4LG0B

Structure of a ternary foxo1-ets1 dna complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
106
structure length
106
Chain Sequence
GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a ternary FOXO1-ETS1 DNA complex
rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords Forkhead box protein O1
total genus 37
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2013-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4lg0B00
4BHCA 1RNLA 4A5NA 4GYIA 1KYZA 4ZYEA 1B4AA 4EJTA 4ESJA 2EB7A 1USTA 5L3EA 2CSOA 2VC0A 3ZMDA 2STWA 5D8LB 3F6OA 2QZ8A 2WV0A 3JSOA 5LHGA 1AOYA 1P2FA 3BROA 1HW2A 4Y15A 2XUBA 1ZG1A 2OU2A 4L9TA 1BN5A 3DFGA 2BGCA 4L5IA 1MJ9A 3FX3A 3H3UA 3WTVC 2UZKA 5IT9Z 2VOPA 5F64A 2VBZA 3F23A 2P8TA 2IA1A 4A6EA 1EH7A 2F5CA 1KQ8A 3MCZA 2ZKZA 1UHWA 2QLZA 1O57A 2HKXA 2G9WA 4XBFA 2ZO4A 3EDPA 2FMYA 2VT3A 2XAGA 2XV4S 4ON0A 4MNUA 2NYXA 2P4WA 4G8XA 4UNOA 4IXAA 2HOEA 2O61A 2ZXJA 1HSJA 5DUKA 3V4GA 3HTSB 3V8JA 2HQRA 1FY7A 2Z3YA 4OINF 1YLFA 1ZREA 4WF2A 1ZLKA 2COMA 3EQLF 3PFIA 1P92A 4BH9A 5D8KB 3ZMTA 1ZHFA 3KZZA 3E5QA 4XLPF 1B1BA 5DCFA 4PZJA 1MD0A 1RIOH 1DUXC 1FOKA 4OIPF 3RIRA 2P6SA 2Z99A 4ASNA 1SFEA 2EFOA 3KEOA 5LBQA 4WWCA 3G73A 1STZA 4RAYA 5K5OA 4RB1A 5DEQA 3ZMSA 1FSHA 1GXQA 4P9FA 2DK5A 4B09A 2HZTA 5K5RA 2MD5A 2HEOA 3C1DA 3R61A 4Y17A 3WG9A 2FOKA 2A6HF 3M8EA 2Y0MA 2EK5A 3AAFA 5D5XB 4ENKA 1EH6A 2ELHA 5K1YA 2BE5F 2DTRA 2V1UA 2HTSA 2IVMA 5DD4A 1TLHB 1Z91A 5DUIA 3IL2A 2CG4A 3GO5A 3ISPA 2GWRA 1HQCA 1LQ1A 1H0MA 3HIFA 4EGYA 3KZYA 1U5TA 5CVRA 4CYDA 1LVAA 4UXNA 1WWXA 3EYYA 1FYMA 1XGMA 5LEKA 1IN5A 4U0WA 2PI0A 3LFKA 3I4PA 1OYIA 4WCGA 1ON1A 4OMZA 4UV8A 4Q5SF 1FWZA 2MC3A 3ZN0A 1XB4A 5E1XA 2XHKA 3E5UA 2VN2A 3QRFF 2BYVE 4KT5C 1QPMA 5CVUA 5L3DA 2XGXA 4WXHA 1OKRA 3I64A 2V6CA 1WI9A 2D1VA 4R1HA 1W7PA 4R8HA 4LFUA 5TJJA 1K78B 3ZN1A 1B9MA 1RUNA 2TDXA 3CTAA 4ZYGA 1J9IA 2YSRA 3VEPA 3GEZA 2FF4A 1PP7U 2RQPA 5D6EA 3IRQA 2P5LC 4I0BA 5E1ZB 1REPC 2CYYA 2XAQA 1XSVA 1K6OA 2ZJ2A 1L0OC 2LNBA 1P6RA 5HS8A 3KETA 4HOBA 2D1HA 2DU9A 2DI3A 4MEXF 3C3WA 1R1TA 4I09A 4KIFA 2ZNYA 3FM5A 4IPAA 2OZUA 5LRRA 1XGSA 5CVVA 3KP3A 3TO6A 5L3BA 4KMUX 5DCMB 5ED4A 1G3TA 3RPQA 3IC7A 5KVRA 3SZPA 2M8EA 3BDDA 4CDGA 4RGRA 4IRHA 1W7PD 3RPUA 1ZN2A 5LLQA 5A2QK 2HYGD 3Q9VA 2ISYA 1T2KA 2WTEA 4LK1F 2DT5A 2W84A 4A6DA 4N9HA 4YG2F 3EUHA 2VC1A 3LAPA 4KN4X 3FHZA 2DO7A 2OAZA 4AIKA 4CICA 3FWEA 4PGHA 3I58A 1XSDA 3CUQB 4ZH4F 3D5LA 2RNJA 2A69F 2VE8A 3QU6A 4U0YA 1XDUA 1U78A 2LF8A 1GVJA 1H9TA 1LDDA 4BXUA 1QZYA 4UVBA 4WXCA 3RTRA 3R60A 1SMYF 1FC3A 3R0AA 1EV7A 1R22A 3E97A 3JTHA 1XGNA 4M6XA 2QM3A 3GF2A 2MA3A 1CGPA 1I27A 1KQ9A 3Q5FA 4OIQF 2FMLA 5D5UB 3K1MA 1IXRC 2PEXA 4ZYDA 2EFNA 4HV5A 2W25A 1YW9A 3L2CA 1FYKA 2JPCA 4KIBA 2OQRA 3HHGA 2CO5A 1JHHA 2XKOA 4AD9A 3HUGA 1HW1A 1U3EM 1R7JA 1C0WA 1HXDA 2P7VB 3MFKA 2W85A 1SFUA 5HLIA 1QQIA 4RB0A 1F9NA 2AS5F 3GZ6A 1ZRFA 1TQIA 2EV6A 1FSEA 2OA4A 4RAZA 1LEAA 5ICEA 3F8NA 4YFKF 2KRFA 1AWCA 2QQBA 2IPQX 4M9ZA 4I0AA 5EEGA 4UV9A 3LA7A 3IHUA 1DPRA 1P4AA 4BAYA 4A5MA 2HS5A 5D6FA 4XSZF 3T8TA 1QNTA 4P5OA 3M8FA 2X4HA 3R6SA 1U5TB 4HX7A 4WX9A 3S2WA 2IP2A 4ENNA 4P9UA 4EM0B 5FLXK 1KYWA 4FT8A 3FXQA 4LG0A 3RJPA 1B6AA 4GYGA 2K4JA 4KMFA 4G7HF 2H27A 1EH8A 4MTEA 1XCVA 2HQNA 1ZG3A 2QUFA 2RGVA 1F1ZA 4G9YA 4KNYA 3VB2A 1FBQA 1W5SA 2GXGA 1HW5A 3V8KA 3NRVA 5LRSA 3K9TA 3TDZC 3IWFA 2ZFWA 5JI6A 5E8GA 2V9VA 3ZP5A 5BPDA 4LB5A 4QWQA 1YTYA 3ZQ7A 1WKMA 3HSEA 1ZAOA 3E5XA 2F5FA 1YS6A 5CVJA 2HGCA 4D0PA 3WE2A 3MEXA 1IRGA 3LA2A 1Z9CA 4ESFA 2GZWA 4MQVA 1I6XA 2PN6A 2NNNA 2EWNA 2UXXA 2OBPA 1O7LA 4CGZA 5ICFA 4L9JA 4KN7X 2DAOA 4KIGA 2H6CA 3C18A 3ULQB 4HF1A 1ZARA 3D0SA 4M74A 1JE8A 3IWZA 5CJ9A 5HDGA 2FXAA 3K1NA 1KA8A 5ILVA 3SXYA 3FM3A 3QOPA 1XDSA 2IW5A 1O7FA 3P9KA 3RDIA 3ZMVA 2E7WA 5E8IA 1JXSA 3M7GA 2A6EF 2VBWA 2VBYA 2M87A 5ICGA 4YIIA 5E20A 2QBYB 4UUVA 4LK0F 4EM1A 5LEJA 1MJAA 1KU3A 1TTYA 1ULYA 2L4MA 4G6QA 1ZYRF 2RKHA 2J5PA 2L54A 2FNAA 1BBYA 4IVNA 5D5WB 3OV8A 5E1WA 4PDKA 4U0VA 3SZTA 1H9GA 3RI4A 3I53A 3GZ5A 3N97A 2XASA 3J80K 2H94A 1KU9A 5J8FA 2VT2A 3F72A 3HOSA 3R4KA 3SQNA 2A3SA 3I0TA 2PQ8A 1OYYA 1U8RA 5E18F 2BV6A 2LKPA 1U6GA 1QGPA 3KCCA 1OMIA 1R36A 3FMQA 3JW4A 2RVCA 4KFCA 1MKMA 1T0FA 4XRFA 4NB5A 2ESNA 1YQAA 4PGGA 3V7SA 1R1UA 1FBUA 1PP8F 5KK1A 2PLYA 2VONA 1W5TA 3FMSA 5JHUA 2ESHA 2K86A 2IRFG 1ZGJA 1SD5A 5EEHA 4U88A 1SAXA 4A0YA 2V79A 5ILUA 1QO0D 1BOAA 2FBKA 3IRRA 1KQ0A 3VFZA 2KJBA 3BOQA 2HDCA 1W4MA 3O6BB 1ZGAA 3F8CA 1YYVA 4UVCA 5FO5A 2JT1A 2LDUA 2VXZA 2VODA 1FP2A 3EETA 4IHSA 1JHFA 5ERIA 3LAJA 3GUDA 1MJBA 3N4MA 3RYPA 1Z7UA 6PAXA 2M30A 4KYWA 2RDPA 4BNCA 4HV6A 3TOBA 2FBIA 3L9FA 4ZZDA 3DKWA 5FB2A 3KP2A 2Q8KA 1BIAA 2R7FA 4IRIA 2XAFA 2O03A 4LJZF 1HBXG 3T8RA 3KP4A 5LGTA 1USSA 4ENJA 2UXNA 4MEYF 3P9IA 1ZG5A 2W57A 2PFBA 4YIFA 2JTVA 3QP5A 3GWZA 5DDGA 1WQ2A 1D5VA 3U2RA 4HQMA 1J59A 2EFPA 5DV5A 3JSPA 4RB3C 3Q9SA 3F22A 5JVTA 2EA4A 3EYIA 1LDKB 3OOPA 1RUOA 2LSOA 3H3ZA 3P9CA 4IRGA 4FX4A 1XMAA 1SFXA 4EVIA 2M5WA 4U7DA 1P4WA 3K69A 3QU3A 3ZMUA 