3VEPA

Crystal structure of sigd4 in complex with its negative regulator rsda
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
70
structure length
70
Chain Sequence
MAIEADSVTRMNELLEILPAKQREILILRVVVGLSAEETAAAVGSTTGAVRVAQHRALQRLKDEIVAAGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein Rv3413c/MT3522
publication title Mycobacterium tuberculosis RsdA provides a conformational rationale for selective regulation of sigma-factor activity by proteolysis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Membrane protein/transcription
total genus 19
structure length 70
sequence length 70
chains with identical sequence D, E, H
ec nomenclature
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08281 Sigma70_r4_2 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3vepA00
2EFOA 4WXHA 3LAJA 2HKXA 3F8FA 3NEUA 3R0JA 1Q1HA 3IRQA 1S29A 3S2WA 2MBFA 2L3DA 2E1NA 3ULQB 4XRFA 5TJJA 4KN7X 4I2OA 3CUQA 2M45A 2L02A 2D1VA 1R1UA 2A61A 1FSEA 3NQOA 2STTA 2M5WA 5L3EA 4KIFA 3WTWC 3QP6A 2EFQA 2JPCA 1Z1DA 4XLNF 4Y17A 2R7DA 4HV6A 3LWFA 2GA2A 3GWZA 4Z2YA 1O3RA 1BC7C 3L09A 3BZ6A 2VODA 2K86A 3R0AA 4BQAA 5D4SA 4YFNF 4FX4A 1ZGJA 3F8MA 2DK8A 2L4MA 2JTVA 5CVJA 1P4XA 5FFXA 1TTYA 5FD6A 2OQRA 3DPTA 3SQNA 1D5VA 2FA5A 3MZYA 1YFHA 5F64A 2ZO4A 5J8FA 1QO0D 4PGHA 2Q2EA 1FNNA 2Z99A 5K5QA 2CSOA 4EMSA 3M8EA 2HWVA 4F7ZA 5F1RA 3JSOA 2X4HA 3FMSA 3CO6C 1SMTA 2V1DA 1FX7A 3BJAA 2HDCA 1IXRC 2ESNA 3ROUA 3HTUA 3ZMUA 2FNPA 4KUMA 1XSXA 2Y48A 3I54A 3V8JA 2FBHA 4GYIA 2CQKA 4U0WA 2H09A 1U8RA 2A6EF 2H27A 2K4BA 3CUOA 3LAPA 3I53A 3QPHA 1MKMA 4L18B 1BI3A 4EGYA 3T8TA 2DI3A 4KT5C 1MGTA 2O0YA 3QU6A 3IRRA 2DPDA 5ED4A 5CVUA 1PDNC 4GGGA 3H3ZA 5DV5A 3QP5A 1Z6TA 2EA4A 3L00A 1CF7A 1MJBA 2HYGD 4YIIA 2CW0F 3GX4X 3CUQC 1G4DA 3EYIA 4MQ9F 5H6RA 3DXJF 4IHTA 2YU3A 4A0XA 1HW2A 5D5VB 4A12A 3I59A 1XB4A 3EDPA 1JE8A 4G7OF 5E20A 2A6HF 1I27A 3BPVA 2MH2A 2XASA 2QZ8A 2HTJA 2DBBA 5ICGA 1U3EM 3QRFF 5CVVA 4XSZF 1WQ2A 4CICA 3P7NA 2Z9OA 3KP3A 5HS9A 3BJ6A 2EFNA 4MGRA 2FE3A 2QWWA 1ZRFA 2M8EA 1QNTA 2COMA 2CGPA 2W25A 5BPDA 3PFIA 3I64A 4I98B 4RB0A 1HSJA 3B02A 1TQPA 4N9IA 2RVCA 5CJ9A 3P9IA 4MHGA 2KJBA 3HUGA 2RDPA 2FNAA 2JT1A 3F23A 4A6EA 4ZYDA 1XSVA 1J0RA 1WSUA 5DCMB 2ETHA 1ON2A 3WTSC 1J7KA 2ESHA 2YPRA 1D8KA 4Y13A 4U0YA 1F1ZA 4KYWA 1FT9A 2HZTA 1YW9A 1HKSA 4FHTA 2FBKA 4LMYA 1ZG3A 5DUIA 2MC3A 5BOXA 2QQBA 2XRNA 1MDMA 3DFGA 2XAGA 1K7AA 4EM2A 3RKXA 1T39A 2ISZA 1LNWA 4G8XA 4CYDA 4WCGA 2RGVA 2EA2A 2W57A 2XAJA 1P6RA 4HX8A 2J5OA 3MAJA 4UV8A 4QLCU 4MEXF 4LJZF 4HYEA 3VOEA 4XSXF 1RUNA 5HDGA 2CWEA 2MA3A 2P6TA 3VB2A 1HQCA 2HYFA 1LJ9A 3T5XA 2KIFA 2QQAA 2PJPA 4EJWA 3ISPA 4CO8A 3ZMDA 3ZQ7A 1O3SA 3HRUA 3WTZA 1HKTA 3WTVC 2JSCA 5ICFA 2IA1A 4UXNA 4A6DA 4N9HA 4LLNA 1XDSA 3KCCA 4O5VA 1S8NA 3W6JB 4LFUA 2PN6A 3FHZA 5HVQC 4RGRA 5A2QK 4R1HA 1YLFA 2UWMA 5LGTA 4MQVA 4P9FA 1ZHFA 3DKWA 2XVCA 3BDDA 3WTUC 3ZMVA 1W5SA 3FF5A 1R22A 5HS8A 4B09A 1ZN2A 3RYRA 2Y0MA 4DQ2A 3MZHA 4I09A 2XIGA 2FMLA 5D4RA 1WKMA 1UHMA 2L54A 2K4JA 2RV8A 2NRAC 3IHUA 1D8JA 3MFKA 3K69A 4BHPA 1SFUA 3ABTA 3ZPLA 2G9WA 4MEYF 1YS6A 1OR7A 1P92A 2ZFWA 2IT0A 4OIPF 4HA8A 5E18F 3B73A 2XAFA 1L3LA 1O3TA 5L3GA 4IRGA 2Y75A 1FBUA 1QQIA 4CZZA 3IKVA 4EV0A 3WE2A 1FZPB 2GAUA 1ZG5A 3SHFA 1FYLA 5IT9Z 4EJOA 1SFXA 2ZNYA 3FXRA 2EK5A 3LQQA 2K27A 4ETSA 1ZYRF 1IN5A 3K1PA 2E1CA 1CGPA 4FX0A 4A5MA 3U2RA 2PQ8A 3QOPA 4ZH4F 1XMKA 3DF8A 1U5TA 1YW8A 3R4KA 3GYHX 3ML6A 1O7FA 2QYOA 4L0ZB 1RNLA 3C7JA 1FPQA 2B0LA 3WGGA 4L9NA 3HIFA 4H0EA 3E6MA 1UB9A 5JR3A 5HLHA 1LDDA 3K1NA 4HBLA 4QWQA 1F9NA 2G7HA 2P8TA 5F6FA 4Y15A 1BBYA 1TW3A 4HOBA 2PBIA 3V4GA 3WGHA 4EQQA 3TO6A 3E6DA 5FLXK 1ZRCA 3MQ0A 2HGCA 2ZMEA 4KIGA 4HAMA 2M30A 4M74A 5BMZA 1S7AA 1ZAOA 2D1HA 1WI9A 2PMHA 4ENJA 2UXXA 1GHCA 2V1UA 1R5GA 4AD9A 3BOQA 4IPAA 1BIBA 2GXGA 5LEJA 5D8KB 2X0LA 1R00A 1LB2A 5D5WB 1FWZA 2HEOA 3JTGA 4GO1A 2DQLA 1GVJA 1ULYA 2XV4S 2UZKA 2FRHA 3SFZA 2A69F 3FWEA 3KE2A 3E6BA 3AAFA 4K2EA 3GO5A 3H3UA 5FGMA 2DLLA 2KKOA 4M73A 3WTYC 3BROA 4EGZA 1V3FA 2H94A 1KU2A 1RI7A 2P5LC 2ZXJA 4AWXB 1JHHA 3O2PE 2L01A 5ILSA 1UHWA 2P6SA 1BI0A 4LD5A 1SD5A 1T2KA 1RZ4A 4G7HF 2QLZA 3TKYA 3HTSB 1KU9A 2LSOA 3RPQA 1BOAA 3KFWX 4D0PA 4HLYA 4L5IA 1Z05A 3R6SA 2HS5A 2GA1A 1W7PB 2O3FA 3WG9A 4MTEA 4L0YB 1YS7A 4KIBA 4BH9A 2CG4A 2QQ9A 5FB2A 2FMYA 2EFWA 2WV0A 1R1TA 3GVAA 5HLGA 3CJNA 4HDUA 3M7GA 3DEUA 1U5TC 4O3MA 5LGUA 2A5YB 1SD7A 3ABUA 3GFMA 2ZBKA 4KMFA 2BV6A 4CDGA 4ZZLA 4S05A 3L9FA 4ESJA 1I5ZA 2XKPA 4Q47A 1Z6RA 2ZJ2A 3FM3A 1HSTA 5FFZA 1R58A 1FBSA 3V7RA 1GXPA 3K0LA 1USTA 4KMUX 1UCRA 3GZ5A 1FY7A 5BQTA 3G73A 4LG0A 1BIAA 3KP5A 4LLGF 3FMRA 1EV7A 2Z3YA 1B1BA 4DNCA 2VC0A 4G94A 1XN7A 2JRTA 3VFZA 2WWYA 3EUHA 2GWRA 1S7OA 1IXSB 5DCFA 3M8FA 2Z33A 2KRFA 4RGUA 2DU9A 5K1YA 3FZVA 5E17F 5A2QZ 5L3DA 1JGSA 4OMYA 4LB5A 1XD7A 3WODF 4IF4A 5D6EA 1YYVA 3KP4A 1R7JA 2F5EA 2VONA 2O8XA 2OA4A 3J80K 3ELKA 2LDUA 4ASNA 3G3ZA 4PZJA 1Y0UA 2H6CA 1QBJA 3LFKA 4RAYA 2DPUA 3P9KA 4KA4A 1DP7P 3TOAA 5ILUA 3I58A 1ZREA 1QGPA 1S3JA 1O3QA 4GCVA 4BNCA 2NS0A 1STZA 2HFHA 2FQ3A 4XLPF 4A0ZA 5ILVA 2BEOA 5DDGA 2HQRA 5E1XA 2EV6A 3E3VA 1LDKB 4P96A 2Q0OA 1IF1A 1T98A 1K78A 3TO9A 5L3CA 2ZKZA 1USSA 1IRFA 2FSWA 1JXSA 1QZZA 1MJAA 4O6JA 1Z7UA 3HYIA 4HW0A 1B9NA 3T8RA 2M87A 1OPCA 3PQKA 2OQGA 4HLXA 2BGCA 5LRSA 3RKWA 3F6OA 2W85A 2BBYA 4JBAA 1H0MA 3HSFA 4P5OA 1XMAA 1NHAA 2DT5A 4KICA 3E5UA 2F5FA 4KFCA 2ADUA 2XUBA 1KA8A 1AWCA 3RTRA 3KP7A 5FLXZ 3KZYA 4L9TA 4OINF 2E7WA 1K6OA 5ERIA 1X3UA 2ZMEB 3KLOA 3V8KA 3JTHA 3F22A 1G3YA 2DQRA 1KU3A 3K1MA 2ACJA 4M9ZA 3MEXA 1ZH5A 5IT3A 3R60A 5HDNA 4EJVA 3KP2A 2PMUA 2UXNA 2YX7A 4HF2A 3LA7A 2D45A 1JHFA 1IW7F 2IPQX 1XGMA 5L3FA 2WC2A 4FT8A 5DYMA 3QPTA 3VODA 3CUQB 2OAZA 4KNYA 3TDUC 2HKOA 4Q48A 4EJUA 5D5XB 2E7XA 5K5RA 2CFXA 1G3WA 3E97A 2VBWA 4U88A 1AOYA 2F5DA 3KEQA 2PLYA 1I1GA 1FC3A 3KZZA 2ZNZA 4B8XA 3RJPA 1BI1A 2NAZA 3J81K 3W6KB 2V9VA 1RUOA 1K79A 5EEGA 5J8CA 4N0BA 3DPLC 4M6YA 2XHKA 3F6VA 4JQFA 1EH8A 2QBYA 1VTNC 3IWFA 3U9GA 3C18A 1MD0A 1BM9A 2EV5A 2DTRA 2XAHA 2FEZA 3KEOA 1EH7A 1WWXA 2KJCA 1DUXC 1OKRA 1O7LA 3IL2A 4G9YA 2EFPA 4UV9A 2HR3A 4YG2F 4Q4ZF 1ODDA 3HSRA 2LNBA 4GYGA 1ZGAA 3K9TA 2Q8KA 4UNOA 5DD8A 4A2UA 3MWMA 2FF4A 5FD5A 4S04A 2D2WA 3K2ZA 5JFRA 2GQQA 2A07F 2YSRA 1BN5A 1OYWA 3GFIA 3TDZC 4AVPA 4L9VA 2IJLA 5DCMA 1F4KA 3O6BB 1TBXA 1BJAA 3BPXA 1OYYA 1H9GA 5D8LB 1J5YA 3HOTA 2HQNA 4UHTA 2F2EA 3BJOA 3F8NA 4M72A 4EM0B 1XCBA 2ELHA 1I6XA 4EJTA 4OIQF 5ICCA 4M9XA 4G6QA 3I0TA 1HW1A 2PEXA 3TQNA 1W5TA 4M71A 4AIHA 2KIMA 2NYXA 3V7SA 1YW7A 4CXFA 1BI2A 2JPBA 1KQ0A 2IRFG 4LG0B 1TQIA 5ICEA 4MNUA 5H6QA 4BXUA 3LQRA 4ESBA 1BC8C 4RS8A 2VN2A 1W7PD 1T6SA 5JHUA 3RPUA 2STWA 2VBZA 5TRDA 1IZ1A 4PGGA 5HLIA 4G6DA 4M6XA 1CF7B 2P5VA 5HDKA 2P7CB 2EV0A 3R61A 4MTDA 5JVTA 2LF8A 2QM3A 4LK0F 2VBYA 5HOOA 3OOPA 2CYYA 1B59A 1B4AA 1XGSA 1IN6A 4P9UA 4OIOF 3WU1B 3O3KA 3I59B 2K7LA 1DDNA 1B9MA 3SZPA 1J75A 5HS7A 3J80Z 1REPC 2ZCWA 1Z9CA 2XGXA 4IRIA 1SAXA 2BYVE 3GXOA 3NRVA 4Q5SF 1V4RA 1S6LA 1IAWA 1H9TA 1TNSA 3BP8A 4AIJA 4BHBA 3EYYA 5LGNA 2AS5F 1SD6A 3GUDA 1I1SA 2K02A 3GW2A 4IXAA 4R8HA 2O61A 2NNNA 1U6GA 4A5NA 3LA3A 5LRRA 3QU3A 2V79A 2FBIA 4U7BA 4WWCA 5E1ZB 2GIVA 2P5KA 1U2WA 1FLIA 3KP6A 3V8LA 4LGWA 1FP1D 2PI0A 1DPUA 1K78B 3M1EA 4AIKA 1R5HA 3WE3A 1DPRA 2QVOA 1LEBA 4TV7A 1QZYA 3ZP5A 1J9IA 5DD4A 4RAZA 1ZG1A 3HHHA 4CHUA 5J6XA 4IJAA 5H20A 4XBFA 1A04A 1MDMB 3IWZA 1YTYA 4PDKA 1FYMA 4RGXA 3P9CA 3ZMTA 1KQ8A 5IT9K 4WF2A 5CYVA 2V6CA 5KK1A 2IP2A 1E2XA 1ZARA 2C6YA 2VT3A 2LF7A 2BE5F 4P55A 4BYYA 3CLOA 5LLQA 1YO5C 2PFBA 3DQVC 3EQLF 4WXCA 5K5OA 1G3TA 1HBXG 1YQAA 4I0AA 3TO7A 3E5XA 5LHGA 2VE9A 1IN4A 3T0YA 1T38A 3CO7C 2TDXA 3F3XA 3JSPA 4HX4A 2W84A 3ZN1A 2VT2A 3FXUA 2F5CA 3ZMSA 5E8IA 3T1BA 4I0BA 5AONA 2OZUA 1RIOH 4NQWA 2DAOA 2RC4A 1XSDA 1MZBA 3JAMK 1ONVA 1TQMA 3JW4A 3OV8A 2FU4A 1ON1A 3E6CC 2P4WA 3KETA 3J81Z 2MLKA 1ZLJA 1R23A 3Q9VA 4KDPA 1P4AA 3KLNA 1EH6A 5LEKA 3CDHA 2FXAA 3U1DA 2VBXA 2GXBA 4HF0A 5E8GA 3COAC 4IRHA 2G7UA 2XAQA 5JI6A 3HSEA 3ERED 1P2FA 3I4PA 2OZ6A 2QBYB 4U0VA 1FSHA 2ISYA 2EJRA 2Z5UA 3V7CA 5BPIA 4IHSA 5DEQA 4R79A 1J59A 3EETA 2DK5A 3Q9SA 4OOIA 3RI4A 4HQMA 3WGIA 4CGZA 3N4MA 3D0SA 5D6FA 1SFEA 4M9SA 3M9AA 1HKQA 1XGNA 5BS6A 3RDIA 1XCVA 2P7VB 3PQJA 1XGOA 3HRSA 3Q5FA 4ZYGA 3F21A 2W24A 1O57A 2FOKA 2IA2A 4ENMA 1LVAA 3HRTA 1FBQA 1B6AA 2IVMA 1TW2A 4PCQA 1T0FA 4GXOA 1U78A 1SMYF 2XROA 1C0WA 4HDVA 3FXQA 2AXLA 1KU7A 3BWGA 1U5TB 2NNYA 1IUYA 3GF2A 3SZTA 2A68F 1P4WA 3FX3A 4WK8F 1KQ9A 5EEHA 3J7AO 2VOOA 3ZMZA 2OD5A 1FYKA 3I5UA 1R1VA 4A0YA 1Z91A 4U7DA 1WRJA 4LLLA 2MLGA 1W7PA 2M1BA 3HRMA 3GFJA 2DFIA 2PG4A 4ZYEA 1FP2A 3TGNA 2WTEA 1LEAA 1XDUA 5DUKA 2R7FA 1W4MA 4NHJA 3ECOA 3FMQA 4RGSA 1E17A 2OBPA 3L7WA 3HHGA 1G3SA 2V1XA 2VC1A 3TOBA 2DO7A 1OYIA 4RB1A 2MH9A 3F8BA 1QPMA 2VOPA 3GFLA 3MCZA 2OU2A 2EWNA 4JK1X 3C3WA 2IW5A 2LKPA 2EB7A 4I02A 3GEZA 4ENKA 4BAYA 3C1DA 3BY6A 2CO5A 3RIRA 4OIRF 3WU0A 2KIUA 4UVAA 4HQEA 3RYPA 4UVBA 5KVRA 4EM1A 4HV5A 4BHCA 1PP8F 1F5TA 2GZWA 3LA2A 3H92A 2QUFA 4ENNA 5CLSA 1FOKA 2O03A 4OU0A 3RKYA 1R36A 2RKHA 1YG2A 3F8CA 1PP7U 1J2XA 5LHHA 1D3YA 2VE8A 1HW5A 2RN7A 2O6GE 3ZN0A 3WTXC 5L3BA 2QENA 4E70A 4OMZA 3E5QA 2JZYA 4HF1A 5AIPA 3FM5A 5CVRA 5CVIA 2A3SA 2RQPA 2H6BA 1HXDA 2HTSA 3F72A 4RB2C 2L4AA 4KN4X 3CTAA 6PAXA 1IN8A 5FO5A 3SXYA 3QAHA 4G7ZF 4LB6B 1ZRDA 4ESFA 4RB3C 1YIOA 3DP7A 4IVNA 4UVCA 2HOEA 2J5PA 4UUVA 3VEPA 4L5JA 3IC7A 3HOSA 4L9JA 4YFXF 1TLHB 1LDJA 5LBQA 3LSTA 3WTTC 1UFMA 1MJ9A 3IKTA 1G6NA 1PUEE 3I71A 4HX7A 5E1WA 4I7HA 5LHIA 3ECHA 3REOA 5AIQA 4EVIA 4YIFA 4I01A 3GZ6A 1LQ1A 3DV8A 1IN7A 1OMIA 4NB5A 3L2CA 2R3SA 2YX4A 2XKOA 4HZFA 4ON0A 5D5UB 2VXZA 1IRGA 4LK1F 3GLXA 2MD5A 1KYWA 1TNTA 2IA0A 1IXCA 4ZZDA 1SD4A 4YFKF 4WX9A 1GXQA 3JAMZ 2YR2A 1KGSA 2RNJA 1ZLKA 1KYZA 1L0OC 3N97A 4ZYHA 4WXDA 3D5LA 2DW4A
chains in the Genus database with same CATH superfamily
3H36A 2B9SA 2CQ7A 2EFOA 2RQQA 3LMMA 3B6CA 3S15J 5B66C 4WXHA 3LAJA 2HKXA 3F8FA 3NEUA 1F36A 3R0JA 1Q1HA 3OYGA 2L7FP 5F0FA 3RSNA 4MFEA 3IRQA 1R9TJ 3ASNH 4BUPA 1S29A 3JRCA 3S2WA 3IV5A 1HDDC 2ZSHB 1NK3P 2BXYA 2MBFA 2L3DA 2G0EA 3S8PA 2E1NA 2XRLA 4J00A 3ULQB 4XRFA 3MN2A 4IHWA 3ZQLA 2HU9A 2QA4I 5TJJA 4KN7X 3LSHA 4I2OA 3WHBA 2DA3A 3CUQA 2M45A 2L02A 4A3FJ 1ACIA 1E3OC 1Y0NA 4IO9F 3OS2A 1GV2A 4XICA 1QVUA 2D1VA 3QWLA 1R1UA 2A61A 1HF0A 1FSEA 3A03A 2H8WA 3EUAA 3BCAA 3NQOA 2STTA 3TEDA 1WPKA 2M5WA 5L3EA 4KIFA 3OYDA 1IRZA 3WTWC 4B4CA 3QP6A 2EFQA 2JPCA 2R7WA 1Z1DA 1H8AC 3MD2A 4CYCA 2R93J 2R7UA 3OR1C 4D9JA 4XLNF 4Y17A 3QOEA 2R7DA 4HV6A 2OV7A 4CCLA 3LWFA 2GA2A 4BQQA 3GWZA 4Z2YA 2IGOA 5DM6F 1O3RA 1BC7C 3Q0VA 3L09A 2KL4A 3BZ6A 2ZJRF 2NVUB 4PJMA 2JA7J 2VODA 2K86A 3R0AA 4BQAA 3PO2J 5D4SA 4YFNF 4FX4A 1ZGJA 2V4JC 3BG7A 1PVEA 3BR3A 3DLAA 3ABLH 3F8MA 2VIXA 2CUZA 3CCMI 2DK8A 2M0CA 2L4MA 2JTVA 1D0YA 3GTMJ 5GADJ 5CVJA 3JRBA 3HOYJ 2M2EA 1I50J 1V5FA 2XGDA 2DFHA 5J4VA 1RESA 1P4XA 3SEZA 5FFXA 2V1NA 4DIQA 4Y3OA 1TTYA 4D7NA 5TGTA 4QPQA 2EQRA 3TW7A 4XMYA 5FD6A 2OQRA 3DPTA 3SQNA 1D5VA 2FA5A 3MZYA 1YFHA 5F64A 2HI3A 3GTLJ 1RETA 2ZO4A 5J8FA 1QO0D 3S1NJ 4PGHA 3FK7A 4FASD 3I4MJ 2LOOA 2Q2EA 1FNNA 3M3YJ 5IP9J 2Y69H 4ITVA 1LE8A 4B1RA 3OYKA 2Z99A 2XDVA 5K5QA 5IPAA 2FUG2 3K4NA 2CSOA 4AUXA 4EMSA 4CZCA 1RKTA 1YJWI 3BZKA 2V9KA 3M8EA 3PUBA 2HWVA 2BOLA 2FD5A 4F7ZA 3OOUA 1OFCX 5F1RA 4FTHA 1VQ4I 3JSOA 1Y1WJ 2X4HA 3FMSA 3BG5A 3OS0A 2ZXHA 1H88C 3CO6C 3L2QA 4IZZA 1SMTA 5E3NA 2MABA 1UG2A 2V1DA 1FIPA 4JOMA 1FX7A 5EF6A 3BJAA 4HNTA 2HDCA 1IXRC 2HZDA 2ESNA 2E2HJ 3ROUA 2OTJI 2L9NA 2IS1A 3HTUA 4A3KJ 3ZMUA 2DMPA 2R5ZB 2FNPA 1TC3C 4KUMA 1Z7LA 2NS7A 1XSXA 2Y48A 3I54A 5IP7J 3VYSB 3V8JA 1X1AA 2FBHA 2TRTA 4GYIA 4BXFA 2ZSIB 3S2HJ 3CCYA 3C2BA 2CQKA 4U0WA 2Z2SB 2H09A 2LTPA 3H35A 3U21A 1U8RA 3ZQHA 3ZQFA 4G12A 2A6EF 2H27A 2K4BA 1MMNA 