2BZTA

Nmr structure of the bacterial protein yfhj from e. coli
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
66
structure length
66
Chain Sequence
b'MGLKWTDSREIGEALYDAYPDLDPKTVRFTDMHQWICDLEDFDDDPQASNEKILEAILLVWLDEAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN ISCX
publication title YfhJ, a molecular adaptor in iron-sulfur cluster formation or a frataxin-like protein?
pubmed doi rcsb
source organism Escherichia coli
molecule tags Iron binding protein
total genus 18
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2005-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04384 Fe-S_assembly Iron-sulphur cluster assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.600 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A IscX-like 2bztA00
2BZTA 1UJ8A
chains in the Genus database with same CATH superfamily
1TC3C 5AONA 2E36A 2X9DA 3Q0UA 2DFHA 3HDDA 3A02A 2WAEA 4KITB 4U0WA 5ILSA 5JLXA 2R7SA 3EQLF 2OAZA 5HODA 2XF7A 3OYNA 1VQ4I 2VXZA 2PFBA 4BY7J 3GMEA 3PFIA 3OOUA 3OYIA 2ECCA 5M5WJ 4LLNA 1DGWY 2DQRA 2JWTA 4JYKA 1JJ8C 1ULYA 5DD4A 2VBXA 1J9IA 4B8XA 2HQ5A 3BG9A 4ANJA 1H9GA 3I0TA 4V2FA 5M5YJ 2XAQA 3E5QA 3JRAA 3HGYA 5IY5H 3HKZA 3SYTA 2MD5A 3LL7A 3J81Z 1FOXA 2FA5A 5JFRA 1ON1A 3MAJA 4NBQA 3GF2A 2RAEA 4R8HA 3W6JB 4DBQA 2JA7J 2Y31A 3HOYJ 2RQQA 2EZIA 2DXIA 1RPWA 2RV8A 4F3QA 3ABTA 3OYBA 1DP3A 2M9HA 1OYIA 5HS7A 1E3OC 1MBGA 1ZG1A 4OMZA 2FD5A 4HEA2 2W24A 4IRGA 2DA5A 5HS8A 3H92A 3FDYA 3P5JA 1IW7F 3S93A 1EH7A 1DU0A 5FROA 3IUOA 3VODA 2M7AA 2H6BA 3C3WA 3K1PA 2IXSA 1Z05A 3HSEA 4M6YA 4F93B 3AL0C 5DEQA 2ZMEA 2PN6A 3V42A 2K86A 1MH4A 3OYDA 4M74A 3KEYA 5IT3A 4N0BA 2HYJA 4DZJA 3VOEA 1BR4A 2VODA 4P1WA 5L3EA 1SVMA 5GTIC 2COMA 4NQWA 1D1AA 1LNWA 5DUKA 2H27A 1ZELA 2BGCA 4KIFA 1I3QJ 3QYEA 1Y0UA 5FD5A 2MLKA 3ML6A 3GZ6A 1WJAA 5L3BA 1MDMB 4NB5A 4BQOA 5GAEJ 1JUPA 2XAGA 2ZJRF 1GVJA 3DEEA 2W00A 4I76A 4CH7A 1HSTA 1XSDA 2WB1A 2O8KA 2F2EA 3I4MJ 2L9NA 1IN7A 3ZP5A 2NXNB 4KMUX 4QLCU 5CQGA 2HVRA 3M3YJ 2PMHA 2DW4A 1L3LA 1T39A 1D5YA 2OJED 1R1UA 1R1TA 3IKVA 5J40A 5CVUA 5J8FA 5M3FJ 2YU9J 1JT6A 3LAPA 1IF1A 4M9XA 2RVCA 5GAGJ 2DJNA 4RGRA 3S2DJ 1E0EA 1ZGAA 5LRRA 3JRCA 3HRTA 2DPUA 4RM3A 1OFCX 2Y30A 5D8LB 2BBYA 3CJTB 5HNHA 4AM3A 4CCOA 2LNBA 3M1CA 3ZQFA 3JRFA 2XAJA 2ZNYA 4BACA 5FFXA 3RKQA 4HSTA 2EV6A 4KIBA 3CCEI 3DV8A 2W48A 3A1YA 1LE8A 1ZRFA 3TBIA 2D1HA 3FX3A 1T0FC 2FJ1A 2M8GX 1Z67A 2EINH 3FK6A 4ZDOA 4I0AA 4ON0A 3E97A 1LVKA 2ZKZA 3MKLA 2QM3A 4IOCF 1FZPB 1V5FA 3RKYA 1Z7LA 5LBQA 5FKLA 2VPRA 3WTXC 3G1OA 2IGNA 1OLTA 3OY9A 1MNDA 1K4SA 4EJTA 2X51A 4XL9A 4Y17A 3S8PA 3F8NA 4HNVA 1XTAA 2VN2A 1XGMA 3M8EA 1GT0C 3RKXA 2JRTA 2AQFA 5AIPA 2BVMA 1UFMA 2JT1A 1N25A 4PUSA 5H6QA 3ELKA 3H0GJ 2GWRA 4BEHB 1S72I 3R6SA 1FEXA 1R71A 2DI3A 4R79A 1QZYA 1R5HA 5DYMA 2ID3A 3GFJA 1WQ2A 2DJIA 4O6JA 2LRDA 2P81A 4QPQA 3JAMZ 3RQ4A 4GDFA 1OR7A 3Q3SA 2HQRA 5HS9A 3CCLI 4IJAA 4N9IA 1KONA 4EJUA 3FISA 4EV0A 1S6LA 3F22A 3GX4X 1BC8C 1WCMJ 3KP4A 3GLLA 3GTMJ 2IGKA 1XG1A 4NUBA 4BQAA 3TO9A 2CFOA 4C9YA 3FM3A 1S29A 3S16J 4ZC3A 1KYZA 2BHYA 4MNUA 2XDVA 4QSHA 3W2VA 5M5XJ 3WTYC 1FSHA 2E7WA 1UHSA 4S0HB 3SZGA 1NTCA 1O3QA 3PO3J 4A6DA 5IPAA 4D1QA 1BIAA 4KNYA 5CVJA 2V7FA 1ETOA 4XNFA 1MMDA 2M4GA 3I5UA 1P7JA 1EA3A 1IN8A 2XB5A 4G94A 3SEQA 3HJEA 6PAXA 2MA3A 1FIAA 4YFXF 2DA2A 1S7EA 2DK5A 2P4WA 1UB9A 3LOCA 1J0RA 4F52A 2V26A 1K4TA 3MN2A 5F08A 3WU0A 3KYDB 3SHFA 3OS1A 4B43A 3JREA 4LGWA 5FKKA 1B4AA 5CVVA 2I8DA 1UHMA 3LAJA 5LHHA 3F8BA 2WBMA 1OKRA 2XF5A 3CQZJ 3FXJA 4BKXA 4R1HA 1GDTA 5E17F 3R61A 4KUMA 4BY1J 2L7ZA 4KDPA 2DT6A 2QKMB 4BBSJ 2O3FA 1WI9A 5DS9A 1TZLA 5BOXA 4CDGA 2ZNZA 1FY7A 2P7VB 3IC7A 2GIZA 4N9HA 4E7ZA 4I09A 3VEPA 3VYTB 2XPVA 3HG9A 5ILVA 3RI4A 2FMYA 1IJWC 1MBHA 2QYOA 1RUOA 4IXAA 2Y48A 4HG2A 2ZSHB 1CF7B 1V4RA 4PJ0C 2IS6A 4CCNA 5FKOA 3SJMA 3E1SA 4MEYF 4XMYA 2DYRH 1BIBA 3LSJA 4GYGA 3HBLA 2WC2A 3F6OA 4XN3A 4V2GA 4IQJA 2OBPA 3PFYA 5KAIC 3D0SA 5FJ8J 2DPDA 2HOEA 1P92A 4I6ZA 4E7JA 1U3EM 1S5LC 4ZH4F 2R7VA 1I1SA 4JK1X 2R7UA 3MKZA 3CC7I 2CH0A 3ZOBA 3S1QJ 1RC9A 4WX9A 5DTDA 4J00A 1SD5A 1LFUP 2HVSA 1IUFA 4PGHA 3HKZN 5GTHC 1A5JA 4A5MA 1KU2A 5FKMA 5HDKA 2KDZA 3H36A 5JI6A 3CCSI 1APLC 2A05A 2XB0X 4FT8A 5IP6A 1KU9A 3PM1A 4Y7NJ 2G9WA 3O8HA 3H9GA 4D9JA 4XORA 3A01A 5HVQC 1S7OA 1HKSA 3VSLA 1I6XA 4M9SA 1HLVA 2ZMEB 4U0VA 2A68F 4KN4X 1OCZH 1BN5A 2D2WA 2EA4A 1PJRA 3ERMA 3TW7A 4ABZA 2L7FP 3C2HA 1P4XA 1GUUA 2IA0A 4BHPA 1Z6TA 2DN0A 3JW4A 3PO2J 2KHMA 2Z2SB 4NQWB 2XKOA 4WF2A 3FZVA 3H3VK 3I4NJ 5BQTA 3L2UA 1T56A 3IH3A 3KZYA 1YE9A 1XCVA 2JA2A 2FXAA 3COAC 2E5ZA 2EB7A 1SFOJ 2VPLA 3MFKA 5E79C 1HDDC 1ETWA 1YW9A 2OV7A 5FLXZ 5J1UA 1I6HJ 3FXOA 3CDIA 4ZYGA 2NOJB 1D1CA 2V9VA 4A3IJ 1RNLA 2RNJA 3FBIB 3CCQI 2DDBA 5LLQA 2WAQA 2FUG2 4A6EA 4DQ2A 1R36A 3WHBA 1VQNI 2FU4A 1JKOC 1KQ9A 5DM6F 1DPUA 2WB1N 4DZPA 5F6FA 2RGVA 4BJTA 3OYGA 2GOMA 3SFZA 3OOPA 1QVTA 4HX8A 4W97A 2IBDA 2PMUA 4N4OB 2QVOA 4KN7X 1WH5A 2TRTA 4UHTA 4G12A 3V7RA 4YRVA 2OTJI 3I64A 5J3LA 2OPTA 2L02A 4OU0A 2DMUA 2HOTA 4L9NA 4E6KG 4RS8A 3JCUC 4KIGA 3VWBA 5K7FA 2IS1A 4LK0F 3HHGA 2JSPA 4IRIA 3K4NA 1ZLJA 4HYEA 3L00A 2ZMEC 2QF7A 1LE8B 5JVTA 3J7AO 2ZXIA 1XGOA 1QO0D 2VBYA 3O2PE 4M9ZA 2F5CA 4LITA 2VE8A 2KRFA 1MIJA 3T5XA 1FT9A 3B6CA 4AVZA 1FJLA 4HRIA 3BG6A 1H88C 3WG7H 3TDZC 2CW0F 4CCKA 3LA7A 4IQ4A 2HEOA 2FF4A 5ICFA 1KGSA 1E3PA 1YS6A 2W84A 4G8XA 5D5UB 3IWZA 2NVXJ 3VSKA 1OMIA 3KEQA 3FKJA 1IG7A 3IV5A 2STWA 4FASD 1XGNA 2FE3A 2M45A 3U1DA 2LBFA 2KZGA 4X1EA 2HVQA 3WTVC 4BS9A 2DT7B 4CUGA 2M7BA 4PJLA 2F5FA 2XPWA 4MFDA 5JR3A 2EH3A 4PSWA 2D5VA 1YG2A 1Z9CA 2HR3A 2HZTA 2EIMH 4ETSA 4UNOA 2M87A 4RBOA 1Y8QB 4L9JA 1ETQA 2NS0A 4IEJA 1ZGJA 4YEJA 4FX4A 4I0BA 4Y4RA 1JKRC 1X3ZB 5F1JA 2LFBA 4X6AJ 1Z0XA 2Z1DA 4AU7A 1X3UA 3S15J 3P9CA 3X2QH 5JHUA 3FXMA 5FRNA 2L9RA 3TGNA 5D5VB 2YUSA 2LP0A 2X48A 3IP4B 5JLWA 2XROA 1YJWI 2H1KA 1SD7A 2E34A 2OCCH 2KT0A 4GFBA 1TNSA 5E20A 1P4WA 4YFNF 3OS0A 3WE3A 1I3AA 3DPTA 2H09A 3LSMA 1MMAA 3PSFA 4XLPF 1X1CA 3ZMZA 1T08B 4B4CA 2OF7A 4LOCA 4IVNA 2ECBA 1IC8A 1MSEC 2Z5UA 3OIPA 3CESA 4ESFA 2MD0A 2A69F 1F36A 4RB3C 2XC7A 3E6DA 4WXDA 5TGTA 2VBZA 3ZQLA 2QQAA 2VOPA 1G59A 1ZH5A 1IXRC 