1VQPI

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
b'GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vqpI00
1VQ7I 1Y39A 3CCUI 1VQMI 4IOCF 3G71I 3CC4I 3G4SI 3CD6I 1YJWI 3CCJI 3DLLF 1VQ8I 3CCVI 2ZJQF 2ZJRF 1VQNI 5GAGJ 1HC8A 3CCEI 1YJNI 1FOYA 1MMSA 1S72I 1YJ9I 1FOXA 3CCLI 4V19K 3PIOF 3CCRI 3CCMI 2QEXI 2NXNB 5DM7F 1QA6A 3CCQI 1VQ4I 5GAEJ 1VQ9I 3CCSI 3CC2I 3I56I 1VQOI 1VQLI 2QA4I 1VQPI 3J7YJ 5GAHJ 2H8WA 3CMEI 2ZJPF 3CMAI 3CF5F 1YHQI 1VQ5I 2E34A 4IO9F 2FOWA 5JVGF 1ACIA 1YI2I 3I55I 5GADJ 2K3FA 4UY8I 2OTLI 4IOAF 1YITI 1VQ6I 5DM6F 2E35A 1VQKI 3CJTB 1YIJI 2OTJI 3PIPF 1FOWA 2JQ7A 2E36A 3CC7I 3G6EI 3J7ZI
chains in the Genus database with same CATH superfamily
2P0WA 2V1DA 3OYEA 3BR5A 2DN0A 2OQGA 4N0BA 2V1UA 1XTAA 4C9YA 3GTGJ 2KKOA 1BI1A 1R5ID 1MSFC 2Y0MA 3TW7A 3CUQA 5J1UA 1TWGJ 2KJCA 4CCLA 1ON1A 3S16J 2NOJB 3AG1H 2R7WA 2R7SA 2FNPA 1TLHB 2HZDA 2VONA 5IP7J 1XGMA 2P81A 2PJRA 3ABKH 2WTEA 5D5UB 3S15J 1AOYA 3LQRA 1ZKGA 2DA6A 4HRIA 2QKMB 2Y9ZA 2QVOA 1YW9A 4G6TB 2LKPA 2AO9A 3I71A 4ZZDA 5EYRA 4M9ZA 5F64A 4WK8F 2LREA 5H20A 3RTRA 4Y17A 2PLYA 1R4NB 2CO5A 1LUJB 3VPRA 4CICA 2BY1A 1I1GA 4M71A 1MJ9A 3CCRI 3VYSB 1JJ8C 3EPZA 2A6TA 2HDDA 2QSGX 5IOYA 4OAYA 2HTJA 2V1NA 3MN2A 1XMKA 1FEXA 2J5PA 2E19A 3HDDA 4YRVA 4RBOA 2BV6A 2QWWA 3QP5A 3PFIA 5JLWA 3OYLA 2GM4A 3S2DJ 2ZFWA 3I56I 2NS0A 4UVAA 3V7CA 4EJTA 1F43A 2GBYA 4LIVA 1Y56A 3F8MA 2QQAA 1FP2A 2CU7A 5BMZA 1VQLI 1BA5A 1I3AA 2QSHX 2IEKA 4PGGA 1LFBA 1ETOA 5J4YA 5FJ8J 3ZGKA 5KCMA 1MMNA 1P4AA 2ZSHB 3KEYA 5DCMB 1VQ5I 2IT0A 4WXHA 4L0YB 3V8JA 5L3EA 1J59A 5C3EJ 3GTQJ 2Z16A 5F1RA 3CJNA 5CVRA 2NVYJ 2VIXA 3RPUA 1DP3A 1LVKA 2R5YA 3KP3A 1SD4A 5EF6A 4AYBA 2W84A 2VBXA 4XRFA 2Z2SB 3NQOA 2KHMA 3ABUA 1TP4A 4C30A 1DDNA 4GYGA 4NQWA 4EQQA 3Q9VA 1JKRC 4GDFA 4C3JJ 1N77A 4BXXJ 1MMAA 5FROA 5E17F 2FBKA 3VYUB 1FOWA 3J7AY 2JA2A 3MD2A 1S3JA 1E17A 3Q3SA 4KT5C 4X0GA 1KU7A 3T8TA 1EH8A 1Y39A 4O3MA 5FKMA 4IHXA 3E5XA 2BZTA 1YOVB 4PFPA 3H3VK 1I6XA 4JX6A 2DO7A 2AQFA 2DA4A 2VKDA 2P8TA 2HOSA 2PMZA 1IZ1A 1TQMA 2MYSA 2R5ZB 3BR6A 3GF2A 3GUDA 1ZYRF 4BE2A 1NG6A 4GFBA 1MW7A 2DFEA 5BNGA 1QVTA 2TCTA 4GXOA 3JAMZ 1P7JA 1JXSA 3OYGA 2M5WA 3BC8A 1VI0A 3CF2A 3GWZA 4E7HA 2P5VA 4F93B 3KP4A 2EIKH 1O3QA 3OYMA 3O3KA 5E3NA 1FOXA 3HOWJ 2KZVA 1YE9A 3WGGA 2O5RA 3GYHX 4F52A 4TV7A 1GXQA 4II3A 3F6VA 4DQ2A 1Z77A 2XGCA 1S7OA 2OQRA 2I10A 1QA6A 4QPQA 3I4PA 3LSHA 3QOPA 4RA2A 2CQKA 5B1BH 1X1BA 5J47A 4D7NA 2LVSA 3KIOA 2ESNA 1ZAOA 3WG7H 2DT7B 3E0JB 3KFWX 1SMTA 1UELB 4OOIA 1VQPI 3AAFA 4XOPA 3MWMA 1GHCA 4BS9A 2QLZA 3J7YJ 2NVUB 1UJ8A 4N4NB 2EA4A 2BOLA 2F4IA 5DD8A 1ZG3A 3E5QA 3TO6A 2I5UA 2KL4A 3CJRB 4HG2A 3OS0A 2ZSIB 2A3SA 2NNYA 3OOUA 3S2HJ 1UHMA 3DPLC 1RC9A 2Y0SN 1BM9A 4IVNA 4FASD 5EG0B 2VBZA 3DP7A 4U0YA 3CUQB 2IBDA 2R7OA 5EEGA 1SFKA 3MAJA 1XX5A 4MGRA 4XRSA 2LBFA 2QUFA 4KN7X 2XGEA 4A69C 1JT0A 1OCOH 3FKIJ 5DTDA 2Y69H 2HVSA 3OL4A 2DFIA 3KZYA 4PJJA 4EMSA 3DBRB 4C2MJ 4DBQA 4I0BA 5JR3A 1TWAJ 3GO5A 5D5XB 4BHBA 2M7AA 3EUKL 1JUPA 3M7GA 2QENA 4CYCB 1KU3A 4EJWA 1FYLA 3JRBA 5HNFA 1SD6A 1JTXA 1UB9A 2VT3A 3K69A 1YW7A 4FISA 2CFXA 1MNEA 2JRMA 4W97A 2L02A 1D1CA 1HXDA 3HGYA 1C0WA 3IH4A 2YS9A 3PSFA 2KMUA 3FF5A 3LA2A 3BJAA 1BR1A 2STTA 3OS1A 1T6SA 5FD5A 3AL0B 1VQNI 4IF4A 5BPDA 2HXIA 2MA3A 1YYVA 3RPUD 3H92A 1FOYA 1KU2A 3GFJA 1P4WA 5K7ZA 1B1BA 4HSRA 2PBIA 4WF2A 3HOXJ 1WHUA 3OIPA 3FKJA 3PQKA 5E1ZB 2KRHA 4G7HF 1T0FC 4BXFA 3A0BC 1FC3A 4IXAA 2QEXI 4A3JJ 2TRTA 1YX5A 2H1KA 5FLVA 5LEJA 2E1NA 4PSXA 5D5VB 3FMRA 1WCMJ 1P9QC 3CCQI 1Y1WJ 3TL4X 1ZGJA 4L9NA 2R5YB 3FZVA 4XNFA 3G1MA 1EF4A 2UZKA 5B66C 1Y8RB 3ZMSA 2UXNA 2M8GX 2DTRA 4YIIA 2QYOA 2RVCA 2CJJA 3ZN0A 1TBXA 1YG2A 3H9QA 2DJNA 2R0QC 2X6WA 4PDKA 5HS8A 1XD7A 2H8WA 3CMAI 4ESBA 3TKYA 4C3IJ 1WQ2A 3IKTA 1IRXA 4G7OF 4Y7NJ 1R4MB 2DPDA 5TISC 5EJCA 4LLLA 4OIOF 1MBKA 3LWFA 4HX8A 3K1NA 2LTPA 2Q8KA 3B02A 1JHHA 4OMZA 2HGCA 3VSLA 3S17J 3OS2A 3KCCA 2QM3A 1CQTA 4M3GA 4B47A 3RDIA 5LGTA 5HODA 5FFZA 3F22A 3GX4X 2VN2A 1VQKI 2P6SA 1OISA 2OTJI 4HLXA 1E3HA 3U21A 3OYHA 1I5ZA 4RGRA 1XSVA 2FQ4A 2H1LA 4UB6C 3TW6A 4KFCA 2IP2A 2DMTA 4KITB 1LE8A 1BC7C 3OOPA 1Y8QB 1NH3A 1ZN2A 2EH3A 4LIUA 3HTSB 1UG0A 2YU3A 5CPRB 4I6ZA 3CTAA 1U8RA 3FM5A 3FMQA 4MTDA 3LAJA 4IOCF 3GTPJ 1G2HA 1JTYA 2H09A 4L5EA 1MJAA 1IRFA 5HS7A 3PUFA 4LG0B 3K4KA 3BTLA 2NVQJ 1Z1DA 3FWEA 2B0LA 2D5VA 4JYKA 2JA5J 3K10A 4AWXB 2XB5A 4M9SA 3TP3A 5JHFA 2ZJQF 3LNQA 2ME6A 2UV1A 3K0LA 4WXCA 4IRIA 1YQAA 4BACA 1BBYA 4A3GJ 4IPAA 3JW4A 3PM1A 2DYRH 5F1JA 1HC8A 1R71A 4Z6YA 4FTHA 4E7SA 4XKWA 1K4SA 4AIKA 3HRTA 3RKXA 1MMSA 4HNUA 3K1PA 4H0EA 2DOAA 2DPUA 3JR9A 4LB6B 5M5WJ 2XRNA 1KGSA 1N25A 4UUSB 2NNNA 4MEXF 1B6AA 2CG4A 2VBYA 2Y9YA 4KIGA 2KT0A 4M6XA 2MFZA 3VYTB 3CCMI 1U2WA 1FMWA 2LP0A 4Y15A 5IP9J 2HPMA 1LEBA 2R92J 1PP8F 5DV5A 3W2AA 5H6QA 2HYFA 2FMLA 3KP6A 3J7AO 4ZDLA 3ULQB 3J81K 2ADUA 2JMWA 2RNJA 3LSMA 3BR2A 3SZPA 4HOBA 3FXJA 1A6QA 3ZMZA 5ICFA 5J1YA 1PP7U 2KQRA 3GXOA 4IL6C 2GZWA 3ZMDA 2IS2A 1RI7A 5E3LA 2QBYA 2GXBA 5H2FC 2F5CA 4P55A 3IWZA 2YU9J 4LJZF 4ESFA 4CHUA 4KYWA 3M8EA 4NUBA 5GAHJ 3W6VA 2HEOA 2VLAA 1RKTA 2DDBA 2HOEA 1K6OA 2JSCA 5KNLA 3BY6A 1FNNA 2RN7A 1UHWA 1IGNA 4RAFA 2XF5A 1TW2A 5J8CA 1W7PA 4N4OB 1J75A 1T95A 3JTHA 2QSFX 5L3DA 3K4BA 2WB1N 3ZCOA 1NTCA 1Y1VJ 3L2WA 2Z33A 4PJNA 1ACIA 1GLNA 3KYLA 2WV1A 4PJ0C 4BEHB 5E18F 3QPTA 3S3MA 3H36A 3K4JA 2O0YA 3ASNH 5AIQA 4BDYA 1K83J 4BHCA 2NOGA 2FEZA 5HLIA 3HSFA 4ENKA 1FTZA 4BJ6C 3K2ZA 3SHFA 3E6CC 2Z5UA 3F72A 2WAEA 4MQ9F 1FX7A 3I3LA 2G7HA 2B7EA 4M3EA 1GT0C 3VYRB 2OF7A 3HB9A 4JP0A 3GTLJ 1SMYF 1O4XA 4BQNA 1FY7A 2LY2A 1YFHA 1O7FA 5CVIA 1PUEE 2E2HJ 3BWGA 1WZ2A 2WA0A 1ZTRA 3A01A 1UFMA 2NYXA 2P6TA 3B6CA 2KDOA 3U1DA 3HG9A 2K9LA 1CF7A 3I4NJ 3T1BA 2ZJ2A 1VF9A 4ON0A 2HDCA 4QIWN 3G71I 1XB4A 4MFEA 1EH6A 1SD7A 2VXZA 3HIFA 4LFUA 4LITA 3G4SI 1R36A 3ERED 3JRFA 2R7VA 3BPXA 3PNYA 1JGSA 2EB7A 2ZCWA 5HDGA 4M6VA 1TZLA 1XC5A 1ZGAA 2P5LC 4A0XA 2IAIA 1TL8A 3MZ8A 1MDMA 1BW6A 2IS6A 2MLKA 2CV0A 1K6YA 4MTEA 5DS9A 3PSIA 3H5RA 3LMMA 2DQRA 1G6NA 1QQIA 4LD5A 3WTZA 4MFDA 2MSYA 1E3OC 3LFKA 1LJ9A 2OJED 5M3FJ 1IN7A 5FGMA 2GWRA 3FK6A 2DA1A 3M9AA 3M1CA 3GTMJ 4CSWA 1APLC 1YS6A 2FA5A 1OKRA 4HX7A 2X85A 3LSIA 3ZN1A 3GFIA 2BW3A 1RETA 3HJEA 3FISA 2HI3A 3G73A 3MZYA 4C2TA 2WC2A 2JUGA 4BQOA 2W48A 4RMNA 3BPVA 2V4JC 2FUG2 1ZG1A 1MZBA 1JHFA 1H89C 2LY9A 3F0CA 4RM3A 5LHIA 2Q1ZB 5E79C 3MEXA 1MSEC 1R23A 1B4AA 1QZZA 2VPLA 3CUQC 