2AHQA

Solution structure of the c-terminal rpon domain of sigma-54 from aquifex aeolicus
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
TYSLRTFFVRESAEGLTQGELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAKYREMLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RNA polymerase sigma factor RpoN
publication title The C-terminal RpoN domain of sigma54 forms an unpredicted helix-turn-helix motif similar to domains of sigma70.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 11
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2005-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ahqA01
1HF0A 2DMQA 3FIWA 3LSRA 1IJWC 3BR3A 5J1UA 5IYDJ 1MBJA 3H3VK 1GUUA 5FKKA 3ZOBA 4DZJA 3WHBA 2ZB9A 3DCFA 3HGYA 5FKMA 3JRBA 1S7EA 2EZKA 5EG0B 2DA2A 3HOYJ 3SJMA 5F0FA 1UHSA 1BW6A 3JRFA 2VKEA 2Y2ZA 3NAUA 4A3EJ 2VPRA 3CCYA 2X9DA 4RBOA 3JRGA 2IBDA 3H0GJ 2EZLA 2FX0A 3BR0A 1RPWA 5M5XJ 3S14J 3QPSA 1GDTA 2CJJA 2PMZN 4UUTA 5IP6A 2M0CA 1Z77A 1U8BA 1PUFB 5K7ZA 2XRLA 2HI3A 1JUMA 4C3JJ 4RDUA 5EDNA 4M3EA 4C3IJ 3GTPJ 1Y1VJ 3ZQIA 1BW5A 2VKVA 3LSGA 1BA5A 1DU6A 1T56A 1B72A 2OPTA 1B8IB 3RZDJ 3HOUJ 3CDLA 4UUSA 3BT9A 3BG3A 3D1NI 2DN0A 2X6OA 1JKOC 1LE8A 3FK6A 3FISA 1ORKA 3CMYA 3ZQCA 3JR9A 3CQZJ 5IP7J 1TC3C 1AKHB 3BG5A 2XB5A 1FIPA 3K7AJ 1GVDA 3DEWA 3I4NJ 2L9RA 1GV2A 4D5FA 4A3JJ 1RESA 5FJ8J 3NARA 1SFOJ 5EG0A 4MO7A 1JJ8C 2FJ1A 1ETKA 3BTJA 3K2AA 4X1EA 2DJNA 1E3OC 1Q1VA 3TEDA 5IPAA 3GTKJ 2XSDC 4JYKA 1P7IA 3C2BA 2HDDA 2CUEA 3B6AA 1X2NA 4C3HJ 1F43A 4A3KJ 4FE7A 4MIMA 1X58A 4G12A 3RKQA 1PUFA 2QCOA 2DA6A 1MBHA 4ABZA 2CRGA 4J19A 1XG1A 2G0EA 2MSYA 3GTGJ 3ZQFA 1Y1WJ 1X2MA 4L5EA 1CQTA 3A01B 4DYCA 1AU7A 5IYBJ 3BR2A 3BTIA 2K9QA 3G1MA 3TW7A 5DTDA 2ME0A 3O8GA 5F1JA 3FKIJ 2KT0A 3GTOJ 1AKHA 9ANTA 1WI3A 3Q0UA 4JX6A 1ENHA 2H8RA 2CUFA 4XK4A 5FLMJ 3S1QJ 4MFDA 3PO2J 3OSFA 1OJLA 3TW6A 3M4OJ 1HDDC 1TWCJ 2HQ5A 2XPUA 4AC0A 4DYQA 1IDYA 2CQQA 3IH4A 5M3FJ 4XRSA 4A3MJ 5F0CA 1NK3P 1WH7A 4A3CJ 1JT6A 4D7MA 2CU7A 5E3MA 3JRDA 3GBGA 1NK2P 3GTJJ 2JK3A 2TCTA 4M6VA 5DS9A 1T33A 4V2FA 3JRIA 3E7LA 3VPRA 3ZQGA 4W1UA 4FTHA 2GLOA 2DA7A 2LLKA 2R0QC 1ITYA 1FIAA 4QSHA 4A3DJ 1TWAJ 1JTXA 1FTZA 2R5YB 1ETVA 5C4JJ 5M5YJ 1JKRC 2XGCA 1OCPA 4JX4A 4FCYA 1MBEA 1JUSA 4M3GA 1R9TJ 4NDLA 5J3LA 2M9HA 3HKZN 1ZGWA 3S1RJ 2NS8A 5M5WJ 1WPKA 3O8HA 5K7FA 3OSGA 1JUPA 1I3QJ 2X48A 3PM1A 2O9LA 1LFUP 2YUSA 2M34A 2JA7J 5EGOB 2XPVA 4V2GA 5J1YA 3S17J 3W6VA 4IHYA 4M3DA 1DU0A 2E1OA 2L7ZA 4BKXA 2DMUA 4B4CA 1JTYA 2DA4A 1W0UA 1QPIA 1BJZA 3HOZJ 2FQ4A 2HOTA 5EEAA 2LTPA 3BTCA 5K7HA 2HOAA 2DMNA 2Y0SN 5IOYA 5C44J 1IV6A 2YS9A 2E2HJ 5F08A 5GPAA 3BR6A 1H88C 1QVTA 4MLOA 3HOWJ 2P81A 1XC5A 2R5ZB 4C2MJ 2NS7A 4I76A 2KDZA 2M8GX 2DTZA 2L7FP 2R5YA 3SFIA 1GV5A 1MSFC 2FD5A 4D5CA 2MW8A 5IOZA 4A3IJ 2ID6A 4XRSG 3BQZA 1NTCA 2MG4A 1WCMJ 3Q3SA 3JRHA 3GTMJ 4B1RA 2COBA 2AHQA 1O4XA 2B63J 5HODA 1ETOA 1OFCX 4A3LJ 5F04A 3BTLA 4MFEA 2Y9YA 4FE4A 2K40A 5BNGA 3MN2A 4DW6A 3B6CA 1IDZA 2JWTA 3QQAA 3SDGA 5EGOA 2NVTJ 4A93J 1MSEC 2LKXA 2N8GA 1B8IA 1U9OA 2NVXJ 3MKLA 2LR8A 4BBRJ 1IG7A 3L1PA 1TWGJ 3HB9A 1HCRA 1IGNA 3S2HJ 1TWFJ 2L7MP 3JRCA 4JP0A 1D5YA 1QRYA 2H1KA 5FKNA 5E3OA 2OF7A 3G1LA 1U9NA 2GBYA 2NVYJ 2E19A 4XIDA 2XB0X 2R5ZA 3Q0WA 1HOMA 5EZHA 1LFBA 2JN6A 1HDPA 1MNMC 3BR1A 4M3BA 1HLVA 5FLVA 4W97A 3OOUA 3TP3A 2NVQJ 5F27A 5EZGA 1ZQ3P 1MBGA 2EZIA 2EBIA 2AO9A 1RR7A 5E3NA 3JREA 2O7OA 4X6AJ 1WH5A 2ECBA 3IH2A 3HOVJ 1ZKGA 1VNDA 3S2DJ 4D7NA 4EEFG 3WHCA 1ZR4A 2M2EA 4B3AA 2VI6A 1VFCA 1ETYA 3I4MJ 2GM4A 3A01A 1I6HJ 1AHDP 2ID3A 2Y9ZA 4HNVA 1MH3A 1JKQC 3HGGA 4XRMA 2ELKA 2I10A 4CYCB 4BY1J 1WGXA 1W0TA 1MH4A 4XICA 3ZQLA 3G1OA 1ETQA 1EF4A 3LSPA 4S0HB 3F0CA 2ME6A 2WB1N 1QVUA 2K9NA 1BL0A 1P7JA 2L0KA 1H8AC 4IHVA 1ZR2A 1IUFA 1UMQA 2JA6J 1K61A 3IH3A 1UG2A 5M3MJ 3BR5A 2DMPA 4DYRA 2JMWA 2K9SA 3A03A 1JKPC 5F0HA 1MBFA 2E2JJ 1FEXA 3GTLJ 1TWHJ 2R7ZJ 1JT0A 2QF7A 2HYJA 3RQIA 2JA8J 2TRTA 2E2IJ 1POGA 4BXXJ 4Y52J 3S16J 4I6ZA 1MBKA 5C3EJ 5EYRA 4IHWA 3HBLA 1ZK8A 5EF6A 1I50J 3MVPA 3S1MJ 3HOXJ 1A6IA 1JGGA 1IRZA 3UKGA 1VF9A 2LK2A 1ZTRA 4M3FA 2IAIA 2O8KA 5J1RA 2D5VA 3LSJA 2XPWA 2Y31A 3RZOJ 1YRNB 4A69C 3Q0VA 4DZPA 2WV1A 3S15J 2DA3A 4CYCA 3FK7A 2R93J 1A5JA 5GP9A 1G2HA 2XGEA 1JJ6C 3OIOA 4IEJA 4BY7J 3PO3J 5FKLA 5FKOA 4A3FJ 5IP9J 2NOGA 2IEKA 3ZQHA 3BQYA 5IYCJ 4QIWN 3IV5A 1U78A 2R92J 1XS9A 2RAEA 2W48A 2LVSA 2Y30A 3HEFA 2HOSA 1SANA 3LNQA 3GTQJ 4QTRA 1RKWA 2EZHA 1GT0C 2MGQA 2VUMJ 4LOCA 2CQXA 4A3BJ 2DA5A 2HXOA 5JLWA 1APLC 1RKTA 3TP0A 1K83J 2YU9J 3HDDA 1RETA 2DA1A 2LY9A 2XGDA 4GFBA 1ETXA 1H89C 2LD5A 3BG9A 3S1NJ 1FJLA 1ETWA 1Z0XA 2WAQN 4FISA 2LP0A 2DMTA 2EH3A 2LFBA 3HM5A 1OCTC 2EQRA 2JA5J 1F36A 1YRNA 4IHXA 2JJ7A 1IC8A 5E3LA 4AUXA 1VI0A 5C4XJ 4Y7NJ 4AYBN 1B72B 3QPLA 3JRAA 3LOCA 5JLXA 3M3YJ 4JX5A 4BBSJ 3A02A 2HXIA 4UUSB 1FTTA 5GPCA 1LE8B 4A3GJ 2ECCA
chains in the Genus database with same CATH superfamily
2DODA 2FEZA 4P5OA 4CH7A 4P1WA 1J7KA 1ULYA 5IYDJ 4A12A 2B9SA 2DPUA 2AQEA 3ZN1A 3QP6A 3TDUC 5LGUA 2XKPA 3WHBA 3HGYA 3I64A 1XGSA 5HDNA 1TLHB 2EZKA 1T39A 1W7PA 3FXOA 3SJMA 3KLOA 3U9GA 1MMNA 1YS7A 1F9NA 1BW6A 2PN6A 2XIGA 2Y2ZA 4GGGA 2VPRA 2X85A 3K9TA 3CF2A 3QAHA 3EUHA 5ICEA 1RPWA 2RGVA 3LAJA 5M5XJ 3S14J 1WZ2A 3QYBA 4RGSA 1GDTA 4YRVA 4UUTA 3HUGB 2IS2A 2KRCA 2M0CA 1K78B 2FUG2 4Y17A 1MJAA 1IN5A 2LDUA 3CDIA 1PUFB 3G4SI 1X3ZB 5K7ZA 2K3FA 5JHFA 3ECOA 4C3JJ 5TISC 3DFGA 5LGNA 2BY2A 5EDNA 4YIRX 3EDPA 1BA5A 1F1ZA 4RMNA 3BZCA 2DTRA 3RZDJ 2DI3A 4PGGA 4HQMA 4UUSA 3BT9A 1SD6A 4HX7A 1IXRC 4HF0A 2DN0A 2X6OA 4ENMA 1LE8A 3WE3A 3FK6A 1ORKA 1G3SA 3KP7A 2A07F 3JR9A 5IP7J 1Z67A 2F6CA 5H2FC 3BOQA 2QENA 3HTUA 3CMAI 2A05A 3GW2A 4ENNA 3BG5A 4MHGA 1N25A 2DQLA 4LK1F 3K70D 2L9RA 3I4NJ 3WU2C 3S32A 4LJZF 4A3JJ 2LREA 5FJ8J 4J00A 1LPQA 4BU2A 5J8CA 1Z05A 4XKBA 1X19A 2BBYA 2HWVA 2QBYA 2IXSA 5DCMB 3CC7I 1GHCA 2LY2A 3JSPA 5IPAA 3BG6A 3KEQA 4BE0A 2FQ3A 5LHGA 3H92A 3C2BA 1KQ8A 5DEQA 4IO9F 3B6AA 2L01A 2IA2A 2XV4S 1U8RA 1S7OA 2COMA 3VSLA 2KHMA 1MZBA 2MA3A 2BZTA 4KN7X 4MIMA 1X58A 1RNLA 3RKQA 1LDKB 2QCOA 2DA6A 1MBHA 3CJRB 2CRGA 2LBFA 3CUQC 3L2WA 2NRAC 2L9NA 3GTGJ 3GMEA 1Y1WJ 2IW5A 2OU2A 1MDMB 5DDGA 1OLTA 4A0YA 2R7DA 1W5SA 3ERED 3A1YA 5E17F 2K9MA 3KEYA 3PFIA 5L3DA 3RPUD 3E5UA 1VQ4I 2V9VA 3GVAA 5D5WB 3OOPA 4YIFA 2Y0SA 2ZBKA 3G6EI 4LG0B 1KZHA 3T8TA 2H09A 4XOTA 5BQTA 2V79A 3GTOJ 1AKHA 4XK4A 5FLMJ 2V4JC 3S1QJ 4ZC3A 1AA7A 5FGMA 3PO2J 1HDDC 1TWCJ 4IRIA 2HQ5A 3SZTA 2XPUA 4PDKA 1OISA 4DYQA 1IDYA 2H1LA 2NS0A 1LB2A 2AS5F 5M3FJ 4XRSA 2P0WA 1Z1DA 1NK3P 3R0AA 4FX4A 4KDPA 1JT6A 3GBGA 2RREA 2JK3A 4XN0A 4XL9A 5LRSA 2ESNA 2F5CA 3E7LA 4W1UA 3HSFA 2IS6A 3PNVA 3R4KA 2DA7A 3FXMA 2R0QC 2V9PA 3M8FA 1BR2A 4HRIA 4WCGA 2OCEA 1FOXA 2EIMH 3H35A 1D3YA 2R5YB 1G8XA 1JKRC 1S72I 1YE9A 2HTJA 1K4TA 2XGCA 4NC6A 4FCYA 4XKVA 1R9TJ 2A5YB 2ZFUA 1Z9CA 1MGTA 3FXJA 4RLQA 1OQYA 2M9HA 4BACA 1WPKA 2OJED 2X4HA 3O8HA 2PJPA 2K4JA 5CJ9A 1I3QJ 4PUSA 3OS2A 3OL3A 5LEJA 4HV5A 4MEYF 3CMMA 2JA7J 3DBHB 1HXDA 5EGOB 1B9MA 1Z6RA 5DYMA 1MJ9A 1DU0A 2HU9A 1T6SA 1B59A 1JTYA 3DLLF 4XR6A 5KAIC 1FC3A 2I5UA 2CV2A 1W1WE 2HOTA 1HBXG 5EEAA 5FRMA 2DOEA 3ABTA 2NXNB 2M30A 3I55I 4I0BA 2LTPA 3DKYA 2HOAA 2E5NA 2GOXB 1IV6A 4I02A 3LSTA 4WWCA 5F08A 5GPAA 3LSIA 3F8NA 1H88C 3LSHA 5AONA 4M9SA 2BVMA 2DAOA 3OL4A 4C2MJ 2NS7A 3FXLA 4I76A 2M8GX 3SZGA 3I5UA 3WTTC 2E71A 1LNWA 1V5EA 3VOEA 2FD5A 4D5CA 3MFKA 2W7NA 2DT5A 3ZQQA 1FOWA 3HOSA 1VQPI 3HKZA 3BQZA 5AIPA 2MG4A 1WCMJ 4H0EA 4CZCA 4IXAA 3JRHA 3H1CA 3KZIC 3S8PA 4FT8A 2VN2A 1I1GA 1OFCX 3OYLA 3HUGA 5F04A 1H9TA 3BTLA 2ADUA 2Y9YA 3F8BA 5BNGA 2K40A 1UCRA 2J5PA 3QQAA 3SDGA 2UXNA 3HOTA 4A93J 2X0LA 4HV6A 4U87A 4CDGA 2N8GA 3K4JA 1QBJA 4LIUA 1VQ9I 4DQ2A 4XRFA 2FMLA 2XAGA 5BPIA 2MC3A 2RNJA 5ILSA 3F9KA 2E1MB 2STWA 1IN4A 4ITVA 1HCRA 2LKPA 1D5VA 1N77A 1WSUA 4FASD 1FOYA 3FHZA 1HA8A 1FWZA 1U9NA 1Y8RB 1S8NA 2XB0X 1HOMA 4ZZDA 3HL2A 4E7HA 5HDGA 3U21A 3H3ZA 2Y48A 2HVQA 3PJRA 3BR1A 4M3BA 2BW3A 4PJNA 4EMSA 3GO5A 4IX7A 3FMRA 3F3XA 1JE8A 3RPQA 3RPUA 4EJWA 2BXYA 3ZR8X 4A6DA 5HVQC 1YX3A 1V54H 2E7XA 2XKOA 5KK1A 2EBIA 2AO9A 1RR7A 5E3NA 3KP3A 2ECBA 5ILUA 1ZKGA 2H27A 1VNDA 1SD5A 2HQRA 4WXCA 2E5ZA 2F4IA 1YOVB 1H0MA 3FXQA 3WHCA 2EFWA 2OTLI 2EV5A 2JPCA 1Y56A 4B3AA 2HEOA 1XSVA 3OS0A 3I4MJ 1MDMA 3T5XA 1ZGJA 3T8RA 2FE3A 1JKQC 2L9SA 4C9YA 3M8EA 4E7LA 4HPQA 1YG2A 2ELKA 3FXUA 2QM3A 5KHDA 3CF5F 3TO7A 4UHTA 1S5LC 1TTYA 2VXDA 5EEHA 3KYLA 1EF4A 3LSPA 3ZRGA 1XMXA 2HDCA 3F0CA 5FROA 2UV1A 5AIQA 1D0YA 2L0KA 2R7SA 1IUFA 1UMQA 4HLYA 1X3UA 3CP8A 5M3MJ 3DKXA 2YSRA 1FLIA 2JUCA 1EH6A 2K9SA 5H6QA 1ZARA 1MBFA 4N4NB 2E2JJ 3ELKA 5B66C 2DPDA 3KZYA 3MCZA 4BXXJ 4Y52J 3TDZC 4ESFA 4WK8F 4I6ZA 2V1DA 4RS8A 1RR8C 2WV0A 1LDJA 1XX5A 3BZKA 5EYRA 4P55A 2ELHA 4LLNA 4EQQA 2GXBA 2NVUB 3E5QA 4Y33A 1HKQA 4EM1A 