1IF1A

Interferon regulatory factor 1 (irf-1) complex with dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
105
structure length
105
Chain Sequence
RMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (26-MER)
publication title Structure of IRF-1 with bound DNA reveals determinants of interferon regulation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 17
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1if1A00
1G6NA 2YR2A 3GX4X 3GEZA 3D0SA 4ZH4F 3EYIA 4IRIA 4LLLA 1MKMA 5LEJA 2HGCA 3K1NA 3H3ZA 1QZZA 3ML6A 4UVAA 3TGNA 2STWA 3BDDA 3RI4A 2VODA 2GA1A 2F5DA 1KU7A 3KP5A 4L0ZB 1XGSA 5E1XA 1G3SA 4UHTA 1T39A 5FB2A 3BPVA 4L18B 4L9VA 5BQTA 2RC4A 5J8FA 4CICA 2D45A 1CGPA 1PUEE 1E17A 2ZJ2A 4G9YA 1Q1HA 4CHUA 2DBBA 3F23A 3ERED 1FP2A 2A5YB 4HBLA 2ETHA 1WQ2A 2XASA 1K7AA 1HW5A 2EJRA 2P5LC 2TDXA 4CXFA 3V8KA 3JSOA 4H0EA 1QBJA 2P5KA 2Z3YA 4IHSA 4CYDA 4L5JA 3WTUC 2M45A 5CVUA 4R8HA 1STZA 4ZYHA 4Y17A 3GYHX 5CLSA 1J59A 2QUFA 2XHKA 2Z99A 1YLFA 4A5MA 2OD5A 4WWCA 2QENA 5LGNA 1R22A 5AIPA 4ENKA 3GFLA 5LHGA 2OBPA 3CDHA 2ACJA 2CFXA 2L3DA 3L09A 3PQKA 2Y48A 2OQRA 1TBXA 3ECHA 4UXNA 2XAFA 2ZKZA 3ZQ7A 2FBIA 5J6XA 3M8FA 3T5XA 4ESBA 1R58A 4GGGA 4HV6A 3ECOA 5BPIA 4EM2A 2L4AA 1IZ1A 1KA8A 5DD4A 5L3DA 3FXRA 1KU9A 5L3GA 4G94A 4EJTA 3RIRA 3GZ5A 5CVRA 4ZYDA 3W6JB 1U5TB 1FBUA 1R1VA 1HXDA 3CTAA 4FHTA 1USSA 3MEXA 3FWEA 3LA7A 2GXGA 4OIQF 2F5CA 4KMUX 4I0BA 1JXSA 1ON2A 2FU4A 1KGSA 2GQQA 1W7PB 3RTRA 2V1DA 1IW7F 2YX4A 2W84A 2PBIA 1HKTA 2H09A 3CLOA 2DAOA 4XSZF 3GFIA 1D3YA 2XAQA 2HQNA 1R1TA 3P7NA 2D2WA 4L5IA 2VE8A 1QQIA 3E6BA 3KEQA 1O3SA 4JK1X 3IWZA 3K69A 4AVPA 1XSVA 2P6TA 5D5UB 2GIVA 2RKHA 2DPDA 4RGRA 3J81K 1WI9A 2COMA 3BWGA 4HW0A 3SZPA 3HRTA 4P96A 1SFUA 3RKYA 4YG2F 2RNJA 2OAZA 5DEQA 3C18A 1CF7A 3R60A 2HTJA 1S7OA 2XRNA 3TO7A 1GXPA 1P4XA 2CSOA 4IVNA 3FM3A 1IF1A 3ELKA 1TNTA 2AS5F 3WTZA 3JW4A 1KU2A 1HKQA 1I27A 3U2RA 4MTEA 1XCBA 1YW7A 2X0LA 2ZBKA 4U0VA 4HYEA 2IT0A 1R23A 3HOSA 3JAMK 3QP5A 2H6BA 3CUQB 2VN2A 5F64A 5JHUA 2JZYA 2O6GE 1GHCA 4WCGA 4ESJA 3VOEA 5FGMA 5BPDA 4ASNA 5L3BA 3R4KA 2EV6A 4OIOF 2DK5A 2GAUA 1FT9A 1RIOH 1ZGJA 2W57A 1HQCA 1T6SA 4M71A 2YPRA 4XLNF 1FBQA 1UHWA 1JGSA 2DQLA 4GYGA 1ZRCA 3VB2A 2DQRA 1IRFA 5H6QA 1K79A 4ZYGA 4DQ2A 1EH8A 1S7AA 5F1RA 4N9HA 2JT1A 1OYWA 2HOEA 4EM1A 2R7FA 1FZPB 4IRGA 3WU0A 3F72A 4L9JA 4I2OA 1LDKB 1YO5C 1K6OA 2VT2A 1DDNA 4NHJA 1SMTA 2VBXA 2Y75A 4LK0F 3K9TA 3SFZA 1IUYA 4PGGA 2ESHA 1LQ1A 4I09A 5ERIA 4KMFA 3HTUA 3MZHA 3R61A 4UV8A 2VE9A 1DPUA 4P5OA 3RKWA 3KE2A 2QQAA 4S04A 3GFJA 2QLZA 3QOPA 3TKYA 5TJJA 1O7LA 2KIUA 4CO8A 4R79A 3V8LA 5D8LB 2FOKA 4E70A 3BJOA 5H6RA 3R6SA 2ZNYA 1ON1A 1U5TA 3IRRA 2Q0OA 1R00A 3TO9A 3VFZA 1BN5A 2CO5A 3E5QA 1S6LA 3IC7A 2FEZA 1C0WA 3Q9SA 4P9UA 2HFHA 5D4SA 1ULYA 3SXYA 1W7PA 2EWNA 3PFIA 3QRFF 3QU6A 4M9SA 1SFEA 2KIMA 1RUNA 4FX0A 3RDIA 1U5TC 5E17F 2FXAA 4PGHA 3DFGA 3VEPA 2VOOA 2K27A 4EJWA 1ZRFA 1HSTA 2F2EA 5HS8A 3F8BA 2ISZA 1GVJA 3FX3A 2KIFA 3QP6A 2QQBA 4WXHA 3N97A 4IPAA 5K5QA 3WTSC 4MTDA 4ZZLA 2E1CA 1ZN2A 3GF2A 1KQ8A 2VC0A 1P6RA 1F4KA 4ENMA 4Q4ZF 1G4DA 3DXJF 4F7ZA 3FMSA 2A69F 1J7KA 5KVRA 5HS7A 4G7ZF 1GXQA 1XMKA 2P6SA 1U6GA 3SZTA 2EA4A 1TW3A 1I1GA 4G7HF 2VOPA 2PMUA 2PI0A 1XSDA 1KU3A 2E7XA 3DF8A 4HF0A 2FMYA 4BHPA 3TDUC 4HOBA 3U9GA 5HDGA 3G73A 1HSJA 5FLXZ 5HDKA 2A6HF 3CUQA 3R0JA 3TO6A 4K2EA 2XV4S 4EQQA 2OU2A 1UCRA 3RYRA 4BQAA 1RNLA 2BE5F 2P7VB 1IXRC 1L0OC 3GLXA 1HBXG 3I71A 3T8RA 4OMYA 2GXBA 4HF2A 3J81Z 2EFQA 3I54A 4UUVA 3I4PA 3HTSB 1ZG1A 1LVAA 4R1HA 3CUQC 1OMIA 4KUMA 4EV0A 5D5WB 1XSXA 1YIOA 3IHUA 4EM0B 1XD7A 3ISPA 2ZNZA 2UXXA 3E6MA 1FSEA 1ZHFA 1XDSA 4RAZA 3FHZA 1S29A 2XAGA 3V8JA 1K78A 4O5VA 5AONA 3WTTC 2GZWA 1IN5A 3BY6A 4M9ZA 1AOYA 1T2KA 4I01A 3RKXA 4AIJA 1V3FA 3EYYA 1MD0A 1Z6TA 1OKRA 3HOTA 1IN4A 1NHAA 3HSRA 4HLXA 3I5UA 2HS5A 2D1VA 2XUBA 2A61A 3JAMZ 4GXOA 5DUKA 3F8FA 3GZ6A 4CZZA 3AAFA 3FM5A 3WTYC 1B6AA 3M9AA 2EV0A 1LEAA 1MZBA 2JSCA 1YW8A 2DW4A 4XSXF 4M74A 1PP7U 5FO5A 5KK1A 1BI2A 1PDNC 1V4RA 3GFMA 3F8CA 1DUXC 2W25A 2MD5A 1QPMA 1UFMA 2MH2A 5HLIA 4HA8A 1KQ0A 4WF2A 3IRQA 1SMYF 2M1BA 2JPBA 4Y15A 2LKPA 1FP1D 1S3JA 5DCMB 5CJ9A 1LJ9A 2FRHA 1FOKA 4KN7X 2WWYA 4OIPF 3MZYA 4GYIA 2PFBA 3ZMTA 4BYYA 1TQPA 4AWXB 3N4MA 2NRAC 4M72A 3TOBA 4QLCU 4RB3C 2IVMA 1KYWA 4EJOA 2FMLA 3F8NA 3NEUA 1QZYA 2F5FA 1U3EM 1ZLJA 3M1EA 2RV8A 5D5XB 2FBHA 1ZH5A 5FLXK 1FC3A 2ZO4A 5DV5A 2OA4A 3L9FA 4LK1F 4EGZA 3HIFA 2P4WA 1TLHB 3GXOA 3HSFA 3DEUA 1SD4A 4WXCA 2EFNA 2J5OA 2WV0A 3IKVA 4UVCA 3ZMDA 4HZFA 5ILVA 5FD6A 3DP7A 5A2QZ 4ZYEA 1E2XA 4LLNA 3DPTA 2AXLA 2UXNA 1T0FA 3HRSA 5LRSA 2PQ8A 2QQ9A 2BV6A 2IA0A 1I5ZA 5E8IA 1B9NA 3NRVA 3V7RA 4PZJA 1ZARA 5LRRA 4B09A 4YIFA 2YU3A 1J75A 1D8JA 3NQOA 3FMRA 4G8XA 3LAJA 1SD6A 3MQ0A 4UNOA 5D6FA 5LBQA 3KEOA 1IAWA 4WK8F 2HKOA 4G6DA 1YS6A 1P2FA 3U1DA 2BYVE 3FXQA 4RAYA 1Z9CA 3M8EA 4HQEA 5ED4A 2VT3A 1B59A 4XBFA 2A07F 1XB4A 3WTWC 5D4RA 2DU9A 4M73A 1X3UA 2NS0A 1YFHA 1Y0UA 5LLQA 2FA5A 1MJAA 2O03A 4MGRA 4A2UA 2EB7A 3DQVC 3KZYA 2QWWA 5LGTA 4Q47A 2Z33A 1FPQA 4LB6B 2KRFA 2LF7A 4BXUA 2CQKA 3PQJA 4G7OF 3G3ZA 1LEBA 2DO7A 2MBFA 4HX8A 5JVTA 2R7DA 4ON0A 2EK5A 4I7HA 2Z9OA 3GUDA 5ILUA 1D5VA 2DI3A 5CYVA 4LG0B 3BOQA 3ROUA 2CG4A 2HQRA 3LFKA 5JI6A 5BOXA 2BGCA 4RB0A 4U7DA 4BHCA 5ILSA 1R36A 3KP2A 1IN6A 3MAJA 1MDMB 1TNSA 1BC8C 1BOAA 1IXCA 2RN7A 1K78B 1ONVA 2VBYA 4BAYA 2X4HA 3K2ZA 4WX9A 4JBAA 5BS6A 1ZRDA 3HRUA 4NQWA 4KDPA 1U2WA 3ULQB 3ZPLA 2D1HA 2VXZA 5CVIA 2YX7A 4IRHA 3HYIA 2H27A 4HQMA 3WU1B 1ODDA 1BJAA 2EA2A 5L3CA 4U0YA 2RDPA 2P5VA 2KKOA 1BBYA 4HF1A 3ZMZA 2HYGD 2MC3A 5A2QK 1F9NA 3WGGA 1ZG5A 1P4AA 4HV5A 4O6JA 2K7LA 4KT5C 5DD8A 3QAHA 2M8EA 4KN4X 1TQMA 3C7JA 1SD5A 1BIBA 5IT9K 1EH6A 5D5VB 3KFWX 1BI3A 1REPC 1XCVA 5CVVA 3BJAA 1FYKA 3LWFA 3F6VA 3J80Z 3KP4A 4MQVA 1BI1A 4RGUA 5D6EA 5DCMA 2XVCA 2XKOA 4MNUA 2ELHA 4U0WA 5DDGA 2W85A 1G3WA 2XKPA 4M6YA 1BIAA 2OZ6A 2PEXA 2HZTA 1G3TA 1R5GA 2DTRA 3TDZC 4OOIA 3I53A 4AIKA 1WSUA 2V79A 3CO6C 4IHTA 1T38A 3RPQA 2CYYA 3K1PA 2GA2A 1L3LA 1HW2A 3GW2A 3GVAA 4XLPF 2FQ3A 1XGOA 1FLIA 5FD5A 5LHHA 3R0AA 2LF8A 3GWZA 2Y0MA 2QYOA 1W5TA 1W5SA 3LA3A 4LFUA 3MFKA 1KYZA 1PP8F 1Z91A 3C1DA 2MLKA 3Q5FA 1O7FA 4ENNA 3F6OA 4LD5A 2WC2A 4RB1A 2M30A 2QBYB 3OOPA 2QM3A 4B8XA 2L4MA 5HOOA 4RGXA 4FT8A 5E8GA 3WODF 5FFZA 3P9IA 4I02A 3J7AO 1WRJA 1KQ9A 2ZXJA 1IRGA 3B02A 4NB5A 2LDUA 2NAZA 4P9FA 3RPUA 1R1UA 1RZ4A 3P9CA 5HVQC 2ZFWA 3E5XA 3CUOA 3F8MA 3ZN0A 3EETA 3MCZA 5JR3A 2FBKA 4YIIA 4OIRF 4CDGA 1AWCA 1YQAA 1RUOA 2Z5UA 1OYIA 4KICA 3T8TA 2V1UA 3E3VA 5K5RA 1OR7A 4ESFA 4MHGA 1FSHA 1HKSA 3COAC 3VODA 1ZYRF 2L01A 3LQQA 3H92A 5ICEA 2VBWA 1J5YA 4ETSA 1FBSA 4G6QA 4D0PA 5FFXA 2K4BA 1I6XA 3CO7C 4OINF 3DV8A 2UWMA 4A5NA 1O3RA 2XAJA 2DT5A 4L9NA 3J80K 1QO0D 3KP7A 4LB5A 5D8KB 1W7PD 1TTYA 4YFXF 4LG0A 3F21A 1BM9A 3IKTA 1IXSB 1FY7A 2PMHA 1MDMA 5HDNA 2RVCA 3V7SA 4M9XA 1XGNA 1Z05A 2STTA 3TQNA 3F22A 3FF5A 5HLHA 1QNTA 2OQGA 2A68F 2ESNA 4KA4A 4A0XA 4Q5SF 2NNNA 4HDVA 2NYXA 4N0BA 4AD9A 3CJNA 2LNBA 4O3MA 1H9GA 4I0AA 1TQIA 1OPCA 1WKMA 3I59A 3O6BB 2BBYA 4IF4A 2K86A 2KJCA 3LSTA 4Q48A 2Q8KA 1SD7A 4RGSA 4WXDA 3S2WA 4HAMA 3ZMSA 2FE3A 2V6CA 2DK8A 3FMQA 3HSEA 2L02A 3KCCA 2IRFG 1O57A 2ADUA 2RGVA 3SQNA 2VONA 5EEHA 3C3WA 5LHIA 1J9IA 1JHFA 1UHMA 2XROA 4GCVA 1F1ZA 2MA3A 5LGUA 2HKXA 3ZMVA 5HS9A 1A04A 3ZP5A 1EV7A 2FNAA 3KP3A 3I0TA 1Z6RA 4N9IA 2IPQX 4EJVA 2BEOA 4UVBA 4HLYA 5E1WA 4RB2C 2R3SA 2QVOA 3D5LA 2EFOA 3IL2A 1G3YA 4HX4A 2PLYA 4A12A 1IN8A 3I58A 5CVJA 1YG2A 3W6KB 3EDPA 5H20A 3KZZA 3SHFA 1SAXA 4EJUA 1MJBA 4U88A 1B9MA 4U7BA 1U78A 5E18F 1FYLA 3P9KA 6PAXA 2P7CB 2ZCWA 3Q9VA 2QZ8A 1EH7A 4BHBA 2MH9A 5AIQA 4M6XA 5EEGA 5J8CA 4IXAA 2HDCA 5BMZA 4FX4A 5ICCA 1MJ9A 3RJPA 4OMZA 2NNYA 4CGZA 4MEXF 5IT9Z 3WGIA 1B4AA 2IW5A 1H9TA 3E97A 2QBYA 3FZVA 3DPLC 4I98B 1O3TA 2ZMEB 3JTHA 4L9TA 1ZREA 4QWQA 3WG9A 5DUIA 3HHHA 3BPXA 1DP7P 2DPUA 3I64A 2E7WA 2GWRA 4ZZDA 5IT3A 2LSOA 4KNYA 2F5EA 2O61A 1XN7A 2PJPA 2JRTA 2HWVA 2K4JA 1SFXA 5JFRA 3E6CC 4XRFA 5DYMA 3KLNA 4PCQA 4EGYA 2MLGA 5E20A 2W24A 3QU3A 1YYVA 3ZMUA 1FX7A 4RS8A 2H94A 1FNNA 2CWEA 4LGWA 3O3KA 1YW9A 1ZAOA 5ICGA 1UB9A 2HR3A 2FNPA 3ZN1A 2IP2A 4A0YA 1W4MA 4LLGF 1B1BA 5LEKA 2G7HA 1P4WA 2V1XA 1T98A 2YSRA 1ZGAA 3E6DA 3ABTA 3REOA 2K02A 3K0LA 4A0ZA 5ICFA 2EFWA 1J2XA 1XGMA 2J5PA 3F3XA 3H3UA 3EQLF 2VBZA 3L00A 1ZG3A 4A6EA 3BZ6A 2G7UA 2EFPA 2XIGA 3QPHA 3RYPA 3V4GA 1P92A 4KIFA 2HEOA 2WTEA 2IJLA 1VTNC 2VC1A 1ZLKA 3I59B 2V9VA 3O2PE 2XGXA 1D8KA 2CGPA 2E1NA 3K1MA 4KIBA 1R5HA 3KLOA 4S05A 2HTSA 4Y13A 3FXUA 3HHGA 3LA2A 4MEYF 5L3FA 2O3FA 2FSWA 4HDUA 4KIGA 2PG4A 3EUHA 1U8RA 2G9WA 1TW2A 2DLLA 2Q2EA 1LDJA 1XMAA 2B0LA 3KP6A 4EVIA 3HRMA 3BJ6A 4L0YB 3T0YA 2M87A 1LNWA 4KFCA 5L3EA 1J0RA 2DFIA 3M7GA 1BI0A 3JTGA 4LMYA 2CW0F 4KYWA 3HUGA 1R7JA 1XDUA 2O8XA 3WGHA 3L2CA 1JHHA 5E1ZB 2JPCA 2P8TA 5DCFA 1LDDA 4A6DA 2RQPA 4Z2YA 3IWFA 4HX7A 3GO5A 1Z7UA 1O3QA 2ISYA 1YTYA 4OU0A 1FWZA 1QGPA 1RI7A 3OV8A 1S8NA 1MGTA 3WTVC 1WWXA 1YS7A 1DPRA 1F5TA 3QPTA 1H0MA 4LJZF 2XAHA 2A3SA 2EV5A 4DNCA 3E5UA 4IJAA 3TOAA 2A6EF 5K1YA 4BNCA 3JSPA 3V7CA 1OYYA 2HYFA 1Z1DA 4YFNF 2PN6A 3L7WA 4P55A 3T1BA 1LB2A 2IA2A 3KETA 4BH9A 4TV7A 5F6FA 4AIHA 3MWMA 4UV9A 3LAPA 3WE3A 4MQ9F 2O0YA 2ZMEA 2M5WA 1IN7A 2L54A 3LQRA 3WE2A 4JQFA 2KJBA 5HLGA 1CF7B 4ENJA 3ABUA 3BROA 1HW1A 5K5OA 2C6YA 3BP8A 2OZUA 4EMSA 2UZKA 2JTVA 5TRDA 3B73A 3DKWA 3WTXC 4PDKA 4YFKF 2IA1A 1JE8A 1USTA 4GO1A 2FF4A 1BC7C 1I1SA 2H6CA 1FYMA
chains in the Genus database with same CATH superfamily
2N8GA 1G6NA 2YR2A 2ZMEC 3GX4X 5GADJ 3GEZA 3D0SA 1WI3A 4ZH4F 3EYIA 4IRIA 1FOXA 4LLLA 4IEJA 1MKMA 5LEJA 3BTCA 3GTLJ 1F36A 2HGCA 3K1NA 3IAM2 3H3ZA 2QGUA 3DEWA 3LSKA 4XLAA 1QZZA 3OS1A 4D5FA 4BE2A 3ML6A 4UVAA 3TGNA 2STWA 5J1UA 3BDDA 3RI4A 2VODA 1T33A 2GA1A 4CUGA 2F5DA 5IPAA 1KU7A 3OWTA 4F91B 5IY5H 4AIDA 1WVRA 1WHUA 3KP5A 4L0ZB 1XGSA 5E1XA 3C2HA 2KZVA 2JA5J 4C2UA 1G3SA 3IP4B 4UHTA 1T39A 4YRVA 5FB2A 4F93B 3NWSA 3FXOA 3VSKA 4M6VA 4CH7A 2VKVA 3BPVA 4L18B 2V4JC 2VUMJ 5JLXA 2EZLA 4E7JA 4L9VA 5BQTA 2RC4A 1QZEA 5J8FA 4CICA 2D45A 2NVQJ 1CGPA 1PUEE 3LNQA 4HSRA 3BG5A 1E17A 2ZJ2A 2Z16A 2ZXWH 4G9YA 1Q1HA 3SEZA 4CHUA 3KYCB 2DBBA 4N4OB 1E3OC 4ZTFA 3F23A 2JN6A 3ERED 3PNTA 1D0ZA 1FP2A 2BZTA 2A5YB 4HBLA 2XSJC 2ETHA 3W2VA 5FKNA 1WQ2A 1IC8A 2XASA 1K7AA 1HW5A 2EJRA 2P5LC 2TDXA 3LMMA 4CXFA 2CU7A 3V8KA 5FRMA 1ACIA 2K85A 4BJ6C 2ZSIB 3JSOA 1IRZA 3GMEA 3HL2A 2L5QA 3GTJJ 2X1EA 1ZR4A 2OPTA 4H0EA 1QBJA 2P5KA 2Z3YA 4IHSA 3A1YA 4CYDA 4J01A 3KPHA 2R0QC 4L5JA 3K4KA 3WTUC 1Y8QB 2ZFUA 2M45A 5CVUA 4R8HA 1VQ9I 3OL4A 3L1PA 1STZA 1VQMI 4ZYHA 4Y17A 3PM1A 3GYHX 4FASD 1QVUA 5CKTA 3PSFA 4BXXJ 5CLSA 1PUFB 2DFHA 3GTKJ 2M2EA 2XB0X 1OCCH 2DJIA 1ORKA 1J59A 1U8BA 4IOAF 2QUFA 3VYSB 3I3LA 3ZCOA 2XHKA 2Z99A 1YLFA 4A5MA 2OD5A 4WWCA 2QENA 5LGNA 5D5WB 5EGOA 1R22A 4XKVA 5AIPA 1UZCA 4ENKA 1U9OA 3J7YJ 5BNGA 3GFLA 5LHGA 3RPUD 2K40A 2OBPA 2R5ZB 3CDHA 2ACJA 4F52A 5E3OA 1RR8C 2M4GA 3PIPF 3E0JB 4S0HB 2CFXA 2L3DA 3L09A 3G1OA 3PQKA 2X9DA 3GLLA 2QQ8A 1VQ6I 3CCUI 2Y48A 3OYNA 4LIVA 2OQRA 4E7HA 1TBXA 3BG7A 5KAIC 4IOCF 3ECHA 4UXNA 2XAFA 2ZKZA 3OYFA 3ZQ7A 1UG0A 2FBIA 1TZLA 5J6XA 3M8FA 2QF7A 4XKCA 3T5XA 4ESBA 1R58A 4E6KG 4GGGA 4HV6A 3ECOA 5BPIA 1RETA 2AQEA 4EM2A 2L4AA 1IZ1A 3BR0A 1KA8A 1XX5A 4HSTA 5DD4A 3D1NI 1WJAA 5L3DA 3FXRA 2V9KA 1W36D 1KU9A 5L3GA 4G94A 4EJTA 3RIRA 3GZ5A 2GIZA 5CVRA 4ZYDA 5H2FC 2BW3A 2LK2A 3W6JB 3L2VA 1U5TB 2H8WA 1FBUA 1R1VA 1HXDA 3CTAA 4FHTA 1USSA 1V54H 3MEXA 3FWEA 3LA7A 2GXGA 4OIQF 2F5CA 4KMUX 4I0BA 5EG0B 2RNGA 1JXSA 1SANA 1UJ8A 1ON2A 1WJCA 1I39A 4LOCA 3GTMJ 3IV5A 1FIPA 1ETQA 2FU4A 1KGSA 2GQQA 1W7PB 3A0BC 3HXLA 3MKLA 2X6YA 1Z21A 4Y4RA 4A3EJ 3RTRA 2DYSH 2V1DA 1IW7F 2YX4A 2W84A 2PBIA 5FKLA 1HKTA 2H09A 3CLOA 2DAOA 2XGCA 