1IF1A

Interferon regulatory factor 1 (irf-1) complex with dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
105
structure length
105
Chain Sequence
RMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (26-MER)
publication title Structure of IRF-1 with bound DNA reveals determinants of interferon regulation.
pubmed doi rcsb
source organism Mus musculus
total genus 17
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1if1A00
1DP7P 3P9KA 4XSZF 5EEHA 3DPTA 4AIJA 1B9MA 4M9XA 1U5TA 1K78B 1S7AA 3QP5A 3D5LA 4ZZLA 4HBLA 3D0SA 1PP7U 2LDUA 4OOIA 2A68F 4G94A 2IJLA 2DQRA 1P2FA 2DI3A 5E1WA 1PUEE 4HLXA 2UWMA 5D8KB 1I6XA 3V7SA 1IN6A 3CJNA 4YIFA 3KFWX 5D5XB 3ML6A 2QVOA 2O03A 1J75A 3K2ZA 4M6XA 4HYEA 4WXDA 4I0AA 1USSA 3GO5A 1KA8A 4L5JA 4HV5A 3F23A 1IN8A 4LD5A 4U7BA 3JSOA 2IT0A 3LA3A 2K02A 3R60A 2MBFA 2O6GE 4PGGA 3J80Z 1G3WA 4MGRA 4HLYA 4HW0A 2A07F 2OQRA 2EJRA 1TQPA 3I59A 4IRHA 1JHFA 4RB1A 2XGXA 4L9JA 4ESJA 3L9FA 1XMAA 4N0BA 4UVAA 5CVVA 4LG0A 1SD7A 3MZHA 3WU1B 3K0LA 3ISPA 4ZYGA 4CXFA 4GYIA 2Z3YA 3IL2A 2O3FA 5K5QA 3FMSA 4AVPA 5H6QA 1IUYA 3WG9A 1DUXC 5FD5A 1S6LA 2IP2A 3EQLF 1FX7A 1EH8A 1S7OA 2CWEA 3KLNA 1MJ9A 1KU3A 1T38A 2FBIA 5L3EA 2JPBA 3F72A 5D5WB 3L2CA 5AONA 1ZG1A 3FZVA 4YFKF 3V7RA 4G8XA 2BE5F 5IT9Z 1TNTA 5TRDA 1P4AA 1SFXA 3PFIA 5DUKA 3L7WA 3GFIA 3TGNA 4LLNA 4HF2A 2BV6A 4OU0A 3M8EA 2Q8KA 1ZGJA 2EFPA 1OMIA 4WF2A 4MTEA 2FNPA 4Q4ZF 2M8EA 1VTNC 4KFCA 5ICFA 3SZTA 3IWZA 1YW9A 5DUIA 3PQJA 1OKRA 1G3TA 1HSJA 2VBXA 2FU4A 5HS8A 2PBIA 3B02A 5DV5A 1YW8A 3FMQA 3EETA 2UXXA 2ISZA 3C18A 3F8NA 1R58A 2YR2A 3R61A 3BZ6A 1UHMA 4ETSA 1LB2A 4YIIA 3RPUA 4O3MA 4ZYHA 4LB5A 1B9NA 4R1HA 2EV6A 3AAFA 2FSWA 1TQIA 1U6GA 1KGSA 1T39A 1R36A 1V4RA 4HA8A 3RI4A 4YG2F 1LDKB 4BHPA 4PDKA 4RS8A 1KU9A 3WE2A 4HX4A 3KLOA 1FSEA 4L9NA 1QQIA 4M9SA 1IRGA 3KE2A 3CUOA 3O3KA 1J9IA 3LA2A 2WTEA 4GXOA 4L0YB 3EDPA 1D8JA 3J81Z 2EV0A 3ZPLA 4B8XA 2F5DA 5LHGA 2V9VA 2WWYA 4Q47A 3F8BA 2JRTA 4TV7A 2FMLA 5JFRA 1DDNA 1JHHA 3TKYA 2DFIA 2DK5A 1W7PD 4R8HA 1QNTA 3RKWA 1P4WA 4BHCA 2KIUA 3SHFA 1YS7A 2P5LC 3LAJA 5HDNA 3HRSA 2XKPA 1SFUA 5ED4A 4UVBA 2GAUA 2XIGA 1V3FA 3E6MA 3NQOA 5DCFA 2IW5A 5BQTA 1YS6A 2OD5A 2XRNA 5BPDA 1XD7A 3EYIA 1HKSA 4KA4A 5D8LB 3WTVC 2EA2A 2QWWA 1LVAA 3ROUA 5CVUA 1Z91A 5BS6A 1GXPA 3OOPA 2OA4A 2LKPA 4LK0F 1QPMA 1ZREA 5ERIA 3BJ6A 4ZYDA 1HKQA 4HDVA 1MJBA 3HIFA 1W4MA 4WX9A 4WK8F 1PP8F 2DK8A 3WU0A 1K7AA 3I4PA 2VOOA 5LBQA 4HF1A 4EGZA 5A2QK 3I0TA 4ESBA 2XV4S 4A5NA 4CHUA 2GA2A 1Z9CA 3KETA 3HSRA 3ABUA 1K79A 3ZMVA 2E1NA 5HLGA 3HSEA 1XCBA 3DF8A 4G7ZF 1W5SA 5DDGA 1RI7A 1SAXA 1ZRDA 4CDGA 3JTGA 1QZZA 2HDCA 4OIRF 3VOEA 3WTSC 2FBHA 3JAMK 1TTYA 2DO7A 2IRFG 3KP6A 3K1PA 1MJAA 3DFGA 3I58A 4EJWA 1XGNA 2CYYA 4Y17A 1G3SA 3U9GA 4HOBA 3J7AO 4DNCA 3FXUA 3HSFA 3T5XA 3WGGA 1D3YA 3Q9VA 2HOEA 4U88A 2XAHA 2Y75A 1XDSA 3K1MA 1EH6A 4ASNA 1YFHA 2XAGA 1YYVA 2XAQA 1BI1A 5TJJA 3RYPA 1IN5A 2GZWA 2YU3A 1ZRCA 1A04A 5ILSA 3P9CA 1FT9A 4O6JA 2ZNYA 4KT5C 1T2KA 3R6SA 4I7HA 2ELHA 1F1ZA 1IAWA 2STTA 1O3TA 1WRJA 3CTAA 4HQMA 3T0YA 4WXHA 5J8CA 3I5UA 4A6DA 2YX7A 1RIOH 3CDHA 1XMKA 2FMYA 4H0EA 4LB6B 3ZP5A 3KP7A 2OQGA 1RNLA 1Z1DA 4Y15A 2MC3A 5FFXA 1R00A 2ZO4A 4ENNA 3N97A 2OU2A 1ZYRF 4PGHA 4ZZDA 3J80K 1IZ1A 1FY7A 4HX7A 5EEGA 3IKVA 1JXSA 4EJVA 2D1HA 3TO7A 3ZN0A 2BEOA 3ZQ7A 2P6SA 3QU6A 4UHTA 2XAFA 5LHHA 3BROA 4GO1A 2H6BA 4A12A 2RKHA 1YW7A 1J7KA 2M1BA 2YX4A 4L0ZB 2OZ6A 4RGSA 3HRMA 5LGNA 2WC2A 3TDZC 4KNYA 3F8FA 4KICA 4ENMA 3F6OA 3V4GA 2JT1A 2PMHA 2EK5A 1IRFA 3ZMUA 2KJCA 3MZYA 1MD0A 2W84A 5CYVA 1UB9A 3NRVA 1HXDA 2E7WA 4I09A 3CUQC 1TBXA 3BJOA 4Q48A 1USTA 2J5OA 5CVIA 2P5KA 2IA0A 5LHIA 1OYIA 4KIGA 3QP6A 4NQWA 3GEZA 1P6RA 4XSXF 5IT9K 3K69A 2Z99A 1R22A 3BJAA 3HHGA 4IRGA 3EYYA 2PFBA 2HTJA 2X4HA 4NHJA 1ZARA 4R79A 4Y13A 3DV8A 4I0BA 2COMA 1IW7F 3T8RA 2K7LA 2GIVA 4UUVA 1FYMA 1BJAA 1AWCA 3U1DA 1IN4A 1S3JA 1XGSA 4RB2C 1R5HA 3HUGA 1S29A 3ZMTA 2H6CA 5LEJA 1O3SA 2D2WA 5L3GA 3F22A 5D6FA 4BHBA 3I54A 4CICA 5JR3A 2RQPA 3ZMDA 1J5YA 1C0WA 4OIQF 2VT3A 1SD4A 5F6FA 3DKWA 2VOPA 1YQAA 2QQAA 4L18B 4RAZA 1B6AA 4EMSA 4AD9A 2RNJA 3ECOA 4JK1X 3GW2A 5JVTA 4GGGA 1HW1A 2CGPA 4IHTA 3L00A 1ZLJA 1FNNA 3COAC 1R5GA 1KQ0A 1KU7A 2XASA 3FXRA 1YIOA 2DPUA 4OIPF 2XKOA 1UCRA 3I53A 3J81K 5KVRA 1L0OC 1OYYA 2XROA 4MEXF 5FFZA 3KP2A 1BOAA 3O2PE 2XAJA 1R1VA 1XDUA 2HYFA 1STZA 3MQ0A 5K5RA 5L3BA 2Z5UA 3GF2A 5CJ9A 1OR7A 3GFLA 2K27A 3ZMSA 3GVAA 4IJAA 4LK1F 1BC7C 2BYVE 2LSOA 4E70A 1IXSB 5DCMB 3IWFA 1PDNC 4I2OA 3BOQA 1X3UA 3CO7C 3BDDA 3GFJA 4IPAA 4M74A 1YG2A 2L4AA 1R7JA 5LGUA 2ZJ2A 4WWCA 1KQ9A 1Z6TA 1ZGAA 4XBFA 2LNBA 5ILUA 2G7HA 1E17A 2EB7A 2M45A 2R7DA 2O0YA 3QU3A 1YTYA 2K4JA 3MAJA 4PZJA 1H9GA 3QOPA 4BYYA 1TQMA 2MH2A 3RTRA 5HS9A 5CLSA 4KUMA 1Z05A 1UHWA 2C6YA 3CUQA 1R1TA 3V8LA 2ETHA 1GVJA 4RAYA 3K1NA 5FB2A 2MLKA 2OZUA 3GZ6A 3GYHX 1MGTA 2EA4A 5E8IA 1O3QA 1BN5A 2HKOA 2A6HF 4CYDA 2FF4A 2QLZA 1CGPA 4AIKA 4A0XA 3DEUA 2HR3A 2WV0A 2VODA 5ICEA 3HTSB 2O61A 2DBBA 2UZKA 3CLOA 5LRRA 3FM3A 2XUBA 1O3RA 3C7JA 2ZXJA 1EH7A 4B09A 1G4DA 5D6EA 3CUQB 1ODDA 2NAZA 3C1DA 2A3SA 1FBUA 1QZYA 3WTWC 3Q9SA 3V7CA 3DQVC 2IVMA 2W57A 1BI2A 3GUDA 3RYRA 4EVIA 2FA5A 3E6DA 2RGVA 1Y0UA 1BBYA 2VE9A 3W6JB 2NS0A 3M9AA 1LQ1A 1D8KA 5HLIA 1IN7A 1MDMB 3SFZA 4F7ZA 4N9IA 1YO5C 3KP5A 3BP8A 1BC8C 4G6QA 3FM5A 5BOXA 2OAZA 1AOYA 1FYKA 1IXRC 4KMFA 2L01A 2Y0MA 1T6SA 1WWXA 2VBWA 4JQFA 5AIQA 1NHAA 4UXNA 3BWGA 2P4WA 2M5WA 1R23A 3KZYA 1O57A 4G7OF 2HWVA 1W7PB 3ECHA 2D1VA 3TOAA 1DPRA 4KMUX 4OIOF 1T98A 1F9NA 3B73A 4IHSA 2RV8A 5L3FA 1LDJA 2GQQA 3N4MA 1L3LA 2ZNZA 4OMYA 1OPCA 1H0MA 2CSOA 3MCZA 3VEPA 3CO6C 3C3WA 3E6CC 3ERED 3WTUC 4RB0A 1I27A 4ZH4F 2Q0OA 3KEQA 1F5TA 3F8CA 2ESHA 2QUFA 1FZPB 2OBPA 4NB5A 3HOTA 2X0LA 3V8KA 3Q5FA 4ENKA 2PN6A 4U0WA 1JE8A 2CO5A 3H3ZA 2H09A 2HKXA 4EQQA 4BNCA 5L3CA 3TO9A 4FHTA 2PLYA 1KYWA 2FOKA 3KCCA 3E5UA 3JSPA 3BY6A 2DT5A 2HS5A 5E18F 4LJZF 3TDUC 3TOBA 1SD5A 3FX3A 1S8NA 2MA3A 3ZMZA 2EWNA 4O5VA 2KKOA 3WGHA 1ONVA 3LAPA 3LSTA 2ACJA 3REOA 3E5QA 2CFXA 1BIAA 2L4MA 4UVCA 4U0YA 1ON2A 1FPQA 2DAOA 4MHGA 4GYGA 4PCQA 5E1ZB 3I64A 1LNWA 2EFQA 4RGUA 1ZLKA 4G9YA 3DXJF 2FE3A 1LEAA 4ON0A 5D5VB 3FWEA 1TW2A 5DD8A 2VXZA 4KIFA 4IF4A 2CQKA 2Q2EA 3M8FA 3HOSA 1HW5A 3ULQB 1U3EM 2IPQX 5JHUA 2KIMA 2FXAA 3H92A 2UXNA 3PQKA 5FLXZ 1O7FA 1LJ9A 4MNUA 4FT8A 4LMYA 5IT3A 4AWXB 2G7UA 1XSVA 2QQ9A 2W85A 2H27A 2V1UA 4RB3C 5DEQA 1ON1A 4M71A 3LA7A 1MKMA 2FBKA 4A6EA 1MZBA 1ZRFA 1TW3A 2ISYA 3SQNA 2A5YB 2W25A 2QYOA 4XRFA 4RGXA 4DQ2A 5D5UB 3E3VA 1IF1A 4HAMA 2DLLA 2CG4A 3RDIA 4G7HF 2VC0A 2FQ3A 4L9TA 2IA2A 3RKXA 4BQAA 4UNOA 4JBAA 5H20A 5HDKA 3LQQA 4XLPF 4HF0A 2F5FA 1XGMA 1B4AA 4FX0A 3JW4A 4YFXF 5E8GA 1KU2A 2ZMEB 5ILVA 4Z2YA 1HW2A 2AXLA 2BGCA 1WKMA 2J5PA 4S05A 4S04A 4KDPA 3E97A 1FP1D 6PAXA 1P92A 2ESNA 4HZFA 3K9TA 1U5TB 3V8JA 2M30A 2F2EA 3IC7A 5ICGA 4U0VA 3GZ5A 2DW4A 2DU9A 2YSRA 2PQ8A 4A5MA 4CO8A 2Y48A 3T8TA 4EM2A 5HDGA 5AIPA 2P6TA 4LGWA 3IHUA 1FOKA 3RIRA 2MLGA 2LF7A 4CZZA 1XGOA 2KRFA 4G6DA 5J8FA 2QBYA 3ZN1A 4P5OA 1ZG3A 3WTTC 2QM3A 5H6RA 5E17F 2PI0A 3WTXC 4HX8A 1FP2A 4CGZA 4I98B 1TLHB 2XHKA 4MTDA 1HQCA 2D45A 4MQ9F 3RPQA 5DCMA 2Z33A 2E7XA 3I59B 1BI3A 3R0AA 3WGIA 4FX4A 1OYWA 4LG0B 4EJUA 4HQEA 1JGSA 4LLLA 2NNNA 1HKTA 2FRHA 3FF5A 2VC1A 4RGRA 2HQNA 2R3SA 2RDPA 2QBYB 4EJTA 2ZFWA 1B1BA 5L3DA 3RJPA 5DD4A 2HGCA 4D0PA 3P9IA 4OMZA 1XSXA 2FNAA 1H9TA 4Q5SF 2NNYA 3IRRA 4KIBA 1ZG5A 4IRIA 1E2XA 3QPTA 4A0ZA 2R7FA 5D4SA 2PG4A 2YPRA 1REPC 4HV6A 2HFHA 2HYGD 3GWZA 2EFWA 1BI0A 1SD6A 4EV0A 4P9UA 1CF7A 2E1CA 4AIHA 1EV7A 4IXAA 4GCVA 2ZCWA 3FHZA 1Z7UA 4P55A 4U7DA 2XVCA 3HRUA 1FWZA 1Z6RA 3R0JA 3LFKA 2GWRA 3HYIA 1O7LA 2PMUA 3NEUA 2G9WA 1Q1HA 3WODF 1FBQA 1XN7A 3E6BA 4L9VA 2L3DA 4OINF 5D4RA 4P96A 5F1RA 1J59A 4I02A 3TO6A 1QGPA 1LEBA 1QO0D 2RVCA 2ZKZA 3TQNA 1WI9A 2JTVA 2ADUA 3KP3A 3VB2A 3U2RA 1U8RA 2ZBKA 3M1EA 3BPVA 3MFKA 1CF7B 2A69F 1MDMA 4L5IA 1B59A 3T1BA 1HBXG 2V79A 2EFNA 1FBSA 2HQRA 2O8XA 3GX4X 2JPCA 4XLNF 5K5OA 2AS5F 1GXQA 3MEXA 3IRQA 4EGYA 2B0LA 2K86A 3ABTA 3KZZA 4HDUA 2MH9A 3E5XA 2P5VA 1FYLA 5LRSA 5E20A 4KN7X 3QAHA 2IA1A 3VODA 1W5TA 4A2UA 5LGTA 2DTRA 2VT2A 2STWA 1U5TC 2BBYA 2L54A 4M73A 1XB4A 1W7PA 5CVJA 3DPLC 3S2WA 5FO5A 1RUOA 3ELKA 2KIFA 2RC4A 4BXUA 1J0RA 2PJPA 2GA1A 1KQ8A 3WTYC 3WTZA 1K6OA 3F8MA 4I01A 4M72A 1FC3A 5HLHA 4YFNF 5DYMA 2NYXA 5KK1A 5FD6A 3KEOA 1I1GA 2JZYA 3I71A 2H94A 2K4BA 3HTUA 2HEOA 2P8TA 1R1UA 3RKYA 2HTSA 2PEXA 2F5EA 2FEZA 1KYZA 4UV8A 3G73A 4M9ZA 3SXYA 3M7GA 4MEYF 1G3YA 5JI6A 1WSUA 1RZ4A 4K2EA 2VE8A 2F5CA 1SMYF 3LWFA 4KN4X 5CVRA 2CW0F 4IVNA 3GLXA 2P7CB 1FSHA 2Z9OA 3P7NA 4QLCU 2W24A 2MD5A 5HS7A 3IKTA 4UV9A 5ICCA 4EM0B 5HVQC 1UFMA 2V6CA 3F21A 1WQ2A 3FMRA 4EJOA 4QWQA 1BM9A 3HHHA 1IXCA 2V1XA 5FLXK 4LFUA 5F64A 2DQLA 1J2XA 4ZYEA 1ZH5A 2L02A 1HSTA 2VBYA 1SMTA 1LDDA 1D5VA 4KYWA 3FXQA 3BPXA 2VN2A 3GFMA 2QENA 4BAYA 2EV5A 1U2WA 4M6YA 4ENJA 1XCVA 5A2QZ 1XSDA 3R4KA 4P9FA 4A0YA 5LLQA 1TNSA 1F4KA 3W6KB 4WCGA 3L09A 2RN7A 1U78A 4N9HA 3HRTA 1FLIA 2VBZA 1YLFA 1ZAOA 5LEKA 4WXCA 1BIBA 2A61A 3DP7A 5HOOA 1QBJA 1P4XA 1T0FA 3F6VA 2TDXA 1G6NA 4LLGF 3EUHA 2JSCA 4MQVA 2V1DA 5BMZA 2QQBA 1ZN2A 3VFZA 3JAMZ 1ULYA 2LF8A 1I5ZA 3H3UA 1K78A 2GXGA 2M87A 2A6EF 2DPDA 3O6BB 3KP4A 3JTHA 1RUNA 4EM1A 2P7VB 2KJBA 3GXOA 3MWMA 3LQRA 1ZHFA 2VONA 3WE3A 5J6XA 1SFEA 2HZTA 3OV8A 3F3XA 3QRFF 2GXBA 1GHCA 2ZMEA 5BPIA 3SZPA 1I1SA 2QZ8A 4BH9A 5K1YA 4ESFA 3G3ZA 2EFOA 5FGMA 2NRAC 1DPUA 3QPHA 5E1XA
chains in the Genus database with same CATH superfamily
1DP7P 4XLAA 1D1BA 3P9KA 1UG2A 2OCEA 4XSZF 5EEHA 2DMQA 1WJFA 3DPTA 4UUTA 3GTLJ 3AG1H 3OYIA 4AIJA 1B9MA 4M9XA 1U5TA 1K78B 1S7AA 3QP5A 3CCSI 4GFBA 4B3AA 3E0JB 3JRBA 4Y4RA 1I50J 3D5LA 2EZLA 3TP3A 4HBLA 3D0SA 1WJCA 2LDUA 4ZZLA 1PP7U 5J1UA 1NG7A 2DYRH 4FISA 4OOIA 2A68F 4G94A 5E3MA 2O5RA 3GTMJ 2IJLA 2DQRA 3OIPA 2KRHA 5FKMA 2R5ZB 2CRGA 2MSYA 1S5LC 4X6AJ 1P2FA 1NTCA 2DI3A 5E1WA 3GTPJ 1PUEE 4HLXA 2UWMA 5D8KB 3CCEI 1I6XA 1IDYA 4I76A 4EEFG 2JA8J 3V7SA 1VQKI 1IN6A 3K4NA 3CJNA 4YIFA 3KFWX 5D5XB 1T33A 5J1RA 2R7RA 3S3NA 2HU9A 2HXIA 1X1BA 3HGGA 2JUGA 1WHUA 3ML6A 2QVOA 2O03A 1YHQI 2ICWG 2KLOA 1J75A 3K2ZA 4M6XA 4HYEA 4WXDA 2DA7A 2LKSA 3IH2A 1QU3A 1BR2A 4I0AA 1H88C 1USSA 3GO5A 1X3WB 1KA8A 4L5JA 3JRCA 2WA0A 2DA3A 2E19A 4HV5A 1P7JA 3F23A 1IN8A 4LD5A 4U7BA 3CMMA 3JSOA 2IT0A 1V55H 3LA3A 2K02A 2K3PA 2MBFA 3R60A 4RLQA 4PGGA 3J80Z 1ZGWA 1IG7A 2O6GE 1G3WA 4MGRA 4HSRA 4HW0A 5TISC 4HLYA 2A07F 5FKKA 3M4OJ 2OQRA 4V19K 2EILH 1OCOH 1BW6A 3FK7A 2WB1A 5J3LA 4DGWB 2EJRA 1Z3XA 4J00A 1TQPA 3SJMA 2L9NA 2MC4A 4KT6A 3I59A 4IRHA 3VYRB 1RRJA 1JHFA 1F36A 4RB1A 3A2KA 2XGXA 3W2AA 4L9JA 5JVGF 4ESJA 3VWBA 3L9FA 1XMAA 4N0BA 4UVAA 5CVVA 4IQJA 3L2UA 4LG0A 1SD7A 1Y56A 4C30A 3MZHA 2O7OA 3WU1B 2ID6A 3K0LA 3ISPA 4ZYGA 3BG5A 4CXFA 4GYIA 2Z3YA 3IL2A 2O3FA 4A3DJ 4NQWB 5K5QA 3FMSA 1FIPA 2HDDA 1WVRA 4AVPA 1ETQA 5H6QA 1IUYA 2VPLA 3WG9A 1DUXC 5FD5A 3ONQA 4PSWA 4Y52J 1S6LA 3Q0WA 2IP2A 3HEFA 4BUPA 3EQLF 1FX7A 1EH8A 1S7OA 2CWEA 3OYGA 4E7IA 3KLNA 1MJ9A 2JUCA 5LFAA 1KU3A 2R7WA 1WCMJ 1T38A 2FBIA 5L3EA 3C2HA 2JPBA 4ZC3A 4ZDPA 3F72A 3DEEA 5IPAA 4CCJA 3PUBA 5D5WB 2E1MB 3L2CA 5AONA 2E34A 1ZG1A 3FZVA 3GTGJ 4YFKF 3BR3A 4B48A 3V7RA 3CC2I 5B3SH 4G8XA 2BE5F 1H8AC 5IT9Z 3P5JA 1QZEA 2DDAA 1TNTA 5TRDA 1FMWA 1P4AA 1SFXA 3QWLA 1VNDA 3PFIA 2CUEA 2P81A 4PJLA 3L7WA 5DUKA 3TGNA 3GFIA 4LLNA 4BE1A 2BV6A 4OU0A 4HF2A 3M8EA 4L5EA 2Q8KA 1ZGJA 2X6XA 1MH3A 2EFPA 1V54H 2L7ZA 2DFFA 1NK3P 5EG0B 2HYJA 1OMIA 4WF2A 1AKHA 1MNMC 4BQNA 4MTEA 3TP0A 5M5WJ 3RZOJ 1VQ5I 3N05A 1TWHJ 2FNPA 4Q4ZF 2M8EA 1VTNC 4KFCA 5ICFA 2GLOA 3SZTA 3IWZA 1GV2A 1YW9A 2L9RA 2QSHX 3VYSB 5DUIA 3PQJA 1OKRA 2Y31A 1G3TA 3ZQFA 1HSJA 2CUZA 2VBXA 2FU4A 3ABKH 4IOCF 4IO9F 3MKZA 2Y2ZA 5HS8A 2PBIA 