1IF1A

Interferon regulatory factor 1 (irf-1) complex with dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
105
structure length
105
Chain Sequence
RMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of IRF-1 with bound DNA reveals determinants of interferon regulation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords DNA (26-MER)
total genus 17
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1if1A00
3WTTC 1QZZA 2XUBA 3M1EA 4ENJA 1C0WA 2VC0A 1IZ1A 4G6QA 4RB1A 3N4MA 3K69A 1MKMA 2FSWA 3HRTA 1O3SA 1TNSA 1KQ8A 4XLNF 2A07F 1I6XA 2F5DA 1W7PD 2D1VA 4P9UA 3T0YA 4I09A 2P5LC 4RB3C 4ASNA 1ODDA 2STTA 1XMKA 4A6EA 3EYYA 3MQ0A 3P9CA 4KFCA 1D3YA 5HLHA 1FP1D 2LF7A 1LDJA 3K2ZA 2GAUA 3CUQB 1FZPB 2RN7A 2CYYA 5D6EA 2LSOA 5E8IA 3K1MA 2STWA 3BPXA 4OU0A 4EM2A 1XGMA 4LGWA 5D4RA 1FYMA 4H0EA 4DNCA 2W24A 1IW7F 3FMQA 3U9GA 2PI0A 2JPBA 4MNUA 5LHIA 4RB2C 4CYDA 5D5XB 4ZYEA 4CDGA 1T6SA 3E6CC 1IXSB 1H9GA 1FNNA 4HF0A 3M7GA 4E70A 3SQNA 4HX8A 2FBIA 3F6OA 2W85A 3K1PA 3DEUA 3I64A 3ROUA 2GWRA 2ZJ2A 4TV7A 4FT8A 3J7AO 5JR3A 3I58A 1KU9A 2DLLA 3BOQA 1WI9A 1MZBA 3WTZA 1XSXA 2L4MA 4HLYA 4N9IA 5CVRA 4IRIA 1B4AA 5FFZA 4UNOA 3ULQB 3PQJA 3RKWA 2RDPA 3DPTA 5ILUA 2V6CA 4U0WA 5HDNA 1QPMA 5HLGA 2X0LA 2GZWA 1BC7C 5F1RA 3B02A 4G7ZF 1EH8A 1U6GA 4XBFA 3GWZA 4A0XA 4HX7A 3KP3A 2MH2A 5FD5A 3QOPA 4R1HA 3FXUA 4XSXF 1O3RA 4HQEA 2UWMA 3DP7A 1YW9A 3FHZA 1L0OC 3CUQA 3F8MA 4KN4X 3H3UA 2HYFA 1FBQA 3D0SA 2KIUA 3PQKA 1WKMA 3IKTA 3QP5A 4KDPA 5EEGA 2FA5A 1G3YA 2KKOA 4Y17A 5HLIA 3WTVC 1USSA 2H09A 2MH9A 1I27A 1O3QA 1TQMA 3FWEA 4KIGA 5D8LB 3C3WA 3ISPA 3FXRA 2PJPA 4P55A 2GA2A 3KLNA 1R1UA 2WV0A 3VOEA 4RGUA 4O5VA 3K1NA 2VXZA 2QZ8A 2OBPA 5E1XA 4O6JA 5FLXK 1DDNA 2HQNA 3R61A 4I01A 1D8KA 1ON2A 1YTYA 1KA8A 2DFIA 1ZRDA 5FFXA 4HF2A 4BXUA 4KIFA 3ERED 1REPC 1RUNA 5HDKA 1YS6A 3C7JA 1U5TB 1HW5A 1S8NA 4EJUA 3RI4A 1E17A 5ILSA 1IXCA 3TOBA 5FO5A 3WG9A 3P9IA 2RQPA 1F5TA 4N0BA 4GYGA 2IVMA 4G8XA 3SZPA 3CLOA 1QBJA 5DUKA 3KP2A 1RI7A 4BH9A 2DO7A 3EYIA 2HTJA 3CO7C 2NS0A 2W57A 3QAHA 3KETA 4LK1F 2ZNZA 2HTSA 3WODF 3J81Z 1AOYA 4P5OA 5D5WB 1W7PB 3BJOA 4QLCU 3JTHA 1R58A 3HTSB 5DCFA 1MGTA 4IHSA 4S05A 3RJPA 2VT2A 3I59B 5LLQA 2WC2A 3LQQA 1K7AA 2GA1A 3IRQA 2MLKA 5CVVA 1FP2A 2RV8A 1YYVA 1K78B 4YFKF 2Y75A 3Q5FA 1SD7A 2A3SA 1G3SA 4LB5A 4HDVA 3KEOA 4RGRA 2K4JA 3QP6A 3MFKA 1XSVA 3GZ5A 4OOIA 2ZO4A 2NAZA 5E17F 4HLXA 3RPUA 5L3CA 3QPHA 3SXYA 2LDUA 1TW2A 3FF5A 2IW5A 3F8CA 2XRNA 4HQMA 1SFEA 2HS5A 1G4DA 4L9JA 3MWMA 5FGMA 2HKOA 1PUEE 2A68F 1IN4A 3QPTA 1ZH5A 4NB5A 1R7JA 2M8EA 5BS6A 2EA2A 4G94A 2V1UA 2EB7A 3GZ6A 1ZLJA 1ZRFA 5L3EA 1UHWA 2O3FA 1J2XA 1I5ZA 3ML6A 4ETSA 2ISYA 1STZA 5F6FA 4OIPF 4BQAA 4KICA 2KRFA 3HRMA 4GXOA 2DBBA 2R7FA 1FX7A 2K4BA 2J5PA 3BJ6A 2JSCA 2YSRA 4B8XA 1P92A 5E1ZB 1MJAA 5FD6A 1ZGAA 3ABUA 4EJWA 2XROA 3CUOA 4AIHA 3FXQA 4KN7X 1B6AA 5DCMB 2K02A 1RZ4A 5KK1A 3JSOA 4HF1A 4EJOA 3F8BA 2D2WA 1S7OA 2VODA 5FB2A 1XMAA 5E18F 2LNBA 1BJAA 4WF2A 5DYMA 3BP8A 4BHCA 2O6GE 2KIFA 4AVPA 1OYWA 4EM0B 1T98A 2L4AA 5CYVA 3VODA 3VEPA 3F23A 1YIOA 2C6YA 2G7UA 3WTXC 4ENMA 4UHTA 3E97A 5AONA 1SFXA 3T8RA 3GF2A 2V79A 3OOPA 1UHMA 1F9NA 3BY6A 1U8RA 1FSEA 4HAMA 4YG2F 2QLZA 1X3UA 1Z05A 1D8JA 1TBXA 5CJ9A 1BI0A 4PCQA 2L01A 4OIOF 1W5SA 1GXQA 5KVRA 5D6FA 4MQVA 3M8FA 1J59A 3E3VA 3NRVA 1YFHA 1YS7A 1QNTA 3LA7A 2GXBA 2Q8KA 2NNNA 3LAPA 3T5XA 1J7KA 1G3TA 2PMUA 1ZREA 4KA4A 2BV6A 3TGNA 1HW1A 1ZAOA 1MJBA 5DEQA 1KU2A 2HOEA 4NQWA 3L9FA 1ZN2A 5CVUA 5BPDA 2O61A 1O7FA 1WWXA 3F21A 2FNPA 1ZARA 3WGHA 4HV5A 2DK8A 1NHAA 4EQQA 3LAJA 1Y0UA 1SMYF 3KZZA 4A6DA 2VBYA 5HDGA 1P4AA 4Q48A 2FMLA 1MDMB 2JRTA 2CSOA 2E7XA 4CO8A 5ICCA 2DQRA 3E6MA 2QQ9A 4M71A 1P4XA 2AXLA 2H27A 1JGSA 2ZFWA 1YG2A 3IHUA 2EFOA 5F64A 1QQIA 3P7NA 3SFZA 2PMHA 2UZKA 1S7AA 2IPQX 6PAXA 3FMSA 4D0PA 1FWZA 4NHJA 2A6HF 4EVIA 5TRDA 4R79A 2OQRA 1QGPA 3GYHX 5LHHA 4JK1X 1KU3A 1FBSA 1R00A 2HYGD 1I1SA 1Q1HA 4Z2YA 3Q9SA 2XVCA 1GHCA 1K6OA 2Z99A 3KCCA 3F8NA 2P6TA 2PN6A 2P7CB 1IRFA 4I98B 4WXDA 4KYWA 3MEXA 1T39A 1ZG1A 2OQGA 3RYRA 2IRFG 4AWXB 2M45A 3PFIA 4OINF 2BGCA 2Z33A 1Z6TA 2DT5A 4IXAA 4FX4A 4BAYA 2ZKZA 2K86A 2CO5A 1PP8F 5ICFA 4KMUX 3M9AA 3LFKA 3F8FA 4WX9A 3FMRA 3G73A 1CF7A 3F22A 4CGZA 3WE3A 4LLGF 3HHGA 2K7LA 4MGRA 2ESHA 3F3XA 3KP7A 3RPQA 5FLXZ 4LG0A 4Q4ZF 2W25A 1Z6RA 5H20A 4LD5A 4I7HA 2IA0A 2XAJA 1AWCA 3WU0A 2NNYA 2VBWA 1TNTA 3E5UA 2JT1A 1S6LA 3F6VA 4Y15A 4YIFA 2PEXA 4WCGA 4YFNF 2ZMEB 1U5TC 4L9NA 2ZBKA 2GXGA 1HBXG 3O6BB 4HOBA 1B1BA 4M74A 3LWFA 1YW8A 5DD4A 1E2XA 4G7OF 2DW4A 4LLLA 1KQ9A 3CTAA 1BIAA 1BI1A 5HS8A 4LB6B 3GEZA 1I1GA 2XHKA 3I71A 2VT3A 1SD4A 2KJCA 2KJBA 1G3WA 1IUYA 3HTUA 2VN2A 2OU2A 5D5VB 2JTVA 3MAJA 4RB0A 2HWVA 2EFQA 4BHBA 3ECOA 4S04A 3L7WA 3WTWC 1F1ZA 1GXPA 3I0TA 2Q0OA 3ZMZA 2QENA 1SAXA 4LJZF 3WGIA 3WGGA 1RUOA 4LG0B 5LHGA 1XB4A 2VOPA 2HQRA 5IT9Z 1ONVA 4JBAA 2CG4A 1HKQA 4M9SA 4I2OA 2RKHA 2ESNA 5JHUA 2XV4S 1UB9A 3ZP5A 3GO5A 4N9HA 2XAFA 1V3FA 1D5VA 1DP7P 4ZH4F 1U5TA 3R0AA 2VE9A 2WTEA 3MZHA 2VC1A 1QZYA 4WWCA 2YX4A 4LK0F 4XLPF 1XGNA 2DAOA 4A2UA 1G6NA 2G7HA 4U7BA 3V8KA 4ENNA 3KP5A 3R6SA 1O7LA 2P6SA 2EFWA 1USTA 3WU1B 3WTSC 3HOTA 5ICEA 1Z1DA 3W6JB 4B09A 2E1NA 1PDNC 1IN6A 1OPCA 1WQ2A 4ZZDA 1ZG5A 2VOOA 4I0BA 5K5QA 1BI3A 4F7ZA 4EJTA 2ZXJA 2A6EF 2RGVA 1TQIA 1P2FA 1TQPA 1FYKA 2DTRA 1VTNC 4MEXF 2Y0MA 1HSJA 1OKRA 1FBUA 4R8HA 1BM9A 2NYXA 5A2QZ 4LMYA 3ELKA 3TDZC 4RAZA 4XSZF 2IT0A 3TDUC 3KP4A 4IJAA 1L3LA 2CGPA 3QRFF 2FE3A 3ZMVA 2WWYA 2FQ3A 4KMFA 1ZHFA 1H9TA 2H6CA 5BPIA 4UVAA 3GXOA 5EEHA 3ZMSA 4A12A 2V1XA 1JXSA 2XKPA 3M8EA 4GCVA 4UXNA 5LGNA 1KU7A 5TJJA 4HYEA 5L3GA 2DQLA 1XGOA 3IKVA 4M9XA 2D45A 2BE5F 4EJVA 4L0YB 2HR3A 4CICA 3DFGA 1K79A 4UUVA 4AIJA 1BIBA 5CLSA 4Y13A 2V9VA 3WTYC 3RKXA 3RYPA 3ECHA 3V8LA 2GIVA 4LLNA 1HQCA 3I5UA 1KYZA 2FEZA 3EQLF 3E6DA 1W7PA 3TO9A 2UXNA 3JSPA 1LQ1A 2DPDA 3KP6A 3IC7A 5HVQC 5L3FA 4ZYDA 4BNCA 5L3BA 3GFIA 2E7WA 2QQAA 3KZYA 3BDDA 4YIIA 2A69F 3J80K 2X4HA 2QBYB 3HRSA 5LRRA 4GO1A 4CHUA 4WK8F 2DU9A 2Z5UA 4I0AA 1O3TA 4KNYA 1EH6A 2O0YA 1FLIA 5CVIA 3HSFA 1BOAA 5JI6A 1Z9CA 2QVOA 1LDDA 4HBLA 2Q2EA 2ELHA 4M72A 1JE8A 5K1YA 3TO7A 4G9YA 1HXDA 1BC8C 2CFXA 2W84A 2FXAA 2RC4A 4PZJA 2P5VA 3JAMK 3JAMZ 4OMYA 4O3MA 2YR2A 2IJLA 4M6XA 3OV8A 3HHHA 4HX4A 2M5WA 4HA8A 4OMZA 4A5NA 1Z91A 5IT3A 4ENKA 1TTYA 1WSUA 1TW3A 3MZYA 2QWWA 4ESJA 5DV5A 1F4KA 3VB2A 1OYYA 2RNJA 5D4SA 1R5HA 1YQAA 1LB2A 5BQTA 5JVTA 1FY7A 3V8JA 2EFNA 5HOOA 3LA2A 5DDGA 3RTRA 5K5RA 5J6XA 2CW0F 1HSTA 1YLFA 3L09A 1R22A 2A61A 5D8KB 2P5KA 2BBYA 4KUMA 3U1DA 2XKOA 4RGXA 3G3ZA 3BWGA 3ZMUA 3ZMTA 2XASA 4MQ9F 3I53A 4HV6A 4A0ZA 3TKYA 2FRHA 2R3SA 3SZTA 4L5IA 3NQOA 2Y48A 4MEYF 2RVCA 5H6QA 2G9WA 2HDCA 3GFMA 5K5OA 5AIQA 3HSEA 3QU3A 2L02A 1K78A 2B0LA 2AS5F 1BN5A 2EA4A 3O2PE 1Z7UA 2R7DA 4HW0A 3I59A 4HDUA 5J8FA 1UCRA 2ZMEA 1LEAA 3H3ZA 3DPLC 3AAFA 1T0FA 3CO6C 4L0ZB 3EDPA 2VONA 3FM3A 1B9MA 2OAZA 4GYIA 1PP7U 2E1CA 2FMYA 1R23A 3C1DA 1KGSA 2ADUA 3BPVA 3ZN0A 3R4KA 2EK5A 1RNLA 3BROA 3I4PA 1XD7A 2O8XA 5A2QK 3HSRA 2VE8A 4QWQA 2COMA 2IA1A 2MA3A 3GFJA 4UV9A 1FPQA 4EV0A 4ON0A 1UFMA 1OR7A 1U2WA 2PBIA 5BMZA 3F72A 3GFLA 3DF8A 3ZQ7A 1CF7B 1FC3A 3KEQA 4RAYA 1H0MA 2FBKA 1ULYA 5ICGA 3MCZA 1T2KA 3U2RA 3IRRA 3LQRA 2VBZA 2XAHA 3V7SA 3DXJF 4OIQF 5HS9A 3ABTA 1HW2A 3V7CA 5E20A 1S3JA 3E6BA 2EJRA 1IXRC 1P4WA 4CZZA 1OYIA 5JFRA 2IA2A 4U88A 4UVCA 2H6BA 1FYLA 2TDXA 3P9KA 2IP2A 3E5XA 5ED4A 2EV5A 4UVBA 2BYVE 1R1TA 3FX3A 3I54A 1MDMA 1YW7A 4L5JA 3HRUA 5L3DA 5DD8A 5ILVA 3TOAA 1QO0D 4MTEA 2V1DA 3E5QA 1RIOH 4HZFA 4L9VA 4L18B 1R36A 1DPUA 1KQ0A 3D5LA 2NRAC 2JZYA 4Q5SF 4OIRF 2OZUA 2K27A 4EM1A 1DPRA 5ERIA 1P6RA 1J0RA 1GVJA 1HKSA 2QUFA 5AIPA 3J81K 1XGSA 4KT5C 4IVNA 3CJNA 1HKTA 1OMIA 1A04A 3HIFA 4KIBA 1YO5C 1FOKA 3WTUC 4G7HF 1JHFA 2M1BA 1ZYRF 2F5FA 1TLHB 4PGGA 5LGUA 3T8TA 2EFPA 5LEJA 2HZTA 5BOXA 3H92A 4EGZA 2QM3A 3FZVA 2MLGA 2EWNA 3GUDA 1B59A 5IT9K 1LNWA 4G6DA 3N97A 3COAC 2PFBA 4EMSA 3K9TA 4MHGA 2F5EA 1LEBA 3HOSA 1SD5A 2FF4A 2EV6A 4P9FA 1MJ9A 1IN7A 2YU3A 3B73A 4PDKA 3RDIA 3SHFA 3LSTA 2P7VB 2DPUA 2HFHA 1J5YA 3Q9VA 3TQNA 2ACJA 1J9IA 3V4GA 2P4WA 3L2CA 3ZPLA 4IHTA 3RKYA 4A0YA 4ESFA 2OZ6A 4IRGA 2Z9OA 4ZYHA 4BYYA 2XIGA 3REOA 2LF8A 3V7RA 1JHHA 5LEKA 2P8TA 1R1VA 3KFWX 2FU4A 3DQVC 4U7DA 4RGSA 2HKXA 1KYWA 1IAWA 2H94A 4UV8A 5LBQA 1XCVA 2YX7A 3CDHA 1ON1A 4GGGA 2F5CA 2YPRA 2KIMA 2L54A 2LKPA 2UXXA 1J75A 1R5GA 5H6RA 2DK5A 3IWFA 1ZGJA 2M30A 1BI2A 3R60A 2D1HA 4U0YA 2ISZA 2MD5A 1XDUA 3RIRA 4FX0A 2PG4A 3JTGA 1ZRCA 4PGHA 3GX4X 5DCMA 2EV0A 5J8CA 3WE2A 2Z3YA 1EV7A 3BZ6A 3NEUA 3TO6A 4M73A 3R0JA 5LRSA 1LDKB 1IN8A 1XCBA 2GQQA 1O57A 3IWZA 2J5OA 2XAGA 4AD9A 2QYOA 4ESBA 2ETHA 2FBHA 1V4RA 3GW2A 4L9TA 4IRHA 1XDSA 3QU6A 4RS8A 3BJAA 1WRJA 2OA4A 2XAQA 1U78A 2VBXA 2A5YB 3ZMDA 1B9NA 4U0VA 1LJ9A 2QBYA 4JQFA 4IF4A 3HYIA 1XN7A 4MTDA 3EUHA 3GVAA 3S2WA 1DUXC 2PLYA 1IRGA 3KE2A 3L00A 5D5UB 1W4MA 4ZYGA 2CQKA 3W6KB 1T38A 4CXFA 1FSHA 4AIKA 4Q47A 2HGCA 1SD6A 1CGPA 2XGXA 3T1BA 2BEOA 2HEOA 3DKWA 4YFXF 5DUIA 2MBFA 4WXCA 4XRFA 4IPAA 4P96A 3J80Z 4EGYA 3CUQC 4A5MA 1LVAA 2O03A 3KLOA 2ZNYA 1IF1A 2F2EA 1W5TA 3VFZA 2ZCWA 3ZN1A 4BHPA 5E8GA 1EH7A 3FM5A 1ZLKA 1BBYA 3IL2A 4I02A 4M6YA 1SMTA 2DI3A 2M87A 1XSDA 5E1WA 3EETA 1ZG3A 4ZZLA 3O3KA 1MD0A 4LFUA 1FT9A 3DV8A 3HUGA 2JPCA 2L3DA 3C18A 3GLXA 4WXHA 1U3EM 2CWEA 3JW4A 2MC3A 4M9ZA 4DQ2A 2OD5A 2QQBA 1SFUA 2FNAA 1S29A 5CVJA 4K2EA 1IN5A 3LA3A 2PQ8A 5LGTA 5HS7A 4FHTA 3K0LA 2FOKA
chains in the Genus database with same CATH superfamily
3WTTC 3K2AA 5EGOB 1ZELA 1QZZA 3CMAI 2NXNB 2XUBA 3PSIA 2DYRH 4M3GA 3M1EA 4ENJA 1C0WA 3RCOA 2VC0A 1IZ1A 3HOYJ 4G6QA 2E36A 4RB1A 3N4MA 1ETYA 1QHHD 5CQEA 1YHQI 5FKNA 1D1AA 3K69A 1VQ4I 4KT6A 1MKMA 2FSWA 3HRTA 2EZKA 1TNSA 2Z1DA 3BR0A 4BDZA 1O3SA 1KQ8A 4XLNF 2A07F 3ONQA 1I6XA 2Y0SN 2F5DA 1W7PD 3BR3A 2D1VA 2X6XA 4P9UA 3QQAA 1Z3XA 3T0YA 4I09A 4Z6YA 2P5LC 4RB3C 1EJ9A 3HOVJ 4ASNA 1ODDA 4CYCA 5HLTA 5C4XJ 2STTA 1SFKA 1XMKA 4A6EA 3EYYA 4XIDA 3MQ0A 1U9NA 3P9CA 5F0FA 4KFCA 3QOEA 3LOCA 1D3YA 1VQ7I 3F0CA 1WI3A 5HLHA 1FP1D 4XKCA 2LF7A 4PFOA 5EGOA 3J7ZI 1IV8A 2EZIA 1LDJA 3K2ZA 3I9V2 2QKMB 1TWFJ 3TP3A 2GAUA 3OWTA 3CUQB 1FZPB 2RN7A 1ETQA 1FOYA 2K3FA 4HNUA 2CYYA 5D6EA 2LSOA 2CQ7A 5E8IA 3K1MA 4PSWA 3BT9A 2STWA 2NVTJ 3BPXA 3LSGA 4OU0A 4EM2A 3EPZA 4PJJA 2EIMH 3FISA 5IP9J 1XGMA 3FK6A 2EIJH 4BQNA 4LGWA 5D4RA 1FYMA 5C44J 3CDIA 3HUGB 4H0EA 1R4NB 5EF6A 1YJNI 4DNCA 1R71A 2W24A 4H4KC 4BJ6C 1IW7F 3OR1C 3FMQA 3U9GA 1NH3A 2PI0A 2JPBA 1LFUP 3L2VA 1V55H 4MNUA 5LHIA 4RB2C 2XB0X 4XLEA 4CYDA 3S3MA 1RC9A 5D5XB 4II2A 1FIPA 2F48A 4ZYEA 4CDGA 3S2DJ 1T6SA 3E6CC 2O9LA 1IXSB 1H9GA 1FNNA 2L9RA 3ZQFA 3Q0VA 1V54H 4E7HA 3BTJA 4HF0A 3TP0A 3M7GA 4W1UA 4E70A 3SQNA 4HX8A 2FBIA 4DBRA 1OJLA 3F6OA 2W85A 3K1PA 3DEUA 1V5EA 3I64A 3ROUA 1TT5B 2GWRA 2LMDA 2DFEA 2ZJ2A 4JX6A 4TV7A 2R7SA 4ZC3A 2DMTA 2RREA 1E3OC 2BY1A 2VUMJ 3VSLA 4FT8A 4OAYA 3J7AO 3S15J 5JR3A 2TCTA 1DGRM 2EPFA 2DJNA 3I58A 3SZGA 1X3ZB 1KU9A 2DLLA 3BOQA 1WI9A 4XOPA 1LUJB 1TC3C 4DJAA 1MZBA 2HVQA 3WTZA 2CW7A 2XGDA 4Y4RA 1HC8A 2G0EA 1XSXA 2HDDA 2LRDA 1PUFA 2L4MA 4HLYA 4N9IA 2JA8J 4IKFA 1X3WB 3JRGA 4C3IJ 2W4SA 5CVRA 3RSNA 4AYBA 4IRIA 2LVSA 1B4AA 4G6TB 5FFZA 2E71A 4UNOA 3ULQB 3FK7A 5F1JA 2RQQA 3PQJA 2LTPA 3RKWA 3HDDA 2PJRA 4FQGA 2K40A 2RDPA 3DPTA 5ILUA 3PUFA 3H9GA 1X1AA 2V6CA 1OLTA 3CCJI 4U0WA 3WHCA 5FKMA 3LFUA 5HDNA 1QPMA 4F92B 2DN0A 5HLGA 2X0LA 5FLVA 2GZWA 2CQQA 1BC7C 5F1RA 3B02A 1JKOC 1TWGJ 1XX5A 4RLQA 3L2RA 4G7ZF 1EH8A 1U6GA 1RRJA 4XBFA 2WY7Q 3GWZA 4A0XA 4HX7A 1RESA 4E7LA 2DA7A 4RA2A 3KP3A 2VJ5A 3PIPF 3Q3SA 2MH2A 1EKEA 4IQ4A 5FD5A 3QOPA 3AL0C 3FXLA 4R1HA 3OSGA 3FXUA 3QYBA 4XSXF 1EA3A 1O3RA 4HQEA 2R7WA 3K6GA 2UWMA 4N4NB 3DP7A 1YW9A 2XPVA 3FHZA 2O8KA 4XICA 4I6ZA 1L0OC 3CUQA 