1VQPI

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vqpI00
3CMAI 3CC2I 4IOAF 1VQOI 1YIJI 3CCSI 2E35A 1FOWA 4V19K 3I55I 1ACIA 3CMEI 3J7ZI 1S72I 5GAGJ 3CCLI 3I56I 2OTLI 2QA4I 1VQ4I 3PIOF 1VQ5I 2OTJI 3G6EI 4UY8I 1YJ9I 3CCUI 3CD6I 5GAEJ 3G4SI 1VQPI 2ZJQF 5DM6F 2QEXI 1HC8A 1FOYA 1FOXA 5DM7F 1VQ7I 3PIPF 1YJWI 1VQLI 5GADJ 2ZJRF 1VQMI 1VQ9I 2NXNB 1YI2I 2FOWA 2H8WA 1MMSA 2ZJPF 3CC4I 3CCJI 3CJTB 1VQNI 3CCMI 3G71I 3CCRI 1VQ6I 3CCVI 1Y39A 1YJNI 2K3FA 3CCQI 1VQKI 1VQ8I 2E34A 3CCEI 5GAHJ 3DLLF 1YHQI 2E36A 1QA6A 3J7YJ 2JQ7A 4IOCF 1YITI 4IO9F 3CF5F 3CC7I 5JVGF
chains in the Genus database with same CATH superfamily
3QWLA 4D5FA 4IOAF 2Q0OA 1MGTA 4XLNF 2ZMEB 3FX3A 3JRFA 3ASOH 2UZKA 3CCSI 2NVQJ 1W5CC 2RREA 1FOWA 3LSGA 2QBYA 2JTVA 2NOJB 4GCVA 2KDZA 5E8IA 3PFIA 2DT7B 2LKSA 4AU7A 5JVTA 1WPKA 3M3YJ 4V2FA 4LD5A 1YRNB 3G1LA 3AAFA 1GV5A 4EVIA 2H8RA 4P96A 2DI3A 1VQ4I 2BY2A 1UB9A 2EWNA 2IGNA 3MQ0A 1LEBA 4MQVA 2X85A 4PFPA 3HEFA 3PO3J 3EETA 1AWCA 2JSPA 4OIRF 1BA5A 1T0FC 4FE4A 4BKXA 4RDUA 4QLCU 1Y8QB 2ZXJA 1TNTA 3GTMJ 2FE3A 2DQRA 3JRAA 2ZJ2A 3CCUI 5EF6A 2R7ZJ 2JA5J 1FMWA 3CUOA 4AIHA 2XRNA 2VBYA 5CQGA 2M34A 2H94A 4Y52J 1GDTA 3TP3A 3MZYA 4MGRA 2Y31A 2IA0A 2QCOA 4KMUX 4YFNF 5K7HA 5GPCA 4ZZLA 1VQ7I 3C18A 4I0BA 2W24A 3PIPF 1FOKA 2CUZA 4RB1A 2HXIA 3OR1C 5GADJ 1JGSA 1KU7A 2EA4A 1OYWA 1A35A 2LYCA 2FOWA 1GLNA 4M9ZA 3V4GA 2O3FA 1Z0XA 4KICA 1ZLKA 3SZTA 1MBGA 2KZVA 2JVGA 3IAS2 3J80K 2EV6A 4BXXJ 1IN8A 1MBHA 4A3GJ 2PN6A 4UVBA 3M9AA 4B4CA 4C3HJ 5E18F 1G6NA 1J5YA 1XGNA 2DMPA 3IV5A 4M3GA 2PFBA 5LGUA 4CCNA 2HTJA 2L7ZA 2JRTA 1DGWY 1PP7U 2E34A 1IAWA 2QQBA 2QZ8A 3W2VA 4HRIA 1LFPA 3CJNA 1JKOC 3I4MJ 5A2QK 4CDGA 3K6GA 4KIFA 4M72A 4XOPA 1BR4A 1EV7A 4U7BA 2PEXA 1W36D 3GTKJ 3LSHA 4ENNA 2UV1A 1LVKA 1MDMA 2MLKA 3DEEA 3DTIA 2UXNA 2BBYA 2P7VB 5CPRB 2PBIA 3OYCA 2HOAA 2XAQA 2YU3A 1DGRM 1YG2A 2F4IA 4GGGA 4PZJA 1JUPA 4A5MA 2R7XA 1T8IA 3GXOA 1G59A 4UV9A 2G0EA 5CLSA 1XGOA 5FKKA 3CMEI 5LEJA 1GHCA 2VJIA 4FQGA 4CCOA 3JTHA 4PSWA 2X1DA 1X1AA 2EQRA 4NNJA 3RQ4A 3LQQA 1SFKA 3REOA 1Y56A 1FYKA 5H2FC 4XR6A 2QGUA 1J9IA 1IN4A 3S1QJ 1OCRH 5HODA 2HYGD 4LLNA 3WTSC 1S7EA 2DA2A 2XAUA 4LJZF 5CQEA 4WF2A 1M1EB 1R6RA 1MH4A 2ECBA 2PG4A 3ASNH 1YFHA 2ID3A 1FBUA 3RKWA 3ZMVA 3HDDA 2XAFA 1V5FA 3H9GA 5JR3A 2Y2ZA 1OCTC 4HBLA 3U1DA 1IJWC 1OFCX 1W1WE 3FMSA 3FK7A 4NBQA 4IQJA 1RKWA 4M9SA 4C2UA 1LDDA 2LR8A 4EM0B 5D4SA 1B59A 3BZCA 2XPUA 2IAIA 2V1XA 2L0KA 1YJWI 5TRDA 5L3BA 1ETWA 4BJ6C 2Z16A 3ECOA 2HI3A 5KVRA 3MEXA 2OD5A 1AKHB 3B73A 1WJFA 2R0QC 1ZR2A 2V9VA 2STWA 2BY3A 4XNFA 2CW0F 2XHKA 4FX4A 5ICFA 3ZQCA 4G8XA 3CJTB 3KX2A 3S3MA 1T6SA 1VF9A 2ICWG 4XKVA 3GTQJ 3ZXSA 3M07A 4RAZA 2XROA 2FUG2 4EGZA 2HYJA 1U5TA 4FT8A 2ETHA 2R3SA 3GZ5A 5E3NA 1R7JA 4M3BA 3BJAA 2LG4A 2WWYA 2LH9A 3WG7H 3JRCA 2HEOA 3GTGJ 2BGCA 2XAGA 1W0TA 1T33A 2CQ7A 3S8PA 2V1UA 4IZZA 5ED4A 5D5XB 2NS8A 3A0HC 4V2GA 4I7HA 5K5OA 2ELKA 3FK6A 3KP5A 1P92A 3QU3A 2IS4A 4RAYA 4EEFG 5FB2A 2X9DA 3HTUA 1IZ1A 4AM3A 2HDWA 2XPWA 1KQ9A 3DPLC 3FXQA 1V55H 5CVRA 3E5UA 4A0YA 2GWRA 3F3XA 3HHGA 2CRGA 1KGSA 3S2WA 1P6RA 3OYAA 1DPUA 3GFMA 1FYMA 3FXUA 1XN7A 1YS7A 2M4KA 2KKOA 4D9JA 4BACA 5LHHA 2XVCA 2BEOA 5LLQA 4AIKA 5C4XJ 2WTEA 2DDAA 2Y0MA 3CP8A 3E6CC 2GXAA 4FHTA 2QVOA 4GRIA 5CVJA 4CCMA 4A93J 4GO1A 2GOMA 1OR7C 2LFBA 1E0EA 2DMQA 3GYHX 3FF5A 3O8GA 5IT9K 4D5CA 1BI2A 2D45A 1BI3A 1OMIA 1TT5B 1L0OC 1UELB 3DLAA 4RLQA 5JHUA 3I54A 2VN2A 2E7WA 2KT0A 3V7RA 4IHXA 2YR2A 4L5JA 4TV7A 4UB6C 4M3DA 4L9VA 3RI4A 1R1TA 4HG2A 2LF8A 3DCFA 4IL6C 4RS8A 2VJJA 1NK3P 1Z05A 1IV6A 2M5WA 3VYRB 3QRFF 2DFEA 3M1CA 3MAJA 3JRHA 2HR3A 1UJ8A 4XIDA 4M6VA 1E3PA 3HOXJ 4UVCA 4XKBA 2GQQA 2JK3A 1RETA 4HEA2 1W5SA 3F21A 3T8TA 4MQ9F 5DTDA 1ODDA 3MVPA 3H5AA 4ZYEA 3OYNA 1JGGA 1YI2I 4HNVA 3K4JA 1FTTA 1OJLA 2VQCA 3SHFA 1P7IA 1OYYA 1QHHD 2EILH 3H3UA 2DO7A 3ZQ7A 2XRLA 5DCMB 1MMNA 1D8JA 2EFNA 2Q8KA 1JTXA 2E2IJ 1SFUA 2HU9A 1X3WB 2KQRA 5E20A 1IN7A 1TQIA 3CDLA 3E0JB 4YIRX 4DZPA 1PDNC 2V1DA 3OOUA 1B72A 2HS5A 3HOUJ 1GV2A 1TZLA 4FCYA 2E36A 4P9FA 3CCYA 4XLHA 3GX4X 3OYFA 3HPHA 2R93J 1O7LA 5FGMA 2MFZA 2LOOA 1R58A 1GVJA 5M5YJ 3ZMZA 4Y4RA 3E6BA 2LKPA 4E7IA 4JK1X 3F72A 4DW6A 4MIMA 4GXOA 4XK4A 1RESA 1MKMA 4DOZA 4JQFA 2QQ9A 4ESJA 2VKVA 2XGDA 4PK4A 3P7NA 2LLKA 3OYGA 5IT3A 1F43A 2KIUA 4LB5A 4BBRJ 2V9KA 2R5YA 1OPCA 3E5QA 1FNNA 4F52A 3J81Z 2PX9A 1R5ID 2IS2A 5BS6A 1Y1VJ 4BJTA 1MMDA 5F08A 1G3YA 4XRFA 2VC0A 2CMPA 1LDKB 3WGGA 1BN5A 3AKZA 1HCRA 3ZQFA 2PMZA 4P1WA 3GFLA 1VQ5I 4HF2A 4Q4ZF 4G6TB 1SVOA 4E4HA 5EZHA 1ZELA 5K7FA 1V4RA 2RQQA 2LREA 3OYBA 2JA8J 1JJ8C 3QYEA 5J3LA 5EGOB 3E6DA 4HLXA 1ERDA 2M45A 4XKWA 1QQIA 2HQNA 2NVXJ 1OCPA 3CD6I 4K2EA 1ZR4A 1QO0D 5LRRA 1RUNA 1VQPI 2VASA 2ZXWH 2W25A 2DOFA 5ILVA 1MH3A 1VI0A 2PJPA 2M4GA 1FOXA 4EGYA 2R7OA 1U78A 1U0JA 3SDGA 4XKCA 3S15J 1JXSA 4KN7X 3GBGA 1R5GA 5DEQA 2FNPA 4WXDA 3OYLA 3IKTA 2CYYA 1DQUA 3GWZA 1YIOA 1LQ1A 3JRGA 4A3CJ 5AIQA 4A3FJ 1U9NA 2CFOA 4HNTA 1TW2A 3LA2A 2OQRA 3MD2A 1XMAA 3KZIC 3VSLA 3OIPA 3P9CA 3BROA 3CCRI 1VQ6I 5TGTA 3BQYA 2ME0A 3I5UA 3P5JA 1HBXG 3I0TA 2LD5A 3BG9A 1VQ8I 4UHTA 2DMNA 3IKVA 4G7ZF 4BE2A 1XDSA 1SVLA 2VB6A 3CP2A 1D3YA 4XL9A 1ZREA 1YS6A 3TOAA 2K85A 3WTYC 4KIBA 1W7PD 2MLGA 4O5VA 2F4OB 4CCKA 4Z6YA 5BPIA 1WCMJ 3KP3A 4WXHA 1BI1A 3CUQC 1R4MB 4KNYA 3LWFA 5HLGA 1N25A 3R60A 3ZR8X 2HKOA 2R7FA 2W4SA 3AFHA 3HSFA 3UNGC 4P55A 1PJRA 4BEHB 3HRMA 4RGSA 4DNCA 2W48A 3KZZA 3HPGA 3EPZA 3TO9A 1XSVA 1ACIA 1FX7A 2HDCA 1O57A 3J7ZI 4GDFA 3HOZJ 3BOQA 1O7FA 2E1NA 1HDDC 1MJ9A 1TWCJ 1FBSA 2P6TA 1RC9A 3C2GA 3HJEA 4P9UA 2CG4A 5J4VA 4R79A 4FETA 1R23A 4M6YA 1G3WA 1W4MA 4PGGA 3WHBA 5EDNA 4IXAA 5JLWA 4L0ZB 4LG3A 3H1CA 1XDUA 4XORA 2DTZA 2DA4A 3HIFA 5LGTA 2HOEA 4C3IJ 2VXDA 1DP3A 1YW9A 2XF7A 4BDZA 5HLTA 1JT0A 5IP7J 3QOEA 2H1KA 4IHWA 1LJ9A 3GFJA 5HS7A 2QKMB 4D0PA 4U0VA 3J7AO 2KIFA 4BE0A 1BW5A 2MH9A 5HNHA 5EJCA 2QBYB 1W5TA 1P4XA 1S8NA 1TW3A 3DP7A 4KN4X 3LSIA 4CICA 5E3OA 3S3OA 4HX8A 4EJOA 5LBQA 2A69F 4HA8A 5D5VB 1ZRCA 5CVIA 3HXLA 2F5FA 3ZQLA 4BUPA 1GUUA 2CUEA 1YW7A 4DGWB 1D5VA 1K83J 2IBDA 4I98B 3EQLF 4U87A 4O6JA 2VLAA 3C2BA 2CQNA 3OIQA 3EYIA 1ULYA 1Y6IA 4DJAA 5E1ZB 3L7WA 3JAMZ 3S93A 1I6XA 2ESNA 3SQNA 3ZQHA 5ICEA 3CCMI 3M8JA 3PUFA 1N75A 4Y15A 1I5ZA 2W85A 4KIGA 1WZ2A 3X2QH 5AIPA 4D7NA 1CQTA 1K78B 1FWZA 2E71A 3OIOA 3DXJF 1SAXA 4XLEA 2XGCA 2FRHA 3ABMH 3C3WA 3I3LA 3K7AJ 4EV0A 3TEDA 1DUXC 1SD7A 4S05A 2ESHA 4KISA 