2K02A

Solution structure of putative ferrous iron transport protein c (feoc) of klebsiella pneumoniae
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
79
structure length
79
Chain Sequence
MASLMEVRDMLALQGRMEAKQLSARLQTPQPLIDAMLERMEAMGKVVRISETSEGCLSGSCKSCPEGKAACRQEWWALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Ferrous iron transport protein C
publication title NMR structure note: the ferrous iron transport protein C (FeoC) from Klebsiella pneumoniae.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
total genus 12
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09012 FeoC FeoC like transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2k02A00
1U5TA 3ML6A 1LDKB 2OD5A 3CUOA 2PEXA 4EM0B 1UB9A 2DT5A 3I53A 1P6RA 2K86A 2V79A 1JXSA 1QBJA 4KIBA 1R1UA 2DQRA 1MKMA 2EB7A 1F5TA 5FGMA 3GFMA 4A0XA 5BOXA 2J5PA 4WWCA 3I59A 2A07F 1XGMA 4IHSA 2QQAA 3PQJA 4YIIA 5LRSA 1HKSA 2D1VA 4I98B 1XDUA 2Y75A 2FBIA 4BH9A 3R4KA 2PG4A 2QWWA 2AS5F 1D8JA 3F8BA 4M72A 3R61A 3V7RA 5EEHA 1QPMA 3WGHA 1TW2A 5ILUA 3G73A 3FM5A 1ZN2A 1OYIA 1Z7UA 3MWMA 1I27A 4KICA 1U8RA 5D8KB 1YW9A 2FXAA 3FXQA 4EGYA 4HOBA 5K5RA 3QU6A 2GXGA 3GUDA 1ZG5A 4LLLA 3V7SA 1TQIA 3FF5A 3D5LA 1D8KA 2FOKA 2GQQA 4WX9A 5EEGA 1Z6TA 5HVQC 5AIQA 2NRAC 1FYMA 2OAZA 5AIPA 3M1EA 2F2EA 1R1VA 2HTJA 5E1XA 4I0BA 2O3FA 4Q47A 4G8XA 2WWYA 2EA4A 2YX4A 2EK5A 3GFLA 5CLSA 2Z3YA 3E6DA 3F8CA 4I7HA 4HBLA 5BS6A 3D0SA 3FMSA 3HSFA 3GFJA 2K4JA 4U0VA 1S6LA 4E70A 3C7JA 2CG4A 4L5JA 4RGSA 3HOTA 5LHGA 4KNYA 4CDGA 2UWMA 5LRRA 4EM2A 4ESBA 1PDNC 2P4WA 4PGGA 1MJAA 1HW2A 4I01A 1RUNA 2OZUA 4U7DA 3JSOA 1SFXA 1Z9CA 1GHCA 3RPQA 3JAMK 3O2PE 3EDPA 1GXQA 3ZPLA 2IT0A 5L3FA 3HHGA 3CJNA 3E6MA 4WF2A 3MZYA 2DPUA 4NHJA 4L18B 1XD7A 2KJBA 3TDUC 3FXUA 2GAUA 4UVBA 1GVJA 1OR7A 3CTAA 5TRDA 3K9TA 4BHPA 3GX4X 1FZPB 1XSDA 1XMKA 3M8FA 2P5KA 5H6QA 2LF8A 1S7OA 2V9VA 4EQQA 2LKPA 1DPRA 5D4RA 2QQ9A 3TO6A 2GA2A 1J2XA 1HW5A 2VBYA 3WGIA 3TOAA 2A68F 1KQ8A 1OKRA 4EJOA 3BROA 4K2EA 2ZKZA 3F22A 1UCRA 3EUHA 4BNCA 1RZ4A 2XVCA 1U3EM 5DUIA 4G7ZF 1MDMA 5E1WA 2VXZA 5BPIA 3ZP5A 4CXFA 3LAJA 1YQAA 1OPCA 2XAJA 3CUQC 5FLXZ 2ADUA 4ENNA 2V1XA 4A0YA 2CWEA 1KYWA 3R60A 3ZMSA 4KN4X 3GYHX 3V8KA 2FQ3A 3I54A 2PI0A 4L9TA 1W7PA 1WWXA 5D5UB 3KEQA 1ON2A 2RVCA 5E17F 4CGZA 3E97A 1HKQA 2M30A 5L3GA 4ZYDA 1MZBA 1STZA 2PQ8A 3B73A 4LG0A 5D5WB 2QENA 4IRGA 5ERIA 4G7HF 1FP2A 2FNPA 2W84A 3QOPA 4O5VA 1Z91A 1XGNA 2EV5A 2GWRA 4L0YB 3L9FA 2H6CA 1CF7A 2YR2A 2H27A 4RB1A 3H3UA 3JTGA 4G9YA 4PCQA 1U5TB 1C0WA 4UNOA 3P9IA 2MD5A 4U0YA 1KA8A 3GWZA 1R5HA 4FT8A 3RKXA 1BI3A 2VODA 2ZCWA 5HDKA 1B1BA 1YIOA 3K1PA 1YW8A 2H09A 5H20A 2Z99A 3P9KA 5JI6A 1MJ9A 3L2CA 2OQRA 3KP7A 5E20A 4R79A 3CO6C 4QWQA 5F64A 3I59B 3LA3A 3GLXA 1T98A 1LDJA 3QPTA 1JGSA 1UFMA 5FD6A 4L9NA 1G3TA 4HDUA 1B6AA 3MQ0A 2BGCA 1H0MA 3ZN0A 2XHKA 5FO5A 2A6EF 1ZRCA 4P55A 2YU3A 2B0LA 4M9XA 4OMYA 1QGPA 5FFXA 2HQRA 2FMLA 2O03A 5E18F 4S04A 1WQ2A 1FBUA 4KIFA 3C1DA 4JBAA 1ON1A 2X4HA 2HQNA 2K4BA 1K7AA 1FT9A 1TW3A 2RV8A 3ELKA 5ICFA 5A2QK 2M87A 2XKPA 2MLKA 2PLYA 3K0LA 5DD8A 1O7LA 4NB5A 3MAJA 4AIHA 4XSZF 4IVNA 1YFHA 1I1SA 4BAYA 3JSPA 2JTVA 2YSRA 4AWXB 3JW4A 2K02A 4U0WA 4EM1A 3K2ZA 1B59A 2UXXA 1TNSA 1F1ZA 4N0BA 3EQLF 1D5VA 1TNTA 1SAXA 4CICA 3KP4A 5ED4A 1QZYA 1IRFA 3KLOA 1IN5A 3U9GA 2BBYA 5HLGA 1R00A 2OA4A 3I64A 4NQWA 1WRJA 4HDVA 2NAZA 4A12A 2BE5F 3QAHA 5CYVA 3IC7A 1IF1A 2DW4A 1BI2A 3EYIA 2IA2A 1S29A 1YTYA 3ECHA 2DU9A 4KIGA 2L4MA 3VODA 2CO5A 5D6EA 1KU3A 3WTWC 3P7NA 5DCMA 3PFIA 4RB0A 2E1CA 1HXDA 3FZVA 2QYOA 1U78A 3CUQA 1FYKA 3HIFA 4MQ9F 5CVRA 4A6DA 3MCZA 5IT3A 3F21A 3T8RA 2ZO4A 4HX8A 4P9FA 4U88A 3I58A 4ZYGA 2FNAA 4Q4ZF 3DKWA 1W7PD 2F5CA 3K1NA 3GFIA 1SD4A 3P9CA 5LGUA 3DPLC 2P6TA 1HBXG 4G6DA 1G4DA 4FHTA 3KP5A 1LDDA 1XN7A 3ZMUA 3QP5A 2ZNYA 1ZYRF 2IP2A 1J5YA 1YO5C 3BOQA 1USSA 4UV9A 3HUGA 2D45A 1ZRDA 3SZTA 1PP7U 2L3DA 4AVPA 2CW0F 4WXDA 2V1UA 1LNWA 1LEBA 1WSUA 3GF2A 3BZ6A 3W6JB 5J8FA 5D6FA 3VEPA 4ZYEA 1O3TA 2XAGA 1MDMB 4UV8A 2EFWA 1X3UA 4IRHA 3IWZA 3BP8A 1XCBA 2XIGA 2CGPA 3ROUA 2MBFA 2XROA 4JK1X 3TKYA 2M1BA 1SD6A 1V3FA 4ETSA 4ZZDA 3HTSB 4LB6B 1IAWA 1W7PB 5JFRA 2IA0A 4EV0A 1FYLA 3CO7C 3RI4A 2CQKA 2QM3A 3T0YA 1ZG1A 2PMUA 3DFGA 2VONA 1SD5A 4UXNA 4LG0B 3RJPA 4HZFA 5ICGA 5K1YA 1H9TA 3GXOA 4MEXF 4I09A 2JPCA 3RYRA 3PQKA 5HS9A 2VE8A 2ISZA 3RIRA 2L4AA 1CF7B 5DYMA 3LAPA 4ESJA 5DEQA 5H6RA 2FU4A 5IT9Z 1G6NA 3DPTA 1I5ZA 1O7FA 2ESHA 2VOOA 4OOIA 1EH7A 5E8GA 1K78A 4GYGA 1P4AA 3ZMDA 1EH8A 2NNYA 1EV7A 1K79A 3KCCA 3WGGA 1ZLJA 5E8IA 4F7ZA 3RYPA 2QVOA 4IJAA 3F6OA 4GGGA 1XGSA 2Y48A 4AD9A 1RI7A 2IRFG 5FLXK 3V7CA 1P4XA 1BI0A 4OIQF 5D4SA 2DAOA 4UVCA 2PBIA 2V1DA 2FSWA 2EWNA 1I1GA 3BJAA 2BEOA 2E1NA 3NQOA 3FM3A 4EGZA 3Q9VA 2VC0A 1JE8A 4ASNA 3Q5FA 4P96A 4A5MA 3N4MA 2K7LA 2Q2EA 4RB2C 3ECOA 3TO9A 2LF7A 3E5QA 1G3YA 2CFXA 4P5OA 1U2WA 5KK1A 3TO7A 3WTSC 4KMUX 1SD7A 3J81K 4Y13A 1S8NA 3BPVA 2FEZA 3I0TA 1H9GA 4B8XA 2CSOA 4RAYA 3WODF 3VFZA 3N97A 4OIRF 2IPQX 1J9IA 2KRFA 2HS5A 4JQFA 1YLFA 1R36A 1BN5A 1BC8C 5LEKA 2V6CA 3S2WA 4M73A 2A3SA 4EMSA 3F3XA 2HYFA 5CVJA 1HSJA 4IRIA 4LD5A 1ULYA 3QPHA 5D5VB 2ETHA 3KE2A 1NHAA 2DBBA 2ESNA 6PAXA 4I02A 3WTYC 5JHUA 1T38A 1GXPA 2XAHA 5DCFA 3WTZA 2GIVA 1ZAOA 3H92A 1SFUA 2UZKA 2ZNZA 4L9VA 4MNUA 4BXUA 3U1DA 3RPUA 4BHBA 1S7AA 1DPUA 4XLPF 3TOBA 4M6YA 2O61A 1I6XA 2P8TA 4BQAA 4LK1F 3BJOA 4Z2YA 4QLCU 4L0ZB 4HQEA 1HSTA 1OYYA 3FMQA 2HWVA 4KT5C 5DCMB 2Z5UA 3DV8A 1W4MA 2TDXA 2G7UA 4KFCA 2VT2A 3J81Z 4PDKA 2RQPA 4IXAA 2VBWA 3CUQB 3RKYA 1PUEE 2OQGA 1FSEA 3WTTC 2H94A 2ZFWA 3FHZA 4XSXF 4LLNA 1IN7A 2ZMEA 2EV0A 3ZMTA 3LFKA 3ZMVA 3G3ZA 1FOKA 1IXRC 2FMYA 3CLOA 1J0RA 1QNTA 2H6BA 5FD5A 5F1RA 2F5EA 5HOOA 2W57A 3J80Z 3KZYA 4WXHA 2L02A 2J5OA 3V8LA 1T6SA 3HRMA 4L9JA 2DLLA 1AWCA 4YG2F 2HEOA 3HSRA 4YFNF 4MEYF 4Y15A 4LMYA 2E7WA 2W24A 3BDDA 2FRHA 1HW1A 3KP3A 3BJ6A 5KVRA 3NEUA 1LJ9A 3EYYA 2EJRA 3MZHA 1TTYA 1W5SA 3C3WA 1Q1HA 4HX7A 3REOA 3WTXC 3FMRA 1IN6A 5BPDA 2L54A 1IXSB 4ZH4F 3LQRA 3WE3A 3JTHA 1SFEA 4KYWA 1A04A 4YFXF 1ONVA 2IJLA 3ABTA 4XLNF 4HA8A 3OV8A 4HQMA 5HDGA 4UHTA 2HKOA 5LBQA 4ZYHA 5K5QA 2VN2A 4EJTA 1ZREA 4YIFA 4Q5SF 1O3SA 1IXCA 4LLGF 1LQ1A 3BPXA 5CVIA 4HX4A 3AAFA 2LSOA 1K78B 3R6SA 1XCVA 3SXYA 2BYVE 2F5FA 2W25A 2Y0MA 4WXCA 4A0ZA 1TQPA 3DEUA 3CDHA 4RAZA 1E17A 5FFZA 2P7VB 3I5UA 1AOYA 3DQVC 2KKOA 3LA2A 4Y17A 4RS8A 2P5VA 2BV6A 3R0AA 4AIJA 3RTRA 3FX3A 3F72A 4M6XA 4HV6A 3EETA 4WCGA 2HYGD 3HRTA 2IA1A 3IHUA 1FY7A 5ICEA 2JSCA 1ODDA 1YG2A 2E7XA 2MH9A 2C6YA 4ENKA 3H3ZA 2YPRA 3ISPA 3MFKA 1KQ0A 2F5DA 2FBKA 4A2UA 2HDCA 2NS0A 3ZQ7A 4RGXA 3IRRA 2VC1A 3O6BB 4ENJA 3MEXA 2FA5A 3GZ6A 5DD4A 3U2RA 2HOEA 1IUYA 5IT9K 5CVUA 1F9NA 3ULQB 4M74A 2JZYA 4A5NA 1O3RA 1R5GA 3IL2A 4FX0A 2R7FA 1J59A 2W85A 4HW0A 2HR3A 3DXJF 2FF4A 1BOAA 3BWGA 3E6BA 3RDIA 4B09A 4P9UA 3LSTA 5J6XA 2OU2A 1BM9A 2VBXA 3L7WA 3LWFA 4ZZLA 1J75A 2KIFA 1CGPA 4G7OF 1FBSA 1L0OC 3DP7A 1V4RA 3M7GA 2HFHA 1IN4A 1XDSA 4EJVA 5ILVA 2M5WA 2JPBA 1IW7F 5JR3A 4OIOF 3LA7A 2QBYA 3T5XA 3V4GA 3V8JA 4OU0A 2QLZA 5ICCA 2RKHA 2YX7A 4PGHA 5L3EA 4A6EA 4D0PA 1QO0D 1MD0A 2DPDA 2QQBA 4G94A 3GEZA 4N9HA 1R23A 5HS8A 3KP2A 1DUXC 5L3CA 4LB5A 3HHHA 1T39A 3E5XA 1B4AA 4I2OA 4CHUA 2NNNA 2P7CB 5BQTA 3F23A 5L3BA 1ZRFA 3WE2A 1O57A 3ZMZA 1LVAA 1D3YA 2AXLA 2O6GE 1F4KA 4HLYA 4M9SA 3WU1B 2ZMEB 4KMFA 1YYVA 1O3QA 1OYWA 2DK8A 2P6SA 1EH6A 2OZ6A 2A5YB 4DNCA 1ZGJA 1FLIA 1W5TA 2LNBA 4XBFA 3GO5A 3Q9SA 4MTEA 4Q48A 1R58A 2DO7A 5ILSA 2MH2A 5JVTA 1B9NA 3HYIA 2WV0A 5HLHA 3DF8A 2WTEA 3TGNA 5LHHA 2JT1A 4KA4A 1ZH5A 1YS7A 3GZ5A 1L3LA 4BHCA 3F8FA 3E3VA 1T2KA 5J8CA 2QUFA 2Z9OA 3KLNA 4GYIA 2XGXA 2EFPA 4G6QA 2VE9A 1VTNC 1QZZA 1KGSA 3WG9A 1FNNA 3KEOA 2HKXA 4LFUA 3IKVA 1XGOA 1RIOH 1WKMA 2HTSA 1XSXA 2VOPA 3B02A 3M8EA 1G3WA 3TQNA 2G9WA 1FP1D 1WI9A 3F8MA 1KU9A 2PJPA 1BBYA 3SQNA 2DQLA 1HQCA 2Q8KA 4CO8A 1XSVA 1P2FA 1OMIA 1ZLKA 1FWZA 2EFQA 2D2WA 3HOSA 1IZ1A 3J80K 3ERED 5AONA 4N9IA 3C18A 3HRUA 1DP7P 1P4WA 1Z1DA 5HLIA 1P92A 5DUKA 3E5UA 1BI1A 3OOPA 1FPQA 4U7BA 1RUOA 2LDUA 4DQ2A 1FBQA 2XAFA 1KU7A 2PFBA 4HF2A 4H0EA 3IKTA 2EV6A 2K27A 3T1BA 4ON0A 3FWEA 2MC3A 2FE3A 1ZARA 2KIMA 3GW2A 4AIKA 1BIBA 4KN7X 4MTDA 1U5TC 2VT3A 4IPAA 4I0AA 5LLQA 4HF0A 4XRFA 3QP6A 4BYYA 1BJAA 5D5XB 1FC3A 1UHMA 2WC2A 2ZXJA 1FSHA 1XB4A 1G3SA 2DFIA 3VOEA 1HKTA 4OIPF 3VB2A 2O0YA 3JAMZ 1USTA 1BIAA 3IWFA 2ISYA 3F6VA 1LEAA 3KP6A 2EFNA 2R7DA 2XKOA 2RN7A 5HDNA 3O3KA 4HAMA 4R1HA 3I4PA 3ZN1A 1PP8F 2QZ8A 1MGTA 4IHTA 4GXOA 3I71A 4CZZA 2G7HA 1IN8A 2RGVA 4EVIA 4HYEA 2O8XA 1T0FA 4GCVA 3K1MA 4MGRA 3HSEA 4MQVA 1R22A 1ZG3A 2ZJ2A 4TV7A 1XMAA 4KUMA 5LGNA 3F8NA 3M9AA 2DTRA 5TJJA 2MLGA 4RGUA 1DDNA 1B9MA 1ZHFA 5LGTA 2EA2A 4S05A 3R0JA 4ENMA 2XUBA 3W6KB 3E6CC 4HV5A 2GXBA 3TDZC 5BMZA 5D8LB 2KJCA 1FX7A 1TLHB 4GO1A 1Z6RA 2NYXA 4HF1A 3WU0A 2A6HF 1R7JA 3QRFF 3COAC 2STWA 3LQQA 3KFWX 1TQMA 4OMZA 1S3JA 3GVAA 2XV4S 4R8HA 4UUVA 4ESFA 3SZPA 2M45A 2PN6A 5DDGA 2A69F 4HLXA 5K5OA 2UXNA 3KZZA 2OBPA 2GA1A 4YFKF 2P5LC 3IRQA 3NRVA 1QQIA 1R1TA 2DI3A 4L5IA 2X0LA 2QBYB 2RDPA 1KU2A 3BY6A 4M71A 1JHHA 2STTA 2ZBKA 1TBXA 1ZGAA 5DV5A 1BC7C 1SMYF 1U6GA 2L01A 1LB2A 5HS7A 2COMA 4CYDA 1YS6A 4UVAA 4PZJA 5LHIA 1KYZA 5F6FA 2PMHA 2CYYA 5E1ZB 4LJZF 5CVVA 2KIUA 3FXRA 2JRTA 4RB3C 2EFOA 3SHFA 3WTVC 1MJBA 4KDPA 2RC4A 2XAQA 3WTUC 3T8TA 5CJ9A 2VBZA 2XRNA 3HRSA 4O6JA 2HZTA 3KETA 4IF4A 1REPC 3ABUA 4RGRA 2MA3A 2FBHA 4LK0F 5LEJA 3J7AO 2HGCA 2A61A 2IW5A 4EJWA 2DK5A 3HTUA 3SFZA 1Y0UA 5FB2A 1UHWA 2ACJA 4MHGA 2IVMA 2Z33A 1E2XA 5L3DA 4LGWA 4WK8F 1K6OA 2XASA 2RNJA 1J7KA 1IRGA 3L09A 2GZWA 2ELHA 1SMTA 1YW7A 2R3SA 3RKWA 2M8EA 4OINF 2Q0OA 2D1HA 1RNLA 4M9ZA 1Z05A 1KQ9A 3K69A 5A2QZ 3L00A 4EJUA 4O3MA 3QU3A 4FX4A 1JHFA
chains in the Genus database with same CATH superfamily
4NC7A 2K9LA 2MFZA 5EG0A 1U5TA 3S93A 3ML6A 1WJDA 4HNTA 1LDKB 2OD5A 3CUOA 2PEXA 4EM0B 1UB9A 4PSWA 5GAHJ 2WB1N 2XB0X 3VPRA 4HNUA 2DT5A 4B47A 3I53A 1P6RA 2K86A 2R7SA 3BLYA 4DZPA 2V79A 2XRLA 1S9HA 1JXSA 1LVKA 3GLLA 1QBJA 4KIBA 1R1UA 5B66C 2DQRA 3DKXA 2W00A 1MKMA 2EB7A 5GTHC 1DP3A 4E7ZA 2VKVA 1F5TA 1EF4A 3BQYA 5FGMA 3GFMA 4A0XA 3TL4X 4XKWA 5BOXA 3PUBA 2J5PA 4WWCA 3I59A 2A07F 1XGMA 4IHSA 2VQCA 1VI0A 2QQAA 3SEZA 5HODA 2JVHA 1OCTC 5FKNA 3PQJA 2ECBA 4YIIA 5LRSA 2BY1A 2GBYA 4IHWA 1HKSA 1X3WB 2D1VA 5EZGA 4I98B 3KX2A 3HC7A 1TL8A 5F0FA 4CCMA 3DBHB 5J4YA 4V2GA 1XDUA 4CCOA 2NVTJ 1X19A 2Y75A 2FBIA 2LY9A 4BH9A 4UB8C 2CUZA 3H9JA 3GTOJ 2X1EA 3R4KA 1SVLA 2PG4A 4DGWB 1QRYA 4D5CA 1SANA 2RNGA 1S7EA 3OL3A 2QWWA 4UUSA 2AS5F 5IYBJ 1D8JA 3HPHA 1MMGA 3F8BA 5K7ZA 3B6AA 4M72A 3R61A 3V7RA 5EEHA 3RZOJ 2R7OA 1QPMA 1ZTRA 3WGHA 1TW2A 1ZGWA 5ILUA 5E3OA 2LKXA 3G73A 3FM5A 3NAUA 1ZN2A 4DYQA 4FCYA 1OYIA 1Z7UA 3QPLA 1P9QC 3MWMA 1I27A 4KICA 1U8RA 5D8KB 3SYTA 4ZDLA 3G1LA 4BY7J 3LSRA 1YW9A 2FXAA 3S16J 1MMAA 3LL7A 3FXQA 3S14J 4DIQA 2F48A 4W1UA 2V6EA 2I8DA 3ABLH 1RR8C 2BXYA 4EGYA 1HF0A 4HOBA 5K5RA 4RM2A 3QU6A 2GXGA 1JUMA 3GUDA 1JJ8C 1ZG5A 1X2MA 4LLLA 3BG6A 3V7SA 1GT0C 1TQIA 3BZKA 3ZQHA 4AYBA 2E2JJ 3H9GA 1NTCA 3FF5A 2X6OA 4YRVA 3D5LA 4XKCA 1D8KA 3BG7A 2R0QC 2PJRA 2FOKA 2GQQA 4WX9A 3CF5F 5EEGA 1Z6TA 4XONA 2EQRA 5HVQC 5AIQA 2NRAC 4V19K 3J7ZI 1FYMA 1X2NA 2EIKH 2OAZA 1HDDC 5AIPA 3M1EA 3Q0UA 2F2EA 1YHQI 3BR5A 1R1VA 2HOTA 2HTJA 2CW8A 1GVDA 3EUKL 5E1XA 1Y1VJ 4I0BA 2O3FA 4Q47A 4G8XA 3LMMA 2K9NA 2WWYA 2EA4A 2YX4A 3ZQIA 3FBNB 3ZQGA 2EK5A 1WCMJ 1Y6IA 4MFDA 3GFLA 5CLSA 2Z3YA 4UY8I 3E6DA 3F8CA 2WBMA 4I7HA 2FX0A 4HBLA 5IP6A 5BS6A 2QA4I 3D0SA 4XOPA 3FMSA 3Q3SA 2VI6A 3HSFA 3GFJA 2K4JA 3AG4H 4U0VA 1XS9A 1S6LA 1Y8QB 3K6GA 4E70A 3C7JA 1JKPC 1WH7A 3L2VA 2CG4A 1BR1A 1VQ4I 4L5JA 4RGSA 3HOTA 5F1JA 5F08A 5LHGA 4KNYA 3QQAA 2ID6A 4CDGA 3SDGA 2UWMA 2F4OB 5LRRA 4EM2A 1VQLI 4ESBA 1PDNC 3KIOA 2P4WA 4PGGA 1OJLA 4HNVA 1MJAA 2DA1A 