2W24A 2D1VA 2JTVA 2ZFUA 3VDXA 3FMSA 1Y0UA 4WXDA 1MBFA 5K5OA 2O7OA 3UKGA 1ZLKA 3S14J 1UG2A 2DW4A 2B9SA 1ON2A 2VI6A 2A07F 4NNJA 2ZJPF 2CQNA 3AFHA 4EEFG 4XLFA 2XPWA 2K9QA 5D5WB 1LE8B 2LYCA 5CYVA 3WG9A 4OAZA 1ZHFA 2LDUA 2DU9A 5CVUA 1Z6RA 4IHSA 1KQ0A 2ZO4A 3V8KA 3WE3A 4FCYA 1X4OA 4HEA2 4A3DJ 2DK8A 2XAHA 1X3ZB 1H9TA 1FSHA 1D0ZA 4EGZA 5LRSA 2J5OA 3WU2C 4ZYHA 3I55I 1IO2A 1WJ5A 2K3FA 1OQYA 5J8FA 1A31A 2HFHA 1FYKA 3CP2A 2HXOA 1UHSA 3GZNB 4IJAA 4O6JA 1WH5A 3GTKJ 4BU2A 1YO5C 1F9NA 4IZZA 3G6EI 3J7ZI 1BR2A 4PZJA 3DEUA 4IHVA 5FO5A 4ABZA 4EM2A 3M8JA 2IJLA 1IN5A 4A0YA 3CD6I 4I2OA 4R1HA 3ASOH 3GTOJ 2VOPA 2DMNA 2PI0A 3E6MA 1IJWC 1OCRH 2ECCA 2ZJRF 1A36A 3C18A 1W7PD 1J0RA 2QBYB 2EJRA 1Z05A 2R7UA 2P7VB 3DFGA 2L01A 3RKQA 3COAC 1IXRC 4AIDA 4BHPA 1LVAA 1G3SA 4XSXF 2W00A 4Y4RA 2GXAA 1JKQC 3B6AA 3I53A 3RSNA 2HDWA 4KDPA 4XN0A 2VB6A 1EKEA 1T39A 2PX9A 5CKTA 3ZQGA 3C7JA 3TGNA 2FU4A 2JA7J 3TOBA 1YX3A 1W7PB 1ZR2A 3BG3A 3G1OA 3PL8A 3FXMA 2BHZA 5GAEJ 3F23A 4A6DA 2XC7A 2RC4A 3R60A 2VQCA 2PMUA 4FX0A 4LK1F 3IRRA 5FKNA 2R7ZJ 3HC7A 1QVUA 3DPTA 2E7WA 4PJMA 5HNHA 1YW8A 3HSRA 4M73A 2EZKA 3WHBA 5JVTA 1U0JA 4XL9A 1SFEA 1XS9A 1IF1A 2OZUA 5DYMA 2ZXJA 3DF8A 1J09A 2BXZA 1MJBA 2YR2A 2K9MA 2Z99A 1UMQA 1AKHA 1CF7B 1I27A 2HVQA 3R4KA 2O3FA 2R7TA 4A3IJ 2IPQX 3O8GA 3Q9SA 2KRCA 4LOCA 2FBHA 2F48A 2WY7Q 3KYDB 2CW7A 4M9XA 1N78A 1D1AA 2M30A 1TC3C 1XCBA 1H9GA 2ID3A 5D8KB 4A3CJ 5GP9A 4CCNA 2O8KA 4D1QA 3FHZA 1MDMB 1ZR4A 3KP2A 2LSOA 2D45A 2IGMA 3K4LA 2A5WA 3IAM2 1M1EB 4LG3A 1MH3A 1ZRCA 2DXIA 4HZFA 1BR4A 5K5RA 4AVPA 2L4MA 2L7KA 4B4CA 3NWTA 2FXAA 1N75A 2EZLA 1Z6TA 1U9OA 2OBPA 2R7DA 1Y0NA 4JOMA 4RLQA 4NHJA 4YFKF 2MW8A 4XQFA 4QWQA 4RGUA 5F6FA 2AHQA 2NAZA 3L2UA 2F5EA 1K7AA 5L3CA 1O3TA 3HKZA 2VKVA 1SVMA 3AKZA 4UVCA 4RM2A 4YEJA 2OU2A 1R49A 2DBBA 3F8NA 1B8IB 2LF8A 5BPIA 2HQAA 2EIJH 1REPC 3GEZA 1ZK8A 2OD5A 2VBWA 3BDDA 3RJPA 1ORKA 5J4VA 1KONA 2DOEA 2NRAC 1HW2A 3OYJA 3UNGC 2IA2A 4WCGA 5LHHA 2VOOA 1HKTA 2CUEA 2CQQA 1BI3A 4OWRB 3A03A 4NC6A 4XORA 2BHYA 4GGGA 4M3BA 3JAMK 5KHDA 4B1RA 2NXNB 3E5UA 1U8BA 2M0MA 4ESJA 3HOUJ 4AVZA 3RCOA 4CCOA 4KN4X 1BIAA 1D0XA 2D2WA 2X1CA 4E4HA 5A2QZ 3EQLF 4KIBA 1LB2A 2HYGD 4E7ZA 5E3MA 1PVEA 3TP0A 2COMA 1GXPA 3DEWA 3KPHA 3HOZJ 2GIVA 2O9LA 3GFLA 1MBHA 2QGUA 2MC3A 1Z9CA 4A12A 4U0WA 2W85A 3IC7A 5FD6A 1WH7A 3ZMUA 1YHQI 4W1UA 3H5AA 2XB0X 4YIFA 5TGTA 3Q0WA 4MQVA 4DYCA 3QU3A 2HTSA 3GW2A 3TOAA 2F5DA 2LF7A 4IHYA 2BXYA 3OYCA 1R1TA 4OIRF 1BN5A 2WBMA 3HRUA 1FSEA 3ABMH 4AYBN 4S04A 1YI2I 3DKWA 2OCEA 3BJ6A 3WTUC 1YRNB 1G8XA 3JRHA 1OCZH 1RPWA 1ZQ3P 3ML6A 1XG1A 4EV0A 2RKHA 4UXNA 1H8AC 4KMUX 3QPLA 1FZPB 4LLGF 1BC8C 2LR8A 1GV5A 5JI6A 3NEUA 4BQAA 1U9NA 3RZDJ 5B1AH 4BGDA 2WAQA 2F5FA 1ITYA 3R61A 1XN7A 1STZA 3M8FA 3CCJI 3CC7I 2ME0A 2XAUA 2MGQA 3WODF 4YELA 3WGIA 1H0MA 1SAUA 5KAIC 5CVVA 3PNVA 2PMZN 1X1CA 1EJ9A 1YJWI 1K79A 1T08B 3TDUC 3N4MA 2E7XA 3SYTA 2PJRB 4L18B 1VFCA 2KIQA 3U1KA 3E7LA 4D5CA 4MLOA 2QZ8A 5M5YJ 4Q5SF 3SZTA 4EJVA 4HAMA 5KAFC 3E6DA 1TNSA 1TWCJ 4CYDA 3LFUA 3CO6C 1YJ9I 2JA8J 3ZP5A 3HEFA 4G94A 2KIMA 3F9KA 5HOOA 1IAWA 4Q47A 4V19K 4UUTA 2W25A 4HF2A 3DTIA 2JPBA 3KYCB 3W6JB 3S3OA 3L2CA 2MC4A 1AKHB 2BY2A 3I54A 4G6QA 1IDZA 3DU5A 3KP7A 3ZQLA 2CGPA 4D7MA 1G3YA 2BYVE 1ZRFA 1OYYA 5GPAA 3BTJA 2H8RA 4DJAA 4BE1A 4DGWB 3CO7C 5FRNA 3H1CA 3P7NA 2COBA 3TEDA 3CJQB 1A6IA 3IV5A 1KQ9A 1XSXA 2Q0OA 3HYIA 4L9JA 1Z21A 2M9HA 1I50J 2ZMEA 3CZ6A 1AU7A 3FXLA 3NARA 1J9IA 2HKXA 3PUBA 2X9DA 1IV8A 1D8JA 3DQVC 3WHCA 3OYDA 2WY8Q 2DJIA 2XGDA 1G59A 5LBQA 3I59A 2V1XA 3JRGA 2H94A 3HRSA 5HLGA 4A3EJ 3HHGA 4LGWA 1XCVA 1KA8A 4P9FA 1HSTA 4NQWB 3LQQA 2BY3A 4NB5A 4HA8A 3WTTC 5GPCA 4BNCA 4II2A 3ZOBA 3V7SA 3K70D 2ISZA 5D6EA 2E35A 2LKXA 3CLQA 2UWMA 1ZRDA 3A4CA 3RZOJ 1QPIA 2IS1A 2IGNA 1J7KA 3NWSA 3O8HA 3OR1C 4D5FA 2QQBA 3NRVA 1RR8C 2KIFA 4E70A 1BL0A 2PN6A 1DPUA 3HSEA 5ICCA 1S7AA 3FXKA 3RIRA 5GTHC 3FBNB 4ZDPA 3CQZJ 3R0JA 3R0AA 3ZR8X 1I1SA 4I98B 1X3WB 2QF7A 5ED4A 1FIPA 1QNTA 1RIOH 3HOSA 2VQLA 3HXLA 2EFWA 5GAGJ 2EZIA 3MKZA 2MLGA 1KZHA 4C3HJ 1ZLJA 3H0DA 1X58A 3OYNA 3JRAA 1HSJA 2OUMA 2DLLA 3TMOA 1ZG5A 2Y2ZA 3MKLA 3MZHA 4NDLA 1QBJA 5LRRA 4ZYDA 2G7UA 5FKLA 3JTGA 4ZTFA 1E3PA 4DNCA 1HOMA 5CLSA 1K61A 1R1UA 1T33A 2NVTJ 3ERMA 1QO0D 1Z3XA 4FQGA 4JQFA 4PJLA 1MNDA 4Y33A 2V7FA 4G7ZF 3VFZA 2JA6J 2CRGA 2JRTA 3V7RA 3D0SA 3RQ4A 2OPTA 3G2BA 2XGXA 1VQOI 2HWVA 2OV7A 1P92A 1EV7A 1SFXA 4ITVA 2WV0A 2LH9A 5DD4A 3ZQ7A 1P7IA 1IN4A 2KPMA 3KLNA 5L3GA 1B9MA 1F4KA 4AM3A 5E20A 2CW0F 1X1AA 5LHGA 2X48A 2GA2A 3WU1B 1KU9A 2EWNA 4AIJA 2LLKA 2DQLA 1K78A 1VZ0A 1UAAA 1T98A 1USSA 2IS4A 1LDKB 2W4SA 4ZC3A 4BYYA 5J6XA 2NS7A 1NHAA 5E8GA 2PJPA 2CWEA 2XSJC 3FX3A 4B43A 2LBFB 5DEQA 1O57A 3EUHA 4WX9A 3L09A 4RS8A 4Y52J 4CCJA 3W3CA 4UHTA 4P5OA 2VASA 1WJEA 2V6EA 1IRGA 2E1OA 5HS9A 3L2VA 5LD2C 1A35A 4F91B 4WWCA 1HF0A 2L9RA 3CUOA 4EJOA 4G12A 2JQ7A 3F8FA 2MH9A 3FM3A 1O3RA 2YPRA 4HF1A 4ENMA 1VQ7I 1W36D 1GVJA 1IRZA 1BIBA 1B59A 4HQEA 2DCEA 3RYRA 2P4WA 3VWBA 4L9TA 2LG4A 2LFBA 2K4JA 3A02A 1JUSA 3FDYA 2G0EA 4HV6A 2M87A 1IV6A 3N05A 4JK1X 4RB1A 1QRYA 3H9GA 2V9VA 4AUXA 5HDNA 2BE5F 5GTIC 3JSOA 3JRCA 4BY1J 1DU0A 2UXXA 4B48A 2FNAA 2XPVA 1R6RA 1R9TJ 1D0YA 3HRMA 3B73A 3DPUA 4XIDA 3CCEI 3ZQIA 1TNTA 2EK5A 4XRMA 2D1HA 1HDDC 3H3ZA 1XMAA 1NG7A 2A61A 3V42A 1S7EA 2ZMEB 3FXRA 4DYQA 4OINF 3S1RJ 3SQNA 1MKMA 3F8BA 1UZCA 1MH4A 2KZGA 5FLXZ 5IPAA 2PG4A 3F3XA 3FXQA 4HNTA 1TWHJ 3I59B 2ZNYA 5F04A 3F21A 2KIUA 1ETXA 4XR6A 4QPOA 1WI9A 3S93A 5TRDA 2OA4A 1WJFA 1RUOA 3HPGA 3TDZC 1WPKA 2M4GA 4AIHA 3CCSI 4BE0A 1ENHA 3BR0A 2JVGA 3M4OJ 2F5VA 2EPFA 5IT3A 3ZQFA 4E7KA 1MGTA 2PQ8A 2R3SA 3GBGA 3OIOA 3GZ5A 2DMPA 3OMYA 4S0HB 2X1EA 1IW7F 3RQIA 4XN3A 2DA7A 1U5TA 5EEAA 1T56A 4ASNA 2BBYA 4F55A 5DCMA 2ELKA 4HX4A 4EM0B 2KP6A 4ETSA 2EQRA 4MHGA 2RQQA 5EGOA 4CUGA 3BTCA 1R5HA 2A68F 2M45A 1ONVA 3BG5A 5KK1A 3KZIC 4UB8C 4XICA 2A6EF 2FBIA 2LNBA 4U87A 3M07A 1ZGWA 1T8IA 3BT9A 2RREA 5CJ9A 4YG2F 3WU0A 3ZQQA 2PMHA 3ECHA 3LSKA 4PFOA 4XMYA 1FP1D 3RPQA 3OSGA 5DUIA 1MIJA 2W1OA 3QP6A 2ISYA 3HUGA 2XDVA 3OR2C 5DUKA 5K5QA 4DZJA 3W6KB 2JUCA 1JKPC 1FBSA 1JE8A 4B3AA 4HDUA 3K6GA 3DTKA 2L7MP 4RB2C 3KETA 3HL2A 1VQMI 4A93J 1YLFA 2OCCH 2LD5A 2R93J 4F7ZA 2P5KA 2M3AA 2E71A 1J2XA 3TBIA 2FE3A 3HM5A 4P1WA 1LFUP 1W5CC 2JWTA 5LLQA 2GLOA 3WE2A 2E1MB 2CQ7A 1QHHD 2XHKA 3SZGA 4RLFA 3JRDA 2QCOA 4YFXF 1KYZA 1V3FA 2O03A 3BG7A 1QGPA 1XGNA 2CW8A 1OR7A 3GLXA 2R5ZA 