5FD6A 4DYQA 2DW4A 4QPQA 2E1CA 2V79A 3I58A 5L3DA 1RIOH 3BJ6A 2VI6A 3OYKA 1CGPA 4QWQA 3PQJA 2YS9A 3C1DA 9ANTA 3ZMDA 2VOPA 2DFFA 4BY1J 2QF7A 1TQMA 2WAEA 2KRFA 3K4NA 3KYLA 3DTEA 1UG0A 4DYCA 3CC7I 5K7ZA 1ZQ3P 2XGXA 2LRDA 4M71A 3L2RA 2P5LC 3E7LA 2DBBA 2F5VA 1MBJA 3ISPA 3OYHA 2KZGA 2R7DA 2E35A 5HDGA 1Y0NA 4IRIA 4UUSA 1HSJA 1BM9A 4LK0F 3CO7C 2GZWA 2XKOA 4KFCA 4XOTA 3BZ6A 5DUIA 1I50J 2H09A 3BTJA 3I56I 3F9KA 1IXRC 2L9SA 3A4CA 4PCQA 2R7QA 5EEHA 5HLIA 2STTA 3BY6A 3UR3C 2MW8A 4XLFA 3OL4A 4W1UA 5HS9A 3CMMA 4NHJA 4RGUA 3L2WA 3TOBA 3A0BC 3S3NA 1MJAA 1MBKA 2Y9YA 1G8XA 1MDMB 2A5WA 2DYSH 3HGGA 3A01A 3PO2J 1O4XA 3K2ZA 2MD0A 5HS8A 3DPTA 3KETA 3VSKA 3IH3A 2G9WA 1S7AA 1XD7A 1Z7LA 2L9VA 2ZC2A 2E1MB 3HG9A 3Q9VA 1T38A 2CO5A 2K7LA 2W1OA 4BE1A 2OBPA 2ZJQF 3E97A 4A6EA 1HLVA 2CV2A 1HW1A 3LOCA 2DODA 1TLHB 3CUQA 3BLYA 2OUMA 4LFUA 1KU3A 5BOXA 3S2HJ 1LPQA 2MA3A 1WH5A 4LK1F 3Q0WA 2G7HA 2FA5A 2OZUA 3EUHA 1VQMI 3A1YA 1GXQA 3I9V2 1D1CA 1MMSA 2P5KA 3ABLH 3DV8A 2VL8A 2DPDA 4C30A 2TCTA 2F5EA 1IUFA 1YW8A 1V5EA 5E3MA 1K78A 5M3MJ 1Y0UA 4I0AA 2E60A 2ACJA 2XB5A 4EMSA 2L9NA 3J7AY 1DP7P 4A3BJ 5TISC 4ZTJA 2KMUA 2WAQA 1GVDA 3JRBA 2X6OA 1WI3A 2XUBA 1USSA 1HW2A 1EJ9A 1QRYA 3RPUD 1U8BA 2P7CB 2V7FA 4WX9A 2PMZN 5C44J 3J7YJ 3V7SA 3WG9A 2FD5A 3OS2A 2JQ7A 2DMTA 1SEUA 1G4DA 2BV6A 2EIKH 4BQOA 4XRMA 2K9QA 2QYOA 2FXAA 2L01A 1ZGJA 3T1BA 2GXBA 2OU2A 2K9SA 1LDJA 1Z6TA 3D5SC 2YPRA 2EFPA 1ETKA 5C4JJ 4YRVA 1UG2A 3F8BA 4FASD 1O3SA 2KP6A 4C2MJ 5FLXZ 4OMZA 4UB8C 1FP2A 2HTSA 2WADA 4Y7NJ 4HX7A 2BZTA 2H1LA 1LVAA 3SJMA 3WE3A 1U5TB 3ESWB 3OR2C 1IO2A 3DEUA 1XGMA 3HHHA 3QPLA 3DBLB 2BYVE 3VYSB 3H3VK 5J4YA 4XRSA 4M6XA 4MTEA 1FT9A 2A68F 4B44A 2OZ6A 4PJ0C 4LITA 4BU2A 3E1SA 1SANA 4IF4A 2KISA 3P9IA 4ABZA 5F1RA 2FQ3A 4KA4A 4RB2C 2HYFA 2MH2A 3K1NA 2GLOA 2DLLA 3WE2A 1H89C 2QLZA 2R7VA 2DA5A 4NQWA 2EJRA 1SMTA 3DF8A 3SZPA 1KQ0A 1MW7A 1B9NA 1C0WA 4M73A 3KLOA 3ZCOA 2X1CA 5CYVA 3WTUC 1QGPA 1RNLA 4JX5A 1MSEC 4KJZA 1KA8A 4R1HA 1BW6A 5FO5A 3HB9A 2FNAA 2V6CA 2CFXA 3BTLA 3F6VA 4UXNA 3HTSB 2X48A 4FX0A 1HF0A 4N0BA 3ZMUA 3F22A 1ZG1A 2NNYA 3IHUA 1IF1A 2QSGX 3KIOA 2FX0A 2L7MP 2XGEA 3PNVA 5B1AH 4BQQA 2K40A 3R6SA 2L54A 2ZSHB 3DWLE 1NTCA 3L9FA 4ZZDA 2K3PA 4M3EA 2DA6A 2ZJPF 4RGRA 2DMUA 5HVQC 3OV8A 1L3LA 3PL8A 3GTOJ 2HOTA 3M8EA 4KUMA 4C2TA 4XQFA 2QSFX 2EIJH 1RUOA 2GM4A 5GPAA 2MYSA 5TJJA 3QPTA 3DBRB 3GLXA 3CCEI 4MTDA 3KLNA 2CUJA 5J8CA 1KONA 2D5VA 1NG7A 3PNTA 1KYZA 4ENMA 1ETQA 2VE9A 4O3MA 4M74A 1K79A 1B4AA 1JT6A 3CZ6A 3N97A 3S14J 2GIVA 2L5QA 3FISA 3PSFA 1U3EM 2Z5UA 4G6QA 5KCMA 2JVHA 3KEQA 5JVGF 2M1BA 2E7XA 3ZOBA 3CMAI 2L9RA 3FWEA 3QQAA 2K86A 2KL4A 3TMOA 4OIOF 2P5VA 3Q3SA 3RCOA 3WTVC 4IRGA 1BI0A 1XS9A 3GTLJ 4LB6B 1S3JA 3D5LA 4HSTA 4HDVA 1H8AC 1DDNA 3S17J 2IGOA 1IC8A 2BHZA 2E5NA 1S72I 2IJLA 2Y48A 1T0FA 4J01A 1QHGA 1GXPA 2D1VA 2ZFWA 1IN5A 4G7OF 1B72B 4IJAA 2J5OA 2ZCWA 4GFBA 4HF0A 3H0DA 3H0GJ 3QU6A 4XONA 1S7OA 1UCRA 4OU0A 5E17F 3W6KB 1MBFA 2BW3B 2R7TA 4BS9A 3ZPLA 3VEPA 2FBKA 3GLLA 4HV5A 4H0EA 4UY8I 2ELHA 1V5GA 1XGSA 2NS7A 2XSDC 1X1CA 2OCEA 4IEJA 2EIMH 1KYWA 3QPSA 2WY7Q 3K1MA 4CYDA 3A02A 2R5YB 4B47A 1J75A 1JJ6C 3WGIA 5IPAA 4A3MJ 2Q1ZB 5DM6F 3WODF 5L3GA 5E1XA 3WU0A 2KRCA 2UXXA 2R4GA 1FOYA 4ZJZA 5F0FA 5M3FJ 2AQFA 2EFQA 3QAHA 2EPFA 1ZH5A 1WVRA 2JSCA 1SAUA 4XN0A 1QPIA 4BBSJ 1VQLI 4RB0A 3LA3A 1RI7A 5DD8A 4R8HA 2FBIA 2M8GX 2IPQX 2Y30A 2E2HJ 1WJDA 2VJ4A 5HDKA 2HWVA 3KPHA 3IL2A 3HRUA 1N78A 2L4AA 2M0CA 4H4KC 4U0WA 4P5OA 5M5WJ 3CTAA 3TBIA 3K69A 2X4HA 4WXCA 2ZXIA 4BHCA 1BBYA 1ZKGA 3U21A 4BNCA 4PJNA 2GOXB 2IRFG 2VT3A 2AXTC 3Q0VA 2XC7A 4XSZF 2CH0A 4Y17A 5IOZA 1QVUA 2C6YA 2R92J 4HAMA 1XB4A 3TL4X 4XBFA 1XX5A 2F6CA 3HSEA 4I2OA 4CSWA 3TGNA 2HGCA 5H6RA 3BR6A 4NC7A 2DXIA 3LNQA 5FKLA 1YLFA 3NWSA 4HF1A 1X19A 1H0MA 3VODA 4E7ZA 3KYDB 2LDUA 3ZQGA 5EG0A 2Z99A 2KHMA 2L02A 4ZYGA 1OLTA 3JW4A 4IHVA 1FSEA 3ABKH 1FTZA 2FQ4A 1YYVA 3Q5FA 2EZKA 4RGXA 3K0LA 4CYCA 2JWTA 2PJRA 3QOPA 1E3OC 4PJLA 3LMMA 3HSRA 1ZLJA 4RMNA 3FBIB 4Y13A 3DKXA 3VDXA 2HKXA 3SFIA 2O9LA 1NHAA 2OCCH 3JREA 1POGA 1YTYA 1R5HA 2OTLI 3ZMTA 2BW3A 4D7MA 1TBXA 3L2VA 2V26A 1DU0A 3ECHA 4YIIA 1UZCA 1PUEE 2JRMA 3FM3A 4CUGA 3LSKA 1BC7C 4LGWA 4YIFA 2ME6A 2JJ7A 1BR1A 4ZTFA 2WV1A 3JTGA 2VONA 4F91B 1ZARA 3HKZA 4OOIA 3LSRA 3KCCA 3N4MA 3K70C 2N8GA 3FXRA 2OQGA 4BQAA 3SYTA 2VC1A 2VIXA 3K4KA 5K1YA 5J40A 1ZTRA 3GVAA 1K61A 1UHSA 3IH4A 4GYIA 2OC6A 4IHTA 1HDPA 1ZN2A 2DK5A 4MFDA 2ADUA 3Q0UA 4BDYA 2P4WA 1MJBA 3TDUC 5ILSA 1LFBA 5J1UA 4ESBA 2RC4A 2CSOA 3H36A 2OAZA 3MMYB 2JUGA 4CCLA 3OYDA 1T39A 2CW7A 3JRIA 2KPMA 1MD0A 3FHZA 1WGXA 4KDPA 2BVMA 2ISZA 5CKTA 1D0YA 3BTIA 4Q47A 3HGYA 3BZKA 4RA2A 1JKRC 4U0YA 3CC4I 3AG1H 2B0LA 3DQVC 4A6DA 2PQ8A 4IQ4A 3B02A 5FKNA 3G2BA 2K3FA 4CZCA 3MZHA 1VQKI 4A3JJ 2KIMA 5E79C 5HLHA 4G12A 3DKWA 1D1AA 3DLLF 4UV8A 3H9JA 3LFUA 4L18B 4LG0A 3KP2A 4AYBA 2K9MA 4ZH4F 5FRMA 2VUMJ 3BR1A 1A36A 3I4NJ 5KK1A 1ON2A 3ML6A 5L3EA 3FKIJ 4II2A 1R1UA 1HSTA 1PUFA 1D0ZA 3HUGA 5LHGA 3ONQA 4XM3A 1XTAA 3OSGA 2GIZA 1A31A 3CC2I 3HOSA 4IVNA 1I1SA 2QSHX 3MKYB 1W7PA 2M0MA 2P0WA 3GTPJ 3W6VA 1U2WA 1OR7A 3OL3A 4E7KA 2DFHA 5DYMA 5J1RA 2RV8A 1Z6RA 2DN0A 3PM1A 2JA2A 3D1NI 2DQLA 1F36A 4KITB 2D1HA 1B8IA 1WQ2A 2CUFA 4G9YA 2PMHA 2JMWA 5EEAA 4A0XA 4RB3C 3PNYA 5ICCA 2FU4A 2VT2A 2VBZA 5FLVA 2CWEA 3BQZA 4X0GA 1Z91A 3TW7A 1I39A 1JI8A 3BCBA 3K10A 2MC3A 3AL0C 3RIRA 1F9NA 2P8TA 1FZPB 4AC0A 2VQLA 4G94A 1EH7A 3VPRA 2M8EA 2Z33A 2CQQA 3WU1B 3HRSA 1IUYA 4MLOA 5FD5A 2A6EF 2QENA 3LFKA 3H5RA 1Y1WJ 4UUSB 1S5LC 4LOCA 2RKHA 4HQMA 4RAGA 5B66C 1UMQA 3J80Z 4IHSA 4XSXF 2HZDA 3G4SI 2H6CA 1A5JA 1BOAA 4AWXB 2QEXI 3RZOJ 3JSPA 1N77A 4IHYA 1Z7UA 3WU2C 1ORKA 3GCMA 4B43A 3F6OA 1TWAJ 4XN3A 4M3FA 4J19A 1QZZA 4RM3A 3L2QA 3G73A 2KIQA 2KFDA 5J1YA 2ZJRF 1T2KA 4PFOA 1JKPC 4AIDA 3K4CA 5A2QZ 4UUTA 2RGVA 2VQGA 1IW7F 5C3EJ 2KLOA 1J7KA 2E1OA 3NRVA 4X1EA 1I3QJ 3A01B 3FMRA 3LSTA 4W97A 1VQNI 1ETYA 2L3DA 3CCVI 3D0SA 3LSPA 2EFOA 2EINH 3F0CA 2LK2A 2WY8Q 2YX7A 3IUOA 2VKDA 3ZMSA 4FE7A 1LE8A 2GA2A 2XDVA 3A03A 3I53A 4IRHA 5FKOA 4LMYA 3CUQB 3KZYA 3K1PA 2R7UA 5KAIC 4YELA 2IA1A 2D2WA 1DPRA 4HPQA 2VXZA 2EZIA 4U7DA 1OKRA 1XC5A 5KNLA 2XAHA 1WJ5A 4EQQA 3CMYA 3S1RJ 1Z21A 2Q2EA 4AVZA 1H9TA 1E3HA 3HOWJ 1E2XA 2FMYA 2LC2A 1K4SA 1NG6A 5KHDA 3GZ6A 4Q5SF 3K70D 3IP4B 1SVMA 2GAUA 3ZRGA 4E7SA 3WTTC 3EUKL 1WKMA 5H20A 1FSHA 3S16J 1CF7A 2F2EA 5D4RA 1XPXA 2H27A 2ZMEC 1YE9A 4JX6A 4OIPF 