2XF6A

Crystal structure of bacillus subtilis spp1 phage gp23.1, a putative chaperone.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
50
structure length
50
Chain Sequence
SESLLYGYFLDSWLDGTASEELLRVAVNAGDLTQEEADKIMSYPWGAWND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords GP23.1
publication title Crystal Structure of Bacillus Subtilis Spp1 Phage Gp23.1, A Putative Chaperone.
pubmed doi rcsb
source organism Bacillus phage spp1
total genus 17
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2010-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2xf6A00
2XF7A 2XF5A 2XF6A
chains in the Genus database with same CATH superfamily
1GXPA 4LG0B 4EM2A 4BNCA 3I9V2 1QNTA 4ASNA 4B44A 4LK0F 2JMWA 1Z1DA 2V9KA 4L18B 2IS2A 4PFOA 2MSYA 1ZKGA 2CQ7A 4BE0A 3U1KA 4KDPA 1IUFA 3K1PA 3LSRA 2CMPA 5JVGF 1D0ZA 2LFBA 4BXFA 1V5FA 2EA4A 3ESWB 2IPQX 4PJMA 3O8HA 1BC8C 1D1BA 4A0XA 3QWLA 3ABUA 4IVNA 1KZHA 2VE8A 1GV2A 3LQRA 3T8TA 1R5HA 1QVUA 4GFBA 5A2QK 1BBYA 2VJJA 5D5UB 3GEZA 3EPZA 5F1RA 2H09A 3I3LA 2NXNB 3N4MA 1QHHD 3HOZJ 2H94A 4KIFA 1XMAA 1JKOC 3HXLA 1IRFA 3RI4A 4HF1A 3CCQI 3BT9A 5LGTA 2Q8KA 2PJRA 5FLMJ 1T08B 2DA5A 4MEXF 3IL2A 1NG6A 2Y75A 3CC2I 4JK1X 3P5JA 4P1WA 5E79C 2KRCA 3CUQA 4XMYA 3GTPJ 2P8TA 4A69C 2CQKA 2ZB9A 2DMQA 3TMOA 2CQQA 3FZVA 3ZCOA 2OUMA 4KA4A 4ZC3A 5FKNA 2LKPA 4XKVA 2W4SA 4OIOF 2B9SA 1IDYA 2NS0A 2XGDA 3OYGA 3I54A 1NK3P 5GAGJ 2CQXA 2VKHA 2FE3A 4M71A 2E1OA 2MLGA 5M5XJ 2XF6A 2PMZA 4CCLA 2JQ7A 1MJAA 2GXGA 4Z6YA 2M87A 3GTKJ 4XLAA 3J7ZI 1TBXA 2DI3A 2E60A 3KP2A 5DCMB 3JW4A 4PDKA 3WODF 3HHGA 2RV8A 2IGKA 4JYKA 3K4KA 3WHBA 1XDSA 4HV5A 2DPDA 2VE9A 2DFFA 4CSWA 4C30A 2Z3YA 1Y39A 3OIQA 2QVOA 3IH2A 5M5WJ 1XCBA 2PLYA 3G71I 2F5CA 4HA8A 2E7XA 1OCOH 4IJAA 1FTZA 2R7XA 3CUQC 2EK5A 4DQ2A 1ZGWA 4BHBA 4EJWA 3I55I 2EB7A 1W5TA 2VC0A 2OA4A 5FGMA 3V7SA 3MWMA 5HS9A 1S29A 2JA2A 4F7ZA 3RZDJ 1BOBA 3ISPA 2DTZA 3H1CA 3N05A 1ZELA 4IEJA 4J19A 1FP2A 1F4KA 2G0EA 1KQ8A 4AIDA 2HXIA 2JVGA 3IAM2 3NEUA 3CP8A 4U88A 4B1RA 3O2PE 4CO8A 3Q9SA 3ZPLA 1P2FA 1BOAA 4PGHA 4QWQA 1VF9A 4OMYA 1X2MA 2JT1A 3F8MA 2Q1ZB 2DU9A 1YRNA 2OJED 3I56I 3PNTA 2PFBA 2R3SA 3K2ZA 1YQAA 2E36A 3ABKH 3D5RC 3E7LA 3EUKL 1QU3A 1B72A 2KIFA 5TISC 3BJAA 1IRXA 2W57A 4M73A 1FZPB 3I59A 3E97A 2FBHA 4GDFA 2HDDA 2JPCA 2JN6A 2MBFA 1N77A 2DYSH 2EFQA 1BN5A 1UJ8A 2LBFB 4XK4A 5DCFA 5LGNA 3GFLA 4MFDA 2TRTA 3V7CA 3COAC 2Y69H 3T5XA 5E8IA 3S8PA 3WU2C 4ON0A 4ZTJA 2FOKA 4HG2A 2BY2A 3DU5A 4A0ZA 4EEFG 1VI0A 3FMQA 1J59A 1DGWY 3VYUB 2LYCA 3T0YA 3A0BC 4MLOA 2O61A 1ORKA 3QPSA 5HNHA 2NRAC 1J0RA 5F64A 2OU2A 5F0HA 3LAJA 3QP6A 4KYWA 4XKWA 3FXMA 2DA3A 2X51A 4WWCA 4X0GA 4Y15A 1FP1D 4NQWA 4MTDA 2FNPA 3HJEA 1ETQA 2CJJA 1LDKB 2ZSIB 2KZVA 3MZYA 3QPLA 5CVIA 1YX5A 2QSFX 2V9VA 3HSRA 1DGRM 1Z6RA 4M9SA 4BY7J 4IPAA 3RJPA 4B09A 1HKQA 2DO7A 5E3LA 5JHFA 1SD5A 4IO9F 2V7FA 2GOXB 3V4GA 2QKLB 5TJJA 1W1WE 1X1DA 1VQ4I 4XRSG 1LVKA 1TC3C 3CLOA 1Z7UA 2HQNA 1CQTA 3OOPA 4LG0A 1SD4A 2R7OA 2K9MA 2TDXA 1S7AA 3MEXA 4E7SA 3LSGA 1JHHA 2EZKA 4XBFA 1R23A 4RDUA 3TEDA 1VQOI 4HPQA 1YW8A 3KP7A 2CG4A 1HW2A 4PZJA 3HUGB 2HTSA 1YW9A 2JWTA 2XPUA 5K7FA 1JT6A 1R71A 4NUBA 1HF0A 3HOVJ 4NC7A 4Y7NJ 2M5WA 3S1NJ 1WH5A 4G7OF 1T56A 2HU9A 4AIJA 1KQ0A 4DZJA 3OIOA 3SZGA 5ICGA 4B43A 2RNGA 3HTSB 5EEHA 4JP0A 2WAQA 2L7MP 2H1KA 2BYVE 4KMFA 4E7IA 1ZRCA 3V42A 4NBQA 2WWYA 1Z3YA 2HOAA 4XKCA 4KISA 5B1BH 5C4XJ 3DLAA 2LMDA 3FM5A 5K5QA 3REOA 4KIGA 4DGWB 1PP8F 5AIPA 2P7VB 1TLHB 4Y3OA 2A69F 1ONVA 3F9KA 3IAS2 4KJZA 2EZHA 2UV1A 2VXDA 3LQQA 4YELA 5CLSA 1PUEE 1BJAA 1ZR2A 1GDTA 2PG4A 3TQNA 1ETXA 5EDNA 3H5RA 4BBSJ 5LRRA 3WE2A 4GGGA 3FXRA 2VUMJ 3DPUA 3PIOF 3GTQJ 2EINH 2ZXIA 2M7BA 1IN7A 3WHCA 3IHUA 3BG7A 3BQYA 4IHSA 4A12A 1WJFA 2R7RA 1B8IB 4HSTA 1LFUP 2W24A 3AL0C 1BI2A 2VL8A 1VQLI 4BXXJ 3HB9A 5DCMA 1A35A 1IF1A 3FWEA 2DMUA 1XGOA 5LFAA 4B47A 4G6TB 3S2DJ 2J5OA 1TW3A 3DWLE 4BL0B 3J81Z 5CYVA 3G6EI 3QPHA 2FQ4A 3DPLC 2F48A 2JSCA 1N75A 2FX0A 1LFPA 3WTSC 5FLVA 1RKWA 2OBPA 3AFHA 1IW7F 2DA1A 1XB4A 2VJIA 1K4SA 1Z05A 3G1MA 2K4JA 3JREA 4FISA 3U9GA 3ZMVA 3R0JA 1MBKA 3T1BA 1KGSA 3E1SA 2ID6A 2E34A 2O9LA 3L2WA 2FSWA 3WU0A 3JR9A 2HVQA 3ZN1A 2ZBKA 4MQ9F 3TOAA 2HQAA 3VFZA 5ICEA 4A6EA 3L2RA 2BHZA 2DQRA 3BOQA 3A01B 3OYNA 1SFXA 4UY8I 2QA4I 1Y8RB 4AM3A 2ZXWH 1X1BA 5IYDJ 1ZAOA 5FJ8J 4M3BA 4G6DA 5DTDA 3W2AA 1TQIA 5HOOA 2B0LA 2XRNA 4CH7A 4U7DA 3S3MA 3U21A 3G1LA 1RIOH 1H9TA 1Y1VJ 1FBQA 1MW7A 2WY8Q 4G9YA 4RGRA 1IRGA 1MIJA 3K70C 2LBFA 3OSGA 2VI6A 4IL6C 1SMTA 1MBHA 2P5VA 2HZTA 2H6CA 2HYJA 3HDDA 1RC9A 1T95A 2KJBA 1K83J 5D6FA 2FXAA 2OCEA 3GUDA 1R9TJ 4IOAF 2B63J 1WJ5A 5DDGA 1YJWI 1REPC 1UCRA 2FA5A 2PMZN 1TP4A 5IP7J 5DEQA 4IX7A 4EGYA 4A3JJ 2AO9A 4E7JA 1QRYA 3DPTA 4GO1A 3HEFA 1H88C 4PJJA 2D45A 2P6TA 3SQNA 3T8RA 1KYWA 5IOYA 2DLLA 1QZZA 1WI3A 3MZHA 2L4AA 3CDLA 3BCAA 3H36A 1G3SA 2ZO4A 3KP3A 1OKRA 1S8NA 3A0HC 1WKMA 3FMRA 4S05A 2JA7J 1ULYA 3V8LA 5JI6A 2GA1A 2QF7A 2XDVA 3DBHB 1BR4A 1W7PD 4CYCB 3AG4H 3OYBA 3BPVA 1OYWA 3F21A 5LHHA 4AC0A 3FBIB 4JX4A 1GUUA 3NARA 4N9IA 3PIPF 1RNLA 3ELKA 1W0TA 1LNWA 2K9SA 3J81K 3GFIA 3HSEA 2YX7A 2ZC2A 3L2CA 3RZOJ 2GAUA 4IQ4A 2YSRA 2P4WA 3IUOA 4HX7A 4PSXA 5FRNA 2XGEA 3E6DA 2QM3A 1WQ2A 1VZ0A 4IRGA 5BS6A 2IJLA 3ASOH 4G7HF 4XRMA 3HUGA 1G3WA 2CUEA 3KYCB 1SC7A 3KFWX 1JTXA 1A36A 1XSVA 2DA6A 3HZJA 2DMTA 3R0AA 4YIRX 2L9RA 2X9DA 2VKDA 2XASA 2F6CA 1XDUA 1S6LA 3KZYA 4HOBA 5D8KB 3IRQA 3K10A 3OMYA 2KDZA 3O3KA 3KLOA 4Y33A 1VQPI 5GPCA 3Q0UA 1XGNA 1S7OA 1DDNA 3M8JA 4FQGA 4XSZF 3WTWC 3S1QJ 2R93J 3CCRI 3HGGA 4BH9A 3K4CA 1JUPA 4O5VA 3ZQCA 3V8KA 4DYCA 1I39A 2KDOA 2DBBA 3J80Z 3M3YJ 2CW0F 1L0OC 4X1EA 2K02A 3F23A 4WCGA 2YPRA 3N97A 1H9GA 2ECBA 2V9PA 3TDUC 4FX4A 2A5YB 2XRLA 1XGMA 1M1EB 4U87A 3JSPA 2O8KA 2XB0X 1WHUA 1Y56A 1J2XA 2PQ8A 2IS6A 3BROA 3L9FA 3U1DA 2NVYJ 1B8IA 2EFNA 4WK8F 1FSHA 3I0TA 3MN2A 1HBXG 1VQ8I 1OFCX 4FASD 4A3BJ 2KRFA 2L7KA 4TV7A 4F93B 2CYYA 2V1DA 5DM6F 2QWWA 4BDYA 3ZP5A 3H3VK 3E6MA 5DM7F 1BA5A 1Q1HA 1NH3A 3IP4B 3AG1H 3ZXSA 3A2KA 2ID3A 1A5JA 3GXOA 3K2AA 4CCKA 2CWEA 2DAOA 3PUBA 1XMXA 3V8JA 4GXOA 1SFKA 1R1VA 1HSTA 3R4KA 4BGDA 1MNMC 2WC2A 1VQ7I 1WJEA 4HNUA 3H9QA 5E3NA 3DXJF 2DA7A 1FBUA 4C2MJ 2BY0A 4DJAA 4MHGA 2G7UA 2LF7A 3CCEI 3D5LA 4YEJA 3QQAA 4B4CA 4CCMA 2IEKA 2Z5UA 1VQMI 1A31A 1QA6A 2BY1A 2DA2A 2EPFA 3RCOA 1FIPA 4LIUA 5BPIA 4HSRA 3FMSA 3FKJA 3A01A 2D1VA 5EZGA 2ZNZA 3S32A 5CKTA 1JKPC 1Y8QB 1SFUA 2WAQN 4CHUA 3LA7A 1FOXA 3SEZA 2DQLA 4UUSB 2OV7A 4NHJA 4A3KJ 3OR1C 1LVAA 2DJNA 5H20A 4D7MA 2MFZA 1B1BA 4OU0A 1JUMA 4PUSA 3TW7A 3HRUA 1OCCH 2L02A 1KA8A 4ZZLA 2C6YA 2X1CA 5J1RA 4LB6B 1YHQI 3TDZC 1W7PB 3HC7A 3OYMA 2GLOA 3CCMI 4F91B 1K6YA 5AONA 2F4MB 4IQJA 3DCFA 3ABTA 3LSHA 3FKIJ 2R5YB 2WB1A 1USTA 3J80K 2DK8A 2XIGA 3E6BA 4M9XA 5GADJ 3L2QA 4B3AA 1G6NA 2A3SA 2ZFUA 1GV5A 2W25A 4FE4A 2DFHA 3G1OA 1PJRA 3M8FA 4OMZA 1YTYA 2XKPA 3L09A 2OQRA 1AA7A 4BKXA 1Z9CA 2WTEA 1USSA 1R5ID 5FFZA 1OCRH 4K2EA 2BVLA 4QSHA 3OYEA 1TL8A 4IRHA 2BVMA 2VB6A 2L9SA 4XLPF 3X2QH 4II2A 1RR7A 2EA2A 5FKKA 3GTMJ 1IN8A 3M7GA 3GCMA 3JSOA 5H6QA 5K1YA 2FBKA 1PDNC 2CRGA 3M1EA 4KNYA 3FHZA 4CYCA 1V3FA 1ZRFA 4JX6A 2ZNYA 4JQFA 1J5YA 2CO5A 5HVQC 3GTOJ 4PK4A 3OY9A 3PNVA 3K9TA 1K7AA 3OOUA 4L5IA 5LEKA 1ZN2A 5C3EJ 1XCVA 2GIVA 4ZDPA 3ZRGA 2E2HJ 1VFCA 3GYHX 4NB5A 1OISA 2B7EA 3RYPA 2R7ZJ 3F8NA 1XGSA 3RTRA 3MZ8A 4E7KA 2UUZA 3AL0B 1P7IA 3BR1A 3S15J 4ZTFA 5GTIC 1YIJI 3S16J 1IG7A 3ZQ7A 1YS7A 3GLLA 5DUKA 2R7SA 3C3WA 1KU9A 2VKVA 1H0MA 1DP3A 4OIRF 2KIUA 3K4NA 1D5VA 3PUFA 5FO5A 5JLXA 5CVRA 