4LG0B

Structure of a ternary foxo1-ets1 dna complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
106
structure length
106
Chain Sequence
GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords Forkhead box protein O1
publication title Structure of a ternary FOXO1-ETS1 DNA complex
rcsb
source organism Homo sapiens
total genus 37
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2013-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4lg0B00
1B9MA 4Q47A 3HRUA 4ETSA 5D5VB 2M8EA 5J8CA 4CICA 5D6FA 1EH8A 4XLPF 5HLHA 1O3TA 3ELKA 1XB4A 4BH9A 2BE5F 2YU3A 2V1DA 4ZZLA 2XAGA 4G7ZF 1Z7UA 4WF2A 1IAWA 3WTZA 3C1DA 2UXNA 2Z99A 5KVRA 3FHZA 5HDKA 2F5CA 4GYGA 3TOBA 5D8KB 4LK0F 1LDJA 2A61A 1IXRC 1WWXA 3TKYA 1MDMA 4Z2YA 2H6BA 1I27A 4RB3C 4G8XA 1XMKA 3AAFA 4HOBA 1AWCA 3EYYA 3D0SA 4G7HF 2EA2A 3ISPA 4E70A 4UVBA 4LB5A 5FGMA 2GAUA 2QQ9A 3E5XA 4HW0A 4UHTA 3R6SA 3WE2A 2HKXA 1O3QA 5E1ZB 5LEJA 1ON1A 5D5WB 1FBQA 5DUKA 4O3MA 3NRVA 2ADUA 5HOOA 5ED4A 3CUOA 3KP2A 1YG2A 5AIPA 3T8TA 2JPCA 3CUQA 1ZGAA 2E1CA 4CXFA 3KLNA 1R22A 3VODA 1IN7A 1WQ2A 5HS7A 3SZTA 3RKXA 4RAYA 2O3FA 2O8XA 1HXDA 3SQNA 4O5VA 2O61A 3I53A 1HQCA 3RDIA 4YIIA 2Z3YA 3WE3A 4A0YA 1J5YA 1P4XA 2OU2A 4L0YB 2JZYA 3M7GA 1E2XA 1I1SA 2VOOA 1KGSA 1U8RA 2M45A 4I0AA 4UXNA 3SFZA 2W85A 3ROUA 1GVJA 1T39A 2QENA 3ABTA 1T6SA 3JAMK 3KFWX 2CGPA 3RYRA 2HQNA 2ZMEA 2MD5A 1W4MA 2PBIA 4A0XA 2RKHA 1IUYA 2H94A 1I1GA 2W57A 3J81K 3F6OA 1MJ9A 1R5GA 4MTDA 3CUQC 1Z6RA 4L9VA 4HA8A 3DFGA 4M74A 2K02A 4EM0B 3K2ZA 2COMA 1SMYF 4ZZDA 3ZQ7A 3GX4X 4YIFA 5K5RA 1ZYRF 3W6JB 2EK5A 1SFXA 4IHTA 1X3UA 1XCVA 3BWGA 5LEKA 4WXDA 3F3XA 2ELHA 5J8FA 5K1YA 2QUFA 2WC2A 2EFWA 2EV6A 3ZN0A 1SD5A 4RGUA 3V7SA 5CVRA 1L0OC 5F1RA 4KT5C 3P7NA 3V7CA 2HFHA 2IP2A 5BS6A 3BPVA 5CVIA 1TLHB 2FMLA 1YS6A 1KQ9A 3LFKA 3ZMVA 4IHSA 1W7PB 4HF1A 3E3VA 5K5QA 2AXLA 4WXCA 3LQRA 5BQTA 5LLQA 2NRAC 2WTEA 2C6YA 3FXRA 3Q9VA 5DEQA 5LGTA 1TBXA 1OR7A 2BGCA 4EM2A 2EWNA 1ZG3A 2FQ3A 2RQPA 4QWQA 4M9ZA 1YIOA 3HSEA 2NNYA 4Q5SF 4KYWA 1JE8A 2IRFG 5L3CA 5BPIA 4EVIA 4JQFA 3P9CA 1G3YA 2WWYA 4RGSA 1FT9A 4N0BA 3JAMZ 2ACJA 3G73A 2QWWA 1S6LA 4PDKA 3I59B 2Q8KA 1W5TA 1YW8A 4RB1A 4XSXF 4NHJA 4LJZF 1FWZA 3J81Z 4FHTA 3K0LA 2GA2A 4Q48A 1G3WA 1BJAA 1Z05A 2NS0A 3FZVA 1L3LA 1BI0A 3RKYA 1FSEA 4JK1X 3GZ5A 4R8HA 4GXOA 3KP3A 1HSTA 1OMIA 2OQRA 1H0MA 4L0ZB 2VBXA 1SD6A 2V6CA 2DPUA 2DBBA 3WTUC 3N4MA 2XAFA 2KIFA 1HSJA 2GXGA 4M6YA 2DPDA 1FNNA 1T98A 2PG4A 4GYIA 1KQ8A 4HF2A 3HRSA 3KETA 3LAJA 1O3RA 1UFMA 2F2EA 2HZTA 3ULQB 1MGTA 2DTRA 1XGOA 2KIUA 1MJAA 4ZYHA 5HS9A 3RPUA 4L9NA 3GFIA 3FWEA 4U0VA 3IKVA 1R23A 4KMFA 2K4BA 5E1WA 3O6BB 4N9HA 1DPRA 2DU9A 5BOXA 4ON0A 3SHFA 5ICEA 2LDUA 3I5UA 3DP7A 1H9TA 2QQAA 3HSFA 4IRIA 4RGRA 4RS8A 3D5LA 4OMYA 1RNLA 2JPBA 2XAHA 5D4SA 1S29A 1TNSA 2BYVE 2EFPA 4PGGA 1P4AA 1SD4A 1YYVA 3L09A 4KMUX 1FPQA 3WODF 2L4MA 1HW2A 1XD7A 4LGWA 1J59A 4ZYDA 1RUNA 3FXUA 1XGMA 1U2WA 2PMHA 1ZG5A 2FF4A 4FX4A 4JBAA 1Z1DA 5E1XA 2GA1A 4B09A 2OBPA 4G7OF 1TTYA 4MQ9F 2KJBA 1QNTA 2A6HF 5HVQC 5CVJA 3WTYC 1YW9A 1QBJA 2P5KA 3BJ6A 2EV0A 5DCMA 4RB0A 4OIOF 4HDVA 3T0YA 2VBZA 4XRFA 3DKWA 2XUBA 2FA5A 2A6EF 1R1VA 1B1BA 3FXQA 1LVAA 2D1HA 2ZNYA 3E5QA 3QP6A 3PQJA 4U7DA 3GXOA 3GVAA 2PN6A 5DDGA 3GO5A 2FNPA 3HRTA 1IF1A 3R0JA 5TJJA 5CLSA 4L9JA 1G3TA 2W84A 4XLNF 5D8LB 4R79A 2CO5A 2VXZA 4LLLA 3WG9A 3MAJA 4A0ZA 2NAZA 2ZJ2A 2QLZA 3GUDA 1JHHA 2FMYA 4AWXB 2E1NA 3RJPA 4M6XA 3GFLA 3VFZA 4Q4ZF 5LRRA 3PFIA 3WTTC 5LGUA 1MD0A 5DUIA 2ZFWA 2VBWA 3L2CA 1JHFA 5LHGA 2IT0A 1BI3A 4RAZA 5FFZA 5HS8A 4M9XA 1T0FA 5CJ9A 4M72A 1ZG1A 2UXXA 4YG2F 3TQNA 3JTHA 3OOPA 3DF8A 2A07F 1MDMB 1ON2A 2FSWA 1XDSA 1R36A 4HBLA 4P9UA 2DT5A 2Z5UA 2IPQX 2Y0MA 2ZNZA 1Z91A 2OZUA 4K2EA 2PFBA 1U3EM 3CTAA 4BHBA 4ESJA 4EGYA 5DV5A 2OQGA 2RN7A 1EH7A 2DI3A 1ZAOA 2OD5A 3BJOA 3HHGA 1BBYA 1MKMA 4HX8A 1ZN2A 1RI7A 2L4AA 2GQQA 1BC8C 3WTVC 4ZH4F 3CUQB 2M30A 2EV5A 4GO1A 3V8LA 5JFRA 3EQLF 1QPMA 1G3SA 4OMZA 1IXSB 1U5TA 3RTRA 2MH2A 3P9KA 3BZ6A 2MLKA 2AS5F 2A69F 2DO7A 4A5MA 4HQEA 4HV5A 2PQ8A 1ZGJA 3G3ZA 1LQ1A 2KRFA 4FX0A 1ZLJA 3EUHA 4HZFA 4EM1A 1TNTA 4P55A 4AD9A 3WTWC 3DQVC 2HTSA 1OYYA 5BPDA 4EJWA 3MZHA 3N97A 3HHHA 2HYGD 3CJNA 2ZMEB 2O03A 4O6JA 1UHMA 3QU6A 5IT9K 4CDGA 2Q2EA 4A12A 2RC4A 3IKTA 2V1UA 5D6EA 1IN8A 2H27A 4L18B 5HDGA 1IZ1A 1KU2A 3MWMA 2EB7A 2QZ8A 4MGRA 4KNYA 5E17F 2BEOA 1LDKB 3IRQA 1S7OA 1U5TC 2EFOA 1RIOH 2CFXA 1KQ0A 3ZPLA 4PGHA 5AIQA 3P9IA 4I98B 3BPXA 2RNJA 4IPAA 3U2RA 2LNBA 3BP8A 2LF8A 4A6DA 1ZRFA 3QPTA 1HW1A 1MJBA 1UHWA 2Z9OA 3EYIA 3KZYA 1LJ9A 4YFNF 5LRSA 1HKTA 1F4KA 3F23A 4DNCA 2XGXA 4Y13A 4PCQA 2LF7A 5HDNA 1HKQA 3ABUA 1QZZA 3LA2A 2F5FA 3GF2A 5EEGA 4LG0A 4U88A 5DYMA 4KIGA 1FY7A 2R7DA 4WK8F 3C18A 3C7JA 3R0AA 3I71A 5LHHA 3E97A 3PQKA 3VOEA 1TQPA 3HYIA 3QOPA 1PUEE 3K1MA 3E6CC 1W7PD 1FSHA 4D0PA 2P8TA 3B02A 2Y75A 1O7FA 4BHPA 4ZYGA 2PEXA 1VTNC 3Q5FA 2BV6A 3S2WA 1IRFA 5ICGA 1K78A 3CDHA 1QO0D 2ZBKA 2VC1A 1GXPA 5FB2A 1Z6TA 4NB5A 1ZRCA 1WSUA 2L01A 1J9IA 1G4DA 1IN6A 4EJOA 1SAXA 3LWFA 1C0WA 2P4WA 3JTGA 3BOQA 5BMZA 2LSOA 4KA4A 2EFNA 5H6QA 2OAZA 1SD7A 1HW5A 1YFHA 1P6RA 4MEXF 4LK1F 1TQMA 2QQBA 4S05A 2G9WA 1XSVA 3ZMUA 1EV7A 3FF5A 1TQIA 3CLOA 2KKOA 5FD6A 2J5OA 5DD4A 2PJPA 4MHGA 2HS5A 5LBQA 4ESFA 2O6GE 2VONA 2CSOA 3RYPA 2K27A 3JSOA 3FM5A 2P7CB 2EA4A 2A3SA 2HOEA 5F6FA 4MQVA 2ISYA 1FBSA 1XCBA 4CHUA 1B9NA 1V3FA 2UWMA 4EGZA 2VN2A 3REOA 2BBYA 3B73A 5TRDA 4Y15A 2ETHA 2K7LA 3FM3A 1HBXG 3LSTA 4I2OA 1FC3A 2F5DA 3F8CA 1K6OA 1UCRA 2ESNA 4IXAA 1UB9A 4IJAA 1ZARA 4OIRF 4IVNA 1R1TA 1STZA 3DXJF 5AONA 2STWA 4AIJA 3COAC 1YLFA 2ISZA 2XHKA 2R3SA 3HOSA 3I58A 4XSZF 1PDNC 1SFEA 3WGHA 4FT8A 3F6VA 1KU9A 3TDUC 1RZ4A 4YFXF 1QGPA 5JHUA 2DFIA 3DPLC 2M87A 4M73A 5CVVA 2FBKA 2NNNA 1YO5C 4EQQA 2JT1A 1CF7A 2X4HA 5CVUA 1V4RA 1ZLKA 1DPUA 2XKPA 1WRJA 3CO6C 2QBYA 3I4PA 2ZXJA 2JTVA 3FMRA 3HSRA 3L00A 1S7AA 4HAMA 4AIHA 1PP8F 2GXBA 1O7LA 4EJTA 1YS7A 2VBYA 1FYMA 1O57A 1JGSA 4LFUA 2L54A 3R60A 5HLIA 1J2XA 3BROA 1R00A 3KP7A 1B6AA 4OINF 4QLCU 3GZ6A 5DCMB 4L9TA 2DK5A 4A2UA 2E7XA 3FMQA 1GHCA 3K1PA 1FYKA 1FP2A 5L3EA 4IRGA 4UV9A 2P5LC 2VOPA 5DCFA 2IVMA 2V79A 4F7ZA 3SZPA 4RB2C 1REPC 4LD5A 3F8BA 2STTA 1H9GA 1YQAA 2QM3A 2YR2A 3K1NA 1BN5A 3TDZC 4U7BA 3ZMDA 3JW4A 1FOKA 3IHUA 1R1UA 2RDPA 4KICA 4A6EA 3V8JA 4BXUA 4I0BA 1P4WA 5JVTA 3C3WA 1BI2A 1XGNA 5E20A 2QYOA 4RGXA 2JRTA 2O0YA 2H09A 4L5JA 4P96A 2FRHA 2OZ6A 3I54A 5LHIA 2K4JA 1TW3A 3ERED 1F1ZA 2D45A 1LNWA 1S3JA 4I7HA 2VE9A 3F72A 3HOTA 4EV0A 1ZHFA 3V4GA 1FYLA 3KLOA 3TOAA 4HDUA 4UVAA 3NEUA 1D3YA 4BYYA 3V7RA 5J6XA 5ICCA 3KP5A 1USTA 1IN4A 2M5WA 3HUGA 4OOIA 1R5HA 4WCGA 2HKOA 1XGSA 2DAOA 3QAHA 3GW2A 4G6QA 2WV0A 3NQOA 1A04A 3DV8A 3MFKA 2HWVA 5HLGA 1XDUA 4MTEA 2VE8A 2FNAA 3O2PE 1D5VA 4ENKA 1P2FA 1E17A 4LLNA 1W5SA 2KIMA 3Q9SA 4P5OA 4G94A 5IT3A 5ILVA 1ONVA 3KEQA 1FBUA 2P6TA 1R7JA 5ERIA 1DUXC 4XBFA 1K79A 3BDDA 5F64A 1IN5A 3RKWA 1F9NA 4CYDA 2RV8A 2GZWA 5L3GA 4I09A 4BNCA 4CO8A 4HX4A 5ILSA 1U5TB 3QP5A 3L9FA 2H6CA 3QU3A 2QVOA 1AOYA 1QZYA 3SXYA 2UZKA 2YPRA 3VEPA 3F21A 2FEZA 3WTXC 2P6SA 5E18F 5FO5A 3TO6A 1T2KA 1ZH5A 3ZMSA 3LQQA 4HF0A 4YFKF 2DQRA 4CGZA 3E6BA 3GYHX 2W24A 4H0EA 2Y48A 2B0LA 3HRMA 3ZP5A 1Y0UA 3K9TA 1J75A 3IC7A 4AIKA 1GXQA 3RI4A 4OIQF 5L3FA 1KA8A 5K5OA 3M8FA 2XASA 1BIAA 4KN4X 4UV8A 2PLYA 4KUMA 4U0WA 2JSCA 2RGVA 1NHAA 5KK1A 1LB2A 4WX9A 3JSPA 4BAYA 4R1HA 1KYZA 1ULYA 4I01A 4EMSA 1CGPA 3WU0A 1KYWA 2D2WA 5JI6A 3O3KA 2XV4S 3J7AO 3GFJA 3ML6A 2HTJA 4LMYA 4WXHA 2HQRA 5D5XB 4B8XA 1LEAA 3T5XA 4EJVA 4IF4A 3KCCA 1J7KA 1KU3A 1QQIA 3IWZA 2D1VA 1DDNA 3IWFA 1ZRDA 3EDPA 3J80K 5EEHA 2IA2A 1BI1A 5FD5A 2L02A 3M9AA 2L3DA 3DEUA 3HTSB 4I02A 4DQ2A 4TV7A 4LG0B 5H6RA 4S04A 2A5YB 1BC7C 1YW7A 3LA7A 5JR3A 3LA3A 2VT3A 2HDCA 3RPQA 1DP7P 1RUOA 5A2QK 1J0RA 3U1DA 2G7HA 1HKSA 2CQKA 4G6DA 3I0TA 5D4RA 1XSXA 1K78B 2FE3A 3WTSC 2MA3A 2RVCA 3R4KA 5FLXK 3LAPA 1BIBA 3BJAA 5LGNA 2ZO4A 3GLXA 5CYVA 2VC0A 3QRFF 2FBIA 5ICFA 3KP6A 4HV6A 1LDDA 2FU4A 3ZN1A 4ASNA 5IT9Z 2GIVA 1FZPB 1R58A 2E7WA 4GGGA 2IW5A 1W7PA 4LB6B 2DW4A 1LEBA 1XSDA 3W6KB 1SFUA 2CW0F 4KN7X 3GEZA 2F5EA 5H20A 1IW7F 3MZYA 2HYFA 3E6DA 3KZZA 3F8NA 4A5NA 5FFXA 3M8EA 4ENNA 3ZMTA 2MH9A 3H3UA 2DQLA 4BHCA 1JXSA 2XVCA 1FP1D 1I5ZA 4HLYA 3MQ0A 3J80Z 4PZJA 5L3BA 1K7AA 2X0LA 3TO7A 2MBFA 1WKMA 2Q0OA 4M9SA 3U9GA 4Y17A 2KJCA 3H92A 4OIPF 1OKRA 2A68F 3I64A 3I59A 2LKPA 2MC3A 3T8RA 1USSA 4MNUA 3K69A 3GFMA 5A2QZ 5E8GA 2EJRA 1IRGA 4HYEA 4LLGF 2EFQA 2P7VB 4NQWA 4ENMA 1OPCA 3IL2A 2XAJA 1Q1HA 3HTUA 2XROA 4KIFA 2DK8A 1ZREA 3QPHA 2V1XA 5FLXZ 2P5VA 5ILUA 1D8JA 4BQAA 3WGIA 1CF7B 1WI9A 1EH6A 1U78A 1D8KA 2ZCWA 4GCVA 1KU7A 1PP7U 2QBYB 4ZYEA 1XMAA 2PI0A 2FOKA 5DD8A 4M71A 3DPTA 4KIBA 3F8MA 2W25A 2CG4A 3V8KA 4CZZA 2DLLA 1U6GA 2GWRA 1MZBA 2Z33A 2FBHA 3MCZA 3T1BA 1FX7A 4EJUA 2IA1A 3TO9A 2R7FA 2CWEA 3RIRA 1F5TA 2CYYA 1SMTA 3GWZA 5E8IA 1ODDA 1BM9A 2J5PA 1XN7A 4HQMA 5L3DA 4KFCA 3VB2A 3FMSA 4G9YA 2NYXA 2HGCA 3FX3A 3MEXA 2HR3A 2ESHA 1S8NA 3KEOA 1Z9CA 3HIFA 3KE2A 3L7WA 2HEOA 3OV8A 4KDPA 2VODA 4ESBA 3F22A 1OYIA 3CO7C 2G7UA 3WGGA 3IRRA 2XAQA 4WWCA 4HLXA 3E6MA 1YTYA 4L5IA 3M1EA 3BY6A 3E5UA 4MEYF 1TW2A 2MLGA 4HX7A 3TGNA 1OYWA 3WU1B 1G6NA 3ECHA 1BOAA 2XKOA 6PAXA 3F8FA 4U0YA 1B4AA 3ZMZA 2YSRA 2ZKZA 1O3SA 4OU0A 2XRNA 1B59A 1I6XA 4AVPA 2YX4A 3R61A 3H3ZA 2IA0A 2M1BA 3ECOA 2XIGA 5D5UB 3KP4A 2OA4A 4IRHA 2YX7A 2FXAA 4UUVA 2PMUA 1T38A 2TDXA 2IJLA 3EETA 1IXCA 4P9FA 1FLIA 1P92A 2K86A 4UNOA 4N9IA 4ENJA 2V9VA 4UVCA 2VT2A
chains in the Genus database with same CATH superfamily
1B9MA 2XPVA 4Q47A 3HRUA 4ETSA 5D5VB 2M8EA 5J8CA 2L9SA 1YOVB 3I4NJ 4CICA 2LG4A 2W1OA 1EH8A 2DOAA 3FHNA 5D6FA 1JKRC 2CMPA 4XLPF 5HLHA 1O3TA 3ELKA 1XB4A 3OYJA 1TWHJ 4IOAF 4RA2A 2Q1ZB 1BR2A 1I6HJ 1OLTA 4BH9A 2BE5F 2IS1A 2YU3A 5F1JA 2V1DA 1FIPA 4DW6A 4ZJZA 4ZZLA 2XAGA 5J40A 4IHVA 4G7ZF 1Z7UA 5HLTA 3CJRB 4WF2A 5C3EJ 1IAWA 3WTZA 3C1DA 2UXNA 1BW5A 2E71A 2GIZA 4IHWA 2Z99A 1J09A 5KVRA 1Z7LA 3ZXSA 4XRSG 3FHZA 3S1RJ 3DKXA 2HOAA 5HDKA 2F5CA 5M5XJ 2JA2A 3D5SC 4GYGA 3TOBA 5D8KB 4LK0F 1LDJA 2A61A 3VSLA 3A2KA 2L9RA 1IXRC 1UZCA 1WWXA 3TKYA 4KITB 1QPIA 2O5RA 1GLNA 2HXOA 2IGKA 1MDMA 3HC7A 2K3FA 4Z2YA 2H6BA 1I27A 4RB3C 4G8XA 1XMKA 2CQNA 2YUSA 3AAFA 4HOBA 1AWCA 4QTRA 2KISA 3MVPA 4BQOA 1VQ5I 3EYYA 2ZXWH 2K85A 3QYBA 2CV0A 3D0SA 3CCYA 2CW7A 4M3FA 4IX7A 2KDOA 2DA1A 4G7HF 1LE8B 4Y52J 3S2DJ 1B72B 1I50J 1IC8A 2EA2A 3ISPA 4E70A 4UVBA 2VKHA 4LB5A 2L2OA 5FGMA 2MABA 1MBGA 2GAUA 3H0GJ 5FROA 2YU9J 2QQ9A 3E5XA 4FISA 4HW0A 2P0WA 4UHTA 3L2UA 2KZVA 3R6SA 3UNGC 3WE2A 2X85A 2HKXA 4CUGA 2JK3A 1O3QA 2DOEA 5E1ZB 5LEJA 1ON1A 1YITI 2KQRA 2Q2EB 1P9QC 5D5WB 1FBQA 5DUKA 4B1RA 4A3KJ 2DA6A 4O3MA 3ASOH 2G0EA 3NRVA 1S72I 4XM3A 2ADUA 3FXLA 5HOOA 5ED4A 1XC5A 3CUOA 3KP2A 1YG2A 5AIPA 3T8TA 2JPCA 1YHQI 2LBFA 3CUQA 3VPRA 1ZGAA 3SFIA 2E1CA 4CXFA 3KLNA 1R22A 3VODA 1IN7A 1WQ2A 1VQ6I 5HS7A 3SZTA 2XSDC 3RKXA 4RAYA 4XORA 1X1PA 2K9MA 2E35A 4EATA 2O3FA 1SVOA 2O8XA 1HXDA 2DMQA 2HYJA 3K4MA 3H35A 3PSIA 3SQNA 4O5VA 2O61A 3I53A 1HQCA 3RDIA 2X6YA 3C2HA 2XGCA 1WZ2A 4LOCA 4YIIA 1AU7A 2Z3YA 1LPQA 3WE3A 4A0YA 2XDVA 1J5YA 3S15J 3KYLA 1P4XA 2OU2A 3NAUA 4L0YB 2JZYA 3M7GA 1E2XA 1I1SA 3PL8A 2VOOA 1KGSA 4XK4A 2M45A 1U8RA 5FKNA 4I0AA 4UXNA 1AA7A 3SFZA 2QKLB 2VQLA 2W85A 3ROUA 1A35A 1GVJA 1T39A 1WJEA 3CC7I 3H9JA 4X6AJ 4PFPA 2E1MC 2E2HJ 2M2EA 2QENA 1EA3A 3ABTA 1T6SA 2E2JJ 3JAMK 3PJRA 3KFWX 2CGPA 4PFOA 3RYRA 2HQNA 4A3GJ 2VUMJ 2ZMEA 2OF7A 2MD5A 4E6KG 1JKPC 1W4MA 2PBIA 4A0XA 4FASD 2AO9A 4BL0B 2RKHA 1D0ZA 1BL0A 5C4XJ 1IUYA 2L7MP 2H94A 5B1BH 1I1GA 1TT5B 2W57A 3J81K 3F6OA 3BG9A 3V42A 1MJ9A 1R5GA 4MTDA 2F4MB 4YELA 2M8GX 2DA2A 2TRTA 3CUQC 1Z6RA 4L9VA 1D0YA 1SAUA 4PUSA 4LG3A 2ZJQF 4HA8A 1R49A 3OMYA 3DFGA 4M74A 2K02A 4EM0B 3DLLF 1NK3P 