5JLXA 3S1MJ 2EBIA 4FE4A 2F6CA 2L4AA 4PUSA 2L9SA 3KEQA 1B72A 1J5YA 1IXSB 1XPXA 1I39A 2E5ZA 4A6EA 5HDKA 4BH9A 2OAZA 2AXLA 1Z7LA 2Z3YA 1S72I 1XDSA 3H0GJ 2VUMJ 1OYIA 2BY0A 1WJAA 4DW6A 3BTIA 2OC6A 3CCLI 4J00A 4UNOA 1OYWA 4F3QA 4CGZA 1F36A 2KFDA 4XLNF 3OYBA 3E1SA 4IHWA 1G3TA 1K4TA 5B5EC 1D1BA 2EINH 1HKQA 1K78B 5IT9K 2HOAA 2NVXJ 2MG4A 5L3BA 4M6YA 2VPRA 4E7JA 2XSDC 1DGWY 4BBSJ 2ECBA 1PYVA 5L3FA 4OIPF 1GDTA 5IT9Z 2JVHA 2EFPA 2YX4A 3GCMA 3CDIA 1DGRM 1BJAA 1LDJA 1D3YA 1SAXA 1XGSA 4A3LJ 1FJLA 3O2PE 3WGHA 5IY5H 4K2EA 4BQQA 4ZYAA 2DMQA 3BG9A 4R79A 3L7WA 5DCFA 2GOMA 2HKOA 4OMYA 1RKWA 3ZRGA 4HQMA 3IH2A 4BXUA 3I0TA 2IXSA 2L3DA 1UCRA 3OYAA 2KJBA 2RV8A 2EFNA 3P9KA 2CQXA 4I99C 1IN6A 3DWLE 5F0HA 3K70C 4J01A 3S1NJ 4C2UA 2I8DA 1MBJA 1ULYA 5EG0A 5D4SA 2NS8A 4Y13A 2X1DA 1FBUA 4ENNA 2XUBA 1HBXG 3REOA 1TTYA 2K4BA 5DM6F 1HW1A 2CS3A 5JFRA 2F2EA 2E2IJ 1S9HA 2H6BA 2X4HA 1ODDA 2LRDA 4QLCU 4CDGA 5KVRA 1FPQA 3A01B 2RGVA 3D5LA 1QZEA 1KQ8A 3M3YJ 1HW5A 2DFHA 3GZ6A 3LSGA 2HQ5A 4CYCA 1LQ1A 2HU9A 2LKSA 2MBFA 4A5NA 4ENJA 3BP8A 3DCFA 2EILH 3N97A 2VQHA 3KE2A 4KMFA 2RAEA 2ZXIA 3U9GA 1MNMC 1FWZA 3W2WA 3HPHA 4HBLA 2DYSH 2P7CB 2R7XA 4HYEA 4OU0A 4D9JA 2ACJA 1EA3A 1IDYA 4KISA 5EZHA 1A5JA 3FK7A 2DA5A 2M8EA 3LAPA 3ZPLA 2BW3B 4PGHA 2EFQA 2ESHA 4Y3OA 2JZYA 4I02A 2DOFA 2O6GE 2X6YA 3F6OA 2L7ZA 3ROUA 1BOBA 4KA4A 2HS5A 3QRFF 1FYMA 1U5TB 4BY7J 4GYIA 1X3UA 3DBHB 2G9WA 3DU6A 4UUVA 3S1QJ 1RESA 2ZC2A 3V4GA 3ONQA 4XOTA 1OLTA 4P96A 5EGOB 4HPQA 3Q0UA 3TO9A 3ECOA 4UV8A 2HVRA 3ZXSA 3ZMTA 4AC0A 4XLPF 4ZTJA 2QQ9A 5CQGA 5H6RA 5LGUA 1Z3YA 3FBIB 1MD0A 3PJRA 1RNLA 3PO3J 1OJLA 2H6CA 1L0OC 1SFOJ 4XLHA 3CMEI 2DDAA 3HUGB 2VE8A 3DKYA 3LA3A 3SEQA 1F1ZA 3Q5FA 3H9JA 4GO1A 2WWYA 3EYYA 3BZKA 2MD5A 2EIMH 5A2QK 2CV2A 3QYEA 2PFBA 3I4MJ 2FSWA 3DEEA 3A1YA 3HOTA 3CMYA 1V54H 2R7QA 1JT6A 4M74A 4RDUA 2KISA 2Y0SA 3A0HC 4P9UA 1W0UA 2A05A 3VODA 2K02A 4JX5A 1R7JA 5BOXA 3CCYA 5GADJ 3WTWC 1S29A 1XGOA 4IQJA 2XAJA 4UY8I 3MKYB 2XAQA 5IYDJ 1X1DA 2LOOA 3MCZA 2CV1A 1FIAA 1W36C 4A0ZA 3ZMVA 6PAXA 4Q4ZF 1B72B 2M0CA 4CA0A 4MNUA 2A6HF 3DTEA 3NAUA 4RB0A 5AONA 1X2NA 5ERIA 1WJBA 1V5GA 2EFOA 3P9CA 1R5GA 2ZMEC 4NBQA 2E60A 3CCUI 5ILVA 4IRGA 1SEUA 2EZHA 4LK0F 3HKZN 3CC4I 3KZZA 2L0KA 4U7BA 4XRSG 1R1VA 1T2KA 1OCPA 2VODA 3ZQCA 2FQ3A 2MD0A 4R8HA 1P2FA 4X1EA 3LA7A 4LG0A 3L2QA 2ZXHA 5FKOA 4LMYA 5F08A 4YIRX 3L2RA 3OSFA 2XVCA 5FFXA 1W5SA 4IX7A 1MMGA 4EVIA 5FKKA 1V4RA 1IC8A 3R6SA 2L54A 1OCTC 2VT2A 3V8LA 2FD5A 2BVLA 1R22A 3HGGA 1U6GA 3IUOA 3MMYB 2CUJA 1NK3P 2W7NA 2W82A 2AS5F 1ETWA 1ETVA 4V2GA 4BJTA 4LB5A 3C3WA 1P4XA 5ILUA 4S05A 3ESWB 1DQUA 4JBAA 3AG2H 4UUSA 4I09A 1Z0XA 4UVBA 3ABLH 5LEKA 4XONA 5BS6A 1HCRA 3ZQHA 3AG4H 2M1BA 2FJ1A 1VQ4I 1VQ9I 3CP8A 2E2JJ 2XF6A 4XKCA 2YUSA 2QQ8A 2RNGA 1BW5A 2V26A 1QU3A 2K85A 1WVRA 1ETYA 4BUPA 2CSOA 4G9YA 3MFKA 2QA4I 5C4XJ 4U88A 3L00A 1H88C 4MEYF 3KLOA 2FF4A 1S8NA 2Q2EA 3KX2A 2HQNA 4RGXA 5TJJA 1TT0A 1DP7P 4E6KG 4ZYGA 3LSJA 1ZELA 2LC2A 2LK2A 3VSKA 4CZCA 5C4JJ 4OIQF 2RQPA 2E34A 5ICEA 4IO9F 4RGSA 1FMVA 4PSWA 4PCQA 3EYIA 3GFMA 3AG3H 4FT8A 4NC7A 3L9FA 4FHTA 2DA2A 2E5NA 2IGKA 2E1MC 3Q0VA 4JX4A 3HTUA 2VQGA 4FE7A 5F0CA 4BEHA 4ZYEA 5IYBJ 1WJDA 1PUFA 2OTLI 1MBGA 1TQPA 1HA8A 2K86A 3BCAA 1YITI 2VKEA 4I0AA 1VQ6I 2XAFA 3QPHA 4XLEA 1ZH5A 2WAQN 1WI3A 3RYPA 3QPSA 4HF0A 5ICGA 5LFAA 2HYJA 3SDBA 2WADA 5DDGA 5BQTA 2VJ5A 3BCBA 1V5FA 4I76A 1W5TA 4XKVA 3I64A 4YFNF 2MH2A 3OYKA 5E1XA 4A3KJ 2CUZA 2XRLA 1B9NA 3LL7A 4KICA 1WKMA 2VC1A 3K4CA 1RUNA 2EV6A 3HBLA 4N9HA 4ZH4F 3BR1A 3W2VA 2CMPA 1D8KA 2ZXWH 4RB3C 2B63J 1VQ8I 3PO2J 4MO7A 2F4MB 3LSRA 3EUHC 1ZREA 2R7RA 3SFZA 3T8RA 4XKBA 1R58A 2IA1A 3UR3C 2DT6A 3C1DA 4E7LA 3S3NA 2BVMA 4KIFA 3LSTA 2XKOA 1YJNI 2DT5A 3BROA 4D0PA 3WTXC 5EEHA 1SD5A 5FB2A 3WTVC 4L5JA 5AIPA 5HLHA 2ID6A 4ZDOA 1TQIA 1OFCX 2ZBKA 3IHUA 5ILSA 2L5QA 3CESA 4DZPA 3MVPA 3EDPA 3RKWA 1QZYA 4X6AJ 1MMDA 1OMIA 5HVQC 4I01A 1Z67A 1MBEA 1JI8A 2IGOA 3SJMA 3QU6A 1I3QJ 2Y31A 3HOYJ 3HOVJ 2DODA 4M72A 3T0YA 3TQNA 5DM7F 3M1EA 5E3OA 1LDDA 2Y75A 4F92B 5HLTA 4EM1A 2VC0A 2R7FA 3K4MA 4IQ4A 3GMEA 3OV8A 9ANTA 1RRJA 4B3XA 3GLLA 4U0VA 3FHNA 5IOZA 3ABTA 1TWFJ 2FX0A 3QYBA 4KUMA 4XLAA 4BBRJ 1TW3A 2UUZA 3K7AJ 3JREA 5EZGA 3H35A 5D8LB 2GQQA 1WJCA 2O61A 1YIOA 1HDPA 4IKFA 2STWA 3KP5A 3CF5F 2N8GA 1VNDA 1T38A 3I9V2 2X6XA 2FOWA 5IYCJ 2W57A 3GTJJ 4V2FA 2DI3A 3IP4B 5IP6A 2WB1A 3ISPA 2KDZA 3BG6A 1GVDA 4HW0A 1R00A 1G4DA 5CQEA 3DLAA 2K9SA 3FXUA 3OWTA 4U7DA 2GOXB 3LOCA 4M3FA 1X2MA 4EJUA 5FRMA 1LKXA 2VJ4A 3MKWB 2FOKA 4CZZA 1QHGA 1O3SA 1D5VA 4DOZA 2VXDA 1CGPA 3PIPF 1FOKA 2PEXA 3QODA 4Q48A 1T0FA 4BJ5C 4GCVA 4A5MA 3S8PA 1V55H 1GUUA 3JCUC 2KRFA 5E8IA 1U5TC 2CH0A 3HZJA 5CVJA 3QAHA 3C2HA 2L2OA 2ETHA 1V5EA 3SFIA 5B3SH 3BOQA 3BQYA 1EH7A 1LNWA 2F4OB 2VJJA 3PNTA 4QSHA 2A69F 1SC7A 2IRFG 2HQRA 4BL0B 1ZARA 1X4PA 2XASA 4BKXA 4LLNA 5M5XJ 1SFUA 3G3ZA 2EA2A 3IH3A 2IW5A 2JK3A 4KNYA 4UV9A 5EDNA 1USTA 3OL3A 1YTYA 1DUXC 1S6LA 4B8XA 3J81Z 1FLIA 3EETA 1WRJA 3VOEA 2Q2EB 2Z1DA 4A3BJ 3H5NA 3TO7A 2XF7A 1W0TA 3QYFA 3P5JA 3VEPA 2ELHA 3BQZA 1HKSA 2AXTC 2ICWG 2K27A 1DU6A 1IN8A 3PIOF 1IUYA 4J19A 3IWFA 1RZ4A 3DKXA 1TT5B 1ETKA 1GV2A 1PJRA 2ZNZA 4N9IA 3T5XA 2X0LA 1W4MA 2ELJA 3JSPA 1X1PA 1W1WE 1FT9A 4XSZF 1JUMA 2YSRA 4QTRA 3IL2A 1QPMA 3IRQA 1WSUA 3IKVA 3K9TA 5F0FA 5K1YA 3J80K 3CC2I 2V79A 4MIMA 2O8XA 3BLYA 3RI4A 1Q1HA 3CMMA 2FMYA 1I6HJ 1PUFB 3E3VA 5FLXK 2E1CA 4FETA 4A2UA 4L9VA 1LPQA 1OR7C 4B44A 4H4KC 4CXFA 3J80Z 4XLCA 1IG7A 3WTSC 5FLMJ 1WWXA 1JGGA 4DBRA 2JSPA 1OPCA 3DBLB 3O6BB 3LSPA 1BJZA 1IUFA 4EATA 3OY9A 2XV4S 3BJOA 3FIWA 2OZ6A 5J3LA 2AQEA 2GIZA 1SVOA 1WGXA 2LMDA 2HR3A 5D6FA 1BOAA 3E6BA 4CH7A 4ZJZA 4A3MJ 1U78A 1RR7A 4RAZA 1E2XA 2C6YA 2YX7A 4KT6A 3S2WA 2GA1A 1U3EM 4IOAF 1D5YA 1VTNC 1S5LC 4ANJA 1HQCA 2M7BA 4HLYA 3OIQA 2V9KA 1BI0A 3P9IA 1PDNC 4AD9A 3CJTB 1YIJI 5K7FA 4A3FJ 1WFXA 4E7IA 3D5RC 4XM3A 2V6CA 1LEAA 3PQJA 3F8CA 3QOEA 3WTYC 5LGNA 2E36A 2L9NA 2K5CA 3EUAA 2K9NA 4HV5A 2GAUA 3BR3A 4I7HA 4L5IA 2CUFA 1JKOC 4HNVA 1O7LA 3GVAA 1NK2P 1F5TA 4DIQA 1A04A 1SVLA 2M2EA 3MQ0A 3CDHA 2DAOA 2IA0A 3VB2A 4DYRA 2ZKZA 3ELKA 3QWLA 3DLLF 5K7HA 1L3LA 3CCVI 1BI2A 2K3PA 3FXOA 5JHUA 5J1RA 1FBQA 2XPUA 3IAS2 1B8IA 1SANA 2RDPA 4AU7A 4CCMA 1E0EA 1P6RA 2HNHA 2M34A 3JRIA 2M4KA 3L1PA 1HLVA 2GXGA 4NC8A 1POGA 1XMXA 2DK5A 2DMUA 4CO8A 3C2GA 3D1NI 2XROA 4O5VA 2XKPA 2ZB9A 3OYIA 3RKYA 4HDVA 3KEOA 2VL8A 4RAGA 4EGYA 2Y30A 2X51A 4RAYA 1Z7UA 4IHTA 3BZCA 3S32A 2HOTA 2Y48A 2JPCA 1KYWA 5E1WA 1ERDA 2VKHA 2MABA 4L0ZB 1JJ6C 4BAYA 3OYFA 3K1MA 1DPRA 2EV5A 3CLOA 4G8XA 1AA7A 2IVMA 2K40A 2XIGA 2L9VA 4PK4A 4B09A 2A5YB 4G6DA 3PFYA 2WAFA 1AWCA 2XAGA 2HPIA 4HSTA 3AL0C 5M3MJ 2VE9A 3DXJF 4Z2YA 2CFOA 2FRHA 2DTZA 2L7FP 1IXCA 4BDZA 4GRIA 3K4NA 4FX4A 3SEZA 2BEOA 4M3DA 1LFPA 4IEJA 3K2AA 4KJZA 3U2RA 5JVGF 2BGCA 2HZTA 3G1LA 4CCKA 3C2BA 2LY1A 3H3UA 2K7LA 2KLOA 2QKLB 2X6OA 3CDLA 2EV0A 3QQAA 4IRHA 2VJIA 2H27A 1X19A 3E97A 2JT1A 3HHHA 2Z9OA 1AHDP 2DA3A 1FTTA 2TDXA 1YRNA 3BZ6A 1XSDA 2CYYA 2V9PA 3A2KA 1Q1VA 2DFFA 5C44J 5F27A 3I5UA 1XDUA 2R4GA 3X2QH 4ZZLA 4XK4A 1OCCH 1G3WA 3I58A 2JN6A 1YS7A 1Z91A 5J40A 2JJ7A 3SXYA 5D4RA 1ETQA 3DV8A 3SDGA 1Y6IA 4XBFA 3D5SC
