2KRHA

Structure of the c-terminal actin binding domain of abra
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
85
structure length
85
Chain Sequence
GAMARAEEHIYREIMELCFVIRTMARHRRDGKIQVTFGELFDRYVRISDKVVGILMRARKHGLVHFEGEMLWQGKDDHVVITLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-binding Rho-activating protein
publication title Structure of the C-terminal actin binding domain of ABRA
rcsb
source organism Rattus norvegicus
molecule tags Actin-binding protein
total genus 15
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2009-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14705 Costars Costars
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2krhA00
2L2OA 2KRHA
chains in the Genus database with same CATH superfamily
1IXSB 3W6KB 4PDKA 5LGTA 1NTCA 3RZDJ 3T1BA 2FOKA 3BCBA 5K1YA 1NK2P 4D7MA 3ROUA 2O7OA 1AA7A 3HTSB 5DYMA 1ZH5A 2ISYA 2D1VA 1KYWA 2B7EA 3FXRA 4KIGA 4L5EA 5TGTA 5LLQA 2OF7A 4EEFG 3PFIA 3KP5A 4HNUA 3J80Z 1BOBA 2HU9A 5GAHJ 3AG2H 3HIFA 2BHYA 3CO6C 4IO9F 5FKKA 1XN7A 3ZQ7A 2W57A 4KNYA 4D5CA 2Z16A 4XKBA 1TNTA 2FD5A 1FNNA 2LBFA 1F36A 1G4DA 3FX3A 2NNNA 1ZELA 1KZHA 4KMUX 1STZA 3EYYA 3S3OA 4L18B 2AXTC 5BPDA 3U21A 2CV0A 4WWCA 4MTDA 3H9QA 2UXNA 2XAGA 1X4PA 4OAZA 1Z9CA 2DOAA 4MEXF 2VE9A 3J80K 1RRJA 2P6SA 3FKIJ 3TW6A 5E3NA 4XK4A 3UR3C 2ELJA 3W6JB 4ZYEA 2P4WA 3OOUA 2HQ5A 4DZPA 4E7KA 2WBMA 3WTTC 3WU0A 1YFHA 4BHBA 1YS6A 4LIUA 3BJAA 3HSRA 3OL3A 2JK3A 4OOIA 3DU6A 1ZG3A 3U1KA 3DKYA 4A3JJ 1IXCA 3OSFA 4Z2YA 5EG0A 2XUBA 2VPLA 1IGNA 4DZJA 1ENHA 1MIJA 2WV1A 2V79A 5FD5A 5KAIC 3VSLA 3HOWJ 5LFAA 4AU7A 1RR8C 2W25A 3LL7A 1BR1A 1VQNI 3WHCA 2JA6J 4XRMA 2CH0A 2CW8A 3HXLA 3O8HA 3IH4A 5JHUA 4DJAA 3FXKA 5JVGF 2FE3A 2QLZA 3EUAA 5K5QA 3TMOA 2XAQA 3SYTA 3AKZA 3KYLA 1S7AA 3LSTA 4XLNF 2I10A 4C2TA 3K69A 3RKWA 2V1NA 1U9NA 2IBDA 3HSEA 1VNDA 3HRSA 2PFBA 1W5SA 4OIRF 4HF0A 4ITVA 3QU6A 5BQTA 1W7PA 2P5KA 1VQ6I 3Q3SA 3L1PA 3HOTA 2EBIA 3FBNB 3H3UA 1FSHA 4LG3A 4DYCA 1IRXA 4LFUA 2XB0X 4A0ZA 3EDPA 3OYBA 3ASNH 4UVBA 3CCRI 2HDWA 2AXLA 3ABTA 3TQNA 2MD0A 1H89C 3M3YJ 3ZCOA 3FXMA 2M7AA 2VJIA 5J47A 4IQ4A 6PAXA 1UFMA 4XQFA 2M34A 3SFIA 4XONA 2GXGA 4E7LA 2AHQA 1D0XA 2JPCA 3P5JA 3WTSC 1OCPA 4UVAA 2MD5A 2PG4A 4L5JA 3PM1A 2PJRA 1R7JA 3CCSI 2HVRA 1X3WB 3WE2A 2XDVA 2K86A 1RPWA 4M73A 4YG2F 2UXXA 3R0JA 1WJBA 4M3EA 3CC7I 1SD6A 2HYJA 3D1NI 3CUQB 5ICEA 4HV5A 1HKSA 1YX3A 5GPAA 4RBOA 2EFWA 1MMAA 4A3GJ 2YX7A 5AIQA 2RAEA 1L3LA 1LEBA 3CJRB 2KL4A 1WZ2A 4A3LJ 1QVUA 3RYRA 5HVQC 2QA4I 4EJVA 3A0HC 1MNEA 5HS7A 5L3BA 1SAUA 2P5VA 2XF6A 3PSFA 2BVLA 2ZB9A 4YIRX 2X9DA 3OOPA 2IJLA 2QQ9A 3I0TA 2LVSA 2MYSA 2VOPA 1XTAA 2A3SA 2EA4A 4EJUA 1RKWA 2YX4A 1BC8C 4U0WA 3BQZA 1JTXA 2IEKA 4CCOA 1Z7LA 2DA2A 2K3FA 2ICWG 3OL4A 2ZKZA 1HA8A 3HZJA 2LF7A 2M30A 4AVPA 1K78B 3K6GA 3SQNA 1H9GA 1W5CC 1CF7A 4BNCA 3LAJA 1ETKA 2NVUB 3JRHA 1EJ9A 3KP6A 1IUYA 3IWZA 2FU4A 4M6VA 1IXRC 1R71A 3GTKJ 3I64A 1ZR4A 4HF1A 1TWGJ 2FX0A 3SHFA 2HNHA 4V2FA 1NG6A 1ORKA 2L0KA 1OJLA 3FK7A 3HEFA 3LQRA 2CQQA 4UHTA 5HLHA 5EEAA 1ETYA 2ZJRF 4KIBA 5ICCA 1SVOA 3HHGA 2ZXJA 2G9WA 1U78A 2GIVA 4G8XA 4DYQA 1R4MB 1PP8F 1Y8QB 4CCLA 1TBXA 4BHPA 1D8JA 2O0YA 1SD7A 3W2VA 4J01A 1N77A 1IUFA 5EZGA 2PBIA 4U87A 2RC4A 4HDUA 4AIDA 2KDOA 1K6YA 4BDZA 4HV6A 5DTDA 1S7EA 1PUFB 2BXYA 4LG0A 3FMSA 1HXDA 4M6YA 1G3TA 3DLAA 1MSFC 2CUFA 1J2XA 5JLWA 2GWRA 2K9QA 4E7SA 4Q4ZF 3JRIA 3BJOA 3DPLC 3GX4X 2DT7B 3S1MJ 3DKWA 2GOMA 1MZBA 4JQFA 3M07A 2VBXA 3ZQHA 1JUPA 4I01A 2LKSA 4FQGA 4RM2A 4XKCA 3ZMUA 1XPXA 4ESBA 4E7ZA 3T0YA 3C2GA 4LIVA 5EEGA 4DOZA 3B73A 3ZRGA 2MABA 1O3QA 1LE8B 4Y15A 2OV7A 1KU2A 1Q1HA 4BJ5C 1X19A 3MEXA 1ZQ3P 3GYHX 5LRSA 1TQMA 3W3CA 4D5FA 4HLXA 3VPRA 2KJBA 1MBJA 3HOVJ 1X1CA 5LEJA 4B3XA 2FQ4A 1BBYA 3A01B 2KDZA 2R7RA 3BDDA 3ZOBA 2R7VA 4ZTFA 2ZMEC 3P7NA 1HLVA 2X51A 2NYXA 5E8GA 4FT8A 4GCVA 3BG7A 1YG2A 3KP7A 2N8GA 3IUOA 2ISZA 2R4GA 3REOA 2EV0A 4BAYA 2HKXA 2HDCA 3T5XA 2EINH 4A3FJ 1YIOA 2XV4S 2F2EA 5DCMB 4BUPA 3GZ5A 4HDVA 4G6DA 4G6QA 1MGTA 3L2VA 1U8RA 1H0MA 4HQEA 2W48A 3WTXC 3CMAI 3DEEA 1TWHJ 3GF2A 5B66C 3NWTA 3HUGA 5LHIA 3FWEA 3F22A 2DMQA 4L5IA 3BTJA 4ETSA 1E2XA 2LREA 4A2UA 2VASA 3CQZJ 3HOXJ 2QSFX 3CF2A 2WAEA 1YLFA 2JUGA 3EYIA 3KZIC 2M4GA 3P9CA 4WXDA 1FOXA 2OJED 3WE3A 1KA8A 1A6IA 2WY7Q 4A93J 2KIMA 4XKVA 3DTIA 4IXAA 1TQPA 4ENJA 3HC7A 3J7AO 1IN8A 2HI3A 1YE9A 2RVCA 3Q9SA 3S17J 4A69C 3MD2A 4A6DA 3CD6I 1K7AA 2LMDA 2LBFB 5KCMA 5FROA 5LBQA 2X1EA 4S04A 2RNGA 3C3WA 3VODA 4BYYA 4I76A 4YIIA 1G2HA 1WHUA 3GUDA 1XSXA 3RKXA 5IP7J 3RQIA 1I1SA 3H5AA 4EJTA 4I0AA 5H6RA 3K4BA 3PUFA 4X0GA 2JRMA 3I9V2 1IDYA 5ILUA 3OYEA 4LJZF 3FK6A 1HKQA 3BJ6A 1HCRA 2VKHA 4WXHA 3CCUI 4HYEA 4CGZA 3OY9A 3ZMZA 4AWXB 4IZZA 3OIQA 2JVGA 3HJEA 2DLLA 4F52A 2ME0A 2X6WA 2P7VB 3H3ZA 1LDKB 1OCCH 3BQYA 2VQLA 4XOPA 4RB1A 1UHMA 3RJPA 4BXFA 4IRGA 3BPXA 5IYBJ 1GV2A 2EV6A 3AFHA 1LDDA 2A6EF 2MFZA 3OS2A 2R7TA 3HYIA 1YRNA 1P4XA 5EG0B 1G8XA 1RUOA 3V4GA 2HEOA 1FY7A 1Z21A 1ETQA 5GAEJ 3CDIA 5HS9A 1V3FA 4A5MA 1YYVA 2AS5F 1HBXG 2NS7A 3EPZA 1AWCA 1X1AA 4BH9A 4M9ZA 2JA5J 2K40A 2TDXA 2E5ZA 5HDKA 2Y9YA 3GTQJ 1U6GA 2FA5A 3S14J 4Y4RA 4ESFA 4BHCA 1OYIA 1K6OA 2DA5A 1SFXA 4M6XA 1FOKA 3IL2A 3UKGA 1T0FC 2XGDA 3PNVA 3SEZA 2V4JC 2DW4A 1Q1VA 2XGEA 2HS5A 3WGHA 2F5EA 1JUMA 3GLLA 2DBBA 3HM5A 2DQRA 1EH8A 3BLYA 4BDYA 2JQ7A 3S1RJ 4C2MJ 2QQAA 1JE8A 2CYYA 3GTMJ 1W7PB 3IP4B 4AYBA 5LEKA 1TC3C 3HTUA 4KUMA 4GO1A 4CZCA 1U3EM 1K83J 2FBIA 1U2WA 2AQEA 5FKLA 3BT9A 5ICFA 2VL8A 3BTLA 1YITI 4HG2A 3ZP5A 1Z77A 2VKDA 1Y6IA 4RAYA 5FKNA 1GUUA 1W0TA 2RKHA 5ED4A 4LLNA 3H1CA 1Y39A 2D45A 2R92J 3A1YA 2VBYA 1XDUA 2CUZA 2ZXWH 4WF2A 3I4PA 1QO0D 2L02A 4JP0A 1XGOA 5C4XJ 3G1LA 2PJRB 3FM5A 1TZLA 3QYEA 2R7WA 1N75A 4I6ZA 2D1HA 3C1DA 3WTVC 1BOAA 2K3PA 2O61A 2IGOA 5FRNA 3S93A 1ZHFA 1ETOA 4M72A 4AUXA 4EM0B 2ECCA 3K2ZA 4K2EA 1E3OC 1P2FA 2F48A 4PSXA 4EJOA 4KN7X 4IRIA 3ABLH 4BXUA 4PJ0C 2Y30A 2LSOA 2OD5A 2ID6A 1R23A 2XASA 3PFYA 3WGGA 1D0ZA 1U8BA 1Z0XA 5DM7F 4CICA 2LRDA 4FX0A 3DKXA 2ZJ2A 2JSPA 4W97A 2K4BA 2COMA 2DK5A 4KISA 1MNDA 3FXOA 5EDNA 1G3SA 2KPMA 4KITB 1KGSA 1VZ0A 1D3YA 2DMPA 2IT0A 4QWQA 1QZZA 1TNSA 1UHWA 5FLXZ 1P7IA 5GTHC 2KRFA 4EJWA 3I55I 2IGMA 2Y31A 2Y0SN 4BJTA 2JA8J 2CW7A 1PDNC 2IA1A 2K7LA 1FBSA 5D5XB 3GTOJ 3JCUC 3BZKA 4KFCA 1ZK8A 2A6HF 4A5NA 5B1BH 1N78A 1B4AA 4JX6A 2RDPA 1YW8A 3GZNB 4PGGA 2XHKA 1SAXA 2BHZA 5IPAA 4KA4A 3PNYA 3RPUA 1CF7B 2XGCA 1Y0NA 4ZDLA 2OA4A 2LKPA 2HZTA 2CGPA 4ZYGA 4UVCA 3JTGA 2VBZA 3K4MA 4HW0A 3S16J 1IN6A 4PJLA 4NDLA 5F04A 3IAM2 2WY8Q 2OU2A 3EUHC 4PFOA 3DEWA 1X1BA 3V42A 1LE8A 2EILH 2BW3A 2CQKA 2Y69H 1I1GA 2M0CA 4CCMA 5EF6A 3AG4H 1OCRH 1TWFJ 1DDNA 2PLYA 1OFCX 3QOEA 3COAC 2XGXA 4F55A 5J1RA 5K5RA 2ESNA 1IRFA 1Z3XA 1QZYA 4KYWA 1T39A 1XX5A 3KX2A 1HKTA 2F5FA 1OYYA 3OYLA 1WJEA 3JR9A 1P7JA 2MLKA 3DCFA 3DQVC 4LG0B 5L3GA 5ERIA 3TOBA 1X58A 2K9LA 5CQEA 5FLVA 3C2HA 1YW9A 3M1EA 4RGSA 5ILSA 3E6MA 3QPTA 1J7KA 4XIDA 2F4MB 1V54H 1ERDA 2V6CA 1QPMA 5FO5A 2L9RA 2GIZA 3UNGC 4FASD 1X2MA 2R93J 2QM3A 3E3VA 4I0BA 4CSWA 2YPRA 3TBIA 3VFZA 4B1RA 2DA1A 2QYOA 5F0CA 3KP2A 3E1SA 2CFOA 2L4AA 4G7ZF 4MNUA 1FIPA 1MBFA 4ZZDA 1R9TJ 3JW4A 3S1NJ 3FMQA 1V55H 2FXAA 1J75A 2VJ5A 5GP9A 2CUJA 1IV6A 1D5VA 4CUGA 4R8HA 2DN0A 2E1MC 3PO2J 4P9UA 1FLIA 1G3WA 2DA4A 4IOCF 1J9IA 4OINF 2HKOA 2ZSIB 5IYCJ 4XRSA 5HOOA 2YU9J 1O3RA 5E20A 4LLLA 4HSRA 3HKZN 4S05A 1SVLA 4NB5A 3T8RA 2JTVA 3L7WA 5CVUA 4ZTJA 2R5ZA 3LSMA 3H0DA 1W36D 2W00A 3OYCA 1EH6A 5BMZA 2FBHA 1VQ9I 1WJDA 4IQJA 4XRFA 1I3QJ 3IWFA 4RAZA 2CW0F 1RZ4A 2L9NA 