3F8MA 4KN4X 1XPXA 3H3UA 1R4MB 1MMDA 3DEWA 3ZGKA 4D7NA 1JKPC 1JJ8C 4C2UA 1T56A 2HYFA 1FBQA 3D0SA 1ZQ3P 2KIUA 1MBEA 3PQKA 1WKMA 1HDPA 3IKTA 3QP5A 3CF5F 4KDPA 3JRAA 2KRHA 5EEGA 2FA5A 2M4GA 3W2WA 4FCYA 1G3YA 3H0GJ 2KKOA 4Y17A 5HLIA 1W0TA 3WTVC 2QA4I 1USSA 2H09A 1IC8A 2DA2A 2MH9A 1I27A 2WADA 1O3QA 4M3BA 3L2UA 2E2JJ 1TQMA 4XONA 3AFHA 3FWEA 4KIGA 5D8LB 3C3WA 4YEJA 3ISPA 3FXRA 2PJPA 4P55A 1CQTA 2GA2A 5K7FA 1IDYA 3KLNA 1R1UA 2WV0A 2XB5A 1K61A 3VOEA 4RGUA 4O5VA 3K1NA 3HEFA 2VXZA 2QZ8A 2OBPA 3VSKA 5E1XA 2WB1A 4O6JA 3H5RA 5FLXK 2Y31A 5E3OA 1DDNA 1GT0C 1QZEA 2HQNA 3R61A 1BJZA 1VQ6I 4C30A 4I01A 1IRZA 5TGTA 1D8KA 1ON2A 3G2BA 1YTYA 1KA8A 2DFIA 2ZJPF 5FFXA 1ZRDA 4A69C 4HF2A 1WJ5A 4IEJA 4KIFA 4BXUA 3ZQGA 3ERED 4B48A 1REPC 3ABKH 1PYVA 1RUNA 5HDKA 3FBIB 3MN2A 1YS6A 3C7JA 1U5TB 4XLHA 2V6EA 4KISA 1YX5A 4X0GA 1HW5A 1BW5A 1S8NA 4EJUA 2EH3A 1HCRA 2N8GA 4NBQA 5ILSA 2VQGA 3RI4A 1E17A 2KIQA 1IXCA 1QA6A 2Z16A 3TOBA 5FO5A 3WG9A 3P9IA 2RQPA 1F5TA 4N0BA 4GYGA 4B3AA 3I4NJ 2IVMA 4G8XA 4W97A 3SZPA 4BBRJ 3S1RJ 3KIOA 1B8IA 3CLOA 3BTIA 1YRNB 1QBJA 4V2GA 5DUKA 2CQXA 3KP2A 4BUPA 1OCCH 3HOXJ 1XMXA 1PVEA 2F4MB 2GLOA 3PO2J 1JGGA 1RI7A 4BH9A 2DO7A 4BACA 3EYIA 3SEQA 1XTAA 2HTJA 1ERDA 3S3NA 4PJMA 3VWBA 4IHXA 2DA5A 3CO7C 2MSYA 2NS0A 2KP6A 2RAEA 2VASA 2W57A 3QAHA 2LR8A 1MBGA 3KETA 2MFZA 3CJTB 3EUKL 2HI3A 2KDZA 2HPIA 4LK1F 3BCBA 1WJBA 2ZNZA 1YE9A 2HTSA 3A01B 4CCMA 1X1PA 3WODF 3J81Z 1LKXA 1SVMA 1AOYA 3H5NA 4P5OA 5D5WB 1W7PB 3BJOA 4QLCU 3JTHA 1TT0A 1R58A 3HTSB 3VYUB 1ZTRA 5DCFA 1MGTA 4IHSA 2L7MP 4S05A 4A3KJ 2CW8A 3RJPA 2XRLA 1HLVA 2VT2A 3FXMA 3I59B 5LLQA 2FD5A 2WC2A 3LQQA 3OL3A 1K7AA 4DGWB 2GA1A 3IRQA 2MLKA 5CVVA 1FP2A 2E34A 2WAQN 1QPIA 2RV8A 1YYVA 2Y30A 4XQFA 1K78B 2FQ4A 4RLFA 2VLAA 3H9QA 4HPQA 4BDYA 4YFKF 2ZMEC 2Y75A 3Q5FA 4QIWN 1SD7A 2A3SA 1G3SA 2OJED 3FKIJ 4LB5A 3QODA 4HDVA 3KEOA 4GRIA 5J1UA 4RGRA 2K4JA 3QP6A 4I76A 1ZK8A 3MFKA 2W7NA 1XSVA 3OOUA 1E0EA 3GZ5A 4OOIA 2ZO4A 2NAZA 5E17F 3WU2C 2HZDA 4HLXA 4IQJA 2A5WA 1R6RA 1AKHB 3RPUA 5L3CA 3M1CA 3QPHA 4ZDOA 3C2BA 3KPHA 3SXYA 2LDUA 5F08A 3ZQIA 1TW2A 3FF5A 2IW5A 3F8CA 2CV1A 2V4JC 2XRNA 4HQMA 1SFEA 2HS5A 1G4DA 5GP9A 2JN6A 4L9JA 4PJ0C 3MWMA 2NVXJ 5FGMA 2HKOA 1PUEE 5F27A 1X4OA 3BQYA 2A68F 1IN4A 3FHNA 3GMEA 3DTEA 3VPRA 3QPTA 3OIPA 1ZH5A 1BL0A 4NB5A 1Z67A 1ETXA 1R7JA 2M8EA 1MMNA 5BS6A 1WZ2A 2EA2A 4G94A 2R5ZB 1IUFA 2V1UA 2EB7A 3GZ6A 4X1EA 2LD5A 2HDWA 3GLLA 1T0FC 4BEHA 1A6IA 1ZLJA 1ZRFA 5L3EA 1UHWA 2O3FA 4C2TA 1J2XA 1I5ZA 3ML6A 4ETSA 2X1EA 2ISYA 1STZA 5F6FA 3AL0B 1K4TA 4OIPF 4BQAA 4KICA 2PMZN 3IUOA 2KRFA 4Y33A 3HRMA 1N25A 4GXOA 2ICWG 4MIMA 2DBBA 2R7FA 4XKBA 1FX7A 2K4BA 2J5PA 1WFXA 3BJ6A 4OWRB 1T8IA 2HPMA 2JSCA 3H36A 2WAQA 4HNTA 2YSRA 1ETWA 4B3XA 3OYDA 2B9SA 4B8XA 2HNHA 3EUAA 1P92A 5E1ZB 1MJAA 5FD6A 5DM6F 1ZGAA 1G59A 3PSFA 2ELJA 3PNYA 3ABUA 3GTOJ 4N4OB 4EJWA 2XROA 4GFBA 3CUOA 1JT0A 1TWHJ 4AIHA 1S72I 4E4HA 2HYJA 4CCNA 1TP4A 3QYEA 2K9MA 5FROA 1W1WE 3FXQA 3M4OJ 2YUSA 4ZJZA 4ZTFA 3BG9A 4KN7X 1B6AA 5DCMB 2K02A 1I50J 1RZ4A 2QQ8A 3GTQJ 5KK1A 1XG1A 4JP0A 3JSOA 4EJOA 3F8BA 4HF1A 2D2WA 1S7OA 3LNQA 2VODA 5FB2A 1XMAA 1IDZA 5E18F 1K83J 2LNBA 3BQZA 2E35A 3E1SA 3H0DA 1BJAA 2LK2A 4WF2A 1XS9A 2DT6A 5DYMA 3BP8A 4BHCA 1YI2I 2MGQA 2O6GE 3IH3A 2KIFA 4AVPA 1OYWA 5JLXA 2JA6J 4BKXA 4EM0B 1T98A 2LP0A 2L4AA 5CYVA 3VODA 3VEPA 3F23A 1YIOA 2C6YA 2G7UA 3HL2A 9ANTA 2HU9A 3A02A 2ID3A 3WTXC 2K85A 2WBMA 2Y0SA 4ENMA 2R5YA 2KZGA 4QPOA 4UHTA 3E97A 5AONA 4KITB 2KL4A 1SFXA 3T8RA 3GF2A 1OCRH 1B72B 2V79A 2ECCA 3OOPA 1VQOI 1UHMA 1F9NA 2LH9A 3BY6A 5IP7J 3OS1A 1U8RA 2M4KA 2YS9A 4F52A 1FSEA 4HAMA 1VFCA 4YG2F 4HSTA 2QLZA 1MBJA 1X3UA 4A3FJ 1Z05A 4AUXA 1D8JA 4XL9A 1TBXA 2KMUA 5CJ9A 4F91B 4HEA2 1W36C 1BI0A 4NC8A 2BHZA 4PCQA 2L01A 3L2WA 1W5SA 1GXQA 3HKZN 5D6FA 4MQVA 5KVRA 4OIOF 3M8FA 4B4CA 1N78A 4A3BJ 1J59A 3E3VA 3NRVA 2M7BA 1YFHA 4DYRA 2L7ZA 1YS7A 4FTHA 1QNTA 3LA7A 3K70C 2F6CA 2GXBA 2Q8KA 2NNNA 2Y2ZA 3LAPA 1X2MA 2CUZA 3T5XA 4ZTJA 1J7KA 3IAS2 1G3TA 2VKHA 2PMUA 1ZREA 3SEZA 4KA4A 4DOZA 2BV6A 3TGNA 3HOZJ 2FUG2 2BZTA 3HC7A 1MNEA 1HW1A 1Z77A 1ZAOA 4BQOA 1MJBA 4ITVA 3RZOJ 1OQYA 2M34A 2ZFUA 5DEQA 2X1DA 1QVTA 4DW6A 1KU2A 2HOEA 4NQWA 3KYDB 3L9FA 1Z0XA 3HOUJ 1ZN2A 2WA0A 2H1LA 5CVUA 5BPDA 2O61A 1O7FA 5HODA 1WWXA 3F21A 2K9QA 5E3LA 3OMYA 2FNPA 4IOCF 1H8AC 2CUEA 1ZARA 3WGHA 4HV5A 2DK8A 1NHAA 3ABLH 4IL6C 4EQQA 4BE2A 3LAJA 1Y0UA 1UMQA 3CC7I 2AHQA 3SDBA 1SMYF 1WH5A 4A93J 3KZZA 2LLKA 5IP6A 4A6DA 2VBYA 5HDGA 3OYEA 3BR5A 1NK3P 1QHGA 1JTXA 1P4AA 1BR4A 4Q48A 2FMLA 2DT7B 3A01A 1RPWA 1MDMB 2JRTA 2KZVA 2CSOA 2E7XA 2L9NA 3QYFA 4CO8A 5ICCA 2DQRA 5IPAA 3E6MA 1WJCA 4LG3A 2QQ9A 3A0HC 3IV5A 2LFBA 2HVSA 4M71A 1P4XA 4JOMA 2AXLA 3RQIA 2V9PA 2H27A 2FX0A 1JGSA 4NDLA 2R5YB 4NC6A 1BR1A 4AIDA 1DU6A 4UUTA 2ZFWA 1YG2A 3IHUA 2EFOA 5F64A 2DCEA 1QQIA 2NVYJ 3P7NA 3SFZA 1OCZH 2PMHA 2ME6A 2BHYA 2UZKA 1S7AA 1X4PA 3CJQB 2IPQX 1NG7A 6PAXA 3FMSA 4D0PA 2NVQJ 4DZJA 2XPUA 1YJ9I 1FWZA 5JLWA 4NHJA 2A6HF 3NAUA 4EVIA 3GCMA 5TRDA 4R79A 2QCOA 2OQRA 1ORKA 1QGPA 3GYHX 2QSGX 2BVMA 5LHHA 2DOFA 4JK1X 1DU0A 3BG5A 1KU3A 1FBSA 1R00A 2HYGD 4E7IA 1I1SA 1Q1HA 4Z2YA 3Q9SA 1X1CA 2XVCA 1GHCA 2HXIA 3RZDJ 2V9KA 3ZQLA 2K9SA 1K6OA 4XORA 3H35A 2Z99A 2XDVA 3AG2H 3KCCA 3F8NA 4HG2A 2LY2A 3WHBA 3JRCA 5FKLA 2P6TA 1X58A 1Y8QB 1IRFA 2GOXB 2PN6A 4I98B 2P7CB 5GPCA 4WXDA 5IYCJ 4KYWA 1RR8C 3MEXA 1T39A 1ZG1A 2KFDA 2MC4A 5EG0A 4OAZA 2JJ7A 2OQGA 3RYRA 2IRFG 4RAGA 4XM3A 1JKQC 2KRCA 3DU5A 4PJLA 4AWXB 2AXTC 2M45A 3PFIA 4OINF 4J19A 2BGCA 5LD2C 3K7AJ 1Z6TA 1XC5A 2Z33A 3K4LA 2DT5A 2DYSH 4IXAA 3ZR8X 5KCMA 1YITI 4FX4A 4BAYA 3M07A 2R7TA 1SVOA 2A05A 3OR2C 2ZKZA 2R0QC 1GDTA 2XAUA 2HVRA 2K86A 1D0ZA 2CO5A 1PP8F 4UB6C 2NS8A 5ICFA 4KMUX 1AA7A 3G1OA 3CCQI 3M9AA 4XN0A 2ELKA 3F8FA 3LFKA 4WX9A 3FMRA 3G73A 1CF7A 3F22A 4CGZA 3E0JB 3WE3A 1UELB 4XLCA 4LLGF 5DTDA 2FOWA 1LFBA 3HHGA 1AHDP 2R4GA 2K7LA 4MGRA 2ESHA 1IO2A 3F3XA 1M1EB 3BG7A 3KP7A 4J00A 3RPQA 1WJFA 5FLXZ 4FE4A 4LG0A 2OTJI 3CJRB 1MH4A 4Q4ZF 3ZRGA 4CUGA 2W25A 5F0HA 1A5JA 1Z6RA 5H20A 2PJRB 4LD5A 1VQKI 4I7HA 1G2HA 2IA0A 4MFEA 2XAJA 1AWCA 2QEXI 2L7KA 5GAHJ 3WU0A 2NNYA 2VBWA 1TNTA 3E5UA 2AQEA 2JT1A 1S6LA 3F6VA 4Y15A 4YIFA 2PEXA 5B3SH 2JQ7A 2CRGA 2E1MB 4WCGA 4YELA 2ZMEB 3QWLA 4YFNF 1U5TC 4L9NA 2ZBKA 2GXGA 1J09A 3CDLA 5GADJ 4XRSA 1HBXG 4CSWA 1MBFA 3O6BB 4JX5A 3OYGA 4HOBA 3RKQA 3D1NI 1FJLA 1B1BA 2ECBA 2CUJA 2HQ5A 2XSJC 5J4YA 4M74A 3CLQA 5E3MA 3LWFA 1YW8A 4ZYAA 5DD4A 1D5YA 4CA0A 1E2XA 3K4BA 4G7OF 2XF7A 2DW4A 1JUPA 4LLLA 3A0BC 1KQ9A 3CTAA 1BIAA 2BY0A 1BI1A 3K4KA 2XGEA 1JT6A 3H1CA 4LB6B 5HS8A 3W6VA 1WPKA 1GV5A 3GEZA 1BW6A 4D9JA 4AVZA 1A35A 1I1GA 1MIJA 1LFPA 4B47A 2XHKA 3I71A 2VT3A 1SD4A 2KJCA 3U21A 2KJBA 2R93J 1TWAJ 3SFIA 4DYQA 2VQLA 1BR2A 1S9HA 4DBQA 1G3WA 1IUYA 3HTUA 4LITA 2CH0A 1G8XA 2VN2A 2OU2A 5D5VB 2BY3A 2LY9A 4RMNA 1SEUA 2JTVA 1X2NA 3MAJA 1MMSA 1UG2A 4M6VA 4RB0A 2VPLA 2HWVA 2W48A 2EFQA 3OYMA 2A6TA 2WY8Q 3JRBA 4BHBA 3CMYA 3ECOA 4S04A 3L7WA 4HNVA 3WTWC 1X19A 1F1ZA 1VF9A 3K70D 1D0YA 2DJIA 3CC4I 3LSHA 1GXPA 2CQNA 3I0TA 3OSFA 4PK4A 2Q0OA 1X1DA 3ZMZA 2XF5A 2MD0A 2OCEA 2QENA 1SAXA 4LJZF 3WGIA 3WGGA 1RUOA 2IGOA 2P0WA 4LG0B 5J4VA 4IHYA 5LHGA 3HPGA 1XB4A 2VOPA 2HQRA 1HOMA 5IT9Z 1ONVA 2M7AA 3GBGA 1D1BA 3H3VK 3KZIC 2CG4A 4JBAA 2KLOA 2L9VA 1HKQA 4M9SA 4I2OA 2RKHA 2ESNA 5JHUA 2XV4S 1UB9A 2L9SA 2DFHA 1YRNA 2XGCA 1R49A 1N77A 3JRDA 3ZP5A 1U0JA 3GO5A 4N9HA 3LSKA 3S14J 3H9JA 3GTGJ 1D1CA 2XAFA 1W5CC 3CMMA 3DWLE 5M5XJ 1GV2A 1V3FA 1D5VA 1DP7P 4XRMA 2VKDA 4ZH4F 4RAFA 4HSRA 1U5TA 3R0AA 3X2QH 2VE9A 4QPQA 4BBSJ 2WTEA 3MZHA 2VJ4A 2VC1A 3K4CA 1QZYA 5M3FJ 4WWCA 2YX4A 4LK0F 2HOAA 4XLPF 1XGNA 2BW3B 1IRXA 2K9LA 2DAOA 4A2UA 3GTMJ 1G6NA 2DA1A 2KDOA 5CPRB 1QVUA 1P7JA 2G7HA 4U7BA 2H8WA 2M0CA 3P5JA 3V8KA 4ENNA 3KP5A 4IZZA 1I6HJ 3R6SA 3J7YJ 1O7LA 2P6SA 3QPLA 2EFWA 4DYCA 2R7XA 1USTA 3IAM2 2Y9YA 2M9HA 4BEHB 3WU1B 5HNHA 3WTSC 3CCSI 1VI0A 3L1PA 4A3MJ 3HOTA 5ICEA 2LYCA 1DP3A 1Z1DA 3SJMA 4XRSG 4F93B 2WAFA 4LOCA 3W6JB 3PO3J 4B09A 2E1NA 5CKTA 4A3IJ 1PDNC 5FRNA 1MBHA 2W00A 1ZR2A 1IN6A 1ENHA 1ZKGA 1OPCA 1WQ2A 4A3CJ 3ABMH 4ZZDA 1ZG5A 2VOOA 1I3AA 1A6QA 1Y56A 3DLLF 2IS6A 4I0BA 5K5QA 1BI3A 4F7ZA 4EJTA 2OPTA 2ZXJA 2A6EF 2D5VA 2RGVA 1TQIA 2R7UA 1P2FA 1TQPA 1FYKA 3KEYA 1DQUA 2DOEA 1R5ID 2DTRA 5B66C 1VTNC 4MEXF 2Y0MA 1HSJA 1MW7A 1OKRA 1FBUA 4R8HA 1BM9A 2NYXA 5A2QZ 4LMYA 1KONA 2X85A 4XNFA 1MSFC 2E2IJ 2UV1A 1Y1WJ 3ELKA 3TDZC 3S32A 3BG6A 4RAZA 4XSZF 2IT0A 3DPUA 3B6AA 5GAGJ 2JUCA 5M3MJ 5FLMJ 3TDUC 3H5AA 3KP4A 3QPSA 4IJAA 1ETOA 1L3LA 4MFDA 1YOVB 2CGPA 2GM4A 2K9NA 1BA5A 1MMAA 3OYFA 3QRFF 2FE3A 2PMZA 3ZMVA 2WWYA 2IGKA 4P1WA 2FQ3A 4XLFA 4KMFA 1ZHFA 4CZCA 1H9TA 2K5CA 5BNGA 2CJJA 1QRYA 2H6CA 5BPIA 4UVAA 3GXOA 4E7SA 5EEHA 3ZMSA 4A12A 2V1XA 1APLC 1JXSA 2XKPA 3M8EA 4GCVA 4UXNA 5LGNA 1KU7A 5TJJA 3S93A 4HYEA 5L3GA 2NS7A 2L5QA 2EZLA 1SVLA 2DQLA 3PNTA 1XGOA 3IKVA 4M9XA 1QU3A 2D45A 4NC7A 3PFYA 2BE5F 2E5ZA 1SC7A 3W2VA 4EJVA 1RKWA 4L0YB 2HR3A 4CICA 3OYKA 2JUGA 3DFGA 1K79A 2EQRA 4UUVA 4AIJA 4YRVA 2VL8A 1BIBA 3FDYA 5CLSA 4Y13A 2V9VA 3HGGA 3WTYC 2DMPA 2P81A 3RKXA 1UG0A 3RYPA 3ECHA 3V8LA 4L5EA 1B8IB 2GIVA 4LLNA 4M3FA 4DZPA 3UNGC 1HQCA 3LL7A 5IYBJ 1V5GA 3I5UA 3G4SI 2I8DA 1F43A 1KYZA 3RQ4A 5LFAA 2FEZA 3DKXA 3ESWB 3CP2A 3E6DA 3EQLF 1W7PA 5FRMA 3TO9A 2UXNA 2W1OA 1SANA 1AU7A 2KISA 5FKOA 3S3OA 3C2HA 1VZ0A 3JSPA 1LQ1A 4BE1A 1A36A 2DPDA 2DMNA 2E5NA 3KP6A 4E7JA 3IC7A 5HVQC 5L3FA 2NVUB 2O5RA 4ZYDA 4M3DA 4IX7A 2Z2SB 4BNCA 5EG0B 1NK2P 5L3BA 3GFIA 5KAIC 2E7WA 2QQAA 2VQCA 1VQ9I 3ASOH 3KZYA 3BDDA 3A4CA 1F36A 3CESA 4YIIA 5KHDA 3C2GA 2A69F 3WG7H 3J80K 5TISC 2X4HA 2QBYB 3HRSA 1FTZA 5LRRA 4GO1A 4CHUA 1WGXA 2DU9A 4WK8F 4A3DJ 2Z5UA 5IY5H 2IXSA 4I0AA 2HOSA 1O3TA 4KNYA 1EH6A 2O0YA 4BU2A 5M5WJ 1FLIA 1FTTA 3DTIA 5CVIA 2IGNA 3HSFA 1BOAA 5JI6A 1MH3A 5B1BH 1Z9CA 3MD2A 1UZCA 2WAEA 1BOBA 2QVOA 1LDDA 3O8GA 4HBLA 1FMWA 1UAAA 2Q2EA 3OYHA 2EIKH 2ELHA 2IBDA 4X6AJ 4M72A 1VQ8I 1JE8A 2IEKA 4BXFA 5K1YA 3TO7A 4G9YA 3UR3C 1HXDA 3HB9A 1BC8C 3E7LA 1SFOJ 5EJCA 3KX2A 2GIZA 3LMMA 3CC2I 1EF4A 3I55I 1GUUA 2CFXA 2CU7A 2TRTA 3G1LA 3GTJJ 2W84A 3CCUI 2FXAA 5J40A 1Y6IA 4MLOA 2RC4A 3DLAA 3OL4A 4XK4A 2LREA 3TW7A 4PZJA 1FEXA 3M8JA 4XLAA 4C9YA 2P5VA 1WCMJ 5JHFA 3JAMK 1S7EA 1TL8A 3TMOA 3JAMZ 4OMYA 4O3MA 2YR2A 1WJDA 2IJLA 4M6XA 1UJ8A 3OV8A 3MVPA 3HHHA 2IGMA 3A1YA 4HX4A 3CCLI 2M5WA 2CV0A 4HA8A 4OMZA 2BY2A 4PJNA 3ZCOA 4A5NA 1Z91A 3HM5A 5KNLA 4BGDA 4PFPA 5IT3A 4ENKA 1TTYA 2DA4A 3FXOA 3BZKA 1TW3A 1WSUA 3MZYA 4D5FA 2QWWA 4FASD 3D5RC 4ESJA 2VB6A 2ZB9A 2QKLB 4RDUA 5DV5A 2FJ1A 1F4KA 3VB2A 1OYYA 3BC8A 5J1RA 2H8RA 2RNJA 5D4SA 1R5HA 4CCLA 1YQAA 4AU7A 3OYJA 2LOOA 2DOAA 1LB2A 5BQTA 5JVTA 2M8GX 3CCYA 1OCTC 1LPQA 1FY7A 3JCUC 3PM1A 3V8JA 2EFNA 1OISA 5HOOA 4Y3OA 2DDBA 1D0XA 4G12A 5K7HA 3LA2A 4LIUA 2AO9A 3NWTA 5DDGA 1W0UA 1H89C 1V5FA 2MYSA 3RTRA 2EINH 5K5RA 5J6XA 3TW6A 2CW0F 3NARA 1HSTA 3DTKA 3OS0A 1H88C 1I3QJ 1WH7A 2BXYA 2JVHA 4AM3A 1YLFA 2E1MC 2DODA 1Q1VA 3L09A 1R22A 2A61A 4UUSA 5D8KB 3OYNA 2P5KA 2BBYA 4KUMA 3U1DA 2XKOA 4RGXA 2IS1A 5F04A 5CQGA 3G3ZA 3BWGA 3ZMUA 3ZMTA 2XASA 4MQ9F 3I53A 3OYIA 3KYLA 3LSPA 4HV6A 4A0ZA 1U9OA 3TKYA 4ABZA 4IO9F 3K4NA 2FRHA 1AKHA 1X1BA 3UKGA 2R3SA 2NOJB 3SZTA 3OYLA 4L5IA 4NQWB 3NQOA 2Y48A 2DXIA 4MEYF 1LVKA 2RVCA 5H6QA 2G9WA 2HDCA 4IOAF 4RBOA 2R7RA 3BZCA 2DFFA 3GFMA 3HG9A 5K5OA 5AIQA 3HSEA 3QU3A 1P9QC 3CF2A 4ANJA 1FOWA 2L02A 2WV1A 3U1KA 1YIJI 3SYTA 1K78A 5J47A 2B0LA 2AS5F 1BN5A 2E60A 2EA4A 3O2PE 1Z7UA 2JWTA 4B44A 2R7DA 4A3EJ 4HW0A 3I59A 4HDUA 3S17J 1P7IA 5J8FA 2VKEA 2OC6A 2KQRA 1UCRA 3CP8A 2I5UA 3JREA 2VPRA 2ZMEA 2GXAA 3PL8A 5DS9A 1LEAA 4JX4A 3HZJA 1VQNI 3H3ZA 2I10A 3DPLC 2IS2A 3AAFA 1T0FA 1E3HA 5JVGF 2ZSHB 5C4JJ 3CO6C 