3KP6A 1F36A 1FLIA 3CC4I 2VQHA 2QBYB 1Z7LA 1ZLJA 1EA3A 1ZARA 2QKMB 1K4TA 2ISZA 3HPHA 4D1QA 1UFMA 2HGCA 4BXUA 1Z6TA 2FMYA 1MD0A 4U0YA 3JAMZ 2R7TA 5FD6A 1BI0A 1OQYA 2IRFG 1EH8A 2I10A 1UG0A 4O3MA 5HLIA 3IRRA 4XLEA 3S14J 4A3IJ 4XLFA 4ENKA 1MMGA 1U0JA 3BWGA 4L0ZB 1ERDA 4A3FJ 1O3QA 1TWCJ 2BXZA 2K3FA 5ERIA 3TP3A 4A3EJ 4ZYGA 4OWRB 2F4OB 4OINF 1X1AA 5F6FA 2Y9ZA 3RDIA 4JBAA 2WADA 2LR8A 5GTHC 2CV1A 4ZYDA 3S17J 1LUJB 3FK6A 2KT0A 3FXOA 1XX5A 3CP2A 3J7AO 1HSJA 1R00A 3DEUA 4ZDLA 2X6YA 4RGUA 3PNYA 2J5PA 4D9JA 1LKXA 3BY6A 5FROA 4BDZA 3OYIA 2KISA 4RAZA 3ERED 1IN6A 2W85A 3S3OA 4RS8A 1T98A 3JRGA 5LLQA 1ZYRF 2HI3A 4ENNA 4N4NB 3WTXC 3D0SA 4UVAA 2DFEA 3HOUJ 2XAUA 1N78A 3ZN0A 2E35A 3I5UA 4UHTA 3K4JA 3KP5A 2MD0A 1OCPA 2EIKH 4ZJZA 4LB5A 2HQ5A 3QU3A 1FC3A 3SFZA 2MYSA 2NAZA 5DV5A 2ZJQF 5J47A 1Y1WJ 2EFPA 3H9GA 1TWAJ 2CUZA 4AWXB 1TWFJ 3CCYA 4MQVA 4Y4RA 3H0DA 4UUSA 5ILSA 2O03A 3L00A 2CW8A 3MKLA 1WFXA 3LMMA 2O3FA 1N25A 2DN0A 1BIAA 2DK5A 3HHHA 1ZG3A 5DD8A 5IT9Z 3IC7A 5KCMA 1B4AA 2P5LC 4EV0A 2M30A 2Y9YA 2NVQJ 5F04A 3PFYA 2M0CA 2Z99A 3CMEI 4IKFA 1ZQ3P 3BQZA 2PBIA 2K40A 1IO2A 3ZQGA 3OYAA 1BM9A 1D1AA 4DOZA 4HF0A 5H6RA 1X19A 2VQGA 1GHCA 4BE1A 2GZWA 3TW6A 2R5YA 5TRDA 3JAMK 4RM2A 1G4DA 2RDPA 4MIMA 4KFCA 2R7VA 1DU6A 2CFOA 4UUTA 4Z2YA 4BE2A 1JE8A 2FNAA 3OV8A 1APLC 4A3LJ 2A6HF 3BJ6A 2EFOA 1K78B 2HDCA 3HG9A 1AU7A 5E20A 1NG7A 3F6OA 1QPIA 2M7AA 5LBQA 1ZH5A 2CSOA 2FU4A 2JUGA 3GZ5A 3ZQFA 2HNHA 1YLFA 1FTTA 5L3GA 3EETA 3EYIA 1FOWA 1S7EA 2RQQA 3BLYA 4AVZA 1LDJA 1O57A 2QQAA 2F4IA 1IRZA 1TZLA 3TP0A 3GO5A 2JUCA 1BIBA 1WJBA 3MFKA 3KZZA 4HDVA 3HPGA 4B3XA 2DT6A 5C4JJ 4XOTA 3KYLA 1YJNI 4KN7X 3HM5A 1IXSB 2BBYA 3R6SA 4EGZA 2KFDA 4LITA 2EQRA 2K86A 2KRHA 1TNTA 2OF7A 2O7OA 2VASA 1JI8A 2H8WA 2IS4A 3BR2A 3ABLH 1ETYA 3JTHA 1W36C 2F5DA 3HOXJ 2H27A 1R4MB 1H89C 2QSGX 1FYKA 5D6EA 4PJLA 2JPBA 2VC1A 3RKQA 1W5CC 3A4CA 1E17A 3DKWA 2IAIA 2VQCA 4A3GJ 2RREA 2DJIA 2ADUA 2ESNA 4M74A 1T2KA 3VYRB 3RQIA 5D5VB 3KP4A 2LD5A 2WA0A 5GAHJ 3BTJA 2QBYA 2YX4A 5HDGA 4HQMA 3WU1B 3E6CC 1YOVB 2MG4A 1GVDA 2NOGA 2O8XA 4OAZA 4ZDOA 1XD7A 2E1MB 3GTJJ 4BQOA 5ICFA 1O3SA 4AD9A 2FRHA 3L2UA 3GVAA 3OS0A 2XF7A 1MBFA 1XPXA 1SANA 2EZIA 4EM1A 1O3TA 2K5CA 3KX2A 3MKWB 4XORA 4L9JA 1R6RA 2WB1N 2HOSA 5F08A 4LJZF 1HKTA 1NHAA 2XAFA 1YFHA 2V26A 3PO3J 1FOYA 4AIHA 2LP0A 4YIIA 4F55A 1SVOA 5E3OA 1SFOJ 1IDZA 4NC8A 3J7AY 2LTPA 3VDXA 5D4RA 3PO2J 1HDDC 5DYMA 5F0FA 5EG0B 5M3FJ 1ETOA 4CCJA 1XMKA 1VQ9I 3CCUI 4CUGA 3IH3A 1Z0XA 2K7LA 3CF5F 3SDBA 4ZH4F 3CJTB 4HF2A 1G2HA 3OL4A 3CJNA 2ZXHA 5LHGA 3OYCA 3LSTA 4EVIA 3QYFA 4C3JJ 1TWHJ 1YX3A 1SMYF 3VYTB 3LWFA 1LFBA 2EIMH 2ZFWA 1QHGA 5HLHA 3BG6A 3ZQQA 4CZCA 4Q48A 3DBRB 1HA8A 2LNBA 1P4AA 2HWVA 1QGPA 3BTLA 3ZQIA 1ZHFA 3H3UA 1NTCA 2CS3A 4E4HA 3S1RJ 2K9NA 2IBDA 2BV6A 1I3QJ 1MH3A 2HQRA 2LK2A 3FM3A 2P81A 4G7ZF 5E17F 4QIWN 2VLAA 5J8CA 2E7WA 1ZLKA 4KITB 4M6VA 1GXQA 2HOEA 2W82A 4KICA 1T0FA 2ACJA 1A04A 4PCQA 1BI3A 1K79A 4XQFA 2BXYA 2NVUB 3W6JB 4A5MA 3C1DA 1EV7A 1V54H 4J01A 1Z91A 2QZ8A 4QPOA 3KLNA 3VSKA 5LRSA 5E1XA 1DQUA 1ZGJA 1WJDA 3FDYA 2KP6A 5EF6A 3H5NA 3CCLI 4RMNA 4DBRA 2GWRA 3S1MJ 2LY2A 3I71A 1MNDA 4EMSA 2IA1A 3SFIA 2L7ZA 2M2EA 1Y6IA 3RPQA 1R4NB 3AAFA 2A61A 4LLLA 4W1UA 3HOSA 1RI7A 2ZJPF 3FXQA 2UXNA 3BZKA 1IGNA 4LFUA 1FWZA 3QOEA 1E0EA 4P5OA 4LLGF 1R7JA 3BZCA 4P9UA 1IJWC 1F9NA 3CCJI 1K78A 3C18A 2Z16A 1OLTA 2BZTA 2RAEA 4G94A 5E1ZB 3K7AJ 2EV5A 2XVCA 3B6CA 1BR1A 4CDGA 2YS9A 5F1JA 2VXZA 5CPRB 2MC3A 1FX7A 3KYDB 4ITVA 4QTRA 1T0FC 1OR7A 3EUAA 4FE7A 5JFRA 2R7FA 3U2RA 3ONQA 3CMYA 1WWXA 3C2HA 4JX5A 5L3FA 2R0QC 2M0MA 1WVRA 2Y0SA 4J00A 2Q2EB 3LL7A 1SVMA 2EH3A 2M8EA 4GYIA 2RC4A 5E1WA 2GXAA 3LFKA 3HRSA 1X4PA 2EFWA 4HLXA 1W36D 2HTJA 3O6BB 5BMZA 1R49A 4M3FA 1FOKA 3SJMA 3Q9VA 3DF8A 2HFHA 2R7WA 3F8BA 1MJBA 1U8BA 4II3A 3PL8A 2R5ZB 1IV6A 1OCZH 2ESHA 4M72A 2D2WA 4A3CJ 2HEOA 1C0WA 2F2EA 2Y30A 3BZ6A 3NQOA 5KAIC 3CO6C 3DFGA 5L3CA 1I3AA 2LKXA 1DPUA 3HL2A 4V2GA 3A1YA 5KVRA 3J7YJ 2ELHA 1JJ6C 2LG4A 3FISA 4Q47A 1U3EM 1VTNC 3PSIA 2RKHA 2ZJRF 3I4MJ 1D8JA 1OR7C 4Y17A 3GTGJ 3GBGA 3ZMSA 3OYLA 2GIZA 2KIMA 2I5UA 2Q0OA 4YFKF 1UHMA 1WJCA 4PGGA 3IKTA 3K4BA 1IN5A 2QYOA 4LOCA 5F0CA 4HX4A 2HZDA 3FX3A 1T39A 4A93J 3NAUA 2R7QA 5EGOB 2JRMA 4EJOA 5HDKA 3C7JA 5D5WB 2ZMEC 3SEQA 3O8GA 2NNNA 1FNNA 3P7NA 3QYBA 5GP9A 4MNUA 1X1CA 2BE5F 3ABMH 2F5VA 1H8AC 2NNYA 2IXSA 5EG0A 2NOJB 2HVRA 2X48A 2M1BA 4OAYA 2DOFA 1U78A 2O6GE 4D0PA 3IV5A 1A6IA 1TW2A 1ODDA 4IOCF 1BW5A 2OD5A 2M4GA 4R79A 4E7LA 4BBRJ 3JTGA 2DDBA 4UV9A 2FF4A 2BOLA 4D5CA 2FJ1A 5J6XA 1YO5C 4ENMA 3CMAI 4BJ5C 1JUSA 5FRMA 4EJUA 3DLLF 3TOBA 4F92B 2W7NA 1VQ5I 3AKZA 1IZ1A 1P7JA 3PQKA 2E1MC 4E6KG 3P9CA 4O6JA 5CQEA 5IP9J 1PYVA 3WTTC 4CYDA 1OYIA 2V1UA 4RB0A 4BEHB 2O5RA 5B1AH 5DUIA 2V6CA 2MGQA 1QZEA 3LFUA 3DU6A 3RPUD 4L5EA 1I6HJ 1X2NA 4DBQA 1SVLA 3NWSA 4HYEA 2K85A 1JJ8C 3ZQLA 2QENA 2Y31A 3CDHA 1XSXA 3SZPA 1O3RA 1KU7A 4EM0B 2CFXA 3LSKA 3ZMDA 2IGNA 3CJRB 3OL3A 2VPRA 1X4OA 5KAFC 3KETA 2MABA 4P55A 2UWMA 1ETWA 1I50J 3E3VA 3EUHA 5HLGA 1FYLA 1E3HA 1X58A 1YE9A 2WBMA 1TT0A 2XPWA 2D1HA 3FXUA 3DKYA 2LF8A 1IAWA 4XLHA 2VBYA 5L3DA 5DS9A 4IF4A 3W2VA 3DTKA 4E7HA 1U5TB 1WGXA 1HKSA 4CCOA 4ABZA 1JGGA 3CUOA 1HDPA 2A6TA 4ENJA 4XICA 2ISYA 3RKXA 2HDWA 5BNGA 4DNCA 3VOEA 4A0YA 4FX0A 1ON2A 1ZG5A 1LQ1A 4M9ZA 2XAHA 2QQ8A 3H3ZA 2EV0A 4CA0A 2VKEA 4L9TA 2FD5A 2CQNA 1QZYA 4HX8A 3WG7H 2D5VA 3MVPA 4RBOA 2VJ4A 1EJ9A 3LSPA 4XLCA 2K9QA 4Q5SF 4XNFA 2FBIA 1MSFC 1R1UA 4RGSA 3PQJA 1LEAA 2XGCA 4G12A 3MAJA 1JXSA 2X6WA 4U0WA 1AKHB 1YJ9I 1X3WB 3PJRA 2QUFA 3EUHC 2VN2A 2XGXA 1D0XA 2M8GX 1HCRA 1VQKI 1DU0A 3JRHA 3FXJA 2X1DA 4CICA 1S9HA 4C2UA 1V55H 4XM3A 2DT5A 2EBIA 4HQEA 4ESBA 2LC2A 2Q2EA 2R92J 2EJRA 2BEOA 2X1EA 4PJNA 1MMAA 3BR5A 3K1NA 4XIDA 4FTHA 4OIQF 2CUFA 3LAPA 3AG3H 4N4OB 4PFPA 1O7LA 2O0YA 1D5YA 4Y13A 3HOTA 4IZZA 2IT0A 3CD6I 2XC7A 4YRVA 2AS5F 5E3MA 2OZUA 4I6ZA 1HW1A 2EIJH 4BS9A 4LLNA 3CLQA 3Q0WA 3GMEA 2JVHA 2ZSHB 4ZYHA 4HW0A 1FMVA 1UHWA 4UXNA 2R5ZA 2IW5A 3DV8A 1QO0D 3M07A 2E1NA 4UVCA 3TGNA 1T8IA 4BU2A 3OSFA 4E7ZA 5J40A 1R5GA 2FEZA 3DP7A 5GAEJ 4HEA2 1JKQC 2DA4A 1AHDP 4BY1J 1WJAA 5TGTA 3E0JB 3GFMA 2JSPA 2MLKA 3G2BA 2BW3B 3GF2A 1E2XA 1UB9A 3BJOA 4D5FA 4G8XA 2GBYA 1IXCA 3DQVC 1B9NA 2EV6A 3MKYB 4LIVA 4CZZA 3ZMUA 5E8GA 4XN3A 4P96A 3M1CA 5K5RA 1DP7P 3SHFA 3TKYA 1Z67A 1BJZA 2E5NA 5FFXA 1UAAA 2XAJA 1Y0UA 1J7KA 4S04A 5EGOA 4KT5C 4HDUA 2V4JC 2NYXA 5LGUA 2ICWG 3V7RA 2R4GA 1BR2A 2Z2SB 5IT3A 2QQ9A 4LMYA 4G6QA 4BACA 2ECCA 2L0KA 4MEYF 5M3MJ 4ANJA 1UELB 5IOZA 3BP8A 4MGRA 2HYFA 4YG2F 2DMNA 3VSLA 4KUMA 3SXYA 2Z33A 4MO7A 1U9NA 4LK1F 2L3DA 2F5EA 3BTCA 4WX9A 4IHTA 4RAYA 3IH4A 1SD7A 2Y0SN 3OWTA 2GQQA 2JRTA 3WGIA 3B6AA 1T33A 4QLCU 1ETVA 2LLKA 2VJ5A 3BR3A 4S0HB 4EJVA 2EILH 5J3LA 4CXFA 3GZ6A 4XSXF 4U7BA 4L0YB 1RUOA 4ESFA 3JRDA 1POGA 3KEYA 2YU9J 4XRFA 3R60A 1HQCA 3BG5A 4A2UA 4BEHA 4BQQA 3I4NJ 4X6AJ 1WI9A 1WCMJ 2FOWA 1QVTA 2RGVA 1UMQA 3KIOA 2XSDC 2IGMA 5ED4A 1AOYA 3DEEA 1BL0A 1MGTA 4XLNF 2XROA 5E18F 1KONA 3I58A 1WSUA 5CVUA 1NK2P 4OOIA 5HS7A 9ANTA 2RN7A 1LEBA 2ETHA 2CUJA 3TO9A 1J9IA 3QP5A 2A6EF 2KZGA 3WE3A 1W0UA 1STZA 1BC7C 3HTUA 3HSFA 1U9OA 1RR8C 4AIKA 1KQ9A 3E5XA 5KNLA 4A5NA 1XC5A 5JHUA 1U5TA 2HVSA 5EJCA 3UR3C 3WGGA 1KYZA 2X0LA 1ZREA 3ECHA 4BYYA 4RLQA 2CH0A 2MH2A 3BR0A 4EQQA 2E5ZA 2I8DA 1W7PA 4UV8A 2OPTA 4M3EA 3UKGA 5HS8A 3MQ0A 4XKBA 5BQTA 2VBXA 3KPHA 1LDDA 3HGYA 2XAQA 3CCSI 3S2HJ 4BQNA 5JLWA 1JHFA 2L7FP 4HAMA 1VQ6I 3JCUC 1MBEA 2HR3A 2KHMA 3VYSB 1HLVA 3M4OJ 3SDGA 3BCBA 1K61A 