2XF6A

Crystal structure of bacillus subtilis spp1 phage gp23.1, a putative chaperone.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
50
structure length
50
Chain Sequence
b'SESLLYGYFLDSWLDGTASEELLRVAVNAGDLTQEEADKIMSYPWGAWND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GP23.1
publication title Crystal Structure of Bacillus Subtilis Spp1 Phage Gp23.1, A Putative Chaperone.
pubmed doi rcsb
source organism Bacillus phage spp1
molecule tags Viral protein
total genus 17
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2010-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2xf6A00
2XF5A 2XF6A 2XF7A
chains in the Genus database with same CATH superfamily
3ELKA 4NB5A 3KP2A 1H89C 1PUFB 3A03A 1TBXA 1J2XA 1A6QA 3HRSA 1WPKA 2EFNA 4UY8I 4LOCA 2DI3A 1QPIA 3BZCA 2BE5F 4QLCU 2HI3A 3BZ6A 4BYYA 2Y69H 3ASOH 4L9NA 3CCVI 1FBSA 2YU3A 3D5LA 4GDFA 4MFEA 3LQRA 3OY9A 1I39A 2JRMA 1MKMA 4U7BA 3LFKA 3CJRB 2DN0A 1XD7A 2K40A 1T2KA 2JJ7A 1R22A 1NG6A 4X6AJ 2HNHA 4EQQA 4IL6C 1LFPA 2L7KA 4AIKA 3I53A 2W25A 1R71A 4D7NA 1QPMA 3UR3C 2IXSA 4KIGA 2H27A 2M0CA 5CVUA 1WJEA 2DA3A 5CQGA 1ZYRF 2LY2A 3EYIA 2WTEA 3PNYA 5KNLA 4EV0A 2ID3A 4ENMA 2JTVA 2HYFA 4L9TA 1WQ2A 1IN5A 3KPHA 3O6BB 5FROA 1B59A 1LFBA 5AONA 2L02A 1R4NB 3FHZA 2ZSHB 3FWEA 3RZOJ 2COBA 2VJIA 1X1AA 2ZNZA 1XGNA 2P6TA 2K7LA 3OV8A 3W2AA 1DP7P 2X85A 3PO2J 1T98A 3FDYA 1ZGJA 3S32A 3C1DA 5HDNA 4BDYA 1WHUA 4HF1A 1ZKGA 1RI7A 1DU6A 1YYVA 3L2CA 3KCCA 2D2WA 1ODDA 5F0FA 3ZQFA 3H1CA 3J81K 2XPUA 4RGRA 3GZ6A 4O5VA 1QA6A 3OYDA 1UZCA 2NVXJ 2YX4A 2F5EA 2EV6A 3LA7A 4QWQA 4G7HF 4BAYA 1F9NA 1FOWA 1KU9A 3PQJA 2L3DA 2MABA 2R7ZJ 1HF0A 1SFKA 4Q5SF 2JUGA 1JJ6C 1Y0NA 2FA5A 2P5KA 4B3AA 4BGDA 2M87A 3S3MA 3W3CA 4OU0A 1WVRA 4RAGA 2R7OA 1R36A 4MLOA 3MKZA 2VB6A 5FRNA 4BHCA 2V26A 3TO6A 2MA3A 1FSHA 1E0EA 4CDGA 2L7ZA 4Y13A 5FD5A 3CJTB 2PMUA 3ZGKA 3GYHX 3QPTA 3R60A 2K9LA 4WXDA 2KIFA 3WG7H 1U2WA 2WBMA 3ZMUA 1TWCJ 4PJNA 5E18F 3SZGA 4CUGA 1W7PB 4AWXB 2LYCA 4KA4A 2HQNA 1XTAA 2L4MA 2QM3A 1O57A 3SZPA 4YRVA 4AIHA 2M0MA 1SD4A 4AUXA 2CV2A 1JT6A 2OJED 1WJFA 3IH2A 3B6AA 4L9VA 4DBRA 1FLIA 1RETA 2LFBA 2E1NA 4AD9A 2Z33A 4FE7A 2ZSIB 4JOMA 4A6DA 4DQ2A 1XGMA 2K9NA 4QSHA 2LOOA 4DYQA 5EGOA 1W4MA 3MMYB 5H20A 3BWGA 2CQ7A 4S04A 3DP7A 3ZQGA 4P96A 3TP0A 1C0WA 2MLKA 3QOPA 2FQ4A 2A68F 3FK7A 3RI4A 1O3TA 4XQFA 1O7LA 3K6GA 2GXAA 5L3CA 5DYMA 2OBPA 5KAFC 4G9YA 1B9MA 1ZG5A 4DYCA 2DT5A 2EV5A 5CYVA 3EQLF 5CVVA 3HKZA 3LAPA 1F5TA 4RM2A 4J00A 3IC7A 1SC7A 1M1EB 1IN8A 1YW7A 2COMA 3HOTA 3OS0A 3HOYJ 3OOPA 3F8CA 4XONA 2ZMEA 3OR1C 3PUBA 2JMWA 4GXOA 5HDKA 4N9IA 2PFBA 1S72I 3HM5A 1QQIA 3KP4A 2QKLB 2FEZA 3WTVC 3JRGA 5HLTA 2R5ZB 2QBYA 1QZEA 2FF4A 3K1NA 1WH7A 1SVOA 3ML6A 1O3SA 1YIOA 2XPWA 5J1RA 5J8CA 3BT9A 5D5UB 3GX4X 2DA1A 2DFIA 1TWHJ 1SD7A 4I01A 5FLMJ 4M6XA 4UVCA 1FOXA 4GRIA 4NC7A 4LB6B 3AG3H 3TO7A 4RA2A 4UUVA 5K5OA 1JKRC 3GTMJ 5EEHA 1MBHA 1R23A 1DP3A 2VC1A 4MNUA 4KITB 1P7IA 4CZCA 3W6KB 4E7JA 2H6BA 1SFOJ 3FXUA 1V5EA 3HBLA 3I71A 4O3MA 5LRRA 4QPQA 3V8JA 1WJBA 3OYMA 2OQGA 4A3KJ 2KISA 1ZQ3P 2L54A 4EGYA 1WJDA 3V42A 3GZ5A 3SEQA 5FKLA 4UB6C 1VZ0A 1SEUA 5DUIA 3MZHA 1A36A 3FXJA 4LITA 4HBLA 1EH7A 4FQGA 2NVYJ 4E7ZA 4XKWA 5DCMA 3GLLA 2X6YA 2HEOA 3K10A 3HHGA 2EH3A 3UKGA 2DTRA 2GZWA 2NOJB 3TP3A 2WY7Q 2XVCA 5J40A 1WWXA 1E3PA 1U5TC 2F5FA 2W1OA 2ESNA 2MG4A 2HTSA 2QA4I 2PLYA 4E7HA 2BY3A 4IEJA 2M8GX 1IGNA 1B6AA 4G6QA 5D8KB 2W84A 4Y17A 2IGNA 3KIOA 2L9VA 3FM3A 2E5NA 2MW8A 4BBRJ 1IUYA 3P9CA 3MWMA 2FX0A 1UB9A 4DZJA 2R7SA 1HW1A 1TT0A 4CCLA 4BXXJ 4FCYA 3P7NA 4HRIA 4IRIA 4A3IJ 2WV0A 2E5ZA 4FX0A 1CQTA 5E3OA 4DBQA 1X2NA 2V7FA 1S6LA 3BR2A 2XSJC 2XAHA 4R79A 4M3GA 1LNWA 5L3BA 1YX5A 3H3UA 1MDMB 1ULYA 4OWRB 4M74A 3BG3A 1LQ1A 5H6QA 4XRSG 3BJAA 3I4PA 2UV1A 2WB1A 1ZK8A 3NEUA 2M1BA 5IOZA 1YW9A 1BI3A 4BUPA 1IXCA 3SFZA 3M4OJ 4ZTFA 3DBHB 4ZYGA 3CC2I 1N75A 1SMYF 1RR7A 5DV5A 3F9KA 1ZHFA 3CZ6A 3RKWA 1UJ8A 1YX3A 4BY1J 1RPWA 2CS3A 5TISC 3L9FA 1FOKA 3L2QA 1IN7A 3M1CA 2K02A 3QYBA 4RDUA 4Y52J 4XLCA 1I6XA 5HLIA 4HV6A 3WTWC 3ZQCA 1ZH5A 1VQMI 5ILSA 1APLC 3G6EI 5EZGA 3I55I 1YE9A 4BH9A 2EFWA 3HJEA 4C3HJ 1ZTRA 1ZR2A 3PFYA 5GPAA 4ZJZA 1ZAOA 3ZRGA 1NK3P 5D5WB 3K70C 2LP0A 3EYYA 4BS9A 4IHTA 3KETA 1DDNA 3FIWA 2RQQA 5CPRB 5JLWA 1MJ9A 4XRFA 2CQXA 1FTTA 2E2IJ 3IP4B 1T39A 1YLFA 1WI9A 4UVAA 1DPRA 2K9QA 2HTJA 5BOXA 4U87A 3F6VA 1LPQA 2JT1A 5GAEJ 3K4LA 2IT0A 1Y1WJ 2MBFA 3J7YJ 3GVAA 5J4YA 5IT9Z 2GA1A 3DPUA 4GCVA 2BEOA 1T8IA 1EF4A 4KT6A 4RM3A 1D8JA 4KICA 3LSHA 5F0HA 2WADA 4QPOA 3WTTC 3E3VA 3QAHA 3RKXA 3SDBA 1YIJI 2VBXA 2ADUA 3ERMA 3AAFA 2XASA 2XUBA 2QUFA 1D0YA 4HF0A 3HOZJ 2KDZA 3MVPA 1F43A 3ZPLA 3FISA 3QP5A 1UAAA 3BP8A 2AXTC 2I8DA 5FO5A 3ZQLA 4K2EA 1BJZA 2QYOA 3WHCA 4LIVA 2VQLA 2ZJPF 2HVQA 4WF2A 4XBFA 3G1MA 2VOPA 2MFZA 1T95A 3H9GA 4AU7A 2Q2EA 3A01A 2M3AA 1SD6A 3CUQB 2M30A 1R6RA 2PMZN 3S16J 3CMAI 5FRMA 3K9TA 4Z2YA 4J19A 5L3FA 3M1EA 1WH5A 5GAHJ 1AU7A 3LMMA 2EIKH 3O8GA 1J09A 1LKXA 1KA8A 3BPXA 2LKXA 1UG2A 4KIFA 3CCUI 2DFEA 2EIJH 1DGWY 1ZG3A 1FNNA 1B72A 3BLYA 4ITVA 5K5QA 2BVLA 1V4RA 3K4MA 3KYCB 5GTIC 1S7OA 1TWFJ 1FP1D 3PNVA 2KIQA 4PGHA 3CJNA 4BJ6C 4CGZA 2VE8A 3DEEA 2ECCA 1H88C 1O4XA 3BR0A 5TGTA 2ISYA 2VC0A 5GADJ 4E70A 2O8XA 3BR1A 2X6XA 1FSEA 4PGGA 5J4VA 4RAFA 1AHDP 3S1MJ 3S3NA 4NHJA 2FJ1A 3C7JA 1VQNI 1OR7C 2P5VA 3PSFA 1J5YA 4YIFA 2H94A 2FBKA 3ZMTA 1F4KA 2HOEA 1T38A 4A3CJ 2EV0A 3FMQA 1YRNB 1W5TA 3PJRA 1QZYA 1QVTA 2XSDC 4N4NB 3OL3A 1TQPA 3ABTA 3CP2A 4KT5C 1PDNC 4Z6YA 3NARA 1TQIA 3RPUD 2VODA 1V3FA 3FBIB 4DYRA 3D1NI 4CHUA 4HG2A 2CH0A 1TNSA 3CCLI 2M9HA 2XHKA 4PJLA 1FYLA 1K7AA 1IG7A 3GZNB 2NVQJ 4ZYDA 1WGXA 4ESFA 3RPQA 5IYBJ 1S3JA 2OV7A 2MC3A 1IAWA 1BI1A 4EJOA 1DUXC 1PUFA 1D3YA 3HHHA 4RGSA 2QENA 1D5VA 2O61A 4NDLA 3M9AA 2JZYA 2M4KA 2HQ5A 2A6TA 2NXNB 1SMTA 3RYRA 2KIUA 3H5NA 4HPQA 1J75A 2DMUA 2E1OA 2QWWA 2X4HA 2E34A 2E7XA 2PJRB 3GBGA 3BZKA 1HW5A 3LA2A 2BW3B 1IO2A 4OINF 3E0JB 4JP0A 3I9V2 3G4SI 3ZP5A 2VBZA 1JGSA 1IRZA 2B9SA 3AG4H 3O8HA 3PFIA 1WZ2A 4YIIA 4P1WA 2OCEA 4UVBA 4XKVA 4U7DA 1HSTA 3J7ZI 4PUSA 1NHAA 4A2UA 2K85A 4PJMA 3HTSB 3EUHA 1KU3A 3HGGA 2BVMA 5D8LB 3BG7A 3WG9A 3CC7I 2E71A 3BQZA 4XLEA 1X1BA 3OOUA 1GV2A 4CCMA 2HPMA 2IAIA 3KYLA 3S2HJ 1P2FA 2IS2A 2X1DA 4HDUA 2BY1A 3P5JA 5JLXA 4R8HA 2JA8J 5E3NA 4DZPA 3TL4X 4NBQA 2GOXB 2DJIA 2EZKA 2XAFA 1MD0A 1T0FC 1MMSA 1U9NA 1EJ9A 2RREA 2ZJ2A 3UNGC 1B72B 3MCZA 3K70D 4B48A 4DJAA 5A2QZ 4BBSJ 4HLYA 2V1UA 1YOVB 1UCRA 5IYDJ 4R1HA 5E1XA 1SFXA 3H35A 3HOUJ 3K4NA 4EJVA 2YUSA 4UB8C 3VFZA 3GTPJ 1YJ9I 3IRQA 3R0JA 2P7CB 1H9GA 3LQQA 1VQ8I 5F0CA 1MH3A 3IKVA 5HOOA 1RESA 1E3HA 1OCPA 1HKSA 5FLXZ 3JRIA 2D1HA 3ZMDA 4YFNF 2OAZA 2IVMA 1NK2P 3J7AY 2VXZA 5F64A 1S5LC 2DMNA 4L9JA 1SAXA 1BC7C 4KFCA 3SQNA 2IA0A 1Z3XA 2P6SA 2WA0A 1MW7A 4JK1X 2XC7A 3D5RC 1HXDA 5F27A 3CDIA 4BKXA 1VTNC 3DPTA 4F52A 1W7PA 5L3EA 4IHVA 1XSXA 2XROA 2V6EA 4EM2A 2W82A 1XMKA 3F21A 2ECBA 1VQLI 2K9MA 1O3QA 1FWZA 1GXQA 3ZR8X 5B66C 3DF8A 1K61A 4H4KC 2L01A 3GTJJ 3LNQA 1EKEA 4XLNF 2X9DA 4LIUA 4C2MJ 3RCOA 3CO7C 3BTJA 2QQBA 3GUDA 1TZLA 4PJJA 5HNHA 3OS1A 2JA5J 1HCRA 1TWAJ 3AG2H 4CO8A 2Y0SN 1EH8A 2K9SA 3JREA 2W85A 3OYIA 1G8XA 3J7AO 1TQMA 2EJRA 2DBBA 1OKRA 3TOBA 3O3KA 3K2ZA 3TW7A 4BU2A 4Y3OA 3OYBA 1J0RA 3H0DA 3Q5FA 4IO9F 1R1TA 1W36D 3F3XA 3S17J 1JHHA 2ZB9A 3F72A 3PQKA 5LGUA 2BHZA 2KZVA 2LY1A 3KP3A 5FKNA 1VQ5I 2KJCA 1ETVA 1X19A 3ZN0A 1D0ZA 2VKVA 2NAZA 2P5LC 2IRFG 4H0EA 3W2WA 2EZLA 3MD2A 2XF7A 2DLLA 1JKOC 2M4GA 2L7MP 1G3SA 3OYCA 4WX9A 4DNCA 2R92J 1N78A 5J47A 4V2FA 