2BZTA

Nmr structure of the bacterial protein yfhj from e. coli
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
66
structure length
66
Chain Sequence
MGLKWTDSREIGEALYDAYPDLDPKTVRFTDMHQWICDLEDFDDDPQASNEKILEAILLVWLDEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Iron binding protein
molecule keywords PROTEIN ISCX
publication title YfhJ, a molecular adaptor in iron-sulfur cluster formation or a frataxin-like protein?
pubmed doi rcsb
source organism Escherichia coli
total genus 18
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2005-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04384 Fe-S_assembly Iron-sulphur cluster assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.600 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A IscX-like 2bztA00
2BZTA 1UJ8A
chains in the Genus database with same CATH superfamily
3JREA 3KYCB 2OQGA 1UHMA 1LJ9A 1Q1VA 3E1SA 2P81A 3OS0A 1ZQ3P 2DQRA 5KHDA 4EM2A 1VQOI 4LK1F 1O57A 2TDXA 2H09A 4NC6A 4OIPF 1ETQA 1MGTA 2VE8A 5BPDA 5EG0B 4RB3C 4HF2A 2FF4A 3BG5A 5EZHA 1FMWA 3TDUC 1ZGWA 4IRHA 5TJJA 1X1CA 2ZXHA 1Z0XA 3A4CA 3CO6C 2L9VA 2GXBA 4GFBA 2XPWA 3K2ZA 3VOEA 3CC4I 2HKOA 3OV8A 1YYVA 5L3GA 3ECOA 3FHZA 4XOTA 4XBFA 4CYCA 3KP5A 3LSTA 4D9JA 5FLXZ 3D5LA 4QPQA 5E3NA 1W7PA 4HOBA 3ABUA 3OR1C 2MABA 4LMYA 3RQIA 1MMGA 3ERMA 3QPLA 2LMDA 2K9LA 3ZMSA 2KRFA 3F8BA 1IUYA 1K4TA 4XONA 4XLFA 1YITI 4BU2A 2PEXA 2LG4A 3Q0VA 4Q48A 1WH5A 2XDVA 1VQ8I 2KLOA 2D1VA 3RKQA 1Z1DA 3FXKA 2R5YB 2JA5J 2K4BA 1RC9A 4FETA 3HZJA 1XGNA 3JSOA 2JZYA 4ENKA 1X3WB 1D0XA 1ZRFA 4CYDA 1XMKA 3J80K 5D5WB 2IEKA 4C2TA 5F0FA 5E17F 1HCRA 2X48A 2A5YB 1FOXA 4A5MA 3PO3J 1FPQA 3I54A 3HRMA 3ZQ7A 3W3CA 2CW7A 1IN4A 3PFIA 2QKMB 3DEWA 5F08A 3EUKL 1Z05A 3ZR8X 1X1BA 3E6MA 4MTDA 1JTYA 1OQYA 4HV6A 4XRMA 4M6YA 2FMLA 4CZCA 3U21A 2EWNA 1X3UA 2JUCA 3D1NI 1NG7A 1IDZA 2PX9A 2A6EF 3L1PA 1JUMA 1OCZH 2H8WA 1Z7UA 5F64A 2IA1A 4UUTA 2XAGA 4XLEA 5TGTA 4D7NA 4BBRJ 3LSGA 4D0PA 2QKLB 2NYXA 4AIJA 3FMRA 2K40A 3V8LA 3J80Z 1K6OA 2HGCA 5L3BA 4NB5A 2PMUA 4ESFA 1CQTA 1QO0D 3M1CA 1VI0A 2FNAA 2ID3A 5DUIA 4HG2A 1CGPA 1QPMA 3F21A 4CZZA 3HPGA 1OCRH 3B02A 2EILH 1TNTA 3K0LA 3RYRA 1P6RA 2DT5A 2QM3A 3GW2A 3I71A 4BXXJ 2BE5F 2COBA 4P96A 2L7MP 3WE3A 1H88C 2K5CA 2MYSA 2OV7A 4IX7A 1IC8A 5ICEA 2QBYA 4AM3A 4BE0A 4L9JA 3OS1A 2EINH 4J01A 1AOYA 1V5EA 1H9GA 2CUJA 4KIFA 1R5ID 4GYGA 3HKZN 2HQNA 2L9SA 3Q0UA 1NH3A 4I2OA 3MEXA 4EGZA 2XKOA 2L01A 4WXCA 3OWTA 2TCTA 2VKDA 2M8EA 3CZ6A 4V2FA 4HSRA 3BY6A 1SMTA 2DTZA 4RGSA 5EGOB 3REOA 2JSPA 2DA4A 3BC8A 5JFRA 2OBPA 3VPRA 2R5ZB 3AG3H 3L2WA 2FEZA 2HDDA 1FP2A 1S3JA 5L3CA 1WWXA 5L3DA 3BLYA 1FYMA 1UZCA 2QQBA 4EJOA 5FFXA 1XC5A 4A3MJ 4YFNF 3CJTB 2DA5A 1HDDC 3G1OA 1L3LA 3SEZA 4BJ5C 2L3DA 2KQRA 5K7FA 4G9YA 1I1GA 5B66C 4B44A 3LL7A 1WHUA 3BZKA 1OLTA 4E7KA 1I50J 1UHWA 1SFOJ 1SAUA 3OYFA 2DQLA 2E35A 2X6XA 3KP6A 4HQMA 1SD5A 4XRFA 1YTYA 1PDNC 1F9NA 1WCMJ 3TO9A 4A0XA 2IRFG 2PN6A 2EZLA 1R49A 1W7PD 3OMYA 4C30A 2KIFA 2VC1A 2VJ5A 3HOXJ 3MFKA 2DMNA 3WE2A 2GIZA 2Z99A 1E3PA 4JBAA 1B1BA 3H9QA 2KISA 1U6GA 2NS7A 1U9OA 1HKQA 5DCMB 3K1MA 3GTJJ 3FK7A 1U5TC 2F4MB 4XR6A 3W2VA 2YPRA 1ULYA 1X2MA 2YX7A 3EDPA 3RYPA 3PSFA 1FMVA 4M6XA 3H9GA 3K4JA 3TBIA 4P5OA 3VB2A 3RSNA 3FX3A 3IRRA 1YE9A 2CV2A 4QSHA 3LOCA 4ABZA 4E7ZA 1HSTA 3H0DA 3CUOA 2J5PA 3EUHA 1YRNB 4QTRA 2B9SA 4Y52J 4UVBA 1KQ8A 2R7OA 2UUZA 1MNEA 2CUZA 3A0BC 3BROA 4FE4A 2ELKA 1OR7A 2QQAA 4JX4A 1D5VA 2CWEA 1B4AA 1FYKA 1WJEA 3GTOJ 2HVQA 3LQRA 5JI6A 2XB5A 3BG6A 3LAJA 2E1MC 4XLAA 3V7SA 4ZH4F 2YU3A 4XRSA 1FSEA 3BR3A 3HOVJ 4LLGF 2VT2A 3RQ4A 3SHFA 3U2RA 1SMYF 2E1NA 1BC7C 3S2HJ 3PL8A 2RAEA 4G7HF 3AAFA 1X3ZB 3H1CA 4F93B 1KU2A 1QNTA 3ZRGA 3KLNA 4CSWA 2XASA 3Q3SA 3BTJA 2XGEA 1XD7A 5ERIA 5K5QA 5E8IA 4L9VA 2OTLI 4IRIA 1HW5A 4DBQA 5M5WJ 4RAZA 2EFWA 1JKQC 3KZZA 1LKXA 3LA2A 2XUBA 2QQ8A 3ERED 3GZ6A 1UG2A 3HRUA 4E7JA 1UAAA 3HGGA 1GV2A 5GAEJ 2Y48A 4ENMA 2B63J 2M3AA 1U9NA 1FT9A 4OIQF 1YJNI 5KK1A 2VKHA 4IHSA 1B72A 2K27A 3WGGA 4B47A 1IF1A 2OZ6A 4CUGA 4PGHA 4M3BA 3GO5A 3WU0A 5IOYA 1D8KA 1MBJA 3GTLJ 1T38A 3J81K 1FOYA 4WWCA 1IXCA 4OWRB 2M1BA 1D5YA 4PDKA 1TP4A 3GMEA 4U7BA 5FRMA 1HW1A 1RR8C 2DK5A 5J1RA 1S7EA 1WFXA 2HVRA 4ON0A 1O3SA 1X1PA 3RIRA 3S3NA 3E7LA 2BY0A 3HM5A 2WAEA 2X1CA 4K2EA 3MKWB 2LR8A 5F6FA 1LEAA 2DOAA 5H20A 5JVGF 1V4RA 3ABMH 2P6SA 3CUQA 4RLQA 3QOPA 3RKXA 2X6WA 4YIRX 3MD2A 4CXFA 1QGPA 1ZH5A 4G94A 1O3RA 2KIUA 1T33A 2CFXA 2DT6A 2YX4A 2EPFA 4II3A 2F5VA 2WADA 3FXUA 2X4HA 1IJWC 2MFZA 3FXMA 2ZCWA 3ISPA 4HLYA 2COMA 1S29A 4RMNA 4EJUA 3J81Z 4MEXF 3FHNA 3H3ZA 3VFZA 3DKWA 4U0WA 1EV7A 3QP6A 4KT5C 3T1BA 2LH9A 4N0BA 4PSWA 1MH3A 3R4KA 4L9TA 4DYQA 2KL4A 1WJBA 3TGNA 1Y6IA 3JRCA 3CF2A 4BJ6C 1TWGJ 2DOEA 1TQMA 2E2JJ 4WXHA 4OMYA 4DIQA 4XMYA 5ILUA 3C1DA 1RRJA 2PLYA 1IG7A 2R7ZJ 2K02A 3OYJA 3I9V2 4FCYA 4M9SA 1EH6A 1GLNA 2H6BA 1B59A 1Z91A 4I7HA 3NRVA 3HPHA 3EQLF 1G6NA 5M3FJ 2CUEA 3H5RA 4N9HA 2V1DA 5EJCA 1VQ6I 3TDZC 2L9RA 4EM0B 2BYVE 2OF7A 2XF6A 1YHQI 2KZVA 2NVTJ 2JVHA 2LKSA 1Y8QB 4MLOA 4R79A 4BEHB 5LGNA 2X0LA 1RUNA 4MQVA 4I99C 2X6OA 2A6TA 1AHDP 2L7ZA 4C9YA 4HBLA 1SC7A 4JQFA 3RDIA 3A03A 5D4SA 1DU6A 2BVMA 5D5VB 4E7IA 3E5QA 1OFCX 2LY1A 3PUBA 2NAZA 3I58A 4A3CJ 1XCBA 3BR2A 4BACA 1YFHA 4FE7A 1QHGA 1O4XA 1KU7A 4G6QA 2BY2A 1ZR2A 4DQ2A 3T5XA 3CLOA 4B4CA 4XLCA 1ZREA 1W5CC 4A93J 3WTUC 3OYNA 4ZC3A 3KFWX 3VYTB 3HIFA 2DTRA 1WJFA 3S14J 3M8EA 5AONA 1W36C 2HEOA 3E5UA 1TLHB 5BQTA 5M5XJ 5HLTA 2L4AA 1EA3A 4A3IJ 3E6DA 4G8XA 4DJAA 4MFEA 3FWEA 1XGOA 5FKKA 3K7AJ 3HSEA 1ZTRA 2VI6A 5KNLA 3ZGKA 3OOPA 3IHUA 1P4WA 4PCQA 4DZJA 1LUJB 2DDBA 1ENHA 2JPCA 4MTEA 4AIDA 3F23A 3SEQA 2EA2A 2LKXA 1C0WA 2FU4A 3HG9A 4PSXA 2DPDA 4RAGA 4OMZA 2Q8KA 2KT0A 1QA6A 2RNJA 2DMTA 2OPTA 2ACJA 1U8RA 3CF5F 1UELB 3GFJA 1I3AA 2E34A 3FF5A 4S04A 2GLOA 1OYWA 4L5JA 3CCYA 1TL8A 2VC0A 3FXLA 2Y9ZA 1MMSA 2DJNA 3FXOA 2LP0A 3H5NA 1RPWA 2W84A 1ZG5A 3DPUA 5J47A 2JJ7A 2IT0A 5CLSA 1FLIA 2VIXA 1UCRA 2ICWG 2FX0A 2XGDA 5LBQA 1D0ZA 2GQQA 3T0YA 4BKXA 3J7AY 2EIKH 1LE8A 2LSOA 3SFIA 1ZGAA 3GZNB 2L4MA 1QRYA 5EEGA 1KONA 1R1UA 2FBKA 5EYRA 4CYCB 3DF8A 1W7PB 1BBYA 3OR2C 3BG9A 4KICA 2RVCA 5FRNA 2YR2A 3L2QA 4E4HA 