3QYBA 2DODA 2MBFA 3I53A 1B8IA 3PUBA 2EA2A 3OYIA 3HUGB 3GEZA 3G71I 2IS6A 1ETXA 1Y1WJ 3CC2I 1S9HA 2PN6A 1MMDA 2DFIA 2KZGA 2VXZA 4G7HF 2KHMA 2JT1A 4DQ2A 3D0SA 4CH7A 1FOWA 3WG7H 5J1YA 4A0XA 1O3SA 2M7BA 2XPWA 1USTA 4BKXA 2HOEA 4CCNA 2VONA 1GXQA 1BIAA 4Y3OA 1R58A 1BIBA 4U0VA 3FBIB 5EGOA 3KYDB 1CQTA 4UXNA 1J5YA 2QF7A 5M5WJ 2OZUA 3DTEA 2R5YA 3BR5A 3F23A 1RR7A 2DAOA 4A3EJ 1YOVB 2MLGA 3BR0A 2K85A 2E1NA 3VYTB 4Y52J 4Q48A 4MQVA 2IVMA 2FOWA 4IHSA 1D8KA 4BJ6C 5E3LA 3CCYA 4MLOA 2XPVA 3SZGA 1WRJA 2L7FP 2YR2A 3SDBA 1R36A 1Y1VJ 2DYSH 2O8KA 5IOZA 4KN4X 3ECOA 3OYKA 1U5TA 2IA0A 2O5RA 2KT0A 3QRFF 2VI6A 3GZ6A 3I5UA 2R7ZJ 3S2HJ 1KU9A 1QHGA 2FBKA 1DUXC 4ENMA 2WB1A 1YQAA 4MFDA 2NRAC 1MMGA 1GVJA 2BY0A 4G94A 2EFQA 2K27A 3CLQA 2F5DA 4HBLA 3V7CA 3HRTA 5DDGA 5M3MJ 2K02A 2J5OA 1EF4A 4B8XA 1ZGJA 1BI3A 2KIFA 3O6BB 2LP0A 1QGPA 1UAAA 1FOYA 2PI0A 2KRHA 1VQOI 1QQIA 2NS8A 3LSJA 1KQ0A 2EPFA 4LOCA 4XKWA 1OR7A 3CCEI 1W7PD 3A03A 1YRNB 5D4SA 1P4WA 2VC0A 1U9OA 2G7UA 5J40A 5K7HA 2Y2ZA 1JXSA 1ON2A 2E7XA 3JRAA 1Z1DA 3RIRA 3SXYA 4E4HA 1BJZA 2K9NA 5E79C 1D1CA 4E70A 2M9HA 1ON1A 4YFKF 2V1XA 4RB2C 3K1PA 4HNTA 1RC9A 4HEA2 1RESA 2HYGD 2CV2A 4BQNA 2DFEA 2PEXA 5H2FC 2NS0A 2BXZA 4CXFA 3CP8A 2EWNA 3L2CA 1FMWA 3CZ6A 4EQQA 1QPIA 2ID3A 2NVYJ 3ZQCA 1B6AA 4H0EA 3OWTA 3VSKA 3DU5A 3L09A 1KQ8A 4L9TA 2XROA 2Z99A 1UG2A 4Q47A 1WKMA 3TL4X 4EATA 3CCJI 5D8LB 3KLNA 1VQLI 2DJNA 3KFWX 3ERED 3DBLB 2L54A 1J59A 4I09A 2KIQA 3GLXA 3DBRB 5HDNA 4RLQA 2W7NA 3WHBA 3CUQC 4JYKA 2BV6A 2QGUA 3DF8A 3PIPF 2W84A 1XSVA 1ONVA 1ZARA 5F27A 3OYAA 4MQ9F 1B9NA 2H8RA 5KAFC 3BR3A 2J5PA 2EFNA 4TV7A 4MEYF 1BW5A 4C9YA 1XC5A 5J1UA 1JT0A 1F5TA 2EJRA 3BC8A 3IKTA 2FUG2 5F1JA 3IRQA 1T8IA 3G2BA 4UNOA 3RQ4A 1Y0UA 2V7FA 4M9SA 5LRRA 1PUEE 1I39A 3PNTA 4I2OA 1AOYA 1HOMA 3QYFA 3PSIA 3IH2A 1R6RA 1A6QA 5M5YJ 2XC7A 4NUBA 1FSEA 3X2QH 3S8PA 4R79A 1HW2A 1JHFA 1W5TA 4N9HA 1V5FA 1D1BA 4P55A 3OYGA 2MH9A 3O2PE 5J6XA 1MBEA 2HQAA 5J4VA 1UMQA 4J19A 5DS9A 4M3DA 2VT3A 2QENA 3BR2A 2GXAA 2R7FA 4HLYA 2DTRA 2IAIA 4OIQF 5CPRB 4D9JA 1OKRA 1OYWA 3ZQFA 3CCMI 3G3ZA 1O7LA 2LFBA 3ZPLA 2OPTA 4C3IJ 3F8MA 2W4SA 2Y9ZA 1D5YA 3RDIA 3BG6A 1B59A 2ZNZA 2HZDA 5M5XJ 2FSWA 4UV9A 1IRGA 1J0RA 1IAWA 1BR2A 2VPRA 2X6YA 3G6EI 3GCMA 4C3JJ 3CP2A 4RA2A 1Z91A 2Q0OA 1LVKA 3JRGA 3OS1A 1IN7A 3K0LA 5LHGA 2OTJI 2L3DA 4AIJA 2LC2A 2PMZA 3HL2A 1LVAA 2EFPA 4FE4A 1NH3A 3H5RA 1OMIA 2XB5A 2YUSA 5J3LA 2YS9A 2BW3B 2LK2A 2EQRA 4CCKA 1MDMA 4Y13A 1BI0A 1LQ1A 4F92B 2KJCA 3DPUA 1I27A 1BC7C 1ZRCA 3HPGA 1A36A 3GTLJ 5L3EA 2UWMA 5CVRA 3CJNA 1X1PA 2FRHA 3ML6A 1YJWI 1RUNA 3A2KA 2QZ8A 2UV1A 3OYFA 1QBJA 4JX4A 1KYZA 1H9TA 4BQQA 3LFUA 3MMYB 1EA3A 1D0YA 3I4MJ 3HHHA 1HDDC 4EV0A 2PMUA 3ZMSA 1FEXA 2R7UA 4V2GA 5F1RA 4XSZF 2RN7A 2VIXA 2HFHA 5E1WA 1MJBA 3V8JA 1BJAA 5JI6A 2LKXA 1UHSA 3O3KA 5HS8A 4V19K 4AM3A 4M74A 3E6DA 3PJRA 2QBYB 9ANTA 1V5EA 1UG0A 4B44A 1XS9A 3NAUA 2Q8KA 1MMNA 2H1LA 2CJJA 1VI0A 3QPLA 4F91B 3JREA 2DFFA 5B3SH 4EGZA 5KVRA 2LOOA 1Y8RB 4RMNA 2JZYA 4IOAF 2ELKA 2ETHA 3IC7A 1R4NB 3OYNA 3H35A 1QVTA 4XLAA 1K79A 3GTPJ 3WODF 4ZDPA 2BOLA 2M3AA 1I3AA 3BR1A 4P1WA 3WTUC 2ESHA 2JA2A 2K5CA 5C44J 2M2EA 5CVVA 1DGRM 2A05A 4O6JA 1SEUA 4A3DJ 2M8GX 5HODA 1BI2A 2FEZA 5CJ9A 3F21A 1JT6A 4RB0A 2R5ZB 2VN2A 1YTYA 2IW5A 2GA2A 1W36C 4OIPF 2KISA 2KFDA 3ZXSA 2CUEA 3LNQA 2R7XA 2HQRA 4XLHA 4XR6A 2X85A 2PQ8A 3CCLI 5CYVA 2VOOA 3L9FA 3JSPA 1B8IB 3FF5A 3OIOA 3TDZC 1FPQA 3KPHA 1WSUA 5BPIA 1PVEA 5GAGJ 3G73A 2LY9A 3RZOJ 2CFXA 3HOZJ 1MD0A 2I8DA 1IG7A 2V9KA 3PL8A 3GFLA 3RYPA 3JTHA 2E2IJ 4BXXJ 2R7SA 4HF2A 5C3EJ 3K4NA 2OQGA 1FP2A 4BE1A 1PYVA 2NNYA 4A3BJ 5K7ZA 4OAYA 1K61A 2VKEA 1BW6A 2CQXA 2D5VA 5EGOB 1NHAA 3I58A 3QOPA 2DT5A 2Z9OA 1JJ6C 3K70D 2R5YB 4I02A 3N05A 4BE2A 3H0GJ 2PJPA 3GVAA 2K4JA 1F4KA 1UZCA 2DT6A 1Y56A 3LAPA 3E0JB 2M45A 3CDLA 3LSKA 5JFRA 2GM4A 1V5GA 1TT0A 3F6OA 2GAUA 4HQMA 3F8CA 1JHHA 3BG3A 1LKXA 1WJAA 1W0UA 1YI2I 3I54A 4N4NB 5D6FA 3S3MA 2DA7A 3Q0VA 3FIWA 3QP6A 1U5TB 1B9MA 1YJ9I 2LR8A 4BE0A 4RDUA 2OUMA 1FZPB 1R1VA 2MC4A 3PO3J 3LA2A 1IZ1A 3BCAA 3KEYA 3Q9VA 3ZMDA 1GT0C 2R7QA 2GXBA 3L00A 3E97A 2E2JJ 3R4KA 1SFUA 1FBQA 4ENNA 3GTGJ 2BZTA 1O57A 1ZN2A 3HGGA 4XN0A 2M1BA 1H88C 1GLNA 4J00A 4I99C 2ME6A 4ABZA 1NK3P 3F8FA 2EZLA 2YU3A 2JPBA 3E5XA 1MH4A 3K2AA 4M3BA 5FJ8J 3S15J 4RLFA 2Q1ZB 3MKYB 3WG9A 4YELA 3MWMA 3CMMA 2R3SA 2W82A 5DUIA 2C6YA 4BL0B 2CV1A 3S2DJ 1T2KA 1HC8A 3FISA 1W4MA 1XMKA 3IHUA 3QQAA 4ZH4F 3FXQA 3OYJA 2XKOA 1LJ9A 3TP3A 1LFPA 1T56A 4W1UA 5D5UB 1JJ8C 3OR1C 3F0CA 3OYDA 1G59A 2W1OA 1VQ7I 5JHFA 1MBGA 1T6SA 2P0WA 1X2NA 1R5ID 4AIHA 2VQGA 3FZVA 4PZJA 1QZEA 3VOEA 1WJ5A 1S29A 3ABMH 3HOYJ 3DPTA 1DPRA 1BI1A 2K9SA 1TTYA 2DDAA 2Y48A 1G6NA 3LWFA 2X6XA 2GBYA 2PMHA 3M8EA 5B1AH 1FYMA 3Q5FA 2E60A 2E34A 1TWAJ 3NARA 2QKLB 3QP5A 3CDHA 4UUSB 3TOAA 1ZGAA 3FHZA 1Z67A 3Q0WA 3M1CA 4DIQA 4C30A 4OMYA 4LB6B 4O5VA 5EYRA 5DEQA 5IY5H 1C0WA 2QUFA 3BTCA 1IO2A 3GBGA 2TRTA 5TRDA 1MNMC 4G7OF 2NOJB 1JKPC 2XAUA 1DP7P 4XSXF 2OTLI 2VJJA 2LY1A 2A5WA 4CCJA 1UB9A 4ZZLA 3IAS2 2KKOA 4S0HB 4HNVA 2RQQA 3HDDA 3MKWB 3TKYA 3IKVA 1XCVA 1OCOH 5JLXA 3F9KA 4LB5A 2DA3A 1S3JA 2LDUA 3MN2A 1XSDA 3DXJF 1JKRC 4L9VA 3AL0B 4CA0A 2JRTA 4II3A 5CQGA 3HB9A 5F0HA 4WK8F 1SD5A 1FTZA 1IC8A 1E0EA 5CLSA 3RPUD 4HSTA 2XKPA 1KONA 2KQRA 3GMEA 5KHDA 2HR3A 2ZFUA 2VKVA 4XMYA 3WU1B 2GQQA 2JA7J 1MSEC 3NRVA 1TP4A 2Q2EA 4MO7A 4BEHA 2IXSA 3B02A 4D7NA 2VT2A 3CMYA 2BVMA 1LPQA 1WH5A 5E1ZB 1HQCA 3SZTA 3TO9A 1APLC 3I71A 3R60A 3LSPA 4C2UA 3KP4A 3I59A 4KDPA 3KCCA 2WA0A 1B72A 2EIMH 5J4YA 1IDZA 4GGGA 1X1DA 3HBLA 3OYMA 3J7ZI 2XAFA 1UCRA 2HGCA 3FDYA 5D4RA 4KJZA 2GA1A 4DNCA 2IGNA 5DCFA 4F3QA 2ZMEA 3VDXA 3ZQQA 1SFEA 3TW7A 4B43A 3PQKA 4IHXA 1BA5A 3MQ0A 2QQ8A 4JK1X 5LGNA 2JSCA 2QBYA 4X6AJ 1U0JA 3E6CC 2ZXIA 1MDMB 4NQWA 1ZG1A 1Z6RA 3IV5A 4AC0A 2L7ZA 3MCZA 2EK5A 3CTAA 3MAJA 1POGA 2EZIA 2HXOA 3EUKL 1DPUA 1X3UA 4CDGA 1AKHA 2DOFA 3VYSB 4IPAA 3BROA 5EZHA 3MVPA 2WADA 2H27A 4F7ZA 1EH7A 3MFKA 2HQNA 2H8WA 2I5UA 4IKFA 1ETWA 4IL6C 2DPUA 3CMEI 3KYCB 4XN3A 1IN4A 4LK1F 2IRFG 3K4LA 3K1NA 4GDFA 3ZMVA 2OAZA 3JAMZ 4A3CJ 5LD2C 2ECBA 5GADJ 4ENKA 4KT5C 2R7DA 4QIWN 1VQKI 2A07F 3R61A 4XLEA 2MW8A 4AIKA 4BBSJ 2P5LC 3S32A 2Z5UA 3WU2C 4AD9A 3ERMA 5IT3A 4HA8A 5LHHA 3CC4I 2CG4A 1Z6TA 2KIUA 1P6RA 2LTPA 4Z6YA 2ZXHA 2UZKA 4Q5SF 2MH2A 3ASOH 1S8NA 2P7CB 1XGMA 4ZYAA 4KIFA 2H6CA 2V6EA 4RGXA 2LLKA 3TP0A 3IH3A 3GO5A 4GRIA 1EKEA 4XNFA 5J8CA 4XLFA 2HYFA 4XORA 1FX7A 4Y33A 4PK4A 2D2WA 1ZYRF 3CUOA 4AYBN 5EEHA 5C4JJ 3KZYA 3J7YJ 4CZZA 2QVOA 3B6CA 4GFBA 2XRLA 1QNTA 1I50J 1G3YA 2VQCA 3JAMK 2DMUA 2IS1A 2Z2SB 3P9IA 2HTJA 4LD5A 1E3HA 3ECHA 3V8KA 3ABKH 2NVXJ 2ZJPF 2WC2A 4BGDA 4CYCA 5JVTA 2H09A 4QPQA 4XLCA 5BNGA 2IA2A 4D0PA 1WPKA 5LGUA 2P81A 2CQNA 3RSNA 4B09A 3ABUA 2CWEA 1B1BA 1RETA 2B63J 2RV8A 4RAFA 3GWZA 4CYDA 4G6TB 3ZN0A 1S72I 2HDDA 2ADUA 2FNAA 1VQ8I 2XF5A 3OSGA 2EZKA 4EVIA 3OV8A 2NVQJ 4A3MJ 1P4AA 5F0FA 5A2QZ 5IYDJ 3AG1H 3PQJA 3V8LA 2V1DA 1Z05A 3ULQB 4EMSA 2P6TA 2M4KA 3S3NA 2M0MA 2X1DA 3RKYA 4B3AA 1DU6A 1BM9A 1KU3A 1T0FA 3K70C 1O7FA 4PFPA 2Z33A 4E7HA 1ULYA 1LEAA 2FNPA 4G9YA 4E7JA 1FTTA 5JR3A 4KMFA 2X6OA 2H1KA 3VWBA 3BTIA 3BY6A 2DDBA 4ZYDA 1RIOH 1AU7A 4PSWA 3I56I 4ON0A 1XD7A 3F6VA 2R0QC 3C7JA 1SFKA 1VF9A 2E71A 3GXOA 2MA3A 1T08B 4II2A 3L2RA 1VFCA 3ZMTA 4NC8A 3Q0UA 4HOBA 4GYGA 3QWLA 4IHWA 5BOXA 3K4CA 4E6KG 1YIJI 3F8NA 1QA6A 2P8TA 3TO7A 3DFGA 5A2QK 5F64A 5B5EC 2VXDA 5FRMA 4UB6C 4UB8C 1GXPA 4F93B 1MMSA 1WGXA 2EFOA 4PUSA 2O6GE 3WTWC 4BQAA 2A5YB 1XB4A 1FC3A 2RQPA 4NBQA 3R6SA 1QRYA 