2LY1A 4L0ZB 3EDPA 3AG4H 2VONA 1K6YA 3FM3A 4UUSB 3LSMA 1B9MA 2OAZA 4GYIA 1PP7U 3JRFA 2E1CA 2FMYA 3DBRB 1R23A 4RM2A 3C1DA 1KGSA 4A3GJ 2ADUA 3BPVA 3ZN0A 1B72A 3HJEA 3R4KA 4CCKA 4JYKA 2EK5A 1RNLA 3BROA 3I4PA 1XD7A 2O8XA 2DMQA 2OUMA 2ZC2A 5E79C 5A2QK 1WVRA 2CUFA 3GZNB 3HSRA 2VE8A 4QWQA 2COMA 2IA1A 2MA3A 1VQMI 3GFJA 3BCAA 4BY1J 4UV9A 1FPQA 4ON0A 4EV0A 1UFMA 1OR7A 1U2WA 3CCMI 1Y39A 2PBIA 5BMZA 3F72A 3S16J 3GFLA 4B43A 3G1MA 3DF8A 3ZQ7A 1CF7B 2BW3A 2E1OA 1FC3A 4V19K 3KEQA 4LIVA 4RAYA 5FJ8J 1RKTA 1H0MA 2FBKA 2R7QA 2VIXA 1ULYA 5ICGA 3LSJA 3GTKJ 1Z21A 3MCZA 3ZQQA 5EEAA 1T2KA 5DM7F 3CMEI 3U2RA 4AYBN 4HRIA 5HNFA 2CFOA 3IRRA 2F4OB 3LQRA 2VBZA 5J1YA 1VNDA 3S1QJ 5IOZA 3ASNH 2XAHA 3V7SA 3DXJF 1GLNA 3L2QA 4OIQF 5HS9A 3ABTA 3V7CA 1HW2A 5E20A 1S3JA 3E6BA 4MO7A 4QTRA 2EJRA 1IXRC 1P4WA 3Q0WA 4CZZA 2H1KA 2IS4A 1OYIA 1T95A 5JFRA 2IA2A 3AG3H 4U88A 1OFCX 4UVCA 2H6BA 1DGWY 1FYLA 2TDXA 2JA5J 4AC0A 3AKZA 1PJRA 3P9KA 2IP2A 2X51A 3BR2A 3E5XA 3IH2A 5ED4A 4C3HJ 5KAFC 2XSDC 3IP4B 2EV5A 4UVBA 2BYVE 1R1TA 3FX3A 3M3YJ 4YIRX 1ACIA 2W82A 3I54A 1MDMA 1YW7A 4L5JA 3ZQHA 3HRUA 5L3DA 5DD8A 2Q2EB 1IG7A 3HOWJ 3LSRA 5ILVA 3TOAA 3CD6I 1QO0D 3OS2A 4MTEA 2V1DA 3E5QA 1RIOH 3VYRB 3JRIA 4HZFA 3MKWB 4L9VA 3OYAA 2JA7J 1MSEC 3PUBA 1R36A 4L18B 1DPUA 1N75A 1KQ0A 3D5LA 4J01A 2NRAC 2JZYA 4Q5SF 4OIRF 2ZJRF 3W2AA 2ID6A 2ZXIA 2KPMA 3FXKA 2OZUA 2V26A 2K27A 4E7KA 4EM1A 1DPRA 5ERIA 1P6RA 1J0RA 1GVJA 2HXOA 4V2FA 1HKSA 3BLYA 2DMUA 2QUFA 3BTLA 4XKWA 1XGSA 5AIPA 4KT5C 3J81K 4IVNA 1WJEA 3Q0UA 3CJNA 5IYDJ 1OMIA 1HKTA 1A04A 2MABA 3HIFA 2ZJQF 2R7OA 3TBIA 5IOYA 1ITYA 4KIBA 1YO5C 1FOKA 2CMPA 3FIWA 1MNDA 3D5SC 4F55A 3WTUC 2QF7A 3HGYA 4G7HF 3GTPJ 1JHFA 1FIAA 2M1BA 1ZYRF 2F5FA 1TLHB 2DDAA 4PGGA 5LGUA 3T8TA 2EFPA 4DIQA 3NWSA 5LEJA 2HZTA 2DA6A 2EZHA 5BOXA 2OCCH 1RETA 3H92A 2QM3A 3I3LA 4EGZA 2X9DA 2BVLA 4EEFG 3FZVA 2MLGA 3OYBA 2EWNA 2LKXA 1IGNA 2NOGA 4UB8C 3GUDA 3MKZA 2K3PA 3MMYB 3OIQA 1B59A 1JUMA 3B6CA 5IT9K 2CV2A 1ETKA 3TL4X 3HXLA 1LNWA 3I4MJ 1UHSA 4G6DA 3N97A 1LE8B 3COAC 4D5CA 2PFBA 2LKSA 3S1NJ 4PSXA 2VJIA 3FBNB 4GDFA 4EMSA 3JRHA 2GOMA 3K9TA 4MHGA 4BY7J 1MMGA 3DBLB 4D7MA 2F5EA 1LEBA 3HOSA 1SD5A 2FF4A 1LE8A 2B63J 1K4SA 2COBA 2EV6A 3S2HJ 2R7ZJ 4ZDPA 5K7ZA 4BL0B 4NNJA 5GAEJ 4P9FA 1MJ9A 1IN7A 2YU3A 2EILH 3B73A 4PDKA 3RDIA 3SHFA 3LSTA 3VYTB 2JRMA 2P7VB 2HFHA 2DPUA 1J5YA 5C3EJ 3Q9VA 3TQNA 1YJWI 2ACJA 1J9IA 3V4GA 2P4WA 2L2OA 4BJTA 3L2CA 2JVGA 3ZPLA 4IHTA 3RKYA 4A0YA 4CCJA 4ESFA 2OZ6A 1KZHA 1GVDA 4IRGA 2Z9OA 4ZYHA 4BYYA 2XIGA 2QGUA 2VKVA 3REOA 2LF8A 3V7RA 2JA2A 1JHHA 4XN3A 2P8TA 3K4MA 5LEKA 2XC7A 1RR7A 4BXXJ 1R1VA 3KFWX 2FU4A 3DQVC 1W36D 4U7DA 2HKXA 1KYWA 4RGSA 1IAWA 5M5YJ 1OCOH 2H94A 2O7OA 3DEEA 4UV8A 5LBQA 2XPWA 1XCVA 2YX7A 3CDHA 1ON1A 1VQLI 2M0MA 4GGGA 2CS3A 3RPUD 2F5CA 2YPRA 1O4XA 2KIMA 3DU6A 2L54A 2LKPA 2UXXA 3DBHB 1R5GA 5EZHA 5H6RA 1J75A 2DK5A 2Y9ZA 3K10A 3IWFA 1ZGJA 2M30A 3OY9A 1BI2A 4A3JJ 3R60A 5GPAA 3ZXSA 1ETVA 2KT0A 2D1HA 4U0YA 3OYCA 2ISZA 2MD5A 3DKYA 5GTIC 4QSHA 1XDUA 2DTZA 1NG6A 3RIRA 2QSFX 4FX0A 2Q1ZB 2PG4A 5EDNA 3OIOA 3JTGA 2RNGA 2X1CA 1ZRCA 2V1NA 3G71I 2HOTA 4PGHA 3FXJA 3GX4X 3W3CA 5DCMA 3HBLA 2EV0A 1FMVA 5J3LA 1POGA 2F5VA 4BS9A 5FKKA 5J8CA 2KHMA 3WE2A 2Z3YA 4CCOA 2E2HJ 2DA3A 2VJJA 1EV7A 2M2EA 3BZ6A 4C3JJ 3CCEI 3NEUA 3TO6A 1JJ6C 3HKZA 3O8HA 3MKYB 2V7FA 1JTYA 2F4IA 2PX9A 4M73A 4BJ5C 3R0JA 2R5ZA 1Y8RB 5LRSA 3BR1A 1A31A 1LDKB 1IN8A 1Y1VJ 3ERMA 5E3NA 4CYCB 2OTLI 2ZSIB 1HF0A 2YU9J 1XCBA 1T33A 2X6OA 3DCFA 2GQQA 1O57A 3IWZA 2J5OA 2L7FP 3JR9A 1JKRC 2B7EA 2XAGA 4AD9A 3CZ6A 2QYOA 4II3A 3CQZJ 1MBKA 2ETHA 4ESBA 3PIOF 4FETA 2FBHA 1V4RA 3GW2A 3G6EI 2QSHX 2ME0A 3HPHA 4L9TA 4IRHA 1XDSA 3ZQCA 3F9KA 2E19A 2EBIA 3BJAA 3QU6A 1WRJA 2OA4A 2VI6A 2XAQA 4FISA 4RS8A 5H2FC 1ZR4A 3PJRA 1U78A 3VYSB 4ZDLA 2MG4A 2VBXA 4S0HB 2R7VA 1Z3YA 4XKVA 2VXDA 2A5YB 3ZMDA 1VQ5I 1B9NA 4U0VA 1LJ9A 2JSPA 2QBYA 3TEDA 4JQFA 4IF4A 1I39A 3HYIA 1XN7A 1Y0NA 4MTDA 4E6KG 3EUHA 3GVAA 3MKLA 3S2WA 1IJWC 1DUXC 1MNMC 2PLYA 5F0CA 1IRGA 4C2MJ 3MZ8A 3V42A 3IH4A 3KE2A 5EYRA 3L00A 2AQFA 2OV7A 2LC2A 3SDGA 4EATA 5D5UB 1R9TJ 3KYCB 4IHWA 1W4MA 4NUBA 1WJAA 3A2KA 4ZYGA 2JMWA 2CQKA 1SAUA 3W6KB 2Y69H 1T38A 4CXFA 1FSHA 3VDXA 4AIKA 4Q47A 4CH7A 2HGCA 1SD6A 2LBFB 4F3QA 3PNVA 1CGPA 3AG1H 2XGXA 4BQQA 3T1BA 2BEOA 4E7ZA 4A3LJ 1VQPI 1OCPA 3DKWA 2HEOA 4YFXF 3FKJA 1ZGWA 5DUIA 2MBFA 2WB1N 4WXCA 4FE7A 2X48A 1TWCJ 4XRFA 3N05A 2XF6A 5B1AH 4IPAA 4Y52J 4P96A 3J80Z 4EGYA 3CUQC 4I99C 4A5MA 1LVAA 1TZLA 2O03A 4PUSA 3KLOA 1IV6A 2ZNYA 1Z7LA 1IF1A 2F2EA 4D1QA 3J7AY 4XOTA 2X6WA 1OR7C 3S1MJ 4XMYA 1W5TA 3VFZA 5GTHC 2OF7A 2ZCWA 4KJZA 1S5LC 1JUSA 3ZN1A 2ZXHA 5E8GA 4BHPA 1HA8A 1NTCA 2MW8A 2BOLA 2UUZA 4RM3A 2IAIA 1HDDC 4B1RA 3K4JA 1EH7A 2VQHA 3FM5A 2ZXWH 1ZLKA 1BBYA 3IL2A 4I02A 2R92J 4M6YA 1SMTA 2DI3A 2M87A 1XSDA 5E1WA 1PUFB 3EETA 1ZG3A 4UY8I 4ZZLA 3O3KA 1MD0A 3A03A 4LFUA 1FT9A 3DV8A 2BXZA 3CCVI 5EZGA 3HUGA 2JPCA 2L3DA 3C18A 2M3AA 3GLXA 1E3PA 2LBFA 4WXHA 1U3EM 3GTLJ 4BE0A 3BR6A 2HQAA 2CWEA 5B5EC 2LG4A 2X6YA 1JI8A 3JW4A 2MC3A 4M9ZA 3S8PA 3I56I 4DQ2A 1FOXA 4U87A 4IHVA 4Y7NJ 3BTCA 2OD5A 2QQBA 1SFUA 2JK3A 2L0KA 2FNAA 1S29A 5CVJA 2GBYA 4M3EA 3EUHC 1YX3A 3BG3A 3ZOBA 4K2EA 3CCRI 3LSIA 1IN5A 3LA3A 2PQ8A 5LGTA 5HS7A 1WHUA 1U8BA 1T08B 4FHTA 4XR6A 3K0LA 2FOKA
chains in the Genus database with same CATH topology
3WTTC 1QZZA 2XUBA 3M1EA 4ENJA 1C0WA 2VC0A 1IZ1A 4G6QA 4RB1A 3N4MA 3K69A 1MKMA 2FSWA 3HRTA 1O3SA 1TNSA 1KQ8A 4XLNF 2A07F 1I6XA 2F5DA 1W7PD 2D1VA 4P9UA 3T0YA 4I09A 2P5LC 4RB3C 4ASNA 1ODDA 2STTA 1XMKA 4A6EA 3EYYA 3MQ0A 3P9CA 4KFCA 1D3YA 5HLHA 1FP1D 2LF7A 1LDJA 3K2ZA 2GAUA 3CUQB 1FZPB 2RN7A 2CYYA 5D6EA 2LSOA 5E8IA 3K1MA 2STWA 3BPXA 4OU0A 4EM2A 1XGMA 4LGWA 5D4RA 1FYMA 4H0EA 4DNCA 2W24A 1IW7F 3FMQA 3U9GA 2PI0A 2JPBA 4MNUA 5LHIA 4RB2C 4CYDA 5D5XB 4ZYEA 4CDGA 1T6SA 3E6CC 1IXSB 1H9GA 1FNNA 4HF0A 3M7GA 4E70A 3SQNA 4HX8A 2FBIA 3F6OA 2W85A 3K1PA 3DEUA 3I64A 3ROUA 2GWRA 2ZJ2A 4TV7A 4FT8A 3J7AO 5JR3A 3I58A 1KU9A 2DLLA 3BOQA 1WI9A 1MZBA 3WTZA 1XSXA 2L4MA 4HLYA 4N9IA 5CVRA 4IRIA 1B4AA 5FFZA 4UNOA 3ULQB 3PQJA 3RKWA 2RDPA 3DPTA 5ILUA 2V6CA 4U0WA 5HDNA 1QPMA 5HLGA 2X0LA 2GZWA 1BC7C 5F1RA 3B02A 4G7ZF 1EH8A 1U6GA 4XBFA 3GWZA 4A0XA 4HX7A 3KP3A 2MH2A 5FD5A 3QOPA 4R1HA 3FXUA 4XSXF 1O3RA 4HQEA 2UWMA 3DP7A 1YW9A 3FHZA 1L0OC 3CUQA 3F8MA 4KN4X 3H3UA 2HYFA 1FBQA 3D0SA 2KIUA 3PQKA 1WKMA 3IKTA 3QP5A 4KDPA 5EEGA 2FA5A 1G3YA 2KKOA 4Y17A 5HLIA 3WTVC 1USSA 2H09A 2MH9A 1I27A 1O3QA 1TQMA 3FWEA 4KIGA 5D8LB 3C3WA 3ISPA 3FXRA 2PJPA 4P55A 2GA2A 3KLNA 1R1UA 2WV0A 3VOEA 4RGUA 4O5VA 3K1NA 2VXZA 2QZ8A 2OBPA 5E1XA 4O6JA 5FLXK 1DDNA 2HQNA 3R61A 4I01A 1D8KA 1ON2A 1YTYA 1KA8A 2DFIA 1ZRDA 5FFXA 4HF2A 4BXUA 4KIFA 3ERED 1REPC 1RUNA 5HDKA 1YS6A 3C7JA 1U5TB 1HW5A 1S8NA 4EJUA 3RI4A 1E17A 5ILSA 1IXCA 3TOBA 5FO5A 3WG9A 3P9IA 2RQPA 1F5TA 4N0BA 4GYGA 2IVMA 4G8XA 3SZPA 3CLOA 1QBJA 5DUKA 3KP2A 1RI7A 4BH9A 2DO7A 3EYIA 2HTJA 3CO7C 2NS0A 2W57A 3QAHA 3KETA 4LK1F 2ZNZA 2HTSA 3WODF 3J81Z 1AOYA 4P5OA 5D5WB 1W7PB 3BJOA 4QLCU 3JTHA 1R58A 3HTSB 5DCFA 1MGTA 4IHSA 4S05A 3RJPA 2VT2A 3I59B 5LLQA 2WC2A 3LQQA 1K7AA 2GA1A 3IRQA 2MLKA 5CVVA 1FP2A 2RV8A 1YYVA 1K78B 4YFKF 2Y75A 3Q5FA 1SD7A 2A3SA 1G3SA 4LB5A 4HDVA 3KEOA 4RGRA 2K4JA 3QP6A 3MFKA 1XSVA 3GZ5A 4OOIA 2ZO4A 2NAZA 5E17F 4HLXA 3RPUA 5L3CA 3QPHA 3SXYA 2LDUA 1TW2A 3FF5A 2IW5A 3F8CA 2XRNA 4HQMA 1SFEA 2HS5A 1G4DA 4L9JA 3MWMA 5FGMA 2HKOA 1PUEE 2A68F 1IN4A 3QPTA 1ZH5A 4NB5A 1R7JA 2M8EA 5BS6A 2EA2A 4G94A 2V1UA 2EB7A 3GZ6A 1ZLJA 1ZRFA 5L3EA 1UHWA 2O3FA 1J2XA 1I5ZA 3ML6A 4ETSA 2ISYA 1STZA 5F6FA 4OIPF 4BQAA 4KICA 2KRFA 3HRMA 4GXOA 2DBBA 2R7FA 1FX7A 2K4BA 2J5PA 3BJ6A 2JSCA 2YSRA 4B8XA 1P92A 5E1ZB 1MJAA 5FD6A 1ZGAA 3ABUA 4EJWA 2XROA 3CUOA 4AIHA 3FXQA 4KN7X 1B6AA 5DCMB 2K02A 1RZ4A 5KK1A 3JSOA 4HF1A 4EJOA 3F8BA 2D2WA 1S7OA 2VODA 5FB2A 1XMAA 5E18F 2LNBA 1BJAA 4WF2A 5DYMA 3BP8A 4BHCA 2O6GE 2KIFA 4AVPA 1OYWA 4EM0B 1T98A 2L4AA 5CYVA 3VODA 3VEPA 3F23A 1YIOA 2C6YA 2G7UA 3WTXC 4ENMA 4UHTA 3E97A 5AONA 1SFXA 3T8RA 3GF2A 2V79A 3OOPA 1UHMA 1F9NA 3BY6A 1U8RA 1FSEA 4HAMA 4YG2F 2QLZA 1X3UA 1Z05A 1D8JA 1TBXA 5CJ9A 1BI0A 4PCQA 2L01A 4OIOF 1W5SA 1GXQA 5KVRA 5D6FA 4MQVA 3M8FA 1J59A 3E3VA 3NRVA 1YFHA 1YS7A 1QNTA 3LA7A 2GXBA 2Q8KA 2NNNA 3LAPA 3T5XA 1J7KA 1G3TA 2PMUA 1ZREA 4KA4A 2BV6A 3TGNA 1HW1A 1ZAOA 1MJBA 5DEQA 1KU2A 2HOEA 4NQWA 3L9FA 1ZN2A 5CVUA 5BPDA 2O61A 1O7FA 1WWXA 3F21A 2FNPA 1ZARA 3WGHA 4HV5A 2DK8A 1NHAA 4EQQA 3LAJA 1Y0UA 1SMYF 3KZZA 4A6DA 2VBYA 5HDGA 1P4AA 4Q48A 2FMLA 1MDMB 2JRTA 2CSOA 2E7XA 4CO8A 5ICCA 2DQRA 3E6MA 2QQ9A 4M71A 1P4XA 2AXLA 2H27A 1JGSA 2ZFWA 1YG2A 3IHUA 2EFOA 5F64A 1QQIA 3P7NA 3SFZA 2PMHA 2UZKA 1S7AA 2IPQX 6PAXA 3FMSA 4D0PA 1FWZA 4NHJA 2A6HF 4EVIA 5TRDA 4R79A 2OQRA 1QGPA 3GYHX 5LHHA 4JK1X 1KU3A 1FBSA 1R00A 2HYGD 1I1SA 1Q1HA 4Z2YA 3Q9SA 2XVCA 1GHCA 1K6OA 2Z99A 3KCCA 3F8NA 2P6TA 2PN6A 2P7CB 1IRFA 4I98B 4WXDA 4KYWA 3MEXA 1T39A 1ZG1A 2OQGA 3RYRA 2IRFG 4AWXB 2M45A 3PFIA 4OINF 2BGCA 2Z33A 1Z6TA 2DT5A 4IXAA 4FX4A 4BAYA 2ZKZA 2K86A 2CO5A 1PP8F 5ICFA 4KMUX 3M9AA 3LFKA 3F8FA 4WX9A 3FMRA 3G73A 1CF7A 3F22A 4CGZA 3WE3A 4LLGF 3HHGA 2K7LA 4MGRA 2ESHA 3F3XA 3KP7A 3RPQA 5FLXZ 4LG0A 4Q4ZF 2W25A 1Z6RA 5H20A 4LD5A 4I7HA 2IA0A 2XAJA 1AWCA 3WU0A 2NNYA 2VBWA 1TNTA 3E5UA 2JT1A 1S6LA 3F6VA 4Y15A 4YIFA 2PEXA 4WCGA 4YFNF 2ZMEB 1U5TC 4L9NA 2ZBKA 2GXGA 1HBXG 3O6BB 4HOBA 1B1BA 4M74A 3LWFA 1YW8A 5DD4A 1E2XA 4G7OF 2DW4A 4LLLA 1KQ9A 3CTAA 1BIAA 1BI1A 5HS8A 4LB6B 3GEZA 1I1GA 2XHKA 3I71A 2VT3A 1SD4A 2KJCA 2KJBA 1G3WA 1IUYA 3HTUA 2VN2A 2OU2A 5D5VB 2JTVA 3MAJA 4RB0A 2HWVA 2EFQA 4BHBA 3ECOA 4S04A 3L7WA 3WTWC 1F1ZA 1GXPA 3I0TA 2Q0OA 3ZMZA 2QENA 1SAXA 4LJZF 3WGIA 3WGGA 1RUOA 4LG0B 5LHGA 1XB4A 2VOPA 2HQRA 5IT9Z 1ONVA 4JBAA 2CG4A 1HKQA 4M9SA 4I2OA 2RKHA 2ESNA 5JHUA 2XV4S 1UB9A 3ZP5A 3GO5A 4N9HA 2XAFA 1V3FA 1D5VA 1DP7P 4ZH4F 1U5TA 3R0AA 2VE9A 2WTEA 3MZHA 2VC1A 1QZYA 4WWCA 2YX4A 4LK0F 4XLPF 1XGNA 2DAOA 4A2UA 1G6NA 2G7HA 4U7BA 3V8KA 4ENNA 3KP5A 3R6SA 1O7LA 2P6SA 2EFWA 1USTA 3WU1B 3WTSC 3HOTA 5ICEA 1Z1DA 3W6JB 4B09A 2E1NA 1PDNC 1IN6A 1OPCA 1WQ2A 4ZZDA 1ZG5A 2VOOA 4I0BA 5K5QA 1BI3A 4F7ZA 4EJTA 2ZXJA 2A6EF 2RGVA 1TQIA 1P2FA 1TQPA 1FYKA 2DTRA 1VTNC 4MEXF 2Y0MA 1HSJA 1OKRA 1FBUA 4R8HA 1BM9A 2NYXA 5A2QZ 4LMYA 3ELKA 3TDZC 4RAZA 4XSZF 2IT0A 3TDUC 3KP4A 4IJAA 1L3LA 2CGPA 3QRFF 2FE3A 3ZMVA 2WWYA 2FQ3A 4KMFA 1ZHFA 1H9TA 2H6CA 5BPIA 4UVAA 3GXOA 5EEHA 3ZMSA 4A12A 2V1XA 1JXSA 2XKPA 3M8EA 4GCVA 4UXNA 5LGNA 1KU7A 5TJJA 4HYEA 5L3GA 2DQLA 1XGOA 3IKVA 4M9XA 2D45A 2BE5F 4EJVA 4L0YB 2HR3A 4CICA 3DFGA 1K79A 4UUVA 4AIJA 1BIBA 5CLSA 4Y13A 2V9VA 3WTYC 3RKXA 3RYPA 3ECHA 3V8LA 2GIVA 4LLNA 1HQCA 3I5UA 1KYZA 2FEZA 3EQLF 3E6DA 1W7PA 3TO9A 2UXNA 3JSPA 1LQ1A 2DPDA 3KP6A 3IC7A 5HVQC 5L3FA 4ZYDA 4BNCA 5L3BA 3GFIA 2E7WA 2QQAA 3KZYA 3BDDA 4YIIA 2A69F 3J80K 2X4HA 2QBYB 3HRSA 5LRRA 4GO1A 4CHUA 4WK8F 2DU9A 2Z5UA 4I0AA 1O3TA 4KNYA 1EH6A 2O0YA 1FLIA 5CVIA 3HSFA 1BOAA 5JI6A 1Z9CA 2QVOA 1LDDA 4HBLA 2Q2EA 2ELHA 4M72A 1JE8A 5K1YA 3TO7A 4G9YA 1HXDA 1BC8C 2CFXA 2W84A 2FXAA 2RC4A 4PZJA 2P5VA 3JAMK 3JAMZ 4OMYA 4O3MA 2YR2A 2IJLA 4M6XA 3OV8A 3HHHA 4HX4A 2M5WA 4HA8A 4OMZA 4A5NA 1Z91A 5IT3A 4ENKA 1TTYA 1WSUA 1TW3A 3MZYA 2QWWA 4ESJA 5DV5A 1F4KA 3VB2A 1OYYA 2RNJA 5D4SA 1R5HA 1YQAA 1LB2A 5BQTA 5JVTA 1FY7A 3V8JA 2EFNA 5HOOA 3LA2A 5DDGA 3RTRA 5K5RA 5J6XA 2CW0F 1HSTA 1YLFA 3L09A 1R22A 2A61A 5D8KB 2P5KA 2BBYA 4KUMA 3U1DA 2XKOA 4RGXA 3G3ZA 3BWGA 3ZMUA 3ZMTA 2XASA 4MQ9F 3I53A 4HV6A 4A0ZA 3TKYA 2FRHA 2R3SA 3SZTA 4L5IA 3NQOA 2Y48A 4MEYF 2RVCA 5H6QA 2G9WA 2HDCA 3GFMA 5K5OA 5AIQA 3HSEA 3QU3A 2L02A 1K78A 2B0LA 2AS5F 1BN5A 2EA4A 3O2PE 1Z7UA 2R7DA 4HW0A 3I59A 4HDUA 5J8FA 1UCRA 2ZMEA 1LEAA 