1PYVA 2LBFA 3MKWB 2R5ZA 4BE1A 3WGHA 1ZLKA 5KK1A 2AS5F 3QQAA 4FISA 4UUTA 1VQ7I 1WKMA 3KZYA 1U3EM 1QU3A 1XX5A 2VPRA 2DMTA 4A5MA 4OIQF 1HSJA 5B5EC 3HRUA 1RKWA 4U0WA 5ICFA 4C3JJ 4PDKA 3S8PA 4E7KA 4MEXF 5ILUA 3L2UA 5D4SA 2CMPA 2Q1ZB 5F6FA 1ONVA 2DYSH 4RLQA 4XL9A 1UHSA 2RNJA 1VQ9I 1UG0A 3I4MJ 3IWZA 4D9JA 5LEKA 1ITYA 3JCUC 4HX8A 3NWSA 3I4NJ 3M8JA 4LG3A 1K79A 5E20A 4IHYA 2KLOA 2L4AA 2R7FA 1BN5A 2ID6A 3JTHA 4EM0B 1XGSA 1WI3A 1IC8A 2FBHA 1IW7F 3HOVJ 1MJAA 1XSVA 3F8BA 5EEGA 3M8FA 1DQUA 2TRTA 3KEQA 4A3GJ 1SD5A 3QP6A 4UV9A 2HS5A 2GBYA 2EK5A 2H1LA 2OA4A 4F91B 1U5TB 2DMPA 3VYTB 3JTGA 1VQ4I 4AYBA 2H1KA 5FGMA 3BTCA 2HQRA 2F5CA 2FUG2 3REOA 2M7AA 1OCOH 4F7ZA 1JUPA 2R4GA 3LA3A 1CGPA 3AG1H 1MMGA 1ETKA 1KGSA 3D0SA 3SJMA 5JHFA 1V5FA 1JUSA 1PP7U 3K7AJ 1JTYA 4N9HA 3BTLA 5HNFA 1XC5A 4HW0A 1XCBA 2MSYA 1HLVA 1AOYA 1X3UA 4MFDA 3ZXSA 4A3MJ 2D5VA 3ZQHA 2DT7B 3AKZA 2W24A 3QU3A 5E17F 4MTEA 3WTSC 3OMYA 1HQCA 2WAFA 1MBGA 1ACIA 5CKTA 2ICWG 5KVRA 2O3FA 3JRBA 1U78A 1MBEA 3OR2C 5DM6F 4II3A 1Z7LA 1VF9A 4RB2C 1G3TA 4A0ZA 1RZ4A 2O5RA 3KE2A 1G3YA 3SEZA 2EA4A 3RQIA 1IJWC 2XF5A 4IPAA 3JRCA 2L9SA 4MQVA 2FU4A 1T08B 4W1UA 4OMYA 1GXPA 1OYWA 3GFLA 5IOYA 1ZELA 4WWCA 1MDMA 3QPSA 4ABZA 1Z77A 2KHMA 3WTZA 4ENKA 4CYCA 3S14J 1XMXA 2A6EF 2Y31A 3OSGA 4EMSA 2M2EA 5TJJA 3ULQB 1XGOA 2V1XA 1E17A 2FNPA 3MZ8A 3E1SA 2VONA 2VT3A 2HU9A 4NUBA 4E7SA 2LBFB 5DD8A 3P9IA 4OOIA 3ROUA 4BACA 1FIPA 3GFIA 1G4DA 3GTKJ 4KIBA 2R0QC 1FEXA 3E5QA 5EJCA 3GXOA 2CFOA 1R1UA 3ZCOA 5M5YJ 4XLFA 3JSPA 3VSLA 3CCQI 2H6CA 4V2GA 3VSKA 2HZTA 4A3JJ 4L5JA 5CVJA 3BC8A 4XSZF 3TQNA 2V9VA 4JQFA 3OYKA 4MEYF 2OC6A 4BDZA 2NNNA 3WHBA 2DO7A 2HDWA 2R7VA 5B3SH 3G73A 3M3YJ 4M6YA 1BW6A 2EIMH 4MQ9F 1KYWA 2FMLA 2NYXA 4C30A 2DOFA 2YPRA 3NRVA 2CG4A 4FETA 1SVMA 3LAJA 1Y8RB 1E3OC 4PCQA 3DU6A 3A0HC 1MJBA 4ZDPA 2D45A 2O8KA 4GYIA 2AXLA 3CMMA 3FXLA 3RQ4A 4EM1A 3T1BA 1RKTA 4P5OA 5J3LA 4D5CA 5H2FC 5HLGA 2FBIA 1N77A 3HSFA 3R0AA 3FXMA 2Z2SB 2EPFA 2A69F 3F0CA 1UELB 1ZRCA 2LREA 2X0LA 5HLHA 1B1BA 3H92A 1P92A 1R5GA 1X2MA 5FD6A 1HW2A 5CLSA 3E7LA 2XRLA 4A6EA 1AWCA 3DBRB 2LH9A 4P9FA 4P9UA 4YG2F 2RC4A 2ELHA 1CF7A 3OYJA 2Y9ZA 1G59A 2HGCA 2BY2A 2MD5A 5E3MA 5D5XB 4B09A 3OIPA 2IS6A 4G6DA 5K7ZA 1Y6IA 2HXOA 4I99C 3DCFA 1IRXA 2NNYA 2HR3A 2Y9YA 2Y48A 5KAIC 4A3FJ 2A61A 4IVNA 4MGRA 2ISZA 4IHWA 2VQCA 1JE8A 3G2BA 1DGRM 3IV5A 3RYPA 3IAS2 1ZRDA 4YFXF 4F92B 1VQ6I 3HZJA 2BHYA 4YELA 1Z21A 2KIMA 3LSMA 2HVRA 1MMNA 2QKMB 4LMYA 4XNFA 4W97A 1FPQA 4A3BJ 3LSIA 1PUEE 1SVLA 3V4GA 2E19A 3CUQA 4IQ4A 3MKYB 4XR6A 3CQZJ 3JSOA 5ICEA 1JHFA 2WAQN 4ZYEA 4CYCB 3H3VK 2OD5A 2JQ7A 3ABKH 1V54H 4C9YA 5K7FA 2R7DA 1JJ8C 2GIZA 3TKYA 3GWZA 2KP6A 3R4KA 1TW2A 4XK4A 4HV5A 2LVSA 3HRTA 5E79C 4CCOA 2F2EA 4IX7A 4A93J 1TLHB 2DMQA 1VQPI 2VI6A 1UHMA 2IPQX 1FBUA 3CF5F 2YR2A 4I7HA 3K69A 2Z9OA 1MMAA 4BJTA 4BE2A 1D1CA 1LFUP 3U1KA 1FX7A 3ABLH 5FJ8J 1KQ0A 4WK8F 2IW5A 1YJNI 3GFMA 2KL4A 1G6NA 1FYMA 3IUOA 5K7HA 1YS7A 1W1WE 2JVHA 2VKHA 2X6WA 4LK0F 4XOPA 1BL0A 1KYZA 4U88A 1BOAA 1YRNA 5FKMA 3L2VA 3CMYA 2QF7A 4WXHA 3HGYA 4FASD 5HS7A 2XV4S 5F1RA 2VT2A 2VIXA 5EDNA 4M6VA 2LY9A 2PJPA 2W00A 1B8IB 1QGPA 4EGZA 2E2HJ 1WJAA 2JPBA 2XPVA 1OCCH 2XDVA 2LMDA 2CFXA 2QQAA 3Q9SA 4HSTA 2JSPA 4FTHA 2RV8A 2HDCA 4IXAA 2AHQA 2Z16A 2R7RA 3DLLF 1IF1A 5GPCA 3RKYA 1K78B 1BJAA 1JKQC 2XKPA 1ON2A 3U1DA 5DDGA 1XPXA 1K83J 1FYKA 3ZMVA 2K86A 2NS0A 6PAXA 4NQWA 4BXUA 4BEHA 4KYWA 2DT6A 3T8RA 3C3WA 2HXIA 1CF7B 4PZJA 4LGWA 3TEDA 1R58A 2KDOA 3CTAA 1AKHB 1Q1VA 2RN7A 4G7OF 3MQ0A 2PJRA 4LG0B 2F4MB 4MO7A 1FY7A 2BW3A 1MNDA 2LK2A 1L3LA 1GLNA 1X3ZB 5EF6A 3SXYA 5CJ9A 3IH3A 1KU2A 2Z99A 2XGCA 5AIPA 3U21A 1HKTA 4IOAF 4G94A 1YQAA 2W4SA 3GMEA 4II2A 2I5UA 3ESWB 1DPUA 5E1WA 1T56A 2L9NA 3VYSB 1P7JA 5BS6A 3FM5A 2Y30A 5GTHC 2ZXWH 3HSEA 3KFWX 3TDZC 3CC4I 1QO0D 4MHGA 2VLAA 3L2WA 2G9WA 2M45A 4BHBA 4BXFA 1VNDA 1PVEA 1ZARA 2LD5A 3J80K 1ETXA 3E6MA 4BQOA 2ME6A 5E3LA 3W2VA 1MSFC 1YS6A 3FXQA 4I0AA 4L5IA 2CYYA 1Y39A 1MMDA 2NOGA 5C3EJ 1WJCA 3CJQB 1QVUA 5ICGA 1W36C 4A3EJ 1ZR4A 3VPRA 4KUMA 5J6XA 4NC8A 2DK5A 4V19K 4D1QA 3LOCA 3D5SC 3EUAA 1WCMJ 2ETHA 3K4JA 3JAMZ 4M71A 4RGXA 2VKEA 2BV6A 4LD5A 1H9TA 5HS9A 2DJNA 3E5XA 4A5NA 5ICCA 2JA2A 3GW2A 2HPIA 2CW0F 3H9JA 2EA2A 2RGVA 4X1EA 4CA0A 3HDDA 1NH3A 1JI8A 1GT0C 2B0LA 2CW7A 3OIOA 3OL4A 4I98B 1OPCA 1JGGA 1U9OA 2VE9A 2OZUA 1Z3YA 2CUFA 3JRAA 1OCRH 2CU7A 2LTPA 3OYLA 1P9QC 1IN4A 2XGXA 4OIPF 3HIFA 2ZMEC 1BI0A 1A5JA 5LHIA 1F1ZA 4JX4A 5FKKA 3QYFA 2VQGA 2VBWA 1USSA 3HKZN 4A3LJ 3HEFA 3BR6A 4PJ0C 1FIAA 1YHQI 3CESA 2ZFWA 3DTEA 3QRFF 2H8RA 2OTJI 3L1PA 1P6RA 2M8EA 3I64A 4C2UA 4UNOA 4U0VA 1H8AC 2CJJA 1FP2A 3FX3A 3K2AA 4EJTA 4UXNA 3GTQJ 2P4WA 5E8GA 4ZDLA 3Q0VA 2CV1A 4NQWB 1OJLA 4BEHB 4QTRA 3PO3J 4ESJA 5BPIA 1FT9A 2IEKA 4WXCA 1W7PD 1I1SA 2MC4A 5IP6A 2PI0A 2XRNA 2MH9A 2PMHA 2L0KA 4XLPF 4IHXA 1WSUA 1FJLA 1EV7A 4O6JA 2R7UA 1MNEA 1S7EA 3HUGB 9ANTA 1LVKA 2M5WA 3CDHA 2HVSA 1G2HA 1UMQA 1ZREA 4L0ZB 3OYHA 5EZHA 5B1BH 2KKOA 4Q47A 1KZHA 3V8KA 2CV0A 4PSWA 3BTIA 1GHCA 4PSXA 5GP9A 5FKOA 4MIMA 2G0EA 5CVRA 2OZ6A 2OTLI 3ABMH 2DA2A 2JPCA 1LEBA 2E35A 3ZMSA 1U6GA 1XN7A 2CRGA 4PFPA 2X6OA 2K3FA 3BROA 3NAUA 4QIWN 2VN2A 2P81A 3FXKA 5EG0B 3DKXA 4A0XA 3BDDA 1HC8A 1JXSA 1LE8A 5H6RA 2QEXI 1FZPB 3QWLA 1OYYA 2A5YB 2ESHA 3BG9A 4GYGA 1A31A 2PX9A 5JI6A 1SAUA 1S7AA 2GA2A 1QNTA 5CVIA 5ERIA 3VYRB 4B1RA 1RNLA 3FZVA 1YFHA 2DFHA 1Z67A 4BQAA 2E1MC 2DQLA 2WAEA 3DFGA 3FKJA 3VODA 2Q0OA 4LK1F 2XF6A 1Z9CA 1JKPC 5ED4A 4IHSA 3VDXA 2JA7J 5KCMA 3CF2A 3W6VA 3LSTA 3WU0A 4A3DJ 2G7UA 2KQRA 2HOTA 3WGIA 3A4CA 2OUMA 3L2RA 2HYJA 1I1GA 2DOAA 2KFDA 1I6HJ 1BA5A 2ZBKA 2R7WA 5JFRA 3FMRA 2FSWA 2R3SA 5DM7F 1B4AA 1U5TA 2X1EA 4ZYHA 1RC9A 5FFZA 1YITI 2XKOA 4ZZLA 2VXDA 1K6OA 5ILVA 2R5YA 1J7KA 1TP4A 3FMSA 2DODA 2KZGA 5LBQA 3DEWA 1MH4A 2FOWA 2PEXA 2UWMA 2K4JA 1IV8A 4CICA 1ZN2A 4CYDA 3MEXA 5IYCJ 3I5UA 5B1AH 2WB1N 5J1YA 3LSRA 4B3XA 2F5DA 3OYNA 1IZ1A 3DLAA 4IJAA 2V1DA 3NWTA 4BY7J 3IHUA 3KEYA 1BR4A 4E4HA 2MYSA 3L00A 1YO5C 3S1QJ 1B9NA 3DXJF 2F6CA 3B73A 4M3BA 2IJLA 2VPLA 4D0PA 2ZCWA 4HNTA 1RUOA 3ZQQA 1Q1HA 4HA8A 1L0OC 3CCSI 3B6CA 2ZC2A 4I02A 3RIRA 2N8GA 4OIRF 2GXBA 1HOMA 1BR2A 2BGCA 1OCTC 3KZIC 1R4MB 2CQNA 2JRTA 3BCBA 3SHFA 2HOAA 1Y0UA 5EEAA 4G12A 1TC3C 2QSHX 3E97A 4Y15A 3Q9VA 3GTLJ 1EH6A 4XRMA 2R7QA 4BE0A 3CCRI 1X1CA 3BQYA 5HS8A 2ZXIA 3V7CA 2YU9J 3CUOA 4ZH4F 1MIJA 2HZDA 1IDZA 2CGPA 5C4XJ 2P7VB 3ECOA 1A6IA 2X51A 3SDGA 1A04A 1O7FA 5DEQA 1YW8A 4TV7A 3DWLE 4HQMA 3C2BA 1VQKI 4B44A 1MBKA 2PQ8A 2DA5A 4ASNA 3V8LA 5D5VB 1LE8B 3TO9A 4LFUA 3HTUA 2LG4A 2K3PA 5LRSA 2HOSA 1MBJA 5LHHA 4X0GA 4AVZA 1Y1VJ 2IGMA 2IS1A 5D4RA 2GAUA 1ETWA 3FKIJ 1S8NA 3CCEI 1RRJA 2XGDA 1QHHD 1ZLJA 3KP7A 2KT0A 2CW8A 1SFUA 4OIOF 3JRFA 5JVGF 2K5CA 2UXNA 2PG4A 4EEFG 3PIOF 4RB3C 2EBIA 3A2KA 5GAGJ 3ZQ7A 4S05A 2V9PA 2VJ4A 4HLXA 4M3EA 4ZZDA 3B02A 4XORA 1UFMA 4XLAA 1BR1A 2ELJA 3CLOA 2KRFA 5F08A 3K4BA 1TWGJ 2DDBA 2V9KA 3F8FA 4EVIA 5FLVA 2FOKA 3RDIA 1HDPA 3CCMI 4HDVA 4NC6A 1R7JA 3C2GA 2DU9A 2BBYA 3OYFA 2HQAA 2O03A 4XN3A 2DPUA 2R5YB 2X1CA 2LLKA 2DXIA 2V79A 4YEJA 1OMIA 2C6YA 4HAMA 2EINH 3CCYA 3P9KA 2XAGA 4A0YA 5HVQC 1ETOA 3EPZA 1HBXG 1GDTA 2B63J 4C2TA 2P0WA 2PMZA 2ZNYA 2EZHA 3LSJA 2LR8A 2XAUA 1G3WA 1GVJA 4BHPA 1BM9A 1JT0A 3MKLA 2L9RA 3EETA 4RAZA 3O2PE 3GFJA 4XMYA 1IRFA 3F6OA 4P55A 2WWYA 2O0YA 4PK4A 2DQRA 3HSRA 4DW6A 5M3FJ 5IT3A 1ZGWA 3S2DJ 1YG2A 1D1BA 1ETQA 2L7FP 4KN7X 3TMOA 2FE3A 3M7GA 4RB1A 3I56I 3ZMZA 2STTA 3I54A 2GM4A 1ETYA 1U0JA 2EB7A 2QQ9A 3DPLC 2QVOA 4E7LA 3N97A 2EQRA 