1HW2A 1WJCA 3DU6A 4I01A 3ZQFA 1RUNA 4MIMA 4J19A 3G6EI 2OZUA 1JUPA 4U7DA 1D1CA 2P0WA 4C3IJ 1APLC 3HOZJ 3JSOA 3AKZA 1B8IB 3PNTA 3MKWB 3TP3A 1SFXA 1Z9CA 5DS9A 4II2A 1GHCA 3J7YJ 4BGDA 3RPQA 4ANJA 3O2PE 3JAMK 3EDPA 1GXQA 3ZPLA 2IT0A 2BXZA 5L3FA 1H89C 3HHGA 2CQQA 1SFKA 3CJNA 1WI3A 3E6MA 4WF2A 3MZYA 2E35A 2DPUA 1MIJA 1MW7A 1NG6A 1MH3A 4NHJA 4L18B 1XD7A 2KJBA 3TDUC 3OYGA 3FXUA 3I4NJ 5J40A 2AQFA 2MGQA 4M3FA 2GAUA 4UVBA 1GVJA 2DA2A 1OR7A 1TC3C 3CTAA 5TRDA 3K9TA 4RDUA 1TWHJ 4BHPA 2IBDA 2L7ZA 1BR4A 3VYSB 2X51A 3GX4X 1FZPB 1XSDA 1JKRC 1XMKA 3M8FA 2P5KA 5H6QA 5J1UA 2O8KA 2LF8A 1S7OA 1GV5A 2V9VA 4EQQA 2LKPA 2CU7A 4XM3A 1DPRA 2MYSA 3O8GA 2HQ5A 4Y33A 5D4RA 1UG2A 1YE9A 2QQ9A 3CF2A 4BE1A 2R93J 3TO6A 2GA2A 1J2XA 1HW5A 1QU3A 2VBYA 3VYRB 3WGIA 3ZQCA 1Y0NA 3IH3A 3TOAA 3SJMA 2A68F 1KQ8A 2DOFA 3GTQJ 1OKRA 4EJOA 3BROA 3LSKA 2CJJA 4Y7NJ 2CV1A 4K2EA 2ZKZA 4BQNA 3F22A 1UCRA 3EUHA 4BNCA 1I39A 1RZ4A 2XVCA 2OPTA 1U3EM 1MBJA 4DOZA 5DUIA 4G7ZF 1MDMA 5E1WA 2DA6A 4C3HJ 5EF6A 2VXZA 5BPIA 3ZP5A 4CXFA 1WGXA 3WHBA 3LAJA 1YQAA 3MVPA 3ONQA 1OPCA 2XAJA 2X6XA 3CUQC 3HXLA 5FLXZ 2KDOA 2ADUA 1YX3A 1MNDA 1MSFC 4ENNA 2V1XA 4A0YA 2CWEA 2TCTA 2DT6A 2KLOA 1X1DA 1KYWA 3R60A 3OR2C 2R7XA 1ERDA 1I3QJ 3ZMSA 4KN4X 3GYHX 4JOMA 3V8KA 4AVZA 4A93J 3V42A 2FQ3A 3ABMH 1YITI 4CCJA 3I54A 2PI0A 4L9TA 1W7PA 4IHXA 1WWXA 5D5UB 3BG9A 2VJJA 3KEQA 1ON2A 4M6VA 2RVCA 5E17F 4PSXA 4CGZA 3E97A 4UUTA 1HKQA 2M30A 3SFIA 5L3GA 4ZYDA 1MZBA 1STZA 2PQ8A 5FKLA 3B73A 2V7FA 4XIDA 4LG0A 3LFUA 3OSFA 4QSHA 5D5WB 2QENA 3KPHA 3NARA 4IRGA 5ERIA 3KYLA 3L2RA 2R5ZB 3TBIA 4G7HF 3CD6I 3GBGA 1FP2A 2R7WA 2FNPA 2W84A 3I4MJ 3QOPA 4O5VA 4LITA 4DYCA 5K7HA 1Z91A 1XGNA 3CJTB 1R71A 2MG4A 2GOXB 2EV5A 2GWRA 2UV1A 3QOEA 3L9FA 2H6CA 4L0YB 5CQGA 1CF7A 2JA6J 2YR2A 2H27A 1Y8RB 4RB1A 3H3UA 4RMNA 3JTGA 3SDBA 4G9YA 4PCQA 2A5WA 1U5TB 5EG0B 1KZHA 1C0WA 4UNOA 2X1CA 3P9IA 2MW8A 3LSGA 2MD5A 4U0YA 1KA8A 3GWZA 2JA2A 1R5HA 3JRHA 4FT8A 3RKXA 1BI3A 2VODA 3G2BA 3HGYA 2ZCWA 1TT5B 5HDKA 1B1BA 1YIOA 5KNLA 3K1PA 4IOCF 3GTPJ 1YW8A 1I6HJ 2ZC2A 4C2TA 1SFOJ 2H09A 5H20A 1N77A 2Z99A 3P9KA 5JI6A 1MJ9A 1Q1VA 3L2CA 1OLTA 2BVLA 2OQRA 2X85A 3KP7A 5E20A 4R79A 3CO6C 3JCUC 4QWQA 5F64A 3I59B 3LA3A 3GLXA 1U0JA 3RQIA 1T98A 1LDJA 3QPTA 1YIJI 1JGSA 1UFMA 1HA8A 5FD6A 1WJAA 4L9NA 1G3TA 4HDUA 1B6AA 3MQ0A 2BGCA 4QTRA 1H0MA 3ZN0A 2XHKA 1K4TA 1IRXA 1J09A 5FO5A 2XPWA 2A6EF 1X1PA 4S0HB 4P55A 1ZRCA 3ZQLA 2YU3A 2V1NA 3LSHA 4JX6A 2B0LA 3A4CA 2EPFA 4JX5A 4M9XA 1YX5A 2KT0A 4OMYA 4FX4A 1QGPA 2DFEA 3CC4I 5FFXA 1RKWA 4A3DJ 2HQRA 3HKZN 1GUUA 4F93B 2ZFUA 4UUSB 2FMLA 2O03A 1V5FA 5E18F 3DEEA 4E7SA 1WQ2A 4S04A 1FBUA 2HXOA 4KIFA 3C1DA 4JBAA 1ON1A 1WFXA 1XC5A 2X4HA 2HQNA 2VJIA 2K4BA 1K7AA 1FT9A 4PJ0C 1TW3A 4EEFG 2RV8A 2DMNA 3ELKA 5ICFA 5A2QK 2M87A 2XKPA 2MLKA 4B3XA 5KAIC 3IV5A 3U21A 2PLYA 3K0LA 5DD8A 3LSPA 1O7LA 1JUSA 4NB5A 4XNFA 3OYFA 2NS8A 2OV7A 4LG3A 3FXLA 3MAJA 4XLFA 3WU2C 3LNQA 4AIHA 4BJ6C 4N4NB 4XSZF 4IVNA 2QKLB 3KZIC 1YFHA 1I1SA 4BAYA 3JSPA 3OYJA 2JTVA 1I3AA 2YSRA 2Y0SA 2ELJA 4AWXB 3JW4A 3FXMA 2K02A 4U0WA 4EM1A 3K2ZA 1RRJA 3QWLA 5IY5H 1B59A 3OSGA 2PJRB 3SZGA 2UXXA 2JK3A 2L7KA 4D7MA 3K2AA 1TNSA 1F1ZA 4N0BA 1NH3A 3EQLF 2B63J 1D5VA 1TNTA 1SAXA 4X0GA 2JUCA 4CICA 3PO3J 4IX7A 3KP4A 4A3IJ 4UB6C 1LKXA 1D1BA 5ED4A 1QZYA 2X48A 1IRFA 2W1OA 3KLOA 1IN5A 3U9GA 3K70C 2BBYA 1F43A 2AQEA 3ABKH 5HLGA 1ETXA 1R00A 3GCMA 2OA4A 4CCNA 2IEKA 4F91B 3I64A 3CDLA 5C4XJ 3H0GJ 3N05A 4NQWA 4QIWN 2WA0A 4E7JA 1WRJA 1QPIA 4HDVA 2NAZA 4CYCA 2KHMA 4D1QA 1ETKA 4A12A 1G8XA 3PFYA 2BE5F 4LIVA 1RETA 3GZNB 3QAHA 1MMDA 2IS1A 5CYVA 3DTIA 1KONA 1JGGA 3IC7A 1IF1A 2DW4A 1BI2A 3EYIA 3JR9A 3CP2A 2IA2A 4B4CA 1FTZA 1S29A 1YTYA 3ECHA 4XRSA 2L2OA 1ETOA 2HOAA 1GLNA 1NK2P 1VZ0A 2DU9A 2IGOA 4KIGA 3A0HC 3CC7I 3OL4A 4BKXA 3QPSA 1D0XA 2L4MA 2EZHA 3VODA 1AU7A 1B72A 2CO5A 5D6EA 3HL2A 3DTEA 4BE0A 1KU3A 2Y9ZA 4ITVA 3WTWC 3P7NA 5DCMA 4HRIA 3PFIA 4RB0A 5EGOA 2E1CA 3HJEA 4PJMA 4E4HA 1HXDA 3FZVA 4D5FA 2QYOA 3NWTA 1U78A 2MC4A 3LOCA 3CUQA 4OWRB 2M7BA 2VB6A 1FYKA 3EUHC 3HIFA 3OIPA 4MQ9F 4C3JJ 3OMYA 3K4NA 3PIPF 5CVRA 4A6DA 3MCZA 5F0HA 5IT3A 3F21A 2XF7A 3CCLI 3T8RA 2ZO4A 1WVRA 2DFHA 4HX8A 4P9FA 4U88A 3I58A 4ZYGA 1FTTA 4XRSG 4KITB 2FNAA 3DKWA 4Q4ZF 1W7PD 2F5CA 3K1NA 3GFIA 1SD4A 3P9CA 2WY8Q 5LGUA 3DPLC 3FBIB 1X4PA 2P6TA 4RBOA 1S72I 3DU5A 1HBXG 3RCOA 3CC2I 4Y4RA 2HYJA 4G6DA 1G4DA 4FHTA 3OYHA 3KP5A 1LDDA 1XN7A 3ZMUA 3W6VA 3QP5A 2X9DA 3E1SA 1WHUA 2ZNYA 1TWCJ 1ZYRF 1JT0A 2IP2A 1J5YA 2L7FP 1YO5C 3BOQA 1USSA 4IHVA 2QGUA 4UV9A 1UMQA 3HUGA 4H4KC 1P7JA 2D45A 1ZRDA 4IQ4A 4C30A 3SZTA 4BACA 1PP7U 3HOUJ 2L3DA 4P1WA 3FIWA 4AVPA 2CW0F 2XSJC 4WXDA 1LNWA 3RSNA 1WJFA 2V1UA 3GTLJ 1LEBA 1WSUA 3GF2A 2LMDA 3BZ6A 3W6JB 5J8FA 4HG2A 4BBSJ 2XPVA 5D6FA 3VEPA 4ZYEA 3S3NA 1O3TA 2XAGA 5IP7J 3FHNA 2PMZN 1MDMB 4ZYAA 4UV8A 3JRCA 2EFWA 3ESWB 2KISA 4OAYA 1X3UA 2DJIA 2JQ7A 4IRHA 3IWZA 1G2HA 2KRCA 2R7ZJ 1HOMA 3E0JB 1OCZH 3BP8A 1XCBA 2XIGA 2CGPA 4IEJA 3ROUA 4IOAF 2D5VA 1I50J 1UHSA 2MBFA 1TWAJ 3DCFA 2QKMB 2XROA 3HDDA 3L2UA 4JK1X 3TKYA 2ZSHB 2LY2A 2ME6A 2VUMJ 2LBFA 2M1BA 3BTJA 1LE8A 1SD6A 3D5SC 1V3FA 4ETSA 4ZZDA 3HTSB 2VPRA 2MSYA 5IP9J 4LB6B 1IAWA 1AA7A 1W7PB 5JFRA 2IA0A 3A02A 4EV0A 1FYLA 3CO7C 2LRDA 3M8JA 3RI4A 2CQKA 2LC2A 5IPAA 2IGMA 2QM3A 3T0YA 1VQOI 2EZIA 4JYKA 3OS2A 2QSHX 2K3PA 1ZG1A 2PMUA 3DFGA 2VONA 1RESA 1SD5A 2I10A 3H5AA 4UXNA 1AKHA 4LG0B 3CCJI 3RJPA 4HZFA 1YJWI 5ICGA 5K1YA 1H9TA 3GXOA 4MEXF 5C44J 3HBLA 4I09A 1EJ9A 2DMQA 4FETA 1Y56A 4B44A 3BR3A 2XAUA 4N4OB 2JPCA 3RYRA 1R5ID 2XC7A 2CQ7A 1FIPA 3PQKA 5HS9A 2ZJRF 2VE8A 2ISZA 3RIRA 2H1KA 2L4AA 3MD2A 3PIOF 1QHGA 1CF7B 4OAZA 4A3KJ 1MBGA 1BJZA 5DYMA 3LAPA 4ESJA 2NOGA 5TGTA 5DEQA 2VQHA 5H6RA 2NVXJ 2FU4A 4X1EA 2CV0A 5IT9Z 2K9MA 1G6NA 3DPTA 3UR3C 1I5ZA 4F52A 1O7FA 2ESHA 2VOOA 4OOIA 1EH7A 2EIJH 4XORA 5E8GA 1K78A 1R4MB 4GYGA 1P4AA 3CLQA 3ZMDA 1D0YA 2DODA 2F5VA 1EH8A 1A35A 1W5CC 1EV7A 2NNYA 1K79A 4E7KA 3KCCA 3WGGA 4CA0A 1ZLJA 5E8IA 4F7ZA 1XPXA 1WH5A 4Y3OA 4BJ5C 1VQKI 3VYUB 4A69C 1H8AC 4BY1J 3RYPA 1VQ5I 1A6QA 2QVOA 4IJAA 3F6OA 4GGGA 1XGSA 5CQEA 2Y48A 4AD9A 1RI7A 2DOEA 2LLKA 3FKJA 2IRFG 4MFEA 5EJCA 4C2MJ 1Z3YA 5FLXK 3QYEA 3DTKA 4IQJA 3V7CA 5GTIC 3GTKJ 1P4XA 1BI0A 1MBFA 4OIQF 3EUAA 1VQMI 2O7OA 2DAOA 2KIQA 5D4SA 4UVCA 5JLXA 2PBIA 2TRTA 2ICWG 2HPIA 2V1DA 9ANTA 2CQXA 2E19A 2FSWA 3DLAA 2EWNA 1I1GA 3BJAA 2BEOA 2E1NA 3NQOA 2DFFA 3B6CA 3FM3A 1Z7LA 4EGZA 1TWGJ 5DTDA 3Q9VA 2VC0A 4DZJA 1JE8A 3VSKA 4ASNA 3Q5FA 2KDZA 1FMVA 4P96A 4A5MA 3N4MA 2K7LA 2ZJQF 2Q2EA 4RB2C 1O4XA 1W36C 2Q1ZB 3ECOA 4M3EA 2HVRA 2LVSA 1QZEA 3TO9A 4DYRA 2LF7A 3E5QA 2XPUA 1G3YA 2CFXA 1N75A 3HOYJ 4P5OA 2H8WA 1U2WA 2L9SA 2R4GA 5KK1A 1W1WE 3TO7A 3WTSC 1LFUP 5IYDJ 4KMUX 2AO9A 1SD7A 4NC8A 5DM6F 2QQ8A 3QYBA 2KFDA 3MKLA 1AHDP 3J81K 4Y13A 1S8NA 3BPVA 3DKYA 2O9LA 2FEZA 2EBIA 3I0TA 1H9GA 4B8XA 3CP8A 3IP4B 4XN3A 2CSOA 4RAYA 1FEXA 3WODF 3VFZA 2JUGA 3N97A 3BG3A 2JJ7A 4OIRF 2IPQX 1J9IA 3VYTB 2KRFA 2HS5A 2ME0A 2XGDA 1K61A 1T56A 4JQFA 2Y69H 5J47A 1YLFA 1R36A 1ZR2A 1BN5A 1V5GA 4ZDPA 1BC8C 3JRDA 3AFHA 5LEKA 2L0KA 2V6CA 1YOVB 2E34A 3S2WA 4M73A 2RQQA 2ZXWH 2A3SA 4A3FJ 4EMSA 3F3XA 3S2DJ 2HYFA 5CVJA 1HSJA 4M3BA 4IRIA 4LD5A 1ULYA 3QPHA 5D5VB 4A3JJ 2F6CA 3I56I 2HU9A 4BEHA 3DLLF 2ETHA 2WAEA 2VKEA 1D0ZA 4II3A 5FRMA 3KE2A 1WZ2A 1NHAA 3A01A 2HI3A 2DBBA 4MO7A 2M9HA 1S5LC 2ESNA 2IS4A 6PAXA 4I02A 3WTYC 1Z3XA 5JHUA 1T38A 1GXPA 2XAHA 5DCFA 5E79C 4NQWB 3WTZA 4E7LA 2GIVA 2HVQA 3MZ8A 4CYCB 1ZAOA 3H92A 1IG7A 1SFUA 2UZKA 2ZNZA 1H88C 4L9VA 4MNUA 4CCLA 4BXUA 3U1DA 3WHCA 3RPUA 4BHBA 1S7AA 1EA3A 1DPUA 4XLPF 3TOBA 4M6YA 1MH4A 2Y31A 2O61A 1VQ9I 1D5YA 4C2UA 2RREA 1I6XA 2P8TA 4BQAA 4LK1F 3CCEI 3L2WA 5DM7F 2XGEA 3BJOA 3H35A 3OIQA 2OCEA 4YEJA 5IOZA 2COBA 4Z2YA 4QLCU 4L0ZB 3ZR8X 4HQEA 2EIMH 1HSTA 4PJLA 1K83J 1OYYA 4AYBN 2E2IJ 3FMQA 2WAQA 3M07A 1X58A 2HWVA 1B72B 4KT5C 2E5ZA 5DCMB 1MMSA 2Z5UA 2HNHA 2QSGX 3DV8A 1W4MA 2TDXA 5EGOB 4LIUA 2DMPA 2G7UA 4KFCA 2VT2A 5IYCJ 1Z67A 2R7TA 3J81Z 4PDKA 1JKQC 2RQPA 1W0TA 3S1NJ 4IXAA 2VBWA 3CUQB 3RKYA 3S17J 2BHYA 1PUEE 2KL4A 2OQGA 3DWLE 1FSEA 1XG1A 2H94A 3WTTC 2ZFWA 3FHZA 4XSXF 1PUFA 2NXNB 2QF7A 4LLNA 3TMOA 1IN7A 2ZMEA 4KJZA 2EV0A 3WG7H 1XTAA 3ZMTA 1GDTA 3LFKA 3ZMVA 3G3ZA 3DBRB 4XLEA 1FOKA 2QSFX 3PM1A 1RKTA 1IXRC 1V55H 2FMYA 4ZDOA 2WB1A 3CLOA 5GPAA 2E1MC 1J0RA 3ASOH 4XRMA 1QNTA 2H6BA 1W0UA 3PNYA 5FD5A 4AIDA 5F1RA 3F0CA 1TP4A 3PSIA 2F5EA 5HOOA 2W57A 3BZCA 3J80Z 5LFAA 2VQGA 3DEWA 4J00A 3KZYA 1BOBA 4WXHA 2MABA 2L02A 2ELKA 2J5OA 3V8LA 1T6SA 2JRMA 2E2HJ 3HRMA 2CQNA 1POGA 3D5RC 4L9JA 1ITYA 2CW7A 2DLLA 5EYRA 1AWCA 3JREA 3PNVA 4YG2F 2HEOA 3S15J 3HSRA 3OWTA 4YFNF 3PSFA 3PJRA 2UUZA 4MEYF 2FD5A 1IJWC 4Y15A 2XSDC 3RKQA 3HUGB 5J4VA 4BDZA 4Y52J 4LMYA 3MKZA 2E7WA 2W24A 2GXAA 1N25A 1V54H 3BDDA 2FRHA 2M3AA 1HW1A 3KP3A 3A2KA 3FXKA 3BJ6A 2DDAA 2L9RA 5KVRA 2LK2A 3Q0VA 4XKBA 1IV8A 3NEUA 1ETVA 1LJ9A 3EPZA 3EYYA 3H0DA 4NDLA 5KCMA 2HPMA 2EJRA 1XX5A 4FE7A 3SEQA 2LTPA 3MZHA 5M5YJ 1TTYA 2R7QA 1W5SA 2E1MB 5FLMJ 1CQTA 1PJRA 3C3WA 1Q1HA 4HX7A 4BE2A 4M3DA 4XK4A 1X1BA 3REOA 3WTXC 3FMRA 1TZLA 4BBRJ 1Y39A 2LBFB 4BUPA 1LE8B 1IN6A 5BPDA 3BR6A 2L54A 1IXSB 1HLVA 1NG7A 3I3LA 4ZH4F 3LQRA 2V4JC 3WE3A 1R6RA 2R5YA 1JJ6C 4NBQA 1RC9A 3BTIA 3OS1A 1LFBA 3JTHA 2HOSA 2DYSH 2E1OA 3OYIA 1SFEA 4KYWA 1A04A 4HEA2 2JA8J 4YFXF 1ONVA 4GDFA 2IJLA 2OJED 4JX4A 3CDIA 3ABTA 4XLNF 2OTJI 4HA8A 1AKHB 2QEXI 2CRGA 3OV8A 5JVGF 4HQMA 1VQPI 5HDGA 3K70D 2GM4A 4UHTA 2HKOA 5LBQA 1YJNI 4CSWA 4ZYHA 1T33A 5K5QA 2VN2A 4B1RA 4EJTA 1ZREA 4YIFA 2BVMA 1BA5A 4Q5SF 2L5QA 1O3SA 1TT0A 1IXCA 4LLGF 1HC8A 2CV2A 5H2FC 2FQ4A 1LQ1A 3M3YJ 2NVQJ 1A6IA 2EILH 2I5UA 2IXSA 4IKFA 3BPXA 1IRZA 5CVIA 4HX4A 3BR1A 3AAFA 2LSOA 4CUGA 1E3HA 1K78B 3R6SA 4BXXJ 1ETQA 1E0EA 1XCVA 3SXYA 2BYVE 2F5FA 2W25A 4FQGA 2BOLA 1LFPA 3S3MA 2Y0MA 2HZDA 2DMTA 2DA3A 4WXCA 2KZGA 4A0ZA 3O8HA 2K85A 3CJRB 4J01A 1TQPA 4BDYA 3GTMJ 3DEUA 3CDHA 4RAZA 1E17A 5FFZA 5LD2C 1R49A 3BG5A 1DQUA 2P7VB 3I5UA 3BT9A 3FXJA 1AOYA 3DQVC 2KKOA 3LA2A 5C4JJ 2GOMA 3JRAA 4Y17A 4RS8A 2P5VA 3CMMA 4M3GA 3M1CA 2EZLA 3DBLB 2BV6A 4XLAA 2K40A 5FKKA 3Q0WA 3R0AA 4AIJA 3RTRA 3FX3A 1VF9A 3MN2A 2NS7A 3CCVI 3F72A 1QA6A 4M6XA 2K5CA 4HV6A 4XL9A 5F0CA 3EETA 3OYKA 3HPGA 2GIZA 3JRIA 4FE4A 4WCGA 1FJLA 2OUMA 2HYGD 3IUOA 2JVGA 3CESA 3HRTA 4RAFA 5FROA 2IA1A 1NK3P 3OYDA 1UZCA 1UELB 3FISA 5B1BH 2WAQN 2O5RA 3IHUA 1FY7A 5ICEA 2R92J 2JSCA 1ODDA 1YG2A 2E7XA 1X4OA 2MH9A 4B3AA 2C6YA 4ENKA 2Q2EB 3H3ZA 2YPRA 5C3EJ 3ISPA 1YI2I 3MFKA 4X6AJ 1KQ0A 2F5DA 2FBKA 2N8GA 4A2UA 2M0CA 3A1YA 1T08B 2HDCA 2NS0A 4RM3A 1OQYA 3RPUD 2EINH 3ZQ7A 2W4SA 4RGXA 3IRRA 2VC1A 4AC0A 2IS2A 3O6BB 4ENJA 3MEXA 2M7AA 2V26A 2FA5A 3GZ6A 5J1RA 2DTZA 3S3OA 1RPWA 5DD4A 1SC7A 3U2RA 4RAGA 2XB5A 2HOEA 1IUYA 3C2BA 5IT9K 3X2QH 5B3SH 3CMEI 4XQFA 3K4KA 3L1PA 5CVUA 1F9NA 4DW6A 4E6KG 3ULQB 4XOTA 1JTXA 3L2QA 4M74A 2A6TA 3VSLA 5FJ8J 3JRFA 3TEDA 2JZYA 4A5NA 1MBKA 2M4GA 3G1OA 1O3RA 1R5GA 3IL2A 2BW3A 4FX0A 2R7FA 1ZQ3P 1J59A 4EATA 3U1KA 4V2FA 2E60A 3OYBA 2DDBA 4IL6C 2W85A 4HW0A 2HR3A 2B7EA 5IOYA 3DXJF 2FF4A 1BOAA 3BWGA 2BY0A 1T95A 1IDYA 4U87A 2DA5A 3E6BA 1XMXA 5J1YA 3RDIA 3GTGJ 4B09A 3HZJA 2VIXA 4P9UA 3LSTA 2K3FA 4BEHB 2YU9J 5J6XA 2OU2A 1BM9A 2VBXA 4A3LJ 2CS3A 5GPCA 3L7WA 3AG3H 3LWFA 4ZZLA 1J75A 2JN6A 2KIFA 4XLHA 3A01B 2KMUA 1CGPA 4G7OF 5E3LA 1FBSA 1L0OC 3DP7A 1V4RA 3M7GA 4A3MJ 1RR7A 2HFHA 1IN4A 1XDSA 1ORKA 4EJVA 1MSEC 5EZHA 5ILVA 3J7AY 2WV1A 2H1LA 2M5WA 1T8IA 3OYAA 2FUG2 2JPBA 1IW7F 2ZMEC 2L9VA 4Z6YA 2ZJPF 5JR3A 2VLAA 1OISA 2OF7A 1A31A 4OIOF 3LA7A 2QBYA 3OYNA 3T5XA 3V4GA 3V8JA 3BTLA 4OU0A 3AL0C 2QLZA 5ICCA 2KRHA 1QVUA 1OCPA 2RKHA 2DJNA 2YX7A 4PGHA 4BQQA 3AG1H 5L3EA 1T0FC 2OCCH 2R7RA 4A6EA 2CUEA 4D0PA 1QO0D 4IO9F 1A36A 3ZOBA 1MD0A 2DPDA 