3K2ZA 1PUFA 2LFBA 2COMA 1SMYF 4ZZDA 3ZQ7A 3GX4X 4YIFA 4UUSA 5K5RA 1ZYRF 4JYKA 3W6JB 1GVDA 1FEXA 2EK5A 1SFXA 4HRIA 4IHXA 4IHTA 1X3UA 2V4JC 3LNQA 4YRVA 4XR6A 2R5YA 2O8KA 1SVMA 1XCVA 1DP3A 2FQ4A 1OCOH 2EH3A 3BWGA 5LEKA 4WXDA 4ZDPA 3F3XA 2ELHA 4ANJA 2QCOA 5J8FA 5K1YA 2QUFA 2VI6A 3M8JA 2WC2A 2ELJA 2EFWA 2EV6A 3MN2A 5FJ8J 3ZN0A 1SD5A 3DEEA 4HNUA 4RGUA 3V7SA 5CVRA 1L0OC 5F1RA 2LY2A 4KT5C 4D7NA 3P7NA 2DMUA 2ZB9A 3V7CA 2HFHA 1Y56A 4RBOA 3OYLA 2IP2A 3S16J 3BG7A 4CZCA 4GFBA 3OYAA 2CW8A 3M1CA 3GTKJ 5BS6A 1I3QJ 3JRIA 3BPVA 5CVIA 1WH7A 2ZMEC 3ASNH 2JRMA 4II2A 1LKXA 1XS9A 2XF6A 5GPCA 2NS8A 4A3FJ 1TLHB 3DU5A 4KJZA 4Y3OA 3VYTB 2QSGX 4BBSJ 2FMLA 1YS6A 1KQ9A 3LFKA 3ZMVA 4IHSA 1W7PB 4HF1A 3E3VA 5K5QA 1Q1VA 2AXLA 4WXCA 3LQRA 5BQTA 5LLQA 5M5WJ 2NRAC 1FIAA 2WTEA 4A3CJ 4E4HA 4D1QA 2C6YA 1MIJA 3FXRA 3Q9VA 2K9QA 5DEQA 5LGTA 1TBXA 1OR7A 1IGNA 2BGCA 4EM2A 3LSKA 2EWNA 2ICWG 1ZG3A 2FQ3A 3BCAA 2RQPA 4II3A 3ABMH 4QWQA 4M9ZA 2WY8Q 5K7HA 1YIOA 5EGOA 3HSEA 4RM3A 3JREA 2NNYA 4Q5SF 4J01A 2N8GA 4KYWA 1JE8A 3KEYA 5J1RA 2IRFG 5L3CA 3OIOA 4HSTA 5BPIA 1T08B 4EVIA 4JQFA 3ZGKA 3P9CA 1G3YA 2WWYA 1LUJB 1QVUA 1FTZA 1H88C 1WJ5A 3OYFA 1VF9A 2XF7A 4CCKA 4RGSA 5EF6A 1FT9A 4N0BA 3JAMZ 2ACJA 3G73A 1GT0C 1G59A 3HOUJ 2QWWA 1S6LA 1N75A 4PDKA 1TWGJ 3I59B 2O9LA 1W5TA 1YW8A 2A05A 2Q8KA 1ZGWA 3W2AA 2DMNA 3PM1A 3MKWB 3PNTA 4RB1A 2X9DA 4N4NB 4XSXF 3CDLA 2R7ZJ 3VYRB 4NHJA 1R4NB 3OS0A 4LJZF 4NQWB 1FWZA 1LVKA 2K9LA 3J81Z 3M4OJ 4EEFG 4FHTA 4JP0A 2R7SA 3K0LA 2GA2A 1RKWA 1WH5A 5IYBJ 2JMWA 4S0HB 3SEQA 3SYTA 1OCRH 4Q48A 3OYEA 1G3WA 1HLVA 1BJAA 3QODA 1Z05A 2NS0A 3FZVA 2UV1A 2JUCA 3Q3SA 4A3JJ 2PX9A 1OR7C 1A5JA 4RDUA 1L3LA 1T95A 3PO3J 4A3DJ 1YX5A 2M3AA 1BI0A 2MG4A 2MYSA 3P5JA 3RKYA 1FSEA 1D1BA 5F0CA 4JK1X 3GZ5A 4XONA 4R8HA 3DCFA 2K3PA 4GXOA 3LFUA 3KP3A 1HSTA 1OMIA 2WBMA 2OQRA 3S2HJ 1H0MA 1PYVA 4L0ZB 2VBXA 1SD6A 3F9KA 2K9SA 2V6CA 1MBFA 3ESWB 2DPUA 2DBBA 2EIKH 3S32A 5J1UA 3WTUC 1NH3A 3N4MA 2VJ4A 2XB0X 2XAFA 2KIFA 1RESA 1HSJA 2GXGA 4M6YA 2DPDA 4PJNA 1X3WB 2B7EA 5GPAA 2W48A 2GXAA 1FNNA 2IAIA 3SDBA 1T98A 2L9NA 2PG4A 4GYIA 1KQ8A 4HF2A 3HRSA 3KETA 3LAJA 1O3RA 1UFMA 3GTLJ 5EG0A 3E0JB 1B8IB 3DTEA 1V55H 3CJQB 5J47A 3H3VK 2X6OA 2F2EA 2HZTA 2V26A 3FDYA 3ULQB 1YRNA 2MSYA 4V19K 1MGTA 2DTRA 4F3QA 1RC9A 1XGOA 2KIUA 1MJAA 4ZYHA 5HS9A 3KIOA 3BR6A 3RPUA 4L9NA 3GFIA 1SFKA 2NXNB 3FWEA 4U0VA 2BY0A 3IKVA 3KYDB 3D5RC 1D5YA 1R23A 2DDBA 2QEXI 4KMFA 4V2GA 3A0BC 2K4BA 3RZDJ 2O7OA 2B63J 5E1WA 3O6BB 3MZ8A 3OIPA 4N9HA 1DPRA 3X2QH 1G2HA 2DU9A 4D5FA 5BOXA 4ON0A 4M3EA 3SHFA 5ICEA 2LDUA 3I5UA 3DP7A 4PJLA 1H9TA 3RKQA 3OS1A 3OSFA 3FKJA 1OISA 2QQAA 3FBNB 3HSFA 4IRIA 4RGRA 3CD6I 3D5LA 4RS8A 4OMYA 1M1EB 2K5CA 1RNLA 2JPBA 2UUZA 2XAHA 1S29A 5D4SA 1ORKA 5IYCJ 2NVQJ 4NDLA 1TNSA 3OYGA 2BYVE 2ZJRF 2EFPA 3ZR8X 3BR0A 4A3MJ 4PGGA 2WAFA 1P4AA 1SD4A 1YYVA 3L09A 4KMUX 4BACA 1AKHA 3ZQGA 5E3MA 1FPQA 2Y9YA 2CH0A 2MW8A 3WODF 1K83J 5M3MJ 2L4MA 1HW2A 2FX0A 4L5EA 1XD7A 2M7AA 4LGWA 1TWCJ 2ZSIB 1J59A 4ZYDA 1RUNA 3FXUA 1XGMA 2LY1A 3OYCA 1WJBA 1K4SA 4OAYA 3H9GA 3PFYA 1U9NA 2HOTA 4D5CA 2VJ5A 3K70C 4CH7A 1U2WA 2PMHA 1OCZH 1Y0NA 1IV8A 2FF4A 2GBYA 1ZG5A 3SJMA 2EBIA 1TT0A 5TGTA 2RNGA 4FX4A 4JBAA 3FXKA 1Z1DA 1EF4A 3HGGA 1SFOJ 5E1XA 1SVLA 2GA1A 4B09A 2OBPA 2XC7A 2JA8J 3K4KA 4G7OF 1TTYA 2R7VA 2X1DA 4MQ9F 2KJBA 1QNTA 2A6HF 5HVQC 5CVJA 3ZQFA 1ETYA 3WTYC 4HNVA 1YW9A 3NWSA 1QBJA 3OYHA 1WJAA 2HZDA 4C30A 4XRMA 4BDZA 4BXXJ 4UB8C 2P5KA 1W5CC 3BJ6A 3S8PA 1XPXA 2DXIA 2EV0A 2V1NA 5DCMA 4RB0A 5GAGJ 4OIOF 3AKZA 4HDVA 3T0YA 2VBZA 4XRFA 4BDYA 3DKWA 2XPUA 1S5LC 2LP0A 2XUBA 2DFHA 2FA5A 2A6EF 4M3BA 1R1VA 2BY2A 3PSFA 2WY7Q 2XRLA 1QHHD 2PJRB 1B1BA 4PJJA 2HI3A 3FXQA 4IKFA 1LVAA 2L5QA 2D1HA 2L7KA 2ZNYA 3E5QA 3QP6A 5JHFA 1VQOI 5IY5H 2CV1A 3PQJA 4U7DA 4IHYA 2QF7A 2LOOA 2XPWA 2R5ZB 1JTYA 2BOLA 3A4CA 3GXOA 3GVAA 2IGNA 3LSIA 3BCBA 3VYSB 2PN6A 5DDGA 4AU7A 3BR5A 2FNPA 3GO5A 3HRTA 1UELB 1NTCA 1WJDA 3GLLA 3MKLA 1IF1A 2ZJPF 3R0JA 1JKOC 1LFBA 1Y1VJ 1TP4A 5TJJA 5CLSA 4L9JA 1G3TA 2W84A 3OL4A 4XLNF 5D8LB 4R79A 4G6TB 1IG7A 2CO5A 2LYCA 3VWBA 1X1BA 2VXZA 2NOJB 4LLLA 3WG9A 3MAJA 2R7XA 4A0ZA 2NAZA 2ZJ2A 2W00A 4HEA2 3G71I 2QLZA 3GUDA 1JHHA 2FMYA 4AWXB 1DQUA 2E1NA 2DCEA 3RJPA 4M6XA 5HNHA 3KZIC 3GFLA 3VFZA 4Q4ZF 5LRRA 5GAEJ 5DS9A 2HQ5A 4E7KA 2LR8A 3PFIA 1UG2A 3WTTC 5LGUA 5HODA 1MD0A 5DUIA 1JJ6C 2ZFWA 2VBWA 3L2CA 1JHFA 1YX3A 1MH3A 5LHGA 1ZR4A 3OY9A 2HVSA 2IT0A 1EJ9A 2NOGA 1BI3A 4RAZA 5FFZA 4XRSA 5HS8A 1JKQC 3A0HC 3A02A 2XB5A 4M9XA 1VFCA 1T0FA 3DBLB 4G12A 5CJ9A 3ZQLA 2BHZA 4XLFA 2CQ7A 4M72A 1ZG1A 2UXXA 4YG2F 5IP9J 3TQNA 3JTHA 3OOPA 5J4YA 3DF8A 2X6XA 2F4IA 2A07F 1MDMB 3CCSI 1ON2A 2FSWA 1XDSA 1R36A 2IGOA 4HBLA 2KRHA 5FKMA 4P9UA 1U0JA 2ID6A 4XL9A 3TL4X 2DT5A 3G1MA 4E7SA 4E7ZA 1ITYA 2Z5UA 2IPQX 1FOYA 2E1MB 2Y0MA 1FMWA 4A69C 2ZNZA 1Z91A 1YJNI 2OZUA 2EQRA 2NVXJ 3Q0VA 4K2EA 4C2MJ 2DN0A 3KYCB 1FJLA 2PFBA 1N25A 1U3EM 3CTAA 1BOBA 3JRGA 4ZYAA 4BHBA 1WJFA 4ESJA 4EGYA 3K6GA 5DV5A 4E7JA 2OQGA 2RN7A 2ZC2A 1EH7A 2DI3A 1ZAOA 2OD5A 3BJOA 3HHGA 1BBYA 1MKMA 3TW6A 4HX8A 1ZKGA 1ZN2A 1RI7A 2L4AA 3VYUB 2GQQA 1I39A 1BC8C 3WTVC 1ERDA 4ZH4F 1XX5A 2LBFB 3CUQB 3K2AA 2M30A 2EV5A 4GO1A 3K4CA 3BT9A 1F36A 4CYCA 3V8LA 5JFRA 3EQLF 4W97A 5IP7J 2JA7J 4DYCA 1MMGA 3AL0C 2F6CA 1QPMA 1G3SA 4OMZA 2YS9A 1IXSB 1XG1A 4BE1A 2L9VA 1U5TA 3O8GA 3RTRA 2MH2A 3P9KA 3BZ6A 2MLKA 3CP2A 2AS5F 4FE4A 2A69F 2DO7A 4A5MA 2M0CA 4HQEA 2ZSHB 4ZTFA 3HZJA 1LFPA 4F55A 4HV5A 2PQ8A 3MD2A 1ZGJA 1E3OC 3G3ZA 1LQ1A 2KRFA 2Z16A 4FX0A 1T33A 1ZLJA 3EUHA 4HZFA 1MH4A 4EM1A 3HOYJ 1TNTA 4P55A 4AD9A 1IRZA 3WTWC 2VIXA 3K10A 4X0GA 4DJAA 1X58A 3DQVC 2HTSA 1OYYA 5BPDA 4XLHA 4EJWA 3C2BA 1SEUA 3MZHA 4NNJA 3GTGJ 3BR2A 4XIDA 3N97A 2EILH 3HHHA 2HYGD 3CJNA 2A5WA 2ZMEB 2O03A 2DT7B 1X1DA 3LSMA 4O6JA 1UHMA 4X1EA 3QU6A 2Y2ZA 1ETQA 2R93J 5IT9K 5B5EC 4CDGA 2KPMA 3SDGA 1ETOA 2Q2EA 4A12A 3JCUC 2RC4A 3I55I 3IKTA 4A3LJ 3W6VA 2H1KA 3CMEI 2V1UA 5D6EA 2DA4A 1IN8A 2DMPA 2HPMA 1G8XA 1D1CA 2H27A 3OYBA 4L18B 5HDGA 1IZ1A 1KU2A 1V5FA 3MWMA 1RETA 2EB7A 2QZ8A 4MGRA 4KNYA 5E17F 2BEOA 3HL2A 5IPAA 1O4XA 1DU0A 3QPSA 1LDKB 3BC8A 3GZNB 4UUSB 1ZK8A 3IRQA 1S7OA 2LC2A 1U5TC 1S7EA 2EFOA 2CFXA 1KQ0A 4IEJA 1R9TJ 1RIOH 1MSEC 3PNVA 3ZPLA 2M9HA 4PGHA 3OYDA 3KX2A 2R5YB 5AIQA 2LRDA 2M34A 3P9IA 4I98B 4XNFA 3E7LA 3BPXA 2RNJA 3IAM2 4IPAA 3U2RA 4UB6C 3GCMA 2LLKA 2VKEA 2LNBA 3PUFA 4N4OB 3BP8A 2LF8A 3E1SA 4A6DA 3OR1C 1ZRFA 3EUHC 4LIVA 1Y1WJ 3QPTA 1ETXA 1HW1A 1MJBA 4M3GA 1UHWA 4E7HA 2Z9OA 1ETWA 2IGMA 2ECBA 2FD5A 2KMUA 3KZYA 3EYIA 2R0QC 1W36D 1LJ9A 4YFNF 5LRSA 1U8BA 1HKTA 4DGWB 2NVYJ 5J4VA 2BY3A 4JX6A 1F4KA 3F23A 4DNCA 1HOMA 4QPOA 1BJZA 5IOZA 2MFZA 2XGXA 1AHDP 1IO2A 4Y13A 2IS4A 4PCQA 1R6RA 2LF7A 5HDNA 1HKQA 3ABUA 1V5GA 3FXJA 3BR3A 4C2UA 1QZZA 3LA2A 2F5FA 3GF2A 5GAHJ 4CCLA 5FKOA 3FXMA 3BZKA 4IQJA 5EEGA 5IP6A 4LG0A 4U88A 5DYMA 4BY1J 3G6EI 4KIGA 1APLC 1FY7A 2R7DA 4WK8F 2CFOA 1OFCX 3C18A 3C7JA 3H9QA 3R0AA 2EIJH 4DIQA 1VQ9I 3I71A 5LHHA 1OQYA 3E97A 3PQKA 3VOEA 1TQPA 2RREA 3HYIA 5E3OA 1WPKA 3W2VA 3QOPA 1PUEE 3W2WA 3K1MA 4Y4RA 3E6CC 1W7PD 1FSHA 1ZELA 4FETA 3UKGA 4D0PA 2OUMA 2P8TA 4BGDA 3B02A 3DEWA 5EGOB 2VQGA 1OCCH 2Y75A 3BTCA 1O7FA 4BHPA 1W0UA 1X1AA 3OYMA 4ZYGA 2ELKA 2PEXA 1VTNC 3GTPJ 4ABZA 4XKWA 3G4SI 1MMSA 3Q5FA 3S3OA 2BV6A 2WAEA 3S2WA 2MD0A 1MNEA 4PSWA 5F04A 1QVTA 1IRFA 3H36A 4RAGA 2IXSA 1RR8C 4HNTA 5ICGA 5GTHC 5K7FA 1K78A 5CQEA 3CDHA 1A6QA 1ZQ3P 1QO0D 1Z77A 2ZBKA 2VC1A 1GXPA 1X19A 2VKDA 3J7ZI 5FB2A 5GADJ 1Z6TA 3HOXJ 2EZLA 4NB5A 1ZRCA 2BZTA 2AHQA 1WSUA 2L01A 3I56I 3OYIA 4A3IJ 1J9IA 2Y30A 1G4DA 4F91B 1IN6A 2OJED 1SANA 1MBHA 4EJOA 1UG0A 3ZQIA 1SAXA 3LWFA 3ABLH 3A01A 1C0WA 4XKBA 9ANTA 4GDFA 2P4WA 1E3PA 3JTGA 3BOQA 3HGYA 2LSOA 5BMZA 1JGGA 1CQTA 3NWTA 4KA4A 2EFNA 5H6QA 2R92J 3OS2A 2OTLI 4M6VA 3WHCA 2OAZA 4BJ6C 3HEFA 3IP4B 4C3HJ 1NG7A 1SD7A 1HW5A 1R5ID 1YFHA 4MFEA 1P6RA 4MEXF 4LK1F 2JA6J 2FOWA 1TQMA 2LH9A 2XF5A 4BU2A 2CUJA 2QQBA 4S05A 1TL8A 2G9WA 3J7YJ 3L2QA 1XSVA 3CCEI 3ZMUA 1EV7A 3CESA 3QYFA 3FF5A 1YJWI 3JRCA 1TQIA 3CLOA 2ME0A 3I9V2 4XKCA 2KKOA 1I3AA 2J5OA 5FD6A 3K4LA 4XOTA 2H1LA 3K7AJ 4BY7J 5DD4A 2PJPA 1LFUP 4CSWA 4MHGA 2JJ7A 2HS5A 5LBQA 3Q0WA 3CQZJ 4ESFA 2JVHA 2O6GE 2VONA 4BEHA 2CSOA 1YI2I 3RYPA 2HOSA 3RQ4A 2K27A 3H5AA 2V9PA 3JSOA 3FM5A 1V5EA 1WVRA 2P7CB 2EA4A 2A3SA 2HOEA 5F6FA 5EG0B 4MQVA 1OCPA 2ISYA 5IYDJ 1FBSA 1XCBA 5KAIC 4CHUA 3VSKA 1YRNB 1B9NA 2MGQA 1V3FA 4DZJA 2UWMA 4EGZA 2QQ8A 3LMMA 1IJWC 1Z21A 2R7WA 2KRCA 4B47A 2VN2A 3REOA 2CJJA 2BBYA 4BQQA 3B73A 2IBDA 4FQGA 4FCYA 5TRDA 4Y15A 2ETHA 2K7LA 3FM3A 1HBXG 3QWLA 3LSTA 3OL3A 4I2OA 1PVEA 1FC3A 3DLAA 2F5DA 3F8CA 1K6OA 2JWTA 1UCRA 5LD2C 2ESNA 4IXAA 1UB9A 4IJAA 3PIOF 1ZARA 4OIRF 3AG3H 4IVNA 1HC8A 4CCOA 1R1TA 1STZA 1KONA 2E36A 3DXJF 5AONA 3L2WA 2STWA 4AIJA 1R71A 2JN6A 3TEDA 3COAC 1YLFA 2R7TA 2ISZA 2BW3A 1PJRA 2ZXHA 2KHMA 3A1YA 4OAZA 1NG6A 3VDXA 2XHKA 3S17J 4UUTA 2VB6A 2R3SA 1H89C 3ZOBA 1JUSA 2GOXB 2E34A 3HOSA 4Y33A 3I58A 2CV2A 1R4MB 4XSZF 1AKHB 4HSRA 1PDNC 4A3BJ 1SFEA 4FT8A 3WGHA 3F6VA 1KU9A 3TDUC 1RZ4A 3LL7A 4YEJA 1RKTA 4YFXF 1QGPA 5JHUA 2DFIA 3DPLC 2M87A 4M73A 2KL4A 5CVVA 2FBKA 2W7NA 4UY8I 1YIJI 5EYRA 2NNNA 1Z0XA 1YO5C 4EQQA 1GV5A 2JT1A 4B44A 1CF7A 1MBJA 2X4HA 5CVUA 3FKIJ 1V4RA 5J1YA 1ZLKA 1DPUA 2XKPA 1VQ4I 1IUFA 1WRJA 1VI0A 3CO6C 2QBYA 3I4PA 3IH2A 2ZXJA 2X6WA 4C3JJ 1P7JA 2JTVA 3FMRA 3FK7A 4AYBN 2DT6A 2XGEA 3HSRA 3NARA 4BUPA 3L00A 1S7AA 3HJEA 4HAMA 4AIHA 4DZPA 4I76A 1PP8F 2GXBA 1O7LA 5CPRB 4EJTA 1Y8RB 1YS7A 2EZHA 2VBYA 4I99C 4BE0A 1FYMA 1O57A 1JGSA 4LFUA 4BKXA 2L54A 3R60A 5HLIA 5LFAA 1J2XA 3BROA 3H5RA 3IH4A 1R00A 2K9NA 3KP7A 4DOZA 1B6AA 2BY1A 3OR2C 4OINF 4QLCU 3GZ6A 5DCMB 4RM2A 4IOCF 2V7FA 1VNDA 4L9TA 2GM4A 3PO2J 3O8HA 2DK5A 4A2UA 2E7XA 3FMQA 1GHCA 4NC7A 3K1PA 5FKKA 4J00A 1FYKA 1FP2A 5L3EA 2IS2A 2EZKA 1ZR2A 4IRGA 4UV9A 2P5LC 2VPRA 1JI8A 2VOPA 2R7QA 5DCFA 3TMOA 3HPHA 2IVMA 4MIMA 1MBEA 5CKTA 4Y7NJ 2V79A 3ZQCA 3ONQA 4I6ZA 3U21A 2LK2A 2DODA 1MBKA 4F7ZA 3SZPA 4RB2C 1JTXA 1X3ZB 1REPC 4LD5A 3JRAA 1K4TA 3F8BA 5J3LA 2STTA 1H9GA 2DYRH 2QA4I 1YQAA 1Y39A 4DBQA 3CCQI 2QM3A 2YR2A 3K1NA 1BN5A 4AUXA 1DGWY 3TDZC 1VQNI 4U7BA 3ZMDA 1IDYA 3JW4A 1FOKA 3IHUA 5E3LA 5H2FC 1R1UA 4CCJA 4U87A 3J7AY 2WV1A 2RDPA 3CC2I 4KICA 1D0XA 4A6EA 3V8JA 4BXUA 4I0BA 1YJ9I 1WCMJ 1IRXA 1FOWA 2FJ1A 1P4WA 5FLVA 5JVTA 2H8RA 3IUOA 2LD5A 3C3WA 1BI2A 1XGNA 1BR4A 2QYOA 4RGXA 5E20A 2JRTA 3CCJI 3S1MJ 2HU9A 2H09A 2O0YA 3QPLA 1JT6A 4L5JA 3BQYA 2FRHA 4P96A 2OZ6A 2HVRA 3AL0B 1VQ8I 1D1AA 2VPLA 3DTKA 3I54A 2K4JA 5LHIA 1TW3A 1ENHA 2R7UA 2A6TA 3ERED 1F1ZA 2D45A 1LNWA 1S3JA 3BLYA 4I7HA 2VE9A 3F72A 1HDPA 3M07A 2WB1N 3OYNA 3HOTA 2VASA 3I3LA 3BG3A 2Y0SA 2Y31A 4EV0A 3GBGA 2LKXA 1ZHFA 3V4GA 2OC6A 1FYLA 3KLOA 4H4KC 3HDDA 3TOAA 2V9KA 5B3SH 4HDUA 3ERMA 5FRNA 2JA5J 2ZFUA 4UVAA 3NEUA 4LITA 1D3YA 4BYYA 3V7RA 5J6XA 3KP5A 1USTA 2CRGA 5ICCA 1IN4A 2M5WA 1WHUA 3BTIA 3HUGA 1R5HA 4OOIA 3SEZA 4WCGA 2HKOA 1XGSA 2DAOA 4DBRA 3QAHA 1S9HA 3GW2A 4G6QA 2WV0A 3DBRB 3NQOA 3ZQHA 4BJ5C 3CMAI 3HBLA 1A04A 3DV8A 3MFKA 4FTHA 2HWVA 5HLGA 1XDUA 4MTEA 1MNDA 2VE8A 2FNAA 3O2PE 2R7OA 4D7MA 3RQIA 2VXDA 3CCUI 1D5VA 4ENKA 1P2FA 1V54H 1U9OA 3IV5A 4LLNA 1W5SA 2KIMA 3S1QJ 1E17A 2KFDA 1P7IA 2JSPA 1OJLA 3Q9SA 3GTOJ 4P5OA 2E19A 4G94A 4M3DA 5IT3A 2PMZN 5ILVA 1ONVA 3KEQA 1FBUA 1MW7A 2P6TA 1R7JA 5ERIA 2M0MA 4RAFA 3JRHA 1DUXC 4XBFA 3DU6A 1K79A 3BDDA 3OSGA 5F64A 1IN5A 5M5YJ 4CYCB 3RKWA 1F9NA 4CYDA 3BTLA 2RV8A 2GZWA 3JR9A 2JVGA 4F93B 2HQAA 2HVQA 2X1CA 2F4OB 5L3GA 4I09A 4BNCA 5HNFA 4CO8A 4HX4A 5ILSA 4AVZA 1U5TB 3QP5A 3L9FA 2DOFA 2KP6A 4XQFA 2H6CA 1GUUA 2DA5A 3QU3A 1QU3A 4PJ0C 2QVOA 3H1CA 1AOYA 1QZYA 3AG2H 4B43A 3SXYA 1RPWA 3A03A 1WJCA 2UZKA 2YPRA 4MLOA 3VEPA 1VZ0A 3F21A 