2XF6A

Crystal structure of bacillus subtilis spp1 phage gp23.1, a putative chaperone.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
50
structure length
50
Chain Sequence
SESLLYGYFLDSWLDGTASEELLRVAVNAGDLTQEEADKIMSYPWGAWND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GP23.1
publication title Crystal Structure of Bacillus Subtilis Spp1 Phage Gp23.1, A Putative Chaperone.
pubmed doi rcsb
source organism Bacillus phage spp1
molecule tags Viral protein
total genus 17
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2010-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2xf6A00
2XF7A 2XF5A 2XF6A
chains in the Genus database with same CATH superfamily
3FK6A 5JHUA 3HOZJ 4KIGA 3S3MA 5M3MJ 3W2VA 3F23A 1JUMA 5ILVA 1TWAJ 3OV8A 3JTHA 5JVTA 5EEHA 1OCOH 3S1RJ 1EV7A 2L4AA 2EV0A 4KIBA 4IJAA 3ZMDA 3HOTA 2W85A 2EBIA 1A35A 1QPMA 2K3FA 1YJ9I 3ELKA 3IH2A 4IEJA 2YS9A 2NOJB 2G9WA 2VB6A 4X0GA 1VQNI 4QLCU 2HOAA 2H1KA 1CF7A 4B09A 4C3IJ 1FY7A 1B9MA 3GXOA 3KP6A 2P7VB 4MLOA 2K85A 1KU2A 2LY2A 2MW8A 3HPGA 4L9TA 1IO2A 3BR2A 3TO9A 1ZG5A 3CJTB 2VPRA 2Z9OA 2DT5A 4HSTA 4PJLA 4D5FA 1OCRH 5F1RA 1ETOA 3K2ZA 4M3GA 1SVLA 5F6FA 2K4JA 5LHIA 1HW5A 2FF4A 1R1TA 3ZMTA 1OISA 3RTRA 2DPDA 1IXCA 4CZZA 1K6OA 3F22A 3HGYA 1X1CA 2PJPA 4M6VA 2QVOA 1ZN2A 2OCEA 2X48A 3KPHA 3EQLF 3OIOA 3J81Z 2A61A 1ON1A 3FWEA 4GDFA 1D0YA 2DFIA 5KAIC 4XRSA 1QO0D 2VQLA 4NQWA 2VKVA 3CUOA 1W7PB 2XPWA 3S2WA 3F8BA 2M4GA 3FXQA 1LQ1A 1QQIA 2NVYJ 1E2XA 3PM1A 2NS8A 4C30A 3M8JA 1B4AA 1JI8A 3TKYA 2LY9A 4AVPA 3HOUJ 1IXSB 4MEXF 2JPBA 1OQYA 2NVTJ 5IP9J 1KQ9A 2Z1DA 1I6XA 4O3MA 4M9XA 2EA2A 3IRQA 3J80K 1U2WA 2XSDC 1YW9A 2KIUA 4PDKA 2L9VA 3DEUA 3DTIA 4AUXA 2XGDA 3E3VA 2D2WA 2QM3A 4G94A 3QU3A 3SXYA 5L3GA 2L0KA 4LK0F 4KA4A 1B6AA 2ZSIB 2ADUA 4IPAA 3OY9A 5H20A 3VFZA 5K7FA 3OYGA 4HEA2 2IS6A 2DA5A 4BKXA 4I76A 5LHGA 2QEXI 5HLGA 3GTQJ 1S7AA 4XMYA 2K9MA 4LK1F 4QSHA 2M3AA 4PJNA 4M9SA 4EQQA 4HSRA 4ZDLA 2KRHA 4A3JJ 3OYLA 1JJ8C 1OPCA 2L7ZA 4OOIA 2ID6A 3HSFA 4A69C 2NRAC 3SDBA 2R7UA 3V7RA 2FOWA 2XRLA 4MFDA 3VSLA 2M34A 5LBQA 4QTRA 5EF6A 2IS1A 2L5QA 3DTEA 1EH7A 5HVQC 3HOVJ 4BNCA 4LIVA 3BJ6A 1PJRA 5F08A 2LSOA 3VOEA 4ZZLA 1R5GA 3GX4X 5D4RA 3LSMA 4FHTA 4EJOA 1WSUA 4M73A 3MKLA 5HNFA 3WTXC 4Z2YA 1JHFA 2E7XA 1R49A 4ASNA 4EM0B 2R7SA 2M4KA 4EJTA 1WH5A 1Z1DA 2BXYA 3F6VA 1J59A 5CJ9A 4AU7A 2F5EA 3LSRA 1MMGA 1VQ5I 1MH3A 1FMVA 4OIPF 3IAS2 5FO5A 3S17J 3E5XA 5DD4A 2QBYA 3W6JB 1FLIA 2DCEA 5CLSA 1MBJA 4BDZA 1FOKA 3KIOA 2CYYA 1KU3A 1JKOC 4ANJA 1BOAA 1VQ7I 3FBIB 3S1NJ 3BR3A 1G4DA 2VT3A 2GAUA 2PEXA 4CYCB 3CCLI 1Q1VA 1YE9A 4UY8I 3M07A 1FX7A 3LQQA 4GRIA 4XLAA 1VQ4I 1NG6A 4FE7A 4HDVA 1F43A 3G1MA 4K2EA 1P92A 4B1RA 3ABTA 3QP6A 3T5XA 4A3FJ 1G3YA 3BG7A 3BZCA 5DEQA 4D9JA 2STTA 3TQNA 2GA1A 3ZN1A 3WGIA 3CESA 3KFWX 1TWHJ 5CVJA 1W0UA 4HX8A 3BTLA 3L7WA 3FXRA 3TP0A 4IQJA 3IH3A 4IRGA 3ESWB 1DPRA 3KP4A 3KZYA 3OYHA 2HOSA 4U87A 1XG1A 2DK8A 3F3XA 2JA2A 1VQMI 3LAPA 2MBFA 5HLIA 3MZHA 2MLGA 1XS9A 1BR4A 1TP4A 2FQ3A 2DDAA 4E70A 2KJBA 2W82A 2P5KA 4UB8C 1UFMA 2M8EA 3RCOA 2K9LA 2IBDA 2JSPA 4OAYA 1IN5A 3PNYA 4WXCA 1VQKI 5J40A 4WXDA 2YX7A 1QA6A 3GO5A 4PFOA 3BQZA 1B8IA 3ASOH 4ENKA 4L18B 1QHGA 2Y30A 5IY5H 1RNLA 3NAUA 5E3NA 5J1YA 4KFCA 4DYQA 1DPUA 3GMEA 3I5UA 1TWGJ 1W5CC 1D5YA 3IUOA 3W2AA 3H1CA 1LDDA 5D5VB 2FBIA 4EJUA 2IGMA 2DA2A 3HUGB 1G2HA 1Q1HA 1XGNA 1W4MA 2DMNA 1IRXA 3TDUC 4H0EA 4HW0A 1UHMA 1Y0NA 2MG4A 4L0YB 1ZH5A 1BC8C 1GVJA 2QF7A 5GADJ 3FM3A 1SAUA 2I10A 3LNQA 3CUQC 3HOSA 4UB6C 2H27A 2R7RA 4MGRA 3VYTB 1YTYA 3WTUC 1BM9A 3NWSA 4P5OA 4L0ZB 3Q9SA 2V79A 5J6XA 1STZA 1DGRM 1D8JA 3W6KB 2CJJA 2ELHA 1O4XA 4IOCF 1FYMA 4RDUA 3F0CA 3FDYA 1ETXA 2JVHA 2VJIA 1MMAA 2R7OA 2K7LA 2XAUA 1FWZA 2EZKA 3RQIA 1IRFA 1D0XA 1S3JA 2W25A 1K78B 1F1ZA 3OR2C 4L9NA 1G59A 1QVTA 1LKXA 2K9SA 4EMSA 2MC4A 1K83J 3A01B 4RGRA 1A31A 3BP8A 5IYDJ 2L7MP 3E6DA 1P7JA 5HODA 1A6IA 4PZJA 5J8CA 3HKZA 2JQ7A 4MTDA 2HVRA 3TOAA 2CQ7A 4GYGA 2OF7A 4HZFA 3DQVC 3G71I 2W24A 2XGCA 1HA8A 4IRHA 1K78A 2WAQN 5FRMA 1KU9A 4YFKF 1QGPA 1MNDA 3LSIA 3H92A 1ZELA 2M9HA 4HPQA 1IDZA 3E6BA 5BPIA 2H94A 4LG3A 3SZTA 1BN5A 3K4LA 3U1KA 4M72A 3H3VK 3BROA 1ZAOA 5DM7F 1XTAA 2NVUB 2FD5A 1H9TA 1XDUA 1T6SA 3DEEA 3I3LA 3MZ8A 4C2UA 3GUDA 2A6HF 2QCOA 4U88A 2P5VA 1J0RA 3E0JB 4ZDPA 4G6TB 1RI7A 4ABZA 3CO7C 2X1DA 2R7TA 3TW6A 2W48A 5LEJA 1U3EM 1OYWA 1D8KA 2K9NA 3HRSA 1KONA 4XN0A 1Z3XA 3I4MJ 4A0ZA 2IGOA 4KICA 2J5OA 2Z2SB 3BWGA 3TDZC 3K4JA 3QPLA 2VQHA 4A0YA 2DA7A 2ACJA 3D1NI 3SHFA 4M3BA 4BAYA 4WX9A 2JWTA 1DDNA 1N25A 3K70C 4Y4RA 2WAFA 2ESNA 2JPCA 3RSNA 2GA2A 4Q5SF 4HLXA 2CG4A 1BOBA 2ZNYA 3CMEI 1PUFB 4PUSA 1ODDA 1WRJA 5FB2A 2E19A 3ERMA 1UMQA 2GWRA 1MJ9A 4G7OF 3GTJJ 4HF0A 4AC0A 2JA7J 5D6EA 3L2QA 2DYSH 3I4PA 4BXFA 3S16J 1GHCA 4B47A 4LB6B 3P9KA 4G9YA 1ERDA 2ZXHA 2CUEA 4ZYAA 1LE8B 2L9SA 5GAGJ 3UR3C 3WTVC 2F5DA 4BUPA 1PUFA 2ZJPF 2VASA 1SFUA 3M4OJ 1OYIA 1B72A 2HGCA 3PSFA 3A4CA 3KZZA 1BI3A 5EEGA 1FMWA 3EDPA 5DCMA 3H0GJ 1Z67A 3PL8A 2KL4A 2V6CA 4CH7A 4BY7J 2MGQA 4W1UA 2QUFA 1U6GA 5TGTA 3C7JA 1MSEC 1QBJA 1MMSA 2UXNA 1FBUA 2XAJA 4NNJA 5DD8A 4HF2A 1AU7A 4I0BA 1LE8A 2KIQA 4BJ5C 1E3PA 2KDOA 3KP5A 4F55A 3IC7A 2Y0SN 5KNLA 3AG4H 4BY1J 1SFEA 3GFMA 1R9TJ 2KQRA 3CF2A 3QYBA 4A6DA 3CC7I 3MWMA 4CCLA 1JHHA 3J7AY 3S2HJ 2OV7A 5DYMA 3ZQ7A 4UNOA 3LOCA 1LUJB 4DW6A 3OYJA 2K5CA 3JRAA 2IPQX 1PDNC 5D4SA 4XKWA 1BI0A 1R1VA 3MVPA 4UVCA 3ZMUA 2LD5A 2MD5A 2RNJA 3OR1C 4XLPF 2DA6A 4WXHA 2ECBA 2ZO4A 5B1AH 3MCZA 2R7ZJ 4RGSA 5D5WB 2LG4A 3ASNH 3DKYA 1GVDA 2XVCA 1LDJA 2JN6A 4LLNA 2F48A 3LA2A 2E36A 2P81A 2XPUA 3CCSI 1G8XA 2KT0A 5FKOA 2ZNZA 1OR7A 2A3SA 4BBSJ 2E5NA 1FBQA 2LF7A 5FGMA 5TISC 2GIZA 4WK8F 3NQOA 2Y48A 3PJRA 2JUGA 1V5EA 3V8JA 5IP6A 4II3A 3Q3SA 1KGSA 3L2UA 1T39A 3G6EI 1MDMB 3LSGA 1XCVA 2H09A 4H4KC 4Y17A 4ZDOA 2BGCA 2MH9A 3OYFA 1R23A 5HLTA 3GFLA 4JX4A 5JHFA 1J75A 1FTZA 2F4OB 3I64A 4LJZF 2R93J 5J1UA 2R7XA 1LFBA 2R5ZB 2VC0A 1ENHA 2OQRA 3C2BA 3ECHA 2V9KA 3W3CA 3BC8A 4R8HA 2ICWG 9ANTA 1W36D 4EVIA 3KX2A 4XKBA 2KP6A 2NAZA 3GF2A 3RI4A 3VEPA 1HF0A 2GBYA 3S3NA 3N97A 1RESA 2FNAA 1OLTA 4RA2A 4G12A 1JT0A 2KIMA 2DK5A 2HDDA 1K4TA 4PSWA 1W7PD 1U8BA 4E7JA 4KISA 3FX3A 3PQKA 3SFZA 4YFNF 1Y6IA 3ZQHA 4KT6A 3S15J 2X6OA 3CCEI 2BE5F 2XF7A 3RKWA 3WTWC 3BPXA 1WZ2A 2J5PA 1I39A 4HX7A 2A07F 4QPQA 2A6TA 2R4GA 4A3BJ 2DFFA 3R0JA 3OMYA 4HV5A 5F0HA 1UG0A 2HVSA 2A5YB 3MN2A 4CCNA 2ZMEA 3O8GA 5AONA 3VYRB 2VOOA 3IP4B 1VNDA 2KHMA 2HEOA 2Y69H 1ZRDA 3CCUI 1WJCA 2VKEA 3HOXJ 2RVCA 3HRMA 1AWCA 2KIFA 2BV6A 4WF2A 2WWYA 2VI6A 1XMKA 3Q5FA 2ISZA 2WBMA 1TTYA 4A3MJ 2ELKA 1ZRFA 4E7LA 1ETKA 3OYMA 2LTPA 4BEHB 3BLYA 1MMNA 3RYPA 4N9HA 1UB9A 3AKZA 3TBIA 3LFKA 2FMLA 2XHKA 5F0FA 1LPQA 4LB5A 1HKSA 5K5OA 3S32A 2L02A 2Y0MA 2CQKA 2BEOA 2P4WA 2M0MA 3KEOA 4CA0A 2JA5J 4CCJA 3K0LA 1CGPA 1ZRCA 1X3ZB 2BVMA 5CVRA 3V42A 3JSPA 2EFOA 5JI6A 2E7WA 1FIAA 1VTNC 4FX0A 1APLC 2ETHA 3BOQA 2E35A 3TO7A 3HXLA 4KJZA 2HKOA 2FU4A 2LLKA 1CF7B 2NVXJ 1USTA 2GOXB 1GLNA 2X9DA 2XKOA 3VDXA 2FE3A 4N9IA 2GXAA 3TW7A 2RN7A 4BL0B 1Y56A 3MEXA 3ZPLA 3BQYA 3TOBA 4D0PA 4IZZA 1YRNA 2DOAA 4B44A 1SVMA 1POGA 4JK1X 1OYYA 3H36A 4DYCA 1MKMA 2KRFA 4LLGF 3IWFA 1I50J 3WTZA 4AIDA 5BOXA 1OR7C 4RMNA 4CUGA 4U0YA 4Q48A 2IP2A 2PBIA 1UELB 4RGXA 3RPUA 3C2HA 1N75A 3OOUA 4RGUA 4RAGA 1JT6A 3D0SA 4E7IA 3C2GA 1EKEA 3ZCOA 4DBRA 4EV0A 2JJ7A 1T98A 3HGGA 3MKWB 1Y39A 1K79A 5EZGA 4A3KJ 5B1BH 3IRRA 1YW8A 4PFPA 1IJWC 5FFXA 1R6RA 2F5VA 2KZVA 3FMQA 2XRNA 3CJRB 1I5ZA 2X4HA 3DPLC 1FPQA 1Y8RB 1O7LA 4NQWB 3K4NA 3DBRB 