2BEOA 1O3RA 3BJOA 3BPVA 1BM9A 1CF7A 3GW2A 3WTYC 3DXJF 5HS7A 5K5QA 2UWMA 3H92A 3RKXA 4EM2A 1V4RA 1ZH5A 3WGHA 1D8KA 2EFQA 3E6MA 2HYFA 4KUMA 3V7RA 1I1GA 1O3TA 2PBIA 3RYRA 2Z9OA 3JAMZ 1O3QA 3KLNA 5F1RA 3DPTA 2O3FA 2QQ9A 1XD7A 1P4XA 3GXOA 4HYEA 5HS9A 3W6JB 4A0ZA 3T1BA 1BC8C 1UCRA 2RV8A 3HRSA 2CW0F 3J81K 1F5TA 2P7CB 5HVQC 1T98A 2Q2EA 2M45A 4N0BA 1S3JA 1MZBA 3HTUA 4WXDA 1IXSB 2YX7A 3CDHA 1U5TC 5L3FA 3DP7A 2FQ3A 1T6SA 3QP6A 1ZRDA 4S05A 4I2OA 1KGSA 3RKWA 2GAUA 1TW3A 1G3YA 2E1CA 4GCVA 1SD7A 3JTGA 4HDVA 1IN7A 1HKSA 2CQKA 3IKVA 1J2XA 4MTDA 2EFWA 2JRTA 1YFHA 2V1XA 2YU3A 3R0JA 3F8MA 5HDNA 3DF8A 3F8FA 2DPUA 4PCQA 4ZZLA 2A61A 2OZ6A 5FFXA 4HX8A 3FXRA 3WGGA 2KIMA 4EGZA 1Z6RA 1UB9A 3J80Z 2L02A 2XAJA 3K2ZA 1OPCA 2JPBA 3TO9A 1D3YA 1J0RA 4LLGF 3CO7C 2NNYA 1IZ1A 3WTZA 3KP7A 2X0LA 2PG4A 1YW8A 3KP6A 2QYOA 4CO8A 1DPUA 1S7OA 3PQJA 2XKPA 3GFJA 4HLYA 5E17F 1O3SA 3NEUA 3HRUA 2ACJA 4A0XA 3HYIA 4ENMA 3COAC 4OOIA 4LGWA 2HKOA 5LGNA 2O8XA 4AWXB 5IT9K 4RGSA 3KEQA 1KU7A 3HRTA 4RGUA 3L00A 1R5GA 3J81Z 2KIFA 5BMZA 3F8BA 3V7CA 2RC4A 1YO5C 2PMHA 5FFZA 4AIJA 2ADUA 4MQ9F 4O5VA 3V8LA 4U7BA 2DFIA 4XSXF 3SHFA 1T38A 1S29A 2VOOA 3WTUC 2DW4A 2FSWA 4OU0A 1BC7C 4K2EA 1SD4A 3KE2A 2J5OA 3CJNA 2NAZA 3LA3A 4MHGA 2ISZA 5FLXZ 4BQAA 4L5JA 5H6RA 3WODF 1LEBA 1RZ4A 5TRDA 1LNWA 2IA0A 1QZZA 1IF1A 2ZCWA 3BP8A 1K79A 3MZHA 2Z5UA 4Q47A 4M6YA 2PJPA 1TQPA 2HFHA 4N9IA 3WTSC 3E6DA 4XLNF 2OQGA 5HLHA 2ZNZA 1BI1A 2ZMEB 1R1VA 4L0YB 2V1DA 1I1SA 4Y13A 3CLOA 3GX4X 4HDUA 1Z05A 2DQLA 3TDUC 2PMUA 3KP5A 2W24A 1LJ9A 2XRNA 4EMSA 3WU1B 5FGMA 2EV0A 1T39A 3GFIA 2AXLA 1S8NA 1CF7B 4IJAA 4L9NA 4I01A 2DBBA 1E2XA 4HAMA 1XSXA 3TOAA 1D8JA 1E17A 1F4KA 3ROUA 1SD6A 4LG0B 4P55A 3F6VA 3HSFA 5FD5A 2MH9A 5BOXA 1BI2A 1XGOA 2NRAC 3E6CC 1DDNA 2MH2A 4AIHA 4IF4A 4I7HA 3QPHA 3WGIA 1FT9A 1S7AA 5FD6A 2P6TA 3FZVA 4S04A 3MZYA 1DP7P 1K78A 3FF5A 4NQWA 1FX7A 1ZRCA 2KKOA 1ZLJA 4EQQA 3T0YA 2EA2A 1B59A 4KA4A 3PQKA 1V3FA 3BJ6A 4GO1A 1YS7A 3ECOA 1L3LA 1XMKA 1FLIA 4M9XA 1SMTA 1FZPB 3BY6A 3ERED 3GFMA 3DPLC 4RGXA 2GA1A 2RN7A 4DQ2A 4EJVA 3KFWX 3LWFA 5DYMA 3CO6C 1XN7A 4FX0A 1IW7F 4IHTA 1RI7A 3TGNA 4B8XA 1MDMA 1Z6TA 1S6LA 3ZMZA 2GIVA 2K02A 3GFLA 1UFMA 4ETSA 2XVCA 1IXCA 3T5XA 2WC2A 4EV0A 2R7DA 3QAHA 1ON2A 3LSTA 3VODA 2FNPA 4LLLA 2IJLA 3QPTA 1FYLA 2YPRA 1IN4A 4HX4A 2FBHA 3ECHA 1IRFA 2Y75A 4GGGA 5ILSA 1OR7A 1WSUA 2FRHA 2HTJA 4G6DA 4MGRA 2GA2A 4O3MA 1UHMA 3LQQA 4I98B 4WK8F 2FE3A 5CLSA 4Z2YA 2OD5A 2HWVA 1BIBA 4BYYA 2DK8A 4BHBA 3E6BA 3F3XA 2Q0OA 3MWMA 1IN8A 2XROA 1VTNC 4ESBA 4E70A 4HQEA 1PDNC 1IN6A 4A2UA 2DPDA 2ZMEA 4CZZA 1TW2A 1U2WA 2YR2A 5AIPA 4HA8A 2QVOA 1Q1HA 3B73A 2K4BA 5BQTA 3M1EA 1BI0A 3RKYA 5HLGA 1R5HA 4R79A 4LLNA 2FA5A 4LMYA 5LGUA 3G3ZA 2JZYA 3REOA 3DEUA 3I59A 1JGSA 3TO7A 2P5KA 5J6XA 3P7NA 5H6QA 3J7AO 2STTA 2H09A 4JBAA 3GLXA 4F7ZA 2FU4A 1R23A 3C7JA 3HOTA 1IUYA 3L09A 1ONVA 1R00A 2QQAA 2VBXA 1OYWA 2M1BA 4JQFA 5CYVA 4EJWA 4Q48A 1XCBA 2H6BA 2DQRA 1R58A 4G7OF 2KJCA 1BI3A 3BPXA 3HRMA 2K7LA 4JK1X 3CUOA 4QLCU 2HR3A 4L18B 4DNCA 3GYHX 5ICCA 2ETHA 1GXPA 3FXUA 4CXFA 1MDMB 2B0LA 4LD5A 3MQ0A 2CGPA 3O3KA 2Z33A 1TBXA 1G6NA 3JAMK 2DLLA 3BZ6A 2F5DA 1HSTA 1X3UA 5LHHA 1HKQA 3ML6A 2YX4A 3DQVC 3KLOA 4P96A 1YIOA 2KIUA 1GHCA 3O2PE 3DV8A 3ABTA 2A5YB 4A12A 2CWEA 3WTTC 2IA2A 2WWYA 5JFRA 1G3WA 3I5UA 3VOEA 3K1PA 1TQMA 1FP1D 1W7PB 2MLKA 3NQOA 4Q4ZF 4I02A 1K7AA 4HF2A 2E1NA 4M72A 5BS6A 4CHUA 4GXOA 1J7KA 3ABUA 4HZFA 4O6JA 1IAWA 2C6YA 4G94A 2EJRA 4UVAA 5F6FA 2L4AA 3LQRA 1BJAA 5BPIA 2ZBKA 3HHHA 2K27A 5D5VB 1LDJA 3TQNA 2G7HA 3U1DA 1FBSA 4HLXA 1WRJA 2A68F 1Z1DA 4KDPA 5D4RA 1FNNA 3IKTA 5IT3A 3W6KB 4M71A 4FHTA 4ZYHA 3U9GA 1NHAA 2VE9A 2L01A 2XIGA 3CUQA 5DD8A 3BJAA 2EV5A 4UHTA 2A07F 1G3SA 2XAHA 1J5YA 4G7ZF 2MBFA 3GVAA 4OIRF 5CVIA 2D2WA 5JR3A 4HBLA 3K0LA 2BBYA 1HKTA 1QBJA 5H20A 2O0YA 4M73A 4EJUA 2P5VA 3M9AA 4H0EA 5HDKA 4KICA 3WTWC 3ZPLA 2G7UA 4YFXF 1A04A 3I59B 1YW7A 3SFZA 3TKYA 4OMYA 5D4SA 2D45A 4HW0A 5DCMA 2O6GE 2F5EA 4M9SA 4AVPA 1YG2A 1MGTA 2QBYA 1TNSA 2F2EA 4EJOA 2QWWA 5AONA 3F21A 3MAJA 3I71A 5J8CA 3WE3A 2LF7A 4TV7A 2IT0A 1J75A 1LB2A 5LHIA 1ODDA 4RS8A 3FMRA 1TNTA 2QENA 5AIQA 3CUQC 3L7WA 2L3DA 3BWGA 2JSCA 2E7XA 5A2QZ 4YFNF 2R3SA 4LB6B 5L3CA 4NHJA 3B02A 2NS0A 1G4DA 4BHPA 4HF0A 3I54A 4L0ZB 4OIOF 5HOOA 3ELKA 3HSRA 5L3GA 1I5ZA 3WTXC 1B9NA 2GQQA 2FEZA 2CFXA 3E3VA 1FPQA 1PUEE 1KU2A 1Y0UA 4L9VA 2GXBA 2MLGA 4RB2C 3WU0A 2Y48A
chains in the Genus database with same CATH superfamily
4BHCA 1RNLA 4M3GA 4E7JA 4A5NA 1YX5A 2HPIA 4GYIA 1KYZA 4ZYEA 4NBQA 4P1WA 1B4AA 4EJTA 4MIMA 3HGYA 4ESJA 2EB7A 1USTA 2L2OA 3H0GJ 2CSOA 5L3EA 4XORA 2M7AA 2JA8J 2VC0A 3BG7A 1VQ8I 2VI6A 5DTDA 3ZMDA 2STWA 2F4OB 5D8LB 1XC5A 4DYRA 3F6OA 2QZ8A 2WV0A 3JSOA 5LHGA 2KIQA 3OYLA 1AOYA 1P2FA 5GAEJ 1HA8A 3BROA 2XGCA 1X1CA 1HW2A 2XPWA 2CU7A 1R6RA 4Y15A 2XUBA 1ZG1A 2OU2A 4L9TA 1BN5A 2O5RA 2X6YA 4JX4A 3DFGA 1D0YA 4S0HB 1JT6A 2BGCA 4Y7NJ 4L5IA 2H8RA 2KFDA 1MJ9A 1EKEA 3FX3A 1T33A 3DLAA 3K2AA 3FKJA 3H3UA 3WTVC 2UZKA 5GAHJ 5IT9Z 2VOPA 5F64A 2VBZA 3F23A 2P8TA 2IA1A 4HSRA 3VYTB 2MG4A 4A6EA 1EH7A 3BTLA 1P7IA 2F5CA 1KQ8A 1BW6A 3MCZA 2ZKZA 1UHWA 2QLZA 1O57A 3OYGA 3D5SC 1ENHA 3ZRGA 2ZJRF 3DPUA 2HKXA 3FXLA 3S1MJ 2G9WA 4OAZA 2E35A 1XTAA 3FXJA 4XBFA 2EPFA 2ZO4A 3S14J 3EDPA 1A6QA 3ABLH 2FMYA 2VT3A 2XAGA 2XV4S 4ON0A 3S3MA 3D5RC 4MNUA 3H5NA 2IS2A 2OTJI 4BQQA 3OSFA 2NYXA 2Y0SA 2P4WA 2PMZN 4G8XA 5B3SH 4IXAA 4UNOA 3M07A 4C2TA 1SFKA 2HOEA 2ZXJA 2O61A 1HSJA 2HVQA 1TL8A 4BQNA 1R4NB 2WV1A 5DUKA 3V4GA 1JKQC 3DTKA 3HTSB 3S1RJ 2R5YB 3V8JA 2HQRA 2XDVA 1ZR2A 1JGGA 1FY7A 2Z3YA 4OINF 1JTXA 3GBGA 1YLFA 5JVGF 1V5FA 5KAIC 2DA1A 3AG3H 4CZCA 4WF2A 1ZREA 1ZLKA 4HG2A 1DU0A 3WHCA 2COMA 3EQLF 1UHSA 3DBHB 3PFIA 5FKNA 1P92A 4BH9A 4B47A 4XL9A 5D8KB 1BOBA 4PK4A 2JJ7A 3ZMTA 1ZHFA 2OJED 1X3ZB 3KZZA 3A0HC 3E5QA 4XLPF 1B1BA 1TWGJ 1WJEA 5DCFA 4PZJA 1MD0A 5K7ZA 4NUBA 1RIOH 1DUXC 1BJZA 1FOKA 3CF5F 3CCJI 4OAYA 3CLQA 3EUKL 1VQLI 4OIPF 3RIRA 2P6SA 4A3DJ 4AVZA 1YOVB 2Z99A 4ASNA 4V2FA 1SFEA 1NH3A 2EFOA 5F27A 3KEOA 5LBQA 4L5EA 4WWCA 3G73A 1STZA 1VQ9I 4RAYA 5K5OA 3C2BA 4RB1A 2CH0A 4D9JA 5DEQA 3ZMSA 1Z3XA 1FSHA 1YJNI 1GXQA 4P9FA 4KJZA 2DK5A 4B09A 2HZTA 1VQNI 5K5RA 2MD5A 2HEOA 3C1DA 2CQXA 4IZZA 3JRAA 3BT9A 3HM5A 3R61A 2BY2A 3M8JA 2WAQA 1HF0A 4Y17A 5CKTA 2FOKA 3WG9A 2A6HF 1S7EA 3M8EA 1SFOJ 2Y0MA 4DYCA 2EK5A 3AAFA 1X1AA 5D5XB 2JWTA 4ENKA 2EH3A 1EH6A 4Y3OA 2ELHA 3OL4A 5K1YA 2BE5F 2DTRA 2BXZA 2BHZA 1LFBA 1GVDA 2V1UA 4A3EJ 2DXIA 2HNHA 2HTSA 1TWAJ 4RLFA 2IVMA 5DD4A 4M3FA 3OS2A 1TLHB 1Z91A 4XLHA 5DUIA 3IL2A 1OLTA 3DLLF 2CG4A 3GO5A 3ISPA 2ZB9A 2GWRA 2QF7A 1HQCA 3VSKA 4XR6A 3ZGKA 2Y2ZA 4OWRB 1H0MA 3HIFA 3JRCA 1LQ1A 4EGYA 3BLYA 3KZYA 3RKQA 1U5TA 5CVRA 4RBOA 4CYDA 1HDDC 1LVAA 1WVRA 4UXNA 4M3EA 5KAFC 1WWXA 2KPMA 3EYYA 1FYMA 1XGMA 4RAFA 5LEKA 1IN5A 1X3WB 5IYCJ 4U0WA 2PI0A 3LFKA 3L1PA 1A6IA 3K10A 3I4PA 1OYIA 5TISC 4WCGA 1ON1A 1VF9A 2CRGA 3K4CA 3PIPF 2XPVA 4A3FJ 4OMZA 4UV8A 2ID6A 1R9TJ 4DW6A 2E1MC 4Q5SF 1ITYA 1FWZA 2Z1DA 2MC3A 3C2HA 1XB4A 3ZN0A 2V4JC 3NWTA 3RZDJ 5E1XA 2XHKA 3E5UA 3MZ8A 1XMXA 2VN2A 3FXMA 3QRFF 3W2AA 2BYVE 1T8IA 2KISA 4KT5C 5IP7J 1QPMA 3NAUA 1OCOH 2MFZA 5CVUA 5L3DA 2XGXA 1OR7C 4WXHA 1X1BA 4G6TB 4IQJA 1OKRA 3I64A 2V6CA 2HVSA 1WI9A 2D1VA 2QQ8A 1X2MA 3OIOA 4XKWA 4N4NB 2XGEA 4R1HA 1HC8A 2CS3A 1W7PA 4R8HA 3IAM2 4IL6C 4BXFA 4LFUA 5TJJA 1K78B 3ZN1A 1B9MA 5FLVA 1OQYA 2W48A 1RUNA 1VQ6I 4YIRX 2TDXA 1WFXA 3QYBA 4BU2A 5KNLA 3DCFA 2W00A 2HDDA 3CTAA 4CCNA 4ZYGA 1J9IA 2YSRA 1SVOA 3GEZA 3VEPA 2FF4A 4MO7A 1PP7U 2RQPA 5D6EA 3IRQA 2P5LC 4BS9A 3HPGA 3CCYA 4I0BA 5E1ZB 5EJCA 1REPC 2CYYA 3I4NJ 2XAQA 1XSVA 3PSFA 1K6OA 2ZJ2A 3HBLA 3ZCOA 4HEA2 2FD5A 1L0OC 2LNBA 1DU6A 4KITB 1P6RA 2LMDA 2K3PA 2V9PA 1VQ5I 5FRMA 1DP3A 2AQEA 2BVMA 5HS8A 3KETA 3LL7A 2D1HA 2DU9A 4HOBA 2DI3A 3G4SI 4MEXF 3C3WA 1Y8QB 1R1TA 4I09A 1YJWI 4KIFA 2ZNYA 1K61A 1E3HA 3RQIA 2AO9A 3P5JA 2Z16A 2JQ7A 4XQFA 1W36D 2K9MA 1PYVA 2XF6A 4FCYA 3OY9A 3FM5A 2GLOA 3AL0C 5FKLA 3KIOA 4W1UA 3M1CA 1WJ5A 4IPAA 2Y30A 4Z6YA 2OZUA 5LRRA 1PVEA 1XGSA 5CVVA 3KP3A 3TO6A 1NK3P 2EINH 5L3BA 4UY8I 1WI3A 2GOMA 4KMUX 2IEKA 2H1KA 5DCMB 4CA0A 5ED4A 5C4JJ 4BE1A 5FKKA 1XPXA 2BHYA 2VASA 3FHNA 1VQKI 3OYEA 1G3TA 1H8AC 3RPQA 3IC7A 4F93B 5KVRA 2LRDA 4XLCA 2MD0A 3SZPA 2PX9A 5E3OA 2M34A 2NVTJ 2M8EA 3BDDA 4CDGA 2JA6J 1ZELA 4B3AA 3H36A 4RGRA 3Q0VA 4IRHA 2DFHA 1GV5A 1W7PD 4HPQA 1N77A 1JI8A 1ETQA 3O8HA 3LSGA 3RPUA 3Q0WA 2IGNA 1ZN2A 1ETXA 3VDXA 5LLQA 5A2QK 3WU2C 2HYGD 3CC7I 3Q9VA 3A01B 2NVYJ 4D1QA 2ISYA 3D1NI 2KLOA 3GTQJ 4B48A 1T2KA 2WTEA 4BACA 1VZ0A 4LK1F 3CDIA 2DT5A 2W84A 3UNGC 4A6DA 4N9HA 4NQWB 4YG2F 3EUHA 3KPHA 2VC1A 3LAPA 4KN4X 2LKXA 3FHZA 2DO7A 2OAZA 4A3JJ 3HOYJ 3K4NA 4AIKA 5CQEA 3OIQA 2UUZA 4CICA 3FWEA 4PGHA 2B9SA 3I58A 1XSDA 2ZFUA 3CUQB 3DBLB 3OYBA 4ZH4F 2E2HJ 3D5LA 4ZC3A 1JUPA 2RNJA 2VE8A 2A69F 2MABA 1U9OA 2TCTA 3PM1A 3QQAA 3BQZA 3QU6A 3LNQA 5IP9J 4U0YA 1XDUA 2WAQN 1W5CC 3BG5A 2LF8A 1U78A 1GVJA 1H9TA 3ZQLA 1LDDA 5DS9A 4BXUA 1QZYA 2R93J 2MYSA 1O4XA 4UVBA 4WXCA 3RTRA 3R60A 1SMYF 1FC3A 1FEXA 3CJQB 2M0MA 1T0FC 3R0AA 2F48A 3EUHC 4XM3A 1D0XA 1EV7A 1R22A 3S1NJ 3E97A 3JTHA 1XGNA 4M6XA 5F1JA 2QM3A 3GF2A 2MA3A 4IHVA 2CUFA 1CGPA 1I27A 1KQ9A 2M9HA 3Q5FA 4OIQF 2FMLA 2R5YA 5D5UB 3OYCA 1IRXA 3SYTA 3K1MA 1DGWY 3LSKA 4A3BJ 1IXRC 2PEXA 1Y0NA 4ZYDA 2GM4A 4J01A 3S3OA 2XF7A 4LIVA 4C2UA 2EFNA 4HV5A 4U87A 2JUCA 2OPTA 5EG0B 2W25A 1MH3A 1YW9A 4NC8A 3L2CA 3CCLI 4HNUA 2CFOA 1FYKA 2JPCA 1KONA 2KQRA 2DMPA 4KIBA 1PJRA 1WJDA 2OQRA 3HHGA 2CO5A 1JHHA 2XKOA 2ME6A 4AD9A 3HUGA 2FOWA 1LE8B 1IDZA 1HW1A 1IJWC 1U3EM 3HKZN 1LE8A 1R7JA 4II2A 3CCQI 1C0WA 4YELA 1HXDA 2P7VB 3MFKA 2W85A 3OYIA 3JCUC 1SFUA 4DBRA 5HLIA 2MSYA 1Y56A 1AKHB 1QQIA 4XOPA 4PSXA 3BR1A 5M3MJ 4RB0A 1F9NA 2AS5F 2LBFB 4F3QA 3GZ6A 3VYRB 1ZRFA 1TQIA 2W4SA 2EV6A 1FSEA 2OA4A 3OIPA 4RLQA 4RAZA 4X0GA 1LKXA 1LEAA 4D5CA 5ICEA 3BG3A 3QPSA 3F8NA 1HDPA 1MIJA 3TP0A 4LITA 1MNDA 3OR2C 3A4CA 4C9YA 4E7LA 1JJ8C 4YFKF 2XGDA 1E0EA 2KRFA 2O7OA 1AWCA 3OSGA 1A31A 2QQBA 1QA6A 1NK2P 2IPQX 4M9ZA 3BCBA 3DU6A 4I0AA 