3B02A 5DV5A 1YW8A 3FMQA 3ZQCA 4AUXA 3EETA 2UXXA 2ISZA 3C18A 3F8NA 1ACIA 2XPVA 1R58A 2YR2A 3R61A 3BZ6A 1UHMA 4ETSA 4YELA 1LB2A 3IH4A 3S32A 4A3LJ 2COBA 4YIIA 3RPUA 4O3MA 4C2MJ 4QTRA 4ZYHA 4LB5A 1B9NA 4R1HA 3BG6A 2EV6A 5KAFC 1NH3A 5EDNA 3AAFA 4MFEA 2FSWA 1TQIA 1U6GA 1JKOC 4Z6YA 1KGSA 1T39A 1R36A 2VQCA 3LSMA 2LREA 2M8GX 1U8BA 1V4RA 2BXYA 4U87A 4HA8A 3BG9A 5TGTA 3RI4A 2ELKA 3A4CA 4YG2F 1LDKB 1I6HJ 4BHPA 4PDKA 4RS8A 4W1UA 4BY7J 1MBHA 3B6AA 1KU9A 3WE2A 1AU7A 2ECCA 4HX4A 3FBIB 3GMEA 3KLOA 3PNYA 1N77A 1FSEA 2VJIA 4L9NA 1QQIA 4M9SA 3OYAA 9ANTA 4XMYA 1D0ZA 2OF7A 4B4CA 1H89C 1IRGA 2BW3B 3KE2A 2M0MA 3OYMA 2KL4A 3CUOA 3O3KA 3FBNB 1J9IA 4NC6A 2EZIA 2K9NA 3LA2A 2QEXI 1XTAA 4W97A 1X1AA 2LH9A 2WTEA 2L5QA 5FKNA 2DOFA 4CUGA 4GXOA 3CC7I 2XRLA 1HCRA 3BG3A 4L0YB 3VSKA 3EDPA 1D8JA 3J81Z 2EV0A 3ZPLA 4B8XA 2ZJQF 3CP2A 2F5DA 3K70D 5LHGA 2V9VA 2WWYA 5K7ZA 5IYBJ 2CQ7A 2VJ5A 4Q47A 3F8BA 2JRTA 1RR7A 2HPIA 4TV7A 2FMLA 5IOZA 4RMNA 5JFRA 3MN2A 2BVMA 3LL7A 2E71A 4JP0A 1DDNA 3BR5A 3G2BA 1JHHA 5J1YA 3JRDA 3TKYA 2DFIA 1W7PD 2DK5A 4R8HA 4BEHA 5EF6A 1QNTA 2AQFA 3RKWA 4PUSA 4XKBA 2MABA 2R92J 1P4WA 4BHCA 3H5RA 2JQ7A 5C3EJ 2R4GA 2KIUA 3SHFA 5M5YJ 1YS7A 2MW8A 2P5LC 3LAJA 2VQLA 5HDNA 4PFPA 3HRSA 2XKPA 2QSGX 2LKXA 4XN3A 1SFUA 5ED4A 4UVBA 1TL8A 2GAUA 3KYDB 2XIGA 3PFYA 1UHSA 2ZXIA 1MIJA 1V3FA 2FJ1A 3E6MA 3NQOA 2VUMJ 1R4MB 5DCFA 2IW5A 5BQTA 1YS6A 2OD5A 2KRCA 3DTEA 2VL8A 2XRNA 5BPDA 1IUFA 4XICA 2Z16A 3L2RA 3ZQHA 1XD7A 4XLFA 1ETXA 2E2HJ 3EYIA 4M6VA 1V5GA 3M3YJ 1HKSA 4DZPA 4KA4A 1LKXA 4F93B 5D8LB 1WJEA 1CQTA 3WTVC 2EA2A 1RC9A 2W1OA 1ETKA 1LVAA 1WFXA 2QWWA 5CVUA 3ROUA 4B3XA 1Z91A 5BS6A 3BR6A 1GXPA 4DZJA 3O8GA 4XONA 3VYTB 3OOPA 1OISA 2OA4A 3KZIC 2LKPA 1M1EB 2XGEA 3EUAA 1NG6A 4LK0F 2LY2A 4BEHB 1QPMA 2ME0A 2QSFX 1ZREA 3NAUA 5ERIA 2BY0A 3SZGA 2KQRA 3BJ6A 1HOMA 4ZYDA 3LSIA 2PMZA 4BBRJ 1HKQA 2YUSA 4HDVA 4OAZA 3GCMA 1MJBA 3FHNA 2XPUA 3HIFA 1FTTA 1W4MA 3MD2A 4WX9A 4WK8F 2DK8A 1PP8F 3WU0A 2QCOA 1SVMA 2DMPA 5GADJ 1K7AA 3I4PA 2VOOA 3S3OA 2HI3A 5LBQA 4HF1A 2HVRA 3JR9A 4EGZA 5A2QK 3I0TA 4ESBA 2EINH 2XV4S 3IUOA 4A5NA 2UUZA 4A3MJ 5GAHJ 1Q1VA 3I55I 2CQXA 1WZ2A 4CHUA 2GA2A 1Z9CA 3KETA 3Q3SA 4QPQA 3HSRA 4XOTA 3ABUA 1K79A 3ZMVA 2E1NA 1K83J 5HLGA 1R4NB 1YX5A 1NK2P 1D0YA 1U9OA 4CZCA 2QA4I 3HSEA 1XCBA 2XPWA 4F3QA 2E1MC 3DF8A 1W5SA 3HKZN 3IAM2 5DDGA 3OYJA 1RI7A 4G7ZF 3BG7A 1SAXA 3LSRA 1ZRDA 4CDGA 3JTGA 1QZZA 2LR8A 2HDCA 2E60A 3ZQGA 4OIRF 2IGKA 3VOEA 3WTSC 4DJAA 4DBRA 3GLLA 3ZXSA 2FBHA 4A3IJ 3JAMK 3GTQJ 2DDBA 1DPUA 1TTYA 2DO7A 2IRFG 1R49A 3MZ8A 3KP6A 3K1PA 1LUJB 2XB5A 3DFGA 1MJAA 1V5FA 2D5VA 2DJIA 1W0TA 3I58A 4EJWA 2ZJRF 1XGNA 2CYYA 4Y17A 4FETA 1DQUA 1G3SA 3U9GA 3K7AJ 2DOAA 4HOBA 3J7AO 1OLTA 2NVUB 4DNCA 3H5AA 3FXUA 1MBFA 3OWTA 3HSFA 2HQAA 4BQQA 3T5XA 4XORA 3WGGA 3H0DA 1D3YA 4DYQA 3Q9VA 3OYFA 2HOEA 4U88A 1PUFA 2XAHA 1R5ID 2H8WA 2IBDA 2Y75A 1XDSA 3AG2H 3K1MA 4PJNA 3OYHA 1EH6A 1S9HA 2E2JJ 5GTHC 3JRFA 3HBLA 3HXLA 4ASNA 1YFHA 2DA5A 2XAGA 5EZGA 2CQNA 1Y1VJ 4UY8I 2IGOA 5C44J 1YYVA 2XAQA 1BI1A 2KMUA 5TJJA 3ZQQA 3RYPA 1IN5A 3K4KA 3UKGA 2GZWA 4II3A 2YU3A 3HM5A 1ZRCA 1A04A 5ILSA 1UJ8A 3LSGA 3P9CA 4PJ0C 1FT9A 4O6JA 3S16J 2ZNYA 2IS4A 3JRAA 2CW7A 2LP0A 2E1OA 4KT5C 3W2VA 4D5FA 1XPXA 1T2KA 3R6SA 3OSFA 4I7HA 1GV5A 1MMGA 2ELHA 1B72A 1MSFC 2L7FP 1F1ZA 1IAWA 2STTA 2BHZA 1EA3A 1O3TA 1WRJA 3CTAA 1TWCJ 3CJRB 4HQMA 3M8JA 3T0YA 1JGGA 4A3CJ 2L7KA 4IKFA 4WXHA 1KZHA 5J8CA 4D5CA 3FK6A 1Y8RB 3I5UA 4A6DA 1BR1A 2AO9A 2JMWA 2YX7A 1RIOH 2L2OA 3QYBA 3CDHA 1YIJI 1XMKA 2FMYA 3ESWB 1OCRH 4H0EA 4LB6B 3ZP5A 1OR7C 1RETA 2WAEA 3KP7A 5EEAA 2OQGA 1RNLA 4BU2A 1Z1DA 4Y15A 3CCQI 2MC3A 1A6IA 5FFXA 3X2QH 3K6GA 1TWAJ 1R00A 2ZO4A 4ENNA 3N97A 1UZCA 2OU2A 1Y39A 4LITA 1ZYRF 4PGHA 4ZZDA 3J80K 5IP9J 3OIQA 1IZ1A 1FY7A 2R5ZA 4HX7A 5EEGA 3IKVA 1JXSA 2Y9ZA 4UB8C 4EJVA 2D1HA 1B72B 3O8HA 3TO7A 4M3FA 3ZN0A 2BEOA 4MLOA 2VASA 3ZQ7A 2ZC2A 2P6SA 2MFZA 2LK2A 3QU6A 4NBQA 4UHTA 3G6EI 2XAFA 5LHHA 3BROA 3FISA 2H6BA 4GO1A 3F9KA 3IH3A 2LYCA 2O8KA 4A12A 4A3EJ 2RKHA 1YW7A 1J7KA 2M1BA 2CQQA 2YX4A 4NC8A 2NS7A 4L0ZB 4NUBA 2OZ6A 2NVYJ 2OPTA 5F08A 4RGSA 3HRMA 2ECBA 5LGNA 2F4IA 2WC2A 3BTCA 4II2A 3TDZC 3F8FA 4KNYA 4KICA 4ENMA 2DYSH 3CQZJ 5E79C 3F6OA 2BY3A 1YE9A 2HXOA 1E3PA 2OV7A 3V4GA 2JT1A 2PMHA 4XQFA 2EK5A 1JKPC 1IRFA 3ZMUA 2DA4A 2KJCA 2VB6A 1FMVA 5FROA 3MZYA 1Y1WJ 3CDLA 4C2TA 3FDYA 1MD0A 3K4CA 4CCKA 2W84A 2W00A 5CYVA 1UB9A 4FASD 3NRVA 2M4KA 1X3ZB 5F0CA 3J7YJ 2XC7A 3VSLA 2Q2EB 1HXDA 2E7WA 1T08B 4I09A 1X1DA 3CUQC 3A1YA 3L1PA 2R7TA 1X4PA 1TBXA 2E36A 3BJOA 4Q48A 3OS0A 4I6ZA 1USTA 2J5OA 5CVIA 4B47A 2P5KA 1T56A 2IA0A 5LHIA 1MNDA 3CCUI 2IGNA 3DCFA 1OYIA 4D7NA 4BXFA 4KIGA 4XM3A 3V42A 3QP6A 4NQWA 3GEZA 1P6RA 3QOEA 4XSXF 5IT9K 3JRIA 1QPIA 3K69A 2Z99A 4AVZA 2EIKH 1R22A 1TWFJ 3BJAA 3HHGA 4IRGA 3EYYA 3CC4I 1TWGJ 1VFCA 2PFBA 2HTJA 2X4HA 3HPHA 4NHJA 1Y0NA 3AG4H 4HG2A 1ZARA 3TBIA 1AHDP 3CZ6A 1SEUA 4R79A 5M3MJ 4Y13A 4XLHA 3PNTA 3H36A 3DV8A 4I0BA 2COMA 1IW7F 4FTHA 5J40A 3T8RA 5GAEJ 2K7LA 2GIVA 4UUVA 1Z3YA 3SDBA 2R7XA 4XOPA 5GAGJ 1FYMA 1BJAA 1AWCA 1TP4A 3U1DA 4IX7A 1IN4A 4GRIA 4JYKA 1S3JA 1XGSA 4RB2C 4XKWA 4YEJA 3KX2A 1XS9A 1R5HA 3G1LA 2B63J 3A03A 1PVEA 2LFBA 2I8DA 2VI6A 3HUGA 1S29A 3ZMTA 2H6CA 5LEJA 1O3SA 2D2WA 2M34A 5L3GA 4RA2A 3F22A 5D6FA 4BHBA 2OCCH 2M7BA 3I54A 5EG0A 4CICA 2HPMA 5JR3A 2RQPA 3ZMDA 1J5YA 2EQRA 2Y9YA 2W82A 1C0WA 4OIQF 3PUFA 2VT3A 1DU0A 3D5RC 2F6CA 1SD4A 2TRTA 4KITB 3E1SA 5F6FA 3DKWA 4J01A 2Y69H 2G0EA 2VOPA 1YQAA 3KYCB 5B1BH 2QQAA 4DYRA 4E7LA 1SFOJ 2GIZA 3HPGA 4L18B 4RAZA 1B6AA 1DGRM 2JRMA 5HNHA 4EMSA 4AD9A 2RNJA 3DTKA 3ECOA 1ZR4A 3SFIA 1IC8A 4LOCA 1JUPA 4JK1X 3GW2A 1JUMA 5JVTA 4GGGA 1HW1A 4DW6A 2CGPA 4IHTA 3L00A 3FKJA 3HUGB 3TMOA 1ZLJA 1FNNA 3J7ZI 3COAC 5F0FA 1R5GA 1KQ0A 4BBSJ 1KU7A 4BL0B 4BKXA 2KPMA 2XASA 5FKOA 3FXRA 1YIOA 2DPUA 1OCPA 4OIPF 3MVPA 2XKOA 1UCRA 3I53A 2DT6A 3RPUD 5KVRA 1L0OC 1OYYA 5JLWA 3J81K 2XROA 1XC5A 4MEXF 5CQGA 5FFZA 4YIRX 3KP2A 3S8PA 3D1NI 1BOAA 4ZTJA 3O2PE 2XAJA 1R1VA 1XDUA 3QQAA 2KZGA 2HYFA 1STZA 3MQ0A 1GLNA 3KIOA 5K5RA 5L3BA 2Z5UA 4RM2A 3GF2A 5GP9A 2VQHA 3C2BA 5CJ9A 3JRHA 3LNQA 2BW3A 5CQEA 1OR7A 3M1CA 2VKVA 2IS6A 2L7MP 2IEKA 4ZDOA 3GFLA 3LSJA 2K27A 2WBMA 3ZMSA 3JRGA 3OR2C 3GVAA 2QQ8A 4IJAA 3OYKA 2EZHA 4LK1F 1BC7C 3QYFA 2BYVE 2LSOA 3HL2A 5EGOA 4E70A 1D5YA 1IXSB 2LD5A 5DCMB 5GPCA 4OWRB 3EUKL 2R5YA 4ZTFA 3CJTB 3IWFA 1PDNC 4DIQA 2WAQN 2Y0SN 3CMAI 3BOQA 4I2OA 1X3UA 1R71A 3CO7C 1X19A 2K40A 3BDDA 3GFJA 4IPAA 3DBHB 2WY7Q 1QHHD 5FLVA 4M74A 1U9NA 2DMTA 1UG0A 1YG2A 2NVXJ 2L4AA 1BL0A 3FIWA 1RPWA 1R7JA 5LGUA 2YU9J 2MGQA 3BT9A 2ZJ2A 4WWCA 1KQ9A 1FIAA 1Z6TA 4ITVA 2CFOA 3H35A 1ZGAA 3OIOA 4XBFA 4Y7NJ 2DJNA 1IV8A 1GT0C 2LNBA 1WJAA 3DU6A 5ILUA 2G7HA 1ETYA 1E17A 2EB7A 2M45A 2R7DA 1VF9A 1OCCH 2O0YA 3QU3A 4QSHA 1YTYA 1LFUP 2HNHA 2K4JA 3MAJA 4PZJA 4BDZA 4D1QA 1H9GA 1W0UA 1FTZA 1QVTA 3HZJA 3QOPA 2CW8A 4BYYA 1TQMA 1YITI 5EGOB 3DLLF 2MH2A 3RTRA 5HS9A 4MO7A 1JT6A 2NOJB 5CLSA 4KUMA 3OY9A 2R5YB 1Z05A 1FOYA 1UHWA 1IGNA 2C6YA 3S14J 4CYCB 3CUQA 1R1TA 5FLMJ 3V8LA 2MG4A 2ETHA 1GVJA 1W1WE 4RAYA 3K1NA 5FB2A 3LSPA 1WI3A 3A01B 1TZLA 1WGXA 3DBLB 2KHMA 2MLKA 3S17J 2OZUA 1ZK8A 1D0XA 2RNGA 3GZ6A 1YX3A 4BS9A 2M3AA 2QF7A 3GYHX 1MGTA 2EA4A 3I56I 5E8IA 2IAIA 4B44A 5J4YA 1AA7A 2HOAA 3VPRA 1O3QA 2KIQA 2DTZA 3ZRGA 1BN5A 3Q0UA 2HKOA 3I4MJ 4CH7A 2A6HF 4CYDA 2FF4A 1QVUA 3RSNA 2QLZA 5EZHA 2WV1A 1CGPA 2O9LA 5FKLA 4AIKA 1JTXA 3HKZA 4A0XA 3DEUA 3H9QA 2CH0A 2XGCA 2HR3A 2WV0A 3M07A 4A93J 2VODA 5ICEA 3HTSB 3CCMI 1DGWY 2DBBA 2O61A 2UZKA 1YJNI 3CLOA 5LRRA 3FM3A 3TW7A 2XUBA 1LFBA 3S2HJ 1O3RA 2HVQA 3WG7H 3C7JA 2BVLA 4RDUA 2ZXJA 4AC0A 1EH7A 2KT0A 3HGYA 4B09A 1G4DA 1YRNB 3ZR8X 2IS1A 5D6EA 3CUQB 1FJLA 1ODDA 2NAZA 4RAFA 3AKZA 1BW5A 3IP4B 2YS9A 2KZVA 3C1DA 2A3SA 2A6TA 1FBUA 1QZYA 3HJEA 4C3JJ 3WTWC 3Q9SA 1LFPA 3W3CA 3DQVC 3V7CA 2IVMA 1WJDA 2KP6A 2W57A 1BI2A 2EIJH 3GUDA 1MBJA 4FCYA 3RYRA 4EVIA 2FA5A 3W6VA 3E6DA 2RGVA 1ORKA 3G1OA 4AU7A 1IRZA 1Y0UA 1BBYA 2VE9A 4AM3A 5IY5H 1Y6IA 3W6JB 3I4NJ 4BY1J 2NS0A 3M9AA 3OYBA 2KDOA 1LQ1A 1D8KA 5HLIA 1X4OA 4YRVA 1IN7A 1MDMB 1YOVB 3DLAA 3SFZA 3BQYA 4N9IA 4F7ZA 1YO5C 3KP5A 3BP8A 2XGDA 1BC8C 4G6QA 2V7FA 3FM5A 5IP6A 5BOXA 1E3HA 1N25A 1DU6A 1MMDA 4M3GA 2OAZA 1AOYA 4D9JA 1FYKA 3UNGC 3HOWJ 1IXRC 1XG1A 4KMFA 2L01A 2W4SA 2Y0MA 3PO2J 1T6SA 1WWXA 2DA6A 2LMDA 4A3KJ 3HDDA 3OL4A 2VBWA 2XAUA 5IYDJ 2ELJA 1OFCX 1HA8A 1VQOI 4JQFA 4N4NB 2I5UA 2V1NA 2AHQA 5AIQA 1QRYA 1NHAA 3DWLE 4ABZA 3QYEA 2EZKA 4UXNA 1N75A 5IP7J 3CMYA 2R7OA 3BWGA 2P4WA 1B8IB 3K10A 2GOXB 2M5WA 4XLEA 1I39A 1R23A 3KZYA 5E3LA 1OQYA 2X48A 1O57A 4G7OF 3S93A 2VXDA 2HWVA 3OYDA 1W7PB 1QHGA 3ECHA 3H9GA 2D1VA 3TOAA 4AYBN 1DPRA 4ZDLA 1S72I 2M0CA 4KMUX 1N78A 1LVKA 1TT5B 4OIOF 1T98A 1F9NA 3B73A 4IHSA 2RV8A 2HOTA 5L3FA 2R7VA 1LDJA 2GQQA 3N4MA 1ZKGA 1L3LA 1O4XA 2ZNZA 4NC7A 3K2AA 4A3JJ 4OMYA 1G2HA 5F04A 3TEDA 1OPCA 3S2DJ 3LSHA 4BE0A 2Q1ZB 1H0MA 3CF5F 3FXKA 2CSOA 2DA1A 3MCZA 3VEPA 4MIMA 3C3WA 3CO6C 3E6CC 3WTUC 3ERED 4RB0A 1I27A 1ITYA 4ZH4F 2Q0OA 3KEQA 1SANA 1F5TA 3JCUC 3F8CA 2ESHA 2QUFA 1K4TA 1FZPB 4M3DA 2OBPA 1VQLI 4NB5A 3AL0C 5JLXA 3HOTA 3L2QA 1ERDA 2X0LA 3V8KA 4AIDA 3Q5FA 2VPRA 3KPHA 4ENKA 2PN6A 4M3EA 4U0WA 4N4OB 3TW6A 1JE8A 4M3BA 2CO5A 4XIDA 4XR6A 4IQ4A 3K4LA 3KYLA 4E7SA 3H3ZA 4G12A 3MKLA 2CU7A 2H09A 2HKXA 3VDXA 4EQQA 4BNCA 1HF0A 4S0HB 5L3CA 2X1EA 3FKIJ 3TO9A 4FHTA 2PLYA 5KHDA 1KYWA 3S15J 1V5EA 1LPQA 3G1MA 3DEWA 2IS2A 1FOXA 2FOKA 3W2WA 3KCCA 3E5UA 3JSPA 3BY6A 2BOLA 2DT5A 4X1EA 1ZR2A 3A0HC 2HS5A 5E18F 3S1RJ 4LJZF 3OYLA 3ABLH 3TDUC 3TOBA 1SD5A 2LG4A 4V2GA 5CPRB 2EBIA 3BZKA 1DP3A 1MH4A 3FX3A 2XF6A 1S8NA 1WJ5A 2MA3A 3ZMZA 2EWNA 2L0KA 1W5CC 3NWTA 1ETVA 4O5VA 2KKOA 3WGHA 1ONVA 3LAPA 3LSTA 3BC8A 2OJED 2ACJA 3REOA 3E5QA 3BTLA 2CFXA 3Q0VA 1S7EA 2HDWA 3ZCOA 1MBKA 2CV2A 4HNUA 2B9SA 1UAAA 3SDGA 1BIAA 2L4MA 4UVCA 4CSWA 4U0YA 1ON2A 5JHFA 1FPQA 2DAOA 4MHGA 5KCMA 1XMXA 4GYGA 4PCQA 5E1ZB 2R93J 2R7UA 3WHBA 5FRNA 1PYVA 3AFHA 1UMQA 3I64A 1LNWA 2EFQA 3CJQB 4JX4A 4RGUA 1ZLKA 4G9YA 4Y3OA 3DXJF 1SVOA 1OJLA 2FE3A 1LEAA 4ON0A 1A5JA 2RAEA 3FWEA 5D5VB 1TW2A 2DT7B 5DD8A 2VXZA 1HDDC 4KIFA 1BJZA 4IF4A 4CCOA 2CQKA 2Q2EA 2EIMH 2K3FA 3FXMA 3M8FA 3HOSA 2ZFUA 4NNJA 3QPSA 1HW5A 3ULQB 3PO3J 3HB9A 3TL4X 2IPQX 1U3EM 3CCJI 3RQIA 5JHUA 2KIMA 2FXAA 3H92A 2UXNA 2JJ7A 3PQKA 4B43A 5FLXZ 1O7FA 1SFKA 2DOEA 1LJ9A 3PSIA 4MNUA 4HSTA 4FT8A 4D7MA 1OCZH 4LMYA 5IT3A 4AWXB 2G7UA 3E7LA 1XSVA 3SEQA 2QQ9A 4QPOA 3IV5A 2W85A 2H27A 4HRIA 4DOZA 2V1UA 2XSJC 5B1AH 4RB3C 5DEQA 1ON1A 1FEXA 4M71A 3LA7A 3CP8A 1MKMA 2FBKA 4A6EA 1MZBA 1ZRFA 1TW3A 2ISYA 1YJ9I 3HC7A 3CCYA 5IYCJ 3H0GJ 2NVQJ 5FJ8J 1ZQ3P 1WH5A 2M7AA 3SQNA 2A5YB 3DBRB 3NARA 3U21A 2W25A 2QYOA 4XRFA 4RGXA 2CV0A 2AQEA 3QPLA 4DQ2A 5D5UB 2KISA 2X1DA 3E3VA 1IF1A 4HAMA 2DFEA 3GBGA 1I3AA 2CG4A 2DLLA 3PJRA 3RDIA 4G7HF 2X6OA 2VC0A 2FQ3A 4L9TA 2IA2A 3RKXA 4HNTA 4F92B 1GUUA 4BQAA 2V6EA 3L2VA 4UNOA 4JBAA 2JA5J 3GZNB 5H20A 5HDKA 3LQQA 4XLPF 1KONA 2DODA 4HF0A 4LG3A 2F5FA 2WAFA 1XGMA 1B4AA 4FX0A 3BCAA 3JW4A 5E8GA 4YFXF 1KU2A 2ZMEB 3ZGKA 4Z2YA 5ILVA 1HW2A 2AXLA 2BGCA 1E0EA 3ABMH 4PSXA 2A05A 3HOZJ 1WKMA 3ZQIA 2PJRB 3DKYA 2J5PA 4S05A 4S04A 2CUFA 2ME6A 2R7ZJ 4KDPA 3E97A 1FP1D 4XL9A 6PAXA 1P92A 2ESNA 4HZFA 3K9TA 5F1JA 4I99C 2JA7J 5DM6F 2RQQA 3LOCA 1VQPI 1F43A 1OCTC 1U5TB 3V8JA 2M30A 2F2EA 2TCTA 3IC7A 5ICGA 3K70C 3KEYA 4U0VA 3GZ5A 4UB6C 2DW4A 3PIOF 1EJ9A 2DU9A 2YSRA 3OL3A 5HLTA 1X58A 1APLC 2PQ8A 5HODA 4A5MA 4CO8A 2ZXWH 2A5WA 2Y48A 4Y33A 4EATA 5DS9A 2W7NA 1TC3C 3H9JA 3T8TA 4EM2A 3JREA 4P1WA 5HDGA 5AIPA 1RKWA 2P6TA 3UR3C 4LGWA 3BTJA 3IHUA 2K85A 3FXLA 3DPUA 1SC7A 1FOKA 3RIRA 2IXSA 1JKRC 2MLGA 2WAQA 2LF7A 2Y0SA 2XF5A 3ZOBA 4CZZA 1JT0A 3BR0A 