1FJLA 3ZQLA 2DA6A 4JBAA 4X1EA 4DBRA 2E2HJ 2LYCA 5FD6A 1SMYF 4ZYHA 1DQUA 3ZN1A 1S5LC 1SFOJ 4ZC3A 5E17F 5HNFA 1VQPI 3RCOA 3U9GA 1VQMI 3AAFA 1REPC 5FKMA 1NG7A 4QTRA 3F3XA 2YSRA 1Z7UA 3E7LA 1LUJB 3TO6A 4UUSA 1ZGWA 1BN5A 5DUKA 3SFZA 2WV0A 4MIMA 2OCCH 4GXOA 1KQ9A 5L3DA 4P9FA 3DP7A 3S1QJ 5HLTA 1TW2A 3SJMA 4M3GA 2IS4A 4NC7A 1JTYA 1QU3A 3LA7A 4UV8A 1IV8A 2LY2A 3B6AA 3MKZA 4UUVA 2CRGA 1HSJA 4WX9A 2ZCWA 3M8JA 3HGYA 3SDGA 3BZCA 1ZTRA 1ODDA 3VYUB 4XRSG 2KMUA 3GFMA 4N4OB 3ESWB 4HAMA 4U88A 3FKJA 4YIFA 1IW7F 2F4IA 5CKTA 3D5RC 3NQOA 2HPIA 2AQFA 2JVHA 4QLCU 1XG1A 1RI7A 2GZWA 3JRFA 1E17A 1HDPA 1A35A 3V7RA 3BOQA 3ZR8X 2Z1DA 2B9SA 4IHYA 4IHTA 1WWXA 1WI9A 1T95A 2HOAA 3RTRA 1BR4A 2E19A 4RGUA 2BY3A 3C2BA 1ZR2A 2XVCA 2WAQA 1KU7A 2HWVA 4BACA 2O9LA 3EUHA 1TQIA 2ZBKA 1MBKA 5HDGA 4MGRA 3HG9A 2O3FA 3P9KA 5E18F 4ASNA 3CCVI 1HW5A 1PJRA 3FXJA 1K4TA 3O8GA 4MTEA 2EV5A 3HOUJ 1RNLA 4BBRJ 4KT6A 2DMNA 5FB2A 2BGCA 2L9SA 2MG4A 3K9TA 4M3FA 1WJFA 2QWWA 4IF4A 4A3IJ 1YW7A 1GV5A 1SC7A 1MW7A 2VB6A 4RM3A 4ESJA 5IT9Z 1USSA 4ZJZA 4GYIA 3QPSA 2GLOA 4Y7NJ 3KZZA 4PGHA 3QU3A 5F6FA 5GPCA 3LOCA 4O3MA 1FMVA 3BG9A 4R1HA 1WI3A 2BBYA 3BG5A 3NEUA 3F8BA 5E3OA 4YFNF 2BEOA 1A31A 2X4HA 1HW1A 5FFZA 4DGWB 1UJ8A 4QSHA 3G4SI 2Q2EB 1VTNC 4BEHB 2HVSA 2V1UA 1ACIA 2LD5A 2K9MA 2HTSA 3G1OA 1YJNI 3FXLA 4P5OA 3LSHA 4L9JA 2FMYA 1X3ZB 2VBWA 2X0LA 2RREA 2XRNA 2V26A 3MZHA 3W6VA 1R5GA 2MGQA 3A0BC 2BYVE 2WWYA 2W85A 3I59B 4U7DA 1B72B 2DFHA 3TDUC 2CSOA 1M1EB 2CU7A 4BS9A 1K4SA 4HRIA 3J81Z 1UELB 2UUZA 2V9VA 5FGMA 1YHQI 2STWA 1R22A 2KZVA 5IT9K 3W2WA 1SD4A 4N0BA 2VE8A 4WCGA 4EGYA 2ZO4A 3WTZA 1WH7A 1WCMJ 2OC6A 5IP6A 1BL0A 2A68F 4I98B 2DYRH 1D1AA 5KNLA 1CGPA 1SVMA 2DI3A 2ZMEB 3K7AJ 2VLAA 2HOTA 1YO5C 1T98A 4IX7A 4BY1J 3KEOA 2QEXI 2WB1N 1E3PA 3JSOA 2Y0MA 4OIOF 5EJCA 2A61A 2BY1A 4HPQA 2CO5A 4HZFA 4BU2A 4FCYA 3GFIA 2AO9A 4ZDOA 1JUSA 5TISC 2LF8A 2X1CA 3GFJA 4NQWB 2TCTA 4PJJA 4EM2A 2CS3A 3EETA 4FISA 5DD8A 1WVRA 2KLOA 2WAFA 5KK1A 4L9NA 5M3FJ 1PP7U 1H8AC 5K5OA 1I6HJ 4DBQA 3CJQB 2Y0SA 2R7OA 2A69F 4FE7A 1HSTA 1JKQC 4LLGF 1XCBA 1AKHB 2XSDC 2L01A 1ZKGA 3CLOA 3DBHB 4L0ZB 1F1ZA 4ANJA 4FHTA 3J81K 5TJJA 5L3FA 2L4MA 2DOEA 1TL8A 2E1OA 2M87A 4LGWA 1EV7A 4KICA 4MFEA 2HOSA 4YEJA 3LSIA 2CQ7A 5E1XA 1TLHB 3H36A 3WTYC 2KP6A 3HRUA 1XMXA 3VEPA 1XDSA 1FIAA 4XBFA 3NWSA 2L2OA 5HLGA 3F72A 5FLMJ 3RI4A 5CVJA 2KRCA 3LMMA 3OR2C 3K1MA 4YFXF 3K4JA 4UUTA 2F5VA 3BWGA 3FHNA 1TW3A 5K7FA 3OMYA 4P96A 4Y17A 4A0YA 4B4CA 5H20A 3LA3A 1GVDA 3ZQGA 2XAHA 3KE2A 5D6EA 3LQQA 3L2UA 2CMPA 2DK8A 1IJWC 3LSRA 4FX4A 4B48A 1SANA 4XLPF 3SEQA 5DD4A 1P9QC 3CJTB 1WFXA 5ICGA 4RGRA 1JI8A 1OQYA 4HX7A 1OCTC 3E5QA 1IF1A 3M8FA 1S7OA 2DMTA 3ONQA 4JOMA 2VODA 1T33A 1ETVA 3VYRB 1A5JA 1ZRDA 4CYCB 3TEDA 3TGNA 2B0LA 1JGGA 3AG3H 1RKTA 2QKMB 4LK0F 2VUMJ 2ELHA 5GTIC 4U0YA 3QAHA 2L9VA 2L5QA 1I6XA 3GW2A 2O03A 2PX9A 2XPUA 2OCEA 3I4NJ 2BE5F 2XIGA 5D5WB 2M8EA 1LNWA 2FQ3A 2G0EA 2O8XA 2OZ6A 5AIPA 1VQ4I 3RKQA 2DQLA 4XOTA 1OLTA 2LH9A 4N9IA 1A04A 1R00A 2IP2A 5ILVA 2ZFWA 3BZ6A 2QSGX 1U5TC 2L7MP 1J09A 4A3KJ 2WTEA 5FKOA 3BR6A 1SMTA 3HKZA 3ISPA 4PJMA 2X48A 3HRMA 4E7IA 3R0AA 4EM1A 1F9NA 3JRDA 2QCOA 2OQRA 3K10A 4IHVA 3DWLE 3FXUA 5HNHA 1OISA 5FFXA 1XGNA 3KP3A 2XF7A 3DTKA 3KLOA 4QPOA 2DO7A 2WAQN 2MSYA 5L3CA 1IN5A 2ZNYA 2XAJA 3CF5F 3H3VK 1VQ5I 2EZHA 3OS0A 1X4OA 1DP3A 1N25A 2E1CA 1OR7C 1LB2A 4CO8A 1P92A 4A12A 2NOGA 3FMRA 1JKOC 2M5WA 1ZG5A 2GOXB 4RAGA 1ZREA 4PJNA 1ZRFA 3HOSA 2H94A 1Z3YA 1T38A 3J7AY 3DEUA 3EQLF 3FM3A 3ZQIA 4OU0A 1XMAA 1TT5B 3CUQA 3MZYA 2JMWA 3N4MA 2IPQX 2ZJQF 2JN6A 3H9JA 5HLIA 2DJIA 2COBA 3V7SA 2PMZN 4G12A 3U1DA 2EB7A 2Y75A 4RB3C 3L2QA 3LFKA 3CO7C 2LG4A 2H6BA 2ACJA 2QQBA 5DV5A 1YX5A 3LSGA 1OCZH 2FMLA 4DYRA 4OWRB 3ELKA 3H92A 1HF0A 2DPDA 3WGIA 2W24A 2DU9A 3VB2A 1IRZA 1O4XA 2NXNB 4LITA 3MZ8A 1GHCA 4RS8A 2DXIA 2QSHX 3D5LA 4BY7J 4DW6A 3HSFA 1O3TA 1K78A 4XM3A 1DGWY 4JX5A 2HXIA 2NAZA 3JRCA 5D8KB 1GDTA 3H5NA 3M9AA 5J8FA 4D1QA 2IS2A 1V4RA 3A02A 3DV8A 2FF4A 4NC6A 2VQHA 1FYLA 4WXCA 1MJAA 4FETA 2EIKH 4YRVA 1JGSA 1MBHA 4NNJA 2IGKA 1AHDP 2JWTA 1R1UA 2F6CA 2BY2A 4LMYA 3BP8A 3ZGKA 4IEJA 3G1MA 5AONA 1FP1D 3MKLA 4HX4A 3T8TA 3M7GA 4XICA 3IRRA 3KETA 4UY8I 3AL0C 3CCQI 4CHUA 4U7BA 4A6EA 4I7HA 2JJ7A 1FYKA 1ITYA 3QODA 3PIOF 1PUFA 4IVNA 2EH3A 4M9XA 3DLLF 4C3HJ 1I5ZA 1XGSA 2VC1A 4H4KC 2A6TA 2E7WA 4XL9A 2E5NA 1LFUP 2DTZA 3GTJJ 1FWZA 5IP9J 3OYHA 5E3MA 2E36A 2G7HA 2ZSHB 3BPVA 2RGVA 1R49A 2HVQA 2STTA 3KIOA 1QHHD 4L0YB 1L0OC 4IJAA 2F4OB 3C18A 1MH3A 1TWCJ 1R1TA 4OMZA 3W2AA 4BQOA 5DM6F 2EIJH 1S6LA 1LFBA 2L7KA 1FBUA 5FLXK 5CVIA 3RPQA 1WJCA 3I3LA 5E8IA 3H9GA 2VJ4A 4MHGA 2Z3YA 2LNBA 5D5VB 1OPCA 3N97A 1YS7A 3L2WA 4NHJA 1LDJA 1ZAOA 2JUCA 1DU0A 3U2RA 5F08A 1R5HA 4FTHA 3A01A 4PCQA 1ZLKA 4M71A 3A4CA 2DCEA 3D5SC 1MJ9A 2HPMA 3E6BA 2NVTJ 2E35A 2V9PA 1FT9A 2OBPA 3HPHA 4IRHA 3CESA 2ZC2A 5DCMA 3QPHA 4HX8A 3SZPA 1W1WE 1F43A 1ZLJA 1MKMA 3M4OJ 5H6QA 3E5UA 3S2WA 5IOYA 3OIPA 3JRBA 3KEQA 5BS6A 2RNJA 2FJ1A 2F5CA 2XSJC 2E1MB 2MC3A 4AVZA 1WQ2A 4B47A 3K4KA
chains in the Genus database with same CATH topology
3BCBA 3A1YA 1NG7A 3PJRA 2CUZA 1AA7A 1V5EA 1UG0A 4B44A 1MMNA 5TGTA 4F91B 2PJRB 4HNUA 1TZLA 3QYEA 5HLTA 2R7WA 1N75A 2LOOA 2IS4A 4NC7A 1BOBA 4RMNA 2HU9A 1QU3A 2K3PA 3OYNA 3H35A 2IGOA 2LY2A 4XLAA 3S93A 3MKZA 5FRNA 4ZDPA 2BOLA 2M3AA 4P1WA 2JA2A 2K5CA 2Z16A 4PSXA 4XKBA 3M8JA 2LBFA 1DGRM 3PFYA 1ZELA 1D0ZA 3VYUB 3S3OA 2KMUA 2LRDA 3DKXA 4N4OB 1W36C 2JSPA 3U21A 2CV0A 3FKJA 3ZXSA 3H9QA 2R7XA 4KISA 4XLHA 2F4IA 1MNDA 4XR6A 2X85A 1X4PA 3D5RC 4OAZA 2DOAA 5CKTA 2HPIA 2AQFA 2JVHA 2KPMA 4KITB 1VZ0A 3UR3C 2ELJA 2IGMA 4BJTA 3ZR8X 4E7KA 2Z1DA 3OOUA 2WBMA 1T95A 2I8DA 3RTRA 1BR4A 2V9KA 2CW7A 3PL8A 2WAQA 4LIUA 4BACA 1N78A 3OL3A 2R7SA 3DU6A 4BE1A 3K4NA 3HG9A 1PYVA 3DKYA 3PNYA 4OAYA 4ZDLA 2VPLA 1PJRA 3K70D 4KT6A 3K4MA 2L9SA 1WJFA 3N05A 3VSLA 4BE2A 4PJLA 5LFAA 3IAM2 2DT6A 2WY8Q 1Y56A 4AU7A 3EUHC 3E0JB 3LL7A 1BR1A 1MW7A 1X1BA 2VB6A 4PFOA 4RM3A 3V42A 2BW3A 3LSKA 2CH0A 2CW8A 3HXLA 4ZJZA 1V5GA 1TT0A 4CCMA 4DJAA 1LKXA 1WJAA 3EUAA 3TMOA 4N4NB 3SYTA 1FMVA 3QOEA 3AKZA 4F55A 3KYLA 3S3MA 1Z3XA 4BE0A 4C2TA 3KX2A 2OUMA 4DGWB 2V1NA 2HVSA 2MC4A 2Q2EB 4BEHB 3OYLA 3KEYA 3BCAA 1WJEA 4ITVA 2K9MA 3DQVC 2R7QA 4P5OA 3LSHA 2K9LA 5CQEA 3HOTA 3FBNB 2RREA 3C2HA 2V26A 4LG3A 1IRXA 4XN0A 1GLNA 1ERDA 4J00A 3OYBA 3UNGC 4FASD 4BS9A 4HRIA 2HDWA 1UELB 4CSWA 2MD0A 2UUZA 3TBIA 3ZCOA 2KZVA 2M7AA 3W2WA 3E1SA 2CFOA 2VJIA 4RLFA 4IQ4A 2Q1ZB 4XQFA 2OC6A 4XONA 3MKYB 4E7LA 1D0XA 1D1AA 4YELA 3CMMA 5KNLA 2W82A 2VJ5A 2VLAA 2CUJA 4BL0B 4CUGA 4IX7A 2CV1A 2PJRA 2E1MC 2HVRA 4HPQA 3OYJA 4BU2A 4ZDOA 1LFPA 2XDVA 2X1CA 4NQWB 4PJJA 2CS3A 3OR1C 2WAFA 2KLOA 2W1OA 3OYDA 1G59A 2ZSIB 4DBQA 3CJQB 1WJBA 2P0WA 2Y0SA 5JHFA 2R7OA 5HOOA 2VQGA 4HSRA 4ANJA 1WJ5A 3DPTA 1YX3A 4ZTJA 3LSMA 3H0DA 1MMAA 1W36D 2W00A 3OYCA 4YEJA 3CJRB 3LSIA 2X6XA 2KL4A 5HVQC 1WJDA 2KP6A 1MNEA 4IQJA 1SAUA 2E60A 2L9NA 2XF6A 3QYBA 3PSFA 2BVLA 2QKLB 3PUBA 3OYIA 3HUGB 3M1CA 3NWSA 2L2OA 4DIQA 2IS6A 2MYSA 4C30A 1S9HA 2KRCA 3LMMA 3OR2C 1MMDA 3K4JA 2VXZA 3GBGA 2KHMA 2F5VA 2NOJB 3FHNA 2XAUA 4CH7A 2VJJA 2M7BA 3OMYA 2LY1A 4CCOA 1Z7LA 2A5WA 4CCJA 3OL4A 1HA8A 4CCNA 3IAS2 4Y3OA 3L2UA 2CMPA 2RQQA 3K6GA 3MKWB 3RCOA 4B48A 3FBIB 3SEQA 1P9QC 1WFXA 3F9KA 3DTEA 1JI8A 3AL0B 4CA0A 2HNHA 4II3A 5CQGA 1NG6A 3ONQA 3VYTB 4JOMA 3VYRB 4BJ6C 1E0EA 4MLOA 3RPUD 4HSTA 3SZGA 1KONA 2KQRA 2QKMB 3SDBA 5KHDA 4CCLA 2ZFUA 3OYKA 4XMYA 2L5QA 3W2VA 2O5RA 4J01A 1N77A 4U87A 1QHGA 4BEHA 2KDOA 1K6YA 2WB1A 