4PSWA 3D0SA 2RKHA 1IRZA 3DWLE 3WTYC 1OMIA 2K5CA 2LK2A 3V7CA 3HHGA 1UHWA 2VIXA 3PFYA 3S3MA 2KJCA 4GYIA 4WX9A 4Y13A 2FOWA 2Y31A 3ZPLA 5IT9K 3VODA 5JI6A 4DZPA 1TZLA 1RI7A 2WV1A 2W57A 2GIZA 2O03A 4KUMA 1TP4A 2DA3A 4CYCA 3WTVC 3FK7A 3D5LA 2R93J 1A5JA 5GP9A 4O3MA 4AM3A 2ESHA 2JUGA 4N9HA 3FBNB 1MMDA 5FKOA 4A3FJ 2DDAA 5LGTA 4I98B 1UG0A 5FLXK 3A4CA 2CV1A 1IAWA 2VKDA 2XAUA 2RAEA 3AG2H 2IGMA 2HOSA 3K2ZA 3LNQA 2EZHA 3N97A 1Z6TA 3QWLA 3HXLA 1W7PB 2J5OA 1APLC 3G2BA 1RKTA 4RGRA 1SMTA 3HC7A 1JI8A 2P5KA 4ZYDA 1Z3XA 3W2VA 1ZH5A 3I3LA 3IKVA 3ONQA 5D8LB 3V8JA 1I5ZA 1RETA 2LY9A 4G7ZF 2QZ8A 2E1CA 2YU9J 4F91B 1ETXA 4CCJA 4DJAA 4R8HA 1SVMA 1H89C 1KQ0A 2HOEA 2PEXA 2VBYA 4RB2C 4BDZA 2IVMA 5HS7A 3WG7H 2ETHA 4ESJA 1Z0XA 2WAQN 4M72A 1RUNA 3NWSA 3F8MA 4HYEA 5E8GA 4ZZLA 1GXQA 2UZKA 1U3EM 2XC7A 4HSTA 4ENKA 2EFOA 1P9QC 4IHXA 5E3LA 2YPRA 2ZJQF 1Y6IA 4AYBN 4Y7NJ 3M7GA 3O3KA 2PMHA 4BAYA 5E1ZB 3LOCA 2PFBA 5JLXA 4YFXF 1XDUA 3M3YJ 1EJ9A 4XM3A 4UUSB 2CW8A 5GPCA 3DTIA 2AQFA 3G73A 2CGPA 1LE8B 3WTUC 2GWRA 1R49A 3EETA 4YIIA 5JVTA 2DMQA 3FIWA 3LSRA 1IJWC 3BR3A 1MBJA 2M7AA 4JQFA 3L2CA 5E1WA 4L18B 2UWMA 4Z6YA 2Z33A 3B73A 1ZG3A 2CFOA 2H6CA 2ZB9A 4XLFA 4LITA 3BZ6A 5F6FA 4CCLA 1JGSA 4PCQA 3SYTA 3CCQI 1D8KA 4NC7A 2QBYB 4BE1A 2ZJRF 3M1EA 3CCYA 4I2OA 4BE2A 4LMYA 3H0GJ 4HOBA 3VYTB 1QA6A 2WAFA 3K4BA 2ZMEA 5ICCA 3QPSA 3ASNH 2XUBA 3QOEA 1T38A 3M8JA 2XSJC 1V4RA 4HEA2 2VBXA 3P5JA 1IV8A 3ASOH 5CVVA 3L7WA 2XRLA 1UJ8A 1JUMA 2LBFB 2W4SA 3S2WA 4M3EA 4OAZA 2MLKA 4N4OB 4C3IJ 1ONVA 2KZVA 3ZQIA 1BW5A 3LSGA 1KYWA 3E6BA 1DPRA 1U5TA 1KU7A 2WBMA 1BJAA 3GLLA 1ZLJA 4XLEA 3D1NI 2H8WA 3MMYB 1X1PA 4OU0A 4CUGA 2DK8A 1NG7A 3DU5A 2OD5A 3ABUA 4AIHA 4RB1A 2STTA 2M45A 5CPRB 4OOIA 4A2UA 1AKHB 2JA2A 1FIPA 3OY9A 1GVDA 3IWZA 2EIJH 3TO6A 2IJLA 4EJOA 3OS1A 1SFOJ 1FYMA 5TJJA 4BJ6C 3ZGKA 1JJ8C 3GYHX 5H20A 2FJ1A 1HW2A 4NNJA 4Y15A 3MZHA 4X1EA 5HS9A 2GA1A 1Q1VA 4XN3A 3CCEI 3TEDA 5BOXA 1HW1A 1V5GA 3HSRA 2CH0A 2X1EA 2PMZA 4A5NA 3CUQA 5D5VB 2CUEA 5LBQA 2XASA 2Y75A 1X2NA 4RAFA 1DGRM 4LB6B 5LEKA 1IF1A 1F43A 2LG4A 1YO5C 1UELB 1VZ0A 4RAYA 2Q1ZB 3MZ8A 4PFPA 4Q4ZF 1W36C 5D6EA 3BJ6A 1TQPA 1XG1A 3ZN0A 4HNTA 1FNNA 2NAZA 1STZA 2LH9A 4LGWA 1XB4A 4L5EA 2DU9A 3LQRA 3A01B 2W85A 5E79C 4DYCA 2OCCH 2EFQA 3NEUA 1BR1A 3JW4A 3HPHA 3I4PA 4A0ZA 2K9QA 4FHTA 2P7CB 3REOA 2DFHA 3DEEA 2LF8A 3PIPF 2KT0A 3QU3A 1G3TA 9ANTA 1WI3A 4JX6A 1ENHA 2KP6A 2CUFA 1MNEA 2VT3A 4MFDA 3H9JA 3TW6A 1MD0A 5H6RA 1UFMA 2HS5A 3DPLC 4MTEA 2QSFX 1YYVA 4PK4A 4HG2A 4A3MJ 2FBHA 4A3CJ 4D7MA 5DUIA 1N78A 1TNSA 1W4MA 2FU4A 4B48A 5DS9A 3WTWC 2QSGX 4V2FA 4UNOA 2CFXA 1FYKA 3JRIA 2GLOA 2P5LC 3AL0C 2LLKA 2CUZA 3ZP5A 1A36A 1FIAA 3HHHA 2XHKA 3K4MA 4DNCA 1K7AA 2HQNA 2VQHA 1X4PA 1TWAJ 1JTXA 1FTZA 5L3FA 4KMUX 5FO5A 2IRFG 2XAHA 2EK5A 4JX4A 1MBEA 2VPLA 2TDXA 1BIAA 3MEXA 4MQVA 4UV8A 2L3DA 4MNUA 1G59A 3DLAA 4KITB 2VB6A 5J40A 3U1DA 1K79A 2BYVE 3VYRB 2QQAA 3OSGA 1JUPA 2RVCA 3K4LA 2HTSA 1LFUP 2YUSA 1T0FC 1TW2A 3S17J 3AG3H 4BHCA 1U2WA 4M3DA 2M4GA 4H4KC 3A0BC 2R7FA 3QRFF 1YITI 4XKWA 4B4CA 2Y69H 1W0UA 3LA3A 1BJZA 3HOZJ 2LSOA 5HOOA 1BR4A 2JPBA 3WODF 3G3ZA 5CLSA 3CUOA 2DFFA 1RC9A 3KP5A 3SEQA 5K7HA 2DYRH 3F72A 3TGNA 4HF1A 1OCOH 5C44J 5ILVA 1OR7C 4I01A 5HLIA 1XD7A 3HOWJ 4OIOF 4D0PA 3VDXA 5IT9Z 2DTZA 4NUBA 5DCFA 4BXFA 1MW7A 2KDOA 2MW8A 2E60A 2BW3B 5IOZA 4DIQA 3QYEA 3Q3SA 3GTMJ 1BI0A 1XSXA 4LG3A 2JZYA 2COBA 3CCSI 1O4XA 1TQMA 2K9LA 2VL8A 1ETOA 2VKHA 5FLXZ 3I58A 3AFHA 4MFEA 3MN2A 5JR3A 2DLLA 2NYXA 2BY3A 2V7FA 2XGXA 1YFHA 3C2GA 1SC7A 1J0RA 5FFXA 1MSEC 5LRRA 4B43A 5LD2C 3FM3A 1U9OA 3E97A 2NVXJ 1L0OC 3MKLA 2LR8A 1MMSA 4CICA 4BBRJ 4IKFA 4MGRA 2IP2A 3IRQA 2CUJA 1BN5A 5DUKA 1MMAA 3K0LA 2HNHA 2Q0OA 4B8XA 2K3PA 2L7MP 3JRCA 1IXSB 2ZFWA 2HKOA 3CCUI 2A6EF 1UB9A 1SVLA 1R5HA 2JVHA 3GFLA 3LFUA 4JP0A 2ZC2A 1WRJA 4BQNA 1R1VA 2IGNA 3OYFA 4HW0A 2GBYA 1OCZH 1VQOI 4XIDA 3SZPA 1R23A 1S9HA 3H5AA 2K7LA 2E34A 2F5DA 3GFIA 1FZPB 1MNMC 2IS1A 1XSDA 2D1VA 3OOUA 3R60A 1ZG5A 3T0YA 1Y39A 3TP3A 3L2VA 1ZQ3P 1MBGA 1I27A 2BOLA 4O6JA 2EZIA 3JREA 2BY1A 2CW7A 4X6AJ 3QODA 3TKYA 2HGCA 3DBLB 4LLLA 4MQ9F 2VC0A 4PGHA 4D7NA 5ICFA 3H5NA 1WJ5A 2YU3A 2LYCA 2L4MA 4EM2A 2M7BA 1IN7A 1ETYA 4CHUA 6PAXA 3A01A 1MMGA 2BEOA 1AHDP 1VQMI 3OMYA 3MQ0A 3FF5A 3GFJA 4CYCB 4BY1J 1WGXA 1YIJI 3ZXSA 1TNTA 3GF2A 2KIFA 4XICA 4M6YA 3ZQLA 1A31A 2ZXWH 3LAPA 1VTNC 2FA5A 4DBQA 1Q1HA 2WB1N 4GCVA 1BL0A 1ZRCA 3LA2A 4OIQF 3DKWA 4IQ4A 1K6OA 4U7BA 4GYGA 5L3CA 1ZR2A 1D8JA 1K61A 2DMPA 2JMWA 2F2EA 2DW4A 1JKPC 1OYWA 3PQKA 3BPVA 1LEBA 1ZAOA 3GTLJ 4KNYA 5D8KB 4IRHA 2ZSIB 4CSWA 3RQIA 4IVNA 3L2RA 1LKXA 2JA8J 3CDHA 3RKYA 2LY1A 1POGA 1X1AA 1QZZA 2W24A 3DBRB 3BPXA 5C3EJ 3DP7A 1I39A 2O8XA 2H94A 2KQRA 2EIKH 1P2FA 4Q48A 4ZYGA 3PUBA 1W5CC 2VE8A 1W36D 3MVPA 1A6IA 1JGGA 1KONA 3AG1H 2K27A 1XGOA 2A61A 2RN7A 1TQIA 2EA2A 2Q8KA 1CGPA 3RZOJ 1BI2A 4A69C 3F8FA 1LVKA 4G6TB 1E0EA 1FMVA 4OIRF 3EPZA 3HSEA 1A35A 2MC4A 3S15J 5L3BA 1G4DA 2P7VB 1LEAA 1G2HA 3OIOA 3RTRA 2BGCA 2AXTC 5D5UB 3AKZA 5FRNA 4CZZA 3PUFA 3PIOF 3OYKA 1HSJA 3QPHA 4CCNA 4YFNF 2IEKA 5EEGA 5CVUA 2R92J 1WHUA 4BXUA 1O3TA 1BC7C 2PMUA 3VFZA 3S93A 1YTYA 2F5VA 3GTQJ 3CCMI 4QTRA 2DQRA 2VUMJ 3O2PE 1PP7U 1IRFA 2FF4A 5JLWA 3QOPA 4UUVA 4BUPA 2HKXA 3P9CA 2QQ9A 2DA1A 1B9NA 5IT3A 4LK0F 3DU6A 3HYIA 1NH3A 4GFBA 2W1OA 2ZMEB 2IS4A 4J01A 4M6XA 3IWFA 1ETWA 2QUFA 2LP0A 3HRSA 4KN4X 3IL2A 1V55H 2DMTA 2JRMA 4XONA 3DEUA 2G7HA 4FQGA 1OCTC 3RCOA 3E3VA 1DP7P 1YRNA 3DV8A 1YJWI 2Q2EA 2GXAA 1UAAA 1U5TB 2D1HA 3JRAA 2OQRA 3TL4X 1E2XA 2PJRA 3A02A 2HXIA 3FWEA 3CLQA 5FFZA 2Z16A 3LWFA 4A3GJ 5GAEJ 3FDYA 5GAGJ 4CA0A 4DGWB 3C7JA 3QU6A 4HZFA 3KX2A 2CYYA 1GXPA 5J1UA 3H5RA 1GUUA 4KA4A 1XDSA 3DCFA 3OYEA 4NQWA 5FKMA 3JRBA 2VLAA 4KISA 3HOYJ 3RIRA 1UHSA 2IA1A 1R5ID 2VJ5A 2VKEA 2MBFA 3HG9A 3NAUA 4A3EJ 2DO7A 5J6XA 4RBOA 1IW7F 1P6RA 4KIBA 2IBDA 3H36A 4XNFA 3CESA 2FX0A 2WTEA 2RDPA 2GOMA 2O61A 3CUQB 2KPMA 3IAS2 2DCEA 4Q47A 3OYGA 4KT6A 1HKTA 4BGDA 4N0BA 2B0LA 4HF2A 5IP6A 3F6VA 4KMFA 3TO9A 3J7ZI 1IRGA 2O5RA 1Z77A 1LJ9A 1E3HA 4ASNA 3BJOA 1P92A 2I8DA 1B1BA 1EKEA 1FBUA 3IUOA 3T1BA 4RDUA 5D5XB 1ZHFA 4PJMA 1S7AA 2DFIA 3GTPJ 2IGOA 2VKVA 3GZ5A 2DFEA 1T56A 4NBQA 2OPTA 4IQJA 3HOUJ 2L7KA 3RKWA 1KU3A 2GAUA 1QZEA 4XLAA 2QYOA 4KIGA 1O3RA 4U0WA 4CO8A 1JKOC 4HLXA 1WI9A 3W2WA 3ZMUA 3FISA 2CQ7A 3I53A 2XAFA 3CQZJ 4BHPA 1TC3C 2BV6A 1DP3A 2P4WA 2XB5A 5EJCA 3DEWA 4L5JA 1GV2A 2XDVA 1YW8A 4D5FA 4E7SA 1ZRFA 2ZXIA 3B02A 1YX5A 4FETA 1RESA 5EG0A 3OYNA 1ETKA 2RQPA 3BTJA 3K2AA 2DJNA 2QWWA 4E4HA 5K5RA 1E3OC 4YG2F 1YS6A 4I99C 3FXKA 2WA0A 4U0VA 1LQ1A 4GRIA 4M9ZA 1REPC 4TV7A 2XF5A 1NHAA 1BBYA 2O3FA 2EFNA 1R1TA 4HAMA 4KYWA 3CO7C 4M74A 4CXFA 1Z21A 3I59A 4G6DA 1LVAA 4J19A 4MTDA 4E7KA 2PI0A 2L5QA 4EV0A 1H9GA 1X2MA 1WJAA 1SFXA 3J81K 2ZJ2A 1K4SA 2QSHX 2NNNA 3EUKL 1D1AA 1AU7A 1F4KA 5B1AH 2X6WA 5ICGA 1KA8A 3BTIA 4IL6C 1XMAA 2GIVA 4G9YA 3SQNA 1FPQA 2ME0A 1EV7A 1KGSA 3NRVA 1R1UA 1IN8A 2QQBA 5DD8A 5HNFA 3RYPA 2H8RA 4F3QA 3HIFA 5HS8A 2R7QA 2F5EA 3LMMA 3J7YJ 3M4OJ 2FBKA 1XN7A 1IN6A 3E5XA 2Z5UA 4D1QA 4AVPA 3OYIA 2CQQA 5K5QA 3DPUA 3WGHA 3A2KA 5F0CA 5HLGA 1IXCA 2HVSA 1NK2P 3F21A 3GTJJ 2TCTA 4UB8C 1BOBA 3S3OA 3MAJA 4NC8A 1O3SA 4FTHA 1DQUA 2MD0A 4ZYEA 3VEPA 5JFRA 3R61A 1S29A 4RAZA 2LF7A 3ECHA 2B7EA 1EH7A 4QSHA 4A3DJ 2V9KA 4XOPA 4Y4RA 5E18F 5GTIC 5C4JJ 1Z7UA 1WWXA 2DDBA 4UVCA 2EV6A 3DTEA 2FXAA 1R58A 3K1PA 2QQ8A 2BXZA 3Q9VA 1O57A 2EILH 1EA3A 5J3LA 4YELA 3HKZN 1ZGWA 3S1RJ 1I1SA 4C2TA 5IY5H 2MYSA 1TT0A 5K7FA 5J47A 2X48A 3PM1A 4ZDLA 4XQFA 2HYGD 2NNYA 4OIPF 1SFKA 3TBIA 3GEZA 3IAM2 4F92B 2XPVA 1DUXC 5J1YA 3AAFA 2LNBA 4IHYA 1FBQA 2E1OA 2L7ZA 2W82A 3RJPA 3ZMTA 4BKXA 3L09A 5HLHA 1QPIA 2G7UA 1W5TA 2KIUA 2FQ4A 3FX3A 1PVEA 3U2RA 1ZN2A 3K4CA 3BTCA 1OR7A 2VJIA 4PZJA 2DMNA 2BVLA 1RIOH 4LB5A 5IOYA 2ZO4A 1SD4A 2E2HJ 4EATA 1ZG1A 4MLOA 1BI1A 2LKSA 2A69F 2P81A 4ESBA 1PYVA 1XC5A 4M73A 2R7OA 2KDZA 3PQJA 3GUDA 1ACIA 4C2UA 2RNGA 3SFIA 2VJJA 2VJ4A 2W00A 2X51A 3LL7A 3IKTA 1FBSA 3ERMA 1BIBA 2ID6A 3JCUC 3R6SA 4XRSG 1NTCA 4S05A 2A5WA 3WTZA 2IGKA 4OMZA 3J7AO 5HODA 3M1CA 1G3YA 5E20A 4A3LJ 4CCOA 1I6XA 5GTHC 3ZMVA 2WC2A 4FE4A 2VC1A 3E6DA 2KKOA 3B6CA 2WB1A 1VQ8I 1IDZA 4BS9A 1ZLKA 2CWEA 1E17A 4D9JA 4U88A 3IHUA 2X1DA 5F1RA 4ZH4F 4JOMA 3D5SC 5FD6A 2FRHA 2OAZA 2P5VA 3LQQA 5B5EC 4CCMA 2R7WA 4PJ0C 2JQ7A 3LFKA 1IG7A 3JTGA 3EQLF 1SAUA 3L1PA 1XCBA 1TWGJ 1IGNA 1Z91A 3ZQ7A 1TWFJ 2LRDA 4LD5A 2KL4A 2QVOA 2RQQA 1QRYA 2H1KA 2RC4A 3C18A 5FKNA 3U1KA 5E3OA 1OCRH 1J5YA 2OF7A 4LIVA 2NVYJ 1U6GA 2V1NA 1T8IA 4L0ZB 2HDWA 1AOYA 2R5ZA 5L3GA 1RUOA 3CJQB 1G3WA 4QLCU 5CYVA 2VOOA 1DGWY 3ZMSA 4AVZA 3SFZA 3HJEA 4ZTJA 1ON1A 1LFBA 1YHQI 4E7IA 1HDPA 1QPMA 2FSWA 2EINH 3FBIB 4I09A 3JAMK 3GX4X 1YQAA 3GWZA 4W97A 2V1XA 1R4MB 2F4MB 4PJJA 4IZZA 2PLYA 2A3SA 