4C3IJ 3QPTA 3S3NA 3CMMA 2DPUA 3GWZA 1BI1A 1B59A 1RESA 2F5FA 1UHSA 2W48A 4P9FA 2M3AA 1GVJA 2JJ7A 1ON1A 1S3JA 4I02A 3PSFA 2VOOA 3ASNH 2N8GA 3OR2C 2WAEA 1YYVA 2L9VA 1WRJA 1GT0C 3HKZA 4NNJA 1LPQA 1G3TA 5CVJA 3H35A 1AKHA 3LSMA 2ELKA 1XS9A 1XTAA 3K6GA 2K4BA 4WF2A 3QRFF 3WTZA 4V19K 1Q1VA 1V4RA 3FF5A 4HBLA 1F5TA 5H2FC 3KZIC 2DODA 3L1PA 1QBJA 1U5TC 2HXOA 4DW6A 4RB1A 1X1PA 4WXHA 3HIFA 1HXDA 1X3UA 3FXLA 4XOPA 1TNSA 3RKYA 3PFIA 2JA6J 3I64A 2TCTA 4E70A 4RB2C 1FY7A 4KMUX 5D8LB 4YFNF 1OCTC 3DTEA 3F6VA 2DCEA 2K9LA 2R7UA 3H92A 4F3QA 2DT7B 3IWFA 4LG3A 1JGSA 1V5EA 3OYFA 1KU3A 2ZMEB 3KCCA 2HOTA 1HOMA 4A6DA 1RKTA 3VPRA 5K7ZA 3A03A 4DYQA 3I4PA 4H0EA 1OYYA 1S5LC 5EEAA 2KQRA 4L5JA 5LEJA 1CF7B 1OJLA 2LOOA 4IXAA 3MCZA 4BHCA 2DTRA 2Z1DA 1MMDA 3QAHA 4AVPA 3VEPA 1ZR4A 1MBJA 1I6XA 3VWBA 4CGZA 4N0BA 1D8KA 1FT9A 5FB2A 2CV0A 2X85A 3JRIA 1ITYA 2LRDA 5GPAA 3WTYC 2JZYA 1ZG1A 2VIXA 2BW3A 2M9HA 2HYGD 5CJ9A 2ME0A 4I01A 4BJTA 3OS2A 1VQNI 3OYJA 3DTIA 3RQ4A 3BPXA 1JT0A 3K4LA 1P6RA 2IVMA 4BAYA 4M3DA 2DDAA 1IXRC 2IA0A 2MC4A 4I76A 2ELJA 4L9NA 2V79A 1YITI 1L3LA 4R8HA 1PUFB 3WG9A 2OTLI 4YFXF 2NS7A 1RZ4A 1EF4A 5IT9K 4WXCA 2Z9OA 3OYHA 4RA2A 2XUBA 1RETA 2A68F 3CESA 3K1MA 2L9NA 3KE2A 3SYTA 4DYRA 4DZPA 4ESJA 3VB2A 1XSDA 2STWA 2MW8A 5EYRA 5M5YJ 1RRJA 1EH7A 2Y48A 1Y0NA 4AYBA 2G9WA 5EEGA 1YW7A 1Z77A 5IY5H 3TL4X 1DPRA 2KKOA 3LSJA 3RPUA 1MZBA 1E3OC 3G73A 4XONA 4H4KC 3K0LA 1S72I 2E2JJ 1MDMB 1QPMA 4I7HA 1ZTRA 3WTVC 3EDPA 5BOXA 2VT2A 2VT3A 2KIQA 3EYYA 5J4VA 4GRIA 3R61A 4MTEA 3L2VA 2M45A 5L3BA 2OTJI 1R36A 3F3XA 3M9AA 5LHIA 2DOAA 4NDLA 3GW2A 1EH6A 3QODA 2V1NA 3GX4X 4L9VA 3FBNB 2LKSA 5FLXZ 1IUYA 3OS1A 4PJ0C 4RB3C 2K3PA 2BHYA 2LH9A 2G7HA 2XB5A 2FQ3A 2NVXJ 1U8RA 2JTVA 2XF5A 1T38A 1W5SA 1FIAA 1DUXC 2RQPA 5HNFA 3FIWA 2VONA 2M4KA 3ULQB 5IPAA 4Q4ZF 3Q5FA 1U6GA 4EJTA 2NS8A 3NWTA 1FBSA 3KEOA 3HOWJ 2M34A 4I0AA 1P92A 4IHXA 1JTYA 1SFEA 1LB2A 2HPIA 4UB8C 1SAXA 2JA5J 5LD2C 4UUVA 1G8XA 1WH7A 4KN4X 3HYIA 4R1HA 1RUNA 2BGCA 2LY9A 2VOPA 4BHPA 1P4XA 2V1XA 5HLTA 4FCYA 1G59A 1IN4A 2UZKA 1I27A 2P5KA 1J09A 5F27A 1T6SA 2BY3A 1LE8B 3HOYJ 1IC8A 2JK3A 2K27A 3CQZJ 5HODA 2P0WA 3CJQB 2QEXI 1SD6A 4HNTA 3HBLA 1U2WA 3PM1A 3H9JA 4IRIA 2AQFA 2HS5A 1FEXA 2FUG2 1TT5B 3FK7A 1X3ZB 3IWZA 5HDNA 2E19A 3LA2A 2X4HA 1CGPA 4Y52J 2OQGA 3Q0VA 4KT6A 2LVSA 3JRBA 1TWGJ 3MMYB 3L7WA 2COMA 1ENHA 2ZXJA 3ZR8X 2YU3A 3CC7I 1I1SA 4C2TA 2L2OA 3RYRA 4A3DJ 4N9HA 2R7DA 2A5WA 2MH9A 4HZFA 5K5OA 3ZOBA 1K6OA 4C3HJ 2H1LA 1TTYA 5BPDA 1ACIA 3S93A 3TO7A 4IHYA 1YS6A 4IHWA 3ZMZA 1MJ9A 2PMHA 3C2GA 3ML6A 4FT8A 1XG1A 3CTAA 5D4SA 2W1OA 1BW6A 2LY1A 2Y0MA 4RAFA 2W00A 1W4MA 1FYMA 2GM4A 1OMIA 3ERMA 4ZYAA 4LGWA 3BTIA 3P9KA 2VODA 2HKXA 2QCOA 3G3ZA 2KMUA 4CCNA 1QQIA 4UNOA 4W97A 5FLXK 2OAZA 2P6SA 1A6QA 2ZMEA 2XHKA 5C44J 3UNGC 2DOEA 4BQAA 4XL9A 2IP2A 3Q3SA 4KIBA 1I1GA 2LREA 5EZHA 1EKEA 5B66C 1CF7A 1Z21A 3BG3A 4RM3A 2X6XA 4UB6C 1E3PA 1D0YA 5KHDA 4BUPA 1PP7U 2AQEA 2CW7A 3RKWA 5IP6A 2IS1A 2IGOA 2LDUA 2CV2A 1MH4A 3ECOA 3JRAA 1O4XA 4HV6A 2A07F 4M6XA 3ZGKA 2UXXA 3GTLJ 3WGHA 2P7CB 1P4WA 1R22A 3OIPA 5JVTA 1MBGA 1MMNA 2PX9A 1HW5A 2AXTC 4ETSA 2OZ6A 3C2BA 1PVEA 2VQLA 3I53A 5J8FA 1F43A 3BC8A 4RAGA 3B73A 3H0GJ 1LJ9A 2EWNA 1FMWA 1PUFA 2FMLA 1SAUA 5ILVA 2LSOA 3HRTA 3VODA 3W6VA 3W3CA 2L01A 2YR2A 1R1TA 1MKMA 3ROUA 1O7FA 2OC6A 2ZCWA 1VNDA 2PJRB 2NVTJ 5ICCA 4HNVA 1KU2A 2XSJC 2X6OA 3GZNB 3OYKA 3H5AA 3A02A 3FHNA 3LOCA 4EATA 2IA2A 3MKZA 1B6AA 3LNQA 3CUQB 2CU7A 2EZLA 5FKMA 4A3MJ 4RLFA 1FPQA 5IYCJ 2ZKZA 2XKOA 2WY7Q 3HKZN 1I5ZA 1MDMA 1R58A 3ZQHA 3DKXA 3BG9A 1V5GA 2WAFA 3QU6A 4DIQA 2QSHX 2PN6A 2ME6A 4F52A 3BR6A 1UG2A 2W84A 5KK1A 3F72A 5K7HA 3JRCA 4I2OA 1FJLA 1ETKA 3GLXA 3TBIA 3FXKA 2XPVA 4NC6A 3DBLB 3G4SI 2JA8J 3E5QA 4AU7A 3M8EA 2VPLA 1YI2I 1HC8A 1MMSA 3P9IA 5IYBJ 2COBA 5FD5A 2A05A 5FKLA 3QOPA 4ZZDA 5DD4A 4ZYEA 1J75A 2AXLA 4WXDA 1MNEA 3LA3A 2STTA 5ILUA 4I0BA 3IKVA 4AUXA 5B5EC 2QLZA 5JR3A 1ZK8A 3SZTA 4UVBA 4GYGA 3AG2H 5CQGA 3W2WA 1XN7A 5L3EA 2RNJA 2Y2ZA 1WPKA 3F0CA 4I09A 1OPCA 4B8XA 4I99C 4HRIA 4OIPF 6PAXA 4FHTA 2V6EA 4MFEA 3KEQA 5A2QZ 2AHQA 3NRVA 4XRSA 4QPQA 4XN0A 1JKRC 3F22A 1LE8A 3BDDA 3ZMTA 2OCCH 2E2IJ 5D5XB 3DEWA 2L54A 2L5QA 4BJ6C 1YRNB 2ZJ2A 2DYRH 3E5UA 2L4MA 2QQBA 2XV4S 4PSWA 1YIOA 3F8CA 3CF2A 5AIQA 3CO7C 1G3YA 1B72B 3CCVI 3EQLF 3K70D 2GOMA 3TO6A 2HKOA 5J1UA 4AYBN 3I59B 1F1ZA 2QGUA 2PMUA 1AWCA 4GCVA 1ZRDA 2DXIA 4FETA 3GFJA 1FSEA 4JOMA 1IV8A 1TQPA 3W6KB 2GA2A 3D1NI 5FKOA 2GXBA 1YG2A 2KLOA 4HLYA 2DMPA 5J4YA 5B3SH 4M3GA 2KPMA 3D5SC 2KL4A 1D1CA 4D7NA 5J1YA 2PEXA 2WV1A 3B02A 3CDIA 3RIRA 2MA3A 2WV0A 2CGPA 4LD5A 4V2FA 1D3YA 1GLNA 1P9QC 5CVVA 2E1CA 3LSIA 4NQWB 1SEUA 4IHVA 3OYDA 4RGXA 1UZCA 2HPMA 1Z3XA 3F8FA 3MD2A 2E71A 1RPWA 1WZ2A 2VBWA 1TQMA 2MD5A 3QYEA 3HRMA 2DFIA 4M6YA 3K4MA 2KJCA 2XAGA 2DW4A 4B48A 2YUSA 3K69A 3WTUC 3JRFA 1B9MA 4I98B 1MSEC 2PJPA 3S2WA 4YIFA 2H8RA 4U0VA 2PI0A 2H6BA 3RSNA 2VBZA 4C9YA 2RVCA 1ZGAA 3CZ6A 4XR6A
chains in the Genus database with same CATH topology
3I9V2 2M3AA 4B44A 3PSFA 3OR2C 2V9KA 2WAEA 2IS2A 4U87A 4PFOA 3HKZA 4NNJA 4BE0A 1Y56A 3H35A 2VLAA 2IS6A 4KITB 3LSMA 2CMPA 3K6GA 1D0ZA 2W82A 4BXFA 1V5FA 4FASD 4PJMA 1D1BA 2L7KA 4XQFA 4F93B 4BDYA 4J01A 4QPOA 3IP4B 3VSKA 3ZXSA 3A2KA 2VJJA 3EPZA 1DQUA 4XOPA 3I3LA 4CCKA 1QHHD 1WJDA 3FDYA 2KP6A 3PUBA 3H5NA 3DTEA 3HXLA 4RMNA 2DCEA 2K9LA 4DBRA 1SFKA 2R7UA 2LY2A 2PJRA 4F3QA 2DT7B 1MNDA 4LG3A 1V5EA 3OYFA 4BGDA 1NG6A 1WJEA 4HNUA 3H9QA 1Y6IA 4P1WA 2KRCA 4XMYA 3HOSA 4DJAA 3TMOA 3ZCOA 2OUMA 2KQRA 3D5LA 3QOEA 4P5OA 4YEJA 4CCMA 1E0EA 4ZC3A 2LOOA 4XKVA 2W4SA 2Z16A 1OLTA 2Z1DA 1MMDA 3OYGA 3RCOA 2VKHA 3VWBA 4LIUA 1BR1A 4HSRA 2CV0A 2VXZA 2XF6A 2PMZA 3FKJA 2X85A 5CPRB 2LRDA 4CCLA 4ITVA 1T0FC 3S32A 5CKTA 3EUAA 2VIXA 2BW3A 4BJTA 3OS2A 3SEZA 3ONQA 2OV7A 3OYJA 3DTIA 3RQ4A 3OR1C 3C2HA 3K4LA 4XLAA 2M0MA 2Y0SA 2E60A 4J00A 2MC4A 2MFZA 2ELJA 2Q2EB 2IGKA 3LL7A 4PUSA 3K4KA 1X4PA 3OYHA 4CSWA 2X1CA 4C30A 3CESA 3SYTA 2L9NA 1W36D 3OIQA 3HC7A 3OYMA 4F91B 4AYBA 1K6YA 2R7WA 3TL4X 2R7XA 4IQJA 4II3A 3LSHA 3PL8A 2WB1A 4XONA 4H4KC 3L2QA 2ZFUA 2JA2A 1BOBA 3HL2A 3N05A 1PJRA 3A1YA 1ZELA 4GRIA 2JVGA 1AA7A 3IAM2 3CP8A 3L2VA 2LG4A 2BVLA 3OYEA 3PSIA 2BVMA 2VB6A 2DOAA 1OR7C 2L9SA 3QODA 2Q1ZB 4II2A 2V1NA 3GBGA 3OYLA 3PNTA 3FBNB 3OS1A 3D5RC 2K3PA 1WJCA 3EUKL 2LH9A 1QU3A 2XF5A 3K4BA 1IRXA 4JQFA 5HVQC 5HNFA 1N77A 2M4KA 4PK4A 3OY9A 3PNVA 2HZDA 2LBFB 3OOUA 2R7QA 3NWTA 4ZDPA 3S8PA 3ZRGA 3SEQA 4ZTJA 4HG2A 3DU5A 3QYBA 1DGWY 2HPIA 3VYUB 2LYCA 5LD2C 3RTRA 4E7KA 1X1CA 2UUZA 1G8XA 4MLOA 2F5VA 3AL0B 2IXSA 5HNHA 4ZTFA 2NOJB 2HVRA 4OAYA 4XKWA 2X51A 4X0GA 2R7SA 1DP3A 5HLTA 1G59A 2M4GA 4R79A 3K4NA 4E7LA 1J09A 1LDKB 2ZSIB 2KZVA 2BOLA 1YX5A 2VQHA 1Z7LA 2P0WA 3CJQB 1EA3A 4BJ5C 5FRMA 1DGRM 4HNTA 2QKMB 4F92B 3H9JA 3HPHA 5JHFA 4D1QA 2W7NA 2V7FA 2AQFA 2GOXB 3AKZA 2FUG2 2QKLB 2E1MC 4E6KG 2R7TA 5CQEA 1PYVA 1X1DA 4KT6A 1UG0A 4BEHB 1LVKA 2O5RA 3MMYB 4XLEA 4XLFA 3LFUA 3ZR8X 1MMGA 1U0JA 3DU6A 2R7OA 3RPUD 4C2TA 2L2OA 3NWSA 4DBQA 2K9MA 1ERDA 2A5WA 4E7SA 3LSGA 3LSKA 4HPQA 4OWRB 2IGNA 3CJRB 3OL3A 1X4OA 1X1AA 2MABA 3HUGB 2UWMA 3S93A 1YE9A 2WBMA 3C2GA 4NUBA 1TT0A 2WADA 4NC7A 3DKYA 2CV1A 4XLHA 2W1OA 2LY1A 2HU9A 2W00A 3SZGA 4B43A 2RNGA 3W2VA 3DTKA 3CP2A 2WAQA 4E7HA 4CCOA 4ZDLA 4E7IA 2X6YA 3PNYA 3V42A 4ZYAA 1Z3YA 4D9JA 2A6TA 1LKXA 5FROA 4BDZA 4XKCA 4KISA 3OYIA 2HDWA 2KMUA 4CCNA 3DLAA 3S3OA 4DGWB 4N4NB 4Y3OA 3UNGC 4XL9A 3F9KA 4CA0A 3IAS2 4KJZA 2UV1A 2VXDA 2LREA 2XAUA 1N78A 4YELA 3H5RA 1Z21A 4RM3A 