4CCNA 3PSIA 5H6QA 2HDWA 1BI3A 1N25A 1VQ5I 1Z77A 3L7WA 2DFHA 3ZN0A 1Y1WJ 2V1UA 1POGA 4HPQA 1F4KA 1YW8A 4EGYA 2Y2ZA 4UVAA 1OISA 1ETYA 1IRXA 5KCMA 1Z3YA 1XN7A 4UUSA 4S05A 2MLKA 3FXRA 3QODA 1P9QC 3M8FA 1FBQA 2W48A 1DDNA 2K85A 1ZRCA 2O03A 3JRBA 4U88A 4ASNA 3M9AA 1UHSA 5LLQA 3K70D 1VFCA 3DPTA 3QU3A 1G4DA 1JGSA 2BVLA 4BY7J 3ZCOA 1U5TA 2V7FA 4BAYA 2VE9A 4BBSJ 4GCVA 5F0CA 3GTQJ 1S72I 2X1DA 2JMWA 4JX5A 2CJJA 2DFEA 2X1EA 2PMZA 3DKXA 2CRGA 2B0LA 1NG6A 3I53A 1YLFA 1DP3A 2DPUA 1HF0A 3SQNA 2VBZA 1P7JA 1IV6A 2QF7A 2CGPA 2WC2A 2DMUA 2EQRA 2E60A 1IDYA 1X4OA 2F2EA 1DGRM 3FM5A 2VUMJ 2M7BA 1R5HA 3AG2H 3AL0B 2UZKA 4HRIA 5LGTA 1P92A 2L0KA 2DU9A 1USTA 1Y39A 3JRGA 4NHJA 4BE1A 4FISA 1IN7A 4ITVA 1TQPA 1QZYA 1ACIA 4RDUA 3RZOJ 3MCZA 3F8MA 1FOWA 5H6RA 1Z9CA 2EFOA 1QQIA 2A07F 1TWAJ 3BR5A 2WB1N 2DT7B 3BJOA 1Q1HA 1BW6A 5ICCA 1MH4A 4XM3A 3MZHA 2VBYA 3IH4A 5CVUA 1HKSA 4UNOA 2VBWA 4YIIA 2LY9A 2IBDA 1FBUA 5LHHA 2QBYB 4ZYAA 4II2A 2CQ7A 2K9SA 1HA8A 2VJJA 2A69F 1XMAA 3K4CA 1G59A 2VQGA 4EV0A 2FA5A 2OD5A 1H0MA 1K4SA 4M73A 5FKNA 3FBIB 2D1HA 2R7RA 2HR3A 3Q0WA 3ZOBA 2DW4A 1TNSA 2QEXI 2OCCH 2RDPA 2XSDC 4Y13A 2HQ5A 1T39A 4BE2A 2HXOA 1ZK8A 3ULQB 4B8XA 4XICA 2W24A 4FHTA 3ZQQA 2V6CA 4BY1J 3ZQIA 2QCOA 3OIOA 3ASOH 3KETA 3KEQA 4HLXA 3GTKJ 3O3KA 1FIAA 1F36A 1IUFA 3LMMA 4CH7A 3CCUI 3LSIA 3GYHX 3PO2J 1FX7A 1LVAA 3FXQA 3MZ8A 4IQ4A 3C2BA 3DEEA 1K78A 3TQNA 1XB4A 4NQWB 2Y31A 3E0JB 2V4JC 3KP7A 5LEJA 4IZZA 1S9HA 2FBHA 2XPVA 3A02A 3GBGA 2VXDA 3F8NA 1EKEA 2R93J 2VASA 4BNCA 4FTHA 4JX6A 4HQEA 2GBYA 2GWRA 3KEOA 2HNHA 4ZYHA 5CVRA 1JI8A 3D0SA 3H0GJ 2GM4A 2W00A 5D6EA 4XKBA 2VQLA 4RB1A 3M07A 2VQHA 1JGGA 4EJWA 4A12A 2IS4A 4F52A 4KNYA 2I5UA 3FZVA 4RAFA 1ETOA 2ETHA 3HDDA 3FBNB 1DGWY 5F27A 1Z6TA 2F48A 3IH2A 2L5QA 2OU2A 2AHQA 5J8FA 2HYGD 4XLNF 4ENJA 3GF2A 1AKHA 1JTXA 5GP9A 1ETXA 2RKHA 3IRQA 1HSJA 4KMUX 2XAFA 3PNYA 2MC4A 5HS8A 3BDDA 2X6YA 1LFBA 2VJIA 5CYVA 2LBFB 2VODA 2GZWA 5GADJ 4B09A 2O5RA 2ELJA 2JSCA 1RR7A 3S1RJ 2XIGA 2V79A 5D5XB 4LK0F 3JTGA 1G3YA 2AO9A 5GTIC 2M4KA 3I0TA 4RAYA 1B8IA 1BOBA 2EK5A 3I3LA 3K2AA 1ERDA 1ZGJA 4M9ZA 5FKLA 2L2OA 3ABKH 5TISC 3TEDA 4M72A 4OAYA 2VQCA 1BW5A 1B72B 4KDPA 2WV1A 2XPUA 1FC3A 1X1DA 1T2KA 4KMFA 2ESHA 3TO6A 1KYZA 4HF0A 1XCVA 2K9MA 3IL2A 2QVOA 3OS2A 4OAZA 4LB5A 1ZR4A 2H6CA 2GOXB 5HLIA 3QOEA 3O2PE 1ETWA 2XHKA 2YU9J 2Y0SN 2VN2A 3JRHA 4EM1A 2QA4I 2HPIA 2LFBA 3PM1A 5FKMA 5LFAA 1XTAA 5CVVA 4KA4A 3GFLA 3F8FA 1SD7A 5CVJA 4MEYF 1EH8A 2STTA 2Z2SB 3DCFA 5J4VA 5IYBJ 2Z3YA 4BUPA 3R61A 2QGUA 4LGWA 4G7OF 4E70A 1O3TA 4OIOF 3ASNH 4I76A 1ZG1A 4C3JJ 3HSRA 3ZMZA 4A69C 5JR3A 2DYRH 3CUQB 3O6BB 2C6YA 3L2VA 2K9QA 4BXUA 1I6XA 2VJ4A 2XF7A 3DU6A 5E1ZB 2LYCA 4PJMA 5C4XJ 4BQNA 3W2WA 3V8KA 3KPHA 4GDFA 5EEHA 5B5EC 3DU5A 2F4OB 1ON1A 2EB7A 4CDGA 1W0UA 1MNMC 4KYWA 2DFIA 2MC3A 2LREA 1YS7A 2CH0A 4IHYA 4HNTA 2KRHA 3IWFA 5C3EJ 4L18B 1O3QA 2HYJA 3F9KA 1JKOC 2MH2A 1ITYA 1RESA 3ABLH 2F4IA 1AU7A 4WF2A 4NQWA 4ESBA 1LNWA 1E3OC 3CJNA 2RGVA 2AXTC 2DN0A 4N4OB 1QZEA 1VZ0A 3BTLA 3G1MA 4M3GA 4AD9A 1D8JA 2E36A 1HDPA 2A5WA 4AU7A 2O6GE 2HZDA 1LDKB 5BOXA 1NTCA 3J7YJ 1VQPI 3C2GA 3OL4A 3G71I 5HDKA 3X2QH 2W7NA 1V55H 3P9IA 2FQ4A 5FO5A 1DPUA 3ECHA 5K7ZA 5HS9A 2WBMA 4Q5SF 3H9JA 2Y69H 2R7QA 5IOZA 2STWA 1TWFJ 5E3LA 1U3EM 4U0VA 2HS5A 1T6SA 2RNGA 1FYLA 4O3MA 4OINF 1OKRA 2FD5A 3FMQA 3SDGA 2L9NA 4CCOA 1KU3A 1VF9A 2ZJ2A 1STZA 5DYMA 2M4GA 3K6GA 2BBYA 2BV6A 2CU7A 1ZYRF 2A61A 3S15J 4LOCA 4OIRF 2IW5A 1BOAA 4A0YA 2IA0A 1XS9A 3I56I 4AVPA 2LBFA 4BHCA 1XMXA 2ZXWH 3DKYA 4XSZF 1GV5A 1FNNA 1RI7A 3HTSB 1W0TA 2JT1A 1WRJA 5F0HA 1PVEA 2ZJRF 3TP3A 3RCOA 3ZMVA 3PQKA 2KPMA 2KIMA 4UHTA 2ZMEC 1BI2A 3LA7A 4A3EJ 1H9TA 1VQ9I 1R36A 4DW6A 3WTSC 3B6CA 1HBXG 2CFOA 1WI3A 3HJEA 2R0QC 2OJED 4L9NA 1D1BA 3ESWB 4IXAA 2QSGX 1HXDA 3S2DJ 3S93A 3QYFA 3TW6A 4RGRA 2Z5UA 1RIOH 1X1AA 2KJCA 2LTPA 1JHHA 1IN8A 2BW3A 4UY8I 1ZLJA 1R4NB 4I09A 4BYYA 3MKZA 1G2HA 1WPKA 4NNJA 5B1BH 4M3FA 1X19A 5GPAA 3HOTA 2FUG2 4H0EA 2YSRA 3E5XA 5C44J 1SFKA 3JRFA 2E5NA 4A0ZA 3CCMI 2MD0A 3B73A 4E7SA 4RM2A 2WY7Q 4CCLA 5B1AH 4D1QA 5K5OA 1MD0A 3OYHA 4OU0A 4ZZDA 1YJWI 3GLXA 1U0JA 3BJAA 3OIQA 3WG7H 2IP2A 1FOKA 2QSFX 1JKRC 2ZFWA 1Y0UA 4WX9A 1A6QA 1R5GA 2ADUA 2Y0SA 3DLAA 2FQ3A 4J19A 3CMMA 4KFCA 5K1YA 3OY9A 1OMIA 2ME0A 3HKZA 1YW9A 3D5SC 1LE8B 1MSEC 2OTJI 4B43A 4M3EA 2J5OA 2ZNYA 2CQXA 4IVNA 5HS7A 2RV8A 2JQ7A 1HKTA 3CTAA 3BZ6A 4AUXA 4M74A 2LVSA 2R7DA 2CSOA 4EVIA 3H35A 2EIMH 2M7AA 3OYKA 4G6TB 2R3SA 3IKVA 5CJ9A 4FASD 4ENNA 2OUMA 5DM7F 1PJRA 3DTEA 1P7IA 1IV8A 3IWZA 2CQQA 1FTTA 2H8RA 4UB6C 5DTDA 3H3UA 2KDOA 3QU6A 4IOCF 4A5NA 2JA7J 4YFXF 2EIJH 2HOTA 2QSHX 2ELHA 3FM3A 3TP0A 4CA0A 1K7AA 3VWBA 1D3YA 4GYIA 2JPBA 2PI0A 3MAJA 3OYIA 2CO5A 1VNDA 3B6AA 4ZTFA 3HL2A 1Z67A 2JA8J 3FXJA 1AA7A 3CCVI 2O7OA 5HDGA 3GX4X 2A3SA 3IH3A 4KN4X 5JLXA 4ETSA 5F1RA 5ED4A 4A3BJ 2L54A 1SFEA 4UUSB 4I6ZA 4DYRA 3QPSA 2D2WA 2K7LA 2Q2EA 3KYLA 2LF8A 2ZKZA 2W1OA 2ZC2A 1I6HJ 2KRCA 3DTKA 3VODA 2DA2A 3CCJI 2NXNB 1NHAA 2BZTA 5TRDA 1X58A 4XKVA 5FD6A 2QQ9A 4A3KJ 2KIQA 1U5TB 2VXZA 1R7JA 1Z3XA 1IN6A 5ILSA 3WTYC 2Z33A 4XORA 1TZLA 1ZRDA 4UXNA 2K4JA 1QVUA 4NBQA 4I0AA 1S5LC 1YQAA 3SDBA 2V6EA 3AKZA 4Y17A 3G6EI 1SAXA 3CESA 1XSXA 1IRZA 2P6TA 1IRGA 1TC3C 2RQQA 3CC7I 3CP2A 2A6HF 4BQAA 4Q4ZF 3DWLE 4XRSG 3F6OA 4A3DJ 3KZIC 3RKWA 3TO7A 2IXSA 5CKTA 4ANJA 4M6VA 3L9FA 4JK1X 1MSFC 2DJIA 2GIVA 3CLQA 1GVDA 4XOPA 3D5RC 1SVMA 4MHGA 3CDHA 3ONQA 5IY5H 5E20A 3TOBA 3A2KA 4DNCA 3EYIA 1Z21A 3KP2A 3VDXA 4E6KG 2R92J 4B1RA 2KHMA 3BP8A 2O0YA 3GFIA 3ZMDA 3S17J 3OYDA 2LLKA 1S7OA 4Y3OA 1MBHA 4B3XA 1BM9A 2FBIA 2QZ8A 2X9DA 1L0OC 1V54H 1R4MB 1FP1D 2DDAA 3AG1H 3K69A 2UXXA 3CP8A 3H92A 5HNFA 3WHCA 3L00A 3SYTA 3S16J 2E71A 1WJAA 2ZJPF 2QYOA 3NWSA 3OL3A 4E7HA 4A3JJ 1ZG3A 1AWCA 2E1OA 2XAUA 2IJLA 5HVQC 3UR3C 2HYFA 4LD5A 3O8GA 2HTJA 4F55A 1J5YA 5FKOA 4XNFA 2D5VA 4CHUA 2I8DA 3VYUB 1H89C 3Q9SA 2KZGA 3HRTA 4HV5A 2PBIA 1OYYA 3VSLA 4M9XA 1RKTA 1OCPA 3LSJA 4HAMA 2ME6A 1HOMA 2ID6A 3SZGA 2EFNA 3MMYB 2NVYJ 4WCGA 3QPTA 4HNUA 2IA2A 3ZQGA 2HVSA 4L0ZB 4AWXB 1WH7A 3GTGJ 4HX8A 2HTSA 1K78B 2MW8A 4EQQA 1ON2A 3A01A 2O3FA 1BC8C 2EFPA 3LFUA 3L2UA 1J09A 3HB9A 2O61A 3LA3A 2DFFA 3LSMA 