2BZTA

Nmr structure of the bacterial protein yfhj from e. coli
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
66
structure length
66
Chain Sequence
MGLKWTDSREIGEALYDAYPDLDPKTVRFTDMHQWICDLEDFDDDPQASNEKILEAILLVWLDEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN ISCX
publication title YfhJ, a molecular adaptor in iron-sulfur cluster formation or a frataxin-like protein?
pubmed doi rcsb
source organism Escherichia coli
molecule tags Iron binding protein
total genus 18
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2005-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04384 Fe-S_assembly Iron-sulphur cluster assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.600 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A IscX-like 2bztA00
1UJ8A 2BZTA
chains in the Genus database with same CATH superfamily
1WJ5A 2LLKA 3R0AA 4M3BA 1YE9A 2V9PA 1B8IA 2NAZA 4D1QA 1BR4A 4LD5A 5JVGF 1SANA 4EVIA 2H1KA 1O7LA 2DU9A 1U5TC 3FHZA 1ENHA 1PUEE 1LKXA 1D3YA 1SFEA 3CO7C 1D8KA 4DBRA 4PJMA 5F6FA 4J01A 3BC8A 2KQRA 5JVTA 4KITB 5HLIA 4BS9A 2E34A 3WTUC 5DV5A 3L2QA 3OL3A 3FXQA 3LSHA 3H92A 1T98A 1Z6RA 2W4SA 2P5VA 2K40A 3QP6A 2PN6A 5D4RA 4LLNA 4A5MA 2H6CA 3RKYA 1O3TA 1UFMA 4KJZA 1IV8A 3OYHA 2NS8A 3QPSA 3OYFA 2GWRA 3A1YA 4KISA 3ZQ7A 1GDTA 3V42A 4YEJA 5TRDA 1ZRCA 1ZLKA 1S7EA 3TEDA 1PP7U 3Q0UA 2DOAA 1K6YA 4AYBN 3F8FA 2OJED 1HKQA 4BAYA 2VONA 5M5WJ 3DP7A 4AIHA 1USSA 2XHKA 1V5EA 2HQNA 2K27A 2A5YB 1W7PA 3GZ5A 5HLHA 3FXKA 5J8CA 2K7LA 3FMQA 1MMAA 2CGPA 1U3EM 3DU6A 3LAPA 4E4HA 3CJTB 4LMYA 4DOZA 2P7CB 3OYKA 1E3PA 5EJCA 1ZGAA 2LH9A 3GX4X 3S17J 3GVAA 2FQ3A 1T08B 3ELKA 3E3VA 2EIKH 1DU6A 3BROA 5FD6A 2W85A 4YG2F 4BGDA 4CDGA 2AXLA 2E1MB 2CV1A 4ESBA 4FTHA 4KN7X 5HVQC 4X6AJ 1MBGA 1QZZA 3EYYA 5HS8A 3NAUA 3KETA 3CC2I 4E7KA 4C3JJ 1BIBA 2LYCA 1IAWA 5FB2A 1VZ0A 1I3QJ 3K4LA 4IHTA 1IDZA 1FBSA 1WPKA 2JVGA 1JT6A 3WE2A 3F8NA 3ECOA 4M6XA 4XLPF 1XS9A 3OWTA 4LOCA 3WE3A 4C2UA 2Y2ZA 3SEZA 3CZ6A 3BDDA 1AHDP 4OINF 2VXZA 2QLZA 5DD8A 5K7ZA 5M5YJ 5HODA 2FSWA 1Z77A 3H9QA 1W7PD 3PUFA 4MTEA 2AO9A 3ZMVA 3RIRA 2Z1DA 3WGIA 2TCTA 1R23A 2PMZN 1P92A 3MQ0A 3OYLA 3HOXJ 1MMGA 2R7UA 2VN2A 4A2UA 5C44J 2EIMH 3LSIA 4WXCA 5DYMA 2JUGA 4MFEA 3KP7A 2A69F 2E19A 1ORKA 5FKMA 5J4YA 1T39A 5B1BH 3K1MA 1BIAA 3N4MA 1D5VA 2QQ9A 4HDVA 5FFZA 3TQNA 1QPIA 1QVUA 4ZH4F 2ZXJA 2VIXA 4RLFA 3LQQA 3CCYA 4B43A 1RKTA 4O3MA 1YX5A 3E7LA 1X2NA 1VFCA 3FXMA 1UHWA 3QYEA 4PGHA 1DGWY 1ULYA 4LGWA 4CH7A 2A07F 3ASNH 2M30A 1UHMA 1SVMA 1U6GA 1SVLA 1NK3P 5FRMA 4RMNA 3VFZA 4MLOA 4KMFA 3HKZN 5FGMA 4GRIA 4ANJA 2H8WA 3VYUB 4LLLA 1S72I 2VBWA 1NH3A 3HRTA 4YELA 1P9QC 5J1YA 1R7JA 4XQFA 2UZKA 2LDUA 2FOWA 3M07A 5B1AH 1H0MA 2R7SA 1LNWA 2LFBA 3U2RA 3BTIA 4XLHA 3GTKJ 2VC1A 3WTZA 5D6EA 3GTJJ 3WTSC 1JUSA 1Y8RB 3K4NA 5EGOB 1ETKA 2EZIA 1F43A 2V6CA 4EGZA 5BNGA 1PP8F 3GTPJ 5DDGA 2HTJA 2DMQA 3BR1A 1DPRA 3FZVA 4MTDA 2RGVA 3ASOH 1CF7A 1FLIA 2IPQX 3I54A 1FP1D 2ZXIA 2A68F 4HLXA 5LD2C 1W5SA 4EGYA 2V26A 1RPWA 1I3AA 3QP5A 3P9CA 4G9YA 3BTLA 2L02A 3DBRB 2D5VA 1WH5A 2D1VA 2DFFA 3PSIA 3VODA 5E3MA 1REPC 2K3FA 4BQNA 2VPRA 2QVOA 1S7OA 1I27A 2Z99A 4ASNA 3F6VA 3KEYA 3LSTA 1LEBA 4BXUA 5E18F 1X4OA 1VQ4I 2M4GA 3E5UA 1G3YA 3CMAI 2E1NA 4A6DA 4XN3A 3DTIA 1LFPA 1K61A 1V54H 3K4BA 1ODDA 4XK4A 3FF5A 4BEHB 1BC8C 1B1BA 1K7AA 1SAUA 1R4MB 1R9TJ 4HYEA 3SZPA 2KT0A 3G71I 3ABUA 3I56I 4IVNA 2V1UA 3CCUI 3S1QJ 3OYJA 3EQLF 2W7NA 3L2UA 4RB3C 3DEWA 3FMSA 4P1WA 2L4AA 1VF9A 1JKQC 1JGGA 4XSXF 4HEA2 2GBYA 3PJRA 2EQRA 2P6TA 3ZCOA 5GPCA 2CW0F 1YW7A 1GVDA 4FE4A 3JCUC 1Z3YA 1ZG5A 2BV6A 4QPQA 1MMDA 1QGPA 2BW3B 1UMQA 4G7OF 2R0QC 2I10A 1VQMI 4Y15A 3SQNA 3ROUA 2QF7A 5L3FA 2HKXA 3BJ6A 1YW9A 2KMUA 3SFZA 3HSEA 2FNPA 4IQJA 1WWXA 2DDAA 3BG6A 5L3EA 4JP0A 4MHGA 3G73A 2L3DA 5EDNA 2NVTJ 1MMNA 5FD5A 2R7FA 3M4OJ 1YS7A 2K85A 4FT8A 3FWEA 3HXLA 2L7KA 4ENKA 2WY7Q 2K9LA 4DYQA 2EB7A 1TT0A 1U9OA 3BZKA 3B02A 4IRIA 2NXNB 3JAMZ 3ZQQA 2Y0MA 4A3JJ 2VOOA 2DPDA 2I8DA 2VKHA 2XASA 3S3NA 4L18B 3R4KA 3DLAA 2DXIA 2NS7A 5JLXA 4EATA 2R7XA 3IUOA 4BY1J 5LRRA 1UJ8A 1FOYA 5KNLA 4ESFA 3L00A 1HXDA 3AL0C 1T0FA 2HZTA 2OCCH 2X4HA 3C2BA 3J7ZI 3IHUA 1S9HA 3F8MA 1XD7A 3LOCA 4XN0A 2ECCA 3X2QH 1GT0C 2M3AA 1OCRH 4A3KJ 1JKRC 3ULQB 2JWTA 3G1LA 2PFBA 3ZQLA 1X3WB 1XSXA 2RDPA 5AIQA 4OIPF 4L9NA 1CQTA 2VLAA 2LKXA 4L9VA 1X3ZB 3PL8A 4F93B 1Z3XA 2EZHA 2MLKA 3M7GA 3PNYA 4A69C 1XMXA 2KKOA 1ZAOA 4AVPA 3OV8A 1W0UA 2YU9J 3CCRI 2W57A 3QU6A 4V19K 1J9IA 2FUG2 3GTOJ 1HKTA 2HOAA 2M5WA 5GADJ 1J09A 4FX4A 1YQAA 3W3CA 4UVAA 4UV8A 5F0FA 2PG4A 1QA6A 3K4MA 2LR8A 3CC4I 2YX4A 4KT5C 2Z9OA 2WA0A 4PK4A 2JQ7A 2KRCA 2PEXA 2DFIA 4ZDOA 3PIOF 1ETYA 2A6TA 1R71A 1KQ8A 3WGHA 3BPXA 3EDPA 1JJ6C 3CC7I 4RAFA 2QM3A 2QWWA 3BR5A 2ID6A 2FJ1A 2WB1N 4GYGA 4WF2A 5E8GA 1R36A 4D0PA 2DLLA 3B73A 2DT6A 2JA8J 1R5GA 1L3LA 1Z7UA 1W5CC 2XAUA 3KZZA 3ZMDA 2QSHX 1RRJA 3M1CA 4WX9A 2NYXA 1ON2A 4G94A 5IP6A 2O7OA 4LG3A 5K5OA 2M7BA 3ZP5A 2DW4A 3GEZA 2LVSA 2DA1A 3S1MJ 1OQYA 3HOUJ 9ANTA 4NC8A 1WJAA 3BG9A 4G12A 4XL9A 5JI6A 2L54A 4PSWA 2GA2A 3MFKA 3DXJF 2CQXA 3LA3A 3L2VA 1H89C 4KN4X 2HVQA 1PVEA 1ETOA 5FKOA 3PIPF 2OZUA 3WTWC 3A0BC 2BEOA 4PGGA 4YIFA 2K9NA 3K2ZA 3QPTA 4M72A 3VOEA 3IRQA 2BY2A 2ZC2A 4Y7NJ 1X1PA 3CUQB 1M1EB 3G1MA 3Q3SA 2EFWA 3S32A 3HTUA 1IN4A 4H4KC 1JHHA 2B7EA 2LY9A 3O6BB 3CDIA 2W82A 1R6RA 2JK3A 3WHBA 1K83J 4EM0B 1FT9A 3IWFA 4A6EA 4E7JA 3JRFA 4BXFA 2VASA 4FX0A 2X1DA 4IZZA 4JX4A 3F9KA 4UV9A 1TLHB 1KU2A 5GP9A 1OISA 2OD5A 1LFUP 2DK8A 2F2EA 2F4OB 4OOIA 4IX7A 2CUZA 1F1ZA 1Q1HA 4EJWA 2V9VA 3PNVA 3F21A 2COBA 3JAMK 3T0YA 3SXYA 1ZH5A 4ENNA 1TW2A 4RM2A 2FBKA 1B59A 4N9IA 2KFDA 3R61A 5IT3A 2P4WA 3JTHA 1WRJA 4XICA 2HDDA 1R1VA 5IP7J 3Q9SA 2EILH 3JRIA 1Y6IA 4HZFA 3KYCB 2WAQN 1H88C 3FK6A 2FX0A 1V3FA 4LK1F 3G2BA 1Q1VA 1T0FC 2XV4S 4HX7A 3W2VA 2VQCA 4S04A 3DBLB 4HAMA 4M73A 4XRMA 2P0WA 3T8TA 3JRAA 3CMMA 1G3TA 1ZG1A 4CSWA 5ILUA 5H6QA 3W6KB 2DA7A 3CJRB 2EZKA 3CDLA 2QBYB 2RQPA 3IAM2 1IO2A 4I02A 3DCFA 1TC3C 5BPDA 3R6SA 1PJRA 3CJNA 4IL6C 1TT5B 4DNCA 2HXOA 4J19A 3CMEI 5C4JJ 2XDVA 2L9NA 1FMVA 1E3HA 1JT0A 2LP0A 1T56A 3ZGKA 2H09A 2LKPA 3HHGA 4BDZA 4F52A 2QA4I 2DA6A 1Y0UA 2BXZA 1WVRA 