3LSHA 3H5NA 3ZCOA 2FEZA 3WTXC 2DA7A 2P6SA 5E18F 5FO5A 3TO6A 1T2KA 1ZH5A 3ZMSA 3LQQA 4HF0A 4YFKF 1HDDC 2DQRA 1JUPA 4CGZA 4IZZA 4CCNA 3AG4H 3E6BA 3GYHX 2BVLA 2W24A 3Q0UA 2K40A 1T0FC 1Y6IA 1QHGA 4H0EA 5FKLA 2Y48A 4BJTA 2B0LA 2HPIA 4XN0A 2E60A 3PUBA 4XICA 5BNGA 1HF0A 3HRMA 3ZP5A 3BR1A 1Y0UA 2E5ZA 3FISA 3HXLA 1POGA 3K9TA 1J75A 3IC7A 4AIKA 1H8AC 2EINH 3G2BA 1GXQA 2OPTA 4QIWN 3F0CA 3RI4A 4XN3A 3HPGA 2EPFA 3MMYB 2VJIA 4OIQF 4J19A 5L3FA 1KA8A 2ID3A 5CQGA 1LE8A 5K5OA 3M8FA 3GTMJ 1B72A 2XASA 1BIAA 1EKEA 4XKVA 4A3EJ 2L0KA 1JUMA 4KN4X 2KIQA 4UV8A 1GDTA 2JQ7A 2ECCA 2PLYA 3DKYA 4KUMA 4U0WA 2JSCA 2RGVA 2WADA 1NHAA 4JX4A 4BXFA 1Z3XA 4NC6A 5KK1A 2VLAA 1LB2A 2DFEA 5B1AH 4WX9A 3JSPA 1Z3YA 4BAYA 3GMEA 4R1HA 2M7BA 3PNYA 4NBQA 1KYZA 1X4PA 4AYBA 1ULYA 3CLQA 4I01A 4EMSA 3S14J 1CGPA 3WU0A 5EZGA 3OOUA 1KYWA 2D2WA 4HPQA 5JI6A 5DTDA 5F0HA 3O3KA 1PUFB 2XV4S 2V6EA 3J7AO 3GFJA 3OYKA 2AXTC 3ML6A 1MMNA 2HTJA 4LMYA 4WXHA 2HQRA 5D5XB 2OTJI 4B8XA 1LEAA 1BR1A 3HG9A 3T5XA 4EJVA 4IF4A 5EJCA 3KCCA 1J7KA 1KU3A 1QQIA 3IWZA 3MKYB 2D1VA 2L7ZA 4MFDA 1DDNA 3IWFA 3CF5F 3K4JA 2BXZA 2ZXIA 1ZRDA 3EDPA 2OV7A 3J80K 1HCRA 5EEHA 3EUKL 1IV6A 2IA2A 1NK2P 1BI1A 5FD5A 2L02A 3M9AA 2NS7A 2L3DA 3DEUA 3HTSB 4I02A 4KT6A 4DQ2A 1E0EA 3TBIA 4TV7A 2X48A 4LG0B 5H6RA 4S04A 1SC7A 2A5YB 4JOMA 1BC7C 1YW7A 3LA7A 5EZHA 5C4JJ 5JR3A 3GTQJ 4NC8A 3LA3A 2X1EA 2VT3A 4GRIA 4IO9F 2HDCA 3RPQA 3FXOA 1DP7P 1GV2A 1KZHA 1RUOA 5A2QK 1UJ8A 1J0RA 5B66C 3U1DA 2R7RA 2G7HA 2E1OA 1ETKA 1HKSA 2E2IJ 4CCMA 3CMYA 4AC0A 2CQKA 3JRDA 4G6DA 2F48A 3I0TA 5D4RA 1FMVA 1JJ8C 1XSXA 1K78B 3SZGA 2FE3A 4XLCA 2M4GA 1F43A 3WTSC 2MA3A 2RVCA 4LIUA 4RMNA 2KDZA 2RQQA 2XSJC 3R4KA 4MO7A 5FLXK 3LAPA 1BIBA 3K4NA 2OCEA 3BJAA 4RLQA 5GTIC 3G1LA 5LGNA 2Y9ZA 4P1WA 2WB1A 2DTZA 3HM5A 5FRMA 2ZO4A 2LY9A 1YE9A 3GLXA 1XMXA 1W1WE 3W3CA 2IEKA 4BS9A 3MKZA 3QOEA 5CYVA 1WFXA 2VC0A 3QRFF 2CQXA 1A31A 3A01B 1UAAA 1UHSA 3RSNA 2FBIA 5ICFA 3KP6A 3OIQA 4HV6A 1LDDA 2FU4A 2LKSA 4QSHA 3ZN1A 4ASNA 2F5VA 2DJIA 3JRBA 2Y69H 4Z6YA 5DM6F 5IT9Z 2Y0SN 2GIVA 1A36A 2X51A 1JT0A 2CUZA 3B6CA 3ZQQA 1FZPB 1R58A 2E7WA 1X1CA 4GGGA 2IW5A 3HKZN 2DDAA 1W7PA 3HB9A 4PK4A 4LB6B 4BE2A 2DW4A 1LEBA 1MSFC 4A93J 3B6AA 1XSDA 5F27A 3W6KB 1OCTC 2PMZA 1SFUA 2CW0F 4KN7X 1FOXA 3DPUA 4NUBA 1RRJA 3GEZA 2F5EA 5H20A 4KISA 5EEAA 1IW7F 3MZYA 2HYFA 3E6DA 3KZZA 4BEHB 3F8NA 2L7FP 3G1OA 1TWFJ 2WAQN 4A5NA 5FFXA 4HG2A 3M8EA 4ENNA 3ZMTA 2MH9A 2W4SA 3QQAA 3H3UA 4ZDOA 1DGRM 3CF2A 2RAEA 2DQLA 4BHCA 5KNLA 1JXSA 2XVCA 3FK6A 1W36C 5E3NA 1FP1D 1I5ZA 3WHBA 2W82A 4HLYA 1Z67A 3CJTB 1K61A 3MQ0A 3J80Z 4PZJA 4RLFA 1XTAA 3KPHA 5L3BA 1K7AA 2X0LA 3TO7A 4B48A 2LMDA 2MBFA 3CMMA 2MC4A 2KT0A 1WKMA 2Q0OA 2HDDA 4M9SA 1MNMC 4AM3A 1ACIA 2OCCH 3WU2C 1DU6A 1MMAA 3U9GA 2KLOA 3S3MA 3IH3A 4Y17A 3C2GA 2KJCA 3K70D 3H92A 4OIPF 4V2FA 1OKRA 5C44J 2A68F 3I64A 1N78A 5M3FJ 3I59A 2LKPA 5JLWA 2MC3A 3T8RA 4BBRJ 3UR3C 1USSA 4MNUA 3BQZA 2HXIA 3RPUD 3LSPA 1TZLA 3K69A 3GFMA 5A2QZ 5E8GA 2EJRA 1IRGA 2QSFX 4HYEA 4LLGF 2FUG2 2EFQA 2P7VB 4CA0A 1X2MA 2BW3B 3S1NJ 4NQWA 4ENMA 1OPCA 3AFHA 3IL2A 3BTJA 2XAJA 5JVGF 1Q1HA 1QRYA 3HTUA 2XROA 1ZTRA 2EZIA 1A6IA 4KIFA 3M3YJ 5KHDA 2DK8A 4B3AA 1ZREA 3RZOJ 3QPHA 4JX5A 2QGUA 3CCRI 2QSHX 3RCOA 2LVSA 5EDNA 2LREA 3DBHB 3CP8A 1UMQA 2V1XA 4XLAA 3DTIA 4PSXA 2VKVA 1QZEA 3CCLI 5FLXZ 2HNHA 2P5VA 3TP3A 5ILUA 4BQAA 1D8JA 2E5NA 1VQLI 3WGIA 1CF7B 1IDZA 1MMDA 3L2VA 4IQ4A 4E7IA 1WI9A 1EH6A 1U78A 1D8KA 2ZCWA 4GCVA 2VL8A 1KU7A 1PP7U 2QBYB 4ZYEA 1XMAA 3LSGA 2PI0A 1WGXA 2FOKA 5DD8A 2XGDA 4M71A 3DPTA 4KIBA 2GLOA 4C9YA 3F8MA 2W25A 1T8IA 2CG4A 3I4MJ 3V8KA 1BA5A 4CZZA 2DLLA 2BXYA 3WG7H 1HA8A 1U6GA 3HOVJ 2GWRA 1MZBA 5IOYA 2FBHA 3MCZA 3T1BA 1FX7A 2Z33A 1B8IA 4QPQA 4EJUA 3CCMI 2IA1A 3TO9A 1WI3A 2R7FA 2CWEA 3FIWA 3RIRA 3LSRA 2DA3A 1F5TA 2VJJA 5F0FA 2CYYA 2H8WA 1SMTA 3GWZA 4XMYA 2DFFA 3BZCA 5E8IA 5KAFC 3H0DA 4XOPA 3BG5A 1ODDA 1BM9A 2J5PA 1XN7A 1VQKI 2NVUB 4HQMA 5L3DA 4KFCA 3EPZA 2AQEA 3N05A 3VB2A 1Y8QB 2I8DA 2XAUA 2NYXA 3FMSA 4G9YA 5TISC 2HGCA 2LTPA 3FX3A 2WA0A 3MEXA 3ZRGA 2HR3A 2ESHA 5JLXA 1S8NA 2JUGA 3KEOA 4FE7A 1Z9CA 4B4CA 5F08A 3EUAA 3HIFA 2BHYA 3KE2A 5E79C 2Z2SB 3L7WA 2HEOA 3CCVI 3OV8A 1X4OA 2D5VA 3FBIB 3LOCA 4KDPA 2VODA 4ESBA 1E3HA 1TC3C 2Z1DA 3OWTA 2CU7A 3DWLE 3F22A 1OYIA 3CO7C 2G7UA 3WGGA 1RR7A 2XAQA 4WWCA 3IRRA 2R4GA 1TWAJ 3QYEA 3TW7A 4ZC3A 4HLXA 3E6MA 1YTYA 4L5IA 3TP0A 1BW6A 3M1EA 3CC4I 3BY6A 3JRFA 2M4KA 3E5UA 2B9SA 4MEYF 1TW2A 2AQFA 2MLGA 4ZTJA 2CUEA 4HX7A 1W0TA 3TGNA 3LSJA 1VQMI 1OYWA 2VQHA 3IAS2 3L2RA 3WU1B 4B3XA 1FTTA 1G6NA 2GOMA 3ECHA 1BOAA 1K6YA 1ETVA 2HDWA 2XKOA 3U1KA 2ME6A 4OWRB 6PAXA 3CDIA 4W1UA 4XLEA 2DJNA 4ITVA 3ABKH 3F8FA 3BG6A 4U0YA 4AIDA 1B4AA 4F52A 5K7ZA 3ZMZA 2EIMH 2YSRA 2ZKZA 1QA6A 1O3SA 4OU0A 3GTJJ 1T56A 2VQCA 4BQNA 2DYSH 3S93A 4DYQA 2XRNA 1VQPI 4F92B 5DM7F 4PJMA 1B59A 2P81A 2NVTJ 3HUGB 1I6XA 4AVPA 4E7LA 2I5UA 4IL6C 2YX4A 5GP9A 2CS3A 3S3NA 3R61A 5FLMJ 2TCTA 3H3ZA 4YIRX 2IA0A 2CUFA 2M1BA 3CZ6A 3K4BA 3ECOA 2CQQA 4D9JA 2QKMB 2XIGA 2DMTA 5KCMA 5D5UB 2COBA 3HOWJ 2PJRA 3HKZA 3KP4A 2OA4A 4IRHA 2YX7A 1X2NA 4DYRA 2BVMA 2FXAA 4UUVA 3PIPF 2PMUA 1T38A 2TDXA 2IJLA 3EETA 2IS6A 4ZDLA 1IXCA 4P9FA 2R5ZA 1FLIA 1P92A 2I10A 4C3IJ 1N77A 2K86A 3AG1H 3D1NI 1VQ7I 4UNOA 2KZGA 4N9IA 3L1PA 4ENJA 4C2TA 2V9VA 4UVCA 2VT2A 2WAQA 3HOZJ
chains in the Genus database with same CATH topology
1B9MA 4Q47A 3HRUA 4ETSA 5D5VB 2M8EA 5J8CA 4CICA 5D6FA 1EH8A 4XLPF 5HLHA 1O3TA 3ELKA 1XB4A 4BH9A 2BE5F 2YU3A 2V1DA 4ZZLA 2XAGA 4G7ZF 1Z7UA 4WF2A 1IAWA 3WTZA 3C1DA 2UXNA 2Z99A 5KVRA 3FHZA 5HDKA 2F5CA 4GYGA 3TOBA 5D8KB 4LK0F 1LDJA 2A61A 1IXRC 1WWXA 3TKYA 1MDMA 4Z2YA 2H6BA 1I27A 4RB3C 4G8XA 1XMKA 3AAFA 4HOBA 1AWCA 3EYYA 3D0SA 4G7HF 2EA2A 3ISPA 4E70A 4UVBA 4LB5A 5FGMA 2GAUA 2QQ9A 3E5XA 4HW0A 4UHTA 3R6SA 3WE2A 2HKXA 1O3QA 5E1ZB 5LEJA 1ON1A 5D5WB 1FBQA 5DUKA 4O3MA 3NRVA 2ADUA 5HOOA 5ED4A 3CUOA 3KP2A 1YG2A 5AIPA 3T8TA 2JPCA 3CUQA 1ZGAA 2E1CA 4CXFA 3KLNA 1R22A 3VODA 1IN7A 1WQ2A 5HS7A 3SZTA 3RKXA 4RAYA 2O3FA 2O8XA 1HXDA 3SQNA 4O5VA 2O61A 3I53A 1HQCA 3RDIA 4YIIA 2Z3YA 3WE3A 4A0YA 1J5YA 1P4XA 2OU2A 4L0YB 2JZYA 3M7GA 1E2XA 1I1SA 2VOOA 1KGSA 1U8RA 2M45A 4I0AA 4UXNA 3SFZA 2W85A 3ROUA 1GVJA 1T39A 2QENA 3ABTA 1T6SA 3JAMK 3KFWX 2CGPA 3RYRA 2HQNA 2ZMEA 2MD5A 1W4MA 2PBIA 4A0XA 2RKHA 1IUYA 2H94A 1I1GA 2W57A 3J81K 3F6OA 1MJ9A 1R5GA 4MTDA 3CUQC 1Z6RA 4L9VA 4HA8A 3DFGA 4M74A 2K02A 4EM0B 3K2ZA 2COMA 1SMYF 4ZZDA 3ZQ7A 3GX4X 4YIFA 5K5RA 1ZYRF 3W6JB 2EK5A 1SFXA 4IHTA 1X3UA 1XCVA 3BWGA 5LEKA 4WXDA 3F3XA 2ELHA 5J8FA 5K1YA 2QUFA 2WC2A 2EFWA 2EV6A 3ZN0A 1SD5A 4RGUA 3V7SA 5CVRA 1L0OC 5F1RA 4KT5C 3P7NA 3V7CA 2HFHA 2IP2A 5BS6A 3BPVA 5CVIA 1TLHB 2FMLA 1YS6A 1KQ9A 3LFKA 3ZMVA 4IHSA 1W7PB 4HF1A 3E3VA 5K5QA 2AXLA 4WXCA 3LQRA 5BQTA 5LLQA 2NRAC 2WTEA 2C6YA 3FXRA 3Q9VA 5DEQA 5LGTA 1TBXA 1OR7A 2BGCA 4EM2A 2EWNA 1ZG3A 2FQ3A 2RQPA 4QWQA 4M9ZA 1YIOA 3HSEA 2NNYA 4Q5SF 4KYWA 1JE8A 2IRFG 5L3CA 5BPIA 4EVIA 4JQFA 3P9CA 1G3YA 2WWYA 4RGSA 1FT9A 4N0BA 3JAMZ 2ACJA 3G73A 2QWWA 1S6LA 4PDKA 3I59B 2Q8KA 1W5TA 1YW8A 4RB1A 4XSXF 4NHJA 4LJZF 1FWZA 3J81Z 4FHTA 3K0LA 2GA2A 4Q48A 1G3WA 1BJAA 1Z05A 2NS0A 3FZVA 1L3LA 1BI0A 3RKYA 1FSEA 4JK1X 3GZ5A 4R8HA 4GXOA 3KP3A 1HSTA 1OMIA 2OQRA 1H0MA 4L0ZB 2VBXA 1SD6A 2V6CA 2DPUA 2DBBA 3WTUC 3N4MA 2XAFA 2KIFA 1HSJA 2GXGA 4M6YA 2DPDA 1FNNA 1T98A 2PG4A 4GYIA 1KQ8A 4HF2A 3HRSA 3KETA 3LAJA 1O3RA 1UFMA 2F2EA 2HZTA 3ULQB 1MGTA 2DTRA 1XGOA 2KIUA 1MJAA 4ZYHA 5HS9A 3RPUA 4L9NA 3GFIA 3FWEA 4U0VA 3IKVA 1R23A 4KMFA 2K4BA 5E1WA 3O6BB 4N9HA 1DPRA 2DU9A 5BOXA 4ON0A 3SHFA 5ICEA 2LDUA 3I5UA 3DP7A 1H9TA 2QQAA 3HSFA 4IRIA 4RGRA 4RS8A 3D5LA 4OMYA 1RNLA 2JPBA 2XAHA 5D4SA 1S29A 1TNSA 2BYVE 2EFPA 4PGGA 1P4AA 1SD4A 1YYVA 3L09A 4KMUX 1FPQA 3WODF 2L4MA 1HW2A 1XD7A 4LGWA 1J59A 4ZYDA 1RUNA 3FXUA 1XGMA 1U2WA 2PMHA 1ZG5A 2FF4A 4FX4A 4JBAA 1Z1DA 5E1XA 2GA1A 4B09A 2OBPA 4G7OF 1TTYA 4MQ9F 2KJBA 1QNTA 2A6HF 5HVQC 5CVJA 3WTYC 1YW9A 1QBJA 2P5KA 3BJ6A 2EV0A 5DCMA 4RB0A 4OIOF 4HDVA 3T0YA 2VBZA 4XRFA 3DKWA 2XUBA 2FA5A 2A6EF 1R1VA 1B1BA 3FXQA 1LVAA 2D1HA 2ZNYA 3E5QA 3QP6A 3PQJA 4U7DA 3GXOA 3GVAA 2PN6A 5DDGA 3GO5A 2FNPA 3HRTA 1IF1A 3R0JA 5TJJA 5CLSA 4L9JA 1G3TA 2W84A 4XLNF 5D8LB 4R79A 2CO5A 2VXZA 4LLLA 3WG9A 3MAJA 4A0ZA 2NAZA 2ZJ2A 2QLZA 3GUDA 1JHHA 2FMYA 4AWXB 2E1NA 3RJPA 4M6XA 3GFLA 3VFZA 4Q4ZF 5LRRA 3PFIA 3WTTC 5LGUA 1MD0A 5DUIA 2ZFWA 2VBWA 3L2CA 1JHFA 5LHGA 2IT0A 1BI3A 4RAZA 5FFZA 5HS8A 4M9XA 1T0FA 5CJ9A 4M72A 1ZG1A 2UXXA 4YG2F 3TQNA 3JTHA 3OOPA 3DF8A 2A07F 1MDMB 1ON2A 2FSWA 1XDSA 1R36A 4HBLA 4P9UA 2DT5A 2Z5UA 2IPQX 2Y0MA 2ZNZA 1Z91A 2OZUA 4K2EA 2PFBA 1U3EM 3CTAA 4BHBA 4ESJA 4EGYA 5DV5A 2OQGA 2RN7A 1EH7A 2DI3A 1ZAOA 2OD5A 3BJOA 3HHGA 1BBYA 1MKMA 4HX8A 1ZN2A 1RI7A 2L4AA 2GQQA 1BC8C 3WTVC 4ZH4F 3CUQB 2M30A 2EV5A 4GO1A 3V8LA 5JFRA 3EQLF 1QPMA 1G3SA 4OMZA 1IXSB 1U5TA 3RTRA 2MH2A 3P9KA 3BZ6A 2MLKA 2AS5F 2A69F 2DO7A 4A5MA 4HQEA 4HV5A 2PQ8A 1ZGJA 3G3ZA 1LQ1A 2KRFA 4FX0A 1ZLJA 3EUHA 4HZFA 4EM1A 1TNTA 4P55A 4AD9A 3WTWC 3DQVC 2HTSA 1OYYA 5BPDA 4EJWA 3MZHA 3N97A 3HHHA 2HYGD 3CJNA 2ZMEB 2O03A 4O6JA 1UHMA 3QU6A 5IT9K 4CDGA 2Q2EA 4A12A 2RC4A 3IKTA 2V1UA 5D6EA 1IN8A 2H27A 4L18B 5HDGA 1IZ1A 1KU2A 3MWMA 2EB7A 2QZ8A 4MGRA 4KNYA 5E17F 2BEOA 1LDKB 3IRQA 1S7OA 1U5TC 2EFOA 1RIOH 2CFXA 1KQ0A 3ZPLA 4PGHA 5AIQA 3P9IA 4I98B 3BPXA 2RNJA 4IPAA 3U2RA 2LNBA 3BP8A 2LF8A 4A6DA 1ZRFA 3QPTA 1HW1A 1MJBA 1UHWA 2Z9OA 3EYIA 3KZYA 1LJ9A 4YFNF 5LRSA 1HKTA 1F4KA 3F23A 4DNCA 2XGXA 4Y13A 4PCQA 2LF7A 5HDNA 1HKQA 3ABUA 1QZZA 3LA2A 2F5FA 3GF2A 5EEGA 4LG0A 4U88A 5DYMA 4KIGA 1FY7A 2R7DA 4WK8F 3C18A 3C7JA 3R0AA 3I71A 5LHHA 3E97A 3PQKA 3VOEA 1TQPA 3HYIA 3QOPA 1PUEE 3K1MA 3E6CC 1W7PD 1FSHA 4D0PA 2P8TA 3B02A 2Y75A 1O7FA 4BHPA 4ZYGA 2PEXA 1VTNC 3Q5FA 2BV6A 3S2WA 1IRFA 5ICGA 1K78A 3CDHA 1QO0D 2ZBKA 2VC1A 1GXPA 5FB2A 1Z6TA 4NB5A 1ZRCA 1WSUA 2L01A 1J9IA 1G4DA 1IN6A 4EJOA 1SAXA 3LWFA 1C0WA 2P4WA 3JTGA 3BOQA 5BMZA 2LSOA 4KA4A 2EFNA 5H6QA 2OAZA 1SD7A 1HW5A 1YFHA 1P6RA 4MEXF 4LK1F 1TQMA 2QQBA 4S05A 2G9WA 1XSVA 3ZMUA 1EV7A 3FF5A 1TQIA 3CLOA 2KKOA 5FD6A 2J5OA 5DD4A 2PJPA 4MHGA 2HS5A 5LBQA 4ESFA 2O6GE 2VONA 2CSOA 3RYPA 2K27A 3JSOA 3FM5A 2P7CB 2EA4A 2A3SA 2HOEA 5F6FA 4MQVA 2ISYA 1FBSA 1XCBA 4CHUA 1B9NA 1V3FA 2UWMA 4EGZA 2VN2A 3REOA 2BBYA 3B73A 5TRDA 4Y15A 2ETHA 2K7LA 3FM3A 1HBXG 3LSTA 4I2OA 1FC3A 2F5DA 3F8CA 1K6OA 1UCRA 2ESNA 4IXAA 1UB9A 4IJAA 1ZARA 4OIRF 4IVNA 1R1TA 1STZA 3DXJF 5AONA 2STWA 4AIJA 3COAC 1YLFA 2ISZA 2XHKA 2R3SA 3HOSA 3I58A 4XSZF 1PDNC 1SFEA 3WGHA 4FT8A 3F6VA 1KU9A 3TDUC 1RZ4A 4YFXF 1QGPA 5JHUA 2DFIA 3DPLC 2M87A 4M73A 5CVVA 2FBKA 2NNNA 1YO5C 4EQQA 2JT1A 1CF7A 2X4HA 5CVUA 1V4RA 1ZLKA 1DPUA 2XKPA 1WRJA 3CO6C 2QBYA 3I4PA 2ZXJA 2JTVA 3FMRA 3HSRA 3L00A 1S7AA 4HAMA 4AIHA 1PP8F 2GXBA 1O7LA 4EJTA 1YS7A 2VBYA 1FYMA 1O57A 1JGSA 4LFUA 2L54A 3R60A 5HLIA 1J2XA 3BROA 1R00A 3KP7A 1B6AA 4OINF 4QLCU 3GZ6A 5DCMB 4L9TA 2DK5A 4A2UA 2E7XA 3FMQA 1GHCA 3K1PA 1FYKA 1FP2A 5L3EA 4IRGA 4UV9A 2P5LC 2VOPA 5DCFA 2IVMA 2V79A 4F7ZA 3SZPA 4RB2C 1REPC 4LD5A 3F8BA 2STTA 1H9GA 1YQAA 2QM3A 2YR2A 3K1NA 1BN5A 3TDZC 4U7BA 3ZMDA 3JW4A 1FOKA 3IHUA 1R1UA 2RDPA 4KICA 4A6EA 3V8JA 4BXUA 4I0BA 1P4WA 5JVTA 3C3WA 1BI2A 1XGNA 5E20A 2QYOA 4RGXA 2JRTA 2O0YA 2H09A 4L5JA 4P96A 2FRHA 2OZ6A 3I54A 5LHIA 2K4JA 1TW3A 3ERED 1F1ZA 2D45A 1LNWA 1S3JA 4I7HA 2VE9A 3F72A 3HOTA 4EV0A 1ZHFA 3V4GA 1FYLA 3KLOA 3TOAA 4HDUA 4UVAA 3NEUA 1D3YA 4BYYA 3V7RA 5J6XA 5ICCA 3KP5A 1USTA 1IN4A 2M5WA 3HUGA 4OOIA 1R5HA 4WCGA 2HKOA 1XGSA 2DAOA 3QAHA 3GW2A 4G6QA 2WV0A 3NQOA 1A04A 3DV8A 3MFKA 2HWVA 5HLGA 1XDUA 4MTEA 2VE8A 2FNAA 3O2PE 1D5VA 4ENKA 1P2FA 1E17A 4LLNA 1W5SA 2KIMA 3Q9SA 4P5OA 4G94A 5IT3A 5ILVA 1ONVA 3KEQA 1FBUA 2P6TA 