1IF1A

Interferon regulatory factor 1 (irf-1) complex with dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
105
structure length
105
Chain Sequence
b'RMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (26-MER)
molecule tags Transcription/dna
source organism Mus musculus
publication title Structure of IRF-1 with bound DNA reveals determinants of interferon regulation.
pubmed doi rcsb
total genus 17
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1if1A00
3P9IA 2H6CA 4EGZA 4UXNA 1IN4A 2GZWA 1HKQA 1J7KA 4RB1A 1HKTA 2BV6A 3PFIA 3BOQA 3O3KA 4MTDA 4L9NA 2AXLA 4WWCA 4LG0B 1LDKB 3OV8A 4WX9A 2VBYA 1U5TC 1I1SA 2EK5A 4I0AA 5L3CA 4YFNF 1FBSA 3D5LA 3WTWC 1K78A 1ZH5A 3ZPLA 3H3ZA 4HF0A 4ZH4F 4Q48A 3EYYA 1LVAA 4S05A 3VB2A 2CG4A 4G6DA 3WTXC 2IJLA 3ABTA 5FLXK 2KIUA 3HYIA 2IPQX 4M9ZA 2EFNA 4ESBA 5ERIA 2P5VA 4O5VA 2W25A 4BH9A 4ENMA 4CDGA 3DXJF 3Q9VA 2Z9OA 4EVIA 3IRRA 2F5FA 1XMKA 3DV8A 4HX8A 4P55A 1SMTA 5LHHA 2OQGA 1U78A 1MGTA 1XSDA 3K1PA 3V4GA 4P5OA 2Y48A 2K4BA 2MLGA 2CFXA 2P5LC 3E5XA 2BYVE 4HF2A 2COMA 2L4AA 4RAYA 4RB2C 4I98B 5FFZA 4GGGA 2ADUA 5ILUA 4G6QA 1MDMB 1QGPA 4M6XA 1IRFA 2IRFG 3WTZA 5CVJA 3REOA 1XDUA 4B09A 4EQQA 4RGUA 2XVCA 5DV5A 4ENJA 4GCVA 4HAMA 1QNTA 5LHGA 1TBXA 3F8MA 1ZRCA 2K4JA 2DPUA 1LDJA 1TNSA 2H6BA 4MTEA 2QUFA 3H92A 2PN6A 1J9IA 1IAWA 1Q1HA 4Y17A 5E1WA 5IT3A 1UHMA 1R36A 1MD0A 3ROUA 4LLNA 4OIPF 5K5QA 3BY6A 3HRTA 1EH6A 1CF7B 3M8EA 5IT9Z 1IN6A 2E7XA 1L0OC 1K78B 1Y0UA 1FYMA 5KK1A 2M87A 1LEBA 5ILVA 4QLCU 3NEUA 1WQ2A 2UZKA 3F72A 4ETSA 4BHPA 1MJBA 4EJTA 2UXNA 1B9MA 3G73A 3H3UA 1UFMA 1R1TA 1OYYA 1STZA 1B4AA 4K2EA 1PP8F 2FA5A 1U5TB 3ZMDA 3BDDA 1YW9A 1P6RA 1J5YA 1IXRC 2ETHA 2LSOA 1USSA 3TDZC 5ICEA 2ESNA 3O6BB 5E1ZB 3K2ZA 1BIAA 5JI6A 2DQLA 3ZQ7A 2Z99A 3DF8A 5LLQA 3MZHA 1USTA 5LEJA 3WGIA 2FMLA 1TQPA 2FXAA 1OPCA 1PUEE 2HWVA 4M71A 1OKRA 2FRHA 3RTRA 4A5MA 2DLLA 3GF2A 4HW0A 3TOAA 2L4MA 2UXXA 3MEXA 4MGRA 1V3FA 1HBXG 3WTYC 3SZTA 2A6EF 4MQ9F 4PZJA 1RZ4A 5L3DA 2RDPA 2QQ9A 4EMSA 2BBYA 1FSEA 2IA2A 4UVAA 5FLXZ 1LNWA 4AWXB 2VC1A 1HKSA 1BI2A 4LLLA 4HV5A 1DPRA 4RB0A 2ZJ2A 3CUQA 2DBBA 1R7JA 2GA1A 2K27A 1FWZA 1U3EM 2CYYA 1SFUA 2L54A 4IVNA 3Q5FA 3F6VA 3RKYA 2JRTA 4R1HA 4OU0A 5HVQC 4G7ZF 2QQAA 2XIGA 1FY7A 1I6XA 3E5UA 3ISPA 2H94A 3FM3A 1CF7A 3L00A 1B59A 4OMZA 3KP7A 5DCFA 2QWWA 3FX3A 4M73A 3BPVA 1R1VA 5D5XB 5HLGA 3RDIA 1TTYA 1E2XA 2QVOA 1SFEA 4NB5A 3SXYA 2ISYA 5LGNA 5BOXA 4I09A 2PFBA 1QO0D 4IJAA 3J80K 3IWZA 3IHUA 1LDDA 1U5TA 3EQLF 2MH9A 2A68F 2P7VB 3K9TA 5DEQA 2M45A 2YX7A 3I5UA 1EH7A 3CUQB 1T0FA 2YU3A 2WTEA 2VOPA 3ECHA 3HSEA 3ABUA 2CSOA 2JSCA 3LQRA 1RIOH 1XN7A 4HLXA 3B02A 4MHGA 1EV7A 4KIGA 4TV7A 5DD4A 5HOOA 4LLGF 2R7FA 5CYVA 2Q0OA 4AD9A 4G7OF 3K1MA 2QYOA 5ICGA 4M9SA 1G3SA 1SD5A 3GWZA 2OBPA 2PLYA 3IL2A 1Z05A 4RGXA 3COAC 5HS7A 1R22A 3ULQB 3LAPA 3HHHA 2XAGA 4KYWA 5E8GA 4ESJA 3T1BA 2BEOA 2ZKZA 2OU2A 3C3WA 5H6RA 4KNYA 5TJJA 1G4DA 4L0YB 1D8KA 4IRHA 3V7CA 5JVTA 2STTA 4WXCA 2O03A 4U88A 1A04A 3WU0A 2HYFA 1QBJA 3BP8A 4LB6B 3KZYA 1YG2A 2EV0A 2W57A 1Z1DA 1TQMA 3E6CC 1EH8A 2XROA 1T6SA 4OIQF 4O6JA 2ZFWA 4G8XA 1OMIA 3ZMSA 3KCCA 2EV5A 2XV4S 1MJAA 2PJPA 1S7OA 3GZ5A 1T2KA 1HQCA 1ZGAA 1RNLA 3MAJA 1H9TA 5IT9K 3KEQA 3WTUC 3F22A 1YFHA 3P7NA 4OMYA 5HLIA 3P9KA 1KQ0A 1BBYA 2LDUA 3VEPA 1ZG1A 2LNBA 2Z33A 3RPUA 1AOYA 2D45A 4MQVA 5A2QK 2EA2A 4M74A 2NNYA 1HXDA 3DEUA 2RGVA 3MFKA 3F8NA 2KIFA 1UCRA 1ZHFA 3PQKA 3I64A 1WWXA 1ZN2A 2GIVA 3FXQA 1O7FA 3FMRA 3HRSA 1G3WA 2RVCA 2RV8A 2AS5F 3R61A 3MQ0A 5JR3A 3FF5A 3NRVA 1ULYA 4N0BA 4GXOA 3GFJA 2R7DA 4I0BA 5H6QA 3IKVA 1GXPA 2XKOA 4WK8F 1XMAA 1OYIA 2EB7A 3TKYA 3F8BA 3QPHA 4BNCA 1W7PA 4ZYHA 1K79A 4L5JA 2Y0MA 1Z7UA 3MWMA 2H27A 2HTSA 3QAHA 3K69A 2Z5UA 2FEZA 3KLOA 2V1XA 4HYEA 4L18B 5L3GA 4GO1A 2MA3A 3GUDA 4FX4A 1F1ZA 4HOBA 5BMZA 1KGSA 3ZMUA 1IN8A 3L09A 5FGMA 4HBLA 2YSRA 4OINF 1H0MA 5FD6A 1MJ9A 4IHSA 1QZZA 4A6DA 4HDUA 3GEZA 2X0LA 4ENKA 5K5OA 3WGHA 1LB2A 2MBFA 3FMSA 1QPMA 3T5XA 3TOBA 1FC3A 5LGUA 3WU1B 3IKTA 4BYYA 2UWMA 4HX4A 3T8RA 1TQIA 1FYLA 3L9FA 2YX4A 2WV0A 2F5CA 2ZNYA 2ZMEB 4UNOA 2QBYA 1I5ZA 1XDSA 5HDKA 3KEOA 2P7CB 3I0TA 1TW3A 1FNNA 1JXSA 1OR7A 1T38A 4YFXF 4RAZA 2KIMA 2M8EA 3AAFA 1YLFA 3L2CA 1G3TA 1B1BA 3TO6A 5DUKA 1NHAA 2PEXA 4G94A 4A5NA 3BPXA 5BPDA 2HFHA 2FBHA 4PCQA 1HW1A 4U0VA 3TDUC 1KU7A 2PQ8A 1DP7P 2LF7A 2W84A 2XHKA 2XKPA 1ZLJA 2W85A 4U7BA 2FBKA 4R8HA 3DP7A 1T98A 4P9UA 2G7HA 2Q8KA 4BHCA 5D5UB 2GXBA 4EGYA 1U2WA 2B0LA 3J80Z 2XAJA 2HDCA 2D1HA 1I1GA 1FBQA 1BJAA 2HQNA 4M6YA 2WWYA 1IUYA 2VBZA 1SAXA 1W7PD 4BXUA 2QBYB 1MDMA 3GXOA 2FNAA 1K7AA 2DQRA 3BROA 2O3FA 5E8IA 2XAQA 3NQOA 2TDXA 3GFLA 2DK8A 4LJZF 1K6OA 4G7HF 1CGPA 1FPQA 5ICFA 4JBAA 2FNPA 1BI3A 3KP2A 5F1RA 2ZO4A 1WI9A 2KKOA 5D5WB 2HOEA 1LJ9A 3T8TA 1XD7A 3GZ6A 5FO5A 4F7ZA 2XGXA 4A0XA 4A2UA 2RN7A 1D5VA 5LGTA 5CVRA 1SD4A 1IW7F 1ZAOA 2NNNA 2L3DA 3ZN0A 1HSJA 3OOPA 1XGNA 2ZXJA 4LB5A 3BJ6A 3EYIA 2JTVA 2G7UA 3HSRA 1R1UA 1W7PB 3WG9A 1IN7A 4PDKA 2MD5A 2GQQA 4I7HA 2V79A 4AIJA 2VONA 1IRGA 5KVRA 1YW8A 3DFGA 2Y75A 4WXHA 3JAMZ 1KQ9A 5ILSA 3F3XA 1ZRFA 3J7AO 4UVBA 4A6EA 1SFXA 2EFWA 1BC8C 2HZTA 3V8JA 3D0SA 4PGGA 4EJWA 2HQRA 3KP4A 4XLPF 2FBIA 3L7WA 2OQRA 3LWFA 1J75A 3WTTC 3TO7A 3CUQC 5CVIA 4Q5SF 2VN2A 4IF4A 4H0EA 4RGSA 5BPIA 1R5GA 2W24A 2F2EA 4U0WA 3HTSB 3J81K 1TW2A 3HSFA 3ZP5A 1FOKA 4FHTA 3BJOA 3GFMA 4UVCA 1W5SA 3E6MA 4UHTA 1S6LA 3E97A 4A12A 4EM2A 5FD5A 5LRSA 1YS7A 4CICA 5D8KB 5DDGA 3I59B 3IRQA 3GO5A 4BQAA 4E70A 4I01A 3JAMK 4ZZLA 3FHZA 2HEOA 3RI4A 2A3SA 4UUVA 4IXAA 2ZNZA 1WKMA 1B9NA 1JHFA 2DFIA 1ZREA 4IRGA 1TNTA 4Z2YA 4KA4A 2HKOA 2F5EA 3F8FA 1Z91A 1R5HA 1FYKA 3CJNA 1IXCA 3WTVC 1U8RA 3V7SA 1HSTA 3IWFA 2KJCA 3SQNA 1KU3A 1F4KA 2EV6A 3FXUA 3E5QA 2Q2EA 2OA4A 4N9IA 3M7GA 3QRFF 3RIRA 1P4WA 5JHUA 2O8XA 3O2PE 1FT9A 2FMYA 4KMFA 3VOEA 4ZYGA 4DNCA 2OAZA 5BS6A 5HS8A 5E1XA 2GA2A 3KP5A 4WF2A 1BI1A 4EJUA 1BOAA 1XGOA 2CO5A 2IVMA 2DT5A 1BM9A 4UV8A 4HV6A 2VBXA 1F5TA 5DCMA 4S04A 2BE5F 3E6DA 2XAHA 3ZMVA 4Q47A 1J2XA 3SFZA 5K1YA 4KFCA 2HR3A 5CJ9A 4BAYA 2IT0A 3I54A 1PDNC 5A2QZ 1B6AA 4YG2F 1GVJA 5J8FA 5F64A 3FM5A 1O57A 2G9WA 4GYIA 1ODDA 3BZ6A 2FE3A 4L9JA 4EJOA 3PQJA 2HS5A 5JFRA 5E18F 3WE3A 4LGWA 2QQBA 3HIFA 2FF4A 4ZYDA 2A07F 4FT8A 4KUMA 4ASNA 2M1BA 5FB2A 2A5YB 4RB3C 2DU9A 5ED4A 1FBUA 2DAOA 3RYRA 4IHTA 5TRDA 2EFPA 3MZYA 2MC3A 2V1DA 5CLSA 2K7LA 2L01A 1LQ1A 3EETA 2J5OA 2NAZA 3EUHA 1ON2A 1D3YA 5DYMA 3QOPA 3RPQA 1FP1D 2O0YA 1YYVA 3N97A 3F8CA 2XRNA 4Y13A 1J0RA 3W6JB 4I2OA 1X3UA 3ML6A 2HKXA 3U2RA 1XCVA 1O3SA 4R79A 1S3JA 2IA0A 2CW0F 3P9CA 1SD7A 1IXSB 1YW7A 3F6OA 3WTSC 1RUNA 4AIHA 4IPAA 3GYHX 3ELKA 3GVAA 4EM1A 4KIFA 2P6TA 3KFWX 2VXZA 2IW5A 3ERED 1IZ1A 2ISZA 2LKPA 1BC7C 5EEGA 3WGGA 1JGSA 4RS8A 1ZGJA 4A0YA 4B8XA 2VE8A 4IRIA 5DD8A 3M8FA 4CZZA 4MNUA 1KYZA 3CLOA 3E6BA 3JTHA 1Z6RA 4KN7X 1BIBA 2J5PA 2FOKA 5J8CA 4HZFA 4Y15A 4I02A 2WC2A 5LRRA 3QP6A 2DK5A 3KP6A 2EWNA 3RKWA 3TGNA 4OIOF 1JE8A 4LMYA 4KT5C 4AIKA 3IC7A 1L3LA 1O3RA 4L5IA 2HYGD 4CYDA 3V8KA 2VT2A 5AIQA 3K1NA 3R60A 3QU6A 3J81Z 3LA2A 2LF8A 1ZLKA 2QZ8A 4L0ZB 3EDPA 2VE9A 3JW4A 3I58A 5E17F 2QLZA 2V1UA 1ONVA 2CGPA 2M5WA 5AONA 5LEKA 1FLIA 4EJVA 5ICCA 2PMHA 2K02A 1TLHB 2P5KA 1HW5A 3S2WA 4LK1F 1XSXA 4M72A 4YIIA 2IP2A 1SMYF 5D6EA 1R58A 2H09A 1O3QA 2XUBA 2ZMEA 2E7WA 3C1DA 1W5TA 2X4HA 3DPLC 1RI7A 5CVVA 2NS0A 3I71A 3TQNA 1DDNA 5L3FA 4HDVA 2V9VA 3QU3A 2EFOA 3WODF 3CUOA 4P96A 4L9TA 1C0WA 1MZBA 3LAJA 1U6GA 3CDHA 2A69F 2R3SA 2O6GE 3I53A 4CHUA 4EV0A 1Z6TA 2RC4A 5D4RA 3W6KB 1G3YA 3T0YA 2ZBKA 4ESFA 3I4PA 1T39A 3CO6C 3BWGA 1F9NA 4LFUA 3RJPA 1GXQA 1S7AA 2QM3A 3HHGA 2V6CA 4KN4X 5CVUA 1QQIA 1QZYA 3QPTA 1XGMA 2FQ3A 4OIRF 5D6FA 4LG0A 3JSOA 2JPCA 3KP3A 4JK1X 2VOOA 4A0ZA 2KRFA 1E17A 3GFIA 2MLKA 2A61A 3FXRA 3QP5A 1BN5A 2YPRA 3B73A 2ESHA 4QWQA 3SHFA 3GW2A 3U9GA 4WCGA 2C6YA 2VC0A 2VBWA 3M1EA 4ZYEA 1O3TA 2PI0A 1YIOA 1KA8A 2MH2A 2FU4A 3BJAA 1YO5C 1FSHA 1H9GA 5L3BA 1FZPB 5BQTA 4CO8A 2VT3A 3DKWA 2E1NA 2ZCWA 4FX0A 3KE2A 2FSWA 4U0YA 2GXGA 2VODA 3CTAA 2DI3A 2CWEA 4XSZF 5D4SA 3DPTA 3V8LA 4XRFA 3KZZA 3HRMA 1W4MA 1PP7U 1I27A 1O7LA 1IF1A 1YTYA 4KMUX 2K86A 3GLXA 2DO7A 2DTRA 4KIBA 3VODA 3GX4X 4YFKF 4ON0A 5DUIA 3G3ZA 2OZ6A 4LD5A 2QENA 1YQAA 2PMUA 2DW4A 2NRAC 1DUXC 5HS9A 1WSUA 3K0LA 1RUOA 1S29A 5AIPA 1XGSA 4O3MA 4KDPA 1XB4A 1KU9A 1S8NA 4HA8A 3R6SA 2CQKA 4KICA 1XSVA 4AVPA 4EM0B 3C7JA 3HOSA 4D0PA 4GYGA 3FWEA 3U1DA 4P9FA 1FP2A 4HQMA 1HW2A 2IA1A 5LHIA 4XLNF 1ZG5A 3R4KA 2ACJA 1BI0A 3C18A 4OOIA 3V7RA 1ZRDA 1JHHA 2RQPA 1KU2A 3JSPA 1G6NA 4PGHA 1V4RA 2P6SA 5LBQA 5E20A 3RKXA 5H20A 2Z3YA 1GHCA 3Q9SA 1ZYRF 3E3VA 4HLYA 5K5RA 3LQQA 3VFZA 3ZMTA 3HUGA 4U7DA 2JZYA 1FX7A 2GAUA 5D5VB 1R00A 5FFXA 3FZVA 1AWCA 2XAFA 3N4MA 2P4WA 4ENNA 1D8JA 3HRUA 1Z9CA 2EJRA 3F23A 3CO7C 1DPUA 3TO9A 4NQWA 3LA7A 4L9VA 3ZN1A 5D8LB 1OYWA 1REPC 5L3EA 4NHJA 2EFQA 2P8TA 4BHBA 2XASA 2DPDA 3KLNA 2BGCA 2OD5A 4UV9A 2JPBA 1UHWA 4MEYF 1MKMA 3JTGA 2GWRA 4ZZDA 4CXFA 4LK0F 3M9AA 3LFKA 2E1CA 2EA4A 3MCZA 4HQEA 4JQFA 3ZMZA 4N9HA 3HOTA 3WE2A 2PBIA 3SZPA 1VTNC 4G9YA 1UB9A 1LEAA 4RGRA 1P4AA 5DCMB 4WXDA 3FMQA 2RNJA 1IN5A 5J6XA 4MEXF 4Q4ZF 1P4XA 5EEHA 2F5DA 5F6FA 1KQ8A 4HF1A 1P92A 2D1VA 3KETA 2M30A 2JT1A 1P2FA 3LSTA 3I59A 3HTUA 1R23A 4YIFA 1SD6A 2NYXA 2L02A 4XSXF 2A6HF 6PAXA 3LA3A 2HGCA 5HLHA 1YS6A 2STWA 3DQVC 2O61A 1ZARA 2YR2A 1J59A 2OZUA 2PG4A 5HDNA 1WRJA 2KJBA 2D2WA 1KYWA 4HX7A 1ON1A 3ECOA 4XBFA 3RYPA 2ELHA 2RKHA 3R0AA 3R0JA 2HTJA 4DQ2A 3F21A 1ZG3A 5HDGA 4M9XA 4CGZA 1XCBA
chains in the Genus database with same CATH superfamily
2X1DA 3LSHA 3P9IA 1TP4A 3BTCA 2H6CA 4PK4A 4UXNA 4EGZA 1DQUA 3ZQLA 4F55A 1R49A 1IN4A 2GZWA 2M7BA 1HKQA 1J7KA 4RB1A 1HKTA 2BV6A 1ENHA 3PFIA 2QKLB 3BOQA 3O3KA 2K85A 2VL8A 4MTDA 4L9NA 4X0GA 2AXLA 4WWCA 5EJCA 2QA4I 4LG0B 1LDKB 3OV8A 4WX9A 1LE8B 2DODA 2VBYA 2ZXIA 1U5TC 1I1SA 2EK5A 4I0AA 5L3CA 1PVEA 4YFNF 1FBSA 3D5LA 3WTWC 3S32A 1E3HA 1K78A 4AIDA 4YELA 1ZH5A 1YX5A 1MNDA 3ZPLA 2LMDA 3H3ZA 4HF0A 4Y33A 4ZH4F 1AHDP 4HNUA 4Q48A 4Y52J 1A5JA 3EYYA 1LVAA 1OCPA 2EILH 2CQ7A 4S05A 3PO2J 3BR1A 1U0JA 1ZK8A 3VB2A 3OYDA 2B63J 3S1MJ 3P5JA 2PMZN 1IV6A 2CG4A 3W2VA 3RSNA 2KHMA 3N05A 4G6DA 3WTXC 1VQ7I 1WJAA 2IJLA 3ABTA 1BL0A 3CCEI 4C2TA 4DZJA 5FLXK 4AM3A 1TZLA 2KIUA 4NC6A 3HYIA 2IPQX 4M9ZA 2EFNA 4ESBA 2HXIA 5ERIA 2CH0A 2M7AA 2P5VA 3IUOA 1WJCA 2H1KA 3KEYA 4O5VA 1MNMC 2W25A 3GTPJ 2BY1A 4BH9A 3HGGA 3OYNA 4ENMA 3I56I 4CDGA 3DXJF 3Q9VA 3S15J 2Z9OA 4EVIA 4DJAA 4DZPA 3PO3J 3IRRA 2F5FA 1XMKA 2R92J 3DV8A 4HX8A 2BVMA 4P55A 1DGRM 1SMTA 3CJQB 5LHHA 2OQGA 1U78A 2ZSHB 4DYCA 4E7JA 1OCTC 1MGTA 1XSDA 2ZSIB 3K1PA 3V4GA 4CA0A 1BW5A 2BY3A 4J01A 4P5OA 2Y48A 4FASD 2K4BA 4F3QA 4RBOA 2MLGA 1QRYA 1XC5A 1I50J 2LY9A 2CFXA 5GAEJ 2P5LC 3E5XA 1POGA 4E7IA 4W1UA 3K4JA 5F0FA 4BJTA 2BYVE 1IDYA 4HF2A 2COMA 4Z6YA 2L4AA 4RAYA 4RB2C 2YUSA 1UJ8A 3LSRA 4I98B 4CCLA 4B4CA 3L2VA 5FFZA 4BE1A 4GGGA 4FCYA 1HF0A 2L7KA 2BW3B 4FE4A 2ADUA 4D5FA 5ILUA 4G6QA 1MDMB 5EEAA 2W48A 1JKRC 1QGPA 3S3NA 4M6XA 3D5SC 3IH4A 2L9RA 5FKOA 1IRFA 2M4KA 3VPRA 4JX6A 2IRFG 1Z3YA 3WTZA 3WHBA 5CVJA 3REOA 2MYSA 1XDUA 2CUZA 1XG1A 4B09A 4EQQA 4AYBN 2HOTA 4RGUA 4F93B 2XVCA 1AKHB 5J1RA 3VSKA 2VLAA 3OYJA 1P9QC 5DV5A 4XICA 4ENJA 4GCVA 4HAMA 2FOWA 2L9SA 1QNTA 1TWAJ 5J4YA 5LHGA 4BJ6C 1TBXA 5CQEA 1MH4A 2DTZA 2FUG2 3TP3A 3F8MA 1ZRCA 2K4JA 2DPUA 1K6YA 1LDJA 1TNSA 1QA6A 3CMMA 1EA3A 2H6BA 1U9OA 3QPLA 4MTEA 2QUFA 3H92A 1QHHD 4F52A 2PN6A 1J9IA 3HOYJ 5TISC 1IAWA 1Q1HA 2L5QA 4Y17A 5E1WA 4MFEA 5IT3A 3Q0VA 5LFAA 1UHMA 1R36A 1MD0A 3K4NA 3ROUA 3I4NJ 4LLNA 1D1AA 4DIQA 1MMDA 2XF7A 5EG0A 1BR4A 3UNGC 2R7OA 4OIPF 5K5QA 3BY6A 3HRTA 4J00A 1T0FC 3I55I 1JTXA 2K3FA 5IOZA 1Q1VA 3HL2A 2K9SA 1MSFC 2R7QA 2M9HA 1EH6A 2X48A 1CF7B 1GVDA 3M8EA 5IT9Z 1IN6A 2E7XA 3ERMA 