3B6CA 3BJAA 1W36D 2LBFA 4E7HA 3KYLA 4L5EA 5B5EC 2V1XA 3SFIA 1KYWA 4DGWB 1JTYA 1X2MA 3CCSI 5EEGA 1YHQI 1BI0A 2IP2A 1OCPA 4HDUA 4I01A 3PM1A 1PUFB 3A01A 1LUJB 5GTHC 2IAIA 1IRZA 2DMTA 2DT7B 3BY6A 5BQTA 2QEXI 2Y48A 3EUHA 1MIJA 2DOFA 2ZNYA 2ZJPF 2L0KA 1GLNA 4Y4RA 3BQZA 1TQPA 2BXYA 1Z1DA 3HRSA 5TJJA 5J3LA 1KONA 4HF0A 2HGCA 1OPCA 4BHPA 2DODA 2M87A 1G8XA 3KP3A 2F5VA 3LA2A 2X0LA 4EM1A 2HU9A 4ZDLA 3ZQHA 4A93J 5E3NA 4BEHA 2GM4A 3K9TA 2H1LA 2G9WA 2BVLA 2VKVA 3HJEA 1GHCA 4RLQA 2ME0A 1SFXA 2E1MC 2Y0SA 2ZFWA 3HUGA 3TP0A 3K1NA 2Y75A 5HDKA 3OYDA 5KAFC 4FQGA 2E2HJ 4MEXF 5ICCA 2AS5F 2E5ZA 5DM7F 2EPFA 2K3PA 1G2HA 1MSEC 4W1UA 3S93A 2VJIA 2XPWA 1T8IA 1FP2A 2DFEA 2VQHA 1KZHA 3K4KA 3F0CA 2DQRA 2QUFA 2D1HA 4UUSA 3TL4X 3WTVC 1DP7P 4GO1A 4DYRA 2BW3A 2MW8A 2IA1A 2FU4A 5IYBJ 1D0YA 3BG3A 1FBQA 2V4JC 5JHUA 1AWCA 4BJTA 1LDKB 3GFLA 4R8HA 3VPRA 3GZNB 2DQLA 4HNVA 3K7AJ 4HV5A 2M8EA 2KPMA 3J7YJ 2G7HA 3D5RC 1IGNA 1UHSA 5F08A 3MCZA 5D8LB 4R79A 2L2OA 1XB4A 1KQ0A 1UELB 4U0YA 2MGQA 2CUFA 1KGSA 1YYVA 3AG4H 3VYSB 3HEFA 2IS2A 2IS4A 3ZXSA 3CCEI 2XKOA 2XRNA 3K10A 1IN5A 3RKQA 3ZN0A 1MJAA 2XVCA 4P96A 1RKWA 4BJ6C 4F92B 1JI8A 2BE5F 1HW5A 1VQ9I 4ZYDA 1JJ8C 4OU0A 1RUNA 3CCJI 2H8RA 3MMYB 1FTZA 1R00A 4EJVA 3FBIB 1WI9A 2V1DA 2XF7A 2BY1A 4RGUA 3HTSB 4CICA 1FIAA 4RAYA 1AKHB 3K70D 1Y0NA 3M9AA 1FC3A 1D8JA 3HPGA 1ON1A 3KCCA 1HDPA 3DLLF 4M9ZA 3REOA 5CYVA 3MN2A 2L7ZA 4N4OB 1SEUA 1BJAA 3Q0VA 1MSFC 4BY7J 3IP4B 3WU1B 4AWXB 1V4RA 4UY8I 1LDJA 2DYSH 5TGTA 1X1BA 1QZYA 1FWZA 1SD5A 3EUHC 1MNDA 1XGSA 2EA2A 2KL4A 5DM6F 3I64A 2QCOA 3FXOA 1RZ4A 4NBQA 1AA7A 3BCAA 3BR2A 2YSRA 5J8FA 3FM5A 5HDGA 1WHUA 2IEKA 3BG5A 1H8AC 1FY7A 1NHAA 3KP6A 4G6DA 2EWNA 3HIFA 2HYFA 2GIZA 2JT1A 3WTTC 4Q4ZF 4NNJA 4BUPA 3HPHA 4XLAA 3OYMA 1ZGJA 2JSPA 2PMZA 3OYBA 1WQ2A 2VKEA 4C30A 2ZJRF 2G7UA 4KA4A 4M71A 1R22A 1XN7A 2DOEA 4HX4A 4CCKA 2BZTA 4D7MA 2LC2A 3A2KA 2F48A 5FJ8J 3GMEA 5LHGA 2MH9A 1XMAA 2F5EA 1IXRC 1Z7LA 3MWMA 1YTYA 4JX6A 2NNYA 1ZR4A 1HC8A 1MMSA 3SDGA 3RKXA 2MC3A 4A0YA 4BBSJ 1POGA 2LY1A 3C1DA 2GOXB 3OIPA 3F22A 6PAXA 3GXOA 5DS9A 4IHVA 2V1NA 3K70C 3CUQA 2XROA 2R5ZB 4IPAA 3HKZA 1SD6A 5EEAA 1HKSA 1R4NB 2M7AA 3FHNA 3GTMJ 2VODA 4A5NA 2EINH 3GFJA 5J1UA 3HOWJ 4IOCF 2HOEA 2HPMA 4EV0A 4L9JA 2WADA 4LB5A 1WJDA 1A6IA 1YJ9I 2GXGA 3CCQI 4YFXF 1DP3A 2YS9A 2DA2A 2DYRH 3F6OA 4XLFA 1WGXA 1YX3A 2W1OA 3TO7A 1WFXA 4XORA 5IP9J 1I39A 5HLTA 1MKMA 1BBYA 4LB6B 2M45A 4S0HB 1GXQA 5DUIA 4FISA 3FMRA 3ML6A 1RESA 2HPIA 1KYZA 4D9JA 2XAFA 2QZ8A 2QKMB 1ITYA 3TOBA 1TWFJ 5LRSA 3S3MA 5DTDA 2Q8KA 3DPLC 5L3BA 3QOPA 1FSEA 2JA2A 1HW1A 2RVCA 3GWZA 4OAZA 1HBXG 5IT9K 1ZYRF 4G6QA 4U88A 1HOMA 3TGNA 2LG4A 3K6GA 2GLOA 2Y9ZA 4RS8A 3K69A 3GO5A 5FLXZ 2QBYA 1OYIA 2ELHA 4Y17A 1LJ9A 5LBQA 2LBFB 4ENJA 2IA0A 2B63J 4B3XA 3S1NJ 3L2WA 3ZQCA 5TISC 2KIQA 5IYCJ 2KRHA 2CMPA 2VBXA 2KHMA 3G3ZA 3BZCA 2HI3A 2XGCA 4RB2C 3WTXC 2XSJC 5J40A 2IGMA 3RQIA 2NVXJ 3A01B 1B6AA 4M6YA 1XSDA 1GV2A 2K86A 4GYIA 5LLQA 1O4XA 5DUKA 2O61A 5EYRA 3ERMA 2HDWA 3QU3A 2O8KA 1KA8A 2DFHA 3OYIA 2HQRA 2R4GA 2FMLA 3DF8A 4F7ZA 3LSJA 1D0ZA 1YFHA 3CTAA 5A2QK 4GFBA 4MO7A 4GCVA 3CF2A 1CGPA 1A04A 3ZOBA 4TV7A 4ABZA 3Q0WA 2PI0A 3GTGJ 1TNTA 1PUFA 2JTVA 3HZJA 2ZXWH 2RNJA 1T95A 4ZYAA 3G6EI 3RI4A 2K02A 4RBOA 1GXPA 1O3RA 2ME6A 3U9GA 3MD2A 2AQEA 3IL2A 2XKPA 3RKWA 2M9HA 3LMMA 3BG7A 3LSMA 3FXLA 1VQ7I 4B09A 2A05A 1R5HA 2CH0A 2EFQA 3F72A 2O6GE 3HUGB 3IKTA 2R7TA 1BI3A 2BVMA 1HSTA 4I09A 3LQRA 2EFNA 2XGXA 2HFHA 2M0CA 4BE2A 4V2GA 3H5AA 2WV0A 1A6QA 2HS5A 2Y30A 1YJNI 1ZK8A 4HF2A 3NEUA 3CUQC 3ABKH 3MKZA 3BOQA 4IXAA 1XX5A 2KLOA 4FASD 4UUSB 2P6SA 1JKOC 4F91B 4ESJA 2W84A 1E0EA 1GV5A 3KYDB 2RNGA 1RETA 1BA5A 3HOZJ 3HGGA 1MJ9A 1FBUA 3L09A 1B4AA 3NARA 1J2XA 2GQQA 4BH9A 1Y8QB 4P9FA 3EPZA 1WJCA 2ISYA 3KX2A 3TO6A 4Q47A 2VC0A 3EETA 1ZRFA 4HX8A 3FX3A 1RNLA 2DMPA 1A36A 2J5OA 2P5KA 1BC7C 5F0CA 1MDMB 3WODF 3RSNA 3AKZA 3S15J 4G7HF 2R7OA 2IRFG 2KISA 1U0JA 5J47A 1EH8A 1UG2A 3VSLA 2JN6A 4I76A 4XRSG 3TBIA 1VI0A 2LF7A 4G8XA 5ED4A 3C2GA 2ZFUA 4EJUA 2XPUA 1X3UA 1T2KA 1IN6A 3OS0A 4AU7A 2P8TA 3IAS2 3IH3A 3F8CA 3IC7A 2JSCA 4KYWA 4B48A 5CKTA 1V5GA 3TDZC 4PZJA 1FOXA 2TRTA 5FLXK 4IQ4A 1EF4A 2WB1A 4PDKA 3I4PA 2ID3A 2VT2A 2HOSA 3MEXA 1FIPA 2R7ZJ 4ZTFA 4BYYA 2ZSIB 3QRFF 2FRHA 4PCQA 4L9TA 4LK0F 2FOKA 2CJJA 1IZ1A 1DDNA 1ETWA 3PQJA 4XKBA 4YIIA 2DDBA 3L1PA 5ICFA 3JSPA 2O03A 1ZQ3P 2XC7A 3E6CC 2Z16A 1A31A 1XDUA 4IOAF 3GLXA 3BR3A 5B3SH 2BY0A 2F5FA 4ZJZA 1D1AA 1I1GA 1FNNA 3ZQGA 1SAXA 4LJZF 2TDXA 2BY3A 1AKHA 3R60A 3JSOA 3NWTA 3KPHA 3V7RA 3N97A 3IRRA 4ZYEA 2AXTC 1USTA 4WXDA 4MNUA 4HPQA 2R7DA 2DA3A 4DBQA 3U1KA 2HYGD 5H20A 5GPAA 4NC6A 1ZLJA 3OYAA 4CYDA 4KT6A 1G3SA 4WXHA 2KRFA 4JX5A 1P4AA 3S2HJ 1BW6A 2VT3A 2H27A 3SHFA 4IO9F 4N0BA 4ETSA 3TOAA 2F4MB 1OMIA 3IH4A 3VYTB 3MAJA 3CLOA 4U87A 2XAHA 1QRYA 2E5NA 1OR7A 3CJQB 3T8RA 4DJAA 5IOYA 5F0HA 1ZG3A 2E35A 3DEEA 1ONVA 3FDYA 3K4CA 4OWRB 4RAGA 2XB0X 5EZHA 4CCLA 2X6OA 1D5YA 2VJ5A 2R5YB 1J0RA 1I50J 1Z6TA 3COAC 3I53A 3PFYA 2CYYA 4X1EA 4IJAA 2QQ8A 4RGXA 4QPOA 5J1RA 1QHHD 1VQ6I 1XGNA 4B1RA 3VWBA 1WJEA 4RB1A 2HWVA 3PNTA 2PJRA 1BOAA 4EJTA 1RI7A 5IYDJ 4CZCA 2MD5A 2R7QA 3I3LA 2EFPA 4S05A 4C3HJ 4E70A 2H94A 3PO2J 2KJCA 4DW6A 2EIJH 2QQBA 3BTJA 4KIGA 5BMZA 3CCLI 1JE8A 2Q1ZB 4B3AA 1PYVA 3JTGA 3EYIA 1VQLI 2Y9YA 2FMYA 5JFRA 1V5FA 2AHQA 5GAGJ 5ERIA 2HQ5A 4ITVA 3MKWB 3O8GA 4Y33A 2MFZA 1IW7F 1KU7A 1TWHJ 4XKCA 2RKHA 4II2A 3HBLA 1I6HJ 1ZRDA 3ZMZA 2QGUA 3E6BA 5CVVA 2K5CA 2V6EA 5HNFA 1P4WA 3FKJA 5KAIC 3WGGA 3ABMH 1PDNC 3RZDJ 5ILSA 2R5ZA 3SJMA 2VBZA 4XOPA 2RREA 3J7AY 4BE1A 4KIBA 2VUMJ 3S8PA 1WCMJ 1XDSA 3T5XA 2K4BA 3I58A 2EH3A 4WWCA 1QQIA 2XUBA 1UZCA 2X1CA 2JZYA 4HA8A 4NQWB 1MH4A 1YO5C 1SVOA 4YFNF 4A3LJ 1TP4A 4CZZA 2ELJA 2BBYA 2CQKA 3HOVJ 2KDZA 1YITI 1XC5A 2MYSA 3M8FA 1V55H 3E6MA 3I71A 5M3MJ 1HW2A 3H0GJ 4RAZA 1IDYA 4BQOA 2JUCA 2KZVA 4XKVA 1HSJA 3E97A 1S7AA 2GA1A 2DTZA 2L7FP 1KU3A 4BQQA 3H9JA 4XIDA 1DU0A 2OC6A 2DN0A 3V4GA 4ZYHA 3HM5A 2ISZA 4Q5SF 3OIOA 4E6KG 3JRGA 2R7VA 4MQ9F 3OIQA 2F4IA 1ZREA 2E71A 1IUFA 2MG4A 3I4MJ 3U1DA 1EA3A 1MBJA 5M5XJ 2JA7J 1X1DA 4ZYGA 3BP8A 3PUBA 2KP6A 3FXRA 2L4MA 4LG0B 4AUXA 2MC4A 5JR3A 4C2MJ 2L9RA 1SMTA 