SDGA 4D1QA 3TO9A 5L3BA 1YIOA 1OFCX 3RI4A 4HSRA 3GFMA 1VQ8I 5JR3A 3C1DA 1WJAA 1NH3A 2F2EA 4EJTA 2EFNA 4RB1A 3KP7A 3S1MJ 2O9LA 4IHSA 2QSGX 4E70A 4ZC3A 5E3MA 1DDNA 5E3NA 1SMYF 2KIUA 4EM1A 5J4VA 2MH2A 1BOBA 2P81A 2Y69H 1OCTC 4HX4A 5FRNA 2MSYA 4EATA 3M8FA 1GXQA 1ZRFA 3N97A 4WCGA 3QPHA 2V9KA 3Q0WA 3HOUJ 4OIQF 3FK7A 3GBGA 4DQ2A 4KFCA 2G7UA 2W85A 1G2HA 1I3AA 3FK6A 3KCCA 3MEXA 3QAHA 4CCNA 1APLC 2IVMA 4HV6A 2LTPA 2R5ZB 3ZQFA 3SFIA 3OR2C 4XNFA 3VSLA 1KU9A 1LPQA 1T98A 2YSRA 4XMYA 3ECHA 3EQLF 2PEXA 3I53A 4BH9A 3CF5F 4DBRA 2E1MC 4IRIA 1J09A 1XMAA 2J5OA 4G9YA 3UR3C 5HLIA 4XSXF 5A2QZ 2AO9A 1FZPB 4N9HA 3FKJA 2KFDA 3OYLA 2GXGA 1KU7A 1JKRC 2XROA 1BIAA 1OLTA 3KEQA 3B02A 1T33A 4XBFA 2DOAA 4LIUA 2R4GA 2K85A 3Q0UA 3U1KA 4D0PA 2A6HF 3PJRA 4BL0B 4E7SA 1VQ9I 1HBXG 5F0FA 3RKXA 4PK4A 2KISA 4JX4A 2LY1A 2LY2A 3NQOA 4EJUA 1MNMC 5M5YJ 2DA5A 1Z3YA 5HOOA 3CJSB 3K9TA 1XC5A 3PNVA 3WU1B 1OCCH 2P7CB 4MGRA 2JPBA 3QU6A 3OOUA 4N4OB 4RGRA 3OIOA 5CLSA 2K9QA 4P5OA 3NRVA 1ONVA 4ZTJA 3RTRA 3VYTB 2NRAC 1HC8A 2RNJA 4DIQA 2AS5F 1MSEC 1UHMA 4XLAA 1S72I 4RBOA 1IV8A 1HXDA 2XV4S 3TDUC 4AWXB 2L2OA 1BW6A 3MVPA 2HZTA 3GO5A 5FKMA 4HNUA 2VPLA 5AIPA 3HG9A 2BY1A 4I02A 4AVPA 3I4NJ 3BJ6A 3CCMI 1LDJA 1T95A 4DNCA 2DA2A 1GV5A 4BKXA 4XLHA 4OIPF 1MBJA 3CUQA 3FXRA 2R7DA 2E7WA 3BROA 3ZMZA 1TP4A 3S8PA 1TZLA 3R0AA 4Y3OA 3M07A 4MFEA 4QIWN 4KYWA 1B72B 3W2AA 1K4SA 1R22A 4A0XA 2CUFA 2HFHA 1KZHA 4IX7A 3MZHA 1TW3A 5EG0A 5EF6A 1RUOA 3RSNA 2FD5A 3A02A 1JXSA 1PVEA 4ESJA 3I4PA 5FLXK 1IGNA 2VJJA 5J40A 2Q8KA 1EJ9A 5AONA 1ULYA 4ZYEA 4F92B 1J0RA 2DO7A 4XR6A 2KRCA 1G59A 4L5JA 3G1MA 5E3OA 3MKWB 2Y0SN 1Z67A 5LFAA 1RC9A 5IOZA 1D1AA 2GM4A 4MTDA 1QHHD 3G4SI 4LK0F 2WA0A 4I01A 3OOPA 2XSDC 3REOA 1U2WA 4U0VA 2JUCA 4CYCA 1YITI 1SMTA 1IDYA 1EKEA 1QQIA 3HL2A 3I3LA 2EFWA 1MZBA 5GTHC 1KQ0A 2ELKA 3K70D 2K3PA 1R9TJ 2PMZN 3HOYJ 1HKQA 1NG7A 4E7ZA 2CJJA 2K7LA 2DQRA 1I3QJ 4F55A 2M30A 2XF7A 4YFKF 5E8GA 2GOXB 1SVMA 3GX4X 2EJRA 4MIMA 2VI6A 3CP2A 4FHTA 3ZMUA 2VXZA 3FISA 3BZ6A 1QGPA 3E6DA 4BQAA 4O3MA 3NARA 5DCMB 5C4XJ 4JP0A 3AAFA 2H09A 3BZKA 4IO9F 1M1EB 3BG6A 1A6IA 4G94A 2RNGA 4HF1A 2ZFWA 1G8XA 2CQNA 2ZJ2A 2A05A 4JQFA 2YUSA 3BLYA 3RZOJ 5HDGA 4A6DA 3CCUI 2V79A 4LB5A 1JUSA 2L9SA 2DCEA 1JGGA 1YFHA 1FBSA 1SD5A 4WXCA 4CZZA 4G7ZF 3OS1A 1YIJI 4LITA 5HDNA 3HSEA 4I76A 1KQ9A 4MQ9F 2ECCA 4YRVA 1NK3P 4B09A 3QWLA 2CSOA 3IRRA 1H0MA 1K6OA 1CF7A 2CUJA 3T8TA 5BPDA 2WB1A 3KPHA 4UB6C 3E7LA 4PJLA 1RKWA 2GXBA 2HXIA 2ISYA 2VASA 2HVRA 1W7PA 4CCOA 1Z1DA 1XX5A 2PMHA 4ZYAA 3FXKA 2EIKH 1Z0XA 2H8RA 3FMRA 1FP1D 3LAJA 4M72A 3S15J 1Z7UA 3KYLA 4BNCA 4Y33A 5CJ9A 3M9AA 1VZ0A 4HRIA 3I59B 1R5ID 2E1OA 4HNTA 1GVJA 2J5PA 3IH3A 4HQMA 2M2EA 2QQ8A 3W2WA 4B1RA 2DT5A 3BJOA 3LSPA 3CD6I 2ZCWA 2KJCA 1S3JA 3SZTA 3BCAA 3G6EI 1LFPA 3CCJI 1K78B 2JWTA 1K61A 3F9KA 2MW8A 4CCJA 2IA1A 4QPQA 3VSKA 2IGNA 4FCYA 1G3YA 3HTUA 2E19A 1QRYA 5HVQC 3C2HA 1ZG3A 3S16J 3E5XA 2EINH 1QA6A 3H36A 5IT9Z 2IJLA 1J7KA 2JVHA 2NXNB 5H20A 3DV8A 2QQAA 1S7AA 2BY2A 3K4KA 3S3MA 2E1CA 2HGCA 2QEXI 1SD7A 2A5YB 5H6RA 4ESFA 3SFZA 3WODF 2VONA 1HSTA 2WADA 4AYBN 4WK8F 3Q0VA 2VKVA 1X3ZB 3UNGC 4G6DA 4BHPA 5ERIA 3ZOBA 2CV2A 4F7ZA 3GCMA 2CS3A 4PCQA 4ENMA 2DTRA 3OMYA 2GZWA 3HGGA 4FE7A 4L0YB 3DTEA 1XD7A 3JRIA 2LP0A 1PUFA 4PZJA 5CVJA 3FX3A 1OR7C 4BHBA 4L9VA 1IN6A 1ZN2A 3IL2A 4IJAA 4ZYHA 1HDPA 2QBYB 3TQNA 4RB3C 4EVIA 2EH3A 5DM7F 4ZDOA 3WU0A 1DUXC 4U87A 1ZELA 2W82A 3BDDA 2I8DA 2WC2A 1REPC 4MHGA 1IAWA 5CVRA 3MQ0A 5EJCA 1HSJA 2GIVA 1T0FA 5TJJA 4LLLA 4PFOA 3OL3A 1Z21A 3H9GA 1ERDA 2ZJQF 1QPIA 1ETOA 2VBZA 3V8LA 1X2NA 2MG4A 3X2QH 3VPRA 2YS9A 5K5RA 4IVNA 3CCEI 4J01A 4Q4ZF 2EFOA 2DMNA 3HPHA 4MNUA 1IDZA 3RPUA 3QP5A 1UFMA 2EZHA 4NDLA 4E7IA 4XK4A 4CA0A 2PMZA 5LHGA 1YW9A 2CW7A 2JRTA 3LMMA 5J1YA 1USTA 1FIPA 1MMGA 1MJ9A 4A3BJ 3E97A 3AG2H 3LQRA 4EM2A 3E5UA 3KZZA 2Z99A 3I5UA 2LKPA 3ABKH 2MFZA 1G4DA 3RCOA 3HTSB 1KYWA 1WVRA 2XGEA 1WJDA 4RAYA 3DQVC 2VJ4A 4CO8A 3F8BA 5HLTA 3IC7A 4ZTFA 3TO7A 3L2QA 2MA3A 1NK2P 5H6QA 1R1UA 2E71A 3HSRA 4UVCA 5CYVA 4FX4A 1R58A 4ANJA 4AUXA 2E2IJ 3E3VA 2A3SA 2R7FA 1YLFA 2Z9OA 2CYYA 1JGSA 1WJBA 2ID3A 1RRJA 2CUZA 4XOPA 4QPOA 2HTJA 3HHHA 3WG7H 2VJIA 3IKVA 1A5JA 3GFJA 3K6GA 1MW7A 4L0ZB 3F8NA 5AIQA 2H27A 2EK5A 2WV1A 2KIMA 2IA0A 1R7JA 2VLAA 1VQ6I 4RDUA 4GFBA 3PSFA 2CG4A 1YX3A 3Q3SA 3ZQ7A 4A3IJ 4XRFA 3BR2A 2JPCA 5DD8A 3ELKA 4I0BA 1FP2A 3OYKA 3K7AJ 1EA3A 1LB2A 2O0YA 3PFYA 2IPQX 2LR8A 3H0DA 3HOZJ 1D0XA 4WX9A 4M74A 3H1CA 1UCRA 3KX2A 2HPMA 2XAJA 3CJQB 1FOWA 2A68F 3P9IA 2ZSHB 1QHGA 2HKXA 2E2HJ 1BC7C 1ETXA 2GXAA 4LMYA 2ETHA 1ON2A 3VYRB 3ZQLA 5J1RA 4C3JJ 2V6EA 1MH4A 3ZGKA 3B6CA 4MLOA 5FROA 2V1NA 5GADJ 1XDUA 3WGIA 3CUQB 2JUGA 4A3MJ 5IYCJ 2HOEA 4XKCA 3JR9A 2D5VA 1YW8A 2R7TA 4RLQA 1SD6A 3PSIA 1W36D 2EIJH 4BQNA 1P92A 2EA2A 3U21A 2CQKA 4PUSA 2DPDA 3CUOA 5EG0B 2ZXIA 4KIBA 2IGMA 4NC8A 5EEHA 4XLFA 2LREA 3QYFA 5F0HA 2HYFA 1FT9A 1IN8A 3FXMA 1XPXA 3AKZA 1QO0D 3HZJA 4A12A 5ICGA 5FGMA 3MD2A 