1VQPI

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 14
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vqpI00
4IOAF 2OTJI 1VQKI 2ZJPF 3CCRI 1VQ4I 1Y39A 2ZJQF 3CC4I 2ZJRF 4V19K 1YJWI 4IO9F 3CCUI 3CCEI 3CCJI 1YJNI 3CD6I 3CCVI 3G6EI 1VQPI 1VQLI 3CC2I 1FOXA 1VQNI 1VQMI 3CCLI 1VQ8I 1VQ7I 3CMEI 1YJ9I 3DLLF 1VQ9I 4UY8I 2NXNB 2K3FA 3CCQI 1YI2I 5JVGF 1S72I 3PIOF 3I56I 2E36A 3CCMI 2QA4I 2OTLI 3CCSI 2E35A 1YIJI 2FOWA 3J7YJ 5GAEJ 5GAGJ 3G71I 1VQOI 3I55I 1VQ5I 1ACIA 5DM7F 1QA6A 2H8WA 5GAHJ 2QEXI 1MMSA 3CMAI 5GADJ 1FOYA 3CJTB 1YHQI 2E34A 3G4SI 2JQ7A 1VQ6I 1YITI 5DM6F 4IOCF 1HC8A 1FOWA 3CF5F 3CC7I 3J7ZI 3PIPF
chains in the Genus database with same CATH superfamily
2NVUB 5CKTA 4XKBA 4A93J 2DFEA 3RIRA 5CVJA 3LSIA 1LFBA 3CUQC 1A6QA 5K1YA 1RPWA 1XSXA 1G59A 5GP9A 1S29A 4HEA2 5FKKA 3KETA 2KIUA 1VFCA 1R36A 2NAZA 4IVNA 2BBYA 4RB2C 3H5NA 4RAGA 2CQNA 3OYBA 3S14J 2XC7A 5EEHA 1LUJB 2EV5A 4P9FA 4LG0A 2VOPA 2E1OA 1U0JA 4M72A 2WB1A 4UB6C 2V1DA 2DMTA 2NYXA 4EGYA 1KYZA 1W7PD 5IP9J 1OCOH 1JT6A 1UZCA 5HS9A 1TT0A 1JJ8C 1VQ8I 2CW8A 1U3EM 2XKOA 1N75A 4RM3A 1JE8A 2DPUA 2IS6A 2EA2A 2HXOA 4XKCA 3K69A 2PJRA 3IRQA 2M30A 3ZP5A 2O9LA 1RIOH 2P6SA 3BTCA 5F0HA 2GA1A 2Q1ZB 2HKOA 4HDUA 3HTSB 1D1AA 4Z6YA 2R3SA 2Z5UA 3DTIA 3RPUA 2X1DA 1FP2A 4A12A 1QVTA 5ERIA 1UG2A 2KL4A 4HA8A 3DTKA 1LDDA 2DU9A 2E1NA 4YIFA 1OYIA 2WA0A 3VYSB 4Q47A 4G7HF 2VJIA 2CQXA 4Y52J 1IO2A 2TCTA 1JKOC 1R4NB 4GDFA 1I27A 1GV5A 2QEXI 4K2EA 4E7IA 1WH7A 2M4KA 3QU6A 4A3LJ 2QQBA 4XLNF 2YUSA 5LHGA 4OINF 2ZJQF 4I7HA 5HDGA 1PUFB 3TBIA 4LJZF 4D9JA 4E7HA 2QBYB 1WSUA 3MWMA 4NBQA 4XQFA 2K3FA 2H94A 2LRDA 1T0FC 3CJRB 5F64A 2XSDC 1K78A 4OMZA 3H0GJ 2CQKA 2Z2SB 4Y13A 5C4JJ 3OSFA 1B72B 3S16J 5FJ8J 4M6YA 4C3JJ 2FJ1A 5D5UB 3U1KA 3EDPA 4HSRA 1OFCX 3SZTA 3ZQLA 4RMNA 2W48A 5AIPA 5EGOA 1U8BA 2R7ZJ 5JVTA 2ZMEC 1U9NA 1E0EA 4D7MA 1IZ1A 3GF2A 4X6AJ 2HTJA 3K4BA 3ZXSA 4II2A 4II3A 2E7XA 3GUDA 1FMWA 2K02A 1VQOI 4BYYA 3L2VA 3CUQB 3GBGA 2DA2A 1ZTRA 3F72A 4C2MJ 2JJ7A 2UUZA 4WXCA 2CQ7A 4KMFA 2DAOA 3V7RA 2I10A 2QQ8A 2W84A 1B1BA 2GOMA 4IOCF 1ENHA 1F36A 1P92A 3ZQIA 4HV6A 4ENNA 1S7EA 1WFXA 1FNNA 4PJLA 4A3GJ 1T2KA 4D0PA 4A5MA 3F6OA 3SQNA 3QP6A 2CW7A 1D1CA 1XB4A 4DYRA 4JP0A 3IL2A 2XAJA 3K7AJ 4PSWA 2FXAA 2VQGA 4ZTJA 2P7CB 3GZNB 3BR1A 3KLNA 3T5XA 1DGRM 2HQNA 5GADJ 3J7AO 4KIFA 1APLC 3QODA 4M3DA 1W4MA 1IV8A 1LVKA 3OY9A 3RCOA 2PMZA 3MCZA 4QPQA 4J19A 4HSTA 2HKXA 1QU3A 2K40A 1BIBA 1EF4A 5IOZA 1KGSA 1IDZA 2W24A 4S05A 5A2QK 2Z1DA 1WGXA 3OS0A 2KJCA 3S1QJ 1UCRA 3WE2A 4LLLA 2LY9A 3JSPA 1WJEA 3W3CA 3ASNH 4WXDA 2L01A 4XN3A 3ZMUA 3QPHA 1Z77A 2YR2A 1H89C 5EEAA 5DCFA 3PO2J 2F5EA 3DKWA 3FX3A 4EQQA 4CCNA 3JAMZ 1XN7A 1ZK8A 1TWAJ 3MKLA 1FX7A 3IAS2 1ETXA 3QPSA 4XORA 3OYJA 1VQ4I 2W4SA 1LPQA 1SD5A 2GXBA 4ITVA 3FHZA 2QKMB 3FXKA 1IN8A 2A6EF 1SFXA 1LDKB 2VQLA 2QQAA 3RKYA 3CMMA 3MD2A 5GTHC 4ZYAA 2PMHA 3HB9A 4ANJA 2VE9A 1IUYA 1WH5A 5CQEA 3GYHX 3E97A 4O5VA 3M8FA 1IV6A 1R71A 2DJIA 3QPLA 4E7SA 5EEGA 2KDZA 4B3XA 3NWSA 2H6CA 3R4KA 3JRHA 2EQRA 2DCEA 4RAFA 2FSWA 2EJRA 1KQ0A 1PYVA 2FQ3A 1O57A 2M7BA 3K1PA 4OAYA 4BQOA 3R6SA 3KP3A 5K5OA 2R5ZB 3K2AA 5H6QA 3FK6A 3U21A 3PUFA 4EJVA 3QOEA 2JA5J 2VXDA 1XGMA 2R7TA 1SD7A 2VI6A 3RKXA 4RBOA 3FDYA 3FXJA 4A3CJ 3H3ZA 2OZUA 3ZGKA 5HNFA 2HVQA 3TW7A 1XSDA 3E6MA 5FKMA 3TP0A 3FBNB 3HYIA 3R61A 2IRFG 1YG2A 1FZPB 2V9PA 3JTHA 2QENA 3QP5A 1VQNI 3F8CA 1T33A 2MLGA 1IN7A 2R7QA 5K5RA 2LKXA 2RQPA 2JVHA 2I8DA 5J3LA 3H3VK 4OOIA 3IHUA 4I0AA 1H9TA 5JLWA 5JHUA 4OIQF 5DM7F 3O8GA 1B9MA 2JTVA 4MQ9F 4ZDOA 3BG7A 3LA2A 3CF5F 3BTJA 3LAJA 3J81K 1DU6A 2EFNA 3JRDA 2A3SA 3A03A 2LVSA 1MJ9A 3HDDA 1POGA 1N78A 2GA2A 2OCCH 3KZZA 1HQCA 3DBRB 3IWFA 4MEYF 3BG5A 2HS5A 3K0LA 4O6JA 2B0LA 4RLFA 2MFZA 1XS9A 2E60A 2HOTA 2XF6A 2XAFA 3VYUB 2LKSA 4MQVA 4JX4A 3OYEA 1HXDA 1XGOA 3V7CA 2L9RA 2RAEA 1B6AA 1FYLA 1MD0A 2LKPA 1GUUA 2GAUA 3BWGA 4RLQA 1Y1WJ 4Y3OA 5LD2C 4IO9F 2BV6A 4Y15A 1FYKA 3GLLA 1W5TA 3E6CC 1TW2A 2XDVA 3HTUA 1LQ1A 5C4XJ 4I2OA 2HDDA 4Q5SF 2OBPA 3ZPLA 4YIRX 1MJBA 1USSA 4A0YA 3JRGA 2IT0A 2KRHA 4AD9A 2E2HJ 5JI6A 5FGMA 1W0UA 3LFUA 3OL4A 3K1NA 1YS7A 5KCMA 3CDIA 1TTYA 4P1WA 5LHIA 2K86A 1MBKA 3HM5A 3I4MJ 1ETOA 1U6GA 3CMYA 3ULQB 3WGIA 2G7UA 2NVTJ 2BZTA 2M0MA 2EPFA 3A0BC 4U7DA 4C3HJ 3LQQA 1V54H 1ON2A 4CCLA 4GXOA 4MNUA 4UVBA 2DO7A 4DBQA 5HNHA 4AU7A 2Y69H 1XX5A 4BXXJ 4R79A 4EVIA 2VXZA 2JZYA 1G4DA 1USTA 4A3EJ 2E35A 2IW5A 5EZHA 2B9SA 1TQIA 3S15J 1SVMA 2R7SA 3MKWB 1R1UA 5JHFA 2VT2A 3GTKJ 2ELHA 4BE1A 5E8GA 3V8LA 3S3MA 1ONVA 5KNLA 3R0JA 3A2KA 2PFBA 1ETYA 4D1QA 5TISC 2Z33A 2OZ6A 5E3MA 3TKYA 2ETHA 1WQ2A 3KEYA 3MKYB 2W57A 1H8AC 1G3SA 1YRNB 2KMUA 3OYLA 3NEUA 3WTYC 3SZPA 3CMEI 4IHSA 2BXYA 2ME0A 3BR3A 1R1VA 4EJOA 2R4GA 1RKTA 4RS8A 4A69C 4UV8A 1G2HA 2O7OA 4EJTA 3M1EA 1W5CC 2X6XA 4PCQA 5C44J 4L9JA 3SHFA 2STTA 1T95A 3L2WA 1MMGA 1D3YA 3TOBA 2HOSA 3JW4A 3FXOA 3FKJA 3TO7A 5J4YA 2E1MB 2VPRA 3HJEA 3HC7A 4FQGA 1MBJA 5D4SA 1JTYA 1IXSB 1IDYA 5KVRA 2EZIA 1LE8A 1B59A 3K10A 2CV1A 1B4AA 2A5YB 1Z9CA 4ZDPA 1VQ9I 3KP5A 4IHWA 3BCBA 2HZTA 1VNDA 5EJCA 1BI3A 2F5DA 3RKWA 1SFUA 4MTEA 1HBXG 2B7EA 3FISA 4MFEA 5D5XB 3RQ4A 3E5QA 3K2ZA 3TMOA 4EM2A 4EJUA 2KZVA 3SFZA 2YSRA 5FLXZ 4LITA 1V3FA 4V19K 5FRNA 4YELA 3HOUJ 1VQPI 2J5PA 2KHMA 1W5SA 2VC0A 2KRCA 1SD4A 4LB5A 1R9TJ 1PUFA 1JGGA 1B8IA 1PDNC 3GCMA 5E1ZB 4G7ZF 3BZCA 2YX4A 1JKRC 5GAGJ 1UHMA 3TO6A 1GVDA 2F5FA 1JKQC 2M8GX 1REPC 2OUMA 3ABUA 2OQGA 1TLHB 2ZSHB 1IRXA 3S2WA 2E2JJ 5J1RA 2K9QA 4AIJA 2ZFUA 1OJLA 5ED4A 3PO3J 5IT9Z 4DQ2A 2MD0A 2LREA 5FB2A 3RPUD 3GTPJ 1X3ZB 3FXQA 1IXCA 4I98B 4IXAA 4BY1J 2YU9J 4DZJA 4DYCA 2HWVA 1G6NA 1YYVA 2DA6A 3TOAA 2IXSA 1R5ID 4UB8C 3I59B 2DOFA 2VBXA 2DMQA 1CF7B 3S32A 4BE2A 3DF8A 4M3GA 1RR8C 2JA2A 2WB1N 1JUSA 4B3AA 5GAEJ 1W7PB 5B1BH 1WZ2A 1ZG3A 2VL8A 4IKFA 2AS5F 2GQQA 4BBRJ 1QPIA 1BR1A 2XB0X 4G8XA 2XV4S 3CUQA 1CQTA 2LNBA 2CYYA 1QQIA 3WTUC 3EUKL 1ZQ3P 4PFOA 4B4CA 3K4MA 2ZC2A 3F23A 5FROA 3V4GA 3L7WA 4M3EA 2PX9A 2V79A 5LBQA 2IGNA 4M6VA 3D5SC 4FT8A 4PJJA 2XAUA 3F8BA 3HKZN 2CRGA 4DIQA 1TT5B 2RC4A 2BY1A 4XIDA 2OF7A 3G4SI 1AWCA 4BBSJ 2K9NA 4XMYA 4HW0A 5F1RA 2ECCA 4KISA 1UJ8A 2HDWA 5BPIA 1HW5A 1PVEA 2OC6A 3GMEA 4IHXA 2EINH 3DCFA 2VJ4A 2Y2ZA 1FT9A 3IWZA 5L3FA 2V1UA 1FBQA 4B47A 1S8NA 4S04A 2M9HA 2FRHA 4N4OB 3HOZJ 1FOKA 2G9WA 1X19A 3FM5A 4ZJZA 2N8GA 4KYWA 1AOYA 4RAYA 3GO5A 3G71I 2KISA 3C7JA 4L0ZB 2QWWA 2EILH 5TRDA 1ZR2A 4CCKA 5JVGF 2PQ8A 