1YJNI 5F27A 3G71I 2ZCWA 3BJAA 2R7UA 2ISYA 2JTVA 4BJTA 5D4SA 5A2QK 3W6JB 1MKMA 4HA8A 3JSOA 1T08B 2HYFA 2EA4A 3KCCA 3ZCOA 5B3SH 5LFAA 3HOVJ 4XMYA 3IP4B 3ULQB 2K86A 2MH2A 2PQ8A 3S2DJ 3E0JB 1OCCH 4U0YA 2A68F 5D4RA 3BLYA 2XF6A 3LSKA 2X6XA 1FMWA 2OUMA 4BEHA 5K1YA 2M2EA 2VI6A 1VFCA 1MIJA 1T2KA 2GM4A 5B1BH 3GFMA 2ID3A 4HNVA 2VT2A 2QGUA 1MH3A 3P7NA 3HGGA 1FSHA 1XTAA 3FZVA 1VQKI 2JRTA 1J9IA 3K1NA 2GXGA 1ETQA 2MABA 2IT0A 2R4GA 4S0HB 2ME6A 3FHNA 1E3PA 1WVRA 2F48A 2K9NA 4E7JA 2E1MC 2K4BA 3V4GA 4CYDA 4IHVA 1Y0NA 1R00A 4EGZA 2JA6J 3PSIA 5DD4A 3VSKA 3A03A 3MWMA 5GADJ 3RKXA 3AG4H 1FEXA 1B6AA 2MD5A 1JT0A 2R7ZJ 2HYJA 2CW0F 2TRTA 1J2XA 3DTKA 1TBXA 2E2IJ 2ZMEC 1SEUA 1RRJA 3KZZA 2EB7A 3S16J 3BCBA 1S3JA 2L54A 1YLFA 3CJNA 3HZJA 3TOAA 3UR3C 3CO6C 2H6BA 2X6YA 4BQAA 1UHMA 5J8FA 2KRFA 5CVJA 5EF6A 4BHBA 1Z3YA 1I50J 2C6YA 3I54A 3S1MJ 3HOXJ 3V8LA 4ZDPA 4N9IA 3OYJA 1SVOA 1ZTRA 4M3FA 1U5TC 1D1BA 4K2EA 2D5VA 3LSJA 4WXDA 5ERIA 1YRNB 3Q0VA 1VQNI 5DM6F 2Q2EB 3FKJA 3CC2I 2DT7B 1D0XA 2PJRB 3H9QA 5BMZA 2KISA 1JJ6C 4XORA 3PO3J 3HRTA 1N75A 2F5FA 1IO2A 2XRNA 2P6TA 2NOGA 3NQOA 1JHHA 1S6LA 3X2QH 3ZQHA 2VODA 1D1CA 4L0YB 4UV9A 3IV5A 2FNAA 4ZTFA 1ODDA 4L5IA 2W48A 3UNGC 3PNTA 4HBLA 3VYUB 4M71A 1J59A 2KLOA 4NQWB 3F8CA 3LSMA 5D6FA 5BS6A 3J81Z 2HVRA 3S3NA 2XVCA 4LOCA 4YEJA 2DA5A 3VB2A 3WU0A 3V42A 3E6MA 4A0XA 1K83J 2EJRA 3N4MA 1R7JA 3WE2A 3HDDA 4IJAA 2CO5A 1X1CA 1HC8A 4XLPF 1AWCA 2QEXI 2VOPA 3MKZA 3K4NA 3KPHA 3BG9A 2L4AA 3S1NJ 4G7OF 3BC8A 1OYYA 1XGMA 1X1DA 2EH3A 2X1CA 2Z2SB 3I56I 3HM5A 1QHGA 2JA5J 4OAYA 4ZYAA 1VQ7I 1VQLI 3VYSB 1SAXA 4AUXA 1VI0A 2E36A 1WFXA 3RI4A 2JSPA 4S04A 3CJTB 4EJUA 3H3UA 4BBSJ 3OWTA 3E1SA 3OYDA 4OWRB 1WJCA 4HX4A 1FTTA 5E1XA 2CQKA 1GLNA 1HSTA 4R79A 1UZCA 1T98A 2Y0MA 2ECCA 3SEZA 1HF0A 3KP6A 1FSEA 3N05A 3J80K 3H3VK 5FKKA 3W2AA 3ZOBA 4DZJA 1TT5B 2HR3A 3QYFA 4G8XA 1S7EA 5EG0B 2GQQA 4Z2YA 2DA2A 2HQAA 2KRHA 4BQQA 5F0FA 2VQLA 3JRFA 3W6KB 1TW3A 4G7HF 3D5RC 2X9DA 3JRGA 2EZLA 1IRXA 3BR0A 4RGXA 4IF4A 3SXYA 4B3XA 2WAQA 2KMUA 2CJJA 2PMZN 3RQ4A 2R3SA 1K6YA 4F55A 3KE2A 4KIFA 2R7XA 3CCRI 3I59B 3EUHC 1U8BA 3ABLH 2WAEA 3RDIA 2HI3A 1OYIA 4P9UA 3BROA 4UXNA 4I0AA 4AYBA 1CF7A 3DPTA 2UXXA 3ZMDA 2HZTA 4JBAA 1Y1VJ 2BHYA 2OC6A 3WGIA 4IHSA 1DU6A 1T95A 3H0DA 1B72A 1B8IB 2JSCA 4GXOA 3C3WA 1YW9A 3CDLA 4ANJA 4EVIA 2OTJI 1KU9A 1RZ4A 1MJBA 3BG3A 3CCJI 4FX0A 1R22A 1VQ6I 4ON0A 5CVIA 3O6BB 3OV8A 3CMYA 3ZQCA 4RGUA 4F93B 2LOOA 3CZ6A 1M1EB 4KJZA 4DBRA 2EV0A 1LUJB 4XSXF 4F52A 5FD5A 3IC7A 1DDNA 3K7AJ 2K85A 1ZRDA 1QZYA 1R36A 4BJ5C 3L00A 1WJFA 1V3FA 2M5WA 3NARA 5CVRA 4MO7A 1X4OA 1FOKA 1ZELA 4E70A 2VQCA 3AL0B 3KFWX 3M9AA 3SHFA 2OZ6A 3GTKJ 2XSDC 4JYKA 4Q5SF 2R7TA 1WJDA 2Z1DA 1P7IA 4RA2A 3I9V2 3ZMZA 2DXIA 2HDDA 3KIOA 2XAQA 1TL8A 3OIQA 1YIOA 3W3CA 4C3HJ 2L9VA 2E7WA 4OMYA 2K02A 4A3KJ 2L02A 1K78A 4FE7A 4QPOA 4G12A 4OINF 1PUFA 1MNDA 1Z7LA 4BNCA 4G94A 3V7RA 4ABZA 3E6CC 1C0WA 1EH8A 2E35A 2G0EA 2MSYA 2ZNZA 3ZQFA 1PDNC 5KVRA 1J75A 3Q5FA 1CQTA 3WTXC 1WJBA 4BQOA 3PNYA 5IYBJ 3BR2A 1SFEA 3RYRA 3WU1B 4DOZA 4BDYA 4XKCA 2DOFA 3FXRA 3G1MA 2PBIA 5DTDA 3TW7A 3EYYA 5L3EA 3O8GA 5F1JA 1JHFA 2WWYA 3HRUA 3FKIJ 2QLZA 2DBBA 2Z9OA 2CG4A 3Q0UA 5LLQA 3DXJF 3ISPA 2QKLB 1LFPA 3BWGA 3OSFA 1OJLA 2AXLA 3JAMZ 1V5FA 4KICA 2BE5F 4AC0A 2ZKZA 2EWNA 2YX4A 3MZYA 3IH4A 3L2QA 1XPXA 3ML6A 5DCMA 1WH7A 5A2QZ 3MD2A 2CU7A 5E3MA 3JRDA 3OYAA 2V26A 4M6VA 3MKYB 5JVGF 4ZDOA 3OYHA 1T33A 3F6OA 5CQGA 2FNPA 2UUZA 4L9TA 4F7ZA 4O5VA 3VPRA 3ZQGA 3VWBA 1LDDA 4I7HA 4EM0B 1ITYA 3TOBA 3K69A 2QA4I 2V1UA 1HW5A 2HZDA 3K10A 2KIQA 1ETVA 3V8KA 5M5YJ 5DM7F 3QPTA 5CQEA 1FT9A 2VQGA 5LHHA 1OCPA 1WJEA 2DYSH 1JUSA 4M3GA 3OR1C 4G6QA 5F64A 2ELJA 4NDLA 5LHIA 1B4AA 4CGZA 3ESWB 4B09A 3NWTA 4PJLA 2NS8A 5M5WJ 2ZXHA 4HQEA 4C30A 4PSXA 3K4KA 4B47A 2O9LA 3GZ6A 3CCVI 4LG0A 2W25A 1O7FA 3Q9SA 4AD9A 2M34A 4AIKA 3PSFA 4V2GA 2BY0A 3W6VA 1R5GA 1P4XA 3K6GA 1HKSA 2VE9A 2DMUA 2DA4A 4HDVA 4ENJA 1USTA 3DF8A 3DQVC 2GA2A 3TMOA 2V6CA 1YJ9I 1QNTA 3C1DA 5FB2A 2OZUA 3GXOA 4HX8A 4RAGA 3BY6A 1IZ1A 3QP5A 2Y0SN 4LFUA 2YS9A 5BPDA 3BR6A 1QVTA 4BH9A 2DT6A 2JT1A 3WGGA 2BHZA 2R5ZB 4R1HA 3KYDB 3LA7A 1KU2A 2F4OB 3GLXA 1BOAA 2L7FP 3I0TA 1BI3A 2R5YA 1GV5A 4LLGF 1MSFC 2DJIA 2ACJA 2ZXJA 4ZJZA 2HFHA 4A3IJ 3SDBA 1J09A 2P6SA 4B1RA 2VONA 2AHQA 2B63J 3V7SA 1P4AA 3L2UA 3K1MA 1X3WB 5J4VA 1QU3A 2D2WA 4E7ZA 4DW6A 3COAC 5CKTA 3WG9A 2JWTA 1A04A 2O0YA 5TRDA 2A6TA 5EGOA 4BEHB 2O6GE 2NVTJ 2LKXA 3EYIA 3C2HA 2XROA 2FMYA 2OQGA 2P8TA 1FY7A 1B8IA 1WKMA 2HPIA 2DOAA 3HRMA 4B44A 3K70C 4QWQA 2OA4A 1HQCA 2FBIA 3HB9A 4UVAA 2WY7Q 3ROUA 4NB5A 3S2HJ 1ZYRF 3MKWB 3PL8A 3CLOA 1DPUA 1D5YA 4L9VA 2LMDA 4UY8I 1WQ2A 3G1LA 3KEOA 2IA0A 4ZYHA 3TQNA 4KFCA 2E19A 2M1BA 4HSRA 4CCKA 3Q0WA 4L9NA 5EZHA 1ZGAA 1R6RA 4ETSA 4V19K 4BYYA 2PG4A 4U7DA 1GVJA 2GZWA 2JN6A 4XLHA 1OKRA 5K5OA 4UB6C 2E1NA 2Z99A 1HLVA 5FLVA 1FP2A 4QPQA 1PUEE 4RM2A 4HNUA 1ERDA 2VBZA 2A6HF 1W7PD 2NVQJ 2ICWG 5EZGA 3FMSA 3WTSC 1X1BA 1JXSA 1Y0UA 3CP2A 3BCAA 5ED4A 2KFDA 2O7OA 4AWXB 1WH5A 2XAJA 2ZSHB 3GZNB 3IH2A 3J80Z 3OYBA 4AU7A 3BDDA 4JK1X 1SMYF 3FM5A 4EEFG 3KETA 1ZR4A 1IUYA 2VXZA 4RLFA 2M8EA 1NG6A 1F5TA 1I6HJ 4E6KG 2G9WA 2Y9ZA 2CS3A 2CMPA 1T0FA 1XGNA 3OIPA 2ZNYA 4XRMA 2I10A 2M4KA 5GAHJ 1MH4A 2QKMB 1W0TA 2MFZA 4XLCA 3H9GA 3G1OA 3P9KA 1SD7A 1ZREA 1QVUA 4Y3OA 1P7JA 2JVGA 3EUAA 1H8AC 4II3A 3OYCA 3IH3A 4RB3C 1UG2A 2YX7A 1G6NA 5DV5A 3BR5A 4BL0B 4IOCF 1O3QA 4DYRA 4RB0A 4HDUA 3CD6I 2WY8Q 4XBFA 5F0HA 3BP8A 3HTSB 1YW7A 1TWHJ 4IHTA 2QF7A 4WF2A 2VBWA 2RV8A 5KCMA 5KNLA 3M07A 1U0JA 4IOAF 3L9FA 3OYMA 3KYCB 1KYZA 1MBKA 3CC4I 5E8IA 2DK5A 1KQ9A 1QGPA 2IPQX 2ZJPF 5HLTA 5HDKA 1O7LA 2NOJB 4IHWA 3HBLA 1ZK8A 2M0MA 4YFKF 2L2OA 2D45A 2CV0A 2R7VA 2OBPA 3UKGA 1VF9A 4AIDA 3R0JA 2IAIA 3FMQA 2Z3YA 2VASA 3BG7A 4UVBA 5J1RA 1P4WA 1PJRA 2O8KA 2XPWA 4AIJA 2ISZA 3GCMA 4GO1A 1D0ZA 3IRRA 3KLNA 3P9IA 2OV7A 1PP8F 4EGYA 1OPCA 2XGEA 2YR2A 4XLNF 4XSZF 2KIMA 3CCLI 4IEJA 4BY7J 1R71A 4RM3A 5FKLA 4PFOA 1QO0D 5IP9J 3I71A 2MLGA 4KT5C 4IRGA 1FYLA 3F22A 3BQYA 1A6QA 4QIWN 4A6EA 5IYCJ 1U78A 4M9XA 2R7RA 1XS9A 2LVSA 2Y30A 1Y8QB 3HEFA 1SANA 5J4YA 5TGTA 2MH9A 1GT0C 1RKWA 1QQIA 2KZGA 4EJVA 2M87A 2MGQA 2CQXA 3CMEI 4P96A 1ON2A 2HXOA 1I3AA 4A3BJ 4MEXF 3TP0A 5JHUA 2LC2A 3ABMH 1BM9A 3HPGA 5KAFC 2XGDA 1FX7A 4IPAA 4II2A 4GDFA 3CTAA 4WXHA 2XF7A 1QHHD 4EJTA 2LD5A 1FP1D 3JTHA 2W84A 1VQ5I 2M3AA 3KP2A 3RSNA 4X0GA 1FJLA 1XCVA 4FISA 4P9FA 3ABKH 2WADA 4L9JA 2EFPA 2CQNA 4NHJA 2FOKA 2LFBA 2KJBA 2EQRA 1YI2I 1CF7B 1F36A 3A0HC 2JJ7A 1IC8A 2HPMA 5HNHA 5C4XJ 2V6EA 2EPFA 1USSA 3OR2C 1B72B 2PX9A 3QPLA 3F23A 3KP4A 1SFUA 4JX5A 2CSOA 1XMKA 1BC8C 4A5MA 3J7AY 1L3LA 1R4NB
chains in the Genus database with same CATH topology
1HF0A 2DMQA 3FIWA 3LSRA 1IJWC 3BR3A 5J1UA 5IYDJ 1MBJA 3H3VK 1GUUA 5FKKA 3ZOBA 4DZJA 3WHBA 2ZB9A 3DCFA 3HGYA 5FKMA 3JRBA 1S7EA 2EZKA 5EG0B 2DA2A 3HOYJ 3SJMA 5F0FA 1UHSA 1BW6A 3JRFA 2VKEA 2Y2ZA 3NAUA 4A3EJ 2VPRA 3CCYA 2X9DA 4RBOA 3JRGA 2IBDA 3H0GJ 2EZLA 2FX0A 3BR0A 1RPWA 5M5XJ 3S14J 3QPSA 1GDTA 2CJJA 2PMZN 4UUTA 5IP6A 2M0CA 1Z77A 1U8BA 1PUFB 5K7ZA 2XRLA 2HI3A 1JUMA 4C3JJ 4RDUA 5EDNA 4M3EA 4C3IJ 3GTPJ 1Y1VJ 3ZQIA 1BW5A 2VKVA 3LSGA 1BA5A 1DU6A 1T56A 1B72A 2OPTA 1B8IB 3RZDJ 3HOUJ 3CDLA 4UUSA 3BT9A 3BG3A 3D1NI 2DN0A 2X6OA 1JKOC 1LE8A 3FK6A 3FISA 1ORKA 3CMYA 3ZQCA 3JR9A 3CQZJ 5IP7J 1TC3C 1AKHB 3BG5A 2XB5A 1FIPA 3K7AJ 1GVDA 3DEWA 3I4NJ 2L9RA 1GV2A 4D5FA 4A3JJ 1RESA 5FJ8J 3NARA 1SFOJ 5EG0A 4MO7A 1JJ8C 2FJ1A 1ETKA 3BTJA 3K2AA 4X1EA 2DJNA 1E3OC 1Q1VA 3TEDA 5IPAA 3GTKJ 2XSDC 4JYKA 1P7IA 3C2BA 2HDDA 2CUEA 3B6AA 1X2NA 4C3HJ 1F43A 4A3KJ 4FE7A 4MIMA 1X58A 4G12A 3RKQA 1PUFA 2QCOA 2DA6A 1MBHA 4ABZA 2CRGA 4J19A 1XG1A 2G0EA 2MSYA 3GTGJ 3ZQFA 1Y1WJ 1X2MA 4L5EA 1CQTA 3A01B 4DYCA 1AU7A 5IYBJ 3BR2A 3BTIA 2K9QA 3G1MA 3TW7A 5DTDA 2ME0A 3O8GA 5F1JA 3FKIJ 2KT0A 3GTOJ 1AKHA 9ANTA 1WI3A 3Q0UA 4JX6A 1ENHA 2H8RA 2CUFA 4XK4A 5FLMJ 3S1QJ 4MFDA 3PO2J 3OSFA 1OJLA 3TW6A 3M4OJ 1HDDC 1TWCJ 2HQ5A 2XPUA 4AC0A 4DYQA 1IDYA 2CQQA 3IH4A 5M3FJ 4XRSA 4A3MJ 5F0CA 1NK3P 1WH7A 4A3CJ 1JT6A 4D7MA 2CU7A 5E3MA 3JRDA 3GBGA 1NK2P 3GTJJ 2JK3A 2TCTA 4M6VA 5DS9A 1T33A 4V2FA 3JRIA 3E7LA 3VPRA 3ZQGA 4W1UA 4FTHA 2GLOA 2DA7A 2LLKA 2R0QC 1ITYA 1FIAA 4QSHA 4A3DJ 1TWAJ 1JTXA 1FTZA 2R5YB 1ETVA 5C4JJ 5M5YJ 1JKRC 2XGCA 1OCPA 4JX4A 4FCYA 1MBEA 1JUSA 4M3GA 1R9TJ 4NDLA 5J3LA 2M9HA 3HKZN 1ZGWA 3S1RJ 2NS8A 5M5WJ 1WPKA 3O8HA 5K7FA 3OSGA 1JUPA 1I3QJ 2X48A 3PM1A 2O9LA 1LFUP 2YUSA 2M34A 2JA7J 5EGOB 2XPVA 4V2GA 5J1YA 3S17J 3W6VA 4IHYA 4M3DA 1DU0A 2E1OA 2L7ZA 4BKXA 2DMUA 4B4CA 1JTYA 2DA4A 1W0UA 1QPIA 1BJZA 3HOZJ 2FQ4A 2HOTA 5EEAA 2LTPA 3BTCA 5K7HA 2HOAA 2DMNA 2Y0SN 5IOYA 5C44J 1IV6A 2YS9A 2E2HJ 5F08A 5GPAA 3BR6A 1H88C 1QVTA 4MLOA 3HOWJ 2P81A 1XC5A 2R5ZB 4C2MJ 2NS7A 4I76A 