3CJTB 1L0OC 1H88C 2JA7J 1K78B 1Y0UA 3K70D 3TW6A 1FYMA 1DGWY 2OV7A 5KK1A 2M87A 1LEBA 3GLLA 4QLCU 5ILVA 3NEUA 1WQ2A 2OJED 3C2HA 1LFBA 2UZKA 3MD2A 3F72A 2E35A 3FK6A 3OR2C 4AC0A 4ETSA 2KFDA 4BHPA 1MJBA 3OL4A 4EJTA 2UXNA 4NQWB 2IBDA 4OAZA 1B9MA 2JJ7A 1JTYA 3HZJA 2FX0A 2JK3A 3G73A 3H3UA 4XLEA 2H1LA 1UFMA 1R1TA 2EIJH 1OYYA 1STZA 3GTGJ 1B4AA 1LVKA 4K2EA 4BEHA 1PP8F 5F08A 5JHFA 2JVHA 5F0HA 5FRNA 1FIAA 2FA5A 2UV1A 1U5TB 3ZMDA 3BDDA 1YW9A 1P6RA 1J5YA 1MBKA 1VQ9I 1IXRC 2ETHA 2LSOA 1USSA 3TDZC 3S1NJ 3HUGB 5ICEA 5KCMA 2ESNA 1S7EA 3L2WA 4BQOA 3O6BB 2HOSA 5IY5H 1MW7A 5E1ZB 3HB9A 3K2ZA 1BIAA 4V19K 3QWLA 4ZC3A 5JI6A 1UG2A 2R5YB 4PJNA 4C2MJ 2KQRA 4XRMA 2X51A 3CD6I 2DQLA 3ZQ7A 2Z99A 3DF8A 5LLQA 5CKTA 2LOOA 3MZHA 1USTA 5LEJA 4I6ZA 4M3DA 2FMLA 1TQPA 2KZVA 3WGIA 4AVZA 2FXAA 3CC7I 1OPCA 1PUEE 1X1PA 2HWVA 1VZ0A 4A3DJ 1SFOJ 1GDTA 2BZTA 4M71A 1OKRA 1NG6A 2OCEA 2XGEA 1MBGA 2V1NA 2FRHA 3RTRA 4HSTA 1T8IA 4A5MA 1QVTA 2DLLA 3GF2A 4HW0A 2DOEA 3TOAA 2L4MA 2UXXA 2CUEA 5GTHC 3MEXA 4M3EA 4MGRA 4EATA 2R7TA 4IZZA 3OIPA 3OYHA 3DU5A 1V54H 1V3FA 1FTZA 2QGUA 1HBXG 3WTYC 3SZTA 2A6EF 4MQ9F 4CUGA 5JVGF 2JA8J 4IL6C 3PUBA 4PZJA 4XN0A 1RZ4A 4DOZA 5L3DA 2RDPA 1AKHA 1ZGWA 2QQ9A 4OWRB 4EMSA 4IHWA 2BBYA 1FSEA 2IA2A 4UVAA 5FLXZ 1LNWA 4OAYA 4AWXB 1F36A 3ONQA 2VC1A 3BR5A 4ZDLA 2CMPA 1HKSA 3IP4B 1BI2A 4N4OB 4LLLA 4HV5A 1DPRA 4UB8C 4RB0A 4E6KG 2ZJ2A 1PYVA 3CUQA 2R4GA 3VYRB 5GAHJ 2DBBA 1R7JA 5F1JA 2GA1A 2K27A 3JRDA 2BY2A 1FWZA 1U3EM 4XLCA 3JRGA 2CYYA 4PJ0C 1SFUA 2L54A 3OYMA 5KAFC 4KT6A 4IVNA 3DWLE 5B1BH 3Q5FA 3E0JB 3F6VA 3RKYA 2JRTA 4R1HA 4OU0A 4F92B 5HVQC 4G7ZF 2QQAA 2XIGA 3W6VA 1FY7A 1I6XA 3E5UA 1BR1A 3ISPA 2H94A 2ZMEC 3FM3A 4BXXJ 3RQ4A 1RPWA 2DOFA 1CF7A 3L00A 1B59A 4OMZA 3KYCB 2ID6A 1PUFB 3KP7A 2P0WA 5DCFA 1NG7A 1GLNA 4MO7A 4PJJA 2QWWA 3FX3A 1OJLA 3RCOA 4M73A 3S1QJ 3BPVA 1R1VA 2AQEA 3MKLA 3D5RC 3K6GA 1HC8A 5D5XB 5HLGA 3H3VK 3RDIA 1TTYA 1E2XA 2QVOA 1SFEA 4NB5A 3SXYA 2ISYA 5LGNA 5BOXA 4I09A 1RR8C 2NXNB 2PFBA 1QO0D 4IJAA 1NTCA 2LG4A 3J80K 1B72B 5EZHA 4B44A 2WAFA 1DP3A 4RAGA 3IWZA 3IHUA 2JUGA 1LDDA 1U5TA 5IP6A 4S0HB 3EQLF 2KRHA 2MH9A 2A68F 2DA2A 2P7VB 3K9TA 2CW7A 2ZXHA 1HCRA 5DEQA 2YX7A 2M45A 2JA2A 3I5UA 4ABZA 3BG3A 3CLQA 1EH7A 1MMSA 3CUQB 1T0FA 2YU3A 4M3GA 1QZEA 2M4GA 4PJMA 1ETVA 2WTEA 5GPCA 1FIPA 3BZCA 4E7LA 2VOPA 3ECHA 3FISA 2KP6A 3HSEA 3ABUA 2CSOA 3I3LA 2GXAA 2JSCA 3HG9A 3LQRA 1Z7LA 3CZ6A 1ZQ3P 1I39A 1RIOH 1XN7A 4HLXA 4MLOA 3B02A 4MHGA 1EV7A 4KIGA 4TV7A 5DD4A 2OUMA 5HOOA 4D9JA 4LLGF 2R7FA 2W1OA 5CYVA 2Q0OA 4AD9A 4G7OF 2E1MB 3K1MA 2QYOA 5ICGA 4M9SA 2M3AA 2CUJA 1G3SA 1SD5A 2W82A 3A1YA 3FXLA 3GWZA 2VXDA 2V26A 3OSGA 2UUZA 4PFPA 3ZQFA 2OBPA 2O5RA 2PLYA 3IL2A 4I99C 1Z05A 4RGXA 1XX5A 3COAC 1VNDA 5HS7A 3OYLA 1X19A 1R22A 3ULQB 3JRFA 3FBNB 2IS4A 4UUTA 2MW8A 3BR0A 3LAPA 2LREA 1T56A 2XAGA 3HHHA 4KYWA 5E8GA 5J40A 5M3MJ 4ESJA 2VKDA 3HOUJ 3T1BA 2BEOA 2K9QA 2ZKZA 1YJNI 2OU2A 2CV1A 1ETYA 3C3WA 2XF6A 5H6RA 4KNYA 5TJJA 4NBQA 2LFBA 3DBLB 1G4DA 4L0YB 1D8KA 3BC8A 3WHCA 2JA6J 4IRHA 3V7CA 1M1EB 5JVTA 2STTA 2JVGA 2O03A 4WXCA 3LL7A 4U88A 5E3OA 1A04A 1IO2A 1JJ6C 3WU0A 2M0CA 2HYFA 1QBJA 3BP8A 4LB6B 3KZYA 3OS0A 4QPQA 1YG2A 2EV0A 2W57A 4ZTJA 3VYUB 5J4VA 5EYRA 3U1KA 3GTJJ 1Z1DA 5M5WJ 4NDLA 1TQMA 5IYCJ 3KIOA 3E6CC 1B8IA 4GDFA 1EH8A 2E36A 4G12A 2JUCA 4XQFA 2XROA 5FKMA 1T6SA 4OIQF 4O6JA 2ZFWA 4G8XA 1OMIA 3ZMSA 3GMEA 3KCCA 2E5ZA 2L7ZA 1QVUA 2E19A 2ELJA 4RLQA 2EV5A 2XV4S 1MJAA 1HDDC 3S3OA 2PJPA 2L9VA 1S7OA 2F6CA 3GZ5A 2KDZA 1T2KA 3FKIJ 2DDBA 1HQCA 1ZGAA 1RNLA 3LSIA 3MAJA 1FMWA 3NAUA 2LKXA 4QIWN 1H9TA 5IT9K 3KEQA 3WTUC 3F22A 1YFHA 3P7NA 4OMYA 3LOCA 4C3IJ 5HLIA 3P9KA 1JI8A 1KQ0A 1BBYA 2X6XA 2LDUA 3CC2I 2NS8A 2E60A 3H0GJ 3VEPA 1ZG1A 1SVMA 1IGNA 1X3WB 3F0CA 2LNBA 2NVTJ 5H2FC 2Z33A 3FBIB 3C2GA 3RPUA 3ZQHA 1AOYA 3MKZA 2D45A 3BZKA 4AUXA 4MQVA 5A2QK 2X6WA 2EA2A 4M74A 1YIJI 3G1LA 3RZDJ 2NNYA 3H36A 1HXDA 2RGVA 3DEUA 3F8NA 3O8GA 3MFKA 2KIFA 2BXZA 1UCRA 1ZHFA 3PQKA 3HGYA 3I64A 2TRTA 1WWXA 1ZN2A 3JRCA 4L5EA 2GIVA 2NOJB 3FXQA 1O7FA 2HZDA 2VI6A 3DBHB 3FMRA 3HOXJ 1XMXA 3HRSA 2CU7A 2JN6A 2M34A 1G3WA 2YU9J 2RVCA 2RV8A 1X2MA 1A31A 2O8KA 2AS5F 3R61A 3CCYA 3MQ0A 5JR3A 3FF5A 3NRVA 4A3MJ 1ULYA 3G1MA 4N0BA 3IAM2 1K4TA 4GXOA 3ASNH 4XLFA 2XSJC 3TEDA 3GFJA 2R7DA 4I0BA 5IOYA 5H6QA 2WB1N 3IKVA 1JT6A 1GXPA 2XKOA 2DFFA 4WK8F 1XMAA 2X1CA 2QKMB 4HNVA 1OYIA 2EB7A 3GZNB 3O8HA 3TKYA 3F8BA 4IHYA 3QPHA 4BNCA 3ZCOA 2R93J 1W7PA 4A3CJ 4ZYHA 5BNGA 2K3PA 1K79A 4L5JA 1I3AA 1Z7UA 2Y0MA 3MWMA 5FKKA 1UMQA 2IAIA 2IGKA 2H27A 2CV0A 1U9NA 3CDIA 1OR7C 2HTSA 3SEZA 3G2BA 2E1MC 2KL4A 2Y31A 3QAHA 3K69A 2DMTA 2Z5UA 4XORA 2VQCA 1W5CC 2FEZA 3KLOA 3G71I 2V1XA 4HYEA 4L18B 5L3GA 2DJIA 4GO1A 2K40A 4DYQA 2VJJA 2NVYJ 2MA3A 3GUDA 2BY0A 2DA6A 4FX4A 2ZJRF 1F1ZA 2CFOA 1IDZA 3QYBA 4HOBA 5BMZA 1TWCJ 1KGSA 3ZMUA 1IN8A 3L09A 2DMQA 2ME6A 3S2HJ 3DBRB 4HBLA 2YSRA 5FGMA 4OINF 5FD6A 1MJ9A 1H0MA 3BQZA 4IHSA 1QZZA 4YRVA 4E7HA 5FLMJ 3SYTA 3TMOA 4A6DA 4HDUA 1VQNI 3GEZA 2X0LA 4ENKA 5K5OA 1YHQI 2XAUA 2ZXWH 3WGHA 2ECBA 1VQLI 1LB2A 3DKYA 5TGTA 2MBFA 3FMSA 1QPMA 3A4CA 4B1RA 1FOWA 3M1CA 3T5XA 3TOBA 1FC3A 5LGUA 4JOMA 3WU1B 3IKTA 5GADJ 4BYYA 3CMEI 4HX4A 2UWMA 3T8RA 1FEXA 2NVXJ 4X6AJ 1TQIA 1FYLA 3L9FA 1EF4A 3KX2A 2YX4A 2WV0A 2CQNA 3OYFA 2ECCA 4YIRX 2F5CA 2QSGX 3LSKA 2ZNYA 2ZMEB 3LSGA 4UNOA 2DOAA 2QBYA 1I5ZA 1XDSA 5HDKA 3KEOA 1VQKI 2P7CB 3I0TA 1TW3A 2K5CA 1FNNA 2A5WA 2MG4A 1JXSA 1OR7A 1ZKGA 1T38A 4A3LJ 4YFXF 4RAZA 2KIMA 2M8EA 3AAFA 4GFBA 1WCMJ 1YLFA 2HVSA 3L2CA 4NC8A 2ZC2A 3L2QA 1G3TA 4AYBA 2IGOA 2QEXI 4CCNA 1B1BA 3H5AA 1YRNB 1PJRA 2XB0X 2XGCA 2WAQN 2IS1A 1V5EA 3TO6A 5DUKA 1IUFA 1NHAA 3S2DJ 2PEXA 4G94A 4A5NA 5LD2C 3BPXA 5BPDA 2QSHX 2HFHA 2FBHA 3OYGA 4PCQA 1HW1A 1HLVA 4U0VA 3TDUC 1KU7A 3PL8A 3OL3A 5EG0B 3OS1A 2PQ8A 3IAS2 5FLVA 4C2UA 1YX3A 1DP7P 2LF7A 2DDAA 4XOPA 2W84A 2XHKA 2XKPA 4BQQA 1ZLJA 4HG2A 3HOWJ 2W85A 1YOVB 4U7BA 2Y30A 4ZDPA 3HPGA 3CP8A 2M8GX 2FBKA 4R8HA 4LG3A 3WU2C 2WA0A 3DP7A 1LUJB 2LH9A 1R6RA 1T98A 4P9UA 2G7HA 4LIVA 2Q8KA 3PSFA 1R4MB 4BHCA 5D5UB 3HJEA 3DU6A 4E7SA 1MMNA 2GXBA 2COBA 4EGYA 1ITYA 4H4KC 2XPVA 1UG0A 5FROA 1U2WA 1ZTRA 2B0LA 2V7FA 4D7MA 3J80Z 2XAJA 3AG2H 2HDCA 2D1HA 1I1GA 2VPRA 1FBQA 1BJAA 4DGWB 2HQNA 4M6YA 2WWYA 1IUYA 2WAQA 2VBZA 5CPRB 1SAXA 4AU7A 1W7PD 2VJ4A 4BXUA 2QBYB 5C4JJ 2HNHA 3GXOA 1MDMA 2FQ4A 2FNAA 3PNYA 1K7AA 3B6CA 2DQRA 3NWSA 3BROA 5J3LA 2L0KA 2O3FA 1WJ5A 5E8IA 2DMPA 5FRMA 5EZGA 5DTDA 4IHVA 2XAQA 1P7IA 3AG3H 3FXOA 1U8BA 1HA8A 3NQOA 4NNJA 2TDXA 3GFLA 3KZIC 1SANA 2DK8A 3FXKA 4FTHA 4LJZF 4XKCA 1N25A 2HXOA 3M4OJ 5FKNA 1K6OA 1T33A 4G7HF 1CGPA 1FPQA 2LRDA 5ICFA 1VF9A 3BCAA 4JBAA 1JKOC 2FNPA 1MBHA 1RRJA 1BI3A 3KP2A 3TP0A 2ZO4A 5F1RA 1WI9A 2KKOA 3LSMA 5D5WB 1YITI 2OTJI 2HOEA 3FHNA 4KISA 1VQMI 1LJ9A 3T8TA 1XD7A 3GZ6A 1YI2I 1FTTA 1JUPA 1UZCA 1Z21A 5FO5A 2W7NA 4F7ZA 2XGXA 4A0XA 4A2UA 1GT0C 3RPUD 4CCKA 2RN7A 1D5VA 1MMAA 5LGTA 1ETWA 5CVRA 3L2UA 3E1SA 1X58A 3HBLA 3W2WA 1SD4A 3B6AA 1IW7F 2BW3A 4IX7A 1ETXA 1Z77A 1OISA 2NVQJ 1ZAOA 2XPUA 2L3DA 2NNNA 3ZN0A 5K7FA 1HSJA 2A6TA 1GV2A 4BE0A 3OOPA 3QYFA 1XGNA 3DLAA 1IV8A 2XSDC 2HQ5A 2ZB9A 4Y3OA 2ZXJA 4LB5A 3BJ6A 3EYIA 3BCBA 2JTVA 2G7UA 4UY8I 3HSRA 2H8RA 3HDDA 4BBRJ 1R1UA 1W7PB 2DYRH 3WG9A 5B5EC 1IN7A 4XRSA 2KISA 4PDKA 2E2HJ 2HVQA 2MD5A 2GQQA 1SEUA 2KDOA 3HKZA 4XM3A 4I7HA 2V79A 3HKZN 4JP0A 4B3AA 5K7HA 4AIJA 3AG1H 1VFCA 2VONA 2LTPA 1T08B 3OSFA 1IRGA 1G59A 2CQQA 2HPIA 1YW8A 3DFGA 5KVRA 4RDUA 2R0QC 2Y75A 4WXHA 3JAMZ 1KQ9A 5ILSA 3F3XA 1ZRFA 2F4MB 3J7AO 4UVBA 4A6EA 1SFXA 3OIQA 2EFWA 2JQ7A 3MVPA 1SVOA 1BC8C 1QPIA 2HZTA 3V8JA 2MFZA 2XRLA 3D0SA 4PGGA 1J09A 2BXYA 4EJWA 2HQRA 3KP4A 3CMYA 4XLPF 3A01A 2FBIA 1Y0NA 3L7WA 2OQRA 3LWFA 2LR8A 1J75A 3WTTC 3TO7A 3CUQC 1W0TA 1R71A 5CVIA 5IPAA 2L9NA 4Q5SF 3RZOJ 1TT0A 2VN2A 3ESWB 4IF4A 2ME0A 4H0EA 2QF7A 4RGSA 5BPIA 1R5GA 3OYEA 2W24A 2F2EA 5IP7J 4BJ5C 4BBSJ 4U0WA 3HTSB 2Y9YA 1VQ6I 4Y7NJ 1TW2A 2I8DA 3HSFA 3J81K 2KPMA 4U87A 3ZP5A 1FOKA 4FHTA 3BJOA 2B9SA 3GFMA 1WHUA 2LBFB 2ELKA 4UVCA 1W5SA 3E6MA 3ABKH 4I76A 4UHTA 3CCQI 2DFEA 4J19A 1S6LA 5IYBJ 4BACA 3E97A 1Y8QB 4A12A 4EM2A 4IOCF 4B3XA 2VASA 5FD5A 2Y0SA 5LRSA 1D0YA 1YS7A 3A0BC 4CICA 4F91B 5D8KB 3KPHA 5DDGA 2K9LA 3I59B 1TL8A 3IRQA 3DEWA 3GO5A 4PFOA 2R7UA 4II2A 3G1OA 4BQAA 2FD5A 4E70A 1H8AC 4I01A 3JAMK 4ZZLA 4BL0B 5GAGJ 3SJMA 4BDYA 2DA5A 3MMYB 4BY1J 3FHZA 2HEOA 3RI4A 2A3SA 4UUVA 4IXAA 2ZNZA 1WGXA 2CQXA 1WKMA 4BQNA 1V55H 1B9NA 1JHFA 2DFIA 1ZREA 4IRGA 2BVLA 1B8IB 2DN0A 1TNTA 4Z2YA 4KA4A 3EUHC 4DBRA 3BR2A 2HKOA 2F5EA 3MKYB 3F8FA 3VWBA 4RA2A 1Z91A 1R5HA 1FYKA 3CJNA 1IXCA 3K70C 3EUKL 4JX4A 3WTVC 3HOZJ 3Q3SA 1U8RA 3IV5A 3V7SA 1HSTA 3IWFA 2IXSA 2DA7A 1T95A 2KJCA 2D5VA 3SQNA 1MIJA 1WJDA 2WY8Q 5IP9J 2LY1A 1KU3A 4LIUA 1F4KA 3E7LA 2EV6A 3FXUA 2MSYA 2Q2EA 3E5QA 1NH3A 2OA4A 4C9YA 4N9IA 1XPXA 1VI0A 3M7GA 3AL0B 3QRFF 1IC8A 3RIRA 4NC7A 4BY7J 1P4WA 5JHUA 1OLTA 2VB6A 3DTEA 2O8XA 3O2PE 4C3JJ 1FOYA 1FT9A 1JGGA 2FMYA 3OR1C 4KMFA 2GM4A 3VOEA 4ZYGA 2GIZA 4E7KA 4BXFA 4DNCA 4XLHA 2OAZA 5BS6A 3CESA 5HLTA 5HS8A 2EZKA 5E1XA 1O4XA 1UAAA 2GA2A 3KP5A 4WF2A 5EF6A 5DM6F 3G6EI 2R7WA 4HEA2 1BI1A 4EJUA 4B47A 1DU0A 2L2OA 1RR7A 1BOAA 1ZELA 1XGOA 2CO5A 2NS7A 2IVMA 2H8WA 1LE8A 1E0EA 2DT5A 2L7FP 1BM9A 3K4LA 4UV8A 4A3JJ 1A35A 3QPSA 2HI3A 4A3FJ 4HV6A 2VBXA 4FQGA 1F5TA 1OCOH 5DCMA 4S04A 2EIKH 2VJ5A 2KT0A 1W36C 2BE5F 3E6DA 2XAHA 1IJWC 3ZMVA 1NK3P 4Q47A 1J2XA 3RQIA 3SFZA 5K1YA 3K10A 2MC4A 2HR3A 1Y39A 4KFCA 2DA3A 5CJ9A 2CV2A 4BAYA 1WI3A 1BA5A 1R5ID 2IT0A 3I54A 1PDNC 3AL0C 1B72A 5A2QZ 1B6AA 4YG2F 1GVJA 3CMAI 5J8FA 5F64A 1VQ4I 2IEKA 3FM5A 1O57A 2G9WA 3BTLA 2LBFA 1Y1WJ 4GYIA 1ODDA 5EGOB 2CW8A 3CF5F 4XKBA 4ANJA 3A0HC 3BZ6A 2FE3A 3JRIA 4L9JA 4EJOA 2RQQA 2EBIA 3PQJA 2VQGA 1WJFA 2HS5A 5JFRA 1XTAA 5E18F 1R4NB 3WE3A 4LGWA 3I4MJ 2QQBA 1D1BA 3HIFA 1X1CA 2FF4A 1JUSA 4CCJA 3Q0WA 4ZYDA 2A07F 2DXIA 4FT8A 1AU7A 1WVRA 3L2RA 4KUMA 1Z0XA 4ASNA 4V2GA 2M1BA 5FB2A 2YS9A 2E34A 4FE7A 3S93A 3ZXSA 2A5YB 4RB3C 2DU9A 5ED4A 3S8PA 3CCVI 3FDYA 3NWTA 2W4SA 3SFIA 1FBUA 1X4OA 2DA1A 2DAOA 2V9PA 3RYRA 1OFCX 1BJZA 2OTLI 2HQAA 4IHTA 1WPKA 5TRDA 4BUPA 1MBFA 2EFPA 3MZYA 2MC3A 2V1DA 3PJRA 2LY2A 3ABLH 2VJIA 5CLSA 2K7LA 4CCMA 4HPQA 2L01A 1LQ1A 3EETA 2J5OA 2NAZA 3EUHA 1ON2A 1D3YA 5KNLA 5DYMA 2RREA 3QOPA 3RPQA 1FP1D 2O0YA 3OYKA 1YYVA 2XGDA 3N97A 3F8CA 1MH3A 4A3GJ 2XRNA 4Y13A 1J0RA 3W6JB 4I2OA 1X3UA 3ML6A 2MABA 5IYDJ 2HKXA 3U2RA 2R5ZA 5M5XJ 2OCCH 1JKPC 1XCVA 5EGOA 1O3SA 4R79A 1X4PA 5EDNA 3BTIA 1S3JA 3GBGA 4PUSA 2DCEA 3JRHA 3KYDB 2XDVA 2IA0A 2CW0F 3P9CA 1SD7A 5E3MA 1IXSB 3HXLA 4XNFA 2BOLA 1YW7A 5F04A 2VPLA 3F6OA 1RKWA 3WTSC 3CDLA 4A3IJ 4HRIA 1RUNA 2DMUA 4QPOA 4AIHA 5E79C 4IPAA 5M3FJ 2G0EA 3GYHX 3ELKA 3GVAA 4EM1A 4KIFA 3MN2A 2P6TA 3PUFA 1OQYA 3KFWX 1MNEA 2VXZA 2IW5A 2EZIA 3ERED 3BG5A 1IZ1A 2ISZA 2LKPA 3Q0UA 2Y0SN 1BC7C 4BGDA 5EEGA 2DJNA 2BHZA 3WGGA 1JGSA 4RS8A 5C44J 1ZGJA 2LVSA 3GTLJ 1D1CA 3GTOJ 4A0YA 4B8XA 1VQOI 2VE8A 4ZJZA 3K4BA 4IRIA 5DD8A 3M8FA 4CZZA 1I6HJ 4MNUA 3OIOA 1KYZA 3OMYA 3PM1A 5FJ8J 3CLOA 3E6BA 3JTHA 1Z6RA 4KN7X 1BIBA 2J5PA 3A02A 2FOKA 5F0CA 4HZFA 5J8CA 3ZQCA 2F5VA 4Y15A 4CYCB 4I02A 2WC2A 5LRRA 2X1EA 3QP6A 4ITVA 1VQ8I 2DK5A 2AHQA 1V5FA 3KP6A 2EWNA 4P1WA 4RAFA 4EEFG 4XOTA 3RKWA 1R9TJ 3TGNA 2VQLA 4OIOF 2HYJA 1DU6A 4RLFA 2KZGA 2VKVA 3CCSI 1MBJA 1JE8A 4ZTFA 3BG9A 3CCLI 2OC6A 4LMYA 5M5YJ 4KT5C 3K2AA 1TWGJ 1BOBA 4AIKA 1SC7A 4D7NA 3IC7A 3PIOF 1L3LA 3HPHA 1O3RA 4L5IA 2HYGD 4CYDA 3ZOBA 4BKXA 3BR6A 2ID3A 1ERDA 1IRZA 3V8KA 3VYSB 3BT9A 2VT2A 2E1OA 5AIQA 3M8JA 3K1NA 2AO9A 3R60A 2PJRA 4A3BJ 3QU6A 2CUFA 3BTJA 3OYBA 3J81Z 3H9QA 3LA2A 2LF8A 1ZLKA 4MFDA 3BQYA 2QZ8A 4CSWA 4L0ZB 2QQ8A 3EDPA 2VE9A 3CCJI 3JW4A 2LLKA 3JRBA 3QQAA 1ETQA 