3K4JA 2VJ4A 2X6XA 2MD0A 3DPUA 1D0YA 4XLCA 5KHDA 4XNFA 2ZXIA 4BUPA 2AQEA 2CW7A 2M7BA 4ZJZA 2IS1A 2IGOA 2CV2A 2X6WA 2MYSA 3BG7A 1WJFA 2R7RA 3H9GA 3PJRA 4HSTA 3EUHC 3AL0C 3ZGKA 1D0XA 2CUZA 2VL8A 2X1DA 1S9HA 4Y4RA 4C2UA 3H0DA 4XM3A 3OIPA 1MMNA 2CW8A 1WFXA 3LMMA 2VQLA 3BC8A 2LC2A 2X1EA 1FMWA 5LFAA 4B47A 4PJNA 1MMAA 5KCMA 4G6TB 1SAUA 4BL0B 3DWLE 4N4OB 4PFPA 4IZZA 3HOTA 3W3CA 2XC7A 4YRVA 3PFYA 3DPLC 1N75A 2OC6A 1LFPA 4BS9A 2PJRB 4IKFA 3OYAA 2XSJC 3OYKA 3H5AA 1D1AA 3AFHA 4DOZA 2ZSHB 2JVHA 3FHNA 2VJIA 1X19A 2VQGA 4EATA 3MKZA 4BE1A 4RM2A 1FMVA 4RLFA 2WY7Q 2R7VA 2CFOA 4BE2A 3E1SA 4BU2A 3DKXA 4E7ZA 1V5GA 2WAFA 3HG9A 3L2WA 1NG7A 4DIQA 4HEA2 2HVQA 1WJAA 2M7AA 5TGTA 3E0JB 2HQAA 2JUGA 4F52A 3L2RA 2JSPA 2HNHA 3G2BA 3OYNA 2BW3B 3TBIA 2RQQA 3BLYA 4AVZA 1X1BA 2F4IA 3DQVC 1TZLA 4AU7A 3W2AA 2VPLA 3MKYB 4LIVA 5HOOA 1WJBA 4CH7A 3S3MA 3U21A 3HPGA 4XN3A 2DT6A 4B3XA 3M1CA 4XOTA 3KYLA 1MW7A 2WY8Q 2E5NA 1UAAA 3K70C 2LBFA 4LITA 2KRHA 1MNEA 1JI8A 2VASA 2IS4A 2V4JC 1W36C 2R4GA 1T95A 1BR2A 2Z2SB 4BACA 5CQGA 3W2WA 4PJLA 1WJ5A 3A4CA 4ANJA 1UELB 4HRIA 2VQCA 2RREA 2V6EA 3VSLA 4IX7A 4E7JA 3DPTA 2DJIA 4PJJA 3VYRB 4QPQA 4XN0A 2WA0A 3OWTA 3BCAA 2L5QA 4BJ6C 2VJ5A 4PSWA 4OAZA 3CF2A 4ZDOA 4U7BA 2XDVA 2E1MB 1BR4A 3KEYA 4BQOA 3OYBA 2GOMA 3K70D 3FBIB 3L2UA 3OS0A 4BEHA 2XF7A 4BQQA 2DXIA 2K5CA 3KX2A 4FETA 4JOMA 4XORA 3MKWB 1R6RA 2IGMA 3DEEA 4IQ4A 3IUOA 5FRNA 2V26A 4PSXA 2KLOA 4F55A 1KONA 1VZ0A 2KPMA 4NC8A 3D5SC 3J7AY 2KL4A 3VDXA 1D1CA 4CCJA 2CUJA 4CUGA 1GLNA 1P9QC 3SDBA 3LSIA 2VKDA 3OL4A 4NQWB 2F6CA 2ZXHA 3OYCA 3OYDA 3K10A 3OMYA 5KNLA 2HPMA 1Z3XA 3QYFA 2HVSA 3UR3C 3MD2A 4Y33A 4RLQA 1YX3A 2CH0A 3VYTB 3QYEA 2E5ZA 3M8JA 3K4MA 2I8DA 4B48A 1QHGA 4XKBA 3K4CA 3BG6A 3ZQQA 4CZCA 1HA8A 4BQNA 2KDOA 3RSNA 2KHMA 3VYSB 4C9YA 2CS3A 3BCBA 4E4HA 3S3NA 3CZ6A 3CMMA 4XR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XF7 A;  2XF5 A;  2XF6 A; 
#chains in the Genus database with same CATH topology
 1GXP A;  4LG0 B;  4EM2 A;  4BNC A;  3I9V 2;  1QNT A;  4ASN A;  4B44 A;  4LK0 F;  2JMW A;  1Z1D A;  2V9K A;  4L18 B;  2IS2 A;  4PFO A;  2MSY A;  1ZKG A;  2CQ7 A;  4BE0 A;  3U1K A;  4KDP A;  1IUF A;  3K1P A;  3LSR A;  2CMP A;  5JVG F;  1D0Z A;  2LFB A;  4BXF A;  1V5F A;  2EA4 A;  3ESW B;  2IPQ X;  4PJM A;  3O8H A;  1BC8 C;  1D1B A;  4A0X A;  3QWL A;  3ABU A;  4IVN A;  1KZH A;  2VE8 A;  1GV2 A;  3LQR A;  3T8T A;  1R5H A;  1QVU A;  4GFB A;  5A2Q K;  1BBY A;  2VJJ A;  5D5U B;  3GEZ A;  3EPZ A;  5F1R A;  2H09 A;  3I3L A;  2NXN B;  3N4M A;  1QHH D;  3HOZ J;  2H94 A;  4KIF A;  1XMA A;  1JKO C;  3HXL A;  1IRF A;  3RI4 A;  4HF1 A;  3CCQ I;  3BT9 A;  5LGT A;  2Q8K A;  2PJR A;  5FLM J;  1T08 B;  2DA5 A;  4MEX F;  3IL2 A;  1NG6 A;  2Y75 A;  3CC2 I;  4JK1 X;  3P5J A;  4P1W A;  5E79 C;  2KRC A;  3CUQ A;  4XMY A;  3GTP J;  2P8T A;  4A69 C;  2CQK A;  2ZB9 A;  2DMQ A;  3TMO A;  2CQQ A;  3FZV A;  3ZCO A;  2OUM A;  4KA4 A;  4ZC3 A;  5FKN A;  2LKP A;  4XKV A;  2W4S A;  4OIO F;  2B9S A;  1IDY A;  2NS0 A;  2XGD A;  3OYG A;  3I54 A;  1NK3 P;  5GAG J;  2CQX A;  2VKH A;  2FE3 A;  4M71 A;  2E1O A;  2MLG A;  5M5X J;  2XF6 A;  2PMZ A;  4CCL A;  2JQ7 A;  1MJA A;  2GXG A;  4Z6Y A;  2M87 A;  3GTK J;  4XLA A;  3J7Z I;  1TBX A;  2DI3 A;  2E60 A;  3KP2 A;  5DCM B;  3JW4 A;  4PDK A;  3WOD F;  3HHG A;  2RV8 A;  2IGK A;  4JYK A;  3K4K A;  3WHB A;  1XDS A;  4HV5 A;  2DPD A;  2VE9 A;  2DFF A;  4CSW A;  4C30 A;  2Z3Y A;  1Y39 A;  3OIQ A;  2QVO A;  3IH2 A;  5M5W J;  1XCB A;  2PLY A;  3G71 I;  2F5C A;  4HA8 A;  2E7X A;  1OCO H;  4IJA A;  1FTZ A;  2R7X A;  3CUQ C;  2EK5 A;  4DQ2 A;  1ZGW A;  4BHB A;  4EJW A;  3I55 I;  2EB7 A;  1W5T A;  2VC0 A;  2OA4 A;  5FGM A;  3V7S A;  3MWM A;  5HS9 A;  1S29 A;  2JA2 A;  4F7Z A;  3RZD J;  1BOB A;  3ISP A;  2DTZ A;  3H1C A;  3N05 A;  1ZEL A;  4IEJ A;  4J19 A;  1FP2 A;  1F4K A;  2G0E A;  1KQ8 A;  4AID A;  2HXI A;  2JVG A;  3IAM 2;  3NEU A;  3CP8 A;  4U88 A;  4B1R A;  3O2P E;  4CO8 A;  3Q9S A;  3ZPL A;  1P2F A;  1BOA A;  4PGH A;  4QWQ A;  1VF9 A;  4OMY A;  1X2M A;  2JT1 A;  3F8M A;  2Q1Z B;  2DU9 A;  1YRN A;  2OJE D;  3I56 I;  3PNT A;  2PFB A;  2R3S A;  3K2Z A;  1YQA A;  2E36 A;  3ABK H;  3D5R C;  3E7L A;  3EUK L;  1QU3 A;  1B72 A;  2KIF A;  5TIS C;  3BJA A;  1IRX A;  2W57 A;  4M73 A;  1FZP B;  3I59 A;  3E97 A;  2FBH A;  4GDF A;  2HDD A;  2JPC A;  2JN6 A;  2MBF A;  1N77 A;  2DYS H;  2EFQ A;  1BN5 A;  1UJ8 A;  2LBF B;  4XK4 A;  5DCF A;  5LGN A;  3GFL A;  4MFD A;  2TRT A;  3V7C A;  3COA C;  2Y69 H;  3T5X A;  5E8I A;  3S8P A;  3WU2 C;  4ON0 A;  4ZTJ A;  2FOK A;  4HG2 A;  2BY2 A;  3DU5 A;  4A0Z A;  4EEF G;  1VI0 A;  3FMQ A;  1J59 A;  1DGW Y;  3VYU B;  2LYC A;  3T0Y A;  3A0B C;  4MLO A;  2O61 A;  1ORK A;  3QPS A;  5HNH A;  2NRA C;  1J0R A;  5F64 A;  2OU2 A;  5F0H A;  3LAJ A;  3QP6 A;  4KYW A;  4XKW A;  3FXM A;  2DA3 A;  2X51 A;  4WWC A;  4X0G A;  4Y15 A;  1FP1 D;  4NQW A;  4MTD A;  2FNP A;  3HJE A;  1ETQ A;  2CJJ A;  1LDK B;  2ZSI B;  2KZV A;  3MZY A;  3QPL A;  5CVI A;  1YX5 A;  2QSF X;  2V9V A;  3HSR A;  1DGR M;  1Z6R A;  4M9S A;  4BY7 J;  4IPA A;  3RJP A;  4B09 A;  1HKQ A;  2DO7 A;  5E3L A;  5JHF A;  1SD5 A;  4IO9 F;  2V7F A;  2GOX B;  3V4G A;  2QKL B;  5TJJ A;  1W1W E;  1X1D A;  1VQ4 I;  4XRS G;  1LVK A;  1TC3 C;  3CLO A;  1Z7U A;  2HQN A;  1CQT A;  3OOP A;  4LG0 A;  1SD4 A;  2R7O A;  2K9M A;  2TDX A;  1S7A A;  3MEX A;  4E7S A;  3LSG A;  1JHH A;  2EZK A;  4XBF A;  1R23 A;  4RDU A;  3TED A;  1VQO I;  4HPQ A;  1YW8 A;  3KP7 A;  2CG4 A;  1HW2 A;  4PZJ A;  3HUG B;  2HTS A;  1YW9 A;  2JWT A;  2XPU A;  5K7F A;  1JT6 A;  1R71 A;  4NUB A;  1HF0 A;  3HOV J;  4NC7 A;  4Y7N J;  2M5W A;  3S1N J;  1WH5 A;  4G7O F;  1T56 A;  2HU9 A;  4AIJ A;  1KQ0 A;  4DZJ A;  3OIO A;  3SZG A;  5ICG A;  4B43 A;  2RNG A;  3HTS B;  5EEH A;  4JP0 A;  2WAQ A;  2L7M P;  2H1K A;  2BYV E;  4KMF A;  4E7I A;  1ZRC A;  3V42 A;  4NBQ A;  2WWY A;  1Z3Y A;  2HOA A;  4XKC A;  4KIS A;  5B1B H;  5C4X J;  3DLA A;  2LMD A;  3FM5 A;  5K5Q A;  3REO A;  4KIG A;  4DGW B;  1PP8 F;  5AIP A;  2P7V B;  1TLH B;  4Y3O A;  2A69 F;  1ONV A;  3F9K A;  3IAS 2;  4KJZ A;  2EZH A;  2UV1 A;  2VXD A;  3LQQ A;  4YEL A;  5CLS A;  1PUE E;  1BJA A;  1ZR2 A;  1GDT A;  2PG4 A;  3TQN A;  1ETX A;  5EDN A;  3H5R A;  4BBS J;  5LRR A;  3WE2 A;  4GGG A;  3FXR A;  2VUM J;  3DPU A;  3PIO F;  3GTQ J;  2EIN H;  2ZXI A;  2M7B A;  1IN7 A;  3WHC A;  3IHU A;  3BG7 A;  3BQY A;  4IHS A;  4A12 A;  1WJF A;  2R7R A;  1B8I B;  4HST A;  1LFU P;  2W24 A;  3AL0 C;  1BI2 A;  2VL8 A;  1VQL I;  4BXX J;  3HB9 A;  5DCM A;  1A35 A;  1IF1 A;  3FWE A;  2DMU A;  1XGO A;  5LFA A;  4B47 A;  4G6T B;  3S2D J;  2J5O A;  1TW3 A;  3DWL E;  4BL0 B;  3J81 Z;  5CYV A;  3G6E I;  3QPH A;  2FQ4 A;  3DPL C;  2F48 A;  2JSC A;  1N75 A;  2FX0 A;  1LFP A;  3WTS C;  5FLV A;  1RKW A;  2OBP A;  3AFH A;  1IW7 F;  2DA1 A;  1XB4 A;  2VJI A;  1K4S A;  1Z05 A;  3G1M A;  2K4J A;  3JRE A;  4FIS A;  3U9G A;  3ZMV A;  3R0J A;  1MBK A;  3T1B A;  1KGS A;  3E1S A;  2ID6 A;  2E34 A;  2O9L A;  3L2W A;  2FSW A;  3WU0 A;  3JR9 A;  2HVQ A;  3ZN1 A;  2ZBK A;  4MQ9 F;  3TOA A;  2HQA A;  3VFZ A;  5ICE A;  4A6E A;  3L2R A;  2BHZ A;  2DQR A;  3BOQ A;  3A01 B;  3OYN A;  1SFX A;  4UY8 I;  2QA4 I;  1Y8R B;  4AM3 A;  2ZXW H;  1X1B A;  5IYD J;  1ZAO A;  5FJ8 J;  4M3B A;  4G6D A;  5DTD A;  3W2A A;  1TQI A;  5HOO A;  2B0L A;  2XRN A;  