4CICA 2IGOA 4IRHA 5ICEA 1K6YA 3WGGA 1P4AA 4G12A 1WJEA 4ZJZA 4DGWB 4FQGA 1P9QC 3TL4X 1G6NA 2ZBKA 5LLQA 4XOTA 1ACIA 4GGGA 3VB2A 4V2FA 5LGTA 2KIQA 2EIMH 5EGOA 2XPUA 3OYMA 1W1WE 2FQ4A 4PJJA 5HODA 1JTYA 3J7YJ 2EA4A 4LG0A 2NNYA 4YELA 2W24A 3CP8A 4IZZA 2PJPA 1FYMA 5EZHA 2FJ1A 4RGXA 2KDZA 1OCOH 3OYIA 2R93J 4X1EA 1SEUA 1ZQ3P 1F1ZA 4PJMA 5L3EA 2QSHX 2CV0A 1UJ8A 4PGGA 2AQFA 3M8EA 4AIKA 2PG4A 3SZGA 1BBYA 4RAFA 2E5ZA 1VQ4I 4HNVA 1ZTRA 4U0YA 5DTDA 1ZARA 1FOXA 3F23A 5LGNA 1ZLJA 5JVGF 2GBYA 1FMWA 3KEYA 1LVKA 4CDGA 5ICCA 1FOKA 2OU2A 4IRGA 4PFPA 5J47A 3IV5A 2VB6A 2R7ZJ 1TWCJ 1SVLA 1UHWA 4B3AA 4M3BA 1OJLA 5EEGA 3QYEA 3BOQA 3GLXA 3HEFA 2VE9A 3FM5A 2L7FP 5D4RA 3PQJA 3JREA 3WTXC 1W7PD 3LFUA 5IYDJ 2WAQN 5FJ8J 4BJ6C 4NBQA 5FD5A 3N05A 3QPTA 5FKKA 1YJWI 3V7RA 4WWCA 2LMDA 2TDXA 3HM5A 3FMQA 3LSJA 2VODA 1HW5A 2DDAA 2DI3A 3KFWX 3JTGA 1ETYA 4IOCF 3HJEA 4XKWA 2P5LC 3OYHA 4B48A 1LJ9A 3K4LA 3DEUA 2BGCA 4YIIA 1CF7B 5CQEA 2LSOA 2LBFA 1WJFA 1VQOI 3W2VA 3P5JA 1ZH5A 2IXSA 3G73A 3I9V2 2ESHA 2X6WA 2XF5A 3D0SA 5JHUA 1WH5A 5F1RA 2ZNZA 2ZFUA 3OY9A 1PYVA 5KNLA 4HF0A 3ML6A 2CUEA 2W7NA 1TNSA 3H92A 1D8KA 3ISPA 4UY8I 3CF2A 2DBBA 2IBDA 3OIPA 4AD9A 4BBSJ 3EETA 4Y13A 4GYIA 1GLNA 2NVXJ 2L9VA 3ZCOA 1BL0A 4V19K 1OCZH 3ZQHA 1FY7A 1MNDA 1Y8QB 3DBLB 3HB9A 1R71A 2MH9A 4RGSA 3CUQC 3E5QA 4HG2A 5B1AH 3DTIA 1LEBA 2NYXA 2XIGA 2NOGA 2Z16A 1HA8A 4HLYA 2JMWA 3BR1A 1FBUA 1UB9A 4KITB 2VQGA 2ZO4A 3I56I 1JI8A 4HYEA 5DYMA 3OS2A 2L9RA 3JAMZ 1R23A 2QWWA 5B66C 3OR1C 2EPFA 3C7JA 1E17A 5GP9A 4BXFA 2BY0A 2EFQA 4XQFA 2R7WA 3R60A 3SQNA 3S1NJ 4ZZDA 1O57A 3WTVC 2V1DA 4CH7A 2HDDA 4I0AA 1W36C 4CXFA 1ENHA 1IXSB 4A2UA 4H0EA 4DYQA 4X0GA 1IV6A 1F9NA 5FFXA 2FEZA 4EQQA 3M4OJ 2NVTJ 3CCYA 2FUG2 2R7UA 4G7OF 1IXRC 3LA3A 3ABLH 4HA8A 3J81K 1IN7A 4OAZA 3JW4A 4I99C 2DOFA 2EFPA 3MWMA 3L2CA 4NC6A 1ETWA 1PUFB 3RYPA 3BY6A 1WI3A 3RPUD 2XB5A 1IW7F 3ASNH 3GTJJ 4CZCA 4OMYA 5J1UA 1U5TA 2ZMEA 1I1GA 3QP6A 4P1WA 4IHXA 1IC8A 3LQQA 1QNTA 2V7FA 3COAC 4BGDA 1X1PA 1WHUA 1MSFC 2LH9A 2CWEA 1JE8A 2TCTA 1HKTA 3CO7C 2K3FA 5IT9K 3G71I 3T1BA 1HF0A 2VBWA 1BA5A 1F43A 2XPWA 3MKLA 4HX7A 1XS9A 1PP7U 2RQQA 1AWCA 2LF8A 3K1PA 5GAHJ 3L2WA 1S9HA 2Y9ZA 2FOKA 3RIRA 2ELJA 3DLAA 1STZA 4MEYF 3AG4H 1AHDP 2HWVA 5DV5A 1MMDA 1X19A 5GAEJ 2L7ZA 3BWGA 4U7BA 2D1VA 3DXJF 3DLLF 2RC4A 3CC2I 4D5FA 1XTAA 1BJZA 3L2RA 2STTA 1P7JA 2R0QC 2W1OA 1H9GA 4W97A 4C2TA 5FLVA 2HEOA 1G3WA 3BCBA 4HPQA 5CPRB 5JLWA 3LAPA 4EJOA 4DYRA 9ANTA 3ZMVA 2M8GX 3KZYA 1Y0UA 4HBLA 4M6XA 3F22A 3B73A 1W4MA 2BV6A 3T8RA 4BDZA 1ETVA 3HPGA 3ERMA 4KN7X 4GRIA 3EUHC 3PL8A 1SANA 3CC4I 3LSMA 1GHCA 3U9GA 2Y31A 3LWFA 2K4BA 2VN2A 4GXOA 2DA6A 3CCQI 2JSCA 5KK1A 4JK1X 4XRSG 1LFUP 5HNHA 4RM2A 2YPRA 1Y8RB 1GV2A 2Q2EB 4QTRA 2HOSA 5B1BH 3N4MA 1X1BA 4IHVA 4IOAF 4E6KG 2VKEA 4KIFA 2UWMA 2F6CA 2NVUB 3KP5A 1V3FA 5J8FA 4E7JA 1WQ2A 1X1AA 3BTLA 2CFOA 3F6VA 4A3EJ 3OIQA 2O03A 1WH7A 2KJBA 3I55I 1MMSA 3TBIA 1E0EA 3EUKL 2CU7A 2COMA 5IP9J 3EGVB 3OYBA 4KMUX 3QPSA 3U2RA 1ZRDA 1R5HA 5BNGA 2RQPA 3NEUA 2L5QA 4FETA 3OYGA 3HGYA 4IHYA 1LFBA 3DFGA 3M1EA 4BQQA 4LJZF 2BVLA 3WTTC 3ZPLA 3H3VK 3IH2A 3D5LA 4GO1A 2HPIA 3HDDA 2QA4I 3HRSA 3VODA 1I27A 1OYYA 4M3GA 2JT1A 2QGUA 3ZMTA 1P2FA 3CCSI 1BC8C 1U0JA 1E2XA 3VWBA 3A2KA 2Q1ZB 5C44J 4P9FA 1V54H 2QENA
chains in the Genus database with same CATH topology
1VQOI 1HC8A 5GAHJ 5GADJ 1S72I 3CMAI 3CCVI 2E36A 2ZJQF 1FOYA 4UY8I 5GAEJ 1VQLI 2JQ7A 1WIBA 3CCMI 3CC2I 3DLLF 3CCEI 1YJNI 4V19K 3CCRI 3CMEI 1VQ8I 2ZJRF 3CC7I 1VQ5I 3CJRB 2OTLI 3I56I 1ACIA 3CC4I 1VQMI 3CD6I 3CCQI 3J7YJ 3G6EI 1YHQI 3CCJI 3PIPF 3G4SI 3PIOF 4IOAF 1YITI 1VQNI 5GAGJ 3CJTB 1VQKI 1VQ4I 2H8WA 3CF5F 1QA6A 2NXNB 2FOWA 1VQPI 1FOXA 3I55I 2ZJPF 1MMSA 2QEXI 5JVGF 3EGVB 1VQ6I 2E34A 3CCLI 4IO9F 1Y39A 1VQ7I 1VQ9I 1YJWI 3CJSB 2E35A 1YJ9I 3CJQB 2QA4I 1FOWA 3CCUI 1YI2I 4IOCF 2K3FA 3CCSI 3G71I 5DM7F 3J7ZI 1YIJI 5DM6F 2OTJI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQO I;  1HC8 A;  5GAH J;  5GAD J;  1S72 I;  3CMA I;  3CCV I;  2E36 A;  2ZJQ F;  1FOY A;  4UY8 I;  5GAE J;  1VQL I;  2JQ7 A;  1WIB A;  3CCM I;  3CC2 I;  3DLL F;  3CCE I;  1YJN I;  4V19 K;  3CCR I;  3CME I;  1VQ8 I;  2ZJR F;  3CC7 I;  1VQ5 I;  3CJR B;  2OTL I;  3I56 I;  1ACI A;  3CC4 I;  1VQM I;  3CD6 I;  3CCQ I;  3J7Y J;  3G6E I;  1YHQ I;  3CCJ I;  3PIP F;  3G4S I;  3PIO F;  4IOA F;  1YIT I;  1VQN I;  5GAG J;  3CJT B;  1VQK I;  1VQ4 I;  2H8W A;  3CF5 F;  1QA6 A;  2NXN B;  2FOW A;  1VQP I;  1FOX A;  3I55 I;  2ZJP F;  1MMS A;  2QEX I;  5JVG F;  3EGV B;  1VQ6 I;  2E34 A;  3CCL I;  4IO9 F;  1Y39 A;  1VQ7 I;  1VQ9 I;  1YJW I;  3CJS B;  2E35 A;  1YJ9 I;  3CJQ B;  2QA4 I;  1FOW A;  3CCU I;  1YI2 I;  4IOC F;  2K3F A;  3CCS I;  3G71 I;  5DM7 F;  3J7Z I;  1YIJ I;  5DM6 F;  2OTJ I; 
#chains in the Genus database with same CATH topology