1R7JA 5ERIA 1DUXC 4XBFA 1K79A 3BDDA 5F64A 1IN5A 3RKWA 1F9NA 4CYDA 2RV8A 2GZWA 5L3GA 4I09A 4BNCA 4CO8A 4HX4A 5ILSA 1U5TB 3QP5A 3L9FA 2H6CA 3QU3A 2QVOA 1AOYA 1QZYA 3SXYA 2UZKA 2YPRA 3VEPA 3F21A 2FEZA 3WTXC 2P6SA 5E18F 5FO5A 3TO6A 1T2KA 1ZH5A 3ZMSA 3LQQA 4HF0A 4YFKF 2DQRA 4CGZA 3E6BA 3GYHX 2W24A 4H0EA 2Y48A 2B0LA 3HRMA 3ZP5A 1Y0UA 3K9TA 1J75A 3IC7A 4AIKA 1GXQA 3RI4A 4OIQF 5L3FA 1KA8A 5K5OA 3M8FA 2XASA 1BIAA 4KN4X 4UV8A 2PLYA 4KUMA 4U0WA 2JSCA 2RGVA 1NHAA 5KK1A 1LB2A 4WX9A 3JSPA 4BAYA 4R1HA 1KYZA 1ULYA 4I01A 4EMSA 1CGPA 3WU0A 1KYWA 2D2WA 5JI6A 3O3KA 2XV4S 3J7AO 3GFJA 3ML6A 2HTJA 4LMYA 4WXHA 2HQRA 5D5XB 4B8XA 1LEAA 3T5XA 4EJVA 4IF4A 3KCCA 1J7KA 1KU3A 1QQIA 3IWZA 2D1VA 1DDNA 3IWFA 1ZRDA 3EDPA 3J80K 5EEHA 2IA2A 1BI1A 5FD5A 2L02A 3M9AA 2L3DA 3DEUA 3HTSB 4I02A 4DQ2A 4TV7A 4LG0B 5H6RA 4S04A 2A5YB 1BC7C 1YW7A 3LA7A 5JR3A 3LA3A 2VT3A 2HDCA 3RPQA 1DP7P 1RUOA 5A2QK 1J0RA 3U1DA 2G7HA 1HKSA 2CQKA 4G6DA 3I0TA 5D4RA 1XSXA 1K78B 2FE3A 3WTSC 2MA3A 2RVCA 3R4KA 5FLXK 3LAPA 1BIBA 3BJAA 5LGNA 2ZO4A 3GLXA 5CYVA 2VC0A 3QRFF 2FBIA 5ICFA 3KP6A 4HV6A 1LDDA 2FU4A 3ZN1A 4ASNA 5IT9Z 2GIVA 1FZPB 1R58A 2E7WA 4GGGA 2IW5A 1W7PA 4LB6B 2DW4A 1LEBA 1XSDA 3W6KB 1SFUA 2CW0F 4KN7X 3GEZA 2F5EA 5H20A 1IW7F 3MZYA 2HYFA 3E6DA 3KZZA 3F8NA 4A5NA 5FFXA 3M8EA 4ENNA 3ZMTA 2MH9A 3H3UA 2DQLA 4BHCA 1JXSA 2XVCA 1FP1D 1I5ZA 4HLYA 3MQ0A 3J80Z 4PZJA 5L3BA 1K7AA 2X0LA 3TO7A 2MBFA 1WKMA 2Q0OA 4M9SA 3U9GA 4Y17A 2KJCA 3H92A 4OIPF 1OKRA 2A68F 3I64A 3I59A 2LKPA 2MC3A 3T8RA 1USSA 4MNUA 3K69A 3GFMA 5A2QZ 5E8GA 2EJRA 1IRGA 4HYEA 4LLGF 2EFQA 2P7VB 4NQWA 4ENMA 1OPCA 3IL2A 2XAJA 1Q1HA 3HTUA 2XROA 4KIFA 2DK8A 1ZREA 3QPHA 2V1XA 5FLXZ 2P5VA 5ILUA 1D8JA 4BQAA 3WGIA 1CF7B 1WI9A 1EH6A 1U78A 1D8KA 2ZCWA 4GCVA 1KU7A 1PP7U 2QBYB 4ZYEA 1XMAA 2PI0A 2FOKA 5DD8A 4M71A 3DPTA 4KIBA 3F8MA 2W25A 2CG4A 3V8KA 4CZZA 2DLLA 1U6GA 2GWRA 1MZBA 2Z33A 2FBHA 3MCZA 3T1BA 1FX7A 4EJUA 2IA1A 3TO9A 2R7FA 2CWEA 3RIRA 1F5TA 2CYYA 1SMTA 3GWZA 5E8IA 1ODDA 1BM9A 2J5PA 1XN7A 4HQMA 5L3DA 4KFCA 3VB2A 3FMSA 4G9YA 2NYXA 2HGCA 3FX3A 3MEXA 2HR3A 2ESHA 1S8NA 3KEOA 1Z9CA 3HIFA 3KE2A 3L7WA 2HEOA 3OV8A 4KDPA 2VODA 4ESBA 3F22A 1OYIA 3CO7C 2G7UA 3WGGA 3IRRA 2XAQA 4WWCA 4HLXA 3E6MA 1YTYA 4L5IA 3M1EA 3BY6A 3E5UA 4MEYF 1TW2A 2MLGA 4HX7A 3TGNA 1OYWA 3WU1B 1G6NA 3ECHA 1BOAA 2XKOA 6PAXA 3F8FA 4U0YA 1B4AA 3ZMZA 2YSRA 2ZKZA 1O3SA 4OU0A 2XRNA 1B59A 1I6XA 4AVPA 2YX4A 3R61A 3H3ZA 2IA0A 2M1BA 3ECOA 2XIGA 5D5UB 3KP4A 2OA4A 4IRHA 2YX7A 2FXAA 4UUVA 2PMUA 1T38A 2TDXA 2IJLA 3EETA 1IXCA 4P9FA 1FLIA 1P92A 2K86A 4UNOA 4N9IA 4ENJA 2V9VA 4UVCA 2VT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B9M A;  4Q47 A;  3HRU A;  4ETS A;  5D5V B;  2M8E A;  5J8C A;  4CIC A;  5D6F A;  1EH8 A;  4XLP F;  5HLH A;  1O3T A;  3ELK A;  1XB4 A;  4BH9 A;  2BE5 F;  2YU3 A;  2V1D A;  4ZZL A;  2XAG A;  4G7Z F;  1Z7U A;  4WF2 A;  1IAW A;  3WTZ A;  3C1D A;  2UXN A;  2Z99 A;  5KVR A;  3FHZ A;  5HDK A;  2F5C A;  4GYG A;  3TOB A;  5D8K B;  4LK0 F;  1LDJ A;  2A61 A;  1IXR C;  1WWX A;  3TKY A;  1MDM A;  4Z2Y A;  2H6B A;  1I27 A;  4RB3 C;  4G8X A;  1XMK A;  3AAF A;  4HOB A;  1AWC A;  3EYY A;  3D0S A;  4G7H F;  2EA2 A;  3ISP A;  4E70 A;  4UVB A;  4LB5 A;  5FGM A;  2GAU A;  2QQ9 A;  3E5X A;  4HW0 A;  4UHT A;  3R6S A;  3WE2 A;  2HKX A;  1O3Q A;  5E1Z B;  5LEJ A;  1ON1 A;  5D5W B;  1FBQ A;  5DUK A;  4O3M A;  3NRV A;  2ADU A;  5HOO A;  5ED4 A;  3CUO A;  3KP2 A;  1YG2 A;  5AIP A;  3T8T A;  2JPC A;  3CUQ A;  1ZGA A;  2E1C A;  4CXF A;  3KLN A;  1R22 A;  3VOD A;  1IN7 A;  1WQ2 A;  5HS7 A;  3SZT A;  3RKX A;  4RAY A;  2O3F A;  2O8X A;  1HXD A;  3SQN A;  4O5V A;  2O61 A;  3I53 A;  1HQC A;  3RDI A;  4YII A;  2Z3Y A;  3WE3 A;  4A0Y A;  1J5Y A;  1P4X A;  2OU2 A;  4L0Y B;  2JZY A;  3M7G A;  1E2X A;  1I1S A;  2VOO A;  1KGS A;  1U8R A;  2M45 A;  4I0A A;  4UXN A;  3SFZ A;  2W85 A;  3ROU A;  1GVJ A;  1T39 A;  2QEN A;  3ABT A;  1T6S A;  3JAM K;  3KFW X;  2CGP A;  3RYR A;  2HQN A;  2ZME A;  2MD5 A;  1W4M A;  2PBI A;  4A0X A;  2RKH A;  1IUY A;  2H94 A;  1I1G A;  2W57 A;  3J81 K;  3F6O A;  1MJ9 A;  1R5G A;  4MTD A;  3CUQ C;  1Z6R A;  4L9V A;  4HA8 A;  3DFG A;  4M74 A;  2K02 A;  4EM0 B;  3K2Z A;  2COM A;  1SMY F;  4ZZD A;  3ZQ7 A;  3GX4 X;  4YIF A;  5K5R A;  1ZYR F;  3W6J B;  2EK5 A;  1SFX A;  4IHT A;  1X3U A;  1XCV A;  3BWG A;  5LEK A;  4WXD A;  3F3X A;  2ELH A;  5J8F A;  5K1Y A;  2QUF A;  2WC2 A;  2EFW A;  2EV6 A;  3ZN0 A;  1SD5 A;  4RGU A;  3V7S A;  5CVR A;  1L0O C;  5F1R A;  4KT5 C;  3P7N A;  3V7C A;  2HFH A;  2IP2 A;  5BS6 A;  3BPV A;  5CVI A;  1TLH B;  2FML A;  1YS6 A;  1KQ9 A;  3LFK A;  3ZMV A;  4IHS A;  1W7P B;  4HF1 A;  3E3V A;  5K5Q A;  2AXL A;  4WXC A;  3LQR A;  5BQT A;  5LLQ A;  2NRA C;  2WTE A;  2C6Y A;  3FXR A;  3Q9V A;  5DEQ A;  5LGT A;  1TBX A;  1OR7 A;  2BGC A;  4EM2 A;  2EWN A;  1ZG3 A;  2FQ3 A;  2RQP A;  4QWQ A;  4M9Z A;  1YIO A;  3HSE A;  2NNY A;  4Q5S F;  4KYW A;  1JE8 A;  2IRF G;  5L3C A;  5BPI A;  4EVI A;  4JQF A;  3P9C A;  1G3Y A;  2WWY A;  4RGS A;  1FT9 A;  4N0B A;  3JAM Z;  2ACJ A;  3G73 A;  2QWW A;  1S6L A;  4PDK A;  3I59 B;  2Q8K A;  1W5T A;  1YW8 A;  4RB1 A;  4XSX F;  4NHJ A;  4LJZ F;  1FWZ A;  3J81 Z;  4FHT A;  3K0L A;  2GA2 A;  4Q48 A;  1G3W A;  1BJA A;  1Z05 A;  2NS0 A;  3FZV A;  1L3L A;  1BI0 A;  3RKY A;  1FSE A;  4JK1 X;  3GZ5 A;  4R8H A;  4GXO A;  3KP3 A;  1HST A;  1OMI A;  2OQR A;  1H0M A;  4L0Z B;  2VBX A;  1SD6 A;  2V6C A;  2DPU A;  2DBB A;  3WTU C;  3N4M A;  2XAF A;  2KIF A;  1HSJ A;  2GXG A;  4M6Y A;  2DPD A;  1FNN A;  1T98 A;  2PG4 A;  4GYI A;  1KQ8 A;  4HF2 A;  3HRS A;  3KET A;  3LAJ A;  1O3R A;  1UFM A;  2F2E A;  2HZT A;  3ULQ B;  1MGT A;  2DTR A;  1XGO A;  2KIU A;  1MJA A;  4ZYH A;  5HS9 A;  3RPU A;  4L9N A;  3GFI A;  3FWE A;  4U0V A;  3IKV A;  1R23 A;  4KMF A;  2K4B A;  5E1W A;  3O6B B;  4N9H A;  1DPR A;  2DU9 A;  5BOX A;  4ON0 A;  3SHF A;  5ICE A;  2LDU A;  3I5U A;  3DP7 A;  1H9T A;  2QQA A;  3HSF A;  4IRI A;  4RGR A;  4RS8 A;  3D5L A;  4OMY A;  1RNL A;  2JPB A;  2XAH A;  5D4S A;  1S29 A;  1TNS A;  2BYV E;  2EFP A;  4PGG A;  1P4A A;  1SD4 A;  1YYV A;  3L09 A;  4KMU X;  1FPQ A;  3WOD F;  2L4M A;  1HW2 A;  1XD7 A;  4LGW A;  1J59 A;  4ZYD A;  1RUN A;  3FXU A;  1XGM A;  1U2W A;  2PMH A;  1ZG5 A;  2FF4 A;  4FX4 A;  4JBA A;  1Z1D A;  5E1X A;  2GA1 A;  4B09 A;  2OBP A;  4G7O F;  1TTY A;  4MQ9 F;  2KJB A;  1QNT A;  2A6H F;  5HVQ C;  5CVJ A;  3WTY C;  1YW9 A;  1QBJ A;  2P5K A;  3BJ6 A;  2EV0 A;  5DCM A;  4RB0 A;  4OIO F;  4HDV A;  3T0Y A;  2VBZ A;  4XRF A;  3DKW A;  2XUB A;  2FA5 A;  2A6E F;  1R1V A;  1B1B A;  3FXQ A;  1LVA A;  2D1H A;  2ZNY A;  3E5Q A;  3QP6 A;  3PQJ A;  4U7D A;  3GXO A;  3GVA A;  2PN6 A;  5DDG A;  3GO5 A;  2FNP A;  3HRT A;  1IF1 A;  3R0J A;  5TJJ A;  5CLS A;  4L9J A;  1G3T A;  2W84 A;  4XLN F;  5D8L B;  4R79 A;  2CO5 A;  2VXZ A;  4LLL A;  3WG9 A;  3MAJ A;  4A0Z A;  2NAZ A;  2ZJ2 A;  2QLZ A;  3GUD A;  1JHH A;  2FMY A;  4AWX B;  2E1N A;  3RJP A;  4M6X A;  3GFL A;  3VFZ A;  4Q4Z F;  5LRR A;  3PFI A;  3WTT C;  5LGU A;  1MD0 A;  5DUI A;  2ZFW A;  2VBW A;  3L2C A;  1JHF A;  5LHG A;  2IT0 A;  1BI3 A;  4RAZ A;  5FFZ A;  5HS8 A;  4M9X A;  1T0F A;  5CJ9 A;  4M72 A;  1ZG1 A;  2UXX A;  4YG2 F;  3TQN A;  3JTH A;  3OOP A;  3DF8 A;  2A07 F;  1MDM B;  1ON2 A;  2FSW A;  1XDS A;  1R36 A;  4HBL A;  4P9U A;  2DT5 A;  2Z5U A;  2IPQ X;  2Y0M A;  2ZNZ A;  1Z91 A;  2OZU A;  4K2E A;  2PFB A;  1U3E M;  3CTA A;  4BHB A;  4ESJ A;  4EGY A;  5DV5 A;  2OQG A;  2RN7 A;  1EH7 A;  2DI3 A;  1ZAO A;  2OD5 A;  3BJO A;  3HHG A;  1BBY A;  1MKM A;  4HX8 A;  1ZN2 A;  1RI7 A;  2L4A A;  2GQQ A;  1BC8 C;  3WTV C;  4ZH4 F;  3CUQ B;  2M30 A;  2EV5 A;  4GO1 A;  3V8L A;  5JFR A;  3EQL F;  1QPM A;  1G3S A;  4OMZ A;  1IXS B;  1U5T A;  3RTR A;  2MH2 A;  3P9K A;  3BZ6 A;  2MLK A;  2AS5 F;  2A69 F;  2DO7 A;  4A5M A;  4HQE A;  4HV5 A;  2PQ8 A;  1ZGJ A;  3G3Z A;  1LQ1 A;  2KRF A;  4FX0 A;  1ZLJ A;  3EUH A;  4HZF A;  4EM1 A;  1TNT A;  4P55 A;  4AD9 A;  3WTW C;  3DQV C;  2HTS A;  1OYY A;  5BPD A;  4EJW A;  3MZH A;  3N97 A;  3HHH A;  2HYG D;  3CJN A;  2ZME B;  2O03 A;  4O6J A;  1UHM A;  3QU6 A;  5IT9 K;  4CDG A;  2Q2E A;  4A12 A;  2RC4 A;  3IKT A;  2V1U A;  5D6E A;  1IN8 A;  2H27 A;  4L18 B;  5HDG A;  1IZ1 A;  1KU2 A;  3MWM A;  2EB7 A;  2QZ8 A;  4MGR A;  4KNY A;  5E17 F;  2BEO A;  1LDK B;  3IRQ A;  1S7O A;  1U5T C;  2EFO A;  1RIO H;  2CFX A;  1KQ0 A;  3ZPL A;  4PGH A;  5AIQ A;  3P9I A;  4I98 B;  3BPX A;  2RNJ A;  4IPA A;  3U2R A;  2LNB A;  3BP8 A;  2LF8 A;  4A6D A;  1ZRF A;  3QPT A;  1HW1 A;  1MJB A;  1UHW A;  2Z9O A;  3EYI A;  3KZY A;  1LJ9 A;  4YFN F;  5LRS A;  1HKT A;  1F4K A;  3F23 A;  4DNC A;  2XGX A;  4Y13 A;  4PCQ A;  2LF7 A;  5HDN A;  1HKQ A;  3ABU A;  1QZZ A;  3LA2 A;  2F5F A;  3GF2 A;  5EEG A;  4LG0 A;  4U88 A;  5DYM A;  4KIG A;  1FY7 A;  2R7D A;  4WK8 F;  3C18 A;  3C7J A;  3R0A A;  3I71 A;  5LHH A;  3E97 A;  3PQK A;  3VOE A;  1TQP A;  3HYI A;  3QOP A;  1PUE E;  3K1M A;  3E6C C;  1W7P D;  1FSH A;  4D0P A;  2P8T A;  3B02 A;  2Y75 A;  1O7F A;  4BHP A;  4ZYG A;  2PEX A;  1VTN C;  3Q5F A;  2BV6 A;  3S2W A;  1IRF A;  5ICG A;  1K78 A;  3CDH A;  1QO0 D;  2ZBK A;  2VC1 A;  1GXP A;  5FB2 A;  1Z6T A;  4NB5 A;  1ZRC A;  1WSU A;  2L01 A;  1J9I A;  1G4D A;  1IN6 A;  4EJO A;  1SAX A;  3LWF A;  1C0W A;  2P4W A;  3JTG A;  3BOQ A;  5BMZ A;  2LSO A;  4KA4 A;  2EFN A;  5H6Q A;  2OAZ A;  1SD7 A;  1HW5 A;  1YFH A;  1P6R A;  4MEX F;  4LK1 F;  1TQM A;  2QQB A;  4S05 A;  2G9W A;  1XSV A;  3ZMU A;  1EV7 A;  3FF5 A;  1TQI A;  3CLO A;  2KKO A;  5FD6 A;  2J5O A;  5DD4 A;  2PJP A;  4MHG A;  2HS5 A;  5LBQ A;  4ESF A;  2O6G E;  2VON A;  2CSO A;  3RYP A;  2K27 A;  3JSO A;  3FM5 A;  2P7C B;  2EA4 A;  2A3S A;  2HOE A;  5F6F A;  4MQV A;  2ISY A;  1FBS A;  1XCB A;  4CHU A;  1B9N A;  1V3F A;  2UWM A;  4EGZ A;  2VN2 A;  3REO A;  2BBY A;  3B73 A;  5TRD A;  4Y15 A;  2ETH A;  2K7L A;  3FM3 A;  1HBX G;  3LST A;  4I2O A;  1FC3 A;  2F5D A;  3F8C A;  1K6O A;  1UCR A;  2ESN A;  4IXA A;  1UB9 A;  4IJA A;  1ZAR A;  4OIR F;  4IVN A;  1R1T A;  1STZ A;  3DXJ F;  5AON A;  2STW A;  4AIJ A;  3COA C;  1YLF A;  2ISZ A;  2XHK A;  2R3S A;  3HOS A;  3I58 A;  4XSZ F;  1PDN C;  1SFE A;  3WGH A;  4FT8 A;  3F6V A;  1KU9 A;  3TDU C;  1RZ4 A;  4YFX F;  1QGP A;  5JHU A;  2DFI A;  3DPL C;  2M87 A;  4M73 A;  5CVV A;  2FBK A;  2NNN A;  1YO5 C;  4EQQ A;  2JT1 A;  1CF7 A;  2X4H A;  5CVU A;  1V4R A;  1ZLK A;  1DPU A;  2XKP A;  1WRJ A;  3CO6 C;  2QBY A;  3I4P A;  2ZXJ A;  2JTV A;  3FMR A;  3HSR A;  3L00 A;  1S7A A;  4HAM A;  4AIH A;  1PP8 F;  2GXB A;  1O7L A;  4EJT A;  1YS7 A;  2VBY A;  1FYM A;  1O57 A;  1JGS A;  4LFU A;  2L54 A;  3R60 A;  5HLI A;  1J2X A;  3BRO A;  1R00 A;  3KP7 A;  1B6A A;  4OIN F;  4QLC U;  3GZ6 A;  5DCM B;  4L9T A;  2DK5 A;  4A2U A;  2E7X A;  3FMQ A;  1GHC A;  3K1P A;  1FYK A;  1FP2 A;  5L3E A;  4IRG A;  4UV9 A;  2P5L C;  2VOP A;  5DCF A;  2IVM A;  2V79 A;  4F7Z A;  3SZP A;  4RB2 C;  1REP C;  4LD5 A;  3F8B A;  2STT A;  1H9G A;  1YQA A;  2QM3 A;  2YR2 A;  3K1N A;  1BN5 A;  3TDZ C;  4U7B A;  3ZMD A;  3JW4 A;  1FOK A;  3IHU A;  1R1U A;  2RDP A;  4KIC A;  4A6E A;  3V8J A;  4BXU A;  4I0B A;  1P4W A;  5JVT A;  3C3W A;  1BI2 A;  1XGN A;  5E20 A;  2QYO A;  4RGX A;  2JRT A;  2O0Y A;  2H09 A;  4L5J A;  4P96 A;  2FRH A;  2OZ6 A;  3I54 A;  5LHI A;  2K4J A;  1TW3 A;  3ERE D;  1F1Z A;  2D45 A;  1LNW A;  1S3J A;  4I7H A;  2VE9 A;  3F72 A;  3HOT A;  4EV0 A;  1ZHF A;  3V4G A;  1FYL A;  3KLO A;  3TOA A;  4HDU A;  4UVA A;  3NEU