5EEGA 2DT6A 2EZKA 4UV9A 4HNVA 5HNHA 3GTKJ 3CESA 3LA7A 4PJNA 1TZLA 3IHUA 1JUMA 1DPRA 1Y1VJ 5C44J 1P4AA 4BAYA 5GPAA 2AQFA 4A5MA 3CMYA 2HS5A 4C30A 2Y31A 1AA7A 5D6FA 4XSZF 2Q1ZB 5M5YJ 1WH5A 3BQYA 3T8TA 1QNTA 4P5OA 3W2WA 5M3FJ 4A69C 1OCPA 3M8FA 3S3NA 1MSEC 4GDFA 2X4HA 3R6SA 1U5TB 4DYQA 2PMZA 4HX7A 4IEJA 4WX9A 3S2WA 2IP2A 2BXYA 3CCVI 4ENNA 4P9UA 2IGKA 4EM0B 5FLXK 1KYWA 4FT8A 3FXQA 4LG0A 3VSLA 1JUSA 3RJPA 3OS0A 4BDZA 5LD2C 2WY7Q 1B6AA 3G1MA 4GYGA 2KZGA 2K4JA 4KMFA 4XICA 4G7HF 2H27A 1EH8A 4MTEA 2DOFA 1XCVA 2HQNA 1ZG3A 3AG2H 1VQPI 3TBIA 2QUFA 3HZJA 2RGVA 1F1ZA 3H5RA 3DEWA 4G9YA 4QIWN 2YU9J 4KNYA 2EIJH 4IX7A 2D5VA 3VB2A 1FBQA 1W5SA 4E7HA 2GXGA 1HW5A 2LREA 4RMNA 3NRVA 3V8KA 5LRSA 4BDYA 3K9TA 3TDZC 2X6OA 3IWFA 2ZFWA 5JI6A 5E8GA 2V9VA 3ZP5A 5BPDA 2CQ7A 4E6KG 4XKCA 4LB5A 3HOWJ 4QWQA 1YTYA 1SANA 3ZQ7A 4ABZA 1UAAA 1WKMA 3HSEA 1ZAOA 1EJ9A 3E5XA 5EDNA 3HOVJ 2F5FA 4BEHB 1BR1A 1YS6A 5CVJA 2HGCA 4D0PA 3WE2A 4DIQA 3MEXA 4ZDLA 3FBNB 1IRGA 2VQHA 3LA2A 2DA4A 4DJAA 2VPLA 1Z9CA 4ESFA 2E5ZA 2KDZA 2GZWA 3KYDB 4MQVA 1I6XA 2PN6A 2NNNA 1KZHA 3LOCA 2EWNA 3LSHA 1MH4A 2UXXA 3OL3A 1VQMI 2OBPA 4HSTA 1QVTA 1QVUA 1APLC 4CYCA 1O7LA 4CGZA 5ICFA 4L9JA 3M3YJ 4KN7X 1R71A 1Z3YA 2DAOA 3OMYA 4KIGA 1ETYA 2H6CA 4RM3A 3C18A 3ULQB 5LFAA 4HF1A 3SEZA 1ZARA 3D0SA 4M74A 1JE8A 1YITI 2HXIA 3IWZA 2ID3A 2K9QA 5CJ9A 5HDGA 2FXAA 3B6AA 1X4OA 3K1NA 2ECBA 3PNYA 1KA8A 2VPRA 5ILVA 2JVHA 4KISA 3SXYA 3FM3A 3QOPA 3GTOJ 1XDSA 2IW5A 1O7FA 2Q2EB 4FE7A 3P9KA 3RDIA 3TW7A 3ZMVA 2E7WA 3J7YJ 5E8IA 4NC6A 1JXSA 1OCRH 2LD5A 3M7GA 2W7NA 1D1AA 2E2IJ 3PSIA 3ZQCA 4H4KC 2A6EF 2VBWA 5FRNA 2VBYA 2M87A 2QSGX 5ICGA 2L7MP 2ZSIB 2WB1N 4YIIA 1MSFC 5E20A 2QBYB 4UUVA 1HOMA 4LK0F 4EM1A 5KHDA 1J09A 2WY8Q 2QSFX 5LEJA 1U8BA 3TEDA 1MJAA 1QHHD 1VI0A 4X1EA 1KU3A 1GDTA 2QA4I 2ECCA 3MKYB 2R7SA 3GCMA 1TTYA 3NARA 2R5ZB 4CSWA 1ULYA 2L4MA 4G6QA 1ZYRF 3ONQA 3DTEA 2DDAA 4MFEA 2RKHA 2R5ZA 1FMVA 2J5PA 3PJRA 3MMYB 4UUTA 1LFUP 2L54A 1ZK8A 2FNAA 2HPMA 1BBYA 4IVNA 5D5WB 3OV8A 5IP6A 4J19A 1H89C 3TW6A 5E1WA 4PDKA 4U0VA 3QODA 3SZTA 1H9GA 3RI4A 2HQAA 3I53A 1TT5B 3GZ5A 3A01A 3N97A 1RC9A 3UR3C 1Y39A 4E7KA 2XASA 4F92B 3J80K 3MN2A 5E3LA 1X4PA 2H94A 1KU9A 1YJ9I 4IHXA 5J8FA 3DWLE 5GTIC 3RCOA 3AL0B 2VT2A 3F72A 1RETA 3HOSA 3R4KA 3SQNA 2A3SA 2QGUA 3I0TA 4NNJA 2PQ8A 1OYYA 1U8RA 5E18F 2HQ5A 2BV6A 2LKPA 2BW3A 1U6GA 2VQGA 1QGPA 3CZ6A 3RSNA 1VNDA 3KCCA 4CCMA 1OMIA 1R36A 2WBMA 3FMQA 3JW4A 2E2JJ 4BXXJ 2OV7A 2RVCA 4KFCA 4FETA 1MKMA 3IH3A 1T0FA 4XRFA 4NB5A 5BNGA 4DGWB 2ESNA 1YQAA 3O8GA 4PGGA 4XKVA 3V7SA 1R1UA 2HXOA 4M6VA 1FBUA 2A6TA 5DM7F 1WZ2A 1NG7A 2M4GA 1PP8F 3SFIA 3L2RA 3QPLA 5KK1A 5B1BH 2PLYA 4J00A 2VONA 2L5QA 1W5TA 2VIXA 3S16J 4XONA 2GOXB 2L9SA 3FMSA 5JHUA 4FTHA 2ESHA 2K86A 3JR9A 4QTRA 1UJ8A 2EBIA 2RREA 2IRFG 1ZGJA 1SD5A 2NS7A 5EEHA 3CCMI 4U88A 1SAXA 2K3FA 1IRZA 4A0YA 1MBHA 2HI3A 2IBDA 2V79A 3SJMA 5ILUA 1QO0D 2ZXHA 1BOAA 1RKWA 3HXLA 3W6VA 4GRIA 2FBKA 3IRRA 1U9NA 1I39A 1KQ0A 3HDDA 4XLAA 3BR5A 3VFZA 2KJBA 2IS6A 1X19A 1XS9A 3KYLA 3BOQA 2HDCA 1WH7A 3CDLA 1W4MA 3O6BB 2VQCA 1ZGAA 3F8CA 3KEYA 2DMUA 1YYVA 5J1RA 4UVCA 1MW7A 3BTCA 5FO5A 2JT1A 3JREA 4IKFA 3FBIB 3S2HJ 3H35A 4RDUA 2LDUA 2VXZA 2VODA 1FP2A 3EETA 4PFPA 1FMWA 1PUFB 2HDWA 4IHSA 1JHFA 5ERIA 1K83J 2XB5A 3K4KA 3LAJA 3GUDA 3N05A 3ZQGA 1MJBA 2EQRA 2KDOA 4NDLA 3N4MA 3H9GA 2LC2A 1E3PA 1OFCX 1WCMJ 3RYPA 1Z7UA 5GAGJ 6PAXA 3E0JB 1XG1A 2M30A 4AU7A 4KYWA 1ZTRA 5J4VA 2R7XA 2RDPA 4BNCA 1FOXA 4HV6A 3FISA 3TOBA 2FBIA 3L9FA 2G0EA 1MNMC 4ZZDA 3DKWA 4B3XA 4A3CJ 5FB2A 2BVLA 2L0KA 3KP2A 2Q8KA 1BIAA 2R7FA 3PNVA 4IRIA 3HPHA 4LOCA 2XAFA 2O03A 4LJZF 2V7FA 4CCJA 3T8RA 1HBXG 4G12A 1X1PA 4CCOA 4I76A 2K85A 3KP4A 5LGTA 1USSA 4ENJA 3BZCA 2UXNA 2H8WA 4MEYF 3P9IA 1ZG5A 1TWHJ 3HC7A 1YRNA 2W57A 2PFBA 4Y4RA 4BY7J 4YIFA 1WJAA 4B43A 2JTVA 3QP5A 2ZSHB 1OCTC 3GWZA 1WQ2A 5DDGA 1D5VA 3U2RA 2R7ZJ 4HQMA 2DA3A 3QWLA 1K4SA 1J59A 2EFPA 1IG7A 5DV5A 3JSPA 5GADJ 3B6CA 4RB3C 3Q9SA 3F22A 5JVTA 5HLTA 2N8GA 2EA4A 2I8DA 2V26A 3EYIA 4D7MA 5M5XJ 1LDKB 2R7TA 3OOPA 1RUOA 2V6EA 2LSOA 3H3ZA 4BQOA 3P9CA 4IRGA 3JRDA 4FX4A 1XMAA 4ZTJA 1SFXA 4EVIA 3GTGJ 2M5WA 4U7DA 1P4WA 3K69A 3QU3A 3ZMUA 2BEOA 1O3RA 3BJOA 3VWBA 2LG4A 3BPVA 1BM9A 1CF7A 3GW2A 1IV6A 3E1SA 5CPRB 3WTYC 3DXJF 5HS7A 2I5UA 5GP9A 5K5QA 2UWMA 3S1QJ 3H92A 3RKXA 2DMQA 2R0QC 1RR8C 4EM2A 1V4RA 1ZH5A 3WGHA 1D8KA 2EFQA 2M2EA 1A36A 2L9RA 3E6MA 5EF6A 2HYFA 4KUMA 3V7RA 1I1GA 1O3TA 4A3LJ 2PBIA 3CCSI 3CJRB 3RYRA 2DA6A 4B1RA 2Z9OA 3JAMZ 4YRVA 1O3QA 3KLNA 3AG4H 2R7UA 4BBRJ 1FTZA 1DGRM 4PUSA 1K4TA 5F1RA 1ETWA 3DPTA 4RM2A 2E19A 2P81A 2O3FA 2QQ9A 1XD7A 2OUMA 2LH9A 2L9VA 1P4XA 3GXOA 4HYEA 5HS9A 1QPIA 3W6JB 4A0ZA 3T1BA 1BC8C 1UCRA 2MW8A 2RV8A 3HRSA 2CW0F 4XRMA 3J81K 1F5TA 1S9HA 2IGMA 3AFHA 2WAFA 2P7CB 3AG1H 5HVQC 1T98A 2Q2EA 2M45A 4N0BA 1P7JA 1S3JA 1MZBA 3HTUA 2RAEA 4WXDA 1IXSB 2O9LA 2IS4A 2YX7A 3BR0A 3CDHA 3LSIA 4W97A 3RPUD 1U5TC 4A3GJ 4X6AJ 5L3FA 3K4BA 1T56A 3DP7A 2FQ3A 3LSMA 1T6SA 2RQQA 3QP6A 4ZTFA 1ZRDA 4S05A 2KT0A 2GIZA 