4CH7 A;  4U7D A;  3S3M A;  3U21 A;  3G1L A;  1RIO H;  1H9T A;  1Y1V J;  1FBQ A;  1MW7 A;  2WY8 Q;  4G9Y A;  4RGR A;  1IRG A;  1MIJ A;  3K70 C;  2LBF A;  3OSG A;  2VI6 A;  4IL6 C;  1SMT A;  1MBH A;  2P5V A;  2HZT A;  2H6C A;  2HYJ A;  3HDD A;  1RC9 A;  1T95 A;  2KJB A;  1K83 J;  5D6F A;  2FXA A;  2OCE A;  3GUD A;  1R9T J;  4IOA F;  2B63 J;  1WJ5 A;  5DDG A;  1YJW I;  1REP C;  1UCR A;  2FA5 A;  2PMZ N;  1TP4 A;  5IP7 J;  5DEQ A;  4IX7 A;  4EGY A;  4A3J J;  2AO9 A;  4E7J A;  1QRY A;  3DPT A;  4GO1 A;  3HEF A;  1H88 C;  4PJJ A;  2D45 A;  2P6T A;  3SQN A;  3T8R A;  1KYW A;  5IOY A;  2DLL A;  1QZZ A;  1WI3 A;  3MZH A;  2L4A A;  3CDL A;  3BCA A;  3H36 A;  1G3S A;  2ZO4 A;  3KP3 A;  1OKR A;  1S8N A;  3A0H C;  1WKM A;  3FMR A;  4S05 A;  2JA7 J;  1ULY A;  3V8L A;  5JI6 A;  2GA1 A;  2QF7 A;  2XDV A;  3DBH B;  1BR4 A;  1W7P D;  4CYC B;  3AG4 H;  3OYB A;  3BPV A;  1OYW A;  3F21 A;  5LHH A;  4AC0 A;  3FBI B;  4JX4 A;  1GUU A;  3NAR A;  4N9I A;  3PIP F;  1RNL A;  3ELK A;  1W0T A;  1LNW A;  2K9S A;  3J81 K;  3GFI A;  3HSE A;  2YX7 A;  2ZC2 A;  3L2C A;  3RZO J;  2GAU A;  4IQ4 A;  2YSR A;  2P4W A;  3IUO A;  4HX7 A;  4PSX A;  5FRN A;  2XGE A;  3E6D A;  2QM3 A;  1WQ2 A;  1VZ0 A;  4IRG A;  5BS6 A;  2IJL A;  3ASO H;  4G7H F;  4XRM A;  3HUG A;  1G3W A;  2CUE A;  3KYC B;  1SC7 A;  3KFW X;  1JTX A;  1A36 A;  1XSV A;  2DA6 A;  3HZJ A;  2DMT A;  3R0A A;  4YIR X;  2L9R A;  2X9D A;  2VKD A;  2XAS A;  2F6C A;  1XDU A;  1S6L A;  3KZY A;  4HOB A;  5D8K B;  3IRQ A;  3K10 A;  3OMY A;  2KDZ A;  3O3K A;  3KLO A;  4Y33 A;  1VQP I;  5GPC A;  3Q0U A;  1XGN A;  1S7O A;  1DDN A;  3M8J A;  4FQG A;  4XSZ F;  3WTW C;  3S1Q J;  2R93 J;  3CCR I;  3HGG A;  4BH9 A;  3K4C A;  1JUP A;  4O5V A;  3ZQC A;  3V8K A;  4DYC A;  1I39 A;  2KDO A;  2DBB A;  3J80 Z;  3M3Y J;  2CW0 F;  1L0O C;  4X1E A;  2K02 A;  3F23 A;  4WCG A;  2YPR A;  3N97 A;  1H9G A;  2ECB A;  2V9P A;  3TDU C;  4FX4 A;  2A5Y B;  2XRL A;  1XGM A;  1M1E B;  4U87 A;  3JSP A;  2O8K A;  2XB0 X;  1WHU A;  1Y56 A;  1J2X A;  2PQ8 A;  2IS6 A;  3BRO A;  3L9F A;  3U1D A;  2NVY J;  1B8I A;  2EFN A;  4WK8 F;  1FSH A;  3I0T A;  3MN2 A;  1HBX G;  1VQ8 I;  1OFC X;  4FAS D;  4A3B J;  2KRF A;  2L7K A;  4TV7 A;  4F93 B;  2CYY A;  2V1D A;  5DM6 F;  2QWW A;  4BDY A;  3ZP5 A;  3H3V K;  3E6M A;  5DM7 F;  1BA5 A;  1Q1H A;  1NH3 A;  3IP4 B;  3AG1 H;  3ZXS A;  3A2K A;  2ID3 A;  1A5J A;  3GXO A;  3K2A A;  4CCK A;  2CWE A;  2DAO A;  3PUB A;  1XMX A;  3V8J A;  4GXO A;  1SFK A;  1R1V A;  1HST A;  3R4K A;  4BGD A;  1MNM C;  2WC2 A;  1VQ7 I;  1WJE A;  4HNU A;  3H9Q A;  5E3N A;  3DXJ F;  2DA7 A;  1FBU A;  4C2M J;  2BY0 A;  4DJA A;  4MHG A;  2G7U A;  2LF7 A;  3CCE I;  3D5L A;  4YEJ A;  3QQA A;  4B4C A;  4CCM A;  2IEK A;  2Z5U A;  1VQM I;  1A31 A;  1QA6 A;  2BY1 A;  2DA2 A;  2EPF A;  3RCO A;  1FIP A;  4LIU A;  5BPI A;  4HSR A;  3FMS A;  3FKJ A;  3A01 A;  2D1V A;  5EZG A;  2ZNZ A;  3S32 A;  5CKT A;  1JKP C;  1Y8Q B;  1SFU A;  2WAQ N;  4CHU A;  3LA7 A;  1FOX A;  3SEZ A;  2DQL A;  4UUS B;  2OV7 A;  4NHJ A;  4A3K J;  3OR1 C;  1LVA A;  2DJN A;  5H20 A;  4D7M A;  2MFZ A;  1B1B A;  4OU0 A;  1JUM A;  4PUS A;  3TW7 A;  3HRU A;  1OCC H;  2L02 A;  1KA8 A;  4ZZL A;  2C6Y A;  2X1C A;  5J1R A;  4LB6 B;  1YHQ I;  3TDZ C;  1W7P B;  3HC7 A;  3OYM A;  2GLO A;  3CCM I;  4F91 B;  1K6Y A;  5AON A;  2F4M B;  4IQJ A;  3DCF A;  3ABT A;  3LSH A;  3FKI J;  2R5Y B;  2WB1 A;  1UST A;  3J80 K;  2DK8 A;  2XIG A;  3E6B A;  4M9X A;  5GAD J;  3L2Q A;  4B3A A;  1G6N A;  2A3S A;  2ZFU A;  1GV5 A;  2W25 A;  4FE4 A;  2DFH A;  3G1O A;  1PJR A;  3M8F A;  4OMZ A;  1YTY A;  2XKP A;  3L09 A;  2OQR A;  1AA7 A;  4BKX A;  1Z9C A;  2WTE A;  1USS A;  1R5I D;  5FFZ A;  1OCR H;  4K2E A;  2BVL A;  4QSH A;  3OYE A;  1TL8 A;  4IRH A;  2BVM A;  2VB6 A;  2L9S A;  4XLP F;  3X2Q H;  4II2 A;  1RR7 A;  2EA2 A;  5FKK A;  3GTM J;  1IN8 A;  3M7G A;  3GCM A;  3JSO A;  5H6Q A;  5K1Y A;  2FBK A;  1PDN C;  2CRG A;  3M1E A;  4KNY A;  3FHZ A;  4CYC A;  1V3F A;  1ZRF A;  4JX6 A;  2ZNY A;  4JQF A;  1J5Y A;  2CO5 A;  5HVQ C;  3GTO J;  4PK4 A;  3OY9 A;  3PNV A;  3K9T A;  1K7A A;  3OOU A;  4L5I A;  5LEK A;  1ZN2 A;  5C3E J;  1XCV A;  2GIV A;  4ZDP A;  3ZRG A;  2E2H J;  1VFC A;  3GYH X;  4NB5 A;  1OIS A;  2B7E A;  3RYP A;  2R7Z J;  3F8N A;  1XGS A;  3RTR A;  3MZ8 A;  4E7K A;  2UUZ A;  3AL0 B;  1P7I A;  3BR1 A;  3S15 J;  4ZTF A;  5GTI C;  1YIJ I;  3S16 J;  1IG7 A;  3ZQ7 A;  1YS7 A;  3GLL A;  5DUK A;  2R7S A;  3C3W A;  1KU9 A;  2VKV A;  1H0M A;  1DP3 A;  4OIR F;  2KIU A;  3K4N A;  1D5V A;  3PUF A;  5FO5 A;  5JLX A;  5CVR A;  3KP6 A;  1F36 A;  1FLI A;  3CC4 I;  2VQH A;  2QBY B;  1Z7L A;  1ZLJ A;  1EA3 A;  1ZAR A;  2QKM B;  1K4T A;  2ISZ A;  3HPH A;  4D1Q A;  1UFM A;  2HGC A;  4BXU A;  1Z6T A;  2FMY A;  1MD0 A;  4U0Y A;  3JAM Z;  2R7T A;  5FD6 A;  1BI0 A;  1OQY A;  2IRF G;  1EH8 A;  2I10 A;  1UG0 A;  4O3M A;  5HLI A;  3IRR A;  4XLE A;  3S14 J;  4A3I J;  4XLF A;  4ENK A;  1MMG A;  1U0J A;  3BWG A;  4L0Z B;  1ERD A;  4A3F J;  1O3Q A;  1TWC J;  2BXZ A;  2K3F A;  5ERI A;  3TP3 A;  4A3E J;  4ZYG A;  4OWR B;  2F4O B;  4OIN F;  1X1A A;  5F6F A;  2Y9Z A;  3RDI A;  4JBA A;  2WAD A;  2LR8 A;  5GTH C;  2CV1 A;  4ZYD A;  3S17 J;  1LUJ B;  3FK6 A;  2KT0 A;  3FXO A;  1XX5 A;  3CP2 A;  3J7A O;  1HSJ A;  1R00 A;  3DEU A;  4ZDL A;  2X6Y A;  4RGU A;  3PNY A;  2J5P A;  4D9J A;  1LKX A;  3BY6 A;  5FRO A;  4BDZ A;  3OYI A;  2KIS A;  4RAZ A;  3ERE D;  1IN6 A;  2W85 A;  3S3O A;  4RS8 A;  1T98 A;  3JRG A;  5LLQ A;  1ZYR F;  2HI3 A;  4ENN A;  4N4N B;  3WTX C;  3D0S A;  4UVA A;  2DFE A;  3HOU J;  2XAU A;  1N78 A;  3ZN0 A;  2E35 A;  3I5U A;  4UHT A;  3K4J A;  3KP5 A;  2MD0 A;  1OCP A;  2EIK H;  4ZJZ A;  4LB5 A;  2HQ5 A;  3QU3 A;  1FC3 A;  3SFZ A;  2MYS A;  2NAZ A;  5DV5 A;  2ZJQ F;  5J47 A;  1Y1W J;  2EFP A;  3H9G A;  1TWA J;  2CUZ A;  4AWX B;  1TWF J;  3CCY A;  4MQV A;  4Y4R A;  3H0D A;  4UUS A;  5ILS A;  2O03 A;  3L00 A;  2CW8 A;  3MKL A;  1WFX A;  3LMM A;  2O3F A;  1N25 A;  2DN0 A;  1BIA A;  2DK5 A;  3HHH A;  1ZG3 A;  5DD8 A;  5IT9 Z;  3IC7 A;  5KCM A;  1B4A A;  2P5L C;  4EV0 A;  2M30 A;  2Y9Y A;  2NVQ J;  5F04 A;  3PFY A;  2M0C A;  2Z99 A;  3CME I;  4IKF A;  1ZQ3 P;  3BQZ A;  2PBI A;  2K40 A;  1IO2 A;  3ZQG A;  3OYA A;  1BM9 A;  1D1A A;  4DOZ A;  4HF0 A;  5H6R A;  1X19 A;  2VQG A;  1GHC A;  4BE1 A;  2GZW A;  3TW6 A;  2R5Y A;  5TRD A;  3JAM K;  4RM2 A;  1G4D A;  2RDP A;  4MIM A;  4KFC A;  2R7V A;  1DU6 A;  2CFO A;  4UUT A;  4Z2Y A;  4BE2 A;  1JE8 A;  2FNA A;  3OV8 A;  1APL C;  4A3L J;  2A6H F;  3BJ6 A;  2EFO A;  1K78 B;  2HDC A;  3HG9 A;  1AU7 A;  5E20 A;  1NG7 A;  3F6O A;  1QPI A;  2M7A A;  5LBQ A;  1ZH5 A;  2CSO A;  2FU4 A;  2JUG A;  3GZ5 A;  3ZQF A;  2HNH A;  1YLF A;  1FTT A;  5L3G A;  3EET A;  3EYI A;  1FOW A;  1S7E A;  2RQQ A;  3BLY A;  4AVZ A;  1LDJ A;  1O57 A;  2QQA A;  2F4I A;  1IRZ A;  1TZL A;  3TP0 A;  3GO5 A;  2JUC A;  1BIB A;  1WJB A;  3MFK A;  3KZZ A;  4HDV A;  3HPG A;  4B3X A;  2DT6 A;  5C4J J;  4XOT A;  3KYL A;  1YJN I;  4KN7 X;  3HM5 A;  1IXS B;  2BBY A;  3R6S A;  4EGZ A;  2KFD A;  4LIT A;  2EQR A;  2K86 A;  2KRH A;  1TNT A;  2OF7 A;  2O7O A;  2VAS A;  1JI8 A;  2H8W A;  2IS4 A;  3BR2 A;  3ABL H;  1ETY A;  3JTH A;  1W36 C;  2F5D A;  3HOX J;  2H27 A;  1R4M B;  1H89 C;  2QSG X;  1FYK A;  5D6E A;  4PJL A;  2JPB A;  