4L5EA 1ZKGA 2QQBA 4G94A 3TW6A 3GEZA 2WADA 1M1EB 2PX9A 3K7AJ 1VQ6I 2W82A 4N9HA 1R23A 5HS8A 3KP2A 1DUXC 5L3CA 4LB5A 2W48A 2Y0SN 3HHHA 4IZZA 1T39A 3FXOA 3E5XA 1B4AA 5F04A 4I2OA 4CHUA 4F55A 2NNNA 3CCYA 3BR0A 2P7CB 2X6YA 2XF5A 5BQTA 4F3QA 2ECCA 4XLCA 3F23A 5L3BA 2AHQA 3OYCA 3WE2A 1ZRFA 1O57A 1UJ8A 3CCQI 3ZMZA 1LVAA 2XDVA 3BCAA 1D3YA 3OR1C 5FKOA 2AXLA 2O6GE 3OYMA 5HNFA 5TISC 1F4KA 4HLYA 1PUFB 4M9SA 3WU1B 4AUXA 2ZMEB 4KMFA 1YYVA 2IGNA 2KPMA 1O3QA 2DK8A 1OYWA 3FK7A 3HG9A 3RQ4A 2P6SA 3AL0B 1EH6A 4BL0B 2OZ6A 3HEFA 2DCEA 4DBQA 1IUFA 1EKEA 2A5YB 3CQZJ 3VWBA 3HM5A 4DNCA 1V5EA 4I99C 1ZGJA 2KQRA 4CZCA 1W5TA 2LNBA 4XBFA 4D9JA 1FLIA 2CFOA 3GO5A 4KT6A 3Q9SA 4MTEA 4YELA 4Q48A 3G71I 1ENHA 3ZRGA 1R58A 2DO7A 4ZTFA 5ILSA 1K4SA 2MH2A 3K4JA 4LOCA 5JVTA 1YRNA 1B9NA 3HYIA 3UKGA 2WV0A 2LFBA 5HLHA 3D1NI 3S32A 2ZB9A 2VQLA 3F9KA 3K4CA 3DF8A 2VASA 2WTEA 3TGNA 1SVOA 5LHHA 2JT1A 1Z0XA 4JP0A 3W2AA 1W36D 2OTLI 5EDNA 4I76A 4KA4A 2VKDA 4XMYA 4PJJA 3LSJA 1ZH5A 1YS7A 3GZ5A 3KYCB 4BHCA 1R9TJ 4ABZA 1L3LA 4GRIA 2LOOA 3F8FA 3E3VA 3S8PA 1T2KA 2L7MP 2LR8A 5J8CA 4I6ZA 4BS9A 5GAGJ 2QUFA 4FASD 2Z9OA 2CH0A 4W97A 3KLNA 4GYIA 1UAAA 2XGXA 2EFPA 2E36A 4G6QA 2VE9A 3HKZA 1VTNC 1QZZA 1SAUA 2WAFA 5M5WJ 1KGSA 2X1DA 1MNEA 3WG9A 1FNNA 2A05A 3KEOA 2HKXA 2L9NA 4LFUA 3P5JA 4QPOA 3IKVA 2M2EA 5GADJ 2ID3A 1XGOA 1RIOH 4A3GJ 1QVTA 1WKMA 3PL8A 2HTSA 1XSXA 2XGCA 4HPQA 2VOPA 3B02A 2YUSA 2M34A 4RA2A 3IH4A 3QODA 3M8EA 2FJ1A 1Y1WJ 1G3WA 3TQNA 1BW5A 2G9WA 1IDZA 4MLOA 4XICA 1FP1D 1WI9A 3F8MA 3PO2J 1KU9A 4ZTJA 2R5YB 1ZK8A 2PJPA 1BBYA 3CMYA 1JTYA 3SQNA 3ZXSA 2DQLA 1VFCA 1HQCA 1E3OC 2Q8KA 4PFPA 4CO8A 4C9YA 2LKSA 1XSVA 4DJAA 2VJ5A 4FISA 1P2FA 1OMIA 1ZLKA 1FWZA 2EFQA 3CJQB 2KP6A 2D2WA 3HOSA 2LREA 1UG0A 1IZ1A 3J80K 3ERED 5AONA 2VPLA 5M3FJ 4GFBA 4N9IA 2CMPA 3C18A 3CCUI 3HRUA 1DP7P 1P4WA 3GTJJ 1SVMA 1Z1DA 5HLIA 3QYFA 1P92A 5DUKA 3OYLA 3HOWJ 3E5UA 1A5JA 1BI1A 3GMEA 3OOPA 1IC8A 1FPQA 1IO2A 4U7BA 1RUOA 2JWTA 2LDUA 3BC8A 4DQ2A 1FBQA 2XAFA 2NVUB 1KU7A 4BJTA 2PFBA 4HF2A 4H0EA 3IKTA 2E71A 2EV6A 2K27A 3G1MA 3T1BA 2HDWA 4ON0A 3AG2H 2DYRH 2DT7B 3FWEA 2MC3A 2FE3A 1ZARA 4QPQA 2KIMA 3GW2A 1MMNA 2HXIA 2HVSA 3A0BC 2BY3A 4AIKA 1BIBA 4KN7X 1X1AA 1U5TC 4MTDA 4KISA 2VT3A 4IPAA 4I0AA 1LUJB 5LLQA 4HF0A 1OFCX 4XRFA 3OIOA 3QP6A 2X6WA 5CPRB 3CCRI 1IGNA 1LPQA 2NOJB 4BYYA 1BJAA 5D5XB 1JKOC 2VXDA 2K9QA 2LYCA 1FC3A 1UHMA 2H8RA 2WC2A 1PVEA 2ZXJA 2Z16A 4ZC3A 1XB4A 1FSHA 3E7LA 1G3SA 1HCRA 2DFIA 2LG4A 3OY9A 2LP0A 3VOEA 5FLVA 1Z77A 1VQ7I 1DU6A 1HKTA 4OIPF 2IS6A 3VB2A 4FTHA 2O0YA 2ZXHA 3JAMZ 1USTA 3IH2A 3H1CA 1BIAA 5FRNA 1P7IA 3IWFA 1X1CA 3CZ6A 3CMAI 5B5EC 2ISYA 3F6VA 3H9QA 1LEAA 3BR2A 3KP6A 2EFNA 2NVYJ 2DN0A 2R7DA 1TWFJ 1FOXA 1VNDA 2ZSIB 3ZCOA 2XKOA 2CUFA 3IAS2 2RN7A 5HDNA 3O3KA 1FMWA 3LSIA 4HAMA 4R1HA 1GV2A 3ZN1A 4F92B 2QZ8A 4E7HA 1PP8F 1MGTA 1WPKA 4IHTA 4GXOA 3I71A 4CZZA 2G7HA 2HQAA 1IN8A 2RGVA 4EVIA 1DGRM 3A03A 1BW6A 4HSRA 2AXTC 2O8XA 4HYEA 1T0FA 4GCVA 3K1MA 5J3LA 4G12A 3HSEA 4MGRA 4MQVA 2R7UA 1U9OA 1R22A 4B48A 1ZG3A 1Z21A 2LY1A 1XMAA 2ZJ2A 4KUMA 4TV7A 3F8NA 5LGNA 4IHYA 2YS9A 1ETWA 3M9AA 5GP9A 2DOAA 1WJ5A 4NUBA 2DTRA 5TJJA 4DBRA 2MLGA 4RGUA 2VL8A 1FIAA 1DDNA 1B9MA 2ZXIA 1ZHFA 5LGTA 2EA2A 3FK6A 3NWSA 4S05A 3R0JA 3C2HA 5M5XJ 2XUBA 3W6KB 4ENMA 3E6CC 4HV5A 3S1RJ 4AM3A 5JLWA 2Z1DA 2GXBA 3C2GA 1BR2A 3TDZC 5BMZA 5D8LB 2KJCA 4A3EJ 1ACIA 1FX7A 1TLHB 2BW3B 1JT6A 4GO1A 2VKHA 3FDYA 1Z6RA 1PYVA 2NYXA 3M4OJ 1OCRH 1MBHA 3K10A 4HF1A 5EEAA 3WU0A 2A6HF 1R7JA 3QRFF 5BNGA 3COAC 5F27A 3HOXJ 2STWA 3LQQA 3KFWX 2RAEA 2G0EA 4NNJA 4BXFA 1TQMA 4OMZA 1S3JA 3GVAA 4B43A 4A3CJ 2XV4S 4R8HA 3S2HJ 3HB9A 4UUVA 4ESFA 3SZPA 3K4BA 5FKMA 2FOWA 2M45A 2PN6A 2V9KA 5DDGA 2P81A 4D7NA 2A69F 3KEYA 3H5NA 3MKYB 4HLXA 5K5OA 3G4SI 2UXNA 3KZZA 2F4IA 1B8IA 1ZELA 2OBPA 3H5RA 2IGKA 2PMZA 2DA7A 2GA1A 1YJ9I 2DA4A 4XR6A 4YFKF 2P5LC 3IRQA 4PFOA 3NRVA 1QQIA 2M4KA 1R1TA 2DI3A 4L5IA 3TW7A 2M8GX 2X0LA 3ZQQA 2QBYB 3LSMA 5GAEJ 2Y30A 2RDPA 3BTCA 3BQZA 3W2VA 3ERMA 1JI8A 1KU2A 4CCKA 4HSTA 2R7VA 3BY6A 4YIRX 4M71A 1OCCH 1F36A 2QCOA 1JHHA 2STTA 5K7FA 1FOWA 3OS0A 1E3PA 1VQNI 3UNGC 2ZBKA 4PJNA 1TBXA 1ZGAA 5DV5A 1BC7C 1R4NB 1SMYF 3CCMI 1MNMC 1U6GA 2L01A 2WY7Q 3RZDJ 1LB2A 2M0MA 5HS7A 2BHZA 2COMA 2JSPA 3ASNH 5JHFA 1FOYA 1HDPA 2E5NA 4CYDA 2EH3A 4CH7A 1DGWY 3FKIJ 3PUFA 1YS6A 2IAIA 1N78A 4UVAA 4PZJA 5LHIA 1KYZA 3K4LA 3DPUA 2GLOA 1BL0A 3K4MA 5F6FA 2KZVA 2XF6A 2Z2SB 2PMHA 1ETYA 5E3MA 2BY2A 5CKTA 3HGGA 2CYYA 5E1ZB 4LJZF 5CVVA 2KIUA 3FXRA 2JRTA 5KHDA 4RB3C 2EFOA 3SHFA 3WTVC 2B9SA 2VJ4A 3I9V2 2DXIA 1MJBA 4KDPA 2RC4A 4RLFA 1DU0A 2XAQA 3S1QJ 1OCOH 3WTUC 3T8TA 3OYEA 1X3ZB 5CJ9A 3MMYB 2VBZA 2XRNA 2Y9YA 3HRSA 2Y2ZA 5HLTA 4O6JA 3I55I 2HZTA 3KETA 4NC6A 4XKVA 3JRBA 4IF4A 2JA7J 1REPC 3ABUA 4RGRA 4PK4A 5KAFC 3CCSI 2MA3A 2MD0A 1G59A 1U9NA 2FBHA 4LK0F 5LEJA 3J7AO 4PUSA 1WJBA 2HGCA 2A61A 2IW5A 4XN0A 4EJWA 2JMWA 2DK5A 3HOVJ 4ZJZA 2HDDA 2LH9A 3HTUA 4RLQA 1YRNB 3BCBA 3SFZA 3ZGKA 5M3MJ 4BQOA 1Y0UA 5FB2A 4A3BJ 1UHWA 2ACJA 3KYDB 4MHGA 2IVMA 1VQ8I 2Z33A 4G6TB 1E2XA 5L3DA 1OR7C 2K9SA 5E3NA 2BZTA 4LGWA 4WK8F 1K6OA 1MBEA 2EZKA 3VDXA 2XASA 4AU7A 2LD5A 2RNJA 1WJEA 5B1AH 1U8BA 1J7KA 2CUJA 3W2WA 1IRGA 3L09A 2GZWA 2OC6A 1IV6A 2ELHA 2V9PA 1SMTA 2W7NA 3S1MJ 1YW7A 1D1AA 2DMUA 1K6YA 2R3SA 1QHHD 2R5ZA 3RKWA 3H36A 1SEUA 2M8EA 4OINF 3JRGA 2JA5J 1ZR4A 2Q0OA 2D1HA 3IAM2 1RNLA 3OOUA 2F4MB 4M9ZA 3TP0A 1Z05A 1KQ9A 3K69A 3W3CA 4BU2A 5A2QZ 3H3VK 3L00A 4EJUA 4O3MA 3QU3A 4E7IA 3I4PA 1JHFA 5HNHA
chains in the Genus database with same CATH topology
1U5TA 3ML6A 1LDKB 2OD5A 3CUOA 2PEXA 4EM0B 1UB9A 2DT5A 3I53A 1P6RA 2K86A 2V79A 1JXSA 1QBJA 4KIBA 1R1UA 2DQRA 1MKMA 2EB7A 1F5TA 5FGMA 3GFMA 4A0XA 5BOXA 2J5PA 4WWCA 3I59A 2A07F 1XGMA 4IHSA 2QQAA 3PQJA 4YIIA 5LRSA 1HKSA 2D1VA 4I98B 1XDUA 2Y75A 2FBIA 4BH9A 3R4KA 2PG4A 2QWWA 2AS5F 1D8JA 3F8BA 4M72A 3R61A 3V7RA 5EEHA 1QPMA 3WGHA 1TW2A 5ILUA 3G73A 3FM5A 1ZN2A 1OYIA 1Z7UA 3MWMA 1I27A 4KICA 1U8RA 5D8KB 1YW9A 2FXAA 3FXQA 4EGYA 4HOBA 5K5RA 3QU6A 2GXGA 3GUDA 1ZG5A 4LLLA 3V7SA 1TQIA 3FF5A 3D5LA 1D8KA 2FOKA 2GQQA 4WX9A 5EEGA 1Z6TA 5HVQC 5AIQA 2NRAC 1FYMA 2OAZA 5AIPA 3M1EA 2F2EA 1R1VA 2HTJA 5E1XA 4I0BA 2O3FA 4Q47A 4G8XA 2WWYA 2EA4A 2YX4A 2EK5A 3GFLA 5CLSA 2Z3YA 3E6DA 3F8CA 4I7HA 4HBLA 5BS6A 3D0SA 3FMSA 3HSFA 3GFJA 2K4JA 4U0VA 1S6LA 4E70A 3C7JA 2CG4A 4L5JA 4RGSA 3HOTA 5LHGA 4KNYA 4CDGA 2UWMA 5LRRA 4EM2A 4ESBA 1PDNC 2P4WA 4PGGA 1MJAA 1HW2A 4I01A 1RUNA 2OZUA 4U7DA 3JSOA 1SFXA 1Z9CA 1GHCA 3RPQA 3JAMK 3O2PE 3EDPA 1GXQA 3ZPLA 2IT0A 5L3FA 3HHGA 3CJNA 3E6MA 4WF2A 3MZYA 2DPUA 4NHJA 4L18B 1XD7A 2KJBA 3TDUC 3FXUA 2GAUA 4UVBA 1GVJA 1OR7A 3CTAA 5TRDA 3K9TA 4BHPA 3GX4X 1FZPB 1XSDA 1XMKA 3M8FA 2P5KA 5H6QA 2LF8A 1S7OA 2V9VA 4EQQA 2LKPA 1DPRA 5D4RA 2QQ9A 3TO6A 2GA2A 1J2XA 1HW5A 2VBYA 3WGIA 3TOAA 2A68F 1KQ8A 1OKRA 4EJOA 3BROA 4K2EA 2ZKZA 3F22A 1UCRA 3EUHA 4BNCA 1RZ4A 2XVCA 1U3EM 5DUIA 4G7ZF 1MDMA 5E1WA 2VXZA 5BPIA 3ZP5A 4CXFA 3LAJA 1YQAA 1OPCA 2XAJA 3CUQC 5FLXZ 2ADUA 4ENNA 2V1XA 4A0YA 2CWEA 1KYWA 3R60A 3ZMSA 4KN4X 3GYHX 3V8KA 2FQ3A 3I54A 2PI0A 4L9TA 1W7PA 1WWXA 5D5UB 3KEQA 1ON2A 2RVCA 5E17F 4CGZA 3E97A 1HKQA 2M30A 5L3GA 4ZYDA 1MZBA 1STZA 2PQ8A 3B73A 4LG0A 5D5WB 2QENA 4IRGA 5ERIA 4G7HF 1FP2A 2FNPA 2W84A 3QOPA 4O5VA 1Z91A 1XGNA 2EV5A 2GWRA 4L0YB 3L9FA 2H6CA 1CF7A 2YR2A 2H27A 4RB1A 3H3UA 3JTGA 4G9YA 4PCQA 1U5TB 1C0WA 4UNOA 3P9IA 2MD5A 4U0YA 1KA8A 3GWZA 1R5HA 4FT8A 3RKXA 1BI3A 2VODA 2ZCWA 5HDKA 1B1BA 1YIOA 3K1PA 1YW8A 2H09A 5H20A 2Z99A 3P9KA 5JI6A 1MJ9A 3L2CA 2OQRA 3KP7A 5E20A 4R79A 3CO6C 4QWQA 5F64A 3I59B 3LA3A 3GLXA 1T98A 1LDJA 3QPTA 1JGSA 1UFMA 5FD6A 4L9NA 1G3TA 4HDUA 1B6AA 3MQ0A 2BGCA 1H0MA 3ZN0A 2XHKA 5FO5A 2A6EF 1ZRCA 4P55A 2YU3A 2B0LA 4M9XA 4OMYA 1QGPA 5FFXA 2HQRA 2FMLA 2O03A 5E18F 4S04A 1WQ2A 1FBUA 4KIFA 3C1DA 4JBAA 1ON1A 2X4HA 2HQNA 2K4BA 1K7AA 1FT9A 1TW3A 2RV8A 3ELKA 5ICFA 5A2QK 2M87A 2XKPA 2MLKA 2PLYA 3K0LA 5DD8A 1O7LA 4NB5A 3MAJA 4AIHA 4XSZF 4IVNA 1YFHA 1I1SA 4BAYA 3JSPA 2JTVA 2YSRA 4AWXB 3JW4A 2K02A 4U0WA 4EM1A 3K2ZA 1B59A 2UXXA 1TNSA 1F1ZA 4N0BA 3EQLF 1D5VA 1TNTA 1SAXA 4CICA 3KP4A 5ED4A 1QZYA 1IRFA 3KLOA 1IN5A 3U9GA 2BBYA 5HLGA 1R00A 2OA4A 3I64A 4NQWA 1WRJA 4HDVA 2NAZA 4A12A 2BE5F 3QAHA 5CYVA 3IC7A 1IF1A 2DW4A 1BI2A 3EYIA 2IA2A 1S29A 1YTYA 3ECHA 2DU9A 4KIGA 2L4MA 3VODA 2CO5A 5D6EA 1KU3A 3WTWC 3P7NA 5DCMA 3PFIA 4RB0A 2E1CA 1HXDA 3FZVA 2QYOA 1U78A 3CUQA 1FYKA 3HIFA 4MQ9F 5CVRA 4A6DA 3MCZA 5IT3A 3F21A 3T8RA 2ZO4A 4HX8A 4P9FA 4U88A 3I58A 4ZYGA 2FNAA 4Q4ZF 3DKWA 1W7PD 2F5CA 3K1NA 3GFIA 1SD4A 3P9CA 5LGUA 3DPLC 2P6TA 1HBXG 4G6DA 1G4DA 4FHTA 3KP5A 1LDDA 1XN7A 3ZMUA 3QP5A 2ZNYA 1ZYRF 2IP2A 1J5YA 1YO5C 3BOQA 1USSA 4UV9A 3HUGA 2D45A 1ZRDA 3SZTA 1PP7U 2L3DA 4AVPA 2CW0F 4WXDA 2V1UA 1LNWA 1LEBA 1WSUA 3GF2A 3BZ6A 3W6JB 5J8FA 5D6FA 3VEPA 4ZYEA 1O3TA 2XAGA 1MDMB 4UV8A 2EFWA 1X3UA 4IRHA 3IWZA 3BP8A 1XCBA 2XIGA 2CGPA 3ROUA 2MBFA 2XROA 4JK1X 3TKYA 2M1BA 1SD6A 1V3FA 4ETSA 4ZZDA 3HTSB 4LB6B 1IAWA 1W7PB 5JFRA 2IA0A 4EV0A 1FYLA 3CO7C 3RI4A 2CQKA 2QM3A 3T0YA 1ZG1A 2PMUA 3DFGA 2VONA 1SD5A 4UXNA 4LG0B 3RJPA 4HZFA 5ICGA 5K1YA 1H9TA 3GXOA 4MEXF 4I09A 2JPCA 3RYRA 3PQKA 5HS9A 2VE8A 2ISZA 3RIRA 2L4AA 1CF7B 5DYMA 3LAPA 4ESJA 5DEQA 5H6RA 2FU4A 5IT9Z 1G6NA 3DPTA 1I5ZA 1O7FA 2ESHA 2VOOA 4OOIA 1EH7A 5E8GA 1K78A 4GYGA 1P4AA 3ZMDA 1EH8A 2NNYA 1EV7A 1K79A 3KCCA 3WGGA 1ZLJA 5E8IA 4F7ZA 3RYPA 2QVOA 4IJAA 3F6OA 4GGGA 1XGSA 2Y48A 4AD9A 1RI7A 2IRFG 5FLXK 3V7CA 1P4XA 1BI0A 4OIQF 5D4SA 2DAOA 4UVCA 2PBIA 2V1DA 2FSWA 2EWNA 1I1GA 3BJAA 2BEOA 2E1NA 3NQOA 3FM3A 4EGZA 3Q9VA 2VC0A 1JE8A 4ASNA 3Q5FA 4P96A 4A5MA 3N4MA 2K7LA 2Q2EA 4RB2C 3ECOA 3TO9A 2LF7A 3E5QA 1G3YA 2CFXA 4P5OA 1U2WA 5KK1A 3TO7A 3WTSC 4KMUX 1SD7A 3J81K 4Y13A 1S8NA 3BPVA 2FEZA 3I0TA 1H9GA 4B8XA 2CSOA 4RAYA 3WODF 3VFZA 3N97A 4OIRF 2IPQX 1J9IA 2KRFA 2HS5A 4JQFA 1YLFA 1R36A 1BN5A 1BC8C 5LEKA 2V6CA 3S2WA 4M73A 2A3SA 4EMSA 3F3XA 2HYFA 5CVJA 1HSJA 4IRIA 4LD5A 1ULYA 3QPHA 5D5VB 2ETHA 3KE2A 1NHAA 2DBBA 2ESNA 6PAXA 4I02A 3WTYC 5JHUA 1T38A 1GXPA 2XAHA 5DCFA 3WTZA 2GIVA 1ZAOA 3H92A 1SFUA 2UZKA 2ZNZA 4L9VA 4MNUA 4BXUA 3U1DA 3RPUA 4BHBA 1S7AA 1DPUA 4XLPF 3TOBA 4M6YA 2O61A 1I6XA 2P8TA 4BQAA 4LK1F 3BJOA 4Z2YA 4QLCU 4L0ZB 4HQEA 1HSTA 1OYYA 3FMQA 2HWVA 4KT5C 5DCMB 2Z5UA 3DV8A 1W4MA 2TDXA 2G7UA 4KFCA 2VT2A 3J81Z 4PDKA 2RQPA 4IXAA 2VBWA 3CUQB 3RKYA 1PUEE 2OQGA 1FSEA 3WTTC 2H94A 2ZFWA 3FHZA 4XSXF 4LLNA 1IN7A 2ZMEA 2EV0A 3ZMTA 3LFKA 3ZMVA 3G3ZA 1FOKA 1IXRC 2FMYA 3CLOA 1J0RA 1QNTA 2H6BA 5FD5A 5F1RA 2F5EA 5HOOA 2W57A 3J80Z 3KZYA 4WXHA 2L02A 2J5OA 3V8LA 1T6SA 3HRMA 4L9JA 2DLLA 1AWCA 4YG2F 2HEOA 3HSRA 4YFNF 4MEYF 4Y15A 4LMYA 2E7WA 2W24A 3BDDA 2FRHA 1HW1A 3KP3A 3BJ6A 5KVRA 3NEUA 1LJ9A 3EYYA 2EJRA 3MZHA 1TTYA 1W5SA 3C3WA 1Q1HA 4HX7A 3REOA 3WTXC 3FMRA 1IN6A 5BPDA 2L54A 1IXSB 4ZH4F 3LQRA 3WE3A 3JTHA 1SFEA 4KYWA 1A04A 4YFXF 1ONVA 2IJLA 3ABTA 4XLNF 4HA8A 3OV8A 4HQMA 5HDGA 4UHTA 2HKOA 5LBQA 4ZYHA 5K5QA 2VN2A 4EJTA 1ZREA 4YIFA 4Q5SF 1O3SA 1IXCA 4LLGF 1LQ1A 3BPXA 5CVIA 4HX4A 3AAFA 2LSOA 1K78B 3R6SA 1XCVA 3SXYA 2BYVE 2F5FA 2W25A 2Y0MA 4WXCA 4A0ZA 1TQPA 3DEUA 3CDHA 4RAZA 1E17A 5FFZA 2P7VB 3I5UA 1AOYA 3DQVC 2KKOA 3LA2A 4Y17A 4RS8A 2P5VA 2BV6A 3R0AA 4AIJA 3RTRA 3FX3A 3F72A 4M6XA 4HV6A 3EETA 4WCGA 2HYGD 3HRTA 2IA1A 3IHUA 1FY7A 5ICEA 2JSCA 1ODDA 1YG2A 2E7XA 2MH9A 2C6YA 4ENKA 3H3ZA 2YPRA 3ISPA 3MFKA 1KQ0A 2F5DA 2FBKA 4A2UA 2HDCA 2NS0A 3ZQ7A 4RGXA 3IRRA 2VC1A 3O6BB 4ENJA 3MEXA 2FA5A 3GZ6A 5DD4A 3U2RA 2HOEA 1IUYA 5IT9K 5CVUA 1F9NA 3ULQB 4M74A 2JZYA 4A5NA 1O3RA 1R5GA 3IL2A 4FX0A 2R7FA 1J59A 2W85A 4HW0A 2HR3A 3DXJF 2FF4A 1BOAA 3BWGA 3E6BA 3RDIA 4B09A 4P9UA 3LSTA 5J6XA 2OU2A 1BM9A 2VBXA 3L7WA 3LWFA 4ZZLA 1J75A 2KIFA 1CGPA 4G7OF 1FBSA 1L0OC 3DP7A 1V4RA 