2BZTA

Nmr structure of the bacterial protein yfhj from e. coli
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
66
structure length
66
Chain Sequence
MGLKWTDSREIGEALYDAYPDLDPKTVRFTDMHQWICDLEDFDDDPQASNEKILEAILLVWLDEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title YfhJ, a molecular adaptor in iron-sulfur cluster formation or a frataxin-like protein?
pubmed doi rcsb
source organism Escherichia coli
molecule tags Iron binding protein
molecule keywords PROTEIN ISCX
total genus 18
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2005-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04384 Fe-S_assembly Iron-sulphur cluster assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.600 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A IscX-like 2bztA00
2BZTA 1UJ8A
chains in the Genus database with same CATH superfamily
2OTJI 1B59A 2HVSA 1I3AA 2KQRA 4D7MA 3F23A 2KJBA 3CO6C 3PFIA 2NVYJ 4MTDA 4AD9A 1POGA 3J81K 4A6EA 3QYFA 3TGNA 2JRMA 3M8FA 2E7WA 1FYKA 1ETVA 2LDUA 2XASA 3OV8A 5EZGA 2KRFA 1HBXG 2O9LA 1JTXA 2IS6A 5DM7F 3LQRA 1OCZH 2IA1A 3CP8A 2FD5A 3DKYA 1FC3A 2QCOA 1XMKA 4D5CA 2PEXA 2DJIA 1X1DA 2D2WA 2K85A 2FXAA 1WQ2A 1S7EA 3ISPA 1VQ9I 4B09A 4L9TA 2VC0A 5ERIA 3KEOA 2MG4A 3E6DA 4NBQA 2WY7Q 3RJPA 5J47A 1SC7A 1KU7A 4A3CJ 3HOWJ 3ESWB 2YX7A 2UWMA 2M9HA 4ZDPA 1HDDC 4N4OB 1F9NA 3LA3A 2WY8Q 5K5RA 3JSOA 1IW7F 3I5UA 4WCGA 5EGOA 1XMAA 4A0YA 2CW7A 1YW7A 2XAFA 2PI0A 2F2EA 2R7VA 1XGOA 2DA5A 3MD2A 1GLNA 1QVUA 3MAJA 1VQOI 2X4HA 2JWTA 4UV8A 5C3EJ 1F4KA 4UUVA 4NQWB 1ETXA 2DA4A 2HOEA 3G1LA 3TOBA 2DO7A 2HQRA 2R7ZJ 2V7FA 1S8NA 1TTYA 3HSEA 3MVPA 2FMYA 1G3SA 3GEZA 1ZELA 4M74A 3P7NA 3F8FA 2STWA 4GFBA 2DN0A 5ILSA 3H36A 1PP7U 2F6CA 4AIKA 2VJIA 4KA4A 1XGSA 1AWCA 2PN6A 2IRFG 3KP2A 3CQZJ 2BOLA 4HZFA 5EEAA 3E97A 3S3NA 3ZQFA 4BHBA 5GTHC 4IJAA 4ETSA 4YFNF 2VLAA 4M3EA 2V9VA 2HU9A 2GIZA 4KUMA 2BVLA 3R4KA 4XRSA 1WJBA 5FRNA 1SD5A 1FYMA 2VONA 1ZR4A 3M8JA 3ONQA 3CLQA 5F64A 1KU3A 4A0ZA 3ZMSA 2L2OA 1SFOJ 4KMFA 1I1GA 1X4PA 1W4MA 4KT5C 4Y52J 2EINH 4DIQA 3MFKA 1J9IA 2PQ8A 1TT0A 2BBYA 2DOAA 1VQ5I 4XICA 2DQRA 2ZJ2A 1SVMA 1VI0A 3B6CA 2H09A 4IRGA 4XN0A 2HXIA 3I55I 3W2AA 2TDXA 3PJRA 3M07A 2DTZA 4IQ4A 2A07F 5HS9A 4HG2A 3BCAA 3VYUB 3JRDA 2XF5A 2CUFA 2JSPA 1T6SA 3CDIA 2VC1A 2VKEA 1A6QA 1D1BA 4ITVA 1MBGA 5J1RA 3LQQA 1FSHA 3SXYA 2HDWA 4QWQA 1B72B 2HPIA 4NUBA 3IH4A 5FLVA 5DUKA 4F92B 2HYFA 5KVRA 1SFKA 2BXZA 3ZQQA 3J80K 4KICA 2ACJA 4EM2A 1L0OC 4NB5A 4CCMA 2EV5A 3CZ6A 5JVGF 4KMUX 3DU5A 3GTOJ 2VN2A 2XV4S 1TZLA 3BQYA 3V7SA 1JJ6C 1ZG5A 5LHGA 3FMQA 5J6XA 2HQNA 1AOYA 1VTNC 3PO3J 4II2A 4RLQA 1BI3A 1DPRA 3CC7I 2B9SA 1WJ5A 2HGCA 2QQBA 5DCMB 4XLCA 1TWFJ 4X0GA 4G94A 3WE3A 2QVOA 5K7FA 2TRTA 4CGZA 5IYBJ 2VIXA 2MH2A 2F5DA 3S1QJ 2JA2A 3RTRA 2MBFA 1X3WB 5E3OA 1OISA 3Q5FA 3PUBA 3S2HJ 2EIJH 3CCJI 3ELKA 3U2RA 1ITYA 3JRGA 1TT5B 4XLNF 2ZXHA 3SEQA 1Y39A 3KEYA 1ZGAA 3ZQGA 4ENMA 3EUHA 1UHSA 3S2DJ 1SAXA 1TL8A 4D0PA 4RDUA 2NNNA 2BE5F 2R7FA 4XK4A 3B02A 3PUFA 1ETOA 4WX9A 1DU0A 2VKHA 1BW6A 2E1MB 2E5ZA 3ABKH 5FO5A 2GA2A 2L0KA 4HPQA 1V5FA 4F7ZA 1BM9A 5ED4A 5KNLA 1QA6A 3KIOA 3JRHA 3CCEI 2X0LA 4U0YA 1G8XA 2A5YB 5D4SA 3ZMZA 1P6RA 3QYEA 2AQFA 2K9LA 2M87A 4PJ0C 3W3CA 1R4NB 1SMYF 4LG0A 1XDSA 2UXNA 4MGRA 3CP2A 5FROA 1QHHD 3K9TA 3IWZA 1QZZA 5D5XB 4KFCA 4LIUA 1S9HA 1O7FA 2I10A 2I5UA 4XKVA 3BQZA 1D8KA 5FFZA 2E2HJ 2Q2EB 4XORA 4EGZA 4BXFA 2OF7A 4CZZA 3CCSI 1JHFA 1JKQC 3BR5A 4IHTA 3J7AY 3CCRI 3OSGA 1XSDA 1RKWA 3KFWX 3MWMA 1I6HJ 2EZKA 3JW4A 2QYOA 3OMYA 4I0AA 4BQOA 3OYBA 1I50J 4A5NA 1JT0A 5F0FA 4MEXF 3OYLA 4BXUA 2CMPA 2IXSA 3KP7A 4KJZA 4IOCF 1W5SA 3C18A 3J80Z 1YS6A 3FXMA 1W36D 4E4HA 5BQTA 5EDNA 2ZFUA 1UELB 1HQCA 2LTPA 1OR7C 4G12A 3FXLA 3O8HA 4G6TB 1IC8A 3A0BC 3G2BA 3CDHA 3RQ4A 3NEUA 3S1RJ 3ASOH 2M8GX 1WKMA 3DBHB 3HOSA 1XTAA 1WCMJ 1GUUA 3KCCA 1NHAA 2EV0A 3DEWA 2QQ9A 5F04A 1HOMA 2FRHA 3DFGA 3PSIA 1X1BA 2ME6A 5EEHA 3WTTC 4MQ9F 3BDDA 5D8LB 5FLMJ 2VQCA 5TISC 4CYCA 5LHIA 1XS9A 5E18F 4BQQA 4LG0B 4C2MJ 2A61A 3SZGA 3A02A 3VPRA 5JI6A 5L3CA 4LB5A 4PJNA 4ESJA 1IG7A 3HSRA 3G6EI 3RSNA 1EV7A 1IN5A 2LC2A 4B43A 4P5OA 4XSZF 2K9QA 4IHYA 1BA5A 1VZ0A 1RIOH 5H2FC 4MFDA 3CTAA 3DLLF 2GBYA 5DV5A 2VI6A 1KYWA 4BDZA 1OCCH 4CYCB 4MFEA 2OCEA 3BG9A 3G1MA 3Q0WA 2JN6A 1GV2A 2EFQA 3BPVA 4WK8F 3PFYA 4A3BJ 2L9VA 5IYCJ 3ZQLA 4BH9A 4BKXA 3BG5A 3NARA 1V55H 1IRZA 1JI8A 3I71A 1MJ9A 3H9QA 1UHWA 2BW3A 5KK1A 1X1CA 2E1MC 3V42A 2F4OB 4BHCA 3T0YA 2P7CB 1GHCA 4L5JA 3QODA 1MH3A 2E2JJ 3OY9A 5TRDA 2ZB9A 1ZG3A 4IHWA 3OIOA 2XGDA 3AAFA 2FBKA 3BZKA 2NS8A 4RM3A 3CUQA 3HXLA 1T0FC 5E1WA 1MGTA 3FIWA 3ZMTA 3FHNA 1Z21A 3EYYA 5GTIC 2MC4A 3G73A 1G4DA 1IXSB 2GWRA 2TCTA 3HB9A 4KIFA 1NK2P 1NG7A 1LE8B 1IF1A 4RLFA 3ZN0A 4F52A 3OYIA 1FT9A 3OOPA 3BP8A 3M1EA 1RUNA 2O03A 4Z2YA 2C6YA 3TP0A 2B7EA 1TQIA 1QZEA 2LYCA 3H35A 3I59A 2DA1A 2O7OA 2FQ3A 1Z1DA 2AXLA 2XKOA 4IEJA 2R5ZB 2JSCA 2ZSIB 2DMUA 1W7PD 1D0ZA 4UB6C 4D7NA 3CF2A 5HS7A 4C3IJ 1G3WA 2DFIA 4FTHA 1MMSA 2A6TA 3ZQIA 1WPKA 2VE9A 2FEZA 3EUKL 3SZPA 2ZJQF 3DPLC 2OAZA 1QQIA 1XGMA 5FLXK 1KA8A 4NC6A 3K10A 5JHUA 5CKTA 1P7JA 2CUEA 4AYBN 3HOVJ 1GXQA 3FBNB 2ADUA 3E5XA 3PQKA 1R1TA 3BWGA 3TO9A 4HNTA 5DEQA 2EQRA 1JHHA 5LRSA 2CQQA 1A6IA 5HNFA 5JVTA 2BV6A 1MJAA 1W1WE 3GVAA 1IUFA 4FCYA 4RGSA 1P9QC 1J09A 2EJRA 3ML6A 3W2WA 3RKQA 2DFHA 2VT2A 3BY6A 4BQAA 2IA0A 4IPAA 1R7JA 3OR1C 3BC8A 4RMNA 4RB2C 3FKJA 2JZYA 2H1KA 3DBRB 5J1YA 1U9OA 5LRRA 2MC3A 4I6ZA 3SDGA 2JPCA 2I8DA 3EUAA 2Q8KA 3H3VK 2LRDA 2OQGA 4QPQA 2Y0MA 1S3JA 3IKVA 4A5MA 2Z9OA 2CGPA 4IXAA 3T5XA 4UXNA 3DEEA 2YS9A 1D5VA 5AONA 5HLTA 4HYEA 3ECOA 2ISYA 1N78A 3P9IA 3HOZJ 3JSPA 4KT6A 4L9JA 2O8XA 4GRIA 2ME0A 1VF9A 1T2KA 3ZMVA 4I01A 2ZXWH 1WI9A 2M8EA 4M9ZA 1F43A 3C3WA 4FHTA 5EZHA 3ERMA 3KP4A 1WJFA 5J4VA 3T8TA 2M0MA 1PUFA 2K5CA 2NOJB 2O6GE 2QWWA 3BJAA 3F6VA 2OJED 4JK1X 4HX8A 3KP3A 2ZO4A 1U3EM 1WI3A 3H1CA 3IC7A 4HSRA 3GXOA 1IN4A 2WADA 3OYGA 3LSPA 2QKLB 3N4MA 3FF5A 5E1XA 3B73A 3KZZA 3FDYA 2K27A 4BE0A 1ZREA 9ANTA 4A6DA 2QBYB 2FU4A 4E7LA 1QRYA 2K4JA 1EA3A 1OKRA 2ID6A 4XRSG 3OL3A 1LEAA 3OYFA 1OPCA 4AUXA 2FF4A 2KHMA 3GTGJ 3GO5A 4EJVA 2JA7J 2Z33A 5AIPA 1T33A 4BYYA 2E36A 