2NRAC 1OCZH 2VPLA 1ETVA 1V5GA 2A61A 1X1DA 1Z67A 3WTSC 2A6TA 2DDBA 2IGOA 3JRCA 4Q4ZF 2ZB9A 1SEUA 1O3RA 4KFCA 2M4GA 5C3EJ 2DK5A 5FLVA 2E1MC 3X2QH 5CPRB 4BHBA 4WX9A 1G8XA 1R4MB 4FX0A 4UUSA 4N4NB 3K70C 2QQ9A 2UV1A 3PUBA 1I39A 2ZNZA 1LVAA 2RDPA 2WAFA 3NQOA 3D5LA 1YS6A 2Z16A 3AG3H 2K5CA 1IAWA 4NHJA 1MNEA 3N05A 5M5XJ 2LDUA 3C2HA 3J7ZI 3H36A 2PI0A 4MTDA 3BP8A 2QCOA 1TQMA 2EIJH 2R7DA 3OYMA 3CCYA 4BJ6C 4EM1A 2IS1A 4LFUA 2MA3A 5HLGA 3PQJA 4BL0B 3BLYA 3OYNA 2A6HF 4RGXA 4LG0B 4UXNA 2NVYJ 1YW7A 2L9NA 5CJ9A 3J81Z 1U9OA 3DPUA 2M7AA 1X1CA 2ADUA 2DA7A 2XF7A 3KP6A 3PFIA 2PMZN 5M3FJ 1TZLA 2DK8A 1X2MA 2CQQA 3BR6A 2KJBA 3OOPA 2VODA 2E5NA 5J1UA 2D2WA 3KPHA 2UZKA 1R22A 3L2CA 3CCEI 1GXPA 3CD6I 1RESA 4IRGA 2FBIA 4LLGF 1BA5A 4XBFA 5DCMA 4RB0A 2LY2A 3MZYA 2PJRB 2EZHA 2RNGA 3PM1A 2GM4A 3S3NA 5E1XA 3K4KA 4V2GA 3HOXJ 5M3MJ 3QYEA 1ZRCA 1X2NA 5D4RA 5CVIA 2M5WA 3WHBA 2AQEA 5HOOA 5D5WB 4HF1A 1S6LA 3Q0VA 1FOWA 3R0AA 2WTEA 5EDNA 3L2QA 1FP1D 3PNYA 1MW7A 2KIMA 3L9FA 5ICCA 1YJWI 4W1UA 3QPTA 4IF4A 1KQ8A 5HDNA 4RAZA 3LSGA 3HPGA 4M74A 3B02A 1XDSA 3KP2A 1WHUA 1GDTA 4UY8I 3JRBA 3HZJA 2MBFA 4BKXA 3UNGC 1T38A 4AM3A 1FIAA 3LWFA 1E2XA 1Z7UA 2D1HA 4ZTFA 4I76A 1J09A 2BW3B 4AYBA 1RZ4A 2IEKA 3RDIA 2GLOA 2O8XA 2LR8A 5FO5A 3KEOA 4CA0A 2P4WA 1QNTA 2QBYA 3H35A 1DP3A 4LB6B 3GTMJ 2HTSA 2LF7A 4YRVA 1P7JA 4CXFA 4YIIA 3HOVJ 4L5IA 4XKWA 2CJJA 4XLPF 1OCPA 3A02A 1O4XA 1D0XA 3RYRA 2K85A 4B8XA 2VQHA 3I3LA 1ZHFA 4U87A 3ASOH 1HSJA 1Q1VA 3I64A 3SYTA 5IT3A 1TL8A 2YPRA 4G94A 5GAHJ 3NAUA 2X0LA 3Q3SA 2Z9OA 1Z3YA 3QOPA 3H0DA 5K7ZA 1MH3A 3VFZA 4JK1X 1KU2A 3CDHA 3HGGA 3OV8A 1PUEE 5F08A 2OPTA 4HDVA 2KKOA 1HSTA 2X4HA 4HOBA 3RSNA 3I71A 1RUOA 1VQLI 4NQWA 3GFMA 3V42A 4FASD 3JSOA 4BEHA 4C2UA 1S9HA 2XGDA 2M0CA 4CCJA 1HKQA 2ID6A 4EEFG 2Y0SN 2XSJC 3Q0UA 4ESFA 3ZQQA 4JX6A 4ZYEA 1F43A 2HOEA 2H27A 2O61A 3NRVA 2DT7B 3KYCB 3LMMA 2W7NA 1PJRA 4M3FA 1QBJA 4YG2F 2ZXIA 1KZHA 1IF1A 3P9IA 1W36D 5J8FA 1P4XA 4L9TA 3BQYA 2FNPA 3RTRA 2F6CA 4LK0F 5F27A 2HFHA 1R7JA 5J6XA 2AXTC 1S72I 1TW3A 1HCRA 5DYMA 2GOXB 5F0FA 5EG0B 4C2TA 5FKNA 2LH9A 2DA5A 4BE0A 4PGHA 4IX7A 3E5UA 3IKVA 4C9YA 2DMPA 1IC8A 1LNWA 3RZOJ 3KEQA 2RGVA 3WTTC 2EB7A 5HS8A 2LTPA 3FK7A 2IA2A 4P5OA 3S1RJ 1JHFA 2DBBA 4PJ0C 2CUFA 1W1WE 2BVMA 2IVMA 2JRTA 3Q9VA 4ZZLA 3D5RC 1FY7A 2ZBKA 4B48A 1F9NA 1OCRH 2BY0A 1F4KA 2GWRA 1WI9A 2XAHA 1Z6TA 2BXZA 1MDMA 3SDBA 3I55I 2OQRA 2O3FA 1JXSA 3GFLA 3E7LA 5LEJA 1LDJA 3S3OA 2VKVA 4LK1F 4WXHA 4DGWB 3RI4A 3MFKA 2XGXA 1B9NA 4ZYHA 1Y39A 3DPLC 5HDKA 4HLXA 2R7VA 4CCOA 4HQEA 2DFHA 1QZYA 1Y8QB 1X4PA 4AWXB 3E0JB 4I0BA 1KA8A 2CUEA 3HKZA 2QZ8A 1WJ5A 3CCMI 2XKPA 3F8FA 5AIQA 5CLSA 1JKPC 1BJZA 1IRFA 4ESBA 3LAPA 3FXUA 2VBZA 3RQIA 4WF2A 3D0SA 3BCAA 3ESWB 3GTLJ 3OIOA 1SAUA 4N0BA 1FLIA 2XRNA 4ZZDA 2LF8A 1QA6A 5L3BA 3QU3A 3N4MA 2J5OA 2VJ5A 3CZ6A 1I1SA 3HPHA 3W6JB 3M07A 1AA7A 3CCVI 4F92B 4F55A 1JJ6C 3TW6A 4RM2A 1K78B 3IKTA 1ITYA 4GCVA 2HQRA 4XOTA 1WRJA 3HOTA 1BOBA 2WAQN 2WAEA 3A4CA 2R92J 3ZR8X 5AONA 2M3AA 5DCMB 1KU3A 2Z3YA 3FHNA 5LGTA 2WBMA 4QSHA 4BHCA 1I50J 2UXXA 4HRIA 2P6TA 5EGOB 3EUHC 3I9V2 2ZXJA 1Y8RB 3CUOA 2NS8A 3ECOA 3WTXC 1DPUA 1MMNA 3ZMVA 3AL0B 5M5YJ 1FYMA 1GV2A 2VKEA 2V6CA 2RKHA 4A0XA 4YFNF 3VEPA 3HL2A 3D1NI 1H0MA 4UVCA 3ZCOA 2E19A 3QYFA 1XCVA 2HU9A 3HSEA 2QSGX 2QM3A 1I3AA 2FE3A 4ETSA 1JHHA 3IUOA 2VASA 1HF0A 3GFJA 1VQ5I 1BI0A 2BGCA 5HVQC 4G6DA 4PGGA 2KIFA 2E34A 4HBLA 3PNVA 3ZOBA 1IGNA 2VOOA 3VPRA 1UB9A 4XLHA 4DNCA 2OTJI 1P9QC 2FU4A 3TP3A 1FJLA 4LLNA 2IPQX 4OIPF 3A0HC 1RRJA 2VN2A 2GXAA 1WPKA 2L54A 1YIOA 1I1GA 1Z0XA 5HLHA 2P0WA 2P7VB 1XGSA 2X1CA 3IH3A 4KIBA 3AL0C 2FQ4A 6PAXA 2KDOA 2OTLI 3KE2A 5CVUA 1D1BA 2L9SA 5ICGA 2MW8A 4MLOA 5FFXA 3DQVC 2TDXA 1SMYF 2DTRA 1UELB 5FFZA 4PSXA 1YITI 3IAM2 2PJPA 1HC8A 2D45A 3FXMA 2L7KA 2ACJA 4ZDLA 4GYGA 5TGTA 2OCEA 3JCUC 4D5CA 2EFWA 1BJAA 1S3JA 5LGNA 3CCJI 1RUNA 2M8EA 2LOOA 2OA4A 2NS7A 5KHDA 2NVQJ 3DWLE 4HG2A 3SDGA 1BIAA 4BU2A 1V5FA 4C3IJ 2UXNA 4NQWB 2AO9A 4M3BA 3T8RA 1X1AA 3BR2A 4A3DJ 1UHWA 1FOYA 1FPQA 5LRSA 1ZRFA 4B1RA 2M1BA 4UUSB 1Z7LA 1ULYA 4CGZA 4EM0B 3WTWC 3LQRA 2CU7A 4BS9A 1XPXA 4MFDA 2V9VA 3BJ6A 3U9GA 1MIJA 3VSLA 3K4NA 1ZARA 2HOAA 4FE7A 1ZYRF 1A04A 2ISZA 3I5UA 3QRFF 2VBYA 3MZ8A 1TC3C 2EA4A 3CDLA 4UV9A 3VYTB 1HW2A 5J47A 1O3QA 2QUFA 3PSFA 1LKXA 3OMYA 3H9GA 2BVLA 5F6FA 5B5EC 5DEQA 4M6XA 2R5ZA 4FTHA 2IA0A 3F8MA 3OYFA 3CCRI 1LEAA 2PLYA 1Y0NA 3DBLB 3GVAA 4XRSA 1JGSA 1Z21A 3BTLA 5KK1A 3EPZA 3N97A 2JT1A 2XRLA 1VQ7I 1MH4A 4KITB 5F0CA 2K9LA 2UWMA 4F91B 2RQQA 1WJFA 3VOEA 2L5QA 3OYKA 2VB6A 3WG9A 5HLIA 1UHSA 3NWTA 1XMXA 1LFUP 2P8TA 4FX4A 3EQLF 1XGNA 3O3KA 4BHPA 2WC2A 4GYIA 1SVLA 5FD6A 1AU7A 1RETA 2LYCA 4OU0A 1F1ZA 1MDMB 4KUMA 1TBXA 2E2IJ 1T39A 4RGSA 4M9ZA 3CCUI 2FBHA 1FEXA 1GHCA 3G6EI 4RDUA 1S7AA 3CESA 1R00A 2CS3A 2JPCA 4HNVA 1XC5A 3LL7A 5D8KB 1RNLA 2HYGD 4CO8A 2CWEA 4CHUA 5E1WA 4XKVA 1R49A 1IN4A 5ILVA 4P9UA 3GX4X 2A07F 2ZJ2A 3QWLA 3KZIC 4XK4A 2K4JA 2HYJA 3KZYA 5BOXA 2VQCA 3DKYA 1NK3P 1IUFA 2BW3A 3OSGA 2K3PA 3K4CA 4L9NA 2DA3A 1WJBA 2O03A 2ZSIB 4CUGA 2HVRA 2NVXJ 1STZA 1QZEA 2LK2A 2HPIA 4Y17A 5DUIA 5CVRA 4E4HA 3HUGB 3CTAA 1OYWA 1P4WA 2CH0A 3EETA 3HHHA 4AIHA 1SMTA 2FD5A 2Z99A 4U88A 3BROA 4I6ZA 2FOWA 2ZNYA 1A31A 3DV8A 5J4VA 1SFKA 2KP6A 2IGKA 2LMDA 1MNMC 3GLXA 1NH3A 1P2FA 4CDGA 3KYDB 3ZQGA 3I4NJ 2BHZA 2LSOA 4KJZA 1HKTA 3S8PA 4BDYA 4UHTA 3W6KB 3WU0A 1YFHA 3C1DA 1KYWA 4IHVA 2CV2A 2JVGA 1BI1A 1DUXC 1H9GA 2KPMA 1Z1DA 2EZKA 4BEHB 2W00A 2QYOA 1X3WB 2EIKH 3HBLA 3CJTB 2R5YB 1R5GA 3ZMSA 4S0HB 4MO7A 1LFPA 2O0YA 4Y7NJ 3DTEA 2HYFA 1O3TA 3J7AY 2FEZA 1C0WA 1OCCH 2KLOA 3ZQ7A 3FXLA 4U0YA 5GTIC 3LFKA 4BGDA 4UUTA 2DT5A 1XDUA 3JAMK 3TEDA 1D8KA 4A3IJ 1YW8A 1V4RA 4IRHA 1DU0A 2CFOA 2QGUA 3KFWX 2VKDA 3P7NA 2HXIA 2F48A 1S5LC 2E36A 1XSVA 1L0OC 1OISA 2VUMJ 2H09A 5JFRA 3OYIA 4KN4X 1J0RA 1IG7A 3OYDA 1IN6A 4LMYA 5GPCA 2L4AA 5EG0A 2XHKA 4B43A 1IJWC 3DXJF 3FXRA 2FF4A 3FMQA 2E1CA 3VDXA 1J5YA 2A69F 3G1LA 9ANTA 1Q1HA 1YJNI 2A5WA 2ESNA 3SEZA 4AIDA 2HZDA 2COMA 2DA1A 5J1YA 3M4OJ 1D8JA 1BN5A 3ECHA 3H9JA 1MBHA 3BPVA 4XRMA 4F93B 3LSKA 4FCYA 2C6YA 2LBFA 2V1NA 3OYHA 3EYIA 3CLOA 3AKZA 2MLKA 4BJTA 1XTAA 4V2FA 1YQAA 2HNHA 1AKHB 3QQAA 1LE8B 1EH7A 3T1BA 1FIPA 2XF5A 4A3BJ 2H1LA 3F0CA 4Q48A 3E5XA 4IQJA 3O8HA 4FETA 4IL6C 4BH9A 2L02A 4ZC3A 1ZRDA 4JBAA 2XPVA 1BOAA 3CCLI 3WG7H 4XRSG 5IYBJ 1HKSA 1OR7A 3DBHB 5LLQA 5IY5H 3LSPA 2Y0MA 3GEZA 1MBFA 4U0WA 1VTNC 