A;  1D3Y A;  4BYY A;  3V7R A;  5J6X A;  5ICC A;  3KP5 A;  1UST A;  1IN4 A;  2M5W A;  3HUG A;  4OOI A;  1R5H A;  4WCG A;  2HKO A;  1XGS A;  2DAO A;  3QAH A;  3GW2 A;  4G6Q A;  2WV0 A;  3NQO A;  1A04 A;  3DV8 A;  3MFK A;  2HWV A;  5HLG A;  1XDU A;  4MTE A;  2VE8 A;  2FNA A;  3O2P E;  1D5V A;  4ENK A;  1P2F A;  1E17 A;  4LLN A;  1W5S A;  2KIM A;  3Q9S A;  4P5O A;  4G94 A;  5IT3 A;  5ILV A;  1ONV A;  3KEQ A;  1FBU A;  2P6T A;  1R7J A;  5ERI A;  1DUX C;  4XBF A;  1K79 A;  3BDD A;  5F64 A;  1IN5 A;  3RKW A;  1F9N A;  4CYD A;  2RV8 A;  2GZW A;  5L3G A;  4I09 A;  4BNC A;  4CO8 A;  4HX4 A;  5ILS A;  1U5T B;  3QP5 A;  3L9F A;  2H6C A;  3QU3 A;  2QVO A;  1AOY A;  1QZY A;  3SXY A;  2UZK A;  2YPR A;  3VEP A;  3F21 A;  2FEZ A;  3WTX C;  2P6S A;  5E18 F;  5FO5 A;  3TO6 A;  1T2K A;  1ZH5 A;  3ZMS A;  3LQQ A;  4HF0 A;  4YFK F;  2DQR A;  4CGZ A;  3E6B A;  3GYH X;  2W24 A;  4H0E A;  2Y48 A;  2B0L A;  3HRM A;  3ZP5 A;  1Y0U A;  3K9T A;  1J75 A;  3IC7 A;  4AIK A;  1GXQ A;  3RI4 A;  4OIQ F;  5L3F A;  1KA8 A;  5K5O A;  3M8F A;  2XAS A;  1BIA A;  4KN4 X;  4UV8 A;  2PLY A;  4KUM A;  4U0W A;  2JSC A;  2RGV A;  1NHA A;  5KK1 A;  1LB2 A;  4WX9 A;  3JSP A;  4BAY A;  4R1H A;  1KYZ A;  1ULY A;  4I01 A;  4EMS A;  1CGP A;  3WU0 A;  1KYW A;  2D2W A;  5JI6 A;  3O3K A;  2XV4 S;  3J7A O;  3GFJ A;  3ML6 A;  2HTJ A;  4LMY A;  4WXH A;  2HQR A;  5D5X B;  4B8X A;  1LEA A;  3T5X A;  4EJV A;  4IF4 A;  3KCC A;  1J7K A;  1KU3 A;  1QQI A;  3IWZ A;  2D1V A;  1DDN A;  3IWF A;  1ZRD A;  3EDP A;  3J80 K;  5EEH A;  2IA2 A;  1BI1 A;  5FD5 A;  2L02 A;  3M9A A;  2L3D A;  3DEU A;  3HTS B;  4I02 A;  4DQ2 A;  4TV7 A;  4LG0 B;  5H6R A;  4S04 A;  2A5Y B;  1BC7 C;  1YW7 A;  3LA7 A;  5JR3 A;  3LA3 A;  2VT3 A;  2HDC A;  3RPQ A;  1DP7 P;  1RUO A;  5A2Q K;  1J0R A;  3U1D A;  2G7H A;  1HKS A;  2CQK A;  4G6D A;  3I0T A;  5D4R A;  1XSX A;  1K78 B;  2FE3 A;  3WTS C;  2MA3 A;  2RVC A;  3R4K A;  5FLX K;  3LAP A;  1BIB A;  3BJA A;  5LGN A;  2ZO4 A;  3GLX A;  5CYV A;  2VC0 A;  3QRF F;  2FBI A;  5ICF A;  3KP6 A;  4HV6 A;  1LDD A;  2FU4 A;  3ZN1 A;  4ASN A;  5IT9 Z;  2GIV A;  1FZP B;  1R58 A;  2E7W A;  4GGG A;  2IW5 A;  1W7P A;  4LB6 B;  2DW4 A;  1LEB A;  1XSD A;  3W6K B;  1SFU A;  2CW0 F;  4KN7 X;  3GEZ A;  2F5E A;  5H20 A;  1IW7 F;  3MZY A;  2HYF A;  3E6D A;  3KZZ A;  3F8N A;  4A5N A;  5FFX A;  3M8E A;  4ENN A;  3ZMT A;  2MH9 A;  3H3U A;  2DQL A;  4BHC A;  1JXS A;  2XVC A;  1FP1 D;  1I5Z A;  4HLY A;  3MQ0 A;  3J80 Z;  4PZJ A;  5L3B A;  1K7A A;  2X0L A;  3TO7 A;  2MBF A;  1WKM A;  2Q0O A;  4M9S A;  3U9G A;  4Y17 A;  2KJC A;  3H92 A;  4OIP F;  1OKR A;  2A68 F;  3I64 A;  3I59 A;  2LKP A;  2MC3 A;  3T8R A;  1USS A;  4MNU A;  3K69 A;  3GFM A;  5A2Q Z;  5E8G A;  2EJR A;  1IRG A;  4HYE A;  4LLG F;  2EFQ A;  2P7V B;  4NQW A;  4ENM A;  1OPC A;  3IL2 A;  2XAJ A;  1Q1H A;  3HTU A;  2XRO A;  4KIF A;  2DK8 A;  1ZRE A;  3QPH A;  2V1X A;  5FLX Z;  2P5V A;  5ILU A;  1D8J A;  4BQA A;  3WGI A;  1CF7 B;  1WI9 A;  1EH6 A;  1U78 A;  1D8K A;  2ZCW A;  4GCV A;  1KU7 A;  1PP7 U;  2QBY B;  4ZYE A;  1XMA A;  2PI0 A;  2FOK A;  5DD8 A;  4M71 A;  3DPT A;  4KIB A;  3F8M A;  2W25 A;  2CG4 A;  3V8K A;  4CZZ A;  2DLL A;  1U6G A;  2GWR A;  1MZB A;  2Z33 A;  2FBH A;  3MCZ A;  3T1B A;  1FX7 A;  4EJU A;  2IA1 A;  3TO9 A;  2R7F A;  2CWE A;  3RIR A;  1F5T A;  2CYY A;  1SMT A;  3GWZ A;  5E8I A;  1ODD A;  1BM9 A;  2J5P A;  1XN7 A;  4HQM A;  5L3D A;  4KFC A;  3VB2 A;  3FMS A;  4G9Y A;  2NYX A;  2HGC A;  3FX3 A;  3MEX A;  2HR3 A;  2ESH A;  1S8N A;  3KEO A;  1Z9C A;  3HIF A;  3KE2 A;  3L7W A;  2HEO A;  3OV8 A;  4KDP A;  2VOD A;  4ESB A;  3F22 A;  1OYI A;  3CO7 C;  2G7U A;  3WGG A;  3IRR A;  2XAQ A;  4WWC A;  4HLX A;  3E6M A;  1YTY A;  4L5I A;  3M1E A;  3BY6 A;  3E5U A;  4MEY F;  1TW2 A;  2MLG A;  4HX7 A;  3TGN A;  1OYW A;  3WU1 B;  1G6N A;  3ECH A;  1BOA A;  2XKO A;  6PAX A;  3F8F A;  4U0Y A;  1B4A A;  3ZMZ A;  2YSR A;  2ZKZ A;  1O3S A;  4OU0 A;  2XRN A;  1B59 A;  1I6X A;  4AVP A;  2YX4 A;  3R61 A;  3H3Z A;  2IA0 A;  2M1B A;  3ECO A;  2XIG A;  5D5U B;  3KP4 A;  2OA4 A;  4IRH A;  2YX7 A;  2FXA A;  4UUV A;  2PMU A;  1T38 A;  2TDX A;  2IJL A;  3EET A;  1IXC A;  4P9F A;  1FLI A;  1P92 A;  2K86 A;  4UNO A;  4N9I A;  4ENJ A;  2V9V A;  4UVC A;  2VT2 A; 
#chains in the Genus database with same CATH topology
 1B9M A;  2XPV A;  4Q47 A;  3HRU A;  4ETS A;  5D5V B;  2M8E A;  5J8C A;  2L9S A;  1YOV B;  3I4N J;  4CIC A;  2LG4 A;  2W1O A;  1EH8 A;  2DOA A;  3FHN A;  5D6F A;  1JKR C;  2CMP A;  4XLP F;  5HLH A;  1O3T A;  3ELK A;  1XB4 A;  3OYJ A;  1TWH J;  4IOA F;  4RA2 A;  2Q1Z B;  1BR2 A;  1I6H J;  1OLT A;  4BH9 A;  2BE5 F;  2IS1 A;  2YU3 A;  5F1J A;  2V1D A;  1FIP A;  4DW6 A;  4ZJZ A;  4ZZL A;  2XAG A;  5J40 A;  4IHV A;  4G7Z F;  1Z7U A;  5HLT A;  3CJR B;  4WF2 A;  5C3E J;  1IAW A;  3WTZ A;  3C1D A;  2UXN A;  1BW5 A;  2E71 A;  2GIZ A;  4IHW A;  2Z99 A;  1J09 A;  5KVR A;  1Z7L A;  3ZXS A;  4XRS G;  3FHZ A;  3S1R J;  3DKX A;  2HOA A;  5HDK A;  2F5C A;  5M5X J;  2JA2 A;  3D5S C;  4GYG A;  3TOB A;  5D8K B;  4LK0 F;  1LDJ A;  2A61 A;  3VSL A;  3A2K A;  2L9R A;  1IXR C;  1UZC A;  1WWX A;  3TKY A;  4KIT B;  1QPI A;  2O5R A;  1GLN A;  2HXO A;  2IGK A;  1MDM A;  3HC7 A;  2K3F A;  4Z2Y A;  2H6B A;  1I27 A;  4RB3 C;  4G8X A;  1XMK A;  2CQN A;  2YUS A;  3AAF A;  4HOB A;  1AWC A;  4QTR A;  2KIS A;  3MVP A;  4BQO A;  1VQ5 I;  3EYY A;  2ZXW H;  2K85 A;  3QYB A;  2CV0 A;  3D0S A;  3CCY A;  2CW7 A;  4M3F A;  4IX7 A;  2KDO A;  2DA1 A;  4G7H F;  1LE8 B;  4Y52 J;  3S2D J;  1B72 B;  1I50 J;  1IC8 A;  2EA2 A;  3ISP A;  4E70 A;  4UVB A;  2VKH A;  4LB5 A;  2L2O A;  5FGM A;  2MAB A;  1MBG A;  2GAU A;  3H0G J;  5FRO A;  2YU9 J;  2QQ9 A;  3E5X A;  4FIS A;  4HW0 A;  2P0W A;  4UHT A;  3L2U A;  2KZV A;  3R6S A;  3UNG C;  3WE2 A;  2X85 A;  2HKX A;  4CUG A;  2JK3 A;  1O3Q A;  2DOE A;  5E1Z B;  5LEJ A;  1ON1 A;  1YIT I;  2KQR A;  2Q2E B;  1P9Q C;  5D5W B;  1FBQ A;  5DUK A;  4B1R A;  4A3K J;  2DA6 A;  4O3M A;  3ASO H;  2G0E A;  3NRV A;  1S72 I;  4XM3 A;  2ADU A;  3FXL A;  5HOO A;  5ED4 A;  1XC5 A;  3CUO A;  3KP2 A;  1YG2 A;  5AIP A;  3T8T A;  2JPC A;  1YHQ I;  2LBF A;  3CUQ A;  3VPR A;  1ZGA A;  3SFI A;  2E1C A;  4CXF A;  3KLN A;  1R22 A;  3VOD A;  1IN7 A;  1WQ2 A;  1VQ6 I;  5HS7 A;  3SZT A;  2XSD C;  3RKX A;  4RAY A;  4XOR A;  1X1P A;  2K9M A;  2E35 A;  4EAT A;  2O3F A;  1SVO A;  2O8X A;  1HXD A;  2DMQ A;  2HYJ A;  3K4M A;  3H35 A;  3PSI A;  3SQN A;  4O5V A;  2O61 A;  3I53 A;  1HQC A;  3RDI A;  2X6Y A;  3C2H A;  2XGC A;  1WZ2 A;  4LOC A;  4YII A;  1AU7 A;  2Z3Y A;  1LPQ A;  3WE3 A;  4A0Y A;  2XDV A;  1J5Y A;  3S15 J;  3KYL A;  1P4X A;  2OU2 A;  3NAU A;  4L0Y B;  2JZY A;  3M7G A;  1E2X A;  1I1S A;  3PL8 A;  2VOO A;  1KGS A;  4XK4 A;  2M45 A;  1U8R A;  5FKN A;  4I0A A;  4UXN A;  1AA7 A;  3SFZ A;  2QKL B;  2VQL A;  2W85 A;  3ROU A;  1A35 A;  1GVJ A;  1T39 A;  1WJE A;  3CC7 I;  3H9J A;  4X6A J;  4PFP A;  2E1M C;  2E2H J;  2M2E A;  2QEN A;  1EA3 A;  3ABT A;  1T6S A;  2E2J J;  3JAM K;  3PJR A;  3KFW X;  2CGP A;  4PFO A;  3RYR A;  2HQN A;  4A3G J;  2VUM J;  2ZME A;  2OF7 A;  2MD5 A;  4E6K G;  1JKP C;  1W4M A;  2PBI A;  4A0X A;  4FAS D;  2AO9 A;  4BL0 B;  2RKH A;  1D0Z A;  1BL0 A;  5C4X J;  1IUY A;  2L7M P;  2H94 A;  5B1B H;  1I1G A;  1TT5 B;  2W57 A;  3J81 K;  3F6O A;  3BG9 A;  3V42 A;  1MJ9 A;  1R5G A;  4MTD A;  2F4M B;  4YEL A;  2M8G X;  2DA2 A;  2TRT A;  3CUQ C;  1Z6R A;  4L9V A;  1D0Y A;  1SAU A;  4PUS A;  4LG3 A;  2ZJQ F;  4HA8 A;  1R49 A;  3OMY A;  3DFG A;  4M74 A;  2K02 A;  4EM0 B;  3DLL F;  1NK3 P;  3K2Z A;  1PUF A;  2LFB A;  2COM A;  1SMY F;  4ZZD A;  3ZQ7 A;  3GX4 X;  4YIF A;  4UUS A;  5K5R A;  1ZYR F;  4JYK A;  3W6J B;  1GVD A;  1FEX A;  2EK5 A;  1SFX A;  4HRI A;  4IHX A;  4IHT A;  1X3U A;  2V4J C;  3LNQ A;  4YRV A;  4XR6 A;  2R5Y A;  2O8K A;  1SVM A;  1XCV A;  1DP3 A;  2FQ4 A;  1OCO H;  2EH3 A;  3BWG A;  5LEK A;  4WXD A;  4ZDP A;  3F3X A;  2ELH A;  4ANJ A;  2QCO A;  5J8F A;  5K1Y A;  2QUF A;  2VI6 A;  3M8J A;  2WC2 A;  2ELJ A;  2EFW A;  2EV6 A;  3MN2 A;  5FJ8 J;  3ZN0 A;  1SD5 A;  3DEE A;  4HNU A;  4RGU A;  3V7S A;  5CVR A;  1L0O C;  5F1R A;  2LY2 A;  4KT5 C;  4D7N A;  3P7N A;  2DMU A;  2ZB9 A;  3V7C A;  2HFH A;  1Y56 A;  4RBO A;  3OYL A;  2IP2 A;  3S16 J;  3BG7 A;  4CZC A;  4GFB A;  3OYA A;  2CW8 A;  3M1C A;  3GTK J;  5BS6 A;  1I3Q J;  3JRI A;  3BPV A;  5CVI A;  1WH7 A;  2ZME C;  3ASN H;  2JRM A;  4II2 A;  1LKX A;  1XS9 A;  2XF6 A;  5GPC A;  2NS8 A;  4A3F J;  1TLH B;  3DU5 A;  4KJZ A;  4Y3O A;  3VYT B;  2QSG X;  4BBS J;  2FML A;  1YS6 A;  1KQ9 A;  3LFK A;  3ZMV A;  4IHS A;  1W7P B;  4HF1 A;  3E3V A;  5K5Q A;  1Q1V A;  2AXL A;  4WXC A;  3LQR A;  5BQT A;  5LLQ A;  5M5W J;  2NRA C;  1FIA A;  2WTE A;  4A3C J;  4E4H A;  4D1Q A;  2C6Y A;  1MIJ A;  3FXR A;  3Q9V A;  2K9Q A;  5DEQ A;  5LGT A;  1TBX A;  1OR7 A;  1IGN A;  2BGC A;  4EM2 A;  3LSK A;  2EWN A;  2ICW G;  1ZG3 A;  2FQ3 A;  3BCA A;  2RQP A;  4II3 A;  3ABM H;  4QWQ A;  4M9Z A;  2WY8 Q;  5K7H A;  1YIO A;  5EGO A;  3HSE A;  4RM3 A;  3JRE A;  2NNY A;  4Q5S F;  4J01 A;  2N8G A;  4KYW A;  1JE8 A;  3KEY A;  5J1R A;  2IRF G;  5L3C A;  3OIO A;  4HST A;  5BPI A;  1T08 B;  4EVI A;  4JQF A;  3ZGK A;  3P9C A;  1G3Y A;  2WWY A;  1LUJ B;  1QVU A;  1FTZ A;  1H88 C;  1WJ5 A;  3OYF A;  1VF9 A;  2XF7 A;  4CCK A;  4RGS A;  5EF6 A;  1FT9 A;  4N0B A;  3JAM Z;  2ACJ A;  3G73 A;  1GT0 C;  1G59 A;  3HOU J;  2QWW A;  1S6L A;  1N75 A;  4PDK A;  1TWG J;  3I59 B;  2O9L A;  1W5T A;  1YW8 A;  2A05 A;  2Q8K A;  1ZGW A;  3W2A A;  2DMN A;  3PM1 A;  3MKW B;  3PNT A;  4RB1 A;  2X9D A;  4N4N B;  4XSX F;  3CDL A;  2R7Z J;  3VYR B;  4NHJ A;  1R4N B;  3OS0 A;  4LJZ F;  4NQW B;  1FWZ A;  1LVK A;  2K9L A;  3J81 Z;  3M4O J;  4EEF G;  4FHT A;  4JP0 A;  2R7S A;  3K0L A;  2GA2 A;  1RKW A;  1WH5 A;  5IYB J;  2JMW A;  4S0H B;  3SEQ A;  3SYT A;  1OCR H;  4Q48 A;  3OYE A;  1G3W A;  1HLV A;  1BJA A;  3QOD A;  1Z05 A;  2NS0 A;  3FZV A;  2UV1 A;  2JUC A;  3Q3S A;  4A3J J;  2PX9 A;  1OR7 C;  1A5J A;  4RDU A;  1L3L A;  1T95 A;  3PO3 J;  4A3D J;  1YX5 A;  2M3A A;  1BI0 A;  2MG4 A;  2MYS A;  3P5J A;  3RKY A;  1FSE A;  1D1B A;  5F0C A;  4JK1 X;  3GZ5 A;  4XON A;  4R8H A;  3DCF A;  2K3P A;  4GXO A;  3LFU A;  3KP3 A;  1HST A;  1OMI A;  2WBM A;  2OQR A;  3S2H J;  1H0M A;  1PYV A;  4L0Z B;  2VBX A;  1SD6 A;  3F9K A;  2K9S A;  2V6C A;  1MBF A;  3ESW B;  2DPU A;  2DBB A;  2EIK H;  3S32 A;  5J1U A;  3WTU C;  1NH3 A;  3N4M A;  2VJ4 A;  2XB0 X;  2XAF A;  2KIF A;  1RES A;  1HSJ A;  2GXG A;  4M6Y A;  2DPD A;  4PJN A;  1X3W B;  2B7E A;  5GPA A;  2W48 A;  2GXA A;  1FNN A;  2IAI A;  3SDB A;  1T98 A;  2L9N A;  2PG4 A;  4GYI A;  1KQ8 A;  4HF2 A;  3HRS A;  3KET A;  3LAJ A;  1O3R A;  1UFM A;  3GTL J;  5EG0 A;  3E0J B;  1B8I B;  3DTE A;  1V55 H;  3CJQ B;  5J47 A;  3H3V K;  2X6O A;  2F2E A;  2HZT A;  2V26 A;  3FDY A;  3ULQ B;  1YRN A;  2MSY A;  4V19 K;  1MGT A;  2DTR A;  4F3Q A;  1RC9 A;  1XGO A;  2KIU A;  1MJA A;  4ZYH A;  5HS9 A;  3KIO A;  3BR6 A;  3RPU A;  4L9N A;  3GFI A;  1SFK A;  2NXN B;  3FWE A;  4U0V A;  2BY0 A;  3IKV A;  3KYD B;  3D5R C;  1D5Y A;  1R23 A;  2DDB A;  2QEX I;  4KMF A;  4V2G A;  3A0B C;  2K4B A;  3RZD J;  2O7O A;  2B63 J;  5E1W A;  3O6B B;  3MZ8 A;  3OIP A;  4N9H A;  1DPR A;  3X2Q H;  1G2H A;  2DU9 A;  4D5F A;  5BOX A;  4ON0 A;  4M3E A;  3SHF A;  5ICE A;  2LDU A;  3I5U A;  3DP7 A;  4PJL A;  1H9T A;  3RKQ A;  3OS1 A;  3OSF A;  3FKJ A;  