2XF6A

Crystal structure of bacillus subtilis spp1 phage gp23.1, a putative chaperone.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
50
structure length
50
Chain Sequence
SESLLYGYFLDSWLDGTASEELLRVAVNAGDLTQEEADKIMSYPWGAWND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Bacillus Subtilis Spp1 Phage Gp23.1, A Putative Chaperone.
pubmed doi rcsb
source organism Bacillus phage spp1
molecule tags Viral protein
molecule keywords GP23.1
total genus 17
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2010-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2xf6A00
2XF6A 2XF5A 2XF7A
chains in the Genus database with same CATH superfamily
3FM5A 2MD0A 1JHHA 4A3JJ 5CVJA 3UNGC 2E1OA 2HQRA 4MGRA 4JX6A 3CLOA 1ZK8A 4L9VA 4A0XA 1KU3A 5DUKA 3KLOA 1I39A 3IP4B 4ZZLA 3IAM2 3IH3A 2WB1A 4PSWA 2OF7A 1JI8A 3EYIA 3QYFA 1YJNI 3L00A 4IHYA 5ICFA 1LPQA 1QZEA 1QGPA 3AG4H 4HX8A 5J8CA 2JUGA 4HLXA 2JWTA 2DT5A 2LG4A 1YFHA 2WTEA 1D0YA 1MNDA 2NS7A 2R7SA 1C0WA 5M5XJ 1IO2A 1PVEA 4Z6YA 4CO8A 5HLIA 1GVDA 1PUFB 1A31A 1XG1A 1ZH5A 1GUUA 3G1MA 3EUAA 4JOMA 3GLLA 1VF9A 4HV5A 3DWLE 1P7JA 4B4CA 1PP7U 1B72B 1IN8A 3MKWB 1MMAA 1T2KA 3TQNA 1E3OC 2KHMA 2STWA 1IF1A 1UHWA 3FISA 3U2RA 5TGTA 1XMKA 1P4XA 4N4OB 1YG2A 2CFXA 5K7ZA 1W5TA 3R4KA 4BL0B 2XV4S 1R1VA 2K5CA 1OFCX 2OJED 2FBHA 3ZQIA 1F5TA 1T08B 3V8LA 2GZWA 1RESA 4MEYF 5D5XB 5FROA 2NRAC 3K4MA 2XSDC 2E2IJ 3E5QA 2OPTA 1RKWA 5DUIA 4MLOA 2BY1A 5KNLA 2Y9ZA 1MKMA 3QWLA 3U21A 5KAIC 1YX5A 3CCMI 4LLNA 4KUMA 2VJ5A 2B0LA 2IT0A 3W2VA 3F6OA 1R6RA 2JJ7A 3Q0VA 3HB9A 2VPLA 1KYWA 4GGGA 5F0CA 4B47A 4M6YA 4D5FA 2V9PA 1UELB 1BW5A 1H8AC 1IG7A 3RIRA 3I4PA 1MJBA 1B9MA 3A1YA 5ERIA 2PMHA 3LSJA 3CESA 3CJQB 2KRHA 2BXZA 2K86A 5HLGA 3I58A 4PFPA 3JRDA 4D9JA 2V7FA 4QSHA 2HGCA 4A69C 3LA2A 1TWAJ 4II3A 2XGXA 1A04A 2OUMA 2EK5A 4LJZF 3RJPA 1VI0A 3QPTA 1LEAA 1VTNC 1R5HA 2RQQA 2XROA 1HW2A 5AIPA 1EH8A 1UMQA 3JW4A 2WC2A 2W24A 3J80Z 2CV0A 1LJ9A 1R58A 2KZGA 5JLXA 1ORKA 2M45A 1MGTA 3GMEA 3LSTA 2HWVA 3I9V2 1LVAA 2JT1A 2D1VA 2YX4A 3OSGA 4IHWA 1USSA 3MZ8A 1ZGWA 3KYLA 1S72I 2QSHX 4O3MA 3GZ5A 2DCEA 4YRVA 2GLOA 4AYBA 2XASA 3BJAA 4FT8A 1HA8A 3ZMTA 3DXJF 1UG0A 1TW2A 1IN4A 3J7AO 4F92B 1BA5A 1Y1WJ 1O3RA 1MIJA 5DD4A 1FOYA 4BY7J 4LLGF 5EGOA 3ZP5A 1OJLA 2PFBA 3ZR8X 3LSKA 1OCOH 2ZFUA 4RGRA 2KIUA 4UVCA 3PSFA 1KU7A 4IJAA 3F8MA 3D5SC 4M9ZA 3GTJJ 3OYEA 3ZOBA 3JRBA 4BHPA 2GWRA 3TL4X 3L1PA 1ZYRF 3HUGB 3L7WA 4Y13A 1KONA 4BXFA 4ZDOA 4UHTA 3Q0WA 4B3AA 1I1GA 1Z6RA 4F7ZA 5HNHA 3KEYA 2DJIA 5LEJA 1GT0C 4F52A 1IDYA 5GPAA 2XUBA 3A4CA 1J9IA 1ACIA 2RKHA 4BEHA 2HTSA 3ECOA 3EETA 4B1RA 2NS8A 3ONQA 4LIVA 1K6OA 3GZNB 1X58A 5CVVA 3IKTA 3N4MA 1YJWI 2F6CA 4Y52J 2ZXWH 3SFZA 4E7KA 3ECHA 2XAUA 2IW5A 3OYJA 2MLKA 5BPIA 2M87A 2YS9A 2Z99A 1HKQA 4XLFA 1FJLA 5HLHA 3HG9A 2HKXA 5IY5H 2EZLA 1NTCA 3TW7A 3TGNA 2GOXB 3CMEI 3LOCA 1NK2P 3PO2J 3PNYA 5HDNA 5HS9A 4O6JA 4IZZA 4E7LA 5LGNA 1OYWA 3K10A 4IHVA 3QAHA 5H6QA 1QRYA 1R5GA 2L9NA 2H27A 3KETA 2IP2A 3CJNA 3CCUI 1O3SA 4P9FA 1V54H 3HRTA 2O6GE 5TISC 4IOAF 4UVBA 3RYPA 9ANTA 2XSJC 4HSRA 4LB6B 1ZG1A 2DA4A 3Q0UA 3E3VA 4MFEA 2IAIA 3RDIA 1VQPI 2W85A 1DGWY 1KU9A 3L2QA 1VQ7I 3MFKA 4A3KJ 3FWEA 4GRIA 1ETXA 1YQAA 1SVLA 2QVOA 4M3GA 4V2FA 5J3LA 3P7NA 4ZDLA 4CUGA 4AIKA 1FBQA 3FXOA 2F5EA 3U1KA 3HKZN 4BHBA 3DLLF 1OCRH 2UXXA 2F5FA 4ZYGA 3C3WA 5LGUA 3UKGA 1H88C 2EZKA 2DA5A 1G4DA 1M1EB 3SEZA 3BG7A 3KEQA 1APLC 3H3VK 2KIFA 4H0EA 2K3FA 3B6AA 5E3OA 1YYVA 2L7ZA 1L3LA 1CF7A 2OTJI 4PGGA 4JK1X 2FNAA 3CZ6A 4M3BA 3H36A 2CW0F 1Z05A 1ZGJA 5E3LA 2LDUA 2R4GA 3K69A 2N8GA 2QKLB 4RAGA 1LDDA 1K6YA 2ZMEA 5EG0B 3HL2A 2MC3A 2ZKZA 3R0JA 5FJ8J 4EJTA 2CUFA 4ITVA 3SZTA 3CUQA 4A5NA 4BDYA 1NK3P 4DYRA 3CCEI 3CC7I 1G3TA 1D1BA 1T6SA 1Z77A 4XLCA 2CFOA 5M3FJ 2XAHA 1OPCA 3GW2A 2L01A 3HPGA 1SFEA 2R5YB 1SD7A 2WA0A 3HPHA 1F1ZA 2TRTA 5CQEA 3Q9SA 2M9HA 1W7PD 1KGSA 1PYVA 2NXNB 3QP5A 5LRRA 5J4YA 4ESJA 1PUEE 1OCTC 1IXRC 1XMAA 2JVHA 4ENNA 3DCFA 4XLNF 2DXIA 4AVZA 3OY9A 1B1BA 1LB2A 4I0BA 4XM3A 3ZGKA 3FXRA 2VQGA 1LDKB 3NQOA 4W1UA 1GVJA 3WTYC 2OCCH 3CLQA 3CC2I 2VLAA 1TLHB 1FEXA 4EJUA 1BI2A 4Y3OA 5E79C 2H8RA 3K70C 1JE8A 3KP6A 2CV1A 1G59A 2JPCA 2AXTC 3PSIA 1LNWA 2XGCA 2HQAA 2OQGA 3DU5A 2ELKA 4KN4X 5AIQA 2PQ8A 2A6HF 2IGKA 3QRFF 1I27A 1Z7LA 4I99C 2LMDA 2GBYA 3VYTB 4XOTA 2O03A 4C2TA 4K2EA 3MMYB 5E17F 3F22A 3S15J 3WHBA 4XKWA 2E36A 3F3XA 4IHXA 5JHFA 3BTIA 2D2WA 1XDUA 1VZ0A 2MC4A 2J5OA 5J4VA 4RBOA 1TQIA 4N0BA 3GBGA 2VASA 2ZNZA 2DT6A 3SXYA 1S3JA 4I02A 3HSEA 3B73A 4CZCA 4A5MA 1TL8A 5HS8A 3GX4X 4A3MJ 2F5VA 1X1PA 3QP6A 4LG3A 4AVPA 1JUPA 2RV8A 1FYKA 5BNGA 2P8TA 3KZIC 3ZQLA 3VPRA 3ZQFA 3BR5A 2VL8A 2L02A 4EJOA 3RZOJ 4BGDA 4DIQA 1BC7C 1AWCA 1X2NA 2AXLA 3I5UA 1QHGA 1ZKGA 3A01A 2VT3A 4G8XA 3GTQJ 2COBA 3UR3C 4EGZA 3T8TA 2L9VA 1WJCA 4HX7A 2ZCWA 3HTSB 4OMYA 5FKNA 1WJEA 5FD6A 4BXUA 3AG2H 4M9XA 5EZHA 1IV6A 4UY8I 3P5JA 2CQNA 2TCTA 2MLGA 3EQLF 2IA0A 1MBHA 1LDJA 2KIMA 2LY1A 4FX0A 3RKYA 5LEKA 1X2MA 4ETSA 3J80K 4FCYA 4GDFA 2A05A 2R5YA 4RGSA 4TV7A 3H9QA 3OSFA 3MKYB 2PJPA 1U8RA 2QA4I 5F08A 1D1AA 4IHSA 4ZDPA 2QZ8A 5IOZA 5DEQA 1XCVA 4CCMA 2DK8A 5EEGA 1PDNC 2LD5A 1ZN2A 5KK1A 4KFCA 5ICEA 1E0EA 2JMWA 3FZVA 3LMMA 2ZJRF 1D0ZA 3HEFA 1FSHA 1N25A 2L7MP 5IOYA 3D5RC 2OA4A 1YRNA 4EJVA 1ZGAA 3MZHA 3E6CC 2EPFA 4WXCA 1G8XA 3S17J 5CQGA 3ZMUA 1SAXA 3GVAA 3HHHA 4U87A 3W6KB 4WXHA 4C3JJ 1RETA 3R61A 3ABKH 4CYCB 5EGOB 4AIDA 3DBRB 3S1MJ 4EMSA 2AS5F 3ZQHA 1Z3YA 2LRDA 2FBIA 2X48A 4G6TB 3OYGA 2W84A 2DFHA 1SVOA 4HBLA 4KA4A 1AA7A 4PZJA 1R7JA 2EFPA 3K4KA 2A6TA 1D5YA 4KT5C 1XX5A 4HNVA 2AQEA 4D0PA 4KIFA 4Q48A 2A6EF 1H9TA 2FX0A 3BTJA 2LNBA 1UB9A 2MW8A 1PP8F 1VQNI 3G73A 2B9SA 4JX5A 1XN7A 2Z33A 3G6EI 1MZBA 1O4XA 4HV6A 3U1DA 2K27A 1ZLJA 2L5QA 5E18F 2M7AA 4C2UA 1TQMA 1ZELA 4RLQA 2HFHA 2CUJA 4YIIA 4BACA 1J0RA 2FEZA 3F9KA 1MH4A 1TC3C 3BZCA 4S0HB 3OS2A 4LFUA 1ZRCA 2D45A 3BY6A 4RLFA 4A3CJ 5IYCJ 2OAZA 2HDCA 2P6TA 2DPDA 3CO6C 4ZH4F 4HDVA 1Y8QB 1ETQA 3GWZA 5CPRB 1K79A 2BYVE 2K9NA 3JRCA 3OIPA 3FKJA 2QQ8A 2LP0A 2KQRA 3I53A 2HPIA 3FKIJ 2LYCA 5B66C 3TO6A 3TEDA 2Y69H 3V42A 3MEXA 5BS6A 4XLAA 1ONVA 5LHGA 1FMVA 2XC7A 2UZKA 2DOAA 3C18A 3WTVC 4E7JA 1SD5A 2ZXHA 4HX4A 3QOPA 2X1DA 3G1OA 1BIBA 5GTIC 2EIJH 3GTLJ 5BQTA 1BOBA 2V26A 2Z9OA 4DYQA 4RB0A 1RNLA 4YELA 3DEUA 3I54A 1MNMC 4KIBA 3OYBA 3S1NJ 2M4GA 1D8JA 1DP3A 2FMLA 1RR7A 2X6XA 3P9KA 2M4KA 4OINF 1BJAA 4HNTA 1TNSA 2HPMA 2XF7A 4XRSG 2M8GX 4PJMA 1K4TA 3ABLH 2P6SA 3WE3A 3C7JA 2C6YA 2B63J 3FBIB 4I7HA 2NVYJ 3WTUC 2VKDA 3S2DJ 1B8IB 2PG4A 3ZRGA 4PJ0C 2K4BA 2ZFWA 4OIPF 4D5CA 2ETHA 1PJRA 3QPHA 1QZZA 2CMPA 4HQMA 4N9IA 2V1NA 3E0JB 4UV9A 4ENKA 2XGEA 2BW3B 5EYRA 4MEXF 2QQ9A 4MFDA 3WU0A 1D3YA 2VONA 3E7LA 3QYEA 3K4BA 4AC0A 3LWFA 5F64A 2G7UA 3X2QH 4IRIA 4DBRA 3OYMA 4PCQA 2E1MC 1XGNA 2DU9A 3F0CA 2X4HA 2HNHA 1DUXC 1XS9A 2FA5A 4HSTA 1ETWA 3GTMJ 2VXZA 2DMPA 1QZYA 5LGTA 3NAUA 1OCZH 2HS5A 4EGYA 2E7XA 1FPQA 3L2WA 3WG7H 4L0ZB 6PAXA 5K7FA 3GTGJ 2KRCA 1X3UA 2G0EA 2P7CB 1Y6IA 3VODA 3K70D 4JP0A 3BTCA 2M7BA 1DDNA 3JTHA 3NEUA 3V8KA 3FBNB 2ME0A 3CP2A 4UB8C 3F23A 3H0DA 5JI6A 3HYIA 3LAJA 3N05A 2WBMA 3EYYA 1WJ5A 2ELJA 3IH2A 3PFIA 3TBIA 4FASD 2Q2EB 3WE2A 1BR2A 3WG9A 2EINH 2MSYA 3RPQA 3DF8A 2KKOA 2HDDA 1D8KA 1XCBA 4D7NA 1FP1D 1SD6A 3K4CA 1K78B 4FETA 1BN5A 2JA6J 1VQKI 3V7RA 4RM3A 3DBHB 2M0CA 1X1BA 2L4MA 2QQAA 1A6QA 3I64A 3CJTB 3RCOA 3MWMA 4R1HA 3K9TA 4B8XA 1I3QJ 5M5WJ 4GO1A 4BAYA 3JR9A 3A0HC 4MQ9F 5BPDA 2V1UA 2UWMA 2R7UA 2GM4A 1DU0A 3WU2C 2UUZA 1P9QC 2HOEA 4HOBA 3WGGA 2F2EA 3KP7A 