3ZQ7A 1JHHA 1FNNA 4HZFA 2R92J 5KHDA 2RN7A 1LDJA 4M3GA 2HNHA 3AAFA 2O5RA 4ENNA 1TLHB 3RQIA 2KMUA 2BHZA 2EZKA 3T8TA 4F91B 3DPUA 1ONVA 1HDPA 4LJZF 4MTEA 3GZNB 1TP4A 3FF5A 4U0YA 4IPAA 3B6AA 5D4RA 4FTHA 1VQOI 3EUKL 3L2WA 4ENJA 2HFHA 3CC2I 3KETA 1WHUA 1R4NB 4MQVA 3QP6A 3OYKA 1OR7C 1U2WA 5ICEA 2DOAA 1WRJA 4A0ZA 1I50J 2LYCA 5HDGA 2PMZA 3NWSA 4DJAA 1WKMA 4IHWA 3C1DA 2PQ8A 1IRGA 1T33A 1J7KA 2M1BA 2ME6A 3ZQGA 2O9LA 1F5TA 1FWZA 3WTUC 2HKXA 2ZXJA 2BY2A 2HDWA 5ILUA 1HKQA 5H6RA 1K6YA 2FNAA 1NK2P 3OYLA 1ETVA 4L9TA 3EYIA 1YW7A 1D0ZA 3FKIJ 3JRDA 2IJLA 3I56I 3I53A 3DTEA 3M8JA 4IHYA 1P9QC 2IAIA 1IN4A 4IHSA 3C2BA 2QLZA 2QA4I 3WG9A 1X19A 1F9NA 1FYMA 1XB4A 3WTTC 5E18F 2HQNA 2FMLA 3BCBA 1FBSA 1W36D 1MMNA 3GTQJ 3A01B 4RAZA 2QZ8A 2ZBKA 4E7KA 4GCVA 5B5EC 1DP7P 4EQQA 4A12A 2IS4A 3LA3A 4XLCA 3BJOA 3HEFA 4F92B 4XKWA 4LG0A 5EGOB 4Z2YA 5TJJA 1SFXA 4PJJA 3LQRA 2G7HA 1FP2A 1Y6IA 2R0QC 4BE0A 3RZDJ 4L18B 3KYCB 1REPC 2H8WA 2V6CA 2CO5A 3OIOA 3V8JA 1QZZA 2LSOA 3TW6A 2QSGX 4ZYHA 3S3MA 2DA1A 3EUHA 2GXAA 2NS7A 4HOBA 2Q0OA 2R5YA 1JXSA 5D6FA 1U8RA 2UXNA 1I5ZA 2OCEA 1U9OA 1FSEA 1R1VA 3S1NJ 2WTEA 2Z99A 3W6VA 1FOKA 4DYCA 3DP7A 4BHBA 1UAAA 3F8FA 1QPIA 1E3HA 1A04A 4Q5SF 3VYUB 2E7XA 1SEUA 1LQ1A 1V3FA 2RDPA 3FBNB 1R5ID 5HOOA 4AIJA 4ENMA 3I59A 4XR6A 3ZN1A 5A2QK 3CCRI 2X1DA 3CJRB 4M6XA 4S04A 1RESA 2CG4A 2GIVA 4G7ZF 2CU7A 1D8JA 2IGOA 2R3SA 4XBFA 2VQCA 2PI0A 1MH3A 4MIMA 2LG4A 4ZZDA 2KQRA 5B1BH 3T8RA 2HDCA 3GWZA 4EM0B 1PP8F 2CW8A 1CF7A 4EGYA 2VC1A 3CDLA 4KICA 1JI8A 5E3LA 2ETHA 3UKGA 4IF4A 3ASOH 2Y0SA 2J5PA 3PIOF 4KT6A 4C2TA 2LTPA 3MEXA 1FYLA 2B9SA 1HSJA 2EZHA 1WI3A 4B3AA 4M3DA 3RSNA 4XLNF 2K9LA 3QP5A 3QYBA 1W0UA 2Y9YA 1AU7A 4KYWA 1MNEA 1TT0A 2K5CA 2VIXA 2CRGA 4PJNA 1Y1WJ 3GVAA 4ZTJA 1V5EA 1E2XA 1Y0NA 2W1OA 3I58A 1FPQA 1O7FA 3D5SC 5LD2C 4I98B 1BL0A 3G71I 2DK8A 2LBFB 3RIRA 5LHIA 3K2AA 4HDUA 4XQFA 3WU1B 1QVUA 3G1LA 2BE5F 3GTPJ 3BZCA 2EA2A 1NG7A 3F8MA 3IAS2 3JRGA 1X4OA 1TW2A 3J7YJ 2F4IA 1A6QA 2CUJA 2DMNA 1IV6A 3LWFA 3C2GA 1OCTC 4FX0A 2DMTA 3OSGA 2KL4A 5F64A 2MYSA 3CUOA 1SANA 4CYDA 3HRMA 1YLFA 2EJRA 1WSUA 2EV0A 5EDNA 2E2JJ 2MH2A 3HOUJ 2XAUA 3PSIA 5JHFA 2ID6A 4CSWA 1Z3YA 1A35A 4Z6YA 5D5WB 3K0LA 3KZZA 5K5OA 2B7EA 1F4KA 2YPRA 1ZR4A 2VJ5A 1MW7A 2LLKA 2M30A 4XLFA 3HOWJ 4E7LA 3SDBA 5TRDA 3S3OA 1FOWA 5FLVA 3AKZA 3OYHA 1RKWA 2P6TA 1MBEA 1OQYA 2OZ6A 4YIRX 1OCOH 4UUTA 5J8CA 2FSWA 4A3DJ 1TQMA 4AIKA 1SD4A 2ME0A 1XSXA 3JSPA 2ISYA 5IYBJ 1D3YA 1UZCA 3RTRA 3V8KA 3QPTA 1ON2A 4HNTA 3DLAA 2Z16A 4A69C 2CFXA 2CQKA 4Y33A 4BQNA 4E4HA 1IN6A 5IT9K 3R0AA 2HTJA 4EGZA 3L09A 4B44A 4A2UA 5F0FA 2Y9ZA 1N75A 5D8KB 2DTRA 4ESBA 1K83J 3I3LA 2KJCA 4HX7A 1MBFA 1AOYA 4I99C 1Z7UA 1TBXA 2JN6A 2L2OA 4AYBA 4D5CA 5FFZA 4CCMA 4KJZA 1K79A 1QA6A 3DXJF 2HTSA 2LKSA 3DKYA 1OYYA 4BDZA 1NG6A 4O5VA 2XGDA 1MJBA 1B9MA 5D6EA 4L9VA 1X1PA 1KQ0A 1I39A 2HOAA 4AUXA 1KA8A 2PMZN 5FKNA 2KIFA 2ZCWA 4LLGF 1ZYRF 2AXTC 1K78A 3L2QA 2MABA 1X58A 3QYFA 4QPOA 5CVRA 1QZEA 1TWGJ 4OAYA 1T6SA 5E1ZB 4BHCA 5ICGA 5EEGA 3KP7A 4PFPA 3RJPA 4HPQA 1JUSA 2GOXB 3RZOJ 4XKVA 3BTLA 4RAGA 3GFIA 3ZN0A 1YOVB 2K9MA 2QBYA 2YU3A 3DU5A 2W85A 4CA0A 4A0YA 1IO2A 2P5VA 4AIHA 2IP2A 3QQAA 3OYFA 3PNVA 2VJJA 4LG0B 4E7IA 3RYRA 3LSKA 2FBIA 2OTLI 1EKEA 2FBKA 2QUFA 3F9KA 3I9V2 1KQ8A 2ISZA 4XM3A 4M3BA 2L9VA 3HC7A 4RM2A 4HF0A 1B9NA 4UVAA 4LB6B 2G0EA 5J6XA 3J81K 4GRIA 5GPCA 3BTIA 3L2VA 4LG3A 2R5YB 1UELB 3ABLH 1R5GA 1D1BA 4UUSA 3HTSB 4CGZA 3BR5A 4L5JA 3ZMUA 3SZPA 4HW0A 3RPQA 4LB5A 2NVQJ 2RREA 4H0EA 1N77A 4BE2A 3CP2A 2ZSIB 3BTJA 5GADJ 3IL2A 1LEBA 3OR2C 3K4BA 5E3MA 2R7FA 2QQ9A 1W4MA 1ZK8A 3GW2A 3WODF 4G7HF 5BMZA 1J59A 4ZTFA 2R4GA 1JGGA 3V7CA 1X1DA 5GP9A 4H4KC 3I59B 4HV6A 4HX4A 1T2KA 4EATA 3ZQCA 1Y8RB 3L1PA 2ZC2A 1JT0A 3DFGA 3TMOA 5LEKA 3LMMA 4UB6C 2PLYA 1HC8A 1D5VA 1GV5A 2K3PA 3F8CA 4PK4A 3TOAA 3CCVI 2CV1A 1LPQA 1JE8A 1UCRA 2CV0A 3IHUA 1QQIA 2XRLA 3DEUA 4BNCA 5ICCA 2DCEA 1U8BA 1H89C 3M7GA 1SC7A 4M3FA 3FXRA 3K70C 2CW7A 4RB1A 3E7LA 3EPZA 4BYYA 3E6MA 2XGCA 3GO5A 3K2ZA 4A3KJ 4BXFA 1I1GA 2NS8A 1YIOA 1W5SA 2BW3B 2Y75A 3VYSB 3TEDA 3TQNA 1G8XA 3P7NA 2L7MP 2CQNA 4WCGA 1VQPI 2E1CA 2JVHA 3K4LA 3EUHC 4RGUA 1R6RA 3A03A 4EEFG 3F6VA 3QODA 4Y3OA 4B09A 1D0YA 2Y69H 4XRFA 1ZARA 4OAZA 5KCMA 3CCMI 2GLOA 3VDXA 2MSYA 2DFEA 1P7IA 3S2HJ 4XLAA 4ZYEA 3O6BB 3PNTA 2WV0A 4B1RA 3OWTA 2K85A 5CPRB 2KISA 2DYSH 2O8XA 2VASA 1VQ7I 1YYVA 1VQLI 4UUVA 5GPAA 4BDYA 3H35A 2A07F 1R58A 2BXYA 2XIGA 1RIOH 4MHGA 1EH6A 2M0MA 5EGOA 2Z9OA 3O8GA 2JA8J 1XSVA 4DNCA 3JRHA 5DV5A 2LY2A 4HA8A 5KVRA 1HCRA 2ZXHA 4B47A 2VC0A 1HW1A 2K4BA 3HRSA 5CVIA 3U9GA 5DD8A 3GFLA 2ZB9A 4Y13A 3BZ6A 2VJIA 2J5OA 2CQXA 1ZREA 2A6EF 3H3UA 2OD5A 3CUQA 5L3DA 2L4MA 2RC4A 1MJ9A 2XGXA 4EM1A 4RA2A 2XF6A 2PJRA 4PDKA 2E2HJ 3WTSC 2CGPA 1FBUA 1RETA 3S3NA 5LFAA 2AQEA 1YIJI 2A61A 2MFZA 2XSDC 1JGSA 2LVSA 3DTKA 2XAFA 2ZJ2A 4PJMA 5HNFA 4M71A 1O3RA 2L54A 1BW6A 3BP8A 4A3GJ 4PSXA 3FMQA 3NARA 5DCFA 2X6OA 2HPIA 2LREA 2WV1A 3H5AA 2LR8A 3JAMK 1VQ9I 1DQUA 2E35A 4ZYAA 3CMAI 3Q0WA 2DDAA 4XLEA 5M3MJ 2FX0A 1YW8A 3KP2A 3CCJI 2HOSA 4BU2A 1G4DA 3ZGKA 1QHGA 1HOMA 1PUFB 1R22A 3J7AY 2BV6A 3CMEI 2PBIA 2GXGA 5DUIA 2OQGA 3N97A 2NVUB 3DLLF 2V1NA 2X1EA 3HGGA 2GBYA 1O3TA 4IO9F 2W4SA 1ZHFA 2A5WA 2E1MC 1BI0A 4ESJA 3JSOA 2GM4A 3KEOA 4K2EA 2WY7Q 2DT5A 1D8KA 3D5RC 1FX7A 2KIUA 3K10A 4DW6A 2P7CB 1J2XA 2NYXA 3MQ0A 1IGNA 3WGIA 2CJJA 4RGSA 4MEXF 1OCPA 3KIOA 3KZIC 1STZA 3BTCA 4D7NA 3GTOJ 3KYLA 2VI6A 4BL0B 2UWMA 2K9QA 3Q9SA 4IX7A 1VQ5I 5FLMJ 4BGDA 1QGPA 2P0WA 4IKFA 3F21A 3S14J 3HUGA 1K78B 1WJDA 3ZXSA 2FRHA 2K9SA 4G9YA 3ISPA 2LMDA 2R7WA 2H8RA 4AYBN 3QU3A 2EIKH 4FHTA 2V79A 1XMAA 4KFCA 4HV5A 2WAFA 4HLYA 1LUJB 4XOTA 3V4GA 2FQ4A 3AG3H 4CZZA 1A31A 3WTWC 4IZZA 2M5WA 2ZJPF 3HSFA 2E1OA 2GA1A 4II2A 2Q2EB 2W57A 2X0LA 4WXHA 2R7TA 1DGRM 5LRSA 2CSOA 2QBYB 1IV8A 4I7HA 4N4NB 2QCOA 5F1RA 2XKPA 2P5KA 2HWVA 1KYWA 3GYHX 3EYYA 3K70D 1W1WE 1JTXA 2ELKA 3S2WA 3J80Z 3KX2A 3B02A 2NAZA 2XPUA 3DKXA 2VQLA 3BROA 2BVLA 3KP3A 3SZTA 5K1YA 2V1UA 3D5LA 1FTTA 3RPUA 1QNTA 3ERED 2BY0A 4CCLA 2M4KA 4XN0A 2R7ZJ 4JP0A 3P9IA 2EPFA 4KISA 1I27A 4E7SA 1T98A 2HI3A 2VJ4A 3HHHA 4L0YB 4UUSB 3H3ZA 5LGNA 2JK3A 4AVPA 3AG4H 3GBGA 