4BEHA 3CUOA 3LAPA 3I53A 3QPHA 4ZJZA 3HOVJ 1MKMA 3H9QA 2Y9ZA 2NXNB 4MO7A 3OYFA 4L18B 2A6TA 2V7FA 3OYEA 2O5RA 3S3NA 1BI3A 2Y9YA 4EGYA 1NH3A 3NAUA 3T8TA 1NG7A 2DI3A 4XLFA 4KT5C 1MGTA 2O0YA 2ZXWH 3QU6A 1A6QA 3UKGA 3F9KA 3IRRA 2DPDA 3JCUC 5ED4A 2BW3B 1HLVA 3SEQA 5CVUA 5JLWA 1Y1VJ 5M3FJ 1PDNC 4F52A 4GGGA 3AG1H 3H3ZA 5DV5A 3QP5A 3CCVI 1Z6TA 5LD2C 4D1QA 2EA4A 3RQ4A 5E3OA 3PIOF 3L00A 3JR9A 4ZTFA 1IV6A 1CF7A 1MJBA 5E3LA 2HYGD 4XLAA 4YIIA 1LPQA 1WGXA 1VQKI 2CW0F 2L0KA 3GX4X 1JKRC 2Z16A 3CUQC 3W2VA 4C3HJ 3JRGA 5CPRB 2LD5A 4JX6A 3MKLA 3MKWB 1M1EB 1G4DA 3EYIA 4MQ9F 5H6RA 3DXJF 2E36A 1V55H 2M4GA 4IHTA 2YU3A 4A0XA 1HW2A 2DOFA 5D5VB 3PM1A 3NARA 3L2UA 1RC9A 3O8HA 4A12A 3I59A 1XB4A 3EDPA 1JE8A 2ZFUA 3SJMA 1VFCA 1X2NA 4G7OF 5E20A 2A6HF 1I27A 2OCCH 4XORA 3BPVA 2MH2A 2XASA 2QZ8A 4ANJA 2HTJA 3LOCA 2DBBA 2KHMA 4M3BA 5ICGA 2VJ5A 2OPTA 1PJRA 4XN3A 1TT5B 1D0XA 1U3EM 3QRFF 3CJTB 5CVVA 2BXZA 2NOJB 4XSZF 3Q0WA 1Y39A 3BTIA 2LRDA 4E7HA 1ETQA 3OIQA 1WQ2A 4HG2A 1OCTC 1ZQ3P 4A69C 4CICA 3P7NA 1D5YA 2Z9OA 1K61A 3PJRA 1FIAA 2KZVA 3KP3A 5HS9A 3BJ6A 1IUFA 2OCEA 2EFNA 4MGRA 2FE3A 2QWWA 4XKBA 1ZRFA 3DCFA 2M8EA 3BC8A 1QNTA 2RNGA 2COMA 4XKVA 2CGPA 2W25A 2MSYA 4AC0A 5BPDA 2L5QA 3PFIA 3I64A 2CS3A 1JTXA 4I98B 4RB0A 1HSJA 3B02A 1TQPA 4N9IA 2RVCA 5IYBJ 1FJLA 5CJ9A 3P9IA 2KJBA 3HUGA 4MHGA 2RDPA 2FNAA 2JT1A 1JKPC 5KAIC 2X6WA 5DS9A 3F23A 2JRMA 4A6EA 2HNHA 4ZYDA 1XSVA 3LSMA 3L2VA 1J0RA 3CCRI 2NVQJ 2P81A 4D5CA 2E2IJ 1WSUA 5DCMB 1AKHA 2ETHA 3LSJA 4C2MJ 2HDDA 1J09A 1WJFA 3TMOA 1ON2A 3WTSC 3S17J 1J7KA 2YPRA 2ESHA 1D8KA 3J7AY 4NC8A 4IKFA 4Y13A 2QSHX 4U0YA 1BR4A 3CDIA 1F1ZA 3W3CA 4KYWA 1FT9A 2HZTA 2W00A 5JVGF 1YW9A 3RZDJ 1HKSA 4FHTA 2FBKA 2HDWA 4LMYA 2F4OB 1ZELA 4NBQA 4BU2A 5C44J 1ZG3A 3BT9A 5DUIA 2QKLB 2MC3A 2VLAA 5BOXA 2QQBA 2XRNA 1S72I 2DTZA 2IBDA 1MDMA 2XPWA 3DFGA 2PMZN 1WH5A 2KQRA 2XAGA 1K7AA 4EM2A 1JJ6C 2M3AA 3RKXA 1T39A 4C2TA 1X4OA 2ISZA 4ZDLA 1LNWA 1XMXA 4G8XA 3BR1A 2BZTA 4CYDA 3HOUJ 3BR0A 4WCGA 2RGVA 2EA2A 2W57A 2XAJA 1P6RA 1MH3A 4HX8A 2X1CA 1RPWA 2EIKH 1X1PA 2J5OA 3MAJA 4UV8A 4QLCU 4MEXF 2HVQA 2JWTA 4LJZF 4HYEA 2CH0A 3VOEA 4XSXF 1RUNA 5HDGA 2HPIA 4NC7A 2HYJA 3K4KA 4A3LJ 2CWEA 2MA3A 2P6TA 3VB2A 4F3QA 3JRHA 2GXAA 1HQCA 2EZHA 2HYFA 5GTHC 1LJ9A 3T5XA 4RLQA 3FDYA 2KIFA 2DA7A 2QQAA 5FRNA 2PJPA 5GP9A 4EJWA 3ISPA 4CO8A 1LKXA 2L7ZA 3ZMDA 1X2MA 3ZQ7A 4UUTA 2F6CA 4QSHA 1O3SA 1YOVB 3HRUA 5K7HA 3WTZA 1HKTA 4L5EA 2L9VA 3WTVC 2JSCA 5ICFA 2IA1A 3GZNB 2JQ7A 4UXNA 4LOCA 2CQXA 3A1YA 5C3EJ 4A6DA 4RAGA 2KMUA 4BL0B 3DWLE 3SFIA 1WHUA 1WI3A 4N9HA 4LLNA 4AVZA 3LSPA 1HOMA 4IOCF 2M4KA 4PSXA 2M7BA 1XDSA 1QVTA 3KCCA 4O5VA 1S9HA 1S8NA 2XGCA 4M3FA 3W6JB 4LFUA 2PN6A 3FHZA 5HVQC 4RGRA 5A2QK 2K85A 4R1HA 4BACA 1YLFA 2UWMA 5LGTA 2E1MC 4M6VA 2KISA 4MQVA 4P9FA 3WU2C 1BW6A 4OWRB 4CYCB 1ZHFA 3DKWA 2CV2A 2XVCA 1A31A 3BDDA 4KJZA 3WTUC 4ZYAA 3ZMVA 1W5SA 2LYCA 4PJLA 3HC7A 4M3EA 5J4YA 3KIOA 3FF5A 1R22A 1ETXA 2MFZA 2R4GA 4B09A 5HS8A 1ZN2A 2NVYJ 3RYRA 3BZCA 1W36C 2Y0MA 1UMQA 4DQ2A 3MZHA 2X6YA 4I09A 1OCCH 2XIGA 4RM3A 2FMLA 5D4RA 1WKMA 1EF4A 1UHMA 3HDDA 2UV1A 2L54A 2K4JA 4BBRJ 2RV8A 1ZGWA 2DA1A 2IGKA 2NRAC 3IHUA 1D8JA 2AXTC 3MFKA 3CJQB 3K69A 4BHPA 1SFUA 3TP0A 3IAM2 3ABTA 5GAHJ 2G9WA 4MFDA 1T56A 4MEYF 2DT6A 1YS6A 1OR7A 3CMYA 1E3HA 5K7FA 3PFYA 1P92A 2ZFWA 2IT0A 4OIPF 4HA8A 2CJJA 5E18F 3B73A 2XAFA 2DXIA 2F4IA 1L3LA 1O3TA 5L3GA 4IRGA 2W48A 1ETVA 2Y75A 3ASOH 1FBUA 1QQIA 1Z67A 2Q2EB 2MD0A 4CZZA 3H3VK 3IKVA 4EV0A 2X51A 4IX7A 3WE2A 1LE8B 1FZPB 2GAUA 1ZG5A 1ZR4A 3SHFA 3G71I 3PNTA 2R7SA 1FYLA 1OCRH 2KIQA 4BY7J 1XS9A 4EJOA 3F0CA 5IT9Z 3JREA 1XC5A 4MIMA 1SFXA 1BR1A 2ZNYA 5M5YJ 2TCTA 3H0GJ 3FXRA 1QZEA 2EK5A 3PO3J 3LQQA 2K27A 3CLQA 4ETSA 1ZYRF 3CC2I 1IN5A 1Q1VA 2I5UA 3K1PA 2E1CA 1U9OA 1CGPA 4PK4A 4FX0A 4A5MA 1B8IA 2L9SA 3K70C 1EJ9A 2CRGA 3U2RA 3QODA 5H2FC 2PQ8A 4X1EA 3QOPA 2JN6A 4ZH4F 3C2HA 1XMKA 3DF8A 1U5TA 1YW8A 3R4KA 3GYHX 1VZ0A 3ML6A 1G59A 3K4LA 1O7FA 2QYOA 4L0ZB 4BBSJ 1RNLA 3S93A 3C7JA 3H5RA 4A3IJ 1LUJB 1WJEA 1FPQA 2B0LA 1JGGA 3WGGA 1D1CA 1SC7A 4L9NA 3HIFA 4H0EA 3E6MA 1UB9A 3ABMH 5JR3A 2Z1DA 5HLHA 1LDDA 3K1NA 4DJAA 3KX2A 4BJTA 4HBLA 4QWQA 4B43A 1X1BA 1ZKGA 2L7KA 1JI8A 1F9NA 2G7HA 3ZGKA 2P8TA 5F6FA 4Y15A 1BBYA 1TW3A 4HOBA 4HPQA 1RRJA 2XF6A 1X1DA 2PBIA 3V4GA 3WGHA 2W82A 4EQQA 3TO6A 3E6DA 5EZGA 5FLXK 1ZRCA 3FHNA 2CV0A 3MQ0A 1MBKA 2HGCA 2ZMEA 4NQWB 4KIGA 2VJJA 3U1KA 4HAMA 2CUEA 2M30A 4IHYA 1ENHA 3S1QJ 4E7SA 4M74A 4QPOA 5BMZA 4HSTA 3M1CA 4ZC3A 1YX5A 2WB1A 2K9NA 1S7AA 1ZAOA 2WV1A 2NVTJ 2R7VA 2N8GA 4CCOA 4NUBA 2FX0A 3KPHA 4C9YA 5B1BH 2D1HA 1YITI 1GDTA 1WI9A 2PMHA 3DU5A 1JJ8C 4ENJA 4GDFA 3FXLA 1IDZA 3K4CA 2UXXA 1LFUP 4LITA 1GHCA 1ETYA 2V1UA 4HSRA 1R5GA 1I3AA 2VXDA 2JA6J 1G8XA 4AD9A 3BOQA 4ZDOA 1Y8QB 2PMZA 4IPAA 1BIBA 2GXGA 3VWBA 3OMYA 5LEJA 3DBLB 5D8KB 2XF5A 2VPRA 2X0LA 1R00A 1QHGA 2JJ7A 4I6ZA 1S7EA 3IP4B 3BTJA 1LB2A 2NOGA 3E0JB 2HVRA 5JHFA 5D5WB 1SEUA 1ZR2A 1SVMA 1PUFA 1B72B 2IS4A 1FWZA 2JUCA 2HEOA 3PNYA 4Y52J 3JTGA 1MMSA 4GO1A 4G6TB 1H89C 2O7OA 2DQLA 2V26A 1GVJA 1ULYA 2XV4S 2UZKA 2FRHA 3W2AA 3SFZA 2A69F 1FTTA 3FWEA 3A0HC 3E6BA 3KE2A 5CQGA 4N4OB 3AAFA 2EZKA 4K2EA 5EG0A 1A35A 3GO5A 3H3UA 5FGMA 3QYFA 3EPZA 2VJIA 2DLLA 2KKOA 3FK6A 4M73A 3E1SA 3WTYC 3BROA 3JRFA 3OYBA 4PJ0C 2I8DA 4EGZA 1V3FA 2H94A 1KU2A 1RI7A 2P5LC 3HUGB 5J3LA 1R71A 2ZXJA 2VJ4A 1OR7C 4N4NB 1HCRA 1QU3A 1U0JA 4AWXB 2AQFA 2F5VA 1JHHA 1X3ZB 2LBFA 3O2PE 3HJEA 2L01A 5ILSA 1UHWA 1DU0A 2P6SA 1OCPA 1BI0A 3S32A 3LSKA 1SD5A 4LD5A 5F0HA 4E7KA 3AL0C 3OL3A 3CD6I 1E3PA 2VKVA 1T2KA 2KRCA 1RZ4A 4G7HF 2QLZA 3FXMA 1SFKA 3TKYA 3HTSB 1KU9A 2LSOA 3RPQA 1BOAA 1VQOI 3KFWX 4Y33A 4D0PA 4HLYA 4L5IA 2VKEA 1Z05A 3R6SA 2HS5A 2ID3A 5HNFA 2I10A 4OAYA 2GA1A 2XAUA 1LVKA 3H9GA 1W7PB 2MG4A 1A5JA 2O3FA 3WG9A 3HPHA 3IH4A 4MTEA 4L0YB 1YS7A 4KIBA 4BH9A 2CG4A 2QQ9A 1APLC 5FB2A 2IAIA 3CCEI 2FMYA 3H0DA 2EFWA 2WV0A 1R1TA 1QRYA 3CJNA 3GVAA 5HLGA 4BE0A 3AFHA 4HDUA 4ZTJA 4HNUA 3CCUI 3M7GA 3DEUA 3FXKA 3LFUA 1U5TC 3TBIA 4O3MA 3QPSA 5LGUA 2A5YB 2CMPA 1SD7A 1XG1A 3K4JA 5EGOA 2GBYA 5J47A 3ABUA 1P9QC 3GFMA 4E7JA 1E0EA 3UNGC 2ZBKA 1Z3YA 3QPLA 2EIJH 5F27A 3BG6A 4C3JJ 4KMFA 2BV6A 4DZPA 4CDGA 4BDZA 4ZZLA 4B47A 3L9FA 4S05A 4B3XA 4ESJA 2LK2A 2L9RA 1I5ZA 2UUZA 2XKPA 4Q47A 2XB5A 3V42A 3TW6A 1Z6RA 4DZJA 2ZJ2A 2IGNA 5B5EC 3FM3A 3S3MA 1WH7A 1HSTA 5FFZA 4II3A 1R58A 1FBSA 3HKZN 3TP3A 3V7RA 2R5YA 1GXPA 3K0LA 4B48A 1USTA 2LFBA 4KMUX 1UCRA 2K40A 3GZ5A 1FY7A 2ZMEC 5BQTA 4JX5A 3G73A 4LG0A 1BIAA 1QHHD 2AQEA 4UUSA 3KP5A 2CFOA 4LLGF 2XGEA 3JRAA 1OCOH 3FMRA 1EV7A 2Z3YA 3FKJA 4IQ4A 1B1BA 5GPCA 5B3SH 1X4PA 2QKMB 4DNCA 2VC0A 5FJ8J 4G94A 1XN7A 4J01A 2JRTA 3VFZA 2XB0X 2WWYA 3EUHA 2DMTA 2LC2A 3CMAI 2X6XA 2GWRA 1S7OA 1IXSB 3IH3A 5DCFA 3M8FA 1MNDA 2Z33A 4IHXA 2KRFA 4XN0A 3L2RA 2R7QA 1JTYA 4RGUA 1YRNA 2DU9A 5K1YA 2EZIA 1TP4A 3W2WA 2LY1A 3A2KA 2WADA 3TL4X 3A01B 3G2BA 1UAAA 3FZVA 5E17F 5A2QZ 3AG4H 5L3DA 2KLOA 4XNFA 1JGSA 4OMYA 4LB5A 3P5JA 1MMDA 1XD7A 3WODF 3G1LA 2F4MB 2DJIA 4Y4RA 4IF4A 3GCMA 3RPUD 1VQPI 5D6EA 1YYVA 2QSFX 1Y56A 3KP4A 3DKYA 1R7JA 2F5EA 2VONA 2O8XA 2OA4A 2X1EA 3J80K 2DN0A 1D0ZA 3ELKA 2LG4A 1WJDA 3GTPJ 2LDUA 4ASNA 2A05A 3G3ZA 4LIUA 4PZJA 1Y0UA 2D5VA 2CQNA 2H6CA 1QBJA 3LFKA 4XOTA 3M4OJ 2GOMA 4F91B 4RAYA 2DPUA 1K6YA 3P9KA 4KA4A 1DP7P 3DPUA 3TOAA 2DT7B 1SANA 2ELJA 5ILUA 2VKHA 5FLMJ 3I58A 1ZREA 1QGPA 1S3JA 4NDLA 2LH9A 4XONA 2COBA 1O3QA 4GCVA 2JMWA 2IEKA 4UY8I 4BNCA 3CESA 2NS0A 4BJ6C 5C4XJ 1X1CA 3AL0B 1STZA 2HFHA 2VQCA 1MH4A 2FQ3A 4XLPF 4A0ZA 2KZGA 5ILVA 1U8BA 1XTAA 4B44A 2BEOA 5DDGA 2HQRA 5E1XA 2EV6A 3E3VA 1MNMC 3NWTA 3I55I 3BLYA 1LDKB 1OJLA 2Q0OA 4P96A 1IF1A 3S1MJ 1T98A 1BA5A 2LY2A 2R0QC 2IXSA 1R4MB 4YELA 1IG7A 2V6EA 2QCOA 1K78A 3TO9A 1JUMA 1WCMJ 3GBGA 5L3CA 5IYDJ 4V2GA 3CMMA 2ZKZA 1USSA 1IRFA 1DGRM 1YE9A 2FSWA 1QZZA 4PUSA 1JXSA 1FTZA 2W1OA 1MJAA 4O6JA 2VUMJ 2RAEA 1Z7UA 5EDNA 1SVLA 3HYIA 4HW0A 4DYQA 1B9NA 3CP8A 3T8RA 2M87A 1OPCA 2FJ1A 3PQKA 5FKNA 1CQTA 1WJAA 2OQGA 2KPMA 4HLXA 1KONA 3ZXSA 2BGCA 5LRSA 4E7LA 3RKWA 4CCJA 2R7TA 3F6OA 3Q0UA 4ZDPA 2W85A 1TWHJ 2BBYA 4JBAA 2BY0A 1YHQI 1TWAJ 1H0MA 3HSFA 4P5OA 4CCNA 1XMAA 1NHAA 2DT5A 2YU9J 2K9MA 2DYRH 4KICA 3RQIA 3E5UA 2F5FA 4KFCA 1Z3XA 2ADUA 2XUBA 3GLLA 3LSGA 1KA8A 1TWGJ 1IDYA 1AWCA 3RTRA 2H8RA 3KP7A 3BQYA 5FLXZ 3KZYA 4L9TA 4M3GA 2E5ZA 2X9DA 1ETWA 4OINF 3ZQQA 2E7WA 2DFFA 1K6OA 5ERIA 2R5ZA 1X3UA 2ZMEB 4AIDA 3KLOA 3V8KA 3JTHA 4QTRA 3F22A 2ZC2A 1G3YA 2DQRA 5IOZA 1KU3A 3K1MA 2ACJA 1F43A 5M3MJ 2X48A 4M9ZA 3MEXA 4PJJA 3L2WA 1ZH5A 4BGDA 3PSFA 5IT3A 3R60A 5HDNA 4D5FA 4EJVA 3KP2A 2PMUA 5FKMA 2UXNA 2YX7A 3VSKA 5K7ZA 4HF2A 3LA7A 2D45A 1JHFA 2E35A 1IW7F 2Y30A 2IS2A 2IPQX 1XGMA 5L3FA 4BQNA 4C2UA 4JP0A 2O8KA 2KP6A 2WC2A 4FT8A 4DBRA 3FIWA 5DYMA 4IOAF 3QPTA 4CCKA 3VODA 3EUHC 3CUQB 3MZ8A 2OAZA 1VQLI 1VQ5I 4KNYA 2BVLA 3VPRA 3TDUC 2E60A 2HKOA 2MGQA 1K4TA 3BG3A 3LSIA 4H4KC 2K5CA 4Q48A 4EJUA 3K4BA 5D5XB 2E7XA 4OAZA 3K2AA 5K5RA 2CFXA 1G3WA 3E97A 2VBWA 3KEYA 2XC7A 1MIJA 4U88A 1AOYA 2F5DA 3KEQA 3CF5F 1RKWA 1I1GA 2PLYA 1TWFJ 1FC3A 3PSIA 4S0HB 3HOZJ 1LFBA 3KZZA 2ZNZA 4B8XA 1PUFB 3RJPA 1BI1A 1AU7A 2ME0A 2NAZA 3J81K 3W6KB 3OYNA 2V9VA 3K7AJ 1RUOA 5C4JJ 3DTEA 1K79A 3I56I 5EEGA 5J8CA 4N0BA 3HOWJ 4XRSG 2JVGA 4RBOA 3DPLC 3VYTB 4M6YA 2HXOA 3DKXA 5EG0B 3PNVA 1VI0A 3N05A 2XHKA 3HKZA 3F6VA 4JQFA 4CH7A 3GTQJ 1EH8A 2E34A 2VASA 2QBYA 1VTNC 1K83J 3MMYB 3DLLF 1VQ6I 4UB6C 1NTCA 3IWFA 3U9GA 1POGA 2BHYA 3C18A 1XX5A 1MD0A 3CCQI 2JA5J 4BXXJ 1BM9A 4AM3A 2EV5A 1Z0XA 4XLCA 2DTRA 2XAHA 3OWTA 2B7EA 2FEZA 3QYBA 1MNEA 3KEOA 1EH7A 3S14J 1JKQC 4QIWN 2LBFB 1WWXA 2KJCA 3BR6A 1DUXC 1OKRA 3ZQGA 2JA8J 1O7LA 5HODA 1MBJA 4G9YA 2EFPA 4UV9A 3IL2A 2DYSH 2ME6A 2HR3A 4YG2F 4Q4ZF 1WVRA 2WAEA 4U87A 3BQZA 1ODDA 3HSRA 2LNBA 2EILH 4W97A 4GYGA 4ABZA 4YRVA 1ZGAA 2DDAA 2JUGA 3K9TA 2Q8KA 4UNOA 1MMAA 5DD8A 4A2UA 3MWMA 4MLOA 4XRSA 2FF4A 5FD5A 2HPMA 4RA2A 2HOSA 4S04A 2WAQN 2D2WA 3WG7H 3K2ZA 5JFRA 2GQQA 1IV8A 2Q1ZB 2VKDA 2A07F 2YSRA 4PJNA 1BN5A 2YS9A 1OYWA 3BTCA 3BCBA 3OYMA 4XR6A 3GFIA 1VQ7I 3TDZC 5F0CA 4AVPA 4L9VA 2IJLA 5DCMA 1F4KA 3O6BB 2KT0A 1TBXA 1BJAA 1VQ8I 3BPXA 1U9NA 1OYYA 1H9GA 3S16J 2M9HA 5D8LB 1J5YA 3HOTA 1I6HJ 2E71A 2HQNA 4II2A 2X6OA 4UHTA 5EGOB 4RAFA 2WBMA 1DQUA 3SDBA 2F2EA 4FETA 3ZOBA 3GTGJ 3SDGA 2VB6A 4DYRA 3I4NJ 3BJOA 2VQLA 3F8NA 2DODA 4M72A 3DBRB 4EM0B 4BE1A 3KYCB 1XCBA 1IJWC 2ELHA 1I6XA 2P0WA 4EJTA 4OIQF 4A3JJ 5ICCA 1NG6A 3D5SC 5KCMA 4M9XA 3HGYA 4G6QA 3QYEA 1R6RA 1HA8A 4BEHB 2ICWG 4IHVA 3I0TA 1HW1A 1ETKA 4F92B 3CCLI 2R7XA 3CF2A 2PEXA 3TQNA 2M34A 2EBIA 1W5TA 4M71A 2Y2ZA 5DM7F 4AIHA 2R5YB 2KIMA 2NYXA 3V7SA 3ZQIA 4RDUA 5GPAA 2V9PA 1YW7A 4CXFA 1BI2A 2JPBA 1KQ0A 2E1OA 4XLHA 2IRFG 2PJRA 1T08B 1ZK8A 4AYBN 2CU7A 4LG0B 5FKOA 1TQIA 5ICEA 4MNUA 3OYLA 5H6QA 1IC8A 3MVPA 4BXUA 3LQRA 4ESBA 3EUKL 1BC8C 4RS8A 1N77A 2QEXI 2VN2A 1W7PD 4PFPA 3A0BC 1T6SA 5JHUA 3RPUA 2STWA 2VBZA 1JT6A 2JA2A 3H5AA 1FMWA 2H1LA 2W4SA 1IZ1A 1Y6IA 4JYKA 4PGGA 5TRDA 1MSEC 2ID6A 5HLIA 3PUFA 4G6DA 4M6XA 1CF7B 2P5VA 4V2FA 2OF7A 5HDKA 2P7CB 2EV0A 4IL6C 4BJ5C 3R61A 2YUSA 1VF9A 4MTDA 5JVTA 2LF8A 1GV5A 2QM3A 4LK0F 2VBYA 5HOOA 3OOPA 2E1MB 5J1YA 1WZ2A 2CYYA 2HQAA 1B59A 1B4AA 3OSFA 1XGSA 3J7YJ 1IN6A 3S3OA 1EA3A 4P9UA 4OIOF 3WU1B 1HDPA 1T8IA 3ZR8X 1BJZA 3HGGA 2ZXIA 3O3KA 3I59B 2K7LA 1DDNA 3JRDA 1B9MA 3SZPA 1J75A 1WJBA 5HS7A 3J80Z 1P7IA 1REPC 2ZCWA 2K9QA 4KITB 1Z9CA 3HG9A 5IYCJ 2XGXA 3AKZA 1Z77A 2HQ5A 3H9JA 4IRIA 5LFAA 1SAXA 2BYVE 3GXOA 3NRVA 3OIPA 4Q5SF 1V4RA 1S6LA 3RCOA 1IAWA 4CSWA 2ZB9A 2EZLA 1H9TA 1TNSA 3BP8A 2KDZA 4AIJA 4BHBA 3EYYA 5LGNA 2AS5F 1SD6A 5CKTA 3GUDA 1RR8C 1BR2A 1W5CC 4PSWA 3D5RC 1OCZH 2BY1A 1I1SA 3A4CA 2K02A 1WFXA 3GW2A 4IXAA 2K3FA 4R8HA 1JKOC 1W1WE 5IY5H 1VNDA 4IEJA 3CCSI 4A93J 2O61A 2NNNA 1U6GA 2XPVA 