1PP8F 3Q0WA 1D8KA 3EDPA 2DOEA 4HQEA 2DA7A 2LC2A 2M7BA 5K1YA 3E6DA 1V5GA 4M9ZA 2D1VA 4HNUA 3S93A 3Q0UA 3KLOA 1W0TA 3LSKA 3QU6A 1SFEA 1YTYA 4RLFA 4L0YB 3AL0C 3MZYA 2CSOA 3WU2C 1X3WB 5JHUA 1OFCX 3HPGA 3F8NA 4I2OA 4CXFA 4S0HB 1OYIA 1STZA 4JBAA 1OR7A 5LGTA 2IBDA 2MLGA 5D6FA 2IA2A 2IP2A 3PIPF 2LF8A 3T0YA 3W6JB 2ZKZA 4ENJA 1R49A 5TRDA 1I5ZA 1YJWI 1V55H 2LKSA 1R5ID 1BBYA 3U2RA 1MSEC 4M72A 2E2JJ 1S29A 2JK3A 3E6BA 5C4JJ 2DDAA 1FC3A 1BW5A 3KLNA 4A69C 2NRAC 2K4BA 5J8FA 4IQJA 2WC2A 3DKYA 4EJWA 2KJBA 3FF5A 5FB2A 3JW4A 3H9QA 5JR3A 3C2HA 2O6GE 1Z91A 3RKQA 3BG5A 2Y75A 4I6ZA 3WTXC 3OWTA 1W5CC 4F55A 3ERED 1IRGA 4UV8A 2HDDA 3EUHC 4ETSA 3BR5A 3J81Z 1VQOI 1B8IA 3Q3SA 2OF7A 3OIQA 2CUZA 1OISA 1GV5A 1VI0A 4DIQA 1T6SA 1BOBA 1E2XA 4BQQA 2VASA 4IKFA 1IXRC 4WCGA 2EFOA 5IP9J 1POGA 3S15J 5C44J 3N05A 2NS7A 2JN6A 3BG6A 3TW6A 3PNTA 1K78A 4CCJA 1ZRFA 1S9HA 4OAZA 4F93B 3CCJI 1NTCA 3VYUB 3S1RJ 1AA7A 1R1VA 3H5RA 3F22A 4ZTJA 4D5FA 5IT9K 1I50J 3K4CA 1R9TJ 2ZXJA 3DKWA 3T8TA 1WJ5A 3GLXA 1Z7UA 1LJ9A 3LSPA 3BPVA 1XMAA 2CQQA 4XM3A 5AIQA 2FQ3A 2L2OA 1XCVA 4G7ZF 1IXSB 1AKHA 1UHWA 4HX7A 2DTZA 2FD5A 4LG0A 4HZFA 4B8XA 3PSIA 3HOSA 3F23A 4M73A 1X1DA 2VJJA 3VB2A 2CUJA 2DA6A 2XAJA 5DTDA 4J01A 3V7RA 2IGKA 1XS9A 2E60A 1XB4A 2DK8A 2Y0MA 1FBQA 2QCOA 1MNMC 4BL0B 4KN4X 2A3SA 2E7WA 2LNBA 2ZFUA 3M07A 3KEOA 2V4JC 2GLOA 1TNTA 3NQOA 4B47A 1T0FA 4LLLA 2HWVA 4XKCA 2R7XA 4DGWB 2UXXA 3BY6A 4BJ5C 2VKDA 1GUUA 2GQQA 5HODA 4G8XA 5EGOB 1WFXA 2TDXA 2B7EA 2PN6A 1KONA 2F4IA 3FK6A 3GO5A 4HSRA 2ZXHA 3A02A 3H36A 2XAQA 3K4KA 4I09A 4CCKA 5L3GA 3R61A 1FOYA 2DAOA 2LDUA 5M5XJ 3TDUC 3OYEA 1I27A 3BR3A 4N0BA 3S2WA 1T33A 4AC0A 4CSWA 2IS4A 3BOQA 4B4CA 1MZBA 1QHGA 3ZOBA 1LDKB 4BQNA 2NVUB 3A0BC 3G3ZA 2H09A 2A05A 3S3OA 2BOLA 4ZYAA 1K6YA 1YI2I 1W0UA 1LB2A 5BNGA 2V1NA 3JAMK 3K1MA 1D0XA 4Y7NJ 4LJZF 2ZMEB 2FXAA 1GVDA 1LUJB 1N25A 2DA4A 2RDPA 3RZDJ 4HOBA 3ONQA 1OLTA 1ZGAA 5M5WJ 2QBYB 4EJUA 4LLNA 2ZJRF 1PJRA 1U8RA 5FFXA 2KPMA 3G71I 1LVAA 2V6CA 3PUFA 1DU0A 2E1CA 4M3DA 2GXGA 4ANJA 2Y0SA 5LLQA 1JUMA 1RIOH 3I59A 2H8WA 5DCFA 2EZIA 1I3AA 4LB5A 4Q48A 4NNJA 3RSNA 2KMUA 3WGGA 5E8IA 4KMFA 2MGQA 4RB0A 3GEZA 1A35A 1ENHA 4F3QA 2WY8Q 2W7NA 5CQEA 1NG7A 2P8TA 1ZG1A 2YS9A 4AVPA 4XRSA 4U0YA 3COAC 3I0TA 3HOXJ 3VWBA 4PFOA 3TBIA 1Y8QB 5BPDA 2JVGA 3DBLB 3ZN1A 4IRGA 3IRRA 4IZZA 2M34A 3K1PA 3LSGA 1HDDC 1OQYA 2A07F 3S1NJ 3HG9A 2HKXA 2HFHA 3IAM2 2FNAA 2NS8A 2DCEA 1HKQA 2BYVE 3L09A 2BY0A 3QODA 4HEA2 2QQ8A 3K0LA 3RJPA 5HDGA 4B43A 1IDYA 5DS9A 1R00A 3WTYC 1P4XA 3M8EA 4HX4A 2XB0X 5DCMB 2IGOA 4ON0A 4KDPA 2PBIA 3A1YA 3RTRA 3QPLA 5LGNA 3F8MA 3HUGA 5LHGA 2QZ8A 5JVTA 2MD0A 3DQVC 1LDDA 4ZC3A 3TOAA 4MTDA 4IOCF 2J5PA 2Q8KA 3DTIA 4YFKF 1Z6RA 1KU7A 1K4TA 4FT8A 4RGUA 5K5RA 5F04A 3IWFA 4YIRX 5IP7J 1ON1A 2QSFX 1HA8A 2IA1A 1R5HA 3KP5A 3GTOJ 3MFKA 4XOTA 3HC7A 3PL8A 3FXOA 3G1LA 3CDLA 4HNVA 3SFIA 1Z6TA 4AM3A 3KZZA 2BXZA 3H3ZA 1J59A 3VOEA 4AYBN 5D6EA 2E1MB 2ZO4A 5KHDA 5LD2C 4BNCA 4L18B 5EG0A 2ME0A 2J5OA 2KRHA 2W48A 2UZKA 3IKTA 2VBYA 3KP6A 3N4MA 4M9XA 3PM1A 4RAYA 4C3IJ 3OSFA 3T5XA 2JSCA 1D5YA 5LFAA 1P4WA 4I76A 1Z05A 3HB9A 4FE4A 5A2QK 4KNYA 2E36A 1I3QJ 1X4OA 2RNGA 2R93J 1F36A 2W57A 2XB5A 1MBFA 2OCCH 5F1JA 2O7OA 3QPHA 3E6CC 2F4OB 3ZQIA 5IPAA 2RVCA 3WE2A 2A5WA 1TT5B 2OPTA 2HKOA 1X1PA 2YSRA 3MAJA 4RMNA 2GOMA 2F48A 2EILH 3BJOA 3C18A 3CP8A 3QYEA 2YX7A 3OYAA 5FLXK 2DFFA 4XLHA 5DUKA 1QBJA 2LRDA 2VQHA 3I59B 4IF4A 5M3MJ 2EFPA 4JX5A 2CUEA 2DYRH 5E1ZB 3ISPA 1Z1DA 4EATA 3HPHA 4RBOA 3X2QH 4XIDA 1LEAA 2UUZA 4KISA 2ZJQF 2AQFA 2QGUA 2A6HF 3SYTA 4UUSA 4ENNA 3I3LA 1KQ8A 1Z0XA 1D1AA 2K27A 2LSOA 1QRYA 3BCAA 3DTKA 1FMVA 3HXLA 4E7IA 2QSGX 2XIGA 2XGEA 4L5EA 1K4SA 2CQKA 3KYDB 1W5SA 4M3FA 2Z3YA 1IV6A 1SANA 2Z1DA 5L3DA 2AQEA 1XDUA 3GTGJ 1OCZH 3HOWJ 4AIJA 3JR9A 2RAEA 1TW3A 1JTXA 3CLQA 2O9LA 3TGNA 4FHTA 4LLGF 4I0BA 2CWEA 2Y2ZA 1IN6A 3H0GJ 3FXRA 3CMEI 3R6SA 4XKBA 1P4AA 4CH7A 1X58A 3ABUA 3OYGA 3QOEA 2X48A 3WODF 3BJ6A 3SZTA 2WV1A 3WTUC 1IUFA 2OU2A 2CO5A 1MGTA 2JWTA 2EWNA 2LF7A 4HYEA 1KQ9A 3HYIA 5J1UA 4GO1A 2JA6J 1USTA 1TTYA 3GF2A 1BIAA 4GFBA 2STWA 5LEJA 1VFCA 4FX4A 3MN2A 5EYRA 4UHTA 2GWRA 2VUMJ 1LDJA 3JRDA 1XDSA 3FHNA 3CD6I 2L5QA 4XSXF 1BI2A 2BXYA 3DV8A 3AFHA 1RR8C 1O3RA 2FRHA 2QLZA 2OQRA 3VEPA 2ELKA 5BMZA 1EA3A 2F5VA 1BC8C 2DW4A 3H5AA 2Q2EB 3E5UA 3A01B 5BQTA 2AO9A 1REPC 3V7SA 3HL2A 2GIVA 3DEUA 4XICA 4IRHA 4Y33A 2I10A 2JUCA 3U9GA 3J80Z 1ERDA 3OS2A 2G7HA 4OAYA 4XN0A 3G1OA 5IY5H 1H0MA 2HYGD 3HRMA 4GGGA 1FTZA 3IH4A 4DOZA 1ORKA 3KX2A 1Y56A 2RQPA 4JX6A 4Y4RA 3FBNB 3LFUA 1WRJA 1RUNA 3WE3A 4KJZA 3CUQC 4AIDA 4D7MA 3WU1B 3CO6C 3RPUA 3I58A 3ECHA 1XSDA 2DPDA 2VJ5A 2VL8A 2MH2A 3ASNH 2R7TA 3DU5A 2Z5UA 4KMUX 3IL2A 3GCMA 2FMYA 3JRHA 2NVTJ 1QZZA 5DD4A 4M9SA 3L7WA 2BZTA 2TCTA 4UUSB 4ESBA 4RS8A 4ZDOA 4HF2A 4G6TB 4OMZA 1XG1A 4E6KG 4CCNA 2LKPA 3EUKL 2WAQA 4JYKA 1U8BA 4Q4ZF 4N4OB 2VOOA 2RKHA 4CZZA 3LL7A 1FMWA 2KRCA 1BIBA 3LWFA 1TL8A 2ACJA 1X4PA 3AL0B 1J9IA 4A12A 2EFQA
chains in the Genus database with same CATH topology
3AL0C 3CP2A 1MMAA 4BJTA 4BE2A 1D1CA 3HPGA 3RPUD 3FBIB 2KL4A 4HG2A 3IUOA 2CH0A 2JVHA 2VKHA 2X6WA 4PJLA 4XOPA 3D5LA 3L2VA 2OV7A 3OY9A 4FASD 4U7BA 3CJRB 2VIXA 4IQJA 1NG6A 3DKYA 2HNHA 2W00A 1WJAA 1LFPA 2L7KA 2XDVA 2M4KA 2A6TA 3H9QA 4HSTA 3UR3C 3C2HA 2JSPA 2IXSA 4HPQA 3H5NA 2Z16A 1WJEA 5CQGA 3OWTA 2R7RA 4F55A 2LY2A 3EUHC 2PJRB 3GBGA 3PNYA 2BW3B 5KNLA 3E0JB 3I9V2 3OIQA 2CUZA 5FROA 4DIQA 4P1WA 2ZSHB 1BOBA 4BEHA 4BQQA 2VJIA 4XKVA 1X1AA 2DT6A 2VASA 4IKFA 4PUSA 3W2AA 4PJMA 2X85A 3FDYA 3S32A 2KDOA 4BDYA 3N05A 2BVMA 3BG6A 2PJRA 3PNTA 4CCJA 3BG7A 1S9HA 2BW3A 4OAZA 4F93B 1MNDA 4XLEA 3VYUB 1AA7A 1GLNA 1X1BA 3H5RA 3OOUA 4CCMA 4ZTJA 2HPMA 3KYLA 3K4CA 2IS2A 2X1DA 1WJ5A 3OYDA 3U21A 3TL4X 2GOXB 2W4SA 4XM3A 4II2A 2L2OA 2DJIA 1T0FC 2MABA 2RREA 2L9NA 3VYSB 1SFKA 3UNGC 2JUGA 4BGDA 3K70D 3PSIA 3HOSA 3S3MA 3W3CA 1X1DA 2VJJA 4B48A 4DJAA 2CUJA 4J01A 2R7OA 3MKZA 4MLOA 2VLAA 2VB6A 5FRNA 3L2WA 2IGKA 2E60A 2V26A 4BXFA 4BL0B 3H35A 1E0EA 3K4NA 2ZFUA 2V4JC 4B47A 4BQOA 3ZGKA 3W2VA 4XKCA 2R7XA 2K9LA 4DGWB 4BJ5C 2WBMA 2VKDA 1MMDA 4PJNA 1W36C 1WJCA 3CJQB 3SZGA 4CUGA 1WFXA 5HOOA 1KONA 2LYCA 2F4IA 4HSRA 4NC8A 2ZXHA 4D1QA 3K4KA 3D5SC 4CCKA 3EUAA 3K4JA 4YRVA 3J7AY 2M0MA 2VXZA 2CV2A 1WJFA 1Z3XA 3OYEA 2WA0A 4DBRA 1MW7A 2XC7A 3D5RC 4CSWA 2IS4A 2JA2A 1QHGA 2HPIA 2ZSIB 3H9JA 4JOMA 3DPTA 4CA0A 1LDKB 2LOOA 4BQNA 4F52A 1JI8A 3MMYB 2CW7A 3S3OA 2BOLA 2V6EA 4ZYAA 1K6YA 2W82A 3OL4A 2K9MA 1Z3YA 3ZR8X 2V1NA 4H4KC 3OYLA 1P9QC 1D0XA 4XQFA 3K6GA 4LIUA 3QYFA 3RCOA 2VQGA 3ONQA 1TZLA 4PJJA 1OLTA 5HNHA 3OS1A 3CESA 3HKZA 1PJRA 3DTEA 4RM2A 4J00A 2KPMA 4C2UA 4ANJA 2Y0SA 3HOTA 3OS0A 3OYIA 1G8XA 4XONA 3OR1C 4NNJA 3RSNA 3PUBA 2KMUA 3OYBA 4ZDLA 4Y3OA 4BU2A 3H0DA 2CV1A 4NQWB 4BEHB 4F3QA 2QKLB 2WY8Q 2W7NA 5HLTA 1W36D 5CQEA 1NG7A 2MC4A 2KZVA 2LY1A 3VWBA 4PFOA 3TBIA 1X19A 1D0ZA 2R7UA 2JVGA 4GRIA 4NC7A 1MNEA 3HUGB 3W2WA 3MD2A 1LVKA 2XF7A 4IZZA 2HVSA 3LSGA 2M4GA 1DP3A 3OYCA 3HG9A 1N78A 3IAM2 4KITB 2DCEA 3OYHA 4CZCA 1PYVA 2LBFA 3MKWB 4E7JA 4BE1A 3QODA 4HEA2 1V5EA 4PSWA 2CV0A 4B43A 4PSXA 1QU3A 4QPQA 2IGOA 3A1YA 1WJBA 3RTRA 3OYMA 4E7KA 3S8PA 3L2UA 2CMPA 2Q1ZB 2MD0A 3DQVC 4XL9A 4RLQA 1UG0A 1WJDA 4PFPA 4ZC3A 4D9JA 3V42A 3SEQA 3NWSA 3DTIA 3M8JA 4LG3A 1VZ0A 3DKXA 2KLOA 4LITA 1HA8A 4E7ZA 4XKWA 1DQUA 4XOTA 3HC7A 3PL8A 2X6YA 3K10A 1SAUA 3VYRB 4F91B 2NOJB 2E1MB 3VYTB 2WY7Q 5KHDA 5LD2C 2W1OA 4AYBA 2E1MC 2WAEA 3FKJA 2FUG2 2KRHA 2M7AA 2XF6A 4E7HA 3VDXA 5KCMA 3CF2A 2R4GA 1MMGA 