1E3HA 4AVZA 2QGUA 1YQAA 1IGNA 1MNEA 2HR3A 1RRJA 1Y1VJ 2RGVA 3U1KA 1F1ZA 4A12A 2MW8A 2BZTA 1DU6A 3HSFA 3GLLA 2RNJA 3VSLA 2E60A 4ZH4F 3GTMJ 2Z99A 3GW2A 1OCTC 1XSXA 1T56A 1R6RA 3L7WA 1D0XA 1KQ9A 4LLNA 3CUQC 2F48A 3KYCB 2ID3A 2O61A 3HDDA 1BIAA 2JPBA 2O8KA 4AM3A 1FSEA 3K7AJ 3ABUA 2A6HF 3R0AA 2YUSA 4OAYA 4U7BA 4LGWA 1MDMB 3TMOA 4RB0A 2OU2A 3E7LA 3D5RC 5H6QA 1MKMA 4A3GJ 5BS6A 4LLGF 4M9XA 4CDGA 3HKZN 3F9KA 4XBFA 3KP5A 2V6CA 3SHFA 2WB1A 2KIQA 2VASA 1FOYA 2X6YA 3BJ6A 3LL7A 2Y31A 1SVOA 3AG3H 2LBFA 3SEZA 3PIOF 4C3JJ 1B8IA 1SMTA 1SAUA 5BPDA 2R7RA 1WSUA 1AKHA 3I53A 1LVAA 3TO7A 5E17F 3COAC 5LBQA 3IKTA 3LSJA 3ZQCA 1FTZA 2X48A 5LGTA 1HXDA 2R7WA 1TQMA 4JP0A 2J5OA 2Y9YA 3AG4H 3DEUA 5KHDA 2IGMA 5CVJA 3FKIJ 2NVUB 1K7AA 1ON2A 5FLXZ 5B66C 2M30A 4WF2A 5L3FA 4Q5SF 2DOFA 4BBRJ 1I27A 1LFUP 5E79C 3HOTA 4FASD 2QSHX 1YJNI 2QA4I 2H8WA 2K3PA 1T8IA 1EKEA 3E1SA 4BJ5C 2EK5A 3GUDA 2Q2EA 1YI2I 4OIQF 4WXCA 3IV5A 4B47A 2B63J 5EG0A 1JJ8C 3ZR8X 1XPXA 1H9TA 4Q4ZF 2DA3A 2DLLA 3AL0C 2EFNA 1B4AA 4M3BA 5GPCA 2NRAC 4ZZDA 2HOTA 4KIGA 2GLOA 1TLHB 3DLAA 4RAYA 2ZMEA 1N75A 1Z91A 3RQIA 2M4KA 5TGTA 3LSIA 3GTPJ 2CSOA 1LJ9A 2A68F 1OCRH 1ZARA 4L9NA 1FOXA 4KN4X 1KZHA 1JGGA 1YTYA 2E1NA 5H20A 4YIFA 2DMQA 4PFOA 1HSJA 2YR2A 1J75A 4XRFA 2X6OA 3TEDA 4DYQA 1X4OA 2KMUA 3K4MA 4OWRB 2IEKA 4O3MA 2LY1A 3CF5F 2L54A 2VPLA 1O7LA 4ZZLA 1DP7P 1GDTA 3ZP5A 2H6CA 3WGHA 4ZYHA 2L7ZA 1D1AA 1HCRA 4AIJA 3BR2A 2RQQA 3T1BA 1CQTA 2AHQA 3CC2I 1OCOH 5D5VB 2DI3A 2EV6A 2MA3A 3HBLA 4BY7J 3OOUA 2XGEA 3WE2A 2OD5A 1DUXC 1KQ0A 3CJQB 2JUGA 3L2WA 4I09A 2HTSA 2RAEA 2KISA 4UB8C 3S14J 4BE2A 4U87A 3ZCOA 1UCRA 1ZKGA 4IX7A 4EGYA 1IN8A 1USTA 2ZJRF 2XRLA 4V19K 3HTUA 3OS1A 2X85A 4YIIA 3W6KB 5BPIA 2IS4A 1MJBA 3IRRA 1W5CC 4KISA 2BY2A 4NQWA 4HA8A 1SFUA 4CCOA 3KLOA 3VB2A 2L9SA 2HWVA 1UG0A 5HNHA 3HRUA 2R7QA 2CV0A 2QLZA 4A3DJ 3BT9A 2KIUA 5DTDA 4HF1A 4D5FA 1TWGJ 3FXKA 5E8IA 2HS5A 2IGNA 1ENHA 2FX0A 2KRHA 1VQLI 1UG2A 2GXAA 1IRGA 4LMYA 4PZJA 2Y69H 2F5FA 5M5WJ 1P7IA 4FETA 4EQQA 2STTA 4NC7A 3JAMZ 4BNCA 3GTLJ 3KE2A 1ZRCA 4HF0A 1ETQA 1IJWC 3K70C 4J01A 3OSFA 3JREA 3S8PA 1YO5C 3CO7C 4EJOA 3HGGA 3K1NA 2HZDA 1T38A 5K7HA 3OR2C 3L2RA 1U5TA 4I98B 3WU0A 1X1AA 5HVQC 5CVIA 4UNOA 2UV1A 3WTSC 3MZHA 2FOWA 3OYCA 4N0BA 3OYDA 3BG3A 1JUPA 4C30A 4E7SA 3SQNA 2W1OA 2CG4A 3HHGA 2WWYA 3CCVI 1SD4A 2JT1A 3F22A 2XAJA 1PVEA 3GLXA 3ECHA 1U5TC 2HPMA 2E35A 4C9YA 5C4JJ 2GXBA 5IP6A 5HLIA 4HV5A 3IRQA 2L7KA 1P4AA 1BI2A 4XKWA 1BOAA 2VQHA 2V9PA 2VPRA 4B8XA 4BL0B 4V2FA 3HOXJ 2E5NA 2H94A 1MDMA 2K02A 2K3FA 3WTYC 1UB9A 2PBIA 3QPLA 5HODA 1YRNA 1E3PA 3S93A 4L0YB 1S7AA 2L7MP 4Y13A 4YFXF 3ROUA 2RDPA 3I64A 4M6YA 3CCMI 3V7CA 3QOEA 1Q1VA 1OQYA 4E7JA 1H88C 1B9MA 1ONVA 4OMYA 3JAMK 2GQQA 3HPGA 2WTEA 4LITA 3L2QA 3R60A 5M3FJ 3RZDJ 4ZJZA 1MMNA 5A2QZ 3EQLF 3QWLA 1TWCJ 4JQFA 2V1DA 1R00A 2HVQA 1YW8A 2P5LC 4I99C 4IHVA 2VUMJ 1WHUA 2BEOA 5FKKA 2ETHA 4ENJA 1Y56A 5F27A 2IW5A 4G9YA 1GVDA 2LLKA 4GDFA 4DZJA 1PJRA 3GCMA 1OR7A 4HV6A 1AU7A 5EEGA 1DP3A 1Z3XA 4P9UA 5JLWA 3UNGC 2HI3A 2HQAA 2ELJA 4S05A 4ZTFA 2K7LA 3NWSA 4XRMA 1X19A 2L4MA 3B6AA 1U5TB 5JLXA 2W24A 2E34A 1R23A 4PJJA 1STZA 2OPTA 1HKTA 3MMYB 4Q48A 1U0JA 2P5KA 4BAYA 1ETWA 3A2KA 4F93B 2VE8A 1PUFB 3FXUA 3CC4I 5EJCA 2VXDA 5LEKA 2DA6A 1B1BA 1IV6A 5IYDJ 4HLYA 4C2UA 4C3HJ 2DMNA 2O3FA 2P8TA 2VJ4A 2QZ8A 3AG1H 2DOEA 1SEUA 3MEXA 3WODF 1YS7A 4KN7X 1P92A 5F1JA 3PO2J 1X2MA 3I0TA 5EG0B 1IDYA 4HW0A 4UUSA 4XKCA 2Y0SN 1XCVA 2COBA 4BS9A 4F3QA 2FE3A 4GYGA 4QPOA 5M5YJ 5CVRA 2XAQA 2PJRA 2XHKA 2EIMH 3Q0UA 3LSHA 3EDPA 2GZWA 3WTXC 2LKSA 4E6KG 4ENNA 4MO7A 1W36C 2XVCA 3PSFA 2WAQN 1PUEE 3CCYA 1Q1HA 2DMTA 2VOOA 4L9VA 3WTUC 2DXIA 3SJMA 3UKGA 4KNYA 3HOUJ 3DPUA 5L3GA 4GYIA 1VQKI 3U21A 4J00A 2VODA 1K79A 2XDVA 3BZ6A 3S3OA 1WVRA 1B8IB 1ZGWA 5C4XJ 1OYWA 1NH3A 2OTLI 1S5LC 1IZ1A 4FQGA 5FKNA 2DYSH 1Z6RA 2WV1A 2R93J 4W97A 2VXZA 3ZN1A 2BY3A 3BTIA 1VQ4I 3QQAA 4CZCA 2GOMA 3DKXA 4ESFA 3QAHA 1XGNA 3K4BA 3F8MA 2JVHA 2R7OA 1ERDA 1HW1A 1XC5A 1KONA 3FK7A 1WZ2A 4AIHA 2NVQJ 1F36A 3RKXA 1VQ8I 2R0QC 4KYWA 1YRNB 2PJRB 2K9MA 3CMEI 3K70D 2R3SA 2ESHA 2NOGA 2ZMEB 1I1SA 2QM3A 2EA2A 1XDUA 1MD0A 2XGCA 3HRSA 3A01B 3DP7A 3I59B 1Y1WJ 2R5YA 2PX9A 4FISA 2DMPA 3WGIA 2D5VA 1L3LA 1F5TA 3I4MJ 4FE4A 3QPHA 3RKYA 1B72A 1OJLA 2LVSA 5J3LA 1IV8A 2YPRA 1MBKA 3GF2A 1GXPA 2BHZA 3E5QA 2V6EA 4AVPA 1FEXA 3LFKA 2QQ8A 3L00A 3RKWA 2UXXA 5D5WB 2JA5J 3MKWB 2HDDA 5GP9A 2X1CA 3J81Z 2AQEA 5HDKA 2DQLA 3E6BA 2M34A 2W84A 2CQKA 3OYMA 4II3A 1R1VA 4NC8A 3IL2A 4YELA 3W6VA 2XAHA 3TL4X 5IY5H 1ZLKA 1JKRC 3GFLA 3U9GA 1H89C 3L2CA 3H5NA 2B0LA 2BGCA 3HKZA 2E1OA 2E7XA 5FRMA 3OYEA 1QVTA 1YYVA 4IF4A 5F0CA 4ZYGA 3G71I 2R4GA 4LJZF 1A04A 4A0XA 3OYNA 2OV7A 1Y0UA 2D1HA 3TW7A 1T08B 3D1NI 1N77A 3TKYA 2CO5A 4XKBA 1LQ1A 1FOKA 4BEHA 1GT0C 1J59A 1K6YA 3OIQA 3TW6A 4ENKA 1D8JA 2J5PA 5DS9A 4L18B 2JRTA 3MN2A 3VDXA 5BNGA 2PJPA 4A3LJ 4RM2A 4IO9F 3VYRB 1GVJA 4GGGA 2UZKA 3MZ8A 3DTIA 4OIRF 2LKXA 2YSRA 4LD5A 3ABMH 4A3FJ 3FK6A 1VFCA 1K78A 2ZNZA 1W0UA 1D1CA 4XM3A 3K1PA 2M2EA 5ICCA 4B44A 4AU7A 3JRIA 4ABZA 2L3DA 3CUOA 4IRIA 3BR0A 4HOBA 5L3DA 3HG9A 3BG6A 2CW0F 3LSTA 3JRCA 2IS2A 2P5VA 4PK4A 4R1HA 1BR4A 4LG3A 5EGOB 3RIRA 3KETA 2KDZA 2JVGA 4XQFA 2W00A 3IP4B 1MBHA 5D5UB 4DJAA 2QENA 3KZIC 2V26A 2MD5A 4E70A 1G3TA 1IN6A 2GXGA 4M72A 2LH9A 3ZRGA 2LY2A 1WJEA 2BYVE 2AS5F 1SFXA 4BHPA 2COMA 1S72I 2DK8A 5J40A 2QBYA 4RBOA 3LAJA 4EVIA 4G8XA 5IT9K 1FWZA 1VQNI 4GO1A 5CQGA 1NK3P 1HW5A 5D6EA 3WG7H 3HRMA 2G0EA 2ISZA 3RPUA 4OIOF 1KGSA 4BE1A 1PDNC 2BVMA 2RC4A 2EH3A 3DV8A 5KAFC 2R7UA 3GZNB 5E3NA 5IOZA 4EATA 4P55A 2LFBA 5ICFA 1V5EA 1HSTA 1XG1A 1EH6A 2XKPA 1ODDA 1RESA 4UVBA 2L9NA 4UUSB 4MQVA 4OU0A 3I4PA 4HAMA 5ILUA 1TBXA 2MYSA 2LMDA 1ETKA 2NS7A 1BC7C 4HRIA 3W6JB 1IDZA 5HS8A 4Y3OA 2WBMA 2JJ7A 1IN7A 3F8NA 1APLC 3G4SI 2FUG2 3OIPA 4PUSA 4Y33A 2EFWA 2EPFA 4GXOA 1YHQI 2Y2ZA 4U88A 2JA8J 5E1ZB 3JRFA 2JA6J 1ZYRF 2N8GA 2ZFWA 4AC0A 4EM1A 1Z67A 3REOA 4OIPF 3K4CA 2GA1A 4XOTA 3DPTA 1K83J 3IHUA 1LFBA 2FSWA 3IH2A 5K5QA 3DTEA 3LSRA 3HRTA 3ZPLA 2QSGX 2XGXA 1V4RA 4OINF 3F8CA 2FQ4A 4G7OF 3LWFA 1Y8RB 2DPUA 4BDYA 4O6JA 1WWXA 2OA4A 3M8EA 1YIOA 4PJLA 1DQUA 3CJNA 3LMMA 4P96A 2VJ5A 