2KRHA

Structure of the c-terminal actin binding domain of abra
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
85
structure length
85
Chain Sequence
GAMARAEEHIYREIMELCFVIRTMARHRRDGKIQVTFGELFDRYVRISDKVVGILMRARKHGLVHFEGEMLWQGKDDHVVITLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Actin-binding protein
molecule keywords Actin-binding Rho-activating protein
publication title Structure of the C-terminal actin binding domain of ABRA
rcsb
source organism Rattus norvegicus
total genus 15
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2009-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14705 Costars Costars
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2krhA00
2KRHA 2L2OA
chains in the Genus database with same CATH superfamily
1D5VA 1RPWA 2YU3A 5D6FA 3DFGA 3DLLF 3S2DJ 1YS7A 2NOJB 4LJZF 1HC8A 1EF4A 1TWGJ 5HS9A 3GFLA 4A3GJ 2EB7A 2L5QA 4GGGA 2L7KA 2KPMA 5DD8A 1JE8A 2LRDA 1LFUP 3SEZA 2E19A 2VUMJ 4BE2A 1R9TJ 2EV5A 2ZNYA 3DP7A 2JPBA 3K4JA 2F4MB 4N9HA 4G7ZF 2EJRA 2ZXWH 4BE1A 2FE3A 3GFJA 5IT3A 5K7HA 2FUG2 2R7RA 5K1YA 2FNAA 1QA6A 3SDBA 1MJBA 2XAGA 4G94A 1IUYA 2R7UA 5F08A 3HSRA 2HOEA 3TDUC 1SAUA 1K78B 3J81K 2Q1ZB 2PJPA 1D1AA 2L9NA 1YX3A 1LDKB 3BWGA 1JGGA 4RDUA 3GW2A 2X4HA 1Y39A 1Y0NA 2VASA 1B9MA 4UB8C 4OIRF 3BR1A 1BR2A 3HPHA 1K4SA 5E20A 4LG0B 3J80K 4XRSG 4AWXB 4K2EA 4NHJA 3QU3A 4EMSA 1GLNA 4WX9A 2NNNA 5CLSA 2BV6A 2Q2EB 2XPWA 4ZC3A 3MKWB 2R93J 1ON2A 4RAZA 4IRGA 3EUHC 1AKHB 2WWYA 1SFOJ 2DMQA 3BR0A 3U1KA 5DTDA 3T0YA 5FRNA 1BI1A 2GXAA 2A5YB 2EA2A 3QP6A 3KZYA 1SD6A 3NAUA 1FLIA 4I01A 2CUZA 4XM3A 4DZPA 4Q4ZF 1ITYA 5HOOA 5CQEA 1KU3A 3CLQA 3KEOA 2EZIA 2YX4A 4RGRA 5EZGA 5GAGJ 3LNQA 2A3SA 2LY1A 2F6CA 1ZH5A 3RKQA 3BG5A 2XB5A 4P55A 2E2IJ 4E7HA 4GFBA 4XBFA 1MJAA 2W1OA 1JHHA 1LEBA 2NXNB 1HDDC 3I55I 4EQQA 2DOEA 4RB1A 1VI0A 2A5WA 1K78A 2KDOA 4E7KA 3QPTA 3SJMA 2FA5A 4EM2A 2CG4A 5LGNA 1FBSA 3CTAA 4KIGA 1G3SA 1BIBA 1YOVB 3V4GA 2JA7J 1FC3A 2JPCA 4OIQF 1MNMC 1XB4A 2H6CA 1EH7A 2M2EA 3LSRA 4PSWA 5HLIA 3JRFA 2PJRB 3FM3A 1WRJA 4LG0A 2LSOA 1B1BA 2XF5A 4I09A 3M8EA 3LSMA 1R22A 1W4MA 2BZTA 2KIMA 2VBZA 4I0AA 3J7ZI 3OR1C 2CGPA 2VJIA 3CMYA 2Q2EA 3BCBA 1UB9A 3WG7H 1T2KA 4A6DA 2HOAA 3KP7A 1FOXA 3WTVC 2LP0A 3RQIA 2O03A 3WGIA 1AKHA 2EV0A 4KN7X 1UHMA 2DT5A 1YTYA 2MC3A 2WAFA 1ZLKA 4HF1A 2R7DA 3Q0UA 1KQ9A 1UFMA 3CCUI 3V7SA 5JR3A 3I5UA 1H8AC 3E3VA 1XC5A 2ISYA 3S1RJ 2M34A 2Y2ZA 4BXUA 1R7JA 2COBA 3QQAA 2J5OA 4BY7J 3HM5A 1T38A 1U9NA 5CVRA 2GQQA 3TL4X 1YE9A 2D45A 1MNEA 2VPRA 2VKHA 3BTIA 2Y75A 3IH2A 2RN7A 1WJ5A 1BJAA 3F8NA 2EIJH 4UY8I 2HZTA 5ICFA 1ZYRF 1XGNA 1W5SA 4FHTA 4BNCA 2PX9A 4WK8F 4II2A 3FM5A 1AOYA 2ZXIA 3C18A 4BXFA 3MKYB 1ZGWA 3E6MA 1F9NA 2QCOA 1G8XA 3I4MJ 1Y8QB 3UR3C 4Q48A 2MC4A 3DXJF 5IP7J 2M9HA 3ULQB 5IY5H 5K5RA 3CC4I 2XGCA 4W97A 5L3CA 2C6YA 5AONA 4HPQA 1ZELA 2DFHA 2DTRA 2BHZA 3BR5A 4JX6A 3TO9A 2PJRA 1ZAOA 1XDUA 3HRMA 2QKMB 4GYIA 2DK5A 3JRHA 5HS7A 3CF5F 1ZKGA 4XONA 3BPVA 1S72I 3MKZA 2BVMA 4I76A 2ZB9A 1QZYA 4CCMA 1Y1VJ 3GTOJ 2UXXA 3HBLA 4Z6YA 5J47A 4ZYHA 3J7AY 1X2NA 2QWWA 1MW7A 5F04A 5HVQC 2L7ZA 4A3MJ 2KZVA 3CJNA 3HUGB 3IV5A 2AHQA 5DM6F 2K02A 2VC1A 2GBYA 5BNGA 4ANJA 2M0MA 5KK1A 2AS5F 2XSJC 3IH4A 3CESA 5J6XA 3ABLH 3KIOA 3F3XA 4XQFA 1HA8A 2Y31A 1IDZA 3AG3H 2LY2A 3OIOA 3L9FA 2WV0A 4YIRX 1UAAA 1VQ6I 1B6AA 5J4VA 4G7HF 3K1NA 1K6YA 3AG4H 1P92A 3CJQB 3BC8A 1SFUA 3GFMA 2TCTA 3E6DA 3H5RA 4LLNA 2YPRA 2Y9ZA 5HS8A 2DA7A 2A07F 1U5TB 3HL2A 3CDLA 3FXJA 4F91B 2A61A 4CCLA 2NOGA 4DIQA 3H9QA 5KCMA 4AVZA 2ID6A 2M30A 2VODA 3KETA 3MVPA 2F5EA 1D1BA 4XKVA 2XGDA 3P7NA 3H92A 1JT0A 3FXLA 2O8XA 3QYBA 3ZMVA 1X3UA 4KFCA 2BEOA 4D0PA 3GEZA 2ZJPF 2V9VA 4XSXF 5AIPA 2GOMA 2LF8A 4GO1A 4LB5A 1CQTA 1HXDA 2FSWA 3CQZJ 3L2WA 2ZFWA 1IXCA 1FOKA 3K4CA 1HDPA 4R1HA 2ZSIB 1OMIA 1TP4A 2EV6A 1IF1A 3S14J 1P9QC 4J19A 3VOEA 1VQMI 4M6XA 1FMWA 3BG3A 3BQYA 3U9GA 3KP4A 3LSKA 3VDXA 2DODA 4BUPA 2QSHX 1SMTA 4ASNA 2QBYB 2XV4S 2LLKA 2QYOA 2X6OA 1Z05A 2NYXA 3FK6A 1AHDP 2O3FA 2X6WA 3DQVC 2OC6A 4CO8A 4RGXA 4PJ0C 1Y6IA 2CSOA 2BYVE 1IO2A 5LRSA 3MCZA 1BW6A 1ERDA 2IGKA 4XLCA 3WODF 3ZPLA 2G9WA 1F1ZA 4M3BA 3LWFA 4CXFA 2R92J 1TQMA 3JSOA 1S6LA 1ZRDA 2HZDA 4Y52J 4ESBA 3S3NA 1FPQA 1IXSB 5F27A 4L18B 3A0HC 2R5YA 3T8RA 1XN7A 4G8XA 1DP3A 3PIOF 1K79A 2WY7Q 2Y69H 3K1PA 1KONA 1BI2A 4JBAA 3DPTA 3BR3A 4GXOA 4MNUA 4IZZA 2HI3A 3IAM2 4LGWA 2EFOA 2EWNA 4ZH4F 1P4WA 3JRDA 1GVJA 3T8TA 4AVPA 1E3OC 1OYYA 3L2QA 1S7OA 3SDGA 3AL0B 4XN0A 2MD5A 3GCMA 5FRMA 2XHKA 1FYMA 2X1DA 5FGMA 2IT0A 3OYBA 5KAIC 1KU9A 2X1EA 4YEJA 4YG2F 1XS9A 1FP1D 1WJBA 1W1WE 2KRFA 3JRBA 2KIQA 3PO2J 3P9CA 4UVBA 2FX0A 1R23A 1O3TA 1IC8A 5ILUA 2VC0A 2NS0A 4ENJA 3DEUA 3IWFA 3C2HA 3DWLE 2QBYA 1RI7A 3IUOA 4BYYA 1YO5C 2H1KA 1K6OA 1WZ2A 1LFBA 3CUQB 2DA2A 2K7LA 3K4KA 3FXOA 2WAQA 3LOCA 1U3EM 2WY8Q 3BOQA 4AIHA 1JUMA 5LHIA 2MD0A 1O3RA 2FMYA 1D3YA 1ETQA 1W7PB 1I6XA 1JGSA 2OBPA 3DF8A 3OS0A 4DGWB 2LR8A 1W5TA 2DT6A 4OAZA 1FJLA 4RLFA 2P0WA 3SYTA 2V1NA 2MA3A 3DLAA 1D0XA 1ZHFA 1X1AA 2Y0SA 5E3MA 4HF2A 3LAPA 1PUEE 1IZ1A 2QQAA 4XLAA 3CZ6A 5ILVA 4B4CA 3ZCOA 3U21A 4YFXF 1TNSA 5E18F 2ZMEC 1RZ4A 1FSHA 3H9JA 1X1CA 3R61A 1BIAA 2W7NA 1B59A 2HR3A 3M8JA 3I59B 4D5FA 3GWZA 2KP6A 5LHHA 3FMRA 1X19A 3E97A 3OIQA 2QSFX 1UJ8A 2JK3A 5LGUA 5F1RA 1YJ9I 1ZGJA 2HVSA 1SFEA 1P4XA 5M3MJ 2K3PA 2N8GA 4PCQA 1YLFA 2FF4A 2M5WA 3S93A 1BI3A 1IV8A 4CCKA 4U7BA 2QVOA 3Q9VA 4E4HA 2L3DA 1QNTA 5EG0A 3KP5A 1U2WA 3W6VA 3K1MA 1U8BA 1O7LA 2M1BA 3KYCB 4FE7A 5LEKA 3MZHA 1VF9A 2DDBA 1QHGA 2HNHA 2CQQA 3BTCA 1J5YA 5IYBJ 1PUFA 4HA8A 4A6EA 4L9VA 1AA7A 3JRIA 1KA8A 5A2QZ 3W6KB 1DGWY 3MWMA 3F22A 1IAWA 4EJTA 1UHWA 1TT0A 3QU6A 1YX5A 1GUUA 3FXQA 2LKPA 2HDCA 4XSZF 3F8FA 4ITVA 3IRQA 2CW8A 4QTRA 3FZVA 2XAQA 3ABMH 3D1NI 1W5CC 4MQ9F 4QWQA 4QSHA 2Z2SB 3M8FA 2L9RA 4FX4A 1VQ8I 2W84A 4M9SA 2JQ7A 2PMZN 3C7JA 3CJTB 2EZLA 1MBKA 4PJNA 2M7BA 3GZ5A 1E0EA 3ERMA 4XORA 2P7CB 2K9NA 4Y33A 3OWTA 2ELJA 1IN5A 3V7RA 2VXDA 1BM9A 4RMNA 1RETA 4C3HJ 1VQNI 4A3LJ 1HSTA 2FNPA 5D5UB 2EBIA 1WQ2A 2RKHA 4DW6A 1ONVA 3HHGA 3IH3A 1P2FA 2V1UA 1MDMB 2O7OA 1B4AA 3MEXA 3H3ZA 4MIMA 5D5VB 1YJWI 1HW2A 1WH7A 4IHSA 1O57A 2NVQJ 3MZYA 4UV9A 3CD6I 3W2VA 2XB0X 3PJRA 2HDWA 1MH3A 3WU1B 3V42A 4FISA 2RVCA 2CV2A 2B63J 2DPDA 4CSWA 2LDUA 1RUOA 2LH9A 2BW3A 4NC7A 3L2UA 4IX7A 2DO7A 3BDDA 5ICCA 3K70C 3KP6A 1QPMA 4E7SA 3G4SI 1MMGA 2XPVA 3M7GA 3K9TA 3HGYA 5IT9Z 1S5LC 1ETKA 4Y13A 4A3KJ 2E7WA 4M73A 2XPUA 2L9VA 2G7UA 2XIGA 4IJAA 1DPRA 2ME0A 5TRDA 1RC9A 2HEOA 1MBGA 2L2OA 3F8CA 3FXUA 1R6RA 2DTZA 2A69F 5E79C 3M9AA 3PSIA 3CCSI 5E17F 3TOBA 1OCTC 3FF5A 1Y0UA 1L0OC 2CQKA 2R7QA 3ZRGA 4BY1J 3KZIC 1J59A 1P7JA 1Q1HA 3ZMSA 4CA0A 5FLVA 1TNTA 3VYSB 1VQ9I 4KT5C 5GTIC 1LEAA 4M71A 1ZK8A 3ELKA 3GMEA 2E35A 2DA3A 4XOPA 2E1NA 3MD2A 4KJZA 4MTEA 2FBKA 2LMDA 1UMQA 2DA6A 2UXNA 3VYUB 3TO6A 1UHSA 1OYIA 1A6IA 4BE0A 2KIUA 3IKVA 3S17J 5JHFA 3HG9A 4FCYA 2A68F 5GAEJ 2IP2A 4D5CA 3KYDB 4DYQA 2E36A 2A05A 2QQ9A 3UKGA 4NDLA 4C9YA 3B6AA 2BXYA 2V26A 3HOYJ 2E7XA 1JKQC 1FX7A 3BROA 3CC2I 1CGPA 1OKRA 4MQVA 3E1SA 2IA2A 2XC7A 1SFXA 4PK4A 3JTHA 2OJED 3TO7A 2BHYA 3FK7A 1SD4A 2K85A 4L9JA 3GTQJ 2RDPA 2MFZA 1I27A 3JCUC 2RNJA 4RAGA 1VNDA 4D7NA 2FQ4A 2LREA 3HPGA 3MZ8A 4QPQA 1WGXA 1BR4A 2OA4A 4G6QA 3R60A 3HIFA 3GTPJ 1C0WA 4PFPA 3GXOA 5F64A 3RKWA 4BGDA 2TRTA 5LFAA 2M0CA 2OTJI 2X51A 2GOXB 1QGPA 2WB1A 3FDYA 1YYVA 1E2XA 3K4LA 4EV0A 2LF7A 3P9IA 4IF4A 4DBQA 1TLHB 5B5EC 3WTYC 4A3JJ 4LFUA 3FBIB 4LIUA 4QPOA 5F6FA 4D9JA 2M8GX 2WADA 3V8LA 4F55A 3TDZC 2NVYJ 3LA3A 4U0WA 