2KQRA 2IGNA 5JHFA 1V5FA 5LFAA 2E5NA 3A4CA 2OUMA 3L2RA 2DOAA 5HNFA 2R7WA 1X4OA 2RNGA 2X1EA 3ZXSA 2R7SA 1TT0A 4CCLA 2DT7B 3AKZA 4HRIA 2E5ZA 2VXDA 4DBQA 2A5WA 3OMYA 2WAFA 2V7FA 2XSJC 4RMNA 5CKTA 4R79A 2GOMA 2UWMA 1YX5A 3CP8A 3QYEA 4OWRB 3OR2C 3OYAA 4XLHA 4B3XA 3OYNA 2LRDA 2UV1A 2VQHA 3DLAA 1Z7LA 3NWTA 2WB1A 4II3A 3KEYA 1BR4A 4E4HA 2MYSA 4EATA 3HPHA 2F6CA 4BUPA 2VPLA 2O5RA 4ZTFA 4HNTA 2UUZA 4KISA 3ZQQA 3SEZA 1N75A 2XF5A 2L9SA 2AQFA 3F9KA 3SYTA 3CZ6A 3I3LA 1D1AA 1ZELA 1YX3A 3DTKA 3BCAA 1BR2A 1FMVA 3HXLA 2CS3A 2KHMA 4E7IA 3BCBA 3L2QA 3M1CA 2Z1DA 3QYBA 2AQEA 4XLCA 3E1SA 4E7SA 2HU9A 4NUBA 2R7QA 4BE0A 2LBFB 1X1CA 2ZXIA 1YE9A 4BACA 3PFYA 2HZDA 4ZJZA 3ZRGA 2X51A 4XKBA 3K70C 2CFOA 3ZCOA 4BS9A 4XLFA 4CH7A 3VSLA 2RQQA 5CPRB 3OYGA 3QOEA 3VSKA 3DWLE 3BC8A 4JQFA 3OYKA 3IP4B 2OC6A 4B44A 4BDZA 4U87A 2HDWA 2LG4A 2R7VA 2K3PA 4X0GA 4AVZA 3K4LA 2IGMA 2IS1A 3DPUA 4C30A 4KT6A 4RM3A 4FETA 3LSHA 1QHHD 3DU6A 2WADA 4QPOA 4ZDPA 3FHNA 2CW8A 2L5QA 3SDBA 3CMMA 3RQ4A 2K5CA 3AFHA 4P5OA 1N77A 2Z2SB 1EA3A 3A2KA 2F5VA 1UELB 2LREA 3H5AA 1D0YA 2Q2EB 2VJ4A 4XORA 4XLAA 3HL2A 1BR1A 2ELJA 4Y33A 1UAAA 3K4BA 2V9KA 1ERDA 2I8DA 3OS2A 4OAYA 3OYJA 4XN0A 1G59A 3C2GA 4LIVA 2VQLA 3OYFA 2HQAA 3OIPA 2HVQA 4XN3A 4DOZA 2X1CA 3KX2A 2IS6A 2DXIA 1Y56A 4YEJA 1Y6IA 2MFZA 1T95A 3H9GA 1IRXA 3FBNB 4Y4RA 4AU7A 5HVQC 3LFUA 2M3AA 3EPZA 1R6RA 4KJZA 5FRMA 4C2TA 2P0WA 2VQCA 2PMZA 3G2BA 1DGRM 3IAS2 2XAUA 2VJ5A 2VL8A 4F92B 3LMMA 2R7TA 3DU5A 1J09A 1LKXA 4YELA 1Z21A 3LSMA 4XMYA 2HVRA 1MMNA 2QKMB 1DGWY 4XNFA 4PK4A 3BLYA 4ITVA 2BVLA 3K4MA 1D1BA 3LSIA 4ZDOA 3PNVA 3TMOA 4G6TB 4BJ6C 4IQ4A 3MKYB 4XR6A 3DEEA 4E6KG 4CCNA 5TGTA 3EUKL 2WAQA 2X6XA 1U0JA 3DPLC 4E7LA 4C9YA 3S3NA 1OR7C 4N4OB 2LC2A 3PSFA 2M7BA 3LL7A 1FMWA 2KRCA 2KP6A 1V5GA 1X4PA 4CCOA 4IX7A 4HNUA 3S93A 3PJRA 3LSKA 3AL0B 2LH9A 4RLFA 4N4NB 3OL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XF5 A;  2XF6 A;  2XF7 A; 
#chains in the Genus database with same CATH topology
 3ELK A;  4NB5 A;  3KP2 A;  1H89 C;  1PUF B;  3A03 A;  1TBX A;  1J2X A;  1A6Q A;  3HRS A;  1WPK A;  2EFN A;  4UY8 I;  4LOC A;  2DI3 A;  1QPI A;  3BZC A;  2BE5 F;  4QLC U;  2HI3 A;  3BZ6 A;  4BYY A;  2Y69 H;  3ASO H;  4L9N A;  3CCV I;  1FBS A;  2YU3 A;  3D5L A;  4GDF A;  4MFE A;  3LQR A;  3OY9 A;  1I39 A;  2JRM A;  1MKM A;  4U7B A;  3LFK A;  3CJR B;  2DN0 A;  1XD7 A;  2K40 A;  1T2K A;  2JJ7 A;  1R22 A;  1NG6 A;  4X6A J;  2HNH A;  4EQQ A;  4IL6 C;  1LFP A;  2L7K A;  4AIK A;  3I53 A;  2W25 A;  1R71 A;  4D7N A;  1QPM A;  3UR3 C;  2IXS A;  4KIG A;  2H27 A;  2M0C A;  5CVU A;  1WJE A;  2DA3 A;  5CQG A;  1ZYR F;  2LY2 A;  3EYI A;  2WTE A;  3PNY A;  5KNL A;  4EV0 A;  2ID3 A;  4ENM A;  2JTV A;  2HYF A;  4L9T A;  1WQ2 A;  1IN5 A;  3KPH A;  3O6B B;  5FRO A;  1B59 A;  1LFB A;  5AON A;  2L02 A;  1R4N B;  3FHZ A;  2ZSH B;  3FWE A;  3RZO J;  2COB A;  2VJI A;  1X1A A;  2ZNZ A;  1XGN A;  2P6T A;  2K7L A;  3OV8 A;  3W2A A;  1DP7 P;  2X85 A;  3PO2 J;  1T98 A;  3FDY A;  1ZGJ A;  3S32 A;  3C1D A;  5HDN A;  4BDY A;  1WHU A;  4HF1 A;  1ZKG A;  1RI7 A;  1DU6 A;  1YYV A;  3L2C A;  3KCC A;  2D2W A;  1ODD A;  5F0F A;  3ZQF A;  3H1C A;  3J81 K;  2XPU A;  4RGR A;  3GZ6 A;  4O5V A;  1QA6 A;  3OYD A;  1UZC A;  2NVX J;  2YX4 A;  2F5E A;  2EV6 A;  3LA7 A;  4QWQ A;  4G7H F;  4BAY A;  1F9N A;  1FOW A;  1KU9 A;  3PQJ A;  2L3D A;  2MAB A;  2R7Z J;  1HF0 A;  1SFK A;  4Q5S F;  2JUG A;  1JJ6 C;  1Y0N A;  2FA5 A;  2P5K A;  4B3A A;  4BGD A;  2M87 A;  3S3M A;  3W3C A;  4OU0 A;  1WVR A;  4RAG A;  2R7O A;  1R36 A;  4MLO A;  3MKZ A;  2VB6 A;  5FRN A;  4BHC A;  2V26 A;  3TO6 A;  2MA3 A;  1FSH A;  1E0E A;  4CDG A;  2L7Z A;  4Y13 A;  5FD5 A;  3CJT B;  2PMU A;  3ZGK A;  3GYH X;  3QPT A;  3R60 A;  2K9L A;  4WXD A;  2KIF A;  3WG7 H;  1U2W A;  2WBM A;  3ZMU A;  1TWC J;  4PJN A;  5E18 F;  3SZG A;  4CUG A;  1W7P B;  4AWX B;  2LYC A;  4KA4 A;  2HQN A;  1XTA A;  2L4M A;  2QM3 A;  1O57 A;  3SZP A;  4YRV A;  4AIH A;  2M0M A;  1SD4 A;  4AUX A;  2CV2 A;  1JT6 A;  2OJE D;  1WJF A;  3IH2 A;  3B6A A;  4L9V A;  4DBR A;  1FLI A;  1RET A;  2LFB A;  2E1N A;  4AD9 A;  2Z33 A;  4FE7 A;  2ZSI B;  4JOM A;  4A6D A;  4DQ2 A;  1XGM A;  2K9N A;  4QSH A;  2LOO A;  4DYQ A;  5EGO A;  1W4M A;  3MMY B;  5H20 A;  3BWG A;  2CQ7 A;  4S04 A;  3DP7 A;  3ZQG A;  4P96 A;  3TP0 A;  1C0W A;  2MLK A;  3QOP A;  2FQ4 A;  2A68 F;  3FK7 A;  3RI4 A;  1O3T A;  4XQF A;  1O7L A;  3K6G A;  2GXA A;  5L3C A;  5DYM A;  2OBP A;  5KAF C;  4G9Y A;  1B9M A;  1ZG5 A;  4DYC A;  2DT5 A;  2EV5 A;  5CYV A;  3EQL F;  5CVV A;  3HKZ A;  3LAP A;  1F5T A;  4RM2 A;  4J00 A;  3IC7 A;  1SC7 A;  1M1E B;  1IN8 A;  1YW7 A;  2COM A;  3HOT A;  3OS0 A;  3HOY J;  3OOP A;  3F8C A;  4XON A;  2ZME A;  3OR1 C;  3PUB A;  2JMW A;  4GXO A;  5HDK A;  4N9I A;  2PFB A;  1S72 I;  3HM5 A;  1QQI A;  3KP4 A;  2QKL B;  2FEZ A;  3WTV C;  3JRG A;  5HLT A;  2R5Z B;  2QBY A;  1QZE A;  2FF4 A;  3K1N A;  1WH7 A;  1SVO A;  3ML6 A;  1O3S A;  1YIO A;  2XPW A;  5J1R A;  5J8C A;  3BT9 A;  5D5U B;  3GX4 X;  2DA1 A;  2DFI A;  1TWH J;  1SD7 A;  4I01 A;  5FLM J;  4M6X A;  4UVC A;  1FOX A;  4GRI A;  4NC7 A;  4LB6 B;  3AG3 H;  3TO7 A;  4RA2 A;  4UUV A;  5K5O A;  1JKR C;  3GTM J;  5EEH A;  1MBH A;  1R23 A;  1DP3 A;  2VC1 A;  4MNU A;  4KIT B;  1P7I A;  4CZC A;  3W6K B;  4E7J A;  2H6B A;  1SFO J;  3FXU A;  1V5E A;  3HBL A;  3I71 A;  4O3M A;  5LRR A;  4QPQ A;  3V8J A;  1WJB A;  3OYM A;  2OQG A;  4A3K J;  2KIS A;  1ZQ3 P;  2L54 A;  4EGY A;  1WJD A;  3V42 A;  3GZ5 A;  3SEQ A;  5FKL A;  4UB6 C;  1VZ0 A;  1SEU A;  5DUI A;  3MZH A;  1A36 A;  3FXJ A;  4LIT A;  4HBL A;  1EH7 A;  4FQG A;  2NVY J;  4E7Z A;  4XKW A;  5DCM A;  3GLL A;  2X6Y A;  2HEO A;  3K10 A;  3HHG A;  2EH3 A;  3UKG A;  2DTR A;  2GZW A;  2NOJ B;  3TP3 A;  2WY7 Q;  2XVC A;  5J40 A;  1WWX A;  1E3P A;  1U5T C;  2F5F A;  2W1O A;  2ESN A;  2MG4 A;  2HTS A;  2QA4 I;  2PLY A;  4E7H A;  2BY3 A;  4IEJ A;  2M8G X;  1IGN A;  1B6A A;  4G6Q A;  5D8K B;  2W84 A;  4Y17 A;  2IGN A;  3KIO A;  2L9V A;  3FM3 A;  2E5N A;  2MW8 A;  4BBR J;  1IUY A;  3P9C A;  3MWM A;  2FX0 A;  1UB9 A;  4DZJ A;  2R7S A;  1HW1 A;  1TT0 A;  4CCL A;  4BXX J;  4FCY A;  3P7N A;  4HRI A;  4IRI A;  4A3I J;  2WV0 A;  2E5Z A;  4FX0 A;  1CQT A;  5E3O A;  4DBQ A;  1X2N A;  2V7F A;  1S6L A;  3BR2 A;  2XSJ C;  2XAH A;  4R79 A;  4M3G A;  1LNW A;  5L3B A;  1YX5 A;  3H3U A;  1MDM B;  1ULY A;  4OWR B;  4M74 A;  3BG3 A;  1LQ1 A;  5H6Q A;  4XRS G;  3BJA A;  3I4P A;  2UV1 A;  2WB1 A;  1ZK8 A;  3NEU A;  2M1B A;  5IOZ A;  1YW9 A;  1BI3 A;  4BUP A;  1IXC A;  3SFZ A;  3M4O J;  4ZTF A;  3DBH B;  4ZYG A;  3CC2 I;  1N75 A;  1SMY F;  1RR7 A;  5DV5 A;  3F9K A;  1ZHF A;  3CZ6 A;  3RKW A;  1UJ8 A;  1YX3 A;  4BY1 J;  1RPW A;  2CS3 A;  5TIS C;  3L9F A;  1FOK A;  3L2Q A;  1IN7 A;  3M1C A;  2K02 A;  3QYB A;  4RDU A;  4Y52 J;  4XLC A;  1I6X A;  5HLI A;  4HV6 A;  3WTW C;  3ZQC A;  1ZH5 A;  1VQM I;  5ILS A;  1APL C;  3G6E I;  5EZG A;  3I55 I;  1YE9 A;  4BH9 A;  2EFW A;  3HJE A;  4C3H J;  1ZTR A;  1ZR2 A;  3PFY A;  5GPA A;  4ZJZ A;  1ZAO A;  3ZRG A;  1NK3 P;  5D5W B;  3K70 C;  2LP0 A;  3EYY A;  4BS9 A;  4IHT A;  3KET A;  1DDN A;  3FIW A;  2RQQ A;  5CPR B;  5JLW A;  1MJ9 A;  4XRF A;  2CQX A;  1FTT A;  2E2I J;  3IP4 B;  1T39 A;  1YLF A;  1WI9 A;  4UVA A;  1DPR A;  2K9Q A;  2HTJ A;  5BOX A;  4U87 A;  3F6V A;  1LPQ A;  2JT1 A;  5GAE J;  3K4L A;  