3M7GA 2HFHA 1IN4A 1XDSA 4EJVA 5ILVA 2M5WA 2JPBA 1IW7F 5JR3A 4OIOF 3LA7A 2QBYA 3T5XA 3V4GA 3V8JA 4OU0A 2QLZA 5ICCA 2RKHA 2YX7A 4PGHA 5L3EA 4A6EA 4D0PA 1QO0D 1MD0A 2DPDA 2QQBA 4G94A 3GEZA 4N9HA 1R23A 5HS8A 3KP2A 1DUXC 5L3CA 4LB5A 3HHHA 1T39A 3E5XA 1B4AA 4I2OA 4CHUA 2NNNA 2P7CB 5BQTA 3F23A 5L3BA 1ZRFA 3WE2A 1O57A 3ZMZA 1LVAA 1D3YA 2AXLA 2O6GE 1F4KA 4HLYA 4M9SA 3WU1B 2ZMEB 4KMFA 1YYVA 1O3QA 1OYWA 2DK8A 2P6SA 1EH6A 2OZ6A 2A5YB 4DNCA 1ZGJA 1FLIA 1W5TA 2LNBA 4XBFA 3GO5A 3Q9SA 4MTEA 4Q48A 1R58A 2DO7A 5ILSA 2MH2A 5JVTA 1B9NA 3HYIA 2WV0A 5HLHA 3DF8A 2WTEA 3TGNA 5LHHA 2JT1A 4KA4A 1ZH5A 1YS7A 3GZ5A 1L3LA 4BHCA 3F8FA 3E3VA 1T2KA 5J8CA 2QUFA 2Z9OA 3KLNA 4GYIA 2XGXA 2EFPA 4G6QA 2VE9A 1VTNC 1QZZA 1KGSA 3WG9A 1FNNA 3KEOA 2HKXA 4LFUA 3IKVA 1XGOA 1RIOH 1WKMA 2HTSA 1XSXA 2VOPA 3B02A 3M8EA 1G3WA 3TQNA 2G9WA 1FP1D 1WI9A 3F8MA 1KU9A 2PJPA 1BBYA 3SQNA 2DQLA 1HQCA 2Q8KA 4CO8A 1XSVA 1P2FA 1OMIA 1ZLKA 1FWZA 2EFQA 2D2WA 3HOSA 1IZ1A 3J80K 3ERED 5AONA 4N9IA 3C18A 3HRUA 1DP7P 1P4WA 1Z1DA 5HLIA 1P92A 5DUKA 3E5UA 1BI1A 3OOPA 1FPQA 4U7BA 1RUOA 2LDUA 4DQ2A 1FBQA 2XAFA 1KU7A 2PFBA 4HF2A 4H0EA 3IKTA 2EV6A 2K27A 3T1BA 4ON0A 3FWEA 2MC3A 2FE3A 1ZARA 2KIMA 3GW2A 4AIKA 1BIBA 4KN7X 4MTDA 1U5TC 2VT3A 4IPAA 4I0AA 5LLQA 4HF0A 4XRFA 3QP6A 4BYYA 1BJAA 5D5XB 1FC3A 1UHMA 2WC2A 2ZXJA 1FSHA 1XB4A 1G3SA 2DFIA 3VOEA 1HKTA 4OIPF 3VB2A 2O0YA 3JAMZ 1USTA 1BIAA 3IWFA 2ISYA 3F6VA 1LEAA 3KP6A 2EFNA 2R7DA 2XKOA 2RN7A 5HDNA 3O3KA 4HAMA 4R1HA 3I4PA 3ZN1A 1PP8F 2QZ8A 1MGTA 4IHTA 4GXOA 3I71A 4CZZA 2G7HA 1IN8A 2RGVA 4EVIA 4HYEA 2O8XA 1T0FA 4GCVA 3K1MA 4MGRA 3HSEA 4MQVA 1R22A 1ZG3A 2ZJ2A 4TV7A 1XMAA 4KUMA 5LGNA 3F8NA 3M9AA 2DTRA 5TJJA 2MLGA 4RGUA 1DDNA 1B9MA 1ZHFA 5LGTA 2EA2A 4S05A 3R0JA 4ENMA 2XUBA 3W6KB 3E6CC 4HV5A 2GXBA 3TDZC 5BMZA 5D8LB 2KJCA 1FX7A 1TLHB 4GO1A 1Z6RA 2NYXA 4HF1A 3WU0A 2A6HF 1R7JA 3QRFF 3COAC 2STWA 3LQQA 3KFWX 1TQMA 4OMZA 1S3JA 3GVAA 2XV4S 4R8HA 4UUVA 4ESFA 3SZPA 2M45A 2PN6A 5DDGA 2A69F 4HLXA 5K5OA 2UXNA 3KZZA 2OBPA 2GA1A 4YFKF 2P5LC 3IRQA 3NRVA 1QQIA 1R1TA 2DI3A 4L5IA 2X0LA 2QBYB 2RDPA 1KU2A 3BY6A 4M71A 1JHHA 2STTA 2ZBKA 1TBXA 1ZGAA 5DV5A 1BC7C 1SMYF 1U6GA 2L01A 1LB2A 5HS7A 2COMA 4CYDA 1YS6A 4UVAA 4PZJA 5LHIA 1KYZA 5F6FA 2PMHA 2CYYA 5E1ZB 4LJZF 5CVVA 2KIUA 3FXRA 2JRTA 4RB3C 2EFOA 3SHFA 3WTVC 1MJBA 4KDPA 2RC4A 2XAQA 3WTUC 3T8TA 5CJ9A 2VBZA 2XRNA 3HRSA 4O6JA 2HZTA 3KETA 4IF4A 1REPC 3ABUA 4RGRA 2MA3A 2FBHA 4LK0F 5LEJA 3J7AO 2HGCA 2A61A 2IW5A 4EJWA 2DK5A 3HTUA 3SFZA 1Y0UA 5FB2A 1UHWA 2ACJA 4MHGA 2IVMA 2Z33A 1E2XA 5L3DA 4LGWA 4WK8F 1K6OA 2XASA 2RNJA 1J7KA 1IRGA 3L09A 2GZWA 2ELHA 1SMTA 1YW7A 2R3SA 3RKWA 2M8EA 4OINF 2Q0OA 2D1HA 1RNLA 4M9ZA 1Z05A 1KQ9A 3K69A 5A2QZ 3L00A 4EJUA 4O3MA 3QU3A 4FX4A 1JHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U5T A;  3ML6 A;  1LDK B;  2OD5 A;  3CUO A;  2PEX A;  4EM0 B;  1UB9 A;  2DT5 A;  3I53 A;  1P6R A;  2K86 A;  2V79 A;  1JXS A;  1QBJ A;  4KIB A;  1R1U A;  2DQR A;  1MKM A;  2EB7 A;  1F5T A;  5FGM A;  3GFM A;  4A0X A;  5BOX A;  2J5P A;  4WWC A;  3I59 A;  2A07 F;  1XGM A;  4IHS A;  2QQA A;  3PQJ A;  4YII A;  5LRS A;  1HKS A;  2D1V A;  4I98 B;  1XDU A;  2Y75 A;  2FBI A;  4BH9 A;  3R4K A;  2PG4 A;  2QWW A;  2AS5 F;  1D8J A;  3F8B A;  4M72 A;  3R61 A;  3V7R A;  5EEH A;  1QPM A;  3WGH A;  1TW2 A;  5ILU A;  3G73 A;  3FM5 A;  1ZN2 A;  1OYI A;  1Z7U A;  3MWM A;  1I27 A;  4KIC A;  1U8R A;  5D8K B;  1YW9 A;  2FXA A;  3FXQ A;  4EGY A;  4HOB A;  5K5R A;  3QU6 A;  2GXG A;  3GUD A;  1ZG5 A;  4LLL A;  3V7S A;  1TQI A;  3FF5 A;  3D5L A;  1D8K A;  2FOK A;  2GQQ A;  4WX9 A;  5EEG A;  1Z6T A;  5HVQ C;  5AIQ A;  2NRA C;  1FYM A;  2OAZ A;  5AIP A;  3M1E A;  2F2E A;  1R1V A;  2HTJ A;  5E1X A;  4I0B A;  2O3F A;  4Q47 A;  4G8X A;  2WWY A;  2EA4 A;  2YX4 A;  2EK5 A;  3GFL A;  5CLS A;  2Z3Y A;  3E6D A;  3F8C A;  4I7H A;  4HBL A;  5BS6 A;  3D0S A;  3FMS A;  3HSF A;  3GFJ A;  2K4J A;  4U0V A;  1S6L A;  4E70 A;  3C7J A;  2CG4 A;  4L5J A;  4RGS A;  3HOT A;  5LHG A;  4KNY A;  4CDG A;  2UWM A;  5LRR A;  4EM2 A;  4ESB A;  1PDN C;  2P4W A;  4PGG A;  1MJA A;  1HW2 A;  4I01 A;  1RUN A;  2OZU A;  4U7D A;  3JSO A;  1SFX A;  1Z9C A;  1GHC A;  3RPQ A;  3JAM K;  3O2P E;  3EDP A;  1GXQ A;  3ZPL A;  2IT0 A;  5L3F A;  3HHG A;  3CJN A;  3E6M A;  4WF2 A;  3MZY A;  2DPU A;  4NHJ A;  4L18 B;  1XD7 A;  2KJB A;  3TDU C;  3FXU A;  2GAU A;  4UVB A;  1GVJ A;  1OR7 A;  3CTA A;  5TRD A;  3K9T A;  4BHP A;  3GX4 X;  1FZP B;  1XSD A;  1XMK A;  3M8F A;  2P5K A;  5H6Q A;  2LF8 A;  1S7O A;  2V9V A;  4EQQ A;  2LKP A;  1DPR A;  5D4R A;  2QQ9 A;  3TO6 A;  2GA2 A;  1J2X A;  1HW5 A;  2VBY A;  3WGI A;  3TOA A;  2A68 F;  1KQ8 A;  1OKR A;  4EJO A;  3BRO A;  4K2E A;  2ZKZ A;  3F22 A;  1UCR A;  3EUH A;  4BNC A;  1RZ4 A;  2XVC A;  1U3E M;  5DUI A;  4G7Z F;  1MDM A;  5E1W A;  2VXZ A;  5BPI A;  3ZP5 A;  4CXF A;  3LAJ A;  1YQA A;  1OPC A;  2XAJ A;  3CUQ C;  5FLX Z;  2ADU A;  4ENN A;  2V1X A;  4A0Y A;  2CWE A;  1KYW A;  3R60 A;  3ZMS A;  4KN4 X;  3GYH X;  3V8K A;  2FQ3 A;  3I54 A;  2PI0 A;  4L9T A;  1W7P A;  1WWX A;  5D5U B;  3KEQ A;  1ON2 A;  2RVC A;  5E17 F;  4CGZ A;  3E97 A;  1HKQ A;  2M30 A;  5L3G A;  4ZYD A;  1MZB A;  1STZ A;  2PQ8 A;  3B73 A;  4LG0 A;  5D5W B;  2QEN A;  4IRG A;  5ERI A;  4G7H F;  1FP2 A;  2FNP A;  2W84 A;  3QOP A;  4O5V A;  1Z91 A;  1XGN A;  2EV5 A;  2GWR A;  4L0Y B;  3L9F A;  2H6C A;  1CF7 A;  2YR2 A;  2H27 A;  4RB1 A;  3H3U A;  3JTG A;  4G9Y A;  4PCQ A;  1U5T B;  1C0W A;  4UNO A;  3P9I A;  2MD5 A;  4U0Y A;  1KA8 A;  3GWZ A;  1R5H A;  4FT8 A;  3RKX A;  1BI3 A;  2VOD A;  2ZCW A;  5HDK A;  1B1B A;  1YIO A;  3K1P A;  1YW8 A;  2H09 A;  5H20 A;  2Z99 A;  3P9K A;  5JI6 A;  1MJ9 A;  3L2C A;  2OQR A;  3KP7 A;  5E20 A;  4R79 A;  3CO6 C;  4QWQ A;  5F64 A;  3I59 B;  3LA3 A;  3GLX A;  1T98 A;  1LDJ A;  3QPT A;  1JGS A;  1UFM A;  5FD6 A;  4L9N A;  1G3T A;  4HDU A;  1B6A A;  3MQ0 A;  2BGC A;  1H0M A;  3ZN0 A;  2XHK A;  5FO5 A;  2A6E F;  1ZRC A;  4P55 A;  2YU3 A;  2B0L A;  4M9X A;  4OMY A;  1QGP A;  5FFX A;  2HQR A;  2FML A;  2O03 A;  5E18 F;  4S04 A;  1WQ2 A;  1FBU A;  4KIF A;  3C1D A;  4JBA A;  1ON1 A;  2X4H A;  2HQN A;  2K4B A;  1K7A A;  1FT9 A;  1TW3 A;  2RV8 A;  3ELK A;  5ICF A;  5A2Q K;  2M87 A;  2XKP A;  2MLK A;  2PLY A;  3K0L A;  5DD8 A;  1O7L A;  4NB5 A;  3MAJ A;  4AIH A;  4XSZ F;  4IVN A;  1YFH A;  1I1S A;  4BAY A;  3JSP A;  2JTV A;  2YSR A;  4AWX B;  3JW4 A;  2K02 A;  4U0W A;  4EM1 A;  3K2Z A;  1B59 A;  2UXX A;  1TNS A;  1F1Z A;  4N0B A;  3EQL F;  1D5V A;  1TNT A;  1SAX A;  4CIC A;  3KP4 A;  5ED4 A;  1QZY A;  1IRF A;  3KLO A;  1IN5 A;  3U9G A;  2BBY A;  5HLG A;  1R00 A;  2OA4 A;  3I64 A;  4NQW A;  1WRJ A;  4HDV A;  2NAZ A;  4A12 A;  2BE5 F;  3QAH A;  5CYV A;  3IC7 A;  1IF1 A;  2DW4 A;  1BI2 A;  3EYI A;  2IA2 A;  1S29 A;  1YTY A;  3ECH A;  2DU9 A;  4KIG A;  2L4M A;  3VOD A;  2CO5 A;  5D6E A;  1KU3 A;  3WTW C;  3P7N A;  5DCM A;  3PFI A;  4RB0 A;  2E1C A;  1HXD A;  3FZV A;  2QYO A;  1U78 A;  3CUQ A;  1FYK A;  3HIF A;  4MQ9 F;  5CVR A;  4A6D A;  3MCZ A;  5IT3 A;  3F21 A;  3T8R A;  2ZO4 A;  4HX8 A;  4P9F A;  4U88 A;  3I58 A;  4ZYG A;  2FNA A;  4Q4Z F;  3DKW A;  1W7P D;  2F5C A;  3K1N A;  3GFI A;  1SD4 A;  3P9C A;  5LGU A;  3DPL C;  2P6T A;  1HBX G;  4G6D A;  1G4D A;  4FHT A;  3KP5 A;  1LDD A;  1XN7 A;  3ZMU A;  3QP5 A;  2ZNY A;  1ZYR F;  2IP2 A;  1J5Y A;  1YO5 C;  3BOQ A;  1USS A;  4UV9 A;  3HUG A;  2D45 A;  1ZRD A;  3SZT A;  1PP7 U;  2L3D A;  4AVP A;  2CW0 F;  4WXD A;  2V1U A;  1LNW A;  1LEB A;  1WSU A;  3GF2 A;  3BZ6 A;  3W6J B;  5J8F A;  5D6F A;  3VEP A;  4ZYE A;  1O3T A;  2XAG A;  1MDM B;  4UV8 A;  2EFW A;  1X3U A;  4IRH A;  3IWZ A;  3BP8 A;  1XCB A;  2XIG A;  2CGP A;  3ROU A;  2MBF A;  2XRO A;  4JK1 X;  3TKY A;  2M1B A;  1SD6 A;  1V3F A;  4ETS A;  4ZZD A;  3HTS B;  4LB6 B;  1IAW A;  1W7P B;  5JFR A;  2IA0 A;  4EV0 A;  1FYL A;  3CO7 C;  3RI4 A;  2CQK A;  2QM3 A;  3T0Y A;  1ZG1 A;  2PMU A;  3DFG A;  2VON A;  1SD5 A;  4UXN A;  4LG0 B;  3RJP A;  4HZF A;  5ICG A;  5K1Y A;  1H9T A;  3GXO A;  4MEX F;  4I09 A;  2JPC A;  3RYR A;  3PQK A;  5HS9 A;  2VE8 A;  2ISZ A;  3RIR A;  2L4A A;  1CF7 B;  5DYM A;  3LAP A;  4ESJ A;  5DEQ A;  5H6R A;  2FU4 A;  5IT9 Z;  1G6N A;  3DPT A;  1I5Z A;  1O7F A;  2ESH A;  2VOO A;  4OOI A;  1EH7 A;  5E8G A;  1K78 A;  4GYG A;  1P4A A;  3ZMD A;  1EH8 A;  2NNY A;  1EV7 A;  1K79 A;  3KCC A;  3WGG A;  1ZLJ A;  5E8I A;  4F7Z A;  3RYP A;  2QVO A;  4IJA A;  3F6O A;  4GGG A;  1XGS A;  2Y48 A;  4AD9 A;  1RI7 A;  2IRF G;  5FLX K;  3V7C A;  1P4X A;  1BI0 A;  4OIQ F;  5D4S A;  2DAO A;  4UVC A;  2PBI A;  2V1D A;  2FSW A;  2EWN A;  1I1G A;  3BJA A;  2BEO A;  2E1N A;  3NQO A;  3FM3 A;  4EGZ A;  3Q9V A;  2VC0 A;  1JE8 A;  4ASN A;  3Q5F A;  4P96 A;  4A5M A;  3N4M A;  2K7L A;  2Q2E A;  4RB2 C;  3ECO A;  3TO9 A;  2LF7 A;  3E5Q A;  1G3Y A;  2CFX A;  4P5O A;  1U2W A;  5KK1 A;  3TO7 A;  3WTS C;  4KMU X;  1SD7 A;  3J81 K;  4Y13 A;  1S8N A;  3BPV A;  2FEZ A;  3I0T A;  1H9G A;  4B8X A;  2CSO A;  4RAY A;  3WOD F;  3VFZ A;  3N97 A;  4OIR F;  2IPQ X;  1J9I A;  2KRF A;  2HS5 A;  4JQF A;  1YLF A;  1R36 A;  1BN5 A;  1BC8 C;  5LEK A;  2V6C A;  3S2W A;  4M73 A;  2A3S A;  4EMS A;  3F3X A;  2HYF A;  5CVJ A;  1HSJ A;  4IRI A;  4LD5 A;  1ULY A;  3QPH A;  5D5V B;  2ETH A;  3KE2 A;  1NHA A;  2DBB A;  2ESN A;  6PAX A;  4I02 A;  3WTY C;  5JHU A;  1T38 A;  1GXP A;  2XAH A;  5DCF A;  3WTZ A;  2GIV A;  1ZAO A;  3H92 A;  1SFU A;  2UZK A;  2ZNZ A;  4L9V A;  4MNU A;  4BXU A;  3U1D A;  3RPU A;  4BHB A;  1S7A A;  1DPU A;  4XLP F;  3TOB A;  4M6Y A;  2O61 A;  1I6X A;  2P8T A;  4BQA A;  4LK1 F;  3BJO A;  4Z2Y A;  4QLC U;  4L0Z B;  4HQE A;  1HST A;  1OYY A;  3FMQ A;  2HWV A;  4KT5 C;  5DCM B;  2Z5U A;  3DV8 A;  1W4M A;  2TDX A;  2G7U A;  4KFC A;  2VT2 A;  3J81 Z;  4PDK A;  2RQP A;  4IXA A;  2VBW A;  3CUQ B;  3RKY A;  1PUE E;  2OQG A;  1FSE A;  3WTT C;  2H94 A;  2ZFW A;  3FHZ A;  4XSX F;  4LLN A;  1IN7 A;  2ZME A;  2EV0 A;  3ZMT A;  3LFK A;  3ZMV A;  3G3Z A;  1FOK A;  1IXR C;  2FMY A;  3CLO A;  1J0R A;  1QNT A;  2H6B A;  5FD5 A;  5F1R A;  2F5E A;  5HOO A;  2W57 A;  3J80 Z;  3KZY A;  4WXH A;  2L02 A;  2J5O A;  3V8L A;  1T6S A;  3HRM A;  4L9J A;  2DLL A;  1AWC A;  4YG2 F;  2HEO A;  3HSR A;  4YFN F;  4MEY F;  4Y15 A;  4LMY A;  2E7W A;  2W24 A;  3BDD A;  2FRH A;  1HW1 A;  3KP3 A;  3BJ6 A;  5KVR A;  3NEU A;  1LJ9 A;  3EYY A;  2EJR A;  3MZH A;  1TTY A;  1W5S A;  3C3W A;  1Q1H A;  4HX7 A;  3REO A;  3WTX C;  3FMR A;  1IN6 A;  5BPD A;  2L54 A;  1IXS B;  4ZH4 F;  3LQR A;  3WE3 A;  3JTH A;  1SFE A;  4KYW A;  1A04 A;  4YFX F;  1ONV A;  2IJL A;  3ABT A;  4XLN F;  4HA8 A;  3OV8 A;  4HQM A;  5HDG A;  4UHT A;  2HKO A;  5LBQ A;  4ZYH A;  5K5Q A;  2VN2 A;  4EJT A;  1ZRE A;  4YIF A;  4Q5S F;  1O3S A;  1IXC A;  4LLG F;  1LQ1 A;  3BPX A;  5CVI A;  4HX4 A;  3AAF A;  2LSO A;  1K78 B;  3R6S A;  1XCV A;  3SXY A;  2BYV E;  2F5F A;  2W25 A;  2Y0M A;  4WXC A;  4A0Z A;  1TQP A;  3DEU A;  3CDH A;  4RAZ A;  1E17 A;  5FFZ A;  2P7V B;  3I5U A;  1AOY A;  3DQV C;  2KKO A;  3LA2 A;  4Y17 A;  4RS8 A;  2P5V A;  2BV6 A;  3R0A A;  4AIJ A;  3RTR A;  3FX3 A;  3F72 A;  4M6X A;  4HV6 A;  3EET A;  4WCG A;  2HYG D;  3HRT A;  2IA1 A;  3IHU A;  1FY7 A;  5ICE A;  2JSC A;  1ODD A;  1YG2 A;  2E7X A;  2MH9 A;  2C6Y A;  4ENK A;  3H3Z A;  2YPR A;  3ISP A;  3MFK A;  1KQ0 A;  2F5D A;  2FBK A;  4A2U A;  2HDC A;  2NS0 A;  3ZQ7 A;  4RGX A;  3IRR A;  2VC1 A;  3O6B B;  4ENJ A;  3MEX A;  2FA5 A;  3GZ6 A;  5DD4 A;  3U2R A;  2HOE A;  1IUY A;  5IT9 K;  5CVU A;  1F9N A;  3ULQ B;  4M74 A;  2JZY A;  4A5N A;  1O3R A;  1R5G A;  3IL2 A;  4FX0 A;  2R7F A;  1J59 A;  2W85 A;  4HW0 A;  2HR3 A;  3DXJ F;  2FF4 A;  1BOA A;  3BWG A;  3E6B A;  3RDI A;  4B09 A;  4P9U A;  3LST A;  5J6X A;  2OU2 A;  1BM9 A;  2VBX A;  3L7W A;  3LWF A;  4ZZL A;  1J75 A;  2KIF A;  1CGP A;  4G7O F;  1FBS A;  1L0O C;  3DP7 A;  1V4R A;  3M7G A;  2HFH A;  1IN4 A;  1XDS A;  4EJV A;  5ILV A;  2M5W A;  2JPB A;  1IW7 F;  5JR3 A;  4OIO F;  3LA7 A;  2QBY A;  3T5X A;  3V4G A;  3V8J A;  4OU0 A;  2QLZ A;  5ICC A;  2RKH A;  2YX7 A;  4PGH A;  5L3E A;  4A6E A;  4D0P A;  1QO0 D;  1MD0 A;  2DPD A;  2QQB A;  4G94 A;  3GEZ A;  4N9H A;  1R23 A;  5HS8 A;  3KP2 A;  1DUX C;  5L3C A;  4LB5 A;  3HHH A;  1T39 A;  3E5X A;  1B4A A;  4I2O A;  4CHU A;  2NNN A;  2P7C B;  5BQT A;  3F23 A;  5L3B A;  1ZRF A;  3WE2 A;  1O57 A;  3ZMZ A;  1LVA A;  1D3Y A;  2AXL A;  2O6G E;  1F4K A;  4HLY A;  4M9S A;  3WU1 B;  2ZME B;  4KMF A;  1YYV A;  1O3Q A;  1OYW A;  2DK8 A;  2P6S A;  1EH6 A;  2OZ6 A;  2A5Y B;  4DNC A;  1ZGJ A;  1FLI A;  1W5T A;  2LNB A;  4XBF A;  3GO5 A;  3Q9S A;  4MTE A;  4Q48 A;  1R58 A;  2DO7 A;  5ILS A;  2MH2 A;  5JVT A;  1B9N A;  3HYI A;  2WV0 A;  5HLH A;  3DF8 A;  2WTE A;  3TGN A;  5LHH A;  2JT1 A;  4KA4 A;  1ZH5 A;  1YS7 A;  3GZ5 A;  1L3L A;  4BHC A;  3F8F A;  3E3V A;  1T2K A;  5J8C A;  2QUF A;  2Z9O A;  3KLN A;  4GYI A;  2XGX A;  2EFP A;  4G6Q A;  2VE9 A;  1VTN C;  1QZZ A;  1KGS A;  3WG9 A;  1FNN A;  3KEO A;  2HKX A;  4LFU A;  3IKV A;  1XGO A;  1RIO H;  1WKM A;  2HTS A;  1XSX A;  2VOP A;  3B02 A;  3M8E A;  1G3W A;  3TQN A;  2G9W A;  1FP1 D;  1WI9 A;  3F8M A;  1KU9 A;  2PJP A;  1BBY A;  3SQN A;  2DQL A;  1HQC A;  2Q8K A;  4CO8 A;  1XSV A;  1P2F A;  1OMI A;  1ZLK A;  1FWZ A;  2EFQ A;  2D2W A;  3HOS A;  1IZ1 A;  3J80 K;  3ERE D;  5AON A;  4N9I A;  3C18 A;  3HRU A;  1DP7 P;  1P4W A;  1Z1D A;  5HLI A;  1P92 A;  5DUK A;  3E5U A;  1BI1 A;  3OOP A;  1FPQ A;  4U7B A;  1RUO A;  2LDU A;  4DQ2 A;  1FBQ A;  2XAF A;  1KU7 A;  2PFB A;  4HF2 A;  4H0E A;  3IKT A;  2EV6 A;  2K27 A;  3T1B A;  4ON0 A;  3FWE A;  2MC3 A;  2FE3 A;  1ZAR A;  2KIM A;  3GW2 A;  4AIK A;  1BIB A;  4KN7 X;  4MTD A;  1U5T C;  2VT3 A;  4IPA A;  4I0A A;  5LLQ A;  4HF0 A;  4XRF A;  3QP6 A;  4BYY A;  1BJA A;  5D5X B;  1FC3 A;  1UHM A;  2WC2 A;  2ZXJ A;  1FSH A;  1XB4 A;  1G3S A;  2DFI A;  3VOE A;  1HKT A;  4OIP F;  3VB2 A;  2O0Y A;  3JAM Z;  1UST A;  1BIA A;  3IWF A;  2ISY A;  3F6V A;  1LEA A;  3KP6 A;  2EFN A;  2R7D A;  2XKO A;  2RN7 A;  5HDN A;  3O3K A;  4HAM A;  4R1H A;  3I4P A;  3ZN1 A;  1PP8 F;  2QZ8 A;  1MGT A;  4IHT A;  4GXO A;  3I71 A;  4CZZ A;  2G7H A;  1IN8 A;  2RGV A;  4EVI A;  4HYE A;  2O8X A;  1T0F A;  4GCV A;  3K1M A;  4MGR A;  3HSE A;  4MQV A;  1R22 A;  1ZG3 A;  2ZJ2 A;  4TV7 A;  1XMA A;  4KUM A;  5LGN A;  3F8N A;  3M9A A;  2DTR A;  5TJJ A;  2MLG A;  4RGU A;  1DDN A;  1B9M A;  1ZHF A;  5LGT A;  2EA2 A;  4S05 A;  3R0J A;  4ENM A;  2XUB A;  3W6K B;  3E6C C;  4HV5 A;  2GXB A;  3TDZ C;  5BMZ A;  5D8L B;  2KJC A;  1FX7 A;  1TLH B;  4GO1 A;  1Z6R A;  2NYX A;  4HF1 A;  3WU0 A;  2A6H F;  1R7J A;  3QRF F;  3COA C;  2STW A;  3LQQ A;  3KFW X;  1TQM A;  4OMZ A;  1S3J A;  3GVA A;  2XV4 S;  4R8H A;  4UUV A;  4ESF A;  3SZP A;  2M45 A;  2PN6 A;  5DDG A;  2A69 F;  4HLX A;  5K5O A;  2UXN A;  3KZZ A;  2OBP A;  2GA1 A;  4YFK F;  2P5L C;  3IRQ A;  3NRV A;  1QQI A;  1R1T A;  2DI3 A;  4L5I A;  2X0L A;  2QBY B;  2RDP A;  1KU2 A;  3BY6 A;  4M71 A;  1JHH A;  2STT A;  2ZBK A;  1TBX A;  1ZGA A;  5DV5 A;  1BC7 C;  1SMY F;  1U6G A;  2L01 A;  1LB2 A;  5HS7 A;  2COM A;  4CYD A;  1YS6 A;  4UVA A;  4PZJ A;  5LHI A;  1KYZ A;  5F6F A;  2PMH A;  2CYY A;  5E1Z B;  4LJZ F;  5CVV A;  2KIU A;  3FXR A;  2JRT A;  4RB3 C;  2EFO A;  3SHF A;  3WTV C;  1MJB A;  4KDP A;  2RC4 A;  2XAQ A;  3WTU C;  3T8T A;  5CJ9 A;  2VBZ A;  2XRN A;  3HRS A;  4O6J A;  2HZT A;  3KET A;  4IF4 A;  1REP C;  3ABU A;  4RGR A;  2MA3 A;  2FBH A;  4LK0 F;  5LEJ A;  3J7A O;  2HGC A;  2A61 A;  2IW5 A;  4EJW A;  2DK5 A;  3HTU A;  3SFZ A;  1Y0U A;  5FB2 A;  1UHW A;  2ACJ A;  4MHG A;  2IVM A;  2Z33 A;  1E2X A;  5L3D A;  4LGW A;  4WK8 F;  1K6O A;  2XAS A;  2RNJ A;  1J7K A;  1IRG A;  3L09 A;  2GZW A;  2ELH A;  1SMT A;  1YW7 A;  2R3S A;  3RKW A;  2M8E A;  4OIN F;  2Q0O A;  2D1H A;  1RNL A;  4M9Z A;  1Z05 A;  1KQ9 A;  3K69 A;  5A2Q Z;  3L00 A;  4EJU A;  4O3M A;  3QU3 A;  4FX4 A;  1JHF A; 
#chains in the Genus database with same CATH topology
 4NC7 A;  2K9L A;  2MFZ A;  5EG0 A;  1U5T A;  3S93 A;  3ML6 A;  1WJD A;  4HNT A;  1LDK B;  2OD5 A;  3CUO A;  2PEX A;  4EM0 B;  1UB9 A;  4PSW A;  5GAH J;  2WB1 N;  2XB0 X;  3VPR A;  4HNU A;  2DT5 A;  4B47 A;  3I53 A;  1P6R A;  2K86 A;  2R7S A;  3BLY A;  4DZP A;  2V79 A;  2XRL A;  1S9H A;  1JXS A;  1LVK A;  3GLL A;  1QBJ A;  4KIB A;  1R1U A;  5B66 C;  2DQR A;  3DKX A;  2W00 A;  1MKM A;  2EB7 A;  5GTH C;  1DP3 A;  4E7Z A;  2VKV A;  1F5T A;  1EF4 A;  3BQY A;  5FGM A;  3GFM A;  4A0X A;  3TL4 X;  4XKW A;  5BOX A;  3PUB A;  2J5P A;  4WWC A;  3I59 A;  2A07 F;  1XGM A;  4IHS A;  2VQC A;  1VI0 A;  2QQA A;  3SEZ A;  5HOD A;  2JVH A;  1OCT C;  5FKN A;  3PQJ A;  2ECB A;  4YII A;  5LRS A;  2BY1 A;  2GBY A;  4IHW A;  1HKS A;  1X3W B;  2D1V A;  5EZG A;  4I98 B;  3KX2 A;  3HC7 A;  1TL8 A;  5F0F A;  4CCM A;  3DBH B;  5J4Y A;  4V2G A;  1XDU A;  4CCO A;  2NVT J;  1X19 A;  2Y75 A;  2FBI A;  2LY9 A;  4BH9 A;  4UB8 C;  2CUZ A;  3H9J A;  3GTO J;  2X1E A;  3R4K A;  1SVL A;  2PG4 A;  4DGW B;  1QRY A;  4D5C A;  1SAN A;  2RNG A;  1S7E A;  3OL3 A;  2QWW A;  4UUS A;  2AS5 F;  5IYB J;  1D8J A;  3HPH A;  1MMG A;  3F8B A;  5K7Z A;  3B6A A;  4M72 A;  3R61 A;  3V7R A;  5EEH A;  3RZO J;  2R7O A;  1QPM A;  1ZTR A;  3WGH A;  1TW2 A;  1ZGW A;  5ILU A;  5E3O A;  2LKX A;  3G73 A;  3FM5 A;  3NAU A;  1ZN2 A;  4DYQ A;  4FCY A;  1OYI A;  1Z7U A;  3QPL A;  1P9Q C;  3MWM A;  1I27 A;  4KIC A;  1U8R A;  5D8K B;  3SYT A;  4ZDL A;  3G1L A;  4BY7 J;  3LSR A;  1YW9 A;  2FXA A;  3S16 J;  1MMA A;  3LL7 A;  3FXQ A;  3S14 J;  4DIQ A;  2F48 A;  4W1U A;  2V6E A;  2I8D A;  3ABL H;  1RR8 C;  2BXY A;  4EGY A;  1HF0 A;  4HOB A;  5K5R A;  4RM2 A;  3QU6 A;  2GXG A;  1JUM A;  3GUD A;  1JJ8 C;  1ZG5 A;  1X2M A;  4LLL A;  3BG6 A;  3V7S A;  1GT0 C;  1TQI A;  3BZK A;  3ZQH A;  4AYB A;  2E2J J;  3H9G A;  1NTC A;  3FF5 A;  2X6O A;  4YRV A;  3D5L A;  4XKC A;  1D8K A;  3BG7 A;  2R0Q C;  2PJR A;  2FOK A;  2GQQ A;  4WX9 A;  3CF5 F;  5EEG A;  1Z6T A;  4XON A;  2EQR A;  5HVQ C;  5AIQ A;  2NRA C;  4V19 K;  3J7Z I;  1FYM A;  1X2N A;  2EIK H;  2OAZ A;  1HDD C;  5AIP A;  3M1E A;  3Q0U A;  2F2E A;  1YHQ I;  3BR5 A;  1R1V A;  2HOT A;  2HTJ A;  2CW8 A;  1GVD A;  3EUK L;  5E1X A;  1Y1V J;  4I0B A;  2O3F A;  4Q47 A;  4G8X A;  3LMM A;  2K9N A;  2WWY A;  2EA4 A;  2YX4 A;  3ZQI A;  3FBN B;  3ZQG A;  2EK5 A;  1WCM J;  1Y6I A;  4MFD A;  3GFL A;  5CLS A;  2Z3Y A;  4UY8 I;  3E6D A;  3F8C A;  2WBM A;  4I7H A;  2FX0 A;  4HBL A;  5IP6 A;  5BS6 A;  2QA4 I;  3D0S A;  4XOP A;  3FMS A;  3Q3S A;  2VI6 A;  3HSF A;  3GFJ A;  2K4J A;  3AG4 H;  4U0V A;  1XS9 A;  1S6L A;  1Y8Q B;  3K6G A;  4E70 A;  3C7J A;  1JKP C;  1WH7 A;  3L2V A;  2CG4 A;  1BR1 A;  1VQ4 I;  4L5J A;  4RGS A;  3HOT A;  5F1J A;  5F08 A;  5LHG A;  4KNY A;  3QQA A;  2ID6 A;  4CDG A;  3SDG A;  2UWM A;  2F4O B;  5LRR A;  4EM2 A;  1VQL I;  4ESB A;  1PDN C;  3KIO A;  2P4W A;  4PGG A;  1OJL A;  4HNV A;  1MJA A;  2DA1 A;  1HW2 A;  1WJC A;  3DU6 A;  4I01 A;  3ZQF A;  1RUN A;  4MIM A;  4J19 A;  3G6E I;  2OZU A;  1JUP A;  4U7D A;  1D1C A;  2P0W A;  4C3I J;  1APL C;  3HOZ J;  3JSO A;  3AKZ A;  1B8I B;  3PNT A;  3MKW B;  3TP3 A;  1SFX A;  1Z9C A;  5DS9 A;  4II2 A;  1GHC A;  3J7Y J;  4BGD A;  3RPQ A;  4ANJ A;  3O2P E;  3JAM K;  3EDP A;  1GXQ A;  3ZPL A;  2IT0 A;  2BXZ A;  5L3F A;  1H89 C;  3HHG A;  2CQQ A;  1SFK A;  3CJN A;  1WI3 A;  3E6M A;  4WF2 A;  3MZY A;  2E35 A;  2DPU A;  1MIJ A;  1MW7 A;  1NG6 A;  1MH3 A;  4NHJ A;  4L18 B;  1XD7 A;  2KJB A;  3TDU C;  3OYG A;  3FXU A;  3I4N J;  5J40 A;  2AQF A;  2MGQ A;  4M3F A;  2GAU A;  4UVB A;  1GVJ A;  2DA2 A;  1OR7 A;  1TC3 C;  3CTA A;  5TRD A;  3K9T A;  4RDU A;  1TWH J;  4BHP A;  2IBD A;  2L7Z A;  1BR4 A;  3VYS B;  2X51 A;  3GX4 X;  1FZP B;  1XSD A;  1JKR C;  1XMK A;  3M8F A;  2P5K A;  5H6Q A;  5J1U A;  2O8K A;  2LF8 A;  1S7O A;  1GV5 A;  2V9V A;  4EQQ A;  2LKP A;  2CU7 A;  4XM3 A;  1DPR A;  2MYS A;  3O8G A;  2HQ5 A;  4Y33 A;  5D4R A;  1UG2 A;  1YE9 A;  2QQ9 A;  3CF2 A;  4BE1 A;  2R93 J;  3TO6 A;  2GA2 A;  1J2X A;  1HW5 A;  1QU3 A;  2VBY A;  3VYR B;  3WGI A;  3ZQC A;  1Y0N A;  3IH3 A;  3TOA A;  3SJM A;  2A68 F;  1KQ8 A;  2DOF A;  3GTQ J;  1OKR A;  4EJO A;  3BRO A;  3LSK A;  2CJJ A;  4Y7N J;  2CV1 A;  4K2E A;  2ZKZ A;  4BQN A;  3F22 A;  1UCR A;  3EUH A;  4BNC A;  1I39 A;  1RZ4 A;  2XVC A;  2OPT A;  1U3E M;  1MBJ A;  4DOZ A;  5DUI A;  4G7Z F;  1MDM A;  5E1W A;  2DA6 A;  4C3H J;  5EF6 A;  2VXZ A;  5BPI A;  3ZP5 A;  4CXF A;  1WGX A;  3WHB A;  3LAJ A;  1YQA A;  3MVP A;  3ONQ A;  1OPC A;  2XAJ A;  2X6X A;  3CUQ C;  3HXL A;  5FLX Z;  2KDO A;  2ADU A;  1YX3 A;  1MND A;  1MSF C;  4ENN A;  2V1X A;  4A0Y A;  2CWE A;  2TCT A;  2DT6 A;  2KLO A;  1X1D A;  1KYW A;  3R60 A;  3OR2 C;  2R7X A;  1ERD A;  1I3Q J;  3ZMS A;  4KN4 X;  3GYH X;  4JOM A;  3V8K A;  4AVZ A;  4A93 J;  3V42 A;  2FQ3 A;  3ABM H;  1YIT I;  4CCJ A;  3I54 A;  2PI0 A;  4L9T A;  1W7P A;  4IHX A;  1WWX A;  5D5U B;  3BG9 A;  2VJJ A;  3KEQ A;  1ON2 A;  4M6V A;  2RVC A;  5E17 F;  4PSX A;  4CGZ A;  3E97 A;  4UUT A;  1HKQ A;  2M30 A;  3SFI A;  5L3G A;  4ZYD A;  1MZB A;  1STZ A;  2PQ8 A;  5FKL A;  3B73 A;  2V7F A;  4XID A;  4LG0 A;  3LFU A;  3OSF A;  4QSH A;  5D5W B;  2QEN A;  3KPH A;  3NAR A;  4IRG A;  5ERI A;  3KYL A;  3L2R A;  2R5Z B;  3TBI A;  4G7H F;  3CD6 I;  3GBG A;  1FP2 A;  2R7W A;  2FNP A;  2W84 A;  3I4M J;  3QOP A;  4O5V A;  4LIT A;  4DYC A;  5K7H A;  1Z91 A;  1XGN A;  3CJT B;  1R71 A;  2MG4 A;  2GOX B;  2EV5 A;  2GWR A;  2UV1 A;  3QOE A;  3L9F A;  2H6C A;  4L0Y B;  5CQG A;  1CF7 A;  2JA6 J;  2YR2 A;  2H27 A;  1Y8R B;  4RB1 A;  3H3U A;  4RMN A;  3JTG A;  3SDB A;  4G9Y A;  4PCQ A;  2A5W A;  1U5T B;  5EG0 B;  1KZH A;  1C0W A;  4UNO A;  2X1C A;  3P9I A;  2MW8 A;  3LSG A;  2MD5 A;  4U0Y A;  1KA8 A;  3GWZ A;  2JA2 A;  1R5H A;  3JRH A;  4FT8 A;  3RKX A;  1BI3 A;  2VOD A;  3G2B A;  3HGY A;  2ZCW A;  1TT5 B;  5HDK A;  1B1B A;  1YIO A;  5KNL A;  3K1P A;  4IOC F;  3GTP J;  1YW8 A;  1I6H J;  2ZC2 A;  4C2T A;  1SFO J;  2H09 A;  5H20 A;  1N77 A;  2Z99 A;  3P9K A;  5JI6 A;  1MJ9 A;  1Q1V A;  3L2C A;  1OLT A;  2BVL A;  2OQR A;  2X85 A;  3KP7 A;  5E20 A;  4R79 A;  3CO6 C;  3JCU C;  4QWQ A;  5F64 A;  3I59 B;  3LA3 A;  3GLX A;  1U0J A;  3RQI A;  1T98 A;  1LDJ A;  3QPT A;  1YIJ I;  1JGS A;  1UFM A;  1HA8 A;  5FD6 A;  1WJA A;  4L9N A;  1G3T A;  4HDU A;  1B6A A;  3MQ0 A;  2BGC A;  4QTR A;  1H0M A;  3ZN0 A;  2XHK A;  1K4T A;  1IRX A;  1J09 A;  5FO5 A;  2XPW A;  2A6E F;  1X1P A;  4S0H B;  4P55 A;  1ZRC A;  3ZQL A;  2YU3 A;  2V1N A;  3LSH A;  4JX6 A;  2B0L A;  3A4C A;  2EPF A;  4JX5 A;  4M9X A;  1YX5 A;  2KT0 A;  4OMY A;  4FX4 A;  1QGP A;  2DFE A;  3CC4 I;  5FFX A;  1RKW A;  4A3D J;  2HQR A;  3HKZ N;  1GUU A;  4F93 B;  2ZFU A;  4UUS B;  2FML A;  2O03 A;  1V5F A;  5E18 F;  3DEE A;  4E7S A;  1WQ2 A;  4S04 A;  1FBU A;  2HXO A;  4KIF A;  3C1D A;  4JBA A;  1ON1 A;  1WFX A;  1XC5 A;  2X4H A;  2HQN A;  2VJI A;  2K4B A;  1K7A A;  1FT9 A;  4PJ0 C;  1TW3 A;  4EEF G;  2RV8 A;  2DMN A;  3ELK A;  5ICF A;  