1OIS A;  2QQA A;  3FBN B;  3HSF A;  4IRI A;  4RGR A;  3CD6 I;  3D5L A;  4RS8 A;  4OMY A;  1M1E B;  2K5C A;  1RNL A;  2JPB A;  2UUZ A;  2XAH A;  1S29 A;  5D4S A;  1ORK A;  5IYC J;  2NVQ J;  4NDL A;  1TNS A;  3OYG A;  2BYV E;  2ZJR F;  2EFP A;  3ZR8 X;  3BR0 A;  4A3M J;  4PGG A;  2WAF A;  1P4A A;  1SD4 A;  1YYV A;  3L09 A;  4KMU X;  4BAC A;  1AKH A;  3ZQG A;  5E3M A;  1FPQ A;  2Y9Y A;  2CH0 A;  2MW8 A;  3WOD F;  1K83 J;  5M3M J;  2L4M A;  1HW2 A;  2FX0 A;  4L5E A;  1XD7 A;  2M7A A;  4LGW A;  1TWC J;  2ZSI B;  1J59 A;  4ZYD A;  1RUN A;  3FXU A;  1XGM A;  2LY1 A;  3OYC A;  1WJB A;  1K4S A;  4OAY A;  3H9G A;  3PFY A;  1U9N A;  2HOT A;  4D5C A;  2VJ5 A;  3K70 C;  4CH7 A;  1U2W A;  2PMH A;  1OCZ H;  1Y0N A;  1IV8 A;  2FF4 A;  2GBY A;  1ZG5 A;  3SJM A;  2EBI A;  1TT0 A;  5TGT A;  2RNG A;  4FX4 A;  4JBA A;  3FXK A;  1Z1D A;  1EF4 A;  3HGG A;  1SFO J;  5E1X A;  1SVL A;  2GA1 A;  4B09 A;  2OBP A;  2XC7 A;  2JA8 J;  3K4K A;  4G7O F;  1TTY A;  2R7V A;  2X1D A;  4MQ9 F;  2KJB A;  1QNT A;  2A6H F;  5HVQ C;  5CVJ A;  3ZQF A;  1ETY A;  3WTY C;  4HNV A;  1YW9 A;  3NWS A;  1QBJ A;  3OYH A;  1WJA A;  2HZD A;  4C30 A;  4XRM A;  4BDZ A;  4BXX J;  4UB8 C;  2P5K A;  1W5C C;  3BJ6 A;  3S8P A;  1XPX A;  2DXI A;  2EV0 A;  2V1N A;  5DCM A;  4RB0 A;  5GAG J;  4OIO F;  3AKZ A;  4HDV A;  3T0Y A;  2VBZ A;  4XRF A;  4BDY A;  3DKW A;  2XPU A;  1S5L C;  2LP0 A;  2XUB A;  2DFH A;  2FA5 A;  2A6E F;  4M3B A;  1R1V A;  2BY2 A;  3PSF A;  2WY7 Q;  2XRL A;  1QHH D;  2PJR B;  1B1B A;  4PJJ A;  2HI3 A;  3FXQ A;  4IKF A;  1LVA A;  2L5Q A;  2D1H A;  2L7K A;  2ZNY A;  3E5Q A;  3QP6 A;  5JHF A;  1VQO I;  5IY5 H;  2CV1 A;  3PQJ A;  4U7D A;  4IHY A;  2QF7 A;  2LOO A;  2XPW A;  2R5Z B;  1JTY A;  2BOL A;  3A4C A;  3GXO A;  3GVA A;  2IGN A;  3LSI A;  3BCB A;  3VYS B;  2PN6 A;  5DDG A;  4AU7 A;  3BR5 A;  2FNP A;  3GO5 A;  3HRT A;  1UEL B;  1NTC A;  1WJD A;  3GLL A;  3MKL A;  1IF1 A;  2ZJP F;  3R0J A;  1JKO C;  1LFB A;  1Y1V J;  1TP4 A;  5TJJ A;  5CLS A;  4L9J A;  1G3T A;  2W84 A;  3OL4 A;  4XLN F;  5D8L B;  4R79 A;  4G6T B;  1IG7 A;  2CO5 A;  2LYC A;  3VWB A;  1X1B A;  2VXZ A;  2NOJ B;  4LLL A;  3WG9 A;  3MAJ A;  2R7X A;  4A0Z A;  2NAZ A;  2ZJ2 A;  2W00 A;  4HEA 2;  3G71 I;  2QLZ A;  3GUD A;  1JHH A;  2FMY A;  4AWX B;  1DQU A;  2E1N A;  2DCE A;  3RJP A;  4M6X A;  5HNH A;  3KZI C;  3GFL A;  3VFZ A;  4Q4Z F;  5LRR A;  5GAE J;  5DS9 A;  2HQ5 A;  4E7K A;  2LR8 A;  3PFI A;  1UG2 A;  3WTT C;  5LGU A;  5HOD A;  1MD0 A;  5DUI A;  1JJ6 C;  2ZFW A;  2VBW A;  3L2C A;  1JHF A;  1YX3 A;  1MH3 A;  5LHG A;  1ZR4 A;  3OY9 A;  2HVS A;  2IT0 A;  1EJ9 A;  2NOG A;  1BI3 A;  4RAZ A;  5FFZ A;  4XRS A;  5HS8 A;  1JKQ C;  3A0H C;  3A02 A;  2XB5 A;  4M9X A;  1VFC A;  1T0F A;  3DBL B;  4G12 A;  5CJ9 A;  3ZQL A;  2BHZ A;  4XLF A;  2CQ7 A;  4M72 A;  1ZG1 A;  2UXX A;  4YG2 F;  5IP9 J;  3TQN A;  3JTH A;  3OOP A;  5J4Y A;  3DF8 A;  2X6X A;  2F4I A;  2A07 F;  1MDM B;  3CCS I;  1ON2 A;  2FSW A;  1XDS A;  1R36 A;  2IGO A;  4HBL A;  2KRH A;  5FKM A;  4P9U A;  1U0J A;  2ID6 A;  4XL9 A;  3TL4 X;  2DT5 A;  3G1M A;  4E7S A;  4E7Z A;  1ITY A;  2Z5U A;  2IPQ X;  1FOY A;  2E1M B;  2Y0M A;  1FMW A;  4A69 C;  2ZNZ A;  1Z91 A;  1YJN I;  2OZU A;  2EQR A;  2NVX J;  3Q0V A;  4K2E A;  4C2M J;  2DN0 A;  3KYC B;  1FJL A;  2PFB A;  1N25 A;  1U3E M;  3CTA A;  1BOB A;  3JRG A;  4ZYA A;  4BHB A;  1WJF A;  4ESJ A;  4EGY A;  3K6G A;  5DV5 A;  4E7J A;  2OQG A;  2RN7 A;  2ZC2 A;  1EH7 A;  2DI3 A;  1ZAO A;  2OD5 A;  3BJO A;  3HHG A;  1BBY A;  1MKM A;  3TW6 A;  4HX8 A;  1ZKG A;  1ZN2 A;  1RI7 A;  2L4A A;  3VYU B;  2GQQ A;  1I39 A;  1BC8 C;  3WTV C;  1ERD A;  4ZH4 F;  1XX5 A;  2LBF B;  3CUQ B;  3K2A A;  2M30 A;  2EV5 A;  4GO1 A;  3K4C A;  3BT9 A;  1F36 A;  4CYC A;  3V8L A;  5JFR A;  3EQL F;  4W97 A;  5IP7 J;  2JA7 J;  4DYC A;  1MMG A;  3AL0 C;  2F6C A;  1QPM A;  1G3S A;  4OMZ A;  2YS9 A;  1IXS B;  1XG1 A;  4BE1 A;  2L9V A;  1U5T A;  3O8G A;  3RTR A;  2MH2 A;  3P9K A;  3BZ6 A;  2MLK A;  3CP2 A;  2AS5 F;  4FE4 A;  2A69 F;  2DO7 A;  4A5M A;  2M0C A;  4HQE A;  2ZSH B;  4ZTF A;  3HZJ A;  1LFP A;  4F55 A;  4HV5 A;  2PQ8 A;  3MD2 A;  1ZGJ A;  1E3O C;  3G3Z A;  1LQ1 A;  2KRF A;  2Z16 A;  4FX0 A;  1T33 A;  1ZLJ A;  3EUH A;  4HZF A;  1MH4 A;  4EM1 A;  3HOY J;  1TNT A;  4P55 A;  4AD9 A;  1IRZ A;  3WTW C;  2VIX A;  3K10 A;  4X0G A;  4DJA A;  1X58 A;  3DQV C;  2HTS A;  1OYY A;  5BPD A;  4XLH A;  4EJW A;  3C2B A;  1SEU A;  3MZH A;  4NNJ A;  3GTG J;  3BR2 A;  4XID A;  3N97 A;  2EIL H;  3HHH A;  2HYG D;  3CJN A;  2A5W A;  2ZME B;  2O03 A;  2DT7 B;  1X1D A;  3LSM A;  4O6J A;  1UHM A;  4X1E A;  3QU6 A;  2Y2Z A;  1ETQ A;  2R93 J;  5IT9 K;  5B5E C;  4CDG A;  2KPM A;  3SDG A;  1ETO A;  2Q2E A;  4A12 A;  3JCU C;  2RC4 A;  3I55 I;  3IKT A;  4A3L J;  3W6V A;  2H1K A;  3CME I;  2V1U A;  5D6E A;  2DA4 A;  1IN8 A;  2DMP A;  2HPM A;  1G8X A;  1D1C A;  2H27 A;  3OYB A;  4L18 B;  5HDG A;  1IZ1 A;  1KU2 A;  1V5F A;  3MWM A;  1RET A;  2EB7 A;  2QZ8 A;  4MGR A;  4KNY A;  5E17 F;  2BEO A;  3HL2 A;  5IPA A;  1O4X A;  1DU0 A;  3QPS A;  1LDK B;  3BC8 A;  3GZN B;  4UUS B;  1ZK8 A;  3IRQ A;  1S7O A;  2LC2 A;  1U5T C;  1S7E A;  2EFO A;  2CFX A;  1KQ0 A;  4IEJ A;  1R9T J;  1RIO H;  1MSE C;  3PNV A;  3ZPL A;  2M9H A;  4PGH A;  3OYD A;  3KX2 A;  2R5Y B;  5AIQ A;  2LRD A;  2M34 A;  3P9I A;  4I98 B;  4XNF A;  3E7L A;  3BPX A;  2RNJ A;  3IAM 2;  4IPA A;  3U2R A;  4UB6 C;  3GCM A;  2LLK A;  2VKE A;  2LNB A;  3PUF A;  4N4O B;  3BP8 A;  2LF8 A;  3E1S A;  4A6D A;  3OR1 C;  1ZRF A;  3EUH C;  4LIV A;  1Y1W J;  3QPT A;  1ETX A;  1HW1 A;  1MJB A;  4M3G A;  1UHW A;  4E7H A;  2Z9O A;  1ETW A;  2IGM A;  2ECB A;  2FD5 A;  2KMU A;  3KZY A;  3EYI A;  2R0Q C;  1W36 D;  1LJ9 A;  4YFN F;  5LRS A;  1U8B A;  1HKT A;  4DGW B;  2NVY J;  5J4V A;  2BY3 A;  4JX6 A;  1F4K A;  3F23 A;  4DNC A;  1HOM A;  4QPO A;  1BJZ A;  5IOZ A;  2MFZ A;  2XGX A;  1AHD P;  1IO2 A;  4Y13 A;  2IS4 A;  4PCQ A;  1R6R A;  2LF7 A;  5HDN A;  1HKQ A;  3ABU A;  1V5G A;  3FXJ A;  3BR3 A;  4C2U A;  1QZZ A;  3LA2 A;  2F5F A;  3GF2 A;  5GAH J;  4CCL A;  5FKO A;  3FXM A;  3BZK A;  4IQJ A;  5EEG A;  5IP6 A;  4LG0 A;  4U88 A;  5DYM A;  4BY1 J;  3G6E I;  4KIG A;  1APL C;  1FY7 A;  2R7D A;  4WK8 F;  2CFO A;  1OFC X;  3C18 A;  3C7J A;  3H9Q A;  3R0A A;  2EIJ H;  4DIQ A;  1VQ9 I;  3I71 A;  5LHH A;  1OQY A;  3E97 A;  3PQK A;  3VOE A;  1TQP A;  2RRE A;  3HYI A;  5E3O A;  1WPK A;  3W2V A;  3QOP A;  1PUE E;  3W2W A;  3K1M A;  4Y4R A;  3E6C C;  1W7P D;  1FSH A;  1ZEL A;  4FET A;  3UKG A;  4D0P A;  2OUM A;  2P8T A;  4BGD A;  3B02 A;  3DEW A;  5EGO B;  2VQG A;  1OCC H;  2Y75 A;  3BTC A;  1O7F A;  4BHP A;  1W0U A;  1X1A A;  3OYM A;  4ZYG A;  2ELK A;  2PEX A;  1VTN C;  3GTP J;  4ABZ A;  4XKW A;  3G4S I;  1MMS A;  3Q5F A;  3S3O A;  2BV6 A;  2WAE A;  3S2W A;  2MD0 A;  1MNE A;  4PSW A;  5F04 A;  1QVT A;  1IRF A;  3H36 A;  4RAG A;  2IXS A;  1RR8 C;  4HNT A;  5ICG A;  5GTH C;  5K7F A;  1K78 A;  5CQE A;  3CDH A;  1A6Q A;  1ZQ3 P;  1QO0 D;  1Z77 A;  2ZBK A;  2VC1 A;  1GXP A;  1X19 A;  2VKD A;  3J7Z I;  5FB2 A;  5GAD J;  1Z6T A;  3HOX J;  2EZL A;  4NB5 A;  1ZRC A;  2BZT A;  2AHQ A;  1WSU A;  2L01 A;  3I56 I;  3OYI A;  4A3I J;  1J9I A;  2Y30 A;  1G4D A;  4F91 B;  1IN6 A;  2OJE D;  1SAN A;  1MBH A;  4EJO A;  1UG0 A;  3ZQI A;  1SAX A;  3LWF A;  3ABL H;  3A01 A;  1C0W A;  4XKB A;  9ANT A;  4GDF A;  2P4W A;  1E3P A;  3JTG A;  3BOQ A;  3HGY A;  2LSO A;  5BMZ A;  1JGG A;  1CQT A;  3NWT A;  4KA4 A;  2EFN A;  5H6Q A;  2R92 J;  3OS2 A;  2OTL I;  4M6V A;  3WHC A;  2OAZ A;  4BJ6 C;  3HEF A;  3IP4 B;  4C3H J;  1NG7 A;  1SD7 A;  1HW5 A;  1R5I D;  1YFH A;  4MFE A;  1P6R A;  4MEX F;  4LK1 F;  2JA6 J;  2FOW A;  1TQM A;  2LH9 A;  2XF5 A;  4BU2 A;  2CUJ A;  2QQB A;  4S05 A;  1TL8 A;  2G9W A;  3J7Y J;  3L2Q A;  1XSV A;  3CCE I;  3ZMU A;  1EV7 A;  3CES A;  3QYF A;  3FF5 A;  1YJW I;  3JRC A;  1TQI A;  3CLO A;  2ME0 A;  3I9V 2;  4XKC A;  2KKO A;  1I3A A;  2J5O A;  5FD6 A;  3K4L A;  4XOT A;  2H1L A;  3K7A J;  4BY7 J;  5DD4 A;  2PJP A;  1LFU P;  4CSW A;  4MHG A;  2JJ7 A;  2HS5 A;  5LBQ A;  3Q0W A;  3CQZ J;  4ESF A;  2JVH A;  2O6G E;  2VON A;  4BEH A;  2CSO A;  1YI2 I;  3RYP A;  2HOS A;  3RQ4 A;  2K27 A;  3H5A A;  2V9P A;  3JSO A;  3FM5 A;  1V5E A;  1WVR A;  2P7C B;  2EA4 A;  2A3S A;  2HOE A;  5F6F A;  5EG0 B;  4MQV A;  1OCP A;  2ISY A;  5IYD J;  1FBS A;  1XCB A;  5KAI C;  4CHU A;  3VSK A;  1YRN B;  1B9N A;  2MGQ A;  1V3F A;  4DZJ A;  2UWM A;  4EGZ A;  2QQ8 A;  3LMM A;  1IJW C;  1Z21 A;  2R7W A;  2KRC A;  4B47 A;  2VN2 A;  3REO A;  2CJJ A;  2BBY A;  4BQQ A;  3B73 A;  2IBD A;  4FQG A;  4FCY A;  5TRD A;  4Y15 A;  2ETH A;  2K7L A;  3FM3 A;  1HBX G;  3QWL A;  3LST A;  3OL3 A;  4I2O A;  1PVE A;  1FC3 A;  3DLA A;  2F5D A;  3F8C A;  1K6O A;  2JWT A;  1UCR A;  5LD2 C;  2ESN A;  4IXA A;  1UB9 A;  4IJA A;  3PIO F;  1ZAR A;  4OIR F;  3AG3 H;  4IVN A;  1HC8 A;  4CCO A;  1R1T A;  1STZ A;  1KON A;  2E36 A;  3DXJ F;  5AON A;  3L2W A;  2STW A;  4AIJ A;  1R71 A;  2JN6 A;  3TED A;  3COA C;  1YLF A;  2R7T A;  2ISZ A;  2BW3 A;  1PJR A;  2ZXH A;  2KHM A;  3A1Y A;  4OAZ A;  1NG6 A;  3VDX A;  2XHK A;  3S17 J;  4UUT A;  2VB6 A;  2R3S A;  1H89 C;  3ZOB A;  1JUS A;  2GOX B;  2E34 A;  3HOS A;  4Y33 A;  3I58 A;  2CV2 A;  1R4M B;  4XSZ F;  1AKH B;  4HSR A;  1PDN C;  4A3B J;  1SFE A;  4FT8 A;  3WGH A;  3F6V A;  1KU9 A;  3TDU C;  1RZ4 A;  3LL7 A;  4YEJ A;  1RKT A;  4YFX F;  1QGP A;  5JHU A;  2DFI A;  3DPL C;  2M87 A;  4M73 A;  2KL4 A;  5CVV A;  2FBK A;  2W7N A;  4UY8 I;  1YIJ I;  5EYR A;  2NNN A;  1Z0X A;  1YO5 C;  4EQQ A;  1GV5 A;  2JT1 A;  4B44 A;  1CF7 A;  1MBJ A;  2X4H A;  5CVU A;  3FKI J;  1V4R A;  5J1Y A;  1ZLK A;  1DPU A;  2XKP A;  1VQ4 I;  1IUF A;  1WRJ A;  1VI0 A;  3CO6 C;  2QBY A;  3I4P A;  3IH2 A;  2ZXJ A;  2X6W A;  4C3J J;  1P7J A;  2JTV A;  3FMR A;  3FK7 A;  4AYB N;  2DT6 A;  2XGE A;  3HSR A;  3NAR A;  4BUP A;  3L00 A;  1S7A A;  3HJE A;  4HAM A;  4AIH A;  4DZP A;  4I76 A;  1PP8 F;  2GXB A;  1O7L A;  5CPR B;  4EJT A;  1Y8R B;  1YS7 A;  2EZH A;  2VBY A;  4I99 C;  4BE0 A;  1FYM A;  1O57 A;  1JGS A;  4LFU A;  4BKX A;  2L54 A;  3R60 A;  5HLI A;  5LFA A;  1J2X A;  3BRO A;  3H5R A;  3IH4 A;  1R00 A;  2K9N A;  3KP7 A;  4DOZ A;  1B6A A;  2BY1 A;  3OR2 C;  4OIN F;  4QLC U;  3GZ6 A;  5DCM B;  4RM2 A;  4IOC F;  2V7F A;  1VND A;  4L9T A;  2GM4 A;  3PO2 J;  3O8H A;  2DK5 A;  4A2U A;  2E7X A;  3FMQ A;  1GHC A;  4NC7 A;  3K1P A;  5FKK A;  4J00 A;  1FYK A;  1FP2 A;  5L3E A;  2IS2 A;  2EZK A;  1ZR2 A;  4IRG A;  4UV9 A;  2P5L C;  2VPR A;  1JI8 A;  2VOP A;  2R7Q A;  5DCF A;  3TMO A;  3HPH A;  2IVM A;  4MIM A;  1MBE A;  5CKT A;  4Y7N J;  2V79 A;  3ZQC A;  3ONQ A;  4I6Z A;  3U21 A;  2LK2 A;  2DOD A;  1MBK A;  4F7Z A;  3SZP A;  4RB2 C;  1JTX A;  1X3Z B;  1REP C;  4LD5 A;  3JRA A;  1K4T A;  3F8B A;  5J3L A;  2STT A;  1H9G A;  2DYR H;  2QA4 I;  1YQA A;  1Y39 A;  4DBQ A;  3CCQ I;  2QM3 A;  2YR2 A;  3K1N A;  1BN5 A;  4AUX A;  1DGW Y;  3TDZ C;  1VQN I;  4U7B A;  3ZMD A;  1IDY A;  3JW4 A;  1FOK A;  3IHU A;  5E3L A;  5H2F C;  1R1U A;  4CCJ A;  4U87 A;  3J7A Y;  2WV1 A;  2RDP A;  3CC2 I;  4KIC A;  1D0X A;  4A6E A;  3V8J A;  4BXU A;  4I0B A;  1YJ9 I;  1WCM J;  1IRX A;  1FOW A;  2FJ1 A;  1P4W A;  5FLV A;  5JVT A;  2H8R A;  3IUO A;  2LD5 A;  3C3W A;  1BI2 A;  1XGN A;  1BR4 A;  2QYO A;  4RGX A;  5E20 A;  2JRT A;  3CCJ I;  3S1M J;  2HU9 A;  2H09 A;  2O0Y A;  3QPL A;  1JT6 A;  4L5J A;  3BQY