2IT0 A;  1Y1W J;  2MBF A;  3J7Y J;  3GVA A;  5J4Y A;  5IT9 Z;  2GA1 A;  3DPU A;  4GCV A;  2BEO A;  1T8I A;  1EF4 A;  4KT6 A;  4RM3 A;  1D8J A;  4KIC A;  3LSH A;  5F0H A;  2WAD A;  4QPO A;  3WTT C;  3E3V A;  3QAH A;  3RKX A;  3SDB A;  1YIJ I;  2VBX A;  2ADU A;  3ERM A;  3AAF A;  2XAS A;  2XUB A;  2QUF A;  1D0Y A;  4HF0 A;  3HOZ J;  2KDZ A;  3MVP A;  1F43 A;  3ZPL A;  3FIS A;  3QP5 A;  1UAA A;  3BP8 A;  2AXT C;  2I8D A;  5FO5 A;  3ZQL A;  4K2E A;  1BJZ A;  2QYO A;  3WHC A;  4LIV A;  2VQL A;  2ZJP F;  2HVQ A;  4WF2 A;  4XBF A;  3G1M A;  2VOP A;  2MFZ A;  1T95 A;  3H9G A;  4AU7 A;  2Q2E A;  3A01 A;  2M3A A;  1SD6 A;  3CUQ B;  2M30 A;  1R6R A;  2PMZ N;  3S16 J;  3CMA I;  5FRM A;  3K9T A;  4Z2Y A;  4J19 A;  5L3F A;  3M1E A;  1WH5 A;  5GAH J;  1AU7 A;  3LMM A;  2EIK H;  3O8G A;  1J09 A;  1LKX A;  1KA8 A;  3BPX A;  2LKX A;  1UG2 A;  4KIF A;  3CCU I;  2DFE A;  2EIJ H;  1DGW Y;  1ZG3 A;  1FNN A;  1B72 A;  3BLY A;  4ITV A;  5K5Q A;  2BVL A;  1V4R A;  3K4M A;  3KYC B;  5GTI C;  1S7O A;  1TWF J;  1FP1 D;  3PNV A;  2KIQ A;  4PGH A;  3CJN A;  4BJ6 C;  4CGZ A;  2VE8 A;  3DEE A;  2ECC A;  1H88 C;  1O4X A;  3BR0 A;  5TGT A;  2ISY A;  2VC0 A;  5GAD J;  4E70 A;  2O8X A;  3BR1 A;  2X6X A;  1FSE A;  4PGG A;  5J4V A;  4RAF A;  1AHD P;  3S1M J;  3S3N A;  4NHJ A;  2FJ1 A;  3C7J A;  1VQN I;  1OR7 C;  2P5V A;  3PSF A;  1J5Y A;  4YIF A;  2H94 A;  2FBK A;  3ZMT A;  1F4K A;  2HOE A;  1T38 A;  4A3C J;  2EV0 A;  3FMQ A;  1YRN B;  1W5T A;  3PJR A;  1QZY A;  1QVT A;  2XSD C;  4N4N B;  3OL3 A;  1TQP A;  3ABT A;  3CP2 A;  4KT5 C;  1PDN C;  4Z6Y A;  3NAR A;  1TQI A;  3RPU D;  2VOD A;  1V3F A;  3FBI B;  4DYR A;  3D1N I;  4CHU A;  4HG2 A;  2CH0 A;  1TNS A;  3CCL I;  2M9H A;  2XHK A;  4PJL A;  1FYL A;  1K7A A;  1IG7 A;  3GZN B;  2NVQ J;  4ZYD A;  1WGX A;  4ESF A;  3RPQ A;  5IYB J;  1S3J A;  2OV7 A;  2MC3 A;  1IAW A;  1BI1 A;  4EJO A;  1DUX C;  1PUF A;  1D3Y A;  3HHH A;  4RGS A;  2QEN A;  1D5V A;  2O61 A;  4NDL A;  3M9A A;  2JZY A;  2M4K A;  2HQ5 A;  2A6T A;  2NXN B;  1SMT A;  3RYR A;  2KIU A;  3H5N A;  4HPQ A;  1J75 A;  2DMU A;  2E1O A;  2QWW A;  2X4H A;  2E34 A;  2E7X A;  2PJR B;  3GBG A;  3BZK A;  1HW5 A;  3LA2 A;  2BW3 B;  1IO2 A;  4OIN F;  3E0J B;  4JP0 A;  3I9V 2;  3G4S I;  3ZP5 A;  2VBZ A;  1JGS A;  1IRZ A;  2B9S A;  3AG4 H;  3O8H A;  3PFI A;  1WZ2 A;  4YII A;  4P1W A;  2OCE A;  4UVB A;  4XKV A;  4U7D A;  1HST A;  3J7Z I;  4PUS A;  1NHA A;  4A2U A;  2K85 A;  4PJM A;  3HTS B;  3EUH A;  1KU3 A;  3HGG A;  2BVM A;  5D8L B;  3BG7 A;  3WG9 A;  3CC7 I;  2E71 A;  3BQZ A;  4XLE A;  1X1B A;  3OOU A;  1GV2 A;  4CCM A;  2HPM A;  2IAI A;  3KYL A;  3S2H J;  1P2F A;  2IS2 A;  2X1D A;  4HDU A;  2BY1 A;  3P5J A;  5JLX A;  4R8H A;  2JA8 J;  5E3N A;  4DZP A;  3TL4 X;  4NBQ A;  2GOX B;  2DJI A;  2EZK A;  2XAF A;  1MD0 A;  1T0F C;  1MMS A;  1U9N A;  1EJ9 A;  2RRE A;  2ZJ2 A;  3UNG C;  1B72 B;  3MCZ A;  3K70 D;  4B48 A;  4DJA A;  5A2Q Z;  4BBS J;  4HLY A;  2V1U A;  1YOV B;  1UCR A;  5IYD J;  4R1H A;  5E1X A;  1SFX A;  3H35 A;  3HOU J;  3K4N A;  4EJV A;  2YUS A;  4UB8 C;  3VFZ A;  3GTP J;  1YJ9 I;  3IRQ A;  3R0J A;  2P7C B;  1H9G A;  3LQQ A;  1VQ8 I;  5F0C A;  1MH3 A;  3IKV A;  5HOO A;  1RES A;  1E3H A;  1OCP A;  1HKS A;  5FLX Z;  3JRI A;  2D1H A;  3ZMD A;  4YFN F;  2OAZ A;  2IVM A;  1NK2 P;  3J7A Y;  2VXZ A;  5F64 A;  1S5L C;  2DMN A;  4L9J A;  1SAX A;  1BC7 C;  4KFC A;  3SQN A;  2IA0 A;  1Z3X A;  2P6S A;  2WA0 A;  1MW7 A;  4JK1 X;  2XC7 A;  3D5R C;  1HXD A;  5F27 A;  3CDI A;  4BKX A;  1VTN C;  3DPT A;  4F52 A;  1W7P A;  5L3E A;  4IHV A;  1XSX A;  2XRO A;  2V6E A;  4EM2 A;  2W82 A;  1XMK A;  3F21 A;  2ECB A;  1VQL I;  2K9M A;  1O3Q A;  1FWZ A;  1GXQ A;  3ZR8 X;  5B66 C;  3DF8 A;  1K61 A;  4H4K C;  2L01 A;  3GTJ J;  3LNQ A;  1EKE A;  4XLN F;  2X9D A;  4LIU A;  4C2M J;  3RCO A;  3CO7 C;  3BTJ A;  2QQB A;  3GUD A;  1TZL A;  4PJJ A;  5HNH A;  3OS1 A;  2JA5 J;  1HCR A;  1TWA J;  3AG2 H;  4CO8 A;  2Y0S N;  1EH8 A;  2K9S A;  3JRE A;  2W85 A;  3OYI A;  1G8X A;  3J7A O;  1TQM A;  2EJR A;  2DBB A;  1OKR A;  3TOB A;  3O3K A;  3K2Z A;  3TW7 A;  4BU2 A;  4Y3O A;  3OYB A;  1J0R A;  3H0D A;  3Q5F A;  4IO9 F;  1R1T A;  1W36 D;  3F3X A;  3S17 J;  1JHH A;  2ZB9 A;  3F72 A;  3PQK A;  5LGU A;  2BHZ A;  2KZV A;  2LY1 A;  3KP3 A;  5FKN A;  1VQ5 I;  2KJC A;  1ETV A;  1X19 A;  3ZN0 A;  1D0Z A;  2VKV A;  2NAZ A;  2P5L C;  2IRF G;  4H0E A;  3W2W A;  2EZL A;  3MD2 A;  2XF7 A;  2DLL A;  1JKO C;  2M4G A;  2L7M P;  1G3S A;  3OYC A;  4WX9 A;  4DNC A;  2R92 J;  1N78 A;  5J47 A;  4V2F A;  1PYV A;  2LBF A;  3MKW B;  2R5Z A;  4BE1 A;  3WGH A;  1ZLK A;  5KK1 A;  2AS5 F;  3QQA A;  4FIS A;  4UUT A;  1VQ7 I;  1WKM A;  3KZY A;  1U3E M;  1QU3 A;  1XX5 A;  2VPR A;  2DMT A;  4A5M A;  4OIQ F;  1HSJ A;  5B5E C;  3HRU A;  1RKW A;  4U0W A;  5ICF A;  4C3J J;  4PDK A;  3S8P A;  4E7K A;  4MEX F;  5ILU A;  3L2U A;  5D4S A;  2CMP A;  2Q1Z B;  5F6F A;  1ONV A;  2DYS H;  4RLQ A;  4XL9 A;  1UHS A;  2RNJ A;  1VQ9 I;  1UG0 A;  3I4M J;  3IWZ A;  4D9J A;  5LEK A;  1ITY A;  3JCU C;  4HX8 A;  3NWS A;  3I4N J;  3M8J A;  4LG3 A;  1K79 A;  5E20 A;  4IHY A;  2KLO A;  2L4A A;  2R7F A;  1BN5 A;  2ID6 A;  3JTH A;  4EM0 B;  1XGS A;  1WI3 A;  1IC8 A;  2FBH A;  1IW7 F;  3HOV J;  1MJA A;  1XSV A;  3F8B A;  5EEG A;  3M8F A;  1DQU A;  2TRT A;  3KEQ A;  4A3G J;  1SD5 A;  3QP6 A;  4UV9 A;  2HS5 A;  2GBY A;  2EK5 A;  2H1L A;  2OA4 A;  4F91 B;  1U5T B;  2DMP A;  3VYT B;  3JTG A;  1VQ4 I;  4AYB A;  2H1K A;  5FGM A;  3BTC A;  2HQR A;  2F5C A;  2FUG 2;  3REO A;  2M7A A;  1OCO H;  4F7Z A;  1JUP A;  2R4G A;  3LA3 A;  1CGP A;  3AG1 H;  1MMG A;  1ETK A;  1KGS A;  3D0S A;  3SJM A;  5JHF A;  1V5F A;  1JUS A;  1PP7 U;  3K7A J;  1JTY A;  4N9H A;  3BTL A;  5HNF A;  1XC5 A;  4HW0 A;  1XCB A;  2MSY A;  1HLV A;  1AOY A;  1X3U A;  4MFD A;  3ZXS A;  4A3M J;  2D5V A;  3ZQH A;  2DT7 B;  3AKZ A;  2W24 A;  3QU3 A;  5E17 F;  4MTE A;  3WTS C;  3OMY A;  1HQC A;  2WAF A;  1MBG A;  1ACI A;  5CKT A;  2ICW G;  5KVR A;  2O3F A;  3JRB A;  1U78 A;  1MBE A;  3OR2 C;  5DM6 F;  4II3 A;  1Z7L A;  1VF9 A;  4RB2 C;  1G3T A;  4A0Z A;  1RZ4 A;  2O5R A;  3KE2 A;  1G3Y A;  3SEZ A;  2EA4 A;  3RQI A;  1IJW C;  2XF5 A;  4IPA A;  3JRC A;  2L9S A;  4MQV A;  2FU4 A;  1T08 B;  4W1U A;  4OMY A;  1GXP A;  1OYW A;  3GFL A;  5IOY A;  1ZEL A;  4WWC A;  1MDM A;  3QPS A;  4ABZ A;  1Z77 A;  2KHM A;  3WTZ A;  4ENK A;  4CYC A;  3S14 J;  1XMX A;  2A6E F;  2Y31 A;  3OSG A;  4EMS A;  2M2E A;  5TJJ A;  3ULQ B;  1XGO A;  2V1X A;  1E17 A;  2FNP A;  3MZ8 A;  3E1S A;  2VON A;  2VT3 A;  2HU9 A;  4NUB A;  4E7S A;  2LBF B;  5DD8 A;  3P9I A;  4OOI A;  3ROU A;  4BAC A;  1FIP A;  3GFI A;  1G4D A;  3GTK J;  4KIB A;  2R0Q C;  1FEX A;  3E5Q A;  5EJC A;  3GXO A;  2CFO A;  1R1U A;  3ZCO A;  5M5Y J;  4XLF A;  3JSP A;  3VSL A;  3CCQ I;  2H6C A;  4V2G A;  3VSK A;  2HZT A;  4A3J J;  4L5J A;  5CVJ A;  3BC8 A;  4XSZ F;  3TQN A;  2V9V A;  4JQF A;  3OYK A;  4MEY F;  2OC6 A;  4BDZ A;  2NNN A;  3WHB A;  2DO7 A;  2HDW A;  2R7V A;  5B3S H;  3G73 A;  3M3Y J;  4M6Y A;  1BW6 A;  2EIM H;  4MQ9 F;  1KYW A;  2FML A;  2NYX A;  4C30 A;  2DOF A;  2YPR A;  3NRV A;  2CG4 A;  4FET A;  1SVM A;  3LAJ A;  1Y8R B;  1E3O C;  4PCQ A;  3DU6 A;  3A0H C;  1MJB A;  4ZDP A;  2D45 A;  2O8K A;  4GYI A;  2AXL A;  3CMM A;  3FXL A;  3RQ4 A;  4EM1 A;  