5A2Q K;  2M87 A;  2XKP A;  2MLK A;  4B3X A;  5KAI C;  3IV5 A;  3U21 A;  2PLY A;  3K0L A;  5DD8 A;  3LSP A;  1O7L A;  1JUS A;  4NB5 A;  4XNF A;  3OYF A;  2NS8 A;  2OV7 A;  4LG3 A;  3FXL A;  3MAJ A;  4XLF A;  3WU2 C;  3LNQ A;  4AIH A;  4BJ6 C;  4N4N B;  4XSZ F;  4IVN A;  2QKL B;  3KZI C;  1YFH A;  1I1S A;  4BAY A;  3JSP A;  3OYJ A;  2JTV A;  1I3A A;  2YSR A;  2Y0S A;  2ELJ A;  4AWX B;  3JW4 A;  3FXM A;  2K02 A;  4U0W A;  4EM1 A;  3K2Z A;  1RRJ A;  3QWL A;  5IY5 H;  1B59 A;  3OSG A;  2PJR B;  3SZG A;  2UXX A;  2JK3 A;  2L7K A;  4D7M A;  3K2A A;  1TNS A;  1F1Z A;  4N0B A;  1NH3 A;  3EQL F;  2B63 J;  1D5V A;  1TNT A;  1SAX A;  4X0G A;  2JUC A;  4CIC A;  3PO3 J;  4IX7 A;  3KP4 A;  4A3I J;  4UB6 C;  1LKX A;  1D1B A;  5ED4 A;  1QZY A;  2X48 A;  1IRF A;  2W1O A;  3KLO A;  1IN5 A;  3U9G A;  3K70 C;  2BBY A;  1F43 A;  2AQE A;  3ABK H;  5HLG A;  1ETX A;  1R00 A;  3GCM A;  2OA4 A;  4CCN A;  2IEK A;  4F91 B;  3I64 A;  3CDL A;  5C4X J;  3H0G J;  3N05 A;  4NQW A;  4QIW N;  2WA0 A;  4E7J A;  1WRJ A;  1QPI A;  4HDV A;  2NAZ A;  4CYC A;  2KHM A;  4D1Q A;  1ETK A;  4A12 A;  1G8X A;  3PFY A;  2BE5 F;  4LIV A;  1RET A;  3GZN B;  3QAH A;  1MMD A;  2IS1 A;  5CYV A;  3DTI A;  1KON A;  1JGG A;  3IC7 A;  1IF1 A;  2DW4 A;  1BI2 A;  3EYI A;  3JR9 A;  3CP2 A;  2IA2 A;  4B4C A;  1FTZ A;  1S29 A;  1YTY A;  3ECH A;  4XRS A;  2L2O A;  1ETO A;  2HOA A;  1GLN A;  1NK2 P;  1VZ0 A;  2DU9 A;  2IGO A;  4KIG A;  3A0H C;  3CC7 I;  3OL4 A;  4BKX A;  3QPS A;  1D0X A;  2L4M A;  2EZH A;  3VOD A;  1AU7 A;  1B72 A;  2CO5 A;  5D6E A;  3HL2 A;  3DTE A;  4BE0 A;  1KU3 A;  2Y9Z A;  4ITV A;  3WTW C;  3P7N A;  5DCM A;  4HRI A;  3PFI A;  4RB0 A;  5EGO A;  2E1C A;  3HJE A;  4PJM A;  4E4H A;  1HXD A;  3FZV A;  4D5F A;  2QYO A;  3NWT A;  1U78 A;  2MC4 A;  3LOC A;  3CUQ A;  4OWR B;  2M7B A;  2VB6 A;  1FYK A;  3EUH C;  3HIF A;  3OIP A;  4MQ9 F;  4C3J J;  3OMY A;  3K4N A;  3PIP F;  5CVR A;  4A6D A;  3MCZ A;  5F0H A;  5IT3 A;  3F21 A;  2XF7 A;  3CCL I;  3T8R A;  2ZO4 A;  1WVR A;  2DFH A;  4HX8 A;  4P9F A;  4U88 A;  3I58 A;  4ZYG A;  1FTT A;  4XRS G;  4KIT B;  2FNA A;  3DKW A;  4Q4Z F;  1W7P D;  2F5C A;  3K1N A;  3GFI A;  1SD4 A;  3P9C A;  2WY8 Q;  5LGU A;  3DPL C;  3FBI B;  1X4P A;  2P6T A;  4RBO A;  1S72 I;  3DU5 A;  1HBX G;  3RCO A;  3CC2 I;  4Y4R A;  2HYJ A;  4G6D A;  1G4D A;  4FHT A;  3OYH A;  3KP5 A;  1LDD A;  1XN7 A;  3ZMU A;  3W6V A;  3QP5 A;  2X9D A;  3E1S A;  1WHU A;  2ZNY A;  1TWC J;  1ZYR F;  1JT0 A;  2IP2 A;  1J5Y A;  2L7F P;  1YO5 C;  3BOQ A;  1USS A;  4IHV A;  2QGU A;  4UV9 A;  1UMQ A;  3HUG A;  4H4K C;  1P7J A;  2D45 A;  1ZRD A;  4IQ4 A;  4C30 A;  3SZT A;  4BAC A;  1PP7 U;  3HOU J;  2L3D A;  4P1W A;  3FIW A;  4AVP A;  2CW0 F;  2XSJ C;  4WXD A;  1LNW A;  3RSN A;  1WJF A;  2V1U A;  3GTL J;  1LEB A;  1WSU A;  3GF2 A;  2LMD A;  3BZ6 A;  3W6J B;  5J8F A;  4HG2 A;  4BBS J;  2XPV A;  5D6F A;  3VEP A;  4ZYE A;  3S3N A;  1O3T A;  2XAG A;  5IP7 J;  3FHN A;  2PMZ N;  1MDM B;  4ZYA A;  4UV8 A;  3JRC A;  2EFW A;  3ESW B;  2KIS A;  4OAY A;  1X3U A;  2DJI A;  2JQ7 A;  4IRH A;  3IWZ A;  1G2H A;  2KRC A;  2R7Z J;  1HOM A;  3E0J B;  1OCZ H;  3BP8 A;  1XCB A;  2XIG A;  2CGP A;  4IEJ A;  3ROU A;  4IOA F;  2D5V A;  1I50 J;  1UHS A;  2MBF A;  1TWA J;  3DCF A;  2QKM B;  2XRO A;  3HDD A;  3L2U A;  4JK1 X;  3TKY A;  2ZSH B;  2LY2 A;  2ME6 A;  2VUM J;  2LBF A;  2M1B A;  3BTJ A;  1LE8 A;  1SD6 A;  3D5S C;  1V3F A;  4ETS A;  4ZZD A;  3HTS B;  2VPR A;  2MSY A;  5IP9 J;  4LB6 B;  1IAW A;  1AA7 A;  1W7P B;  5JFR A;  2IA0 A;  3A02 A;  4EV0 A;  1FYL A;  3CO7 C;  2LRD A;  3M8J A;  3RI4 A;  2CQK A;  2LC2 A;  5IPA A;  2IGM A;  2QM3 A;  3T0Y A;  1VQO I;  2EZI A;  4JYK A;  3OS2 A;  2QSH X;  2K3P A;  1ZG1 A;  2PMU A;  3DFG A;  2VON A;  1RES A;  1SD5 A;  2I10 A;  3H5A A;  4UXN A;  1AKH A;  4LG0 B;  3CCJ I;  3RJP A;  4HZF A;  1YJW I;  5ICG A;  5K1Y A;  1H9T A;  3GXO A;  4MEX F;  5C44 J;  3HBL A;  4I09 A;  1EJ9 A;  2DMQ A;  4FET A;  1Y56 A;  4B44 A;  3BR3 A;  2XAU A;  4N4O B;  2JPC A;  3RYR A;  1R5I D;  2XC7 A;  2CQ7 A;  1FIP A;  3PQK A;  5HS9 A;  2ZJR F;  2VE8 A;  2ISZ A;  3RIR A;  2H1K A;  2L4A A;  3MD2 A;  3PIO F;  1QHG A;  1CF7 B;  4OAZ A;  4A3K J;  1MBG A;  1BJZ A;  5DYM A;  3LAP A;  4ESJ A;  2NOG A;  5TGT A;  5DEQ A;  2VQH A;  5H6R A;  2NVX J;  2FU4 A;  4X1E A;  2CV0 A;  5IT9 Z;  2K9M A;  1G6N A;  3DPT A;  3UR3 C;  1I5Z A;  4F52 A;  1O7F A;  2ESH A;  2VOO A;  4OOI A;  1EH7 A;  2EIJ H;  4XOR A;  5E8G A;  1K78 A;  1R4M B;  4GYG A;  1P4A A;  3CLQ A;  3ZMD A;  1D0Y A;  2DOD A;  2F5V A;  1EH8 A;  1A35 A;  1W5C C;  1EV7 A;  2NNY A;  1K79 A;  4E7K A;  3KCC A;  3WGG A;  4CA0 A;  1ZLJ A;  5E8I A;  4F7Z A;  1XPX A;  1WH5 A;  4Y3O A;  4BJ5 C;  1VQK I;  3VYU B;  4A69 C;  1H8A C;  4BY1 J;  3RYP A;  1VQ5 I;  1A6Q A;  2QVO A;  4IJA A;  3F6O A;  4GGG A;  1XGS A;  5CQE A;  2Y48 A;  4AD9 A;  1RI7 A;  2DOE A;  2LLK A;  3FKJ A;  2IRF G;  4MFE A;  5EJC A;  4C2M J;  1Z3Y A;  5FLX K;  3QYE A;  3DTK A;  4IQJ A;  3V7C A;  5GTI C;  3GTK J;  1P4X A;  1BI0 A;  1MBF A;  4OIQ F;  3EUA A;  1VQM I;  2O7O A;  2DAO A;  2KIQ A;  5D4S A;  4UVC A;  5JLX A;  2PBI A;  2TRT A;  2ICW G;  2HPI A;  2V1D A;  9ANT A;  2CQX A;  2E19 A;  2FSW A;  3DLA A;  2EWN A;  1I1G A;  3BJA A;  2BEO A;  2E1N A;  3NQO A;  2DFF A;  3B6C A;  3FM3 A;  1Z7L A;  4EGZ A;  1TWG J;  5DTD A;  3Q9V A;  2VC0 A;  4DZJ A;  1JE8 A;  3VSK A;  4ASN A;  3Q5F A;  2KDZ A;  1FMV A;  4P96 A;  4A5M A;  3N4M A;  2K7L A;  2ZJQ F;  2Q2E A;  4RB2 C;  1O4X A;  1W36 C;  2Q1Z B;  3ECO A;  4M3E A;  2HVR A;  2LVS A;  1QZE A;  3TO9 A;  4DYR A;  2LF7 A;  3E5Q A;  2XPU A;  1G3Y A;  2CFX A;  1N75 A;  3HOY J;  4P5O A;  2H8W A;  1U2W A;  2L9S A;  2R4G A;  5KK1 A;  1W1W E;  3TO7 A;  3WTS C;  1LFU P;  5IYD J;  4KMU X;  2AO9 A;  1SD7 A;  4NC8 A;  5DM6 F;  2QQ8 A;  3QYB A;  2KFD A;  3MKL A;  1AHD P;  3J81 K;  4Y13 A;  1S8N A;  3BPV A;  3DKY A;  2O9L A;  2FEZ A;  2EBI A;  3I0T A;  1H9G A;  4B8X A;  3CP8 A;  3IP4 B;  4XN3 A;  2CSO A;  4RAY A;  1FEX A;  3WOD F;  3VFZ A;  2JUG A;  3N97 A;  3BG3 A;  2JJ7 A;  4OIR F;  2IPQ X;  1J9I A;  3VYT B;  2KRF A;  2HS5 A;  2ME0 A;  2XGD A;  1K61 A;  1T56 A;  4JQF A;  2Y69 H;  5J47 A;  1YLF A;  1R36 A;  1ZR2 A;  1BN5 A;  1V5G A;  4ZDP A;  1BC8 C;  3JRD A;  3AFH A;  5LEK A;  2L0K A;  2V6C A;  1YOV B;  2E34 A;  3S2W A;  4M73 A;  2RQQ A;  2ZXW H;  2A3S A;  4A3F J;  4EMS A;  3F3X A;  3S2D J;  2HYF A;  5CVJ A;  1HSJ A;  4M3B A;  4IRI A;  4LD5 A;  1ULY A;  3QPH A;  5D5V B;  4A3J J;  2F6C A;  3I56 I;  2HU9 A;  4BEH A;  3DLL F;  2ETH A;  2WAE A;  2VKE A;  1D0Z A;  4II3 A;  5FRM A;  3KE2 A;  1WZ2 A;  1NHA A;  3A01 A;  2HI3 A;  2DBB A;  4MO7 A;  2M9H A;  1S5L C;  2ESN A;  2IS4 A;  6PAX A;  4I02 A;  3WTY C;  1Z3X A;  5JHU A;  1T38 A;  1GXP A;  2XAH A;  5DCF A;  5E79 C;  4NQW B;  3WTZ A;  4E7L A;  2GIV A;  2HVQ A;  3MZ8 A;  4CYC B;  1ZAO A;  3H92 A;  1IG7 A;  1SFU A;  2UZK A;  2ZNZ A;  1H88 C;  4L9V A;  4MNU A;  4CCL A;  4BXU A;  3U1D A;  3WHC A;  3RPU A;  4BHB A;  1S7A A;  1EA3 A;  1DPU A;  4XLP F;  3TOB A;  4M6Y A;  1MH4 A;  2Y31 A;  2O61 A;  1VQ9 I;  1D5Y A;  4C2U A;  2RRE A;  1I6X A;  2P8T A;  4BQA A;  4LK1 F;  3CCE I;  3L2W A;  5DM7 F;  2XGE A;  3BJO A;  3H35 A;  3OIQ A;  2OCE A;  4YEJ A;  5IOZ A;  2COB A;  4Z2Y A;  4QLC U;  4L0Z B;  3ZR8 X;  4HQE A;  2EIM H;  1HST A;  4PJL A;  1K83 J;  1OYY A;  4AYB N;  2E2I J;  3FMQ A;  2WAQ A;  3M07 A;  1X58 A;  2HWV A;  1B72 B;  4KT5 C;  2E5Z A;  5DCM B;  1MMS A;  2Z5U A;  2HNH A;  2QSG X;  3DV8 A;  1W4M A;  2TDX A;  5EGO B;  4LIU A;  2DMP A;  2G7U A;  4KFC A;  2VT2 A;  5IYC J;  1Z67 A;  2R7T A;  3J81 Z;  4PDK A;  1JKQ C;  2RQP A;  1W0T A;  3S1N J;  4IXA A;  2VBW A;  3CUQ B;  3RKY A;  3S17 J;  2BHY A;  1PUE E;  2KL4 A;  2OQG A;  3DWL E;  1FSE A;  1XG1 A;  2H94 A;  3WTT C;  2ZFW A;  3FHZ A;  4XSX F;  1PUF A;  2NXN B;  2QF7 A;  4LLN A;  3TMO A;  1IN7 A;  2ZME A;  4KJZ A;  2EV0 A;  3WG7 H;  1XTA A;  3ZMT A;  1GDT A;  3LFK A;  3ZMV A;  3G3Z A;  3DBR B;  4XLE A;  1FOK A;  2QSF X;  3PM1 A;  1RKT A;  1IXR C;  1V55 H;  2FMY A;  4ZDO A;  2WB1 A;  3CLO A;  5GPA A;  2E1M C;  1J0R A;  3ASO H;  4XRM A;  1QNT A;  2H6B A;  1W0U A;  3PNY A;  5FD5 A;  4AID A;  5F1R A;  3F0C A;  1TP4 A;  3PSI A;  2F5E A;  5HOO A;  2W57 A;  3BZC A;  3J80 Z;  5LFA A;  2VQG A;  3DEW A;  4J00 A;  3KZY A;  1BOB A;  4WXH A;  2MAB A;  2L02 A;  2ELK A;  2J5O A;  3V8L A;  1T6S A;  2JRM A;  2E2H J;  3HRM A;  2CQN A;  1POG A;  3D5R C;  4L9J A;  1ITY A;  2CW7 A;  2DLL A;  5EYR A;  1AWC A;  3JRE A;  3PNV A;  4YG2 F;  2HEO A;  3S15 J;  3HSR A;  3OWT A;  4YFN F;  3PSF A;  3PJR A;  2UUZ A;  4MEY F;  2FD5 A;  1IJW C;  4Y15 A;  2XSD C;  3RKQ A;  3HUG B;  5J4V A;  4BDZ A;  4Y52 J;  4LMY A;  3MKZ A;  2E7W A;  2W24 A;  2GXA A;  1N25 A;  1V54 H;  3BDD A;  2FRH A;  2M3A A;  1HW1 A;  3KP3 A;  3A2K A;  3FXK A;  3BJ6 A;  2DDA A;  2L9R A;  5KVR A;  2LK2 A;  3Q0V A;  4XKB A;  1IV8 A;  3NEU A;  1ETV A;  1LJ9 A;  3EPZ A;  3EYY A;  3H0D A;  4NDL A;  5KCM A;  2HPM A;  2EJR A;  1XX5 A;  4FE7 A;  3SEQ A;  2LTP A;  3MZH A;  5M5Y J;  1TTY A;  2R7Q A;  1W5S A;  2E1M B;  5FLM J;  1CQT A;  1PJR A;  3C3W A;  1Q1H A;  4HX7 A;  4BE2 A;  4M3D A;  4XK4 A;  1X1B A;  3REO A;  3WTX C;  3FMR A;  1TZL A;  4BBR J;  1Y39 A;  2LBF B;  4BUP A;  1LE8 B;  1IN6 A;  5BPD A;  3BR6 A;  2L54 A;  1IXS B;  1HLV A;  1NG7 A;  3I3L A;  4ZH4 F;  3LQR A;  2V4J C;  3WE3 A;  1R6R A;  2R5Y A;  1JJ6 C;  4NBQ A;  1RC9 A;  3BTI A;  3OS1 A;  1LFB A;  3JTH A;  2HOS A;  2DYS H;  2E1O A;  3OYI A;  1SFE A;  4KYW A;  1A04 A;  4HEA 2;  2JA8 J;  4YFX F;  1ONV A;  4GDF A;  2IJL A;  2OJE D;  4JX4 A;  3CDI A;  3ABT A;  4XLN F;  2OTJ I;  4HA8 A;  1AKH B;  2QEX I;  2CRG A;  3OV8 A;  5JVG F;  4HQM A;  1VQP I;  5HDG A;  3K70 D;  2GM4 A;  4UHT A;  2HKO A;  5LBQ A;  1YJN I;  4CSW A;  4ZYH A;  1T33 A;  5K5Q A;  2VN2 A;  4B1R A;  4EJT A;  1ZRE A;  4YIF A;  2BVM A;  1BA5 A;  4Q5S F;  2L5Q A;  1O3S A;  1TT0 A;  1IXC A;  4LLG F;  1HC8 A;  2CV2 A;  5H2F C;  2FQ4 A;  1LQ1 A;  3M3Y J;  2NVQ J;  1A6I A;  2EIL H;  2I5U A;  2IXS A;  4IKF A;  3BPX A;  1IRZ A;  5CVI A;  4HX4 A;  3BR1 A;  3AAF A;  2LSO A;  4CUG A;  1E3H A;  1K78 B;  3R6S A;  4BXX J;  1ETQ A;  1E0E A;  1XCV A;  3SXY A;  2BYV E;  2F5F A;  2W25 A;  4FQG A;  2BOL A;  1LFP A;  3S3M A;  2Y0M A;  2HZD A;  2DMT A;  2DA3 A;  4WXC A;  2KZG A;  4A0Z A;  3O8H A;  2K85 A;  3CJR B;  4J01 A;  1TQP A;  4BDY A;  3GTM J;  3DEU A;  3CDH A;  4RAZ A;  1E17 A;  5FFZ A;  5LD2 C;  1R49 A;  3BG5 A;  1DQU A;  2P7V B;  3I5U A;  3BT9 A;  3FXJ A;  1AOY A;  3DQV C;  2KKO A;  3LA2 A;  5C4J J;  2GOM A;  3JRA A;  4Y17 A;  4RS8 A;  2P5V A;  3CMM A;  4M3G A;  3M1C A;  2EZL A;  3DBL B;  2BV6 A;  4XLA A;  2K40 A;  5FKK A;  3Q0W A;  3R0A A;  4AIJ A;  3RTR A;  3FX3 A;  1VF9 A;  3MN2 A;  2NS7 A;  3CCV I;  3F72 A;  1QA6 A;  4M6X A;  2K5C A;  4HV6 A;  4XL9 A;  5F0C A;  3EET A;  3OYK A;  3HPG A;  2GIZ A;  3JRI A;  4FE4 A;  4WCG A;  1FJL A;  2OUM A;  2HYG D;  3IUO A;  2JVG A;  3CES A;  3HRT A;  4RAF A;  5FRO A;  2IA1 A;  1NK3 P;  3OYD A;  1UZC A;  1UEL B;  3FIS A;  5B1B H;  2WAQ N;  2O5R A;  3IHU A;  1FY7 A;  5ICE A;  2R92 J;  2JSC A;  1ODD A;  1YG2 A;  2E7X A;  1X4O A;  2MH9 A;  4B3A A;  2C6Y A;  4ENK A;  2Q2E B;  3H3Z A;  2YPR A;  5C3E J;  3ISP A;  1YI2 I;  3MFK A;  4X6A J;  1KQ0 A;  2F5D A;  2FBK A;  2N8G A;  4A2U A;  2M0C A;  3A1Y A;  1T08 B;  2HDC A;  2NS0 A;  4RM3 A;  1OQY A;  3RPU D;  2EIN H;  3ZQ7 A;  2W4S A;  4RGX A;  3IRR