1P7JA 2X85A 4NC6A 4A5NA 1JUSA 2L7MP 4FE4A 3LA3A 3AG2H 5LRRA 3QU3A 2V79A 2GLOA 2FBIA 2QSGX 5J40A 3KYLA 3OYIA 4U7BA 4WWCA 1BOBA 4LG3A 5CQEA 5E1ZB 1G2HA 2GIVA 2P5KA 1ZTRA 2LKSA 2RREA 2E2JJ 1U2WA 2ELKA 2K9LA 2Y0SN 1FLIA 1AKHB 3KP6A 4BQOA 3V8LA 4LGWA 1FP1D 2PI0A 1DPUA 1K78B 3M1EA 4AIKA 1R5HA 4V19K 3WE3A 1DPRA 2CV1A 1DU6A 2QVOA 2M7AA 1LEBA 4TV7A 2HOAA 1QZYA 5FLVA 3ZP5A 1J9IA 3IUOA 5DD4A 4RAZA 1ZG1A 2XSJC 3HHHA 4CHUA 5EYRA 5GAEJ 1AA7A 5J6XA 4IJAA 3BR2A 5H20A 5J1UA 1TL8A 3GTOJ 4XBFA 1A04A 1MDMB 3IWZA 1PYVA 1YTYA 1X3WB 4PDKA 1FYMA 2EH3A 4RGXA 3P9CA 3ZMTA 2ECCA 4E4HA 1KQ8A 4KISA 3RKQA 4WF2A 4XOPA 5CYVA 2V6CA 5KK1A 5IT9K 5BNGA 3CJRB 3G1OA 4XL9A 2IP2A 3B6AA 1UELB 1E2XA 1ZARA 2C6YA 2VT3A 2LF7A 4X0GA 1EKEA 2BE5F 1MSFC 4P55A 1MMGA 4BE2A 4BYYA 3CLOA 5LLQA 1YO5C 2PFBA 1X58A 3DQVC 1FOYA 2OC6A 2Y31A 3EQLF 4WXCA 5K5OA 3G4SI 1G3TA 2IS6A 1FOXA 2VI6A 1HBXG 2KRHA 1YQAA 2DA4A 4I0AA 3TO7A 4A3EJ 3E5XA 5LHGA 2VE9A 4FQGA 3AG3H 1IN4A 3T0YA 3BG9A 3OSGA 4UB8C 1HC8A 3O8GA 1T38A 3CO7C 1YI2I 5F08A 2TDXA 3F3XA 1JT0A 2XSDC 3I9V2 1A36A 5KHDA 3DEWA 3JSPA 2DA6A 2CW7A 4HX4A 2HOTA 2W84A 1VQ9I 3ZN1A 2VT2A 5M5WJ 4BS9A 3FXUA 2CW8A 5GTIC 2F5CA 1TWCJ 3ZMSA 5E8IA 2WAQA 3T1BA 4I0BA 5AONA 1A6IA 1VQMI 2OZUA 3Q3SA 1RIOH 4NNJA 3DEEA 4NQWA 2DAOA 2RC4A 2MYSA 4YIRX 2KFDA 2BVMA 1GVDA 1XSDA 3HXLA 1MZBA 3X2QH 2K3PA 3JAMK 3OS1A 2F48A 1T95A 1ONVA 1ITYA 2DMQA 1UJ8A 1TQMA 3JW4A 3OV8A 2FU4A 1ON1A 4HRIA 4A3BJ 3E6CC 4GFBA 4A3DJ 3ZCOA 2DMUA 2P4WA 3KETA 2MC4A 3J81Z 1FEXA 3FKIJ 2MLKA 3H1CA 1ZLJA 1R49A 3HZJA 3W6VA 1R23A 3CZ6A 3DBHB 3Q9VA 4KDPA 1P4AA 3K4MA 3KLNA 2VL8A 5IP6A 4E7IA 4DBQA 4AU7A 1EH6A 5LEKA 3CDHA 2XF7A 2FXAA 2WAFA 2VBXA 3U1DA 4HF0A 5E8GA 3COAC 2GXBA 5FKLA 3IAS2 2H1KA 5KAFC 4IRHA 2DDBA 3CMEI 1Y8RB 2G7UA 4W1UA 3HBLA 2LREA 2LY9A 2XAQA 5JI6A 3HSEA 3ERED 1P2FA 1W0TA 3I4PA 2OZ6A 2QBYB 1OQYA 4U0VA 1FSHA 2QQ8A 2JVHA 5EEAA 2ISYA 1MBEA 2AHQA 2EJRA 2Z5UA 1ORKA 3I3LA 4AYBA 3V7CA 5BPIA 5HLTA 1B72A 4IHSA 5DEQA 4R79A 4M3DA 1YJNI 2LR8A 3EETA 1S5LC 1J59A 2HVSA 1R4NB 2DK5A 3Q9SA 3OR2C 1V5GA 5E79C 5F1JA 4A3CJ 5FRMA 3GMEA 3S2DJ 4OOIA 4FISA 3VYRB 3OYAA 4HQMA 4LIVA 3RI4A 3WGIA 4CGZA 3OYCA 3UR3C 3N4MA 4J19A 3D0SA 5D6FA 3M8JA 3JRIA 3H5NA 3K10A 1RR7A 4E7ZA 1SFEA 2XPUA 4XQFA 1SFOJ 4M9SA 3M9AA 1HKQA 1XGNA 5BS6A 3RDIA 5FROA 1XCVA 2P7VB 3PQJA 2MW8A 1XGOA 1N25A 2X1DA 3HRSA 1K4SA 3Q5FA 1MBFA 4XKCA 4ZYGA 2WA0A 3VSLA 3F21A 2W24A 1O57A 1YJ9I 2FOKA 2IA2A 4ENMA 1LVAA 3HRTA 1VQNI 1FBQA 1QPIA 1B6AA 2IVMA 1OLTA 3FXJA 1TW2A 2EPFA 9ANTA 4PCQA 2QGUA 4F55A 5GAGJ 2R92J 2WY7Q 1T0FA 1V5EA 3CQZJ 4GXOA 1B8IB 1U78A 2E5NA 3ZRGA 1SMYF 2FQ4A 2XROA 1C0WA 1V54H 4HDVA 3FXQA 2AXLA 1KU7A 5J1RA 3BWGA 3G1MA 3CC4I 1U5TB 2NNYA 4RLFA 1IUYA 3BR5A 3GF2A 3SZTA 2EINH 2A68F 3M07A 1P4WA 2DCEA 3G6EI 2WB1N 3FX3A 4WK8F 5FKKA 4I99C 1KQ9A 2DA2A 5EEHA 3J7AO 4HEA2 2VOOA 4A3GJ 3ZMZA 2OD5A 1FYKA 3I5UA 1N78A 1R1VA 4A0YA 4Z6YA 1Z91A 4U7DA 2W7NA 1WRJA 4LLLA 4I76A 2MLGA 1W7PA 5IOYA 2M1BA 2FOWA 2ECBA 3HRMA 3GFJA 4FCYA 2DFIA 2O9LA 1WJ5A 2PG4A 3OYHA 4ZYEA 1FP2A 3ESWB 3TGNA 2WTEA 1LEAA 4EATA 1QA6A 1XDUA 3MKYB 5DUKA 2R7FA 3E7LA 1W4MA 2ZJQF 2CUJA 2LVSA 4NHJA 2PJRB 2B63J 1O4XA 2R7ZJ 3ECOA 2IGMA 3FMQA 2PX9A 2NS8A 3DTIA 2Y0SA 4C3IJ 1FMVA 1BL0A 3FBNB 2OTLI 4RGSA 1E17A 4A3MJ 3QQAA 3IH2A 2CQQA 1SVOA 2OBPA 3L7WA 3HHGA 1G3SA 2V1XA 4RM2A 2VC1A 3LNQA 2LMDA 5E3MA 3TOBA 3MKZA 2DO7A 2LP0A 3J7ZI 1OYIA 4B3AA 4RB1A 2MH9A 5EJCA 3F8BA 1QPMA 2VOPA 3FBIB 3GFLA 3MCZA 3VDXA 4JX4A 2OU2A 1AHDP 1X19A 1N75A 2EWNA 2BY3A 4JK1X 3C2GA 3C3WA 2IW5A 2LKPA 3KZIC 2EB7A 4I02A 1XPXA 3KYDB 3GEZA 4ENKA 1TT0A 4BAYA 5F04A 3C1DA 2BW3A 3BY6A 1IGNA 4BDYA 1IRXA 4YEJA 2CO5A 3OY9A 3RIRA 3SYTA 4OIRF 2DOEA 3WU0A 2KIUA 2DJNA 4UVAA 3GTJJ 2K9SA 4HQEA 4GRIA 3RYPA 4UVBA 5KVRA 4D7MA 4EM1A 4XLEA 3A01A 4HV5A 4BHCA 3OIOA 2AO9A 1PP8F 1F5TA 4RMNA 3DU6A 1BW5A 2GZWA 3LA2A 3ONQA 1GLNA 1GT0C 5JLXA 4CCMA 3H92A 2QUFA 4ENNA 2NVXJ 5CLSA 1FOKA 3ZPLA 3DTKA 4X6AJ 3S1RJ 2O03A 2R7RA 1MBHA 2DOAA 4OU0A 3RKYA 3HL2A 5B1AH 2R7OA 5M5XJ 3HEFA 1R36A 2RKHA 2BHZA 4P1WA 1ERDA 1YG2A 3F8CA 3ABKH 1MBGA 1PP7U 1J2XA 5LHHA 1D3YA 3CCJI 3D1NI 2VE8A 1HW5A 2RN7A 5DTDA 4BKXA 2O6GE 2M0MA 3ZN0A 2LLKA 1YIJI 3WTXC 1DGWY 5L3BA 2LKXA 2QENA 4XKWA 2VPLA 3PL8A 2GM4A 4E70A 4Y7NJ 4OMZA 3E5QA 2JZYA 2M8GX 4HF1A 3A02A 5AIPA 3FM5A 1I39A 2BY2A 2L2OA 4XM3A 5CVRA 5CVIA 3HB9A 2A3SA 2RQPA 2H6BA 4EEFG 1DP3A 2JK3A 1HXDA 2HTSA 3F72A 3HPGA 4XIDA 4C30A 4RB2C 2L4AA 4KN4X 3LSRA 3CTAA 1W36D 1UZCA 2GOXB 6PAXA 1IN8A 3LL7A 5FO5A 3SXYA 1FOWA 3QAHA 4PFOA 4F93B 2OUMA 4G7ZF 1ETOA 1D1BA 4LB6B 1KZHA 1ZRDA 4ESFA 4RB3C 1YIOA 5HNHA 3DP7A 3K6GA 3VYUB 3WHCA 4IVNA 4DOZA 1IO2A 2GIZA 3FISA 4UVCA 2DMNA 1T0FC 2HOEA 2J5PA 5TISC 2WY8Q 4UUVA 3HOXJ 3VEPA 1UG0A 4L5JA 3RZOJ 3IC7A 3HM5A 4KT6A 3HOSA 4L9JA 4YFXF 3L1PA 1TLHB 1LDJA 5LBQA 3LSTA 3WTTC 1UFMA 1R5ID 1MJ9A 3IKTA 1G6NA 1I3QJ 1YX3A 2E19A 1PUEE 3I71A 4HX7A 2HXIA 4I7HA 5E1WA 5LHIA 3ECHA 3REOA 4BY1J 1Z21A 5AIQA 4EVIA 4YIFA 4I01A 3CDLA 1GUUA 3GZ6A 4IQJA 1LFPA 3FXOA 1LQ1A 2ZJPF 2EIMH 4DW6A 3DV8A 2VQGA 3OYJA 1IN7A 1D1AA 1OMIA 4NB5A 3L2CA 4FE7A 5EZHA 3OL4A 2CUFA 2R3SA 3PIPF 2YX4A 3CP2A 3ZQCA 2XKOA 4HZFA 4HNVA 3BTLA 4ON0A 5D5UB 1SAUA 2VXZA 1JUPA 1NK2P 1WJCA 3NWSA 1IRGA 2QF7A 5KNLA 4UUSB 4LK1F 3K70D 3SZGA 3GLXA 4DGWB 1T33A 4DYCA 2VQHA 2KDOA 2MD5A 2A5WA 1KYWA 1TNTA 3ERMA 2DA5A 2DFEA 4XK4A 4XRMA 1UHSA 3GTKJ 2OJED 2JSPA 1OISA 2IA0A 4E6KG 1MW7A 1IXCA 4ZZDA 1SD4A 3CC7I 4YFKF 4WX9A 1GXQA 1TZLA 3JAMZ 2YR2A 1KGSA 1W0UA 2RNJA 1YRNB 1ZLKA 1KYZA 1L0OC 4CA0A 3N97A 4ZYHA 4WXDA 3D5LA 2DW4A 4CUGA
chains in the Genus database with same CATH topology
2EFOA 4WXHA 3LAJA 2HKXA 3F8FA 3NEUA 3R0JA 1Q1HA 3IRQA 1S29A 3S2WA 2MBFA 2L3DA 2E1NA 3ULQB 4XRFA 5TJJA 4KN7X 4I2OA 3CUQA 2M45A 2L02A 2D1VA 1R1UA 2A61A 1FSEA 3NQOA 2STTA 2M5WA 5L3EA 4KIFA 3WTWC 3QP6A 2EFQA 2JPCA 1Z1DA 4XLNF 4Y17A 2R7DA 4HV6A 3LWFA 2GA2A 3GWZA 4Z2YA 1O3RA 1BC7C 3L09A 3BZ6A 2VODA 2K86A 3R0AA 4BQAA 5D4SA 4YFNF 4FX4A 1ZGJA 3F8MA 2DK8A 2L4MA 2JTVA 5CVJA 1P4XA 5FFXA 1TTYA 5FD6A 2OQRA 3DPTA 3SQNA 1D5VA 2FA5A 3MZYA 1YFHA 5F64A 2ZO4A 5J8FA 1QO0D 4PGHA 2Q2EA 1FNNA 2Z99A 5K5QA 2CSOA 4EMSA 3M8EA 2HWVA 4F7ZA 5F1RA 3JSOA 2X4HA 3FMSA 3CO6C 1SMTA 2V1DA 1FX7A 3BJAA 2HDCA 1IXRC 2ESNA 3ROUA 3HTUA 3ZMUA 2FNPA 4KUMA 1XSXA 2Y48A 3I54A 3V8JA 2FBHA 4GYIA 2CQKA 4U0WA 2H09A 1U8RA 2A6EF 2H27A 2K4BA 3CUOA 3LAPA 3I53A 3QPHA 1MKMA 4L18B 1BI3A 4EGYA 3T8TA 2DI3A 4KT5C 1MGTA 2O0YA 3QU6A 3IRRA 2DPDA 5ED4A 5CVUA 1PDNC 4GGGA 3H3ZA 5DV5A 3QP5A 1Z6TA 2EA4A 3L00A 1CF7A 1MJBA 2HYGD 4YIIA 2CW0F 3GX4X 3CUQC 1G4DA 3EYIA 4MQ9F 5H6RA 3DXJF 4IHTA 2YU3A 4A0XA 1HW2A 5D5VB 4A12A 3I59A 1XB4A 3EDPA 1JE8A 4G7OF 5E20A 2A6HF 1I27A 3BPVA 2MH2A 2XASA 2QZ8A 2HTJA 2DBBA 5ICGA 1U3EM 3QRFF 5CVVA 4XSZF 1WQ2A 4CICA 3P7NA 2Z9OA 3KP3A 5HS9A 3BJ6A 2EFNA 4MGRA 2FE3A 2QWWA 1ZRFA 2M8EA 1QNTA 2COMA 2CGPA 2W25A 5BPDA 3PFIA 3I64A 4I98B 4RB0A 1HSJA 3B02A 1TQPA 4N9IA 2RVCA 5CJ9A 3P9IA 4MHGA 2KJBA 3HUGA 2RDPA 2FNAA 2JT1A 3F23A 4A6EA 4ZYDA 1XSVA 1J0RA 1WSUA 5DCMB 2ETHA 1ON2A 3WTSC 1J7KA 2ESHA 2YPRA 1D8KA 4Y13A 4U0YA 1F1ZA 4KYWA 1FT9A 2HZTA 1YW9A 1HKSA 4FHTA 2FBKA 4LMYA 1ZG3A 5DUIA 2MC3A 5BOXA 2QQBA 2XRNA 1MDMA 3DFGA 2XAGA 1K7AA 4EM2A 3RKXA 1T39A 2ISZA 1LNWA 4G8XA 4CYDA 4WCGA 2RGVA 2EA2A 2W57A 2XAJA 1P6RA 4HX8A 2J5OA 3MAJA 4UV8A 4QLCU 4MEXF 4LJZF 4HYEA 3VOEA 4XSXF 1RUNA 5HDGA 2CWEA 2MA3A 2P6TA 3VB2A 1HQCA 2HYFA 1LJ9A 3T5XA 2KIFA 2QQAA 2PJPA 4EJWA 3ISPA 4CO8A 3ZMDA 3ZQ7A 1O3SA 3HRUA 3WTZA 1HKTA 3WTVC 2JSCA 5ICFA 2IA1A 4UXNA 4A6DA 4N9HA 4LLNA 1XDSA 3KCCA 4O5VA 1S8NA 3W6JB 4LFUA 2PN6A 3FHZA 5HVQC 4RGRA 5A2QK 4R1HA 1YLFA 2UWMA 5LGTA 4MQVA 4P9FA 1ZHFA 3DKWA 2XVCA 3BDDA 3WTUC 3ZMVA 1W5SA 3FF5A 1R22A 5HS8A 4B09A 1ZN2A 3RYRA 2Y0MA 4DQ2A 3MZHA 4I09A 2XIGA 2FMLA 5D4RA 1WKMA 1UHMA 2L54A 2K4JA 2RV8A 2NRAC 3IHUA 1D8JA 3MFKA 3K69A 4BHPA 1SFUA 3ABTA 3ZPLA 2G9WA 4MEYF 1YS6A 1OR7A 1P92A 2ZFWA 2IT0A 4OIPF 4HA8A 5E18F 3B73A 2XAFA 1L3LA 1O3TA 5L3GA 4IRGA 2Y75A 1FBUA 1QQIA 4CZZA 3IKVA 4EV0A 3WE2A 1FZPB 2GAUA 1ZG5A 3SHFA 1FYLA 5IT9Z 4EJOA 1SFXA 2ZNYA 3FXRA 2EK5A 3LQQA 2K27A 4ETSA 1ZYRF 1IN5A 3K1PA 2E1CA 1CGPA 4FX0A 4A5MA 3U2RA 2PQ8A 3QOPA 4ZH4F 1XMKA 3DF8A 1U5TA 1YW8A 3R4KA 3GYHX 3ML6A 1O7FA 2QYOA 4L0ZB 1RNLA 3C7JA 1FPQA 2B0LA 3WGGA 4L9NA 3HIFA 4H0EA 3E6MA 1UB9A 5JR3A 5HLHA 1LDDA 3K1NA 4HBLA 4QWQA 1F9NA 2G7HA 2P8TA 5F6FA 4Y15A 1BBYA 1TW3A 4HOBA 2PBIA 3V4GA 3WGHA 4EQQA 3TO6A 3E6DA 5FLXK 1ZRCA 3MQ0A 2HGCA 2ZMEA 4KIGA 4HAMA 2M30A 4M74A 5BMZA 1S7AA 1ZAOA 2D1HA 1WI9A 2PMHA 4ENJA 2UXXA 1GHCA 2V1UA 1R5GA 4AD9A 3BOQA 4IPAA 1BIBA 2GXGA 5LEJA 5D8KB 2X0LA 1R00A 1LB2A 5D5WB 1FWZA 2HEOA 3JTGA 4GO1A 2DQLA 1GVJA 1ULYA 2XV4S 2UZKA 2FRHA 3SFZA 2A69F 3FWEA 3KE2A 3E6BA 3AAFA 4K2EA 3GO5A 3H3UA 5FGMA 2DLLA 2KKOA 4M73A 3WTYC 3BROA 4EGZA 1V3FA 2H94A 1KU2A 1RI7A 2P5LC 2ZXJA 4AWXB 1JHHA 3O2PE 2L01A 5ILSA 1UHWA 2P6SA 1BI0A 4LD5A 1SD5A 1T2KA 1RZ4A 4G7HF 2QLZA 3TKYA 3HTSB 1KU9A 2LSOA 3RPQA 1BOAA 3KFWX 4D0PA 4HLYA 4L5IA 1Z05A 3R6SA 2HS5A 2GA1A 1W7PB 2O3FA 3WG9A 4MTEA 4L0YB 1YS7A 4KIBA 4BH9A 2CG4A 2QQ9A 5FB2A 2FMYA 2EFWA 2WV0A 1R1TA 3GVAA 5HLGA 3CJNA 4HDUA 3M7GA 3DEUA 1U5TC 4O3MA 5LGUA 2A5YB 1SD7A 3ABUA 3GFMA 2ZBKA 4KMFA 2BV6A 4CDGA 4ZZLA 4S05A 3L9FA 4ESJA 1I5ZA 2XKPA 4Q47A 1Z6RA 2ZJ2A 3FM3A 1HSTA 5FFZA 1R58A 1FBSA 3V7RA 1GXPA 3K0LA 1USTA 4KMUX 1UCRA 3GZ5A 1FY7A 5BQTA 3G73A 4LG0A 1BIAA 3KP5A 4LLGF 3FMRA 1EV7A 2Z3YA 1B1BA 4DNCA 2VC0A 4G94A 1XN7A 2JRTA 3VFZA 2WWYA 3EUHA 2GWRA 1S7OA 1IXSB 5DCFA 3M8FA 2Z33A 2KRFA 4RGUA 2DU9A 5K1YA 3FZVA 5E17F 5A2QZ 5L3DA 1JGSA 4OMYA 4LB5A 1XD7A 3WODF 4IF4A 5D6EA 1YYVA 3KP4A 1R7JA 2F5EA 2VONA 2O8XA 2OA4A 3J80K 3ELKA 2LDUA 4ASNA 3G3ZA 4PZJA 1Y0UA 2H6CA 1QBJA 3LFKA 4RAYA 2DPUA 3P9KA 4KA4A 1DP7P 3TOAA 5ILUA 3I58A 1ZREA 1QGPA 1S3JA 1O3QA 4GCVA 4BNCA 2NS0A 1STZA 2HFHA 2FQ3A 4XLPF 4A0ZA 5ILVA 2BEOA 5DDGA 2HQRA 5E1XA 2EV6A 3E3VA 1LDKB 4P96A 2Q0OA 1IF1A 1T98A 1K78A 3TO9A 5L3CA 2ZKZA 1USSA 1IRFA 2FSWA 1JXSA 1QZZA 1MJAA 4O6JA 1Z7UA 3HYIA 4HW0A 1B9NA 3T8RA 2M87A 1OPCA 3PQKA 2OQGA 4HLXA 2BGCA 5LRSA 3RKWA 3F6OA 2W85A 2BBYA 4JBAA 1H0MA 3HSFA 4P5OA 1XMAA 1NHAA 2DT5A 4KICA 3E5UA 2F5FA 4KFCA 2ADUA 2XUBA 1KA8A 1AWCA 3RTRA 3KP7A 5FLXZ 3KZYA 4L9TA 4OINF 2E7WA 1K6OA 5ERIA 1X3UA 2ZMEB 3KLOA 3V8KA 3JTHA 3F22A 1G3YA 2DQRA 1KU3A 3K1MA 2ACJA 4M9ZA 3MEXA 1ZH5A 5IT3A 3R60A 5HDNA 4EJVA 3KP2A 2PMUA 2UXNA 2YX7A 4HF2A 3LA7A 2D45A 1JHFA 1IW7F 2IPQX 1XGMA 5L3FA 2WC2A 4FT8A 5DYMA 3QPTA 3VODA 3CUQB 2OAZA 4KNYA 3TDUC 2HKOA 4Q48A 4EJUA 5D5XB 2E7XA 5K5RA 2CFXA 1G3WA 3E97A 2VBWA 4U88A 1AOYA 2F5DA 3KEQA 2PLYA 1I1GA 1FC3A 3KZZA 2ZNZA 4B8XA 3RJPA 1BI1A 2NAZA 3J81K 3W6KB 2V9VA 1RUOA 1K79A 5EEGA 5J8CA 4N0BA 3DPLC 4M6YA 2XHKA 3F6VA 4JQFA 1EH8A 2QBYA 1VTNC 3IWFA 3U9GA 3C18A 1MD0A 1BM9A 2EV5A 2DTRA 2XAHA 2FEZA 3KEOA 1EH7A 1WWXA 2KJCA 1DUXC 1OKRA 1O7LA 3IL2A 4G9YA 2EFPA 4UV9A 2HR3A 4YG2F 4Q4ZF 1ODDA 3HSRA 2LNBA 4GYGA 1ZGAA 3K9TA 2Q8KA 4UNOA 5DD8A 4A2UA 3MWMA 2FF4A 5FD5A 4S04A 2D2WA 3K2ZA 5JFRA 2GQQA 2A07F 2YSRA 1BN5A 1OYWA 3GFIA 3TDZC 4AVPA 4L9VA 2IJLA 5DCMA 1F4KA 3O6BB 1TBXA 1BJAA 3BPXA 1OYYA 1H9GA 5D8LB 1J5YA 3HOTA 2HQNA 4UHTA 2F2EA 3BJOA 3F8NA 4M72A 4EM0B 1XCBA 2ELHA 1I6XA 4EJTA 4OIQF 5ICCA 4M9XA 4G6QA 3I0TA 1HW1A 2PEXA 3TQNA 1W5TA 4M71A 4AIHA 2KIMA 2NYXA 3V7SA 1YW7A 4CXFA 1BI2A 2JPBA 1KQ0A 2IRFG 4LG0B 1TQIA 5ICEA 4MNUA 5H6QA 4BXUA 3LQRA 4ESBA 1BC8C 4RS8A 2VN2A 1W7PD 1T6SA 5JHUA 3RPUA 2STWA 2VBZA 5TRDA 1IZ1A 4PGGA 5HLIA 4G6DA 4M6XA 1CF7B 2P5VA 5HDKA 2P7CB 2EV0A 3R61A 4MTDA 5JVTA 2LF8A 2QM3A 4LK0F 2VBYA 5HOOA 3OOPA 2CYYA 1B59A 1B4AA 1XGSA 1IN6A 4P9UA 4OIOF 3WU1B 3O3KA 3I59B 2K7LA 1DDNA 1B9MA 3SZPA 1J75A 5HS7A 3J80Z 1REPC 2ZCWA 1Z9CA 2XGXA 4IRIA 1SAXA 2BYVE 