2VC1 A;  3RKQ A;  1W5C C;  3A4C A;  1E17 A;  3DKW A;  2IAI A;  2VQC A;  4A3G J;  2RRE A;  2DJI A;  2ADU A;  2ESN A;  4M74 A;  1T2K A;  3VYR B;  3RQI A;  5D5V B;  3KP4 A;  2LD5 A;  2WA0 A;  5GAH J;  3BTJ A;  2QBY A;  2YX4 A;  5HDG A;  4HQM A;  3WU1 B;  3E6C C;  1YOV B;  2MG4 A;  1GVD A;  2NOG A;  2O8X A;  4OAZ A;  4ZDO A;  1XD7 A;  2E1M B;  3GTJ J;  4BQO A;  5ICF A;  1O3S A;  4AD9 A;  2FRH A;  3L2U A;  3GVA A;  3OS0 A;  2XF7 A;  1MBF A;  1XPX A;  1SAN A;  2EZI A;  4EM1 A;  1O3T A;  2K5C A;  3KX2 A;  3MKW B;  4XOR A;  4L9J A;  1R6R A;  2WB1 N;  2HOS A;  5F08 A;  4LJZ F;  1HKT A;  1NHA A;  2XAF A;  1YFH A;  2V26 A;  3PO3 J;  1FOY A;  4AIH A;  2LP0 A;  4YII A;  4F55 A;  1SVO A;  5E3O A;  1SFO J;  1IDZ A;  4NC8 A;  3J7A Y;  2LTP A;  3VDX A;  5D4R A;  3PO2 J;  1HDD C;  5DYM A;  5F0F A;  5EG0 B;  5M3F J;  1ETO A;  4CCJ A;  1XMK A;  1VQ9 I;  3CCU I;  4CUG A;  3IH3 A;  1Z0X A;  2K7L A;  3CF5 F;  3SDB A;  4ZH4 F;  3CJT B;  4HF2 A;  1G2H A;  3OL4 A;  3CJN A;  2ZXH A;  5LHG A;  3OYC A;  3LST A;  4EVI A;  3QYF A;  4C3J J;  1TWH J;  1YX3 A;  1SMY F;  3VYT B;  3LWF A;  1LFB A;  2EIM H;  2ZFW A;  1QHG A;  5HLH A;  3BG6 A;  3ZQQ A;  4CZC A;  4Q48 A;  3DBR B;  1HA8 A;  2LNB A;  1P4A A;  2HWV A;  1QGP A;  3BTL A;  3ZQI A;  1ZHF A;  3H3U A;  1NTC A;  2CS3 A;  4E4H A;  3S1R J;  2K9N A;  2IBD A;  2BV6 A;  1I3Q J;  1MH3 A;  2HQR A;  2LK2 A;  3FM3 A;  2P81 A;  4G7Z F;  5E17 F;  4QIW N;  2VLA A;  5J8C A;  2E7W A;  1ZLK A;  4KIT B;  4M6V A;  1GXQ A;  2HOE A;  2W82 A;  4KIC A;  1T0F A;  2ACJ A;  1A04 A;  4PCQ A;  1BI3 A;  1K79 A;  4XQF A;  2BXY A;  2NVU B;  3W6J B;  4A5M A;  3C1D A;  1EV7 A;  1V54 H;  4J01 A;  1Z91 A;  2QZ8 A;  4QPO A;  3KLN A;  3VSK A;  5LRS A;  5E1X A;  1DQU A;  1ZGJ A;  1WJD A;  3FDY A;  2KP6 A;  5EF6 A;  3H5N A;  3CCL I;  4RMN A;  4DBR A;  2GWR A;  3S1M J;  2LY2 A;  3I71 A;  1MND A;  4EMS A;  2IA1 A;  3SFI A;  2L7Z A;  2M2E A;  1Y6I A;  3RPQ A;  1R4N B;  3AAF A;  2A61 A;  4LLL A;  4W1U A;  3HOS A;  1RI7 A;  2ZJP F;  3FXQ A;  2UXN A;  3BZK A;  1IGN A;  4LFU A;  1FWZ A;  3QOE A;  1E0E A;  4P5O A;  4LLG F;  1R7J A;  3BZC A;  4P9U A;  1IJW C;  1F9N A;  3CCJ I;  1K78 A;  3C18 A;  2Z16 A;  1OLT A;  2BZT A;  2RAE A;  4G94 A;  5E1Z B;  3K7A J;  2EV5 A;  2XVC A;  3B6C A;  1BR1 A;  4CDG A;  2YS9 A;  5F1J A;  2VXZ A;  5CPR B;  2MC3 A;  1FX7 A;  3KYD B;  4ITV A;  4QTR A;  1T0F C;  1OR7 A;  3EUA A;  4FE7 A;  5JFR A;  2R7F A;  3U2R A;  3ONQ A;  3CMY A;  1WWX A;  3C2H A;  4JX5 A;  5L3F A;  2R0Q C;  2M0M A;  1WVR A;  2Y0S A;  4J00 A;  2Q2E B;  3LL7 A;  1SVM A;  2EH3 A;  2M8E A;  4GYI A;  2RC4 A;  5E1W A;  2GXA A;  3LFK A;  3HRS A;  1X4P A;  2EFW A;  4HLX A;  1W36 D;  2HTJ A;  3O6B B;  5BMZ A;  1R49 A;  4M3F A;  1FOK A;  3SJM A;  3Q9V A;  3DF8 A;  2HFH A;  2R7W A;  3F8B A;  1MJB A;  1U8B A;  4II3 A;  3PL8 A;  2R5Z B;  1IV6 A;  1OCZ H;  2ESH A;  4M72 A;  2D2W A;  4A3C J;  2HEO A;  1C0W A;  2F2E A;  2Y30 A;  3BZ6 A;  3NQO A;  5KAI C;  3CO6 C;  3DFG A;  5L3C A;  1I3A A;  2LKX A;  1DPU A;  3HL2 A;  4V2G A;  3A1Y A;  5KVR A;  3J7Y J;  2ELH A;  1JJ6 C;  2LG4 A;  3FIS A;  4Q47 A;  1U3E M;  1VTN C;  3PSI A;  2RKH A;  2ZJR F;  3I4M J;  1D8J A;  1OR7 C;  4Y17 A;  3GTG J;  3GBG A;  3ZMS A;  3OYL A;  2GIZ A;  2KIM A;  2I5U A;  2Q0O A;  4YFK F;  1UHM A;  1WJC A;  4PGG A;  3IKT A;  3K4B A;  1IN5 A;  2QYO A;  4LOC A;  5F0C A;  4HX4 A;  2HZD A;  3FX3 A;  1T39 A;  4A93 J;  3NAU A;  2R7Q A;  5EGO B;  2JRM A;  4EJO A;  5HDK A;  3C7J A;  5D5W B;  2ZME C;  3SEQ A;  3O8G A;  2NNN A;  1FNN A;  3P7N A;  3QYB A;  5GP9 A;  4MNU A;  1X1C A;  2BE5 F;  3ABM H;  2F5V A;  1H8A C;  2NNY A;  2IXS A;  5EG0 A;  2NOJ B;  2HVR A;  2X48 A;  2M1B A;  4OAY A;  2DOF A;  1U78 A;  2O6G E;  4D0P A;  3IV5 A;  1A6I A;  1TW2 A;  1ODD A;  4IOC F;  1BW5 A;  2OD5 A;  2M4G A;  4R79 A;  4E7L A;  4BBR J;  3JTG A;  2DDB A;  4UV9 A;  2FF4 A;  2BOL A;  4D5C A;  2FJ1 A;  5J6X A;  1YO5 C;  4ENM A;  3CMA I;  4BJ5 C;  1JUS A;  5FRM A;  4EJU A;  3DLL F;  3TOB A;  4F92 B;  2W7N A;  1VQ5 I;  3AKZ A;  1IZ1 A;  1P7J A;  3PQK A;  2E1M C;  4E6K G;  3P9C A;  4O6J A;  5CQE A;  5IP9 J;  1PYV A;  3WTT C;  4CYD A;  1OYI A;  2V1U A;  4RB0 A;  4BEH B;  2O5R A;  5B1A H;  5DUI A;  2V6C A;  2MGQ A;  1QZE A;  3LFU A;  3DU6 A;  3RPU D;  4L5E A;  1I6H J;  1X2N A;  4DBQ A;  1SVL A;  3NWS A;  4HYE A;  2K85 A;  1JJ8 C;  3ZQL A;  2QEN A;  2Y31 A;  3CDH A;  1XSX A;  3SZP A;  1O3R A;  1KU7 A;  4EM0 B;  2CFX A;  3LSK A;  3ZMD A;  2IGN A;  3CJR B;  3OL3 A;  2VPR A;  1X4O A;  5KAF C;  3KET A;  2MAB A;  4P55 A;  2UWM A;  1ETW A;  1I50 J;  3E3V A;  3EUH A;  5HLG A;  1FYL A;  1E3H A;  1X58 A;  1YE9 A;  2WBM A;  1TT0 A;  2XPW A;  2D1H A;  3FXU A;  3DKY A;  2LF8 A;  1IAW A;  4XLH A;  2VBY A;  5L3D A;  5DS9 A;  4IF4 A;  3W2V A;  3DTK A;  4E7H A;  1U5T B;  1WGX A;  1HKS A;  4CCO A;  4ABZ A;  1JGG A;  3CUO A;  1HDP A;  2A6T A;  4ENJ A;  4XIC A;  2ISY A;  3RKX A;  2HDW A;  5BNG A;  4DNC A;  3VOE A;  4A0Y A;  4FX0 A;  1ON2 A;  1ZG5 A;  1LQ1 A;  4M9Z A;  2XAH A;  2QQ8 A;  3H3Z A;  2EV0 A;  4CA0 A;  2VKE A;  4L9T A;  2FD5 A;  2CQN A;  1QZY A;  4HX8 A;  3WG7 H;  2D5V A;  3MVP A;  4RBO A;  2VJ4 A;  1EJ9 A;  3LSP A;  4XLC A;  2K9Q A;  4Q5S F;  4XNF A;  2FBI A;  1MSF C;  1R1U A;  4RGS A;  3PQJ A;  1LEA A;  2XGC A;  4G12 A;  3MAJ A;  1JXS A;  2X6W A;  4U0W A;  1AKH B;  1YJ9 I;  1X3W B;  3PJR A;  2QUF A;  3EUH C;  2VN2 A;  2XGX A;  1D0X A;  2M8G X;  1HCR A;  1VQK I;  1DU0 A;  3JRH A;  3FXJ A;  2X1D A;  4CIC A;  1S9H A;  4C2U A;  1V55 H;  4XM3 A;  2DT5 A;  2EBI A;  4HQE A;  4ESB A;  2LC2 A;  2Q2E A;  2R92 J;  2EJR A;  2BEO A;  2X1E A;  4PJN A;  1MMA A;  3BR5 A;  3K1N A;  4XID A;  4FTH A;  4OIQ F;  2CUF A;  3LAP A;  3AG3 H;  4N4O B;  4PFP A;  1O7L A;  2O0Y A;  1D5Y A;  4Y13 A;  3HOT A;  4IZZ A;  2IT0 A;  3CD6 I;  2XC7 A;  4YRV A;  2AS5 F;  5E3M A;  2OZU A;  4I6Z A;  1HW1 A;  2EIJ H;  4BS9 A;  4LLN A;  3CLQ A;  3Q0W A;  3GME A;  2JVH A;  2ZSH B;  4ZYH A;  4HW0 A;  1FMV A;  1UHW A;  4UXN A;  2R5Z A;  2IW5 A;  3DV8 A;  1QO0 D;  3M07 A;  2E1N A;  4UVC A;  3TGN A;  1T8I A;  4BU2 A;  3OSF A;  4E7Z A;  5J40 A;  1R5G A;  2FEZ A;  3DP7 A;  5GAE J;  4HEA 2;  1JKQ C;  2DA4 A;  1AHD P;  4BY1 J;  1WJA A;  5TGT A;  3E0J B;  3GFM A;  2JSP A;  2MLK A;  3G2B A;  2BW3 B;  3GF2 A;  1E2X A;  1UB9 A;  3BJO A;  4D5F A;  4G8X A;  2GBY A;  1IXC A;  3DQV C;  1B9N A;  2EV6 A;  3MKY B;  4LIV A;  4CZZ A;  3ZMU A;  5E8G A;  4XN3 A;  4P96 A;  3M1C A;  5K5R A;  1DP7 P;  3SHF A;  3TKY A;  1Z67 A;  1BJZ A;  2E5N A;  5FFX A;  1UAA A;  2XAJ A;  1Y0U A;  1J7K A;  4S04 A;  5EGO A;  4KT5 C;  4HDU A;  2V4J C;  2NYX A;  5LGU A;  2ICW G;  3V7R A;  2R4G A;  1BR2 A;  2Z2S B;  5IT3 A;  2QQ9 A;  4LMY A;  4G6Q A;  4BAC A;  2ECC A;  2L0K A;  4MEY F;  5M3M J;  4ANJ A;  1UEL B;  5IOZ A;  3BP8 A;  4MGR A;  2HYF A;  4YG2 F;  2DMN A;  3VSL A;  4KUM A;  3SXY A;  2Z33 A;  4MO7 A;  1U9N A;  4LK1 F;  2L3D A;  2F5E A;  3BTC A;  4WX9 A;  4IHT A;  4RAY A;  3IH4 A;  1SD7 A;  2Y0S N;  3OWT A;  2GQQ A;  2JRT A;  3WGI A;  3B6A A;  1T33 A;  4QLC U;  1ETV A;  2LLK A;  2VJ5 A;  3BR3 A;  4S0H B;  4EJV A;  2EIL H;  5J3L A;  4CXF A;  3GZ6 A;  4XSX F;  4U7B A;  4L0Y B;  1RUO A;  4ESF A;  3JRD A;  1POG A;  3KEY A;  2YU9 J;  4XRF A;  3R60 A;  1HQC A;  3BG5 A;  4A2U A;  4BEH A;  4BQQ A;  3I4N J;  4X6A