2VB6A 1XDUA 4I02A 4BQOA 1I39A 2M34A 2OC6A 3C18A 3HHHA 3GFMA 3PQJA 3V42A 3NEUA 1J59A 2L7FP 2FE3A 4XK4A 4NC7A 1K79A 1X4PA 5IP9J 2KJBA 1JHFA 5DM6F 3PNVA 2EZKA 4RA2A 2HXIA 1JUPA 4FX4A 1CF7A 1GDTA 1OJLA 2MBFA 5EDNA 2OQRA 3I59A 1P2FA 3SXYA 2PQ8A 1IRFA 1OCTC 2E2IJ 3S1QJ 5J4YA 1MBGA 4GO1A 2DA6A 3WTWC 2IGNA 4FQGA 3Q5FA 5IP7J 4LITA 4XKCA 3EPZA 3I4MJ 3CJRB 4LG0A 4W97A 1MJBA 2G0EA 3Q9VA 3CCRI 1AKHB 3HOZJ 1OYIA 4G7ZF 2XSJC 4KISA 1WSUA 4FX0A 2L7KA 3JRAA 2V1NA 1FBSA 4YELA 2Y9YA 4YRVA 3CDIA 4MFDA 5LHGA 1ZN2A 1PP8F 3G3ZA 3KCCA 3F0CA 4D5FA 1Y0NA 1T0FC 2PJRA 1LFUP 3AG4H 3BT9A 3ZN1A 4LG3A 2BHZA 5ICFA 2CQKA 3K9TA 1OCCH 2DBBA 3F8CA 1KQ0A 1NK2P 5K7HA 1FY7A 1B8IB 1W5SA 2IS2A 4YIFA 4HW0A 3GEZA 2AS5F 4WK8F 1YX5A 4F3QA 3EETA 1UFMA 2Q0OA 1BA5A 4XN3A 1VTNC 1P4AA 5L3EA 3IC7A 1JUSA 2DLLA 4HSTA 5M3MJ 3CCSI 4BL0B 3QYEA 1EJ9A 4HDUA 3DTIA 5E1XA 4X6AJ 2VL8A 1A31A 4ZJZA 1R00A 5LEKA 3OYCA 4GRIA 4F92B 1ODDA 1UG0A 2FNPA 1T8IA 5BS6A 3ELKA 1A5JA 2HOAA 4W1UA 4A6DA 1MZBA 5CPRB 1T95A 2BXYA 3W6JB 2XRLA 5K5RA 9ANTA 1XSVA 3ZXSA 5H2FC 4IHWA 2VKEA 1LEBA 2ZMEA 5GAHJ 2HDCA 2CYYA 2F5DA 5IP6A 2Y0MA 3DBHB 3E6CC 3WU1B 1F1ZA 1SD6A 4A3FJ 4BH9A 4RGUA 2IS1A 2XF5A 4BJTA 3TW7A 3CCQI 3QRFF 2QENA 2MH9A 4BQQA 2VOPA 1KYWA 1PUFA 3N05A 3JRDA 1IXSB 3T8TA 2FRHA 2JN6A 4B3AA 1SANA 1M1EB 4PJNA 2JA2A 3P9CA 3CCEI 3PIPF 5E8GA 1HLVA 3JR9A 1BIAA 1MJ9A 2CW0F 3LSHA 3LFKA 3KP3A 1IW7F 1FWZA 2WAFA 5C4JJ 4TV7A 2XGCA 5J8CA 4D7MA 2RQPA 3UNGC 5L3FA 2WAQN 1I27A 2Y75A 4ZYDA 2V9PA 2AQEA 4R8HA 1FSHA 4C2UA 2M0MA 2VOOA 4P9UA 1USSA 4UV9A 1TT5B 3DFGA 3DQVC 3OYMA 1BL0A 2FOKA 1F5TA 3TL4X 4RBOA 2MD5A 5LD2C 1WGXA 2EZIA 2DOFA 5M5YJ 1XGSA 3ABTA 3LSRA 3LAPA 3HUGA 5CVIA 5HODA 1J75A 2EZHA 1UJ8A 5HOOA 3NAUA 1YS6A 3JTHA 2M45A 1EF4A 2G7UA 4P55A 2Q1ZB 4CCMA 4HYEA 4PFOA 4A6EA 4IOAF 5D6FA 1Z6RA 1XPXA 3SFZA 3ZMTA 3JCUC 1QVTA 1VQMI 5E18F 3OSFA 2DA7A 3HOWJ 1IGNA 3K70C 1XDSA 2E19A 1BR4A 4IPAA 2ZO4A 2G9WA 1V5FA 5DD4A 2LRDA 4V2GA 3UKGA 1BJZA 3OOUA 4RB0A 4ZYGA 2RC4A 1B9MA 4XLPF 2VKVA 1KU9A 3IV5A 5KAFC 3KZYA 3V7CA 5LGUA 2IGMA 4A2UA 2MSYA 1U8BA 1KQ9A 3IKTA 3S1MJ 3HRSA 2M87A 2WY8Q 3KP4A 1LFPA 5DS9A 1BJAA 1VQ4I 3BZCA 3BR0A 4HX7A 4OOIA 1E0EA 2A68F 3VYSB 1RUOA 3U1DA 2ISYA 2GXGA 2XAJA 4MIMA 3RPUA 2P5KA 3OYEA 3WTTC 4BDYA 2LF7A 2EFQA 3BTCA 2H1LA 3RI4A 1R58A 2DCEA 3NQOA 3JSPA 1H8AC 2R7WA 3FKJA 2KP6A 4P9FA 3HYIA 1G3TA 3S1NJ 1HW2A 3DLLF 4Q47A 2G7HA 1BR1A 1LB2A 2IGOA 2ZNZA 3LSPA 1W5TA 3BG7A 5DD8A 2ECBA 2BW3B 3BTIA 4A3GJ 2NS8A 3BR1A 5EEAA 5A2QK 2CV1A 3SZTA 3OSGA 1F43A 3JW4A 1QU3A 2P0WA 4HDVA 4KN7X 4J00A 1MIJA 3P5JA 3I5UA 3M4OJ 4QIWN 2UWMA 2A05A 2QWWA 1G3SA 2P4WA 2WB1A 4G6DA 2K3FA 3FIWA 5E3MA 2R7TA 4AIHA 2FOWA 2JVGA 2R7XA 5JHUA 2H1KA 2R4GA 5LRRA 2WA0A 3ZQHA 4P1WA 3N4MA 4XL9A 3P7NA 4XKWA 3O8HA 1SVLA 2E2HJ 3ZMUA 3WTXC 3M3YJ 2X51A 1YIOA 2QUFA 4C3HJ 4KIBA 2Z9OA 2WV0A 4FT8A 1IAWA 1S7AA 3G2BA 2B7EA 3K10A 4HEA2 3I4NJ 1ETKA 5FJ8J 3ML6A 1S8NA 2LC2A 2ZSHB 2LNBA 4KJZA 3HTUA 1ZKGA 5A2QZ 4O6JA 4R1HA 4BDZA 1PP7U 1SFXA 4XLHA 2Z16A 2HOSA 3CCLI 4JOMA 3QP5A 1ZHFA 1HC8A 1BIBA 4E7LA 1V5GA 4DGWB 3KX2A 4LLLA 3G1LA 2X85A 4H4KC 3ZQFA 1VQ7I 1DP7P 2PG4A 3WU2C 1JJ8C 1MMNA 3R60A 3K4LA 3JRIA 5KAIC 1E17A 1MMAA 1WVRA 5EG0A 1T56A 4IHTA 3ROUA 1XX5A 2NRAC 1W4MA 2GA1A 2WAQA 3OYLA 3PFYA 2JRMA 3S32A 2DMPA 5IT3A 2Q2EB 2XRNA 3CC2I 5CQGA 2BXZA 3V4GA 2BY1A 4L5IA 3RJPA 5F04A 2RN7A 3KLOA 2HQRA 5BPIA 3KE2A 3R6SA 1FTZA 2R7UA 4CCKA 3TKYA 4RS8A 1RKWA 2HKXA 2IVMA 3NARA 1ZAOA 4HNVA 3MQ0A 2XC7A 2D45A 2E1CA 3BJ6A 4UUVA 3J7AO 3L2RA 2H94A 2BEOA 2F5EA 2R5YA 5LRSA 5ILVA 4N4NB 3FMSA 3T8RA 2KDZA 2CS3A 4CO8A 4L0YB 1LVKA 1Y8RB 3FISA 1GXQA 3K4KA 1TWCJ 2XVCA 2K86A 4IEJA 2R7SA 1QPIA 3CJQB 3RPUD 3H3VK 3PUFA 1KA8A 2XGXA 2LOOA 2XAQA 4PJ0C 2O8KA 3K4NA 4Y7NJ 3QWLA 2EJRA 3BPXA 1KZHA 3CO7C 4V19K 4LJZF 4M3DA 5BMZA 1ZARA 3N97A 4IKFA 3HOSA 4Z6YA 2Y30A 1T0FA 2ESNA 1UMQA 1J0RA 3MN2A 3J7ZI 4ZDLA 3R0AA 3H36A 2M30A 4EATA 2KKOA 3LQQA 1ONVA 4MNUA 2BHYA 3RPQA 1I3QJ 3BCBA 2K9NA 2NNNA 4PK4A 3SZPA 4ZZLA 2N8GA 2XKPA 3L2CA 3F22A 2NVXJ 2PJPA 4Y15A 2E7XA 4UV8A 1WZ2A 1W36D 1JE8A 3BQYA 3U1KA 2W4SA 1OCOH 4PJJA 4NC8A 3MVPA 4F91B 3EUAA 4GXOA 2LY2A 1T08B 1Y56A 5GPCA 1GVJA 1APLC 2FXAA 1MW7A 2VBXA 2GOMA 3AFHA 3GLLA 3I55I 4LLNA 1WJCA 4XN0A 4PFPA 3IAS2 4I0BA 2P8TA 3PIOF 4LFUA 3GWZA 3PJRA 3MKYB 4EJVA 3C7JA 5E79C 3C2HA 4LB6B 2R7VA 2VPRA 4YEJA 3MKLA 3A01B 1DPRA 3BR6A 1N77A 5EGOA 3K4BA 3GVAA 3GTMJ 2M8GX 2L02A 4YG2F 1JXSA 5J1YA 2R5ZA 1GT0C 5FD5A 1LDJA 2MLGA 1XG1A 2ISZA 4KIGA 4HF1A 3E3VA 1I5ZA 2M2EA 3LWFA 4KUMA 3S3MA 1SFUA 2EV6A 2K3PA 1IXRC 2AQFA 5IYCJ 1B9NA 4RM3A 1CF7B 2DXIA 5JLWA 1J7KA 1TT0A 1MBEA 3VYRB 1IZ1A 2O8XA 5DV5A 1MKMA 5FROA 2RREA 3I59B 5DDGA 3BWGA 2V1XA 3I4PA 3G73A 1VQLI 2VONA 4U87A 1YO5C 3HSFA 2F5CA 2WTEA 4BHBA 3JAMK 4F7ZA 3BOQA 2NVUB 2P5VA 4HZFA 3WODF 5HNHA 3MZYA 2AXLA 3GCMA 1R23A 3VSKA 4LG0B 1K83J 4IF4A 2JA6J 1BI0A 3LSKA 4Z2YA 5FB2A 2HFHA 3CMYA 5DCMA 1WQ2A 2ZFUA 5HLHA 2DODA 3U9GA 1T98A 1TWHJ 2LKPA 3WHBA 2HWVA 2PJRB 1MNDA 2PMZN 3QQAA 4CCJA 3COAC 1O7FA 1A04A 2OAZA 1GHCA 2W25A 1WI9A 2LD5A 5FFZA 4DYCA 3F3XA 5J6XA 1TQIA 1TTYA 4GGGA 3DXJF 4XQFA 1YRNA 5FLMJ 3DBRB 3AL0C 2HQAA 1YIJI 1VQNI 3HEFA 2Z1DA 3M1EA 4Y4RA 3LNQA 1Y1VJ 5LHIA 2E1MB 2OCEA 3BQZA 2ZJQF 3CD6I 3SJMA 1SVOA 3H5AA 4IL6C 3QAHA 3JAMZ 1RZ4A 4AYBN 1FEXA 1BR2A 2LDUA 4UVCA 4BHPA 4C3IJ 2MA3A 3TMOA 3OYBA 3BCAA 2CW8A 5HLGA 3CMAI 2HPMA 2VT3A 4BXFA 2IPQX 2HI3A 3F6VA 3QPHA 3WGHA 1MDMB 4KITB 4L5EA 3WG9A 2LK2A 1R1TA 2V9KA 2YUSA 3F72A 3DBLB 3TOAA 2DMQA 5GTHC 2ZMEB 4I98B 2EBIA 2CUFA 1NK3P 4HX4A 5D8KB 5ICGA 2IGKA 1A6IA 3ZPLA 1P4XA 1A35A 2M0CA 1MJAA 2W85A 3E6BA 3EYYA 1J2XA 1RETA 1V3FA 2PMHA 1G3WA 2KFDA 1PUFB 2VPLA 5B3SH 3GTPJ 1O7LA 2YS9A 4NUBA 1MBFA 4PZJA 5DCFA 2KMUA 2QLZA 3CQZJ 1QBJA 1K6YA 3CDLA 3ZQCA 2ZB9A 4AC0A 2BGCA 3DV8A 1YJ9I 4LIUA 1FZPB 4X0GA 1R9TJ 2M9HA 1RNLA 3E97A 4CGZA 3GUDA 1QZZA 1D0YA 2V26A 3DP7A 2DK8A 4RB2C 1LQ1A 2DO7A 4RLFA 2JUGA 2NOGA 4MQ9F 4QLCU 1BI1A 5BNGA 4JYKA 2DYSH 2PFBA 5EZGA 5J1UA 5FLVA 2HOEA 4ZDPA 4AIKA 3MWMA 1E2XA 1JT6A 3NWTA 3M8JA 1WKMA 1S6LA 1GXPA 2M5WA 4N9IA 5DUKA 5D4RA 1XSDA 2GA2A 2JK3A 4IJAA 1R22A 1I1SA 1DUXC 3HUGB 4HA8A 2WWYA 