1P4AA 2Y31A 2EFQA 1NK2P 1TNSA 1R1TA 1K83J 2EK5A 4CH7A 1Y6IA 2F5VA 1TWCJ 2AQFA 2CMPA 2R7OA 2DI3A 2IJLA 3Q9SA 4A2UA 3TL4X 2CUJA 2VC1A 4PJNA 1XMAA 4JX5A 1FSEA 2DMUA 2V1XA 3CC2I 3GTOJ 4L5JA 1BC8C 1G3TA 3FKIJ 4BQNA 1P7IA 1J2XA 2MC4A 4PK4A 1ZAOA 3BZKA 2IGMA 1R5HA 2K9MA 3TQNA 3V8JA 4U7BA 2EV6A 4HLYA 2F2EA 2FX0A 3KIOA 1HOMA 2KFDA 1IRZA 4MGRA 3DEEA 1YHQI 1LB2A 2O8KA 3JRFA 5IP6A 3OYCA 1HA8A 5D6FA 3PQKA 2MYSA 2RNJA 5IPAA 1GXQA 3PSIA 3H1CA 3ELKA 1KQ9A 2JUCA 4OAZA 4EV0A 2DW4A 2HVSA 2FUG2 4E7KA 1HDPA 2W82A 2NS0A 2DOAA 3G2BA 2KT0A 1L3LA 4RB3C 3SXYA 2DT6A 3TDZC 4HZFA 1K7AA 1OLTA 3F9KA 4CYCA 3VB2A 1WJAA 3F8NA 3EYYA 4PFPA 4XRFA 4ENMA 3K1MA 3MEXA 3KP4A 1PP7U 3RYPA 2JQ7A 4E7ZA 2MH2A 3GFIA 1G3YA 3E6DA 4HPQA 5BPDA 2M34A 3MQ0A 3W2VA 5HODA 5B3SH 2BHYA 1P6RA 1TQPA 2DFFA 4JOMA 3ZQFA 1T6SA 1U8RA 3DU5A 4XLFA 4GFBA 3LSJA 3M1CA 1JI8A 3HRMA 4A3KJ 4X0GA 1SFOJ 3CO7C 2DQRA 1BM9A 3ZMTA 1WCMJ 3BPXA 3DU6A 1LJ9A 3HUGA 4A6EA 1K6OA 4OMYA 2X85A 1O7LA 3K4LA 5E20A 2LD5A 1SC7A 2D1VA 1ZH5A 1JT0A 3HGYA 3H3UA 2XUBA 1I6HJ 3BJAA 1XG1A 5EYRA 1WKMA 2JSCA 4NUBA 2K27A 4UVAA 5BQTA 5DUKA 3K6GA 1MJAA 2HR3A 4Y4RA 4GGGA 3G1MA 1U5TB 3WODF 1YI2I 4Y33A 2K9SA 5D8LB 1K61A 3PJRA 2D5VA 2BY3A 4KT5C 1NG7A 4RGRA 4G7OF 1YTYA 3S17J 3Q0WA 1I5ZA 5IYDJ 2ZKZA 3IH4A 4EATA 4IHYA 3V7SA 4F3QA 3O2PE 2X9DA 2P5LC 4C30A 3WU1B 2OJED 3CF2A 2CGPA 4FHTA 3K4JA 3FZVA 2GIVA 3SJMA 1X1BA 5DS9A 4WWCA 2E71A 2HGCA 3WTVC 2JA8J 3DEWA 2DDAA 2GIZA 4XM3A 2Q8KA 2CW0F 1EJ9A 1MMAA 5HLTA 2HI3A 2NXNB 2L3DA 2XGEA 2CUZA 1EV7A 3VWBA 1T56A 3OYGA 1H88C 1WWXA 2DXIA 4L5EA 3ONQA 3KYLA 3MKZA 1QPMA 4GO1A 1G3WA 2R7WA 2FOKA 3GTGJ 2OAZA 2R93J 1ERDA 3IC7A 3WHCA 3LNQA 3FMSA 1GVJA 3CJQB 4XOPA 3BG6A 2MD5A 1J7KA 3GZ6A 4A5NA 2ELJA 2VIXA 3NARA 5FLXK 4KA4A 4KT6A 1TNTA 2LP0A 3VYRB 3S93A 1BR2A 1MSFC 1UFMA 4XLEA 4QIWN 4EMSA 4N9HA 3MZHA 1WVRA 4XLAA 1YO5C 2P5VA 1ORKA 1VF9A 1ETQA 1JUPA 1E3HA 2DODA 2IBDA 4G6QA 4E7LA 4KDPA 3LSMA 4BAYA 3B6AA 4PDKA 5A2QZ 4BQAA 4EJWA 2DMNA 3ABMH 2L7MP 4J00A 4AUXA 5CVVA 1YX5A 3LSTA 5E18F 4UNOA 5JLXA 2E7WA 5KAIC 1AKHA 3W2AA 4NC7A 4OIRF 3P9KA 2VBWA 4UUVA 1ZREA 4E6KG 3C3WA 1T0FA 2JA7J 1GLNA 2HQAA 3E3VA 2XAGA 4NB5A 2R5YA 2G0EA 4BXUA 3BY6A 5DDGA 1T08B 5E3LA 2MSYA 1DP7P 3P5JA 2BYVE 1FMVA 3A01B 1NTCA 2FBKA 4J01A 5TJJA 2WY7Q 4LOCA 4KICA 3OS2A 2ZJRF 2JWTA 2ECBA 3FF5A 2ISYA 2VONA 2CO5A 5EZGA 1N77A 3F21A 2RV8A 2STWA 5DTDA 2MGQA 2WV1A 1Z91A 2F5CA 2L0KA 3AFHA 3HIFA 1BW6A 5B1AH 3T8TA 1FBSA 1R23A 4BQQA 3S1NJ 3S2HJ 1NHAA 4CZCA 2PG4A 3FMRA 4HNTA 2HEOA 2H8WA 3BZ6A 5B66C 5EF6A 2VE8A 4IEJA 2GZWA 5FKOA 3C2BA 3RZDJ 3SFIA 3OIPA 2WY8Q 2BEOA 4DYQA 3DFGA 5LEKA 1VQKI 4M73A 1X1PA 4NDLA 1MGTA 1EH6A 3ZMDA 2H6BA 4O3MA 5F1JA 4RB1A 3L2UA 3ZQHA 4WK8F 2OU2A 2KQRA 4I99C 1MBEA 2COBA 3I0TA 4HF2A 2X1EA 2EIMH 3CP2A 2NNNA 1D0YA 3H5RA 3FWEA 4I02A 4HQMA 3OR2C 1K4TA 2HQ5A 2M2EA 4AVZA 1OCTC 2ESHA 5LRRA 1XD7A 4CZZA 1E17A 1A6IA 1ZN2A 2GXGA 4IOAF 1ZELA 1EKEA 2FA5A 2IAIA 2LFBA 4JQFA 3SEQA 1F5TA 2CV0A 1Z05A 4B09A 1X58A 3G3ZA 1QHGA 2IS4A 3M8EA 3F22A 4RGUA 4LIVA 3PIOF 5H20A 1MNDA 2BOLA 5F04A 1J59A 3EUAA 4GRIA 1MMDA 2Q0OA 4G12A 2L9VA 5L3GA 1Y1VJ 3SZGA 2VLAA 1YOVB 1MZBA 3HRUA 1X4OA 2DPDA 2QSHX 3TO9A 3JR9A 3S2DJ 3HOSA 2ZJPF 2AHQA 2R7RA 3HRSA 2BE5F 1K4SA 3DLAA 2RREA 3FM3A 3OS1A 3HSRA 3RPQA 3I58A 4KNYA 3E6BA 3H9QA 4HX7A 3GXOA 1ODDA 3CO6C 4ON0A 2YS9A 3LSHA 2JRMA 3JRIA 1OQYA 3ZQCA 2FMYA 3W2WA 3H5AA 2L7ZA 2JSPA 3T0YA 4BACA 1PP8F 3J7YJ 5E3NA 4HAMA 2JUGA 1EA3A 4A6DA 3HG9A 1QVUA 2A05A 3FBIB 4LG3A 3AAFA 1UMQA 4IPAA 3KP7A 3REOA 4TV7A 1J75A 1D5YA 1SVOA 2F4OB 3ZMZA 2XPWA 2AXLA 4G6TB 1IN5A 3G1OA 4IJAA 1FBUA 1JTXA 2GBYA 2NOGA 5J8CA 5GPAA 3CQZJ 2KZGA 4KMUX 2X51A 2TRTA 1SD6A 1YE9A 3ABTA 5M5WJ 4ABZA 4OIOF 3WU2C 4OWRB 3RJPA 2QA4I 3W6VA 1SFEA 1R6RA 2L4MA 4AC0A 1FC3A 5L3DA 2L2OA 2DJNA 2JK3A 4YFKF 1UAAA 5FLMJ 1S7OA 1XCBA 2K7LA 2Y9YA 4YEJA 1FWZA 2H8RA 1VI0A 5ILUA 3J80Z 1V55H 3MAJA 1A5JA 3EUHA 4B44A 2DYSH 5H2FC 1DQUA 4NC8A 1DDNA 1I6XA 4FE4A 3S1MJ 4MEXF 4WCGA 5LHHA 3E1SA 1YRNA 1J9IA 4CCMA 4W97A 4XSZF 5CYVA 3WE3A 3U1DA 2RVCA 4XSXF 4ZH4F 3ABLH 1WI3A 5JR3A 1RKWA 3I56I 3VSKA 2WAQA 2EFPA 1XMKA 2ICWG 4L9VA 4BJ5C 3VODA 1HLVA 2B63J 1K79A 2MABA 2Y75A 2W25A 3PNTA 3LSRA 2W85A 1X3UA 3B73A 1M1EB 3AG1H 3IV5A 3BDDA 2K4BA 3JREA 1ETKA 2PBIA 3FIWA 2XROA 2M87A 3L00A 1R58A 4HV5A 4CYCB 4A3MJ 3IP4B 2DA4A 3BR5A 5D6EA 1Z3XA 2QLZA 2YX7A 4D5FA 4ENJA 3ABKH 2EBIA 4L0YB 2LLKA 3ISPA 2Y0SA 1EH8A 1OYYA 2ME6A 2XPUA 3L2RA 4Z2YA 2X6OA 5K7HA 3I53A 3LOCA 4G9YA 3A01A 2O6GE 3BG9A 1FSHA 1YJ9I 2PEXA 4HF0A 1BW5A 1HDDC 3LA3A 3BC8A 1YW9A 2RN7A 1WJCA 3MMYB 3WTZA 2CG4A 4ZYGA 1ETWA 5L3EA 2M45A 2P81A 3BTIA 4LD5A 2ZFWA 3HSFA 3JTGA 4RA2A 4D7NA 2IA1A 1O3SA 1OKRA 4R8HA 2IP2A 1W0TA 4ENKA 1N25A 4P55A 1BI2A 4P96A 1B72A 3BT9A 3CCSI 2MC3A 2IS2A 5IT9K 2ZMEA 4A3JJ 3PL8A 1U5TA 1KU7A 2W1OA 2F4IA 3I59A 2Q2EB 4FISA 2E5ZA 1CF7A 1OR7C 4XLCA 4DOZA 4A3FJ 3M3YJ 2X48A 3I4PA 1W7PA 2LG4A 3TGNA 2JA6J 3BJOA 2EZLA 5E3OA 1ZGAA 3WGGA 3MN2A 3KLOA 2MG4A 4HYEA 3P9CA 4CICA 5BS6A 2CFXA 1YIJI 2LC2A 2XASA 3KCCA 1AHDP 4KIGA 4IRIA 5KAFC 2ZCWA 2QF7A 3CP8A 4BDZA 3OOUA 5DD8A 2H1KA 2WV0A 2I5UA 4DJAA 1BBYA 2FMLA 2FNAA 1LEBA 5H6RA 1CGPA 3HRTA 5IP7J 1HW1A 2OD5A 5DD4A 1IW7F 2WWYA 2KRFA 4AYBN 4F7ZA 4R1HA 1QHHD 2NOJB 3RKQA 5L3CA 3GW2A 5FRMA 2G7HA 3CLQA 3DPTA 1TWHJ 2Y30A 1YLFA 1GT0C 4NNJA 2XB5A 2ZXWH 3L09A 3KX2A 1KU9A 4PZJA 2R0QC 4A0ZA 5FD5A 1SANA 4AVPA 2V4JC 2XGCA 3LA7A 2A68F 4XN0A 2YU3A 3I54A 2NNYA 2HPMA 4QWQA 3O6BB 2XAQA 1E3PA 1BC7C 2CSOA 3HOWJ 2V9KA 4H4KC 4DW6A 3AG4H 3IRRA 1ZGJA 3C2GA 1KONA 4X1EA 3F3XA 2HDCA 1U2WA 1W36C 4XONA 5ICFA 2O5RA 1Y0UA 2R7FA 2ID3A 3OYAA 2DOEA 1NG6A 3BOQA 3CCQI 1TWGJ 3ZRGA 2VKHA 4PJMA 1ACIA 4ASNA 4MIMA 4PUSA 2F4MB 2DTZA 4N9IA 2R7XA 5DM6F 3ROUA 2MH9A 3COAC 2QSFX 2KIQA 1DPRA 1MBGA 4XR6A 5E79C 1FTTA 3QAHA 1ZR4A 1QZZA 1TP4A 3DP7A 3OWTA 1VQMI 3ZN0A 4AIKA 4BUPA 3M9AA 4KN7X 5HS7A 1Y56A 2ELKA 4U0VA 5E17F 3IH2A 1MSEC 1SAXA 4M71A 3H92A 3ML6A 3MVPA 3TDUC 3UR3C 1B8IB 1WJDA 1ZGWA 4QLCU 1ZLJA 3A1YA 2P5KA 2EH3A 4L18B 4NC6A 3WGHA 4JYKA 1MKMA 1ZG1A 4IHTA 4M9SA 2V6EA 4IZZA 1ZKGA 2DFIA 4H0EA 1FOXA 3OIQA 3GTJJ 5BMZA 2VJJA 3QYBA 4DBRA 2PN6A 3F6VA 4QPOA 2JPBA 3DLLF 5K7FA 3K9TA 4EGZA 5E8IA 1U5TC 4E70A 1JUMA 1OMIA 3U2RA 1QO0D 4XICA 2L7FP 4HX4A 2DLLA 1A36A 3B6CA 3ERMA 3CMAI 2VT3A 3DEUA 2Y9ZA 1UG0A 4HNUA 2ZXHA 3CC7I 3PIPF 2V7FA 3J80K 1T8IA 4E7JA 1DGWY 4ESJA 5ILSA 5K5QA 2LY1A 3HXLA 4CSWA 5BNGA 1RR7A 1RI7A 1ON1A 1U78A 3GZ5A 3C18A 3V8KA 4MHGA 4ZYDA 3GWZA 3CJNA 4M9XA 4I09A 3JRAA 2JMWA 2JN6A 1QRYA 4BY7J 3ERED 1E3OC 3AG2H 4BXFA 1VQ6I 3PFYA 5IYCJ 3ZN1A 2EV0A 2QVOA 1D0ZA 3DKXA 3R60A 2XVCA 1A35A 4HX8A 2PMUA 3UKGA 2V26A 4F52A 3HOYJ 1QGPA 1VZ0A 3BQZA 2DYRH 4YFXF 3Q5FA 1O7FA 1BR4A 3GTQJ 4QTRA 3G73A 5LGUA 1IRGA 1FTZA 2XIGA 3HHGA 4I01A 1MMSA 5D5VB 1D5VA 2EFOA 2QKLB 4XL9A 4IQ4A 2EWNA 4CYDA 1I3QJ 4BNCA 5FKLA 4XNFA 3BR0A 2ZMEB 1OPCA 3OR1C 2X6YA 1ZG5A 4DZPA 3CC4I 2DQLA 2Q2EA 2R7UA 5LFAA 1K6YA 1ZLKA 2DN0A 1YX3A 2ZO4A 2LBFB 3HEFA 3M8JA 1BL0A 2Y48A 2X6WA 5CQGA 2OV7A 5IOYA 2BY2A 3BG3A 3M7GA 3L1PA 2WADA 1T98A 3K70D 1Z6RA 5DV5A 1V5EA 4LIUA 5ICEA 3OL3A 1TWFJ 5J40A 1RC9A 1IXRC 4LGWA