5JHFA 2NS7A 4XSZF 3GFIA 1VFCA 1D3YA 2XAQA 2HQNA 1MBHA 1R1TA 1T56A 3P7NA 4Y52J 1HA8A 2D2WA 4L5IA 2B9SA 2VE8A 1TT0A 3HDDA 1QQIA 4M3BA 3E6BA 4A3MJ 3KEQA 1O3SA 4JK1X 3IWZA 3CCJI 3K69A 4AVPA 1XSVA 2M7BA 2P6TA 3PFYA 2DMPA 3FDYA 4A3BJ 4RA2A 1UHSA 5D5UB 2GIVA 4IX7A 2RKHA 2DPDA 4RGRA 3J81K 1WI9A 2COMA 3BWGA 4HW0A 4A93J 1BL0A 2QSHX 3SZPA 3U1KA 2KL4A 1R6RA 4FE4A 3CMAI 3ZXSA 4DW6A 3HRTA 3LSGA 4P96A 1SFUA 3RKYA 2DCEA 4YG2F 2L9VA 2RNJA 2VJIA 1EA3A 4CA0A 2OAZA 3OIPA 5DEQA 3I4NJ 1YIJI 3PUBA 3C18A 1CF7A 3R60A 5IP7J 5KAFC 4PJLA 2HTJA 1S7OA 2XRNA 3J7AY 3F0CA 3TO7A 5FROA 1GXPA 3S1NJ 1P4XA 2CSOA 3ONQA 4IVNA 1LE8B 3OYBA 3PNVA 4D5CA 2QEXI 3H5AA 1ITYA 1JKOC 2E36A 3FM3A 3HC7A 3BC8A 2NOJB 1IF1A 3ELKA 1TNTA 2AS5F 3CJTB 3ZQFA 2KPMA 1R49A 2HXOA 3WTZA 3JW4A 1KU2A 1SFKA 3K4BA 4A3LJ 1OCOH 1HKQA 1I3AA 3RQ4A 1JJ6C 2R7XA 3S2DJ 1BR4A 1I27A 1HOMA 2OCEA 3U2RA 4ITVA 2DFEA 4MTEA 1XCBA 4E4HA 1YW7A 2X0LA 2ZBKA 2R7RA 2W82A 4EEFG 4U0VA 4HYEA 3TP0A 2H1KA 2IT0A 5IYDJ 1R23A 1FJLA 3HOSA 3JAMK 3QP5A 1ZK8A 1BW5A 2H6BA 4FE7A 3CUQB 2BY1A 2ELKA 5FKKA 2EZIA 2VN2A 5F64A 5JHUA 2JZYA 5K7HA 2X6XA 3WHCA 1G59A 2O6GE 5HNFA 4HRIA 1N77A 1GHCA 1E3PA 2KZGA 4WCGA 2VXDA 3UNGC 4U87A 2GOMA 3AKZA 4ESJA 3VOEA 4DJAA 5FGMA 5BPDA 2CRGA 4NC6A 4ASNA 5L3BA 3R4KA 2EV6A 3GTPJ 3SFIA 3EPZA 3ASNH 4OIOF 2DK5A 2VQHA 4UB8C 4Y7NJ 2GAUA 1FT9A 2XAUA 1RIOH 1ZGJA 1OCRH 2W57A 1HQCA 1T6SA 4M71A 4DIQA 3RKQA 3HGGA 2YPRA 4XLNF 2NOGA 4M3DA 1FBQA 2F6CA 2LFBA 5EZHA 1MSFC 1UHWA 1JGSA 2DQLA 1LUJB 4J00A 4GYGA 1ZRCA 3VB2A 3W2AA 2DQRA 1IRFA 5M3MJ 2COBA 2O7OA 5H6QA 1K79A 2FX0A 3EUKL 2VASA 4ZYGA 4HNUA 2R4GA 4DQ2A 3S32A 2LC2A 1TL8A 1EH8A 3SEQA 2ECBA 1WGXA 3CD6I 2XPVA 1S7AA 5F1RA 4N9HA 2M7AA 2JT1A 3MVPA 2HNHA 2JA2A 5TISC 1OYWA 2WA0A 2HOEA 1N25A 4EM1A 2QSGX 2R7FA 4BJTA 1ETVA 2XGEA 4CCJA 1FZPB 4IRGA 3WU0A 2M0MA 3F72A 3LSJA 2MYSA 4L9JA 2WAEA 4I2OA 4XONA 1LDKB 4FQGA 4C2MJ 1YO5C 2OV7A 1K6OA 5EGOB 2VT2A 2DN0A 2ZXIA 1DDNA 2X48A 4NHJA 1SMTA 4C3HJ 4C2TA 1TWAJ 2VBXA 2Y75A 4LK0F 3K9TA 3SFZA 1IUYA 4PGGA 4RAFA 2R5ZA 1DQUA 2ESHA 3M8JA 1QHGA 2K9SA 1LQ1A 4I09A 1I3QJ 3BR5A 5ERIA 4KMFA 3HTUA 2XB5A 3MZHA 1IUFA 3R61A 4UV8A 2VE9A 1DPUA 3W2WA 1OCTC 4P5OA 3RKWA 5J47A 2D5VA 3HOXJ 3KE2A 2QQAA 2ZSHB 3HOUJ 4S04A 3GFJA 1PVEA 4XKWA 4RLFA 4D7NA 1RESA 3C2GA 5FLMJ 2E34A 2QLZA 3ZQHA 3S3NA 3QOPA 3TKYA 5TJJA 4V19K 1O7LA 2KIUA 1TP4A 4CO8A 3CJQB 2XF7A 4R79A 3V8LA 3JRGA 1ETKA 1WJDA 5D8LB 2FOKA 4E70A 3EUAA 1NK3P 4BGDA 1X4PA 3BJOA 2CW7A 3TBIA 2V6EA 5H6RA 2Y30A 2ZNYA 3R6SA 1ON1A 1WJ5A 1U5TA 2IXSA 4BY1J 2CUJA 1X19A 3IRRA 1QVTA 2Q0OA 1R00A 2AXTC 3TO9A 4A3IJ 3VFZA 4ZDLA 1BN5A 2CO5A 3IH2A 5J4YA 3E5QA 1S6LA 3IC7A 2FEZA 1C0WA 3HOWJ 2IGKA 1JKPC 4IO9F 3MKYB 5EG0A 1OISA 3VYUB 2IEKA 3Q9SA 4P9UA 1BW6A 2HFHA 3RQIA 5F08A 3TW7A 3BR1A 5D4SA 1ZR2A 1ULYA 3SXYA 1W7PA 3HBLA 3DCFA 3CCVI 2EWNA 3PFIA 3BG6A 3KZIC 3QRFF 4A3DJ 2LH9A 3QU6A 3OYAA 4M9SA 3LL7A 1SFEA 4MIMA 2KIMA 1RUNA 2BY0A 1FTZA 4FX0A 3RDIA 4P1WA 1U5TC 2HZDA 5E17F 2FXAA 4PGHA 1SVMA 5FKOA 3E7LA 5IYCJ 3ZQCA 2GLOA 3DFGA 2E19A 3VEPA 2WB1N 2AHQA 2VOOA 1LVKA 2K27A 3BG9A 4EJWA 2VI6A 1JUMA 1ZRFA 1HSTA 2F2EA 3P5JA 2KISA 1QU3A 2GXAA 5HS8A 3F8BA 2ISZA 1GVJA 3FX3A 5KNLA 2KIFA 3QP6A 4XM3A 1NG7A 2QQBA 4WXHA 3DWLE 3N97A 4IPAA 3OYJA 5K5QA 3WTSC 4MTDA 4ZZLA 1JT6A 2E1CA 2R7VA 1DGRM 1V5EA 1ZN2A 4IHYA 3GF2A 4GRIA 1KQ8A 2VC0A 1P6RA 3MD2A 1F4KA 1AKHB 2JRMA 4ENMA 4Q4ZF 1G4DA 4IHVA 4DYRA 3BTIA 5DM7F 5B1BH 3L2RA 2E71A 1EJ9A 1T95A 3DXJF 4B1RA 1RKWA 2XPUA 2VQLA 4F7ZA 3FMSA 5C4JJ 2A69F 1J7KA 2XF6A 3OY9A 3FK6A 1LE8A 4JYKA 2QSFX 2RAEA 1ETWA 5J1YA 1V55H 2CUFA 1BA5A 5KVRA 2KRHA 1HC8A 5HS7A 4D1QA 4RM3A 3CLQA 5IP9J 3JRAA 4G7ZF 2FOWA 2KIQA 2ELJA 1GXQA 2OC6A 1XMKA 1Z77A 2P6SA 1XS9A 1U6GA 4PJJA 2EA4A 1TW3A 3SZTA 2ID6A 1I1GA 1MBFA 3OL3A 4PFPA 1DU6A 4G7HF 2VOPA 2PMUA 2PI0A 1XSDA 1KU3A 2E1MB 2E7XA 3K6GA 3DF8A 4HF0A 2FMYA 4BHPA 1MH3A 3OYEA 2E2IJ 3TDUC 1O4XA 4HOBA 2X1CA 1D0YA 4V2FA 3U9GA 2X6WA 3TL4X 2IS4A 5HDGA 3G73A 1HSJA 5FLXZ 5HDKA 2A6HF 3CUQA 4DOZA 2DMUA 3R0JA 3TO6A 3ZOBA 4IHXA 4K2EA 2VQGA 4IQ4A 2XV4S 2EIMH 4EQQA 1S9HA 2OU2A 2XSDC 3CMYA 1UCRA 2BY2A 2FUG2 3RYRA 4BQAA 2WB1A 3VYRB 1RNLA 4XLEA 2BE5F 2P7VB 4M3FA 2QKLB 1IXRC 1L0OC 3GLXA 3KIOA 1HBXG 3I71A 2HOAA 3T8RA 2MABA 4OMYA 2GXBA 3S16J 4HF2A 3A4CA 1SVLA 2EFQA 3I54A 5GPCA 3J81Z 3NWTA 4UUVA 3I4PA 4DZPA 3HTSB 4V2GA 1ZG1A 1LVAA 3FISA 1OQYA 4R1HA 1E0EA 3D5SC 3CUQC 1MBGA 2JA7J 1OMIA 2CQNA 4KUMA 4EV0A 3OYLA 1MNMC 4KISA 2VPRA 4CCKA 4DYQA 5F0HA 2CH0A 1BJZA 1XSXA 1YIOA 3IHUA 5LFAA 2OJED 3AG2H 4EM0B 2BXYA 4BJ5C 1XD7A 2ME0A 3ISPA 2ZNZA 2UXXA 3E6MA 1FSEA 1YX5A 1Z67A 1D5YA 3H9QA 2YUSA 3MN2A 1U0JA 1ZHFA 1X1CA 1XDSA 2HYJA 4RAZA 3FHZA 2HU9A 3TW6A 1S29A 3AG1H 1K4SA 4XN3A 4CCNA 1N78A 2XAGA 3IUOA 3V8JA 1K78A 1AU7A 4QIWN 4O5VA 2W48A 5AONA 1JGGA 3WTTC 2JQ7A 2K3FA 2VLAA 2GZWA 1IN5A 3BY6A 1RKTA 2O5RA 2R7OA 4M9ZA 4NQWB 2ID3A 1AOYA 2R7ZJ 2MFZA 2CW8A 4I01A 1T2KA 2GBYA 3RKXA 2XPWA 2MGQA 4AIJA 4CSWA 1V3FA 3EYYA 1YI2I 1MD0A 3DU5A 1Z6TA 1OKRA 2WY8Q 2CUEA 1GDTA 3HOTA 1IN4A 1NHAA 3HSRA 2DMTA 1T8IA 4HLXA 3SJMA 4XLFA 3I5UA 2HS5A 2D1VA 2XUBA 3JRFA 2A61A 5IOYA 3FBNB 1DP3A 3JAMZ 4GXOA 5DUKA 4OAYA 3F8FA 3QPLA 4FETA 3GZ6A 4CZZA 3AAFA 3HKZN 4HPQA 3FM5A 4HNTA 3WTYC 3HOZJ 1B6AA 3G4SI 3M9AA 2K9NA 3QOEA 1MMDA 3K4CA 2EV0A 1LEAA 1MZBA 2JSCA 5GP9A 4ABZA 1YW8A 3FXMA 2DW4A 4XSXF 4M74A 1PP7U 2IGNA 5FO5A 3I9V2 5KK1A 2F48A 1BI2A 1PDNC 1V4RA 3GFMA 3F8CA 1DUXC 2W25A 3OR2C 2DT6A 2KHMA 4DZJA 2MD5A 1QPMA 1UFMA 2MH2A 3CCSI 3BR3A 5HLIA 2X6OA 4HA8A 1H89C 2H8RA 1KQ0A 4WF2A 3IRQA 3CMEI 3CF2A 2I5UA 1SMYF 2M1BA 2JPBA 2LYCA 4Y15A 4BDZA 3UKGA 2DA2A 2EPFA 2LKPA 3M4OJ 1FP1D 4BY7J 1S3JA 5FLVA 1VQ8I 5DCMB 1ERDA 5CJ9A 4W97A 1LJ9A 2FRHA 3RCOA 3SZGA 3IAS2 3K4JA 1FOKA 4KN7X 3OYCA 4FISA 2WWYA 5F1JA 3JREA 2L7FP 3CCLI 1R71A 4OIPF 3MZYA 3H1CA 4GYIA 2PFBA 3ZMTA 2VKDA 4BYYA 5DM6F 1TQPA 4AWXB 3CF5F 3N4MA 2NRAC 1X1PA 2KLOA 2CQ7A 4M72A 3TOBA 1MW7A 4QLCU 4RB3C 2V7FA 2E60A 2IVMA 3ZQIA 1OFCX 1KYWA 3BQYA 4EJOA 1YITI 3OS0A 2FMLA 3QYBA 4MFDA 1X3WB 2LG4A 3M07A 3F8NA 1MMNA 3NEUA 1ZQ3P 1QZYA 2F5FA 3FXJA 1ZLJA 3M1EA 1U3EM 2RV8A 2CMPA 5D5XB 2FBHA 1ZH5A 2L0KA 5FLXK 1FC3A 1W0TA 2JSPA 2OTJI 4XOTA 2ZO4A 2VKHA 4HG2A 5DV5A 3ABMH 4KJZA 2OA4A 5HNHA 3PUFA 3L9FA 4LK1F 4EGZA 3HIFA 4AYBN 2P4WA 3DKXA 1TLHB 3GXOA 2V26A 2VKEA 3HSFA 3DEUA 1SD4A 4WXCA 2EFNA 5CQEA 2J5OA 2LLKA 3HKZA 2WV0A 4M3GA 3IKVA 4UVCA 3ZMDA 2TRTA 4HZFA 4RLQA 3OR1C 4X6AJ 5ILVA 5FD6A 5J1RA 2WY7Q 3DP7A 5A2QZ 4XLCA 4ZYEA 1E2XA 4LLNA 3DPTA 2AXLA 2MW8A 1D1AA 2UXNA 1T0FA 3HRSA 5LRSA 3HG9A 2PQ8A 3Q3SA 2QQ9A 2BV6A 2ICWG 2IA0A 3H3VK 1I5ZA 3JRDA 5E8IA 4DGWB 2I8DA 1AKHA 2NVUB 3QYEA 1B9NA 2HPIA 2CFOA 2UUZA 3NRVA 3V7RA 2LTPA 1VQLI 4PZJA 1ZARA 2DODA 3NARA 5LRRA 3PIOF 4B09A 4BU2A 4YIFA 2YU3A 3A03A 2P0WA 3JRBA 1J75A 1D8JA 2ME6A 3NQOA 1MSEC 3FMRA 4G8XA 4CCLA 1VZ0A 2NVYJ 2QKMB 3RSNA 3LAJA 1VQNI 1SD6A 3S17J 4M3EA 3MQ0A 4UNOA 5D6FA 1UG2A 2P81A 5LBQA 3KEOA 1GV5A 1IAWA 4WK8F 2HKOA 4OAZA 5FJ8J 4G6DA 1T0FC 1YS6A 3CDLA 1P2FA 5M5WJ 3U1DA 2BYVE 2DA6A 1YRNB 1Y39A 3FXQA 2ECCA 4RAYA 1QA6A 2KFDA 3M8EA 5F0FA 4HQEA 1Z9CA 1D1CA 2M9HA 5ED4A 1X1BA 2VT3A 1B59A 4NNJA 4XBFA 2A07F 4HNVA 1XB4A 2YS9A 3WTWC 2R7WA 4Y3OA 5D4RA 2DU9A 4M73A 4ZYAA 1X3UA 2NS0A 5M3FJ 1YFHA 1Y0UA 2DA7A 5LLQA 1SFOJ 3DTEA 3RZDJ 2FA5A 1MNEA 1KONA 2Y9ZA 1MJAA 2JA6J 2R92J 2O03A 1LFUP 2JVGA 1HF0A 4MGRA 1M1EB 1F43A 4A2UA 2EB7A 3S3OA 4BKXA 4XLHA 3DQVC 2DFFA 3KZYA 2QWWA 1HDDC 5LGTA 1U9NA 4F92B 4AYBA 1YJNI 3K70C 2EILH 4Q47A 2Z33A 1FPQA 4LB6B 4IHWA 3B6AA 2JWTA 1IRXA 2KRFA 2LF7A 4BXUA 3B6CA 1X4OA 5E3MA 2W00A 2E1MC 2CQKA 2IAIA 2E1OA 2DA1A 1UELB 3PQJA 1AA7A 4G7OF 3G3ZA 3DTIA 2DO7A 1LEBA 2MBFA 3BR2A 4HX8A 5JVTA 2R7DA 4ON0A 2EK5A 5EYRA 4I7HA 2Z9OA 2RQQA 3GUDA 5ILUA 1D5VA 2XRLA 2DI3A 5CYVA 4LG0B 3BOQA 3ROUA 3G71I 2CG4A 4XR6A 2R93J 2HQRA 3LFKA 5JI6A 5BOXA 2BGCA 4RAGA 1G8XA 4RB0A 4U7DA 4BHCA 3WG7H 5ILSA 1R36A 2F4OB 3KP2A 1IN6A 3MAJA 4IZZA 4ZDPA 1MDMB 1JUPA 1WH7A 1TNSA 2DJNA 4RMNA 1BC8C 1BOAA 1IXCA 2RN7A 2K9LA 2XC7A 1K78B 1ONVA 2VBYA 4XRSA 1OCPA 2IS2A 4BEHA 4BAYA 2X4HA 3BTJA 2W4SA 5GTIC 2YU9J 2EIJH 3K2ZA 1LPQA 3DLAA 4NC8A 1B8IA 5FKMA 4WX9A 4JBAA 5BS6A 3DLLF 1ZRDA 4A3JJ 2I10A 3HRUA 4NQWA 3BZKA 4KDPA 4C9YA 1U2WA 4BUPA 3ULQB 3ZPLA 2D1HA 2HXIA 3H36A 4JOMA 2VXZA 5CVIA 2YX7A 4IRHA 3K7AJ 1YJWI 3HYIA 2H27A 4HQMA 1K4TA 2AO9A 4UUTA 3WU1B 1ODDA 1BJAA 2EA2A 2VQCA 2AQFA 5L3CA 4U0YA 3OYKA 5DTDA 2RDPA 2P5VA 3AG3H 2KKOA 3AL0B 1MMGA 3DU6A 4ZC3A 3OYGA 5M5YJ 2NVTJ 1BBYA 3LSMA 4HF1A 3ZMZA 2HYGD 1W1WE 3HJEA 1FMWA 3LSPA 2MC3A 5A2QK 1F9NA 2HPMA 4Y33A 3WGGA 4B43A 1ZG5A 1P4AA 3CZ6A 4HV5A 4O6JA 2K7LA 1G2HA 4KT5C 3BTLA 4JX4A 5DD8A 4IQJA 3QAHA 2M8EA 4KN4X 3ASOH 1TQMA 3C7JA 1SD5A 1MBEA 1BIBA 2M3AA 2EBIA 5IT9K 1EH6A 3H0DA 5D5VB 1BR2A 3KFWX 1BI3A 1REPC 2HDWA 1ZTRA 2HVSA 3S3MA 3QYFA 1XCVA 3H35A 4BBSJ 2XF5A 4PJ0C 5CVVA 1Z0XA 3BJAA 1FYKA 3LWFA 3H9GA 3F6VA 3J80Z 3KP4A 3OIQA 4MQVA 5IP6A 1BI1A 4RGUA 5D6EA 5DCMA 2XVCA 2ZXHA 1NH3A 4C3IJ 2XKOA 1E3HA 4MNUA 3TMOA 5LD2C 4GFBA 2EIKH 4BXFA 5JVGF 2ELHA 3FXKA 2JK3A 4U0WA 5F0CA 3A02A 5DDGA 5M5XJ 3OS2A 2W85A 2K3PA 3CMMA 1G3WA 3ESWB 3GTGJ 2LY1A 3JCUC 2Z1DA 2XKPA 3HPGA 3CP2A 1WZ2A 4M6YA 1BIAA 2OZ6A 1K61A 2PEXA 1RR7A 2HZTA 1G3TA 2OCCH 1R5GA 3S1RJ 2DTRA 5B1AH 1MNDA 2M34A 1A36A 1IO2A 3Q0WA 3TDZC 4B3XA 2FD5A 4OOIA 3I53A 4AIKA 4A69C 3RZOJ 1WSUA 2F4IA 2V79A 3OIOA 4XRSG 3CO6C 3BR6A 3M3YJ 4IHTA 5B3SH 3RPQA 2CYYA 1T38A 4B44A 2MC4A 3K1PA 2GA2A 2WV1A 1L3LA 2KDOA 2HVQA 3CCEI 3S1MJ 4PJNA 3JRHA 2DA5A 1HW2A 3GW2A 1LFPA 3H0GJ 4CYCB 1WH5A 3GVAA 4XLPF 2JUCA 1LKXA 2FQ3A 2R7SA 1XGOA 3E1SA 1FLIA 2HDDA 1YHQI 5FD5A 3HOYJ 5LHHA 3R0AA 2LF8A 3GWZA 2Y0MA 2QYOA 2IS6A 4B3AA 1W5TA 3FK7A 4YELA 1ETOA 3ERMA 1W5SA 3LA3A 4E7SA 4LFUA 3MFKA 1BOBA 3OSGA 1KYZA 1PP8F 1Z91A 4DBRA 1JUSA 3C1DA 2VJ5A 1SC7A 4KITB 3CCYA 2MLKA 4UB6C 3Q5FA 1O7FA 3OOUA 4ENNA 2F4MB 3F6OA 3FKIJ 4LD5A 2HQAA 1GT0C 3J7ZI 2WC2A 1ZELA 4RB1A 2OF7A 2R7TA 2M30A 2A05A 4XNFA 2QBYB 2VJJA 3OOPA 3GTQJ 2QM3A 2EINH 3HGYA 4B8XA 2L4MA 5HOOA 2L9SA 4RGXA 4FT8A 5E8GA 3WODF 2A6TA 5FFZA 3P9IA 4I02A 3J7AO 1WRJA 2X85A 5EEAA 2FJ1A 3W3CA 4D7MA 1KQ9A 1X3ZB 2ZXJA 1IRGA 3S8PA 3B02A 4NB5A 1JKRC 2LDUA 1X1AA 2NAZA 4P9FA 3AFHA 3RPUA 1R1UA 1RZ4A 3P9CA 1EKEA 2VIXA 2PX9A 5GPAA 5HVQC 2ZFWA 5GAGJ 3E5XA 3CUOA 3F8MA 1YRNA 2L7MP 3ZN0A 1TWGJ 2PMZN 3EETA 5CPRB 3MCZA 5JR3A 3KX2A 2FBKA 2R7UA 4YIIA 4OIRF 1J09A 2EH3A 4CDGA 1AWCA 2XDVA 1JJ8C 1OJLA 1YQAA 1RUOA 4LG3A 3S14J 3CCQI 4BACA 2Z5UA 1OYIA 5K7FA 4KICA 4E7KA 3T8TA 2V1UA 3E3VA 4ZTJA 5GAEJ 2KRCA 2VPLA 1I6HJ 5K5RA 5HODA 5E79C 1OR7A 3A01A 4ESFA 1Z3XA 4MHGA 4BS9A 3PO2J 1HKSA 1FSHA 2DOFA 5C3EJ 1IV8A 5B66C 3COAC 3VODA 1P7JA 1ZYRF 4XKBA 2L01A 3LQQA 3H92A 2BY3A 4AVZA 5ICEA 2VBWA 1J5YA 4ETSA 1FBSA 3HB9A 4G6QA 4FCYA 4ZJZA 4D0PA 5FFXA 2K4BA 1I6XA 3CO7C 2R5YB 5TGTA 4D9JA 1QHHD 2NXNB 4OINF 3DV8A 3K4NA 3A0HC 1MMSA 2UWMA 5KHDA 3OYIA 2CQXA 2VJ4A 4A5NA 1O3RA 2XAJA 1P9QC 2DT5A 4L9NA 5EF6A 3J80K 1QO0D 3CQZJ 5C4XJ 1V5FA 3KP7A 2E5NA 4UY8I 4LB5A 5D8KB 4MFEA 1W7PD 1TTYA 2LREA 3PO3J 4YFXF 3H5NA 1OR7C 4LG0A 1X1DA 3F21A 1BM9A 1W36C 3IKTA 2BOLA 2CV2A 4PSXA 2DOEA 5J4VA 1FIAA 1IXSB 2L9NA 3S93A 1FY7A 3SDGA 1QRYA 1VI0A 2PMHA 2LKXA 1MDMA 1V5GA 3DTKA 5HDNA 2RVCA 3V7SA 4M9XA 1XGNA 3WHBA 1Z05A 2LY9A 2STTA 3TQNA 4JX5A 3VPRA 3F22A 3FF5A 4BEHB 3I4MJ 5HLHA 1FMVA 1QNTA 1IDZA 2OQGA 2A68F 1VQOI 2ESNA 1B8IB 4KA4A 4A0XA 4Q5SF 2NNNA 1HLVA 5C44J 4XN0A 4BBRJ 4RM2A 4HDVA 4ANJA 2NYXA 4N0BA 4AD9A 3CJNA 3F9KA 2LNBA 2G0EA 3JRIA 4O3MA 3FKJA 1W0UA 3DBHB 1H9GA 4JX6A 1S7EA 4I0AA 5F04A 1WJFA 2BVLA 1TQIA 2PMZA 1OPCA 1WKMA 3I59A 3O6BB 4QPQA 5B5EC 3A2KA 2BBYA 3MKZA 2CQQA 2WBMA 4IF4A 5HLTA 2HI3A 3JR9A 2K86A 2PJRB 