2BY2A 2EFQA 4PGHA 5K7ZA 4RLQA 3ASNH 2E1MC 1TWFJ 5CVJA 2ZSHB 3OYJA 1MBEA 4WCGA 3F8BA 3GFIA 2V9PA 1R1VA 2EINH 5F0CA 2NVXJ 1U5TC 2CUEA 3J81Z 5FD5A 4ETSA 1IRGA 5CPRB 5HLHA 3ERED 1J0RA 4FQGA 2OQGA 2XKPA 3O2PE 5LHGA 3VSLA 3TBIA 2M8EA 5E1WA 3TP0A 3IKTA 2CW0F 2X85A 5F0FA 2RQPA 1R00A 1A04A 2XAHA 3MKLA 3OYFA 2O5RA 3PFIA 3J80Z 2ZXJA 1TW3A 3GBGA 1H9TA 4AU7A 1Z3XA 5BS6A 2X9DA 2ESNA 4IXAA 1HBXG 1JT6A 2ESHA 3OOPA 1OQYA 2YU9J 1GDTA 3G71I 1X3ZB 4BQAA 2NRAC 1F4KA 3ABUA 4AIJA 3FXKA 4E70A 4L5EA 3B73A 3S16J 1ZG5A 3K4MA 3IP4B 1I3QJ 2ZMEA 1FY7A 3AG2H 3PQKA 4HW0A 1K4TA 1IRZA 5L3GA 3ZQHA 2RNGA 2B9SA 3EDPA 2VJ5A 1ZRCA 2JT1A 1V5EA 5GP9A 3ZQ7A 2M87A 2L7FP 2RV8A 1GHCA 2Y30A 1R5ID 1A6QA 5ICEA 5KHDA 2H6BA 1R1TA 1FZPB 5FJ8J 2WC2A 4UUVA 5BPIA 3IC7A 2O61A 2W85A 2IGMA 5ILSA 1DU6A 4LMYA 2JA2A 5GADJ 3WTZA 5J4YA 1I1SA 1LDDA 4H4KC 1VQLI 5IPAA 3HOSA 1Z91A 5IOYA 4E7IA 4HSTA 3QRFF 5E1ZB 1FBUA 1ON1A 2EFWA 3F72A 3HTUA 2KRHA 3L2VA 2E5NA 4HYEA 4XOTA 1U9OA 4F52A 1LJ9A 1IXRC 1FT9A 3ZMDA 3WTXC 4F93B 1E3PA 1MBFA 2F2EA 1WI3A 3QYEA 3AL0C 2PFBA 2V7FA 2HTJA 1X4OA 1ORKA 3EETA 2UZKA 1IV6A 1PDNC 2XAUA 4EM1A 3CCYA 3ONQA 3QP5A 3H3UA 1D0YA 3BLYA 4EJVA 2KQRA 3FBNB 5DUIA 3OYKA 1BOAA 4NBQA 4C2TA 1SAXA 2HYGD 2CV1A 1Z77A 1MMSA 2IS4A 2VQGA 3KP3A 4RS8A 3LSIA 3OR2C 4F92B 1MSFC 5IYCJ 3ZXSA 4A0ZA 1S7AA 3CUQC 2AXLA 5HNHA 2L4AA 3JRGA 2EH3A 3SXYA 2GXGA 3PQJA 2H09A 3DBRB 1ZR4A 1TT5B 2KDZA 1J2XA 2PQ8A 2Q8KA 4BL0B 5DCFA 3PNTA 2JUCA 2VIXA 3E6CC 1H9GA 3K7AJ 2PG4A 3I0TA 4YIFA 1D8JA 4XLFA 2V4JC 3R0JA 5LLQA 2WBMA 4L9NA 1X1DA 3F6OA 2YSRA 1VQPI 3BZ6A 1QZZA 3BCAA 4RA2A 1F43A 2JVGA 5BPDA 1IN4A 2K9QA 1HCRA 1R36A 2G7HA 1ZGAA 3J7AO 1AU7A 1LUJB 2X0LA 1T39A 1X1PA 3K69A 1VTNC 3BJAA 3NARA 1MJ9A 3PIPF 2ZXHA 2OZ6A 1FTTA 1HQCA 3VYRB 4HQMA 2OD5A 2Z16A 5H2FC 3K70D 2VT2A 2VQLA 5FO5A 3S1QJ 3QYFA 1RR8C 4U0YA 3DCFA 2ZO4A 2V79A 4BXXJ 1NTCA 4PFOA 3JAMK 3LSHA 3CCMI 1W0UA 1ETYA 2VOOA 1I50J 4J00A 3DBLB 9ANTA 1OFCX 1WJAA 3TW6A 3CO6C 2G0EA 3J7YJ 1F5TA 2O8KA 2K9LA 2IS6A 3Q5FA 1FYLA 4R79A 2CWEA 1J75A 3TEDA 3C2BA 4CYCB 3U2RA 1LDJA 2R5ZB 2JRMA 2R5YB 4IRIA 3GZ6A 4M3FA 5L3EA 5FD6A 1YW7A 5B3SH 3M1EA 3A0BC 4CUGA 3CCJI 4CCOA 5JLXA 1T08B 1VQ5I 4G6TB 1OR7A 3WTWC 5ERIA 3DTKA 1MD0A 2GM4A 1XGOA 3WGGA 2VKVA 4LK0F 4IHVA 1ETOA 5JHUA 1WH5A 2NS7A 1WVRA 3HOVJ 4LB6B 3N97A 1O3QA 1LNWA 4H0EA 2FOWA 2JN6A 2Y9YA 3ABKH 4HV6A 2YR2A 3KYLA 4ZDLA 1GV5A 5HLTA 4B48A 2K40A 3WE2A 3CMMA 1YW9A 3GTGJ 3REOA 2DFIA 4ZYEA 1SEUA 4E6KG 1OCRH 4A12A 1ZR2A 4BQOA 1L3LA 1FSEA 4A3DJ 1GVDA 4B8XA 5KNLA 5E8GA 1JXSA 1H88C 2P81A 2FJ1A 4A5NA 1A31A 1YRNA 2JSCA 1MMDA 4GCVA 2BVLA 2DQRA 4BACA 4CYCA 1B72A 2R5ZA 3GYHX 3H1CA 1ETWA 2M4GA 4I02A 3DV8A 2F4OB 2JTVA 1IN7A 1ZQ3P 2OAZA 5D4RA 2EILH 3OYHA 3IRRA 2ZJRF 2JA5J 4XN3A 1LB2A 1VQ4I 3HKZA 2Y0MA 1R1UA 1T0FC 1HSJA 1RKWA 5JLWA 4DYRA 2GA2A 5D5WB 4Y4RA 3DKXA 4F7ZA 1R5GA 4BU2A 4EVIA 3CF2A 2LKSA 1UZCA 2EFNA 1HKSA 3FKIJ 4YFNF 1EJ9A 3IHUA 2V6CA 1Z7UA 1X2MA 4IHTA 4L9TA 3ECHA 2K27A 1SVOA 1N25A 2LFBA 2OF7A 3I4PA 3ZMTA 4RM3A 4N4OB 2A6TA 4UVAA 3S2HJ 4A3BJ 5C4XJ 1UCRA 2FBIA 4HLXA 5TISC 4B1RA 1LPQA 4HG2A 1X4PA 2HKOA 3IL2A 2MH9A 2IBDA 3SZTA 1PP8F 1Z0XA 1Y56A 3JTGA 2GAUA 3IAS2 2WAQN 2XDVA 2IS1A 1TL8A 3HSFA 4HF0A 1XCBA 5E8IA 3EUHA 4WXDA 2PLYA 4HQEA 3ZMUA 5J1YA 1WSUA 5D8LB 2W24A 3FKJA 4M3DA 2PEXA 4A3EJ 1R4NB 3BTJA 1XTAA 1XGSA 5J3LA 1OCCH 1U6GA 4BJ5C 3T1BA 2OZUA 1ZG1A 5EG0B 2DPUA 1ULYA 1BW5A 2VBXA 2FU4A 4P96A 3OSFA 2NVUB 1OCZH 2ZCWA 3K6GA 1OCOH 1UG2A 4Q47A 3VPRA 4B43A 2Y0SN 3OYNA 2XROA 1PUFB 3M3YJ 3I71A 1KGSA 4JYKA 5FKNA 2GZWA 1SVLA 2ADUA 2L9SA 1H89C 2ICWG 3I64A 2X6YA 5LGTA 2IXSA 3DU5A 3S8PA 3I3LA 2LD5A 3A2KA 1Z67A 3HGGA 1U8RA 4ENNA 1HKQA 3W3CA 3QOEA 4B3XA 1Z6TA 1IDYA 2ZKZA 5FKLA 4XKWA 2HGCA 2D5VA 4JP0A 3RKYA 1K61A 2FOKA 3VB2A 3LQRA 2ZC2A 2DFEA 3A4CA 3BJOA 3D5LA 4HX7A 4LIVA 1FWZA 4MHGA 4AUXA 4JX5A 2DCEA 3I56I 1A5JA 5FFXA 2HYFA 1DGRM 1DU0A 4BHPA 2BY1A 4BS9A 4IVNA 3F23A 3Q0WA 5D6EA 3LSGA 3V8KA 3FXMA 5DCMA 4OU0A 3HOWJ 2IS2A 2VE8A 2FRHA 4BQQA 1WKMA 5HDNA 1BOBA 3L1PA 5FLXZ 4UNOA 4CCJA 4BHCA 2E71A 3PFYA 3OOUA 4KITB 2VBWA 2XASA 3WGHA 2VKDA 3D5SC 3NWSA 2VT3A 3F21A 3OYMA 2JZYA 4PUSA 3BT9A 4BHBA 4AD9A 1ZTRA 2CMPA 5B66C 3Q0VA 1G6NA 3E5XA 1R58A 3OL3A 4HSRA 4I7HA 4A2UA 3MQ0A 4PJMA 1POGA 3S2WA 4N0BA 4YELA 2L02A 1YHQI 1JKRC 4FX0A 1OCPA 3ECOA 4PJJA 3E7LA 3RIRA 3PO3J 2WA0A 3RTRA 3CCVI 4U0VA 2BW3B 3H0GJ 2EK5A 1D5YA 4ZZLA 4CH7A 1RNLA 2M3AA 3QAHA 5A2QK 1JUPA 3OIPA 2HVQA 2MH2A 2MSYA 3F0CA 4B3AA 1MH4A 3JW4A 3E5QA 3H35A 2KZGA 4QLCU 1FIPA 4UVCA 1JI8A 2FBHA 2STTA 2HXIA 1X1BA 2ME6A 1J7KA 1MNDA 2LBFB 1V4RA 4F3QA 4CYDA 3O8HA 3CCEI 3VFZA 2D1HA 4RB0A 4ZYGA 1YIOA 1ZARA 1MGTA 5M3FJ 2VJJA 4XICA 4DBRA 4XKBA 4MGRA 2FQ3A 2QGUA 3DBHB 2I5UA 1MMAA 4AYBA 2XVCA 1T33A 1ZLJA 5EDNA 4A93J 4UUTA 3CP8A 4R8HA 1Z6RA 3LAJA 3R6SA 3SQNA 3SHFA 1O4XA 1LKXA 1R5HA 3D5RC 3DTEA 3RCOA 2RREA 2OCEA 1HOMA 2IAIA 3H36A 2KRCA 4E7ZA 4BJ6C 2CV0A 1DUXC 5CKTA 2ECBA 2PI0A 3WU0A 2STWA 4ZYAA 5B1BH 2VKEA 2LG4A 3M4OJ 4BH9A 3HJEA 2BE5F 1DP7P 2QSGX 2HVRA 1K83J 2IEKA 3KCCA 4XLNF 2EIKH 4UXNA 1I5ZA 3GUDA 3HTSB 2V6EA 4DQ2A 3ISPA 2DMNA 5DV5A 2JMWA 2BXZA 2J5PA 5E3LA 2ISZA 3RZOJ 2GIVA 2HXOA 5K7FA 2KMUA 2UWMA 2CQXA 3CP2A 2AXTC 2D2WA 2DI3A 5EJCA 2HQNA 2GIZA 2IW5A 1IN6A 2H8WA 2F5CA 1LQ1A 2GXBA 2DLLA 1XMKA 5L3BA 1ZN2A 4MEXF 3OS2A 3I53A 3TOAA 4OIPF 4UUSB 3VYTB 3EUAA 1ODDA 1A35A 2K9SA 2LBFA 1YW8A 2P5VA 1D8KA 2QLZA 1SVMA 4X1EA 1DDNA 5J40A 2PMUA 1JTYA 5M5YJ 1XSXA 1R49A 1PJRA 5F1JA 4D7MA 2JJ7A 3NQOA 1YQAA 4M74A 2CS3A 2ECCA 4N9IA 2V1DA 3S1NJ 3LSTA 1WPKA 4U7DA 1USSA 4IPAA 2E1OA 4CDGA 5BMZA 4HZFA 4M6VA 4BDZA 3FX3A 5LD2C 3AAFA 2P8TA 2OCCH 3QWLA 5LRRA 3A03A 4M3GA 4PGGA 1OLTA 3HZJA 1K7AA 4Y17A 4M6YA 1XSVA 4HBLA 4M72A 2I10A 1KQ8A 5GTHC 4XK4A 4W1UA 4YRVA 4NC6A 3KX2A 1S3JA 1TWAJ 2K5CA 3VSKA 4S05A 4KA4A 2E1CA 4FETA 2R7WA 2RAEA 3BG7A 2CO5A 1YIJI 2QKLB 2QQ8A 3COAC 1TWHJ 2K4JA 4KUMA 2W25A 1FP2A 1RIOH 1FTZA 2L0KA 2Z5UA 4KYWA 2EQRA 4RGSA 4LOCA 2KHMA 1SD5A 5DEQA 5GPCA 4BEHB 2DJIA 4AM3A 3MAJA 4FE4A 5J8CA 4PZJA 2RQQA 5J8FA 5DM7F 2DJNA 4CCNA 4O3MA 1JTXA 3BZKA 1AWCA 4UUSA 2X6XA 2OV7A 2XAJA 2DW4A 2R7VA 4KT6A 3WHBA 2WB1N 2JA6J 2V1XA 2NS8A 2IA0A 4M9ZA 1PVEA 4D1QA 2W57A 1UG0A 1HW5A 5F0HA 1I39A 4BAYA 2VL8A 2B0LA 2CFXA 1U0JA 1W36C 4RB3C 2DOAA 2K4BA 2ZMEB 5HDGA 4B47A 3VEPA 4NQWA 2QQBA 4I0BA 2DXIA 5EZHA 3BG9A 2KLOA 3GF2A 5C44J 1BN5A 4S0HB 2HTSA 3S32A 4G9YA 4RBOA 4EGYA 1QHHD 1HKTA 3CJRB 4MFDA 2VPLA 4HAMA 4YIIA 3QODA 5DYMA 3GTMJ 1R71A 1Z21A 1USTA 5FKOA 4FTHA 2LK2A 3KE2A 6PAXA 1VQOI 3KP2A 2KISA 1FIAA 3K2ZA 2VB6A 5JFRA 3PNVA 2XF6A 1GV2A 4RB2C 1O3SA 1XSDA 5EEGA 4IHWA 4C2UA 3G3ZA 1EH8A 3DEWA 4A69C 3HXLA 2MYSA 4HDUA 1N77A 2BBYA 3CUOA 2HFHA 3KFWX 1WJFA 3PM1A 4XRSA 3JRCA 4XL9A 5DD4A 3GZNB 1VQKI 3MMYB 2R7OA 5K5OA 1G3YA 3SZPA 4XLHA 2ZJ2A 2CYYA 3PL8A 1YITI 4BEHA 4DYCA 2IGNA 4L0ZB 5HDKA 4L5IA 3K4BA 3LFKA 1XX5A 2P6TA 5K5QA 1KYWA 2EFPA 1G3TA 1B9NA 4MO7A 4M3EA 2CFOA 2F4IA 2Q0OA 1IG7A 2DA1A 4BJTA 2QZ8A 2MABA 5EEAA 1F36A 1MBJA 4WXHA 4OIOF 2P5KA 3LFUA 5EYRA 4IL6C 1U78A 2WTEA 3OYGA 2DOFA 2W48A 4V2FA 2HQ5A 1VZ0A 3HB9A 3UNGC 1V55H 1J09A 4CICA 1BC7C 1XCVA 4ZTFA 1TQIA 2AQEA 3FHNA 2O6GE 2R0QC 5EF6A 2DAOA 4LLLA 5HLGA 4ENKA 4A3IJ 2O9LA 2MLGA 3TKYA 2LTPA 3LSPA 4KMFA 2K3FA 3GTLJ 5C3EJ 3CMAI 2VBYA 4PJLA 4XRMA 2L54A 4NNJA 3CLOA 1G3WA 5GPAA 1QVTA 1T6SA 3H9GA 1Z1DA 3E0JB 1S29A 1SC7A 4RGUA 1ENHA 4UB6C 2A6HF 1S7EA 2XKOA 5CJ9A 1IUFA 3GO5A 2ID3A 3ZQFA 2R7TA 1MSEC 2OPTA 1J9IA 1NHAA 1Z3YA 3GX4X 3O3KA 4OINF 