3H3ZA 3DPLC 3AAFA 1T0FA 3CO6C 4L0ZB 3EDPA 2VONA 3FM3A 1B9MA 2OAZA 4GYIA 1PP7U 2E1CA 2FMYA 1R23A 3C1DA 1KGSA 2ADUA 3BPVA 3ZN0A 3R4KA 2EK5A 1RNLA 3BROA 3I4PA 1XD7A 2O8XA 5A2QK 3HSRA 2VE8A 4QWQA 2COMA 2IA1A 2MA3A 3GFJA 4UV9A 1FPQA 4EV0A 4ON0A 1UFMA 1OR7A 1U2WA 2PBIA 5BMZA 3F72A 3GFLA 3DF8A 3ZQ7A 1CF7B 1FC3A 3KEQA 4RAYA 1H0MA 2FBKA 1ULYA 5ICGA 3MCZA 1T2KA 3U2RA 3IRRA 3LQRA 2VBZA 2XAHA 3V7SA 3DXJF 4OIQF 5HS9A 3ABTA 1HW2A 3V7CA 5E20A 1S3JA 3E6BA 2EJRA 1IXRC 1P4WA 4CZZA 1OYIA 5JFRA 2IA2A 4U88A 4UVCA 2H6BA 1FYLA 2TDXA 3P9KA 2IP2A 3E5XA 5ED4A 2EV5A 4UVBA 2BYVE 1R1TA 3FX3A 3I54A 1MDMA 1YW7A 4L5JA 3HRUA 5L3DA 5DD8A 5ILVA 3TOAA 1QO0D 4MTEA 2V1DA 3E5QA 1RIOH 4HZFA 4L9VA 4L18B 1R36A 1DPUA 1KQ0A 3D5LA 2NRAC 2JZYA 4Q5SF 4OIRF 2OZUA 2K27A 4EM1A 1DPRA 5ERIA 1P6RA 1J0RA 1GVJA 1HKSA 2QUFA 5AIPA 3J81K 1XGSA 4KT5C 4IVNA 3CJNA 1HKTA 1OMIA 1A04A 3HIFA 4KIBA 1YO5C 1FOKA 3WTUC 4G7HF 1JHFA 2M1BA 1ZYRF 2F5FA 1TLHB 4PGGA 5LGUA 3T8TA 2EFPA 5LEJA 2HZTA 5BOXA 3H92A 4EGZA 2QM3A 3FZVA 2MLGA 2EWNA 3GUDA 1B59A 5IT9K 1LNWA 4G6DA 3N97A 3COAC 2PFBA 4EMSA 3K9TA 4MHGA 2F5EA 1LEBA 3HOSA 1SD5A 2FF4A 2EV6A 4P9FA 1MJ9A 1IN7A 2YU3A 3B73A 4PDKA 3RDIA 3SHFA 3LSTA 2P7VB 2DPUA 2HFHA 1J5YA 3Q9VA 3TQNA 2ACJA 1J9IA 3V4GA 2P4WA 3L2CA 3ZPLA 4IHTA 3RKYA 4A0YA 4ESFA 2OZ6A 4IRGA 2Z9OA 4ZYHA 4BYYA 2XIGA 3REOA 2LF8A 3V7RA 1JHHA 5LEKA 2P8TA 1R1VA 3KFWX 2FU4A 3DQVC 4U7DA 4RGSA 2HKXA 1KYWA 1IAWA 2H94A 4UV8A 5LBQA 1XCVA 2YX7A 3CDHA 1ON1A 4GGGA 2F5CA 2YPRA 2KIMA 2L54A 2LKPA 2UXXA 1J75A 1R5GA 5H6RA 2DK5A 3IWFA 1ZGJA 2M30A 1BI2A 3R60A 2D1HA 4U0YA 2ISZA 2MD5A 1XDUA 3RIRA 4FX0A 2PG4A 3JTGA 1ZRCA 4PGHA 3GX4X 5DCMA 2EV0A 5J8CA 3WE2A 2Z3YA 1EV7A 3BZ6A 3NEUA 3TO6A 4M73A 3R0JA 5LRSA 1LDKB 1IN8A 1XCBA 2GQQA 1O57A 3IWZA 2J5OA 2XAGA 4AD9A 2QYOA 4ESBA 2ETHA 2FBHA 1V4RA 3GW2A 4L9TA 4IRHA 1XDSA 3QU6A 4RS8A 3BJAA 1WRJA 2OA4A 2XAQA 1U78A 2VBXA 2A5YB 3ZMDA 1B9NA 4U0VA 1LJ9A 2QBYA 4JQFA 4IF4A 3HYIA 1XN7A 4MTDA 3EUHA 3GVAA 3S2WA 1DUXC 2PLYA 1IRGA 3KE2A 3L00A 5D5UB 1W4MA 4ZYGA 2CQKA 3W6KB 1T38A 4CXFA 1FSHA 4AIKA 4Q47A 2HGCA 1SD6A 1CGPA 2XGXA 3T1BA 2BEOA 2HEOA 3DKWA 4YFXF 5DUIA 2MBFA 4WXCA 4XRFA 4IPAA 4P96A 3J80Z 4EGYA 3CUQC 4A5MA 1LVAA 2O03A 3KLOA 2ZNYA 1IF1A 2F2EA 1W5TA 3VFZA 2ZCWA 3ZN1A 4BHPA 5E8GA 1EH7A 3FM5A 1ZLKA 1BBYA 3IL2A 4I02A 4M6YA 1SMTA 2DI3A 2M87A 1XSDA 5E1WA 3EETA 1ZG3A 4ZZLA 3O3KA 1MD0A 4LFUA 1FT9A 3DV8A 3HUGA 2JPCA 2L3DA 3C18A 3GLXA 4WXHA 1U3EM 2CWEA 3JW4A 2MC3A 4M9ZA 4DQ2A 2OD5A 2QQBA 1SFUA 2FNAA 1S29A 5CVJA 4K2EA 1IN5A 3LA3A 2PQ8A 5LGTA 5HS7A 4FHTA 3K0LA 2FOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTT C;  1QZZ A;  2XUB A;  3M1E A;  4ENJ A;  1C0W A;  2VC0 A;  1IZ1 A;  4G6Q A;  4RB1 A;  3N4M A;  3K69 A;  1MKM A;  2FSW A;  3HRT A;  1O3S A;  1TNS A;  1KQ8 A;  4XLN F;  2A07 F;  1I6X A;  2F5D A;  1W7P D;  2D1V A;  4P9U A;  3T0Y A;  4I09 A;  2P5L C;  4RB3 C;  4ASN A;  1ODD A;  2STT A;  1XMK A;  4A6E A;  3EYY A;  3MQ0 A;  3P9C A;  4KFC A;  1D3Y A;  5HLH A;  1FP1 D;  2LF7 A;  1LDJ A;  3K2Z A;  2GAU A;  3CUQ B;  1FZP B;  2RN7 A;  2CYY A;  5D6E A;  2LSO A;  5E8I A;  3K1M A;  2STW A;  3BPX A;  4OU0 A;  4EM2 A;  1XGM A;  4LGW A;  5D4R A;  1FYM A;  4H0E A;  4DNC A;  2W24 A;  1IW7 F;  3FMQ A;  3U9G A;  2PI0 A;  2JPB A;  4MNU A;  5LHI A;  4RB2 C;  4CYD A;  5D5X B;  4ZYE A;  4CDG A;  1T6S A;  3E6C C;  1IXS B;  1H9G A;  1FNN A;  4HF0 A;  3M7G A;  4E70 A;  3SQN A;  4HX8 A;  2FBI A;  3F6O A;  2W85 A;  3K1P A;  3DEU A;  3I64 A;  3ROU A;  2GWR A;  2ZJ2 A;  4TV7 A;  4FT8 A;  3J7A O;  5JR3 A;  3I58 A;  1KU9 A;  2DLL A;  3BOQ A;  1WI9 A;  1MZB A;  3WTZ A;  1XSX A;  2L4M A;  4HLY A;  4N9I A;  5CVR A;  4IRI A;  1B4A A;  5FFZ A;  4UNO A;  3ULQ B;  3PQJ A;  3RKW A;  2RDP A;  3DPT A;  5ILU A;  2V6C A;  4U0W A;  5HDN A;  1QPM A;  5HLG A;  2X0L A;  2GZW A;  1BC7 C;  5F1R A;  3B02 A;  4G7Z F;  1EH8 A;  1U6G A;  4XBF A;  3GWZ A;  4A0X A;  4HX7 A;  3KP3 A;  2MH2 A;  5FD5 A;  3QOP A;  4R1H A;  3FXU A;  4XSX F;  1O3R A;  4HQE A;  2UWM A;  3DP7 A;  1YW9 A;  3FHZ A;  1L0O C;  3CUQ A;  3F8M A;  4KN4 X;  3H3U A;  2HYF A;  1FBQ A;  3D0S A;  2KIU A;  3PQK A;  1WKM A;  3IKT A;  3QP5 A;  4KDP A;  5EEG A;  2FA5 A;  1G3Y A;  2KKO A;  4Y17 A;  5HLI A;  3WTV C;  1USS A;  2H09 A;  2MH9 A;  1I27 A;  1O3Q A;  1TQM A;  3FWE A;  4KIG A;  5D8L B;  3C3W A;  3ISP A;  3FXR A;  2PJP A;  4P55 A;  2GA2 A;  3KLN A;  1R1U A;  2WV0 A;  3VOE A;  4RGU A;  4O5V A;  3K1N A;  2VXZ A;  2QZ8 A;  2OBP A;  5E1X A;  4O6J A;  5FLX K;  1DDN A;  2HQN A;  3R61 A;  4I01 A;  1D8K A;  1ON2 A;  1YTY A;  1KA8 A;  2DFI A;  1ZRD A;  5FFX A;  4HF2 A;  4BXU A;  4KIF A;  3ERE D;  1REP C;  1RUN A;  5HDK A;  1YS6 A;  3C7J A;  1U5T B;  1HW5 A;  1S8N A;  4EJU A;  3RI4 A;  1E17 A;  5ILS A;  1IXC A;  3TOB A;  5FO5 A;  3WG9 A;  3P9I A;  2RQP A;  1F5T A;  4N0B A;  4GYG A;  2IVM A;  4G8X A;  3SZP A;  3CLO A;  1QBJ A;  5DUK A;  3KP2 A;  1RI7 A;  4BH9 A;  2DO7 A;  3EYI A;  2HTJ A;  3CO7 C;  2NS0 A;  2W57 A;  3QAH A;  3KET A;  4LK1 F;  2ZNZ A;  2HTS A;  3WOD F;  3J81 Z;  1AOY A;  4P5O A;  5D5W B;  1W7P B;  3BJO A;  4QLC U;  3JTH A;  1R58 A;  3HTS B;  5DCF A;  1MGT A;  4IHS A;  4S05 A;  3RJP A;  2VT2 A;  3I59 B;  5LLQ A;  2WC2 A;  3LQQ A;  1K7A A;  2GA1 A;  3IRQ A;  2MLK A;  5CVV A;  1FP2 A;  2RV8 A;  1YYV A;  1K78 B;  4YFK F;  2Y75 A;  3Q5F A;  1SD7 A;  2A3S A;  1G3S A;  4LB5 A;  4HDV A;  3KEO A;  4RGR A;  2K4J A;  3QP6 A;  3MFK A;  1XSV A;  3GZ5 A;  4OOI A;  2ZO4 A;  2NAZ A;  5E17 F;  4HLX A;  3RPU A;  5L3C A;  3QPH A;  3SXY A;  2LDU A;  1TW2 A;  3FF5 A;  2IW5 A;  3F8C A;  2XRN A;  4HQM A;  1SFE A;  2HS5 A;  1G4D A;  4L9J A;  3MWM A;  5FGM A;  2HKO A;  1PUE E;  2A68 F;  1IN4 A;  3QPT A;  1ZH5 A;  4NB5 A;  1R7J A;  2M8E A;  5BS6 A;  2EA2 A;  4G94 A;  2V1U A;  2EB7 A;  3GZ6 A;  1ZLJ A;  1ZRF A;  5L3E A;  1UHW A;  2O3F A;  1J2X A;  1I5Z A;  3ML6 A;  4ETS A;  2ISY A;  1STZ A;  5F6F A;  4OIP F;  4BQA A;  4KIC A;  2KRF A;  3HRM A;  4GXO A;  2DBB A;  2R7F A;  1FX7 A;  2K4B A;  2J5P A;  3BJ6 A;  2JSC A;  2YSR A;  4B8X A;  1P92 A;  5E1Z B;  1MJA A;  5FD6 A;  1ZGA A;  3ABU A;  4EJW A;  2XRO A;  3CUO A;  4AIH A;  3FXQ A;  4KN7 X;  1B6A A;  5DCM B;  2K02 A;  1RZ4 A;  5KK1 A;  3JSO A;  4HF1 A;  4EJO A;  3F8B A;  2D2W A;  1S7O A;  2VOD A;  5FB2 A;  1XMA A;  5E18 F;  2LNB A;  1BJA A;  4WF2 A;  5DYM A;  3BP8 A;  4BHC A;  2O6G E;  2KIF A;  4AVP A;  1OYW A;  4EM0 B;  1T98 A;  2L4A A;  5CYV A;  3VOD A;  3VEP A;  3F23 A;  1YIO A;  2C6Y A;  2G7U A;  3WTX C;  4ENM A;  4UHT A;  3E97 A;  5AON A;  1SFX A;  3T8R A;  3GF2 A;  2V79 A;  3OOP A;  1UHM A;  1F9N A;  3BY6 A;  1U8R A;  1FSE A;  4HAM A;  4YG2 F;  2QLZ A;  1X3U A;  1Z05 A;  1D8J A;  1TBX A;  5CJ9 A;  1BI0 A;  4PCQ A;  2L01 A;  4OIO F;  1W5S A;  1GXQ A;  5KVR A;  5D6F A;  4MQV A;  3M8F A;  1J59 A;  3E3V A;  3NRV A;  1YFH A;  1YS7 A;  1QNT A;  3LA7 A;  2GXB A;  2Q8K A;  2NNN A;  3LAP A;  3T5X A;  1J7K A;  1G3T A;  2PMU A;  1ZRE A;  4KA4 A;  2BV6 A;  3TGN A;  1HW1 A;  1ZAO A;  1MJB A;  5DEQ A;  1KU2 A;  2HOE A;  4NQW A;  3L9F A;  1ZN2 A;  5CVU A;  5BPD A;  2O61 A;  1O7F A;  1WWX A;  3F21 A;  2FNP A;  1ZAR A;  3WGH A;  4HV5 A;  2DK8 A;  1NHA A;  4EQQ A;  3LAJ A;  1Y0U A;  1SMY F;  3KZZ A;  4A6D A;  2VBY A;  5HDG A;  1P4A A;  4Q48 A;  2FML A;  1MDM B;  2JRT A;  2CSO A;  2E7X A;  4CO8 A;  5ICC A;  2DQR A;  3E6M A;  2QQ9 A;  4M71 A;  1P4X A;  2AXL A;  2H27 A;  1JGS A;  2ZFW A;  1YG2 A;  3IHU A;  2EFO A;  5F64 A;  1QQI A;  3P7N A;  3SFZ A;  2PMH A;  2UZK A;  1S7A A;  2IPQ X;  6PAX A;  3FMS A;  4D0P A;  1FWZ A;  4NHJ A;  2A6H F;  4EVI A;  5TRD A;  4R79 A;  2OQR A;  1QGP A;  3GYH X;  5LHH A;  4JK1 X;  1KU3 A;  1FBS A;  1R00 A;  2HYG D;  1I1S A;  1Q1H A;  4Z2Y A;  3Q9S A;  2XVC A;  1GHC A;  1K6O A;  2Z99 A;  3KCC A;  3F8N A;  2P6T A;  2PN6 A;  2P7C B;  1IRF A;  4I98 B;  4WXD A;  4KYW A;  3MEX A;  1T39 A;  1ZG1 A;  2OQG A;  3RYR A;  2IRF G;  4AWX B;  2M45 A;  3PFI A;  4OIN F;  2BGC A;  2Z33 A;  1Z6T A;  2DT5 A;  4IXA A;  4FX4 A;  4BAY A;  2ZKZ A;  2K86 A;  2CO5 A;  1PP8 F;  5ICF A;  4KMU X;  3M9A A;  3LFK A;  3F8F A;  4WX9 A;  3FMR A;  3G73 A;  1CF7 A;  3F22 A;  4CGZ A;  3WE3 A;  4LLG F;  3HHG A;  2K7L A;  4MGR A;  2ESH A;  3F3X A;  3KP7 A;  3RPQ A;  5FLX Z;  4LG0 A;  4Q4Z F;  2W25 A;  1Z6R A;  5H20 A;  4LD5 A;  4I7H A;  2IA0 A;  2XAJ A;  1AWC A;  3WU0 A;  2NNY A;  2VBW A;  1TNT A;  3E5U A;  2JT1 A;  1S6L A;  3F6V A;  4Y15 A;  4YIF A;  2PEX A;  4WCG A;  4YFN F;  2ZME B;  1U5T C;  4L9N A;  2ZBK A;  2GXG A;  1HBX G;  3O6B B;  4HOB A;  1B1B A;  4M74 A;  3LWF A;  1YW8 A;  5DD4 A;  1E2X A;  4G7O F;  2DW4 A;  4LLL A;  1KQ9 A;  3CTA A;  1BIA A;  1BI1 A;  5HS8 A;  4LB6 B;  3GEZ A;  1I1G A;  2XHK A;  3I71 A;  2VT3 A;  1SD4 A;  2KJC A;  2KJB A;  1G3W A;  1IUY A;  3HTU A;  2VN2 A;  2OU2 A;  5D5V B;  2JTV A;  3MAJ A;  4RB0 A;  2HWV A;  2EFQ A;  4BHB A;  3ECO A;  4S04 A;  3L7W A;  3WTW C;  1F1Z A;  1GXP A;  3I0T A;  2Q0O A;  3ZMZ A;  2QEN A;  1SAX A;  4LJZ F;  3WGI A;  3WGG A;  1RUO A;  4LG0 B;  5LHG A;  1XB4 A;  2VOP A;  2HQR A;  5IT9 Z;  1ONV A;  4JBA A;  2CG4 A;  1HKQ A;  4M9S A;  4I2O A;  2RKH A;  2ESN A;  5JHU A;  2XV4 S;  1UB9 A;  3ZP5 A;  3GO5 A;  4N9H A;  2XAF A;  1V3F A;  1D5V A;  1DP7 P;  4ZH4 F;  1U5T A;  3R0A A;  2VE9 A;  2WTE A;  3MZH A;  2VC1 A;  1QZY A;  4WWC A;  2YX4 A;  4LK0 F;  4XLP F;  1XGN A;  2DAO A;  4A2U A;  1G6N A;  2G7H A;  4U7B A;  3V8K A;  4ENN A;  3KP5 A;  3R6S A;  1O7L A;  2P6S A;  2EFW A;  1UST A;  3WU1 B;  3WTS C;  3HOT A;  5ICE A;  1Z1D A;  3W6J B;  4B09 A;  2E1N A;  1PDN C;  1IN6 A;  1OPC A;  1WQ2 A;  4ZZD A;  1ZG5 A;  2VOO A;  4I0B A;  5K5Q A;  1BI3 A;  4F7Z A;  4EJT A;  2ZXJ A;  2A6E F;  2RGV A;  1TQI A;  1P2F A;  1TQP A;  1FYK A;  2DTR A;  1VTN C;  4MEX F;  2Y0M A;  1HSJ A;  1OKR A;  1FBU A;  4R8H A;  1BM9 A;  2NYX A;  5A2Q Z;  4LMY A;  3ELK A;  3TDZ C;  4RAZ A;  4XSZ F;  2IT0 A;  3TDU C;  3KP4 A;  4IJA A;  1L3L A;  2CGP A;  3QRF F;  2FE3 A;  3ZMV A;  2WWY A;  2FQ3 A;  4KMF A;  1ZHF A;  1H9T A;  2H6C A;  5BPI A;  4UVA A;  3GXO A;  5EEH A;  3ZMS A;  4A12 A;  2V1X A;  1JXS A;  2XKP A;  3M8E A;  4GCV A;  4UXN A;  5LGN A;  1KU7 A;  5TJJ A;  4HYE A;  5L3G A;  2DQL A;  1XGO A;  3IKV A;  4M9X A;  2D45 A;  2BE5 F;  4EJV A;  4L0Y B;  2HR3 A;  4CIC A;  3DFG A;  1K79 A;  4UUV A;  4AIJ A;  1BIB A;  5CLS A;  4Y13 A;  2V9V A;  3WTY C;  3RKX A;  3RYP A;  3ECH A;  3V8L A;  2GIV A;  4LLN A;  1HQC A;  3I5U A;  1KYZ A;  2FEZ A;  3EQL F;  3E6D A;  1W7P A;  3TO9 A;  2UXN A;  3JSP A;  1LQ1 A;  2DPD A;  3KP6 A;  3IC7 A;  5HVQ C;  5L3F A;  4ZYD A;  4BNC A;  5L3B A;  3GFI A;  2E7W A;  2QQA A;  3KZY A;  3BDD A;  4YII A;  2A69 F;  3J80 K;  2X4H A;  2QBY B;  3HRS A;  5LRR A;  4GO1 A;  4CHU A;  4WK8 F;  2DU9 A;  2Z5U A;  4I0A A;  1O3T A;  4KNY A;  1EH6 A;  2O0Y A;  1FLI A;  5CVI A;  3HSF A;  1BOA A;  5JI6 A;  1Z9C A;  2QVO A;  1LDD A;  4HBL A;  2Q2E A;  2ELH A;  4M72 A;  1JE8 A;  5K1Y A;  3TO7 A;  4G9Y A;  1HXD A;  1BC8 C;  2CFX A;  2W84 A;  2FXA A;  2RC4 A;  4PZJ A;  2P5V A;  3JAM K;  3JAM Z;  4OMY A;  4O3M A;  2YR2 A;  2IJL A;  4M6X A;  3OV8 A;  3HHH A;  4HX4 A;  2M5W A;  4HA8 A;  4OMZ A;  4A5N A;  1Z91 A;  5IT3 A;  4ENK A;  1TTY A;  1WSU A;  1TW3 A;  3MZY A;  2QWW A;  4ESJ A;  5DV5 A;  1F4K A;  3VB2 A;  1OYY A;  2RNJ A;  5D4S A;  1R5H A;  1YQA A;  1LB2 A;  5BQT A;  5JVT A;  1FY7 A;  3V8J A;  2EFN A;  5HOO A;  3LA2 A;  5DDG A;  3RTR A;  5K5R A;  5J6X A;  2CW0 F;  1HST A;  1YLF A;  3L09 A;  1R22 A;  2A61 A;  5D8K