1XGOA 4XKVA 3CD6I 4PJMA 2Y30A 3A02A 2KRFA 2R7QA 2BHYA 4C3HJ 3PNVA 2IGMA 4G6DA 2X1CA 5J8FA 3S1QJ 2QBYA 3ZN1A 4P5OA 1ZG3A 3WTTC 4A3FJ 2GBYA 3CF2A 2V9PA 3OSGA 3D5SC 2QM3A 2LBFA 1WPKA 3I3LA 1SAUA 5H6RA 5E17F 2M9HA 2PI0A 1X1CA 3WTXC 1K6YA 3ERMA 4HX8A 4A69C 3U1KA 1FP2A 4CGZA 1PJRA 3IAS2 3MKWB 4I98B 1TLHB 2XHKA 4ZJZA 1HQCA 4MTDA 2D45A 4IHWA 1Z77A 4MQ9F 4J19A 4IEJA 1VQMI 2DA2A 5DCMA 3RPQA 2Z33A 2E7XA 3PL8A 2ZSIB 4LIUA 3I59B 2HZDA 1BI3A 4XRMA 3R0AA 3CESA 3WGIA 5LD2C 4FX4A 1OYWA 1WJBA 2QKMB 4E4HA 4LG0B 4EJUA 4HQEA 1YJWI 1JGSA 2EPFA 2LVSA 4LLLA 2NNNA 5K7HA 1HKTA 1ZELA 4XKCA 1IJWC 2FRHA 3FF5A 2KDZA 2FUG2 3GTJJ 2VC1A 3LMMA 4RGRA 4XNFA 1HDPA 2HQNA 2R3SA 3G4SI 3AL0B 2RDPA 2QBYB 4BGDA 1W36D 4RLFA 4C9YA 4EJTA 3OS1A 2ZFWA 5H2FC 1B1BA 4IHYA 4E7ZA 5L3DA 3RJPA 2LBFB 5DD4A 2V26A 4BJ6C 2HGCA 2WB1N 4D0PA 3P9IA 4OMZA 4NDLA 2LY1A 2NOGA 1XSXA 2M2EA 2FNAA 4C3IJ 5EJCA 1QA6A 3H1CA 1H9TA 4GDFA 3CLQA 4Q5SF 4E6KG 4UUSA 2VKDA 2NNYA 3IRRA 4KIBA 1ZG5A 4IRIA 1E2XA 4H4KC 3QPTA 4A0ZA 4HNVA 4CYCA 4IHVA 2GXAA 4IHXA 2E5ZA 2R7FA 4XK4A 5D4SA 2HOSA 2BY2A 3A01A 1Y8QB 2PG4A 2N8GA 2YPRA 3QODA 4B1RA 1REPC 1GDTA 2BY1A 4HV6A 2HFHA 2V4JC 5K7FA 3GTOJ 2H1KA 3CCVI 2HYGD 3GWZA 2EH3A 3DKXA 3RCOA 2EFWA 1BI0A 3BCBA 3OR1C 3L2WA 2XDVA 3HG9A 2LY9A 2JVHA 1SD6A 2K9QA 5GPAA 4EV0A 4P9UA 1AKHB 3OOUA 4DBQA 1CF7A 1JJ6C 1D1CA 2E1CA 4AIHA 1EV7A 4IXAA 4GCVA 4BJ5C 2ZCWA 5M3FJ 3F0CA 3OS2A 4JOMA 4XN0A 3FHZA 1Z7UA 2WY8Q 1ENHA 3H5NA 4P55A 4U7DA 3BR2A 2B7EA 5E3OA 2DN0A 3LSKA 2XVCA 5BNGA 3HRUA 1FWZA 1Z7LA 4UUSB 1Z6RA 3R0JA 3LFKA 2GWRA 1EF4A 3HYIA 1O7LA 1YRNA 2PMUA 2QKLB 3BLYA 3BZCA 3NEUA 2G9WA 3SEZA 3HOUJ 1Q1HA 1T0FC 3WODF 1FBQA 1XN7A 1JI8A 3DTIA 3E6BA 2R0QC 1A31A 3EPZA 2L3DA 4L9VA 4OINF 4P96A 5D4RA 3EUHC 5F1RA 4I02A 1J59A 2FOWA 2MD0A 3TO6A 2ZJPF 1QGPA 2OC6A 1LEBA 1QO0D 2RVCA 2ZKZA 3FXOA 1WI9A 4JX6A 3TQNA 4HEA2 2JTVA 5CKTA 2ADUA 5GTIC 1X2NA 3KP3A 3VB2A 3U2RA 5B66C 1JJ8C 1U8RA 2X6WA 2ZBKA 2OUMA 4RM3A 1TT0A 4X0GA 3M1EA 4LIVA 1IRXA 2RREA 3BPVA 5J47A 3MFKA 3PM1A 1CF7B 2BXZA 2A69F 1MDMA 4L5IA 1B59A 2DCEA 2V9KA 2XF7A 1HC8A 1G59A 1MBGA 3T1BA 1HBXG 2V79A 2EFNA 1FBSA 2HQRA 2X51A 3MKYB 2M4GA 4AYBA 1LE8A 2O8XA 1UELB 3GX4X 1MNEA 2JPCA 2X9DA 4XLNF 2VKHA 5K5OA 2AS5F 1Z67A 2NS8A 2VKEA 1GXQA 3MEXA 4F55A 3IRQA 1VQNI 2Z2SB 4EGYA 1EKEA 1P7IA 2ZMEC 2ZB9A 2B0LA 2K86A 4XRSG 3ABTA 4PK4A 1BR4A 3KZZA 4HDUA 5FRMA 2MH9A 1MBEA 5IOYA 3E5XA 1RKTA 2P5VA 1FYLA 5F27A 5J4VA 3AG3H 5LRSA 2MYSA 1Z0XA 5E20A 2LRDA 4KN7X 3QAHA 2IA1A 5DTDA 2NXNB 2I10A 3VODA 3OYCA 3CCRI 1W5TA 4A2UA 1B8IA 5LGTA 4DYCA 2DTRA 2VT2A 2STWA 1BOBA 2JSPA 4PFOA 1U5TC 2BBYA 2L54A 2DMUA 4RAGA 4M73A 1XB4A 3RZDJ 1W7PA 5CVJA 3DPLC 3S2WA 1MSEC 5FO5A 1RUOA 3ELKA 4IOAF 2KIFA 2OTJI 2RC4A 4OAYA 4BXUA 1J0RA 2X6YA 3HOYJ 1SVLA 3RQ4A 4BJTA 2PJPA 1G8XA 2GA1A 1KQ8A 3WTYC 2L9VA 3S1MJ 3WTZA 1K6OA 3F8MA 4E7KA 4ZYAA 1LE8B 1X2MA 4I01A 1VQ6I 4M72A 1FC3A 5KAIC 5HLHA 4YFNF 3HOXJ 4HPQA 5DYMA 4RBOA 2NYXA 3RKQA 5KK1A 2VJJA 3BR1A 5FD6A 3KEOA 3G71I 1I1GA 4XRSA 2JZYA 5B5EC 1IDZA 1WH7A 2W48A 2JN6A 2H94A 3I71A 4BE2A 2K4BA 3HTUA 2XB0X 2CS3A 1D1AA 2HEOA 1R6RA 2LLKA 4E7JA 2P8TA 2HVSA 1R1UA 3RKYA 3HOVJ 4CCMA 2HTSA 4FQGA 1MMNA 2PEXA 3S3MA 2F5EA 2DFHA 2FEZA 4PJJA 1T8IA 1KYZA 3PSFA 2VLAA 4UV8A 2GOMA 1ETWA 1Z21A 1E3OC 1MMSA 3G73A 4M9ZA 3SXYA 2F4OB 3M7GA 4MEYF 4MFDA 3J7AY 3BQZA 1G3YA 3SYTA 2JK3A 5JI6A 1WSUA 1A6QA 1RR8C 1RZ4A 1RESA 4K2EA 2VE8A 2F5CA 1SMYF 2ID3A 3LWFA 4KN4X 1ZTRA 3WHCA 3WU2C 5CVRA 1J09A 2CW0F 4IVNA 3GTKJ 3C2GA 3GLXA 2NVTJ 4JX5A 2P7CB 1P9QC 2LC2A 1VZ0A 1FSHA 1VI0A 3CCLI 2Z9OA 3P7NA 4QLCU 2W24A 2MD5A 5HS7A 3IKTA 4UV9A 5ICCA 2QGUA 5M5XJ 4EM0B 2DXIA 5HVQC 2JWTA 3K4BA 1UFMA 2P0WA 4FE4A 4F52A 2V6CA 2LOOA 3F21A 1I3QJ 2K9LA 1WQ2A 3ZQLA 1XX5A 3FMRA 1MW7A 1VQ7I 1VQ4I 4V2FA 4A3BJ 4EJOA 1IO2A 4QWQA 2WADA 1BM9A 3HHHA 3B6CA 1IXCA 2V1XA 2ZSHB 5FLXK 4LFUA 5F64A 2VIXA 1IV6A 1R9TJ 3H3VK 4BXXJ 1HLVA 2DQLA 1J2XA 3K4JA 4ZYEA 1ZH5A 5KNLA 2XSDC 2L02A 4IL6C 2OTLI 1HSTA 2VBYA 5HNFA 1SMTA 1LDDA 1D5VA 4KYWA 5C4JJ 1POGA 3FXQA 2PMZN 3BPXA 2VN2A 1YI2I 2JVGA 1JTYA 3GFMA 2QENA 4BAYA 1A35A 2R7SA 2FX0A 2EV5A 1T95A 3S1NJ 1U2WA 4M6YA 4ENJA 3FXJA 3I9V2 1XCVA 4CCNA 4C2UA 1ETOA 2F5VA 3NWSA 3OMYA 5A2QZ 1XSDA 5E3NA 3R4KA 3BTIA 4P9FA 4A0YA 5LLQA 1TNSA 2BZTA 1F4KA 3W6KB 4WCGA 1JUSA 2PX9A 1K61A 2H8RA 3OYNA 1VQ8I 3A0BC 2CMPA 3L09A 3PIPF 2RN7A 2JA6J 1U78A 4N9HA 3HRTA 2LTPA 3VYUB 1FLIA 1MMAA 2VBZA 1YLFA 2VJ4A 4QIWN 2E2IJ 1ZAOA 5LEKA 4WXCA 4BACA 5F0HA 1X1PA 1BIBA 2A61A 3DP7A 2K5CA 5HOOA 1QBJA 1VQ9I 1P4XA 1T0FA 2ZXHA 3F6VA 2F4MB 2TDXA 5DM7F 4ANJA 1PUFB 2CUJA 1G6NA 1U0JA 4LLGF 4IZZA 4KJZA 2UV1A 5C4XJ 3EUHA 2JSCA 2DMNA 4MQVA 2V1DA 2FQ4A 5BMZA 2QQBA 1ZN2A 3VFZA 4XLCA 3JAMZ 3LFUA 4E7HA 1GVDA 4A3GJ 4CA0A 2VQGA 1ULYA 3OYEA 2LF8A 1I5ZA 3H3UA 1K78A 3CMEI 2GXGA 2M87A 2A6EF 1JKQC 2AXTC 3O6BB 3KP4A 2DPDA 3JTHA 1RUNA 4EM1A 3CDIA 2P7VB 2KJBA 2E35A 3GXOA 3K4MA 4FE7A 3MWMA 2K9MA 2FD5A 4BDYA 2L9SA 3LQRA 3DU5A 4F91B 4CCLA 1BA5A 1ZHFA 2VONA 3MMYB 2KFDA 1FOWA 5EYRA 2CJJA 3WE3A 5J6XA 2F48A 1SFEA 2HQ5A 2HZTA 3OV8A 1K4SA 3F3XA 3QRFF 2GXBA 1GHCA 3ASNH 2ZMEA 5BPIA 1W36C 1A36A 3ASOH 3SZPA 1I1SA 2K9SA 4G6TB 2QZ8A 4BH9A 2Z1DA 5K1YA 4KISA 2JA2A 4ESFA 3G3ZA 2EFOA 2PJRA 5FGMA 2CV1A 2NRAC 2GM4A 4BQOA 2E5NA 2X85A 3QPHA 5E1XA 2H1LA
chains in the Genus database with same CATH topology
1DP7P 3P9KA 4XSZF 5EEHA 3DPTA 4AIJA 1B9MA 4M9XA 1U5TA 1K78B 1S7AA 3QP5A 3D5LA 4ZZLA 4HBLA 3D0SA 1PP7U 2LDUA 4OOIA 2A68F 4G94A 2IJLA 2DQRA 1P2FA 2DI3A 5E1WA 1PUEE 4HLXA 2UWMA 5D8KB 1I6XA 3V7SA 1IN6A 3CJNA 4YIFA 3KFWX 5D5XB 3ML6A 2QVOA 2O03A 1J75A 3K2ZA 4M6XA 4HYEA 4WXDA 4I0AA 1USSA 3GO5A 1KA8A 4L5JA 4HV5A 3F23A 1IN8A 4LD5A 4U7BA 3JSOA 2IT0A 3LA3A 2K02A 3R60A 2MBFA 2O6GE 4PGGA 3J80Z 1G3WA 4MGRA 4HLYA 4HW0A 2A07F 2OQRA 2EJRA 1TQPA 3I59A 4IRHA 1JHFA 4RB1A 2XGXA 4L9JA 4ESJA 3L9FA 1XMAA 4N0BA 4UVAA 5CVVA 4LG0A 1SD7A 3MZHA 3WU1B 3K0LA 3ISPA 4ZYGA 4CXFA 4GYIA 2Z3YA 3IL2A 2O3FA 5K5QA 3FMSA 4AVPA 5H6QA 1IUYA 3WG9A 1DUXC 5FD5A 1S6LA 2IP2A 3EQLF 1FX7A 1EH8A 1S7OA 2CWEA 3KLNA 1MJ9A 1KU3A 1T38A 2FBIA 5L3EA 2JPBA 3F72A 5D5WB 3L2CA 5AONA 1ZG1A 3FZVA 4YFKF 3V7RA 4G8XA 2BE5F 5IT9Z 1TNTA 5TRDA 1P4AA 1SFXA 3PFIA 5DUKA 3L7WA 3GFIA 3TGNA 4LLNA 4HF2A 2BV6A 4OU0A 3M8EA 2Q8KA 1ZGJA 2EFPA 1OMIA 4WF2A 4MTEA 2FNPA 4Q4ZF 2M8EA 1VTNC 4KFCA 5ICFA 3SZTA 3IWZA 1YW9A 5DUIA 3PQJA 1OKRA 1G3TA 1HSJA 2VBXA 2FU4A 5HS8A 2PBIA 3B02A 5DV5A 1YW8A 3FMQA 3EETA 2UXXA 2ISZA 3C18A 3F8NA 1R58A 2YR2A 3R61A 3BZ6A 1UHMA 4ETSA 1LB2A 4YIIA 3RPUA 4O3MA 4ZYHA 4LB5A 1B9NA 4R1HA 2EV6A 3AAFA 2FSWA 1TQIA 1U6GA 1KGSA 1T39A 1R36A 1V4RA 4HA8A 3RI4A 4YG2F 1LDKB 4BHPA 4PDKA 4RS8A 1KU9A 3WE2A 4HX4A 3KLOA 1FSEA 4L9NA 1QQIA 4M9SA 1IRGA 3KE2A 3CUOA 3O3KA 1J9IA 3LA2A 2WTEA 4GXOA 4L0YB 3EDPA 1D8JA 3J81Z 2EV0A 3ZPLA 4B8XA 2F5DA 5LHGA 2V9VA 2WWYA 4Q47A 3F8BA 2JRTA 4TV7A 2FMLA 5JFRA 1DDNA 1JHHA 3TKYA 2DFIA 2DK5A 1W7PD 4R8HA 1QNTA 3RKWA 1P4WA 4BHCA 2KIUA 3SHFA 1YS7A 2P5LC 3LAJA 5HDNA 3HRSA 2XKPA 1SFUA 5ED4A 4UVBA 2GAUA 2XIGA 1V3FA 3E6MA 3NQOA 5DCFA 2IW5A 5BQTA 1YS6A 2OD5A 2XRNA 5BPDA 1XD7A 3EYIA 1HKSA 4KA4A 5D8LB 3WTVC 2EA2A 2QWWA 1LVAA 3ROUA 5CVUA 1Z91A 5BS6A 1GXPA 3OOPA 2OA4A 2LKPA 4LK0F 1QPMA 1ZREA 5ERIA 3BJ6A 4ZYDA 1HKQA 4HDVA 1MJBA 3HIFA 1W4MA 4WX9A 4WK8F 1PP8F 2DK8A 3WU0A 1K7AA 3I4PA 2VOOA 5LBQA 4HF1A 4EGZA 5A2QK 3I0TA 4ESBA 2XV4S 4A5NA 4CHUA 2GA2A 1Z9CA 3KETA 3HSRA 3ABUA 1K79A 3ZMVA 2E1NA 5HLGA 3HSEA 1XCBA 3DF8A 4G7ZF 1W5SA 5DDGA 1RI7A 1SAXA 1ZRDA 4CDGA 3JTGA 1QZZA 2HDCA 4OIRF 3VOEA 3WTSC 2FBHA 3JAMK 1TTYA 2DO7A 2IRFG 3KP6A 3K1PA 1MJAA 3DFGA 3I58A 4EJWA 1XGNA 2CYYA 4Y17A 1G3SA 3U9GA 4HOBA 3J7AO 4DNCA 3FXUA 3HSFA 3T5XA 3WGGA 1D3YA 3Q9VA 2HOEA 4U88A 2XAHA 2Y75A 1XDSA 3K1MA 1EH6A 4ASNA 1YFHA 2XAGA 1YYVA 2XAQA 1BI1A 5TJJA 3RYPA 1IN5A 2GZWA 2YU3A 1ZRCA 1A04A 5ILSA 3P9CA 1FT9A 4O6JA 2ZNYA 4KT5C 1T2KA 3R6SA 4I7HA 2ELHA 1F1ZA 1IAWA 2STTA 1O3TA 1WRJA 3CTAA 4HQMA 3T0YA 4WXHA 5J8CA 3I5UA 4A6DA 2YX7A 1RIOH 3CDHA 1XMKA 2FMYA 4H0EA 4LB6B 3ZP5A 3KP7A 2OQGA 1RNLA 1Z1DA 4Y15A 2MC3A 5FFXA 1R00A 2ZO4A 4ENNA 3N97A 2OU2A 1ZYRF 4PGHA 4ZZDA 3J80K 1IZ1A 1FY7A 4HX7A 5EEGA 3IKVA 1JXSA 4EJVA 2D1HA 3TO7A 3ZN0A 2BEOA 3ZQ7A 2P6SA 3QU6A 4UHTA 2XAFA 5LHHA 3BROA 4GO1A 2H6BA 4A12A 2RKHA 1YW7A 1J7KA 2M1BA 2YX4A 4L0ZB 2OZ6A 4RGSA 3HRMA 5LGNA 2WC2A 3TDZC 4KNYA 3F8FA 4KICA 4ENMA 3F6OA 3V4GA 2JT1A 2PMHA 2EK5A 1IRFA 3ZMUA 2KJCA 3MZYA 1MD0A 2W84A 5CYVA 1UB9A 3NRVA 1HXDA 2E7WA 4I09A 3CUQC 1TBXA 3BJOA 4Q48A 1USTA 2J5OA 5CVIA 2P5KA 2IA0A 5LHIA 1OYIA 4KIGA 3QP6A 4NQWA 3GEZA 1P6RA 4XSXF 5IT9K 3K69A 2Z99A 1R22A 3BJAA 3HHGA 4IRGA 3EYYA 2PFBA 2HTJA 2X4HA 4NHJA 1ZARA 4R79A 4Y13A 3DV8A 4I0BA 2COMA 1IW7F 3T8RA 2K7LA 2GIVA 4UUVA 1FYMA 1BJAA 1AWCA 3U1DA 1IN4A 1S3JA 1XGSA 4RB2C 1R5HA 3HUGA 1S29A 3ZMTA 2H6CA 5LEJA 1O3SA 2D2WA 5L3GA 3F22A 5D6FA 4BHBA 3I54A 4CICA 5JR3A 2RQPA 3ZMDA 1J5YA 1C0WA 4OIQF 2VT3A 1SD4A 5F6FA 3DKWA 2VOPA 1YQAA 2QQAA 4L18B 4RAZA 1B6AA 4EMSA 4AD9A 2RNJA 3ECOA 4JK1X 3GW2A 5JVTA 4GGGA 1HW1A 2CGPA 4IHTA 3L00A 1ZLJA 1FNNA 3COAC 1R5GA 1KQ0A 1KU7A 2XASA 3FXRA 1YIOA 2DPUA 4OIPF 2XKOA 1UCRA 3I53A 3J81K 5KVRA 1L0OC 1OYYA 2XROA 4MEXF 5FFZA 3KP2A 1BOAA 3O2PE 2XAJA 1R1VA 1XDUA 2HYFA 1STZA 3MQ0A 5K5RA 5L3BA 2Z5UA 3GF2A 5CJ9A 1OR7A 3GFLA 2K27A 3ZMSA 3GVAA 4IJAA 4LK1F 1BC7C 2BYVE 2LSOA 4E70A 1IXSB 5DCMB 3IWFA 1PDNC 4I2OA 3BOQA 1X3UA 3CO7C 3BDDA 3GFJA 4IPAA 4M74A 1YG2A 2L4AA 1R7JA 5LGUA 2ZJ2A 4WWCA 1KQ9A 1Z6TA 1ZGAA 4XBFA 2LNBA 5ILUA 2G7HA 1E17A 2EB7A 2M45A 2R7DA 2O0YA 3QU3A 1YTYA 2K4JA 3MAJA 4PZJA 1H9GA 3QOPA 4BYYA 1TQMA 2MH2A 3RTRA 5HS9A 5CLSA 4KUMA 1Z05A 1UHWA 2C6YA 3CUQA 1R1TA 3V8LA 2ETHA 1GVJA 4RAYA 3K1NA 5FB2A 2MLKA 2OZUA 3GZ6A 3GYHX 1MGTA 2EA4A 5E8IA 1O3QA 1BN5A 2HKOA 2A6HF 4CYDA 2FF4A 2QLZA 1CGPA 4AIKA 4A0XA 3DEUA 2HR3A 2WV0A 2VODA 5ICEA 3HTSB 2O61A 2DBBA 2UZKA 3CLOA 5LRRA 3FM3A 2XUBA 1O3RA 3C7JA 2ZXJA 1EH7A 4B09A 1G4DA 5D6EA 3CUQB 1ODDA 2NAZA 3C1DA 2A3SA 1FBUA 1QZYA 3WTWC 3Q9SA 3V7CA 3DQVC 2IVMA 2W57A 1BI2A 3GUDA 3RYRA 4EVIA 2FA5A 3E6DA 2RGVA 1Y0UA 1BBYA 2VE9A 3W6JB 2NS0A 3M9AA 1LQ1A 1D8KA 5HLIA 1IN7A 1MDMB 3SFZA 4F7ZA 4N9IA 1YO5C 3KP5A 3BP8A 1BC8C 4G6QA 3FM5A 5BOXA 2OAZA 1AOYA 1FYKA 1IXRC 4KMFA 2L01A 2Y0MA 1T6SA 1WWXA 2VBWA 4JQFA 5AIQA 1NHAA 4UXNA 3BWGA 2P4WA 2M5WA 1R23A 3KZYA 1O57A 4G7OF 2HWVA 1W7PB 3ECHA 2D1VA 3TOAA 1DPRA 4KMUX 4OIOF 1T98A 1F9NA 3B73A 4IHSA 2RV8A 5L3FA 1LDJA 2GQQA 3N4MA 1L3LA 2ZNZA 4OMYA 1OPCA 1H0MA 2CSOA 3MCZA 3VEPA 3CO6C 3C3WA 3E6CC 3ERED 3WTUC 4RB0A 1I27A 4ZH4F 2Q0OA 3KEQA 1F5TA 3F8CA 2ESHA 2QUFA 1FZPB 2OBPA 4NB5A 3HOTA 2X0LA 3V8KA 3Q5FA 4ENKA 2PN6A 4U0WA 1JE8A 2CO5A 3H3ZA 2H09A 2HKXA 4EQQA 4BNCA 5L3CA 3TO9A 4FHTA 2PLYA 1KYWA 2FOKA 3KCCA 3E5UA 3JSPA 3BY6A 2DT5A 2HS5A 5E18F 4LJZF 3TDUC 3TOBA 1SD5A 3FX3A 1S8NA 2MA3A 3ZMZA 2EWNA 4O5VA 2KKOA 3WGHA 1ONVA 3LAPA 3LSTA 2ACJA 3REOA 3E5QA 2CFXA 1BIAA 2L4MA 4UVCA 4U0YA 1ON2A 1FPQA 2DAOA 4MHGA 4GYGA 4PCQA 5E1ZB 3I64A 1LNWA 2EFQA 4RGUA 1ZLKA 4G9YA 3DXJF 2FE3A 1LEAA 4ON0A 5D5VB 3FWEA 1TW2A 5DD8A 2VXZA 4KIFA 4IF4A 2CQKA 2Q2EA 3M8FA 3HOSA 1HW5A 3ULQB 1U3EM 2IPQX 5JHUA 2KIMA 2FXAA 3H92A 2UXNA 3PQKA 5FLXZ 1O7FA 1LJ9A 4MNUA 4FT8A 4LMYA 5IT3A 4AWXB 2G7UA 1XSVA 2QQ9A 2W85A 2H27A 2V1UA 4RB3C 5DEQA 1ON1A 4M71A 3LA7A 1MKMA 2FBKA 4A6EA 1MZBA 1ZRFA 1TW3A 2ISYA 3SQNA 2A5YB 2W25A 2QYOA 4XRFA 4RGXA 4DQ2A 5D5UB 3E3VA 1IF1A 4HAMA 2DLLA 2CG4A 3RDIA 4G7HF 2VC0A 2FQ3A 4L9TA 2IA2A 3RKXA 4BQAA 4UNOA 4JBAA 5H20A 5HDKA 3LQQA 4XLPF 4HF0A 2F5FA 1XGMA 1B4AA 4FX0A 3JW4A 4YFXF 5E8GA 1KU2A 2ZMEB 5ILVA 4Z2YA 1HW2A 2AXLA 2BGCA 1WKMA 2J5PA 4S05A 4S04A 4KDPA 3E97A 1FP1D 6PAXA 1P92A 2ESNA 4HZFA 3K9TA 1U5TB 3V8JA 2M30A 2F2EA 