2GXBA 5EJCA 3KE2A 4OIQF 2PEXA 5LBQA 2ACJA 1YOVB 1HQCA 3FM3A 2DODA 3HIFA 1FLIA 2V1DA 1TW3A 4RAYA 2ME6A 3V8JA 1QPMA 3TP0A 2OD5A 5L3CA 2IS2A 4CGZA 1YLFA 1YIJI 2CV2A 1BIAA 1RI7A 3VYUB 3H9JA 3OV8A 1T38A 3LSPA 4EM0B 3GFIA 1MNEA 4KN7X 2K9LA 1T95A 1MSEC 1EJ9A 2QF7A 3IWFA 1QA6A 2CYYA 3VWBA 1F43A 4ASNA 2RN7A 3OL3A 2QGUA 2LK2A 4NB5A 1WSUA 2HVSA 4M74A 2VC1A 1WI3A 3T1BA 3ZQGA 2NS0A 1BBYA 2P4WA 3C2HA 1I6XA 4IEJA 4A0ZA 2M2EA 4NQWB 2HXOA 4M9SA 2O7OA 5DCFA 2NVXJ 1R9TJ 4L18B 3HOUJ 2IS6A 4KNYA 4U0WA 4ZC3A 2H94A 3SFIA 1U3EM 1J59A 3ISPA 1FBSA 1REPC 2WY8Q 1V4RA 1SEUA 2XIGA 4XR6A 2WAQA 3TKYA 4BE1A 1Z91A 5HOOA 2Z3YA 1MBKA 4KITB 4MHGA 5JVTA 1AU7A 1JGGA 2DDAA 3CCRI 1EH6A 1JKQC 4ESFA 1WVRA 4LIUA 1ZQ3P 3ZXSA 1HC8A 1IRXA 2OU2A 3HTUA 1KQ9A 2CU7A 2L4AA 3OOPA 1YW9A 1TQPA 2WADA 2Q8KA 3MKZA 2GOMA 2FJ1A 3W6JB 2FBKA 1MD0A 2P5KA 3ABMH 2XKPA 2Y0SN 4OOIA 3H3UA 5D5UB 2DYRH 4Q4ZF 4R8HA 4LMYA 3M7GA 2PX9A 2QKMB 4CA0A 1IXCA 4ENMA 3GFMA 2KLOA 2DTRA 1P4AA 4RM2A 1STZA 4V2GA 1R71A 4IQJA 3TOBA 1JUMA 3CUOA 1JKPC 2FOWA 1T0FA 2MGQA 4I76A 5DYMA 3QYBA 4D7MA 1BI0A 4Z2YA 4M72A 5D8LB 1B6AA 2IRFG 4DQ2A 4LD5A 3I4NJ 2XAQA 1O7FA 1G3YA 2IS4A 4PGHA 3S14J 3HOVJ 2L3DA 2Z1DA 5A2QK 4NDLA 4NC8A 5AONA 2M5WA 1A6IA 4LK1F 3F8NA 3HRUA 2DFEA 2XRLA 1T39A 2O8XA 3NWTA 4WK8F 1FY7A 5F1RA 2BVMA 5L3BA 2GIZA 1KQ8A 1SFXA 4XKBA 1HW1A 4QTRA 3RSNA 1XDSA 1T8IA 1IUFA 4CCLA 1U78A 2MH2A 2H1KA 2F5DA 1W4MA 2L2OA 3CCYA 3RPUA 4X0GA 2VBWA 3LFKA 4KT6A 1T56A 3O6BB 3HOWJ 3BCAA 5HS7A 5J1UA 4EM2A 3CF5F 2O9LA 1TZLA 1BL0A 1SAUA 2LY2A 3OIOA 3ZQCA 3OYKA 1JJ6C 4XRFA 3A2KA 2OQRA 4HLYA 3QPLA 2K4JA 4XN3A 4AYBN 3CCVI 3IH4A 2ZBKA 2X6WA 2EJRA 3OYAA 3G2BA 5CVIA 3MCZA 1YHQI 1Z21A 1AHDP 2XRNA 4E4HA 4UNOA 3CDIA 2CW8A 2DN0A 2O3FA 2CWEA 2KL4A 2Y0SA 1RKTA 3W2AA 4HG2A 2JUCA 2W57A 3B6CA 2K3PA 1XGSA 1IN5A 2P5LC 4J01A 2EA4A 4OAZA 1SMYF 2H6BA 1P7IA 1WI9A 2K85A 1ITYA 3FXUA 2VJIA 1LFBA 4BE0A 2CO5A 4P55A 4I2OA 2CUEA 3CUQB 2ECBA 3LAPA 2M30A 1MDMB 1NH3A 3DTEA 1V5EA 4N4NB 5L3DA 1U0JA 5J40A 3PUBA 2RQPA 4XNFA 4FE7A 2HVQA 4L9NA 2OTLI 1S8NA 2VKEA 2OBPA 2P5VA 2NAZA 5IT3A 1EKEA 1JKRC 3BR2A 3OYCA 2ESNA 3LL7A 2QBYB 3O8GA 2HEOA 3MN2A 2UXNA 3KYCB 3W2WA 1H0MA 2QBYA 1LKXA 4A3EJ 3PO3J 1GV5A 4CCNA 3IAS2 2O8KA 4LLLA 4EEFG 2R7RA 2ADUA 1MMNA 5EG0A 3PFYA 3JRFA 3KLNA 3LA7A 3L2RA 2FU4A 2M8EA 3H5AA 4ZYHA 1P6RA 1OCPA 2M34A 5CJ9A 2FQ4A 1XMXA 2LSOA 3BZKA 2VOPA 3GZ6A 4PFOA 3K6GA 5F1JA 1K61A 1VFCA 3S32A 4KJZA 4A3IJ 1SFKA 3KIOA 3KP5A 4XSZF 3FXKA 1D1CA 1IGNA 1BR4A 2PN6A 5A2QZ 2R7TA 2FF4A 2FOKA 4IO9F 4QPQA 2L9SA 2X9DA 1JUSA 1ZG5A 4UXNA 2JQ7A 2VE9A 2JSPA 3F8FA 5CVRA 2KMUA 4ZJZA 5B1AH 2GA1A 4C3HJ 3BQZA 1KQ0A 3PIOF 4DOZA 1QQIA 4JYKA 1E2XA 2KDOA 1S7EA 2KZVA 1P2FA 2BXYA 4QIWN 1VQLI 3TMOA 3SYTA 1X1CA 4PSXA 4MTEA 3RKWA 2PI0A 3FX3A 2YR2A 2D5VA 5HVQC 3PL8A 1Z3XA 5FRMA 4P1WA 2DDBA 1TWCJ 1RPWA 3DTKA 5FKMA 3BP8A 1L0OC 1SFUA 1X3WB 1W36D 2HZTA 5DCMA 3KYDB 1RRJA 3HSRA 3SDGA 2X6YA 2J5PA 1JT0A 2DA7A 1ETOA 2DMTA 4EATA 5GTHC 3ABUA 3MAJA 2YPRA 2PBIA 3DU6A 1EA3A 3DFGA 3HKZA 3I4MJ 1HKSA 2E19A 5IP9J 4OIRF 2QCOA 2VBZA 2W25A 1QBJA 5E1XA 2R7FA 1RR8C 2Z5UA 3VYRB 4CDGA 3K4NA 4JX4A 2VODA 5LHHA 1SC7A 4HPQA 3H3ZA 2EIMH 4F91B 3R0AA 4B44A 1JGSA 1J09A 5K7HA 2HTJA 3A0BC 2VB6A 1ZR4A 3K7AJ 4BS9A 2HDWA 3K2AA 2IXSA 2BBYA 3O8HA 5ILUA 2QSFX 1EH7A 2RNJA 3FK6A 2DT7B 4L9JA 1YITI 1MBGA 4PK4A 1WZ2A 3WHCA 3HXLA 1IZ1A 3JRGA 3H0GJ 2ELHA 4E7HA 4KYWA 2IS1A 3S3MA 1FOXA 1TWHJ 4P5OA 2RAEA 1WCMJ 2W48A 1YRNB 2LF7A 2NOJB 5JVGF 2VQHA 1VQOI 1HSTA 1N77A 2DI3A 2DQLA 1SANA 1IC8A 2ZMEB 5FFZA 4M3DA 4DZJA 5L3EA 4AIHA 2K9QA 5CYVA 3KPHA 4WCGA 1TP4A 1ERDA 2BHZA 2DMNA 3P9IA 5HLTA 2R5ZA 2QM3A 3GLXA 4C9YA 2MA3A 4L9TA 2K02A 2JTVA 1R23A 3ZCOA 1OQYA 2FUG2 1NG7A 4PJJA 4XRSA 4FTHA 4XLPF 5IYBJ 5E3NA 3QQAA 1Y0UA 1UG2A 3KCCA 4BQQA 2DFFA 3OMYA 2BY0A 1BR1A 5LLQA 3ZQQA 2DMQA 2W00A 3TOAA 1LUJB 3M1EA 3QPSA 2EFQA 1V3FA 4RGXA 1YS7A 1IN7A 4A12A 1R36A 1JJ8C 3LSIA 3PQJA 3D5LA 1H89C 3BG3A 2GIVA 4F93B 3AL0C 2LR8A 2JK3A 2JA7J 2E71A 5L3GA 1CGPA 3BZ6A 3H5RA 1J75A 4UUVA 3H1CA 2Q2EA 4CH7A 1SFOJ 2DMUA 1DPUA 1WHUA 1XGMA 2NVTJ 1QNTA 2E1MB 3I59B 3M8FA 1WH5A 3DKXA 3FXLA 2BVLA 1O7LA 2EZHA 5JHUA 1BM9A 1MMGA 2CG4A 5K5OA 1W36C 2ISYA 2ZXIA 4AD9A 1RZ4A 4R79A 2WV1A 5K5RA 3H35A 4ON0A 5CLSA 1CQTA 4IX7A 4UB6C 3H92A 3GO5A 3LA3A 4YFNF 4Y7NJ 5EZGA 2NNYA 1AOYA 3JAMZ 3LNQA 1GV2A 1RUOA 3S3NA 2DBBA 5F0FA 2W82A 1ETKA 5D4SA 1FTTA 5J1YA 5GAHJ 3SZGA 3G1LA 3PQKA 5IYDJ 5DCMB 4V19K 2G7HA 2P81A 1HKTA 1YE9A 3I0TA 1VQMI 3TDZC 3K1MA 1KU2A 2A61A 3V4GA 4UUSB 1LE8A 1O3QA 4OIOF 4G7OF 2ZJQF 2Y2ZA 2MBFA 2H09A 3OYNA 2HVRA 2R7OA 3PNTA 1X1DA 3HOTA 3L09A 3RYRA 4EQQA 3CCJI 4BNCA 4U7BA 1WH7A 1P92A 1O57A 2LFBA 2QQBA 1G2HA 3L2VA 4WF2A 1ZARA 3PNVA 2LTPA 1FC3A 1JHFA 5JFRA 4BH9A 4C2MJ 1Z0XA 2CH0A 1NHAA 2L7FP 2MH9A 2WWYA 4YFKF 2EA2A 4IRGA 5F27A 5E8IA 3IRQA 3BPVA 3FXMA 3OYHA 2JSCA 4BE2A 3I3LA 1A5JA 3M4OJ 4DBQA 2MG4A 4A6DA 3ASNH 1ZRFA 1FT9A 2LF8A 3DPUA 3CDHA 3FHNA 2GAUA 2XPWA 4BU2A 5DM7F 4RA2A 4N9HA 2VKVA 3REOA 4YG2F 1VQ4I 1OLTA 2K9SA 5E1ZB 2KJCA 4UV8A 3AG3H 3D0SA 2EIKH 2CW7A 1N75A 2K7LA 3HUGA 4ZTJA 5E1WA 3G4SI 4X6AJ 2PMZA 2NVUB 3LSRA 3K1NA 3NRVA 1OYYA 2HR3A 3DBLB 5LHIA 4C3IJ 3DV8A 1WJAA 2DJNA 2E60A 4FQGA 2OZ6A 3VSKA 3ABTA 4JBAA 2NOGA 4MNUA 4M6VA 4U0YA 2Q1ZB 1G3SA 4HRIA 3GF2A 1WKMA 2JVGA 3WTTC 3L2UA 1HBXG 1SVMA 1XTAA 4WXDA 3AKZA 4PJNA 4ZTFA 3F72A 4NHJA 2V6EA 3IRRA 5F04A 3U9GA 3FXJA 2H8WA 2MD5A 3NARA 4XKCA 1HDPA 2XF6A 1FIPA 4I0AA 3CCQI 2DOEA 2E34A 3ZN0A 1Q1VA 2JA2A 4IVNA 2O0YA 3BQYA 4YFXF 2D1HA 4X1EA 4XKVA 3A03A 5DS9A 1UAAA 2HQ5A 3RI4A 3M07A 1W7PA 3E1SA 2ICWG 3PUFA 3GXOA 3RKXA 5DDGA 3JCUC 4HF2A 4DZPA 2HYJA 2V1XA 3OYLA 4S04A 3NWSA 2Y9YA 1UHMA 5B3SH 1D5VA 2EB7A 3ERMA 1I1SA 3HOYJ 3HC7A 4M3EA 5HNFA 3BC8A 2LBFB 1Y8RB 3EDPA 5FLXK 1HSJA 5IPAA 1QO0D 1IUYA 2QUFA 3D1NI 5D4RA 5H6RA 2EV0A 1FOKA 3A01B 4A3GJ 3S8PA 4G12A 2CS3A 1WPKA 1K7AA 1ENHA 1XSVA 2YU3A 3WGHA 1R22A 2A5YB 2A5WA 2BY2A 4M3FA 4UUSA 1LE8B 2FMYA 2KISA 1YS6A 4RAZA 3WTXC 2DK5A 2YX7A 3C2BA 3R6SA 3BROA 1B59A 2PMZN 2E2JJ 2NNNA 5FLMJ 4XLHA 3JRAA 4PJLA 1ON1A 3TO9A 2L7KA 2XB0X 5KHDA 3F8CA 1X1AA 1U9NA 4HDUA 2LBFA 2OCEA 4XLEA 1G3WA 4WX9A 3E6MA 1OYIA 5TRDA 3LSHA 2HZDA 3N97A 3GFJA 3FHZA 3HHGA 3ZMSA 5IP7J 5D5VB 2IGMA 2KRFA 4O5VA 4HNUA 4IQ4A 2COMA 3HZJA 4EVIA 2Q0OA 3ZN1A 2XHKA 5J6XA 1X19A 4ABZA 1MMSA 3B02A 4XN0A 5HDKA 1Y1VJ 1HCRA 4LITA 3CD6I 3EUHC 4RB3C 2L54A 4GYIA 5HDGA 2XAGA 4KICA 2R7VA 2CRGA 2R7DA 2VBXA 3C1DA 5LFAA 5IT9Z 3MZYA 3OYDA 3S2HJ 1BJZA 1DU6A 2VXDA 1FOWA 1MBEA 2K9MA 3K4LA 2DA6A 2NVQJ 3KP3A 5K1YA 4A0YA 2WB1N 3OWTA 4PUSA 3FF5A 1OISA 1Z9CA 5J1RA 1VQ9I 2FSWA 4E7ZA 1F9NA 3BR1A 1JTYA 1B4AA 1F36A 3GUDA 1QHHD 1FYLA 5E3MA 3CDLA 3LQRA 2KIQA 4F55A 4XIDA 2LKXA 3GFLA 1IXSB 2IVMA 2OV7A 4G6DA 2AO9A 2IPQX 4I01A 5ICCA 2CJJA 1R1UA 1USTA 3ULQB 1Q1HA 3CO7C 3CC4I 2LKSA 1FX7A 3EUHA 3P9CA 1WWXA 2ZMEC 3KP4A 1X3ZB 2HYGD 1SD4A 3CUQC 3IHUA 1WRJA 2VJJA 2MYSA 1FTZA 2Y0MA 4EM1A 3OOUA 4KDPA 1UHSA 4C30A 1U2WA 1JKOC 2H6CA 1LVKA 1YTYA 2CQ7A 3W3CA 4IHTA 2FNPA 3CP8A 3BJ6A 1MJ9A 4FHTA 3E5XA 4U7DA 1OR7A 4EV0A 2DO7A 3HM5A 3OR2C 1BC8C 4HF1A 4LG0B 5D6FA 4BJTA 3TP3A 1XC5A 2XGDA 1U9OA 2DA2A 2Y48A 3J81K 4HQEA 3VFZA 2YSRA 4BBRJ 2W7NA 1OMIA 2R3SA 3VYSB 2JN6A 1ZLKA 1MBFA 3V7CA 3DLAA 2XKOA 3GEZA 5KVRA 4XICA 3IL2A 4KMUX 2LREA 3GYHX 2LH9A 2X51A 1U5TB 2DYSH 4FISA 5GP9A 4NC7A 4XBFA 1EF4A 2BOLA 5LD2C 1QPIA 4GFBA 4Q5SF 1W1WE 4DJAA 4XQFA 2V6CA 3I59A 2CQKA 2R0QC 1FYMA 4CHUA 3RQIA 3RZDJ 3CCSI 1BW6A 1I5ZA 3E6DA 