1POGA 1D1BA 2LP0A 4BE1A 3FIWA 3PJRA 2KJCA 1Y8RB 3LSTA 2UV1A 4Q48A 4X1EA 1OLTA 3VDXA 2Q8KA 1SD7A 3BQZA 4RGSA 4WXDA 4G12A 1OCZH 1JI8A 1JTYA 3S2WA 4HAMA 1VNDA 3ZMSA 2CV1A 5J40A 1VQ5I 1XTAA 2A5WA 2FE3A 1FTTA 1A5JA 2V6CA 3GCMA 4F3QA 2DK8A 3FMQA 4JP0A 3HSEA 1MH4A 2L02A 3L2UA 3KCCA 1K6YA 2IRFG 1O57A 2ADUA 2RGVA 3SQNA 1SAUA 2Z2SB 2VONA 1PJRA 2L7KA 3V42A 1RC9A 5EEHA 3C3WA 2DT7B 3QPSA 5LHIA 4E7ZA 2Q2EB 1J9IA 4NUBA 1JHFA 1TWFJ 1UHMA 2DDAA 3OSFA 2OTLI 1A6QA 2EZHA 3AL0C 2XROA 2Y0SN 4GCVA 1F1ZA 2MA3A 3O8GA 2Y2ZA 5LGUA 2DA4A 5EDNA 3SDBA 3ABKH 3GZNB 2HKXA 3ZMVA 5HS9A 1A04A 2LBFB 3ZP5A 1EV7A 2JJ7A 3BG3A 3FXLA 1T08B 2FNAA 1EF4A 3HUGB 1Y1VJ 2LKSA 1GLNA 3I0TA 1Z6RA 3KP3A 4C3JJ 4N9IA 2IPQX 4EJVA 3ZQLA 2BEOA 4UVBA 1KZHA 4HLYA 2ZB9A 5E1WA 1ENHA 2R3SA 4RB2C 2QVOA 1MBJA 1JTXA 3D5LA 4AM3A 2V9PA 4LIUA 3S1QJ 2JVHA 2EFOA 3CC2I 3IL2A 1XPXA 1G3YA 4HX4A 2MD0A 2L7ZA 2PLYA 4CCMA 4DBQA 4A12A 1IN8A 3I58A 5CVJA 4N4NB 1YG2A 4BQQA 3Q0VA 3W6KB 3EDPA 1ZGWA 4AC0A 5H20A 1JKQC 2V1NA 3KZZA 3SHFA 1SEUA 1SAXA 1WJBA 2B63J 1APLC 2CJJA 4EJUA 3VWBA 4CYCA 1MJBA 1QPIA 4U88A 1B9MA 3PNYA 3NAUA 2Q1ZB 4U7BA 9ANTA 1U78A 2CS3A 2XGDA 5E18F 1FYLA 3P9KA 2X1DA 4IKFA 6PAXA 2P7CB 1MIJA 2ZCWA 1VF9A 3Q9VA 2QZ8A 5GAHJ 3AG4H 1EH7A 3I55I 4CZCA 4BHBA 4YEJA 2MH9A 3PL8A 5AIQA 4M6XA 3W6VA 2ZJPF 5EEGA 1I50J 2CUZA 3TEDA 5J8CA 4IXAA 4C30A 2HDCA 4UUSB 1VQKI 5BMZA 4G6TB 4FX4A 4KT6A 5ICCA 1MJ9A 3RJPA 3DBLB 4CCOA 4OMZA 2NNYA 4CGZA 4MEXF 5J3LA 5IT9Z 1XG1A 2DA3A 2BHZA 3WGIA 2H1LA 2CV0A 1B4AA 2LOOA 2IW5A 3U21A 1H9TA 3E97A 2QBYA 4I99C 3FZVA 3GTOJ 3ZQGA 2TCTA 3WU2C 3DPLC 1LFBA 4I98B 1O3TA 2HVRA 1B72B 2ZMEB 2X51A 3JTHA 4L9TA 4QTRA 1ZREA 2HOTA 2Y0SA 4QWQA 3FHNA 3QODA 4H4KC 3WG9A 4DYCA 5DUIA 3HPHA 3HHHA 3BPXA 1DP7P 2DPUA 1AHDP 2Y9YA 1R4MB 3I64A 2E7WA 3ZRGA 5F27A 3OYHA 3IH3A 1GVDA 3IH4A 2GWRA 4ZZDA 5IT3A 1NK2P 1A31A 2M0CA 2LSOA 4II3A 1R4NB 4KNYA 2F5EA 2O61A 3KEYA 1MBKA 3HEFA 1IDYA 1XN7A 2VB6A 3S2HJ 5JLWA 1IG7A 2JRTA 2PJPA 4XRMA 4XICA 1WJEA 2KQRA 2HWVA 2LVSA 4XMYA 2K4JA 1SFXA 1Q1VA 1IJWC 1IV6A 5JFRA 3K10A 3E6CC 1RRJA 4XRFA 5DYMA 3KLNA 4PCQA 4EGYA 2MLGA 5E20A 2W1OA 4MO7A 2W24A 3QU3A 4BQOA 3G6EI 5IYBJ 4A3KJ 1YYVA 4BL0B 3DPUA 4PFOA 3LFUA 3ZMUA 4HEA2 2DTZA 3A01B 2K5CA 2OUMA 1FX7A 3ZQQA 1Y56A 4RS8A 2H94A 2MSYA 4PK4A 4EATA 1FNNA 2CWEA 4LGWA 3O3KA 3VYTB 1UMQA 3M1CA 1YW9A 2B7EA 1ZAOA 5ICGA 1UB9A 2ZJQF 4E7IA 2HR3A 2FNPA 2Y69H 3ZN1A 2W7NA 2IP2A 4A0YA 3C2BA 4RDUA 1W4MA 3Q0UA 4LLGF 4NC7A 1Y1WJ 1B1BA 3VSLA 1TC3C 2LR8A 5LEKA 3DKYA 3CC7I 2G7HA 1P4WA 2IS1A 4X0GA 2V1XA 2R5YA 1T98A 2YSRA 1TT5B 4XORA 1YJ9I 1ZGAA 3E6DA 3ABTA 1GUUA 3H5RA 2NS8A 3REOA 1CQTA 2K02A 1X2NA 3K0LA 4A0ZA 5ICFA 2EFWA 1IGNA 1J2XA 1XGMA 2J5PA 3PSIA 4XIDA 2BXZA 4FTHA 4LITA 5E3NA 1S72I 3F3XA 2M8GX 3CDIA 4XOPA 5K7ZA 2IGOA 2L2OA 3H3UA 3QQAA 1NG6A 3EQLF 3G2BA 2QA4I 3BCAA 2VBZA 3L00A 1ZG3A 4A6EA 3BZ6A 4NDLA 2G7UA 2O9LA 4E7LA 2EFPA 2XIGA 3CP8A 3QPHA 3BCBA 3RYPA 3V4GA 2GOXB 1P92A 4XL9A 5EZGA 3MMYB 4BDYA 2MG4A 3LSHA 4KIFA 4RBOA 2EZKA 2HEOA 2WTEA 1Y0NA 4A3FJ 2E2HJ 4AUXA 2IJLA 1YE9A 1JT0A 2LD5A 4B4CA 1VTNC 2DOAA 2VC1A 2O8KA 3S15J 1ZLKA 3I59B 2V9VA 5GTHC 4I6ZA 1BR1A 3O2PE 2XGXA 4OWRB 3KYLA 4ZDOA 2HOSA 2R7QA 1D8KA 3BT9A 2BHYA 1Y6IA 2CGPA 1PUFA 2E5ZA 2E1NA 3G1MA 1D0XA 2PJRA 3K1MA 4KIBA 1R5HA 1DGWY 3KLOA 5FRNA 1TWCJ 2LY2A 4S05A 2HTSA 4Y13A 2JA8J 3FXUA 3HHGA 3LA2A 4MEYF 5L3FA 2O3FA 2FSWA 4HDUA 4A3CJ 4KIGA 2PG4A 2NVXJ 1S5LC 5KCMA 3BZCA 4F55A 3EUHA 1PYVA 3SYTA 1U8RA 1A6IA 1TWHJ 1WPKA 1X58A 1VQPI 1Z3YA 2G9WA 3MZ8A 4L5EA 4BQNA 3K70D 2KT0A 3DBRB 2F5VA 1TW2A 4QSHA 2DLLA 4GDFA 2Q2EA 1P7IA 4PJMA 1LDJA 3K4MA 1XMAA 2B0LA 3TP3A 1VQ7I 3KP6A 3UR3C 4EVIA 3HRMA 3BJ6A 2BVMA 4L0YB 3T0YA 3JRCA 1ETYA 1K83J 2M87A 4BE0A 1LNWA 3D5RC 1W5CC 3FBIB 4KFCA 5E3LA 4YIRX 5L3EA 2GM4A 2LBFA 1XMXA 1HDPA 2L9RA 1X2MA 2DMNA 1J0RA 2DFIA 1ZKGA 3M7GA 1BI0A 3JTGA 4LMYA 2CW0F 2JUGA 3HUGA 4KYWA 3H9JA 1R7JA 1XDUA 3ZGKA 4NBQA 2O8XA 3EUHC 3WGHA 3L2CA 3CCMI 1JHHA 5E1ZB 2BW3B 2JPCA 2P8TA 5DCFA 3BLYA 3X2QH 4IL6C 1LDDA 1WFXA 1H88C 4A6DA 2KDZA 2RQPA 1YX3A 4PUSA 3GBGA 4Z2YA 3IWFA 4HX7A 3O8HA 2WAQN 2LMDA 3GO5A 1Z7UA 3L2QA 1O3QA 2ZC2A 4II2A 2ISYA 4QPOA 1YTYA 4OU0A 1FWZA 1DU0A 1YOVB 1QGPA 1RI7A 3OV8A 1FOYA 1S8NA 1MGTA 3WTVC 2HQ5A 3MKWB 5IOZA 1WWXA 2E35A 1YS7A 2KP6A 3OYDA 1DPRA 3CESA 1F5TA 2LRDA 3CCRI 3QPTA 1H0MA 2DDBA 4LJZF 2XAHA 4XQFA 2A3SA 4J19A 1SVOA 4Z6YA 3LSRA 1HCRA 1XC5A 2EV5A 1FOWA 4DNCA 1N75A 2DXIA 3E5UA 4IJAA 3TOAA 2A6EF 2WADA 2IBDA 5K1YA 4BNCA 3JSPA 4PSWA 3V7CA 3DEEA 2QCOA 2K9QA 3OYMA 1OYYA 2HYFA 1Z1DA 3L7WA 2PN6A 1MMAA 4YFNF 4UUSA 4P55A 4I76A 5DS9A 2DYRH 3HOVJ 1UAAA 3L2WA 3T1BA 1LB2A 2EQRA 2IA2A 3KETA 4B48A 4TV7A 4BH9A 3I56I 5F6FA 4XK4A 4AIHA 3MWMA 2RREA 1R5ID 4W1UA 4UV9A 1WCMJ 3LAPA 3WE3A 4MQ9F 2O0YA 1B72A 1GV2A 2ZMEA 2M5WA 1R9TJ 1IN7A 2L54A 4A3GJ 2WAFA 5EJCA 3LQRA 3LOCA 3WE2A 2E2JJ 4JQFA 3CC4I 2KJBA 5HLGA 1CF7B 2K9MA 2IGMA 3KYDB 3ZR8X 4ENJA 3ABLH 3CJRB 3ABUA 3BROA 3OMYA 5CQGA 1ETXA 1HW1A 1Z7LA 2KMUA 5K5OA 2ZJRF 2C6YA 3BP8A 3LSIA 4AU7A 2FQ4A 2OZUA 3N05A 4EMSA 2UZKA 2M4KA 4MLOA 2JTVA 2DMQA 3K2AA 5TRDA 3B73A 3DKWA 3HZJA 1RPWA 3QWLA 4PDKA 4YFKF 3WTXC 2IA1A 1H8AC 3HM5A 2VL8A 3G1LA 1FEXA 2Y31A 1JE8A 1USTA 3K4LA 4GO1A 2FF4A 1BC7C 2JMWA 1A35A 4B47A 1I1SA 2WAQA 1VQ4I 2H6CA 1FYMA 1NTCA
chains in the Genus database with same CATH topology
1G6NA 2YR2A 3GX4X 3GEZA 3D0SA 4ZH4F 3EYIA 4IRIA 4LLLA 1MKMA 5LEJA 2HGCA 3K1NA 3H3ZA 1QZZA 3ML6A 4UVAA 3TGNA 2STWA 3BDDA 3RI4A 2VODA 2GA1A 2F5DA 1KU7A 3KP5A 4L0ZB 1XGSA 5E1XA 1G3SA 4UHTA 1T39A 5FB2A 3BPVA 4L18B 4L9VA 5BQTA 2RC4A 5J8FA 4CICA 2D45A 1CGPA 1PUEE 1E17A 2ZJ2A 4G9YA 1Q1HA 4CHUA 2DBBA 3F23A 3ERED 1FP2A 2A5YB 4HBLA 2ETHA 1WQ2A 2XASA 1K7AA 1HW5A 2EJRA 2P5LC 2TDXA 4CXFA 3V8KA 3JSOA 4H0EA 1QBJA 2P5KA 2Z3YA 4IHSA 4CYDA 4L5JA 3WTUC 2M45A 5CVUA 4R8HA 1STZA 4ZYHA 4Y17A 3GYHX 5CLSA 1J59A 2QUFA 2XHKA 2Z99A 1YLFA 4A5MA 2OD5A 4WWCA 2QENA 5LGNA 1R22A 5AIPA 4ENKA 3GFLA 5LHGA 2OBPA 3CDHA 2ACJA 2CFXA 2L3DA 3L09A 3PQKA 2Y48A 2OQRA 1TBXA 3ECHA 4UXNA 2XAFA 2ZKZA 3ZQ7A 2FBIA 5J6XA 3M8FA 3T5XA 4ESBA 1R58A 4GGGA 4HV6A 3ECOA 5BPIA 4EM2A 2L4AA 1IZ1A 1KA8A 5DD4A 5L3DA 3FXRA 1KU9A 5L3GA 4G94A 4EJTA 3RIRA 3GZ5A 5CVRA 4ZYDA 3W6JB 1U5TB 1FBUA 1R1VA 1HXDA 3CTAA 4FHTA 1USSA 3MEXA 3FWEA 3LA7A 2GXGA 4OIQF 2F5CA 4KMUX 4I0BA 1JXSA 1ON2A 2FU4A 1KGSA 2GQQA 1W7PB 3RTRA 2V1DA 1IW7F 2YX4A 2W84A 2PBIA 1HKTA 2H09A 3CLOA 2DAOA 4XSZF 3GFIA 1D3YA 2XAQA 2HQNA 1R1TA 3P7NA 2D2WA 4L5IA 2VE8A 1QQIA 3E6BA 3KEQA 1O3SA 4JK1X 3IWZA 3K69A 4AVPA 1XSVA 2P6TA 5D5UB 2GIVA 2RKHA 2DPDA 4RGRA 3J81K 1WI9A 2COMA 3BWGA 4HW0A 3SZPA 3HRTA 4P96A 1SFUA 3RKYA 4YG2F 2RNJA 2OAZA 5DEQA 3C18A 1CF7A 3R60A 2HTJA 1S7OA 2XRNA 3TO7A 1GXPA 1P4XA 2CSOA 4IVNA 3FM3A 1IF1A 3ELKA 1TNTA 2AS5F 3WTZA 3JW4A 1KU2A 1HKQA 1I27A 3U2RA 4MTEA 1XCBA 1YW7A 2X0LA 2ZBKA 4U0VA 4HYEA 2IT0A 1R23A 3HOSA 3JAMK 3QP5A 2H6BA 3CUQB 2VN2A 5F64A 5JHUA 2JZYA 2O6GE 1GHCA 4WCGA 4ESJA 3VOEA 5FGMA 5BPDA 4ASNA 5L3BA 3R4KA 2EV6A 4OIOF 2DK5A 2GAUA 1FT9A 1RIOH 1ZGJA 2W57A 1HQCA 1T6SA 4M71A 2YPRA 4XLNF 1FBQA 1UHWA 1JGSA 2DQLA 4GYGA 1ZRCA 3VB2A 2DQRA 1IRFA 5H6QA 1K79A 4ZYGA 4DQ2A 1EH8A 1S7AA 5F1RA 4N9HA 2JT1A 1OYWA 2HOEA 4EM1A 2R7FA 1FZPB 4IRGA 3WU0A 3F72A 4L9JA 4I2OA 1LDKB 1YO5C 1K6OA 2VT2A 1DDNA 4NHJA 1SMTA 2VBXA 2Y75A 4LK0F 3K9TA 3SFZA 1IUYA 4PGGA 2ESHA 1LQ1A 4I09A 5ERIA 4KMFA 3HTUA 3MZHA 3R61A 4UV8A 2VE9A 1DPUA 4P5OA 3RKWA 3KE2A 2QQAA 4S04A 3GFJA 2QLZA 3QOPA 3TKYA 5TJJA 1O7LA 2KIUA 4CO8A 4R79A 3V8LA 5D8LB 2FOKA 4E70A 3BJOA 5H6RA 3R6SA 2ZNYA 1ON1A 1U5TA 3IRRA 2Q0OA 1R00A 3TO9A 3VFZA 1BN5A 2CO5A 3E5QA 1S6LA 3IC7A 2FEZA 1C0WA 3Q9SA 4P9UA 2HFHA 5D4SA 1ULYA 3SXYA 1W7PA 2EWNA 3PFIA 3QRFF 3QU6A 4M9SA 1SFEA 2KIMA 1RUNA 4FX0A 3RDIA 1U5TC 5E17F 2FXAA 4PGHA 3DFGA 3VEPA 2VOOA 2K27A 4EJWA 1ZRFA 1HSTA 2F2EA 5HS8A 3F8BA 2ISZA 1GVJA 3FX3A 2KIFA 3QP6A 2QQBA 4WXHA 3N97A 4IPAA 5K5QA 3WTSC 4MTDA 4ZZLA 2E1CA 1ZN2A 3GF2A 1KQ8A 2VC0A 1P6RA 1F4KA 4ENMA 4Q4ZF 1G4DA 3DXJF 4F7ZA 3FMSA 2A69F 1J7KA 5KVRA 5HS7A 4G7ZF 1GXQA 1XMKA 2P6SA 1U6GA 3SZTA 2EA4A 1TW3A 1I1GA 4G7HF 2VOPA 2PMUA 2PI0A 1XSDA 1KU3A 2E7XA 3DF8A 4HF0A 2FMYA 4BHPA 3TDUC 4HOBA 3U9GA 5HDGA 3G73A 1HSJA 5FLXZ 5HDKA 2A6HF 3CUQA 3R0JA 3TO6A 4K2EA 2XV4S 4EQQA 2OU2A 1UCRA 3RYRA 4BQAA 1RNLA 2BE5F 2P7VB 1IXRC 1L0OC 3GLXA 1HBXG 3I71A 3T8RA 4OMYA 2GXBA 4HF2A 3J81Z 2EFQA 3I54A 4UUVA 3I4PA 3HTSB 1ZG1A 1LVAA 4R1HA 3CUQC 1OMIA 4KUMA 4EV0A 5D5WB 1XSXA 1YIOA 3IHUA 4EM0B 1XD7A 3ISPA 2ZNZA 2UXXA 3E6MA 1FSEA 1ZHFA 1XDSA 4RAZA 3FHZA 1S29A 2XAGA 3V8JA 1K78A 4O5VA 5AONA 3WTTC 2GZWA 1IN5A 3BY6A 4M9ZA 1AOYA 1T2KA 4I01A 3RKXA 4AIJA 1V3FA 3EYYA 1MD0A 1Z6TA 1OKRA 3HOTA 1IN4A 1NHAA 3HSRA 4HLXA 3I5UA 2HS5A 2D1VA 2XUBA 2A61A 3JAMZ 4GXOA 5DUKA 3F8FA 3GZ6A 4CZZA 3AAFA 3FM5A 3WTYC 1B6AA 3M9AA 2EV0A 1LEAA 1MZBA 2JSCA 1YW8A 2DW4A 4XSXF 4M74A 1PP7U 5FO5A 5KK1A 1BI2A 1PDNC 1V4RA 3GFMA 3F8CA 1DUXC 2W25A 2MD5A 1QPMA 1UFMA 2MH2A 5HLIA 4HA8A 1KQ0A 4WF2A 3IRQA 1SMYF 2M1BA 2JPBA 4Y15A 2LKPA 1FP1D 1S3JA 5DCMB 5CJ9A 1LJ9A 2FRHA 1FOKA 4KN7X 2WWYA 4OIPF 3MZYA 4GYIA 2PFBA 3ZMTA 4BYYA 1TQPA 4AWXB 3N4MA 2NRAC 4M72A 3TOBA 4QLCU 4RB3C 2IVMA 1KYWA 4EJOA 2FMLA 3F8NA 3NEUA 1QZYA 2F5FA 1U3EM 1ZLJA 3M1EA 2RV8A 5D5XB 2FBHA 1ZH5A 5FLXK 1FC3A 2ZO4A 5DV5A 2OA4A 3L9FA 4LK1F 4EGZA 3HIFA 2P4WA 1TLHB 3GXOA 3HSFA 3DEUA 1SD4A 4WXCA 2EFNA 2J5OA 2WV0A 3IKVA 4UVCA 3ZMDA 4HZFA 5ILVA 5FD6A 3DP7A 5A2QZ 4ZYEA 1E2XA 4LLNA 3DPTA 2AXLA 2UXNA 1T0FA 3HRSA 5LRSA 2PQ8A 2QQ9A 2BV6A 2IA0A 1I5ZA 5E8IA 1B9NA 3NRVA 3V7RA 4PZJA 1ZARA 5LRRA 4B09A 4YIFA 2YU3A 1J75A 1D8JA 3NQOA 3FMRA 4G8XA 3LAJA 1SD6A 3MQ0A 4UNOA 5D6FA 5LBQA 3KEOA 1IAWA 4WK8F 2HKOA 4G6DA 1YS6A 1P2FA 3U1DA 2BYVE 3FXQA 4RAYA 1Z9CA 3M8EA 4HQEA 5ED4A 2VT3A 1B59A 4XBFA 2A07F 1XB4A 3WTWC 5D4RA 2DU9A 4M73A 1X3UA 2NS0A 1YFHA 1Y0UA 5LLQA 2FA5A 1MJAA 2O03A 4MGRA 4A2UA 2EB7A 3DQVC 3KZYA 2QWWA 5LGTA 4Q47A 2Z33A 1FPQA 4LB6B 2KRFA 2LF7A 4BXUA 2CQKA 3PQJA 4G7OF 3G3ZA 1LEBA 2DO7A 2MBFA 4HX8A 5JVTA 2R7DA 4ON0A 2EK5A 4I7HA 2Z9OA 3GUDA 5ILUA 1D5VA 2DI3A 5CYVA 4LG0B 3BOQA 3ROUA 2CG4A 2HQRA 3LFKA 5JI6A 5BOXA 2BGCA 4RB0A 4U7DA 4BHCA 5ILSA 1R36A 3KP2A 1IN6A 3MAJA 1MDMB 1TNSA 1BC8C 1BOAA 1IXCA 2RN7A 1K78B 1ONVA 2VBYA 4BAYA 2X4HA 3K2ZA 4WX9A 4JBAA 5BS6A 1ZRDA 3HRUA 4NQWA 4KDPA 1U2WA 3ULQB 3ZPLA 2D1HA 2VXZA 5CVIA 2YX7A 4IRHA 3HYIA 2H27A 4HQMA 3WU1B 1ODDA 1BJAA 2EA2A 5L3CA 4U0YA 2RDPA 2P5VA 2KKOA 1BBYA 4HF1A 3ZMZA 2HYGD 2MC3A 5A2QK 1F9NA 3WGGA 1ZG5A 1P4AA 4HV5A 4O6JA 2K7LA 4KT5C 5DD8A 3QAHA 2M8EA 4KN4X 1TQMA 3C7JA 1SD5A 1BIBA 5IT9K 1EH6A 5D5VB 3KFWX 1BI3A 1REPC 1XCVA 5CVVA 3BJAA 1FYKA 3LWFA 3F6VA 3J80Z 3KP4A 4MQVA 1BI1A 4RGUA 5D6EA 5DCMA 2XVCA 2XKOA 4MNUA 2ELHA 4U0WA 5DDGA 2W85A 1G3WA 2XKPA 4M6YA 1BIAA 2OZ6A 2PEXA 2HZTA 1G3TA 1R5GA 2DTRA 3TDZC 4OOIA 3I53A 4AIKA 1WSUA 2V79A 3CO6C 4IHTA 1T38A 3RPQA 2CYYA 3K1PA 2GA2A 1L3LA 1HW2A 3GW2A 3GVAA 4XLPF 2FQ3A 1XGOA 1FLIA 5FD5A 5LHHA 3R0AA 2LF8A 3GWZA 2Y0MA 2QYOA 1W5TA 1W5SA 3LA3A 4LFUA 3MFKA 1KYZA 1PP8F 1Z91A 3C1DA 2MLKA 3Q5FA 1O7FA 4ENNA 3F6OA 4LD5A 2WC2A 4RB1A 2M30A 2QBYB 3OOPA 2QM3A 4B8XA 2L4MA 5HOOA 4RGXA 4FT8A 5E8GA 3WODF 5FFZA 3P9IA 4I02A 3J7AO 1WRJA 1KQ9A 2ZXJA 1IRGA 3B02A 4NB5A 2LDUA 2NAZA 4P9FA 3RPUA 1R1UA 1RZ4A 3P9CA 5HVQC 2ZFWA 3E5XA 3CUOA 3F8MA 3ZN0A 3EETA 3MCZA 5JR3A 2FBKA 4YIIA 4OIRF 4CDGA 1AWCA 1YQAA 1RUOA 2Z5UA 1OYIA 4KICA 3T8TA 2V1UA 3E3VA 5K5RA 1OR7A 4ESFA 4MHGA 1FSHA 1HKSA 3COAC 3VODA 1ZYRF 2L01A 3LQQA 3H92A 5ICEA 2VBWA 1J5YA 4ETSA 1FBSA 4G6QA 4D0PA 5FFXA 2K4BA 1I6XA 3CO7C 4OINF 3DV8A 2UWMA 4A5NA 1O3RA 2XAJA 2DT5A 4L9NA 3J80K 1QO0D 3KP7A 4LB5A 5D8KB 1W7PD 1TTYA 4YFXF 4LG0A 3F21A 1BM9A 3IKTA 1IXSB 1FY7A 2PMHA 