2KL4A 2L4MA 3LA2A 4PDKA 1FBQA 1DQUA 1LFPA 2R7SA 4IHXA 4IEJA 2JSPA 3HRUA 4UV8A 5E3NA 1LVKA 3KLNA 1XD7A 1R4MB 2E60A 2HQAA 1P4AA 3SEQA 2CJJA 1XGMA 3NWTA 4P9FA 2E2HJ 1BJZA 3I54A 4JOMA 3DEEA 4MEYF 3G1OA 2XF7A 5TJJA 4ZYDA 1G59A 1IJWC 4A3FJ 2YUSA 2X48A 4II3A 5BQTA 2L01A 5CVVA 2FMLA 4ZJZA 4CHUA 4AIKA 1LE8B 1SD7A 2EA4A 4DOZA 4AC0A 1YI2I 2ELKA 4PSXA 1TC3C 3WE3A 3NEUA 4I2OA 1QBJA 2MGQA 2KIFA 1YFHA 3G73A 4I98B 2P5LC 3D0SA 3AG1H 4BBSJ 4ZTJA 3MFKA 3N05A 4XRFA 4ON0A 3ZMZA 5H6QA 3RPUD 2EPFA 3RPUA 1JJ8C 1IRFA 4M9XA 2JWTA 1NG7A 3MN2A 4BDYA 2RGVA 2LC2A 3K0LA 2H27A 5H20A 4E7JA 1QU3A 3NRVA 4N4NB 3HRTA 5E3OA 4NUBA 1RESA 4EJOA 3S3OA 2FD5A 1QO0D 1P6RA 4KIFA 2IJLA 2FXAA 5D8KB 4EJWA 3HDDA 2HQRA 2W4SA 4HX4A 3X2QH 3KEYA 5DS9A 5CVUA 1DPUA 3V8JA 3CCLI 2DQLA 2R3SA 2KFDA 2M7AA 2P7VB 2R7ZJ 2PMHA 1T8IA 3FWEA 4BKXA 1OJLA 3WHCA 1SFKA 2ZBKA 4C3JJ 5JVGF 1NH3A 2BOLA 3AFHA 1WFXA 3QPHA 3HSEA 1OYWA 3OY9A 2JUGA 3KZZA 3G2BA 4KIBA 3Q3SA 1MIJA 5EEHA 2KJCA 4WXCA 3OSGA 2Z3YA 2LYCA 3C2GA 3OYIA 1QQIA 3CC7I 1XDSA 5FFZA 3BTLA 1LE8A 2ELHA 3RDIA 5M5WJ 1CF7B 1YRNB 3BG6A 4HNUA 1I6HJ 3KEQA 1W0TA 2YX7A 1B72B 2VQHA 2HU9A 4LITA 4A5MA 3JAMZ 2JA8J 5IYDJ 3ABTA 1V5GA 2CRGA 3CCQI 1VQ7I 3PUBA 4GRIA 4KMUX 5IOZA 3G1LA 1XG1A 2AQFA 2EIMH 2DDAA 4KN4X 2GWRA 2MLKA 2WV1A 2DMUA 1MBHA 4UHTA 3DU6A 4HLYA 3A1YA 3BQZA 2E1MB 3DTIA 2MBFA 2YS9A 3HRSA 3VODA 1B8IB 2BY3A 3A02A 3EUKL 2QUFA 1QZEA 3BR2A 2X1CA 1SANA 4HV5A 3JRAA 1LVAA 4G6DA 2CU7A 3R4KA 2VQCA 3QPSA 4BQNA 1KYZA 2JRTA 3FIWA 5CVIA 3ZGKA 3HEFA 4HNTA 2DN0A 3OYAA 4Q5SF 2DMPA 4RAFA 3K4NA 3ML6A 4LD5A 3CCRI 3A01B 4QIWN 1EKEA 2F5DA 3ASOH 1MKMA 4NC8A 2ZFUA 2DMTA 2DU9A 2EZHA 1D0ZA 1M1EB 4GYGA 2O0YA 3OMYA 3ZQIA 2Z99A 3SFZA 3DPLC 1FYKA 3QOPA 2E2JJ 3ZOBA 2Z9OA 1PP7U 3HKZN 2HPIA 3EQLF 3TGNA 1WHUA 3ZQGA 1CF7A 1KU2A 1HW1A 3HUGA 1E3HA 3HC7A 1RR7A 3G6EI 3ZQLA 3RPQA 3E5UA 1W36D 3HOUJ 1V5FA 1KZHA 2QENA 1JHFA 1G4DA 4HRIA 4OMYA 2HDDA 2KKOA 4MLOA 2XUBA 4HX8A 3RJPA 4XLEA 2DFFA 4XR6A 2F5FA 2E5ZA 4P1WA 2LVSA 2MW8A 3S1MJ 3LQQA 4IO9F 4EM0B 2VE9A 2FEZA 2NAZA 1ETVA 3FXRA 4TV7A 3W2WA 3WTUC 5IP9J 3HOTA 2R7XA 1B8IA 4JK1X 4EGZA 3L7WA 4V19K 3B02A 1U5TA 5D4SA 2KT0A 3ZQQA 2IA1A 3TP3A 1TBXA 5H6RA 4ESJA 3GTJJ 1Z9CA 4OWRB 2XSDC 3L09A 3IWZA 3O6BB 4IRHA 4WF2A 2DA4A 2LOOA 4OAYA 5DCMB 5LBQA 1XMXA 2B7EA 4C2MJ 4HDVA 1QPIA 3H3VK 1Y1WJ 3L00A 1Z7LA 3GLLA 2BGCA 3A01A 1TTYA 1X58A 5LEJA 1ACIA 3HYIA 1S8NA 1YS6A 2PN6A 4X0GA 3ESWB 1WJCA 4RM2A 1TWCJ 2LKXA 2WAEA 1YG2A 1A36A 4Y15A 3LMMA 4U88A 1YJNI 1FOYA 4IHYA 3OYCA 2HOSA 1OISA 1NG6A 2UUZA 5J1RA 3GTKJ 4IOAF 1XPXA 4ZDOA 3M07A 4XIDA 2GLOA 1IGNA 4A0YA 2RC4A 3FISA 3L2RA 1FEXA 5CQGA 4IOCF 2I8DA 4S04A 3FMQA 2CUFA 3PNYA 3I4NJ 2IRFG 4V2GA 3WTSC 3W2AA 2Z1DA 3G1MA 2VOPA 4HNVA 1STZA 1D1CA 4OMZA 3EPZA 1ZRFA 5HNFA 1HLVA 2CH0A 5AIQA 5CYVA 2LY9A 3OV8A 5L3FA 4A0XA 2QA4I 2COMA 2P4WA 1BC8C 1JUSA 1RUNA 4L0YB 2V9KA 1FOWA 2QF7A 1JKOC 3RYRA 4HEA2 1ZG3A 2DBBA 2TDXA 1NK3P 4ENMA 1IW7F 3GVAA 4IQJA 5FROA 2HKXA 4KNYA 1RKTA 3CO7C 1V54H 1T98A 5FLXK 1Y8RB 5KVRA 4DJAA 1X3WB 2XGEA 1WJEA 5ED4A 4DZJA 3C3WA 1APLC 3ZR8X 1ETXA 4CZZA 1GXPA 1PYVA 4L5JA 3V7CA 4G12A 3JR9A 3R0AA 3I9V2 3DPUA 2DYSH 4RAYA 5M5XJ 1VFCA 1WWXA 4EATA 1QRYA 1Q1VA 2F5VA 3HOZJ 1P7IA 3B6CA 3DKYA 2OTLI 4BBRJ 1H0MA 2W00A 2MG4A 1TQPA 3WTTC 1JJ6C 4XNFA 3T5XA 3CUQA 4NB5A 4X6AJ 2HOTA 2HPMA 3C1DA 4ZZDA 1BR1A 3M1CA 3WU2C 2CUJA 3BPXA 4AYBN 3TW7A 2F48A 3K2AA 1O7FA 2XRLA 2BY0A 3F9KA 1QVUA 5IP6A 1W7PD 1UELB 1W7PA 4MFEA 4J01A 3HHHA 1I1GA 3KPHA 4I6ZA 5C4JJ 1RRJA 1S9HA 3P5JA 4O6JA 5FKKA 5TGTA 1WCMJ 2NVTJ 2CQ7A 3U1DA 3QPLA 1XMAA 3K10A 4Y3OA 3SFIA 2KJBA 4O5VA 1GT0C 2VXZA 1MZBA 3F8MA 4DNCA 2ACJA 4ZDPA 1EV7A 5GAHJ 4C3IJ 5EGOB 3RI4A 5E1XA 2W82A 3BZCA 4B44A 1BI0A 1N75A 3OYLA 2XAFA 3WG9A 3O8GA 2ZJQF 3BY6A 4FASD 3CDHA 3CDIA 3I59A 2P6SA 3Q9SA 4JQFA 3RSNA 2LNBA 3RYPA 3OYEA 1BA5A 1IRXA 1MMNA 5DDGA 1T56A 2DK8A 3PUFA 1G2HA 1JKPC 1EA3A 5B1AH 2CW7A 4Y7NJ 2DA5A 3ZN1A 1WJDA 5KAFC 4P9UA 1WI9A 1KQ0A 2JVHA 2IGOA 5JI6A 5L3DA 3OL4A 2PMZA 2GA1A 3BR6A 3ZP5A 2H1LA 1HF0A 3OYDA 3JREA 2OU2A 2H8RA 2HS5A 3H0DA 3VWBA 3I58A 2M45A 2XRNA 2K86A 2R7FA 3PSFA 4KISA 5IT9K 4A3CJ 3EYYA 1BL0A 1N78A 5BOXA 4U87A 4ABZA 4LLGF 2Z33A 3FMSA 3S15J 2D1VA 3ZQCA 2HWVA 2VLAA 5FKMA 3LA7A 1TW2A 1EH6A 3EYIA 3LSJA 2AO9A 2VI6A 3JSPA 2OUMA 1ZREA 4WWCA 3AKZA 3SZGA 3RQ4A 3TQNA 2VONA 2CQNA 3N4MA 3DKWA 2ETHA 4NQWB 4EEFG 4YFKF 1TZLA 4P5OA 4Z2YA 4G7OF 3KLOA 1BBYA 2DYRH 2E34A 3L2CA 5JVTA 2VJ4A 4EJUA 2UV1A 5EGOA 3CMEI 1V3FA 2VN2A 3E6BA 3OS1A 4KDPA 5J1UA 4JX4A 3BP8A 1E17A 2NNYA 4XKCA 3S3MA 3P9KA 4LG3A 2IVMA 3W6JB 4OOIA 4CZCA 2OQRA 4MTDA 1SMYF 3ZN0A 1OPCA 1I3AA 1IN8A 2PBIA 4GDFA 5ICGA 2QEXI 4XMYA 2EZKA 1OR7C 1FMVA 4I99C 2H94A 2HYJA 3TMOA 2R4GA 3BJ6A 2XGXA 3H5AA 4ESFA 1GXQA 3FHZA 1KU7A 4HOBA 4CGZA 2Y48A 4E7LA 1REPC 3RZDJ 4B09A 1FNNA 4C30A 1MDMA 4KICA 1NK2P 5D5XB 2DT7B 4LK1F 2M4KA 4IQ4A 4IKFA 5FLMJ 4AIDA 2K9MA 3LL7A 1T0FA 3GLXA 1T95A 3HOXJ 5FB2A 2QM3A 2ZNZA 2A6EF 4FT8A 5DUKA 3ROUA 5HODA 3F6VA 3H5NA 4XLPF 3RKXA 2IPQX 2L7MP
chains in the Genus database with same CATH topology
1AA7A 4ZTJA 2M4GA 3N05A 2NOJB 1DGWY 3OYHA 3RPUD 4XN3A 2L5QA 3HKZA 1NG7A 2L7KA 2KPMA 1T0FC 1TT0A 2LRDA 1YX5A 3SEZA 4BDYA 2LC2A 4BE2A 3K4JA 4Y4RA 3DKXA 4E7JA 1QU3A 4ITVA 4BU2A 4N4NB 2CW8A 3CF2A 4NUBA 4BE1A 2FUG2 3S3OA 2R7RA 3SDBA 2Z2SB 2R7UA 2W4SA 1SAUA 4RM3A 4N4OB 3KEYA 2A6TA 2Q1ZB 4HG2A 1D1AA 1X4PA 2L9NA 1YX3A 4PJNA 1LDKB 2M7BA 1E0EA 4XORA 1Y56A 2M7AA 3IAS2 3OWTA 4Y33A 2XDVA 2ELJA 2IS1A 2VXDA 4RMNA 1SFKA 2VASA 3FKJA 1BR2A 2BOLA 3AFHA 1WFXA 3HPHA 3OY9A 2JUGA 4BJ5C 3G2BA 2LYCA 1GLNA 3C2GA 3W2VA 3OYIA 3PJRA 2HDWA 2Q2EB 4ZC3A 3MKWB 3V42A 3K6GA 2CV2A 4B43A 4CSWA 3EUHC 3OYNA 2LH9A 2BW3A 4NC7A 3L2UA 4IX7A 3K70C 5FRNA 3BG6A 4HNUA 4E7SA 2VQHA 2HU9A 4LITA 1MMGA 2CUZA 4XM3A 2L9SA 5HOOA 1V5GA 5CQEA 2X6YA 2IXSA 3DU5A 3S8PA 3I3LA 3PUBA 4GRIA 3A2KA 2AQFA 3W3CA 3QOEA 4B3XA 2LY1A 2F6CA 2L2OA 1R6RA 4XKWA 3DU6A 3A1YA 3PSIA 4E7HA 2E1MB 3DTIA 2W1OA 3D5LA 3A4CA 4LIVA 2DCEA 3EUKL 1DGRM 2A5WA 2X1CA 2KDOA 4BS9A 4E7KA 2R7QA 3ZRGA 2VQCA 3LSGA 4BQNA 3ZGKA 4CA0A 2IS2A 3VYSB 4BQQA 4HNTA 1BOBA 4CCJA 3OYAA 3PFYA 3OOUA 3K4NA 4KITB 2VKDA 4XOPA 3MD2A 4KJZA 4PSWA 3D5SC 3NWSA 2PJRB 3VYUB 3OYMA 4NC8A 2ZFUA 4BE0A 4PUSA 1D0ZA 2XF5A 2CMPA 3OMYA 3LSMA 3OR1C 5JHFA 2VJIA 3OL3A 3HG9A 4HSRA 3BCBA 4PJMA 3DPLC 4YELA 4C9YA 2HPIA 2V26A 4PJJA 2WAFA 2WA0A 3HC7A 3RTRA 2BW3B 1W36D 1V5FA 3E1SA 2XC7A 4CH7A 2M3AA 4PK4A 3OIPA 2HVQA 4HRIA 4MLOA 2MFZA 4XLEA 3H35A 4XR6A 3TL4X 1YE9A 2LREA 3HPGA 1MNEA 2VKHA 4QPQA 1JI8A 2E5ZA 4P1WA 1WJ5A 1BR4A 1X1BA 1MNDA 2LBFB 4F3QA 3W2WA 2VJJA 4II2A 3HOTA 2R7XA 2ZXIA 4XKBA 4PFPA 4BXFA 4DBRA 3MKYB 4BGDA 5LFAA 1G8XA 2GOXB 2X51A 2WB1A 3FDYA 3UR3C 3ZQQA 1MMAA 4AYBA 2MC4A 3K4LA 4DBQA 3CP8A 4OWRB 3FBIB 4LIUA 4QPOA 4D9JA 4F55A 2WADA 2LOOA 4OAYA 4HPQA 1ZELA 4RLQA 1Z7LA 2E1MC 1LKXA 3DTEA 3D5RC 3RCOA 2RREA 2KRCA 2ZSHB 4BJ6C 4E7ZA 3OYJA 2CV0A 2PJRA 5CKTA 4X0GA 4RM2A 1WJCA 2QKMB 2WAEA 4ZYAA 2LG4A 3LMMA 4XONA 3OYCA 3MKZA 2BVMA 1NG6A 2UUZA 4ZDOA 5CPRB 2HVRA 4CCMA 2V6EA 3L2RA 3VSLA 3TBIA 5CQGA 2I8DA 3J7AY 1MW7A 5HVQC 2KMUA 2KZVA 2X85A 3HUGB 2UWMA 3CP2A 3PNYA 3OYFA 2O5RA 4ANJA 2M0MA 3GBGA 4AU7A 2XSJC 3W2AA 3CESA 1Z3XA 2Z1DA 3OS2A 1D1CA 3EPZA 4XQFA 1HA8A 5HNFA 3VYTB 3EUAA 2CH0A 2LY2A 2LBFA 1UAAA 1K6YA 2V9KA 3K4MA 1PJRA 3CJQB 3BC8A 3IP4B 4HEA2 2CS3A 3H5RA 2RNGA 2VJ5A 3HL2A 1V5EA 4IQJA 4F91B 4CCLA 5FROA 4BDZA 4DIQA 3H9QA 5KCMA 4AVZA 5LD2C 5KHDA 1OLTA 1D1BA 4XKVA 4DJAA 2IGMA 3QYBA 