2KDZA 2M8GX 2DTZA 2L7FP 2R5YA 3SFIA 1GV5A 1MSFC 2FD5A 4D5CA 2MW8A 5IOZA 4A3IJ 2ID6A 4XRSG 3BQZA 1NTCA 2MG4A 1WCMJ 3Q3SA 3JRHA 3GTMJ 4B1RA 2COBA 2AHQA 1O4XA 2B63J 5HODA 1ETOA 1OFCX 4A3LJ 5F04A 3BTLA 4MFEA 2Y9YA 4FE4A 2K40A 5BNGA 3MN2A 4DW6A 3B6CA 1IDZA 2JWTA 3QQAA 3SDGA 5EGOA 2NVTJ 4A93J 1MSEC 2LKXA 2N8GA 1B8IA 1U9OA 2NVXJ 3MKLA 2LR8A 4BBRJ 1IG7A 3L1PA 1TWGJ 3HB9A 1HCRA 1IGNA 3S2HJ 1TWFJ 2L7MP 3JRCA 4JP0A 1D5YA 1QRYA 2H1KA 5FKNA 5E3OA 2OF7A 3G1LA 1U9NA 2GBYA 2NVYJ 2E19A 4XIDA 2XB0X 2R5ZA 3Q0WA 1HOMA 5EZHA 1LFBA 2JN6A 1HDPA 1MNMC 3BR1A 4M3BA 1HLVA 5FLVA 4W97A 3OOUA 3TP3A 2NVQJ 5F27A 5EZGA 1ZQ3P 1MBGA 2EZIA 2EBIA 2AO9A 1RR7A 5E3NA 3JREA 2O7OA 4X6AJ 1WH5A 2ECBA 3IH2A 3HOVJ 1ZKGA 1VNDA 3S2DJ 4D7NA 4EEFG 3WHCA 1ZR4A 2M2EA 4B3AA 2VI6A 1VFCA 1ETYA 3I4MJ 2GM4A 3A01A 1I6HJ 1AHDP 2ID3A 2Y9ZA 4HNVA 1MH3A 1JKQC 3HGGA 4XRMA 2ELKA 2I10A 4CYCB 4BY1J 1WGXA 1W0TA 1MH4A 4XICA 3ZQLA 3G1OA 1ETQA 1EF4A 3LSPA 4S0HB 3F0CA 2ME6A 2WB1N 1QVUA 2K9NA 1BL0A 1P7JA 2L0KA 1H8AC 4IHVA 1ZR2A 1IUFA 1UMQA 2JA6J 1K61A 3IH3A 1UG2A 5M3MJ 3BR5A 2DMPA 4DYRA 2JMWA 2K9SA 3A03A 1JKPC 5F0HA 1MBFA 2E2JJ 1FEXA 3GTLJ 1TWHJ 2R7ZJ 1JT0A 2QF7A 2HYJA 3RQIA 2JA8J 2TRTA 2E2IJ 1POGA 4BXXJ 4Y52J 3S16J 4I6ZA 1MBKA 5C3EJ 5EYRA 4IHWA 3HBLA 1ZK8A 5EF6A 1I50J 3MVPA 3S1MJ 3HOXJ 1A6IA 1JGGA 1IRZA 3UKGA 1VF9A 2LK2A 1ZTRA 4M3FA 2IAIA 2O8KA 5J1RA 2D5VA 3LSJA 2XPWA 2Y31A 3RZOJ 1YRNB 4A69C 3Q0VA 4DZPA 2WV1A 3S15J 2DA3A 4CYCA 3FK7A 2R93J 1A5JA 5GP9A 1G2HA 2XGEA 1JJ6C 3OIOA 4IEJA 4BY7J 3PO3J 5FKLA 5FKOA 4A3FJ 5IP9J 2NOGA 2IEKA 3ZQHA 3BQYA 5IYCJ 4QIWN 3IV5A 1U78A 2R92J 1XS9A 2RAEA 2W48A 2LVSA 2Y30A 3HEFA 2HOSA 1SANA 3LNQA 3GTQJ 4QTRA 1RKWA 2EZHA 1GT0C 2MGQA 2VUMJ 4LOCA 2CQXA 4A3BJ 2DA5A 2HXOA 5JLWA 1APLC 1RKTA 3TP0A 1K83J 2YU9J 3HDDA 1RETA 2DA1A 2LY9A 2XGDA 4GFBA 1ETXA 1H89C 2LD5A 3BG9A 3S1NJ 1FJLA 1ETWA 1Z0XA 2WAQN 4FISA 2LP0A 2DMTA 2EH3A 2LFBA 3HM5A 1OCTC 2EQRA 2JA5J 1F36A 1YRNA 4IHXA 2JJ7A 1IC8A 5E3LA 4AUXA 1VI0A 5C4XJ 4Y7NJ 4AYBN 1B72B 3QPLA 3JRAA 3LOCA 5JLXA 3M3YJ 4JX5A 4BBSJ 3A02A 2HXIA 4UUSB 1FTTA 5GPCA 1LE8B 4A3GJ 2ECCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HF0 A;  2DMQ A;  3FIW A;  3LSR A;  1IJW C;  3BR3 A;  5J1U A;  5IYD J;  1MBJ A;  3H3V K;  1GUU A;  5FKK A;  3ZOB A;  4DZJ A;  3WHB A;  2ZB9 A;  3DCF A;  3HGY A;  5FKM A;  3JRB A;  1S7E A;  2EZK A;  5EG0 B;  2DA2 A;  3HOY J;  3SJM A;  5F0F A;  1UHS A;  1BW6 A;  3JRF A;  2VKE A;  2Y2Z A;  3NAU A;  4A3E J;  2VPR A;  3CCY A;  2X9D A;  4RBO A;  3JRG A;  2IBD A;  3H0G J;  2EZL A;  2FX0 A;  3BR0 A;  1RPW A;  5M5X J;  3S14 J;  3QPS A;  1GDT A;  2CJJ A;  2PMZ N;  4UUT A;  5IP6 A;  2M0C A;  1Z77 A;  1U8B A;  1PUF B;  5K7Z A;  2XRL A;  2HI3 A;  1JUM A;  4C3J J;  4RDU A;  5EDN A;  4M3E A;  4C3I J;  3GTP J;  1Y1V J;  3ZQI A;  1BW5 A;  2VKV A;  3LSG A;  1BA5 A;  1DU6 A;  1T56 A;  1B72 A;  2OPT A;  1B8I B;  3RZD J;  3HOU J;  3CDL A;  4UUS A;  3BT9 A;  3BG3 A;  3D1N I;  2DN0 A;  2X6O A;  1JKO C;  1LE8 A;  3FK6 A;  3FIS A;  1ORK A;  3CMY A;  3ZQC A;  3JR9 A;  3CQZ J;  5IP7 J;  1TC3 C;  1AKH B;  3BG5 A;  2XB5 A;  1FIP A;  3K7A J;  1GVD A;  3DEW A;  3I4N J;  2L9R A;  1GV2 A;  4D5F A;  4A3J J;  1RES A;  5FJ8 J;  3NAR A;  1SFO J;  5EG0 A;  4MO7 A;  1JJ8 C;  2FJ1 A;  1ETK A;  3BTJ A;  3K2A A;  4X1E A;  2DJN A;  1E3O C;  1Q1V A;  3TED A;  5IPA A;  3GTK J;  2XSD C;  4JYK A;  1P7I A;  3C2B A;  2HDD A;  2CUE A;  3B6A A;  1X2N A;  4C3H J;  1F43 A;  4A3K J;  4FE7 A;  4MIM A;  1X58 A;  4G12 A;  3RKQ A;  1PUF A;  2QCO A;  2DA6 A;  1MBH A;  4ABZ A;  2CRG A;  4J19 A;  1XG1 A;  2G0E A;  2MSY A;  3GTG J;  3ZQF A;  1Y1W J;  1X2M A;  4L5E A;  1CQT A;  3A01 B;  4DYC A;  1AU7 A;  5IYB J;  3BR2 A;  3BTI A;  2K9Q A;  3G1M A;  3TW7 A;  5DTD A;  2ME0 A;  3O8G A;  5F1J A;  3FKI J;  2KT0 A;  3GTO J;  1AKH A;  9ANT A;  1WI3 A;  3Q0U A;  4JX6 A;  1ENH A;  2H8R A;  2CUF A;  4XK4 A;  5FLM J;  3S1Q J;  4MFD A;  3PO2 J;  3OSF A;  1OJL A;  3TW6 A;  3M4O J;  1HDD C;  1TWC J;  2HQ5 A;  2XPU A;  4AC0 A;  4DYQ A;  1IDY A;  2CQQ A;  3IH4 A;  5M3F J;  4XRS A;  4A3M J;  5F0C A;  1NK3 P;  1WH7 A;  4A3C J;  1JT6 A;  4D7M A;  2CU7 A;  5E3M A;  3JRD A;  3GBG A;  1NK2 P;  3GTJ J;  2JK3 A;  2TCT A;  4M6V A;  5DS9 A;  1T33 A;  4V2F A;  3JRI A;  3E7L A;  3VPR A;  3ZQG A;  4W1U A;  4FTH A;  2GLO A;  2DA7 A;  2LLK A;  2R0Q C;  1ITY A;  1FIA A;  4QSH A;  4A3D J;  1TWA J;  1JTX A;  1FTZ A;  2R5Y B;  1ETV A;  5C4J J;  5M5Y J;  1JKR C;  2XGC A;  1OCP A;  4JX4 A;  4FCY A;  1MBE A;  1JUS A;  4M3G A;  1R9T J;  4NDL A;  5J3L A;  2M9H A;  3HKZ N;  1ZGW A;  3S1R J;  2NS8 A;  5M5W J;  1WPK A;  3O8H A;  5K7F A;  3OSG A;  1JUP A;  1I3Q J;  2X48 A;  3PM1 A;  2O9L A;  1LFU P;  2YUS A;  2M34 A;  2JA7 J;  5EGO B;  2XPV A;  4V2G A;  5J1Y A;  3S17 J;  3W6V A;  4IHY A;  4M3D A;  1DU0 A;  2E1O A;  2L7Z A;  4BKX A;  2DMU A;  4B4C A;  1JTY A;  2DA4 A;  1W0U A;  1QPI A;  1BJZ A;  3HOZ J;  2FQ4 A;  2HOT A;  5EEA A;  2LTP A;  3BTC A;  5K7H A;  2HOA A;  2DMN A;  2Y0S N;  5IOY A;  5C44 J;  1IV6 A;  2YS9 A;  2E2H J;  5F08 A;  5GPA A;  3BR6 A;  1H88 C;  1QVT A;  4MLO A;  3HOW J;  2P81 A;  1XC5 A;  2R5Z B;  4C2M J;  2NS7 A;  4I76 A;  2KDZ A;  2M8G X;  2DTZ A;  2L7F P;  2R5Y A;  3SFI A;  1GV5 A;  1MSF C;  2FD5 A;  4D5C A;  2MW8 A;  5IOZ A;  4A3I J;  2ID6 A;  4XRS G;  3BQZ A;  1NTC A;  2MG4 A;  1WCM J;  3Q3S A;  3JRH A;  3GTM J;  4B1R A;  2COB A;  2AHQ A;  1O4X A;  2B63 J;  5HOD A;  1ETO A;  1OFC X;  4A3L J;  5F04 A;  3BTL A;  4MFE A;  2Y9Y A;  4FE4 A;  2K40 A;  5BNG A;  3MN2 A;  4DW6 A;  3B6C A;  1IDZ A;  2JWT A;  3QQA A;  3SDG A;  5EGO A;  2NVT J;  4A93 J;  1MSE C;  2LKX A;  2N8G A;  1B8I A;  1U9O A;  2NVX J;  3MKL A;  2LR8 A;  4BBR J;  1IG7 A;  3L1P A;  1TWG J;  3HB9 A;  1HCR A;  1IGN A;  3S2H J;  1TWF J;  2L7M P;  3JRC A;  4JP0 A;  1D5Y A;  1QRY A;  2H1K A;  5FKN A;  5E3O A;  2OF7 A;  3G1L A;  1U9N A;  2GBY A;  2NVY J;  2E19 A;  4XID A;  2XB0 X;  2R5Z A;  3Q0W A;  1HOM A;  5EZH A;  1LFB A;  2JN6 A;  1HDP A;  1MNM C;  3BR1 A;  4M3B A;  1HLV A;  5FLV A;  4W97 A;  3OOU A;  3TP3 A;  2NVQ J;  5F27 A;  5EZG A;  1ZQ3 P;  1MBG A;  2EZI A;  2EBI A;  2AO9 A;  1RR7 A;  5E3N A;  3JRE A;  2O7O A;  4X6A J;  1WH5 A;  2ECB A;  3IH2 A;  3HOV J;  1ZKG A;  1VND A;  3S2D J;  4D7N A;  4EEF G;  3WHC A;  1ZR4 A;  2M2E A;  4B3A A;  2VI6 A;  1VFC A;  1ETY A;  3I4M J;  2GM4 A;  3A01 A;  1I6H J;  1AHD P;  2ID3 A;  2Y9Z A;  4HNV A;  1MH3 A;  1JKQ C;  3HGG A;  4XRM A;  2ELK A;  2I10 A;  4CYC B;  4BY1 J;  1WGX A;  1W0T A;  1MH4 A;  4XIC A;  3ZQL A;  3G1O A;  1ETQ A;  1EF4 A;  3LSP A;  4S0H B;  3F0C A;  2ME6 A;  2WB1 N;  1QVU A;  2K9N A;  1BL0 A;  1P7J A;  2L0K A;  1H8A C;  4IHV A;  1ZR2 A;  1IUF A;  1UMQ A;  2JA6 J;  1K61 A;  3IH3 A;  1UG2 A;  5M3M J;  3BR5 A;  2DMP A;  4DYR A;  2JMW A;  2K9S A;  3A03 A;  1JKP C;  5F0H A;  1MBF A;  2E2J J;  1FEX A;  3GTL J;  1TWH J;  2R7Z J;  1JT0 A;  2QF7 A;  2HYJ A;  3RQI A;  2JA8 J;  2TRT A;  2E2I J;  1POG A;  4BXX J;  4Y52 J;  3S16 J;  4I6Z A;  1MBK A;  5C3E J;  5EYR A;  4IHW A;  3HBL A;  1ZK8 A;  5EF6 A;  1I50 J;  3MVP A;  3S1M J;  3HOX J;  1A6I A;  1JGG A;  1IRZ A;  3UKG A;  1VF9 A;  2LK2 A;  1ZTR A;  4M3F A;  2IAI A;  2O8K A;  5J1R A;  2D5V A;  3LSJ A;  2XPW A;  2Y31 A;  3RZO J;  1YRN B;  4A69 C;  3Q0V A;  4DZP A;  2WV1 A;  3S15 J;  2DA3 A;  4CYC A;  3FK7 A;  2R93 J;  1A5J A;  5GP9 A;  1G2H A;  2XGE A;  1JJ6 C;  3OIO A;  4IEJ A;  4BY7 J;  3PO3 J;  5FKL A;  5FKO A;  4A3F J;  5IP9 J;  2NOG A;  2IEK A;  3ZQH A;  3BQY A;  5IYC J;  4QIW N;  3IV5 A;  1U78 A;  2R92 J;  1XS9 A;  2RAE A;  2W48 A;  2LVS A;  2Y30 A;  3HEF A;  2HOS A;  1SAN A;  3LNQ A;  3GTQ J;  4QTR A;  1RKW A;  2EZH A;  1GT0 C;  2MGQ A;  2VUM J;  4LOC A;  2CQX A;  4A3B J;  2DA5 A;  2HXO A;  5JLW A;  1APL C;  1RKT A;  3TP0 A;  1K83 J;  2YU9 J;  3HDD A;  1RET A;  2DA1 A;  2LY9 A;  2XGD A;  4GFB A;  1ETX A;  1H89 C;  2LD5 A;  3BG9 A;  3S1N J;  1FJL A;  1ETW A;  1Z0X A;  2WAQ N;  4FIS A;  2LP0 A;  2DMT A;  2EH3 A;  2LFB A;  3HM5 A;  1OCT C;  2EQR A;  2JA5 J;  1F36 A;  1YRN A;  4IHX A;  2JJ7 A;  1IC8 A;  5E3L A;  4AUX A;  1VI0 A;  5C4X J;  4Y7N J;  4AYB N;  1B72 B;  3QPL A;  3JRA A;  3LOC A;  5JLX A;  3M3Y J;  4JX5 A;  4BBS J;  3A02 A;  2HXI A;  4UUS B;  1FTT A;  5GPC A;  1LE8 B;  4A3G J;  2ECC A; 
#chains in the Genus database with same CATH topology