2R5ZA 4EJWA 1TNSA 2ELJA 1OQYA 3C7JA 3F8CA 3BPXA 3NAUA 2W82A 5D5UB 4DZJA 4UNOA 2E1MC 5DUKA 2DOAA 3LAPA 1SC7A 3L00A 5DV5A 3VYUB 3R4KA 4AUXA 1UHWA 4A69C 4BHBA 3CO6C 1X1BA 3FZVA 4G7HF 2DYRH 1D1BA 1STZA 4X6AJ 4MNUA 4BXUA 2QWWA 3E5XA 4Y33A 3J81K 1ETXA 1V3FA 5BPDA 3O3KA 3HOVJ 4A3LJ 2LY1A 1J59A 4PSXA 2AO9A 1WRJA 1T95A 4LIVA 2F5DA 3JSOA 4NB5A 3CDHA 2V9PA 2MGQA 5GAEJ 5LHIA 2XPVA 3TDZC 2W84A 2FOKA 2JA7J 1MSFC 5K5RA 3I59A 1TWFJ 2JT1A 3LA7A 3HC7A 5DD4A 4BYYA 1I6HJ 1K4TA 3BT9A 3HM5A 4F7ZA 3DFGA 2K27A 1U8RA 2NNNA 5CVUA 3FXKA 3IH2A 2BVLA 1HKSA 3EDPA 4A2UA 5HOOA 2M9HA 5KAFC 3PFYA 1NK2P 1UFMA 4YG2F 4CGZA 4LLLA 2IGMA 3FKJA 3CDIA 1T56A 4NQWB 2VJ5A 3RPQA 2HPIA 4Y3OA 4BAYA 5BQTA 5BNGA 3G71I 1IRZA 2L7KA 2YSRA 4QTRA 1Y39A 3KP4A 5FROA 2IT0A 5CJ9A 5LGNA 1ZGWA 4E7HA 1BR2A 1XSXA 1FIPA 3EYYA 2JA6J 4N9IA 1SFXA 3OYMA 4HV6A 2A3SA 1Z3XA 2COMA 4OAYA 4NC6A 4MO7A 1BL0A 1OCCH 1YHQI 4WWCA 1T08B 1YOVB 2WV0A 4OAZA 2B7EA 2ZKZA 4BH9A 5FKMA 4A0ZA 4CO8A 2EBIA 4S04A 4OINF 4DQ2A 3SEQA 1ETOA 3TP0A 3HKZN 3IRQA 4PUSA 2RAEA 1U5TC 2X1EA 3RPUA 1ZHFA 2J5PA 3WHCA 4ENJA 1WI9A 4E6KG 2Y69H 4N4NB 2NYXA 1ZAOA 3OYEA 1YIJI 2HVRA 5IT9Z 2V6EA 1A04A 1QVTA 1P7JA 3KEYA 3B6CA 4GYGA 1LNWA 3CF2A 3ZN1A 5FFXA 2X0LA 4I02A 3NARA 1UAAA 4HDUA 3B6AA 2BY1A 1RPWA 5JHFA 1IRFA 3BR3A 2ISYA 5HDNA 3DU6A 2QUFA 3BG3A 2E5ZA 1BIBA 1R4NB 1XCBA 2CJJA 3RDIA 4IPAA 5M5XJ 5HNFA 5J8FA 1HOMA 1I3AA 2FJ1A 3V8KA 1SD5A 2CW8A 3S32A 5L3CA 5F27A 4F55A 4PDKA 2W7NA 2YU9J 2HQRA 3P9KA 2FSWA 1WWXA 5F64A 2GA1A 2Z1DA 2AQEA 5F0HA 2KJCA 4ZC3A 5IY5H 2LY9A 2VBXA 3LL7A 1KZHA 1FMVA 2LP0A 4M9XA 2L2OA 2JPBA 2Z2SB 2MG4A 3FHNA 2RNJA 1TP4A 3ROUA 1HC8A 2BXZA 1ONVA 2O8XA 4HX4A 4JX4A 4AYBN 3BWGA 1ETVA 1S29A 1XMXA 4J00A 1HW5A 5F0CA 2NVTJ 5K5QA 3C2HA 2EA2A 4ZYDA 5E1WA 1BIAA 2Z3YA 3I64A 5AONA 2JZYA 3AG3H 4UVAA 3ERED 2V1NA 5D8LB 2LMDA 2L7FP 2RNGA 5D6FA 4II3A 4FTHA 3BP8A 1RKTA 2WBMA 2ZMEA 4CZZA 4AD9A 4A3KJ 1KU9A 1BC8C 3K4LA 2KDOA 3V8LA 1TWHJ 3OMYA 3RSNA 2BHYA 5GTIC 2CGPA 4I01A 2QKLB 1BOBA 3BR0A 1P2FA 5E8GA 1KU2A 3U1KA 1YRNA 2A6HF 3CESA 2COBA 2ZXHA 2Y0SA 1GT0C 1R1VA 4YFXF 3OOPA 1R36A 2IXSA 4N4OB 1F5TA 4S0HB 3JAMK 1U9OA 2ID6A 3SFZA 2Z9OA 1Z3YA 3ABTA 1Z77A 4XLAA 3L1PA 3H5NA 3U2RA 2NAZA 4YEJA 4WCGA 2VQHA 2HQAA 4L9JA 2UWMA 5JI6A 2DJIA 4WK8F 4HNUA 3FXOA 1ZG5A 2XSJC 2NVUB 3ZQIA 3OS0A 4KT5C 3I55I 4AIJA 2LNBA 2ZSIB 3DU5A 1D5YA 4LLGF 5GP9A 2CV0A 4IX7A 1R00A 2PLYA 3CCLI 4RBOA 1LEAA 3GZNB 2LSOA 3WTWC 2F5CA 2IVMA 4MEYF 1FY7A 2H6BA 2UUZA 2M7BA 4JYKA 1AHDP 1UHMA 2ZNYA 3IRRA 1QPMA 3ZQQA 4A3DJ 3IWZA 2DT5A 3QPHA 3GUDA 3W2WA 2XF6A 1S9HA 1YO5C 3N05A 4ZDLA 5LRSA 3W2AA 5EG0B 5IYDJ 2VODA 5DS9A 5H6QA 3DTKA 2XIGA 3KFWX 4NUBA 1Q1VA 1LFUP 1HKQA 2BY0A 1ZYRF 3QYFA 3V8JA 2CU7A 3CQZJ 1X4PA 4L5IA 3M1EA 3D5RC 3BCAA 4CYCB 2PJRB 4ENKA 3S1MJ 3WTXC 4YFKF 5IOYA 1RRJA 4XRSG 2XASA 1H88C 3DPUA 4EM1A 3FXLA 2O5RA 2HZTA 4ZYAA 4BL0B 2WB1A 3S1NJ 3F8NA 2XKPA 3O8HA 3R0AA 3UKGA 3FMQA 3PUBA 4CHUA 4DBQA 1JKQC 5B5EC 3OS1A 1FBQA 3MCZA 1JUMA 2Y9ZA 2P6SA 3HRTA 2KJBA 2NXNB 1FYLA 3E3VA 2EK5A 3JRDA 4HW0A 3ZP5A 3GFIA 2V4JC 5CVVA 1APLC 2DU9A 5LFAA 2HVQA 1EA3A 5F1JA 3H3ZA 4HLYA 4QPOA 5EZGA 2EV5A 4A3IJ 2O03A 2MD5A 4CH7A 1BJZA 1MNEA 1JHFA 3A2KA 1AU7A 1FPQA 2EZLA 1YJNI 5DCFA 2I5UA 2VKHA 1TQPA 5E3LA 1R71A 1IG7A 4BQNA 1F1ZA 3H35A 5LD2C 5B3SH 4I99C 2HVSA 3OY9A 3BTCA 2ZO4A 3MFKA 3FBNB 2JN6A 1BJAA 3H9QA 5B1BH 1VFCA 5GTHC 1X3UA 3M7GA 4DIQA 1OYIA 1X58A 2ZB9A 1HXDA 3ULQB 1H9GA 3CJQB 3HBLA 2OPTA 3KP6A 6PAXA 3HOTA 2DAOA 3ERMA 3LSMA 4B3AA 3GMEA 1DU6A 1X1PA 3CLQA 4PJJA 1G3SA 1QZYA 1X2MA 4V19K 4ESFA 3PQKA 2IEKA 1XCVA 2TDXA 1Z67A 3V7CA 2O6GE 2X6WA 1WJCA 3OWTA 1YQAA 3K4BA 1ITYA 1V54H 2WC2A 1KQ8A 1LB2A 2LTPA 4XMYA 4E70A 2RQPA 3BG5A 4U88A 4LG0B 3OYJA 1JHHA 1O3TA 3FXJA 3RKYA 4ZDPA 1VNDA 2G7UA 1J09A 2IS1A 2GXGA 4F92B 1S6LA 1MIJA 2M3AA 3DEWA 1AKHA 1PUFB 1Q1HA 2HNHA 3HUGB 3V42A 2AHQA 1F4KA 1SFOJ 2I8DA 1HKTA 5FLXK 1YX3A 1YJ9I 3FIWA 4F93B 1MMGA 2A61A 1P9QC 1A6IA 3ZN0A 5FLMJ 1I27A 3BG6A 1W7PB 3BR2A 4A12A 4B48A 2O0YA 5ERIA 1E17A 4RLFA 3M8FA 3GW2A 4EJVA 1ZRFA 2DPUA 2IS6A 2K9LA 5EEGA 2BOLA 3COAC 4XLCA 1B8IB 1ZGAA 2M2EA 3IAM2 4NC8A 5D8KB 1SMYF 4ZYHA 5D6EA 3L09A 3TKYA 4LIUA 2IW5A 4BHPA 3QODA 3DBHB 3Q9SA 1G2HA 2MABA 3HYIA 4KT6A 5L3FA 1G3TA 1VQ9I 2CQXA 4I09A 4HSRA 5J6XA 4BGDA 4AVPA 3BR5A 1FP1D 3QP5A 1O3QA 2IP2A 1MNMC 2M7AA 2WAQN 2KRHA 3TO6A 1XG1A 2EV0A 1PVEA 3MKWB 2W57A 4C3JJ 1K7AA 4KMFA 1A6QA 3SXYA 4C9YA 3O6BB 1ZG3A 3SDBA 3CCQI 2AS5F 4QIWN 1EH6A 2VPRA 3DKYA 1AA7A 4JP0A 3HOYJ 5ILUA 4RM2A 3GO5A 4UUVA 2E2JJ 3L2CA 2VPLA 1IRGA 2K4BA 2HFHA 2YX4A 4HOBA 2HDDA 5DDGA 1WSUA 3JCUC 5IYBJ 1IXCA 3QYBA 2X51A 1OCZH 4NDLA 3TQNA 4HYEA 1IN6A 2LY2A 2NVYJ 2M87A 5ICGA 4G6DA 2CS3A 4E7JA 3F23A 2FMLA 3L2UA 4OIQF 2X6YA 1IDYA 5F6FA 1VQOI 3K4MA 4OMYA 1FC3A 2BXYA 1K6YA 3K2AA 2K02A 3PJRA 3G3ZA 2A05A 3G1OA 2WAFA 2GBYA 5GAGJ 2PI0A 4BY7J 1LE8B 2MBFA 1QBJA 4IKFA 4PGHA 3T0YA 2EFWA 3ELKA 1Z1DA 1QZEA 5BMZA 1X4OA 2ZNZA 3R61A 3PIOF 2DA7A 2RDPA 3RZDJ 3RQIA 3NQOA 3VFZA 1U6GA 3HL2A 4MEXF 1IGNA 2DA3A 2QQ8A 2OTJI 2EB7A 2FF4A 4L9NA 3RJPA 2ECCA 4L9TA 1HA8A 2Q2EB 3I4PA 2NRAC 2A07F 1I1GA 2IA2A 1IXSB 2VBWA 1RR7A 2DA1A 5FFZA 4CXFA 4A3EJ 2JUCA 1WJEA 5DCMA 3RYPA 4CCJA 1D0XA 5JFRA 4KYWA 3VYTB 2HQ5A 1K6OA 3NEUA 2EZHA 4MFEA 4Z2YA 1CF7B 4ZDOA 3MKLA 3VOEA 1J2XA 3F8FA 3RKXA 1LKXA 2R5ZB 1EF4A 2Y0SN 3E6MA 3ZGKA 1OCOH 3KEOA 1B9MA 4FISA 4DBRA 2K9NA 4OWRB 3BDDA 2OA4A 5D5WB 4E7LA 3W3CA 3BJOA 1PYVA 5EYRA 3MZ8A 2R7SA 4ETSA 3KYCB 2NS0A 4ON0A 1Z9CA 2XB0X 1WH7A 3OYIA 2VOOA 1O3RA 2HPMA 3T8RA 2M30A 4L5EA 2R7RA 4JOMA 2O8KA 2ZBKA 1AOYA 4F3QA 1LUJB 1FJLA 1TWGJ 1FIAA 3FM5A 1R49A 2LBFB 4L0YB 2O7OA 2CQKA 3FDYA 2E19A 3AG2H 3EUHC 1YX5A 4HZFA 4N9HA 5JLXA 3LAJA 2F48A 1PP8F 1EH8A 1REPC 3CJRB 1VZ0A 2NOGA 3CLOA 3I59B 5GAHJ 3O2PE 3IWFA 2B9SA 2IGKA 1WHUA 2RVCA 3T5XA 2AXLA 2OV7A 3MN2A 1T98A 3VB2A 4XICA 2MSYA 1R9TJ 1ZK8A 4IO9F 2A5YB 2F4MB 2R7WA 1FLIA 3I71A 1TC3C 4EJTA 5IYCJ 3KP7A 2OF7A 3K9TA 2VKEA 1P4AA 2B63J 1MNDA 4QSHA 2RN7A 2CV1A 2BE5F 1MZBA 5EGOA 3TW6A 4HQEA 1TT0A 4D1QA 2WB1N 2A6TA 1B1BA 1D8KA 4CA0A 1JUSA 3LSJA 2P81A 2LKXA 3S2DJ 4EATA 1HQCA 1TL8A 2O61A 1NH3A 3SZGA 3AG4H 2YUSA 3LQRA 1ENHA 4DYRA 1QNTA 3FXMA 2QA4I 3AL0B 3ABUA 3F8MA 4EM2A 2DOEA 1Y8RB 4BXFA 2Y75A 1XMKA 2QQAA 1W36C 1IDZA 1EKEA 2DCEA 4RAFA 2OJED 1IRXA 2I10A 3TO7A 1WFXA 1B6AA 3G6EI 2DTRA 1WJAA 4B1RA 2HXOA 3G1MA 3IC7A 4EJUA 1FEXA 5F04A 1X3ZB 1RR8C 4Q48A 5FRNA 2K4JA 2DFIA 1W0UA 1J0RA 1X2NA 2DK8A 5LEKA 3MKZA 4JBAA 4B09A 1P4WA 4B3XA 2L4MA 3RKQA 1MBEA 5DM7F 2XAJA 1ON1A 3BPVA 3BC8A 4B8XA 5J47A 4ASNA 3WTZA 5IP9J 1JTYA 2ZFUA 4ANJA 5IP6A 1VTNC 2XF5A 1USTA 2H8WA 2XV4S 3BG7A 3QP6A 3VWBA 2K5CA 3EUAA 1SD6A 2LBFA 2FEZA 4MHGA 3SEZA 1OISA 4BJ5C 2FBHA 1RZ4A 3CCJI 1TTYA 1IV8A 3GEZA 4ITVA 4BEHA 1XSDA 1R22A 4PJMA 4I6ZA 3GF2A 2TRTA 3RYRA 3WGHA 3JR9A 3NWTA 2LVSA 2LF7A 1SFEA 3PSIA 3OSFA 1ZRDA 3W6JB 3M4OJ 3KE2A 2VE8A 2EH3A 3RTRA 3MWMA 1MMAA 3H92A 1X1DA 2WA0A 2DT6A 5FJ8J 3U9GA 1QA6A 2W00A 2DJNA 2JPCA 2PMUA 4IOCF 1SD4A 3R0JA 2X6XA 4A5NA 1YITI 1QU3A 3GTJJ 2DDBA 2QM3A 2MC4A 4I76A 1JE8A 1WJBA 3CF5F 3HZJA 4XLPF 2HOSA