3T1B A;  1RKT A;  4P5O A;  5J3L A;  4D5C A;  5H2F C;  5HLG A;  2FBI A;  1N77 A;  3HSF A;  3R0A A;  3FXM A;  2Z2S B;  2EPF A;  2A69 F;  3F0C A;  1UEL B;  1ZRC A;  2LRE A;  2X0L A;  5HLH A;  1B1B A;  3H92 A;  1P92 A;  1R5G A;  1X2M A;  5FD6 A;  1HW2 A;  5CLS A;  3E7L A;  2XRL A;  4A6E A;  1AWC A;  3DBR B;  2LH9 A;  4P9F A;  4P9U A;  4YG2 F;  2RC4 A;  2ELH A;  1CF7 A;  3OYJ A;  2Y9Z A;  1G59 A;  2HGC A;  2BY2 A;  2MD5 A;  5E3M A;  5D5X B;  4B09 A;  3OIP A;  2IS6 A;  4G6D A;  5K7Z A;  1Y6I A;  2HXO A;  4I99 C;  3DCF A;  1IRX A;  2NNY A;  2HR3 A;  2Y9Y A;  2Y48 A;  5KAI C;  4A3F J;  2A61 A;  4IVN A;  4MGR A;  2ISZ A;  4IHW A;  2VQC A;  1JE8 A;  3G2B A;  1DGR M;  3IV5 A;  3RYP A;  3IAS 2;  1ZRD A;  4YFX F;  4F92 B;  1VQ6 I;  3HZJ A;  2BHY A;  4YEL A;  1Z21 A;  2KIM A;  3LSM A;  2HVR A;  1MMN A;  2QKM B;  4LMY A;  4XNF A;  4W97 A;  1FPQ A;  4A3B J;  3LSI A;  1PUE E;  1SVL A;  3V4G A;  2E19 A;  3CUQ A;  4IQ4 A;  3MKY B;  4XR6 A;  3CQZ J;  3JSO A;  5ICE A;  1JHF A;  2WAQ N;  4ZYE A;  4CYC B;  3H3V K;  2OD5 A;  2JQ7 A;  3ABK H;  1V54 H;  4C9Y A;  5K7F A;  2R7D A;  1JJ8 C;  2GIZ A;  3TKY A;  3GWZ A;  2KP6 A;  3R4K A;  1TW2 A;  4XK4 A;  4HV5 A;  2LVS A;  3HRT A;  5E79 C;  4CCO A;  2F2E A;  4IX7 A;  4A93 J;  1TLH B;  2DMQ A;  1VQP I;  2VI6 A;  1UHM A;  2IPQ X;  1FBU A;  3CF5 F;  2YR2 A;  4I7H A;  3K69 A;  2Z9O A;  1MMA A;  4BJT A;  4BE2 A;  1D1C A;  1LFU P;  3U1K A;  1FX7 A;  3ABL H;  5FJ8 J;  1KQ0 A;  4WK8 F;  2IW5 A;  1YJN I;  3GFM A;  2KL4 A;  1G6N A;  1FYM A;  3IUO A;  5K7H A;  1YS7 A;  1W1W E;  2JVH A;  2VKH A;  2X6W A;  4LK0 F;  4XOP A;  1BL0 A;  1KYZ A;  4U88 A;  1BOA A;  1YRN A;  5FKM A;  3L2V A;  3CMY A;  2QF7 A;  4WXH A;  3HGY A;  4FAS D;  5HS7 A;  2XV4 S;  5F1R A;  2VT2 A;  2VIX A;  5EDN A;  4M6V A;  2LY9 A;  2PJP A;  2W00 A;  1B8I B;  1QGP A;  4EGZ A;  2E2H J;  1WJA A;  2JPB A;  2XPV A;  1OCC H;  2XDV A;  2LMD A;  2CFX A;  2QQA A;  3Q9S A;  4HST A;  2JSP A;  4FTH A;  2RV8 A;  2HDC A;  4IXA A;  2AHQ A;  2Z16 A;  2R7R A;  3DLL F;  1IF1 A;  5GPC A;  3RKY A;  1K78 B;  1BJA A;  1JKQ C;  2XKP A;  1ON2 A;  3U1D A;  5DDG A;  1XPX A;  1K83 J;  1FYK A;  3ZMV A;  2K86 A;  2NS0 A;  6PAX A;  4NQW A;  4BXU A;  4BEH A;  4KYW A;  2DT6 A;  3T8R A;  3C3W A;  2HXI A;  1CF7 B;  4PZJ A;  4LGW A;  3TED A;  1R58 A;  2KDO A;  3CTA A;  1AKH B;  1Q1V A;  2RN7 A;  4G7O F;  3MQ0 A;  2PJR A;  4LG0 B;  2F4M B;  4MO7 A;  1FY7 A;  2BW3 A;  1MND A;  2LK2 A;  1L3L A;  1GLN A;  1X3Z B;  5EF6 A;  3SXY A;  5CJ9 A;  3IH3 A;  1KU2 A;  2Z99 A;  2XGC A;  5AIP A;  3U21 A;  1HKT A;  4IOA F;  4G94 A;  1YQA A;  2W4S A;  3GME A;  4II2 A;  2I5U A;  3ESW B;  1DPU A;  5E1W A;  1T56 A;  2L9N A;  3VYS B;  1P7J A;  5BS6 A;  3FM5 A;  2Y30 A;  5GTH C;  2ZXW H;  3HSE A;  3KFW X;  3TDZ C;  3CC4 I;  1QO0 D;  4MHG A;  2VLA A;  3L2W A;  2G9W A;  2M45 A;  4BHB A;  4BXF A;  1VND A;  1PVE A;  1ZAR A;  2LD5 A;  3J80 K;  1ETX A;  3E6M A;  4BQO A;  2ME6 A;  5E3L A;  3W2V A;  1MSF C;  1YS6 A;  3FXQ A;  4I0A A;  4L5I A;  2CYY A;  1Y39 A;  1MMD A;  2NOG A;  5C3E J;  1WJC A;  3CJQ B;  1QVU A;  5ICG A;  1W36 C;  4A3E J;  1ZR4 A;  3VPR A;  4KUM A;  5J6X A;  4NC8 A;  2DK5 A;  4V19 K;  4D1Q A;  3LOC A;  3D5S C;  3EUA A;  1WCM J;  2ETH A;  3K4J A;  3JAM Z;  4M71 A;  4RGX A;  2VKE A;  2BV6 A;  4LD5 A;  1H9T A;  5HS9 A;  2DJN A;  3E5X A;  4A5N A;  5ICC A;  2JA2 A;  3GW2 A;  2HPI A;  2CW0 F;  3H9J A;  2EA2 A;  2RGV A;  4X1E A;  4CA0 A;  3HDD A;  1NH3 A;  1JI8 A;  1GT0 C;  2B0L A;  2CW7 A;  3OIO A;  3OL4 A;  4I98 B;  1OPC A;  1JGG A;  1U9O A;  2VE9 A;  2OZU A;  1Z3Y A;  2CUF A;  3JRA A;  1OCR H;  2CU7 A;  2LTP A;  3OYL A;  1P9Q C;  1IN4 A;  2XGX A;  4OIP F;  3HIF A;  2ZME C;  1BI0 A;  1A5J A;  5LHI A;  1F1Z A;  4JX4 A;  5FKK A;  3QYF A;  2VQG A;  2VBW A;  1USS A;  3HKZ N;  4A3L J;  3HEF A;  3BR6 A;  4PJ0 C;  1FIA A;  1YHQ I;  3CES A;  2ZFW A;  3DTE A;  3QRF F;  2H8R A;  2OTJ I;  3L1P A;  1P6R A;  2M8E A;  3I64 A;  4C2U A;  4UNO A;  4U0V A;  1H8A C;  2CJJ A;  1FP2 A;  3FX3 A;  3K2A A;  4EJT A;  4UXN A;  3GTQ J;  2P4W A;  5E8G A;  4ZDL A;  3Q0V A;  2CV1 A;  4NQW B;  1OJL A;  4BEH B;  4QTR A;  3PO3 J;  4ESJ A;  5BPI A;  1FT9 A;  2IEK A;  4WXC A;  1W7P D;  1I1S A;  2MC4 A;  5IP6 A;  2PI0 A;  2XRN A;  2MH9 A;  2PMH A;  2L0K A;  4XLP F;  4IHX A;  1WSU A;  1FJL A;  1EV7 A;  4O6J A;  2R7U A;  1MNE A;  1S7E A;  3HUG B;  9ANT A;  1LVK A;  2M5W A;  3CDH A;  2HVS A;  1G2H A;  1UMQ A;  1ZRE A;  4L0Z B;  3OYH A;  5EZH A;  5B1B H;  2KKO A;  4Q47 A;  1KZH A;  3V8K A;  2CV0 A;  4PSW A;  3BTI A;  1GHC A;  4PSX A;  5GP9 A;  5FKO A;  4MIM A;  2G0E A;  5CVR A;  2OZ6 A;  2OTL I;  3ABM H;  2DA2 A;  2JPC A;  1LEB A;  2E35 A;  3ZMS A;  1U6G A;  1XN7 A;  2CRG A;  4PFP A;  2X6O A;  2K3F A;  3BRO A;  3NAU A;  4QIW N;  2VN2 A;  2P81 A;  3FXK A;  5EG0 B;  3DKX A;  4A0X A;  3BDD A;  1HC8 A;  1JXS A;  1LE8 A;  5H6R A;  2QEX I;  1FZP B;  3QWL A;  1OYY A;  2A5Y B;  2ESH A;  3BG9 A;  4GYG A;  1A31 A;  2PX9 A;  5JI6 A;  1SAU A;  1S7A A;  2GA2 A;  1QNT A;  5CVI A;  5ERI A;  3VYR B;  4B1R A;  1RNL A;  3FZV A;  1YFH A;  2DFH A;  1Z67 A;  4BQA A;  2E1M C;  2DQL A;  2WAE A;  3DFG A;  3FKJ A;  3VOD A;  2Q0O A;  4LK1 F;  2XF6 A;  1Z9C A;  1JKP C;  5ED4 A;  4IHS A;  3VDX A;  2JA7 J;  5KCM A;  3CF2 A;  3W6V A;  3LST A;  3WU0 A;  4A3D J;  2G7U A;  2KQR A;  2HOT A;  3WGI A;  3A4C A;  2OUM A;  3L2R A;  2HYJ A;  1I1G A;  2DOA A;  2KFD A;  1I6H J;  1BA5 A;  2ZBK A;  2R7W A;  5JFR A;  3FMR A;  2FSW A;  2R3S A;  5DM7 F;  1B4A A;  1U5T A;  2X1E A;  4ZYH A;  1RC9 A;  5FFZ A;  1YIT I;  2XKO A;  4ZZL A;  2VXD A;  1K6O A;  5ILV A;  2R5Y A;  1J7K A;  1TP4 A;  3FMS A;  2DOD A;  2KZG A;  5LBQ A;  3DEW A;  1MH4 A;  2FOW A;  2PEX A;  2UWM A;  2K4J A;  1IV8 A;  4CIC A;  1ZN2 A;  4CYD A;  3MEX A;  5IYC J;  3I5U A;  5B1A H;  2WB1 N;  5J1Y A;  3LSR A;  4B3X A;  2F5D A;  3OYN A;  1IZ1 A;  3DLA A;  4IJA A;  2V1D A;  3NWT A;  4BY7 J;  3IHU A;  3KEY A;  1BR4 A;  4E4H A;  2MYS A;  3L00 A;  1YO5 C;  3S1Q J;  1B9N A;  3DXJ F;  2F6C A;  3B73 A;  4M3B A;  2IJL A;  2VPL A;  4D0P A;  2ZCW A;  4HNT A;  1RUO A;  3ZQQ A;  1Q1H A;  4HA8 A;  1L0O C;  3CCS I;  3B6C A;  2ZC2 A;  4I02 A;  3RIR A;  2N8G A;  4OIR F;  2GXB A;  1HOM A;  1BR2 A;  2BGC A;  1OCT C;  3KZI C;  1R4M B;  2CQN A;  2JRT A;  3BCB A;  3SHF A;  2HOA A;  1Y0U A;  5EEA A;  4G12 A;  1TC3 C;  2QSH X;  3E97 A;  4Y15 A;  3Q9V A;  3GTL J;  1EH6 A;  4XRM A;  2R7Q A;  4BE0 A;  3CCR I;  1X1C A;  3BQY A;  5HS8 A;  2ZXI A;  3V7C A;  2YU9 J;  3CUO A;  4ZH4 F;  1MIJ A;  2HZD A;  1IDZ A;  2CGP A;  5C4X J;  2P7V B;  3ECO A;  1A6I A;  2X51 A;  3SDG A;  1A04 A;  1O7F A;  5DEQ A;  1YW8 A;  4TV7 A;  3DWL E;  4HQM A;  3C2B A;  1VQK I;  4B44 A;  1MBK A;  2PQ8 A;  2DA5 A;  4ASN A;  3V8L A;  5D5V B;  1LE8 B;  3TO9 A;  4LFU A;  3HTU A;  2LG4 A;  2K3P A;  5LRS A;  2HOS A;  1MBJ A;  5LHH A;  4X0G A;  4AVZ A;  1Y1V J;  2IGM A;  2IS1 A;  5D4R A;  2GAU A;  1ETW A;  3FKI J;  1S8N A;  3CCE I;  1RRJ A;  2XGD A;  1QHH D;  1ZLJ A;  3KP7 A;  2KT0 A;  2CW8 A;  1SFU A;  4OIO F;  3JRF A;  5JVG F;  2K5C A;  2UXN A;  2PG4 A;  4EEF G;  3PIO F;  4RB3 C;  2EBI A;  3A2K A;  5GAG J;  3ZQ7 A;  4S05 A;  2V9P A;  2VJ4 A;  4HLX A;  4M3E A;  4ZZD A;  3B02 A;  4XOR A;  1UFM A;  4XLA A;  1BR1 A;  2ELJ A;  3CLO A;  2KRF A;  5F08 A;  3K4B A;  1TWG