4I2OA 1KGSA 3OYMA 1G59A 3RKWA 1TWFJ 1IC8A 2GAUA 2JSPA 1TW3A 2Y0SN 1G3YA 1I50J 2E1CA 4GCVA 1SD7A 3JTGA 4HDVA 2PJRA 1IN7A 2DOEA 3MD2A 1W36C 1HKSA 2CQKA 2VXDA 1J2XA 3IKVA 3J7AY 4AUXA 5HODA 4MTDA 5F0FA 1G8XA 3JRIA 2EFWA 2JRTA 1YFHA 2WADA 5B5EC 2V1XA 1JTYA 2YU3A 5IY5H 3R0JA 3F8MA 5HDNA 3F8FA 3DF8A 4XK4A 4PCQA 2DPUA 3BG6A 1YX3A 4ZZLA 2A61A 1F43A 1ETVA 2MC4A 2JUGA 2LTPA 2OZ6A 5FKOA 3TP3A 3U1KA 5FFXA 4HX8A 3X2QH 3FXRA 1RR7A 3WGGA 4BE0A 1HLVA 2LOOA 3KX2A 2KIMA 1QZEA 4EGZA 1Z6RA 2NS8A 2BY3A 1UB9A 1OCCH 3J80Z 2L02A 1MMGA 2XAJA 3K2ZA 4AM3A 1OPCA 3HOUJ 1I3QJ 2ICWG 2JPBA 2LFBA 2COBA 5J1UA 3TO9A 3S2DJ 1D3YA 1J0RA 1B8IA 1YIJI 1UMQA 2R7RA 3A02A 4ZDOA 1MNEA 4LLGF 3CO7C 3TL4X 3I55I 1IZ1A 3WTZA 2NNYA 3KP7A 1B8IB 2CUJA 4F52A 2Y9ZA 2HZDA 2X0LA 3PL8A 3PIOF 2PG4A 1YW8A 3KP6A 1CQTA 2QYOA 4N4OB 3SEQA 3OOUA 1S72I 4CO8A 1DPUA 1S7OA 2HYJA 2QKLB 3C2GA 3PQJA 1LPQA 2DJIA 2XKPA 3OYDA 3GFJA 4HLYA 5E17F 3S8PA 1O3SA 3NEUA 1V54H 3HRUA 4C3IJ 4BKXA 2M4KA 2ACJA 2A05A 4A0XA 2E5NA 3HYIA 1N78A 4ENMA 3COAC 4OOIA 4LGWA 2HKOA 5LGNA 2O8XA 4AWXB 2NVXJ 5IT9K 4RGSA 3KEQA 2BOLA 1KU7A 3HRTA 4RGUA 4D5FA 4JX5A 3L00A 1R5GA 2A5WA 2LVSA 3PO2J 3J81Z 2KIFA 5BMZA 3F8BA 2ELJA 3V7CA 2KZVA 2RC4A 4YEJA 1YO5C 2PMHA 3ZR8X 3IUOA 5FFZA 4AIJA 2OTLI 2ADUA 4MQ9F 4O5VA 3V8LA 4U7BA 1IDYA 4CCKA 2DFIA 2VJJA 1X2NA 3NWSA 3FKIJ 4XSXF 3SHFA 1T38A 1GT0C 3CC2I 2CUEA 1S29A 2DFEA 1SVLA 1N25A 2OCCH 2VOOA 3FIWA 3H1CA 4PJJA 3WTUC 2DW4A 4ZYAA 2EZHA 2FSWA 4OU0A 5IOZA 1BC7C 2IXSA 4K2EA 4F91B 3BCAA 1SD4A 4DZJA 3KE2A 3QYEA 3I9V2 3PNTA 3S32A 2J5OA 2CV1A 2CW8A 3CJNA 2NAZA 2K9NA 3LA3A 1Y1WJ 3ZQQA 3AKZA 1GV2A 2CW7A 1Z67A 4MHGA 3PUFA 1XX5A 2HVRA 3OYNA 2Y69H 2ISZA 5FLXZ 4BQAA 2CUZA 3WHBA 4AYBN 4JOMA 5GPCA 4L5JA 1V5EA 5H6RA 3WODF 2VB6A 5F04A 1LEBA 3L2UA 2X48A 1R49A 1RZ4A 3I56I 4B4CA 5TRDA 4A3IJ 1FIAA 4FE4A 5JLWA 1TC3C 2XAUA 4V2GA 2DJNA 1LNWA 2E1MB 3BTIA 2LY2A 4C3HJ 4BGDA 5H2FC 5C3EJ 2IA0A 4Y33A 1QZZA 1IF1A 2ZCWA 2VJIA 3BP8A 2LBFA 2ZJQF 1K79A 2JVGA 4EEFG 5B1AH 4XIDA 4HNTA 3MZHA 2Z5UA 4Q47A 5HNFA 2GBYA 4M6YA 2DYRH 2PJPA 2LK2A 1SVMA 1TQPA 2HFHA 3CD6I 4N9IA 3WTSC 3E6DA 4PFOA 4XLNF 4JYKA 2OQGA 5HLHA 2VLAA 2ZNZA 1BI1A 2ZMEB 4A3KJ 1R1VA 4L0YB 4V19K 2MGQA 3CMMA 2V1DA 2E1OA 1GLNA 4Y13A 3CLOA 2DT7B 4ANJA 2R4GA 1I1SA 3K7AJ 3GX4X 4HDUA 1Z05A 2K5CA 1IV8A 4F55A 3K6GA 2DQLA 2JRMA 3TDUC 2PMUA 3KP5A 5IPAA 2W24A 1LJ9A 1X58A 2XRNA 1Z77A 1ZKGA 5J1YA 4EMSA 3WU1B 3PO3J 5FGMA 2EV0A 1T39A 3GFIA 2AXLA 1U0JA 1S8NA 1CF7B 4IJAA 2QKMB 1UELB 4L9NA 4I01A 2DBBA 1E2XA 3H5AA 1AU7A 4HAMA 3BR6A 3CCUI 1BR4A 2BY1A 1XSXA 3CQZJ 4MLOA 3TOAA 3OYJA 3VPRA 2R7QA 1WJBA 2WB1A 1JJ6C 1D8JA 1E17A 1T95A 2FUG2 1F4KA 3FXKA 3ROUA 3GTPJ 2XRLA 3BR3A 4BBSJ 1SD6A 2EZIA 4LG0B 4P55A 3HG9A 4CCLA 1TP4A 2B7EA 3F6VA 3HSFA 2DCEA 5J47A 2K9SA 2E71A 5FD5A 2MH9A 3QOEA 5BOXA 1BI2A 2IGOA 2M3AA 1XGOA 3IV5A 3GLLA 3ZQIA 2NRAC 3E6CC 3K4MA 1DDNA 2MH2A 4AIHA 4IF4A 1I6HJ 4I7HA 3QPHA 3WGIA 4A93J 1FT9A 2ELKA 2KL4A 1S7AA 3LFUA 5FD6A 2P6TA 2VJ4A 3FZVA 4S04A 3MZYA 2GXAA 4Y52J 3CF2A 1DP7P 4NC7A 4UB8C 1K78A 2W1OA 3FF5A 3E7LA 4NQWA 1FX7A 4RA2A 1ZRCA 2E60A 2M8GX 1RESA 2KKOA 4QPQA 1ZLJA 4EQQA 3T0YA 1ETOA 1B59A 2EA2A 2F4IA 4KA4A 2KMUA 3PQKA 1D0ZA 5EYRA 5FJ8J 1V3FA 2BW3B 3BJ6A 4GO1A 1YS7A 3ECOA 1L3LA 1XMKA 1FLIA 1EA3A 4JX6A 4M9XA 1SMTA 3OYFA 1FZPB 3BY6A 1YI2I 2ZC2A 3ERED 3IH2A 3GFMA 3DPLC 4RGXA 2GA1A 2RN7A 4DQ2A 4EJVA 3KFWX 3F9KA 3LWFA 5DYMA 3MKZA 1RRJA 3CO6C 1XN7A 2Z2SB 1IW7F 4FX0A 4IHTA 1RI7A 2R7VA 1P9QC 3TGNA 4B8XA 1MDMA 2VJ5A 1S6LA 1Z6TA 1NTCA 1LUJB 3ZMZA 2GIVA 3ZOBA 2ZJPF 2DA2A 2K02A 3GFLA 5EZGA 2DOAA 1VQOI 2IS1A 1IO2A 1UFMA 2XVCA 4ETSA 2R92J 1IXCA 3T5XA 2KHMA 2WC2A 4EV0A 2R7DA 1FOWA 3QAHA 4UUSB 4D7NA 4I6ZA 1ON2A 2X9DA 3LSTA 3VODA 2FNPA 4LLLA 2IJLA 3QPTA 2M0CA 4QPOA 2VKDA 1FYLA 4XOTA 2YPRA 4CH7A 2X51A 3S15J 1FTTA 1IN4A 2CV2A 2VKHA 3BZKA 1JKPC 2Y9YA 4HX4A 2KP6A 3HOZJ 2FBHA 3ECHA 3SZGA 1IRFA 2Y75A 4GGGA 3FK7A 5ILSA 1OR7A 1WSUA 1N75A 2FRHA 3MKLA 2HTJA 4M3DA 2R7WA 2JA2A 4G6DA 2B63J 2JK3A 4MGRA 2GA2A 1D1CA 4O3MA 1UHMA 3LQQA 2EZLA 5DM6F 2O8KA 5KCMA 4E4HA 1VFCA 4I98B 4WK8F 2FE3A 5FROA 5CLSA 2VL8A 2L9NA 5IOYA 4AIDA 3L2WA 4Z2YA 2F4MB 2OD5A 4AYBA 4C3JJ 3ABMH 2HWVA 1UZCA 2XSJC 3GTMJ 1BIBA 1S5LC 4BYYA 1DQUA 2DK8A 4BHBA 4IO9F 4MFDA 4XLEA 3E6BA 2QSHX 2HOAA 2VKVA 3F3XA 1JKRC 1Z7LA 2Q0OA 4BY1J 3MWMA 3H0DA 2V9KA 3GTJJ 5EZHA 2HOSA 2X1CA 5E3NA 1IN8A 5F08A 2XSDC 2XROA 3F0CA 1VTNC 2UV1A 4ESBA 4E70A 4HQEA 1PDNC 1IN6A 4A2UA 2XPUA 2ZXIA 2ZMEA 3JRFA 2DPDA 3RZOJ 5IYDJ 1B72B 3HL2A 4CZZA 1TW2A 1U2WA 2YR2A 2BY0A 5EEAA 4M3BA 1F36A 4A3MJ 2FX0A 5AIPA 2EIKH 2FQ4A 4HA8A 2DA7A 1UG2A 4FISA 2QVOA 1Q1HA 2JA7J 3B73A 2CMPA 2K4BA 5BQTA 3M1EA 2DMNA 2LY9A 1BI0A 3RKYA 4ITVA 1MMSA 3FK6A 2L7FP 5F0CA 5HLGA 1R5ID 1M1EB 1R5HA 1OISA 4R79A 2VKEA 4LLNA 2FA5A 4LMYA 5LGUA 3G3ZA 2XF5A 2JZYA 4DOZA 1OJLA 3REOA 3DEUA 3CMAI 2W82A 2TRTA 3PUBA 1MMAA 4QSHA 3I59A 1OCZH 1SEUA 1JGSA 3TO7A 2P5KA 5J6XA 3ZXSA 3EUAA 1QHGA 3P7NA 5H6QA 3J7AO 3A1YA 2STTA 4LIUA 5IYBJ 2RNGA 