 4ENJ A;  4OU0 A;  1ODD A;  3QQA A;  1POG A;  2V4J C;  1MMA A;  3HOX J;  5KHD A;  3TOA A;  2HS5 A;  3VDX A;  2IS2 A;  2H6C A;  1W5C C;  1V5E A;  1BI1 A;  3PQK A;  3HYI A;  3MMY B;  1WGX A;  1T56 A;  3ZMD A;  3QOP A;  5E20 A;  4DJA A;  1B8I A;  3WE3 A;  4C2U A;  3C3W A;  4BS9 A;  1XGN A;  3HUG B;  1D5V A;  1OMI A;  3SJM A;  3DWL E;  1XG1 A;  3U1D A;  1OCP A;  4FIS A;  1ZK8 A;  3FXJ A;  4UB8 C;  5LRR A;  3E0J B;  5JVT A;  3M8J A;  4UUS A;  1MBF A;  2F4M B;  1JTX A;  5EGO B;  4L5I A;  1V4R A;  5E79 C;  2X6X A;  2GAU A;  1WPK A;  2LY9 A;  3KP4 A;  4MEX F;  2BEO A;  2LKS A;  4LG0 B;  3LSH A;  2V6C A;  4LLN A;  3HOT A;  1UMQ A;  3WU2 C;  3KP3 A;  4XRM A;  5E1Z B;  2K9N A;  1DGR M;  1YYV A;  2YR2 A;  2OZU A;  2DA3 A;  3K4M A;  3HSF A;  2O5R A;  3K2Z A;  3OL4 A;  3OSF A;  2K40 A;  2NVY J;  2UXN A;  2XVC A;  4XKB A;  2FSW A;  3HOV J;  1MBH A;  2WTE A;  2VBX A;  1TWA J;  1U3E M;  3ZMS A;  4M3E A;  2OCC H;  2MAB A;  2AXT C;  2LG4 A;  3HKZ N;  2LD5 A;  4HST A;  4ENN A;  5D5W B;  4G8X A;  2PJR A;  2H8W A;  4XN0 A;  2UV1 A;  4XLC A;  4II3 A;  3F72 A;  2MGQ A;  2XAG A;  2L4M A;  2W57 A;  2B0L A;  5FLM J;  1EH7 A;  3OYD A;  5D5X B;  2C6Y A;  1SD4 A;  2G7H A;  2XGD A;  2GQQ A;  2QSF X;  3S2D J;  1JT0 A;  1IJW C;  3OYN A;  2VT3 A;  2CQQ A;  4BYY A;  2IP2 A;  1WFX A;  2A5W A;  2KMU A;  3WHC A;  4A5M A;  5LEJ A;  4ZZL A;  2FRH A;  1G3T A;  3QRF F;  2EWN A;  1IUF A;  1I6H J;  2ELH A;  1TQP A;  1B9N A;  1YRN A;  2R5Y A;  1BW5 A;  3PFI A;  1MNE A;  5D6F A;  2M87 A;  3A4C A;  1YJ9 I;  2FA5 A;  1QU3 A;  3MKZ A;  2BYV E;  4XM3 A;  4H4K C;  4L9T A;  3BTJ A;  1RPW A;  2QLZ A;  2JSP A;  3TMO A;  4B8X A;  1OIS A;  1ZKG A;  5L3G A;  4AIJ A;  4GDF A;  1DGW Y;  2BVM A;  2HKO A;  5BQT A;  3JRB A;  2WV0 A;  2O6G E;  3GEZ A;  5JI6 A;  2NS0 A;  2OBP A;  2VT2 A;  1SAX A;  3SDB A;  3A03 A;  5CVI A;  2QM3 A;  1FOY A;  1S8N A;  2OA4 A;  5KVR A;  1J9I A;  2VC0 A;  1I5Z A;  2FF4 A;  4PGH A;  2P6S A;  3MAJ A;  1XGM A;  1R36 A;  1R5G A;  4ZYD A;  4G7H F;  2VPR A;  1MJA A;  2X1D A;  3O2P E;  2XKP A;  2VKD A;  4OOI A;  3IKT A;  1TTY A;  4KMF A;  3CME I;  2XAS A;  5BMZ A;  2ZB9 A;  3Q5F A;  1PUE E;  4O5V A;  1OYI A;  5ILU A;  4ZH4 F;  1OKR A;  4HW0 A;  2QQ9 A;  2Y0S A;  4A3J J;  1ZG5 A;  1EH6 A;  2CW0 F;  4YFX F;  2BE5 F;  3K0L A;  2JA8 J;  4XLE A;  1IN4 A;  4KA4 A;  3K70 C;  3RJP A;  3JSP A;  2CRG A;  3K2A A;  2LLK A;  1Y6I A;  3IWF A;  5IOY A;  2DFI A;  2EIL H;  3GZ6 A;  2IGK A;  2FXA A;  1JKQ C;  3SEZ A;  5C4J J;  5FKO A;  1OPC A;  4MO7 A;  1YHQ I;  3PIP F;  2L02 A;  5TGT A;  1RUN A;  4LIV A;  3ERE D;  2OQG A;  3DTK A;  2KLO A;  3O8G A;  4L9N A;  3TP3 A;  4WF2 A;  3HRT A;  3PIO F;  3JRA A;  1HDD C;  2ME0 A;  2Z5U A;  1VQK I;  1G3S A;  3K1N A;  3LL7 A;  2LKX A;  4BXX J;  1U9O A;  3DKW A;  3T5X A;  5DS9 A;  2W84 A;  2MD5 A;  2QYO A;  2NS8 A;  5JHF A;  5J8C A;  1JKP C;  1DU0 A;  2M1B A;  1A35 A;  2P6T A;  4A5N A;  1U5T B;  3KEO A;  2ZME B;  4N4N B;  3JAM K;  3ZN1 A;  1R00 A;  1X4P A;  2M9H A;  1FSH A;  3DU6 A;  4F93 B;  4BJT A;  2YU3 A;  2H1K A;  1QZZ A;  3IHU A;  1L3L A;  1FBQ A;  5F64 A;  4IQ4 A;  3JRG A;  2JA6 J;  3E6B A;  1X3U A;  3TW6 A;  2F5C A;  3LSG A;  1FJL A;  1X3W B;  2WY7 Q;  4M6Y A;  3HC7 A;  3TW7 A;  1P4X A;  2L7K A;  2STW A;  3FXQ A;  5EEA A;  3VYU B;  5J6X A;  2LVS A;  5F1J A;  2DOD A;  1MH3 A;  3F8F A;  3LA7 A;  1E3P A;  2LK2 A;  4RM3 A;  4XL9 A;  3LSK A;  4LLG F;  4M9S A;  5M5X J;  3H0G J;  1WSU A;  3VFZ A;  5DD4 A;  2DFE A;  1YOV B;  2XAH A;  3GW2 A;  2A69 F;  2XAQ A;  3F0C A;  1GDT A;  1YX5 A;  4OAY A;  1MBG A;  2IW5 A;  4Y4R A;  3SZP A;  2KQR A;  2P0W A;  4M9X A;  3H35 A;  2DJN A;  3BP8 A;  5DDG A;  3IRQ A;  1WJ5 A;  1KQ8 A;  4KDP A;  2DT6 A;  1VND A;  4B43 A;  1Y56 A;  2R7O A;  3BG3 A;  4EGZ A;  4B47 A;  4ZDP A;  5A2Q K;  3ZQC A;  2NNN A;  3PO3 J;  2IS1 A;  2HYG D;  3WE2 A;  3CJR B;  2GWR A;  2RV8 A;  3KLO A;  4UUT A;  2M5W A;  3RQ4 A;  2QF7 A;  2EV6 A;  4XN3 A;  4OIN F;  2PLY A;  1YW7 A;  4LOC A;  4RS8 A;  5M3M J;  4QLC U;  2EZI A;  3PUB A;  1SFE A;  3TP0 A;  3TED A;  4LB6 B;  3OYJ A;  1IRF A;  3A0H C;  3CJN A;  2JK3 A;  5IP6 A;  2COB A;  1U8B A;  4YEJ A;  3GTQ J;  3S1Q J;  4S0H B;  3KYD B;  1RI7 A;  4HEA 2;  4MFD A;  5B5E C;  1ZGW A;  1TT5 B;  3WHB A;  1DU6 A;  1MD0 A;  3A01 A;  1IG7 A;  2BBY A;  2ZXJ A;  3S93 A;  3F21 A;  2DMT A;  2Y2Z A;  3GVA A;  4U7D A;  2M8E A;  1RR8 C;  3NWT A;  3FZV A;  2DXI A;  1OR7 A;  3A0B C;  1E3O C;  4AYB A;  2KPM A;  2VJ5 A;  3K10 A;  3K69 A;  4D7N A;  1O3S A;  1B9M A;  4L9J A;  2FOW A;  5ED4 A;  2HQN A;  1JHF A;  1TBX A;  2LFB A;  2L0K A;  1MDM A;  4DZJ A;  2Y75 A;  4CYC B;  1JJ8 C;  4Y7N J;  3H5R A;  5D5U B;  1N75 A;  5ICF A;  2AHQ A;  1AOY A;  5D5V B;  4E7H A;  4M3D A;  2K02 A;  2YX7 A;  4E4H A;  1VQ7 I;  1FMV A;  2VE8 A;  2V26 A;  3GTO J;  1I1S A;  2HQA A;  3F8M A;  4Q48 A;  2IEK A;  2ECB A;  5LHH A;  1ETK A;  2E35 A;  1JUP A;  1KGS A;  2K9S A;  4P55 A;  2X0L