chains in the Genus database with same CATH topology
1VQ7I 1Y39A 3CCUI 1VQMI 4IOCF 3G71I 3CC4I 3G4SI 3CD6I 1YJWI 3CCJI 3DLLF 1VQ8I 3CCVI 2ZJQF 2ZJRF 1VQNI 5GAGJ 1HC8A 3CCEI 1YJNI 1FOYA 1MMSA 1S72I 1YJ9I 1FOXA 3CCLI 4V19K 3PIOF 3CCRI 3CCMI 2QEXI 2NXNB 5DM7F 1QA6A 3CCQI 1VQ4I 5GAEJ 1VQ9I 3CCSI 3CC2I 3I56I 1VQOI 1VQLI 2QA4I 1VQPI 3J7YJ 5GAHJ 2H8WA 3CMEI 2ZJPF 3CMAI 3CF5F 1YHQI 1VQ5I 2E34A 4IO9F 2FOWA 5JVGF 1ACIA 1YI2I 3I55I 5GADJ 2K3FA 4UY8I 2OTLI 4IOAF 1YITI 1VQ6I 5DM6F 2E35A 1VQKI 3CJTB 1YIJI 2OTJI 3PIPF 1FOWA 2JQ7A 2E36A 3CC7I 3G6EI 3J7ZI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ7 I;  1Y39 A;  3CCU I;  1VQM I;  4IOC F;  3G71 I;  3CC4 I;  3G4S I;  3CD6 I;  1YJW I;  3CCJ I;  3DLL F;  1VQ8 I;  3CCV I;  2ZJQ F;  2ZJR F;  1VQN I;  5GAG J;  1HC8 A;  3CCE I;  1YJN I;  1FOY A;  1MMS A;  1S72 I;  1YJ9 I;  1FOX A;  3CCL I;  4V19 K;  3PIO F;  3CCR I;  3CCM I;  2QEX I;  2NXN B;  5DM7 F;  1QA6 A;  3CCQ I;  1VQ4 I;  5GAE J;  1VQ9 I;  3CCS I;  3CC2 I;  3I56 I;  1VQO I;  1VQL I;  2QA4 I;  1VQP I;  3J7Y J;  5GAH J;  2H8W A;  3CME I;  2ZJP F;  3CMA I;  3CF5 F;  1YHQ I;  1VQ5 I;  2E34 A;  4IO9 F;  2FOW A;  5JVG F;  1ACI A;  1YI2 I;  3I55 I;  5GAD J;  2K3F A;  4UY8 I;  2OTL I;  4IOA F;  1YIT I;  1VQ6 I;  5DM6 F;  2E35 A;  1VQK I;  3CJT B;  1YIJ I;  2OTJ I;  3PIP F;  1FOW A;  2JQ7 A;  2E36 A;  3CC7 I;  3G6E I;  3J7Z I; 
#chains in the Genus database with same CATH topology
 2P0W A;  2V1D A;  3OYE A;  3BR5 A;  2DN0 A;  2OQG A;  4N0B A;  2V1U A;  1XTA A;  4C9Y A;  3GTG J;  2KKO A;  1BI1 A;  1R5I D;  1MSF C;  2Y0M A;  3TW7 A;  3CUQ A;  5J1U A;  1TWG J;  2KJC A;  4CCL A;  1ON1 A;  3S16 J;  2NOJ B;  3AG1 H;  2R7W A;  2R7S A;  2FNP A;  1TLH B;  2HZD A;  2VON A;  5IP7 J;  1XGM A;  2P81 A;  2PJR A;  3ABK H;  2WTE A;  5D5U B;  3S15 J;  1AOY A;  3LQR A;  1ZKG A;  2DA6 A;  4HRI A;  2QKM B;  2Y9Z A;  2QVO A;  1YW9 A;  4G6T B;  2LKP A;  2AO9 A;  3I71 A;  4ZZD A;  5EYR A;  4M9Z A;  5F64 A;  4WK8 F;  2LRE A;  5H20 A;  3RTR A;  4Y17 A;  2PLY A;  1R4N B;  2CO5 A;  1LUJ B;  3VPR A;  4CIC A;  2BY1 A;  1I1G A;  4M71 A;  1MJ9 A;  3CCR I;  3VYS B;  1JJ8 C;  3EPZ A;  2A6T A;  2HDD A;  2QSG X;  5IOY A;  4OAY A;  2HTJ A;  2V1N A;  3MN2 A;  1XMK A;  1FEX A;  2J5P A;  2E19 A;  3HDD A;  4YRV A;  4RBO A;  2BV6 A;  2QWW A;  3QP5 A;  3PFI A;  5JLW A;  3OYL A;  2GM4 A;  3S2D J;  2ZFW A;  3I56 I;  2NS0 A;  4UVA A;  3V7C A;  4EJT A;  1F43 A;  2GBY A;  4LIV A;  1Y56 A;  3F8M A;  2QQA A;  1FP2 A;  2CU7 A;  5BMZ A;  1VQL I;  1BA5 A;  1I3A A;  2QSH X;  2IEK A;  4PGG A;  1LFB A;  1ETO A;  5J4Y A;  5FJ8 J;  3ZGK A;  5KCM A;  1MMN A;  1P4A A;  2ZSH B;  3KEY A;  5DCM B;  1VQ5 I;  2IT0 A;  4WXH A;  4L0Y B;  3V8J A;  5L3E A;  1J59 A;  5C3E J;  3GTQ J;  2Z16 A;  5F1R A;  3CJN A;  5CVR A;  2NVY J;  2VIX A;  3RPU A;  1DP3 A;  1LVK A;  2R5Y A;  3KP3 A;  1SD4 A;  5EF6 A;  4AYB A;  2W84 A;  2VBX A;  4XRF A;  2Z2S B;  3NQO A;  2KHM A;  3ABU A;  1TP4 A;  4C30 A;  1DDN A;  4GYG A;  4NQW A;  4EQQ A;  3Q9V A;  1JKR C;  4GDF A;  4C3J J;  1N77 A;  4BXX J;  1MMA A;  5FRO A;  5E17 F;  2FBK A;  3VYU B;  1FOW A;  3J7A Y;  2JA2 A;  3MD2 A;  1S3J A;  1E17 A;  3Q3S A;  4KT5 C;  4X0G A;  1KU7 A;  3T8T A;  1EH8 A;  1Y39 A;  4O3M A;  5FKM A;  4IHX A;  3E5X A;  2BZT A;  1YOV B;  4PFP A;  3H3V K;  1I6X A;  4JX6 A;  2DO7 A;  2AQF A;  2DA4 A;  2VKD A;  2P8T A;  2HOS A;  2PMZ A;  1IZ1 A;  1TQM A;  2MYS A;  2R5Z B;  3BR6 A;  3GF2 A;  3GUD A;  1ZYR F;  4BE2 A;  1NG6 A;  4GFB A;  1MW7 A;  2DFE A;  5BNG A;  1QVT A;  2TCT A;  4GXO A;  3JAM Z;  1P7J A;  1JXS A;  3OYG A;  2M5W A;  3BC8 A;  1VI0 A;  3CF2 A;  3GWZ A;  4E7H A;  2P5V A;  4F93 B;  3KP4 A;  2EIK H;  1O3Q A;  3OYM A;  3O3K A;  5E3N A;  1FOX A;  3HOW J;  2KZV A;  1YE9 A;  3WGG A;  2O5R A;  3GYH X;  4F52 A;  4TV7 A;  1GXQ A;  4II3 A;  3F6V A;  4DQ2 A;  1Z77 A;  2XGC A;  1S7O A;  2OQR A;  2I10 A;  1QA6 A;  4QPQ A;  3I4P A;  3LSH A;  3QOP A;  4RA2 A;  2CQK A;  5B1B H;  1X1B A;  5J47 A;  4D7N A;  2LVS A;  3KIO A;  2ESN A;  1ZAO A;  3WG7 H;  2DT7 B;  3E0J B;  3KFW X;  1SMT A;  1UEL B;  4OOI A;  1VQP I;  3AAF A;  4XOP A;  3MWM A;  1GHC A;  4BS9 A;  2QLZ A;  3J7Y J;  2NVU B;  1UJ8 A;  4N4N B;  2EA4 A;  2BOL A;  2F4I A;  5DD8 A;  1ZG3 A;  3E5Q A;  3TO6 A;  2I5U A;  2KL4 A;  3CJR B;  4HG2 A;  3OS0 A;  2ZSI B;  2A3S A;  2NNY A;  3OOU A;  3S2H J;  1UHM A;  3DPL C;  1RC9 A;  2Y0S N;  1BM9 A;  4IVN A;  4FAS D;  5EG0 B;  2VBZ A;  3DP7 A;  4U0Y A;  3CUQ B;  2IBD A;  2R7O A;  5EEG A;  1SFK A;  3MAJ A;  1XX5 A;  4MGR A;  4XRS A;  2LBF A;  2QUF A;  4KN7 X;  2XGE A;  4A69 C;  1JT0 A;  1OCO H;  3FKI J;  5DTD A;  2Y69 H;  2HVS A;  3OL4 A;  2DFI A;  3KZY A;  4PJJ A;  4EMS A;  3DBR B;  4C2M J;  4DBQ A;  4I0B A;  5JR3 A;  1TWA J;  3GO5 A;  5D5X B;  4BHB A;  2M7A A;  3EUK L;  1JUP A;  3M7G A;  2QEN A;  4CYC B;  1KU3 A;  4EJW A;  1FYL A;  3JRB A;  5HNF A;  1SD6 A;  1JTX A;  1UB9 A;  2VT3 A;  3K69 A;  1YW7 A;  4FIS A;  2CFX A;  1MNE A;  2JRM A;  4W97 A;  2L02 A;  1D1C A;  1HXD A;  3HGY A;  1C0W A;  3IH4 A;  2YS9 A;  3PSF A;  2KMU A;  3FF5 A;  3LA2 A;  3BJA A;  1BR1 A;  2STT A;  3OS1 A;  1T6S A;  5FD5 A;  3AL0 B;  1VQN I;  4IF4 A;  5BPD A;  2HXI A;  2MA3 A;  1YYV A;  3RPU D;  3H92 A;  1FOY A;  1KU2 A;  3GFJ A;  1P4W A;  5K7Z A;  1B1B A;  4HSR A;  2PBI A;  4WF2 A;  3HOX J;  1WHU A;  3OIP A;  3FKJ A;  3PQK A;  5E1Z B;  2KRH A;  4G7H F;  1T0F C;  4BXF A;  3A0B C;  1FC3 A;  4IXA A;  2QEX I;  4A3J J;  2TRT A;  1YX5 A;  2H1K A;  5FLV A;  5LEJ A;  2E1N A;  