A;  2FRH A;  4P96 A;  2OZ6 A;  2HVR A;  3AL0 B;  1VQ8 I;  1D1A A;  2VPL A;  3DTK A;  3I54 A;  2K4J A;  5LHI A;  1TW3 A;  1ENH A;  2R7U A;  2A6T A;  3ERE D;  1F1Z A;  2D45 A;  1LNW A;  1S3J A;  3BLY A;  4I7H A;  2VE9 A;  3F72 A;  1HDP A;  3M07 A;  2WB1 N;  3OYN A;  3HOT A;  2VAS A;  3I3L A;  3BG3 A;  2Y0S A;  2Y31 A;  4EV0 A;  3GBG A;  2LKX A;  1ZHF A;  3V4G A;  2OC6 A;  1FYL A;  3KLO A;  4H4K C;  3HDD A;  3TOA A;  2V9K A;  5B3S H;  4HDU A;  3ERM A;  5FRN A;  2JA5 J;  2ZFU A;  4UVA A;  3NEU A;  4LIT A;  1D3Y A;  4BYY A;  3V7R A;  5J6X A;  3KP5 A;  1UST A;  2CRG A;  5ICC A;  1IN4 A;  2M5W A;  1WHU A;  3BTI A;  3HUG A;  1R5H A;  4OOI A;  3SEZ A;  4WCG A;  2HKO A;  1XGS A;  2DAO A;  4DBR A;  3QAH A;  1S9H A;  3GW2 A;  4G6Q A;  2WV0 A;  3DBR B;  3NQO A;  3ZQH A;  4BJ5 C;  3CMA I;  3HBL A;  1A04 A;  3DV8 A;  3MFK A;  4FTH A;  2HWV A;  5HLG A;  1XDU A;  4MTE A;  1MND A;  2VE8 A;  2FNA A;  3O2P E;  2R7O A;  4D7M A;  3RQI A;  2VXD A;  3CCU I;  1D5V A;  4ENK A;  1P2F A;  1V54 H;  1U9O A;  3IV5 A;  4LLN A;  1W5S A;  2KIM A;  3S1Q J;  1E17 A;  2KFD A;  1P7I A;  2JSP A;  1OJL A;  3Q9S A;  3GTO J;  4P5O A;  2E19 A;  4G94 A;  4M3D A;  5IT3 A;  2PMZ N;  5ILV A;  1ONV A;  3KEQ A;  1FBU A;  1MW7 A;  2P6T A;  1R7J A;  5ERI A;  2M0M A;  4RAF A;  3JRH A;  1DUX C;  4XBF A;  3DU6 A;  1K79 A;  3BDD A;  3OSG A;  5F64 A;  1IN5 A;  5M5Y J;  4CYC B;  3RKW A;  1F9N A;  4CYD A;  3BTL A;  2RV8 A;  2GZW A;  3JR9 A;  2JVG A;  4F93 B;  2HQA A;  2HVQ A;  2X1C A;  2F4O B;  5L3G A;  4I09 A;  4BNC A;  5HNF A;  4CO8 A;  4HX4 A;  5ILS A;  4AVZ A;  1U5T B;  3QP5 A;  3L9F A;  2DOF A;  2KP6 A;  4XQF A;  2H6C A;  1GUU A;  2DA5 A;  3QU3 A;  1QU3 A;  4PJ0 C;  2QVO A;  3H1C A;  1AOY A;  1QZY A;  3AG2 H;  4B43 A;  3SXY A;  1RPW A;  3A03 A;  1WJC A;  2UZK A;  2YPR A;  4MLO A;  3VEP A;  1VZ0 A;  3F21 A;  3LSH A;  3H5N A;  3ZCO A;  2FEZ A;  3WTX C;  2DA7 A;  2P6S A;  5E18 F;  5FO5 A;  3TO6 A;  1T2K A;  1ZH5 A;  3ZMS A;  3LQQ A;  4HF0 A;  4YFK F;  1HDD C;  2DQR A;  1JUP A;  4CGZ A;  4IZZ A;  4CCN A;  3AG4 H;  3E6B A;  3GYH X;  2BVL A;  2W24 A;  3Q0U A;  2K40 A;  1T0F C;  1Y6I A;  1QHG A;  4H0E A;  5FKL A;  2Y48 A;  4BJT A;  2B0L A;  2HPI A;  4XN0 A;  2E60 A;  3PUB A;  4XIC A;  5BNG A;  1HF0 A;  3HRM A;  3ZP5 A;  3BR1 A;  1Y0U A;  2E5Z A;  3FIS A;  3HXL A;  1POG A;  3K9T A;  1J75 A;  3IC7 A;  4AIK A;  1H8A C;  2EIN H;  3G2B A;  1GXQ A;  2OPT A;  4QIW N;  3F0C A;  3RI4 A;  4XN3 A;  3HPG A;  2EPF A;  3MMY B;  2VJI A;  4OIQ F;  4J19 A;  5L3F A;  1KA8 A;  2ID3 A;  5CQG A;  1LE8 A;  5K5O A;  3M8F A;  3GTM J;  1B72 A;  2XAS A;  1BIA A;  1EKE A;  4XKV A;  4A3E J;  2L0K A;  1JUM A;  4KN4 X;  2KIQ A;  4UV8 A;  1GDT A;  2JQ7 A;  2ECC A;  2PLY A;  3DKY A;  4KUM A;  4U0W A;  2JSC A;  2RGV A;  2WAD A;  1NHA A;  4JX4 A;  4BXF A;  1Z3X A;  4NC6 A;  5KK1 A;  2VLA A;  1LB2 A;  2DFE A;  5B1A H;  4WX9 A;  3JSP A;  1Z3Y A;  4BAY A;  3GME A;  4R1H A;  2M7B A;  3PNY A;  4NBQ A;  1KYZ A;  1X4P A;  4AYB A;  1ULY A;  3CLQ A;  4I01 A;  4EMS A;  3S14 J;  1CGP A;  3WU0 A;  5EZG A;  3OOU A;  1KYW A;  2D2W A;  4HPQ A;  5JI6 A;  5DTD A;  5F0H A;  3O3K A;  1PUF B;  2XV4 S;  2V6E A;  3J7A O;  3GFJ A;  3OYK A;  2AXT C;  3ML6 A;  1MMN A;  2HTJ A;  4LMY A;  4WXH A;  2HQR A;  5D5X B;  2OTJ I;  4B8X A;  1LEA A;  1BR1 A;  3HG9 A;  3T5X A;  4EJV A;  4IF4 A;  5EJC A;  3KCC A;  1J7K A;  1KU3 A;  1QQI A;  3IWZ A;  3MKY B;  2D1V A;  2L7Z A;  4MFD A;  1DDN A;  3IWF A;  3CF5 F;  3K4J A;  2BXZ A;  2ZXI A;  1ZRD A;  3EDP A;  2OV7 A;  3J80 K;  1HCR A;  5EEH A;  3EUK L;  1IV6 A;  2IA2 A;  1NK2 P;  1BI1 A;  5FD5 A;  2L02 A;  3M9A A;  2NS7 A;  2L3D A;  3DEU A;  3HTS B;  4I02 A;  4KT6 A;  4DQ2 A;  1E0E A;  3TBI A;  4TV7 A;  2X48 A;  4LG0 B;  5H6R A;  4S04 A;  1SC7 A;  2A5Y B;  4JOM A;  1BC7 C;  1YW7 A;  3LA7 A;  5EZH A;  5C4J J;  5JR3 A;  3GTQ J;  4NC8 A;  3LA3 A;  2X1E A;  2VT3 A;  4GRI A;  4IO9 F;  2HDC A;  3RPQ A;  3FXO A;  1DP7 P;  1GV2 A;  1KZH A;  1RUO A;  5A2Q K;  1UJ8 A;  1J0R A;  5B66 C;  3U1D A;  2R7R A;  2G7H A;  2E1O A;  1ETK A;  1HKS A;  2E2I J;  4CCM A;  3CMY A;  4AC0 A;  2CQK A;  3JRD A;  4G6D A;  2F48 A;  3I0T A;  5D4R A;  1FMV A;  1JJ8 C;  1XSX A;  1K78 B;  3SZG A;  2FE3 A;  4XLC A;  2M4G A;  1F43 A;  3WTS C;  2MA3 A;  2RVC A;  4LIU A;  4RMN A;  2KDZ A;  2RQQ A;  2XSJ C;  3R4K A;  4MO7 A;  5FLX K;  3LAP A;  1BIB A;  3K4N A;  2OCE A;  3BJA A;  4RLQ A;  5GTI C;  3G1L A;  5LGN A;  2Y9Z A;  4P1W A;  2WB1 A;  2DTZ A;  3HM5 A;  5FRM A;  2ZO4 A;  2LY9 A;  1YE9 A;  3GLX A;  1XMX A;  1W1W E;  3W3C A;  2IEK A;  4BS9 A;  3MKZ A;  3QOE A;  5CYV A;  1WFX A;  2VC0 A;  3QRF F;  2CQX A;  1A31 A;  3A01 B;  1UAA A;  1UHS A;  3RSN A;  2FBI A;  5ICF A;  3KP6 A;  3OIQ A;  4HV6 A;  1LDD A;  2FU4 A;  2LKS A;  4QSH A;  3ZN1 A;  4ASN A;  2F5V A;  2DJI A;  3JRB A;  2Y69 H;  4Z6Y A;  5DM6 F;  5IT9 Z;  2Y0S N;  2GIV A;  1A36 A;  2X51 A;  1JT0 A;  2CUZ A;  3B6C A;  3ZQQ A;  1FZP B;  1R58 A;  2E7W A;  1X1C A;  4GGG A;  2IW5 A;  3HKZ N;  2DDA A;  1W7P A;  3HB9 A;  4PK4 A;  4LB6 B;  4BE2 A;  2DW4 A;  1LEB A;  1MSF C;  4A93 J;  3B6A A;  1XSD A;  5F27 A;  3W6K B;  1OCT C;  2PMZ A;  1SFU A;  2CW0 F;  4KN7 X;  1FOX A;  3DPU A;  4NUB A;  1RRJ A;  3GEZ A;  2F5E A;  5H20 A;  4KIS A;  5EEA A;  1IW7 F;  3MZY A;  2HYF A;  3E6D A;  3KZZ A;  4BEH B;  3F8N A;  2L7F P;  3G1O A;  1TWF J;  2WAQ N;  4A5N A;  5FFX A;  4HG2 A;  3M8E A;  4ENN A;  3ZMT A;  2MH9 A;  2W4S A;  3QQA A;  3H3U A;  4ZDO A;  1DGR M;  3CF2 A;  2RAE A;  2DQL A;  4BHC A;  5KNL A;  1JXS A;  2XVC A;  3FK6 A;  1W36 C;  5E3N A;  1FP1 D;  1I5Z A;  3WHB A;  2W82 A;  4HLY A;  1Z67 A;  3CJT B;  1K61 A;  3MQ0 A;  3J80 Z;  4PZJ A;  4RLF A;  1XTA A;  3KPH A;  5L3B A;  1K7A A;  2X0L A;  3TO7 A;  4B48 A;  2LMD A;  2MBF A;  3CMM A;  2MC4 A;  2KT0 A;  1WKM A;  2Q0O A;  2HDD A;  4M9S A;  1MNM C;  4AM3 A;  1ACI A;  2OCC H;  3WU2 C;  1DU6 A;  1MMA A;  3U9G A;  2KLO A;  3S3M A;  3IH3 A;  4Y17 A;  3C2G A;  2KJC A;  3K70 D;  3H92 A;  4OIP F;  4V2F A;  1OKR A;  5C44 J;  2A68 F;  3I64 A;  1N78 A;  5M3F J;  3I59 A;  2LKP A;  5JLW A;  2MC3 A;  3T8R A;  4BBR J;  3UR3 C;  1USS A;  4MNU A;  3BQZ A;  2HXI A;  3RPU D;  3LSP A;  1TZL A;  3K69 A;  3GFM A;  5A2Q Z;  5E8G A;  2EJR A;  1IRG A;  2QSF X;  4HYE A;  4LLG F;  2FUG 2;  2EFQ A;  2P7V B;  4CA0 A;  1X2M A;  2BW3 B;  3S1N J;  4NQW A;  4ENM A;  1OPC A;  3AFH A;  3IL2 A;  3BTJ A;  2XAJ A;  5JVG F;  1Q1H A;  1QRY A;  3HTU A;  2XRO A;  1ZTR A;  2EZI A;  1A6I A;  4KIF A;  3M3Y J;  5KHD A;  2DK8 A;  4B3A A;  1ZRE A;  3RZO J;  3QPH A;  4JX5 A;  2QGU A;  3CCR I;  2QSH X;  3RCO A;  2LVS A;  5EDN A;  2LRE A;  3DBH B;  3CP8 A;  1UMQ A;  2V1X A;  4XLA A;  3DTI A;  4PSX A;  2VKV A;  1QZE A;  3CCL I;  5FLX Z;  2HNH A;  2P5V A;  3TP3 A;  5ILU A;  4BQA A;  1D8J A;  2E5N A;  1VQL I;  3WGI A;  1CF7 B;  1IDZ A;  1MMD A;  3L2V A;  4IQ4 A;  4E7I A;  1WI9 A;  1EH6 A;  1U78 A;  1D8K A;  2ZCW A;  4GCV A;  2VL8 A;  1KU7 A;  1PP7 U;  2QBY B;  4ZYE A;  1XMA A;  3LSG A;  2PI0 A;  1WGX A;  2FOK A;  5DD8 A;  2XGD A;  4M71 A;  3DPT A;  4KIB A;  2GLO A;  4C9Y A;  3F8M A;  2W25 A;  1T8I A;  2CG4 A;  3I4M J;  3V8K A;  1BA5 A;  4CZZ A;  2DLL A;  2BXY A;  3WG7 H;  1HA8 A;  1U6G A;  3HOV J;  2GWR A;  1MZB A;  5IOY A;  2FBH A;  3MCZ A;  3T1B A;  1FX7 A;  2Z33 A;  1B8I A;  4QPQ A;  4EJU A;  3CCM I;  2IA1 A;  3TO9 A;  1WI3 A;  2R7F A;  2CWE A;  3FIW A;  3RIR A;  3LSR A;  2DA3 A;  1F5T A;  2VJJ A;  5F0F A;  2CYY A;  2H8W A;  1SMT A;  3GWZ A;  4XMY A;  2DFF A;  3BZC A;  5E8I A;  5KAF C;  3H0D A;  4XOP A;  3BG5 A;  1ODD A;  1BM9 A;  2J5P A;  1XN7 A;  1VQK I;  2NVU B;  4HQM A;  5L3D A;  4KFC A;  3EPZ A;  2AQE A;  3N05 A;  3VB2 A;  1Y8Q B;  2I8D A;  2XAU A;  2NYX A;  3FMS A;  4G9Y A;  5TIS C;  2HGC A;  2LTP A;  3FX3 A;  2WA0 A;  3MEX A;  3ZRG A;  2HR3 A;  2ESH A;  5JLX A;  1S8N A;  2JUG A;  3KEO A;  4FE7 A;  1Z9C A;  4B4C A;  5F08 A;  3EUA A;  3HIF A;  2BHY A;  3KE2 A;  5E79 C;  2Z2S B;  3L7W A;  2HEO A;  3CCV I;  3OV8 A;  1X4O A;  2D5V A;  3FBI B;  3LOC A;  4KDP A;  2VOD A;  4ESB A;  1E3H A;  1TC3 C;  2Z1D A;  3OWT A;  2CU7 A;  3DWL E;  3F22 A;  1OYI A;  3CO7 C;  2G7U A;  3WGG A;  1RR7 A;  2XAQ A;  4WWC A;  3IRR A;  2R4G A;  1TWA J;  3QYE A;  3TW7 A;  4ZC3 A;  4HLX A;  3E6M A;  1YTY A;  4L5I A;  3TP0 A;  1BW6 A;  3M1E A;  3CC4 I;  3BY6 A;  3JRF A;  2M4K A;  3E5U A;  2B9S A;  4MEY F;  1TW2 A;  2AQF A;  2MLG A;  4ZTJ A;  2CUE A;  4HX7 A;  1W0T A;  3TGN A;  3LSJ A;  1VQM I;  1OYW A;  2VQH A;  3IAS 2;  3L2R A;  3WU1 B;  4B3X A;  1FTT A;  1G6N A;  2GOM A;  3ECH A;  1BOA A;  1K6Y A;  1ETV A;  2HDW A;  2XKO A;  3U1K A;  2ME6 A;  4OWR B;  6PAX A;  3CDI A;  4W1U A;  4XLE A;  2DJN A;  4ITV A;  3ABK H;  3F8F A;  3BG6 A;  4U0Y A;  4AID A;  1B4A A;  4F52 A;  5K7Z A;  3ZMZ A;  2EIM H;  2YSR A;  2ZKZ A;  1QA6 A;  1O3S A;  4OU0 A;  3GTJ J;  1T56 A;  2VQC A;  4BQN A;  2DYS H;  3S93 A;  4DYQ A;  2XRN A;  1VQP I;  4F92 B;  5DM7 F;  4PJM A;  1B59 A;  2P81 A;  2NVT J;  3HUG B;  1I6X A;  4AVP A;  4E7L A;  2I5U A;  4IL6 C;  2YX4 A;  5GP9 A;  2CS3 A;  3S3N A;  3R61 A;  5FLM J;  2TCT A;  3H3Z A;  4YIR X;  2IA0 A;  2CUF A;  2M1B A;  3CZ6 A;  3K4B A;  3ECO A;  2CQQ A;  4D9J A;  2QKM B;  2XIG A;  2DMT A;  5KCM A;  5D5U B;  2COB A;  3HOW J;  2PJR A;  3HKZ A;  3KP4 A;  2OA4 A;  4IRH A;  2YX7 A;  1X2N A;  4DYR A;  2BVM A;  2FXA A;  4UUV A;  3PIP F;  2PMU A;  1T38 A;  2TDX A;  2IJL A;  3EET A;  2IS6 A;  4ZDL A;  1IXC A;  4P9F A;  2R5Z A;  1FLI A;  1P92 A;  2I10 A;  4C3I J;  1N77 A;  2K86 A;  3AG1 H;  3D1N I;  1VQ7 I;  4UNO A;  2KZG A;  4N9I A;  3L1P A;  4ENJ A;  4C2T A;  2V9V A;  4UVC A;  2VT2 A;  2WAQ A;  3HOZ J; 
#chains in the Genus database with same CATH homology
 1B9M A;  4Q47 A;  3HRU A;  4ETS A;  5D5V B;  2M8E A;  5J8C A;  4CIC A;  5D6F A;  1EH8 A;  4XLP F;  5HLH A;  1O3T A;  3ELK A;  1XB4 A;  4BH9 A;  2BE5 F;  2YU3 A;  2V1D A;  4ZZL A;  2XAG A;  4G7Z F;  1Z7U A;  4WF2 A;  1IAW A;  3WTZ A;  3C1D A;  2UXN A;  2Z99 A;  5KVR A;  3FHZ A;  5HDK A;  2F5C A;  4GYG A;  3TOB A;  5D8K B;  4LK0 F;  1LDJ A;  2A61 A;  1IXR C;  1WWX A;  3TKY A;  1MDM A;  4Z2Y A;  2H6B A;  1I27 A;  4RB3 C;  4G8X A;  1XMK A;  3AAF A;  4HOB A;  1AWC A;  3EYY A;  3D0S A;  4G7H F;  2EA2 A;  3ISP A;  4E70 A;  4UVB A;  4LB5 A;  5FGM A;  2GAU A;  2QQ9 A;  3E5X A;  4HW0 A;  4UHT A;  3R6S A;  3WE2 A;  2HKX A;  1O3Q A;  5E1Z B;  5LEJ A;  1ON1 A;  5D5W B;  1FBQ A;  5DUK A;  4O3M A;  3NRV A;  2ADU A;  5HOO A;  5ED4 A;  3CUO A;  3KP2 A;  1YG2 A;  5AIP A;  3T8T A;  2JPC A;  3CUQ A;  1ZGA A;  2E1C A;  4CXF A;  3KLN A;  1R22 A;  3VOD A;  1IN7 A;  1WQ2 A;  5HS7 A;  3SZT A;  3RKX A;  4RAY A;  2O3F A;  2O8X A;  1HXD A;  3SQN A;  4O5V A;  2O61 A;  3I53 A;  1HQC A;  3RDI A;  4YII A;  2Z3Y A;  3WE3 A;  4A0Y A;  1J5Y A;  1P4X A;  2OU2 A;  4L0Y B;  2JZY A;  3M7G A;  1E2X A;  1I1S A;  2VOO A;  1KGS A;  1U8R A;  2M45 A;  4I0A A;  4UXN A;  3SFZ A;  2W85 A;  3ROU A;  1GVJ A;  1T39 A;  2QEN A;  3ABT A;  1T6S A;  3JAM K;  3KFW X;  2CGP A;  3RYR A;  2HQN A;  2ZME A;  2MD5 A;  1W4M A;  2PBI A;  4A0X A;  2RKH A;  1IUY A;  2H94 A;  1I1G A;  2W57 A;  3J81 K;  3F6O A;  1MJ9 A;  1R5G A;  4MTD A;  3CUQ C;  1Z6R A;  4L9V A;  4HA8 A;  3DFG A;  4M74 A;  2K02 A;  4EM0 B;  3K2Z A;  2COM A;  1SMY F;  4ZZD A;  3ZQ7 A;  3GX4 X;  4YIF A;  5K5R A;  1ZYR F;  3W6J B;  2EK5 A;  1SFX A;  4IHT A;  1X3U A;  1XCV A;  3BWG A;  5LEK A;  4WXD A;  3F3X A;  2ELH A;  5J8F A;  