A;  2RGV A;  1U5T C;  2ZME C;  4EEF G;  2KL4 A;  1ZRE A;  5D4S A;  1YS7 A;  4NUB A;  4IXA A;  4KIS A;  3ZQI A;  2PN6 A;  2I10 A;  1B8I B;  5K7H A;  5C3E J;  3GFI A;  1QBJ A;  5LEK A;  2L54 A;  5IP7 J;  2PFB A;  2HDW A;  1JUM A;  4BY7 J;  3KET A;  2GA2 A;  4UUV A;  4A93 J;  1R1T A;  5HS7 A;  2KKO A;  5HDK A;  3JRD A;  1ZHF A;  1X1D A;  2HTS A;  2ZXH A;  4S05 A;  2M7B A;  4IKF A;  4RB2 C;  3IH4 A;  4A6E A;  2HXO A;  5EZG A;  2JTV A;  4KUM A;  2OJE D;  3GYH X;  1BIB A;  3MZ8 A;  4KIC A;  1OQY A;  4BU2 A;  2G0E A;  4MTE A;  2ME6 A;  4A3L J;  1VQ5 I;  2P4W A;  1VI0 A;  2A61 A;  2Z33 A;  3W6K B;  4D7M A;  3DEW A;  1U9N A;  1T6S A;  1W7P B;  2OPT A;  4Z2Y A;  2JA7 J;  3F6O A;  2OZ6 A;  4IF4 A;  3OYA A;  2VKH A;  1J59 A;  4HX8 A;  2OTL I;  1PJR A;  5CVV A;  4ITV A;  2KIF A;  3O8H A;  3CMY A;  3G1O A;  3H5N A;  5E18 F;  1TC3 C;  2DW4 A;  1TNT A;  4JYK A;  2PJR B;  1T8I A;  2KZV A;  3E6M A;  2XAU A;  3EUA A;  1CQT A;  2YU9 J;  2PQ8 A;  1WCM J;  1K7A A;  4BEH A;  1D0Z A;  4C3I J;  1O7F A;  1EH8 A;  2CMP A;  4A0Y A;  3OSG A;  5BOX A;  3C2G A;  4Y15 A;  5E8I A;  3FM3 A;  3DBR B;  1X1C A;  3MN2 A;  3DP7 A;  2EQR A;  3GZN B;  3V42 A;  4HAM A;  4CCL A;  3VOE A;  2B9S A;  3B6A A;  2JA5 J;  4QWQ A;  2PI0 A;  1TWH J;  2BW3 A;  2F5D A;  5L3D A;  2LOO A;  3V8J A;  2EB7 A;  5IYB J;  2FNA A;  3V4G A;  1YRN B;  1N78 A;  3AG1 H;  3CQZ J;  3ECO A;  3DPU A;  4BHC A;  3E1S A;  1AKH A;  4PJN A;  1GXP A;  3BG9 A;  5L3C A;  3CCL I;  3KP6 A;  3LOC A;  1MIJ A;  3CMM A;  4FX0 A;  4AID A;  1FYL A;  4A3F J;  4A3K J;  1Y0N A;  1ITY A;  1ZR2 A;  2X85 A;  5DUI A;  5H2F C;  4FT8 A;  1W5S A;  3LSR A;  2UZK A;  1Y39 A;  2P5V A;  2XKO A;  2IS4 A;  1Z05 A;  3BQY A;  3JRH A;  2UXX A;  2H1L A;  3D5R C;  1HW2 A;  4UVB A;  3ASO H;  2NS7 A;  1TT0 A;  4G6T B;  2ICW G;  5HLG A;  3GTK J;  3CLO A;  2ESN A;  3PM1 A;  5IY5 H;  2I5U A;  4I09 A;  3TGN A;  2CO5 A;  1BOA A;  3E6C C;  2OV7 A;  4X6A J;  2WWY A;  2OTJ I;  1LNW A;  2VC1 A;  2JJ7 A;  3BG5 A;  2CH0 A;  1LUJ B;  2FBH A;  4II2 A;  3SYT A;  1F5T A;  5M5W J;  1D3Y A;  3CDL A;  3O6B B;  5DCF A;  1WIB A;  4UXN A;  4IHW A;  4A3D J;  5K7F A;  5LGU A;  3WTZ A;  1GUU A;  4BY1 J;  1O3T A;  2KT0 A;  3BR3 A;  3I58 A;  4M71 A;  4ZDL A;  2X6O A;  3HBL A;  5IT3 A;  3GTM J;  3TDZ C;  1DPU A;  1W0T A;  2VUM J;  4PJ0 C;  3R6S A;  4I2O A;  1PDN C;  1QVU A;  3QOD A;  1F4K A;  3M7G A;  4WXD A;  2JA2 A;  3C2B A;  4KT6 A;  2WB1 N;  3EDP A;  4EMS A;  3ZR8 X;  2JRM A;  1ZGJ A;  2RN7 A;  1IZ1 A;  2F5F A;  2LRD A;  3BPX A;  3FIW A;  1UAA A;  1KA8 A;  1XB4 A;  5TIS C;  4P9U A;  3BQZ A;  2KRF A;  3NWS A;  3GTG J;  1WZ2 A;  3F8C A;  3V7C A;  5FRM A;  4C30 A;  5L3F A;  2M3A A;  1VQM I;  4EM0 B;  4R79 A;  1RZ4 A;  2X51 A;  2DK8 A;  2MLG A;  3IWZ A;  1H88 C;  3WTS C;  1KU3 A;  3ZQQ A;  1TQI A;  4BUP A;  1NG6 A;  3P9K A;  3ROU A;  3DU5 A;  2QKM B;  5DEQ A;  1OCR H;  2CGP A;  1E3H A;  4YG2 F;  3TKY A;  3I71 A;  1P7I A;  2D1H A;  2LYC A;  1D1C A;  1Q1H A;  2KDO A;  3ESW B;  1S7E A;  5GAG J;  2Q0O A;  3LA2 A;  3L00 A;  1T2K A;  1QPM A;  2Y30 A;  3R4K A;  2DAO A;  1R4M B;  1FIA A;  1JT6 A;  3S3O A;  3AG3 H;  2EBI A;  2DQL A;  1O3R A;  2HVS A;  2MLK A;  3KYC B;  5HNF A;  2WAQ A;  3IAM 2;  3D5S C;  1QZY A;  2BHY A;  3DCF A;  2IS6 A;  1ZAO A;  5E3L A;  4BDY A;  2HI3 A;  4Y52 J;  2OUM A;  3EYY A;  1JKO C;  1S5L C;  2WY8 Q;  1IN5 A;  1Y1W J;  3J80 Z;  1YTY A;  4YIR X;  4XRS A;  3I64 A;  3EYI A;  3OV8 A;  4F52 A;  4FTH A;  3BZC A;  2MBF A;  2KRH A;  2PBI A;  2QZ8 A;  2EZL A;  3UKG A;  1YI2 I;  1B59 A;  4A69 C;  3SXY A;  1AU7 A;  4R1H A;  4NHJ A;  2OF7 A;  3C18 A;  2FML A;  1ZG1 A;  4CCM A;  3WTW C;  3RQI A;  3G3Z A;  1WWX A;  5KCM A;  3F3X A;  3LNQ A;  1R6R A;  5KAI C;  1K4T A;  3HOW J;  5JLX A;  4B3X A;  1GVD A;  3Q9V A;  4W1U A;  2FBK A;  4BXU A;  1SVO A;  1J2X A;  4HLX A;  1Z6T A;  2HQR A;  4NQW A;  3J7A O;  2DYR H;  3ABT A;  5HS9 A;  3H3U A;  3K4C A;  1ETQ A;  2KP6 A;  2ISZ A;  3RKQ A;  3H9Q A;  1A04 A;  4ESB A;  5EDN A;  4L18 B;  1FSE A;  2D45 A;  6PAX A;  2P7V B;  2R7V A;  3JTH A;  3DPT A;  2K27 A;  3JSO A;  2VQC A;  4E7K A;  2CFX A;  4K2E A;  4BJ5 C;  1SFO J;  1LKX A;  1IUY A;  5K5O A;  3QYB A;  2DA4 A;  1LQ1 A;  5D6E A;  2VL8 A;  4EGY A;  3GLL A;  1Z6R A;  2FQ3 A;  2DT7 B;  2VQL A;  4HDU A;  3QOE A;  1XMX A;  2CV1 A;  2OCE A;  1U78 A;  2HDC A;  1J75 A;  1N77 A;  4OIO F;  2OAZ A;  1TW2 A;  2ZKZ A;  3KP2 A;  3CO6 C;  3A01 B;  1T0F C;  3OWT A;  4ENK A;  4A3G J;  2ZXW H;  1VF9 A;  2E7X A;  4HV5 A;  4UV8 A;  4OIR F;  4KIG A;  2XSJ C;  1TLH B;  2F48 A;  3HHG A;  1RES A;  3W3C A;  1BM9 A;  4EJV A;  2MD0 A;  2RDP A;  1FEX A;  5LHI A;  2R7S A;  1R4N B;  3LSI A;  1XCV A;  1ON1 A;  1MDM B;  2H94 A;  2RKH A;  2MC4 A;  2M34 A;  3EPZ A;  4XOR A;  3SEQ A;  1LE8 A;  1VQN I;  2B63 J;  2E5N A;  4BBR J;  5JFR A;  