1VQPI

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 14
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vqpI00
3J7ZI 5DM6F 1MMSA 1VQKI 1YJ9I 1YIJI 1Y39A 3CCRI 3PIPF 3CCUI 1VQNI 3I55I 3CC2I 2FOWA 1VQ5I 1VQ8I 1VQ9I 4IOCF 1ACIA 3CCSI 1YI2I 2OTJI 2E35A 4UY8I 3G4SI 1YHQI 2QA4I 3CD6I 5DM7F 3DLLF 2E36A 1HC8A 5GAGJ 5GAEJ 3CMAI 3CC7I 2ZJPF 1YJWI 3CJTB 1S72I 1VQOI 1YJNI 1VQLI 3G71I 5GAHJ 3CCEI 2NXNB 3I56I 1VQ4I 2K3FA 2ZJRF 3CCMI 3CF5F 3CCJI 1QA6A 3CCLI 5GADJ 1YITI 2JQ7A 4IOAF 1VQMI 3J7YJ 2ZJQF 3CMEI 5JVGF 1VQ7I 4V19K 3CCQI 1VQPI 2OTLI 3G6EI 1VQ6I 2QEXI 2H8WA 3CC4I 3CCVI 4IO9F 1FOWA 3PIOF 1FOYA 1FOXA 2E34A
chains in the Genus database with same CATH superfamily
4MQVA 2F4IA 5K7HA 2KIMA 3JTGA 3OMYA 4GDFA 4DZJA 2MD0A 2XAUA 3WHCA 2OCCH 3CCRI 1R49A 3MMYB 2EFQA 5BQTA 4XORA 1FLIA 1SAXA 3LNQA 4MEXF 1BJAA 2IA0A 3QU6A 1ZR4A 4ZDOA 3PL8A 5B3SH 5ICCA 4RB2C 2YSRA 5FLXK 1RIOH 2ESNA 4RAFA 2UXNA 4RMNA 2ECBA 3GTLJ 1BR2A 4HG2A 3ASNH 2GM4A 1ZRCA 4BKXA 4MQ9F 2PQ8A 3AL0C 2MYSA 4LLGF 3IP4B 4WXCA 4HDVA 2XVCA 1ZH5A 3B73A 1S29A 3M9AA 2M8EA 4N4OB 2GIZA 3BG6A 3VYSB 3J80K 1FBSA 4FE7A 1ONVA 3FM5A 2JUGA 1MDMA 1U6GA 2ELKA 3GZ6A 1Z67A 3BWGA 2JK3A 2RQQA 3BPVA 2FA5A 3F0CA 1D1CA 2CQQA 1GDTA 3J80Z 1Y56A 4CDGA 5BS6A 3W2VA 2Z2SB 5DUIA 1TC3C 4HSRA 3VPRA 1K83J 3BR6A 3H35A 1A36A 3CO7C 4X6AJ 4RM3A 3DPUA 1S72I 2QGUA 1D0ZA 5LFAA 4AU7A 1EH8A 4U0WA 4BEHB 2IS6A 1GXPA 2R7ZJ 4XK4A 2Z33A 2XDVA 3CCYA 1UFMA 2BHZA 1B9NA 3BTJA 1LQ1A 4FETA 2CFXA 1F36A 1O57A 3ECHA 5EEAA 2XF7A 1IN6A 4II3A 4UV8A 2WV0A 3HSRA 4AIJA 5D4SA 1XGNA 4A3KJ 4A0ZA 2O0YA 4HQMA 3DFGA 2WTEA 3AG4H 3KZZA 3TDUC 2LYCA 3NRVA 3PSFA 1VQ7I 3GTMJ 5IPAA 2L9VA 1E3PA 2DW4A 2FRHA 2L7ZA 3UKGA 3FISA 5KVRA 4F55A 4E7JA 2ZB9A 3ZCOA 3RYRA 2KISA 4IHYA 3VYTB 4OAYA 5DD8A 3EUHC 4A12A 2E71A 2BXYA 5KHDA 3CCVI 1QU3A 1T95A 2BVMA 1A6QA 1TW2A 4ZDLA 4MNUA 3H9JA 3ONQA 1CF7A 5F0FA 1XPXA 1DPRA 1JKPC 1X19A 1W36C 3C2GA 2KJBA 4XKWA 4P9FA 4HA8A 1ZG5A 2KMUA 2QYOA 4WXDA 2X85A 2A68F 4QTRA 3I5UA 4C3IJ 1FTTA 3B02A 2X4HA 4WXHA 3NQOA 2VBWA 3PM1A 2L4AA 2Z16A 2Y69H 1ETXA 5FROA 4KNYA 3BTLA 4QPOA 4ENKA 1VQ9I 1LJ9A 2R5ZB 1G3SA 4Y33A 2VXDA 5EJCA 3GLLA 4FT8A 3DBLB 1XG1A 3MZHA 1SMTA 5E3NA 4KYWA 1KZHA 1YE9A 3T8TA 4Y13A 3CUOA 3QOEA 5E20A 1H9TA 1HC8A 3CJQB 2LH9A 2L5QA 4CUGA 2FXAA 3CMAI 1IGNA 2RAEA 3WU1B 1SVLA 4X1EA 1I3AA 1PP7U 1HXDA 2XSJC 4C2MJ 2XB5A 2OA4A 3ZQIA 2OZUA 3K4JA 1BA5A 2WAQA 3G73A 3DKWA 2QKLB 4E7SA 1O3QA 3BROA 3FBNB 3A02A 4CO8A 3MCZA 5HDNA 3K70D 4CHUA 2LLKA 1B9MA 2EFWA 2NXNB 3KLNA 4UV9A 1IN5A 2VASA 4ABZA 4HNVA 1T0FC 3I59B 1WSUA 4BHPA 2ZJRF 2ZMEA 2EQRA 2LRDA 3KZYA 1V5EA 4KN4X 3A0BC 2O8XA 1SD7A 1YX3A 5DUKA 2KDOA 3ZMSA 1WVRA 2I10A 2F4MB 1ZGJA 5CVJA 2EIKH 3COAC 3DEUA 1X1AA 3S1QJ 2K9MA 1NHAA 4AVPA 4L0YB 2M0MA 2M5WA 1QRYA 3LSKA 1LUJB 5JVGF 4G8XA 2VC1A 1R22A 1V54H 1FPQA 3D1NI 4IXAA 5D4RA 1XSXA 4M71A 2N8GA 4Y52J 1F5TA 2EB7A 3TMOA 2LMDA 3CC4I 3CUQB 2Y0SA 3HKZN 4U0YA 3E5XA 3PUFA 1DU6A 3TOBA 2DYRH 4ZTJA 4G94A 3RCOA 1LDJA 3KYCB 1HSTA 4PFPA 3TQNA 5LRSA 2LK2A 3ABUA 2VQHA 2TDXA 1KA8A 5DTDA 3AKZA 3VYRB 4G7HF 2YUSA 3SDGA 4XKCA 2W24A 5HDGA 3M8JA 1A04A 1WHUA 1I3QJ 1SFEA 3FXKA 3BOQA 2RC4A 2F5CA 3RPQA 2NVXJ 5IT9K 1TNTA 3HSFA 2XPUA 3DF8A 2LKSA 1ON1A 2Q8KA 2IXSA 1I27A 2M0CA 3R60A 2FMYA 1MNMC 3LA7A 4ENJA 2OTJI 4MTEA 2MC3A 5IT9Z 1B1BA 2NAZA 4DYQA 3G4SI 1OLTA 2VQGA 4CCMA 1QGPA 4NB5A 4EJOA 5FRMA 3ROUA 1BI0A 1C0WA 2DMTA 3NAUA 1O3SA 1XD7A 2KT0A 4A3FJ 1TT5B 4GGGA 1OKRA 4PZJA 2L9SA 5IYBJ 4IRHA 4CH7A 4NBQA 3W6KB 3G2BA 1DGRM 1V5GA 1N75A 2MH2A 2DPUA 4KA4A 2R7QA 3NWTA 2VOOA 4Z2YA 3T1BA 4OMYA 2K9QA 5CJ9A 3FXQA 4DYRA 2XKPA 5GAHJ 2M7BA 1X4OA 1MDMB 1NK2P 3V7RA 5F6FA 2K7LA 2CFOA 2JUCA 4YEJA 2L01A 1QA6A 3QPTA 3HC7A 1ZAOA 4BS9A 4A0XA 4RAYA 2FQ3A 5AONA 2M8GX 1IDZA 4F52A 1ZREA 2M3AA 5D5UB 1RR8C 3OYBA 2E1MB 2JSCA 4I09A 2FNAA 4O6JA 2BHYA 4MHGA 4B3AA 5HDKA 5ILUA 3GTGJ 3MVPA 4JP0A 3LQQA 3VB2A 3HDDA 5K7FA 3GCMA 4V19K 1ON2A 1K79A 3K1PA 3S8PA 2XHKA 2DA2A 4XRSG 4RA2A 2ZCWA 5JLXA 2PMUA 3HOYJ 2O6GE 2FOKA 4S05A 1UMQA 3RSNA 2VOPA 3FK6A 1R4NB 2G7HA 4XQFA 4MGRA 3QWLA 3TBIA 3F72A 2E1MC 3H1CA 4RDUA 2E34A 2EBIA 3M1EA 2R7TA 5HNFA 1OYWA 2X48A 3HYIA 4XR6A 1VQKI 3VSLA 3DCFA 5FRNA 1XDSA 2DMPA 4PDKA 2VODA 5E17F 1KU7A 1FTZA 2A61A 2NS7A 1IW7F 1UJ8A 3GLXA 3TO7A 4EM1A 2LF7A 4OWRB 4HSTA 3CDLA 2L54A 3TL4X 4FE4A 5H2FC 3OL3A 4LK0F 1RZ4A 4FX4A 3NEUA 4F93B 1RPWA 3JREA 3S2WA 4CCOA 5FD6A 2R5YA 4BQNA 1VQ5I 3Q0VA 4Y17A 2XKOA 1RUOA 1CF7B 3L2QA 2GXBA 1Z21A 4ESBA 4Y7NJ 3GTKJ 4CYCA 1BJZA 2DMQA 1MD0A 3RI4A 3H3VK 2LP0A 2LSOA 4M9XA 2GXAA 2CUJA 4UY8I 3FKJA 1K7AA 4YRVA 3X2QH 5J4YA 4IQ4A 1RC9A 1TWGJ 2DJNA 3E6DA 2CW8A 3K7AJ 1KONA 1LFPA 3Q0UA 2EA2A 3B6CA 3ZP5A 3DU6A 1XN7A 2QLZA 5K5QA 3ZR8X 4V2FA 4D7MA 1R4MB 5L3FA 2UWMA 1KU2A 1P7JA 2V9PA 1D0XA 1SMYF 1IRGA 3EUAA 1YJWI 1Z77A 3GTPJ 3HZJA 2FBHA 1R00A 5LBQA 3EQLF 3FMRA 4JOMA 4NHJA 4EJUA 1SFKA 2VIXA 3BZ6A 1P4XA 5JLWA 1ZRDA 3P9IA 1I5ZA 1Y6IA 3MQ0A 5LD2C 3F22A 4B09A 3N05A 3GX4X 2VE8A 4UVCA 5EG0A 1S5LC 4KUMA 1U9OA 4XLPF 4P96A 1AOYA 2M87A 2ZXHA 1XMXA 2ACJA 3BJ6A 3HXLA 1MSFC 1MBGA 4HX8A 3JRGA 3J7YJ 2PLYA 2ZJQF 3CMEI 4BACA 2J5OA 4B4CA 3S1MJ 5EEGA 2JA6J 2M9HA 3RIRA 2VKDA 4M3FA 1EA3A 4ENMA 2HI3A 3K70C 3PJRA 5KK1A 1WRJA 4HF0A 2B9SA 1RUNA 3CCQI 4F91B 5CQEA 1ZGAA 4KIBA 3O2PE 5ILVA 3ABMH 3DEWA 2JWTA 4ZH4F 1VQ6I 3W2WA 1WFXA 2ZMEB 1GUUA 3HJEA 4S0HB 2V1NA 3JRDA 1BBYA 1JUSA 3GYHX 3DPLC 4IO9F 2DFFA 5HS7A 3TOAA 5H20A 3KEOA 1J0RA 4CZZA 1T2KA 1DP3A 4M3EA 4I02A 3DTEA 3BDDA 1CGPA 3RZDJ 2QSFX 3ESWB 3WG7H 1G3WA 2VT2A 4LITA 3O3KA 4JX4A 2KFDA 3PO2J 5HS8A 4A3CJ 1WI3A 2ZC2A 3HTSB 3EDPA 1BIAA 2ZMEC 2CWEA 2VJ5A 2KZVA 2M45A 3KX2A 3CZ6A 1D3YA 1L0OC 3MN2A 4XIDA 3GBGA 1I50J 1QHHD 2V6CA 2DFIA 2VJIA 3FZVA 3KE2A 3L2WA 2HVSA 1U5TA 5GPAA 5LHHA 3OR1C 5D5WB 1BOBA 3BR0A 3V42A 3ZQGA 4Z6YA 1PJRA 1MBEA 1B8IA 4OIQF 2DYSH 3HRSA 3AG1H 3WTSC 3BY6A 1A5JA 3KPHA 1RRJA 3IRRA 2E35A 1Y1VJ 3IH4A 2QA4I 3SFIA 5E8IA 5K1YA 4L9NA 3G1LA 5DM7F 2P5KA 1T0FA 3DLLF 4I7HA 1HKTA 3V8JA 3CDIA 1TWCJ 1QO0D 3C7JA 2XSDC 2CSOA 1Z91A 3I9V2 4WX9A 1XGMA 3Q9VA 1D1AA 1Y1WJ 3ELKA 1EJ9A 1Z1DA 4MO7A 3WTTC 4ZTFA 2CV0A 4L18B 1F43A 4IHWA 3K2AA 2L4MA 3D5LA 4AC0A 4F7ZA 1WWXA 3PQKA 4IF4A 3JAMK 1PUEE 2L7FP 2QKMB 4TV7A 2DOFA 4AUXA 2E1CA 1WJCA 4AIDA 4CCLA 1VNDA 3CF2A 2JSPA 4M72A 2D1VA 5M3FJ 2DA7A 2DA5A 4ZC3A 2K85A 1MBFA 5HVQC 5DS9A 3OL4A 1HDDC 3HSEA 1JGSA 1V3FA 