2E19A 5CLSA 5GAGJ 5L3EA 1R22A 1P2FA 3M4OJ 1J7KA 5B3SH 3E3VA 1A5JA 2GOXB 3BJOA 3IH3A 1LFPA 4HBLA 1R49A 3I54A 4LOCA 1VQ6I 4DYRA 2V1NA 2DA2A 1FBUA 1G6NA 3TDUC 5HLHA 3JRBA 1ZH5A 5D6FA 4HSTA 2MGQA 3H5AA 2IPQX 2F5VA 4BQNA 2L5QA 2CFXA 2O5RA 3VSKA 3AKZA 1X1PA 2HZTA 2L01A 2P7VB 3DU6A 4AIDA 3RCOA 2F4MB 3DF8A 2VJJA 3R6SA 1FTTA 4FT8A 5IT9Z 1K78B 5EYRA 1FOWA 2ZKZA 2L4AA 4RAGA 3HUGA 1CF7A 2PMZA 3AFHA 2IBDA 2CS3A 4CCJA 4RB3C 3RPQA 3PIPF 1LUJB 1DGRM 1FMWA 1YOVB 4MLOA 2D45A 2K40A 3OS0A 1OFCX 4HNUA 2R7TA 1FP2A 3KX2A 4HQEA 3K4LA 2LY9A 4IZZA 2FOKA 3BTCA 5K7ZA 3S1NJ 2LF8A 1LVKA 2Z16A 2DDBA 3HPHA 5HLGA 2EFPA 2JQ7A 3TOAA 3NWTA 2XSJC 4BU2A 2X9DA 3K2ZA 1RR7A 2OC6A 4E7IA 1HF0A 4XLHA 2CV1A 3IAS2 1RI7A 2WAEA 1UAAA 4PFPA 1WJAA 3LSMA 3TO6A 3ZGKA 4RAFA 2CUZA 2H6BA 2V1UA 3HHHA 3MQ0A 4LLLA 3GTKJ 4XL9A 4I76A 1S29A 2ZSHB 4KIBA 1I3QJ 2O0YA 1QNTA 2IAIA 5K1YA 4YRVA 1MMDA 4EM0B 2HYJA 4ON0A 3O8GA 3P9KA 1XB4A 4XMYA 3IAM2 3C7JA 3Q3SA 4N9HA 5CVVA 5LLQA 1KQ8A 4CXFA 2KPMA 1WFXA 4IHXA 3WTWC 4CCNA 1IUYA 2XRNA 5GAHJ 1LDKB 3WHBA 4D9JA 4JX6A 1X2NA 2RN7A 1CF7B 1U78A 3D0SA 4IRHA 2W48A 3PNVA 2HEOA 2VBYA 2NAZA 2DT6A 2OUMA 3K6GA 5FKLA 4ZDLA 3VOEA 4EEFG 1LKXA 2IGKA 2HTJA 5J4YA 2PLYA 4L0ZB 2VOPA 4A3KJ 2LR8A 5DD4A 1A31A 2KT0A 2K9NA 2VBZA 2KRCA 2KLOA 2R7XA 5AIQA 1DPUA 1MBEA 1R5GA 5FKMA 3S1MJ 4X6AJ 1FIPA 4V2GA 3BLYA 1VQPI 3FBIB 2EIKH 2OCCH 1TNTA 2CUJA 4YG2F 3HTSB 4XIDA 3BR6A 1MMGA 3MZYA 2DU9A 3F3XA 1K4TA 2CQXA 3FMSA 4XSXF 1FMVA 3OYAA 2H27A 1EJ9A 1E3OC 2YU3A 2Z3YA 4TV7A 1BIBA 1BI1A 5E8GA 1K4SA 1FBQA 2QKMB 3GZ6A 3WTZA 4RGXA 1KU2A 4HX7A 3M1CA 3FXQA 4F91B 1QPIA 2D1VA 2RQPA 2FA5A 4DYCA 2P6SA 3FM5A 1ZG1A 3GFIA 1YW9A 5B5EC 2KFDA 3CMMA 4Y7NJ 2FNPA 1MSEC 3K0LA 4PJMA 2EBIA 3RYPA 2F5EA 4IHSA 1T39A 3EYIA 3H9GA 3MKYB 3HEFA 2LNBA 4JX5A 1YJWI 3EPZA 5IPAA 6PAXA 3H0GJ 2P81A 4B4CA 2V4JC 3L1PA 2AO9A 3GMEA 5GADJ 4JOMA 4A3EJ 3A1YA 1ZRFA 4IOAF 1JXSA 2MSYA 4IVNA 1XMXA 2FNAA 1N25A 3HL2A 2MLGA 2V9KA 1XX5A 3F0CA 1FZPB 3TBIA 3L2VA 3S2WA 2VT3A 2BY0A 2VQLA 2IJLA 3S3MA 4G7ZF 5D4RA 1P4XA 4P1WA 5CVUA 1TP4A 3FXRA 2RKHA 2ESNA 3GTQJ 2W25A 3WGGA 1Y8QB 1A35A 1HC8A 4M3DA 1TC3C 1YG2A 2CYYA 3E5UA 3SFIA 2RNGA 2OBPA 1UJ8A 5DD8A 1O3TA 3KP6A 5ICGA 2HFHA 1WJDA 4QTRA 2BHYA 3BTLA 3DQVC 3A4CA 4ZYAA 1YLFA 2MFZA 1T0FA 5E3MA 2WAQA 3J7ZI 3BG7A 3W2VA 2Z1DA 4BJ6C 1S7OA 4X1EA 4A3IJ 2DA7A 2K86A 3ZOBA 3S16J 3GFJA 4M6XA 4HDUA 3QPTA 2ZMEC 3H5RA 3AG2H 2G9WA 1R5HA 4DBRA 1R1UA 3KPHA 2M0CA 3JR9A 3V4GA 3D5LA 2FJ1A 3ZXSA 1FX7A 3IUOA 3VYTB 1A36A 2DODA 1TWHJ 2DK5A 4MEYF 4XONA 1ZR2A 2Q0OA 3QYBA 5BMZA 3M3YJ 2LKPA 4LK0F 5F08A 1HKQA 2M1BA 4PCQA 1VQMI 3AL0B 4Y17A 2NYXA 3RDIA 3D5SC 5IT3A 3RI4A 2W7NA 3BCBA 1MBFA 1H0MA 4MIMA 1T95A 3CDLA 4LIVA 1ULYA 4CO8A 4EJUA 1RUOA 2QUFA 3KEQA 2DPDA 1XCBA 3K4NA 2CRGA 1EF4A 4OMZA 2F4IA 5JHFA 1IRXA 2PMZN 5J8FA 4MTEA 3DCFA 4MHGA 2HKOA 2PMHA 3O6BB 1Z3YA 1BJAA 1OMIA 2MD0A 2ZBKA 1E17A 4M9SA 3I4NJ 2VQGA 4FE7A 5ILVA 1MNDA 1OYIA 2XIGA 3JCUC 4HNVA 1U8RA 4ZTJA 3PNYA 3A0HC 4WXDA 3BR1A 4RS8A 5FD5A 3LNQA 3K1MA 1YITI 3R61A 2DFFA 1O57A 4GCVA 3MCZA 3QU3A 3HGYA 3ZMDA 4DQ2A 1Z77A 4RGUA 3CUQB 3FISA 2ZNYA 3GZ5A 1S6LA 1SFEA 3HZJA 4BBSJ 1QHGA 1BW5A 2A69F 4S04A 1MW7A 2DJNA 3EETA 1O3QA 3E6CC 4EJTA 4E7HA 2XSDC 2KL4A 3Q0VA 3N05A 4FX4A 2FMLA 3C2BA 2WV0A 1JTYA 2V79A 5FJ8J 1M1EB 3SYTA 5E3LA 2NVXJ 1NTCA 5F0HA 4L5EA 4IKFA 2NNYA 1USSA 1W7PB 3CLOA 5FKOA 3O3KA 1XD7A 2K4BA 3J7AO 4NNJA 4YFKF 4B1RA 2JTVA 2DAOA 4XNFA 4UVAA 4PGHA 4BGDA 4EMSA 4YIRX 1G3YA 2HKXA 2Q1ZB 5J8CA 4XN3A 3M7GA 3PM1A 1W0TA 2G7HA 1DGWY 3C1DA 2EFOA 4DBQA 3VEPA 2DT5A 1MZBA 1QPMA 1WGXA 2VB6A 4M71A 5DYMA 1QO0D 2ECCA 3FXOA 3S32A 1Z9CA 2YU9J 1WJCA 4XOPA 2KKOA 1I5ZA 5DUIA 1CGPA 1I6XA 1JKOC 3H3UA 2P0WA 1UZCA 2LF7A 2W57A 4IL6C 5FGMA 1BI0A 4A2UA 3QP5A 1VQ7I 3C2GA 3JRAA 3LAPA 4I7HA 1BC8C 1BJZA 1JT6A 2IS1A 3H92A 1MH4A 1D0YA 2CV2A 4BY1J 3KYDB 5M3MJ 2CW8A 4ZYDA 1GV5A 4L5IA 1HKSA 1G59A 1ZAOA 4ZC3A 1O3RA 2IVMA 1T98A 1H9GA 1FY7A 1ZTRA 4G6DA 1ZRDA 3FWEA 3SFZA 1Z05A 1O4XA 1XN7A 5IP7J 1AHDP 2Y48A 1BR2A 1BL0A 2JK3A 5HDGA 2GAUA 4A3MJ 3I9V2 2LSOA 3LFUA 5LFAA 1TNSA 2DBBA 2R7DA 1R9TJ 3E0JB 4UVCA 4QIWN 3GBGA 1OCPA 5JFRA 5C44J 3LSKA 2KDOA 1YX3A 4CCLA 2E1CA 2ICWG 3CJRB 4PSWA 1FJLA 3RZOJ 2R5ZA 2A6EF 2OZUA 4CSWA 4H0EA 2IT0A 1QU3A 4HLXA 2Y9ZA 3HIFA 4B48A 2GM4A 1UMQA 2IP2A 5LHHA 2LP0A 3NRVA 4HEA2 1K6OA 3A03A 3ZQHA 5KCMA 3DBLB 4YEJA 3K2AA 4E7KA 1YFHA 2A3SA 2ELKA 2CH0A 1QBJA 4PGGA 5GPAA 2LG4A 2NXNB 3LSGA 4B3AA 1ZGJA 3JTGA 3GWZA 1LE8A 1BOBA 1WH5A 2ECBA 3PNTA 3J7YJ 2XUBA 2DT7B 1EH8A 3Q9SA 2CWEA 4BJTA 1DDNA 3FHZA 2HDCA 4WWCA 1TW3A 3OYJA 1JE8A 1JUMA 4I0BA 2RREA 1FYLA 1V3FA 3BPXA 4NDLA 4F55A 2XC7A 1P4WA 1KYZA 5F1RA 3OYHA 1MMAA 3P9CA 2WB1N 2OZ6A 1FPQA 1ZLJA 2DCEA 1Z0XA 3FXJA 1ZHFA 4RB1A 4DZPA 1FBSA 4HF2A 1QZYA 1IO2A 4NHJA 3G1OA 1ZN2A 1FP1D 1LNWA 2VKDA 1HDPA 5CPRB 4CUGA 2L9RA 1EH7A 1MBJA 2UUZA 2XPWA 1R5ID 1SD6A 3I56I 5BOXA 5D8KB 1IAWA 2WC2A 2XPUA 3F72A 1RR8C 2CFOA 4LB6B 1RKTA 1J5YA 3BZCA 4I02A 2ELHA 2G7UA 4RAZA 5E20A 2FBIA 2EILH 3CCLI 4DOZA 4ZYEA 4HDVA 4KDPA 2M45A 1H8AC 2E71A 2PFBA 3IWFA 4LFUA 3K69A 3UR3C 3ABTA 3QOPA 3WU2C 3N97A 2PG4A 4DNCA 1JUSA 3K4KA 5F6FA 1LB2A 2KZVA 2HOAA 1W5TA 1V5GA 2CU7A 1OYYA 2M3AA 2W4SA 3OL4A 2LK2A 2VL8A 4XLFA 2HNHA 3WHCA 2KP6A 2XAUA 4RGRA 5M5XJ 2XB5A 3KYLA 2KIMA 4XLEA 4K2EA 3L2UA 3I3LA 4S0HB 5CQEA 5B1AH 1PYVA 2HOSA 2R7SA 4D1QA 5HOOA 1IXCA 4BEHB 4I2OA 1E2XA 4A93J 4PSXA 2DW4A 3GYHX 4A3JJ 4XLPF 2WAFA 2QF7A 3BR3A 4Q47A 4U0VA 2JUCA 3H0DA 3CMAI 3TDZC 3DKWA 2ZCWA 3PQJA 4EV0A 2W85A 5LD2C 2VKVA 3CMYA 2WA0A 1X58A 2IA2A 3F6OA 3U1DA 1X3UA 2P4WA 3CCQI 1IRFA 2CJJA 5LEJA 3GX4X 4JX4A 2W82A 3QP6A 4RA2A 4J19A 1VNDA 5IP9J 2CQ7A 1C0WA 1LEBA 3WTVC 3LA2A 3HOYJ 1SVLA 3JTHA 3MKLA 2RVCA 2VBWA 3X2QH 3KZYA 5KAIC 3WG9A 4ESBA 2DTRA 1V54H 4O5VA 1REPC 4DGWB 3QPSA 5K5OA 2Y75A 2Z5UA 4CYDA 3LOCA 2QSFX 2GIVA 3HYIA 3V7RA 1UHMA 2KJCA 1U6GA 2R5YB 4AWXB 2EZLA 2IGOA 3TQNA 4HX4A 1FIAA 1UFMA 3V8LA 2DFEA 2LOOA 4XLAA 4ANJA 2LREA 4XR6A 1RPWA 1ETYA 1LPQA 2ZXJA 2BY1A 2ZC2A 5DDGA 3F8BA 1WRJA 2PMUA 3H3ZA 2M7AA 4N9IA 1G2HA 3PL8A 4CICA 3ZMUA 1TWAJ 1SANA 4M73A 3CESA 4UUTA 5HDNA 3OS2A 2JMWA 4M3GA 3FM3A 3QRFF 4C2TA 