1WJEA 2JA2A 3ZR8X 2GOMA 1PYVA 4YRVA 4H4KC 3VSKA 3KX2A 2K5CA 3HOSA 4FETA 2R7WA 3L2WA 4E7IA 3BG7A 4HSTA 2QKLB 3I9V2 3DPUA 3K4CA 2KRHA 2ZSIB 3L2VA 2E5NA 4XOTA 4F52A 4EATA 1P9QC 2F5VA 4F93B 2KHMA 3DKYA 1FMWA 2W00A 3LSKA 3VDXA 3QYEA 3AL0C 2V7FA 2DJIA 4BEHB 4BUPA 1X4OA 4XNFA 2RQQA 2XAUA 2X6WA 3DQVC 3ONQA 4CCNA 2HPMA 1D0YA 1BR1A 3M1CA 3BLYA 2OC6A 2X6XA 2OV7A 2KQRA 2CUJA 3FBNB 2R7VA 4KT6A 3OYKA 1Y6IA 4C2TA 1ERDA 2IGKA 4XLCA 2CV1A 2IS4A 2VQGA 4D1QA 3F9KA 2HZDA 1UG0A 3LSIA 3OR2C 1UELB 2VL8A 4F92B 4J01A 3S3NA 3ZXSA 1U0JA 1W36C 2DOAA 1S9HA 5HNHA 1DP3A 4B47A 2WY7Q 2DXIA 2KLOA 5TGTA 1KONA 4Y3OA 3DPTA 3K10A 3S32A 4IZZA 1QHHD 2VXZA 3CJRB 4BL0B 3PNTA 2VPLA 3IAM2 3QODA 2VIXA 4ZDPA 1Z21A 2W82A 4XLFA 2V4JC 2WBMA 4B44A 1N75A 3OYLA 1X1DA 2VB6A 3PNVA 2XF6A 3L2QA 3AL0B 4XN0A 3BCAA 5FRMA 2X1DA 4FASD 2JVGA 4C2UA 3OYBA 4JQFA 3RSNA 2X1EA 4YEJA 3HXLA 2MYSA 3OYEA 1N77A 1IRXA 1WJBA 1MMNA 1WJFA 1EA3A 2CW7A 4XL9A 1WJDA 3MMYB 2JVHA 2IGOA 2R7OA 2ZXHA 3OL4A 4XLHA 2PMZA 3PL8A 3VYRB 2Z16A 3C2HA 4BEHA 3DWLE 3K70D 2VQLA 2IGNA 3IUOA 3OYDA 3QYFA 3H0DA 3K4BA 3VWBA 4PFOA 3PSFA 3K4KA 3LSHA 4KISA 2WAQA 4J00A 2WY8Q 1N78A 4U87A 1WJAA 2CFOA 2F4IA 2K9LA 4BJTA 2VLAA 2IS6A 2MABA 4R79A 2MD0A 3LFUA 3OYGA 2OUMA 3AKZA 1VZ0A 3UNGC 3OS0A 3SZGA 4DGWB 2DT6A 1J09A 3RQ4A 4OAZA 4ZTFA 4NQWB 4RLFA 2P0WA 2AQEA 1TZLA 3FHNA 3SYTA 4P5OA 4CUGA 2V1NA 3DLAA 1D0XA 1X1AA 2Y0SA 4CCOA 2VJ4A 4G6TB 2UV1A 3DTKA 4XLAA 3CZ6A 3OS1A 3S3MA 4XKCA 4PJLA 3U21A 3ZCOA 4NNJA 4LG3A 3H9JA 1X1CA 4CZCA 3H9GA 3E0JB 2W7NA 3M8JA 2R7TA 2KP6A 4XMYA 1Z3YA 1OR7C 1X19A 1FMVA 3OIQA 4BACA 3TMOA 2R4GA 2KL4A 3KYLA 2HVSA 3H5AA 1DQUA 1LFPA 2R7SA 2K3PA 4ZDLA 4E7LA 2JSPA 5HLTA 4B48A 3CMMA 3S93A 4CCKA 1LVKA 4U7BA 4C30A 2E60A 2HQAA 4E4HA 3SEQA 4E6KG 2DT7B 3NWTA 4BQOA 4JOMA 2M4KA 3DEEA 4IQ4A 4IKFA 2XF7A 5KNLA 2K9MA 3LL7A 1G59A 1T95A 4II3A 4ZJZA 3H5NA 1QHGA 2HNHA 4DOZA 4PSXA 1MMDA 2BVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRH A;  2L2O A; 
#chains in the Genus database with same CATH topology
 1D5V A;  1RPW A;  2YU3 A;  5D6F A;  3DFG A;  3DLL F;  3S2D J;  1YS7 A;  2NOJ B;  4LJZ F;  1HC8 A;  1EF4 A;  1TWG J;  5HS9 A;  3GFL A;  4A3G J;  2EB7 A;  2L5Q A;  4GGG A;  2L7K A;  2KPM A;  5DD8 A;  1JE8 A;  2LRD A;  1LFU P;  3SEZ A;  2E19 A;  2VUM J;  4BE2 A;  1R9T J;  2EV5 A;  2ZNY A;  3DP7 A;  2JPB A;  3K4J A;  2F4M B;  4N9H A;  4G7Z F;  2EJR A;  2ZXW H;  4BE1 A;  2FE3 A;  3GFJ A;  5IT3 A;  5K7H A;  2FUG 2;  2R7R A;  5K1Y A;  2FNA A;  1QA6 A;  3SDB A;  1MJB A;  2XAG A;  4G94 A;  1IUY A;  2R7U A;  5F08 A;  3HSR A;  2HOE A;  3TDU C;  1SAU A;  1K78 B;  3J81 K;  2Q1Z B;  2PJP A;  1D1A A;  2L9N A;  1YX3 A;  1LDK B;  3BWG A;  1JGG A;  4RDU A;  3GW2 A;  2X4H A;  1Y39 A;  1Y0N A;  2VAS A;  1B9M A;  4UB8 C;  4OIR F;  3BR1 A;  1BR2 A;  3HPH A;  1K4S A;  5E20 A;  4LG0 B;  3J80 K;  4XRS G;  4AWX B;  4K2E A;  4NHJ A;  3QU3 A;  4EMS A;  1GLN A;  4WX9 A;  2NNN A;  5CLS A;  2BV6 A;  2Q2E B;  2XPW A;  4ZC3 A;  3MKW B;  2R93 J;  1ON2 A;  4RAZ A;  4IRG A;  3EUH C;  1AKH B;  2WWY A;  1SFO J;  2DMQ A;  3BR0 A;  3U1K A;  5DTD A;  3T0Y A;  5FRN A;  1BI1 A;  2GXA A;  2A5Y B;  2EA2 A;  3QP6 A;  3KZY A;  1SD6 A;  3NAU A;  1FLI A;  4I01 A;  2CUZ A;  4XM3 A;  4DZP A;  4Q4Z F;  1ITY A;  5HOO A;  5CQE A;  1KU3 A;  3CLQ A;  3KEO A;  2EZI A;  2YX4 A;  4RGR A;  5EZG A;  5GAG J;  3LNQ A;  2A3S A;  2LY1 A;  2F6C A;  1ZH5 A;  3RKQ A;  3BG5 A;  2XB5 A;  4P55 A;  2E2I J;  4E7H A;  4GFB A;  4XBF A;  1MJA A;  2W1O A;  1JHH A;  1LEB A;  2NXN B;  1HDD C;  3I55 I;  4EQQ A;  2DOE A;  4RB1 A;  1VI0 A;  2A5W A;  1K78 A;  2KDO A;  4E7K A;  3QPT A;  3SJM A;  2FA5 A;  4EM2 A;  2CG4 A;  5LGN A;  1FBS A;  3CTA A;  4KIG A;  1G3S A;  1BIB A;  1YOV B;  3V4G A;  2JA7 J;  1FC3 A;  2JPC A;  4OIQ F;  1MNM C;  1XB4 A;  2H6C A;  1EH7 A;  2M2E A;  3LSR A;  4PSW A;  5HLI A;  3JRF A;  2PJR B;  3FM3 A;  1WRJ A;  4LG0 A;  2LSO A;  1B1B A;  2XF5 A;  4I09 A;  3M8E A;  3LSM A;  1R22 A;  1W4M A;  2BZT A;  2KIM A;  2VBZ A;  4I0A A;  3J7Z I;  3OR1 C;  2CGP A;  2VJI A;  3CMY A;  2Q2E A;  3BCB A;  1UB9 A;  3WG7 H;  1T2K A;  4A6D A;  2HOA A;  3KP7 A;  1FOX A;  3WTV C;  2LP0 A;  3RQI A;  2O03 A;  3WGI A;  1AKH A;  2EV0 A;  4KN7 X;  1UHM A;  2DT5 A;  1YTY A;  2MC3 A;  2WAF A;  1ZLK A;  4HF1 A;  2R7D A;  3Q0U A;  1KQ9 A;  1UFM A;  3CCU I;  3V7S A;  5JR3 A;  3I5U A;  1H8A C;  3E3V A;  1XC5 A;  2ISY A;  3S1R J;  2M34 A;  2Y2Z A;  4BXU A;  1R7J A;  2COB A;  3QQA A;  2J5O A;  4BY7 J;  3HM5 A;  1T38 A;  1U9N A;  5CVR A;  2GQQ A;  3TL4 X;  1YE9 A;  2D45 A;  1MNE A;  2VPR A;  2VKH A;  3BTI A;  2Y75 A;  3IH2 A;  2RN7 A;  1WJ5 A;  1BJA A;  3F8N A;  2EIJ H;  4UY8 I;  2HZT A;  5ICF A;  1ZYR F;  1XGN A;  1W5S A;  4FHT A;  4BNC A;  2PX9 A;  4WK8 F;  4II2 A;  3FM5 A;  1AOY A;  2ZXI A;  3C18 A;  4BXF A;  3MKY B;  1ZGW A;  3E6M A;  1F9N A;  2QCO A;  1G8X A;  3I4M J;  1Y8Q B;  3UR3 C;  4Q48 A;  2MC4 A;  3DXJ F;  5IP7 J;  2M9H A;  3ULQ B;  5IY5 H;  5K5R A;  3CC4 I;  2XGC A;  4W97 A;  5L3C A;  2C6Y A;  5AON A;  4HPQ A;  1ZEL A;  2DFH A;  2DTR A;  2BHZ A;  3BR5 A;  4JX6 A;  3TO9 A;  2PJR A;  1ZAO A;  1XDU A;  3HRM A;  2QKM B;  4GYI A;  2DK5 A;  3JRH A;  5HS7 A;  3CF5 F;  1ZKG A;  4XON A;  3BPV A;  1S72 I;  3MKZ A;  2BVM A;  4I76 A;  2ZB9 A;  1QZY A;  4CCM A;  1Y1V J;  3GTO J;  2UXX A;  3HBL A;  4Z6Y A;  5J47 A;  4ZYH A;  3J7A Y;  1X2N A;  2QWW A;  1MW7 A;  5F04 A;  5HVQ C;  2L7Z A;  4A3M J;  2KZV A;  3CJN A;  3HUG B;  3IV5 A;  2AHQ A;  5DM6 F;  2K02 A;  2VC1 A;  2GBY A;  5BNG A;  4ANJ A;  2M0M A;  5KK1 A;  2AS5 F;  2XSJ C;  3IH4 A;  3CES A;  5J6X A;  3ABL H;  3KIO A;  3F3X A;  4XQF A;  1HA8 A;  2Y31 A;  1IDZ A;  3AG3 H;  2LY2 A;  3OIO A;  3L9F A;  2WV0 A;  4YIR X;  1UAA A;  1VQ6 I;  1B6A A;  5J4V A;  4G7H F;  3K1N A;  1K6Y A;  3AG4 H;  1P92 A;  3CJQ B;  3BC8 A;  1SFU A;  3GFM A;  2TCT A;  3E6D A;  3H5R A;  4LLN A;  2YPR A;  2Y9Z A;  5HS8 A;  2DA7 A;  2A07 F;  1U5T B;  3HL2 A;  3CDL A;  3FXJ A;  4F91 B;  2A61 A;  4CCL A;  2NOG A;  4DIQ A;  3H9Q A;  5KCM A;  4AVZ A;  2ID6 A;  2M30 A;  2VOD A;  3KET A;  3MVP A;  2F5E A;  1D1B A;  4XKV A;  2XGD A;  3P7N A;  3H92 A;  1JT0 A;  3FXL A;  2O8X A;  3QYB A;  3ZMV A;  1X3U A;  4KFC A;  2BEO A;  4D0P A;  3GEZ A;  2ZJP F;  2V9V A;  4XSX F;  5AIP A;  2GOM A;  2LF8 A;  4GO1 A;  4LB5 A;  1CQT A;  1HXD A;  2FSW A;  3CQZ J;  3L2W A;  2ZFW A;  1IXC A;  1FOK A;  3K4C A;  1HDP A;  4R1H A;  2ZSI B;  1OMI A;  1TP4 A;  2EV6 A;  1IF1 A;  3S14 J;  1P9Q C;  4J19 A;  3VOE A;  1VQM I;  4M6X A;  1FMW A;  3BG3 A;  3BQY A;  3U9G A;  3KP4 A;  3LSK A;  3VDX A;  2DOD A;  4BUP A;  2QSH X;  1SMT A;  4ASN A;  2QBY B;  2XV4 S;  2LLK A;  2QYO A;  2X6O A;  1Z05 A;  2NYX A;  3FK6 A;  1AHD P;  2O3F A;  2X6W A;  3DQV C;  2OC6 A;  4CO8 A;  4RGX A;  4PJ0 C;  1Y6I A;  2CSO A;  2BYV E;  1IO2 A;  5LRS A;  3MCZ A;  1BW6 A;  1ERD A;  2IGK A;  4XLC A;  3WOD F;  3ZPL A;  2G9W A;  1F1Z A;  4M3B A;  3LWF A;  4CXF A;  2R92 J;  1TQM A;  3JSO A;  1S6L A;  1ZRD A;  2HZD A;  4Y52 J;  4ESB A;  3S3N A;  1FPQ A;  1IXS B;  5F27 A;  4L18 B;  3A0H C;  2R5Y A;  3T8R A;  1XN7 A;  4G8X A;  1DP3 A;  3PIO F;  1K79 A;  2WY7 Q;  2Y69 H;  3K1P A;  1KON A;  1BI2 A;  4JBA A;  3DPT A;  3BR3 A;  4GXO A;  4MNU A;  4IZZ A;  2HI3 A;  3IAM 2;  4LGW A;  2EFO A;  2EWN A;  4ZH4 F;  1P4W A;  3JRD A;  1GVJ A;  3T8T A;  4AVP A;  1E3O C;  1OYY A;  3L2Q