5E3OA 5E1WA 1IO2A 3S2WA 2ZXIA 3HOYJ 4X1EA 2XROA 2BOLA 2CV0A 4C2MJ 2DA1A 2TRTA 4BS9A 1TW2A 3FK6A 4D5CA 4EEFG 3DEUA 4ZYEA 2MGQA 1FIPA 3VEPA 4XIDA 3WTZA 2JTVA 4DBRA 1JT0A 3EUHC 5J3LA 2FSWA 3GZ5A 5J40A 3V8JA 3HOUJ 2O9LA 2XV4S 4O5VA 3IAM2 3W6VA 4DOZA 3RZDJ 1WJDA 4PJLA 2IS6A 1REPC 1OR7C 2EV5A 6PAXA 4WXDA 2ECCA 4BGDA 5HDNA 2JRTA 3HGYA 3HXLA 4Y33A 5JVTA 3S3OA 2XAHA 1MMDA 2ZBKA 2V9VA 3FKIJ 1UB9A 2W82A 1YW7A 2F6CA 3A1YA 3RKYA 5EF6A 4IQJA 4A3LJ 5KVRA 1R1VA 2GAUA 1R71A 5IT9K 4G12A 1FJLA 1DU0A 4QPOA 4IHXA 1J9IA 4U7DA 2OZUA 4U0YA 2DA3A 3RTRA 2EH3A 2CMPA 4JP0A 1U78A 1SD4A 5JHFA 1ORKA 1X2NA 3G4SI 3BPVA 1ETVA 2P7VB 2NOJB 4CICA 4EMSA 4YFKF 1ZLKA 3DPLC 4BEHA 3P9KA 3GXOA 4IO9F 4ZDOA 3W2AA 1B6AA 2EA4A 3ZQLA 1TBXA 1N78A 1N75A 3PNTA 1W1WE 1GUUA 3W6KB 4LIVA 2DI3A 2UV1A 5F1JA 1BN5A 1YG2A 3V7RA 2GXAA 1HQCA 3KEYA 3QYBA 3WTVC 2P5LC 1YI2I 2H27A 3FDYA 3HBLA 1PYVA 1OPCA 3K1NA 1K61A 4DZPA 1R6RA 3K4MA 1JJ6C 3M7GA 3IP4B 2E7WA 1D1CA 2JWTA 1G8XA 3KYDB 3HHGA 1MDMA 4ESJA 2W57A 4EJTA 2EV0A 1YOVB 2E5ZA 2HZTA 3BG3A 1VQKI 2NS0A 5DEQA 5IT9Z 1IN5A 4MGRA 4I01A 5D8LB 2IAIA 4AYBA 2HU9A 4IHVA 1EH7A 1D1AA 3HC7A 5IYDJ 4QWQA 2R7FA 2P7CB 2OA4A 1LDDA 2I10A 2F5FA 4XSXF 5IPAA 5D5UB 4MO7A 1WJ5A 4IRGA 3OYAA 2FMYA 2MG4A 2CQNA 1KGSA 2ZXJA 1ZELA 4UB8C 2CG4A 2VLAA 1TW3A 5AIQA 4S0HB 3L09A 4NDLA 1U2WA 1MBKA 3CUQC 1Z7LA 4RGXA 3ZP5A 4B48A 3K1PA 2DAOA 2NVQJ 2ZSIB 4PGGA 1LPQA 3IUOA 3C3WA 1SEUA 1XGMA 5GAGJ 3R0JA 4PUSA 3CMEI 5FLXK 1A36A 2BY3A 3S8PA 2FJ1A 3KIOA 4M71A 4ZTJA 3OIPA 1DQUA 3WGIA 1JKPC 1YX3A 2UXNA 5CQEA 3I64A 5AIPA 5FGMA 4AVZA 2NNYA 3OYGA 4KT6A 1QHHD 3A0HC 1PUEE 2XB0X 1E3HA
chains in the Genus database with same CATH topology
2BZTA 1UJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BZT A;  1UJ8 A; 
#chains in the Genus database with same CATH topology
 3JRE A;  3KYC B;  2OQG A;  1UHM A;  1LJ9 A;  1Q1V A;  3E1S A;  2P81 A;  3OS0 A;  1ZQ3 P;  2DQR A;  5KHD A;  4EM2 A;  1VQO I;  4LK1 F;  1O57 A;  2TDX A;  2H09 A;  4NC6 A;  4OIP F;  1ETQ A;  1MGT A;  2VE8 A;  5BPD A;  5EG0 B;  4RB3 C;  4HF2 A;  2FF4 A;  3BG5 A;  5EZH A;  1FMW A;  3TDU C;  1ZGW A;  4IRH A;  5TJJ A;  1X1C A;  2ZXH A;  1Z0X A;  3A4C A;  3CO6 C;  2L9V A;  2GXB A;  4GFB A;  2XPW A;  3K2Z A;  3VOE A;  3CC4 I;  2HKO A;  3OV8 A;  1YYV A;  5L3G A;  3ECO A;  3FHZ A;  4XOT A;  4XBF A;  4CYC A;  3KP5 A;  3LST A;  4D9J A;  5FLX Z;  3D5L A;  4QPQ A;  5E3N A;  1W7P A;  4HOB A;  3ABU A;  3OR1 C;  2MAB A;  4LMY A;  3RQI A;  1MMG A;  3ERM A;  3QPL A;  2LMD A;  2K9L A;  3ZMS A;  2KRF A;  3F8B A;  1IUY A;  1K4T A;  4XON A;  4XLF A;  1YIT I;  4BU2 A;  2PEX A;  2LG4 A;  3Q0V A;  4Q48 A;  1WH5 A;  2XDV A;  1VQ8 I;  2KLO A;  2D1V A;  3RKQ A;  1Z1D A;  3FXK A;  2R5Y B;  2JA5 J;  2K4B A;  1RC9 A;  4FET A;  3HZJ A;  1XGN A;  3JSO A;  2JZY A;  4ENK A;  1X3W B;  1D0X A;  1ZRF A;  4CYD A;  1XMK A;  3J80 K;  5D5W B;  2IEK A;  4C2T A;  5F0F A;  5E17 F;  1HCR A;  2X48 A;  2A5Y B;  1FOX A;  4A5M A;  3PO3 J;  1FPQ A;  3I54 A;  3HRM A;  3ZQ7 A;  3W3C A;  2CW7 A;  1IN4 A;  3PFI A;  2QKM B;  3DEW A;  5F08 A;  3EUK L;  1Z05 A;  3ZR8 X;  1X1B A;  3E6M A;  4MTD A;  1JTY A;  1OQY A;  4HV6 A;  4XRM A;  4M6Y A;  2FML A;  4CZC A;  3U21 A;  2EWN A;  1X3U A;  2JUC A;  3D1N I;  1NG7 A;  1IDZ A;  2PX9 A;  2A6E F;  3L1P A;  1JUM A;  1OCZ H;  2H8W A;  1Z7U A;  5F64 A;  2IA1 A;  4UUT A;  2XAG A;  4XLE A;  5TGT A;  4D7N A;  4BBR J;  3LSG A;  4D0P A;  2QKL B;  2NYX A;  4AIJ A;  3FMR A;  2K40 A;  3V8L A;  3J80 Z;  1K6O A;  2HGC A;  5L3B A;  4NB5 A;  2PMU A;  4ESF A;  1CQT A;  1QO0 D;  3M1C A;  1VI0 A;  2FNA A;  2ID3 A;  5DUI A;  4HG2 A;  1CGP A;  1QPM A;  3F21 A;  4CZZ A;  3HPG A;  1OCR H;  3B02 A;  2EIL H;  1TNT A;  3K0L A;  3RYR A;  1P6R A;  2DT5 A;  2QM3 A;  3GW2 A;  3I71 A;  4BXX J;  2BE5 F;  2COB A;  4P96 A;  2L7M P;  3WE3 A;  1H88 C;  2K5C A;  2MYS A;  2OV7 A;  4IX7 A;  1IC8 A;  5ICE A;  2QBY A;  4AM3 A;  4BE0 A;  4L9J A;  3OS1 A;  2EIN H;  4J01 A;  1AOY A;  1V5E A;  1H9G A;  2CUJ A;  4KIF A;  1R5I D;  4GYG A;  3HKZ N;  2HQN A;  2L9S A;  3Q0U A;  1NH3 A;  4I2O A;  3MEX A;  4EGZ A;  2XKO A;  2L01 A;  4WXC A;  3OWT A;  2TCT A;  2VKD A;  2M8E A;  3CZ6 A;  4V2F A;  4HSR A;  3BY6 A;  1SMT A;  2DTZ A;  4RGS A;  5EGO B;  3REO A;  2JSP A;  2DA4 A;  3BC8 A;  5JFR A;  2OBP A;  3VPR A;  2R5Z B;  3AG3 H;  3L2W A;  2FEZ A;  2HDD A;  1FP2 A;  1S3J A;  5L3C A;  1WWX A;  5L3D A;  3BLY A;  1FYM A;  1UZC A;  2QQB A;  4EJO A;  5FFX A;  1XC5 A;  4A3M J;  4YFN F;  3CJT B;  2DA5 A;  1HDD C;  3G1O A;  1L3L A;  3SEZ A;  4BJ5 C;  2L3D A;  2KQR A;  5K7F A;  4G9Y A;  1I1G A;  5B66 C;  4B44 A;  3LL7 A;  1WHU A;  3BZK A;  1OLT A;  4E7K A;  1I50 J;  1UHW A;  1SFO J;  1SAU A;  3OYF A;  2DQL A;  2E35 A;  2X6X A;  3KP6 A;  4HQM A;  1SD5 A;  4XRF A;  1YTY A;  1PDN C;  1F9N A;  1WCM J;  3TO9 A;  4A0X A;  2IRF G;  2PN6 A;  2EZL A;  1R49 A;  1W7P D;  3OMY A;  4C30 A;  2KIF A;  2VC1 A;  2VJ5 A;  3HOX J;  3MFK A;  2DMN A;  3WE2 A;  2GIZ A;  2Z99 A;  1E3P A;  4JBA A;  1B1B A;  3H9Q A;  2KIS A;  1U6G A;  2NS7 A;  1U9O A;  1HKQ A;  5DCM B;  3K1M A;  3GTJ J;  3FK7 A;  1U5T C;  2F4M B;  4XR6 A;  3W2V A;  2YPR A;  1ULY A;  1X2M A;  2YX7 A;  3EDP A;  3RYP A;  3PSF A;  1FMV A;  4M6X A;  3H9G A;  3K4J A;  3TBI A;  4P5O A;  3VB2 A;  3RSN A;  3FX3 A;  3IRR A;  1YE9 A;  2CV2 A;  4QSH A;  3LOC A;  4ABZ A;  4E7Z A;  1HST A;  3H0D A;  3CUO A;  2J5P A;  3EUH A;  1YRN B;  4QTR A;  2B9S A;  4Y52 J;  4UVB A;  1KQ8 A;  2R7O A;  2UUZ A;  1MNE A;  2CUZ A;  3A0B C;  3BRO A;  4FE4 A;  2ELK A;  1OR7 A;  2QQA A;  4JX4 A;  1D5V A;  2CWE A;  1B4A A;  1FYK A;  1WJE A;  3GTO J;  2HVQ A;  3LQR A;  5JI6 A;  2XB5 A;  3BG6 A;  3LAJ A;  2E1M C;  4XLA A;  3V7S A;  4ZH4 F;  2YU3 A;  4XRS A;  1FSE A;  3BR3 A;  3HOV J;  4LLG F;  2VT2 A;  3RQ4 A;  3SHF A;  3U2R A;  1SMY F;  2E1N A;  1BC7 C;  3S2H J;  3PL8 A;  2RAE A;  4G7H F;  3AAF A;  1X3Z B;  3H1C A;  4F93 B;  1KU2 A;  1QNT A;  3ZRG A;  3KLN A;  4CSW A;  2XAS A;  3Q3S A;  3BTJ A;  2XGE A;  1XD7 A;  5ERI A;  5K5Q A;  5E8I A;  4L9V A;  2OTL I;  