1K6OA 3ZMTA 2X6XA 4ZYDA 2PEXA 1G3TA 4LIVA 4NHJA 2NVTJ 1XGSA 2A5YB 1W7PA 3OV8A 2VOOA 1LKXA 4EMSA 3ABMH 1O7LA 1X2NA 3MVPA 5LHGA 1Y1VJ 3HOSA 1GVDA 5CKTA 1MBKA 2IGMA 4WXCA 1WJFA 3HOTA 2EFWA 1YO5C 1BA5A 2KDOA 3K1MA 1QPMA 4EJVA 1B72A 2DQLA 3M9AA 3GXOA 4Q48A 3I4PA 5EF6A 3BCAA 4BBRJ 3IAM2 4CCJA 1JTYA 2DA4A 5JVGF 4QIWN 3M8FA 2RKHA 2X6YA 1XCBA 2JZYA 3RCOA 3QOPA 4B3XA 2LK2A 4IHXA 1ETXA 2B63J 1WGXA 1EH8A 4PZJA 2PJPA 1WJCA 2JUCA 2P6SA 2L01A 4YIIA 1IUYA 1R49A 1F43A 3SQNA 4ZZLA 3E3VA 3JTGA 4HAMA 3MZ8A 4P9FA 2M3AA 1V55H 4NNJA 2LOOA 5HLTA 4J19A 5FLXK 2OA4A 2QKLB 4FISA 1FLIA 3TP3A 4GYIA 2NRAC 2KIQA 3BR1A 2CS3A 3CJNA 3BPVA 2LKXA 3V8LA 4M6VA 1C0WA 1JHFA 5EG0A 1B59A 5L3GA 1R9TJ 4A3MJ 1N78A 2CV2A 2JTVA 3BJAA 3MMYB 1AKHA 3DBLB 4A3FJ 2HYGD 3CDHA 1X1BA 9ANTA 1KZHA 3AG1H 4I01A 2R7OA 3DPLC 3CO6C 4BXUA 4NC6A 1WJ5A 2I5UA 2MLGA 1LJ9A 3ULQB 1DU6A 5IYDJ 3NQOA 3EDPA 4P5OA 4D7MA 4JX5A 1G2HA 3DEWA 1PVEA 3RKWA 4CHUA 2LF7A 1VQKI 3OS2A 3OYCA 3SXYA 2O7OA 5K5QA 1W5CC 3LSIA 1CGPA 2LF8A 4ASNA 2FBHA 5EZGA 1TWFJ 5E1XA 4ZDPA 2F6CA 3FXLA 3PUFA 4EVIA 4JBAA 1BR2A 4D5FA 3DU6A 4ZDLA 5DM7F 4BH9A 3DBRB 3CUQB 3MWMA 5IP7J 1V54H 3LFKA 2R5ZA 4LK1F 3OIQA 1G3YA 1G3SA 2PJRB 1SD6A 3MZYA 5C3EJ 1TWAJ 3FHNA 1OYWA 2XRNA 3BR6A 2BEOA 4U87A 3IRRA 5FO5A 3F0CA 2F4OB 2HDDA 1ACIA 3ZCOA 3G73A 2K4JA 4A3JJ 3S1RJ 2ACJA 1XPXA 1DDNA 2KKOA 2L0KA 3PQJA 1OJLA 1YI2I 2QWWA 3HOVJ 2G7UA 3H9QA 1XD7A 3QPHA 3KPHA 1IXCA 2ZO4A 2JRMA 3I55I 1U0JA 2IVMA 2WAQN 3E6CC 4HSRA 4LFUA 3JRBA 1VI0A 5DCMA 1ZKGA 1DPRA 1YJNI 4GXOA 2DMPA 3OL3A 2FOKA 1H8AC 1YHQI 1UHWA 4JX6A 1FC3A 2DA7A 3UR3C 5ED4A 1FTZA 2ESNA 2F5EA 2BW3A 5EYRA 1Z1DA 2KJBA 3SFIA 2H94A 3CLOA 3QWLA 5FD6A 3CC4I 2L5QA 1ODDA 2O03A 2AHQA 4WK8F 3CP8A 3GTLJ 5IYCJ 4CZCA 3CUQC 4GO1A 3C18A 3QOEA 5GAHJ 4HQEA 3LSTA 3IH4A 2EIJH 1IZ1A 2XGEA 3DQVC 3QPSA 1G3WA 2JPBA 1YTYA 2EWNA 3HUGB 3BC8A 3OL4A 1FIPA 4UB8C 4AIDA 4F7ZA 3ESWB 3KLOA 4RLQA 1H0MA 2BXZA 3BT9A 2E71A 3BR0A 3K4CA 2JA6J 5HLGA 1WFXA 1SAXA 4P9UA 4MFEA 4OMYA 1FBQA 1PP7U 2ESHA 2EFQA 4C3JJ 2VXDA 2Q1ZB 2KPMA 3K69A 4G6QA 1P6RA 4M73A 4XICA 3EUAA 1V5GA 5HLIA 4Y15A 1RR7A 3QU6A 2LH9A 3TP0A 1GXQA 1DUXC 1S9HA 2RQPA 1YX5A 5BNGA 3L2RA 1OCRH 2E5NA 4D0PA 1S8NA 4EJWA 2KLOA 1U5TA 1G6NA 3DBHB 1YITI 4JOMA 2O6GE 2X6WA 1WPKA 1T95A 1P4AA 3ECOA 2A3SA 1MZBA 3ROUA 4NDLA 3REOA 2XHKA 2KRHA 3W2WA 2OQRA 2OUMA 1PDNC 3BQZA 1MMSA 1POGA 4XSXF 2EFOA 5LGUA 1LB2A 3BLYA 1F1ZA 2EZLA 5EZHA 4OIOF 1J09A 3NWTA 2OZUA 3GTKJ 4CO8A 2VT3A 4RGXA 3M1EA 1GXPA 5B66C 3M4OJ 4OIQF 1YFHA 1AA7A 5K7HA 1LVAA 4BQQA 1SMTA 1W7PB 1FP1D 5DDGA 4YELA 2DBBA 5F27A 3IWFA 2CQQA 1XMKA 1Z6RA 3BG7A 2RNGA 4TV7A 3H0DA 3F23A 1VTNC 2MBFA 4A5NA 1Z91A 1B6AA 2EV5A 1O3SA 2QSFX 1B72B 1MGTA 4G7OF 2OC6A 3BG5A 1ZRDA 1D0XA 3U2RA 1PUFA 2NOGA 1USSA 2HPMA 2IA2A 2KP6A 2LY9A 1CQTA 2Z33A 1W0TA 1ZN2A 5IOYA 2W82A 1H9TA 2AXLA 4BAYA 4LD5A 1B8IB 5TISC 5J4VA 4IOAF 4XRSG 4LIUA 4XRSA 4DOZA 2YR2A 2TDXA 2D45A 2NNNA 1GV2A 2KZVA 2VKVA 3F3XA 4XK4A 1S7AA 2ICWG 2JMWA 2BZTA 3BR2A 2DO7A 2KFDA 5KNLA 2XVCA 2BOLA 4OINF 2F4MB 4XLHA 3OYAA 2V6EA 3WGHA 4E7HA 4XRMA 4NC7A 3P9KA 2ZJQF 1UG2A 5CLSA 2GQQA 2K3FA 1HW2A 4WWCA 4DGWB 1HF0A 4KMFA 4IHVA 2GXBA 3A0HC 1IAWA 2ADUA 1AWCA 5EG0B 2MC4A 4CICA 3FXUA 4CXFA 3V7SA 4BJ6C 4YFKF 2WWYA 4A3CJ 2Q2EA 1R7JA 2VB6A 3PL8A 4ITVA 3HYIA 3ABKH 2HQAA 5IOZA 3PUBA 1AKHB 1VQ8I 1K7AA 3HOXJ 4U7DA 3D1NI 3H9JA 1ITYA 4KA4A 3SEZA 1HW5A 1M1EB 5B3SH 5E3NA 2ZFUA 4C3HJ 4XKCA 1ENHA 2B0LA 1RZ4A 1Q1HA 3F72A 2VQHA 4A93J 2QQ8A 5F0CA 1VNDA 3K9TA 3R60A 4C2UA 3TL4X 2K27A 2BYVE 3CD6I 1L0OC 4RAFA 1BJAA 3GZ5A 3CF5F 4EM2A 2VKHA 2JSCA 3HSRA 1BI2A 1NHAA 2EQRA 2LDUA 1OPCA 2F5VA 2VONA 3QPLA 4XSZF 2DOFA 2E1NA 2P5LC 2R5ZB 4FCYA 1J5YA 2QSHX 1YJ9I 3W2AA 5D4SA 2PG4A 2GAUA 1HA8A 2MC3A 2K40A 2CUFA 3GTJJ 2L4AA 3CJQB 5EJCA 1WJBA 1X3WB 1Y56A 3ZRGA 1IRZA 4C30A 2F5DA 3FM5A 1LDKB 3CCUI 2JVGA 2CMPA 3VB2A 2E60A 3RDIA 1ZG5A 2IPQX 4RB0A 1OCCH 3J7ZI 2LKPA 1USTA 2KIMA 2XV4S 3VFZA 5BPIA 1VQMI 3JRIA 2R7DA 3OMYA 3E6BA 4GGGA 2XUBA 2JUGA 4U7BA 2DFIA 5DCMB 2MH9A 3K4MA 3GCMA 3IH2A 1HQCA 3PNYA 1ZTRA 3R4KA 2W7NA 4ENKA 2P8TA 4JQFA 4RLFA 1ETYA 5E8IA 3BY6A 4L0ZB 4A3BJ 4MGRA 2X1CA 5J47A 2LD5A 4MLOA 3GLXA 3EETA 1IRXA 4U88A 3WTZA 4EJOA 5HDNA 1ZRCA 3HXLA 4UV9A 1LFBA 1MJAA 1WZ2A 3K6GA 3PQKA 2C6YA 4B48A 2Y0SN 2IA1A 5L3FA 5BS6A 3L2CA 5C4XJ 1HBXG 4HF1A 4MTDA 5CJ9A 3LSPA 4A3EJ 2IT0A 1GHCA 1WH7A 2JQ7A 1TT5B 5J4YA 2EBIA 3FXKA 3G2BA 2R7XA 1TWCJ 2F48A 2L3DA 3ZQHA 1GLNA 1MMGA 4FETA 2QGUA 1JUMA 3E0JB 3KE2A 4A3LJ 3BQYA 2UV1A 4RMNA 1R23A 4BE1A 3BWGA 1X4PA 1Y39A 2Y0MA 3LA2A 2MG4A 3CO7C 4DYQA 2O61A 2E1MB 4PFOA 1HKTA 4MQ9F 2V1XA 4YIFA 3MD2A 5F0HA 1LFPA 2UXXA 2CWEA 1BR1A 2E19A 4RDUA 4L5EA 3RPUD 2E2IJ 1U5TB 3H1CA 1ORKA 1WWXA 4LMYA 3FIWA 1Q1VA 1KU3A 1YS7A 2K02A 3Q9VA 1TQIA 5FGMA 2VLAA 3M07A 3TO6A 3IKTA 1U9NA 2YS9A 4G6DA 1SAUA 5AIQA 3GTGJ 1P2FA 3N4MA 1FMWA 1K61A 3NRVA 2VKEA 2EFPA 2V4JC 2QEXI 1BJZA 1E17A 5KK1A 1NK3P 1T38A 1TTYA 1XDUA 4UXNA 2YX4A 5H2FC 3KFWX 1W7PD 2V9PA 3ZMSA 5E8GA 3ZQIA 5LEJA 1YRNA 5K5RA 4C2MJ 1SFKA 3W3CA 4QWQA 2I10A 3CZ6A 1OISA 3L7WA 3DKWA 2IRFG 1XX5A 4HDVA 3OSFA 3WU2C 5FRMA 4CYCA 3FMRA 3TKYA 2QQBA 3VYRB 1BOAA 4IHTA 1A36A 1TL8A 3CLQA 4OOIA 1ETKA 4HBLA 3JR9A 1BI1A 4XOPA 3CMYA 3UNGC 3A0BC 5J1YA 1IN5A 5E3OA 3ZPLA 3HB9A 1BC7C 1MKMA 3G1MA 3VPRA 3HOZJ 2AS5F 2WA0A 4Q4ZF 4RAYA 3FMSA 1SFEA 2HZDA 4MO7A 1U5TC 1W36C 1VF9A 3BZKA 1BOBA 5CQEA 1R4MB 1ZGWA 3ZMVA 2JJ7A 1BBYA 5BPDA 1TNTA 2DAOA 4NC8A 2Z3YA 3ECHA 1IXSB 2EILH 3CTAA 1MD0A 1SVOA 4UY8I 2GA2A 4P96A 3HPHA 4HLXA 1MNMC 4AC0A 2HYFA 2Y2ZA 4AWXB 1YQAA 2L9SA 3OYMA 5C4JJ 2FEZA 4O3MA 3DWLE 1FYKA 2MW8A 1U78A 1TW3A 4BUPA 5FB2A 1WJEA 2TCTA 3LNQA 1Z77A 3ABUA 4X0GA 3W6KB 3NEUA 2YSRA 3HZJA 5B1AH 1EV7A 3I71A 3Q0VA 1O4XA 3U21A 4HNUA 2R93J 4FE4A 2BY3A 3OYEA 2IS2A 1JKPC 3L9FA 1R00A 2V9KA 3KLNA 2VQGA 1MBJA 3N05A 1KU7A 2FQ3A 2UUZA 2HGCA 3WGGA 2A6HF 3BR3A 5IP9J 1VFCA 2R7RA 4KT5C 1ZLKA 1O57A 2WADA 2X85A 5EEAA 3PJRA 4XKBA 2IW5A 1ZR2A 1XMXA 2EK5A 3TO7A 5A2QZ 3T1BA 4II3A 3HL2A 3LSHA 2O0YA 3GUDA 4UVCA 2H6CA 1UMQA 1XC5A 2K7LA 4C3IJ 2DFFA 1BW5A 4L5IA 1U6GA 1XDSA 3OYJA 3LQQA 1T0FA 1IRFA 2QENA 2DU9A 3CCYA 3ZR8X 3A4CA 1AHDP 