A;  1S7O A;  3SDG A;  3AL0 B;  4XN0 A;  2MD5 A;  3GCM A;  5FRM A;  2XHK A;  1FYM A;  2X1D A;  5FGM A;  2IT0 A;  3OYB A;  5KAI C;  1KU9 A;  2X1E A;  4YEJ A;  4YG2 F;  1XS9 A;  1FP1 D;  1WJB A;  1W1W E;  2KRF A;  3JRB A;  2KIQ A;  3PO2 J;  3P9C A;  4UVB A;  2FX0 A;  1R23 A;  1O3T A;  1IC8 A;  5ILU A;  2VC0 A;  2NS0 A;  4ENJ A;  3DEU A;  3IWF A;  3C2H A;  3DWL E;  2QBY A;  1RI7 A;  3IUO A;  4BYY A;  1YO5 C;  2H1K A;  1K6O A;  1WZ2 A;  1LFB A;  3CUQ B;  2DA2 A;  2K7L A;  3K4K A;  3FXO A;  2WAQ A;  3LOC A;  1U3E M;  2WY8 Q;  3BOQ A;  4AIH A;  1JUM A;  5LHI A;  2MD0 A;  1O3R A;  2FMY A;  1D3Y A;  1ETQ A;  1W7P B;  1I6X A;  1JGS A;  2OBP A;  3DF8 A;  3OS0 A;  4DGW B;  2LR8 A;  1W5T A;  2DT6 A;  4OAZ A;  1FJL A;  4RLF A;  2P0W A;  3SYT A;  2V1N A;  2MA3 A;  3DLA A;  1D0X A;  1ZHF A;  1X1A A;  2Y0S A;  5E3M A;  4HF2 A;  3LAP A;  1PUE E;  1IZ1 A;  2QQA A;  4XLA A;  3CZ6 A;  5ILV A;  4B4C A;  3ZCO A;  3U21 A;  4YFX F;  1TNS A;  5E18 F;  2ZME C;  1RZ4 A;  1FSH A;  3H9J A;  1X1C A;  3R61 A;  1BIA A;  2W7N A;  1B59 A;  2HR3 A;  3M8J A;  3I59 B;  4D5F A;  3GWZ A;  2KP6 A;  5LHH A;  3FMR A;  1X19 A;  3E97 A;  3OIQ A;  2QSF X;  1UJ8 A;  2JK3 A;  5LGU A;  5F1R A;  1YJ9 I;  1ZGJ A;  2HVS A;  1SFE A;  1P4X A;  5M3M J;  2K3P A;  2N8G A;  4PCQ A;  1YLF A;  2FF4 A;  2M5W A;  3S93 A;  1BI3 A;  1IV8 A;  4CCK A;  4U7B A;  2QVO A;  3Q9V A;  4E4H A;  2L3D A;  1QNT A;  5EG0 A;  3KP5 A;  1U2W A;  3W6V A;  3K1M A;  1U8B A;  1O7L A;  2M1B A;  3KYC B;  4FE7 A;  5LEK A;  3MZH A;  1VF9 A;  2DDB A;  1QHG A;  2HNH A;  2CQQ A;  3BTC A;  1J5Y A;  5IYB J;  1PUF A;  4HA8 A;  4A6E A;  4L9V A;  1AA7 A;  3JRI A;  1KA8 A;  5A2Q Z;  3W6K B;  1DGW Y;  3MWM A;  3F22 A;  1IAW A;  4EJT A;  1UHW A;  1TT0 A;  3QU6 A;  1YX5 A;  1GUU A;  3FXQ A;  2LKP A;  2HDC A;  4XSZ F;  3F8F A;  4ITV A;  3IRQ A;  2CW8 A;  4QTR A;  3FZV A;  2XAQ A;  3ABM H;  3D1N I;  1W5C C;  4MQ9 F;  4QWQ A;  4QSH A;  2Z2S B;  3M8F A;  2L9R A;  4FX4 A;  1VQ8 I;  2W84 A;  4M9S A;  2JQ7 A;  2PMZ N;  3C7J A;  3CJT B;  2EZL A;  1MBK A;  4PJN A;  2M7B A;  3GZ5 A;  1E0E A;  3ERM A;  4XOR A;  2P7C B;  2K9N A;  4Y33 A;  3OWT A;  2ELJ A;  1IN5 A;  3V7R A;  2VXD A;  1BM9 A;  4RMN A;  1RET A;  4C3H J;  1VQN I;  4A3L J;  1HST A;  2FNP A;  5D5U B;  2EBI A;  1WQ2 A;  2RKH A;  4DW6 A;  1ONV A;  3HHG A;  3IH3 A;  1P2F A;  2V1U A;  1MDM B;  2O7O A;  1B4A A;  3MEX A;  3H3Z A;  4MIM A;  5D5V B;  1YJW I;  1HW2 A;  1WH7 A;  4IHS A;  1O57 A;  2NVQ J;  3MZY A;  4UV9 A;  3CD6 I;  3W2V A;  2XB0 X;  3PJR A;  2HDW A;  1MH3 A;  3WU1 B;  3V42 A;  4FIS A;  2RVC A;  2CV2 A;  2B63 J;  2DPD A;  4CSW A;  2LDU A;  1RUO A;  2LH9 A;  2BW3 A;  4NC7 A;  3L2U A;  4IX7 A;  2DO7 A;  3BDD A;  5ICC A;  3K70 C;  3KP6 A;  1QPM A;  4E7S A;  3G4S I;  1MMG A;  2XPV A;  3M7G A;  3K9T A;  3HGY A;  5IT9 Z;  1S5L C;  1ETK A;  4Y13 A;  4A3K J;  2E7W A;  4M73 A;  2XPU A;  2L9V A;  2G7U A;  2XIG A;  4IJA A;  1DPR A;  2ME0 A;  5TRD A;  1RC9 A;  2HEO A;  1MBG A;  2L2O A;  3F8C A;  3FXU A;  1R6R A;  2DTZ A;  2A69 F;  5E79 C;  3M9A A;  3PSI A;  3CCS I;  5E17 F;  3TOB A;  1OCT C;  3FF5 A;  1Y0U A;  1L0O C;  2CQK A;  2R7Q A;  3ZRG A;  4BY1 J;  3KZI C;  1J59 A;  1P7J A;  1Q1H A;  3ZMS A;  4CA0 A;  5FLV A;  1TNT A;  3VYS B;  1VQ9 I;  4KT5 C;  5GTI C;  1LEA A;  4M71 A;  1ZK8 A;  3ELK A;  3GME A;  2E35 A;  2DA3 A;  4XOP A;  2E1N A;  3MD2 A;  4KJZ A;  4MTE A;  2FBK A;  2LMD A;  1UMQ A;  2DA6 A;  2UXN A;  3VYU B;  3TO6 A;  1UHS A;  1OYI A;  1A6I A;  4BE0 A;  2KIU A;  3IKV A;  3S17 J;  5JHF A;  3HG9 A;  4FCY A;  2A68 F;  5GAE J;  2IP2 A;  4D5C A;  3KYD B;  4DYQ A;  2E36 A;  2A05 A;  2QQ9 A;  3UKG A;  4NDL A;  4C9Y A;  3B6A A;  2BXY A;  2V26 A;  3HOY J;  2E7X A;  1JKQ C;  1FX7 A;  3BRO A;  3CC2 I;  1CGP A;  1OKR A;  4MQV A;  3E1S A;  2IA2 A;  2XC7 A;  1SFX A;  4PK4 A;  3JTH A;  2OJE D;  3TO7 A;  2BHY A;  3FK7 A;  1SD4 A;  2K85 A;  4L9J A;  3GTQ J;  2RDP A;  2MFZ A;  1I27 A;  3JCU C;  2RNJ A;  4RAG A;  1VND A;  4D7N A;  2FQ4 A;  2LRE A;  3HPG A;  3MZ8 A;  4QPQ A;  1WGX A;  1BR4 A;  2OA4 A;  4G6Q A;  3R60 A;  3HIF A;  3GTP J;  1C0W A;  4PFP A;  3GXO A;  5F64 A;  3RKW A;  4BGD A;  2TRT A;  5LFA A;  2M0C A;  2OTJ I;  2X51 A;  2GOX B;  1QGP A;  2WB1 A;  3FDY A;  1YYV A;  1E2X A;  3K4L A;  4EV0 A;  2LF7 A;  3P9I A;  4IF4 A;  4DBQ A;  1TLH B;  5B5E C;  3WTY C;  4A3J J;  4LFU A;  3FBI B;  4LIU A;  4QPO A;  5F6F A;  4D9J A;  2M8G X;  2WAD A;  3V8L A;  4F55 A;  3TDZ C;  2NVY J;  3LA3 A;  4U0W A;  2BY2 A;  2EFQ A;  4PGH A;  5K7Z A;  4RLQ A;  3ASN H;  2E1M C;  1TWF J;  5CVJ A;  2ZSH B;  3OYJ A;  1MBE A;  4WCG A;  3F8B A;  3GFI A;  2V9P A;  1R1V A;  2EIN H;  5F0C A;  2NVX J;  1U5T C;  2CUE A;  3J81 Z;  5FD5 A;  4ETS A;  1IRG A;  5CPR B;  5HLH A;  3ERE D;  1J0R A;  4FQG A;  2OQG A;  2XKP A;  3O2P E;  5LHG A;  3VSL A;  3TBI A;  2M8E A;  5E1W A;  3TP0 A;  3IKT A;  2CW0 F;  2X85 A;  5F0F A;  2RQP A;  1R00 A;  1A04 A;  2XAH A;  3MKL A;  3OYF A;  2O5R A;  3PFI A;  3J80 Z;  2ZXJ A;  1TW3 A;  3GBG A;  1H9T A;  4AU7 A;  1Z3X A;  5BS6 A;  2X9D A;  2ESN A;  4IXA A;  1HBX G;  1JT6 A;  2ESH A;  3OOP A;  1OQY A;  2YU9 J;  1GDT A;  3G71 I;  1X3Z B;  4BQA A;  2NRA C;  1F4K A;  3ABU A;  4AIJ A;  3FXK A;  4E70 A;  4L5E A;  3B73 A;  3S16 J;  1ZG5 A;  3K4M A;  3IP4 B;  1I3Q J;  2ZME A;  1FY7 A;  3AG2 H;  3PQK A;  4HW0 A;  1K4T A;  1IRZ A;  5L3G A;  3ZQH A;  2RNG A;  2B9S A;  3EDP A;  2VJ5 A;  1ZRC A;  2JT1 A;  1V5E A;  5GP9 A;  3ZQ7 A;  2M87 A;  2L7F P;  2RV8 A;  1GHC A;  2Y30 A;  1R5I D;  1A6Q A;  5ICE A;  5KHD A;  2H6B A;  1R1T A;  1FZP B;  5FJ8 J;  2WC2 A;  4UUV A;  5BPI A;  3IC7 A;  2O61 A;  2W85 A;  2IGM A;  5ILS A;  1DU6 A;  4LMY A;  2JA2 A;  5GAD J;  3WTZ A;  5J4Y A;  1I1S A;  1LDD A;  4H4K C;  1VQL I;  5IPA A;  3HOS A;  1Z91 A;  5IOY A;  4E7I A;  4HST A;  3QRF F;  5E1Z B;  1FBU A;  1ON1 A;  2EFW A;  3F72 A;  3HTU A;  2KRH A;  3L2V A;  2E5N A;  4HYE A;  4XOT A;  1U9O A;  4F52 A;  1LJ9 A;  1IXR C;  1FT9 A;  3ZMD A;  3WTX C;  4F93 B;  1E3P A;  1MBF A;  2F2E A;  1WI3 A;  3QYE A;  3AL0 C;  2PFB A;  2V7F A;  2HTJ A;  1X4O A;  1ORK A;  3EET A;  2UZK A;  1IV6 A;  1PDN C;  2XAU A;  4EM1 A;  3CCY A;  3ONQ A;  3QP5 A;  3H3U A;  1D0Y A;  3BLY A;  4EJV A;  2KQR A;  3FBN B;  5DUI A;  3OYK A;  1BOA A;  4NBQ A;  4C2T A;  1SAX A;  2HYG D;  2CV1 A;  1Z77 A;  1MMS A;  2IS4 A;  2VQG A;  3KP3 A;  4RS8 A;  3LSI A;  3OR2 C;  4F92 B;  1MSF C;  5IYC J;  3ZXS A;  4A0Z A;  1S7A A;  3CUQ C;  2AXL A;  5HNH A;  2L4A A;  3JRG A;  2EH3 A;  3SXY A;  2GXG A;  3PQJ A;  2H09 A;  3DBR B;  1ZR4 A;  1TT5 B;  2KDZ A;  1J2X A;  2PQ8 A;  2Q8K A;  4BL0 B;  5DCF A;  3PNT A;  2JUC A;  2VIX A;  3E6C C;  1H9G A;  3K7A J;  2PG4 A;  3I0T A;  4YIF A;  1D8J A;  4XLF A;  2V4J C;  3R0J A;  5LLQ A;  2WBM A;  4L9N A;  1X1D A;  3F6O A;  2YSR A;  1VQP I;  3BZ6 A;  1QZZ A;  3BCA A;  4RA2 A;  1F43 A;  2JVG A;  5BPD A;  1IN4 A;  2K9Q A;  1HCR A;  1R36 A;  2G7H A;  1ZGA A;  3J7A O;  1AU7 A;  1LUJ B;  2X0L A;  1T39 A;  1X1P A;  3K69 A;  1VTN C;  3BJA A;  3NAR A;  1MJ9 A;  3PIP F;  2ZXH A;  2OZ6 A;  1FTT A;  1HQC A;  3VYR B;  4HQM A;  2OD5 A;  2Z16 A;  5H2F C;  3K70 D;  2VT2 A;  2VQL A;  5FO5 A;  3S1Q J;  3QYF A;  1RR8 C;  4U0Y A;  3DCF A;  2ZO4 A;  2V79 A;  4BXX J;  1NTC A;  4PFO A;  3JAM K;  3LSH A;  3CCM I;  1W0U A;  1ETY A;  2VOO A;  1I50 J;  4J00 