4PSX A;  5D5V B;  3FMR A;  1WCM J;  1P9Q C;  3CCQ I;  1Y1W J;  3TL4 X;  1ZGJ A;  4L9N A;  2R5Y B;  3FZV A;  4XNF A;  3G1M A;  1EF4 A;  2UZK A;  5B66 C;  1Y8R B;  3ZMS A;  2UXN A;  2M8G X;  2DTR A;  4YII A;  2QYO A;  2RVC A;  2CJJ A;  3ZN0 A;  1TBX A;  1YG2 A;  3H9Q A;  2DJN A;  2R0Q C;  2X6W A;  4PDK A;  5HS8 A;  1XD7 A;  2H8W A;  3CMA I;  4ESB A;  3TKY A;  4C3I J;  1WQ2 A;  3IKT A;  1IRX A;  4G7O F;  4Y7N J;  1R4M B;  2DPD A;  5TIS C;  5EJC A;  4LLL A;  4OIO F;  1MBK A;  3LWF A;  4HX8 A;  3K1N A;  2LTP A;  2Q8K A;  3B02 A;  1JHH A;  4OMZ A;  2HGC A;  3VSL A;  3S17 J;  3OS2 A;  3KCC A;  2QM3 A;  1CQT A;  4M3G A;  4B47 A;  3RDI A;  5LGT A;  5HOD A;  5FFZ A;  3F22 A;  3GX4 X;  2VN2 A;  1VQK I;  2P6S A;  1OIS A;  2OTJ I;  4HLX A;  1E3H A;  3U21 A;  3OYH A;  1I5Z A;  4RGR A;  1XSV A;  2FQ4 A;  2H1L A;  4UB6 C;  3TW6 A;  4KFC A;  2IP2 A;  2DMT A;  4KIT B;  1LE8 A;  1BC7 C;  3OOP A;  1Y8Q B;  1NH3 A;  1ZN2 A;  2EH3 A;  4LIU A;  3HTS B;  1UG0 A;  2YU3 A;  5CPR B;  4I6Z A;  3CTA A;  1U8R A;  3FM5 A;  3FMQ A;  4MTD A;  3LAJ A;  4IOC F;  3GTP J;  1G2H A;  1JTY A;  2H09 A;  4L5E A;  1MJA A;  1IRF A;  5HS7 A;  3PUF A;  4LG0 B;  3K4K A;  3BTL A;  2NVQ J;  1Z1D A;  3FWE A;  2B0L A;  2D5V A;  4JYK A;  2JA5 J;  3K10 A;  4AWX B;  2XB5 A;  4M9S A;  3TP3 A;  5JHF A;  2ZJQ F;  3LNQ A;  2ME6 A;  2UV1 A;  3K0L A;  4WXC A;  4IRI A;  1YQA A;  4BAC A;  1BBY A;  4A3G J;  4IPA A;  3JW4 A;  3PM1 A;  2DYR H;  5F1J A;  1HC8 A;  1R71 A;  4Z6Y A;  4FTH A;  4E7S A;  4XKW A;  1K4S A;  4AIK A;  3HRT A;  3RKX A;  1MMS A;  4HNU A;  3K1P A;  4H0E A;  2DOA A;  2DPU A;  3JR9 A;  4LB6 B;  5M5W J;  2XRN A;  1KGS A;  1N25 A;  4UUS B;  2NNN A;  4MEX F;  1B6A A;  2CG4 A;  2VBY A;  2Y9Y A;  4KIG A;  2KT0 A;  4M6X A;  2MFZ A;  3VYT B;  3CCM I;  1U2W A;  1FMW A;  2LP0 A;  4Y15 A;  5IP9 J;  2HPM A;  1LEB A;  2R92 J;  1PP8 F;  5DV5 A;  3W2A A;  5H6Q A;  2HYF A;  2FML A;  3KP6 A;  3J7A O;  4ZDL A;  3ULQ B;  3J81 K;  2ADU A;  2JMW A;  2RNJ A;  3LSM A;  3BR2 A;  3SZP A;  4HOB A;  3FXJ A;  1A6Q A;  3ZMZ A;  5ICF A;  5J1Y A;  1PP7 U;  2KQR A;  3GXO A;  4IL6 C;  2GZW A;  3ZMD A;  2IS2 A;  1RI7 A;  5E3L A;  2QBY A;  2GXB A;  5H2F C;  2F5C A;  4P55 A;  3IWZ A;  2YU9 J;  4LJZ F;  4ESF A;  4CHU A;  4KYW A;  3M8E A;  4NUB A;  5GAH J;  3W6V A;  2HEO A;  2VLA A;  1RKT A;  2DDB A;  2HOE A;  1K6O A;  2JSC A;  5KNL A;  3BY6 A;  1FNN A;  2RN7 A;  1UHW A;  1IGN A;  4RAF A;  2XF5 A;  1TW2 A;  5J8C A;  1W7P A;  4N4O B;  1J75 A;  1T95 A;  3JTH A;  2QSF X;  5L3D A;  3K4B A;  2WB1 N;  3ZCO A;  1NTC A;  1Y1V J;  3L2W A;  2Z33 A;  4PJN A;  1ACI A;  1GLN A;  3KYL A;  2WV1 A;  4PJ0 C;  4BEH B;  5E18 F;  3QPT A;  3S3M A;  3H36 A;  3K4J A;  2O0Y A;  3ASN H;  5AIQ A;  4BDY A;  1K83 J;  4BHC A;  2NOG A;  2FEZ A;  5HLI A;  3HSF A;  4ENK A;  1FTZ A;  4BJ6 C;  3K2Z A;  3SHF A;  3E6C C;  2Z5U A;  3F72 A;  2WAE A;  4MQ9 F;  1FX7 A;  3I3L A;  2G7H A;  2B7E A;  4M3E A;  1GT0 C;  3VYR B;  2OF7 A;  3HB9 A;  4JP0 A;  3GTL J;  1SMY F;  1O4X A;  4BQN A;  1FY7 A;  2LY2 A;  1YFH A;  1O7F A;  5CVI A;  1PUE E;  2E2H J;  3BWG A;  1WZ2 A;  2WA0 A;  1ZTR A;  3A01 A;  1UFM A;  2NYX A;  2P6T A;  3B6C A;  2KDO A;  3U1D A;  3HG9 A;  2K9L A;  1CF7 A;  3I4N J;  3T1B A;  2ZJ2 A;  1VF9 A;  4ON0 A;  2HDC A;  4QIW N;  3G71 I;  1XB4 A;  4MFE A;  1EH6 A;  1SD7 A;  2VXZ A;  3HIF A;  4LFU A;  4LIT A;  3G4S I;  1R36 A;  3ERE D;  3JRF A;  2R7V A;  3BPX A;  3PNY A;  1JGS A;  2EB7 A;  2ZCW A;  5HDG A;  4M6V A;  1TZL A;  1XC5 A;  1ZGA A;  2P5L C;  4A0X A;  2IAI A;  1TL8 A;  3MZ8 A;  1MDM A;  1BW6 A;  2IS6 A;  2MLK A;  2CV0 A;  1K6Y A;  4MTE A;  5DS9 A;  3PSI A;  3H5R A;  3LMM A;  2DQR A;  1G6N A;  1QQI A;  4LD5 A;  3WTZ A;  4MFD A;  2MSY A;  1E3O C;  3LFK A;  1LJ9 A;  2OJE D;  5M3F J;  1IN7 A;  5FGM A;  2GWR A;  3FK6 A;  2DA1 A;  3M9A A;  3M1C A;  3GTM J;  4CSW A;  1APL C;  1YS6 A;  2FA5 A;  1OKR A;  4HX7 A;  2X85 A;  3LSI A;  3ZN1 A;  3GFI A;  2BW3 A;  1RET A;  3HJE A;  3FIS A;  2HI3 A;  3G73 A;  3MZY A;  4C2T A;  2WC2 A;  2JUG A;  4BQO A;  2W48 A;  4RMN A;  3BPV A;  2V4J C;  2FUG 2;  1ZG1 A;  1MZB A;  1JHF A;  1H89 C;  2LY9 A;  3F0C A;  4RM3 A;  5LHI A;  2Q1Z B;  5E79 C;  3MEX A;  1MSE C;  1R23 A;  1B4A A;  1QZZ A;  2VPL A;  3CUQ C;  2W24 A;  2D1V A;  2JTV A;  2ZFU A;  3VDX A;  3FMS A;  1Y0U A;  4WXD A;  1MBF A;  5K5O A;  2O7O A;  3UKG A;  1ZLK A;  3S14 J;  1UG2 A;  2DW4 A;  2B9S A;  1ON2 A;  2VI6 A;  2A07 F;  4NNJ A;  2ZJP F;  2CQN A;  3AFH A;  4EEF G;  4XLF A;  2XPW A;  2K9Q A;  5D5W B;  1LE8 B;  2LYC A;  5CYV A;  3WG9 A;  4OAZ A;  1ZHF A;  2LDU A;  2DU9 A;  5CVU A;  1Z6R A;  4IHS A;  1KQ0 A;  2ZO4 A;  3V8K A;  3WE3 A;  4FCY A;  1X4O A;  4HEA 2;  4A3D J;  2DK8 A;  2XAH A;  1X3Z B;  1H9T A;  1FSH A;  1D0Z A;  4EGZ A;  5LRS A;  2J5O A;  3WU2 C;  4ZYH A;  3I55 I;  1IO2 A;  1WJ5 A;  2K3F A;  1OQY A;  5J8F A;  1A31 A;  2HFH A;  1FYK A;  3CP2 A;  2HXO A;  1UHS A;  3GZN B;  4IJA A;  4O6J A;  1WH5 A;  3GTK J;  4BU2 A;  1YO5 C;  1F9N A;  4IZZ A;  3G6E I;  3J7Z I;  1BR2 A;  4PZJ A;  3DEU A;  4IHV A;  5FO5 A;  4ABZ A;  4EM2 A;  3M8J A;  2IJL A;  1IN5 A;  4A0Y A;  3CD6 I;  4I2O A;  4R1H A;  3ASO H;  3GTO J;  2VOP A;  2DMN A;  2PI0 A;  3E6M A;  1IJW C;  1OCR H;  2ECC A;  2ZJR F;  1A36 A;  3C18 A;  1W7P D;  1J0R A;  2QBY B;  2EJR A;  1Z05 A;  2R7U A;  2P7V B;  3DFG A;  2L01 A;  3RKQ A;  3COA C;  1IXR C;  4AID A;  4BHP A;  1LVA A;  1G3S A;  4XSX F;  2W00 A;  4Y4R A;  2GXA A;  1JKQ C;  3B6A A;  3I53 A;  3RSN A;  2HDW A;  4KDP A;  4XN0 A;  2VB6 A;  1EKE A;  1T39 A;  2PX9 A;  5CKT A;  3ZQG A;  3C7J A;  3TGN A;  2FU4 A;  2JA7 J;  3TOB A;  1YX3 A;  1W7P B;  1ZR2 A;  3BG3 A;  3G1O A;  3PL8 A;  3FXM A;  2BHZ A;  5GAE J;  3F23 A;  4A6D A;  2XC7 A;  2RC4 A;  3R60 A;  2VQC A;  2PMU A;  4FX0 A;  4LK1 F;  3IRR A;  5FKN A;  2R7Z J;  3HC7 A;  1QVU A;  3DPT A;  2E7W A;  4PJM A;  5HNH A;  1YW8 A;  3HSR A;  4M73 A;  2EZK A;  3WHB A;  5JVT A;  1U0J A;  4XL9 A;  1SFE A;  1XS9 A;  1IF1 A;  2OZU A;  5DYM A;  2ZXJ A;  3DF8 A;  1J09 A;  2BXZ A;  1MJB A;  2YR2 A;  2K9M A;  2Z99 A;  1UMQ A;  1AKH A;  1CF7 B;  1I27 A;  2HVQ A;  3R4K A;  2O3F A;  2R7T A;  4A3I J;  2IPQ X;  3O8G A;  3Q9S A;  2KRC A;  4LOC A;  2FBH A;  2F48 A;  2WY7 Q;  3KYD B;  2CW7 