2HQNA 4MO7A 1OR7C 1WGXA 3T0YA 1HXDA 4EJWA 4L5JA 3BR3A 2HI3A 4BJ5C 1JXSA 2LOOA 3ZQ7A 3ERED 5E20A 2O5RA 2EZIA 1MJAA 3ASOH 4E70A 3JSOA 4Y15A 3SEQA 1MBJA 3LSMA 2FXAA 2OZUA 3DKYA 4M71A 5H20A 3RQ4A 4RS8A 4HF0A 4AIJA 2IGOA 2LLKA 3CMYA 2DTZA 3VOEA 1B8IA 1BI1A 5FKOA 4U88A 3GTPJ 4OU0A 2IA1A 1FIAA 4LGWA 1FWZA 2STTA 4I6ZA 4CCJA 3KZZA 2F4OB 1MSFC 2E5NA 2KT0A 1W0UA 2X0LA 2XVCA 5GAEJ 2VQLA 2X85A 1IW7F 1ZHFA 1Z67A 3HRMA 4AM3A 5GPCA 5EEAA 3IC7A 4RMNA 5FLVA 3TDUC 3FMQA 3HOXJ 1ZRDA 2UV1A 5IP6A 3AL0B 2FD5A 4ESBA 1GDTA 5LRSA 1GXQA 5CKTA 2LKPA 3DPTA 2DAOA 2GXGA 2X1CA 2FRHA 3JSPA 3E97A 4P9UA 4CCOA 4ZYDA 2AQFA 2VN2A 1TNTA 3Q3SA 1FP2A 1I50J 1E3HA 2W4SA 3M8EA 5B1BH 4E7IA 3FXQA 3HOSA 3DEWA 4G9YA 3Q9VA 1LQ1A 2P7VB 1G6NA 2NYXA 1MMDA 1WJDA 2A69F 5K5QA 1TTYA 1FSEA 3OIQA 4MIMA 5FD5A 3KFWX 4G7HF 3MKLA 3ZPLA 1UZCA 2X1EA 3E6BA 2PJRA 4AUXA 1Z1DA 3RPUD 4QWQA 1LFPA 2HXIA 5D8KB 2L0KA 1XGOA 2Z16A 3DEEA 5FLXZ 2VC0A 3DKWA 2BW3A 1JT6A 1YI2I 2DA3A 3FIWA 2RGVA 3MQ0A 2A07F 3ZMVA 4QPOA 2LY9A 3J81Z 1DP7P 5H2FC 3SDBA 1J5YA 1QVTA 1MH3A 2ZSIB 4BDZA 4B43A 3H5NA 3FK7A 3BJOA 1RUNA 1WJFA 2JRTA 3O2PE 5FB2A 4BQAA 3BLYA 1W7PB 1V5GA 1R5ID 2E7WA 3KP2A 4XOPA 3BPXA 3DPLC 3SHFA 4CSWA 2BE5F 2IGNA 4XK4A 4A2UA 1W5SA 4CICA 2JRMA 1MW7A 3FMSA 5B5EC 5C4JJ 3JRIA 1R49A 4A6EA 4DNCA 1ZR2A 1RIOH 4ENJA 3K1PA 3PJRA 3OS1A 1IRFA 1HF0A 3F21A 4L0YB 2O61A 3DQVC 3COAC 4ZZDA 2QSGX 4IOCF 4QLCU 3OYFA 1X4OA 2MFZA 2P0WA 4MQVA 4OAYA 1XD7A 4E6KG 2F4IA 1K78A 3SJMA 2VQCA 3GCMA 1RC9A 3HRSA 1FNNA 3SQNA 1IV8A 2E1NA 2WAEA 2H1LA 3HGYA 4NUBA 1K4SA 3VEPA 1S7AA 1UFMA 4NC6A 2GA2A 2HOTA 1DGRM 4Y17A 3K4JA 3OYIA 5ILVA 1KYZA 2RDPA 4BKXA 1FZPB 4HYEA 5CVUA 3ELKA 5JR3A 4ZYEA 1KZHA 1F4KA 4BQOA 4XMYA 3IV5A 2KPMA 2Y31A 1J7KA 2YUSA 5J47A 3BCBA 5GAGJ 2QEXI 2A68F 3JAMK 1E3PA 3WTSC 2R93J 1UJ8A 4L5EA 4JQFA 5DD8A 2VT2A 2QWWA 3S16J 3L2CA 3M3YJ 1NG6A 3CF2A 1ETYA 2QLZA 1X4PA 3LQQA 3I71A 4I09A 2PLYA 4LK0F 2V79A 3JRHA 4MTDA 5DM6F 1SMTA 2E35A 4OMZA 3EPZA 3C2GA 3S93A 3MD2A 2VBYA 4DGWB 1YO5C 1S29A 2I8DA 4IF4A 2JZYA 3HGGA 3M8JA 1N78A 3R60A 3QU3A 2IA2A 2EFNA 4G7ZF 1MDMA 4HZFA 3T8RA 4FX4A 5IT9K 4CZZA 1E17A 3HDDA 4NNJA 4B09A 5M3MJ 3QOEA 4HA8A 5GADJ 1KA8A 3KEOA 5ILSA 5FGMA 1D0XA 4NQWA 4UVAA 2W1OA 2HU9A 4CYCA 1S9HA 4Y4RA 1S5LC 3BWGA 4RGUA 5DV5A 4B48A 2R7ZJ 2ZB9A 5FRNA 1R4MB 4HW0A 2DLLA 2M0MA 3ESWB 1BI3A 5BMZA 3ML6A 1PUFA 4B3XA 1I3AA 1XB4A 4KIGA 3AAFA 2IJLA 4A93J 2R5ZB 2M1BA 3WODF 2XAFA 1B9NA 5D5WB 2X6OA 4BUPA 1QVUA 2R7QA 2VI6A 1YJ9I 2OC6A 4YIRX 3GTKJ 1T33A 4IXAA 3HBLA 5FKLA 3CCLI 4CCKA 4G94A 5C4XJ 1TT0A 2CQQA 2GQQA 3A02A 2EV5A 1Y56A 3W6VA 4LG0A 4LB5A 3VDXA 1ODDA 2HYFA 1TWGJ 3HJEA 3BG6A 3BDDA 2PJRB 4YEJA 1POGA 4RB1A 2EWNA 4OWRB 1B72A 3AFHA 4A3BJ 5TJJA 4F3QA 2ZO4A 1IRZA 1WFXA 2A3SA 3G3ZA 4IKFA 3IKVA 2EILH 5EDNA 2JA8J 1W5CC 4YIFA 2JA5J 1WQ2A 2GXAA 1V55H 3WU1B 1Z7UA 4J19A 2F48A 3L9FA 3I55I 1AKHB 4DYCA 3I56I 3CMAI 4UUTA 2EBIA 2CUZA 2WAQN 5DTDA 2LC2A 1IDZA 2MABA 2E2HJ 3SZPA 3QODA 4XRMA 3GTOJ 1O3TA 4A3FJ 3OR1C 1IAWA 2VOOA 3HOZJ 2K40A 1W0TA 2ZXJA 3S3OA 3M9AA 5KCMA 2DW4A 2L9RA 3WGIA 3JTGA 2QENA 1R4NB 1Y39A 2HOSA 2Y30A 2E5ZA 5ICGA 3CJRB 4M73A 4RB2C 4A3DJ 2XDVA 2BGCA 1CF7B 1HOMA 2DA1A 1WJBA 4M6XA 1GLNA 2ZSHB 2EFWA 1VNDA 2EQRA 2Y75A 1ETVA 2DFIA 2VIXA 2XPUA 1VQ5I 2M3AA 2LVSA 1R00A 5BOXA 2ID3A 2VPRA 4AU7A 4GCVA 4HAMA 4KISA 5J8FA 1YIOA 5L3FA 1DPRA 1OKRA 3KX2A 4CYDA 4S05A 3QU6A 3J7ZI 1UCRA 3FMRA 3RTRA 2ISZA 2Z2SB 5EF6A 2XPVA 1ZG3A 4LOCA 1XPXA 3AG1H 5KAFC 3ROUA 2WY7Q 1LEBA 2B7EA 1ZAOA 3M1CA 2FQ3A 4XSXF 2XF5A 4CXFA 1U8BA 2V9VA 1R1TA 2ZC2A 1P4WA 1YW7A 1TWFJ 3DTIA 4ANJA 1HLVA 2DQRA 1JTXA 2HKOA 2WAFA 2ESHA 3PM1A 2F5CA 3F8BA 3ZMDA 3TW6A 2R7XA 3K2ZA 2QYOA 3IUOA 2KP6A 4BQNA 3BT9A 3OS0A 4I98B 2DOFA 2R92J 4RDUA 3LSGA 3HSFA 2BV6A 2YU9J 2G9WA 3H9GA 4ZYAA 4H4KC 4PDKA 4IRHA 1AKHA 5ED4A 2VKHA 4HEA2 1EV7A 1GHCA 4II2A 2BZTA 2F4MB 3VB2A 4BHCA 4U0VA 2BY3A 1Y0NA 3CQZJ 1ON2A 5M5YJ 4P96A 5F0HA 4DW6A 3TO7A 5HODA 4GYGA 4BJ6C 4BEHB 2ZNYA 2AHQA 1T98A 1YX3A 2PMUA 4G6QA 3PIPF 5FKKA 3BR0A 2EH3A 1S7OA 2IBDA 2RVCA 3BG5A 4AWXB 2RC4A 4D1QA 2KJBA 4L5IA 2EV6A 4KMFA 3RKQA 4NBQA 1U5TA 1TBXA 1ULYA 3MVPA 2ZJ2A 4W97A 4BYYA 3FDYA 1A35A 4IL6C 1H9GA 2RNGA 4XONA 2CSOA 4BXXJ 2ECCA 2KDZA 1T0FC 1ZREA 3IWZA 2EFOA 3J7YJ 5E8GA 3S2WA 3V7SA 1U6GA 1TT5B 3ZMZA 2BEOA 2IEKA 2BHYA 2TDXA 5C44J 2CGPA 3T5XA 3BTLA 3JREA 3OL4A 1GXPA 4J00A 5F6FA 2FE3A 4A3LJ 3S1RJ 1QU3A 1S6LA 2XAJA 1ZTRA 1V5FA 1OCCH 4RAFA 3Q5FA 3F6VA 2V4JC 3G71I 2ID6A 1IRGA 1J2XA 2R7WA 2DPUA 1I6HJ 1U5TC 2WV0A 3WTZA 1K83J 2RREA 2E1CA 4FE4A 2VUMJ 1VQ6I 2VE8A 1IJWC 1FBUA 3BOQA 3VSLA 5D6EA 3CTAA 2I5UA 1HW5A 2XB5A 4XL9A 4E7SA 2VJ4A 1XSXA 3KZYA 4BY1J 1FMWA 3WTWC 1DQUA 4IPAA 2JPBA 3O3KA 3E5UA 1HDDC 5FFXA 3K0LA 3S1QJ 3BR6A 1YW8A 3DP7A 5EEHA 5C3EJ 5JLWA 3EUKL 1LFUP 1Z6TA 1A36A 3BG9A 2ZJPF 4BBSJ 1VQ8I 4GXOA 3CMMA 1IN6A 4XORA 3J7AY 2I10A 2KFDA 1BOAA 2V9KA 5FO5A 4WWCA 1XSDA 3LFUA 4Y33A 2HOAA 2CQXA 4Q47A
chains in the Genus database with same CATH topology
3PL8A 1Z3XA 5FRMA 4P1WA 2MD0A 3UNGC 3DTKA 4CCJA 2E5NA 1W36D 2L5QA 2VQLA 2M7AA 4C2UA 1ZELA 2X85A 4RLQA 2CUJA 4BACA 3F9KA 3IP4B 2X6YA 3IAM2 2WB1A 3OS2A 4PSWA 4EATA 1JI8A 3QYFA 4RMNA 3DU6A 1EA3A 2UV1A 3HKZA 4RLFA 3AL0B 2JUGA 2LG4A 5CKTA 3DPTA 3VYRB 2X1CA 3K4NA 1D0YA 1MNDA 4HPQA 2AQFA 4CCOA 2R7SA 4E7IA 2W4SA 5CPRB 4F91B 4B44A 1J09A 2VB6A 3HOSA 3OIPA 3FKJA 1MMDA 1WJDA 2HDWA 4BS9A 2KQRA 2HPIA 2IXSA 2LYCA 3EUAA 4JOMA 3OIQA 3DWLE 2DT7B 4PK4A 3MKWB 1MMAA 3HXLA 3V42A 2X1EA 4XLAA 1FMVA 2KHMA 2XC7A 4E7HA 3RPUD 2PJRA 2IS1A 3S3MA 2DOAA 1LFPA 4P5OA 5TGTA 2Z16A 2NOJB 3DEEA 4E7JA 2ZXHA 2VQHA 4N4OB 2BW3A 4BL0B 2X1DA 1N77A 2K5CA 1BOBA 2V26A 4QPOA 5FROA 3K4MA 4YELA 1ERDA 5HLTA 3OYBA 3SDBA 2M4GA 4MLOA 5KNLA 1DP3A 4C9YA 2X6XA 2ZSIB 3U21A 4BDZA 2M4KA 4B43A 1YX5A 3H5NA 4HNTA 2HPMA 3ZCOA 2XF7A 1WJFA 4PJMA 2VJ5A 2FUG2 1NG7A 3BLYA 1V5GA 3W2VA 4PJJA 1R6RA 4XOPA 3DPLC 2VPLA 3FBIB 2IGNA 4B47A 4CSWA 4BQQA 2VKDA 1UELB 3OMYA 1BR1A 3ZRGA 1MW7A 3ZQQA 2W00A 3PJRA 3A1YA 3OS1A 1PJRA 2CMPA 3CESA 3CJQB 2KRHA 2V1NA 3DQVC 3E0JB 3LSIA 2BW3B 3D5LA 4PFPA 3OYFA 4D9JA 1X4OA 2MFZA 2P0WA 2V7FA 4OAYA 3QYEA 3K4BA 4E6KG 2F4IA 2VQCA 4II3A 4F93B 3AL0C 2OUMA 2WAEA 4NUBA 4DBRA 3OYMA 3H5RA 4CH7A 2E1MC 2E1MB 1DGRM 2RQQA 3K4JA 2HNHA 3DKXA 3OYIA 2BVLA 4HSTA 2VXZA 1MMGA 1W36C 2ZXIA 2CV0A 4R79A 3H35A 4BQOA 4IX7A 3L2WA 4XMYA 2KPMA 3I9V2 3BCBA 2KRCA 1Y6IA 3S3NA 3KYLA 2DCEA 3K70D 2W82A 4YRVA 4JQFA 2M7BA 4AYBA 1NG6A 3CF2A 3FBNB 3CP2A 1X4PA 1HA8A 1UG0A 3H0DA 4F92B 3SZGA 3N05A 2WBMA 3EPZA 3C2GA 1WJ5A 2ELJA 3S93A 3TBIA 1YE9A 3MD2A 4FASD 2Q2EB 1BR2A 4DGWB 3ZR8X 2I8DA 3LSKA 2ZFUA 3PSFA 3M8JA 3OYNA 2HVRA 3K4CA 2R7OA 3PNTA 1N78A 1X1DA 4FETA 3HOTA 3D5SC 3OYEA 4U7BA 4RM3A 1X1BA 4NNJA 3TL4X 3QOEA 3HUGB 1KONA 4BXFA 4ZDOA 3RCOA 3L2VA 3PNVA 5HNHA 3KEYA 1D0XA 2DJIA 4F52A 2W1OA 2CH0A 2R7UA 2HU9A 2UWMA 1S9HA 3A4CA 4Y4RA 4BEHA 2UUZA 1P9QC 4B48A 3ONQA 4LIVA 5FRNA 2M0MA 3OYHA 2F6CA 4BE2A 3I3LA 4E7KA 2XAUA 4B3XA 4DBQA 3OYJA 3DPUA 4XLFA 3HG9A 3FHNA 4BUPA 2R7QA 2IS2A 4BU2A 2OC6A 2GOXB 2CV2A 1OLTA 4CCKA 3VYUB 3H9JA 3PNYA 4IZZA 1TT0A 4E7LA 1MNEA 3K10A 2CW7A 2K9LA 1T95A 1N75A 4ZTJA 1Y56A 2L9NA 2PMZA 3VWBA 3VDXA 3OL3A 1WJAA 3BG6A 2HVSA 2PJRB 2E60A 4YEJA 3VSKA 2XSJC 4HSRA 4OWRB 3AFHA 3C2HA 4F3QA 1WFXA 2Q1ZB 4NQWB 4HRIA 4IKFA 1DGWY 2JVGA 2IS6A 3L2QA 3L2UA 4ZC3A 4GRIA 3AKZA 2WY8Q 4PJNA 4ZDLA 4CUGA 4ZTFA 2V6EA 4XR6A 2WAQA 4BE1A 2CUZA 5HOOA 4XKCA 2LC2A 2XF6A 2MABA 4KITB 3QODA 2JA2A 4LIUA 3BG7A 3SEZA 