A;  3DBL B;  9ANT A;  1OFC X;  1WJA A;  3TW6 A;  3CO6 C;  2G0E A;  3J7Y J;  1F5T A;  2O8K A;  2K9L A;  2IS6 A;  3Q5F A;  1FYL A;  4R79 A;  2CWE A;  1J75 A;  3TED A;  3C2B A;  4CYC B;  3U2R A;  1LDJ A;  2R5Z B;  2JRM A;  2R5Y B;  4IRI A;  3GZ6 A;  4M3F A;  5L3E A;  5FD6 A;  1YW7 A;  5B3S H;  3M1E A;  3A0B C;  4CUG A;  3CCJ I;  4CCO A;  5JLX A;  1T08 B;  1VQ5 I;  4G6T B;  1OR7 A;  3WTW C;  5ERI A;  3DTK A;  1MD0 A;  2GM4 A;  1XGO A;  3WGG A;  2VKV A;  4LK0 F;  4IHV A;  1ETO A;  5JHU A;  1WH5 A;  2NS7 A;  1WVR A;  3HOV J;  4LB6 B;  3N97 A;  1O3Q A;  1LNW A;  4H0E A;  2FOW A;  2JN6 A;  2Y9Y A;  3ABK H;  4HV6 A;  2YR2 A;  3KYL A;  4ZDL A;  1GV5 A;  5HLT A;  4B48 A;  2K40 A;  3WE2 A;  3CMM A;  1YW9 A;  3GTG J;  3REO A;  2DFI A;  4ZYE A;  1SEU A;  4E6K G;  1OCR H;  4A12 A;  1ZR2 A;  4BQO A;  1L3L A;  1FSE A;  4A3D J;  1GVD A;  4B8X A;  5KNL A;  5E8G A;  1JXS A;  1H88 C;  2P81 A;  2FJ1 A;  4A5N A;  1A31 A;  1YRN A;  2JSC A;  1MMD A;  4GCV A;  2BVL A;  2DQR A;  4BAC A;  4CYC A;  1B72 A;  2R5Z A;  3GYH X;  3H1C A;  1ETW A;  2M4G A;  4I02 A;  3DV8 A;  2F4O B;  2JTV A;  1IN7 A;  1ZQ3 P;  2OAZ A;  5D4R A;  2EIL H;  3OYH A;  3IRR A;  2ZJR F;  2JA5 J;  4XN3 A;  1LB2 A;  1VQ4 I;  3HKZ A;  2Y0M A;  1R1U A;  1T0F C;  1HSJ A;  1RKW A;  5JLW A;  4DYR A;  2GA2 A;  5D5W B;  4Y4R A;  3DKX A;  4F7Z A;  1R5G A;  4BU2 A;  4EVI A;  3CF2 A;  2LKS A;  1UZC A;  2EFN A;  1HKS A;  3FKI J;  4YFN F;  1EJ9 A;  3IHU A;  2V6C A;  1Z7U A;  1X2M A;  4IHT A;  4L9T A;  3ECH A;  2K27 A;  1SVO A;  1N25 A;  2LFB A;  2OF7 A;  3I4P A;  3ZMT A;  4RM3 A;  4N4O B;  2A6T A;  4UVA A;  3S2H J;  4A3B J;  5C4X J;  1UCR A;  2FBI A;  4HLX A;  5TIS C;  4B1R A;  1LPQ A;  4HG2 A;  1X4P A;  2HKO A;  3IL2 A;  2MH9 A;  2IBD A;  3SZT A;  1PP8 F;  1Z0X A;  1Y56 A;  3JTG A;  2GAU A;  3IAS 2;  2WAQ N;  2XDV A;  2IS1 A;  1TL8 A;  3HSF A;  4HF0 A;  1XCB A;  5E8I A;  3EUH A;  4WXD A;  2PLY A;  4HQE A;  3ZMU A;  5J1Y A;  1WSU A;  5D8L B;  2W24 A;  3FKJ A;  4M3D A;  2PEX A;  4A3E J;  1R4N B;  3BTJ A;  1XTA A;  1XGS A;  5J3L A;  1OCC H;  1U6G A;  4BJ5 C;  3T1B A;  2OZU A;  1ZG1 A;  5EG0 B;  2DPU A;  1ULY A;  1BW5 A;  2VBX A;  2FU4 A;  4P96 A;  3OSF A;  2NVU B;  1OCZ H;  2ZCW A;  3K6G A;  1OCO H;  1UG2 A;  4Q47 A;  3VPR A;  4B43 A;  2Y0S N;  3OYN A;  2XRO A;  1PUF B;  3M3Y J;  3I71 A;  1KGS A;  4JYK A;  5FKN A;  2GZW A;  1SVL A;  2ADU A;  2L9S A;  1H89 C;  2ICW G;  3I64 A;  2X6Y A;  5LGT A;  2IXS A;  3DU5 A;  3S8P A;  3I3L A;  2LD5 A;  3A2K A;  1Z67 A;  3HGG A;  1U8R A;  4ENN A;  1HKQ A;  3W3C A;  3QOE A;  4B3X A;  1Z6T A;  1IDY A;  2ZKZ A;  5FKL A;  4XKW A;  2HGC A;  2D5V A;  4JP0 A;  3RKY A;  1K61 A;  2FOK A;  3VB2 A;  3LQR A;  2ZC2 A;  2DFE A;  3A4C A;  3BJO A;  3D5L A;  4HX7 A;  4LIV A;  1FWZ A;  4MHG A;  4AUX A;  4JX5 A;  2DCE A;  3I56 I;  1A5J A;  5FFX A;  2HYF A;  1DGR M;  1DU0 A;  4BHP A;  2BY1 A;  4BS9 A;  4IVN A;  3F23 A;  3Q0W A;  5D6E A;  3LSG A;  3V8K A;  3FXM A;  5DCM A;  4OU0 A;  3HOW J;  2IS2 A;  2VE8 A;  2FRH A;  4BQQ A;  1WKM A;  5HDN A;  1BOB A;  3L1P A;  5FLX Z;  4UNO A;  4CCJ A;  4BHC A;  2E71 A;  3PFY A;  3OOU A;  4KIT B;  2VBW A;  2XAS A;  3WGH A;  2VKD A;  3D5S C;  3NWS A;  2VT3 A;  3F21 A;  3OYM A;  2JZY A;  4PUS A;  3BT9 A;  4BHB A;  4AD9 A;  1ZTR A;  2CMP A;  5B66 C;  3Q0V A;  1G6N A;  3E5X A;  1R58 A;  3OL3 A;  4HSR A;  4I7H A;  4A2U A;  3MQ0 A;  4PJM A;  1POG A;  3S2W A;  4N0B A;  4YEL A;  2L02 A;  1YHQ I;  1JKR C;  4FX0 A;  1OCP A;  3ECO A;  4PJJ A;  3E7L A;  3RIR A;  3PO3 J;  2WA0 A;  3RTR A;  3CCV I;  4U0V A;  2BW3 B;  3H0G J;  2EK5 A;  1D5Y A;  4ZZL A;  4CH7 A;  1RNL A;  2M3A A;  3QAH A;  5A2Q K;  1JUP A;  3OIP A;  2HVQ A;  2MH2 A;  2MSY A;  3F0C A;  4B3A A;  1MH4 A;  3JW4 A;  3E5Q A;  3H35 A;  2KZG A;  4QLC U;  1FIP A;  4UVC A;  1JI8 A;  2FBH A;  2STT A;  2HXI A;  1X1B A;  2ME6 A;  1J7K A;  1MND A;  2LBF B;  1V4R A;  4F3Q A;  4CYD A;  3O8H A;  3CCE I;  3VFZ A;  2D1H A;  4RB0 A;  4ZYG A;  1YIO A;  1ZAR A;  1MGT A;  5M3F J;  2VJJ A;  4XIC A;  4DBR A;  4XKB A;  4MGR A;  2FQ3 A;  2QGU A;  3DBH B;  2I5U A;  1MMA A;  4AYB A;  2XVC A;  1T33 A;  1ZLJ A;  5EDN A;  4A93 J;  4UUT A;  3CP8 A;  4R8H A;  1Z6R A;  3LAJ A;  3R6S A;  3SQN A;  3SHF A;  1O4X A;  1LKX A;  1R5H A;  3D5R C;  3DTE A;  3RCO A;  2RRE A;  2OCE A;  1HOM A;  2IAI A;  3H36 A;  2KRC A;  4E7Z A;  4BJ6 C;  2CV0 A;  1DUX C;  5CKT A;  2ECB A;  2PI0 A;  3WU0 A;  2STW A;  4ZYA A;  5B1B H;  2VKE A;  2LG4 A;  3M4O J;  4BH9 A;  3HJE A;  2BE5 F;  1DP7 P;  2QSG X;  2HVR A;  1K83 J;  2IEK A;  3KCC A;  4XLN F;  2EIK H;  4UXN A;  1I5Z A;  3GUD A;  3HTS B;  2V6E A;  4DQ2 A;  3ISP A;  2DMN A;  5DV5 A;  2JMW A;  2BXZ A;  2J5P A;  5E3L A;  2ISZ A;  3RZO J;  2GIV A;  2HXO A;  5K7F A;  2KMU A;  2UWM A;  2CQX A;  3CP2 A;  2AXT C;  2D2W A;  2DI3 A;  5EJC A;  2HQN A;  2GIZ A;  2IW5 A;  1IN6 A;  2H8W A;  2F5C A;  1LQ1 A;  2GXB A;  2DLL A;  1XMK A;  5L3B A;  1ZN2 A;  4MEX F;  3OS2 A;  3I53 A;  3TOA A;  4OIP F;  4UUS B;  3VYT B;  3EUA A;  1ODD A;  1A35 A;  2K9S A;  2LBF A;  1YW8 A;  2P5V A;  1D8K A;  2QLZ A;  1SVM A;  4X1E A;  1DDN A;  5J40 A;  2PMU A;  1JTY A;  5M5Y J;  1XSX A;  1R49 A;  1PJR A;  5F1J A;  4D7M A;  2JJ7 A;  3NQO A;  1YQA A;  4M74 A;  2CS3 A;  2ECC A;  4N9I A;  2V1D A;  3S1N J;  3LST A;  1WPK A;  4U7D A;  1USS A;  4IPA A;  2E1O A;  4CDG A;  5BMZ A;  4HZF A;  4M6V A;  4BDZ A;  3FX3 A;  5LD2 C;  3AAF A;  2P8T A;  2OCC H;  3QWL A;  5LRR A;  3A03 A;  4M3G A;  4PGG A;  1OLT A;  3HZJ A;  1K7A A;  4Y17 A;  4M6Y A;  1XSV A;  4HBL A;  4M72 A;  2I10 A;  1KQ8 A;  5GTH C;  4XK4 A;  4W1U A;  4YRV A;  4NC6 A;  3KX2 A;  1S3J A;  1TWA J;  2K5C A;  3VSK A;  4S05 A;  4KA4 A;  2E1C A;  4FET A;  2R7W A;  2RAE A;  3BG7 A;  2CO5 A;  1YIJ I;  2QKL B;  2QQ8 A;  3COA C;  1TWH J;  2K4J A;  4KUM A;  2W25 A;  1FP2 A;  1RIO H;  1FTZ A;  2L0K A;  2Z5U A;  4KYW A;  2EQR A;  4RGS A;  4LOC A;  2KHM A;  1SD5 A;  5DEQ A;  5GPC A;  4BEH B;  2DJI A;  4AM3 A;  3MAJ A;  4FE4 A;  5J8C A;  4PZJ A;  2RQQ A;  5J8F A;  5DM7 F;  2DJN A;  4CCN A;  4O3M A;  1JTX A;  3BZK A;  1AWC A;  4UUS A;  2X6X A;  2OV7 A;  2XAJ A;  2DW4 A;  2R7V A;  4KT6 A;  3WHB A;  2WB1 N;  2JA6 J;  2V1X A;  2NS8 A;  2IA0 A;  4M9Z A;  1PVE A;  4D1Q A;  2W57 A;  1UG0 A;  1HW5 A;  5F0H A;  1I39 A;  4BAY A;  2VL8 A;  2B0L A;  2CFX A;  1U0J A;  1W36 C;  4RB3 C;  2DOA A;  2K4B A;  2ZME B;  5HDG A;  4B47 A;  3VEP A;  4NQW A;  2QQB A;  4I0B A;  2DXI A;  5EZH A;  3BG9 A;  2KLO A;  3GF2 A;  5C44 J;  1BN5 A;  4S0H B;  2HTS A;  3S32 A;  4G9Y A;  4RBO A;  4EGY A;  1QHH D;  1HKT A;  3CJR B;  4MFD A;  2VPL A;  4HAM A;  4YII A;  3QOD A;  5DYM A;  3GTM J;  1R71 A;  1Z21 A;  1UST A;  5FKO A;  4FTH A;  2LK2 A;  3KE2 A;  6PAX A;  1VQO I;  3KP2 A;  2KIS A;  1FIA A;  3K2Z A;  2VB6 A;  5JFR A;  3PNV A;  2XF6 A;  1GV2 A;  4RB2 C;  1O3S A;  1XSD A;  5EEG A;  4IHW A;  4C2U A;  3G3Z A;  1EH8 A;  3DEW A;  4A69 C;  3HXL A;  2MYS A;  4HDU A;  1N77 A;  2BBY A;  3CUO A;  2HFH A;  3KFW X;  1WJF A;  3PM1 A;  4XRS A;  3JRC A;  4XL9 A;  5DD4 A;  3GZN B;  1VQK I;  3MMY B;  2R7O A;  5K5O A;  1G3Y A;  3SZP A;  4XLH A;  2ZJ2 A;  2CYY A;  3PL8 A;  1YIT I;  4BEH A;  4DYC A;  2IGN A;  4L0Z B;  5HDK A;  4L5I A;  3K4B A;  3LFK A;  1XX5 A;  2P6T A;  5K5Q A;  1KYW A;  2EFP A;  1G3T A;  1B9N A;  4MO7 A;  4M3E A;  2CFO A;  2F4I