A;  4M9X A;  1N78 A;  1D1A A;  2M30 A;  1TC3 C;  1XCB A;  1H9G A;  2ID3 A;  5D8K B;  4A3C J;  5GP9 A;  4CCN A;  2O8K A;  4D1Q A;  3FHZ A;  1MDM B;  1ZR4 A;  3KP2 A;  2LSO A;  2D45 A;  2IGM A;  3K4L A;  2A5W A;  3IAM 2;  1M1E B;  4LG3 A;  1MH3 A;  1ZRC A;  2DXI A;  4HZF A;  1BR4 A;  5K5R A;  4AVP A;  2L4M A;  2L7K A;  4B4C A;  3NWT A;  2FXA A;  1N75 A;  2EZL A;  1Z6T A;  1U9O A;  2OBP A;  2R7D A;  1Y0N A;  4JOM A;  4RLQ A;  4NHJ A;  4YFK F;  2MW8 A;  4XQF A;  4QWQ A;  4RGU A;  5F6F A;  2AHQ A;  2NAZ A;  3L2U A;  2F5E A;  1K7A A;  5L3C A;  1O3T A;  3HKZ A;  2VKV A;  1SVM A;  3AKZ A;  4UVC A;  4RM2 A;  4YEJ A;  2OU2 A;  1R49 A;  2DBB A;  3F8N A;  1B8I B;  2LF8 A;  5BPI A;  2HQA A;  2EIJ H;  1REP C;  3GEZ A;  1ZK8 A;  2OD5 A;  2VBW A;  3BDD A;  3RJP A;  1ORK A;  5J4V A;  1KON A;  2DOE A;  2NRA C;  1HW2 A;  3OYJ A;  3UNG C;  2IA2 A;  4WCG A;  5LHH A;  2VOO A;  1HKT A;  2CUE A;  2CQQ A;  1BI3 A;  4OWR B;  3A03 A;  4NC6 A;  4XOR A;  2BHY A;  4GGG A;  4M3B A;  3JAM K;  5KHD A;  4B1R A;  2NXN B;  3E5U A;  1U8B A;  2M0M A;  4ESJ A;  3HOU J;  4AVZ A;  3RCO A;  4CCO A;  4KN4 X;  1BIA A;  1D0X A;  2D2W A;  2X1C A;  4E4H A;  5A2Q Z;  3EQL F;  4KIB A;  1LB2 A;  2HYG D;  4E7Z A;  5E3M A;  1PVE A;  3TP0 A;  2COM A;  1GXP A;  3DEW A;  3KPH A;  3HOZ J;  2GIV A;  2O9L A;  3GFL A;  1MBH A;  2QGU A;  2MC3 A;  1Z9C A;  4A12 A;  4U0W A;  2W85 A;  3IC7 A;  5FD6 A;  1WH7 A;  3ZMU A;  1YHQ I;  4W1U A;  3H5A A;  2XB0 X;  4YIF A;  5TGT A;  3Q0W A;  4MQV A;  4DYC A;  3QU3 A;  2HTS A;  3GW2 A;  3TOA A;  2F5D A;  2LF7 A;  4IHY A;  2BXY A;  3OYC A;  1R1T A;  4OIR F;  1BN5 A;  2WBM A;  3HRU A;  1FSE A;  3ABM H;  4AYB N;  4S04 A;  1YI2 I;  3DKW A;  2OCE A;  3BJ6 A;  3WTU C;  1YRN B;  1G8X A;  3JRH A;  1OCZ H;  1RPW A;  1ZQ3 P;  3ML6 A;  1XG1 A;  4EV0 A;  2RKH A;  4UXN A;  1H8A C;  4KMU X;  3QPL A;  1FZP B;  4LLG F;  1BC8 C;  2LR8 A;  1GV5 A;  5JI6 A;  3NEU A;  4BQA A;  1U9N A;  3RZD J;  5B1A H;  4BGD A;  2WAQ A;  2F5F A;  1ITY A;  3R61 A;  1XN7 A;  1STZ A;  3M8F A;  3CCJ I;  3CC7 I;  2ME0 A;  2XAU A;  2MGQ A;  3WOD F;  4YEL A;  3WGI A;  1H0M A;  1SAU A;  5KAI C;  5CVV A;  3PNV A;  2PMZ N;  1X1C A;  1EJ9 A;  1YJW I;  1K79 A;  1T08 B;  3TDU C;  3N4M A;  2E7X A;  3SYT A;  2PJR B;  4L18 B;  1VFC A;  2KIQ A;  3U1K A;  3E7L A;  4D5C A;  4MLO A;  2QZ8 A;  5M5Y J;  4Q5S F;  3SZT A;  4EJV A;  4HAM A;  5KAF C;  3E6D A;  1TNS A;  1TWC J;  4CYD A;  3LFU A;  3CO6 C;  1YJ9 I;  2JA8 J;  3ZP5 A;  3HEF A;  4G94 A;  2KIM A;  3F9K A;  5HOO A;  1IAW A;  4Q47 A;  4V19 K;  4UUT A;  2W25 A;  4HF2 A;  3DTI A;  2JPB A;  3KYC B;  3W6J B;  3S3O A;  3L2C A;  2MC4 A;  1AKH B;  2BY2 A;  3I54 A;  4G6Q A;  1IDZ A;  3DU5 A;  3KP7 A;  3ZQL A;  2CGP A;  4D7M A;  1G3Y A;  2BYV E;  1ZRF A;  1OYY A;  5GPA A;  3BTJ A;  2H8R A;  4DJA A;  4BE1 A;  4DGW B;  3CO7 C;  5FRN A;  3H1C A;  3P7N A;  2COB A;  3TED A;  3CJQ B;  1A6I A;  3IV5 A;  1KQ9 A;  1XSX A;  2Q0O A;  3HYI A;  4L9J A;  1Z21 A;  2M9H A;  1I50 J;  2ZME A;  3CZ6 A;  1AU7 A;  3FXL A;  3NAR A;  1J9I A;  2HKX A;  3PUB A;  2X9D A;  1IV8 A;  1D8J A;  3DQV C;  3WHC A;  3OYD A;  2WY8 Q;  2DJI A;  2XGD A;  1G59 A;  5LBQ A;  3I59 A;  2V1X A;  3JRG A;  2H94 A;  3HRS A;  5HLG A;  4A3E J;  3HHG A;  4LGW A;  1XCV A;  1KA8 A;  4P9F A;  1HST A;  4NQW B;  3LQQ A;  2BY3 A;  4NB5 A;  4HA8 A;  3WTT C;  5GPC A;  4BNC A;  4II2 A;  3ZOB A;  3V7S A;  3K70 D;  2ISZ A;  5D6E A;  2E35 A;  2LKX A;  3CLQ A;  2UWM A;  1ZRD A;  3A4C A;  3RZO J;  1QPI A;  2IS1 A;  2IGN A;  1J7K A;  3NWS A;  3O8H A;  3OR1 C;  4D5F A;  2QQB A;  3NRV A;  1RR8 C;  2KIF A;  4E70 A;  1BL0 A;  2PN6 A;  1DPU A;  3HSE A;  5ICC A;  1S7A A;  3FXK A;  3RIR A;  5GTH C;  3FBN B;  4ZDP A;  3CQZ J;  3R0J A;  3R0A A;  3ZR8 X;  1I1S A;  4I98 B;  1X3W B;  2QF7 A;  5ED4 A;  1FIP A;  1QNT A;  1RIO H;  3HOS A;  2VQL A;  3HXL A;  2EFW A;  5GAG J;  2EZI A;  3MKZ A;  2MLG A;  1KZH A;  4C3H J;  1ZLJ A;  3H0D A;  1X58 A;  3OYN A;  3JRA A;  1HSJ A;  2OUM A;  2DLL A;  3TMO A;  1ZG5 A;  2Y2Z A;  3MKL A;  3MZH A;  4NDL A;  1QBJ A;  5LRR A;  4ZYD A;  2G7U A;  5FKL A;  3JTG A;  4ZTF A;  1E3P A;  4DNC A;  1HOM A;  5CLS A;  1K61 A;  1R1U A;  1T33 A;  2NVT J;  3ERM A;  1QO0 D;  1Z3X A;  4FQG A;  4JQF A;  4PJL A;  1MND A;  4Y33 A;  2V7F A;  4G7Z F;  3VFZ A;  2JA6 J;  2CRG A;  2JRT A;  3V7R A;  3D0S A;  3RQ4 A;  2OPT A;  3G2B A;  2XGX A;  1VQO I;  2HWV A;  2OV7 A;  1P92 A;  1EV7 A;  1SFX A;  4ITV A;  2WV0 A;  2LH9 A;  5DD4 A;  3ZQ7 A;  1P7I A;  1IN4 A;  2KPM A;  3KLN A;  5L3G A;  1B9M A;  1F4K A;  4AM3 A;  5E20 A;  2CW0 F;  1X1A A;  5LHG A;  2X48 A;  2GA2 A;  3WU1 B;  1KU9 A;  2EWN A;  4AIJ A;  2LLK A;  2DQL A;  1K78 A;  1VZ0 A;  1UAA A;  1T98 A;  1USS A;  2IS4 A;  1LDK B;  2W4S A;  4ZC3 A;  4BYY A;  5J6X A;  2NS7 A;  1NHA A;  5E8G A;  2PJP A;  2CWE A;  2XSJ C;  3FX3 A;  4B43 A;  2LBF B;  5DEQ A;  1O57 A;  3EUH A;  4WX9 A;  3L09 A;  4RS8 A;  4Y52 J;  4CCJ A;  3W3C A;  4UHT A;  4P5O A;  2VAS A;  1WJE A;  2V6E A;  1IRG A;  2E1O A;  5HS9 A;  3L2V A;  5LD2 C;  1A35 A;  4F91 B;  4WWC A;  1HF0 A;  2L9R A;  3CUO A;  4EJO A;  4G12 A;  2JQ7 A;  3F8F A;  2MH9 A;  3FM3 A;  1O3R A;  2YPR A;  4HF1 A;  4ENM A;  1VQ7 I;  1W36 D;  1GVJ A;  1IRZ A;  1BIB A;  1B59 A;  4HQE A;  2DCE A;  3RYR A;  2P4W A;  3VWB A;  4L9T A;  2LG4 A;  2LFB A;  2K4J A;  3A02 A;  1JUS A;  3FDY A;  2G0E A;  4HV6 A;  2M87 A;  1IV6 A;  3N05 A;  4JK1 X;  4RB1 A;  1QRY A;  3H9G A;  2V9V A;  4AUX A;  5HDN A;  2BE5 F;  5GTI C;  3JSO A;  3JRC A;  4BY1 J;  1DU0 A;  2UXX A;  4B48 A;  2FNA A;  2XPV A;  1R6R A;  1R9T J;  1D0Y A;  3HRM A;  3B73 A;  3DPU A;  4XID A;  3CCE I;  3ZQI A;  1TNT A;  2EK5 A;  4XRM A;  2D1H A;  1HDD C;  3H3Z A;  1XMA A;  1NG7 A;  2A61 A;  3V42 A;  1S7E A;  2ZME B;  3FXR A;  4DYQ A;  4OIN F;  3S1R J;  3SQN A;  1MKM A;  3F8B A;  1UZC A;  1MH4 A;  2KZG A;  5FLX Z;  5IPA A;  2PG4 A;  3F3X A;  3FXQ A;  4HNT A;  1TWH J;  3I59 B;  2ZNY A;  5F04 A;  3F21 A;  2KIU A;  1ETX A;  4XR6 A;  4QPO A;  1WI9 A;  3S93 A;  5TRD A;  2OA4 A;  1WJF A;  1RUO A;  3HPG A;  3TDZ C;  1WPK A;  2M4G A;  4AIH A;  3CCS I;  4BE0 A;  1ENH A;  3BR0 A;  2JVG A;  3M4O J;  2F5V A;  2EPF A;  5IT3 A;  3ZQF A;  4E7K A;  1MGT A;  2PQ8 A;  2R3S A;  3GBG A;  3OIO