1MMGA 4BDZA 2IXSA 2BVMA 4XOTA 1OLTA 2LH9A 3DLAA 4E7SA 4C2UA 3DPLC 2DT7B 2WA0A 1UAAA 2GOMA 2KRHA 1J09A 4JQFA 3HKZA 1X1DA 4PJMA 4RM2A 4XKCA 4E7IA 4E7ZA 3OYMA 4XKWA 3C2GA 4LIVA 4DOZA 3FDYA 3ZRGA 2MABA 4KJZA 2OV7A 3K10A 3DWLE 5HNHA 4F3QA 2IGNA 4BJ5C 1X19A 3VDXA 3ZQQA 4B43A 2XF7A 3DTKA 4QPOA 4E4HA 3W3CA 1D1CA 1U0JA 3OS0A 1X4OA 1DP3A 2ZXIA 1OR7C 1X1CA 4HNTA 4B3XA 4HEA2 2CV2A 4BQNA 2R7RA 2GOXB 4PJNA 3EUKL 3CP8A 3HOSA 2R7VA 1Z3YA 4ZTFA 1FMWA 3CZ6A 3J7AY 2X51A 3VYSB 2WADA 3OWTA 3VSKA 3DU5A 3BG7A 4IKFA 3IUOA 3H9JA 2DJIA 2R4GA 4XN3A 3TL4X 4EATA 3K4LA 4BUPA 3L2QA 5LD2C 2LG4A 3L2VA 2W7NA 4RLQA 4XLEA 1YX5A 3LSGA 3S32A 3DEEA 3NWTA 4OWRB 2ZXHA 3OYAA 4ZYAA 2V6EA 2LREA 2VASA 3CF2A 2WAEA 4GRIA 4XNFA 2JUGA 4C9YA 4XLFA 4LITA 2M4GA 4XORA 2DXIA 4Y33A 3D5LA 4PK4A 2WY7Q 3BC8A 4XM3A 2FUG2 4XKVA 1DGWY 3DTIA 3G2BA 3HC7A 3RQ4A 2V7FA 1YE9A 3H5NA 4D1QA 2IS2A 2VQCA 3PNTA 2IS1A 2Z2SB 3QYFA 3MD2A 3PSIA 2LBFB 5KCMA 1R6RA 2VQHA 2X1EA 5FROA 2XC7A 4NUBA 2RNGA 3S8PA 4FETA 4YRVA 4R79A 4BGDA 4NNJA 2IGKA 4QPQA 1V5FA 1D1BA 4XLCA 2F6CA 3OYGA 3H5AA 3ZGKA 3K4BA 3RSNA 2HQAA 4X0GA 3I9V2 3OYEA 3AL0C 4U7BA 2VKHA 5CPRB 3QODA 4D9JA 3OY9A 4G6TB 4IZZA 4H4KC 3OIQA 2A6TA 2JVGA 4XL9A 2E5NA 2XF5A 2W4SA 4F52A 3OYHA 2X6WA 3BG6A 1LDKB 2ZSHB 2HZDA 4XOPA 2VQLA 4BXFA 2HVQA 1BR2A 2X6YA 1QHHD 3AFHA 2MFZA 3CP2A 2M4KA 3OS2A 2M0MA 3S3NA 2X1DA 2R7TA 1LVKA 3OS1A 1G8XA 1Z21A 2LC2A 2PMZA 3K70C 4BQOA 3HL2A 3W2AA 2L7KA 4PFPA 3EPZA 4E7HA 4E7JA 1X1AA 3H5RA 1WJCA 3I3LA 3VWBA 2E5ZA 2VJ4A 3H9GA 2BW3B 4PSWA 4Y4RA 3L2WA 4CCKA 1SFKA 4II2A 3L2RA 4F92B 1T0FC 3PNVA 4NC8A 3SEZA 2V4JC 3DPUA 3A4CA 3HPGA 2DCEA 3K4CA 4E6KG 2UWMA 3D5SC 3BLYA 4BDYA 2HPMA 3HPHA 2VXDA 5FRMA 3A2KA 2UV1A 3OYFA 3CESA 4F93B 4PUSA 4BQQA 3IP4B 3LFUA 4AYBA 3MMYB 1EA3A 1D0YA 4CZCA 2R7UA 4DBRA 2AQEA 2VL8A 2LYCA 3OIPA 1DQUA 4HG2A 2VIXA 2VKDA 1Y6IA 2E1MB 2XSJC 4ZC3A 4AVZA 5HNFA 4B47A 3K4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L2O A;  2KRH A; 
#chains in the Genus database with same CATH topology
 1IXS B;  3W6K B;  4PDK A;  5LGT A;  1NTC A;  3RZD J;  3T1B A;  2FOK A;  3BCB A;  5K1Y A;  1NK2 P;  4D7M A;  3ROU A;  2O7O A;  1AA7 A;  3HTS B;  5DYM A;  1ZH5 A;  2ISY A;  2D1V A;  1KYW A;  2B7E A;  3FXR A;  4KIG A;  4L5E A;  5TGT A;  5LLQ A;  2OF7 A;  4EEF G;  3PFI A;  3KP5 A;  4HNU A;  3J80 Z;  1BOB A;  2HU9 A;  5GAH J;  3AG2 H;  3HIF A;  2BHY A;  3CO6 C;  4IO9 F;  5FKK A;  1XN7 A;  3ZQ7 A;  2W57 A;  4KNY A;  4D5C A;  2Z16 A;  4XKB A;  1TNT A;  2FD5 A;  1FNN A;  2LBF A;  1F36 A;  1G4D A;  3FX3 A;  2NNN A;  1ZEL A;  1KZH A;  4KMU X;  1STZ A;  3EYY A;  3S3O A;  4L18 B;  2AXT C;  5BPD A;  3U21 A;  2CV0 A;  4WWC A;  4MTD A;  3H9Q A;  2UXN A;  2XAG A;  1X4P A;  4OAZ A;  1Z9C A;  2DOA A;  4MEX F;  2VE9 A;  3J80 K;  1RRJ A;  2P6S A;  3FKI J;  3TW6 A;  5E3N A;  4XK4 A;  3UR3 C;  2ELJ A;  3W6J B;  4ZYE A;  2P4W A;  3OOU A;  2HQ5 A;  4DZP A;  4E7K A;  2WBM A;  3WTT C;  3WU0 A;  1YFH A;  4BHB A;  1YS6 A;  4LIU A;  3BJA A;  3HSR A;  3OL3 A;  2JK3 A;  4OOI A;  3DU6 A;  1ZG3 A;  3U1K A;  3DKY A;  4A3J J;  1IXC A;  3OSF A;  4Z2Y A;  5EG0 A;  2XUB A;  2VPL A;  1IGN A;  4DZJ A;  1ENH A;  1MIJ A;  2WV1 A;  2V79 A;  5FD5 A;  5KAI C;  3VSL A;  3HOW J;  5LFA A;  4AU7 A;  1RR8 C;  2W25 A;  3LL7 A;  1BR1 A;  1VQN I;  3WHC A;  2JA6 J;  4XRM A;  2CH0 A;  2CW8 A;  3HXL A;  3O8H A;  3IH4 A;  5JHU A;  4DJA A;  3FXK A;  5JVG F;  2FE3 A;  2QLZ A;  3EUA A;  5K5Q A;  3TMO A;  2XAQ A;  3SYT A;  3AKZ A;  3KYL A;  1S7A A;  3LST A;  4XLN F;  2I10 A;  4C2T A;  3K69 A;  3RKW A;  2V1N A;  1U9N A;  2IBD A;  3HSE A;  1VND A;  3HRS A;  2PFB A;  1W5S A;  4OIR F;  4HF0 A;  4ITV A;  3QU6 A;  5BQT A;  1W7P A;  2P5K A;  1VQ6 I;  3Q3S A;  3L1P A;  3HOT A;  2EBI A;  3FBN B;  3H3U A;  1FSH A;  4LG3 A;  4DYC A;  1IRX A;  4LFU A;  2XB0 X;  4A0Z A;  3EDP A;  3OYB A;  3ASN H;  4UVB A;  3CCR I;  2HDW A;  2AXL A;  3ABT A;  3TQN A;  2MD0 A;  1H89 C;  3M3Y J;  3ZCO A;  3FXM A;  2M7A A;  2VJI A;  5J47 A;  4IQ4 A;  6PAX A;  1UFM A;  4XQF A;  2M34 A;  3SFI A;  4XON A;  2GXG A;  4E7L A;  2AHQ A;  1D0X A;  2JPC A;  3P5J A;  3WTS C;  1OCP A;  4UVA A;  2MD5 A;  2PG4 A;  4L5J A;  3PM1 A;  2PJR A;  1R7J A;  3CCS I;  2HVR A;  1X3W B;  3WE2 A;  2XDV A;  2K86 A;  1RPW A;  4M73 A;  4YG2 F;  2UXX A;  3R0J A;  1WJB A;  4M3E A;  3CC7 I;  1SD6 A;  2HYJ A;  3D1N I;  3CUQ B;  5ICE A;  4HV5 A;  1HKS A;  1YX3 A;  5GPA A;  4RBO A;  2EFW A;  1MMA A;  4A3G J;  2YX7 A;  5AIQ A;  2RAE A;  1L3L A;  1LEB A;  3CJR B;  2KL4 A;  1WZ2 A;  4A3L J;  1QVU A;  3RYR A;  5HVQ C;  2QA4 I;  4EJV A;  3A0H C;  1MNE A;  5HS7 A;  5L3B A;  1SAU A;  2P5V A;  2XF6 A;  3PSF A;  2BVL A;  2ZB9 A;  4YIR X;  2X9D A;  3OOP A;  2IJL A;  2QQ9 A;  3I0T A;  2LVS A;  2MYS A;  2VOP A;  1XTA A;  2A3S A;  2EA4 A;  4EJU A;  1RKW A;  2YX4 A;  1BC8 C;  4U0W A;  3BQZ A;  1JTX A;  2IEK A;  4CCO A;  1Z7L A;  2DA2 A;  2K3F A;  2ICW G;  3OL4 A;  2ZKZ A;  1HA8 A;  3HZJ A;  2LF7 A;  2M30 A;  4AVP A;  1K78 B;  3K6G A;  3SQN A;  1H9G A;  1W5C C;  1CF7 A;  4BNC A;  3LAJ A;  1ETK A;  2NVU B;  3JRH A;  1EJ9 A;  3KP6 A;  1IUY A;  3IWZ A;  2FU4 A;  4M6V A;  1IXR C;  1R71 A;  3GTK J;  3I64 A;  1ZR4 A;  4HF1 A;  1TWG J;  2FX0 A;  3SHF A;  2HNH A;  4V2F A;  1NG6 A;  1ORK A;  2L0K A;  1OJL A;  3FK7 A;  3HEF A;  3LQR A;  2CQQ A;  4UHT A;  5HLH A;  5EEA A;  1ETY A;  2ZJR F;  4KIB A;  5ICC A;  1SVO A;  3HHG A;  2ZXJ A;  2G9W A;  1U78 A;  2GIV A;  4G8X A;  4DYQ A;  1R4M B;  1PP8 F;  1Y8Q B;  4CCL A;  1TBX A;  4BHP A;  1D8J A;  2O0Y A;  1SD7 A;  3W2V A;  4J01 A;  1N77 A;  1IUF A;  5EZG A;  2PBI A;  4U87 A;  2RC4 A;  4HDU A;  4AID A;  2KDO A;  1K6Y A;  4BDZ A;  4HV6 A;  5DTD A;  1S7E A;  1PUF B;  2BXY A;  4LG0 A;  3FMS A;  1HXD A;  4M6Y A;  1G3T A;  3DLA A;  1MSF C;  2CUF A;  1J2X A;  5JLW A;  2GWR A;  2K9Q A;  4E7S A;  4Q4Z F;  3JRI A;  3BJO A;  3DPL C;  3GX4 X;  2DT7 B;  3S1M J;  3DKW A;  2GOM A;  1MZB A;  4JQF A;  3M07 A;  2VBX A;  3ZQH A;  1JUP A;  4I01 A;  2LKS A;  4FQG A;  4RM2 A;  4XKC A;  3ZMU A;  1XPX A;  4ESB A;  4E7Z A;  3T0Y A;  3C2G A;  4LIV A;  5EEG A;  4DOZ A;  3B73 A;  3ZRG A;  2MAB A;  1O3Q A;  1LE8 B;  4Y15 A;  2OV7 A;  1KU2 A;  1Q1H A;  4BJ5 C;  1X19 A;  3MEX A;  1ZQ3 P;  3GYH X;  5LRS A;  1TQM A;  3W3C A;  4D5F A;  4HLX A;  3VPR A;  2KJB A;  1MBJ A;  3HOV J;  1X1C A;  5LEJ A;  4B3X A;  2FQ4 A;  1BBY A;  3A01 B;  2KDZ A;  2R7R A;  3BDD A;  3ZOB A;  2R7V A;  4ZTF A;  2ZME C;  3P7N A;  1HLV A;  2X51 A;  2NYX A;  5E8G A;  4FT8 A;  4GCV A;  3BG7 A;  1YG2 A;  3KP7 A;  2N8G A;  3IUO A;  2ISZ A;  2R4G A;  3REO A;  2EV0 A;  4BAY A;  2HKX A;  2HDC A;  3T5X A;  2EIN H;  4A3F J;  1YIO A;  2XV4 S;  2F2E A;  5DCM B;  4BUP A;  3GZ5 A;  4HDV A;  4G6D A;  4G6Q A;  1MGT A;  3L2V A;  1U8R A;  1H0M A;  4HQE A;  2W48 A;  3WTX C;  3CMA I;  3DEE A;  1TWH J;  3GF2 A;  5B66 C;  3NWT A;  3HUG A;  5LHI A;  3FWE A;  3F22 A;  2DMQ A;  4L5I A;  3BTJ A;  4ETS A;  1E2X A;  2LRE A;  4A2U A;  2VAS A;  3CQZ J;  3HOX J;  2QSF X;  3CF2 A;  2WAE A;  1YLF A;  2JUG A;  3EYI A;  3KZI C;  2M4G A;  3P9C A;  4WXD A;  1FOX A;  2OJE D;  3WE3 A;  1KA8 A;  1A6I A;  2WY7 Q;  4A93 J;  2KIM A;  4XKV A;  3DTI A;  4IXA A;  1TQP A;  4ENJ A;  3HC7 A;  3J7A O;  1IN8 A;  2HI3 A;  1YE9 A;  2RVC A;  3Q9S A;  3S17 J;  4A69 C;  3MD2 A;  4A6D A;  3CD6 I;  1K7A A;  2LMD A;  2LBF B;  5KCM A;  5FRO A;  5LBQ A;  