1RUNA 1T8IA 2JA5J 3T0YA 1MSFC 1UJ8A 2BY1A 1MDMA 2N8GA 4HF2A 2VKDA 2COBA 3AG2H 1ERDA 1X2MA 2DA6A 2W25A 4UVBA 4AD9A 3MKYB 3BPXA 4QTRA 1X1AA 3HTUA 3MKWB 1BM9A 1NH3A 4F55A 3B73A 1Z21A 5L3CA 4JX4A 1RR8C 4ZJZA 2STTA 3BDDA 3H5NA 4J01A 5C44J 2DMQA 3SDGA 3U1KA 1ZQ3P 2X4HA 1SFUA 1QHHD 2M0CA 3KP5A 2ZFWA 1B8IA 2H1LA 2M34A 1QBJA 1EJ9A 3K1NA 1WVRA 2NVYJ 2YX7A 4RB2C 3IRQA 3O3KA 5D5XB 1W5TA 4A0XA 2LC2A 2LY1A 3ASNH 2CUZA 3PIPF 4LLLA 3G6EI 2NNYA 4E70A 3OR1C 4OIPF 1RI7A 3DCFA 3A2KA 2DODA 1IDYA 2IEKA 5F04A 2CQ7A 4BXXJ 3GEZA 3LSRA 3S32A 3MCZA 3DF8A 3ZMDA 3Q5FA 3GFMA 4P55A 5E1WA 2GZWA 1HXDA 4PGGA 2EFNA 2FOWA 4Q47A 5CYVA 3QRFF 1VQ6I 1Z3XA 2JPCA 3HRUA 4W1UA 1S3JA 4BJ5C 1TWHJ 3AFHA 5H20A 4V19K 3C7JA 3MZHA 1FMVA 4M72A 1QRYA 2DOEA 3BJ6A 2KRCA 2OU2A 3TDUC 2WY8Q 3LFUA 1LDDA 2HS5A 1PYVA 2CYYA 2R7QA 2VL8A 3HM5A 4I02A 1SVLA 1JJ6C 1PUEE 1SMYF 1UG0A 3WHCA 2HXIA 3LSGA 2UZKA 1IDZA 1FOYA 2K9NA 5J1RA 3S17J 4FQGA 4BEHA 4OWRB 4FE7A 1TQPA 5EEHA 5ERIA 3KCCA 5K7ZA 2ZXWH 2DA3A 3DTIA 4XONA 3JTHA 1LEAA 1RKTA 1J75A 2VT2A 4Y52J 2MGQA 4G6TB 1XS9A 1JKQC 4I2OA 3HPGA 2D1VA 1A6IA 3BG3A 2DLLA 3K7AJ 4OIRF 4YG2F 5IT9Z 4HQMA 4DYRA 2VBWA 3CMMA 4PCQA 1QU3A 2PX9A 2DTZA 3FWEA 3K4JA 5LGTA 1VZ0A 5HLHA 3CF2A 3K4KA 3QAHA 5KAFC 1ZAOA 2CUEA 2FNPA 2L7KA 3NAUA 3R0JA 3TOBA 2VE9A 3HIFA 1XN7A 2HXOA 2HU9A 4XIDA 3E5UA 3I54A 3H5RA 1YRNB 2XSJC 4DIQA 1BI3A 2M2EA 2M8EA 2A6TA 2HKOA 3ZQQA 3WE2A 1EF4A 2VUMJ 3G4SI 2V1DA 3S1MJ 1ZG3A 3BOQA 2ELHA 4S05A 1RRJA 4CYCB 4IRHA 2AO9A 1YX3A 3FK7A 1B1BA 3J80K 2XASA 3ONQA 4IL6C 3KP6A 2Q8KA 4DBRA 3FHZA 3FXQA 3E5XA 3RYPA 2ELJA 4UV8A 2XAHA 3G3ZA 4M3EA 3AL0B
chains in the Genus database with same CATH topology
2BZTA 1UJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BZT A;  1UJ8 A; 
#chains in the Genus database with same CATH topology
 1TC3 C;  5AON A;  2E36 A;  2X9D A;  3Q0U A;  2DFH A;  3HDD A;  3A02 A;  2WAE A;  4KIT B;  4U0W A;  5ILS A;  5JLX A;  2R7S A;  3EQL F;  2OAZ A;  5HOD A;  2XF7 A;  3OYN A;  1VQ4 I;  2VXZ A;  2PFB A;  4BY7 J;  3GME A;  3PFI A;  3OOU A;  3OYI A;  2ECC A;  5M5W J;  4LLN A;  1DGW Y;  2DQR A;  2JWT A;  4JYK A;  1JJ8 C;  1ULY A;  5DD4 A;  2VBX A;  1J9I A;  4B8X A;  2HQ5 A;  3BG9 A;  4ANJ A;  1H9G A;  3I0T A;  4V2F A;  5M5Y J;  2XAQ A;  3E5Q A;  3JRA A;  3HGY A;  5IY5 H;  3HKZ A;  3SYT A;  2MD5 A;  3LL7 A;  3J81 Z;  1FOX A;  2FA5 A;  5JFR A;  1ON1 A;  3MAJ A;  4NBQ A;  3GF2 A;  2RAE A;  4R8H A;  3W6J B;  4DBQ A;  2JA7 J;  2Y31 A;  3HOY J;  2RQQ A;  2EZI A;  2DXI A;  1RPW A;  2RV8 A;  4F3Q A;  3ABT A;  3OYB A;  1DP3 A;  2M9H A;  1OYI A;  5HS7 A;  1E3O C;  1MBG A;  1ZG1 A;  4OMZ A;  2FD5 A;  4HEA 2;  2W24 A;  4IRG A;  2DA5 A;  5HS8 A;  3H92 A;  3FDY A;  3P5J A;  1IW7 F;  3S93 A;  1EH7 A;  1DU0 A;  5FRO A;  3IUO A;  3VOD A;  2M7A A;  2H6B A;  3C3W A;  3K1P A;  2IXS A;  1Z05 A;  3HSE A;  4M6Y A;  4F93 B;  3AL0 C;  5DEQ A;  2ZME A;  2PN6 A;  3V42 A;  2K86 A;  1MH4 A;  3OYD A;  4M74 A;  3KEY A;  5IT3 A;  4N0B A;  2HYJ A;  4DZJ A;  3VOE A;  1BR4 A;  2VOD A;  4P1W A;  5L3E A;  1SVM A;  5GTI C;  2COM A;  4NQW A;  1D1A A;  1LNW A;  5DUK A;  2H27 A;  1ZEL A;  2BGC A;  4KIF A;  1I3Q J;  3QYE A;  1Y0U A;  5FD5 A;  2MLK A;  3ML6 A;  3GZ6 A;  1WJA A;  5L3B A;  1MDM B;  4NB5 A;  4BQO A;  5GAE J;  1JUP A;  2XAG A;  2ZJR F;  1GVJ A;  3DEE A;  2W00 A;  4I76 A;  4CH7 A;  1HST A;  1XSD A;  2WB1 A;  2O8K A;  2F2E A;  3I4M J;  2L9N A;  1IN7 A;  3ZP5 A;  2NXN B;  4KMU X;  4QLC U;  5CQG A;  2HVR A;  3M3Y J;  2PMH A;  2DW4 A;  1L3L A;  1T39 A;  1D5Y A;  2OJE D;  1R1U A;  1R1T A;  3IKV A;  5J40 A;  5CVU A;  5J8F A;  5M3F J;  2YU9 J;  1JT6 A;  3LAP A;  1IF1 A;  4M9X A;  2RVC A;  5GAG J;  2DJN A;  4RGR A;  3S2D J;  1E0E A;  1ZGA A;  5LRR A;  3JRC A;  3HRT A;  2DPU A;  4RM3 A;  1OFC X;  2Y30 A;  5D8L B;  2BBY A;  3CJT B;  5HNH A;  4AM3 A;  4CCO A;  2LNB A;  3M1C A;  3ZQF A;  3JRF A;  2XAJ A;  2ZNY A;  4BAC A;  5FFX A;  3RKQ A;  4HST A;  2EV6 A;  4KIB A;  3CCE I;  3DV8 A;  2W48 A;  3A1Y A;  1LE8 A;  1ZRF A;  3TBI A;  2D1H A;  3FX3 A;  1T0F C;  2FJ1 A;  2M8G X;  1Z67 A;  2EIN H;  3FK6 A;  4ZDO A;  4I0A A;  4ON0 A;  3E97 A;  1LVK A;  2ZKZ A;  3MKL A;  2QM3 A;  4IOC F;  1FZP B;  1V5F A;  3RKY A;  1Z7L A;  5LBQ A;  5FKL A;  2VPR A;  3WTX C;  3G1O A;  2IGN A;  1OLT A;  3OY9 A;  1MND A;  1K4S A;  4EJT A;  2X51 A;  4XL9 A;  4Y17 A;  3S8P A;  3F8N A;  4HNV A;  1XTA A;  2VN2 A;  1XGM A;  3M8E A;  1GT0 C;  3RKX A;  2JRT A;  2AQF A;  5AIP A;  2BVM A;  1UFM A;  2JT1 A;  1N25 A;  4PUS A;  5H6Q A;  3ELK A;  3H0G J;  2GWR A;  4BEH B;  1S72 I;  3R6S A;  1FEX A;  1R71 A;  2DI3 A;  4R79 A;  1QZY A;  1R5H A;  5DYM A;  2ID3 A;  3GFJ A;  1WQ2 A;  2DJI A;  4O6J A;  2LRD A;  2P81 A;  4QPQ A;  3JAM Z;  3RQ4 A;  4GDF A;  1OR7 A;  3Q3S A;  2HQR A;  5HS9 A;  3CCL I;  4IJA A;  4N9I A;  1KON A;  4EJU A;  3FIS A;  4EV0 A;  1S6L A;  3F22 A;  3GX4 X;  1BC8 C;  1WCM J;  3KP4 A;  3GLL A;  3GTM J;  2IGK A;  1XG1 A;  4NUB A;  4BQA A;  3TO9 A;  2CFO A;  4C9Y A;  3FM3 A;  1S29 A;  3S16 J;  4ZC3 A;  1KYZ A;  2BHY A;  4MNU A;  2XDV A;  4QSH A;  3W2V A;  5M5X J;  3WTY C;  1FSH A;  2E7W A;  1UHS A;  4S0H B;  3SZG A;  1NTC A;  1O3Q A;  3PO3 J;  4A6D A;  5IPA A;  4D1Q A;  1BIA A;  4KNY A;  5CVJ A;  2V7F A;  1ETO A;  4XNF A;  1MMD A;  2M4G A;  3I5U A;  1P7J A;  1EA3 A;  1IN8 A;  2XB5 A;  4G94 A;  3SEQ A;  3HJE A;  6PAX A;  2MA3 A;  1FIA A;  4YFX F;  2DA2 A;  1S7E A;  2DK5 A;  2P4W A;  1UB9 A;  3LOC A;  1J0R A;  4F52 A;  2V26 A;  1K4T A;  3MN2 A;  5F08 A;  3WU0 A;  3KYD B;  3SHF A;  3OS1 A;  4B43 A;  3JRE A;  4LGW A;  5FKK A;  1B4A A;  5CVV A;  2I8D A;  1UHM A;  3LAJ A;  5LHH A;  3F8B A;  2WBM A;  1OKR A;  2XF5 A;  3CQZ J;  3FXJ A;  4BKX A;  4R1H A;  1GDT A;  5E17 F;  3R61 A;  4KUM A;  4BY1 J;  2L7Z A;  4KDP A;  2DT6 A;  2QKM B;  4BBS J;  2O3F A;  1WI9 A;  5DS9 A;  1TZL A;  5BOX A;  4CDG A;  2ZNZ A;  1FY7 A;  2P7V B;  3IC7 A;  2GIZ A;  4N9H A;  4E7Z A;  4I09 A;  3VEP A;  3VYT B;  2XPV A;  3HG9 A;  5ILV A;  3RI4 A;  2FMY A;  1IJW C;  1MBH A;  2QYO A;  1RUO A;  4IXA A;  2Y48 A;  4HG2 A;  2ZSH B;  1CF7 B;  1V4R A;  4PJ0 C;  2IS6 A;  4CCN A;  5FKO A;  3SJM A;  3E1S A;  4MEY F;  4XMY A;  2DYR H;  1BIB A;  3LSJ A;  4GYG A;  3HBL A;  2WC2 A;  3F6O A;  4XN3 A;  4V2G A;  4IQJ A;  2OBP A;  3PFY A;  5KAI C;  3D0S A;  5FJ8 J;  2DPD A;  2HOE A;  1P92 A;  4I6Z A;  4E7J A;  1U3E M;  1S5L C;  4ZH4 F;  2R7V A;  1I1S A;  4JK1 X;  2R7U A;  3MKZ A;  3CC7 I;  2CH0 A;  3ZOB A;  3S1Q J;  1RC9 A;  4WX9 A;  5DTD A;  4J00 A;  1SD5 A;  1LFU P;  2HVS A;  1IUF A;  4PGH A;  3HKZ N;  5GTH C;  1A5J A;  4A5M A;  1KU2 A;  5FKM A;  5HDK A;  2KDZ A;  3H36 A;  5JI6 A;  3CCS I;  1APL C;  2A05 A;  2XB0 X;  4FT8 A;  5IP6 A;  1KU9 A;  3PM1 A;  4Y7N J;  2G9W A;  3O8H A;  3H9G A;  4D9J A;  4XOR A;  3A01 A;  5HVQ C;  1S7O A;  1HKS A;  3VSL A;  1I6X A;  4M9S A;  1HLV A;  2ZME B;  4U0V A;  2A68 F;  4KN4 X;  1OCZ H;  1BN5 A;  2D2W A;  2EA4 A;  1PJR A;  3ERM A;  3TW7 A;  4ABZ A;  2L7F P;  3C2H A;  1P4X A;  1GUU A;  2IA0 A;  4BHP A;  1Z6T A;  2DN0 A;  3JW4 A;  3PO2 J;  2KHM A;  2Z2S B;  4NQW B;  2XKO A;  4WF2 A;  3FZV A;  3H3V K;  3I4N J;  5BQT A;  3L2U A;  1T56 A;  3IH3 A;  3KZY A;  1YE9 A;  1XCV A;  2JA2 A;  2FXA A;  3COA C;  2E5Z A;  2EB7 A;  1SFO J;  2VPL A;  3MFK A;  5E79 C;  1HDD C;  1ETW A;  1YW9 A;  2OV7 A;  5FLX Z;  5J1U A;  1I6H J;  3FXO A;  3CDI A;  4ZYG A;  2NOJ B;  1D1C A;  2V9V A;  4A3I J;  1RNL A;  2RNJ A;  3FBI B;  3CCQ I;  2DDB A;  5LLQ A;  2WAQ A;  2FUG 2;  4A6E A;  4DQ2 A;  1R36 A;  3WHB A;  1VQN I;  2FU4 A;  1JKO C;  1KQ9 A;  5DM6 F;  1DPU A;  2WB1 N;  4DZP A;  5F6F A;  2RGV A;  4BJT A;  3OYG A;  2GOM A;  3SFZ A;  3OOP A;  1QVT A;  4HX8 A;  4W97 A;  2IBD A;  2PMU A;  4N4O B;  2QVO A;  4KN7 X;  1WH5 A;  2TRT A;  4UHT A;  4G12 A;  3V7R A;  4YRV A;  2OTJ I;  3I64 A;  5J3L A;  2OPT A;  2L02 A;  4OU0 A;  2DMU A;  2HOT A;  4L9N A;  4E6K G;  4RS8 A;  3JCU C;  4KIG A;  3VWB A;  5K7F A;  2IS1 A;  4LK0 F;  3HHG A;  2JSP A;  4IRI A;  3K4N A;  1ZLJ A;  4HYE A;  3L00 A;  2ZME C;  2QF7 A;  1LE8 B;  5JVT A;  3J7A O;  2ZXI A;  1XGO A;  1QO0 D;  2VBY A;  3O2P E;  4M9Z A;  2F5C A;  4LIT A;  2VE8 A;  2KRF A;  1MIJ A;  3T5X A;  1FT9 A;  3B6C A;  4AVZ A;  1FJL A;  4HRI A;  3BG6 A;  1H88 C;  3WG7 H;  3TDZ C;  2CW0 F;  4CCK A;  3LA7 A;  4IQ4 A;  2HEO A;  2FF4 A;  5ICF A;  1KGS A;  1E3P A;  1YS6 A;  2W84 A;  4G8X A;  5D5U B;  3IWZ A;  2NVX J;  3VSK A;  1OMI A;  3KEQ A;  3FKJ A;  1IG7 A;  3IV5 A;  2STW A;  4FAS D;  1XGN A;  2FE3 A;  2M45 A;  3U1D A;  2LBF A;  2KZG A;  4X1E A;  2HVQ A;  3WTV C;  4BS9 A;  2DT7 B;  4CUG A;  2M7B A;  4PJL A;  2F5F A;  2XPW A;  4MFD A;  5JR3 A;  2EH3 A;  4PSW A;  2D5V A;  1YG2 A;  1Z9C A;  2HR3 A;  2HZT A;  2EIM H;  4ETS A;  4UNO A;  2M87 A;  4RBO A;  1Y8Q B;  4L9J A;  1ETQ A;  2NS0 A;  4IEJ A;  1ZGJ A;  4YEJ A;  4FX4 A;  4I0B A;  4Y4R A;  1JKR C;  1X3Z B;  5F1J A;  2LFB A;  4X6A J;  1Z0X A;  2Z1D A;  4AU7 A;  1X3U A;  3S15 J;  3P9C A;  3X2Q H;  5JHU A;  3FXM A;  5FRN A;  2L9R A;  3TGN A;  5D5V B;  2YUS A;  2LP0 A;  2X48 A;  3IP4 B;  5JLW A;  2XRO A;  1YJW I;  2H1K A;  1SD7 A;  2E34 A;  2OCC H;  2KT0 A;  4GFB A;  1TNS A;  5E20 A;  1P4W A;  4YFN F;  3OS0 A;  3WE3 A;  1I3A A;  3DPT A;  2H09 A;  3LSM A;  1MMA A;  3PSF A;  4XLP F;  1X1C A;  3ZMZ A;  1T08 B;  4B4C A;  2OF7 A;  4LOC A;  4IVN A;  2ECB A;  1IC8 A;  1MSE C;  2Z5U A;  3OIP A;  3CES A;  4ESF A;  2MD0 A;  2A69 F;  1F36 A;  4RB3 C;  2XC7 A;  3E6D A;  4WXD A;  5TGT A;  2VBZ A;  3ZQL A;  2QQA A;  2VOP A;  1G59 A;  1ZH5 A;  1IXR C;  3ZQ7 A;  1JHH A;  1FNN A;  4HZF A;  2R92 J;  5KHD A;  2RN7 A;  1LDJ A;  4M3G A;  2HNH A;  3AAF A;  2O5R A;  4ENN A;  1TLH B;  3RQI A;  2KMU A;  2BHZ A;  2EZK A;  3T8T A;  4F91 B;  3DPU A;  1ONV A;  1HDP A;  4LJZ F;  4MTE A;  3GZN B;  1TP4 A;  3FF5 A;  4U0Y A;  4IPA A;  3B6A A;  5D4R A;  4FTH A;  1VQO I;  3EUK L;  3L2W A;  4ENJ A;  2HFH A;  3CC2 I;  3KET A;  1WHU A;  1R4N B;  4MQV A;  3QP6 A;  3OYK A;  1OR7 C;  1U2W A;  5ICE A;  2DOA A;  1WRJ A;  4A0Z A;  1I50 J;  2LYC A;  5HDG A;  2PMZ A;  3NWS A;  4DJA A;  1WKM A;  4IHW A;  3C1D A;  2PQ8 A;  1IRG A;  1T33 A;  1J7K A;  2M1B A;  2ME6 A;  3ZQG A;  2O9L A;  1F5T A;  1FWZ A;  3WTU C;  2HKX A;  2ZXJ A;  2BY2 A;  2HDW A;  5ILU A;  1HKQ A;  5H6R A;  1K6Y A;  2FNA A;  1NK2 P;  3OYL A;  1ETV A;  4L9T A;  3EYI A;  1YW7 A;  1D0Z A;  3FKI J;  3JRD A;  2IJL A;  3I56 I;  3I53 A;  3DTE A;  3M8J A;  4IHY A;  1P9Q C;  2IAI A;  1IN4 A;  4IHS A;  3C2B A;  2QLZ A;  2QA4 I;  3WG9 A;  1X19 A;  1F9N A;  1FYM A;  1XB4 A;  3WTT C;  5E18 F;  2HQN A;  2FML A;  3BCB A;  1FBS A;  1W36 D;  1MMN A;  3GTQ J;  3A01 B;  4RAZ A;  2QZ8 A;  2ZBK A;  4E7K A;  4GCV A;  5B5E C;  1DP7 P;  4EQQ A;  4A12 A;  2IS4 A;  3LA3 A;  4XLC A;  3BJO A;  3HEF A;  4F92 B;  4XKW A;  4LG0 A;  5EGO B;  4Z2Y A;  5TJJ A;  1SFX A;  4PJJ A;  3LQR A;  2G7H A;  1FP2 A;  1Y6I A;  2R0Q C;  4BE0 A;  3RZD J;  4L18 B;  3KYC B;  1REP C;  2H8W A;  2V6C A;  2CO5 A;  3OIO A;  3V8J A;  1QZZ A;  2LSO A;  3TW6 A;  2QSG X;  4ZYH A;  3S3M A;  2DA1 A;  3EUH A;  2GXA A;  2NS7 A;  4HOB A;  2Q0O A;  2R5Y A;  1JXS A;  5D6F A;  1U8R A;  2UXN A;  1I5Z A;  2OCE A;  1U9O A;  1FSE A;  1R1V A;  3S1N J;  2WTE A;  2Z99 A;  3W6V A;  1FOK A;  4DYC A;  3DP7 A;  4BHB A;  1UAA A;  3F8F A;  1QPI A;  1E3H A;  1A04 A;  4Q5S F;  3VYU B;  2E7X A;  1SEU A;  1LQ1 A;  1V3F A;  2RDP A;  3FBN B;  1R5I D;  5HOO A;  4AIJ A;  4ENM A;  3I59 A;  4XR6 A;  3ZN1 A;  5A2Q K;  3CCR I;  2X1D A;  3CJR B;  4M6X A;  4S04 A;  1RES A;  2CG4 A;  2GIV A;  4G7Z F;  2CU7 A;  1D8J A;  2IGO A;  2R3S A;  4XBF A;  2VQC A;  2PI0 A;  1MH3 A;  4MIM A;  2LG4 A;  4ZZD A;  2KQR A;  5B1B H;  3T8R A;  2HDC A;  3GWZ A;  4EM0 B;  1PP8 F;  2CW8 A;  1CF7 A;  4EGY A;  2VC1 A;  3CDL A;  4KIC A;  1JI8 A;  5E3L A;  2ETH A;  3UKG A;  4IF4 A;  3ASO H;  2Y0S A;  2J5P A;  3PIO F;  4KT6 A;  4C2T A;  2LTP A;  3MEX A;  1FYL A;  2B9S A;  1HSJ A;  2EZH A;  1WI3 A;  4B3A A;  4M3D A;  3RSN A;  4XLN F;  2K9L A;  3QP5 A;  3QYB A;  1W0U A;  2Y9Y A;  1AU7 A;  4KYW A;  1MNE A;  1TT0 A;  2K5C A;  