2Y48 A;  3PO2 J;  2PX9 A;  1AA7 A;  1F36 A;  2TRT A;  1OYW A;  2EV5 A;  2A07 F;  3ZQG A;  2H6B A;  4QSH A;  2UUZ A;  3FWE A;  3S1R J;  3GZ5 A;  2VOP A;  1VQP I;  3FBI B;  2HVQ A;  1N25 A;  3D1N I;  4Q5S F;  1MBK A;  4KJZ A;  1EF4 A;  1J5Y A;  1HLV A;  2F4I A;  3S3N A;  1XCB A;  1FWZ A;  2B7E A;  2F5V A;  4I98 B;  1HOM A;  5ILS A;  2ZC2 A;  3DBH B;  1O3Q A;  3IP4 B;  1X58 A;  2DMP A;  1VFC A;  3S17 J;  1FX7 A;  4UVA A;  4XON A;  3L1P A;  2XF6 A;  2R7Q A;  3H9J A;  4OMZ A;  2FBI A;  2MYS A;  1WKM A;  1XGO A;  2ADU A;  1KU2 A;  2QUF A;  3VYS B;  3OYC A;  1JHH A;  2DPU A;  3HOS A;  4BAC A;  4D9J A;  1LVA A;  4DZP A;  2NAZ A;  2VBY A;  2HR3 A;  2BXY A;  4O6J A;  3VEP A;  2JZY A;  3FF5 A;  3LST A;  2JVG A;  1BN5 A;  1SFX A;  4Q47 A;  2X1C A;  5D8L B;  4A3C J;  4NC7 A;  3GXO A;  3BC8 A;  1X4O A;  4XLN F;  4IEJ A;  1QZE A;  2IT0 A;  2O8K A;  3K4J A;  4RLF A;  2YX4 A;  2DA7 A;  2Z3Y A;  3EUH A;  4L5E A;  4AC0 A;  1TQM A;  1XGS A;  2XHK A;  2QKL B;  2V9P A;  1IRX A;  3L2U A;  5FD6 A;  4JX6 A;  4M3F A;  5FB2 A;  3J81 Z;  1VQL I;  2JQ7 A;  3I0T A;  1IRG A;  2L4A A;  2LBF B;  4S04 A;  3RKY A;  3TO6 A;  3PUF A;  1YJN I;  1Z3X A;  2X6Y A;  1IRZ A;  3CCR I;  2K9L A;  5F08 A;  2XRN A;  3H5A A;  2ZJR F;  1RR7 A;  2PMU A;  4KN4 X;  5J3L A;  2EV0 A;  4Z6Y A;  4DBQ A;  4KT5 C;  2X48 A;  1MJB A;  1FNN A;  5CQG A;  4C2M J;  3CZ6 A;  1BJA A;  5E1W A;  1YG2 A;  1BI0 A;  2GIZ A;  5F04 A;  2IA2 A;  2Y9Y A;  2IAI A;  3JRC A;  4BE0 A;  3IAS 2;  1WRJ A;  1SFK A;  3WTY C;  4BEH B;  2M0C A;  5FKL A;  1HW1 A;  2HZD A;  3GF2 A;  4KNY A;  1FLI A;  3QU3 A;  1O4X A;  2P5K A;  2ID6 A;  4G6Q A;  4NNJ A;  3S2H J;  4XIC A;  3DPL C;  1DP3 A;  1U8R A;  1NHA A;  1IXC A;  4BAY A;  2CQX A;  1FC3 A;  3GME A;  4PSX A;  1ZLK A;  2BW3 B;  2VQH A;  4UHT A;  4ZYG A;  3KE2 A;  1BR4 A;  2W48 A;  2Z1D A;  4B4C A;  1I50 J;  1USS A;  2AQE A;  3CJT B;  5E1X A;  2DFH A;  2OC6 A;  3WGH A;  4YFN F;  3ZP5 A;  3BR0 A;  2O3F A;  3CLQ A;  3W6J B;  4DW6 A;  1AKH B;  3FHZ A;  3GWZ A;  1ORK A;  1HQC A;  3PNT A;  4N0B A;  4HZF A;  1O7L A;  4CCK A;  4UV9 A;  2BXZ A;  2DTZ A;  2R5Z A;  2ZJP F;  1B1B A;  2DFF A;  4C3H J;  1D8J A;  2OQR A;  2R92 J;  3L09 A;  4R8H A;  4JBA A;  2E34 A;  2DU9 A;  3V8K A;  5TRD A;  1H8A C;  5F6F A;  3GTP J;  1MMN A;  2M45 A;  4FAS D;  1FPQ A;  1WJC A;  1SC7 A;  2DK5 A;  1GT0 C;  1PP8 F;  1YE9 A;  4LD5 A;  2F5E A;  2AXL A;  5LRS A;  2XAF A;  3OYE A;  4NB5 A;  4F3Q A;  3I54 A;  5HLH A;  2ZNY A;  2P8T A;  2LC2 A;  2VOO A;  5E17 F;  2CQ7 A;  5FLX Z;  3J7Z I;  2ACJ A;  1MGT A;  5DM6 F;  1XMK A;  2HNH A;  2WAF A;  1XDS A;  4AVZ A;  3S32 A;  5IPA A;  1FTT A;  5CVU A;  2K5C A;  3LFK A;  3FXL A;  1T08 B;  2K9M A;  2DMQ A;  3L9F A;  4V2G A;  4JOM A;  3CCV I;  2Y0M A;  1Z77 A;  3L7W A;  3CDI A;  1IO2 A;  3JRF A;  2E36 A;  2RAE A;  1XSX A;  4A0Z A;  1LEA A;  2DOE A;  2DDB A;  3DKY A;  1I39 A;  1QVT A;  4M73 A;  4ETS A;  1I6X A;  4MQV A;  5K5Q A;  2EZK A;  1A6Q A;  4ASN A;  1BR1 A;  1UG0 A;  1XN7 A;  4GYG A;  1A31 A;  1KYZ A;  2M4G A;  2QCO A;  1CGP A;  3H3Z A;  3HXL A;  1RET A;  2L3D A;  4RMN A;  1T38 A;  1XSV A;  4EV0 A;  1B4A A;  2W25 A;  3KLN A;  2O7O A;  1S6L A;  3WTU C;  2GLO A;  2FX0 A;  3FDY A;  5FFZ A;  1TL8 A;  1T39 A;  1RNL A;  2FE3 A;  2Z2S B;  1S7O A;  4C9Y A;  3ZRG A;  3RZD J;  1B72 A;  4IL6 C;  5DUK A;  2BY3 A;  2DJI A;  2Q2E A;  1YS6 A;  1VTN C;  3T0Y A;  1H89 C;  2R7X A;  3Q9S A;  4D5C A;  1SFU A;  3HKZ A;  3RKW A;  2BHZ A;  2FMY A;  3BJA A;  1HCR A;  2E60 A;  2F4O B;  2K86 A;  3O3K A;  5FO5 A;  2DLL A;  4BE1 A;  1K83 J;  2ZSI B;  2LDU A;  5B3S H;  3DEE A;  4ABZ A;  2CW8 A;  1UG2 A;  3OS0 A;  4LG3 A;  1HKS A;  4P96 A;  3K1M A;  3S14 J;  4XLP F;  1WI9 A;  3FHN A;  1V5G A;  3BR6 A;  1Z7L A;  2X4H A;  2HU9 A;  3ZXS A;  1LDD A;  1RKT A;  2M4K A;  2HQ5 A;  4GCV A;  1LDK B;  2M0M A;  4RAZ A;  5BS6 A;  3K4N A;  2A6E F;  3ABM H;  2O8X A;  3J7A Y;  5HS8 A;  3RDI A;  4YIF A;  4CGZ A;  3ZN0 A;  3ONQ A;  1TWF J;  3P7N A;  4EJW A;  1TWG J;  2W4S A;  1P4W A;  2O61 A;  2A6T A;  2GA1 A;  3FXO A;  4AU7 A;  4M6V A;  3G2B A;  1ZRC A;  2LNB A;  3CDH A;  4BE2 A;  1R1V A;  2L7M P;  2XDV A;  3HRU A;  4M9Z A;  4RB0 A;  3MFK A;  2R7R A;  3AL0 B;  1W5T A;  3L2V A;  2BZT A;  4F91 B;  2LF7 A;  2FU4 A;  4DOZ A;  5GPA A;  1X2M A;  5GTI C;  3V7S A;  4NQW B;  1DQU A;  5DCM A;  4E7L A;  4LFU A;  1YQA A;  3G1L A;  3FBN B;  1Z9C A;  1D1B A;  4CUG A;  2X1E A;  4CHU A;  4N9I A;  3BG7 A;  1Q1V A;  3SHF A;  3OYF A;  2NOJ B;  4J00 A;  5BPI A;  2VXD A;  2L01 A;  4PSW A;  3HUG A;  3S2W A;  3GUD A;  3HIF A;  3CMA I;  2DN0 A;  2D2W A;  3A1Y A;  4U88 A;  4XKV A;  4OWR B;  3J80 K;  1C0W A;  3GFL A;  3MCZ A;  2IRF G;  4IHT A;  3CTA A;  5GPC A;  2HOA A;  3K4B A;  2OD5 A;  1S29 A;  4CSW A;  1XSD A;  3M3Y J;  3NAU A;  2K4J A;  1Z91 A;  3KZI C;  2KHM