chains in the Genus database with same CATH topology
3CMAI 3CC2I 4IOAF 1VQOI 1YIJI 3CCSI 2E35A 1FOWA 4V19K 3I55I 1ACIA 3CMEI 3J7ZI 1S72I 5GAGJ 3CCLI 3I56I 2OTLI 2QA4I 1VQ4I 3PIOF 1VQ5I 2OTJI 3G6EI 4UY8I 1YJ9I 3CCUI 3CD6I 5GAEJ 3G4SI 1VQPI 2ZJQF 5DM6F 2QEXI 1HC8A 1FOYA 1FOXA 5DM7F 1VQ7I 3PIPF 1YJWI 1VQLI 5GADJ 2ZJRF 1VQMI 1VQ9I 2NXNB 1YI2I 2FOWA 2H8WA 1MMSA 2ZJPF 3CC4I 3CCJI 3CJTB 1VQNI 3CCMI 3G71I 3CCRI 1VQ6I 3CCVI 1Y39A 1YJNI 2K3FA 3CCQI 1VQKI 1VQ8I 2E34A 3CCEI 5GAHJ 3DLLF 1YHQI 2E36A 1QA6A 3J7YJ 2JQ7A 4IOCF 1YITI 4IO9F 3CF5F 3CC7I 5JVGF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA I;  3CC2 I;  4IOA F;  1VQO I;  1YIJ I;  3CCS I;  2E35 A;  1FOW A;  4V19 K;  3I55 I;  1ACI A;  3CME I;  3J7Z I;  1S72 I;  5GAG J;  3CCL I;  3I56 I;  2OTL I;  2QA4 I;  1VQ4 I;  3PIO F;  1VQ5 I;  2OTJ I;  3G6E I;  4UY8 I;  1YJ9 I;  3CCU I;  3CD6 I;  5GAE J;  3G4S I;  1VQP I;  2ZJQ F;  5DM6 F;  2QEX I;  1HC8 A;  1FOY A;  1FOX A;  5DM7 F;  1VQ7 I;  3PIP F;  1YJW I;  1VQL I;  5GAD J;  2ZJR F;  1VQM I;  1VQ9 I;  2NXN B;  1YI2 I;  2FOW A;  2H8W A;  1MMS A;  2ZJP F;  3CC4 I;  3CCJ I;  3CJT B;  1VQN I;  3CCM I;  3G71 I;  3CCR I;  1VQ6 I;  3CCV I;  1Y39 A;  1YJN I;  2K3F A;  3CCQ I;  1VQK I;  1VQ8 I;  2E34 A;  3CCE I;  5GAH J;  3DLL F;  1YHQ I;  2E36 A;  1QA6 A;  3J7Y J;  2JQ7 A;  4IOC F;  1YIT I;  4IO9 F;  3CF5 F;  3CC7 I;  5JVG F; 
#chains in the Genus database with same CATH topology
 3QWL A;  4D5F A;  4IOA F;  2Q0O A;  1MGT A;  4XLN F;  2ZME B;  3FX3 A;  3JRF A;  3ASO H;  2UZK A;  3CCS I;  2NVQ J;  1W5C C;  2RRE A;  1FOW A;  3LSG A;  2QBY A;  2JTV A;  2NOJ B;  4GCV A;  2KDZ A;  5E8I A;  3PFI A;  2DT7 B;  2LKS A;  4AU7 A;  5JVT A;  1WPK A;  3M3Y J;  4V2F A;  4LD5 A;  1YRN B;  3G1L A;  3AAF A;  1GV5 A;  4EVI A;  2H8R A;  4P96 A;  2DI3 A;  1VQ4 I;  2BY2 A;  1UB9 A;  2EWN A;  2IGN A;  3MQ0 A;  1LEB A;  4MQV A;  2X85 A;  4PFP A;  3HEF A;  3PO3 J;  3EET A;  1AWC A;  2JSP A;  4OIR F;  1BA5 A;  1T0F C;  4FE4 A;  4BKX A;  4RDU A;  4QLC U;  1Y8Q B;  2ZXJ A;  1TNT A;  3GTM J;  2FE3 A;  2DQR A;  3JRA A;  2ZJ2 A;  3CCU I;  5EF6 A;  2R7Z J;  2JA5 J;  1FMW A;  3CUO A;  4AIH A;  2XRN A;  2VBY A;  5CQG A;  2M34 A;  2H94 A;  4Y52 J;  1GDT A;  3TP3 A;  3MZY A;  4MGR A;  2Y31 A;  2IA0 A;  2QCO A;  4KMU X;  4YFN F;  5K7H A;  5GPC A;  4ZZL A;  1VQ7 I;  3C18 A;  4I0B A;  2W24 A;  3PIP F;  1FOK A;  2CUZ A;  4RB1 A;  2HXI A;  3OR1 C;  5GAD J;  1JGS A;  1KU7 A;  2EA4 A;  1OYW A;  1A35 A;  2LYC A;  2FOW A;  1GLN A;  4M9Z A;  3V4G A;  2O3F A;  1Z0X A;  4KIC A;  1ZLK A;  3SZT A;  1MBG A;  2KZV A;  2JVG A;  3IAS 2;  3J80 K;  2EV6 A;  4BXX J;  1IN8 A;  1MBH A;  4A3G J;  2PN6 A;  4UVB A;  3M9A A;  4B4C A;  4C3H J;  5E18 F;  1G6N A;  1J5Y A;  1XGN A;  2DMP A;  3IV5 A;  4M3G A;  2PFB A;  5LGU A;  4CCN A;  2HTJ A;  2L7Z A;  2JRT A;  1DGW Y;  1PP7 U;  2E34 A;  1IAW A;  2QQB A;  2QZ8 A;  3W2V A;  4HRI A;  1LFP A;  3CJN A;  1JKO C;  3I4M J;  5A2Q K;  4CDG A;  3K6G A;  4KIF A;  4M72 A;  4XOP A;  1BR4 A;  1EV7 A;  4U7B A;  2PEX A;  1W36 D;  3GTK J;  3LSH A;  4ENN A;  2UV1 A;  1LVK A;  1MDM A;  2MLK A;  3DEE A;  3DTI A;  2UXN A;  2BBY A;  2P7V B;  5CPR B;  2PBI A;  3OYC A;  2HOA A;  2XAQ A;  2YU3 A;  1DGR M;  1YG2 A;  2F4I A;  4GGG A;  4PZJ A;  1JUP A;  4A5M A;  2R7X A;  1T8I A;  3GXO A;  1G59 A;  4UV9 A;  2G0E A;  5CLS A;  1XGO A;  5FKK A;  3CME I;  5LEJ A;  1GHC A;  2VJI A;  4FQG A;  4CCO A;  3JTH A;  4PSW A;  2X1D A;  1X1A A;  2EQR A;  4NNJ A;  3RQ4 A;  3LQQ A;  1SFK A;  3REO A;  1Y56 A;  1FYK A;  5H2F C;  4XR6 A;  2QGU A;  1J9I A;  1IN4 A;  3S1Q J;  1OCR H;  5HOD A;  2HYG D;  4LLN A;  3WTS C;  1S7E A;  2DA2 A;  2XAU A;  4LJZ F;  5CQE A;  4WF2 A;  1M1E B;  1R6R A;  1MH4 A;  2ECB A;  2PG4 A;  3ASN H;  1YFH A;  2ID3 A;  1FBU A;  3RKW A;  3ZMV A;  3HDD A;  2XAF A;  1V5F A;  3H9G A;  5JR3 A;  2Y2Z A;  1OCT C;  4HBL A;  3U1D A;  1IJW C;  1OFC X;  1W1W E;  3FMS A;  3FK7 A;  4NBQ A;  4IQJ A;  1RKW A;  4M9S A;  4C2U A;  1LDD A;  2LR8 A;  4EM0 B;  5D4S A;  1B59 A;  3BZC A;  2XPU A;  2IAI A;  2V1X A;  2L0K A;  1YJW I;  5TRD A;  5L3B A;  1ETW A;  4BJ6 C;  2Z16 A;  3ECO A;  2HI3 A;  5KVR A;  3MEX A;  2OD5 A;  1AKH B;  3B73 A;  1WJF A;  2R0Q C;  1ZR2 A;  2V9V A;  2STW A;  2BY3 A;  4XNF A;  2CW0 F;  2XHK A;  4FX4 A;  5ICF A;  3ZQC A;  4G8X A;  3CJT B;  3KX2 A;  3S3M A;  1T6S A;  1VF9 A;  2ICW G;  4XKV A;  3GTQ J;  3ZXS A;  3M07 A;  4RAZ A;  2XRO A;  2FUG 2;  4EGZ A;  2HYJ A;  1U5T A;  4FT8 A;  2ETH A;  2R3S A;  3GZ5 A;  5E3N A;  1R7J A;  4M3B A;  3BJA A;  2LG4 A;  2WWY A;  2LH9 A;  3WG7 H;  3JRC A;  2HEO A;  3GTG J;  2BGC A;  2XAG A;  1W0T A;  1T33 A;  2CQ7 A;  3S8P A;  2V1U A;  4IZZ A;  5ED4 A;  5D5X B;  2NS8 A;  3A0H C;  4V2G A;  4I7H A;  5K5O A;  2ELK A;  3FK6 A;  3KP5 A;  1P92 A;  3QU3 A;  2IS4 A;  4RAY A;  4EEF G;  5FB2 A;  2X9D A;  3HTU A;  1IZ1 A;  4AM3 A;  2HDW A;  2XPW A;  1KQ9 A;  3DPL C;  3FXQ A;  1V55 H;  5CVR A;  3E5U A;  4A0Y A;  2GWR A;  3F3X A;  3HHG A;  2CRG A;  1KGS A;  3S2W A;  1P6R A;  3OYA A;  1DPU A;  3GFM A;  1FYM A;  3FXU A;  1XN7 A;  1YS7 A;  2M4K A;  2KKO A;  4D9J A;  4BAC A;  5LHH A;  2XVC A;  2BEO A;  5LLQ A;  4AIK A;  5C4X J;  2WTE A;  2DDA A;  2Y0M A;  3CP8 A;  3E6C C;  2GXA A;  4FHT A;  2QVO A;  4GRI A;  5CVJ A;  4CCM A;  4A93 J;  4GO1 A;  2GOM A;  1OR7 C;  2LFB A;  1E0E A;  2DMQ A;  3GYH X;  3FF5 A;  3O8G A;  5IT9 K;  4D5C A;  1BI2 A;  2D45 A;  1BI3 A;  1OMI A;  1TT5 B;  1L0O C;  1UEL B;  3DLA A;  4RLQ A;  5JHU A;  3I54 A;  2VN2 A;  2E7W A;  2KT0 A;  3V7R A;  