B;  2P5K A;  2BBY A;  4KUM A;  3U1D A;  2XKO A;  4RGX A;  3G3Z A;  3BWG A;  3ZMU A;  3ZMT A;  2XAS A;  4MQ9 F;  3I53 A;  4HV6 A;  4A0Z A;  3TKY A;  2FRH A;  2R3S A;  3SZT A;  4L5I A;  3NQO A;  2Y48 A;  4MEY F;  2RVC A;  5H6Q A;  2G9W A;  2HDC A;  3GFM A;  5K5O A;  5AIQ A;  3HSE A;  3QU3 A;  2L02 A;  1K78 A;  2B0L A;  2AS5 F;  1BN5 A;  2EA4 A;  3O2P E;  1Z7U A;  2R7D A;  4HW0 A;  3I59 A;  4HDU A;  5J8F A;  1UCR A;  2ZME A;  1LEA A;  3H3Z A;  3DPL C;  3AAF A;  1T0F A;  3CO6 C;  4L0Z B;  3EDP A;  2VON A;  3FM3 A;  1B9M A;  2OAZ A;  4GYI A;  1PP7 U;  2E1C A;  2FMY A;  1R23 A;  3C1D A;  1KGS A;  2ADU A;  3BPV A;  3ZN0 A;  3R4K A;  2EK5 A;  1RNL A;  3BRO A;  3I4P A;  1XD7 A;  2O8X A;  5A2Q K;  3HSR A;  2VE8 A;  4QWQ A;  2COM A;  2IA1 A;  2MA3 A;  3GFJ A;  4UV9 A;  1FPQ A;  4EV0 A;  4ON0 A;  1UFM A;  1OR7 A;  1U2W A;  2PBI A;  5BMZ A;  3F72 A;  3GFL A;  3DF8 A;  3ZQ7 A;  1CF7 B;  1FC3 A;  3KEQ A;  4RAY A;  1H0M A;  2FBK A;  1ULY A;  5ICG A;  3MCZ A;  1T2K A;  3U2R A;  3IRR A;  3LQR A;  2VBZ A;  2XAH A;  3V7S A;  3DXJ F;  4OIQ F;  5HS9 A;  3ABT A;  1HW2 A;  3V7C A;  5E20 A;  1S3J A;  3E6B A;  2EJR A;  1IXR C;  1P4W A;  4CZZ A;  1OYI A;  5JFR A;  2IA2 A;  4U88 A;  4UVC A;  2H6B A;  1FYL A;  2TDX A;  3P9K A;  2IP2 A;  3E5X A;  5ED4 A;  2EV5 A;  4UVB A;  2BYV E;  1R1T A;  3FX3 A;  3I54 A;  1MDM A;  1YW7 A;  4L5J A;  3HRU A;  5L3D A;  5DD8 A;  5ILV A;  3TOA A;  1QO0 D;  4MTE A;  2V1D A;  3E5Q A;  1RIO H;  4HZF A;  4L9V A;  4L18 B;  1R36 A;  1DPU A;  1KQ0 A;  3D5L A;  2NRA C;  2JZY A;  4Q5S F;  4OIR F;  2OZU A;  2K27 A;  4EM1 A;  1DPR A;  5ERI A;  1P6R A;  1J0R A;  1GVJ A;  1HKS A;  2QUF A;  5AIP A;  3J81 K;  1XGS A;  4KT5 C;  4IVN A;  3CJN A;  1HKT A;  1OMI A;  1A04 A;  3HIF A;  4KIB A;  1YO5 C;  1FOK A;  3WTU C;  4G7H F;  1JHF A;  2M1B A;  1ZYR F;  2F5F A;  1TLH B;  4PGG A;  5LGU A;  3T8T A;  2EFP A;  5LEJ A;  2HZT A;  5BOX A;  3H92 A;  4EGZ A;  2QM3 A;  3FZV A;  2MLG A;  2EWN A;  3GUD A;  1B59 A;  5IT9 K;  1LNW A;  4G6D A;  3N97 A;  3COA C;  2PFB A;  4EMS A;  3K9T A;  4MHG A;  2F5E A;  1LEB A;  3HOS A;  1SD5 A;  2FF4 A;  2EV6 A;  4P9F A;  1MJ9 A;  1IN7 A;  2YU3 A;  3B73 A;  4PDK A;  3RDI A;  3SHF A;  3LST A;  2P7V B;  2DPU A;  2HFH A;  1J5Y A;  3Q9V A;  3TQN A;  2ACJ A;  1J9I A;  3V4G A;  2P4W A;  3L2C A;  3ZPL A;  4IHT A;  3RKY A;  4A0Y A;  4ESF A;  2OZ6 A;  4IRG A;  2Z9O A;  4ZYH A;  4BYY A;  2XIG A;  3REO A;  2LF8 A;  3V7R A;  1JHH A;  5LEK A;  2P8T A;  1R1V A;  3KFW X;  2FU4 A;  3DQV C;  4U7D A;  4RGS A;  2HKX A;  1KYW A;  1IAW A;  2H94 A;  4UV8 A;  5LBQ A;  1XCV A;  2YX7 A;  3CDH A;  1ON1 A;  4GGG A;  2F5C A;  2YPR A;  2KIM A;  2L54 A;  2LKP A;  2UXX A;  1J75 A;  1R5G A;  5H6R A;  2DK5 A;  3IWF A;  1ZGJ A;  2M30 A;  1BI2 A;  3R60 A;  2D1H A;  4U0Y A;  2ISZ A;  2MD5 A;  1XDU A;  3RIR A;  4FX0 A;  2PG4 A;  3JTG A;  1ZRC A;  4PGH A;  3GX4 X;  5DCM A;  2EV0 A;  5J8C A;  3WE2 A;  2Z3Y A;  1EV7 A;  3BZ6 A;  3NEU A;  3TO6 A;  4M73 A;  3R0J A;  5LRS A;  1LDK B;  1IN8 A;  1XCB A;  2GQQ A;  1O57 A;  3IWZ A;  2J5O A;  2XAG A;  4AD9 A;  2QYO A;  4ESB A;  2ETH A;  2FBH A;  1V4R A;  3GW2 A;  4L9T A;  4IRH A;  1XDS A;  3QU6 A;  4RS8 A;  3BJA A;  1WRJ A;  2OA4 A;  2XAQ A;  1U78 A;  2VBX A;  2A5Y B;  3ZMD A;  1B9N A;  4U0V A;  1LJ9 A;  2QBY A;  4JQF A;  4IF4 A;  3HYI A;  1XN7 A;  4MTD A;  3EUH A;  3GVA A;  3S2W A;  1DUX C;  2PLY A;  1IRG A;  3KE2 A;  3L00 A;  5D5U B;  1W4M A;  4ZYG A;  2CQK A;  3W6K B;  1T38 A;  4CXF A;  1FSH A;  4AIK A;  4Q47 A;  2HGC A;  1SD6 A;  1CGP A;  2XGX A;  3T1B A;  2BEO A;  2HEO A;  3DKW A;  4YFX F;  5DUI A;  2MBF A;  4WXC A;  4XRF A;  4IPA A;  4P96 A;  3J80 Z;  4EGY A;  3CUQ C;  4A5M A;  1LVA A;  2O03 A;  3KLO A;  2ZNY A;  1IF1 A;  2F2E A;  1W5T A;  3VFZ A;  2ZCW A;  3ZN1 A;  4BHP A;  5E8G A;  1EH7 A;  3FM5 A;  1ZLK A;  1BBY A;  3IL2 A;  4I02 A;  4M6Y A;  1SMT A;  2DI3 A;  2M87 A;  1XSD A;  5E1W A;  3EET A;  1ZG3 A;  4ZZL A;  3O3K A;  1MD0 A;  4LFU A;  1FT9 A;  3DV8 A;  3HUG A;  2JPC A;  2L3D A;  3C18 A;  3GLX A;  4WXH A;  1U3E M;  2CWE A;  3JW4 A;  2MC3 A;  4M9Z A;  4DQ2 A;  2OD5 A;  2QQB A;  1SFU A;  2FNA A;  1S29 A;  5CVJ A;  4K2E A;  1IN5 A;  3LA3 A;  2PQ8 A;  5LGT A;  5HS7 A;  4FHT A;  3K0L A;  2FOK A; 
#chains in the Genus database with same CATH topology
 3WTT C;  3K2A A;  5EGO B;  1ZEL A;  1QZZ A;  3CMA I;  2NXN B;  2XUB A;  3PSI A;  2DYR H;  4M3G A;  3M1E A;  4ENJ A;  1C0W A;  3RCO A;  2VC0 A;  1IZ1 A;  3HOY J;  4G6Q A;  2E36 A;  4RB1 A;  3N4M A;  1ETY A;  1QHH D;  5CQE A;  1YHQ I;  5FKN A;  1D1A A;  3K69 A;  1VQ4 I;  4KT6 A;  1MKM A;  2FSW A;  3HRT A;  2EZK A;  1TNS A;  2Z1D A;  3BR0 A;  4BDZ A;  1O3S A;  1KQ8 A;  4XLN F;  2A07 F;  3ONQ A;  1I6X A;  2Y0S N;  2F5D A;  1W7P D;  3BR3 A;  2D1V A;  2X6X A;  4P9U A;  3QQA A;  1Z3X A;  3T0Y A;  4I09 A;  4Z6Y A;  2P5L C;  4RB3 C;  1EJ9 A;  3HOV J;  4ASN A;  1ODD A;  4CYC A;  5HLT A;  5C4X J;  2STT A;  1SFK A;  1XMK A;  4A6E A;  3EYY A;  4XID A;  3MQ0 A;  1U9N A;  3P9C A;  5F0F A;  4KFC A;  3QOE A;  3LOC A;  1D3Y A;  1VQ7 I;  3F0C A;  1WI3 A;  5HLH A;  1FP1 D;  4XKC A;  2LF7 A;  4PFO A;  5EGO A;  3J7Z I;  1IV8 A;  2EZI A;  1LDJ A;  3K2Z A;  3I9V 2;  2QKM B;  1TWF J;  3TP3 A;  2GAU A;  3OWT A;  3CUQ B;  1FZP B;  2RN7 A;  1ETQ A;  1FOY A;  2K3F A;  4HNU A;  2CYY A;  5D6E A;  2LSO A;  2CQ7 A;  5E8I A;  3K1M A;  4PSW A;  3BT9 A;  2STW A;  2NVT J;  3BPX A;  3LSG A;  4OU0 A;  4EM2 A;  3EPZ A;  4PJJ A;  2EIM H;  3FIS A;  5IP9 J;  1XGM A;  3FK6 A;  2EIJ H;  4BQN A;  4LGW A;  5D4R A;  1FYM A;  5C44 J;  3CDI A;  3HUG B;  4H0E A;  1R4N B;  5EF6 A;  1YJN I;  4DNC A;  1R71 A;  2W24 A;  4H4K C;  4BJ6 C;  1IW7 F;  3OR1 C;  3FMQ A;  3U9G A;  1NH3 A;  2PI0 A;  2JPB A;  1LFU P;  3L2V A;  1V55 H;  4MNU A;  5LHI A;  4RB2 C;  2XB0 X;  4XLE A;  4CYD A;  3S3M A;  1RC9 A;  5D5X B;  4II2 A;  1FIP A;  2F48 A;  4ZYE A;  4CDG A;  3S2D J;  1T6S A;  3E6C C;  2O9L A;  1IXS B;  1H9G A;  1FNN A;  2L9R A;  3ZQF A;  3Q0V A;  1V54 H;  4E7H A;  3BTJ A;  4HF0 A;  3TP0 A;  3M7G A;  4W1U A;  4E70 A;  3SQN A;  4HX8 A;  2FBI A;  4DBR A;  1OJL A;  3F6O A;  2W85 A;  3K1P A;  3DEU A;  1V5E A;  3I64 A;  3ROU A;  1TT5 B;  2GWR A;  2LMD A;  2DFE A;  2ZJ2 A;  4JX6 A;  4TV7 A;  2R7S A;  4ZC3 A;  2DMT A;  2RRE A;  1E3O C;  2BY1 A;  2VUM J;  3VSL A;  4FT8 A;  4OAY A;  3J7A O;  3S15 J;  5JR3 A;  2TCT A;  1DGR M;  2EPF A;  2DJN A;  3I58 A;  3SZG A;  1X3Z B;  1KU9 A;  2DLL A;  3BOQ A;  1WI9 A;  4XOP A;  1LUJ B;  1TC3 C;  4DJA A;  1MZB A;  2HVQ A;  3WTZ A;  2CW7 A;  2XGD A;  4Y4R A;  1HC8 A;  2G0E A;  1XSX A;  2HDD A;  2LRD A;  1PUF A;  2L4M A;  4HLY A;  4N9I A;  2JA8 J;  4IKF A;  1X3W B;  3JRG A;  4C3I J;  2W4S A;  5CVR A;  3RSN A;  4AYB A;  4IRI A;  2LVS A;  1B4A A;  4G6T B;  5FFZ A;  2E71 A;  4UNO A;  3ULQ B;  3FK7 A;  5F1J A;  2RQQ A;  3PQJ A;  2LTP A;  3RKW A;  3HDD A;  2PJR A;  4FQG A;  2K40 A;  2RDP A;  3DPT A;  5ILU A;  3PUF A;  3H9G A;  1X1A A;  2V6C A;  1OLT A;  3CCJ I;  4U0W A;  3WHC A;  5FKM A;  3LFU A;  5HDN A;  1QPM A;  4F92 B;  2DN0 A;  5HLG A;  2X0L A;  5FLV A;  2GZW A;  2CQQ A;  1BC7 C;  5F1R A;  3B02 A;  1JKO C;  1TWG J;  1XX5 A;  4RLQ A;  3L2R A;  4G7Z F;  1EH8 A;  1U6G A;  1RRJ A;  4XBF A;  2WY7 Q;  3GWZ A;  4A0X A;  4HX7 A;  1RES A;  4E7L A;  2DA7 A;  4RA2 A;  3KP3 A;  2VJ5 A;  3PIP F;  3Q3S A;  2MH2 A;  1EKE A;  4IQ4 A;  5FD5 A;  3QOP A;  3AL0 C;  3FXL A;  4R1H A;  3OSG A;  3FXU A;  3QYB A;  4XSX F;  1EA3 A;  1O3R A;  4HQE A;  2R7W A;  3K6G A;  2UWM A;  4N4N B;  3DP7 A;  1YW9 A;  2XPV A;  3FHZ A;  2O8K A;  4XIC A;  4I6Z A;  1L0O C;  3CUQ A;  3F8M A;  4KN4 X;  1XPX A;  3H3U A;  1R4M B;  1MMD A;  3DEW A;  3ZGK A;  4D7N A;  1JKP C;  1JJ8 C;  4C2U A;  1T56 A;  2HYF A;  1FBQ A;  3D0S A;  1ZQ3 P;  2KIU A;  1MBE A;  3PQK A;  1WKM A;  1HDP A;  3IKT A;  3QP5 A;  3CF5 F;  4KDP A;  3JRA A;  2KRH A;  5EEG A;  2FA5 A;  2M4G A;  3W2W A;  4FCY A;  1G3Y A;  3H0G J;  2KKO A;  4Y17 A;  5HLI A;  1W0T A;  3WTV C;  2QA4 I;  1USS A;  2H09 A;  1IC8 A;  2DA2 A;  2MH9 A;  1I27 A;  2WAD A;  1O3Q A;  4M3B A;  3L2U A;  2E2J J;  1TQM A;  4XON A;  3AFH A;  3FWE A;  4KIG A;  5D8L B;  3C3W A;  4YEJ A;  3ISP A;  3FXR A;  2PJP A;  4P55 A;  1CQT A;  2GA2 A;  5K7F A;  1IDY A;  3KLN A;  1R1U A;  2WV0 A;  2XB5 A;  1K61 A;  3VOE A;  4RGU A;  4O5V A;  3K1N A;  3HEF A;  2VXZ A;  2QZ8 A;  2OBP A;  3VSK A;  5E1X A;  2WB1 A;  4O6J A;  3H5R A;  5FLX K;  2Y31 A;  5E3O A;  1DDN A;  1GT0 C;  1QZE A;  2HQN A;  3R61 A;  1BJZ A;  1VQ6 I;  4C30 A;  4I01 A;  1IRZ A;  5TGT A;  1D8K A;  1ON2 A;  3G2B A;  1YTY A;  1KA8 A;  2DFI A;  2ZJP F;  5FFX A;  1ZRD A;  4A69 C;  4HF2 A;  1WJ5 A;  4IEJ A;  4KIF A;  4BXU A;  3ZQG A;  3ERE D;  4B48 A;  1REP C;  3ABK H;  1PYV A;  1RUN A;  5HDK A;  3FBI B;  3MN2 A;  1YS6 A;  3C7J A;  1U5T B;  4XLH A;  2V6E A;  4KIS A;  1YX5 A;  4X0G A;  1HW5 A;  1BW5 A;  1S8N A;  4EJU A;  2EH3 A;  1HCR A;  2N8G A;  4NBQ A;  5ILS A;  2VQG A;  3RI4 A;  1E17 A;  2KIQ A;  1IXC A;  1QA6 A;  2Z16 A;  3TOB A;  5FO5 A;  3WG9 A;  3P9I A;  2RQP A;  1F5T A;  4N0B A;  4GYG A;  4B3A A;  3I4N J;  2IVM A;  4G8X A;  4W97 A;  3SZP A;  4BBR J;  3S1R J;  3KIO A;  1B8I A;  3CLO A;  3BTI A;  1YRN B;  1QBJ A;  4V2G A;  5DUK A;  2CQX A;  3KP2 A;  4BUP A;  1OCC H;  3HOX J;  1XMX A;  1PVE A;  2F4M B;  2GLO A;  3PO2 J;  1JGG A;  1RI7 A;  4BH9 A;  2DO7 A;  4BAC A;  3EYI A;  3SEQ A;  1XTA A;  2HTJ A;  1ERD A;  3S3N A;  4PJM A;  3VWB A;  4IHX A;  2DA5 A;  3CO7 C;  2MSY A;  2NS0 A;  2KP6 A;  2RAE A;  2VAS A;  2W57 A;  3QAH A;  2LR8 A;  1MBG A;  3KET A;  2MFZ A;  3CJT B;  3EUK L;  2HI3 A;  2KDZ A;  2HPI A;  4LK1 F;  3BCB A;  1WJB A;  2ZNZ A;  1YE9 A;  2HTS A;  3A01 B;  4CCM A;  1X1P A;  3WOD F;  3J81 Z;  1LKX A;  1SVM A;  1AOY A;  3H5N A;  4P5O A;  5D5W B;  1W7P B;  3BJO A;  4QLC U;  3JTH A;  1TT0 A;  1R58 A;  3HTS B;  3VYU B;  1ZTR A;  5DCF A;  1MGT A;  4IHS A;  2L7M P;  4S05 A;  4A3K J;  2CW8 A;  3RJP A;  2XRL A;  1HLV A;  2VT2 A;  3FXM A;  3I59 B;  5LLQ A;  2FD5 A;  2WC2 A;  3LQQ A;  3OL3 A;  1K7A A;  4DGW B;  2GA1 A;  3IRQ A;  2MLK A;  5CVV A;  1FP2 A;  2E34 A;  2WAQ N;  1QPI A;  2RV8 A;  1YYV A;  2Y30 A;  4XQF A;  1K78 B;  2FQ4 A;  4RLF A;  2VLA A;  3H9Q A;  4HPQ A;  4BDY A;  4YFK F;  2ZME C;  2Y75 A;  3Q5F A;  4QIW N;  1SD7 A;  2A3S A;  1G3S A;  2OJE D;  3FKI J;  4LB5 A;  3QOD A;  4HDV A;  3KEO A;  4GRI A;  5J1U A;  4RGR A;  2K4J A;  3QP6 A;  4I76 A;  1ZK8 A;  3MFK A;  2W7N A;  1XSV A;  3OOU A;  1E0E A;  3GZ5 A;  4OOI A;  2ZO4 A;  2NAZ A;  5E17 F;  3WU2 C;  2HZD A;  4HLX A;  4IQJ A;  2A5W A;  1R6R A;  1AKH B;  3RPU A;  5L3C A;  3M1C A;  3QPH A;  4ZDO A;  3C2B A;  3KPH A;  3SXY A;  2LDU A;  5F08 A;  3ZQI A;  1TW2 A;  3FF5 A;  2IW5 A;  3F8C A;  2CV1 A;  2V4J C;  2XRN A;  4HQM A;  1SFE A;  2HS5 A;  1G4D A;  5GP9 A;  2JN6 A;  4L9J A;  4PJ0 C;  3MWM A;  2NVX J;  5FGM A;  2HKO A;  1PUE E;  5F27 A;  1X4O A;  3BQY A;  2A68 F;  1IN4 A;  3FHN A;  3GME A;  3DTE A;  3VPR A;  3QPT A;  3OIP A;  1ZH5 A;  1BL0 A;  4NB5 A;  1Z67 A;  1ETX A;  1R7J A;  2M8E A;  1MMN A;  5BS6 A;  1WZ2 A;  2EA2 A;  4G94 A;  2R5Z B;  1IUF A;  2V1U A;  2EB7 A;  3GZ6 A;  4X1E A;  2LD5 A;  2HDW A;  3GLL A;  1T0F C;  4BEH A;  1A6I A;  1ZLJ A;  1ZRF A;  5L3E A;  1UHW A;  2O3F A;  4C2T A;  1J2X A;  1I5Z A;  3ML6 A;  4ETS A;  2X1E A;  2ISY A;  1STZ A;  5F6F A;  3AL0 B;  1K4T A;  4OIP F;  4BQA A;  4KIC A;  2PMZ N;  3IUO A;  2KRF A;  4Y33 A;  3HRM A;  1N25 