A;  2Q0O A;  1IG7 A;  2DA1 A;  4BJT A;  2QZ8 A;  2MAB A;  5EEA A;  1F36 A;  1MBJ A;  4WXH A;  4OIO F;  2P5K A;  3LFU A;  5EYR A;  4IL6 C;  1U78 A;  2WTE A;  3OYG A;  2DOF A;  2W48 A;  4V2F A;  2HQ5 A;  1VZ0 A;  3HB9 A;  3UNG C;  1V55 H;  1J09 A;  4CIC A;  1BC7 C;  1XCV A;  4ZTF A;  1TQI A;  2AQE A;  3FHN A;  2O6G E;  2R0Q C;  5EF6 A;  2DAO A;  4LLL A;  5HLG A;  4ENK A;  4A3I J;  2O9L A;  2MLG A;  3TKY A;  2LTP A;  3LSP A;  4KMF A;  2K3F A;  3GTL J;  5C3E J;  3CMA I;  2VBY A;  4PJL A;  4XRM A;  2L54 A;  4NNJ A;  3CLO A;  1G3W A;  5GPA A;  1QVT A;  1T6S A;  3H9G A;  1Z1D A;  3E0J B;  1S29 A;  1SC7 A;  4RGU A;  1ENH A;  4UB6 C;  2A6H F;  1S7E A;  2XKO A;  5CJ9 A;  1IUF A;  3GO5 A;  2ID3 A;  3ZQF A;  2R7T A;  1MSE C;  2OPT A;  1J9I A;  1NHA A;  1Z3Y A;  3GX4 X;  3O3K A;  4OIN F;  2KL4 A;  2L4M A;  3LA2 A;  4PDK A;  1FBQ A;  1DQU A;  1LFP A;  2R7S A;  4IHX A;  4IEJ A;  2JSP A;  3HRU A;  4UV8 A;  5E3N A;  1LVK A;  3KLN A;  1XD7 A;  1R4M B;  2E60 A;  2HQA A;  1P4A A;  3SEQ A;  2CJJ A;  1XGM A;  3NWT A;  4P9F A;  2E2H J;  1BJZ A;  3I54 A;  4JOM A;  3DEE A;  4MEY F;  3G1O A;  2XF7 A;  5TJJ A;  4ZYD A;  1G59 A;  1IJW C;  4A3F J;  2YUS A;  2X48 A;  4II3 A;  5BQT A;  2L01 A;  5CVV A;  2FML A;  4ZJZ A;  4CHU A;  4AIK A;  1LE8 B;  1SD7 A;  2EA4 A;  4DOZ A;  4AC0 A;  1YI2 I;  2ELK A;  4PSX A;  1TC3 C;  3WE3 A;  3NEU A;  4I2O A;  1QBJ A;  2MGQ A;  2KIF A;  1YFH A;  3G73 A;  4I98 B;  2P5L C;  3D0S A;  3AG1 H;  4BBS J;  4ZTJ A;  3MFK A;  3N05 A;  4XRF A;  4ON0 A;  3ZMZ A;  5H6Q A;  3RPU D;  2EPF A;  3RPU A;  1JJ8 C;  1IRF A;  4M9X A;  2JWT A;  1NG7 A;  3MN2 A;  4BDY A;  2RGV A;  2LC2 A;  3K0L A;  2H27 A;  5H20 A;  4E7J A;  1QU3 A;  3NRV A;  4N4N B;  3HRT A;  5E3O A;  4NUB A;  1RES A;  4EJO A;  3S3O A;  2FD5 A;  1QO0 D;  1P6R A;  4KIF A;  2IJL A;  2FXA A;  5D8K B;  4EJW A;  3HDD A;  2HQR A;  2W4S A;  4HX4 A;  3X2Q H;  3KEY A;  5DS9 A;  5CVU A;  1DPU A;  3V8J A;  3CCL I;  2DQL A;  2R3S A;  2KFD A;  2M7A A;  2P7V B;  2R7Z J;  2PMH A;  1T8I A;  3FWE A;  4BKX A;  1OJL A;  3WHC A;  1SFK A;  2ZBK A;  4C3J J;  5JVG F;  1NH3 A;  2BOL A;  3AFH A;  1WFX A;  3QPH A;  3HSE A;  1OYW A;  3OY9 A;  2JUG A;  3KZZ A;  3G2B A;  4KIB A;  3Q3S A;  1MIJ A;  5EEH A;  2KJC A;  4WXC A;  3OSG A;  2Z3Y A;  2LYC A;  3C2G A;  3OYI A;  1QQI A;  3CC7 I;  1XDS A;  5FFZ A;  3BTL A;  1LE8 A;  2ELH A;  3RDI A;  5M5W J;  1CF7 B;  1YRN B;  3BG6 A;  4HNU A;  1I6H J;  3KEQ A;  1W0T A;  2YX7 A;  1B72 B;  2VQH A;  2HU9 A;  4LIT A;  4A5M A;  3JAM Z;  2JA8 J;  5IYD J;  3ABT A;  1V5G A;  2CRG A;  3CCQ I;  1VQ7 I;  3PUB A;  4GRI A;  4KMU X;  5IOZ A;  3G1L A;  1XG1 A;  2AQF A;  2EIM H;  2DDA A;  4KN4 X;  2GWR A;  2MLK A;  2WV1 A;  2DMU A;  1MBH A;  4UHT A;  3DU6 A;  4HLY A;  3A1Y A;  3BQZ A;  2E1M B;  3DTI A;  2MBF A;  2YS9 A;  3HRS A;  3VOD A;  1B8I B;  2BY3 A;  3A02 A;  3EUK L;  2QUF A;  1QZE A;  3BR2 A;  2X1C A;  1SAN A;  4HV5 A;  3JRA A;  1LVA A;  4G6D A;  2CU7 A;  3R4K A;  2VQC A;  3QPS A;  4BQN A;  1KYZ A;  2JRT A;  3FIW A;  5CVI A;  3ZGK A;  3HEF A;  4HNT A;  2DN0 A;  3OYA A;  4Q5S F;  2DMP A;  4RAF A;  3K4N A;  3ML6 A;  4LD5 A;  3CCR I;  3A01 B;  4QIW N;  1EKE A;  2F5D A;  3ASO H;  1MKM A;  4NC8 A;  2ZFU A;  2DMT A;  2DU9 A;  2EZH A;  1D0Z A;  1M1E B;  4GYG A;  2O0Y A;  3OMY A;  3ZQI A;  2Z99 A;  3SFZ A;  3DPL C;  1FYK A;  3QOP A;  2E2J J;  3ZOB A;  2Z9O A;  1PP7 U;  3HKZ N;  2HPI A;  3EQL F;  3TGN A;  1WHU A;  3ZQG A;  1CF7 A;  1KU2 A;  1HW1 A;  3HUG A;  1E3H A;  3HC7 A;  1RR7 A;  3G6E I;  3ZQL A;  3RPQ A;  3E5U A;  1W36 D;  3HOU J;  1V5F A;  1KZH A;  2QEN A;  1JHF A;  1G4D A;  4HRI A;  4OMY A;  2HDD A;  2KKO A;  4MLO A;  2XUB A;  4HX8 A;  3RJP A;  4XLE A;  2DFF A;  4XR6 A;  2F5F A;  2E5Z A;  4P1W A;  2LVS A;  2MW8 A;  3S1M J;  3LQQ A;  4IO9 F;  4EM0 B;  2VE9 A;  2FEZ A;  2NAZ A;  1ETV A;  3FXR A;  4TV7 A;  3W2W A;  3WTU C;  5IP9 J;  3HOT A;  2R7X A;  1B8I A;  4JK1 X;  4EGZ A;  3L7W A;  4V19 K;  3B02 A;  1U5T A;  5D4S A;  2KT0 A;  3ZQQ A;  2IA1 A;  3TP3 A;  1TBX A;  5H6R A;  4ESJ A;  3GTJ J;  1Z9C A;  4OWR B;  2XSD C;  3L09 A;  3IWZ A;  3O6B B;  4IRH A;  4WF2 A;  2DA4 A;  2LOO A;  4OAY A;  5DCM B;  5LBQ A;  1XMX A;  2B7E A;  4C2M J;  4HDV A;  1QPI A;  3H3V K;  1Y1W J;  3L00 A;  1Z7L A;  3GLL A;  2BGC A;  3A01 A;  1TTY A;  1X58 A;  5LEJ A;  1ACI A;  3HYI A;  1S8N A;  1YS6 A;  2PN6 A;  4X0G A;  3ESW B;  1WJC A;  4RM2 A;  1TWC J;  2LKX A;  2WAE A;  1YG2 A;  1A36 A;  4Y15 A;  3LMM A;  4U88 A;  1YJN I;  1FOY A;  4IHY A;  3OYC A;  2HOS A;  1OIS A;  1NG6 A;  2UUZ A;  5J1R A;  3GTK J;  4IOA F;  1XPX A;  4ZDO A;  3M07 A;  4XID A;  2GLO A;  1IGN A;  4A0Y A;  2RC4 A;  3FIS A;  3L2R A;  1FEX A;  5CQG A;  4IOC F;  2I8D A;  4S04 A;  3FMQ A;  2CUF A;  3PNY A;  3I4N J;  2IRF G;  4V2G A;  3WTS C;  3W2A A;  2Z1D A;  3G1M A;  2VOP A;  4HNV A;  1STZ A;  1D1C A;  4OMZ A;  3EPZ A;  1ZRF A;  5HNF A;  1HLV A;  2CH0 A;  5AIQ A;  5CYV A;  2LY9 A;  3OV8 A;  5L3F A;  4A0X A;  2QA4 I;  2COM A;  2P4W A;  1BC8 C;  1JUS A;  1RUN A;  4L0Y B;  2V9K A;  1FOW A;  2QF7 A;  1JKO C;  3RYR A;  4HEA 2;  1ZG3 A;  2DBB A;  2TDX A;  1NK3 P;  4ENM A;  1IW7 F;  3GVA A;  4IQJ A;  5FRO A;  2HKX A;  4KNY A;  1RKT A;  3CO7 C;  1V54 H;  1T98 A;  5FLX K;  1Y8R B;  5KVR A;  4DJA A;  1X3W B;  2XGE A;  1WJE A;  5ED4 A;  4DZJ A;  3C3W A;  1APL C;  3ZR8 X;  1ETX A;  4CZZ A;  1GXP A;  1PYV A;  4L5J A;  3V7C A;  4G12 A;  3JR9 A;  3R0A A;  3I9V 2;  3DPU A;  2DYS H;  4RAY A;  5M5X J;  1VFC A;  1WWX A;  4EAT A;  1QRY A;  1Q1V A;  2F5V A;  3HOZ J;  1P7I A;  3B6C A;  3DKY A;  2OTL I;  4BBR J;  1H0M A;  2W00 A;  2MG4 A;  1TQP A;  3WTT C;  1JJ6 C;  4XNF A;  3T5X A;  3CUQ A;  4NB5 A;  4X6A J;  2HOT A;  2HPM A;  3C1D A;  4ZZD A;  1BR1 A;  3M1C A;  3WU2 C;  2CUJ A;  3BPX A;  4AYB N;  3TW7 A;  2F48 A;  3K2A A;  1O7F A;  2XRL A;  2BY0 A;  3F9K A;  1QVU A;  5IP6 A;  1W7P D;  1UEL B;  1W7P A;  4MFE A;  4J01 A;  3HHH A;  1I1G A;  3KPH A;  4I6Z A;  5C4J J;  1RRJ A;  1S9H A;  3P5J A;  4O6J A;  5FKK A;  5TGT A;  1WCM J;  2NVT J;  2CQ7 A;  3U1D A;  3QPL A;  1XMA A;  3K10 A;  4Y3O A;  3SFI A;  2KJB A;  4O5V A;  1GT0 C;  2VXZ A;  1MZB A;  3F8M A;  4DNC A;  2ACJ A;  4ZDP A;  1EV7 A;  5GAH J;  4C3I J;  5EGO B;  3RI4 A;  5E1X A;  2W82 A;  3BZC A;  4B44 A;  1BI0 A;  1N75 A;  3OYL A;  2XAF A;  3WG9 A;  3O8G A;  2ZJQ F;  3BY6 A;  4FAS D;  3CDH A;  3CDI A;  3I59 A;  2P6S A;  3Q9S A;  4JQF A;  3RSN A;  2LNB A;  3RYP A;  3OYE A;  1BA5 A;  1IRX A;  1MMN A;  5DDG A;  1T56 A;  2DK8 A;  3PUF A;  1G2H A;  1JKP C;  1EA3 A;  5B1A H;  2CW7 A;  4Y7N J;  2DA5 A;  3ZN1 A;  1WJD A;  5KAF C;  4P9U A;  1WI9 A;  1KQ0 A;  2JVH A;  2IGO A;  5JI6 A;  5L3D A;  3OL4 A;  2PMZ A;  2GA1 A;  3BR6 A;  3ZP5 A;  2H1L A;  1HF0 A;  3OYD A;  3JRE A;  2OU2 A;  2H8R A;  2HS5 A;  3H0D A;  3VWB A;  3I58 A;  2M45 A;  2XRN A;  2K86 A;  2R7F A;  3PSF A;  4KIS A;  5IT9 K;  4A3C J;  3EYY A;  1BL0 A;  1N78 A;  5BOX A;  4U87 A;  4ABZ A;  4LLG F;  2Z33 A;  3FMS A;  3S15 J;  2D1V A;  3ZQC A;  2HWV A;  2VLA A;  5FKM A;  3LA7 A;  1TW2 A;  1EH6 A;  3EYI A;  3LSJ A;  2AO9 A;  2VI6 A;  3JSP A;  2OUM A;  1ZRE A;  4WWC A;  3AKZ A;  3SZG A;  3RQ4 A;  3TQN A;  2VON A;  2CQN A;  3N4M A;  3DKW A;  2ETH A;  4NQW B;  4EEF G;  4YFK F;  1TZL A;  4P5O A;  4Z2Y A;  4G7O F;  3KLO A;  1BBY A;  2DYR H;  2E34 A;  3L2C A;  5JVT A;  2VJ4 A;  4EJU A;  2UV1 A;  5EGO A;  3CME I;  1V3F A;  2VN2 A;  3E6B A;  3OS1 A;  4KDP A;  5J1U A;  4JX4 A;  3BP8 A;  1E17 A;  2NNY A;  4XKC A;  3S3M A;  3P9K A;  4LG3 A;  2IVM A;  3W6J B;  4OOI A;  4CZC A;  2OQR A;  4MTD A;  1SMY F;  3ZN0 A;  1OPC A;  1I3A A;  1IN8 A;  2PBI A;  4GDF A;  5ICG A;  2QEX I;  4XMY A;  2EZK A;  1OR7 C;  1FMV A;  4I99 C;  2H94 A;  2HYJ A;  3TMO A;  2R4G A;  3BJ6 A;  2XGX A;  3H5A A;  4ESF A;  1GXQ A;  3FHZ A;  1KU7 A;  4HOB A;  4CGZ A;  2Y48 A;  4E7L A;  1REP C;  3RZD J;  4B09 A;  1FNN A;  4C30 A;  1MDM A;  4KIC A;  1NK2 P;  5D5X B;  2DT7 B;  4LK1 F;  2M4K A;  4IQ4 A;  4IKF A;  5FLM J;  4AID A;  2K9M A;  3LL7 A;  1T0F A;  3GLX A;  1T95 A;  3HOX J;  5FB2 A;  2QM3 A;  2ZNZ A;  2A6E F;  4FT8 A;  5DUK A;  3ROU A;  5HOD A;  3F6V A;  3H5N A;  4XLP F;  3RKX A;  2IPQ X;  2L7M P; 