A;  2XGC A;  4AM3 A;  1DPR A;  4AIH A;  4TV7 A;  4J19 A;  4IQJ A;  3MKY B;  4FE4 A;  3CC7 I;  4HF2 A;  4B44 A;  2V9V A;  2DMU A;  2XGX A;  3P9C A;  5F27 A;  3TOB A;  1SAU A;  4I6Z A;  3JCU C;  2L9N A;  3M1C A;  1R49 A;  3BR5 A;  2GOM A;  3R61 A;  3BT9 A;  4XSZ F;  3BTC A;  1MKM A;  1UZC A;  1YO5 C;  2NVQ J;  5CKT A;  5LD2 C;  5ILV A;  4UUS B;  2MC3 A;  2E1M B;  3CES A;  4WXH A;  3ULQ B;  2HOT A;  1LE8 B;  1D5Y A;  5EYR A;  1UEL B;  2XC7 A;  3RYR A;  4HOB A;  2VIX A;  4BQO A;  4JX5 A;  4PDK A;  2E2J J;  3WG9 A;  5KAF C;  3I59 A;  2RVC A;  3R0J A;  4XID A;  1ZGA A;  5M3F J;  3AFH A;  3ABU A;  1D0Y A;  2JN6 A;  4RAG A;  2XRL A;  5J4Y A;  5K1Y A;  2N8G A;  3PNY A;  1K78 A;  1U6G A;  2V1X A;  2E1N A;  5F0C A;  4HQE A;  2V1U A;  3FMS A;  1K79 A;  1BR2 A;  4RA2 A;  3GTL J;  2XPV A;  2XB0 X;  4RGU A;  4Y17 A;  1EV7 A;  4HDV A;  2M7A A;  1RIO H;  4UNO A;  4LK1 F;  2KZG A;  4ON0 A;  2HYJ A;  2QVO A;  3MZY A;  3DKX A;  3W6V A;  3BPV A;  2DYS H;  1DP7 P;  1FYK A;  2WAE A;  4I7H A;  3RPQ A;  1B6A A;  5FKN A;  3DF8 A;  2WBM A;  1A36 A;  1IF1 A;  1UHS A;  1L0O C;  2BOL A;  3IUO A;  1H9T A;  1P6R A;  1W0U A;  1MBE A;  2X9D A;  2R5Y B;  3FKI J;  3BTI A;  1ZYR F;  2XUB A;  2DA1 A;  1BI3 A;  1KON A;  1Y1V J;  2W00 A;  2QQB A;  3FXU A;  5K7Z A;  5D8K B;  2G9W A;  1BI2 A;  4LGW A;  2QBY A;  3AL0 C;  3I4M J;  3KIO A;  1V5F A;  1ZR4 A;  5LBQ A;  1V55 H;  3QPL A;  4IPA A;  3HRM A;  4U0W A;  2RRE A;  4DYC A;  1JJ6 C;  2R3S A;  1FTZ A;  1NTC A;  4CYD A;  2FNP A;  3SDG A;  4D1Q A;  3TO9 A;  5L3B A;  1YIO A;  1OFC X;  3RI4 A;  4HSR A;  3GFM A;  1VQ8 I;  5JR3 A;  3C1D A;  1WJA A;  1NH3 A;  2F2E A;  4EJT A;  2EFN A;  4RB1 A;  3KP7 A;  3S1M J;  2O9L A;  4IHS A;  2QSG X;  4E70 A;  4ZC3 A;  5E3M A;  1DDN A;  5E3N A;  1SMY F;  2KIU A;  4EM1 A;  5J4V A;  2MH2 A;  1BOB A;  2P81 A;  2Y69 H;  1OCT C;  4HX4 A;  5FRN A;  2MSY A;  4EAT A;  3M8F A;  1GXQ A;  1ZRF A;  3N97 A;  4WCG A;  3QPH A;  2V9K A;  3Q0W A;  3HOU J;  4OIQ F;  3FK7 A;  3GBG A;  4DQ2 A;  4KFC A;  2G7U A;  2W85 A;  1G2H A;  1I3A A;  3FK6 A;  3KCC A;  3MEX A;  3QAH A;  4CCN A;  1APL C;  2IVM A;  4HV6 A;  2LTP A;  2R5Z B;  3ZQF A;  3SFI A;  3OR2 C;  4XNF A;  3VSL A;  1KU9 A;  1LPQ A;  1T98 A;  2YSR A;  4XMY A;  3ECH A;  3EQL F;  2PEX A;  3I53 A;  4BH9 A;  3CF5 F;  4DBR A;  2E1M C;  4IRI A;  1J09 A;  1XMA A;  2J5O A;  4G9Y A;  3UR3 C;  5HLI A;  4XSX F;  5A2Q Z;  2AO9 A;  1FZP B;  4N9H A;  3FKJ A;  2KFD A;  3OYL A;  2GXG A;  1KU7 A;  1JKR C;  2XRO A;  1BIA A;  1OLT A;  3KEQ A;  3B02 A;  1T33 A;  4XBF A;  2DOA A;  4LIU A;  2R4G A;  2K85 A;  3Q0U A;  3U1K A;  4D0P A;  2A6H F;  3PJR A;  4BL0 B;  4E7S A;  1VQ9 I;  1HBX G;  5F0F A;  3RKX A;  4PK4 A;  2KIS A;  4JX4 A;  2LY1 A;  2LY2 A;  3NQO A;  4EJU A;  1MNM C;  5M5Y J;  2DA5 A;  1Z3Y A;  5HOO A;  3CJS B;  3K9T A;  1XC5 A;  3PNV A;  3WU1 B;  1OCC H;  2P7C B;  4MGR A;  2JPB A;  3QU6 A;  3OOU A;  4N4O B;  4RGR A;  3OIO A;  5CLS A;  2K9Q A;  4P5O A;  3NRV A;  1ONV A;  4ZTJ A;  3RTR A;  3VYT B;  2NRA C;  1HC8 A;  2RNJ A;  4DIQ A;  2AS5 F;  1MSE C;  1UHM A;  4XLA A;  1S72 I;  4RBO A;  1IV8 A;  1HXD A;  2XV4 S;  3TDU C;  4AWX B;  2L2O A;  1BW6 A;  3MVP A;  2HZT A;  3GO5 A;  5FKM A;  4HNU A;  2VPL A;  5AIP A;  3HG9 A;  2BY1 A;  4I02 A;  4AVP A;  3I4N J;  3BJ6 A;  3CCM I;  1LDJ A;  1T95 A;  4DNC A;  2DA2 A;  1GV5 A;  4BKX A;  4XLH A;  4OIP F;  1MBJ A;  3CUQ A;  3FXR A;  2R7D A;  2E7W A;  3BRO A;  3ZMZ A;  1TP4 A;  3S8P A;  1TZL A;  3R0A A;  4Y3O A;  3M07 A;  4MFE A;  4QIW N;  4KYW A;  1B72 B;  3W2A A;  1K4S A;  1R22 A;  4A0X A;  2CUF A;  2HFH A;  1KZH A;  4IX7 A;  3MZH A;  1TW3 A;  5EG0 A;  5EF6 A;  1RUO A;  3RSN A;  2FD5 A;  3A02 A;  1JXS A;  1PVE A;  4ESJ A;  3I4P A;  5FLX K;  1IGN A;  2VJJ A;  5J40 A;  2Q8K A;  1EJ9 A;  5AON A;  1ULY A;  4ZYE A;  4F92 B;  1J0R A;  2DO7 A;  4XR6 A;  2KRC A;  1G59 A;  4L5J A;  3G1M A;  5E3O A;  3MKW B;  2Y0S N;  1Z67 A;  5LFA A;  1RC9 A;  5IOZ A;  1D1A A;  2GM4 A;  4MTD A;  1QHH D;  3G4S I;  4LK0 F;  2WA0 A;  4I01 A;  3OOP A;  2XSD C;  3REO A;  1U2W A;  4U0V A;  2JUC A;  4CYC A;  1YIT I;  1SMT A;  1IDY A;  1EKE A;  1QQI A;  3HL2 A;  3I3L A;  2EFW A;  1MZB A;  5GTH C;  1KQ0 A;  2ELK A;  3K70 D;  2K3P A;  1R9T J;  2PMZ N;  3HOY J;  1HKQ A;  1NG7 A;  4E7Z A;  2CJJ A;  2K7L A;  2DQR A;  1I3Q J;  4F55 A;  2M30 A;  2XF7 A;  4YFK F;  5E8G A;  2GOX B;  1SVM A;  3GX4 X;  2EJR A;  4MIM A;  2VI6 A;  3CP2 A;  4FHT A;  3ZMU A;  2VXZ A;  3FIS A;  3BZ6 A;  1QGP A;  3E6D A;  4BQA A;  4O3M A;  3NAR A;  5DCM B;  5C4X J;  4JP0 A;  3AAF A;  2H09 A;  3BZK A;  4IO9 F;  1M1E B;  3BG6 A;  1A6I A;  4G94 A;  2RNG A;  4HF1 A;  2ZFW A;  1G8X A;  2CQN A;  2ZJ2 A;  2A05 A;  4JQF A;  2YUS A;  3BLY A;  3RZO J;  5HDG A;  4A6D A;  3CCU I;  2V79 A;  4LB5 A;  1JUS A;  2L9S A;  2DCE A;  1JGG A;  1YFH A;  