2PJRB 3I58A 5E17F 2QLZA 2V1UA 2X9DA 1ONVA 2V4JC 3DPUA 2ICWG 4CZCA 3UKGA 4X1EA 1D0ZA 1ACIA 2CGPA 1TWFJ 1TT5B 4DYRA 2M5WA 5AONA 3HOVJ 5LEKA 1FLIA 2W00A 4EJVA 5ICCA 5J1YA 2PMHA 1VQPI 2K02A 4FETA 1TLHB 2EQRA 2P5KA 1AA7A 1HW5A 3S2WA 4D5CA 4LK1F 3F9KA 1XSXA 4M72A 4YIIA 2IP2A 1SMYF 4XN3A 5D6EA 1R58A 4LITA 4IKFA 1JUMA 2H09A 1O3QA 2O7OA 1S9HA 2XUBA 2ZMEA 2E7WA 3C1DA 2LC2A 2K9MA 2M0MA 1W5TA 2ZJPF 2X4HA 3DPLC 2EIMH 2V6EA 1RI7A 5J47A 3LMMA 5CVVA 2NS0A 3I71A 3V42A 3K4MA 3DLLF 4HSRA 2KMUA 2GLOA 1CQTA 1OCZH 4XMYA 1S72I 1SVLA 3TQNA 1DDNA 3PNTA 5L3FA 3H0DA 1KZHA 3C2BA 4HDVA 1A36A 3CQZJ 1APLC 4XK4A 2CRGA 2LYCA 4XKVA 4G6TB 2V9VA 1TWHJ 3VDXA 1VQ5I 5GTIC 3QU3A 2WAEA 3BR3A 1NK2P 1LKXA 2EFOA 4V2FA 3WODF 2R7SA 3GTQJ 1JKQC 4C3HJ 3CUOA 4P96A 3K4KA 2Y2ZA 3BG6A 4L9TA 3ZRGA 4D1QA 1C0WA 3JR9A 1MZBA 3S1RJ 3LAJA 3TL4X 2GOXB 1U6GA 3CDHA 2A69F 4UUSB 2HU9A 2R3SA 4IOAF 1LFPA 3H5NA 1BR2A 2O6GE 2R7XA 1HDPA 3I53A 4CHUA 4EV0A 1Z6TA 2RC4A 3GCMA 5D4RA 3D1NI 3W6KB 1G3YA 3T0YA 2ZBKA 4ESFA 1XS9A 1OCCH 3I4PA 2R7RA 1EKEA 3TBIA 1T39A 3ZGKA 3CO6C 3BWGA 1F9NA 4LFUA 3EUAA 3OYAA 2NVUB 1RKTA 4XRSG 3CC4I 1SFKA 2LKSA 3RJPA 2EPFA 1GXQA 1S7AA 3I9V2 2QM3A 3L1PA 2ZFUA 5B1AH 3HHGA 2V6CA 4KN4X 5CVUA 3DKXA 5C3EJ 2IS6A 2V9KA 4KJZA 1QQIA 5CQGA 1QZYA 2CS3A 3H1CA 3QPTA 2Z2SB 1XGMA 3DTIA 3ZQIA 2AXTC 2FQ3A 5J1UA 4OIRF 4RM2A 5D6FA 2Y9ZA 4LG0A 3X2QH 3JSOA 9ANTA 2JPCA 3IH3A 3KP3A 4JK1X 2VOOA 2XB5A 4A0ZA 2EZLA 2WY7Q 2KRFA 4XR6A 1E17A 2I5UA 4CCOA 3GFIA 4UB6C 2JRMA 2GBYA 2MLKA 2IGMA 2A61A 4RMNA 3DCFA 1X1DA 1G2HA 3FXRA 2WBMA 3QP5A 1BN5A 2YPRA 3B73A 2ESHA 1RETA 4QWQA 3SHFA 3QODA 3H9JA 3GW2A 5K7ZA 2X6OA 2DYSH 3U9GA 1E3OC 1ETKA 3JCUC 3H9GA 1ORKA 4WCGA 4M3FA 2C6YA 2EZHA 2VC0A 2VBWA 3FXMA 5JLWA 3M1EA 4IEJA 2XPWA 4ZYEA 1WJBA 3PFYA 1O3TA 3DEEA 2PI0A 1YIOA 5F27A 4IQ4A 2HDDA 1KA8A 2MH2A 2FU4A 3BJAA 3LFUA 3J7YJ 1YO5C 1K61A 1Y6IA 5KAIC 4E7ZA 2CJJA 4IHXA 1FSHA 1H9GA 1JJ8C 5L3BA 1FZPB 5BQTA 3W3CA 1X2NA 3SZGA 4CO8A 2VT3A 3DKWA 2B7EA 2LD5A 2E1NA 2ZCWA 4FX0A 1MMGA 2FSWA 3KE2A 2GXGA 4U0YA 1A6IA 2ZJQF 2VODA 3CTAA 1Y8RB 2DI3A 2IS2A 2CWEA 4XSZF 3SEQA 4BU2A 3AFHA 5D4SA 3DPTA 1X1BA 1BW6A 4XRFA 1YE9A 3KZZA 1RC9A 3MZ8A 3HRMA 1W4MA 3V8LA 4CYCA 1PUFA 4A3EJ 1W0UA 3RKQA 1PP7U 3FK7A 1I27A 1O7LA 1P7JA 1IF1A 5KHDA 1OCRH 4Y4RA 1YTYA 4KMUX 3S17J 4GRIA 2K86A 4B43A 1N78A 3GLXA 2Z1DA 2DO7A 3M3YJ 2DTRA 4KIBA 3VODA 3A01B 3GX4X 2XC7A 2WADA 4YFKF 1H89C 1RESA 4ON0A 2A05A 2PX9A 5DUIA 2BHYA 3WG7H 3M07A 3G3ZA 1X1AA 2OZ6A 3ZQGA 4LD5A 2QENA 2HPMA 1YQAA 2PMUA 1N77A 2DW4A 1IRXA 2NRAC 1DUXC 5HS9A 1WSUA 1D5YA 3A2KA 3K0LA 2MGQA 4DW6A 1S29A 5AIPA 4JYKA 3OY9A 1RUOA 4LOCA 2WB1A 1XGSA 1ZR4A 4O3MA 2L7MP 4NUBA 4KDPA 2HVRA 1XB4A 3J7AY 1KU9A 4A93J 4C30A 1S8NA 3CJRB 2GOMA 4HA8A 4N4NB 3R6SA 2DT7B 2CQKA 3LSJA 2RAEA 3PNVA 4KICA 1XSVA 3ZQQA 3SDGA 2E5NA 4PSXA 3U21A 3LSPA 4AVPA 4EM0B 3C7JA 3CCUI 3OWTA 3HM5A 2PMZA 4D0PA 3HOSA 3AKZA 2QSFX 2XF5A 1ETOA 3FWEA 4GYGA 3DTKA 3U1DA 5B66C 4P9FA 4M6VA 4XLAA 2R5ZB 1FP2A 1QU3A 3S14J 1LPQA 4HQMA 4XIDA 2DA4A 1HW2A 3ABMH 3OS2A 4KITB 2KIQA 3BLYA 4QTRA 2IA1A 5LHIA 4XLNF 3SDBA 1WH5A 1ZG5A 2I10A 4JX5A 3CF2A 3R4KA 1W36D 2E2JJ 5E3LA 2ACJA 1FJLA 2VKHA 1BI0A 3C18A 4OOIA 3V7RA 3GTKJ 2Y69H 4XKWA 1ZRDA 1UELB 1JHHA 2RQPA 3HEFA 1KU2A 1G8XA 1G6NA 4PGHA 4DBQA 5HNFA 3JSPA 1V4RA 2P6SA 3KYLA 5LBQA 5E20A 4XONA 3RKXA 4ZDOA 2JWTA 2R7VA 5H20A 2Z3YA 1GHCA 3Q9SA 1ZYRF 3E3VA 4HLYA 3H35A 2RNGA 5K5RA 2X85A 3K7AJ 3LQQA 1EJ9A 3VFZA 3CCMI 4W97A 1QHGA 2OF7A 2KRCA 3ZMTA 3HUGA 4PSWA 1Y1VJ 2K9NA 1K4SA 4U7DA 2JZYA 2AQFA 3J7ZI 1FX7A 2TCTA 2GAUA 5D5VB 1R00A 5FFXA 3FZVA 1JT0A 1AWCA 2F4OB 2XAFA 2P81A 3N4MA 2P4WA 3GTMJ 3TW7A 4ENNA 4BEHB 1D8JA 4E4HA 5JLXA 2VKEA 3BG7A 3HRUA 1Z9CA 2EJRA 3F23A 3CO7C 1DPUA 3TO9A 3OYCA 4B48A 5E3NA 4NQWA 2VUMJ 3LA7A 4L9VA 3ZN1A 5D8LB 1OYWA 1REPC 2KLOA 4BDZA 2E71A 5L3EA 1YRNA 4NHJA 2JA5J 3W2AA 2EFQA 2P8TA 4BHBA 2XASA 3H5RA 2DPDA 2IGNA 3KLNA 2BGCA 1MSEC 3QYEA 4M3BA 1Z3XA 2OD5A 2OPTA 2DFHA 4UV9A 3G4SI 5GP9A 2JPBA 1X3ZB 1UHWA 4MEYF 2FJ1A 3UR3C 3JREA 3VSLA 1WH7A 3K4CA 3CP2A 3ASOH 1UHSA 1F43A 1MKMA 1Y56A 3JTGA 2GWRA 4ZZDA 4CXFA 1E3PA 4BE2A 4LK0F 1FOXA 4QSHA 3M9AA 1A6QA 3LNQA 2DT6A 1LFUP 2E2IJ 3LFKA 4MIMA 2EA4A 2JMWA 3MCZA 4JQFA 4HQEA 2E1CA 5DM7F 3ZMZA 4N9HA 3PIPF 2NOGA 3HOTA 2HDWA 2JSPA 1WZ2A 1GV5A 3WE2A 2PBIA 1I3QJ 3SZPA 1VTNC 3AG4H 4HNTA 4G9YA 2EH3A 1UB9A 1LEAA 4BS9A 4YEJA 4RGRA 1D0XA 1P4AA 1ZR2A 5DCMB 2EINH 4WXDA 3OYIA 2LP0A 4RM3A 2N8GA 3CCRI 1YJWI 3FMQA 3ZR8X 2RNJA 4UUSA 5B3SH 1IN5A 3A03A 5J6XA 2O9LA 4MEXF 2F4IA 4Q4ZF 4IO9F 1MBEA 3QOEA 1P4XA 5EEHA 2F5DA 2X6YA 5F6FA 1WJEA 2DMNA 1KQ8A 3FXJA 4HF1A 3FKJA 2Q2EB 1P92A 1KONA 3OOUA 1N75A 5C4XJ 1K83J 2D1VA 1WFXA 1W1WE 3KETA 4A69C 4FISA 1YJ9I 2M30A 2JT1A 2MD0A 1P2FA 3JRAA 2VIXA 3FIWA 3S16J 3LSTA 1S5LC 1FMVA 3MKWB 3I59A 3HTUA 2R5YA 2WV1A 2Z16A 2QCOA 2VQHA 1R23A 4YIFA 1SD6A 2NYXA 1V5GA 2HOAA 5DS9A 2L02A 4XSXF 5HODA 2A6HF 1IG7A 6PAXA 3LA3A 2HGCA 3IH2A 4IQJA 5HLHA 5GPAA 1YS6A 3PSIA 1Z67A 2Q1ZB 4XL9A 3S3MA 3VYTB 2STWA 1TC3C 3DQVC 2M2EA 2O61A 5FKLA 2R7ZJ 1ZARA 3NARA 2YR2A 1J59A 2LK2A 2OZUA 2PG4A 5HDNA 3EPZA 1HOMA 1WRJA 2KJBA 2D2WA 1KYWA 4HX7A 1ON1A 4ZYAA 4CH7A 3ECOA 2F48A 4PJLA 4XBFA 4II3A 3RYPA 1GUUA 2ELHA 4A3KJ 2RKHA 3R0AA 3R0JA 3HC7A 2HTJA 4DQ2A 3F21A 1ZG3A 1SAUA 5HDGA 4M9XA 5HNHA 4CGZA 1XCBA
chains in the Genus database with same CATH topology
3P9IA 2H6CA 4EGZA 4UXNA 1IN4A 2GZWA 1HKQA 1J7KA 4RB1A 1HKTA 2BV6A 3PFIA 3BOQA 3O3KA 4MTDA 4L9NA 2AXLA 4WWCA 4LG0B 1LDKB 3OV8A 4WX9A 2VBYA 1U5TC 1I1SA 2EK5A 4I0AA 5L3CA 4YFNF 1FBSA 3D5LA 3WTWC 1K78A 1ZH5A 3ZPLA 3H3ZA 4HF0A 4ZH4F 4Q48A 3EYYA 1LVAA 4S05A 3VB2A 2CG4A 4G6DA 3WTXC 2IJLA 3ABTA 5FLXK 2KIUA 3HYIA 2IPQX 4M9ZA 2EFNA 4ESBA 5ERIA 2P5VA 4O5VA 2W25A 4BH9A 4ENMA 4CDGA 3DXJF 3Q9VA 2Z9OA 4EVIA 3IRRA 2F5FA 1XMKA 3DV8A 4HX8A 4P55A 1SMTA 5LHHA 2OQGA 1U78A 1MGTA 1XSDA 3K1PA 3V4GA 4P5OA 2Y48A 2K4BA 2MLGA 2CFXA 2P5LC 3E5XA 2BYVE 4HF2A 2COMA 2L4AA 4RAYA 4RB2C 4I98B 5FFZA 4GGGA 2ADUA 5ILUA 4G6QA 1MDMB 1QGPA 4M6XA 1IRFA 2IRFG 3WTZA 5CVJA 3REOA 1XDUA 4B09A 4EQQA 4RGUA 2XVCA 5DV5A 4ENJA 4GCVA 4HAMA 1QNTA 5LHGA 1TBXA 3F8MA 1ZRCA 2K4JA 2DPUA 1LDJA 1TNSA 2H6BA 4MTEA 2QUFA 3H92A 2PN6A 1J9IA 1IAWA 1Q1HA 4Y17A 5E1WA 5IT3A 1UHMA 1R36A 1MD0A 3ROUA 4LLNA 4OIPF 5K5QA 3BY6A 3HRTA 1EH6A 1CF7B 3M8EA 5IT9Z 1IN6A 2E7XA 1L0OC 1K78B 1Y0UA 1FYMA 5KK1A 2M87A 1LEBA 5ILVA 4QLCU 3NEUA 1WQ2A 2UZKA 3F72A 4ETSA 4BHPA 1MJBA 4EJTA 2UXNA 1B9MA 3G73A 3H3UA 1UFMA 1R1TA 1OYYA 1STZA 1B4AA 4K2EA 1PP8F 2FA5A 1U5TB 3ZMDA 3BDDA 1YW9A 1P6RA 1J5YA 1IXRC 2ETHA 2LSOA 1USSA 3TDZC 5ICEA 2ESNA 3O6BB 5E1ZB 3K2ZA 1BIAA 5JI6A 2DQLA 3ZQ7A 2Z99A 3DF8A 5LLQA 3MZHA 1USTA 5LEJA 3WGIA 2FMLA 1TQPA 2FXAA 1OPCA 1PUEE 2HWVA 4M71A 1OKRA 2FRHA 3RTRA 4A5MA 2DLLA 3GF2A 4HW0A 3TOAA 2L4MA 2UXXA 3MEXA 4MGRA 1V3FA 1HBXG 3WTYC 3SZTA 2A6EF 4MQ9F 4PZJA 1RZ4A 5L3DA 2RDPA 2QQ9A 4EMSA 2BBYA 1FSEA 2IA2A 4UVAA 5FLXZ 1LNWA 4AWXB 2VC1A 1HKSA 1BI2A 4LLLA 4HV5A 1DPRA 4RB0A 2ZJ2A 3CUQA 2DBBA 1R7JA 2GA1A 2K27A 1FWZA 1U3EM 2CYYA 1SFUA 2L54A 4IVNA 3Q5FA 3F6VA 3RKYA 2JRTA 4R1HA 4OU0A 5HVQC 4G7ZF 2QQAA 2XIGA 1FY7A 1I6XA 3E5UA 3ISPA 2H94A 3FM3A 1CF7A 3L00A 1B59A 4OMZA 3KP7A 5DCFA 2QWWA 3FX3A 4M73A 3BPVA 1R1VA 5D5XB 5HLGA 3RDIA 1TTYA 1E2XA 2QVOA 1SFEA 4NB5A 3SXYA 2ISYA 5LGNA 5BOXA 4I09A 2PFBA 1QO0D 4IJAA 3J80K 3IWZA 3IHUA 1LDDA 1U5TA 3EQLF 2MH9A 2A68F 2P7VB 3K9TA 5DEQA 2M45A 2YX7A 3I5UA 1EH7A 3CUQB 1T0FA 2YU3A 2WTEA 2VOPA 3ECHA 3HSEA 3ABUA 2CSOA 2JSCA 3LQRA 1RIOH 1XN7A 4HLXA 3B02A 4MHGA 1EV7A 4KIGA 4TV7A 5DD4A 5HOOA 4LLGF 2R7FA 5CYVA 2Q0OA 4AD9A 4G7OF 3K1MA 2QYOA 5ICGA 4M9SA 1G3SA 1SD5A 3GWZA 2OBPA 2PLYA 3IL2A 1Z05A 4RGXA 3COAC 5HS7A 1R22A 3ULQB 3LAPA 3HHHA 2XAGA 4KYWA 5E8GA 4ESJA 3T1BA 2BEOA 2ZKZA 2OU2A 3C3WA 5H6RA 4KNYA 5TJJA 1G4DA 4L0YB 1D8KA 4IRHA 3V7CA 5JVTA 2STTA 4WXCA 2O03A 4U88A 1A04A 3WU0A 2HYFA 1QBJA 3BP8A 4LB6B 3KZYA 1YG2A 2EV0A 2W57A 1Z1DA 1TQMA 3E6CC 1EH8A 2XROA 1T6SA 4OIQF 4O6JA 2ZFWA 4G8XA 1OMIA 3ZMSA 3KCCA 2EV5A 2XV4S 1MJAA 2PJPA 1S7OA 3GZ5A 1T2KA 1HQCA 1ZGAA 1RNLA 3MAJA 1H9TA 5IT9K 3KEQA 3WTUC 3F22A 1YFHA 3P7NA 4OMYA 5HLIA 3P9KA 1KQ0A 1BBYA 2LDUA 3VEPA 1ZG1A 2LNBA 2Z33A 3RPUA 1AOYA 2D45A 4MQVA 5A2QK 2EA2A 4M74A 2NNYA 1HXDA 3DEUA 2RGVA 3MFKA 3F8NA 2KIFA 1UCRA 1ZHFA 3PQKA 3I64A 1WWXA 1ZN2A 2GIVA 3FXQA 1O7FA 3FMRA 3HRSA 1G3WA 2RVCA 2RV8A 2AS5F 3R61A 3MQ0A 5JR3A 3FF5A 3NRVA 1ULYA 4N0BA 4GXOA 3GFJA 2R7DA 4I0BA 5H6QA 3IKVA 1GXPA 2XKOA 4WK8F 1XMAA 1OYIA 2EB7A 3TKYA 3F8BA 3QPHA 4BNCA 1W7PA 4ZYHA 1K79A 4L5JA 2Y0MA 1Z7UA 3MWMA 2H27A 2HTSA 3QAHA 3K69A 2Z5UA 2FEZA 3KLOA 2V1XA 4HYEA 4L18B 5L3GA 4GO1A 2MA3A 3GUDA 4FX4A 1F1ZA 4HOBA 5BMZA 1KGSA 3ZMUA 1IN8A 3L09A 5FGMA 4HBLA 2YSRA 4OINF 1H0MA 5FD6A 1MJ9A 4IHSA 1QZZA 4A6DA 4HDUA 3GEZA 2X0LA 4ENKA 5K5OA 3WGHA 1LB2A 2MBFA 3FMSA 1QPMA 3T5XA 3TOBA 1FC3A 5LGUA 3WU1B 3IKTA 4BYYA 2UWMA 4HX4A 3T8RA 1TQIA 1FYLA 3L9FA 2YX4A 2WV0A 2F5CA 2ZNYA 2ZMEB 4UNOA 2QBYA 1I5ZA 1XDSA 5HDKA 3KEOA 2P7CB 3I0TA 1TW3A 1FNNA 1JXSA 1OR7A 1T38A 4YFXF 4RAZA 2KIMA 2M8EA 3AAFA 1YLFA 3L2CA 1G3TA 1B1BA 3TO6A 5DUKA 1NHAA 2PEXA 4G94A 4A5NA 3BPXA 5BPDA 2HFHA 2FBHA 4PCQA 1HW1A 4U0VA 3TDUC 1KU7A 2PQ8A 1DP7P 2LF7A 2W84A 2XHKA 2XKPA 1ZLJA 2W85A 4U7BA 2FBKA 4R8HA 3DP7A 1T98A 4P9UA 2G7HA 2Q8KA 4BHCA 5D5UB 2GXBA 4EGYA 1U2WA 2B0LA 3J80Z 2XAJA 2HDCA 2D1HA 1I1GA 1FBQA 1BJAA 2HQNA 4M6YA 2WWYA 1IUYA 2VBZA 1SAXA 1W7PD 4BXUA 2QBYB 1MDMA 3GXOA 2FNAA 1K7AA 2DQRA 3BROA 2O3FA 5E8IA 2XAQA 3NQOA 2TDXA 3GFLA 2DK8A 4LJZF 1K6OA 4G7HF 1CGPA 1FPQA 5ICFA 4JBAA 2FNPA 1BI3A 3KP2A 5F1RA 2ZO4A 1WI9A 2KKOA 5D5WB 2HOEA 1LJ9A 3T8TA 1XD7A 3GZ6A 5FO5A 4F7ZA 2XGXA 4A0XA 4A2UA 2RN7A 1D5VA 5LGTA 5CVRA 1SD4A 1IW7F 1ZAOA 2NNNA 2L3DA 3ZN0A 1HSJA 3OOPA 1XGNA 2ZXJA 4LB5A 3BJ6A 3EYIA 2JTVA 2G7UA 3HSRA 1R1UA 1W7PB 3WG9A 1IN7A 4PDKA 2MD5A 2GQQA 4I7HA 2V79A 4AIJA 2VONA 1IRGA 5KVRA 1YW8A 3DFGA 2Y75A 4WXHA 3JAMZ 1KQ9A 5ILSA 3F3XA 1ZRFA 3J7AO 4UVBA 4A6EA 1SFXA 2EFWA 1BC8C 2HZTA 3V8JA 3D0SA 4PGGA 4EJWA 2HQRA 3KP4A 4XLPF 2FBIA 3L7WA 2OQRA 3LWFA 1J75A 3WTTC 3TO7A 3CUQC 5CVIA 4Q5SF 2VN2A 4IF4A 4H0EA 4RGSA 5BPIA 1R5GA 2W24A 2F2EA 4U0WA 3HTSB 3J81K 1TW2A 3HSFA 3ZP5A 1FOKA 4FHTA 3BJOA 3GFMA 4UVCA 1W5SA 3E6MA 4UHTA 1S6LA 3E97A 4A12A 4EM2A 5FD5A 5LRSA 1YS7A 4CICA 5D8KB 5DDGA 3I59B 3IRQA 3GO5A 4BQAA 4E70A 4I01A 3JAMK 4ZZLA 3FHZA 2HEOA 3RI4A 2A3SA 4UUVA 4IXAA 2ZNZA 1WKMA 1B9NA 1JHFA 2DFIA 1ZREA 4IRGA 1TNTA 4Z2YA 4KA4A 2HKOA 2F5EA 3F8FA 1Z91A 1R5HA 1FYKA 3CJNA 1IXCA 3WTVC 1U8RA 3V7SA 1HSTA 3IWFA 2KJCA 3SQNA 1KU3A 1F4KA 2EV6A 3FXUA 3E5QA 2Q2EA 2OA4A 4N9IA 3M7GA 3QRFF 3RIRA 1P4WA 5JHUA 2O8XA 3O2PE 1FT9A 2FMYA 4KMFA 3VOEA 4ZYGA 4DNCA 2OAZA 5BS6A 5HS8A 5E1XA 2GA2A 3KP5A 4WF2A 1BI1A 4EJUA 1BOAA 1XGOA 2CO5A 2IVMA 2DT5A 1BM9A 4UV8A 4HV6A 2VBXA 1F5TA 5DCMA 4S04A 2BE5F 3E6DA 2XAHA 3ZMVA 4Q47A 1J2XA 3SFZA 5K1YA 4KFCA 2HR3A 5CJ9A 4BAYA 2IT0A 3I54A 1PDNC 5A2QZ 1B6AA 4YG2F 1GVJA 5J8FA 5F64A 3FM5A 1O57A 2G9WA 4GYIA 1ODDA 3BZ6A 2FE3A 4L9JA 4EJOA 3PQJA 2HS5A 5JFRA 5E18F 3WE3A 4LGWA 2QQBA 3HIFA 2FF4A 4ZYDA 2A07F 4FT8A 4KUMA 4ASNA 2M1BA 5FB2A 2A5YB 4RB3C 2DU9A 5ED4A 1FBUA 2DAOA 3RYRA 4IHTA 5TRDA 2EFPA 3MZYA 2MC3A 2V1DA 5CLSA 2K7LA 2L01A 1LQ1A 3EETA 2J5OA 2NAZA 3EUHA 1ON2A 1D3YA 5DYMA 3QOPA 3RPQA 1FP1D 2O0YA 1YYVA 3N97A 3F8CA 2XRNA 4Y13A 1J0RA 3W6JB 4I2OA 1X3UA 3ML6A 2HKXA 3U2RA 1XCVA 1O3SA 4R79A 1S3JA 2IA0A 2CW0F 3P9CA 1SD7A 1IXSB 1YW7A 3F6OA 3WTSC 1RUNA 4AIHA 4IPAA 3GYHX 3ELKA 3GVAA 4EM1A 4KIFA 2P6TA 3KFWX 2VXZA 2IW5A 3ERED 1IZ1A 2ISZA 2LKPA 1BC7C 5EEGA 3WGGA 1JGSA 4RS8A 1ZGJA 4A0YA 4B8XA 2VE8A 4IRIA 5DD8A 3M8FA 4CZZA 4MNUA 1KYZA 3CLOA 3E6BA 3JTHA 1Z6RA 4KN7X 1BIBA 2J5PA 2FOKA 5J8CA 