1MDMA 5HDNA 2RVCA 3V7SA 4M9XA 1XGNA 1Z05A 2STTA 3TQNA 3F22A 3FF5A 5HLHA 1QNTA 2OQGA 2A68F 2ESNA 4KA4A 4A0XA 4Q5SF 2NNNA 4HDVA 2NYXA 4N0BA 4AD9A 3CJNA 2LNBA 4O3MA 1H9GA 4I0AA 1TQIA 1OPCA 1WKMA 3I59A 3O6BB 2BBYA 4IF4A 2K86A 2KJCA 3LSTA 4Q48A 2Q8KA 1SD7A 4RGSA 4WXDA 3S2WA 4HAMA 3ZMSA 2FE3A 2V6CA 2DK8A 3FMQA 3HSEA 2L02A 3KCCA 2IRFG 1O57A 2ADUA 2RGVA 3SQNA 2VONA 5EEHA 3C3WA 5LHIA 1J9IA 1JHFA 1UHMA 2XROA 4GCVA 1F1ZA 2MA3A 5LGUA 2HKXA 3ZMVA 5HS9A 1A04A 3ZP5A 1EV7A 2FNAA 3KP3A 3I0TA 1Z6RA 4N9IA 2IPQX 4EJVA 2BEOA 4UVBA 4HLYA 5E1WA 4RB2C 2R3SA 2QVOA 3D5LA 2EFOA 3IL2A 1G3YA 4HX4A 2PLYA 4A12A 1IN8A 3I58A 5CVJA 1YG2A 3W6KB 3EDPA 5H20A 3KZZA 3SHFA 1SAXA 4EJUA 1MJBA 4U88A 1B9MA 4U7BA 1U78A 5E18F 1FYLA 3P9KA 6PAXA 2P7CB 2ZCWA 3Q9VA 2QZ8A 1EH7A 4BHBA 2MH9A 5AIQA 4M6XA 5EEGA 5J8CA 4IXAA 2HDCA 5BMZA 4FX4A 5ICCA 1MJ9A 3RJPA 4OMZA 2NNYA 4CGZA 4MEXF 5IT9Z 3WGIA 1B4AA 2IW5A 1H9TA 3E97A 2QBYA 3FZVA 3DPLC 4I98B 1O3TA 2ZMEB 3JTHA 4L9TA 1ZREA 4QWQA 3WG9A 5DUIA 3HHHA 3BPXA 1DP7P 2DPUA 3I64A 2E7WA 2GWRA 4ZZDA 5IT3A 2LSOA 4KNYA 2F5EA 2O61A 1XN7A 2PJPA 2JRTA 2HWVA 2K4JA 1SFXA 5JFRA 3E6CC 4XRFA 5DYMA 3KLNA 4PCQA 4EGYA 2MLGA 5E20A 2W24A 3QU3A 1YYVA 3ZMUA 1FX7A 4RS8A 2H94A 1FNNA 2CWEA 4LGWA 3O3KA 1YW9A 1ZAOA 5ICGA 1UB9A 2HR3A 2FNPA 3ZN1A 2IP2A 4A0YA 1W4MA 4LLGF 1B1BA 5LEKA 2G7HA 1P4WA 2V1XA 1T98A 2YSRA 1ZGAA 3E6DA 3ABTA 3REOA 2K02A 3K0LA 4A0ZA 5ICFA 2EFWA 1J2XA 1XGMA 2J5PA 3F3XA 3H3UA 3EQLF 2VBZA 3L00A 1ZG3A 4A6EA 3BZ6A 2G7UA 2EFPA 2XIGA 3QPHA 3RYPA 3V4GA 1P92A 4KIFA 2HEOA 2WTEA 2IJLA 1VTNC 2VC1A 1ZLKA 3I59B 2V9VA 3O2PE 2XGXA 1D8KA 2CGPA 2E1NA 3K1MA 4KIBA 1R5HA 3KLOA 4S05A 2HTSA 4Y13A 3FXUA 3HHGA 3LA2A 4MEYF 5L3FA 2O3FA 2FSWA 4HDUA 4KIGA 2PG4A 3EUHA 1U8RA 2G9WA 1TW2A 2DLLA 2Q2EA 1LDJA 1XMAA 2B0LA 3KP6A 4EVIA 3HRMA 3BJ6A 4L0YB 3T0YA 2M87A 1LNWA 4KFCA 5L3EA 1J0RA 2DFIA 3M7GA 1BI0A 3JTGA 4LMYA 2CW0F 4KYWA 3HUGA 1R7JA 1XDUA 2O8XA 3WGHA 3L2CA 1JHHA 5E1ZB 2JPCA 2P8TA 5DCFA 1LDDA 4A6DA 2RQPA 4Z2YA 3IWFA 4HX7A 3GO5A 1Z7UA 1O3QA 2ISYA 1YTYA 4OU0A 1FWZA 1QGPA 1RI7A 3OV8A 1S8NA 1MGTA 3WTVC 1WWXA 1YS7A 1DPRA 1F5TA 3QPTA 1H0MA 4LJZF 2XAHA 2A3SA 2EV5A 4DNCA 3E5UA 4IJAA 3TOAA 2A6EF 5K1YA 4BNCA 3JSPA 3V7CA 1OYYA 2HYFA 1Z1DA 4YFNF 2PN6A 3L7WA 4P55A 3T1BA 1LB2A 2IA2A 3KETA 4BH9A 4TV7A 5F6FA 4AIHA 3MWMA 4UV9A 3LAPA 3WE3A 4MQ9F 2O0YA 2ZMEA 2M5WA 1IN7A 2L54A 3LQRA 3WE2A 4JQFA 2KJBA 5HLGA 1CF7B 4ENJA 3ABUA 3BROA 1HW1A 5K5OA 2C6YA 3BP8A 2OZUA 4EMSA 2UZKA 2JTVA 5TRDA 3B73A 3DKWA 3WTXC 4PDKA 4YFKF 2IA1A 1JE8A 1USTA 4GO1A 2FF4A 1BC7C 1I1SA 2H6CA 1FYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G6N A;  2YR2 A;  3GX4 X;  3GEZ A;  3D0S A;  4ZH4 F;  3EYI A;  4IRI A;  4LLL A;  1MKM A;  5LEJ A;  2HGC A;  3K1N A;  3H3Z A;  1QZZ A;  3ML6 A;  4UVA A;  3TGN A;  2STW A;  3BDD A;  3RI4 A;  2VOD A;  2GA1 A;  2F5D A;  1KU7 A;  3KP5 A;  4L0Z B;  1XGS A;  5E1X A;  1G3S A;  4UHT A;  1T39 A;  5FB2 A;  3BPV A;  4L18 B;  4L9V A;  5BQT A;  2RC4 A;  5J8F A;  4CIC A;  2D45 A;  1CGP A;  1PUE E;  1E17 A;  2ZJ2 A;  4G9Y A;  1Q1H A;  4CHU A;  2DBB A;  3F23 A;  3ERE D;  1FP2 A;  2A5Y B;  4HBL A;  2ETH A;  1WQ2 A;  2XAS A;  1K7A A;  1HW5 A;  2EJR A;  2P5L C;  2TDX A;  4CXF A;  3V8K A;  3JSO A;  4H0E A;  1QBJ A;  2P5K A;  2Z3Y A;  4IHS A;  4CYD A;  4L5J A;  3WTU C;  2M45 A;  5CVU A;  4R8H A;  1STZ A;  4ZYH A;  4Y17 A;  3GYH X;  5CLS A;  1J59 A;  2QUF A;  2XHK A;  2Z99 A;  1YLF A;  4A5M A;  2OD5 A;  4WWC A;  2QEN A;  5LGN A;  1R22 A;  5AIP A;  4ENK A;  3GFL A;  5LHG A;  2OBP A;  3CDH A;  2ACJ A;  2CFX A;  2L3D A;  3L09 A;  3PQK A;  2Y48 A;  2OQR A;  1TBX A;  3ECH A;  4UXN A;  2XAF A;  2ZKZ A;  3ZQ7 A;  2FBI A;  5J6X A;  3M8F A;  3T5X A;  4ESB A;  1R58 A;  4GGG A;  4HV6 A;  3ECO A;  5BPI A;  4EM2 A;  2L4A A;  1IZ1 A;  1KA8 A;  5DD4 A;  5L3D A;  3FXR A;  1KU9 A;  5L3G A;  4G94 A;  4EJT A;  3RIR A;  3GZ5 A;  5CVR A;  4ZYD A;  3W6J B;  1U5T B;  1FBU A;  1R1V A;  1HXD A;  3CTA A;  4FHT A;  1USS A;  3MEX A;  3FWE A;  3LA7 A;  2GXG A;  4OIQ F;  2F5C A;  4KMU X;  4I0B A;  1JXS A;  1ON2 A;  2FU4 A;  1KGS A;  2GQQ A;  1W7P B;  3RTR A;  2V1D A;  1IW7 F;  2YX4 A;  2W84 A;  2PBI A;  1HKT A;  2H09 A;  3CLO A;  2DAO A;  4XSZ F;  3GFI A;  1D3Y A;  2XAQ A;  2HQN A;  1R1T A;  3P7N A;  2D2W A;  4L5I A;  2VE8 A;  1QQI A;  3E6B A;  3KEQ A;  1O3S A;  4JK1 X;  3IWZ A;  3K69 A;  4AVP A;  1XSV A;  2P6T A;  5D5U B;  2GIV A;  2RKH A;  2DPD A;  4RGR A;  3J81 K;  1WI9 A;  2COM A;  3BWG A;  4HW0 A;  3SZP A;  3HRT A;  4P96 A;  1SFU A;  3RKY A;  4YG2 F;  2RNJ A;  2OAZ A;  5DEQ A;  3C18 A;  1CF7 A;  3R60 A;  2HTJ A;  1S7O A;  2XRN A;  3TO7 A;  1GXP A;  1P4X A;  2CSO A;  4IVN A;  3FM3 A;  1IF1 A;  3ELK A;  1TNT A;  2AS5 F;  3WTZ A;  3JW4 A;  1KU2 A;  1HKQ A;  1I27 A;  3U2R A;  4MTE A;  1XCB A;  1YW7 A;  2X0L A;  2ZBK A;  4U0V A;  4HYE A;  2IT0 A;  1R23 A;  3HOS A;  3JAM K;  3QP5 A;  2H6B A;  3CUQ B;  2VN2 A;  5F64 A;  5JHU A;  2JZY A;  2O6G E;  1GHC A;  4WCG A;  4ESJ A;  3VOE A;  5FGM A;  5BPD A;  4ASN A;  5L3B A;  3R4K A;  2EV6 A;  4OIO F;  2DK5 A;  2GAU A;  1FT9 A;  1RIO H;  1ZGJ A;  2W57 A;  1HQC A;  1T6S A;  4M71 A;  2YPR A;  4XLN F;  1FBQ A;  1UHW A;  1JGS A;  2DQL A;  4GYG A;  1ZRC A;  3VB2 A;  2DQR A;  1IRF A;  5H6Q A;  1K79 A;  4ZYG A;  4DQ2 A;  1EH8 A;  1S7A A;  5F1R A;  4N9H A;  2JT1 A;  1OYW A;  2HOE A;  4EM1 A;  2R7F A;  1FZP B;  4IRG A;  3WU0 A;  3F72 A;  4L9J A;  4I2O A;  1LDK B;  1YO5 C;  1K6O A;  2VT2 A;  1DDN A;  4NHJ A;  1SMT A;  2VBX A;  2Y75 A;  4LK0 F;  3K9T A;  3SFZ A;  1IUY A;  4PGG A;  2ESH A;  1LQ1 A;  4I09 A;  5ERI A;  4KMF A;  3HTU A;  3MZH A;  3R61 A;  4UV8 A;  2VE9 A;  1DPU A;  4P5O A;  3RKW A;  3KE2 A;  2QQA A;  4S04 A;  3GFJ A;  2QLZ A;  3QOP A;  3TKY A;  5TJJ A;  1O7L A;  2KIU A;  4CO8 A;  4R79 A;  3V8L A;  5D8L B;  2FOK A;  4E70 A;  3BJO A;  5H6R A;  3R6S A;  2ZNY A;  1ON1 A;  1U5T A;  3IRR A;  2Q0O A;  1R00 A;  3TO9 A;  3VFZ A;  1BN5 A;  2CO5 A;  3E5Q A;  1S6L A;  3IC7 A;  2FEZ A;  1C0W A;  3Q9S A;  4P9U A;  2HFH A;  5D4S A;  1ULY A;  3SXY A;  1W7P A;  2EWN A;  3PFI A;  3QRF F;  3QU6 A;  4M9S A;  1SFE A;  2KIM A;  1RUN A;  4FX0 A;  3RDI A;  1U5T C;  5E17 F;  2FXA A;  4PGH A;  3DFG A;  3VEP A;  2VOO A;  2K27 A;  4EJW A;  1ZRF A;  1HST A;  2F2E A;  5HS8 A;  3F8B A;  2ISZ A;  1GVJ A;  3FX3 A;  2KIF A;  3QP6 A;  2QQB A;  4WXH A;  3N97 A;  4IPA A;  5K5Q A;  3WTS C;  4MTD A;  4ZZL A;  2E1C A;  1ZN2 A;  3GF2 A;  1KQ8 A;  2VC0 A;  1P6R A;  1F4K A;  4ENM A;  4Q4Z F;  1G4D A;  3DXJ F;  4F7Z A;  3FMS A;  2A69 F;  1J7K A;  5KVR A;  5HS7 A;  4G7Z F;  1GXQ A;  1XMK A;  2P6S A;  1U6G A;  3SZT A;  2EA4 A;  1TW3 A;  1I1G A;  4G7H F;  2VOP A;  2PMU A;  2PI0 A;  1XSD A;  1KU3 A;  2E7X A;  3DF8 A;  4HF0 A;  2FMY A;  4BHP A;  3TDU C;  4HOB A;  3U9G A;  5HDG A;  3G73 A;  1HSJ A;  5FLX Z;  5HDK A;  2A6H F;  3CUQ A;  3R0J A;  3TO6 A;  4K2E A;  2XV4 S;  4EQQ A;  2OU2 A;  1UCR A;  3RYR A;  4BQA A;  1RNL A;  2BE5 F;  2P7V B;  1IXR C;  1L0O C;  3GLX A;  1HBX G;  3I71 A;  3T8R A;  4OMY A;  2GXB A;  4HF2 A;  3J81 Z;  2EFQ A;  3I54 A;  4UUV A;  3I4P A;  3HTS B;  1ZG1 A;  1LVA A;  4R1H A;  3CUQ C;  1OMI A;  4KUM A;  4EV0 A;  5D5W B;  1XSX A;  1YIO A;  3IHU A;  4EM0 B;  1XD7 A;  3ISP A;  2ZNZ A;  2UXX A;  3E6M A;  1FSE A;  1ZHF A;  1XDS A;  4RAZ A;  3FHZ A;  1S29 A;  2XAG A;  3V8J A;  1K78 A;  4O5V A;  5AON A;  3WTT C;  2GZW A;  1IN5 A;  3BY6 A;  4M9Z A;  1AOY A;  1T2K A;  4I01 A;  3RKX A;  4AIJ A;  1V3F A;  3EYY A;  1MD0 A;  1Z6T A;  1OKR A;  3HOT A;  1IN4 A;  1NHA A;  3HSR A;  4HLX A;  3I5U A;  2HS5 A;  2D1V A;  2XUB A;  2A61 A;  3JAM Z;  4GXO A;  5DUK A;  3F8F A;  3GZ6 A;  4CZZ A;  3AAF A;  3FM5 A;  3WTY C;  1B6A A;  3M9A A;  2EV0 A;  1LEA A;  1MZB A;  2JSC A;  1YW8 A;  2DW4 A;  4XSX F;  4M74 A;  1PP7 U;  5FO5 A;  5KK1 A;  1BI2 A;  1PDN C;  1V4R A;  3GFM A;  3F8C A;  1DUX C;  2W25 A;  2MD5 A;  1QPM A;  1UFM A;  2MH2 A;  5HLI A;  4HA8 A;  1KQ0 A;  4WF2 A;  3IRQ A;  1SMY F;  2M1B A;  2JPB A;  4Y15 A;  2LKP A;  1FP1 D;  1S3J A;  5DCM B;  5CJ9 A;  1LJ9 A;  2FRH A;  1FOK A;  4KN7 X;  2WWY A;  4OIP F;  3MZY A;  4GYI A;  2PFB A;  3ZMT A;  4BYY A;  1TQP A;  4AWX B;  3N4M A;  2NRA C;  4M72 A;  3TOB A;  4QLC U;  4RB3 C;  2IVM A;  1KYW A;  4EJO A;  2FML A;  3F8N A;  3NEU A;  1QZY A;  2F5F A;  1U3E M;  1ZLJ A;  3M1E A;  2RV8 A;  5D5X B;  2FBH A;  1ZH5 A;  5FLX K;  1FC3 A;  2ZO4 A;  5DV5 A;  2OA4 A;  3L9F A;  4LK1 F;  4EGZ A;  3HIF A;  2P4W A;  1TLH B;  3GXO A;  3HSF A;  3DEU A;  1SD4 A;  4WXC A;  2EFN A;  2J5O A;  2WV0 A;  3IKV A;  4UVC A;  3ZMD A;  4HZF A;  5ILV A;  5FD6 A;  3DP7 A;  5A2Q Z;  4ZYE A;  1E2X A;  4LLN A;  3DPT A;  2AXL A;  2UXN A;  1T0F A;  3HRS A;  5LRS A;  2PQ8 A;  2QQ9 A;  2BV6 A;  2IA0 A;  1I5Z A;  5E8I A;  1B9N A;  3NRV A;  3V7R A;  4PZJ A;  1ZAR A;  5LRR A;  4B09 A;  4YIF A;  2YU3 A;  1J75 A;  1D8J A;  3NQO A;  3FMR A;  4G8X A;  3LAJ A;  1SD6 A;  3MQ0 A;  4UNO A;  5D6F A;  5LBQ A;  3KEO A;  1IAW A;  4WK8 F;  2HKO A;  4G6D A;  1YS6 A;  1P2F A;  3U1D A;  2BYV E;  3FXQ A;  4RAY A;  1Z9C A;  3M8E A;  4HQE A;  5ED4 A;  2VT3 A;  1B59 A;  4XBF A;  2A07 F;  1XB4 A;  3WTW C;  5D4R A;  2DU9 A;  4M73 A;  1X3U A;  2NS0 A;  1YFH A;  1Y0U A;  5LLQ A;  2FA5 A;  1MJA A;  2O03 A;  4MGR A;  4A2U A;  2EB7 A;  3DQV C;  3KZY A;  2QWW A;  5LGT A;  4Q47 A;  2Z33 A;  1FPQ A;  4LB6 B;  2KRF A;  2LF7 A;  4BXU A;  2CQK A;  3PQJ A;  4G7O F;  3G3Z A;  1LEB A;  2DO7 A;  2MBF A;  4HX8 A;  5JVT A;  2R7D A;  4ON0 A;  2EK5 A;  4I7H A;  2Z9O A;  3GUD A;  5ILU A;  1D5V A;  2DI3 A;  5CYV A;  4LG0 B;  3BOQ A;  3ROU A;  2CG4 A;  2HQR A;  3LFK A;  5JI6 A;  5BOX A;  2BGC A;  4RB0 A;  4U7D A;  4BHC A;  5ILS A;  1R36 A;  3KP2 A;  1IN6 A;  3MAJ A;  1MDM B;  1TNS A;  1BC8 C;  1BOA A;  1IXC A;  2RN7 A;  1K78 B;  1ONV A;  2VBY A;  4BAY A;  2X4H A;  3K2Z A;  4WX9 A;  4JBA A;  5BS6 A;  1ZRD A;  3HRU A;  4NQW A;  4KDP A;  1U2W A;  3ULQ B;  3ZPL A;  2D1H A;  2VXZ A;  5CVI A;  2YX7 A;  4IRH A;  3HYI A;  2H27 A;  4HQM A;  3WU1 B;  1ODD A;  1BJA A;  2EA2 A;  5L3C A;  4U0Y A;  2RDP A;  2P5V A;  2KKO A;  1BBY A;  4HF1 A;  3ZMZ A;  2HYG D;  2MC3 A;  5A2Q K;  1F9N A;  3WGG A;  1ZG5 A;  1P4A A;  4HV5 A;  4O6J A;  2K7L A;  4KT5 C;  5DD8 A;  3QAH A;  2M8E A;  4KN4 X;  1TQM A;  3C7J A;  1SD5 A;  1BIB A;  5IT9 K;  1EH6 A;  5D5V B;  3KFW X;  1BI3 A;  1REP C;  1XCV A;  5CVV A;  3BJA A;  1FYK A;  3LWF A;  3F6V A;  3J80 Z;  3KP4 A;  4MQV A;  1BI1 A;  4RGU A;  5D6E A;  5DCM A;  2XVC A;  2XKO A;  4MNU A;  2ELH A;  4U0W A;  5DDG A;  2W85 A;  1G3W A;  2XKP A;  4M6Y A;  1BIA A;  2OZ6 A;  2PEX A;  2HZT A;  1G3T A;  1R5G A;  2DTR A;  3TDZ C;  4OOI A;  3I53 A;  4AIK A;  1WSU A;  2V79 A;  3CO6 C;  4IHT A;  1T38 A;  3RPQ A;  2CYY A;  3K1P A;  2GA2 A;  1L3L A;  1HW2 A;  3GW2 A;  3GVA A;  4XLP F;  2FQ3 A;  1XGO A;  1FLI A;  5FD5 A;  5LHH A;  3R0A A;  2LF8 A;  3GWZ A;  2Y0M A;  2QYO A;  1W5T A;  1W5S A;  3LA3 A;  4LFU A;  3MFK A;  1KYZ A;  1PP8 F;  1Z91 A;  3C1D A;  2MLK A;  3Q5F A;  1O7F A;  4ENN A;  3F6O A;  4LD5 A;  2WC2 A;  4RB1 A;  2M30 A;  2QBY B;  3OOP A;  2QM3 A;  4B8X A;  2L4M A;  5HOO A;  4RGX A;  4FT8 A;  5E8G A;  3WOD F;  5FFZ A;  3P9I A;  4I02 A;  3J7A O;  1WRJ A;  1KQ9 A;  2ZXJ A;  1IRG A;  3B02 A;  4NB5 A;  2LDU A;  2NAZ A;  4P9F A;  3RPU A;  1R1U A;  1RZ4 A;  3P9C A;  5HVQ C;  2ZFW A;  3E5X A;  3CUO A;  3F8M A;  3ZN0 A;  3EET A;  3MCZ A;  5JR3 A;  2FBK A;  4YII A;  4OIR F;  4CDG A;  1AWC A;  1YQA A;  1RUO A;  2Z5U A;  1OYI A;  4KIC A;  