J;  1WI9 A;  1WCM J;  2FOW A;  1QVT A;  2RGV A;  1UMQ A;  3KIO A;  2XSD C;  2IGM A;  5ED4 A;  1AOY A;  3DEE A;  1BL0 A;  1MGT A;  4XLN F;  2XRO A;  5E18 F;  1KON A;  3I58 A;  1WSU A;  5CVU A;  1NK2 P;  4OOI A;  5HS7 A;  9ANT A;  2RN7 A;  1LEB A;  2ETH A;  2CUJ A;  3TO9 A;  1J9I A;  3QP5 A;  2A6E F;  2KZG A;  3WE3 A;  1W0U A;  1STZ A;  1BC7 C;  3HTU A;  3HSF A;  1U9O A;  1RR8 C;  4AIK A;  1KQ9 A;  3E5X A;  5KNL A;  4A5N A;  1XC5 A;  5JHU A;  1U5T A;  2HVS A;  5EJC A;  3UR3 C;  3WGG A;  1KYZ A;  2X0L A;  1ZRE A;  3ECH A;  4BYY A;  4RLQ A;  2CH0 A;  2MH2 A;  3BR0 A;  4EQQ A;  2E5Z A;  2I8D A;  1W7P A;  4UV8 A;  2OPT A;  4M3E A;  3UKG A;  5HS8 A;  3MQ0 A;  4XKB A;  5BQT A;  2VBX A;  3KPH A;  1LDD A;  3HGY A;  2XAQ A;  3CCS I;  3S2H J;  4BQN A;  5JLW A;  1JHF A;  2L7F P;  4HAM A;  1VQ6 I;  3JCU C;  1MBE A;  2HR3 A;  2KHM A;  3VYS B;  1HLV A;  3M4O J;  3SDG A;  3BCB A;  1K61 A;  4C3I J;  3QPT A;  3S3N A;  3CMM A;  2DPU A;  3GWZ A;  1BI1 A;  1B59 A;  1RES A;  2F5F A;  1UHS A;  2W48 A;  4P9F A;  2M3A A;  1GVJ A;  2JJ7 A;  1ON1 A;  1S3J A;  4I02 A;  3PSF A;  2VOO A;  3ASN H;  2N8G A;  3OR2 C;  2WAE A;  1YYV A;  2L9V A;  1WRJ A;  1GT0 C;  3HKZ A;  4NNJ A;  1LPQ A;  1G3T A;  5CVJ A;  3H35 A;  1AKH A;  3LSM A;  2ELK A;  1XS9 A;  1XTA A;  3K6G A;  2K4B A;  4WF2 A;  3QRF F;  3WTZ A;  4V19 K;  1Q1V A;  1V4R A;  3FF5 A;  4HBL A;  1F5T A;  5H2F C;  3KZI C;  2DOD A;  3L1P A;  1QBJ A;  1U5T C;  2HXO A;  4DW6 A;  4RB1 A;  1X1P A;  4WXH A;  3HIF A;  1HXD A;  1X3U A;  3FXL A;  4XOP A;  1TNS A;  3RKY A;  3PFI A;  2JA6 J;  3I64 A;  2TCT A;  4E70 A;  4RB2 C;  1FY7 A;  4KMU X;  5D8L B;  4YFN F;  1OCT C;  3DTE A;  3F6V A;  2DCE A;  2K9L A;  2R7U A;  3H92 A;  4F3Q A;  2DT7 B;  3IWF A;  4LG3 A;  1JGS A;  1V5E A;  3OYF A;  1KU3 A;  2ZME B;  3KCC A;  2HOT A;  1HOM A;  4A6D A;  1RKT A;  3VPR A;  5K7Z A;  3A03 A;  4DYQ A;  3I4P A;  4H0E A;  1OYY A;  1S5L C;  5EEA A;  2KQR A;  4L5J A;  5LEJ A;  1CF7 B;  1OJL A;  2LOO A;  4IXA A;  3MCZ A;  4BHC A;  2DTR A;  2Z1D A;  1MMD A;  3QAH A;  4AVP A;  3VEP A;  1ZR4 A;  1MBJ A;  1I6X A;  3VWB A;  4CGZ A;  4N0B A;  1D8K A;  1FT9 A;  5FB2 A;  2CV0 A;  2X85 A;  3JRI A;  1ITY A;  2LRD A;  5GPA A;  3WTY C;  2JZY A;  1ZG1 A;  2VIX A;  2BW3 A;  2M9H A;  2HYG D;  5CJ9 A;  2ME0 A;  4I01 A;  4BJT A;  3OS2 A;  1VQN I;  3OYJ A;  3DTI A;  3RQ4 A;  3BPX A;  1JT0 A;  3K4L A;  1P6R A;  2IVM A;  4BAY A;  4M3D A;  2DDA A;  1IXR C;  2IA0 A;  2MC4 A;  4I76 A;  2ELJ A;  4L9N A;  2V79 A;  1YIT I;  1L3L A;  4R8H A;  1PUF B;  3WG9 A;  2OTL I;  4YFX F;  2NS7 A;  1RZ4 A;  1EF4 A;  5IT9 K;  4WXC A;  2Z9O A;  3OYH A;  4RA2 A;  2XUB A;  1RET A;  2A68 F;  3CES A;  3K1M A;  2L9N A;  3KE2 A;  3SYT A;  4DYR A;  4DZP A;  4ESJ A;  3VB2 A;  1XSD A;  2STW A;  2MW8 A;  5EYR A;  5M5Y J;  1RRJ A;  1EH7 A;  2Y48 A;  1Y0N A;  4AYB A;  2G9W A;  5EEG A;  1YW7 A;  1Z77 A;  5IY5 H;  3TL4 X;  1DPR A;  2KKO A;  3LSJ A;  3RPU A;  1MZB A;  1E3O C;  3G73 A;  4XON A;  4H4K C;  3K0L A;  1S72 I;  2E2J J;  1MDM B;  1QPM A;  4I7H A;  1ZTR A;  3WTV C;  3EDP A;  5BOX A;  2VT2 A;  2VT3 A;  2KIQ A;  3EYY A;  5J4V A;  4GRI A;  3R61 A;  4MTE A;  3L2V A;  2M45 A;  5L3B A;  2OTJ I;  1R36 A;  3F3X A;  3M9A A;  5LHI A;  2DOA A;  4NDL A;  3GW2 A;  1EH6 A;  3QOD A;  2V1N A;  3GX4 X;  4L9V A;  3FBN B;  2LKS A;  5FLX Z;  1IUY A;  3OS1 A;  4PJ0 C;  4RB3 C;  2K3P A;  2BHY A;  2LH9 A;  2G7H A;  2XB5 A;  2FQ3 A;  2NVX J;  1U8R A;  2JTV A;  2XF5 A;  1T38 A;  1W5S A;  1FIA A;  1DUX C;  2RQP A;  5HNF A;  3FIW A;  2VON A;  2M4K A;  3ULQ B;  5IPA A;  4Q4Z F;  3Q5F A;  1U6G A;  4EJT A;  2NS8 A;  3NWT A;  1FBS A;  3KEO A;  3HOW J;  2M34 A;  4I0A A;  1P92 A;  4IHX A;  1JTY A;  1SFE A;  1LB2 A;  2HPI A;  4UB8 C;  1SAX A;  2JA5 J;  5LD2 C;  4UUV A;  1G8X A;  1WH7 A;  4KN4 X;  3HYI A;  4R1H A;  1RUN A;  2BGC A;  2LY9 A;  2VOP A;  4BHP A;  1P4X A;  2V1X A;  5HLT A;  4FCY A;  1G59 A;  1IN4 A;  2UZK A;  1I27 A;  2P5K A;  1J09 A;  5F27 A;  1T6S A;  2BY3 A;  1LE8 B;  3HOY J;  1IC8 A;  2JK3 A;  2K27 A;  3CQZ J;  5HOD A;  2P0W A;  3CJQ B;  2QEX I;  1SD6 A;  4HNT A;  3HBL A;  1U2W A;  3PM1 A;  3H9J A;  4IRI A;  2AQF A;  2HS5 A;  1FEX A;  2FUG 2;  1TT5 B;  3FK7 A;  1X3Z B;  3IWZ A;  5HDN A;  2E19 A;  3LA2 A;  2X4H A;  1CGP A;  4Y52 J;  2OQG A;  3Q0V A;  4KT6 A;  2LVS A;  3JRB A;  1TWG J;  3MMY B;  3L7W A;  2COM A;  1ENH A;  2ZXJ A;  3ZR8 X;  2YU3 A;  3CC7 I;  1I1S A;  4C2T A;  2L2O A;  3RYR A;  4A3D J;  4N9H A;  2R7D A;  2A5W A;  2MH9 A;  4HZF A;  5K5O A;  3ZOB A;  1K6O A;  4C3H J;  2H1L A;  1TTY A;  5BPD A;  1ACI A;  3S93 A;  3TO7 A;  4IHY A;  1YS6 A;  4IHW A;  3ZMZ A;  1MJ9 A;  2PMH A;  3C2G A;  3ML6 A;  4FT8 A;  1XG1 A;  3CTA A;  5D4S A;  2W1O A;  1BW6 A;  2LY1 A;  2Y0M A;  4RAF A;  2W00 A;  1W4M A;  1FYM A;  2GM4 A;  1OMI A;  3ERM A;  4ZYA A;  4LGW A;  3BTI A;  3P9K A;  2VOD A;  2HKX A;  2QCO A;  3G3Z A;  2KMU A;  4CCN A;  1QQI A;  4UNO A;  4W97 A;  5FLX K;  2OAZ A;  2P6S A;  1A6Q A;  2ZME A;  2XHK A;  5C44 J;  3UNG C;  2DOE A;  4BQA A;  4XL9 A;  2IP2 A;  3Q3S A;  4KIB A;  1I1G A;  2LRE A;  5EZH A;  1EKE A;  5B66 C;  1CF7 A;  1Z21 A;  3BG3 A;  4RM3 A;  2X6X A;  4UB6 C;  1E3P A;  1D0Y A;  5KHD A;  4BUP A;  1PP7 U;  2AQE A;  2CW7 A;  3RKW A;  5IP6 A;  2IS1 A;  2IGO A;  2LDU A;  2CV2 A;  1MH4 A;  3ECO A;  3JRA A;  1O4X A;  4HV6 A;  2A07 F;  4M6X A;  3ZGK A;  2UXX A;  3GTL J;  3WGH A;  2P7C B;  1P4W A;  1R22 A;  3OIP A;  5JVT A;  1MBG A;  1MMN A;  2PX9 A;  1HW5 A;  2AXT C;  4ETS A;  2OZ6 A;  3C2B A;  1PVE A;  2VQL A;  3I53 A;  5J8F A;  1F43 A;  3BC8 A;  4RAG A;  3B73 A;  3H0G J;  1LJ9 A;  2EWN A;  1FMW A;  1PUF A;  2FML A;  1SAU A;  5ILV A;  2LSO A;  3HRT A;  3VOD A;  3W6V A;  3W3C A;  2L01 A;  2YR2 A;  1R1T A;  1MKM A;  3ROU A;  1O7F A;  2OC6 A;  2ZCW A;  1VND A;  2PJR B;  2NVT J;  5ICC A;  4HNV A;  1KU2 A;  2XSJ C;  2X6O A;  3GZN B;  3OYK A;  3H5A A;  3A02 A;  3FHN A;  3LOC A;  4EAT A;  2IA2 A;  3MKZ A;  1B6A A;  3LNQ A;  3CUQ B;  2CU7 A;  2EZL A;  5FKM A;  4A3M J;  4RLF A;  1FPQ A;  5IYC J;  2ZKZ A;  2XKO A;  2WY7 Q;  3HKZ N;  1I5Z A;  1MDM A;  1R58 A;  3ZQH A;  3DKX A;  3BG9 A;  1V5G A;  2WAF A;  3QU6 A;  4DIQ A;  2QSH X;  2PN6 A;  2ME6 A;  4F52 A;  3BR6 A;  1UG2 A;  2W84 A;  5KK1 A;  3F72 A;  5K7H A;  3JRC A;  4I2O A;  1FJL A;  1ETK A;  3GLX A;  3TBI A;  3FXK A;  2XPV A;  4NC6 A;  3DBL B;  3G4S I;  2JA8 J;  3E5Q A;  4AU7 A;  3M8E A;  2VPL A;  1YI2 I;  1HC8 A;  1MMS A;  3P9I A;  5IYB J;  2COB A;  5FD5 A;  2A05 A;  5FKL A;  3QOP A;  4ZZD A;  5DD4 A;  4ZYE A;  1J75 A;  2AXL A;  4WXD A;  1MNE A;  3LA3 A;  2STT A;  5ILU A;  4I0B A;  3IKV A;  4AUX A;  5B5E C;  2QLZ A;  5JR3 A;  1ZK8 A;  3SZT A;  4UVB A;  4GYG A;  3AG2 H;  5CQG A;  3W2W A;  1XN7 A;  5L3E A;  2RNJ A;  2Y2Z A;  1WPK A;  3F0C A;  4I09 A;  1OPC A;  4B8X A;  4I99 C;  4HRI A;  4OIP F;  6PAX A;  4FHT A;  2V6E A;  4MFE A;  3KEQ A;  5A2Q Z;  2AHQ A;  3NRV A;  4XRS A;  4QPQ A;  4XN0 A;  1JKR C;  3F22 A;  1LE8 A;  3BDD A;  3ZMT A;  2OCC H;  2E2I J;  5D5X B;  3DEW A;  2L54 A;  2L5Q A;  4BJ6 C;  1YRN B;  2ZJ2 A;  2DYR H;  3E5U A;  2L4M A;  2QQB A;  2XV4 S;  4PSW A;  1YIO A;  3F8C A;  3CF2 A;  5AIQ A;  3CO7 C;  1G3Y A;  1B72 B;  3CCV I;  3EQL F;  3K70 D;  2GOM A;  3TO6 A;  2HKO A;  5J1U A;  4AYB N;  3I59 B;  1F1Z A;  2QGU A;  2PMU A;  1AWC A;  4GCV A;  1ZRD A;  2DXI A;  4FET A;  3GFJ A;  1FSE A;  4JOM A;  1IV8 A;  1TQP A;  3W6K B;  2GA2 A;  3D1N I;  5FKO A;  2GXB A;  1YG2 A;  2KLO A;  4HLY A;  2DMP A;  5J4Y A;  5B3S H;  4M3G A;  2KPM A;  3D5S C;  2KL4 A;  1D1C A;  4D7N A;  5J1Y A;  2PEX A;  2WV1 A;  3B02 A;  3CDI A;  3RIR A;  2MA3 A;  2WV0 A;  2CGP A;  4LD5 A;  4V2F A;  1D3Y A;  1GLN A;  1P9Q C;  5CVV A;  2E1C A;  3LSI A;  4NQW B;  1SEU A;  4IHV A;  3OYD A;  4RGX A;  1UZC A;  2HPM A;  1Z3X A;  3F8F A;  3MD2 A;  2E71 A;  1RPW A;  1WZ2 A;  2VBW A;  1TQM A;  2MD5 A;  3QYE A;  3HRM A;  2DFI A;  4M6Y A;  3K4M A;  2KJC A;  2XAG A;  2DW4 A;  4B48 A;  2YUS A;  3K69 A;  3WTU C;  3JRF A;  1B9M A;  4I98 B;  1MSE C;  2PJP A;  3S2W A;  4YIF A;  2H8R A;  4U0V A;  2PI0 A;  2H6B A;  3RSN A;  2VBZ A;  4C9Y A;  2RVC A;  1ZGA A;  3CZ6 A;  4XR6 A; 