 2DOD A;  2FEZ A;  4P5O A;  4CH7 A;  4P1W A;  1J7K A;  1ULY A;  5IYD J;  4A12 A;  2B9S A;  2DPU A;  2AQE A;  3ZN1 A;  3QP6 A;  3TDU C;  5LGU A;  2XKP A;  3WHB A;  3HGY A;  3I64 A;  1XGS A;  5HDN A;  1TLH B;  2EZK A;  1T39 A;  1W7P A;  3FXO A;  3SJM A;  3KLO A;  3U9G A;  1MMN A;  1YS7 A;  1F9N A;  1BW6 A;  2PN6 A;  2XIG A;  2Y2Z A;  4GGG A;  2VPR A;  2X85 A;  3K9T A;  3CF2 A;  3QAH A;  3EUH A;  5ICE A;  1RPW A;  2RGV A;  3LAJ A;  5M5X J;  3S14 J;  1WZ2 A;  3QYB A;  4RGS A;  1GDT A;  4YRV A;  4UUT A;  3HUG B;  2IS2 A;  2KRC A;  2M0C A;  1K78 B;  2FUG 2;  4Y17 A;  1MJA A;  1IN5 A;  2LDU A;  3CDI A;  1PUF B;  3G4S I;  1X3Z B;  5K7Z A;  2K3F A;  5JHF A;  3ECO A;  4C3J J;  5TIS C;  3DFG A;  5LGN A;  2BY2 A;  5EDN A;  4YIR X;  3EDP A;  1BA5 A;  1F1Z A;  4RMN A;  3BZC A;  2DTR A;  3RZD J;  2DI3 A;  4PGG A;  4HQM A;  4UUS A;  3BT9 A;  1SD6 A;  4HX7 A;  1IXR C;  4HF0 A;  2DN0 A;  2X6O A;  4ENM A;  1LE8 A;  3WE3 A;  3FK6 A;  1ORK A;  1G3S A;  3KP7 A;  2A07 F;  3JR9 A;  5IP7 J;  1Z67 A;  2F6C A;  5H2F C;  3BOQ A;  2QEN A;  3HTU A;  3CMA I;  2A05 A;  3GW2 A;  4ENN A;  3BG5 A;  4MHG A;  1N25 A;  2DQL A;  4LK1 F;  3K70 D;  2L9R A;  3I4N J;  3WU2 C;  3S32 A;  4LJZ F;  4A3J J;  2LRE A;  5FJ8 J;  4J00 A;  1LPQ A;  4BU2 A;  5J8C A;  1Z05 A;  4XKB A;  1X19 A;  2BBY A;  2HWV A;  2QBY A;  2IXS A;  5DCM B;  3CC7 I;  1GHC A;  2LY2 A;  3JSP A;  5IPA A;  3BG6 A;  3KEQ A;  4BE0 A;  2FQ3 A;  5LHG A;  3H92 A;  3C2B A;  1KQ8 A;  5DEQ A;  4IO9 F;  3B6A A;  2L01 A;  2IA2 A;  2XV4 S;  1U8R A;  1S7O A;  2COM A;  3VSL A;  2KHM A;  1MZB A;  2MA3 A;  2BZT A;  4KN7 X;  4MIM A;  1X58 A;  1RNL A;  3RKQ A;  1LDK B;  2QCO A;  2DA6 A;  1MBH A;  3CJR B;  2CRG A;  2LBF A;  3CUQ C;  3L2W A;  2NRA C;  2L9N A;  3GTG J;  3GME A;  1Y1W J;  2IW5 A;  2OU2 A;  1MDM B;  5DDG A;  1OLT A;  4A0Y A;  2R7D A;  1W5S A;  3ERE D;  3A1Y A;  5E17 F;  2K9M A;  3KEY A;  3PFI A;  5L3D A;  3RPU D;  3E5U A;  1VQ4 I;  2V9V A;  3GVA A;  5D5W B;  3OOP A;  4YIF A;  2Y0S A;  2ZBK A;  3G6E I;  4LG0 B;  1KZH A;  3T8T A;  2H09 A;  4XOT A;  5BQT A;  2V79 A;  3GTO J;  1AKH A;  4XK4 A;  5FLM J;  2V4J C;  3S1Q J;  4ZC3 A;  1AA7 A;  5FGM A;  3PO2 J;  1HDD C;  1TWC J;  4IRI A;  2HQ5 A;  3SZT A;  2XPU A;  4PDK A;  1OIS A;  4DYQ A;  1IDY A;  2H1L A;  2NS0 A;  1LB2 A;  2AS5 F;  5M3F J;  4XRS A;  2P0W A;  1Z1D A;  1NK3 P;  3R0A A;  4FX4 A;  4KDP A;  1JT6 A;  3GBG A;  2RRE A;  2JK3 A;  4XN0 A;  4XL9 A;  5LRS A;  2ESN A;  2F5C A;  3E7L A;  4W1U A;  3HSF A;  2IS6 A;  3PNV A;  3R4K A;  2DA7 A;  3FXM A;  2R0Q C;  2V9P A;  3M8F A;  1BR2 A;  4HRI A;  4WCG A;  2OCE A;  1FOX A;  2EIM H;  3H35 A;  1D3Y A;  2R5Y B;  1G8X A;  1JKR C;  1S72 I;  1YE9 A;  2HTJ A;  1K4T A;  2XGC A;  4NC6 A;  4FCY A;  4XKV A;  1R9T J;  2A5Y B;  2ZFU A;  1Z9C A;  1MGT A;  3FXJ A;  4RLQ A;  1OQY A;  2M9H A;  4BAC A;  1WPK A;  2OJE D;  2X4H A;  3O8H A;  2PJP A;  2K4J A;  5CJ9 A;  1I3Q J;  4PUS A;  3OS2 A;  3OL3 A;  5LEJ A;  4HV5 A;  4MEY F;  3CMM A;  2JA7 J;  3DBH B;  1HXD A;  5EGO B;  1B9M A;  1Z6R A;  5DYM A;  1MJ9 A;  1DU0 A;  2HU9 A;  1T6S A;  1B59 A;  1JTY A;  3DLL F;  4XR6 A;  5KAI C;  1FC3 A;  2I5U A;  2CV2 A;  1W1W E;  2HOT A;  1HBX G;  5EEA A;  5FRM A;  2DOE A;  3ABT A;  2NXN B;  2M30 A;  3I55 I;  4I0B A;  2LTP A;  3DKY A;  2HOA A;  2E5N A;  2GOX B;  1IV6 A;  4I02 A;  3LST A;  4WWC A;  5F08 A;  5GPA A;  3LSI A;  3F8N A;  1H88 C;  3LSH A;  5AON A;  4M9S A;  2BVM A;  2DAO A;  3OL4 A;  4C2M J;  2NS7 A;  3FXL A;  4I76 A;  2M8G X;  3SZG A;  3I5U A;  3WTT C;  2E71 A;  1LNW A;  1V5E A;  3VOE A;  2FD5 A;  4D5C A;  3MFK A;  2W7N A;  2DT5 A;  3ZQQ A;  1FOW A;  3HOS A;  1VQP I;  3HKZ A;  3BQZ A;  5AIP A;  2MG4 A;  1WCM J;  4H0E A;  4CZC A;  4IXA A;  3JRH A;  3H1C A;  3KZI C;  3S8P A;  4FT8 A;  2VN2 A;  1I1G A;  1OFC X;  3OYL A;  3HUG A;  5F04 A;  1H9T A;  3BTL A;  2ADU A;  2Y9Y A;  3F8B A;  5BNG A;  2K40 A;  1UCR A;  2J5P A;  3QQA A;  3SDG A;  2UXN A;  3HOT A;  4A93 J;  2X0L A;  4HV6 A;  4U87 A;  4CDG A;  2N8G A;  3K4J A;  1QBJ A;  4LIU A;  1VQ9 I;  4DQ2 A;  4XRF A;  2FML A;  2XAG A;  5BPI A;  2MC3 A;  2RNJ A;  5ILS A;  3F9K A;  2E1M B;  2STW A;  1IN4 A;  4ITV A;  1HCR A;  2LKP A;  1D5V A;  1N77 A;  1WSU A;  4FAS D;  1FOY A;  3FHZ A;  1HA8 A;  1FWZ A;  1U9N A;  1Y8R B;  1S8N A;  2XB0 X;  1HOM A;  4ZZD A;  3HL2 A;  4E7H A;  5HDG A;  3U21 A;  3H3Z A;  2Y48 A;  2HVQ A;  3PJR A;  3BR1 A;  4M3B A;  2BW3 A;  4PJN A;  4EMS A;  3GO5 A;  4IX7 A;  3FMR A;  3F3X A;  1JE8 A;  3RPQ A;  3RPU A;  4EJW A;  2BXY A;  3ZR8 X;  4A6D A;  5HVQ C;  1YX3 A;  1V54 H;  2E7X A;  2XKO A;  5KK1 A;  2EBI A;  2AO9 A;  1RR7 A;  5E3N A;  3KP3 A;  2ECB A;  5ILU A;  1ZKG A;  2H27 A;  1VND A;  1SD5 A;  2HQR A;  4WXC A;  2E5Z A;  2F4I A;  1YOV B;  1H0M A;  3FXQ A;  3WHC A;  2EFW A;  2OTL I;  2EV5 A;  2JPC A;  1Y56 A;  4B3A A;  2HEO A;  1XSV A;  3OS0 A;  3I4M J;  1MDM A;  3T5X A;  1ZGJ A;  3T8R A;  2FE3 A;  1JKQ C;  2L9S A;  4C9Y A;  3M8E A;  4E7L A;  4HPQ A;  1YG2 A;  2ELK A;  3FXU A;  2QM3 A;  5KHD A;  3CF5 F;  3TO7 A;  4UHT A;  1S5L C;  1TTY A;  2VXD A;  5EEH A;  3KYL A;  1EF4 A;  3LSP A;  3ZRG A;  1XMX A;  2HDC A;  3F0C A;  5FRO A;  2UV1 A;  5AIQ A;  1D0Y A;  2L0K A;  2R7S A;  1IUF A;  1UMQ A;  4HLY A;  1X3U A;  3CP8 A;  5M3M J;  3DKX A;  2YSR A;  1FLI A;  2JUC A;  1EH6 A;  2K9S A;  5H6Q A;  1ZAR A;  1MBF A;  4N4N B;  2E2J J;  3ELK A;  5B66 C;  2DPD A;  3KZY A;  3MCZ A;  4BXX J;  4Y52 J;  3TDZ C;  4ESF A;  4WK8 F;  4I6Z A;  2V1D A;  4RS8 A;  1RR8 C;  2WV0 A;  1LDJ A;  1XX5 A;  3BZK A;  5EYR A;  4P55 A;  2ELH A;  4LLN A;  4EQQ A;  2GXB A;  2NVU B;  3E5Q A;  4Y33 A;  1HKQ A;  4EM1 A;  4PSW A;  3D0S A;  2RKH A;  1IRZ A;  3DWL E;  3WTY C;  1OMI A;  2K5C A;  2LK2 A;  3V7C A;  3HHG A;  1UHW A;  2VIX A;  3PFY A;  3S3M A;  2KJC A;  4GYI A;  4WX9 A;  4Y13 A;  2FOW A;  2Y31 A;  3ZPL A;  5IT9 K;  3VOD A;  5JI6 A;  4DZP A;  1TZL A;  1RI7 A;  2WV1 A;  2W57 A;  2GIZ A;  2O03 A;  4KUM A;  1TP4 A;  2DA3 A;  4CYC A;  3WTV C;  3FK7 A;  3D5L A;  2R93 J;  1A5J A;  5GP9 A;  4O3M A;  4AM3 A;  2ESH A;  2JUG A;  4N9H A;  3FBN B;  1MMD A;  5FKO A;  4A3F J;  2DDA A;  5LGT A;  4I98 B;  1UG0 A;  5FLX K;  3A4C A;  2CV1 A;  1IAW A;  2VKD A;  2XAU A;  2RAE A;  3AG2 H;  2IGM A;  2HOS A;  3K2Z A;  3LNQ A;  2EZH A;  3N97 A;  1Z6T A;  3QWL A;  3HXL A;  1W7P B;  2J5O A;  1APL C;  3G2B A;  1RKT A;  4RGR A;  1SMT A;  3HC7 A;  1JI8 A;  2P5K A;  4ZYD A;  1Z3X A;  3W2V A;  1ZH5 A;  3I3L A;  3IKV A;  3ONQ A;  5D8L B;  3V8J A;  1I5Z A;  1RET A;  2LY9 A;  4G7Z F;  2QZ8 A;  2E1C A;  2YU9 J;  4F91 B;  1ETX A;  4CCJ A;  4DJA A;  4R8H A;  1SVM A;  1H89 C;  1KQ0 A;  2HOE A;  2PEX A;  2VBY A;  4RB2 C;  4BDZ A;  2IVM A;  5HS7 A;  3WG7 H;  2ETH A;  4ESJ A;  1Z0X A;  2WAQ N;  4M72 A;  1RUN A;  3NWS A;  3F8M A;  4HYE A;  5E8G A;  4ZZL A;  1GXQ A;  2UZK A;  1U3E M;  2XC7 A;  4HST A;  4ENK A;  2EFO A;  1P9Q C;  4IHX A;  5E3L A;  2YPR A;  2ZJQ F;  1Y6I A;  4AYB N;  4Y7N J;  3M7G A;  3O3K A;  2PMH A;  4BAY A;  5E1Z B;  3LOC A;  2PFB A;  5JLX A;  4YFX F;  1XDU A;  3M3Y J;  1EJ9 A;  4XM3 A;  4UUS B;  2CW8 A;  5GPC A;  3DTI A;  2AQF A;  3G73 A;  2CGP A;  1LE8 B;  3WTU C;  2GWR A;  1R49 A;  3EET A;  4YII A;  5JVT A;  2DMQ A;  3FIW A;  3LSR A;  1IJW C;  3BR3 A;  1MBJ A;  2M7A A;  4JQF A;  3L2C A;  5E1W A;  4L18 B;  2UWM A;  4Z6Y A;  2Z33 A;  3B73 A;  1ZG3 A;  2CFO A;  2H6C A;  2ZB9 A;  4XLF A;  4LIT A;  3BZ6 A;  5F6F A;  4CCL A;  1JGS A;  4PCQ A;  3SYT A;  3CCQ I;  1D8K A;  4NC7 A;  2QBY B;  4BE1 A;  2ZJR F;  3M1E A;  3CCY A;  4I2O A;  4BE2 A;  4LMY A;  3H0G J;  4HOB A;  3VYT B;  1QA6 A;  2WAF A;  3K4B A;  2ZME A;  5ICC A;  3QPS A;  3ASN H;  2XUB A;  3QOE A;  1T38 A;  3M8J A;  2XSJ C;  1V4R A;  4HEA 2;  2VBX A;  3P5J A;  1IV8 A;  3ASO H;  5CVV A;  3L7W A;  2XRL A;  1UJ8 A;  1JUM A;  2LBF B;  2W4S A;  3S2W A;  4M3E A;  4OAZ A;  2MLK A;  4N4O B;  4C3I J;  1ONV A;  2KZV A;  3ZQI A;  1BW5 A;  3LSG A;  1KYW A;  3E6B A;  1DPR A;  1U5T A;  1KU7 A;  2WBM A;  1BJA A;  3GLL A;  1ZLJ A;  4XLE A;  3D1N I;  2H8W A;  3MMY B;  1X1P A;  4OU0 A;  4CUG A;  2DK8 A;  1NG7 A;  3DU5 A;  2OD5 A;  3ABU A;  4AIH A;  4RB1 A;  2STT A;  2M45 A;  5CPR B;  4OOI A;  4A2U A;  1AKH B;  2JA2 A;  1FIP A;  3OY9 A;  1GVD A;  3IWZ A;  2EIJ H;  3TO6 A;  2IJL A;  4EJO A;  3OS1 A;  1SFO J;  1FYM A;  5TJJ A;  4BJ6 C;  3ZGK A;  1JJ8 C;  3GYH X;  5H20 A;  2FJ1 A;  1HW2 A;  4NNJ A;  4Y15 A;  3MZH A;  4X1E A;  5HS9 A;  2GA1 A;  1Q1V A;  4XN3 A;  3CCE I;  3TED A;  5BOX A;  1HW1 A;  1V5G A;  3HSR A;  2CH0 A;  2X1E A;  2PMZ A;  4A5N A;  3CUQ A;  5D5V B;  2CUE A;  5LBQ A;  2XAS A;  2Y75 A;  1X2N A;  4RAF A;  1DGR M;  4LB6 B;  5LEK A;  1IF1 A;  1F43 A;  2LG4 A;  1YO5 C;  1UEL B;  1VZ0 A;  4RAY A;  2Q1Z B;  3MZ8 A;  4PFP A;  4Q4Z F;  1W36 C;  5D6E A;  