chains in the Genus database with same CATH topology
4IOAF 2OTJI 1VQKI 2ZJPF 3CCRI 1VQ4I 1Y39A 2ZJQF 3CC4I 2ZJRF 4V19K 1YJWI 4IO9F 3CCUI 3CCEI 3CCJI 1YJNI 3CD6I 3CCVI 3G6EI 1VQPI 1VQLI 3CC2I 1FOXA 1VQNI 1VQMI 3CCLI 1VQ8I 1VQ7I 3CMEI 1YJ9I 3DLLF 1VQ9I 4UY8I 2NXNB 2K3FA 3CCQI 1YI2I 5JVGF 1S72I 3PIOF 3I56I 2E36A 3CCMI 2QA4I 2OTLI 3CCSI 2E35A 1YIJI 2FOWA 3J7YJ 5GAEJ 5GAGJ 3G71I 1VQOI 3I55I 1VQ5I 1ACIA 5DM7F 1QA6A 2H8WA 5GAHJ 2QEXI 1MMSA 3CMAI 5GADJ 1FOYA 3CJTB 1YHQI 2E34A 3G4SI 2JQ7A 1VQ6I 1YITI 5DM6F 4IOCF 1HC8A 1FOWA 3CF5F 3CC7I 3J7ZI 3PIPF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOA F;  2OTJ I;  1VQK I;  2ZJP F;  3CCR I;  1VQ4 I;  1Y39 A;  2ZJQ F;  3CC4 I;  2ZJR F;  4V19 K;  1YJW I;  4IO9 F;  3CCU I;  3CCE I;  3CCJ I;  1YJN I;  3CD6 I;  3CCV I;  3G6E I;  1VQP I;  1VQL I;  3CC2 I;  1FOX A;  1VQN I;  1VQM I;  3CCL I;  1VQ8 I;  1VQ7 I;  3CME I;  1YJ9 I;  3DLL F;  1VQ9 I;  4UY8 I;  2NXN B;  2K3F A;  3CCQ I;  1YI2 I;  5JVG F;  1S72 I;  3PIO F;  3I56 I;  2E36 A;  3CCM I;  2QA4 I;  2OTL I;  3CCS I;  2E35 A;  1YIJ I;  2FOW A;  3J7Y J;  5GAE J;  5GAG J;  3G71 I;  1VQO I;  3I55 I;  1VQ5 I;  1ACI A;  5DM7 F;  1QA6 A;  2H8W A;  5GAH J;  2QEX I;  1MMS A;  3CMA I;  5GAD J;  1FOY A;  3CJT B;  1YHQ I;  2E34 A;  3G4S I;  2JQ7 A;  1VQ6 I;  1YIT I;  5DM6 F;  4IOC F;  1HC8 A;  1FOW A;  3CF5 F;  3CC7 I;  3J7Z I;  3PIP F; 
#chains in the Genus database with same CATH topology
 2NVU B;  5CKT A;  4XKB A;  4A93 J;  2DFE A;  3RIR A;  5CVJ A;  3LSI A;  1LFB A;  3CUQ C;  1A6Q A;  5K1Y A;  1RPW A;  1XSX A;  1G59 A;  5GP9 A;  1S29 A;  4HEA 2;  5FKK A;  3KET A;  2KIU A;  1VFC A;  1R36 A;  2NAZ A;  4IVN A;  2BBY A;  4RB2 C;  3H5N A;  4RAG A;  2CQN A;  3OYB A;  3S14 J;  2XC7 A;  5EEH A;  1LUJ B;  2EV5 A;  4P9F A;  4LG0 A;  2VOP A;  2E1O A;  1U0J A;  4M72 A;  2WB1 A;  4UB6 C;  2V1D A;  2DMT A;  2NYX A;  4EGY A;  1KYZ A;  1W7P D;  5IP9 J;  1OCO H;  1JT6 A;  1UZC A;  5HS9 A;  1TT0 A;  1JJ8 C;  1VQ8 I;  2CW8 A;  1U3E M;  2XKO A;  1N75 A;  4RM3 A;  1JE8 A;  2DPU A;  2IS6 A;  2EA2 A;  2HXO A;  4XKC A;  3K69 A;  2PJR A;  3IRQ A;  2M30 A;  3ZP5 A;  2O9L A;  1RIO H;  2P6S A;  3BTC A;  5F0H A;  2GA1 A;  2Q1Z B;  2HKO A;  4HDU A;  3HTS B;  1D1A A;  4Z6Y A;  2R3S A;  2Z5U A;  3DTI A;  3RPU A;  2X1D A;  1FP2 A;  4A12 A;  1QVT A;  5ERI A;  1UG2 A;  2KL4 A;  4HA8 A;  3DTK A;  1LDD A;  2DU9 A;  2E1N A;  4YIF A;  1OYI A;  2WA0 A;  3VYS B;  4Q47 A;  4G7H F;  2VJI A;  2CQX A;  4Y52 J;  1IO2 A;  2TCT A;  1JKO C;  1R4N B;  4GDF A;  1I27 A;  1GV5 A;  2QEX I;  4K2E A;  4E7I A;  1WH7 A;  2M4K A;  3QU6 A;  4A3L J;  2QQB A;  4XLN F;  2YUS A;  5LHG A;  4OIN F;  2ZJQ F;  4I7H A;  5HDG A;  1PUF B;  3TBI A;  4LJZ F;  4D9J A;  4E7H A;  2QBY B;  1WSU A;  3MWM A;  4NBQ A;  4XQF A;  2K3F A;  2H94 A;  2LRD A;  1T0F C;  3CJR B;  5F64 A;  2XSD C;  1K78 A;  4OMZ A;  3H0G J;  2CQK A;  2Z2S B;  4Y13 A;  5C4J J;  3OSF A;  1B72 B;  3S16 J;  5FJ8 J;  4M6Y A;  4C3J J;  2FJ1 A;  5D5U B;  3U1K A;  3EDP A;  4HSR A;  1OFC X;  3SZT A;  3ZQL A;  4RMN A;  2W48 A;  5AIP A;  5EGO A;  1U8B A;  2R7Z J;  5JVT A;  2ZME C;  1U9N A;  1E0E A;  4D7M A;  1IZ1 A;  3GF2 A;  4X6A J;  2HTJ A;  3K4B A;  3ZXS A;  4II2 A;  4II3 A;  2E7X A;  3GUD A;  1FMW A;  2K02 A;  1VQO I;  4BYY A;  3L2V A;  3CUQ B;  3GBG A;  2DA2 A;  1ZTR A;  3F72 A;  4C2M J;  2JJ7 A;  2UUZ A;  4WXC A;  2CQ7 A;  4KMF A;  2DAO A;  3V7R A;  2I10 A;  2QQ8 A;  2W84 A;  1B1B A;  2GOM A;  4IOC F;  1ENH A;  1F36 A;  1P92 A;  3ZQI A;  4HV6 A;  4ENN A;  1S7E A;  1WFX A;  1FNN A;  4PJL A;  4A3G J;  1T2K A;  4D0P A;  4A5M A;  3F6O A;  3SQN A;  3QP6 A;  2CW7 A;  1D1C A;  1XB4 A;  4DYR A;  4JP0 A;  3IL2 A;  2XAJ A;  3K7A J;  4PSW A;  2FXA A;  2VQG A;  4ZTJ A;  2P7C B;  3GZN B;  3BR1 A;  3KLN A;  3T5X A;  1DGR M;  2HQN A;  5GAD J;  3J7A O;  4KIF A;  1APL C;  3QOD A;  4M3D A;  1W4M A;  1IV8 A;  1LVK A;  3OY9 A;  3RCO A;  2PMZ A;  3MCZ A;  4QPQ A;  4J19 A;  4HST A;  2HKX A;  1QU3 A;  2K40 A;  1BIB A;  1EF4 A;  5IOZ A;  1KGS A;  1IDZ A;  2W24 A;  4S05 A;  5A2Q K;  2Z1D A;  1WGX A;  3OS0 A;  2KJC A;  3S1Q J;  1UCR A;  3WE2 A;  4LLL A;  2LY9 A;  3JSP A;  1WJE A;  3W3C A;  3ASN H;  4WXD A;  2L01 A;  4XN3 A;  3ZMU A;  3QPH A;  1Z77 A;  2YR2 A;  1H89 C;  5EEA A;  5DCF A;  3PO2 J;  2F5E A;  3DKW A;  3FX3 A;  4EQQ A;  4CCN A;  3JAM Z;  1XN7 A;  1ZK8 A;  1TWA J;  3MKL A;  1FX7 A;  3IAS 2;  1ETX A;  3QPS A;  4XOR A;  3OYJ A;  1VQ4 I;  2W4S A;  1LPQ A;  1SD5 A;  2GXB A;  4ITV A;  3FHZ A;  2QKM B;  3FXK A;  1IN8 A;  2A6E F;  1SFX A;  1LDK B;  2VQL A;  2QQA A;  3RKY A;  3CMM A;  3MD2 A;  5GTH C;  4ZYA A;  2PMH A;  3HB9 A;  4ANJ A;  2VE9 A;  1IUY A;  1WH5 A;  5CQE A;  3GYH X;  3E97 A;  4O5V A;  3M8F A;  1IV6 A;  1R71 A;  2DJI A;  3QPL A;  4E7S A;  5EEG A;  2KDZ A;  4B3X A;  3NWS A;  2H6C A;  3R4K A;  3JRH A;  2EQR A;  2DCE A;  4RAF A;  2FSW A;  2EJR A;  1KQ0 A;  1PYV A;  2FQ3 A;  1O57 A;  2M7B A;  3K1P A;  4OAY A;  4BQO A;  3R6S A;  3KP3 A;  5K5O A;  2R5Z B;  3K2A A;  5H6Q A;  3FK6 A;  3U21 A;  3PUF A;  4EJV A;  3QOE A;  2JA5 J;  2VXD A;  1XGM A;  2R7T A;  1SD7 A;  2VI6 A;  3RKX A;  4RBO A;  3FDY A;  3FXJ A;  4A3C J;  3H3Z A;  2OZU A;  3ZGK A;  5HNF A;  2HVQ A;  3TW7 A;  1XSD A;  3E6M A;  5FKM A;  3TP0 A;  3FBN B;  3HYI A;  3R61 A;  2IRF G;  1YG2 A;  1FZP B;  2V9P A;  3JTH A;  2QEN A;  3QP5 A;  1VQN I;  3F8C A;  1T33 A;  2MLG A;  1IN7 A;  2R7Q A;  5K5R A;  2LKX A;  2RQP A;  2JVH A;  2I8D A;  5J3L A;  3H3V K;  4OOI A;  3IHU A;  4I0A A;  1H9T A;  