3WTSC 2RAEA 1V55H 2V1UA 3M8FA 1IV6A 3ZQCA 2TDXA 1V5FA 5LHHA 4IKFA 2ISYA 4O6JA 4Y7NJ 5ILUA 2BXZA 5J8FA 1OJLA 5C4JJ 3FKJA 1F9NA 3R4KA 3ERED 1XDSA 4OMZA 4A12A 3ML6A 3I71A 3ZMZA 3DKWA 5E20A 2HTJA 4I7HA 3DBLB 1P4WA 1XD7A 3GLXA 2HQNA 4L5JA 5BNGA 2DQLA 4KNYA 2VC1A 3P5JA 4RAZA 2FOKA 3BCAA 3H3UA 3I58A 2Z5UA 3BZKA 4XIDA 1TBXA 1K6YA 4BHBA 3IV5A 2NYXA 4YIFA 1QRYA 3HB9A 2WAQA 1ZGAA 2GIVA 2IA0A 3CUQB 3K7AJ 1R5ID 2UUZA 2OPTA 4DYRA 2ME6A 3HTUA 4FCYA 1TNSA 3H5NA 3H5AA 1A36A 4A3CJ 1WI3A 1ZG1A 3L00A 2WB1N 2XDVA 2ZMEC 1RC9A 3KCCA 2Y31A 2E1CA 4QIWN 2P5LC 4L9VA 4Y15A 2Y2ZA 4HBLA 4RM2A 3VPRA 1W5SA 1V4RA 3G1OA 2RV8A 1GUUA 1YYVA 1TWFJ 2VE8A 2DDBA 1Z91A 4M71A 1N77A 3QU6A 4XNFA 2OCCH 1BA5A 3BG6A 3CUQA 2OZUA 1HSJA 1RPWA 2VXZA 3I55I 4LGWA 1R4NB 1X3UA 1X58A 1Z7UA 4U7BA 4J01A 1VFCA 2GXGA 1EJ9A 5B66C 1GV5A 3RKYA 3TL4X 3WG7H 5IP7J 4IHVA 3GVAA 1MBKA 2V9PA 3HSEA 3K4KA 3Q9VA 4FE4A 3R60A 3ZRGA 5L3BA 1FJLA 2KDZA 5HDNA 1WJDA 1T8IA 4FISA 1QZEA 2XSJC 3CJQB 1JGGA 1H0MA 2ELJA 2XUBA 4YG2F 1ZHFA 2F4MB 2B63J 2IGKA 2HYFA 1E17A 1P6RA 3SEZA 2K40A 1SFKA 2QBYB 1MW7A 2PN6A 2K3PA 3CP2A 3EUHC 1RZ4A 3FMSA 4AWXB 3VB2A 3L1PA 1PP8F 1SVOA 2O03A 1IW7F 4HA8A 3HPHA 2F2EA 2COBA 3GYHX 2WC2A 5H2FC 3PO2J 4CYDA 2G0EA 1ZREA 2EH3A 3K1MA 2LYCA 2L9NA 4DNCA 5CQEA 2UXXA 1SD4A 3J80Z 3GZ5A 4HF1A 2CUFA 4XLEA 5BQTA 2IRFG 3MFKA 3BG3A 2XAHA 2QA4I 2HPMA 3FXJA 2YPRA 1AA7A 2CQQA 2HWVA 1USSA 5IPAA 3PIPF 4EJVA 1BBYA 1R5HA 3DF8A 3DU6A 3UNGC 4BJTA 3JRCA 2HOEA 3OL3A 4OIRF 2K02A 3GFIA 2ZB9A 1Y8QB 2Y0SA 3QRFF 3HOWJ 1HXDA 2WY8Q 4XLHA 1B9NA 4A3GJ 1S9HA 2Y9ZA 3OYAA 4AYBN 1WCMJ 5BPDA 1XC5A 2XB0X 1SAXA 1RIOH 3J7AO 2DMUA 2RDPA 3FXKA 2XROA 4G6QA 1WJEA 4KN7X 1D0ZA 4IHTA 4JX6A 3FBNB 3ECOA 1LJ9A 5EYRA 2YR2A 5E3LA 1IGNA 1JKQC 2QSFX 3RDIA 2VOPA 3TGNA 5CKTA 1B8IB 1FYKA 1OCZH 1FSEA 1U5TB 4LITA 3QOEA 3P9IA 2ZFUA 4ZYGA 4XL9A 3A0BC 1U78A 3ABLH 1HW2A 5GTIC 3VWBA 3BTCA 3F8FA 3RZDJ 3KETA 3FZVA 4ENMA 2PMUA 5BMZA 1DU6A 1ETQA 2JRTA 3CCQI 4B3AA 3K4MA 1P4AA 5CPRB 4OAZA 1IG7A 1J2XA 2VONA 4BQNA 3T8RA 5E8IA 5CVVA 2E1NA 5L3FA 3SYTA 3IKTA 2CW0F 2PG4A 1MBHA 1J7KA 1U5TA 2B0LA 2KPMA 3R0AA 1YQAA 4XLCA 1WWXA 1FYLA 3CDHA 3PO3J 4KMUX 4BHCA 2NS7A 1XGMA 1Z0XA 4U0WA 3GW2A 4PJJA 1IUFA 5E18F 3JAMK 1IN6A 1I1GA 1P9QC 4UV8A 3J7YJ 2QZ8A 3CCRI 3BJAA 2JK3A 3OSFA 3V7CA 2CV1A 2ECCA 3ZP5A 2A05A 3MAJA 2EJRA 2Z99A 2VKDA 5GTHC 4I6ZA 2WV1A 1EH6A 1OKRA 1KQ8A 1MBFA 1JKRC 1IRZA 2FSWA 4W97A 3ABKH 5J4YA 1FP1D 3Q0VA 4U7DA 1FEXA 1S5LC 2YX4A 2NNNA 1WH7A 2O6GE 2EIKH 3IH4A 3AL0C 4UUVA 2RGVA 1CQTA 4A3LJ 4PGHA 5AIQA 4UUSB 2IXSA 5KCMA 2WADA 3K10A 2NXNB 3I0TA 3VYUB 2QGUA 2BVLA 1SFOJ 1T2KA 2QKMB 1MNEA 4HRIA 4BJ6C 1YFHA 2GLOA 5FD5A 3VYSB 4D1QA 4CO8A 4B8XA 3M7GA 4B48A 4XBFA 1FP2A 2JRMA 3O2PE 3OYNA 2VODA 3OYCA 1H89C 1ZLKA 3RYRA 4UUSA 3BDDA 1P2FA 2M0CA 4P9FA 3D5LA 1LVAA 1MZBA 5LFAA 2VXDA 2O8XA 3LQRA 3OYBA 2D5VA 1WJ5A 1YIOA 3DWLE 1WKMA 2D45A 2Q0OA 4KN4X 5AIPA 4GXOA 2PLYA 5JLWA 3M3YJ 1XSDA 2BW3A 4NDLA 4ZH4F 3JAMZ 1MMDA 4G6DA 3OS2A 2IS2A 2UZKA 4XRSG 2P6SA 1D1BA 1YIJI 2KKOA 2M5WA 5F04A 4I01A 2H1LA 2X6XA 1FOXA 2LRDA 3KP3A 5FLMJ 2EZHA 5KHDA 4ESFA 1BIAA 2DTRA 1SFXA 2XAGA 2KLOA 4KDPA 1AHDP 2DAOA 4BE1A 3PUFA 1PUEE 2QSHX 3FK7A 2IVMA 4QWQA 1FIPA 3BTJA 3E97A 3J7ZI 5EG0A 4RB2C 2VJJA 1R1UA 3E6MA 3LWFA 4GYIA 3BPVA 4GCVA 4CCOA 3RQ4A 1PVEA 5FKNA 2XAQA 1IDYA 2CUJA 2KZGA 2O7OA 4M9ZA 2DTZA 1OCTC 1OFCX 2H6BA 1RUNA 2X6WA 3GTLJ 1R7JA 5H6QA 2QQ8A 4AIJA 3P7NA 4PCQA 3F9KA 4XKCA 2W84A 1ULYA 2BOLA 2EV6A 2G7HA 1B72B 3QYFA 1G3WA 2BY3A 2E2JJ 4U0VA 3GLLA 2R7WA 3LFUA 4AIKA 2VBYA 5DCMB 3OSGA 2FBHA 1FBSA 1U5TC 1VZ0A 3DLLF 4N0BA 4FASD 4KIFA 1HDPA 3M1CA 3DEWA 2VJ5A 1XMXA 3ZQIA 3EETA 4LD5A 2DU9A 5LGTA 4KUMA 5DUKA 5J3LA 4KYWA 2MD0A 2E60A 2GOMA 4E7SA 3JRGA 4C2MJ 2HQRA 3BT9A 3V8LA 3JRBA 3C1DA 3DTKA 3ROUA 1MD0A 1K61A 1B1BA 5KK1A 3V7SA 1TT0A 2D1HA 2NNYA 4HAMA 1X2MA 5ICCA 2MLKA 2JA6J 3ZN0A 5DV5A 3CLOA 3CDIA 1IN4A 4C3JJ 1ON2A 1PYVA 1ZR4A 1UHSA 3K4CA 2OTJI 3GZNB 5HLHA 3I4NJ 1W5TA 3CC4I 1WFXA 2RKHA 4XQFA 1J09A 3HTSB 4A2UA 1RR8C 3HRUA 3FM5A 2L01A 3CF5F 4P9UA 4NC8A 2X51A 2V9VA 2EZLA 4NB5A 2M7AA 2RC4A 2LK2A 4ZYEA 2IA1A 2ZKZA 2LREA 4G7HF 1YG2A 2VPLA 2LDUA 1MJAA 1Y0UA 3CLQA 4ESBA 2WB1A 4F93B 4M6YA 4OINF 2XGXA 2COMA 1U8RA 4IHWA 4KMFA 5FRNA 2KMUA 4PGGA 1ZKGA 4XOPA 3GTKJ 3DXJF 2FBKA 1LB2A 3S1MJ 2X1CA 2MC3A 3O8HA 5EZHA 5L3EA 5E1ZB 3QAHA 2L54A 5ICFA 4HNUA 2VLAA 2H8WA 5L3DA 1XGOA 3KLNA 2UWMA 2X85A 3I53A 4P96A 2JMWA 3ISPA 3BZ6A 3CCYA 3H3ZA 3L09A 3EUAA 2BYVE 3DLAA 2GM4A 3HC7A 4IXAA 1BR1A 2CSOA 2O0YA 3QP5A 1WJFA 2E71A 2GQQA 3QWLA 3DV8A 1EH8A 4KT5C 5FFZA 4CICA 3AAFA 1YX5A 2VBXA 3WE3A 1A5JA 4RS8A 2K4BA 1GXQA 1B59A 4KITB 2MYSA 1SD7A 4ZC3A 3V4GA 4ZYDA 4LFUA 1VQ8I 3B02A 5K5RA 4XSXF 3B73A 2BHYA 1IRGA 1E3OC 5BS6A 5FD6A 2DOEA 4HNTA 4Y52J 3JRFA 2JTVA 1S8NA 3ABUA 2IEKA 3NARA 2DQRA 2HDCA 2L4MA 2CV2A 3EUKL 4F3QA 1I27A 2ZMEB 2AQFA 4BS9A 4QPOA 1RKWA 1QZYA 2CS3A 4OMYA 2DFEA 3KLOA 4HV6A 2HPIA 1SANA 2CRGA 2P8TA 3FHNA 2OAZA 3E7LA 2R3SA 3CCJI 4GFBA 4IHXA 5E17F 2LVSA 3U1DA 5FJ8J 3GTPJ 4A3EJ 5K1YA 2OUMA 2TCTA 1I3AA 2PJRB 5FKKA 2YU9J 1A6QA 2O5RA 3T0YA 1X4PA 3LMMA 5J47A 2FX0A 4C9YA 3ONQA 4TV7A 4MFEA 3FXUA 5E8GA 1MJBA 2HS5A 4CCMA 2E5ZA 1NK3P 4M74A 3DPUA 3WU1B 3M8EA 2P7CB 3CQZJ 3S1QJ 2LKPA 2O8KA 2DA3A 4AYBA 4RAYA 3IL2A 4V2GA 4HYEA 1QNTA 2ID3A 4HG2A 2O61A 5HNHA 3NWTA 1F4KA 1YLFA 5IYBJ 2PJRA 3WTYC 3PFYA 3OS1A 2EB7A 1J5YA 2R7QA 4YIIA 4BBRJ 1JJ6C 5GP9A 5JR3A 2RREA 5C4XJ 4OWRB 3JR9A 2M8GX 2FJ1A 1BC7C 4UXNA 1T0FA 2M7BA 4NC6A 1WGXA 1I3QJ 1OCPA 4BYYA 4R1HA 2AS5F 2OD5A 2HU9A 2R5YB 4IVNA 2HR3A 3HEFA 2QQAA 1T95A 3GFJA 2E2IJ 5ED4A 1YRNB 5DS9A 3ZMSA 3ZQFA 4J19A 3I56I 1FNNA 1DQUA 3LL7A 2E1MC 5FLVA 2LFBA 3I54A 1Z3YA 1O7FA 3DBHB 3EUHA 4S05A 2DT6A 4ETSA 4CZCA 1HCRA 4NHJA 4F92B 4BE0A 1H8AC 2EFQA 5HS7A 2R5YA 3DFGA 2FEZA 4E7KA 1TZLA 3M9AA 2UV1A 4UVBA 4Y33A 4BQQA 4IO9F 1H9GA 5KVRA 4DJAA 4PJ0C 1YO5C 3CMMA 4RB3C 3HIFA 3WTTC 1G6NA 3FXLA 5A2QK 2R0QC 3FXMA 4UUTA 4NBQA 5K7HA 2OZ6A 3BG9A 3K9TA 2DN0A 1LEBA 1XSXA 1O3RA 5TJJA 2NOGA 4YFXF 1UHWA 3DP7A 2K86A 3RIRA 2CMPA 3MKZA 4AD9A 1ONVA 1HBXG 1X19A 2QENA 2W4SA 2ZXIA 4OU0A 4V2FA 3ZQGA 1JKPC 4I09A 1WJBA 3DCFA 2QKLB 4XSZF 3K70D 3G4SI 4BQOA 3SEQA 1T33A 1TT5B 5IT9K 2G7UA 1MBGA 2HXOA 2CWEA 4CSWA 1XMAA 4ESJA 2XKPA 3CJNA 3OL4A 1T56A 2HVQA 1U9OA 1HOMA 4YEJA 2CQNA 1M1EB 2F4IA 3ZXSA 5TRDA 1U9NA 1S6LA 3QODA 4B43A 2JVGA 3HG9A 2V26A 4MHGA 5IOZA 2YUSA 4MTEA 4B4CA 1T08B 2HZDA 5LGUA 4F91B 5C3EJ 1HW1A 3OIQA 2OJED 2HYGD 3A0HC 3PNTA 2K27A 2XC7A 4A3DJ 3ZGKA 3GWZA 1TNTA 2BHZA 1LFPA 1IAWA 1X4OA 2Z33A 2YSRA 2DMPA 3JSOA 4XONA 3JTGA 1S72I 3TEDA 2CO5A 4UV9A 1DGWY 3JCUC 3OYIA 2XGEA 4NC7A 3MD2A 3WODF 3O6BB 2HTSA 4Y13A 4I02A 3OYEA 2W7NA 2HOTA 2DFHA 4DBQA 4G7ZF 2ZFWA 3RKXA 5JLXA 2WTEA 1N78A 5LLQA 1HLVA 5LEKA 5B5EC 1W1WE 5A2QZ 2XAFA 4JP0A 2PQ8A 1KU7A 3WHCA 3N05A 2LMDA 2FMYA 4D7NA 1ZQ3P 1ZR2A 5KAFC 3GTOJ 1S7EA 2XF5A 3ULQB 2LR8A 1Z21A 3F21A 3HBLA 1O3SA 3TMOA 3LSPA 4C2TA 3CC2I 3AL0B 3SJMA 1HQCA 2Z16A 2Y9YA 2BZTA 4FETA 2IGNA 2ZXJA 2X1EA 4FT8A 3K1NA 5ILSA 5F0CA 1YJNI 2MH2A 2X6YA 5CQGA 1EA3A 2LOOA 3B6AA 1W7PA 3GCMA 5CYVA 2W00A 2DMTA 1T0FC 4IX7A 3T1BA 5IT9Z 4DIQA 2ZCWA 4DZJA 3HYIA 3FMRA 1BJZA 4XK4A 4C3HJ 3PFIA 4X6AJ 1UG2A 3KP2A 1VI0A 2CUZA 4A5NA 2WAEA 3H5RA 2XPVA 2DOFA 2JSCA 1TQMA 3MQ0A 2PMZA 3ZQQA 1KZHA 5DTDA 5J1RA 2EWNA 3H9GA 4BE2A 4ZJZA 5LRSA 4IQ4A 4JQFA 4IF4A 5J4VA 1ZK8A 1ETVA 3FHZA 4E7HA 2PFBA 4WCGA 2LKXA 4AIHA 1SEUA 1MH4A 3SZGA 4RAFA 4NUBA 2Z3YA 2DPUA 2CFXA 