3GXOA 3NRVA 4Q5SF 1V4RA 1S6LA 1IAWA 1H9TA 1TNSA 3BP8A 4AIJA 4BHBA 3EYYA 5LGNA 2AS5F 1SD6A 3GUDA 1I1SA 2K02A 3GW2A 4IXAA 4R8HA 2O61A 2NNNA 1U6GA 4A5NA 3LA3A 5LRRA 3QU3A 2V79A 2FBIA 4U7BA 4WWCA 5E1ZB 2GIVA 2P5KA 1U2WA 1FLIA 3KP6A 3V8LA 4LGWA 1FP1D 2PI0A 1DPUA 1K78B 3M1EA 4AIKA 1R5HA 3WE3A 1DPRA 2QVOA 1LEBA 4TV7A 1QZYA 3ZP5A 1J9IA 5DD4A 4RAZA 1ZG1A 3HHHA 4CHUA 5J6XA 4IJAA 5H20A 4XBFA 1A04A 1MDMB 3IWZA 1YTYA 4PDKA 1FYMA 4RGXA 3P9CA 3ZMTA 1KQ8A 5IT9K 4WF2A 5CYVA 2V6CA 5KK1A 2IP2A 1E2XA 1ZARA 2C6YA 2VT3A 2LF7A 2BE5F 4P55A 4BYYA 3CLOA 5LLQA 1YO5C 2PFBA 3DQVC 3EQLF 4WXCA 5K5OA 1G3TA 1HBXG 1YQAA 4I0AA 3TO7A 3E5XA 5LHGA 2VE9A 1IN4A 3T0YA 1T38A 3CO7C 2TDXA 3F3XA 3JSPA 4HX4A 2W84A 3ZN1A 2VT2A 3FXUA 2F5CA 3ZMSA 5E8IA 3T1BA 4I0BA 5AONA 2OZUA 1RIOH 4NQWA 2DAOA 2RC4A 1XSDA 1MZBA 3JAMK 1ONVA 1TQMA 3JW4A 3OV8A 2FU4A 1ON1A 3E6CC 2P4WA 3KETA 3J81Z 2MLKA 1ZLJA 1R23A 3Q9VA 4KDPA 1P4AA 3KLNA 1EH6A 5LEKA 3CDHA 2FXAA 3U1DA 2VBXA 2GXBA 4HF0A 5E8GA 3COAC 4IRHA 2G7UA 2XAQA 5JI6A 3HSEA 3ERED 1P2FA 3I4PA 2OZ6A 2QBYB 4U0VA 1FSHA 2ISYA 2EJRA 2Z5UA 3V7CA 5BPIA 4IHSA 5DEQA 4R79A 1J59A 3EETA 2DK5A 3Q9SA 4OOIA 3RI4A 4HQMA 3WGIA 4CGZA 3N4MA 3D0SA 5D6FA 1SFEA 4M9SA 3M9AA 1HKQA 1XGNA 5BS6A 3RDIA 1XCVA 2P7VB 3PQJA 1XGOA 3HRSA 3Q5FA 4ZYGA 3F21A 2W24A 1O57A 2FOKA 2IA2A 4ENMA 1LVAA 3HRTA 1FBQA 1B6AA 2IVMA 1TW2A 4PCQA 1T0FA 4GXOA 1U78A 1SMYF 2XROA 1C0WA 4HDVA 3FXQA 2AXLA 1KU7A 3BWGA 1U5TB 2NNYA 1IUYA 3GF2A 3SZTA 2A68F 1P4WA 3FX3A 4WK8F 1KQ9A 5EEHA 3J7AO 2VOOA 3ZMZA 2OD5A 1FYKA 3I5UA 1R1VA 4A0YA 1Z91A 4U7DA 1WRJA 4LLLA 2MLGA 1W7PA 2M1BA 3HRMA 3GFJA 2DFIA 2PG4A 4ZYEA 1FP2A 3TGNA 2WTEA 1LEAA 1XDUA 5DUKA 2R7FA 1W4MA 4NHJA 3ECOA 3FMQA 4RGSA 1E17A 2OBPA 3L7WA 3HHGA 1G3SA 2V1XA 2VC1A 3TOBA 2DO7A 1OYIA 4RB1A 2MH9A 3F8BA 1QPMA 2VOPA 3GFLA 3MCZA 2OU2A 2EWNA 4JK1X 3C3WA 2IW5A 2LKPA 2EB7A 4I02A 3GEZA 4ENKA 4BAYA 3C1DA 3BY6A 2CO5A 3RIRA 4OIRF 3WU0A 2KIUA 4UVAA 4HQEA 3RYPA 4UVBA 5KVRA 4EM1A 4HV5A 4BHCA 1PP8F 1F5TA 2GZWA 3LA2A 3H92A 2QUFA 4ENNA 5CLSA 1FOKA 2O03A 4OU0A 3RKYA 1R36A 2RKHA 1YG2A 3F8CA 1PP7U 1J2XA 5LHHA 1D3YA 2VE8A 1HW5A 2RN7A 2O6GE 3ZN0A 3WTXC 5L3BA 2QENA 4E70A 4OMZA 3E5QA 2JZYA 4HF1A 5AIPA 3FM5A 5CVRA 5CVIA 2A3SA 2RQPA 2H6BA 1HXDA 2HTSA 3F72A 4RB2C 2L4AA 4KN4X 3CTAA 6PAXA 1IN8A 5FO5A 3SXYA 3QAHA 4G7ZF 4LB6B 1ZRDA 4ESFA 4RB3C 1YIOA 3DP7A 4IVNA 4UVCA 2HOEA 2J5PA 4UUVA 3VEPA 4L5JA 3IC7A 3HOSA 4L9JA 4YFXF 1TLHB 1LDJA 5LBQA 3LSTA 3WTTC 1UFMA 1MJ9A 3IKTA 1G6NA 1PUEE 3I71A 4HX7A 5E1WA 4I7HA 5LHIA 3ECHA 3REOA 5AIQA 4EVIA 4YIFA 4I01A 3GZ6A 1LQ1A 3DV8A 1IN7A 1OMIA 4NB5A 3L2CA 2R3SA 2YX4A 2XKOA 4HZFA 4ON0A 5D5UB 2VXZA 1IRGA 4LK1F 3GLXA 2MD5A 1KYWA 1TNTA 2IA0A 1IXCA 4ZZDA 1SD4A 4YFKF 4WX9A 1GXQA 3JAMZ 2YR2A 1KGSA 2RNJA 1ZLKA 1KYZA 1L0OC 3N97A 4ZYHA 4WXDA 3D5LA 2DW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFO A;  4WXH A;  3LAJ A;  2HKX A;  3F8F A;  3NEU A;  3R0J A;  1Q1H A;  3IRQ A;  1S29 A;  3S2W A;  2MBF A;  2L3D A;  2E1N A;  3ULQ B;  4XRF A;  5TJJ A;  4KN7 X;  4I2O A;  3CUQ A;  2M45 A;  2L02 A;  2D1V A;  1R1U A;  2A61 A;  1FSE A;  3NQO A;  2STT A;  2M5W A;  5L3E A;  4KIF A;  3WTW C;  3QP6 A;  2EFQ A;  2JPC A;  1Z1D A;  4XLN F;  4Y17 A;  2R7D A;  4HV6 A;  3LWF A;  2GA2 A;  3GWZ A;  4Z2Y A;  1O3R A;  1BC7 C;  3L09 A;  3BZ6 A;  2VOD A;  2K86 A;  3R0A A;  4BQA A;  5D4S A;  4YFN F;  4FX4 A;  1ZGJ A;  3F8M A;  2DK8 A;  2L4M A;  2JTV A;  5CVJ A;  1P4X A;  5FFX A;  1TTY A;  5FD6 A;  2OQR A;  3DPT A;  3SQN A;  1D5V A;  2FA5 A;  3MZY A;  1YFH A;  5F64 A;  2ZO4 A;  5J8F A;  1QO0 D;  4PGH A;  2Q2E A;  1FNN A;  2Z99 A;  5K5Q A;  2CSO A;  4EMS A;  3M8E A;  2HWV A;  4F7Z A;  5F1R A;  3JSO A;  2X4H A;  3FMS A;  3CO6 C;  1SMT A;  2V1D A;  1FX7 A;  3BJA A;  2HDC A;  1IXR C;  2ESN A;  3ROU A;  3HTU A;  3ZMU A;  2FNP A;  4KUM A;  1XSX A;  2Y48 A;  3I54 A;  3V8J A;  2FBH A;  4GYI A;  2CQK A;  4U0W A;  2H09 A;  1U8R A;  2A6E F;  2H27 A;  2K4B A;  3CUO A;  3LAP A;  3I53 A;  3QPH A;  1MKM A;  4L18 B;  1BI3 A;  4EGY A;  3T8T A;  2DI3 A;  4KT5 C;  1MGT A;  2O0Y A;  3QU6 A;  3IRR A;  2DPD A;  5ED4 A;  5CVU A;  1PDN C;  4GGG A;  3H3Z A;  5DV5 A;  3QP5 A;  1Z6T A;  2EA4 A;  3L00 A;  1CF7 A;  1MJB A;  2HYG D;  4YII A;  2CW0 F;  3GX4 X;  3CUQ C;  1G4D A;  3EYI A;  4MQ9 F;  5H6R A;  3DXJ F;  4IHT A;  2YU3 A;  4A0X A;  1HW2 A;  5D5V B;  4A12 A;  3I59 A;  1XB4 A;  3EDP A;  1JE8 A;  4G7O F;  5E20 A;  2A6H F;  1I27 A;  3BPV A;  2MH2 A;  2XAS A;  2QZ8 A;  2HTJ A;  2DBB A;  5ICG A;  1U3E M;  3QRF F;  5CVV A;  4XSZ F;  1WQ2 A;  4CIC A;  3P7N A;  2Z9O A;  3KP3 A;  5HS9 A;  3BJ6 A;  2EFN A;  4MGR A;  2FE3 A;  2QWW A;  1ZRF A;  2M8E A;  1QNT A;  2COM A;  2CGP A;  2W25 A;  5BPD A;  3PFI A;  3I64 A;  4I98 B;  4RB0 A;  1HSJ A;  3B02 A;  1TQP A;  4N9I A;  2RVC A;  5CJ9 A;  3P9I A;  4MHG A;  2KJB A;  3HUG A;  2RDP A;  2FNA A;  2JT1 A;  3F23 A;  4A6E A;  4ZYD A;  1XSV A;  1J0R A;  1WSU A;  5DCM B;  2ETH A;  1ON2 A;  3WTS C;  1J7K A;  2ESH A;  2YPR A;  1D8K A;  4Y13 A;  4U0Y A;  1F1Z A;  4KYW A;  1FT9 A;  2HZT A;  1YW9 A;  1HKS A;  4FHT A;  2FBK A;  4LMY A;  1ZG3 A;  5DUI A;  2MC3 A;  5BOX A;  2QQB A;  2XRN A;  1MDM A;  3DFG A;  2XAG A;  1K7A A;  4EM2 A;  3RKX A;  1T39 A;  2ISZ A;  1LNW A;  4G8X A;  4CYD A;  4WCG A;  2RGV A;  2EA2 A;  2W57 A;  2XAJ A;  1P6R A;  4HX8 A;  2J5O A;  3MAJ A;  4UV8 A;  4QLC U;  4MEX F;  4LJZ F;  4HYE A;  3VOE A;  4XSX F;  1RUN A;  5HDG A;  2CWE A;  2MA3 A;  2P6T A;  3VB2 A;  1HQC A;  2HYF A;  1LJ9 A;  3T5X A;  2KIF A;  2QQA A;  2PJP A;  4EJW A;  3ISP A;  4CO8 A;  3ZMD A;  3ZQ7 A;  1O3S A;  3HRU A;  3WTZ A;  1HKT A;  3WTV C;  2JSC A;  5ICF A;  2IA1 A;  4UXN A;  4A6D A;  4N9H A;  4LLN A;  1XDS A;  3KCC A;  4O5V A;  1S8N A;  3W6J B;  4LFU A;  2PN6 A;  3FHZ A;  5HVQ C;  4RGR A;  5A2Q K;  4R1H A;  1YLF A;  2UWM A;  5LGT A;  4MQV A;  4P9F A;  1ZHF A;  3DKW A;  2XVC A;  3BDD A;  3WTU C;  3ZMV A;  1W5S A;  3FF5 A;  1R22 A;  5HS8 A;  4B09 A;  1ZN2 A;  3RYR A;  2Y0M A;  4DQ2 A;  3MZH A;  4I09 A;  2XIG A;  2FML A;  5D4R A;  1WKM A;  1UHM A;  2L54 A;  2K4J A;  2RV8 A;  2NRA C;  3IHU A;  1D8J A;  3MFK A;  3K69 A;  4BHP A;  1SFU A;  3ABT A;  3ZPL A;  2G9W A;  4MEY F;  1YS6 A;  1OR7 A;  1P92 A;  2ZFW A;  2IT0 A;  4OIP F;  4HA8 A;  5E18 F;  3B73 A;  2XAF A;  1L3L A;  1O3T A;  5L3G A;  4IRG A;  2Y75 A;  1FBU A;  1QQI A;  4CZZ A;  3IKV A;  4EV0 A;  3WE2 A;  1FZP B;  2GAU A;  1ZG5 A;  3SHF A;  1FYL A;  5IT9 Z;  4EJO A;  1SFX A;  2ZNY A;  3FXR A;  2EK5 A;  3LQQ A;  2K27 A;  4ETS A;  1ZYR F;  1IN5 A;  3K1P A;  2E1C A;  1CGP A;  4FX0 A;  4A5M A;  3U2R A;  2PQ8 A;  3QOP A;  4ZH4 F;  1XMK A;  3DF8 A;  1U5T A;  1YW8 A;  3R4K A;  3GYH X;  3ML6 A;  1O7F A;  2QYO A;  4L0Z B;  1RNL A;  3C7J A;  1FPQ A;  2B0L A;  3WGG A;  4L9N A;  3HIF A;  4H0E A;  3E6M A;  1UB9 A;  5JR3 A;  5HLH A;  1LDD A;  3K1N A;  4HBL A;  4QWQ A;  1F9N A;  2G7H A;  2P8T A;  5F6F A;  4Y15 A;  1BBY A;  1TW3 A;  4HOB A;  2PBI A;  3V4G A;  3WGH A;  4EQQ A;  3TO6 A;  3E6D A;  5FLX K;  1ZRC A;  3MQ0 A;  2HGC A;  2ZME A;  4KIG A;  4HAM A;  2M30 A;  4M74 A;  5BMZ A;  1S7A A;  1ZAO A;  2D1H A;  1WI9 A;  2PMH A;  4ENJ A;  2UXX A;  1GHC A;  2V1U A;  1R5G A;  4AD9 A;  3BOQ A;  4IPA A;  1BIB A;  2GXG A;  5LEJ A;  5D8K B;  2X0L A;  1R00 A;  1LB2 A;  5D5W B;  1FWZ A;  2HEO A;  3JTG A;  4GO1 A;  2DQL A;  1GVJ A;  1ULY A;  2XV4 S;  2UZK A;  2FRH A;  3SFZ A;  2A69 F;  3FWE A;  3KE2 A;  3E6B A;  3AAF A;  4K2E A;  3GO5 A;  3H3U A;  5FGM A;  2DLL A;  2KKO A;  4M73 A;  3WTY C;  3BRO A;  4EGZ A;  1V3F A;  2H94 A;  1KU2 A;  1RI7 A;  2P5L C;  2ZXJ A;  4AWX B;  1JHH A;  3O2P E;  2L01 A;  5ILS A;  1UHW A;  2P6S A;  1BI0 A;  4LD5 A;  1SD5 A;  1T2K A;  1RZ4 A;  4G7H F;  2QLZ A;  3TKY A;  3HTS B;  1KU9 A;  2LSO A;  3RPQ A;  1BOA A;  3KFW X;  4D0P A;  4HLY A;  4L5I A;  1Z05 A;  3R6S A;  2HS5 A;  2GA1 A;  1W7P B;  2O3F A;  3WG9 A;  4MTE A;  4L0Y B;  1YS7 A;  4KIB A;  4BH9 A;  2CG4 A;  2QQ9 A;  5FB2 A;  2FMY A;  2EFW A;  2WV0 A;  1R1T A;  3GVA A;  5HLG A;  3CJN A;  4HDU A;  3M7G A;  3DEU A;  1U5T C;  4O3M A;  5LGU A;  2A5Y B;  1SD7 A;  3ABU A;  3GFM A;  2ZBK A;  4KMF A;  2BV6 A;  4CDG A;  4ZZL A;  4S05 A;  3L9F A;  4ESJ A;  1I5Z A;  2XKP A;  4Q47 A;  1Z6R A;  2ZJ2 A;  3FM3 A;  1HST A;  5FFZ A;  1R58 A;  1FBS A;  3V7R A;  1GXP A;  3K0L A;  1UST A;  4KMU X;  1UCR A;  3GZ5 A;  1FY7 A;  5BQT A;  3G73 A;  4LG0 A;  1BIA A;  3KP5 A;  4LLG F;  3FMR A;  1EV7 A;  2Z3Y A;  1B1B A;  4DNC A;  2VC0 A;  4G94 A;  1XN7 A;  2JRT A;  3VFZ A;  2WWY A;  3EUH A;  2GWR A;  1S7O A;  1IXS B;  5DCF A;  3M8F A;  2Z33 A;  2KRF A;  4RGU A;  2DU9 A;  5K1Y A;  3FZV A;  5E17 F;  5A2Q Z;  5L3D A;  1JGS A;  4OMY A;  4LB5 A;  1XD7 A;  3WOD F;  4IF4 A;  5D6E A;  1YYV A;  3KP4 A;  1R7J A;  2F5E A;  2VON A;  2O8X A;  2OA4 A;  3J80 K;  3ELK A;  2LDU A;  4ASN A;  3G3Z A;  4PZJ A;  1Y0U A;  2H6C A;  1QBJ A;  3LFK A;  4RAY A;  2DPU A;  3P9K A;  4KA4 A;  1DP7 P;  3TOA A;  5ILU A;  3I58 A;  1ZRE A;  1QGP A;  1S3J A;  1O3Q A;  4GCV A;  4BNC A;  2NS0 A;  1STZ A;  2HFH A;  2FQ3 A;  4XLP F;  4A0Z A;  5ILV A;  2BEO A;  5DDG A;  2HQR A;  5E1X A;  2EV6 A;  3E3V A;  1LDK B;  4P96 A;  2Q0O A;  1IF1 A;  1T98 A;  1K78 A;  3TO9 A;  5L3C A;  2ZKZ A;  1USS A;  1IRF A;  2FSW A;  1JXS A;  1QZZ A;  1MJA A;  4O6J A;  1Z7U A;  3HYI A;  4HW0 A;  1B9N A;  3T8R A;  2M87 A;  1OPC A;  3PQK A;  2OQG A;  4HLX A;  2BGC A;  5LRS A;  3RKW A;  3F6O A;  2W85 A;  2BBY A;  4JBA A;  1H0M A;  3HSF A;  4P5O A;  1XMA A;  1NHA A;  2DT5 A;  4KIC A;  3E5U A;  2F5F A;  4KFC A;  2ADU A;  2XUB A;  1KA8 A;  1AWC A;  3RTR A;  3KP7 A;  5FLX Z;  3KZY A;  4L9T A;  4OIN F;  2E7W A;  1K6O A;  5ERI A;  1X3U A;  2ZME B;  3KLO A;  3V8K A;  3JTH A;  3F22 A;  1G3Y A;  2DQR A;  1KU3 A;  3K1M A;  2ACJ A;  4M9Z A;  3MEX A;  1ZH5 A;  5IT3 A;  3R60 A;  5HDN A;  4EJV A;  3KP2 A;  2PMU A;  2UXN A;  2YX7 A;  4HF2 A;  3LA7 A;  2D45 A;  1JHF A;  1IW7 F;  2IPQ X;  1XGM A;  5L3F A;  2WC2 A;  4FT8 A;  5DYM A;  3QPT A;  3VOD A;  3CUQ B;  2OAZ A;  4KNY A;  3TDU C;  2HKO A;  4Q48 A;  4EJU A;  5D5X B;  2E7X A;  5K5R A;  2CFX A;  1G3W A;  3E97 A;  2VBW A;  4U88 A;  1AOY A;  2F5D A;  3KEQ A;  2PLY A;  1I1G A;  1FC3 A;  3KZZ A;  2ZNZ A;  4B8X A;  3RJP A;  1BI1 A;  2NAZ A;  3J81 K;  3W6K B;  2V9V A;  1RUO A;  1K79 A;  5EEG A;  5J8C A;  4N0B A;  3DPL C;  4M6Y A;  2XHK A;  3F6V A;  4JQF A;  1EH8 A;  2QBY A;  1VTN C;  3IWF A;  3U9G A;  3C18 A;  1MD0 A;  1BM9 A;  2EV5 A;  2DTR A;  2XAH A;  2FEZ A;  3KEO A;  1EH7 A;  1WWX A;  2KJC A;  1DUX C;  1OKR A;  1O7L A;  3IL2 A;  4G9Y A;  2EFP A;  4UV9 A;  2HR3 A;  4YG2 F;  4Q4Z F;  1ODD A;  3HSR A;  2LNB A;  4GYG A;  1ZGA A;  3K9T A;  2Q8K A;  4UNO A;  5DD8 A;  4A2U A;  3MWM A;  2FF4 A;  5FD5 A;  4S04 A;  2D2W A;  3K2Z A;  5JFR A;  2GQQ A;  2A07 F;  2YSR A;  1BN5 A;  1OYW A;  3GFI A;  3TDZ C;  4AVP A;  4L9V A;  2IJL A;  5DCM A;  1F4K A;  3O6B B;  1TBX A;  1BJA A;  3BPX A;  1OYY A;  1H9G A;  5D8L B;  1J5Y A;  3HOT A;  2HQN A;  4UHT A;  2F2E A;  3BJO A;  3F8N A;  4M72 A;  4EM0 B;  1XCB A;  2ELH A;  1I6X A;  4EJT A;  4OIQ F;  5ICC A;  4M9X A;  4G6Q A;  3I0T A;  1HW1 A;  2PEX A;  3TQN A;  1W5T A;  4M71 A;  4AIH A;  2KIM A;  2NYX A;  3V7S A;  1YW7 A;  4CXF A;  1BI2 A;  2JPB A;  1KQ0 A;  2IRF G;  4LG0 B;  1TQI A;  5ICE A;  4MNU A;  5H6Q A;  4BXU A;  3LQR A;  4ESB A;  1BC8 C;  4RS8 A;  2VN2 A;  1W7P D;  1T6S A;  5JHU A;  3RPU A;  2STW A;  2VBZ A;  5TRD A;  1IZ1 A;  4PGG A;  5HLI A;  4G6D A;  4M6X A;  1CF7 B;  2P5V A;  5HDK A;  2P7C B;  2EV0 A;  3R61 A;  