3IC7A 5ICGA 4U0VA 3GZ5A 2DW4A 2DU9A 2YSRA 2PQ8A 4A5MA 4CO8A 2Y48A 3T8TA 4EM2A 5HDGA 5AIPA 2P6TA 4LGWA 3IHUA 1FOKA 3RIRA 2MLGA 2LF7A 4CZZA 1XGOA 2KRFA 4G6DA 5J8FA 2QBYA 3ZN1A 4P5OA 1ZG3A 3WTTC 2QM3A 5H6RA 5E17F 2PI0A 3WTXC 4HX8A 1FP2A 4CGZA 4I98B 1TLHB 2XHKA 4MTDA 1HQCA 2D45A 4MQ9F 3RPQA 5DCMA 2Z33A 2E7XA 3I59B 1BI3A 3R0AA 3WGIA 4FX4A 1OYWA 4LG0B 4EJUA 4HQEA 1JGSA 4LLLA 2NNNA 1HKTA 2FRHA 3FF5A 2VC1A 4RGRA 2HQNA 2R3SA 2RDPA 2QBYB 4EJTA 2ZFWA 1B1BA 5L3DA 3RJPA 5DD4A 2HGCA 4D0PA 3P9IA 4OMZA 1XSXA 2FNAA 1H9TA 4Q5SF 2NNYA 3IRRA 4KIBA 1ZG5A 4IRIA 1E2XA 3QPTA 4A0ZA 2R7FA 5D4SA 2PG4A 2YPRA 1REPC 4HV6A 2HFHA 2HYGD 3GWZA 2EFWA 1BI0A 1SD6A 4EV0A 4P9UA 1CF7A 2E1CA 4AIHA 1EV7A 4IXAA 4GCVA 2ZCWA 3FHZA 1Z7UA 4P55A 4U7DA 2XVCA 3HRUA 1FWZA 1Z6RA 3R0JA 3LFKA 2GWRA 3HYIA 1O7LA 2PMUA 3NEUA 2G9WA 1Q1HA 3WODF 1FBQA 1XN7A 3E6BA 4L9VA 2L3DA 4OINF 5D4RA 4P96A 5F1RA 1J59A 4I02A 3TO6A 1QGPA 1LEBA 1QO0D 2RVCA 2ZKZA 3TQNA 1WI9A 2JTVA 2ADUA 3KP3A 3VB2A 3U2RA 1U8RA 2ZBKA 3M1EA 3BPVA 3MFKA 1CF7B 2A69F 1MDMA 4L5IA 1B59A 3T1BA 1HBXG 2V79A 2EFNA 1FBSA 2HQRA 2O8XA 3GX4X 2JPCA 4XLNF 5K5OA 2AS5F 1GXQA 3MEXA 3IRQA 4EGYA 2B0LA 2K86A 3ABTA 3KZZA 4HDUA 2MH9A 3E5XA 2P5VA 1FYLA 5LRSA 5E20A 4KN7X 3QAHA 2IA1A 3VODA 1W5TA 4A2UA 5LGTA 2DTRA 2VT2A 2STWA 1U5TC 2BBYA 2L54A 4M73A 1XB4A 1W7PA 5CVJA 3DPLC 3S2WA 5FO5A 1RUOA 3ELKA 2KIFA 2RC4A 4BXUA 1J0RA 2PJPA 2GA1A 1KQ8A 3WTYC 3WTZA 1K6OA 3F8MA 4I01A 4M72A 1FC3A 5HLHA 4YFNF 5DYMA 2NYXA 5KK1A 5FD6A 3KEOA 1I1GA 2JZYA 3I71A 2H94A 2K4BA 3HTUA 2HEOA 2P8TA 1R1UA 3RKYA 2HTSA 2PEXA 2F5EA 2FEZA 1KYZA 4UV8A 3G73A 4M9ZA 3SXYA 3M7GA 4MEYF 1G3YA 5JI6A 1WSUA 1RZ4A 4K2EA 2VE8A 2F5CA 1SMYF 3LWFA 4KN4X 5CVRA 2CW0F 4IVNA 3GLXA 2P7CB 1FSHA 2Z9OA 3P7NA 4QLCU 2W24A 2MD5A 5HS7A 3IKTA 4UV9A 5ICCA 4EM0B 5HVQC 1UFMA 2V6CA 3F21A 1WQ2A 3FMRA 4EJOA 4QWQA 1BM9A 3HHHA 1IXCA 2V1XA 5FLXK 4LFUA 5F64A 2DQLA 1J2XA 4ZYEA 1ZH5A 2L02A 1HSTA 2VBYA 1SMTA 1LDDA 1D5VA 4KYWA 3FXQA 3BPXA 2VN2A 3GFMA 2QENA 4BAYA 2EV5A 1U2WA 4M6YA 4ENJA 1XCVA 5A2QZ 1XSDA 3R4KA 4P9FA 4A0YA 5LLQA 1TNSA 1F4KA 3W6KB 4WCGA 3L09A 2RN7A 1U78A 4N9HA 3HRTA 1FLIA 2VBZA 1YLFA 1ZAOA 5LEKA 4WXCA 1BIBA 2A61A 3DP7A 5HOOA 1QBJA 1P4XA 1T0FA 3F6VA 2TDXA 1G6NA 4LLGF 3EUHA 2JSCA 4MQVA 2V1DA 5BMZA 2QQBA 1ZN2A 3VFZA 3JAMZ 1ULYA 2LF8A 1I5ZA 3H3UA 1K78A 2GXGA 2M87A 2A6EF 2DPDA 3O6BB 3KP4A 3JTHA 1RUNA 4EM1A 2P7VB 2KJBA 3GXOA 3MWMA 3LQRA 1ZHFA 2VONA 3WE3A 5J6XA 1SFEA 2HZTA 3OV8A 3F3XA 3QRFF 2GXBA 1GHCA 2ZMEA 5BPIA 3SZPA 1I1SA 2QZ8A 4BH9A 5K1YA 4ESFA 3G3ZA 2EFOA 5FGMA 2NRAC 1DPUA 3QPHA 5E1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DP7 P;  3P9K A;  4XSZ F;  5EEH A;  3DPT A;  4AIJ A;  1B9M A;  4M9X A;  1U5T A;  1K78 B;  1S7A A;  3QP5 A;  3D5L A;  4ZZL A;  4HBL A;  3D0S A;  1PP7 U;  2LDU A;  4OOI A;  2A68 F;  4G94 A;  2IJL A;  2DQR A;  1P2F A;  2DI3 A;  5E1W A;  1PUE E;  4HLX A;  2UWM A;  5D8K B;  1I6X A;  3V7S A;  1IN6 A;  3CJN A;  4YIF A;  3KFW X;  5D5X B;  3ML6 A;  2QVO A;  2O03 A;  1J75 A;  3K2Z A;  4M6X A;  4HYE A;  4WXD A;  4I0A A;  1USS A;  3GO5 A;  1KA8 A;  4L5J A;  4HV5 A;  3F23 A;  1IN8 A;  4LD5 A;  4U7B A;  3JSO A;  2IT0 A;  3LA3 A;  2K02 A;  3R60 A;  2MBF A;  2O6G E;  4PGG A;  3J80 Z;  1G3W A;  4MGR A;  4HLY A;  4HW0 A;  2A07 F;  2OQR A;  2EJR A;  1TQP A;  3I59 A;  4IRH A;  1JHF A;  4RB1 A;  2XGX A;  4L9J A;  4ESJ A;  3L9F A;  1XMA A;  4N0B A;  4UVA A;  5CVV A;  4LG0 A;  1SD7 A;  3MZH A;  3WU1 B;  3K0L A;  3ISP A;  4ZYG A;  4CXF A;  4GYI A;  2Z3Y A;  3IL2 A;  2O3F A;  5K5Q A;  3FMS A;  4AVP A;  5H6Q A;  1IUY A;  3WG9 A;  1DUX C;  5FD5 A;  1S6L A;  2IP2 A;  3EQL F;  1FX7 A;  1EH8 A;  1S7O A;  2CWE A;  3KLN A;  1MJ9 A;  1KU3 A;  1T38 A;  2FBI A;  5L3E A;  2JPB A;  3F72 A;  5D5W B;  3L2C A;  5AON A;  1ZG1 A;  3FZV A;  4YFK F;  3V7R A;  4G8X A;  2BE5 F;  5IT9 Z;  1TNT A;  5TRD A;  1P4A A;  1SFX A;  3PFI A;  5DUK A;  3L7W A;  3GFI A;  3TGN A;  4LLN A;  4HF2 A;  2BV6 A;  4OU0 A;  3M8E A;  2Q8K A;  1ZGJ A;  2EFP A;  1OMI A;  4WF2 A;  4MTE A;  2FNP A;  4Q4Z F;  2M8E A;  1VTN C;  4KFC A;  5ICF A;  3SZT A;  3IWZ A;  1YW9 A;  5DUI A;  3PQJ A;  1OKR A;  1G3T A;  1HSJ A;  2VBX A;  2FU4 A;  5HS8 A;  2PBI A;  3B02 A;  5DV5 A;  1YW8 A;  3FMQ A;  3EET A;  2UXX A;  2ISZ A;  3C18 A;  3F8N A;  1R58 A;  2YR2 A;  3R61 A;  3BZ6 A;  1UHM A;  4ETS A;  1LB2 A;  4YII A;  3RPU A;  4O3M A;  4ZYH A;  4LB5 A;  1B9N A;  4R1H A;  2EV6 A;  3AAF A;  2FSW A;  1TQI A;  1U6G A;  1KGS A;  1T39 A;  1R36 A;  1V4R A;  4HA8 A;  3RI4 A;  4YG2 F;  1LDK B;  4BHP A;  4PDK A;  4RS8 A;  1KU9 A;  3WE2 A;  4HX4 A;  3KLO A;  1FSE A;  4L9N A;  1QQI A;  4M9S A;  1IRG A;  3KE2 A;  3CUO A;  3O3K A;  1J9I A;  3LA2 A;  2WTE A;  4GXO A;  4L0Y B;  3EDP A;  1D8J A;  3J81 Z;  2EV0 A;  3ZPL A;  4B8X A;  2F5D A;  5LHG A;  2V9V A;  2WWY A;  4Q47 A;  3F8B A;  2JRT A;  4TV7 A;  2FML A;  5JFR A;  1DDN A;  1JHH A;  3TKY A;  2DFI A;  2DK5 A;  1W7P D;  4R8H A;  1QNT A;  3RKW A;  1P4W A;  4BHC A;  2KIU A;  3SHF A;  1YS7 A;  2P5L C;  3LAJ A;  5HDN A;  3HRS A;  2XKP A;  1SFU A;  5ED4 A;  4UVB A;  2GAU A;  2XIG A;  1V3F A;  3E6M A;  3NQO A;  5DCF A;  2IW5 A;  5BQT A;  1YS6 A;  2OD5 A;  2XRN A;  5BPD A;  1XD7 A;  3EYI A;  1HKS A;  4KA4 A;  5D8L B;  3WTV C;  2EA2 A;  2QWW A;  1LVA A;  3ROU A;  5CVU A;  1Z91 A;  5BS6 A;  1GXP A;  3OOP A;  2OA4 A;  2LKP A;  4LK0 F;  1QPM A;  1ZRE A;  5ERI A;  3BJ6 A;  4ZYD A;  1HKQ A;  4HDV A;  1MJB A;  3HIF A;  1W4M A;  4WX9 A;  4WK8 F;  1PP8 F;  2DK8 A;  3WU0 A;  1K7A A;  3I4P A;  2VOO A;  5LBQ A;  4HF1 A;  4EGZ A;  5A2Q K;  3I0T A;  4ESB A;  2XV4 S;  4A5N A;  4CHU A;  2GA2 A;  1Z9C A;  3KET A;  3HSR A;  3ABU A;  1K79 A;  3ZMV A;  2E1N A;  5HLG A;  3HSE A;  1XCB A;  3DF8 A;  4G7Z F;  1W5S A;  5DDG A;  1RI7 A;  1SAX A;  1ZRD A;  4CDG A;  3JTG A;  1QZZ A;  2HDC A;  4OIR F;  3VOE A;  3WTS C;  2FBH A;  3JAM K;  1TTY A;  2DO7 A;  2IRF G;  3KP6 A;  3K1P A;  1MJA A;  3DFG A;  3I58 A;  4EJW A;  1XGN A;  2CYY A;  4Y17 A;  1G3S A;  3U9G A;  4HOB A;  3J7A O;  4DNC A;  3FXU A;  3HSF A;  3T5X A;  3WGG A;  1D3Y A;  3Q9V A;  2HOE A;  4U88 A;  2XAH A;  2Y75 A;  1XDS A;  3K1M A;  1EH6 A;  4ASN A;  1YFH A;  2XAG A;  1YYV A;  2XAQ A;  1BI1 A;  5TJJ A;  3RYP A;  1IN5 A;  2GZW A;  2YU3 A;  1ZRC A;  1A04 A;  5ILS A;  3P9C A;  1FT9 A;  4O6J A;  2ZNY A;  4KT5 C;  1T2K A;  3R6S A;  4I7H A;  2ELH A;  1F1Z A;  1IAW A;  2STT A;  1O3T A;  1WRJ A;  3CTA A;  4HQM A;  3T0Y A;  4WXH A;  5J8C A;  3I5U A;  4A6D A;  2YX7 A;  1RIO H;  3CDH A;  1XMK A;  2FMY A;  4H0E A;  4LB6 B;  3ZP5 A;  3KP7 A;  2OQG A;  1RNL A;  1Z1D A;  4Y15 A;  2MC3 A;  5FFX A;  1R00 A;  2ZO4 A;  4ENN A;  3N97 A;  2OU2 A;  1ZYR F;  4PGH A;  4ZZD A;  3J80 K;  1IZ1 A;  1FY7 A;  4HX7 A;  5EEG A;  3IKV A;  1JXS A;  4EJV A;  2D1H A;  3TO7 A;  3ZN0 A;  2BEO A;  3ZQ7 A;  2P6S A;  3QU6 A;  4UHT A;  2XAF A;  5LHH A;  3BRO A;  4GO1 A;  2H6B A;  4A12 A;  2RKH A;  1YW7 A;  1J7K A;  2M1B A;  2YX4 A;  4L0Z B;  2OZ6 A;  4RGS A;  3HRM A;  5LGN A;  2WC2 A;  3TDZ C;  4KNY A;  3F8F A;  4KIC A;  4ENM A;  3F6O A;  3V4G A;  2JT1 A;  2PMH A;  2EK5 A;  1IRF A;  3ZMU A;  2KJC A;  3MZY A;  1MD0 A;  2W84 A;  5CYV A;  1UB9 A;  3NRV A;  1HXD A;  2E7W A;  4I09 A;  3CUQ C;  1TBX A;  3BJO A;  4Q48 A;  1UST A;  2J5O A;  5CVI A;  2P5K A;  2IA0 A;  5LHI A;  1OYI A;  4KIG A;  3QP6 A;  4NQW A;  3GEZ A;  1P6R A;  4XSX F;  5IT9 K;  3K69 A;  2Z99 A;  1R22 A;  3BJA A;  3HHG A;  4IRG A;  3EYY A;  2PFB A;  2HTJ A;  2X4H A;  4NHJ A;  1ZAR A;  4R79 A;  4Y13 A;  3DV8 A;  4I0B A;  2COM A;  1IW7 F;  3T8R A;  2K7L A;  2GIV A;  4UUV A;  1FYM A;  1BJA A;  1AWC A;  3U1D A;  1IN4 A;  1S3J A;  1XGS A;  4RB2 C;  1R5H A;  3HUG A;  1S29 A;  3ZMT A;  2H6C A;  5LEJ A;  1O3S A;  2D2W A;  5L3G A;  3F22 A;  5D6F A;  4BHB A;  3I54 A;  4CIC A;  5JR3 A;  2RQP A;  3ZMD A;  1J5Y A;  1C0W A;  4OIQ F;  2VT3 A;  1SD4 A;  5F6F A;  3DKW A;  2VOP A;  1YQA A;  2QQA A;  4L18 B;  4RAZ A;  1B6A A;  4EMS A;  4AD9 A;  2RNJ A;  3ECO A;  4JK1 X;  3GW2 A;  5JVT A;  4GGG A;  1HW1 A;  2CGP A;  4IHT A;  3L00 A;  1ZLJ A;  1FNN A;  3COA C;  1R5G A;  1KQ0 A;  1KU7 A;  2XAS A;  3FXR A;  1YIO A;  2DPU A;  4OIP F;  2XKO A;  1UCR A;  3I53 A;  3J81 K;  5KVR A;  1L0O C;  1OYY A;  2XRO A;  4MEX F;  5FFZ A;  3KP2 A;  1BOA A;  3O2P E;  2XAJ A;  1R1V A;  1XDU A;  2HYF A;  1STZ A;  3MQ0 A;  5K5R A;  5L3B A;  2Z5U A;  3GF2 A;  5CJ9 A;  1OR7 A;  3GFL A;  2K27 A;  3ZMS A;  3GVA A;  4IJA A;  4LK1 F;  1BC7 C;  2BYV E;  2LSO A;  4E70 A;  1IXS B;  5DCM B;  3IWF A;  1PDN C;  4I2O A;  3BOQ A;  1X3U A;  3CO7 C;  3BDD A;  3GFJ A;  4IPA A;  4M74 A;  1YG2 A;  2L4A A;  1R7J A;  5LGU A;  2ZJ2 A;  4WWC A;  1KQ9 A;  1Z6T A;  1ZGA A;  4XBF A;  2LNB A;  5ILU A;  2G7H A;  1E17 A;  2EB7 A;  2M45 A;  2R7D A;  2O0Y A;  3QU3 A;  1YTY A;  2K4J A;  3MAJ A;  4PZJ A;  1H9G A;  3QOP A;  4BYY A;  1TQM A;  2MH2 A;  3RTR A;  5HS9 A;  5CLS A;  4KUM A;  1Z05 A;  1UHW A;  2C6Y A;  3CUQ A;  1R1T A;  3V8L A;  2ETH A;  1GVJ A;  4RAY A;  3K1N A;  5FB2 A;  2MLK A;  2OZU A;  3GZ6 A;  3GYH X;  1MGT A;  2EA4 A;  5E8I A;  1O3Q A;  1BN5 A;  2HKO A;  2A6H F;  4CYD A;  2FF4 A;  2QLZ A;  1CGP A;  4AIK A;  4A0X A;  3DEU A;  2HR3 A;  2WV0 A;  2VOD A;  5ICE A;  3HTS B;  2O61 A;  2DBB A;  2UZK A;  3CLO A;  5LRR A;  3FM3 A;  2XUB A;  1O3R A;  3C7J A;  2ZXJ A;  1EH7 A;  4B09 A;  1G4D A;  5D6E A;  3CUQ B;  1ODD A;  2NAZ A;  3C1D A;  2A3S A;  1FBU A;  1QZY A;  3WTW C;  3Q9S A;  3V7C A;  3DQV C;  2IVM A;  2W57 A;  1BI2 A;  3GUD A;  3RYR A;  4EVI A;  2FA5 A;  3E6D A;  2RGV A;  1Y0U A;  1BBY A;  2VE9 A;  3W6J B;  2NS0 A;  3M9A A;  1LQ1 A;  1D8K A;  5HLI A;  1IN7 A;  1MDM B;  3SFZ A;  4F7Z A;  4N9I A;  1YO5 C;  3KP5 A;  3BP8 A;  1BC8 C;  4G6Q A;  3FM5 A;  5BOX A;  2OAZ A;  1AOY A;  1FYK A;  1IXR C;  4KMF A;  2L01 A;  2Y0M A;  1T6S A;  1WWX A;  2VBW A;  4JQF A;  5AIQ A;  1NHA A;  4UXN A;  3BWG A;  2P4W A;  2M5W A;  1R23 A;  3KZY A;  1O57 A;  4G7O F;  2HWV A;  1W7P B;  3ECH A;  2D1V A;  3TOA A;  1DPR A;  4KMU X;  4OIO F;  1T98 A;  1F9N A;  3B73 A;  4IHS A;  2RV8 A;  5L3F A;  1LDJ A;  2GQQ A;  3N4M A;  1L3L A;  2ZNZ A;  4OMY A;  1OPC A;  1H0M A;  2CSO A;  3MCZ A;  3VEP A;  3CO6 C;  3C3W A;  3E6C C;  3ERE D;  3WTU C;  4RB0 A;  1I27 A;  4ZH4 F;  2Q0O A;  3KEQ A;  1F5T A;  3F8C A;  2ESH A;  2QUF A;  1FZP B;  2OBP A;  4NB5 A;  3HOT A;  2X0L A;  3V8K A;  3Q5F A;  4ENK A;  2PN6 A;  4U0W A;  1JE8 A;  2CO5 A;  3H3Z A;  2H09 A;  2HKX A;  4EQQ A;  4BNC A;  5L3C A;  3TO9 A;  4FHT A;  2PLY A;  1KYW A;  2FOK A;  3KCC A;  3E5U A;  3JSP A;  3BY6 A;  2DT5 A;  2HS5 A;  5E18 F;  4LJZ F;  3TDU C;  3TOB A;  1SD5 A;  3FX3 A;  1S8N A;  2MA3 A;  3ZMZ A;  2EWN A;  4O5V A;  2KKO A;  3WGH A;  1ONV A;  3LAP A;  3LST A;  2ACJ A;  3REO A;  3E5Q A;  2CFX A;  1BIA A;  2L4M A;  4UVC A;  4U0Y A;  1ON2 A;  1FPQ A;  2DAO A;  4MHG A;  4GYG A;  4PCQ A;  5E1Z B;  3I64 A;  1LNW A;  2EFQ A;  4RGU A;  1ZLK A;  4G9Y A;  3DXJ F;  2FE3 A;  1LEA A;  4ON0 A;  5D5V B;  3FWE A;  1TW2 A;  5DD8 A;  2VXZ A;  4KIF A;  4IF4 A;  2CQK A;  2Q2E A;  3M8F A;  3HOS A;  1HW5 A;  3ULQ B;  1U3E M;  2IPQ X;  5JHU A;  2KIM A;  2FXA A;  3H92 A;  2UXN A;  3PQK A;  5FLX Z;  1O7F A;  1LJ9 A;  4MNU A;  4FT8 A;  4LMY A;  5IT3 A;  4AWX B;  2G7U A;  1XSV A;  2QQ9 A;  2W85 A;  2H27 A;  2V1U A;  4RB3 C;  5DEQ A;  1ON1 A;  4M71 A;  3LA7 A;  1MKM A;  2FBK A;  4A6E A;  1MZB A;  1ZRF A;  1TW3 A;  2ISY A;  3SQN A;  2A5Y B;  2W25 A;  2QYO A;  4XRF A;  4RGX A;  4DQ2 A;  5D5U B;  3E3V A;  1IF1 