2MSYA 2DW4A 2L7FP 1WVRA 1LDKB 3JRDA 1QZZA 1S29A 2L7KA 4XM3A 2ZJRF 2MABA 2ZJ2A 1KYWA 1YX3A 4RB1A 2JA8J 1O3TA 4CGZA 3QYEA 5IYCJ 2HI3A 4LMYA 1PP7U 1VF9A 1MBEA 1TL8A 4MEYF 4M3FA 3CCMI 2VE9A 3Q0WA 1GV2A 2DODA 5DCFA 3EYIA 3CZ6A 4F7ZA 2HZTA 2VIXA 1P4XA 1BJAA 3A03A 2E2HJ 1REPC 4JBAA 2OA4A 2EPFA 1F5TA 2O3FA 2AQEA 2DT7B 1OMIA 1TQIA 2R7VA 3AFHA 1RRJA 2ZBKA 3DU5A 1XCBA 3CP8A 4XLFA 1W0TA 5IT3A 5D6FA 1QPIA 1WHUA 2A68F 2Q2EB 2VBZA 5F27A 2NVQJ 1JGSA 5F1JA 1IZ1A 3S8PA 2TRTA 5CVUA 2R7DA 1NH3A 3S2DJ 4UHTA 1D5VA 4AM3A 2RQQA 2XIGA 4D7MA 3KP7A 2ME0A 4XR6A 4LIUA 3BR0A 4PK4A 1DU0A 3CD6I 1NG7A 3OWTA 3U21A 1YS7A 3JW4A 3H35A 3LSJA 3K69A 3HHHA 3CCVI 5D5XB 3RJPA 3BG5A 2EK5A 2Q2EA 1FZPB 2N8GA 3FIWA 3LSHA 4D5CA 2BY1A 4CYCA 4BXXJ 3C18A 2QQBA 3GEZA 5GPAA 5E1WA 4E4HA 1GT0C 4HOBA 2QSGX 3D5RC 2F6CA 3F6OA 1GXPA 4L5IA 2H8RA 3KEYA 1E3HA 3VSKA 3A1YA 1MNMC 2K9QA 2BY2A 3EYYA 4GO1A 5FKMA 4DOZA 4LLLA 2EILH 3PQJA 1YS6A 4PSXA 2IS4A 2JZYA 1ETYA 2HYJA 2V4JC 2M45A 3KEQA 4YIRX 3OOPA 2QLZA 5EJCA 3MKYB 4ZTFA 1W36C 2DA1A 4M3EA 1V3FA 4ZZDA 4IOAF 1FT9A 2STWA 2CGPA 1SD6A 3Q0UA 4MQ9F 3WG9A 4Y3OA 3F8MA 5L3CA 5EGOB 3NRVA 3CMYA 4YRVA 1YJWI 1G3SA 2OU2A 3G2BA 5LGNA 2V1XA 2CW7A 2LKSA 3QOPA 1FC3A 1FSHA 2IA2A 3KZIC 1O57A 1ZG3A 2ZXWH 5JVGF 1FTTA 2OC6A 1V54H 2EINH 1S7OA 2IW5A 1AKHB 2GZWA 3MMYB 4YELA 3WGGA 5GAEJ 1KYZA 1TW3A 2FRHA 1A04A 1MGTA 1I1SA 3QPTA 2AXLA 5E3OA 2ZC2A 4HLYA 5EGOA 4HX4A 1BR2A 2EV5A 4XKVA 1K7AA 5GAHJ 1ORKA 2EA4A 3K1PA 1YHQI 2V7FA 3KYLA 3COAC 5M5YJ 3L2VA 2HDWA 3L2CA 6PAXA 4BU2A 1DP3A 1R22A 1V5GA 3HUGA 3LAJA 1AKHA 4HNVA 2XF6A 1R4MB 3H9QA 1Y1VJ 2BW3B 5JFRA 1L0OC 3KYCB 5C44J 5HS9A 1DP7P 3I59B 3UKGA 1VQ6I 3I9V2 3WE2A 1F36A 4LG0B 4DQ2A 1J9IA 2FUG2 3E5QA 4S0HB 1RETA 2IT0A 3CMAI 5HDKA 2O9LA 3FISA 3H9JA 2HQAA 3LSKA 3WU2C 1BL0A 2IAIA 2A5WA 2VBWA 2A6EF 5FKLA 4OIQF 1D1CA 1UJ8A 1X1BA 4ENJA 2DJIA 1U0JA 2OTLI 3I59A 4ON0A 3JREA 5HDGA 4EJWA 4LG0A 5E1XA 2FNPA 3QPSA 1QU3A 4BGDA 5EG0B 2E1OA 4BH9A 4CCKA 1XGSA 5DUIA 3X2QH 3K4BA 4ITVA 3O3KA 3S14J 2Q8KA 1TLHB 4IRIA 1XSVA 3T8TA 4EM2A 3E5UA 1X1PA 5B3SH 2JT1A 3H0DA 5D5UB 4N4NB 2EFNA 2EQRA 3FXOA 3A01A 2DBBA 2CFOA 4RM3A 1KQ0A 4II2A 1YI2I 1MSFC 4RLFA 5H6RA 3HM5A 1BI2A 2NS0A 2EIMH 2ESHA 5HOOA 4Q4ZF 5CVIA 1RR7A 3MZYA 2MFZA 5E79C 1AOYA 4XN3A 3GTGJ 1XX5A 4WWCA 1K4SA 3V8KA 5E3MA 4BDYA 3QQAA 3IHUA 4ZYHA 2QQ9A 3AG3H 1L3LA 4X1EA 2EIJH 3QPHA 1Z9CA 4RBOA 2PMZN 1TC3C 3GZ6A 2RNGA 3VODA 5D8LB 4N4OB 2F5CA 3OS0A 2KFDA 3HHGA 1SC7A 3CDLA 4BACA 3LSTA 1O3QA 4I0AA 2WY7Q 3SDGA 2BBYA 4XRMA 4DGWB 2X0LA 2Q1ZB 4AVZA 1BI1A 4L5EA 2VJ4A 3WU0A 2KISA 5M5WJ 3R6SA 3SQNA 2ZJQF 1ZLJA 2LBFB 2CQXA 3ZMVA 1JUSA 5ICGA 3AG2H 1OCCH 2M1BA 3BY6A 3K6GA 1BIBA 1HKTA 2VQCA 4HDUA 1ACIA 2VN2A 1Z6TA 3E6CC 1QHHD 2AXTC 3CTAA 3LA7A 2E1MB 4Z6YA 3BJOA 5EDNA 2CV0A 1XPXA 3HJEA 1GDTA 3U9GA 1D1AA 3TO6A 5FROA 4I98B 3WGHA 2FQ4A 3B6CA 3G73A 2WA0A 3K2AA 2KRCA 4B3XA 4CXFA 5ERIA 2LBFA 3CO6C 5FLXK 1IV8A 4R79A 4FX4A 1I6HJ 1XB4A 5K5QA 1R58A 4I2OA 1LNWA 3N4MA 4HQMA 1RKTA 1HSTA 2DYRH 4A3IJ 3PIOF 1UZCA 3BCBA 3RPUD 2HKXA 4O5VA 2IJLA 3REOA 4MQVA 1QVUA 1ZGWA 5M3FJ 3LA3A 2B7EA 4J00A 4A0XA 3M1EA 2PMHA 4FTHA 2CW8A 3NEUA 1LVKA 3RKQA 2LH9A 2DMQA 3F8NA 3HSRA 4EGYA 2V6EA 2HNHA 4PJMA 3L9FA 4BXUA 1Z05A 2FA5A 2P6TA 1WI9A 3EPZA 4M3DA 2EFPA 3DPTA 1VQ9I 4JOMA 1BW5A 4Q47A 3F72A 4EATA 1WJAA 5LD2C 2M30A 3PNVA 2M87A 3BR5A 1C0WA 2HFHA 3RZOJ 1WQ2A 1IC8A 4E7ZA 3DKXA 4G8XA 4LOCA 3U2RA 2DA4A 1ITYA 3E1SA 2P0WA 3JRHA 3IKVA 1NHAA 4XORA 4A5MA 1TWCJ 3A02A 3ABMH 2WV0A 4A93J 5GPCA 3BTIA 4P55A 4XOTA 4MO7A 4XICA 4A6EA 1Z77A 2XB5A 2AHQA 1DUXC 1H88C 1NK2P 3HDDA 1RUOA 4I99C 1X2NA 2RQPA 3WHBA 1VQOI 4JX5A 1LFUP 1D3YA 1IN7A 1ZYRF 2L9RA 4EM1A 3S93A 2QYOA 2QWWA 2I5UA 2DI3A 2ZSHB 5HS8A 1UAAA 3GBGA 1JTXA 1Z7LA 2DXIA 3HOYJ 2HXIA 5FLXZ 4OIOF 5M5XJ 1IUYA 1XN7A 2VUMJ 4EEFG 1ZGJA 2YU3A 3OYDA 1JXSA 1FOWA 4ENNA 2H6CA 2JUCA 1E0EA 1JTYA 2LY1A 1JE8A 3ZOBA 2W1OA 1YOVB 2M2EA 3JRIA 1WPKA 3HL2A 2CH0A 2D1VA 2FXAA 2VT2A 1MDMA 2EFWA 1HKQA 2I8DA 5D8KB 1HDDC 1X3WB 3PUBA 4E6KG 1YITI 4RB0A 2E34A 1X1AA 1ZARA 4HQEA 1BW6A 3L2RA 1SMTA 2OBPA 2W57A 1ETWA 2Y75A 2R5ZA 2LP0A 3KE2A 4RLQA 2BY0A 3FKIJ 2XASA 5F64A 1Y1WJ 2B9SA 4IHSA 4M6XA 1MIJA 3D5SC 5LRRA 2LC2A 5DM6F 3HRTA 4GGGA 3IWZA 4DZPA 4ZTJA 1TQPA 3C3WA 4FQGA 4MNUA 3W2WA 3GTMJ 1YW7A 2DJNA 2VL8A 1X1DA 4V19K 3BR6A 2VQGA 1T38A 2MA3A 2KJCA 3PSIA 4MIMA 5EEAA 3OIPA 2XV4S 1VQLI 3SZPA 3F8CA 1R71A 3RPQA 1KA8A 2AO9A 2R7FA 3S3OA 5K7ZA 3W6VA 1VQPI 3A2KA 1ZTRA 2DO7A 5DDGA 1TW2A 4XRFA 4IL6C 4CHUA 4EGZA 3L2WA 4BHPA 2PX9A 3ZR8X 4P1WA 3P9CA 1NTCA 3ZQLA 3HKZN 2V1NA 2VKHA 1IXRC 4L9JA 3OYKA 2R92J 2L2OA 1IF1A 1SMYF 3HZJA 3TP3A 2A69F 2DLLA 4UVAA 2F5FA 5IOYA 3IAM2 1R00A 2PI0A 2LF8A 3BR1A 4F52A 1SD5A 1EF4A 3KYDB 4S04A 2CU7A 2HQ5A 1FOYA 1LEAA 3G3ZA 3SFIA 3R61A 1P7IA 4JYKA 1R36A 2LNBA 4XLNF 1IN8A 3J81K 1JUPA 3FF5A 5ICEA 2OQGA 4CDGA 4BQAA 2GXBA 1G3TA 1UCRA 3AG1H 2L3DA 4IHYA 2EZIA 1Z6RA 3G1LA 1HC8A 2V1DA 2C6YA 4BEHA
chains in the Genus database with same CATH topology
2L7KA 2MABA 1YX3A 3S3MA 3OYNA 3OYCA 3QYEA 3W2VA 2LG4A 3DKYA 3D5LA 5LFAA 1G8XA 3CZ6A 2VXDA 2VIXA 3OYBA 1WJ5A 3DWLE 2E5NA 3HOTA 3PJRA 2JUGA 1V5EA 2BW3A 2AQEA 2DT7B 4II3A 3L2UA 3OS2A 1MMDA 3AFHA 3LSGA 2R7VA 3DU5A 2NOJB 2VB6A 4X0GA 2IS2A 4H4KC 3CP8A 4ZDOA 1D1BA 4XLFA 3OYFA 5HLTA 5JHFA 4MLOA 2X6XA 2R7XA 2LY2A 2LRDA 2Q2EB 3HPGA 2V9KA 5KHDA 3W3CA 3BC8A 3S8PA 2KLOA 2RQQA 4BE1A 4HSTA 4PJLA 1W36D 3KX2A 4XKBA 2KP6A 4XR6A 4LIUA 4PK4A 1NG7A 3OWTA 3S3NA 2VJJA 3U21A 3H35A 3RTRA 1OLTA 4CCOA 3RQ4A 1X1CA 2CUJA 4PSWA 4E7JA 4KISA 1Y6IA 2X6WA 4KT6A 3LSHA 2XF7A 4E4HA 1D0YA 3F9KA 2VQLA 4XKCA 3D5RC 2M4GA 2BOLA 2F6CA 4QPQA 3QYFA 2A6TA 4C30A 1JI8A 2R4GA 3M8JA 3KEYA 2R7WA 3VSKA 3A1YA 3LFUA 3OMYA 4DOZA 4PSXA 2IS4A 1VZ0A 1UG0A 4FASD 2V4JC 2HVSA 4CCNA 3M1CA 2VJ5A 3MKYB 4ZTFA 3VYRB 2Z1DA 3IP4B 1W36C 2KHMA 2MD0A 2E60A 4Y3OA 2GOMA 4E7SA 3DTIA 4YRVA 1WJCA 3G2BA 2CW7A 3DTKA 1TT0A 2ZSIB 3OY9A 2OC6A 2WBMA 4YELA 3MMYB 3OYGA 4E7LA 4HEA2 3OYMA 2IS6A 4BEHB 1PYVA 3BLYA 1MMNA 3AKZA 3K4CA 3TBIA 4XMYA 2K9MA 1BR2A 3S32A 2M3AA 1WFXA 4XQFA 1J09A 2M0MA 4XKVA 4PJNA 4CA0A 4HSRA 2V7FA 4NC8A 3KYLA 4ZDLA 2KRHA 2X51A 4CCJA 3OYLA 3L2VA 2HDWA 2M7AA 4BU2A 1DP3A 2BVMA 3V42A 1V5GA 3SDBA 2R7UA 2LREA 3VSLA 2XF6A 3H9QA 2IS1A 2BW3B 2L5QA 3DTEA 5HVQC 2VPLA 3I9V2 4F93B 2WB1A 3HXLA 4KJZA 2FUG2 4LIVA 1PJRA 2GOXB 1GLNA 5FRNA 3VDXA 2KMUA 4XOPA 4XM3A 4BL0B 3LSMA 1Y56A 3H9JA 3LSKA 2HQAA 4IZZA 5HNFA 2DOAA 2X1CA 4B44A 2A5WA 2R7SA 2M4KA 1D1CA 4HNUA 1OR7C 1X1BA 2DJIA 4RMNA 4CUGA 1U0JA 2VLAA 2UWMA 1UELB 4AU7A 2X85A 1MMGA 1N75A 3C2HA 3OOUA 1FMVA 1QU3A 3IAS2 4BGDA 4CCKA 4E7IA 3C2GA 3ZCOA 3EUAA 4DBRA 2DCEA 3K4BA 3DLAA 4ITVA 4BDZA 3HC7A 1BR1A 3MKWB 4ANJA 3FBIB 1WJFA 4PFPA 3H0DA 1YX5A 4N4NB 1R6RA 2F5VA 2KZVA 3CJRB 1YE9A 4KITB 4GRIA 2MYSA 3DPLC 4XLAA 4ZC3A 1NG6A 2CFOA 4NQWB 3K4NA 4RM3A 4II2A 4RLFA 4HNTA 3BG7A 5HOOA 1V5FA 4D9JA 2MFZA 4XN3A 3CESA 4IKFA 4BDYA 2CV2A 3EUKL 4F3QA 4BS9A 2AQFA 4QPOA 3FKJA 2CS3A 4IQJA 2RNGA 3OYHA 2HPIA 4N4OB 4U87A 3FHNA 3OS0A 2JA2A 4BACA 3BCAA 2WY7Q 1BR4A 1K6YA 2OUMA 2PJRB 4DGWB 2O5RA 2Q1ZB 1X4PA 2W82A 4AVZA 3LMMA 3RCOA 2WAQA 2K9LA 3ONQA 4C9YA 2VJ4A 2JSPA 4OAYA 3PNYA 4CCMA 2E5ZA 2UUZA 4PFOA 2LBFB 3H5NA 3H5AA 1QHGA 3DPUA 2XDVA 4AYBA 3K6GA 4RM2A 2VQCA 3IUOA 4HG2A 1QHHD 5HNHA 3W2AA 3NWTA 2E1MB 2CV0A 2PJRA 2IGMA 3PFYA 3OS1A 3HUGB 2R7QA 1D1AA 5FROA 2RREA 1N77A 4OWRB 4XNFA 3BG6A 1IRXA 2VXZA 2WA0A 2M7BA 2KRCA 4B3XA 2LBFA 4R79A 1SAUA 4U7BA 2HU9A 3HOSA 4J01A 