1JJ8C

Testing the water-mediated hin recombinase dna recognition by systematic mutations
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
49
structure length
49
Chain Sequence
GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords 5'-D(*TP*GP*(5IT)P*TP*TP*TP*TP*GP*AP*TP*AP*AP*GP*A)-3'
publication title Testing water-mediated DNA recognition by the Hin recombinase.
pubmed doi rcsb
total genus 12
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2001-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jj8C00
2HXOA 5GPCA 4JX4A 3Q0VA 5IP6A 3TEDA 1PUFB 4BXXJ 2LK2A 5C4XJ 1RETA 4CYCA 2CUEA 3JRGA 1ETXA 1POGA 3S2DJ 3ZQFA 2NVTJ 1WH5A 4LOCA 4W1UA 1AHDP 4FCYA 3UKGA 1RKTA 2CJJA 2JA5J 4W97A 3TP0A 3TW6A 3S1RJ 3LSRA 3BR1A 1LE8B 1ITYA 2B63J 2R5ZA 2JWTA 2DMNA 1RESA 2EH3A 3S15J 1ETOA 4DYRA 1FTZA 4BY7J 2DMUA 1ETYA 4BKXA 1I50J 3JRIA 2X48A 4B3AA 4DW6A 3BTLA 2DA6A 3PM1A 5IOYA 4IHXA 1ZTRA 2EBIA 1ENHA 1MH3A 1ZK8A 2TRTA 3CDLA 3S14J 1JT6A 2O7OA 3FIWA 2D5VA 3S1MJ 3QPLA 3SJMA 1QVUA 2DA1A 5F04A 3S2HJ 1TWGJ 3ZQGA 4BBSJ 1XC5A 1NK3P 2CQXA 3JRFA 2E2JJ 1SFOJ 4C2MJ 1P7IA 4BBRJ 2VKVA 4MFDA 4MLOA 1K83J 2L7ZA 2LLKA 1O4XA 3A03A 2M9HA 3S16J 4MIMA 1JTYA 5FJ8J 3HGYA 3W6VA 1R9TJ 5FLMJ 1EF4A 1E3OC 1ZQ3P 4UUSA 1SANA 1UG2A 4JYKA 1Y1WJ 4GFBA 2QF7A 3IH4A 2K9SA 1F36A 1AKHB 2R5YB 2JN6A 1HOMA 3JRDA 4D7MA 1Y1VJ 5F1JA 2JJ7A 3BQYA 1IG7A 1IUFA 5E3MA 4XRSG 2ELKA 4DYCA 1G2HA 3BTIA 4M6VA 4A3DJ 2QCOA 1OJLA 4JX6A 3HBLA 2NS7A 3GTJJ 3BQZA 2VI6A 3G1MA 3GTQJ 2NS8A 2JA6J 3OOUA 1AU7A 5FKKA 5IYCJ 3WHCA 4HNVA 4QSHA 1RPWA 3JRAA 4DZPA 2HQ5A 3FK7A 5IP9J 1BL0A 4A3KJ 2Y9YA 1QRYA 1BJZA 1JUMA 5E3NA 1ZKGA 1ETVA 5M3FJ 2LR8A 4RDUA 2VKEA 3HOVJ 4A3IJ 3ZQHA 2O8KA 5E3LA 2Y9ZA 5EF6A 5EZHA 1WH7A 2MG4A 2IEKA 5M5WJ 4QIWN 4A3FJ 3SDGA 5IPAA 1NTCA 4I76A 3MKLA 3HEFA 4Y7NJ 2XRLA 5FKNA 3C2BA 2E2IJ 5GPAA 3ZQIA 5EEAA 2XGCA 5DS9A 2R93J 1MBKA 2XPWA 1IDZA 2HDDA 1LE8A 2GBYA 3MN2A 2CUFA 3LSPA 1FTTA 4XRMA 1B72B 5BNGA 9ANTA 3ZOBA 2LVSA 1BA5A 5EZGA 2VPRA 3OSGA 1MH4A 4M3BA 4XIDA 2XSDC 2FD5A 5F0HA 2DMQA 1P7JA 1UHSA 1H89C 3JRBA 1JKOC 1B8IA 2CRGA 1ZR4A 3HB9A 3LNQA 4A93J 2XB0X 3PO3J 4Y52J 1FJLA 1GDTA 2DMPA 1ETQA 2LFBA 1B8IB 5GP9A 2L7FP 2CQQA 4MFEA 3CCYA 3WHBA 2LY9A 2DA7A 5J1UA 1VFCA 4JX5A 4ABZA 3CQZJ 4XRSA 3E7LA 3OIOA 3QPSA 3HOWJ 1I3QJ 2KT0A 2DA4A 2WV1A 4S0HB 4L5EA 1QVTA 2HOAA 1ZR2A 5FKOA 1IJWC 2E2HJ 2X6OA 2RAEA 1TWHJ 4A3EJ 1FIAA 2WB1N 5HODA 2TCTA 2LTPA 1GV2A 3Q3SA 4IHWA 2R7ZJ 1W0UA 2EZHA 1MSFC 3GTOJ 4A3LJ 2DTZA 3S1NJ 1AKHA 2R5YA 1FIPA 5EGOB 2XB5A 5FKMA 2R92J 1WCMJ 2MSYA 2ECBA 1DU0A 1JKQC 1U9OA 4BY1J 2EQRA 3RZDJ 1OFCX 1HDPA 1H88C 3GTPJ 3K2AA 5F08A 1F43A 2XGEA 1MBGA 3O8HA 4A69C 5F27A 1OCTC 3GTKJ 2NVYJ 1APLC 1RR7A 3O8GA 5DTDA 4B1RA 1ETWA 1JUSA 1LFBA 3GTMJ 3BR0A 2DA3A 4A3CJ 3JR9A 5J1RA 4RBOA 4M3EA 3B6AA 1MBHA 4NDLA 4D5CA 2ZB9A 3BR5A 5K7HA 1K61A 3H0GJ 1GV5A 3GTGJ 5C4JJ 5J1YA 2EZIA 5EG0A 1VF9A 4UUTA 3HKZN 4C3HJ 4FTHA 3HOUJ 3M4OJ 2I10A 4QTRA 3BR6A 2NOGA 4IEJA 4AYBN 1A6IA 5EG0B 2IAIA 3RKQA 1MNMC 2HYJA 3FKIJ 3I4NJ 2K9QA 2OPTA 3PO2J 1S7EA 4FE7A 2L7MP 5E3OA 1JUPA 2XGDA 3TP3A 1GT0C 3QQAA 3M3YJ 2CU7A 2MGQA 3HOYJ 1HDDC 5JLWA 1U8BA 2ME6A 1U78A 2O9LA 3IH2A 1YRNA 1TWAJ 1JKPC 1B72A 3JRHA 1HCRA 2LP0A 3VPRA 1BW5A 1TWFJ 3A01B 1GVDA 3G1LA 1MSEC 1Q1VA 3HDDA 2Y30A 5M5YJ 2Y2ZA 1YRNB 3FISA 4J19A 2Y0SN 1IGNA 1WGXA 3FK6A 2XPUA 5IYBJ 2M34A 4D7NA 5C3EJ 2E19A 3OSFA 1IV6A 2M2EA 1BW6A 1T56A 2H8RA 2OF7A 5K7ZA 2ECCA 4XICA 2MW8A 4IHVA 3JREA 4MO7A 1HF0A 1ORKA 1T33A 1JTXA 4I6ZA 2XPVA 1NK2P 3JRCA 3BR2A 4CYCB 2KDZA 5M3MJ 2HOSA 1W0TA 1IDYA 3GBGA 1QPIA 1VNDA 4M3DA 4V2GA 4AUXA 3ZQCA 2Y31A 1ETKA 4X6AJ 5IOZA 2EZLA 1U9NA 3IV5A 3HOZJ 1FEXA 1Z77A 2HXIA 2JK3A 3SFIA 2X9DA 5IP7J 3IH3A 5FLVA 4FE4A 2R5ZB 1JKRC 1DU6A 1UMQA 3RZOJ 2G0EA 2FJ1A 4JP0A 3Q0UA 4C3IJ 2YS9A 2GLOA 2JA8J 5M5XJ 1LFUP 2ID6A 3GTLJ 5EGOA 1XS9A 3L1PA 3S17J 4A3BJ 3BR3A 2VUMJ 3BTJA 5EDNA 3BTCA 2GM4A 4A3JJ 2ID3A 3S1QJ 1XG1A 2P81A 2K40A 4IHYA 3B6CA 3CMYA 3BG5A 4DZJA 2EZKA 5JLXA 2FQ4A 3Q0WA 4A3MJ 1A5JA 1JGGA 2YU9J 4D5FA 1H8AC 5FKLA 2H1KA 4M3GA 3G1OA 1JJ8C 2ME0A 4G12A 2JA7J 3I4MJ 2K9NA 2DJNA 2FX0A 3DEWA 2E1OA 1WPKA 4C3JJ 1I6HJ 1MBFA 2NVXJ 1VI0A 1X58A 3RQIA 3HOXJ 4UUSB 2AO9A 5EYRA 3BG3A 3TW7A 4AC0A 2COBA 2L9RA 2R0QC 2YUSA 2M0CA 1TWCJ 2PMZN 4B4CA 1X2MA 3D1NI 1RKWA 2DA2A 2HI3A 4FISA 2NVQJ 4X1EA 1Z0XA 3H3VK 1GUUA 3ZQLA 2IBDA 3HGGA 4A3GJ 1OCPA 3LOCA 5K7FA 2DA5A 3NAUA 4XK4A 1JJ6C 1ZGWA 5F0FA 3K7AJ 5F0CA 1D5YA 1IC8A 3A01A 4DYQA 3DCFA 2L0KA 4V2FA 1MBJA 2HOTA 3HM5A 5IYDJ 2WAQN 1CQTA 3BT9A 2N8GA 2W48A 2LD5A 1JT0A 3F0CA 1WI3A 2JMWA 3A02A 3BG9A 3MVPA 2AHQA 2LKXA 5J3LA 2DMTA 1MBEA 1HLVA 3LSGA 1PUFA 1X2NA 3LSJA 5C44J 4EEFG 3NARA 4M3FA 2DN0A 1IRZA 2M8GX 1TC3C
chains in the Genus database with same CATH superfamily
2UV1A 4HBLA 3E5UA 2OA4A 2Z99A 2XSJC 5IP6A 2DT5A 1ZLJA 3OYGA 3GZ6A 4RB0A 4KICA 4CYCA 2CUEA 2IA2A 1IUYA 3BG7A 2ISZA 1POGA 2V7FA 1XMAA 2QZ8A 4PFPA 4HX8A 2EK5A 3M8FA 2KL4A 1VQ4I 4PGGA 4RAYA 3UKGA 1S29A 1RKTA 3RKYA 5JI6A 2JA5J 4I98B 2BHZA 1KU3A 3NWTA 2K9LA 3DTIA 4FETA 1K7AA 2EH3A 4NC8A 3JAMZ 1ETOA 2G7UA 4HZFA 4XORA 4OIQF 3UNGC 5CVVA 5AIQA 2FEZA 3BDDA 4YIIA 4BY7J 3OMYA 1ETYA 5B1AH 3AL0B 1I50J 1SEUA 4B3AA 2DA6A 1Y8RB 3QOEA 4N0BA 2ESHA 1XN7A 3HKZA 2OCCH 4IHXA 4J01A 1ZTRA 1VQPI 1U0JA 3I58A 4PDKA 2EBIA 1MH3A 2TRTA 1UHMA 2EFPA 4NHJA 3KEYA 1JT6A 2O7OA 1G3SA 3FIWA 3H36A 4PJ0C 2D5VA 4WX9A 3QPLA 1WJDA 3WTWC 2VT2A 3KETA 4HX4A 1SFXA 2KPMA 1LVAA 3H0DA 2EV0A 2F4OB 4BBSJ 4QPQA 1XC5A 2LY1A 2ZNZA 2RN7A 3OR2C 5ILUA 3D5SC 3IHUA 1AOYA 4CZCA 1LUJB 4U7BA 1K83J 2V6CA 2LLKA 1YITI 2L9NA 1D8KA 1O4XA 3IWZA 4TV7A 3VWBA 2FU4A 2M9HA 3EPZA 3K69A 4AIKA 3M7GA 3S16J 4E7KA 3HGYA 5DUKA 2F4IA 5LEKA 4UV9A 1K79A 4UUSA 2LKPA 1SANA 4OAZA 1Y1WJ 2R7OA 3L09A 1DPUA 2XVCA 2GZWA 1S9HA 2QF7A 2OU2A 3G2BA 1B9MA 1AKHB 2VKHA 3IKTA 4D1QA 4C9YA 1TL8A 1MNDA 4D7MA 2ZJ2A 1R36A 3IRQA 3LSMA 4YFNF 1G59A 2JJ7A 3QYBA 2PEXA 4XRSG 3HSEA 1G2HA 4DYCA 4EATA 2VOPA 4X0GA 3WTSC 3C2HA 3R0AA 4BDYA 3WGHA 2OD5A 2WV0A 5HDGA 2VPLA 1R49A 3GTJJ 3CUQA 4UVAA 5CJ9A 3BQZA 2NOJB 4M6YA 3OYEA 1J59A 3A0HC 5J4VA 3ZPLA 4CHUA 2A68F 2R7RA 1F1ZA 2MD0A 4YELA 5FKKA 3FXJA 4XLHA 2PLYA 2ZC2A 1D8JA 5FROA 2MBFA 4HNVA 5E79C 2IGKA 1QZEA 2OCEA 4ZTFA 4MTDA 2Y9YA 3ZP5A 5LHGA 5E3NA 3W2AA 1ETVA 2MH2A 2A6TA 2PJPA 2VKEA 3S32A 5IT9Z 2O03A 2R7TA 4A3IJ 5F1RA 2Y9ZA 5EZHA 1WH7A 3MWMA 4EJTA 1X1AA 5M5WJ 5B66C 2HTSA 2AQEA 1NTCA 2QSHX 5HLIA 2V1DA 5LLQA 4OMYA 5GPAA 4GRIA 3EQLF 4JBAA 4EMSA 3OY9A 4I99C 2D1HA 2E34A 5TGTA 2E7WA 2K9MA 2XPWA 5KHDA 4HQEA 3IWFA 3LQRA 2GBYA 3MN2A 2CUFA 2UWMA 1B4AA 1EV7A 4I2OA 2M30A 2KDOA 3U1KA 2BXYA 1ZRFA 1XX5A 2EILH 4RGXA 1FC3A 4KUMA 1UHSA 3SEZA 1JKOC 3CP8A 1B8IA 1NH3A 3V7CA 2JSPA 3KYDB 4M71A 4CICA 2DCEA 1N75A 1IW7F 3HB9A 3OL3A 4MEYF 1USSA 4II2A 3OYNA 3PO3J 3E5XA 1BN5A 3VFZA 3P9CA 3ZMUA 1ETQA 3NRVA 4ESBA 1B8IB 1ZRDA 1MDMB 5FO5A 4ITVA 5D8LB 4MFEA 4BACA 3CCYA 3RYPA 2IS2A 3HSFA 2RNJA 4ABZA 5EJCA 4MQ9F 3FXKA 4NQWB 3AG2H 4ZC3A 1I3QJ 4ON0A 4XLPF 2QA4I 2DA4A 3DEUA 3FMRA 5JVGF 5BOXA 4L5EA 1JE8A 2E5ZA 5GTHC 2HOAA 5FKOA 2E2HJ 3LSKA 5EEHA 2RAEA 2IA1A 1G3YA 2FMLA 2E36A 2WAQA 4L18B 1HW1A 2VE9A 3LSHA 4Y4RA 5HDNA 3N97A 1MSFC 1W7PD 2Y0MA 5IY5H 1T0FC 2R5YA 3LFKA 3PQJA 1MNEA 5FD5A 1HC8A 5JVTA 1SVMA 2ECBA 2JZYA 3FHNA 5D5WB 4U87A 4N4OB 3GLLA 4LMYA 2EQRA 2STTA 4JK1X 2HYGD 1R5ID 5JFRA 2BE5F 3K2AA 1Q1HA 5J8FA 6PAXA 2G7HA 3J80K 4A69C 2YR2A 2NVYJ 3F8BA 1APLC 2R4GA 3ABLH 1RR7A 2FNAA 3K4BA 4BQAA 3F21A 1UCRA 1X1DA 1LFBA 3GFJA 5E1WA 2BYVE 3CO6C 1D1BA 4ANJA 4L0ZB 3EUKL 1YW7A 3E3VA 1K78A 3ERMA 1VQMI 1YTYA 5ICEA 2DOEA 2P5VA 1W7PA 1UAAA 1QU3A 2UUZA 3H0GJ 3F9KA 3HSRA 1HKQA 3BP8A 5J1YA 3HTUA 2BV6A 4MQVA 4B09A 3MKWB 1K78B 5EG0A 2ADUA 4UUTA 3HKZN 1BM9A 1W7PB 1Z05A 2HZDA 3R60A 2FF4A 2EFWA 4L9NA 4HF0A 3HOUJ 3ECHA 3HIFA 2I10A 1Z1DA 4Q5SF 1S72I 1RZ4A 1A31A 5EG0B 2IAIA 1VZ0A 2AXLA 2HYJA 1MNMC 2Q8KA 1MJBA 2K9QA 2X1EA 3PO2J 4FE7A 1JUPA 2L54A 1WJAA 2BVMA 4KMUX 1GT0C 3QQAA 3VYSB 5L3BA 1X19A 2MGQA 4WXHA 4CSWA 1QO0D 4CA0A 1FZPB 2UXNA 1MMDA 4HV5A 1U78A 2CV2A 2O9LA 3RKWA 3MAJA 4LK1F 3G1LA 1ULYA 1Q1VA 4E7JA 5M5YJ 3S2WA 1VQ8I 3FISA 3HXLA 3WODF 2DW4A 2Z3YA 5LFAA 2XPUA 4QPOA 2QM3A 3C3WA 3L2CA 5HDKA 1BW6A 2DFFA 2VIXA 4YFXF 1LDJA 2HU9A 1ERDA 1T56A 4LIVA 4II3A 2KRHA 2MW8A 3BZCA 1X1BA 1WQ2A 2GQQA 4MGRA 1ORKA 1P4WA 1JTXA 1XMXA 1HW2A 2X6WA 3JRCA 1SVOA 2KDZA 2DFIA 1QHGA 3NWSA 4XMYA 3MZHA 4IVNA 1Z7UA 3GBGA 3EUHC 4L0YB 4PSWA 2WADA 3OYJA 4M3DA 1ETKA 4UXNA 4HLYA 1TT0A 2DJIA 1FEXA 4DIQA 3K6GA 2BHYA 2BEOA 2X9DA 4Y33A 3H5NA 5FGMA 4DBRA 1YHQI 2YPRA 3CLOA 4PCQA 5HOOA 3R4KA 1C0WA 1DU6A 4IO9F 4KDPA 1UMQA 1Y0UA 2O3FA 2V4JC 3DKYA 1DDNA 2G0EA 4C3IJ 2H94A 2XC7A 2L4AA 2YS9A 5BQTA 2QENA 3VYTB 5M5XJ 