3ZXSA 4XKVA 1IRXA 1UAAA 3OR1C 3E1SA 2WADA 3S3OA 3MKZA 5KCMA 2GOMA 3CZ6A 3OYLA 3NWSA 2R4GA 2E5ZA 3CJRB 2QKLB 1K6YA 3HC7A 3HL2A 2XDVA 2QKMB 4CA0A 4ITVA 1WJBA 5HNFA 2KLOA 1GLNA 2ZSHB 3BC8A 4RM2A 2LBFB 4BDYA 4IQJA 1D1BA 4XLCA 2CFOA 2VIXA 2M3AA 3HPGA 3QYBA 3S8PA 2CS3A 2WA0A 3HPHA 5CQEA 4AU7A 1PYVA 4KISA 2A5WA 2JVHA 3KX2A 2DXIA 4AVZA 3OY9A 2IS4A 4XM3A 3ZGKA 2Z1DA 2VQGA 4NC8A 4XLHA 3RTRA 2Z2SB 1LDKB 4PJLA 2L7KA 2VLAA 5KHDA 1X1AA 4Y3OA 2LBFA 3K70C 4XLEA 2CV1A 2WY7Q 1G59A 3M1CA 3LSHA 3PSIA 2XF5A 3NWTA 2HZDA 2HQAA 3DU5A 2BVMA 4ANJA 3DTIA 2IGKA 1Z7LA 2WAFA 3VYTB 4XOTA 4C2TA 4XKBA 2IGMA 3RSNA 3MMYB 4HNUA 4IQ4A 4CCLA 2R7XA 1X19A 3IUOA 4XKWA 4XN0A 2L2OA 5JHFA 4X0GA 4LITA 3EUHC 2KP6A 4KT6A 4BQNA 1VZ0A 2R7VA 3BCAA 3OS0A 2MC4A 5LFAA 3GBGA 2VASA 3LSGA 2DT6A 1TZLA 3OYDA 1SAUA 2LY2A 3H9GA 4ZYAA 3OYKA 3A2KA 4H4KC 4CZCA 4XN3A 2VXDA 2VKHA 4HEA2 2K9MA 3K4LA 4II2A 2F5VA 4LG3A 2X6WA 3OYAA 3G2BA 1Z21A 4PUSA 3OWTA 4E4HA 2CW8A 2KL4A 2Y0SA 3W2AA 2VL8A 4HG2A 4BJ6C 4E7ZA 4BGDA 4BEHB 4DIQA 1YX3A 1QHHD 2K3PA 1QHGA 4F55A 4D1QA 4J01A 2OV7A 4OAZA 3UR3C 1WJCA 2VJIA 4BE0A 3FDYA 2VJJA 3DTEA 2MYSA 1V5EA 4N4NB 1WJEA 1U0JA 2RNGA 4XONA 3PUBA 3OOUA 4XNFA 4C30A 2HVQA 1T0FC 1LVKA 3W3CA 2LY1A 3CP8A 3OYCA 3LL7A 3H9QA 3OR2C 3MKYB 3W2WA 4BJTA 1LKXA 1D1AA 4CCNA 4ZDPA 3IAS2 3OL4A 4J00A 2W7NA 4CCMA 1QU3A 2R7RA 1MMNA 3VYSB 3PFYA 1V5FA 3L2RA 3H5AA 2V4JC 3DLAA 1E0EA 2LREA 3LMMA 2LH9A 2R7WA 2X51A 1D0ZA 4PFOA 3K6GA 2RREA 4NC7A 3S32A 4KJZA 3D5RC 1SFKA 2BOLA 5LD2C 3VSLA 4XL9A 4E7SA 1D1CA 4XQFA 4DJAA 2VJ4A 1BR4A 2R7TA 1FMWA 1G8XA 5CQGA 4U87A 1DQUA 4QPQA 2L9SA 1OR7C 2JSPA 3EUKL 4BJ5C 2KMUA 4ZJZA 2LOOA 1Z3YA 2LRDA 4G6TB 3OYGA 3CMMA 2O5RA 4XORA 1AA7A 3SEQA 4DOZA 3LSMA 3DKYA 3K4KA 3J7AY 2KDOA 2V9KA 2KZVA 3RQ4A 2A6TA 3LFUA 3TMOA 4Y33A 3SYTA 2IGOA 1X1CA 4PSXA 2AQEA 5HVQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XF6 A;  2XF5 A;  2XF7 A; 
#chains in the Genus database with same CATH topology
 3FM5 A;  2MD0 A;  1JHH A;  4A3J J;  5CVJ A;  3UNG C;  2E1O A;  2HQR A;  4MGR A;  4JX6 A;  3CLO A;  1ZK8 A;  4L9V A;  4A0X A;  1KU3 A;  5DUK A;  3KLO A;  1I39 A;  3IP4 B;  4ZZL A;  3IAM 2;  3IH3 A;  2WB1 A;  4PSW A;  2OF7 A;  1JI8 A;  3EYI A;  3QYF A;  1YJN I;  3L00 A;  4IHY A;  5ICF A;  1LPQ A;  1QZE A;  1QGP A;  3AG4 H;  4HX8 A;  5J8C A;  2JUG A;  4HLX A;  2JWT A;  2DT5 A;  2LG4 A;  1YFH A;  2WTE A;  1D0Y A;  1MND A;  2NS7 A;  2R7S A;  1C0W A;  5M5X J;  1IO2 A;  1PVE A;  4Z6Y A;  4CO8 A;  5HLI A;  1GVD A;  1PUF B;  1A31 A;  1XG1 A;  1ZH5 A;  1GUU A;  3G1M A;  3EUA A;  4JOM A;  3GLL A;  1VF9 A;  4HV5 A;  3DWL E;  1P7J A;  4B4C A;  1PP7 U;  1B72 B;  1IN8 A;  3MKW B;  1MMA A;  1T2K A;  3TQN A;  1E3O C;  2KHM A;  2STW A;  1IF1 A;  1UHW A;  3FIS A;  3U2R A;  5TGT A;  1XMK A;  1P4X A;  4N4O B;  1YG2 A;  2CFX A;  5K7Z A;  1W5T A;  3R4K A;  4BL0 B;  2XV4 S;  1R1V A;  2K5C A;  1OFC X;  2OJE D;  2FBH A;  3ZQI A;  1F5T A;  1T08 B;  3V8L A;  2GZW A;  1RES A;  4MEY F;  5D5X B;  5FRO A;  2NRA C;  3K4M A;  2XSD C;  2E2I J;  3E5Q A;  2OPT A;  1RKW A;  5DUI A;  4MLO A;  2BY1 A;  5KNL A;  2Y9Z A;  1MKM A;  3QWL A;  3U21 A;  5KAI C;  1YX5 A;  3CCM I;  4LLN A;  4KUM A;  2VJ5 A;  2B0L A;  2IT0 A;  3W2V A;  3F6O A;  1R6R A;  2JJ7 A;  3Q0V A;  3HB9 A;  2VPL A;  1KYW A;  4GGG A;  5F0C A;  4B47 A;  4M6Y A;  4D5F A;  2V9P A;  1UEL B;  1BW5 A;  1H8A C;  1IG7 A;  3RIR A;  3I4P A;  1MJB A;  1B9M A;  3A1Y A;  5ERI A;  2PMH A;  3LSJ A;  3CES A;  3CJQ B;  2KRH A;  2BXZ A;  2K86 A;  5HLG A;  3I58 A;  4PFP A;  3JRD A;  4D9J A;  2V7F A;  4QSH A;  2HGC A;  4A69 C;  3LA2 A;  1TWA J;  4II3 A;  2XGX A;  1A04 A;  2OUM A;  2EK5 A;  4LJZ F;  3RJP A;  1VI0 A;  3QPT A;  1LEA A;  1VTN C;  1R5H A;  2RQQ A;  2XRO A;  1HW2 A;  5AIP A;  1EH8 A;  1UMQ A;  3JW4 A;  2WC2 A;  2W24 A;  3J80 Z;  2CV0 A;  1LJ9 A;  1R58 A;  2KZG A;  5JLX A;  1ORK A;  2M45 A;  1MGT A;  3GME A;  3LST A;  2HWV A;  3I9V 2;  1LVA A;  2JT1 A;  2D1V A;  2YX4 A;  3OSG A;  4IHW A;  1USS A;  3MZ8 A;  1ZGW A;  3KYL A;  1S72 I;  2QSH X;  4O3M A;  3GZ5 A;  2DCE A;  4YRV A;  2GLO A;  4AYB A;  2XAS A;  3BJA A;  4FT8 A;  1HA8 A;  3ZMT A;  3DXJ F;  1UG0 A;  1TW2 A;  1IN4 A;  3J7A O;  4F92 B;  1BA5 A;  1Y1W J;  1O3R A;  1MIJ A;  5DD4 A;  1FOY A;  4BY7 J;  4LLG F;  5EGO A;  3ZP5 A;  1OJL A;  2PFB A;  3ZR8 X;  3LSK A;  1OCO H;  2ZFU A;  4RGR A;  2KIU A;  4UVC A;  3PSF A;  1KU7 A;  4IJA A;  3F8M A;  3D5S C;  4M9Z A;  3GTJ J;  3OYE A;  3ZOB A;  3JRB A;  4BHP A;  2GWR A;  3TL4 X;  3L1P A;  1ZYR F;  3HUG B;  3L7W A;  4Y13 A;  1KON A;  4BXF A;  4ZDO A;  4UHT A;  3Q0W A;  4B3A A;  1I1G A;  1Z6R A;  4F7Z A;  5HNH A;  3KEY A;  2DJI A;  5LEJ A;  1GT0 C;  4F52 A;  1IDY A;  5GPA A;  2XUB A;  3A4C A;  1J9I A;  1ACI A;  2RKH A;  4BEH A;  2HTS A;  3ECO A;  3EET A;  4B1R A;  2NS8 A;  3ONQ A;  4LIV A;  1K6O A;  3GZN B;  1X58 A;  5CVV A;  3IKT A;  3N4M A;  1YJW I;  2F6C A;  4Y52 J;  2ZXW H;  3SFZ A;  4E7K A;  3ECH A;  2XAU A;  2IW5 A;  3OYJ A;  2MLK A;  5BPI A;  2M87 A;  2YS9 A;  2Z99 A;  1HKQ A;  4XLF A;  1FJL A;  5HLH A;  3HG9 A;  2HKX A;  5IY5 H;  2EZL A;  1NTC A;  3TW7 A;  3TGN A;  2GOX B;  3CME I;  3LOC A;  1NK2 P;  3PO2 J;  3PNY A;  5HDN A;  5HS9 A;  4O6J A;  4IZZ A;  4E7L A;  5LGN A;  1OYW A;  3K10 A;  4IHV A;  3QAH A;  5H6Q A;  1QRY A;  1R5G A;  2L9N A;  2H27 A;  3KET A;  2IP2 A;  3CJN A;  3CCU I;  1O3S A;  4P9F A;  1V54 H;  3HRT A;  2O6G E;  5TIS C;  4IOA F;  4UVB A;  3RYP A;  9ANT A;  2XSJ C;  4HSR A;  4LB6 B;  1ZG1 A;  2DA4 A;  3Q0U A;  3E3V A;  4MFE A;  2IAI A;  3RDI A;  1VQP I;  2W85 A;  1DGW Y;  1KU9 A;  3L2Q A;  1VQ7 I;  3MFK A;  4A3K J;  3FWE A;  4GRI A;  1ETX A;  1YQA A;  1SVL A;  2QVO A;  4M3G A;  4V2F A;  5J3L A;  3P7N A;  4ZDL A;  4CUG A;  4AIK A;  1FBQ A;  3FXO A;  2F5E A;  3U1K A;  3HKZ N;  4BHB A;  3DLL F;  1OCR H;  2UXX A;  2F5F A;  4ZYG A;  3C3W A;  5LGU A;  3UKG A;  1H88 C;  2EZK A;  2DA5 A;  1G4D A;  1M1E B;  3SEZ A;  3BG7 A;  3KEQ A;  1APL C;  3H3V K;  2KIF A;  4H0E A;  2K3F A;  3B6A A;  5E3O A;  1YYV A;  2L7Z A;  1L3L A;  1CF7 A;  2OTJ I;  4PGG A;  4JK1 X;  2FNA A;  3CZ6 A;  4M3B A;  3H36 A;  2CW0 F;  1Z05 A;  1ZGJ A;  5E3L A;  2LDU A;  2R4G A;  3K69 A;  2N8G A;  2QKL B;  4RAG A;  1LDD A;  1K6Y A;  2ZME A;  5EG0 B;  3HL2 A;  2MC3 A;  2ZKZ A;  3R0J A;  5FJ8 J;  4EJT A;  2CUF A;  4ITV A;  3SZT A;  3CUQ A;  4A5N A;  4BDY A;  1NK3 P;  4DYR A;  3CCE I;  3CC7 I;  1G3T A;  1D1B A;  1T6S A;  1Z77 A;  4XLC A;  2CFO A;  5M3F J;  2XAH A;  1OPC A;  3GW2 A;  2L01 A;  3HPG A;  1SFE A;  2R5Y B;  1SD7 A;  2WA0 A;  3HPH A;  1F1Z A;  2TRT A;  5CQE A;  3Q9S A;  2M9H A;  1W7P D;  1KGS A;  1PYV A;  2NXN B;  3QP5 A;  5LRR A;  5J4Y A;  4ESJ A;  1PUE E;  1OCT C;  1IXR C;  1XMA A;  2JVH A;  4ENN A;  3DCF A;  4XLN F;  2DXI A;  4AVZ A;  3OY9 A;  1B1B A;  1LB2 A;  4I0B A;  4XM3 A;  3ZGK A;  3FXR A;  2VQG A;  1LDK B;  3NQO A;  4W1U A;  1GVJ A;  3WTY C;  2OCC H;  3CLQ A;  3CC2 I;  2VLA A;  1TLH B;  1FEX A;  4EJU A;  1BI2 A;  4Y3O A;  5E79 C;  2H8R A;  3K70 C;  1JE8 A;  3KP6 A;  2CV1 A;  1G59 A;  2JPC A;  2AXT C;  3PSI A;  1LNW A;  2XGC A;  2HQA A;  2OQG A;  3DU5 A;  2ELK A;  4KN4 X;  5AIQ A;  2PQ8 A;  2A6H F;  2IGK A;  3QRF F;  1I27 A;  1Z7L A;  4I99 C;  2LMD A;  2GBY A;  3VYT B;  4XOT A;  2O03 A;  4C2T A;  4K2E A;  3MMY B;  5E17 F;  3F22 A;  3S15 J;  3WHB A;  4XKW A;  2E36 A;  