4MTD A;  5JVT A;  2LF8 A;  2QM3 A;  4LK0 F;  2VBY A;  5HOO A;  3OOP A;  2CYY A;  1B59 A;  1B4A A;  1XGS A;  1IN6 A;  4P9U A;  4OIO F;  3WU1 B;  3O3K A;  3I59 B;  2K7L A;  1DDN A;  1B9M A;  3SZP A;  1J75 A;  5HS7 A;  3J80 Z;  1REP C;  2ZCW A;  1Z9C A;  2XGX A;  4IRI A;  1SAX A;  2BYV E;  3GXO A;  3NRV A;  4Q5S F;  1V4R A;  1S6L A;  1IAW A;  1H9T A;  1TNS A;  3BP8 A;  4AIJ A;  4BHB A;  3EYY A;  5LGN A;  2AS5 F;  1SD6 A;  3GUD A;  1I1S A;  2K02 A;  3GW2 A;  4IXA A;  4R8H A;  2O61 A;  2NNN A;  1U6G A;  4A5N A;  3LA3 A;  5LRR A;  3QU3 A;  2V79 A;  2FBI A;  4U7B A;  4WWC A;  5E1Z B;  2GIV A;  2P5K A;  1U2W A;  1FLI A;  3KP6 A;  3V8L A;  4LGW A;  1FP1 D;  2PI0 A;  1DPU A;  1K78 B;  3M1E A;  4AIK A;  1R5H A;  3WE3 A;  1DPR A;  2QVO A;  1LEB A;  4TV7 A;  1QZY A;  3ZP5 A;  1J9I A;  5DD4 A;  4RAZ A;  1ZG1 A;  3HHH A;  4CHU A;  5J6X A;  4IJA A;  5H20 A;  4XBF A;  1A04 A;  1MDM B;  3IWZ A;  1YTY A;  4PDK A;  1FYM A;  4RGX A;  3P9C A;  3ZMT A;  1KQ8 A;  5IT9 K;  4WF2 A;  5CYV A;  2V6C A;  5KK1 A;  2IP2 A;  1E2X A;  1ZAR A;  2C6Y A;  2VT3 A;  2LF7 A;  2BE5 F;  4P55 A;  4BYY A;  3CLO A;  5LLQ A;  1YO5 C;  2PFB A;  3DQV C;  3EQL F;  4WXC A;  5K5O A;  1G3T A;  1HBX G;  1YQA A;  4I0A A;  3TO7 A;  3E5X A;  5LHG A;  2VE9 A;  1IN4 A;  3T0Y A;  1T38 A;  3CO7 C;  2TDX A;  3F3X A;  3JSP A;  4HX4 A;  2W84 A;  3ZN1 A;  2VT2 A;  3FXU A;  2F5C A;  3ZMS A;  5E8I A;  3T1B A;  4I0B A;  5AON A;  2OZU A;  1RIO H;  4NQW A;  2DAO A;  2RC4 A;  1XSD A;  1MZB A;  3JAM K;  1ONV A;  1TQM A;  3JW4 A;  3OV8 A;  2FU4 A;  1ON1 A;  3E6C C;  2P4W A;  3KET A;  3J81 Z;  2MLK A;  1ZLJ A;  1R23 A;  3Q9V A;  4KDP A;  1P4A A;  3KLN A;  1EH6 A;  5LEK A;  3CDH A;  2FXA A;  3U1D A;  2VBX A;  2GXB A;  4HF0 A;  5E8G A;  3COA C;  4IRH A;  2G7U A;  2XAQ A;  5JI6 A;  3HSE A;  3ERE D;  1P2F A;  3I4P A;  2OZ6 A;  2QBY B;  4U0V A;  1FSH A;  2ISY A;  2EJR A;  2Z5U A;  3V7C A;  5BPI A;  4IHS A;  5DEQ A;  4R79 A;  1J59 A;  3EET A;  2DK5 A;  3Q9S A;  4OOI A;  3RI4 A;  4HQM A;  3WGI A;  4CGZ A;  3N4M A;  3D0S A;  5D6F A;  1SFE A;  4M9S A;  3M9A A;  1HKQ A;  1XGN A;  5BS6 A;  3RDI A;  1XCV A;  2P7V B;  3PQJ A;  1XGO A;  3HRS A;  3Q5F A;  4ZYG A;  3F21 A;  2W24 A;  1O57 A;  2FOK A;  2IA2 A;  4ENM A;  1LVA A;  3HRT A;  1FBQ A;  1B6A A;  2IVM A;  1TW2 A;  4PCQ A;  1T0F A;  4GXO A;  1U78 A;  1SMY F;  2XRO A;  1C0W A;  4HDV A;  3FXQ A;  2AXL A;  1KU7 A;  3BWG A;  1U5T B;  2NNY A;  1IUY A;  3GF2 A;  3SZT A;  2A68 F;  1P4W A;  3FX3 A;  4WK8 F;  1KQ9 A;  5EEH A;  3J7A O;  2VOO A;  3ZMZ A;  2OD5 A;  1FYK A;  3I5U A;  1R1V A;  4A0Y A;  1Z91 A;  4U7D A;  1WRJ A;  4LLL A;  2MLG A;  1W7P A;  2M1B A;  3HRM A;  3GFJ A;  2DFI A;  2PG4 A;  4ZYE A;  1FP2 A;  3TGN A;  2WTE A;  1LEA A;  1XDU A;  5DUK A;  2R7F A;  1W4M A;  4NHJ A;  3ECO A;  3FMQ A;  4RGS A;  1E17 A;  2OBP A;  3L7W A;  3HHG A;  1G3S A;  2V1X A;  2VC1 A;  3TOB A;  2DO7 A;  1OYI A;  4RB1 A;  2MH9 A;  3F8B A;  1QPM A;  2VOP A;  3GFL A;  3MCZ A;  2OU2 A;  2EWN A;  4JK1 X;  3C3W A;  2IW5 A;  2LKP A;  2EB7 A;  4I02 A;  3GEZ A;  4ENK A;  4BAY A;  3C1D A;  3BY6 A;  2CO5 A;  3RIR A;  4OIR F;  3WU0 A;  2KIU A;  4UVA A;  4HQE A;  3RYP A;  4UVB A;  5KVR A;  4EM1 A;  4HV5 A;  4BHC A;  1PP8 F;  1F5T A;  2GZW A;  3LA2 A;  3H92 A;  2QUF A;  4ENN A;  5CLS A;  1FOK A;  2O03 A;  4OU0 A;  3RKY A;  1R36 A;  2RKH A;  1YG2 A;  3F8C A;  1PP7 U;  1J2X A;  5LHH A;  1D3Y A;  2VE8 A;  1HW5 A;  2RN7 A;  2O6G E;  3ZN0 A;  3WTX C;  5L3B A;  2QEN A;  4E70 A;  4OMZ A;  3E5Q A;  2JZY A;  4HF1 A;  5AIP A;  3FM5 A;  5CVR A;  5CVI A;  2A3S A;  2RQP A;  2H6B A;  1HXD A;  2HTS A;  3F72 A;  4RB2 C;  2L4A A;  4KN4 X;  3CTA A;  6PAX A;  1IN8 A;  5FO5 A;  3SXY A;  3QAH A;  4G7Z F;  4LB6 B;  1ZRD A;  4ESF A;  4RB3 C;  1YIO A;  3DP7 A;  4IVN A;  4UVC A;  2HOE A;  2J5P A;  4UUV A;  3VEP A;  4L5J A;  3IC7 A;  3HOS A;  4L9J A;  4YFX F;  1TLH B;  1LDJ A;  5LBQ A;  3LST A;  3WTT C;  1UFM A;  1MJ9 A;  3IKT A;  1G6N A;  1PUE E;  3I71 A;  4HX7 A;  5E1W A;  4I7H A;  5LHI A;  3ECH A;  3REO A;  5AIQ A;  4EVI A;  4YIF A;  4I01 A;  3GZ6 A;  1LQ1 A;  3DV8 A;  1IN7 A;  1OMI A;  4NB5 A;  3L2C A;  2R3S A;  2YX4 A;  2XKO A;  4HZF A;  4ON0 A;  5D5U B;  2VXZ A;  1IRG A;  4LK1 F;  3GLX A;  2MD5 A;  1KYW A;  1TNT A;  2IA0 A;  1IXC A;  4ZZD A;  1SD4 A;  4YFK F;  4WX9 A;  1GXQ A;  3JAM Z;  2YR2 A;  1KGS A;  2RNJ A;  1ZLK A;  1KYZ A;  1L0O C;  3N97 A;  4ZYH A;  4WXD A;  3D5L A;  2DW4 A; 
#chains in the Genus database with same CATH topology
 3H36 A;  2B9S A;  2CQ7 A;  2EFO A;  2RQQ A;  3LMM A;  3B6C A;  3S15 J;  5B66 C;  4WXH A;  3LAJ A;  2HKX A;  3F8F A;  3NEU A;  1F36 A;  3R0J A;  1Q1H A;  3OYG A;  2L7F P;  5F0F A;  3RSN A;  4MFE A;  3IRQ A;  1R9T J;  3ASN H;  4BUP A;  1S29 A;  3JRC A;  3S2W A;  3IV5 A;  1HDD C;  2ZSH B;  1NK3 P;  2BXY A;  2MBF A;  2L3D A;  2G0E A;  3S8P A;  2E1N A;  2XRL A;  4J00 A;  3ULQ B;  4XRF A;  3MN2 A;  4IHW A;  3ZQL A;  2HU9 A;  2QA4 I;  5TJJ A;  4KN7 X;  3LSH A;  4I2O A;  3WHB A;  2DA3 A;  3CUQ A;  2M45 A;  2L02 A;  4A3F J;  1ACI A;  1E3O C;  1Y0N A;  4IO9 F;  3OS2 A;  1GV2 A;  4XIC A;  1QVU A;  2D1V A;  3QWL A;  1R1U A;  2A61 A;  1HF0 A;  1FSE A;  3A03 A;  2H8W A;  3EUA A;  3BCA A;  3NQO A;  2STT A;  3TED A;  1WPK A;  2M5W A;  5L3E A;  4KIF A;  3OYD A;  1IRZ A;  3WTW C;  4B4C A;  3QP6 A;  2EFQ A;  2JPC A;  2R7W A;  1Z1D A;  1H8A C;  3MD2 A;  4CYC A;  2R93 J;  2R7U A;  3OR1 C;  4D9J A;  4XLN F;  4Y17 A;  3QOE A;  2R7D A;  4HV6 A;  2OV7 A;  4CCL A;  3LWF A;  2GA2 A;  4BQQ A;  3GWZ A;  4Z2Y A;  2IGO A;  5DM6 F;  1O3R A;  1BC7 C;  3Q0V A;  3L09 A;  2KL4 A;  3BZ6 A;  2ZJR F;  2NVU B;  4PJM A;  2JA7 J;  2VOD A;  2K86 A;  3R0A A;  4BQA A;  3PO2 J;  5D4S A;  4YFN F;  4FX4 A;  1ZGJ A;  2V4J C;  3BG7 A;  1PVE A;  3BR3 A;  3DLA A;  3ABL H;  3F8M A;  2VIX A;  2CUZ A;  3CCM I;  2DK8 A;  2M0C A;  2L4M A;  2JTV A;  1D0Y A;  3GTM J;  5GAD J;  5CVJ A;  3JRB A;  3HOY J;  2M2E A;  1I50 J;  1V5F A;  2XGD A;  2DFH A;  5J4V A;  1RES A;  1P4X A;  3SEZ A;  5FFX A;  2V1N A;  4DIQ A;  4Y3O A;  1TTY A;  4D7N A;  5TGT A;  4QPQ A;  2EQR A;  3TW7 A;  4XMY A;  5FD6 A;  2OQR A;  3DPT A;  3SQN A;  1D5V A;  2FA5 A;  3MZY A;  1YFH A;  5F64 A;  2HI3 A;  3GTL J;  1RET A;  2ZO4 A;  5J8F A;  1QO0 D;  3S1N J;  4PGH A;  3FK7 A;  4FAS D;  3I4M J;  2LOO A;  2Q2E A;  1FNN A;  3M3Y J;  5IP9 J;  2Y69 H;  4ITV A;  1LE8 A;  4B1R A;  3OYK A;  2Z99 A;  2XDV A;  5K5Q A;  5IPA A;  2FUG 2;  3K4N A;  2CSO A;  4AUX A;  4EMS A;  4CZC A;  1RKT A;  1YJW I;  3BZK A;  2V9K A;  3M8E A;  3PUB A;  2HWV A;  2BOL A;  2FD5 A;  4F7Z A;  3OOU A;  1OFC X;  5F1R A;  4FTH A;  1VQ4 I;  3JSO A;  1Y1W J;  2X4H A;  3FMS A;  3BG5 A;  3OS0 A;  2ZXH A;  1H88 C;  3CO6 C;  3L2Q A;  4IZZ A;  1SMT A;  5E3N A;  2MAB A;  1UG2 A;  2V1D A;  1FIP A;  4JOM A;  1FX7 A;  5EF6 A;  3BJA A;  4HNT A;  2HDC A;  1IXR C;  2HZD A;  2ESN A;  2E2H J;  3ROU A;  2OTJ I;  2L9N A;  2IS1 A;  3HTU A;  4A3K J;  3ZMU A;  2DMP A;  2R5Z B;  2FNP A;  1TC3 C;  4KUM A;  1Z7L A;  2NS7 A;  1XSX A;  2Y48 A;  3I54 A;  5IP7 J;  3VYS B;  3V8J A;  1X1A A;  2FBH A;  2TRT A;  4GYI A;  4BXF A;  2ZSI B;  3S2H J;  3CCY A;  3C2B A;  2CQK A;  4U0W A;  2Z2S B;  2H09 A;  2LTP A;  3H35 A;  3U21 A;  1U8R A;  3ZQH A;  3ZQF A;  4G12 A;  2A6E F;  2H27 A;  2K4B A;  1MMN A;  4BEH A;  3CUO A;  3LAP A;  3I53 A;  3QPH A;  4ZJZ A;  3HOV J;  1MKM A;  3H9Q A;  2Y9Z A;  2NXN B;  4MO7 A;  3OYF A;  4L18 B;  2A6T A;  2V7F A;  3OYE A;  2O5R A;  3S3N A;  1BI3 A;  2Y9Y A;  4EGY A;  1NH3 A;  3NAU A;  3T8T A;  1NG7 A;  2DI3 A;  4XLF A;  4KT5 C;  1MGT A;  2O0Y A;  2ZXW H;  3QU6 A;  1A6Q A;  3UKG A;  3F9K A;  3IRR A;  2DPD A;  3JCU C;  5ED4 A;  2BW3 B;  1HLV A;  3SEQ A;  5CVU A;  5JLW A;  1Y1V J;  5M3F J;  1PDN C;  4F52 A;  4GGG A;  3AG1 H;  3H3Z A;  5DV5 A;  3QP5 A;  3CCV I;  1Z6T A;  5LD2 C;  4D1Q A;  2EA4 A;  3RQ4 A;  5E3O A;  3PIO F;  3L00 A;  3JR9 A;  4ZTF A;  1IV6 A;  1CF7 A;  1MJB A;  5E3L A;  2HYG D;  4XLA A;  4YII A;  1LPQ A;  1WGX A;  1VQK I;  2CW0 F;  2L0K A;  3GX4 X;  1JKR C;  2Z16 A;  3CUQ C;  3W2V A;  4C3H J;  3JRG A;  5CPR B;  2LD5 A;  4JX6 A;  3MKL A;  3MKW B;  1M1E B;  1G4D A;  3EYI A;  4MQ9 F;  5H6R A;  3DXJ F;  2E36 A;  1V55 H;  2M4G A;  4IHT A;  2YU3 A;  4A0X A;  1HW2 A;  2DOF A;  5D5V B;  3PM1 A;  3NAR A;  3L2U A;  1RC9 A;  3O8H A;  4A12 A;  3I59 A;  1XB4 A;  3EDP A;  1JE8 A;  2ZFU A;  3SJM A;  1VFC A;  1X2N A;  4G7O F;  5E20 A;  2A6H F;  1I27 A;  2OCC H;  4XOR A;  3BPV A;  2MH2 A;  2XAS A;  2QZ8 A;  4ANJ A;  2HTJ A;  3LOC A;  2DBB A;  2KHM A;  4M3B A;  5ICG A;  2VJ5 A;  2OPT A;  1PJR A;  4XN3 A;  1TT5 B;  1D0X A;  1U3E M;  3QRF F;  3CJT B;  5CVV A;  2BXZ A;  2NOJ B;  4XSZ F;  3Q0W A;  1Y39 A;  3BTI A;  2LRD A;  4E7H A;  1ETQ A;  3OIQ A;  1WQ2 A;  4HG2 A;  1OCT C;  1ZQ3 P;  4A69 C;  4CIC A;  3P7N A;  1D5Y A;  2Z9O A;  1K61 A;  3PJR A;  1FIA A;  2KZV A;  3KP3 A;  5HS9 A;  3BJ6 A;  1IUF A;  2OCE A;  2EFN A;  4MGR A;  2FE3 A;  2QWW A;  4XKB A;  1ZRF A;  3DCF A;  2M8E A;  3BC8 A;  1QNT A;  2RNG A;  2COM A;  4XKV A;  2CGP A;  2W25 A;  2MSY A;  4AC0 A;  5BPD A;  2L5Q A;  3PFI A;  3I64 A;  2CS3 A;  1JTX A;  4I98 B;  4RB0 A;  1HSJ A;  3B02 A;  1TQP A;  4N9I A;  2RVC A;  5IYB J;  1FJL A;  5CJ9 A;  3P9I A;  2KJB A;  3HUG A;  4MHG A;  2RDP A;  2FNA A;  2JT1 A;  1JKP C;  5KAI C;  2X6W A;  5DS9 A;  3F23 A;  2JRM A;  4A6E A;  2HNH A;  4ZYD A;  1XSV A;  3LSM A;  3L2V A;  1J0R A;  3CCR I;  2NVQ J;  2P81 A;  4D5C A;  2E2I J;  1WSU A;  5DCM B;  1AKH A;  2ETH A;  3LSJ A;  4C2M J;  2HDD A;  1J09 A;  1WJF A;  3TMO A;  1ON2 A;  3WTS C;  3S17 J;  1J7K A;  2YPR A;  2ESH A;  1D8K A;  3J7A Y;  4NC8 A;  4IKF A;  4Y13 A;  2QSH X;  4U0Y A;  1BR4 A;  3CDI A;  1F1Z A;  3W3C A;  4KYW A;  1FT9 A;  2HZT A;  2W00 A;  5JVG F;  1YW9 A;  3RZD J;  1HKS A;  4FHT A;  2FBK A;  2HDW A;  4LMY A;  2F4O B;  1ZEL A;  4NBQ A;  4BU2 A;  5C44 J;  1ZG3 A;  3BT9 A;  5DUI A;  2QKL B;  2MC3 A;  2VLA A;  5BOX A;  2QQB A;  2XRN A;  1S72 I;  2DTZ A;  2IBD A;  1MDM A;  2XPW A;  3DFG A;  2PMZ N;  1WH5 A;  2KQR A;  2XAG A;  1K7A A;  4EM2 A;  1JJ6 C;  2M3A A;  3RKX A;  1T39 A;  4C2T A;  1X4O A;  2ISZ A;  4ZDL A;  1LNW A;  1XMX A;  4G8X A;  3BR1 A;  2BZT A;  4CYD A;  3HOU J;  3BR0 A;  4WCG A;  2RGV A;  2EA2 A;  2W57 A;  2XAJ A;  1P6R A;  1MH3 A;  4HX8 A;  2X1C A;  1RPW A;  2EIK H;  1X1P A;  2J5O A;  3MAJ A;  4UV8 A;  4QLC U;  4MEX F;  2HVQ A;  2JWT A;  4LJZ F;  4HYE A;  2CH0 A;  3VOE A;  4XSX F;  1RUN A;  5HDG A;  2HPI A;  4NC7 A;  2HYJ A;  3K4K A;  4A3L J;  2CWE A;  2MA3 A;  2P6T A;  3VB2 A;  4F3Q A;  3JRH A;  2GXA A;  1HQC A;  2EZH A;  2HYF A;  5GTH C;  1LJ9 A;  3T5X A;  4RLQ A;  3FDY A;  2KIF A;  2DA7 A;  2QQA A;  5FRN A;  2PJP A;  5GP9 A;  4EJW A;  3ISP A;  4CO8 A;  1LKX A;  2L7Z A;  3ZMD A;  1X2M A;  3ZQ7 A;  4UUT A;  2F6C A;  4QSH A;  1O3S A;  1YOV B;  3HRU A;  5K7H A;  3WTZ A;  1HKT A;  4L5E A;  2L9V A;  3WTV C;  2JSC A;  5ICF A;  2IA1 A;  3GZN B;  2JQ7 A;  4UXN A;  4LOC A;  2CQX A;  3A1Y A;  5C3E J;  4A6D A;  4RAG A;  2KMU A;  4BL0 B;  3DWL E;  3SFI A;  1WHU A;  1WI3 A;  4N9H A;  4LLN A;  4AVZ A;  3LSP A;  1HOM A;  4IOC F;  2M4K A;  4PSX A;  2M7B A;  1XDS A;  1QVT A;  3KCC A;  4O5V A;  1S9H A;  1S8N A;  2XGC A;  4M3F A;  3W6J B;  4LFU A;  2PN6 A;  3FHZ A;  5HVQ C;  4RGR A;  5A2Q K;  2K85 A;  4R1H A;  4BAC A;  1YLF A;  2UWM A;  5LGT A;  2E1M C;  4M6V A;  2KIS A;  4MQV A;  4P9F A;  3WU2 C;  1BW6 A;  4OWR B;  4CYC B;  1ZHF A;  3DKW A;  2CV2 A;  2XVC A;  1A31 A;  3BDD