J;  2DDB A;  2V9K A;  3F8F A;  4EVI A;  5FLV A;  2FOK A;  3RDI A;  1HDP A;  3CCM I;  4HDV A;  4NC6 A;  1R7J A;  3C2G A;  2DU9 A;  2BBY A;  3OYF A;  2HQA A;  2O03 A;  4XN3 A;  2DPU A;  2R5Y B;  2X1C A;  2LLK A;  2DXI A;  2V79 A;  4YEJ A;  1OMI A;  2C6Y A;  4HAM A;  2EIN H;  3CCY A;  3P9K A;  2XAG A;  4A0Y A;  5HVQ C;  1ETO A;  3EPZ A;  1HBX G;  1GDT A;  2B63 J;  4C2T A;  2P0W A;  2PMZ A;  2ZNY A;  2EZH A;  3LSJ A;  2LR8 A;  2XAU A;  1G3W A;  1GVJ A;  4BHP A;  1BM9 A;  1JT0 A;  3MKL A;  2L9R A;  3EET A;  4RAZ A;  3O2P E;  3GFJ A;  4XMY A;  1IRF A;  3F6O A;  4P55 A;  2WWY A;  2O0Y A;  4PK4 A;  2DQR A;  3HSR A;  4DW6 A;  5M3F J;  5IT3 A;  1ZGW A;  3S2D J;  1YG2 A;  1D1B A;  1ETQ A;  2L7F P;  4KN7 X;  3TMO A;  2FE3 A;  3M7G A;  4RB1 A;  3I56 I;  3ZMZ A;  2STT A;  3I54 A;  2GM4 A;  1ETY A;  1U0J A;  2EB7 A;  2QQ9 A;  3DPL C;  2QVO A;  4E7L A;  3N97 A;  2EQR A;  1PP8 F;  3Q0W A;  1D8K A;  3EDP A;  2DOE A;  4HQE A;  2DA7 A;  2LC2 A;  2M7B A;  5K1Y A;  3E6D A;  1V5G A;  4M9Z A;  2D1V A;  4HNU A;  3S93 A;  3Q0U A;  3KLO A;  1W0T A;  3LSK A;  3QU6 A;  1SFE A;  1YTY A;  4RLF A;  4L0Y B;  3AL0 C;  3MZY A;  2CSO A;  3WU2 C;  1X3W B;  5JHU A;  1OFC X;  3HPG A;  3F8N A;  4I2O A;  4CXF A;  4S0H B;  1OYI A;  1STZ A;  4JBA A;  1OR7 A;  5LGT A;  2IBD A;  2MLG A;  5D6F A;  2IA2 A;  2IP2 A;  3PIP F;  2LF8 A;  3T0Y A;  3W6J B;  2ZKZ A;  4ENJ A;  1R49 A;  5TRD A;  1I5Z A;  1YJW I;  1V55 H;  2LKS A;  1R5I D;  1BBY A;  3U2R A;  1MSE C;  4M72 A;  2E2J J;  1S29 A;  2JK3 A;  3E6B A;  5C4J J;  2DDA A;  1FC3 A;  1BW5 A;  3KLN A;  4A69 C;  2NRA C;  2K4B A;  5J8F A;  4IQJ A;  2WC2 A;  3DKY A;  4EJW A;  2KJB A;  3FF5 A;  5FB2 A;  3JW4 A;  3H9Q A;  5JR3 A;  3C2H A;  2O6G E;  1Z91 A;  3RKQ A;  3BG5 A;  2Y75 A;  4I6Z A;  3WTX C;  3OWT A;  1W5C C;  4F55 A;  3ERE D;  1IRG A;  4UV8 A;  2HDD A;  3EUH C;  4ETS A;  3BR5 A;  3J81 Z;  1VQO I;  1B8I A;  3Q3S A;  2OF7 A;  3OIQ A;  2CUZ A;  1OIS A;  1GV5 A;  1VI0 A;  4DIQ A;  1T6S A;  1BOB A;  1E2X A;  4BQQ A;  2VAS A;  4IKF A;  1IXR C;  4WCG A;  2EFO A;  5IP9 J;  1POG A;  3S15 J;  5C44 J;  3N05 A;  2NS7 A;  2JN6 A;  3BG6 A;  3TW6 A;  3PNT A;  1K78 A;  4CCJ A;  1ZRF A;  1S9H A;  4OAZ A;  4F93 B;  3CCJ I;  1NTC A;  3VYU B;  3S1R J;  1AA7 A;  1R1V A;  3H5R A;  3F22 A;  4ZTJ A;  4D5F A;  5IT9 K;  1I50 J;  3K4C A;  1R9T J;  2ZXJ A;  3DKW A;  3T8T A;  1WJ5 A;  3GLX A;  1Z7U A;  1LJ9 A;  3LSP A;  3BPV A;  1XMA A;  2CQQ A;  4XM3 A;  5AIQ A;  2FQ3 A;  2L2O A;  1XCV A;  4G7Z F;  1IXS B;  1AKH A;  1UHW A;  4HX7 A;  2DTZ A;  2FD5 A;  4LG0 A;  4HZF A;  4B8X A;  3PSI A;  3HOS A;  3F23 A;  4M73 A;  1X1D A;  2VJJ A;  3VB2 A;  2CUJ A;  2DA6 A;  2XAJ A;  5DTD A;  4J01 A;  3V7R A;  2IGK A;  1XS9 A;  2E60 A;  1XB4 A;  2DK8 A;  2Y0M A;  1FBQ A;  2QCO A;  1MNM C;  4BL0 B;  4KN4 X;  2A3S A;  2E7W A;  2LNB A;  2ZFU A;  3M07 A;  3KEO A;  2V4J C;  2GLO A;  1TNT A;  3NQO A;  4B47 A;  1T0F A;  4LLL A;  2HWV A;  4XKC A;  2R7X A;  4DGW B;  2UXX A;  3BY6 A;  4BJ5 C;  2VKD A;  1GUU A;  2GQQ A;  5HOD A;  4G8X A;  5EGO B;  1WFX A;  2TDX A;  2B7E A;  2PN6 A;  1KON A;  2F4I A;  3FK6 A;  3GO5 A;  4HSR A;  2ZXH A;  3A02 A;  3H36 A;  2XAQ A;  3K4K A;  4I09 A;  4CCK A;  5L3G A;  3R61 A;  1FOY A;  2DAO A;  2LDU A;  5M5X J;  3TDU C;  3OYE A;  1I27 A;  3BR3 A;  4N0B A;  3S2W A;  1T33 A;  4AC0 A;  4CSW A;  2IS4 A;  3BOQ A;  4B4C A;  1MZB A;  1QHG A;  3ZOB A;  1LDK B;  4BQN A;  2NVU B;  3A0B C;  3G3Z A;  2H09 A;  2A05 A;  3S3O A;  2BOL A;  4ZYA A;  1K6Y A;  1YI2 I;  1W0U A;  1LB2 A;  5BNG A;  2V1N A;  3JAM K;  3K1M A;  1D0X A;  4Y7N J;  4LJZ F;  2ZME B;  2FXA A;  1GVD A;  1LUJ B;  1N25 A;  2DA4 A;  2RDP A;  3RZD J;  4HOB A;  3ONQ A;  1OLT A;  1ZGA A;  5M5W J;  2QBY B;  4EJU A;  4LLN A;  2ZJR F;  1PJR A;  1U8R A;  5FFX A;  2KPM A;  3G71 I;  1LVA A;  2V6C A;  3PUF A;  1DU0 A;  2E1C A;  4M3D A;  2GXG A;  4ANJ A;  2Y0S A;  5LLQ A;  1JUM A;  1RIO H;  3I59 A;  2H8W A;  5DCF A;  2EZI A;  1I3A A;  4LB5 A;  4Q48 A;  4NNJ A;  3RSN A;  2KMU A;  3WGG A;  5E8I A;  4KMF A;  2MGQ A;  4RB0 A;  3GEZ A;  1A35 A;  1ENH A;  4F3Q A;  2WY8 Q;  2W7N A;  5CQE A;  1NG7 A;  2P8T A;  1ZG1 A;  2YS9 A;  4AVP A;  4XRS A;  4U0Y A;  3COA C;  3I0T A;  3HOX J;  3VWB A;  4PFO A;  3TBI A;  1Y8Q B;  5BPD A;  2JVG A;  3DBL B;  3ZN1 A;  4IRG A;  3IRR A;  4IZZ A;  2M34 A;  3K1P A;  3LSG A;  1HDD C;  1OQY A;  2A07 F;  3S1N J;  3HG9 A;  2HKX A;  2HFH A;  3IAM 2;  2FNA A;  2NS8 A;  2DCE A;  1HKQ A;  2BYV E;  3L09 A;  2BY0 A;  3QOD A;  4HEA 2;  2QQ8 A;  3K0L A;  3RJP A;  5HDG A;  4B43 A;  1IDY A;  5DS9 A;  1R00 A;  3WTY C;  1P4X A;  3M8E A;  4HX4 A;  2XB0 X;  5DCM B;  2IGO A;  4ON0 A;  4KDP A;  2PBI A;  3A1Y A;  3RTR A;  3QPL A;  5LGN A;  3F8M A;  3HUG A;  5LHG A;  2QZ8 A;  5JVT A;  2MD0 A;  3DQV C;  1LDD A;  4ZC3 A;  3TOA A;  4MTD A;  4IOC F;  2J5P A;  2Q8K A;  3DTI A;  4YFK F;  1Z6R A;  1KU7 A;  1K4T A;  4FT8 A;  4RGU A;  5K5R A;  5F04 A;  3IWF A;  4YIR X;  5IP7 J;  1ON1 A;  2QSF X;  1HA8 A;  2IA1 A;  1R5H A;  3KP5 A;  3GTO J;  3MFK A;  4XOT A;  3HC7 A;  3PL8 A;  3FXO A;  3G1L A;  3CDL A;  4HNV A;  3SFI A;  1Z6T A;  4AM3 A;  3KZZ A;  2BXZ A;  3H3Z A;  1J59 A;  3VOE A;  4AYB N;  5D6E A;  2E1M B;  2ZO4 A;  5KHD A;  5LD2 C;  4BNC A;  4L18 B;  5EG0 A;  2ME0 A;  2J5O A;  2KRH A;  2W48 A;  2UZK A;  3IKT A;  2VBY A;  3KP6 A;  3N4M A;  4M9X A;  3PM1 A;  4RAY A;  4C3I J;  3OSF A;  3T5X A;  2JSC A;  1D5Y A;  5LFA A;  1P4W A;  4I76 A;  1Z05 A;  3HB9 A;  4FE4 A;  5A2Q K;  4KNY A;  2E36 A;  1I3Q J;  1X4O A;  2RNG A;  2R93 J;  1F36 A;  2W57 A;  2XB5 A;  1MBF A;  2OCC H;  5F1J A;  2O7O A;  3QPH A;  3E6C C;  2F4O B;  3ZQI A;  5IPA A;  2RVC A;  3WE2 A;  2A5W A;  1TT5 B;  2OPT A;  2HKO A;  1X1P A;  2YSR A;  3MAJ A;  4RMN A;  2GOM A;  2F48 A;  2EIL H;  3BJO A;  3C18 A;  3CP8 A;  3QYE A;  2YX7 A;  3OYA A;  5FLX K;  2DFF A;  4XLH A;  5DUK A;  1QBJ A;  2LRD A;  2VQH A;  3I59 B;  4IF4 A;  5M3M J;  2EFP A;  4JX5 A;  2CUE A;  2DYR H;  5E1Z B;  3ISP A;  1Z1D A;  4EAT A;  3HPH A;  4RBO A;  3X2Q H;  4XID A;  1LEA A;  2UUZ A;  4KIS A;  2ZJQ F;  2AQF A;  2QGU A;  2A6H F;  3SYT A;  4UUS A;  4ENN A;  3I3L A;  1KQ8 A;  1Z0X A;  1D1A A;  2K27 A;  2LSO A;  1QRY A;  3BCA A;  3DTK A;  1FMV A;  3HXL A;  4E7I A;  2QSG X;  2XIG A;  2XGE A;  4L5E A;  1K4S A;  2CQK A;  3KYD B;  1W5S A;  4M3F A;  2Z3Y A;  1IV6 A;  1SAN A;  2Z1D A;  5L3D A;  2AQE A;  1XDU A;  3GTG J;  1OCZ H;  3HOW J;  4AIJ A;  3JR9 A;  2RAE A;  1TW3 A;  1JTX A;  3CLQ A;  2O9L A;  3TGN A;  4FHT A;  4LLG F;  4I0B A;  2CWE A;  2Y2Z A;  1IN6 A;  3H0G J;  3FXR A;  3CME I;  3R6S A;  4XKB A;  1P4A A;  4CH7 A;  1X58 A;  3ABU A;  3OYG A;  3QOE A;  2X48 A;  3WOD F;  3BJ6 A;  3SZT A;  2WV1 A;  3WTU C;  1IUF A;  2OU2 A;  2CO5 A;  1MGT A;  2JWT A;  2EWN A;  2LF7 A;  4HYE A;  1KQ9 A;  3HYI A;  5J1U A;  4GO1 A;  2JA6 J;  1UST A;  1TTY A;  3GF2 A;  1BIA A;  4GFB A;  2STW A;  5LEJ A;  1VFC A;  4FX4 A;  3MN2 A;  5EYR A;  4UHT A;  2GWR A;  2VUM J;  1LDJ A;  3JRD A;  1XDS A;  3FHN A;  3CD6 I;  2L5Q A;  4XSX F;  1BI2 A;  2BXY A;  3DV8 A;  3AFH A;  1RR8 C;  1O3R A;  2FRH A;  2QLZ A;  2OQR A;  3VEP A;  2ELK A;  5BMZ A;  1EA3 A;  2F5V A;  1BC8 C;  2DW4 A;  3H5A A;  2Q2E B;  3E5U A;  3A01 B;  5BQT A;  2AO9 A;  1REP C;  3V7S A;  3HL2 A;  2GIV A;  3DEU A;  4XIC A;  4IRH A;  4Y33 A;  2I10 A;  2JUC A;  3U9G A;  3J80 Z;  1ERD A;  3OS2 A;  2G7H A;  4OAY A;  4XN0 A;  3G1O A;  5IY5 H;  1H0M A;  2HYG D;  3HRM A;  4GGG A;  1FTZ A;  3IH4 A;  4DOZ A;  1ORK A;  3KX2 A;  1Y56 A;  2RQP A;  4JX6 A;  4Y4R A;  3FBN B;  3LFU A;  1WRJ A;  1RUN A;  3WE3 A;  4KJZ A;  3CUQ C;  4AID A;  4D7M A;  3WU1 B;  3CO6 C;  3RPU A;  3I58 A;  3ECH A;  1XSD A;  2DPD A;  2VJ5 A;  2VL8 A;  2MH2 A;  3ASN H;  2R7T A;  3DU5 A;  2Z5U A;  4KMU X;  3IL2 A;  3GCM A;  2FMY A;  3JRH A;  2NVT J;  1QZZ A;  5DD4 A;  4M9S A;  3L7W A;  2BZT A;  2TCT A;  4UUS B;  4ESB A;  4RS8 A;  4ZDO A;  4HF2 A;  4G6T B;  4OMZ A;  1XG1 A;  4E6K G;  4CCN A;  2LKP A;  3EUK L;  2WAQ A;  4JYK A;  1U8B A;  4Q4Z F;  4N4O B;  2VOO A;  2RKH A;  4CZZ A;  3LL7 A;  1FMW A;  2KRC A;  1BIB A;  3LWF A;  1TL8 A;  2ACJ A;  1X4P A;  3AL0 B;  1J9I A;  4A12 A;  2EFQ A; 