A;  4GXO A;  2ICW G;  4MIM A;  2DBB A;  2R7F A;  4XKB A;  1FX7 A;  2K4B A;  2J5P A;  1WFX A;  3BJ6 A;  4OWR B;  1T8I A;  2HPM A;  2JSC A;  3H36 A;  2WAQ A;  4HNT A;  2YSR A;  1ETW A;  4B3X A;  3OYD A;  2B9S A;  4B8X A;  2HNH A;  3EUA A;  1P92 A;  5E1Z B;  1MJA A;  5FD6 A;  5DM6 F;  1ZGA A;  1G59 A;  3PSF A;  2ELJ A;  3PNY A;  3ABU A;  3GTO J;  4N4O B;  4EJW A;  2XRO A;  4GFB A;  3CUO A;  1JT0 A;  1TWH J;  4AIH A;  1S72 I;  4E4H A;  2HYJ A;  4CCN A;  1TP4 A;  3QYE A;  2K9M A;  5FRO A;  1W1W E;  3FXQ A;  3M4O J;  2YUS A;  4ZJZ A;  4ZTF A;  3BG9 A;  4KN7 X;  1B6A A;  5DCM B;  2K02 A;  1I50 J;  1RZ4 A;  2QQ8 A;  3GTQ J;  5KK1 A;  1XG1 A;  4JP0 A;  3JSO A;  4EJO A;  3F8B A;  4HF1 A;  2D2W A;  1S7O A;  3LNQ A;  2VOD A;  5FB2 A;  1XMA A;  1IDZ A;  5E18 F;  1K83 J;  2LNB A;  3BQZ A;  2E35 A;  3E1S A;  3H0D A;  1BJA A;  2LK2 A;  4WF2 A;  1XS9 A;  2DT6 A;  5DYM A;  3BP8 A;  4BHC A;  1YI2 I;  2MGQ A;  2O6G E;  3IH3 A;  2KIF A;  4AVP A;  1OYW A;  5JLX A;  2JA6 J;  4BKX A;  4EM0 B;  1T98 A;  2LP0 A;  2L4A A;  5CYV A;  3VOD A;  3VEP A;  3F23 A;  1YIO A;  2C6Y A;  2G7U A;  3HL2 A;  9ANT A;  2HU9 A;  3A02 A;  2ID3 A;  3WTX C;  2K85 A;  2WBM A;  2Y0S A;  4ENM A;  2R5Y A;  2KZG A;  4QPO A;  4UHT A;  3E97 A;  5AON A;  4KIT B;  2KL4 A;  1SFX A;  3T8R A;  3GF2 A;  1OCR H;  1B72 B;  2V79 A;  2ECC A;  3OOP A;  1VQO I;  1UHM A;  1F9N A;  2LH9 A;  3BY6 A;  5IP7 J;  3OS1 A;  1U8R A;  2M4K A;  2YS9 A;  4F52 A;  1FSE A;  4HAM A;  1VFC A;  4YG2 F;  4HST A;  2QLZ A;  1MBJ A;  1X3U A;  4A3F J;  1Z05 A;  4AUX A;  1D8J A;  4XL9 A;  1TBX A;  2KMU A;  5CJ9 A;  4F91 B;  4HEA 2;  1W36 C;  1BI0 A;  4NC8 A;  2BHZ A;  4PCQ A;  2L01 A;  3L2W A;  1W5S A;  1GXQ A;  3HKZ N;  5D6F A;  4MQV A;  5KVR A;  4OIO F;  3M8F A;  4B4C A;  1N78 A;  4A3B J;  1J59 A;  3E3V A;  3NRV A;  2M7B A;  1YFH A;  4DYR A;  2L7Z A;  1YS7 A;  4FTH A;  1QNT A;  3LA7 A;  3K70 C;  2F6C A;  2GXB A;  2Q8K A;  2NNN A;  2Y2Z A;  3LAP A;  1X2M A;  2CUZ A;  3T5X A;  4ZTJ A;  1J7K A;  3IAS 2;  1G3T A;  2VKH A;  2PMU A;  1ZRE A;  3SEZ A;  4KA4 A;  4DOZ A;  2BV6 A;  3TGN A;  3HOZ J;  2FUG 2;  2BZT A;  3HC7 A;  1MNE A;  1HW1 A;  1Z77 A;  1ZAO A;  4BQO A;  1MJB A;  4ITV A;  3RZO J;  1OQY A;  2M34 A;  2ZFU A;  5DEQ A;  2X1D A;  1QVT A;  4DW6 A;  1KU2 A;  2HOE A;  4NQW A;  3KYD B;  3L9F A;  1Z0X A;  3HOU J;  1ZN2 A;  2WA0 A;  2H1L A;  5CVU A;  5BPD A;  2O61 A;  1O7F A;  5HOD A;  1WWX A;  3F21 A;  2K9Q A;  5E3L A;  3OMY A;  2FNP A;  4IOC F;  1H8A C;  2CUE A;  1ZAR A;  3WGH A;  4HV5 A;  2DK8 A;  1NHA A;  3ABL H;  4IL6 C;  4EQQ A;  4BE2 A;  3LAJ A;  1Y0U A;  1UMQ A;  3CC7 I;  2AHQ A;  3SDB A;  1SMY F;  1WH5 A;  4A93 J;  3KZZ A;  2LLK A;  5IP6 A;  4A6D A;  2VBY A;  5HDG A;  3OYE A;  3BR5 A;  1NK3 P;  1QHG A;  1JTX A;  1P4A A;  1BR4 A;  4Q48 A;  2FML A;  2DT7 B;  3A01 A;  1RPW A;  1MDM B;  2JRT A;  2KZV A;  2CSO A;  2E7X A;  2L9N A;  3QYF A;  4CO8 A;  5ICC A;  2DQR A;  5IPA A;  3E6M A;  1WJC A;  4LG3 A;  2QQ9 A;  3A0H C;  3IV5 A;  2LFB A;  2HVS A;  4M71 A;  1P4X A;  4JOM A;  2AXL A;  3RQI A;  2V9P A;  2H27 A;  2FX0 A;  1JGS A;  4NDL A;  2R5Y B;  4NC6 A;  1BR1 A;  4AID A;  1DU6 A;  4UUT A;  2ZFW A;  1YG2 A;  3IHU A;  2EFO A;  5F64 A;  2DCE A;  1QQI A;  2NVY J;  3P7N A;  3SFZ A;  1OCZ H;  2PMH A;  2ME6 A;  2BHY A;  2UZK A;  1S7A A;  1X4P A;  3CJQ B;  2IPQ X;  1NG7 A;  6PAX A;  3FMS A;  4D0P A;  2NVQ J;  4DZJ A;  2XPU A;  1YJ9 I;  1FWZ A;  5JLW A;  4NHJ A;  2A6H F;  3NAU A;  4EVI A;  3GCM A;  5TRD A;  4R79 A;  2QCO A;  2OQR A;  1ORK A;  1QGP A;  3GYH X;  2QSG X;  2BVM A;  5LHH A;  2DOF A;  4JK1 X;  1DU0 A;  3BG5 A;  1KU3 A;  1FBS A;  1R00 A;  2HYG D;  4E7I A;  1I1S A;  1Q1H A;  4Z2Y A;  3Q9S A;  1X1C A;  2XVC A;  1GHC A;  2HXI A;  3RZD J;  2V9K A;  3ZQL A;  2K9S A;  1K6O A;  4XOR A;  3H35 A;  2Z99 A;  2XDV A;  3AG2 H;  3KCC A;  3F8N A;  4HG2 A;  2LY2 A;  3WHB A;  3JRC A;  5FKL A;  2P6T A;  1X58 A;  1Y8Q B;  1IRF A;  2GOX B;  2PN6 A;  4I98 B;  2P7C B;  5GPC A;  4WXD A;  5IYC J;  4KYW A;  1RR8 C;  3MEX A;  1T39 A;  1ZG1 A;  2KFD A;  2MC4 A;  5EG0 A;  4OAZ A;  2JJ7 A;  2OQG A;  3RYR A;  2IRF G;  4RAG A;  4XM3 A;  1JKQ C;  2KRC A;  3DU5 A;  4PJL A;  4AWX B;  2AXT C;  2M45 A;  3PFI A;  4OIN F;  4J19 A;  2BGC A;  5LD2 C;  3K7A J;  1Z6T A;  1XC5 A;  2Z33 A;  3K4L A;  2DT5 A;  2DYS H;  4IXA A;  3ZR8 X;  5KCM A;  1YIT I;  4FX4 A;  4BAY A;  3M07 A;  2R7T A;  1SVO A;  2A05 A;  3OR2 C;  2ZKZ A;  2R0Q C;  1GDT A;  2XAU A;  2HVR A;  2K86 A;  1D0Z A;  2CO5 A;  1PP8 F;  4UB6 C;  2NS8 A;  5ICF A;  4KMU X;  1AA7 A;  3G1O A;  3CCQ I;  3M9A A;  4XN0 A;  2ELK A;  3F8F A;  3LFK A;  4WX9 A;  3FMR A;  3G73 A;  1CF7 A;  3F22 A;  4CGZ A;  3E0J B;  3WE3 A;  1UEL B;  4XLC A;  4LLG F;  5DTD A;  2FOW A;  1LFB A;  3HHG A;  1AHD P;  2R4G A;  2K7L A;  4MGR A;  2ESH A;  1IO2 A;  3F3X A;  1M1E B;  3BG7 A;  3KP7 A;  4J00 A;  3RPQ A;  1WJF A;  5FLX Z;  4FE4 A;  4LG0 A;  2OTJ I;  3CJR B;  1MH4 A;  4Q4Z F;  3ZRG A;  4CUG A;  2W25 A;  5F0H A;  1A5J A;  1Z6R A;  5H20 A;  2PJR B;  4LD5 A;  1VQK I;  4I7H A;  1G2H A;  2IA0 A;  4MFE A;  2XAJ A;  1AWC A;  2QEX I;  2L7K A;  5GAH J;  3WU0 A;  2NNY A;  2VBW A;  1TNT A;  3E5U A;  2AQE A;  2JT1 A;  1S6L A;  3F6V A;  4Y15 A;  4YIF A;  2PEX A;  5B3S H;  2JQ7 A;  2CRG A;  2E1M B;  4WCG A;  4YEL A;  2ZME B;  3QWL A;  4YFN F;  1U5T C;  4L9N A;  2ZBK A;  2GXG A;  1J09 A;  3CDL A;  5GAD J;  4XRS A;  1HBX G;  4CSW A;  1MBF A;  3O6B B;  4JX5 A;  3OYG A;  4HOB A;  3RKQ A;  3D1N I;  1FJL A;  1B1B A;  2ECB A;  2CUJ A;  2HQ5 A;  2XSJ C;  5J4Y A;  4M74 A;  3CLQ A;  5E3M A;  3LWF A;  1YW8 A;  4ZYA A;  5DD4 A;  1D5Y A;  4CA0 A;  1E2X A;  3K4B A;  4G7O F;  2XF7 A;  2DW4 A;  1JUP A;  4LLL A;  3A0B C;  1KQ9 A;  3CTA A;  1BIA A;  2BY0 A;  1BI1 A;  3K4K A;  2XGE A;  1JT6 A;  3H1C A;  4LB6 B;  5HS8 A;  3W6V A;  1WPK A;  1GV5 A;  3GEZ A;  1BW6 A;  4D9J A;  4AVZ A;  1A35 A;  1I1G A;  1MIJ A;  1LFP A;  4B47 A;  2XHK A;  3I71 A;  2VT3 A;  1SD4 A;  2KJC A;  3U21 A;  2KJB A;  2R93 J;  1TWA J;  3SFI A;  4DYQ A;  2VQL A;  1BR2 A;  1S9H A;  4DBQ A;  1G3W A;  1IUY A;  3HTU A;  4LIT A;  2CH0 A;  1G8X A;  2VN2 A;  2OU2 A;  5D5V B;  2BY3 A;  2LY9 A;  4RMN A;  1SEU A;  2JTV A;  1X2N A;  3MAJ A;  1MMS A;  1UG2 A;  4M6V A;  4RB0 A;  2VPL A;  2HWV A;  2W48 A;  2EFQ A;  3OYM A;  2A6T A;  2WY8 Q;  3JRB A;  4BHB A;  3CMY A;  3ECO A;  4S04 A;  3L7W A;  4HNV A;  3WTW C;  1X19 A;  1F1Z A;  1VF9 A;  3K70 D;  1D0Y A;  2DJI A;  3CC4 I;  3LSH A;  1GXP A;  2CQN A;  3I0T A;  3OSF A;  4PK4 A;  2Q0O A;  1X1D A;  3ZMZ A;  2XF5 A;  2MD0 A;  2OCE A;  2QEN A;  1SAX A;  4LJZ F;  3WGI A;  3WGG A;  1RUO A;  2IGO A;  2P0W A;  4LG0 B;  5J4V A;  4IHY A;  5LHG A;  3HPG A;  1XB4 A;  2VOP A;  2HQR A;  1HOM A;  5IT9 Z;  1ONV A;  2M7A A;  3GBG A;  1D1B A;  3H3V K;  3KZI C;  2CG4 A;  4JBA A;  2KLO A;  2L9V A;  1HKQ A;  4M9S A;  4I2O A;  2RKH A;  2ESN A;  5JHU A;  2XV4 S;  1UB9 A;  2L9S A;  2DFH A;  1YRN A;  2XGC A;  1R49 A;  1N77 A;  3JRD A;  3ZP5 A;  1U0J A;  3GO5 A;  4N9H A;  3LSK A;  3S14 J;  3H9J A;  3GTG J;  1D1C A;  2XAF A;  1W5C C;  3CMM A;  3DWL E;  5M5X J;  1GV2 A;  1V3F A;  1D5V A;  1DP7 P;  4XRM A;  2VKD A;  4ZH4 F;  4RAF A;  4HSR A;  1U5T A;  3R0A A;  3X2Q H;  2VE9 A;  4QPQ A;  4BBS J;  2WTE A;  3MZH A;  2VJ4 A;  2VC1 A;  3K4C A;  1QZY A;  5M3F J;  4WWC A;  2YX4 A;  4LK0 F;  2HOA A;  4XLP F;  1XGN A;  2BW3 B;  1IRX A;  2K9L A;  2DAO A;  4A2U A;  3GTM J;  1G6N A;  2DA1 A;  2KDO A;  5CPR B;  1QVU A;  1P7J A;  2G7H A;  4U7B A;  2H8W A;  2M0C A;  3P5J A;  3V8K A;  4ENN A;  3KP5 A;  4IZZ A;  1I6H J;  3R6S A;  3J7Y J;  1O7L A;  2P6S A;  3QPL A;  2EFW A;  4DYC A;  2R7X A;  1UST A;  3IAM 2;  2Y9Y A;  2M9H A;  4BEH B;  3WU1 B;  5HNH A;  3WTS C;  3CCS I;  1VI0 A;  3L1P A;  4A3M J;  3HOT A;  5ICE A;  2LYC A;  1DP3 A;  1Z1D A;  3SJM A;  4XRS G;  4F93 B;  2WAF A;  4LOC A;  3W6J B;  3PO3 J;  4B09 A;  2E1N A;  5CKT A;  4A3I J;  1PDN C;  5FRN A;  1MBH A;  2W00 A;  1ZR2 A;  1IN6 A;  1ENH A;  1ZKG A;  1OPC A;  1WQ2 A;  4A3C J;  3ABM H;  4ZZD A;  1ZG5 A;  2VOO A;  1I3A A;  1A6Q A;  1Y56 A;  3DLL F;  2IS6 A;  4I0B A;  5K5Q A;  1BI3 A;  4F7Z A;  4EJT A;  2OPT A;  2ZXJ A;  2A6E F;  2D5V A;  2RGV A;  1TQI A;  2R7U A;  1P2F A;  1TQP A;  1FYK A;  3KEY A;  1DQU A;  2DOE A;  1R5I D;  2DTR A;  5B66 C;  1VTN C;  4MEX F;  2Y0M A;  1HSJ A;  1MW7 A;  1OKR A;  1FBU A;  4R8H A;  1BM9 A;  2NYX A;  5A2Q Z;  4LMY A;  1KON A;  2X85 A;  4XNF A;  1MSF C;  2E2I J;  2UV1 A;  1Y1W J;  3ELK A;  3TDZ C;  3S32 A;  3BG6 A;  4RAZ A;  4XSZ F;  2IT0 A;  3DPU A;  3B6A A;  5GAG J;  2JUC A;  5M3M J;  5FLM J;  3TDU C;  3H5A A;  3KP4 A;  3QPS A;  4IJA A;  1ETO A;  1L3L A;  4MFD A;  1YOV B;  2CGP A;  2GM4 A;  2K9N A;  1BA5 A;  1MMA A;  3OYF A;  3QRF F;  2FE3 A;  2PMZ A;  3ZMV A;  2WWY A;  2IGK A;  4P1W A;  2FQ3 A;  4XLF A;  4KMF A;  1ZHF A;  4CZC A;  1H9T A;  2K5C A;  5BNG A;  2CJJ A;  1QRY A;  2H6C A;  5BPI A;  4UVA A;  3GXO A;  4E7S A;  5EEH A;  3ZMS A;  4A12 A;  2V1X A;  1APL C;  1JXS A;  2XKP A;  3M8E A;  4GCV A;  4UXN A;  5LGN A;  1KU7 A;  5TJJ A;  3S93 A;  4HYE A;  5L3G A;  2NS7 A;  2L5Q A;  2EZL A;  1SVL A;  2DQL A;  3PNT A;  1XGO A;  3IKV A;  4M9X A;  1QU3 A;  2D45 A;  4NC7 A;  3PFY A;  2BE5 F;  2E5Z A;  1SC7 A;  3W2V A;  4EJV A;  1RKW A;  4L0Y B;  2HR3 A;  4CIC A;  3OYK A;  2JUG A;  3DFG A;  1K79 A;  2EQR A;  4UUV A;  4AIJ A;  4YRV A;  2VL8 A;  1BIB A;  3FDY A;  5CLS A;  4Y13 A;  2V9V A;  3HGG A;  3WTY C;  2DMP A;  2P81 A;  3RKX A;  1UG0 A;  3RYP A;  3ECH A;  3V8L A;  4L5E A;  1B8I B;  2GIV A;  4LLN A;  4M3F A;  4DZP A;  3UNG C;  1HQC A;  3LL7 A;  5IYB J;  1V5G A;  3I5U A;  3G4S I;  2I8D A;  1F43 A;  1KYZ A;  3RQ4 A;  5LFA A;  2FEZ A;  3DKX A;  3ESW B;  3CP2 A;  3E6D A;  3EQL F;  1W7P A;  5FRM A;  3TO9 A;  2UXN A;  2W1O A;  1SAN A;  1AU7 A;  2KIS A;  5FKO A;  3S3O A;  3C2H A;  1VZ0 A;  3JSP A;  1LQ1 A;  4BE1 A;  1A36 A;  2DPD A;  2DMN A;  2E5N A;  3KP6 A;  4E7J A;  3IC7 A;  5HVQ C;  5L3F A;  2NVU B;  2O5R A;  4ZYD A;  4M3D A;  4IX7 A;  2Z2S B;  4BNC A;  5EG0 B;  1NK2 P;  5L3B A;  3GFI A;  5KAI C;  2E7W A;  2QQA A;  2VQC A;  1VQ9 I;  3ASO H;  3KZY A;  3BDD A;  3A4C A;  1F36 A;  3CES A;  4YII A;  5KHD A;  3C2G A;  2A69 F;  3WG7 H;  3J80 K;  5TIS C;  2X4H A;  2QBY B;  3HRS A;  1FTZ A;  5LRR A;  4GO1 A;  4CHU A;  1WGX A;  2DU9 A;  4WK8 F;  4A3D J;  2Z5U A;  5IY5 H;  2IXS A;  4I0A A;  2HOS A;  1O3T A;  4KNY A;  1EH6 A;  2O0Y A;  4BU2 A;  5M5W J;  1FLI A;  1FTT A;  3DTI A;  5CVI A;  2IGN A;  3HSF A;  1BOA A;  5JI6 A;  1MH3 A;  5B1B H;  1Z9C A;  3MD2 A;  1UZC A;  2WAE A;  1BOB A;  2QVO A;  1LDD A;  3O8G A;  4HBL A;  1FMW A;  1UAA A;  2Q2E A;  3OYH A;  2EIK H;  2ELH A;  2IBD A;  4X6A J;  4M72 A;  1VQ8 I;  1JE8 A;  2IEK A;  4BXF A;  5K1Y A;  3TO7 A;  4G9Y A;  3UR3 C;  1HXD A;  3HB9 A;  1BC8 C;  3E7L A;  1SFO J;  5EJC A;  3KX2 A;  2GIZ A;  3LMM A;  3CC2 I;  1EF4 A;  3I55 I;  1GUU A;  2CFX A;  2CU7 A;  2TRT A;  3G1L A;  3GTJ J;  2W84 A;  3CCU I;  2FXA A;  5J40 A;  1Y6I A;  4MLO A;  2RC4 A;  3DLA A;  3OL4 A;  4XK4 A;  2LRE A;  3TW7 A;  4PZJ A;  1FEX A;  3M8J A;  4XLA A;  4C9Y A;  2P5V A;  1WCM J;  5JHF A;  3JAM K;  1S7E A;  1TL8 A;  3TMO A;  3JAM Z;  4OMY A;  4O3M A;  2YR2 A;  1WJD A;  2IJL A;  4M6X A;  1UJ8 A;  3OV8 A;  3MVP A;  3HHH A;  2IGM A;  3A1Y A;  4HX4 A;  3CCL I;  2M5W A;  2CV0 A;  4HA8 A;  4OMZ A;  2BY2 A;  4PJN A;  3ZCO A;  4A5N A;  1Z91 A;  3HM5 A;  5KNL A;  4BGD