2X1E A;  4S04 A;  2RNG A;  3C3W A;  3VOD A;  4BYY A;  4I76 A;  4YII A;  1G2H A;  1WHU A;  3GUD A;  1XSX A;  3RKX A;  5IP7 J;  3RQI A;  1I1S A;  3H5A A;  4EJT A;  4I0A A;  5H6R A;  3K4B A;  3PUF A;  4X0G A;  2JRM A;  3I9V 2;  1IDY A;  5ILU A;  3OYE A;  4LJZ F;  3FK6 A;  1HKQ A;  3BJ6 A;  1HCR A;  2VKH A;  4WXH A;  3CCU I;  4HYE A;  4CGZ A;  3OY9 A;  3ZMZ A;  4AWX B;  4IZZ A;  3OIQ A;  2JVG A;  3HJE A;  2DLL A;  4F52 A;  2ME0 A;  2X6W A;  2P7V B;  3H3Z A;  1LDK B;  1OCC H;  3BQY A;  2VQL A;  4XOP A;  4RB1 A;  1UHM A;  3RJP A;  4BXF A;  4IRG A;  3BPX A;  5IYB J;  1GV2 A;  2EV6 A;  3AFH A;  1LDD A;  2A6E F;  2MFZ A;  3OS2 A;  2R7T A;  3HYI A;  1YRN A;  1P4X A;  5EG0 B;  1G8X A;  1RUO A;  3V4G A;  2HEO A;  1FY7 A;  1Z21 A;  1ETQ A;  5GAE J;  3CDI A;  5HS9 A;  1V3F A;  4A5M A;  1YYV A;  2AS5 F;  1HBX G;  2NS7 A;  3EPZ A;  1AWC A;  1X1A A;  4BH9 A;  4M9Z A;  2JA5 J;  2K40 A;  2TDX A;  2E5Z A;  5HDK A;  2Y9Y A;  3GTQ J;  1U6G A;  2FA5 A;  3S14 J;  4Y4R A;  4ESF A;  4BHC A;  1OYI A;  1K6O A;  2DA5 A;  1SFX A;  4M6X A;  1FOK A;  3IL2 A;  3UKG A;  1T0F C;  2XGD A;  3PNV A;  3SEZ A;  2V4J C;  2DW4 A;  1Q1V A;  2XGE A;  2HS5 A;  3WGH A;  2F5E A;  1JUM A;  3GLL A;  2DBB A;  3HM5 A;  2DQR A;  1EH8 A;  3BLY A;  4BDY A;  2JQ7 A;  3S1R J;  4C2M J;  2QQA A;  1JE8 A;  2CYY A;  3GTM J;  1W7P B;  3IP4 B;  4AYB A;  5LEK A;  1TC3 C;  3HTU A;  4KUM A;  4GO1 A;  4CZC A;  1U3E M;  1K83 J;  2FBI A;  1U2W A;  2AQE A;  5FKL A;  3BT9 A;  5ICF A;  2VL8 A;  3BTL A;  1YIT I;  4HG2 A;  3ZP5 A;  1Z77 A;  2VKD A;  1Y6I A;  4RAY A;  5FKN A;  1GUU A;  1W0T A;  2RKH A;  5ED4 A;  4LLN A;  3H1C A;  1Y39 A;  2D45 A;  2R92 J;  3A1Y A;  2VBY A;  1XDU A;  2CUZ A;  2ZXW H;  4WF2 A;  3I4P A;  1QO0 D;  2L02 A;  4JP0 A;  1XGO A;  5C4X J;  3G1L A;  2PJR B;  3FM5 A;  1TZL A;  3QYE A;  2R7W A;  1N75 A;  4I6Z A;  2D1H A;  3C1D A;  3WTV C;  1BOA A;  2K3P A;  2O61 A;  2IGO A;  5FRN A;  3S93 A;  1ZHF A;  1ETO A;  4M72 A;  4AUX A;  4EM0 B;  2ECC A;  3K2Z A;  4K2E A;  1E3O C;  1P2F A;  2F48 A;  4PSX A;  4EJO A;  4KN7 X;  4IRI A;  3ABL H;  4BXU A;  4PJ0 C;  2Y30 A;  2LSO A;  2OD5 A;  2ID6 A;  1R23 A;  2XAS A;  3PFY A;  3WGG A;  1D0Z A;  1U8B A;  1Z0X A;  5DM7 F;  4CIC A;  2LRD A;  4FX0 A;  3DKX A;  2ZJ2 A;  2JSP A;  4W97 A;  2K4B A;  2COM A;  2DK5 A;  4KIS A;  1MND A;  3FXO A;  5EDN A;  1G3S A;  2KPM A;  4KIT B;  1KGS A;  1VZ0 A;  1D3Y A;  2DMP A;  2IT0 A;  4QWQ A;  1QZZ A;  1TNS A;  1UHW A;  5FLX Z;  1P7I A;  5GTH C;  2KRF A;  4EJW A;  3I55 I;  2IGM A;  2Y31 A;  2Y0S N;  4BJT A;  2JA8 J;  2CW7 A;  1PDN C;  2IA1 A;  2K7L A;  1FBS A;  5D5X B;  3GTO J;  3JCU C;  3BZK A;  4KFC A;  1ZK8 A;  2A6H F;  4A5N A;  5B1B H;  1N78 A;  1B4A A;  4JX6 A;  2RDP A;  1YW8 A;  3GZN B;  4PGG A;  2XHK A;  1SAX A;  2BHZ A;  5IPA A;  4KA4 A;  3PNY A;  3RPU A;  1CF7 B;  2XGC A;  1Y0N A;  4ZDL A;  2OA4 A;  2LKP A;  2HZT A;  2CGP A;  4ZYG A;  4UVC A;  3JTG A;  2VBZ A;  3K4M A;  4HW0 A;  3S16 J;  1IN6 A;  4PJL A;  4NDL A;  5F04 A;  3IAM 2;  2WY8 Q;  2OU2 A;  3EUH C;  4PFO A;  3DEW A;  1X1B A;  3V42 A;  1LE8 A;  2EIL H;  2BW3 A;  2CQK A;  2Y69 H;  1I1G A;  2M0C A;  4CCM A;  5EF6 A;  3AG4 H;  1OCR H;  1TWF J;  1DDN A;  2PLY A;  1OFC X;  3QOE A;  3COA C;  2XGX A;  4F55 A;  5J1R A;  5K5R A;  2ESN A;  1IRF A;  1Z3X A;  1QZY A;  4KYW A;  1T39 A;  1XX5 A;  3KX2 A;  1HKT A;  2F5F A;  1OYY A;  3OYL A;  1WJE A;  3JR9 A;  1P7J A;  2MLK A;  3DCF A;  3DQV C;  4LG0 B;  5L3G A;  5ERI A;  3TOB A;  1X58 A;  2K9L A;  5CQE A;  5FLV A;  3C2H A;  1YW9 A;  3M1E A;  4RGS A;  5ILS A;  3E6M A;  3QPT A;  1J7K A;  4XID A;  2F4M B;  1V54 H;  1ERD A;  2V6C A;  1QPM A;  5FO5 A;  2L9R A;  2GIZ A;  3UNG C;  4FAS D;  1X2M A;  2R93 J;  2QM3 A;  3E3V A;  4I0B A;  4CSW A;  2YPR A;  3TBI A;  3VFZ A;  4B1R A;  2DA1 A;  2QYO A;  5F0C A;  3KP2 A;  3E1S A;  2CFO A;  2L4A A;  4G7Z F;  4MNU A;  1FIP A;  1MBF A;  4ZZD A;  1R9T J;  3JW4 A;  3S1N J;  3FMQ A;  1V55 H;  2FXA A;  1J75 A;  2VJ5 A;  5GP9 A;  2CUJ A;  1IV6 A;  1D5V A;  4CUG A;  4R8H A;  2DN0 A;  2E1M C;  3PO2 J;  4P9U A;  1FLI A;  1G3W A;  2DA4 A;  4IOC F;  1J9I A;  4OIN F;  2HKO A;  2ZSI B;  5IYC J;  4XRS A;  5HOO A;  2YU9 J;  1O3R A;  5E20 A;  4LLL A;  4HSR A;  3HKZ N;  4S05 A;  1SVL A;  4NB5 A;  3T8R A;  2JTV A;  3L7W A;  5CVU A;  4ZTJ A;  2R5Z A;  3LSM A;  3H0D A;  1W36 D;  2W00 A;  3OYC A;  1EH6 A;  5BMZ A;  2FBH A;  1VQ9 I;  1WJD A;  4IQJ A;  4XRF A;  1I3Q J;  3IWF A;  4RAZ A;  2CW0 F;  1RZ4 A;  2L9N A;  3QYB A;  2DOD A;  2MBF A;  3I53 A;  1B8I A;  3PUB A;  2EA2 A;  3OYI A;  3HUG B;  3GEZ A;  3G71 I;  2IS6 A;  1ETX A;  1Y1W J;  3CC2 I;  1S9H A;  2PN6 A;  1MMD A;  2DFI A;  2KZG A;  2VXZ A;  4G7H F;  2KHM A;  2JT1 A;  4DQ2 A;  3D0S A;  4CH7 A;  1FOW A;  3WG7 H;  5J1Y A;  4A0X A;  1O3S A;  2M7B A;  2XPW A;  1UST A;  4BKX A;  2HOE A;  4CCN A;  2VON A;  1GXQ A;  1BIA A;  4Y3O A;  1R58 A;  1BIB A;  4U0V A;  3FBI B;  5EGO A;  3KYD B;  1CQT A;  4UXN A;  1J5Y A;  2QF7 A;  5M5W J;  2OZU A;  3DTE A;  2R5Y A;  3BR5 A;  3F23 A;  1RR7 A;  2DAO A;  4A3E J;  1YOV B;  2MLG A;  3BR0 A;  2K85 A;  2E1N A;  3VYT B;  4Y52 J;  4Q48 A;  4MQV A;  2IVM A;  2FOW A;  4IHS A;  1D8K A;  4BJ6 C;  5E3L A;  3CCY A;  4MLO A;  2XPV A;  3SZG A;  1WRJ A;  2L7F P;  2YR2 A;  3SDB A;  1R36 A;  1Y1V J;  2DYS H;  2O8K A;  5IOZ A;  4KN4 X;  3ECO A;  3OYK A;  1U5T A;  2IA0 A;  2O5R A;  2KT0 A;  3QRF F;  2VI6 A;  3GZ6 A;  3I5U A;  2R7Z J;  3S2H J;  1KU9 A;  1QHG A;  2FBK A;  1DUX C;  4ENM A;  2WB1 A;  1YQA A;  4MFD A;  2NRA C;  1MMG A;  1GVJ A;  2BY0 A;  4G94 A;  2EFQ A;  2K27 A;  3CLQ A;  2F5D A;  4HBL A;  3V7C A;  3HRT A;  5DDG A;  5M3M J;  2K02 A;  2J5O A;  1EF4 A;  4B8X A;  1ZGJ A;  1BI3 A;  2KIF A;  3O6B B;  2LP0 A;  1QGP A;  1UAA A;  1FOY A;  2PI0 A;  2KRH A;  1VQO I;  1QQI A;  2NS8 A;  3LSJ A;  1KQ0 A;  2EPF A;  4LOC A;  4XKW A;  1OR7 A;  3CCE I;  1W7P D;  3A03 A;  1YRN B;  5D4S A;  1P4W A;  2VC0 A;  1U9O A;  2G7U A;  5J40 A;  5K7H A;  2Y2Z A;  1JXS A;  1ON2 A;  2E7X A;  3JRA A;  1Z1D A;  3RIR A;  3SXY A;  4E4H A;  1BJZ A;  2K9N A;  5E79 C;  1D1C A;  4E70 A;  2M9H A;  1ON1 A;  4YFK F;  2V1X A;  4RB2 C;  3K1P A;  4HNT A;  1RC9 A;  4HEA 2;  1RES A;  2HYG D;  2CV2 A;  4BQN A;  2DFE A;  2PEX A;  5H2F C;  2NS0 A;  2BXZ A;  4CXF A;  3CP8 A;  2EWN A;  3L2C A;  1FMW A;  3CZ6 A;  4EQQ A;  1QPI A;  2ID3 A;  2NVY J;  3ZQC A;  1B6A A;  4H0E A;  3OWT A;  3VSK A;  3DU5 A;  3L09 A;  1KQ8 A;  4L9T A;  2XRO A;  2Z99 A;  1UG2 A;  4Q47 A;  1WKM A;  3TL4 X;  4EAT A;  3CCJ I;  5D8L B;  3KLN A;  1VQL I;  2DJN A;  3KFW X;  3ERE D;  3DBL B;  2L54 A;  1J59 A;  4I09 A;  2KIQ A;  3GLX A;  3DBR B;  5HDN A;  4RLQ A;  2W7N A;  3WHB A;  3CUQ C;  4JYK A;  2BV6 A;  2QGU A;  3DF8 A;  3PIP F;  2W84 A;  1XSV A;  1ONV A;  1ZAR A;  5F27 A;  3OYA A;  4MQ9 F;  1B9N A;  2H8R A;  5KAF C;  3BR3 A;  2J5P A;  2EFN A;  4TV7 A;  4MEY F;  1BW5 A;  4C9Y A;  1XC5 A;  5J1U A;  1JT0 A;  1F5T A;  2EJR A;  3BC8 A;  3IKT A;  2FUG 2;  5F1J A;  3IRQ A;  1T8I A;  3G2B A;  4UNO A;  3RQ4 A;  1Y0U A;  2V7F A;  4M9S A;  5LRR A;  1PUE E;  1I39 A;  3PNT A;  4I2O A;  1AOY A;  1HOM A;  3QYF A;  3PSI A;  3IH2 A;  1R6R A;  1A6Q A;  5M5Y J;  2XC7 A;  4NUB A;  1FSE A;  3X2Q H;  3S8P A;  4R79 A;  1HW2 A;  1JHF A;  1W5T A;  4N9H A;  1V5F A;  1D1B A;  4P55 A;  3OYG A;  2MH9 A;  3O2P E;  