3T8T A;  2V1U A;  3E3V A;  5K5R A;  1OR7 A;  4ESF A;  4MHG A;  1FSH A;  1HKS A;  3COA C;  3VOD A;  1ZYR F;  2L01 A;  3LQQ A;  3H92 A;  5ICE A;  2VBW A;  1J5Y A;  4ETS A;  1FBS A;  4G6Q A;  4D0P A;  5FFX A;  2K4B A;  1I6X A;  3CO7 C;  4OIN F;  3DV8 A;  2UWM A;  4A5N A;  1O3R A;  2XAJ A;  2DT5 A;  4L9N A;  3J80 K;  1QO0 D;  3KP7 A;  4LB5 A;  5D8K B;  1W7P D;  1TTY A;  4YFX F;  4LG0 A;  3F21 A;  1BM9 A;  3IKT A;  1IXS B;  1FY7 A;  2PMH A;  1MDM A;  5HDN A;  2RVC A;  3V7S A;  4M9X A;  1XGN A;  1Z05 A;  2STT A;  3TQN A;  3F22 A;  3FF5 A;  5HLH A;  1QNT A;  2OQG A;  2A68 F;  2ESN A;  4KA4 A;  4A0X A;  4Q5S F;  2NNN A;  4HDV A;  2NYX A;  4N0B A;  4AD9 A;  3CJN A;  2LNB A;  4O3M A;  1H9G A;  4I0A A;  1TQI A;  1OPC A;  1WKM A;  3I59 A;  3O6B B;  2BBY A;  4IF4 A;  2K86 A;  2KJC A;  3LST A;  4Q48 A;  2Q8K A;  1SD7 A;  4RGS A;  4WXD A;  3S2W A;  4HAM A;  3ZMS A;  2FE3 A;  2V6C A;  2DK8 A;  3FMQ A;  3HSE A;  2L02 A;  3KCC A;  2IRF G;  1O57 A;  2ADU A;  2RGV A;  3SQN A;  2VON A;  5EEH A;  3C3W A;  5LHI A;  1J9I A;  1JHF A;  1UHM A;  2XRO A;  4GCV A;  1F1Z A;  2MA3 A;  5LGU A;  2HKX A;  3ZMV A;  5HS9 A;  1A04 A;  3ZP5 A;  1EV7 A;  2FNA A;  3KP3 A;  3I0T A;  1Z6R A;  4N9I A;  2IPQ X;  4EJV A;  2BEO A;  4UVB A;  4HLY A;  5E1W A;  4RB2 C;  2R3S A;  2QVO A;  3D5L A;  2EFO A;  3IL2 A;  1G3Y A;  4HX4 A;  2PLY A;  4A12 A;  1IN8 A;  3I58 A;  5CVJ A;  1YG2 A;  3W6K B;  3EDP A;  5H20 A;  3KZZ A;  3SHF A;  1SAX A;  4EJU A;  1MJB A;  4U88 A;  1B9M A;  4U7B A;  1U78 A;  5E18 F;  1FYL A;  3P9K A;  6PAX A;  2P7C B;  2ZCW A;  3Q9V A;  2QZ8 A;  1EH7 A;  4BHB A;  2MH9 A;  5AIQ A;  4M6X A;  5EEG A;  5J8C A;  4IXA A;  2HDC A;  5BMZ A;  4FX4 A;  5ICC A;  1MJ9 A;  3RJP A;  4OMZ A;  2NNY A;  4CGZ A;  4MEX F;  5IT9 Z;  3WGI A;  1B4A A;  2IW5 A;  1H9T A;  3E97 A;  2QBY A;  3FZV A;  3DPL C;  4I98 B;  1O3T A;  2ZME B;  3JTH A;  4L9T A;  1ZRE A;  4QWQ A;  3WG9 A;  5DUI A;  3HHH A;  3BPX A;  1DP7 P;  2DPU A;  3I64 A;  2E7W A;  2GWR A;  4ZZD A;  5IT3 A;  2LSO A;  4KNY A;  2F5E A;  2O61 A;  1XN7 A;  2PJP A;  2JRT A;  2HWV A;  2K4J A;  1SFX A;  5JFR A;  3E6C C;  4XRF A;  5DYM A;  3KLN A;  4PCQ A;  4EGY A;  2MLG A;  5E20 A;  2W24 A;  3QU3 A;  1YYV A;  3ZMU A;  1FX7 A;  4RS8 A;  2H94 A;  1FNN A;  2CWE A;  4LGW A;  3O3K A;  1YW9 A;  1ZAO A;  5ICG A;  1UB9 A;  2HR3 A;  2FNP A;  3ZN1 A;  2IP2 A;  4A0Y A;  1W4M A;  4LLG F;  1B1B A;  5LEK A;  2G7H A;  1P4W A;  2V1X A;  1T98 A;  2YSR A;  1ZGA A;  3E6D A;  3ABT A;  3REO A;  2K02 A;  3K0L A;  4A0Z A;  5ICF A;  2EFW A;  1J2X A;  1XGM A;  2J5P A;  3F3X A;  3H3U A;  3EQL F;  2VBZ A;  3L00 A;  1ZG3 A;  4A6E A;  3BZ6 A;  2G7U A;  2EFP A;  2XIG A;  3QPH A;  3RYP A;  3V4G A;  1P92 A;  4KIF A;  2HEO A;  2WTE A;  2IJL A;  1VTN C;  2VC1 A;  1ZLK A;  3I59 B;  2V9V A;  3O2P E;  2XGX A;  1D8K A;  2CGP A;  2E1N A;  3K1M A;  4KIB A;  1R5H A;  3KLO A;  4S05 A;  2HTS A;  4Y13 A;  3FXU A;  3HHG A;  3LA2 A;  4MEY F;  5L3F A;  2O3F A;  2FSW A;  4HDU A;  4KIG A;  2PG4 A;  3EUH A;  1U8R A;  2G9W A;  1TW2 A;  2DLL A;  2Q2E A;  1LDJ A;  1XMA A;  2B0L A;  3KP6 A;  4EVI A;  3HRM A;  3BJ6 A;  4L0Y B;  3T0Y A;  2M87 A;  1LNW A;  4KFC A;  5L3E A;  1J0R A;  2DFI A;  3M7G A;  1BI0 A;  3JTG A;  4LMY A;  2CW0 F;  4KYW A;  3HUG A;  1R7J A;  1XDU A;  2O8X A;  3WGH A;  3L2C A;  1JHH A;  5E1Z B;  2JPC A;  2P8T A;  5DCF A;  1LDD A;  4A6D A;  2RQP A;  4Z2Y A;  3IWF A;  4HX7 A;  3GO5 A;  1Z7U A;  1O3Q A;  2ISY A;  1YTY A;  4OU0 A;  1FWZ A;  1QGP A;  1RI7 A;  3OV8 A;  1S8N A;  1MGT A;  3WTV C;  1WWX A;  1YS7 A;  1DPR A;  1F5T A;  3QPT A;  1H0M A;  4LJZ F;  2XAH A;  2A3S A;  2EV5 A;  4DNC A;  3E5U A;  4IJA A;  3TOA A;  2A6E F;  5K1Y A;  4BNC A;  3JSP A;  3V7C A;  1OYY A;  2HYF A;  1Z1D A;  4YFN F;  2PN6 A;  3L7W A;  4P55 A;  3T1B A;  1LB2 A;  2IA2 A;  3KET A;  4BH9 A;  4TV7 A;  5F6F A;  4AIH A;  3MWM A;  4UV9 A;  3LAP A;  3WE3 A;  4MQ9 F;  2O0Y A;  2ZME A;  2M5W A;  1IN7 A;  2L54 A;  3LQR A;  3WE2 A;  4JQF A;  2KJB A;  5HLG A;  1CF7 B;  4ENJ A;  3ABU A;  3BRO A;  1HW1 A;  5K5O A;  2C6Y A;  3BP8 A;  2OZU A;  4EMS A;  2UZK A;  2JTV A;  5TRD A;  3B73 A;  3DKW A;  3WTX C;  4PDK A;  4YFK F;  2IA1 A;  1JE8 A;  1UST A;  4GO1 A;  2FF4 A;  1BC7 C;  1I1S A;  2H6C A;  1FYM A; 
#chains in the Genus database with same CATH topology
 2N8G A;  1G6N A;  2YR2 A;  2ZME C;  3GX4 X;  5GAD J;  3GEZ A;  3D0S A;  1WI3 A;  4ZH4 F;  3EYI A;  4IRI A;  1FOX A;  4LLL A;  4IEJ A;  1MKM A;  5LEJ A;  3BTC A;  3GTL J;  1F36 A;  2HGC A;  3K1N A;  3IAM 2;  3H3Z A;  2QGU A;  3DEW A;  3LSK A;  4XLA A;  1QZZ A;  3OS1 A;  4D5F A;  4BE2 A;  3ML6 A;  4UVA A;  3TGN A;  2STW A;  5J1U A;  3BDD A;  3RI4 A;  2VOD A;  1T33 A;  2GA1 A;  4CUG A;  2F5D A;  5IPA A;  1KU7 A;  3OWT A;  4F91 B;  5IY5 H;  4AID A;  1WVR A;  1WHU A;  3KP5 A;  4L0Z B;  1XGS A;  5E1X A;  3C2H A;  2KZV A;  2JA5 J;  4C2U A;  1G3S A;  3IP4 B;  4UHT A;  1T39 A;  4YRV A;  5FB2 A;  4F93 B;  3NWS A;  3FXO A;  3VSK A;  4M6V A;  4CH7 A;  2VKV A;  3BPV A;  4L18 B;  2V4J C;  2VUM J;  5JLX A;  2EZL A;  4E7J A;  4L9V A;  5BQT A;  2RC4 A;  1QZE A;  5J8F A;  4CIC A;  2D45 A;  2NVQ J;  1CGP A;  1PUE E;  3LNQ A;  4HSR A;  3BG5 A;  1E17 A;  2ZJ2 A;  2Z16 A;  2ZXW H;  4G9Y A;  1Q1H A;  3SEZ A;  4CHU A;  3KYC B;  2DBB A;  4N4O B;  1E3O C;  4ZTF A;  3F23 A;  2JN6 A;  3ERE D;  3PNT A;  1D0Z A;  1FP2 A;  2BZT A;  2A5Y B;  4HBL A;  2XSJ C;  2ETH A;  3W2V A;  5FKN A;  1WQ2 A;  1IC8 A;  2XAS A;  1K7A A;  1HW5 A;  2EJR A;  2P5L C;  2TDX A;  3LMM A;  4CXF A;  2CU7 A;  3V8K A;  5FRM A;  1ACI A;  2K85 A;  4BJ6 C;  2ZSI B;  3JSO A;  1IRZ A;  3GME A;  3HL2 A;  2L5Q A;  3GTJ J;  2X1E A;  1ZR4 A;  2OPT A;  4H0E A;  1QBJ A;  2P5K A;  2Z3Y A;  4IHS A;  3A1Y A;  4CYD A;  4J01 A;  3KPH A;  2R0Q C;  4L5J A;  3K4K A;  3WTU C;  1Y8Q B;  2ZFU A;  2M45 A;  5CVU A;  4R8H A;  1VQ9 I;  3OL4 A;  3L1P A;  1STZ A;  1VQM I;  4ZYH A;  4Y17 A;  3PM1 A;  3GYH X;  4FAS D;  1QVU A;  5CKT A;  3PSF A;  4BXX J;  5CLS A;  1PUF B;  2DFH A;  3GTK J;  2M2E A;  2XB0 X;  1OCC H;  2DJI A;  1ORK A;  1J59 A;  1U8B A;  4IOA F;  2QUF A;  3VYS B;  3I3L A;  3ZCO A;  2XHK A;  2Z99 A;  1YLF A;  4A5M A;  2OD5 A;  4WWC A;  2QEN A;  5LGN A;  5D5W B;  5EGO A;  1R22 A;  4XKV A;  5AIP A;  1UZC A;  4ENK A;  1U9O A;  3J7Y J;  5BNG A;  3GFL A;  5LHG A;  3RPU D;  2K40 A;  2OBP A;  2R5Z B;  3CDH A;  2ACJ A;  4F52 A;  5E3O A;  1RR8 C;  2M4G A;  3PIP F;  3E0J B;  4S0H B;  2CFX A;  2L3D A;  3L09 A;  3G1O A;  3PQK A;  2X9D A;  3GLL A;  2QQ8 A;  1VQ6 I;  3CCU I;  2Y48 A;  3OYN A;  4LIV A;  2OQR A;  4E7H A;  1TBX A;  3BG7 A;  5KAI C;  4IOC F;  3ECH A;  4UXN A;  2XAF A;  2ZKZ A;  3OYF A;  3ZQ7 A;  1UG0 A;  2FBI A;  1TZL A;  5J6X A;  3M8F A;  2QF7 A;  4XKC A;  3T5X A;  4ESB A;  1R58 A;  4E6K G;  4GGG A;  4HV6 A;  3ECO A;  5BPI A;  1RET A;  2AQE A;  4EM2 A;  2L4A A;  1IZ1 A;  3BR0 A;  1KA8 A;  1XX5 A;  4HST A;  5DD4 A;  3D1N I;  1WJA A;  5L3D A;  3FXR A;  2V9K A;  1W36 D;  1KU9 A;  5L3G A;  4G94 A;  4EJT A;  3RIR A;  3GZ5 A;  2GIZ A;  5CVR A;  4ZYD A;  5H2F C;  2BW3 A;  2LK2 A;  3W6J B;  3L2V A;  1U5T B;  2H8W A;  1FBU A;  1R1V A;  1HXD A;  3CTA A;  4FHT A;  1USS A;  1V54 H;  3MEX A;  3FWE A;  3LA7 A;  2GXG A;  4OIQ F;  2F5C A;  4KMU X;  4I0B A;  5EG0 B;  2RNG A;  1JXS A;  1SAN A;  1UJ8 A;  1ON2 A;  1WJC A;  1I39 A;  4LOC A;  3GTM J;  3IV5 A;  1FIP A;  1ETQ A;  2FU4 A;  1KGS A;  2GQQ A;  1W7P B;  3A0B C;  3HXL A;  3MKL A;  2X6Y A;  1Z21 A;  4Y4R A;  4A3E J;  3RTR A;  2DYS H;  2V1D A;  1IW7 F;  2YX4 A;  2W84 A;  2PBI A;  5FKL A;  1HKT A;  2H09 A;  3CLO A;  2DAO A;  2XGC A;  5JHF A;  2NS7 A;  4XSZ F;  3GFI A;  1VFC A;  1D3Y A;  2XAQ A;  2HQN A;  1MBH A;  1R1T A;  1T56 A;  3P7N A;  4Y52 J;  1HA8 A;  2D2W A;  4L5I A;  2B9S A;  2VE8 A;  1TT0 A;  3HDD A;  1QQI A;  4M3B A;  3E6B A;  4A3M J;  3KEQ A;  1O3S A;  4JK1 X;  3IWZ A;  3CCJ I;  3K69 A;  4AVP A;  1XSV A;  2M7B A;  2P6T A;  3PFY A;  2DMP A;  3FDY A;  4A3B J;  4RA2 A;  1UHS A;  5D5U B;  2GIV A;  4IX7 A;  2RKH A;  2DPD A;  4RGR A;  3J81 K;  1WI9 A;  2COM A;  3BWG A;  4HW0 A;  4A93 J;  1BL0 A;  2QSH X;  3SZP A;  3U1K A;  2KL4 A;  1R6R A;  4FE4 A;  3CMA I;  3ZXS A;  4DW6 A;  3HRT A;  3LSG A;  4P96 A;  1SFU A;  3RKY A;  2DCE A;  4YG2 F;  2L9V A;  2RNJ A;  2VJI A;  1EA3 A;  4CA0 A;  2OAZ A;  3OIP A;  5DEQ A;  3I4N J;  1YIJ I;  3PUB A;  3C18 A;  1CF7 A;  3R60 A;  5IP7 J;  5KAF C;  4PJL A;  2HTJ A;  1S7O A;  2XRN A;  3J7A Y;  3F0C A;  3TO7 A;  5FRO A;  1GXP A;  3S1N J;  1P4X A;  2CSO A;  3ONQ A;  4IVN A;  1LE8 B;  3OYB A;  3PNV A;  4D5C A;  2QEX I;  3H5A A;  1ITY A;  1JKO C;  2E36 A;  3FM3 A;  3HC7 A;  3BC8 A;  2NOJ B;  1IF1 A;  3ELK A;  1TNT A;  2AS5 F;  3CJT B;  3ZQF A;  2KPM A;  1R49 A;  2HXO A;  3WTZ A;  3JW4 A;  1KU2 A;  1SFK A;  3K4B A;  4A3L J;  1OCO H;  1HKQ A;  1I3A A;  3RQ4 A;  1JJ6 C;  2R7X A;  3S2D J;  1BR4 A;  1I27 A;  1HOM A;  2OCE A;  3U2R A;  4ITV A;  2DFE A;  4MTE A;  1XCB A;  4E4H A;  1YW7 A;  2X0L A;  2ZBK A;  2R7R A;  2W82 A;  4EEF G;  4U0V A;  4HYE A;  3TP0 A;  2H1K A;  2IT0 A;  5IYD J;  1R23 A;  1FJL A;  3HOS A;  3JAM K;  3QP5 A;  1ZK8 A;  1BW5 A;  2H6B A;  4FE7 A;  3CUQ B;  2BY1 A;  2ELK A;  5FKK A;  2EZI A;  2VN2 A;  5F64 A;  5JHU A;  2JZY A;  5K7H A;  2X6X A;  3WHC A;  1G59 A;  2O6G E;  5HNF A;  4HRI A;  1N77 A;  1GHC A;  1E3P A;  2KZG A;  4WCG A;  2VXD A;  3UNG C;  4U87 A;  2GOM A;  3AKZ A;  4ESJ A;  3VOE A;  4DJA A;  5FGM A;  5BPD A;  2CRG A;  4NC6 A;  4ASN A;  5L3B A;  3R4K A;  2EV6 A;  3GTP J;  3SFI A;  3EPZ A;  3ASN H;  4OIO F;  2DK5 A;  2VQH A;  4UB8 C;  4Y7N J;  2GAU A;  1FT9 A;  2XAU A;  1RIO H;  1ZGJ A;  1OCR H;  2W57 A;  1HQC A;  1T6S A;  4M71 A;  4DIQ A;  3RKQ A;  3HGG A;  2YPR A;  4XLN F;  2NOG A;  4M3D A;  1FBQ A;  2F6C A;  2LFB A;  5EZH A;  1MSF C;  1UHW A;  1JGS A;  2DQL A;  1LUJ B;  4J00 A;  4GYG A;  1ZRC A;  3VB2 A;  3W2A A;  2DQR A;  1IRF A;  5M3M J;  2COB A;  2O7O A;  5H6Q A;  1K79 A;  2FX0 A;  3EUK L;  2VAS A;  4ZYG A;  4HNU A;  2R4G A;  4DQ2 A;  3S32 A;  2LC2 A;  1TL8 A;  1EH8 A;  3SEQ A;  2ECB A;  1WGX A;  3CD6 I;  2XPV A;  1S7A A;  5F1R A;  4N9H A;  2M7A A;  2JT1 A;  3MVP A;  2HNH A;  2JA2 A;  5TIS C;  1OYW A;  2WA0 A;  2HOE A;  1N25 A;  4EM1 A;  2QSG X;  2R7F A;  4BJT A;  1ETV A;  2XGE A;  4CCJ A;  1FZP B;  4IRG A;  3WU0 A;  2M0M A;  3F72 A;  3LSJ A;  2MYS A;  4L9J A;  2WAE A;  4I2O A;  4XON A;  1LDK B;  4FQG A;  4C2M J;  1YO5 C;  2OV7 A;  1K6O A;  5EGO B;  2VT2 A;  2DN0 A;  2ZXI A;  1DDN A;  2X48 A;  4NHJ A;  1SMT A;  4C3H J;  4C2T A;  1TWA J;  2VBX A;  2Y75 A;  4LK0 F;  3K9T A;  3SFZ A;  1IUY A;  4PGG A;  4RAF A;  2R5Z A;  1DQU A;  2ESH A;  3M8J A;  1QHG A;  2K9S A;  1LQ1 A;  4I09 A;  1I3Q J;  3BR5 A;  5ERI A;  4KMF A;  3HTU A;  2XB5 A;  3MZH A;  1IUF A;  3R61 A;  4UV8 A;  2VE9 A;  1DPU A;  3W2W A;  1OCT C;  4P5O A;  3RKW A;  5J47 A;  2D5V A;  3HOX J;  3KE2 A;  2QQA A;  2ZSH B;  3HOU J;  4S04 A;  3GFJ A;  1PVE A;  4XKW A;  4RLF A;  4D7N A;  1RES A;  3C2G A;  5FLM J;  2E34 A;  2QLZ A;  3ZQH A;  3S3N A;  3QOP A;  3TKY A;  5TJJ A;  4V19 K;  1O7L A;  2KIU A;  1TP4 A;  4CO8 A;  3CJQ B;  2XF7 A;  4R79 A;  3V8L A;  3JRG A;  1ETK A;  1WJD A;  5D8L B;  2FOK A;  4E70 A;  3EUA A;  1NK3 P;  4BGD A;  1X4P A;  3BJO A;  2CW7 A;  3TBI A;  2V6E A;  5H6R A;  2Y30 A;  2ZNY A;  3R6S A;  1ON1 A;  1WJ5 A;  1U5T A;  2IXS A;  4BY1 J;  2CUJ A;  1X19 A;  3IRR A;  1QVT A;  2Q0O A;  1R00 A;  2AXT C;  3TO9 A;  4A3I J;  