A;  4PFP A;  5IT3 A;  4ENK A;  1TTY A;  2DA4 A;  3FXO A;  3BZK A;  1TW3 A;  1WSU A;  3MZY A;  4D5F A;  2QWW A;  4FAS D;  3D5R C;  4ESJ A;  2VB6 A;  2ZB9 A;  2QKL B;  4RDU A;  5DV5 A;  2FJ1 A;  1F4K A;  3VB2 A;  1OYY A;  3BC8 A;  5J1R A;  2H8R A;  2RNJ A;  5D4S A;  1R5H A;  4CCL A;  1YQA A;  4AU7 A;  3OYJ A;  2LOO A;  2DOA A;  1LB2 A;  5BQT A;  5JVT A;  2M8G X;  3CCY A;  1OCT C;  1LPQ A;  1FY7 A;  3JCU C;  3PM1 A;  3V8J A;  2EFN A;  1OIS A;  5HOO A;  4Y3O A;  2DDB A;  1D0X A;  4G12 A;  5K7H A;  3LA2 A;  4LIU A;  2AO9 A;  3NWT A;  5DDG A;  1W0U A;  1H89 C;  1V5F A;  2MYS A;  3RTR A;  2EIN H;  5K5R A;  5J6X A;  3TW6 A;  2CW0 F;  3NAR A;  1HST A;  3DTK A;  3OS0 A;  1H88 C;  1I3Q J;  1WH7 A;  2BXY A;  2JVH A;  4AM3 A;  1YLF A;  2E1M C;  2DOD A;  1Q1V A;  3L09 A;  1R22 A;  2A61 A;  4UUS A;  5D8K B;  3OYN A;  2P5K A;  2BBY A;  4KUM A;  3U1D A;  2XKO A;  4RGX A;  2IS1 A;  5F04 A;  5CQG A;  3G3Z A;  3BWG A;  3ZMU A;  3ZMT A;  2XAS A;  4MQ9 F;  3I53 A;  3OYI A;  3KYL A;  3LSP A;  4HV6 A;  4A0Z A;  1U9O A;  3TKY A;  4ABZ A;  4IO9 F;  3K4N A;  2FRH A;  1AKH A;  1X1B A;  3UKG A;  2R3S A;  2NOJ B;  3SZT A;  3OYL A;  4L5I A;  4NQW B;  3NQO A;  2Y48 A;  2DXI A;  4MEY F;  1LVK A;  2RVC A;  5H6Q A;  2G9W A;  2HDC A;  4IOA F;  4RBO A;  2R7R A;  3BZC A;  2DFF A;  3GFM A;  3HG9 A;  5K5O A;  5AIQ A;  3HSE A;  3QU3 A;  1P9Q C;  3CF2 A;  4ANJ A;  1FOW A;  2L02 A;  2WV1 A;  3U1K A;  1YIJ I;  3SYT A;  1K78 A;  5J47 A;  2B0L A;  2AS5 F;  1BN5 A;  2E60 A;  2EA4 A;  3O2P E;  1Z7U A;  2JWT A;  4B44 A;  2R7D A;  4A3E J;  4HW0 A;  3I59 A;  4HDU A;  3S17 J;  1P7I A;  5J8F A;  2VKE A;  2OC6 A;  2KQR A;  1UCR A;  3CP8 A;  2I5U A;  3JRE A;  2VPR A;  2ZME A;  2GXA A;  3PL8 A;  5DS9 A;  1LEA A;  4JX4 A;  3HZJ A;  1VQN I;  3H3Z A;  2I10 A;  3DPL C;  2IS2 A;  3AAF A;  1T0F A;  1E3H A;  5JVG F;  2ZSH B;  5C4J J;  3CO6 C;  2LY1 A;  4L0Z B;  3EDP A;  3AG4 H;  2VON A;  1K6Y A;  3FM3 A;  4UUS B;  3LSM A;  1B9M A;  2OAZ A;  4GYI A;  1PP7 U;  3JRF A;  2E1C A;  2FMY A;  3DBR B;  1R23 A;  4RM2 A;  3C1D A;  1KGS A;  4A3G J;  2ADU A;  3BPV A;  3ZN0 A;  1B72 A;  3HJE A;  3R4K A;  4CCK A;  4JYK A;  2EK5 A;  1RNL A;  3BRO A;  3I4P A;  1XD7 A;  2O8X A;  2DMQ A;  2OUM A;  2ZC2 A;  5E79 C;  5A2Q K;  1WVR A;  2CUF A;  3GZN B;  3HSR A;  2VE8 A;  4QWQ A;  2COM A;  2IA1 A;  2MA3 A;  1VQM I;  3GFJ A;  3BCA A;  4BY1 J;  4UV9 A;  1FPQ A;  4ON0 A;  4EV0 A;  1UFM A;  1OR7 A;  1U2W A;  3CCM I;  1Y39 A;  2PBI A;  5BMZ A;  3F72 A;  3S16 J;  3GFL A;  4B43 A;  3G1M A;  3DF8 A;  3ZQ7 A;  1CF7 B;  2BW3 A;  2E1O A;  1FC3 A;  4V19 K;  3KEQ A;  4LIV A;  4RAY A;  5FJ8 J;  1RKT A;  1H0M A;  2FBK A;  2R7Q A;  2VIX A;  1ULY A;  5ICG A;  3LSJ A;  3GTK J;  1Z21 A;  3MCZ A;  3ZQQ A;  5EEA A;  1T2K A;  5DM7 F;  3CME I;  3U2R A;  4AYB N;  4HRI A;  5HNF A;  2CFO A;  3IRR A;  2F4O B;  3LQR A;  2VBZ A;  5J1Y A;  1VND A;  3S1Q J;  5IOZ A;  3ASN H;  2XAH A;  3V7S A;  3DXJ F;  1GLN A;  3L2Q A;  4OIQ F;  5HS9 A;  3ABT A;  3V7C A;  1HW2 A;  5E20 A;  1S3J A;  3E6B A;  4MO7 A;  4QTR A;  2EJR A;  1IXR C;  1P4W A;  3Q0W A;  4CZZ A;  2H1K A;  2IS4 A;  1OYI A;  1T95 A;  5JFR A;  2IA2 A;  3AG3 H;  4U88 A;  1OFC X;  4UVC A;  2H6B A;  1DGW Y;  1FYL A;  2TDX A;  2JA5 J;  4AC0 A;  3AKZ A;  1PJR A;  3P9K A;  2IP2 A;  2X51 A;  3BR2 A;  3E5X A;  3IH2 A;  5ED4 A;  4C3H J;  5KAF C;  2XSD C;  3IP4 B;  2EV5 A;  4UVB A;  2BYV E;  1R1T A;  3FX3 A;  3M3Y J;  4YIR X;  1ACI A;  2W82 A;  3I54 A;  1MDM A;  1YW7 A;  4L5J A;  3ZQH A;  3HRU A;  5L3D A;  5DD8 A;  2Q2E B;  1IG7 A;  3HOW J;  3LSR A;  5ILV A;  3TOA A;  3CD6 I;  1QO0 D;  3OS2 A;  4MTE A;  2V1D A;  3E5Q A;  1RIO H;  3VYR B;  3JRI A;  4HZF A;  3MKW B;  4L9V A;  3OYA A;  2JA7 J;  1MSE C;  3PUB A;  1R36 A;  4L18 B;  1DPU A;  1N75 A;  1KQ0 A;  3D5L A;  4J01 A;  2NRA C;  2JZY A;  4Q5S F;  4OIR F;  2ZJR F;  3W2A A;  2ID6 A;  2ZXI A;  2KPM A;  3FXK A;  2OZU A;  2V26 A;  2K27 A;  4E7K A;  4EM1 A;  1DPR A;  5ERI A;  1P6R A;  1J0R A;  1GVJ A;  2HXO A;  4V2F A;  1HKS A;  3BLY A;  2DMU A;  2QUF A;  3BTL A;  4XKW A;  1XGS A;  5AIP A;  4KT5 C;  3J81 K;  4IVN A;  1WJE A;  3Q0U A;  3CJN A;  5IYD J;  1OMI A;  1HKT A;  1A04 A;  2MAB A;  3HIF A;  2ZJQ F;  2R7O A;  3TBI A;  5IOY A;  1ITY A;  4KIB A;  1YO5 C;  1FOK A;  2CMP A;  3FIW A;  1MND A;  3D5S C;  4F55 A;  3WTU C;  2QF7 A;  3HGY A;  4G7H F;  3GTP J;  1JHF A;  1FIA A;  2M1B A;  1ZYR F;  2F5F A;  1TLH B;  2DDA A;  4PGG A;  5LGU A;  3T8T A;  2EFP A;  4DIQ A;  3NWS A;  5LEJ A;  2HZT A;  2DA6 A;  2EZH A;  5BOX A;  2OCC H;  1RET A;  3H92 A;  2QM3 A;  3I3L A;  4EGZ A;  2X9D A;  2BVL A;  4EEF G;  3FZV A;  2MLG A;  3OYB A;  2EWN A;  2LKX A;  1IGN A;  2NOG A;  4UB8 C;  3GUD A;  3MKZ A;  2K3P A;  3MMY B;  3OIQ A;  1B59 A;  1JUM A;  3B6C A;  5IT9 K;  2CV2 A;  1ETK A;  3TL4 X;  3HXL A;  1LNW A;  3I4M J;  1UHS A;  4G6D A;  3N97 A;  1LE8 B;  3COA C;  4D5C A;  2PFB A;  2LKS A;  3S1N J;  4PSX A;  2VJI A;  3FBN B;  4GDF A;  4EMS A;  3JRH A;  2GOM A;  3K9T A;  4MHG A;  4BY7 J;  1MMG A;  3DBL B;  4D7M A;  2F5E A;  1LEB A;  3HOS A;  1SD5 A;  2FF4 A;  1LE8 A;  2B63 J;  1K4S A;  2COB A;  2EV6 A;  3S2H J;  2R7Z J;  4ZDP A;  5K7Z A;  4BL0 B;  4NNJ A;  5GAE J;  4P9F A;  1MJ9 A;  1IN7 A;  2YU3 A;  2EIL H;  3B73 A;  4PDK A;  3RDI A;  3SHF A;  3LST A;  3VYT B;  2JRM A;  2P7V B;  2HFH A;  2DPU A;  1J5Y A;  5C3E J;  3Q9V A;  3TQN A;  1YJW I;  2ACJ A;  1J9I A;  3V4G A;  2P4W A;  2L2O A;  4BJT A;  3L2C A;  2JVG A;  3ZPL A;  4IHT A;  3RKY A;  4A0Y A;  4CCJ A;  4ESF A;  2OZ6 A;  1KZH A;  1GVD A;  4IRG A;  2Z9O A;  4ZYH A;  4BYY A;  2XIG A;  2QGU A;  2VKV A;  3REO A;  2LF8 A;  3V7R A;  2JA2 A;  1JHH A;  4XN3 A;  2P8T A;  3K4M A;  5LEK A;  2XC7 A;  1RR7 A;  4BXX J;  1R1V A;  3KFW X;  2FU4 A;  3DQV C;  1W36 D;  4U7D A;  2HKX A;  1KYW A;  4RGS A;  1IAW A;  5M5Y J;  1OCO H;  2H94 A;  2O7O A;  3DEE A;  4UV8 A;  5LBQ A;  2XPW A;  1XCV A;  2YX7 A;  3CDH A;  1ON1 A;  1VQL I;  2M0M A;  4GGG A;  2CS3 A;  3RPU D;  2F5C A;  2YPR A;  1O4X A;  2KIM A;  3DU6 A;  2L54 A;  2LKP A;  2UXX A;  3DBH B;  1R5G A;  5EZH A;  5H6R A;  1J75 A;  2DK5 A;  2Y9Z A;  3K10 A;  3IWF A;  1ZGJ A;  2M30 A;  3OY9 A;  1BI2 A;  4A3J J;  3R60 A;  5GPA A;  3ZXS A;  1ETV A;  2KT0 A;  2D1H A;  4U0Y A;  3OYC A;  2ISZ A;  2MD5 A;  3DKY A;  5GTI C;  4QSH A;  1XDU A;  2DTZ A;  1NG6 A;  3RIR A;  2QSF X;  4FX0 A;  2Q1Z B;  2PG4 A;  5EDN A;  3OIO A;  3JTG A;  2RNG A;  2X1C A;  1ZRC A;  2V1N A;  3G71 I;  2HOT A;  4PGH A;  3FXJ A;  3GX4 X;  3W3C A;  5DCM A;  3HBL A;  2EV0 A;  1FMV A;  5J3L A;  1POG A;  2F5V A;  4BS9 A;  5FKK A;  5J8C A;  2KHM A;  3WE2 A;  2Z3Y A;  4CCO A;  2E2H J;  2DA3 A;  2VJJ A;  1EV7 A;  2M2E A;  3BZ6 A;  4C3J J;  3CCE I;  3NEU A;  3TO6 A;  1JJ6 C;  3HKZ A;  3O8H A;  3MKY B;  2V7F A;  1JTY A;  2F4I A;  2PX9 A;  4M73 A;  4BJ5 C;  3R0J A;  2R5Z A;  1Y8R B;  5LRS A;  3BR1 A;  1A31 A;  1LDK B;  1IN8 A;  1Y1V J;  3ERM A;  5E3N A;  4CYC B;  2OTL I;  2ZSI B;  1HF0 A;  2YU9 J;  1XCB A;  1T33 A;  2X6O A;  3DCF A;  2GQQ A;  1O57 A;  3IWZ A;  2J5O A;  2L7F P;  3JR9 A;  1JKR C;  2B7E A;  2XAG A;  4AD9 A;  3CZ6 A;  2QYO A;  4II3 A;  3CQZ J;  1MBK A;  2ETH A;  4ESB A;  3PIO F;  4FET A;  2FBH A;  1V4R A;  3GW2 A;  3G6E I;  2QSH X;  2ME0 A;  3HPH A;  4L9T A;  4IRH A;  1XDS A;  3ZQC A;  3F9K A;  2E19 A;  2EBI A;  3BJA A;  3QU6 A;  1WRJ A;  2OA4 A;  2VI6 A;  2XAQ A;  4FIS A;  4RS8 A;  5H2F C;  1ZR4 A;  3PJR A;  1U78 A;  3VYS B;  4ZDL A;  2MG4 A;  2VBX A;  4S0H B;  2R7V A;  1Z3Y A;  4XKV A;  2VXD A;  2A5Y B;  3ZMD A;  1VQ5 I;  1B9N A;  4U0V A;  1LJ9 A;  2JSP A;  2QBY A;  3TED A;  4JQF A;  4IF4 A;  1I39 A;  3HYI A;  1XN7 A;  1Y0N A;  4MTD A;  4E6K G;  3EUH A;  3GVA A;  3MKL A;  3S2W A;  1IJW C;  1DUX C;  1MNM C;  2PLY A;  5F0C A;  1IRG A;  4C2M J;  3MZ8 A;  3V42 A;  3IH4 A;  3KE2 A;  5EYR A;  3L00 A;  2AQF A;  2OV7 A;  2LC2 A;  3SDG A;  4EAT A;  5D5U B;  1R9T J;  3KYC B;  4IHW A;  1W4M A;  4NUB A;  1WJA A;  3A2K A;  4ZYG A;  2JMW A;  2CQK A;  1SAU A;  3W6K B;  2Y69 H;  1T38 A;  4CXF A;  1FSH A;  3VDX A;  4AIK A;  4Q47 A;  4CH7 A;  2HGC A;  1SD6 A;  2LBF B;  4F3Q A;  3PNV A;  1CGP A;  3AG1 H;  2XGX A;  4BQQ A;  3T1B A;  2BEO A;  4E7Z A;  4A3L J;  1VQP I;  1OCP A;  3DKW A;  2HEO A;  4YFX F;  3FKJ A;  1ZGW A;  5DUI A;  2MBF A;  2WB1 N;  4WXC A;  4FE7 A;  2X48 A;  1TWC J;  4XRF A;  3N05 A;  2XF6 A;  5B1A H;  4IPA A;  4Y52 J;  4P96 A;  3J80 Z;  4EGY A;  3CUQ C;  4I99 C;  4A5M A;  1LVA A;  1TZL A;  2O03 A;  4PUS A;  3KLO A;  1IV6 A;  2ZNY A;  1Z7L A;  1IF1 A;  2F2E A;  4D1Q A;  3J7A Y;  4XOT A;  2X6W A;  1OR7 C;  3S1M J;  4XMY A;  1W5T A;  3VFZ A;  5GTH C;  2OF7 A;  2ZCW A;  4KJZ A;  1S5L C;  1JUS A;  3ZN1 A;  2ZXH A;  5E8G A;  4BHP A;  1HA8 A;  1NTC A;  2MW8 A;  2BOL A;  2UUZ A;  4RM3 A;  2IAI A;  1HDD C;  4B1R A;  3K4J A;  1EH7 A;  2VQH A;  3FM5 A;  2ZXW H;  1ZLK A;  1BBY A;  3IL2 A;  4I02 A;  2R92 J;  4M6Y A;  1SMT A;  2DI3 A;  2M87 A;  1XSD A;  5E1W A;  1PUF B;  3EET A;  1ZG3 A;  4UY8 I;  4ZZL A;  3O3K A;  1MD0 A;  3A03 A;  4LFU A;  1FT9 A;  3DV8 A;  2BXZ A;  3CCV I;  5EZG A;  3HUG A;  2JPC A;  2L3D A;  3C18 A;  2M3A A;  3GLX A;  1E3P A;  2LBF A;  4WXH A;  1U3E M;  3GTL J;  4BE0 A;  3BR6 A;  2HQA A;  2CWE A;  5B5E C;  2LG4 A;  2X6Y A;  1JI8 A;  3JW4 A;  2MC3 A;  4M9Z A;  3S8P A;  3I56 I;  4DQ2 A;  1FOX A;  4U87 A;  4IHV A;  4Y7N J;  3BTC A;  2OD5 A;  2QQB A;  1SFU A;  2JK3 A;  2L0K A;  2FNA A;  1S29 A;  5CVJ A;  2GBY A;  4M3E A;  3EUH C;  1YX3 A;  3BG3 A;  3ZOB A;  4K2E A;  3CCR I;  3LSI A;  1IN5 A;  3LA3 A;  2PQ8 A;  5LGT A;  5HS7 A;  1WHU A;  1U8B A;  1T08 B;  4FHT A;  4XR6 A;  3K0L A;  2FOK A; 
#chains in the Genus database with same CATH homology
 3WTT C;  1QZZ A;  2XUB A;  3M1E A;  4ENJ A;  1C0W A;  2VC0 A;  1IZ1 A;  4G6Q A;  4RB1 A;  3N4M A;  3K69 A;  1MKM A;  2FSW A;  3HRT A;  1O3S A;  1TNS A;  1KQ8 A;  4XLN F;  2A07 F;  1I6X A;  2F5D A;  1W7P D;  2D1V A;  4P9U A;  3T0Y A;  4I09 A;  2P5L C;  4RB3 C;  4ASN A;  1ODD A;  2STT A;  1XMK A;  4A6E A;  3EYY A;  3MQ0 A;  3P9C A;  4KFC A;  1D3Y A;  5HLH A;  1FP1 D;  2LF7 A;  1LDJ A;  3K2Z A;  2GAU A;  3CUQ B;  1FZP B;  2RN7 A;  2CYY A;  5D6E A;  2LSO A;  5E8I A;  3K1M A;  2STW A;  3BPX A;  4OU0 A;  4EM2 A;  1XGM A;  4LGW A;  5D4R A;  1FYM A;  4H0E A;  4DNC A;  2W24 A;  1IW7 F;  3FMQ A;  3U9G A;  2PI0 A;  2JPB A;  4MNU A;  5LHI A;  4RB2 C;  4CYD A;  5D5X B;  4ZYE A;  4CDG A;  1T6S A;  3E6C C;  1IXS B;  1H9G A;  1FNN A;  4HF0 A;  3M7G A;  4E70 A;  3SQN A;  4HX8 A;  2FBI A;  3F6O A;  2W85 A;  3K1P A;  3DEU A;  3I64 A;  3ROU A;  2GWR A;  2ZJ2 A;  4TV7 A;  4FT8 A;  3J7A O;  5JR3 A;  3I58 A;  1KU9 A;  2DLL A;  3BOQ A;  1WI9 A;  1MZB A;  3WTZ A;  1XSX A;  2L4M A;  4HLY A;  4N9I A;  5CVR A;  4IRI A;  1B4A A;  5FFZ A;  4UNO A;  3ULQ B;  3PQJ A;  3RKW A;  2RDP A;  3DPT A;  5ILU A;  2V6C A;  4U0W A;  5HDN A;  1QPM A;  5HLG A;  2X0L A;  2GZW A;  1BC7 C;  5F1R A;  3B02 A;  4G7Z F;  1EH8 A;  1U6G A;  4XBF A;  3GWZ A;  4A0X A;  4HX7 A;  3KP3 A;  2MH2 A;  5FD5 A;  3QOP A;  4R1H A;  3FXU A;  4XSX F;  1O3R A;  4HQE A;  2UWM A;  3DP7 A;  1YW9 A;  3FHZ A;  1L0O C;  3CUQ A;  3F8M A;  4KN4 X;  3H3U A;  2HYF A;  1FBQ A;  3D0S A;  2KIU A;  3PQK A;  1WKM A;  3IKT A;  3QP5 A;  4KDP A;  5EEG A;  2FA5 A;  1G3Y A;  2KKO A;  4Y17 A;  5HLI A;  3WTV C;  1USS A;  2H09 A;  2MH9 A;  1I27 A;  1O3Q A;  1TQM A;  3FWE A;  4KIG A;  5D8L B;  3C3W A;  3ISP A;  3FXR A;  2PJP