3JW4A 1WZ2A 2CWEA 1IUYA 1FOWA 3H3VK 3ESWB 2STTA 1I1SA 2NVUB 1RR7A 4XRFA 3WU0A 1U78A 1F9NA 1N25A 4M3EA 1J5YA 4HRIA 5E8IA 2IGNA 4CXFA 3SZGA 3FISA 4Y13A 1OR7C 2L5QA 1GVJA 2OZ6A 2DA4A 2Z33A 4HQMA 3D5LA 2ESNA 1FOKA 2IGKA 3CO6C 1YJWI 1T38A 2G0EA 3RYPA 3I9V2 2XAQA 2O0YA 4RM3A 2NS0A 2ECBA 3OY9A 1YLFA 3CD6I 2DI3A 2EFOA 1J75A 5C4XJ 1ETXA 1FX7A 2QKLB 3RPUA 2EBIA 4HSTA 4H0EA 1OJLA 1OYWA 4U7BA 3LFKA 4M74A 2H6BA 1HLVA 3RPQA 1E3OC 1ZTRA 3E6DA 4GXOA 4RGSA 3OR2C 4L0ZB 1JXSA 4B44A 3DBHB 1T33A 1NG6A 2YUSA 2ZO4A 5K1YA 2DK5A 2KDOA 3HRMA 3QAHA 3SDBA 3DWLE 1FMWA 2WV1A 1XPXA 4Z6YA 3KZYA 5KHDA 1H9GA 3F8BA 4Y3OA 2OPTA 2V9KA 4P5OA 2GXAA 1JUMA 2WTEA 5EG0A 3ABTA 2CW8A 2E60A 5CVIA 1BN5A 3KP5A 2WC2A 1HF0A 3BR0A 2WBMA 1APLC 1BI2A 3HL2A 2F6CA 1QZEA 3Q5FA 3GTQJ 2K9SA 2W25A 3HB9A 3U21A 2IVMA 3KE2A 5IOZA 1Y1WJ 3QYBA 5EF6A 4C9YA 5ICGA 1K6OA 2A5WA 2FA5A 3LSGA 4A3CJ 2LNBA 2OF7A 4HF1A 3N05A 2ESHA 2R3SA 1ZKGA 4U0WA 2RN7A 2GZWA 1G6NA 5KVRA 1YRNB 1S6LA 3LA7A 4NUBA 4LFUA 4HSRA 4BBRJ 4A12A 2VJ4A 3JRCA 1J59A 1MDMA 3K2AA 3SEQA 5E79C 2VKDA 2I5UA 3HSFA 4FETA 4CO8A 4QIWN 1FPQA 3OYNA 1O3SA 2WAFA 1WJBA 4A3BJ 4M3FA 5M3FJ 2Z3YA 3HDDA 1K79A 4UB6C 4MGRA 1YIJI 3CDHA 2PQ8A 3TW7A 1K4SA 2IA2A 4E7SA 2CQ7A 1ZR2A 3CLQA 2P5LC 4AYBA 3MKYB 2Y0SN 1UB9A 3SZTA 3VB2A 2JA5J 1BM9A 4X0GA 1ZELA 2CSOA 2DT5A 2HXIA 3H9GA 3O8HA 1TWCJ 2FBHA 5F1JA 3H3ZA 3MKLA 4UXNA 5IT9Z 1R1UA 5LEJA 2X9DA 2K4JA 1TBXA 2A3SA 5FRNA 1K78B 3D1NI 2HNHA 3KEOA 2E7WA 4XLCA 1MBFA 3DPTA 3VDXA 3CMYA 1Z0XA 2XSDC 2ZCWA 4HV6A 4EMSA 3V8KA 2XAJA 3S2DJ 3HOSA 1XGMA 1DGRM 2EV0A 4N4NB 2RQQA 1DUXC 3DU5A 4BE0A 5D8KB 1OCOH 4OIOF 4MIMA 1VQKI 3ZQIA 5DEQA 1LEAA 2BHYA 4I7HA 2LRDA 2EV6A 1QBJA 2BHZA 4LIVA 2BOLA 4JYKA 3RQ4A 4I2OA 1MW7A 4ENMA 3E0JB 5J4VA 1WH7A 5AONA 3GBGA 3J81Z 3IV5A 4LITA 2OV7A 5A2QZ 1XMKA 1QU3A 1TTYA 2UV1A 1HCRA 2PJRB 5IPAA 4PJ0C 4HOBA 2ZMEB 4QTRA 2P81A 4QLCU 2WY8Q 3PFIA 1MJBA 2A6HF 3AG2H 2MD0A 1EH7A 2IS1A 2R5YA 2R93J 1AOYA 4KIFA 1I5ZA 1QNTA 4I0AA 1MD0A 2EJRA 3BPVA 4IEJA 1G3WA 3J80Z 3NRVA 4F3QA 1YIOA 1OFCX 5HS7A 1STZA 5BS6A 5D5WB 4R1HA 1EKEA 2PLYA 3UKGA 2DA5A 4BL0B 1B72A 3L2RA 3JREA 1TQIA 2LY2A 3F3XA 4C3IJ 2FEZA 5E3OA 3PSFA 2IT0A 3LAJA 3QQAA 1XSVA 5HDNA 3ECHA 1VTNC 3W6VA 4HBLA 4HW0A 2Y69H 5LHHA 4BU2A 1Y56A 2NVQJ 3LFUA 4CCJA 4MEYF 5E1WA 5FLMJ 3OYGA 1RC9A 1LVKA 2F5CA 3ZRGA 5GTIC 2NOGA 2ZXHA 1OCZH 2GOMA 2HZDA 1MH3A 2LREA 1JGSA 4A0XA 3KLNA 1OCCH 1MZBA 2D45A 2VB6A 1X4PA 3GLLA 2W24A 3JRDA 1S8NA 1SC7A 2PMUA 3P5JA 4YIRX 4I6ZA 4NC7A 2M4KA 1TWAJ 2MH2A 3HYIA 4NQWA 3LL7A 3OS2A 5AIPA 3TKYA 1VQNI 3CF5F 3FXJA 2FXAA 1QHGA 1TZLA 5ILVA 4KFCA 3OL4A 2ZJQF 4ZZLA 4A3EJ 4G7ZF 5JLWA 5F27A 2COMA 4B47A 5E1ZB 1DQUA 2RC4A 3UNGC 4M3GA 4XLNF 2E36A 1DPUA 1R49A 3ZPLA 1LVAA 2LTPA 3EUAA 3OSFA 3GFIA 4UHTA 5FLVA 3AG1H 3TP3A 3HOYJ 3C2HA 1VQPI 3Q9VA 2ADUA 3HRUA 1H9TA 4IKFA 4UB8C 2LD5A 2XB5A 5HNHA 3L7WA 2WAEA 1N75A 3RJPA 2M0MA 4U7DA 3DV8A 4KICA 1FEXA 3WHCA 1FSHA 1L0OC 4LG0A 3DQVC 4NDLA 4BJ5C 2JPCA 2VJJA 3HHHA 3ONQA 2ZJ2A 3GFMA 1LE8B 1XTAA 4F55A 2R92J 1Z9CA 1N77A 4AD9A 1U5TB 4LLGF 1KQ9A 1ZN2A 4ZC3A 3S1RJ 2Q0OA 3J81K 3QPHA 4M3DA 1TW3A 5E17F 3E5QA 2YR2A 1ZGWA 5C3EJ 2PMHA 4KDPA 5IY5H 4AM3A 3P9IA 1FTTA 1MNEA 1G59A 5K7HA 3AFHA 4A3MJ 3BQYA 4L0YB 1NG7A 3G1OA 4JBAA 5D6FA 4CCNA 1S5LC 2QQAA 3O3KA 3AG3H 2Z5UA 2ZBKA 5DCMA 1MNMC 1AU7A 1FJLA 4V2FA 4C2TA 2IW5A 1QO0D 2JRTA 4XLEA 3H5RA 3J80K 1ETQA 1X1CA 3LSRA 2E2JJ 4XONA 2OAZA 1RUOA 1TWGJ 1P7IA 3L9FA 3LWFA 5EG0B 3K1PA 2QSFX 3H5NA 1ETVA 2CUJA 2UXNA 2CQNA 1IN8A 2EZLA 3DKYA 4BHCA 2L01A 4FHTA 2Y31A 1Z05A 3ZN1A 2L7MP 3ZQFA 4JK1X 1X58A 2M1BA 2LF8A 4U0VA 1HQCA 1QVTA 1BR2A 4KNYA 3BZ6A 4L5IA 3LSKA 1JTXA 3H1CA 1UG0A 4MFDA 5L3GA 5HOOA 4II3A 1N78A 2IXSA 3GUDA 4RB0A 4O6JA 2O5RA 3DPUA 1FYKA 3HOTA 3VSKA 5D5UB 5LGUA 1SD7A 2QYOA 2XRLA 1E17A 1E2XA 4AIDA 1EJ9A 1OYYA 2QENA 4AC0A 4BKXA 1SD4A 4Z2YA 2X48A 1JHFA 4I98B 1TNSA 3RTRA 2VQLA 4EM2A 2HOTA 4QWQA 2GXBA 2X6WA 2M34A 4AVZA 4N9HA 4KUMA 3B6AA 1IG7A 2XF6A 4XRSA 2O9LA 2UUZA 2LKSA 3GTLJ 3D5SC 1IV6A 5CJ9A 1YRNA 1IRFA 1Y39A 2GAUA 5K7FA 2PBIA 4XMYA 1WJFA 1J7KA 1MBEA 4PJNA 3LNQA 4CA0A 2HDCA 4P55A 1OKRA 2EA4A 5CPRB 1MGTA 2FQ4A 2O8XA 3K0LA 1VQ5I 3M8EA 2DJIA 2LK2A 1FZPB 3A03A 1IN7A 2KJBA 4D7NA 2NOJB 3OYEA 5KCMA 2E1OA 1OCTC 4IHWA 4CYCB 1RR8C 1P7JA 1WI3A 5D5XB 4JQFA 1IXCA 1K4TA 4IHXA 2K9QA 3RZOJ 4XSZF 1B9NA 2Q2EB 3BCBA 2RV8A 4GDFA 1HA8A 2ZSHB 3V7SA 1LPQA 3S14J 3E5XA 2DJNA 3E1SA 3CP8A 3HSRA 4E7ZA 1B8IB 3BLYA 1ZHFA 4XKWA 2PJPA 2KIFA 1X19A 2FNAA 4IRHA 3ISPA 2A6EF 3FIWA 1FYMA 1R1TA 4XOTA 3BJOA 1G4DA 1EV7A 3CP2A 4DIQA 4WK8F 1WSUA 3I59A 5BOXA 3WTYC 1K78A 2CV2A 2NRAC 3MZYA 1VNDA 1Z67A 5F04A 1LB2A 1P4XA 3C18A 4PJJA 2OQRA 4M9SA 5L3DA 2X1EA 4I99C 4XR6A 3HG9A 2F5DA 4RGRA 1YS6A 3A02A 1BL0A 3J7AO 3DTKA 2HVRA 3KFWX 4GGGA 1YG2A 5B66C 4OAYA 5F64A 1U9NA 4L5JA 2WWYA 4UUTA 3ZMUA 2J5PA 2OBPA 3K4JA 4BHBA 4ZTJA 3MVPA 1TL8A 4CUGA 3F23A 1FYLA 1D1BA 1MBHA 1U2WA 4P9UA 5D5VB 4A3IJ 3R0JA 3QODA 1Y1VJ 5E1XA 4AIJA 3NQOA 2N8GA 1R58A 4DQ2A 1IF1A 4IHSA 2E7XA 1W7PB 1SMYF 2LSOA 3H35A 1F36A 4CGZA 2NNNA 2OTJI 2FE3A 4IRGA 3WG9A 4WCGA 1XCBA 4OIRF 3BT9A 2ZMEA 1D1CA 4PJLA 2LMDA 3P7NA 4IHYA 1S29A 4KMUX 3CCVI 1B72B 3DKWA 1W1WE 4ZZDA 1SFOJ 3WG7H 3GYHX 3P9KA 1LFBA 2X85A 2B0LA 2UXXA 2WAQA 1GUUA 4J00A 4UUVA 5K5QA 2W00A 4BXXJ 3ABLH 3SYTA 3VYRB 5CVJA 4E7IA 3MZHA 2OCEA 2P7VB 3FK7A 3M8JA 2KIMA 3L2CA 1IRXA 2ZKZA 1IJWC 4Y52J 2VPLA 2ZNZA 3JRHA 2JPBA 3GCMA 2DCEA 1U8RA 2MBFA 1NTCA 2CS3A 2A61A 2FBIA 3PO3J 4A3GJ 5L3CA 5D4SA 2YU3A 2VL8A 2XF5A 1W4MA 3CESA 1Z21A 4M9XA 5H2FC 4FE7A 1RIOH 2OQGA 2DPUA 1A5JA 4BDYA 2X51A 3NWSA 5H6RA 4OMZA 4PFOA 1YI2I 1P2FA 2C6YA 4DZPA 2MABA 2MSYA 5K5RA 1Z91A 4IF4A 2KIUA 4M6VA 3OS1A 2JA6J 1ZARA 3DFGA 3OR1C 4UVBA 1VQ8I 2XGDA 2DMUA 3KLOA 3TO9A 2M8GX 5E20A 2LOOA 4ON0A 3GZ6A 2CRGA 3FM3A 1D0XA 3A4CA 3TW6A 2ETHA 4UNOA 2BGCA 4DZJA 1OLTA 3IWZA 5FKKA 3BTCA 3CQZJ 2X6YA 1O3QA 2GIVA 4HG2A 2V7FA 4OMYA 2E1CA 3A0HC 1T6SA 3BWGA 5GAHJ 4RDUA 1EH6A 4CCMA 5CQEA 5CVUA 3KIOA 1TQMA 3QWLA 2VBYA 4EJOA 3FXUA 1UCRA 1W5TA 5DCFA 3OYCA 4YFKF 5KK1A 5F1RA 1BR1A 2D2WA 4I0BA 4FCYA 1UAAA 1YW8A 4PFPA 1X1AA 1ERDA 2OU2A 4HQEA 1IXSB 2O3FA 2CU7A 