4HZFA 4Y15A 4I02A 2WC2A 5LRRA 3QP6A 2DK5A 3KP6A 2EWNA 3RKWA 3TGNA 4OIOF 1JE8A 4LMYA 4KT5C 4AIKA 3IC7A 1L3LA 1O3RA 4L5IA 2HYGD 4CYDA 3V8KA 2VT2A 5AIQA 3K1NA 3R60A 3QU6A 3J81Z 3LA2A 2LF8A 1ZLKA 2QZ8A 4L0ZB 3EDPA 2VE9A 3JW4A 3I58A 5E17F 2QLZA 2V1UA 1ONVA 2CGPA 2M5WA 5AONA 5LEKA 1FLIA 4EJVA 5ICCA 2PMHA 2K02A 1TLHB 2P5KA 1HW5A 3S2WA 4LK1F 1XSXA 4M72A 4YIIA 2IP2A 1SMYF 5D6EA 1R58A 2H09A 1O3QA 2XUBA 2ZMEA 2E7WA 3C1DA 1W5TA 2X4HA 3DPLC 1RI7A 5CVVA 2NS0A 3I71A 3TQNA 1DDNA 5L3FA 4HDVA 2V9VA 3QU3A 2EFOA 3WODF 3CUOA 4P96A 4L9TA 1C0WA 1MZBA 3LAJA 1U6GA 3CDHA 2A69F 2R3SA 2O6GE 3I53A 4CHUA 4EV0A 1Z6TA 2RC4A 5D4RA 3W6KB 1G3YA 3T0YA 2ZBKA 4ESFA 3I4PA 1T39A 3CO6C 3BWGA 1F9NA 4LFUA 3RJPA 1GXQA 1S7AA 2QM3A 3HHGA 2V6CA 4KN4X 5CVUA 1QQIA 1QZYA 3QPTA 1XGMA 2FQ3A 4OIRF 5D6FA 4LG0A 3JSOA 2JPCA 3KP3A 4JK1X 2VOOA 4A0ZA 2KRFA 1E17A 3GFIA 2MLKA 2A61A 3FXRA 3QP5A 1BN5A 2YPRA 3B73A 2ESHA 4QWQA 3SHFA 3GW2A 3U9GA 4WCGA 2C6YA 2VC0A 2VBWA 3M1EA 4ZYEA 1O3TA 2PI0A 1YIOA 1KA8A 2MH2A 2FU4A 3BJAA 1YO5C 1FSHA 1H9GA 5L3BA 1FZPB 5BQTA 4CO8A 2VT3A 3DKWA 2E1NA 2ZCWA 4FX0A 3KE2A 2FSWA 4U0YA 2GXGA 2VODA 3CTAA 2DI3A 2CWEA 4XSZF 5D4SA 3DPTA 3V8LA 4XRFA 3KZZA 3HRMA 1W4MA 1PP7U 1I27A 1O7LA 1IF1A 1YTYA 4KMUX 2K86A 3GLXA 2DO7A 2DTRA 4KIBA 3VODA 3GX4X 4YFKF 4ON0A 5DUIA 3G3ZA 2OZ6A 4LD5A 2QENA 1YQAA 2PMUA 2DW4A 2NRAC 1DUXC 5HS9A 1WSUA 3K0LA 1RUOA 1S29A 5AIPA 1XGSA 4O3MA 4KDPA 1XB4A 1KU9A 1S8NA 4HA8A 3R6SA 2CQKA 4KICA 1XSVA 4AVPA 4EM0B 3C7JA 3HOSA 4D0PA 4GYGA 3FWEA 3U1DA 4P9FA 1FP2A 4HQMA 1HW2A 2IA1A 5LHIA 4XLNF 1ZG5A 3R4KA 2ACJA 1BI0A 3C18A 4OOIA 3V7RA 1ZRDA 1JHHA 2RQPA 1KU2A 3JSPA 1G6NA 4PGHA 1V4RA 2P6SA 5LBQA 5E20A 3RKXA 5H20A 2Z3YA 1GHCA 3Q9SA 1ZYRF 3E3VA 4HLYA 5K5RA 3LQQA 3VFZA 3ZMTA 3HUGA 4U7DA 2JZYA 1FX7A 2GAUA 5D5VB 1R00A 5FFXA 3FZVA 1AWCA 2XAFA 3N4MA 2P4WA 4ENNA 1D8JA 3HRUA 1Z9CA 2EJRA 3F23A 3CO7C 1DPUA 3TO9A 4NQWA 3LA7A 4L9VA 3ZN1A 5D8LB 1OYWA 1REPC 5L3EA 4NHJA 2EFQA 2P8TA 4BHBA 2XASA 2DPDA 3KLNA 2BGCA 2OD5A 4UV9A 2JPBA 1UHWA 4MEYF 1MKMA 3JTGA 2GWRA 4ZZDA 4CXFA 4LK0F 3M9AA 3LFKA 2E1CA 2EA4A 3MCZA 4HQEA 4JQFA 3ZMZA 4N9HA 3HOTA 3WE2A 2PBIA 3SZPA 1VTNC 4G9YA 1UB9A 1LEAA 4RGRA 1P4AA 5DCMB 4WXDA 3FMQA 2RNJA 1IN5A 5J6XA 4MEXF 4Q4ZF 1P4XA 5EEHA 2F5DA 5F6FA 1KQ8A 4HF1A 1P92A 2D1VA 3KETA 2M30A 2JT1A 1P2FA 3LSTA 3I59A 3HTUA 1R23A 4YIFA 1SD6A 2NYXA 2L02A 4XSXF 2A6HF 6PAXA 3LA3A 2HGCA 5HLHA 1YS6A 2STWA 3DQVC 2O61A 1ZARA 2YR2A 1J59A 2OZUA 2PG4A 5HDNA 1WRJA 2KJBA 2D2WA 1KYWA 4HX7A 1ON1A 3ECOA 4XBFA 3RYPA 2ELHA 2RKHA 3R0AA 3R0JA 2HTJA 4DQ2A 3F21A 1ZG3A 5HDGA 4M9XA 4CGZA 1XCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P9I A;  2H6C A;  4EGZ A;  4UXN A;  1IN4 A;  2GZW A;  1HKQ A;  1J7K A;  4RB1 A;  1HKT A;  2BV6 A;  3PFI A;  3BOQ A;  3O3K A;  4MTD A;  4L9N A;  2AXL A;  4WWC A;  4LG0 B;  1LDK B;  3OV8 A;  4WX9 A;  2VBY A;  1U5T C;  1I1S A;  2EK5 A;  4I0A A;  5L3C A;  4YFN F;  1FBS A;  3D5L A;  3WTW C;  1K78 A;  1ZH5 A;  3ZPL A;  3H3Z A;  4HF0 A;  4ZH4 F;  4Q48 A;  3EYY A;  1LVA A;  4S05 A;  3VB2 A;  2CG4 A;  4G6D A;  3WTX C;  2IJL A;  3ABT A;  5FLX K;  2KIU A;  3HYI A;  2IPQ X;  4M9Z A;  2EFN A;  4ESB A;  5ERI A;  2P5V A;  4O5V A;  2W25 A;  4BH9 A;  4ENM A;  4CDG A;  3DXJ F;  3Q9V A;  2Z9O A;  4EVI A;  3IRR A;  2F5F A;  1XMK A;  3DV8 A;  4HX8 A;  4P55 A;  1SMT A;  5LHH A;  2OQG A;  1U78 A;  1MGT A;  1XSD A;  3K1P A;  3V4G A;  4P5O A;  2Y48 A;  2K4B A;  2MLG A;  2CFX A;  2P5L C;  3E5X A;  2BYV E;  4HF2 A;  2COM A;  2L4A A;  4RAY A;  4RB2 C;  4I98 B;  5FFZ A;  4GGG A;  2ADU A;  5ILU A;  4G6Q A;  1MDM B;  1QGP A;  4M6X A;  1IRF A;  2IRF G;  3WTZ A;  5CVJ A;  3REO A;  1XDU A;  4B09 A;  4EQQ A;  4RGU A;  2XVC A;  5DV5 A;  4ENJ A;  4GCV A;  4HAM A;  1QNT A;  5LHG A;  1TBX A;  3F8M A;  1ZRC A;  2K4J A;  2DPU A;  1LDJ A;  1TNS A;  2H6B A;  4MTE A;  2QUF A;  3H92 A;  2PN6 A;  1J9I A;  1IAW A;  1Q1H A;  4Y17 A;  5E1W A;  5IT3 A;  1UHM A;  1R36 A;  1MD0 A;  3ROU A;  4LLN A;  4OIP F;  5K5Q A;  3BY6 A;  3HRT A;  1EH6 A;  1CF7 B;  3M8E A;  5IT9 Z;  1IN6 A;  2E7X A;  1L0O C;  1K78 B;  1Y0U A;  1FYM A;  5KK1 A;  2M87 A;  1LEB A;  5ILV A;  4QLC U;  3NEU A;  1WQ2 A;  2UZK A;  3F72 A;  4ETS A;  4BHP A;  1MJB A;  4EJT A;  2UXN A;  1B9M A;  3G73 A;  3H3U A;  1UFM A;  1R1T A;  1OYY A;  1STZ A;  1B4A A;  4K2E A;  1PP8 F;  2FA5 A;  1U5T B;  3ZMD A;  3BDD A;  1YW9 A;  1P6R A;  1J5Y A;  1IXR C;  2ETH A;  2LSO A;  1USS A;  3TDZ C;  5ICE A;  2ESN A;  3O6B B;  5E1Z B;  3K2Z A;  1BIA A;  5JI6 A;  2DQL A;  3ZQ7 A;  2Z99 A;  3DF8 A;  5LLQ A;  3MZH A;  1UST A;  5LEJ A;  3WGI A;  2FML A;  1TQP A;  2FXA A;  1OPC A;  1PUE E;  2HWV A;  4M71 A;  1OKR A;  2FRH A;  3RTR A;  4A5M A;  2DLL A;  3GF2 A;  4HW0 A;  3TOA A;  2L4M A;  2UXX A;  3MEX A;  4MGR A;  1V3F A;  1HBX G;  3WTY C;  3SZT A;  2A6E F;  4MQ9 F;  4PZJ A;  1RZ4 A;  5L3D A;  2RDP A;  2QQ9 A;  4EMS A;  2BBY A;  1FSE A;  2IA2 A;  4UVA A;  5FLX Z;  1LNW A;  4AWX B;  2VC1 A;  1HKS A;  1BI2 A;  4LLL A;  4HV5 A;  1DPR A;  4RB0 A;  2ZJ2 A;  3CUQ A;  2DBB A;  1R7J A;  2GA1 A;  2K27 A;  1FWZ A;  1U3E M;  2CYY A;  1SFU A;  2L54 A;  4IVN A;  3Q5F A;  3F6V A;  3RKY A;  2JRT A;  4R1H A;  4OU0 A;  5HVQ C;  4G7Z F;  2QQA A;  2XIG A;  1FY7 A;  1I6X A;  3E5U A;  3ISP A;  2H94 A;  3FM3 A;  1CF7 A;  3L00 A;  1B59 A;  4OMZ A;  3KP7 A;  5DCF A;  2QWW A;  3FX3 A;  4M73 A;  3BPV A;  1R1V A;  5D5X B;  5HLG A;  3RDI A;  1TTY A;  1E2X A;  2QVO A;  1SFE A;  4NB5 A;  3SXY A;  2ISY A;  5LGN A;  5BOX A;  4I09 A;  2PFB A;  1QO0 D;  4IJA A;  3J80 K;  3IWZ A;  3IHU A;  1LDD A;  1U5T A;  3EQL F;  2MH9 A;  2A68 F;  2P7V B;  3K9T A;  5DEQ A;  2M45 A;  2YX7 A;  3I5U A;  1EH7 A;  3CUQ B;  1T0F A;  2YU3 A;  2WTE A;  2VOP A;  3ECH A;  3HSE A;  3ABU A;  2CSO A;  2JSC A;  3LQR A;  1RIO H;  1XN7 A;  4HLX A;  3B02 A;  4MHG A;  1EV7 A;  4KIG A;  4TV7 A;  5DD4 A;  5HOO A;  4LLG F;  2R7F A;  5CYV A;  2Q0O A;  4AD9 A;  4G7O F;  3K1M A;  2QYO A;  5ICG A;  4M9S A;  1G3S A;  1SD5 A;  3GWZ A;  2OBP A;  2PLY A;  3IL2 A;  1Z05 A;  4RGX A;  3COA C;  5HS7 A;  1R22 A;  3ULQ B;  3LAP A;  3HHH A;  2XAG A;  4KYW A;  5E8G A;  4ESJ A;  3T1B A;  2BEO A;  2ZKZ A;  2OU2 A;  3C3W A;  5H6R A;  4KNY A;  5TJJ A;  1G4D A;  4L0Y B;  1D8K A;  4IRH A;  3V7C A;  5JVT A;  2STT A;  4WXC A;  2O03 A;  4U88 A;  1A04 A;  3WU0 A;  2HYF A;  1QBJ A;  3BP8 A;  4LB6 B;  3KZY A;  1YG2 A;  2EV0 A;  2W57 A;  1Z1D A;  1TQM A;  3E6C C;  1EH8 A;  2XRO A;  1T6S A;  4OIQ F;  4O6J A;  2ZFW A;  4G8X A;  1OMI A;  3ZMS A;  3KCC A;  2EV5 A;  2XV4 S;  1MJA A;  2PJP A;  1S7O A;  3GZ5 A;  1T2K A;  1HQC A;  1ZGA A;  1RNL A;  3MAJ A;  1H9T A;  5IT9 K;  3KEQ A;  3WTU C;  3F22 A;  1YFH A;  3P7N A;  4OMY A;  5HLI A;  3P9K A;  1KQ0 A;  1BBY A;  2LDU A;  3VEP A;  1ZG1 A;  2LNB A;  2Z33 A;  3RPU A;  1AOY A;  2D45 A;  4MQV A;  5A2Q K;  2EA2 A;  4M74 A;  2NNY A;  1HXD A;  3DEU A;  2RGV A;  3MFK A;  3F8N A;  2KIF A;  1UCR A;  1ZHF A;  3PQK A;  3I64 A;  1WWX A;  1ZN2 A;  2GIV A;  3FXQ A;  1O7F A;  3FMR A;  3HRS A;  1G3W A;  2RVC A;  2RV8 A;  2AS5 F;  3R61 A;  3MQ0 A;  5JR3 A;  3FF5 A;  3NRV A;  1ULY A;  4N0B A;  4GXO A;  3GFJ A;  2R7D A;  4I0B A;  5H6Q A;  3IKV A;  1GXP A;  2XKO A;  4WK8 F;  1XMA A;  1OYI A;  2EB7 A;  3TKY A;  3F8B A;  3QPH A;  4BNC A;  1W7P A;  4ZYH A;  1K79 A;  4L5J A;  2Y0M A;  1Z7U A;  3MWM A;  2H27 A;  2HTS A;  3QAH A;  3K69 A;  2Z5U A;  2FEZ A;  3KLO A;  2V1X A;  4HYE A;  4L18 B;  5L3G A;  4GO1 A;  2MA3 A;  3GUD A;  4FX4 A;  1F1Z A;  4HOB A;  5BMZ A;  1KGS A;  3ZMU A;  1IN8 A;  3L09 A;  5FGM A;  4HBL A;  2YSR A;  4OIN F;  1H0M A;  5FD6 A;  1MJ9 A;  4IHS A;  1QZZ A;  4A6D A;  4HDU A;  3GEZ A;  2X0L A;  4ENK A;  5K5O A;  3WGH A;  1LB2 A;  2MBF A;  3FMS A;  1QPM A;  3T5X A;  3TOB A;  1FC3 A;  5LGU A;  3WU1 B;  3IKT A;  4BYY A;  2UWM A;  4HX4 A;  3T8R A;  1TQI A;  1FYL A;  3L9F A;  2YX4 A;  2WV0 A;  2F5C A;  2ZNY A;  2ZME B;  4UNO A;  2QBY A;  1I5Z A;  1XDS A;  5HDK A;  3KEO A;  2P7C B;  3I0T A;  1TW3 A;  1FNN A;  1JXS A;  1OR7 A;  1T38 A;  4YFX F;  4RAZ A;  2KIM A;  2M8E A;  3AAF A;  1YLF A;  3L2C A;  1G3T A;  1B1B A;  3TO6 A;  5DUK A;  1NHA A;  2PEX A;  4G94 A;  4A5N A;  3BPX A;  5BPD A;  2HFH A;  2FBH A;  4PCQ A;  1HW1 A;  4U0V A;  3TDU C;  1KU7 A;  2PQ8 A;  1DP7 P;  2LF7 A;  2W84 A;  2XHK A;  2XKP A;  1ZLJ A;  2W85 A;  4U7B A;  2FBK A;  4R8H A;  3DP7 A;  1T98 A;  4P9U A;  2G7H A;  2Q8K A;  4BHC A;  5D5U B;  2GXB A;  4EGY A;  1U2W A;  2B0L A;  3J80 Z;  2XAJ A;  2HDC A;  2D1H A;  1I1G A;  1FBQ A;  1BJA A;  2HQN A;  4M6Y A;  2WWY A;  1IUY A;  2VBZ A;  1SAX A;  1W7P D;  4BXU A;  2QBY B;  1MDM A;  3GXO A;  2FNA A;  1K7A A;  2DQR A;  3BRO A;  2O3F A;  5E8I A;  2XAQ A;  3NQO A;  2TDX A;  3GFL A;  2DK8 A;  4LJZ F;  1K6O A;  4G7H F;  1CGP A;  1FPQ A;  5ICF A;  4JBA A;  2FNP A;  1BI3 A;  3KP2 A;  5F1R A;  2ZO4 A;  1WI9 A;  2KKO A;  5D5W B;  2HOE A;  1LJ9 A;  3T8T A;  1XD7 A;  3GZ6 A;  5FO5 A;  4F7Z A;  2XGX A;  4A0X A;  4A2U A;  2RN7 A;  1D5V A;  5LGT A;  5CVR A;  1SD4 A;  1IW7 F;  1ZAO A;  2NNN A;  2L3D A;  3ZN0 A;  1HSJ A;  3OOP A;  1XGN A;  2ZXJ A;  4LB5 A;  3BJ6 A;  3EYI A;  2JTV A;  2G7U A;  3HSR A;  1R1U A;  1W7P B;  3WG9 A;  1IN7 A;  4PDK A;  2MD5 A;  2GQQ A;  4I7H A;  2V79 A;  4AIJ A;  2VON A;  1IRG A;  5KVR A;  1YW8 A;  3DFG A;  2Y75 A;  4WXH A;  3JAM Z;  1KQ9 A;  5ILS A;  3F3X A;  1ZRF A;  3J7A O;  4UVB A;  4A6E A;  1SFX A;  2EFW A;  1BC8 C;  2HZT A;  3V8J A;  3D0S A;  4PGG A;  4EJW A;  2HQR A;  3KP4 A;  4XLP F;  2FBI A;  3L7W A;  2OQR A;  3LWF A;  1J75 A;  3WTT C;  3TO7 A;  3CUQ C;  5CVI A;  4Q5S F;  2VN2 A;  4IF4 A;  4H0E A;  4RGS A;  5BPI A;  1R5G A;  2W24 A;  2F2E A;  4U0W A;  3HTS B;  3J81 K;  1TW2 A;  3HSF A;  3ZP5 A;  1FOK A;  4FHT A;  3BJO A;  3GFM A;  4UVC A;  1W5S A;  3E6M A;  4UHT A;  1S6L A;  3E97 A;  4A12 A;  4EM2 A;  5FD5 A;  5LRS A;  1YS7 A;  4CIC A;  5D8K B;  5DDG A;  3I59 B;  3IRQ A;  3GO5 A;  4BQA A;  4E70 A;  4I01 A;  3JAM K;  4ZZL A;  3FHZ A;  2HEO A;  3RI4 A;  2A3S A;  4UUV A;  4IXA A;  2ZNZ A;  1WKM A;  1B9N A;  1JHF A;  2DFI A;  1ZRE A;  4IRG A;  1TNT A;  4Z2Y A;  4KA4 A;  2HKO A;  2F5E A;  3F8F A;  1Z91 A;  1R5H A;  1FYK A;  3CJN A;  1IXC A;  3WTV C;  1U8R A;  3V7S A;  1HST A;  3IWF A;  2KJC A;  3SQN A;  1KU3 A;  1F4K A;  2EV6 A;  3FXU A;  3E5Q A;  2Q2E A;  2OA4 A;  4N9I A;  3M7G A;  3QRF F;  3RIR A;  1P4W A;  5JHU A;  2O8X A;  3O2P E;  1FT9 A;  2FMY A;  4KMF A;  3VOE A;  4ZYG A;  4DNC A;  2OAZ A;  5BS6 A;  5HS8 A;  5E1X A;  2GA2 A;  3KP5 A;  4WF2 A;  1BI1 A;  4EJU A;  1BOA A;  1XGO A;  2CO5 A;  2IVM A;  2DT5 A;  1BM9 A;  4UV8 A;  4HV6 A;  2VBX A;  1F5T A;  5DCM A;  4S04 A;  2BE5 F;  3E6D A;  2XAH A;  3ZMV A;  4Q47 A;  1J2X A;  3SFZ A;  5K1Y A;  4KFC A;  2HR3 A;  5CJ9 A;  4BAY A;  2IT0 A;  3I54 A;  1PDN C;  5A2Q Z;  1B6A A;  4YG2 F;  1GVJ A;  5J8F A;  5F64 A;  3FM5 A;  1O57 A;  2G9W A;  4GYI A;  1ODD A;  3BZ6 A;  2FE3 A;  4L9J A;  4EJO A;  3PQJ A;  2HS5 A;  5JFR A;  5E18 F;  3WE3 A;  4LGW A;  2QQB A;  3HIF A;  2FF4 A;  4ZYD A;  2A07 F;  4FT8 A;  4KUM A;  4ASN A;  2M1B A;  5FB2 A;  2A5Y B;  4RB3 C;  2DU9 A;  5ED4 A;  1FBU A;  2DAO A;  3RYR A;  4IHT A;  5TRD A;  2EFP A;  3MZY A;  2MC3 A;  2V1D A;  5CLS A;  2K7L A;  2L01 A;  1LQ1 A;  3EET A;  2J5O A;  2NAZ A;  3EUH A;  1ON2 A;  1D3Y A;  5DYM A;  3QOP A;  3RPQ A;  1FP1 D;  2O0Y A;  1YYV A;  3N97 A;  3F8C A;  2XRN A;  4Y13 A;  1J0R A;  3W6J B;  4I2O A;  1X3U A;  3ML6 A;  2HKX A;  3U2R A;  1XCV A;  1O3S A;  4R79 A;  1S3J A;  2IA0 A;  2CW0 F;  3P9C A;  1SD7 A;  1IXS B;  1YW7 A;  3F6O A;  3WTS C;  1RUN A;  4AIH A;  4IPA A;  3GYH X;  3ELK A;  3GVA A;  4EM1 A;  4KIF A;  2P6T A;  3KFW X;  2VXZ A;  2IW5 A;  3ERE D;  1IZ1 A;  2ISZ A;  2LKP A;  1BC7 C;  5EEG A;  3WGG A;  1JGS A;  4RS8 A;  1ZGJ A;  4A0Y A;  4B8X A;  2VE8 A;  4IRI A;  5DD8 A;  3M8F A;  4CZZ A;  4MNU A;  1KYZ A;  3CLO A;  3E6B A;  3JTH A;  1Z6R A;  4KN7 X;  1BIB A;  2J5P A;  2FOK A;  5J8C A;  4HZF A;  4Y15 A;  4I02 A;  2WC2 A;  5LRR A;  3QP6 A;  2DK5 A;  3KP6 A;  2EWN A;  3RKW A;  3TGN A;  4OIO F;  1JE8 A;  4LMY A;  4KT5 C;  4AIK A;  3IC7 A;  1L3L A;  1O3R A;  4L5I A;  2HYG D;  4CYD A;  3V8K A;  2VT2 A;  5AIQ A;  3K1N A;  3R60 A;  3QU6 A;  3J81 Z;  3LA2 A;  2LF8 A;  1ZLK A;  2QZ8 A;  4L0Z B;  3EDP A;  2VE9 A;  3JW4 A;  3I58 A;  5E17 F;  2QLZ A;  2V1U A;  1ONV A;  2CGP A;  2M5W A;  5AON A;  5LEK A;  1FLI A;  4EJV A;  5ICC A;  2PMH A;  2K02 A;  1TLH B;  2P5K A;  1HW5 A;  3S2W A;  4LK1 F;  1XSX A;  4M72 A;  4YII A;  2IP2 A;  1SMY F;  5D6E A;  1R58 A;  2H09 A;  1O3Q A;  2XUB A;  2ZME A;  2E7W A;  3C1D A;  1W5T A;  2X4H A;  3DPL C;  1RI7 A;  5CVV A;  2NS0 A;  3I71 A;  3TQN A;  1DDN A;  5L3F A;  4HDV A;  2V9V A;  3QU3 A;  2EFO A;  3WOD F;  3CUO A;  4P96 A;  4L9T A;  1C0W A;  1MZB A;  3LAJ A;  1U6G A;  3CDH A;  2A69 F;  2R3S A;  2O6G E;  3I53 A;  4CHU A;  4EV0 A;  1Z6T A;  2RC4 A;  5D4R A;  3W6K B;  1G3Y A;  3T0Y A;  2ZBK A;  4ESF A;  3I4P A;  1T39 A;  3CO6 C;  3BWG A;  1F9N A;  4LFU A;  3RJP A;  1GXQ A;  1S7A A;  2QM3 A;  3HHG A;  2V6C A;  4KN4 X;  5CVU A;  1QQI A;  1QZY A;  3QPT A;  1XGM A;  2FQ3 A;  4OIR F;  5D6F A;  4LG0 A;  3JSO A;  2JPC A;  3KP3 A;  4JK1 X;  2VOO A;  4A0Z A;  2KRF A;  1E17 A;  3GFI A;  2MLK A;  2A61 A;  3FXR A;  3QP5 A;  1BN5 A;  2YPR A;  3B73 A;  2ESH A;  4QWQ A;  3SHF A;  3GW2 A;  3U9G A;  4WCG A;  2C6Y A;  2VC0 A;  2VBW A;  3M1E A;  4ZYE A;  1O3T A;  2PI0 A;  1YIO A;  1KA8 A;  2MH2 A;  2FU4 A;  3BJA A;  1YO5 C;  1FSH A;  1H9G A;  5L3B A;  1FZP B;  5BQT A;  4CO8 A;  2VT3 A;  3DKW A;  2E1N A;  2ZCW A;  4FX0 A;  3KE2 A;  2FSW A;  4U0Y A;  2GXG A;  2VOD A;  3CTA A;  2DI3 A;  2CWE A;  4XSZ F;  5D4S A;  3DPT A;  3V8L A;  4XRF A;  3KZZ A;  3HRM A;  1W4M A;  1PP7 U;  1I27 A;  1O7L A;  1IF1 A;  1YTY A;  4KMU X;  2K86 A;  3GLX A;  2DO7 A;  2DTR A;  4KIB A;  3VOD A;  3GX4 X;  4YFK F;  4ON0 A;  5DUI A;  3G3Z A;  2OZ6 A;  4LD5 A;  2QEN A;  1YQA A;  2PMU A;  2DW4 A;  2NRA C;  1DUX C;  5HS9 A;  1WSU A;  3K0L A;  1RUO A;  1S29 A;  5AIP A;  1XGS A;  4O3M A;  4KDP A;  1XB4 A;  1KU9 A;  1S8N A;  4HA8 A;  3R6S A;  2CQK A;  4KIC A;  1XSV A;  4AVP A;  4EM0 B;  3C7J A;  3HOS A;  4D0P A;  4GYG A;  3FWE A;  3U1D A;  4P9F A;  1FP2 A;  4HQM A;  1HW2 A;  2IA1 A;  5LHI A;  4XLN F;  1ZG5 A;  3R4K A;  2ACJ A;  1BI0 A;  3C18 A;  4OOI A;  3V7R A;  1ZRD A;  1JHH A;  2RQP A;  1KU2 A;  3JSP A;  1G6N A;  4PGH A;  1V4R A;  2P6S A;  5LBQ A;  5E20 A;  3RKX A;  5H20 A;  2Z3Y A;  1GHC A;  3Q9S A;  1ZYR F;  3E3V A;  4HLY A;  5K5R A;  3LQQ A;  3VFZ A;  3ZMT A;  3HUG A;  4U7D A;  2JZY A;  1FX7 A;  2GAU A;  5D5V B;  1R00 A;  5FFX A;  3FZV A;  1AWC A;  2XAF A;  3N4M A;  2P4W A;  4ENN A;  1D8J A;  3HRU A;  1Z9C A;  2EJR A;  3F23 A;  3CO7 C;  1DPU A;  3TO9 A;  4NQW A;  3LA7 A;  4L9V A;  3ZN1 A;  5D8L B;  1OYW A;  1REP C;  5L3E A;  4NHJ A;  2EFQ A;  2P8T A;  4BHB A;  2XAS A;  2DPD A;  3KLN A;  2BGC A;  2OD5 A;  4UV9 A;  2JPB A;  1UHW A;  4MEY F;  1MKM A;  3JTG A;  2GWR A;  4ZZD A;  4CXF A;  4LK0 F;  3M9A A;  3LFK A;  2E1C A;  2EA4 A;  3MCZ A;  4HQE A;  4JQF A;  3ZMZ A;  4N9H A;  3HOT A;  3WE2 A;  2PBI A;  3SZP A;  1VTN C;  4G9Y A;  1UB9 A;  1LEA A;  4RGR A;  1P4A A;  5DCM B;  4WXD A;  3FMQ A;  2RNJ A;  1IN5 A;  5J6X A;  4MEX F;  4Q4Z F;  1P4X A;  5EEH A;  2F5D A;  5F6F A;  1KQ8 A;  4HF1 A;  1P92 A;  2D1V A;  3KET A;  2M30 A;  2JT1 A;  1P2F A;  3LST A;  3I59 A;  3HTU A;  1R23 A;  4YIF A;  1SD6 A;  2NYX A;  2L02 A;  4XSX F;  2A6H F;  6PAX A;  3LA3 A;  2HGC A;  5HLH A;  1YS6 A;  2STW A;  3DQV C;  2O61 A;  1ZAR A;  2YR2 A;  1J59 A;  2OZU A;  2PG4 A;  5HDN A;  1WRJ A;  2KJB A;  2D2W A;  1KYW A;  4HX7 A;  1ON1 A;  3ECO A;  4XBF A;  3RYP A;  2ELH A;  2RKH A;  3R0A A;  3R0J A;  2HTJ A;  4DQ2 A;  3F21 A;  1ZG3 A;  5HDG A;  4M9X A;  4CGZ A;  1XCB A; 
#chains in the Genus database with same CATH topology
 2X1D A;  3LSH A;  3P9I A;  1TP4 A;  3BTC A;  2H6C A;  4PK4 A;  4UXN A;  4EGZ A;  1DQU A;  3ZQL A;  4F55 A;  1R49 A;  1IN4 A;  2GZW A;  2M7B A;  1HKQ A;  1J7K A;  4RB1 A;  1HKT A;  2BV6 A;  1ENH A;  3PFI A;  2QKL B;  3BOQ A;  3O3K A;  2K85 A;  2VL8 A;  4MTD A;  4L9N A;  4X0G A;  2AXL A;  4WWC A;  5EJC A;  2QA4 I;  4LG0 B;  1LDK B;  3OV8 A;  4WX9 A;  1LE8 B;  2DOD A;  2VBY A;  2ZXI A;  1U5T C;  1I1S A;  2EK5 A;  4I0A A;  5L3C A;  1PVE A;  4YFN F;  1FBS A;  3D5L A;  3WTW C;  3S32 A;  1E3H A;  1K78 A;  4AID A;  4YEL A;  1ZH5 A;  1YX5 A;  1MND A;  3ZPL A;  2LMD A;  3H3Z A;  4HF0 A;  4Y33 A;  4ZH4 F;  1AHD P;  4HNU A;  4Q48 A;  4Y52 J;  1A5J A;  3EYY A;  1LVA A;  1OCP A;  2EIL H;  2CQ7 A;  4S05 A;  3PO2 J;  3BR1 A;  1U0J A;  1ZK8 A;  3VB2 A;  3OYD A;  2B63 J;  3S1M J;  3P5J A;  2PMZ N;  1IV6 A;  2CG4 A;  3W2V A;  3RSN A;  2KHM A;  3N05 A;  4G6D A;  3WTX C;  1VQ7 I;  1WJA A;  2IJL A;  3ABT A;  1BL0 A;  3CCE I;  4C2T A;  4DZJ A;  5FLX K;  4AM3 A;  1TZL A;  2KIU A;  4NC6 A;  3HYI A;  2IPQ X;  4M9Z A;  2EFN A;  4ESB A;  2HXI A;  5ERI A;  2CH0 A;  2M7A A;  2P5V A;  3IUO A;  1WJC A;  2H1K A;  3KEY A;  4O5V A;  1MNM C;  2W25 A;  3GTP J;  2BY1 A;  4BH9 A;  3HGG A;  3OYN A;  4ENM A;  3I56 I;  4CDG A;  3DXJ F;  3Q9V A;  3S15 J;  2Z9O A;  4EVI A;  4DJA A;  4DZP A;  3PO3 J;  3IRR A;  2F5F A;  1XMK A;  2R92 J;  3DV8 A;  4HX8 A;  2BVM A;  4P55 A;  1DGR M;  1SMT A;  3CJQ B;  5LHH A;  2OQG A;  1U78 A;  2ZSH B;  4DYC A;  4E7J A;  1OCT C;  1MGT A;  1XSD A;  2ZSI B;  3K1P A;  3V4G A;  4CA0 A;  1BW5 A;  2BY3 A;  4J01 A;  4P5O A;  2Y48 A;  4FAS D;  2K4B A;  4F3Q A;  4RBO A;  2MLG A;  1QRY A;  1XC5 A;  1I50 J;  2LY9 A;  2CFX A;  5GAE J;  2P5L C;  3E5X A;  1POG A;  4E7I A;  4W1U A;  3K4J A;  5F0F A;  4BJT A;  2BYV E;  1IDY A;  4HF2 A;  2COM A;  4Z6Y A;  2L4A A;  4RAY A;  4RB2 C;  2YUS A;  1UJ8 A;  3LSR A;  4I98 B;  4CCL A;  4B4C A;  3L2V A;  5FFZ A;  4BE1 A;  4GGG A;  4FCY A;  1HF0 A;  2L7K A;  2BW3 B;  4FE4 A;  2ADU A;  4D5F A;  5ILU A;  4G6Q A;  1MDM B;  5EEA A;  2W48 A;  1JKR C;  1QGP A;  3S3N A;  4M6X A;  3D5S C;  3IH4 A;  2L9R A;  5FKO A;  1IRF A;  2M4K A;  3VPR A;  4JX6 A;  2IRF G;  1Z3Y A;  3WTZ A;  3WHB A;  5CVJ A;  3REO A;  2MYS A;  1XDU A;  2CUZ A;  1XG1 A;  4B09 A;  4EQQ A;  4AYB N;  2HOT A;  4RGU A;  4F93 B;  2XVC A;  1AKH B;  5J1R A;  3VSK A;  2VLA A;  3OYJ A;  1P9Q C;  5DV5 A;  4XIC A;  4ENJ A;  4GCV A;  4HAM A;  2FOW A;  2L9S A;  1QNT A;  1TWA J;  5J4Y A;  5LHG A;  4BJ6 C;  1TBX A;  5CQE A;  1MH4 A;  2DTZ A;  2FUG 2;  3TP3 A;  3F8M A;  1ZRC A;  2K4J A;  2DPU A;  1K6Y A;  1LDJ A;  1TNS A;  1QA6 A;  3CMM A;  1EA3 A;  2H6B A;  1U9O A;  3QPL A;  4MTE A;  2QUF A;  3H92 A;  1QHH D;  4F52 A;  2PN6 A;  1J9I A;  3HOY J;  5TIS C;  1IAW A;  1Q1H A;  2L5Q A;  4Y17 A;  5E1W A;  4MFE A;  5IT3 A;  3Q0V A;  5LFA A;  1UHM A;  1R36 A;  1MD0 A;  3K4N A;  3ROU A;  3I4N J;  4LLN A;  1D1A A;  4DIQ A;  1MMD A;  2XF7 A;  5EG0 A;  1BR4 A;  3UNG C;  2R7O A;  4OIP F;  5K5Q A;  3BY6 A;  3HRT A;  4J00 A;  1T0F C;  3I55 I;  1JTX A;  2K3F A;  5IOZ A;  1Q1V A;  3HL2 A;  2K9S A;  1MSF C;  2R7Q A;  2M9H A;  1EH6 A;  2X48 A;  1CF7 B;  1GVD A;  3M8E A;  5IT9 Z;  1IN6 A;  2E7X A;  3ERM A;  3CJT B;  1L0O C;  1H88 C;  2JA7 J;  1K78 B;  1Y0U A;  3K70 D;  3TW6 A;  1FYM A;  1DGW Y;  2OV7 A;  5KK1 A;  2M87 A;  1LEB A;  3GLL A;  4QLC U;  5ILV A;  3NEU A;  1WQ2 A;  2OJE D;  3C2H A;  1LFB A;  2UZK A;  3MD2 A;  3F72 A;  2E35 A;  3FK6 A;  3OR2 C;  4AC0 A;  4ETS A;  2KFD A;  4BHP A;  1MJB A;  3OL4 A;  4EJT A;  2UXN A;  4NQW B;  2IBD A;  4OAZ A;  1B9M A;  2JJ7 A;  1JTY A;  3HZJ A;  2FX0 A;  2JK3 A;  3G73 A;  3H3U A;  4XLE A;  2H1L A;  1UFM A;  1R1T A;  2EIJ H;  1OYY A;  1STZ A;  3GTG J;  1B4A A;  1LVK A;  4K2E A;  4BEH A;  1PP8 F;  5F08 A;  5JHF A;  2JVH A;  5F0H A;  5FRN A;  1FIA A;  2FA5 A;  2UV1 A;  1U5T B;  3ZMD A;  3BDD A;  1YW9 A;  1P6R A;  1J5Y A;  1MBK A;  1VQ9 I;  1IXR C;  2ETH A;  2LSO A;  1USS A;  3TDZ C;  3S1N J;  3HUG B;  5ICE A;  5KCM A;  2ESN A;  1S7E A;  3L2W A;  4BQO A;  3O6B B;  2HOS A;  5IY5 H;  1MW7 A;  5E1Z B;  3HB9 A;  3K2Z A;  1BIA A;  4V19 K;  3QWL A;  4ZC3 A;  5JI6 A;  1UG2 A;  2R5Y B;  4PJN A;  4C2M J;  2KQR A;  4XRM A;  2X51 A;  3CD6 I;  2DQL A;  3ZQ7 A;  2Z99 A;  3DF8 A;  5LLQ A;  5CKT A;  2LOO A;  3MZH A;  1UST A;  5LEJ A;  4I6Z A;  4M3D A;  2FML A;  1TQP A;  2KZV A;  3WGI A;  4AVZ A;  2FXA A;  3CC7 I;  1OPC A;  1PUE E;  1X1P A;  2HWV A;  1VZ0 A;  4A3D J;  1SFO J;  1GDT A;  2BZT A;  4M71 A;  1OKR A;  1NG6 A;  2OCE A;  2XGE A;  1MBG A;  2V1N A;  2FRH A;  3RTR A;  4HST A;  1T8I A;  4A5M A;  1QVT A;  2DLL A;  3GF2 A;  4HW0 A;  2DOE A;  3TOA A;  2L4M A;  2UXX A;  2CUE A;  5GTH C;  3MEX A;  4M3E A;  4MGR A;  4EAT A;  2R7T A;  4IZZ A;  3OIP A;  3OYH A;  3DU5 A;  1V54 H;  1V3F A;  1FTZ A;  2QGU A;  1HBX G;  3WTY C;  3SZT A;  2A6E F;  4MQ9 F;  4CUG A;  5JVG F;  2JA8 J;  4IL6 C;  3PUB A;  4PZJ A;  4XN0 A;  1RZ4 A;  4DOZ A;  5L3D A;  2RDP A;  1AKH A;  1ZGW A;  2QQ9 A;  4OWR B;  4EMS A;  4IHW A;  2BBY A;  1FSE A;  2IA2 A;  4UVA A;  5FLX Z;  1LNW A;  4OAY A;  4AWX B;  1F36 A;  3ONQ A;  2VC1 A;  3BR5 A;  4ZDL A;  2CMP A;  1HKS A;  3IP4 B;  1BI2 A;  4N4O B;  4LLL A;  4HV5 A;  1DPR A;  4UB8 C;  4RB0 A;  4E6K G;  2ZJ2 A;  1PYV A;  3CUQ A;  2R4G A;  3VYR B;  5GAH J;  2DBB A;  1R7J A;  5F1J A;  2GA1 A;  2K27 A;  3JRD A;  2BY2 A;  1FWZ A;  1U3E M;  4XLC A;  3JRG A;  2CYY A;  4PJ0 C;  1SFU A;  2L54 A;  3OYM A;  5KAF C;  4KT6 A;  4IVN A;  3DWL E;  5B1B H;  3Q5F A;  3E0J B;  3F6V A;  3RKY A;  2JRT A;  4R1H A;  4OU0 A;  4F92 B;  5HVQ C;  4G7Z F;  2QQA A;  2XIG A;  3W6V A;  1FY7 A;  1I6X A;  3E5U A;  1BR1 A;  3ISP A;  2H94 A;  2ZME C;  3FM3 A;  4BXX J;  3RQ4 A;  1RPW A;  2DOF A;  1CF7 A;  3L00 A;  1B59 A;  4OMZ A;  3KYC B;  2ID6 A;  1PUF B;  3KP7 A;  2P0W A;  5DCF A;  1NG7 A;  1GLN A;  4MO7 A;  4PJJ A;  2QWW A;  3FX3 A;  1OJL A;  3RCO A;  4M73 A;  3S1Q J;  3BPV A;  1R1V A;  2AQE A;  3MKL A;  3D5R C;  3K6G A;  1HC8 A;  5D5X B;  5HLG A;  3H3V K;  3RDI A;  1TTY A;  1E2X A;  2QVO A;  1SFE A;  4NB5 A;  3SXY A;  2ISY A;  5LGN A;  5BOX A;  4I09 A;  1RR8 C;  2NXN B;  2PFB A;  1QO0 D;  4IJA A;  1NTC A;  2LG4 A;  3J80 K;  1B72 B;  5EZH A;  4B44 A;  2WAF A;  1DP3 A;  4RAG A;  3IWZ A;  3IHU A;  2JUG A;  1LDD A;  1U5T A;  5IP6 A;  4S0H B;  3EQL F;  2KRH A;  2MH9 A;  2A68 F;  2DA2 A;  2P7V B;  3K9T A;  2CW7 A;  2ZXH A;  1HCR A;  5DEQ A;  2YX7 A;  2M45 A;  2JA2 A;  3I5U A;  4ABZ A;  3BG3 A;  3CLQ A;  1EH7 A;  1MMS A;  3CUQ B;  1T0F A;  2YU3 A;  4M3G A;  1QZE A;  2M4G A;  4PJM A;  1ETV A;  2WTE A;  5GPC A;  1FIP A;  3BZC A;  4E7L A;  2VOP A;  3ECH A;  3FIS A;  2KP6 A;  3HSE A;  3ABU A;  2CSO A;  3I3L A;  2GXA A;  2JSC A;  3HG9 A;  3LQR A;  1Z7L A;  3CZ6 A;  1ZQ3 P;  1I39 A;  1RIO H;  1XN7 A;  4HLX A;  4MLO A;  3B02 A;  4MHG A;  1EV7 A;  4KIG A;  4TV7 A;  5DD4 A;  2OUM A;  5HOO A;  4D9J A;  4LLG F;  2R7F A;  2W1O A;  5CYV A;  2Q0O A;  4AD9 A;  4G7O F;  2E1M B;  3K1M A;  2QYO A;  5ICG A;  4M9S A;  2M3A A;  2CUJ A;  1G3S A;  1SD5 A;  2W82 A;  3A1Y A;  3FXL A;  3GWZ A;  2VXD A;  2V26 A;  3OSG A;  2UUZ A;  4PFP A;  3ZQF A;  2OBP A;  2O5R A;  2PLY A;  3IL2 A;  4I99 C;  1Z05 A;  4RGX A;  1XX5 A;  3COA C;  1VND A;  5HS7 A;  3OYL A;  1X19 A;  1R22 A;  3ULQ B;  3JRF A;  3FBN B;  2IS4 A;  4UUT A;  2MW8 A;  3BR0 A;  3LAP A;  2LRE A;  1T56 A;  2XAG A;  3HHH A;  4KYW A;  5E8G A;  5J40 A;  5M3M J;  4ESJ A;  2VKD A;  3HOU J;  3T1B A;  2BEO A;  2K9Q A;  2ZKZ A;  1YJN I;  2OU2 A;  2CV1 A;  1ETY A;  3C3W A;  2XF6 A;  5H6R A;  4KNY A;  5TJJ A;  4NBQ A;  2LFB A;  3DBL B;  1G4D A;  4L0Y B;  1D8K A;  3BC8 A;  3WHC A;  2JA6 J;  4IRH A;  3V7C A;  1M1E B;  5JVT A;  2STT A;  2JVG A;  2O03 A;  4WXC A;  3LL7 A;  4U88 A;  5E3O A;  1A04 A;  1IO2 A;  1JJ6 C;  3WU0 A;  2M0C A;  2HYF A;  1QBJ A;  3BP8 A;  4LB6 B;  3KZY A;  3OS0 A;  4QPQ A;  1YG2 A;  2EV0 A;  2W57 A;  4ZTJ A;  3VYU B;  5J4V A;  5EYR A;  3U1K A;  3GTJ J;  1Z1D A;  5M5W J;  4NDL A;  1TQM A;  5IYC J;  3KIO A;  3E6C C;  1B8I A;  4GDF A;  1EH8 A;  2E36 A;  4G12 A;  2JUC A;  4XQF A;  2XRO A;  5FKM A;  1T6S A;  4OIQ F;  4O6J A;  2ZFW A;  4G8X A;  1OMI A;  3ZMS A;  3GME A;  3KCC A;  2E5Z A;  2L7Z A;  1QVU A;  2E19 A;  2ELJ A;  4RLQ A;  2EV5 A;  2XV4 S;  1MJA A;  1HDD C;  3S3O A;  2PJP A;  2L9V A;  1S7O A;  2F6C A;  3GZ5 A;  2KDZ A;  1T2K A;  3FKI J;  2DDB A;  1HQC A;  1ZGA A;  1RNL A;  3LSI A;  3MAJ A;  1FMW A;  3NAU A;  2LKX A;  4QIW N;  1H9T A;  5IT9 K;  3KEQ A;  3WTU C;  3F22 A;  1YFH A;  3P7N A;  4OMY A;  3LOC A;  4C3I J;  5HLI A;  3P9K A;  1JI8 A;  1KQ0 A;  1BBY A;  2X6X A;  2LDU A;  3CC2 I;  2NS8 A;  2E60 A;  3H0G J;  3VEP A;  1ZG1 A;  1SVM A;  1IGN A;  1X3W B;  3F0C A;  2LNB A;  2NVT J;  5H2F C;  2Z33 A;  3FBI B;  3C2G A;  3RPU A;  3ZQH A;  1AOY A;  3MKZ A;  2D45 A;  3BZK A;  4AUX A;  4MQV A;  5A2Q K;  2X6W A;  2EA2 A;  4M74 A;  1YIJ I;  3G1L A;  3RZD J;  2NNY A;  3H36 A;  1HXD A;  2RGV A;  3DEU A;  3F8N A;  3O8G A;  3MFK A;  2KIF A;  2BXZ A;  1UCR A;  1ZHF A;  3PQK A;  3HGY A;  3I64 A;  2TRT A;  1WWX A;  1ZN2 A;  3JRC A;  4L5E A;  2GIV A;  2NOJ B;  3FXQ A;  1O7F A;  2HZD A;  2VI6 A;  3DBH B;  3FMR A;  3HOX J;  1XMX A;  3HRS A;  2CU7 A;  2JN6 A;  2M34 A;  1G3W A;  2YU9 J;  2RVC A;  2RV8 A;  1X2M A;  1A31 A;  2O8K A;  2AS5 F;  3R61 A;  3CCY A;  3MQ0 A;  5JR3 A;  3FF5 A;  3NRV A;  4A3M J;  1ULY A;  3G1M A;  4N0B A;  3IAM 2;  1K4T A;  4GXO A;  3ASN H;  4XLF A;  2XSJ C;  3TED A;  3GFJ A;  2R7D A;  4I0B A;  5IOY A;  5H6Q A;  2WB1 N;  3IKV A;  1JT6 A;  1GXP A;  2XKO A;  2DFF A;  4WK8 F;  1XMA A;  2X1C A;  2QKM B;  4HNV A;  1OYI A;  2EB7 A;  3GZN B;  3O8H A;  3TKY A;  3F8B A;  4IHY A;  3QPH A;  4BNC A;  3ZCO A;  2R93 J;  1W7P A;  4A3C J;  4ZYH A;  5BNG A;  2K3P A;  1K79 A;  4L5J A;  1I3A A;  1Z7U A;  2Y0M A;  3MWM A;  5FKK A;  1UMQ A;  2IAI A;  2IGK A;  2H27 A;  2CV0 A;  1U9N A;  3CDI A;  1OR7 C;  2HTS A;  3SEZ A;  3G2B A;  2E1M C;  2KL4 A;  2Y31 A;  3QAH A;  3K69 A;  2DMT A;  2Z5U A;  4XOR A;  2VQC A;  1W5C C;  2FEZ A;  3KLO A;  3G71 I;  2V1X A;  4HYE A;  4L18 B;  5L3G A;  2DJI A;  4GO1 A;  2K40 A;  4DYQ A;  2VJJ A;  2NVY J;  2MA3 A;  3GUD A;  2BY0 A;  2DA6 A;  4FX4 A;  2ZJR F;  1F1Z A;  2CFO A;  1IDZ A;  3QYB A;  4HOB A;  5BMZ A;  1TWC J;  1KGS A;  3ZMU A;  1IN8 A;  3L09 A;  2DMQ A;  2ME6 A;  3S2H J;  3DBR B;  4HBL A;  2YSR A;  5FGM A;  4OIN F;  5FD6 A;  1MJ9 A;  1H0M A;  3BQZ A;  4IHS A;  1QZZ A;  4YRV A;  4E7H A;  5FLM J;  3SYT A;  3TMO A;  4A6D A;  4HDU A;  1VQN I;  3GEZ A;  2X0L A;  4ENK A;  5K5O A;  1YHQ I;  2XAU A;  2ZXW H;  3WGH A;  2ECB A;  1VQL I;  1LB2 A;  3DKY A;  5TGT A;  2MBF A;  3FMS A;  1QPM A;  3A4C A;  4B1R A;  1FOW A;  3M1C A;  3T5X A;  3TOB A;  1FC3 A;  5LGU A;  4JOM A;  3WU1 B;  3IKT A;  5GAD J;  4BYY A;  3CME I;  4HX4 A;  2UWM A;  3T8R A;  1FEX A;  2NVX J;  4X6A J;  1TQI A;  1FYL A;  3L9F A;  1EF4 A;  3KX2 A;  2YX4 A;  2WV0 A;  2CQN A;  3OYF A;  2ECC A;  4YIR X;  2F5C A;  2QSG X;  3LSK A;  2ZNY A;  2ZME B;  3LSG A;  4UNO A;  2DOA A;  2QBY A;  1I5Z A;  1XDS A;  5HDK A;  3KEO A;  1VQK I;  2P7C B;  3I0T A;  1TW3 A;  2K5C A;  1FNN A;  2A5W A;  2MG4 A;  1JXS A;  1OR7 A;  1ZKG A;  1T38 A;  4A3L J;  4YFX F;  4RAZ A;  2KIM A;  2M8E A;  3AAF A;  4GFB A;  1WCM J;  1YLF A;  2HVS A;  3L2C A;  4NC8 A;  2ZC2 A;  3L2Q A;  1G3T A;  4AYB A;  2IGO A;  2QEX I;  4CCN A;  1B1B A;  3H5A A;  1YRN B;  1PJR A;  2XB0 X;  2XGC A;  2WAQ N;  2IS1 A;  1V5E A;  3TO6 A;  5DUK A;  1IUF A;  1NHA A;  3S2D J;  2PEX A;  4G94 A;  4A5N A;  5LD2 C;  3BPX A;  5BPD A;  2QSH X;  2HFH A;  2FBH A;  3OYG A;  4PCQ A;  1HW1 A;  1HLV A;  4U0V A;  3TDU C;  1KU7 A;  3PL8 A;  3OL3 A;  5EG0 B;  3OS1 A;  2PQ8 A;  3IAS 2;  5FLV A;  4C2U A;  1YX3 A;  1DP7 P;  2LF7 A;  2DDA A;  4XOP A;  2W84 A;  2XHK A;  2XKP A;  4BQQ A;  1ZLJ A;  4HG2 A;  3HOW J;  2W85 A;  1YOV B;  4U7B A;  2Y30 A;  4ZDP A;  3HPG A;  3CP8 A;  2M8G X;  2FBK A;  4R8H A;  4LG3 A;  3WU2 C;  2WA0 A;  3DP7 A;  1LUJ B;  2LH9 A;  1R6R A;  1T98 A;  4P9U A;  2G7H A;  4LIV A;  2Q8K A;  3PSF A;  1R4M B;  4BHC A;  5D5U B;  3HJE A;  3DU6 A;  4E7S A;  1MMN A;  2GXB A;  2COB A;  4EGY A;  1ITY A;  4H4K C;  2XPV A;  1UG0 A;  5FRO A;  1U2W A;  1ZTR A;  2B0L A;  2V7F A;  4D7M A;  3J80 Z;  2XAJ A;  3AG2 H;  2HDC A;  2D1H A;  1I1G A;  2VPR A;  1FBQ A;  1BJA A;  4DGW B;  2HQN A;  4M6Y A;  2WWY A;  1IUY A;  2WAQ A;  2VBZ A;  5CPR B;  1SAX A;  4AU7 A;  1W7P D;  2VJ4 A;  4BXU A;  2QBY B;  5C4J J;  2HNH A;  3GXO A;  1MDM A;  2FQ4 A;  2FNA A;  3PNY A;  1K7A A;  3B6C A;  2DQR A;  3NWS A;  3BRO A;  5J3L A;  2L0K A;  2O3F A;  1WJ5 A;  5E8I A;  2DMP A;  5FRM A;  5EZG A;  5DTD A;  4IHV A;  2XAQ A;  1P7I A;  3AG3 H;  3FXO A;  1U8B A;  1HA8 A;  3NQO A;  4NNJ A;  2TDX A;  3GFL A;  3KZI C;  1SAN A;  2DK8 A;  3FXK A;  4FTH A;  4LJZ F;  4XKC A;  1N25 A;  2HXO A;  3M4O J;  5FKN A;  1K6O A;  1T33 A;  4G7H F;  1CGP A;  1FPQ A;  2LRD A;  5ICF A;  1VF9 A;  3BCA A;  4JBA A;  1JKO C;  2FNP A;  1MBH A;  1RRJ A;  1BI3 A;  3KP2 A;  3TP0 A;  2ZO4 A;  5F1R A;  1WI9 A;  2KKO A;  3LSM A;  5D5W B;  1YIT I;  2OTJ I;  2HOE A;  3FHN A;  4KIS A;  1VQM I;  1LJ9 A;  3T8T A;  1XD7 A;  3GZ6 A;  1YI2 I;  1FTT A;  1JUP A;  1UZC A;  1Z21 A;  5FO5 A;  2W7N A;  4F7Z A;  2XGX A;  4A0X A;  4A2U A;  1GT0 C;  3RPU D;  4CCK A;  2RN7 A;  1D5V A;  1MMA A;  5LGT A;  1ETW A;  5CVR A;  3L2U A;  3E1S A;  1X58 A;  3HBL A;  3W2W A;  1SD4 A;  3B6A A;  1IW7 F;  2BW3 A;  4IX7 A;  1ETX A;  1Z77 A;  1OIS A;  2NVQ J;  1ZAO A;  2XPU A;  2L3D A;  2NNN A;  3ZN0 A;  5K7F A;  1HSJ A;  2A6T A;  1GV2 A;  4BE0 A;  3OOP A;  3QYF A;  1XGN A;  3DLA A;  1IV8 A;  2XSD C;  2HQ5 A;  2ZB9 A;  4Y3O A;  2ZXJ A;  4LB5 A;  3BJ6 A;  3EYI A;  3BCB A;  2JTV A;  2G7U A;  4UY8 I;  3HSR A;  2H8R A;  3HDD A;  4BBR J;  1R1U A;  1W7P B;  2DYR H;  3WG9 A;  5B5E C;  1IN7 A;  4XRS A;  2KIS A;  4PDK A;  2E2H J;  2HVQ A;  2MD5 A;  2GQQ A;  1SEU A;  2KDO A;  3HKZ A;  4XM3 A;  4I7H A;  2V79 A;  3HKZ N;  4JP0 A;  4B3A A;  5K7H A;  4AIJ A;  3AG1 H;  1VFC A;  2VON A;  2LTP A;  1T08 B;  3OSF A;  1IRG A;  1G59 A;  2CQQ A;  2HPI A;  1YW8 A;  3DFG A;  5KVR A;  4RDU A;  2R0Q C;  2Y75 A;  4WXH A;  3JAM Z;  1KQ9 A;  5ILS A;  3F3X A;  1ZRF A;  2F4M B;  3J7A O;  4UVB A;  4A6E A;  1SFX A;  3OIQ A;  2EFW A;  2JQ7 A;  3MVP A;  1SVO A;  1BC8 C;  1QPI A;  2HZT A;  3V8J A;  2MFZ A;  2XRL A;  3D0S A;  4PGG A;  1J09 A;  2BXY A;  4EJW A;  2HQR A;  3KP4 A;  3CMY A;  4XLP F;  3A01 A;  2FBI A;  1Y0N A;  3L7W A;  2OQR A;  3LWF A;  2LR8 A;  1J75 A;  3WTT C;  3TO7 A;  3CUQ C;  1W0T A;  1R71 A;  5CVI A;  5IPA A;  2L9N A;  4Q5S F;  3RZO J;  1TT0 A;  2VN2 A;  3ESW B;  4IF4 A;  2ME0 A;  4H0E A;  2QF7 A;  4RGS A;  5BPI A;  1R5G A;  3OYE A;  2W24 A;  2F2E A;  5IP7 J;  4BJ5 C;  4BBS J;  4U0W A;  3HTS B;  2Y9Y A;  1VQ6 I;  4Y7N J;  1TW2 A;  2I8D A;  3HSF A;  3J81 K;  2KPM A;  4U87 A;  3ZP5 A;  1FOK A;  4FHT A;  3BJO A;  2B9S A;  3GFM A;  1WHU A;  2LBF B;  2ELK A;  4UVC A;  1W5S A;  3E6M A;  3ABK H;  4I76 A;  4UHT A;  3CCQ I;  2DFE A;  4J19 A;  1S6L A;  5IYB J;  4BAC A;  3E97 A;  1Y8Q B;  4A12 A;  4EM2 A;  4IOC F;  4B3X A;  2VAS A;  5FD5 A;  2Y0S A;  5LRS A;  1D0Y A;  1YS7 A;  3A0B C;  4CIC A;  4F91 B;  5D8K B;  3KPH A;  5DDG A;  2K9L A;  3I59 B;  1TL8 A;  3IRQ A;  3DEW A;  3GO5 A;  4PFO A;  2R7U A;  4II2 A;  3G1O A;  4BQA A;  2FD5 A;  4E70 A;  1H8A C;  4I01 A;  3JAM K;  4ZZL A;  4BL0 B;  5GAG J;  3SJM A;  4BDY A;  2DA5 A;  3MMY B;  4BY1 J;  3FHZ A;  2HEO A;  3RI4 A;  2A3S A;  4UUV A;  4IXA A;  2ZNZ A;  1WGX A;  2CQX A;  1WKM A;  4BQN A;  1V55 H;  1B9N A;  1JHF A;  2DFI A;  1ZRE A;  4IRG A;  2BVL A;  1B8I B;  2DN0 A;  1TNT A;  4Z2Y A;  4KA4 A;  3EUH C;  4DBR A;  3BR2 A;  2HKO A;  2F5E A;  3MKY B;  3F8F A;  3VWB A;  4RA2 A;  1Z91 A;  1R5H A;  1FYK A;  3CJN A;  1IXC A;  3K70 C;  3EUK L;  4JX4 A;  3WTV C;  3HOZ J;  3Q3S A;  1U8R A;  3IV5 A;  3V7S A;  1HST A;  3IWF A;  2IXS A;  2DA7 A;  1T95 A;  2KJC A;  2D5V A;  3SQN A;  1MIJ A;  1WJD A;  2WY8 Q;  5IP9 J;  2LY1 A;  1KU3 A;  4LIU A;  1F4K A;  3E7L A;  2EV6 A;  3FXU A;  2MSY A;  2Q2E A;  3E5Q A;  1NH3 A;  2OA4 A;  4C9Y A;  4N9I A;  1XPX A;  1VI0 A;  3M7G A;  3AL0 B;  3QRF F;  1IC8 A;  3RIR A;  4NC7 A;  4BY7 J;  1P4W A;  5JHU A;  1OLT A;  2VB6 A;  3DTE A;  2O8X A;  3O2P E;  4C3J J;  1FOY A;  1FT9 A;  1JGG A;  2FMY A;  3OR1 C;  4KMF A;  2GM4 A;  3VOE A;  4ZYG A;  2GIZ A;  4E7K A;  4BXF A;  4DNC A;  4XLH A;  2OAZ A;  5BS6 A;  3CES A;  5HLT A;  5HS8 A;  2EZK A;  5E1X A;  1O4X A;  1UAA A;  2GA2 A;  3KP5 A;  4WF2 A;  5EF6 A;  5DM6 F;  3G6E I;  2R7W A;  4HEA 2;  1BI1 A;  4EJU A;  4B47 A;  1DU0 A;  2L2O A;  1RR7 A;  1BOA A;  1ZEL A;  1XGO A;  2CO5 A;  2NS7 A;  2IVM A;  2H8W A;  1LE8 A;  1E0E A;  2DT5 A;  2L7F P;  1BM9 A;  3K4L A;  4UV8 A;  4A3J J;  1A35 A;  3QPS A;  2HI3 A;  4A3F J;  4HV6 A;  2VBX A;  4FQG A;  1F5T A;  1OCO H;  5DCM A;  4S04 A;  2EIK H;  2VJ5 A;  2KT0 A;  1W36 C;  2BE5 F;  3E6D A;  2XAH A;  1IJW C;  3ZMV A;  1NK3 P;  4Q47 A;  1J2X A;  3RQI A;  3SFZ A;  5K1Y A;  3K10 A;  2MC4 A;  2HR3 A;  1Y39 A;  4KFC A;  2DA3 A;  5CJ9 A;  2CV2 A;  4BAY A;  1WI3 A;  1BA5 A;  1R5I D;  2IT0 A;  3I54 A;  1PDN C;  3AL0 C;  1B72 A;  5A2Q Z;  1B6A A;  4YG2 F;  1GVJ A;  3CMA I;  5J8F A;  5F64 A;  1VQ4 I;  2IEK A;  3FM5 A;  1O57 A;  2G9W A;  3BTL A;  2LBF A;  1Y1W J;  4GYI A;  1ODD A;  5EGO B;  2CW8 A;  3CF5 F;  4XKB A;  4ANJ A;  3A0H C;  3BZ6 A;  2FE3 A;  3JRI A;  4L9J A;  4EJO A;  2RQQ A;  2EBI A;  3PQJ A;  2VQG A;  1WJF A;  2HS5 A;  5JFR A;  1XTA A;  5E18 F;  1R4N B;  3WE3 A;  4LGW A;  3I4M J;  2QQB A;  1D1B A;  3HIF A;  1X1C A;  2FF4 A;  1JUS A;  4CCJ A;  3Q0W A;  4ZYD A;  2A07 F;  2DXI A;  4FT8 A;  1AU7 A;  1WVR A;  3L2R A;  4KUM A;  1Z0X A;  4ASN A;  4V2G A;  2M1B A;  5FB2 A;  2YS9 A;  2E34 A;  4FE7 A;  3S93 A;  3ZXS A;  2A5Y B;  4RB3 C;  2DU9 A;  5ED4 A;  3S8P A;  3CCV I;  3FDY A;  3NWT A;  2W4S A;  3SFI A;  1FBU A;  1X4O A;  2DA1 A;  2DAO A;  2V9P A;  3RYR A;  1OFC X;  1BJZ A;  2OTL I;  2HQA A;  4IHT A;  1WPK A;  5TRD A;  4BUP A;  1MBF A;  2EFP A;  3MZY A;  2MC3 A;  2V1D A;  3PJR A;  2LY2 A;  3ABL H;  2VJI A;  5CLS A;  2K7L A;  4CCM A;  4HPQ A;  2L01 A;  1LQ1 A;  3EET A;  2J5O A;  2NAZ A;  3EUH A;  1ON2 A;  1D3Y A;  5KNL A;  5DYM A;  2RRE A;  3QOP A;  3RPQ A;  1FP1 D;  2O0Y A;  3OYK A;  1YYV A;  2XGD A;  3N97 A;  3F8C A;  1MH3 A;  4A3G J;  2XRN A;  4Y13 A;  1J0R A;  3W6J B;  4I2O A;  1X3U A;  3ML6 A;  2MAB A;  5IYD J;  2HKX A;  3U2R A;  2R5Z A;  5M5X J;  2OCC H;  1JKP C;  1XCV A;  5EGO A;  