1LFUP 5AONA 2IW5A 4CCLA 2QLZA 2OBPA 3BR3A 3FX3A 2XAHA 3GMEA 3CJTB 4A3JJ 4LLGF 3S1QJ 3M9AA 1J5YA 1X3UA 1XG1A 2M3AA 4KIFA 4CUGA 2F48A 1UELB 3B6CA 1LVKA 2X1CA 4BHCA 2LSOA 4DZJA 3C2GA 5JLXA 2FQ4A 3DPTA 2M8EA 3W6JB 4ZYHA 3BZ6A 4HQMA 2VBXA 3DFGA 4LGWA 2H8WA 1WWXA 2GOXB 4LJZF 3JCUC 3DBLB 2Y48A 4LK0F 3COAC 2XIGA 4WWCA 1SVLA 1A04A 3HTSB 3ZXSA 3SXYA 3MQ0A 1JHHA 4IRGA 2COMA 2MABA 3DEEA 1DQUA 1MBFA 4QWQA 5LHIA 1X58A 4UVBA 3RQIA 4RGUA 3RQ4A 2V79A 1QBJA 2E1NA 4AIDA 2KRFA 4AC0A 2COBA 2R0QC 4UB8C 2M0CA 1OYYA 1X2MA 4IQ4A 2DQLA 5H20A 4JQFA 4E6KG 2J5PA 2DA2A 2FQ3A 3CO7C 3PSFA 1O7FA 1BI0A 1S6LA 1IN6A 3CMMA 4FISA 2IS6A 4X1EA 1Z0XA 2FMYA 2QGUA 5D6FA 3H3VK 2X85A 4LLLA 4BJ5C 2OV7A 1OCZH 1TBXA 1ZH5A 1LKXA 3VYUB 4IXAA 5DD8A 3W3CA 2DOFA 1TTYA 1L0OC 1MW7A 2DA5A 3BC8A 3NAUA 4XK4A 1ZGWA 4I7HA 5F0CA 2FNPA 3A01A 5GAHJ 2I8DA 5GADJ 4ZYEA 1HQCA 2HOTA 3HM5A 3TDUC 2WAQN 3KEOA 3KX2A 3MKYB 1CQTA 5IYDJ 1AA7A 2O0YA 1F4KA 1GLNA 4M74A 5DEQA 4AM3A 3MVPA 3O3KA 1BIAA 2LKXA 1SD7A 1W36D 5J3LA 1MBEA 1V3FA 1FOWA 3F23A 3IC7A 2JT1A 4XN3A 1FYLA 4M3FA 3ZN1A 4EJVA 3OS2A 1IRZA 1TC3C 2RQQA 4IPAA 4EV0A 2HXOA 4F3QA 4GDFA 3HG9A 4BH9A 4BXXJ 4CYDA 1SD6A 2LK2A 1RETA 2R7UA 1TQPA 3W2VA 1YX3A 3S2DJ 1OLTA 4OIPF 2CQKA 2DAOA 1WH5A 3QWLA 3OYLA 4W1UA 2PI0A 1AHDP 1IN7A 2OZ6A 1R5HA 2ZBKA 3TP0A 3TW6A 2WAEA 2CFXA 1S7OA 1LE8B 2R5ZA 3V42A 3U21A 1RESA 2W1OA 3F3XA 4KMFA 4GO1A 4MHGA 1FTZA 4XONA 1ZARA 2VKDA 4BKXA 2KQRA 3JRIA 2X48A 1YOVB 3K70D 3BTLA 3EDPA 1M1EB 1R1VA 2VJ4A 3S3NA 2K27A 3PM1A 3JTGA 1I27A 2VQGA 1W5TA 2Z2SB 2EFNA 4UB6C 4YRVA 4KYWA 4XLCA 3CCUI 1SMTA 3ONQA 1ENHA 2KP6A 3CDLA 1WJ5A 3S14J 3FBNB 4N9IA 4L9VA 2HOEA 3S1MJ 3ULQB 4ENKA 1O3QA 1J09A 1CF7B 2DI3A 5JHFA 3S2HJ 3ZQGA 4BQQA 1O57A 2EFOA 1P4XA 2QQ8A 3OL4A 2E2JJ 4OINF 1SFOJ 3QP5A 4BYYA 1P7IA 4BBRJ 3SZTA 1GXPA 2XV4S 3PIOF 2VLAA 4AD9A 2DTRA 1N78A 3RTRA 5FD6A 4EVIA 3WU1B 1RRJA 2AQFA 3J7YJ 3WE2A 1EF4A 2F5VA 1KU9A 1Y0NA 2UXXA 4XM3A 4OMZA 2EIJH 5DM6F 4KFCA 1UG2A 4V19K 2LOOA 2CW7A 2IJLA 2K9SA 3JTHA 4CCOA 2CSOA 1U5TA 4YG2F 4CH7A 2JN6A 3FXLA 5KNLA 3JRDA 1O3SA 3KP2A 3BQYA 4L5IA 5E3MA 2O6GE 2Z33A 2VE8A 4RM3A 1SAXA 1KU7A 2K4BA 3ELKA 1OISA 4ZDLA 1UG0A 3HBLA 4U0WA 2NS7A 5GAGJ 1YYVA 5LBQA 2STWA 1KQ0A 4H0EA 3EYYA 4RA2A 3HL2A 1VTNC 2XF7A 2NS8A 3VSLA 1ZRCA 2F4MB 1AU7A 1I1SA 4BE0A 4BNCA 5IYCJ 2M0MA 4A6DA 3CCRI 3WHCA 2CG4A 3BG6A 1DP7P 3FK7A 5IP9J 1E0EA 2XGXA 2W7NA 1H0MA 3CUQC 1S3JA 3OOPA 2LR8A 4PSXA 3B02A 1REPC 2XKOA 1I1GA 4HX7A 2O8KA 2EIMH 4CXFA 5EF6A 1OQYA 1W5SA 5IT3A 2CO5A 3DKWA 3Q9SA 2E1CA 1R4MB 4CDGA 2DLLA 2IVMA 4XLAA 3TO7A 5A2QZ 4BL0B 2XRLA 5FKNA 4E7SA 3TL4X 3FXUA 4O3MA 3HC7A 5EEAA 3I56I 2Q2EB 1YS7A 2R93J 2V1UA 1DGWY 4GYIA 5D4RA 3LSPA 3MKZA 3CCQI 4XRMA 1FTTA 2ZNYA 1B72B 2LVSA 1J9IA 4UY8I 2FBKA 1IXSB 1MH4A 3ABMH 2RDPA 4M3BA 4HF1A 4ENNA 3LA3A 5HS9A 5FB2A 2FD5A 2RGVA 1SD5A 2E60A 2ICWG 3QPHA 3JRBA 1QHHD 2VASA 1A36A 3PNTA 3DLLF 1QQIA 1T39A 1NG7A 3BJAA 3LNQA 2R7VA 1WRJA 3L2UA 2DXIA 4RB2C 5LRRA 2HPMA 1FJLA 3HOTA 1IN4A 2FOWA 4Q4ZF 2ZSHB 2Z1DA 2CQQA 3CJNA 3ZCOA 3K9TA 3WHBA 2LY9A 1B59A 2DA7A 2JSCA 3CQZJ 3K4NA 4XRSA 3E7LA 5CVIA 1DUXC 1E17A 1RI7A 3HOWJ 3GUDA 4A0ZA 3LA7A 2KT0A 3FF5A 2WV1A 2ZFWA 4S0HB 4EM0B 1QA6A 1D0XA 4C2TA 3PNVA 5E20A 5CVUA 1IJWC 1V5GA 5KK1A 3QU6A 1FIAA 2XDVA 4F91B 3DTEA 3HRUA 5HODA 2TCTA 3H9JA 1GV2A 3ZMTA 3Q3SA 4IHWA 5A2QK 2R7ZJ 2EZHA 1STZA 4LG3A 4A3LJ 1YG2A 1AKHA 3ERED 1FIPA 2FSWA 3QYEA 5FKMA 2PMHA 4BQNA 4MTEA 2MYSA 3KP5A 5KAFC 1BR1A 1GVJA 2O61A 1JKQC 2IS1A 5BS6A 4BY1J 2VONA 1DGRM 1P6RA 4P9UA 1IAWA 1U6GA 1HDPA 2F5CA 1H88C 5F08A 2W25A 3I53A 4RLQA 4I0BA 4LB5A 1KGSA 3QP6A 2XGEA 2W57A 2W00A 1OCTC 2M7BA 4IHTA 2ZCWA 2LF8A 1QZZA 2B7EA 1V5FA 2L2OA 2P6TA 2A07F 1P9QC 1ETWA 1JUSA 1Z7LA 2WAFA 2RV8A 2XAFA 3BR0A 4A3CJ 2VBYA 4XKCA 4M3EA 2R7QA 4PFOA 4NDLA 4M6XA 2ZB9A 4LG0A 1K4SA 1MMAA 1K61A 4R1HA 1BI2A 2XRNA 2JPCA 2ZMEB 3GFMA 2O8XA 4AVZA 3F8MA 1VF9A 4LG0B 4M9ZA 5ILSA 2PMUA 1IO2A 3BCAA 1SD4A 1TQMA 4QTRA 2FUG2 1XSXA 1A6IA 4HLXA 2NAZA 3RKQA 2W85A 3I54A 3FKIJ 1PDNC 1SC7A 1OKRA 2OPTA 1B6AA 3HPGA 2DT7B 2H1LA 3IUOA 1DP3A 5J40A 4HNUA 2P7VB 1HA8A 3WE3A 4RGRA 4HV6A 4RAGA 2IA0A 3KP6A 1ZAOA 1U8BA 5D8KB 3IH2A 3JRHA 1HCRA 4C2UA 2VQCA 4RS8A 5IT9K 4XSXF 1TWFJ 1UZCA 1PYVA 3KCCA 1MSEC 2HGCA 3WU2C 2V9PA 2BXZA 1S7AA 4JOMA 2GXGA 3MFKA 5IYBJ 2M34A 2QEXI 3J80Z 2HKXA 1IV6A 3V4GA 2M2EA 2YX4A 1TNTA 1Y56A 3JW4A 2MC4A 4Z2YA 2L3DA 2H8RA 3QPTA 2ECCA 4L9TA 4IHVA 2VJ5A 2E1MC 3JREA 3WTXC 1MDMA 3T0YA 4E4HA 5B1BH 4I6ZA 2XPVA 1FSHA 4D9JA 1YS6A 2EPFA 3BR2A 1YJ9I 1W0TA 4NQWA 2L9SA 3FMSA 1YFHA 3T1BA 2E71A 4V2GA 5CQGA 4RB1A 1YIOA 5IOZA 2K5CA 3TQNA 1RIOH 3KFWX 1U9NA 2Z9OA 3RKXA 3FXRA 1FSEA 3SFIA 5CQEA 3L2RA 4UV8A 4HW0A 4ZYDA 4F55A 3IH3A 3OYFA 2KHMA 3E6BA 3K0LA 2VBZA 1MMGA 1PJRA 2FJ1A 5ED4A 2XAQA 3GTLJ 1FP2A 2M4KA 2LY2A 1B9NA 4A2UA 3L1PA 3S17J 1EKEA 4M73A 3L2VA 4WXCA 2VT3A 4ESJA 1MZBA 2HQRA 4IHYA 3OYIA 4KA4A 2HS5A 3CMYA 2A6EF 3BG5A 5ICFA 3FXMA 5J47A 2XF5A 3CC2I 4E7IA 3Q0WA 3FWEA 4LITA 2FXAA 3K2ZA 4EJUA 1FYMA 1IN5A 1JGGA 2BVLA 1Z67A 4RM2A 2V1NA 1H8AC 2GXBA 4BS9A 3C7JA 1FOXA 1XGSA 3H9GA 2H1KA 3CCMI 3QRFF 3E6CC 4M3GA 3OYDA 1HKTA 3PQKA 2E35A 2ME0A 1XDSA 4FASD 2DT6A 1IRFA 3M8JA 3ML6A 2PJRB 4MEXF 2E1OA 4G6DA 4NC6A 1VQ9I 2VN2A 3WTTC 2NVXJ 1VI0A 4RLFA 2KIUA 2LBFA 3K4JA 4XQFA 3MMYB 4F7ZA 3PUFA 3TW7A 3D5LA 2XASA 2L9RA 2YUSA 3CF5F 2Q0OA 4PJMA 5L3GA 1RKWA 4ASNA 2LBFB 2LNBA 1YQAA 4HNTA 2VL8A 1ZG1A 1FNNA 2JRMA 1PP7U 2R7SA 1XTAA 4AU7A 3NQOA 1H9GA 4D0PA 3OYCA 1S8NA 1IZ1A 3DWLE 3G71I 1ZGAA 2BBYA 3K4MA 3CCJI 1FBSA 1JJ6C 4BAYA 3RDIA 3VDXA 4QLCU 2L5QA 3K7AJ 5KCMA 4GYGA 2UZKA 4RMNA 4DYQA 3DCFA 3LFUA 4DGWB 1MBJA 2D1VA 1J2XA 1WJEA 2LMDA 2W48A 1JT0A 3F0CA 4G94A 1WI3A 3A02A 1X4OA 2AHQA 2WB1A 3TO6A 3V7SA 1EJ9A 2PQ8A 2DMTA 3KPHA 1PP8F 2ESNA 3H35A 1HLVA 4IRIA 3QODA 1Z3YA 1PUFA 1X2NA 2YU3A 1XMKA 2K86A 4ZZLA 3DV8A 1LJ9A 4L5JA 3K1MA 3CJQB 2F5DA 4JX4A 3Q0VA 1TP4A 4ZH4F 3S8PA 1R4NB 3TEDA 1PUFB 4UNOA 2IGNA 3SFZA 3CP2A 5C4XJ 2K4JA 2M4GA 1E3PA 1T2KA 3VSKA 2NVTJ 2IGOA 4LOCA 3LSTA 4ZDPA 1JXSA 4FCYA 2QSGX 2CJJA 2BY3A 4W97A 3S1RJ 4P55A 5E1XA 3C18A 2IS4A 2A05A 4G8XA 1OCCH 1FWZA 2ELHA 2XROA 1QNTA 3GZ5A 3F22A 3I59B 3ZMZA 2A69F 5LEJA 2DO7A 3G6EI 3S15J 1FP1D 1D1CA 2LC2A 4A6EA 2EV5A 3OIPA 1HXDA 2X51A 2DMUA 3D0SA 4DW6A 3IL2A 1BI1A 1BR4A 3H1CA 2M5WA 1KYZA 4B47A 5IOYA 2LRDA 5B3SH 2HDCA 3CC4I 1X4PA 1RC9A 2ZJRF 3IRRA 4HDUA 3DPLC 5E8IA 2JVHA 2ZO4A 1TWGJ 3M1EA 4HDVA 3BLYA 5GTIC 2W24A 2CQXA 3JRFA 2MA3A 4KISA 3VYRB 3F72A 4U0VA 4C2MJ 2DFHA 3LA2A 2NVUB 4MFDA 1ACIA 3ZQQA 4EGYA 4MLOA 2L7ZA 1IXRC 2KIMA 3BCBA 2GWRA 1JTYA 5FJ8J 3W6VA 2VXDA 1R9TJ 1IRXA 5FLMJ 3LL7A 3U1DA 4K2EA 1ZQ3P 2IGMA 2L4MA 4JYKA 1P92A 3F8NA 3PNYA 4BHPA 2X0LA 1LNWA 2FBHA 3IH4A 3KP4A 4A5MA 1ZG5A 1F36A 4XLEA 4HPQA 1R6RA 4E7ZA 1HOMA 3RPQA 3ZRGA 1HW5A 4S05A 3OYHA 1MJAA 1X1PA 1IG7A 4EGZA 1T98A 2ELKA 3JSPA 1D5VA 2MLKA 2IT0A 3BTIA 1XPXA 4A3DJ 3HUGB 2QCOA 2DFEA 3BPVA 3ZQ7A 1U5TC 2K3FA 3BOQA 2VI6A 3G1MA 3W2WA 1KYWA 3A1YA 1OCRH 3X2QH 4ZZDA 3G3ZA 1QZYA 2JA6J 2P0WA 3PSIA 2A3SA 2XUBA 4PJNA 2OC6A 5ILVA 2A5YB 3CTAA 3JRAA 4NUBA 4DZPA 1FBUA 5HLGA 1JUMA 2BY2A 1ZKGA 1XGNA 3E6DA 3KZZA 4RDUA 1G4DA 3HOVJ 4BDZA 4E7LA 1Z6TA 2KJCA 5E3LA 4ENJA 3KEQA 2ZXWH 2QWWA 1OR7A 2MG4A 3ZMSA 2IEKA 1VQ5I 4QIWN 4A3FJ 2W84A 3SDGA 5IPAA 2VQHA 1TZLA 3TMOA 4I76A 5DCFA 3A0BC 3MKLA 3I71A 4Y7NJ 5L3EA 2R3SA 1YIJI 2E2IJ 3C2BA 2HQNA 2X6XA 5CVJA 3KLOA 1J0RA 3ZQIA 3HHGA 4XBFA 3E97A 2L02A 2NYXA 2FBIA 2DBBA 2ZJQF 1LE8A 2XAGA 1G3TA 2OAZA 3A4CA 1LDKB 5BNGA 9ANTA 1USTA 5FFXA 3ZOBA 1Z91A 2M7AA 2NNNA 3B73A 3FKJA 3OSGA 3LAPA 4XIDA 2X4HA 5DV5A 4OIRF 3EUHA 5H6RA 2K85A 2DMQA 5F0HA 1SFUA 4WXDA 3IKVA 1IV8A 2P4WA 2P6SA 2CRGA 3CMEI 1WJBA 2H09A 3CMAI 4CO8A 5BPIA 2PMZA 2XB0X 2K7LA 4Y52J 4EJOA 3FDYA 2DMPA 3KE2A 3AL0C 4Y17A 1CF7A 3WU0A 4XKVA 5TRDA 1XGMA 2YSRA 1IXCA 1V5EA 1Z3XA 1ZYRF 1OYIA 1S5LC 5J1UA 3K4CA 2LYCA 2JVGA 3DTKA 4ZTJA 1R00A 3QPSA 2Z5UA 2CYYA 1QPMA 3G4SI 4RAFA 1PUEE 1QGPA 1KQ9A 1QVTA 4NC7A 5E18F 4XOTA 1P4AA 1F9NA 3H5AA 1BBYA 5F64A 4BXUA 5ERIA 2XAJA 1K6OA 1B1BA 4BGDA 4A3EJ 2WB1N 1IN8A 1ZGJA 2LTPA 1FMWA 1Z21A 5D5VB 3H92A 4N4NB 1W0UA 5HLHA 2VXZA 3V7RA 2DQRA 2QQAA 3GTOJ 1NHAA 2DTZA 2QQBA 3S1NJ 5AIPA 1FPQA 2XB5A 5EGOB 2R92J 2VOOA 1WCMJ 4B3XA 5BPDA 5KAIC 2BGCA 4OU0A 1DU0A 3CD6I 3O2PE 1U9OA 2HFHA 4U0YA 2X6YA 4PJJA 2H27A 3KIOA 4IJAA 2L7KA 3GTPJ 3BROA 4BEHB 1XDUA 2NNYA 3M07A 3O8HA 3GTKJ 1LEAA 4G9YA 4OAYA 2V26A 3F6VA 1XCVA 3O8GA 4O5VA 3R6SA 3ABKH 4B8XA 1TQIA 1YE9A 3GTMJ 2P5KA 1EH7A 2DA3A 3U9GA 3JR9A 1BJAA 4XOPA 2CUJA 3B6AA 1MBHA 2OZUA 4G7ZF 5FLXK 2W82A 3BR5A 4O6JA 1IRGA 3KYCB 2E7XA 3AG3H 3GCMA 4A5NA 3GTGJ 5C4JJ 4XRFA 4LB6B 2EZIA 2BW3B 4P5OA 4IRHA 4FTHA 1FOYA 3M4OJ 4BJTA 3BJ6A 3LSIA 4B43A 