2R7RA 3VYTB 1T95A 3TL4X 4BEHA 3BCBA 3RPUD 3NWSA 4P5OA 3K4KA 3ZRGA 1DGRM 1WJDA 1DQUA 3LL7A 4J00A 2E1MC 2XSJC 1Z3YA 3CJQB 2CW8A 2DT6A 4CZCA 2ELJA 4F92B 4BE0A 1LVKA 3FDYA 2LH9A 2JVHA 2IGKA 2V6EA 2HNHA 2VJIA 4PJMA 3SEZA 1MMAA 1SFKA 1MW7A 2R7OA 2K3PA 3CP2A 1TZLA 3EUHC 4E7KA 2XAUA 3EPZA 1D0XA 2UV1A 4BQQA 4Y33A 3DPTA 4JOMA 4DJAA 3HPHA 3OR2C 3CMMA 1G59A 1LKXA 4EATA 1WJAA 2MC4A 5LD2C 3PNVA 2LYCA 2L9NA 4E7ZA 3DKXA 5CQEA 3E1SA 2P0WA 3HKZA 4XORA 2HVRA 3MKZA 2CMPA 4XLEA 1X19A 3DQVC 2W4SA 2HPMA 4XOTA 2ZXIA 1HA8A 1WJBA 1AA7A 2QKLB 3K70D 4BQOA 5FRMA 3SEQA 3DU6A 4BJTA 3UNGC 1MNDA 3LSIA 3OL3A 1ZELA 2Y0SA 3S93A 4HPQA 2WY8Q 4XLHA 4CSWA 3OL4A 4LG3A 2HVQA 2ZSHB 1S9HA 4YEJA 3K4LA 2F4IA 3OYAA 1UAAA 3GBGA 3ZXSA 1Z7LA 2DXIA 3DEEA 3I3LA 3QODA 4B43A 4C2UA 1WJEA 1D0ZA 2JVGA 3HG9A 2V26A 3E0JB 3FBNB 4ZDPA 4G6TB 3OYDA 2R7TA 2X1DA 1E0EA 2HZDA 2LY1A 4F91B 2W1OA 3OIQA 1KONA 4XN0A 1Z3XA 5CKTA 3HL2A 2CH0A 3PNTA 2XC7A 2IGOA 2I8DA 2Z2SB 4LITA 3K4JA 3ZGKA 3QOEA 2VQHA 3PUBA 4E6KG 2ZFUA 1LFPA 4XL9A 1X1AA 1X4OA 3L2RA 4XONA 3VWBA 4RLQA 1DGWY 3OYIA 3K70C 4Y4RA 2WAFA 4NC7A 3MD2A 2W7NA 3OYEA 3K4MA 3RSNA 5CPRB 4OAZA 4BQNA 4DBQA 3D5SC 1BOBA 2LC2A 4PUSA 3SYTA 1N78A 2KPMA 4ZTJA 4XLCA 3N05A 3W2WA 2VL8A 1X1DA 2XF5A 2VQGA 4PJJA 3PSIA 3L2QA 3OIPA 1Z21A 4BXFA 3TMOA 4B47A 4C2TA 1P9QC 3AL0B 2Z16A 4FETA 3S3OA 2ZXHA 2IGNA 1ERDA 4ZYAA 2X1EA 3A2KA 2L9SA 3UR3C 4BUPA 2X6YA 2CV1A 2VASA 5CQGA 1EA3A 2LOOA 3L2WA 2W00A 1T0FC 4P1WA 3ZR8X 4IX7A 3PSFA 3A4CA 4DIQA 2V1NA 2VKDA 2VKHA 1FMWA 3PL8A 2KL4A 3OYKA 4CH7A 2L2OA 5TGTA 2CUZA 2WAEA 3H5RA 4NNJA 2PMZA 3ZQQA 4BJ5C 3IAM2 3H9GA 2KDOA 4F55A 5KNLA 4F52A 4BE2A 3AL0C 2KQRA 3CF2A 3QYBA 4ZJZA 4IQ4A 4JQFA 2IXSA 5KCMA 4CCLA 3J7AY 4E7HA 2OV7A 2WADA 3K10A 3VYUB 2BVLA 3OYJA 2K5CA 2QKMB 3SZGA 1MNEA 4HRIA 4NUBA 4BJ6C 3VYSB 4XKWA 4D1QA 4B48A 1LDKB 3OR1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XF7 A;  2XF5 A;  2XF6 A; 
#chains in the Genus database with same CATH topology
 3FK6 A;  5JHU A;  3HOZ J;  4KIG A;  3S3M A;  5M3M J;  3W2V A;  3F23 A;  1JUM A;  5ILV A;  1TWA J;  3OV8 A;  3JTH A;  5JVT A;  5EEH A;  1OCO H;  3S1R J;  1EV7 A;  2L4A A;  2EV0 A;  4KIB A;  4IJA A;  3ZMD A;  3HOT A;  2W85 A;  2EBI A;  1A35 A;  1QPM A;  2K3F A;  1YJ9 I;  3ELK A;  3IH2 A;  4IEJ A;  2YS9 A;  2NOJ B;  2G9W A;  2VB6 A;  4X0G A;  1VQN I;  4QLC U;  2HOA A;  2H1K A;  1CF7 A;  4B09 A;  4C3I J;  1FY7 A;  1B9M A;  3GXO A;  3KP6 A;  2P7V B;  4MLO A;  2K85 A;  1KU2 A;  2LY2 A;  2MW8 A;  3HPG A;  4L9T A;  1IO2 A;  3BR2 A;  3TO9 A;  1ZG5 A;  3CJT B;  2VPR A;  2Z9O A;  2DT5 A;  4HST A;  4PJL A;  4D5F A;  1OCR H;  5F1R A;  1ETO A;  3K2Z A;  4M3G A;  1SVL A;  5F6F A;  2K4J A;  5LHI A;  1HW5 A;  2FF4 A;  1R1T A;  3ZMT A;  1OIS A;  3RTR A;  2DPD A;  1IXC A;  4CZZ A;  1K6O A;  3F22 A;  3HGY A;  1X1C A;  2PJP A;  4M6V A;  2QVO A;  1ZN2 A;  2OCE A;  2X48 A;  3KPH A;  3EQL F;  3OIO A;  3J81 Z;  2A61 A;  1ON1 A;  3FWE A;  4GDF A;  1D0Y A;  2DFI A;  5KAI C;  4XRS A;  1QO0 D;  2VQL A;  4NQW A;  2VKV A;  3CUO A;  1W7P B;  2XPW A;  3S2W A;  3F8B A;  2M4G A;  3FXQ A;  1LQ1 A;  1QQI A;  2NVY J;  1E2X A;  3PM1 A;  2NS8 A;  4C30 A;  3M8J A;  1B4A A;  1JI8 A;  3TKY A;  2LY9 A;  4AVP A;  3HOU J;  1IXS B;  4MEX F;  2JPB A;  1OQY A;  2NVT J;  5IP9 J;  1KQ9 A;  2Z1D A;  1I6X A;  4O3M A;  4M9X A;  2EA2 A;  3IRQ A;  3J80 K;  1U2W A;  2XSD C;  1YW9 A;  2KIU A;  4PDK A;  2L9V A;  3DEU A;  3DTI A;  4AUX A;  2XGD A;  3E3V A;  2D2W A;  2QM3 A;  4G94 A;  3QU3 A;  3SXY A;  5L3G A;  2L0K A;  4LK0 F;  4KA4 A;  1B6A A;  2ZSI B;  2ADU A;  4IPA A;  3OY9 A;  5H20 A;  3VFZ A;  5K7F A;  3OYG A;  4HEA 2;  2IS6 A;  2DA5 A;  4BKX A;  4I76 A;  5LHG A;  2QEX I;  5HLG A;  3GTQ J;  1S7A A;  4XMY A;  2K9M A;  4LK1 F;  4QSH A;  2M3A A;  4PJN A;  4M9S A;  4EQQ A;  4HSR A;  4ZDL A;  2KRH A;  4A3J J;  3OYL A;  1JJ8 C;  1OPC A;  2L7Z A;  4OOI A;  2ID6 A;  3HSF A;  4A69 C;  2NRA C;  3SDB A;  2R7U A;  3V7R A;  2FOW A;  2XRL A;  4MFD A;  3VSL A;  2M34 A;  5LBQ A;  4QTR A;  5EF6 A;  2IS1 A;  2L5Q A;  3DTE A;  1EH7 A;  5HVQ C;  3HOV J;  4BNC A;  4LIV A;  3BJ6 A;  1PJR A;  5F08 A;  2LSO A;  3VOE A;  4ZZL A;  1R5G A;  3GX4 X;  5D4R A;  3LSM A;  4FHT A;  4EJO A;  1WSU A;  4M73 A;  3MKL A;  5HNF A;  3WTX C;  4Z2Y A;  1JHF A;  2E7X A;  1R49 A;  4ASN A;  4EM0 B;  2R7S A;  2M4K A;  4EJT A;  1WH5 A;  1Z1D A;  2BXY A;  3F6V A;  1J59 A;  5CJ9 A;  4AU7 A;  2F5E A;  3LSR A;  1MMG A;  1VQ5 I;  1MH3 A;  1FMV A;  4OIP F;  3IAS 2;  5FO5 A;  3S17 J;  3E5X A;  5DD4 A;  2QBY A;  3W6J B;  1FLI A;  2DCE A;  5CLS A;  1MBJ A;  4BDZ A;  1FOK A;  3KIO A;  2CYY A;  1KU3 A;  1JKO C;  4ANJ A;  1BOA A;  1VQ7 I;  3FBI B;  3S1N J;  3BR3 A;  1G4D A;  2VT3 A;  2GAU A;  2PEX A;  4CYC B;  3CCL I;  1Q1V A;  1YE9 A;  4UY8 I;  3M07 A;  1FX7 A;  3LQQ A;  4GRI A;  4XLA A;  1VQ4 I;  1NG6 A;  4FE7 A;  4HDV A;  1F43 A;  3G1M A;  4K2E A;  1P92 A;  4B1R A;  3ABT A;  3QP6 A;  3T5X A;  4A3F J;  1G3Y A;  3BG7 A;  3BZC A;  5DEQ A;  4D9J A;  2STT A;  3TQN A;  2GA1 A;  3ZN1 A;  3WGI A;  3CES A;  3KFW X;  1TWH J;  5CVJ A;  1W0U A;  4HX8 A;  3BTL A;  3L7W A;  3FXR A;  3TP0 A;  4IQJ A;  3IH3 A;  4IRG A;  3ESW B;  1DPR A;  3KP4 A;  3KZY A;  3OYH A;  2HOS A;  4U87 A;  1XG1 A;  2DK8 A;  3F3X A;  2JA2 A;  1VQM I;  3LAP A;  2MBF A;  5HLI A;  3MZH A;  2MLG A;  1XS9 A;  1BR4 A;  1TP4 A;  2FQ3 A;  2DDA A;  4E70 A;  2KJB A;  2W82 A;  2P5K A;  4UB8 C;  1UFM A;  2M8E A;  3RCO A;  2K9L A;  2IBD A;  2JSP A;  4OAY A;  1IN5 A;  3PNY A;  4WXC A;  1VQK I;  5J40 A;  4WXD A;  2YX7 A;  1QA6 A;  3GO5 A;  4PFO A;  3BQZ A;  1B8I A;  3ASO H;  4ENK A;  4L18 B;  1QHG A;  2Y30 A;  5IY5 H;  1RNL A;  3NAU A;  5E3N A;  5J1Y A;  4KFC A;  4DYQ A;  1DPU A;  3GME A;  3I5U A;  1TWG J;  1W5C C;  1D5Y A;  3IUO A;  3W2A A;  3H1C A;  1LDD A;  5D5V B;  2FBI A;  4EJU A;  2IGM A;  2DA2 A;  3HUG B;  1G2H A;  1Q1H A;  1XGN A;  1W4M A;  2DMN A;  1IRX A;  3TDU C;  4H0E A;  4HW0 A;  1UHM A;  1Y0N A;  2MG4 A;  4L0Y B;  1ZH5 A;  1BC8 C;  1GVJ A;  2QF7 A;  5GAD J;  3FM3 A;  1SAU A;  2I10 A;  3LNQ A;  3CUQ C;  3HOS A;  4UB6 C;  2H27 A;  2R7R A;  4MGR A;  3VYT B;  1YTY A;  3WTU C;  1BM9 A;  3NWS A;  4P5O A;  4L0Z B;  3Q9S A;  2V79 A;  5J6X A;  1STZ A;  1DGR M;  1D8J A;  3W6K B;  2CJJ A;  2ELH A;  1O4X A;  4IOC F;  1FYM A;  4RDU A;  3F0C A;  3FDY A;  1ETX A;  2JVH A;  2VJI A;  1MMA A;  2R7O A;  2K7L A;  2XAU A;  1FWZ A;  2EZK A;  3RQI A;  1IRF A;  1D0X A;  1S3J A;  2W25 A;  1K78 B;  1F1Z A;  3OR2 C;  4L9N A;  1G59 A;  1QVT A;  1LKX A;  2K9S A;  4EMS A;  2MC4 A;  1K83 J;  3A01 B;  4RGR A;  1A31 A;  3BP8 A;  5IYD J;  2L7M P;  3E6D A;  1P7J A;  5HOD A;  1A6I A;  4PZJ A;  5J8C A;  3HKZ A;  2JQ7 A;  4MTD A;  2HVR A;  3TOA A;  2CQ7 A;  4GYG A;  2OF7 A;  4HZF A;  3DQV C;  3G71 I;  2W24 A;  2XGC A;  1HA8 A;  4IRH A;  1K78 A;  2WAQ N;  5FRM A;  1KU9 A;  4YFK F;  1QGP A;  1MND A;  3LSI A;  3H92 A;  1ZEL A;  2M9H A;  4HPQ A;  1IDZ A;  3E6B A;  5BPI A;  2H94 A;  4LG3 A;  3SZT A;  1BN5 A;  3K4L A;  3U1K A;  4M72 A;  3H3V K;  3BRO A;  1ZAO A;  5DM7 F;  1XTA A;  2NVU B;  2FD5 A;  1H9T A;  1XDU A;  1T6S A;  3DEE A;  3I3L A;  3MZ8 A;  4C2U A;  3GUD A;  2A6H F;  2QCO A;  4U88 A;  2P5V A;  1J0R A;  3E0J B;  4ZDP A;  4G6T B;  1RI7 A;  4ABZ A;  3CO7 C;  2X1D A;  2R7T A;  3TW6 A;  2W48 A;  5LEJ A;  1U3E M;  1OYW A;  1D8K A;  2K9N A;  3HRS A;  