2PMHA 2R7RA 2GA1A 4ZDPA 4A3IJ 3K0LA 1XCVA 1FSEA 1RNLA 3WG9A 3H9GA 4B47A 1GV2A 1Q1HA 1W7PA 2WAFA 4XICA 3BR5A 3P5JA 5DV5A 2DA6A 3PSIA 3MFKA 4N9IA 3Q3SA 1TW3A 4EGYA 2Z3YA 1QQIA 3HEFA 1GVJA 2H8WA 2G7UA 3MKZA 2HOSA 5CVRA 3KYLA 1S9HA 2YU9J 1LVAA 3RPUA 2OBPA 1FOXA 4LIVA 4CXFA 2DODA 3F8FA 5EGOA 1FNNA 1R9TJ 3F6OA 1XMKA 4RAZA 2O03A 4L9VA 3LAJA 2JRTA 2MW8A 2ZBKA 4LIUA 1Z6RA 5FKOA 1Y39A 1JJ8C 2NNNA 4MEYF 3HHHA 3CCUI 4AYBA 4MFEA 1MMDA 4C2UA 2V6EA 3KFWX 2VQLA 2PBIA 5IP6A 1P6RA 5LLQA 5LEKA 3SJMA 1FIPA 1T38A 1JKQC 2ZSHB 3LSPA 2VKHA 4DJAA 1J5YA 3K4MA 1HCRA 2FOWA 3IH2A 1MJAA 5D6FA 4MLOA 3MKYB 1IXSB 3CQZJ 1S3JA 3N4MA 3JRAA 2VL8A 4XL9A 4L0ZB 2ZFUA 2O7OA 2X9DA 2OUMA 4PSWA 1ZYRF 3AL0B 1KU9A 2CJJA 3L2RA 4M3BA 1IV6A 3FXMA 4M6XA 2R7OA 4BAYA 3IHUA 3L7WA 1Y8QB 4MTDA 3IKVA 4M3DA 5DEQA 3GEZA 2IAIA 4ITVA 2E36A 1ZTRA 3FK7A 5GAEJ 4EV0A 4A3GJ 4CCJA 5K7ZA 2R5YB 1UB9A 1IN4A 4CZCA 3I4PA 1S7OA 2JJ7A 3RJPA 4G6QA 4UUSA 4RGSA 2IT0A 4EQQA 4Y3OA 5J1UA 2PJPA 4DW6A 2EJRA 1ERDA 5CPRB 3DLAA 4B44A 4CYCB 4I01A 4KIFA 2R7VA 4HNUA 2ZXIA 3DTIA 5C3EJ 1OISA 5JVTA 3TW7A 2A6HF 2MBFA 1BI1A 1WI9A 3SFZA 2JMWA 2F48A 2HKOA 2VN2A 2PEXA 2Q0OA 5FKLA 5GP9A 2EWNA 2KIUA 1TZLA 2K4JA 2HFHA 4A3JJ 1UHWA 2LOOA 4KMFA 2AO9A 1S6LA 2JTVA 5CLSA 2X6WA 2ZNYA 1OFCX 2LBFB 2Y48A 2W1OA 3F8BA 3PFYA 4N0BA 3RKXA 2GOXB 4H4KC 3JRBA 1P4AA 2W57A 3MWMA 2DBBA 4NC7A 4HYEA 1LE8A 3G1OA 1GV5A 2FMLA 5EG0B 3E6BA 3OS0A 2KJCA 2CU7A 4XBFA 1XGSA 2P5VA 1QPIA 3GTQJ 4LLLA 5JR3A 4U88A 1OCCH 1LB2A 4PJ0C 3PIOF 3IRQA 5B1AH 2IS4A 1UELB 1Z0XA 4CA0A 2R7XA 1USTA 2A5WA 2F6CA 2QQBA 2LREA 2PN6A 2YPRA 3VSKA 4XKVA 3MD2A 4NUBA 2V1DA 4S04A 1N77A 2LF8A 3ZQQA 1JTYA 1T33A 5L3BA 3OYCA 3AG3H 4GFBA 4EGZA 2L02A 1VQNI 2M34A 3LOCA 5LRRA 2STTA 3CC2I 4CYDA 2NOGA 3SEZA 4ZYEA 3L9FA 2RREA 5L3EA 2ICWG 1D1BA 1T56A 2Y31A 3HOTA 5IP7J 2JT1A 1ETQA 4XLNF 3JCUC 4E7LA 1PP8F 2ZNZA 3T0YA 2HDCA 4A3DJ 2LC2A 2KHMA 4RGXA 4RGRA 1GHCA 1KQ9A 3T8RA 4HF2A 4BYYA 2CUFA 2XGEA 5CVIA 4UVAA 1YHQI 4ESJA 1T6SA 3DP7A 1YO5C 3HOWJ 3OSFA 3CD6I 1FYMA 5E3OA 4BJ5C 3ZMZA 2L9RA 3CJRB 3FMSA 3SZGA 3CDHA 1J9IA 4ZYDA 2GLOA 4M9SA 4L5EA 3OIPA 1U5TB 4BXUA 2IA2A 3V7CA 3I71A 4FHTA 3N97A 2ZFWA 2RQPA 1Z7LA 4PCQA 2HNHA 4XN0A 1B8IB 2HPIA 2EIMH 5BNGA 5FB2A 1TNSA 4BE2A 1IG7A 4HBLA 5TRDA 3BCAA 3I64A 1YLFA 3QU3A 3V7SA 1A31A 2D45A 2LY2A 4N9HA 4YFXF 1Y0NA 1QBJA 3RZOJ 1X3WB 2XGDA 5F08A 3U1KA 3S1RJ 2VE9A 4D9JA 4R1HA 2DA3A 1U5TC 3CESA 1JI8A 2JVHA 4BBSJ 4UB8C 2BZTA 3FXOA 2ZO4A 4HQEA 2KRCA 2WY7Q 1YQAA 2E7WA 2LTPA 3C2HA 2MABA 3E0JB 4YG2F 2H6BA 5FKKA 2R92J 1MGTA 2IRFG 1IAWA 4IRIA 1XTAA 3CMMA 1MNDA 4E7KA 2DTRA 2P81A 4ZYAA 2VC0A 4JX6A 1TBXA 3LA3A 2R7WA 3GO5A 4BJ6C 2STWA 1EH6A 2PG4A 1G4DA 2NS8A 2K9LA 1MJ9A 2WY8Q 4BXFA 4Q4ZF 4E70A 2A05A 1UG0A 2QQAA 5J1RA 1J2XA 5JHFA 1U3EM 5EYRA 2CH0A 4PJNA 2OCEA 5E3LA 3I4MJ 1Z7UA 2AXTC 4ZZDA 4IHSA 2BXZA 1EH7A 3E5UA 4M9ZA 2QQ9A 1G3TA 1W7PB 4GCVA 2BE5F 1RR7A 4A3LJ 1FC3A 2L9NA 1EV7A 2VKVA 4PUSA 3BR3A 3D5SC 2X1CA 2I8DA 4IQJA 1X3ZB 4RGUA 5J6XA 2X1DA 4B43A 3AAFA 3BG5A 1W5CC 3LSTA 2L7KA 5KAFC 2F2EA 1E2XA 5D8LB 2W48A 1X4PA 3JTHA 5EGOB 1QVTA 3I58A 3F8MA 4DQ2A 3KP6A 5HOOA 5EF6A 4XKBA 1WQ2A 4NQWA 4QIWN 3DXJF 3SXYA 2DO7A 1Z3XA 2K5CA 3WTZA 3QQAA 4ASNA 4B1RA 2EH3A 2V1XA 4IHTA 3IH3A 3ZRGA 5AIPA 1ZN2A 5HNHA 2VT3A 2IGKA 1SVMA 2ISYA 4XLHA 1B6AA 2JN6A 3T5XA 2Q2EA 2F5EA 1D5VA 3KCCA 3QOPA 2AQFA 2NRAC 2K3FA 4OMZA 3A01A 2MD5A 4DOZA 3CCMI 4UVBA 5A2QK 3S15J 3GZNB 1SFUA 1XSVA 3OV8A 1J09A 2FE3A 1MMGA 2BBYA 3S3NA 2KQRA 5BPDA 3CO6C 1ZRFA 2DPDA 2M4GA 4EJTA 3VODA 1SFXA 4UUSB 4KICA 1U8RA 3V8KA 3S93A 3QRFF 2JA7J 5A2QZ 4C2TA 1FEXA 2EINH 1K6OA 2M4KA 2EV6A 2OV7A 3JRCA 2CQ7A 2LY9A 1U0JA 1CQTA 2A69F 1EF4A 3K4BA 4JQFA 4GYGA 1UZCA 4FASD 2CGPA 1QZZA 2ME0A 2UV1A 4BY7J 4CCNA 2DK8A 4A3EJ 3DKYA 3MZYA 2P8TA 1HW1A 2BY3A 2K9NA 3P9CA 1LKXA 2QBYA 1QZEA 1W5SA 5C44J 1SFOJ 4RS8A 1N78A 1MJBA 1IO2A 1JXSA 1X2MA 2IGMA 3IV5A 3IAS2 5FJ8J 4A0YA 1U9NA 3FIWA 1FX7A 5LHGA 3KP2A 3TGNA 1MMSA 1JKOC 1E3HA 1MBJA 3OYIA 5FLVA 3G3ZA 5FGMA 1B59A 3HUGA 2BY1A 3NARA 1IDYA 3S14J 4E7IA 4HRIA 4RB0A 1LE8B 5GTIC 4D0PA 2ELJA 3K10A 5KAIC 1U8BA 2PMZN 4LOCA 2DJIA 1VQ8I 2HTSA 3LA2A 2M30A 4B8XA 4YIIA 3S1NJ 4G6DA 5DCMA 3DBHB 2E19A 5J3LA 3J7AY 1APLC 3OSGA 3HIFA 3I0TA 1P92A 2DCEA 1FBUA 3E1SA 4LG3A 4N4NB 1OYIA 4HDUA 1J59A 4KDPA 3BZKA 2DT5A 4A6EA 2BOLA 3OWTA 2B0LA 5JFRA 3K69A 1VZ0A 4M6YA 4LGWA 4YIFA 3H5AA 3LAPA 1G6NA 3FHNA 2XRLA 2CO5A 2VBXA 3ML6A 3FM3A 4OAZA 2FNPA 1JT0A 2GAUA 3LQRA 1OMIA 2OF7A 2NVUB 3ZMDA 3A0HC 4W97A 3I3LA 1DUXC 1JT6A 1AA7A 3HPGA 2CRGA 4J01A 1X1PA 4ENNA 2P7VB 1VQOI 3H0DA 1K4TA 2X1EA 3HGYA 2CV2A 2O8KA 4OOIA 1XDUA 5FO5A 3GVAA 1W0UA 1I1SA 3CCEI 4FQGA 3E6MA 1V5FA 2RN7A 3PUBA 1ZHFA 3MEXA 3HOUJ 1IUFA 2ID3A 4EATA 4I76A 3I4NJ 3OIOA 3NWSA 2DN0A 3SYTA 1B72A 2QVOA 2CUZA 3LSRA 1GXQA 3GFMA 2HYJA 4C9YA 3BC8A 4A3BJ 3HL2A 2XGXA 4HOBA 4ESFA 2H1LA 4AIHA 1ZKGA 1F4KA 3GTOJ 2ISZA 3KEQA 3FX3A 1A6IA 2G0EA 4XSXF 1NTCA 5FKMA 1KQ0A 3HKZA 1WH7A 4A69C 4BDYA 1LFBA 3OYEA 3BPXA 3EYIA 5J8CA 4RLQA 5C4JJ 4LMYA 1D5YA 3MZ8A 4PJJA 5J40A 4CGZA 1MNEA 2ETHA 5IY5H 1ITYA 2KIQA 1BI2A 2Q1ZB 1R5ID 1BM9A 3IAM2 5EZHA 2W4SA 2OPTA 2XUBA 1U2WA 3WHBA 2H6CA 1JKRC 1H9GA 2VBYA 3F6VA 5IOYA 1BR4A 1BL0A 2OQGA 1YJ9I 5B5EC 3E5QA 1VF9A 1ZLJA 2HKXA 2JA8J 4NDLA 1R6RA 3P9KA 2HS5A 3HOZJ 3EETA 3K4LA 3OYHA 1WKMA 2EZIA 3FXUA 5ERIA 4KJZA 4DZPA 4KT5C 2CQNA 4JX5A 3DPTA 2RNJA 2A07F 1HOMA 1HW5A 5EEHA 3OYGA 4P55A 3KEYA 1ACIA 2FEZA 3KETA 3WGHA 2R4GA 3U1DA 5E79C 4YFKF 4AD9A 1Y8RB 2LD5A 2K40A 3ZMVA 3QYBA 2OJED 4AIKA 3KZIC 2WAEA 3RTRA 5D5XB 4AWXB 2VPLA 5F0HA 3OYLA 3OR2C 4WWCA 2UXXA 3PNVA 2YX4A 1F1ZA 4X0GA 2DMUA 2DI3A 3A2KA 3H36A 2QWWA 1O4XA 2ZJPF 3VFZA 1F9NA 1AHDP 3ZQHA 3WGGA 3R61A 3VEPA 3CJTB 4XLEA 1HQCA 3QODA 2P5LC 1YJNI 1Y0UA 1ZG1A 1VQLI 2HYGD 2P7CB 4JBAA 3LL7A 1HBXG 2XGCA 4NQWB 2DFEA 1O3RA 4AM3A 3ZQCA 1Q1VA 1USSA 2FQ4A 3JSOA 1XX5A 1S7AA 2HR3A 3GZ5A 3VOEA 1YW9A 1O3TA 2COBA 3OYKA 4BUPA 2JQ7A 2XC7A 3O8HA 1VQMI 4EJWA 1SD5A 4Q47A 2CW7A 1FMVA 1YW8A 1TP4A 2GWRA 3S3OA 1ZG3A 1R71A 4UNOA 1XMAA 2P6SA 3ZXSA 2W25A 2BW3A 2Q2EB 3BTIA 3CP2A 2CYYA 2VXZA 2WB1A 4QWQA 3WTWC 5BOXA 1VQPI 4NNJA 5ICFA 3PQJA 3HBLA 5IT3A 3HHGA 3A01B 2ME6A 2HEOA 2OC6A 3OIQA 3TO9A 4BU2A 4I98B 2LNBA 1H88C 1LVKA 5L3CA 2K4BA 1I6HJ 3DU5A 4DGWB 5TJJA 1JTXA 1R5HA 2DXIA 5CKTA 1BW6A 2G9WA 3K4NA 3PNYA 1G2HA 2HU9A 4D5CA 3EPZA 3FBIB 1ETOA 1KYWA 1BC7C 2E2HJ 