4PJ0C 2DN0A 2H09A 3L2VA 1BR2A 3G71I 5B66C 1QRYA 2KRHA 4JBAA 2WA0A 3GLXA 3ZQHA 1POGA 4F7ZA 2FU4A 3I4MJ 1R23A 2ZMEC 3C7JA 3HOTA 1IUYA 3L09A 3MKWB 1ONVA 3ESWB 5K7FA 1R00A 3OS1A 2QQAA 1WJCA 1UG0A 2VBXA 1OYWA 2LY1A 2M1BA 2FJ1A 3ERMA 4JQFA 4JP0A 5CYVA 4EJWA 1MBJA 4Q48A 3HOXJ 5GTHC 3CC4I 1XCBA 2H6BA 5EGOB 2DQRA 3CP2A 1R58A 4G7OF 3BG9A 2I10A 5EGOA 2KJCA 1WGXA 3Q3SA 1BI3A 4PJMA 4XMYA 3BPXA 3HRMA 3OWTA 1HCRA 2OC6A 1AKHA 2CJJA 1JT0A 2CV0A 2K7LA 4JK1X 3H3VK 2NOJB 3CUOA 2YS9A 3PFYA 4QLCU 2HR3A 1WJFA 3I3LA 4L18B 4IOCF 3ABKH 3K70C 4DNCA 1V55H 1FIPA 3GYHX 3VYSB 3A03A 5ICCA 2ETHA 2DFFA 1GXPA 3FXUA 4CXFA 2QEXI 1MDMB 1GUUA 2B0LA 4B44A 2X85A 4LD5A 3SDGA 3MQ0A 4E7IA 2CGPA 1A5JA 3O3KA 2Z33A 1TBXA 3EPZA 2WAEA 3HGGA 1G6NA 4CYCB 2VUMJ 3JAMK 2DLLA 3BZ6A 1AHDP 2P0WA 3L2QA 2F5DA 1SC7A 1B72A 2VQLA 1HSTA 5C4XJ 2HU9A 1X3UA 5F0HA 5LHHA 3OYHA 1YHQI 1HKQA 3ML6A 1Q1VA 2YX4A 3DQVC 4XN3A 3KLOA 4P96A 3GMEA 1YIOA 2KIUA 4DBQA 1GHCA 2CQQA 5K7HA 3HEFA 3O2PE 3DV8A 2DA5A 2DYSH 2PJRB 3ABTA 1E3OC 2A5YB 1BW5A 2X1EA 4A12A 3CCEI 5E79C 3Q0UA 1R4MB 3DTIA 5FLMJ 2NVQJ 4I99C 5J4YA 3ZQFA 4GFBA 2CWEA 3WTTC 2IA2A 2WWYA 3CCRI 4XKBA 5JFRA 1G3WA 1BL0A 1ZR4A 1MMNA 1ZGWA 3HUGB 3I5UA 3VOEA 4XRSG 3K1PA 3MVPA 1TQMA 3G1OA 3KYCB 1FP1D 1W7PB 2MLKA 2X6XA 2ME0A 3NQOA 4Q4ZF 1FOYA 4I02A 4IQ4A 1T08B 1Z0XA 3QYFA 1K7AA 1MBGA 4HF2A 2E1NA 2NOGA 4M72A 5BS6A 1QU3A 4CHUA 4GXOA 1J7KA 1W0TA 3ABUA 4FASD 3ASOH 4HZFA 2L7ZA 1LVKA 3HB9A 3JRBA 4O6JA 3OYKA 1IAWA 4II3A 2C6YA 4G94A 1ZQ3P 2EJRA 2XB0X 4UVAA 3K70D 5F6FA 2L4AA 4AC0A 3LQRA 1BJAA 1TT0A 3IP4B 5TGTA 5BPIA 2ZBKA 3BR2A 1VQ4I 1D1BA 3HHHA 9ANTA 4BJ6C 2K27A 3CJTB 3ASNH 5D5VB 1LDJA 1TWCJ 3A0BC 3TQNA 3HJEA 2G7HA 2IAIA 3U1DA 3W2VA 1FBSA 4HLXA 3K4JA 1WRJA 2A68F 1Z1DA 4BL0B 2JA5J 2E36A 4KDPA 4IOAF 1JKOC 3G2BA 5JLXA 2AHQA 5D4RA 4PJLA 1FNNA 3IKTA 2OCEA 5IT3A 3W6KB 4M71A 4FHTA 2EILH 2X1DA 1H88C 4ZYHA 2H1LA 1NHAA 3U9GA 2VE9A 1Y8RB 4BJ5C 3H9QA 2L01A 4IHYA 3IAS2 3CUQA 2KRCA 2JN6A 2XIGA 5DD8A 2JMWA 1W0UA 3FXOA 3BJAA 3OR1C 1FJLA 2LLKA 2EV5A 4BUPA 1NG6A 1ORKA 2DODA 1I3AA 1X1DA 4UHTA 4BJTA 2XC7A 3G6EI 1MMDA 2A07F 1G3SA 1W1WE 1J5YA 2XAHA 5J3LA 3OYAA 4G7ZF 5JHFA 1ERDA 1Z21A 2MBFA 2LP0A 3V42A 2NXNB 3LMMA 4LG3A 3GVAA 1IGNA 4OIRF 3VYUB 5CVIA 3U21A 1MBFA 4EATA 3GZNB 2D2WA 5JR3A 4HBLA 3K0LA 2BBYA 1HKTA 5J40A 1QBJA 3BC8A 5H20A 3HKZA 3TMOA 2O0YA 4M73A 4UUSA 4KT6A 3GTLJ 3LSJA 1RPWA 5FKMA 4EJUA 1WHUA 1YRNB 2P5VA 3LSPA 3M9AA 1EF4A 4H0EA 5HDKA 4ZJZA 4KICA 2L7KA 4RAGA 3S93A 3SDBA 1RKTA 3WTWC 3ZPLA 2X6WA 2EIMH 2G7UA 5E3MA 2NVUB 4YFXF 1A04A 5EG0A 1BA5A 3I59B 1YW7A 3G1LA 3SFZA 3TKYA 4CUGA 4OMYA 5D4SA 2D45A 2CQNA 2M7BA 4HW0A 5DCMA 2O6GE 2F5EA 4M9SA 4AVPA 3UKGA 3LSRA 2E34A 1YG2A 4IHWA 4HRIA 1MGTA 2QBYA 2ZXWH 1LFPA 4BEHA 3KZIC 4PSWA 1TNSA 2F2EA 4ZDPA 2K9LA 3FDYA 1IUFA 2YUSA 4EJOA 2QWWA 5AONA 3F21A 3MAJA 4C2MJ 1ETKA 3I71A 1K6YA 3WE3A 5J8CA 2LF7A 2F6CA 2AXTC 1PUFA 2DDBA 3RQ4A 4TV7A 5CQGA 4FQGA 2IT0A 2LYCA 3W3CA 5M5WJ 1J75A 1LB2A 2QCOA 5LHIA 1G2HA 1ODDA 4RS8A 1SAUA 3DU5A 3FMRA 1MBEA 2R7OA 3WG7H 3S17J 1TNTA 2QENA 4XRSA 4E7SA 5AIQA 3CUQC 4DZPA 2OF7A 3BTJA 2F5VA 3L7WA 1WPKA 2L3DA 3BWGA 2JSCA 2E7XA 3A2KA 1Y6IA 1A35A 5A2QZ 4YFNF 2R3SA 4XNFA 4LB6B 3DBRB 2DTZA 4UB6C 5L3CA 4NHJA 3H9JA 3B02A 2NS0A 1G4DA 4BHPA 2DMTA 3CP8A 4HF0A 2K40A 3I54A 4L0ZB 1YE9A 2V1NA 2BZTA 4OIOF 3DKYA 4XN0A 4XLFA 2LKSA 3K4LA 3JRGA 5HOOA 3ELKA 3HSRA 5L3GA 1I5ZA 2LR8A 3WTXC 1B9NA 3DEEA 2GQQA 2CFXA 2FEZA 3DKXA 3E3VA 1MBKA 1FPQA 3M4OJ 2HOTA 3JRHA 1KU2A 1PUEE 3J7ZI 1Y0UA 4L9VA 2GXBA 1V5GA 2MLGA 1D5YA 1VQ7I 4RB2C 3IH4A 3WU0A 1ACIA 3CMEI 4BE2A 4E7ZA 2Y48A
chains in the Genus database with same CATH topology
4BHCA 1RNLA 4A5NA 4GYIA 1KYZA 4ZYEA 1B4AA 4EJTA 4ESJA 2EB7A 1USTA 5L3EA 2CSOA 2VC0A 3ZMDA 2STWA 5D8LB 3F6OA 2QZ8A 2WV0A 3JSOA 5LHGA 1AOYA 1P2FA 3BROA 1HW2A 4Y15A 2XUBA 1ZG1A 2OU2A 4L9TA 1BN5A 3DFGA 2BGCA 4L5IA 1MJ9A 3FX3A 3H3UA 3WTVC 2UZKA 5IT9Z 2VOPA 5F64A 2VBZA 3F23A 2P8TA 2IA1A 4A6EA 1EH7A 2F5CA 1KQ8A 3MCZA 2ZKZA 1UHWA 2QLZA 1O57A 2HKXA 2G9WA 4XBFA 2ZO4A 3EDPA 2FMYA 2VT3A 2XAGA 2XV4S 4ON0A 4MNUA 2NYXA 2P4WA 4G8XA 4UNOA 4IXAA 2HOEA 2O61A 2ZXJA 1HSJA 5DUKA 3V4GA 3HTSB 3V8JA 2HQRA 1FY7A 2Z3YA 4OINF 1YLFA 1ZREA 4WF2A 1ZLKA 2COMA 3EQLF 3PFIA 1P92A 4BH9A 5D8KB 3ZMTA 1ZHFA 3KZZA 3E5QA 4XLPF 1B1BA 5DCFA 4PZJA 1MD0A 1RIOH 1DUXC 1FOKA 4OIPF 3RIRA 2P6SA 2Z99A 4ASNA 1SFEA 2EFOA 3KEOA 5LBQA 4WWCA 3G73A 1STZA 4RAYA 5K5OA 4RB1A 5DEQA 3ZMSA 1FSHA 1GXQA 4P9FA 2DK5A 4B09A 2HZTA 5K5RA 2MD5A 2HEOA 3C1DA 3R61A 4Y17A 3WG9A 2FOKA 2A6HF 3M8EA 2Y0MA 2EK5A 3AAFA 5D5XB 4ENKA 1EH6A 2ELHA 5K1YA 2BE5F 2DTRA 2V1UA 2HTSA 2IVMA 5DD4A 1TLHB 1Z91A 5DUIA 3IL2A 2CG4A 3GO5A 3ISPA 2GWRA 1HQCA 1LQ1A 1H0MA 3HIFA 4EGYA 3KZYA 1U5TA 5CVRA 4CYDA 1LVAA 4UXNA 1WWXA 3EYYA 1FYMA 1XGMA 5LEKA 1IN5A 4U0WA 2PI0A 3LFKA 3I4PA 1OYIA 4WCGA 1ON1A 4OMZA 4UV8A 4Q5SF 1FWZA 2MC3A 3ZN0A 1XB4A 5E1XA 2XHKA 3E5UA 2VN2A 3QRFF 2BYVE 4KT5C 1QPMA 5CVUA 5L3DA 2XGXA 4WXHA 1OKRA 3I64A 2V6CA 1WI9A 2D1VA 