2E2IJ 2JJ7A 1BJZA 1VQOI 2NVYJ 4A3DJ 3AL0B 5LGNA 1JKPC 2OA4A 4A0ZA 5ICEA 3VEPA 4PUSA 2FD5A 3O2PE 3AAFA 1I6XA 3I5UA 1HDDC 2STWA 4UVCA 5FFXA 3QYFA 5EZGA 2QSGX 3PQKA 2OTLI 2ACJA 1CF7B 3GF2A 2DTRA 2ELKA 2ICWG 4EEFG 2R7RA 4BNCA 2JVHA 3GW2A 3CCMI 4YRVA 5E3LA 4OIQF 3OOUA 1F5TA 2HVSA 1LE8A 3JR9A 1C0WA 2YPRA 1U5TA 5EGOA 3W2AA 2OUMA 3I55I 5DCMB 4Q48A 2KZGA 2AQFA 2ZB9A 4G6TB 3G4SI 3RCOA 2IS6A 3IH2A 3RYRA 4ZDPA 2ZMEC 1BI1A 1QPMA 3QOEA 4AIKA 2VE8A 3FKIJ 4NHJA 2RAEA 2EK5A 2R7WA 2VXDA 4MQVA 2VOPA 2W48A 1YOVB 1R5ID 4JOMA 2B9SA 3TMOA 4CCOA 1LQ1A 4EQQA 3H0DA 2XIGA 5FROA 3TDUC 1O7FA 2XAGA 3H36A 2K9MA 5FKLA 3BR6A 1WKMA 1BOBA 5CQGA 3WU2C 1U8BA 4O5VA 3D0SA 2M2EA 2YX7A 1JUPA 2L9VA 3V7CA 3KEQA 5JHFA 1P6RA 1XGOA 5CVRA 2X6XA 1BW5A 3C3WA 4HNTA 2CFXA 3IKVA 2CO5A 4HLYA 1LDDA 2XGEA 4DYCA 1S3JA 3DTEA 1SFUA 2IBDA 2HEOA 2IJLA 3OOPA 1IRGA 2JRMA 2VQGA 3I0TA 5GAEJ 1W0TA 3KP2A 1KU9A 2HKOA 4BACA 4XNFA 4E7LA 4B8XA 4D5FA 5FKNA 3CUOA 3DEUA 2CG4A 2HQAA 3M1EA 4RA2A 5LEKA 3S2WA 3ZMSA 3RPUD 2HTSA 1XCVA 3MZ8A 4A3FJ 2VI6A 3H3UA 3ZR8X 3DKXA 5DD4A 2Z2SB 4K2EA 2BYVE 3UR3C 5FO5A 3V8LA 5BPIA 4B4CA 5LFAA 2FF4A 2JMWA 2HR3A 4BQAA 2UWMA 1W36C 2IGOA 3KZIC 3OMYA 4W97A 4XBFA 4XM3A 4LIUA 5EEHA 2XPVA 5HS9A 4QSHA 5LHIA 5LGTA 3HC7A 3V8JA 2PX9A 4NB5A 3S3OA 3FBNB 3T1BA 2DAOA 1O57A 3M3YJ 1MBKA 3JRBA 3OSGA 3W2WA 5CLSA 2CUEA 2CW7A 1B9MA 2DMNA 3HGYA 4HNUA 1XG1A 2CFOA 3EUKL 2EV5A 4D5CA 1F4KA 4CHUA 3I4NJ 5J6XA 2DBBA 2HYJA 2CV0A 1NK2P 4CYCA 1A35A 2MLGA 3RDIA 1ACIA 2DO7A 3S16J 3QPLA 3W6JB 2MA3A 3C7JA 3I59B 3ZMTA 3KP4A 2Q2EA 1SFKA 2V79A 4PSXA 2L9SA 3LSPA 1IC8A 5HLGA 2VE9A 3ERED 2CQQA
chains in the Genus database with same CATH topology
1UJ8A 2BZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UJ8 A;  2BZT A; 
#chains in the Genus database with same CATH topology
 1WJ5 A;  2LLK A;  3R0A A;  4M3B A;  1YE9 A;  2V9P A;  1B8I A;  2NAZ A;  4D1Q A;  1BR4 A;  4LD5 A;  5JVG F;  1SAN A;  4EVI A;  2H1K A;  1O7L A;  2DU9 A;  1U5T C;  3FHZ A;  1ENH A;  1PUE E;  1LKX A;  1D3Y A;  1SFE A;  3CO7 C;  1D8K A;  4DBR A;  4PJM A;  5F6F A;  4J01 A;  3BC8 A;  2KQR A;  5JVT A;  4KIT B;  5HLI A;  4BS9 A;  2E34 A;  3WTU C;  5DV5 A;  3L2Q A;  3OL3 A;  3FXQ A;  3LSH A;  3H92 A;  1T98 A;  1Z6R A;  2W4S A;  2P5V A;  2K40 A;  3QP6 A;  2PN6 A;  5D4R A;  4LLN A;  4A5M A;  2H6C A;  3RKY A;  1O3T A;  1UFM A;  4KJZ A;  1IV8 A;  3OYH A;  2NS8 A;  3QPS A;  3OYF A;  2GWR A;  3A1Y A;  4KIS A;  3ZQ7 A;  1GDT A;  3V42 A;  4YEJ A;  5TRD A;  1ZRC A;  1ZLK A;  1S7E A;  3TED A;  1PP7 U;  3Q0U A;  2DOA A;  1K6Y A;  4AYB N;  3F8F A;  2OJE D;  1HKQ A;  4BAY A;  2VON A;  5M5W J;  3DP7 A;  4AIH A;  1USS A;  2XHK A;  1V5E A;  2HQN A;  2K27 A;  2A5Y B;  1W7P A;  3GZ5 A;  5HLH A;  3FXK A;  5J8C A;  2K7L A;  3FMQ A;  1MMA A;  2CGP A;  1U3E M;  3DU6 A;  3LAP A;  4E4H A;  3CJT B;  4LMY A;  4DOZ A;  2P7C B;  3OYK A;  1E3P A;  5EJC A;  1ZGA A;  2LH9 A;  3GX4 X;  3S17 J;  3GVA A;  2FQ3 A;  1T08 B;  3ELK A;  3E3V A;  2EIK H;  1DU6 A;  3BRO A;  5FD6 A;  2W85 A;  4YG2 F;  4BGD A;  4CDG A;  2AXL A;  2E1M B;  2CV1 A;  4ESB A;  4FTH A;  4KN7 X;  5HVQ C;  4X6A J;  1MBG A;  1QZZ A;  3EYY A;  5HS8 A;  3NAU A;  3KET A;  3CC2 I;  4E7K A;  4C3J J;  1BIB A;  2LYC A;  1IAW A;  5FB2 A;  1VZ0 A;  1I3Q J;  3K4L A;  4IHT A;  1IDZ A;  1FBS A;  1WPK A;  2JVG A;  1JT6 A;  3WE2 A;  3F8N A;  3ECO A;  4M6X A;  4XLP F;  1XS9 A;  3OWT A;  4LOC A;  3WE3 A;  4C2U A;  2Y2Z A;  3SEZ A;  3CZ6 A;  3BDD A;  1AHD P;  4OIN F;  2VXZ A;  2QLZ A;  5DD8 A;  5K7Z A;  5M5Y J;  5HOD A;  2FSW A;  1Z77 A;  3H9Q A;  1W7P D;  3PUF A;  4MTE A;  2AO9 A;  3ZMV A;  3RIR A;  2Z1D A;  3WGI A;  2TCT A;  1R23 A;  2PMZ N;  1P92 A;  3MQ0 A;  3OYL A;  3HOX J;  1MMG A;  2R7U A;  2VN2 A;  4A2U A;  5C44 J;  2EIM H;  3LSI A;  4WXC A;  5DYM A;  2JUG A;  4MFE A;  3KP7 A;  2A69 F;  2E19 A;  1ORK A;  5FKM A;  5J4Y A;  1T39 A;  5B1B H;  3K1M A;  1BIA A;  3N4M A;  1D5V A;  2QQ9 A;  4HDV A;  5FFZ A;  3TQN A;  1QPI A;  1QVU A;  4ZH4 F;  2ZXJ A;  2VIX A;  4RLF A;  3LQQ A;  3CCY A;  4B43 A;  1RKT A;  4O3M A;  1YX5 A;  3E7L A;  1X2N A;  1VFC A;  3FXM A;  1UHW A;  3QYE A;  4PGH A;  1DGW Y;  1ULY A;  4LGW A;  4CH7 A;  2A07 F;  3ASN H;  2M30 A;  1UHM A;  1SVM A;  1U6G A;  1SVL A;  1NK3 P;  5FRM A;  4RMN A;  3VFZ A;  4MLO A;  4KMF A;  3HKZ N;  5FGM A;  4GRI A;  4ANJ A;  2H8W A;  3VYU B;  4LLL A;  1S72 I;  2VBW A;  1NH3 A;  3HRT A;  4YEL A;  1P9Q C;  5J1Y A;  1R7J A;  4XQF A;  2UZK A;  2LDU A;  2FOW A;  3M07 A;  5B1A H;  1H0M A;  2R7S A;  1LNW A;  2LFB A;  3U2R A;  3BTI A;  4XLH A;  3GTK J;  2VC1 A;  3WTZ A;  5D6E A;  3GTJ J;  3WTS C;  1JUS A;  1Y8R B;  3K4N A;  5EGO B;  1ETK A;  2EZI A;  1F43 A;  2V6C A;  4EGZ A;  5BNG A;  1PP8 F;  3GTP J;  5DDG A;  2HTJ A;  2DMQ A;  3BR1 A;  1DPR A;  3FZV A;  4MTD A;  2RGV A;  3ASO H;  1CF7 A;  1FLI A;  2IPQ X;  3I54 A;  1FP1 D;  2ZXI A;  2A68 F;  4HLX A;  5LD2 C;  1W5S A;  4EGY A;  2V26 A;  1RPW A;  1I3A A;  3QP5 A;  3P9C A;  4G9Y A;  3BTL A;  2L02 A;  3DBR B;  2D5V A;  1WH5 A;  2D1V A;  2DFF A;  3PSI A;  3VOD A;  5E3M A;  1REP C;  2K3F A;  4BQN A;  2VPR A;  2QVO A;  1S7O A;  1I27 A;  2Z99 A;  4ASN A;  3F6V A;  3KEY A;  3LST A;  1LEB A;  4BXU A;  5E18 F;  1X4O A;  1VQ4 I;  2M4G A;  3E5U A;  1G3Y A;  3CMA I;  2E1N A;  4A6D A;  4XN3 A;  3DTI A;  1LFP A;  1K61 A;  1V54 H;  3K4B A;  1ODD A;  4XK4 A;  3FF5 A;  4BEH B;  1BC8 C;  1B1B A;  1K7A A;  1SAU A;  1R4M B;  1R9T J;  4HYE A;  3SZP A;  2KT0 A;  3G71 I;  3ABU A;  3I56 I;  4IVN A;  2V1U A;  3CCU I;  3S1Q J;  3OYJ A;  3EQL F;  2W7N A;  3L2U A;  4RB3 C;  3DEW A;  3FMS A;  4P1W A;  2L4A A;  1VF9 A;  1JKQ C;  1JGG A;  4XSX F;  4HEA 2;  2GBY A;  3PJR A;  2EQR A;  2P6T A;  3ZCO A;  5GPC A;  2CW0 F;  1YW7 A;  1GVD A;  4FE4 A;  3JCU C;  1Z3Y A;  1ZG5 A;  2BV6 A;  4QPQ A;  1MMD A;  1QGP A;  2BW3 B;  1UMQ A;  4G7O F;  2R0Q C;  2I10 A;  1VQM I;  4Y15 A;  3SQN A;  3ROU A;  2QF7 A;  5L3F A;  2HKX A;  3BJ6 A;  1YW9 A;  2KMU A;  3SFZ A;  3HSE A;  2FNP A;  4IQJ A;  1WWX A;  2DDA A;  3BG6 A;  5L3E A;  4JP0 A;  4MHG