A;  4KJZ A;  3WTU C;  4ZYA A;  3ZMV A;  1W5S A;  2LYC A;  4PJL A;  3HC7 A;  4M3E A;  5J4Y A;  3KIO A;  3FF5 A;  1R22 A;  1ETX A;  2MFZ A;  2R4G A;  4B09 A;  5HS8 A;  1ZN2 A;  2NVY J;  3RYR A;  3BZC A;  1W36 C;  2Y0M A;  1UMQ A;  4DQ2 A;  3MZH A;  2X6Y A;  4I09 A;  1OCC H;  2XIG A;  4RM3 A;  2FML A;  5D4R A;  1WKM A;  1EF4 A;  1UHM A;  3HDD A;  2UV1 A;  2L54 A;  2K4J A;  4BBR J;  2RV8 A;  1ZGW A;  2DA1 A;  2IGK A;  2NRA C;  3IHU A;  1D8J A;  2AXT C;  3MFK A;  3CJQ B;  3K69 A;  4BHP A;  1SFU A;  3TP0 A;  3IAM 2;  3ABT A;  5GAH J;  2G9W A;  4MFD A;  1T56 A;  4MEY F;  2DT6 A;  1YS6 A;  1OR7 A;  3CMY A;  1E3H A;  5K7F A;  3PFY A;  1P92 A;  2ZFW A;  2IT0 A;  4OIP F;  4HA8 A;  2CJJ A;  5E18 F;  3B73 A;  2XAF A;  2DXI A;  2F4I A;  1L3L A;  1O3T A;  5L3G A;  4IRG A;  2W48 A;  1ETV A;  2Y75 A;  3ASO H;  1FBU A;  1QQI A;  1Z67 A;  2Q2E B;  2MD0 A;  4CZZ A;  3H3V K;  3IKV A;  4EV0 A;  2X51 A;  4IX7 A;  3WE2 A;  1LE8 B;  1FZP B;  2GAU A;  1ZG5 A;  1ZR4 A;  3SHF A;  3G71 I;  3PNT A;  2R7S A;  1FYL A;  1OCR H;  2KIQ A;  4BY7 J;  1XS9 A;  4EJO A;  3F0C A;  5IT9 Z;  3JRE A;  1XC5 A;  4MIM A;  1SFX A;  1BR1 A;  2ZNY A;  5M5Y J;  2TCT A;  3H0G J;  3FXR A;  1QZE A;  2EK5 A;  3PO3 J;  3LQQ A;  2K27 A;  3CLQ A;  4ETS A;  1ZYR F;  3CC2 I;  1IN5 A;  1Q1V A;  2I5U A;  3K1P A;  2E1C A;  1U9O A;  1CGP A;  4PK4 A;  4FX0 A;  4A5M A;  1B8I A;  2L9S A;  3K70 C;  1EJ9 A;  2CRG A;  3U2R A;  3QOD A;  5H2F C;  2PQ8 A;  4X1E A;  3QOP A;  2JN6 A;  4ZH4 F;  3C2H A;  1XMK A;  3DF8 A;  1U5T A;  1YW8 A;  3R4K A;  3GYH X;  1VZ0 A;  3ML6 A;  1G59 A;  3K4L A;  1O7F A;  2QYO A;  4L0Z B;  4BBS J;  1RNL A;  3S93 A;  3C7J A;  3H5R A;  4A3I J;  1LUJ B;  1WJE A;  1FPQ A;  2B0L A;  1JGG A;  3WGG A;  1D1C A;  1SC7 A;  4L9N A;  3HIF A;  4H0E A;  3E6M A;  1UB9 A;  3ABM H;  5JR3 A;  2Z1D A;  5HLH A;  1LDD A;  3K1N A;  4DJA A;  3KX2 A;  4BJT A;  4HBL A;  4QWQ A;  4B43 A;  1X1B A;  1ZKG A;  2L7K A;  1JI8 A;  1F9N A;  2G7H A;  3ZGK A;  2P8T A;  5F6F A;  4Y15 A;  1BBY A;  1TW3 A;  4HOB A;  4HPQ A;  1RRJ A;  2XF6 A;  1X1D A;  2PBI A;  3V4G A;  3WGH A;  2W82 A;  4EQQ A;  3TO6 A;  3E6D A;  5EZG A;  5FLX K;  1ZRC A;  3FHN A;  2CV0 A;  3MQ0 A;  1MBK A;  2HGC A;  2ZME A;  4NQW B;  4KIG A;  2VJJ A;  3U1K A;  4HAM A;  2CUE A;  2M30 A;  4IHY A;  1ENH A;  3S1Q J;  4E7S A;  4M74 A;  4QPO A;  5BMZ A;  4HST A;  3M1C A;  4ZC3 A;  1YX5 A;  2WB1 A;  2K9N A;  1S7A A;  1ZAO A;  2WV1 A;  2NVT J;  2R7V A;  2N8G A;  4CCO A;  4NUB A;  2FX0 A;  3KPH A;  4C9Y A;  5B1B H;  2D1H A;  1YIT I;  1GDT A;  1WI9 A;  2PMH A;  3DU5 A;  1JJ8 C;  4ENJ A;  4GDF A;  3FXL A;  1IDZ A;  3K4C A;  2UXX A;  1LFU P;  4LIT A;  1GHC A;  1ETY A;  2V1U A;  4HSR A;  1R5G A;  1I3A A;  2VXD A;  2JA6 J;  1G8X A;  4AD9 A;  3BOQ A;  4ZDO A;  1Y8Q B;  2PMZ A;  4IPA A;  1BIB A;  2GXG A;  3VWB A;  3OMY A;  5LEJ A;  3DBL B;  5D8K B;  2XF5 A;  2VPR A;  2X0L A;  1R00 A;  1QHG A;  2JJ7 A;  4I6Z A;  1S7E A;  3IP4 B;  3BTJ A;  1LB2 A;  2NOG A;  3E0J B;  2HVR A;  5JHF A;  5D5W B;  1SEU A;  1ZR2 A;  1SVM A;  1PUF A;  1B72 B;  2IS4 A;  1FWZ A;  2JUC A;  2HEO A;  3PNY A;  4Y52 J;  3JTG A;  1MMS A;  4GO1 A;  4G6T B;  1H89 C;  2O7O A;  2DQL A;  2V26 A;  1GVJ A;  1ULY A;  2XV4 S;  2UZK A;  2FRH A;  3W2A A;  3SFZ A;  2A69 F;  1FTT A;  3FWE A;  3A0H C;  3E6B A;  3KE2 A;  5CQG A;  4N4O B;  3AAF A;  2EZK A;  4K2E A;  5EG0 A;  1A35 A;  3GO5 A;  3H3U A;  5FGM A;  3QYF A;  3EPZ A;  2VJI A;  2DLL A;  2KKO A;  3FK6 A;  4M73 A;  3E1S A;  3WTY C;  3BRO A;  3JRF A;  3OYB A;  4PJ0 C;  2I8D A;  4EGZ A;  1V3F A;  2H94 A;  1KU2 A;  1RI7 A;  2P5L C;  3HUG B;  5J3L A;  1R71 A;  2ZXJ A;  2VJ4 A;  1OR7 C;  4N4N B;  1HCR A;  1QU3 A;  1U0J A;  4AWX B;  2AQF A;  2F5V A;  1JHH A;  1X3Z B;  2LBF A;  3O2P E;  3HJE A;  2L01 A;  5ILS A;  1UHW A;  1DU0 A;  2P6S A;  1OCP A;  1BI0 A;  3S32 A;  3LSK A;  1SD5 A;  4LD5 A;  5F0H A;  4E7K A;  3AL0 C;  3OL3 A;  3CD6 I;  1E3P A;  2VKV A;  1T2K A;  2KRC A;  1RZ4 A;  4G7H F;  2QLZ A;  3FXM A;  1SFK A;  3TKY A;  3HTS B;  1KU9 A;  2LSO A;  3RPQ A;  1BOA A;  1VQO I;  3KFW X;  4Y33 A;  4D0P A;  4HLY A;  4L5I A;  2VKE A;  1Z05 A;  3R6S A;  2HS5 A;  2ID3 A;  5HNF A;  2I10 A;  4OAY A;  2GA1 A;  2XAU A;  1LVK A;  3H9G A;  1W7P B;  2MG4 A;  1A5J A;  2O3F A;  3WG9 A;  3HPH A;  3IH4 A;  4MTE A;  4L0Y B;  1YS7 A;  4KIB A;  4BH9 A;  2CG4 A;  2QQ9 A;  1APL C;  5FB2 A;  2IAI A;  3CCE I;  2FMY A;  3H0D A;  2EFW A;  2WV0 A;  1R1T A;  1QRY A;  3CJN A;  3GVA A;  5HLG A;  4BE0 A;  3AFH A;  4HDU A;  4ZTJ A;  4HNU A;  3CCU I;  3M7G A;  3DEU A;  3FXK A;  3LFU A;  1U5T C;  3TBI A;  4O3M A;  3QPS A;  5LGU A;  2A5Y B;  2CMP A;  1SD7 A;  1XG1 A;  3K4J A;  5EGO A;  2GBY A;  5J47 A;  3ABU A;  1P9Q C;  3GFM A;  4E7J A;  1E0E A;  3UNG C;  2ZBK A;  1Z3Y A;  3QPL A;  2EIJ H;  5F27 A;  3BG6 A;  4C3J J;  4KMF A;  2BV6 A;  4DZP A;  4CDG A;  4BDZ A;  4ZZL A;  4B47 A;  3L9F A;  4S05 A;  4B3X A;  4ESJ A;  2LK2 A;  2L9R A;  1I5Z A;  2UUZ A;  2XKP A;  4Q47 A;  2XB5 A;  3V42 A;  3TW6 A;  1Z6R A;  4DZJ A;  2ZJ2 A;  2IGN A;  5B5E C;  3FM3 A;  3S3M A;  1WH7 A;  1HST A;  5FFZ A;  4II3 A;  1R58 A;  1FBS A;  3HKZ N;  3TP3 A;  3V7R A;  2R5Y A;  1GXP A;  3K0L A;  4B48 A;  1UST A;  2LFB A;  4KMU X;  1UCR A;  2K40 A;  3GZ5 A;  1FY7 A;  2ZME C;  5BQT A;  4JX5 A;  3G73 A;  4LG0 A;  1BIA A;  1QHH D;  2AQE A;  4UUS A;  3KP5 A;  2CFO A;  4LLG F;  2XGE A;  3JRA A;  1OCO H;  3FMR A;  1EV7 A;  2Z3Y A;  3FKJ A;  4IQ4 A;  1B1B A;  5GPC A;  5B3S H;  1X4P A;  2QKM B;  4DNC A;  2VC0 A;  5FJ8 J;  4G94 A;  1XN7 A;  4J01 A;  2JRT A;  3VFZ A;  2XB0 X;  2WWY A;  3EUH A;  2DMT A;  2LC2 A;  3CMA I;  2X6X A;  2GWR A;  1S7O A;  1IXS B;  3IH3 A;  5DCF A;  3M8F A;  1MND A;  2Z33 A;  4IHX A;  2KRF A;  4XN0 A;  3L2R A;  2R7Q A;  1JTY A;  4RGU A;  1YRN A;  2DU9 A;  5K1Y A;  2EZI A;  1TP4 A;  3W2W A;  2LY1 A;  3A2K A;  2WAD A;  3TL4 X;  3A01 B;  3G2B A;  1UAA A;  3FZV A;  5E17 F;  5A2Q Z;  3AG4 H;  5L3D A;  2KLO A;  4XNF A;  1JGS A;  4OMY A;  4LB5 A;  3P5J A;  1MMD A;  1XD7 A;  3WOD F;  3G1L A;  2F4M B;  2DJI A;  4Y4R A;  4IF4 A;  3GCM A;  3RPU D;  1VQP I;  5D6E A;  1YYV A;  2QSF X;  1Y56 A;  3KP4 A;  3DKY A;  1R7J A;  2F5E A;  2VON A;  2O8X A;  2OA4 A;  2X1E A;  3J80 K;  2DN0 A;  1D0Z A;  3ELK A;  2LG4 A;  1WJD A;  3GTP J;  2LDU A;  4ASN A;  2A05 A;  3G3Z A;  4LIU A;  4PZJ A;  1Y0U A;  2D5V A;  2CQN A;  2H6C A;  1QBJ A;  3LFK A;  4XOT A;  3M4O J;  2GOM A;  4F91 B;  4RAY A;  2DPU A;  1K6Y A;  3P9K A;  4KA4 A;  1DP7 P;  3DPU A;  3TOA A;  2DT7 B;  1SAN A;  2ELJ A;  5ILU A;  2VKH A;  5FLM J;  3I58 A;  1ZRE A;  1QGP A;  1S3J A;  4NDL A;  2LH9 A;  4XON A;  2COB A;  1O3Q A;  4GCV A;  2JMW A;  2IEK A;  4UY8 I;  4BNC A;  3CES A;  2NS0 A;  4BJ6 C;  5C4X J;  1X1C A;  3AL0 B;  1STZ A;  2HFH A;  2VQC A;  1MH4 A;  2FQ3 A;  4XLP F;  4A0Z A;  2KZG A;  5ILV A;  1U8B A;  1XTA A;  4B44 A;  2BEO A;  5DDG A;  2HQR A;  5E1X A;  2EV6 A;  3E3V A;  1MNM C;  3NWT A;  3I55 I;  3BLY A;  1LDK B;  1OJL A;  2Q0O A;  4P96 A;  1IF1 A;  3S1M J;  1T98 A;  1BA5 A;  2LY2 A;  2R0Q C;  2IXS A;  1R4M B;  4YEL A;  1IG7 A;  2V6E A;  2QCO A;  1K78 A;  3TO9 A;  1JUM A;  1WCM J;  3GBG A;  5L3C A;  5IYD J;  4V2G A;  3CMM A;  2ZKZ A;  1USS A;  1IRF A;  1DGR M;  1YE9 A;  2FSW A;  1QZZ A;  4PUS A;  1JXS A;  1FTZ A;  2W1O A;  1MJA A;  4O6J A;  2VUM J;  2RAE A;  1Z7U A;  5EDN A;  1SVL A;  3HYI A;  4HW0 A;  4DYQ A;  1B9N A;  3CP8 A;  3T8R A;  2M87 A;  1OPC A;  2FJ1 A;  3PQK A;  5FKN A;  1CQT A;  1WJA A;  2OQG A;  2KPM A;  4HLX A;  1KON A;  3ZXS A;  2BGC A;  5LRS A;  4E7L A;  3RKW A;  4CCJ A;  2R7T A;  3F6O A;  3Q0U A;  4ZDP A;  2W85 A;  1TWH J;  2BBY A;  4JBA A;  2BY0 A;  1YHQ I;  1TWA J;  1H0M A;  3HSF A;  4P5O A;  4CCN A;  1XMA A;  1NHA A;  2DT5 A;  2YU9 J;  2K9M A;  2DYR H;  4KIC A;  3RQI A;  3E5U A;  2F5F A;  4KFC A;  1Z3X A;  2ADU A;  2XUB A;  3GLL A;  3LSG A;  1KA8 A;  1TWG J;  1IDY A;  1AWC A;  3RTR A;  2H8R A;  3KP7 A;  3BQY A;  5FLX Z;  3KZY A;  4L9T A;  4M3G A;  2E5Z A;  2X9D A;  1ETW A;  4OIN F;  3ZQQ A;  2E7W A;  2DFF A;  1K6O A;  5ERI A;  2R5Z A;  1X3U A;  2ZME B;  4AID A;  3KLO A;  3V8K A;  3JTH A;  4QTR A;  3F22 A;  2ZC2 A;  1G3Y A;  2DQR A;  5IOZ A;  1KU3 A;  3K1M A;  2ACJ A;  1F43 A;  5M3M J;  2X48 A;  4M9Z A;  3MEX A;  4PJJ A;  3L2W A;  1ZH5 A;  4BGD A;  3PSF A;  5IT3 A;  3R60 A;  5HDN A;  4D5F A;  4EJV A;  3KP2 A;  2PMU A;  5FKM A;  2UXN A;  2YX7 A;  3VSK A;  5K7Z A;  4HF2 A;  3LA7 A;  2D45 A;  1JHF A;  2E35 A;  1IW7 F;  2Y30 A;  2IS2 A;  2IPQ X;  1XGM A;  5L3F A;  4BQN A;  4C2U A;  4JP0 A;  2O8K A;  2KP6 A;  2WC2 A;  4FT8 A;  4DBR A;  3FIW A;  5DYM A;  4IOA F;  3QPT A;  4CCK A;  3VOD A;  3EUH C;  3CUQ B;  3MZ8 A;  2OAZ A;  1VQL I;  1VQ5 I;  4KNY A;  2BVL A;  3VPR A;  3TDU C;  2E60 A;  2HKO A;  2MGQ A;  1K4T A;  3BG3 A;  3LSI A;  4H4K C;  2K5C A;  4Q48 A;  4EJU A;  3K4B A;  5D5X B;  2E7X A;  4OAZ A;  3K2A A;  5K5R A;  2CFX A;  1G3W A;  3E97 A;  2VBW A;  3KEY A;  2XC7 A;  1MIJ A;  4U88 A;  1AOY A;  2F5D A;  3KEQ A;  3CF5 F;  1RKW A;  1I1G A;  2PLY A;  1TWF J;  1FC3 A;  3PSI A;  4S0H B;  3HOZ J;  1LFB A;  3KZZ A;  2ZNZ A;  4B8X A;  1PUF B;  3RJP A;  1BI1 A;  1AU7 A;  2ME0 A;  2NAZ A;  3J81 K;  3W6K B;  3OYN A;  2V9V A;  3K7A J;  1RUO A;  5C4J J;  3DTE A;  1K79 A;  3I56 I;  5EEG A;  5J8C A;  4N0B A;  3HOW J;  4XRS G;  2JVG A;  4RBO A;  3DPL C;  3VYT B;  4M6Y A;  2HXO A;  3DKX A;  5EG0 B;  3PNV A;  1VI0 A;  3N05 A;  2XHK A;  3HKZ A;  3F6V A;  4JQF A;  4CH7 A;  3GTQ J;  1EH8 A;  2E34 A;  2VAS A;  2QBY A;  1VTN C;  1K83 J;  3MMY B;  3DLL F;  1VQ6 I;  4UB6 C;  1NTC A;  3IWF A;  3U9G A;  1POG A;  2BHY A;  3C18 A;  1XX5 A;  1MD0 A;  3CCQ I;  2JA5 J;  4BXX J;  1BM9 A;  4AM3 A;  2EV5 A;  1Z0X A;  4XLC A;  2DTR A;  2XAH A;  3OWT A;  2B7E A;  2FEZ A;  3QYB A;  1MNE A;  3KEO A;  1EH7 A;  3S14 J;  1JKQ C;  4QIW N;  2LBF B;  1WWX A;  2KJC A;  3BR6 A;  1DUX C;  1OKR A;  3ZQG A;  2JA8 J;  1O7L A;  5HOD A;  1MBJ A;  4G9Y A;  2EFP A;  4UV9 A;  3IL2 A;  2DYS H;  2ME6 A;  2HR3 A;  4YG2 F;  4Q4Z F;  1WVR A;  2WAE A;  4U87 A;  3BQZ A;  1ODD A;  3HSR A;  2LNB A;  2EIL H;  4W97 A;  4GYG A;  4ABZ A;  4YRV A;  1ZGA A;  2DDA A;  2JUG A;  3K9T A;  2Q8K A;  4UNO A;  1MMA A;  5DD8 A;  4A2U A;  3MWM A;  4MLO A;  4XRS A;  2FF4 A;  5FD5 A;  2HPM A;  4RA2 A;  2HOS A;  4S04 A;  2WAQ N;  2D2W A;  3WG7 H;  3K2Z A;  5JFR A;  2GQQ A;  1IV8 A;  2Q1Z B;  2VKD A;  2A07 F;  2YSR A;  4PJN A;  1BN5 A;  2YS9 A;  1OYW A;  3BTC A;  3BCB A;  3OYM A;  4XR6 A;  3GFI A;  1VQ7 I;  3TDZ C;  5F0C A;  4AVP A;  4L9V A;  2IJL A;  5DCM A;  1F4K A;  3O6B B;  2KT0 A;  1TBX A;  1BJA A;  1VQ8 I;  3BPX A;  1U9N A;  1OYY A;  1H9G A;  3S16 J;  2M9H A;  5D8L B;  1J5Y A;  3HOT A;  1I6H J;  2E71 A;  2HQN A;  4II2 A;  2X6O A;  4UHT A;  5EGO B;  4RAF A;  2WBM A;  1DQU A;  3SDB A;  2F2E A;  4FET A;  3ZOB A;  3GTG J;  3SDG A;  2VB6 A;  4DYR A;  3I4N J;  3BJO A;  2VQL A;  3F8N A;  2DOD A;  4M72 A;  3DBR B;  4EM0 B;  4BE1 A;  3KYC B;  1XCB A;  1IJW C;  2ELH A;  1I6X A;  2P0W A;  4EJT A;  4OIQ F;  4A3J J;  5ICC A;  1NG6 A;  3D5S C;  5KCM A;  4M9X A;  3HGY A;  4G6Q A;  3QYE A;  1R6R A;  1HA8 A;  4BEH B;  2ICW G;  4IHV A;  3I0T A;  1HW1 A;  1ETK A;  4F92 B;  3CCL I;  2R7X A;  3CF2 A;  2PEX A;  3TQN A;  2M34 A;  2EBI A;  1W5T A;  4M71 A;  2Y2Z A;  5DM7 F;  4AIH A;  2R5Y B;  2KIM A;  2NYX A;  3V7S A;  3ZQI A;  4RDU A;  5GPA A;  2V9P A;  1YW7 A;  4CXF A;  1BI2 A;  2JPB A;  1KQ0 A;  2E1O A;  4XLH A;  2IRF G;  2PJR A;  1T08 