A;  4P55 A;  2GA2 A;  3KLN A;  1R1U A;  2WV0 A;  3VOE A;  4RGU A;  4O5V A;  3K1N A;  2VXZ A;  2QZ8 A;  2OBP A;  5E1X A;  4O6J A;  5FLX K;  1DDN A;  2HQN A;  3R61 A;  4I01 A;  1D8K A;  1ON2 A;  1YTY A;  1KA8 A;  2DFI A;  1ZRD A;  5FFX A;  4HF2 A;  4BXU A;  4KIF A;  3ERE D;  1REP C;  1RUN A;  5HDK A;  1YS6 A;  3C7J A;  1U5T B;  1HW5 A;  1S8N A;  4EJU A;  3RI4 A;  1E17 A;  5ILS A;  1IXC A;  3TOB A;  5FO5 A;  3WG9 A;  3P9I A;  2RQP A;  1F5T A;  4N0B A;  4GYG A;  2IVM A;  4G8X A;  3SZP A;  3CLO A;  1QBJ A;  5DUK A;  3KP2 A;  1RI7 A;  4BH9 A;  2DO7 A;  3EYI A;  2HTJ A;  3CO7 C;  2NS0 A;  2W57 A;  3QAH A;  3KET A;  4LK1 F;  2ZNZ A;  2HTS A;  3WOD F;  3J81 Z;  1AOY A;  4P5O A;  5D5W B;  1W7P B;  3BJO A;  4QLC U;  3JTH A;  1R58 A;  3HTS B;  5DCF A;  1MGT A;  4IHS A;  4S05 A;  3RJP A;  2VT2 A;  3I59 B;  5LLQ A;  2WC2 A;  3LQQ A;  1K7A A;  2GA1 A;  3IRQ A;  2MLK A;  5CVV A;  1FP2 A;  2RV8 A;  1YYV A;  1K78 B;  4YFK F;  2Y75 A;  3Q5F A;  1SD7 A;  2A3S A;  1G3S A;  4LB5 A;  4HDV A;  3KEO A;  4RGR A;  2K4J A;  3QP6 A;  3MFK A;  1XSV A;  3GZ5 A;  4OOI A;  2ZO4 A;  2NAZ A;  5E17 F;  4HLX A;  3RPU A;  5L3C A;  3QPH A;  3SXY A;  2LDU A;  1TW2 A;  3FF5 A;  2IW5 A;  3F8C A;  2XRN A;  4HQM A;  1SFE A;  2HS5 A;  1G4D A;  4L9J A;  3MWM A;  5FGM A;  2HKO A;  1PUE E;  2A68 F;  1IN4 A;  3QPT A;  1ZH5 A;  4NB5 A;  1R7J A;  2M8E A;  5BS6 A;  2EA2 A;  4G94 A;  2V1U A;  2EB7 A;  3GZ6 A;  1ZLJ A;  1ZRF A;  5L3E A;  1UHW A;  2O3F A;  1J2X A;  1I5Z A;  3ML6 A;  4ETS A;  2ISY A;  1STZ A;  5F6F A;  4OIP F;  4BQA A;  4KIC A;  2KRF A;  3HRM A;  4GXO A;  2DBB A;  2R7F A;  1FX7 A;  2K4B A;  2J5P A;  3BJ6 A;  2JSC A;  2YSR A;  4B8X A;  1P92 A;  5E1Z B;  1MJA A;  5FD6 A;  1ZGA A;  3ABU A;  4EJW A;  2XRO A;  3CUO A;  4AIH A;  3FXQ A;  4KN7 X;  1B6A A;  5DCM B;  2K02 A;  1RZ4 A;  5KK1 A;  3JSO A;  4HF1 A;  4EJO A;  3F8B A;  2D2W A;  1S7O A;  2VOD A;  5FB2 A;  1XMA A;  5E18 F;  2LNB A;  1BJA A;  4WF2 A;  5DYM A;  3BP8 A;  4BHC A;  2O6G E;  2KIF A;  4AVP A;  1OYW A;  4EM0 B;  1T98 A;  2L4A A;  5CYV A;  3VOD A;  3VEP A;  3F23 A;  1YIO A;  2C6Y A;  2G7U A;  3WTX C;  4ENM A;  4UHT A;  3E97 A;  5AON A;  1SFX A;  3T8R A;  3GF2 A;  2V79 A;  3OOP A;  1UHM A;  1F9N A;  3BY6 A;  1U8R A;  1FSE A;  4HAM A;  4YG2 F;  2QLZ A;  1X3U A;  1Z05 A;  1D8J A;  1TBX A;  5CJ9 A;  1BI0 A;  4PCQ A;  2L01 A;  4OIO F;  1W5S A;  1GXQ A;  5KVR A;  5D6F A;  4MQV A;  3M8F A;  1J59 A;  3E3V A;  3NRV A;  1YFH A;  1YS7 A;  1QNT A;  3LA7 A;  2GXB A;  2Q8K A;  2NNN A;  3LAP A;  3T5X A;  1J7K A;  1G3T A;  2PMU A;  1ZRE A;  4KA4 A;  2BV6 A;  3TGN A;  1HW1 A;  1ZAO A;  1MJB A;  5DEQ A;  1KU2 A;  2HOE A;  4NQW A;  3L9F A;  1ZN2 A;  5CVU A;  5BPD A;  2O61 A;  1O7F A;  1WWX A;  3F21 A;  2FNP A;  1ZAR A;  3WGH A;  4HV5 A;  2DK8 A;  1NHA A;  4EQQ A;  3LAJ A;  1Y0U A;  1SMY F;  3KZZ A;  4A6D A;  2VBY A;  5HDG A;  1P4A A;  4Q48 A;  2FML A;  1MDM B;  2JRT A;  2CSO A;  2E7X A;  4CO8 A;  5ICC A;  2DQR A;  3E6M A;  2QQ9 A;  4M71 A;  1P4X A;  2AXL A;  2H27 A;  1JGS A;  2ZFW A;  1YG2 A;  3IHU A;  2EFO A;  5F64 A;  1QQI A;  3P7N A;  3SFZ A;  2PMH A;  2UZK A;  1S7A A;  2IPQ X;  6PAX A;  3FMS A;  4D0P A;  1FWZ A;  4NHJ A;  2A6H F;  4EVI A;  5TRD A;  4R79 A;  2OQR A;  1QGP A;  3GYH X;  5LHH A;  4JK1 X;  1KU3 A;  1FBS A;  1R00 A;  2HYG D;  1I1S A;  1Q1H A;  4Z2Y A;  3Q9S A;  2XVC A;  1GHC A;  1K6O A;  2Z99 A;  3KCC A;  3F8N A;  2P6T A;  2PN6 A;  2P7C B;  1IRF A;  4I98 B;  4WXD A;  4KYW A;  3MEX A;  1T39 A;  1ZG1 A;  2OQG A;  3RYR A;  2IRF G;  4AWX B;  2M45 A;  3PFI A;  4OIN F;  2BGC A;  2Z33 A;  1Z6T A;  2DT5 A;  4IXA A;  4FX4 A;  4BAY A;  2ZKZ A;  2K86 A;  2CO5 A;  1PP8 F;  5ICF A;  4KMU X;  3M9A A;  3LFK A;  3F8F A;  4WX9 A;  3FMR A;  3G73 A;  1CF7 A;  3F22 A;  4CGZ A;  3WE3 A;  4LLG F;  3HHG A;  2K7L A;  4MGR A;  2ESH A;  3F3X A;  3KP7 A;  3RPQ A;  5FLX Z;  4LG0 A;  4Q4Z F;  2W25 A;  1Z6R A;  5H20 A;  4LD5 A;  4I7H A;  2IA0 A;  2XAJ A;  1AWC A;  3WU0 A;  2NNY A;  2VBW A;  1TNT A;  3E5U A;  2JT1 A;  1S6L A;  3F6V A;  4Y15 A;  4YIF A;  2PEX A;  4WCG A;  4YFN F;  2ZME B;  1U5T C;  4L9N A;  2ZBK A;  2GXG A;  1HBX G;  3O6B B;  4HOB A;  1B1B A;  4M74 A;  3LWF A;  1YW8 A;  5DD4 A;  1E2X A;  4G7O F;  2DW4 A;  4LLL A;  1KQ9 A;  3CTA A;  1BIA A;  1BI1 A;  5HS8 A;  4LB6 B;  3GEZ A;  1I1G A;  2XHK A;  3I71 A;  2VT3 A;  1SD4 A;  2KJC A;  2KJB A;  1G3W A;  1IUY A;  3HTU A;  2VN2 A;  2OU2 A;  5D5V B;  2JTV A;  3MAJ A;  4RB0 A;  2HWV A;  2EFQ A;  4BHB A;  3ECO A;  4S04 A;  3L7W A;  3WTW C;  1F1Z A;  1GXP A;  3I0T A;  2Q0O A;  3ZMZ A;  2QEN A;  1SAX A;  4LJZ F;  3WGI A;  3WGG A;  1RUO A;  4LG0 B;  5LHG A;  1XB4 A;  2VOP A;  2HQR A;  5IT9 Z;  1ONV A;  4JBA A;  2CG4 A;  1HKQ A;  4M9S A;  4I2O A;  2RKH A;  2ESN A;  5JHU A;  2XV4 S;  1UB9 A;  3ZP5 A;  3GO5 A;  4N9H A;  2XAF A;  1V3F A;  1D5V A;  1DP7 P;  4ZH4 F;  1U5T A;  3R0A A;  2VE9 A;  2WTE A;  3MZH A;  2VC1 A;  1QZY A;  4WWC A;  2YX4 A;  4LK0 F;  4XLP F;  1XGN A;  2DAO A;  4A2U A;  1G6N A;  2G7H A;  4U7B A;  3V8K A;  4ENN A;  3KP5 A;  3R6S A;  1O7L A;  2P6S A;  2EFW A;  1UST A;  3WU1 B;  3WTS C;  3HOT A;  5ICE A;  1Z1D A;  3W6J B;  4B09 A;  2E1N A;  1PDN C;  1IN6 A;  1OPC A;  1WQ2 A;  4ZZD A;  1ZG5 A;  2VOO A;  4I0B A;  5K5Q A;  1BI3 A;  4F7Z A;  4EJT A;  2ZXJ A;  2A6E F;  2RGV A;  1TQI A;  1P2F A;  1TQP A;  1FYK A;  2DTR A;  1VTN C;  4MEX F;  2Y0M A;  1HSJ A;  1OKR A;  1FBU A;  4R8H A;  1BM9 A;  2NYX A;  5A2Q Z;  4LMY A;  3ELK A;  3TDZ C;  4RAZ A;  4XSZ F;  2IT0 A;  3TDU C;  3KP4 A;  4IJA A;  1L3L A;  2CGP A;  3QRF F;  2FE3 A;  3ZMV A;  2WWY A;  2FQ3 A;  4KMF A;  1ZHF A;  1H9T A;  2H6C A;  5BPI A;  4UVA A;  3GXO A;  5EEH A;  3ZMS A;  4A12 A;  2V1X A;  1JXS A;  2XKP A;  3M8E A;  4GCV A;  4UXN A;  5LGN A;  1KU7 A;  5TJJ A;  4HYE A;  5L3G A;  2DQL A;  1XGO A;  3IKV A;  4M9X A;  2D45 A;  2BE5 F;  4EJV A;  4L0Y B;  2HR3 A;  4CIC A;  3DFG A;  1K79 A;  4UUV A;  4AIJ A;  1BIB A;  5CLS A;  4Y13 A;  2V9V A;  3WTY C;  3RKX A;  3RYP A;  3ECH A;  3V8L A;  2GIV A;  4LLN A;  1HQC A;  3I5U A;  1KYZ A;  2FEZ A;  3EQL F;  3E6D A;  1W7P A;  3TO9 A;  2UXN A;  3JSP A;  1LQ1 A;  2DPD A;  3KP6 A;  3IC7 A;  5HVQ C;  5L3F A;  4ZYD A;  4BNC A;  5L3B A;  3GFI A;  2E7W A;  2QQA A;  3KZY A;  3BDD A;  4YII A;  2A69 F;  3J80 K;  2X4H A;  2QBY B;  3HRS A;  5LRR A;  4GO1 A;  4CHU A;  4WK8 F;  2DU9 A;  2Z5U A;  4I0A A;  1O3T A;  4KNY A;  1EH6 A;  2O0Y A;  1FLI A;  5CVI A;  3HSF A;  1BOA A;  5JI6 A;  1Z9C A;  2QVO A;  1LDD A;  4HBL A;  2Q2E A;  2ELH A;  4M72 A;  1JE8 A;  5K1Y A;  3TO7 A;  4G9Y A;  1HXD A;  1BC8 C;  2CFX A;  2W84 A;  2FXA A;  2RC4 A;  4PZJ A;  2P5V A;  3JAM K;  3JAM Z;  4OMY A;  4O3M A;  2YR2 A;  2IJL A;  4M6X A;  3OV8 A;  3HHH A;  4HX4 A;  2M5W A;  4HA8 A;  4OMZ A;  4A5N A;  1Z91 A;  5IT3 A;  4ENK A;  1TTY A;  1WSU A;  1TW3 A;  3MZY A;  2QWW A;  4ESJ A;  5DV5 A;  1F4K A;  3VB2 A;  1OYY A;  2RNJ A;  5D4S A;  1R5H A;  1YQA A;  1LB2 A;  5BQT A;  5JVT A;  1FY7 A;  3V8J A;  2EFN A;  5HOO A;  3LA2 A;  5DDG A;  3RTR A;  5K5R A;  5J6X A;  2CW0 F;  1HST A;  1YLF A;  3L09 A;  1R22 A;  2A61 A;  5D8K B;  2P5K A;  2BBY A;  4KUM A;  3U1D A;  2XKO A;  4RGX A;  3G3Z A;  3BWG A;  3ZMU A;  3ZMT A;  2XAS A;  4MQ9 F;  3I53 A;  4HV6 A;  4A0Z A;  3TKY A;  2FRH A;  2R3S A;  3SZT A;  4L5I A;  3NQO A;  2Y48 A;  4MEY F;  2RVC A;  5H6Q A;  2G9W A;  2HDC A;  3GFM A;  5K5O A;  5AIQ A;  3HSE A;  3QU3 A;  2L02 A;  1K78 A;  2B0L A;  2AS5 F;  1BN5 A;  2EA4 A;  3O2P E;  1Z7U A;  2R7D A;  4HW0 A;  3I59 A;  4HDU A;  5J8F A;  1UCR A;  2ZME A;  1LEA A;  3H3Z A;  3DPL C;  3AAF A;  1T0F A;  3CO6 C;  4L0Z B;  3EDP A;  2VON A;  3FM3 A;  1B9M A;  2OAZ A;  4GYI A;  1PP7 U;  2E1C A;  2FMY A;  1R23 A;  3C1D A;  1KGS A;  2ADU A;  3BPV A;  3ZN0 A;  3R4K A;  2EK5 A;  1RNL A;  3BRO A;  3I4P A;  1XD7 A;  2O8X A;  5A2Q K;  3HSR A;  2VE8 A;  4QWQ A;  2COM A;  2IA1 A;  2MA3 A;  3GFJ A;  4UV9 A;  1FPQ A;  4EV0 A;  4ON0 A;  1UFM A;  1OR7 A;  1U2W A;  2PBI A;  5BMZ A;  3F72 A;  3GFL A;  3DF8 A;  3ZQ7 A;  1CF7 B;  1FC3 A;  3KEQ A;  4RAY A;  1H0M A;  2FBK A;  1ULY A;  5ICG A;  3MCZ A;  1T2K A;  3U2R A;  3IRR A;  3LQR A;  2VBZ A;  2XAH A;  3V7S A;  3DXJ F;  4OIQ F;  5HS9 A;  3ABT A;  1HW2 A;  3V7C A;  5E20 A;  1S3J A;  3E6B A;  2EJR A;  1IXR C;  1P4W A;  4CZZ A;  1OYI A;  5JFR A;  2IA2 A;  4U88 A;  4UVC A;  2H6B A;  1FYL A;  2TDX A;  3P9K A;  2IP2 A;  3E5X A;  5ED4 A;  2EV5 A;  4UVB A;  2BYV E;  1R1T A;  3FX3 A;  3I54 A;  1MDM A;  1YW7 A;  4L5J A;  3HRU A;  5L3D A;  5DD8 A;  5ILV A;  3TOA A;  1QO0 D;  4MTE A;  2V1D A;  3E5Q A;  1RIO H;  4HZF A;  4L9V A;  4L18 B;  1R36 A;  1DPU A;  1KQ0 A;  3D5L A;  2NRA C;  2JZY A;  4Q5S F;  4OIR F;  2OZU A;  2K27 A;  4EM1 A;  1DPR A;  5ERI A;  1P6R A;  1J0R A;  1GVJ A;  1HKS A;  2QUF A;  5AIP A;  3J81 K;  1XGS A;  4KT5 C;  4IVN A;  3CJN A;  1HKT A;  1OMI A;  1A04 A;  3HIF A;  4KIB A;  1YO5 C;  1FOK A;  3WTU C;  4G7H F;  1JHF A;  2M1B A;  1ZYR F;  2F5F A;  1TLH B;  4PGG A;  5LGU A;  3T8T A;  2EFP A;  5LEJ A;  2HZT A;  5BOX A;  3H92 A;  4EGZ A;  2QM3 A;  3FZV A;  2MLG A;  2EWN A;  3GUD A;  1B59 A;  5IT9 K;  1LNW A;  4G6D A;  3N97 A;  3COA C;  2PFB A;  4EMS A;  3K9T A;  4MHG A;  2F5E A;  1LEB A;  3HOS A;  1SD5 A;  2FF4 A;  2EV6 A;  4P9F A;  1MJ9 A;  1IN7 A;  2YU3 A;  3B73 A;  4PDK A;  3RDI A;  3SHF A;  3LST A;  2P7V B;  2DPU A;  2HFH A;  1J5Y A;  3Q9V A;  3TQN A;  2ACJ A;  1J9I A;  3V4G A;  2P4W A;  3L2C A;  3ZPL A;  4IHT A;  3RKY A;  4A0Y A;  4ESF A;  2OZ6 A;  4IRG A;  2Z9O A;  4ZYH A;  4BYY A;  2XIG A;  3REO A;  2LF8 A;  3V7R A;  1JHH A;  5LEK A;  2P8T A;  1R1V A;  3KFW X;  2FU4 A;  3DQV C;  4U7D A;  4RGS A;  2HKX A;  1KYW A;  1IAW A;  2H94 A;  4UV8 A;  5LBQ A;  1XCV A;  2YX7 A;  3CDH A;  1ON1 A;  4GGG A;  2F5C A;  2YPR A;  2KIM A;  2L54 A;  2LKP A;  2UXX A;  1J75 A;  1R5G A;  5H6R A;  2DK5 A;  3IWF A;  1ZGJ A;  2M30 A;  1BI2 A;  3R60 A;  2D1H A;  4U0Y A;  2ISZ A;  2MD5 A;  1XDU A;  3RIR A;  4FX0 A;  2PG4 A;  3JTG A;  1ZRC A;  4PGH A;  3GX4 X;  5DCM A;  2EV0 A;  5J8C A;  3WE2 A;  2Z3Y A;  1EV7 A;  3BZ6 A;  3NEU A;  3TO6 A;  4M73 A;  3R0J A;  5LRS A;  1LDK B;  1IN8 A;  1XCB A;  2GQQ A;  1O57 A;  3IWZ A;  2J5O A;  2XAG A;  4AD9 A;  2QYO A;  4ESB A;  2ETH A;  2FBH A;  1V4R A;  3GW2 A;  4L9T A;  4IRH A;  1XDS A;  3QU6 A;  4RS8 A;  3BJA A;  1WRJ A;  2OA4 A;  2XAQ A;  1U78 A;  2VBX A;  2A5Y B;  3ZMD A;  1B9N A;  4U0V A;  1LJ9 A;  2QBY A;  4JQF A;  4IF4 A;  3HYI A;  1XN7 A;  4MTD A;  3EUH A;  3GVA A;  3S2W A;  1DUX C;  2PLY A;  1IRG A;  3KE2 A;  3L00 A;  5D5U B;  1W4M A;  4ZYG A;  2CQK A;  3W6K B;  1T38 A;  4CXF A;  1FSH A;  4AIK A;  4Q47 A;  2HGC A;  1SD6 A;  1CGP A;  2XGX A;  3T1B A;  2BEO A;  2HEO A;  3DKW A;  4YFX F;  5DUI A;  2MBF A;  4WXC A;  4XRF A;  4IPA A;  4P96 A;  3J80 Z;  4EGY A;  3CUQ C;  4A5M A;  1LVA A;  2O03 A;  3KLO A;  2ZNY A;  1IF1 A;  2F2E A;  1W5T A;  3VFZ A;  2ZCW A;  3ZN1 A;  4BHP A;  5E8G A;  1EH7 A;  3FM5 A;  1ZLK A;  1BBY A;  3IL2 A;  4I02 A;  4M6Y A;  1SMT A;  2DI3 A;  2M87 A;  1XSD A;  5E1W A;  3EET A;  1ZG3 A;  4ZZL A;  3O3K A;  1MD0 A;  4LFU A;  1FT9 A;  3DV8 A;  3HUG A;  2JPC A;  2L3D A;  3C18 A;  3GLX A;  4WXH A;  1U3E M;  2CWE A;  3JW4 A;  2MC3 A;  4M9Z A;  4DQ2 A;  2OD5 A;  2QQB A;  1SFU A;  2FNA A;  1S29 A;  5CVJ A;  4K2E A;  1IN5 A;  3LA3 A;  2PQ8 A;  5LGT A;  5HS7 A;  4FHT A;  3K0L A;  2FOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...