4R1HA 1W7PA 4R8HA 4LFUA 5TJJA 1K78B 3ZN1A 1B9MA 1RUNA 2TDXA 3CTAA 4ZYGA 1J9IA 2YSRA 3VEPA 3GEZA 2FF4A 1PP7U 2RQPA 5D6EA 3IRQA 2P5LC 4I0BA 5E1ZB 1REPC 2CYYA 2XAQA 1XSVA 1K6OA 2ZJ2A 1L0OC 2LNBA 1P6RA 5HS8A 3KETA 4HOBA 2D1HA 2DU9A 2DI3A 4MEXF 3C3WA 1R1TA 4I09A 4KIFA 2ZNYA 3FM5A 4IPAA 2OZUA 5LRRA 1XGSA 5CVVA 3KP3A 3TO6A 5L3BA 4KMUX 5DCMB 5ED4A 1G3TA 3RPQA 3IC7A 5KVRA 3SZPA 2M8EA 3BDDA 4CDGA 4RGRA 4IRHA 1W7PD 3RPUA 1ZN2A 5LLQA 5A2QK 2HYGD 3Q9VA 2ISYA 1T2KA 2WTEA 4LK1F 2DT5A 2W84A 4A6DA 4N9HA 4YG2F 3EUHA 2VC1A 3LAPA 4KN4X 3FHZA 2DO7A 2OAZA 4AIKA 4CICA 3FWEA 4PGHA 3I58A 1XSDA 3CUQB 4ZH4F 3D5LA 2RNJA 2A69F 2VE8A 3QU6A 4U0YA 1XDUA 1U78A 2LF8A 1GVJA 1H9TA 1LDDA 4BXUA 1QZYA 4UVBA 4WXCA 3RTRA 3R60A 1SMYF 1FC3A 3R0AA 1EV7A 1R22A 3E97A 3JTHA 1XGNA 4M6XA 2QM3A 3GF2A 2MA3A 1CGPA 1I27A 1KQ9A 3Q5FA 4OIQF 2FMLA 5D5UB 3K1MA 1IXRC 2PEXA 4ZYDA 2EFNA 4HV5A 2W25A 1YW9A 3L2CA 1FYKA 2JPCA 4KIBA 2OQRA 3HHGA 2CO5A 1JHHA 2XKOA 4AD9A 3HUGA 1HW1A 1U3EM 1R7JA 1C0WA 1HXDA 2P7VB 3MFKA 2W85A 1SFUA 5HLIA 1QQIA 4RB0A 1F9NA 2AS5F 3GZ6A 1ZRFA 1TQIA 2EV6A 1FSEA 2OA4A 4RAZA 1LEAA 5ICEA 3F8NA 4YFKF 2KRFA 1AWCA 2QQBA 2IPQX 4M9ZA 4I0AA 5EEGA 4UV9A 3LA7A 3IHUA 1DPRA 1P4AA 4BAYA 4A5MA 2HS5A 5D6FA 4XSZF 3T8TA 1QNTA 4P5OA 3M8FA 2X4HA 3R6SA 1U5TB 4HX7A 4WX9A 3S2WA 2IP2A 4ENNA 4P9UA 4EM0B 5FLXK 1KYWA 4FT8A 3FXQA 4LG0A 3RJPA 1B6AA 4GYGA 2K4JA 4KMFA 4G7HF 2H27A 1EH8A 4MTEA 1XCVA 2HQNA 1ZG3A 2QUFA 2RGVA 1F1ZA 4G9YA 4KNYA 3VB2A 1FBQA 1W5SA 2GXGA 1HW5A 3V8KA 3NRVA 5LRSA 3K9TA 3TDZC 3IWFA 2ZFWA 5JI6A 5E8GA 2V9VA 3ZP5A 5BPDA 4LB5A 4QWQA 1YTYA 3ZQ7A 1WKMA 3HSEA 1ZAOA 3E5XA 2F5FA 1YS6A 5CVJA 2HGCA 4D0PA 3WE2A 3MEXA 1IRGA 3LA2A 1Z9CA 4ESFA 2GZWA 4MQVA 1I6XA 2PN6A 2NNNA 2EWNA 2UXXA 2OBPA 1O7LA 4CGZA 5ICFA 4L9JA 4KN7X 2DAOA 4KIGA 2H6CA 3C18A 3ULQB 4HF1A 1ZARA 3D0SA 4M74A 1JE8A 3IWZA 5CJ9A 5HDGA 2FXAA 3K1NA 1KA8A 5ILVA 3SXYA 3FM3A 3QOPA 1XDSA 2IW5A 1O7FA 3P9KA 3RDIA 3ZMVA 2E7WA 5E8IA 1JXSA 3M7GA 2A6EF 2VBWA 2VBYA 2M87A 5ICGA 4YIIA 5E20A 2QBYB 4UUVA 4LK0F 4EM1A 5LEJA 1MJAA 1KU3A 1TTYA 1ULYA 2L4MA 4G6QA 1ZYRF 2RKHA 2J5PA 2L54A 2FNAA 1BBYA 4IVNA 5D5WB 3OV8A 5E1WA 4PDKA 4U0VA 3SZTA 1H9GA 3RI4A 3I53A 3GZ5A 3N97A 2XASA 3J80K 2H94A 1KU9A 5J8FA 2VT2A 3F72A 3HOSA 3R4KA 3SQNA 2A3SA 3I0TA 2PQ8A 1OYYA 1U8RA 5E18F 2BV6A 2LKPA 1U6GA 1QGPA 3KCCA 1OMIA 1R36A 3FMQA 3JW4A 2RVCA 4KFCA 1MKMA 1T0FA 4XRFA 4NB5A 2ESNA 1YQAA 4PGGA 3V7SA 1R1UA 1FBUA 1PP8F 5KK1A 2PLYA 2VONA 1W5TA 3FMSA 5JHUA 2ESHA 2K86A 2IRFG 1ZGJA 1SD5A 5EEHA 4U88A 1SAXA 4A0YA 2V79A 5ILUA 1QO0D 1BOAA 2FBKA 3IRRA 1KQ0A 3VFZA 2KJBA 3BOQA 2HDCA 1W4MA 3O6BB 1ZGAA 3F8CA 1YYVA 4UVCA 5FO5A 2JT1A 2LDUA 2VXZA 2VODA 1FP2A 3EETA 4IHSA 1JHFA 5ERIA 3LAJA 3GUDA 1MJBA 3N4MA 3RYPA 1Z7UA 6PAXA 2M30A 4KYWA 2RDPA 4BNCA 4HV6A 3TOBA 2FBIA 3L9FA 4ZZDA 3DKWA 5FB2A 3KP2A 2Q8KA 1BIAA 2R7FA 4IRIA 2XAFA 2O03A 4LJZF 1HBXG 3T8RA 3KP4A 5LGTA 1USSA 4ENJA 2UXNA 4MEYF 3P9IA 1ZG5A 2W57A 2PFBA 4YIFA 2JTVA 3QP5A 3GWZA 5DDGA 1WQ2A 1D5VA 3U2RA 4HQMA 1J59A 2EFPA 5DV5A 3JSPA 4RB3C 3Q9SA 3F22A 5JVTA 2EA4A 3EYIA 1LDKB 3OOPA 1RUOA 2LSOA 3H3ZA 3P9CA 4IRGA 4FX4A 1XMAA 1SFXA 4EVIA 2M5WA 4U7DA 1P4WA 3K69A 3QU3A 3ZMUA 2BEOA 1O3RA 3BJOA 3BPVA 1BM9A 1CF7A 3GW2A 3WTYC 3DXJF 5HS7A 5K5QA 2UWMA 3H92A 3RKXA 4EM2A 1V4RA 1ZH5A 3WGHA 1D8KA 2EFQA 3E6MA 2HYFA 4KUMA 3V7RA 1I1GA 1O3TA 2PBIA 3RYRA 2Z9OA 3JAMZ 1O3QA 3KLNA 5F1RA 3DPTA 2O3FA 2QQ9A 1XD7A 1P4XA 3GXOA 4HYEA 5HS9A 3W6JB 4A0ZA 3T1BA 1BC8C 1UCRA 2RV8A 3HRSA 2CW0F 3J81K 1F5TA 2P7CB 5HVQC 1T98A 2Q2EA 2M45A 4N0BA 1S3JA 1MZBA 3HTUA 4WXDA 1IXSB 2YX7A 3CDHA 1U5TC 5L3FA 3DP7A 2FQ3A 1T6SA 3QP6A 1ZRDA 4S05A 4I2OA 1KGSA 3RKWA 2GAUA 1TW3A 1G3YA 2E1CA 4GCVA 1SD7A 3JTGA 4HDVA 1IN7A 1HKSA 2CQKA 3IKVA 1J2XA 4MTDA 2EFWA 2JRTA 1YFHA 2V1XA 2YU3A 3R0JA 3F8MA 5HDNA 3DF8A 3F8FA 2DPUA 4PCQA 4ZZLA 2A61A 2OZ6A 5FFXA 4HX8A 3FXRA 3WGGA 2KIMA 4EGZA 1Z6RA 1UB9A 3J80Z 2L02A 2XAJA 3K2ZA 1OPCA 2JPBA 3TO9A 1D3YA 1J0RA 4LLGF 3CO7C 2NNYA 1IZ1A 3WTZA 3KP7A 2X0LA 2PG4A 1YW8A 3KP6A 2QYOA 4CO8A 1DPUA 1S7OA 3PQJA 2XKPA 3GFJA 4HLYA 5E17F 1O3SA 3NEUA 3HRUA 2ACJA 4A0XA 3HYIA 4ENMA 3COAC 4OOIA 4LGWA 2HKOA 5LGNA 2O8XA 4AWXB 5IT9K 4RGSA 3KEQA 1KU7A 3HRTA 4RGUA 3L00A 1R5GA 3J81Z 2KIFA 5BMZA 3F8BA 3V7CA 2RC4A 1YO5C 2PMHA 5FFZA 4AIJA 2ADUA 4MQ9F 4O5VA 3V8LA 4U7BA 2DFIA 4XSXF 3SHFA 1T38A 1S29A 2VOOA 3WTUC 2DW4A 2FSWA 4OU0A 1BC7C 4K2EA 1SD4A 3KE2A 2J5OA 3CJNA 2NAZA 3LA3A 4MHGA 2ISZA 5FLXZ 4BQAA 4L5JA 5H6RA 3WODF 1LEBA 1RZ4A 5TRDA 1LNWA 2IA0A 1QZZA 1IF1A 2ZCWA 3BP8A 1K79A 3MZHA 2Z5UA 4Q47A 4M6YA 2PJPA 1TQPA 2HFHA 4N9IA 3WTSC 3E6DA 4XLNF 2OQGA 5HLHA 2ZNZA 1BI1A 2ZMEB 1R1VA 4L0YB 2V1DA 1I1SA 4Y13A 3CLOA 3GX4X 4HDUA 1Z05A 2DQLA 3TDUC 2PMUA 3KP5A 2W24A 1LJ9A 2XRNA 4EMSA 3WU1B 5FGMA 2EV0A 1T39A 3GFIA 2AXLA 1S8NA 1CF7B 4IJAA 4L9NA 4I01A 2DBBA 1E2XA 4HAMA 1XSXA 3TOAA 1D8JA 1E17A 1F4KA 3ROUA 1SD6A 4LG0B 4P55A 3F6VA 3HSFA 5FD5A 2MH9A 5BOXA 1BI2A 1XGOA 2NRAC 3E6CC 1DDNA 2MH2A 4AIHA 4IF4A 4I7HA 3QPHA 3WGIA 