3F3X A;  4IHX A;  5JHF A;  3BTI A;  2D2W A;  1XDU A;  1VZ0 A;  2MC4 A;  2J5O A;  5J4V A;  4RBO A;  1TQI A;  4N0B A;  3GBG A;  2VAS A;  2ZNZ A;  2DT6 A;  3SXY A;  1S3J A;  4I02 A;  3HSE A;  3B73 A;  4CZC A;  4A5M A;  1TL8 A;  5HS8 A;  3GX4 X;  4A3M J;  2F5V A;  1X1P A;  3QP6 A;  4LG3 A;  4AVP A;  1JUP A;  2RV8 A;  1FYK A;  5BNG A;  2P8T A;  3KZI C;  3ZQL A;  3VPR A;  3ZQF A;  3BR5 A;  2VL8 A;  2L02 A;  4EJO A;  3RZO J;  4BGD A;  4DIQ A;  1BC7 C;  1AWC A;  1X2N A;  2AXL A;  3I5U A;  1QHG A;  1ZKG A;  3A01 A;  2VT3 A;  4G8X A;  3GTQ J;  2COB A;  3UR3 C;  4EGZ A;  3T8T A;  2L9V A;  1WJC A;  4HX7 A;  2ZCW A;  3HTS B;  4OMY A;  5FKN A;  1WJE A;  5FD6 A;  4BXU A;  3AG2 H;  4M9X A;  5EZH A;  1IV6 A;  4UY8 I;  3P5J A;  2CQN A;  2TCT A;  2MLG A;  3EQL F;  2IA0 A;  1MBH A;  1LDJ A;  2KIM A;  2LY1 A;  4FX0 A;  3RKY A;  5LEK A;  1X2M A;  4ETS A;  3J80 K;  4FCY A;  4GDF A;  2A05 A;  2R5Y A;  4RGS A;  4TV7 A;  3H9Q A;  3OSF A;  3MKY B;  2PJP A;  1U8R A;  2QA4 I;  5F08 A;  1D1A A;  4IHS A;  4ZDP A;  2QZ8 A;  5IOZ A;  5DEQ A;  1XCV A;  4CCM A;  2DK8 A;  5EEG A;  1PDN C;  2LD5 A;  1ZN2 A;  5KK1 A;  4KFC A;  5ICE A;  1E0E A;  2JMW A;  3FZV A;  3LMM A;  2ZJR F;  1D0Z A;  3HEF A;  1FSH A;  1N25 A;  2L7M P;  5IOY A;  3D5R C;  2OA4 A;  1YRN A;  4EJV A;  1ZGA A;  3MZH A;  3E6C C;  2EPF A;  4WXC A;  1G8X A;  3S17 J;  5CQG A;  3ZMU A;  1SAX A;  3GVA A;  3HHH A;  4U87 A;  3W6K B;  4WXH A;  4C3J J;  1RET A;  3R61 A;  3ABK H;  4CYC B;  5EGO B;  4AID A;  3DBR B;  3S1M J;  4EMS A;  2AS5 F;  3ZQH A;  1Z3Y A;  2LRD A;  2FBI A;  2X48 A;  4G6T B;  3OYG A;  2W84 A;  2DFH A;  1SVO A;  4HBL A;  4KA4 A;  1AA7 A;  4PZJ A;  1R7J A;  2EFP A;  3K4K A;  2A6T A;  1D5Y A;  4KT5 C;  1XX5 A;  4HNV A;  2AQE A;  4D0P A;  4KIF A;  4Q48 A;  2A6E F;  1H9T A;  2FX0 A;  3BTJ A;  2LNB A;  1UB9 A;  2MW8 A;  1PP8 F;  1VQN I;  3G73 A;  2B9S A;  4JX5 A;  1XN7 A;  2Z33 A;  3G6E I;  1MZB A;  1O4X A;  4HV6 A;  3U1D A;  2K27 A;  1ZLJ A;  2L5Q A;  5E18 F;  2M7A A;  4C2U A;  1TQM A;  1ZEL A;  4RLQ A;  2HFH A;  2CUJ A;  4YII A;  4BAC A;  1J0R A;  2FEZ A;  3F9K A;  1MH4 A;  1TC3 C;  3BZC A;  4S0H B;  3OS2 A;  4LFU A;  1ZRC A;  2D45 A;  3BY6 A;  4RLF A;  4A3C J;  5IYC J;  2OAZ A;  2HDC A;  2P6T A;  2DPD A;  3CO6 C;  4ZH4 F;  4HDV A;  1Y8Q B;  1ETQ A;  3GWZ A;  5CPR B;  1K79 A;  2BYV E;  2K9N A;  3JRC A;  3OIP A;  3FKJ A;  2QQ8 A;  2LP0 A;  2KQR A;  3I53 A;  2HPI A;  3FKI J;  2LYC A;  5B66 C;  3TO6 A;  3TED A;  2Y69 H;  3V42 A;  3MEX A;  5BS6 A;  4XLA A;  1ONV A;  5LHG A;  1FMV A;  2XC7 A;  2UZK A;  2DOA A;  3C18 A;  3WTV C;  4E7J A;  1SD5 A;  2ZXH A;  4HX4 A;  3QOP A;  2X1D A;  3G1O A;  1BIB A;  5GTI C;  2EIJ H;  3GTL J;  5BQT A;  1BOB A;  2V26 A;  2Z9O A;  4DYQ A;  4RB0 A;  1RNL A;  4YEL A;  3DEU A;  3I54 A;  1MNM C;  4KIB A;  3OYB A;  3S1N J;  2M4G A;  1D8J A;  1DP3 A;  2FML A;  1RR7 A;  2X6X A;  3P9K A;  2M4K A;  4OIN F;  1BJA A;  4HNT A;  1TNS A;  2HPM A;  2XF7 A;  4XRS G;  2M8G X;  4PJM A;  1K4T A;  3ABL H;  2P6S A;  3WE3 A;  3C7J A;  2C6Y A;  2B63 J;  3FBI B;  4I7H A;  2NVY J;  3WTU C;  2VKD A;  3S2D J;  1B8I B;  2PG4 A;  3ZRG A;  4PJ0 C;  2K4B A;  2ZFW A;  4OIP F;  4D5C A;  2ETH A;  1PJR A;  3QPH A;  1QZZ A;  2CMP A;  4HQM A;  4N9I A;  2V1N A;  3E0J B;  4UV9 A;  4ENK A;  2XGE A;  2BW3 B;  5EYR A;  4MEX F;  2QQ9 A;  4MFD A;  3WU0 A;  1D3Y A;  2VON A;  3E7L A;  3QYE A;  3K4B A;  4AC0 A;  3LWF A;  5F64 A;  2G7U A;  3X2Q H;  4IRI A;  4DBR A;  3OYM A;  4PCQ A;  2E1M C;  1XGN A;  2DU9 A;  3F0C A;  2X4H A;  2HNH A;  1DUX C;  1XS9 A;  2FA5 A;  4HST A;  1ETW A;  3GTM J;  2VXZ A;  2DMP A;  1QZY A;  5LGT A;  3NAU A;  1OCZ H;  2HS5 A;  4EGY A;  2E7X A;  1FPQ A;  3L2W A;  3WG7 H;  4L0Z B;  6PAX A;  5K7F A;  3GTG J;  2KRC A;  1X3U A;  2G0E A;  2P7C B;  1Y6I A;  3VOD A;  3K70 D;  4JP0 A;  3BTC A;  2M7B A;  1DDN A;  3JTH A;  3NEU A;  3V8K A;  3FBN B;  2ME0 A;  3CP2 A;  4UB8 C;  3F23 A;  3H0D A;  5JI6 A;  3HYI A;  3LAJ A;  3N05 A;  2WBM A;  3EYY A;  1WJ5 A;  2ELJ A;  3IH2 A;  3PFI A;  3TBI A;  4FAS D;  2Q2E B;  3WE2 A;  1BR2 A;  3WG9 A;  2EIN H;  2MSY A;  3RPQ A;  3DF8 A;  2KKO A;  2HDD A;  1D8K A;  1XCB A;  4D7N A;  1FP1 D;  1SD6 A;  3K4C A;  1K78 B;  4FET A;  1BN5 A;  2JA6 J;  1VQK I;  3V7R A;  4RM3 A;  3DBH B;  2M0C A;  1X1B A;  2L4M A;  2QQA A;  1A6Q A;  3I64 A;  3CJT B;  3RCO A;  3MWM A;  4R1H A;  3K9T A;  4B8X A;  1I3Q J;  5M5W J;  4GO1 A;  4BAY A;  3JR9 A;  3A0H C;  4MQ9 F;  5BPD A;  2V1U A;  2UWM A;  2R7U A;  2GM4 A;  1DU0 A;  3WU2 C;  2UUZ A;  1P9Q C;  2HOE A;  4HOB A;  3WGG A;  2F2E A;  3KP7 A;  2GXB A;  5EJC A;  3KE2 A;  4OIQ F;  2PEX A;  5LBQ A;  2ACJ A;  1YOV B;  1HQC A;  3FM3 A;  2DOD A;  3HIF A;  1FLI A;  2V1D A;  1TW3 A;  4RAY A;  2ME6 A;  3V8J A;  1QPM A;  3TP0 A;  2OD5 A;  5L3C A;  2IS2 A;  4CGZ A;  1YLF A;  1YIJ I;  2CV2 A;  1BIA A;  1RI7 A;  3VYU B;  3H9J A;  3OV8 A;  1T38 A;  3LSP A;  4EM0 B;  3GFI A;  1MNE A;  4KN7 X;  2K9L A;  1T95 A;  1MSE C;  1EJ9 A;  2QF7 A;  3IWF A;  1QA6 A;  2CYY A;  3VWB A;  1F43 A;  4ASN A;  2RN7 A;  3OL3 A;  2QGU A;  2LK2 A;  4NB5 A;  1WSU A;  2HVS A;  4M74 A;  2VC1 A;  1WI3 A;  3T1B A;  3ZQG A;  2NS0 A;  1BBY A;  2P4W A;  3C2H A;  1I6X A;  4IEJ A;  4A0Z A;  2M2E A;  4NQW B;  2HXO A;  4M9S A;  2O7O A;  5DCF A;  2NVX J;  1R9T J;  4L18 B;  3HOU J;  2IS6 A;  4KNY A;  4U0W A;  4ZC3 A;  2H94 A;  3SFI A;  1U3E M;  1J59 A;  3ISP A;  1FBS A;  1REP C;  2WY8 Q;  1V4R A;  1SEU A;  2XIG A;  4XR6 A;  2WAQ A;  3TKY A;  4BE1 A;  1Z91 A;  5HOO A;  2Z3Y A;  1MBK A;  4KIT B;  4MHG A;  5JVT A;  1AU7 A;  1JGG A;  2DDA A;  3CCR I;  1EH6 A;  1JKQ C;  4ESF A;  1WVR A;  4LIU A;  1ZQ3 P;  3ZXS A;  1HC8 A;  1IRX A;  2OU2 A;  3HTU A;  1KQ9 A;  2CU7 A;  2L4A A;  3OOP A;  1YW9 A;  1TQP A;  2WAD A;  2Q8K A;  3MKZ A;  2GOM A;  2FJ1 A;  3W6J B;  2FBK A;  1MD0 A;  2P5K A;  3ABM H;  2XKP A;  2Y0S N;  4OOI A;  3H3U A;  5D5U B;  2DYR H;  4Q4Z F;  4R8H A;  4LMY A;  3M7G A;  2PX9 A;  2QKM B;  4CA0 A;  1IXC A;  4ENM A;  3GFM A;  2KLO A;  2DTR A;  1P4A A;  4RM2 A;  1STZ A;  4V2G A;  1R71 A;  4IQJ A;  3TOB A;  1JUM A;  3CUO A;  1JKP C;  2FOW A;  1T0F A;  2MGQ A;  4I76 A;  5DYM A;  3QYB A;  4D7M A;  1BI0 A;  4Z2Y A;  4M72 A;  5D8L B;  1B6A A;  2IRF G;  4DQ2 A;  4LD5 A;  3I4N J;  2XAQ A;  1O7F A;  1G3Y A;  2IS4 A;  4PGH A;  3S14 J;  3HOV J;  2L3D A;  2Z1D A;  5A2Q K;  4NDL A;  4NC8 A;  5AON A;  2M5W A;  1A6I A;  4LK1 F;  3F8N A;  3HRU A;  2DFE A;  2XRL A;  1T39 A;  2O8X A;  3NWT A;  4WK8 F;  1FY7 A;  5F1R A;  2BVM A;  5L3B A;  2GIZ A;  1KQ8 A;  1SFX A;  4XKB A;  1HW1 A;  4QTR A;  3RSN A;  1XDS A;  1T8I A;  1IUF A;  4CCL A;  1U78 A;  2MH2 A;  2H1K A;  2F5D A;  1W4M A;  2L2O A;  3CCY A;  3RPU A;  4X0G A;  2VBW A;  3LFK A;  4KT6 A;  1T56 A;  3O6B B;  3HOW J;  3BCA A;  5HS7 A;  5J1U A;  4EM2 A;  3CF5 F;  2O9L A;  1TZL A;  1BL0 A;  1SAU A;  2LY2 A;  3OIO A;  3ZQC A;  3OYK A;  1JJ6 C;  4XRF A;  3A2K A;  2OQR A;  4HLY A;  3QPL A;  2K4J A;  4XN3 A;  4AYB N;  3CCV I;  3IH4 A;  2ZBK A;  2X6W A;  2EJR A;  3OYA A;  3G2B A;  5CVI A;  3MCZ A;  1YHQ I;  1Z21 A;  1AHD P;  2XRN A;  4E4H A;  4UNO A;  3CDI A;  2CW8 A;  2DN0 A;  2O3F A;  2CWE A;  2KL4 A;  2Y0S A;  1RKT A;  3W2A A;  4HG2 A;  2JUC A;  2W57 A;  3B6C A;  2K3P A;  1XGS A;  1IN5 A;  2P5L C;  4J01 A;  2EA4 A;  4OAZ A;  1SMY F;  2H6B A;  