1FBS A;  1SD5 A;  4WXC A;  4CZZ A;  4G7Z F;  3OS1 A;  1YIJ I;  4LIT A;  5HDN A;  3HSE A;  4I76 A;  1KQ9 A;  4MQ9 F;  2ECC A;  4YRV A;  1NK3 P;  4B09 A;  3QWL A;  2CSO A;  3IRR A;  1H0M A;  1K6O A;  1CF7 A;  2CUJ A;  3T8T A;  5BPD A;  2WB1 A;  3KPH A;  4UB6 C;  3E7L A;  4PJL A;  1RKW A;  2GXB A;  2HXI A;  2ISY A;  2VAS A;  2HVR A;  1W7P A;  4CCO A;  1Z1D A;  1XX5 A;  2PMH A;  4ZYA A;  3FXK A;  2EIK H;  1Z0X A;  2H8R A;  3FMR A;  1FP1 D;  3LAJ A;  4M72 A;  3S15 J;  1Z7U A;  3KYL A;  4BNC A;  4Y33 A;  5CJ9 A;  3M9A A;  1VZ0 A;  4HRI A;  3I59 B;  1R5I D;  2E1O A;  4HNT A;  1GVJ A;  2J5P A;  3IH3 A;  4HQM A;  2M2E A;  2QQ8 A;  3W2W A;  4B1R A;  2DT5 A;  3BJO A;  3LSP A;  3CD6 I;  2ZCW A;  2KJC A;  1S3J A;  3SZT A;  3BCA A;  3G6E I;  1LFP A;  3CCJ I;  1K78 B;  2JWT A;  1K61 A;  3F9K A;  2MW8 A;  4CCJ A;  2IA1 A;  4QPQ A;  3VSK A;  2IGN A;  4FCY A;  1G3Y A;  3HTU A;  2E19 A;  1QRY A;  5HVQ C;  3C2H A;  1ZG3 A;  3S16 J;  3E5X A;  2EIN H;  1QA6 A;  3H36 A;  5IT9 Z;  2IJL A;  1J7K A;  2JVH A;  2NXN B;  5H20 A;  3DV8 A;  2QQA A;  1S7A A;  2BY2 A;  3K4K A;  3S3M A;  2E1C A;  2HGC A;  2QEX I;  1SD7 A;  2A5Y B;  5H6R A;  4ESF A;  3SFZ A;  3WOD F;  2VON A;  1HST A;  2WAD A;  4AYB N;  4WK8 F;  3Q0V A;  2VKV A;  1X3Z B;  3UNG C;  4G6D A;  4BHP A;  5ERI A;  3ZOB A;  2CV2 A;  4F7Z A;  3GCM A;  2CS3 A;  4PCQ A;  4ENM A;  2DTR A;  3OMY A;  2GZW A;  3HGG A;  4FE7 A;  4L0Y B;  3DTE A;  1XD7 A;  3JRI A;  2LP0 A;  1PUF A;  4PZJ A;  5CVJ A;  3FX3 A;  1OR7 C;  4BHB A;  4L9V A;  1IN6 A;  1ZN2 A;  3IL2 A;  4IJA A;  4ZYH A;  1HDP A;  2QBY B;  3TQN A;  4RB3 C;  4EVI A;  2EH3 A;  5DM7 F;  4ZDO A;  3WU0 A;  1DUX C;  4U87 A;  1ZEL A;  2W82 A;  3BDD A;  2I8D A;  2WC2 A;  1REP C;  4MHG A;  1IAW A;  5CVR A;  3MQ0 A;  5EJC A;  1HSJ A;  2GIV A;  1T0F A;  5TJJ A;  4LLL A;  4PFO A;  3OL3 A;  1Z21 A;  3H9G A;  1ERD A;  2ZJQ F;  1QPI A;  1ETO A;  2VBZ A;  3V8L A;  1X2N A;  2MG4 A;  3X2Q H;  3VPR A;  2YS9 A;  5K5R A;  4IVN A;  3CCE I;  4J01 A;  4Q4Z F;  2EFO A;  2DMN A;  3HPH A;  4MNU A;  1IDZ A;  3RPU A;  3QP5 A;  1UFM A;  2EZH A;  4NDL A;  4E7I A;  4XK4 A;  4CA0 A;  2PMZ A;  5LHG A;  1YW9 A;  2CW7 A;  2JRT A;  3LMM A;  5J1Y A;  1UST A;  1FIP A;  1MMG A;  1MJ9 A;  4A3B J;  3E97 A;  3AG2 H;  3LQR A;  4EM2 A;  3E5U A;  3KZZ A;  2Z99 A;  3I5U A;  2LKP A;  3ABK H;  2MFZ A;  1G4D A;  3RCO A;  3HTS B;  1KYW A;  1WVR A;  2XGE A;  1WJD A;  4RAY A;  3DQV C;  2VJ4 A;  4CO8 A;  3F8B A;  5HLT A;  3IC7 A;  4ZTF A;  3TO7 A;  3L2Q A;  2MA3 A;  1NK2 P;  5H6Q A;  1R1U A;  2E71 A;  3HSR A;  4UVC A;  5CYV A;  4FX4 A;  1R58 A;  4ANJ A;  4AUX A;  2E2I J;  3E3V A;  2A3S A;  2R7F A;  1YLF A;  2Z9O A;  2CYY A;  1JGS A;  1WJB A;  2ID3 A;  1RRJ A;  2CUZ A;  4XOP A;  4QPO A;  2HTJ A;  3HHH A;  3WG7 H;  2VJI A;  3IKV A;  1A5J A;  3GFJ A;  3K6G A;  1MW7 A;  4L0Z B;  3F8N A;  5AIQ A;  2H27 A;  2EK5 A;  2WV1 A;  2KIM A;  2IA0 A;  1R7J A;  2VLA A;  1VQ6 I;  4RDU A;  4GFB A;  3PSF A;  2CG4 A;  1YX3 A;  3Q3S A;  3ZQ7 A;  4A3I J;  4XRF A;  3BR2 A;  2JPC A;  5DD8 A;  3ELK A;  4I0B A;  1FP2 A;  3OYK A;  3K7A J;  1EA3 A;  1LB2 A;  2O0Y A;  3PFY A;  2IPQ X;  2LR8 A;  3H0D A;  3HOZ J;  1D0X A;  4WX9 A;  4M74 A;  3H1C A;  1UCR A;  3KX2 A;  2HPM A;  2XAJ A;  3CJQ B;  1FOW A;  2A68 F;  3P9I A;  2ZSH B;  1QHG A;  2HKX A;  2E2H J;  1BC7 C;  1ETX A;  2GXA A;  4LMY A;  2ETH A;  1ON2 A;  3VYR B;  3ZQL A;  5J1R A;  4C3J J;  2V6E A;  1MH4 A;  3ZGK A;  3B6C A;  4MLO A;  5FRO A;  2V1N A;  5GAD J;  1XDU A;  3WGI A;  3CUQ B;  2JUG A;  4A3M J;  5IYC J;  2HOE A;  4XKC A;  3JR9 A;  2D5V A;  1YW8 A;  2R7T A;  4RLQ A;  1SD6 A;  3PSI A;  1W36 D;  2EIJ H;  4BQN A;  1P92 A;  2EA2 A;  3U21 A;  2CQK A;  4PUS A;  2DPD A;  3CUO A;  5EG0 B;  2ZXI A;  4KIB A;  2IGM A;  4NC8 A;  5EEH A;  4XLF A;  2LRE A;  3QYF A;  5F0H A;  2HYF A;  1FT9 A;  1IN8 A;  3FXM A;  1XPX A;  3AKZ A;  1QO0 D;  3HZJ A;  4A12 A;  5ICG A;  5FGM A;  3MD2 A;  4CIC A;  2IGO A;  4IRH A;  5ICE A;  1K6Y A;  3WGG A;  1P4A A;  4G12 A;  1WJE A;  4ZJZ A;  4DGW B;  4FQG A;  1P9Q C;  3TL4 X;  1G6N A;  2ZBK A;  5LLQ A;  4XOT A;  1ACI A;  4GGG A;  3VB2 A;  4V2F A;  5LGT A;  2KIQ A;  2EIM H;  5EGO A;  2XPU A;  3OYM A;  1W1W E;  2FQ4 A;  4PJJ A;  5HOD A;  1JTY A;  3J7Y J;  2EA4 A;  4LG0 A;  2NNY A;  4YEL A;  2W24 A;  3CP8 A;  4IZZ A;  2PJP A;  1FYM A;  5EZH A;  2FJ1 A;  4RGX A;  2KDZ A;  1OCO H;  3OYI A;  2R93 J;  4X1E A;  1SEU A;  1ZQ3 P;  1F1Z A;  4PJM A;  5L3E A;  2QSH X;  2CV0 A;  1UJ8 A;  4PGG A;  2AQF A;  3M8E A;  4AIK A;  2PG4 A;  3SZG A;  1BBY A;  4RAF A;  2E5Z A;  1VQ4 I;  4HNV A;  1ZTR A;  4U0Y A;  5DTD A;  1ZAR A;  1FOX A;  3F23 A;  5LGN A;  1ZLJ A;  5JVG F;  2GBY A;  1FMW A;  3KEY A;  1LVK A;  4CDG A;  5ICC A;  1FOK A;  2OU2 A;  4IRG A;  4PFP A;  5J47 A;  3IV5 A;  2VB6 A;  2R7Z J;  1TWC J;  1SVL A;  1UHW