3E5QA 1SAUA 3M1CA 3GFLA 3ECOA 2FA5A 2ACJA 4NBQA 3HHHA 3OIQA 3BWGA 2R7XA 1S7EA 2WY7Q 2L7MP 4KN4X 3TP3A 1RUOA 3N05A 4OIOF 4IZZA 4KITB 2E5NA 3M3YJ 2Q2EA 3FXQA 5HS8A 3S93A 1HDDC 5JLWA 3L2WA 3IAM2 2ME6A 2DDBA 2IP2A 3LQQA 1YRNA 1B72A 3ZR8X 3VPRA 1BW5A 4GXOA 1GVDA 1G6NA 2RNGA 2V9VA 1OYWA 4XNFA 3TKYA 1U2WA 4EJWA 1YJNI 3HDDA 1YRNB 4RB3C 2ZJPF 4J19A 2K02A 2R7FA 3SEQA 5CPRB 5C3EJ 2E19A 2ZKZA 4XLNF 2V6EA 2GIVA 2OF7A 5K7ZA 4XICA 3J81K 1TW3A 3DBHB 3T8TA 5JHUA 3BY6A 3REOA 1YW9A 3H3UA 3WGIA 1T33A 2FE3A 3BPXA 1NK2P 4HA8A 2HQAA 4CYCB 2H6CA 5LGNA 4CCJA 5M3MJ 2HOSA 1EH8A 1IDYA 1JGSA 5L3DA 4A0YA 1HSJA 4PK4A 1QPIA 1VNDA 4AUXA 4X6AJ 3OYKA 1RNLA 2VBWA 2EZLA 3KP3A 3IV5A 2O5RA 4Y15A 1FYKA 2OTLI 2JK3A 5F6FA 2QQ9A 4XN0A 5IP7J 4UHTA 5FLVA 2ZXHA 2NXNB 1JKRC 4I01A 1MIJA 4G6QA 3D5RC 3T8RA 2P5LC 2XHKA 5LHHA 1SFKA 3DKXA 3O6BB 1X3WB 3ZMVA 4CCNA 4U7DA 4AIJA 1R7JA 4XR6A 3J7ZI 3BTJA 4F52A 4KIGA 3CESA 2CV0A 2DYSH 2XAUA 1BOBA 1TNSA 2K40A 3CZ6A 1ONVA 3MZ8A 3TOAA 2HVQA 2QSFX 3H9QA 2GXAA 2CGPA 5LGUA 2RVCA 2CFOA 2LDUA 4D5FA 2XKPA 3GVAA 4Q48A 3L2QA 1TT5B 4F93B 3DPUA 4S04A 4IQJA 3V8LA 5DD4A 2CMPA 2F5FA 2W4SA 3OR1C 4G12A 3CCEI 2K9NA 2DJNA 2ZMEA 3FM5A 1SMYF 1WPKA 5J4YA 2JRTA 4FHTA 1FLIA 1I6HJ 5FFZA 3F8CA 4HEA2 2JUCA 3ASNH 2M1BA 4DBQA 4UUSB 5EYRA 3BG3A 3R0JA 1UJ8A 3LWFA 4P96A 2PMZN 4G7HF 4B4CA 3I4PA 4BE1A 1WSUA 1FOKA 3PUBA 1MD0A 1X1CA 3OV8A 1WJCA 3MCZA 5D5UB 3JAMK 1JHFA 2KLOA 1MMSA 3QOPA 5D5XB 4FX4A 3OWTA 3GO5A 5J8CA 1BC8C 2IBDA 2FOKA 1GHCA 4HSTA 1Z6RA 1IF1A 5CKTA 2GOMA 3VEPA 3I55I 1I39A 4XL9A 1OCPA 4G7OF 4E70A 4IL6C 3LOCA 5K7FA 1HBXG 3E1SA 5CYVA 5LD2C 5F0FA 3CUQB 4BE2A 4DNCA 2MLGA 3EYIA 4G6TB 1T38A 3EETA 2Y69H 1NG6A 1K6YA 1N25A 3KYLA 4BJ6C 2JUGA 4OOIA 2LG4A 2WC2A 2N8GA 2WY8Q 2JMWA 1GXQA 3BG9A 3MEXA 3GZNB 4PZJA 5CVRA 4GGGA 3LSGA 2EWNA 4ZJZA 2F6CA 5FRMA 1UB9A 3HPHA 3LSJA 1MKMA 1AWCA 3NARA 2DN0A 3DBRB 4DOZA 2HNHA 2VB6A 2M8GX 4Y3OA 3SZPA 3F8FA 2CW8A 5GPCA 2OUMA 1V54H 1FMVA 1KONA 1R23A 2BY0A 3FHZA 3N4MA 3J7AO 2EINH 1UHWA 3C1DA 3JRGA 1ETXA 1EH6A 2R7WA 3RJPA 2XF6A 1XB4A 3VOEA 3ZQFA 1W5CC 2OQGA 3GWZA 5K1YA 3HRSA 3K10A 5H2FC 3CC7I 4Q47A 3LSRA 1DPRA 1FT9A 3BR1A 5DUIA 1O7LA 1ITYA 2K3PA 2B63J 1H9TA 4IHSA 2JWTA 2RKHA 5HVQC 2VODA 4HAMA 2DMNA 2F2EA 3OYAA 2HPIA 1WZ2A 4DYRA 5LGTA 1LDDA 4UUVA 3BZKA 4IX7A 3CLQA 3QAHA 4FT8A 4A0XA 3FM3A 1ZG3A 5EEGA 2L9VA 1VQ7I 1ZK8A 3WGGA 1R58A 4AYBA 4H4KC 4HF2A 1V55H 4KJZA 4WF2A 2C6YA 4CZZA 3SJMA 2B9SA 2ZXJA 1QVUA 2DA1A 3KP7A 5F04A 4M9XA 4NNJA 1NK3P 5L3FA 3MZYA 2YX7A 3H5RA 2VJJA 1LFPA 3AKZA 5HNHA 2VKVA 1TW2A 2NS0A 3ZN0A 2AS5F 1JI8A 4AWXB 3A03A 4HYEA 4YIFA 2PJRA 2VC0A 1HSTA 2DK8A 4LFUA 4MIMA 2PG4A 2PBIA 3L9FA 1MGTA 3TBIA 3ZGKA 1E3OC 2HYFA 4DQ2A 2LH9A 2WA0A 4R79A 2Y0SA 5H6QA 4M72A 4GFBA 2IXSA 1WVRA 3S3OA 3RPUD 2R5YB 5K5OA 1T95A 5K5RA 1Y1VJ 1FBQA 2KIQA 4I0AA 5F1JA 1E2XA 3TO9A 4A12A 1IUFA 2BY1A 2HWVA 4I09A 1T8IA 2KZVA 1YW8A 5HS7A 1F5TA 1WI9A 1N77A 4M6VA 3GW2A 2KKOA 2EA2A 5CLSA 3I64A 1OJLA 4JX6A 4LLNA 2P8TA 3VODA 2I5UA 1T6SA 3GTQJ 5BMZA 3OOUA 1ZLKA 3GFIA 3TDZC 1VQNI 5FRNA 3S3MA 5J6XA 3U2RA 5B5EC 1K4TA 2KIFA 4QSHA 1RPWA 5E17F 3SYTA 2QVOA 5E1ZB 1XGOA 2HQ5A 3RIRA 2V1XA 4PGHA 1BL0A 3HJEA 3RPUA 4EM2A 4A3KJ 3DXJF 1J7KA 1ZREA 5JR3A 4BHBA 1QRYA 1BJZA 3CCSI 5M3FJ 2DK5A 3SZGA 3P9KA 1EA3A 1YJWI 3ZQHA 3SHFA 3FZVA 2GAUA 1WHUA 2F5EA 4P9FA 3WG7H 1RR8C 2KFDA 2EFQA 1G8XA 1R22A 3H3ZA 4RAZA 3HEFA 5L3CA 3PL8A 3RYRA 3GLXA 1VQOI 3DU5A 4HSRA 3A2KA 3FXOA 1KU2A 2XGCA 1OMIA 2OTJI 5DS9A 1MBKA 1LQ1A 2EA4A 4PJLA 4XSZF 1OR7C 2HDDA 1IDZA 2ZXIA 3OYMA 2HVRA 2PX9A 3K1NA 5TISC 2WBMA 3I59A 2EIKH 4IOCF 3CDIA 1O3TA 1BA5A 5EZGA 2VPRA 3WTYC 1ODDA 3CCLI 2E1MB 2J5OA 2BOLA 2KMUA 1YLFA 1D1AA 2XSDC 3ZMDA 3L7WA 4FX0A 5DYMA 4MNUA 3PFYA 1ZHFA 3G73A 1P7JA 4UVCA 5GAEJ 1H89C 2HVSA 2V9KA 2ETHA 1ZR4A 1Y39A 3HZJA 4A93J 3KLNA 4ETSA 1GDTA 2EJRA 2DDAA 3DQVC 3CF2A 4DJAA 2Z16A 2LFBA 1W36C 3P5JA 2QKMB 3UR3C 2KRCA 1T08B 3K4LA 4N9HA 2L7FP 5GP9A 3I5UA 3WTUC 1V4RA 2HEOA 1A35A 1VFCA 4JX5A 4F92B 4KT5C 4L9JA 3E6MA 5ICGA 3OIOA 4PUSA 4XKBA 2QBYA 2A6HF 1XSDA 2CW0F 4CCKA 1L3LA 1D3YA 1T0FA 1ZR2A 1U8RA 1FY7A 3W6KB 2MH9A 2X6OA 2QBYB 2HR3A 3I3LA 1TWHJ 2ZFUA 4BQOA 4ESFA 1BI3A 3ESWB 4I02A 3OS0A 4CGZA 1D0YA 4RGSA 1LEBA 1G3WA 4KT6A 1MMNA 1OPCA 2A61A 1TLHB 3K1PA 2HZTA 4LD5A 4U88A 1VQ6I 1E3HA 4WCGA 3Q5FA 2MSYA 2OQRA 2CS3A 2A5WA 5ICCA 3RZDJ 1OFCX 1D0ZA 2H6BA 5E8GA 4AIHA 1F43A 3Q9VA 4EQQA 3K70C 3HUGA 1MBGA 5F27A 3JSOA 5HLTA 3LAJA 3RI4A 5KVRA 3AFHA 1WKMA 5DTDA 4B1RA 3IP4B 3OYBA 5J1RA 4ZDOA 4B44A 4RBOA 3GYHX 4D5CA 1BOAA 5K7HA 2L01A 3R61A 1GV5A 3CDHA 5HNFA 2M45A 3FMQA 1W1WE 1OCOH 1YX5A 4CCMA 4C3HJ 1KZHA 1Y8QB 1MJ9A 2KJBA 3AAFA 2CH0A 4KN7X 3HYIA 5LRSA 3TGNA 3ROUA 2QYOA 1RUNA 3BR6A 4AVPA 1XD7A 2NOGA 4LIUA 4IEJA 4Z6YA 4AYBN 2GA1A 4XKWA 1XSVA 3I4NJ 4KNYA 4KIBA 5E3OA 2EB7A 3HRMA 2XGDA 3AG4H 4NB5A 4R8HA 2JQ7A 4YFKF 1YI2I 2VC1A 3VB2A 5DM7F 2CU7A 3HOYJ 5K5QA 1YO5C 4C30A 2X1DA 2MC3A 1LPQA 2HDWA 2RREA 1TWAJ 4J00A 1JKPC 3P7NA 3ABUA 2LP0A 1CGPA 3KZYA 3E0JB 2MFZA 3PFIA 2QKLB 2HKOA 1P2FA 3A01B 3QYFA 2Y30A 2Y2ZA 2DOAA 2Y0SN 1IGNA 3AG1H 1WGXA 3FK6A 3RCOA 1WFXA 4D7NA 2DPUA 3P9IA 3IAS2 3OSFA 3V8KA 2EV6A 2VQLA 1ON1A 3GF2A 2KISA 3DLAA 4BUPA 1WJFA 3M8EA 4ZYAA 3TOBA 4BXFA 4MO7A 1HF0A 5D4SA 2P7CB 4BU2A 5FLXZ 3PJRA 2MD5A 4FQGA 3SQNA 1VQKI 1BIBA 3F6OA 3ZQCA 2Y31A 4XLFA 1VQLI 3T5XA 4E7HA 3NEUA 4YEJA 3HOZJ 2OJED 1Z77A 2HXIA 3PIPF 3WTZA 2WWYA 1O3RA 1ON2A 1W4MA 4Y13A 4HRIA 2ZSIB 1LB2A 4FE4A 2B0LA 4IF4A 2R5ZB 2DODA 1PVEA 1R1UA 3RZOJ 4HG2A 4EM1A 4OWRB 4JP0A 2JPBA 3Q0UA 3EUAA 2GLOA 2JA8J 2Y75A 2ID6A 1I6XA 4YIRX 5EGOA 2ISYA 1XS9A 2RC4A 2CUZA 4A3BJ 3DU6A 3RSNA 2VUMJ 5EDNA 1A6QA 3BTCA 2GM4A 2ID3A 3V8JA 4WK8F 1SFEA 3OS1A 1J75A 2P81A 4IKFA 2LKSA 4BEHA 2CQ7A 2D2WA 2EZKA 4ZYGA 1A5JA 4A3MJ 2TDXA 3HRTA 2WTEA 3ISPA 3LMMA 2KZGA 2NRAC 2YU9J 3CJRB 3GEZA 1BR2A 1I5ZA 5FKLA 3MD2A 2CQNA 4M9SA 3CUOA 1ZELA 3GXOA 3I9V2 1ZN2A 1U3EM 3J81Z 3GX4X 3G1OA 1JJ8C 2JA7J 1R71A 3I4MJ 2HTJA 2FX0A 2LF7A 2IRFG 3DEWA 1UFMA 4C3JJ 2BW3A 2G9WA 3QU3A 1XCBA 4GCVA 3BJOA 2VJIA 4HOBA 3HOXJ 2ELJA 1KA8A 2AO9A 2GA2A 3WG9A 1R5GA 5DDGA 4B48A 3HOSA 1TWCJ 5D6EA 3D1NI 2CV1A 3DP7A 2LREA 2R7DA 1U5TB 2GIZA 3ABTA 2HI3A 5TJJA 2ZMEC 2DYRH 1BC7C 3SDBA 2NVQJ 1Z9CA 2RQPA 3I0TA 1GUUA 3ZQLA 2AXTC 3KZIC 3HGGA 2DU9A 4A3GJ 2PN6A 4P1WA 3K4KA 3J7AY 3DF8A 1Y6IA 5DCMA 1R1TA 2M87A 3L00A 2DPDA 1D5YA 2BZTA 2FRHA 1IC8A 2IPQX 2L0KA 4V2FA 5DCMB 1X3ZB 3BT9A 2CWEA 2QUFA 2JA2A 4ENMA 2LD5A 2D45A 3FBIB 3WTVC 1KQ8A 2JTVA 2PFBA 1I3AA 4IOAF 3ASOH 1FX7A 4EEFG 5C44J 3CCVI 1HKSA 2Q1ZB
chains in the Genus database with same CATH topology
2HXOA 5GPCA 4JX4A 3Q0VA 5IP6A 3TEDA 1PUFB 4BXXJ 2LK2A 5C4XJ 1RETA 4CYCA 2CUEA 3JRGA 1ETXA 1POGA 3S2DJ 3ZQFA 2NVTJ 1WH5A 4LOCA 4W1UA 1AHDP 4FCYA 3UKGA 1RKTA 2CJJA 2JA5J 4W97A 3TP0A 3TW6A 3S1RJ 3LSRA 3BR1A 1LE8B 1ITYA 2B63J 2R5ZA 2JWTA 2DMNA 1RESA 2EH3A 3S15J 1ETOA 4DYRA 1FTZA 4BY7J 2DMUA 1ETYA 4BKXA 1I50J 3JRIA 2X48A 4B3AA 4DW6A 3BTLA 2DA6A 3PM1A 5IOYA 4IHXA 1ZTRA 2EBIA 1ENHA 1MH3A 1ZK8A 2TRTA 3CDLA 3S14J 1JT6A 2O7OA 3FIWA 2D5VA 3S1MJ 3QPLA 3SJMA 1QVUA 2DA1A 5F04A 3S2HJ 1TWGJ 3ZQGA 4BBSJ 1XC5A 1NK3P 2CQXA 3JRFA 2E2JJ 1SFOJ 4C2MJ 1P7IA 4BBRJ 2VKVA 4MFDA 4MLOA 1K83J 2L7ZA 2LLKA 1O4XA 3A03A 2M9HA 3S16J 4MIMA 1JTYA 5FJ8J 3HGYA 3W6VA 1R9TJ 5FLMJ 1EF4A 1E3OC 1ZQ3P 4UUSA 1SANA 1UG2A 4JYKA 1Y1WJ 4GFBA 2QF7A 3IH4A 2K9SA 1F36A 1AKHB 2R5YB 2JN6A 1HOMA 3JRDA 4D7MA 1Y1VJ 5F1JA 2JJ7A 3BQYA 1IG7A 1IUFA 5E3MA 4XRSG 2ELKA 4DYCA 1G2HA 3BTIA 4M6VA 4A3DJ 2QCOA 1OJLA 4JX6A 3HBLA 2NS7A 3GTJJ 3BQZA 2VI6A 3G1MA 3GTQJ 2NS8A 2JA6J 3OOUA 1AU7A 5FKKA 5IYCJ 3WHCA 4HNVA 4QSHA 1RPWA 3JRAA 4DZPA 2HQ5A 3FK7A 5IP9J 1BL0A 4A3KJ 2Y9YA 1QRYA 1BJZA 1JUMA 5E3NA 1ZKGA 1ETVA 5M3FJ 2LR8A 4RDUA 2VKEA 3HOVJ 4A3IJ 3ZQHA 2O8KA 5E3LA 2Y9ZA 5EF6A 5EZHA 1WH7A 2MG4A 2IEKA 5M5WJ 4QIWN 4A3FJ 3SDGA 5IPAA 1NTCA 4I76A 3MKLA 3HEFA 4Y7NJ 2XRLA 5FKNA 3C2BA 2E2IJ 5GPAA 3ZQIA 5EEAA 2XGCA 5DS9A 2R93J 1MBKA 2XPWA 1IDZA 2HDDA 1LE8A 2GBYA 3MN2A 2CUFA 3LSPA 1FTTA 4XRMA 1B72B 5BNGA 9ANTA 3ZOBA 2LVSA 1BA5A 5EZGA 2VPRA 3OSGA 1MH4A 4M3BA 4XIDA 2XSDC 2FD5A 5F0HA 2DMQA 1P7JA 1UHSA 1H89C 3JRBA 1JKOC 1B8IA 2CRGA 1ZR4A 3HB9A 3LNQA 4A93J 2XB0X 3PO3J 4Y52J 1FJLA 1GDTA 2DMPA 1ETQA 2LFBA 1B8IB 5GP9A 2L7FP 2CQQA 4MFEA 3CCYA 3WHBA 2LY9A 2DA7A 5J1UA 1VFCA 4JX5A 4ABZA 3CQZJ 4XRSA 3E7LA 3OIOA 3QPSA 3HOWJ 1I3QJ 2KT0A 2DA4A 2WV1A 4S0HB 4L5EA 1QVTA 2HOAA 1ZR2A 5FKOA 1IJWC 2E2HJ 2X6OA 2RAEA 1TWHJ 4A3EJ 1FIAA 2WB1N 5HODA 2TCTA 2LTPA 1GV2A 3Q3SA 4IHWA 2R7ZJ 1W0UA 2EZHA 1MSFC 3GTOJ 4A3LJ 2DTZA 3S1NJ 1AKHA 2R5YA 1FIPA 5EGOB 2XB5A 5FKMA 2R92J 1WCMJ 2MSYA 2ECBA 1DU0A 1JKQC 1U9OA 4BY1J 2EQRA 3RZDJ 1OFCX 1HDPA 1H88C 3GTPJ 3K2AA 5F08A 1F43A 