5JLW A;  5JHU A;  4OIQ F;  5DM7 F;  3O8G A;  1B9M A;  2JTV A;  4MQ9 F;  4ZDO A;  3BG7 A;  3LA2 A;  3CF5 F;  3BTJ A;  3LAJ A;  3J81 K;  1DU6 A;  2EFN A;  3JRD A;  2A3S A;  3A03 A;  2LVS A;  1MJ9 A;  3HDD A;  1POG A;  1N78 A;  2GA2 A;  2OCC H;  3KZZ A;  1HQC A;  3DBR B;  3IWF A;  4MEY F;  3BG5 A;  2HS5 A;  3K0L A;  4O6J A;  2B0L A;  4RLF A;  2MFZ A;  1XS9 A;  2E60 A;  2HOT A;  2XF6 A;  2XAF A;  3VYU B;  2LKS A;  4MQV A;  4JX4 A;  3OYE A;  1HXD A;  1XGO A;  3V7C A;  2L9R A;  2RAE A;  1B6A A;  1FYL A;  1MD0 A;  2LKP A;  1GUU A;  2GAU A;  3BWG A;  4RLQ A;  1Y1W J;  4Y3O A;  5LD2 C;  4IO9 F;  2BV6 A;  4Y15 A;  1FYK A;  3GLL A;  1W5T A;  3E6C C;  1TW2 A;  2XDV A;  3HTU A;  1LQ1 A;  5C4X J;  4I2O A;  2HDD A;  4Q5S F;  2OBP A;  3ZPL A;  4YIR X;  1MJB A;  1USS A;  4A0Y A;  3JRG A;  2IT0 A;  2KRH A;  4AD9 A;  2E2H J;  5JI6 A;  5FGM A;  1W0U A;  3LFU A;  3OL4 A;  3K1N A;  1YS7 A;  5KCM A;  3CDI A;  1TTY A;  4P1W A;  5LHI A;  2K86 A;  1MBK A;  3HM5 A;  3I4M J;  1ETO A;  1U6G A;  3CMY A;  3ULQ B;  3WGI A;  2G7U A;  2NVT J;  2BZT A;  2M0M A;  2EPF A;  3A0B C;  4U7D A;  4C3H J;  3LQQ A;  1V54 H;  1ON2 A;  4CCL A;  4GXO A;  4MNU A;  4UVB A;  2DO7 A;  4DBQ A;  5HNH A;  4AU7 A;  2Y69 H;  1XX5 A;  4BXX J;  4R79 A;  4EVI A;  2VXZ A;  2JZY A;  1G4D A;  1UST A;  4A3E J;  2E35 A;  2IW5 A;  5EZH A;  2B9S A;  1TQI A;  3S15 J;  1SVM A;  2R7S A;  3MKW B;  1R1U A;  5JHF A;  2VT2 A;  3GTK J;  2ELH A;  4BE1 A;  5E8G A;  3V8L A;  3S3M A;  1ONV A;  5KNL A;  3R0J A;  3A2K A;  2PFB A;  1ETY A;  4D1Q A;  5TIS C;  2Z33 A;  2OZ6 A;  5E3M A;  3TKY A;  2ETH A;  1WQ2 A;  3KEY A;  3MKY B;  2W57 A;  1H8A C;  1G3S A;  1YRN B;  2KMU A;  3OYL A;  3NEU A;  3WTY C;  3SZP A;  3CME I;  4IHS A;  2BXY A;  2ME0 A;  3BR3 A;  1R1V A;  4EJO A;  2R4G A;  1RKT A;  4RS8 A;  4A69 C;  4UV8 A;  1G2H A;  2O7O A;  4EJT A;  3M1E A;  1W5C C;  2X6X A;  4PCQ A;  5C44 J;  4L9J A;  3SHF A;  2STT A;  1T95 A;  3L2W A;  1MMG A;  1D3Y A;  3TOB A;  2HOS A;  3JW4 A;  3FXO A;  3FKJ A;  3TO7 A;  5J4Y A;  2E1M B;  2VPR A;  3HJE A;  3HC7 A;  4FQG A;  1MBJ A;  5D4S A;  1JTY A;  1IXS B;  1IDY A;  5KVR A;  2EZI A;  1LE8 A;  1B59 A;  3K10 A;  2CV1 A;  1B4A A;  2A5Y B;  1Z9C A;  4ZDP A;  1VQ9 I;  3KP5 A;  4IHW A;  3BCB A;  2HZT A;  1VND A;  5EJC A;  1BI3 A;  2F5D A;  3RKW A;  1SFU A;  4MTE A;  1HBX G;  2B7E A;  3FIS A;  4MFE A;  5D5X B;  3RQ4 A;  3E5Q A;  3K2Z A;  3TMO A;  4EM2 A;  4EJU A;  2KZV A;  3SFZ A;  2YSR A;  5FLX Z;  4LIT A;  1V3F A;  4V19 K;  5FRN A;  4YEL A;  3HOU J;  1VQP I;  2J5P A;  2KHM A;  1W5S A;  2VC0 A;  2KRC A;  1SD4 A;  4LB5 A;  1R9T J;  1PUF A;  1JGG A;  1B8I A;  1PDN C;  3GCM A;  5E1Z B;  4G7Z F;  3BZC A;  2YX4 A;  1JKR C;  5GAG J;  1UHM A;  3TO6 A;  1GVD A;  2F5F A;  1JKQ C;  2M8G X;  1REP C;  2OUM A;  3ABU A;  2OQG A;  1TLH B;  2ZSH B;  1IRX A;  3S2W A;  2E2J J;  5J1R A;  2K9Q A;  4AIJ A;  2ZFU A;  1OJL A;  5ED4 A;  3PO3 J;  5IT9 Z;  4DQ2 A;  2MD0 A;  2LRE A;  5FB2 A;  3RPU D;  3GTP J;  1X3Z B;  3FXQ A;  1IXC A;  4I98 B;  4IXA A;  4BY1 J;  2YU9 J;  4DZJ A;  4DYC A;  2HWV A;  1G6N A;  1YYV A;  2DA6 A;  3TOA A;  2IXS A;  1R5I D;  4UB8 C;  3I59 B;  2DOF A;  2VBX A;  2DMQ A;  1CF7 B;  3S32 A;  4BE2 A;  3DF8 A;  4M3G A;  1RR8 C;  2JA2 A;  2WB1 N;  1JUS A;  4B3A A;  5GAE J;  1W7P B;  5B1B H;  1WZ2 A;  1ZG3 A;  2VL8 A;  4IKF A;  2AS5 F;  2GQQ A;  4BBR J;  1QPI A;  1BR1 A;  2XB0 X;  4G8X A;  2XV4 S;  3CUQ A;  1CQT A;  2LNB A;  2CYY A;  1QQI A;  3WTU C;  3EUK L;  1ZQ3 P;  4PFO A;  4B4C A;  3K4M A;  2ZC2 A;  3F23 A;  5FRO A;  3V4G A;  3L7W A;  4M3E A;  2PX9 A;  2V79 A;  5LBQ A;  2IGN A;  4M6V A;  3D5S C;  4FT8 A;  4PJJ A;  2XAU A;  3F8B A;  3HKZ N;  2CRG A;  4DIQ A;  1TT5 B;  2RC4 A;  2BY1 A;  4XID A;  2OF7 A;  3G4S I;  1AWC A;  4BBS J;  2K9N A;  4XMY A;  4HW0 A;  5F1R A;  2ECC A;  4KIS A;  1UJ8 A;  2HDW A;  5BPI A;  1HW5 A;  1PVE A;  2OC6 A;  3GME A;  4IHX A;  2EIN H;  3DCF A;  2VJ4 A;  2Y2Z A;  1FT9 A;  3IWZ A;  5L3F A;  2V1U A;  1FBQ A;  4B47 A;  1S8N A;  4S04 A;  2M9H A;  2FRH A;  4N4O B;  3HOZ J;  1FOK A;  2G9W A;  1X19 A;  3FM5 A;  4ZJZ A;  2N8G A;  4KYW A;  1AOY A;  4RAY A;  3GO5 A;  3G71 I;  2KIS A;  3C7J A;  4L0Z B;  2QWW A;  2EIL H;  5TRD A;  1ZR2 A;  4CCK A;  5JVG F;  2PQ8 A;  2NRA C;  1OCZ H;  2VPL A;  1ETV A;  1V5G A;  2A61 A;  1X1D A;  1Z67 A;  3WTS C;  2A6T A;  2DDB A;  2IGO A;  3JRC A;  4Q4Z F;  2ZB9 A;  1SEU A;  1O3R A;  4KFC A;  2M4G A;  5C3E J;  2DK5 A;  5FLV A;  2E1M C;  3X2Q H;  5CPR B;  4BHB A;  4WX9 A;  1G8X A;  1R4M B;  4FX0 A;  4UUS A;  4N4N B;  3K70 C;  2QQ9 A;  2UV1 A;  3PUB A;  1I39 A;  2ZNZ A;  1LVA A;  2RDP A;  2WAF A;  3NQO A;  3D5L A;  1YS6 A;  2Z16 A;  3AG3 H;  2K5C A;  1IAW A;  4NHJ A;  1MNE A;  3N05 A;  5M5X J;  2LDU A;  3C2H A;  3J7Z I;  3H36 A;  2PI0 A;  4MTD A;  3BP8 A;  2QCO A;  1TQM A;  2EIJ H;  2R7D A;  3OYM A;  3CCY A;  4BJ6 C;  4EM1 A;  2IS1 A;  4LFU A;  2MA3 A;  5HLG A;  3PQJ A;  4BL0 B;  3BLY A;  3OYN A;  2A6H F;  4RGX A;  4LG0 B;  4UXN A;  2NVY J;  1YW7 A;  2L9N A;  5CJ9 A;  3J81 Z;  1U9O A;  3DPU A;  2M7A A;  1X1C A;  2ADU A;  2DA7 A;  2XF7 A;  3KP6 A;  3PFI A;  2PMZ N;  5M3F J;  1TZL A;  2DK8 A;  1X2M A;  2CQQ A;  3BR6 A;  2KJB A;  3OOP A;  2VOD A;  2E5N A;  5J1U A;  2D2W A;  3KPH A;  2UZK A;  1R22 A;  3L2C A;  3CCE I;  1GXP A;  3CD6 I;  1RES A;  4IRG A;  2FBI A;  4LLG F;  1BA5 A;  4XBF A;  5DCM A;  4RB0 A;  2LY2 A;  3MZY A;  2PJR B;  2EZH A;  2RNG A;  3PM1 A;  2GM4 A;  3S3N A;  5E1X A;  3K4K A;  4V2G A;  3HOX J;  5M3M J;  3QYE A;  1ZRC A;  1X2N A;  5D4R A;  5CVI A;  2M5W A;  3WHB A;  2AQE A;  5HOO A;  5D5W B;  4HF1 A;  1S6L A;  3Q0V A;  1FOW A;  3R0A A;  2WTE A;  5EDN A;  3L2Q A;  1FP1 D;  3PNY A;  1MW7 A;  2KIM A;  3L9F A;  5ICC A;  1YJW I;  4W1U A;  3QPT A;  4IF4 A;  1KQ8 A;  5HDN A;  4RAZ A;  3LSG A;  3HPG A;  4M74 A;  3B02 A;  1XDS A;  3KP2 A;  1WHU A;  1GDT A;  4UY8 I;  3JRB A;  3HZJ A;  2MBF A;  4BKX A;  3UNG C;  1T38 A;  4AM3 A;  1FIA A;  3LWF A;  1E2X A;  1Z7U A;  2D1H A;  4ZTF A;  4I76 A;  1J09 A;  2BW3 B;  4AYB A;  1RZ4 A;  2IEK A;  3RDI A;  2GLO A;  2O8X A;  2LR8 A;  5FO5 A;  3KEO A;  4CA0 A;  2P4W A;  1QNT A;  2QBY A;  3H35 A;  1DP3 A;  4LB6 B;  3GTM J;  2HTS A;  2LF7 A;  4YRV A;  1P7J A;  4CXF A;  4YII