A;  3G73 A;  2L3D A;  5EDN A;  2NVT J;  1MMN A;  5FD5 A;  2R7F A;  3M4O J;  1YS7 A;  2K85 A;  4FT8 A;  3FWE A;  3HXL A;  2L7K A;  4ENK A;  2WY7 Q;  2K9L A;  4DYQ A;  2EB7 A;  1TT0 A;  1U9O A;  3BZK A;  3B02 A;  4IRI A;  2NXN B;  3JAM Z;  3ZQQ A;  2Y0M A;  4A3J J;  2VOO A;  2DPD A;  2I8D A;  2VKH A;  2XAS A;  3S3N A;  4L18 B;  3R4K A;  3DLA A;  2DXI A;  2NS7 A;  5JLX A;  4EAT A;  2R7X A;  3IUO A;  4BY1 J;  5LRR A;  1UJ8 A;  1FOY A;  5KNL A;  4ESF A;  3L00 A;  1HXD A;  3AL0 C;  1T0F A;  2HZT A;  2OCC H;  2X4H A;  3C2B A;  3J7Z I;  3IHU A;  1S9H A;  3F8M A;  1XD7 A;  3LOC A;  4XN0 A;  2ECC A;  3X2Q H;  1GT0 C;  2M3A A;  1OCR H;  4A3K J;  1JKR C;  3ULQ B;  2JWT A;  3G1L A;  2PFB A;  3ZQL A;  1X3W B;  1XSX A;  2RDP A;  5AIQ A;  4OIP F;  4L9N A;  1CQT A;  2VLA A;  2LKX A;  4L9V A;  1X3Z B;  3PL8 A;  4F93 B;  1Z3X A;  2EZH A;  2MLK A;  3M7G A;  3PNY A;  4A69 C;  1XMX A;  2KKO A;  1ZAO A;  4AVP A;  3OV8 A;  1W0U A;  2YU9 J;  3CCR I;  2W57 A;  3QU6 A;  4V19 K;  1J9I A;  2FUG 2;  3GTO J;  1HKT A;  2HOA A;  2M5W A;  5GAD J;  1J09 A;  4FX4 A;  1YQA A;  3W3C A;  4UVA A;  4UV8 A;  5F0F A;  2PG4 A;  1QA6 A;  3K4M A;  2LR8 A;  3CC4 I;  2YX4 A;  4KT5 C;  2Z9O A;  2WA0 A;  4PK4 A;  2JQ7 A;  2KRC A;  2PEX A;  2DFI A;  4ZDO A;  3PIO F;  1ETY A;  2A6T A;  1R71 A;  1KQ8 A;  3WGH A;  3BPX A;  3EDP A;  1JJ6 C;  3CC7 I;  4RAF A;  2QM3 A;  2QWW A;  3BR5 A;  2ID6 A;  2FJ1 A;  2WB1 N;  4GYG A;  4WF2 A;  5E8G A;  1R36 A;  4D0P A;  2DLL A;  3B73 A;  2DT6 A;  2JA8 J;  1R5G A;  1L3L A;  1Z7U A;  1W5C C;  2XAU A;  3KZZ A;  3ZMD A;  2QSH X;  1RRJ A;  3M1C A;  4WX9 A;  2NYX A;  1ON2 A;  4G94 A;  5IP6 A;  2O7O A;  4LG3 A;  5K5O A;  2M7B A;  3ZP5 A;  2DW4 A;  3GEZ A;  2LVS A;  2DA1 A;  3S1M J;  1OQY A;  3HOU J;  9ANT A;  4NC8 A;  1WJA A;  3BG9 A;  4G12 A;  4XL9 A;  5JI6 A;  2L54 A;  4PSW A;  2GA2 A;  3MFK A;  3DXJ F;  2CQX A;  3LA3 A;  3L2V A;  1H89 C;  4KN4 X;  2HVQ A;  1PVE A;  1ETO A;  5FKO A;  3PIP F;  2OZU A;  3WTW C;  3A0B C;  2BEO A;  4PGG A;  4YIF A;  2K9N A;  3K2Z A;  3QPT A;  4M72 A;  3VOE A;  3IRQ A;  2BY2 A;  2ZC2 A;  4Y7N J;  1X1P A;  3CUQ B;  1M1E B;  3G1M A;  3Q3S A;  2EFW A;  3S32 A;  3HTU A;  1IN4 A;  4H4K C;  1JHH A;  2B7E A;  2LY9 A;  3O6B B;  3CDI A;  2W82 A;  1R6R A;  2JK3 A;  3WHB A;  1K83 J;  4EM0 B;  1FT9 A;  3IWF A;  4A6E A;  4E7J A;  3JRF A;  4BXF A;  2VAS A;  4FX0 A;  2X1D A;  4IZZ A;  4JX4 A;  3F9K A;  4UV9 A;  1TLH B;  1KU2 A;  5GP9 A;  1OIS A;  2OD5 A;  1LFU P;  2DK8 A;  2F2E A;  2F4O B;  4OOI A;  4IX7 A;  2CUZ A;  1F1Z A;  1Q1H A;  4EJW A;  2V9V A;  3PNV A;  3F21 A;  2COB A;  3JAM K;  3T0Y A;  3SXY A;  1ZH5 A;  4ENN A;  1TW2 A;  4RM2 A;  2FBK A;  1B59 A;  4N9I A;  2KFD A;  3R61 A;  5IT3 A;  2P4W A;  3JTH A;  1WRJ A;  4XIC A;  2HDD A;  1R1V A;  5IP7 J;  3Q9S A;  2EIL H;  3JRI A;  1Y6I A;  4HZF A;  3KYC B;  2WAQ N;  1H88 C;  3FK6 A;  2FX0 A;  1V3F A;  4LK1 F;  3G2B A;  1Q1V A;  1T0F C;  2XV4 S;  4HX7 A;  3W2V A;  2VQC A;  4S04 A;  3DBL B;  4HAM A;  4M73 A;  4XRM A;  2P0W A;  3T8T A;  3JRA A;  3CMM A;  1G3T A;  1ZG1 A;  4CSW A;  5ILU A;  5H6Q A;  3W6K B;  2DA7 A;  3CJR B;  2EZK A;  3CDL A;  2QBY B;  2RQP A;  3IAM 2;  1IO2 A;  4I02 A;  3DCF A;  1TC3 C;  5BPD A;  3R6S A;  1PJR A;  3CJN A;  4IL6 C;  1TT5 B;  4DNC A;  2HXO A;  4J19 A;  3CME I;  5C4J J;  2XDV A;  2L9N A;  1FMV A;  1E3H A;  1JT0 A;  2LP0 A;  1T56 A;  3ZGK A;  2H09 A;  2LKP A;  3HHG A;  4BDZ A;  4F52 A;  2QA4 I;  2DA6 A;  1Y0U A;  2BXZ A;  1WVR A;  3B6C A;  3BJA A;  1W36 D;  2LBF A;  4E7H A;  3KYL A;  4L5E A;  5B5E C;  2V1X A;  3SFI A;  1KYW A;  4DGW B;  1JTY A;  1X2M A;  3CCS I;  5EEG A;  1YHQ I;  1BI0 A;  2IP2 A;  1OCP A;  4HDU A;  4I01 A;  3PM1 A;  1PUF B;  3A01 A;  1LUJ B;  5GTH C;  2IAI A;  1IRZ A;  2DMT A;  2DT7 B;  3BY6 A;  5BQT A;  2QEX I;  2Y48 A;  3EUH A;  1MIJ A;  2DOF A;  2ZNY A;  2ZJP F;  2L0K A;  1GLN A;  4Y4R A;  3BQZ A;  1TQP A;  2BXY A;  1Z1D A;  3HRS A;  5TJJ A;  5J3L A;  1KON A;  4HF0 A;  2HGC A;  1OPC A;  4BHP A;  2DOD A;  2M87 A;  1G8X A;  3KP3 A;  2F5V A;  3LA2 A;  2X0L A;  4EM1 A;  2HU9 A;  4ZDL A;  3ZQH A;  4A93 J;  5E3N A;  4BEH A;  2GM4 A;  3K9T A;  2H1L A;  2G9W A;  2BVL A;  2VKV A;  3HJE A;  1GHC A;  4RLQ A;  2ME0 A;  1SFX A;  2E1M C;  2Y0S A;  2ZFW A;  3HUG A;  3TP0 A;  3K1N A;  2Y75 A;  5HDK A;  3OYD A;  5KAF C;  4FQG A;  2E2H J;  4MEX F;  5ICC A;  2AS5 F;  2E5Z A;  5DM7 F;  2EPF A;  2K3P A;  1G2H A;  1MSE C;  4W1U A;  3S93 A;  2VJI A;  2XPW A;  1T8I A;  1FP2 A;  2DFE A;  2VQH A;  1KZH A;  3K4K A;  3F0C A;  2DQR A;  2QUF A;  2D1H A;  4UUS A;  3TL4 X;  3WTV C;  1DP7 P;  4GO1 A;  4DYR A;  2BW3 A;  2MW8 A;  2IA1 A;  2FU4 A;  5IYB J;  1D0Y A;  3BG3 A;  1FBQ A;  2V4J C;  5JHU A;  1AWC A;  4BJT A;  1LDK B;  3GFL A;  4R8H A;  3VPR A;  3GZN B;  2DQL A;  4HNV A;  3K7A J;  4HV5 A;  2M8E A;  2KPM A;  3J7Y J;  2G7H A;  3D5R C;  1IGN A;  1UHS A;  5F08 A;  3MCZ A;  5D8L B;  4R79 A;  2L2O A;  1XB4 A;  1KQ0 A;  1UEL B;  4U0Y A;  2MGQ A;  2CUF A;  1KGS A;  1YYV A;  3AG4 H;  3VYS B;  3HEF A;  2IS2 A;  2IS4 A;  3ZXS A;  3CCE I;  2XKO A;  2XRN A;  3K10 A;  1IN5 A;  3RKQ A;  3ZN0 A;  1MJA A;  2XVC A;  4P96 A;  1RKW A;  4BJ6 C;  4F92 B;  1JI8 A;  2BE5 F;  1HW5 A;  1VQ9 I;  4ZYD A;  1JJ8 C;  4OU0 A;  1RUN A;  3CCJ I;  2H8R A;  3MMY B;  1FTZ A;  1R00 A;  4EJV A;  3FBI B;  1WI9 A;  2V1D A;  2XF7 A;  2BY1 A;  4RGU A;  3HTS B;  4CIC A;  1FIA A;  4RAY A;  1AKH B;  3K70 D;  1Y0N A;  3M9A A;  1FC3 A;  1D8J A;  3HPG A;  1ON1 A;  3KCC A;  1HDP A;  3DLL F;  4M9Z A;  3REO A;  5CYV A;  3MN2 A;  2L7Z A;  4N4O B;  1SEU A;  1BJA A;  3Q0V A;  1MSF C;  4BY7 J;  3IP4 B;  3WU1 B;  4AWX B;  1V4R A;  4UY8 I;  1LDJ A;  2DYS H;  5TGT A;  1X1B A;  1QZY A;  1FWZ A;  1SD5 A;  3EUH C;  1MND A;  1XGS A;  2EA2 A;  2KL4 A;  5DM6 F;  3I64 A;  2QCO A;  3FXO A;  1RZ4 A;  4NBQ A;  1AA7 A;  3BCA A;  3BR2 A;  2YSR A;  5J8F A;  3FM5 A;  5HDG A;  1WHU A;  2IEK A;  3BG5 A;  1H8A C;  1FY7 A;  1NHA A;  3KP6 A;  4G6D A;  2EWN A;  3HIF A;  2HYF A;  2GIZ A;  