A;  4B3A A;  4M3B A;  1OJL A;  5EEG A;  3QYE A;  3BOQ A;  3GLX A;  3HEF A;  2VE9 A;  3FM5 A;  2L7F P;  5D4R A;  3PQJ A;  3JRE A;  3WTX C;  1W7P D;  3LFU A;  5IYD J;  2WAQ N;  5FJ8 J;  4BJ6 C;  4NBQ A;  5FD5 A;  3N05 A;  3QPT A;  5FKK A;  1YJW I;  3V7R A;  4WWC A;  2LMD A;  2TDX A;  3HM5 A;  3FMQ A;  3LSJ A;  2VOD A;  1HW5 A;  2DDA A;  2DI3 A;  3KFW X;  3JTG A;  1ETY A;  4IOC F;  3HJE A;  4XKW A;  2P5L C;  3OYH A;  4B48 A;  1LJ9 A;  3K4L A;  3DEU A;  2BGC A;  4YII A;  1CF7 B;  5CQE A;  2LSO A;  2LBF A;  1WJF A;  1VQO I;  3W2V A;  3P5J A;  1ZH5 A;  2IXS A;  3G73 A;  3I9V 2;  2ESH A;  2X6W A;  2XF5 A;  3D0S A;  5JHU A;  1WH5 A;  5F1R A;  2ZNZ A;  2ZFU A;  3OY9 A;  1PYV A;  5KNL A;  4HF0 A;  3ML6 A;  2CUE A;  2W7N A;  1TNS A;  3H92 A;  1D8K A;  3ISP A;  4UY8 I;  3CF2 A;  2DBB A;  2IBD A;  3OIP A;  4AD9 A;  4BBS J;  3EET A;  4Y13 A;  4GYI A;  1GLN A;  2NVX J;  2L9V A;  3ZCO A;  1BL0 A;  4V19 K;  1OCZ H;  3ZQH A;  1FY7 A;  1MND A;  1Y8Q B;  3DBL B;  3HB9 A;  1R71 A;  2MH9 A;  4RGS A;  3CUQ C;  3E5Q A;  4HG2 A;  5B1A H;  3DTI A;  1LEB A;  2NYX A;  2XIG A;  2NOG A;  2Z16 A;  1HA8 A;  4HLY A;  2JMW A;  3BR1 A;  1FBU A;  1UB9 A;  4KIT B;  2VQG A;  2ZO4 A;  3I56 I;  1JI8 A;  4HYE A;  5DYM A;  3OS2 A;  2L9R A;  3JAM Z;  1R23 A;  2QWW A;  5B66 C;  3OR1 C;  2EPF A;  3C7J A;  1E17 A;  5GP9 A;  4BXF A;  2BY0 A;  2EFQ A;  4XQF A;  2R7W A;  3R60 A;  3SQN A;  3S1N J;  4ZZD A;  1O57 A;  3WTV C;  2V1D A;  4CH7 A;  2HDD A;  4I0A A;  1W36 C;  4CXF A;  1ENH A;  1IXS B;  4A2U A;  4H0E A;  4DYQ A;  4X0G A;  1IV6 A;  1F9N A;  5FFX A;  2FEZ A;  4EQQ A;  3M4O J;  2NVT J;  3CCY A;  2FUG 2;  2R7U A;  4G7O F;  1IXR C;  3LA3 A;  3ABL H;  4HA8 A;  3J81 K;  1IN7 A;  4OAZ A;  3JW4 A;  4I99 C;  2DOF A;  2EFP A;  3MWM A;  3L2C A;  4NC6 A;  1ETW A;  1PUF B;  3RYP A;  3BY6 A;  1WI3 A;  3RPU D;  2XB5 A;  1IW7 F;  3ASN H;  3GTJ J;  4CZC A;  4OMY A;  5J1U A;  1U5T A;  2ZME A;  1I1G A;  3QP6 A;  4P1W A;  4IHX A;  1IC8 A;  3LQQ A;  1QNT A;  2V7F A;  3COA C;  4BGD A;  1X1P A;  1WHU A;  1MSF C;  2LH9 A;  2CWE A;  1JE8 A;  2TCT A;  1HKT A;  3CO7 C;  2K3F A;  5IT9 K;  3G71 I;  3T1B A;  1HF0 A;  2VBW A;  1BA5 A;  1F43 A;  2XPW A;  3MKL A;  4HX7 A;  1XS9 A;  1PP7 U;  2RQQ A;  1AWC A;  2LF8 A;  3K1P A;  5GAH J;  3L2W A;  1S9H A;  2Y9Z A;  2FOK A;  3RIR A;  2ELJ A;  3DLA A;  1STZ A;  4MEY F;  3AG4 H;  1AHD P;  2HWV A;  5DV5 A;  1MMD A;  1X19 A;  5GAE J;  2L7Z A;  3BWG A;  4U7B A;  2D1V A;  3DXJ F;  3DLL F;  2RC4 A;  3CC2 I;  4D5F A;  1XTA A;  1BJZ A;  3L2R A;  2STT A;  1P7J A;  2R0Q C;  2W1O A;  1H9G A;  4W97 A;  4C2T A;  5FLV A;  2HEO A;  1G3W A;  3BCB A;  4HPQ A;  5CPR B;  5JLW A;  3LAP A;  4EJO A;  4DYR A;  9ANT A;  3ZMV A;  2M8G X;  3KZY A;  1Y0U A;  4HBL A;  4M6X A;  3F22 A;  3B73 A;  1W4M A;  2BV6 A;  3T8R A;  4BDZ A;  1ETV A;  3HPG A;  3ERM A;  4KN7 X;  4GRI A;  3EUH C;  3PL8 A;  1SAN A;  3CC4 I;  3LSM A;  1GHC A;  3U9G A;  2Y31 A;  3LWF A;  2K4B A;  2VN2 A;  4GXO A;  2DA6 A;  3CCQ I;  2JSC A;  5KK1 A;  4JK1 X;  4XRS G;  1LFU P;  5HNH A;  4RM2 A;  2YPR A;  1Y8R B;  1GV2 A;  2Q2E B;  4QTR A;  2HOS A;  5B1B H;  3N4M A;  1X1B A;  4IHV A;  4IOA F;  4E6K G;  2VKE A;  4KIF A;  2UWM A;  2F6C A;  2NVU B;  3KP5 A;  1V3F A;  5J8F A;  4E7J A;  1WQ2 A;  1X1A A;  3BTL A;  2CFO A;  3F6V A;  4A3E J;  3OIQ A;  2O03 A;  1WH7 A;  2KJB A;  3I55 I;  1MMS A;  3TBI A;  1E0E A;  3EUK L;  2CU7 A;  2COM A;  5IP9 J;  3EGV B;  3OYB A;  4KMU X;  3QPS A;  3U2R A;  1ZRD A;  1R5H A;  5BNG A;  2RQP A;  3NEU A;  2L5Q A;  4FET A;  3OYG A;  3HGY A;  4IHY A;  1LFB A;  3DFG A;  3M1E A;  4BQQ A;  4LJZ F;  2BVL A;  3WTT C;  3ZPL A;  3H3V K;  3IH2 A;  3D5L A;  4GO1 A;  2HPI A;  3HDD A;  2QA4 I;  3HRS A;  3VOD A;  1I27 A;  1OYY A;  4M3G A;  2JT1 A;  2QGU A;  3ZMT A;  1P2F A;  3CCS I;  1BC8 C;  1U0J A;  1E2X A;  3VWB A;  3A2K A;  2Q1Z B;  5C44 J;  4P9F A;  1V54 H;  2QEN A; 
#chains in the Genus database with same CATH homology
 1VQO I;  1HC8 A;  5GAH J;  5GAD J;  1S72 I;  3CMA I;  3CCV I;  2E36 A;  2ZJQ F;  1FOY A;  4UY8 I;  5GAE J;  1VQL I;  2JQ7 A;  1WIB A;  3CCM I;  3CC2 I;  3DLL F;  3CCE I;  1YJN I;  4V19 K;  3CCR I;  3CME I;  1VQ8 I;  2ZJR F;  3CC7 I;  1VQ5 I;  3CJR B;  2OTL I;  3I56 I;  1ACI A;  3CC4 I;  1VQM I;  3CD6 I;  3CCQ I;  3J7Y J;  3G6E I;  1YHQ I;  3CCJ I;  3PIP F;  3G4S I;  3PIO F;  4IOA F;  1YIT I;  1VQN I;  5GAG J;  3CJT B;  1VQK I;  1VQ4 I;  2H8W A;  3CF5 F;  1QA6 A;  2NXN B;  2FOW A;  1VQP I;  1FOX A;  3I55 I;  2ZJP F;  1MMS A;  2QEX I;  5JVG F;  3EGV B;  1VQ6 I;  2E34 A;  3CCL I;  4IO9 F;  1Y39 A;  1VQ7 I;  1VQ9 I;  1YJW I;  3CJS B;  2E35 A;  1YJ9 I;  3CJQ B;  2QA4 I;  1FOW A;  3CCU I;  1YI2 I;  4IOC F;  2K3F A;  3CCS I;  3G71 I;  5DM7 F;  3J7Z I;  1YIJ I;  5DM6 F;  2OTJ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...