A;  2VC1 A;  4AC0 A;  2IS2 A;  3O6B B;  4ENJ A;  3MEX A;  2M7A A;  2V26 A;  2FA5 A;  3GZ6 A;  5J1R A;  2DTZ A;  3S3O A;  1RPW A;  5DD4 A;  1SC7 A;  3U2R A;  4RAG A;  2XB5 A;  2HOE A;  1IUY A;  3C2B A;  5IT9 K;  3X2Q H;  5B3S H;  3CME I;  4XQF A;  3K4K A;  3L1P A;  5CVU A;  1F9N A;  4DW6 A;  4E6K G;  3ULQ B;  4XOT A;  1JTX A;  3L2Q A;  4M74 A;  2A6T A;  3VSL A;  5FJ8 J;  3JRF A;  3TED A;  2JZY A;  4A5N A;  1MBK A;  2M4G A;  3G1O A;  1O3R A;  1R5G A;  3IL2 A;  2BW3 A;  4FX0 A;  2R7F A;  1ZQ3 P;  1J59 A;  4EAT A;  3U1K A;  4V2F A;  2E60 A;  3OYB A;  2DDB A;  4IL6 C;  2W85 A;  4HW0 A;  2HR3 A;  2B7E A;  5IOY A;  3DXJ F;  2FF4 A;  1BOA A;  3BWG A;  2BY0 A;  1T95 A;  1IDY A;  4U87 A;  2DA5 A;  3E6B A;  1XMX A;  5J1Y A;  3RDI A;  3GTG J;  4B09 A;  3HZJ A;  2VIX A;  4P9U A;  3LST A;  2K3F A;  4BEH B;  2YU9 J;  5J6X A;  2OU2 A;  1BM9 A;  2VBX A;  4A3L J;  2CS3 A;  5GPC A;  3L7W A;  3AG3 H;  3LWF A;  4ZZL A;  1J75 A;  2JN6 A;  2KIF A;  4XLH A;  3A01 B;  2KMU A;  1CGP A;  4G7O F;  5E3L A;  1FBS A;  1L0O C;  3DP7 A;  1V4R A;  3M7G A;  4A3M J;  1RR7 A;  2HFH A;  1IN4 A;  1XDS A;  1ORK A;  4EJV A;  1MSE C;  5EZH A;  5ILV A;  3J7A Y;  2WV1 A;  2H1L A;  2M5W A;  1T8I A;  3OYA A;  2FUG 2;  2JPB A;  1IW7 F;  2ZME C;  2L9V A;  4Z6Y A;  2ZJP F;  5JR3 A;  2VLA A;  1OIS A;  2OF7 A;  1A31 A;  4OIO F;  3LA7 A;  2QBY A;  3OYN A;  3T5X A;  3V4G A;  3V8J A;  3BTL A;  4OU0 A;  3AL0 C;  2QLZ A;  5ICC A;  2KRH A;  1QVU A;  1OCP A;  2RKH A;  2DJN A;  2YX7 A;  4PGH A;  4BQQ A;  3AG1 H;  5L3E A;  1T0F C;  2OCC H;  2R7R A;  4A6E A;  2CUE A;  4D0P A;  1QO0 D;  4IO9 F;  1A36 A;  3ZOB A;  1MD0 A;  2DPD A;  4L5E A;  1ZKG A;  2QQB A;  4G94 A;  3TW6 A;  3GEZ A;  2WAD A;  1M1E B;  2PX9 A;  3K7A J;  1VQ6 I;  2W82 A;  4N9H A;  1R23 A;  5HS8 A;  3KP2 A;  1DUX C;  5L3C A;  4LB5 A;  2W48 A;  2Y0S N;  3HHH A;  4IZZ A;  1T39 A;  3FXO A;  3E5X A;  1B4A A;  5F04 A;  4I2O A;  4CHU A;  4F55 A;  2NNN A;  3CCY A;  3BR0 A;  2P7C B;  2X6Y A;  2XF5 A;  5BQT A;  4F3Q A;  2ECC A;  4XLC A;  3F23 A;  5L3B A;  2AHQ A;  3OYC A;  3WE2 A;  1ZRF A;  1O57 A;  1UJ8 A;  3CCQ I;  3ZMZ A;  1LVA A;  2XDV A;  3BCA A;  1D3Y A;  3OR1 C;  5FKO A;  2AXL A;  2O6G E;  3OYM A;  5HNF A;  5TIS C;  1F4K A;  4HLY A;  1PUF B;  4M9S A;  3WU1 B;  4AUX A;  2ZME B;  4KMF A;  1YYV A;  2IGN A;  2KPM A;  1O3Q A;  2DK8 A;  1OYW A;  3FK7 A;  3HG9 A;  3RQ4 A;  2P6S A;  3AL0 B;  1EH6 A;  4BL0 B;  2OZ6 A;  3HEF A;  2DCE A;  4DBQ A;  1IUF A;  1EKE A;  2A5Y B;  3CQZ J;  3VWB A;  3HM5 A;  4DNC A;  1V5E A;  4I99 C;  1ZGJ A;  2KQR A;  4CZC A;  1W5T A;  2LNB A;  4XBF A;  4D9J A;  1FLI A;  2CFO A;  3GO5 A;  4KT6 A;  3Q9S A;  4MTE A;  4YEL A;  4Q48 A;  3G71 I;  1ENH A;  3ZRG A;  1R58 A;  2DO7 A;  4ZTF A;  5ILS A;  1K4S A;  2MH2 A;  3K4J A;  4LOC A;  5JVT A;  1YRN A;  1B9N A;  3HYI A;  3UKG A;  2WV0 A;  2LFB A;  5HLH A;  3D1N I;  3S32 A;  2ZB9 A;  2VQL A;  3F9K A;  3K4C A;  3DF8 A;  2VAS A;  2WTE A;  3TGN A;  1SVO A;  5LHH A;  2JT1 A;  1Z0X A;  4JP0 A;  3W2A A;  1W36 D;  2OTL I;  5EDN A;  4I76 A;  4KA4 A;  2VKD A;  4XMY A;  4PJJ A;  3LSJ A;  1ZH5 A;  1YS7 A;  3GZ5 A;  3KYC B;  4BHC A;  1R9T J;  4ABZ A;  1L3L A;  4GRI A;  2LOO A;  3F8F A;  3E3V A;  3S8P A;  1T2K A;  2L7M P;  2LR8 A;  5J8C A;  4I6Z A;  4BS9 A;  5GAG J;  2QUF A;  4FAS D;  2Z9O A;  2CH0 A;  4W97 A;  3KLN A;  4GYI A;  1UAA A;  2XGX A;  2EFP A;  2E36 A;  4G6Q A;  2VE9 A;  3HKZ A;  1VTN C;  1QZZ A;  1SAU A;  2WAF A;  5M5W J;  1KGS A;  2X1D A;  1MNE A;  3WG9 A;  1FNN A;  2A05 A;  3KEO A;  2HKX A;  2L9N A;  4LFU A;  3P5J A;  4QPO A;  3IKV A;  2M2E A;  5GAD J;  2ID3 A;  1XGO A;  1RIO H;  4A3G J;  1QVT A;  1WKM A;  3PL8 A;  2HTS A;  1XSX A;  2XGC A;  4HPQ A;  2VOP A;  3B02 A;  2YUS A;  2M34 A;  4RA2 A;  3IH4 A;  3QOD A;  3M8E A;  2FJ1 A;  1Y1W J;  1G3W A;  3TQN A;  1BW5 A;  2G9W A;  1IDZ A;  4MLO A;  4XIC A;  1FP1 D;  1WI9 A;  3F8M A;  3PO2 J;  1KU9 A;  4ZTJ A;  2R5Y B;  1ZK8 A;  2PJP A;  1BBY A;  3CMY A;  1JTY A;  3SQN A;  3ZXS A;  2DQL A;  1VFC A;  1HQC A;  1E3O C;  2Q8K A;  4PFP A;  4CO8 A;  4C9Y A;  2LKS A;  1XSV A;  4DJA A;  2VJ5 A;  4FIS A;  1P2F A;  1OMI A;  1ZLK A;  1FWZ A;  2EFQ A;  3CJQ B;  2KP6 A;  2D2W A;  3HOS A;  2LRE A;  1UG0 A;  1IZ1 A;  3J80 K;  3ERE D;  5AON A;  2VPL A;  5M3F J;  4GFB A;  4N9I A;  2CMP A;  3C18 A;  3CCU I;  3HRU A;  1DP7 P;  1P4W A;  3GTJ J;  1SVM A;  1Z1D A;  5HLI A;  3QYF A;  1P92 A;  5DUK A;  3OYL A;  3HOW J;  3E5U A;  1A5J A;  1BI1 A;  3GME A;  3OOP A;  1IC8 A;  1FPQ A;  1IO2 A;  4U7B A;  1RUO A;  2JWT A;  2LDU A;  3BC8 A;  4DQ2 A;  1FBQ A;  2XAF A;  2NVU B;  1KU7 A;  4BJT A;  2PFB A;  4HF2 A;  4H0E A;  3IKT A;  2E71 A;  2EV6 A;  2K27 A;  3G1M A;  3T1B A;  2HDW A;  4ON0 A;  3AG2 H;  2DYR H;  2DT7 B;  3FWE A;  2MC3 A;  2FE3 A;  1ZAR A;  4QPQ A;  2KIM A;  3GW2 A;  1MMN A;  2HXI A;  2HVS A;  3A0B C;  2BY3 A;  4AIK A;  1BIB A;  4KN7 X;  1X1A A;  1U5T C;  4MTD A;  4KIS A;  2VT3 A;  4IPA A;  4I0A A;  1LUJ B;  5LLQ A;  4HF0 A;  1OFC X;  4XRF A;  3OIO A;  3QP6 A;  2X6W A;  5CPR B;  3CCR I;  1IGN A;  1LPQ A;  2NOJ B;  4BYY A;  1BJA A;  5D5X B;  1JKO C;  2VXD A;  2K9Q A;  2LYC A;  1FC3 A;  1UHM A;  2H8R A;  2WC2 A;  1PVE A;  2ZXJ A;  2Z16 A;  4ZC3 A;  1XB4 A;  1FSH A;  3E7L A;  1G3S A;  1HCR A;  2DFI A;  2LG4 A;  3OY9 A;  2LP0 A;  3VOE A;  5FLV A;  1Z77 A;  1VQ7 I;  1DU6 A;  1HKT A;  4OIP F;  2IS6 A;  3VB2 A;  4FTH A;  2O0Y A;  2ZXH A;  3JAM Z;  1UST A;  3IH2 A;  3H1C A;  1BIA A;  5FRN A;  1P7I A;  3IWF A;  1X1C A;  3CZ6 A;  3CMA I;  5B5E C;  2ISY A;  3F6V A;  3H9Q A;  1LEA A;  3BR2 A;  3KP6 A;  2EFN A;  2NVY J;  2DN0 A;  2R7D A;  1TWF J;  1FOX A;  1VND A;  2ZSI B;  3ZCO A;  2XKO A;  2CUF A;  3IAS 2;  2RN7 A;  5HDN A;  3O3K A;  1FMW A;  3LSI A;  4HAM A;  4R1H A;  1GV2 A;  3ZN1 A;  4F92 B;  2QZ8 A;  4E7H A;  1PP8 F;  1MGT A;  1WPK A;  4IHT A;  4GXO A;  3I71 A;  4CZZ A;  2G7H A;  2HQA A;  1IN8 A;  2RGV A;  4EVI A;  1DGR M;  3A03 A;  1BW6 A;  4HSR A;  2AXT C;  2O8X A;  4HYE A;  1T0F A;  4GCV A;  3K1M A;  5J3L A;  4G12 A;  3HSE A;  4MGR A;  4MQV A;  2R7U A;  1U9O A;  1R22 A;  4B48 A;  1ZG3 A;  1Z21 A;  2LY1 A;  1XMA A;  2ZJ2 A;  4KUM A;  4TV7 A;  3F8N A;  5LGN A;  4IHY A;  2YS9 A;  1ETW A;  3M9A A;  5GP9 A;  2DOA A;  1WJ5 A;  4NUB A;  2DTR A;  5TJJ A;  4DBR A;  2MLG A;  4RGU A;  2VL8 A;  1FIA A;  1DDN A;  1B9M A;  2ZXI A;  1ZHF A;  5LGT A;  2EA2 A;  3FK6 A;  3NWS A;  4S05 A;  3R0J A;  3C2H A;  5M5X J;  2XUB A;  3W6K B;  4ENM A;  3E6C C;  4HV5 A;  3S1R J;  4AM3 A;  5JLW A;  2Z1D A;  2GXB A;  3C2G A;  1BR2 A;  3TDZ C;  5BMZ A;  5D8L B;  2KJC A;  4A3E J;  1ACI A;  1FX7 A;  1TLH B;  2BW3 B;  1JT6 A;  4GO1 A;  2VKH A;  3FDY A;  1Z6R A;  1PYV A;  2NYX A;  3M4O J;  1OCR H;  1MBH A;  3K10 A;  4HF1 A;  5EEA A;  3WU0 A;  2A6H F;  1R7J A;  3QRF F;  5BNG A;  3COA C;  5F27 A;  3HOX J;  2STW A;  3LQQ A;  3KFW X;  2RAE A;  2G0E A;  4NNJ A;  4BXF A;  1TQM A;  4OMZ A;  1S3J A;  3GVA A;  4B43 A;  4A3C J;  2XV4 S;  4R8H A;  3S2H J;  3HB9 A;  4UUV A;  4ESF A;  3SZP A;  3K4B A;  5FKM A;  2FOW A;  2M45 A;  2PN6 A;  2V9K A;  5DDG A;  2P81 A;  4D7N A;  2A69 F;  3KEY A;  3H5N A;  3MKY B;  4HLX A;  5K5O A;  3G4S I;  2UXN A;  3KZZ A;  2F4I A;  1B8I A;  1ZEL A;  2OBP A;  3H5R A;  2IGK A;  2PMZ A;  2DA7 A;  2GA1 A;  1YJ9 I;  2DA4 A;  4XR6 A;  4YFK F;  2P5L C;  3IRQ A;  4PFO A;  3NRV A;  1QQI A;  2M4K A;  1R1T A;  2DI3 A;  4L5I A;  3TW7 A;  2M8G X;  2X0L A;  3ZQQ A;  2QBY B;  3LSM A;  5GAE J;  2Y30 A;  2RDP A;  3BTC A;  3BQZ A;  3W2V A;  3ERM A;  1JI8 A;  1KU2 A;  4CCK A;  4HST A;  2R7V A;  3BY6 A;  4YIR X;  4M71 A;  1OCC H;  1F36 A;  2QCO A;  1JHH A;  2STT A;  5K7F A;  1FOW A;  3OS0 A;  1E3P A;  1VQN I;  3UNG C;  2ZBK A;  4PJN A;  1TBX A;  1ZGA A;  5DV5 A;  1BC7 C;  1R4N B;  1SMY F;  3CCM I;  1MNM C;  1U6G A;  2L01 A;  2WY7 Q;  3RZD J;  1LB2 A;  2M0M A;  5HS7 A;  2BHZ A;  2COM A;  2JSP A;  3ASN H;  5JHF A;  1FOY A;  1HDP A;  2E5N A;  4CYD A;  2EH3 A;  4CH7 A;  1DGW Y;  3FKI J;  3PUF A;  1YS6 A;  2IAI A;  1N78 A;  4UVA A;  4PZJ A;  5LHI A;  1KYZ A;  3K4L A;  3DPU A;  2GLO A;  1BL0 A;  3K4M A;  5F6F A;  2KZV A;  2XF6 A;  2Z2S B;  2PMH A;  1ETY A;  5E3M A;  2BY2 A;  5CKT A;  3HGG A;  2CYY A;  5E1Z B;  4LJZ F;  5CVV A;  2KIU A;  3FXR A;  2JRT A;  5KHD A;  4RB3 C;  2EFO A;  3SHF A;  3WTV C;  2B9S A;  2VJ4 A;  3I9V 2;  2DXI A;  1MJB A;  4KDP A;  2RC4 A;  4RLF A;  1DU0 A;  2XAQ A;  3S1Q J;  1OCO H;  3WTU C;  3T8T A;  3OYE A;  1X3Z B;  5CJ9 A;  3MMY B;  2VBZ A;  2XRN A;  2Y9Y A;  3HRS A;  2Y2Z A;  5HLT A;  4O6J A;  3I55 I;  2HZT A;  3KET A;  4NC6 A;  4XKV A;  3JRB A;  4IF4 A;  2JA7 J;  1REP C;  3ABU A;  4RGR A;  4PK4 A;  5KAF C;  3CCS I;  2MA3 A;  2MD0 A;  1G59 A;  1U9N A;  2FBH A;  4LK0 F;  5LEJ A;  3J7A O;  4PUS A;  1WJB A;  2HGC A;  2A61 A;  2IW5 A;  4XN0 A;  4EJW A;  2JMW A;  2DK5 A;  3HOV J;  4ZJZ A;  2HDD A;  2LH9 A;  3HTU A;  4RLQ A;  1YRN B;  3BCB A;  3SFZ A;  3ZGK A;  5M3M J;  4BQO A;  1Y0U A;  5FB2 A;  4A3B J;  1UHW A;  2ACJ A;  3KYD B;  4MHG A;  2IVM A;  1VQ8 I;  2Z33 A;  4G6T B;  1E2X A;  5L3D A;  1OR7 C;  2K9S A;  5E3N A;  2BZT A;  4LGW A;  4WK8 F;  1K6O A;  1MBE A;  2EZK A;  3VDX A;  2XAS A;  4AU7 A;  2LD5 A;  2RNJ A;  1WJE A;  5B1A H;  1U8B A;  1J7K A;  2CUJ A;  3W2W A;  1IRG A;  3L09 A;  2GZW A;  2OC6 A;  1IV6 A;  2ELH A;  2V9P A;  1SMT A;  2W7N A;  3S1M J;  1YW7 A;  1D1A A;  2DMU A;  1K6Y A;  2R3S A;  1QHH D;  2R5Z A;  3RKW A;  3H36 A;  1SEU A;  2M8E A;  4OIN F;  3JRG A;  2JA5 J;  1ZR4 A;  2Q0O A;  2D1H A;  3IAM 2;  1RNL A;  3OOU A;  2F4M B;  4M9Z A;  3TP0 A;  1Z05 A;  1KQ9 A;  3K69 A;  3W3C A;  4BU2 A;  5A2Q Z;  3H3V K;  3L00 A;  4EJU A;  4O3M A;  3QU3 A;  4E7I A;  3I4P A;  1JHF A;  5HNH A; 
#chains in the Genus database with same CATH homology