4IHX A;  2YR2 A;  4L5J A;  4TV7 A;  4UB6 C;  4M3D A;  4L9V A;  3RI4 A;  1R1T A;  4HG2 A;  2LF8 A;  3DCF A;  4IL6 C;  4RS8 A;  2VJJ A;  1NK3 P;  1Z05 A;  1IV6 A;  2M5W A;  3VYR B;  3QRF F;  2DFE A;  3M1C A;  3MAJ A;  3JRH A;  2HR3 A;  1UJ8 A;  4XID A;  4M6V A;  1E3P A;  3HOX J;  4UVC A;  4XKB A;  2GQQ A;  2JK3 A;  1RET A;  4HEA 2;  1W5S A;  3F21 A;  3T8T A;  4MQ9 F;  5DTD A;  1ODD A;  3MVP A;  3H5A A;  4ZYE A;  3OYN A;  1JGG A;  1YI2 I;  4HNV A;  3K4J A;  1FTT A;  1OJL A;  2VQC A;  3SHF A;  1P7I A;  1OYY A;  1QHH D;  2EIL H;  3H3U A;  2DO7 A;  3ZQ7 A;  2XRL A;  5DCM B;  1MMN A;  1D8J A;  2EFN A;  2Q8K A;  1JTX A;  2E2I J;  1SFU A;  2HU9 A;  1X3W B;  2KQR A;  5E20 A;  1IN7 A;  1TQI A;  3CDL A;  3E0J B;  4YIR X;  4DZP A;  1PDN C;  2V1D A;  3OOU A;  1B72 A;  2HS5 A;  3HOU J;  1GV2 A;  1TZL A;  4FCY A;  2E36 A;  4P9F A;  3CCY A;  4XLH A;  3GX4 X;  3OYF A;  3HPH A;  2R93 J;  1O7L A;  5FGM A;  2MFZ A;  2LOO A;  1R58 A;  1GVJ A;  5M5Y J;  3ZMZ A;  4Y4R A;  3E6B A;  2LKP A;  4E7I A;  4JK1 X;  3F72 A;  4DW6 A;  4MIM A;  4GXO A;  4XK4 A;  1RES A;  1MKM A;  4DOZ A;  4JQF A;  2QQ9 A;  4ESJ A;  2VKV A;  2XGD A;  4PK4 A;  3P7N A;  2LLK A;  3OYG A;  5IT3 A;  1F43 A;  2KIU A;  4LB5 A;  4BBR J;  2V9K A;  2R5Y A;  1OPC A;  3E5Q A;  1FNN A;  4F52 A;  3J81 Z;  2PX9 A;  1R5I D;  2IS2 A;  5BS6 A;  1Y1V J;  4BJT A;  1MMD A;  5F08 A;  1G3Y A;  4XRF A;  2VC0 A;  2CMP A;  1LDK B;  3WGG A;  1BN5 A;  3AKZ A;  1HCR A;  3ZQF A;  2PMZ A;  4P1W A;  3GFL A;  1VQ5 I;  4HF2 A;  4Q4Z F;  4G6T B;  1SVO A;  4E4H A;  5EZH A;  1ZEL A;  5K7F A;  1V4R A;  2RQQ A;  2LRE A;  3OYB A;  2JA8 J;  1JJ8 C;  3QYE A;  5J3L A;  5EGO B;  3E6D A;  4HLX A;  1ERD A;  2M45 A;  4XKW A;  1QQI A;  2HQN A;  2NVX J;  1OCP A;  3CD6 I;  4K2E A;  1ZR4 A;  1QO0 D;  5LRR A;  1RUN A;  1VQP I;  2VAS A;  2ZXW H;  2W25 A;  2DOF A;  5ILV A;  1MH3 A;  1VI0 A;  2PJP A;  2M4G A;  1FOX A;  4EGY A;  2R7O A;  1U78 A;  1U0J A;  3SDG A;  4XKC A;  3S15 J;  1JXS A;  4KN7 X;  3GBG A;  1R5G A;  5DEQ A;  2FNP A;  4WXD A;  3OYL A;  3IKT A;  2CYY A;  1DQU A;  3GWZ A;  1YIO A;  1LQ1 A;  3JRG A;  4A3C J;  5AIQ A;  4A3F J;  1U9N A;  2CFO A;  4HNT A;  1TW2 A;  3LA2 A;  2OQR A;  3MD2 A;  1XMA A;  3KZI C;  3VSL A;  3OIP A;  3P9C A;  3BRO A;  3CCR I;  1VQ6 I;  5TGT A;  3BQY A;  2ME0 A;  3I5U A;  3P5J A;  1HBX G;  3I0T A;  2LD5 A;  3BG9 A;  1VQ8 I;  4UHT A;  2DMN A;  3IKV A;  4G7Z F;  4BE2 A;  1XDS A;  1SVL A;  2VB6 A;  3CP2 A;  1D3Y A;  4XL9 A;  1ZRE A;  1YS6 A;  3TOA A;  2K85 A;  3WTY C;  4KIB A;  1W7P D;  2MLG A;  4O5V A;  2F4O B;  4CCK A;  4Z6Y A;  5BPI A;  1WCM J;  3KP3 A;  4WXH A;  1BI1 A;  3CUQ C;  1R4M B;  4KNY A;  3LWF A;  5HLG A;  1N25 A;  3R60 A;  3ZR8 X;  2HKO A;  2R7F A;  2W4S A;  3AFH A;  3HSF A;  3UNG C;  4P55 A;  1PJR A;  4BEH B;  3HRM A;  4RGS A;  4DNC A;  2W48 A;  3KZZ A;  3HPG A;  3EPZ A;  3TO9 A;  1XSV A;  1ACI A;  1FX7 A;  2HDC A;  1O57 A;  3J7Z I;  4GDF A;  3HOZ J;  3BOQ A;  1O7F A;  2E1N A;  1HDD C;  1MJ9 A;  1TWC J;  1FBS A;  2P6T A;  1RC9 A;  3C2G A;  3HJE A;  4P9U A;  2CG4 A;  5J4V A;  4R79 A;  4FET A;  1R23 A;  4M6Y A;  1G3W A;  1W4M A;  4PGG A;  3WHB A;  5EDN A;  4IXA A;  5JLW A;  4L0Z B;  4LG3 A;  3H1C A;  1XDU A;  4XOR A;  2DTZ A;  2DA4 A;  3HIF A;  5LGT A;  2HOE A;  4C3I J;  2VXD A;  1DP3 A;  1YW9 A;  2XF7 A;  4BDZ A;  5HLT A;  1JT0 A;  5IP7 J;  3QOE A;  2H1K A;  4IHW A;  1LJ9 A;  3GFJ A;  5HS7 A;  2QKM B;  4D0P A;  4U0V A;  3J7A O;  2KIF A;  4BE0 A;  1BW5 A;  2MH9 A;  5HNH A;  5EJC A;  2QBY B;  1W5T A;  1P4X A;  1S8N A;  1TW3 A;  3DP7 A;  4KN4 X;  3LSI A;  4CIC A;  5E3O A;  3S3O A;  4HX8 A;  4EJO A;  5LBQ A;  2A69 F;  4HA8 A;  5D5V B;  1ZRC A;  5CVI A;  3HXL A;  2F5F A;  3ZQL A;  4BUP A;  1GUU A;  2CUE A;  1YW7 A;  4DGW B;  1D5V A;  1K83 J;  2IBD A;  4I98 B;  3EQL F;  4U87 A;  4O6J A;  2VLA A;  3C2B A;  2CQN A;  3OIQ A;  3EYI A;  1ULY A;  1Y6I A;  4DJA A;  5E1Z B;  3L7W A;  3JAM Z;  3S93 A;  1I6X A;  2ESN A;  3SQN A;  3ZQH A;  5ICE A;  3CCM I;  3M8J A;  3PUF A;  1N75 A;  4Y15 A;  1I5Z A;  2W85 A;  4KIG A;  1WZ2 A;  3X2Q H;  5AIP A;  4D7N A;  1CQT A;  1K78 B;  1FWZ A;  2E71 A;  3OIO A;  3DXJ F;  1SAX A;  4XLE A;  2XGC A;  2FRH A;  3ABM H;  3C3W A;  3I3L A;  3K7A J;  4EV0 A;  3TED A;  1DUX C;  1SD7 A;  4S05 A;  2ESH A;  4KIS A;  5FD6 A;  4DYQ A;  2DW4 A;  4QPQ A;  2E1C A;  2V79 A;  3I58 A;  5L3D A;  1RIO H;  3BJ6 A;  2VI6 A;  3OYK A;  1CGP A;  4QWQ A;  3PQJ A;  2YS9 A;  3C1D A;  9ANT A;  3ZMD A;  2VOP A;  2DFF A;  4BY1 J;  2QF7 A;  1TQM A;  2WAE A;  2KRF A;  3K4N A;  3KYL A;  3DTE A;  1UG0 A;  4DYC A;  3CC7 I;  5K7Z A;  1ZQ3 P;  2XGX A;  2LRD A;  4M71 A;  3L2R A;  2P5L C;  3E7L A;  2DBB A;  2F5V A;  1MBJ A;  3ISP A;  3OYH A;  2KZG A;  2R7D A;  2E35 A;  5HDG A;  1Y0N A;  4IRI A;  4UUS A;  1HSJ A;  1BM9 A;  4LK0 F;  3CO7 C;  2GZW A;  2XKO A;  4KFC A;  4XOT A;  3BZ6 A;  5DUI A;  1I50 J;  2H09 A;  3BTJ A;  3I56 I;  3F9K A;  1IXR C;  2L9S A;  3A4C A;  4PCQ A;  2R7Q A;  5EEH A;  5HLI A;  2STT A;  3BY6 A;  3UR3 C;  2MW8 A;  4XLF A;  3OL4 A;  4W1U A;  5HS9 A;  3CMM A;  4NHJ A;  4RGU A;  3L2W A;  3TOB A;  3A0B C;  3S3N A;  1MJA A;  1MBK A;  2Y9Y A;  1G8X A;  1MDM B;  2A5W A;  2DYS H;  3HGG A;  3A01 A;  3PO2 J;  1O4X A;  3K2Z A;  2MD0 A;  5HS8 A;  3DPT A;  3KET A;  3VSK A;  3IH3 A;  2G9W A;  1S7A A;  1XD7 A;  1Z7L A;  2L9V A;  2ZC2 A;  2E1M B;  3HG9 A;  3Q9V A;  1T38 A;  2CO5 A;  2K7L A;  2W1O A;  4BE1 A;  2OBP A;  2ZJQ F;  3E97 A;  4A6E A;  1HLV A;  2CV2 A;  1HW1 A;  3LOC A;  2DOD A;  1TLH B;  3CUQ A;  3BLY A;  2OUM A;  4LFU A;  1KU3 A;  5BOX A;  3S2H J;  1LPQ A;  2MA3 A;  1WH5 A;  4LK1 F;  3Q0W A;  2G7H A;  2FA5 A;  2OZU A;  3EUH A;  1VQM I;  3A1Y A;  1GXQ A;  3I9V 2;  1D1C A;  1MMS A;  2P5K A;  3ABL H;  3DV8 A;  2VL8 A;  2DPD A;  4C30 A;  2TCT A;  2F5E A;  1IUF A;  1YW8 A;  1V5E A;  5E3M A;  1K78 A;  5M3M J;  1Y0U A;  4I0A A;  2E60 A;  2ACJ A;  2XB5 A;  4EMS A;  2L9N A;  3J7A Y;  1DP7 P;  4A3B J;  5TIS C;  4ZTJ A;  2KMU A;  2WAQ A;  1GVD A;  3JRB A;  2X6O A;  1WI3 A;  2XUB A;  1USS A;  1HW2 A;  1EJ9 A;  1QRY A;  3RPU D;  1U8B A;  2P7C B;  2V7F A;  4WX9 A;  2PMZ N;  5C44 J;  3J7Y J;  3V7S A;  3WG9 A;  2FD5 A;  3OS2 A;  2JQ7 A;  2DMT A;  1SEU A;  1G4D A;  2BV6 