B;  1ZK8 A;  4AYB N;  2CU7 A;  4LG0 B;  5FKO A;  1TQI A;  5ICE A;  4MNU A;  3OYL A;  5H6Q A;  1IC8 A;  3MVP A;  4BXU A;  3LQR A;  4ESB A;  3EUK L;  1BC8 C;  4RS8 A;  1N77 A;  2QEX I;  2VN2 A;  1W7P D;  4PFP A;  3A0B C;  1T6S A;  5JHU A;  3RPU A;  2STW A;  2VBZ A;  1JT6 A;  2JA2 A;  3H5A A;  1FMW A;  2H1L A;  2W4S A;  1IZ1 A;  1Y6I A;  4JYK A;  4PGG A;  5TRD A;  1MSE C;  2ID6 A;  5HLI A;  3PUF A;  4G6D A;  4M6X A;  1CF7 B;  2P5V A;  4V2F A;  2OF7 A;  5HDK A;  2P7C B;  2EV0 A;  4IL6 C;  4BJ5 C;  3R61 A;  2YUS A;  1VF9 A;  4MTD A;  5JVT A;  2LF8 A;  1GV5 A;  2QM3 A;  4LK0 F;  2VBY A;  5HOO A;  3OOP A;  2E1M B;  5J1Y A;  1WZ2 A;  2CYY A;  2HQA A;  1B59 A;  1B4A A;  3OSF A;  1XGS A;  3J7Y J;  1IN6 A;  3S3O A;  1EA3 A;  4P9U A;  4OIO F;  3WU1 B;  1HDP A;  1T8I A;  3ZR8 X;  1BJZ A;  3HGG A;  2ZXI A;  3O3K A;  3I59 B;  2K7L A;  1DDN A;  3JRD A;  1B9M A;  3SZP A;  1J75 A;  1WJB A;  5HS7 A;  3J80 Z;  1P7I A;  1REP C;  2ZCW A;  2K9Q A;  4KIT B;  1Z9C A;  3HG9 A;  5IYC J;  2XGX A;  3AKZ A;  1Z77 A;  2HQ5 A;  3H9J A;  4IRI A;  5LFA A;  1SAX A;  2BYV E;  3GXO A;  3NRV A;  3OIP A;  4Q5S F;  1V4R A;  1S6L A;  3RCO A;  1IAW A;  4CSW A;  2ZB9 A;  2EZL A;  1H9T A;  1TNS A;  3BP8 A;  2KDZ A;  4AIJ A;  4BHB A;  3EYY A;  5LGN A;  2AS5 F;  1SD6 A;  5CKT A;  3GUD A;  1RR8 C;  1BR2 A;  1W5C C;  4PSW A;  3D5R C;  1OCZ H;  2BY1 A;  1I1S A;  3A4C A;  2K02 A;  1WFX A;  3GW2 A;  4IXA A;  2K3F A;  4R8H A;  1JKO C;  1W1W E;  5IY5 H;  1VND A;  4IEJ A;  3CCS I;  4A93 J;  2O61 A;  2NNN A;  1U6G A;  2XPV A;  1P7J A;  2X85 A;  4NC6 A;  4A5N A;  1JUS A;  2L7M P;  4FE4 A;  3LA3 A;  3AG2 H;  5LRR A;  3QU3 A;  2V79 A;  2GLO A;  2FBI A;  2QSG X;  5J40 A;  3KYL A;  3OYI A;  4U7B A;  4WWC A;  1BOB A;  4LG3 A;  5CQE A;  5E1Z B;  1G2H A;  2GIV A;  2P5K A;  1ZTR A;  2LKS A;  2RRE A;  2E2J J;  1U2W A;  2ELK A;  2K9L A;  2Y0S N;  1FLI A;  1AKH B;  3KP6 A;  4BQO A;  3V8L A;  4LGW A;  1FP1 D;  2PI0 A;  1DPU A;  1K78 B;  3M1E A;  4AIK A;  1R5H A;  4V19 K;  3WE3 A;  1DPR A;  2CV1 A;  1DU6 A;  2QVO A;  2M7A A;  1LEB A;  4TV7 A;  2HOA A;  1QZY A;  5FLV A;  3ZP5 A;  1J9I A;  3IUO A;  5DD4 A;  4RAZ A;  1ZG1 A;  2XSJ C;  3HHH A;  4CHU A;  5EYR A;  5GAE J;  1AA7 A;  5J6X A;  4IJA A;  3BR2 A;  5H20 A;  5J1U A;  1TL8 A;  3GTO J;  4XBF A;  1A04 A;  1MDM B;  3IWZ A;  1PYV A;  1YTY A;  1X3W B;  4PDK A;  1FYM A;  2EH3 A;  4RGX A;  3P9C A;  3ZMT A;  2ECC A;  4E4H A;  1KQ8 A;  4KIS A;  3RKQ A;  4WF2 A;  4XOP A;  5CYV A;  2V6C A;  5KK1 A;  5IT9 K;  5BNG A;  3CJR B;  3G1O A;  4XL9 A;  2IP2 A;  3B6A A;  1UEL B;  1E2X A;  1ZAR A;  2C6Y A;  2VT3 A;  2LF7 A;  4X0G A;  1EKE A;  2BE5 F;  1MSF C;  4P55 A;  1MMG A;  4BE2 A;  4BYY A;  3CLO A;  5LLQ A;  1YO5 C;  2PFB A;  1X58 A;  3DQV C;  1FOY A;  2OC6 A;  2Y31 A;  3EQL F;  4WXC A;  5K5O A;  3G4S I;  1G3T A;  2IS6 A;  1FOX A;  2VI6 A;  1HBX G;  2KRH A;  1YQA A;  2DA4 A;  4I0A A;  3TO7 A;  4A3E J;  3E5X A;  5LHG A;  2VE9 A;  4FQG A;  3AG3 H;  1IN4 A;  3T0Y A;  3BG9 A;  3OSG A;  4UB8 C;  1HC8 A;  3O8G A;  1T38 A;  3CO7 C;  1YI2 I;  5F08 A;  2TDX A;  3F3X A;  1JT0 A;  2XSD C;  3I9V 2;  1A36 A;  5KHD A;  3DEW A;  3JSP A;  2DA6 A;  2CW7 A;  4HX4 A;  2HOT A;  2W84 A;  1VQ9 I;  3ZN1 A;  2VT2 A;  5M5W J;  4BS9 A;  3FXU A;  2CW8 A;  5GTI C;  2F5C A;  1TWC J;  3ZMS A;  5E8I A;  2WAQ A;  3T1B A;  4I0B A;  5AON A;  1A6I A;  1VQM I;  2OZU A;  3Q3S A;  1RIO H;  4NNJ A;  3DEE A;  4NQW A;  2DAO A;  2RC4 A;  2MYS A;  4YIR X;  2KFD A;  2BVM A;  1GVD A;  1XSD A;  3HXL A;  1MZB A;  3X2Q H;  2K3P A;  3JAM K;  3OS1 A;  2F48 A;  1T95 A;  1ONV A;  1ITY A;  2DMQ A;  1UJ8 A;  1TQM A;  3JW4 A;  3OV8 A;  2FU4 A;  1ON1 A;  4HRI A;  4A3B J;  3E6C C;  4GFB A;  4A3D J;  3ZCO A;  2DMU A;  2P4W A;  3KET A;  2MC4 A;  3J81 Z;  1FEX A;  3FKI J;  2MLK A;  3H1C A;  1ZLJ A;  1R49 A;  3HZJ A;  3W6V A;  1R23 A;  3CZ6 A;  3DBH B;  3Q9V A;  4KDP A;  1P4A A;  3K4M A;  3KLN A;  2VL8 A;  5IP6 A;  4E7I A;  4DBQ A;  4AU7 A;  1EH6 A;  5LEK A;  3CDH A;  2XF7 A;  2FXA A;  2WAF A;  2VBX A;  3U1D A;  4HF0 A;  5E8G A;  3COA C;  2GXB A;  5FKL A;  3IAS 2;  2H1K A;  5KAF C;  4IRH A;  2DDB A;  3CME I;  1Y8R B;  2G7U A;  4W1U A;  3HBL A;  2LRE A;  2LY9 A;  2XAQ A;  5JI6 A;  3HSE A;  3ERE D;  1P2F A;  1W0T A;  3I4P A;  2OZ6 A;  2QBY B;  1OQY A;  4U0V A;  1FSH A;  2QQ8 A;  2JVH A;  5EEA A;  2ISY A;  1MBE A;  2AHQ A;  2EJR A;  2Z5U A;  1ORK A;  3I3L A;  4AYB A;  3V7C A;  5BPI A;  5HLT A;  1B72 A;  4IHS A;  5DEQ A;  4R79 A;  4M3D A;  1YJN I;  2LR8 A;  3EET A;  1S5L C;  1J59 A;  2HVS A;  1R4N B;  2DK5 A;  3Q9S A;  3OR2 C;  1V5G A;  5E79 C;  5F1J A;  4A3C J;  5FRM A;  3GME A;  3S2D J;  4OOI A;  4FIS A;  3VYR B;  3OYA A;  4HQM A;  4LIV A;  3RI4 A;  3WGI A;  4CGZ A;  3OYC A;  3UR3 C;  3N4M A;  4J19 A;  3D0S A;  5D6F A;  3M8J A;  3JRI A;  3H5N A;  3K10 A;  1RR7 A;  4E7Z A;  1SFE A;  2XPU A;  4XQF A;  1SFO J;  4M9S A;  3M9A A;  1HKQ A;  1XGN A;  5BS6 A;  3RDI A;  5FRO A;  1XCV A;  2P7V B;  3PQJ A;  2MW8 A;  1XGO A;  1N25 A;  2X1D A;  3HRS A;  1K4S A;  3Q5F A;  1MBF A;  4XKC A;  4ZYG A;  2WA0 A;  3VSL A;  3F21 A;  2W24 A;  1O57 A;  1YJ9 I;  2FOK A;  2IA2 A;  4ENM A;  1LVA A;  3HRT A;  1VQN I;  1FBQ A;  1QPI A;  1B6A A;  2IVM A;  1OLT A;  3FXJ A;  1TW2 A;  2EPF A;  9ANT A;  4PCQ A;  2QGU A;  4F55 A;  5GAG J;  2R92 J;  2WY7 Q;  1T0F A;  1V5E A;  3CQZ J;  4GXO A;  1B8I B;  1U78 A;  2E5N A;  3ZRG A;  1SMY F;  2FQ4 A;  2XRO A;  1C0W A;  1V54 H;  4HDV A;  3FXQ A;  2AXL A;  1KU7 A;  5J1R A;  3BWG A;  3G1M A;  3CC4 I;  1U5T B;  2NNY A;  4RLF A;  1IUY A;  3BR5 A;  3GF2 A;  3SZT A;  2EIN H;  2A68 F;  3M07 A;  1P4W A;  2DCE A;  3G6E I;  2WB1 N;  3FX3 A;  4WK8 F;  5FKK A;  4I99 C;  1KQ9 A;  2DA2 A;  5EEH A;  3J7A O;  4HEA 2;  2VOO A;  4A3G J;  3ZMZ A;  2OD5 A;  1FYK A;  3I5U A;  1N78 A;  1R1V A;  4A0Y A;  4Z6Y A;  1Z91 A;  4U7D A;  2W7N A;  1WRJ A;  4LLL A;  4I76 A;  2MLG A;  1W7P A;  5IOY A;  2M1B A;  2FOW A;  2ECB A;  3HRM A;  3GFJ A;  4FCY A;  2DFI A;  2O9L A;  1WJ5 A;  2PG4 A;  3OYH A;  4ZYE A;  1FP2 A;  3ESW B;  3TGN A;  2WTE A;  1LEA A;  4EAT A;  1QA6 A;  1XDU A;  3MKY B;  5DUK A;  2R7F A;  3E7L A;  1W4M A;  2ZJQ F;  2CUJ A;  2LVS A;  4NHJ A;  2PJR B;  2B63 J;  1O4X A;  2R7Z J;  3ECO A;  2IGM A;  3FMQ A;  2PX9 A;  2NS8 A;  3DTI A;  2Y0S A;  4C3I J;  1FMV A;  1BL0 A;  3FBN B;  2OTL I;  4RGS A;  1E17 A;  4A3M J;  3QQA A;  3IH2 A;  2CQQ A;  1SVO A;  2OBP A;  3L7W A;  3HHG A;  1G3S A;  2V1X A;  4RM2 A;  2VC1 A;  3LNQ A;  2LMD A;  5E3M A;  3TOB A;  3MKZ A;  2DO7 A;  2LP0 A;  3J7Z I;  1OYI A;  4B3A A;  4RB1 A;  2MH9 A;  5EJC A;  3F8B A;  1QPM A;  2VOP A;  3FBI B;  3GFL A;  3MCZ A;  3VDX A;  4JX4 A;  2OU2 A;  1AHD P;  1X19 A;  1N75 A;  2EWN A;  2BY3 A;  4JK1 X;  3C2G A;  3C3W A;  2IW5 A;  2LKP A;  3KZI C;  2EB7 A;  4I02 A;  1XPX A;  3KYD B;  3GEZ A;  4ENK A;  1TT0 A;  4BAY A;  5F04 A;  3C1D A;  2BW3 A;  3BY6 A;  1IGN A;  4BDY A;  1IRX A;  4YEJ A;  2CO5 A;  3OY9 A;  3RIR A;  3SYT A;  4OIR F;  2DOE A;  3WU0 A;  2KIU A;  2DJN A;  4UVA A;  3GTJ J;  2K9S A;  4HQE A;  4GRI A;  3RYP A;  4UVB A;  5KVR A;  4D7M A;  4EM1 A;  4XLE A;  3A01 A;  4HV5 A;  4BHC A;  3OIO A;  2AO9 A;  1PP8 F;  1F5T A;  4RMN A;  3DU6 A;  1BW5 A;  2GZW A;  3LA2 A;  3ONQ A;  1GLN A;  1GT0 C;  5JLX A;  4CCM A;  3H92 A;  2QUF A;  4ENN A;  2NVX J;  5CLS A;  1FOK A;  3ZPL A;  3DTK A;  4X6A J;  3S1R J;  2O03 A;  2R7R A;  1MBH A;  2DOA A;  4OU0 A;  3RKY A;  3HL2 A;  5B1A H;  2R7O A;  5M5X J;  3HEF A;  1R36 A;  2RKH A;  2BHZ A;  4P1W A;  1ERD A;  1YG2 A;  3F8C A;  3ABK H;  1MBG A;  1PP7 U;  1J2X A;  5LHH A;  1D3Y A;  3CCJ I;  3D1N I;  2VE8 A;  1HW5 A;  2RN7 A;  5DTD A;  4BKX A;  2O6G E;  2M0M A;  3ZN0 A;  2LLK A;  1YIJ I;  3WTX C;  1DGW Y;  5L3B A;  2LKX A;  2QEN A;  4XKW A;  2VPL A;  3PL8 A;  2GM4 A;  4E70 A;  4Y7N J;  4OMZ A;  3E5Q A;  2JZY A;  2M8G X;  4HF1 A;  3A02 A;  5AIP A;  3FM5 A;  1I39 A;  2BY2 A;  2L2O A;  4XM3 A;  5CVR A;  5CVI A;  3HB9 A;  2A3S A;  2RQP A;  2H6B A;  4EEF G;  1DP3 A;  2JK3 A;  1HXD A;  2HTS A;  3F72 A;  3HPG A;  4XID A;  4C30 A;  4RB2 C;  2L4A A;  4KN4 X;  3LSR A;  3CTA A;  1W36 D;  1UZC A;  2GOX B;  6PAX A;  1IN8 A;  3LL7 A;  5FO5 A;  3SXY A;  1FOW A;  3QAH A;  4PFO A;  4F93 B;  2OUM A;  4G7Z F;  1ETO A;  1D1B A;  4LB6 B;  1KZH A;  1ZRD A;  4ESF A;  4RB3 C;  1YIO A;  5HNH A;  3DP7 A;  3K6G A;  3VYU B;  3WHC A;  4IVN A;  4DOZ A;  1IO2 A;  2GIZ A;  3FIS A;  4UVC A;  2DMN A;  1T0F C;  2HOE A;  2J5P A;  5TIS C;  2WY8 Q;  4UUV A;  3HOX J;  3VEP A;  1UG0 A;  4L5J A;  3RZO J;  3IC7 A;  3HM5 A;  4KT6 A;  3HOS A;  4L9J A;  4YFX F;  3L1P A;  1TLH B;  1LDJ A;  5LBQ A;  3LST A;  3WTT C;  1UFM A;  1R5I D;  1MJ9 A;  3IKT A;  1G6N A;  1I3Q J;  1YX3 A;  2E19 A;  1PUE E;  3I71 A;  4HX7 A;  2HXI A;  4I7H A;  5E1W A;  5LHI A;  3ECH A;  3REO A;  4BY1 J;  1Z21 A;  5AIQ A;  4EVI A;  4YIF A;  4I01 A;  3CDL A;  1GUU A;  3GZ6 A;  4IQJ A;  1LFP A;  3FXO A;  1LQ1 A;  2ZJP F;  2EIM H;  4DW6 A;  3DV8 A;  2VQG A;  3OYJ A;  1IN7 A;  1D1A A;  1OMI A;  4NB5 A;  3L2C A;  4FE7 A;  5EZH A;  3OL4 A;  2CUF A;  2R3S A;  3PIP F;  2YX4 A;  3CP2 A;  3ZQC A;  2XKO A;  4HZF A;  4HNV A;  3BTL A;  4ON0 A;  5D5U B;  1SAU A;  2VXZ A;  1JUP A;  1NK2 P;  1WJC A;  3NWS A;  1IRG A;  2QF7 A;  5KNL A;  4UUS B;  4LK1 F;  3K70 D;  3SZG A;  3GLX A;  4DGW B;  1T33 A;  4DYC A;  2VQH A;  2KDO A;  2MD5 A;  2A5W A;  1KYW A;  1TNT A;  3ERM A;  2DA5 A;  2DFE A;  4XK4 A;  4XRM A;  1UHS A;  3GTK J;  2OJE D;  2JSP A;  1OIS A;  2IA0 A;  4E6K G;  1MW7 A;  1IXC A;  4ZZD A;  1SD4 A;  3CC7 I;  4YFK F;  4WX9 A;  1GXQ A;  1TZL A;  3JAM Z;  2YR2 A;  1KGS A;  1W0U A;  2RNJ A;  1YRN B;  1ZLK A;  1KYZ A;  1L0O C;  4CA0 A;  3N97 A;  4ZYH A;  4WXD A;  3D5L A;  2DW4 A;  4CUG A; 
#chains in the Genus database with same CATH homology