1KON A;  4XN0 A;  1Z3X A;  3I4M J;  4A0Z A;  2IGO A;  4KIC A;  2J5O A;  2Z2S B;  3BWG A;  3TDZ C;  3K4J A;  3QPL A;  2VQH A;  4A0Y A;  2DA7 A;  2ACJ A;  3D1N I;  3SHF A;  4M3B A;  4BAY A;  4WX9 A;  2JWT A;  1DDN A;  1N25 A;  3K70 C;  4Y4R A;  2WAF A;  2ESN A;  2JPC A;  3RSN A;  2GA2 A;  4Q5S F;  4HLX A;  2CG4 A;  1BOB A;  2ZNY A;  3CME I;  1PUF B;  4PUS A;  1ODD A;  1WRJ A;  5FB2 A;  2E19 A;  3ERM A;  1UMQ A;  2GWR A;  1MJ9 A;  4G7O F;  3GTJ J;  4HF0 A;  4AC0 A;  2JA7 J;  5D6E A;  3L2Q A;  2DYS H;  3I4P A;  4BXF A;  3S16 J;  1GHC A;  4B47 A;  4LB6 B;  3P9K A;  4G9Y A;  1ERD A;  2ZXH A;  2CUE A;  4ZYA A;  1LE8 B;  2L9S A;  5GAG J;  3UR3 C;  3WTV C;  2F5D A;  4BUP A;  1PUF A;  2ZJP F;  2VAS A;  1SFU A;  3M4O J;  1OYI A;  1B72 A;  2HGC A;  3PSF A;  3A4C A;  3KZZ A;  1BI3 A;  5EEG A;  1FMW A;  3EDP A;  5DCM A;  3H0G J;  1Z67 A;  3PL8 A;  2KL4 A;  2V6C A;  4CH7 A;  4BY7 J;  2MGQ A;  4W1U A;  2QUF A;  1U6G A;  5TGT A;  3C7J A;  1MSE C;  1QBJ A;  1MMS A;  2UXN A;  1FBU A;  2XAJ A;  4NNJ A;  5DD8 A;  4HF2 A;  1AU7 A;  4I0B A;  1LE8 A;  2KIQ A;  4BJ5 C;  1E3P A;  2KDO A;  3KP5 A;  4F55 A;  3IC7 A;  2Y0S N;  5KNL A;  3AG4 H;  4BY1 J;  1SFE A;  3GFM A;  1R9T J;  2KQR A;  3CF2 A;  3QYB A;  4A6D A;  3CC7 I;  3MWM A;  4CCL A;  1JHH A;  3J7A Y;  3S2H J;  2OV7 A;  5DYM A;  3ZQ7 A;  4UNO A;  3LOC A;  1LUJ B;  4DW6 A;  3OYJ A;  2K5C A;  3JRA A;  2IPQ X;  1PDN C;  5D4S A;  4XKW A;  1BI0 A;  1R1V A;  3MVP A;  4UVC A;  3ZMU A;  2LD5 A;  2MD5 A;  2RNJ A;  3OR1 C;  4XLP F;  2DA6 A;  4WXH A;  2ECB A;  2ZO4 A;  5B1A H;  3MCZ A;  2R7Z J;  4RGS A;  5D5W B;  2LG4 A;  3ASN H;  3DKY A;  1GVD A;  2XVC A;  1LDJ A;  2JN6 A;  4LLN A;  2F48 A;  3LA2 A;  2E36 A;  2P81 A;  2XPU A;  3CCS I;  1G8X A;  2KT0 A;  5FKO A;  2ZNZ A;  1OR7 A;  2A3S A;  4BBS J;  2E5N A;  1FBQ A;  2LF7 A;  5FGM A;  5TIS C;  2GIZ A;  4WK8 F;  3NQO A;  2Y48 A;  3PJR A;  2JUG A;  1V5E A;  3V8J A;  5IP6 A;  4II3 A;  3Q3S A;  1KGS A;  3L2U A;  1T39 A;  3G6E I;  1MDM B;  3LSG A;  1XCV A;  2H09 A;  4H4K C;  4Y17 A;  4ZDO A;  2BGC A;  2MH9 A;  3OYF A;  1R23 A;  5HLT A;  3GFL A;  4JX4 A;  5JHF A;  1J75 A;  1FTZ A;  2F4O B;  3I64 A;  4LJZ F;  2R93 J;  5J1U A;  2R7X A;  1LFB A;  2R5Z B;  2VC0 A;  1ENH A;  2OQR A;  3C2B A;  3ECH A;  2V9K A;  3W3C A;  3BC8 A;  4R8H A;  2ICW G;  9ANT A;  1W36 D;  4EVI A;  3KX2 A;  4XKB A;  2KP6 A;  2NAZ A;  3GF2 A;  3RI4 A;  3VEP A;  1HF0 A;  2GBY A;  3S3N A;  3N97 A;  1RES A;  2FNA A;  1OLT A;  4RA2 A;  4G12 A;  1JT0 A;  2KIM A;  2DK5 A;  2HDD A;  1K4T A;  4PSW A;  1W7P D;  1U8B A;  4E7J A;  4KIS A;  3FX3 A;  3PQK A;  3SFZ A;  4YFN F;  1Y6I A;  3ZQH A;  4KT6 A;  3S15 J;  2X6O A;  3CCE I;  2BE5 F;  2XF7 A;  3RKW A;  3WTW C;  3BPX A;  1WZ2 A;  2J5P A;  1I39 A;  4HX7 A;  2A07 F;  4QPQ A;  2A6T A;  2R4G A;  4A3B J;  2DFF A;  3R0J A;  3OMY A;  4HV5 A;  5F0H A;  1UG0 A;  2HVS A;  2A5Y B;  3MN2 A;  4CCN A;  2ZME A;  3O8G A;  5AON A;  3VYR B;  2VOO A;  3IP4 B;  1VND A;  2KHM A;  2HEO A;  2Y69 H;  1ZRD A;  3CCU I;  1WJC A;  2VKE A;  3HOX J;  2RVC A;  3HRM A;  1AWC A;  2KIF A;  2BV6 A;  4WF2 A;  2WWY A;  2VI6 A;  1XMK A;  3Q5F A;  2ISZ A;  2WBM A;  1TTY A;  4A3M J;  2ELK A;  1ZRF A;  4E7L A;  1ETK A;  3OYM A;  2LTP A;  4BEH B;  3BLY A;  1MMN A;  3RYP A;  4N9H A;  1UB9 A;  3AKZ A;  3TBI A;  3LFK A;  2FML A;  2XHK A;  5F0F A;  1LPQ A;  4LB5 A;  1HKS A;  5K5O A;  3S32 A;  2L02 A;  2Y0M A;  2CQK A;  2BEO A;  2P4W A;  2M0M A;  3KEO A;  4CA0 A;  2JA5 J;  4CCJ A;  3K0L A;  1CGP A;  1ZRC A;  1X3Z B;  2BVM A;  5CVR A;  3V42 A;  3JSP A;  2EFO A;  5JI6 A;  2E7W A;  1FIA A;  1VTN C;  4FX0 A;  1APL C;  2ETH A;  3BOQ A;  2E35 A;  3TO7 A;  3HXL A;  4KJZ A;  2HKO A;  2FU4 A;  2LLK A;  1CF7 B;  2NVX J;  1UST A;  2GOX B;  1GLN A;  2X9D A;  2XKO A;  3VDX A;  2FE3 A;  4N9I A;  2GXA A;  3TW7 A;  2RN7 A;  4BL0 B;  1Y56 A;  3MEX A;  3ZPL A;  3BQY A;  3TOB A;  4D0P A;  4IZZ A;  1YRN A;  2DOA A;  4B44 A;  1SVM A;  1POG A;  4JK1 X;  1OYY A;  3H36 A;  4DYC A;  1MKM A;  2KRF A;  4LLG F;  3IWF A;  1I50 J;  3WTZ A;  4AID A;  5BOX A;  1OR7 C;  4RMN A;  4CUG A;  4U0Y A;  4Q48 A;  2IP2 A;  2PBI A;  1UEL B;  4RGX A;  3RPU A;  3C2H A;  1N75 A;  3OOU A;  4RGU A;  4RAG A;  1JT6 A;  3D0S A;  4E7I A;  3C2G A;  1EKE A;  3ZCO A;  4DBR A;  4EV0 A;  2JJ7 A;  1T98 A;  3HGG A;  3MKW B;  1Y39 A;  1K79 A;  5EZG A;  4A3K J;  5B1B H;  3IRR A;  1YW8 A;  4PFP A;  1IJW C;  5FFX A;  1R6R A;  2F5V A;  2KZV A;  3FMQ A;  2XRN A;  3CJR B;  1I5Z A;  2X4H A;  3DPL C;  1FPQ A;  1Y8R B;  1O7L A;  4NQW B;  3K4N A;  3DBR B;  3WTS C;  2RAE A;  1V55 H;  2V1U A;  3M8F A;  1IV6 A;  3ZQC A;  2TDX A;  1V5F A;  5LHH A;  4IKF A;  2ISY A;  4O6J A;  4Y7N J;  5ILU A;  2BXZ A;  5J8F A;  1OJL A;  5C4J J;  3FKJ A;  1F9N A;  3R4K A;  3ERE D;  1XDS A;  4OMZ A;  4A12 A;  3ML6 A;  3I71 A;  3ZMZ A;  3DKW A;  5E20 A;  2HTJ A;  4I7H A;  3DBL B;  1P4W A;  1XD7 A;  3GLX A;  2HQN A;  4L5J A;  5BNG A;  2DQL A;  4KNY A;  2VC1 A;  3P5J A;  4RAZ A;  2FOK A;  3BCA A;  3H3U A;  3I58 A;  2Z5U A;  3BZK A;  4XID A;  1TBX A;  1K6Y A;  4BHB A;  3IV5 A;  2NYX A;  4YIF A;  1QRY A;  3HB9 A;  2WAQ A;  1ZGA A;  2GIV A;  2IA0 A;  3CUQ B;  3K7A J;  1R5I D;  2UUZ A;  2OPT A;  4DYR A;  2ME6 A;  3HTU A;  4FCY A;  1TNS A;  3H5N A;  3H5A A;  1A36 A;  4A3C J;  1WI3 A;  1ZG1 A;  3L00 A;  2WB1 N;  2XDV A;  2ZME C;  1RC9 A;  3KCC A;  2Y31 A;  2E1C A;  4QIW N;  2P5L C;  4L9V A;  4Y15 A;  2Y2Z A;  4HBL A;  4RM2 A;  3VPR A;  1W5S A;  1V4R A;  3G1O A;  2RV8 A;  1GUU A;  1YYV A;  1TWF J;  2VE8 A;  2DDB A;  1Z91 A;  4M71 A;  1N77 A;  3QU6 A;  4XNF A;  2OCC H;  1BA5 A;  3BG6 A;  3CUQ A;  2OZU A;  1HSJ A;  1RPW A;  2VXZ A;  3I55 I;  4LGW A;  1R4N B;  1X3U A;  1X58 A;  1Z7U A;  4U7B A;  4J01 A;  1VFC A;  2GXG A;  1EJ9 A;  5B66 C;  1GV5 A;  3RKY A;  3TL4 X;  3WG7 H;  5IP7 J;  4IHV A;  3GVA A;  1MBK A;  2V9P A;  3HSE A;  3K4K A;  3Q9V A;  4FE4 A;  3R60 A;  3ZRG A;  5L3B A;  1FJL A;  2KDZ A;  5HDN A;  1WJD A;  1T8I A;  4FIS A;  1QZE A;  2XSJ C;  3CJQ B;  1JGG A;  1H0M A;  2ELJ A;  2XUB A;  4YG2 F;  1ZHF A;  2F4M B;  2B63 J;  2IGK A;  2HYF A;  1E17 A;  1P6R A;  3SEZ A;  2K40 A;  1SFK A;  2QBY B;  1MW7 A;  2PN6 A;  2K3P A;  3CP2 A;  3EUH C;  1RZ4 A;  3FMS A;  4AWX B;  3VB2 A;  3L1P A;  1PP8 F;  1SVO A;  2O03 A;  1IW7 F;  4HA8 A;  3HPH A;  2F2E A;  2COB A;  3GYH X;  2WC2 A;  5H2F C;  3PO2 J;  4CYD A;  2G0E A;  1ZRE A;  2EH3 A;  3K1M A;  2LYC A;  2L9N A;  4DNC A;  5CQE A;  2UXX A;  1SD4 A;  3J80 Z;  3GZ5 A;  4HF1 A;  2CUF A;  4XLE A;  5BQT A;  2IRF G;  3MFK A;  3BG3 A;  2XAH A;  2QA4 I;  2HPM A;  3FXJ A;  2YPR A;  1AA7 A;  2CQQ A;  2HWV A;  1USS A;  5IPA A;  3PIP F;  4EJV A;  1BBY A;  1R5H A;  3DF8 A;  3DU6 A;  3UNG C;  4BJT A;  3JRC A;  2HOE A;  3OL3 A;  4OIR F;  2K02 A;  3GFI A;  2ZB9 A;  1Y8Q B;  2Y0S A;  3QRF F;  3HOW J;  1HXD A;  2WY8 Q;  4XLH A;  1B9N A;  4A3G J;  1S9H A;  2Y9Z A;  3OYA A;  4AYB N;  1WCM J;  5BPD A;  1XC5 A;  2XB0 X;  1SAX A;  1RIO H;  3J7A O;  2DMU A;  2RDP A;  3FXK A;  2XRO A;  4G6Q A;  1WJE A;  4KN7 X;  1D0Z A;  4IHT A;  4JX6 A;  3FBN B;  3ECO A;  1LJ9 A;  5EYR A;  2YR2 A;  5E3L A;  1IGN A;  1JKQ C;  2QSF X;  3RDI A;  2VOP A;  3TGN A;  5CKT A;  1B8I B;  1FYK A;  1OCZ H;  1FSE A;  1U5T B;  4LIT A;  3QOE A;  3P9I A;  2ZFU A;  4ZYG A;  4XL9 A;  3A0B C;  1U78 A;  