2XGEA 1MBGA 3O8HA 4A69C 5F27A 1OCTC 3GTKJ 2NVYJ 1APLC 1RR7A 3O8GA 5DTDA 4B1RA 1ETWA 1JUSA 1LFBA 3GTMJ 3BR0A 2DA3A 4A3CJ 3JR9A 5J1RA 4RBOA 4M3EA 3B6AA 1MBHA 4NDLA 4D5CA 2ZB9A 3BR5A 5K7HA 1K61A 3H0GJ 1GV5A 3GTGJ 5C4JJ 5J1YA 2EZIA 5EG0A 1VF9A 4UUTA 3HKZN 4C3HJ 4FTHA 3HOUJ 3M4OJ 2I10A 4QTRA 3BR6A 2NOGA 4IEJA 4AYBN 1A6IA 5EG0B 2IAIA 3RKQA 1MNMC 2HYJA 3FKIJ 3I4NJ 2K9QA 2OPTA 3PO2J 1S7EA 4FE7A 2L7MP 5E3OA 1JUPA 2XGDA 3TP3A 1GT0C 3QQAA 3M3YJ 2CU7A 2MGQA 3HOYJ 1HDDC 5JLWA 1U8BA 2ME6A 1U78A 2O9LA 3IH2A 1YRNA 1TWAJ 1JKPC 1B72A 3JRHA 1HCRA 2LP0A 3VPRA 1BW5A 1TWFJ 3A01B 1GVDA 3G1LA 1MSEC 1Q1VA 3HDDA 2Y30A 5M5YJ 2Y2ZA 1YRNB 3FISA 4J19A 2Y0SN 1IGNA 1WGXA 3FK6A 2XPUA 5IYBJ 2M34A 4D7NA 5C3EJ 2E19A 3OSFA 1IV6A 2M2EA 1BW6A 1T56A 2H8RA 2OF7A 5K7ZA 2ECCA 4XICA 2MW8A 4IHVA 3JREA 4MO7A 1HF0A 1ORKA 1T33A 1JTXA 4I6ZA 2XPVA 1NK2P 3JRCA 3BR2A 4CYCB 2KDZA 5M3MJ 2HOSA 1W0TA 1IDYA 3GBGA 1QPIA 1VNDA 4M3DA 4V2GA 4AUXA 3ZQCA 2Y31A 1ETKA 4X6AJ 5IOZA 2EZLA 1U9NA 3IV5A 3HOZJ 1FEXA 1Z77A 2HXIA 2JK3A 3SFIA 2X9DA 5IP7J 3IH3A 5FLVA 4FE4A 2R5ZB 1JKRC 1DU6A 1UMQA 3RZOJ 2G0EA 2FJ1A 4JP0A 3Q0UA 4C3IJ 2YS9A 2GLOA 2JA8J 5M5XJ 1LFUP 2ID6A 3GTLJ 5EGOA 1XS9A 3L1PA 3S17J 4A3BJ 3BR3A 2VUMJ 3BTJA 5EDNA 3BTCA 2GM4A 4A3JJ 2ID3A 3S1QJ 1XG1A 2P81A 2K40A 4IHYA 3B6CA 3CMYA 3BG5A 4DZJA 2EZKA 5JLXA 2FQ4A 3Q0WA 4A3MJ 1A5JA 1JGGA 2YU9J 4D5FA 1H8AC 5FKLA 2H1KA 4M3GA 3G1OA 1JJ8C 2ME0A 4G12A 2JA7J 3I4MJ 2K9NA 2DJNA 2FX0A 3DEWA 2E1OA 1WPKA 4C3JJ 1I6HJ 1MBFA 2NVXJ 1VI0A 1X58A 3RQIA 3HOXJ 4UUSB 2AO9A 5EYRA 3BG3A 3TW7A 4AC0A 2COBA 2L9RA 2R0QC 2YUSA 2M0CA 1TWCJ 2PMZN 4B4CA 1X2MA 3D1NI 1RKWA 2DA2A 2HI3A 4FISA 2NVQJ 4X1EA 1Z0XA 3H3VK 1GUUA 3ZQLA 2IBDA 3HGGA 4A3GJ 1OCPA 3LOCA 5K7FA 2DA5A 3NAUA 4XK4A 1JJ6C 1ZGWA 5F0FA 3K7AJ 5F0CA 1D5YA 1IC8A 3A01A 4DYQA 3DCFA 2L0KA 4V2FA 1MBJA 2HOTA 3HM5A 5IYDJ 2WAQN 1CQTA 3BT9A 2N8GA 2W48A 2LD5A 1JT0A 3F0CA 1WI3A 2JMWA 3A02A 3BG9A 3MVPA 2AHQA 2LKXA 5J3LA 2DMTA 1MBEA 1HLVA 3LSGA 1PUFA 1X2NA 3LSJA 5C44J 4EEFG 3NARA 4M3FA 2DN0A 1IRZA 2M8GX 1TC3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HXO A;  5GPC A;  4JX4 A;  3Q0V A;  5IP6 A;  3TED A;  1PUF B;  4BXX J;  2LK2 A;  5C4X J;  1RET A;  4CYC A;  2CUE A;  3JRG A;  1ETX A;  1POG A;  3S2D J;  3ZQF A;  2NVT J;  1WH5 A;  4LOC A;  4W1U A;  1AHD P;  4FCY A;  3UKG A;  1RKT A;  2CJJ A;  2JA5 J;  4W97 A;  3TP0 A;  3TW6 A;  3S1R J;  3LSR A;  3BR1 A;  1LE8 B;  1ITY A;  2B63 J;  2R5Z A;  2JWT A;  2DMN A;  1RES A;  2EH3 A;  3S15 J;  1ETO A;  4DYR A;  1FTZ A;  4BY7 J;  2DMU A;  1ETY A;  4BKX A;  1I50 J;  3JRI A;  2X48 A;  4B3A A;  4DW6 A;  3BTL A;  2DA6 A;  3PM1 A;  5IOY A;  4IHX A;  1ZTR A;  2EBI A;  1ENH A;  1MH3 A;  1ZK8 A;  2TRT A;  3CDL A;  3S14 J;  1JT6 A;  2O7O A;  3FIW A;  2D5V A;  3S1M J;  3QPL A;  3SJM A;  1QVU A;  2DA1 A;  5F04 A;  3S2H J;  1TWG J;  3ZQG A;  4BBS J;  1XC5 A;  1NK3 P;  2CQX A;  3JRF A;  2E2J J;  1SFO J;  4C2M J;  1P7I A;  4BBR J;  2VKV A;  4MFD A;  4MLO A;  1K83 J;  2L7Z A;  2LLK A;  1O4X A;  3A03 A;  2M9H A;  3S16 J;  4MIM A;  1JTY A;  5FJ8 J;  3HGY A;  3W6V A;  1R9T J;  5FLM J;  1EF4 A;  1E3O C;  1ZQ3 P;  4UUS A;  1SAN A;  1UG2 A;  4JYK A;  1Y1W J;  4GFB A;  2QF7 A;  3IH4 A;  2K9S A;  1F36 A;  1AKH B;  2R5Y B;  2JN6 A;  1HOM A;  3JRD A;  4D7M A;  1Y1V J;  5F1J A;  2JJ7 A;  3BQY A;  1IG7 A;  1IUF A;  5E3M A;  4XRS G;  2ELK A;  4DYC A;  1G2H A;  3BTI A;  4M6V A;  4A3D J;  2QCO A;  1OJL A;  4JX6 A;  3HBL A;  2NS7 A;  3GTJ J;  3BQZ A;  2VI6 A;  3G1M A;  3GTQ J;  2NS8 A;  2JA6 J;  3OOU A;  1AU7 A;  5FKK A;  5IYC J;  3WHC A;  4HNV A;  4QSH A;  1RPW A;  3JRA A;  4DZP A;  2HQ5 A;  3FK7 A;  5IP9 J;  1BL0 A;  4A3K J;  2Y9Y A;  1QRY A;  1BJZ A;  1JUM A;  5E3N A;  1ZKG A;  1ETV A;  5M3F J;  2LR8 A;  4RDU A;  2VKE A;  3HOV J;  4A3I J;  3ZQH A;  2O8K A;  5E3L A;  2Y9Z A;  5EF6 A;  5EZH A;  1WH7 A;  2MG4 A;  2IEK A;  5M5W J;  4QIW N;  4A3F J;  3SDG A;  5IPA A;  1NTC A;  4I76 A;  3MKL A;  3HEF A;  4Y7N J;  2XRL A;  5FKN A;  3C2B A;  2E2I J;  5GPA A;  3ZQI A;  5EEA A;  2XGC A;  5DS9 A;  2R93 J;  1MBK A;  2XPW A;  1IDZ A;  2HDD A;  1LE8 A;  2GBY A;  3MN2 A;  2CUF A;  3LSP A;  1FTT A;  4XRM A;  1B72 B;  5BNG A;  9ANT A;  3ZOB A;  2LVS A;  1BA5 A;  5EZG A;  2VPR A;  3OSG A;  1MH4 A;  4M3B A;  4XID A;  2XSD C;  2FD5 A;  5F0H A;  2DMQ A;  1P7J A;  1UHS A;  1H89 C;  3JRB A;  1JKO C;  1B8I A;  2CRG A;  1ZR4 A;  3HB9 A;  3LNQ A;  4A93 J;  2XB0 X;  3PO3 J;  4Y52 J;  1FJL A;  1GDT A;  2DMP A;  1ETQ A;  2LFB A;  1B8I B;  5GP9 A;  2L7F P;  2CQQ A;  4MFE A;  3CCY A;  3WHB A;  2LY9 A;  2DA7 A;  5J1U A;  1VFC A;  4JX5 A;  4ABZ A;  3CQZ J;  4XRS A;  3E7L A;  3OIO A;  3QPS A;  3HOW J;  1I3Q J;  2KT0 A;  2DA4 A;  2WV1 A;  4S0H B;  4L5E A;  1QVT A;  2HOA A;  1ZR2 A;  5FKO A;  1IJW C;  2E2H J;  2X6O A;  2RAE A;  1TWH J;  4A3E J;  1FIA A;  2WB1 N;  5HOD A;  2TCT A;  2LTP A;  1GV2 A;  3Q3S A;  4IHW A;  2R7Z J;  1W0U A;  2EZH A;  1MSF C;  3GTO J;  4A3L J;  2DTZ A;  3S1N J;  1AKH A;  2R5Y A;  1FIP A;  5EGO B;  2XB5 A;  5FKM A;  2R92 J;  1WCM J;  2MSY A;  2ECB A;  1DU0 A;  1JKQ C;  1U9O A;  4BY1 J;  2EQR A;  3RZD J;  1OFC X;  1HDP A;  1H88 C;  3GTP J;  3K2A A;  5F08 A;  1F43 A;  2XGE A;  1MBG A;  3O8H A;  4A69 C;  5F27 A;  1OCT C;  3GTK J;  2NVY J;  1APL C;  1RR7 A;  3O8G A;  5DTD A;  4B1R A;  1ETW A;  1JUS A;  1LFB A;  3GTM J;  3BR0 A;  2DA3 A;  4A3C J;  3JR9 A;  5J1R A;  4RBO A;  4M3E A;  3B6A A;  1MBH A;  4NDL A;  4D5C A;  2ZB9 A;  3BR5 A;  5K7H A;  1K61 A;  3H0G J;  1GV5 A;  3GTG J;  5C4J J;  5J1Y A;  2EZI A;  5EG0 A;  1VF9 A;  4UUT A;  3HKZ N;  4C3H J;  4FTH A;  3HOU J;  3M4O J;  2I10 A;  4QTR A;  3BR6 A;  2NOG A;  4IEJ A;  4AYB N;  1A6I A;  5EG0 B;  2IAI A;  3RKQ A;  1MNM C;  2HYJ A;  3FKI J;  3I4N J;  2K9Q A;  2OPT A;  3PO2 J;  1S7E A;  4FE7 A;  2L7M P;  5E3O A;  1JUP A;  2XGD A;  3TP3 A;  1GT0 C;  3QQA A;  3M3Y J;  2CU7 A;  2MGQ A;  3HOY J;  1HDD C;  5JLW A;  1U8B A;  2ME6 A;  1U78 A;  2O9L A;  3IH2 A;  1YRN A;  1TWA J;  1JKP C;  1B72 A;  3JRH A;  1HCR A;  2LP0 A;  3VPR A;  1BW5 A;  1TWF J;  3A01 B;  1GVD A;  3G1L A;  1MSE C;  1Q1V A;  3HDD A;  2Y30 A;  5M5Y J;  2Y2Z A;  1YRN B;  3FIS A;  4J19 A;  2Y0S N;  1IGN A;  1WGX A;  3FK6 A;  2XPU A;  5IYB J;  2M34 A;  4D7N A;  5C3E J;  2E19 A;  3OSF A;  1IV6 A;  2M2E A;  1BW6 A;  1T56 A;  2H8R A;  2OF7 A;  5K7Z A;  2ECC A;  4XIC A;  2MW8 A;  4IHV A;  3JRE A;  4MO7 A;  1HF0 A;  1ORK A;  1T33 A;  1JTX A;  4I6Z A;  2XPV A;  1NK2 P;  3JRC A;  3BR2 A;  4CYC B;  2KDZ A;  5M3M J;  2HOS A;  1W0T A;  1IDY A;  3GBG A;  1QPI A;  1VND A;  4M3D A;  4V2G A;  4AUX A;  3ZQC A;  2Y31 A;  1ETK A;  4X6A J;  5IOZ A;  2EZL A;  1U9N A;  3IV5 A;  3HOZ J;  1FEX A;  1Z77 A;  2HXI A;  2JK3 A;  3SFI A;  2X9D A;  5IP7 J;  3IH3 A;  5FLV A;  4FE4 A;  2R5Z B;  1JKR C;  1DU6 A;  1UMQ A;  3RZO J;  2G0E A;  2FJ1 A;  4JP0 A;  3Q0U A;  4C3I J;  2YS9 A;  2GLO A;  2JA8 J;  5M5X J;  1LFU P;  2ID6 A;  3GTL J;  5EGO A;  1XS9 A;  3L1P A;  3S17 J;  4A3B J;  3BR3 A;  2VUM J;  3BTJ A;  5EDN A;  3BTC A;  2GM4 A;  4A3J J;  2ID3 A;  3S1Q J;  1XG1 A;  2P81 A;  2K40 A;  4IHY A;  3B6C A;  3CMY A;  3BG5 A;  4DZJ A;  2EZK A;  5JLX A;  2FQ4 A;  3Q0W A;  4A3M J;  1A5J A;  1JGG A;  2YU9 J;  4D5F A;  1H8A C;  5FKL A;  2H1K A;  4M3G A;  3G1O A;  1JJ8 C;  2ME0 A;  4G12 A;  2JA7 J;  3I4M J;  2K9N A;  2DJN A;  2FX0 A;  3DEW A;  2E1O A;  1WPK A;  4C3J J;  1I6H J;  1MBF A;  2NVX J;  1VI0 A;  1X58 A;  3RQI A;  3HOX J;  4UUS B;  2AO9 A;  5EYR A;  3BG3 A;  3TW7 A;  4AC0 A;  2COB A;  2L9R A;  2R0Q C;  2YUS A;  2M0C A;  1TWC J;  2PMZ N;  4B4C A;  1X2M A;  3D1N I;  1RKW A;  2DA2 A;  2HI3 A;  4FIS A;  2NVQ J;  4X1E A;  1Z0X A;  3H3V K;  1GUU A;  3ZQL A;  2IBD A;  3HGG A;  4A3G J;  1OCP A;  3LOC A;  5K7F A;  2DA5 A;  3NAU A;  4XK4 A;  1JJ6 C;  1ZGW A;  5F0F A;  3K7A J;  5F0C A;  1D5Y A;  1IC8 A;  3A01 A;  4DYQ A;  3DCF A;  2L0K A;  4V2F A;  1MBJ A;  2HOT A;  3HM5 A;  5IYD J;  2WAQ N;  1CQT A;  3BT9 A;  2N8G A;  2W48 A;  2LD5 A;  1JT0 A;  3F0C A;  1WI3 A;  2JMW A;  3A02 A;  3BG9 A;  3MVP A;  2AHQ A;  2LKX A;  5J3L A;  2DMT A;  1MBE A;  1HLV A;  3LSG A;  1PUF A;  1X2N A;  3LSJ A;  5C44 J;  4EEF G;  3NAR A;  4M3F A;  2DN0 A;  1IRZ A;  2M8G X;  1TC3 C; 
#chains in the Genus database with same CATH topology