1O3S A;  4R79 A;  1X4P A;  5EDN A;  3BTI A;  1S3J A;  3GBG A;  4PUS A;  2DCE A;  3JRH A;  3KYD B;  2XDV A;  2IA0 A;  2CW0 F;  3P9C A;  1SD7 A;  5E3M A;  1IXS B;  3HXL A;  4XNF A;  2BOL A;  1YW7 A;  5F04 A;  2VPL A;  3F6O A;  1RKW A;  3WTS C;  3CDL A;  4A3I J;  4HRI A;  1RUN A;  2DMU A;  4QPO A;  4AIH A;  5E79 C;  4IPA A;  5M3F J;  2G0E A;  3GYH X;  3ELK A;  3GVA A;  4EM1 A;  4KIF A;  3MN2 A;  2P6T A;  3PUF A;  1OQY A;  3KFW X;  1MNE A;  2VXZ A;  2IW5 A;  2EZI A;  3ERE D;  3BG5 A;  1IZ1 A;  2ISZ A;  2LKP A;  3Q0U A;  2Y0S N;  1BC7 C;  4BGD A;  5EEG A;  2DJN A;  2BHZ A;  3WGG A;  1JGS A;  4RS8 A;  5C44 J;  1ZGJ A;  2LVS A;  3GTL J;  1D1C A;  3GTO J;  4A0Y A;  4B8X A;  1VQO I;  2VE8 A;  4ZJZ A;  3K4B A;  4IRI A;  5DD8 A;  3M8F A;  4CZZ A;  1I6H J;  4MNU A;  3OIO A;  1KYZ A;  3OMY A;  3PM1 A;  5FJ8 J;  3CLO A;  3E6B A;  3JTH A;  1Z6R A;  4KN7 X;  1BIB A;  2J5P A;  3A02 A;  2FOK A;  5F0C A;  4HZF A;  5J8C A;  3ZQC A;  2F5V A;  4Y15 A;  4CYC B;  4I02 A;  2WC2 A;  5LRR A;  2X1E A;  3QP6 A;  4ITV A;  1VQ8 I;  2DK5 A;  2AHQ A;  1V5F A;  3KP6 A;  2EWN A;  4P1W A;  4RAF A;  4EEF G;  4XOT A;  3RKW A;  1R9T J;  3TGN A;  2VQL A;  4OIO F;  2HYJ A;  1DU6 A;  4RLF A;  2KZG A;  2VKV A;  3CCS I;  1MBJ A;  1JE8 A;  4ZTF A;  3BG9 A;  3CCL I;  2OC6 A;  4LMY A;  5M5Y J;  4KT5 C;  3K2A A;  1TWG J;  1BOB A;  4AIK A;  1SC7 A;  4D7N A;  3IC7 A;  3PIO F;  1L3L A;  3HPH A;  1O3R A;  4L5I A;  2HYG D;  4CYD A;  3ZOB A;  4BKX A;  3BR6 A;  2ID3 A;  1ERD A;  1IRZ A;  3V8K A;  3VYS B;  3BT9 A;  2VT2 A;  2E1O A;  5AIQ A;  3M8J A;  3K1N A;  2AO9 A;  3R60 A;  2PJR A;  4A3B J;  3QU6 A;  2CUF A;  3BTJ A;  3OYB A;  3J81 Z;  3H9Q A;  3LA2 A;  2LF8 A;  1ZLK A;  4MFD A;  3BQY A;  2QZ8 A;  4CSW A;  4L0Z B;  2QQ8 A;  3EDP A;  2VE9 A;  3CCJ I;  3JW4 A;  2LLK A;  3JRB A;  3QQA A;  1ETQ A;  2PJR B;  3I58 A;  5E17 F;  2QLZ A;  2V1U A;  2X9D A;  1ONV A;  2V4J C;  3DPU A;  2ICW G;  4CZC A;  3UKG A;  4X1E A;  1D0Z A;  1ACI A;  2CGP A;  1TWF J;  1TT5 B;  4DYR A;  2M5W A;  5AON A;  3HOV J;  5LEK A;  1FLI A;  2W00 A;  4EJV A;  5ICC A;  5J1Y A;  2PMH A;  1VQP I;  2K02 A;  4FET A;  1TLH B;  2EQR A;  2P5K A;  1AA7 A;  1HW5 A;  3S2W A;  4D5C A;  4LK1 F;  3F9K A;  1XSX A;  4M72 A;  4YII A;  2IP2 A;  1SMY F;  4XN3 A;  5D6E A;  1R58 A;  4LIT A;  4IKF A;  1JUM A;  2H09 A;  1O3Q A;  2O7O A;  1S9H A;  2XUB A;  2ZME A;  2E7W A;  3C1D A;  2LC2 A;  2K9M A;  2M0M A;  1W5T A;  2ZJP F;  2X4H A;  3DPL C;  2EIM H;  2V6E A;  1RI7 A;  5J47 A;  3LMM A;  5CVV A;  2NS0 A;  3I71 A;  3V42 A;  3K4M A;  3DLL F;  4HSR A;  2KMU A;  2GLO A;  1CQT A;  1OCZ H;  4XMY A;  1S72 I;  1SVL A;  3TQN A;  1DDN A;  3PNT A;  5L3F A;  3H0D A;  1KZH A;  3C2B A;  4HDV A;  1A36 A;  3CQZ J;  1APL C;  4XK4 A;  2CRG A;  2LYC A;  4XKV A;  4G6T B;  2V9V A;  1TWH J;  3VDX A;  1VQ5 I;  5GTI C;  3QU3 A;  2WAE A;  3BR3 A;  1NK2 P;  1LKX A;  2EFO A;  4V2F A;  3WOD F;  2R7S A;  3GTQ J;  1JKQ C;  4C3H J;  3CUO A;  4P96 A;  3K4K A;  2Y2Z A;  3BG6 A;  4L9T A;  3ZRG A;  4D1Q A;  1C0W A;  3JR9 A;  1MZB A;  3S1R J;  3LAJ A;  3TL4 X;  2GOX B;  1U6G A;  3CDH A;  2A69 F;  4UUS B;  2HU9 A;  2R3S A;  4IOA F;  1LFP A;  3H5N A;  1BR2 A;  2O6G E;  2R7X A;  1HDP A;  3I53 A;  4CHU A;  4EV0 A;  1Z6T A;  2RC4 A;  3GCM A;  5D4R A;  3D1N I;  3W6K B;  1G3Y A;  3T0Y A;  2ZBK A;  4ESF A;  1XS9 A;  1OCC H;  3I4P A;  2R7R A;  1EKE A;  3TBI A;  1T39 A;  3ZGK A;  3CO6 C;  3BWG A;  1F9N A;  4LFU A;  3EUA A;  3OYA A;  2NVU B;  1RKT A;  4XRS G;  3CC4 I;  1SFK A;  2LKS A;  3RJP A;  2EPF A;  1GXQ A;  1S7A A;  3I9V 2;  2QM3 A;  3L1P A;  2ZFU A;  5B1A H;  3HHG A;  2V6C A;  4KN4 X;  5CVU A;  3DKX A;  5C3E J;  2IS6 A;  2V9K A;  4KJZ A;  1QQI A;  5CQG A;  1QZY A;  2CS3 A;  3H1C A;  3QPT A;  2Z2S B;  1XGM A;  3DTI A;  3ZQI A;  2AXT C;  2FQ3 A;  5J1U A;  4OIR F;  4RM2 A;  5D6F A;  2Y9Z A;  4LG0 A;  3X2Q H;  3JSO A;  9ANT A;  2JPC A;  3IH3 A;  3KP3 A;  4JK1 X;  2VOO A;  2XB5 A;  4A0Z A;  2EZL A;  2WY7 Q;  2KRF A;  4XR6 A;  1E17 A;  2I5U A;  4CCO A;  3GFI A;  4UB6 C;  2JRM A;  2GBY A;  2MLK A;  2IGM A;  2A61 A;  4RMN A;  3DCF A;  1X1D A;  1G2H A;  3FXR A;  2WBM A;  3QP5 A;  1BN5 A;  2YPR A;  3B73 A;  2ESH A;  1RET A;  4QWQ A;  3SHF A;  3QOD A;  3H9J A;  3GW2 A;  5K7Z A;  2X6O A;  2DYS H;  3U9G A;  1E3O C;  1ETK A;  3JCU C;  3H9G A;  1ORK A;  4WCG A;  4M3F A;  2C6Y A;  2EZH A;  2VC0 A;  2VBW A;  3FXM A;  5JLW A;  3M1E A;  4IEJ A;  2XPW A;  4ZYE A;  1WJB A;  3PFY A;  1O3T A;  3DEE A;  2PI0 A;  1YIO A;  5F27 A;  4IQ4 A;  2HDD A;  1KA8 A;  2MH2 A;  2FU4 A;  3BJA A;  3LFU A;  3J7Y J;  1YO5 C;  1K61 A;  1Y6I A;  5KAI C;  4E7Z A;  2CJJ A;  4IHX A;  1FSH A;  1H9G A;  1JJ8 C;  5L3B A;  1FZP B;  5BQT A;  3W3C A;  1X2N A;  3SZG A;  4CO8 A;  2VT3 A;  3DKW A;  2B7E A;  2LD5 A;  2E1N A;  2ZCW A;  4FX0 A;  1MMG A;  2FSW A;  3KE2 A;  2GXG A;  4U0Y A;  1A6I A;  2ZJQ F;  2VOD A;  3CTA A;  1Y8R B;  2DI3 A;  2IS2 A;  2CWE A;  4XSZ F;  3SEQ A;  4BU2 A;  3AFH A;  5D4S A;  3DPT A;  1X1B A;  1BW6 A;  4XRF A;  1YE9 A;  3KZZ A;  1RC9 A;  3MZ8 A;  3HRM A;  1W4M A;  3V8L A;  4CYC A;  1PUF A;  4A3E J;  1W0U A;  3RKQ A;  1PP7 U;  3FK7 A;  1I27 A;  1O7L A;  1P7J A;  1IF1 A;  5KHD A;  1OCR H;  4Y4R A;  1YTY A;  4KMU X;  3S17 J;  4GRI A;  2K86 A;  4B43 A;  1N78 A;  3GLX A;  2Z1D A;  2DO7 A;  3M3Y J;  2DTR A;  4KIB A;  3VOD A;  3A01 B;  3GX4 X;  2XC7 A;  2WAD A;  4YFK F;  1H89 C;  1RES A;  4ON0 A;  2A05 A;  2PX9 A;  5DUI A;  2BHY A;  3WG7 H;  3M07 A;  3G3Z A;  1X1A A;  2OZ6 A;  3ZQG A;  4LD5 A;  2QEN A;  2HPM A;  1YQA A;  2PMU A;  1N77 A;  2DW4 A;  1IRX A;  2NRA C;  1DUX C;  5HS9 A;  1WSU A;  1D5Y A;  3A2K A;  3K0L A;  2MGQ A;  4DW6 A;  1S29 A;  5AIP A;  4JYK A;  3OY9 A;  1RUO A;  4LOC A;  2WB1 A;  1XGS A;  1ZR4 A;  4O3M A;  2L7M P;  4NUB A;  4KDP A;  2HVR A;  1XB4 A;  3J7A Y;  1KU9 A;  4A93 J;  4C30 A;  1S8N A;  3CJR B;  2GOM A;  4HA8 A;  4N4N B;  3R6S A;  2DT7 B;  2CQK A;  3LSJ A;  2RAE A;  3PNV A;  4KIC A;  1XSV A;  3ZQQ A;  3SDG A;  2E5N A;  4PSX A;  3U21 A;  3LSP A;  4AVP A;  4EM0 B;  3C7J A;  3CCU I;  3OWT A;  3HM5 A;  2PMZ A;  4D0P A;  3HOS A;  3AKZ A;  2QSF X;  2XF5 A;  1ETO A;  3FWE A;  4GYG A;  3DTK A;  3U1D A;  5B66 C;  4P9F A;  4M6V A;  4XLA A;  2R5Z B;  1FP2 A;  1QU3 A;  3S14 J;  1LPQ A;  4HQM A;  4XID A;  2DA4 A;  1HW2 A;  3ABM H;  3OS2 A;  4KIT B;  2KIQ A;  3BLY A;  4QTR A;  2IA1 A;  5LHI A;  4XLN F;  3SDB A;  1WH5 A;  1ZG5 A;  2I10 A;  4JX5 A;  3CF2 A;  3R4K A;  1W36 D;  2E2J J;  5E3L A;  2ACJ A;  1FJL A;  2VKH A;  1BI0 A;  3C18 A;  4OOI A;  3V7R A;  3GTK J;  2Y69 H;  4XKW A;  1ZRD A;  1UEL B;  1JHH A;  2RQP A;  3HEF A;  1KU2 A;  1G8X A;  1G6N A;  4PGH A;  4DBQ A;  5HNF A;  3JSP A;  1V4R A;  2P6S A;  3KYL A;  5LBQ A;  5E20 A;  4XON A;  3RKX A;  4ZDO A;  2JWT A;  2R7V A;  5H20 A;  2Z3Y A;  1GHC A;  3Q9S A;  1ZYR F;  3E3V A;  4HLY A;  3H35 A;  2RNG A;  5K5R A;  2X85 A;  3K7A J;  3LQQ A;  1EJ9 A;  3VFZ A;  3CCM I;  4W97 A;  1QHG A;  2OF7 A;  2KRC A;  3ZMT A;  3HUG A;  4PSW A;  1Y1V J;  2K9N A;  1K4S A;  4U7D A;  2JZY A;  2AQF A;  3J7Z I;  1FX7 A;  2TCT A;  2GAU A;  5D5V B;  1R00 A;  5FFX A;  3FZV A;  1JT0 A;  1AWC A;  2F4O B;  2XAF A;  2P81 A;  3N4M A;  2P4W A;  3GTM J;  3TW7 A;  4ENN A;  4BEH B;  1D8J A;  4E4H A;  5JLX A;  2VKE A;  3BG7 A;  3HRU A;  1Z9C A;  2EJR A;  3F23 A;  3CO7 C;  1DPU A;  3TO9 A;  3OYC A;  4B48 A;  5E3N A;  4NQW A;  2VUM J;  3LA7 A;  4L9V A;  3ZN1 A;  5D8L B;  1OYW A;  1REP C;  2KLO A;  4BDZ A;  2E71 A;  5L3E A;  1YRN A;  4NHJ A;  2JA5 J;  3W2A A;  2EFQ A;  2P8T A;  4BHB A;  2XAS A;  3H5R A;  2DPD A;  2IGN A;  3KLN A;  2BGC A;  1MSE C;  3QYE A;  4M3B A;  1Z3X A;  2OD5 A;  2OPT A;  2DFH A;  4UV9 A;  3G4S I;  5GP9 A;  2JPB A;  1X3Z B;  1UHW A;  4MEY F;  2FJ1 A;  3UR3 C;  3JRE A;  3VSL A;  1WH7 A;  3K4C A;  3CP2 A;  3ASO H;  1UHS A;  1F43 A;  1MKM A;  1Y56 A;  3JTG A;  2GWR A;  4ZZD A;  4CXF A;  1E3P A;  4BE2 A;  4LK0 F;  1FOX A;  4QSH A;  3M9A A;  1A6Q A;  3LNQ A;  2DT6 A;  1LFU P;  2E2I J;  3LFK A;  4MIM A;  2EA4 A;  2JMW A;  3MCZ A;  4JQF A;  4HQE A;  2E1C A;  5DM7 F;  3ZMZ A;  4N9H A;  3PIP F;  2NOG A;  3HOT A;  2HDW A;  2JSP A;  1WZ2 A;  1GV5 A;  3WE2 A;  2PBI A;  1I3Q J;  3SZP A;  1VTN C;  3AG4 H;  4HNT A;  4G9Y A;  2EH3 A;  1UB9 A;  1LEA A;  4BS9 A;  4YEJ A;  4RGR A;  1D0X A;  1P4A A;  1ZR2 A;  5DCM B;  2EIN H;  4WXD A;  3OYI A;  2LP0 A;  4RM3 A;  2N8G A;  3CCR I;  1YJW I;  3FMQ A;  3ZR8 X;  2RNJ A;  4UUS A;  5B3S H;  1IN5 A;  3A03 A;  5J6X A;  2O9L A;  4MEX F;  2F4I A;  4Q4Z F;  4IO9 F;  1MBE A;  3QOE A;  1P4X A;  5EEH A;  2F5D A;  2X6Y A;  5F6F A;  1WJE A;  2DMN A;  1KQ8 A;  3FXJ A;  4HF1 A;  3FKJ A;  2Q2E B;  1P92 A;  1KON A;  3OOU A;  1N75 A;  5C4X J;  1K83 J;  2D1V A;  1WFX A;  1W1W E;  3KET A;  4A69 C;  4FIS A;  1YJ9 I;  2M30 A;  2JT1 A;  2MD0 A;  1P2F A;  3JRA A;  2VIX A;  3FIW A;  3S16 J;  3LST A;  1S5L C;  1FMV A;  3MKW B;  3I59 A;  3HTU A;  2R5Y A;  2WV1 A;  2Z16 A;  2QCO A;  2VQH A;  1R23 A;  4YIF A;  1SD6 A;  2NYX A;  1V5G A;  2HOA A;  5DS9 A;  2L02 A;  4XSX F;  5HOD A;  2A6H F;  1IG7 A;  6PAX A;  3LA3 A;  2HGC A;  3IH2 A;  4IQJ A;  5HLH A;  5GPA A;  1YS6 A;  3PSI A;  1Z67 A;  2Q1Z B;  4XL9 A;  3S3M A;  3VYT B;  2STW A;  1TC3 C;  3DQV C;  2M2E A;  2O61 A;  5FKL A;  2R7Z J;  1ZAR A;  3NAR A;  2YR2 A;  1J59 A;  2LK2 A;  2OZU A;  2PG4 A;  5HDN A;  3EPZ A;  1HOM A;  1WRJ A;  2KJB A;  2D2W A;  1KYW A;  4HX7 A;  1ON1 A;  4ZYA A;  4CH7 A;  3ECO A;  2F48 A;  4PJL A;  4XBF A;  4II3 A;  3RYP A;  1GUU A;  2ELH A;  4A3K J;  2RKH A;  3R0A A;  3R0J A;  3HC7 A;  2HTJ A;  4DQ2 A;  3F21 A;  1ZG3 A;  1SAU A;  5HDG A;  4M9X A;  5HNH A;  4CGZ A;  1XCB A; 
#chains in the Genus database with same CATH homology
 3P9I A;  2H6C A;  4EGZ A;  4UXN A;  1IN4 A;  2GZW A;  1HKQ A;  1J7K A;  4RB1 A;  1HKT A;  2BV6 A;  3PFI A;  3BOQ A;  3O3K A;  4MTD A;  4L9N A;  2AXL A;  4WWC A;  4LG0 B;  1LDK B;  3OV8 A;  4WX9 A;  2VBY A;  1U5T C;  1I1S A;  2EK5 A;  4I0A A;  5L3C A;  4YFN F;  1FBS A;  3D5L A;  3WTW C;  1K78 A;  1ZH5 A;  3ZPL A;  3H3Z A;  4HF0 A;  4ZH4 F;  4Q48 A;  3EYY A;  1LVA A;  4S05 A;  3VB2 A;  2CG4 A;  4G6D A;  3WTX C;  2IJL A;  3ABT A;  5FLX K;  2KIU A;  3HYI A;  2IPQ X;  4M9Z A;  2EFN A;  4ESB A;  5ERI A;  2P5V A;  4O5V A;  2W25 A;  4BH9 A;  4ENM A;  4CDG A;  3DXJ F;  3Q9V A;  2Z9O A;  4EVI A;  3IRR A;  2F5F A;  1XMK A;  3DV8 A;  4HX8 A;  4P55 A;  1SMT A;  5LHH A;  2OQG A;  1U78 A;  1MGT A;  1XSD A;  3K1P A;  3V4G A;  4P5O A;  2Y48 A;  2K4B A;  2MLG A;  2CFX A;  2P5L C;  3E5X A;  2BYV E;  4HF2 A;  2COM A;  2L4A A;  4RAY A;  4RB2 C;  4I98 B;  5FFZ A;  4GGG A;  2ADU A;  5ILU A;  4G6Q A;  1MDM B;  1QGP A;  4M6X A;  1IRF A;  2IRF G;  3WTZ A;  5CVJ A;  3REO A;  1XDU A;  4B09 A;  4EQQ A;  4RGU A;  2XVC A;  5DV5 A;  4ENJ A;  4GCV A;  4HAM A;  1QNT A;  5LHG A;  1TBX A;  3F8M A;  1ZRC A;  2K4J A;  2DPU A;  1LDJ A;  1TNS A;  2H6B A;  4MTE A;  2QUF A;  3H92 A;  2PN6 A;  1J9I A;  1IAW A;  1Q1H A;  4Y17 A;  5E1W A;  5IT3 A;  1UHM A;  1R36 A;  1MD0 A;  3ROU A;  4LLN A;  4OIP F;  5K5Q A;  3BY6 A;  3HRT A;  1EH6 A;  1CF7 B;  3M8E A;  5IT9 Z;  1IN6 A;  2E7X A;  1L0O C;  1K78 B;  1Y0U A;  1FYM A;  5KK1 A;  2M87 A;  1LEB A;  5ILV A;  4QLC U;  3NEU A;  1WQ2 A;  2UZK A;  3F72 A;  4ETS A;  4BHP A;  1MJB A;  4EJT A;  2UXN A;  1B9M A;  3G73 A;  3H3U A;  1UFM A;  1R1T A;  1OYY A;  1STZ A;  1B4A A;  4K2E A;  1PP8 F;  2FA5 A;  1U5T B;  3ZMD A;  3BDD A;  1YW9 A;  