#chains in the Genus database with same CATH homology
 3I9V 2;  2M3A A;  4B44 A;  3PSF A;  3OR2 C;  2V9K A;  2WAE A;  2IS2 A;  4U87 A;  4PFO A;  3HKZ A;  4NNJ A;  4BE0 A;  1Y56 A;  3H35 A;  2VLA A;  2IS6 A;  4KIT B;  3LSM A;  2CMP A;  3K6G A;  1D0Z A;  2W82 A;  4BXF A;  1V5F A;  4FAS D;  4PJM A;  1D1B A;  2L7K A;  4XQF A;  4F93 B;  4BDY A;  4J01 A;  4QPO A;  3IP4 B;  3VSK A;  3ZXS A;  3A2K A;  2VJJ A;  3EPZ A;  1DQU A;  4XOP A;  3I3L A;  4CCK A;  1QHH D;  1WJD A;  3FDY A;  2KP6 A;  3PUB A;  3H5N A;  3DTE A;  3HXL A;  4RMN A;  2DCE A;  2K9L A;  4DBR A;  1SFK A;  2R7U A;  2LY2 A;  2PJR A;  4F3Q A;  2DT7 B;  1MND A;  4LG3 A;  1V5E A;  3OYF A;  4BGD A;  1NG6 A;  1WJE A;  4HNU A;  3H9Q A;  1Y6I A;  4P1W A;  2KRC A;  4XMY A;  3HOS A;  4DJA A;  3TMO A;  3ZCO A;  2OUM A;  2KQR A;  3D5L A;  3QOE A;  4P5O A;  4YEJ A;  4CCM A;  1E0E A;  4ZC3 A;  2LOO A;  4XKV A;  2W4S A;  2Z16 A;  1OLT A;  2Z1D A;  1MMD A;  3OYG A;  3RCO A;  2VKH A;  3VWB A;  4LIU A;  1BR1 A;  4HSR A;  2CV0 A;  2VXZ A;  2XF6 A;  2PMZ A;  3FKJ A;  2X85 A;  5CPR B;  2LRD A;  4CCL A;  4ITV A;  1T0F C;  3S32 A;  5CKT A;  3EUA A;  2VIX A;  2BW3 A;  4BJT A;  3OS2 A;  3SEZ A;  3ONQ A;  2OV7 A;  3OYJ A;  3DTI A;  3RQ4 A;  3OR1 C;  3C2H A;  3K4L A;  4XLA A;  2M0M A;  2Y0S A;  2E60 A;  4J00 A;  2MC4 A;  2MFZ A;  2ELJ A;  2Q2E B;  2IGK A;  3LL7 A;  4PUS A;  3K4K A;  1X4P A;  3OYH A;  4CSW A;  2X1C A;  4C30 A;  3CES A;  3SYT A;  2L9N A;  1W36 D;  3OIQ A;  3HC7 A;  3OYM A;  4F91 B;  4AYB A;  1K6Y A;  2R7W A;  3TL4 X;  2R7X A;  4IQJ A;  4II3 A;  3LSH A;  3PL8 A;  2WB1 A;  4XON A;  4H4K C;  3L2Q A;  2ZFU A;  2JA2 A;  1BOB A;  3HL2 A;  3N05 A;  1PJR A;  3A1Y A;  1ZEL A;  4GRI A;  2JVG A;  1AA7 A;  3IAM 2;  3CP8 A;  3L2V A;  2LG4 A;  2BVL A;  3OYE A;  3PSI A;  2BVM A;  2VB6 A;  2DOA A;  1OR7 C;  2L9S A;  3QOD A;  2Q1Z B;  4II2 A;  2V1N A;  3GBG A;  3OYL A;  3PNT A;  3FBN B;  3OS1 A;  3D5R C;  2K3P A;  1WJC A;  3EUK L;  2LH9 A;  1QU3 A;  2XF5 A;  3K4B A;  1IRX A;  4JQF A;  5HVQ C;  5HNF A;  1N77 A;  2M4K A;  4PK4 A;  3OY9 A;  3PNV A;  2HZD A;  2LBF B;  3OOU A;  2R7Q A;  3NWT A;  4ZDP A;  3S8P A;  3ZRG A;  3SEQ A;  4ZTJ A;  4HG2 A;  3DU5 A;  3QYB A;  1DGW Y;  2HPI A;  3VYU B;  2LYC A;  5LD2 C;  3RTR A;  4E7K A;  1X1C A;  2UUZ A;  1G8X A;  4MLO A;  2F5V A;  3AL0 B;  2IXS A;  5HNH A;  4ZTF A;  2NOJ B;  2HVR A;  4OAY A;  4XKW A;  2X51 A;  4X0G A;  2R7S A;  1DP3 A;  5HLT A;  1G59 A;  2M4G A;  4R79 A;  3K4N A;  4E7L A;  1J09 A;  1LDK B;  2ZSI B;  2KZV A;  2BOL A;  1YX5 A;  2VQH A;  1Z7L A;  2P0W A;  3CJQ B;  1EA3 A;  4BJ5 C;  5FRM A;  1DGR M;  4HNT A;  2QKM B;  4F92 B;  3H9J A;  3HPH A;  5JHF A;  4D1Q A;  2W7N A;  2V7F A;  2AQF A;  2GOX B;  3AKZ A;  2FUG 2;  2QKL B;  2E1M C;  4E6K G;  2R7T A;  5CQE A;  1PYV A;  1X1D A;  4KT6 A;  1UG0 A;  4BEH B;  1LVK A;  2O5R A;  3MMY B;  4XLE A;  4XLF A;  3LFU A;  3ZR8 X;  1MMG A;  1U0J A;  3DU6 A;  2R7O A;  3RPU D;  4C2T A;  2L2O A;  3NWS A;  4DBQ A;  2K9M A;  1ERD A;  2A5W A;  4E7S A;  3LSG A;  3LSK A;  4HPQ A;  4OWR B;  2IGN A;  3CJR B;  3OL3 A;  1X4O A;  1X1A A;  2MAB A;  3HUG B;  2UWM A;  3S93 A;  1YE9 A;  2WBM A;  3C2G A;  4NUB A;  1TT0 A;  2WAD A;  4NC7 A;  3DKY A;  2CV1 A;  4XLH A;  2W1O A;  2LY1 A;  2HU9 A;  2W00 A;  3SZG A;  4B43 A;  2RNG A;  3W2V A;  3DTK A;  3CP2 A;  2WAQ A;  4E7H A;  4CCO A;  4ZDL A;  4E7I A;  2X6Y A;  3PNY A;  3V42 A;  4ZYA A;  1Z3Y A;  4D9J A;  2A6T A;  1LKX A;  5FRO A;  4BDZ A;  4XKC A;  4KIS A;  3OYI A;  2HDW A;  2KMU A;  4CCN A;  3DLA A;  3S3O A;  4DGW B;  4N4N B;  4Y3O A;  3UNG C;  4XL9 A;  3F9K A;  4CA0 A;  3IAS 2;  4KJZ A;  2UV1 A;  2VXD A;  2LRE A;  2XAU A;  1N78 A;  4YEL A;  3H5R A;  1Z21 A;  4RM3 A;  3K4J A;  2VJ4 A;  2X6X A;  2MD0 A;  3DPU A;  1D0Y A;  4XLC A;  5KHD A;  4XNF A;  2ZXI A;  4BUP A;  2AQE A;  2CW7 A;  2M7B A;  4ZJZ A;  2IS1 A;  2IGO A;  2CV2 A;  2X6W A;  2MYS A;  3BG7 A;  1WJF A;  2R7R A;  3H9G A;  3PJR A;  4HST A;  3EUH C;  3AL0 C;  3ZGK A;  1D0X A;  2CUZ A;  2VL8 A;  2X1D A;  1S9H A;  4Y4R A;  4C2U A;  3H0D A;  4XM3 A;  3OIP A;  1MMN A;  2CW8 A;  1WFX A;  3LMM A;  2VQL A;  3BC8 A;  2LC2 A;  2X1E A;  1FMW A;  5LFA A;  4B47 A;  4PJN A;  1MMA A;  5KCM A;  4G6T B;  1SAU A;  4BL0 B;  3DWL E;  4N4O B;  4PFP A;  4IZZ A;  3HOT A;  3W3C A;  2XC7 A;  4YRV A;  3PFY A;  3DPL C;  1N75 A;  2OC6 A;  1LFP A;  4BS9 A;  2PJR B;  4IKF A;  3OYA A;  2XSJ C;  3OYK A;  3H5A A;  1D1A A;  3AFH A;  4DOZ A;  2ZSH B;  2JVH A;  3FHN A;  2VJI A;  1X19 A;  2VQG A;  4EAT A;  3MKZ A;  4BE1 A;  4RM2 A;  1FMV A;  4RLF A;  2WY7 Q;  2R7V A;  2CFO A;  4BE2 A;  3E1S A;  4BU2 A;  3DKX A;  4E7Z A;  1V5G A;  2WAF A;  3HG9 A;  3L2W A;  1NG7 A;  4DIQ A;  4HEA 2;  2HVQ A;  1WJA A;  2M7A A;  5TGT A;  3E0J B;  2HQA A;  2JUG A;  4F52 A;  3L2R A;  2JSP A;  2HNH A;  3G2B A;  3OYN A;  2BW3 B;  3TBI A;  2RQQ A;  3BLY A;  4AVZ A;  1X1B A;  2F4I A;  3DQV C;  1TZL A;  4AU7 A;  3W2A A;  2VPL A;  3MKY B;  4LIV A;  5HOO A;  1WJB A;  4CH7 A;  3S3M A;  3U21 A;  3HPG A;  4XN3 A;  2DT6 A;  4B3X A;  3M1C A;  4XOT A;  3KYL A;  1MW7 A;  2WY8 Q;  2E5N A;  1UAA A;  3K70 C;  2LBF A;  4LIT A;  2KRH A;  1MNE A;  1JI8 A;  2VAS A;  2IS4 A;  2V4J C;  1W36 C;  2R4G A;  1T95 A;  1BR2 A;  2Z2S B;  4BAC A;  5CQG A;  3W2W A;  4PJL A;  1WJ5 A;  3A4C A;  4ANJ A;  1UEL B;  4HRI A;  2VQC A;  2RRE A;  2V6E A;  3VSL A;  4IX7 A;  4E7J A;  3DPT A;  2DJI A;  4PJJ A;  3VYR B;  4QPQ A;  4XN0 A;  2WA0 A;  3OWT A;  3BCA A;  2L5Q A;  4BJ6 C;  2VJ5 A;  4PSW A;  4OAZ A;  3CF2 A;  4ZDO A;  4U7B A;  2XDV A;  2E1M B;  1BR4 A;  3KEY A;  4BQO A;  3OYB A;  2GOM A;  3K70 D;  3FBI B;  3L2U A;  3OS0 A;  4BEH A;  2XF7 A;  4BQQ A;  2DXI A;  2K5C A;  3KX2 A;  4FET A;  4JOM A;  4XOR A;  3MKW B;  1R6R A;  2IGM A;  3DEE A;  4IQ4 A;  3IUO A;  5FRN A;  2V26 A;  4PSX A;  2KLO A;  4F55 A;  1KON A;  1VZ0 A;  2KPM A;  4NC8 A;  3D5S C;  3J7A Y;  2KL4 A;  3VDX A;  1D1C A;  4CCJ A;  2CUJ A;  4CUG A;  1GLN A;  1P9Q C;  3SDB A;  3LSI A;  2VKD A;  3OL4 A;  4NQW B;  2F6C A;  2ZXH A;  3OYC A;  3OYD A;  3K10 A;  3OMY A;  5KNL A;  2HPM A;  1Z3X A;  3QYF A;  2HVS A;  3UR3 C;  3MD2 A;  4Y33 A;  4RLQ A;  1YX3 A;  2CH0 A;  3VYT B;  3QYE A;  2E5Z A;  3M8J A;  3K4M A;  2I8D A;  4B48 A;  1QHG A;  4XKB A;  3K4C A;  3BG6 A;  3ZQQ A;  4CZC A;  1HA8 A;  4BQN A;  2KDO A;  3RSN A;  2KHM A;  3VYS B;  4C9Y A;  2CS3 A;  3BCB A;  4E4H A;  3S3N A;  3CZ6 A;  3CMM A;  4XR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...