3LA7A 4QSHA 1ORKA 5DM6F 1R4MB 1YJ9I 4WXHA 1HA8A 1MNMC 5A2QK 5JR3A 1NG6A 2HXOA 1D5YA 2OQRA 1JKPC 4BXXJ 3NAUA 2DDAA 2H8RA 1FLIA 3S17J 1RC9A 4BUPA 4Z6YA 4JYKA 2AXTC 3KLNA 1RETA 2K9SA 2X6XA 1RNLA 1YE9A 3P5JA 2L02A 3Q9VA 4U7DA 4G7HF 4IQJA 3BTJA 4Y4RA 1OLTA 3C2HA 4P9FA 5ICEA 1LDJA 1XSVA 3SDBA 1B6AA 1Y6IA 4ASNA 2HQ5A 2NVTJ 1Z7UA 2M4GA 1R58A 3VODA 2EZIA 1J0RA 1U9NA 2ZJPF 3I58A 4U0WA 1Y0NA 4JBAA 2CQNA 2E2IJ 3F21A 3WU1B 4MNUA 2X1DA 5FFXA 2DYRH 3VYSB 4A69C 4BACA 3GTJJ 3OWTA 3L9FA 3TP3A 3HJEA 2BXYA 3O2PE 1K61A 3OYKA 2HYGD 4N4NB 2QEXI 1RZ4A 3RYRA 2MLKA 1X3ZB 5FD6A 1U2WA 4ZDOA 5CYVA 4Y15A 3CD6I 2EB7A 2EZHA 4M6VA 3MKZA 3ERED 5TJJA 3A01A 4PDKA 4FX0A 3ABLH 1BBYA 3EUHC 2H1LA 1KU9A 3HUGB 5DCFA 4E7ZA 1YIJI 2L7FP 4CHUA 4OAZA 1YX5A 3VWBA 1D3YA 3HC7A 2XF6A 3DTKA 2KZGA 3GFMA 4W1UA 4AYBA 3G3ZA 2XF7A 1MIJA 2X51A 2XPVA 3FMRA 3BROA 4UV9A 1PP8F 5L3BA 2YX4A 4B3XA 3DWLE 1BR1A 3RPUD 3QU6A 1Z7LA 3M9AA 1AA7A 3HM5A 1B9NA 2NS0A 2ZXIA 3NQOA 2VBXA 2X6WA 1R71A 4LK1F 2EA4A 2XAGA 1AKHB 2BW3B 4HQMA 3ZQ7A 2LBFB 3K4JA 5CJ9A 5IOYA 3BOQA 4G6QA 1MSFC 4DW6A 1SD7A 3V8JA 1J2XA 1ZK8A 2MABA 2A5WA 2F5CA 5LGNA 1FNNA 3CCUI 1Z6TA 1TW2A 4KITB 2M5WA 3DXJF 2MH9A 1I39A 3FZVA 1ZQ3P 2P6TA 2X1EA 5DCMA 2Y30A 2QQAA 1QGPA 3E6MA 3S15J 2M7BA 1U8BA 2R92J 2V1XA 2Z2SB 2EWNA 4CCKA 3ASNH 1LDDA 3R0JA 4R8HA 1E0EA 1ACIA 4M3FA 5EF6A 3ULQB 1WH7A 4H4KC 3VFZA 1O3SA 1HLVA 4QLCU 5H6RA 2KIFA 2XROA 4R79A 3H9JA 3CJTB 2Y0SA 4CA0A 1ON1A 2XB0X 3SZTA 4UY8I 2LD5A 5GAEJ 5LGUA 3FX3A 1IXRC 1JGSA 4CH7A 5J1UA 1HW2A 2RV8A 4OOIA 2HVRA 3T8RA 5FB2A 1R36A 1W7PA 3L09A 2A05A 4EJWA 5B1BH 4UHTA 3V8KA 1TQPA 1BN5A 2FBHA
chains in the Genus database with same CATH topology
2BZTA 1UJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BZT A;  1UJ8 A; 
#chains in the Genus database with same CATH topology
 2OTJ I;  1B59 A;  2HVS A;  1I3A A;  2KQR A;  4D7M A;  3F23 A;  2KJB A;  3CO6 C;  3PFI A;  2NVY J;  4MTD A;  4AD9 A;  1POG A;  3J81 K;  4A6E A;  3QYF A;  3TGN A;  2JRM A;  3M8F A;  2E7W A;  1FYK A;  1ETV A;  2LDU A;  2XAS A;  3OV8 A;  5EZG A;  2KRF A;  1HBX G;  2O9L A;  1JTX A;  2IS6 A;  5DM7 F;  3LQR A;  1OCZ H;  2IA1 A;  3CP8 A;  2FD5 A;  3DKY A;  1FC3 A;  2QCO A;  1XMK A;  4D5C A;  2PEX A;  2DJI A;  1X1D A;  2D2W A;  2K85 A;  2FXA A;  1WQ2 A;  1S7E A;  3ISP A;  1VQ9 I;  4B09 A;  4L9T A;  2VC0 A;  5ERI A;  3KEO A;  2MG4 A;  3E6D A;  4NBQ A;  2WY7 Q;  3RJP A;  5J47 A;  1SC7 A;  1KU7 A;  4A3C J;  3HOW J;  3ESW B;  2YX7 A;  2UWM A;  2M9H A;  4ZDP A;  1HDD C;  4N4O B;  1F9N A;  3LA3 A;  2WY8 Q;  5K5R A;  3JSO A;  1IW7 F;  3I5U A;  4WCG A;  5EGO A;  1XMA A;  4A0Y A;  2CW7 A;  1YW7 A;  2XAF A;  2PI0 A;  2F2E A;  2R7V A;  1XGO A;  2DA5 A;  3MD2 A;  1GLN A;  1QVU A;  3MAJ A;  1VQO I;  2X4H A;  2JWT A;  4UV8 A;  5C3E J;  1F4K A;  4UUV A;  4NQW B;  1ETX A;  2DA4 A;  2HOE A;  3G1L A;  3TOB A;  2DO7 A;  2HQR A;  2R7Z J;  2V7F A;  1S8N A;  1TTY A;  3HSE A;  3MVP A;  2FMY A;  1G3S A;  3GEZ A;  1ZEL A;  4M74 A;  3P7N A;  3F8F A;  2STW A;  4GFB A;  2DN0 A;  5ILS A;  3H36 A;  1PP7 U;  2F6C A;  4AIK A;  2VJI A;  4KA4 A;  1XGS A;  1AWC A;  2PN6 A;  2IRF G;  3KP2 A;  3CQZ J;  2BOL A;  4HZF A;  5EEA A;  3E97 A;  3S3N A;  3ZQF A;  4BHB A;  5GTH C;  4IJA A;  4ETS A;  4YFN F;  2VLA A;  4M3E A;  2V9V A;  2HU9 A;  2GIZ A;  4KUM A;  2BVL A;  3R4K A;  4XRS A;  1WJB A;  5FRN A;  1SD5 A;  1FYM A;  2VON A;  1ZR4 A;  3M8J A;  3ONQ A;  3CLQ A;  5F64 A;  1KU3 A;  4A0Z A;  3ZMS A;  2L2O A;  1SFO J;  4KMF A;  1I1G A;  1X4P A;  1W4M A;  4KT5 C;  4Y52 J;  2EIN H;  4DIQ A;  3MFK A;  1J9I A;  2PQ8 A;  1TT0 A;  2BBY A;  2DOA A;  1VQ5 I;  4XIC A;  2DQR A;  2ZJ2 A;  1SVM A;  1VI0 A;  3B6C A;  2H09 A;  4IRG A;  4XN0 A;  2HXI A;  3I55 I;  3W2A A;  2TDX A;  3PJR A;  3M07 A;  2DTZ A;  4IQ4 A;  2A07 F;  5HS9 A;  4HG2 A;  3BCA A;  3VYU B;  3JRD A;  2XF5 A;  2CUF A;  2JSP A;  1T6S A;  3CDI A;  2VC1 A;  2VKE A;  1A6Q A;  1D1B A;  4ITV A;  1MBG A;  5J1R A;  3LQQ A;  1FSH A;  3SXY A;  2HDW A;  4QWQ A;  1B72 B;  2HPI A;  4NUB A;  3IH4 A;  5FLV A;  5DUK A;  4F92 B;  2HYF A;  5KVR A;  1SFK A;  2BXZ A;  3ZQQ A;  3J80 K;  4KIC A;  2ACJ A;  4EM2 A;  1L0O C;  4NB5 A;  4CCM A;  2EV5 A;  3CZ6 A;  5JVG F;  4KMU X;  3DU5 A;  3GTO J;  2VN2 A;  2XV4 S;  1TZL A;  3BQY A;  3V7S A;  1JJ6 C;  1ZG5 A;  5LHG A;  3FMQ A;  5J6X A;  2HQN A;  1AOY A;  1VTN C;  3PO3 J;  4II2 A;  4RLQ A;  1BI3 A;  1DPR A;  3CC7 I;  2B9S A;  1WJ5 A;  2HGC A;  2QQB A;  5DCM B;  4XLC A;  1TWF J;  4X0G A;  4G94 A;  3WE3 A;  2QVO A;  5K7F A;  2TRT A;  4CGZ A;  5IYB J;  2VIX A;  2MH2 A;  2F5D A;  3S1Q J;  2JA2 A;  3RTR A;  2MBF A;  1X3W B;  5E3O A;  1OIS A;  3Q5F A;  3PUB A;  3S2H J;  2EIJ H;  3CCJ I;  3ELK A;  3U2R A;  1ITY A;  3JRG A;  1TT5 B;  4XLN F;  2ZXH A;  3SEQ A;  1Y39 A;  3KEY A;  1ZGA A;  3ZQG A;  4ENM A;  3EUH A;  1UHS A;  3S2D J;  1SAX A;  1TL8 A;  4D0P A;  4RDU A;  2NNN A;  2BE5 F;  2R7F A;  4XK4 A;  3B02 A;  3PUF A;  1ETO A;  4WX9 A;  1DU0 A;  2VKH A;  1BW6 A;  2E1M B;  2E5Z A;  3ABK H;  5FO5 A;  2GA2 A;  2L0K A;  4HPQ A;  1V5F A;  4F7Z A;  1BM9 A;  5ED4 A;  5KNL A;  1QA6 A;  3KIO A;  3JRH A;  3CCE I;  2X0L A;  4U0Y A;  1G8X A;  2A5Y B;  5D4S A;  3ZMZ A;  1P6R A;  3QYE A;  2AQF A;  2K9L A;  2M87 A;  4PJ0 C;  3W3C A;  1R4N B;  1SMY F;  4LG0 A;  1XDS A;  2UXN A;  4MGR A;  3CP2 A;  5FRO A;  1QHH D;  3K9T A;  3IWZ A;  1QZZ A;  5D5X B;  4KFC A;  4LIU A;  1S9H A;  1O7F A;  2I10 A;  2I5U A;  4XKV A;  3BQZ A;  1D8K A;  5FFZ A;  2E2H J;  2Q2E B;  4XOR A;  4EGZ A;  4BXF A;  2OF7 A;  4CZZ A;  3CCS I;  1JHF A;  1JKQ C;  3BR5 A;  4IHT A;  3J7A Y;  3CCR I;  3OSG A;  1XSD A;  1RKW A;  3KFW X;  3MWM A;  1I6H J;  2EZK A;  3JW4 A;  2QYO A;  3OMY A;  4I0A A;  4BQO A;  3OYB A;  1I50 J;  4A5N A;  1JT0 A;  5F0F A;  4MEX F;  3OYL A;  4BXU A;  2CMP A;  2IXS A;  3KP7 A;  4KJZ A;  4IOC F;  1W5S A;  3C18 A;  3J80 Z;  1YS6 A;  3FXM A;  1W36 D;  4E4H A;  5BQT A;  5EDN A;  2ZFU A;  1UEL B;  1HQC A;  2LTP A;  1OR7 C;  4G12 A;  3FXL A;  3O8H A;  4G6T B;  1IC8 A;  3A0B C;  3G2B A;  3CDH A;  3RQ4 