4IRI A;  1HW5 A;  4DBQ A;  5M5W J;  4RAZ A;  2EFW A;  1JKQ C;  3KZZ A;  1LKX A;  3LA2 A;  2XUB A;  2QQ8 A;  3ERE D;  3GZ6 A;  1UG2 A;  3HRU A;  4E7J A;  1UAA A;  3HGG A;  1GV2 A;  5GAE J;  2Y48 A;  4ENM A;  2B63 J;  2M3A A;  1U9N A;  1FT9 A;  4OIQ F;  1YJN I;  5KK1 A;  2VKH A;  4IHS A;  1B72 A;  2K27 A;  3WGG A;  4B47 A;  1IF1 A;  2OZ6 A;  4CUG A;  4PGH A;  4M3B A;  3GO5 A;  3WU0 A;  5IOY A;  1D8K A;  1MBJ A;  3GTL J;  1T38 A;  3J81 K;  1FOY A;  4WWC A;  1IXC A;  4OWR B;  2M1B A;  1D5Y A;  4PDK A;  1TP4 A;  3GME A;  4U7B A;  5FRM A;  1HW1 A;  1RR8 C;  2DK5 A;  5J1R A;  1S7E A;  1WFX A;  2HVR A;  4ON0 A;  1O3S A;  1X1P A;  3RIR A;  3S3N A;  3E7L A;  2BY0 A;  3HM5 A;  2WAE A;  2X1C A;  4K2E A;  3MKW B;  2LR8 A;  5F6F A;  1LEA A;  2DOA A;  5H20 A;  5JVG F;  1V4R A;  3ABM H;  2P6S A;  3CUQ A;  4RLQ A;  3QOP A;  3RKX A;  2X6W A;  4YIR X;  3MD2 A;  4CXF A;  1QGP A;  1ZH5 A;  4G94 A;  1O3R A;  2KIU A;  1T33 A;  2CFX A;  2DT6 A;  2YX4 A;  2EPF A;  4II3 A;  2F5V A;  2WAD A;  3FXU A;  2X4H A;  1IJW C;  2MFZ A;  3FXM A;  2ZCW A;  3ISP A;  4HLY A;  2COM A;  1S29 A;  4RMN A;  4EJU A;  3J81 Z;  4MEX F;  3FHN A;  3H3Z A;  3VFZ A;  3DKW A;  4U0W A;  1EV7 A;  3QP6 A;  4KT5 C;  3T1B A;  2LH9 A;  4N0B A;  4PSW A;  1MH3 A;  3R4K A;  4L9T A;  4DYQ A;  2KL4 A;  1WJB A;  3TGN A;  1Y6I A;  3JRC A;  3CF2 A;  4BJ6 C;  1TWG J;  2DOE A;  1TQM A;  2E2J J;  4WXH A;  4OMY A;  4DIQ A;  4XMY A;  5ILU A;  3C1D A;  1RRJ A;  2PLY A;  1IG7 A;  2R7Z J;  2K02 A;  3OYJ A;  3I9V 2;  4FCY A;  4M9S A;  1EH6 A;  1GLN A;  2H6B A;  1B59 A;  1Z91 A;  4I7H A;  3NRV A;  3HPH A;  3EQL F;  1G6N A;  5M3F J;  2CUE A;  3H5R A;  4N9H A;  2V1D A;  5EJC A;  1VQ6 I;  3TDZ C;  2L9R A;  4EM0 B;  2BYV E;  2OF7 A;  2XF6 A;  1YHQ I;  2KZV A;  2NVT J;  2JVH A;  2LKS A;  1Y8Q B;  4MLO A;  4R79 A;  4BEH B;  5LGN A;  2X0L A;  1RUN A;  4MQV A;  4I99 C;  2X6O A;  2A6T A;  1AHD P;  2L7Z A;  4C9Y A;  4HBL A;  1SC7 A;  4JQF A;  3RDI A;  3A03 A;  5D4S A;  1DU6 A;  2BVM A;  5D5V B;  4E7I A;  3E5Q A;  1OFC X;  2LY1 A;  3PUB A;  2NAZ A;  3I58 A;  4A3C J;  1XCB A;  3BR2 A;  4BAC A;  1YFH A;  4FE7 A;  1QHG A;  1O4X A;  1KU7 A;  4G6Q A;  2BY2 A;  1ZR2 A;  4DQ2 A;  3T5X A;  3CLO A;  4B4C A;  4XLC A;  1ZRE A;  1W5C C;  4A93 J;  3WTU C;  3OYN A;  4ZC3 A;  3KFW X;  3VYT B;  3HIF A;  2DTR A;  1WJF A;  3S14 J;  3M8E A;  5AON A;  1W36 C;  2HEO A;  3E5U A;  1TLH B;  5BQT A;  5M5X J;  5HLT A;  2L4A A;  1EA3 A;  4A3I J;  3E6D A;  4G8X A;  4DJA A;  4MFE A;  3FWE A;  1XGO A;  5FKK A;  3K7A J;  3HSE A;  1ZTR A;  2VI6 A;  5KNL A;  3ZGK A;  3OOP A;  3IHU A;  1P4W A;  4PCQ A;  4DZJ A;  1LUJ B;  2DDB A;  1ENH A;  2JPC A;  4MTE A;  4AID A;  3F23 A;  3SEQ A;  2EA2 A;  2LKX A;  1C0W A;  2FU4 A;  3HG9 A;  4PSX A;  2DPD A;  4RAG A;  4OMZ A;  2Q8K A;  2KT0 A;  1QA6 A;  2RNJ A;  2DMT A;  2OPT A;  2ACJ A;  1U8R A;  3CF5 F;  1UEL B;  3GFJ A;  1I3A A;  2E34 A;  3FF5 A;  4S04 A;  2GLO A;  1OYW A;  4L5J A;  3CCY A;  1TL8 A;  2VC0 A;  3FXL A;  2Y9Z A;  1MMS A;  2DJN A;  3FXO A;  2LP0 A;  3H5N A;  1RPW A;  2W84 A;  1ZG5 A;  3DPU A;  5J47 A;  2JJ7 A;  2IT0 A;  5CLS A;  1FLI A;  2VIX A;  1UCR A;  2ICW G;  2FX0 A;  2XGD A;  5LBQ A;  1D0Z A;  2GQQ A;  3T0Y A;  4BKX A;  3J7A Y;  2EIK H;  1LE8 A;  2LSO A;  3SFI A;  1ZGA A;  3GZN B;  2L4M A;  1QRY A;  5EEG A;  1KON A;  1R1U A;  2FBK A;  5EYR A;  4CYC B;  3DF8 A;  1W7P B;  1BBY A;  3OR2 C;  3BG9 A;  4KIC A;  2RVC A;  5FRN A;  2YR2 A;  3L2Q A;  4E4H A;  4CCN A;  3PSI A;  5H6Q A;  2HDW A;  1BI3 A;  1N25 A;  1VQ5 I;  1Z77 A;  3L7W A;  2DFH A;  3ZN0 A;  1Y1W J;  2V1U A;  1POG A;  4HPQ A;  1F4K A;  1YW8 A;  4EGY A;  2Y2Z A;  4UVA A;  1OIS A;  1ETY A;  1IRX A;  5KCM A;  1Z3Y A;  1XN7 A;  4UUS A;  4S05 A;  2MLK A;  3FXR A;  3QOD A;  1P9Q C;  3M8F A;  1FBQ A;  2W48 A;  1DDN A;  2K85 A;  1ZRC A;  2O03 A;  3JRB A;  4U88 A;  4ASN A;  3M9A A;  1UHS A;  5LLQ A;  3K70 D;  1VFC A;  3DPT A;  3QU3 A;  1G4D A;  1JGS A;  2BVL A;  4BY7 J;  3ZCO A;  1U5T A;  2V7F A;  4BAY A;  2VE9 A;  4BBS J;  4GCV A;  5F0C A;  3GTQ J;  1S72 I;  2X1D A;  2JMW A;  4JX5 A;  2CJJ A;  2DFE A;  2X1E A;  2PMZ A;  3DKX A;  2CRG A;  2B0L A;  1NG6 A;  3I53 A;  1YLF A;  1DP3 A;  2DPU A;  1HF0 A;  3SQN A;  2VBZ A;  1P7J A;  1IV6 A;  2QF7 A;  2CGP A;  2WC2 A;  2DMU A;  2EQR A;  2E60 A;  1IDY A;  1X4O A;  2F2E A;  1DGR M;  3FM5 A;  2VUM J;  2M7B A;  1R5H A;  3AG2 H;  3AL0 B;  2UZK A;  4HRI A;  5LGT A;  1P92 A;  2L0K A;  2DU9 A;  1UST A;  1Y39 A;  3JRG A;  4NHJ A;  4BE1 A;  4FIS A;  1IN7 A;  4ITV A;  1TQP A;  1QZY A;  1ACI A;  4RDU A;  3RZO J;  3MCZ A;  3F8M A;  1FOW A;  5H6R A;  1Z9C A;  2EFO A;  1QQI A;  2A07 F;  1TWA J;  3BR5 A;  2WB1 N;  2DT7 B;  3BJO A;  1Q1H A;  1BW6 A;  5ICC A;  1MH4 A;  4XM3 A;  3MZH A;  2VBY A;  3IH4 A;  5CVU A;  1HKS A;  4UNO A;  2VBW A;  4YII A;  2LY9 A;  2IBD A;  1FBU A;  5LHH A;  2QBY B;  4ZYA A;  4II2 A;  2CQ7 A;  2K9S A;  1HA8 A;  2VJJ A;  2A69 F;  1XMA A;  3K4C A;  1G59 A;  2VQG A;  4EV0 A;  2FA5 A;  2OD5 A;  1H0M A;  1K4S A;  4M73 A;  5FKN A;  3FBI B;  2D1H A;  2R7R A;  2HR3 A;  3Q0W A;  3ZOB A;  2DW4 A;  1TNS A;  2QEX I;  2OCC H;  2RDP A;  2XSD C;  4Y13 A;  2HQ5 A;  1T39 A;  4BE2 A;  2HXO A;  1ZK8 A;  3ULQ B;  4B8X A;  4XIC A;  2W24 A;  4FHT A;  3ZQQ A;  2V6C A;  4BY1 J;  3ZQI A;  2QCO A;  3OIO A;  3ASO H;  3KET A;  3KEQ A;  4HLX A;  3GTK J;  3O3K A;  1FIA A;  1F36 A;  1IUF A;  3LMM A;  4CH7 A;  3CCU I;  3LSI A;  3GYH X;  3PO2 J;  1FX7 A;  1LVA A;  3FXQ A;  3MZ8 A;  4IQ4 A;  3C2B A;  3DEE A;  1K78 A;  3TQN A;  1XB4 A;  4NQW B;  2Y31 A;  3E0J B;  2V4J C;  3KP7 A;  5LEJ A;  4IZZ A;  1S9H A;  2FBH A;  2XPV A;  3A02 A;  3GBG A;  2VXD A;  3F8N A;  1EKE A;  2R93 J;  2VAS A;  4BNC A;  4FTH A;  4JX6 A;  4HQE A;  2GBY A;  2GWR A;  3KEO A;  2HNH A;  4ZYH A;  5CVR A;  1JI8 A;  3D0S A;  3H0G J;  2GM4 A;  2W00 A;  5D6E A;  4XKB A;  2VQL A;  4RB1 A;  3M07 A;  2VQH A;  1JGG A;  4EJW A;  4A12 A;  2IS4 A;  4F52 A;  4KNY A;  2I5U A;  3FZV A;  4RAF A;  1ETO A;  2ETH A;  3HDD A;  