5J6X A;  1MBE A;  2HQA A;  5J4V A;  1UMQ A;  4J19 A;  5DS9 A;  4M3D A;  2VT3 A;  2QEN A;  3BR2 A;  2GXA A;  2R7F A;  4HLY A;  2DTR A;  2IAI A;  4OIQ F;  5CPR B;  4D9J A;  1OKR A;  1OYW A;  3ZQF A;  3CCM I;  3G3Z A;  1O7L A;  2LFB A;  3ZPL A;  2OPT A;  4C3I J;  3F8M A;  2W4S A;  2Y9Z A;  1D5Y A;  3RDI A;  3BG6 A;  1B59 A;  2ZNZ A;  2HZD A;  5M5X J;  2FSW A;  4UV9 A;  1IRG A;  1J0R A;  1IAW A;  1BR2 A;  2VPR A;  2X6Y A;  3G6E I;  3GCM A;  4C3J J;  3CP2 A;  4RA2 A;  1Z91 A;  2Q0O A;  1LVK A;  3JRG A;  3OS1 A;  1IN7 A;  3K0L A;  5LHG A;  2OTJ I;  2L3D A;  4AIJ A;  2LC2 A;  2PMZ A;  3HL2 A;  1LVA A;  2EFP A;  4FE4 A;  1NH3 A;  3H5R A;  1OMI A;  2XB5 A;  2YUS A;  5J3L A;  2YS9 A;  2BW3 B;  2LK2 A;  2EQR A;  4CCK A;  1MDM A;  4Y13 A;  1BI0 A;  1LQ1 A;  4F92 B;  2KJC A;  3DPU A;  1I27 A;  1BC7 C;  1ZRC A;  3HPG A;  1A36 A;  3GTL J;  5L3E A;  2UWM A;  5CVR A;  3CJN A;  1X1P A;  2FRH A;  3ML6 A;  1YJW I;  1RUN A;  3A2K A;  2QZ8 A;  2UV1 A;  3OYF A;  1QBJ A;  4JX4 A;  1KYZ A;  1H9T A;  4BQQ A;  3LFU A;  3MMY B;  1EA3 A;  1D0Y A;  3I4M J;  3HHH A;  1HDD C;  4EV0 A;  2PMU A;  3ZMS A;  1FEX A;  2R7U A;  4V2G A;  5F1R A;  4XSZ F;  2RN7 A;  2VIX A;  2HFH A;  5E1W A;  1MJB A;  3V8J A;  1BJA A;  5JI6 A;  2LKX A;  1UHS A;  3O3K A;  5HS8 A;  4V19 K;  4AM3 A;  4M74 A;  3E6D A;  3PJR A;  2QBY B;  9ANT A;  1V5E A;  1UG0 A;  4B44 A;  1XS9 A;  3NAU A;  2Q8K A;  1MMN A;  2H1L A;  2CJJ A;  1VI0 A;  3QPL A;  4F91 B;  3JRE A;  2DFF A;  5B3S H;  4EGZ A;  5KVR A;  2LOO A;  1Y8R B;  4RMN A;  2JZY A;  4IOA F;  2ELK A;  2ETH A;  3IC7 A;  1R4N B;  3OYN A;  3H35 A;  1QVT A;  4XLA A;  1K79 A;  3GTP J;  3WOD F;  4ZDP A;  2BOL A;  2M3A A;  1I3A A;  3BR1 A;  4P1W A;  3WTU C;  2ESH A;  2JA2 A;  2K5C A;  5C44 J;  2M2E A;  5CVV A;  1DGR M;  2A05 A;  4O6J A;  1SEU A;  4A3D J;  2M8G X;  5HOD A;  1BI2 A;  2FEZ A;  5CJ9 A;  3F21 A;  1JT6 A;  4RB0 A;  2R5Z B;  2VN2 A;  1YTY A;  2IW5 A;  2GA2 A;  1W36 C;  4OIP F;  2KIS A;  2KFD A;  3ZXS A;  2CUE A;  3LNQ A;  2R7X A;  2HQR A;  4XLH A;  4XR6 A;  2X85 A;  2PQ8 A;  3CCL I;  5CYV A;  2VOO A;  3L9F A;  3JSP A;  1B8I B;  3FF5 A;  3OIO A;  3TDZ C;  1FPQ A;  3KPH A;  1WSU A;  5BPI A;  1PVE A;  5GAG J;  3G73 A;  2LY9 A;  3RZO J;  2CFX A;  3HOZ J;  1MD0 A;  2I8D A;  1IG7 A;  2V9K A;  3PL8 A;  3GFL A;  3RYP A;  3JTH A;  2E2I J;  4BXX J;  2R7S A;  4HF2 A;  5C3E J;  3K4N A;  2OQG A;  1FP2 A;  4BE1 A;  1PYV A;  2NNY A;  4A3B J;  5K7Z A;  4OAY A;  1K61 A;  2VKE A;  1BW6 A;  2CQX A;  2D5V A;  5EGO B;  1NHA A;  3I58 A;  3QOP A;  2DT5 A;  2Z9O A;  1JJ6 C;  3K70 D;  2R5Y B;  4I02 A;  3N05 A;  4BE2 A;  3H0G J;  2PJP A;  3GVA A;  2K4J A;  1F4K A;  1UZC A;  2DT6 A;  1Y56 A;  3LAP A;  3E0J B;  2M45 A;  3CDL A;  3LSK A;  5JFR A;  2GM4 A;  1V5G A;  1TT0 A;  3F6O A;  2GAU A;  4HQM A;  3F8C A;  1JHH A;  3BG3 A;  1LKX A;  1WJA A;  1W0U A;  1YI2 I;  3I54 A;  4N4N B;  5D6F A;  3S3M A;  2DA7 A;  3Q0V A;  3FIW A;  3QP6 A;  1U5T B;  1B9M A;  1YJ9 I;  2LR8 A;  4BE0 A;  4RDU A;  2OUM A;  1FZP B;  1R1V A;  2MC4 A;  3PO3 J;  3LA2 A;  1IZ1 A;  3BCA A;  3KEY A;  3Q9V A;  3ZMD A;  1GT0 C;  2R7Q A;  2GXB A;  3L00 A;  3E97 A;  2E2J J;  3R4K A;  1SFU A;  1FBQ A;  4ENN A;  3GTG J;  2BZT A;  1O57 A;  1ZN2 A;  3HGG A;  4XN0 A;  2M1B A;  1H88 C;  1GLN A;  4J00 A;  4I99 C;  2ME6 A;  4ABZ A;  1NK3 P;  3F8F A;  2EZL A;  2YU3 A;  2JPB A;  3E5X A;  1MH4 A;  3K2A A;  4M3B A;  5FJ8 J;  3S15 J;  4RLF A;  2Q1Z B;  3MKY B;  3WG9 A;  4YEL A;  3MWM A;  3CMM A;  2R3S A;  2W82 A;  5DUI A;  2C6Y A;  4BL0 B;  2CV1 A;  3S2D J;  1T2K A;  1HC8 A;  3FIS A;  1W4M A;  1XMK A;  3IHU A;  3QQA A;  4ZH4 F;  3FXQ A;  3OYJ A;  2XKO A;  1LJ9 A;  3TP3 A;  1LFP A;  1T56 A;  4W1U A;  5D5U B;  1JJ8 C;  3OR1 C;  3F0C A;  3OYD A;  1G59 A;  2W1O A;  1VQ7 I;  5JHF A;  1MBG A;  1T6S A;  2P0W A;  1X2N A;  1R5I D;  4AIH A;  2VQG A;  3FZV A;  4PZJ A;  1QZE A;  3VOE A;  1WJ5 A;  1S29 A;  3ABM H;  3HOY J;  3DPT A;  1DPR A;  1BI1 A;  2K9S A;  1TTY A;  2DDA A;  2Y48 A;  1G6N A;  3LWF A;  2X6X A;  2GBY A;  2PMH A;  3M8E A;  5B1A H;  1FYM A;  3Q5F A;  2E60 A;  2E34 A;  1TWA J;  3NAR A;  2QKL B;  3QP5 A;  3CDH A;  4UUS B;  3TOA A;  1ZGA A;  3FHZ A;  1Z67 A;  3Q0W A;  3M1C A;  4DIQ A;  4C30 A;  4OMY A;  4LB6 B;  4O5V A;  5EYR A;  5DEQ A;  5IY5 H;  1C0W A;  2QUF A;  3BTC A;  1IO2 A;  3GBG A;  2TRT A;  5TRD A;  1MNM C;  4G7O F;  2NOJ B;  1JKP C;  2XAU A;  1DP7 P;  4XSX F;  2OTL I;  2VJJ A;  2LY1 A;  2A5W A;  4CCJ A;  1UB9 A;  4ZZL A;  3IAS 2;  2KKO A;  4S0H B;  4HNV A;  2RQQ A;  3HDD A;  3MKW B;  3TKY A;  3IKV A;  1XCV A;  1OCO H;  5JLX A;  3F9K A;  4LB5 A;  2DA3 A;  1S3J A;  2LDU A;  3MN2 A;  1XSD A;  3DXJ F;  1JKR C;  4L9V A;  3AL0 B;  4CA0 A;  2JRT A;  4II3 A;  5CQG A;  3HB9 A;  5F0H A;  4WK8 F;  1SD5 A;  1FTZ A;  1IC8 A;  1E0E A;  5CLS A;  3RPU D;  4HST A;  2XKP A;  1KON A;  2KQR A;  3GME A;  5KHD A;  2HR3 A;  2ZFU A;  2VKV A;  4XMY A;  3WU1 B;  2GQQ A;  2JA7 J;  1MSE C;  3NRV A;  1TP4 A;  2Q2E A;  4MO7 A;  4BEH A;  2IXS A;  3B02 A;  4D7N A;  2VT2 A;  3CMY A;  2BVM A;  1LPQ A;  1WH5 A;  5E1Z B;  1HQC A;  3SZT A;  3TO9 A;  1APL C;  3I71 A;  3R60 A;  3LSP A;  4C2U A;  3KP4 A;  3I59 A;  4KDP A;  3KCC A;  2WA0 A;  1B72 A;  2EIM H;  5J4Y A;  1IDZ A;  4GGG A;  1X1D A;  3HBL A;  3OYM A;  3J7Z I;  2XAF A;  1UCR A;  2HGC A;  3FDY A;  5D4R A;  4KJZ A;  2GA1 A;  4DNC A;  2IGN A;  5DCF A;  4F3Q A;  2ZME A;  3VDX A;  3ZQQ A;  1SFE A;  3TW7 A;  4B43 A;  3PQK A;  4IHX A;  1BA5 A;  3MQ0 A;  2QQ8 A;  4JK1 X;  5LGN A;  2JSC A;  2QBY A;  4X6A J;  1U0J A;  3E6C C;  2ZXI A;  1MDM B;  4NQW A;  1ZG1 A;  1Z6R A;  3IV5 A;  4AC0 A;  2L7Z A;  3MCZ A;  2EK5 A;  3CTA A;  3MAJ A;  1POG A;  2EZI A;  2HXO A;  3EUK L;  1DPU A;  1X3U A;  4CDG A;  1AKH A;  2DOF A;  3VYS B;  4IPA A;  3BRO A;  5EZH A;  3MVP A;  2WAD A;  2H27 A;  4F7Z A;  1EH7 A;  3MFK A;  2HQN A;  2H8W A;  2I5U A;  4IKF A;  1ETW A;  4IL6 C;  2DPU A;  3CME I;  3KYC B;  4XN3 A;  1IN4 A;  4LK1 F;  2IRF G;  3K4L A;  3K1N A;  4GDF A;  3ZMV A;  2OAZ A;  3JAM Z;  4A3C J;  5LD2 C;  2ECB A;  5GAD J;  4ENK A;  4KT5 C;  2R7D A;  4QIW N;  1VQK I;  2A07 F;  3R61 A;  4XLE A;  2MW8 A;  4AIK A;  4BBS J;  2P5L C;  3S32 A;  2Z5U A;  3WU2 C;  4AD9 A;  3ERM A;  5IT3 A;  4HA8 A;  5LHH A;  3CC4 I;  2CG4 A;  1Z6T A;  2KIU A;  1P6R A;  2LTP A;  4Z6Y A;  2ZXH A;  2UZK A;  4Q5S F;  2MH2 A;  3ASO H;  1S8N A;  2P7C B;  1XGM A;  4ZYA A;  4KIF A;  2H6C A;  2V6E A;  4RGX A;  2LLK A;  3TP0 A;  3IH3 A;  3GO5 A;  4GRI A;  1EKE A;  4XNF A;  5J8C A;  4XLF A;  2HYF A;  4XOR A;  1FX7 A;  4Y33 A;  4PK4 A;  2D2W A;  1ZYR F;  3CUO A;  4AYB N;  5EEH A;  5C4J J;  3KZY A;  3J7Y J;  4CZZ A;  2QVO A;  3B6C A;  4GFB A;  2XRL A;  1QNT A;  1I50 J;  1G3Y A;  2VQC A;  3JAM K;  2DMU A;  2IS1 A;  2Z2S B;  3P9I A;  2HTJ A;  4LD5 A;  1E3H A;  3ECH A;  3V8K A;  3ABK H;  2NVX J;  2ZJP F;  2WC2 A;  4BGD A;  4CYC A;  5JVT A;  2H09 A;  4QPQ A;  4XLC A;  5BNG A;  2IA2 A;  4D0P A;  1WPK A;  5LGU A;  2P81 A;  2CQN A;  3RSN A;  4B09 A;  3ABU A;  2CWE A;  1B1B A;  1RET A;  2B63 J;  2RV8 A;  4RAF A;  3GWZ A;  4CYD A;  4G6T B;  3ZN0 A;  1S72 I;  2HDD A;  2ADU A;  2FNA A;  1VQ8 I;  2XF5 A;  3OSG A;  2EZK A;  4EVI A;  3OV8 A;  2NVQ J;  4A3M J;  1P4A A;  5F0F A;  5A2Q Z;  5IYD J;  3AG1 H;  3PQJ A;  3V8L A;  2V1D A;  1Z05 A;  3ULQ B;  4EMS A;  