 2EFO A;  4WXH A;  3LAJ A;  2HKX A;  3F8F A;  3NEU A;  3R0J A;  1Q1H A;  3IRQ A;  1S29 A;  3S2W A;  2MBF A;  2L3D A;  2E1N A;  3ULQ B;  4XRF A;  5TJJ A;  4KN7 X;  4I2O A;  3CUQ A;  2M45 A;  2L02 A;  2D1V A;  1R1U A;  2A61 A;  1FSE A;  3NQO A;  2STT A;  2M5W A;  5L3E A;  4KIF A;  3WTW C;  3QP6 A;  2EFQ A;  2JPC A;  1Z1D A;  4XLN F;  4Y17 A;  2R7D A;  4HV6 A;  3LWF A;  2GA2 A;  3GWZ A;  4Z2Y A;  1O3R A;  1BC7 C;  3L09 A;  3BZ6 A;  2VOD A;  2K86 A;  3R0A A;  4BQA A;  5D4S A;  4YFN F;  4FX4 A;  1ZGJ A;  3F8M A;  2DK8 A;  2L4M A;  2JTV A;  5CVJ A;  1P4X A;  5FFX A;  1TTY A;  5FD6 A;  2OQR A;  3DPT A;  3SQN A;  1D5V A;  2FA5 A;  3MZY A;  1YFH A;  5F64 A;  2ZO4 A;  5J8F A;  1QO0 D;  4PGH A;  2Q2E A;  1FNN A;  2Z99 A;  5K5Q A;  2CSO A;  4EMS A;  3M8E A;  2HWV A;  4F7Z A;  5F1R A;  3JSO A;  2X4H A;  3FMS A;  3CO6 C;  1SMT A;  2V1D A;  1FX7 A;  3BJA A;  2HDC A;  1IXR C;  2ESN A;  3ROU A;  3HTU A;  3ZMU A;  2FNP A;  4KUM A;  1XSX A;  2Y48 A;  3I54 A;  3V8J A;  2FBH A;  4GYI A;  2CQK A;  4U0W A;  2H09 A;  1U8R A;  2A6E F;  2H27 A;  2K4B A;  3CUO A;  3LAP A;  3I53 A;  3QPH A;  1MKM A;  4L18 B;  1BI3 A;  4EGY A;  3T8T A;  2DI3 A;  4KT5 C;  1MGT A;  2O0Y A;  3QU6 A;  3IRR A;  2DPD A;  5ED4 A;  5CVU A;  1PDN C;  4GGG A;  3H3Z A;  5DV5 A;  3QP5 A;  1Z6T A;  2EA4 A;  3L00 A;  1CF7 A;  1MJB A;  2HYG D;  4YII A;  2CW0 F;  3GX4 X;  3CUQ C;  1G4D A;  3EYI A;  4MQ9 F;  5H6R A;  3DXJ F;  4IHT A;  2YU3 A;  4A0X A;  1HW2 A;  5D5V B;  4A12 A;  3I59 A;  1XB4 A;  3EDP A;  1JE8 A;  4G7O F;  5E20 A;  2A6H F;  1I27 A;  3BPV A;  2MH2 A;  2XAS A;  2QZ8 A;  2HTJ A;  2DBB A;  5ICG A;  1U3E M;  3QRF F;  5CVV A;  4XSZ F;  1WQ2 A;  4CIC A;  3P7N A;  2Z9O A;  3KP3 A;  5HS9 A;  3BJ6 A;  2EFN A;  4MGR A;  2FE3 A;  2QWW A;  1ZRF A;  2M8E A;  1QNT A;  2COM A;  2CGP A;  2W25 A;  5BPD A;  3PFI A;  3I64 A;  4I98 B;  4RB0 A;  1HSJ A;  3B02 A;  1TQP A;  4N9I A;  2RVC A;  5CJ9 A;  3P9I A;  4MHG A;  2KJB A;  3HUG A;  2RDP A;  2FNA A;  2JT1 A;  3F23 A;  4A6E A;  4ZYD A;  1XSV A;  1J0R A;  1WSU A;  5DCM B;  2ETH A;  1ON2 A;  3WTS C;  1J7K A;  2ESH A;  2YPR A;  1D8K A;  4Y13 A;  4U0Y A;  1F1Z A;  4KYW A;  1FT9 A;  2HZT A;  1YW9 A;  1HKS A;  4FHT A;  2FBK A;  4LMY A;  1ZG3 A;  5DUI A;  2MC3 A;  5BOX A;  2QQB A;  2XRN A;  1MDM A;  3DFG A;  2XAG A;  1K7A A;  4EM2 A;  3RKX A;  1T39 A;  2ISZ A;  1LNW A;  4G8X A;  4CYD A;  4WCG A;  2RGV A;  2EA2 A;  2W57 A;  2XAJ A;  1P6R A;  4HX8 A;  2J5O A;  3MAJ A;  4UV8 A;  4QLC U;  4MEX F;  4LJZ F;  4HYE A;  3VOE A;  4XSX F;  1RUN A;  5HDG A;  2CWE A;  2MA3 A;  2P6T A;  3VB2 A;  1HQC A;  2HYF A;  1LJ9 A;  3T5X A;  2KIF A;  2QQA A;  2PJP A;  4EJW A;  3ISP A;  4CO8 A;  3ZMD A;  3ZQ7 A;  1O3S A;  3HRU A;  3WTZ A;  1HKT A;  3WTV C;  2JSC A;  5ICF A;  2IA1 A;  4UXN A;  4A6D A;  4N9H A;  4LLN A;  1XDS A;  3KCC A;  4O5V A;  1S8N A;  3W6J B;  4LFU A;  2PN6 A;  3FHZ A;  5HVQ C;  4RGR A;  5A2Q K;  4R1H A;  1YLF A;  2UWM A;  5LGT A;  4MQV A;  4P9F A;  1ZHF A;  3DKW A;  2XVC A;  3BDD A;  3WTU C;  3ZMV A;  1W5S A;  3FF5 A;  1R22 A;  5HS8 A;  4B09 A;  1ZN2 A;  3RYR A;  2Y0M A;  4DQ2 A;  3MZH A;  4I09 A;  2XIG A;  2FML A;  5D4R A;  1WKM A;  1UHM A;  2L54 A;  2K4J A;  2RV8 A;  2NRA C;  3IHU A;  1D8J A;  3MFK A;  3K69 A;  4BHP A;  1SFU A;  3ABT A;  3ZPL A;  2G9W A;  4MEY F;  1YS6 A;  1OR7 A;  1P92 A;  2ZFW A;  2IT0 A;  4OIP F;  4HA8 A;  5E18 F;  3B73 A;  2XAF A;  1L3L A;  1O3T A;  5L3G A;  4IRG A;  2Y75 A;  1FBU A;  1QQI A;  4CZZ A;  3IKV A;  4EV0 A;  3WE2 A;  1FZP B;  2GAU A;  1ZG5 A;  3SHF A;  1FYL A;  5IT9 Z;  4EJO A;  1SFX A;  2ZNY A;  3FXR A;  2EK5 A;  3LQQ A;  2K27 A;  4ETS A;  1ZYR F;  1IN5 A;  3K1P A;  2E1C A;  1CGP A;  4FX0 A;  4A5M A;  3U2R A;  2PQ8 A;  3QOP A;  4ZH4 F;  1XMK A;  3DF8 A;  1U5T A;  1YW8 A;  3R4K A;  3GYH X;  3ML6 A;  1O7F A;  2QYO A;  4L0Z B;  1RNL A;  3C7J A;  1FPQ A;  2B0L A;  3WGG A;  4L9N A;  3HIF A;  4H0E A;  3E6M A;  1UB9 A;  5JR3 A;  5HLH A;  1LDD A;  3K1N A;  4HBL A;  4QWQ A;  1F9N A;  2G7H A;  2P8T A;  5F6F A;  4Y15 A;  1BBY A;  1TW3 A;  4HOB A;  2PBI A;  3V4G A;  3WGH A;  4EQQ A;  3TO6 A;  3E6D A;  5FLX K;  1ZRC A;  3MQ0 A;  2HGC A;  2ZME A;  4KIG A;  4HAM A;  2M30 A;  4M74 A;  5BMZ A;  1S7A A;  1ZAO A;  2D1H A;  1WI9 A;  2PMH A;  4ENJ A;  2UXX A;  1GHC A;  2V1U A;  1R5G A;  4AD9 A;  3BOQ A;  4IPA A;  1BIB A;  2GXG A;  5LEJ A;  5D8K B;  2X0L A;  1R00 A;  1LB2 A;  5D5W B;  1FWZ A;  2HEO A;  3JTG A;  4GO1 A;  2DQL A;  1GVJ A;  1ULY A;  2XV4 S;  2UZK A;  2FRH A;  3SFZ A;  2A69 F;  3FWE A;  3KE2 A;  3E6B A;  3AAF A;  4K2E A;  3GO5 A;  3H3U A;  5FGM A;  2DLL A;  2KKO A;  4M73 A;  3WTY C;  3BRO A;  4EGZ A;  1V3F A;  2H94 A;  1KU2 A;  1RI7 A;  2P5L C;  2ZXJ A;  4AWX B;  1JHH A;  3O2P E;  2L01 A;  5ILS A;  1UHW A;  2P6S A;  1BI0 A;  4LD5 A;  1SD5 A;  1T2K A;  1RZ4 A;  4G7H F;  2QLZ A;  3TKY A;  3HTS B;  1KU9 A;  2LSO A;  3RPQ A;  1BOA A;  3KFW X;  4D0P A;  4HLY A;  4L5I A;  1Z05 A;  3R6S A;  2HS5 A;  2GA1 A;  1W7P B;  2O3F A;  3WG9 A;  4MTE A;  4L0Y B;  1YS7 A;  4KIB A;  4BH9 A;  2CG4 A;  2QQ9 A;  5FB2 A;  2FMY A;  2EFW A;  2WV0 A;  1R1T A;  3GVA A;  5HLG A;  3CJN A;  4HDU A;  3M7G A;  3DEU A;  1U5T C;  4O3M A;  5LGU A;  2A5Y B;  1SD7 A;  3ABU A;  3GFM A;  2ZBK A;  4KMF A;  2BV6 A;  4CDG A;  4ZZL A;  4S05 A;  3L9F A;  4ESJ A;  1I5Z A;  2XKP A;  4Q47 A;  1Z6R A;  2ZJ2 A;  3FM3 A;  1HST A;  5FFZ A;  1R58 A;  1FBS A;  3V7R A;  1GXP A;  3K0L A;  1UST A;  4KMU X;  1UCR A;  3GZ5 A;  1FY7 A;  5BQT A;  3G73 A;  4LG0 A;  1BIA A;  3KP5 A;  4LLG F;  3FMR A;  1EV7 A;  2Z3Y A;  1B1B A;  4DNC A;  2VC0 A;  4G94 A;  1XN7 A;  2JRT A;  3VFZ A;  2WWY A;  3EUH A;  2GWR A;  1S7O A;  1IXS B;  5DCF A;  3M8F A;  2Z33 A;  2KRF A;  4RGU A;  2DU9 A;  5K1Y A;  3FZV A;  5E17 F;  5A2Q Z;  5L3D A;  1JGS A;  4OMY A;  4LB5 A;  1XD7 A;  3WOD F;  4IF4 A;  5D6E A;  1YYV A;  3KP4 A;  1R7J A;  2F5E A;  2VON A;  2O8X A;  2OA4 A;  3J80 K;  3ELK A;  2LDU A;  4ASN A;  3G3Z A;  4PZJ A;  1Y0U A;  2H6C A;  1QBJ A;  3LFK A;  4RAY A;  2DPU A;  3P9K A;  4KA4 A;  1DP7 P;  3TOA A;  5ILU A;  3I58 A;  1ZRE A;  1QGP A;  1S3J A;  1O3Q A;  4GCV A;  4BNC A;  2NS0 A;  1STZ A;  2HFH A;  2FQ3 A;  4XLP F;  4A0Z A;  5ILV A;  2BEO A;  5DDG A;  2HQR A;  5E1X A;  2EV6 A;  3E3V A;  1LDK B;  4P96 A;  2Q0O A;  1IF1 A;  1T98 A;  1K78 A;  3TO9 A;  5L3C A;  2ZKZ A;  1USS A;  1IRF A;  2FSW A;  1JXS A;  1QZZ A;  1MJA A;  4O6J A;  1Z7U A;  3HYI A;  4HW0 A;  1B9N A;  3T8R A;  2M87 A;  1OPC A;  3PQK A;  2OQG A;  4HLX A;  2BGC A;  5LRS A;  3RKW A;  3F6O A;  2W85 A;  2BBY A;  4JBA A;  1H0M A;  3HSF A;  4P5O A;  1XMA A;  1NHA A;  2DT5 A;  4KIC A;  3E5U A;  2F5F A;  4KFC A;  2ADU A;  2XUB A;  1KA8 A;  1AWC A;  3RTR A;  3KP7 A;  5FLX Z;  3KZY A;  4L9T A;  4OIN F;  2E7W A;  1K6O A;  5ERI A;  1X3U A;  2ZME B;  3KLO A;  3V8K A;  3JTH A;  3F22 A;  1G3Y A;  2DQR A;  1KU3 A;  3K1M A;  2ACJ A;  4M9Z A;  3MEX A;  1ZH5 A;  5IT3 A;  3R60 A;  5HDN A;  4EJV A;  3KP2 A;  2PMU A;  2UXN A;  2YX7 A;  4HF2 A;  3LA7 A;  2D45 A;  1JHF A;  1IW7 F;  2IPQ X;  1XGM A;  5L3F A;  2WC2 A;  4FT8 A;  5DYM A;  3QPT A;  3VOD A;  3CUQ B;  2OAZ A;  4KNY A;  3TDU C;  2HKO A;  4Q48 A;  4EJU A;  5D5X B;  2E7X A;  5K5R A;  2CFX A;  1G3W A;  3E97 A;  2VBW A;  4U88 A;  1AOY A;  2F5D A;  3KEQ A;  2PLY A;  1I1G A;  1FC3 A;  3KZZ A;  2ZNZ A;  4B8X A;  3RJP A;  1BI1 A;  2NAZ A;  3J81 K;  3W6K B;  2V9V A;  1RUO A;  1K79 A;  5EEG A;  5J8C A;  4N0B A;  3DPL C;  4M6Y A;  2XHK A;  3F6V A;  4JQF A;  1EH8 A;  2QBY A;  1VTN C;  3IWF A;  3U9G A;  3C18 A;  1MD0 A;  1BM9 A;  2EV5 A;  2DTR A;  2XAH A;  2FEZ A;  3KEO A;  1EH7 A;  1WWX A;  2KJC A;  1DUX C;  1OKR A;  1O7L A;  3IL2 A;  4G9Y A;  2EFP A;  4UV9 A;  2HR3 A;  4YG2 F;  4Q4Z F;  1ODD A;  3HSR A;  2LNB A;  4GYG A;  1ZGA A;  3K9T A;  2Q8K A;  4UNO A;  5DD8 A;  4A2U A;  3MWM A;  2FF4 A;  5FD5 A;  4S04 A;  2D2W A;  3K2Z A;  5JFR A;  2GQQ A;  2A07 F;  2YSR A;  1BN5 A;  1OYW A;  3GFI A;  3TDZ C;  4AVP A;  4L9V A;  2IJL A;  5DCM A;  1F4K A;  3O6B B;  1TBX A;  1BJA A;  3BPX A;  1OYY A;  1H9G A;  5D8L B;  1J5Y A;  3HOT A;  2HQN A;  4UHT A;  2F2E A;  3BJO A;  3F8N A;  4M72 A;  4EM0 B;  1XCB A;  2ELH A;  1I6X A;  4EJT A;  4OIQ F;  5ICC A;  4M9X A;  4G6Q A;  3I0T A;  1HW1 A;  2PEX A;  3TQN A;  1W5T A;  4M71 A;  4AIH A;  2KIM A;  2NYX A;  3V7S A;  1YW7 A;  4CXF A;  1BI2 A;  2JPB A;  1KQ0 A;  2IRF G;  4LG0 B;  1TQI A;  5ICE A;  4MNU A;  5H6Q A;  4BXU A;  3LQR A;  4ESB A;  1BC8 C;  4RS8 A;  2VN2 A;  1W7P D;  1T6S A;  5JHU A;  3RPU A;  2STW A;  2VBZ A;  5TRD A;  1IZ1 A;  4PGG A;  5HLI A;  4G6D A;  4M6X A;  1CF7 B;  2P5V A;  5HDK A;  2P7C B;  2EV0 A;  3R61 A;  4MTD A;  5JVT A;  2LF8 A;  2QM3 A;  4LK0 F;  2VBY A;  5HOO A;  3OOP A;  2CYY A;  1B59 A;  1B4A A;  1XGS A;  1IN6 A;  4P9U A;  4OIO F;  3WU1 B;  3O3K A;  3I59 B;  2K7L A;  1DDN A;  1B9M A;  3SZP A;  1J75 A;  5HS7 A;  3J80 Z;  1REP C;  2ZCW A;  1Z9C A;  2XGX A;  4IRI A;  1SAX A;  2BYV E;  3GXO A;  3NRV A;  4Q5S F;  1V4R A;  1S6L A;  1IAW A;  1H9T A;  1TNS A;  3BP8 A;  4AIJ A;  4BHB A;  3EYY A;  5LGN A;  2AS5 F;  1SD6 A;  3GUD A;  1I1S A;  2K02 A;  3GW2 A;  4IXA A;  4R8H A;  2O61 A;  2NNN A;  1U6G A;  4A5N A;  3LA3 A;  5LRR A;  3QU3 A;  2V79 A;  2FBI A;  4U7B A;  4WWC A;  5E1Z B;  2GIV A;  2P5K A;  1U2W A;  1FLI A;  3KP6 A;  3V8L A;  4LGW A;  1FP1 D;  2PI0 A;  1DPU A;  1K78 B;  3M1E A;  4AIK A;  1R5H A;  3WE3 A;  1DPR A;  2QVO A;  1LEB A;  4TV7 A;  1QZY A;  3ZP5 A;  1J9I A;  5DD4 A;  4RAZ A;  1ZG1 A;  3HHH A;  4CHU A;  5J6X A;  4IJA A;  5H20 A;  4XBF A;  1A04 A;  1MDM B;  3IWZ A;  1YTY A;  4PDK A;  1FYM A;  4RGX A;  3P9C A;  3ZMT A;  1KQ8 A;  5IT9 K;  4WF2 A;  5CYV A;  2V6C A;  5KK1 A;  2IP2 A;  1E2X A;  1ZAR A;  2C6Y A;  2VT3 A;  2LF7 A;  2BE5 F;  4P55 A;  4BYY A;  3CLO A;  5LLQ A;  1YO5 C;  2PFB A;  3DQV C;  3EQL F;  4WXC A;  5K5O A;  1G3T A;  1HBX G;  1YQA A;  4I0A A;  3TO7 A;  3E5X A;  5LHG A;  2VE9 A;  1IN4 A;  3T0Y A;  1T38 A;  3CO7 C;  2TDX A;  3F3X A;  3JSP A;  4HX4 A;  2W84 A;  3ZN1 A;  2VT2 A;  3FXU A;  2F5C A;  3ZMS A;  5E8I A;  3T1B A;  4I0B A;  5AON A;  2OZU A;  1RIO H;  4NQW A;  2DAO A;  2RC4 A;  1XSD A;  1MZB A;  3JAM K;  1ONV A;  1TQM A;  3JW4 A;  3OV8 A;  2FU4 A;  1ON1 A;  3E6C C;  2P4W A;  3KET A;  3J81 Z;  2MLK A;  1ZLJ A;  1R23 A;  3Q9V A;  4KDP A;  1P4A A;  3KLN A;  1EH6 A;  5LEK A;  3CDH A;  2FXA A;  3U1D A;  2VBX A;  2GXB A;  4HF0 A;  5E8G A;  3COA C;  4IRH A;  2G7U A;  2XAQ A;  5JI6 A;  3HSE A;  3ERE D;  1P2F A;  3I4P A;  2OZ6 A;  2QBY B;  4U0V A;  1FSH A;  2ISY A;  2EJR A;  2Z5U A;  3V7C A;  5BPI A;  4IHS A;  5DEQ A;  4R79 A;  1J59 A;  3EET A;  2DK5 A;  3Q9S A;  4OOI A;  3RI4 A;  4HQM A;  3WGI A;  4CGZ A;  3N4M A;  3D0S A;  5D6F A;  1SFE A;  4M9S A;  3M9A A;  1HKQ A;  1XGN A;  5BS6 A;  3RDI A;  1XCV A;  2P7V B;  3PQJ A;  1XGO A;  3HRS A;  3Q5F A;  4ZYG A;  3F21 A;  2W24 A;  1O57 A;  2FOK A;  2IA2 A;  4ENM A;  1LVA A;  3HRT A;  1FBQ A;  1B6A A;  2IVM A;  1TW2 A;  4PCQ A;  1T0F A;  4GXO A;  1U78 A;  1SMY F;  2XRO A;  1C0W A;  4HDV A;  3FXQ A;  2AXL A;  1KU7 A;  3BWG A;  1U5T B;  2NNY A;  1IUY A;  3GF2 A;  3SZT A;  2A68 F;  1P4W A;  3FX3 A;  4WK8 F;  1KQ9 A;  5EEH A;  3J7A O;  2VOO A;  3ZMZ A;  2OD5 A;  1FYK A;  3I5U A;  1R1V A;  4A0Y A;  1Z91 A;  4U7D A;  1WRJ A;  4LLL A;  2MLG A;  1W7P A;  2M1B A;  3HRM A;  3GFJ A;  2DFI A;  2PG4 A;  4ZYE A;  1FP2 A;  3TGN A;  2WTE A;  1LEA A;  1XDU A;  5DUK A;  2R7F A;  1W4M A;  4NHJ A;  3ECO A;  3FMQ A;  4RGS A;  1E17 A;  2OBP A;  3L7W A;  3HHG A;  1G3S A;  2V1X A;  2VC1 A;  3TOB A;  2DO7 A;  1OYI A;  4RB1 A;  2MH9 A;  3F8B A;  1QPM A;  2VOP A;  3GFL A;  3MCZ A;  2OU2 A;  2EWN A;  4JK1 X;  3C3W A;  2IW5 A;  2LKP A;  2EB7 A;  4I02 A;  3GEZ A;  4ENK A;  4BAY A;  3C1D A;  3BY6 A;  2CO5 A;  3RIR A;  4OIR F;  3WU0 A;  2KIU A;  4UVA A;  4HQE A;  3RYP A;  4UVB A;  5KVR A;  4EM1 A;  4HV5 A;  4BHC A;  1PP8 F;  1F5T A;  2GZW A;  3LA2 A;  3H92 A;  2QUF A;  4ENN A;  5CLS A;  1FOK A;  2O03 A;  4OU0 A;  3RKY A;  1R36 A;  2RKH A;  1YG2 A;  3F8C A;  1PP7 U;  1J2X A;  5LHH A;  1D3Y A;  2VE8 A;  1HW5 A;  2RN7 A;  2O6G E;  3ZN0 A;  3WTX C;  5L3B A;  2QEN A;  4E70 A;  4OMZ A;  3E5Q A;  2JZY A;  4HF1 A;  5AIP A;  3FM5 A;  5CVR A;  5CVI A;  2A3S A;  2RQP A;  2H6B A;  1HXD A;  2HTS A;  3F72 A;  4RB2 C;  2L4A A;  4KN4 X;  3CTA A;  6PAX A;  1IN8 A;  5FO5 A;  3SXY A;  3QAH A;  4G7Z F;  4LB6 B;  1ZRD A;  4ESF A;  4RB3 C;  1YIO A;  3DP7 A;  4IVN A;  4UVC A;  2HOE A;  2J5P A;  4UUV A;  3VEP A;  4L5J A;  3IC7 A;  3HOS A;  4L9J A;  4YFX F;  1TLH B;  1LDJ A;  5LBQ A;  3LST A;  3WTT C;  1UFM A;  1MJ9 A;  3IKT A;  1G6N A;  1PUE E;  3I71 A;  4HX7 A;  5E1W A;  4I7H A;  5LHI A;  3ECH A;  3REO A;  5AIQ A;  4EVI A;  4YIF A;  4I01 A;  3GZ6 A;  1LQ1 A;  3DV8 A;  1IN7 A;  1OMI A;  4NB5 A;  3L2C A;  2R3S A;  2YX4 A;  2XKO A;  4HZF A;  4ON0 A;  5D5U B;  2VXZ A;  1IRG A;  4LK1 F;  3GLX A;  2MD5 A;  1KYW A;  1TNT A;  2IA0 A;  1IXC A;  4ZZD A;  1SD4 A;  4YFK F;  4WX9 A;  1GXQ A;  3JAM Z;  2YR2 A;  1KGS A;  2RNJ A;  1ZLK A;  1KYZ A;  1L0O C;  3N97 A;  4ZYH A;  4WXD A;  3D5L A;  2DW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...