5F27A 5E1ZB 4D5FA 1BN5A 3RKYA 4XRMA 1JJ6C 4MFDA 5IYCJ 3LSIA 3PIPF 2QM3A 5GPCA 1H89C 3W3CA 4A2UA 4D1QA 3UR3C 2BVLA 1BI3A 3WE3A 1MMNA 1RI7A 3I55I 3OYFA 5M5WJ 3OYMA 1FSHA 2KPMA 1IZ1A 1DGWY 1WCMJ 2E2JJ 2QBYB 3CLOA 3WTXC 1HKSA 5AIQA 2R7DA 1TL8A 1FOKA 2ZXWH 4IVNA 3CCSI 4E6KG 4A3MJ 3WE2A 2L3DA 1XCBA 3GFIA 1WGXA 2JA5J 3C3WA 4L5JA 3HUGB 2YS9A 1SANA 1DU0A 3G1MA 1S7EA 5IP9J 4G9YA 3LSJA 1MSEC 4ETSA 3WTYC 2B7EA 3IWFA 3WGIA 2QSGX 2CQKA 1TQMA 2YU3A 2ECCA 2XASA 3A03A 2W84A 4HF1A 3EUKL 3TEDA 2ESHA 5DCMB 3HOSA 1IJWC 1ZARA 2Y9ZA 3R0AA 4OIOF 2LG4A 2NVTJ 5F04A 4B48A 1YG2A 3BJAA 3K2ZA 4AVZA 2E1NA 4LB5A 4EM2A 9ANTA 2DLLA 2CV1A 3FKIJ 2HTJA 3M7GA 1ULYA 5E8GA 2FX0A 4J00A 2IP2A 1ZLKA 2WAQN 3BT9A 3KLOA 1X3UA 2TCTA 2V79A 3IC7A 1P2FA 3ECOA 4BJTA 1YOVB 2IVMA 2XB0X 4NC6A 4PJLA 4DYCA 2FF4A 2EV5A 2XIGA 4OINF 1IF1A 1UHSA 2I5UA 1DPUA 1K6YA 3DTKA 3OYJA 4I0BA 1U78A 4JYKA 5EDNA 1WJ5A 1X1BA 2AS5F 2K9SA 2VJJA 1UAAA 1OCTC 1ETKA 1IRXA 2MH9A 2P4WA 1LDDA 2PI0A 2JVGA 3HOVJ 4PJMA 2NVYJ 2E5ZA 4J19A 1BIBA 3A4CA 4IJAA 1OCRH 1NG7A 2VUMJ 4HX4A 3TO6A 1TT0A 2WADA 3E97A 2K02A 1B72B 3BG3A 4C3JJ 3ZQFA 4EMSA 4XRSA 3DQVC 2KRFA 3OYNA 1OQYA 4XLCA 3OS1A 2EFOA 1HA8A 3L1PA 2DDAA 2EV0A 2DDBA 5FLXZ 2Y0SN 3VWBA 5C4XJ 1H0MA 2VB6A 1TWHJ 3FDYA 2JRMA 3RYPA 5HLTA 2ID6A 3GUDA 1ETWA 3GXOA 1QNTA 3BP8A 2DT6A 5F1RA 1X2NA 1T98A 1OCPA 2XAGA 1L3LA 2K3PA 2Z5UA 3GMEA 2R3SA 4OIRF 4LG0A 2HDWA 2QSHX 3S2DJ 1Z3YA 4W1UA 3ASOH 4R79A 2PFBA 1RKWA 3R4KA 3K1MA 5K5OA 3SZPA 2E7XA 1P4WA 2X51A 5B66C 3R6SA 3ABTA 1YI2I 1G3YA 2H27A 2Y0MA 3LFUA 3GW2A 2J5PA 4L9TA 2YR2A 3K9TA 4XNFA 1XB4A 3TDZC 5J4VA 4QLCU 1WJEA 2MSYA 2BY0A 5GTHC 4BY1J 5F0CA 4BXXJ 2VONA 2R7SA 2A6EF 3ABKH 1MH4A 3SQNA 2OD5A 3ISPA 2X6OA 1NK3P 1WPKA 4FISA 1SEUA 1K78A 3GF2A 1SC7A 3H3UA 1WJFA 3OY9A 2HWVA 4XOTA 1J7KA 4E7ZA 1MMAA 1E0EA 3LSHA 2NNYA 2NYXA 2XF5A 3C2BA 2F5DA 4PGGA 1FZPB 3I53A 1ZK8A 3TP3A 4F3QA 2HZDA 3CCJI 4EJVA 2DFHA 3M3YJ 2KLOA 4HX7A 5IYDJ 3LFKA 3IL2A 2D1HA 2HOAA 4KFCA 4HEA2 1KU3A 2KL4A 2LVSA 3F3XA 4KIGA 3U9GA 3FXRA 5FFZA 2ZSIB 3RQ4A 3H5NA 3W6JB 2QQ8A 3Q0WA 1YTYA 4Q48A 4WK8F 1NH3A 3KP7A 2DOAA 4L5IA 4KMUX 2A3SA 1J75A 3REOA 5LGTA 1SD6A 1TWFJ 3DKXA 1OJLA 2R0QC 1FYKA 4GRIA 4IX7A 2NVQJ 3JR9A 3O8GA 1GT0C 2OU2A 3FXLA 3OS2A 1TTYA 3E6CC 4Q5SF 1ODDA 3HTUA 4JK1X 3F8CA 2XPVA 1JGGA 1FOYA 5FFXA 4PSXA 2WA0A 4G12A 3J7ZI 2AQEA 4MIMA 2KDZA 2XF6A 5DM6F 5D5VB 3CMYA 5D8KB 1YIJI 1D8KA 3OYAA 1PUFA 2CS3A 1OR7C 2DTZA 3WU2C 2BW3B 3HRTA 4LB6B 1WJDA 3GWZA 4V2GA 4D7NA 1GVDA 3ZOBA 3JRHA 3DBRB 3W6VA 3ZMUA 1STZA 3HM5A 5CYVA 4BE1A 3CJNA 4G6TB 4PFOA 1N25A 2M1BA 1YRNA 1HF0A 4BNCA 2FBKA 4CCKA 3H3ZA 3BTCA 3SDBA 4PGHA 2HQNA 5FLMJ 2V9KA 2YX7A 3QPHA 5ICEA 4RM2A 3ZGKA 5HLIA 1S8NA 3MKWB 3TP0A 2ADUA 1IN7A 4HV6A 2VPRA 4EVIA 2P6TA 1YS6A 4DBRA 3D0SA 1QPMA 3DV8A 3LMMA 3GFLA 5H6RA 5LGNA 4R8HA 3S17J 1E3OC 2DMNA 2Y30A 4O5VA 2GIVA 1T39A 2FJ1A 2O5RA 4KN7X 3BR1A 1ENHA 1YYVA 4HZFA 1ETYA 1YFHA 3MAJA 2K86A 1XS9A 3J81K 4QPQA 1ETVA 3V8LA 1IUYA 2UZKA 3BQYA 2V26A 2ZJ2A 4LJZF 1RKTA 3WTUC 2R7UA 3KP3A 4GXOA 2HQAA 5E3MA 1ORKA 3Q9SA 5DCFA 2F5FA 3J81Z 3Q5FA 3HRUA 3K6GA 4UB6C 4CSWA 2IGNA 3JSPA 5KNLA 1VTNC 2A6TA 5GADJ 3ZPLA 1YITI 2VLAA 2QCOA 2BEOA 3ZN0A 1R1VA 2CG4A 2QUFA 4IRGA 1PYVA 2L0KA 2O61A 2DOEA 2KP6A 4RLFA 1X1CA 3FMQA 1R1UA 4II2A 1MIJA 5E1XA 2AXLA 4UXNA 4EM0B 3H92A 2IS1A 4E7HA 1IXCA 2KZGA 2D5VA 3G6EI 1JUMA 4U7BA 4P1WA 3CUQC 3WU0A 2L2OA 1FP2A 2H09A 4A6DA 3QP5A 2MFZA 4RB3C 5J47A 2WWYA 4BHBA 3F21A 4GO1A 3QAHA 2E5NA 2RKHA 3VYUB 3BG7A 1UCRA 2ZKZA 4ZZLA 1NG6A 4K2EA 3KYDB 4IPAA 2A5YB 1TWAJ 3OYDA 3IKTA 4L9JA 1LEBA 4HW0A 5M5YJ 4G7ZF 2Y2ZA 3FWEA 2D2WA 3KP4A 2HOEA 1Z05A 4LD5A 2LKPA 1FWZA 3BJOA 2JA2A 4XLFA 3L2UA 3C18A 4LFUA 2WV1A 3PFIA 5HS9A 3ZN1A 5M3MJ 2PJRA 4H0EA 3JRFA 1JUPA 2QENA 1XSDA 5D6EA 3RQIA 4U7DA 2RV8A 2BGCA 2GZWA 5LHIA 4HLXA 4EEFG 2IGOA 4I2OA 5L3GA 4U87A 1SVOA 4M74A 4YIRX 2WC2A 4KITB 1AKHA 4A5MA 2OQRA 3GFJA 5IOZA 3P7NA 2MC4A 1X58A 2H8RA 5E18F 3DEEA 3OOPA 3TKYA 4PK4A 2Z9OA 3BLYA 4C30A 1FJLA 3S32A 5CQGA 2VI6A 3IUOA 3ULQB 3QP6A 1IRFA 1RESA 1R23A 5F64A 4HLYA 1FP1D 4UUVA 1WJBA 4F92B 3L00A 2M2EA 3RKWA 4DBQA 4LG0B 2E60A 2LY1A 3CC7I 2H94A 2LDUA 4ZJZA 4M73A 1R36A 4FX0A 3K1NA 2NS0A 2MLGA 2V9VA 2IA1A 1W0TA 4P5OA 3S3MA 2X0LA 5CVVA 3JRIA 4XN3A 4UUTA 4DIQA 2XV4S 2HYFA 1TQIA 2Y9YA 4M3GA 1VQ4I 3CP8A 2LFBA 3AG2H 4HAMA 1AWCA 2XRNA 1ZELA 1RETA 1XGOA 1FMWA 4XLAA 5EZGA 4A5NA 2WB1N 4BQAA 5DD4A 4IOAF 1W4MA 2EILH 2K27A 2XAQA 1K78B 1JHHA 2IS2A 2GBYA 3RKQA 2ELHA 4WCGA 3CTAA 2CW0F 4BH9A 1WJAA 1O7FA 2FD5A 3GTJJ 2KRHA 1HSJA 1HDPA 2HXOA 2QEXI 4QSHA 2EPFA 2EZLA 4YFNF 5DDGA 2EZHA 4OU0A 3HPHA 4M6VA 1LEAA 2DK5A 1FOWA 4P9UA 1HLVA 3HB9A 1IRZA 1R1TA 1JHFA 4BQQA 2F5VA 3H9QA 2GQQA 1X1DA 1H8AC 2KKOA 2O9LA 3BCBA 1D0YA 3U2RA 2EA4A 3PNTA 2HQRA 2Y75A 1LDKB 1V4RA 3PO3J 2XPWA 5L3DA 1Z9CA 3FF5A 1OYYA 3ERED 1OCZH 2FUG2 1P9QC 3M8EA 2LR8A 4BDZA 2O3FA 1WZ2A 1QVUA 2MGQA 3OOUA 4HV5A 1T08B 2TRTA 2H1KA 2Z99A 4NC8A 4AYBN 1GLNA 4IEJA 5LEJA 1SAUA 2X6YA 2Z1DA 2COMA 4WF2A 5JHUA 4BQOA 4I0AA 5K5RA 2LBFA 4IOCF 1KQ8A 3E3VA 1PUFB 4BEHA 4OIPF 1R58A 5M5XJ 4FCYA 2BYVE 1R5GA 4HNTA 3K4CA 2VJ4A 2VQCA 2DQRA 5H6QA 1MKMA 5GAGJ 3EUHA 1T8IA 2V4JC 4GYIA 4IL6C 4Y4RA 1D8JA 2M7AA 2HDDA 1YRNB 2EK5A 4XONA 3L09A 2HXIA 3HGGA 2IEKA 2IBDA 5DYMA 1QHGA 3BQZA 2IW5A 1DQUA 5TISC 4ON0A 4IZZA 3F23A 3LSGA 1DP7P 2MLKA 1TQPA 4C3HJ 1W5TA 5CVUA 1MBKA 5KCMA 3G71I 2E1OA 3IWZA 3I56I 3M1CA 2UUZA 4XMYA 2BV6A 2IPQX 2QZ8A 5B1BH 3B6AA 3CF5F 3QPSA 1ZQ3P 3LWFA 1OPCA 3L2CA 2XAFA 5E1WA 3F8NA 1E17A 3QPLA 1YS7A 1FY7A 1O7LA 5J1YA 1P7IA 1BOAA 4U0VA 2QF7A 3D5RC 4KISA 1POGA 3EYYA 3W2AA 4A93J 1IV8A 3WODF 3JW4A 1W36D 2GA2A 3F9KA 2WBMA 2DA1A 4XOPA 2XAHA 3KP5A 1EKEA 5F1JA 1B4AA 2W7NA 1IC8A 5BMZA 1OR7A 2EIJH 5FKNA 3TW6A 3AFHA 4IHXA 5LGUA 4LK1F 3S16J 3FHZA 2PX9A 4ZYHA 3WTVC 1VFCA 4G7OF 4LLNA 2L7MP 5HODA 4RAGA 3M4OJ 3C1DA 3QYFA 5JI6A 1IXRC 4I99C 1FYLA 2RGVA 2R5ZA 2XROA 2DU9A 2P0WA 3KIOA 1YX5A 2OAZA 2PMZA 4O3MA 3QYEA 3A1YA 3CLQA 4BBRJ 2HZTA 2BY2A 3U21A 1PVEA 2C6YA 2GOMA 1ZGWA 2CUEA 2JPBA 4XSZF 1FBQA 2RVCA 2AHQA 2V7FA 2JZYA 1K4SA 1A35A 6PAXA 2W85A 1YW7A 2NOJB 1G59A 1MBHA 3BZCA 3R0JA 2E2IJ 4IHVA 3HG9A 2W82A 4BE0A 1VI0A 4BL0B 2GXGA 2LKXA 1LFUP 2IJLA 2DT7B 4XM3A 2VKEA 2DQLA 4HPQA 1AU7A 2V1UA 1BW5A 4DNCA 4ANJA 1I39A 2MG4A 2X6XA 3O6BB 1K61A 1I6XA 3E7LA 4ZYGA 2PJRB 2CMPA 2RDPA 2XAJA 4B3XA 2R7FA 1JE8A 3DWLE 2EFPA 2HGCA 3I59A 3I54A 4IKFA 2FBIA 1HKQA 2HQ5A 1YIOA 1LPQA 4KT6A 2R93J 1UG2A 3BG9A 1M1EB 3JAMZ 3HRMA 1MZBA 3ZQ7A 1UHMA 3K4KA 5ILSA 4BGDA 2B63J 4XRFA 1R7JA 5ED4A 1MH3A 1Z6TA 1AKHB 2HVQA 3M8FA 3RDIA 2EFNA 1QZYA 4UHTA 4Y15A 4I6ZA 3HOXJ 5BPIA 1I1GA 1KYZA 3FXJA 4CICA 2VBZA 1KGSA 5FD5A 2DAOA 3ZMTA 3L2VA 3S2HJ 2EZKA 1XC5A 3LSMA 1LNWA 1MW7A 2RNGA 4RB1A 1G8XA 1FT9A 3ERMA 3BR2A 3UNGC 2HVRA 3SZTA 1TLHB 3CCLI 3CUQA 5ICGA 3SHFA 4YELA 2KIFA 1WH5A 1ZR2A 4RBOA 3H0GJ 3V4GA 3M07A 2HPMA 3MKLA 1HW2A 1W1WE 1W7PD 2DA4A 2F4OB 2ZXJA 1DDNA 1IN8A 2OZ6A 2MA3A 2W00A 1FIAA 5HLGA 1REPC 3H5RA 1BC8C 2FSWA 4BHCA 2OTLI 3ABLH 2JPCA 5J8FA 3ZQLA 4FTHA 3VDXA 1BR1A 2FU4A 5HLHA 1SD4A 4E4HA 5TGTA 3SEQA 3RPUD 1OCOH 1V55H 3J7AO 2HOTA 2CQXA 1PDNC