A;  3GZ5 A;  2DMP A;  3OMY A;  4S0H B;  2X1E A;  1IW7 F;  3RQI A;  4XN3 A;  2DA7 A;  1U5T A;  5EEA A;  1T56 A;  4ASN A;  2BBY A;  4F55 A;  5DCM A;  2ELK A;  4HX4 A;  4EM0 B;  2KP6 A;  4ETS A;  2EQR A;  4MHG A;  2RQQ A;  5EGO A;  4CUG A;  3BTC A;  1R5H A;  2A68 F;  2M45 A;  1ONV A;  3BG5 A;  5KK1 A;  3KZI C;  4UB8 C;  4XIC A;  2A6E F;  2FBI A;  2LNB A;  4U87 A;  3M07 A;  1ZGW A;  1T8I A;  3BT9 A;  2RRE A;  5CJ9 A;  4YG2 F;  3WU0 A;  3ZQQ A;  2PMH A;  3ECH A;  3LSK A;  4PFO A;  4XMY A;  1FP1 D;  3RPQ A;  3OSG A;  5DUI A;  1MIJ A;  2W1O A;  3QP6 A;  2ISY A;  3HUG A;  2XDV A;  3OR2 C;  5DUK A;  5K5Q A;  4DZJ A;  3W6K B;  2JUC A;  1JKP C;  1FBS A;  1JE8 A;  4B3A A;  4HDU A;  3K6G A;  3DTK A;  2L7M P;  4RB2 C;  3KET A;  3HL2 A;  1VQM I;  4A93 J;  1YLF A;  2OCC H;  2LD5 A;  2R93 J;  4F7Z A;  2P5K A;  2M3A A;  2E71 A;  1J2X A;  3TBI A;  2FE3 A;  3HM5 A;  4P1W A;  1LFU P;  1W5C C;  2JWT A;  5LLQ A;  2GLO A;  3WE2 A;  2E1M B;  2CQ7 A;  1QHH D;  2XHK A;  3SZG A;  4RLF A;  3JRD A;  2QCO A;  4YFX F;  1KYZ A;  1V3F A;  2O03 A;  3BG7 A;  1QGP A;  1XGN A;  2CW8 A;  1OR7 A;  3GLX A;  2R5Z A;  5JLX A;  3S1M J;  2EBI A;  4FE4 A;  2F6C A;  2L4A A;  4PUS A;  2L9S A;  3KEQ A;  1B72 A;  1J5Y A;  1IXS B;  1XPX A;  1I39 A;  2E5Z A;  4A6E A;  5HDK A;  4BH9 A;  2OAZ A;  2AXL A;  1Z7L A;  2Z3Y A;  1S72 I;  1XDS A;  3H0G J;  2VUM J;  1OYI A;  2BY0 A;  1WJA A;  4DW6 A;  3BTI A;  2OC6 A;  3CCL I;  4J00 A;  4UNO A;  1OYW A;  4F3Q A;  4CGZ A;  1F36 A;  2KFD A;  4XLN F;  3OYB A;  3E1S A;  4IHW A;  1G3T A;  1K4T A;  5B5E C;  1D1B A;  2EIN H;  1HKQ A;  1K78 B;  5IT9 K;  2HOA A;  2NVX J;  2MG4 A;  5L3B A;  4M6Y A;  2VPR A;  4E7J A;  2XSD C;  1DGW Y;  4BBS J;  2ECB A;  1PYV A;  5L3F A;  4OIP F;  1GDT A;  5IT9 Z;  2JVH A;  2EFP A;  2YX4 A;  3GCM A;  3CDI A;  1DGR M;  1BJA A;  1LDJ A;  1D3Y A;  1SAX A;  1XGS A;  4A3L J;  1FJL A;  3O2P E;  3WGH A;  5IY5 H;  4K2E A;  4BQQ A;  4ZYA A;  2DMQ A;  3BG9 A;  4R79 A;  3L7W A;  5DCF A;  2GOM A;  2HKO A;  4OMY A;  1RKW A;  3ZRG A;  4HQM A;  3IH2 A;  4BXU A;  3I0T A;  2IXS A;  2L3D A;  1UCR A;  3OYA A;  2KJB A;  2RV8 A;  2EFN A;  3P9K A;  2CQX A;  4I99 C;  1IN6 A;  3DWL E;  5F0H A;  3K70 C;  4J01 A;  3S1N J;  4C2U A;  2I8D A;  1MBJ A;  1ULY A;  5EG0 A;  5D4S A;  2NS8 A;  4Y13 A;  2X1D A;  1FBU A;  4ENN A;  2XUB A;  1HBX G;  3REO A;  1TTY A;  2K4B A;  5DM6 F;  1HW1 A;  2CS3 A;  5JFR A;  2F2E A;  2E2I J;  1S9H A;  2H6B A;  2X4H A;  1ODD A;  2LRD A;  4QLC U;  4CDG A;  5KVR A;  1FPQ A;  3A01 B;  2RGV A;  3D5L A;  1QZE A;  1KQ8 A;  3M3Y J;  1HW5 A;  2DFH A;  3GZ6 A;  3LSG A;  2HQ5 A;  4CYC A;  1LQ1 A;  2HU9 A;  2LKS A;  2MBF A;  4A5N A;  4ENJ A;  3BP8 A;  3DCF A;  2EIL H;  3N97 A;  2VQH A;  3KE2 A;  4KMF A;  2RAE A;  2ZXI A;  3U9G A;  1MNM C;  1FWZ A;  3W2W A;  3HPH A;  4HBL A;  2DYS H;  2P7C B;  2R7X A;  4HYE A;  4OU0 A;  4D9J A;  2ACJ A;  1EA3 A;  1IDY A;  4KIS A;  5EZH A;  1A5J A;  3FK7 A;  2DA5 A;  2M8E A;  3LAP A;  3ZPL A;  2BW3 B;  4PGH A;  2EFQ A;  2ESH A;  4Y3O A;  2JZY A;  4I02 A;  2DOF A;  2O6G E;  2X6Y A;  3F6O A;  2L7Z A;  3ROU A;  1BOB A;  4KA4 A;  2HS5 A;  3QRF F;  1FYM A;  1U5T B;  4BY7 J;  4GYI A;  1X3U A;  3DBH B;  2G9W A;  3DU6 A;  4UUV A;  3S1Q J;  1RES A;  2ZC2 A;  3V4G A;  3ONQ A;  4XOT A;  1OLT A;  4P96 A;  5EGO B;  4HPQ A;  3Q0U A;  3TO9 A;  3ECO A;  4UV8 A;  2HVR A;  3ZXS A;  3ZMT A;  4AC0 A;  4XLP F;  4ZTJ A;  2QQ9 A;  5CQG A;  5H6R A;  5LGU A;  1Z3Y A;  3FBI B;  1MD0 A;  3PJR A;  1RNL A;  3PO3 J;  1OJL A;  2H6C A;  1L0O C;  1SFO J;  4XLH A;  3CME I;  2DDA A;  3HUG B;  2VE8 A;  3DKY A;  3LA3 A;  3SEQ A;  1F1Z A;  3Q5F A;  3H9J A;  4GO1 A;  2WWY A;  3EYY A;  3BZK A;  2MD5 A;  2EIM H;  5A2Q K;  2CV2 A;  3QYE A;  2PFB A;  3I4M J;  2FSW A;  3DEE A;  3A1Y A;  3HOT A;  3CMY A;  1V54 H;  2R7Q A;  1JT6 A;  4M74 A;  4RDU A;  2KIS A;  2Y0S A;  3A0H C;  4P9U A;  1W0U A;  2A05 A;  3VOD A;  2K02 A;  4JX5 A;  1R7J A;  5BOX A;  3CCY A;  5GAD J;  3WTW C;  1S29 A;  1XGO A;  4IQJ A;  2XAJ A;  4UY8 I;  3MKY B;  2XAQ A;  5IYD J;  1X1D A;  2LOO A;  3MCZ A;  2CV1 A;  1FIA A;  1W36 C;  4A0Z A;  3ZMV A;  6PAX A;  4Q4Z F;  1B72 B;  2M0C A;  4CA0 A;  4MNU A;  2A6H F;  3DTE A;  3NAU A;  4RB0 A;  5AON A;  1X2N A;  5ERI A;  1WJB A;  1V5G A;  2EFO A;  3P9C A;  1R5G A;  2ZME C;  4NBQ A;  2E60 A;  3CCU I;  5ILV A;  4IRG A;  1SEU A;  2EZH A;  4LK0 F;  3HKZ N;  3CC4 I;  3KZZ A;  2L0K A;  4U7B A;  4XRS G;  1R1V A;  1T2K A;  1OCP A;  2VOD A;  3ZQC A;  2FQ3 A;  2MD0 A;  4R8H A;  1P2F A;  4X1E A;  3LA7 A;  4LG0 A;  3L2Q A;  2ZXH A;  5FKO A;  4LMY A;  5F08 A;  4YIR X;  3L2R A;  3OSF A;  2XVC A;  5FFX A;  1W5S A;  4IX7 A;  1MMG A;  4EVI A;  5FKK A;  1V4R A;  1IC8 A;  3R6S A;  2L54 A;  1OCT C;  2VT2 A;  3V8L A;  2FD5 A;  2BVL A;  1R22 A;  3HGG A;  1U6G A;  3IUO A;  3MMY B;  2CUJ A;  1NK3 P;  2W7N A;  2W82 A;  2AS5 F;  1ETW A;  1ETV A;  4V2G A;  4BJT A;  4LB5 A;  3C3W A;  1P4X A;  5ILU A;  4S05 A;  3ESW B;  1DQU A;  4JBA A;  3AG2 H;  4UUS A;  4I09 A;  1Z0X A;  4UVB A;  3ABL H;  5LEK A;  4XON A;  5BS6 A;  1HCR A;  3ZQH A;  3AG4 H;  2M1B A;  2FJ1 A;  1VQ4 I;  1VQ9 I;  3CP8 A;  2E2J J;  2XF6 A;  4XKC A;  2YUS A;  2QQ8 A;  2RNG A;  1BW5 A;  2V26 A;  1QU3 A;  2K85 A;  1WVR A;  1ETY A;  4BUP A;  2CSO A;  4G9Y A;  3MFK A;  2QA4 I;  5C4X J;  4U88 A;  3L00 A;  1H88 C;  4MEY F;  3KLO A;  2FF4 A;  1S8N A;  2Q2E A;  3KX2 A;  2HQN A;  4RGX A;  5TJJ A;  1TT0 A;  1DP7 P;  4E6K G;  4ZYG A;  3LSJ A;  1ZEL A;  2LC2 A;  2LK2 A;  3VSK A;  4CZC A;  5C4J J;  4OIQ F;  2RQP A;  2E34 A;  5ICE A;  4IO9 F;  4RGS A;  1FMV A;  4PSW A;  4PCQ A;  3EYI A;  3GFM A;  3AG3 H;  4FT8 A;  4NC7 A;  3L9F A;  4FHT A;  2DA2 A;  2E5N A;  2IGK A;  2E1M C;  3Q0V A;  4JX4 A;  3HTU A;  2VQG A;  4FE7 A;  5F0C A;  4BEH A;  4ZYE A;  5IYB J;  1WJD A;  1PUF A;  2OTL I;  1MBG A;  1TQP A;  1HA8 A;  2K86 A;  3BCA A;  1YIT I;  2VKE A;  4I0A A;  1VQ6 I;  2XAF A;  3QPH A;  4XLE A;  1ZH5 A;  2WAQ N;  1WI3 A;  3RYP A;  3QPS A;  4HF0 A;  5ICG A;  5LFA A;  2HYJ A;  3SDB A;  2WAD A;  5DDG A;  5BQT A;  2VJ5 A;  3BCB A;  1V5F A;  4I76 A;  1W5T A;  4XKV A;  3I64 A;  4YFN F;  2MH2 A;  3OYK A;  5E1X A;  4A3K J;  2CUZ A;  2XRL A;  1B9N A;  3LL7 A;  4KIC A;  1WKM A;  2VC1 A;  3K4C