A;  3HOV J;  4L5I A;  4XKW A;  2CJJ A;  4XLP F;  1OCP A;  3A02 A;  1O4X A;  1D0X A;  3RYR A;  2K85 A;  4B8X A;  2VQH A;  3I3L A;  1ZHF A;  4U87 A;  3ASO H;  1HSJ A;  1Q1V A;  3I64 A;  3SYT A;  5IT3 A;  1TL8 A;  2YPR A;  4G94 A;  5GAH J;  3NAU A;  2X0L A;  3Q3S A;  2Z9O A;  1Z3Y A;  3QOP A;  3H0D A;  5K7Z A;  1MH3 A;  3VFZ A;  4JK1 X;  1KU2 A;  3CDH A;  3HGG A;  3OV8 A;  1PUE E;  5F08 A;  2OPT A;  4HDV A;  2KKO A;  1HST A;  2X4H A;  4HOB A;  3RSN A;  3I71 A;  1RUO A;  1VQL I;  4NQW A;  3GFM A;  3V42 A;  4FAS D;  3JSO A;  4BEH A;  4C2U A;  1S9H A;  2XGD A;  2M0C A;  4CCJ A;  1HKQ A;  2ID6 A;  4EEF G;  2Y0S N;  2XSJ C;  3Q0U A;  4ESF A;  3ZQQ A;  4JX6 A;  4ZYE A;  1F43 A;  2HOE A;  2H27 A;  2O61 A;  3NRV A;  2DT7 B;  3KYC B;  3LMM A;  2W7N A;  1PJR A;  4M3F A;  1QBJ A;  4YG2 F;  2ZXI A;  1KZH A;  1IF1 A;  3P9I A;  1W36 D;  5J8F A;  1P4X A;  4L9T A;  3BQY A;  2FNP A;  3RTR A;  2F6C A;  4LK0 F;  5F27 A;  2HFH A;  1R7J A;  5J6X A;  2AXT C;  1S72 I;  1TW3 A;  1HCR A;  5DYM A;  2GOX B;  5F0F A;  5EG0 B;  4C2T A;  5FKN A;  2LH9 A;  2DA5 A;  4BE0 A;  4PGH A;  4IX7 A;  3E5U A;  3IKV A;  4C9Y A;  2DMP A;  1IC8 A;  1LNW A;  3RZO J;  3KEQ A;  2RGV A;  3WTT C;  2EB7 A;  5HS8 A;  2LTP A;  3FK7 A;  2IA2 A;  4P5O A;  3S1R J;  1JHF A;  2DBB A;  4PJ0 C;  2CUF A;  1W1W E;  2BVM A;  2IVM A;  2JRT A;  3Q9V A;  4ZZL A;  3D5R C;  1FY7 A;  2ZBK A;  4B48 A;  1F9N A;  1OCR H;  2BY0 A;  1F4K A;  2GWR A;  1WI9 A;  2XAH A;  1Z6T A;  2BXZ A;  1MDM A;  3SDB A;  3I55 I;  2OQR A;  2O3F A;  1JXS A;  3GFL A;  3E7L A;  5LEJ A;  1LDJ A;  3S3O A;  2VKV A;  4LK1 F;  4WXH A;  4DGW B;  3RI4 A;  3MFK A;  2XGX A;  1B9N A;  4ZYH A;  1Y39 A;  3DPL C;  5HDK A;  4HLX A;  2R7V A;  4CCO A;  4HQE A;  2DFH A;  1QZY A;  1Y8Q B;  1X4P A;  4AWX B;  3E0J B;  4I0B A;  1KA8 A;  2CUE A;  3HKZ A;  2QZ8 A;  1WJ5 A;  3CCM I;  2XKP A;  3F8F A;  5AIQ A;  5CLS A;  1JKP C;  1BJZ A;  1IRF A;  4ESB A;  3LAP A;  3FXU A;  2VBZ A;  3RQI A;  4WF2 A;  3D0S A;  3BCA A;  3ESW B;  3GTL J;  3OIO A;  1SAU A;  4N0B A;  1FLI A;  2XRN A;  4ZZD A;  2LF8 A;  1QA6 A;  5L3B A;  3QU3 A;  3N4M A;  2J5O A;  2VJ5 A;  3CZ6 A;  1I1S A;  3HPH A;  3W6J B;  3M07 A;  1AA7 A;  3CCV I;  4F92 B;  4F55 A;  1JJ6 C;  3TW6 A;  4RM2 A;  1K78 B;  3IKT A;  1ITY A;  4GCV A;  2HQR A;  4XOT A;  1WRJ A;  3HOT A;  1BOB A;  2WAQ N;  2WAE A;  3A4C A;  2R92 J;  3ZR8 X;  5AON A;  2M3A A;  5DCM B;  1KU3 A;  2Z3Y A;  3FHN A;  5LGT A;  2WBM A;  4QSH A;  4BHC A;  1I50 J;  2UXX A;  4HRI A;  2P6T A;  5EGO B;  3EUH C;  3I9V 2;  2ZXJ A;  1Y8R B;  3CUO A;  2NS8 A;  3ECO A;  3WTX C;  1DPU A;  1MMN A;  3ZMV A;  3AL0 B;  5M5Y J;  1FYM A;  1GV2 A;  2VKE A;  2V6C A;  2RKH A;  4A0X A;  4YFN F;  3VEP A;  3HL2 A;  3D1N I;  1H0M A;  4UVC A;  3ZCO A;  2E19 A;  3QYF A;  1XCV A;  2HU9 A;  3HSE A;  2QSG X;  2QM3 A;  1I3A A;  2FE3 A;  4ETS A;  1JHH A;  3IUO A;  2VAS A;  1HF0 A;  3GFJ A;  1VQ5 I;  1BI0 A;  2BGC A;  5HVQ C;  4G6D A;  4PGG A;  2KIF A;  2E34 A;  4HBL A;  3PNV A;  3ZOB A;  1IGN A;  2VOO A;  3VPR A;  1UB9 A;  4XLH A;  4DNC A;  2OTJ I;  1P9Q C;  2FU4 A;  3TP3 A;  1FJL A;  4LLN A;  2IPQ X;  4OIP F;  3A0H C;  1RRJ A;  2VN2 A;  2GXA A;  1WPK A;  2L54 A;  1YIO A;  1I1G A;  1Z0X A;  5HLH A;  2P0W A;  2P7V B;  1XGS A;  2X1C A;  3IH3 A;  4KIB A;  3AL0 C;  2FQ4 A;  6PAX A;  2KDO A;  2OTL I;  3KE2 A;  5CVU A;  1D1B A;  2L9S A;  5ICG A;  2MW8 A;  4MLO A;  5FFX A;  3DQV C;  2TDX A;  1SMY F;  2DTR A;  1UEL B;  5FFZ A;  4PSX A;  1YIT I;  3IAM 2;  2PJP A;  1HC8 A;  2D45 A;  3FXM A;  2L7K A;  2ACJ A;  4ZDL A;  4GYG A;  5TGT A;  2OCE A;  3JCU C;  4D5C A;  2EFW A;  1BJA A;  1S3J A;  5LGN A;  3CCJ I;  1RUN A;  2M8E A;  2LOO A;  2OA4 A;  2NS7 A;  5KHD A;  2NVQ J;  3DWL E;  4HG2 A;  3SDG A;  1BIA A;  4BU2 A;  1V5F A;  4C3I J;  2UXN A;  4NQW B;  2AO9 A;  4M3B A;  3T8R A;  1X1A A;  3BR2 A;  4A3D J;  1UHW A;  1FOY A;  1FPQ A;  5LRS A;  1ZRF A;  4B1R A;  2M1B A;  4UUS B;  1Z7L A;  1ULY A;  4CGZ A;  4EM0 B;  3WTW C;  3LQR A;  2CU7 A;  4BS9 A;  1XPX A;  4MFD A;  2V9V A;  3BJ6 A;  3U9G A;  1MIJ A;  3VSL A;  3K4N A;  1ZAR A;  2HOA A;  4FE7 A;  1ZYR F;  1A04 A;  2ISZ A;  3I5U A;  3QRF F;  2VBY A;  3MZ8 A;  1TC3 C;  2EA4 A;  3CDL A;  4UV9 A;  3VYT B;  1HW2 A;  5J47 A;  1O3Q A;  2QUF A;  3PSF A;  1LKX A;  3OMY A;  3H9G A;  2BVL A;  5F6F A;  5B5E C;  5DEQ A;  4M6X A;  2R5Z A;  4FTH A;  2IA0 A;  3F8M A;  3OYF A;  3CCR I;  1LEA A;  2PLY A;  1Y0N A;  3DBL B;  3GVA A;  4XRS A;  1JGS A;  1Z21 A;  3BTL A;  5KK1 A;  3EPZ A;  3N97 A;  2JT1 A;  2XRL A;  1VQ7 I;  1MH4 A;  4KIT B;  5F0C A;  2K9L A;  2UWM A;  4F91 B;  2RQQ A;  1WJF A;  3VOE A;  2L5Q A;  3OYK A;  2VB6 A;  3WG9 A;  5HLI A;  1UHS A;  3NWT A;  1XMX A;  1LFU P;  2P8T A;  4FX4 A;  3EQL F;  1XGN A;  3O3K A;  4BHP A;  2WC2 A;  4GYI A;  1SVL A;  5FD6 A;  1AU7 A;  1RET A;  2LYC A;  4OU0 A;  1F1Z A;  1MDM B;  4KUM A;  1TBX A;  2E2I J;  1T39 A;  4RGS A;  4M9Z A;  3CCU I;  2FBH A;  1FEX A;  1GHC A;  3G6E I;  4RDU A;  1S7A A;  3CES A;  1R00 A;  2CS3 A;  2JPC A;  4HNV A;  1XC5 A;  3LL7 A;  5D8K B;  1RNL A;  2HYG D;  4CO8 A;  2CWE A;  4CHU A;  5E1W A;  4XKV A;  1R49 A;  1IN4 A;  5ILV A;  4P9U A;  3GX4 X;  2A07 F;  2ZJ2 A;  3QWL A;  3KZI C;  4XK4 A;  2K4J A;  2HYJ A;  3KZY A;  5BOX A;  2VQC A;  3DKY A;  1NK3 P;  1IUF A;  2BW3 A;  3OSG A;  2K3P A;  3K4C A;  4L9N A;  2DA3 A;  1WJB A;  2O03 A;  2ZSI B;  4CUG A;  2HVR A;  2NVX J;  1STZ A;  1QZE A;  2LK2 A;  2HPI A;  4Y17 A;  5DUI A;  5CVR A;  4E4H A;  3HUG B;  3CTA A;  1OYW A;  1P4W A;  2CH0 A;  3EET A;  3HHH A;  4AIH A;  1SMT A;  2FD5 A;  2Z99 A;  4U88 A;  3BRO A;  4I6Z A;  2FOW A;  2ZNY A;  1A31 A;  3DV8 A;  5J4V A;  1SFK A;  2KP6 A;  2IGK A;  2LMD A;  1MNM C;  3GLX A;  1NH3 A;  1P2F A;  4CDG A;  3KYD B;  3ZQG A;  3I4N J;  2BHZ A;  2LSO A;  4KJZ A;  1HKT A;  3S8P A;  4BDY A;  4UHT A;  3W6K B;  3WU0 A;  1YFH A;  3C1D A;  1KYW A;  4IHV A;  2CV2 A;  2JVG A;  1BI1 A;  1DUX C;  1H9G A;  2KPM A;  1Z1D A;  2EZK A;  4BEH B;  2W00 A;  2QYO A;  1X3W B;  2EIK H;  3HBL A;  3CJT B;  2R5Y B;  1R5G A;  3ZMS A;  4S0H B;  4MO7 A;  1LFP A;  2O0Y A;  4Y7N J;  3DTE A;  2HYF A;  1O3T A;  3J7A Y;  2FEZ A;  1C0W A;  1OCC H;  2KLO A;  3ZQ7 A;  3FXL A;  4U0Y A;  5GTI C;  3LFK A;  4BGD