1P7I A;  1WI9 A;  2K85 A;  1ITY A;  3FXU A;  2VJI A;  1LFB A;  4BE0 A;  2CO5 A;  4P55 A;  4I2O A;  2CUE A;  3CUQ B;  2ECB A;  3LAP A;  2M30 A;  1MDM B;  1NH3 A;  3DTE A;  1V5E A;  4N4N B;  5L3D A;  1U0J A;  5J40 A;  3PUB A;  2RQP A;  4XNF A;  4FE7 A;  2HVQ A;  4L9N A;  2OTL I;  1S8N A;  2VKE A;  2OBP A;  2P5V A;  2NAZ A;  5IT3 A;  1EKE A;  1JKR C;  3BR2 A;  3OYC A;  2ESN A;  3LL7 A;  2QBY B;  3O8G A;  2HEO A;  3MN2 A;  2UXN A;  3KYC B;  3W2W A;  1H0M A;  2QBY A;  1LKX A;  4A3E J;  3PO3 J;  1GV5 A;  4CCN A;  3IAS 2;  2O8K A;  4LLL A;  4EEF G;  2R7R A;  2ADU A;  1MMN A;  5EG0 A;  3PFY A;  3JRF A;  3KLN A;  3LA7 A;  3L2R A;  2FU4 A;  2M8E A;  3H5A A;  4ZYH A;  1P6R A;  1OCP A;  2M34 A;  5CJ9 A;  2FQ4 A;  1XMX A;  2LSO A;  3BZK A;  2VOP A;  3GZ6 A;  4PFO A;  3K6G A;  5F1J A;  1K61 A;  1VFC A;  3S32 A;  4KJZ A;  4A3I J;  1SFK A;  3KIO A;  3KP5 A;  4XSZ F;  3FXK A;  1D1C A;  1IGN A;  1BR4 A;  2PN6 A;  5A2Q Z;  2R7T A;  2FF4 A;  2FOK A;  4IO9 F;  4QPQ A;  2L9S A;  2X9D A;  1JUS A;  1ZG5 A;  4UXN A;  2JQ7 A;  2VE9 A;  2JSP A;  3F8F A;  5CVR A;  2KMU A;  4ZJZ A;  5B1A H;  2GA1 A;  4C3H J;  3BQZ A;  1KQ0 A;  3PIO F;  4DOZ A;  1QQI A;  4JYK A;  1E2X A;  2KDO A;  1S7E A;  2KZV A;  1P2F A;  2BXY A;  4QIW N;  1VQL I;  3TMO A;  3SYT A;  1X1C A;  4PSX A;  4MTE A;  3RKW A;  2PI0 A;  3FX3 A;  2YR2 A;  2D5V A;  5HVQ C;  3PL8 A;  1Z3X A;  5FRM A;  4P1W A;  2DDB A;  1TWC J;  1RPW A;  3DTK A;  5FKM A;  3BP8 A;  1L0O C;  1SFU A;  1X3W B;  1W36 D;  2HZT A;  5DCM A;  3KYD B;  1RRJ A;  3HSR A;  3SDG A;  2X6Y A;  2J5P A;  1JT0 A;  2DA7 A;  1ETO A;  2DMT A;  4EAT A;  5GTH C;  3ABU A;  3MAJ A;  2YPR A;  2PBI A;  3DU6 A;  1EA3 A;  3DFG A;  3HKZ A;  3I4M J;  1HKS A;  2E19 A;  5IP9 J;  4OIR F;  2QCO A;  2VBZ A;  2W25 A;  1QBJ A;  5E1X A;  2R7F A;  1RR8 C;  2Z5U A;  3VYR B;  4CDG A;  3K4N A;  4JX4 A;  2VOD A;  5LHH A;  1SC7 A;  4HPQ A;  3H3Z A;  2EIM H;  4F91 B;  3R0A A;  4B44 A;  1JGS A;  1J09 A;  5K7H A;  2HTJ A;  3A0B C;  2VB6 A;  1ZR4 A;  3K7A J;  4BS9 A;  2HDW A;  3K2A A;  2IXS A;  2BBY A;  3O8H A;  5ILU A;  2QSF X;  1EH7 A;  2RNJ A;  3FK6 A;  2DT7 B;  4L9J A;  1YIT I;  1MBG A;  4PK4 A;  1WZ2 A;  3WHC A;  3HXL A;  1IZ1 A;  3JRG A;  3H0G J;  2ELH A;  4E7H A;  4KYW A;  2IS1 A;  3S3M A;  1FOX A;  1TWH J;  4P5O A;  2RAE A;  1WCM J;  2W48 A;  1YRN B;  2LF7 A;  2NOJ B;  5JVG F;  2VQH A;  1VQO I;  1HST A;  1N77 A;  2DI3 A;  2DQL A;  1SAN A;  1IC8 A;  2ZME B;  5FFZ A;  4M3D A;  4DZJ A;  5L3E A;  4AIH A;  2K9Q A;  5CYV A;  3KPH A;  4WCG A;  1TP4 A;  1ERD A;  2BHZ A;  2DMN A;  3P9I A;  5HLT A;  2R5Z A;  2QM3 A;  3GLX A;  4C9Y A;  2MA3 A;  4L9T A;  2K02 A;  2JTV A;  1R23 A;  3ZCO A;  1OQY A;  2FUG 2;  1NG7 A;  4PJJ A;  4XRS A;  4FTH A;  4XLP F;  5IYB J;  5E3N A;  3QQA A;  1Y0U A;  1UG2 A;  3KCC A;  4BQQ A;  2DFF A;  3OMY A;  2BY0 A;  1BR1 A;  5LLQ A;  3ZQQ A;  2DMQ A;  2W00 A;  3TOA A;  1LUJ B;  3M1E A;  3QPS A;  2EFQ A;  1V3F A;  4RGX A;  1YS7 A;  1IN7 A;  4A12 A;  1R36 A;  1JJ8 C;  3LSI A;  3PQJ A;  3D5L A;  1H89 C;  3BG3 A;  2GIV A;  4F93 B;  3AL0 C;  2LR8 A;  2JK3 A;  2JA7 J;  2E71 A;  5L3G A;  1CGP A;  3BZ6 A;  3H5R A;  1J75 A;  4UUV A;  3H1C A;  2Q2E A;  4CH7 A;  1SFO J;  2DMU A;  1DPU A;  1WHU A;  1XGM A;  2NVT J;  1QNT A;  2E1M B;  3I59 B;  3M8F A;  1WH5 A;  3DKX A;  3FXL A;  2BVL A;  1O7L A;  2EZH A;  5JHU A;  1BM9 A;  1MMG A;  2CG4 A;  5K5O A;  1W36 C;  2ISY A;  2ZXI A;  4AD9 A;  1RZ4 A;  4R79 A;  2WV1 A;  5K5R A;  3H35 A;  4ON0 A;  5CLS A;  1CQT A;  4IX7 A;  4UB6 C;  3H92 A;  3GO5 A;  3LA3 A;  4YFN F;  4Y7N J;  5EZG A;  2NNY A;  1AOY A;  3JAM Z;  3LNQ A;  1GV2 A;  1RUO A;  3S3N A;  2DBB A;  5F0F A;  2W82 A;  1ETK A;  5D4S A;  1FTT A;  5J1Y A;  5GAH J;  3SZG A;  3G1L A;  3PQK A;  5IYD J;  5DCM B;  4V19 K;  2G7H A;  2P81 A;  1HKT A;  1YE9 A;  3I0T A;  1VQM I;  3TDZ C;  3K1M A;  1KU2 A;  2A61 A;  3V4G A;  4UUS B;  1LE8 A;  1O3Q A;  4OIO F;  4G7O F;  2ZJQ F;  2Y2Z A;  2MBF A;  2H09 A;  3OYN A;  2HVR A;  2R7O A;  3PNT A;  1X1D A;  3HOT A;  3L09 A;  3RYR A;  4EQQ A;  3CCJ I;  4BNC A;  4U7B A;  1WH7 A;  1P92 A;  1O57 A;  2LFB A;  2QQB A;  1G2H A;  3L2V A;  4WF2 A;  1ZAR A;  3PNV A;  2LTP A;  1FC3 A;  1JHF A;  5JFR A;  4BH9 A;  4C2M J;  1Z0X A;  2CH0 A;  1NHA A;  2L7F P;  2MH9 A;  2WWY A;  4YFK F;  2EA2 A;  4IRG A;  5F27 A;  5E8I A;  3IRQ A;  3BPV A;  3FXM A;  3OYH A;  2JSC A;  4BE2 A;  3I3L A;  1A5J A;  3M4O J;  4DBQ A;  2MG4 A;  4A6D A;  3ASN H;  1ZRF A;  1FT9 A;  2LF8 A;  3DPU A;  3CDH A;  3FHN A;  2GAU A;  2XPW A;  4BU2 A;  5DM7 F;  4RA2 A;  4N9H A;  2VKV A;  3REO A;  4YG2 F;  1VQ4 I;  1OLT A;  2K9S A;  5E1Z B;  2KJC A;  4UV8 A;  3AG3 H;  3D0S A;  2EIK H;  2CW7 A;  1N75 A;  2K7L A;  3HUG A;  4ZTJ A;  5E1W A;  3G4S I;  4X6A J;  2PMZ A;  2NVU B;  3LSR A;  3K1N A;  3NRV A;  1OYY A;  2HR3 A;  3DBL B;  5LHI A;  4C3I J;  3DV8 A;  1WJA A;  2DJN A;  2E60 A;  4FQG A;  2OZ6 A;  3VSK A;  3ABT A;  4JBA A;  2NOG A;  4MNU A;  4M6V A;  4U0Y A;  2Q1Z B;  1G3S A;  4HRI A;  3GF2 A;  1WKM A;  2JVG A;  3WTT C;  3L2U A;  1HBX G;  1SVM A;  1XTA A;  4WXD A;  3AKZ A;  4PJN A;  4ZTF A;  3F72 A;  4NHJ A;  2V6E A;  3IRR A;  5F04 A;  3U9G A;  3FXJ A;  2H8W A;  2MD5 A;  3NAR A;  4XKC A;  1HDP A;  2XF6 A;  1FIP A;  4I0A A;  3CCQ I;  2DOE A;  2E34 A;  3ZN0 A;  1Q1V A;  2JA2 A;  4IVN A;  2O0Y A;  3BQY A;  4YFX F;  2D1H A;  4X1E A;  4XKV A;  3A03 A;  5DS9 A;  1UAA A;  2HQ5 A;  3RI4 A;  3M07 A;  1W7P A;  3E1S A;  2ICW G;  3PUF A;  3GXO A;  3RKX A;  5DDG A;  3JCU C;  4HF2 A;  4DZP A;  2HYJ A;  2V1X A;  3OYL A;  4S04 A;  3NWS A;  2Y9Y A;  1UHM A;  5B3S H;  1D5V A;  2EB7 A;  3ERM A;  1I1S A;  3HOY J;  3HC7 A;  4M3E A;  5HNF A;  3BC8 A;  2LBF B;  1Y8R B;  3EDP A;  5FLX K;  1HSJ A;  5IPA A;  1QO0 D;  1IUY A;  2QUF A;  3D1N I;  5D4R A;  5H6R A;  2EV0 A;  1FOK A;  3A01 B;  4A3G J;  3S8P A;  4G12 A;  2CS3 A;  1WPK A;  1K7A A;  1ENH A;  1XSV A;  2YU3 A;  3WGH A;  1R22 A;  2A5Y B;  2A5W A;  2BY2 A;  4M3F A;  4UUS A;  1LE8 B;  2FMY A;  2KIS A;  1YS6 A;  4RAZ A;  3WTX C;  2DK5 A;  2YX7 A;  3C2B A;  3R6S A;  3BRO A;  1B59 A;  2PMZ N;  2E2J J;  2NNN A;  5FLM J;  4XLH A;  3JRA A;  4PJL A;  1ON1 A;  3TO9 A;  2L7K A;  2XB0 X;  5KHD A;  3F8C A;  1X1A A;  1U9N A;  4HDU A;  2LBF A;  2OCE A;  4XLE A;  1G3W A;  4WX9 A;  3E6M A;  1OYI A;  5TRD A;  3LSH A;  2HZD A;  3N97 A;  3GFJ A;  3FHZ A;  3HHG A;  3ZMS A;  5IP7 J;  5D5V B;  2IGM A;  2KRF A;  4O5V A;  4HNU A;  4IQ4 A;  2COM A;  3HZJ A;  4EVI A;  2Q0O A;  3ZN1 A;  2XHK A;  5J6X A;  1X19 A;  4ABZ A;  1MMS A;  3B02 A;  4XN0 A;  5HDK A;  1Y1V J;  1HCR A;  4LIT A;  3CD6 I;  3EUH C;  4RB3 C;  2L54 A;  4GYI A;  5HDG A;  2XAG A;  4KIC A;  2R7V A;  2CRG A;  2R7D A;  2VBX A;  3C1D A;  5LFA A;  5IT9 Z;  3MZY A;  3OYD A;  3S2H J;  1BJZ A;  1DU6 A;  2VXD A;  1FOW A;  1MBE A;  2K9M A;  3K4L A;  2DA6 A;  2NVQ J;  3KP3 A;  5K1Y A;  4A0Y A;  2WB1 N;  3OWT A;  4PUS A;  3FF5 A;  1OIS A;  1Z9C A;  5J1R A;  1VQ9 I;  2FSW A;  4E7Z A;  1F9N A;  3BR1 A;  1JTY A;  1B4A A;  1F36 A;  3GUD A;  1QHH D;  1FYL A;  5E3M A;  3CDL A;  3LQR A;  2KIQ A;  4F55 A;  4XID A;  2LKX A;  3GFL A;  1IXS B;  2IVM A;  2OV7 A;  4G6D A;  2AO9 A;  2IPQ X;  4I01 A;  5ICC A;  2CJJ A;  1R1U A;  1UST A;  3ULQ B;  1Q1H A;  3CO7 C;  3CC4 I;  2LKS A;  1FX7 A;  3EUH A;  3P9C A;  1WWX A;  2ZME