 2UV1 A;  4HBL A;  3E5U A;  2OA4 A;  2Z99 A;  2XSJ C;  5IP6 A;  2DT5 A;  1ZLJ A;  3OYG A;  3GZ6 A;  4RB0 A;  4KIC A;  4CYC A;  2CUE A;  2IA2 A;  1IUY A;  3BG7 A;  2ISZ A;  1POG A;  2V7F A;  1XMA A;  2QZ8 A;  4PFP A;  4HX8 A;  2EK5 A;  3M8F A;  2KL4 A;  1VQ4 I;  4PGG A;  4RAY A;  3UKG A;  1S29 A;  1RKT A;  3RKY A;  5JI6 A;  2JA5 J;  4I98 B;  2BHZ A;  1KU3 A;  3NWT A;  2K9L A;  3DTI A;  4FET A;  1K7A A;  2EH3 A;  4NC8 A;  3JAM Z;  1ETO A;  2G7U A;  4HZF A;  4XOR A;  4OIQ F;  3UNG C;  5CVV A;  5AIQ A;  2FEZ A;  3BDD A;  4YII A;  4BY7 J;  3OMY A;  1ETY A;  5B1A H;  3AL0 B;  1I50 J;  1SEU A;  4B3A A;  2DA6 A;  1Y8R B;  3QOE A;  4N0B A;  2ESH A;  1XN7 A;  3HKZ A;  2OCC H;  4IHX A;  4J01 A;  1ZTR A;  1VQP I;  1U0J A;  3I58 A;  4PDK A;  2EBI A;  1MH3 A;  2TRT A;  1UHM A;  2EFP A;  4NHJ A;  3KEY A;  1JT6 A;  2O7O A;  1G3S A;  3FIW A;  3H36 A;  4PJ0 C;  2D5V A;  4WX9 A;  3QPL A;  1WJD A;  3WTW C;  2VT2 A;  3KET A;  4HX4 A;  1SFX A;  2KPM A;  1LVA A;  3H0D A;  2EV0 A;  2F4O B;  4BBS J;  4QPQ A;  1XC5 A;  2LY1 A;  2ZNZ A;  2RN7 A;  3OR2 C;  5ILU A;  3D5S C;  3IHU A;  1AOY A;  4CZC A;  1LUJ B;  4U7B A;  1K83 J;  2V6C A;  2LLK A;  1YIT I;  2L9N A;  1D8K A;  1O4X A;  3IWZ A;  4TV7 A;  3VWB A;  2FU4 A;  2M9H A;  3EPZ A;  3K69 A;  4AIK A;  3M7G A;  3S16 J;  4E7K A;  3HGY A;  5DUK A;  2F4I A;  5LEK A;  4UV9 A;  1K79 A;  4UUS A;  2LKP A;  1SAN A;  4OAZ A;  1Y1W J;  2R7O A;  3L09 A;  1DPU A;  2XVC A;  2GZW A;  1S9H A;  2QF7 A;  2OU2 A;  3G2B A;  1B9M A;  1AKH B;  2VKH A;  3IKT A;  4D1Q A;  4C9Y A;  1TL8 A;  1MND A;  4D7M A;  2ZJ2 A;  1R36 A;  3IRQ A;  3LSM A;  4YFN F;  1G59 A;  2JJ7 A;  3QYB A;  2PEX A;  4XRS G;  3HSE A;  1G2H A;  4DYC A;  4EAT A;  2VOP A;  4X0G A;  3WTS C;  3C2H A;  3R0A A;  4BDY A;  3WGH A;  2OD5 A;  2WV0 A;  5HDG A;  2VPL A;  1R49 A;  3GTJ J;  3CUQ A;  4UVA A;  5CJ9 A;  3BQZ A;  2NOJ B;  4M6Y A;  3OYE A;  1J59 A;  3A0H C;  5J4V A;  3ZPL A;  4CHU A;  2A68 F;  2R7R A;  1F1Z A;  2MD0 A;  4YEL A;  5FKK A;  3FXJ A;  4XLH A;  2PLY A;  2ZC2 A;  1D8J A;  5FRO A;  2MBF A;  4HNV A;  5E79 C;  2IGK A;  1QZE A;  2OCE A;  4ZTF A;  4MTD A;  2Y9Y A;  3ZP5 A;  5LHG A;  5E3N A;  3W2A A;  1ETV A;  2MH2 A;  2A6T A;  2PJP A;  2VKE A;  3S32 A;  5IT9 Z;  2O03 A;  2R7T A;  4A3I J;  5F1R A;  2Y9Z A;  5EZH A;  1WH7 A;  3MWM A;  4EJT A;  1X1A A;  5M5W J;  5B66 C;  2HTS A;  2AQE A;  1NTC A;  2QSH X;  5HLI A;  2V1D A;  5LLQ A;  4OMY A;  5GPA A;  4GRI A;  3EQL F;  4JBA A;  4EMS A;  3OY9 A;  4I99 C;  2D1H A;  2E34 A;  5TGT A;  2E7W A;  2K9M A;  2XPW A;  5KHD A;  4HQE A;  3IWF A;  3LQR A;  2GBY A;  3MN2 A;  2CUF A;  2UWM A;  1B4A A;  1EV7 A;  4I2O A;  2M30 A;  2KDO A;  3U1K A;  2BXY A;  1ZRF A;  1XX5 A;  2EIL H;  4RGX A;  1FC3 A;  4KUM A;  1UHS A;  3SEZ A;  1JKO C;  3CP8 A;  1B8I A;  1NH3 A;  3V7C A;  2JSP A;  3KYD B;  4M71 A;  4CIC A;  2DCE A;  1N75 A;  1IW7 F;  3HB9 A;  3OL3 A;  4MEY F;  1USS A;  4II2 A;  3OYN A;  3PO3 J;  3E5X A;  1BN5 A;  3VFZ A;  3P9C A;  3ZMU A;  1ETQ A;  3NRV A;  4ESB A;  1B8I B;  1ZRD A;  1MDM B;  5FO5 A;  4ITV A;  5D8L B;  4MFE A;  4BAC A;  3CCY A;  3RYP A;  2IS2 A;  3HSF A;  2RNJ A;  4ABZ A;  5EJC A;  4MQ9 F;  3FXK A;  4NQW B;  3AG2 H;  4ZC3 A;  1I3Q J;  4ON0 A;  4XLP F;  2QA4 I;  2DA4 A;  3DEU A;  3FMR A;  5JVG F;  5BOX A;  4L5E A;  1JE8 A;  2E5Z A;  5GTH C;  2HOA A;  5FKO A;  2E2H J;  3LSK A;  5EEH A;  2RAE A;  2IA1 A;  1G3Y A;  2FML A;  2E36 A;  2WAQ A;  4L18 B;  1HW1 A;  2VE9 A;  3LSH A;  4Y4R A;  5HDN A;  3N97 A;  1MSF C;  1W7P D;  2Y0M A;  5IY5 H;  1T0F C;  2R5Y A;  3LFK A;  3PQJ A;  1MNE A;  5FD5 A;  1HC8 A;  5JVT A;  1SVM A;  2ECB A;  2JZY A;  3FHN A;  5D5W B;  4U87 A;  4N4O B;  3GLL A;  4LMY A;  2EQR A;  2STT A;  4JK1 X;  2HYG D;  1R5I D;  5JFR A;  2BE5 F;  3K2A A;  1Q1H A;  5J8F A;  6PAX A;  2G7H A;  3J80 K;  4A69 C;  2YR2 A;  2NVY J;  3F8B A;  1APL C;  2R4G A;  3ABL H;  1RR7 A;  2FNA A;  3K4B A;  4BQA A;  3F21 A;  1UCR A;  1X1D A;  1LFB A;  3GFJ A;  5E1W A;  2BYV E;  3CO6 C;  1D1B A;  4ANJ A;  4L0Z B;  3EUK L;  1YW7 A;  3E3V A;  1K78 A;  3ERM A;  1VQM I;  1YTY A;  5ICE A;  2DOE A;  2P5V A;  1W7P A;  1UAA A;  1QU3 A;  2UUZ A;  3H0G J;  3F9K A;  3HSR A;  1HKQ A;  3BP8 A;  5J1Y A;  3HTU A;  2BV6 A;  4MQV A;  4B09 A;  3MKW B;  1K78 B;  5EG0 A;  2ADU A;  4UUT A;  3HKZ N;  1BM9 A;  1W7P B;  1Z05 A;  2HZD A;  3R60 A;  2FF4 A;  2EFW A;  4L9N A;  4HF0 A;  3HOU J;  3ECH A;  3HIF A;  2I10 A;  1Z1D A;  4Q5S F;  1S72 I;  1RZ4 A;  1A31 A;  5EG0 B;  2IAI A;  1VZ0 A;  2AXL A;  2HYJ A;  1MNM C;  2Q8K A;  1MJB A;  2K9Q A;  2X1E A;  3PO2 J;  4FE7 A;  1JUP A;  2L54 A;  1WJA A;  2BVM A;  4KMU X;  1GT0 C;  3QQA A;  3VYS B;  5L3B A;  1X19 A;  2MGQ A;  4WXH A;  4CSW A;  1QO0 D;  4CA0 A;  1FZP B;  2UXN A;  1MMD A;  4HV5 A;  1U78 A;  2CV2 A;  2O9L A;  3RKW A;  3MAJ A;  4LK1 F;  3G1L A;  1ULY A;  1Q1V A;  4E7J A;  5M5Y J;  3S2W A;  1VQ8 I;  3FIS A;  3HXL A;  3WOD F;  2DW4 A;  2Z3Y A;  5LFA A;  2XPU A;  4QPO A;  2QM3 A;  3C3W A;  3L2C A;  5HDK A;  1BW6 A;  2DFF A;  2VIX A;  4YFX F;  1LDJ A;  2HU9 A;  1ERD A;  1T56 A;  4LIV A;  4II3 A;  2KRH A;  2MW8 A;  3BZC A;  1X1B A;  1WQ2 A;  2GQQ A;  4MGR A;  1ORK A;  1P4W A;  1JTX A;  1XMX A;  1HW2 A;  2X6W A;  3JRC A;  1SVO A;  2KDZ A;  2DFI A;  1QHG A;  3NWS A;  4XMY A;  3MZH A;  4IVN A;  1Z7U A;  3GBG A;  3EUH C;  4L0Y B;  4PSW A;  2WAD A;  3OYJ A;  4M3D A;  1ETK A;  4UXN A;  4HLY A;  1TT0 A;  2DJI A;  1FEX A;  4DIQ A;  3K6G A;  2BHY A;  2BEO A;  2X9D A;  4Y33 A;  3H5N A;  5FGM A;  4DBR A;  1YHQ I;  2YPR A;  3CLO A;  4PCQ A;  5HOO A;  3R4K A;  1C0W A;  1DU6 A;  4IO9 F;  4KDP A;  1UMQ A;  1Y0U A;  2O3F A;  2V4J C;  3DKY A;  1DDN A;  2G0E A;  4C3I J;  2H94 A;  2XC7 A;  2L4A A;  2YS9 A;  5BQT A;  2QEN A;  3VYT B;  5M5X J;  1LFU P;  5AON A;  2IW5 A;  4CCL A;  2QLZ A;  2OBP A;  3BR3 A;  3FX3 A;  2XAH A;  3GME A;  3CJT B;  4A3J J;  4LLG F;  3S1Q J;  3M9A A;  1J5Y A;  1X3U A;  1XG1 A;  2M3A A;  4KIF A;  4CUG A;  2F48 A;  1UEL B;  3B6C A;  1LVK A;  2X1C A;  4BHC A;  2LSO A;  4DZJ A;  3C2G A;  5JLX A;  2FQ4 A;  3DPT A;  2M8E A;  3W6J B;  4ZYH A;  3BZ6 A;  4HQM A;  2VBX A;  3DFG A;  4LGW A;  2H8W A;  1WWX A;  2GOX B;  4LJZ F;  3JCU C;  3DBL B;  2Y48 A;  4LK0 F;  3COA C;  2XIG A;  4WWC A;  1SVL A;  1A04 A;  3HTS B;  3ZXS A;  3SXY A;  3MQ0 A;  1JHH A;  4IRG A;  2COM A;  2MAB A;  3DEE A;  1DQU A;  1MBF A;  4QWQ A;  5LHI A;  1X58 A;  4UVB A;  3RQI A;  4RGU A;  3RQ4 A;  2V79 A;  1QBJ A;  2E1N A;  4AID A;  2KRF A;  4AC0 A;  2COB A;  2R0Q C;  4UB8 C;  2M0C A;  1OYY A;  1X2M A;  4IQ4 A;  2DQL A;  5H20 A;  4JQF A;  4E6K G;  2J5P A;  2DA2 A;  2FQ3 A;  3CO7 C;  3PSF A;  1O7F A;  1BI0 A;  1S6L A;  1IN6 A;  3CMM A;  4FIS A;  2IS6 A;  4X1E A;  1Z0X A;  2FMY A;  2QGU A;  5D6F A;  3H3V K;  2X85 A;  4LLL A;  4BJ5 C;  2OV7 A;  1OCZ H;  1TBX A;  1ZH5 A;  1LKX A;  3VYU B;  4IXA A;  5DD8 A;  3W3C A;  2DOF A;  1TTY A;  1L0O C;  1MW7 A;  2DA5 A;  3BC8 A;  3NAU A;  4XK4 A;  1ZGW A;  4I7H A;  5F0C A;  2FNP A;  3A01 A;  5GAH J;  2I8D A;  5GAD J;  4ZYE A;  1HQC A;  2HOT A;  3HM5 A;  3TDU C;  2WAQ N;  3KEO A;  3KX2 A;  3MKY B;  1CQT A;  5IYD J;  1AA7 A;  2O0Y A;  1F4K A;  1GLN A;  4M74 A;  5DEQ A;  4AM3 A;  3MVP A;  3O3K A;  1BIA A;  2LKX A;  1SD7 A;  1W36 D;  5J3L A;  1MBE A;  1V3F A;  1FOW A;  3F23 A;  3IC7 A;  2JT1 A;  4XN3 A;  1FYL A;  4M3F A;  3ZN1 A;  4EJV A;  3OS2 A;  1IRZ A;  1TC3 C;  2RQQ A;  4IPA A;  4EV0 A;  2HXO A;  4F3Q A;  4GDF A;  3HG9 A;  4BH9 A;  4BXX J;  4CYD A;  1SD6 A;  2LK2 A;  1RET A;  2R7U A;  1TQP A;  3W2V A;  1YX3 A;  3S2D J;  1OLT A;  4OIP F;  2CQK A;  2DAO A;  1WH5 A;  3QWL A;  3OYL A;  4W1U A;  2PI0 A;  1AHD P;  1IN7 A;  2OZ6 A;  1R5H A;  2ZBK A;  3TP0 A;  3TW6 A;  2WAE A;  2CFX A;  1S7O A;  1LE8 B;  2R5Z A;  3V42 A;  3U21 A;  1RES A;  2W1O A;  3F3X A;  4KMF A;  4GO1 A;  4MHG A;  1FTZ A;  4XON A;  1ZAR A;  2VKD A;  4BKX A;  2KQR A;  3JRI A;  2X48 A;  1YOV B;  3K70 D;  3BTL A;  3EDP A;  1M1E B;  1R1V A;  2VJ4 A;  3S3N A;  2K27 A;  3PM1 A;  3JTG A;  1I27 A;  2VQG A;  1W5T A;  2Z2S B;  2EFN A;  4UB6 C;  4YRV A;  4KYW A;  4XLC A;  3CCU I;  1SMT A;  3ONQ A;  1ENH A;  2KP6 A;  3CDL A;  1WJ5 A;  3S14 J;  3FBN B;  4N9I A;  4L9V A;  2HOE A;  3S1M J;  3ULQ B;  4ENK A;  1O3Q A;  1J09 A;  1CF7 B;  2DI3 A;  5JHF A;  3S2H J;  3ZQG A;  4BQQ A;  1O57 A;  2EFO A;  1P4X A;  2QQ8 A;  3OL4 A;  2E2J J;  4OIN F;  1SFO J;  3QP5 A;  4BYY A;  1P7I A;  4BBR J;  3SZT A;  1GXP A;  2XV4 S;  3PIO F;  2VLA A;  4AD9 A;  2DTR A;  1N78 A;  3RTR A;  5FD6 A;  4EVI A;  3WU1 B;  1RRJ A;  2AQF A;  3J7Y J;  3WE2 A;  1EF4 A;  2F5V A;  1KU9 A;  1Y0N A;  2UXX A;  4XM3 A;  4OMZ A;  2EIJ H;  5DM6 F;  4KFC A;  1UG2 A;  4V19 K;  2LOO A;  2CW7 A;  2IJL A;  2K9S A;  3JTH A;  4CCO A;  2CSO A;  1U5T A;  4YG2 F;  4CH7 A;  2JN6 A;  3FXL A;  5KNL A;  3JRD