A;  3NEU A;  3S1R J;  3ASO H;  2M8G X;  1WKM A;  3DBH B;  3HOS A;  1XTA A;  1WCM J;  1GUU A;  3KCC A;  1NHA A;  2EV0 A;  3DEW A;  2QQ9 A;  5F04 A;  1HOM A;  2FRH A;  3DFG A;  3PSI A;  1X1B A;  2ME6 A;  5EEH A;  3WTT C;  4MQ9 F;  3BDD A;  5D8L B;  5FLM J;  2VQC A;  5TIS C;  4CYC A;  5LHI A;  1XS9 A;  5E18 F;  4BQQ A;  4LG0 B;  4C2M J;  2A61 A;  3SZG A;  3A02 A;  3VPR A;  5JI6 A;  5L3C A;  4LB5 A;  4PJN A;  4ESJ A;  1IG7 A;  3HSR A;  3G6E I;  3RSN A;  1EV7 A;  1IN5 A;  2LC2 A;  4B43 A;  4P5O A;  4XSZ F;  2K9Q A;  4IHY A;  1BA5 A;  1VZ0 A;  1RIO H;  5H2F C;  4MFD A;  3CTA A;  3DLL F;  2GBY A;  5DV5 A;  2VI6 A;  1KYW A;  4BDZ A;  1OCC H;  4CYC B;  4MFE A;  2OCE A;  3BG9 A;  3G1M A;  3Q0W A;  2JN6 A;  1GV2 A;  2EFQ A;  3BPV A;  4WK8 F;  3PFY A;  4A3B J;  2L9V A;  5IYC J;  3ZQL A;  4BH9 A;  4BKX A;  3BG5 A;  3NAR A;  1V55 H;  1IRZ A;  1JI8 A;  3I71 A;  1MJ9 A;  3H9Q A;  1UHW A;  2BW3 A;  5KK1 A;  1X1C A;  2E1M C;  3V42 A;  2F4O B;  4BHC A;  3T0Y A;  2P7C B;  1GHC A;  4L5J A;  3QOD A;  1MH3 A;  2E2J J;  3OY9 A;  5TRD A;  2ZB9 A;  1ZG3 A;  4IHW A;  3OIO A;  2XGD A;  3AAF A;  2FBK A;  3BZK A;  2NS8 A;  4RM3 A;  3CUQ A;  3HXL A;  1T0F C;  5E1W A;  1MGT A;  3FIW A;  3ZMT A;  3FHN A;  1Z21 A;  3EYY A;  5GTI C;  2MC4 A;  3G73 A;  1G4D A;  1IXS B;  2GWR A;  2TCT A;  3HB9 A;  4KIF A;  1NK2 P;  1NG7 A;  1LE8 B;  1IF1 A;  4RLF A;  3ZN0 A;  4F52 A;  3OYI A;  1FT9 A;  3OOP A;  3BP8 A;  3M1E A;  1RUN A;  2O03 A;  4Z2Y A;  2C6Y A;  3TP0 A;  2B7E A;  1TQI A;  1QZE A;  2LYC A;  3H35 A;  3I59 A;  2DA1 A;  2O7O A;  2FQ3 A;  1Z1D A;  2AXL A;  2XKO A;  4IEJ A;  2R5Z B;  2JSC A;  2ZSI B;  2DMU A;  1W7P D;  1D0Z A;  4UB6 C;  4D7N A;  3CF2 A;  5HS7 A;  4C3I J;  1G3W A;  2DFI A;  4FTH A;  1MMS A;  2A6T A;  3ZQI A;  1WPK A;  2VE9 A;  2FEZ A;  3EUK L;  3SZP A;  2ZJQ F;  3DPL C;  2OAZ A;  1QQI A;  1XGM A;  5FLX K;  1KA8 A;  4NC6 A;  3K10 A;  5JHU A;  5CKT A;  1P7J A;  2CUE A;  4AYB N;  3HOV J;  1GXQ A;  3FBN B;  2ADU A;  3E5X A;  3PQK A;  1R1T A;  3BWG A;  3TO9 A;  4HNT A;  5DEQ A;  2EQR A;  1JHH A;  5LRS A;  2CQQ A;  1A6I A;  5HNF A;  5JVT A;  2BV6 A;  1MJA A;  1W1W E;  3GVA A;  1IUF A;  4FCY A;  4RGS A;  1P9Q C;  1J09 A;  2EJR A;  3ML6 A;  3W2W A;  3RKQ A;  2DFH A;  2VT2 A;  3BY6 A;  4BQA A;  2IA0 A;  4IPA A;  1R7J A;  3OR1 C;  3BC8 A;  4RMN A;  4RB2 C;  3FKJ A;  2JZY A;  2H1K A;  3DBR B;  5J1Y A;  1U9O A;  5LRR A;  2MC3 A;  4I6Z A;  3SDG A;  2JPC A;  2I8D A;  3EUA A;  2Q8K A;  3H3V K;  2LRD A;  2OQG A;  4QPQ A;  2Y0M A;  1S3J A;  3IKV A;  4A5M A;  2Z9O A;  2CGP A;  4IXA A;  3T5X A;  4UXN A;  3DEE A;  2YS9 A;  1D5V A;  5AON A;  5HLT A;  4HYE A;  3ECO A;  2ISY A;  1N78 A;  3P9I A;  3HOZ J;  3JSP A;  4KT6 A;  4L9J A;  2O8X A;  4GRI A;  2ME0 A;  1VF9 A;  1T2K A;  3ZMV A;  4I01 A;  2ZXW H;  1WI9 A;  2M8E A;  4M9Z A;  1F43 A;  3C3W A;  4FHT A;  5EZH A;  3ERM A;  3KP4 A;  1WJF A;  5J4V A;  3T8T A;  2M0M A;  1PUF A;  2K5C A;  2NOJ B;  2O6G E;  2QWW A;  3BJA A;  3F6V A;  2OJE D;  4JK1 X;  4HX8 A;  3KP3 A;  2ZO4 A;  1U3E M;  1WI3 A;  3H1C A;  3IC7 A;  4HSR A;  3GXO A;  1IN4 A;  2WAD A;  3OYG A;  3LSP A;  2QKL B;  3N4M A;  3FF5 A;  5E1X A;  3B73 A;  3KZZ A;  3FDY A;  2K27 A;  4BE0 A;  1ZRE A;  9ANT A;  4A6D A;  2QBY B;  2FU4 A;  4E7L A;  1QRY A;  2K4J A;  1EA3 A;  1OKR A;  2ID6 A;  4XRS G;  3OL3 A;  1LEA A;  3OYF A;  1OPC A;  4AUX A;  2FF4 A;  2KHM A;  3GTG J;  3GO5 A;  4EJV A;  2JA7 J;  2Z33 A;  5AIP A;  1T33 A;  4BYY A;  2E36 A;  1E3H A;  4AVZ A;  2QGU A;  1YQA A;  1IGN A;  1MNE A;  2HR3 A;  1RRJ A;  1Y1V J;  2RGV A;  3U1K A;  1F1Z A;  4A12 A;  2MW8 A;  2BZT A;  1DU6 A;  3HSF A;  3GLL A;  2RNJ A;  3VSL A;  2E60 A;  4ZH4 F;  3GTM J;  2Z99 A;  3GW2 A;  1OCT C;  1XSX A;  1T56 A;  1R6R A;  3L7W A;  1D0X A;  1KQ9 A;  4LLN A;  3CUQ C;  2F48 A;  3KYC B;  2ID3 A;  2O61 A;  3HDD A;  1BIA A;  2JPB A;  2O8K A;  4AM3 A;  1FSE A;  3K7A J;  3ABU A;  2A6H F;  3R0A A;  2YUS A;  4OAY A;  4U7B A;  4LGW A;  1MDM B;  3TMO A;  4RB0 A;  2OU2 A;  3E7L A;  3D5R C;  5H6Q A;  1MKM A;  4A3G J;  5BS6 A;  4LLG F;  4M9X A;  4CDG A;  3HKZ N;  3F9K A;  4XBF A;  3KP5 A;  2V6C A;  3SHF A;  2WB1 A;  2KIQ A;  2VAS A;  1FOY A;  2X6Y A;  3BJ6 A;  3LL7 A;  2Y31 A;  1SVO A;  3AG3 H;  2LBF A;  3SEZ A;  3PIO F;  4C3J J;  1B8I A;  1SMT A;  1SAU A;  5BPD A;  2R7R A;  1WSU A;  1AKH A;  3I53 A;  1LVA A;  3TO7 A;  5E17 F;  3COA C;  5LBQ A;  3IKT A;  3LSJ A;  3ZQC A;  1FTZ A;  2X48 A;  5LGT A;  1HXD A;  2R7W A;  1TQM A;  4JP0 A;  2J5O A;  2Y9Y A;  3AG4 H;  3DEU A;  5KHD A;  2IGM A;  5CVJ A;  3FKI J;  2NVU B;  1K7A A;  1ON2 A;  5FLX Z;  5B66 C;  2M30 A;  4WF2 A;  5L3F A;  4Q5S F;  2DOF A;  4BBR J;  1I27 A;  1LFU P;  5E79 C;  3HOT A;  4FAS D;  2QSH X;  1YJN I;  2QA4 I;  2H8W A;  2K3P A;  1T8I A;  1EKE A;  3E1S A;  4BJ5 C;  2EK5 A;  3GUD A;  2Q2E A;  1YI2 I;  4OIQ F;  4WXC A;  3IV5 A;  4B47 A;  2B63 J;  5EG0 A;  1JJ8 C;  3ZR8 X;  1XPX A;  1H9T A;  4Q4Z F;  2DA3 A;  2DLL A;  3AL0 C;  2EFN A;  1B4A A;  4M3B A;  5GPC A;  2NRA C;  4ZZD A;  2HOT A;  4KIG A;  2GLO A;  1TLH B;  3DLA A;  4RAY A;  2ZME A;  1N75 A;  1Z91 A;  3RQI A;  2M4K A;  5TGT A;  3LSI A;  3GTP J;  2CSO A;  1LJ9 A;  2A68 F;  1OCR H;  1ZAR A;  4L9N A;  1FOX A;  4KN4 X;  1KZH A;  1JGG A;  1YTY A;  2E1N A;  5H20 A;  4YIF A;  2DMQ A;  4PFO A;  1HSJ A;  2YR2 A;  1J75 A;  4XRF A;  2X6O A;  3TED A;  4DYQ A;  1X4O A;  2KMU A;  3K4M A;  4OWR B;  2IEK A;  4O3M A;  2LY1 A;  3CF5 F;  2L54 A;  2VPL A;  1O7L A;  4ZZL A;  1DP7 P;  1GDT A;  3ZP5 A;  2H6C A;  3WGH A;  4ZYH A;  2L7Z A;  1D1A A;  1HCR A;  4AIJ A;  3BR2 A;  2RQQ A;  3T1B A;  1CQT A;  2AHQ A;  3CC2 I;  1OCO H;  5D5V B;  2DI3 A;  2EV6 A;  2MA3 A;  3HBL A;  4BY7 J;  3OOU A;  2XGE A;  3WE2 A;  2OD5 A;  1DUX C;  1KQ0 A;  3CJQ B;  2JUG A;  3L2W A;  4I09 A;  2HTS A;  2RAE A;  2KIS A;  4UB8 C;  3S14 J;  4BE2 A;  4U87 A;  3ZCO A;  1UCR A;  1ZKG A;  4IX7 A;  4EGY A;  1IN8 A;  1UST A;  2ZJR F;  2XRL A;  4V19 K;  3HTU A;  3OS1 A;  2X85 A;  4YII A;  3W6K B;  5BPI A;  2IS4 