A;  4HAM A;  2DLL A;  2CG4 A;  3RDI A;  4G7H F;  2VC0 A;  2FQ3 A;  4L9T A;  2IA2 A;  3RKX A;  4BQA A;  4UNO A;  4JBA A;  5H20 A;  5HDK A;  3LQQ A;  4XLP F;  4HF0 A;  2F5F A;  1XGM A;  1B4A A;  4FX0 A;  3JW4 A;  4YFX F;  5E8G A;  1KU2 A;  2ZME B;  5ILV A;  4Z2Y A;  1HW2 A;  2AXL A;  2BGC A;  1WKM A;  2J5P A;  4S05 A;  4S04 A;  4KDP A;  3E97 A;  1FP1 D;  6PAX A;  1P92 A;  2ESN A;  4HZF A;  3K9T A;  1U5T B;  3V8J A;  2M30 A;  2F2E A;  3IC7 A;  5ICG A;  4U0V A;  3GZ5 A;  2DW4 A;  2DU9 A;  2YSR A;  2PQ8 A;  4A5M A;  4CO8 A;  2Y48 A;  3T8T A;  4EM2 A;  5HDG A;  5AIP A;  2P6T A;  4LGW A;  3IHU A;  1FOK A;  3RIR A;  2MLG A;  2LF7 A;  4CZZ A;  1XGO A;  2KRF A;  4G6D A;  5J8F A;  2QBY A;  3ZN1 A;  4P5O A;  1ZG3 A;  3WTT C;  2QM3 A;  5H6R A;  5E17 F;  2PI0 A;  3WTX C;  4HX8 A;  1FP2 A;  4CGZ A;  4I98 B;  1TLH B;  2XHK A;  4MTD A;  1HQC A;  2D45 A;  4MQ9 F;  3RPQ A;  5DCM A;  2Z33 A;  2E7X A;  3I59 B;  1BI3 A;  3R0A A;  3WGI A;  4FX4 A;  1OYW A;  4LG0 B;  4EJU A;  4HQE A;  1JGS A;  4LLL A;  2NNN A;  1HKT A;  2FRH A;  3FF5 A;  2VC1 A;  4RGR A;  2HQN A;  2R3S A;  2RDP A;  2QBY B;  4EJT A;  2ZFW A;  1B1B A;  5L3D A;  3RJP A;  5DD4 A;  2HGC A;  4D0P A;  3P9I A;  4OMZ A;  1XSX A;  2FNA A;  1H9T A;  4Q5S F;  2NNY A;  3IRR A;  4KIB A;  1ZG5 A;  4IRI A;  1E2X A;  3QPT A;  4A0Z A;  2R7F A;  5D4S A;  2PG4 A;  2YPR A;  1REP C;  4HV6 A;  2HFH A;  2HYG D;  3GWZ A;  2EFW A;  1BI0 A;  1SD6 A;  4EV0 A;  4P9U A;  1CF7 A;  2E1C A;  4AIH A;  1EV7 A;  4IXA A;  4GCV A;  2ZCW A;  3FHZ A;  1Z7U A;  4P55 A;  4U7D A;  2XVC A;  3HRU A;  1FWZ A;  1Z6R A;  3R0J A;  3LFK A;  2GWR A;  3HYI A;  1O7L A;  2PMU A;  3NEU A;  2G9W A;  1Q1H A;  3WOD F;  1FBQ A;  1XN7 A;  3E6B A;  4L9V A;  2L3D A;  4OIN F;  5D4R A;  4P96 A;  5F1R A;  1J59 A;  4I02 A;  3TO6 A;  1QGP A;  1LEB A;  1QO0 D;  2RVC A;  2ZKZ A;  3TQN A;  1WI9 A;  2JTV A;  2ADU A;  3KP3 A;  3VB2 A;  3U2R A;  1U8R A;  2ZBK A;  3M1E A;  3BPV A;  3MFK A;  1CF7 B;  2A69 F;  1MDM A;  4L5I A;  1B59 A;  3T1B A;  1HBX G;  2V79 A;  2EFN A;  1FBS A;  2HQR A;  2O8X A;  3GX4 X;  2JPC A;  4XLN F;  5K5O A;  2AS5 F;  1GXQ A;  3MEX A;  3IRQ A;  4EGY A;  2B0L A;  2K86 A;  3ABT A;  3KZZ A;  4HDU A;  2MH9 A;  3E5X A;  2P5V A;  1FYL A;  5LRS A;  5E20 A;  4KN7 X;  3QAH A;  2IA1 A;  3VOD A;  1W5T A;  4A2U A;  5LGT A;  2DTR A;  2VT2 A;  2STW A;  1U5T C;  2BBY A;  2L54 A;  4M73 A;  1XB4 A;  1W7P A;  5CVJ A;  3DPL C;  3S2W A;  5FO5 A;  1RUO A;  3ELK A;  2KIF A;  2RC4 A;  4BXU A;  1J0R A;  2PJP A;  2GA1 A;  1KQ8 A;  3WTY C;  3WTZ A;  1K6O A;  3F8M A;  4I01 A;  4M72 A;  1FC3 A;  5HLH A;  4YFN F;  5DYM A;  2NYX A;  5KK1 A;  5FD6 A;  3KEO A;  1I1G A;  2JZY A;  3I71 A;  2H94 A;  2K4B A;  3HTU A;  2HEO A;  2P8T A;  1R1U A;  3RKY A;  2HTS A;  2PEX A;  2F5E A;  2FEZ A;  1KYZ A;  4UV8 A;  3G73 A;  4M9Z A;  3SXY A;  3M7G A;  4MEY F;  1G3Y A;  5JI6 A;  1WSU A;  1RZ4 A;  4K2E A;  2VE8 A;  2F5C A;  1SMY F;  3LWF A;  4KN4 X;  5CVR A;  2CW0 F;  4IVN A;  3GLX A;  2P7C B;  1FSH A;  2Z9O A;  3P7N A;  4QLC U;  2W24 A;  2MD5 A;  5HS7 A;  3IKT A;  4UV9 A;  5ICC A;  4EM0 B;  5HVQ C;  1UFM A;  2V6C A;  3F21 A;  1WQ2 A;  3FMR A;  4EJO A;  4QWQ A;  1BM9 A;  3HHH A;  1IXC A;  2V1X A;  5FLX K;  4LFU A;  5F64 A;  2DQL A;  1J2X A;  4ZYE A;  1ZH5 A;  2L02 A;  1HST A;  2VBY A;  1SMT A;  1LDD A;  1D5V A;  4KYW A;  3FXQ A;  3BPX A;  2VN2 A;  3GFM A;  2QEN A;  4BAY A;  2EV5 A;  1U2W A;  4M6Y A;  4ENJ A;  1XCV A;  5A2Q Z;  1XSD A;  3R4K A;  4P9F A;  4A0Y A;  5LLQ A;  1TNS A;  1F4K A;  3W6K B;  4WCG A;  3L09 A;  2RN7 A;  1U78 A;  4N9H A;  3HRT A;  1FLI A;  2VBZ A;  1YLF A;  1ZAO A;  5LEK A;  4WXC A;  1BIB A;  2A61 A;  3DP7 A;  5HOO A;  1QBJ A;  1P4X A;  1T0F A;  3F6V A;  2TDX A;  1G6N A;  4LLG F;  3EUH A;  2JSC A;  4MQV A;  2V1D A;  5BMZ A;  2QQB A;  1ZN2 A;  3VFZ A;  3JAM Z;  1ULY A;  2LF8 A;  1I5Z A;  3H3U A;  1K78 A;  2GXG A;  2M87 A;  2A6E F;  2DPD A;  3O6B B;  3KP4 A;  3JTH A;  1RUN A;  4EM1 A;  2P7V B;  2KJB A;  3GXO A;  3MWM A;  3LQR A;  1ZHF A;  2VON A;  3WE3 A;  5J6X A;  1SFE A;  2HZT A;  3OV8 A;  3F3X A;  3QRF F;  2GXB A;  1GHC A;  2ZME A;  5BPI A;  3SZP A;  1I1S A;  2QZ8 A;  4BH9 A;  5K1Y A;  4ESF A;  3G3Z A;  2EFO A;  5FGM A;  2NRA C;  1DPU A;  3QPH A;  5E1X A; 
#chains in the Genus database with same CATH topology
 1DP7 P;  4XLA A;  1D1B A;  3P9K A;  1UG2 A;  2OCE A;  4XSZ F;  5EEH A;  2DMQ A;  1WJF A;  3DPT A;  4UUT A;  3GTL J;  3AG1 H;  3OYI A;  4AIJ A;  1B9M A;  4M9X A;  1U5T A;  1K78 B;  1S7A A;  3QP5 A;  3CCS I;  4GFB A;  4B3A A;  3E0J B;  3JRB A;  4Y4R A;  1I50 J;  3D5L A;  2EZL A;  3TP3 A;  4HBL A;  3D0S A;  1WJC A;  2LDU A;  4ZZL A;  1PP7 U;  5J1U A;  1NG7 A;  2DYR H;  4FIS A;  4OOI A;  2A68 F;  4G94 A;  5E3M A;  2O5R A;  3GTM J;  2IJL A;  2DQR A;  3OIP A;  2KRH A;  5FKM A;  2R5Z B;  2CRG A;  2MSY A;  1S5L C;  4X6A J;  1P2F A;  1NTC A;  2DI3 A;  5E1W A;  3GTP J;  1PUE E;  4HLX A;  2UWM A;  5D8K B;  3CCE I;  1I6X A;  1IDY A;  4I76 A;  4EEF G;  2JA8 J;  3V7S A;  1VQK I;  1IN6 A;  3K4N A;  3CJN A;  4YIF A;  3KFW X;  5D5X B;  1T33 A;  5J1R A;  2R7R A;  3S3N A;  2HU9 A;  2HXI A;  1X1B A;  3HGG A;  2JUG A;  1WHU A;  3ML6 A;  2QVO A;  2O03 A;  1YHQ I;  2ICW G;  2KLO A;  1J75 A;  3K2Z A;  4M6X A;  4HYE A;  4WXD A;  2DA7 A;  2LKS A;  3IH2 A;  1QU3 A;  1BR2 A;  4I0A A;  1H88 C;  1USS A;  3GO5 A;  1X3W B;  1KA8 A;  4L5J A;  3JRC A;  2WA0 A;  2DA3 A;  2E19 A;  4HV5 A;  1P7J A;  3F23 A;  1IN8 A;  4LD5 A;  4U7B A;  3CMM A;  3JSO A;  2IT0 A;  1V55 H;  3LA3 A;  2K02 A;  2K3P A;  2MBF A;  3R60 A;  4RLQ A;  4PGG A;  3J80 Z;  1ZGW A;  1IG7 A;  2O6G E;  1G3W A;  4MGR A;  4HSR A;  4HW0 A;  5TIS C;  4HLY A;  2A07 F;  5FKK A;  3M4O J;  2OQR A;  4V19 K;  2EIL H;  1OCO H;  1BW6 A;  3FK7 A;  2WB1 A;  5J3L A;  4DGW B;  2EJR A;  1Z3X A;  4J00 A;  1TQP A;  3SJM A;  2L9N A;  2MC4 A;  4KT6 A;  3I59 A;  4IRH A;  3VYR B;  1RRJ A;  1JHF A;  1F36 A;  4RB1 A;  3A2K A;  2XGX A;  3W2A A;  4L9J A;  5JVG F;  4ESJ A;  3VWB A;  3L9F A;  1XMA A;  4N0B A;  4UVA A;  5CVV A;  4IQJ A;  3L2U A;  4LG0 A;  1SD7 A;  1Y56 A;  4C30 A;  3MZH A;  2O7O A;  3WU1 B;  2ID6 A;  3K0L A;  3ISP A;  4ZYG A;  3BG5 A;  4CXF A;  4GYI A;  2Z3Y A;  3IL2 A;  2O3F A;  4A3D J;  4NQW B;  5K5Q A;  3FMS A;  1FIP A;  2HDD A;  1WVR A;  4AVP A;  1ETQ A;  5H6Q A;  1IUY A;  2VPL A;  3WG9 A;  1DUX C;  5FD5 A;  3ONQ A;  4PSW A;  4Y52 J;  1S6L A;  3Q0W A;  2IP2 A;  3HEF A;  4BUP A;  3EQL F;  1FX7 A;  1EH8 A;  1S7O A;  2CWE A;  3OYG A;  4E7I A;  3KLN A;  1MJ9 A;  2JUC A;  5LFA A;  1KU3 A;  2R7W A;  1WCM J;  1T38 A;  2FBI A;  5L3E A;  3C2H A;  2JPB A;  4ZC3 A;  4ZDP A;  3F72 A;  3DEE A;  5IPA A;  4CCJ A;  3PUB A;  5D5W B;  2E1M B;  3L2C A;  5AON A;  2E34 A;  1ZG1 A;  3FZV A;  3GTG J;  4YFK F;  3BR3 A;  4B48 A;  3V7R A;  3CC2 I;  5B3S H;  4G8X A;  2BE5 F;  1H8A C;  5IT9 Z;  3P5J A;  1QZE A;  2DDA A;  1TNT A;  5TRD A;  1FMW A;  1P4A A;  1SFX A;  3QWL A;  1VND A;  3PFI A;  2CUE A;  2P81 A;  4PJL A;  3L7W A;  5DUK A;  3TGN A;  3GFI A;  4LLN A;  4BE1 A;  2BV6 A;  4OU0 A;  4HF2 A;  3M8E A;  4L5E A;  2Q8K A;  1ZGJ A;  2X6X A;  1MH3 A;  2EFP A;  1V54 H;  2L7Z A;  2DFF A;  1NK3 P;  5EG0 B;  2HYJ A;  1OMI A;  4WF2 A;  1AKH A;  1MNM C;  4BQN A;  4MTE A;  3TP0 A;  5M5W J;  3RZO J;  1VQ5 I;  3N05 A;  1TWH J;  2FNP A;  4Q4Z F;  2M8E A;  1VTN C;  4KFC A;  5ICF A;  2GLO A;  3SZT A;  3IWZ A;  1GV2 A;  1YW9 A;  2L9R A;  2QSH X;  3VYS B;  5DUI A;  3PQJ A;  1OKR A;  2Y31 A;  1G3T A;  3ZQF A;  1HSJ A;  2CUZ A;  2VBX A;  2FU4 A;  3ABK H;  4IOC F;  4IO9 F;  3MKZ A;  2Y2Z A;  5HS8 A;  2PBI A;  3B02 A;  5DV5 A;  1YW8 A;  3FMQ A;  3ZQC A;  4AUX A;  3EET A;  2UXX A;  2ISZ A;  3C18 A;  3F8N A;  1ACI A;  2XPV A;  1R58 A;  2YR2 A;  3R61 A;  3BZ6 A;  1UHM A;  4ETS A;  4YEL A;  1LB2 A;  3IH4 A;  3S32 A;  4A3L J;  2COB A;  4YII A;  3RPU A;  4O3M A;  4C2M J;  4QTR A;  4ZYH A;  4LB5 A;  1B9N A;  4R1H A;  3BG6 A;  2EV6 A;  5KAF C;  1NH3 A;  5EDN A;  3AAF A;  4MFE A;  2FSW A;  1TQI A;  1U6G A;  1JKO C;  4Z6Y A;  1KGS A;  1T39 A;  1R36 A;  2VQC A;  3LSM A;  2LRE A;  2M8G X;  1U8B A;  1V4R A;  2BXY A;  4U87 A;  4HA8 A;  3BG9 A;  5TGT A;  3RI4 A;  2ELK A;  3A4C A;  4YG2 F;  1LDK B;  1I6H J;  4BHP A;  4PDK A;  4RS8 A;  4W1U A;  4BY7 J;  1MBH A;  3B6A A;  1KU9 A;  3WE2 A;  1AU7 A;  2ECC A;  4HX4 A;  3FBI B;  3GME A;  3KLO A;  3PNY A;  1N77 A;  1FSE A;  2VJI A;  4L9N A;  1QQI A;  4M9S A;  3OYA A;  9ANT A;  4XMY A;  1D0Z A;  2OF7 A;  4B4C A;  1H89 C;  1IRG A;  2BW3 B;  3KE2 A;  2M0M A;  3OYM A;  2KL4 A;  3CUO A;  3O3K A;  3FBN B;  1J9I A;  4NC6 A;  2EZI A;  2K9N A;  3LA2 A;  2QEX I;  1XTA A;  4W97 A;  1X1A A;  2LH9 A;  2WTE A;  2L5Q A;  5FKN A;  2DOF A;  4CUG A;  4GXO A;  3CC7 I;  2XRL A;  1HCR A;  3BG3 A;  4L0Y B;  3VSK A;  3EDP A;  1D8J A;  3J81 Z;  2EV0 A;  3ZPL A;  4B8X A;  2ZJQ F;  3CP2 A;  2F5D A;  3K70 D;  5LHG A;  2V9V A;  2WWY A;  5K7Z A;  5IYB J;  2CQ7 A;  2VJ5 A;  4Q47 A;  3F8B A;  2JRT A;  1RR7 A;  2HPI A;  4TV7 A;  2FML A;  5IOZ A;  4RMN A;  5JFR A;  3MN2 A;  2BVM A;  3LL7 A;  2E71 A;  4JP0 A;  1DDN A;  3BR5 A;  3G2B A;  1JHH A;  5J1Y A;  3JRD A;  3TKY A;  2DFI A;  1W7P D;  2DK5 A;  4R8H A;  4BEH A;  5EF6 A;  1QNT A;  2AQF A;  3RKW A;  4PUS A;  4XKB A;  2MAB A;  2R92 J;  1P4W A;  4BHC A;  3H5R A;  2JQ7 A;  5C3E J;  2R4G A;  2KIU A;  3SHF A;  5M5Y J;  1YS7 A;  2MW8 A;  2P5L C;  3LAJ A;  2VQL A;  5HDN A;  4PFP A;  3HRS A;  2XKP A;  2QSG X;  2LKX A;  4XN3 A;  1SFU A;  5ED4 A;  4UVB A;  1TL8 A;  2GAU A;  3KYD B;  2XIG A;  3PFY A;  1UHS A;  2ZXI A;  1MIJ A;  1V3F A;  2FJ1 A;  3E6M A;  3NQO A;  2VUM J;  1R4M B;  5DCF A;  2IW5 A;  5BQT A;  1YS6 A;  2OD5 A;  2KRC A;  3DTE A;  2VL8 A;  2XRN A;  5BPD A;  1IUF A;  4XIC A;  2Z16 A;  3L2R A;  3ZQH A;  1XD7 A;  4XLF A;  1ETX A;  2E2H J;  3EYI A;  4M6V A;  1V5G A;  3M3Y J;  1HKS A;  4DZP A;  4KA4 A;  1LKX A;  4F93 B;  5D8L B;  1WJE A;  1CQT A;  3WTV C;  2EA2 A;  1RC9 A;  2W1O A;  1ETK A;  1LVA A;  1WFX A;  2QWW A;  5CVU A;  3ROU A;  4B3X A;  1Z91 A;  5BS6 A;  3BR6 A;  1GXP A;  4DZJ A;  3O8G A;  4XON A;  3VYT B;  3OOP A;  1OIS A;  2OA4 A;  3KZI C;  2LKP A;  1M1E B;  2XGE A;  3EUA A;  1NG6 A;  4LK0 F;  2LY2 A;  4BEH B;  1QPM A;  2ME0 A;  2QSF X;  1ZRE A;  3NAU A;  5ERI A;  2BY0 A;  3SZG A;  2KQR A;  3BJ6 A;  1HOM A;  4ZYD A;  3LSI A;  2PMZ A;  4BBR J;  1HKQ A;  2YUS A;  4HDV A;  4OAZ A;  3GCM A;  1MJB A;  3FHN A;  2XPU A;  3HIF A;  1FTT A;  1W4M A;  3MD2 A;  4WX9 A;  4WK8 F;  2DK8 A;  1PP8 F;  3WU0 A;  2QCO A;  1SVM A;  2DMP A;  5GAD J;  1K7A A;  3I4P A;  2VOO A;  3S3O A;  2HI3 A;  5LBQ A;  4HF1 A;  2HVR A;  3JR9 A;  4EGZ A;  5A2Q K;  3I0T A;  4ESB A;  2EIN H;  2XV4 S;  3IUO A;  4A5N A;  2UUZ A;  4A3M J;  5GAH J;  1Q1V A;  3I55 I;  2CQX A;  1WZ2 A;  4CHU A;  2GA2 A;  1Z9C A;  3KET A;  3Q3S A;  4QPQ A;  3HSR A;  4XOT A;  3ABU A;  1K79 A;  3ZMV A;  2E1N A;  1K83 J;  5HLG A;  1R4N B;  1YX5 A;  1NK2 P;  1D0Y A;  1U9O A;  4CZC A;  2QA4 I;  3HSE A;  1XCB A;  2XPW A;  4F3Q A;  2E1M C;  3DF8 A;  1W5S A;  3HKZ N;  3IAM 2;  5DDG A;  3OYJ A;  1RI7 A;  4G7Z F;  3BG7 A;  1SAX A;  3LSR A;  1ZRD A;  4CDG A;  3JTG A;  1QZZ A;  2LR8 A;  2HDC A;  2E60 A;  3ZQG A;  4OIR F;  2IGK A;  3VOE A;  3WTS C;  4DJA A;  4DBR A;  3GLL A;  3ZXS A;  2FBH A;  4A3I J;  3JAM K;  3GTQ J;  2DDB A;  1DPU A;  1TTY A;  2DO7 A;  2IRF G;  1R49 A;  3MZ8 A;  3KP6 A;  3K1P A;  1LUJ B;  2XB5 A;  3DFG A;  1MJA A;  1V5F A;  2D5V A;  2DJI A;  1W0T A;  3I58 A;  4EJW A;  2ZJR F;  1XGN A;  2CYY A;  4Y17 A;  4FET A;  1DQU A;  1G3S A;  3U9G A;  3K7A J;  2DOA A;  4HOB A;  3J7A O;  1OLT A;  2NVU B;  4DNC A;  3H5A A;  3FXU A;  1MBF A;  3OWT A;  3HSF A;  2HQA A;  4BQQ A;  3T5X A;  4XOR A;  3WGG A;  3H0D A;  1D3Y A;  4DYQ A;  3Q9V A;  3OYF A;  2HOE A;  4U88 A;  1PUF A;  2XAH A;  1R5I D;  2H8W A;  2IBD A;  2Y75 A;  1XDS A;  3AG2 H;  3K1M A;  4PJN A;  3OYH A;  1EH6 A;  1S9H A;  2E2J J;  5GTH C;  3JRF A;  3HBL A;  3HXL A;  4ASN A;  1YFH A;  2DA5 A;  2XAG A;  5EZG A;  2CQN A;  1Y1V J;  4UY8 I;  2IGO A;  5C44 J;  1YYV A;  2XAQ A;  1BI1 A;  2KMU A;  5TJJ A;  3ZQQ A;  3RYP A;  1IN5 A;  3K4K A;  3UKG A;  2GZW A;  4II3 A;  2YU3 A;  3HM5 A;  1ZRC A;  1A04 A;  5ILS A;  1UJ8 A;  3LSG A;  3P9C A;  4PJ0 C;  1FT9 A;  4O6J A;  3S16 J;  2ZNY A;  2IS4 A;  3JRA A;  2CW7 A;  2LP0 A;  2E1O A;  4KT5 C;  3W2V A;  4D5F A;  1XPX A;  1T2K A;  3R6S A;  3OSF A;  4I7H A;  1GV5 A;  1MMG A;  2ELH A;  1B72 A;  1MSF C;  2L7F P;  1F1Z A;  1IAW A;  2STT A;  2BHZ A;  1EA3 A;  1O3T A;  1WRJ A;  3CTA A;  1TWC J;  3CJR B;  4HQM A;  3M8J A;  3T0Y A;  1JGG A;  4A3C J;  2L7K A;  4IKF A;  4WXH A;  1KZH A;  5J8C A;  4D5C A;  3FK6 A;  1Y8R B;  3I5U A;  4A6D A;  1BR1 A;  2AO9 A;  2JMW A;  2YX7 A;  1RIO H;  2L2O A;  3QYB A;  3CDH A;  1YIJ I;  1XMK A;  2FMY A;  3ESW B;  1OCR H;  4H0E A;  4LB6 B;  3ZP5 A;  1OR7 C;  1RET A;  2WAE A;  3KP7 A;  5EEA A;  2OQG A;  1RNL A;  4BU2 A;  1Z1D A;  4Y15 A;  3CCQ I;  2MC3 A;  1A6I A;  5FFX A;  3X2Q H;  3K6G A;  1TWA J;  1R00 A;  2ZO4 A;  4ENN A;  3N97 A;  1UZC A;  2OU2 A;  1Y39 A;  4LIT A;  1ZYR F;  4PGH A;  4ZZD A;  3J80 K;  5IP9 J;  3OIQ A;  1IZ1 A;  1FY7 A;  2R5Z A;  4HX7 A;  5EEG A;  3IKV A;  1JXS A;  2Y9Z A;  4UB8 C;  4EJV A;  2D1H A;  1B72 B;  3O8H A;  3TO7 A;  4M3F A;  3ZN0 A;  2BEO A;  4MLO A;  2VAS A;  3ZQ7 A;  2ZC2 A;  2P6S A;  2MFZ A;  2LK2 A;  3QU6 A;  4NBQ A;  4UHT A;  3G6E I;  2XAF A;  5LHH A;  3BRO A;  3FIS A;  2H6B A;  4GO1 A;  3F9K A;  3IH3 A;  2LYC A;  2O8K A;  4A12 A;  4A3E J;  2RKH A;  1YW7 A;  1J7K A;  2M1B A;  2CQQ A;  2YX4 A;  4NC8 A;  2NS7 A;  4L0Z B;  4NUB A;  2OZ6 A;  2NVY J;  2OPT A;  5F08 A;  4RGS A;  3HRM A;  2ECB A;  5LGN A;  2F4I A;  2WC2 A;  3BTC A;  4II2 A;  3TDZ C;  3F8F A;  4KNY A;  4KIC A;  4ENM A;  2DYS H;  3CQZ J;  5E79 C;  3F6O A;  2BY3 A;  1YE9 A;  2HXO A;  1E3P A;  2OV7 A;  3V4G A;  2JT1 A;  2PMH A;  4XQF A;  2EK5 A;  1JKP C;  1IRF A;  3ZMU A;  2DA4 A;  2KJC A;  2VB6 A;  1FMV A;  5FRO A;  3MZY A;  1Y1W J;  3CDL A;  4C2T A;  3FDY A;  1MD0 A;  3K4C A;  4CCK A;  2W84 A;  2W00 A;  5CYV A;  1UB9 A;  4FAS D;  3NRV A;  2M4K A;  1X3Z B;  5F0C A;  3J7Y J;  2XC7 A;  3VSL A;  2Q2E B;  1HXD A;  2E7W A;  1T08 B;  4I09 A;  1X1D A;  3CUQ C;  3A1Y A;  3L1P A;  2R7T A;  1X4P A;  1TBX A;  2E36 A;  3BJO A;  4Q48 A;  3OS0 A;  4I6Z A;  1UST A;  2J5O A;  5CVI A;  4B47 A;  2P5K A;  1T56 A;  2IA0 A;  5LHI A;  1MND A;  3CCU I;  2IGN A;  3DCF A;  1OYI A;  4D7N A;  4BXF A;  4KIG A;  4XM3 A;  3V42 A;  3QP6 A;  4NQW A;  3GEZ A;  1P6R A;  3QOE A;  4XSX F;  5IT9 K;  3JRI A;  1QPI A;  3K69 A;  2Z99 A;  4AVZ A;  2EIK H;  1R22 A;  1TWF J;  3BJA A;  3HHG A;  4IRG A;  3EYY A;  3CC4 I;  1TWG J;  1VFC A;  2PFB A;  2HTJ A;  2X4H A;  3HPH A;  4NHJ A;  1Y0N A;  3AG4 H;  4HG2 A;  1ZAR A;  3TBI A;  1AHD P;  3CZ6 A;  1SEU A;  4R79 A;  5M3M J;  4Y13 A;  4XLH A;  3PNT A;  3H36 A;  3DV8 A;  4I0B A;  2COM A;  1IW7 F;  4FTH A;  5J40 A;  3T8R A;  5GAE J;  2K7L A;  2GIV A;  4UUV A;  1Z3Y A;  3SDB A;  2R7X A;  4XOP A;  5GAG J;  1FYM A;  1BJA A;  1AWC A;  1TP4 A;  3U1D A;  4IX7 A;  1IN4 A;  4GRI A;  4JYK A;  1S3J A;  1XGS A;  4RB2 C;  4XKW A;  4YEJ A;  3KX2 A;  1XS9 A;  1R5H A;  3G1L A;  2B63 J;  3A03 A;  1PVE A;  2LFB A;  2I8D A;  2VI6 A;  3HUG A;  1S29 A;  3ZMT A;  2H6C A;  5LEJ A;  1O3S A;  2D2W A;  2M34 A;  5L3G A;  4RA2 A;  3F22 A;  5D6F A;  4BHB A;  2OCC H;  2M7B A;  3I54 A;  5EG0 A;  4CIC A;  2HPM A;  5JR3 A;  2RQP A;  3ZMD A;  1J5Y A;  2EQR A;  2Y9Y A;  2W82 A;  1C0W A;  4OIQ F;  3PUF A;  2VT3 A;  1DU0 A;  3D5R C;  2F6C A;  1SD4 A;  2TRT A;  4KIT B;  3E1S A;  5F6F A;  3DKW A;  4J01 A;  2Y69 H;  2G0E A;  2VOP A;  1YQA A;  3KYC B;  5B1B H;  2QQA A;  4DYR A;  4E7L A;  1SFO J;  2GIZ A;  3HPG A;  4L18 B;  4RAZ A;  1B6A A;  1DGR M;  2JRM A;  5HNH A;  4EMS A;  4AD9 A;  2RNJ A;  3DTK A;  3ECO A;  1ZR4 A;  3SFI A;  1IC8 A;  4LOC A;  1JUP A;  4JK1 X;  3GW2 A;  1JUM A;  5JVT A;  4GGG A;  1HW1 A;  4DW6 A;  2CGP A;  4IHT A;  3L00 A;  3FKJ A;  3HUG B;  3TMO A;  1ZLJ A;  1FNN A;  3J7Z I;  3COA C;  5F0F A;  1R5G A;  1KQ0 A;  4BBS J;  1KU7 A;  4BL0 B;  4BKX A;  2KPM A;  2XAS A;  5FKO A;  3FXR A;  1YIO A;  2DPU A;  1OCP A;  4OIP F;  3MVP A;  2XKO A;  1UCR A;  3I53 A;  2DT6 A;  3RPU D;  5KVR A;  1L0O C;  1OYY A;  5JLW A;  3J81 K;  2XRO A;  1XC5 A;  4MEX F;  5CQG A;  5FFZ A;  4YIR X;  3KP2 A;  3S8P A;  3D1N I;  1BOA A;  4ZTJ A;  3O2P E;  2XAJ A;  1R1V A;  1XDU A;  3QQA A;  2KZG A;  2HYF A;  1STZ A;  3MQ0 A;  1GLN A;  3KIO A;  5K5R A;  5L3B A;  2Z5U A;  4RM2 A;  3GF2 A;  5GP9 A;  2VQH A;  3C2B A;  5CJ9 A;  3JRH A;  3LNQ A;  2BW3 A;  5CQE A;  1OR7 A;  3M1C A;  2VKV A;  2IS6 A;  2L7M P;  2IEK A;  4ZDO A;  3GFL A;  3LSJ A;  2K27 A;  2WBM A;  3ZMS A;  3JRG A;  3OR2 C;  3GVA A;  2QQ8 A;  4IJA A;  3OYK A;  2EZH A;  4LK1 F;  1BC7 C;  3QYF A;  2BYV E;  2LSO A;  3HL2 A;  5EGO A;  4E70 A;  1D5Y A;  1IXS B;  2LD5 A;  5DCM B;  5GPC A;  4OWR B;  3EUK L;  2R5Y A;  4ZTF A;  3CJT B;  3IWF A;  1PDN C;  4DIQ A;  2WAQ N;  2Y0S N;  3CMA I;  3BOQ A;  4I2O A;  1X3U A;  1R71 A;  3CO7 C;  1X19 A;  2K40 A;  3BDD A;  3GFJ A;  4IPA A;  3DBH B;  2WY7 Q;  1QHH D;  5FLV A;  4M74 A;  1U9N A;  2DMT A;  1UG0 A;  1YG2 A;  2NVX J;  2L4A A;  1BL0 A;  3FIW A;  1RPW A;  1R7J A;  5LGU A;  2YU9 J;  2MGQ A;  3BT9 A;  2ZJ2 A;  4WWC A;  1KQ9 A;  1FIA A;  1Z6T A;  4ITV A;  2CFO A;  3H35 A;  1ZGA A;  3OIO A;  4XBF A;  4Y7N J;  2DJN A;  1IV8 A;  1GT0 C;  2LNB A;  1WJA A;  3DU6 A;  5ILU A;  2G7H A;  1ETY A;  1E17 A;  2EB7 A;  2M45 A;  2R7D A;  1VF9 A;  1OCC H;  2O0Y A;  3QU3 A;  4QSH A;  1YTY A;  1LFU P;  2HNH A;  2K4J A;  3MAJ A;  4PZJ A;  4BDZ A;  4D1Q A;  1H9G A;  1W0U A;  1FTZ A;  1QVT A;  3HZJ A;  3QOP A;  2CW8 A;  4BYY A;  1TQM A;  1YIT I;  5EGO B;  3DLL F;  2MH2 A;  3RTR A;  5HS9 A;  4MO7 A;  1JT6 A;  2NOJ B;  5CLS A;  4KUM A;  3OY9 A;  2R5Y B;  1Z05 A;  1FOY A;  1UHW A;  1IGN A;  2C6Y A;  3S14 J;  4CYC B;  3CUQ A;  1R1T A;  5FLM J;  3V8L A;  2MG4 A;  2ETH A;  1GVJ A;  1W1W E;  4RAY A;  3K1N A;  5FB2 A;  3LSP A;  1WI3 A;  3A01 B;  1TZL A;  1WGX A;  3DBL B;  2KHM A;  2MLK A;  3S17 J;  2OZU A;  1ZK8 A;  1D0X A;  2RNG A;  3GZ6 A;  1YX3 A;  4BS9 A;  2M3A A;  2QF7 A;  3GYH X;  1MGT A;  2EA4 A;  3I56 I;  5E8I A;  2IAI A;  4B44 A;  5J4Y A;  1AA7 A;  2HOA A;  3VPR A;  1O3Q A;  2KIQ A;  2DTZ A;  3ZRG A;  1BN5 A;  3Q0U A;  2HKO A;  3I4M J;  4CH7 A;  2A6H F;  4CYD A;  2FF4 A;  1QVU A;  3RSN A;  2QLZ A;  5EZH A;  2WV1 A;  1CGP A;  2O9L A;  5FKL A;  4AIK A;  1JTX A;  3HKZ A;  4A0X A;  3DEU A;  3H9Q A;  2CH0 A;  2XGC A;  2HR3 A;  2WV0 A;  3M07 A;  4A93 J;  2VOD A;  5ICE A;  3HTS B;  3CCM I;  1DGW Y;  2DBB A;  2O61 A;  2UZK A;  1YJN I;  3CLO A;  5LRR A;  3FM3 A;  3TW7 A;  2XUB A;  1LFB A;  3S2H J;  1O3R A;  2HVQ A;  3WG7 H;  3C7J A;  2BVL A;  4RDU A;  2ZXJ A;  4AC0 A;  1EH7 A;  2KT0 A;  3HGY A;  4B09 A;  1G4D A;  1YRN B;  3ZR8 X;  2IS1 A;  5D6E A;  3CUQ B;  1FJL A;  1ODD A;  2NAZ A;  4RAF A;  3AKZ A;  1BW5 A;  3IP4 B;  2YS9 A;  2KZV A;  3C1D A;  2A3S A;  2A6T A;  1FBU A;  1QZY A;  3HJE A;  4C3J J;  3WTW C;  3Q9S A;  1LFP A;  3W3C A;  3DQV C;  3V7C A;  2IVM A;  1WJD A;  2KP6 A;  2W57 A;  1BI2 A;  2EIJ H;  3GUD A;  1MBJ A;  4FCY A;  3RYR A;  4EVI A;  2FA5 A;  3W6V A;  3E6D A;  2RGV A;  1ORK A;  3G1O A;  4AU7 A;  1IRZ A;  1Y0U A;  1BBY A;  2VE9 A;  4AM3 A;  5IY5 H;  1Y6I A;  3W6J B;  3I4N J;  4BY1 J;  2NS0 A;  3M9A A;  3OYB A;  2KDO A;  1LQ1 A;  1D8K A;  5HLI A;  1X4O A;  4YRV A;  1IN7 A;  1MDM B;  1YOV B;  3DLA A;  3SFZ A;  3BQY A;  4N9I A;  4F7Z A;  1YO5 C;  3KP5 A;  3BP8 A;  2XGD A;  1BC8 C;  4G6Q A;  2V7F A;  3FM5 A;  5IP6 A;  5BOX A;  1E3H A;  1N25 A;  1DU6 A;  1MMD A;  4M3G A;  2OAZ A;  1AOY A;  4D9J A;  1FYK A;  3UNG C;  3HOW J;  1IXR C;  1XG1 A;  4KMF A;  2L01 A;  2W4S A;  2Y0M A;  3PO2 J;  1T6S A;  1WWX A;  2DA6 A;  2LMD A;  4A3K J;  3HDD A;  3OL4 A;  2VBW A;  2XAU A;  5IYD J;  2ELJ A;  1OFC X;  1HA8 A;  1VQO I;  4JQF A;  4N4N B;  2I5U A;  2V1N A;  2AHQ A;  5AIQ A;  1QRY A;  1NHA A;  3DWL E;  4ABZ A;  3QYE A;  2EZK A;  4UXN A;  1N75 A;  5IP7 J;  3CMY A;  2R7O A;  3BWG A;  2P4W A;  1B8I B;  3K10 A;  2GOX B;  2M5W A;  4XLE A;  1I39 A;  1R23 A;  3KZY A;  5E3L A;  1OQY A;  2X48 A;  1O57 A;  4G7O F;  3S93 A;  2VXD A;  2HWV A;  3OYD A;  1W7P B;  1QHG A;  3ECH A;  3H9G A;  2D1V A;  3TOA A;  4AYB N;  1DPR A;  4ZDL A;  1S72 I;  2M0C A;  4KMU X;  1N78 A;  1LVK A;  1TT5 B;  4OIO F;  1T98 A;  1F9N A;  3B73 A;  4IHS A;  2RV8 A;  2HOT A;  5L3F A;  2R7V A;  1LDJ A;  2GQQ A;  3N4M A;  1ZKG A;  1L3L A;  1O4X A;  2ZNZ A;  4NC7 A;  3K2A A;  4A3J J;  4OMY A;  1G2H A;  5F04 A;  3TED A;  1OPC A;  3S2D J;  3LSH A;  4BE0 A;  2Q1Z B;  1H0M A;  3CF5 F;  3FXK A;  2CSO A;  2DA1 A;  3MCZ A;  3VEP A;  4MIM A;  3C3W A;  3CO6 C;  3E6C C;  3WTU C;  3ERE D;  4RB0 A;  1I27 A;  1ITY A;  4ZH4 F;  2Q0O A;  3KEQ A;  1SAN A;  1F5T A;  3JCU C;  3F8C A;  2ESH A;  2QUF A;  1K4T A;  1FZP B;  4M3D A;  2OBP A;  1VQL I;  4NB5 A;  3AL0 C;  5JLX A;  3HOT A;  3L2Q A;  1ERD A;  2X0L A;  3V8K A;  4AID A;  3Q5F A;  2VPR A;  3KPH A;  4ENK A;  2PN6 A;  4M3E A;  4U0W A;  4N4O B;  3TW6 A;  1JE8 A;  4M3B A;  2CO5 A;  4XID A;  4XR6 A;  4IQ4 A;  3K4L A;  3KYL A;  4E7S A;  3H3Z A;  4G12 A;  3MKL A;  2CU7 A;  2H09 A;  2HKX A;  3VDX A;  4EQQ A;  4BNC A;  1HF0 A;  4S0H B;  5L3C A;  2X1E A;  3FKI J;  3TO9 A;  4FHT A;  2PLY A;  5KHD A;  1KYW A;  3S15 J;  1V5E A;  1LPQ A;  3G1M A;  3DEW A;  2IS2 A;  1FOX A;  2FOK A;  3W2W A;  3KCC A;  3E5U A;  3JSP A;  3BY6 A;  2BOL A;  2DT5 A;  4X1E A;  1ZR2 A;  3A0H C;  2HS5 A;  5E18 F;  3S1R J;  4LJZ F;  3OYL A;  3ABL H;  3TDU C;  3TOB A;  1SD5 A;  2LG4 A;  4V2G A;  5CPR B;  2EBI A;  3BZK A;  1DP3 A;  1MH4 A;  3FX3 A;  2XF6 A;  1S8N A;  1WJ5 A;  2MA3 A;  3ZMZ A;  2EWN A;  2L0K A;  1W5C C;  3NWT A;  1ETV A;  4O5V A;  2KKO A;  3WGH A;  1ONV A;  3LAP A;  3LST A;  3BC8 A;  2OJE D;  2ACJ A;  3REO A;  3E5Q A;  3BTL A;  2CFX A;  3Q0V A;  1S7E A;  2HDW A;  3ZCO A;  1MBK A;  2CV2 A;  4HNU A;  2B9S A;  1UAA A;  3SDG A;  1BIA A;  2L4M A;  4UVC A;  4CSW A;  4U0Y A;  1ON2 A;  5JHF A;  1FPQ A;  2DAO A;  4MHG A;  5KCM A;  1XMX A;  4GYG A;  4PCQ A;  5E1Z B;  2R93 J;  2R7U A;  3WHB A;  5FRN A;  1PYV A;  3AFH A;  1UMQ A;  3I64 A;  1LNW A;  2EFQ A;  3CJQ B;  4JX4 A;  4RGU A;  1ZLK A;  4G9Y A;  4Y3O A;  3DXJ F;  1SVO A;  1OJL A;  2FE3 A;  1LEA A;  4ON0 A;  1A5J A;  2RAE A;  3FWE A;  5D5V B;  1TW2 A;  2DT7 B;  5DD8 A;  2VXZ A;  1HDD C;  4KIF A;  1BJZ A;  4IF4 A;  4CCO A;  2CQK A;  2Q2E A;  2EIM H;  2K3F A;  3FXM A;  3M8F A;  3HOS A;  2ZFU A;  4NNJ A;  3QPS A;  1HW5 A;  3ULQ B;  3PO3 J;  3HB9 A;  3TL4 X;  2IPQ X;  1U3E M;  3CCJ I;  3RQI A;  5JHU A;  2KIM A;  2FXA A;  3H92 A;  2UXN A;  2JJ7 A;  3PQK A;  4B43 A;  5FLX Z;  1O7F A;  1SFK A;  2DOE A;  1LJ9 A;  3PSI A;  4MNU A;  4HST A;  4FT8 A;  4D7M A;  1OCZ H;  4LMY A;  5IT3 A;  4AWX B;  2G7U A;  