2VIX A;  2CRG A;  4PJN A;  1Y1W J;  3GVA A;  4ZTJ A;  1V5E A;  1E2X A;  1Y0N A;  2W1O A;  3I58 A;  1FPQ A;  1O7F A;  3D5S C;  5LD2 C;  4I98 B;  1BL0 A;  3G71 I;  2DK8 A;  2LBF B;  3RIR A;  5LHI A;  3K2A A;  4HDU A;  4XQF A;  3WU1 B;  1QVU A;  3G1L A;  2BE5 F;  3GTP J;  3BZC A;  2EA2 A;  1NG7 A;  3F8M A;  3IAS 2;  3JRG A;  1X4O A;  1TW2 A;  3J7Y J;  2F4I A;  1A6Q A;  2CUJ A;  2DMN A;  1IV6 A;  3LWF A;  3C2G A;  1OCT C;  4FX0 A;  2DMT A;  3OSG A;  2KL4 A;  5F64 A;  2MYS A;  3CUO A;  1SAN A;  4CYD A;  3HRM A;  1YLF A;  2EJR A;  1WSU A;  2EV0 A;  5EDN A;  2E2J J;  2MH2 A;  3HOU J;  2XAU A;  3PSI A;  5JHF A;  2ID6 A;  4CSW A;  1Z3Y A;  1A35 A;  4Z6Y A;  5D5W B;  3K0L A;  3KZZ A;  5K5O A;  2B7E A;  1F4K A;  2YPR A;  1ZR4 A;  2VJ5 A;  1MW7 A;  2LLK A;  2M30 A;  4XLF A;  3HOW J;  4E7L A;  3SDB A;  5TRD A;  3S3O A;  1FOW A;  5FLV A;  3AKZ A;  3OYH A;  1RKW A;  2P6T A;  1MBE A;  1OQY A;  2OZ6 A;  4YIR X;  1OCO H;  4UUT A;  5J8C A;  2FSW A;  4A3D J;  1TQM A;  4AIK A;  1SD4 A;  2ME0 A;  1XSX A;  3JSP A;  2ISY A;  5IYB J;  1D3Y A;  1UZC A;  3RTR A;  3V8K A;  3QPT A;  1ON2 A;  4HNT A;  3DLA A;  2Z16 A;  4A69 C;  2CFX A;  2CQK A;  4Y33 A;  4BQN A;  4E4H A;  1IN6 A;  5IT9 K;  3R0A A;  2HTJ A;  4EGZ A;  3L09 A;  4B44 A;  4A2U A;  5F0F A;  2Y9Z A;  1N75 A;  5D8K B;  2DTR A;  4ESB A;  1K83 J;  3I3L A;  2KJC A;  4HX7 A;  1MBF A;  1AOY A;  4I99 C;  1Z7U A;  1TBX A;  2JN6 A;  2L2O A;  4AYB A;  4D5C A;  5FFZ A;  4CCM A;  4KJZ A;  1K79 A;  1QA6 A;  3DXJ F;  2HTS A;  2LKS A;  3DKY A;  1OYY A;  4BDZ A;  1NG6 A;  4O5V A;  2XGD A;  1MJB A;  1B9M A;  5D6E A;  4L9V A;  1X1P A;  1KQ0 A;  1I39 A;  2HOA A;  4AUX A;  1KA8 A;  2PMZ N;  5FKN A;  2KIF A;  2ZCW A;  4LLG F;  1ZYR F;  2AXT C;  1K78 A;  3L2Q A;  2MAB A;  1X58 A;  3QYF A;  4QPO A;  5CVR A;  1QZE A;  1TWG J;  4OAY A;  1T6S A;  5E1Z B;  4BHC A;  5ICG A;  5EEG A;  3KP7 A;  4PFP A;  3RJP A;  4HPQ A;  1JUS A;  2GOX B;  3RZO J;  4XKV A;  3BTL A;  4RAG A;  3GFI A;  3ZN0 A;  1YOV B;  2K9M A;  2QBY A;  2YU3 A;  3DU5 A;  2W85 A;  4CA0 A;  4A0Y A;  1IO2 A;  2P5V A;  4AIH A;  2IP2 A;  3QQA A;  3OYF A;  3PNV A;  2VJJ A;  4LG0 B;  4E7I A;  3RYR A;  3LSK A;  2FBI A;  2OTL I;  1EKE A;  2FBK A;  2QUF A;  3F9K A;  3I9V 2;  1KQ8 A;  2ISZ A;  4XM3 A;  4M3B A;  2L9V A;  3HC7 A;  4RM2 A;  4HF0 A;  1B9N A;  4UVA A;  4LB6 B;  2G0E A;  5J6X A;  3J81 K;  4GRI A;  5GPC A;  3BTI A;  3L2V A;  4LG3 A;  2R5Y B;  1UEL B;  3ABL H;  1R5G A;  1D1B A;  4UUS A;  3HTS B;  4CGZ A;  3BR5 A;  4L5J A;  3ZMU A;  3SZP A;  4HW0 A;  3RPQ A;  4LB5 A;  2NVQ J;  2RRE A;  4H0E A;  1N77 A;  4BE2 A;  3CP2 A;  2ZSI B;  3BTJ A;  5GAD J;  3IL2 A;  1LEB A;  3OR2 C;  3K4B A;  5E3M A;  2R7F A;  2QQ9 A;  1W4M A;  1ZK8 A;  3GW2 A;  3WOD F;  4G7H F;  5BMZ A;  1J59 A;  4ZTF A;  2R4G A;  1JGG A;  3V7C A;  1X1D A;  5GP9 A;  4H4K C;  3I59 B;  4HV6 A;  4HX4 A;  1T2K A;  4EAT A;  3ZQC A;  1Y8R B;  3L1P A;  2ZC2 A;  1JT0 A;  3DFG A;  3TMO A;  5LEK A;  3LMM A;  4UB6 C;  2PLY A;  1HC8 A;  1D5V A;  1GV5 A;  2K3P A;  3F8C A;  4PK4 A;  3TOA A;  3CCV I;  2CV1 A;  1LPQ A;  1JE8 A;  1UCR A;  2CV0 A;  3IHU A;  1QQI A;  2XRL A;  3DEU A;  4BNC A;  5ICC A;  2DCE A;  1U8B A;  1H89 C;  3M7G A;  1SC7 A;  4M3F A;  3FXR A;  3K70 C;  2CW7 A;  4RB1 A;  3E7L A;  3EPZ A;  4BYY A;  3E6M A;  2XGC A;  3GO5 A;  3K2Z A;  4A3K J;  4BXF A;  1I1G A;  2NS8 A;  1YIO A;  1W5S A;  2BW3 B;  2Y75 A;  3VYS B;  3TED A;  3TQN A;  1G8X A;  3P7N A;  2L7M P;  2CQN A;  4WCG A;  1VQP I;  2E1C A;  2JVH A;  3K4L A;  3EUH C;  4RGU A;  1R6R A;  3A03 A;  4EEF G;  3F6V A;  3QOD A;  4Y3O A;  4B09 A;  1D0Y A;  2Y69 H;  4XRF A;  1ZAR A;  4OAZ A;  5KCM A;  3CCM I;  2GLO A;  3VDX A;  2MSY A;  2DFE A;  1P7I A;  3S2H J;  4XLA A;  4ZYE A;  3O6B B;  3PNT A;  2WV0 A;  4B1R A;  3OWT A;  2K85 A;  5CPR B;  2KIS A;  2DYS H;  2O8X A;  2VAS A;  1VQ7 I;  1YYV A;  1VQL I;  4UUV A;  5GPA A;  4BDY A;  3H35 A;  2A07 F;  1R58 A;  2BXY A;  2XIG A;  1RIO H;  4MHG A;  1EH6 A;  2M0M A;  5EGO A;  2Z9O A;  3O8G A;  2JA8 J;  1XSV A;  4DNC A;  3JRH A;  5DV5 A;  2LY2 A;  4HA8 A;  5KVR A;  1HCR A;  2ZXH A;  4B47 A;  2VC0 A;  1HW1 A;  2K4B A;  3HRS A;  5CVI A;  3U9G A;  5DD8 A;  3GFL A;  2ZB9 A;  4Y13 A;  3BZ6 A;  2VJI A;  2J5O A;  2CQX A;  1ZRE A;  2A6E F;  3H3U A;  2OD5 A;  3CUQ A;  5L3D A;  2L4M A;  2RC4 A;  1MJ9 A;  2XGX A;  4EM1 A;  4RA2 A;  2XF6 A;  2PJR A;  4PDK A;  2E2H J;  3WTS C;  2CGP A;  1FBU A;  1RET A;  3S3N A;  5LFA A;  2AQE A;  1YIJ I;  2A61 A;  2MFZ A;  2XSD C;  1JGS A;  2LVS A;  3DTK A;  2XAF A;  2ZJ2 A;  4PJM A;  5HNF A;  4M71 A;  1O3R A;  2L54 A;  1BW6 A;  3BP8 A;  4A3G J;  4PSX A;  3FMQ A;  3NAR A;  5DCF A;  2X6O A;  2HPI A;  2LRE A;  2WV1 A;  3H5A A;  2LR8 A;  3JAM K;  1VQ9 I;  1DQU A;  2E35 A;  4ZYA A;  3CMA I;  3Q0W A;  2DDA A;  4XLE A;  5M3M J;  2FX0 A;  1YW8 A;  3KP2 A;  3CCJ I;  2HOS A;  4BU2 A;  1G4D A;  3ZGK A;  1QHG A;  1HOM A;  1PUF B;  1R22 A;  3J7A Y;  2BV6 A;  3CME I;  2PBI A;  2GXG A;  5DUI A;  2OQG A;  3N97 A;  2NVU B;  3DLL F;  2V1N A;  2X1E A;  3HGG A;  2GBY A;  1O3T A;  4IO9 F;  2W4S A;  1ZHF A;  2A5W A;  2E1M C;  1BI0 A;  4ESJ A;  3JSO A;  2GM4 A;  3KEO A;  4K2E A;  2WY7 Q;  2DT5 A;  1D8K A;  3D5R C;  1FX7 A;  2KIU A;  3K10 A;  4DW6 A;  2P7C B;  1J2X A;  2NYX A;  3MQ0 A;  1IGN A;  3WGI A;  2CJJ A;  4RGS A;  4MEX F;  1OCP A;  3KIO A;  3KZI C;  1STZ A;  3BTC A;  4D7N A;  3GTO J;  3KYL A;  2VI6 A;  4BL0 B;  2UWM A;  2K9Q A;  3Q9S A;  4IX7 A;  1VQ5 I;  5FLM J;  4BGD A;  1QGP A;  2P0W A;  4IKF A;  3F21 A;  3S14 J;  3HUG A;  1K78 B;  1WJD A;  3ZXS A;  2FRH A;  2K9S A;  4G9Y A;  3ISP A;  2LMD A;  2R7W A;  2H8R A;  4AYB N;  3QU3 A;  2EIK H;  4FHT A;  2V79 A;  1XMA A;  4KFC A;  4HV5 A;  2WAF A;  4HLY A;  1LUJ B;  4XOT A;  3V4G A;  2FQ4 A;  3AG3 H;  4CZZ A;  1A31 A;  3WTW C;  4IZZ A;  2M5W A;  2ZJP F;  3HSF A;  2E1O A;  2GA1 A;  4II2 A;  2Q2E B;  2W57 A;  2X0L A;  4WXH A;  2R7T A;  1DGR M;  5LRS A;  2CSO A;  2QBY B;  1IV8 A;  4I7H A;  4N4N B;  2QCO A;  5F1R A;  2XKP A;  