chains in the Genus database with same CATH topology
3J7ZI 5DM6F 1MMSA 1VQKI 1YJ9I 1YIJI 1Y39A 3CCRI 3PIPF 3CCUI 1VQNI 3I55I 3CC2I 2FOWA 1VQ5I 1VQ8I 1VQ9I 4IOCF 1ACIA 3CCSI 1YI2I 2OTJI 2E35A 4UY8I 3G4SI 1YHQI 2QA4I 3CD6I 5DM7F 3DLLF 2E36A 1HC8A 5GAGJ 5GAEJ 3CMAI 3CC7I 2ZJPF 1YJWI 3CJTB 1S72I 1VQOI 1YJNI 1VQLI 3G71I 5GAHJ 3CCEI 2NXNB 3I56I 1VQ4I 2K3FA 2ZJRF 3CCMI 3CF5F 3CCJI 1QA6A 3CCLI 5GADJ 1YITI 2JQ7A 4IOAF 1VQMI 3J7YJ 2ZJQF 3CMEI 5JVGF 1VQ7I 4V19K 3CCQI 1VQPI 2OTLI 3G6EI 1VQ6I 2QEXI 2H8WA 3CC4I 3CCVI 4IO9F 1FOWA 3PIOF 1FOYA 1FOXA 2E34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Z I;  5DM6 F;  1MMS A;  1VQK I;  1YJ9 I;  1YIJ I;  1Y39 A;  3CCR I;  3PIP F;  3CCU I;  1VQN I;  3I55 I;  3CC2 I;  2FOW A;  1VQ5 I;  1VQ8 I;  1VQ9 I;  4IOC F;  1ACI A;  3CCS I;  1YI2 I;  2OTJ I;  2E35 A;  4UY8 I;  3G4S I;  1YHQ I;  2QA4 I;  3CD6 I;  5DM7 F;  3DLL F;  2E36 A;  1HC8 A;  5GAG J;  5GAE J;  3CMA I;  3CC7 I;  2ZJP F;  1YJW I;  3CJT B;  1S72 I;  1VQO I;  1YJN I;  1VQL I;  3G71 I;  5GAH J;  3CCE I;  2NXN B;  3I56 I;  1VQ4 I;  2K3F A;  2ZJR F;  3CCM I;  3CF5 F;  3CCJ I;  1QA6 A;  3CCL I;  5GAD J;  1YIT I;  2JQ7 A;  4IOA F;  1VQM I;  3J7Y J;  2ZJQ F;  3CME I;  5JVG F;  1VQ7 I;  4V19 K;  3CCQ I;  1VQP I;  2OTL I;  3G6E I;  1VQ6 I;  2QEX I;  2H8W A;  3CC4 I;  3CCV I;  4IO9 F;  1FOW A;  3PIO F;  1FOY A;  1FOX A;  2E34 A; 
#chains in the Genus database with same CATH topology
 4MQV A;  2F4I A;  5K7H A;  2KIM A;  3JTG A;  3OMY A;  4GDF A;  4DZJ A;  2MD0 A;  2XAU A;  3WHC A;  2OCC H;  3CCR I;  1R49 A;  3MMY B;  2EFQ A;  5BQT A;  4XOR A;  1FLI A;  1SAX A;  3LNQ A;  4MEX F;  1BJA A;  2IA0 A;  3QU6 A;  1ZR4 A;  4ZDO A;  3PL8 A;  5B3S H;  5ICC A;  4RB2 C;  2YSR A;  5FLX K;  1RIO H;  2ESN A;  4RAF A;  2UXN A;  4RMN A;  2ECB A;  3GTL J;  1BR2 A;  4HG2 A;  3ASN H;  2GM4 A;  1ZRC A;  4BKX A;  4MQ9 F;  2PQ8 A;  3AL0 C;  2MYS A;  4LLG F;  3IP4 B;  4WXC A;  4HDV A;  2XVC A;  1ZH5 A;  3B73 A;  1S29 A;  3M9A A;  2M8E A;  4N4O B;  2GIZ A;  3BG6 A;  3VYS B;  3J80 K;  1FBS A;  4FE7 A;  1ONV A;  3FM5 A;  2JUG A;  1MDM A;  1U6G A;  2ELK A;  3GZ6 A;  1Z67 A;  3BWG A;  2JK3 A;  2RQQ A;  3BPV A;  2FA5 A;  3F0C A;  1D1C A;  2CQQ A;  1GDT A;  3J80 Z;  1Y56 A;  4CDG A;  5BS6 A;  3W2V A;  2Z2S B;  5DUI A;  1TC3 C;  4HSR A;  3VPR A;  1K83 J;  3BR6 A;  3H35 A;  1A36 A;  3CO7 C;  4X6A J;  4RM3 A;  3DPU A;  1S72 I;  2QGU A;  1D0Z A;  5LFA A;  4AU7 A;  1EH8 A;  4U0W A;  4BEH B;  2IS6 A;  1GXP A;  2R7Z J;  4XK4 A;  2Z33 A;  2XDV A;  3CCY A;  1UFM A;  2BHZ A;  1B9N A;  3BTJ A;  1LQ1 A;  4FET A;  2CFX A;  1F36 A;  1O57 A;  3ECH A;  5EEA A;  2XF7 A;  1IN6 A;  4II3 A;  4UV8 A;  2WV0 A;  3HSR A;  4AIJ A;  5D4S A;  1XGN A;  4A3K J;  4A0Z A;  2O0Y A;  4HQM A;  3DFG A;  2WTE A;  3AG4 H;  3KZZ A;  3TDU C;  2LYC A;  3NRV A;  3PSF A;  1VQ7 I;  3GTM J;  5IPA A;  2L9V A;  1E3P A;  2DW4 A;  2FRH A;  2L7Z A;  3UKG A;  3FIS A;  5KVR A;  4F55 A;  4E7J A;  2ZB9 A;  3ZCO A;  3RYR A;  2KIS A;  4IHY A;  3VYT B;  4OAY A;  5DD8 A;  3EUH C;  4A12 A;  2E71 A;  2BXY A;  5KHD A;  3CCV I;  1QU3 A;  1T95 A;  2BVM A;  1A6Q A;  1TW2 A;  4ZDL A;  4MNU A;  3H9J A;  3ONQ A;  1CF7 A;  5F0F A;  1XPX A;  1DPR A;  1JKP C;  1X19 A;  1W36 C;  3C2G A;  2KJB A;  4XKW A;  4P9F A;  4HA8 A;  1ZG5 A;  2KMU A;  2QYO A;  4WXD A;  2X85 A;  2A68 F;  4QTR A;  3I5U A;  4C3I J;  1FTT A;  3B02 A;  2X4H A;  4WXH A;  3NQO A;  2VBW A;  3PM1 A;  2L4A A;  2Z16 A;  2Y69 H;  1ETX A;  5FRO A;  4KNY A;  3BTL A;  4QPO A;  4ENK A;  1VQ9 I;  1LJ9 A;  2R5Z B;  1G3S A;  4Y33 A;  2VXD A;  5EJC A;  3GLL A;  4FT8 A;  3DBL B;  1XG1 A;  3MZH A;  1SMT A;  5E3N A;  4KYW A;  1KZH A;  1YE9 A;  3T8T A;  4Y13 A;  3CUO A;  3QOE A;  5E20 A;  1H9T A;  1HC8 A;  3CJQ B;  2LH9 A;  2L5Q A;  4CUG A;  2FXA A;  3CMA I;  1IGN A;  2RAE A;  3WU1 B;  1SVL A;  4X1E A;  1I3A A;  1PP7 U;  1HXD A;  2XSJ C;  4C2M J;  2XB5 A;  2OA4 A;  3ZQI A;  2OZU A;  3K4J A;  1BA5 A;  2WAQ A;  3G73 A;  3DKW A;  2QKL B;  4E7S A;  1O3Q A;  3BRO A;  3FBN B;  3A02 A;  4CO8 A;  3MCZ A;  5HDN A;  3K70 D;  4CHU A;  2LLK A;  1B9M A;  2EFW A;  2NXN B;  3KLN A;  4UV9 A;  1IN5 A;  2VAS A;  4ABZ A;  4HNV A;  1T0F C;  3I59 B;  1WSU A;  4BHP A;  2ZJR F;  2ZME A;  2EQR A;  2LRD A;  3KZY A;  1V5E A;  4KN4 X;  3A0B C;  2O8X A;  1SD7 A;  1YX3 A;  5DUK A;  2KDO A;  3ZMS A;  1WVR A;  2I10 A;  2F4M B;  1ZGJ A;  5CVJ A;  2EIK H;  3COA C;  3DEU A;  1X1A A;  3S1Q J;  2K9M A;  1NHA A;  4AVP A;  4L0Y B;  2M0M A;  2M5W A;  1QRY A;  3LSK A;  1LUJ B;  5JVG F;  4G8X A;  2VC1 A;  1R22 A;  1V54 H;  1FPQ A;  3D1N I;  4IXA A;  5D4R A;  1XSX A;  4M71 A;  2N8G A;  4Y52 J;  1F5T A;  2EB7 A;  3TMO A;  2LMD A;  3CC4 I;  3CUQ B;  2Y0S A;  3HKZ N;  4U0Y A;  3E5X A;  3PUF A;  1DU6 A;  3TOB A;  2DYR H;  4ZTJ A;  4G94 A;  3RCO A;  1LDJ A;  3KYC B;  1HST A;  4PFP A;  3TQN A;  5LRS A;  2LK2 A;  3ABU A;  2VQH A;  2TDX A;  1KA8 A;  5DTD A;  3AKZ A;  3VYR B;  4G7H F;  2YUS A;  3SDG A;  4XKC A;  2W24 A;  5HDG A;  3M8J A;  1A04 A;  1WHU A;  1I3Q J;  1SFE A;  3FXK A;  3BOQ A;  2RC4 A;  2F5C A;  3RPQ A;  2NVX J;  5IT9 K;  1TNT A;  3HSF A;  2XPU A;  3DF8 A;  2LKS A;  1ON1 A;  2Q8K A;  2IXS A;  1I27 A;  2M0C A;  3R60 A;  2FMY A;  1MNM C;  3LA7 A;  4ENJ A;  2OTJ I;  4MTE A;  2MC3 A;  5IT9 Z;  1B1B A;  2NAZ A;  4DYQ A;  3G4S I;  1OLT A;  2VQG A;  4CCM A;  1QGP A;  4NB5 A;  4EJO A;  5FRM A;  3ROU A;  1BI0 A;  1C0W A;  2DMT A;  3NAU A;  1O3S A;  1XD7 A;  2KT0 A;  4A3F J;  1TT5 B;  4GGG A;  1OKR A;  4PZJ A;  