A;  1O3S A;  3KP2 A;  3BQY A;  4L5I A;  5E3M A;  2O6G E;  2Z33 A;  2VE8 A;  4RM3 A;  1SAX A;  1KU7 A;  2K4B A;  3ELK A;  1OIS A;  4ZDL A;  1UG0 A;  3HBL A;  4U0W A;  2NS7 A;  5GAG J;  1YYV A;  5LBQ A;  2STW A;  1KQ0 A;  4H0E A;  3EYY A;  4RA2 A;  3HL2 A;  1VTN C;  2XF7 A;  2NS8 A;  3VSL A;  1ZRC A;  2F4M B;  1AU7 A;  1I1S A;  4BE0 A;  4BNC A;  5IYC J;  2M0M A;  4A6D A;  3CCR I;  3WHC A;  2CG4 A;  3BG6 A;  1DP7 P;  3FK7 A;  5IP9 J;  1E0E A;  2XGX A;  2W7N A;  1H0M A;  3CUQ C;  1S3J A;  3OOP A;  2LR8 A;  4PSX A;  3B02 A;  1REP C;  2XKO A;  1I1G A;  4HX7 A;  2O8K A;  2EIM H;  4CXF A;  5EF6 A;  1OQY A;  1W5S A;  5IT3 A;  2CO5 A;  3DKW A;  3Q9S A;  2E1C A;  1R4M B;  4CDG A;  2DLL A;  2IVM A;  4XLA A;  3TO7 A;  5A2Q Z;  4BL0 B;  2XRL A;  5FKN A;  4E7S A;  3TL4 X;  3FXU A;  4O3M A;  3HC7 A;  5EEA A;  3I56 I;  2Q2E B;  1YS7 A;  2R93 J;  2V1U A;  1DGW Y;  4GYI A;  5D4R A;  3LSP A;  3MKZ A;  3CCQ I;  4XRM A;  1FTT A;  2ZNY A;  1B72 B;  2LVS A;  1J9I A;  4UY8 I;  2FBK A;  1IXS B;  1MH4 A;  3ABM H;  2RDP A;  4M3B A;  4HF1 A;  4ENN A;  3LA3 A;  5HS9 A;  5FB2 A;  2FD5 A;  2RGV A;  1SD5 A;  2E60 A;  2ICW G;  3QPH A;  3JRB A;  1QHH D;  2VAS A;  1A36 A;  3PNT A;  3DLL F;  1QQI A;  1T39 A;  1NG7 A;  3BJA A;  3LNQ A;  2R7V A;  1WRJ A;  3L2U A;  2DXI A;  4RB2 C;  5LRR A;  2HPM A;  1FJL A;  3HOT A;  1IN4 A;  2FOW A;  4Q4Z F;  2ZSH B;  2Z1D A;  2CQQ A;  3CJN A;  3ZCO A;  3K9T A;  3WHB A;  2LY9 A;  1B59 A;  2DA7 A;  2JSC A;  3CQZ J;  3K4N A;  4XRS A;  3E7L A;  5CVI A;  1DUX C;  1E17 A;  1RI7 A;  3HOW J;  3GUD A;  4A0Z A;  3LA7 A;  2KT0 A;  3FF5 A;  2WV1 A;  2ZFW A;  4S0H B;  4EM0 B;  1QA6 A;  1D0X A;  4C2T A;  3PNV A;  5E20 A;  5CVU A;  1IJW C;  1V5G A;  5KK1 A;  3QU6 A;  1FIA A;  2XDV A;  4F91 B;  3DTE A;  3HRU A;  5HOD A;  2TCT A;  3H9J A;  1GV2 A;  3ZMT A;  3Q3S A;  4IHW A;  5A2Q K;  2R7Z J;  2EZH A;  1STZ A;  4LG3 A;  4A3L J;  1YG2 A;  1AKH A;  3ERE D;  1FIP A;  2FSW A;  3QYE A;  5FKM A;  2PMH A;  4BQN A;  4MTE A;  2MYS A;  3KP5 A;  5KAF C;  1BR1 A;  1GVJ A;  2O61 A;  1JKQ C;  2IS1 A;  5BS6 A;  4BY1 J;  2VON A;  1DGR M;  1P6R A;  4P9U A;  1IAW A;  1U6G A;  1HDP A;  2F5C A;  1H88 C;  5F08 A;  2W25 A;  3I53 A;  4RLQ A;  4I0B A;  4LB5 A;  1KGS A;  3QP6 A;  2XGE A;  2W57 A;  2W00 A;  1OCT C;  2M7B A;  4IHT A;  2ZCW A;  2LF8 A;  1QZZ A;  2B7E A;  1V5F A;  2L2O A;  2P6T A;  2A07 F;  1P9Q C;  1ETW A;  1JUS A;  1Z7L A;  2WAF A;  2RV8 A;  2XAF A;  3BR0 A;  4A3C J;  2VBY A;  4XKC A;  4M3E A;  2R7Q A;  4PFO A;  4NDL A;  4M6X A;  2ZB9 A;  4LG0 A;  1K4S A;  1MMA A;  1K61 A;  4R1H A;  1BI2 A;  2XRN A;  2JPC A;  2ZME B;  3GFM A;  2O8X A;  4AVZ A;  3F8M A;  1VF9 A;  4LG0 B;  4M9Z A;  5ILS A;  2PMU A;  1IO2 A;  3BCA A;  1SD4 A;  1TQM A;  4QTR A;  2FUG 2;  1XSX A;  1A6I A;  4HLX A;  2NAZ A;  3RKQ A;  2W85 A;  3I54 A;  3FKI J;  1PDN C;  1SC7 A;  1OKR A;  2OPT A;  1B6A A;  3HPG A;  2DT7 B;  2H1L A;  3IUO A;  1DP3 A;  5J40 A;  4HNU A;  2P7V B;  1HA8 A;  3WE3 A;  4RGR A;  4HV6 A;  4RAG A;  2IA0 A;  3KP6 A;  1ZAO A;  1U8B A;  5D8K B;  3IH2 A;  3JRH A;  1HCR A;  4C2U A;  2VQC A;  4RS8 A;  5IT9 K;  4XSX F;  1TWF J;  1UZC A;  1PYV A;  3KCC A;  1MSE C;  2HGC A;  3WU2 C;  2V9P A;  2BXZ A;  1S7A A;  4JOM A;  2GXG A;  3MFK A;  5IYB J;  2M34 A;  2QEX I;  3J80 Z;  2HKX A;  1IV6 A;  3V4G A;  2M2E A;  2YX4 A;  1TNT A;  1Y56 A;  3JW4 A;  2MC4 A;  4Z2Y A;  2L3D A;  2H8R A;  3QPT A;  2ECC A;  4L9T A;  4IHV A;  2VJ5 A;  2E1M C;  3JRE A;  3WTX C;  1MDM A;  3T0Y A;  4E4H A;  5B1B H;  4I6Z A;  2XPV A;  1FSH A;  4D9J A;  1YS6 A;  2EPF A;  3BR2 A;  1YJ9 I;  1W0T A;  4NQW A;  2L9S A;  3FMS A;  1YFH A;  3T1B A;  2E71 A;  4V2G A;  5CQG A;  4RB1 A;  1YIO A;  5IOZ A;  2K5C A;  3TQN A;  1RIO H;  3KFW X;  1U9N A;  2Z9O A;  3RKX A;  3FXR A;  1FSE A;  3SFI A;  5CQE A;  3L2R A;  4UV8 A;  4HW0 A;  4ZYD A;  4F55 A;  3IH3 A;  3OYF A;  2KHM A;  3E6B A;  3K0L A;  2VBZ A;  1MMG A;  1PJR A;  2FJ1 A;  5ED4 A;  2XAQ A;  3GTL J;  1FP2 A;  2M4K A;  2LY2 A;  1B9N A;  4A2U A;  3L1P A;  3S17 J;  1EKE A;  4M73 A;  3L2V A;  4WXC A;  2VT3 A;  4ESJ A;  1MZB A;  2HQR A;  4IHY A;  3OYI A;  4KA4 A;  2HS5 A;  3CMY A;  2A6E F;  3BG5 A;  5ICF A;  3FXM A;  5J47 A;  2XF5 A;  3CC2 I;  4E7I A;  3Q0W A;  3FWE A;  4LIT A;  2FXA A;  3K2Z A;  4EJU A;  1FYM A;  1IN5 A;  1JGG A;  2BVL A;  1Z67 A;  4RM2 A;  2V1N A;  1H8A C;  2GXB A;  4BS9 A;  3C7J A;  1FOX A;  1XGS A;  3H9G A;  2H1K A;  3CCM I;  3QRF F;  3E6C C;  4M3G A;  3OYD A;  1HKT A;  3PQK A;  2E35 A;  2ME0 A;  1XDS A;  4FAS D;  2DT6 A;  1IRF A;  3M8J A;  3ML6 A;  2PJR B;  4MEX F;  2E1O A;  4G6D A;  4NC6 A;  1VQ9 I;  2VN2 A;  3WTT C;  2NVX J;  1VI0 A;  4RLF A;  2KIU A;  2LBF A;  3K4J A;  4XQF A;  3MMY B;  4F7Z A;  3PUF A;  3TW7 A;  3D5L A;  2XAS A;  2L9R A;  2YUS A;  3CF5 F;  2Q0O A;  4PJM A;  5L3G A;  1RKW A;  4ASN A;  2LBF B;  2LNB A;  1YQA A;  4HNT A;  2VL8 A;  1ZG1 A;  1FNN A;  2JRM A;  1PP7 U;  2R7S A;  1XTA A;  4AU7 A;  3NQO A;  1H9G A;  4D0P A;  3OYC A;  1S8N A;  1IZ1 A;  3DWL E;  3G71 I;  1ZGA A;  2BBY A;  3K4M A;  3CCJ I;  1FBS A;  1JJ6 C;  4BAY A;  3RDI A;  3VDX A;  4QLC U;  2L5Q A;  3K7A J;  5KCM A;  4GYG A;  2UZK A;  4RMN A;  4DYQ A;  3DCF A;  3LFU A;  4DGW B;  1MBJ A;  2D1V A;  1J2X A;  1WJE A;  2LMD A;  2W48 A;  1JT0 A;  3F0C A;  4G94 A;  1WI3 A;  3A02 A;  1X4O A;  2AHQ A;  2WB1 A;  3TO6 A;  3V7S A;  1EJ9 A;  2PQ8 A;  2DMT A;  3KPH A;  1PP8 F;  2ESN A;  3H35 A;  1HLV A;  4IRI A;  3QOD A;  1Z3Y A;  1PUF A;  1X2N A;  2YU3 A;  1XMK A;  2K86 A;  4ZZL A;  3DV8 A;  1LJ9 A;  4L5J A;  3K1M A;  3CJQ B;  2F5D A;  4JX4 A;  3Q0V A;  1TP4 A;  4ZH4 F;  3S8P A;  1R4N B;  3TED A;  1PUF B;  4UNO A;  2IGN A;  3SFZ A;  3CP2 A;  5C4X J;  2K4J A;  2M4G A;  1E3P A;  1T2K A;  3VSK A;  2NVT J;  2IGO A;  4LOC A;  3LST A;  4ZDP A;  1JXS A;  4FCY A;  2QSG X;  2CJJ A;  2BY3 A;  4W97 A;  3S1R J;  4P55 A;  5E1X A;  3C18 A;  2IS4 A;  2A05 A;  4G8X A;  1OCC H;  1FWZ A;  2ELH A;  2XRO A;  1QNT A;  3GZ5 A;  3F22 A;  3I59 B;  3ZMZ A;  2A69 F;  5LEJ A;  2DO7 A;  3G6E I;  3S15 J;  1FP1 D;  1D1C A;  2LC2 A;  4A6E A;  2EV5 A;  3OIP A;  1HXD A;  2X51 A;  2DMU A;  3D0S A;  4DW6 A;  3IL2 A;  1BI1 A;  1BR4 A;  3H1C A;  2M5W A;  1KYZ A;  4B47 A;  5IOY A;  2LRD A;  5B3S H;  2HDC A;  3CC4 I;  1X4P A;  1RC9 A;  2ZJR F;  3IRR A;  4HDU A;  3DPL C;  5E8I A;  2JVH A;  2ZO4 A;  1TWG J;  3M1E A;  4HDV A;  3BLY A;  5GTI C;  2W24 A;  2CQX A;  3JRF A;  2MA3 A;  4KIS A;  3VYR B;  3F72 A;  4U0V A;  4C2M J;  2DFH A;  3LA2 A;  2NVU B;  4MFD A;  1ACI A;  3ZQQ A;  4EGY A;  4MLO A;  2L7Z A;  1IXR C;  2KIM A;  3BCB A;  2GWR A;  1JTY A;  5FJ8 J;  3W6V A;  2VXD A;  1R9T J;  1IRX A;  5FLM J;  3LL7 A;  3U1D A;  4K2E A;  1ZQ3 P;  2IGM A;  2L4M A;  4JYK A;  1P92 A;  3F8N A;  3PNY A;  4BHP A;  2X0L A;  1LNW A;  2FBH A;  3IH4 A;  3KP4 A;  4A5M A;  1ZG5 A;  1F36 A;  4XLE A;  4HPQ A;  1R6R A;  4E7Z A;  1HOM A;  3RPQ A;  3ZRG A;  1HW5 A;  4S05 A;  3OYH A;  1MJA A;  1X1P A;  1IG7 A;  4EGZ A;  1T98 A;  2ELK A;  3JSP A;  1D5V A;  2MLK A;  2IT0 A;  3BTI A;  1XPX A;  4A3D J;  3HUG B;  2QCO A;  2DFE A;  3BPV A;  3ZQ7 A;  1U5T C;  2K3F A;  3BOQ A;  2VI6 A;  3G1M A;  3W2W A;  1KYW A;  3A1Y A;  1OCR H;  3X2Q H;  4ZZD A;  3G3Z A;  1QZY A;  2JA6 J;  2P0W A;  3PSI A;  2A3S A;  2XUB A;  4PJN A;  2OC6 A;  5ILV A;  2A5Y B;  3CTA A;  3JRA A;  4NUB A;  4DZP A;  1FBU A;  5HLG A;  1JUM A;  2BY2 A;  1ZKG A;  1XGN A;  3E6D A;  3KZZ A;  4RDU A;  1G4D A;  3HOV J;  4BDZ A;  4E7L A;  1Z6T A;  2KJC A;  5E3L A;  4ENJ A;  3KEQ A;  2ZXW H;  2QWW A;  1OR7 A;  2MG4 A;  3ZMS A;  2IEK A;  1VQ5 I;  4QIW N;  4A3F J;  2W84 A;  3SDG A;  5IPA A;  2VQH A;  1TZL A;  3TMO A;  4I76 A;  5DCF A;  3A0B C;  3MKL A;  3I71 A;  4Y7N J;  5L3E A;  2R3S A;  1YIJ I;  2E2I J;  3C2B A;  2HQN A;  2X6X A;  5CVJ A;  3KLO A;  1J0R A;  3ZQI A;  3HHG A;  4XBF A;  3E97 A;  2L02 A;  2NYX A;  2FBI A;  2DBB A;  2ZJQ F;  1LE8 A;  2XAG A;  1G3T A;  2OAZ A;  3A4C A;  1LDK B;  5BNG A;  9ANT A;  1UST A;  5FFX A;  3ZOB A;  1Z91 A;  2M7A A;  2NNN A;  3B73 A;  3FKJ A;  3OSG A;  3LAP A;  4XID A;  2X4H A;  5DV5 A;  4OIR F;  3EUH A;  5H6R A;  2K85 A;  2DMQ A;  5F0H A;  1SFU A;  4WXD A;  3IKV A;  1IV8 A;  2P4W A;  2P6S A;  2CRG A;  3CME I;  1WJB A;  2H09 A;  3CMA I;  4CO8 A;  5BPI A;  2PMZ A;  2XB0 X;  2K7L A;  4Y52 J;  4EJO A;  3FDY A;  2DMP A;  3KE2 A;  3AL0 C;  4Y17 A;  1CF7 A;  3WU0 A;  4XKV A;  5TRD A;  1XGM A;  2YSR A;  1IXC A;  1V5E A;  1Z3X A;  1ZYR F;  1OYI A;  1S5L C;  5J1U A;  3K4C A;  2LYC A;  2JVG A;  3DTK A;  4ZTJ A;  1R00 A;  3QPS A;  2Z5U A;  2CYY A;  1QPM A;  3G4S I;  4RAF A;  1PUE E;  1QGP A;  1KQ9 A;  1QVT A;  4NC7 A;  5E18 F;  4XOT A;  1P4A A;  1F9N A;  3H5A A;  1BBY A;  5F64 A;  4BXU A;  5ERI A;  2XAJ A;  1K6O A;  1B1B A;  4BGD A;  4A3E J;  2WB1 N;  1IN8 A;  1ZGJ A;  2LTP A;  1FMW A;  1Z21 A;  5D5V B;  3H92 A;  4N4N B;  1W0U A;  5HLH A;  2VXZ A;  3V7R A;  2DQR A;  2QQA A;  3GTO J;  1NHA A;  2DTZ A;  2QQB A;  3S1N J;  5AIP A;  1FPQ A;  2XB5 A;  5EGO B;  2R92 J;  2VOO A;  1WCM J;  4B3X A;  5BPD A;  5KAI C;  2BGC A;  4OU0 A;  1DU0 A;  3CD6 I;  3O2P E;  1U9O A;  2HFH A;  4U0Y A;  2X6Y A;  4PJJ A;  2H27 A;  3KIO A;  4IJA A;  2L7K A;  3GTP J;  3BRO A;  4BEH B;  1XDU A;  2NNY A;  3M07 A;  3O8H A;  3GTK J;  1LEA A;  4G9Y A;  4OAY A;  2V26 A;  3F6V A;  1XCV A;  3O8G A;  4O5V A;  3R6S A;  3ABK H;  4B8X A;  1TQI A;  1YE9 A;  3GTM J;  2P5K A;  1EH7 A;  2DA3 A;  3U9G A;  3JR9 A;  1BJA A;  4XOP A;  2CUJ A;  3B6A A;  1MBH A;  2OZU A;  4G7Z F;  5FLX K;  2W82 A;  3BR5 A;  4O6J A;  1IRG A;  3KYC B;  2E7X A;  3AG3 H;  3GCM A;  4A5N A;  3GTG J;  5C4J J;  4XRF A;  4LB6 B;  2EZI A;  2BW3 B;  4P5O A;  4IRH A;  4FTH A;  1FOY A;  3M4O J;  4BJT A;  3BJ6 A;  3LSI A;  4B43 A;  3E5Q A;  1SAU A;  3M1C A;  3GFL A;  3ECO A;  2FA5 A;  2ACJ A;  4NBQ A;  3HHH A;  3OIQ A;  3BWG A;  2R7X A;  1S7E A;  2WY7 Q;  2L7M P;  4KN4 X;  3TP3 A;  1RUO A;  3N05 A;  4OIO F;  4IZZ A;  4KIT B;  2E5N A;  3M3Y J;  2Q2E A;  3FXQ A;  5HS8 A;  3S93 A;  1HDD C;  5JLW A;  3L2W A;  3IAM 2;  2ME6 A;  2DDB A;  2IP2 A;  3LQQ A;  1YRN A;  1B72 A;  3ZR8 X;  3VPR A;  1BW5 A;  4GXO A;  1GVD A;  1G6N A;  2RNG A;  2V9V A;  1OYW A;  4XNF A;  3TKY A;  1U2W A;  4EJW A;  1YJN I;  3HDD A;  1YRN B;  4RB3 C;  2ZJP F;  4J19 A;  2K02 A;  2R7F A;  3SEQ A;  5CPR B;  5C3E J;  2E19 A;  2ZKZ A;  4XLN F;  2V6E A;  2GIV A;  2OF7 A;  5K7Z A;  4XIC A;  3J81 K;  1TW3 A;  3DBH B;  3T8T A;  5JHU A;  3BY6 A;  3REO A;  1YW9 A;  3H3U A;  3WGI A;  1T33 A;  2FE3 A;  3BPX A;  1NK2 P;  4HA8 A;  2HQA A;  4CYC B;  2H6C A;  5LGN A;  4CCJ A;  5M3M J;  2HOS A;  1EH8 A;  1IDY A;  1JGS A;  5L3D A;  4A0Y A;  1HSJ A;  4PK4 A;  1QPI A;  1VND A;  4AUX A;  4X6A J;  3OYK A;  1RNL A;  2VBW A;  2EZL A;  3KP3 A;  3IV5 A;  2O5R A;  4Y15 A;  1FYK A;  2OTL I;  2JK3 A;  5F6F A;  2QQ9 A;  4XN0 A;  5IP7 J;  4UHT A;  5FLV A;  2ZXH A;  2NXN B;  1JKR C;  4I01 A;  1MIJ A;  4G6Q A;  3D5R C;  3T8R A;  2P5L C;  2XHK A;  5LHH A;  1SFK A;  3DKX A;  3O6B B;  1X3W B;  3ZMV A;  4CCN A;  4U7D A;  4AIJ A;  1R7J A;  4XR6 A;  3J7Z I;  3BTJ A;  4F52 A;  4KIG A;  3CES A;  2CV0 A;  2DYS H;  2XAU A;  1BOB A;  1TNS A;  2K40 A;  3CZ6 A;  1ONV A;  3MZ8 A;  3TOA A;  2HVQ A;  2QSF X;  3H9Q A;  2GXA A;  2CGP A;  5LGU A;  2RVC A;  2CFO A;  2LDU A;  4D5F A;  2XKP A;  3GVA A;  4Q48 A;  3L2Q A;  1TT5 B;  4F93 B;  3DPU A;  4S04 A;  4IQJ A;  3V8L A;  5DD4 A;  2CMP A;  2F5F A;  2W4S A;  3OR1 C;  4G12 A;  3CCE I;  2K9N A;  2DJN A;  2ZME A;  3FM5 A;  1SMY F;  1WPK A;  5J4Y A;  2JRT A;  4FHT A;  1FLI A;  1I6H J;  5FFZ A;  3F8C A;  4HEA 2;  2JUC A;  3ASN H;  2M1B A;  4DBQ A;  4UUS B;  5EYR A;  3BG3 A;  3R0J A;  1UJ8 A;  3LWF A;  4P96 A;  2PMZ N;  4G7H F;  4B4C A;  3I4P A;  4BE1 A;  1WSU A;  1FOK A;  3PUB A;  1MD0 A;  1X1C A;  3OV8 A;  1WJC A;  3MCZ A;  5D5U B;  3JAM K;  1JHF A;  2KLO A;  1MMS A;  3QOP A;  5D5X B;  4FX4 A;  3OWT A;  3GO5 A;  5J8C A;  1BC8 C;  2IBD A;  2FOK A;  1GHC A;  4HST A;  1Z6R A;  1IF1 A;  5CKT A;  2GOM A;  3VEP A;  3I55 I;  1I39 A;  4XL9 A;  1OCP A;  4G7O F;  4E70 A;  4IL6 C;  3LOC A;  5K7F A;  1HBX G;  3E1S A;  5CYV A;  5LD2 C;  5F0F A;  3CUQ B;  4BE2 A;  4DNC A;  2MLG A;  3EYI A;  4G6T B;  1T38 A;  3EET A;  2Y69 H;  1NG6 A;  1K6Y A;  1N25 A;  3KYL A;  4BJ6 C;  2JUG A;  4OOI A;  2LG4 A;  2WC2 A;  2N8G A;  2WY8 Q;  2JMW A;  1GXQ A;  3BG9 A;  3MEX A;  3GZN B;  4PZJ A;  5CVR A;  4GGG A;  3LSG A;  2EWN A;  4ZJZ A;  2F6C A;  5FRM A;  1UB9 A;  3HPH A;  3LSJ A;  1MKM A;  1AWC A;  3NAR A;  2DN0 A;  3DBR B;  4DOZ A;  2HNH A;  2VB6 A;  2M8G X;  4Y3O A;  3SZP A;  3F8F A;  2CW8 A;  5GPC A;  2OUM A;  1V54 H;  1FMV A;  1KON A;  1R23 A;  2BY0 A;  3FHZ A;  3N4M A;  3J7A O;  2EIN H;  1UHW A;  3C1D A;  3JRG A;  1ETX A;  1EH6 A;  2R7W A;  3RJP A;  2XF6 A;  1XB4 A;  3VOE A;  3ZQF A;  1W5C C;  2OQG A;  3GWZ A;  5K1Y A;  3HRS A;  3K10 A;  5H2F C;  3CC7 I;  4Q47 A;  3LSR A;  1DPR A;  1FT9 A;  3BR1 A;  5DUI A;  1O7L A;  1ITY A;  2K3P A;  2B63 J;  1H9T A;  4IHS A;  2JWT A;  2RKH A;  5HVQ C;  2VOD A;  4HAM A;  2DMN A;  2F2E A;  3OYA A;  2HPI A;  1WZ2 A;  4DYR A;  5LGT A;  1LDD A;  4UUV A;  3BZK A;  4IX7 A;  3CLQ A;  3QAH A;  4FT8 A;  4A0X A;  3FM3 A;  1ZG3 A;  5EEG A;  2L9V A;  1VQ7 I;  1ZK8 A;  3WGG A;  1R58 A;  4AYB A;  4H4K C;  4HF2 A;  1V55 H;  4KJZ A;  4WF2 A;  2C6Y A;  4CZZ A;  3SJM A;  2B9S A;  2ZXJ A;  1QVU A;  2DA1 A;  3KP7 A;  5F04 A;  4M9X A;  4NNJ A;  1NK3 P;  5L3F A;  3MZY A;  2YX7 A;  3H5R A;  2VJJ A;  1LFP A;  3AKZ A;  5HNH A;  2VKV A;  1TW2 A;  2NS0 A;  3ZN0 A;  2AS5 F;  1JI8 A;  4AWX B;  3A03 A;  4HYE A;  4YIF A;  2PJR A;  2VC0 A;  1HST A;  2DK8 A;  4LFU A;  4MIM A;  2PG4 A;  2PBI A;  3L9F A;  1MGT A;  3TBI A;  3ZGK A;  1E3O C;  2HYF A;  4DQ2 A;  2LH9 A;  2WA0 A;  4R79 A;  2Y0S A;  5H6Q A;  4M72 A;  4GFB A;  2IXS A;  1WVR A;  3S3O A;  3RPU D;  2R5Y B;  5K5O A;  1T95 A;  5K5R A;  1Y1V J;  1FBQ A;  2KIQ A;  4I0A A;  5F1J A;  1E2X A;  3TO9 A;  4A12 A;  1IUF A;  2BY1 A;  2HWV A;  4I09 A;  1T8I A;  2KZV A;  1YW8 A;  5HS7 A;  1F5T A;  1WI9 A;  1N77 A;  4M6V A;  3GW2 A;  2KKO A;  2EA2 A;  5CLS A;  3I64 A;  1OJL A;  4JX6 A;  4LLN A;  2P8T A;  3VOD A;  2I5U A;  1T6S A;  3GTQ J;  5BMZ A;  3OOU A;  1ZLK A;  3GFI A;  3TDZ C;  1VQN I;  5FRN A;  3S3M A;  5J6X A;  3U2R A;  5B5E C;  1K4T A;  2KIF A;  4QSH A;  1RPW A;  5E17 F;  3SYT A;  2QVO A;  5E1Z B;  1XGO A;  2HQ5 A;  3RIR A;  2V1X A;  4PGH A;  1BL0 A;  3HJE A;  3RPU A;  4EM2 A;  4A3K J;  3DXJ F;  1J7K A;  1ZRE A;  5JR3 A;  4BHB A;  1QRY A;  1BJZ A;  3CCS I;  5M3F J;  2DK5 A;  3SZG A;  3P9K A;  1EA3 A;  1YJW I;  3ZQH A;  3SHF A;  3FZV A;  2GAU A;  1WHU A;  2F5E A;  4P9F A;  3WG7 H;  1RR8 C;  2KFD A;  2EFQ A;  1G8X A;  1R22 A;  3H3Z A;  4RAZ A;  3HEF A;  5L3C A;  3PL8 A;  3RYR A;  3GLX A;  1VQO I;  3DU5 A;  4HSR A;  3A2K A;  3FXO A;  1KU2 A;  2XGC A;  1OMI A;  2OTJ I;  5DS9 A;  1MBK A;  1LQ1 A;  2EA4 A;  4PJL A;  4XSZ F;  1OR7 C;  2HDD A;  1IDZ A;  2ZXI A;  3OYM A;  2HVR A;  2PX9 A;  3K1N A;  5TIS C;  2WBM A;  3I59 A;  2EIK H;  4IOC F;  3CDI A;  1O3T A;  1BA5 A;  5EZG A;  2VPR A;  3WTY C;  1ODD A;  3CCL I;  2E1M B;  2J5O A;  2BOL A;  2KMU A;  1YLF A;  1D1A A;  2XSD C;  3ZMD A;  3L7W A;  4FX0 A;  5DYM A;  4MNU A;  3PFY A;  1ZHF A;  3G73 A;  1P7J A;  4UVC A;  5GAE J;  1H89 C;  2HVS A;  2V9K A;  2ETH A;  1ZR4 A;  1Y39 A;  3HZJ A;  4A93 J;  3KLN A;  4ETS A;  1GDT A;  2EJR A;  2DDA A;  3DQV C;  3CF2 A;  4DJA A;  2Z16 A;  2LFB A;  1W36 C;  3P5J A;  2QKM B;  3UR3 C;  2KRC A;  1T08 B;  3K4L A;  4N9H A;  2L7F P;  5GP9 A;  3I5U A;  3WTU C;  1V4R A;  2HEO A;  1A35 A;  1VFC A;  4JX5 A;  4F92 B;  4KT5 C;  4L9J A;  3E6M A;  5ICG A;  3OIO A;  4PUS A;  4XKB A;  2QBY A;  2A6H F;  1XSD A;  2CW0 F;  4CCK A;  1L3L A;  1D3Y A;  1T0F A;  1ZR2 A;  1U8R A;  1FY7 A;  3W6K B;  2MH9 A;  2X6O A;  2QBY B;  2HR3 A;  3I3L A;  1TWH J;  2ZFU A;  4BQO A;  4ESF A;  1BI3 A;  3ESW B;  4I02 A;  3OS0 A;  4CGZ A;  1D0Y A;  4RGS A;  1LEB A;  1G3W A;  4KT6 A;  1MMN A;  1OPC A;  2A61 A;  1TLH B;  3K1P A;  2HZT A;  4LD5 A;  4U88 A;  1VQ6 I;  1E3H A;  4WCG A;  3Q5F A;  2MSY A;  2OQR A;  2CS3 A;  2A5W A;  5ICC A;  3RZD J;  1OFC X;  1D0Z A;  2H6B A;  5E8G A;  4AIH A;  1F43 A;  3Q9V A;  4EQQ A;  3K70 C;  3HUG A;  1MBG A;  5F27 A;  3JSO A;  5HLT A;  3LAJ A;  3RI4 A;  5KVR A;  3AFH A;  1WKM A;  5DTD A;  4B1R A;  3IP4 B;  3OYB A;  5J1R A;  4ZDO A;  4B44 A;  4RBO A;  3GYH X;  4D5C A;  1BOA A;  5K7H A;  2L01 A;  3R61 A;  1GV5 A;  3CDH A;  5HNF A;  2M45 A;  3FMQ A;  1W1W E;  1OCO H;  1YX5 A;  4CCM A;  4C3H J;  1KZH A;  1Y8Q B;  1MJ9 A;  2KJB A;  3AAF A;  2CH0 A;  4KN7 X;  3HYI A;  5LRS A;  3TGN A;  3ROU A;  2QYO A;  1RUN A;  3BR6 A;  4AVP A;  1XD7 A;  2NOG A;  4LIU A;  4IEJ A;  4Z6Y A;  4AYB N;  2GA1 A;  4XKW A;  1XSV A;  3I4N J;  4KNY A;  4KIB A;  5E3O A;  2EB7 A;  3HRM A;  2XGD A;  3AG4 H;  4NB5 A;  4R8H A;  2JQ7 A;  4YFK F;  1YI2 I;  2VC1 A;  3VB2 A;  5DM7 F;  2CU7 A;  3HOY J;  5K5Q A;  1YO5 C;  4C30 A;  2X1D A;  2MC3 A;  1LPQ A;  2HDW A;  2RRE A;  1TWA J;  4J00 A;  1JKP C;  3P7N A;  3ABU A;  