C;  3KP4 A;  1X3Z B;  2HYG D;  1SD4 A;  3CUQ C;  3IHU A;  1WRJ A;  2VJJ A;  2MYS A;  1FTZ A;  2Y0M A;  4EM1 A;  3OOU A;  4KDP A;  1UHS A;  4C30 A;  1U2W A;  1JKO C;  2H6C A;  1LVK A;  1YTY A;  2CQ7 A;  3W3C A;  4IHT A;  2FNP A;  3CP8 A;  3BJ6 A;  1MJ9 A;  4FHT A;  3E5X A;  4U7D A;  1OR7 A;  4EV0 A;  2DO7 A;  3HM5 A;  3OR2 C;  1BC8 C;  4HF1 A;  4LG0 B;  5D6F A;  4BJT A;  3TP3 A;  1XC5 A;  2XGD A;  1U9O A;  2DA2 A;  2Y48 A;  3J81 K;  4HQE A;  3VFZ A;  2YSR A;  4BBR J;  2W7N A;  1OMI A;  2R3S A;  3VYS B;  2JN6 A;  1ZLK A;  1MBF A;  3V7C A;  3DLA A;  2XKO A;  3GEZ A;  5KVR A;  4XIC A;  3IL2 A;  4KMU X;  2LRE A;  3GYH X;  2LH9 A;  2X51 A;  1U5T B;  2DYS H;  4FIS A;  5GP9 A;  4NC7 A;  4XBF A;  1EF4 A;  2BOL A;  5LD2 C;  1QPI A;  4GFB A;  4Q5S F;  1W1W E;  4DJA A;  4XQF A;  2V6C A;  3I59 A;  2CQK A;  2R0Q C;  1FYM A;  4CHU A;  3RQI A;  3RZD J;  3CCS I;  1BW6 A;  1I5Z A;  3E6D A;  2HQN A;  4MO7 A;  1OR7 C;  1WGX A;  3T0Y A;  1HXD A;  4EJW A;  4L5J A;  3BR3 A;  2HI3 A;  4BJ5 C;  1JXS A;  2LOO A;  3ZQ7 A;  3ERE D;  5E20 A;  2O5R A;  2EZI A;  1MJA A;  3ASO H;  4E70 A;  3JSO A;  4Y15 A;  3SEQ A;  1MBJ A;  3LSM A;  2FXA A;  2OZU A;  3DKY A;  4M71 A;  5H20 A;  3RQ4 A;  4RS8 A;  4HF0 A;  4AIJ A;  2IGO A;  2LLK A;  3CMY A;  2DTZ A;  3VOE A;  1B8I A;  1BI1 A;  5FKO A;  4U88 A;  3GTP J;  4OU0 A;  2IA1 A;  1FIA A;  4LGW A;  1FWZ A;  2STT A;  4I6Z A;  4CCJ A;  3KZZ A;  2F4O B;  1MSF C;  2E5N A;  2KT0 A;  1W0U A;  2X0L A;  2XVC A;  5GAE J;  2VQL A;  2X85 A;  1IW7 F;  1ZHF A;  1Z67 A;  3HRM A;  4AM3 A;  5GPC A;  5EEA A;  3IC7 A;  4RMN A;  5FLV A;  3TDU C;  3FMQ A;  3HOX J;  1ZRD A;  2UV1 A;  5IP6 A;  3AL0 B;  2FD5 A;  4ESB A;  1GDT A;  5LRS A;  1GXQ A;  5CKT A;  2LKP A;  3DPT A;  2DAO A;  2GXG A;  2X1C A;  2FRH A;  3JSP A;  3E97 A;  4P9U A;  4CCO A;  4ZYD A;  2AQF A;  2VN2 A;  1TNT A;  3Q3S A;  1FP2 A;  1I50 J;  1E3H A;  2W4S A;  3M8E A;  5B1B H;  4E7I A;  3FXQ A;  3HOS A;  3DEW A;  4G9Y A;  3Q9V A;  1LQ1 A;  2P7V B;  1G6N A;  2NYX A;  1MMD A;  1WJD A;  2A69 F;  5K5Q A;  1TTY A;  1FSE A;  3OIQ A;  4MIM A;  5FD5 A;  3KFW X;  4G7H F;  3MKL A;  3ZPL A;  1UZC A;  2X1E A;  3E6B A;  2PJR A;  4AUX A;  1Z1D A;  3RPU D;  4QWQ A;  1LFP A;  2HXI A;  5D8K B;  2L0K A;  1XGO A;  2Z16 A;  3DEE A;  5FLX Z;  2VC0 A;  3DKW A;  2BW3 A;  1JT6 A;  1YI2 I;  2DA3 A;  3FIW A;  2RGV A;  3MQ0 A;  2A07 F;  3ZMV A;  4QPO A;  2LY9 A;  3J81 Z;  1DP7 P;  5H2F C;  3SDB A;  1J5Y A;  1QVT A;  1MH3 A;  2ZSI B;  4BDZ A;  4B43 A;  3H5N A;  3FK7 A;  3BJO A;  1RUN A;  1WJF A;  2JRT A;  3O2P E;  5FB2 A;  4BQA A;  3BLY A;  1W7P B;  1V5G A;  1R5I D;  2E7W A;  3KP2 A;  4XOP A;  3BPX A;  3DPL C;  3SHF A;  4CSW A;  2BE5 F;  2IGN A;  4XK4 A;  4A2U A;  1W5S A;  4CIC A;  2JRM A;  1MW7 A;  3FMS A;  5B5E C;  5C4J J;  3JRI A;  1R49 A;  4A6E A;  4DNC A;  1ZR2 A;  1RIO H;  4ENJ A;  3K1P A;  3PJR A;  3OS1 A;  1IRF A;  1HF0 A;  3F21 A;  4L0Y B;  2O61 A;  3DQV C;  3COA C;  4ZZD A;  2QSG X;  4IOC F;  4QLC U;  3OYF A;  1X4O A;  2MFZ A;  2P0W A;  4MQV A;  4OAY A;  1XD7 A;  4E6K G;  2F4I A;  1K78 A;  3SJM A;  2VQC A;  3GCM A;  1RC9 A;  3HRS A;  1FNN A;  3SQN A;  1IV8 A;  2E1N A;  2WAE A;  2H1L A;  3HGY A;  4NUB A;  1K4S A;  3VEP A;  1S7A A;  1UFM A;  4NC6 A;  2GA2 A;  2HOT A;  1DGR M;  4Y17 A;  3K4J A;  3OYI A;  5ILV A;  1KYZ A;  2RDP A;  4BKX A;  1FZP B;  4HYE A;  5CVU A;  3ELK A;  5JR3 A;  4ZYE A;  1KZH A;  1F4K A;  4BQO A;  4XMY A;  3IV5 A;  2KPM A;  2Y31 A;  1J7K A;  2YUS A;  5J47 A;  3BCB A;  5GAG J;  2QEX I;  2A68 F;  3JAM K;  1E3P A;  3WTS C;  2R93 J;  1UJ8 A;  4L5E A;  4JQF A;  5DD8 A;  2VT2 A;  2QWW A;  3S16 J;  3L2C A;  3M3Y J;  1NG6 A;  3CF2 A;  1ETY A;  2QLZ A;  1X4P A;  3LQQ A;  3I71 A;  4I09 A;  2PLY A;  4LK0 F;  2V79 A;  3JRH A;  4MTD A;  5DM6 F;  1SMT A;  2E35 A;  4OMZ A;  3EPZ A;  3C2G A;  3S93 A;  3MD2 A;  2VBY A;  4DGW B;  1YO5 C;  1S29 A;  2I8D A;  4IF4 A;  2JZY A;  3HGG A;  3M8J A;  1N78 A;  3R60 A;  3QU3 A;  2IA2 A;  2EFN A;  4G7Z F;  1MDM A;  4HZF A;  3T8R A;  4FX4 A;  5IT9 K;  4CZZ A;  1E17 A;  3HDD A;  4NNJ A;  4B09 A;  5M3M J;  3QOE A;  4HA8 A;  5GAD J;  1KA8 A;  3KEO A;  5ILS A;  5FGM A;  1D0X A;  4NQW A;  4UVA A;  2W1O A;  2HU9 A;  4CYC A;  1S9H A;  4Y4R A;  1S5L C;  3BWG A;  4RGU A;  5DV5 A;  4B48 A;  2R7Z J;  2ZB9 A;  5FRN A;  1R4M B;  4HW0 A;  2DLL A;  2M0M A;  3ESW B;  1BI3 A;  5BMZ A;  3ML6 A;  1PUF A;  4B3X A;  1I3A A;  1XB4 A;  4KIG A;  3AAF A;  2IJL A;  4A93 J;  2R5Z B;  2M1B A;  3WOD F;  2XAF A;  1B9N A;  5D5W B;  2X6O A;  4BUP A;  1QVU A;  2R7Q A;  2VI6 A;  1YJ9 I;  2OC6 A;  4YIR X;  3GTK J;  1T33 A;  4IXA A;  3HBL A;  5FKL A;  3CCL I;  4CCK A;  4G94 A;  5C4X J;  1TT0 A;  2CQQ A;  2GQQ A;  3A02 A;  2EV5 A;  1Y56 A;  3W6V A;  4LG0 A;  4LB5 A;  3VDX A;  1ODD A;  2HYF A;  1TWG J;  3HJE A;  3BG6 A;  3BDD A;  2PJR B;  4YEJ A;  1POG A;  4RB1 A;  2EWN A;  4OWR B;  1B72 A;  3AFH A;  4A3B J;  5TJJ A;  4F3Q A;  2ZO4 A;  1IRZ A;  1WFX A;  2A3S A;  3G3Z A;  4IKF A;  3IKV A;  2EIL H;  5EDN A;  2JA8 J;  1W5C C;  4YIF A;  2JA5 J;  1WQ2 A;  2GXA A;  1V55 H;  3WU1 B;  1Z7U A;  4J19 A;  2F48 A;  3L9F A;  3I55 I;  1AKH B;  4DYC A;  3I56 I;  3CMA I;  4UUT A;  2EBI A;  2CUZ A;  2WAQ N;  5DTD A;  2LC2 A;  1IDZ A;  2MAB A;  2E2H J;  3SZP A;  3QOD A;  4XRM A;  3GTO J;  1O3T A;  4A3F J;  3OR1 C;  1IAW A;  2VOO A;  3HOZ J;  2K40 A;  1W0T A;  2ZXJ A;  3S3O A;  3M9A A;  5KCM A;  2DW4 A;  2L9R A;  3WGI A;  3JTG A;  2QEN A;  1R4N B;  1Y39 A;  2HOS A;  2Y30 A;  2E5Z A;  5ICG A;  3CJR B;  4M73 A;  4RB2 C;  4A3D J;  2XDV A;  2BGC A;  1CF7 B;  1HOM A;  2DA1 A;  1WJB A;  4M6X A;  1GLN A;  2ZSH B;  2EFW A;  1VND A;  2EQR A;  2Y75 A;  1ETV A;  2DFI A;  2VIX A;  2XPU A;  1VQ5 I;  2M3A A;  2LVS A;  1R00 A;  5BOX A;  2ID3 A;  2VPR A;  4AU7 A;  4GCV A;  4HAM A;  4KIS A;  5J8F A;  1YIO A;  5L3F A;  1DPR A;  1OKR A;  3KX2 A;  4CYD A;  4S05 A;  3QU6 A;  3J7Z I;  1UCR A;  3FMR A;  3RTR A;  2ISZ A;  2Z2S B;  5EF6 A;  2XPV A;  1ZG3 A;  4LOC A;  1XPX A;  3AG1 H;  5KAF C;  3ROU A;  2WY7 Q;  1LEB A;  2B7E A;  1ZAO A;  3M1C A;  2FQ3 A;  4XSX F;  2XF5 A;  4CXF A;  1U8B A;  2V9V A;  1R1T A;  2ZC2 A;  1P4W A;  1YW7 A;  1TWF J;  3DTI A;  4ANJ A;  1HLV A;  2DQR A;  1JTX A;  2HKO A;  2WAF A;  2ESH A;  3PM1 A;  2F5C A;  3F8B A;  3ZMD A;  3TW6 A;  2R7X A;  3K2Z A;  2QYO A;  3IUO A;  2KP6 A;  4BQN A;  3BT9 A;  3OS0 A;  4I98 B;  2DOF A;  2R92 J;  4RDU A;  3LSG A;  3HSF A;  2BV6 A;  2YU9 J;  2G9W A;  3H9G A;  4ZYA A;  4H4K C;  4PDK A;  4IRH A;  1AKH A;  5ED4 A;  2VKH A;  4HEA 2;  1EV7 A;  1GHC A;  4II2 A;  2BZT A;  2F4M B;  3VB2 A;  4BHC A;  4U0V A;  2BY3 A;  1Y0N A;  3CQZ J;  1ON2 A;  5M5Y J;  4P96 A;  5F0H A;  4DW6 A;  3TO7 A;  5HOD A;  4GYG A;  4BJ6 C;  4BEH B;  2ZNY A;  2AHQ A;  1T98 A;  1YX3 A;  2PMU A;  4G6Q A;  3PIP F;  5FKK A;  3BR0 A;  2EH3 A;  1S7O A;  2IBD A;  2RVC A;  3BG5 A;  4AWX B;  2RC4 A;  4D1Q A;  2KJB A;  4L5I A;  2EV6 A;  4KMF A;  3RKQ A;  4NBQ A;  1U5T A;  1TBX A;  1ULY A;  3MVP A;  2ZJ2 A;  4W97 A;  4BYY A;  3FDY A;  1A35 A;  4IL6 C;  1H9G A;  2RNG A;  4XON A;  2CSO A;  4BXX J;  2ECC A;  2KDZ A;  1T0F C;  1ZRE A;  3IWZ A;  2EFO A;  3J7Y J;  5E8G A;  3S2W A;  3V7S A;  1U6G A;  1TT5 B;  3ZMZ A;  2BEO A;  2IEK A;  2BHY A;  2TDX A;  5C44 J;  2CGP A;  3T5X A;  3BTL A;  3JRE A;  3OL4 A;  1GXP A;  4J00 A;  5F6F A;  2FE3 A;  4A3L J;  3S1R J;  1QU3 A;  1S6L A;  2XAJ A;  1ZTR A;  1V5F A;  1OCC H;  4RAF A;  3Q5F A;  3F6V A;  2V4J C;  3G71 I;  2ID6 A;  1IRG A;  1J2X A;  2R7W A;  2DPU A;  1I6H J;  1U5T C;  2WV0 A;  3WTZ A;  1K83 J;  2RRE A;  2E1C A;  4FE4 A;  2VUM J;  1VQ6 I;  2VE8 A;  1IJW C;  1FBU A;  3BOQ A;  3VSL A;  5D6E A;  3CTA A;  2I5U A;  1HW5 A;  2XB5 A;  4XL9 A;  4E7S A;  2VJ4 A;  1XSX A;  3KZY A;  4BY1 J;  1FMW A;  3WTW C;  1DQU A;  4IPA A;  2JPB A;  3O3K A;  3E5U A;  1HDD C;  5FFX A;  3K0L A;  3S1Q J;  3BR6 A;  1YW8 A;  3DP7 A;  5EEH A;  5C3E J;  5JLW A;  3EUK L;  1LFU P;  1Z6T A;  1A36 A;  3BG9 A;  2ZJP F;  4BBS J;  1VQ8 I;  4GXO A;  3CMM A;  1IN6 A;  4XOR A;  3J7A Y;  2I10 A;  2KFD A;  1BOA A;  2V9K A;  5FO5 A;  4WWC A;  1XSD A;  3LFU A;  4Y33 A;  2HOA A;  2CQX A;  4Q47 A; 