3FBN B;  1DGW Y;  5F27 A;  1Z6T A;  2F48 A;  3IH2 A;  2L5Q A;  2OU2 A;  2AHQ A;  5J8F A;  2HYG D;  4XLN F;  4ENJ A;  3GF2 A;  1AKH A;  1JTX A;  5GP9 A;  1ETX A;  2RKH A;  3IRQ A;  1HSJ A;  4KMU X;  2XAF A;  3PNY A;  2MC4 A;  5HS8 A;  3BDD A;  2X6Y A;  1LFB A;  2VJI A;  5CYV A;  2LBF B;  2VOD A;  2GZW A;  5GAD J;  4B09 A;  2O5R A;  2ELJ A;  2JSC A;  1RR7 A;  3S1R J;  2XIG A;  2V79 A;  5D5X B;  4LK0 F;  3JTG A;  1G3Y A;  2AO9 A;  5GTI C;  2M4K A;  3I0T A;  4RAY A;  1B8I A;  1BOB A;  2EK5 A;  3I3L A;  3K2A A;  1ERD A;  1ZGJ A;  4M9Z A;  5FKL A;  2L2O A;  3ABK H;  5TIS C;  3TED A;  4M72 A;  4OAY A;  2VQC A;  1BW5 A;  1B72 B;  4KDP A;  2WV1 A;  2XPU A;  1FC3 A;  1X1D A;  1T2K A;  4KMF A;  2ESH A;  3TO6 A;  1KYZ A;  4HF0 A;  1XCV A;  2K9M A;  3IL2 A;  2QVO A;  3OS2 A;  4OAZ A;  4LB5 A;  1ZR4 A;  2H6C A;  2GOX B;  5HLI A;  3QOE A;  3O2P E;  1ETW A;  2XHK A;  2YU9 J;  2Y0S N;  2VN2 A;  3JRH A;  4EM1 A;  2QA4 I;  2HPI A;  2LFB A;  3PM1 A;  5FKM A;  5LFA A;  1XTA A;  5CVV A;  4KA4 A;  3GFL A;  3F8F A;  1SD7 A;  5CVJ A;  4MEY F;  1EH8 A;  2STT A;  2Z2S B;  3DCF A;  5J4V A;  5IYB J;  2Z3Y A;  4BUP A;  3R61 A;  2QGU A;  4LGW A;  4G7O F;  4E70 A;  1O3T A;  4OIO F;  3ASN H;  4I76 A;  1ZG1 A;  4C3J J;  3HSR A;  3ZMZ A;  4A69 C;  5JR3 A;  2DYR H;  3CUQ B;  3O6B B;  2C6Y A;  3L2V A;  2K9Q A;  4BXU A;  1I6X A;  2VJ4 A;  2XF7 A;  3DU6 A;  5E1Z B;  2LYC A;  4PJM A;  5C4X J;  4BQN A;  3W2W A;  3V8K A;  3KPH A;  4GDF A;  5EEH A;  5B5E C;  3DU5 A;  2F4O B;  1ON1 A;  2EB7 A;  4CDG A;  1W0U A;  1MNM C;  4KYW A;  2DFI A;  2MC3 A;  2LRE A;  1YS7 A;  2CH0 A;  4IHY A;  4HNT A;  2KRH A;  3IWF A;  5C3E J;  4L18 B;  1O3Q A;  2HYJ A;  3F9K A;  1JKO C;  2MH2 A;  1ITY A;  1RES A;  3ABL H;  2F4I A;  1AU7 A;  4WF2 A;  4NQW A;  4ESB A;  1LNW A;  1E3O C;  3CJN A;  2RGV A;  2AXT C;  2DN0 A;  4N4O B;  1QZE A;  1VZ0 A;  3BTL A;  3G1M A;  4M3G A;  4AD9 A;  1D8J A;  2E36 A;  1HDP A;  2A5W A;  4AU7 A;  2O6G E;  2HZD A;  1LDK B;  5BOX A;  1NTC A;  3J7Y J;  1VQP I;  3C2G A;  3OL4 A;  3G71 I;  5HDK A;  3X2Q H;  2W7N A;  1V55 H;  3P9I A;  2FQ4 A;  5FO5 A;  1DPU A;  3ECH A;  5K7Z A;  5HS9 A;  2WBM A;  4Q5S F;  3H9J A;  2Y69 H;  2R7Q A;  5IOZ A;  2STW A;  1TWF J;  5E3L A;  1U3E M;  4U0V A;  2HS5 A;  1T6S A;  2RNG A;  1FYL A;  4O3M A;  4OIN F;  1OKR A;  2FD5 A;  3FMQ A;  3SDG A;  2L9N A;  4CCO A;  1KU3 A;  1VF9 A;  2ZJ2 A;  1STZ A;  5DYM A;  2M4G A;  3K6G A;  2BBY A;  2BV6 A;  2CU7 A;  1ZYR F;  2A61 A;  3S15 J;  4LOC A;  4OIR F;  2IW5 A;  1BOA A;  4A0Y A;  2IA0 A;  1XS9 A;  3I56 I;  4AVP A;  2LBF A;  4BHC A;  1XMX A;  2ZXW H;  3DKY A;  4XSZ F;  1GV5 A;  1FNN A;  1RI7 A;  3HTS B;  1W0T A;  2JT1 A;  1WRJ A;  5F0H A;  1PVE A;  2ZJR F;  3TP3 A;  3RCO A;  3ZMV A;  3PQK A;  2KPM A;  2KIM A;  4UHT A;  2ZME C;  1BI2 A;  3LA7 A;  4A3E J;  1H9T A;  1VQ9 I;  1R36 A;  4DW6 A;  3WTS C;  3B6C A;  1HBX G;  2CFO A;  1WI3 A;  3HJE A;  2R0Q C;  2OJE D;  4L9N A;  1D1B A;  3ESW B;  4IXA A;  2QSG X;  1HXD A;  3S2D J;  3S93 A;  3QYF A;  3TW6 A;  4RGR A;  2Z5U A;  1RIO H;  1X1A A;  2KJC A;  2LTP A;  1JHH A;  1IN8 A;  2BW3 A;  4UY8 I;  1ZLJ A;  1R4N B;  4I09 A;  4BYY A;  3MKZ A;  1G2H A;  1WPK A;  4NNJ A;  5B1B H;  4M3F A;  1X19 A;  5GPA A;  3HOT A;  2FUG 2;  4H0E A;  2YSR A;  3E5X A;  5C44 J;  1SFK A;  3JRF A;  2E5N A;  4A0Z A;  3CCM I;  2MD0 A;  3B73 A;  4E7S A;  4RM2 A;  2WY7 Q;  4CCL A;  5B1A H;  4D1Q A;  5K5O A;  1MD0 A;  3OYH A;  4OU0 A;  4ZZD A;  1YJW I;  3GLX A;  1U0J A;  3BJA A;  3OIQ A;  3WG7 H;  2IP2 A;  1FOK A;  2QSF X;  1JKR C;  2ZFW A;  1Y0U A;  4WX9 A;  1A6Q A;  1R5G A;  2ADU A;  2Y0S A;  3DLA A;  2FQ3 A;  4J19 A;  3CMM A;  4KFC A;  5K1Y A;  3OY9 A;  1OMI A;  2ME0 A;  3HKZ A;  1YW9 A;  3D5S C;  1LE8 B;  1MSE C;  2OTJ I;  4B43 A;  4M3E A;  2J5O A;  2ZNY A;  2CQX A;  4IVN A;  5HS7 A;  2RV8 A;  2JQ7 A;  1HKT A;  3CTA A;  3BZ6 A;  4AUX A;  4M74 A;  2LVS A;  2R7D A;  2CSO A;  4EVI A;  3H35 A;  2EIM H;  2M7A A;  3OYK A;  4G6T B;  2R3S A;  3IKV A;  5CJ9 A;  4FAS D;  4ENN A;  2OUM A;  5DM7 F;  1PJR A;  3DTE A;  1P7I A;  1IV8 A;  3IWZ A;  2CQQ A;  1FTT A;  2H8R A;  4UB6 C;  5DTD A;  3H3U A;  2KDO A;  3QU6 A;  4IOC F;  4A5N A;  2JA7 J;  4YFX F;  2EIJ H;  2HOT A;  2QSH X;  2ELH A;  3FM3 A;  3TP0 A;  4CA0 A;  1K7A A;  3VWB A;  1D3Y A;  4GYI A;  2JPB A;  2PI0 A;  3MAJ A;  3OYI A;  2CO5 A;  1VND A;  3B6A A;  4ZTF A;  3HL2 A;  1Z67 A;  2JA8 J;  3FXJ A;  1AA7 A;  3CCV I;  2O7O A;  5HDG A;  3GX4 X;  2A3S A;  3IH3 A;  4KN4 X;  5JLX A;  4ETS A;  5F1R A;  5ED4 A;  4A3B J;  2L54 A;  1SFE A;  4UUS B;  4I6Z A;  4DYR A;  3QPS A;  2D2W A;  2K7L A;  2Q2E A;  3KYL A;  2LF8 A;  2ZKZ A;  2W1O A;  2ZC2 A;  1I6H J;  2KRC A;  3DTK A;  3VOD A;  2DA2 A;  3CCJ I;  2NXN B;  1NHA A;  2BZT A;  5TRD A;  1X58 A;  4XKV A;  5FD6 A;  2QQ9 A;  4A3K J;  2KIQ A;  1U5T B;  2VXZ A;  1R7J A;  1Z3X A;  1IN6 A;  5ILS A;  3WTY C;  2Z33 A;  4XOR A;  1TZL A;  1ZRD A;  4UXN A;  2K4J A;  1QVU A;  4NBQ A;  4I0A A;  1S5L C;  1YQA A;  3SDB A;  2V6E A;  3AKZ A;  4Y17 A;  3G6E I;  1SAX A;  3CES A;  1XSX A;  1IRZ A;  2P6T A;  1IRG A;  1TC3 C;  2RQQ A;  3CC7 I;  3CP2 A;  2A6H F;  4BQA A;  4Q4Z F;  3DWL E;  4XRS G;  3F6O A;  4A3D J;  3KZI C;  3RKW A;  3TO7 A;  2IXS A;  5CKT A;  4ANJ A;  4M6V A;  3L9F A;  4JK1 X;  1MSF C;  2DJI A;  2GIV A;  3CLQ A;  1GVD A;  4XOP A;  3D5R C;  1SVM A;  4MHG A;  3CDH A;  3ONQ A;  5IY5 H;  5E20 A;  3TOB A;  3A2K A;  4DNC A;  3EYI A;  1Z21 A;  3KP2 A;  3VDX A;  4E6K G;  2R92 J;  4B1R A;  2KHM A;  3BP8 A;  2O0Y A;  3GFI A;  3ZMD A;  3S17 J;  3OYD A;  2LLK A;  1S7O A;  4Y3O A;  1MBH A;  4B3X A;  1BM9 A;  2FBI A;  2QZ8 A;  2X9D A;  1L0O C;  1V54 H;  1R4M B;  1FP1 D;  2DDA A;  3AG1 H;  3K69 A;  2UXX A;  3CP8 A;  3H92 A;  5HNF A;  3WHC A;  3L00 A;  3SYT A;  3S16 J;  2E71 A;  1WJA A;  2ZJP F;  2QYO A;  3NWS A;  3OL3 A;  4E7H A;  4A3J J;  1ZG3 A;  1AWC A;  2E1O A;  2XAU A;  2IJL A;  5HVQ C;  3UR3 C;  2HYF A;  4LD5 A;  3O8G A;  2HTJ A;  4F55 A;  1J5Y A;  5FKO A;  4XNF A;  2D5V