2P6T A;  2M4K A;  3S3N A;  2M0M A;  2X1D A;  3RKY A;  4B3A A;  1DU6 A;  1BM9 A;  1KU3 A;  1T0F A;  3K70 C;  1O7F A;  4PFP A;  2Z33 A;  4E7H A;  1ULY A;  1LEA A;  2FNP A;  4G9Y A;  4E7J A;  1FTT A;  5JR3 A;  4KMF A;  2X6O A;  2H1K A;  3VWB A;  3BTI A;  3BY6 A;  2DDB A;  4ZYD A;  1RIO H;  1AU7 A;  4PSW A;  3I56 I;  4ON0 A;  1XD7 A;  3F6V A;  2R0Q C;  3C7J A;  1SFK A;  1VF9 A;  2E71 A;  3GXO A;  2MA3 A;  1T08 B;  4II2 A;  3L2R A;  1VFC A;  3ZMT A;  4NC8 A;  3Q0U A;  4HOB A;  4GYG A;  3QWL A;  4IHW A;  5BOX A;  3K4C A;  4E6K G;  1YIJ I;  3F8N A;  1QA6 A;  2P8T A;  3TO7 A;  3DFG A;  5A2Q K;  5F64 A;  5B5E C;  2VXD A;  5FRM A;  4UB6 C;  4UB8 C;  1GXP A;  4F93 B;  1MMS A;  1WGX A;  2EFO A;  4PUS A;  2O6G E;  3WTW C;  4BQA A;  2A5Y B;  1XB4 A;  1FC3 A;  2RQP A;  4NBQ A;  3R6S A;  1QRY A;  1FJL A;  3ZQL A;  2DA6 A;  4JBA A;  4X1E A;  4DBR A;  2E2H J;  2LYC A;  5FD6 A;  1SMY F;  4ZYH A;  1DQU A;  3ZN1 A;  1S5L C;  1SFO J;  4ZC3 A;  5E17 F;  5HNF A;  1VQP I;  3RCO A;  3U9G A;  1VQM I;  3AAF A;  1REP C;  5FKM A;  1NG7 A;  4QTR A;  3F3X A;  2YSR A;  1Z7U A;  3E7L A;  1LUJ B;  3TO6 A;  4UUS A;  1ZGW A;  1BN5 A;  5DUK A;  3SFZ A;  2WV0 A;  4MIM A;  2OCC H;  4GXO A;  1KQ9 A;  5L3D A;  4P9F A;  3DP7 A;  3S1Q J;  5HLT A;  1TW2 A;  3SJM A;  4M3G A;  2IS4 A;  4NC7 A;  1JTY A;  1QU3 A;  3LA7 A;  4UV8 A;  1IV8 A;  2LY2 A;  3B6A A;  3MKZ A;  4UUV A;  2CRG A;  1HSJ A;  4WX9 A;  2ZCW A;  3M8J A;  3HGY A;  3SDG A;  3BZC A;  1ZTR A;  1ODD A;  3VYU B;  4XRS G;  2KMU A;  3GFM A;  4N4O B;  3ESW B;  4HAM A;  4U88 A;  3FKJ A;  4YIF A;  1IW7 F;  2F4I A;  5CKT A;  3D5R C;  3NQO A;  2HPI A;  2AQF A;  2JVH A;  4QLC U;  1XG1 A;  1RI7 A;  2GZW A;  3JRF A;  1E17 A;  1HDP A;  1A35 A;  3V7R A;  3BOQ A;  3ZR8 X;  2Z1D A;  2B9S A;  4IHY A;  4IHT A;  1WWX A;  1WI9 A;  1T95 A;  2HOA A;  3RTR A;  1BR4 A;  2E19 A;  4RGU A;  2BY3 A;  3C2B A;  1ZR2 A;  2XVC A;  2WAQ A;  1KU7 A;  2HWV A;  4BAC A;  2O9L A;  3EUH A;  1TQI A;  2ZBK A;  1MBK A;  5HDG A;  4MGR A;  3HG9 A;  2O3F A;  3P9K A;  5E18 F;  4ASN A;  3CCV I;  1HW5 A;  1PJR A;  3FXJ A;  1K4T A;  3O8G A;  4MTE A;  2EV5 A;  3HOU J;  1RNL A;  4BBR J;  4KT6 A;  2DMN A;  5FB2 A;  2BGC A;  2L9S A;  2MG4 A;  3K9T A;  4M3F A;  1WJF A;  2QWW A;  4IF4 A;  4A3I J;  1YW7 A;  1GV5 A;  1SC7 A;  1MW7 A;  2VB6 A;  4RM3 A;  4ESJ A;  5IT9 Z;  1USS A;  4ZJZ A;  4GYI A;  3QPS A;  2GLO A;  4Y7N J;  3KZZ A;  4PGH A;  3QU3 A;  5F6F A;  5GPC A;  3LOC A;  4O3M A;  1FMV A;  3BG9 A;  4R1H A;  1WI3 A;  2BBY A;  3BG5 A;  3NEU A;  3F8B A;  5E3O A;  4YFN F;  2BEO A;  1A31 A;  2X4H A;  1HW1 A;  5FFZ A;  4DGW B;  1UJ8 A;  4QSH A;  3G4S I;  2Q2E B;  1VTN C;  4BEH B;  2HVS A;  2V1U A;  1ACI A;  2LD5 A;  2K9M A;  2HTS A;  3G1O A;  1YJN I;  3FXL A;  4P5O A;  3LSH A;  4L9J A;  2FMY A;  1X3Z B;  2VBW A;  2X0L A;  2RRE A;  2XRN A;  2V26 A;  3MZH A;  3W6V A;  1R5G A;  2MGQ A;  3A0B C;  2BYV E;  2WWY A;  2W85 A;  3I59 B;  4U7D A;  1B72 B;  2DFH A;  3TDU C;  2CSO A;  1M1E B;  2CU7 A;  4BS9 A;  1K4S A;  4HRI A;  3J81 Z;  1UEL B;  2UUZ A;  2V9V A;  5FGM A;  1YHQ I;  2STW A;  1R22 A;  2KZV A;  5IT9 K;  3W2W A;  1SD4 A;  4N0B A;  2VE8 A;  4WCG A;  4EGY A;  2ZO4 A;  3WTZ A;  1WH7 A;  1WCM J;  2OC6 A;  5IP6 A;  1BL0 A;  2A68 F;  4I98 B;  2DYR H;  1D1A A;  5KNL A;  1CGP A;  1SVM A;  2DI3 A;  2ZME B;  3K7A J;  2VLA A;  2HOT A;  1YO5 C;  1T98 A;  4IX7 A;  4BY1 J;  3KEO A;  2QEX I;  2WB1 N;  1E3P A;  3JSO A;  2Y0M A;  4OIO F;  5EJC A;  2A61 A;  2BY1 A;  4HPQ A;  2CO5 A;  4HZF A;  4BU2 A;  4FCY A;  3GFI A;  2AO9 A;  4ZDO A;  1JUS A;  5TIS C;  2LF8 A;  2X1C A;  3GFJ A;  4NQW B;  2TCT A;  4PJJ A;  4EM2 A;  2CS3 A;  3EET A;  4FIS A;  5DD8 A;  1WVR A;  2KLO A;  2WAF A;  5KK1 A;  4L9N A;  5M3F J;  1PP7 U;  1H8A C;  5K5O A;  1I6H J;  4DBQ A;  3CJQ B;  2Y0S A;  2R7O A;  2A69 F;  4FE7 A;  1HST A;  1JKQ C;  4LLG F;  1XCB A;  1AKH B;  2XSD C;  2L01 A;  1ZKG A;  3CLO A;  3DBH B;  4L0Z B;  1F1Z A;  4ANJ A;  4FHT A;  3J81 K;  5TJJ A;  5L3F A;  2L4M A;  2DOE A;  1TL8 A;  2E1O A;  2M87 A;  4LGW A;  1EV7 A;  4KIC A;  4MFE A;  2HOS A;  4YEJ A;  3LSI A;  2CQ7 A;  5E1X A;  1TLH B;  3H36 A;  3WTY C;  2KP6 A;  3HRU A;  1XMX A;  3VEP A;  1XDS A;  1FIA A;  4XBF A;  3NWS A;  2L2O A;  5HLG A;  3F72 A;  5FLM J;  3RI4 A;  5CVJ A;  2KRC A;  3LMM A;  3OR2 C;  3K1M A;  4YFX F;  3K4J A;  4UUT A;  2F5V A;  3BWG A;  3FHN A;  1TW3 A;  5K7F A;  3OMY A;  4P96 A;  4Y17 A;  4A0Y A;  4B4C A;  5H20 A;  3LA3 A;  1GVD A;  3ZQG A;  2XAH A;  3KE2 A;  5D6E A;  3LQQ A;  3L2U A;  2CMP A;  2DK8 A;  1IJW C;  3LSR A;  4FX4 A;  4B48 A;  1SAN A;  4XLP F;  3SEQ A;  5DD4 A;  1P9Q C;  3CJT B;  1WFX A;  5ICG A;  4RGR A;  1JI8 A;  1OQY A;  4HX7 A;  1OCT C;  3E5Q A;  1IF1 A;  3M8F A;  1S7O A;  2DMT A;  3ONQ A;  4JOM A;  2VOD A;  1T33 A;  1ETV A;  3VYR B;  1A5J A;  1ZRD A;  4CYC B;  3TED A;  3TGN A;  2B0L A;  1JGG A;  3AG3 H;  1RKT A;  2QKM B;  4LK0 F;  2VUM J;  2ELH A;  5GTI C;  4U0Y A;  3QAH A;  2L9V A;  2L5Q A;  1I6X A;  3GW2 A;  2O03 A;  2PX9 A;  2XPU A;  2OCE A;  3I4N J;  2BE5 F;  2XIG A;  5D5W B;  2M8E A;  1LNW A;  2FQ3 A;  2G0E A;  2O8X A;  2OZ6 A;  5AIP A;  1VQ4 I;  3RKQ A;  2DQL A;  4XOT A;  1OLT A;  2LH9 A;  4N9I A;  1A04 A;  1R00 A;  2IP2 A;  5ILV A;  2ZFW A;  3BZ6 A;  2QSG X;  1U5T C;  2L7M P;  1J09 A;  4A3K J;  2WTE A;  5FKO A;  3BR6 A;  1SMT A;  3HKZ A;  3ISP A;  4PJM A;  2X48 A;  3HRM A;  4E7I A;  3R0A A;  4EM1 A;  1F9N A;  3JRD A;  2QCO A;  2OQR A;  3K10 A;  4IHV A;  3DWL E;  3FXU A;  5HNH A;  1OIS A;  5FFX A;  1XGN A;  3KP3 A;  2XF7 A;  3DTK A;  3KLO A;  4QPO A;  2DO7 A;  2WAQ N;  2MSY A;  5L3C A;  1IN5 A;  2ZNY A;  2XAJ A;  3CF5 F;  3H3V K;  1VQ5 I;  2EZH A;  3OS0 A;  1X4O A;  1DP3 A;  1N25 A;  2E1C A;  1OR7 C;  1LB2 A;  4CO8 A;  1P92 A;  4A12 A;  2NOG A;  3FMR A;  1JKO C;  2M5W A;  1ZG5 A;  2GOX B;  4RAG A;  1ZRE A;  4PJN A;  1ZRF A;  3HOS A;  2H94 A;  1Z3Y A;  1T38 A;  3J7A Y;  3DEU A;  3EQL F;  3FM3 A;  3ZQI A;  4OU0 A;  1XMA A;  1TT5 B;  3CUQ A;  3MZY A;  2JMW A;  3N4M A;  2IPQ X;  2ZJQ F;  2JN6 A;  3H9J A;  5HLI A;  2DJI A;  2COB A;  3V7S A;  2PMZ N;  4G12 A;  3U1D A;  2EB7 A;  2Y75 A;  4RB3 C;  3L2Q A;  3LFK A;  3CO7 C;  2LG4 A;  2H6B A;  2ACJ A;  2QQB A;  5DV5 A;  1YX5 A;  3LSG A;  1OCZ H;  2FML A;  4DYR A;  4OWR B;  3ELK A;  3H92 A;  1HF0 A;  2DPD A;  3WGI A;  2W24 A;  2DU9 A;  3VB2 A;  1IRZ A;  1O4X A;  2NXN B;  4LIT A;  3MZ8 A;  1GHC A;  4RS8 A;  2DXI A;  2QSH X;  3D5L A;  4BY7 J;  4DW6 A;  3HSF A;  1O3T A;  1K78 A;  4XM3 A;  1DGW Y;  4JX5 A;  2HXI A;  2NAZ A;  3JRC A;  5D8K B;  1GDT A;  3H5N A;  3M9A A;  5J8F A;  4D1Q A;  2IS2 A;  1V4R A;  3A02 A;  3DV8 A;  2FF4 A;  4NC6 A;  2VQH A;  1FYL A;  4WXC A;  1MJA A;  4FET A;  2EIK H;  4YRV A;  1JGS A;  1MBH A;  4NNJ A;  2IGK A;  1AHD P;  2JWT A;  1R1U A;  2F6C A;  2BY2 A;  4LMY A;  3BP8 A;  3ZGK A;  4IEJ A;  3G1M A;  5AON A;  1FP1 D;  3MKL A;  4HX4 A;  3T8T A;  3M7G A;  4XIC A;  3IRR A;  3KET A;  4UY8 I;  3AL0 C;  3CCQ I;  4CHU A;  4U7B A;  4A6E A;  4I7H A;  2JJ7 A;  1FYK A;  1ITY A;  3QOD A;  3PIO F;  1PUF A;  4IVN A;  2EH3 A;  4M9X A;  3DLL F;  4C3H J;  1I5Z A;  1XGS A;  2VC1 A;  4H4K C;  2A6T A;  2E7W A;  4XL9 A;  2E5N A;  1LFU P;  2DTZ A;  3GTJ J;  1FWZ A;  5IP9 J;  3OYH A;  5E3M A;  2E36 A;  2G7H A;  2ZSH B;  3BPV A;  2RGV A;  1R49 A;  2HVQ A;  2STT A;  3KIO A;  1QHH D;  4L0Y B;  1L0O C;  4IJA A;  2F4O B;  3C18 A;  1MH3 A;  1TWC J;  1R1T A;  4OMZ A;  3W2A A;  4BQO A;  5DM6 F;  2EIJ H;  1S6L A;  1LFB A;  2L7K A;  1FBU A;  5FLX K;  5CVI A;  3RPQ A;  1WJC A;  3I3L A;  5E8I A;  3H9G A;  2VJ4 A;  4MHG A;  2Z3Y A;  2LNB A;  5D5V B;  1OPC A;  3N97 A;  1YS7 A;  3L2W A;  4NHJ A;  1LDJ A;  1ZAO A;  2JUC A;  1DU0 A;  3U2R A;  5F08 A;  1R5H A;  4FTH A;  3A01 A;  4PCQ A;  1ZLK A;  4M71 A;  3A4C A;  2DCE A;  3D5S C;  1MJ9 A;  2HPM A;  3E6B A;  2NVT J;  2E35 A;  2V9P A;  1FT9 A;  2OBP A;  3HPH A;  4IRH A;  3CES A;  2ZC2 A;  5DCM A;  3QPH A;  4HX8 A;  3SZP A;  1W1W E;  1F43 A;  1ZLJ A;  1MKM A;  3M4O J;  5H6Q A;  3E5U A;  3S2W A;  5IOY A;  3OIP A;  3JRB A;  3KEQ A;  5BS6 A;  2RNJ A;  2FJ1 A;  2F5C A;  2XSJ C;  2E1M B;  2MC3 A;  4AVZ A;  1WQ2 A;  4B47 A;  3K4K A; 