A;  4UUT A;  2DT5 A;  1XDU A;  3JAM K;  3TED A;  1D8K A;  4A3I J;  1YW8 A;  1V4R A;  4IRH A;  1DU0 A;  2CFO A;  2QGU A;  3KFW X;  2VKD A;  3P7N A;  2HXI A;  2F48 A;  1S5L C;  2E36 A;  1XSV A;  1L0O C;  1OIS A;  2VUM J;  2H09 A;  5JFR A;  3OYI A;  4KN4 X;  1J0R A;  1IG7 A;  3OYD A;  1IN6 A;  4LMY A;  5GPC A;  2L4A A;  5EG0 A;  2XHK A;  4B43 A;  1IJW C;  3DXJ F;  3FXR A;  2FF4 A;  3FMQ A;  2E1C A;  3VDX A;  1J5Y A;  2A69 F;  3G1L A;  9ANT A;  1Q1H A;  1YJN I;  2A5W A;  2ESN A;  3SEZ A;  4AID A;  2HZD A;  2COM A;  2DA1 A;  5J1Y A;  3M4O J;  1D8J A;  1BN5 A;  3ECH A;  3H9J A;  1MBH A;  3BPV A;  4XRM A;  4F93 B;  3LSK A;  4FCY A;  2C6Y A;  2LBF A;  2V1N A;  3OYH A;  3EYI A;  3CLO A;  3AKZ A;  2MLK A;  4BJT A;  1XTA A;  4V2F A;  1YQA A;  2HNH A;  1AKH B;  3QQA A;  1LE8 B;  1EH7 A;  3T1B A;  1FIP A;  2XF5 A;  4A3B J;  2H1L A;  3F0C A;  4Q48 A;  3E5X A;  4IQJ A;  3O8H A;  4FET A;  4IL6 C;  4BH9 A;  2L02 A;  4ZC3 A;  1ZRD A;  4JBA A;  2XPV A;  1BOA A;  3CCL I;  3WG7 H;  4XRS G;  5IYB J;  1HKS A;  1OR7 A;  3DBH B;  5LLQ A;  5IY5 H;  3LSP A;  2Y0M A;  3GEZ A;  1MBF A;  4U0W A;  1VTN C;  1P4A A;  2Y31 A;  2EFQ A;  1NK2 P;  1TNS A;  1R1T A;  1K83 J;  2EK5 A;  4CH7 A;  1Y6I A;  2F5V A;  1TWC J;  2AQF A;  2CMP A;  2R7O A;  2DI3 A;  2IJL A;  3Q9S A;  4A2U A;  3TL4 X;  2CUJ A;  2VC1 A;  4PJN A;  1XMA A;  4JX5 A;  1FSE A;  2DMU A;  2V1X A;  3CC2 I;  3GTO J;  4L5J A;  1BC8 C;  1G3T A;  3FKI J;  4BQN A;  1P7I A;  1J2X A;  2MC4 A;  4PK4 A;  1ZAO A;  3BZK A;  2IGM A;  1R5H A;  2K9M A;  3TQN A;  3V8J A;  4U7B A;  2EV6 A;  4HLY A;  2F2E A;  2FX0 A;  3KIO A;  1HOM A;  2KFD A;  1IRZ A;  4MGR A;  3DEE A;  1YHQ I;  1LB2 A;  2O8K A;  3JRF A;  5IP6 A;  3OYC A;  1HA8 A;  5D6F A;  3PQK A;  2MYS A;  2RNJ A;  5IPA A;  1GXQ A;  3PSI A;  3H1C A;  3ELK A;  1KQ9 A;  2JUC A;  4OAZ A;  4EV0 A;  2DW4 A;  2HVS A;  2FUG 2;  4E7K A;  1HDP A;  2W82 A;  2NS0 A;  2DOA A;  3G2B A;  2KT0 A;  1L3L A;  4RB3 C;  3SXY A;  2DT6 A;  3TDZ C;  4HZF A;  1K7A A;  1OLT A;  3F9K A;  4CYC A;  3VB2 A;  1WJA A;  3F8N A;  3EYY A;  4PFP A;  4XRF A;  4ENM A;  3K1M A;  3MEX A;  3KP4 A;  1PP7 U;  3RYP A;  2JQ7 A;  4E7Z A;  2MH2 A;  3GFI A;  1G3Y A;  3E6D A;  4HPQ A;  5BPD A;  2M34 A;  3MQ0 A;  3W2V A;  5HOD A;  5B3S H;  2BHY A;  1P6R A;  1TQP A;  2DFF A;  4JOM A;  3ZQF A;  1T6S A;  1U8R A;  3DU5 A;  4XLF A;  4GFB A;  3LSJ A;  3M1C A;  1JI8 A;  3HRM A;  4A3K J;  4X0G A;  1SFO J;  3CO7 C;  2DQR A;  1BM9 A;  3ZMT A;  1WCM J;  3BPX A;  3DU6 A;  1LJ9 A;  3HUG A;  4A6E A;  1K6O A;  4OMY A;  2X85 A;  1O7L A;  3K4L A;  5E20 A;  2LD5 A;  1SC7 A;  2D1V A;  1ZH5 A;  1JT0 A;  3HGY A;  3H3U A;  2XUB A;  1I6H J;  3BJA A;  1XG1 A;  5EYR A;  1WKM A;  2JSC A;  4NUB A;  2K27 A;  4UVA A;  5BQT A;  5DUK A;  3K6G A;  1MJA A;  2HR3 A;  4Y4R A;  4GGG A;  3G1M A;  1U5T B;  3WOD F;  1YI2 I;  4Y33 A;  2K9S A;  5D8L B;  1K61 A;  3PJR A;  2D5V A;  2BY3 A;  4KT5 C;  1NG7 A;  4RGR A;  4G7O F;  1YTY A;  3S17 J;  3Q0W A;  1I5Z A;  5IYD J;  2ZKZ A;  3IH4 A;  4EAT A;  4IHY A;  3V7S A;  4F3Q A;  3O2P E;  2X9D A;  2P5L C;  4C30 A;  3WU1 B;  2OJE D;  3CF2 A;  2CGP A;  4FHT A;  3K4J A;  3FZV A;  2GIV A;  3SJM A;  1X1B A;  5DS9 A;  4WWC A;  2E71 A;  2HGC A;  3WTV C;  2JA8 J;  3DEW A;  2DDA A;  2GIZ A;  4XM3 A;  2Q8K A;  2CW0 F;  1EJ9 A;  1MMA A;  5HLT A;  2HI3 A;  2NXN B;  2L3D A;  2XGE A;  2CUZ A;  1EV7 A;  3VWB A;  1T56 A;  3OYG A;  1H88 C;  1WWX A;  2DXI A;  4L5E A;  3ONQ A;  3KYL A;  3MKZ A;  1QPM A;  4GO1 A;  1G3W A;  2R7W A;  2FOK A;  3GTG J;  2OAZ A;  2R93 J;  1ERD A;  3IC7 A;  3WHC A;  3LNQ A;  3FMS A;  1GVJ A;  3CJQ B;  4XOP A;  3BG6 A;  2MD5 A;  1J7K A;  3GZ6 A;  4A5N A;  2ELJ A;  2VIX A;  3NAR A;  5FLX K;  4KA4 A;  4KT6 A;  1TNT A;  2LP0 A;  3VYR B;  3S93 A;  1BR2 A;  1MSF C;  1UFM A;  4XLE A;  4QIW N;  4EMS A;  4N9H A;  3MZH A;  1WVR A;  4XLA A;  1YO5 C;  2P5V A;  1ORK A;  1VF9 A;  1ETQ A;  1JUP A;  1E3H A;  2DOD A;  2IBD A;  4G6Q A;  4E7L A;  4KDP A;  3LSM A;  4BAY A;  3B6A A;  4PDK A;  5A2Q Z;  4BQA A;  4EJW A;  2DMN A;  3ABM H;  2L7M P;  4J00 A;  4AUX A;  5CVV A;  1YX5 A;  3LST A;  5E18 F;  4UNO A;  5JLX A;  2E7W A;  5KAI C;  1AKH A;  3W2A A;  4NC7 A;  4OIR F;  3P9K A;  2VBW A;  4UUV A;  1ZRE A;  4E6K G;  3C3W A;  1T0F A;  2JA7 J;  1GLN A;  2HQA A;  3E3V A;  2XAG A;  4NB5 A;  2R5Y A;  2G0E A;  4BXU A;  3BY6 A;  5DDG A;  1T08 B;  5E3L A;  2MSY A;  1DP7 P;  3P5J A;  2BYV E;  1FMV A;  3A01 B;  1NTC A;  2FBK A;  4J01 A;  5TJJ A;  2WY7 Q;  4LOC A;  4KIC A;  3OS2 A;  2ZJR F;  2JWT A;  2ECB A;  3FF5 A;  2ISY A;  2VON A;  2CO5 A;  5EZG A;  1N77 A;  3F21 A;  2RV8 A;  2STW A;  5DTD A;  2MGQ A;  2WV1 A;  1Z91 A;  2F5C A;  2L0K A;  3AFH A;  3HIF A;  1BW6 A;  5B1A H;  3T8T A;  1FBS A;  1R23 A;  4BQQ A;  3S1N J;  3S2H J;  1NHA A;  4CZC A;  2PG4 A;  3FMR A;  4HNT A;  2HEO A;  2H8W A;  3BZ6 A;  5B66 C;  5EF6 A;  2VE8 A;  4IEJ A;  2GZW A;  5FKO A;  3C2B A;  3RZD J;  3SFI A;  3OIP A;  2WY8 Q;  2BEO A;  4DYQ A;  3DFG A;  5LEK A;  1VQK I;  4M73 A;  1X1P A;  4NDL A;  1MGT A;  1EH6 A;  3ZMD A;  2H6B A;  4O3M A;  5F1J A;  4RB1 A;  3L2U A;  3ZQH A;  4WK8 F;  2OU2 A;  2KQR A;  4I99 C;  1MBE A;  2COB A;  3I0T A;  4HF2 A;  2X1E A;  2EIM H;  3CP2 A;  2NNN A;  1D0Y A;  3H5R A;  3FWE A;  4I02 A;  4HQM A;  3OR2 C;  1K4T A;  2HQ5 A;  2M2E A;  4AVZ A;  1OCT C;  2ESH A;  5LRR A;  1XD7 A;  4CZZ A;  1E17 A;  1A6I A;  1ZN2 A;  2GXG A;  4IOA F;  1ZEL A;  1EKE A;  2FA5 A;  2IAI A;  2LFB A;  4JQF A;  3SEQ A;  1F5T A;  2CV0 A;  1Z05 A;  4B09 A;  1X58 A;  3G3Z A;  1QHG A;  2IS4 A;  3M8E A;  3F22 A;  4RGU A;  4LIV A;  3PIO F;  5H20 A;  1MND A;  2BOL A;  5F04 A;  1J59 A;  3EUA A;  4GRI A;  1MMD A;  2Q0O A;  4G12 A;  2L9V A;  5L3G A;  1Y1V J;  3SZG A;  2VLA A;  1YOV B;  1MZB A;  3HRU A;  1X4O A;  2DPD A;  2QSH X;  3TO9 A;  3JR9 A;  3S2D J;  3HOS A;  2ZJP F;  2AHQ A;  2R7R A;  3HRS A;  2BE5 F;  1K4S A;  3DLA A;  2RRE A;  3FM3 A;  3OS1 A;  3HSR A;  3RPQ A;  3I58 A;  4KNY A;  3E6B A;  3H9Q A;  4HX7 A;  3GXO A;  1ODD A;  3CO6 C;  4ON0 A;  2YS9 A;  3LSH A;  2JRM A;  3JRI A;  1OQY A;  3ZQC A;  2FMY A;  3W2W A;  3H5A A;  2L7Z A;  2JSP A;  3T0Y A;  4BAC A;  1PP8 F;  3J7Y J;  5E3N A;  4HAM A;  2JUG A;  1EA3 A;  4A6D A;  3HG9 A;  1QVU