1P6R A;  1J5Y A;  1IXR C;  2ETH A;  2LSO A;  1USS A;  3TDZ C;  5ICE A;  2ESN A;  3O6B B;  5E1Z B;  3K2Z A;  1BIA A;  5JI6 A;  2DQL A;  3ZQ7 A;  2Z99 A;  3DF8 A;  5LLQ A;  3MZH A;  1UST A;  5LEJ A;  3WGI A;  2FML A;  1TQP A;  2FXA A;  1OPC A;  1PUE E;  2HWV A;  4M71 A;  1OKR A;  2FRH A;  3RTR A;  4A5M A;  2DLL A;  3GF2 A;  4HW0 A;  3TOA A;  2L4M A;  2UXX A;  3MEX A;  4MGR A;  1V3F A;  1HBX G;  3WTY C;  3SZT A;  2A6E F;  4MQ9 F;  4PZJ A;  1RZ4 A;  5L3D A;  2RDP A;  2QQ9 A;  4EMS A;  2BBY A;  1FSE A;  2IA2 A;  4UVA A;  5FLX Z;  1LNW A;  4AWX B;  2VC1 A;  1HKS A;  1BI2 A;  4LLL A;  4HV5 A;  1DPR A;  4RB0 A;  2ZJ2 A;  3CUQ A;  2DBB A;  1R7J A;  2GA1 A;  2K27 A;  1FWZ A;  1U3E M;  2CYY A;  1SFU A;  2L54 A;  4IVN A;  3Q5F A;  3F6V A;  3RKY A;  2JRT A;  4R1H A;  4OU0 A;  5HVQ C;  4G7Z F;  2QQA A;  2XIG A;  1FY7 A;  1I6X A;  3E5U A;  3ISP A;  2H94 A;  3FM3 A;  1CF7 A;  3L00 A;  1B59 A;  4OMZ A;  3KP7 A;  5DCF A;  2QWW A;  3FX3 A;  4M73 A;  3BPV A;  1R1V A;  5D5X B;  5HLG A;  3RDI A;  1TTY A;  1E2X A;  2QVO A;  1SFE A;  4NB5 A;  3SXY A;  2ISY A;  5LGN A;  5BOX A;  4I09 A;  2PFB A;  1QO0 D;  4IJA A;  3J80 K;  3IWZ A;  3IHU A;  1LDD A;  1U5T A;  3EQL F;  2MH9 A;  2A68 F;  2P7V B;  3K9T A;  5DEQ A;  2M45 A;  2YX7 A;  3I5U A;  1EH7 A;  3CUQ B;  1T0F A;  2YU3 A;  2WTE A;  2VOP A;  3ECH A;  3HSE A;  3ABU A;  2CSO A;  2JSC A;  3LQR A;  1RIO H;  1XN7 A;  4HLX A;  3B02 A;  4MHG A;  1EV7 A;  4KIG A;  4TV7 A;  5DD4 A;  5HOO A;  4LLG F;  2R7F A;  5CYV A;  2Q0O A;  4AD9 A;  4G7O F;  3K1M A;  2QYO A;  5ICG A;  4M9S A;  1G3S A;  1SD5 A;  3GWZ A;  2OBP A;  2PLY A;  3IL2 A;  1Z05 A;  4RGX A;  3COA C;  5HS7 A;  1R22 A;  3ULQ B;  3LAP A;  3HHH A;  2XAG A;  4KYW A;  5E8G A;  4ESJ A;  3T1B A;  2BEO A;  2ZKZ A;  2OU2 A;  3C3W A;  5H6R A;  4KNY A;  5TJJ A;  1G4D A;  4L0Y B;  1D8K A;  4IRH A;  3V7C A;  5JVT A;  2STT A;  4WXC A;  2O03 A;  4U88 A;  1A04 A;  3WU0 A;  2HYF A;  1QBJ A;  3BP8 A;  4LB6 B;  3KZY A;  1YG2 A;  2EV0 A;  2W57 A;  1Z1D A;  1TQM A;  3E6C C;  1EH8 A;  2XRO A;  1T6S A;  4OIQ F;  4O6J A;  2ZFW A;  4G8X A;  1OMI A;  3ZMS A;  3KCC A;  2EV5 A;  2XV4 S;  1MJA A;  2PJP A;  1S7O A;  3GZ5 A;  1T2K A;  1HQC A;  1ZGA A;  1RNL A;  3MAJ A;  1H9T A;  5IT9 K;  3KEQ A;  3WTU C;  3F22 A;  1YFH A;  3P7N A;  4OMY A;  5HLI A;  3P9K A;  1KQ0 A;  1BBY A;  2LDU A;  3VEP A;  1ZG1 A;  2LNB A;  2Z33 A;  3RPU A;  1AOY A;  2D45 A;  4MQV A;  5A2Q K;  2EA2 A;  4M74 A;  2NNY A;  1HXD A;  3DEU A;  2RGV A;  3MFK A;  3F8N A;  2KIF A;  1UCR A;  1ZHF A;  3PQK A;  3I64 A;  1WWX A;  1ZN2 A;  2GIV A;  3FXQ A;  1O7F A;  3FMR A;  3HRS A;  1G3W A;  2RVC A;  2RV8 A;  2AS5 F;  3R61 A;  3MQ0 A;  5JR3 A;  3FF5 A;  3NRV A;  1ULY A;  4N0B A;  4GXO A;  3GFJ A;  2R7D A;  4I0B A;  5H6Q A;  3IKV A;  1GXP A;  2XKO A;  4WK8 F;  1XMA A;  1OYI A;  2EB7 A;  3TKY A;  3F8B A;  3QPH A;  4BNC A;  1W7P A;  4ZYH A;  1K79 A;  4L5J A;  2Y0M A;  1Z7U A;  3MWM A;  2H27 A;  2HTS A;  3QAH A;  3K69 A;  2Z5U A;  2FEZ A;  3KLO A;  2V1X A;  4HYE A;  4L18 B;  5L3G A;  4GO1 A;  2MA3 A;  3GUD A;  4FX4 A;  1F1Z A;  4HOB A;  5BMZ A;  1KGS A;  3ZMU A;  1IN8 A;  3L09 A;  5FGM A;  4HBL A;  2YSR A;  4OIN F;  1H0M A;  5FD6 A;  1MJ9 A;  4IHS A;  1QZZ A;  4A6D A;  4HDU A;  3GEZ A;  2X0L A;  4ENK A;  5K5O A;  3WGH A;  1LB2 A;  2MBF A;  3FMS A;  1QPM A;  3T5X A;  3TOB A;  1FC3 A;  5LGU A;  3WU1 B;  3IKT A;  4BYY A;  2UWM A;  4HX4 A;  3T8R A;  1TQI A;  1FYL A;  3L9F A;  2YX4 A;  2WV0 A;  2F5C A;  2ZNY A;  2ZME B;  4UNO A;  2QBY A;  1I5Z A;  1XDS A;  5HDK A;  3KEO A;  2P7C B;  3I0T A;  1TW3 A;  1FNN A;  1JXS A;  1OR7 A;  1T38 A;  4YFX F;  4RAZ A;  2KIM A;  2M8E A;  3AAF A;  1YLF A;  3L2C A;  1G3T A;  1B1B A;  3TO6 A;  5DUK A;  1NHA A;  2PEX A;  4G94 A;  4A5N A;  3BPX A;  5BPD A;  2HFH A;  2FBH A;  4PCQ A;  1HW1 A;  4U0V A;  3TDU C;  1KU7 A;  2PQ8 A;  1DP7 P;  2LF7 A;  2W84 A;  2XHK A;  2XKP A;  1ZLJ A;  2W85 A;  4U7B A;  2FBK A;  4R8H A;  3DP7 A;  1T98 A;  4P9U A;  2G7H A;  2Q8K A;  4BHC A;  5D5U B;  2GXB A;  4EGY A;  1U2W A;  2B0L A;  3J80 Z;  2XAJ A;  2HDC A;  2D1H A;  1I1G A;  1FBQ A;  1BJA A;  2HQN A;  4M6Y A;  2WWY A;  1IUY A;  2VBZ A;  1SAX A;  1W7P D;  4BXU A;  2QBY B;  1MDM A;  3GXO A;  2FNA A;  1K7A A;  2DQR A;  3BRO A;  2O3F A;  5E8I A;  2XAQ A;  3NQO A;  2TDX A;  3GFL A;  2DK8 A;  4LJZ F;  1K6O A;  4G7H F;  1CGP A;  1FPQ A;  5ICF A;  4JBA A;  2FNP A;  1BI3 A;  3KP2 A;  5F1R A;  2ZO4 A;  1WI9 A;  2KKO A;  5D5W B;  2HOE A;  1LJ9 A;  3T8T A;  1XD7 A;  3GZ6 A;  5FO5 A;  4F7Z A;  2XGX A;  4A0X A;  4A2U A;  2RN7 A;  1D5V A;  5LGT A;  5CVR A;  1SD4 A;  1IW7 F;  1ZAO A;  2NNN A;  2L3D A;  3ZN0 A;  1HSJ A;  3OOP A;  1XGN A;  2ZXJ A;  4LB5 A;  3BJ6 A;  3EYI A;  2JTV A;  2G7U A;  3HSR A;  1R1U A;  1W7P B;  3WG9 A;  1IN7 A;  4PDK A;  2MD5 A;  2GQQ A;  4I7H A;  2V79 A;  4AIJ A;  2VON A;  1IRG A;  5KVR A;  1YW8 A;  3DFG A;  2Y75 A;  4WXH A;  3JAM Z;  1KQ9 A;  5ILS A;  3F3X A;  1ZRF A;  3J7A O;  4UVB A;  4A6E A;  1SFX A;  2EFW A;  1BC8 C;  2HZT A;  3V8J A;  3D0S A;  4PGG A;  4EJW A;  2HQR A;  3KP4 A;  4XLP F;  2FBI A;  3L7W A;  2OQR A;  3LWF A;  1J75 A;  3WTT C;  3TO7 A;  3CUQ C;  5CVI A;  4Q5S F;  2VN2 A;  4IF4 A;  4H0E A;  4RGS A;  5BPI A;  1R5G A;  2W24 A;  2F2E A;  4U0W A;  3HTS B;  3J81 K;  1TW2 A;  3HSF A;  3ZP5 A;  1FOK A;  4FHT A;  3BJO A;  3GFM A;  4UVC A;  1W5S A;  3E6M A;  4UHT A;  1S6L A;  3E97 A;  4A12 A;  4EM2 A;  5FD5 A;  5LRS A;  1YS7 A;  4CIC A;  5D8K B;  5DDG A;  3I59 B;  3IRQ A;  3GO5 A;  4BQA A;  4E70 A;  4I01 A;  3JAM K;  4ZZL A;  3FHZ A;  2HEO A;  3RI4 A;  2A3S A;  4UUV A;  4IXA A;  2ZNZ A;  1WKM A;  1B9N A;  1JHF A;  2DFI A;  1ZRE A;  4IRG A;  1TNT A;  4Z2Y A;  4KA4 A;  2HKO A;  2F5E A;  3F8F A;  1Z91 A;  1R5H A;  1FYK A;  3CJN A;  1IXC A;  3WTV C;  1U8R A;  3V7S A;  1HST A;  3IWF A;  2KJC A;  3SQN A;  1KU3 A;  1F4K A;  2EV6 A;  3FXU A;  3E5Q A;  2Q2E A;  2OA4 A;  4N9I A;  3M7G A;  3QRF F;  3RIR A;  1P4W A;  5JHU A;  2O8X A;  3O2P E;  1FT9 A;  2FMY A;  4KMF A;  3VOE A;  4ZYG A;  4DNC A;  2OAZ A;  5BS6 A;  5HS8 A;  5E1X A;  2GA2 A;  3KP5 A;  4WF2 A;  1BI1 A;  4EJU A;  1BOA A;  1XGO A;  2CO5 A;  2IVM A;  2DT5 A;  1BM9 A;  4UV8 A;  4HV6 A;  2VBX A;  1F5T A;  5DCM A;  4S04 A;  2BE5 F;  3E6D A;  2XAH A;  3ZMV A;  4Q47 A;  1J2X A;  3SFZ A;  5K1Y A;  4KFC A;  2HR3 A;  5CJ9 A;  4BAY A;  2IT0 A;  3I54 A;  1PDN C;  5A2Q Z;  1B6A A;  4YG2 F;  1GVJ A;  5J8F A;  5F64 A;  3FM5 A;  1O57 A;  2G9W A;  4GYI A;  1ODD A;  3BZ6 A;  2FE3 A;  4L9J A;  4EJO A;  3PQJ A;  2HS5 A;  5JFR A;  5E18 F;  3WE3 A;  4LGW A;  2QQB A;  3HIF A;  2FF4 A;  4ZYD A;  2A07 F;  4FT8 A;  4KUM A;  4ASN A;  2M1B A;  5FB2 A;  2A5Y B;  4RB3 C;  2DU9 A;  5ED4 A;  1FBU A;  2DAO A;  3RYR A;  4IHT A;  5TRD A;  2EFP A;  3MZY A;  2MC3 A;  2V1D A;  5CLS A;  2K7L A;  2L01 A;  1LQ1 A;  3EET A;  2J5O A;  2NAZ A;  3EUH A;  1ON2 A;  1D3Y A;  5DYM A;  3QOP A;  3RPQ A;  1FP1 D;  2O0Y A;  1YYV A;  3N97 A;  3F8C A;  2XRN A;  4Y13 A;  1J0R A;  3W6J B;  4I2O A;  1X3U A;  3ML6 A;  2HKX A;  3U2R A;  1XCV A;  1O3S A;  4R79 A;  1S3J A;  2IA0 A;  2CW0 F;  3P9C A;  1SD7 A;  1IXS B;  1YW7 A;  3F6O A;  3WTS C;  1RUN A;  4AIH A;  4IPA A;  3GYH X;  3ELK A;  3GVA A;  4EM1 A;  4KIF A;  2P6T A;  3KFW X;  2VXZ A;  2IW5 A;  3ERE D;  1IZ1 A;  2ISZ A;  2LKP A;  1BC7 C;  5EEG A;  3WGG A;  1JGS A;  4RS8 A;  1ZGJ A;  4A0Y A;  4B8X A;  2VE8 A;  4IRI A;  5DD8 A;  3M8F A;  4CZZ A;  4MNU A;  1KYZ A;  3CLO A;  3E6B A;  3JTH A;  1Z6R A;  4KN7 X;  1BIB A;  2J5P A;  2FOK A;  5J8C A;  4HZF A;  4Y15 A;  4I02 A;  2WC2 A;  5LRR A;  3QP6 A;  2DK5 A;  3KP6 A;  2EWN A;  3RKW A;  3TGN A;  4OIO F;  1JE8 A;  4LMY A;  4KT5 C;  4AIK A;  3IC7 A;  1L3L A;  1O3R A;  4L5I A;  2HYG D;  4CYD A;  3V8K A;  2VT2 A;  5AIQ A;  3K1N A;  3R60 A;  3QU6 A;  3J81 Z;  3LA2 A;  2LF8 A;  1ZLK A;  2QZ8 A;  4L0Z B;  3EDP A;  2VE9 A;  3JW4 A;  3I58 A;  5E17 F;  2QLZ A;  2V1U A;  1ONV A;  2CGP A;  2M5W A;  5AON A;  5LEK A;  1FLI A;  4EJV A;  5ICC A;  2PMH A;  2K02 A;  1TLH B;  2P5K A;  1HW5 A;  3S2W A;  4LK1 F;  1XSX A;  4M72 A;  4YII A;  2IP2 A;  1SMY F;  5D6E A;  1R58 A;  2H09 A;  1O3Q A;  2XUB A;  2ZME A;  2E7W A;  3C1D A;  1W5T A;  2X4H A;  3DPL C;  1RI7 A;  5CVV A;  2NS0 A;  3I71 A;  3TQN A;  1DDN A;  5L3F A;  4HDV A;  2V9V A;  3QU3 A;  2EFO A;  3WOD F;  3CUO A;  4P96 A;  4L9T A;  1C0W A;  1MZB A;  3LAJ A;  1U6G A;  3CDH A;  2A69 F;  2R3S A;  2O6G E;  3I53 A;  4CHU A;  4EV0 A;  1Z6T A;  2RC4 A;  5D4R A;  3W6K B;  1G3Y A;  3T0Y A;  2ZBK A;  4ESF A;  3I4P A;  1T39 A;  3CO6 C;  3BWG A;  1F9N A;  4LFU A;  3RJP A;  1GXQ A;  1S7A A;  2QM3 A;  3HHG A;  2V6C A;  4KN4 X;  5CVU A;  1QQI A;  1QZY A;  3QPT A;  1XGM A;  2FQ3 A;  4OIR F;  5D6F A;  4LG0 A;  3JSO A;  2JPC A;  3KP3 A;  4JK1 X;  2VOO A;  4A0Z A;  2KRF A;  1E17 A;  3GFI A;  2MLK A;  2A61 A;  3FXR A;  3QP5 A;  1BN5 A;  2YPR A;  3B73 A;  2ESH A;  4QWQ A;  3SHF A;  3GW2 A;  3U9G A;  4WCG A;  2C6Y A;  2VC0 A;  2VBW A;  3M1E A;  4ZYE A;  1O3T A;  2PI0 A;  1YIO A;  1KA8 A;  2MH2 A;  2FU4 A;  3BJA A;  1YO5 C;  1FSH A;  1H9G A;  5L3B A;  1FZP B;  5BQT A;  4CO8 A;  2VT3 A;  3DKW A;  2E1N A;  2ZCW A;  4FX0 A;  3KE2 A;  2FSW A;  4U0Y A;  2GXG A;  2VOD A;  3CTA A;  2DI3 A;  2CWE A;  4XSZ F;  5D4S A;  3DPT A;  3V8L A;  4XRF A;  3KZZ A;  3HRM A;  1W4M A;  1PP7 U;  1I27 A;  1O7L A;  1IF1 A;  1YTY A;  4KMU X;  2K86 A;  3GLX A;  2DO7 A;  2DTR A;  4KIB A;  3VOD A;  3GX4 X;  4YFK F;  4ON0 A;  5DUI A;  3G3Z A;  2OZ6 A;  4LD5 A;  2QEN A;  1YQA A;  2PMU A;  2DW4 A;  2NRA C;  1DUX C;  5HS9 A;  1WSU A;  3K0L A;  1RUO A;  1S29 A;  5AIP A;  1XGS A;  4O3M A;  4KDP A;  1XB4 A;  1KU9 A;  1S8N A;  4HA8 A;  3R6S A;  2CQK A;  4KIC A;  1XSV A;  4AVP A;  4EM0 B;  3C7J A;  3HOS A;  4D0P A;  4GYG A;  3FWE A;  3U1D A;  4P9F A;  1FP2 A;  4HQM A;  1HW2 A;  2IA1 A;  5LHI A;  4XLN F;  1ZG5 A;  3R4K A;  2ACJ A;  1BI0 A;  3C18 A;  4OOI A;  3V7R A;  1ZRD A;  1JHH A;  2RQP A;  1KU2 A;  3JSP A;  1G6N A;  4PGH A;  1V4R A;  2P6S A;  5LBQ A;  5E20 A;  3RKX A;  5H20 A;  2Z3Y A;  1GHC A;  3Q9S A;  1ZYR F;  3E3V A;  4HLY A;  5K5R A;  3LQQ A;  3VFZ A;  3ZMT A;  3HUG A;  4U7D A;  2JZY A;  1FX7 A;  2GAU A;  5D5V B;  1R00 A;  5FFX A;  3FZV A;  1AWC A;  2XAF A;  3N4M A;  2P4W A;  4ENN A;  1D8J A;  3HRU A;  1Z9C A;  2EJR A;  3F23 A;  3CO7 C;  1DPU A;  3TO9 A;  4NQW A;  3LA7 A;  4L9V A;  3ZN1 A;  5D8L B;  1OYW A;  1REP C;  5L3E A;  4NHJ A;  2EFQ A;  2P8T A;  4BHB A;  2XAS A;  2DPD A;  3KLN A;  2BGC A;  2OD5 A;  4UV9 A;  2JPB A;  1UHW A;  4MEY F;  1MKM A;  3JTG A;  2GWR A;  4ZZD A;  4CXF A;  4LK0 F;  3M9A A;  3LFK A;  2E1C A;  2EA4 A;  3MCZ A;  4HQE A;  4JQF A;  3ZMZ A;  4N9H A;  3HOT A;  3WE2 A;  2PBI A;  3SZP A;  1VTN C;  4G9Y A;  1UB9 A;  1LEA A;  4RGR A;  1P4A A;  5DCM B;  4WXD A;  3FMQ A;  2RNJ A;  1IN5 A;  5J6X A;  4MEX F;  4Q4Z F;  1P4X A;  5EEH A;  2F5D A;  5F6F A;  1KQ8 A;  4HF1 A;  1P92 A;  2D1V A;  3KET A;  2M30 A;  2JT1 A;  1P2F A;  3LST A;  3I59 A;  3HTU A;  1R23 A;  4YIF A;  1SD6 A;  2NYX A;  2L02 A;  4XSX F;  2A6H F;  6PAX A;  3LA3 A;  2HGC A;  5HLH A;  1YS6 A;  2STW A;  3DQV C;  2O61 A;  1ZAR A;  2YR2 A;  1J59 A;  2OZU A;  2PG4 A;  5HDN A;  1WRJ A;  2KJB A;  2D2W A;  1KYW A;  4HX7 A;  1ON1 A;  3ECO A;  4XBF A;  3RYP A;  2ELH A;  2RKH A;  3R0A A;  3R0J A;  2HTJ A;  4DQ2 A;  3F21 A;  1ZG3 A;  5HDG A;  4M9X A;  4CGZ A;  1XCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...