3BJ6 A;  1TQP A;  1XG1 A;  3ZN0 A;  4HNT A;  1FNN A;  2NAZ A;  1STZ A;  2LH9 A;  4LGW A;  1XB4 A;  4L5E A;  2DU9 A;  3LQR A;  3A01 B;  2W85 A;  5E79 C;  4DYC A;  2OCC H;  2EFQ A;  3NEU A;  1BR1 A;  3JW4 A;  3HPH A;  3I4P A;  4A0Z A;  2K9Q A;  4FHT A;  2P7C B;  3REO A;  2DFH A;  3DEE A;  2LF8 A;  3PIP F;  2KT0 A;  3QU3 A;  1G3T A;  9ANT A;  1WI3 A;  4JX6 A;  1ENH A;  2KP6 A;  2CUF A;  1MNE A;  2VT3 A;  4MFD A;  3H9J A;  3TW6 A;  1MD0 A;  5H6R A;  1UFM A;  2HS5 A;  3DPL C;  4MTE A;  2QSF X;  1YYV A;  4PK4 A;  4HG2 A;  4A3M J;  2FBH A;  4A3C J;  4D7M A;  5DUI A;  1N78 A;  1TNS A;  1W4M A;  2FU4 A;  4B48 A;  5DS9 A;  3WTW C;  2QSG X;  4V2F A;  4UNO A;  2CFX A;  1FYK A;  3JRI A;  2GLO A;  2P5L C;  3AL0 C;  2LLK A;  2CUZ A;  3ZP5 A;  1A36 A;  1FIA A;  3HHH A;  2XHK A;  3K4M A;  4DNC A;  1K7A A;  2HQN A;  2VQH A;  1X4P A;  1TWA J;  1JTX A;  1FTZ A;  5L3F A;  4KMU X;  5FO5 A;  2IRF G;  2XAH A;  2EK5 A;  4JX4 A;  1MBE A;  2VPL A;  2TDX A;  1BIA A;  3MEX A;  4MQV A;  4UV8 A;  2L3D A;  4MNU A;  1G59 A;  3DLA A;  4KIT B;  2VB6 A;  5J40 A;  3U1D A;  1K79 A;  2BYV E;  3VYR B;  2QQA A;  3OSG A;  1JUP A;  2RVC A;  3K4L A;  2HTS A;  1LFU P;  2YUS A;  1T0F C;  1TW2 A;  3S17 J;  3AG3 H;  4BHC A;  1U2W A;  4M3D A;  2M4G A;  4H4K C;  3A0B C;  2R7F A;  3QRF F;  1YIT I;  4XKW A;  4B4C A;  2Y69 H;  1W0U A;  3LA3 A;  1BJZ A;  3HOZ J;  2LSO A;  5HOO A;  1BR4 A;  2JPB A;  3WOD F;  3G3Z A;  5CLS A;  3CUO A;  2DFF A;  1RC9 A;  3KP5 A;  3SEQ A;  5K7H A;  2DYR H;  3F72 A;  3TGN A;  4HF1 A;  1OCO H;  5C44 J;  5ILV A;  1OR7 C;  4I01 A;  5HLI A;  1XD7 A;  3HOW J;  4OIO F;  4D0P A;  3VDX A;  5IT9 Z;  2DTZ A;  4NUB A;  5DCF A;  4BXF A;  1MW7 A;  2KDO A;  2MW8 A;  2E60 A;  2BW3 B;  5IOZ A;  4DIQ A;  3QYE A;  3Q3S A;  3GTM J;  1BI0 A;  1XSX A;  4LG3 A;  2JZY A;  2COB A;  3CCS I;  1O4X A;  1TQM A;  2K9L A;  2VL8 A;  1ETO A;  2VKH A;  5FLX Z;  3I58 A;  3AFH A;  4MFE A;  3MN2 A;  5JR3 A;  2DLL A;  2NYX A;  2BY3 A;  2V7F A;  2XGX A;  1YFH A;  3C2G A;  1SC7 A;  1J0R A;  5FFX A;  1MSE C;  5LRR A;  4B43 A;  5LD2 C;  3FM3 A;  1U9O A;  3E97 A;  2NVX J;  1L0O C;  3MKL A;  2LR8 A;  1MMS A;  4CIC A;  4BBR J;  4IKF A;  4MGR A;  2IP2 A;  3IRQ A;  2CUJ A;  1BN5 A;  5DUK A;  1MMA A;  3K0L A;  2HNH A;  2Q0O A;  4B8X A;  2K3P A;  2L7M P;  3JRC A;  1IXS B;  2ZFW A;  2HKO A;  3CCU I;  2A6E F;  1UB9 A;  1SVL A;  1R5H A;  2JVH A;  3GFL A;  3LFU A;  4JP0 A;  2ZC2 A;  1WRJ A;  4BQN A;  1R1V A;  2IGN A;  3OYF A;  4HW0 A;  2GBY A;  1OCZ H;  1VQO I;  4XID A;  3SZP A;  1R23 A;  1S9H A;  3H5A A;  2K7L A;  2E34 A;  2F5D A;  3GFI A;  1FZP B;  1MNM C;  2IS1 A;  1XSD A;  2D1V A;  3OOU A;  3R60 A;  1ZG5 A;  3T0Y A;  1Y39 A;  3TP3 A;  3L2V A;  1ZQ3 P;  1MBG A;  1I27 A;  2BOL A;  4O6J A;  2EZI A;  3JRE A;  2BY1 A;  2CW7 A;  4X6A J;  3QOD A;  3TKY A;  2HGC A;  3DBL B;  4LLL A;  4MQ9 F;  2VC0 A;  4PGH A;  4D7N A;  5ICF A;  3H5N A;  1WJ5 A;  2YU3 A;  2LYC A;  2L4M A;  4EM2 A;  2M7B A;  1IN7 A;  1ETY A;  4CHU A;  6PAX A;  3A01 A;  1MMG A;  2BEO A;  1AHD P;  1VQM I;  3OMY A;  3MQ0 A;  3FF5 A;  3GFJ A;  4CYC B;  4BY1 J;  1WGX A;  1YIJ I;  3ZXS A;  1TNT A;  3GF2 A;  2KIF A;  4XIC A;  4M6Y A;  3ZQL A;  1A31 A;  2ZXW H;  3LAP A;  1VTN C;  2FA5 A;  4DBQ A;  1Q1H A;  2WB1 N;  4GCV A;  1BL0 A;  1ZRC A;  3LA2 A;  4OIQ F;  3DKW A;  4IQ4 A;  1K6O A;  4U7B A;  4GYG A;  5L3C A;  1ZR2 A;  1D8J A;  1K61 A;  2DMP A;  2JMW A;  2F2E A;  2DW4 A;  1JKP C;  1OYW A;  3PQK A;  3BPV A;  1LEB A;  1ZAO A;  3GTL J;  4KNY A;  5D8K B;  4IRH A;  2ZSI B;  4CSW A;  3RQI A;  4IVN A;  3L2R A;  1LKX A;  2JA8 J;  3CDH A;  3RKY A;  2LY1 A;  1POG A;  1X1A A;  1QZZ A;  2W24 A;  3DBR B;  3BPX A;  5C3E J;  3DP7 A;  1I39 A;  2O8X A;  2H94 A;  2KQR A;  2EIK H;  1P2F A;  4Q48 A;  4ZYG A;  3PUB A;  1W5C C;  2VE8 A;  1W36 D;  3MVP A;  1A6I A;  1JGG A;  1KON A;  3AG1 H;  2K27 A;  1XGO A;  2A61 A;  2RN7 A;  1TQI A;  2EA2 A;  2Q8K A;  1CGP A;  3RZO J;  1BI2 A;  4A69 C;  3F8F A;  1LVK A;  4G6T B;  1E0E A;  1FMV A;  4OIR F;  3EPZ A;  3HSE A;  1A35 A;  2MC4 A;  3S15 J;  5L3B A;  1G4D A;  2P7V B;  1LEA A;  1G2H A;  3OIO A;  3RTR A;  2BGC A;  2AXT C;  5D5U B;  3AKZ A;  5FRN A;  4CZZ A;  3PUF A;  3PIO F;  3OYK A;  1HSJ A;  3QPH A;  4CCN A;  4YFN F;  2IEK A;  5EEG A;  5CVU A;  2R92 J;  1WHU A;  4BXU A;  1O3T A;  1BC7 C;  2PMU A;  3VFZ A;  3S93 A;  1YTY A;  2F5V A;  3GTQ J;  3CCM I;  4QTR A;  2DQR A;  2VUM J;  3O2P E;  1PP7 U;  1IRF A;  2FF4 A;  5JLW A;  3QOP A;  4UUV A;  4BUP A;  2HKX A;  3P9C A;  2QQ9 A;  2DA1 A;  1B9N A;  5IT3 A;  4LK0 F;  3DU6 A;  3HYI A;  1NH3 A;  4GFB A;  2W1O A;  2ZME B;  2IS4 A;  4J01 A;  4M6X A;  3IWF A;  1ETW A;  2QUF A;  2LP0 A;  3HRS A;  4KN4 X;  3IL2 A;  1V55 H;  2DMT A;  2JRM A;  4XON A;  3DEU A;  2G7H A;  4FQG A;  1OCT C;  3RCO A;  3E3V A;  1DP7 P;  1YRN A;  3DV8 A;  1YJW I;  2Q2E A;  2GXA A;  1UAA A;  1U5T B;  2D1H A;  3JRA A;  2OQR A;  3TL4 X;  1E2X A;  2PJR A;  3A02 A;  2HXI A;  3FWE A;  3CLQ A;  5FFZ A;  2Z16 A;  3LWF A;  4A3G J;  5GAE J;  3FDY A;  5GAG J;  4CA0 A;  4DGW B;  3C7J A;  3QU6 A;  4HZF A;  3KX2 A;  2CYY A;  1GXP A;  5J1U A;  3H5R A;  1GUU A;  4KA4 A;  1XDS A;  3DCF A;  3OYE A;  4NQW A;  5FKM A;  3JRB A;  2VLA A;  4KIS A;  3HOY J;  3RIR A;  1UHS A;  2IA1 A;  1R5I D;  2VJ5 A;  2VKE A;  2MBF A;  3HG9 A;  3NAU A;  4A3E J;  2DO7 A;  5J6X A;  4RBO A;  1IW7 F;  1P6R A;  4KIB A;  2IBD A;  3H36 A;  4XNF A;  3CES A;  2FX0 A;  2WTE A;  2RDP A;  2GOM A;  2O61 A;  3CUQ B;  2KPM A;  3IAS 2;  2DCE A;  4Q47 A;  3OYG A;  4KT6 A;  1HKT A;  4BGD A;  4N0B A;  2B0L A;  4HF2 A;  5IP6 A;  3F6V A;  4KMF A;  3TO9 A;  3J7Z I;  1IRG A;  2O5R A;  1Z77 A;  1LJ9 A;  1E3H A;  4ASN A;  3BJO A;  1P92 A;  2I8D A;  1B1B A;  1EKE A;  1FBU A;  3IUO A;  3T1B A;  4RDU A;  5D5X B;  1ZHF A;  4PJM A;  1S7A A;  2DFI A;  3GTP J;  2IGO A;  2VKV A;  3GZ5 A;  2DFE A;  1T56 A;  4NBQ A;  2OPT A;  4IQJ A;  3HOU J;  2L7K A;  3RKW A;  1KU3 A;  2GAU A;  1QZE A;  4XLA A;  2QYO A;  4KIG A;  1O3R A;  4U0W A;  4CO8 A;  1JKO C;  4HLX A;  1WI9 A;  3W2W A;  3ZMU A;  3FIS A;  2CQ7 A;  3I53 A;  2XAF A;  3CQZ J;  4BHP A;  1TC3 C;  2BV6 A;  1DP3 A;  2P4W A;  2XB5 A;  5EJC A;  3DEW A;  4L5J A;  1GV2 A;  2XDV A;  1YW8 A;  4D5F A;  4E7S A;  1ZRF A;  2ZXI A;  3B02 A;  1YX5 A;  4FET A;  1RES A;  5EG0 A;  3OYN A;  1ETK A;  2RQP A;  3BTJ A;  3K2A A;  2DJN A;  2QWW A;  4E4H A;  5K5R A;  1E3O C;  4YG2 F;  1YS6 A;  4I99 C;  3FXK A;  2WA0 A;  4U0V A;  1LQ1 A;  4GRI A;  4M9Z A;  1REP C;  4TV7 A;  2XF5 A;  1NHA A;  1BBY A;  2O3F A;  2EFN A;  1R1T A;  4HAM A;  4KYW A;  3CO7 C;  4M74 A;  4CXF A;  1Z21 A;  3I59 A;  4G6D A;  1LVA A;  4J19 A;  4MTD A;  4E7K A;  2PI0 A;  2L5Q A;  4EV0 A;  1H9G A;  1X2M A;  1WJA A;  1SFX A;  3J81 K;  2ZJ2 A;  1K4S A;  2QSH X;  2NNN A;  3EUK L;  1D1A A;  1AU7 A;  1F4K A;  5B1A H;  2X6W A;  5ICG A;  1KA8 A;  3BTI A;  4IL6 C;  1XMA A;  2GIV A;  4G9Y A;  3SQN A;  1FPQ A;  2ME0 A;  1EV7 A;  1KGS A;  3NRV A;  1R1U A;  1IN8 A;  2QQB A;  5DD8 A;  5HNF A;  3RYP A;  2H8R A;  4F3Q A;  3HIF A;  5HS8 A;  2R7Q A;  2F5E A;  3LMM A;  3J7Y J;  3M4O J;  2FBK A;  1XN7 A;  1IN6 A;  3E5X A;  2Z5U A;  4D1Q A;  4AVP A;  3OYI A;  2CQQ A;  5K5Q A;  3DPU A;  3WGH A;  3A2K A;  5F0C A;  5HLG A;  1IXC A;  2HVS A;  1NK2 P;  3F21 A;  3GTJ J;  2TCT A;  4UB8 C;  1BOB A;  3S3O A;  3MAJ A;  4NC8 A;  1O3S A;  4FTH A;  1DQU A;  2MD0 A;  4ZYE A;  3VEP A;  5JFR A;  3R61 A;  1S29 A;  4RAZ A;  2LF7 A;  3ECH A;  2B7E A;  1EH7 A;  4QSH A;  4A3D J;  2V9K A;  4XOP A;  4Y4R A;  5E18 F;  5GTI C;  5C4J J;  1Z7U A;  1WWX A;  2DDB A;  4UVC A;  2EV6 A;  3DTE A;  2FXA A;  1R58 A;  3K1P A;  2QQ8 A;  2BXZ A;  3Q9V A;  1O57 A;  2EIL H;  1EA3 A;  5J3L A;  4YEL A;  3HKZ N;  1ZGW A;  3S1R J;  1I1S A;  4C2T A;  5IY5 H;  2MYS A;  1TT0 A;  5K7F A;  5J47 A;  2X48 A;  3PM1 A;  4ZDL A;  4XQF A;  2HYG D;  2NNY A;  4OIP F;  1SFK A;  3TBI A;  3GEZ A;  3IAM 2;  4F92 B;  2XPV A;  1DUX C;  5J1Y A;  3AAF A;  2LNB A;  4IHY A;  1FBQ A;  2E1O A;  2L7Z A;  2W82 A;  3RJP A;  3ZMT A;  4BKX A;  3L09 A;  5HLH A;  1QPI A;  2G7U A;  1W5T A;  2KIU A;  2FQ4 A;  3FX3 A;  1PVE A;  3U2R A;  1ZN2 A;  3K4C A;  3BTC A;  1OR7 A;  2VJI A;  4PZJ A;  2DMN A;  2BVL A;  1RIO H;  4LB5 A;  5IOY A;  2ZO4 A;  1SD4 A;  2E2H J;  4EAT A;  1ZG1 A;  4MLO A;  1BI1 A;  2LKS A;  2A69 F;  2P81 A;  4ESB A;  1PYV A;  1XC5 A;  4M73 A;  2R7O A;  2KDZ A;  3PQJ A;  3GUD A;  1ACI A;  4C2U A;  2RNG A;  3SFI A;  2VJJ A;  2VJ4 A;  2W00 A;  2X51 A;  3LL7 A;  3IKT A;  1FBS A;  3ERM A;  1BIB A;  2ID6 A;  