A;  2EIK H;  4BQO A;  4XRM A;  2K9Q A;  2QYO A;  2FXA A;  2L01 A;  1ZGJ A;  3T1B A;  2GXB A;  2OU2 A;  2K9S A;  1LDJ A;  1Z6T A;  3D5S C;  2YPR A;  2EFP A;  1ETK A;  5C4J J;  4YRV A;  1UG2 A;  3F8B A;  4FAS D;  1O3S A;  2KP6 A;  4C2M J;  5FLX Z;  4OMZ A;  4UB8 C;  1FP2 A;  2HTS A;  2WAD A;  4Y7N J;  4HX7 A;  2BZT A;  2H1L A;  1LVA A;  3SJM A;  3WE3 A;  1U5T B;  3ESW B;  3OR2 C;  1IO2 A;  3DEU A;  1XGM A;  3HHH A;  3QPL A;  3DBL B;  2BYV E;  3VYS B;  3H3V K;  5J4Y A;  4XRS A;  4M6X A;  4MTE A;  1FT9 A;  2A68 F;  4B44 A;  2OZ6 A;  4PJ0 C;  4LIT A;  4BU2 A;  3E1S A;  1SAN A;  4IF4 A;  2KIS A;  3P9I A;  4ABZ A;  5F1R A;  2FQ3 A;  4KA4 A;  4RB2 C;  2HYF A;  2MH2 A;  3K1N A;  2GLO A;  2DLL A;  3WE2 A;  1H89 C;  2QLZ A;  2R7V A;  2DA5 A;  4NQW A;  2EJR A;  1SMT A;  3DF8 A;  3SZP A;  1KQ0 A;  1MW7 A;  1B9N A;  1C0W A;  4M73 A;  3KLO A;  3ZCO A;  2X1C A;  5CYV A;  3WTU C;  1QGP A;  1RNL A;  4JX5 A;  1MSE C;  4KJZ A;  1KA8 A;  4R1H A;  1BW6 A;  5FO5 A;  3HB9 A;  2FNA A;  2V6C A;  2CFX A;  3BTL A;  3F6V A;  4UXN A;  3HTS B;  2X48 A;  4FX0 A;  1HF0 A;  4N0B A;  3ZMU A;  3F22 A;  1ZG1 A;  2NNY A;  3IHU A;  1IF1 A;  2QSG X;  3KIO A;  2FX0 A;  2L7M P;  2XGE A;  3PNV A;  5B1A H;  4BQQ A;  2K40 A;  3R6S A;  2L54 A;  2ZSH B;  3DWL E;  1NTC A;  3L9F A;  4ZZD A;  2K3P A;  4M3E A;  2DA6 A;  2ZJP F;  4RGR A;  2DMU A;  5HVQ C;  3OV8 A;  1L3L A;  3PL8 A;  3GTO J;  2HOT A;  3M8E A;  4KUM A;  4C2T A;  4XQF A;  2QSF X;  2EIJ H;  1RUO A;  2GM4 A;  5GPA A;  2MYS A;  5TJJ A;  3QPT A;  3DBR B;  3GLX A;  3CCE I;  4MTD A;  3KLN A;  2CUJ A;  5J8C A;  1KON A;  2D5V A;  1NG7 A;  3PNT A;  1KYZ A;  4ENM A;  1ETQ A;  2VE9 A;  4O3M A;  4M74 A;  1K79 A;  1B4A A;  1JT6 A;  3CZ6 A;  3N97 A;  3S14 J;  2GIV A;  2L5Q A;  3FIS A;  3PSF A;  1U3E M;  2Z5U A;  4G6Q A;  5KCM A;  2JVH A;  3KEQ A;  5JVG F;  2M1B A;  2E7X A;  3ZOB A;  3CMA I;  2L9R A;  3FWE A;  3QQA A;  2K86 A;  2KL4 A;  3TMO A;  4OIO F;  2P5V A;  3Q3S A;  3RCO A;  3WTV C;  4IRG A;  1BI0 A;  1XS9 A;  3GTL J;  4LB6 B;  1S3J A;  3D5L A;  4HST A;  4HDV A;  1H8A C;  1DDN A;  3S17 J;  2IGO A;  1IC8 A;  2BHZ A;  2E5N A;  1S72 I;  2IJL A;  2Y48 A;  1T0F A;  4J01 A;  1QHG A;  1GXP A;  2D1V A;  2ZFW A;  1IN5 A;  4G7O F;  1B72 B;  4IJA A;  2J5O A;  2ZCW A;  4GFB A;  4HF0 A;  3H0D A;  3H0G J;  3QU6 A;  4XON A;  1S7O A;  1UCR A;  4OU0 A;  5E17 F;  3W6K B;  1MBF A;  2BW3 B;  2R7T A;  4BS9 A;  3ZPL A;  3VEP A;  2FBK A;  3GLL A;  4HV5 A;  4H0E A;  4UY8 I;  2ELH A;  1V5G A;  1XGS A;  2NS7 A;  2XSD C;  1X1C A;  2OCE A;  4IEJ A;  2EIM H;  1KYW A;  3QPS A;  2WY7 Q;  3K1M A;  4CYD A;  3A02 A;  2R5Y B;  4B47 A;  1J75 A;  1JJ6 C;  3WGI A;  5IPA A;  4A3M J;  2Q1Z B;  5DM6 F;  3WOD F;  5L3G A;  5E1X A;  3WU0 A;  2KRC A;  2UXX A;  2R4G A;  1FOY A;  4ZJZ A;  5F0F A;  5M3F J;  2AQF A;  2EFQ A;  3QAH A;  2EPF A;  1ZH5 A;  1WVR A;  2JSC A;  1SAU A;  4XN0 A;  1QPI A;  4BBS J;  1VQL I;  4RB0 A;  3LA3 A;  1RI7 A;  5DD8 A;  4R8H A;  2FBI A;  2M8G X;  2IPQ X;  2Y30 A;  2E2H J;  1WJD A;  2VJ4 A;  5HDK A;  2HWV A;  3KPH A;  3IL2 A;  3HRU A;  1N78 A;  2L4A A;  2M0C A;  4H4K C;  4U0W A;  4P5O A;  5M5W J;  3CTA A;  3TBI A;  3K69 A;  2X4H A;  4WXC A;  2ZXI A;  4BHC A;  1BBY A;  1ZKG A;  3U21 A;  4BNC A;  4PJN A;  2GOX B;  2IRF G;  2VT3 A;  2AXT C;  3Q0V A;  2XC7 A;  4XSZ F;  2CH0 A;  4Y17 A;  5IOZ A;  1QVU A;  2C6Y A;  2R92 J;  4HAM A;  1XB4 A;  3TL4 X;  4XBF A;  1XX5 A;  2F6C A;  3HSE A;  4I2O A;  4CSW A;  3TGN A;  2HGC A;  5H6R A;  3BR6 A;  4NC7 A;  2DXI A;  3LNQ A;  5FKL A;  1YLF A;  3NWS A;  4HF1 A;  1X19 A;  1H0M A;  3VOD A;  4E7Z A;  3KYD B;  2LDU A;  3ZQG A;  5EG0 A;  2Z99 A;  2KHM A;  2L02 A;  4ZYG A;  1OLT A;  3JW4 A;  4IHV A;  1FSE A;  3ABK H;  1FTZ A;  2FQ4 A;  1YYV A;  3Q5F A;  2EZK A;  4RGX A;  3K0L A;  4CYC A;  2JWT A;  2PJR A;  3QOP A;  1E3O C;  4PJL A;  3LMM A;  3HSR A;  1ZLJ A;  4RMN A;  3FBI B;  4Y13 A;  3DKX A;  3VDX A;  2HKX A;  3SFI A;  2O9L A;  1NHA A;  2OCC H;  3JRE A;  1POG A;  1YTY A;  1R5H A;  2OTL I;  3ZMT A;  2BW3 A;  4D7M A;  1TBX A;  3L2V A;  2V26 A;  1DU0 A;  3ECH A;  4YII A;  1UZC A;  1PUE E;  2JRM A;  3FM3 A;  4CUG A;  3LSK A;  1BC7 C;  4LGW A;  4YIF A;  2ME6 A;  2JJ7 A;  1BR1 A;  4ZTF A;  2WV1 A;  3JTG A;  2VON A;  4F91 B;  1ZAR A;  3HKZ A;  4OOI A;  3LSR A;  3KCC A;  3N4M A;  3K70 C;  2N8G A;  3FXR A;  2OQG A;  4BQA A;  3SYT A;  2VC1 A;  2VIX A;  3K4K A;  5K1Y A;  5J40 A;  1ZTR A;  3GVA A;  1K61 A;  1UHS A;  3IH4 A;  4GYI A;  2OC6 A;  4IHT A;  1HDP A;  1ZN2 A;  2DK5 A;  4MFD A;  2ADU A;  3Q0U A;  4BDY A;  2P4W A;  1MJB A;  3TDU C;  5ILS A;  1LFB A;  5J1U A;  4ESB A;  2RC4 A;  2CSO A;  3H36 A;  2OAZ A;  3MMY B;  2JUG A;  4CCL A;  3OYD A;  1T39 A;  2CW7 A;  3JRI A;  2KPM A;  1MD0 A;  3FHZ A;  1WGX A;  4KDP A;  2BVM A;  2ISZ A;  5CKT A;  1D0Y A;  3BTI A;  4Q47 A;  3HGY A;  3BZK A;  4RA2 A;  1JKR C;  4U0Y A;  3CC4 I;  3AG1 H;  2B0L A;  3DQV C;  4A6D A;  2PQ8 A;  4IQ4 A;  3B02 A;  5FKN A;  3G2B A;  2K3F A;  4CZC A;  3MZH A;  1VQK I;  4A3J J;  2KIM A;  5E79 C;  5HLH A;  4G12 A;  3DKW A;  1D1A A;  3DLL F;  4UV8 A;  3H9J A;  3LFU A;  4L18 B;  4LG0 A;  3KP2 A;  4AYB A;  2K9M A;  4ZH4 F;  5FRM A;  2VUM J;  3BR1 A;  1A36 A;  3I4N J;  5KK1 A;  1ON2 A;  3ML6 A;  5L3E A;  3FKI J;  4II2 A;  1R1U A;  1HST A;  1PUF A;  1D0Z A;  3HUG A;  5LHG A;  3ONQ A;  4XM3 A;  1XTA A;  3OSG A;  2GIZ A;  1A31 A;  3CC2 I;  3HOS A;  4IVN A;  1I1S A;  2QSH X;  3MKY B;  1W7P A;  2M0M A;  2P0W A;  3GTP J;  3W6V A;  1U2W A;  1OR7 A;  3OL3 A;  4E7K A;  2DFH A;  5DYM A;  5J1R A;  2RV8 A;  1Z6R A;  2DN0 A;  3PM1 A;  2JA2 A;  3D1N I;  2DQL A;  1F36 A;  4KIT B;  2D1H A;  1B8I A;  1WQ2 A;  2CUF A;  4G9Y A;  2PMH A;  2JMW A;  5EEA A;  4A0X A;  4RB3 C;  3PNY A;  5ICC A;  2FU4 A;  2VT2 A;  2VBZ A;  5FLV A;  2CWE A;  3BQZ A;  4X0G A;  1Z91 A;  3TW7 A;  1I39 A;  1JI8 A;  3BCB A;  3K10 A;  2MC3 A;  3AL0 C;  3RIR A;  1F9N A;  2P8T A;  1FZP B;  4AC0 A;  2VQL A;  4G94 A;  1EH7 A;  3VPR A;  2M8E A;  2Z33 A;  2CQQ A;  3WU1 B;  3HRS A;  1IUY A;  4MLO A;  5FD5 A;  2A6E F;  2QEN A;  3LFK A;  3H5R A;  1Y1W J;  4UUS B;  1S5L C;  4LOC A;  2RKH A;  4HQM A;  4RAG A;  5B66 C;  1UMQ A;  3J80 Z;  4IHS A;  4XSX F;  2HZD A;  3G4S I;  2H6C A;  