2JT1 A;  3WTT C;  4Q4Z F;  4NNJ A;  4BUP A;  3HPH A;  4XLA A;  3OYM A;  1ZGJ A;  2JSP A;  2PMZ A;  3OYB A;  1WQ2 A;  2VKE A;  4C30 A;  2ZJR F;  2G7U A;  4KA4 A;  4M71 A;  1R22 A;  1XN7 A;  2DOE A;  4HX4 A;  4CCK A;  2BZT A;  4D7M A;  2LC2 A;  3A2K A;  2F48 A;  5FJ8 J;  3GME A;  5LHG A;  2MH9 A;  1XMA A;  2F5E A;  1IXR C;  1Z7L A;  3MWM A;  1YTY A;  4JX6 A;  2NNY A;  1ZR4 A;  1HC8 A;  1MMS A;  3SDG A;  3RKX A;  2MC3 A;  4A0Y A;  4BBS J;  1POG A;  2LY1 A;  3C1D A;  2GOX B;  3OIP A;  3F22 A;  6PAX A;  3GXO A;  5DS9 A;  4IHV A;  2V1N A;  3K70 C;  3CUQ A;  2XRO A;  2R5Z B;  4IPA A;  3HKZ A;  1SD6 A;  5EEA A;  1HKS A;  1R4N B;  2M7A A;  3FHN A;  3GTM J;  2VOD A;  4A5N A;  2EIN H;  3GFJ A;  5J1U A;  3HOW J;  4IOC F;  2HOE A;  2HPM A;  4EV0 A;  4L9J A;  2WAD A;  4LB5 A;  1WJD A;  1A6I A;  1YJ9 I;  2GXG A;  3CCQ I;  4YFX F;  1DP3 A;  2YS9 A;  2DA2 A;  2DYR H;  3F6O A;  4XLF A;  1WGX A;  1YX3 A;  2W1O A;  3TO7 A;  1WFX A;  4XOR A;  5IP9 J;  1I39 A;  5HLT A;  1MKM A;  1BBY A;  4LB6 B;  2M45 A;  4S0H B;  1GXQ A;  5DUI A;  4FIS A;  3FMR A;  3ML6 A;  1RES A;  2HPI A;  1KYZ A;  4D9J A;  2XAF A;  2QZ8 A;  2QKM B;  1ITY A;  3TOB A;  1TWF J;  5LRS A;  3S3M A;  5DTD A;  2Q8K A;  3DPL C;  5L3B A;  3QOP A;  1FSE A;  2JA2 A;  1HW1 A;  2RVC A;  3GWZ A;  4OAZ A;  1HBX G;  5IT9 K;  1ZYR F;  4G6Q A;  4U88 A;  1HOM A;  3TGN A;  2LG4 A;  3K6G A;  2GLO A;  2Y9Z A;  4RS8 A;  3K69 A;  3GO5 A;  5FLX Z;  2QBY A;  1OYI A;  2ELH A;  4Y17 A;  1LJ9 A;  5LBQ A;  2LBF B;  4ENJ A;  2IA0 A;  2B63 J;  4B3X A;  3S1N J;  3L2W A;  3ZQC A;  5TIS C;  2KIQ A;  5IYC J;  2KRH A;  2CMP A;  2VBX A;  2KHM A;  3G3Z A;  3BZC A;  2HI3 A;  2XGC A;  4RB2 C;  3WTX C;  2XSJ C;  5J40 A;  2IGM A;  3RQI A;  2NVX J;  3A01 B;  1B6A A;  4M6Y A;  1XSD A;  1GV2 A;  2K86 A;  4GYI A;  5LLQ A;  1O4X A;  5DUK A;  2O61 A;  5EYR A;  3ERM A;  2HDW A;  3QU3 A;  2O8K A;  1KA8 A;  2DFH A;  3OYI A;  2HQR A;  2R4G A;  2FML A;  3DF8 A;  4F7Z A;  3LSJ A;  1D0Z A;  1YFH A;  3CTA A;  5A2Q K;  4GFB A;  4MO7 A;  4GCV A;  3CF2 A;  1CGP A;  1A04 A;  3ZOB A;  4TV7 A;  4ABZ A;  3Q0W A;  2PI0 A;  3GTG J;  1TNT A;  1PUF A;  2JTV A;  3HZJ A;  2ZXW H;  2RNJ A;  1T95 A;  4ZYA A;  3G6E I;  3RI4 A;  2K02 A;  4RBO A;  1GXP A;  1O3R A;  2ME6 A;  3U9G A;  3MD2 A;  2AQE A;  3IL2 A;  2XKP A;  3RKW A;  2M9H A;  3LMM A;  3BG7 A;  3LSM A;  3FXL A;  1VQ7 I;  4B09 A;  2A05 A;  1R5H A;  2CH0 A;  2EFQ A;  3F72 A;  2O6G E;  3HUG B;  3IKT A;  2R7T A;  1BI3 A;  2BVM A;  1HST A;  4I09 A;  3LQR A;  2EFN A;  2XGX A;  2HFH A;  2M0C A;  4BE2 A;  4V2G A;  3H5A A;  2WV0 A;  1A6Q A;  2HS5 A;  2Y30 A;  1YJN I;  1ZK8 A;  4HF2 A;  3NEU A;  3CUQ C;  3ABK H;  3MKZ A;  3BOQ A;  4IXA A;  1XX5 A;  2KLO A;  4FAS D;  4UUS B;  2P6S A;  1JKO C;  4F91 B;  4ESJ A;  2W84 A;  1E0E A;  1GV5 A;  3KYD B;  2RNG A;  1RET A;  1BA5 A;  3HOZ J;  3HGG A;  1MJ9 A;  1FBU A;  3L09 A;  1B4A A;  3NAR A;  1J2X A;  2GQQ A;  4BH9 A;  1Y8Q B;  4P9F A;  3EPZ A;  1WJC A;  2ISY A;  3KX2 A;  3TO6 A;  4Q47 A;  2VC0 A;  3EET A;  1ZRF A;  4HX8 A;  3FX3 A;  1RNL A;  2DMP A;  1A36 A;  2J5O A;  2P5K A;  1BC7 C;  5F0C A;  1MDM B;  3WOD F;  3RSN A;  3AKZ A;  3S15 J;  4G7H F;  2R7O A;  2IRF G;  2KIS A;  1U0J A;  5J47 A;  1EH8 A;  1UG2 A;  3VSL A;  2JN6 A;  4I76 A;  4XRS G;  3TBI A;  1VI0 A;  2LF7 A;  4G8X A;  5ED4 A;  3C2G A;  2ZFU A;  4EJU A;  2XPU A;  1X3U A;  1T2K A;  1IN6 A;  3OS0 A;  4AU7 A;  2P8T A;  3IAS 2;  3IH3 A;  3F8C A;  3IC7 A;  2JSC A;  4KYW A;  4B48 A;  5CKT A;  1V5G A;  3TDZ C;  4PZJ A;  1FOX A;  2TRT A;  5FLX K;  4IQ4 A;  1EF4 A;  2WB1 A;  4PDK A;  3I4P A;  2ID3 A;  2VT2 A;  2HOS A;  3MEX A;  1FIP A;  2R7Z J;  4ZTF A;  4BYY A;  2ZSI B;  3QRF F;  2FRH A;  4PCQ A;  4L9T A;  4LK0 F;  2FOK A;  2CJJ A;  1IZ1 A;  1DDN A;  1ETW A;  3PQJ A;  4XKB A;  4YII A;  2DDB A;  3L1P A;  5ICF A;  3JSP A;  2O03 A;  1ZQ3 P;  2XC7 A;  3E6C C;  2Z16 A;  1A31 A;  1XDU A;  4IOA F;  3GLX A;  3BR3 A;  5B3S H;  2BY0 A;  2F5F A;  4ZJZ A;  1D1A A;  1I1G A;  1FNN A;  3ZQG A;  1SAX A;  4LJZ F;  2TDX A;  2BY3 A;  1AKH A;  3R60 A;  3JSO A;  3NWT A;  3KPH A;  3V7R A;  3N97 A;  3IRR A;  4ZYE A;  2AXT C;  1UST A;  4WXD A;  4MNU A;  4HPQ A;  2R7D A;  2DA3 A;  4DBQ A;  3U1K A;  2HYG D;  5H20 A;  5GPA A;  4NC6 A;  1ZLJ A;  3OYA A;  4CYD A;  4KT6 A;  1G3S A;  4WXH A;  2KRF A;  4JX5 A;  1P4A A;  3S2H J;  1BW6 A;  2VT3 A;  2H27 A;  3SHF A;  4IO9 F;  4N0B A;  4ETS A;  3TOA A;  2F4M B;  1OMI A;  3IH4 A;  3VYT B;  3MAJ A;  3CLO A;  4U87 A;  2XAH A;  1QRY A;  2E5N A;  1OR7 A;  3CJQ B;  3T8R A;  4DJA A;  5IOY A;  5F0H A;  1ZG3 A;  2E35 A;  3DEE A;  1ONV A;  3FDY A;  3K4C A;  4OWR B;  4RAG A;  2XB0 X;  5EZH A;  4CCL A;  2X6O A;  1D5Y A;  2VJ5 A;  2R5Y B;  1J0R A;  1I50 J;  1Z6T A;  3COA C;  3I53 A;  3PFY A;  2CYY A;  4X1E A;  4IJA A;  2QQ8 A;  4RGX A;  4QPO A;  5J1R A;  1QHH D;  1VQ6 I;  1XGN A;  4B1R A;  3VWB A;  1WJE A;  4RB1 A;  2HWV A;  3PNT A;  2PJR A;  1BOA A;  4EJT A;  1RI7 A;  5IYD J;  4CZC A;  2MD5 A;  2R7Q A;  3I3L A;  2EFP A;  4S05 A;  4C3H J;  4E70 A;  2H94 A;  3PO2 J;  2KJC A;  4DW6 A;  2EIJ H;  2QQB A;  3BTJ A;  4KIG A;  5BMZ A;  3CCL I;  1JE8 A;  2Q1Z B;  4B3A A;  1PYV A;  3JTG A;  3EYI A;  1VQL I;  2Y9Y A;  2FMY A;  5JFR A;  1V5F A;  2AHQ A;  5GAG J;  5ERI A;  2HQ5 A;  4ITV A;  3MKW B;  3O8G A;  4Y33 A;  2MFZ A;  1IW7 F;  1KU7 A;  1TWH J;  4XKC A;  2RKH A;  4II2 A;  3HBL A;  1I6H J;  1ZRD A;  3ZMZ A;  2QGU A;  3E6B A;  5CVV A;  2K5C A;  2V6E A;  5HNF A;  1P4W A;  3FKJ A;  5KAI C;  3WGG A;  3ABM H;  1PDN C;  3RZD J;  5ILS A;  2R5Z A;  3SJM A;  2VBZ A;  4XOP A;  2RRE A;  3J7A Y;  4BE1 A;  4KIB A;  2VUM J;  3S8P A;  1WCM J;  1XDS A;  3T5X A;  2K4B A;  3I58 A;  2EH3 A;  4WWC A;  1QQI A;  2XUB A;  1UZC A;  2X1C A;  2JZY A;  4HA8 A;  4NQW B;  1MH4 A;  1YO5 C;  1SVO A;  4YFN F;  4A3L J;  1TP4 A;  4CZZ A;  2ELJ A;  2BBY A;  2CQK A;  3HOV J;  2KDZ A;  1YIT I;  1XC5 A;  2MYS A;  3M8F A;  1V55 H;  3E6M A;  3I71 A;  5M3M J;  1HW2 A;  3H0G J;  4RAZ A;  1IDY A;  4BQO A;  