3VFZ A;  4ZDL A;  1BN5 A;  2CO5 A;  3IH2 A;  5J4Y A;  3E5Q A;  1S6L A;  3IC7 A;  2FEZ A;  1C0W A;  3HOW J;  2IGK A;  1JKP C;  4IO9 F;  3MKY B;  5EG0 A;  1OIS A;  3VYU B;  2IEK A;  3Q9S A;  4P9U A;  1BW6 A;  2HFH A;  3RQI A;  5F08 A;  3TW7 A;  3BR1 A;  5D4S A;  1ZR2 A;  1ULY A;  3SXY A;  1W7P A;  3HBL A;  3DCF A;  3CCV I;  2EWN A;  3PFI A;  3BG6 A;  3KZI C;  3QRF F;  4A3D J;  2LH9 A;  3QU6 A;  3OYA A;  4M9S A;  3LL7 A;  1SFE A;  4MIM A;  2KIM A;  1RUN A;  2BY0 A;  1FTZ A;  4FX0 A;  3RDI A;  4P1W A;  1U5T C;  2HZD A;  5E17 F;  2FXA A;  4PGH A;  1SVM A;  5FKO A;  3E7L A;  5IYC J;  3ZQC A;  2GLO A;  3DFG A;  2E19 A;  3VEP A;  2WB1 N;  2AHQ A;  2VOO A;  1LVK A;  2K27 A;  3BG9 A;  4EJW A;  2VI6 A;  1JUM A;  1ZRF A;  1HST A;  2F2E A;  3P5J A;  2KIS A;  1QU3 A;  2GXA A;  5HS8 A;  3F8B A;  2ISZ A;  1GVJ A;  3FX3 A;  5KNL A;  2KIF A;  3QP6 A;  4XM3 A;  1NG7 A;  2QQB A;  4WXH A;  3DWL E;  3N97 A;  4IPA A;  3OYJ A;  5K5Q A;  3WTS C;  4MTD A;  4ZZL A;  1JT6 A;  2E1C A;  2R7V A;  1DGR M;  1V5E A;  1ZN2 A;  4IHY A;  3GF2 A;  4GRI A;  1KQ8 A;  2VC0 A;  1P6R A;  3MD2 A;  1F4K A;  1AKH B;  2JRM A;  4ENM A;  4Q4Z F;  1G4D A;  4IHV A;  4DYR A;  3BTI A;  5DM7 F;  5B1B H;  3L2R A;  2E71 A;  1EJ9 A;  1T95 A;  3DXJ F;  4B1R A;  1RKW A;  2XPU A;  2VQL A;  4F7Z A;  3FMS A;  5C4J J;  2A69 F;  1J7K A;  2XF6 A;  3OY9 A;  3FK6 A;  1LE8 A;  4JYK A;  2QSF X;  2RAE A;  1ETW A;  5J1Y A;  1V55 H;  2CUF A;  1BA5 A;  5KVR A;  2KRH A;  1HC8 A;  5HS7 A;  4D1Q A;  4RM3 A;  3CLQ A;  5IP9 J;  3JRA A;  4G7Z F;  2FOW A;  2KIQ A;  2ELJ A;  1GXQ A;  2OC6 A;  1XMK A;  1Z77 A;  2P6S A;  1XS9 A;  1U6G A;  4PJJ A;  2EA4 A;  1TW3 A;  3SZT A;  2ID6 A;  1I1G A;  1MBF A;  3OL3 A;  4PFP A;  1DU6 A;  4G7H F;  2VOP A;  2PMU A;  2PI0 A;  1XSD A;  1KU3 A;  2E1M B;  2E7X A;  3K6G A;  3DF8 A;  4HF0 A;  2FMY A;  4BHP A;  1MH3 A;  3OYE A;  2E2I J;  3TDU C;  1O4X A;  4HOB A;  2X1C A;  1D0Y A;  4V2F A;  3U9G A;  2X6W A;  3TL4 X;  2IS4 A;  5HDG A;  3G73 A;  1HSJ A;  5FLX Z;  5HDK A;  2A6H F;  3CUQ A;  4DOZ A;  2DMU A;  3R0J A;  3TO6 A;  3ZOB A;  4IHX A;  4K2E A;  2VQG A;  4IQ4 A;  2XV4 S;  2EIM H;  4EQQ A;  1S9H A;  2OU2 A;  2XSD C;  3CMY A;  1UCR A;  2BY2 A;  2FUG 2;  3RYR A;  4BQA A;  2WB1 A;  3VYR B;  1RNL A;  4XLE A;  2BE5 F;  2P7V B;  4M3F A;  2QKL B;  1IXR C;  1L0O C;  3GLX A;  3KIO A;  1HBX G;  3I71 A;  2HOA A;  3T8R A;  2MAB A;  4OMY A;  2GXB A;  3S16 J;  4HF2 A;  3A4C A;  1SVL A;  2EFQ A;  3I54 A;  5GPC A;  3J81 Z;  3NWT A;  4UUV A;  3I4P A;  4DZP A;  3HTS B;  4V2G A;  1ZG1 A;  1LVA A;  3FIS A;  1OQY A;  4R1H A;  1E0E A;  3D5S C;  3CUQ C;  1MBG A;  2JA7 J;  1OMI A;  2CQN A;  4KUM A;  4EV0 A;  3OYL A;  1MNM C;  4KIS A;  2VPR A;  4CCK A;  4DYQ A;  5F0H A;  2CH0 A;  1BJZ A;  1XSX A;  1YIO A;  3IHU A;  5LFA A;  2OJE D;  3AG2 H;  4EM0 B;  2BXY A;  4BJ5 C;  1XD7 A;  2ME0 A;  3ISP A;  2ZNZ A;  2UXX A;  3E6M A;  1FSE A;  1YX5 A;  1Z67 A;  1D5Y A;  3H9Q A;  2YUS A;  3MN2 A;  1U0J A;  1ZHF A;  1X1C A;  1XDS A;  2HYJ A;  4RAZ A;  3FHZ A;  2HU9 A;  3TW6 A;  1S29 A;  3AG1 H;  1K4S A;  4XN3 A;  4CCN A;  1N78 A;  2XAG A;  3IUO A;  3V8J A;  1K78 A;  1AU7 A;  4QIW N;  4O5V A;  2W48 A;  5AON A;  1JGG A;  3WTT C;  2JQ7 A;  2K3F A;  2VLA A;  2GZW A;  1IN5 A;  3BY6 A;  1RKT A;  2O5R A;  2R7O A;  4M9Z A;  4NQW B;  2ID3 A;  1AOY A;  2R7Z J;  2MFZ A;  2CW8 A;  4I01 A;  1T2K A;  2GBY A;  3RKX A;  2XPW A;  2MGQ A;  4AIJ A;  4CSW A;  1V3F A;  3EYY A;  1YI2 I;  1MD0 A;  3DU5 A;  1Z6T A;  1OKR A;  2WY8 Q;  2CUE A;  1GDT A;  3HOT A;  1IN4 A;  1NHA A;  3HSR A;  2DMT A;  1T8I A;  4HLX A;  3SJM A;  4XLF A;  3I5U A;  2HS5 A;  2D1V A;  2XUB A;  3JRF A;  2A61 A;  5IOY A;  3FBN B;  1DP3 A;  3JAM Z;  4GXO A;  5DUK A;  4OAY A;  3F8F A;  3QPL A;  4FET A;  3GZ6 A;  4CZZ A;  3AAF A;  3HKZ N;  4HPQ A;  3FM5 A;  4HNT A;  3WTY C;  3HOZ J;  1B6A A;  3G4S I;  3M9A A;  2K9N A;  3QOE A;  1MMD A;  3K4C A;  2EV0 A;  1LEA A;  1MZB A;  2JSC A;  5GP9 A;  4ABZ A;  1YW8 A;  3FXM A;  2DW4 A;  4XSX F;  4M74 A;  1PP7 U;  2IGN A;  5FO5 A;  3I9V 2;  5KK1 A;  2F48 A;  1BI2 A;  1PDN C;  1V4R A;  3GFM A;  3F8C A;  1DUX C;  2W25 A;  3OR2 C;  2DT6 A;  2KHM A;  4DZJ A;  2MD5 A;  1QPM A;  1UFM A;  2MH2 A;  3CCS I;  3BR3 A;  5HLI A;  2X6O A;  4HA8 A;  1H89 C;  2H8R A;  1KQ0 A;  4WF2 A;  3IRQ A;  3CME I;  3CF2 A;  2I5U A;  1SMY F;  2M1B A;  2JPB A;  2LYC A;  4Y15 A;  4BDZ A;  3UKG A;  2DA2 A;  2EPF A;  2LKP A;  3M4O J;  1FP1 D;  4BY7 J;  1S3J A;  5FLV A;  1VQ8 I;  5DCM B;  1ERD A;  5CJ9 A;  4W97 A;  1LJ9 A;  2FRH A;  3RCO A;  3SZG A;  3IAS 2;  3K4J A;  1FOK A;  4KN7 X;  3OYC A;  4FIS A;  2WWY A;  5F1J A;  3JRE A;  2L7F P;  3CCL I;  1R71 A;  4OIP F;  3MZY A;  3H1C A;  4GYI A;  2PFB A;  3ZMT A;  2VKD A;  4BYY A;  5DM6 F;  1TQP A;  4AWX B;  3CF5 F;  3N4M A;  2NRA C;  1X1P A;  2KLO A;  2CQ7 A;  4M72 A;  3TOB A;  1MW7 A;  4QLC U;  4RB3 C;  2V7F A;  2E60 A;  2IVM A;  3ZQI A;  1OFC X;  1KYW A;  3BQY A;  4EJO A;  1YIT I;  3OS0 A;  2FML A;  3QYB A;  4MFD A;  1X3W B;  2LG4 A;  3M07 A;  3F8N A;  1MMN A;  3NEU A;  1ZQ3 P;  1QZY A;  2F5F A;  3FXJ A;  1ZLJ A;  3M1E A;  1U3E M;  2RV8 A;  2CMP A;  5D5X B;  2FBH A;  1ZH5 A;  2L0K A;  5FLX K;  1FC3 A;  1W0T A;  2JSP A;  2OTJ I;  4XOT A;  2ZO4 A;  2VKH A;  4HG2 A;  5DV5 A;  3ABM H;  4KJZ A;  2OA4 A;  5HNH A;  3PUF A;  3L9F A;  4LK1 F;  4EGZ A;  3HIF A;  4AYB N;  2P4W A;  3DKX A;  1TLH B;  3GXO A;  2V26 A;  2VKE A;  3HSF A;  3DEU A;  1SD4 A;  4WXC A;  2EFN A;  5CQE A;  2J5O A;  2LLK A;  3HKZ A;  2WV0 A;  4M3G A;  3IKV A;  4UVC A;  3ZMD A;  2TRT A;  4HZF A;  4RLQ A;  3OR1 C;  4X6A J;  5ILV A;  5FD6 A;  5J1R A;  2WY7 Q;  3DP7 A;  5A2Q Z;  4XLC A;  4ZYE A;  1E2X A;  4LLN A;  3DPT A;  2AXL A;  2MW8 A;  1D1A A;  2UXN A;  1T0F A;  3HRS A;  5LRS A;  3HG9 A;  2PQ8 A;  3Q3S A;  2QQ9 A;  2BV6 A;  2ICW G;  2IA0 A;  3H3V K;  1I5Z A;  3JRD A;  5E8I A;  4DGW B;  2I8D A;  1AKH A;  2NVU B;  3QYE A;  1B9N A;  2HPI A;  2CFO A;  2UUZ A;  3NRV A;  3V7R A;  2LTP A;  1VQL I;  4PZJ A;  1ZAR A;  2DOD A;  3NAR A;  5LRR A;  3PIO F;  4B09 A;  4BU2 A;  4YIF A;  2YU3 A;  3A03 A;  2P0W A;  3JRB A;  1J75 A;  1D8J A;  2ME6 A;  3NQO A;  1MSE C;  3FMR A;  4G8X A;  4CCL A;  1VZ0 A;  2NVY J;  2QKM B;  3RSN A;  3LAJ A;  1VQN I;  1SD6 A;  3S17 J;  4M3E A;  3MQ0 A;  4UNO A;  5D6F A;  1UG2 A;  2P81 A;  5LBQ A;  3KEO A;  1GV5 A;  1IAW A;  4WK8 F;  2HKO A;  4OAZ A;  5FJ8 J;  4G6D A;  1T0F C;  1YS6 A;  3CDL A;  1P2F A;  5M5W J;  3U1D A;  2BYV E;  2DA6 A;  1YRN B;  1Y39 A;  3FXQ A;  2ECC A;  4RAY A;  1QA6 A;  2KFD A;  3M8E A;  5F0F A;  4HQE A;  1Z9C A;  1D1C A;  2M9H A;  5ED4 A;  1X1B A;  2VT3 A;  1B59 A;  4NNJ A;  4XBF A;  2A07 F;  4HNV A;  1XB4 A;  2YS9 A;  3WTW C;  2R7W A;  4Y3O A;  5D4R A;  2DU9 A;  4M73 A;  4ZYA A;  1X3U A;  2NS0 A;  5M3F J;  1YFH A;  1Y0U A;  2DA7 A;  5LLQ A;  1SFO J;  3DTE A;  3RZD J;  2FA5 A;  1MNE A;  1KON A;  2Y9Z A;  1MJA A;  2JA6 J;  2R92 J;  2O03 A;  1LFU P;  2JVG A;  1HF0 A;  4MGR A;  1M1E B;  1F43 A;  4A2U A;  2EB7 A;  3S3O A;  4BKX A;  4XLH A;  3DQV C;  2DFF A;  3KZY A;  2QWW A;  1HDD C;  5LGT A;  1U9N A;  4F92 B;  4AYB A;  1YJN I;  3K70 C;  2EIL H;  4Q47 A;  2Z33 A;  1FPQ A;  4LB6 B;  4IHW A;  3B6A A;  2JWT A;  1IRX A;  2KRF A;  2LF7 A;  4BXU A;  3B6C A;  1X4O A;  5E3M A;  2W00 A;  2E1M C;  2CQK A;  2IAI A;  2E1O A;  2DA1 A;  1UEL B;  3PQJ A;  1AA7 A;  4G7O F;  3G3Z A;  3DTI A;  2DO7 A;  1LEB A;  2MBF A;  3BR2 A;  4HX8 A;  5JVT A;  2R7D A;  4ON0 A;  2EK5 A;  5EYR A;  4I7H A;  2Z9O A;  2RQQ A;  3GUD A;  5ILU A;  1D5V A;  2XRL A;  2DI3 A;  5CYV A;  4LG0 B;  3BOQ A;  3ROU A;  3G71 I;  2CG4 A;  4XR6 A;  2R93 J;  2HQR A;  3LFK A;  5JI6 A;  5BOX A;  2BGC A;  4RAG A;  1G8X A;  4RB0 A;  4U7D A;  4BHC A;  3WG7 H;  5ILS A;  1R36 A;  2F4O B;  3KP2 A;  1IN6 A;  3MAJ A;  4IZZ A;  4ZDP A;  1MDM B;  1JUP A;  1WH7 A;  1TNS A;  2DJN A;  4RMN A;  1BC8 C;  1BOA A;  1IXC A;  2RN7 A;  2K9L A;  2XC7 A;  1K78 B;  1ONV A;  2VBY A;  4XRS A;  1OCP A;  2IS2 A;  4BEH A;  4BAY A;  2X4H A;  3BTJ A;  2W4S A;  5GTI C;  2YU9 J;  2EIJ H;  3K2Z A;  1LPQ A;  3DLA A;  4NC8 A;  1B8I A;  5FKM A;  4WX9 A;  4JBA A;  5BS6 A;  3DLL F;  1ZRD A;  4A3J J;  2I10 A;  3HRU A;  4NQW A;  3BZK A;  4KDP A;  4C9Y A;  1U2W A;  4BUP A;  3ULQ B;  3ZPL A;  2D1H A;  2HXI A;  3H36 A;  4JOM A;  2VXZ A;  5CVI A;  2YX7 A;  4IRH A;  3K7A J;  1YJW I;  3HYI A;  2H27 A;  4HQM A;  1K4T A;  2AO9 A;  4UUT A;  3WU1 B;  1ODD A;  1BJA A;  2EA2 A;  2VQC A;  2AQF A;  5L3C A;  4U0Y A;  3OYK A;  5DTD A;  2RDP A;  2P5V A;  3AG3 H;  2KKO A;  3AL0 B;  1MMG A;  3DU6 A;  4ZC3 A;  3OYG A;  5M5Y J;  2NVT J;  1BBY A;  3LSM A;  4HF1 A;  3ZMZ A;  2HYG D;  1W1W E;  3HJE A;  1FMW A;  3LSP A;  2MC3 A;  5A2Q K;  1F9N A;  2HPM A;  4Y33 A;  3WGG A;  4B43 A;  1ZG5 A;  1P4A A;  3CZ6 A;  4HV5 A;  4O6J A;  2K7L A;  1G2H A;  4KT5 C;  3BTL A;  4JX4 A;  5DD8 A;  4IQJ A;  3QAH A;  2M8E A;  4KN4 X;  3ASO H;  1TQM A;  3C7J A;  1SD5 A;  1MBE A;  1BIB A;  2M3A A;  2EBI A;  5IT9 K;  1EH6 A;  3H0D A;  5D5V B;  1BR2 A;  3KFW X;  1BI3 A;  1REP C;  2HDW A;  1ZTR A;  2HVS A;  3S3M A;  3QYF A;  1XCV A;  3H35 A;  4BBS J;  2XF5 A;  4PJ0 C;  5CVV A;  1Z0X A;  3BJA A;  1FYK A;  3LWF A;  3H9G A;  3F6V A;  3J80 Z;  3KP4 A;  3OIQ A;  4MQV A;  5IP6 A;  1BI1 A;  4RGU A;  5D6E A;  5DCM A;  2XVC A;  2ZXH A;  1NH3 A;  4C3I J;  2XKO A;  1E3H A;  4MNU A;  3TMO A;  5LD2 C;  4GFB A;  2EIK H;  4BXF A;  5JVG F;  2ELH A;  3FXK A;  2JK3 A;  4U0W A;  5F0C A;  3A02 A;  5DDG A;  5M5X J;  3OS2 A;  2W85 A;  2K3P A;  3CMM A;  1G3W A;  3ESW B;  3GTG J;  2LY1 A;  3JCU C;  2Z1D A;  2XKP A;  3HPG A;  3CP2 A;  1WZ2 A;  4M6Y A;  1BIA A;  2OZ6 A;  1K61 A;  2PEX A;  1RR7 A;  2HZT A;  1G3T A;  2OCC H;  1R5G A;  3S1R J;  2DTR A;  5B1A H;  1MND A;  2M34 A;  1A36 A;  1IO2 A;  3Q0W A;  3TDZ C;  4B3X A;  2FD5 A;  4OOI A;  3I53 A;  4AIK A;  4A69 C;  3RZO J;  1WSU A;  2F4I A;  2V79 A;  3OIO A;  4XRS G;  3CO6 C;  3BR6 A;  3M3Y J;  4IHT A;  5B3S H;  3RPQ A;  2CYY A;  1T38 A;  4B44 A;  2MC4 A;  3K1P A;  2GA2 A;  2WV1 A;  1L3L A;  2KDO A;  2HVQ A;  3CCE I;  3S1M J;  4PJN A;  3JRH A;  2DA5 A;  1HW2 A;  3GW2 A;  1LFP A;  3H0G J;  4CYC B;  1WH5 A;  3GVA A;  4XLP F;  2JUC A;  1LKX A;  2FQ3 A;  2R7S A;  1XGO A;  3E1S A;  1FLI A;  2HDD A;  1YHQ I;  5FD5 A;  3HOY J;  5LHH A;  3R0A A;  2LF8 A;  3GWZ A;  2Y0M A;  2QYO A;  2IS6 A;  4B3A A;  1W5T A;  3FK7 A;  4YEL A;  1ETO A;  3ERM A;  1W5S A;  3LA3 A;  4E7S A;  4LFU A;  3MFK A;  1BOB A;  3OSG A;  1KYZ A;  1PP8 F;  1Z91 A;  4DBR A;  1JUS A;  3C1D A;  2VJ5 A;  1SC7 A;  4KIT B;  3CCY A;  2MLK A;  4UB6 C;  3Q5F A;  1O7F A;  3OOU A;  4ENN A;  2F4M B;  3F6O A;  3FKI J;  4LD5 A;  2HQA A;  1GT0 C;  3J7Z I;  2WC2 A;  1ZEL A;  4RB1 A;  2OF7 A;  2R7T A;  2M30 A;  2A05 A;  4XNF A;  2QBY B;  2VJJ A;  3OOP A;  3GTQ J;  2QM3 A;  2EIN H;  3HGY A;  4B8X A;  2L4M A;  5HOO A;  2L9S A;  4RGX A;  4FT8 A;  5E8G A;  3WOD F;  2A6T A;  5FFZ A;  3P9I A;  4I02 A;  3J7A O;  1WRJ A;  2X85 A;  5EEA A;  2FJ1 A;  3W3C A;  4D7M A;  1KQ9 A;  1X3Z B;  2ZXJ A;  1IRG A;  3S8P A;  3B02 A;  4NB5 A;  1JKR C;  2LDU A;  1X1A A;  2NAZ A;  4P9F A;  3AFH A;  3RPU A;  1R1U A;  1RZ4 A;  3P9C A;  1EKE A;  2VIX A;  2PX9 A;  5GPA A;  5HVQ C;  2ZFW A;  5GAG J;  3E5X A;  3CUO A;  3F8M A;  1YRN A;  2L7M P;  3ZN0 A;  1TWG J;  2PMZ N;  3EET A;  5CPR B;  3MCZ A;  5JR3 A;  3KX2 A;  2FBK A;  2R7U A;  4YII A;  4OIR F;  1J09 A;  2EH3 A;  4CDG A;  