A;  1MJB A;  3IRR A;  1W5C C;  4KIS A;  2BY2 A;  4NQW A;  4HA8 A;  1SFU A;  4CCO A;  3KLO A;  3VB2 A;  2L9S A;  2HWV A;  1UG0 A;  5HNH A;  3HRU A;  2R7Q A;  2CV0 A;  2QLZ A;  4A3D J;  3BT9 A;  2KIU A;  5DTD A;  4HF1 A;  4D5F A;  1TWG J;  3FXK A;  5E8I A;  2HS5 A;  2IGN A;  1ENH A;  2FX0 A;  2KRH A;  1VQL I;  1UG2 A;  2GXA A;  1IRG A;  4LMY A;  4PZJ A;  2Y69 H;  2F5F A;  5M5W J;  1P7I A;  4FET A;  4EQQ A;  2STT A;  4NC7 A;  3JAM Z;  4BNC A;  3GTL J;  3KE2 A;  1ZRC A;  4HF0 A;  1ETQ A;  1IJW C;  3K70 C;  4J01 A;  3OSF A;  3JRE A;  3S8P A;  1YO5 C;  3CO7 C;  4EJO A;  3HGG A;  3K1N A;  2HZD A;  1T38 A;  5K7H A;  3OR2 C;  3L2R A;  1U5T A;  4I98 B;  3WU0 A;  1X1A A;  5HVQ C;  5CVI A;  4UNO A;  2UV1 A;  3WTS C;  3MZH A;  2FOW A;  3OYC A;  4N0B A;  3OYD A;  3BG3 A;  1JUP A;  4C30 A;  4E7S A;  3SQN A;  2W1O A;  2CG4 A;  3HHG A;  2WWY A;  3CCV I;  1SD4 A;  2JT1 A;  3F22 A;  2XAJ A;  1PVE A;  3GLX A;  3ECH A;  1U5T C;  2HPM A;  2E35 A;  4C9Y A;  5C4J J;  2GXB A;  5IP6 A;  5HLI A;  4HV5 A;  3IRQ A;  2L7K A;  1P4A A;  1BI2 A;  4XKW A;  1BOA A;  2VQH A;  2V9P A;  2VPR A;  4B8X A;  4BL0 B;  4V2F A;  3HOX J;  2E5N A;  2H94 A;  1MDM A;  2K02 A;  2K3F A;  3WTY C;  1UB9 A;  2PBI A;  3QPL A;  5HOD A;  1YRN A;  1E3P A;  3S93 A;  4L0Y B;  1S7A A;  2L7M P;  4Y13 A;  4YFX F;  3ROU A;  2RDP A;  3I64 A;  4M6Y A;  3CCM I;  3V7C A;  3QOE A;  1Q1V A;  1OQY A;  4E7J A;  1H88 C;  1B9M A;  1ONV A;  4OMY A;  3JAM K;  2GQQ A;  3HPG A;  2WTE A;  4LIT A;  3L2Q A;  3R60 A;  5M3F J;  3RZD J;  4ZJZ A;  1MMN A;  5A2Q Z;  3EQL F;  3QWL A;  1TWC J;  4JQF A;  2V1D A;  1R00 A;  2HVQ A;  1YW8 A;  2P5L C;  4I99 C;  4IHV A;  2VUM J;  1WHU A;  2BEO A;  5FKK A;  2ETH A;  4ENJ A;  1Y56 A;  5F27 A;  2IW5 A;  4G9Y A;  1GVD A;  2LLK A;  4GDF A;  4DZJ A;  1PJR A;  3GCM A;  1OR7 A;  4HV6 A;  1AU7 A;  5EEG A;  1DP3 A;  1Z3X A;  4P9U A;  5JLW A;  3UNG C;  2HI3 A;  2HQA A;  2ELJ A;  4S05 A;  4ZTF A;  2K7L A;  3NWS A;  4XRM A;  1X19 A;  2L4M A;  3B6A A;  1U5T B;  5JLX A;  2W24 A;  2E34 A;  1R23 A;  4PJJ A;  1STZ A;  2OPT A;  1HKT A;  3MMY B;  4Q48 A;  1U0J A;  2P5K A;  4BAY A;  1ETW A;  3A2K A;  4F93 B;  2VE8 A;  1PUF B;  3FXU A;  3CC4 I;  5EJC A;  2VXD A;  5LEK A;  2DA6 A;  1B1B A;  1IV6 A;  5IYD J;  4HLY A;  4C2U A;  4C3H J;  2DMN A;  2O3F A;  2P8T A;  2VJ4 A;  2QZ8 A;  3AG1 H;  2DOE A;  1SEU A;  3MEX A;  3WOD F;  1YS7 A;  4KN7 X;  1P92 A;  5F1J A;  3PO2 J;  1X2M A;  3I0T A;  5EG0 B;  1IDY A;  4HW0 A;  4UUS A;  4XKC A;  2Y0S N;  1XCV A;  2COB A;  4BS9 A;  4F3Q A;  2FE3 A;  4GYG A;  4QPO A;  5M5Y J;  5CVR A;  2XAQ A;  2PJR A;  2XHK A;  2EIM H;  3Q0U A;  3LSH A;  3EDP A;  2GZW A;  3WTX C;  2LKS A;  4E6K G;  4ENN A;  4MO7 A;  1W36 C;  2XVC A;  3PSF A;  2WAQ N;  1PUE E;  3CCY A;  1Q1H A;  2DMT A;  2VOO A;  4L9V A;  3WTU C;  2DXI A;  3SJM A;  3UKG A;  4KNY A;  3HOU J;  3DPU A;  5L3G A;  4GYI A;  1VQK I;  3U21 A;  4J00 A;  2VOD A;  1K79 A;  2XDV A;  3BZ6 A;  3S3O A;  1WVR A;  1B8I B;  1ZGW A;  5C4X J;  1OYW A;  1NH3 A;  2OTL I;  1S5L C;  1IZ1 A;  4FQG A;  5FKN A;  2DYS H;  1Z6R A;  2WV1 A;  2R93 J;  4W97 A;  2VXZ A;  3ZN1 A;  2BY3 A;  3BTI A;  1VQ4 I;  3QQA A;  4CZC A;  2GOM A;  3DKX A;  4ESF A;  3QAH A;  1XGN A;  3K4B A;  3F8M A;  2JVH A;  2R7O A;  1ERD A;  1HW1 A;  1XC5 A;  1KON A;  3FK7 A;  1WZ2 A;  4AIH A;  2NVQ J;  1F36 A;  3RKX A;  1VQ8 I;  2R0Q C;  4KYW A;  1YRN B;  2PJR B;  2K9M A;  3CME I;  3K70 D;  2R3S A;  2ESH A;  2NOG A;  2ZME B;  1I1S A;  2QM3 A;  2EA2 A;  1XDU A;  1MD0 A;  2XGC A;  3HRS A;  3A01 B;  3DP7 A;  3I59 B;  1Y1W J;  2R5Y A;  2PX9 A;  4FIS A;  2DMP A;  3WGI A;  2D5V A;  1L3L A;  1F5T A;  3I4M J;  4FE4 A;  3QPH A;  3RKY A;  1B72 A;  1OJL A;  2LVS A;  5J3L A;  1IV8 A;  2YPR A;  1MBK A;  3GF2 A;  1GXP A;  2BHZ A;  3E5Q A;  2V6E A;  4AVP A;  1FEX A;  3LFK A;  2QQ8 A;  3L00 A;  3RKW A;  2UXX A;  5D5W B;  2JA5 J;  3MKW B;  2HDD A;  5GP9 A;  2X1C A;  3J81 Z;  2AQE A;  5HDK A;  2DQL A;  3E6B A;  2M34 A;  2W84 A;  2CQK A;  3OYM A;  4II3 A;  1R1V A;  4NC8 A;  3IL2 A;  4YEL A;  3W6V A;  2XAH A;  3TL4 X;  5IY5 H;  1ZLK A;  1JKR C;  3GFL A;  3U9G A;  1H89 C;  3L2C A;  3H5N A;  2B0L A;  2BGC A;  3HKZ A;  2E1O A;  2E7X A;  5FRM A;  3OYE A;  1QVT A;  1YYV A;  4IF4 A;  5F0C A;  4ZYG A;  3G71 I;  2R4G A;  4LJZ F;  1A04 A;  4A0X A;  3OYN A;  2OV7 A;  1Y0U A;  2D1H A;  3TW7 A;  1T08 B;  3D1N I;  1N77 A;  3TKY A;  2CO5 A;  4XKB A;  1LQ1 A;  1FOK A;  4BEH A;  1GT0 C;  1J59 A;  1K6Y A;  3OIQ A;  3TW6 A;  4ENK A;  1D8J A;  2J5P A;  5DS9 A;  4L18 B;  2JRT A;  3MN2 A;  3VDX A;  5BNG A;  2PJP A;  4A3L J;  4RM2 A;  4IO9 F;  3VYR B;  1GVJ A;  4GGG A;  2UZK A;  3MZ8 A;  3DTI A;  4OIR F;  2LKX A;  2YSR A;  4LD5 A;  3ABM H;  4A3F J;  3FK6 A;  1VFC A;  1K78 A;  2ZNZ A;  1W0U A;  1D1C A;  4XM3 A;  3K1P A;  2M2E A;  5ICC A;  4B44 A;  4AU7 A;  3JRI A;  4ABZ A;  2L3D A;  3CUO A;  4IRI A;  3BR0 A;  4HOB A;  5L3D A;  3HG9 A;  3BG6 A;  2CW0 F;  3LST A;  3JRC A;  2IS2 A;  2P5V A;  4PK4 A;  4R1H A;  1BR4 A;  4LG3 A;  5EGO B;  3RIR A;  3KET A;  2KDZ A;  2JVG A;  4XQF A;  2W00 A;  3IP4 B;  1MBH A;  5D5U B;  4DJA A;  2QEN A;  3KZI C;  2V26 A;  2MD5 A;  4E70 A;  1G3T A;  1IN6 A;  2GXG A;  4M72 A;  2LH9 A;  3ZRG A;  2LY2 A;  1WJE A;  2BYV E;  2AS5 F;  1SFX A;  4BHP A;  2COM A;  1S72 I;  2DK8 A;  5J40 A;  2QBY A;  4RBO A;  3LAJ A;  4EVI A;  4G8X A;  5IT9 K;  1FWZ A;  1VQN I;  4GO1 A;  5CQG A;  1NK3 P;  1HW5 A;  5D6E A;  3WG7 H;  3HRM A;  2G0E A;  2ISZ A;  3RPU A;  4OIO F;  1KGS A;  4BE1 A;  1PDN C;  2BVM A;  2RC4 A;  2EH3 A;  3DV8 A;  5KAF C;  2R7U A;  3GZN B;  5E3N A;  5IOZ A;  4EAT A;  4P55 A;  2LFB A;  5ICF A;  1V5E A;  1HST A;  1XG1 A;  1EH6 A;  2XKP A;  1ODD A;  1RES A;  4UVB A;  2L9N A;  4UUS B;  4MQV A;  4OU0 A;  3I4P A;  4HAM A;  5ILU A;  1TBX A;  2MYS A;  2LMD A;  1ETK A;  2NS7 A;  1BC7 C;  4HRI A;  3W6J B;  1IDZ A;  5HS8 A;  4Y3O A;  2WBM A;  2JJ7 A;  1IN7 A;  3F8N A;  1APL C;  3G4S I;  2FUG 2;  3OIP A;  4PUS A;  4Y33 A;  2EFW A;  2EPF A;  4GXO A;  1YHQ I;  2Y2Z A;  4U88 A;  2JA8 J;  5E1Z B;  3JRF A;  2JA6 J;  1ZYR F;  2N8G A;  2ZFW A;  4AC0 A;  4EM1 A;  1Z67 A;  3REO A;  4OIP F;  3K4C A;  2GA1 A;  4XOT A;  3DPT A;  1K83 J;  3IHU A;  1LFB A;  2FSW A;  3IH2 A;  5K5Q A;  3DTE A;  3LSR A;  3HRT A;  3ZPL A;  2QSG X;  2XGX A;  1V4R A;  4OIN F;  3F8C A;  2FQ4 A;  4G7O F;  3LWF A;  1Y8R B;  2DPU A;  4BDY A;  4O6J A;  1WWX A;  2OA4 A;  3M8E A;  1YIO A;  4PJL A;  1DQU A;  3CJN A;  3LMM A;  4P96 A;  2VJ5 A;  2E19 A;  5CLS A;  5GAG J;  5L3E A;  1R22 A;  1P2F A;  3M4O J;  1J7K A;  5B3S H;  3E3V A;  1A5J A;  2GOX B;  3BJO A;  3IH3 A;  1LFP A;  4HBL A;  1R49 A;  3I54 A;  4LOC A;  1VQ6 I;  4DYR A;  2V1N A;  2DA2 A;  1FBU A;  1G6N A;  3TDU C;  5HLH A;  3JRB A;  1ZH5 A;  5D6F A;  4HST A;  2MGQ A;  3H5A A;  2IPQ X;  2F5V A;  4BQN A;  2L5Q A;  2CFX A;  2O5R A;  3VSK A;  3AKZ A;  1X1P A;  2HZT A;  2L01 A;  2P7V B;  3DU6 A;  4AID A;  3RCO A;  2F4M B;  3DF8 A;  2VJJ A;  3R6S A;  1FTT A;  4FT8 A;  5IT9 Z;  1K78 B;  5EYR A;  1FOW A;  2ZKZ A;  2L4A A;  4RAG A;  3HUG A;  1CF7 A;  2PMZ A;  3AFH A;  2IBD A;  2CS3 A;  4CCJ A;  4RB3 C;  3RPQ A;  3PIP F;  1LUJ B;  1DGR M;  1FMW A;  1YOV B;  4MLO A;  2D45 A;  2K40 A;  3OS0 A;  1OFC X;  4HNU A;  2R7T A;  1FP2 A;  3KX2 A;  4HQE A;  3K4L A;  2LY9 A;  4IZZ A;  2FOK A;  3BTC A;  5K7Z A;  3S1N J;  2LF8 A;  1LVK A;  2Z16 A;  2DDB A;  3HPH A;  5HLG A;  2EFP A;  2JQ7 A;  3TOA A;  3NWT A;  2XSJ C;  4BU2 A;  2X9D A;  3K2Z A;  1RR7 A;  2OC6 A;  4E7I A;  1HF0 A;  4XLH A;  2CV1 A;  3IAS 2;  1RI7 A;  2WAE A;  1UAA A;  4PFP A;  1WJA A;  3LSM A;  3TO6 A;  3ZGK A;  4RAF A;  2CUZ A;  2H6B A;  2V1U A;  3HHH A;  3MQ0 A;  4LLL A;  3GTK J;  4XL9 A;  4I76 A;  1S29 A;  2ZSH B;  4KIB A;  1I3Q J;  2O0Y A;  1QNT A;  2IAI A;  5K1Y A;  4YRV A;  1MMD A;  4EM0 B;  2HYJ A;  4ON0 A;  3O8G A;  3P9K A;  1XB4 A;  4XMY A;  3IAM 2;  3C7J A;  3Q3S A;  4N9H A;  5CVV A;  5LLQ A;  1KQ8 A;  4CXF A;  2KPM A;  1WFX A;  4IHX A;  3WTW C;  4CCN A;  1IUY A;  2XRN A;  5GAH J;  1LDK B;  3WHB A;  4D9J A;  4JX6 A;  1X2N A;  2RN7 A;  1CF7 B;  1U78 A;  3D0S A;  4IRH A;  2W48 A;  3PNV A;  2HEO A;  2VBY A;  2NAZ A;  2DT6 A;  2OUM A;  3K6G A;  5FKL A;  4ZDL A;  3VOE A;  4EEF G;  1LKX A;  2IGK A;  2HTJ A;  5J4Y A;  2PLY A;  4L0Z B;  2VOP A;  4A3K J;  2LR8 A;  5DD4 A;  1A31 A;  2KT0 A;  2K9N A;  2VBZ A;  2KRC A;  2KLO A;  2R7X A;  5AIQ A;  1DPU A;  1MBE A;  1R5G A;  5FKM A;  3S1M J;  4X6A J;  1FIP A;  4V2G A;  3BLY A;  1VQP I;  3FBI B;  2EIK H;  2OCC H;  1TNT A;  2CUJ A;  4YG2 F;  3HTS B;  4XID A;  3BR6 A;  1MMG A;  3MZY A;  2DU9 A;  3F3X A;  1K4T A;  2CQX A;  3FMS A;  4XSX F;  1FMV A;  3OYA A;  2H27 A;  1EJ9 A;  1E3O C;  2YU3 A;  2Z3Y A;  4TV7 A;  1BIB A;  1BI1 A;  5E8G A;  1K4S A;  1FBQ A;  2QKM B;  3GZ6 A;  3WTZ A;  4RGX A;  1KU2 A;  4HX7 A;  3M1C A;  3FXQ A;  4F91 B;  1QPI A;  2D1V A;  2RQP A;  2FA5 A;  4DYC A;  2P6S A;  3FM5 A;  1ZG1 A;  3GFI A;  1YW9 A;  5B5E C;  2KFD A;  3CMM A;  4Y7N J;  2FNP A;  1MSE C;  3K0L A;  4PJM A;  2EBI A;  3RYP A;  2F5E A;  4IHS A;  1T39 A;  3EYI A;  3H9G A;  3MKY B;  3HEF A;  2LNB A;  4JX5 A;  1YJW I;  3EPZ A;  5IPA A;  6PAX A;  3H0G J;  2P81 A;  4B4C A;  2V4J C;  3L1P A;  2AO9 A;  3GME A;  5GAD J;  4JOM A;  4A3E J;  3A1Y A;  1ZRF A;  4IOA F;  1JXS A;  2MSY A;  4IVN A;  1XMX A;  2FNA A;  1N25 A;  3HL2 A;  2MLG A;  2V9K A;  1XX5 A;  3F0C A;  1FZP B;  3TBI A;  3L2V A;  3S2W A;  2VT3 A;  2BY0 A;  2VQL A;  2IJL A;  3S3M A;  4G7Z F;  5D4R A;  1P4X A;  4P1W A;  5CVU A;  1TP4 A;  3FXR A;  2RKH A;  2ESN A;  3GTQ J;  2W25 A;  3WGG A;  1Y8Q B;  1A35 A;  1HC8 A;  4M3D A;  1TC3 C;  1YG2 A;  2CYY A;  3E5U A;  3SFI A;  2RNG A;  2OBP A;  1UJ8 A;  5DD8 A;  1O3T A;  3KP6 A;  5ICG A;  2HFH A;  1WJD A;  4QTR A;  2BHY A;  3BTL A;  3DQV C;  3A4C A;  4ZYA A;  1YLF A;  2MFZ A;  1T0F A;  5E3M A;  2WAQ A;  3J7Z I;  3BG7 A;  3W2V A;  2Z1D A;  4BJ6 C;  1S7O A;  4X1E A;  4A3I J;  2DA7 A;  2K86 A;  3ZOB A;  3S16 J;  3GFJ A;  4M6X A;  4HDU A;  3QPT A;  2ZME C;  3H5R A;  3AG2 H;  2G9W A;  1R5H A;  4DBR A;  1R1U A;  3KPH A;  2M0C A;  3JR9 A;  3V4G A;  3D5L A;  2FJ1 A;  3ZXS A;  1FX7 A;  3IUO A;  3VYT B;  1A36 A;  2DOD A;  1TWH J;  2DK5 A;  4MEY F;  4XON A;  1ZR2 A;  2Q0O A;  3QYB A;  5BMZ A;  3M3Y J;  2LKP A;  4LK0 F;  5F08 A;  1HKQ A;  2M1B A;  4PCQ A;  1VQM I;  3AL0 B;  4Y17 A;  2NYX A;  3RDI A;  3D5S C;  5IT3 A;  3RI4 A;  2W7N A;  3BCB A;  1MBF A;  1H0M A;  4MIM A;  1T95 A;  3CDL A;  4LIV A;  1ULY A;  4CO8 A;  4EJU A;  1RUO A;  2QUF A;  3KEQ A;  2DPD A;  1XCB A;  3K4N A;  2CRG A;  1EF4 A;  4OMZ A;  2F4I A;  5JHF A;  1IRX A;  2PMZ N;  5J8F A;  4MTE A;  3DCF A;  4MHG A;  2HKO A;  2PMH A;  3O6B B;  1Z3Y A;  1BJA A;  1OMI A;  2MD0 A;  2ZBK A;  1E17 A;  4M9S A;  3I4N J;  2VQG A;  4FE7 A;  5ILV A;  1MND A;  1OYI A;  2XIG A;  3JCU C;  4HNV A;  1U8R A;  4ZTJ A;  3PNY A;  3A0H C;  4WXD A;  3BR1 A;  4RS8 A;  5FD5 A;  3LNQ A;  3K1M A;  1YIT I;  3R61 A;  2DFF A;  1O57 A;  4GCV A;  3MCZ A;  3QU3 A;  3HGY A;  3ZMD A;  4DQ2 A;  1Z77 A;  4RGU A;  3CUQ B;  3FIS A;  2ZNY A;  3GZ5 A;  1S6L A;  1SFE A;  3HZJ A;  4BBS J;  1QHG A;  1BW5 A;  2A69 F;  4S04 A;  1MW7 A;  2DJN A;  3EET A;  1O3Q A;  3E6C C;  4EJT A;  4E7H A;  2XSD C;  2KL4 A;  3Q0V A;  3N05 A;  4FX4 A;  2FML A;  3C2B A;  2WV0 A;  1JTY A;  2V79 A;  5FJ8 J;  1M1E B;  3SYT A;  5E3L A;  2NVX J;  1NTC A;  5F0H A;  4L5E A;  4IKF A;  2NNY A;  1USS A;  1W7P B;  3CLO A;  5FKO A;  3O3K A;  1XD7 A;  2K4B A;  3J7A O;  4NNJ A;  4YFK F;  4B1R A;  2JTV A;  2DAO A;  4XNF A;  4UVA A;  4PGH A;  4BGD A;  4EMS A;  4YIR X;  1G3Y A;  2HKX A;  2Q1Z B;  5J8C A;  4XN3 A;  3M7G A;  3PM1 A;  1W0T A;  2G7H A;  1DGW Y;  3C1D A;  2EFO A;  4DBQ A;  3VEP A;  2DT5 A;  1MZB A;  1QPM A;  1WGX A;  2VB6 A;  4M71 A;  5DYM A;  1QO0 D;  2ECC A;  3FXO A;  3S32 A;  1Z9C A;  2YU9 J;  1WJC A;  4XOP A;  2KKO A;  1I5Z A;  5DUI A;  1CGP A;  1I6X A;  1JKO C;  3H3U A;  2P0W A;  1UZC A;  2LF7 A;  2W57 A;  4IL6 C;  5FGM A;  1BI0 A;  4A2U A;  3QP5 A;  1VQ7 I;  3C2G A;  3JRA