A;  4CHU A;  2I8D A;  3VYU B;  1H89 C;  3Q9S A;  2KZG A;  3HRT A;  4HV5 A;  2PBI A;  1OYY A;  3VSL A;  4M9X A;  1RKT A;  1OCP A;  3LSJ A;  4HAM A;  2ME6 A;  1HOM A;  2ID6 A;  3SZG A;  2EFN A;  3MMY B;  2NVY J;  4WCG A;  3QPT A;  4HNU A;  2IA2 A;  3ZQG A;  2HVS A;  4L0Z B;  4AWX B;  1WH7 A;  3GTG J;  4HX8 A;  2HTS A;  1K78 B;  2MW8 A;  4EQQ A;  1ON2 A;  3A01 A;  2O3F A;  1BC8 C;  2EFP A;  3LFU A;  3L2U A;  1J09 A;  3HB9 A;  2O61 A;  3LA3 A;  2DFF A;  3LSM A;  2VB6 A;  1XDU A;  4I02 A;  4BQO A;  1I39 A;  2M34 A;  2OC6 A;  3C18 A;  3HHH A;  3GFM A;  3PQJ A;  3V42 A;  3NEU A;  1J59 A;  2L7F P;  2FE3 A;  4XK4 A;  4NC7 A;  1K79 A;  1X4P A;  5IP9 J;  2KJB A;  1JHF A;  5DM6 F;  3PNV A;  2EZK A;  4RA2 A;  2HXI A;  1JUP A;  4FX4 A;  1CF7 A;  1GDT A;  1OJL A;  2MBF A;  5EDN A;  2OQR A;  3I59 A;  1P2F A;  3SXY A;  2PQ8 A;  1IRF A;  1OCT C;  2E2I J;  3S1Q J;  5J4Y A;  1MBG A;  4GO1 A;  2DA6 A;  3WTW C;  2IGN A;  4FQG A;  3Q5F A;  5IP7 J;  4LIT A;  4XKC A;  3EPZ A;  3I4M J;  3CJR B;  4LG0 A;  4W97 A;  1MJB A;  2G0E A;  3Q9V A;  3CCR I;  1AKH B;  3HOZ J;  1OYI A;  4G7Z F;  2XSJ C;  4KIS A;  1WSU A;  4FX0 A;  2L7K A;  3JRA A;  2V1N A;  1FBS A;  4YEL A;  2Y9Y A;  4YRV A;  3CDI A;  4MFD A;  5LHG A;  1ZN2 A;  1PP8 F;  3G3Z A;  3KCC A;  3F0C A;  4D5F A;  1Y0N A;  1T0F C;  2PJR A;  1LFU P;  3AG4 H;  3BT9 A;  3ZN1 A;  4LG3 A;  2BHZ A;  5ICF A;  2CQK A;  3K9T A;  1OCC H;  2DBB A;  3F8C A;  1KQ0 A;  1NK2 P;  5K7H A;  1FY7 A;  1B8I B;  1W5S A;  2IS2 A;  4YIF A;  4HW0 A;  3GEZ A;  2AS5 F;  4WK8 F;  1YX5 A;  4F3Q A;  3EET A;  1UFM A;  2Q0O A;  1BA5 A;  4XN3 A;  1VTN C;  1P4A A;  5L3E A;  3IC7 A;  1JUS A;  2DLL A;  4HST A;  5M3M J;  3CCS I;  4BL0 B;  3QYE A;  1EJ9 A;  4HDU A;  3DTI A;  5E1X A;  4X6A J;  2VL8 A;  1A31 A;  4ZJZ A;  1R00 A;  5LEK A;  3OYC A;  4GRI A;  4F92 B;  1ODD A;  1UG0 A;  2FNP A;  1T8I A;  5BS6 A;  3ELK A;  1A5J A;  2HOA A;  4W1U A;  4A6D A;  1MZB A;  5CPR B;  1T95 A;  2BXY A;  3W6J B;  2XRL A;  5K5R A;  9ANT A;  1XSV A;  3ZXS A;  5H2F C;  4IHW A;  2VKE A;  1LEB A;  2ZME A;  5GAH J;  2HDC A;  2CYY A;  2F5D A;  5IP6 A;  2Y0M A;  3DBH B;  3E6C C;  3WU1 B;  1F1Z A;  1SD6 A;  4A3F J;  4BH9 A;  4RGU A;  2IS1 A;  2XF5 A;  4BJT A;  3TW7 A;  3CCQ I;  3QRF F;  2QEN A;  2MH9 A;  4BQQ A;  2VOP A;  1KYW A;  1PUF A;  3N05 A;  3JRD A;  1IXS B;  3T8T A;  2FRH A;  2JN6 A;  4B3A A;  1SAN A;  1M1E B;  4PJN A;  2JA2 A;  3P9C A;  3CCE I;  3PIP F;  5E8G A;  1HLV A;  3JR9 A;  1BIA A;  1MJ9 A;  2CW0 F;  3LSH A;  3LFK A;  3KP3 A;  1IW7 F;  1FWZ A;  2WAF A;  5C4J J;  4TV7 A;  2XGC A;  5J8C A;  4D7M A;  2RQP A;  3UNG C;  5L3F A;  2WAQ N;  1I27 A;  2Y75 A;  4ZYD A;  2V9P A;  2AQE A;  4R8H A;  1FSH A;  4C2U A;  2M0M A;  2VOO A;  4P9U A;  1USS A;  4UV9 A;  1TT5 B;  3DFG A;  3DQV C;  3OYM A;  1BL0 A;  2FOK A;  1F5T A;  3TL4 X;  4RBO A;  2MD5 A;  5LD2 C;  1WGX A;  2EZI A;  2DOF A;  5M5Y J;  1XGS A;  3ABT A;  3LSR A;  3LAP A;  3HUG A;  5CVI A;  5HOD A;  1J75 A;  2EZH A;  1UJ8 A;  5HOO A;  3NAU A;  1YS6 A;  3JTH A;  2M45 A;  1EF4 A;  2G7U A;  4P55 A;  2Q1Z B;  4CCM A;  4HYE A;  4PFO A;  4A6E A;  4IOA F;  5D6F A;  1Z6R A;  1XPX A;  3SFZ A;  3ZMT A;  3JCU C;  1QVT A;  1VQM I;  5E18 F;  3OSF A;  2DA7 A;  3HOW J;  1IGN A;  3K70 C;  1XDS A;  2E19 A;  1BR4 A;  4IPA A;  2ZO4 A;  2G9W A;  1V5F A;  5DD4 A;  2LRD A;  4V2G A;  3UKG A;  1BJZ A;  3OOU A;  4RB0 A;  4ZYG A;  2RC4 A;  1B9M A;  4XLP F;  2VKV A;  1KU9 A;  3IV5 A;  5KAF C;  3KZY A;  3V7C A;  5LGU A;  2IGM A;  4A2U A;  2MSY A;  1U8B A;  1KQ9 A;  3IKT A;  3S1M J;  3HRS A;  2M87 A;  2WY8 Q;  3KP4 A;  1LFP A;  5DS9 A;  1BJA A;  1VQ4 I;  3BZC A;  3BR0 A;  4HX7 A;  4OOI A;  1E0E A;  2A68 F;  3VYS B;  1RUO A;  3U1D A;  2ISY A;  2GXG A;  2XAJ A;  4MIM A;  3RPU A;  2P5K A;  3OYE A;  3WTT C;  4BDY A;  2LF7 A;  2EFQ A;  3BTC A;  2H1L A;  3RI4 A;  1R58 A;  2DCE A;  3NQO A;  3JSP A;  1H8A C;  2R7W A;  3FKJ A;  2KP6 A;  4P9F A;  3HYI A;  1G3T A;  3S1N J;  1HW2 A;  3DLL F;  4Q47 A;  2G7H A;  1BR1 A;  1LB2 A;  2IGO A;  2ZNZ A;  3LSP A;  1W5T A;  3BG7 A;  5DD8 A;  2ECB A;  2BW3 B;  3BTI A;  4A3G J;  2NS8 A;  3BR1 A;  5EEA A;  5A2Q K;  2CV1 A;  3SZT A;  3OSG A;  1F43 A;  3JW4 A;  1QU3 A;  2P0W A;  4HDV A;  4KN7 X;  4J00 A;  1MIJ A;  3P5J A;  3I5U A;  3M4O J;  4QIW N;  2UWM A;  2A05 A;  2QWW A;  1G3S A;  2P4W A;  2WB1 A;  4G6D A;  2K3F A;  3FIW A;  5E3M A;  2R7T A;  4AIH A;  2FOW A;  2JVG A;  2R7X A;  5JHU A;  2H1K A;  2R4G A;  5LRR A;  2WA0 A;  3ZQH A;  4P1W A;  3N4M A;  4XL9 A;  3P7N A;  4XKW A;  3O8H A;  1SVL A;  2E2H J;  3ZMU A;  3WTX C;  3M3Y J;  2X51 A;  1YIO A;  2QUF A;  4C3H J;  4KIB A;  2Z9O A;  2WV0 A;  4FT8 A;  1IAW A;  1S7A A;  3G2B A;  2B7E A;  3K10 A;  4HEA 2;  3I4N J;  1ETK A;  5FJ8 J;  3ML6 A;  1S8N A;  2LC2 A;  2ZSH B;  2LNB A;  4KJZ A;  3HTU A;  1ZKG A;  5A2Q Z;  4O6J A;  4R1H A;  4BDZ A;  1PP7 U;  1SFX A;  4XLH A;  2Z16 A;  2HOS A;  3CCL I;  4JOM A;  3QP5 A;  1ZHF A;  1HC8 A;  1BIB A;  4E7L A;  1V5G A;  4DGW B;  3KX2 A;  4LLL A;  3G1L A;  2X85 A;  4H4K C;  3ZQF A;  1VQ7 I;  1DP7 P;  2PG4 A;  3WU2 C;  1JJ8 C;  1MMN A;  3R60 A;  3K4L A;  3JRI A;  5KAI C;  1E17 A;  1MMA A;  1WVR A;  5EG0 A;  1T56 A;  4IHT A;  3ROU A;  1XX5 A;  2NRA C;  1W4M A;  2GA1 A;  2WAQ A;  3OYL A;  3PFY A;  2JRM A;  3S32 A;  2DMP A;  5IT3 A;  2Q2E B;  2XRN A;  3CC2 I;  5CQG A;  2BXZ A;  3V4G A;  2BY1 A;  4L5I A;  3RJP A;  5F04 A;  2RN7 A;  3KLO A;  2HQR A;  5BPI A;  3KE2 A;  3R6S A;  1FTZ A;  2R7U A;  4CCK A;  3TKY A;  4RS8 A;  1RKW A;  2HKX A;  2IVM A;  3NAR A;  1ZAO A;  4HNV A;  3MQ0 A;  2XC7 A;  2D45 A;  2E1C A;  3BJ6 A;  4UUV A;  3J7A O;  3L2R A;  2H94 A;  2BEO A;  2F5E A;  2R5Y A;  5LRS A;  5ILV A;  4N4N B;  3FMS A;  3T8R A;  2KDZ A;  2CS3 A;  4CO8 A;  4L0Y B;  1LVK A;  1Y8R B;  3FIS A;  1GXQ A;  3K4K A;  1TWC J;  2XVC A;  2K86 A;  4IEJ A;  2R7S A;  1QPI A;  3CJQ B;  3RPU D;  3H3V K;  3PUF A;  1KA8 A;  2XGX A;  2LOO A;  2XAQ A;  4PJ0 C;  2O8K A;  3K4N A;  4Y7N J;  3QWL A;  2EJR A;  3BPX A;  1KZH