1AWC A;  2XDV A;  1JJ8 C;  1OJL A;  1YQA A;  1RUO A;  4LG3 A;  3S14 J;  3CCQ I;  4BAC A;  2Z5U A;  1OYI A;  5K7F A;  4KIC A;  4E7K A;  3T8T A;  2V1U A;  3E3V A;  4ZTJ A;  5GAE J;  2KRC A;  2VPL A;  1I6H J;  5K5R A;  5HOD A;  5E79 C;  1OR7 A;  3A01 A;  4ESF A;  1Z3X A;  4MHG A;  4BS9 A;  3PO2 J;  1HKS A;  1FSH A;  2DOF A;  5C3E J;  1IV8 A;  5B66 C;  3COA C;  3VOD A;  1P7J A;  1ZYR F;  4XKB A;  2L01 A;  3LQQ A;  3H92 A;  2BY3 A;  4AVZ A;  5ICE A;  2VBW A;  1J5Y A;  4ETS A;  1FBS A;  3HB9 A;  4G6Q A;  4FCY A;  4ZJZ A;  4D0P A;  5FFX A;  2K4B A;  1I6X A;  3CO7 C;  2R5Y B;  5TGT A;  4D9J A;  1QHH D;  2NXN B;  4OIN F;  3DV8 A;  3K4N A;  3A0H C;  1MMS A;  2UWM A;  5KHD A;  3OYI A;  2CQX A;  2VJ4 A;  4A5N A;  1O3R A;  2XAJ A;  1P9Q C;  2DT5 A;  4L9N A;  5EF6 A;  3J80 K;  1QO0 D;  3CQZ J;  5C4X J;  1V5F A;  3KP7 A;  2E5N A;  4UY8 I;  4LB5 A;  5D8K B;  4MFE A;  1W7P D;  1TTY A;  2LRE A;  3PO3 J;  4YFX F;  3H5N A;  1OR7 C;  4LG0 A;  1X1D A;  3F21 A;  1BM9 A;  1W36 C;  3IKT A;  2BOL A;  2CV2 A;  4PSX A;  2DOE A;  5J4V A;  1FIA A;  1IXS B;  2L9N A;  3S93 A;  1FY7 A;  3SDG A;  1QRY A;  1VI0 A;  2PMH A;  2LKX A;  1MDM A;  1V5G A;  3DTK A;  5HDN A;  2RVC A;  3V7S A;  4M9X A;  1XGN A;  3WHB A;  1Z05 A;  2LY9 A;  2STT A;  3TQN A;  4JX5 A;  3VPR A;  3F22 A;  3FF5 A;  4BEH B;  3I4M J;  5HLH A;  1FMV A;  1QNT A;  1IDZ A;  2OQG A;  2A68 F;  1VQO I;  2ESN A;  1B8I B;  4KA4 A;  4A0X A;  4Q5S F;  2NNN A;  1HLV A;  5C44 J;  4XN0 A;  4BBR J;  4RM2 A;  4HDV A;  4ANJ A;  2NYX A;  4N0B A;  4AD9 A;  3CJN A;  3F9K A;  2LNB A;  2G0E A;  3JRI A;  4O3M A;  3FKJ A;  1W0U A;  3DBH B;  1H9G A;  4JX6 A;  1S7E A;  4I0A A;  5F04 A;  1WJF A;  2BVL A;  1TQI A;  2PMZ A;  1OPC A;  1WKM A;  3I59 A;  3O6B B;  4QPQ A;  5B5E C;  3A2K A;  2BBY A;  3MKZ A;  2CQQ A;  2WBM A;  4IF4 A;  5HLT A;  2HI3 A;  3JR9 A;  2K86 A;  2PJR B;  1POG A;  1D1B A;  2LP0 A;  4BE1 A;  3FIW A;  3PJR A;  2KJC A;  1Y8R B;  3LST A;  2UV1 A;  4Q48 A;  4X1E A;  1OLT A;  3VDX A;  2Q8K A;  1SD7 A;  3BQZ A;  4RGS A;  4WXD A;  4G12 A;  1OCZ H;  1JI8 A;  1JTY A;  3S2W A;  4HAM A;  1VND A;  3ZMS A;  2CV1 A;  5J40 A;  1VQ5 I;  1XTA A;  2A5W A;  2FE3 A;  1FTT A;  1A5J A;  2V6C A;  3GCM A;  4F3Q A;  2DK8 A;  3FMQ A;  4JP0 A;  3HSE A;  1MH4 A;  2L02 A;  3L2U A;  3KCC A;  1K6Y A;  2IRF G;  1O57 A;  2ADU A;  2RGV A;  3SQN A;  1SAU A;  2Z2S B;  2VON A;  1PJR A;  2L7K A;  3V42 A;  1RC9 A;  5EEH A;  3C3W A;  2DT7 B;  3QPS A;  5LHI A;  4E7Z A;  2Q2E B;  1J9I A;  4NUB A;  1JHF A;  1TWF J;  1UHM A;  2DDA A;  3OSF A;  2OTL I;  1A6Q A;  2EZH A;  3AL0 C;  2XRO A;  2Y0S N;  4GCV A;  1F1Z A;  2MA3 A;  3O8G A;  2Y2Z A;  5LGU A;  2DA4 A;  5EDN A;  3SDB A;  3ABK H;  3GZN B;  2HKX A;  3ZMV A;  5HS9 A;  1A04 A;  2LBF B;  3ZP5 A;  1EV7 A;  2JJ7 A;  3BG3 A;  3FXL A;  1T08 B;  2FNA A;  1EF4 A;  3HUG B;  1Y1V J;  2LKS A;  1GLN A;  3I0T A;  1Z6R A;  3KP3 A;  4C3J J;  4N9I A;  2IPQ X;  4EJV A;  3ZQL A;  2BEO A;  4UVB A;  1KZH A;  4HLY A;  2ZB9 A;  5E1W A;  1ENH A;  2R3S A;  4RB2 C;  2QVO A;  1MBJ A;  1JTX A;  3D5L A;  4AM3 A;  2V9P A;  4LIU A;  3S1Q J;  2JVH A;  2EFO A;  3CC2 I;  3IL2 A;  1XPX A;  1G3Y A;  4HX4 A;  2MD0 A;  2L7Z A;  2PLY A;  4CCM A;  4DBQ A;  4A12 A;  1IN8 A;  3I58 A;  5CVJ A;  4N4N B;  1YG2 A;  4BQQ A;  3Q0V A;  3W6K B;  3EDP A;  1ZGW A;  4AC0 A;  5H20 A;  1JKQ C;  2V1N A;  3KZZ A;  3SHF A;  1SEU A;  1SAX A;  1WJB A;  2B63 J;  1APL C;  2CJJ A;  4EJU A;  3VWB A;  4CYC A;  1MJB A;  1QPI A;  4U88 A;  1B9M A;  3PNY A;  3NAU A;  2Q1Z B;  4U7B A;  9ANT A;  1U78 A;  2CS3 A;  2XGD A;  5E18 F;  1FYL A;  3P9K A;  2X1D A;  4IKF A;  6PAX A;  2P7C B;  1MIJ A;  2ZCW A;  1VF9 A;  3Q9V A;  2QZ8 A;  5GAH J;  3AG4 H;  1EH7 A;  3I55 I;  4CZC A;  4BHB A;  4YEJ A;  2MH9 A;  3PL8 A;  5AIQ A;  4M6X A;  3W6V A;  2ZJP F;  5EEG A;  1I50 J;  2CUZ A;  3TED A;  5J8C A;  4IXA A;  4C30 A;  2HDC A;  4UUS B;  1VQK I;  5BMZ A;  4G6T B;  4FX4 A;  4KT6 A;  5ICC A;  1MJ9 A;  3RJP A;  3DBL B;  4CCO A;  4OMZ A;  2NNY A;  4CGZ A;  4MEX F;  5J3L A;  5IT9 Z;  1XG1 A;  2DA3 A;  2BHZ A;  3WGI A;  2H1L A;  2CV0 A;  1B4A A;  2LOO A;  2IW5 A;  3U21 A;  1H9T A;  3E97 A;  2QBY A;  4I99 C;  3FZV A;  3GTO J;  3ZQG A;  2TCT A;  3WU2 C;  3DPL C;  1LFB A;  4I98 B;  1O3T A;  2HVR A;  1B72 B;  2ZME B;  2X51 A;  3JTH A;  4L9T A;  4QTR A;  1ZRE A;  2HOT A;  2Y0S A;  4QWQ A;  3FHN A;  3QOD A;  4H4K C;  3WG9 A;  4DYC A;  5DUI A;  3HPH A;  3HHH A;  3BPX A;  1DP7 P;  2DPU A;  1AHD P;  2Y9Y A;  1R4M B;  3I64 A;  2E7W A;  3ZRG A;  5F27 A;  3OYH A;  3IH3 A;  1GVD A;  3IH4 A;  2GWR A;  4ZZD A;  5IT3 A;  1NK2 P;  1A31 A;  2M0C A;  2LSO A;  4II3 A;  1R4N B;  4KNY A;  2F5E A;  2O61 A;  3KEY A;  1MBK A;  3HEF A;  1IDY A;  1XN7 A;  2VB6 A;  3S2H J;  5JLW A;  1IG7 A;  2JRT A;  2PJP A;  4XRM A;  4XIC A;  1WJE A;  2KQR A;  2HWV A;  2LVS A;  4XMY A;  2K4J A;  1SFX A;  1Q1V A;  1IJW C;  1IV6 A;  5JFR A;  3K10 A;  3E6C C;  1RRJ A;  4XRF A;  5DYM A;  3KLN A;  4PCQ A;  4EGY A;  2MLG A;  5E20 A;  2W1O A;  4MO7 A;  2W24 A;  3QU3 A;  4BQO A;  3G6E I;  5IYB J;  4A3K J;  1YYV A;  4BL0 B;  3DPU A;  4PFO A;  3LFU A;  3ZMU A;  4HEA 2;  2DTZ A;  3A01 B;  2K5C A;  2OUM A;  1FX7 A;  3ZQQ A;  1Y56 A;  4RS8 A;  2H94 A;  2MSY A;  4PK4 A;  4EAT A;  1FNN A;  2CWE A;  4LGW A;  3O3K A;  3VYT B;  1UMQ A;  3M1C A;  1YW9 A;  2B7E A;  1ZAO A;  5ICG A;  1UB9 A;  2ZJQ F;  4E7I A;  2HR3 A;  2FNP A;  2Y69 H;  3ZN1 A;  2W7N A;  2IP2 A;  4A0Y A;  3C2B A;  4RDU A;  1W4M A;  3Q0U A;  4LLG F;  4NC7 A;  1Y1W J;  1B1B A;  3VSL A;  1TC3 C;  2LR8 A;  5LEK A;  3DKY A;  3CC7 I;  2G7H A;  1P4W A;  2IS1 A;  4X0G A;  2V1X A;  2R5Y A;  1T98 A;  2YSR A;  1TT5 B;  4XOR A;  1YJ9 I;  1ZGA A;  3E6D A;  3ABT A;  1GUU A;  3H5R A;  2NS8 A;  3REO A;  1CQT A;  2K02 A;  1X2N A;  3K0L A;  4A0Z A;  5ICF A;  2EFW A;  1IGN A;  1J2X A;  1XGM A;  2J5P A;  3PSI A;  4XID A;  2BXZ A;  4FTH A;  4LIT A;  5E3N A;  1S72 I;  3F3X A;  2M8G X;  3CDI A;  4XOP A;  5K7Z A;  2IGO A;  2L2O A;  3H3U A;  3QQA A;  1NG6 A;  3EQL F;  3G2B A;  2QA4 I;  3BCA A;  2VBZ A;  3L00 A;  1ZG3 A;  4A6E A;  3BZ6 A;  4NDL A;  2G7U A;  2O9L A;  4E7L A;  2EFP A;  2XIG A;  3CP8 A;  3QPH A;  3BCB A;  3RYP A;  3V4G A;  2GOX B;  1P92 A;  4XL9 A;  5EZG A;  3MMY B;  4BDY A;  2MG4 A;  3LSH A;  4KIF A;  4RBO A;  2EZK A;  2HEO A;  2WTE A;  1Y0N A;  4A3F J;  2E2H J;  4AUX A;  2IJL A;  1YE9 A;  1JT0 A;  2LD5 A;  4B4C A;  1VTN C;  2DOA A;  2VC1 A;  2O8K A;  3S15 J;  1ZLK A;  3I59 B;  2V9V A;  5GTH C;  4I6Z A;  1BR1 A;  3O2P E;  2XGX A;  4OWR B;  3KYL A;  4ZDO A;  2HOS A;  2R7Q A;  1D8K A;  3BT9 A;  2BHY A;  1Y6I A;  2CGP A;  1PUF A;  2E5Z A;  2E1N A;  3G1M A;  1D0X A;  2PJR A;  3K1M A;  4KIB A;  1R5H A;  1DGW Y;  3KLO A;  5FRN A;  1TWC J;  2LY2 A;  4S05 A;  2HTS A;  4Y13 A;  2JA8 J;  3FXU A;  3HHG A;  3LA2 A;  4MEY F;  5L3F A;  2O3F A;  2FSW A;  4HDU A;  4A3C J;  4KIG A;  2PG4 A;  2NVX J;  1S5L C;  5KCM A;  3BZC A;  4F55 A;  3EUH A;  1PYV A;  3SYT A;  1U8R A;  1A6I A;  1TWH J;  1WPK A;  1X58 A;  1VQP I;  1Z3Y A;  2G9W A;  3MZ8 A;  4L5E A;  4BQN A;  3K70 D;  2KT0 A;  3DBR B;  2F5V A;  1TW2 A;  4QSH A;  2DLL A;  4GDF A;  2Q2E A;  1P7I A;  4PJM A;  1LDJ A;  3K4M A;  1XMA A;  2B0L A;  3TP3 A;  1VQ7 I;  3KP6 A;  3UR3 C;  4EVI A;  3HRM A;  3BJ6 A;  2BVM A;  4L0Y B;  3T0Y A;  3JRC A;  1ETY A;  1K83 J;  2M87 A;  4BE0 A;  1LNW A;  3D5R C;  1W5C C;  3FBI B;  4KFC A;  5E3L A;  4YIR X;  5L3E A;  2GM4 A;  2LBF A;  1XMX A;  1HDP A;  2L9R A;  1X2M A;  2DMN A;  1J0R A;  2DFI A;  1ZKG A;  3M7G A;  1BI0 A;  3JTG A;  4LMY A;  2CW0 F;  2JUG A;  3HUG A;  4KYW A;  3H9J A;  1R7J A;  1XDU A;  3ZGK A;  4NBQ A;  2O8X A;  3EUH C;  3WGH A;  3L2C A;  3CCM I;  1JHH A;  5E1Z B;  2BW3 B;  2JPC A;  2P8T A;  5DCF A;  3BLY A;  3X2Q H;  4IL6 C;  1LDD A;  1WFX A;  1H88 C;  4A6D A;  2KDZ A;  2RQP A;  1YX3 A;  4PUS A;  3GBG A;  4Z2Y A;  3IWF A;  4HX7 A;  3O8H A;  2WAQ N;  2LMD A;  3GO5 A;  1Z7U A;  3L2Q A;  1O3Q A;  2ZC2 A;  4II2 A;  2ISY A;  4QPO A;  1YTY A;  4OU0 A;  1FWZ A;  1DU0 A;  1YOV B;  1QGP A;  1RI7 A;  3OV8 A;  1FOY A;  1S8N A;  1MGT A;  3WTV C;  2HQ5 A;  3MKW B;  5IOZ A;  1WWX A;  2E35 A;  1YS7 A;  2KP6 A;  3OYD A;  1DPR A;  3CES A;  1F5T A;  2LRD A;  3CCR I;  3QPT A;  1H0M A;  2DDB A;  4LJZ F;  2XAH A;  4XQF A;  2A3S A;  4J19 A;  1SVO A;  4Z6Y A;  3LSR A;  1HCR A;  1XC5 A;  2EV5 A;  1FOW A;  4DNC A;  1N75 A;  2DXI A;  3E5U A;  4IJA A;  3TOA A;  2A6E F;  2WAD A;  2IBD A;  5K1Y A;  4BNC A;  3JSP A;  4PSW A;  3V7C A;  3DEE A;  2QCO A;  2K9Q A;  3OYM A;  1OYY A;  2HYF A;  1Z1D A;  3L7W A;  2PN6 A;  1MMA A;  4YFN F;  4UUS A;  4P55 A;  4I76 A;  5DS9 A;  2DYR H;  3HOV J;  1UAA A;  3L2W A;  3T1B A;  1LB2 A;  2EQR A;  2IA2 A;  3KET A;  4B48 A;  4TV7 A;  4BH9 A;  3I56 I;  5F6F A;  4XK4 A;  4AIH A;  3MWM A;  2RRE A;  1R5I D;  4W1U A;  4UV9 A;  1WCM J;  3LAP A;  3WE3 A;  4MQ9 F;  2O0Y A;  1B72 A;  1GV2 A;  2ZME A;  2M5W A;  1R9T J;  1IN7 A;  2L54 A;  4A3G J;  2WAF A;  5EJC A;  3LQR A;  3LOC A;  3WE2 A;  2E2J J;  4JQF A;  3CC4 I;  2KJB A;  5HLG A;  1CF7 B;  2K9M A;  2IGM A;  3KYD B;  3ZR8 X;  4ENJ A;  3ABL H;  3CJR B;  3ABU A;  3BRO A;  3OMY A;  5CQG A;  1ETX A;  1HW1 A;  1Z7L A;  2KMU A;  5K5O A;  2ZJR F;  2C6Y A;  3BP8 A;  3LSI A;  4AU7 A;  2FQ4 A;  2OZU A;  3N05 A;  4EMS A;  2UZK A;  2M4K A;  4MLO A;  2JTV A;  2DMQ A;  3K2A A;  5TRD A;  3B73 A;  3DKW A;  3HZJ A;  1RPW A;  3QWL A;  4PDK A;  4YFK F;  3WTX C;  2IA1 A;  1H8A C;  3HM5 A;  2VL8 A;  3G1L A;  1FEX A;  2Y31 A;  1JE8 A;  1UST A;  3K4L A;  4GO1 A;  2FF4 A;  1BC7 C;  2JMW A;  1A35 A;  4B47 A;  1I1S A;  2WAQ A;  1VQ4 I;  2H6C A;  1FYM A;  1NTC A; 
#chains in the Genus database with same CATH homology
 1G6N A;  2YR2 A;  3GX4 X;  3GEZ A;  3D0S A;  4ZH4 F;  3EYI A;  4IRI A;  4LLL A;  1MKM A;  5LEJ A;  2HGC A;  3K1N A;  3H3Z A;  1QZZ A;  3ML6 A;  4UVA A;  3TGN A;  2STW A;  3BDD A;  3RI4 A;  2VOD A;  2GA1 A;  2F5D A;  1KU7 A;  3KP5 A;  4L0Z B;  1XGS A;  5E1X A;  1G3S A;  4UHT A;  1T39 A;  5FB2 A;  3BPV A;  4L18 B;  4L9V A;  5BQT A;  2RC4 A;  5J8F A;  4CIC A;  2D45 A;  1CGP A;  1PUE E;  1E17 A;  2ZJ2 A;  4G9Y A;  1Q1H A;  4CHU A;  2DBB A;  3F23 A;  3ERE D;  1FP2 A;  2A5Y B;  4HBL A;  2ETH A;  1WQ2 A;  2XAS A;  1K7A A;  1HW5 A;  2EJR A;  2P5L C;  2TDX A;  4CXF A;  3V8K A;  3JSO A;  4H0E A;  1QBJ A;  2P5K A;  2Z3Y A;  4IHS A;  4CYD A;  4L5J A;  3WTU C;  2M45 A;  5CVU A;  4R8H A;  1STZ A;  4ZYH A;  4Y17 A;  3GYH X;  5CLS A;  1J59 A;  2QUF A;  2XHK A;  2Z99 A;  1YLF A;  4A5M A;  2OD5 A;  4WWC A;  2QEN A;  5LGN A;  1R22 A;  5AIP A;  4ENK A;  3GFL A;  5LHG A;  2OBP A;  3CDH A;  2ACJ A;  2CFX A;  2L3D A;  3L09 A;  3PQK A;  2Y48 A;  2OQR A;  1TBX A;  3ECH A;  4UXN A;  2XAF A;  2ZKZ A;  3ZQ7 A;  2FBI A;  5J6X A;  3M8F A;  3T5X A;  4ESB A;  1R58 A;  4GGG A;  4HV6 A;  3ECO A;  5BPI A;  4EM2 A;  2L4A A;  1IZ1 A;  1KA8 A;  5DD4 A;  5L3D A;  3FXR A;  1KU9 A;  5L3G A;  4G94 A;  4EJT A;  3RIR A;  3GZ5 A;  5CVR A;  4ZYD A;  3W6J B;  1U5T B;  1FBU A;  1R1V A;  1HXD A;  3CTA A;  4FHT A;  1USS A;  3MEX A;  3FWE A;  3LA7 A;  2GXG A;  4OIQ F;  2F5C A;  4KMU X;  4I0B A;  1JXS A;  1ON2 A;  2FU4 A;  1KGS A;  2GQQ A;  1W7P B;  3RTR A;  2V1D A;  1IW7 F;  2YX4 A;  2W84 A;  2PBI A;  1HKT A;  2H09 A;  3CLO A;  2DAO A;  4XSZ F;  3GFI A;  1D3Y A;  2XAQ A;  2HQN A;  1R1T A;  3P7N A;  2D2W A;  4L5I A;  2VE8 A;  1QQI A;  3E6B A;  3KEQ A;  1O3S A;  4JK1 X;  3IWZ A;  3K69 