3ABL H;  1HW2 A;  5GTI C;  3VWB A;  3BTC A;  3F8F A;  3RZD J;  3KET A;  3FZV A;  4ENM A;  2PMU A;  5BMZ A;  1DU6 A;  1ETQ A;  2JRT A;  3CCQ I;  4B3A A;  3K4M A;  1P4A A;  5CPR B;  4OAZ A;  1IG7 A;  1J2X A;  2VON A;  4BQN A;  3T8R A;  5E8I A;  5CVV A;  2E1N A;  5L3F A;  3SYT A;  3IKT A;  2CW0 F;  2PG4 A;  1MBH A;  1J7K A;  1U5T A;  2B0L A;  2KPM A;  3R0A A;  1YQA A;  4XLC A;  1WWX A;  1FYL A;  3CDH A;  3PO3 J;  4KMU X;  4BHC A;  2NS7 A;  1XGM A;  1Z0X A;  4U0W A;  3GW2 A;  4PJJ A;  1IUF A;  5E18 F;  3JAM K;  1IN6 A;  1I1G A;  1P9Q C;  4UV8 A;  3J7Y J;  2QZ8 A;  3CCR I;  3BJA A;  2JK3 A;  3OSF A;  3V7C A;  2CV1 A;  2ECC A;  3ZP5 A;  2A05 A;  3MAJ A;  2EJR A;  2Z99 A;  2VKD A;  5GTH C;  4I6Z A;  2WV1 A;  1EH6 A;  1OKR A;  1KQ8 A;  1MBF A;  1JKR C;  1IRZ A;  2FSW A;  4W97 A;  3ABK H;  5J4Y A;  1FP1 D;  3Q0V A;  4U7D A;  1FEX A;  1S5L C;  2YX4 A;  2NNN A;  1WH7 A;  2O6G E;  2EIK H;  3IH4 A;  3AL0 C;  4UUV A;  2RGV A;  1CQT A;  4A3L J;  4PGH A;  5AIQ A;  4UUS B;  2IXS A;  5KCM A;  2WAD A;  3K10 A;  2NXN B;  3I0T A;  3VYU B;  2QGU A;  2BVL A;  1SFO J;  1T2K A;  2QKM B;  1MNE A;  4HRI A;  4BJ6 C;  1YFH A;  2GLO A;  5FD5 A;  3VYS B;  4D1Q A;  4CO8 A;  4B8X A;  3M7G A;  4B48 A;  4XBF A;  1FP2 A;  2JRM A;  3O2P E;  3OYN A;  2VOD A;  3OYC A;  1H89 C;  1ZLK A;  3RYR A;  4UUS A;  3BDD A;  1P2F A;  2M0C A;  4P9F A;  3D5L A;  1LVA A;  1MZB A;  5LFA A;  2VXD A;  2O8X A;  3LQR A;  3OYB A;  2D5V A;  1WJ5 A;  1YIO A;  3DWL E;  1WKM A;  2D45 A;  2Q0O A;  4KN4 X;  5AIP A;  4GXO A;  2PLY A;  5JLW A;  3M3Y J;  1XSD A;  2BW3 A;  4NDL A;  4ZH4 F;  3JAM Z;  1MMD A;  4G6D A;  3OS2 A;  2IS2 A;  2UZK A;  4XRS G;  2P6S A;  1D1B A;  1YIJ I;  2KKO A;  2M5W A;  5F04 A;  4I01 A;  2H1L A;  2X6X A;  1FOX A;  2LRD A;  3KP3 A;  5FLM J;  2EZH A;  5KHD A;  4ESF A;  1BIA A;  2DTR A;  1SFX A;  2XAG A;  2KLO A;  4KDP A;  1AHD P;  2DAO A;  4BE1 A;  3PUF A;  1PUE E;  2QSH X;  3FK7 A;  2IVM A;  4QWQ A;  1FIP A;  3BTJ A;  3E97 A;  3J7Z I;  5EG0 A;  4RB2 C;  2VJJ A;  1R1U A;  3E6M A;  3LWF A;  4GYI A;  3BPV A;  4GCV A;  4CCO A;  3RQ4 A;  1PVE A;  5FKN A;  2XAQ A;  1IDY A;  2CUJ A;  2KZG A;  2O7O A;  4M9Z A;  2DTZ A;  1OCT C;  1OFC X;  2H6B A;  1RUN A;  2X6W A;  3GTL J;  1R7J A;  5H6Q A;  2QQ8 A;  4AIJ A;  3P7N A;  4PCQ A;  3F9K A;  4XKC A;  2W84 A;  1ULY A;  2BOL A;  2EV6 A;  2G7H A;  1B72 B;  3QYF A;  1G3W A;  2BY3 A;  2E2J J;  4U0V A;  3GLL A;  2R7W A;  3LFU A;  4AIK A;  2VBY A;  5DCM B;  3OSG A;  2FBH A;  1FBS A;  1U5T C;  1VZ0 A;  3DLL F;  4N0B A;  4FAS D;  4KIF A;  1HDP A;  3M1C A;  3DEW A;  2VJ5 A;  1XMX A;  3ZQI A;  3EET A;  4LD5 A;  2DU9 A;  5LGT A;  4KUM A;  5DUK A;  5J3L A;  4KYW A;  2MD0 A;  2E60 A;  2GOM A;  4E7S A;  3JRG A;  4C2M J;  2HQR A;  3BT9 A;  3V8L A;  3JRB A;  3C1D A;  3DTK A;  3ROU A;  1MD0 A;  1K61 A;  1B1B A;  5KK1 A;  3V7S A;  1TT0 A;  2D1H A;  2NNY A;  4HAM A;  1X2M A;  5ICC A;  2MLK A;  2JA6 J;  3ZN0 A;  5DV5 A;  3CLO A;  3CDI A;  1IN4 A;  4C3J J;  1ON2 A;  1PYV A;  1ZR4 A;  1UHS A;  3K4C A;  2OTJ I;  3GZN B;  5HLH A;  3I4N J;  1W5T A;  3CC4 I;  1WFX A;  2RKH A;  4XQF A;  1J09 A;  3HTS B;  4A2U A;  1RR8 C;  3HRU A;  3FM5 A;  2L01 A;  3CF5 F;  4P9U A;  4NC8 A;  2X51 A;  2V9V A;  2EZL A;  4NB5 A;  2M7A A;  2RC4 A;  2LK2 A;  4ZYE A;  2IA1 A;  2ZKZ A;  2LRE A;  4G7H F;  1YG2 A;  2VPL A;  2LDU A;  1MJA A;  1Y0U A;  3CLQ A;  4ESB A;  2WB1 A;  4F93 B;  4M6Y A;  4OIN F;  2XGX A;  2COM A;  1U8R A;  4IHW A;  4KMF A;  5FRN A;  2KMU A;  4PGG A;  1ZKG A;  4XOP A;  3GTK J;  3DXJ F;  2FBK A;  1LB2 A;  3S1M J;  2X1C A;  2MC3 A;  3O8H A;  5EZH A;  5L3E A;  5E1Z B;  3QAH A;  2L54 A;  5ICF A;  4HNU A;  2VLA A;  2H8W A;  5L3D A;  1XGO A;  3KLN A;  2UWM A;  2X85 A;  3I53 A;  4P96 A;  2JMW A;  3ISP A;  3BZ6 A;  3CCY A;  3H3Z A;  3L09 A;  3EUA A;  2BYV E;  3DLA A;  2GM4 A;  3HC7 A;  4IXA A;  1BR1 A;  2CSO A;  2O0Y A;  3QP5 A;  1WJF A;  2E71 A;  2GQQ A;  3QWL A;  3DV8 A;  1EH8 A;  4KT5 C;  5FFZ A;  4CIC A;  3AAF A;  1YX5 A;  2VBX A;  3WE3 A;  1A5J A;  4RS8 A;  2K4B A;  1GXQ A;  1B59 A;  4KIT B;  2MYS A;  1SD7 A;  4ZC3 A;  3V4G A;  4ZYD A;  4LFU A;  1VQ8 I;  3B02 A;  5K5R A;  4XSX F;  3B73 A;  2BHY A;  1IRG A;  1E3O C;  5BS6 A;  5FD6 A;  2DOE A;  4HNT A;  4Y52 J;  3JRF A;  2JTV A;  1S8N A;  3ABU A;  2IEK A;  3NAR A;  2DQR A;  2HDC A;  2L4M A;  2CV2 A;  3EUK L;  4F3Q A;  1I27 A;  2ZME B;  2AQF A;  4BS9 A;  4QPO A;  1RKW A;  1QZY A;  2CS3 A;  4OMY A;  2DFE A;  3KLO A;  4HV6 A;  2HPI A;  1SAN A;  2CRG A;  2P8T A;  3FHN A;  2OAZ A;  3E7L A;  2R3S A;  3CCJ I;  4GFB A;  4IHX A;  5E17 F;  2LVS A;  3U1D A;  5FJ8 J;  3GTP J;  4A3E J;  5K1Y A;  2OUM A;  2TCT A;  1I3A A;  2PJR B;  5FKK A;  2YU9 J;  1A6Q A;  2O5R A;  3T0Y A;  1X4P A;  3LMM A;  5J47 A;  2FX0 A;  4C9Y A;  3ONQ A;  4TV7 A;  4MFE A;  3FXU A;  5E8G A;  1MJB A;  2HS5 A;  4CCM A;  2E5Z A;  1NK3 P;  4M74 A;  3DPU A;  3WU1 B;  3M8E A;  2P7C B;  3CQZ J;  3S1Q J;  2LKP A;  2O8K A;  2DA3 A;  4AYB A;  4RAY A;  3IL2 A;  4V2G A;  4HYE A;  1QNT A;  2ID3 A;  4HG2 A;  2O61 A;  5HNH A;  3NWT A;  1F4K A;  1YLF A;  5IYB J;  2PJR A;  3WTY C;  3PFY A;  3OS1 A;  2EB7 A;  1J5Y A;  2R7Q A;  4YII A;  4BBR J;  1JJ6 C;  5GP9 A;  5JR3 A;  2RRE A;  5C4X J;  4OWR B;  3JR9 A;  2M8G X;  2FJ1 A;  1BC7 C;  4UXN A;  1T0F A;  2M7B A;  4NC6 A;  1WGX A;  1I3Q J;  1OCP A;  4BYY A;  4R1H A;  2AS5 F;  2OD5 A;  2HU9 A;  2R5Y B;  4IVN A;  2HR3 A;  3HEF A;  2QQA A;  1T95 A;  3GFJ A;  2E2I J;  5ED4 A;  1YRN B;  5DS9 A;  3ZMS A;  3ZQF A;  4J19 A;  3I56 I;  1FNN A;  1DQU A;  3LL7 A;  2E1M C;  5FLV A;  2LFB A;  3I54 A;  1Z3Y A;  1O7F A;  3DBH B;  3EUH A;  4S05 A;  2DT6 A;  4ETS A;  4CZC A;  1HCR A;  4NHJ A;  4F92 B;  4BE0 A;  1H8A C;  2EFQ A;  5HS7 A;  2R5Y A;  3DFG A;  2FEZ A;  4E7K A;  1TZL A;  3M9A A;  2UV1 A;  4UVB A;  4Y33 A;  4BQQ A;  4IO9 F;  1H9G A;  5KVR A;  4DJA A;  4PJ0 C;  1YO5 C;  3CMM A;  4RB3 C;  3HIF A;  3WTT C;  1G6N A;  3FXL A;  5A2Q K;  2R0Q C;  3FXM A;  4UUT A;  4NBQ A;  5K7H A;  2OZ6 A;  3BG9 A;  3K9T A;  2DN0 A;  1LEB A;  1XSX A;  1O3R A;  5TJJ A;  2NOG A;  4YFX F;  1UHW A;  3DP7 A;  2K86 A;  3RIR A;  2CMP A;  3MKZ A;  4AD9 A;  1ONV A;  1HBX G;  1X19 A;  2QEN A;  2W4S A;  2ZXI A;  4OU0 A;  4V2F A;  3ZQG A;  1JKP C;  4I09 A;  1WJB A;  3DCF A;  2QKL B;  4XSZ F;  3K70 D;  3G4S I;  4BQO A;  3SEQ A;  1T33 A;  1TT5 B;  5IT9 K;  2G7U A;  1MBG A;  2HXO A;  2CWE A;  4CSW A;  1XMA A;  4ESJ A;  2XKP A;  3CJN A;  3OL4 A;  1T56 A;  2HVQ A;  1U9O A;  1HOM A;  4YEJ A;  2CQN A;  1M1E B;  2F4I A;  3ZXS A;  5TRD A;  1U9N A;  1S6L A;  3QOD A;  4B43 A;  2JVG A;  3HG9 A;  2V26 A;  4MHG A;  5IOZ A;  2YUS A;  4MTE A;  4B4C A;  1T08 B;  2HZD A;  5LGU A;  4F91 B;  5C3E J;  1HW1 A;  3OIQ A;  2OJE D;  2HYG D;  3A0H C;  3PNT A;  2K27 A;  2XC7 A;  4A3D J;  3ZGK A;  3GWZ A;  1TNT A;  2BHZ A;  1LFP A;  1IAW A;  1X4O A;  2Z33 A;  2YSR A;  2DMP A;  3JSO A;  4XON A;  3JTG A;  1S72 I;  3TED A;  2CO5 A;  4UV9 A;  1DGW Y;  3JCU C;  3OYI A;  2XGE A;  4NC7 A;  3MD2 A;  3WOD F;  3O6B B;  2HTS A;  4Y13 A;  4I02 A;  3OYE A;  2W7N A;  2HOT A;  2DFH A;  4DBQ A;  4G7Z F;  2ZFW A;  3RKX A;  5JLX A;  2WTE A;  1N78 A;  5LLQ A;  1HLV A;  5LEK A;  5B5E C;  1W1W E;  5A2Q Z;  2XAF A;  4JP0 A;  2PQ8 A;  1KU7 A;  3WHC A;  3N05 A;  2LMD A;  2FMY A;  4D7N A;  1ZQ3 P;  1ZR2 A;  