3E7L A;  1XSV A;  3SEQ A;  2QQ9 A;  4QPO A;  3IV5 A;  2W85 A;  2H27 A;  4HRI A;  4DOZ A;  2V1U A;  2XSJ C;  5B1A H;  4RB3 C;  5DEQ A;  1ON1 A;  1FEX A;  4M71 A;  3LA7 A;  3CP8 A;  1MKM A;  2FBK A;  4A6E A;  1MZB A;  1ZRF A;  1TW3 A;  2ISY A;  1YJ9 I;  3HC7 A;  3CCY A;  5IYC J;  3H0G J;  2NVQ J;  5FJ8 J;  1ZQ3 P;  1WH5 A;  2M7A A;  3SQN A;  2A5Y B;  3DBR B;  3NAR A;  3U21 A;  2W25 A;  2QYO A;  4XRF A;  4RGX A;  2CV0 A;  2AQE A;  3QPL A;  4DQ2 A;  5D5U B;  2KIS A;  2X1D A;  3E3V A;  1IF1 A;  4HAM A;  2DFE A;  3GBG A;  1I3A A;  2CG4 A;  2DLL A;  3PJR A;  3RDI A;  4G7H F;  2X6O A;  2VC0 A;  2FQ3 A;  4L9T A;  2IA2 A;  3RKX A;  4HNT A;  4F92 B;  1GUU A;  4BQA A;  2V6E A;  3L2V A;  4UNO A;  4JBA A;  2JA5 J;  3GZN B;  5H20 A;  5HDK A;  3LQQ A;  4XLP F;  1KON A;  2DOD A;  4HF0 A;  4LG3 A;  2F5F A;  2WAF A;  1XGM A;  1B4A A;  4FX0 A;  3BCA A;  3JW4 A;  5E8G A;  4YFX F;  1KU2 A;  2ZME B;  3ZGK A;  4Z2Y A;  5ILV A;  1HW2 A;  2AXL A;  2BGC A;  1E0E A;  3ABM H;  4PSX A;  2A05 A;  3HOZ J;  1WKM A;  3ZQI A;  2PJR B;  3DKY A;  2J5P A;  4S05 A;  4S04 A;  2CUF A;  2ME6 A;  2R7Z J;  4KDP A;  3E97 A;  1FP1 D;  4XL9 A;  6PAX A;  1P92 A;  2ESN A;  4HZF A;  3K9T A;  5F1J A;  4I99 C;  2JA7 J;  5DM6 F;  2RQQ A;  3LOC A;  1VQP I;  1F43 A;  1OCT C;  1U5T B;  3V8J A;  2M30 A;  2F2E A;  2TCT A;  3IC7 A;  5ICG A;  3K70 C;  3KEY A;  4U0V A;  3GZ5 A;  4UB6 C;  2DW4 A;  3PIO F;  1EJ9 A;  2DU9 A;  2YSR A;  3OL3 A;  5HLT A;  1X58 A;  1APL C;  2PQ8 A;  5HOD A;  4A5M A;  4CO8 A;  2ZXW H;  2A5W A;  2Y48 A;  4Y33 A;  4EAT A;  5DS9 A;  2W7N A;  1TC3 C;  3H9J A;  3T8T A;  4EM2 A;  3JRE A;  4P1W A;  5HDG A;  5AIP A;  1RKW A;  2P6T A;  3UR3 C;  4LGW A;  3BTJ A;  3IHU A;  2K85 A;  3FXL A;  3DPU A;  1SC7 A;  1FOK A;  3RIR A;  2IXS A;  1JKR C;  2MLG A;  2WAQ A;  2LF7 A;  2Y0S A;  2XF5 A;  3ZOB A;  4CZZ A;  1JT0 A;  3BR0 A;  1XGO A;  4XKV A;  3CD6 I;  4PJM A;  2Y30 A;  3A02 A;  2KRF A;  2R7Q A;  2BHY A;  4C3H J;  3PNV A;  2IGM A;  4G6D A;  2X1C A;  5J8F A;  3S1Q J;  2QBY A;  3ZN1 A;  4P5O A;  1ZG3 A;  3WTT C;  4A3F J;  2GBY A;  3CF2 A;  2V9P A;  3OSG A;  3D5S C;  2QM3 A;  2LBF A;  1WPK A;  3I3L A;  1SAU A;  5H6R A;  5E17 F;  2M9H A;  2PI0 A;  1X1C A;  3WTX C;  1K6Y A;  3ERM A;  4HX8 A;  4A69 C;  3U1K A;  1FP2 A;  4CGZ A;  1PJR A;  3IAS 2;  3MKW B;  4I98 B;  1TLH B;  2XHK A;  4ZJZ A;  1HQC A;  4MTD A;  2D45 A;  4IHW A;  1Z77 A;  4MQ9 F;  4J19 A;  4IEJ A;  1VQM I;  2DA2 A;  5DCM A;  3RPQ A;  2Z33 A;  2E7X A;  3PL8 A;  2ZSI B;  4LIU A;  3I59 B;  2HZD A;  1BI3 A;  4XRM A;  3R0A A;  3CES A;  3WGI A;  5LD2 C;  4FX4 A;  1OYW A;  1WJB A;  2QKM B;  4E4H A;  4LG0 B;  4EJU A;  4HQE A;  1YJW I;  1JGS A;  2EPF A;  2LVS A;  4LLL A;  2NNN A;  5K7H A;  1HKT A;  1ZEL A;  4XKC A;  1IJW C;  2FRH A;  3FF5 A;  2KDZ A;  2FUG 2;  3GTJ J;  2VC1 A;  3LMM A;  4RGR A;  4XNF A;  1HDP A;  2HQN A;  2R3S A;  3G4S I;  3AL0 B;  2RDP A;  2QBY B;  4BGD A;  1W36 D;  4RLF A;  4C9Y A;  4EJT A;  3OS1 A;  2ZFW A;  5H2F C;  1B1B A;  4IHY A;  4E7Z A;  5L3D A;  3RJP A;  2LBF B;  5DD4 A;  2V26 A;  4BJ6 C;  2HGC A;  2WB1 N;  4D0P A;  3P9I A;  4OMZ A;  4NDL A;  2LY1 A;  2NOG A;  1XSX A;  2M2E A;  2FNA A;  4C3I J;  5EJC A;  1QA6 A;  3H1C A;  1H9T A;  4GDF A;  3CLQ A;  4Q5S F;  4E6K G;  4UUS A;  2VKD A;  2NNY A;  3IRR A;  4KIB A;  1ZG5 A;  4IRI A;  1E2X A;  4H4K C;  3QPT A;  4A0Z A;  4HNV A;  4CYC A;  4IHV A;  2GXA A;  4IHX A;  2E5Z A;  2R7F A;  4XK4 A;  5D4S A;  2HOS A;  2BY2 A;  3A01 A;  1Y8Q B;  2PG4 A;  2N8G A;  2YPR A;  3QOD A;  4B1R A;  1REP C;  1GDT A;  2BY1 A;  4HV6 A;  2HFH A;  2V4J C;  5K7F A;  3GTO J;  2H1K A;  3CCV I;  2HYG D;  3GWZ A;  2EH3 A;  3DKX A;  3RCO A;  2EFW A;  1BI0 A;  3BCB A;  3OR1 C;  3L2W A;  2XDV A;  3HG9 A;  2LY9 A;  2JVH A;  1SD6 A;  2K9Q A;  5GPA A;  4EV0 A;  4P9U A;  1AKH B;  3OOU A;  4DBQ A;  1CF7 A;  1JJ6 C;  1D1C A;  2E1C A;  4AIH A;  1EV7 A;  4IXA A;  4GCV A;  4BJ5 C;  2ZCW A;  5M3F J;  3F0C A;  3OS2 A;  4JOM A;  4XN0 A;  3FHZ A;  1Z7U A;  2WY8 Q;  1ENH A;  3H5N A;  4P55 A;  4U7D A;  3BR2 A;  2B7E A;  5E3O A;  2DN0 A;  3LSK A;  2XVC A;  5BNG A;  3HRU A;  1FWZ A;  1Z7L A;  4UUS B;  1Z6R A;  3R0J A;  3LFK A;  2GWR A;  1EF4 A;  3HYI A;  1O7L A;  1YRN A;  2PMU A;  2QKL B;  3BLY A;  3BZC A;  3NEU A;  2G9W A;  3SEZ A;  3HOU J;  1Q1H A;  1T0F C;  3WOD F;  1FBQ A;  1XN7 A;  1JI8 A;  3DTI A;  3E6B A;  2R0Q C;  1A31 A;  3EPZ A;  2L3D A;  4L9V A;  4OIN F;  4P96 A;  5D4R A;  3EUH C;  5F1R A;  4I02 A;  1J59 A;  2FOW A;  2MD0 A;  3TO6 A;  2ZJP F;  1QGP A;  2OC6 A;  1LEB A;  1QO0 D;  2RVC A;  2ZKZ A;  3FXO A;  1WI9 A;  4JX6 A;  3TQN A;  4HEA 2;  2JTV A;  5CKT A;  2ADU A;  5GTI C;  1X2N A;  3KP3 A;  3VB2 A;  3U2R A;  5B66 C;  1JJ8 C;  1U8R A;  2X6W A;  2ZBK A;  2OUM A;  4RM3 A;  1TT0 A;  4X0G A;  3M1E A;  4LIV A;  1IRX A;  2RRE A;  3BPV A;  5J47 A;  3MFK A;  3PM1 A;  1CF7 B;  2BXZ A;  2A69 F;  1MDM A;  4L5I A;  1B59 A;  2DCE A;  2V9K A;  2XF7 A;  1HC8 A;  1G59 A;  1MBG A;  3T1B A;  1HBX G;  2V79 A;  2EFN A;  1FBS A;  2HQR A;  2X51 A;  3MKY B;  2M4G A;  4AYB A;  1LE8 A;  2O8X A;  1UEL B;  3GX4 X;  1MNE A;  2JPC A;  2X9D A;  4XLN F;  2VKH A;  5K5O A;  2AS5 F;  1Z67 A;  2NS8 A;  2VKE A;  1GXQ A;  3MEX A;  4F55 A;  3IRQ A;  1VQN I;  2Z2S B;  4EGY A;  1EKE A;  1P7I A;  2ZME C;  2ZB9 A;  2B0L A;  2K86 A;  4XRS G;  3ABT A;  4PK4 A;  1BR4 A;  3KZZ A;  4HDU A;  5FRM A;  2MH9 A;  1MBE A;  5IOY A;  3E5X A;  1RKT A;  2P5V A;  1FYL A;  5F27 A;  5J4V A;  3AG3 H;  5LRS A;  2MYS A;  1Z0X A;  5E20 A;  2LRD A;  4KN7 X;  3QAH A;  2IA1 A;  5DTD A;  2NXN B;  2I10 A;  3VOD A;  3OYC A;  3CCR I;  1W5T A;  4A2U A;  1B8I A;  5LGT A;  4DYC A;  2DTR A;  2VT2 A;  2STW A;  1BOB A;  2JSP A;  4PFO A;  1U5T C;  2BBY A;  2L54 A;  2DMU A;  4RAG A;  4M73 A;  1XB4 A;  3RZD J;  1W7P A;  5CVJ A;  3DPL C;  3S2W A;  1MSE C;  5FO5 A;  1RUO A;  3ELK A;  4IOA F;  2KIF A;  2OTJ I;  2RC4 A;  4OAY A;  4BXU A;  1J0R A;  2X6Y A;  3HOY J;  1SVL A;  3RQ4 A;  4BJT A;  2PJP A;  1G8X A;  2GA1 A;  1KQ8 A;  3WTY C;  2L9V A;  3S1M J;  3WTZ A;  1K6O A;  3F8M A;  4E7K A;  4ZYA A;  1LE8 B;  1X2M A;  4I01 A;  1VQ6 I;  4M72 A;  1FC3 A;  5KAI C;  5HLH A;  4YFN F;  3HOX J;  4HPQ A;  5DYM A;  4RBO A;  2NYX A;  3RKQ A;  5KK1 A;  2VJJ A;  3BR1 A;  5FD6 A;  3KEO A;  3G71 I;  1I1G A;  4XRS A;  2JZY A;  5B5E C;  1IDZ A;  1WH7 A;  2W48 A;  2JN6 A;  2H94 A;  3I71 A;  4BE2 A;  2K4B A;  3HTU A;  2XB0 X;  2CS3 A;  1D1A A;  2HEO A;  1R6R A;  2LLK A;  4E7J A;  2P8T A;  2HVS A;  1R1U A;  3RKY A;  3HOV J;  4CCM A;  2HTS A;  4FQG A;  1MMN A;  2PEX A;  3S3M A;  2F5E A;  2DFH A;  2FEZ A;  4PJJ A;  1T8I A;  1KYZ A;  3PSF A;  2VLA A;  4UV8 A;  2GOM A;  1ETW A;  1Z21 A;  1E3O C;  1MMS A;  3G73 A;  4M9Z A;  3SXY A;  2F4O B;  3M7G A;  4MEY F;  4MFD A;  3J7A Y;  3BQZ A;  1G3Y A;  3SYT A;  2JK3 A;  5JI6 A;  1WSU A;  1A6Q A;  1RR8 C;  1RZ4 A;  1RES A;  4K2E A;  2VE8 A;  2F5C A;  1SMY F;  2ID3 A;  3LWF A;  4KN4 X;  1ZTR A;  3WHC A;  3WU2 C;  5CVR A;  1J09 A;  2CW0 F;  4IVN A;  3GTK J;  3C2G A;  3GLX A;  2NVT J;  4JX5 A;  2P7C B;  1P9Q C;  2LC2 A;  1VZ0 A;  1FSH A;  1VI0 A;  3CCL I;  2Z9O A;  3P7N A;  4QLC U;  2W24 A;  2MD5 A;  5HS7 A;  3IKT A;  4UV9 A;  5ICC A;  2QGU A;  5M5X J;  4EM0 B;  2DXI A;  5HVQ C;  2JWT A;  3K4B A;  1UFM A;  2P0W A;  4FE4 A;  4F52 A;  2V6C A;  2LOO A;  3F21 A;  1I3Q J;  2K9L A;  1WQ2 A;  3ZQL A;  1XX5 A;  3FMR A;  1MW7 A;  1VQ7 I;  1VQ4 I;  4V2F A;  4A3B J;  4EJO A;  1IO2 A;  4QWQ A;  2WAD A;  1BM9 A;  3HHH A;  3B6C A;  1IXC A;  2V1X A;  2ZSH B;  5FLX K;  4LFU A;  5F64 A;  2VIX A;  1IV6 A;  1R9T J;  3H3V K;  4BXX J;  1HLV A;  2DQL A;  1J2X A;  3K4J A;  4ZYE A;  1ZH5 A;  5KNL A;  2XSD C;  2L02 A;  4IL6 C;  2OTL I;  1HST A;  2VBY A;  5HNF A;  1SMT A;  1LDD A;  1D5V A;  4KYW A;  5C4J J;  1POG A;  3FXQ A;  2PMZ N;  3BPX A;  2VN2 A;  1YI2 I;  2JVG A;  1JTY A;  3GFM A;  2QEN A;  4BAY A;  1A35 A;  2R7S A;  2FX0 A;  2EV5 A;  1T95 A;  3S1N J;  1U2W A;  4M6Y A;  4ENJ A;  3FXJ A;  3I9V 2;  1XCV A;  4CCN A;  4C2U A;  1ETO A;  2F5V A;  3NWS A;  3OMY A;  5A2Q Z;  1XSD A;  5E3N A;  3R4K A;  3BTI A;  4P9F A;  4A0Y A;  5LLQ A;  1TNS A;  2BZT A;  1F4K A;  3W6K B;  4WCG A;  1JUS A;  2PX9 A;  1K61 A;  2H8R A;  3OYN A;  1VQ8 I;  3A0B C;  2CMP A;  3L09 A;  3PIP F;  2RN7 A;  2JA6 J;  1U78 A;  4N9H A;  3HRT A;  2LTP A;  3VYU B;  1FLI A;  1MMA A;  2VBZ A;  1YLF A;  2VJ4 A;  4QIW N;  2E2I J;  1ZAO A;  5LEK A;  4WXC A;  4BAC A;  5F0H A;  1X1P A;  1BIB A;  2A61 A;  3DP7 A;  2K5C A;  5HOO A;  1QBJ A;  1VQ9 I;  1P4X A;  1T0F A;  2ZXH A;  3F6V A;  2F4M B;  2TDX A;  5DM7 F;  4ANJ A;  1PUF B;  2CUJ A;  1G6N A;  1U0J A;  4LLG F;  4IZZ A;  4KJZ A;  2UV1 A;  5C4X J;  3EUH A;  2JSC A;  2DMN A;  4MQV A;  2V1D A;  2FQ4 A;  5BMZ A;  2QQB A;  1ZN2 A;  3VFZ A;  4XLC A;  3JAM Z;  3LFU A;  4E7H A;  1GVD A;  4A3G J;  4CA0 A;  2VQG A;  1ULY A;  3OYE A;  2LF8 A;  1I5Z A;  3H3U A;  1K78 A;  3CME I;  2GXG A;  2M87 A;  2A6E F;  1JKQ C;  2AXT C;  3O6B B;  3KP4 A;  2DPD A;  3JTH A;  1RUN A;  4EM1 A;  3CDI A;  2P7V B;  2KJB A;  2E35 A;  3GXO A;  3K4M A;  4FE7 A;  3MWM A;  2K9M A;  2FD5 A;  4BDY A;  2L9S A;  3LQR A;  3DU5 A;  4F91 B;  4CCL A;  1BA5 A;  1ZHF A;  2VON A;  3MMY B;  2KFD A;  1FOW A;  5EYR A;  2CJJ A;  3WE3 A;  5J6X A;  2F48 A;  1SFE A;  2HQ5 A;  2HZT A;  3OV8 A;  1K4S A;  3F3X A;  3QRF F;  2GXB A;  1GHC A;  3ASN H;  2ZME A;  5BPI A;  1W36 C;  1A36 A;  3ASO H;  3SZP A;  1I1S A;  2K9S A;  4G6T B;  2QZ8 A;  4BH9 A;  2Z1D A;  5K1Y A;  4KIS A;  2JA2 A;  4ESF A;  3G3Z A;  2EFO A;  2PJR A;  5FGM A;  2CV1 A;  2NRA C;  2GM4 A;  4BQO A;  2E5N A;  2X85 A;  3QPH A;  5E1X A;  2H1L A; 
#chains in the Genus database with same CATH homology
 1DP7 P;  3P9K A;  4XSZ F;  5EEH A;  3DPT A;  4AIJ A;  1B9M A;  4M9X A;  1U5T A;  1K78 B;  1S7A A;  3QP5 A;  3D5L A;  4ZZL A;  4HBL A;  3D0S A;  1PP7 U;  2LDU A;  4OOI A;  2A68 F;  4G94 A;  2IJL A;  2DQR A;  1P2F A;  2DI3 A;  5E1W A;  1PUE E;  4HLX A;  2UWM A;  5D8K B;  1I6X A;  3V7S A;  1IN6 A;  3CJN A;  4YIF A;  3KFW X;  5D5X B;  3ML6 A;  2QVO A;  2O03 A;  1J75 A;  3K2Z A;  4M6X A;  4HYE A;  4WXD A;  4I0A A;  1USS A;  3GO5 A;  1KA8 A;  4L5J A;  4HV5 A;  3F23 A;  1IN8 A;  4LD5 A;  4U7B A;  3JSO A;  2IT0 A;  3LA3 A;  2K02 A;  3R60 A;  2MBF A;  2O6G E;  4PGG A;  3J80 Z;  1G3W A;  4MGR A;  4HLY A;  4HW0 A;  2A07 F;  2OQR A;  2EJR A;  1TQP A;  3I59 A;  4IRH A;  1JHF A;  4RB1 A;  2XGX A;  4L9J A;  4ESJ A;  3L9F A;  1XMA A;  4N0B A;  4UVA A;  5CVV A;  4LG0 A;  1SD7 A;  3MZH A;  3WU1 B;  3K0L A;  3ISP A;  4ZYG A;  4CXF A;  4GYI A;  2Z3Y A;  3IL2 A;  2O3F A;  5K5Q A;  3FMS A;  4AVP A;  5H6Q A;  1IUY A;  3WG9 A;  1DUX C;  5FD5 A;  1S6L A;  2IP2 A;  3EQL F;  1FX7 A;  1EH8 A;  1S7O A;  2CWE A;  3KLN A;  1MJ9 A;  1KU3 A;  1T38 A;  2FBI A;  5L3E A;  2JPB A;  3F72 A;  5D5W B;  3L2C A;  5AON A;  1ZG1 A;  3FZV A;  4YFK F;  3V7R A;  4G8X A;  2BE5 F;  5IT9 Z;  1TNT A;  5TRD A;  1P4A A;  1SFX A;  3PFI A;  5DUK A;  3L7W A;  3GFI A;  3TGN A;  4LLN A;  4HF2 A;  2BV6 A;  4OU0 A;  3M8E A;  2Q8K A;  1ZGJ A;  2EFP A;  1OMI A;  4WF2 A;  4MTE A;  2FNP A;  4Q4Z F;  2M8E A;  1VTN C;  4KFC A;  5ICF A;  3SZT A;  3IWZ A;  1YW9 A;  5DUI A;  3PQJ A;  1OKR A;  1G3T A;  1HSJ A;  2VBX A;  2FU4 A;  5HS8 A;  2PBI A;  3B02 A;  5DV5 A;  1YW8 A;  3FMQ A;  3EET A;  2UXX A;  2ISZ A;  3C18 A;  3F8N A;  1R58 A;  2YR2 A;  3R61 A;  3BZ6 A;  1UHM A;  4ETS A;  1LB2 A;  4YII A;  