3JCU C;  3R6S A;  4XRS G;  1NTC A;  4S05 A;  2A5W A;  3WTZ A;  2IGK A;  4OMZ A;  3J7A O;  5HOD A;  3M1C A;  1G3Y A;  5E20 A;  4A3L J;  4CCO A;  1I6X A;  5GTH C;  3ZMV A;  2WC2 A;  4FE4 A;  2VC1 A;  3E6D A;  2KKO A;  3B6C A;  2WB1 A;  1VQ8 I;  1IDZ A;  4BS9 A;  1ZLK A;  2CWE A;  1E17 A;  4D9J A;  4U88 A;  3IHU A;  2X1D A;  5F1R A;  4ZH4 F;  4JOM A;  3D5S C;  5FD6 A;  2FRH A;  2OAZ A;  2P5V A;  3LQQ A;  5B5E C;  4CCM A;  2R7W A;  4PJ0 C;  2JQ7 A;  3LFK A;  1IG7 A;  3JTG A;  3EQL F;  1SAU A;  3L1P A;  1XCB A;  1TWG J;  1IGN A;  1Z91 A;  3ZQ7 A;  1TWF J;  2LRD A;  4LD5 A;  2KL4 A;  2QVO A;  2RQQ A;  1QRY A;  2H1K A;  2RC4 A;  3C18 A;  5FKN A;  3U1K A;  5E3O A;  1OCR H;  1J5Y A;  2OF7 A;  4LIV A;  2NVY J;  1U6G A;  2V1N A;  1T8I A;  4L0Z B;  2HDW A;  1AOY A;  2R5Z A;  5L3G A;  1RUO A;  3CJQ B;  1G3W A;  4QLC U;  5CYV A;  2VOO A;  1DGW Y;  3ZMS A;  4AVZ A;  3SFZ A;  3HJE A;  4ZTJ A;  1ON1 A;  1LFB A;  1YHQ I;  4E7I A;  1HDP A;  1QPM A;  2FSW A;  2EIN H;  3FBI B;  4I09 A;  3JAM K;  3GX4 X;  1YQA A;  3GWZ A;  4W97 A;  2V1X A;  1R4M B;  2F4M B;  4PJJ A;  4IZZ A;  2PLY A;  2A3S A;  1YJN I;  5F27 A;  3G71 I;  2ZCW A;  3BJA A;  2R7U A;  2ISY A;  2JTV A;  4BJT A;  5D4S A;  5A2Q K;  3W6J B;  1MKM A;  4HA8 A;  3JSO A;  1T08 B;  2HYF A;  2EA4 A;  3KCC A;  3ZCO A;  5B3S H;  5LFA A;  3HOV J;  4XMY A;  3IP4 B;  3ULQ B;  2K86 A;  2MH2 A;  2PQ8 A;  3S2D J;  3E0J B;  1OCC H;  4U0Y A;  2A68 F;  5D4R A;  3BLY A;  2XF6 A;  3LSK A;  2X6X A;  1FMW A;  2OUM A;  4BEH A;  5K1Y A;  2M2E A;  2VI6 A;  1VFC A;  1MIJ A;  1T2K A;  2GM4 A;  5B1B H;  3GFM A;  2ID3 A;  4HNV A;  2VT2 A;  2QGU A;  1MH3 A;  3P7N A;  3HGG A;  1FSH A;  1XTA A;  3FZV A;  1VQK I;  2JRT A;  1J9I A;  3K1N A;  2GXG A;  1ETQ A;  2MAB A;  2IT0 A;  2R4G A;  4S0H B;  2ME6 A;  3FHN A;  1E3P A;  1WVR A;  2F48 A;  2K9N A;  4E7J A;  2E1M C;  2K4B A;  3V4G A;  4CYD A;  4IHV A;  1Y0N A;  1R00 A;  4EGZ A;  2JA6 J;  3PSI A;  5DD4 A;  3VSK A;  3A03 A;  3MWM A;  5GAD J;  3RKX A;  3AG4 H;  1FEX A;  1B6A A;  2MD5 A;  1JT0 A;  2R7Z J;  2HYJ A;  2CW0 F;  2TRT A;  1J2X A;  3DTK A;  1TBX A;  2E2I J;  2ZME C;  1SEU A;  1RRJ A;  3KZZ A;  2EB7 A;  3S16 J;  3BCB A;  1S3J A;  2L54 A;  1YLF A;  3CJN A;  3HZJ A;  3TOA A;  3UR3 C;  3CO6 C;  2H6B A;  2X6Y A;  4BQA A;  1UHM A;  5J8F A;  2KRF A;  5CVJ A;  5EF6 A;  4BHB A;  1Z3Y A;  1I50 J;  2C6Y A;  3I54 A;  3S1M J;  3HOX J;  3V8L A;  4ZDP A;  4N9I A;  3OYJ A;  1SVO A;  1ZTR A;  4M3F A;  1U5T C;  1D1B A;  4K2E A;  2D5V A;  3LSJ A;  4WXD A;  5ERI A;  1YRN B;  3Q0V A;  1VQN I;  5DM6 F;  2Q2E B;  3FKJ A;  3CC2 I;  2DT7 B;  1D0X A;  2PJR B;  3H9Q A;  5BMZ A;  2KIS A;  1JJ6 C;  4XOR A;  3PO3 J;  3HRT A;  1N75 A;  2F5F A;  1IO2 A;  2XRN A;  2P6T A;  2NOG A;  3NQO A;  1JHH A;  1S6L A;  3X2Q H;  3ZQH A;  2VOD A;  1D1C A;  4L0Y B;  4UV9 A;  3IV5 A;  2FNA A;  4ZTF A;  1ODD A;  4L5I A;  2W48 A;  3UNG C;  3PNT A;  4HBL A;  3VYU B;  4M71 A;  1J59 A;  2KLO A;  4NQW B;  3F8C A;  3LSM A;  5D6F A;  5BS6 A;  3J81 Z;  2HVR A;  3S3N A;  2XVC A;  4LOC A;  4YEJ A;  2DA5 A;  3VB2 A;  3WU0 A;  3V42 A;  3E6M A;  4A0X A;  1K83 J;  2EJR A;  3N4M A;  1R7J A;  3WE2 A;  3HDD A;  4IJA A;  2CO5 A;  1X1C A;  1HC8 A;  4XLP F;  1AWC A;  2QEX I;  2VOP A;  3MKZ A;  3K4N A;  3KPH A;  3BG9 A;  2L4A A;  3S1N J;  4G7O F;  3BC8 A;  1OYY A;  1XGM A;  1X1D A;  2EH3 A;  2X1C A;  2Z2S B;  3I56 I;  3HM5 A;  1QHG A;  2JA5 J;  4OAY A;  4ZYA A;  1VQ7 I;  1VQL I;  3VYS B;  1SAX A;  4AUX A;  1VI0 A;  2E36 A;  1WFX A;  3RI4 A;  2JSP A;  4S04 A;  3CJT B;  4EJU A;  3H3U A;  4BBS J;  3OWT A;  3E1S A;  3OYD A;  4OWR B;  1WJC A;  4HX4 A;  1FTT A;  5E1X A;  2CQK A;  1GLN A;  1HST A;  4R79 A;  1UZC A;  1T98 A;  2Y0M A;  2ECC A;  3SEZ A;  1HF0 A;  3KP6 A;  1FSE A;  3N05 A;  3J80 K;  3H3V K;  5FKK A;  3W2A A;  3ZOB A;  4DZJ A;  1TT5 B;  2HR3 A;  3QYF A;  4G8X A;  1S7E A;  5EG0 B;  2GQQ A;  4Z2Y A;  2DA2 A;  2HQA A;  2KRH A;  4BQQ A;  5F0F A;  2VQL A;  3JRF A;  3W6K B;  1TW3 A;  4G7H F;  3D5R C;  2X9D A;  3JRG A;  2EZL A;  1IRX A;  3BR0 A;  4RGX A;  4IF4 A;  3SXY A;  4B3X A;  2WAQ A;  2KMU A;  2CJJ A;  2PMZ N;  3RQ4 A;  2R3S A;  1K6Y A;  4F55 A;  3KE2 A;  4KIF A;  2R7X A;  3CCR I;  3I59 B;  3EUH C;  1U8B A;  3ABL H;  2WAE A;  3RDI A;  2HI3 A;  1OYI A;  4P9U A;  3BRO A;  4UXN A;  4I0A A;  4AYB A;  1CF7 A;  3DPT A;  2UXX A;  3ZMD A;  2HZT A;  4JBA A;  1Y1V J;  2BHY A;  2OC6 A;  3WGI A;  4IHS A;  1DU6 A;  1T95 A;  3H0D A;  1B72 A;  1B8I B;  2JSC A;  4GXO A;  3C3W A;  1YW9 A;  3CDL A;  4ANJ A;  4EVI A;  2OTJ I;  1KU9 A;  1RZ4 A;  1MJB A;  3BG3 A;  3CCJ I;  4FX0 A;  1R22 A;  1VQ6 I;  4ON0 A;  5CVI A;  3O6B B;  3OV8 A;  3CMY A;  3ZQC A;  4RGU A;  4F93 B;  2LOO A;  3CZ6 A;  1M1E B;  4KJZ A;  4DBR A;  2EV0 A;  1LUJ B;  4XSX F;  4F52 A;  5FD5 A;  3IC7 A;  1DDN A;  3K7A J;  2K85 A;  1ZRD A;  1QZY A;  1R36 A;  4BJ5 C;  3L00 A;  1WJF A;  1V3F A;  2M5W A;  3NAR A;  5CVR A;  4MO7 A;  1X4O A;  1FOK A;  1ZEL A;  4E70 A;  2VQC A;  3AL0 B;  3KFW X;  3M9A A;  3SHF A;  2OZ6 A;  3GTK J;  2XSD C;  4JYK A;  4Q5S F;  2R7T A;  1WJD A;  2Z1D A;  1P7I A;  4RA2 A;  3I9V 2;  3ZMZ A;  2DXI A;  2HDD A;  3KIO A;  2XAQ A;  1TL8 A;  3OIQ A;  1YIO A;  3W3C A;  4C3H J;  2L9V A;  2E7W A;  4OMY A;  2K02 A;  4A3K J;  2L02 A;  1K78 A;  4FE7 A;  4QPO A;  4G12 A;  4OIN F;  1PUF A;  1MND A;  1Z7L A;  4BNC A;  4G94 A;  3V7R A;  4ABZ A;  3E6C C;  1C0W A;  1EH8 A;  2E35 A;  2G0E A;  2MSY A;  2ZNZ A;  3ZQF A;  1PDN C;  5KVR A;  1J75 A;  3Q5F A;  1CQT A;  3WTX C;  1WJB A;  4BQO A;  3PNY A;  5IYB J;  3BR2 A;  1SFE A;  3RYR A;  3WU1 B;  4DOZ A;  4BDY A;  4XKC A;  2DOF A;  3FXR A;  3G1M A;  2PBI A;  5DTD A;  3TW7 A;  3EYY A;  5L3E A;  3O8G A;  5F1J A;  1JHF A;  2WWY A;  3HRU A;  3FKI J;  2QLZ A;  2DBB A;  2Z9O A;  2CG4 A;  3Q0U A;  5LLQ A;  3DXJ F;  3ISP A;  2QKL B;  1LFP A;  3BWG A;  3OSF A;  1OJL A;  2AXL A;  3JAM Z;  1V5F A;  4KIC A;  2BE5 F;  4AC0 A;  2ZKZ A;  2EWN A;  2YX4 A;  3MZY A;  3IH4 A;  3L2Q A;  1XPX A;  3ML6 A;  5DCM A;  1WH7 A;  5A2Q Z;  3MD2 A;  2CU7 A;  5E3M A;  3JRD A;  3OYA A;  2V26 A;  4M6V A;  3MKY B;  5JVG F;  4ZDO A;  3OYH A;  1T33 A;  3F6O A;  5CQG A;  2FNP A;  2UUZ A;  4L9T A;  4F7Z A;  4O5V A;  3VPR A;  3ZQG A;  3VWB A;  1LDD A;  4I7H A;  4EM0 B;  1ITY A;  3TOB A;  3K69 A;  2QA4 I;  2V1U A;  1HW5 A;  2HZD A;  3K10 A;  2KIQ A;  1ETV A;  3V8K A;  5M5Y J;  5DM7 F;  3QPT A;  5CQE A;  1FT9 A;  2VQG A;  5LHH A;  1OCP A;  1WJE A;  2DYS H;  1JUS A;  4M3G A;  3OR1 C;  4G6Q A;  5F64 A;  2ELJ A;  4NDL A;  5LHI A;  1B4A A;  4CGZ A;  3ESW B;  4B09 A;  3NWT A;  4PJL A;  2NS8 A;  5M5W J;  2ZXH A;  4HQE A;  4C30 A;  4PSX A;  3K4K A;  4B47 A;  2O9L A;  3GZ6 A;  3CCV I;  4LG0 A;  2W25 A;  1O7F A;  3Q9S A;  4AD9 A;  2M34 A;  4AIK A;  3PSF A;  4V2G A;  2BY0 A;  3W6V A;  1R5G A;  1P4X A;  3K6G A;  1HKS A;  2VE9 A;  2DMU A;  2DA4 A;  4HDV A;  4ENJ A;  1UST A;  3DF8 A;  3DQV C;  2GA2 A;  3TMO A;  2V6C A;  1YJ9 I;  1QNT A;  3C1D A;  5FB2 A;  2OZU A;  3GXO A;  4HX8 A;  4RAG A;  3BY6 A;  1IZ1 A;  3QP5 A;  2Y0S N;  4LFU A;  2YS9 A;  5BPD A;  3BR6 A;  1QVT A;  4BH9 A;  2DT6 A;  2JT1 A;  3WGG A;  2BHZ A;  2R5Z B;  4R1H A;  3KYD B;  3LA7 A;  1KU2 A;  2F4O B;  3GLX A;  1BOA A;  2L7F P;  3I0T A;  1BI3 A;  2R5Y A;  1GV5 A;  4LLG F;  1MSF C;  2DJI A;  2ACJ A;  2ZXJ A;  4ZJZ A;  2HFH A;  4A3I J;  3SDB A;  1J09 A;  2P6S A;  4B1R A;  2VON A;  2AHQ A;  2B63 J;  3V7S A;  1P4A A;  3L2U A;  3K1M A;  1X3W B;  5J4V A;  1QU3 A;  2D2W A;  4E7Z A;  4DW6 A;  3COA C;  5CKT A;  3WG9 A;  2JWT A;  1A04 A;  2O0Y A;  5TRD A;  2A6T A;  5EGO A;  4BEH B;  2O6G E;  2NVT J;  2LKX A;  3EYI A;  3C2H A;  2XRO A;  2FMY A;  2OQG A;  2P8T A;  1FY7 A;  1B8I A;  1WKM A;  2HPI A;  2DOA A;  3HRM A;  4B44 A;  3K70 C;  4QWQ A;  2OA4 A;  1HQC A;  2FBI A;  3HB9 A;  4UVA A;  2WY7 Q;  3ROU A;  4NB5 A;  3S2H J;  1ZYR F;  3MKW B;  3PL8 A;  3CLO A;  1DPU A;  1D5Y A;  4L9V A;  2LMD A;  4UY8 I;  1WQ2 A;  3G1L A;  3KEO A;  2IA0 A;  4ZYH A;  3TQN A;  4KFC A;  2E19 A;  2M1B A;  4HSR A;  4CCK A;  3Q0W A;  4L9N A;  5EZH A;  1ZGA A;  1R6R A;  4ETS A;  4V19 K;  4BYY A;  2PG4 A;  4U7D A;  1GVJ A;  2GZW A;  2JN6 A;  4XLH A;  1OKR A;  5K5O A;  4UB6 C;  2E1N A;  2Z99 A;  1HLV A;  5FLV A;  1FP2 A;  4QPQ A;  1PUE E;  4RM2 A;  4HNU A;  1ERD A;  2VBZ A;  2A6H F;  1W7P D;  2NVQ J;  2ICW G;  5EZG A;  3FMS A;  3WTS C;  1X1B A;  1JXS A;  1Y0U A;  3CP2 A;  3BCA A;  5ED4 A;  2KFD A;  2O7O A;  4AWX B;  1WH5 A;  2XAJ A;  2ZSH B;  3GZN B;  3IH2 A;  3J80 Z;  3OYB A;  4AU7 A;  3BDD A;  