5KAF C;  3GTO J;  1S7E A;  2XF5 A;  3ULQ B;  2LR8 A;  1Z21 A;  3F21 A;  3HBL A;  1O3S A;  3TMO A;  3LSP A;  4C2T A;  3CC2 I;  3AL0 B;  3SJM A;  1HQC A;  2Z16 A;  2Y9Y A;  2BZT A;  4FET A;  2IGN A;  2ZXJ A;  2X1E A;  4FT8 A;  3K1N A;  5ILS A;  5F0C A;  1YJN I;  2MH2 A;  2X6Y A;  5CQG A;  1EA3 A;  2LOO A;  3B6A A;  1W7P A;  3GCM A;  5CYV A;  2W00 A;  2DMT A;  1T0F C;  4IX7 A;  3T1B A;  5IT9 Z;  4DIQ A;  2ZCW A;  4DZJ A;  3HYI A;  3FMR A;  1BJZ A;  4XK4 A;  4C3H J;  3PFI A;  4X6A J;  1UG2 A;  3KP2 A;  1VI0 A;  2CUZ A;  4A5N A;  2WAE A;  3H5R A;  2XPV A;  2DOF A;  2JSC A;  1TQM A;  3MQ0 A;  2PMZ A;  3ZQQ A;  1KZH A;  5DTD A;  5J1R A;  2EWN A;  3H9G A;  4BE2 A;  4ZJZ A;  5LRS A;  4IQ4 A;  4JQF A;  4IF4 A;  5J4V A;  1ZK8 A;  1ETV A;  3FHZ A;  4E7H A;  2PFB A;  4WCG A;  2LKX A;  4AIH A;  1SEU A;  1MH4 A;  3SZG A;  4RAF A;  4NUB A;  2Z3Y A;  2DPU A;  2CFX A;  2MSY A;  2DW4 A;  2L7F P;  1WVR A;  1LDK B;  3JRD A;  1QZZ A;  1S29 A;  2L7K A;  4XM3 A;  2ZJR F;  2MAB A;  2ZJ2 A;  1KYW A;  1YX3 A;  4RB1 A;  2JA8 J;  1O3T A;  4CGZ A;  3QYE A;  5IYC J;  2HI3 A;  4LMY A;  1PP7 U;  1VF9 A;  1MBE A;  1TL8 A;  4MEY F;  4M3F A;  3CCM I;  2VE9 A;  3Q0W A;  1GV2 A;  2DOD A;  5DCF A;  3EYI A;  3CZ6 A;  4F7Z A;  2HZT A;  2VIX A;  1P4X A;  1BJA A;  3A03 A;  2E2H J;  1REP C;  4JBA A;  2OA4 A;  2EPF A;  1F5T A;  2O3F A;  2AQE A;  2DT7 B;  1OMI A;  1TQI A;  2R7V A;  3AFH A;  1RRJ A;  2ZBK A;  3DU5 A;  1XCB A;  3CP8 A;  4XLF A;  1W0T A;  5IT3 A;  5D6F A;  1QPI A;  1WHU A;  2A68 F;  2Q2E B;  2VBZ A;  5F27 A;  2NVQ J;  1JGS A;  5F1J A;  1IZ1 A;  3S8P A;  2TRT A;  5CVU A;  2R7D A;  1NH3 A;  3S2D J;  4UHT A;  1D5V A;  4AM3 A;  2RQQ A;  2XIG A;  4D7M A;  3KP7 A;  2ME0 A;  4XR6 A;  4LIU A;  3BR0 A;  4PK4 A;  1DU0 A;  3CD6 I;  1NG7 A;  3OWT A;  3U21 A;  1YS7 A;  3JW4 A;  3H35 A;  3LSJ A;  3K69 A;  3HHH A;  3CCV I;  5D5X B;  3RJP A;  3BG5 A;  2EK5 A;  2Q2E A;  1FZP B;  2N8G A;  3FIW A;  3LSH A;  4D5C A;  2BY1 A;  4CYC A;  4BXX J;  3C18 A;  2QQB A;  3GEZ A;  5GPA A;  5E1W A;  4E4H A;  1GT0 C;  4HOB A;  2QSG X;  3D5R C;  2F6C A;  3F6O A;  1GXP A;  4L5I A;  2H8R A;  3KEY A;  1E3H A;  3VSK A;  3A1Y A;  1MNM C;  2K9Q A;  2BY2 A;  3EYY A;  4GO1 A;  5FKM A;  4DOZ A;  4LLL A;  2EIL H;  3PQJ A;  1YS6 A;  4PSX A;  2IS4 A;  2JZY A;  1ETY A;  2HYJ A;  2V4J C;  2M45 A;  3KEQ A;  4YIR X;  3OOP A;  2QLZ A;  5EJC A;  3MKY B;  4ZTF A;  1W36 C;  2DA1 A;  4M3E A;  1V3F A;  4ZZD A;  4IOA F;  1FT9 A;  2STW A;  2CGP A;  1SD6 A;  3Q0U A;  4MQ9 F;  3WG9 A;  4Y3O A;  3F8M A;  5L3C A;  5EGO B;  3NRV A;  3CMY A;  4YRV A;  1YJW I;  1G3S A;  2OU2 A;  3G2B A;  5LGN A;  2V1X A;  2CW7 A;  2LKS A;  3QOP A;  1FC3 A;  1FSH A;  2IA2 A;  3KZI C;  1O57 A;  1ZG3 A;  2ZXW H;  5JVG F;  1FTT A;  2OC6 A;  1V54 H;  2EIN H;  1S7O A;  2IW5 A;  1AKH B;  2GZW A;  3MMY B;  4YEL A;  3WGG A;  5GAE J;  1KYZ A;  1TW3 A;  2FRH A;  1A04 A;  1MGT A;  1I1S A;  3QPT A;  2AXL A;  5E3O A;  2ZC2 A;  4HLY A;  5EGO A;  4HX4 A;  1BR2 A;  2EV5 A;  4XKV A;  1K7A A;  5GAH J;  1ORK A;  2EA4 A;  3K1P A;  1YHQ I;  2V7F A;  3KYL A;  3COA C;  5M5Y J;  3L2V A;  2HDW A;  3L2C A;  6PAX A;  4BU2 A;  1DP3 A;  1R22 A;  1V5G A;  3HUG A;  3LAJ A;  1AKH A;  4HNV A;  2XF6 A;  1R4M B;  3H9Q A;  1Y1V J;  2BW3 B;  5JFR A;  1L0O C;  3KYC B;  5C44 J;  5HS9 A;  1DP7 P;  3I59 B;  3UKG A;  1VQ6 I;  3I9V 2;  3WE2 A;  1F36 A;  4LG0 B;  4DQ2 A;  1J9I A;  2FUG 2;  3E5Q A;  4S0H B;  1RET A;  2IT0 A;  3CMA I;  5HDK A;  2O9L A;  3FIS A;  3H9J A;  2HQA A;  3LSK A;  3WU2 C;  1BL0 A;  2IAI A;  2A5W A;  2VBW A;  2A6E F;  5FKL A;  4OIQ F;  1D1C A;  1UJ8 A;  1X1B A;  4ENJ A;  2DJI A;  1U0J A;  2OTL I;  3I59 A;  4ON0 A;  3JRE A;  5HDG A;  4EJW A;  4LG0 A;  5E1X A;  2FNP A;  3QPS A;  1QU3 A;  4BGD A;  5EG0 B;  2E1O A;  4BH9 A;  4CCK A;  1XGS A;  5DUI A;  3X2Q H;  3K4B A;  4ITV A;  3O3K A;  3S14 J;  2Q8K A;  1TLH B;  4IRI A;  1XSV A;  3T8T A;  4EM2 A;  3E5U A;  1X1P A;  5B3S H;  2JT1 A;  3H0D A;  5D5U B;  4N4N B;  2EFN A;  2EQR A;  3FXO A;  3A01 A;  2DBB A;  2CFO A;  4RM3 A;  1KQ0 A;  4II2 A;  1YI2 I;  1MSF C;  4RLF A;  5H6R A;  3HM5 A;  1BI2 A;  2NS0 A;  2EIM H;  2ESH A;  5HOO A;  4Q4Z F;  5CVI A;  1RR7 A;  3MZY A;  2MFZ A;  5E79 C;  1AOY A;  4XN3 A;  3GTG J;  1XX5 A;  4WWC A;  1K4S A;  3V8K A;  5E3M A;  4BDY A;  3QQA A;  3IHU A;  4ZYH A;  2QQ9 A;  3AG3 H;  1L3L A;  4X1E A;  2EIJ H;  3QPH A;  1Z9C A;  4RBO A;  2PMZ N;  1TC3 C;  3GZ6 A;  2RNG A;  3VOD A;  5D8L B;  4N4O B;  2F5C A;  3OS0 A;  2KFD A;  3HHG A;  1SC7 A;  3CDL A;  4BAC A;  3LST A;  1O3Q A;  4I0A A;  2WY7 Q;  3SDG A;  2BBY A;  4XRM A;  4DGW B;  2X0L A;  2Q1Z B;  4AVZ A;  1BI1 A;  4L5E A;  2VJ4 A;  3WU0 A;  2KIS A;  5M5W J;  3R6S A;  3SQN A;  2ZJQ F;  1ZLJ A;  2LBF B;  2CQX A;  3ZMV A;  1JUS A;  5ICG A;  3AG2 H;  1OCC H;  2M1B A;  3BY6 A;  3K6G A;  1BIB A;  1HKT A;  2VQC A;  4HDU A;  1ACI A;  2VN2 A;  1Z6T A;  3E6C C;  1QHH D;  2AXT C;  3CTA A;  3LA7 A;  2E1M B;  4Z6Y A;  3BJO A;  5EDN A;  2CV0 A;  1XPX A;  3HJE A;  1GDT A;  3U9G A;  1D1A A;  3TO6 A;  5FRO A;  4I98 B;  3WGH A;  2FQ4 A;  3B6C A;  3G73 A;  2WA0 A;  3K2A A;  2KRC A;  4B3X A;  4CXF A;  5ERI A;  2LBF A;  3CO6 C;  5FLX K;  1IV8 A;  4R79 A;  4FX4 A;  1I6H J;  1XB4 A;  5K5Q A;  1R58 A;  4I2O A;  1LNW A;  3N4M A;  4HQM A;  1RKT A;  1HST A;  2DYR H;  4A3I J;  3PIO F;  1UZC A;  3BCB A;  3RPU D;  2HKX A;  4O5V A;  2IJL A;  3REO A;  4MQV A;  1QVU A;  1ZGW A;  5M3F J;  3LA3 A;  2B7E A;  4J00 A;  4A0X A;  3M1E A;  2PMH A;  4FTH A;  2CW8 A;  3NEU A;  1LVK A;  3RKQ A;  2LH9 A;  2DMQ A;  3F8N A;  3HSR A;  4EGY A;  2V6E A;  2HNH A;  4PJM A;  3L9F A;  4BXU A;  1Z05 A;  2FA5 A;  2P6T A;  1WI9 A;  3EPZ A;  4M3D A;  2EFP A;  3DPT A;  1VQ9 I;  4JOM A;  1BW5 A;  4Q47 A;  3F72 A;  4EAT A;  1WJA A;  5LD2 C;  2M30 A;  3PNV A;  2M87 A;  3BR5 A;  1C0W A;  2HFH A;  3RZO J;  1WQ2 A;  1IC8 A;  4E7Z A;  3DKX A;  4G8X A;  4LOC A;  3U2R A;  2DA4 A;  1ITY A;  3E1S A;  2P0W A;  3JRH A;  3IKV A;  1NHA A;  4XOR A;  4A5M A;  1TWC J;  3A02 A;  3ABM H;  2WV0 A;  4A93 J;  5GPC A;  3BTI A;  4P55 A;  4XOT A;  4MO7 A;  4XIC A;  4A6E A;  1Z77 A;  2XB5 A;  2AHQ A;  1DUX C;  1H88 C;  1NK2 P;  3HDD A;  1RUO A;  4I99 C;  1X2N A;  2RQP A;  3WHB A;  1VQO I;  4JX5 A;  1LFU P;  1D3Y A;  1IN7 A;  1ZYR F;  2L9R A;  4EM1 A;  3S93 A;  2QYO A;  2QWW A;  2I5U A;  2DI3 A;  2ZSH B;  5HS8 A;  1UAA A;  3GBG A;  1JTX A;  1Z7L A;  2DXI A;  3HOY J;  2HXI A;  5FLX Z;  4OIO F;  5M5X J;  1IUY A;  1XN7 A;  2VUM J;  4EEF G;  1ZGJ A;  2YU3 A;  3OYD A;  1JXS A;  1FOW A;  4ENN A;  2H6C A;  2JUC A;  1E0E A;  1JTY A;  2LY1 A;  1JE8 A;  3ZOB A;  2W1O A;  1YOV B;  2M2E A;  3JRI A;  1WPK A;  3HL2 A;  2CH0 A;  2D1V A;  2FXA A;  2VT2 A;  1MDM A;  2EFW A;  1HKQ A;  2I8D A;  5D8K B;  1HDD C;  1X3W B;  3PUB A;  4E6K G;  1YIT I;  4RB0 A;  2E34 A;  1X1A A;  1ZAR A;  4HQE A;  1BW6 A;  3L2R A;  1SMT A;  2OBP A;  2W57 A;  1ETW A;  2Y75 A;  2R5Z A;  2LP0 A;  3KE2 A;  4RLQ A;  2BY0 A;  3FKI J;  2XAS A;  5F64 A;  1Y1W J;  2B9S A;  4IHS A;  4M6X A;  1MIJ A;  3D5S C;  5LRR A;  2LC2 A;  5DM6 F;  3HRT A;  4GGG A;  3IWZ A;  4DZP A;  4ZTJ A;  1TQP A;  3C3W A;  4FQG A;  4MNU A;  3W2W A;  3GTM J;  1YW7 A;  2DJN A;  2VL8 A;  1X1D A;  4V19 K;  3BR6 A;  2VQG A;  1T38 A;  2MA3 A;  2KJC A;  3PSI A;  4MIM A;  5EEA A;  3OIP A;  2XV4 S;  1VQL I;  3SZP A;  3F8C A;  1R71 A;  3RPQ A;  1KA8 A;  2AO9 A;  2R7F A;  3S3O A;  5K7Z A;  3W6V A;  1VQP I;  3A2K A;  1ZTR A;  2DO7 A;  5DDG A;  1TW2 A;  4XRF A;  4IL6 C;  4CHU A;  4EGZ A;  3L2W A;  4BHP A;  2PX9 A;  3ZR8 X;  4P1W A;  3P9C A;  1NTC A;  3ZQL A;  3HKZ N;  2V1N A;  2VKH A;  1IXR C;  4L9J A;  3OYK A;  2R92 J;  2L2O A;  1IF1 A;  1SMY F;  3HZJ A;  3TP3 A;  2A69 F;  2DLL A;  4UVA A;  2F5F A;  5IOY A;  3IAM 2;  1R00 A;  2PI0 A;  2LF8 A;  3BR1 A;  4F52 A;  1SD5 A;  1EF4 A;  3KYD B;  4S04 A;  2CU7 A;  2HQ5 A;  1FOY A;  1LEA A;  3G3Z A;  3SFI A;  3R61 A;  1P7I A;  4JYK A;  1R36 A;  2LNB A;  4XLN F;  1IN8 A;  3J81 K;  1JUP A;  3FF5 A;  5ICE A;  2OQG A;  4CDG A;  4BQA A;  2GXB A;  1G3T A;  1UCR A;  3AG1 H;  2L3D A;  4IHY A;  2EZI A;  1Z6R A;  3G1L A;  1HC8 A;  2V1D A;  2C6Y A;  4BEH A; 