A;  2A05 A;  3FBI B;  4LG3 A;  3AAF A;  1UMQ A;  4IPA A;  3KP7 A;  3REO A;  4TV7 A;  1J75 A;  1D5Y A;  1SVO A;  2F4O B;  3ZMZ A;  2XPW A;  2AXL A;  4G6T B;  1IN5 A;  3G1O A;  4IJA A;  1FBU A;  1JTX A;  2GBY A;  2NOG A;  5J8C A;  5GPA A;  3CQZ J;  2KZG A;  4KMU X;  2X51 A;  2TRT A;  1SD6 A;  1YE9 A;  3ABT A;  5M5W J;  4ABZ A;  4OIO F;  3WU2 C;  4OWR B;  3RJP A;  2QA4 I;  3W6V A;  1SFE A;  1R6R A;  2L4M A;  4AC0 A;  1FC3 A;  5L3D A;  2L2O A;  2DJN A;  2JK3 A;  4YFK F;  1UAA A;  5FLM J;  1S7O A;  1XCB A;  2K7L A;  2Y9Y A;  4YEJ A;  1FWZ A;  2H8R A;  1VI0 A;  5ILU A;  3J80 Z;  1V55 H;  3MAJ A;  1A5J A;  3EUH A;  4B44 A;  2DYS H;  5H2F C;  1DQU A;  4NC8 A;  1DDN A;  1I6X A;  4FE4 A;  3S1M J;  4MEX F;  4WCG A;  5LHH A;  3E1S A;  1YRN A;  1J9I A;  4CCM A;  4W97 A;  4XSZ F;  5CYV A;  3WE3 A;  3U1D A;  2RVC A;  4XSX F;  4ZH4 F;  3ABL H;  1WI3 A;  5JR3 A;  1RKW A;  3I56 I;  3VSK A;  2WAQ A;  2EFP A;  1XMK A;  2ICW G;  4L9V A;  4BJ5 C;  3VOD A;  1HLV A;  2B63 J;  1K79 A;  2MAB A;  2Y75 A;  2W25 A;  3PNT A;  3LSR A;  2W85 A;  1X3U A;  3B73 A;  1M1E B;  3AG1 H;  3IV5 A;  3BDD A;  2K4B A;  3JRE A;  1ETK A;  2PBI A;  3FIW A;  2XRO A;  2M87 A;  3L00 A;  1R58 A;  4HV5 A;  4CYC B;  4A3M J;  3IP4 B;  2DA4 A;  3BR5 A;  5D6E A;  1Z3X A;  2QLZ A;  2YX7 A;  4D5F A;  4ENJ A;  3ABK H;  2EBI A;  4L0Y B;  2LLK A;  3ISP A;  2Y0S A;  1EH8 A;  1OYY A;  2ME6 A;  2XPU A;  3L2R A;  4Z2Y A;  2X6O A;  5K7H A;  3I53 A;  3LOC A;  4G9Y A;  3A01 A;  2O6G E;  3BG9 A;  1FSH A;  1YJ9 I;  2PEX A;  4HF0 A;  1BW5 A;  1HDD C;  3LA3 A;  3BC8 A;  1YW9 A;  2RN7 A;  1WJC A;  3MMY B;  3WTZ A;  2CG4 A;  4ZYG A;  1ETW A;  5L3E A;  2M45 A;  2P81 A;  3BTI A;  4LD5 A;  2ZFW A;  3HSF A;  3JTG A;  4RA2 A;  4D7N A;  2IA1 A;  1O3S A;  1OKR A;  4R8H A;  2IP2 A;  1W0T A;  4ENK A;  1N25 A;  4P55 A;  1BI2 A;  4P96 A;  1B72 A;  3BT9 A;  3CCS I;  2MC3 A;  2IS2 A;  5IT9 K;  2ZME A;  4A3J J;  3PL8 A;  1U5T A;  1KU7 A;  2W1O A;  2F4I A;  3I59 A;  2Q2E B;  4FIS A;  2E5Z A;  1CF7 A;  1OR7 C;  4XLC A;  4DOZ A;  4A3F J;  3M3Y J;  2X48 A;  3I4P A;  1W7P A;  2LG4 A;  3TGN A;  2JA6 J;  3BJO A;  2EZL A;  5E3O A;  1ZGA A;  3WGG A;  3MN2 A;  3KLO A;  2MG4 A;  4HYE A;  3P9C A;  4CIC A;  5BS6 A;  2CFX A;  1YIJ I;  2LC2 A;  2XAS A;  3KCC A;  1AHD P;  4KIG A;  4IRI A;  5KAF C;  2ZCW A;  2QF7 A;  3CP8 A;  4BDZ A;  3OOU A;  5DD8 A;  2H1K A;  2WV0 A;  2I5U A;  4DJA A;  1BBY A;  2FML A;  2FNA A;  1LEB A;  5H6R A;  1CGP A;  3HRT A;  5IP7 J;  1HW1 A;  2OD5 A;  5DD4 A;  1IW7 F;  2WWY A;  2KRF A;  4AYB N;  4F7Z A;  4R1H A;  1QHH D;  2NOJ B;  3RKQ A;  5L3C A;  3GW2 A;  5FRM A;  2G7H A;  3CLQ A;  3DPT A;  1TWH J;  2Y30 A;  1YLF A;  1GT0 C;  4NNJ A;  2XB5 A;  2ZXW H;  3L09 A;  3KX2 A;  1KU9 A;  4PZJ A;  2R0Q C;  4A0Z A;  5FD5 A;  1SAN A;  4AVP A;  2V4J C;  2XGC A;  3LA7 A;  2A68 F;  4XN0 A;  2YU3 A;  3I54 A;  2NNY A;  2HPM A;  4QWQ A;  3O6B B;  2XAQ A;  1E3P A;  1BC7 C;  2CSO A;  3HOW J;  2V9K A;  4H4K C;  4DW6 A;  3AG4 H;  3IRR A;  1ZGJ A;  3C2G A;  1KON A;  4X1E A;  3F3X A;  2HDC A;  1U2W A;  1W36 C;  4XON A;  5ICF A;  2O5R A;  1Y0U A;  2R7F A;  2ID3 A;  3OYA A;  2DOE A;  1NG6 A;  3BOQ A;  3CCQ I;  1TWG J;  3ZRG A;  2VKH A;  4PJM A;  1ACI A;  4ASN A;  4MIM A;  4PUS A;  2F4M B;  2DTZ A;  4N9I A;  2R7X A;  5DM6 F;  3ROU A;  2MH9 A;  3COA C;  2QSF X;  2KIQ A;  1DPR A;  1MBG A;  4XR6 A;  5E79 C;  1FTT A;  3QAH A;  1ZR4 A;  1QZZ A;  1TP4 A;  3DP7 A;  3OWT A;  1VQM I;  3ZN0 A;  4AIK A;  4BUP A;  3M9A A;  4KN7 X;  5HS7 A;  1Y56 A;  2ELK A;  4U0V A;  5E17 F;  3IH2 A;  1MSE C;  1SAX A;  4M71 A;  3H92 A;  3ML6 A;  3MVP A;  3TDU C;  3UR3 C;  1B8I B;  1WJD A;  1ZGW A;  4QLC U;  1ZLJ A;  3A1Y A;  2P5K A;  2EH3 A;  4L18 B;  4NC6 A;  3WGH A;  4JYK A;  1MKM A;  1ZG1 A;  4IHT A;  4M9S A;  2V6E A;  4IZZ A;  1ZKG A;  2DFI A;  4H0E A;  1FOX A;  3OIQ A;  3GTJ J;  5BMZ A;  2VJJ A;  3QYB A;  4DBR A;  2PN6 A;  3F6V A;  4QPO A;  2JPB A;  3DLL F;  5K7F A;  3K9T A;  4EGZ A;  5E8I A;  1U5T C;  4E70 A;  1JUM A;  1OMI A;  3U2R A;  1QO0 D;  4XIC A;  2L7F P;  4HX4 A;  2DLL A;  1A36 A;  3B6C A;  3ERM A;  3CMA I;  2VT3 A;  3DEU A;  2Y9Z A;  1UG0 A;  4HNU A;  2ZXH A;  3CC7 I;  3PIP F;  2V7F A;  3J80 K;  1T8I A;  4E7J A;  1DGW Y;  4ESJ A;  5ILS A;  5K5Q A;  2LY1 A;  3HXL A;  4CSW A;  5BNG A;  1RR7 A;  1RI7 A;  1ON1 A;  1U78 A;  3GZ5 A;  3C18 A;  3V8K A;  4MHG A;  4ZYD A;  3GWZ A;  3CJN A;  4M9X A;  4I09 A;  3JRA A;  2JMW A;  2JN6 A;  1QRY A;  4BY7 J;  3ERE D;  1E3O C;  3AG2 H;  4BXF A;  1VQ6 I;  3PFY A;  5IYC J;  3ZN1 A;  2EV0 A;  2QVO A;  1D0Z A;  3DKX A;  3R60 A;  2XVC A;  1A35 A;  4HX8 A;  2PMU A;  3UKG A;  2V26 A;  4F52 A;  3HOY J;  1QGP A;  1VZ0 A;  3BQZ A;  2DYR H;  4YFX F;  3Q5F A;  1O7F A;  1BR4 A;  3GTQ J;  4QTR A;  3G73 A;  5LGU A;  1IRG A;  1FTZ A;  2XIG A;  3HHG A;  4I01 A;  1MMS A;  5D5V B;  1D5V A;  2EFO A;  2QKL B;  4XL9 A;  4IQ4 A;  2EWN A;  4CYD A;  1I3Q J;  4BNC A;  5FKL A;  4XNF A;  3BR0 A;  2ZME B;  1OPC A;  3OR1 C;  2X6Y A;  1ZG5 A;  4DZP A;  3CC4 I;  2DQL A;  2Q2E A;  2R7U A;  5LFA A;  1K6Y A;  1ZLK A;  2DN0 A;  1YX3 A;  2ZO4 A;  2LBF B;  3HEF A;  3M8J A;  1BL0 A;  2Y48 A;  2X6W A;  5CQG A;  2OV7 A;  5IOY A;  2BY2 A;  3BG3 A;  3M7G A;  3L1P A;  2WAD A;  1T98 A;  3K70 D;  1Z6R A;  5DV5 A;  1V5E A;  4LIU A;  5ICE A;  3OL3 A;  1TWF J;  5J40 A;  1RC9 A;  1IXR C;  4LGW A; 
#chains in the Genus database with same CATH homology
 4IOA F;  2OTJ I;  1VQK I;  2ZJP F;  3CCR I;  1VQ4 I;  1Y39 A;  2ZJQ F;  3CC4 I;  2ZJR F;  4V19 K;  1YJW I;  4IO9 F;  3CCU I;  3CCE I;  3CCJ I;  1YJN I;  3CD6 I;  3CCV I;  3G6E I;  1VQP I;  1VQL I;  3CC2 I;  1FOX A;  1VQN I;  1VQM I;  3CCL I;  1VQ8 I;  1VQ7 I;  3CME I;  1YJ9 I;  3DLL F;  1VQ9 I;  4UY8 I;  2NXN B;  2K3F A;  3CCQ I;  1YI2 I;  5JVG F;  1S72 I;  3PIO F;  3I56 I;  2E36 A;  3CCM I;  2QA4 I;  2OTL I;  3CCS I;  2E35 A;  1YIJ I;  2FOW A;  3J7Y J;  5GAE J;  5GAG J;  3G71 I;  1VQO I;  3I55 I;  1VQ5 I;  1ACI A;  5DM7 F;  1QA6 A;  2H8W A;  5GAH J;  2QEX I;  1MMS A;  3CMA I;  5GAD J;  1FOY A;  3CJT B;  1YHQ I;  2E34 A;  3G4S I;  2JQ7 A;  1VQ6 I;  1YIT I;  5DM6 F;  4IOC F;  1HC8 A;  1FOW A;  3CF5 F;  3CC7 I;  3J7Z I;  3PIP F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...