2L9S A;  5IYB J;  4IRH A;  4CH7 A;  4NBQ A;  3W6K B;  3G2B A;  1DGR M;  1V5G A;  1N75 A;  2MH2 A;  2DPU A;  4KA4 A;  2R7Q A;  3NWT A;  2VOO A;  4Z2Y A;  3T1B A;  4OMY A;  2K9Q A;  5CJ9 A;  3FXQ A;  4DYR A;  2XKP A;  5GAH J;  2M7B A;  1X4O A;  1MDM B;  1NK2 P;  3V7R A;  5F6F A;  2K7L A;  2CFO A;  2JUC A;  4YEJ A;  2L01 A;  1QA6 A;  3QPT A;  3HC7 A;  1ZAO A;  4BS9 A;  4A0X A;  4RAY A;  2FQ3 A;  5AON A;  2M8G X;  1IDZ A;  4F52 A;  1ZRE A;  2M3A A;  5D5U B;  1RR8 C;  3OYB A;  2E1M B;  2JSC A;  4I09 A;  2FNA A;  4O6J A;  2BHY A;  4MHG A;  4B3A A;  5HDK A;  5ILU A;  3GTG J;  3MVP A;  4JP0 A;  3LQQ A;  3VB2 A;  3HDD A;  5K7F A;  3GCM A;  4V19 K;  1ON2 A;  1K79 A;  3K1P A;  3S8P A;  2XHK A;  2DA2 A;  4XRS G;  4RA2 A;  2ZCW A;  5JLX A;  2PMU A;  3HOY J;  2O6G E;  2FOK A;  4S05 A;  1UMQ A;  3RSN A;  2VOP A;  3FK6 A;  1R4N B;  2G7H A;  4XQF A;  4MGR A;  3QWL A;  3TBI A;  3F72 A;  2E1M C;  3H1C A;  4RDU A;  2E34 A;  2EBI A;  3M1E A;  2R7T A;  5HNF A;  1OYW A;  2X48 A;  3HYI A;  4XR6 A;  1VQK I;  3VSL A;  3DCF A;  5FRN A;  1XDS A;  2DMP A;  4PDK A;  2VOD A;  5E17 F;  1KU7 A;  1FTZ A;  2A61 A;  2NS7 A;  1IW7 F;  1UJ8 A;  3GLX A;  3TO7 A;  4EM1 A;  2LF7 A;  4OWR B;  4HST A;  3CDL A;  2L54 A;  3TL4 X;  4FE4 A;  5H2F C;  3OL3 A;  4LK0 F;  1RZ4 A;  4FX4 A;  3NEU A;  4F93 B;  1RPW A;  3JRE A;  3S2W A;  4CCO A;  5FD6 A;  2R5Y A;  4BQN A;  1VQ5 I;  3Q0V A;  4Y17 A;  2XKO A;  1RUO A;  1CF7 B;  3L2Q A;  2GXB A;  1Z21 A;  4ESB A;  4Y7N J;  3GTK J;  4CYC A;  1BJZ A;  2DMQ A;  1MD0 A;  3RI4 A;  3H3V K;  2LP0 A;  2LSO A;  4M9X A;  2GXA A;  2CUJ A;  4UY8 I;  3FKJ A;  1K7A A;  4YRV A;  3X2Q H;  5J4Y A;  4IQ4 A;  1RC9 A;  1TWG J;  2DJN A;  3E6D A;  2CW8 A;  3K7A J;  1KON A;  1LFP A;  3Q0U A;  2EA2 A;  3B6C A;  3ZP5 A;  3DU6 A;  1XN7 A;  2QLZ A;  5K5Q A;  3ZR8 X;  4V2F A;  4D7M A;  1R4M B;  5L3F A;  2UWM A;  1KU2 A;  1P7J A;  2V9P A;  1D0X A;  1SMY F;  1IRG A;  3EUA A;  1YJW I;  1Z77 A;  3GTP J;  3HZJ A;  2FBH A;  1R00 A;  5LBQ A;  3EQL F;  3FMR A;  4JOM A;  4NHJ A;  4EJU A;  1SFK A;  2VIX A;  3BZ6 A;  1P4X A;  5JLW A;  1ZRD A;  3P9I A;  1I5Z A;  1Y6I A;  3MQ0 A;  5LD2 C;  3F22 A;  4B09 A;  3N05 A;  3GX4 X;  2VE8 A;  4UVC A;  5EG0 A;  1S5L C;  4KUM A;  1U9O A;  4XLP F;  4P96 A;  1AOY A;  2M87 A;  2ZXH A;  1XMX A;  2ACJ A;  3BJ6 A;  3HXL A;  1MSF C;  1MBG A;  4HX8 A;  3JRG A;  3J7Y J;  2PLY A;  2ZJQ F;  3CME I;  4BAC A;  2J5O A;  4B4C A;  3S1M J;  5EEG A;  2JA6 J;  2M9H A;  3RIR A;  2VKD A;  4M3F A;  1EA3 A;  4ENM A;  2HI3 A;  3K70 C;  3PJR A;  5KK1 A;  1WRJ A;  4HF0 A;  2B9S A;  1RUN A;  3CCQ I;  4F91 B;  5CQE A;  1ZGA A;  4KIB A;  3O2P E;  5ILV A;  3ABM H;  3DEW A;  2JWT A;  4ZH4 F;  1VQ6 I;  3W2W A;  1WFX A;  2ZME B;  1GUU A;  3HJE A;  4S0H B;  2V1N A;  3JRD A;  1BBY A;  1JUS A;  3GYH X;  3DPL C;  4IO9 F;  2DFF A;  5HS7 A;  3TOA A;  5H20 A;  3KEO A;  1J0R A;  4CZZ A;  1T2K A;  1DP3 A;  4M3E A;  4I02 A;  3DTE A;  3BDD A;  1CGP A;  3RZD J;  2QSF X;  3ESW B;  3WG7 H;  1G3W A;  2VT2 A;  4LIT A;  3O3K A;  4JX4 A;  2KFD A;  3PO2 J;  5HS8 A;  4A3C J;  1WI3 A;  2ZC2 A;  3HTS B;  3EDP A;  1BIA A;  2ZME C;  2CWE A;  2VJ5 A;  2KZV A;  2M45 A;  3KX2 A;  3CZ6 A;  1D3Y A;  1L0O C;  3MN2 A;  4XID A;  3GBG A;  1I50 J;  1QHH D;  2V6C A;  2DFI A;  2VJI A;  3FZV A;  3KE2 A;  3L2W A;  2HVS A;  1U5T A;  5GPA A;  5LHH A;  3OR1 C;  5D5W B;  1BOB A;  3BR0 A;  3V42 A;  3ZQG A;  4Z6Y A;  1PJR A;  1MBE A;  1B8I A;  4OIQ F;  2DYS H;  3HRS A;  3AG1 H;  3WTS C;  3BY6 A;  1A5J A;  3KPH A;  1RRJ A;  3IRR A;  2E35 A;  1Y1V J;  3IH4 A;  2QA4 I;  3SFI A;  5E8I A;  5K1Y A;  4L9N A;  3G1L A;  5DM7 F;  2P5K A;  1T0F A;  3DLL F;  4I7H A;  1HKT A;  3V8J A;  3CDI A;  1TWC J;  1QO0 D;  3C7J A;  2XSD C;  2CSO A;  1Z91 A;  3I9V 2;  4WX9 A;  1XGM A;  3Q9V A;  1D1A A;  1Y1W J;  3ELK A;  1EJ9 A;  1Z1D A;  4MO7 A;  3WTT C;  4ZTF A;  2CV0 A;  4L18 B;  1F43 A;  4IHW A;  3K2A A;  2L4M A;  3D5L A;  4AC0 A;  4F7Z A;  1WWX A;  3PQK A;  4IF4 A;  3JAM K;  1PUE E;  2L7F P;  2QKM B;  4TV7 A;  2DOF A;  4AUX A;  2E1C A;  1WJC A;  4AID A;  4CCL A;  1VND A;  3CF2 A;  2JSP A;  4M72 A;  2D1V A;  5M3F J;  2DA7 A;  2DA5 A;  4ZC3 A;  2K85 A;  1MBF A;  5HVQ C;  5DS9 A;  3OL4 A;  1HDD C;  3HSE A;  1JGS A;  1V3F A;  2PMH A;  2R7R A;  2GA1 A;  4ZDP A;  4A3I J;  3K0L A;  1XCV A;  1FSE A;  1RNL A;  3WG9 A;  3H9G A;  4B47 A;  1GV2 A;  1Q1H A;  1W7P A;  2WAF A;  4XIC A;  3BR5 A;  3P5J A;  5DV5 A;  2DA6 A;  3PSI A;  3MFK A;  4N9I A;  3Q3S A;  1TW3 A;  4EGY A;  2Z3Y A;  1QQI A;  3HEF A;  1GVJ A;  2H8W A;  2G7U A;  3MKZ A;  2HOS A;  5CVR A;  3KYL A;  1S9H A;  2YU9 J;  1LVA A;  3RPU A;  2OBP A;  1FOX A;  4LIV A;  4CXF A;  2DOD A;  3F8F A;  5EGO A;  1FNN A;  1R9T J;  3F6O A;  1XMK A;  4RAZ A;  2O03 A;  4L9V A;  3LAJ A;  2JRT A;  2MW8 A;  2ZBK A;  4LIU A;  1Z6R A;  5FKO A;  1Y39 A;  1JJ8 C;  2NNN A;  4MEY F;  3HHH A;  3CCU I;  4AYB A;  4MFE A;  1MMD A;  4C2U A;  2V6E A;  3KFW X;  2VQL A;  2PBI A;  5IP6 A;  1P6R A;  5LLQ A;  5LEK A;  3SJM A;  1FIP A;  1T38 A;  1JKQ C;  2ZSH B;  3LSP A;  2VKH A;  4DJA A;  1J5Y A;  3K4M A;  1HCR A;  2FOW A;  3IH2 A;  1MJA A;  5D6F A;  4MLO A;  3MKY B;  1IXS B;  3CQZ J;  1S3J A;  3N4M A;  3JRA A;  2VL8 A;  4XL9 A;  4L0Z B;  2ZFU A;  2O7O A;  2X9D A;  2OUM A;  4PSW A;  1ZYR F;  3AL0 B;  1KU9 A;  2CJJ A;  3L2R A;  4M3B A;  1IV6 A;  3FXM A;  4M6X A;  2R7O A;  4BAY A;  3IHU A;  3L7W A;  1Y8Q B;  4MTD A;  3IKV A;  4M3D A;  5DEQ A;  3GEZ A;  2IAI A;  4ITV A;  2E36 A;  1ZTR A;  3FK7 A;  5GAE J;  4EV0 A;  4A3G J;  4CCJ A;  5K7Z A;  2R5Y B;  1UB9 A;  1IN4 A;  4CZC A;  3I4P A;  1S7O A;  2JJ7 A;  3RJP A;  4G6Q A;  4UUS A;  4RGS A;  2IT0 A;  4EQQ A;  4Y3O A;  5J1U A;  2PJP A;  4DW6 A;  2EJR A;  1ERD A;  5CPR B;  3DLA A;  4B44 A;  4CYC B;  4I01 A;  4KIF A;  2R7V A;  4HNU A;  2ZXI A;  3DTI A;  5C3E J;  1OIS A;  5JVT A;  3TW7 A;  2A6H F;  2MBF A;  1BI1 A;  1WI9 A;  3SFZ A;  2JMW A;  2F48 A;  2HKO A;  2VN2 A;  2PEX A;  2Q0O A;  5FKL A;  5GP9 A;  2EWN A;  2KIU A;  1TZL A;  2K4J A;  2HFH A;  4A3J J;  1UHW A;  2LOO A;  4KMF A;  2AO9 A;  1S6L A;  2JTV A;  5CLS A;  2X6W A;  2ZNY A;  1OFC X;  2LBF B;  2Y48 A;  2W1O A;  3F8B A;  3PFY A;  4N0B A;  3RKX A;  2GOX B;  4H4K C;  3JRB A;  1P4A A;  