3RPU A;  4O3M A;  4ZYH A;  4LB5 A;  1B9N A;  4R1H A;  2EV6 A;  3AAF A;  2FSW A;  1TQI A;  1U6G A;  1KGS A;  1T39 A;  1R36 A;  1V4R A;  4HA8 A;  3RI4 A;  4YG2 F;  1LDK B;  4BHP A;  4PDK A;  4RS8 A;  1KU9 A;  3WE2 A;  4HX4 A;  3KLO A;  1FSE A;  4L9N A;  1QQI A;  4M9S A;  1IRG A;  3KE2 A;  3CUO A;  3O3K A;  1J9I A;  3LA2 A;  2WTE A;  4GXO A;  4L0Y B;  3EDP A;  1D8J A;  3J81 Z;  2EV0 A;  3ZPL A;  4B8X A;  2F5D A;  5LHG A;  2V9V A;  2WWY A;  4Q47 A;  3F8B A;  2JRT A;  4TV7 A;  2FML A;  5JFR A;  1DDN A;  1JHH A;  3TKY A;  2DFI A;  2DK5 A;  1W7P D;  4R8H A;  1QNT A;  3RKW A;  1P4W A;  4BHC A;  2KIU A;  3SHF A;  1YS7 A;  2P5L C;  3LAJ A;  5HDN A;  3HRS A;  2XKP A;  1SFU A;  5ED4 A;  4UVB A;  2GAU A;  2XIG A;  1V3F A;  3E6M A;  3NQO A;  5DCF A;  2IW5 A;  5BQT A;  1YS6 A;  2OD5 A;  2XRN A;  5BPD A;  1XD7 A;  3EYI A;  1HKS A;  4KA4 A;  5D8L B;  3WTV C;  2EA2 A;  2QWW A;  1LVA A;  3ROU A;  5CVU A;  1Z91 A;  5BS6 A;  1GXP A;  3OOP A;  2OA4 A;  2LKP A;  4LK0 F;  1QPM A;  1ZRE A;  5ERI A;  3BJ6 A;  4ZYD A;  1HKQ A;  4HDV A;  1MJB A;  3HIF A;  1W4M A;  4WX9 A;  4WK8 F;  1PP8 F;  2DK8 A;  3WU0 A;  1K7A A;  3I4P A;  2VOO A;  5LBQ A;  4HF1 A;  4EGZ A;  5A2Q K;  3I0T A;  4ESB A;  2XV4 S;  4A5N A;  4CHU A;  2GA2 A;  1Z9C A;  3KET A;  3HSR A;  3ABU A;  1K79 A;  3ZMV A;  2E1N A;  5HLG A;  3HSE A;  1XCB A;  3DF8 A;  4G7Z F;  1W5S A;  5DDG A;  1RI7 A;  1SAX A;  1ZRD A;  4CDG A;  3JTG A;  1QZZ A;  2HDC A;  4OIR F;  3VOE A;  3WTS C;  2FBH A;  3JAM K;  1TTY A;  2DO7 A;  2IRF G;  3KP6 A;  3K1P A;  1MJA A;  3DFG A;  3I58 A;  4EJW A;  1XGN A;  2CYY A;  4Y17 A;  1G3S A;  3U9G A;  4HOB A;  3J7A O;  4DNC A;  3FXU A;  3HSF A;  3T5X A;  3WGG A;  1D3Y A;  3Q9V A;  2HOE A;  4U88 A;  2XAH A;  2Y75 A;  1XDS A;  3K1M A;  1EH6 A;  4ASN A;  1YFH A;  2XAG A;  1YYV A;  2XAQ A;  1BI1 A;  5TJJ A;  3RYP A;  1IN5 A;  2GZW A;  2YU3 A;  1ZRC A;  1A04 A;  5ILS A;  3P9C A;  1FT9 A;  4O6J A;  2ZNY A;  4KT5 C;  1T2K A;  3R6S A;  4I7H A;  2ELH A;  1F1Z A;  1IAW A;  2STT A;  1O3T A;  1WRJ A;  3CTA A;  4HQM A;  3T0Y A;  4WXH A;  5J8C A;  3I5U A;  4A6D A;  2YX7 A;  1RIO H;  3CDH A;  1XMK A;  2FMY A;  4H0E A;  4LB6 B;  3ZP5 A;  3KP7 A;  2OQG A;  1RNL A;  1Z1D A;  4Y15 A;  2MC3 A;  5FFX A;  1R00 A;  2ZO4 A;  4ENN A;  3N97 A;  2OU2 A;  1ZYR F;  4PGH A;  4ZZD A;  3J80 K;  1IZ1 A;  1FY7 A;  4HX7 A;  5EEG A;  3IKV A;  1JXS A;  4EJV A;  2D1H A;  3TO7 A;  3ZN0 A;  2BEO A;  3ZQ7 A;  2P6S A;  3QU6 A;  4UHT A;  2XAF A;  5LHH A;  3BRO A;  4GO1 A;  2H6B A;  4A12 A;  2RKH A;  1YW7 A;  1J7K A;  2M1B A;  2YX4 A;  4L0Z B;  2OZ6 A;  4RGS A;  3HRM A;  5LGN A;  2WC2 A;  3TDZ C;  4KNY A;  3F8F A;  4KIC A;  4ENM A;  3F6O A;  3V4G A;  2JT1 A;  2PMH A;  2EK5 A;  1IRF A;  3ZMU A;  2KJC A;  3MZY A;  1MD0 A;  2W84 A;  5CYV A;  1UB9 A;  3NRV A;  1HXD A;  2E7W A;  4I09 A;  3CUQ C;  1TBX A;  3BJO A;  4Q48 A;  1UST A;  2J5O A;  5CVI A;  2P5K A;  2IA0 A;  5LHI A;  1OYI A;  4KIG A;  3QP6 A;  4NQW A;  3GEZ A;  1P6R A;  4XSX F;  5IT9 K;  3K69 A;  2Z99 A;  1R22 A;  3BJA A;  3HHG A;  4IRG A;  3EYY A;  2PFB A;  2HTJ A;  2X4H A;  4NHJ A;  1ZAR A;  4R79 A;  4Y13 A;  3DV8 A;  4I0B A;  2COM A;  1IW7 F;  3T8R A;  2K7L A;  2GIV A;  4UUV A;  1FYM A;  1BJA A;  1AWC A;  3U1D A;  1IN4 A;  1S3J A;  1XGS A;  4RB2 C;  1R5H A;  3HUG A;  1S29 A;  3ZMT A;  2H6C A;  5LEJ A;  1O3S A;  2D2W A;  5L3G A;  3F22 A;  5D6F A;  4BHB A;  3I54 A;  4CIC A;  5JR3 A;  2RQP A;  3ZMD A;  1J5Y A;  1C0W A;  4OIQ F;  2VT3 A;  1SD4 A;  5F6F A;  3DKW A;  2VOP A;  1YQA A;  2QQA A;  4L18 B;  4RAZ A;  1B6A A;  4EMS A;  4AD9 A;  2RNJ A;  3ECO A;  4JK1 X;  3GW2 A;  5JVT A;  4GGG A;  1HW1 A;  2CGP A;  4IHT A;  3L00 A;  1ZLJ A;  1FNN A;  3COA C;  1R5G A;  1KQ0 A;  1KU7 A;  2XAS A;  3FXR A;  1YIO A;  2DPU A;  4OIP F;  2XKO A;  1UCR A;  3I53 A;  3J81 K;  5KVR A;  1L0O C;  1OYY A;  2XRO A;  4MEX F;  5FFZ A;  3KP2 A;  1BOA A;  3O2P E;  2XAJ A;  1R1V A;  1XDU A;  2HYF A;  1STZ A;  3MQ0 A;  5K5R A;  5L3B A;  2Z5U A;  3GF2 A;  5CJ9 A;  1OR7 A;  3GFL A;  2K27 A;  3ZMS A;  3GVA A;  4IJA A;  4LK1 F;  1BC7 C;  2BYV E;  2LSO A;  4E70 A;  1IXS B;  5DCM B;  3IWF A;  1PDN C;  4I2O A;  3BOQ A;  1X3U A;  3CO7 C;  3BDD A;  3GFJ A;  4IPA A;  4M74 A;  1YG2 A;  2L4A A;  1R7J A;  5LGU A;  2ZJ2 A;  4WWC A;  1KQ9 A;  1Z6T A;  1ZGA A;  4XBF A;  2LNB A;  5ILU A;  2G7H A;  1E17 A;  2EB7 A;  2M45 A;  2R7D A;  2O0Y A;  3QU3 A;  1YTY A;  2K4J A;  3MAJ A;  4PZJ A;  1H9G A;  3QOP A;  4BYY A;  1TQM A;  2MH2 A;  3RTR A;  5HS9 A;  5CLS A;  4KUM A;  1Z05 A;  1UHW A;  2C6Y A;  3CUQ A;  1R1T A;  3V8L A;  2ETH A;  1GVJ A;  4RAY A;  3K1N A;  5FB2 A;  2MLK A;  2OZU A;  3GZ6 A;  3GYH X;  1MGT A;  2EA4 A;  5E8I A;  1O3Q A;  1BN5 A;  2HKO A;  2A6H F;  4CYD A;  2FF4 A;  2QLZ A;  1CGP A;  4AIK A;  4A0X A;  3DEU A;  2HR3 A;  2WV0 A;  2VOD A;  5ICE A;  3HTS B;  2O61 A;  2DBB A;  2UZK A;  3CLO A;  5LRR A;  3FM3 A;  2XUB A;  1O3R A;  3C7J A;  2ZXJ A;  1EH7 A;  4B09 A;  1G4D A;  5D6E A;  3CUQ B;  1ODD A;  2NAZ A;  3C1D A;  2A3S A;  1FBU A;  1QZY A;  3WTW C;  3Q9S A;  3V7C A;  3DQV C;  2IVM A;  2W57 A;  1BI2 A;  3GUD A;  3RYR A;  4EVI A;  2FA5 A;  3E6D A;  2RGV A;  1Y0U A;  1BBY A;  2VE9 A;  3W6J B;  2NS0 A;  3M9A A;  1LQ1 A;  1D8K A;  5HLI A;  1IN7 A;  1MDM B;  3SFZ A;  4F7Z A;  4N9I A;  1YO5 C;  3KP5 A;  3BP8 A;  1BC8 C;  4G6Q A;  3FM5 A;  5BOX A;  2OAZ A;  1AOY A;  1FYK A;  1IXR C;  4KMF A;  2L01 A;  2Y0M A;  1T6S A;  1WWX A;  2VBW A;  4JQF A;  5AIQ A;  1NHA A;  4UXN A;  3BWG A;  2P4W A;  2M5W A;  1R23 A;  3KZY A;  1O57 A;  4G7O F;  2HWV A;  1W7P B;  3ECH A;  2D1V A;  3TOA A;  1DPR A;  4KMU X;  4OIO F;  1T98 A;  1F9N A;  3B73 A;  4IHS A;  2RV8 A;  5L3F A;  1LDJ A;  2GQQ A;  3N4M A;  1L3L A;  2ZNZ A;  4OMY A;  1OPC A;  1H0M A;  2CSO A;  3MCZ A;  3VEP A;  3CO6 C;  3C3W A;  3E6C C;  3ERE D;  3WTU C;  4RB0 A;  1I27 A;  4ZH4 F;  2Q0O A;  3KEQ A;  1F5T A;  3F8C A;  2ESH A;  2QUF A;  1FZP B;  2OBP A;  4NB5 A;  3HOT A;  2X0L A;  3V8K A;  3Q5F A;  4ENK A;  2PN6 A;  4U0W A;  1JE8 A;  2CO5 A;  3H3Z A;  2H09 A;  2HKX A;  4EQQ A;  4BNC A;  5L3C A;  3TO9 A;  4FHT A;  2PLY A;  1KYW A;  2FOK A;  3KCC A;  3E5U A;  3JSP A;  3BY6 A;  2DT5 A;  2HS5 A;  5E18 F;  4LJZ F;  3TDU C;  3TOB A;  1SD5 A;  3FX3 A;  1S8N A;  2MA3 A;  3ZMZ A;  2EWN A;  4O5V A;  2KKO A;  3WGH A;  1ONV A;  3LAP A;  3LST A;  2ACJ A;  3REO A;  3E5Q A;  2CFX A;  1BIA A;  2L4M A;  4UVC A;  4U0Y A;  1ON2 A;  1FPQ A;  2DAO A;  4MHG A;  4GYG A;  4PCQ A;  5E1Z B;  3I64 A;  1LNW A;  2EFQ A;  4RGU A;  1ZLK A;  4G9Y A;  3DXJ F;  2FE3 A;  1LEA A;  4ON0 A;  5D5V B;  3FWE A;  1TW2 A;  5DD8 A;  2VXZ A;  4KIF A;  4IF4 A;  2CQK A;  2Q2E A;  3M8F A;  3HOS A;  1HW5 A;  3ULQ B;  1U3E M;  2IPQ X;  5JHU A;  2KIM A;  2FXA A;  3H92 A;  2UXN A;  3PQK A;  5FLX Z;  1O7F A;  1LJ9 A;  4MNU A;  4FT8 A;  4LMY A;  5IT3 A;  4AWX B;  2G7U A;  1XSV A;  2QQ9 A;  2W85 A;  2H27 A;  2V1U A;  4RB3 C;  5DEQ A;  1ON1 A;  4M71 A;  3LA7 A;  1MKM A;  2FBK A;  4A6E A;  1MZB A;  1ZRF A;  1TW3 A;  2ISY A;  3SQN A;  2A5Y B;  2W25 A;  2QYO A;  4XRF A;  4RGX A;  4DQ2 A;  5D5U B;  3E3V A;  1IF1 A;  4HAM A;  2DLL A;  2CG4 A;  3RDI A;  4G7H F;  2VC0 A;  2FQ3 A;  4L9T A;  2IA2 A;  3RKX A;  4BQA A;  4UNO A;  4JBA A;  5H20 A;  5HDK A;  3LQQ A;  4XLP F;  4HF0 A;  2F5F A;  1XGM A;  1B4A A;  4FX0 A;  3JW4 A;  4YFX F;  5E8G A;  1KU2 A;  2ZME B;  5ILV A;  4Z2Y A;  1HW2 A;  2AXL A;  2BGC A;  1WKM A;  2J5P A;  4S05 A;  4S04 A;  4KDP A;  3E97 A;  1FP1 D;  6PAX A;  1P92 A;  2ESN A;  4HZF A;  3K9T A;  1U5T B;  3V8J A;  2M30 A;  2F2E A;  3IC7 A;  5ICG A;  4U0V A;  3GZ5 A;  2DW4 A;  2DU9 A;  2YSR A;  2PQ8 A;  4A5M A;  4CO8 A;  2Y48 A;  3T8T A;  4EM2 A;  5HDG A;  5AIP A;  2P6T A;  4LGW A;  3IHU A;  1FOK A;  3RIR A;  2MLG A;  2LF7 A;  4CZZ A;  1XGO A;  2KRF A;  4G6D A;  5J8F A;  2QBY A;  3ZN1 A;  4P5O A;  1ZG3 A;  3WTT C;  2QM3 A;  5H6R A;  5E17 F;  2PI0 A;  3WTX C;  4HX8 A;  1FP2 A;  4CGZ A;  4I98 B;  1TLH B;  2XHK A;  4MTD A;  1HQC A;  2D45 A;  4MQ9 F;  3RPQ A;  5DCM A;  2Z33 A;  2E7X A;  3I59 B;  1BI3 A;  3R0A A;  3WGI A;  4FX4 A;  1OYW A;  4LG0 B;  4EJU A;  4HQE A;  1JGS A;  4LLL A;  2NNN A;  1HKT A;  2FRH A;  3FF5 A;  2VC1 A;  4RGR A;  2HQN A;  2R3S A;  2RDP A;  2QBY B;  4EJT A;  2ZFW A;  1B1B A;  5L3D A;  3RJP A;  5DD4 A;  2HGC A;  4D0P A;  3P9I A;  4OMZ A;  1XSX A;  2FNA A;  1H9T A;  4Q5S F;  2NNY A;  3IRR A;  4KIB A;  1ZG5 A;  4IRI A;  1E2X A;  3QPT A;  4A0Z A;  2R7F A;  5D4S A;  2PG4 A;  2YPR A;  1REP C;  4HV6 A;  2HFH A;  2HYG D;  3GWZ A;  2EFW A;  1BI0 A;  1SD6 A;  4EV0 A;  4P9U A;  1CF7 A;  2E1C A;  4AIH A;  1EV7 A;  4IXA A;  4GCV A;  2ZCW A;  3FHZ A;  1Z7U A;  4P55 A;  4U7D A;  2XVC A;  3HRU A;  1FWZ A;  1Z6R A;  3R0J A;  3LFK A;  2GWR A;  3HYI A;  1O7L A;  2PMU A;  3NEU A;  2G9W A;  1Q1H A;  3WOD F;  1FBQ A;  1XN7 A;  3E6B A;  4L9V A;  2L3D A;  4OIN F;  5D4R A;  4P96 A;  5F1R A;  1J59 A;  4I02 A;  3TO6 A;  1QGP A;  1LEB A;  1QO0 D;  2RVC A;  2ZKZ A;  3TQN A;  1WI9 A;  2JTV A;  2ADU A;  3KP3 A;  3VB2 A;  3U2R A;  1U8R A;  2ZBK A;  3M1E A;  3BPV A;  3MFK A;  1CF7 B;  2A69 F;  1MDM A;  4L5I A;  1B59 A;  3T1B A;  1HBX G;  2V79 A;  2EFN A;  1FBS A;  2HQR A;  2O8X A;  3GX4 X;  2JPC A;  4XLN F;  5K5O A;  2AS5 F;  1GXQ A;  3MEX A;  3IRQ A;  4EGY A;  2B0L A;  2K86 A;  3ABT A;  3KZZ A;  4HDU A;  2MH9 A;  3E5X A;  2P5V A;  1FYL A;  5LRS A;  5E20 A;  4KN7 X;  3QAH A;  2IA1 A;  3VOD A;  1W5T A;  4A2U A;  5LGT A;  2DTR A;  2VT2 A;  2STW A;  1U5T C;  2BBY A;  2L54 A;  4M73 A;  1XB4 A;  1W7P A;  5CVJ A;  3DPL C;  3S2W A;  5FO5 A;  1RUO A;  3ELK A;  2KIF A;  2RC4 A;  4BXU A;  1J0R A;  2PJP A;  2GA1 A;  1KQ8 A;  3WTY C;  3WTZ A;  1K6O A;  3F8M A;  4I01 A;  4M72 A;  1FC3 A;  5HLH A;  4YFN F;  5DYM A;  2NYX A;  5KK1 A;  5FD6 A;  3KEO A;  1I1G A;  2JZY A;  3I71 A;  2H94 A;  2K4B A;  3HTU A;  2HEO A;  2P8T A;  1R1U A;  3RKY A;  2HTS A;  2PEX A;  2F5E A;  2FEZ A;  1KYZ A;  4UV8 A;  3G73 A;  4M9Z A;  3SXY A;  3M7G A;  4MEY F;  1G3Y A;  5JI6 A;  1WSU A;  1RZ4 A;  4K2E A;  2VE8 A;  2F5C A;  1SMY F;  3LWF A;  4KN4 X;  5CVR A;  2CW0 F;  4IVN A;  3GLX A;  2P7C B;  1FSH A;  2Z9O A;  3P7N A;  4QLC U;  2W24 A;  2MD5 A;  5HS7 A;  3IKT A;  4UV9 A;  5ICC A;  4EM0 B;  5HVQ C;  1UFM A;  2V6C A;  3F21 A;  1WQ2 A;  3FMR A;  4EJO A;  4QWQ A;  1BM9 A;  3HHH A;  1IXC A;  2V1X A;  5FLX K;  4LFU A;  5F64 A;  2DQL A;  1J2X A;  4ZYE A;  1ZH5 A;  2L02 A;  1HST A;  2VBY A;  1SMT A;  1LDD A;  1D5V A;  4KYW A;  3FXQ A;  3BPX A;  2VN2 A;  3GFM A;  2QEN A;  4BAY A;  2EV5 A;  1U2W A;  4M6Y A;  4ENJ A;  1XCV A;  5A2Q Z;  1XSD A;  3R4K A;  4P9F A;  4A0Y A;  5LLQ A;  1TNS A;  1F4K A;  3W6K B;  4WCG A;  3L09 A;  2RN7 A;  1U78 A;  4N9H A;  3HRT A;  1FLI A;  2VBZ A;  1YLF A;  1ZAO A;  5LEK A;  4WXC A;  1BIB A;  2A61 A;  3DP7 A;  5HOO A;  1QBJ A;  1P4X A;  1T0F A;  3F6V A;  2TDX A;  1G6N A;  4LLG F;  3EUH A;  2JSC A;  4MQV A;  2V1D A;  5BMZ A;  2QQB A;  1ZN2 A;  3VFZ A;  3JAM Z;  1ULY A;  2LF8 A;  1I5Z A;  3H3U A;  1K78 A;  2GXG A;  2M87 A;  2A6E F;  2DPD A;  3O6B B;  3KP4 A;  3JTH A;  1RUN A;  4EM1 A;  2P7V B;  2KJB A;  3GXO A;  3MWM A;  3LQR A;  1ZHF A;  2VON A;  3WE3 A;  5J6X A;  1SFE A;  2HZT A;  3OV8 A;  3F3X A;  3QRF F;  2GXB A;  1GHC A;  2ZME A;  5BPI A;  3SZP A;  1I1S A;  2QZ8 A;  4BH9 A;  5K1Y A;  4ESF A;  3G3Z A;  2EFO A;  5FGM A;  2NRA C;  1DPU A;  3QPH A;  5E1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...