#chains in the Genus database with same CATH homology
 3BCB A;  3A1Y A;  1NG7 A;  3PJR A;  2CUZ A;  1AA7 A;  1V5E A;  1UG0 A;  4B44 A;  1MMN A;  5TGT A;  4F91 B;  2PJR B;  4HNU A;  1TZL A;  3QYE A;  5HLT A;  2R7W A;  1N75 A;  2LOO A;  2IS4 A;  4NC7 A;  1BOB A;  4RMN A;  2HU9 A;  1QU3 A;  2K3P A;  3OYN A;  3H35 A;  2IGO A;  2LY2 A;  4XLA A;  3S93 A;  3MKZ A;  5FRN A;  4ZDP A;  2BOL A;  2M3A A;  4P1W A;  2JA2 A;  2K5C A;  2Z16 A;  4PSX A;  4XKB A;  3M8J A;  2LBF A;  1DGR M;  3PFY A;  1ZEL A;  1D0Z A;  3VYU B;  3S3O A;  2KMU A;  2LRD A;  3DKX A;  4N4O B;  1W36 C;  2JSP A;  3U21 A;  2CV0 A;  3FKJ A;  3ZXS A;  3H9Q A;  2R7X A;  4KIS A;  4XLH A;  2F4I A;  1MND A;  4XR6 A;  2X85 A;  1X4P A;  3D5R C;  4OAZ A;  2DOA A;  5CKT A;  2HPI A;  2AQF A;  2JVH A;  2KPM A;  4KIT B;  1VZ0 A;  3UR3 C;  2ELJ A;  2IGM A;  4BJT A;  3ZR8 X;  4E7K A;  2Z1D A;  3OOU A;  2WBM A;  1T95 A;  2I8D A;  3RTR A;  1BR4 A;  2V9K A;  2CW7 A;  3PL8 A;  2WAQ A;  4LIU A;  4BAC A;  1N78 A;  3OL3 A;  2R7S A;  3DU6 A;  4BE1 A;  3K4N A;  3HG9 A;  1PYV A;  3DKY A;  3PNY A;  4OAY A;  4ZDL A;  2VPL A;  1PJR A;  3K70 D;  4KT6 A;  3K4M A;  2L9S A;  1WJF A;  3N05 A;  3VSL A;  4BE2 A;  4PJL A;  5LFA A;  3IAM 2;  2DT6 A;  2WY8 Q;  1Y56 A;  4AU7 A;  3EUH C;  3E0J B;  3LL7 A;  1BR1 A;  1MW7 A;  1X1B A;  2VB6 A;  4PFO A;  4RM3 A;  3V42 A;  2BW3 A;  3LSK A;  2CH0 A;  2CW8 A;  3HXL A;  4ZJZ A;  1V5G A;  1TT0 A;  4CCM A;  4DJA A;  1LKX A;  1WJA A;  3EUA A;  3TMO A;  4N4N B;  3SYT A;  1FMV A;  3QOE A;  3AKZ A;  4F55 A;  3KYL A;  3S3M A;  1Z3X A;  4BE0 A;  4C2T A;  3KX2 A;  2OUM A;  4DGW B;  2V1N A;  2HVS A;  2MC4 A;  2Q2E B;  4BEH B;  3OYL A;  3KEY A;  3BCA A;  1WJE A;  4ITV A;  2K9M A;  3DQV C;  2R7Q A;  4P5O A;  3LSH A;  2K9L A;  5CQE A;  3HOT A;  3FBN B;  2RRE A;  3C2H A;  2V26 A;  4LG3 A;  1IRX A;  4XN0 A;  1GLN A;  1ERD A;  4J00 A;  3OYB A;  3UNG C;  4FAS D;  4BS9 A;  4HRI A;  2HDW A;  1UEL B;  4CSW A;  2MD0 A;  2UUZ A;  3TBI A;  3ZCO A;  2KZV A;  2M7A A;  3W2W A;  3E1S A;  2CFO A;  2VJI A;  4RLF A;  4IQ4 A;  2Q1Z B;  4XQF A;  2OC6 A;  4XON A;  3MKY B;  4E7L A;  1D0X A;  1D1A A;  4YEL A;  3CMM A;  5KNL A;  2W82 A;  2VJ5 A;  2VLA A;  2CUJ A;  4BL0 B;  4CUG A;  4IX7 A;  2CV1 A;  2PJR A;  2E1M C;  2HVR A;  4HPQ A;  3OYJ A;  4BU2 A;  4ZDO A;  1LFP A;  2XDV A;  2X1C A;  4NQW B;  4PJJ A;  2CS3 A;  3OR1 C;  2WAF A;  2KLO A;  2W1O A;  3OYD A;  1G59 A;  2ZSI B;  4DBQ A;  3CJQ B;  1WJB A;  2P0W A;  2Y0S A;  5JHF A;  2R7O A;  5HOO A;  2VQG A;  4HSR A;  4ANJ A;  1WJ5 A;  3DPT A;  1YX3 A;  4ZTJ A;  3LSM A;  3H0D A;  1MMA A;  1W36 D;  2W00 A;  3OYC A;  4YEJ A;  3CJR B;  3LSI A;  2X6X A;  2KL4 A;  5HVQ C;  1WJD A;  2KP6 A;  1MNE A;  4IQJ A;  1SAU A;  2E60 A;  2L9N A;  2XF6 A;  3QYB A;  3PSF A;  2BVL A;  2QKL B;  3PUB A;  3OYI A;  3HUG B;  3M1C A;  3NWS A;  2L2O A;  4DIQ A;  2IS6 A;  2MYS A;  4C30 A;  1S9H A;  2KRC A;  3LMM A;  3OR2 C;  1MMD A;  3K4J A;  2VXZ A;  3GBG A;  2KHM A;  2F5V A;  2NOJ B;  3FHN A;  2XAU A;  4CH7 A;  2VJJ A;  2M7B A;  3OMY A;  2LY1 A;  4CCO A;  1Z7L A;  2A5W A;  4CCJ A;  3OL4 A;  1HA8 A;  4CCN A;  3IAS 2;  4Y3O A;  3L2U A;  2CMP A;  2RQQ A;  3K6G A;  3MKW B;  3RCO A;  4B48 A;  3FBI B;  3SEQ A;  1P9Q C;  1WFX A;  3F9K A;  3DTE A;  1JI8 A;  3AL0 B;  4CA0 A;  2HNH A;  4II3 A;  5CQG A;  1NG6 A;  3ONQ A;  3VYT B;  4JOM A;  3VYR B;  4BJ6 C;  1E0E A;  4MLO A;  3RPU D;  4HST A;  3SZG A;  1KON A;  2KQR A;  2QKM B;  3SDB A;  5KHD A;  4CCL A;  2ZFU A;  3OYK A;  4XMY A;  2L5Q A;  3W2V A;  2O5R A;  4J01 A;  1N77 A;  4U87 A;  1QHG A;  4BEH A;  2KDO A;  1K6Y A;  2WB1 A;  1MMG A;  4BDZ A;  2IXS A;  2BVM A;  4XOT A;  1OLT A;  2LH9 A;  3DLA A;  4E7S A;  4C2U A;  3DPL C;  2DT7 B;  2WA0 A;  1UAA A;  2GOM A;  2KRH A;  1J09 A;  4JQF A;  3HKZ A;  1X1D A;  4PJM A;  4RM2 A;  4XKC A;  4E7I A;  4E7Z A;  3OYM A;  4XKW A;  3C2G A;  4LIV A;  4DOZ A;  3FDY A;  3ZRG A;  2MAB A;  4KJZ A;  2OV7 A;  3K10 A;  3DWL E;  5HNH A;  4F3Q A;  2IGN A;  4BJ5 C;  1X19 A;  3VDX A;  3ZQQ A;  4B43 A;  2XF7 A;  3DTK A;  4QPO A;  4E4H A;  3W3C A;  1D1C A;  1U0J A;  3OS0 A;  1X4O A;  1DP3 A;  2ZXI A;  1OR7 C;  1X1C A;  4HNT A;  4B3X A;  4HEA 2;  2CV2 A;  4BQN A;  2R7R A;  2GOX B;  4PJN A;  3EUK L;  3CP8 A;  3HOS A;  2R7V A;  1Z3Y A;  4ZTF A;  1FMW A;  3CZ6 A;  3J7A Y;  2X51 A;  3VYS B;  2WAD A;  3OWT A;  3VSK A;  3DU5 A;  3BG7 A;  4IKF A;  3IUO A;  3H9J A;  2DJI A;  2R4G A;  4XN3 A;  3TL4 X;  4EAT A;  3K4L A;  4BUP A;  3L2Q A;  5LD2 C;  2LG4 A;  3L2V A;  2W7N A;  4RLQ A;  4XLE A;  1YX5 A;  3LSG A;  3S32 A;  3DEE A;  3NWT A;  4OWR B;  2ZXH A;  3OYA A;  4ZYA A;  2V6E A;  2LRE A;  2VAS A;  3CF2 A;  2WAE A;  4GRI A;  4XNF A;  2JUG A;  4C9Y A;  4XLF A;  4LIT A;  2M4G A;  4XOR A;  2DXI A;  4Y33 A;  3D5L A;  4PK4 A;  2WY7 Q;  3BC8 A;  4XM3 A;  2FUG 2;  4XKV A;  1DGW Y;  3DTI A;  3G2B A;  3HC7 A;  3RQ4 A;  2V7F A;  1YE9 A;  3H5N A;  4D1Q A;  2IS2 A;  2VQC A;  3PNT A;  2IS1 A;  2Z2S B;  3QYF A;  3MD2 A;  3PSI A;  2LBF B;  5KCM A;  1R6R A;  2VQH A;  2X1E A;  5FRO A;  2XC7 A;  4NUB A;  2RNG A;  3S8P A;  4FET A;  4YRV A;  4R79 A;  4BGD A;  4NNJ A;  2IGK A;  4QPQ A;  1V5F A;  1D1B A;  4XLC A;  2F6C A;  3OYG A;  3H5A A;  3ZGK A;  3K4B A;  3RSN A;  2HQA A;  4X0G A;  3I9V 2;  3OYE A;  3AL0 C;  4U7B A;  2VKH A;  5CPR B;  3QOD A;  4D9J A;  3OY9 A;  4G6T B;  4IZZ A;  4H4K C;  3OIQ A;  2A6T A;  2JVG A;  4XL9 A;  2E5N A;  2XF5 A;  2W4S A;  4F52 A;  3OYH A;  2X6W A;  3BG6 A;  1LDK B;  2ZSH B;  2HZD A;  4XOP A;  2VQL A;  4BXF A;  2HVQ A;  1BR2 A;  2X6Y A;  1QHH D;  3AFH A;  2MFZ A;  3CP2 A;  2M4K A;  3OS2 A;  2M0M A;  3S3N A;  2X1D A;  2R7T A;  1LVK A;  3OS1 A;  1G8X A;  1Z21 A;  2LC2 A;  2PMZ A;  3K70 C;  4BQO A;  3HL2 A;  3W2A A;  2L7K A;  4PFP A;  3EPZ A;  4E7H A;  4E7J A;  1X1A A;  3H5R A;  1WJC A;  3I3L A;  3VWB A;  2E5Z A;  2VJ4 A;  3H9G A;  2BW3 B;  4PSW A;  4Y4R A;  3L2W A;  4CCK A;  1SFK A;  4II2 A;  3L2R A;  4F92 B;  1T0F C;  3PNV A;  4NC8 A;  3SEZ A;  2V4J C;  3DPU A;  3A4C A;  3HPG A;  2DCE A;  3K4C A;  4E6K G;  2UWM A;  3D5S C;  3BLY A;  4BDY A;  2HPM A;  3HPH A;  2VXD A;  5FRM A;  3A2K A;  2UV1 A;  3OYF A;  3CES A;  4F93 B;  4PUS A;  4BQQ A;  3IP4 B;  3LFU A;  4AYB A;  3MMY B;  1EA3 A;  1D0Y A;  4CZC A;  2R7U A;  4DBR A;  2AQE A;  2VL8 A;  2LYC A;  3OIP A;  1DQU A;  4HG2 A;  2VIX A;  2VKD A;  1Y6I A;  2E1M B;  2XSJ C;  4ZC3 A;  4AVZ A;  5HNF A;  4B47 A;  3K4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...