2W57 A;  3MWM A;  2DBB A;  4NC7 A;  4HYE A;  1LE8 A;  3G1O A;  1GV5 A;  2FML A;  5EG0 B;  3E6B A;  3OS0 A;  2KJC A;  2CU7 A;  4XBF A;  1XGS A;  2P5V A;  1QPI A;  3GTQ J;  4LLL A;  5JR3 A;  4U88 A;  1OCC H;  1LB2 A;  4PJ0 C;  3PIO F;  3IRQ A;  5B1A H;  2IS4 A;  1UEL B;  1Z0X A;  4CA0 A;  2R7X A;  1UST A;  2A5W A;  2F6C A;  2QQB A;  2LRE A;  2PN6 A;  2YPR A;  3VSK A;  4XKV A;  3MD2 A;  4NUB A;  2V1D A;  4S04 A;  1N77 A;  2LF8 A;  3ZQQ A;  1JTY A;  1T33 A;  5L3B A;  3OYC A;  3AG3 H;  4GFB A;  4EGZ A;  2L02 A;  1VQN I;  2M34 A;  3LOC A;  5LRR A;  2STT A;  3CC2 I;  4CYD A;  2NOG A;  3SEZ A;  4ZYE A;  3L9F A;  2RRE A;  5L3E A;  2ICW G;  1D1B A;  1T56 A;  2Y31 A;  3HOT A;  5IP7 J;  2JT1 A;  1ETQ A;  4XLN F;  3JCU C;  4E7L A;  1PP8 F;  2ZNZ A;  3T0Y A;  2HDC A;  4A3D J;  2LC2 A;  2KHM A;  4RGX A;  4RGR A;  1GHC A;  1KQ9 A;  3T8R A;  4HF2 A;  4BYY A;  2CUF A;  2XGE A;  5CVI A;  4UVA A;  1YHQ I;  4ESJ A;  1T6S A;  3DP7 A;  1YO5 C;  3HOW J;  3OSF A;  3CD6 I;  1FYM A;  5E3O A;  4BJ5 C;  3ZMZ A;  2L9R A;  3CJR B;  3FMS A;  3SZG A;  3CDH A;  1J9I A;  4ZYD A;  2GLO A;  4M9S A;  4L5E A;  3OIP A;  1U5T B;  4BXU A;  2IA2 A;  3V7C A;  3I71 A;  4FHT A;  3N97 A;  2ZFW A;  2RQP A;  1Z7L A;  4PCQ A;  2HNH A;  4XN0 A;  1B8I B;  2HPI A;  2EIM H;  5BNG A;  5FB2 A;  1TNS A;  4BE2 A;  1IG7 A;  4HBL A;  5TRD A;  3BCA A;  3I64 A;  1YLF A;  3QU3 A;  3V7S A;  1A31 A;  2D45 A;  2LY2 A;  4N9H A;  4YFX F;  1Y0N A;  1QBJ A;  3RZO J;  1X3W B;  2XGD A;  5F08 A;  3U1K A;  3S1R J;  2VE9 A;  4D9J A;  4R1H A;  2DA3 A;  1U5T C;  3CES A;  1JI8 A;  2JVH A;  4BBS J;  4UB8 C;  2BZT A;  3FXO A;  2ZO4 A;  4HQE A;  2KRC A;  2WY7 Q;  1YQA A;  2E7W A;  2LTP A;  3C2H A;  2MAB A;  3E0J B;  4YG2 F;  2H6B A;  5FKK A;  2R92 J;  1MGT A;  2IRF G;  1IAW A;  4IRI A;  1XTA A;  3CMM A;  1MND A;  4E7K A;  2DTR A;  2P81 A;  4ZYA A;  2VC0 A;  4JX6 A;  1TBX A;  3LA3 A;  2R7W A;  3GO5 A;  4BJ6 C;  2STW A;  1EH6 A;  2PG4 A;  1G4D A;  2NS8 A;  2K9L A;  1MJ9 A;  2WY8 Q;  4BXF A;  4Q4Z F;  4E70 A;  2A05 A;  1UG0 A;  2QQA A;  5J1R A;  1J2X A;  5JHF A;  1U3E M;  5EYR A;  2CH0 A;  4PJN A;  2OCE A;  5E3L A;  3I4M J;  1Z7U A;  2AXT C;  4ZZD A;  4IHS A;  2BXZ A;  1EH7 A;  3E5U A;  4M9Z A;  2QQ9 A;  1G3T A;  1W7P B;  4GCV A;  2BE5 F;  1RR7 A;  4A3L J;  1FC3 A;  2L9N A;  1EV7 A;  2VKV A;  4PUS A;  3BR3 A;  3D5S C;  2X1C A;  2I8D A;  4IQJ A;  1X3Z B;  4RGU A;  5J6X A;  2X1D A;  4B43 A;  3AAF A;  3BG5 A;  1W5C C;  3LST A;  2L7K A;  5KAF C;  2F2E A;  1E2X A;  5D8L B;  2W48 A;  1X4P A;  3JTH A;  5EGO B;  1QVT A;  3I58 A;  3F8M A;  4DQ2 A;  3KP6 A;  5HOO A;  5EF6 A;  4XKB A;  1WQ2 A;  4NQW A;  4QIW N;  3DXJ F;  3SXY A;  2DO7 A;  1Z3X A;  2K5C A;  3WTZ A;  3QQA A;  4ASN A;  4B1R A;  2EH3 A;  2V1X A;  4IHT A;  3IH3 A;  3ZRG A;  5AIP A;  1ZN2 A;  5HNH A;  2VT3 A;  2IGK A;  1SVM A;  2ISY A;  4XLH A;  1B6A A;  2JN6 A;  3T5X A;  2Q2E A;  2F5E A;  1D5V A;  3KCC A;  3QOP A;  2AQF A;  2NRA C;  2K3F A;  4OMZ A;  3A01 A;  2MD5 A;  4DOZ A;  3CCM I;  4UVB A;  5A2Q K;  3S15 J;  3GZN B;  1SFU A;  1XSV A;  3OV8 A;  1J09 A;  2FE3 A;  1MMG A;  2BBY A;  3S3N A;  2KQR A;  5BPD A;  3CO6 C;  1ZRF A;  2DPD A;  2M4G A;  4EJT A;  3VOD A;  1SFX A;  4UUS B;  4KIC A;  1U8R A;  3V8K A;  3S93 A;  3QRF F;  2JA7 J;  5A2Q Z;  4C2T A;  1FEX A;  2EIN H;  1K6O A;  2M4K A;  2EV6 A;  2OV7 A;  3JRC A;  2CQ7 A;  2LY9 A;  1U0J A;  1CQT A;  2A69 F;  1EF4 A;  3K4B A;  4JQF A;  4GYG A;  1UZC A;  4FAS D;  2CGP A;  1QZZ A;  2ME0 A;  2UV1 A;  4BY7 J;  4CCN A;  2DK8 A;  4A3E J;  3DKY A;  3MZY A;  2P8T A;  1HW1 A;  2BY3 A;  2K9N A;  3P9C A;  1LKX A;  2QBY A;  1QZE A;  1W5S A;  5C44 J;  1SFO J;  4RS8 A;  1N78 A;  1MJB A;  1IO2 A;  1JXS A;  1X2M A;  2IGM A;  3IV5 A;  3IAS 2;  5FJ8 J;  4A0Y A;  1U9N A;  3FIW A;  1FX7 A;  5LHG A;  3KP2 A;  3TGN A;  1MMS A;  1JKO C;  1E3H A;  1MBJ A;  3OYI A;  5FLV A;  3G3Z A;  5FGM A;  1B59 A;  3HUG A;  2BY1 A;  3NAR A;  1IDY A;  3S14 J;  4E7I A;  4HRI A;  4RB0 A;  1LE8 B;  5GTI C;  4D0P A;  2ELJ A;  3K10 A;  5KAI C;  1U8B A;  2PMZ N;  4LOC A;  2DJI A;  1VQ8 I;  2HTS A;  3LA2 A;  2M30 A;  4B8X A;  4YII A;  3S1N J;  4G6D A;  5DCM A;  3DBH B;  2E19 A;  5J3L A;  3J7A Y;  1APL C;  3OSG A;  3HIF A;  3I0T A;  1P92 A;  2DCE A;  1FBU A;  3E1S A;  4LG3 A;  4N4N B;  1OYI A;  4HDU A;  1J59 A;  4KDP A;  3BZK A;  2DT5 A;  4A6E A;  2BOL A;  3OWT A;  2B0L A;  5JFR A;  3K69 A;  1VZ0 A;  4M6Y A;  4LGW A;  4YIF A;  3H5A A;  3LAP A;  1G6N A;  3FHN A;  2XRL A;  2CO5 A;  2VBX A;  3ML6 A;  3FM3 A;  4OAZ A;  2FNP A;  1JT0 A;  2GAU A;  3LQR A;  1OMI A;  2OF7 A;  2NVU B;  3ZMD A;  3A0H C;  4W97 A;  3I3L A;  1DUX C;  1JT6 A;  1AA7 A;  3HPG A;  2CRG A;  4J01 A;  1X1P A;  4ENN A;  2P7V B;  1VQO I;  3H0D A;  1K4T A;  2X1E A;  3HGY A;  2CV2 A;  2O8K A;  4OOI A;  1XDU A;  5FO5 A;  3GVA A;  1W0U A;  1I1S A;  3CCE I;  4FQG A;  3E6M A;  1V5F A;  2RN7 A;  3PUB A;  1ZHF A;  3MEX A;  3HOU J;  1IUF A;  2ID3 A;  4EAT A;  4I76 A;  3I4N J;  3OIO A;  3NWS A;  2DN0 A;  3SYT A;  1B72 A;  2QVO A;  2CUZ A;  3LSR A;  1GXQ A;  3GFM A;  2HYJ A;  4C9Y A;  3BC8 A;  4A3B J;  3HL2 A;  2XGX A;  4HOB A;  4ESF A;  2H1L A;  4AIH A;  1ZKG A;  1F4K A;  3GTO J;  2ISZ A;  3KEQ A;  3FX3 A;  1A6I A;  2G0E A;  4XSX F;  1NTC A;  5FKM A;  1KQ0 A;  3HKZ A;  1WH7 A;  4A69 C;  4BDY A;  1LFB A;  3OYE A;  3BPX A;  3EYI A;  5J8C A;  4RLQ A;  5C4J J;  4LMY A;  1D5Y A;  3MZ8 A;  4PJJ A;  5J40 A;  4CGZ A;  1MNE A;  2ETH A;  5IY5 H;  1ITY A;  2KIQ A;  1BI2 A;  2Q1Z B;  1R5I D;  1BM9 A;  3IAM 2;  5EZH A;  2W4S A;  2OPT A;  2XUB A;  1U2W A;  3WHB A;  2H6C A;  1JKR C;  1H9G A;  2VBY A;  3F6V A;  5IOY A;  1BR4 A;  1BL0 A;  2OQG A;  1YJ9 I;  5B5E C;  3E5Q A;  1VF9 A;  1ZLJ A;  2HKX A;  2JA8 J;  4NDL A;  1R6R A;  3P9K A;  2HS5 A;  3HOZ J;  3EET A;  3K4L A;  3OYH A;  1WKM A;  2EZI A;  3FXU A;  5ERI A;  4KJZ A;  4DZP A;  4KT5 C;  2CQN A;  4JX5 A;  3DPT A;  2RNJ A;  2A07 F;  1HOM A;  1HW5 A;  5EEH A;  3OYG A;  4P55 A;  3KEY A;  1ACI A;  2FEZ A;  3KET A;  3WGH A;  2R4G A;  3U1D A;  5E79 C;  4YFK F;  4AD9 A;  1Y8R B;  2LD5 A;  2K40 A;  3ZMV A;  3QYB A;  2OJE D;  4AIK A;  3KZI C;  2WAE A;  3RTR A;  5D5X B;  4AWX B;  2VPL A;  5F0H A;  3OYL A;  3OR2 C;  4WWC A;  2UXX A;  3PNV A;  2YX4 