4JK1 X;  1SMY F;  3FM5 A;  4EEF G;  3KET A;  1ZR4 A;  1IUY A;  2VXZ A;  4RLF A;  2M8E A;  1NG6 A;  1F5T A;  1I6H J;  4E6K G;  2G9W A;  2Y9Z A;  2CS3 A;  2CMP A;  1T0F A;  1XGN A;  3OIP A;  2ZNY A;  4XRM A;  2I10 A;  2M4K A;  5GAH J;  1MH4 A;  2QKM B;  1W0T A;  2MFZ A;  4XLC A;  3H9G A;  3G1O A;  3P9K A;  1SD7 A;  1ZRE A;  1QVU A;  4Y3O A;  1P7J A;  2JVG A;  3EUA A;  1H8A C;  4II3 A;  3OYC A;  3IH3 A;  4RB3 C;  1UG2 A;  2YX7 A;  1G6N A;  5DV5 A;  3BR5 A;  4BL0 B;  4IOC F;  1O3Q A;  4DYR A;  4RB0 A;  4HDU A;  3CD6 I;  2WY8 Q;  4XBF A;  5F0H A;  3BP8 A;  3HTS B;  1YW7 A;  1TWH J;  4IHT A;  2QF7 A;  4WF2 A;  2VBW A;  2RV8 A;  5KCM A;  5KNL A;  3M07 A;  1U0J A;  4IOA F;  3L9F A;  3OYM A;  3KYC B;  1KYZ A;  1MBK A;  3CC4 I;  5E8I A;  2DK5 A;  1KQ9 A;  1QGP A;  2IPQ X;  2ZJP F;  5HLT A;  5HDK A;  1O7L A;  2NOJ B;  4IHW A;  3HBL A;  1ZK8 A;  2M0M A;  4YFK F;  2L2O A;  2D45 A;  2CV0 A;  2R7V A;  2OBP A;  3UKG A;  1VF9 A;  4AID A;  3R0J A;  2IAI A;  3FMQ A;  2Z3Y A;  2VAS A;  3BG7 A;  4UVB A;  5J1R A;  1P4W A;  1PJR A;  2O8K A;  2XPW A;  4AIJ A;  2ISZ A;  3GCM A;  4GO1 A;  1D0Z A;  3IRR A;  3KLN A;  3P9I A;  2OV7 A;  1PP8 F;  4EGY A;  1OPC A;  2XGE A;  2YR2 A;  4XLN F;  4XSZ F;  2KIM A;  3CCL I;  4IEJ A;  4BY7 J;  1R71 A;  4RM3 A;  5FKL A;  4PFO A;  1QO0 D;  5IP9 J;  3I71 A;  2MLG A;  4KT5 C;  4IRG A;  1FYL A;  3F22 A;  3BQY A;  1A6Q A;  4QIW N;  4A6E A;  5IYC J;  1U78 A;  4M9X A;  2R7R A;  1XS9 A;  2LVS A;  2Y30 A;  1Y8Q B;  3HEF A;  1SAN A;  5J4Y A;  5TGT A;  2MH9 A;  1GT0 C;  1RKW A;  1QQI A;  2KZG A;  4EJV A;  2M87 A;  2MGQ A;  2CQX A;  3CME I;  4P96 A;  1ON2 A;  2HXO A;  1I3A A;  4A3B J;  4MEX F;  3TP0 A;  5JHU A;  2LC2 A;  3ABM H;  1BM9 A;  3HPG A;  5KAF C;  2XGD A;  1FX7 A;  4IPA A;  4II2 A;  4GDF A;  3CTA A;  4WXH A;  2XF7 A;  1QHH D;  4EJT A;  2LD5 A;  1FP1 D;  3JTH A;  2W84 A;  1VQ5 I;  2M3A A;  3KP2 A;  3RSN A;  4X0G A;  1FJL A;  1XCV A;  4FIS A;  4P9F A;  3ABK H;  2WAD A;  4L9J A;  2EFP A;  2CQN A;  4NHJ A;  2FOK A;  2LFB A;  2KJB A;  2EQR A;  1YI2 I;  1CF7 B;  1F36 A;  3A0H C;  2JJ7 A;  1IC8 A;  2HPM A;  5HNH A;  5C4X J;  2V6E A;  2EPF A;  1USS A;  3OR2 C;  1B72 B;  2PX9 A;  3QPL A;  3F23 A;  3KP4 A;  1SFU A;  4JX5 A;  2CSO A;  1XMK A;  1BC8 C;  4A5M A;  3J7A Y;  1L3L A;  1R4N B; 
#chains in the Genus database with same CATH homology
 1HF0 A;  2DMQ A;  3FIW A;  3LSR A;  1IJW C;  3BR3 A;  5J1U A;  5IYD J;  1MBJ A;  3H3V K;  1GUU A;  5FKK A;  3ZOB A;  4DZJ A;  3WHB A;  2ZB9 A;  3DCF A;  3HGY A;  5FKM A;  3JRB A;  1S7E A;  2EZK A;  5EG0 B;  2DA2 A;  3HOY J;  3SJM A;  5F0F A;  1UHS A;  1BW6 A;  3JRF A;  2VKE A;  2Y2Z A;  3NAU A;  4A3E J;  2VPR A;  3CCY A;  2X9D A;  4RBO A;  3JRG A;  2IBD A;  3H0G J;  2EZL A;  2FX0 A;  3BR0 A;  1RPW A;  5M5X J;  3S14 J;  3QPS A;  1GDT A;  2CJJ A;  2PMZ N;  4UUT A;  5IP6 A;  2M0C A;  1Z77 A;  1U8B A;  1PUF B;  5K7Z A;  2XRL A;  2HI3 A;  1JUM A;  4C3J J;  4RDU A;  5EDN A;  4M3E A;  4C3I J;  3GTP J;  1Y1V J;  3ZQI A;  1BW5 A;  2VKV A;  3LSG A;  1BA5 A;  1DU6 A;  1T56 A;  1B72 A;  2OPT A;  1B8I B;  3RZD J;  3HOU J;  3CDL A;  4UUS A;  3BT9 A;  3BG3 A;  3D1N I;  2DN0 A;  2X6O A;  1JKO C;  1LE8 A;  3FK6 A;  3FIS A;  1ORK A;  3CMY A;  3ZQC A;  3JR9 A;  3CQZ J;  5IP7 J;  1TC3 C;  1AKH B;  3BG5 A;  2XB5 A;  1FIP A;  3K7A J;  1GVD A;  3DEW A;  3I4N J;  2L9R A;  1GV2 A;  4D5F A;  4A3J J;  1RES A;  5FJ8 J;  3NAR A;  1SFO J;  5EG0 A;  4MO7 A;  1JJ8 C;  2FJ1 A;  1ETK A;  3BTJ A;  3K2A A;  4X1E A;  2DJN A;  1E3O C;  1Q1V A;  3TED A;  5IPA A;  3GTK J;  2XSD C;  4JYK A;  1P7I A;  3C2B A;  2HDD A;  2CUE A;  3B6A A;  1X2N A;  4C3H J;  1F43 A;  4A3K J;  4FE7 A;  4MIM A;  1X58 A;  4G12 A;  3RKQ A;  1PUF A;  2QCO A;  2DA6 A;  1MBH A;  4ABZ A;  2CRG A;  4J19 A;  1XG1 A;  2G0E A;  2MSY A;  3GTG J;  3ZQF A;  1Y1W J;  1X2M A;  4L5E A;  1CQT A;  3A01 B;  4DYC A;  1AU7 A;  5IYB J;  3BR2 A;  3BTI A;  2K9Q A;  3G1M A;  3TW7 A;  5DTD A;  2ME0 A;  3O8G A;  5F1J A;  3FKI J;  2KT0 A;  3GTO J;  1AKH A;  9ANT A;  1WI3 A;  3Q0U A;  4JX6 A;  1ENH A;  2H8R A;  2CUF A;  4XK4 A;  5FLM J;  3S1Q J;  4MFD A;  3PO2 J;  3OSF A;  1OJL A;  3TW6 A;  3M4O J;  1HDD C;  1TWC J;  2HQ5 A;  2XPU A;  4AC0 A;  4DYQ A;  1IDY A;  2CQQ A;  3IH4 A;  5M3F J;  4XRS A;  4A3M J;  5F0C A;  1NK3 P;  1WH7 A;  4A3C J;  1JT6 A;  4D7M A;  2CU7 A;  5E3M A;  3JRD A;  3GBG A;  1NK2 P;  3GTJ J;  2JK3 A;  2TCT A;  4M6V A;  5DS9 A;  1T33 A;  4V2F A;  3JRI A;  3E7L A;  3VPR A;  3ZQG A;  4W1U A;  4FTH A;  2GLO A;  2DA7 A;  2LLK A;  2R0Q C;  1ITY A;  1FIA A;  4QSH A;  4A3D J;  1TWA J;  1JTX A;  1FTZ A;  2R5Y B;  1ETV A;  5C4J J;  5M5Y J;  1JKR C;  2XGC A;  1OCP A;  4JX4 A;  4FCY A;  1MBE A;  1JUS A;  4M3G A;  1R9T J;  4NDL A;  5J3L A;  2M9H A;  3HKZ N;  1ZGW A;  3S1R J;  2NS8 A;  5M5W J;  1WPK A;  3O8H A;  5K7F A;  3OSG A;  1JUP A;  1I3Q J;  2X48 A;  3PM1 A;  2O9L A;  1LFU P;  2YUS A;  2M34 A;  2JA7 J;  5EGO B;  2XPV A;  4V2G A;  5J1Y A;  3S17 J;  3W6V A;  4IHY A;  4M3D A;  1DU0 A;  2E1O A;  2L7Z A;  4BKX A;  2DMU A;  4B4C A;  1JTY A;  2DA4 A;  1W0U A;  1QPI A;  1BJZ A;  3HOZ J;  2FQ4 A;  2HOT A;  5EEA A;  2LTP A;  3BTC A;  5K7H A;  2HOA A;  2DMN A;  2Y0S N;  5IOY A;  5C44 J;  1IV6 A;  2YS9 A;  2E2H J;  5F08 A;  5GPA A;  3BR6 A;  1H88 C;  1QVT A;  4MLO A;  3HOW J;  2P81 A;  1XC5 A;  2R5Z B;  4C2M J;  2NS7 A;  4I76 A;  2KDZ A;  2M8G X;  2DTZ A;  2L7F P;  2R5Y A;  3SFI A;  1GV5 A;  1MSF C;  2FD5 A;  4D5C A;  2MW8 A;  5IOZ A;  4A3I J;  2ID6 A;  4XRS G;  3BQZ A;  1NTC A;  2MG4 A;  1WCM J;  3Q3S A;  3JRH A;  3GTM J;  4B1R A;  2COB A;  2AHQ A;  1O4X A;  2B63 J;  5HOD A;  1ETO A;  1OFC X;  4A3L J;  5F04 A;  3BTL A;  4MFE A;  2Y9Y A;  4FE4 A;  2K40 A;  5BNG A;  3MN2 A;  4DW6 A;  3B6C A;  1IDZ A;  2JWT A;  3QQA A;  3SDG A;  5EGO A;  2NVT J;  4A93 J;  1MSE C;  2LKX A;  2N8G A;  1B8I A;  1U9O A;  2NVX J;  3MKL A;  2LR8 A;  4BBR J;  1IG7 A;  3L1P A;  1TWG J;  3HB9 A;  1HCR A;  1IGN A;  3S2H J;  1TWF J;  2L7M P;  3JRC A;  4JP0 A;  1D5Y A;  1QRY A;  2H1K A;  5FKN A;  5E3O A;  2OF7 A;  3G1L A;  1U9N A;  2GBY A;  2NVY J;  2E19 A;  4XID A;  2XB0 X;  2R5Z A;  3Q0W A;  1HOM A;  5EZH A;  1LFB A;  2JN6 A;  1HDP A;  1MNM C;  3BR1 A;  4M3B A;  1HLV A;  5FLV A;  4W97 A;  3OOU A;  3TP3 A;  2NVQ J;  5F27 A;  5EZG A;  1ZQ3 P;  1MBG A;  2EZI A;  2EBI A;  2AO9 A;  1RR7 A;  5E3N A;  3JRE A;  2O7O A;  4X6A J;  1WH5 A;  2ECB A;  3IH2 A;  3HOV J;  1ZKG A;  1VND A;  3S2D J;  4D7N A;  4EEF G;  3WHC A;  1ZR4 A;  2M2E A;  4B3A A;  2VI6 A;  1VFC A;  1ETY A;  3I4M J;  2GM4 A;  3A01 A;  1I6H J;  1AHD P;  2ID3 A;  2Y9Z A;  4HNV A;  1MH3 A;  1JKQ C;  3HGG A;  4XRM A;  2ELK A;  2I10 A;  4CYC B;  4BY1 J;  1WGX A;  1W0T A;  1MH4 A;  4XIC A;  3ZQL A;  3G1O A;  1ETQ A;  1EF4 A;  3LSP A;  4S0H B;  3F0C A;  2ME6 A;  2WB1 N;  1QVU A;  2K9N A;  1BL0 A;  1P7J A;  2L0K A;  1H8A C;  4IHV A;  1ZR2 A;  1IUF A;  1UMQ A;  2JA6 J;  1K61 A;  3IH3 A;  1UG2 A;  5M3M J;  3BR5 A;  2DMP A;  4DYR A;  2JMW A;  2K9S A;  3A03 A;  1JKP C;  5F0H A;  1MBF A;  2E2J J;  1FEX A;  3GTL J;  1TWH J;  2R7Z J;  1JT0 A;  2QF7 A;  2HYJ A;  3RQI A;  2JA8 J;  2TRT A;  2E2I J;  1POG A;  4BXX J;  4Y52 J;  3S16 J;  4I6Z A;  1MBK A;  5C3E J;  5EYR A;  4IHW A;  3HBL A;  1ZK8 A;  5EF6 A;  1I50 J;  3MVP A;  3S1M J;  3HOX J;  1A6I A;  1JGG A;  1IRZ A;  3UKG A;  1VF9 A;  2LK2 A;  1ZTR A;  4M3F A;  2IAI A;  2O8K A;  5J1R A;  2D5V A;  3LSJ A;  2XPW A;  2Y31 A;  3RZO J;  1YRN B;  4A69 C;  3Q0V A;  4DZP A;  2WV1 A;  3S15 J;  2DA3 A;  4CYC A;  3FK7 A;  2R93 J;  1A5J A;  5GP9 A;  1G2H A;  2XGE A;  1JJ6 C;  3OIO A;  4IEJ A;  4BY7 J;  3PO3 J;  5FKL A;  5FKO A;  4A3F J;  5IP9 J;  2NOG A;  2IEK A;  3ZQH A;  3BQY A;  5IYC J;  4QIW N;  3IV5 A;  1U78 A;  2R92 J;  1XS9 A;  2RAE A;  2W48 A;  2LVS A;  2Y30 A;  3HEF A;  2HOS A;  1SAN A;  3LNQ A;  3GTQ J;  4QTR A;  1RKW A;  2EZH A;  1GT0 C;  2MGQ A;  2VUM J;  4LOC A;  2CQX A;  4A3B J;  2DA5 A;  2HXO A;  5JLW A;  1APL C;  1RKT A;  3TP0 A;  1K83 J;  2YU9 J;  3HDD A;  1RET A;  2DA1 A;  2LY9 A;  2XGD A;  4GFB A;  1ETX A;  1H89 C;  2LD5 A;  3BG9 A;  3S1N J;  1FJL A;  1ETW A;  1Z0X A;  2WAQ N;  4FIS A;  2LP0 A;  2DMT A;  2EH3 A;  2LFB A;  3HM5 A;  1OCT C;  2EQR A;  2JA5 J;  1F36 A;  1YRN A;  4IHX A;  2JJ7 A;  1IC8 A;  5E3L A;  4AUX A;  1VI0 A;  5C4X J;  4Y7N J;  4AYB N;  1B72 B;  3QPL A;  3JRA A;  3LOC A;  5JLX A;  3M3Y J;  4JX5 A;  4BBS J;  3A02 A;  2HXI A;  4UUS B;  1FTT A;  5GPC A;  1LE8 B;  4A3G J;  2ECC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...