2P5K A;  2HWV A;  1KYW A;  3GYH X;  3EYY A;  3K70 D;  1W1W E;  1JTX A;  2ELK A;  3S2W A;  3J80 Z;  3KX2 A;  3B02 A;  2NAZ A;  2XPU A;  3DKX A;  2VQL A;  3BRO A;  2BVL A;  3KP3 A;  3SZT A;  5K1Y A;  2V1U A;  3D5L A;  1FTT A;  3RPU A;  1QNT A;  3ERE D;  2BY0 A;  4CCL A;  2M4K A;  4XN0 A;  2R7Z J;  4JP0 A;  3P9I A;  2EPF A;  4KIS A;  1I27 A;  4E7S A;  1T98 A;  2HI3 A;  2VJ4 A;  3HHH A;  4L0Y B;  4UUS B;  3H3Z A;  5LGN A;  2JK3 A;  4AVP A;  3AG4 H;  3GBG A;  1K6O A;  3ZMT A;  2X6X A;  4ZYD A;  2PEX A;  1G3T A;  4LIV A;  4NHJ A;  2NVT J;  1XGS A;  2A5Y B;  1W7P A;  3OV8 A;  2VOO A;  1LKX A;  4EMS A;  3ABM H;  1O7L A;  1X2N A;  3MVP A;  5LHG A;  1Y1V J;  3HOS A;  1GVD A;  5CKT A;  1MBK A;  2IGM A;  4WXC A;  1WJF A;  3HOT A;  2EFW A;  1YO5 C;  1BA5 A;  2KDO A;  3K1M A;  1QPM A;  4EJV A;  1B72 A;  2DQL A;  3M9A A;  3GXO A;  4Q48 A;  3I4P A;  5EF6 A;  3BCA A;  4BBR J;  3IAM 2;  4CCJ A;  1JTY A;  2DA4 A;  5JVG F;  4QIW N;  3M8F A;  2RKH A;  2X6Y A;  1XCB A;  2JZY A;  3RCO A;  3QOP A;  4B3X A;  2LK2 A;  4IHX A;  1ETX A;  2B63 J;  1WGX A;  1EH8 A;  4PZJ A;  2PJP A;  1WJC A;  2JUC A;  2P6S A;  2L01 A;  4YII A;  1IUY A;  1R49 A;  1F43 A;  3SQN A;  4ZZL A;  3E3V A;  3JTG A;  4HAM A;  3MZ8 A;  4P9F A;  2M3A A;  1V55 H;  4NNJ A;  2LOO A;  5HLT A;  4J19 A;  5FLX K;  2OA4 A;  2QKL B;  4FIS A;  1FLI A;  3TP3 A;  4GYI A;  2NRA C;  2KIQ A;  3BR1 A;  2CS3 A;  3CJN A;  3BPV A;  2LKX A;  3V8L A;  4M6V A;  1C0W A;  1JHF A;  5EG0 A;  1B59 A;  5L3G A;  1R9T J;  4A3M J;  1N78 A;  2CV2 A;  2JTV A;  3BJA A;  3MMY B;  1AKH A;  3DBL B;  4A3F J;  2HYG D;  3CDH A;  1X1B A;  9ANT A;  1KZH A;  3AG1 H;  4I01 A;  2R7O A;  3DPL C;  3CO6 C;  4BXU A;  4NC6 A;  1WJ5 A;  2I5U A;  2MLG A;  1LJ9 A;  3ULQ B;  1DU6 A;  5IYD J;  3NQO A;  3EDP A;  4P5O A;  4D7M A;  4JX5 A;  1G2H A;  3DEW A;  1PVE A;  3RKW A;  4CHU A;  2LF7 A;  1VQK I;  3OS2 A;  3OYC A;  3SXY A;  2O7O A;  5K5Q A;  1W5C C;  3LSI A;  1CGP A;  2LF8 A;  4ASN A;  2FBH A;  5EZG A;  1TWF J;  5E1X A;  4ZDP A;  2F6C A;  3FXL A;  3PUF A;  4EVI A;  4JBA A;  1BR2 A;  4D5F A;  3DU6 A;  4ZDL A;  5DM7 F;  4BH9 A;  3DBR B;  3CUQ B;  3MWM A;  5IP7 J;  1V54 H;  3LFK A;  2R5Z A;  4LK1 F;  3OIQ A;  1G3Y A;  1G3S A;  2PJR B;  1SD6 A;  3MZY A;  5C3E J;  1TWA J;  3FHN A;  1OYW A;  2XRN A;  3BR6 A;  2BEO A;  4U87 A;  3IRR A;  5FO5 A;  3F0C A;  2F4O B;  2HDD A;  1ACI A;  3ZCO A;  3G73 A;  2K4J A;  4A3J J;  3S1R J;  2ACJ A;  1XPX A;  1DDN A;  2KKO A;  2L0K A;  3PQJ A;  1OJL A;  1YI2 I;  2QWW A;  3HOV J;  2G7U A;  3H9Q A;  1XD7 A;  3QPH A;  3KPH A;  1IXC A;  2ZO4 A;  2JRM A;  3I55 I;  1U0J A;  2IVM A;  2WAQ N;  3E6C C;  4HSR A;  4LFU A;  3JRB A;  1VI0 A;  5DCM A;  1ZKG A;  1DPR A;  1YJN I;  4GXO A;  2DMP A;  3OL3 A;  2FOK A;  1H8A C;  1YHQ I;  1UHW A;  4JX6 A;  1FC3 A;  2DA7 A;  3UR3 C;  5ED4 A;  1FTZ A;  2ESN A;  2F5E A;  2BW3 A;  5EYR A;  1Z1D A;  2KJB A;  3SFI A;  2H94 A;  3CLO A;  3QWL A;  5FD6 A;  3CC4 I;  2L5Q A;  1ODD A;  2O03 A;  2AHQ A;  4WK8 F;  3CP8 A;  3GTL J;  5IYC J;  4CZC A;  3CUQ C;  4GO1 A;  3C18 A;  3QOE A;  5GAH J;  4HQE A;  3LST A;  3IH4 A;  2EIJ H;  1IZ1 A;  2XGE A;  3DQV C;  3QPS A;  1G3W A;  2JPB A;  1YTY A;  2EWN A;  3HUG B;  3BC8 A;  3OL4 A;  1FIP A;  4UB8 C;  4AID A;  4F7Z A;  3ESW B;  3KLO A;  4RLQ A;  1H0M A;  2BXZ A;  3BT9 A;  2E71 A;  3BR0 A;  3K4C A;  2JA6 J;  5HLG A;  1WFX A;  1SAX A;  4P9U A;  4MFE A;  4OMY A;  1FBQ A;  1PP7 U;  2ESH A;  2EFQ A;  4C3J J;  2VXD A;  2Q1Z B;  2KPM A;  3K69 A;  4G6Q A;  1P6R A;  4M73 A;  4XIC A;  3EUA A;  1V5G A;  5HLI A;  4Y15 A;  1RR7 A;  3QU6 A;  2LH9 A;  3TP0 A;  1GXQ A;  1DUX C;  1S9H A;  2RQP A;  1YX5 A;  5BNG A;  3L2R A;  1OCR H;  2E5N A;  4D0P A;  1S8N A;  4EJW A;  2KLO A;  1U5T A;  1G6N A;  3DBH B;  1YIT I;  4JOM A;  2O6G E;  2X6W A;  1WPK A;  1T95 A;  1P4A A;  3ECO A;  2A3S A;  1MZB A;  3ROU A;  4NDL A;  3REO A;  2XHK A;  2KRH A;  3W2W A;  2OQR A;  2OUM A;  1PDN C;  3BQZ A;  1MMS A;  1POG A;  4XSX F;  2EFO A;  5LGU A;  1LB2 A;  3BLY A;  1F1Z A;  2EZL A;  5EZH A;  4OIO F;  1J09 A;  3NWT A;  2OZU A;  3GTK J;  4CO8 A;  2VT3 A;  4RGX A;  3M1E A;  1GXP A;  5B66 C;  3M4O J;  4OIQ F;  1YFH A;  1AA7 A;  5K7H A;  1LVA A;  4BQQ A;  1SMT A;  1W7P B;  1FP1 D;  5DDG A;  4YEL A;  2DBB A;  5F27 A;  3IWF A;  2CQQ A;  1XMK A;  1Z6R A;  3BG7 A;  2RNG A;  4TV7 A;  3H0D A;  3F23 A;  1VTN C;  2MBF A;  4A5N A;  1Z91 A;  1B6A A;  2EV5 A;  1O3S A;  2QSF X;  1B72 B;  1MGT A;  4G7O F;  2OC6 A;  3BG5 A;  1ZRD A;  1D0X A;  3U2R A;  1PUF A;  2NOG A;  1USS A;  2HPM A;  2IA2 A;  2KP6 A;  2LY9 A;  1CQT A;  2Z33 A;  1W0T A;  1ZN2 A;  5IOY A;  2W82 A;  1H9T A;  2AXL A;  4BAY A;  4LD5 A;  1B8I B;  5TIS C;  5J4V A;  4IOA F;  4XRS G;  4LIU A;  4XRS A;  4DOZ A;  2YR2 A;  2TDX A;  2D45 A;  2NNN A;  1GV2 A;  2KZV A;  2VKV A;  3F3X A;  4XK4 A;  1S7A A;  2ICW G;  2JMW A;  2BZT A;  3BR2 A;  2DO7 A;  2KFD A;  5KNL A;  2XVC A;  2BOL A;  4OIN F;  2F4M B;  4XLH A;  3OYA A;  2V6E A;  3WGH A;  4E7H A;  4XRM A;  4NC7 A;  3P9K A;  2ZJQ F;  1UG2 A;  5CLS A;  2GQQ A;  2K3F A;  1HW2 A;  4WWC A;  4DGW B;  1HF0 A;  4KMF A;  4IHV A;  2GXB A;  3A0H C;  1IAW A;  2ADU A;  1AWC A;  5EG0 B;  2MC4 A;  4CIC A;  3FXU A;  4CXF A;  3V7S A;  4BJ6 C;  4YFK F;  2WWY A;  4A3C J;  2Q2E A;  1R7J A;  2VB6 A;  3PL8 A;  4ITV A;  3HYI A;  3ABK H;  2HQA A;  5IOZ A;  3PUB A;  1AKH B;  1VQ8 I;  1K7A A;  3HOX J;  4U7D A;  3D1N I;  3H9J A;  1ITY A;  4KA4 A;  3SEZ A;  1HW5 A;  1M1E B;  5B3S H;  5E3N A;  2ZFU A;  4C3H J;  4XKC A;  1ENH A;  2B0L A;  1RZ4 A;  1Q1H A;  3F72 A;  2VQH A;  4A93 J;  2QQ8 A;  5F0C A;  1VND A;  3K9T A;  3R60 A;  4C2U A;  3TL4 X;  2K27 A;  2BYV E;  3CD6 I;  1L0O C;  4RAF A;  1BJA A;  3GZ5 A;  3CF5 F;  4EM2 A;  2VKH A;  2JSC A;  3HSR A;  1BI2 A;  1NHA A;  2EQR A;  2LDU A;  1OPC A;  2F5V A;  2VON A;  3QPL A;  4XSZ F;  2DOF A;  2E1N A;  2P5L C;  2R5Z B;  4FCY A;  1J5Y A;  2QSH X;  1YJ9 I;  3W2A A;  5D4S A;  2PG4 A;  2GAU A;  1HA8 A;  2MC3 A;  2K40 A;  2CUF A;  3GTJ J;  2L4A A;  