A;  1F1Z A;  4X0G A;  2DMU A;  2DI3 A;  3A2K A;  3H36 A;  2QWW A;  1O4X A;  2ZJP F;  3VFZ A;  1F9N A;  1AHD P;  3ZQH A;  3WGG A;  3R61 A;  3VEP A;  3CJT B;  4XLE A;  1HQC A;  3QOD A;  2P5L C;  1YJN I;  1Y0U A;  1ZG1 A;  1VQL I;  2HYG D;  2P7C B;  4JBA A;  3LL7 A;  1HBX G;  2XGC A;  4NQW B;  2DFE A;  1O3R A;  4AM3 A;  3ZQC A;  1Q1V A;  1USS A;  2FQ4 A;  3JSO A;  1XX5 A;  1S7A A;  2HR3 A;  3GZ5 A;  3VOE A;  1YW9 A;  1O3T A;  2COB A;  3OYK A;  4BUP A;  2JQ7 A;  2XC7 A;  3O8H A;  1VQM I;  4EJW A;  1SD5 A;  4Q47 A;  2CW7 A;  1FMV A;  1YW8 A;  1TP4 A;  2GWR A;  3S3O A;  1ZG3 A;  1R71 A;  4UNO A;  1XMA A;  2P6S A;  3ZXS A;  2W25 A;  2BW3 A;  2Q2E B;  3BTI A;  3CP2 A;  2CYY A;  2VXZ A;  2WB1 A;  4QWQ A;  3WTW C;  5BOX A;  1VQP I;  4NNJ A;  5ICF A;  3PQJ A;  3HBL A;  5IT3 A;  3HHG A;  3A01 B;  2ME6 A;  2HEO A;  2OC6 A;  3OIQ A;  3TO9 A;  4BU2 A;  4I98 B;  2LNB A;  1H88 C;  1LVK A;  5L3C A;  2K4B A;  1I6H J;  3DU5 A;  4DGW B;  5TJJ A;  1JTX A;  1R5H A;  2DXI A;  5CKT A;  1BW6 A;  2G9W A;  3K4N A;  3PNY A;  1G2H A;  2HU9 A;  4D5C A;  3EPZ A;  3FBI B;  1ETO A;  1KYW A;  1BC7 C;  2E2H J;  5F27 A;  5E1Z B;  4D5F A;  1BN5 A;  3RKY A;  4XRM A;  1JJ6 C;  4MFD A;  5IYC J;  3LSI A;  3PIP F;  2QM3 A;  5GPC A;  1H89 C;  3W3C A;  4A2U A;  4D1Q A;  3UR3 C;  2BVL A;  1BI3 A;  3WE3 A;  1MMN A;  1RI7 A;  3I55 I;  3OYF A;  5M5W J;  3OYM A;  1FSH A;  2KPM A;  1IZ1 A;  1DGW Y;  1WCM J;  2E2J J;  2QBY B;  3CLO A;  3WTX C;  1HKS A;  5AIQ A;  2R7D A;  1TL8 A;  1FOK A;  2ZXW H;  4IVN A;  3CCS I;  4E6K G;  4A3M J;  3WE2 A;  2L3D A;  1XCB A;  3GFI A;  1WGX A;  2JA5 J;  3C3W A;  4L5J A;  3HUG B;  2YS9 A;  1SAN A;  1DU0 A;  3G1M A;  1S7E A;  5IP9 J;  4G9Y A;  3LSJ A;  1MSE C;  4ETS A;  3WTY C;  2B7E A;  3IWF A;  3WGI A;  2QSG X;  2CQK A;  1TQM A;  2YU3 A;  2ECC A;  2XAS A;  3A03 A;  2W84 A;  4HF1 A;  3EUK L;  3TED A;  2ESH A;  5DCM B;  3HOS A;  1IJW C;  1ZAR A;  2Y9Z A;  3R0A A;  4OIO F;  2LG4 A;  2NVT J;  5F04 A;  4B48 A;  1YG2 A;  3BJA A;  3K2Z A;  4AVZ A;  2E1N A;  4LB5 A;  4EM2 A;  9ANT A;  2DLL A;  2CV1 A;  3FKI J;  2HTJ A;  3M7G A;  1ULY A;  5E8G A;  2FX0 A;  4J00 A;  2IP2 A;  1ZLK A;  2WAQ N;  3BT9 A;  3KLO A;  1X3U A;  2TCT A;  2V79 A;  3IC7 A;  1P2F A;  3ECO A;  4BJT A;  1YOV B;  2IVM A;  2XB0 X;  4NC6 A;  4PJL A;  4DYC A;  2FF4 A;  2EV5 A;  2XIG A;  4OIN F;  1IF1 A;  1UHS A;  2I5U A;  1DPU A;  1K6Y A;  3DTK A;  3OYJ A;  4I0B A;  1U78 A;  4JYK A;  5EDN A;  1WJ5 A;  1X1B A;  2AS5 F;  2K9S A;  2VJJ A;  1UAA A;  1OCT C;  1ETK A;  1IRX A;  2MH9 A;  2P4W A;  1LDD A;  2PI0 A;  2JVG A;  3HOV J;  4PJM A;  2NVY J;  2E5Z A;  4J19 A;  1BIB A;  3A4C A;  4IJA A;  1OCR H;  1NG7 A;  2VUM J;  4HX4 A;  3TO6 A;  1TT0 A;  2WAD A;  3E97 A;  2K02 A;  1B72 B;  3BG3 A;  4C3J J;  3ZQF A;  4EMS A;  4XRS A;  3DQV C;  2KRF A;  3OYN A;  1OQY A;  4XLC A;  3OS1 A;  2EFO A;  1HA8 A;  3L1P A;  2DDA A;  2EV0 A;  2DDB A;  5FLX Z;  2Y0S N;  3VWB A;  5C4X J;  1H0M A;  2VB6 A;  1TWH J;  3FDY A;  2JRM A;  3RYP A;  5HLT A;  2ID6 A;  3GUD A;  1ETW A;  3GXO A;  1QNT A;  3BP8 A;  2DT6 A;  5F1R A;  1X2N A;  1T98 A;  1OCP A;  2XAG A;  1L3L A;  2K3P A;  2Z5U A;  3GME A;  2R3S A;  4OIR F;  4LG0 A;  2HDW A;  2QSH X;  3S2D J;  1Z3Y A;  4W1U A;  3ASO H;  4R79 A;  2PFB A;  1RKW A;  3R4K A;  3K1M A;  5K5O A;  3SZP A;  2E7X A;  1P4W A;  2X51 A;  5B66 C;  3R6S A;  3ABT A;  1YI2 I;  1G3Y A;  2H27 A;  2Y0M A;  3LFU A;  3GW2 A;  2J5P A;  4L9T A;  2YR2 A;  3K9T A;  4XNF A;  1XB4 A;  3TDZ C;  5J4V A;  4QLC U;  1WJE A;  2MSY A;  2BY0 A;  5GTH C;  4BY1 J;  5F0C A;  4BXX J;  2VON A;  2R7S A;  2A6E F;  3ABK H;  1MH4 A;  3SQN A;  2OD5 A;  3ISP A;  2X6O A;  1NK3 P;  1WPK A;  4FIS A;  1SEU A;  1K78 A;  3GF2 A;  1SC7 A;  3H3U A;  1WJF A;  3OY9 A;  2HWV A;  4XOT A;  1J7K A;  4E7Z A;  1MMA A;  1E0E A;  3LSH A;  2NNY A;  2NYX A;  2XF5 A;  3C2B A;  2F5D A;  4PGG A;  1FZP B;  3I53 A;  1ZK8 A;  3TP3 A;  4F3Q A;  2HZD A;  3CCJ I;  4EJV A;  2DFH A;  3M3Y J;  2KLO A;  4HX7 A;  5IYD J;  3LFK A;  3IL2 A;  2D1H A;  2HOA A;  4KFC A;  4HEA 2;  1KU3 A;  2KL4 A;  2LVS A;  3F3X A;  4KIG A;  3U9G A;  3FXR A;  5FFZ A;  2ZSI B;  3RQ4 A;  3H5N A;  3W6J B;  2QQ8 A;  3Q0W A;  1YTY A;  4Q48 A;  4WK8 F;  1NH3 A;  3KP7 A;  2DOA A;  4L5I A;  4KMU X;  2A3S A;  1J75 A;  3REO A;  5LGT A;  1SD6 A;  1TWF J;  3DKX A;  1OJL A;  2R0Q C;  1FYK A;  4GRI A;  4IX7 A;  2NVQ J;  3JR9 A;  3O8G A;  1GT0 C;  2OU2 A;  3FXL A;  3OS2 A;  1TTY A;  3E6C C;  4Q5S F;  1ODD A;  3HTU A;  4JK1 X;  3F8C A;  2XPV A;  1JGG A;  1FOY A;  5FFX A;  4PSX A;  2WA0 A;  4G12 A;  3J7Z I;  2AQE A;  4MIM A;  2KDZ A;  2XF6 A;  5DM6 F;  5D5V B;  3CMY A;  5D8K B;  1YIJ I;  1D8K A;  3OYA A;  1PUF A;  2CS3 A;  1OR7 C;  2DTZ A;  3WU2 C;  2BW3 B;  3HRT A;  4LB6 B;  1WJD A;  3GWZ A;  4V2G A;  4D7N A;  1GVD A;  3ZOB A;  3JRH A;  3DBR B;  3W6V A;  3ZMU A;  1STZ A;  3HM5 A;  5CYV A;  4BE1 A;  3CJN A;  4G6T B;  4PFO A;  1N25 A;  2M1B A;  1YRN A;  1HF0 A;  4BNC A;  2FBK A;  4CCK A;  3H3Z A;  3BTC A;  3SDB A;  4PGH A;  2HQN A;  5FLM J;  2V9K A;  2YX7 A;  3QPH A;  5ICE A;  4RM2 A;  3ZGK A;  5HLI A;  1S8N A;  3MKW B;  3TP0 A;  2ADU A;  1IN7 A;  4HV6 A;  2VPR A;  4EVI A;  2P6T A;  1YS6 A;  4DBR A;  3D0S A;  1QPM A;  3DV8 A;  3LMM A;  3GFL A;  5H6R A;  5LGN A;  4R8H A;  3S17 J;  1E3O C;  2DMN A;  2Y30 A;  4O5V A;  2GIV A;  1T39 A;  2FJ1 A;  2O5R A;  4KN7 X;  3BR1 A;  1ENH A;  1YYV A;  4HZF A;  1ETY A;  1YFH A;  3MAJ A;  2K86 A;  1XS9 A;  3J81 K;  4QPQ A;  1ETV A;  3V8L A;  1IUY A;  2UZK A;  3BQY A;  2V26 A;  2ZJ2 A;  4LJZ F;  1RKT A;  3WTU C;  2R7U A;  3KP3 A;  4GXO A;  2HQA A;  5E3M A;  1ORK A;  3Q9S A;  5DCF A;  2F5F A;  3J81 Z;  3Q5F A;  3HRU A;  3K6G A;  4UB6 C;  4CSW A;  2IGN A;  3JSP A;  5KNL A;  1VTN C;  2A6T A;  5GAD J;  3ZPL A;  1YIT I;  2VLA A;  2QCO A;  2BEO A;  3ZN0 A;  1R1V A;  2CG4 A;  2QUF A;  4IRG A;  1PYV A;  2L0K A;  2O61 A;  2DOE A;  2KP6 A;  4RLF A;  1X1C A;  3FMQ A;  1R1U A;  4II2 A;  1MIJ A;  5E1X A;  2AXL A;  4UXN A;  4EM0 B;  3H92 A;  2IS1 A;  4E7H A;  1IXC A;  2KZG A;  2D5V A;  3G6E I;  1JUM A;  4U7B A;  4P1W A;  3CUQ C;  3WU0 A;  2L2O A;  1FP2 A;  2H09 A;  4A6D A;  3QP5 A;  2MFZ A;  4RB3 C;  5J47 A;  2WWY A;  4BHB A;  3F21 A;  4GO1 A;  3QAH