1A5J A;  1BOA A;  4AWX B;  2QEX I;  3RZO J;  3JSP A;  1N77 A;  4IHY A;  1Z7U A;  3WU2 C;  1ORK A;  3GCM A;  4B43 A;  3F6O A;  1TWA J;  4XN3 A;  4M3F A;  4J19 A;  1QZZ A;  4RM3 A;  3L2Q A;  3G73 A;  2KIQ A;  2KFD A;  5J1Y A;  2ZJR F;  1T2K A;  4PFO A;  1JKP C;  4AID A;  3K4C A;  5A2Q Z;  4UUT A;  2RGV A;  2VQG A;  1IW7 F;  5C3E J;  2KLO A;  1J7K A;  2E1O A;  3NRV A;  4X1E A;  1I3Q J;  3A01 B;  3FMR A;  3LST A;  4W97 A;  1VQN I;  1ETY A;  2L3D A;  3CCV I;  3D0S A;  3LSP A;  2EFO A;  2EIN H;  3F0C A;  2LK2 A;  2WY8 Q;  2YX7 A;  3IUO A;  2VKD A;  3ZMS A;  4FE7 A;  1LE8 A;  2GA2 A;  2XDV A;  3A03 A;  3I53 A;  4IRH A;  5FKO A;  4LMY A;  3CUQ B;  3KZY A;  3K1P A;  2R7U A;  5KAI C;  4YEL A;  2IA1 A;  2D2W A;  1DPR A;  4HPQ A;  2VXZ A;  2EZI A;  4U7D A;  1OKR A;  1XC5 A;  5KNL A;  2XAH A;  1WJ5 A;  4EQQ A;  3CMY A;  3S1R J;  1Z21 A;  2Q2E A;  4AVZ A;  1H9T A;  1E3H A;  3HOW J;  1E2X A;  2FMY A;  2LC2 A;  1K4S A;  1NG6 A;  5KHD A;  3GZ6 A;  4Q5S F;  3K70 D;  3IP4 B;  1SVM A;  2GAU A;  3ZRG A;  4E7S A;  3WTT C;  3EUK L;  1WKM A;  5H20 A;  1FSH A;  3S16 J;  1CF7 A;  2F2E A;  5D4R A;  1XPX A;  2H27 A;  2ZME C;  1YE9 A;  4JX6 A;  4OIP F;  2R5Z A;  4EJW A;  1TNS A;  2ELJ A;  1OQY A;  3C7J A;  3F8C A;  3BPX A;  3NAU A;  2W82 A;  5D5U B;  4DZJ A;  4UNO A;  2E1M C;  5DUK A;  2DOA A;  3LAP A;  1SC7 A;  3L00 A;  5DV5 A;  3VYU B;  3R4K A;  4AUX A;  1UHW A;  4A69 C;  4BHB A;  3CO6 C;  1X1B A;  3FZV A;  4G7H F;  2DYR H;  1D1B A;  1STZ A;  4X6A J;  4MNU A;  4BXU A;  2QWW A;  3E5X A;  4Y33 A;  3J81 K;  1ETX A;  1V3F A;  5BPD A;  3O3K A;  3HOV J;  4A3L J;  2LY1 A;  1J59 A;  4PSX A;  2AO9 A;  1WRJ A;  1T95 A;  4LIV A;  2F5D A;  3JSO A;  4NB5 A;  3CDH A;  2V9P A;  2MGQ A;  5GAE J;  5LHI A;  2XPV A;  3TDZ C;  2W84 A;  2FOK A;  2JA7 J;  1MSF C;  5K5R A;  3I59 A;  1TWF J;  2JT1 A;  3LA7 A;  3HC7 A;  5DD4 A;  4BYY A;  1I6H J;  1K4T A;  3BT9 A;  3HM5 A;  4F7Z A;  3DFG A;  2K27 A;  1U8R A;  2NNN A;  5CVU A;  3FXK A;  3IH2 A;  2BVL A;  1HKS A;  3EDP A;  4A2U A;  5HOO A;  2M9H A;  5KAF C;  3PFY A;  1NK2 P;  1UFM A;  4YG2 F;  4CGZ A;  4LLL A;  2IGM A;  3FKJ A;  3CDI A;  1T56 A;  4NQW B;  2VJ5 A;  3RPQ A;  2HPI A;  4Y3O A;  4BAY A;  5BQT A;  5BNG A;  3G71 I;  1IRZ A;  2L7K A;  2YSR A;  4QTR A;  1Y39 A;  3KP4 A;  5FRO A;  2IT0 A;  5CJ9 A;  5LGN A;  1ZGW A;  4E7H A;  1BR2 A;  1XSX A;  1FIP A;  3EYY A;  2JA6 J;  4N9I A;  1SFX A;  3OYM A;  4HV6 A;  2A3S A;  1Z3X A;  2COM A;  4OAY A;  4NC6 A;  4MO7 A;  1BL0 A;  1OCC H;  1YHQ I;  4WWC A;  1T08 B;  1YOV B;  2WV0 A;  4OAZ A;  2B7E A;  2ZKZ A;  4BH9 A;  5FKM A;  4A0Z A;  4CO8 A;  2EBI A;  4S04 A;  4OIN F;  4DQ2 A;  3SEQ A;  1ETO A;  3TP0 A;  3HKZ N;  3IRQ A;  4PUS A;  2RAE A;  1U5T C;  2X1E A;  3RPU A;  1ZHF A;  2J5P A;  3WHC A;  4ENJ A;  1WI9 A;  4E6K G;  2Y69 H;  4N4N B;  2NYX A;  1ZAO A;  3OYE A;  1YIJ I;  2HVR A;  5IT9 Z;  2V6E A;  1A04 A;  1QVT A;  1P7J A;  3KEY A;  3B6C A;  4GYG A;  1LNW A;  3CF2 A;  3ZN1 A;  5FFX A;  2X0L A;  4I02 A;  3NAR A;  1UAA A;  4HDU A;  3B6A A;  2BY1 A;  1RPW A;  5JHF A;  1IRF A;  3BR3 A;  2ISY A;  5HDN A;  3DU6 A;  2QUF A;  3BG3 A;  2E5Z A;  1BIB A;  1R4N B;  1XCB A;  2CJJ A;  3RDI A;  4IPA A;  5M5X J;  5HNF A;  5J8F A;  1HOM A;  1I3A A;  2FJ1 A;  3V8K A;  1SD5 A;  2CW8 A;  3S32 A;  5L3C A;  5F27 A;  4F55 A;  4PDK A;  2W7N A;  2YU9 J;  2HQR A;  3P9K A;  2FSW A;  1WWX A;  5F64 A;  2GA1 A;  2Z1D A;  2AQE A;  5F0H A;  2KJC A;  4ZC3 A;  5IY5 H;  2LY9 A;  2VBX A;  3LL7 A;  1KZH A;  1FMV A;  2LP0 A;  4M9X A;  2L2O A;  2JPB A;  2Z2S B;  2MG4 A;  3FHN A;  2RNJ A;  1TP4 A;  3ROU A;  1HC8 A;  2BXZ A;  1ONV A;  2O8X A;  4HX4 A;  4JX4 A;  4AYB N;  3BWG A;  1ETV A;  1S29 A;  1XMX A;  4J00 A;  1HW5 A;  5F0C A;  2NVT J;  5K5Q A;  3C2H A;  2EA2 A;  4ZYD A;  5E1W A;  1BIA A;  2Z3Y A;  3I64 A;  5AON A;  2JZY A;  3AG3 H;  4UVA A;  3ERE D;  2V1N A;  5D8L B;  2LMD A;  2L7F P;  2RNG A;  5D6F A;  4II3 A;  4FTH A;  3BP8 A;  1RKT A;  2WBM A;  2ZME A;  4CZZ A;  4AD9 A;  4A3K J;  1KU9 A;  1BC8 C;  3K4L A;  2KDO A;  3V8L A;  1TWH J;  3OMY A;  3RSN A;  2BHY A;  5GTI C;  2CGP A;  4I01 A;  2QKL B;  1BOB A;  3BR0 A;  1P2F A;  5E8G A;  1KU2 A;  3U1K A;  1YRN A;  2A6H F;  3CES A;  2COB A;  2ZXH A;  2Y0S A;  1GT0 C;  1R1V A;  4YFX F;  3OOP A;  1R36 A;  2IXS A;  4N4O B;  1F5T A;  4S0H B;  3JAM K;  1U9O A;  2ID6 A;  3SFZ A;  2Z9O A;  1Z3Y A;  3ABT A;  1Z77 A;  4XLA A;  3L1P A;  3H5N A;  3U2R A;  2NAZ A;  4YEJ A;  4WCG A;  2VQH A;  2HQA A;  4L9J A;  2UWM A;  5JI6 A;  2DJI A;  4WK8 F;  4HNU A;  3FXO A;  1ZG5 A;  2XSJ C;  2NVU B;  3ZQI A;  3OS0 A;  4KT5 C;  3I55 I;  4AIJ A;  2LNB A;  2ZSI B;  3DU5 A;  1D5Y A;  4LLG F;  5GP9 A;  2CV0 A;  4IX7 A;  1R00 A;  2PLY A;  3CCL I;  4RBO A;  1LEA A;  3GZN B;  2LSO A;  3WTW C;  2F5C A;  2IVM A;  4MEY F;  1FY7 A;  2H6B A;  2UUZ A;  2M7B A;  4JYK A;  1AHD P;  1UHM A;  2ZNY A;  3IRR A;  1QPM A;  3ZQQ A;  4A3D J;  3IWZ A;  2DT5 A;  3QPH A;  3GUD A;  3W2W A;  2XF6 A;  1S9H A;  1YO5 C;  3N05 A;  4ZDL A;  5LRS A;  3W2A A;  5EG0 B;  5IYD J;  2VOD A;  5DS9 A;  5H6Q A;  3DTK A;  2XIG A;  3KFW X;  4NUB A;  1Q1V A;  1LFU P;  1HKQ A;  2BY0 A;  1ZYR F;  3QYF A;  3V8J A;  2CU7 A;  3CQZ J;  1X4P A;  4L5I A;  3M1E A;  3D5R C;  3BCA A;  4CYC B;  2PJR B;  4ENK A;  3S1M J;  3WTX C;  4YFK F;  5IOY A;  1RRJ A;  4XRS G;  2XAS A;  1H88 C;  3DPU A;  4EM1 A;  3FXL A;  2O5R A;  2HZT A;  4ZYA A;  4BL0 B;  2WB1 A;  3S1N J;  3F8N A;  2XKP A;  3O8H A;  3R0A A;  3UKG A;  3FMQ A;  3PUB A;  4CHU A;  4DBQ A;  1JKQ C;  5B5E C;  3OS1 A;  1FBQ A;  3MCZ A;  1JUM A;  2Y9Z A;  2P6S A;  3HRT A;  2KJB A;  2NXN B;  1FYL A;  3E3V A;  2EK5 A;  3JRD A;  4HW0 A;  3ZP5 A;  3GFI A;  2V4J C;  5CVV A;  1APL C;  2DU9 A;  5LFA A;  2HVQ A;  1EA3 A;  5F1J A;  3H3Z A;  4HLY A;  4QPO A;  5EZG A;  2EV5 A;  4A3I J;  2O03 A;  2MD5 A;  4CH7 A;  1BJZ A;  1MNE A;  1JHF A;  3A2K A;  1AU7 A;  1FPQ A;  2EZL A;  1YJN I;  5DCF A;  2I5U A;  2VKH A;  1TQP A;  5E3L A;  1R71 A;  1IG7 A;  4BQN A;  1F1Z A;  3H35 A;  5LD2 C;  5B3S H;  4I99 C;  2HVS A;  3OY9 A;  3BTC A;  2ZO4 A;  3MFK A;  3FBN B;  2JN6 A;  1BJA A;  3H9Q A;  5B1B H;  1VFC A;  5GTH C;  1X3U A;  3M7G A;  4DIQ A;  1OYI A;  1X58 A;  2ZB9 A;  1HXD A;  3ULQ B;  1H9G