A;  4AVP A;  1XSV A;  2P6T A;  5D5U B;  2GIV A;  2RKH A;  2DPD A;  4RGR A;  3J81 K;  1WI9 A;  2COM A;  3BWG A;  4HW0 A;  3SZP A;  3HRT A;  4P96 A;  1SFU A;  3RKY A;  4YG2 F;  2RNJ A;  2OAZ A;  5DEQ A;  3C18 A;  1CF7 A;  3R60 A;  2HTJ A;  1S7O A;  2XRN A;  3TO7 A;  1GXP A;  1P4X A;  2CSO A;  4IVN A;  3FM3 A;  1IF1 A;  3ELK A;  1TNT A;  2AS5 F;  3WTZ A;  3JW4 A;  1KU2 A;  1HKQ A;  1I27 A;  3U2R A;  4MTE A;  1XCB A;  1YW7 A;  2X0L A;  2ZBK A;  4U0V A;  4HYE A;  2IT0 A;  1R23 A;  3HOS A;  3JAM K;  3QP5 A;  2H6B A;  3CUQ B;  2VN2 A;  5F64 A;  5JHU A;  2JZY A;  2O6G E;  1GHC A;  4WCG A;  4ESJ A;  3VOE A;  5FGM A;  5BPD A;  4ASN A;  5L3B A;  3R4K A;  2EV6 A;  4OIO F;  2DK5 A;  2GAU A;  1FT9 A;  1RIO H;  1ZGJ A;  2W57 A;  1HQC A;  1T6S A;  4M71 A;  2YPR A;  4XLN F;  1FBQ A;  1UHW A;  1JGS A;  2DQL A;  4GYG A;  1ZRC A;  3VB2 A;  2DQR A;  1IRF A;  5H6Q A;  1K79 A;  4ZYG A;  4DQ2 A;  1EH8 A;  1S7A A;  5F1R A;  4N9H A;  2JT1 A;  1OYW A;  2HOE A;  4EM1 A;  2R7F A;  1FZP B;  4IRG A;  3WU0 A;  3F72 A;  4L9J A;  4I2O A;  1LDK B;  1YO5 C;  1K6O A;  2VT2 A;  1DDN A;  4NHJ A;  1SMT A;  2VBX A;  2Y75 A;  4LK0 F;  3K9T A;  3SFZ A;  1IUY A;  4PGG A;  2ESH A;  1LQ1 A;  4I09 A;  5ERI A;  4KMF A;  3HTU A;  3MZH A;  3R61 A;  4UV8 A;  2VE9 A;  1DPU A;  4P5O A;  3RKW A;  3KE2 A;  2QQA A;  4S04 A;  3GFJ A;  2QLZ A;  3QOP A;  3TKY A;  5TJJ A;  1O7L A;  2KIU A;  4CO8 A;  4R79 A;  3V8L A;  5D8L B;  2FOK A;  4E70 A;  3BJO A;  5H6R A;  3R6S A;  2ZNY A;  1ON1 A;  1U5T A;  3IRR A;  2Q0O A;  1R00 A;  3TO9 A;  3VFZ A;  1BN5 A;  2CO5 A;  3E5Q A;  1S6L A;  3IC7 A;  2FEZ A;  1C0W A;  3Q9S A;  4P9U A;  2HFH A;  5D4S A;  1ULY A;  3SXY A;  1W7P A;  2EWN A;  3PFI A;  3QRF F;  3QU6 A;  4M9S A;  1SFE A;  2KIM A;  1RUN A;  4FX0 A;  3RDI A;  1U5T C;  5E17 F;  2FXA A;  4PGH A;  3DFG A;  3VEP A;  2VOO A;  2K27 A;  4EJW A;  1ZRF A;  1HST A;  2F2E A;  5HS8 A;  3F8B A;  2ISZ A;  1GVJ A;  3FX3 A;  2KIF A;  3QP6 A;  2QQB A;  4WXH A;  3N97 A;  4IPA A;  5K5Q A;  3WTS C;  4MTD A;  4ZZL A;  2E1C A;  1ZN2 A;  3GF2 A;  1KQ8 A;  2VC0 A;  1P6R A;  1F4K A;  4ENM A;  4Q4Z F;  1G4D A;  3DXJ F;  4F7Z A;  3FMS A;  2A69 F;  1J7K A;  5KVR A;  5HS7 A;  4G7Z F;  1GXQ A;  1XMK A;  2P6S A;  1U6G A;  3SZT A;  2EA4 A;  1TW3 A;  1I1G A;  4G7H F;  2VOP A;  2PMU A;  2PI0 A;  1XSD A;  1KU3 A;  2E7X A;  3DF8 A;  4HF0 A;  2FMY A;  4BHP A;  3TDU C;  4HOB A;  3U9G A;  5HDG A;  3G73 A;  1HSJ A;  5FLX Z;  5HDK A;  2A6H F;  3CUQ A;  3R0J A;  3TO6 A;  4K2E A;  2XV4 S;  4EQQ A;  2OU2 A;  1UCR A;  3RYR A;  4BQA A;  1RNL A;  2BE5 F;  2P7V B;  1IXR C;  1L0O C;  3GLX A;  1HBX G;  3I71 A;  3T8R A;  4OMY A;  2GXB A;  4HF2 A;  3J81 Z;  2EFQ A;  3I54 A;  4UUV A;  3I4P A;  3HTS B;  1ZG1 A;  1LVA A;  4R1H A;  3CUQ C;  1OMI A;  4KUM A;  4EV0 A;  5D5W B;  1XSX A;  1YIO A;  3IHU A;  4EM0 B;  1XD7 A;  3ISP A;  2ZNZ A;  2UXX A;  3E6M A;  1FSE A;  1ZHF A;  1XDS A;  4RAZ A;  3FHZ A;  1S29 A;  2XAG A;  3V8J A;  1K78 A;  4O5V A;  5AON A;  3WTT C;  2GZW A;  1IN5 A;  3BY6 A;  4M9Z A;  1AOY A;  1T2K A;  4I01 A;  3RKX A;  4AIJ A;  1V3F A;  3EYY A;  1MD0 A;  1Z6T A;  1OKR A;  3HOT A;  1IN4 A;  1NHA A;  3HSR A;  4HLX A;  3I5U A;  2HS5 A;  2D1V A;  2XUB A;  2A61 A;  3JAM Z;  4GXO A;  5DUK A;  3F8F A;  3GZ6 A;  4CZZ A;  3AAF A;  3FM5 A;  3WTY C;  1B6A A;  3M9A A;  2EV0 A;  1LEA A;  1MZB A;  2JSC A;  1YW8 A;  2DW4 A;  4XSX F;  4M74 A;  1PP7 U;  5FO5 A;  5KK1 A;  1BI2 A;  1PDN C;  1V4R A;  3GFM A;  3F8C A;  1DUX C;  2W25 A;  2MD5 A;  1QPM A;  1UFM A;  2MH2 A;  5HLI A;  4HA8 A;  1KQ0 A;  4WF2 A;  3IRQ A;  1SMY F;  2M1B A;  2JPB A;  4Y15 A;  2LKP A;  1FP1 D;  1S3J A;  5DCM B;  5CJ9 A;  1LJ9 A;  2FRH A;  1FOK A;  4KN7 X;  2WWY A;  4OIP F;  3MZY A;  4GYI A;  2PFB A;  3ZMT A;  4BYY A;  1TQP A;  4AWX B;  3N4M A;  2NRA C;  4M72 A;  3TOB A;  4QLC U;  4RB3 C;  2IVM A;  1KYW A;  4EJO A;  2FML A;  3F8N A;  3NEU A;  1QZY A;  2F5F A;  1U3E M;  1ZLJ A;  3M1E A;  2RV8 A;  5D5X B;  2FBH A;  1ZH5 A;  5FLX K;  1FC3 A;  2ZO4 A;  5DV5 A;  2OA4 A;  3L9F A;  4LK1 F;  4EGZ A;  3HIF A;  2P4W A;  1TLH B;  3GXO A;  3HSF A;  3DEU A;  1SD4 A;  4WXC A;  2EFN A;  2J5O A;  2WV0 A;  3IKV A;  4UVC A;  3ZMD A;  4HZF A;  5ILV A;  5FD6 A;  3DP7 A;  5A2Q Z;  4ZYE A;  1E2X A;  4LLN A;  3DPT A;  2AXL A;  2UXN A;  1T0F A;  3HRS A;  5LRS A;  2PQ8 A;  2QQ9 A;  2BV6 A;  2IA0 A;  1I5Z A;  5E8I A;  1B9N A;  3NRV A;  3V7R A;  4PZJ A;  1ZAR A;  5LRR A;  4B09 A;  4YIF A;  2YU3 A;  1J75 A;  1D8J A;  3NQO A;  3FMR A;  4G8X A;  3LAJ A;  1SD6 A;  3MQ0 A;  4UNO A;  5D6F A;  5LBQ A;  3KEO A;  1IAW A;  4WK8 F;  2HKO A;  4G6D A;  1YS6 A;  1P2F A;  3U1D A;  2BYV E;  3FXQ A;  4RAY A;  1Z9C A;  3M8E A;  4HQE A;  5ED4 A;  2VT3 A;  1B59 A;  4XBF A;  2A07 F;  1XB4 A;  3WTW C;  5D4R A;  2DU9 A;  4M73 A;  1X3U A;  2NS0 A;  1YFH A;  1Y0U A;  5LLQ A;  2FA5 A;  1MJA A;  2O03 A;  4MGR A;  4A2U A;  2EB7 A;  3DQV C;  3KZY A;  2QWW A;  5LGT A;  4Q47 A;  2Z33 A;  1FPQ A;  4LB6 B;  2KRF A;  2LF7 A;  4BXU A;  2CQK A;  3PQJ A;  4G7O F;  3G3Z A;  1LEB A;  2DO7 A;  2MBF A;  4HX8 A;  5JVT A;  2R7D A;  4ON0 A;  2EK5 A;  4I7H A;  2Z9O A;  3GUD A;  5ILU A;  1D5V A;  2DI3 A;  5CYV A;  4LG0 B;  3BOQ A;  3ROU A;  2CG4 A;  2HQR A;  3LFK A;  5JI6 A;  5BOX A;  2BGC A;  4RB0 A;  4U7D A;  4BHC A;  5ILS A;  1R36 A;  3KP2 A;  1IN6 A;  3MAJ A;  1MDM B;  1TNS A;  1BC8 C;  1BOA A;  1IXC A;  2RN7 A;  1K78 B;  1ONV A;  2VBY A;  4BAY A;  2X4H A;  3K2Z A;  4WX9 A;  4JBA A;  5BS6 A;  1ZRD A;  3HRU A;  4NQW A;  4KDP A;  1U2W A;  3ULQ B;  3ZPL A;  2D1H A;  2VXZ A;  5CVI A;  2YX7 A;  4IRH A;  3HYI A;  2H27 A;  4HQM A;  3WU1 B;  1ODD A;  1BJA A;  2EA2 A;  5L3C A;  4U0Y A;  2RDP A;  2P5V A;  2KKO A;  1BBY A;  4HF1 A;  3ZMZ A;  2HYG D;  2MC3 A;  5A2Q K;  1F9N A;  3WGG A;  1ZG5 A;  1P4A A;  4HV5 A;  4O6J A;  2K7L A;  4KT5 C;  5DD8 A;  3QAH A;  2M8E A;  4KN4 X;  1TQM A;  3C7J A;  1SD5 A;  1BIB A;  5IT9 K;  1EH6 A;  5D5V B;  3KFW X;  1BI3 A;  1REP C;  1XCV A;  5CVV A;  3BJA A;  1FYK A;  3LWF A;  3F6V A;  3J80 Z;  3KP4 A;  4MQV A;  1BI1 A;  4RGU A;  5D6E A;  5DCM A;  2XVC A;  2XKO A;  4MNU A;  2ELH A;  4U0W A;  5DDG A;  2W85 A;  1G3W A;  2XKP A;  4M6Y A;  1BIA A;  2OZ6 A;  2PEX A;  2HZT A;  1G3T A;  1R5G A;  2DTR A;  3TDZ C;  4OOI A;  3I53 A;  4AIK A;  1WSU A;  2V79 A;  3CO6 C;  4IHT A;  1T38 A;  3RPQ A;  2CYY A;  3K1P A;  2GA2 A;  1L3L A;  1HW2 A;  3GW2 A;  3GVA A;  4XLP F;  2FQ3 A;  1XGO A;  1FLI A;  5FD5 A;  5LHH A;  3R0A A;  2LF8 A;  3GWZ A;  2Y0M A;  2QYO A;  1W5T A;  1W5S A;  3LA3 A;  4LFU A;  3MFK A;  1KYZ A;  1PP8 F;  1Z91 A;  3C1D A;  2MLK A;  3Q5F A;  1O7F A;  4ENN A;  3F6O A;  4LD5 A;  2WC2 A;  4RB1 A;  2M30 A;  2QBY B;  3OOP A;  2QM3 A;  4B8X A;  2L4M A;  5HOO A;  4RGX A;  4FT8 A;  5E8G A;  3WOD F;  5FFZ A;  3P9I A;  4I02 A;  3J7A O;  1WRJ A;  1KQ9 A;  2ZXJ A;  1IRG A;  3B02 A;  4NB5 A;  2LDU A;  2NAZ A;  4P9F A;  3RPU A;  1R1U A;  1RZ4 A;  3P9C A;  5HVQ C;  2ZFW A;  3E5X A;  3CUO A;  3F8M A;  3ZN0 A;  3EET A;  3MCZ A;  5JR3 A;  2FBK A;  4YII A;  4OIR F;  4CDG A;  1AWC A;  1YQA A;  1RUO A;  2Z5U A;  1OYI A;  4KIC A;  3T8T A;  2V1U A;  3E3V A;  5K5R A;  1OR7 A;  4ESF A;  4MHG A;  1FSH A;  1HKS A;  3COA C;  3VOD A;  1ZYR F;  2L01 A;  3LQQ A;  3H92 A;  5ICE A;  2VBW A;  1J5Y A;  4ETS A;  1FBS A;  4G6Q A;  4D0P A;  5FFX A;  2K4B A;  1I6X A;  3CO7 C;  4OIN F;  3DV8 A;  2UWM A;  4A5N A;  1O3R A;  2XAJ A;  2DT5 A;  4L9N A;  3J80 K;  1QO0 D;  3KP7 A;  4LB5 A;  5D8K B;  1W7P D;  1TTY A;  4YFX F;  4LG0 A;  3F21 A;  1BM9 A;  3IKT A;  1IXS B;  1FY7 A;  2PMH A;  1MDM A;  5HDN A;  2RVC A;  3V7S A;  4M9X A;  1XGN A;  1Z05 A;  2STT A;  3TQN A;  3F22 A;  3FF5 A;  5HLH A;  1QNT A;  2OQG A;  2A68 F;  2ESN A;  4KA4 A;  4A0X A;  4Q5S F;  2NNN A;  4HDV A;  2NYX A;  4N0B A;  4AD9 A;  3CJN A;  2LNB A;  4O3M A;  1H9G A;  4I0A A;  1TQI A;  1OPC A;  1WKM A;  3I59 A;  3O6B B;  2BBY A;  4IF4 A;  2K86 A;  2KJC A;  3LST A;  4Q48 A;  2Q8K A;  1SD7 A;  4RGS A;  4WXD A;  3S2W A;  4HAM A;  3ZMS A;  2FE3 A;  2V6C A;  2DK8 A;  3FMQ A;  3HSE A;  2L02 A;  3KCC A;  2IRF G;  1O57 A;  2ADU A;  2RGV A;  3SQN A;  2VON A;  5EEH A;  3C3W A;  5LHI A;  1J9I A;  1JHF A;  1UHM A;  2XRO A;  4GCV A;  1F1Z A;  2MA3 A;  5LGU A;  2HKX A;  3ZMV A;  5HS9 A;  1A04 A;  3ZP5 A;  1EV7 A;  2FNA A;  3KP3 A;  3I0T A;  1Z6R A;  4N9I A;  2IPQ X;  4EJV A;  2BEO A;  4UVB A;  4HLY A;  5E1W A;  4RB2 C;  2R3S A;  2QVO A;  3D5L A;  2EFO A;  3IL2 A;  1G3Y A;  4HX4 A;  2PLY A;  4A12 A;  1IN8 A;  3I58 A;  5CVJ A;  1YG2 A;  3W6K B;  3EDP A;  5H20 A;  3KZZ A;  3SHF A;  1SAX A;  4EJU A;  1MJB A;  4U88 A;  1B9M A;  4U7B A;  1U78 A;  5E18 F;  1FYL A;  3P9K A;  6PAX A;  2P7C B;  2ZCW A;  3Q9V A;  2QZ8 A;  1EH7 A;  4BHB A;  2MH9 A;  5AIQ A;  4M6X A;  5EEG A;  5J8C A;  4IXA A;  2HDC A;  5BMZ A;  4FX4 A;  5ICC A;  1MJ9 A;  3RJP A;  4OMZ A;  2NNY A;  4CGZ A;  4MEX F;  5IT9 Z;  3WGI A;  1B4A A;  2IW5 A;  1H9T A;  3E97 A;  2QBY A;  3FZV A;  3DPL C;  4I98 B;  1O3T A;  2ZME B;  3JTH A;  4L9T A;  1ZRE A;  4QWQ A;  3WG9 A;  5DUI A;  3HHH A;  3BPX A;  1DP7 P;  2DPU A;  3I64 A;  2E7W A;  2GWR A;  4ZZD A;  5IT3 A;  2LSO A;  4KNY A;  2F5E A;  2O61 A;  1XN7 A;  2PJP A;  2JRT A;  2HWV A;  2K4J A;  1SFX A;  5JFR A;  3E6C C;  4XRF A;  5DYM A;  3KLN A;  4PCQ A;  4EGY A;  2MLG A;  5E20 A;  2W24 A;  3QU3 A;  1YYV A;  3ZMU A;  1FX7 A;  4RS8 A;  2H94 A;  1FNN A;  2CWE A;  4LGW A;  3O3K A;  1YW9 A;  1ZAO A;  5ICG A;  1UB9 A;  2HR3 A;  2FNP A;  3ZN1 A;  2IP2 A;  4A0Y A;  1W4M A;  4LLG F;  1B1B A;  5LEK A;  2G7H A;  1P4W A;  2V1X A;  1T98 A;  2YSR A;  1ZGA A;  3E6D A;  3ABT A;  3REO A;  2K02 A;  3K0L A;  4A0Z A;  5ICF A;  2EFW A;  1J2X A;  1XGM A;  2J5P A;  3F3X A;  3H3U A;  3EQL F;  2VBZ A;  3L00 A;  1ZG3 A;  4A6E A;  3BZ6 A;  2G7U A;  2EFP A;  2XIG A;  3QPH A;  3RYP A;  3V4G A;  1P92 A;  4KIF A;  2HEO A;  2WTE A;  2IJL A;  1VTN C;  2VC1 A;  1ZLK A;  3I59 B;  2V9V A;  3O2P E;  2XGX A;  1D8K A;  2CGP A;  2E1N A;  3K1M A;  4KIB A;  1R5H A;  3KLO A;  4S05 A;  2HTS A;  4Y13 A;  3FXU A;  3HHG A;  3LA2 A;  4MEY F;  5L3F A;  2O3F A;  2FSW A;  4HDU A;  4KIG A;  2PG4 A;  3EUH A;  1U8R A;  2G9W A;  1TW2 A;  2DLL A;  2Q2E A;  1LDJ A;  1XMA A;  2B0L A;  3KP6 A;  4EVI A;  3HRM A;  3BJ6 A;  4L0Y B;  3T0Y A;  2M87 A;  1LNW A;  4KFC A;  5L3E A;  1J0R A;  2DFI A;  3M7G A;  1BI0 A;  3JTG A;  4LMY A;  2CW0 F;  4KYW A;  3HUG A;  1R7J A;  1XDU A;  2O8X A;  3WGH A;  3L2C A;  1JHH A;  5E1Z B;  2JPC A;  2P8T A;  5DCF A;  1LDD A;  4A6D A;  2RQP A;  4Z2Y A;  3IWF A;  4HX7 A;  3GO5 A;  1Z7U A;  1O3Q A;  2ISY A;  1YTY A;  4OU0 A;  1FWZ A;  1QGP A;  1RI7 A;  3OV8 A;  1S8N A;  1MGT A;  3WTV C;  1WWX A;  1YS7 A;  1DPR A;  1F5T A;  3QPT A;  1H0M A;  4LJZ F;  2XAH A;  2A3S A;  2EV5 A;  4DNC A;  3E5U A;  4IJA A;  3TOA A;  2A6E F;  5K1Y A;  4BNC A;  3JSP A;  3V7C A;  1OYY A;  2HYF A;  1Z1D A;  4YFN F;  2PN6 A;  3L7W A;  4P55 A;  3T1B A;  1LB2 A;  2IA2 A;  3KET A;  4BH9 A;  4TV7 A;  5F6F A;  4AIH A;  3MWM A;  4UV9 A;  3LAP A;  3WE3 A;  4MQ9 F;  2O0Y A;  2ZME A;  2M5W A;  1IN7 A;  2L54 A;  3LQR A;  3WE2 A;  4JQF A;  2KJB A;  5HLG A;  1CF7 B;  4ENJ A;  3ABU A;  3BRO A;  1HW1 A;  5K5O A;  2C6Y A;  3BP8 A;  2OZU A;  4EMS A;  2UZK A;  2JTV A;  5TRD A;  3B73 A;  3DKW A;  3WTX C;  4PDK A;  4YFK F;  2IA1 A;  1JE8 A;  1UST A;  4GO1 A;  2FF4 A;  1BC7 C;  1I1S A;  2H6C A;  1FYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...