2JUC A;  2KZV A;  4XKV A;  1HSJ A;  3E97 A;  1S7A A;  2GA1 A;  2DTZ A;  2L7F P;  1KU3 A;  4BQQ A;  3H9J A;  4XID A;  1DU0 A;  2OC6 A;  2DN0 A;  3V4G A;  4ZYH A;  3HM5 A;  2ISZ A;  4Q5S F;  3OIO A;  4E6K G;  3JRG A;  2R7V A;  4MQ9 F;  3OIQ A;  2F4I A;  1ZRE A;  2E71 A;  1IUF A;  2MG4 A;  3I4M J;  3U1D A;  1EA3 A;  1MBJ A;  5M5X J;  2JA7 J;  1X1D A;  4ZYG A;  3BP8 A;  3PUB A;  2KP6 A;  3FXR A;  2L4M A;  4LG0 B;  4AUX A;  2MC4 A;  5JR3 A;  4C2M J;  2L9R A;  1SMT A;  3JW4 A;  1WZ2 A;  2CWE A;  1IUY A;  1FOW A;  3H3V K;  3ESW B;  2STT A;  1I1S A;  2NVU B;  1RR7 A;  4XRF A;  3WU0 A;  1U78 A;  1F9N A;  1N25 A;  4M3E A;  1J5Y A;  4HRI A;  5E8I A;  2IGN A;  4CXF A;  3SZG A;  3FIS A;  4Y13 A;  1OR7 C;  2L5Q A;  1GVJ A;  2OZ6 A;  2DA4 A;  2Z33 A;  4HQM A;  3D5L A;  2ESN A;  1FOK A;  2IGK A;  3CO6 C;  1YJW I;  1T38 A;  2G0E A;  3RYP A;  3I9V 2;  2XAQ A;  2O0Y A;  4RM3 A;  2NS0 A;  2ECB A;  3OY9 A;  1YLF A;  3CD6 I;  2DI3 A;  2EFO A;  1J75 A;  5C4X J;  1ETX A;  1FX7 A;  2QKL B;  3RPU A;  2EBI A;  4HST A;  4H0E A;  1OJL A;  1OYW A;  4U7B A;  3LFK A;  4M74 A;  2H6B A;  1HLV A;  3RPQ A;  1E3O C;  1ZTR A;  3E6D A;  4GXO A;  4RGS A;  3OR2 C;  4L0Z B;  1JXS A;  4B44 A;  3DBH B;  1T33 A;  1NG6 A;  2YUS A;  2ZO4 A;  5K1Y A;  2DK5 A;  2KDO A;  3HRM A;  3QAH A;  3SDB A;  3DWL E;  1FMW A;  2WV1 A;  1XPX A;  4Z6Y A;  3KZY A;  5KHD A;  1H9G A;  3F8B A;  4Y3O A;  2OPT A;  2V9K A;  4P5O A;  2GXA A;  1JUM A;  2WTE A;  5EG0 A;  3ABT A;  2CW8 A;  2E60 A;  5CVI A;  1BN5 A;  3KP5 A;  2WC2 A;  1HF0 A;  3BR0 A;  2WBM A;  1APL C;  1BI2 A;  3HL2 A;  2F6C A;  1QZE A;  3Q5F A;  3GTQ J;  2K9S A;  2W25 A;  3HB9 A;  3U21 A;  2IVM A;  3KE2 A;  5IOZ A;  1Y1W J;  3QYB A;  5EF6 A;  4C9Y A;  5ICG A;  1K6O A;  2A5W A;  2FA5 A;  3LSG A;  4A3C J;  2LNB A;  2OF7 A;  4HF1 A;  3N05 A;  2ESH A;  2R3S A;  1ZKG A;  4U0W A;  2RN7 A;  2GZW A;  1G6N A;  5KVR A;  1YRN B;  1S6L A;  3LA7 A;  4NUB A;  4LFU A;  4HSR A;  4BBR J;  4A12 A;  2VJ4 A;  3JRC A;  1J59 A;  1MDM A;  3K2A A;  3SEQ A;  5E79 C;  2VKD A;  2I5U A;  3HSF A;  4FET A;  4CO8 A;  4QIW N;  1FPQ A;  3OYN A;  1O3S A;  2WAF A;  1WJB A;  4A3B J;  4M3F A;  5M3F J;  2Z3Y A;  3HDD A;  1K79 A;  4UB6 C;  4MGR A;  1YIJ I;  3CDH A;  2PQ8 A;  3TW7 A;  1K4S A;  2IA2 A;  4E7S A;  2CQ7 A;  1ZR2 A;  3CLQ A;  2P5L C;  4AYB A;  3MKY B;  2Y0S N;  1UB9 A;  3SZT A;  3VB2 A;  2JA5 J;  1BM9 A;  4X0G A;  1ZEL A;  2CSO A;  2DT5 A;  2HXI A;  3H9G A;  3O8H A;  1TWC J;  2FBH A;  5F1J A;  3H3Z A;  3MKL A;  4UXN A;  5IT9 Z;  1R1U A;  5LEJ A;  2X9D A;  2K4J A;  1TBX A;  2A3S A;  5FRN A;  1K78 B;  3D1N I;  2HNH A;  3KEO A;  2E7W A;  4XLC A;  1MBF A;  3DPT A;  3VDX A;  3CMY A;  1Z0X A;  2XSD C;  2ZCW A;  4HV6 A;  4EMS A;  3V8K A;  2XAJ A;  3S2D J;  3HOS A;  1XGM A;  1DGR M;  2EV0 A;  4N4N B;  2RQQ A;  1DUX C;  3DU5 A;  4BE0 A;  5D8K B;  1OCO H;  4OIO F;  4MIM A;  1VQK I;  3ZQI A;  5DEQ A;  1LEA A;  2BHY A;  4I7H A;  2LRD A;  2EV6 A;  1QBJ A;  2BHZ A;  4LIV A;  2BOL A;  4JYK A;  3RQ4 A;  4I2O A;  1MW7 A;  4ENM A;  3E0J B;  5J4V A;  1WH7 A;  5AON A;  3GBG A;  3J81 Z;  3IV5 A;  4LIT A;  2OV7 A;  5A2Q Z;  1XMK A;  1QU3 A;  1TTY A;  2UV1 A;  1HCR A;  2PJR B;  5IPA A;  4PJ0 C;  4HOB A;  2ZME B;  4QTR A;  2P81 A;  4QLC U;  2WY8 Q;  3PFI A;  1MJB A;  2A6H F;  3AG2 H;  2MD0 A;  1EH7 A;  2IS1 A;  2R5Y A;  2R93 J;  1AOY A;  4KIF A;  1I5Z A;  1QNT A;  4I0A A;  1MD0 A;  2EJR A;  3BPV A;  4IEJ A;  1G3W A;  3J80 Z;  3NRV A;  4F3Q A;  1YIO A;  1OFC X;  5HS7 A;  1STZ A;  5BS6 A;  5D5W B;  4R1H A;  1EKE A;  2PLY A;  3UKG A;  2DA5 A;  4BL0 B;  1B72 A;  3L2R A;  3JRE A;  1TQI A;  2LY2 A;  3F3X A;  4C3I J;  2FEZ A;  5E3O A;  3PSF A;  2IT0 A;  3LAJ A;  3QQA A;  1XSV A;  5HDN A;  3ECH A;  1VTN C;  3W6V A;  4HBL A;  4HW0 A;  2Y69 H;  5LHH A;  4BU2 A;  1Y56 A;  2NVQ J;  3LFU A;  4CCJ A;  4MEY F;  5E1W A;  5FLM J;  3OYG A;  1RC9 A;  1LVK A;  2F5C A;  3ZRG A;  5GTI C;  2NOG A;  2ZXH A;  1OCZ H;  2GOM A;  2HZD A;  1MH3 A;  2LRE A;  1JGS A;  4A0X A;  3KLN A;  1OCC H;  1MZB A;  2D45 A;  2VB6 A;  1X4P A;  3GLL A;  2W24 A;  3JRD A;  1S8N A;  1SC7 A;  2PMU A;  3P5J A;  4YIR X;  4I6Z A;  4NC7 A;  2M4K A;  1TWA J;  2MH2 A;  3HYI A;  4NQW A;  3LL7 A;  3OS2 A;  5AIP A;  3TKY A;  1VQN I;  3CF5 F;  3FXJ A;  2FXA A;  1QHG A;  1TZL A;  5ILV A;  4KFC A;  3OL4 A;  2ZJQ F;  4ZZL A;  4A3E J;  4G7Z F;  5JLW A;  5F27 A;  2COM A;  4B47 A;  5E1Z B;  1DQU A;  2RC4 A;  3UNG C;  4M3G A;  4XLN F;  2E36 A;  1DPU A;  1R49 A;  3ZPL A;  1LVA A;  2LTP A;  3EUA A;  3OSF A;  3GFI A;  4UHT A;  5FLV A;  3AG1 H;  3TP3 A;  3HOY J;  3C2H A;  1VQP I;  3Q9V A;  2ADU A;  3HRU A;  1H9T A;  4IKF A;  4UB8 C;  2LD5 A;  2XB5 A;  5HNH A;  3L7W A;  2WAE A;  1N75 A;  3RJP A;  2M0M A;  4U7D A;  3DV8 A;  4KIC A;  1FEX A;  3WHC A;  1FSH A;  1L0O C;  4LG0 A;  3DQV C;  4NDL A;  4BJ5 C;  2JPC A;  2VJJ A;  3HHH A;  3ONQ A;  2ZJ2 A;  3GFM A;  1LE8 B;  1XTA A;  4F55 A;  2R92 J;  1Z9C A;  1N77 A;  4AD9 A;  1U5T B;  4LLG F;  1KQ9 A;  1ZN2 A;  4ZC3 A;  3S1R J;  2Q0O A;  3J81 K;  3QPH A;  4M3D A;  1TW3 A;  5E17 F;  3E5Q A;  2YR2 A;  1ZGW A;  5C3E J;  2PMH A;  4KDP A;  5IY5 H;  4AM3 A;  3P9I A;  1FTT A;  1MNE A;  1G59 A;  5K7H A;  3AFH A;  4A3M J;  3BQY A;  4L0Y B;  1NG7 A;  3G1O A;  4JBA A;  5D6F A;  4CCN A;  1S5L C;  2QQA A;  3O3K A;  3AG3 H;  2Z5U A;  2ZBK A;  5DCM A;  1MNM C;  1AU7 A;  1FJL A;  4V2F A;  4C2T A;  2IW5 A;  1QO0 D;  2JRT A;  4XLE A;  3H5R A;  3J80 K;  1ETQ A;  1X1C A;  3LSR A;  2E2J J;  4XON A;  2OAZ A;  1RUO A;  1TWG J;  1P7I A;  3L9F A;  3LWF A;  5EG0 B;  3K1P A;  2QSF X;  3H5N A;  1ETV A;  2CUJ A;  2UXN A;  2CQN A;  1IN8 A;  2EZL A;  3DKY A;  4BHC A;  2L01 A;  4FHT A;  2Y31 A;  1Z05 A;  3ZN1 A;  2L7M P;  3ZQF A;  4JK1 X;  1X58 A;  2M1B A;  2LF8 A;  4U0V A;  1HQC A;  1QVT A;  1BR2 A;  4KNY A;  3BZ6 A;  4L5I A;  3LSK A;  1JTX A;  3H1C A;  1UG0 A;  4MFD A;  5L3G A;  5HOO A;  4II3 A;  1N78 A;  2IXS A;  3GUD A;  4RB0 A;  4O6J A;  2O5R A;  3DPU A;  1FYK A;  3HOT A;  3VSK A;  5D5U B;  