#chains in the Genus database with same CATH homology
 3PL8 A;  1Z3X A;  5FRM A;  4P1W A;  2MD0 A;  3UNG C;  3DTK A;  4CCJ A;  2E5N A;  1W36 D;  2L5Q A;  2VQL A;  2M7A A;  4C2U A;  1ZEL A;  2X85 A;  4RLQ A;  2CUJ A;  4BAC A;  3F9K A;  3IP4 B;  2X6Y A;  3IAM 2;  2WB1 A;  3OS2 A;  4PSW A;  4EAT A;  1JI8 A;  3QYF A;  4RMN A;  3DU6 A;  1EA3 A;  2UV1 A;  3HKZ A;  4RLF A;  3AL0 B;  2JUG A;  2LG4 A;  5CKT A;  3DPT A;  3VYR B;  2X1C A;  3K4N A;  1D0Y A;  1MND A;  4HPQ A;  2AQF A;  4CCO A;  2R7S A;  4E7I A;  2W4S A;  5CPR B;  4F91 B;  4B44 A;  1J09 A;  2VB6 A;  3HOS A;  3OIP A;  3FKJ A;  1MMD A;  1WJD A;  2HDW A;  4BS9 A;  2KQR A;  2HPI A;  2IXS A;  2LYC A;  3EUA A;  4JOM A;  3OIQ A;  3DWL E;  2DT7 B;  4PK4 A;  3MKW B;  1MMA A;  3HXL A;  3V42 A;  2X1E A;  4XLA A;  1FMV A;  2KHM A;  2XC7 A;  4E7H A;  3RPU D;  2PJR A;  2IS1 A;  3S3M A;  2DOA A;  1LFP A;  4P5O A;  5TGT A;  2Z16 A;  2NOJ B;  3DEE A;  4E7J A;  2ZXH A;  2VQH A;  4N4O B;  2BW3 A;  4BL0 B;  2X1D A;  1N77 A;  2K5C A;  1BOB A;  2V26 A;  4QPO A;  5FRO A;  3K4M A;  4YEL A;  1ERD A;  5HLT A;  3OYB A;  3SDB A;  2M4G A;  4MLO A;  5KNL A;  1DP3 A;  4C9Y A;  2X6X A;  2ZSI B;  3U21 A;  4BDZ A;  2M4K A;  4B43 A;  1YX5 A;  3H5N A;  4HNT A;  2HPM A;  3ZCO A;  2XF7 A;  1WJF A;  4PJM A;  2VJ5 A;  2FUG 2;  1NG7 A;  3BLY A;  1V5G A;  3W2V A;  4PJJ A;  1R6R A;  4XOP A;  3DPL C;  2VPL A;  3FBI B;  2IGN A;  4B47 A;  4CSW A;  4BQQ A;  2VKD A;  1UEL B;  3OMY A;  1BR1 A;  3ZRG A;  1MW7 A;  3ZQQ A;  2W00 A;  3PJR A;  3A1Y A;  3OS1 A;  1PJR A;  2CMP A;  3CES A;  3CJQ B;  2KRH A;  2V1N A;  3DQV C;  3E0J B;  3LSI A;  2BW3 B;  3D5L A;  4PFP A;  3OYF A;  4D9J A;  1X4O A;  2MFZ A;  2P0W A;  2V7F A;  4OAY A;  3QYE A;  3K4B A;  4E6K G;  2F4I A;  2VQC A;  4II3 A;  4F93 B;  3AL0 C;  2OUM A;  2WAE A;  4NUB A;  4DBR A;  3OYM A;  3H5R A;  4CH7 A;  2E1M C;  2E1M B;  1DGR M;  2RQQ A;  3K4J A;  2HNH A;  3DKX A;  3OYI A;  2BVL A;  4HST A;  2VXZ A;  1MMG A;  1W36 C;  2ZXI A;  2CV0 A;  4R79 A;  3H35 A;  4BQO A;  4IX7 A;  3L2W A;  4XMY A;  2KPM A;  3I9V 2;  3BCB A;  2KRC A;  1Y6I A;  3S3N A;  3KYL A;  2DCE A;  3K70 D;  2W82 A;  4YRV A;  4JQF A;  2M7B A;  4AYB A;  1NG6 A;  3CF2 A;  3FBN B;  3CP2 A;  1X4P A;  1HA8 A;  1UG0 A;  3H0D A;  4F92 B;  3SZG A;  3N05 A;  2WBM A;  3EPZ A;  3C2G A;  1WJ5 A;  2ELJ A;  3S93 A;  3TBI A;  1YE9 A;  3MD2 A;  4FAS D;  2Q2E B;  1BR2 A;  4DGW B;  3ZR8 X;  2I8D A;  3LSK A;  2ZFU A;  3PSF A;  3M8J A;  3OYN A;  2HVR A;  3K4C A;  2R7O A;  3PNT A;  1N78 A;  1X1D A;  4FET A;  3HOT A;  3D5S C;  3OYE A;  4U7B A;  4RM3 A;  1X1B A;  4NNJ A;  3TL4 X;  3QOE A;  3HUG B;  1KON A;  4BXF A;  4ZDO A;  3RCO A;  3L2V A;  3PNV A;  5HNH A;  3KEY A;  1D0X A;  2DJI A;  4F52 A;  2W1O A;  2CH0 A;  2R7U A;  2HU9 A;  2UWM A;  1S9H A;  3A4C A;  4Y4R A;  4BEH A;  2UUZ A;  1P9Q C;  4B48 A;  3ONQ A;  4LIV A;  5FRN A;  2M0M A;  3OYH A;  2F6C A;  4BE2 A;  3I3L A;  4E7K A;  2XAU A;  4B3X A;  4DBQ A;  3OYJ A;  3DPU A;  4XLF A;  3HG9 A;  3FHN A;  4BUP A;  2R7Q A;  2IS2 A;  4BU2 A;  2OC6 A;  2GOX B;  2CV2 A;  1OLT A;  4CCK A;  3VYU B;  3H9J A;  3PNY A;  4IZZ A;  1TT0 A;  4E7L A;  1MNE A;  3K10 A;  2CW7 A;  2K9L A;  1T95 A;  1N75 A;  4ZTJ A;  1Y56 A;  2L9N A;  2PMZ A;  3VWB A;  3VDX A;  3OL3 A;  1WJA A;  3BG6 A;  2HVS A;  2PJR B;  2E60 A;  4YEJ A;  3VSK A;  2XSJ C;  4HSR A;  4OWR B;  3AFH A;  3C2H A;  4F3Q A;  1WFX A;  2Q1Z B;  4NQW B;  4HRI A;  4IKF A;  1DGW Y;  2JVG A;  2IS6 A;  3L2Q A;  3L2U A;  4ZC3 A;  4GRI A;  3AKZ A;  2WY8 Q;  4PJN A;  4ZDL A;  4CUG A;  4ZTF A;  2V6E A;  4XR6 A;  2WAQ A;  4BE1 A;  2CUZ A;  5HOO A;  4XKC A;  2LC2 A;  2XF6 A;  2MAB A;  4KIT B;  3QOD A;  2JA2 A;  4LIU A;  3BG7 A;  3SEZ A;  3ZXS A;  4XKV A;  1IRX A;  1UAA A;  3OR1 C;  3E1S A;  2WAD A;  3S3O A;  3MKZ A;  5KCM A;  2GOM A;  3CZ6 A;  3OYL A;  3NWS A;  2R4G A;  2E5Z A;  3CJR B;  2QKL B;  1K6Y A;  3HC7 A;  3HL2 A;  2XDV A;  2QKM B;  4CA0 A;  4ITV A;  1WJB A;  5HNF A;  2KLO A;  1GLN A;  2ZSH B;  3BC8 A;  4RM2 A;  2LBF B;  4BDY A;  4IQJ A;  1D1B A;  4XLC A;  2CFO A;  2VIX A;  2M3A A;  3HPG A;  3QYB A;  3S8P A;  2CS3 A;  2WA0 A;  3HPH A;  5CQE A;  4AU7 A;  1PYV A;  4KIS A;  2A5W A;  2JVH A;  3KX2 A;  2DXI A;  4AVZ A;  3OY9 A;  2IS4 A;  4XM3 A;  3ZGK A;  2Z1D A;  2VQG A;  4NC8 A;  4XLH A;  3RTR A;  2Z2S B;  1LDK B;  4PJL A;  2L7K A;  2VLA A;  5KHD A;  1X1A A;  4Y3O A;  2LBF A;  3K70 C;  4XLE A;  2CV1 A;  2WY7 Q;  1G59 A;  3M1C A;  3LSH A;  3PSI A;  2XF5 A;  3NWT A;  2HZD A;  2HQA A;  3DU5 A;  2BVM A;  4ANJ A;  3DTI A;  2IGK A;  1Z7L A;  2WAF A;  3VYT B;  4XOT A;  4C2T A;  4XKB A;  2IGM A;  3RSN A;  3MMY B;  4HNU A;  4IQ4 A;  4CCL A;  2R7X A;  1X19 A;  3IUO A;  4XKW A;  4XN0 A;  2L2O A;  5JHF A;  4X0G A;  4LIT A;  3EUH C;  2KP6 A;  4KT6 A;  4BQN A;  1VZ0 A;  2R7V A;  3BCA A;  3OS0 A;  2MC4 A;  5LFA A;  3GBG A;  2VAS A;  3LSG A;  2DT6 A;  1TZL A;  3OYD A;  1SAU A;  2LY2 A;  3H9G A;  4ZYA A;  3OYK A;  3A2K A;  4H4K C;  4CZC A;  4XN3 A;  2VXD A;  2VKH A;  4HEA 2;  2K9M A;  3K4L A;  4II2 A;  2F5V A;  4LG3 A;  2X6W A;  3OYA A;  3G2B A;  1Z21 A;  4PUS A;  3OWT A;  4E4H A;  2CW8 A;  2KL4 A;  2Y0S A;  3W2A A;  2VL8 A;  4HG2 A;  4BJ6 C;  4E7Z A;  4BGD A;  4BEH B;  4DIQ A;  1YX3 A;  1QHH D;  2K3P A;  1QHG A;  4F55 A;  4D1Q A;  4J01 A;  2OV7 A;  4OAZ A;  3UR3 C;  1WJC A;  2VJI A;  4BE0 A;  3FDY A;  2VJJ A;  3DTE A;  2MYS A;  1V5E A;  4N4N B;  1WJE A;  1U0J A;  2RNG A;  4XON A;  3PUB A;  3OOU A;  4XNF A;  4C30 A;  2HVQ A;  1T0F C;  1LVK A;  3W3C A;  2LY1 A;  3CP8 A;  3OYC A;  3LL7 A;  3H9Q A;  3OR2 C;  3MKY B;  3W2W A;  4BJT A;  1LKX A;  1D1A A;  4CCN A;  4ZDP A;  3IAS 2;  3OL4 A;  4J00 A;  2W7N A;  4CCM A;  1QU3 A;  2R7R A;  1MMN A;  3VYS B;  3PFY A;  1V5F A;  3L2R A;  3H5A A;  2V4J C;  3DLA A;  1E0E A;  2LRE A;  3LMM A;  2LH9 A;  2R7W A;  2X51 A;  1D0Z A;  4PFO A;  3K6G A;  2RRE A;  4NC7 A;  3S32 A;  4KJZ A;  3D5R C;  1SFK A;  2BOL A;  5LD2 C;  3VSL A;  4XL9 A;  4E7S A;  1D1C A;  4XQF A;  4DJA A;  2VJ4 A;  1BR4 A;  2R7T A;  1FMW A;  1G8X A;  5CQG A;  4U87 A;  1DQU A;  4QPQ A;  2L9S A;  1OR7 C;  2JSP A;  3EUK L;  4BJ5 C;  2KMU A;  4ZJZ A;  2LOO A;  1Z3Y A;  2LRD A;  4G6T B;  3OYG A;  3CMM A;  2O5R A;  4XOR A;  1AA7 A;  3SEQ A;  4DOZ A;  3LSM A;  3DKY A;  3K4K A;  3J7A Y;  2KDO A;  2V9K A;  2KZV A;  3RQ4 A;  2A6T A;  3LFU A;  3TMO A;  4Y33 A;  3SYT A;  2IGO A;  1X1C A;  4PSX A;  2AQE A;  5HVQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...