#chains in the Genus database with same CATH homology
 1AA7 A;  4ZTJ A;  2M4G A;  3N05 A;  2NOJ B;  1DGW Y;  3OYH A;  3RPU D;  4XN3 A;  2L5Q A;  3HKZ A;  1NG7 A;  2L7K A;  2KPM A;  1T0F C;  1TT0 A;  2LRD A;  1YX5 A;  3SEZ A;  4BDY A;  2LC2 A;  4BE2 A;  3K4J A;  4Y4R A;  3DKX A;  4E7J A;  1QU3 A;  4ITV A;  4BU2 A;  4N4N B;  2CW8 A;  3CF2 A;  4NUB A;  4BE1 A;  2FUG 2;  3S3O A;  2R7R A;  3SDB A;  2Z2S B;  2R7U A;  2W4S A;  1SAU A;  4RM3 A;  4N4O B;  3KEY A;  2A6T A;  2Q1Z B;  4HG2 A;  1D1A A;  1X4P A;  2L9N A;  1YX3 A;  4PJN A;  1LDK B;  2M7B A;  1E0E A;  4XOR A;  1Y56 A;  2M7A A;  3IAS 2;  3OWT A;  4Y33 A;  2XDV A;  2ELJ A;  2IS1 A;  2VXD A;  4RMN A;  1SFK A;  2VAS A;  3FKJ A;  1BR2 A;  2BOL A;  3AFH A;  1WFX A;  3HPH A;  3OY9 A;  2JUG A;  4BJ5 C;  3G2B A;  2LYC A;  1GLN A;  3C2G A;  3W2V A;  3OYI A;  3PJR A;  2HDW A;  2Q2E B;  4ZC3 A;  3MKW B;  3V42 A;  3K6G A;  2CV2 A;  4B43 A;  4CSW A;  3EUH C;  3OYN A;  2LH9 A;  2BW3 A;  4NC7 A;  3L2U A;  4IX7 A;  3K70 C;  5FRN A;  3BG6 A;  4HNU A;  4E7S A;  2VQH A;  2HU9 A;  4LIT A;  1MMG A;  2CUZ A;  4XM3 A;  2L9S A;  5HOO A;  1V5G A;  5CQE A;  2X6Y A;  2IXS A;  3DU5 A;  3S8P A;  3I3L A;  3PUB A;  4GRI A;  3A2K A;  2AQF A;  3W3C A;  3QOE A;  4B3X A;  2LY1 A;  2F6C A;  2L2O A;  1R6R A;  4XKW A;  3DU6 A;  3A1Y A;  3PSI A;  4E7H A;  2E1M B;  3DTI A;  2W1O A;  3D5L A;  3A4C A;  4LIV A;  2DCE A;  3EUK L;  1DGR M;  2A5W A;  2X1C A;  2KDO A;  4BS9 A;  4E7K A;  2R7Q A;  3ZRG A;  2VQC A;  3LSG A;  4BQN A;  3ZGK A;  4CA0 A;  2IS2 A;  3VYS B;  4BQQ A;  4HNT A;  1BOB A;  4CCJ A;  3OYA A;  3PFY A;  3OOU A;  3K4N A;  4KIT B;  2VKD A;  4XOP A;  3MD2 A;  4KJZ A;  4PSW A;  3D5S C;  3NWS A;  2PJR B;  3VYU B;  3OYM A;  4NC8 A;  2ZFU A;  4BE0 A;  4PUS A;  1D0Z A;  2XF5 A;  2CMP A;  3OMY A;  3LSM A;  3OR1 C;  5JHF A;  2VJI A;  3OL3 A;  3HG9 A;  4HSR A;  3BCB A;  4PJM A;  3DPL C;  4YEL A;  4C9Y A;  2HPI A;  2V26 A;  4PJJ A;  2WAF A;  2WA0 A;  3HC7 A;  3RTR A;  2BW3 B;  1W36 D;  1V5F A;  3E1S A;  2XC7 A;  4CH7 A;  2M3A A;  4PK4 A;  3OIP A;  2HVQ A;  4HRI A;  4MLO A;  2MFZ A;  4XLE A;  3H35 A;  4XR6 A;  3TL4 X;  1YE9 A;  2LRE A;  3HPG A;  1MNE A;  2VKH A;  4QPQ A;  1JI8 A;  2E5Z A;  4P1W A;  1WJ5 A;  1BR4 A;  1X1B A;  1MND A;  2LBF B;  4F3Q A;  3W2W A;  2VJJ A;  4II2 A;  3HOT A;  2R7X A;  2ZXI A;  4XKB A;  4PFP A;  4BXF A;  4DBR A;  3MKY B;  4BGD A;  5LFA A;  1G8X A;  2GOX B;  2X51 A;  2WB1 A;  3FDY A;  3UR3 C;  3ZQQ A;  1MMA A;  4AYB A;  2MC4 A;  3K4L A;  4DBQ A;  3CP8 A;  4OWR B;  3FBI B;  4LIU A;  4QPO A;  4D9J A;  4F55 A;  2WAD A;  2LOO A;  4OAY A;  4HPQ A;  1ZEL A;  4RLQ A;  1Z7L A;  2E1M C;  1LKX A;  3DTE A;  3D5R C;  3RCO A;  2RRE A;  2KRC A;  2ZSH B;  4BJ6 C;  4E7Z A;  3OYJ A;  2CV0 A;  2PJR A;  5CKT A;  4X0G A;  4RM2 A;  1WJC A;  2QKM B;  2WAE A;  4ZYA A;  2LG4 A;  3LMM A;  4XON A;  3OYC A;  3MKZ A;  2BVM A;  1NG6 A;  2UUZ A;  4ZDO A;  5CPR B;  2HVR A;  4CCM A;  2V6E A;  3L2R A;  3VSL A;  3TBI A;  5CQG A;  2I8D A;  3J7A Y;  1MW7 A;  5HVQ C;  2KMU A;  2KZV A;  2X85 A;  3HUG B;  2UWM A;  3CP2 A;  3PNY A;  3OYF A;  2O5R A;  4ANJ A;  2M0M A;  3GBG A;  4AU7 A;  2XSJ C;  3W2A A;  3CES A;  1Z3X A;  2Z1D A;  3OS2 A;  1D1C A;  3EPZ A;  4XQF A;  1HA8 A;  5HNF A;  3VYT B;  3EUA A;  2CH0 A;  2LY2 A;  2LBF A;  1UAA A;  1K6Y A;  2V9K A;  3K4M A;  1PJR A;  3CJQ B;  3BC8 A;  3IP4 B;  4HEA 2;  2CS3 A;  3H5R A;  2RNG A;  2VJ5 A;  3HL2 A;  1V5E A;  4IQJ A;  4F91 B;  4CCL A;  5FRO A;  4BDZ A;  4DIQ A;  3H9Q A;  5KCM A;  4AVZ A;  5LD2 C;  5KHD A;  1OLT A;  1D1B A;  4XKV A;  4DJA A;  2IGM A;  3QYB A;  1WJE A;  2JA2 A;  3ZR8 X;  2GOM A;  1PYV A;  4YRV A;  4H4K C;  3VSK A;  3KX2 A;  2K5C A;  3HOS A;  4FET A;  2R7W A;  3L2W A;  4E7I A;  3BG7 A;  4HST A;  2QKL B;  3I9V 2;  3DPU A;  3K4C A;  2KRH A;  2ZSI B;  3L2V A;  2E5N A;  4XOT A;  4F52 A;  4EAT A;  1P9Q C;  2F5V A;  4F93 B;  2KHM A;  3DKY A;  1FMW A;  2W00 A;  3LSK A;  3VDX A;  3QYE A;  3AL0 C;  2V7F A;  2DJI A;  4BEH B;  4BUP A;  1X4O A;  4XNF A;  2RQQ A;  2XAU A;  2X6W A;  3DQV C;  3ONQ A;  4CCN A;  2HPM A;  1D0Y A;  1BR1 A;  3M1C A;  3BLY A;  2OC6 A;  2X6X A;  2OV7 A;  2KQR A;  2CUJ A;  3FBN B;  2R7V A;  4KT6 A;  3OYK A;  1Y6I A;  4C2T A;  1ERD A;  2IGK A;  4XLC A;  2CV1 A;  2IS4 A;  2VQG A;  4D1Q A;  3F9K A;  2HZD A;  1UG0 A;  3LSI A;  3OR2 C;  1UEL B;  2VL8 A;  4F92 B;  4J01 A;  3S3N A;  3ZXS A;  1U0J A;  1W36 C;  2DOA A;  1S9H A;  5HNH A;  1DP3 A;  4B47 A;  2WY7 Q;  2DXI A;  2KLO A;  5TGT A;  1KON A;  4Y3O A;  3DPT A;  3K10 A;  3S32 A;  4IZZ A;  1QHH D;  2VXZ A;  3CJR B;  4BL0 B;  3PNT A;  2VPL A;  3IAM 2;  3QOD A;  2VIX A;  4ZDP A;  1Z21 A;  2W82 A;  4XLF A;  2V4J C;  2WBM A;  4B44 A;  1N75 A;  3OYL A;  1X1D A;  2VB6 A;  3PNV A;  2XF6 A;  3L2Q A;  3AL0 B;  4XN0 A;  3BCA A;  5FRM A;  2X1D A;  4FAS D;  2JVG A;  4C2U A;  3OYB A;  4JQF A;  3RSN A;  2X1E A;  4YEJ A;  3HXL A;  2MYS A;  3OYE A;  1N77 A;  1IRX A;  1WJB A;  1MMN A;  1WJF A;  1EA3 A;  2CW7 A;  4XL9 A;  1WJD A;  3MMY B;  2JVH A;  2IGO A;  2R7O A;  2ZXH A;  3OL4 A;  4XLH A;  2PMZ A;  3PL8 A;  3VYR B;  2Z16 A;  3C2H A;  4BEH A;  3DWL E;  3K70 D;  2VQL A;  2IGN A;  3IUO A;  3OYD A;  3QYF A;  3H0D A;  3K4B A;  3VWB A;  4PFO A;  3PSF A;  3K4K A;  3LSH A;  4KIS A;  2WAQ A;  4J00 A;  2WY8 Q;  1N78 A;  4U87 A;  1WJA A;  2CFO A;  2F4I A;  2K9L A;  4BJT A;  2VLA A;  2IS6 A;  2MAB A;  4R79 A;  2MD0 A;  3LFU A;  3OYG A;  2OUM A;  3AKZ A;  1VZ0 A;  3UNG C;  3OS0 A;  3SZG A;  4DGW B;  2DT6 A;  1J09 A;  3RQ4 A;  4OAZ A;  4ZTF A;  4NQW B;  4RLF A;  2P0W A;  2AQE A;  1TZL A;  3FHN A;  3SYT A;  4P5O A;  4CUG A;  2V1N A;  3DLA A;  1D0X A;  1X1A A;  2Y0S A;  4CCO A;  2VJ4 A;  4G6T B;  2UV1 A;  3DTK A;  4XLA A;  3CZ6 A;  3OS1 A;  3S3M A;  4XKC A;  4PJL A;  3U21 A;  3ZCO A;  4NNJ A;  4LG3 A;  3H9J A;  1X1C A;  4CZC A;  3H9G A;  3E0J B;  2W7N A;  3M8J A;  2R7T A;  2KP6 A;  4XMY A;  1Z3Y A;  1OR7 C;  1X19 A;  1FMV A;  3OIQ A;  4BAC A;  3TMO A;  2R4G A;  2KL4 A;  3KYL A;  2HVS A;  3H5A A;  1DQU A;  1LFP A;  2R7S A;  2K3P A;  4ZDL A;  4E7L A;  2JSP A;  5HLT A;  4B48 A;  3CMM A;  3S93 A;  4CCK A;  1LVK A;  4U7B A;  4C30 A;  2E60 A;  2HQA A;  4E4H A;  3SEQ A;  4E6K G;  2DT7 B;  3NWT A;  4BQO A;  4JOM A;  2M4K A;  3DEE A;  4IQ4 A;  4IKF A;  2XF7 A;  5KNL A;  2K9M A;  3LL7 A;  1G59 A;  1T95 A;  4II3 A;  4ZJZ A;  3H5N A;  1QHG A;  2HNH A;  4DOZ A;  4PSX A;  1MMD A;  2BVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...