#chains in the Genus database with same CATH homology
 2L7K A;  2MAB A;  1YX3 A;  3S3M A;  3OYN A;  3OYC A;  3QYE A;  3W2V A;  2LG4 A;  3DKY A;  3D5L A;  5LFA A;  1G8X A;  3CZ6 A;  2VXD A;  2VIX A;  3OYB A;  1WJ5 A;  3DWL E;  2E5N A;  3HOT A;  3PJR A;  2JUG A;  1V5E A;  2BW3 A;  2AQE A;  2DT7 B;  4II3 A;  3L2U A;  3OS2 A;  1MMD A;  3AFH A;  3LSG A;  2R7V A;  3DU5 A;  2NOJ B;  2VB6 A;  4X0G A;  2IS2 A;  4H4K C;  3CP8 A;  4ZDO A;  1D1B A;  4XLF A;  3OYF A;  5HLT A;  5JHF A;  4MLO A;  2X6X A;  2R7X A;  2LY2 A;  2LRD A;  2Q2E B;  3HPG A;  2V9K A;  5KHD A;  3W3C A;  3BC8 A;  3S8P A;  2KLO A;  2RQQ A;  4BE1 A;  4HST A;  4PJL A;  1W36 D;  3KX2 A;  4XKB A;  2KP6 A;  4XR6 A;  4LIU A;  4PK4 A;  1NG7 A;  3OWT A;  3S3N A;  2VJJ A;  3U21 A;  3H35 A;  3RTR A;  1OLT A;  4CCO A;  3RQ4 A;  1X1C A;  2CUJ A;  4PSW A;  4E7J A;  4KIS A;  1Y6I A;  2X6W A;  4KT6 A;  3LSH A;  2XF7 A;  4E4H A;  1D0Y A;  3F9K A;  2VQL A;  4XKC A;  3D5R C;  2M4G A;  2BOL A;  2F6C A;  4QPQ A;  3QYF A;  2A6T A;  4C30 A;  1JI8 A;  2R4G A;  3M8J A;  3KEY A;  2R7W A;  3VSK A;  3A1Y A;  3LFU A;  3OMY A;  4DOZ A;  4PSX A;  2IS4 A;  1VZ0 A;  1UG0 A;  4FAS D;  2V4J C;  2HVS A;  4CCN A;  3M1C A;  2VJ5 A;  3MKY B;  4ZTF A;  3VYR B;  2Z1D A;  3IP4 B;  1W36 C;  2KHM A;  2MD0 A;  2E60 A;  4Y3O A;  2GOM A;  4E7S A;  3DTI A;  4YRV A;  1WJC A;  3G2B A;  2CW7 A;  3DTK A;  1TT0 A;  2ZSI B;  3OY9 A;  2OC6 A;  2WBM A;  4YEL A;  3MMY B;  3OYG A;  4E7L A;  4HEA 2;  3OYM A;  2IS6 A;  4BEH B;  1PYV A;  3BLY A;  1MMN A;  3AKZ A;  3K4C A;  3TBI A;  4XMY A;  2K9M A;  1BR2 A;  3S32 A;  2M3A A;  1WFX A;  4XQF A;  1J09 A;  2M0M A;  4XKV A;  4PJN A;  4CA0 A;  4HSR A;  2V7F A;  4NC8 A;  3KYL A;  4ZDL A;  2KRH A;  2X51 A;  4CCJ A;  3OYL A;  3L2V A;  2HDW A;  2M7A A;  4BU2 A;  1DP3 A;  2BVM A;  3V42 A;  1V5G A;  3SDB A;  2R7U A;  2LRE A;  3VSL A;  2XF6 A;  3H9Q A;  2IS1 A;  2BW3 B;  2L5Q A;  3DTE A;  5HVQ C;  2VPL A;  3I9V 2;  4F93 B;  2WB1 A;  3HXL A;  4KJZ A;  2FUG 2;  4LIV A;  1PJR A;  2GOX B;  1GLN A;  5FRN A;  3VDX A;  2KMU A;  4XOP A;  4XM3 A;  4BL0 B;  3LSM A;  1Y56 A;  3H9J A;  3LSK A;  2HQA A;  4IZZ A;  5HNF A;  2DOA A;  2X1C A;  4B44 A;  2A5W A;  2R7S A;  2M4K A;  1D1C A;  4HNU A;  1OR7 C;  1X1B A;  2DJI A;  4RMN A;  4CUG A;  1U0J A;  2VLA A;  2UWM A;  1UEL B;  4AU7 A;  2X85 A;  1MMG A;  1N75 A;  3C2H A;  3OOU A;  1FMV A;  1QU3 A;  3IAS 2;  4BGD A;  4CCK A;  4E7I A;  3C2G A;  3ZCO A;  3EUA A;  4DBR A;  2DCE A;  3K4B A;  3DLA A;  4ITV A;  4BDZ A;  3HC7 A;  1BR1 A;  3MKW B;  4ANJ A;  3FBI B;  1WJF A;  4PFP A;  3H0D A;  1YX5 A;  4N4N B;  1R6R A;  2F5V A;  2KZV A;  3CJR B;  1YE9 A;  4KIT B;  4GRI A;  2MYS A;  3DPL C;  4XLA A;  4ZC3 A;  1NG6 A;  2CFO A;  4NQW B;  3K4N A;  4RM3 A;  4II2 A;  4RLF A;  4HNT A;  3BG7 A;  5HOO A;  1V5F A;  4D9J A;  2MFZ A;  4XN3 A;  3CES A;  4IKF A;  4BDY A;  2CV2 A;  3EUK L;  4F3Q A;  4BS9 A;  2AQF A;  4QPO A;  3FKJ A;  2CS3 A;  4IQJ A;  2RNG A;  3OYH A;  2HPI A;  4N4O B;  4U87 A;  3FHN A;  3OS0 A;  2JA2 A;  4BAC A;  3BCA A;  2WY7 Q;  1BR4 A;  1K6Y A;  2OUM A;  2PJR B;  4DGW B;  2O5R A;  2Q1Z B;  1X4P A;  2W82 A;  4AVZ A;  3LMM A;  3RCO A;  2WAQ A;  2K9L A;  3ONQ A;  4C9Y A;  2VJ4 A;  2JSP A;  4OAY A;  3PNY A;  4CCM A;  2E5Z A;  2UUZ A;  4PFO A;  2LBF B;  3H5N A;  3H5A A;  1QHG A;  3DPU A;  2XDV A;  4AYB A;  3K6G A;  4RM2 A;  2VQC A;  3IUO A;  4HG2 A;  1QHH D;  5HNH A;  3W2A A;  3NWT A;  2E1M B;  2CV0 A;  2PJR A;  2IGM A;  3PFY A;  3OS1 A;  3HUG B;  2R7Q A;  1D1A A;  5FRO A;  2RRE A;  1N77 A;  4OWR B;  4XNF A;  3BG6 A;  1IRX A;  2VXZ A;  2WA0 A;  2M7B A;  2KRC A;  4B3X A;  2LBF A;  4R79 A;  1SAU A;  4U7B A;  2HU9 A;  3HOS A;  4J01 A;  2R7R A;  3VYT B;  1T95 A;  3TL4 X;  4BEH A;  3BCB A;  3RPU D;  3NWS A;  4P5O A;  3K4K A;  3ZRG A;  1DGR M;  1WJD A;  1DQU A;  3LL7 A;  4J00 A;  2E1M C;  2XSJ C;  1Z3Y A;  3CJQ B;  2CW8 A;  2DT6 A;  4CZC A;  2ELJ A;  4F92 B;  4BE0 A;  1LVK A;  3FDY A;  2LH9 A;  2JVH A;  2IGK A;  2V6E A;  2HNH A;  2VJI A;  4PJM A;  3SEZ A;  1MMA A;  1SFK A;  1MW7 A;  2R7O A;  2K3P A;  3CP2 A;  1TZL A;  3EUH C;  4E7K A;  2XAU A;  3EPZ A;  1D0X A;  2UV1 A;  4BQQ A;  4Y33 A;  3DPT A;  4JOM A;  4DJA A;  3HPH A;  3OR2 C;  3CMM A;  1G59 A;  1LKX A;  4EAT A;  1WJA A;  2MC4 A;  5LD2 C;  3PNV A;  2LYC A;  2L9N A;  4E7Z A;  3DKX A;  5CQE A;  3E1S A;  2P0W A;  3HKZ A;  4XOR A;  2HVR A;  3MKZ A;  2CMP A;  4XLE A;  1X19 A;  3DQV C;  2W4S A;  2HPM A;  4XOT A;  2ZXI A;  1HA8 A;  1WJB A;  1AA7 A;  2QKL B;  3K70 D;  4BQO A;  5FRM A;  3SEQ A;  3DU6 A;  4BJT A;  3UNG C;  1MND A;  3LSI A;  3OL3 A;  1ZEL A;  2Y0S A;  3S93 A;  4HPQ A;  2WY8 Q;  4XLH A;  4CSW A;  3OL4 A;  4LG3 A;  2HVQ A;  2ZSH B;  1S9H A;  4YEJ A;  3K4L A;  2F4I A;  3OYA A;  1UAA A;  3GBG A;  3ZXS A;  1Z7L A;  2DXI A;  3DEE A;  3I3L A;  3QOD A;  4B43 A;  4C2U A;  1WJE A;  1D0Z A;  2JVG A;  3HG9 A;  2V26 A;  3E0J B;  3FBN B;  4ZDP A;  4G6T B;  3OYD A;  2R7T A;  2X1D A;  1E0E A;  2HZD A;  2LY1 A;  4F91 B;  2W1O A;  3OIQ A;  1KON A;  4XN0 A;  1Z3X A;  5CKT A;  3HL2 A;  2CH0 A;  3PNT A;  2XC7 A;  2IGO A;  2I8D A;  2Z2S B;  4LIT A;  3K4J A;  3ZGK A;  3QOE A;  2VQH A;  3PUB A;  4E6K G;  2ZFU A;  1LFP A;  4XL9 A;  1X1A A;  1X4O A;  3L2R A;  4XON A;  3VWB A;  4RLQ A;  1DGW Y;  3OYI A;  3K70 C;  4Y4R A;  2WAF A;  4NC7 A;  3MD2 A;  2W7N A;  3OYE A;  3K4M A;  3RSN A;  5CPR B;  4OAZ A;  4BQN A;  4DBQ A;  3D5S C;  1BOB A;  2LC2 A;  4PUS A;  3SYT A;  1N78 A;  2KPM A;  4ZTJ A;  4XLC A;  3N05 A;  3W2W A;  2VL8 A;  1X1D A;  2XF5 A;  2VQG A;  4PJJ A;  3PSI A;  3L2Q A;  3OIP A;  1Z21 A;  4BXF A;  3TMO A;  4B47 A;  4C2T A;  1P9Q C;  3AL0 B;  2Z16 A;  4FET A;  3S3O A;  2ZXH A;  2IGN A;  1ERD A;  4ZYA A;  2X1E A;  3A2K A;  2L9S A;  3UR3 C;  4BUP A;  2X6Y A;  2CV1 A;  2VAS A;  5CQG A;  1EA3 A;  2LOO A;  3L2W A;  2W00 A;  1T0F C;  4P1W A;  3ZR8 X;  4IX7 A;  3PSF A;  3A4C A;  4DIQ A;  2V1N A;  2VKD A;  2VKH A;  1FMW A;  3PL8 A;  2KL4 A;  3OYK A;  4CH7 A;  2L2O A;  5TGT A;  2CUZ A;  2WAE A;  3H5R A;  4NNJ A;  2PMZ A;  3ZQQ A;  4BJ5 C;  3IAM 2;  3H9G A;  2KDO A;  4F55 A;  5KNL A;  4F52 A;  4BE2 A;  3AL0 C;  2KQR A;  3CF2 A;  3QYB A;  4ZJZ A;  4IQ4 A;  4JQF A;  2IXS A;  5KCM A;  4CCL A;  3J7A Y;  4E7H A;  2OV7 A;  2WAD A;  3K10 A;  3VYU B;  2BVL A;  3OYJ A;  2K5C A;  2QKM B;  3SZG A;  1MNE A;  4HRI A;  4NUB A;  4BJ6 C;  3VYS B;  4XKW A;  4D1Q A;  4B48 A;  1LDK B;  3OR1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...