 1U5T A;  3ML6 A;  1LDK B;  2OD5 A;  3CUO A;  2PEX A;  4EM0 B;  1UB9 A;  2DT5 A;  3I53 A;  1P6R A;  2K86 A;  2V79 A;  1JXS A;  1QBJ A;  4KIB A;  1R1U A;  2DQR A;  1MKM A;  2EB7 A;  1F5T A;  5FGM A;  3GFM A;  4A0X A;  5BOX A;  2J5P A;  4WWC A;  3I59 A;  2A07 F;  1XGM A;  4IHS A;  2QQA A;  3PQJ A;  4YII A;  5LRS A;  1HKS A;  2D1V A;  4I98 B;  1XDU A;  2Y75 A;  2FBI A;  4BH9 A;  3R4K A;  2PG4 A;  2QWW A;  2AS5 F;  1D8J A;  3F8B A;  4M72 A;  3R61 A;  3V7R A;  5EEH A;  1QPM A;  3WGH A;  1TW2 A;  5ILU A;  3G73 A;  3FM5 A;  1ZN2 A;  1OYI A;  1Z7U A;  3MWM A;  1I27 A;  4KIC A;  1U8R A;  5D8K B;  1YW9 A;  2FXA A;  3FXQ A;  4EGY A;  4HOB A;  5K5R A;  3QU6 A;  2GXG A;  3GUD A;  1ZG5 A;  4LLL A;  3V7S A;  1TQI A;  3FF5 A;  3D5L A;  1D8K A;  2FOK A;  2GQQ A;  4WX9 A;  5EEG A;  1Z6T A;  5HVQ C;  5AIQ A;  2NRA C;  1FYM A;  2OAZ A;  5AIP A;  3M1E A;  2F2E A;  1R1V A;  2HTJ A;  5E1X A;  4I0B A;  2O3F A;  4Q47 A;  4G8X A;  2WWY A;  2EA4 A;  2YX4 A;  2EK5 A;  3GFL A;  5CLS A;  2Z3Y A;  3E6D A;  3F8C A;  4I7H A;  4HBL A;  5BS6 A;  3D0S A;  3FMS A;  3HSF A;  3GFJ A;  2K4J A;  4U0V A;  1S6L A;  4E70 A;  3C7J A;  2CG4 A;  4L5J A;  4RGS A;  3HOT A;  5LHG A;  4KNY A;  4CDG A;  2UWM A;  5LRR A;  4EM2 A;  4ESB A;  1PDN C;  2P4W A;  4PGG A;  1MJA A;  1HW2 A;  4I01 A;  1RUN A;  2OZU A;  4U7D A;  3JSO A;  1SFX A;  1Z9C A;  1GHC A;  3RPQ A;  3JAM K;  3O2P E;  3EDP A;  1GXQ A;  3ZPL A;  2IT0 A;  5L3F A;  3HHG A;  3CJN A;  3E6M A;  4WF2 A;  3MZY A;  2DPU A;  4NHJ A;  4L18 B;  1XD7 A;  2KJB A;  3TDU C;  3FXU A;  2GAU A;  4UVB A;  1GVJ A;  1OR7 A;  3CTA A;  5TRD A;  3K9T A;  4BHP A;  3GX4 X;  1FZP B;  1XSD A;  1XMK A;  3M8F A;  2P5K A;  5H6Q A;  2LF8 A;  1S7O A;  2V9V A;  4EQQ A;  2LKP A;  1DPR A;  5D4R A;  2QQ9 A;  3TO6 A;  2GA2 A;  1J2X A;  1HW5 A;  2VBY A;  3WGI A;  3TOA A;  2A68 F;  1KQ8 A;  1OKR A;  4EJO A;  3BRO A;  4K2E A;  2ZKZ A;  3F22 A;  1UCR A;  3EUH A;  4BNC A;  1RZ4 A;  2XVC A;  1U3E M;  5DUI A;  4G7Z F;  1MDM A;  5E1W A;  2VXZ A;  5BPI A;  3ZP5 A;  4CXF A;  3LAJ A;  1YQA A;  1OPC A;  2XAJ A;  3CUQ C;  5FLX Z;  2ADU A;  4ENN A;  2V1X A;  4A0Y A;  2CWE A;  1KYW A;  3R60 A;  3ZMS A;  4KN4 X;  3GYH X;  3V8K A;  2FQ3 A;  3I54 A;  2PI0 A;  4L9T A;  1W7P A;  1WWX A;  5D5U B;  3KEQ A;  1ON2 A;  2RVC A;  5E17 F;  4CGZ A;  3E97 A;  1HKQ A;  2M30 A;  5L3G A;  4ZYD A;  1MZB A;  1STZ A;  2PQ8 A;  3B73 A;  4LG0 A;  5D5W B;  2QEN A;  4IRG A;  5ERI A;  4G7H F;  1FP2 A;  2FNP A;  2W84 A;  3QOP A;  4O5V A;  1Z91 A;  1XGN A;  2EV5 A;  2GWR A;  4L0Y B;  3L9F A;  2H6C A;  1CF7 A;  2YR2 A;  2H27 A;  4RB1 A;  3H3U A;  3JTG A;  4G9Y A;  4PCQ A;  1U5T B;  1C0W A;  4UNO A;  3P9I A;  2MD5 A;  4U0Y A;  1KA8 A;  3GWZ A;  1R5H A;  4FT8 A;  3RKX A;  1BI3 A;  2VOD A;  2ZCW A;  5HDK A;  1B1B A;  1YIO A;  3K1P A;  1YW8 A;  2H09 A;  5H20 A;  2Z99 A;  3P9K A;  5JI6 A;  1MJ9 A;  3L2C A;  2OQR A;  3KP7 A;  5E20 A;  4R79 A;  3CO6 C;  4QWQ A;  5F64 A;  3I59 B;  3LA3 A;  3GLX A;  1T98 A;  1LDJ A;  3QPT A;  1JGS A;  1UFM A;  5FD6 A;  4L9N A;  1G3T A;  4HDU A;  1B6A A;  3MQ0 A;  2BGC A;  1H0M A;  3ZN0 A;  2XHK A;  5FO5 A;  2A6E F;  1ZRC A;  4P55 A;  2YU3 A;  2B0L A;  4M9X A;  4OMY A;  1QGP A;  5FFX A;  2HQR A;  2FML A;  2O03 A;  5E18 F;  4S04 A;  1WQ2 A;  1FBU A;  4KIF A;  3C1D A;  4JBA A;  1ON1 A;  2X4H A;  2HQN A;  2K4B A;  1K7A A;  1FT9 A;  1TW3 A;  2RV8 A;  3ELK A;  5ICF A;  5A2Q K;  2M87 A;  2XKP A;  2MLK A;  2PLY A;  3K0L A;  5DD8 A;  1O7L A;  4NB5 A;  3MAJ A;  4AIH A;  4XSZ F;  4IVN A;  1YFH A;  1I1S A;  4BAY A;  3JSP A;  2JTV A;  2YSR A;  4AWX B;  3JW4 A;  2K02 A;  4U0W A;  4EM1 A;  3K2Z A;  1B59 A;  2UXX A;  1TNS A;  1F1Z A;  4N0B A;  3EQL F;  1D5V A;  1TNT A;  1SAX A;  4CIC A;  3KP4 A;  5ED4 A;  1QZY A;  1IRF A;  3KLO A;  1IN5 A;  3U9G A;  2BBY A;  5HLG A;  1R00 A;  2OA4 A;  3I64 A;  4NQW A;  1WRJ A;  4HDV A;  2NAZ A;  4A12 A;  2BE5 F;  3QAH A;  5CYV A;  3IC7 A;  1IF1 A;  2DW4 A;  1BI2 A;  3EYI A;  2IA2 A;  1S29 A;  1YTY A;  3ECH A;  2DU9 A;  4KIG A;  2L4M A;  3VOD A;  2CO5 A;  5D6E A;  1KU3 A;  3WTW C;  3P7N A;  5DCM A;  3PFI A;  4RB0 A;  2E1C A;  1HXD A;  3FZV A;  2QYO A;  1U78 A;  3CUQ A;  1FYK A;  3HIF A;  4MQ9 F;  5CVR A;  4A6D A;  3MCZ A;  5IT3 A;  3F21 A;  3T8R A;  2ZO4 A;  4HX8 A;  4P9F A;  4U88 A;  3I58 A;  4ZYG A;  2FNA A;  4Q4Z F;  3DKW A;  1W7P D;  2F5C A;  3K1N A;  3GFI A;  1SD4 A;  3P9C A;  5LGU A;  3DPL C;  2P6T A;  1HBX G;  4G6D A;  1G4D A;  4FHT A;  3KP5 A;  1LDD A;  1XN7 A;  3ZMU A;  3QP5 A;  2ZNY A;  1ZYR F;  2IP2 A;  1J5Y A;  1YO5 C;  3BOQ A;  1USS A;  4UV9 A;  3HUG A;  2D45 A;  1ZRD A;  3SZT A;  1PP7 U;  2L3D A;  4AVP A;  2CW0 F;  4WXD A;  2V1U A;  1LNW A;  1LEB A;  1WSU A;  3GF2 A;  3BZ6 A;  3W6J B;  5J8F A;  5D6F A;  3VEP A;  4ZYE A;  1O3T A;  2XAG A;  1MDM B;  4UV8 A;  2EFW A;  1X3U A;  4IRH A;  3IWZ A;  3BP8 A;  1XCB A;  2XIG A;  2CGP A;  3ROU A;  2MBF A;  2XRO A;  4JK1 X;  3TKY A;  2M1B A;  1SD6 A;  1V3F A;  4ETS A;  4ZZD A;  3HTS B;  4LB6 B;  1IAW A;  1W7P B;  5JFR A;  2IA0 A;  4EV0 A;  1FYL A;  3CO7 C;  3RI4 A;  2CQK A;  2QM3 A;  3T0Y A;  1ZG1 A;  2PMU A;  3DFG A;  2VON A;  1SD5 A;  4UXN A;  4LG0 B;  3RJP A;  4HZF A;  5ICG A;  5K1Y A;  1H9T A;  3GXO A;  4MEX F;  4I09 A;  2JPC A;  3RYR A;  3PQK A;  5HS9 A;  2VE8 A;  2ISZ A;  3RIR A;  2L4A A;  1CF7 B;  5DYM A;  3LAP A;  4ESJ A;  5DEQ A;  5H6R A;  2FU4 A;  5IT9 Z;  1G6N A;  3DPT A;  1I5Z A;  1O7F A;  2ESH A;  2VOO A;  4OOI A;  1EH7 A;  5E8G A;  1K78 A;  4GYG A;  1P4A A;  3ZMD A;  1EH8 A;  2NNY A;  1EV7 A;  1K79 A;  3KCC A;  3WGG A;  1ZLJ A;  5E8I A;  4F7Z A;  3RYP A;  2QVO A;  4IJA A;  3F6O A;  4GGG A;  1XGS A;  2Y48 A;  4AD9 A;  1RI7 A;  2IRF G;  5FLX K;  3V7C A;  1P4X A;  1BI0 A;  4OIQ F;  5D4S A;  2DAO A;  4UVC A;  2PBI A;  2V1D A;  2FSW A;  2EWN A;  1I1G A;  3BJA A;  2BEO A;  2E1N A;  3NQO A;  3FM3 A;  4EGZ A;  3Q9V A;  2VC0 A;  1JE8 A;  4ASN A;  3Q5F A;  4P96 A;  4A5M A;  3N4M A;  2K7L A;  2Q2E A;  4RB2 C;  3ECO A;  3TO9 A;  2LF7 A;  3E5Q A;  1G3Y A;  2CFX A;  4P5O A;  1U2W A;  5KK1 A;  3TO7 A;  3WTS C;  4KMU X;  1SD7 A;  3J81 K;  4Y13 A;  1S8N A;  3BPV A;  2FEZ A;  3I0T A;  1H9G A;  4B8X A;  2CSO A;  4RAY A;  3WOD F;  3VFZ A;  3N97 A;  4OIR F;  2IPQ X;  1J9I A;  2KRF A;  2HS5 A;  4JQF A;  1YLF A;  1R36 A;  1BN5 A;  1BC8 C;  5LEK A;  2V6C A;  3S2W A;  4M73 A;  2A3S A;  4EMS A;  3F3X A;  2HYF A;  5CVJ A;  1HSJ A;  4IRI A;  4LD5 A;  1ULY A;  3QPH A;  5D5V B;  2ETH A;  3KE2 A;  1NHA A;  2DBB A;  2ESN A;  6PAX A;  4I02 A;  3WTY C;  5JHU A;  1T38 A;  1GXP A;  2XAH A;  5DCF A;  3WTZ A;  2GIV A;  1ZAO A;  3H92 A;  1SFU A;  2UZK A;  2ZNZ A;  4L9V A;  4MNU A;  4BXU A;  3U1D A;  3RPU A;  4BHB A;  1S7A A;  1DPU A;  4XLP F;  3TOB A;  4M6Y A;  2O61 A;  1I6X A;  2P8T A;  4BQA A;  4LK1 F;  3BJO A;  4Z2Y A;  4QLC U;  4L0Z B;  4HQE A;  1HST A;  1OYY A;  3FMQ A;  2HWV A;  4KT5 C;  5DCM B;  2Z5U A;  3DV8 A;  1W4M A;  2TDX A;  2G7U A;  4KFC A;  2VT2 A;  3J81 Z;  4PDK A;  2RQP A;  4IXA A;  2VBW A;  3CUQ B;  3RKY A;  1PUE E;  2OQG A;  1FSE A;  3WTT C;  2H94 A;  2ZFW A;  3FHZ A;  4XSX F;  4LLN A;  1IN7 A;  2ZME A;  2EV0 A;  3ZMT A;  3LFK A;  3ZMV A;  3G3Z A;  1FOK A;  1IXR C;  2FMY A;  3CLO A;  1J0R A;  1QNT A;  2H6B A;  5FD5 A;  5F1R A;  2F5E A;  5HOO A;  2W57 A;  3J80 Z;  3KZY A;  4WXH A;  2L02 A;  2J5O A;  3V8L A;  1T6S A;  3HRM A;  4L9J A;  2DLL A;  1AWC A;  4YG2 F;  2HEO A;  3HSR A;  4YFN F;  4MEY F;  4Y15 A;  4LMY A;  2E7W A;  2W24 A;  3BDD A;  2FRH A;  1HW1 A;  3KP3 A;  3BJ6 A;  5KVR A;  3NEU A;  1LJ9 A;  3EYY A;  2EJR A;  3MZH A;  1TTY A;  1W5S A;  3C3W A;  1Q1H A;  4HX7 A;  3REO A;  3WTX C;  3FMR A;  1IN6 A;  5BPD A;  2L54 A;  1IXS B;  4ZH4 F;  3LQR A;  3WE3 A;  3JTH A;  1SFE A;  4KYW A;  1A04 A;  4YFX F;  1ONV A;  2IJL A;  3ABT A;  4XLN F;  4HA8 A;  3OV8 A;  4HQM A;  5HDG A;  4UHT A;  2HKO A;  5LBQ A;  4ZYH A;  5K5Q A;  2VN2 A;  4EJT A;  1ZRE A;  4YIF A;  4Q5S F;  1O3S A;  1IXC A;  4LLG F;  1LQ1 A;  3BPX A;  5CVI A;  4HX4 A;  3AAF A;  2LSO A;  1K78 B;  3R6S A;  1XCV A;  3SXY A;  2BYV E;  2F5F A;  2W25 A;  2Y0M A;  4WXC A;  4A0Z A;  1TQP A;  3DEU A;  3CDH A;  4RAZ A;  1E17 A;  5FFZ A;  2P7V B;  3I5U A;  1AOY A;  3DQV C;  2KKO A;  3LA2 A;  4Y17 A;  4RS8 A;  2P5V A;  2BV6 A;  3R0A A;  4AIJ A;  3RTR A;  3FX3 A;  3F72 A;  4M6X A;  4HV6 A;  3EET A;  4WCG A;  2HYG D;  3HRT A;  2IA1 A;  3IHU A;  1FY7 A;  5ICE A;  2JSC A;  1ODD A;  1YG2 A;  2E7X A;  2MH9 A;  2C6Y A;  4ENK A;  3H3Z A;  2YPR A;  3ISP A;  3MFK A;  1KQ0 A;  2F5D A;  2FBK A;  4A2U A;  2HDC A;  2NS0 A;  3ZQ7 A;  4RGX A;  3IRR A;  2VC1 A;  3O6B B;  4ENJ A;  3MEX A;  2FA5 A;  3GZ6 A;  5DD4 A;  3U2R A;  2HOE A;  1IUY A;  5IT9 K;  5CVU A;  1F9N A;  3ULQ B;  4M74 A;  2JZY A;  4A5N A;  1O3R A;  1R5G A;  3IL2 A;  4FX0 A;  2R7F A;  1J59 A;  2W85 A;  4HW0 A;  2HR3 A;  3DXJ F;  2FF4 A;  1BOA A;  3BWG A;  3E6B A;  3RDI A;  4B09 A;  4P9U A;  3LST A;  5J6X A;  2OU2 A;  1BM9 A;  2VBX A;  3L7W A;  3LWF A;  4ZZL A;  1J75 A;  2KIF A;  1CGP A;  4G7O F;  1FBS A;  1L0O C;  3DP7 A;  1V4R A;  3M7G A;  2HFH A;  1IN4 A;  1XDS A;  4EJV A;  5ILV A;  2M5W A;  2JPB A;  1IW7 F;  5JR3 A;  4OIO F;  3LA7 A;  2QBY A;  3T5X A;  3V4G A;  3V8J A;  4OU0 A;  2QLZ A;  5ICC A;  2RKH A;  2YX7 A;  4PGH A;  5L3E A;  4A6E A;  4D0P A;  1QO0 D;  1MD0 A;  2DPD A;  2QQB A;  4G94 A;  3GEZ A;  4N9H A;  1R23 A;  5HS8 A;  3KP2 A;  1DUX C;  5L3C A;  4LB5 A;  3HHH A;  1T39 A;  3E5X A;  1B4A A;  4I2O A;  4CHU A;  2NNN A;  2P7C B;  5BQT A;  3F23 A;  5L3B A;  1ZRF A;  3WE2 A;  1O57 A;  3ZMZ A;  1LVA A;  1D3Y A;  2AXL A;  2O6G E;  1F4K A;  4HLY A;  4M9S A;  3WU1 B;  2ZME B;  4KMF A;  1YYV A;  1O3Q A;  1OYW A;  2DK8 A;  2P6S A;  1EH6 A;  2OZ6 A;  2A5Y B;  4DNC A;  1ZGJ A;  1FLI A;  1W5T A;  2LNB A;  4XBF A;  3GO5 A;  3Q9S A;  4MTE A;  4Q48 A;  1R58 A;  2DO7 A;  5ILS A;  2MH2 A;  5JVT A;  1B9N A;  3HYI A;  2WV0 A;  5HLH A;  3DF8 A;  2WTE A;  3TGN A;  5LHH A;  2JT1 A;  4KA4 A;  1ZH5 A;  1YS7 A;  3GZ5 A;  1L3L A;  4BHC A;  3F8F A;  3E3V A;  1T2K A;  5J8C A;  2QUF A;  2Z9O A;  3KLN A;  4GYI A;  2XGX A;  2EFP A;  4G6Q A;  2VE9 A;  1VTN C;  1QZZ A;  1KGS A;  3WG9 A;  1FNN A;  3KEO A;  2HKX A;  4LFU A;  3IKV A;  1XGO A;  1RIO H;  1WKM A;  2HTS A;  1XSX A;  2VOP A;  3B02 A;  3M8E A;  1G3W A;  3TQN A;  2G9W A;  1FP1 D;  1WI9 A;  3F8M A;  1KU9 A;  2PJP A;  1BBY A;  3SQN A;  2DQL A;  1HQC A;  2Q8K A;  4CO8 A;  1XSV A;  1P2F A;  1OMI A;  1ZLK A;  1FWZ A;  2EFQ A;  2D2W A;  3HOS A;  1IZ1 A;  3J80 K;  3ERE D;  5AON A;  4N9I A;  3C18 A;  3HRU A;  1DP7 P;  1P4W A;  1Z1D A;  5HLI A;  1P92 A;  5DUK A;  3E5U A;  1BI1 A;  3OOP A;  1FPQ A;  4U7B A;  1RUO A;  2LDU A;  4DQ2 A;  1FBQ A;  2XAF A;  1KU7 A;  2PFB A;  4HF2 A;  4H0E A;  3IKT A;  2EV6 A;  2K27 A;  3T1B A;  4ON0 A;  3FWE A;  2MC3 A;  2FE3 A;  1ZAR A;  2KIM A;  3GW2 A;  4AIK A;  1BIB A;  4KN7 X;  4MTD A;  1U5T C;  2VT3 A;  4IPA A;  4I0A A;  5LLQ A;  4HF0 A;  4XRF A;  3QP6 A;  4BYY A;  1BJA A;  5D5X B;  1FC3 A;  1UHM A;  2WC2 A;  2ZXJ A;  1FSH A;  1XB4 A;  1G3S A;  2DFI A;  3VOE A;  1HKT A;  4OIP F;  3VB2 A;  2O0Y A;  3JAM Z;  1UST A;  1BIA A;  3IWF A;  2ISY A;  3F6V A;  1LEA A;  3KP6 A;  2EFN A;  2R7D A;  2XKO A;  2RN7 A;  5HDN A;  3O3K A;  4HAM A;  4R1H A;  3I4P A;  3ZN1 A;  1PP8 F;  2QZ8 A;  1MGT A;  4IHT A;  4GXO A;  3I71 A;  4CZZ A;  2G7H A;  1IN8 A;  2RGV A;  4EVI A;  4HYE A;  2O8X A;  1T0F A;  4GCV A;  3K1M A;  4MGR A;  3HSE A;  4MQV A;  1R22 A;  1ZG3 A;  2ZJ2 A;  4TV7 A;  1XMA A;  4KUM A;  5LGN A;  3F8N A;  3M9A A;  2DTR A;  5TJJ A;  2MLG A;  4RGU A;  1DDN A;  1B9M A;  1ZHF A;  5LGT A;  2EA2 A;  4S05 A;  3R0J A;  4ENM A;  2XUB A;  3W6K B;  3E6C C;  4HV5 A;  2GXB A;  3TDZ C;  5BMZ A;  5D8L B;  2KJC A;  1FX7 A;  1TLH B;  4GO1 A;  1Z6R A;  2NYX A;  4HF1 A;  3WU0 A;  2A6H F;  1R7J A;  3QRF F;  3COA C;  2STW A;  3LQQ A;  3KFW X;  1TQM A;  4OMZ A;  1S3J A;  3GVA A;  2XV4 S;  4R8H A;  4UUV A;  4ESF A;  3SZP A;  2M45 A;  2PN6 A;  5DDG A;  2A69 F;  4HLX A;  5K5O A;  2UXN A;  3KZZ A;  2OBP A;  2GA1 A;  4YFK F;  2P5L C;  3IRQ A;  3NRV A;  1QQI A;  1R1T A;  2DI3 A;  4L5I A;  2X0L A;  2QBY B;  2RDP A;  1KU2 A;  3BY6 A;  4M71 A;  1JHH A;  2STT A;  2ZBK A;  1TBX A;  1ZGA A;  5DV5 A;  1BC7 C;  1SMY F;  1U6G A;  2L01 A;  1LB2 A;  5HS7 A;  2COM A;  4CYD A;  1YS6 A;  4UVA A;  4PZJ A;  5LHI A;  1KYZ A;  5F6F A;  2PMH A;  2CYY A;  5E1Z B;  4LJZ F;  5CVV A;  2KIU A;  3FXR A;  2JRT A;  4RB3 C;  2EFO A;  3SHF A;  3WTV C;  1MJB A;  4KDP A;  2RC4 A;  2XAQ A;  3WTU C;  3T8T A;  5CJ9 A;  2VBZ A;  2XRN A;  3HRS A;  4O6J A;  2HZT A;  3KET A;  4IF4 A;  1REP C;  3ABU A;  4RGR A;  2MA3 A;  2FBH A;  4LK0 F;  5LEJ A;  3J7A O;  2HGC A;  2A61 A;  2IW5 A;  4EJW A;  2DK5 A;  3HTU A;  3SFZ A;  1Y0U A;  5FB2 A;  1UHW A;  2ACJ A;  4MHG A;  2IVM A;  2Z33 A;  1E2X A;  5L3D A;  4LGW A;  4WK8 F;  1K6O A;  2XAS A;  2RNJ A;  1J7K A;  1IRG A;  3L09 A;  2GZW A;  2ELH A;  1SMT A;  1YW7 A;  2R3S A;  3RKW A;  2M8E A;  4OIN F;  2Q0O A;  2D1H A;  1RNL A;  4M9Z A;  1Z05 A;  1KQ9 A;  3K69 A;  5A2Q Z;  3L00 A;  4EJU A;  4O3M A;  3QU3 A;  4FX4 A;  1JHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...