A;  1RUN A;  2EV6 A;  3HBL A;  4N9H A;  4ZH4 F;  3BR1 A;  3W2V A;  2CMP A;  1D8K A;  2ZXW H;  4RB3 C;  2B63 J;  1VQ8 I;  3PO2 J;  4MO7 A;  2F4M B;  3LSR A;  3EUH C;  1ZRE A;  2R7R A;  3SFZ A;  3T8R A;  4XKB A;  1R58 A;  2IA1 A;  3UR3 C;  2DT6 A;  3C1D A;  4E7L A;  3S3N A;  2BVM A;  4KIF A;  3LST A;  2XKO A;  1YJN I;  2DT5 A;  3BRO A;  4D0P A;  3WTX C;  5EEH A;  1SD5 A;  5FB2 A;  3WTV C;  4L5J A;  5AIP A;  5HLH A;  2ID6 A;  4ZDO A;  1TQI A;  1OFC X;  2ZBK A;  3IHU A;  5ILS A;  2L5Q A;  3CES A;  4DZP A;  3MVP A;  3EDP A;  3RKW A;  1QZY A;  4X6A J;  1MMD A;  1OMI A;  5HVQ C;  4I01 A;  1Z67 A;  1MBE A;  1JI8 A;  2IGO A;  3SJM A;  3QU6 A;  1I3Q J;  2Y31 A;  3HOY J;  3HOV J;  2DOD A;  4M72 A;  3T0Y A;  3TQN A;  5DM7 F;  3M1E A;  5E3O A;  1LDD A;  2Y75 A;  4F92 B;  5HLT A;  4EM1 A;  2VC0 A;  2R7F A;  3K4M A;  4IQ4 A;  3GME A;  3OV8 A;  9ANT A;  1RRJ A;  4B3X A;  3GLL A;  4U0V A;  3FHN A;  5IOZ A;  3ABT A;  1TWF J;  2FX0 A;  3QYB A;  4KUM A;  4XLA A;  4BBR J;  1TW3 A;  2UUZ A;  3K7A J;  3JRE A;  5EZG A;  3H35 A;  5D8L B;  2GQQ A;  1WJC A;  2O61 A;  1YIO A;  1HDP A;  4IKF A;  2STW A;  3KP5 A;  3CF5 F;  2N8G A;  1VND A;  1T38 A;  3I9V 2;  2X6X A;  2FOW A;  5IYC J;  2W57 A;  3GTJ J;  4V2F A;  2DI3 A;  3IP4 B;  5IP6 A;  2WB1 A;  3ISP A;  2KDZ A;  3BG6 A;  1GVD A;  4HW0 A;  1R00 A;  1G4D A;  5CQE A;  3DLA A;  2K9S A;  3FXU A;  3OWT A;  4U7D A;  2GOX B;  3LOC A;  4M3F A;  1X2M A;  4EJU A;  5FRM A;  1LKX A;  2VJ4 A;  3MKW B;  2FOK A;  4CZZ A;  1QHG A;  1O3S A;  1D5V A;  4DOZ A;  2VXD A;  1CGP A;  3PIP F;  1FOK A;  2PEX A;  3QOD A;  4Q48 A;  1T0F A;  4BJ5 C;  4GCV A;  4A5M A;  3S8P A;  1V55 H;  1GUU A;  3JCU C;  2KRF A;  5E8I A;  1U5T C;  2CH0 A;  3HZJ A;  5CVJ A;  3QAH A;  3C2H A;  2L2O A;  2ETH A;  1V5E A;  3SFI A;  5B3S H;  3BOQ A;  3BQY A;  1EH7 A;  1LNW A;  2F4O B;  2VJJ A;  3PNT A;  4QSH A;  2A69 F;  1SC7 A;  2IRF G;  2HQR A;  4BL0 B;  1ZAR A;  1X4P A;  2XAS A;  4BKX A;  4LLN A;  5M5X J;  1SFU A;  3G3Z A;  2EA2 A;  3IH3 A;  2IW5 A;  2JK3 A;  4KNY A;  4UV9 A;  5EDN A;  1UST A;  3OL3 A;  1YTY A;  1DUX C;  1S6L A;  4B8X A;  3J81 Z;  1FLI A;  3EET A;  1WRJ A;  3VOE A;  2Q2E B;  2Z1D A;  4A3B J;  3H5N A;  3TO7 A;  2XF7 A;  1W0T A;  3QYF A;  3P5J A;  3VEP A;  2ELH A;  3BQZ A;  1HKS A;  2AXT C;  2ICW G;  2K27 A;  1DU6 A;  1IN8 A;  3PIO F;  1IUY A;  4J19 A;  3IWF A;  1RZ4 A;  3DKX A;  1TT5 B;  1ETK A;  1GV2 A;  1PJR A;  2ZNZ A;  4N9I A;  3T5X A;  2X0L A;  1W4M A;  2ELJ A;  3JSP A;  1X1P A;  1W1W E;  1FT9 A;  4XSZ F;  1JUM A;  2YSR A;  4QTR A;  3IL2 A;  1QPM A;  3IRQ A;  1WSU A;  3IKV A;  3K9T A;  5F0F A;  5K1Y A;  3J80 K;  3CC2 I;  2V79 A;  4MIM A;  2O8X A;  3BLY A;  3RI4 A;  1Q1H A;  3CMM A;  2FMY A;  1I6H J;  1PUF B;  3E3V A;  5FLX K;  2E1C A;  4FET A;  4A2U A;  4L9V A;  1LPQ A;  1OR7 C;  4B44 A;  4H4K C;  4CXF A;  3J80 Z;  4XLC A;  1IG7 A;  3WTS C;  5FLM J;  1WWX A;  1JGG A;  4DBR A;  2JSP A;  1OPC A;  3DBL B;  3O6B B;  3LSP A;  1BJZ A;  1IUF A;  4EAT A;  3OY9 A;  2XV4 S;  3BJO A;  3FIW A;  2OZ6 A;  5J3L A;  2AQE A;  2GIZ A;  1SVO A;  1WGX A;  2LMD A;  2HR3 A;  5D6F A;  1BOA A;  3E6B A;  4CH7 A;  4ZJZ A;  4A3M J;  1U78 A;  1RR7 A;  4RAZ A;  1E2X A;  2C6Y A;  2YX7 A;  4KT6 A;  3S2W A;  2GA1 A;  1U3E M;  4IOA F;  1D5Y A;  1VTN C;  1S5L C;  4ANJ A;  1HQC A;  2M7B A;  4HLY A;  3OIQ A;  2V9K A;  1BI0 A;  3P9I A;  1PDN C;  4AD9 A;  3CJT B;  1YIJ I;  5K7F A;  4A3F J;  1WFX A;  4E7I A;  3D5R C;  4XM3 A;  2V6C A;  1LEA A;  3PQJ A;  3F8C A;  3QOE A;  3WTY C;  5LGN A;  2E36 A;  2L9N A;  2K5C A;  3EUA A;  2K9N A;  4HV5 A;  2GAU A;  3BR3 A;  4I7H A;  4L5I A;  2CUF A;  1JKO C;  4HNV A;  1O7L A;  3GVA A;  1NK2 P;  1F5T A;  4DIQ A;  1A04 A;  1SVL A;  2M2E A;  3MQ0 A;  3CDH A;  2DAO A;  2IA0 A;  3VB2 A;  4DYR A;  2ZKZ A;  3ELK A;  3QWL A;  3DLL F;  5K7H A;  1L3L A;  3CCV I;  1BI2 A;  2K3P A;  3FXO A;  5JHU A;  5J1R A;  1FBQ A;  2XPU A;  3IAS 2;  1B8I A;  1SAN A;  2RDP A;  4AU7 A;  4CCM A;  1E0E A;  1P6R A;  2HNH A;  2M34 A;  3JRI A;  2M4K A;  3L1P A;  1HLV A;  2GXG A;  4NC8 A;  1POG A;  1XMX A;  2DK5 A;  2DMU A;  4CO8 A;  3C2G A;  3D1N I;  2XRO A;  4O5V A;  2XKP A;  2ZB9 A;  3OYI A;  3RKY A;  4HDV A;  3KEO A;  2VL8 A;  4RAG A;  4EGY A;  2Y30 A;  2X51 A;  4RAY A;  1Z7U A;  4IHT A;  3BZC A;  3S32 A;  2HOT A;  2Y48 A;  2JPC A;  1KYW A;  5E1W A;  1ERD A;  2VKH A;  2MAB A;  4L0Z B;  1JJ6 C;  4BAY A;  3OYF A;  3K1M A;  1DPR A;  2EV5 A;  3CLO A;  4G8X A;  1AA7 A;  2IVM A;  2K40 A;  2XIG A;  2L9V A;  4PK4 A;  4B09 A;  2A5Y B;  4G6D A;  3PFY A;  2WAF A;  1AWC A;  2XAG A;  2HPI A;  4HST A;  3AL0 C;  5M3M J;  2VE9 A;  3DXJ F;  4Z2Y A;  2CFO A;  2FRH A;  2DTZ A;  2L7F P;  1IXC A;  4BDZ A;  4GRI A;  3K4N A;  4FX4 A;  3SEZ A;  2BEO A;  4M3D A;  1LFP A;  4IEJ A;  3K2A A;  4KJZ A;  3U2R A;  5JVG F;  2BGC A;  2HZT A;  3G1L A;  4CCK A;  3C2B A;  2LY1 A;  3H3U A;  2K7L A;  2KLO A;  2QKL B;  2X6O A;  3CDL A;  2EV0 A;  3QQA A;  4IRH A;  2VJI A;  2H27 A;  1X19 A;  3E97 A;  2JT1 A;  3HHH A;  2Z9O A;  1AHD P;  2DA3 A;  1FTT A;  2TDX A;  1YRN A;  3BZ6 A;  1XSD A;  2CYY A;  2V9P A;  3A2K A;  1Q1V A;  2DFF A;  5C44 J;  5F27 A;  3I5U A;  1XDU A;  2R4G A;  3X2Q H;  4ZZL A;  4XK4 A;  1OCC H;  1G3W A;  3I58 A;  2JN6 A;  1YS7 A;  1Z91 A;  5J40 A;  2JJ7 A;  3SXY A;  5D4R A;  1ETQ A;  3DV8 A;  3SDG A;  1Y6I A;  4XBF A;  3D5S C; 
#chains in the Genus database with same CATH homology
 1VQ7 I;  1Y39 A;  3CCU I;  1VQM I;  4IOC F;  3G71 I;  3CC4 I;  3G4S I;  3CD6 I;  1YJW I;  3CCJ I;  3DLL F;  1VQ8 I;  3CCV I;  2ZJQ F;  2ZJR F;  1VQN I;  5GAG J;  1HC8 A;  3CCE I;  1YJN I;  1FOY A;  1MMS A;  1S72 I;  1YJ9 I;  1FOX A;  3CCL I;  4V19 K;  3PIO F;  3CCR I;  3CCM I;  2QEX I;  2NXN B;  5DM7 F;  1QA6 A;  3CCQ I;  1VQ4 I;  5GAE J;  1VQ9 I;  3CCS I;  3CC2 I;  3I56 I;  1VQO I;  1VQL I;  2QA4 I;  1VQP I;  3J7Y J;  5GAH J;  2H8W A;  3CME I;  2ZJP F;  3CMA I;  3CF5 F;  1YHQ I;  1VQ5 I;  2E34 A;  4IO9 F;  2FOW A;  5JVG F;  1ACI A;  1YI2 I;  3I55 I;  5GAD J;  2K3F A;  4UY8 I;  2OTL I;  4IOA F;  1YIT I;  1VQ6 I;  5DM6 F;  2E35 A;  1VQK I;  3CJT B;  1YIJ I;  2OTJ I;  3PIP F;  1FOW A;  2JQ7 A;  2E36 A;  3CC7 I;  3G6E I;  3J7Z I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...