2LP0 A;  1CGP A;  3KZY A;  3E0J B;  2MFZ A;  3PFI A;  2QKL B;  2HKO A;  1P2F A;  3A01 B;  3QYF A;  2Y30 A;  2Y2Z A;  2DOA A;  2Y0S N;  1IGN A;  3AG1 H;  1WGX A;  3FK6 A;  3RCO A;  1WFX A;  4D7N A;  2DPU A;  3P9I A;  3IAS 2;  3OSF A;  3V8K A;  2EV6 A;  2VQL A;  1ON1 A;  3GF2 A;  2KIS A;  3DLA A;  4BUP A;  1WJF A;  3M8E A;  4ZYA A;  3TOB A;  4BXF A;  4MO7 A;  1HF0 A;  5D4S A;  2P7C B;  4BU2 A;  5FLX Z;  3PJR A;  2MD5 A;  4FQG A;  3SQN A;  1VQK I;  1BIB A;  3F6O A;  3ZQC A;  2Y31 A;  4XLF A;  1VQL I;  3T5X A;  4E7H A;  3NEU A;  4YEJ A;  3HOZ J;  2OJE D;  1Z77 A;  2HXI A;  3PIP F;  3WTZ A;  2WWY A;  1O3R A;  1ON2 A;  1W4M A;  4Y13 A;  4HRI A;  2ZSI B;  1LB2 A;  4FE4 A;  2B0L A;  4IF4 A;  2R5Z B;  2DOD A;  1PVE A;  1R1U A;  3RZO J;  4HG2 A;  4EM1 A;  4OWR B;  4JP0 A;  2JPB A;  3Q0U A;  3EUA A;  2GLO A;  2JA8 J;  2Y75 A;  2ID6 A;  1I6X A;  4YIR X;  5EGO A;  2ISY A;  1XS9 A;  2RC4 A;  2CUZ A;  4A3B J;  3DU6 A;  3RSN A;  2VUM J;  5EDN A;  1A6Q A;  3BTC A;  2GM4 A;  2ID3 A;  3V8J A;  4WK8 F;  1SFE A;  3OS1 A;  1J75 A;  2P81 A;  4IKF A;  2LKS A;  4BEH A;  2CQ7 A;  2D2W A;  2EZK A;  4ZYG A;  1A5J A;  4A3M J;  2TDX A;  3HRT A;  2WTE A;  3ISP A;  3LMM A;  2KZG A;  2NRA C;  2YU9 J;  3CJR B;  3GEZ A;  1BR2 A;  1I5Z A;  5FKL A;  3MD2 A;  2CQN A;  4M9S A;  3CUO A;  1ZEL A;  3GXO A;  3I9V 2;  1ZN2 A;  1U3E M;  3J81 Z;  3GX4 X;  3G1O A;  1JJ8 C;  2JA7 J;  1R71 A;  3I4M J;  2HTJ A;  2FX0 A;  2LF7 A;  2IRF G;  3DEW A;  1UFM A;  4C3J J;  2BW3 A;  2G9W A;  3QU3 A;  1XCB A;  4GCV A;  3BJO A;  2VJI A;  4HOB A;  3HOX J;  2ELJ A;  1KA8 A;  2AO9 A;  2GA2 A;  3WG9 A;  1R5G A;  5DDG A;  4B48 A;  3HOS A;  1TWC J;  5D6E A;  3D1N I;  2CV1 A;  3DP7 A;  2LRE A;  2R7D A;  1U5T B;  2GIZ A;  3ABT A;  2HI3 A;  5TJJ A;  2ZME C;  2DYR H;  1BC7 C;  3SDB A;  2NVQ J;  1Z9C A;  2RQP A;  3I0T A;  1GUU A;  3ZQL A;  2AXT C;  3KZI C;  3HGG A;  2DU9 A;  4A3G J;  2PN6 A;  4P1W A;  3K4K A;  3J7A Y;  3DF8 A;  1Y6I A;  5DCM A;  1R1T A;  2M87 A;  3L00 A;  2DPD A;  1D5Y A;  2BZT A;  2FRH A;  1IC8 A;  2IPQ X;  2L0K A;  4V2F A;  5DCM B;  1X3Z B;  3BT9 A;  2CWE A;  2QUF A;  2JA2 A;  4ENM A;  2LD5 A;  2D45 A;  3FBI B;  3WTV C;  1KQ8 A;  2JTV A;  2PFB A;  1I3A A;  4IOA F;  3ASO H;  1FX7 A;  4EEF G;  5C44 J;  3CCV I;  1HKS A;  2Q1Z B; 
#chains in the Genus database with same CATH homology
 2HXO A;  5GPC A;  4JX4 A;  3Q0V A;  5IP6 A;  3TED A;  1PUF B;  4BXX J;  2LK2 A;  5C4X J;  1RET A;  4CYC A;  2CUE A;  3JRG A;  1ETX A;  1POG A;  3S2D J;  3ZQF A;  2NVT J;  1WH5 A;  4LOC A;  4W1U A;  1AHD P;  4FCY A;  3UKG A;  1RKT A;  2CJJ A;  2JA5 J;  4W97 A;  3TP0 A;  3TW6 A;  3S1R J;  3LSR A;  3BR1 A;  1LE8 B;  1ITY A;  2B63 J;  2R5Z A;  2JWT A;  2DMN A;  1RES A;  2EH3 A;  3S15 J;  1ETO A;  4DYR A;  1FTZ A;  4BY7 J;  2DMU A;  1ETY A;  4BKX A;  1I50 J;  3JRI A;  2X48 A;  4B3A A;  4DW6 A;  3BTL A;  2DA6 A;  3PM1 A;  5IOY A;  4IHX A;  1ZTR A;  2EBI A;  1ENH A;  1MH3 A;  1ZK8 A;  2TRT A;  3CDL A;  3S14 J;  1JT6 A;  2O7O A;  3FIW A;  2D5V A;  3S1M J;  3QPL A;  3SJM A;  1QVU A;  2DA1 A;  5F04 A;  3S2H J;  1TWG J;  3ZQG A;  4BBS J;  1XC5 A;  1NK3 P;  2CQX A;  3JRF A;  2E2J J;  1SFO J;  4C2M J;  1P7I A;  4BBR J;  2VKV A;  4MFD A;  4MLO A;  1K83 J;  2L7Z A;  2LLK A;  1O4X A;  3A03 A;  2M9H A;  3S16 J;  4MIM A;  1JTY A;  5FJ8 J;  3HGY A;  3W6V A;  1R9T J;  5FLM J;  1EF4 A;  1E3O C;  1ZQ3 P;  4UUS A;  1SAN A;  1UG2 A;  4JYK A;  1Y1W J;  4GFB A;  2QF7 A;  3IH4 A;  2K9S A;  1F36 A;  1AKH B;  2R5Y B;  2JN6 A;  1HOM A;  3JRD A;  4D7M A;  1Y1V J;  5F1J A;  2JJ7 A;  3BQY A;  1IG7 A;  1IUF A;  5E3M A;  4XRS G;  2ELK A;  4DYC A;  1G2H A;  3BTI A;  4M6V A;  4A3D J;  2QCO A;  1OJL A;  4JX6 A;  3HBL A;  2NS7 A;  3GTJ J;  3BQZ A;  2VI6 A;  3G1M A;  3GTQ J;  2NS8 A;  2JA6 J;  3OOU A;  1AU7 A;  5FKK A;  5IYC J;  3WHC A;  4HNV A;  4QSH A;  1RPW A;  3JRA A;  4DZP A;  2HQ5 A;  3FK7 A;  5IP9 J;  1BL0 A;  4A3K J;  2Y9Y A;  1QRY A;  1BJZ A;  1JUM A;  5E3N A;  1ZKG A;  1ETV A;  5M3F J;  2LR8 A;  4RDU A;  2VKE A;  3HOV J;  4A3I J;  3ZQH A;  2O8K A;  5E3L A;  2Y9Z A;  5EF6 A;  5EZH A;  1WH7 A;  2MG4 A;  2IEK A;  5M5W J;  4QIW N;  4A3F J;  3SDG A;  5IPA A;  1NTC A;  4I76 A;  3MKL A;  3HEF A;  4Y7N J;  2XRL A;  5FKN A;  3C2B A;  2E2I J;  5GPA A;  3ZQI A;  5EEA A;  2XGC A;  5DS9 A;  2R93 J;  1MBK A;  2XPW A;  1IDZ A;  2HDD A;  1LE8 A;  2GBY A;  3MN2 A;  2CUF A;  3LSP A;  1FTT A;  4XRM A;  1B72 B;  5BNG A;  9ANT A;  3ZOB A;  2LVS A;  1BA5 A;  5EZG A;  2VPR A;  3OSG A;  1MH4 A;  4M3B A;  4XID A;  2XSD C;  2FD5 A;  5F0H A;  2DMQ A;  1P7J A;  1UHS A;  1H89 C;  3JRB A;  1JKO C;  1B8I A;  2CRG A;  1ZR4 A;  3HB9 A;  3LNQ A;  4A93 J;  2XB0 X;  3PO3 J;  4Y52 J;  1FJL A;  1GDT A;  2DMP A;  1ETQ A;  2LFB A;  1B8I B;  5GP9 A;  2L7F P;  2CQQ A;  4MFE A;  3CCY A;  3WHB A;  2LY9 A;  2DA7 A;  5J1U A;  1VFC A;  4JX5 A;  4ABZ A;  3CQZ J;  4XRS A;  3E7L A;  3OIO A;  3QPS A;  3HOW J;  1I3Q J;  2KT0 A;  2DA4 A;  2WV1 A;  4S0H B;  4L5E A;  1QVT A;  2HOA A;  1ZR2 A;  5FKO A;  1IJW C;  2E2H J;  2X6O A;  2RAE A;  1TWH J;  4A3E J;  1FIA A;  2WB1 N;  5HOD A;  2TCT A;  2LTP A;  1GV2 A;  3Q3S A;  4IHW A;  2R7Z J;  1W0U A;  2EZH A;  1MSF C;  3GTO J;  4A3L J;  2DTZ A;  3S1N J;  1AKH A;  2R5Y A;  1FIP A;  5EGO B;  2XB5 A;  5FKM A;  2R92 J;  1WCM J;  2MSY A;  2ECB A;  1DU0 A;  1JKQ C;  1U9O A;  4BY1 J;  2EQR A;  3RZD J;  1OFC X;  1HDP A;  1H88 C;  3GTP J;  3K2A A;  5F08 A;  1F43 A;  2XGE A;  1MBG A;  3O8H A;  4A69 C;  5F27 A;  1OCT C;  3GTK J;  2NVY J;  1APL C;  1RR7 A;  3O8G A;  5DTD A;  4B1R A;  1ETW A;  1JUS A;  1LFB A;  3GTM J;  3BR0 A;  2DA3 A;  4A3C J;  3JR9 A;  5J1R A;  4RBO A;  4M3E A;  3B6A A;  1MBH A;  4NDL A;  4D5C A;  2ZB9 A;  3BR5 A;  5K7H A;  1K61 A;  3H0G J;  1GV5 A;  3GTG J;  5C4J J;  5J1Y A;  2EZI A;  5EG0 A;  1VF9 A;  4UUT A;  3HKZ N;  4C3H J;  4FTH A;  3HOU J;  3M4O J;  2I10 A;  4QTR A;  3BR6 A;  2NOG A;  4IEJ A;  4AYB N;  1A6I A;  5EG0 B;  2IAI A;  3RKQ A;  1MNM C;  2HYJ A;  3FKI J;  3I4N J;  2K9Q A;  2OPT A;  3PO2 J;  1S7E A;  4FE7 A;  2L7M P;  5E3O A;  1JUP A;  2XGD A;  3TP3 A;  1GT0 C;  3QQA A;  3M3Y J;  2CU7 A;  2MGQ A;  3HOY J;  1HDD C;  5JLW A;  1U8B A;  2ME6 A;  1U78 A;  2O9L A;  3IH2 A;  1YRN A;  1TWA J;  1JKP C;  1B72 A;  3JRH A;  1HCR A;  2LP0 A;  3VPR A;  1BW5 A;  1TWF J;  3A01 B;  1GVD A;  3G1L A;  1MSE C;  1Q1V A;  3HDD A;  2Y30 A;  5M5Y J;  2Y2Z A;  1YRN B;  3FIS A;  4J19 A;  2Y0S N;  1IGN A;  1WGX A;  3FK6 A;  2XPU A;  5IYB J;  2M34 A;  4D7N A;  5C3E J;  2E19 A;  3OSF A;  1IV6 A;  2M2E A;  1BW6 A;  1T56 A;  2H8R A;  2OF7 A;  5K7Z A;  2ECC A;  4XIC A;  2MW8 A;  4IHV A;  3JRE A;  4MO7 A;  1HF0 A;  1ORK A;  1T33 A;  1JTX A;  4I6Z A;  2XPV A;  1NK2 P;  3JRC A;  3BR2 A;  4CYC B;  2KDZ A;  5M3M J;  2HOS A;  1W0T A;  1IDY A;  3GBG A;  1QPI A;  1VND A;  4M3D A;  4V2G A;  4AUX A;  3ZQC A;  2Y31 A;  1ETK A;  4X6A J;  5IOZ A;  2EZL A;  1U9N A;  3IV5 A;  3HOZ J;  1FEX A;  1Z77 A;  2HXI A;  2JK3 A;  3SFI A;  2X9D A;  5IP7 J;  3IH3 A;  5FLV A;  4FE4 A;  2R5Z B;  1JKR C;  1DU6 A;  1UMQ A;  3RZO J;  2G0E A;  2FJ1 A;  4JP0 A;  3Q0U A;  4C3I J;  2YS9 A;  2GLO A;  2JA8 J;  5M5X J;  1LFU P;  2ID6 A;  3GTL J;  5EGO A;  1XS9 A;  3L1P A;  3S17 J;  4A3B J;  3BR3 A;  2VUM J;  3BTJ A;  5EDN A;  3BTC A;  2GM4 A;  4A3J J;  2ID3 A;  3S1Q J;  1XG1 A;  2P81 A;  2K40 A;  4IHY A;  3B6C A;  3CMY A;  3BG5 A;  4DZJ A;  2EZK A;  5JLX A;  2FQ4 A;  3Q0W A;  4A3M J;  1A5J A;  1JGG A;  2YU9 J;  4D5F A;  1H8A C;  5FKL A;  2H1K A;  4M3G A;  3G1O A;  1JJ8 C;  2ME0 A;  4G12 A;  2JA7 J;  3I4M J;  2K9N A;  2DJN A;  2FX0 A;  3DEW A;  2E1O A;  1WPK A;  4C3J J;  1I6H J;  1MBF A;  2NVX J;  1VI0 A;  1X58 A;  3RQI A;  3HOX J;  4UUS B;  2AO9 A;  5EYR A;  3BG3 A;  3TW7 A;  4AC0 A;  2COB A;  2L9R A;  2R0Q C;  2YUS A;  2M0C A;  1TWC J;  2PMZ N;  4B4C A;  1X2M A;  3D1N I;  1RKW A;  2DA2 A;  2HI3 A;  4FIS A;  2NVQ J;  4X1E A;  1Z0X A;  3H3V K;  1GUU A;  3ZQL A;  2IBD A;  3HGG A;  4A3G J;  1OCP A;  3LOC A;  5K7F A;  2DA5 A;  3NAU A;  4XK4 A;  1JJ6 C;  1ZGW A;  5F0F A;  3K7A J;  5F0C A;  1D5Y A;  1IC8 A;  3A01 A;  4DYQ A;  3DCF A;  2L0K A;  4V2F A;  1MBJ A;  2HOT A;  3HM5 A;  5IYD J;  2WAQ N;  1CQT A;  3BT9 A;  2N8G A;  2W48 A;  2LD5 A;  1JT0 A;  3F0C A;  1WI3 A;  2JMW A;  3A02 A;  3BG9 A;  3MVP A;  2AHQ A;  2LKX A;  5J3L A;  2DMT A;  1MBE A;  1HLV A;  3LSG A;  1PUF A;  1X2N A;  3LSJ A;  5C44 J;  4EEF G;  3NAR A;  4M3F A;  2DN0 A;  1IRZ A;  2M8G X;  1TC3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...