5LGU A;  1SD7 A;  2QYO A;  2XRL A;  1E17 A;  1E2X A;  4AID A;  1EJ9 A;  1OYY A;  2QEN A;  4AC0 A;  4BKX A;  1SD4 A;  4Z2Y A;  2X48 A;  1JHF A;  4I98 B;  1TNS A;  3RTR A;  2VQL A;  4EM2 A;  2HOT A;  4QWQ A;  2GXB A;  2X6W A;  2M34 A;  4AVZ A;  4N9H A;  4KUM A;  3B6A A;  1IG7 A;  2XF6 A;  4XRS A;  2O9L A;  2UUZ A;  2LKS A;  3GTL J;  3D5S C;  1IV6 A;  5CJ9 A;  1YRN A;  1IRF A;  1Y39 A;  2GAU A;  5K7F A;  2PBI A;  4XMY A;  1WJF A;  1J7K A;  1MBE A;  4PJN A;  3LNQ A;  4CA0 A;  2HDC A;  4P55 A;  1OKR A;  2EA4 A;  5CPR B;  1MGT A;  2FQ4 A;  2O8X A;  3K0L A;  1VQ5 I;  3M8E A;  2DJI A;  2LK2 A;  1FZP B;  3A03 A;  1IN7 A;  2KJB A;  4D7N A;  2NOJ B;  3OYE A;  5KCM A;  2E1O A;  1OCT C;  4IHW A;  4CYC B;  1RR8 C;  1P7J A;  1WI3 A;  5D5X B;  4JQF A;  1IXC A;  1K4T A;  4IHX A;  2K9Q A;  3RZO J;  4XSZ F;  1B9N A;  2Q2E B;  3BCB A;  2RV8 A;  4GDF A;  1HA8 A;  2ZSH B;  3V7S A;  1LPQ A;  3S14 J;  3E5X A;  2DJN A;  3E1S A;  3CP8 A;  3HSR A;  4E7Z A;  1B8I B;  3BLY A;  1ZHF A;  4XKW A;  2PJP A;  2KIF A;  1X19 A;  2FNA A;  4IRH A;  3ISP A;  2A6E F;  3FIW A;  1FYM A;  1R1T A;  4XOT A;  3BJO A;  1G4D A;  1EV7 A;  3CP2 A;  4DIQ A;  4WK8 F;  1WSU A;  3I59 A;  5BOX A;  3WTY C;  1K78 A;  2CV2 A;  2NRA C;  3MZY A;  1VND A;  1Z67 A;  5F04 A;  1LB2 A;  1P4X A;  3C18 A;  4PJJ A;  2OQR A;  4M9S A;  5L3D A;  2X1E A;  4I99 C;  4XR6 A;  3HG9 A;  2F5D A;  4RGR A;  1YS6 A;  3A02 A;  1BL0 A;  3J7A O;  3DTK A;  2HVR A;  3KFW X;  4GGG A;  1YG2 A;  5B66 C;  4OAY A;  5F64 A;  1U9N A;  4L5J A;  2WWY A;  4UUT A;  3ZMU A;  2J5P A;  2OBP A;  3K4J A;  4BHB A;  4ZTJ A;  3MVP A;  1TL8 A;  4CUG A;  3F23 A;  1FYL A;  1D1B A;  1MBH A;  1U2W A;  4P9U A;  5D5V B;  4A3I J;  3R0J A;  3QOD A;  1Y1V J;  5E1X A;  4AIJ A;  3NQO A;  2N8G A;  1R58 A;  4DQ2 A;  1IF1 A;  4IHS A;  2E7X A;  1W7P B;  1SMY F;  2LSO A;  3H35 A;  1F36 A;  4CGZ A;  2NNN A;  2OTJ I;  2FE3 A;  4IRG A;  3WG9 A;  4WCG A;  1XCB A;  4OIR F;  3BT9 A;  2ZME A;  1D1C A;  4PJL A;  2LMD A;  3P7N A;  4IHY A;  1S29 A;  4KMU X;  3CCV I;  1B72 B;  3DKW A;  1W1W E;  4ZZD A;  1SFO J;  3WG7 H;  3GYH X;  3P9K A;  1LFB A;  2X85 A;  2B0L A;  2UXX A;  2WAQ A;  1GUU A;  4J00 A;  4UUV A;  5K5Q A;  2W00 A;  4BXX J;  3ABL H;  3SYT A;  3VYR B;  5CVJ A;  4E7I A;  3MZH A;  2OCE A;  2P7V B;  3FK7 A;  3M8J A;  2KIM A;  3L2C A;  1IRX A;  2ZKZ A;  1IJW C;  4Y52 J;  2VPL A;  2ZNZ A;  3JRH A;  2JPB A;  3GCM A;  2DCE A;  1U8R A;  2MBF A;  1NTC A;  2CS3 A;  2A61 A;  2FBI A;  3PO3 J;  4A3G J;  5L3C A;  5D4S A;  2YU3 A;  2VL8 A;  2XF5 A;  1W4M A;  3CES A;  1Z21 A;  4M9X A;  5H2F C;  4FE7 A;  1RIO H;  2OQG A;  2DPU A;  1A5J A;  4BDY A;  2X51 A;  3NWS A;  5H6R A;  4OMZ A;  4PFO A;  1YI2 I;  1P2F A;  2C6Y A;  4DZP A;  2MAB A;  2MSY A;  5K5R A;  1Z91 A;  4IF4 A;  2KIU A;  4M6V A;  3OS1 A;  2JA6 J;  1ZAR A;  3DFG A;  3OR1 C;  4UVB A;  1VQ8 I;  2XGD A;  2DMU A;  3KLO A;  3TO9 A;  2M8G X;  5E20 A;  2LOO A;  4ON0 A;  3GZ6 A;  2CRG A;  3FM3 A;  1D0X A;  3A4C A;  3TW6 A;  2ETH A;  4UNO A;  2BGC A;  4DZJ A;  1OLT A;  3IWZ A;  5FKK A;  3BTC A;  3CQZ J;  2X6Y A;  1O3Q A;  2GIV A;  4HG2 A;  2V7F A;  4OMY A;  2E1C A;  3A0H C;  1T6S A;  3BWG A;  5GAH J;  4RDU A;  1EH6 A;  4CCM A;  5CQE A;  5CVU A;  3KIO A;  1TQM A;  3QWL A;  2VBY A;  4EJO A;  3FXU A;  1UCR A;  1W5T A;  5DCF A;  3OYC A;  4YFK F;  5KK1 A;  5F1R A;  1BR1 A;  2D2W A;  4I0B A;  4FCY A;  1UAA A;  1YW8 A;  4PFP A;  1X1A A;  1ERD A;  2OU2 A;  4HQE A;  1IXS B;  2O3F A;  2CU7 A;  2E2I J;  2JJ7 A;  1BJZ A;  1VQO I;  2NVY J;  4A3D J;  3AL0 B;  5LGN A;  1JKP C;  2OA4 A;  4A0Z A;  5ICE A;  3VEP A;  4PUS A;  2FD5 A;  3O2P E;  3AAF A;  1I6X A;  3I5U A;  1HDD C;  2STW A;  4UVC A;  5FFX A;  3QYF A;  5EZG A;  2QSG X;  3PQK A;  2OTL I;  2ACJ A;  1CF7 B;  3GF2 A;  2DTR A;  2ELK A;  2ICW G;  4EEF G;  2R7R A;  4BNC A;  2JVH A;  3GW2 A;  3CCM I;  4YRV A;  5E3L A;  4OIQ F;  3OOU A;  1F5T A;  2HVS A;  1LE8 A;  3JR9 A;  1C0W A;  2YPR A;  1U5T A;  5EGO A;  3W2A A;  2OUM A;  3I55 I;  5DCM B;  4Q48 A;  2KZG A;  2AQF A;  2ZB9 A;  4G6T B;  3G4S I;  3RCO A;  2IS6 A;  3IH2 A;  3RYR A;  4ZDP A;  2ZME C;  1BI1 A;  1QPM A;  3QOE A;  4AIK A;  2VE8 A;  3FKI J;  4NHJ A;  2RAE A;  2EK5 A;  2R7W A;  2VXD A;  4MQV A;  2VOP A;  2W48 A;  1YOV B;  1R5I D;  4JOM A;  2B9S A;  3TMO A;  4CCO A;  1LQ1 A;  4EQQ A;  3H0D A;  2XIG A;  5FRO A;  3TDU C;  1O7F A;  2XAG A;  3H36 A;  2K9M A;  5FKL A;  3BR6 A;  1WKM A;  1BOB A;  5CQG A;  3WU2 C;  1U8B A;  4O5V A;  3D0S A;  2M2E A;  2YX7 A;  1JUP A;  2L9V A;  3V7C A;  3KEQ A;  5JHF A;  1P6R A;  1XGO A;  5CVR A;  2X6X A;  1BW5 A;  3C3W A;  4HNT A;  2CFX A;  3IKV A;  2CO5 A;  4HLY A;  1LDD A;  2XGE A;  4DYC A;  1S3J A;  3DTE A;  1SFU A;  2IBD A;  2HEO A;  2IJL A;  3OOP A;  1IRG A;  2JRM A;  2VQG A;  3I0T A;  5GAE J;  1W0T A;  3KP2 A;  1KU9 A;  2HKO A;  4BAC A;  4XNF A;  4E7L A;  4B8X A;  4D5F A;  5FKN A;  3CUO A;  3DEU A;  2CG4 A;  2HQA A;  3M1E A;  4RA2 A;  5LEK A;  3S2W A;  3ZMS A;  3RPU D;  2HTS A;  1XCV A;  3MZ8 A;  4A3F J;  2VI6 A;  3H3U A;  3ZR8 X;  3DKX A;  5DD4 A;  2Z2S B;  4K2E A;  2BYV E;  3UR3 C;  5FO5 A;  3V8L A;  5BPI A;  4B4C A;  5LFA A;  2FF4 A;  2JMW A;  2HR3 A;  4BQA A;  2UWM A;  1W36 C;  2IGO A;  3KZI C;  3OMY A;  4W97 A;  4XBF A;  4XM3 A;  4LIU A;  5EEH A;  2XPV A;  5HS9 A;  4QSH A;  5LHI A;  5LGT A;  3HC7 A;  3V8J A;  2PX9 A;  4NB5 A;  3S3O A;  3FBN B;  3T1B A;  2DAO A;  1O57 A;  3M3Y J;  1MBK A;  3JRB A;  3OSG A;  3W2W A;  5CLS A;  2CUE A;  2CW7 A;  1B9M A;  2DMN A;  3HGY A;  4HNU A;  1XG1 A;  2CFO A;  3EUK L;  2EV5 A;  4D5C A;  1F4K A;  4CHU A;  3I4N J;  5J6X A;  2DBB A;  2HYJ A;  2CV0 A;  1NK2 P;  4CYC A;  1A35 A;  2MLG A;  3RDI A;  1ACI A;  2DO7 A;  3S16 J;  3QPL A;  3W6J B;  2MA3 A;  3C7J A;  3I59 B;  3ZMT A;  3KP4 A;  2Q2E A;  1SFK A;  2V79 A;  4PSX A;  2L9S A;  3LSP A;  1IC8 A;  5HLG A;  2VE9 A;  3ERE D;  2CQQ A; 
#chains in the Genus database with same CATH homology
 1UJ8 A;  2BZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...