A;  3CJQ B;  3HBL A;  2OPT A;  3KP6 A;  6PAX A;  3HOT A;  2DAO A;  3ERM A;  3LSM A;  4B3A A;  3GME A;  1DU6 A;  1X1P A;  3CLQ A;  4PJJ A;  1G3S A;  1QZY A;  1X2M A;  4V19 K;  4ESF A;  3PQK A;  2IEK A;  1XCV A;  2TDX A;  1Z67 A;  3V7C A;  2O6G E;  2X6W A;  1WJC A;  3OWT A;  1YQA A;  3K4B A;  1ITY A;  1V54 H;  2WC2 A;  1KQ8 A;  1LB2 A;  2LTP A;  4XMY A;  4E70 A;  2RQP A;  3BG5 A;  4U88 A;  4LG0 B;  3OYJ A;  1JHH A;  1O3T A;  3FXJ A;  3RKY A;  4ZDP A;  1VND A;  2G7U A;  1J09 A;  2IS1 A;  2GXG A;  4F92 B;  1S6L A;  1MIJ A;  2M3A A;  3DEW A;  1AKH A;  1PUF B;  1Q1H A;  2HNH A;  3HUG B;  3V42 A;  2AHQ A;  1F4K A;  1SFO J;  2I8D A;  1HKT A;  5FLX K;  1YX3 A;  1YJ9 I;  3FIW A;  4F93 B;  1MMG A;  2A61 A;  1P9Q C;  1A6I A;  3ZN0 A;  5FLM J;  1I27 A;  3BG6 A;  1W7P B;  3BR2 A;  4A12 A;  4B48 A;  2O0Y A;  5ERI A;  1E17 A;  4RLF A;  3M8F A;  3GW2 A;  4EJV A;  1ZRF A;  2DPU A;  2IS6 A;  2K9L A;  5EEG A;  2BOL A;  3COA C;  4XLC A;  1B8I B;  1ZGA A;  2M2E A;  3IAM 2;  4NC8 A;  5D8K B;  1SMY F;  4ZYH A;  5D6E A;  3L09 A;  3TKY A;  4LIU A;  2IW5 A;  4BHP A;  3QOD A;  3DBH B;  3Q9S A;  1G2H A;  2MAB A;  3HYI A;  4KT6 A;  5L3F A;  1G3T A;  1VQ9 I;  2CQX A;  4I09 A;  4HSR A;  5J6X A;  4BGD A;  4AVP A;  3BR5 A;  1FP1 D;  3QP5 A;  1O3Q A;  2IP2 A;  1MNM C;  2M7A A;  2WAQ N;  2KRH A;  3TO6 A;  1XG1 A;  2EV0 A;  1PVE A;  3MKW B;  2W57 A;  4C3J J;  1K7A A;  4KMF A;  1A6Q A;  3SXY A;  4C9Y A;  3O6B B;  1ZG3 A;  3SDB A;  3CCQ I;  2AS5 F;  4QIW N;  1EH6 A;  2VPR A;  3DKY A;  1AA7 A;  4JP0 A;  3HOY J;  5ILU A;  4RM2 A;  3GO5 A;  4UUV A;  2E2J J;  3L2C A;  2VPL A;  1IRG A;  2K4B A;  2HFH A;  2YX4 A;  4HOB A;  2HDD A;  5DDG A;  1WSU A;  3JCU C;  5IYB J;  1IXC A;  3QYB A;  2X51 A;  1OCZ H;  4NDL A;  3TQN A;  4HYE A;  1IN6 A;  2LY2 A;  2NVY J;  2M87 A;  5ICG A;  4G6D A;  2CS3 A;  4E7J A;  3F23 A;  2FML A;  3L2U A;  4OIQ F;  2X6Y A;  1IDY A;  5F6F A;  1VQO I;  3K4M A;  4OMY A;  1FC3 A;  2BXY A;  1K6Y A;  3K2A A;  2K02 A;  3PJR A;  3G3Z A;  2A05 A;  3G1O A;  2WAF A;  2GBY A;  5GAG J;  2PI0 A;  4BY7 J;  1LE8 B;  2MBF A;  1QBJ A;  4IKF A;  4PGH A;  3T0Y A;  2EFW A;  3ELK A;  1Z1D A;  1QZE A;  5BMZ A;  1X4O A;  2ZNZ A;  3R61 A;  3PIO F;  2DA7 A;  2RDP A;  3RZD J;  3RQI A;  3NQO A;  3VFZ A;  1U6G A;  3HL2 A;  4MEX F;  1IGN A;  2DA3 A;  2QQ8 A;  2OTJ I;  2EB7 A;  2FF4 A;  4L9N A;  3RJP A;  2ECC A;  4L9T A;  1HA8 A;  2Q2E B;  3I4P A;  2NRA C;  2A07 F;  1I1G A;  2IA2 A;  1IXS B;  2VBW A;  1RR7 A;  2DA1 A;  5FFZ A;  4CXF A;  4A3E J;  2JUC A;  1WJE A;  5DCM A;  3RYP A;  4CCJ A;  1D0X A;  5JFR A;  4KYW A;  3VYT B;  2HQ5 A;  1K6O A;  3NEU A;  2EZH A;  4MFE A;  4Z2Y A;  1CF7 B;  4ZDO A;  3MKL A;  3VOE A;  1J2X A;  3F8F A;  3RKX A;  1LKX A;  2R5Z B;  1EF4 A;  2Y0S N;  3E6M A;  3ZGK A;  1OCO H;  3KEO A;  1B9M A;  4FIS A;  4DBR A;  2K9N A;  4OWR B;  3BDD A;  2OA4 A;  5D5W B;  4E7L A;  3W3C A;  3BJO A;  1PYV A;  5EYR A;  3MZ8 A;  2R7S A;  4ETS A;  3KYC B;  2NS0 A;  4ON0 A;  1Z9C A;  2XB0 X;  1WH7 A;  3OYI A;  2VOO A;  1O3R A;  2HPM A;  3T8R A;  2M30 A;  4L5E A;  2R7R A;  4JOM A;  2O8K A;  2ZBK A;  1AOY A;  4F3Q A;  1LUJ B;  1FJL A;  1TWG J;  1FIA A;  3FM5 A;  1R49 A;  2LBF B;  4L0Y B;  2O7O A;  2CQK A;  3FDY A;  2E19 A;  3AG2 H;  3EUH C;  1YX5 A;  4HZF A;  4N9H A;  5JLX A;  3LAJ A;  2F48 A;  1PP8 F;  1EH8 A;  1REP C;  3CJR B;  1VZ0 A;  2NOG A;  3CLO A;  3I59 B;  5GAH J;  3O2P E;  3IWF A;  2B9S A;  2IGK A;  1WHU A;  2RVC A;  3T5X A;  2AXL A;  2OV7 A;  3MN2 A;  1T98 A;  3VB2 A;  4XIC A;  2MSY A;  1R9T J;  1ZK8 A;  4IO9 F;  2A5Y B;  2F4M B;  2R7W A;  1FLI A;  3I71 A;  1TC3 C;  4EJT A;  5IYC J;  3KP7 A;  2OF7 A;  3K9T A;  2VKE A;  1P4A A;  2B63 J;  1MND A;  4QSH A;  2RN7 A;  2CV1 A;  2BE5 F;  1MZB A;  5EGO A;  3TW6 A;  4HQE A;  1TT0 A;  4D1Q A;  2WB1 N;  2A6T A;  1B1B A;  1D8K A;  4CA0 A;  1JUS A;  3LSJ A;  2P81 A;  2LKX A;  3S2D J;  4EAT A;  1HQC A;  1TL8 A;  2O61 A;  1NH3 A;  3SZG A;  3AG4 H;  2YUS A;  3LQR A;  1ENH A;  4DYR A;  1QNT A;  3FXM A;  2QA4 I;  3AL0 B;  3ABU A;  3F8M A;  4EM2 A;  2DOE A;  1Y8R B;  4BXF A;  2Y75 A;  1XMK A;  2QQA A;  1W36 C;  1IDZ A;  1EKE A;  2DCE A;  4RAF A;  2OJE D;  1IRX A;  2I10 A;  3TO7 A;  1WFX A;  1B6A A;  3G6E I;  2DTR A;  1WJA A;  4B1R A;  2HXO A;  3G1M A;  3IC7 A;  4EJU A;  1FEX A;  5F04 A;  1X3Z B;  1RR8 C;  4Q48 A;  5FRN A;  2K4J A;  2DFI A;  1W0U A;  1J0R A;  1X2N A;  2DK8 A;  5LEK A;  3MKZ A;  4JBA A;  4B09 A;  1P4W A;  4B3X A;  2L4M A;  3RKQ A;  1MBE A;  5DM7 F;  2XAJ A;  1ON1 A;  3BPV A;  3BC8 A;  4B8X A;  5J47 A;  4ASN A;  3WTZ A;  5IP9 J;  1JTY A;  2ZFU A;  4ANJ A;  5IP6 A;  1VTN C;  2XF5 A;  1UST A;  2H8W A;  2XV4 S;  3BG7 A;  3QP6 A;  3VWB A;  2K5C A;  3EUA A;  1SD6 A;  2LBF A;  2FEZ A;  4MHG A;  3SEZ A;  1OIS A;  4BJ5 C;  2FBH A;  1RZ4 A;  3CCJ I;  1TTY A;  1IV8 A;  3GEZ A;  4ITV A;  4BEH A;  1XSD A;  1R22 A;  4PJM A;  4I6Z A;  3GF2 A;  2TRT A;  3RYR A;  3WGH A;  3JR9 A;  3NWT A;  2LVS A;  2LF7 A;  1SFE A;  3PSI A;  3OSF A;  1ZRD A;  3W6J B;  3M4O J;  3KE2 A;  2VE8 A;  2EH3 A;  3RTR A;  3MWM A;  1MMA A;  3H92 A;  1X1D A;  2WA0 A;  2DT6 A;  5FJ8 J;  3U9G A;  1QA6 A;  2W00 A;  2DJN A;  2JPC A;  2PMU A;  4IOC F;  1SD4 A;  3R0J A;  2X6X A;  4A5N A;  1YIT I;  1QU3 A;  3GTJ J;  2DDB A;  2QM3 A;  2MC4 A;  4I76 A;  1JE8 A;  1WJB A;  3CF5 F;  3HZJ A;  4XLP F;  2HOS A; 
#chains in the Genus database with same CATH homology
 3CMA I;  3CC2 I;  4IOA F;  1VQO I;  1YIJ I;  3CCS I;  2E35 A;  1FOW A;  4V19 K;  3I55 I;  1ACI A;  3CME I;  3J7Z I;  1S72 I;  5GAG J;  3CCL I;  3I56 I;  2OTL I;  2QA4 I;  1VQ4 I;  3PIO F;  1VQ5 I;  2OTJ I;  3G6E I;  4UY8 I;  1YJ9 I;  3CCU I;  3CD6 I;  5GAE J;  3G4S I;  1VQP I;  2ZJQ F;  5DM6 F;  2QEX I;  1HC8 A;  1FOY A;  1FOX A;  5DM7 F;  1VQ7 I;  3PIP F;  1YJW I;  1VQL I;  5GAD J;  2ZJR F;  1VQM I;  1VQ9 I;  2NXN B;  1YI2 I;  2FOW A;  2H8W A;  1MMS A;  2ZJP F;  3CC4 I;  3CCJ I;  3CJT B;  1VQN I;  3CCM I;  3G71 I;  3CCR I;  1VQ6 I;  3CCV I;  1Y39 A;  1YJN I;  2K3F A;  3CCQ I;  1VQK I;  1VQ8 I;  2E34 A;  3CCE I;  5GAH J;  3DLL F;  1YHQ I;  2E36 A;  1QA6 A;  3J7Y J;  2JQ7 A;  4IOC F;  1YIT I;  4IO9 F;  3CF5 F;  3CC7 I;  5JVG F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...