A;  2E5N A;  2RKH A;  3VYU B;  3BG7 A;  1UCR A;  2ZKZ A;  4ZZL A;  1NG6 A;  4K2E A;  3KYD B;  4IPA A;  2A5Y B;  1TWA J;  3OYD A;  3IKT A;  4L9J A;  1LEB A;  4HW0 A;  5M5Y J;  4G7Z F;  2Y2Z A;  3FWE A;  2D2W A;  3KP4 A;  2HOE A;  1Z05 A;  4LD5 A;  2LKP A;  1FWZ A;  3BJO A;  2JA2 A;  4XLF A;  3L2U A;  3C18 A;  4LFU A;  2WV1 A;  3PFI A;  5HS9 A;  3ZN1 A;  5M3M J;  2PJR A;  4H0E A;  3JRF A;  1JUP A;  2QEN A;  1XSD A;  5D6E A;  3RQI A;  4U7D A;  2RV8 A;  2BGC A;  2GZW A;  5LHI A;  4HLX A;  4EEF G;  2IGO A;  4I2O A;  5L3G A;  4U87 A;  1SVO A;  4M74 A;  4YIR X;  2WC2 A;  4KIT B;  1AKH A;  4A5M A;  2OQR A;  3GFJ A;  5IOZ A;  3P7N A;  2MC4 A;  1X58 A;  2H8R A;  5E18 F;  3DEE A;  3OOP A;  3TKY A;  4PK4 A;  2Z9O A;  3BLY A;  4C30 A;  1FJL A;  3S32 A;  5CQG A;  2VI6 A;  3IUO A;  3ULQ B;  3QP6 A;  1IRF A;  1RES A;  1R23 A;  5F64 A;  4HLY A;  1FP1 D;  4UUV A;  1WJB A;  4F92 B;  3L00 A;  2M2E A;  3RKW A;  4DBQ A;  4LG0 B;  2E60 A;  2LY1 A;  3CC7 I;  2H94 A;  2LDU A;  4ZJZ A;  4M73 A;  1R36 A;  4FX0 A;  3K1N A;  2NS0 A;  2MLG A;  2V9V A;  2IA1 A;  1W0T A;  4P5O A;  3S3M A;  2X0L A;  5CVV A;  3JRI A;  4XN3 A;  4UUT A;  4DIQ A;  2XV4 S;  2HYF A;  1TQI A;  2Y9Y A;  4M3G A;  1VQ4 I;  3CP8 A;  2LFB A;  3AG2 H;  4HAM A;  1AWC A;  2XRN A;  1ZEL A;  1RET A;  1XGO A;  1FMW A;  4XLA A;  5EZG A;  4A5N A;  2WB1 N;  4BQA A;  5DD4 A;  4IOA F;  1W4M A;  2EIL H;  2K27 A;  2XAQ A;  1K78 B;  1JHH A;  2IS2 A;  2GBY A;  3RKQ A;  2ELH A;  4WCG A;  3CTA A;  2CW0 F;  4BH9 A;  1WJA A;  1O7F A;  2FD5 A;  3GTJ J;  2KRH A;  1HSJ A;  1HDP A;  2HXO A;  2QEX I;  4QSH A;  2EPF A;  2EZL A;  4YFN F;  5DDG A;  2EZH A;  4OU0 A;  3HPH A;  4M6V A;  1LEA A;  2DK5 A;  1FOW A;  4P9U A;  1HLV A;  3HB9 A;  1IRZ A;  1R1T A;  1JHF A;  4BQQ A;  2F5V A;  3H9Q A;  2GQQ A;  1X1D A;  1H8A C;  2KKO A;  2O9L A;  3BCB A;  1D0Y A;  3U2R A;  2EA4 A;  3PNT A;  2HQR A;  2Y75 A;  1LDK B;  1V4R A;  3PO3 J;  2XPW A;  5L3D A;  1Z9C A;  3FF5 A;  1OYY A;  3ERE D;  1OCZ H;  2FUG 2;  1P9Q C;  3M8E A;  2LR8 A;  4BDZ A;  2O3F A;  1WZ2 A;  1QVU A;  2MGQ A;  3OOU A;  4HV5 A;  1T08 B;  2TRT A;  2H1K A;  2Z99 A;  4NC8 A;  4AYB N;  1GLN A;  4IEJ A;  5LEJ A;  1SAU A;  2X6Y A;  2Z1D A;  2COM A;  4WF2 A;  5JHU A;  4BQO A;  4I0A A;  5K5R A;  2LBF A;  4IOC F;  1KQ8 A;  3E3V A;  1PUF B;  4BEH A;  4OIP F;  1R58 A;  5M5X J;  4FCY A;  2BYV E;  1R5G A;  4HNT A;  3K4C A;  2VJ4 A;  2VQC A;  2DQR A;  5H6Q A;  1MKM A;  5GAG J;  3EUH A;  1T8I A;  2V4J C;  4GYI A;  4IL6 C;  4Y4R A;  1D8J A;  2M7A A;  2HDD A;  1YRN B;  2EK5 A;  4XON A;  3L09 A;  2HXI A;  3HGG A;  2IEK A;  2IBD A;  5DYM A;  1QHG A;  3BQZ A;  2IW5 A;  1DQU A;  5TIS C;  4ON0 A;  4IZZ A;  3F23 A;  3LSG A;  1DP7 P;  2MLK A;  1TQP A;  4C3H J;  1W5T A;  5CVU A;  1MBK A;  5KCM A;  3G71 I;  2E1O A;  3IWZ A;  3I56 I;  3M1C A;  2UUZ A;  4XMY A;  2BV6 A;  2IPQ X;  2QZ8 A;  5B1B H;  3B6A A;  3CF5 F;  3QPS A;  1ZQ3 P;  3LWF A;  1OPC A;  3L2C A;  2XAF A;  5E1W A;  3F8N A;  1E17 A;  3QPL A;  1YS7 A;  1FY7 A;  1O7L A;  5J1Y A;  1P7I A;  1BOA A;  4U0V A;  2QF7 A;  3D5R C;  4KIS A;  1POG A;  3EYY A;  3W2A A;  4A93 J;  1IV8 A;  3WOD F;  3JW4 A;  1W36 D;  2GA2 A;  3F9K A;  2WBM A;  2DA1 A;  4XOP A;  2XAH A;  3KP5 A;  1EKE A;  5F1J A;  1B4A A;  2W7N A;  1IC8 A;  5BMZ A;  1OR7 A;  2EIJ H;  5FKN A;  3TW6 A;  3AFH A;  4IHX A;  5LGU A;  4LK1 F;  3S16 J;  3FHZ A;  2PX9 A;  4ZYH A;  3WTV C;  1VFC A;  4G7O F;  4LLN A;  2L7M P;  5HOD A;  4RAG A;  3M4O J;  3C1D A;  3QYF A;  5JI6 A;  1IXR C;  4I99 C;  1FYL A;  2RGV A;  2R5Z A;  2XRO A;  2DU9 A;  2P0W A;  3KIO A;  1YX5 A;  2OAZ A;  2PMZ A;  4O3M A;  3QYE A;  3A1Y A;  3CLQ A;  4BBR J;  2HZT A;  2BY2 A;  3U21 A;  1PVE A;  2C6Y A;  2GOM A;  1ZGW A;  2CUE A;  2JPB A;  4XSZ F;  1FBQ A;  2RVC A;  2AHQ A;  2V7F A;  2JZY A;  1K4S A;  1A35 A;  6PAX A;  2W85 A;  1YW7 A;  2NOJ B;  1G59 A;  1MBH A;  3BZC A;  3R0J A;  2E2I J;  4IHV A;  3HG9 A;  2W82 A;  4BE0 A;  1VI0 A;  4BL0 B;  2GXG A;  2LKX A;  1LFU P;  2IJL A;  2DT7 B;  4XM3 A;  2VKE A;  2DQL A;  4HPQ A;  1AU7 A;  2V1U A;  1BW5 A;  4DNC A;  4ANJ A;  1I39 A;  2MG4 A;  2X6X A;  3O6B B;  1K61 A;  1I6X A;  3E7L A;  4ZYG A;  2PJR B;  2CMP A;  2RDP A;  2XAJ A;  4B3X A;  2R7F A;  1JE8 A;  3DWL E;  2EFP A;  2HGC A;  3I59 A;  3I54 A;  4IKF A;  2FBI A;  1HKQ A;  2HQ5 A;  1YIO A;  1LPQ A;  4KT6 A;  2R93 J;  1UG2 A;  3BG9 A;  1M1E B;  3JAM Z;  3HRM A;  1MZB A;  3ZQ7 A;  1UHM A;  3K4K A;  5ILS A;  4BGD A;  2B63 J;  4XRF A;  1R7J A;  5ED4 A;  1MH3 A;  1Z6T A;  1AKH B;  2HVQ A;  3M8F A;  3RDI A;  2EFN A;  1QZY A;  4UHT A;  4Y15 A;  4I6Z A;  3HOX J;  5BPI A;  1I1G A;  1KYZ A;  3FXJ A;  4CIC A;  2VBZ A;  1KGS A;  5FD5 A;  2DAO A;  3ZMT A;  3L2V A;  3S2H J;  2EZK A;  1XC5 A;  3LSM A;  1LNW A;  1MW7 A;  2RNG A;  4RB1 A;  1G8X A;  1FT9 A;  3ERM A;  3BR2 A;  3UNG C;  2HVR A;  3SZT A;  1TLH B;  3CCL I;  3CUQ A;  5ICG A;  3SHF A;  4YEL A;  2KIF A;  1WH5 A;  1ZR2 A;  4RBO A;  3H0G J;  3V4G A;  3M07 A;  2HPM A;  3MKL A;  1HW2 A;  1W1W E;  1W7P D;  2DA4 A;  2F4O B;  2ZXJ A;  1DDN A;  1IN8 A;  2OZ6 A;  2MA3 A;  2W00 A;  1FIA A;  5HLG A;  1REP C;  3H5R A;  1BC8 C;  2FSW A;  4BHC A;  2OTL I;  3ABL H;  2JPC A;  5J8F A;  3ZQL A;  4FTH A;  3VDX A;  1BR1 A;  2FU4 A;  5HLH A;  1SD4 A;  4E4H A;  5TGT A;  3SEQ A;  3RPU D;  1OCO H;  1V55 H;  3J7A O;  2HOT A;  2CQX A;  1PDN C; 
#chains in the Genus database with same CATH homology
 3J7Z I;  5DM6 F;  1MMS A;  1VQK I;  1YJ9 I;  1YIJ I;  1Y39 A;  3CCR I;  3PIP F;  3CCU I;  1VQN I;  3I55 I;  3CC2 I;  2FOW A;  1VQ5 I;  1VQ8 I;  1VQ9 I;  4IOC F;  1ACI A;  3CCS I;  1YI2 I;  2OTJ I;  2E35 A;  4UY8 I;  3G4S I;  1YHQ I;  2QA4 I;  3CD6 I;  5DM7 F;  3DLL F;  2E36 A;  1HC8 A;  5GAG J;  5GAE J;  3CMA I;  3CC7 I;  2ZJP F;  1YJW I;  3CJT B;  1S72 I;  1VQO I;  1YJN I;  1VQL I;  3G71 I;  5GAH J;  3CCE I;  2NXN B;  3I56 I;  1VQ4 I;  2K3F A;  2ZJR F;  3CCM I;  3CF5 F;  3CCJ I;  1QA6 A;  3CCL I;  5GAD J;  1YIT I;  2JQ7 A;  4IOA F;  1VQM I;  3J7Y J;  2ZJQ F;  3CME I;  5JVG F;  1VQ7 I;  4V19 K;  3CCQ I;  1VQP I;  2OTL I;  3G6E I;  1VQ6 I;  2QEX I;  2H8W A;  3CC4 I;  3CCV I;  4IO9 F;  1FOW A;  3PIO F;  1FOY A;  1FOX A;  2E34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...