A;  3LAP A;  4I7H A;  1BC8 C;  1BJZ A;  1JT6 A;  2IS1 A;  3H92 A;  1MH4 A;  1D0Y A;  2CV2 A;  4BY1 J;  3KYD B;  5M3M J;  2CW8 A;  4ZYD A;  1GV5 A;  4L5I A;  1HKS A;  1G59 A;  1ZAO A;  4ZC3 A;  1O3R A;  2IVM A;  1T98 A;  1H9G A;  1FY7 A;  1ZTR A;  4G6D A;  1ZRD A;  3FWE A;  3SFZ A;  1Z05 A;  1O4X A;  1XN7 A;  5IP7 J;  1AHD P;  2Y48 A;  1BR2 A;  1BL0 A;  2JK3 A;  5HDG A;  2GAU A;  4A3M J;  3I9V 2;  2LSO A;  3LFU A;  5LFA A;  1TNS A;  2DBB A;  2R7D A;  1R9T J;  3E0J B;  4UVC A;  4QIW N;  3GBG A;  1OCP A;  5JFR A;  5C44 J;  3LSK A;  2KDO A;  1YX3 A;  4CCL A;  2E1C A;  2ICW G;  3CJR B;  4PSW A;  1FJL A;  3RZO J;  2R5Z A;  2A6E F;  2OZU A;  4CSW A;  4H0E A;  2IT0 A;  1QU3 A;  4HLX A;  2Y9Z A;  3HIF A;  4B48 A;  2GM4 A;  1UMQ A;  2IP2 A;  5LHH A;  2LP0 A;  3NRV A;  4HEA 2;  1K6O A;  3A03 A;  3ZQH A;  5KCM A;  3DBL B;  4YEJ A;  3K2A A;  4E7K A;  1YFH A;  2A3S A;  2ELK A;  2CH0 A;  1QBJ A;  4PGG A;  5GPA A;  2LG4 A;  2NXN B;  3LSG A;  4B3A A;  1ZGJ A;  3JTG A;  3GWZ A;  1LE8 A;  1BOB A;  1WH5 A;  2ECB A;  3PNT A;  3J7Y J;  2XUB A;  2DT7 B;  1EH8 A;  3Q9S A;  2CWE A;  4BJT A;  1DDN A;  3FHZ A;  2HDC A;  4WWC A;  1TW3 A;  3OYJ A;  1JE8 A;  1JUM A;  4I0B A;  2RRE A;  1FYL A;  1V3F A;  3BPX A;  4NDL A;  4F55 A;  2XC7 A;  1P4W A;  1KYZ A;  5F1R A;  3OYH A;  1MMA A;  3P9C A;  2WB1 N;  2OZ6 A;  1FPQ A;  1ZLJ A;  2DCE A;  1Z0X A;  3FXJ A;  1ZHF A;  4RB1 A;  4DZP A;  1FBS A;  4HF2 A;  1QZY A;  1IO2 A;  4NHJ A;  3G1O A;  1ZN2 A;  1FP1 D;  1LNW A;  2VKD A;  1HDP A;  5CPR B;  4CUG A;  2L9R A;  1EH7 A;  1MBJ A;  2UUZ A;  2XPW A;  1R5I D;  1SD6 A;  3I56 I;  5BOX A;  5D8K B;  1IAW A;  2WC2 A;  2XPU A;  3F72 A;  1RR8 C;  2CFO A;  4LB6 B;  1RKT A;  1J5Y A;  3BZC A;  4I02 A;  2ELH A;  2G7U A;  4RAZ A;  5E20 A;  2FBI A;  2EIL H;  3CCL I;  4DOZ A;  4ZYE A;  4HDV A;  4KDP A;  2M45 A;  1H8A C;  2E71 A;  2PFB A;  3IWF A;  4LFU A;  3K69 A;  3UR3 C;  3ABT A;  3QOP A;  3WU2 C;  3N97 A;  2PG4 A;  4DNC A;  1JUS A;  3K4K A;  5F6F A;  1LB2 A;  2KZV A;  2HOA A;  1W5T A;  1V5G A;  2CU7 A;  1OYY A;  2M3A A;  2W4S A;  3OL4 A;  2LK2 A;  2VL8 A;  4XLF A;  2HNH A;  3WHC A;  2KP6 A;  2XAU A;  4RGR A;  5M5X J;  2XB5 A;  3KYL A;  2KIM A;  4XLE A;  4K2E A;  3L2U A;  3I3L A;  4S0H B;  5CQE A;  5B1A H;  1PYV A;  2HOS A;  2R7S A;  4D1Q A;  5HOO A;  1IXC A;  4BEH B;  4I2O A;  1E2X A;  4A93 J;  4PSX A;  2DW4 A;  3GYH X;  4A3J J;  4XLP F;  2WAF A;  2QF7 A;  3BR3 A;  4Q47 A;  4U0V A;  2JUC A;  3H0D A;  3CMA I;  3TDZ C;  3DKW A;  2ZCW A;  3PQJ A;  4EV0 A;  2W85 A;  5LD2 C;  2VKV A;  3CMY A;  2WA0 A;  1X58 A;  2IA2 A;  3F6O A;  3U1D A;  1X3U A;  2P4W A;  3CCQ I;  1IRF A;  2CJJ A;  5LEJ A;  3GX4 X;  4JX4 A;  2W82 A;  3QP6 A;  4RA2 A;  4J19 A;  1VND A;  5IP9 J;  2CQ7 A;  1C0W A;  1LEB A;  3WTV C;  3LA2 A;  3HOY J;  1SVL A;  3JTH A;  3MKL A;  2RVC A;  2VBW A;  3X2Q H;  3KZY A;  5KAI C;  3WG9 A;  4ESB A;  2DTR A;  1V54 H;  4O5V A;  1REP C;  4DGW B;  3QPS A;  5K5O A;  2Y75 A;  2Z5U A;  4CYD A;  3LOC A;  2QSF X;  2GIV A;  3HYI A;  3V7R A;  1UHM A;  2KJC A;  1U6G A;  2R5Y B;  4AWX B;  2EZL A;  2IGO A;  3TQN A;  4HX4 A;  1FIA A;  1UFM A;  3V8L A;  2DFE A;  2LOO A;  4XLA A;  4ANJ A;  2LRE A;  4XR6 A;  1RPW A;  1ETY A;  1LPQ A;  2ZXJ A;  2BY1 A;  2ZC2 A;  5DDG A;  3F8B A;  1WRJ A;  2PMU A;  3H3Z A;  2M7A A;  4N9I A;  1G2H A;  3PL8 A;  4CIC A;  3ZMU A;  1TWA J;  1SAN A;  4M73 A;  3CES A;  4UUT A;  5HDN A;  3OS2 A;  2JMW A;  4M3G A;  3FM3 A;  3QRF F;  4C2T A;  3LA7 A;  4QSH A;  1ORK A;  5DM6 F;  1R4M B;  1YJ9 I;  4WXH A;  1HA8 A;  1MNM C;  5A2Q K;  5JR3 A;  1NG6 A;  2HXO A;  1D5Y A;  2OQR A;  1JKP C;  4BXX J;  3NAU A;  2DDA A;  2H8R A;  1FLI A;  3S17 J;  1RC9 A;  4BUP A;  4Z6Y A;  4JYK A;  2AXT C;  3KLN A;  1RET A;  2K9S A;  2X6X A;  1RNL A;  1YE9 A;  3P5J A;  2L02 A;  3Q9V A;  4U7D A;  4G7H F;  4IQJ A;  3BTJ A;  4Y4R A;  1OLT A;  3C2H A;  4P9F A;  5ICE A;  1LDJ A;  1XSV A;  3SDB A;  1B6A A;  1Y6I A;  4ASN A;  2HQ5 A;  2NVT J;  1Z7U A;  2M4G A;  1R58 A;  3VOD A;  2EZI A;  1J0R A;  1U9N A;  2ZJP F;  3I58 A;  4U0W A;  1Y0N A;  4JBA A;  2CQN A;  2E2I J;  3F21 A;  3WU1 B;  4MNU A;  2X1D A;  5FFX A;  2DYR H;  3VYS B;  4A69 C;  4BAC A;  3GTJ J;  3OWT A;  3L9F A;  3TP3 A;  3HJE A;  2BXY A;  3O2P E;  1K61 A;  3OYK A;  2HYG D;  4N4N B;  2QEX I;  1RZ4 A;  3RYR A;  2MLK A;  1X3Z B;  5FD6 A;  1U2W A;  4ZDO A;  5CYV A;  4Y15 A;  3CD6 I;  2EB7 A;  2EZH A;  4M6V A;  3MKZ A;  3ERE D;  5TJJ A;  3A01 A;  4PDK A;  4FX0 A;  3ABL H;  1BBY A;  3EUH C;  2H1L A;  1KU9 A;  3HUG B;  5DCF A;  4E7Z A;  1YIJ I;  2L7F P;  4CHU A;  4OAZ A;  1YX5 A;  3VWB A;  1D3Y A;  3HC7 A;  2XF6 A;  3DTK A;  2KZG A;  3GFM A;  4W1U A;  4AYB A;  3G3Z A;  2XF7 A;  1MIJ A;  2X51 A;  2XPV A;  3FMR A;  3BRO A;  4UV9 A;  1PP8 F;  5L3B A;  2YX4 A;  4B3X A;  3DWL E;  1BR1 A;  3RPU D;  3QU6 A;  1Z7L A;  3M9A A;  1AA7 A;  3HM5 A;  1B9N A;  2NS0 A;  2ZXI A;  3NQO A;  2VBX A;  2X6W A;  1R71 A;  4LK1 F;  2EA4 A;  2XAG A;  1AKH B;  2BW3 B;  4HQM A;  3ZQ7 A;  2LBF B;  3K4J A;  5CJ9 A;  5IOY A;  3BOQ A;  4G6Q A;  1MSF C;  4DW6 A;  1SD7 A;  3V8J A;  1J2X A;  1ZK8 A;  2MAB A;  2A5W A;  2F5C A;  5LGN A;  1FNN A;  3CCU I;  1Z6T A;  1TW2 A;  4KIT B;  2M5W A;  3DXJ F;  2MH9 A;  1I39 A;  3FZV A;  1ZQ3 P;  2P6T A;  2X1E A;  5DCM A;  2Y30 A;  2QQA A;  1QGP A;  3E6M A;  3S15 J;  2M7B A;  1U8B A;  2R92 J;  2V1X A;  2Z2S B;  2EWN A;  4CCK A;  3ASN H;  1LDD A;  3R0J A;  4R8H A;  1E0E A;  1ACI A;  4M3F A;  5EF6 A;  3ULQ B;  1WH7 A;  4H4K C;  3VFZ A;  1O3S A;  1HLV A;  4QLC U;  5H6R A;  2KIF A;  2XRO A;  4R79 A;  3H9J A;  3CJT B;  2Y0S A;  4CA0 A;  1ON1 A;  2XB0 X;  3SZT A;  4UY8 I;  2LD5 A;  5GAE J;  5LGU A;  3FX3 A;  1IXR C;  1JGS A;  4CH7 A;  5J1U A;  1HW2 A;  2RV8 A;  4OOI A;  2HVR A;  3T8R A;  5FB2 A;  1R36 A;  1W7P A;  3L09 A;  2A05 A;  4EJW A;  5B1B H;  4UHT A;  3V8K A;  1TQP A;  1BN5 A;  2FBH A; 
#chains in the Genus database with same CATH homology
 2BZT A;  1UJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...