3CJQ B;  5EJC A;  1WJB A;  1X3W B;  1Y56 A;  3ZRG A;  1IRZ A;  4C30 A;  2F5D A;  3FM5 A;  1LDK B;  3CCU I;  2JVG A;  2CMP A;  3VB2 A;  2E60 A;  3RDI A;  1ZG5 A;  2IPQ X;  4RB0 A;  1OCC H;  3J7Z I;  2LKP A;  1UST A;  2KIM A;  2XV4 S;  3VFZ A;  5BPI A;  1VQM I;  3JRI A;  2R7D A;  3OMY A;  3E6B A;  4GGG A;  2XUB A;  2JUG A;  4U7B A;  2DFI A;  5DCM B;  2MH9 A;  3K4M A;  3GCM A;  3IH2 A;  1HQC A;  3PNY A;  1ZTR A;  3R4K A;  2W7N A;  4ENK A;  2P8T A;  4JQF A;  4RLF A;  1ETY A;  5E8I A;  3BY6 A;  4L0Z B;  4A3B J;  4MGR A;  2X1C A;  5J47 A;  2LD5 A;  4MLO A;  3GLX A;  3EET A;  1IRX A;  4U88 A;  3WTZ A;  4EJO A;  5HDN A;  1ZRC A;  3HXL A;  4UV9 A;  1LFB A;  1MJA A;  1WZ2 A;  3K6G A;  3PQK A;  2C6Y A;  4B48 A;  2Y0S N;  2IA1 A;  5L3F A;  5BS6 A;  3L2C A;  5C4X J;  1HBX G;  4HF1 A;  4MTD A;  5CJ9 A;  3LSP A;  4A3E J;  2IT0 A;  1GHC A;  1WH7 A;  2JQ7 A;  1TT5 B;  5J4Y A;  2EBI A;  3FXK A;  3G2B A;  2R7X A;  1TWC J;  2F48 A;  2L3D A;  3ZQH A;  1GLN A;  1MMG A;  4FET A;  2QGU A;  1JUM A;  3E0J B;  3KE2 A;  4A3L J;  3BQY A;  2UV1 A;  4RMN A;  1R23 A;  4BE1 A;  3BWG A;  1X4P A;  1Y39 A;  2Y0M A;  3LA2 A;  2MG4 A;  3CO7 C;  4DYQ A;  2O61 A;  2E1M B;  4PFO A;  1HKT A;  4MQ9 F;  2V1X A;  4YIF A;  3MD2 A;  5F0H A;  1LFP A;  2UXX A;  2CWE A;  1BR1 A;  2E19 A;  4RDU A;  4L5E A;  3RPU D;  2E2I J;  1U5T B;  3H1C A;  1ORK A;  1WWX A;  4LMY A;  3FIW A;  1Q1V A;  1KU3 A;  1YS7 A;  2K02 A;  3Q9V A;  1TQI A;  5FGM A;  2VLA A;  3M07 A;  3TO6 A;  3IKT A;  1U9N A;  2YS9 A;  4G6D A;  1SAU A;  5AIQ A;  3GTG J;  1P2F A;  3N4M A;  1FMW A;  1K61 A;  3NRV A;  2VKE A;  2EFP A;  2V4J C;  2QEX I;  1BJZ A;  1E17 A;  5KK1 A;  1NK3 P;  1T38 A;  1TTY A;  1XDU A;  4UXN A;  2YX4 A;  5H2F C;  3KFW X;  1W7P D;  2V9P A;  3ZMS A;  5E8G A;  3ZQI A;  5LEJ A;  1YRN A;  5K5R A;  4C2M J;  1SFK A;  3W3C A;  4QWQ A;  2I10 A;  3CZ6 A;  1OIS A;  3L7W A;  3DKW A;  2IRF G;  1XX5 A;  4HDV A;  3OSF A;  3WU2 C;  5FRM A;  4CYC A;  3FMR A;  3TKY A;  2QQB A;  3VYR B;  1BOA A;  4IHT A;  1A36 A;  1TL8 A;  3CLQ A;  4OOI A;  1ETK A;  4HBL A;  3JR9 A;  1BI1 A;  4XOP A;  3CMY A;  3UNG C;  3A0B C;  5J1Y A;  1IN5 A;  5E3O A;  3ZPL A;  3HB9 A;  1BC7 C;  1MKM A;  3G1M A;  3VPR A;  3HOZ J;  2AS5 F;  2WA0 A;  4Q4Z F;  4RAY A;  3FMS A;  1SFE A;  2HZD A;  4MO7 A;  1U5T C;  1W36 C;  1VF9 A;  3BZK A;  1BOB A;  5CQE A;  1R4M B;  1ZGW A;  3ZMV A;  2JJ7 A;  1BBY A;  5BPD A;  1TNT A;  2DAO A;  4NC8 A;  2Z3Y A;  3ECH A;  1IXS B;  2EIL H;  3CTA A;  1MD0 A;  1SVO A;  4UY8 I;  2GA2 A;  4P96 A;  3HPH A;  4HLX A;  1MNM C;  4AC0 A;  2HYF A;  2Y2Z A;  4AWX B;  1YQA A;  2L9S A;  3OYM A;  5C4J J;  2FEZ A;  4O3M A;  3DWL E;  1FYK A;  2MW8 A;  1U78 A;  1TW3 A;  4BUP A;  5FB2 A;  1WJE A;  2TCT A;  3LNQ A;  1Z77 A;  3ABU A;  4X0G A;  3W6K B;  3NEU A;  2YSR A;  3HZJ A;  5B1A H;  1EV7 A;  3I71 A;  3Q0V A;  1O4X A;  3U21 A;  4HNU A;  2R93 J;  4FE4 A;  2BY3 A;  3OYE A;  2IS2 A;  1JKP C;  3L9F A;  1R00 A;  2V9K A;  3KLN A;  2VQG A;  1MBJ A;  3N05 A;  1KU7 A;  2FQ3 A;  2UUZ A;  2HGC A;  3WGG A;  2A6H F;  3BR3 A;  5IP9 J;  1VFC A;  2R7R A;  4KT5 C;  1ZLK A;  1O57 A;  2WAD A;  2X85 A;  5EEA A;  3PJR A;  4XKB A;  2IW5 A;  1ZR2 A;  1XMX A;  2EK5 A;  3TO7 A;  5A2Q Z;  3T1B A;  4II3 A;  3HL2 A;  3LSH A;  2O0Y A;  3GUD A;  4UVC A;  2H6C A;  1UMQ A;  1XC5 A;  2K7L A;  4C3I J;  2DFF A;  1BW5 A;  4L5I A;  1U6G A;  1XDS A;  3OYJ A;  3LQQ A;  1T0F A;  1IRF A;  2QEN A;  2DU9 A;  3CCY A;  3ZR8 X;  3A4C A;  1AHD P;  1RUN A;  1T8I A;  2JA5 J;  3T0Y A;  1MSF C;  1UJ8 A;  2BY1 A;  1MDM A;  2N8G A;  4HF2 A;  2VKD A;  2COB A;  3AG2 H;  1ERD A;  1X2M A;  2DA6 A;  2W25 A;  4UVB A;  4AD9 A;  3MKY B;  3BPX A;  4QTR A;  1X1A A;  3HTU A;  3MKW B;  1BM9 A;  1NH3 A;  4F55 A;  3B73 A;  1Z21 A;  5L3C A;  4JX4 A;  1RR8 C;  4ZJZ A;  2STT A;  3BDD A;  3H5N A;  4J01 A;  5C44 J;  2DMQ A;  3SDG A;  3U1K A;  1ZQ3 P;  2X4H A;  1SFU A;  1QHH D;  2M0C A;  3KP5 A;  2ZFW A;  1B8I A;  2H1L A;  2M34 A;  1QBJ A;  1EJ9 A;  3K1N A;  1WVR A;  2NVY J;  2YX7 A;  4RB2 C;  3IRQ A;  3O3K A;  5D5X B;  1W5T A;  4A0X A;  2LC2 A;  2LY1 A;  3ASN H;  2CUZ A;  3PIP F;  4LLL A;  3G6E I;  2NNY A;  4E70 A;  3OR1 C;  4OIP F;  1RI7 A;  3DCF A;  3A2K A;  2DOD A;  1IDY A;  2IEK A;  5F04 A;  2CQ7 A;  4BXX J;  3GEZ A;  3LSR A;  3S32 A;  3MCZ A;  3DF8 A;  3ZMD A;  3Q5F A;  3GFM A;  4P55 A;  5E1W A;  2GZW A;  1HXD A;  4PGG A;  2EFN A;  2FOW A;  4Q47 A;  5CYV A;  3QRF F;  1VQ6 I;  1Z3X A;  2JPC A;  3HRU A;  4W1U A;  1S3J A;  4BJ5 C;  1TWH J;  3AFH A;  5H20 A;  4V19 K;  3C7J A;  3MZH A;  1FMV A;  4M72 A;  1QRY A;  2DOE A;  3BJ6 A;  2KRC A;  2OU2 A;  3TDU C;  2WY8 Q;  3LFU A;  1LDD A;  2HS5 A;  1PYV A;  2CYY A;  2R7Q A;  2VL8 A;  3HM5 A;  4I02 A;  1SVL A;  1JJ6 C;  1PUE E;  1SMY F;  1UG0 A;  3WHC A;  2HXI A;  3LSG A;  2UZK A;  1IDZ A;  1FOY A;  2K9N A;  5J1R A;  3S17 J;  4FQG A;  4BEH A;  4OWR B;  4FE7 A;  1TQP A;  5EEH A;  5ERI A;  3KCC A;  5K7Z A;  2ZXW H;  2DA3 A;  3DTI A;  4XON A;  3JTH A;  1LEA A;  1RKT A;  1J75 A;  2VT2 A;  4Y52 J;  2MGQ A;  4G6T B;  1XS9 A;  1JKQ C;  4I2O A;  3HPG A;  2D1V A;  1A6I A;  3BG3 A;  2DLL A;  3K7A J;  4OIR F;  4YG2 F;  5IT9 Z;  4HQM A;  4DYR A;  2VBW A;  3CMM A;  4PCQ A;  1QU3 A;  2PX9 A;  2DTZ A;  3FWE A;  3K4J A;  5LGT A;  1VZ0 A;  5HLH A;  3CF2 A;  3K4K A;  3QAH A;  5KAF C;  1ZAO A;  2CUE A;  2FNP A;  2L7K A;  3NAU A;  3R0J A;  3TOB A;  2VE9 A;  3HIF A;  1XN7 A;  2HXO A;  2HU9 A;  4XID A;  3E5U A;  3I54 A;  3H5R A;  1YRN B;  2XSJ C;  4DIQ A;  1BI3 A;  2M2E A;  2M8E A;  2A6T A;  2HKO A;  3ZQQ A;  3WE2 A;  1EF4 A;  2VUM J;  3G4S I;  2V1D A;  3S1M J;  1ZG3 A;  3BOQ A;  2ELH A;  4S05 A;  1RRJ A;  4CYC B;  4IRH A;  2AO9 A;  1YX3 A;  3FK7 A;  1B1B A;  3J80 K;  2XAS A;  3ONQ A;  4IL6 C;  3KP6 A;  2Q8K A;  4DBR A;  3FHZ A;  3FXQ A;  3E5X A;  3RYP A;  2ELJ A;  4UV8 A;  2XAH A;  3G3Z A;  4M3E A;  3AL0 B; 
#chains in the Genus database with same CATH homology
 2BZT A;  1UJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...