A;  3CO7 C;  4V19 K;  4LJZ F;  4M3D A;  5BMZ A;  1ZAR A;  3N97 A;  4IKF A;  3HOS A;  4Z6Y A;  2Y30 A;  1T0F A;  2ESN A;  1UMQ A;  1J0R A;  3MN2 A;  3J7Z I;  4ZDL A;  3R0A A;  3H36 A;  2M30 A;  4EAT A;  2KKO A;  3LQQ A;  1ONV A;  4MNU A;  2BHY A;  3RPQ A;  1I3Q J;  3BCB A;  2K9N A;  2NNN A;  4PK4 A;  3SZP A;  4ZZL A;  2N8G A;  2XKP A;  3L2C A;  3F22 A;  2NVX J;  2PJP A;  4Y15 A;  2E7X A;  4UV8 A;  1WZ2 A;  1W36 D;  1JE8 A;  3BQY A;  3U1K A;  2W4S A;  1OCO H;  4PJJ A;  4NC8 A;  3MVP A;  4F91 B;  3EUA A;  4GXO A;  2LY2 A;  1T08 B;  1Y56 A;  5GPC A;  1GVJ A;  1APL C;  2FXA A;  1MW7 A;  2VBX A;  2GOM A;  3AFH A;  3GLL A;  3I55 I;  4LLN A;  1WJC A;  4XN0 A;  4PFP A;  3IAS 2;  4I0B A;  2P8T A;  3PIO F;  4LFU A;  3GWZ A;  3PJR A;  3MKY B;  4EJV A;  3C7J A;  5E79 C;  3C2H A;  4LB6 B;  2R7V A;  2VPR A;  4YEJ A;  3MKL A;  3A01 B;  1DPR A;  3BR6 A;  1N77 A;  5EGO A;  3K4B A;  3GVA A;  3GTM J;  2M8G X;  2L02 A;  4YG2 F;  1JXS A;  5J1Y A;  2R5Z A;  1GT0 C;  5FD5 A;  1LDJ A;  2MLG A;  1XG1 A;  2ISZ A;  4KIG A;  4HF1 A;  3E3V A;  1I5Z A;  2M2E A;  3LWF A;  4KUM A;  3S3M A;  1SFU A;  2EV6 A;  2K3P A;  1IXR C;  2AQF A;  5IYC J;  1B9N A;  4RM3 A;  1CF7 B;  2DXI A;  5JLW A;  1J7K A;  1TT0 A;  1MBE A;  3VYR B;  1IZ1 A;  2O8X A;  5DV5 A;  1MKM A;  5FRO A;  2RRE A;  3I59 B;  5DDG A;  3BWG A;  2V1X A;  3I4P A;  3G73 A;  1VQL I;  2VON A;  4U87 A;  1YO5 C;  3HSF A;  2F5C A;  2WTE A;  4BHB A;  3JAM K;  4F7Z A;  3BOQ A;  2NVU B;  2P5V A;  4HZF A;  3WOD F;  5HNH A;  3MZY A;  2AXL A;  3GCM A;  1R23 A;  3VSK A;  4LG0 B;  1K83 J;  4IF4 A;  2JA6 J;  1BI0 A;  3LSK A;  4Z2Y A;  5FB2 A;  2HFH A;  3CMY A;  5DCM A;  1WQ2 A;  2ZFU A;  5HLH A;  2DOD A;  3U9G A;  1T98 A;  1TWH J;  2LKP A;  3WHB A;  2HWV A;  2PJR B;  1MND A;  2PMZ N;  3QQA A;  4CCJ A;  3COA C;  1O7F A;  1A04 A;  2OAZ A;  1GHC A;  2W25 A;  1WI9 A;  2LD5 A;  5FFZ A;  4DYC A;  3F3X A;  5J6X A;  1TQI A;  1TTY A;  4GGG A;  3DXJ F;  4XQF A;  1YRN A;  5FLM J;  3DBR B;  3AL0 C;  2HQA A;  1YIJ I;  1VQN I;  3HEF A;  2Z1D A;  3M1E A;  4Y4R A;  3LNQ A;  1Y1V J;  5LHI A;  2E1M B;  2OCE A;  3BQZ A;  2ZJQ F;  3CD6 I;  3SJM A;  1SVO A;  3H5A A;  4IL6 C;  3QAH A;  3JAM Z;  1RZ4 A;  4AYB N;  1FEX A;  1BR2 A;  2LDU A;  4UVC A;  4BHP A;  4C3I J;  2MA3 A;  3TMO A;  3OYB A;  3BCA A;  2CW8 A;  5HLG A;  3CMA I;  2HPM A;  2VT3 A;  4BXF A;  2IPQ X;  2HI3 A;  3F6V A;  3QPH A;  3WGH A;  1MDM B;  4KIT B;  4L5E A;  3WG9 A;  2LK2 A;  1R1T A;  2V9K A;  2YUS A;  3F72 A;  3DBL B;  3TOA A;  2DMQ A;  5GTH C;  2ZME B;  4I98 B;  2EBI A;  2CUF A;  1NK3 P;  4HX4 A;  5D8K B;  5ICG A;  2IGK A;  1A6I A;  3ZPL A;  1P4X A;  1A35 A;  2M0C A;  1MJA A;  2W85 A;  3E6B A;  3EYY A;  1J2X A;  1RET A;  1V3F A;  2PMH A;  1G3W A;  2KFD A;  1PUF B;  2VPL A;  5B3S H;  3GTP J;  1O7L A;  2YS9 A;  4NUB A;  1MBF A;  4PZJ A;  5DCF A;  2KMU A;  2QLZ A;  3CQZ J;  1QBJ A;  1K6Y A;  3CDL A;  3ZQC A;  2ZB9 A;  4AC0 A;  2BGC A;  3DV8 A;  1YJ9 I;  4LIU A;  1FZP B;  4X0G A;  1R9T J;  2M9H A;  1RNL A;  3E97 A;  4CGZ A;  3GUD A;  1QZZ A;  1D0Y A;  2V26 A;  3DP7 A;  2DK8 A;  4RB2 C;  1LQ1 A;  2DO7 A;  4RLF A;  2JUG A;  2NOG A;  4MQ9 F;  4QLC U;  1BI1 A;  5BNG A;  4JYK A;  2DYS H;  2PFB A;  5EZG A;  5J1U A;  5FLV A;  2HOE A;  4ZDP A;  4AIK A;  3MWM A;  1E2X A;  1JT6 A;  3NWT A;  3M8J A;  1WKM A;  1S6L A;  1GXP A;  2M5W A;  4N9I A;  5DUK A;  5D4R A;  1XSD A;  2GA2 A;  2JK3 A;  4IJA A;  1R22 A;  1I1S A;  1DUX C;  3HUG B;  4HA8 A;  2WWY A;  5E3O A;  5E1W A;  1IO2 A;  3S2W A;  2ZXI A;  3HOY J;  4X1E A;  2XRO A;  2BOL A;  2CV0 A;  4C2M J;  2DA1 A;  2TRT A;  4BS9 A;  1TW2 A;  3FK6 A;  4D5C A;  4EEF G;  3DEU A;  4ZYE A;  2MGQ A;  1FIP A;  3VEP A;  4XID A;  3WTZ A;  2JTV A;  4DBR A;  1JT0 A;  3EUH C;  5J3L A;  2FSW A;  3GZ5 A;  5J40 A;  3V8J A;  3HOU J;  2O9L A;  2XV4 S;  4O5V A;  3IAM 2;  3W6V A;  4DOZ A;  3RZD J;  1WJD A;  4PJL A;  2IS6 A;  1REP C;  1OR7 C;  2EV5 A;  6PAX A;  4WXD A;  2ECC A;  4BGD A;  5HDN A;  2JRT A;  3HGY A;  3HXL A;  4Y33 A;  5JVT A;  3S3O A;  2XAH A;  1MMD A;  2ZBK A;  2V9V A;  3FKI J;  1UB9 A;  2W82 A;  1YW7 A;  2F6C A;  3A1Y A;  3RKY A;  5EF6 A;  4IQJ A;  4A3L J;  5KVR A;  1R1V A;  2GAU A;  1R71 A;  5IT9 K;  4G12 A;  1FJL A;  1DU0 A;  4QPO A;  4IHX A;  1J9I A;  4U7D A;  2OZU A;  4U0Y A;  2DA3 A;  3RTR A;  2EH3 A;  2CMP A;  4JP0 A;  1U78 A;  1SD4 A;  5JHF A;  1ORK A;  1X2N A;  3G4S I;  3BPV A;  1ETV A;  2P7V B;  2NOJ B;  4CIC A;  4EMS A;  4YFK F;  1ZLK A;  3DPL C;  4BEH A;  3P9K A;  3GXO A;  4IO9 F;  4ZDO A;  3W2A A;  1B6A A;  2EA4 A;  3ZQL A;  1TBX A;  1N78 A;  1N75 A;  3PNT A;  1W1W E;  1GUU A;  3W6K B;  4LIV A;  2DI3 A;  2UV1 A;  5F1J A;  1BN5 A;  1YG2 A;  3V7R A;  2GXA A;  1HQC A;  3KEY A;  3QYB A;  3WTV C;  2P5L C;  1YI2 I;  2H27 A;  3FDY A;  3HBL A;  1PYV A;  1OPC A;  3K1N A;  1K61 A;  4DZP A;  1R6R A;  3K4M A;  1JJ6 C;  3M7G A;  3IP4 B;  2E7W A;  1D1C A;  2JWT A;  1G8X A;  3KYD B;  3HHG A;  1MDM A;  4ESJ A;  2W57 A;  4EJT A;  2EV0 A;  1YOV B;  2E5Z A;  2HZT A;  3BG3 A;  1VQK I;  2NS0 A;  5DEQ A;  5IT9 Z;  1IN5 A;  4MGR A;  4I01 A;  5D8L B;  2IAI A;  4AYB A;  2HU9 A;  4IHV A;  1EH7 A;  1D1A A;  3HC7 A;  5IYD J;  4QWQ A;  2R7F A;  2P7C B;  2OA4 A;  1LDD A;  2I10 A;  2F5F A;  4XSX F;  5IPA A;  5D5U B;  4MO7 A;  1WJ5 A;  4IRG A;  3OYA A;  2FMY A;  2MG4 A;  2CQN A;  1KGS A;  2ZXJ A;  1ZEL A;  4UB8 C;  2CG4 A;  2VLA A;  1TW3 A;  5AIQ A;  4S0H B;  3L09 A;  4NDL A;  1U2W A;  1MBK A;  3CUQ C;  1Z7L A;  4RGX A;  3ZP5 A;  4B48 A;  3K1P A;  2DAO A;  2NVQ J;  2ZSI B;  4PGG A;  1LPQ A;  3IUO A;  3C3W A;  1SEU A;  1XGM A;  5GAG J;  3R0J A;  4PUS A;  3CME I;  5FLX K;  1A36 A;  2BY3 A;  3S8P A;  2FJ1 A;  3KIO A;  4M71 A;  4ZTJ A;  3OIP A;  1DQU A;  3WGI A;  1JKP C;  1YX3 A;  2UXN A;  5CQE A;  3I64 A;  5AIP A;  5FGM A;  4AVZ A;  2NNY A;  3OYG A;  4KT6 A;  1QHH D;  3A0H C;  1PUE E;  2XB0 X;  1E3H A; 
#chains in the Genus database with same CATH homology
 2BZT A;  1UJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...