5K1Y A;  2QUF A;  2WC2 A;  2EFW A;  2EV6 A;  3ZN0 A;  1SD5 A;  4RGU A;  3V7S A;  5CVR A;  1L0O C;  5F1R A;  4KT5 C;  3P7N A;  3V7C A;  2HFH A;  2IP2 A;  5BS6 A;  3BPV A;  5CVI A;  1TLH B;  2FML A;  1YS6 A;  1KQ9 A;  3LFK A;  3ZMV A;  4IHS A;  1W7P B;  4HF1 A;  3E3V A;  5K5Q A;  2AXL A;  4WXC A;  3LQR A;  5BQT A;  5LLQ A;  2NRA C;  2WTE A;  2C6Y A;  3FXR A;  3Q9V A;  5DEQ A;  5LGT A;  1TBX A;  1OR7 A;  2BGC A;  4EM2 A;  2EWN A;  1ZG3 A;  2FQ3 A;  2RQP A;  4QWQ A;  4M9Z A;  1YIO A;  3HSE A;  2NNY A;  4Q5S F;  4KYW A;  1JE8 A;  2IRF G;  5L3C A;  5BPI A;  4EVI A;  4JQF A;  3P9C A;  1G3Y A;  2WWY A;  4RGS A;  1FT9 A;  4N0B A;  3JAM Z;  2ACJ A;  3G73 A;  2QWW A;  1S6L A;  4PDK A;  3I59 B;  2Q8K A;  1W5T A;  1YW8 A;  4RB1 A;  4XSX F;  4NHJ A;  4LJZ F;  1FWZ A;  3J81 Z;  4FHT A;  3K0L A;  2GA2 A;  4Q48 A;  1G3W A;  1BJA A;  1Z05 A;  2NS0 A;  3FZV A;  1L3L A;  1BI0 A;  3RKY A;  1FSE A;  4JK1 X;  3GZ5 A;  4R8H A;  4GXO A;  3KP3 A;  1HST A;  1OMI A;  2OQR A;  1H0M A;  4L0Z B;  2VBX A;  1SD6 A;  2V6C A;  2DPU A;  2DBB A;  3WTU C;  3N4M A;  2XAF A;  2KIF A;  1HSJ A;  2GXG A;  4M6Y A;  2DPD A;  1FNN A;  1T98 A;  2PG4 A;  4GYI A;  1KQ8 A;  4HF2 A;  3HRS A;  3KET A;  3LAJ A;  1O3R A;  1UFM A;  2F2E A;  2HZT A;  3ULQ B;  1MGT A;  2DTR A;  1XGO A;  2KIU A;  1MJA A;  4ZYH A;  5HS9 A;  3RPU A;  4L9N A;  3GFI A;  3FWE A;  4U0V A;  3IKV A;  1R23 A;  4KMF A;  2K4B A;  5E1W A;  3O6B B;  4N9H A;  1DPR A;  2DU9 A;  5BOX A;  4ON0 A;  3SHF A;  5ICE A;  2LDU A;  3I5U A;  3DP7 A;  1H9T A;  2QQA A;  3HSF A;  4IRI A;  4RGR A;  4RS8 A;  3D5L A;  4OMY A;  1RNL A;  2JPB A;  2XAH A;  5D4S A;  1S29 A;  1TNS A;  2BYV E;  2EFP A;  4PGG A;  1P4A A;  1SD4 A;  1YYV A;  3L09 A;  4KMU X;  1FPQ A;  3WOD F;  2L4M A;  1HW2 A;  1XD7 A;  4LGW A;  1J59 A;  4ZYD A;  1RUN A;  3FXU A;  1XGM A;  1U2W A;  2PMH A;  1ZG5 A;  2FF4 A;  4FX4 A;  4JBA A;  1Z1D A;  5E1X A;  2GA1 A;  4B09 A;  2OBP A;  4G7O F;  1TTY A;  4MQ9 F;  2KJB A;  1QNT A;  2A6H F;  5HVQ C;  5CVJ A;  3WTY C;  1YW9 A;  1QBJ A;  2P5K A;  3BJ6 A;  2EV0 A;  5DCM A;  4RB0 A;  4OIO F;  4HDV A;  3T0Y A;  2VBZ A;  4XRF A;  3DKW A;  2XUB A;  2FA5 A;  2A6E F;  1R1V A;  1B1B A;  3FXQ A;  1LVA A;  2D1H A;  2ZNY A;  3E5Q A;  3QP6 A;  3PQJ A;  4U7D A;  3GXO A;  3GVA A;  2PN6 A;  5DDG A;  3GO5 A;  2FNP A;  3HRT A;  1IF1 A;  3R0J A;  5TJJ A;  5CLS A;  4L9J A;  1G3T A;  2W84 A;  4XLN F;  5D8L B;  4R79 A;  2CO5 A;  2VXZ A;  4LLL A;  3WG9 A;  3MAJ A;  4A0Z A;  2NAZ A;  2ZJ2 A;  2QLZ A;  3GUD A;  1JHH A;  2FMY A;  4AWX B;  2E1N A;  3RJP A;  4M6X A;  3GFL A;  3VFZ A;  4Q4Z F;  5LRR A;  3PFI A;  3WTT C;  5LGU A;  1MD0 A;  5DUI A;  2ZFW A;  2VBW A;  3L2C A;  1JHF A;  5LHG A;  2IT0 A;  1BI3 A;  4RAZ A;  5FFZ A;  5HS8 A;  4M9X A;  1T0F A;  5CJ9 A;  4M72 A;  1ZG1 A;  2UXX A;  4YG2 F;  3TQN A;  3JTH A;  3OOP A;  3DF8 A;  2A07 F;  1MDM B;  1ON2 A;  2FSW A;  1XDS A;  1R36 A;  4HBL A;  4P9U A;  2DT5 A;  2Z5U A;  2IPQ X;  2Y0M A;  2ZNZ A;  1Z91 A;  2OZU A;  4K2E A;  2PFB A;  1U3E M;  3CTA A;  4BHB A;  4ESJ A;  4EGY A;  5DV5 A;  2OQG A;  2RN7 A;  1EH7 A;  2DI3 A;  1ZAO A;  2OD5 A;  3BJO A;  3HHG A;  1BBY A;  1MKM A;  4HX8 A;  1ZN2 A;  1RI7 A;  2L4A A;  2GQQ A;  1BC8 C;  3WTV C;  4ZH4 F;  3CUQ B;  2M30 A;  2EV5 A;  4GO1 A;  3V8L A;  5JFR A;  3EQL F;  1QPM A;  1G3S A;  4OMZ A;  1IXS B;  1U5T A;  3RTR A;  2MH2 A;  3P9K A;  3BZ6 A;  2MLK A;  2AS5 F;  2A69 F;  2DO7 A;  4A5M A;  4HQE A;  4HV5 A;  2PQ8 A;  1ZGJ A;  3G3Z A;  1LQ1 A;  2KRF A;  4FX0 A;  1ZLJ A;  3EUH A;  4HZF A;  4EM1 A;  1TNT A;  4P55 A;  4AD9 A;  3WTW C;  3DQV C;  2HTS A;  1OYY A;  5BPD A;  4EJW A;  3MZH A;  3N97 A;  3HHH A;  2HYG D;  3CJN A;  2ZME B;  2O03 A;  4O6J A;  1UHM A;  3QU6 A;  5IT9 K;  4CDG A;  2Q2E A;  4A12 A;  2RC4 A;  3IKT A;  2V1U A;  5D6E A;  1IN8 A;  2H27 A;  4L18 B;  5HDG A;  1IZ1 A;  1KU2 A;  3MWM A;  2EB7 A;  2QZ8 A;  4MGR A;  4KNY A;  5E17 F;  2BEO A;  1LDK B;  3IRQ A;  1S7O A;  1U5T C;  2EFO A;  1RIO H;  2CFX A;  1KQ0 A;  3ZPL A;  4PGH A;  5AIQ A;  3P9I A;  4I98 B;  3BPX A;  2RNJ A;  4IPA A;  3U2R A;  2LNB A;  3BP8 A;  2LF8 A;  4A6D A;  1ZRF A;  3QPT A;  1HW1 A;  1MJB A;  1UHW A;  2Z9O A;  3EYI A;  3KZY A;  1LJ9 A;  4YFN F;  5LRS A;  1HKT A;  1F4K A;  3F23 A;  4DNC A;  2XGX A;  4Y13 A;  4PCQ A;  2LF7 A;  5HDN A;  1HKQ A;  3ABU A;  1QZZ A;  3LA2 A;  2F5F A;  3GF2 A;  5EEG A;  4LG0 A;  4U88 A;  5DYM A;  4KIG A;  1FY7 A;  2R7D A;  4WK8 F;  3C18 A;  3C7J A;  3R0A A;  3I71 A;  5LHH A;  3E97 A;  3PQK A;  3VOE A;  1TQP A;  3HYI A;  3QOP A;  1PUE E;  3K1M A;  3E6C C;  1W7P D;  1FSH A;  4D0P A;  2P8T A;  3B02 A;  2Y75 A;  1O7F A;  4BHP A;  4ZYG A;  2PEX A;  1VTN C;  3Q5F A;  2BV6 A;  3S2W A;  1IRF A;  5ICG A;  1K78 A;  3CDH A;  1QO0 D;  2ZBK A;  2VC1 A;  1GXP A;  5FB2 A;  1Z6T A;  4NB5 A;  1ZRC A;  1WSU A;  2L01 A;  1J9I A;  1G4D A;  1IN6 A;  4EJO A;  1SAX A;  3LWF A;  1C0W A;  2P4W A;  3JTG A;  3BOQ A;  5BMZ A;  2LSO A;  4KA4 A;  2EFN A;  5H6Q A;  2OAZ A;  1SD7 A;  1HW5 A;  1YFH A;  1P6R A;  4MEX F;  4LK1 F;  1TQM A;  2QQB A;  4S05 A;  2G9W A;  1XSV A;  3ZMU A;  1EV7 A;  3FF5 A;  1TQI A;  3CLO A;  2KKO A;  5FD6 A;  2J5O A;  5DD4 A;  2PJP A;  4MHG A;  2HS5 A;  5LBQ A;  4ESF A;  2O6G E;  2VON A;  2CSO A;  3RYP A;  2K27 A;  3JSO A;  3FM5 A;  2P7C B;  2EA4 A;  2A3S A;  2HOE A;  5F6F A;  4MQV A;  2ISY A;  1FBS A;  1XCB A;  4CHU A;  1B9N A;  1V3F A;  2UWM A;  4EGZ A;  2VN2 A;  3REO A;  2BBY A;  3B73 A;  5TRD A;  4Y15 A;  2ETH A;  2K7L A;  3FM3 A;  1HBX G;  3LST A;  4I2O A;  1FC3 A;  2F5D A;  3F8C A;  1K6O A;  1UCR A;  2ESN A;  4IXA A;  1UB9 A;  4IJA A;  1ZAR A;  4OIR F;  4IVN A;  1R1T A;  1STZ A;  3DXJ F;  5AON A;  2STW A;  4AIJ A;  3COA C;  1YLF A;  2ISZ A;  2XHK A;  2R3S A;  3HOS A;  3I58 A;  4XSZ F;  1PDN C;  1SFE A;  3WGH A;  4FT8 A;  3F6V A;  1KU9 A;  3TDU C;  1RZ4 A;  4YFX F;  1QGP A;  5JHU A;  2DFI A;  3DPL C;  2M87 A;  4M73 A;  5CVV A;  2FBK A;  2NNN A;  1YO5 C;  4EQQ A;  2JT1 A;  1CF7 A;  2X4H A;  5CVU A;  1V4R A;  1ZLK A;  1DPU A;  2XKP A;  1WRJ A;  3CO6 C;  2QBY A;  3I4P A;  2ZXJ A;  2JTV A;  3FMR A;  3HSR A;  3L00 A;  1S7A A;  4HAM A;  4AIH A;  1PP8 F;  2GXB A;  1O7L A;  4EJT A;  1YS7 A;  2VBY A;  1FYM A;  1O57 A;  1JGS A;  4LFU A;  2L54 A;  3R60 A;  5HLI A;  1J2X A;  3BRO A;  1R00 A;  3KP7 A;  1B6A A;  4OIN F;  4QLC U;  3GZ6 A;  5DCM B;  4L9T A;  2DK5 A;  4A2U A;  2E7X A;  3FMQ A;  1GHC A;  3K1P A;  1FYK A;  1FP2 A;  5L3E A;  4IRG A;  4UV9 A;  2P5L C;  2VOP A;  5DCF A;  2IVM A;  2V79 A;  4F7Z A;  3SZP A;  4RB2 C;  1REP C;  4LD5 A;  3F8B A;  2STT A;  1H9G A;  1YQA A;  2QM3 A;  2YR2 A;  3K1N A;  1BN5 A;  3TDZ C;  4U7B A;  3ZMD A;  3JW4 A;  1FOK A;  3IHU A;  1R1U A;  2RDP A;  4KIC A;  4A6E A;  3V8J A;  4BXU A;  4I0B A;  1P4W A;  5JVT A;  3C3W A;  1BI2 A;  1XGN A;  5E20 A;  2QYO A;  4RGX A;  2JRT A;  2O0Y A;  2H09 A;  4L5J A;  4P96 A;  2FRH A;  2OZ6 A;  3I54 A;  5LHI A;  2K4J A;  1TW3 A;  3ERE D;  1F1Z A;  2D45 A;  1LNW A;  1S3J A;  4I7H A;  2VE9 A;  3F72 A;  3HOT A;  4EV0 A;  1ZHF A;  3V4G A;  1FYL A;  3KLO A;  3TOA A;  4HDU A;  4UVA A;  3NEU A;  1D3Y A;  4BYY A;  3V7R A;  5J6X A;  5ICC A;  3KP5 A;  1UST A;  1IN4 A;  2M5W A;  3HUG A;  4OOI A;  1R5H A;  4WCG A;  2HKO A;  1XGS A;  2DAO A;  3QAH A;  3GW2 A;  4G6Q A;  2WV0 A;  3NQO A;  1A04 A;  3DV8 A;  3MFK A;  2HWV A;  5HLG A;  1XDU A;  4MTE A;  2VE8 A;  2FNA A;  3O2P E;  1D5V A;  4ENK A;  1P2F A;  1E17 A;  4LLN A;  1W5S A;  2KIM A;  3Q9S A;  4P5O A;  4G94 A;  5IT3 A;  5ILV A;  1ONV A;  3KEQ A;  1FBU A;  2P6T A;  1R7J A;  5ERI A;  1DUX C;  4XBF A;  1K79 A;  3BDD A;  5F64 A;  1IN5 A;  3RKW A;  1F9N A;  4CYD A;  2RV8 A;  2GZW A;  5L3G A;  4I09 A;  4BNC A;  4CO8 A;  4HX4 A;  5ILS A;  1U5T B;  3QP5 A;  3L9F A;  2H6C A;  3QU3 A;  2QVO A;  1AOY A;  1QZY A;  3SXY A;  2UZK A;  2YPR A;  3VEP A;  3F21 A;  2FEZ A;  3WTX C;  2P6S A;  5E18 F;  5FO5 A;  3TO6 A;  1T2K A;  1ZH5 A;  3ZMS A;  3LQQ A;  4HF0 A;  4YFK F;  2DQR A;  4CGZ A;  3E6B A;  3GYH X;  2W24 A;  4H0E A;  2Y48 A;  2B0L A;  3HRM A;  3ZP5 A;  1Y0U A;  3K9T A;  1J75 A;  3IC7 A;  4AIK A;  1GXQ A;  3RI4 A;  4OIQ F;  5L3F A;  1KA8 A;  5K5O A;  3M8F A;  2XAS A;  1BIA A;  4KN4 X;  4UV8 A;  2PLY A;  4KUM A;  4U0W A;  2JSC A;  2RGV A;  1NHA A;  5KK1 A;  1LB2 A;  4WX9 A;  3JSP A;  4BAY A;  4R1H A;  1KYZ A;  1ULY A;  4I01 A;  4EMS A;  1CGP A;  3WU0 A;  1KYW A;  2D2W A;  5JI6 A;  3O3K A;  2XV4 S;  3J7A O;  3GFJ A;  3ML6 A;  2HTJ A;  4LMY A;  4WXH A;  2HQR A;  5D5X B;  4B8X A;  1LEA A;  3T5X A;  4EJV A;  4IF4 A;  3KCC A;  1J7K A;  1KU3 A;  1QQI A;  3IWZ A;  2D1V A;  1DDN A;  3IWF A;  1ZRD A;  3EDP A;  3J80 K;  5EEH A;  2IA2 A;  1BI1 A;  5FD5 A;  2L02 A;  3M9A A;  2L3D A;  3DEU A;  3HTS B;  4I02 A;  4DQ2 A;  4TV7 A;  4LG0 B;  5H6R A;  4S04 A;  2A5Y B;  1BC7 C;  1YW7 A;  3LA7 A;  5JR3 A;  3LA3 A;  2VT3 A;  2HDC A;  3RPQ A;  1DP7 P;  1RUO A;  5A2Q K;  1J0R A;  3U1D A;  2G7H A;  1HKS A;  2CQK A;  4G6D A;  3I0T A;  5D4R A;  1XSX A;  1K78 B;  2FE3 A;  3WTS C;  2MA3 A;  2RVC A;  3R4K A;  5FLX K;  3LAP A;  1BIB A;  3BJA A;  5LGN A;  2ZO4 A;  3GLX A;  5CYV A;  2VC0 A;  3QRF F;  2FBI A;  5ICF A;  3KP6 A;  4HV6 A;  1LDD A;  2FU4 A;  3ZN1 A;  4ASN A;  5IT9 Z;  2GIV A;  1FZP B;  1R58 A;  2E7W A;  4GGG A;  2IW5 A;  1W7P A;  4LB6 B;  2DW4 A;  1LEB A;  1XSD A;  3W6K B;  1SFU A;  2CW0 F;  4KN7 X;  3GEZ A;  2F5E A;  5H20 A;  1IW7 F;  3MZY A;  2HYF A;  3E6D A;  3KZZ A;  3F8N A;  4A5N A;  5FFX A;  3M8E A;  4ENN A;  3ZMT A;  2MH9 A;  3H3U A;  2DQL A;  4BHC A;  1JXS A;  2XVC A;  1FP1 D;  1I5Z A;  4HLY A;  3MQ0 A;  3J80 Z;  4PZJ A;  5L3B A;  1K7A A;  2X0L A;  3TO7 A;  2MBF A;  1WKM A;  2Q0O A;  4M9S A;  3U9G A;  4Y17 A;  2KJC A;  3H92 A;  4OIP F;  1OKR A;  2A68 F;  3I64 A;  3I59 A;  2LKP A;  2MC3 A;  3T8R A;  1USS A;  4MNU A;  3K69 A;  3GFM A;  5A2Q Z;  5E8G A;  2EJR A;  1IRG A;  4HYE A;  4LLG F;  2EFQ A;  2P7V B;  4NQW A;  4ENM A;  1OPC A;  3IL2 A;  2XAJ A;  1Q1H A;  3HTU A;  2XRO A;  4KIF A;  2DK8 A;  1ZRE A;  3QPH A;  2V1X A;  5FLX Z;  2P5V A;  5ILU A;  1D8J A;  4BQA A;  3WGI A;  1CF7 B;  1WI9 A;  1EH6 A;  1U78 A;  1D8K A;  2ZCW A;  4GCV A;  1KU7 A;  1PP7 U;  2QBY B;  4ZYE A;  1XMA A;  2PI0 A;  2FOK A;  5DD8 A;  4M71 A;  3DPT A;  4KIB A;  3F8M A;  2W25 A;  2CG4 A;  3V8K A;  4CZZ A;  2DLL A;  1U6G A;  2GWR A;  1MZB A;  2Z33 A;  2FBH A;  3MCZ A;  3T1B A;  1FX7 A;  4EJU A;  2IA1 A;  3TO9 A;  2R7F A;  2CWE A;  3RIR A;  1F5T A;  2CYY A;  1SMT A;  3GWZ A;  5E8I A;  1ODD A;  1BM9 A;  2J5P A;  1XN7 A;  4HQM A;  5L3D A;  4KFC A;  3VB2 A;  3FMS A;  4G9Y A;  2NYX A;  2HGC A;  3FX3 A;  3MEX A;  2HR3 A;  2ESH A;  1S8N A;  3KEO A;  1Z9C A;  3HIF A;  3KE2 A;  3L7W A;  2HEO A;  3OV8 A;  4KDP A;  2VOD A;  4ESB A;  3F22 A;  1OYI A;  3CO7 C;  2G7U A;  3WGG A;  3IRR A;  2XAQ A;  4WWC A;  4HLX A;  3E6M A;  1YTY A;  4L5I A;  3M1E A;  3BY6 A;  3E5U A;  4MEY F;  1TW2 A;  2MLG A;  4HX7 A;  3TGN A;  1OYW A;  3WU1 B;  1G6N A;  3ECH A;  1BOA A;  2XKO A;  6PAX A;  3F8F A;  4U0Y A;  1B4A A;  3ZMZ A;  2YSR A;  2ZKZ A;  1O3S A;  4OU0 A;  2XRN A;  1B59 A;  1I6X A;  4AVP A;  2YX4 A;  3R61 A;  3H3Z A;  2IA0 A;  2M1B A;  3ECO A;  2XIG A;  5D5U B;  3KP4 A;  2OA4 A;  4IRH A;  2YX7 A;  2FXA A;  4UUV A;  2PMU A;  1T38 A;  2TDX A;  2IJL A;  3EET A;  1IXC A;  4P9F A;  1FLI A;  1P92 A;  2K86 A;  4UNO A;  4N9I A;  4ENJ A;  2V9V A;  4UVC A;  2VT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...