#chains in the Genus database with same CATH homology
 3AL0 C;  3CP2 A;  1MMA A;  4BJT A;  4BE2 A;  1D1C A;  3HPG A;  3RPU D;  3FBI B;  2KL4 A;  4HG2 A;  3IUO A;  2CH0 A;  2JVH A;  2VKH A;  2X6W A;  4PJL A;  4XOP A;  3D5L A;  3L2V A;  2OV7 A;  3OY9 A;  4FAS D;  4U7B A;  3CJR B;  2VIX A;  4IQJ A;  1NG6 A;  3DKY A;  2HNH A;  2W00 A;  1WJA A;  1LFP A;  2L7K A;  2XDV A;  2M4K A;  2A6T A;  3H9Q A;  4HST A;  3UR3 C;  3C2H A;  2JSP A;  2IXS A;  4HPQ A;  3H5N A;  2Z16 A;  1WJE A;  5CQG A;  3OWT A;  2R7R A;  4F55 A;  2LY2 A;  3EUH C;  2PJR B;  3GBG A;  3PNY A;  2BW3 B;  5KNL A;  3E0J B;  3I9V 2;  3OIQ A;  2CUZ A;  5FRO A;  4DIQ A;  4P1W A;  2ZSH B;  1BOB A;  4BEH A;  4BQQ A;  2VJI A;  4XKV A;  1X1A A;  2DT6 A;  2VAS A;  4IKF A;  4PUS A;  3W2A A;  4PJM A;  2X85 A;  3FDY A;  3S32 A;  2KDO A;  4BDY A;  3N05 A;  2BVM A;  3BG6 A;  2PJR A;  3PNT A;  4CCJ A;  3BG7 A;  1S9H A;  2BW3 A;  4OAZ A;  4F93 B;  1MND A;  4XLE A;  3VYU B;  1AA7 A;  1GLN A;  1X1B A;  3H5R A;  3OOU A;  4CCM A;  4ZTJ A;  2HPM A;  3KYL A;  3K4C A;  2IS2 A;  2X1D A;  1WJ5 A;  3OYD A;  3U21 A;  3TL4 X;  2GOX B;  2W4S A;  4XM3 A;  4II2 A;  2L2O A;  2DJI A;  1T0F C;  2MAB A;  2RRE A;  2L9N A;  3VYS B;  1SFK A;  3UNG C;  2JUG A;  4BGD A;  3K70 D;  3PSI A;  3HOS A;  3S3M A;  3W3C A;  1X1D A;  2VJJ A;  4B48 A;  4DJA A;  2CUJ A;  4J01 A;  2R7O A;  3MKZ A;  4MLO A;  2VLA A;  2VB6 A;  5FRN A;  3L2W A;  2IGK A;  2E60 A;  2V26 A;  4BXF A;  4BL0 B;  3H35 A;  1E0E A;  3K4N A;  2ZFU A;  2V4J C;  4B47 A;  4BQO A;  3ZGK A;  3W2V A;  4XKC A;  2R7X A;  2K9L A;  4DGW B;  4BJ5 C;  2WBM A;  2VKD A;  1MMD A;  4PJN A;  1W36 C;  1WJC A;  3CJQ B;  3SZG A;  4CUG A;  1WFX A;  5HOO A;  1KON A;  2LYC A;  2F4I A;  4HSR A;  4NC8 A;  2ZXH A;  4D1Q A;  3K4K A;  3D5S C;  4CCK A;  3EUA A;  3K4J A;  4YRV A;  3J7A Y;  2M0M A;  2VXZ A;  2CV2 A;  1WJF A;  1Z3X A;  3OYE A;  2WA0 A;  4DBR A;  1MW7 A;  2XC7 A;  3D5R C;  4CSW A;  2IS4 A;  2JA2 A;  1QHG A;  2HPI A;  2ZSI B;  3H9J A;  4JOM A;  3DPT A;  4CA0 A;  1LDK B;  2LOO A;  4BQN A;  4F52 A;  1JI8 A;  3MMY B;  2CW7 A;  3S3O A;  2BOL A;  2V6E A;  4ZYA A;  1K6Y A;  2W82 A;  3OL4 A;  2K9M A;  1Z3Y A;  3ZR8 X;  2V1N A;  4H4K C;  3OYL A;  1P9Q C;  1D0X A;  4XQF A;  3K6G A;  4LIU A;  3QYF A;  3RCO A;  2VQG A;  3ONQ A;  1TZL A;  4PJJ A;  1OLT A;  5HNH A;  3OS1 A;  3CES A;  3HKZ A;  1PJR A;  3DTE A;  4RM2 A;  4J00 A;  2KPM A;  4C2U A;  4ANJ A;  2Y0S A;  3HOT A;  3OS0 A;  3OYI A;  1G8X A;  4XON A;  3OR1 C;  4NNJ A;  3RSN A;  3PUB A;  2KMU A;  3OYB A;  4ZDL A;  4Y3O A;  4BU2 A;  3H0D A;  2CV1 A;  4NQW B;  4BEH B;  4F3Q A;  2QKL B;  2WY8 Q;  2W7N A;  5HLT A;  1W36 D;  5CQE A;  1NG7 A;  2MC4 A;  2KZV A;  2LY1 A;  3VWB A;  4PFO A;  3TBI A;  1X19 A;  1D0Z A;  2R7U A;  2JVG A;  4GRI A;  4NC7 A;  1MNE A;  3HUG B;  3W2W A;  3MD2 A;  1LVK A;  2XF7 A;  4IZZ A;  2HVS A;  3LSG A;  2M4G A;  1DP3 A;  3OYC A;  3HG9 A;  1N78 A;  3IAM 2;  4KIT B;  2DCE A;  3OYH A;  4CZC A;  1PYV A;  2LBF A;  3MKW B;  4E7J A;  4BE1 A;  3QOD A;  4HEA 2;  1V5E A;  4PSW A;  2CV0 A;  4B43 A;  4PSX A;  1QU3 A;  4QPQ A;  2IGO A;  3A1Y A;  1WJB A;  3RTR A;  3OYM A;  4E7K A;  3S8P A;  3L2U A;  2CMP A;  2Q1Z B;  2MD0 A;  3DQV C;  4XL9 A;  4RLQ A;  1UG0 A;  1WJD A;  4PFP A;  4ZC3 A;  4D9J A;  3V42 A;  3SEQ A;  3NWS A;  3DTI A;  3M8J A;  4LG3 A;  1VZ0 A;  3DKX A;  2KLO A;  4LIT A;  1HA8 A;  4E7Z A;  4XKW A;  1DQU A;  4XOT A;  3HC7 A;  3PL8 A;  2X6Y A;  3K10 A;  1SAU A;  3VYR B;  4F91 B;  2NOJ B;  2E1M B;  3VYT B;  2WY7 Q;  5KHD A;  5LD2 C;  2W1O A;  4AYB A;  2E1M C;  2WAE A;  3FKJ A;  2FUG 2;  2KRH A;  2M7A A;  2XF6 A;  4E7H A;  3VDX A;  5KCM A;  3CF2 A;  2R4G A;  1MMG A;  2KQR A;  2IGN A;  5JHF A;  1V5F A;  5LFA A;  2E5N A;  3A4C A;  2OUM A;  3L2R A;  2DOA A;  5HNF A;  2R7W A;  1X4O A;  2RNG A;  2X1E A;  3ZXS A;  2R7S A;  1TT0 A;  4CCL A;  2DT7 B;  3AKZ A;  4HRI A;  2E5Z A;  2VXD A;  4DBQ A;  2A5W A;  3OMY A;  2WAF A;  2V7F A;  2XSJ C;  4RMN A;  5CKT A;  4R79 A;  2GOM A;  2UWM A;  1YX5 A;  3CP8 A;  3QYE A;  4OWR B;  3OR2 C;  3OYA A;  4XLH A;  4B3X A;  3OYN A;  2LRD A;  2UV1 A;  2VQH A;  3DLA A;  1Z7L A;  3NWT A;  2WB1 A;  4II3 A;  3KEY A;  1BR4 A;  4E4H A;  2MYS A;  4EAT A;  3HPH A;  2F6C A;  4BUP A;  2VPL A;  2O5R A;  4ZTF A;  4HNT A;  2UUZ A;  4KIS A;  3ZQQ A;  3SEZ A;  1N75 A;  2XF5 A;  2L9S A;  2AQF A;  3F9K A;  3SYT A;  3CZ6 A;  3I3L A;  1D1A A;  1ZEL A;  1YX3 A;  3DTK A;  3BCA A;  1BR2 A;  1FMV A;  3HXL A;  2CS3 A;  2KHM A;  4E7I A;  3BCB A;  3L2Q A;  3M1C A;  2Z1D A;  3QYB A;  2AQE A;  4XLC A;  3E1S A;  4E7S A;  2HU9 A;  4NUB A;  2R7Q A;  4BE0 A;  2LBF B;  1X1C A;  2ZXI A;  1YE9 A;  4BAC A;  3PFY A;  2HZD A;  4ZJZ A;  3ZRG A;  2X51 A;  4XKB A;  3K70 C;  2CFO A;  3ZCO A;  4BS9 A;  4XLF A;  4CH7 A;  3VSL A;  2RQQ A;  5CPR B;  3OYG A;  3QOE A;  3VSK A;  3DWL E;  3BC8 A;  4JQF A;  3OYK A;  3IP4 B;  2OC6 A;  4B44 A;  4BDZ A;  4U87 A;  2HDW A;  2LG4 A;  2R7V A;  2K3P A;  4X0G A;  4AVZ A;  3K4L A;  2IGM A;  2IS1 A;  3DPU A;  4C30 A;  4KT6 A;  4RM3 A;  4FET A;  3LSH A;  1QHH D;  3DU6 A;  2WAD A;  4QPO A;  4ZDP A;  3FHN A;  2CW8 A;  2L5Q A;  3SDB A;  3CMM A;  3RQ4 A;  2K5C A;  3AFH A;  4P5O A;  1N77 A;  2Z2S B;  1EA3 A;  3A2K A;  2F5V A;  1UEL B;  2LRE A;  3H5A A;  1D0Y A;  2Q2E B;  2VJ4 A;  4XOR A;  4XLA A;  3HL2 A;  1BR1 A;  2ELJ A;  4Y33 A;  1UAA A;  3K4B A;  2V9K A;  1ERD A;  2I8D A;  3OS2 A;  4OAY A;  3OYJ A;  4XN0 A;  1G59 A;  3C2G A;  4LIV A;  2VQL A;  3OYF A;  2HQA A;  3OIP A;  2HVQ A;  4XN3 A;  4DOZ A;  2X1C A;  3KX2 A;  2IS6 A;  2DXI A;  1Y56 A;  4YEJ A;  1Y6I A;  2MFZ A;  1T95 A;  3H9G A;  1IRX A;  3FBN B;  4Y4R A;  4AU7 A;  5HVQ C;  3LFU A;  2M3A A;  3EPZ A;  1R6R A;  4KJZ A;  5FRM A;  4C2T A;  2P0W A;  2VQC A;  2PMZ A;  3G2B A;  1DGR M;  3IAS 2;  2XAU A;  2VJ5 A;  2VL8 A;  4F92 B;  3LMM A;  2R7T A;  3DU5 A;  1J09 A;  1LKX A;  4YEL A;  1Z21 A;  3LSM A;  4XMY A;  2HVR A;  1MMN A;  2QKM B;  1DGW Y;  4XNF A;  4PK4 A;  3BLY A;  4ITV A;  2BVL A;  3K4M A;  1D1B A;  3LSI A;  4ZDO A;  3PNV A;  3TMO A;  4G6T B;  4BJ6 C;  4IQ4 A;  3MKY B;  4XR6 A;  3DEE A;  4E6K G;  4CCN A;  5TGT A;  3EUK L;  2WAQ A;  2X6X A;  1U0J A;  3DPL C;  4E7L A;  4C9Y A;  3S3N A;  1OR7 C;  4N4O B;  2LC2 A;  3PSF A;  2M7B A;  3LL7 A;  1FMW A;  2KRC A;  2KP6 A;  1V5G A;  1X4P A;  4CCO A;  4IX7 A;  4HNU A;  3S93 A;  3PJR A;  3LSK A;  3AL0 B;  2LH9 A;  4RLF A;  4N4N B;  3OL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...