1FT9A 1S7AA 5FD6A 2P6TA 3FZVA 4S04A 3MZYA 1DP7P 1K78A 3FF5A 4NQWA 1FX7A 1ZRCA 2KKOA 1ZLJA 4EQQA 3T0YA 2EA2A 1B59A 4KA4A 3PQKA 1V3FA 3BJ6A 4GO1A 1YS7A 3ECOA 1L3LA 1XMKA 1FLIA 4M9XA 1SMTA 1FZPB 3BY6A 3ERED 3GFMA 3DPLC 4RGXA 2GA1A 2RN7A 4DQ2A 4EJVA 3KFWX 3LWFA 5DYMA 3CO6C 1XN7A 4FX0A 1IW7F 4IHTA 1RI7A 3TGNA 4B8XA 1MDMA 1Z6TA 1S6LA 3ZMZA 2GIVA 2K02A 3GFLA 1UFMA 4ETSA 2XVCA 1IXCA 3T5XA 2WC2A 4EV0A 2R7DA 3QAHA 1ON2A 3LSTA 3VODA 2FNPA 4LLLA 2IJLA 3QPTA 1FYLA 2YPRA 1IN4A 4HX4A 2FBHA 3ECHA 1IRFA 2Y75A 4GGGA 5ILSA 1OR7A 1WSUA 2FRHA 2HTJA 4G6DA 4MGRA 2GA2A 4O3MA 1UHMA 3LQQA 4I98B 4WK8F 2FE3A 5CLSA 4Z2YA 2OD5A 2HWVA 1BIBA 4BYYA 2DK8A 4BHBA 3E6BA 3F3XA 2Q0OA 3MWMA 1IN8A 2XROA 1VTNC 4ESBA 4E70A 4HQEA 1PDNC 1IN6A 4A2UA 2DPDA 2ZMEA 4CZZA 1TW2A 1U2WA 2YR2A 5AIPA 4HA8A 2QVOA 1Q1HA 3B73A 2K4BA 5BQTA 3M1EA 1BI0A 3RKYA 5HLGA 1R5HA 4R79A 4LLNA 2FA5A 4LMYA 5LGUA 3G3ZA 2JZYA 3REOA 3DEUA 3I59A 1JGSA 3TO7A 2P5KA 5J6XA 3P7NA 5H6QA 3J7AO 2STTA 2H09A 4JBAA 3GLXA 4F7ZA 2FU4A 1R23A 3C7JA 3HOTA 1IUYA 3L09A 1ONVA 1R00A 2QQAA 2VBXA 1OYWA 2M1BA 4JQFA 5CYVA 4EJWA 4Q48A 1XCBA 2H6BA 2DQRA 1R58A 4G7OF 2KJCA 1BI3A 3BPXA 3HRMA 2K7LA 4JK1X 3CUOA 4QLCU 2HR3A 4L18B 4DNCA 3GYHX 5ICCA 2ETHA 1GXPA 3FXUA 4CXFA 1MDMB 2B0LA 4LD5A 3MQ0A 2CGPA 3O3KA 2Z33A 1TBXA 1G6NA 3JAMK 2DLLA 3BZ6A 2F5DA 1HSTA 1X3UA 5LHHA 1HKQA 3ML6A 2YX4A 3DQVC 3KLOA 4P96A 1YIOA 2KIUA 1GHCA 3O2PE 3DV8A 3ABTA 2A5YB 4A12A 2CWEA 3WTTC 2IA2A 2WWYA 5JFRA 1G3WA 3I5UA 3VOEA 3K1PA 1TQMA 1FP1D 1W7PB 2MLKA 3NQOA 4Q4ZF 4I02A 1K7AA 4HF2A 2E1NA 4M72A 5BS6A 4CHUA 4GXOA 1J7KA 3ABUA 4HZFA 4O6JA 1IAWA 2C6YA 4G94A 2EJRA 4UVAA 5F6FA 2L4AA 3LQRA 1BJAA 5BPIA 2ZBKA 3HHHA 2K27A 5D5VB 1LDJA 3TQNA 2G7HA 3U1DA 1FBSA 4HLXA 1WRJA 2A68F 1Z1DA 4KDPA 5D4RA 1FNNA 3IKTA 5IT3A 3W6KB 4M71A 4FHTA 4ZYHA 3U9GA 1NHAA 2VE9A 2L01A 2XIGA 3CUQA 5DD8A 3BJAA 2EV5A 4UHTA 2A07F 1G3SA 2XAHA 1J5YA 4G7ZF 2MBFA 3GVAA 4OIRF 5CVIA 2D2WA 5JR3A 4HBLA 3K0LA 2BBYA 1HKTA 1QBJA 5H20A 2O0YA 4M73A 4EJUA 2P5VA 3M9AA 4H0EA 5HDKA 4KICA 3WTWC 3ZPLA 2G7UA 4YFXF 1A04A 3I59B 1YW7A 3SFZA 3TKYA 4OMYA 5D4SA 2D45A 4HW0A 5DCMA 2O6GE 2F5EA 4M9SA 4AVPA 1YG2A 1MGTA 2QBYA 1TNSA 2F2EA 4EJOA 2QWWA 5AONA 3F21A 3MAJA 3I71A 5J8CA 3WE3A 2LF7A 4TV7A 2IT0A 1J75A 1LB2A 5LHIA 1ODDA 4RS8A 3FMRA 1TNTA 2QENA 5AIQA 3CUQC 3L7WA 2L3DA 3BWGA 2JSCA 2E7XA 5A2QZ 4YFNF 2R3SA 4LB6B 5L3CA 4NHJA 3B02A 2NS0A 1G4DA 4BHPA 4HF0A 3I54A 4L0ZB 4OIOF 5HOOA 3ELKA 3HSRA 5L3GA 1I5ZA 3WTXC 1B9NA 2GQQA 2FEZA 2CFXA 3E3VA 1FPQA 1PUEE 1KU2A 1Y0UA 4L9VA 2GXBA 2MLGA 4RB2C 3WU0A 2Y48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BHC A;  1RNL A;  4A5N A;  4GYI A;  1KYZ A;  4ZYE A;  1B4A A;  4EJT A;  4ESJ A;  2EB7 A;  1UST A;  5L3E A;  2CSO A;  2VC0 A;  3ZMD A;  2STW A;  5D8L B;  3F6O A;  2QZ8 A;  2WV0 A;  3JSO A;  5LHG A;  1AOY A;  1P2F A;  3BRO A;  1HW2 A;  4Y15 A;  2XUB A;  1ZG1 A;  2OU2 A;  4L9T A;  1BN5 A;  3DFG A;  2BGC A;  4L5I A;  1MJ9 A;  3FX3 A;  3H3U A;  3WTV C;  2UZK A;  5IT9 Z;  2VOP A;  5F64 A;  2VBZ A;  3F23 A;  2P8T A;  2IA1 A;  4A6E A;  1EH7 A;  2F5C A;  1KQ8 A;  3MCZ A;  2ZKZ A;  1UHW A;  2QLZ A;  1O57 A;  2HKX A;  2G9W A;  4XBF A;  2ZO4 A;  3EDP A;  2FMY A;  2VT3 A;  2XAG A;  2XV4 S;  4ON0 A;  4MNU A;  2NYX A;  2P4W A;  4G8X A;  4UNO A;  4IXA A;  2HOE A;  2O61 A;  2ZXJ A;  1HSJ A;  5DUK A;  3V4G A;  3HTS B;  3V8J A;  2HQR A;  1FY7 A;  2Z3Y A;  4OIN F;  1YLF A;  1ZRE A;  4WF2 A;  1ZLK A;  2COM A;  3EQL F;  3PFI A;  1P92 A;  4BH9 A;  5D8K B;  3ZMT A;  1ZHF A;  3KZZ A;  3E5Q A;  4XLP F;  1B1B A;  5DCF A;  4PZJ A;  1MD0 A;  1RIO H;  1DUX C;  1FOK A;  4OIP F;  3RIR A;  2P6S A;  2Z99 A;  4ASN A;  1SFE A;  2EFO A;  3KEO A;  5LBQ A;  4WWC A;  3G73 A;  1STZ A;  4RAY A;  5K5O A;  4RB1 A;  5DEQ A;  3ZMS A;  1FSH A;  1GXQ A;  4P9F A;  2DK5 A;  4B09 A;  2HZT A;  5K5R A;  2MD5 A;  2HEO A;  3C1D A;  3R61 A;  4Y17 A;  3WG9 A;  2FOK A;  2A6H F;  3M8E A;  2Y0M A;  2EK5 A;  3AAF A;  5D5X B;  4ENK A;  1EH6 A;  2ELH A;  5K1Y A;  2BE5 F;  2DTR A;  2V1U A;  2HTS A;  2IVM A;  5DD4 A;  1TLH B;  1Z91 A;  5DUI A;  3IL2 A;  2CG4 A;  3GO5 A;  3ISP A;  2GWR A;  1HQC A;  1LQ1 A;  1H0M A;  3HIF A;  4EGY A;  3KZY A;  1U5T A;  5CVR A;  4CYD A;  1LVA A;  4UXN A;  1WWX A;  3EYY A;  1FYM A;  1XGM A;  5LEK A;  1IN5 A;  4U0W A;  2PI0 A;  3LFK A;  3I4P A;  1OYI A;  4WCG A;  1ON1 A;  4OMZ A;  4UV8 A;  4Q5S F;  1FWZ A;  2MC3 A;  3ZN0 A;  1XB4 A;  5E1X A;  2XHK A;  3E5U A;  2VN2 A;  3QRF F;  2BYV E;  4KT5 C;  1QPM A;  5CVU A;  5L3D A;  2XGX A;  4WXH A;  1OKR A;  3I64 A;  2V6C A;  1WI9 A;  2D1V A;  4R1H A;  1W7P A;  4R8H A;  4LFU A;  5TJJ A;  1K78 B;  3ZN1 A;  1B9M A;  1RUN A;  2TDX A;  3CTA A;  4ZYG A;  1J9I A;  2YSR A;  3VEP A;  3GEZ A;  2FF4 A;  1PP7 U;  2RQP A;  5D6E A;  3IRQ A;  2P5L C;  4I0B A;  5E1Z B;  1REP C;  2CYY A;  2XAQ A;  1XSV A;  1K6O A;  2ZJ2 A;  1L0O C;  2LNB A;  1P6R A;  5HS8 A;  3KET A;  4HOB A;  2D1H A;  2DU9 A;  2DI3 A;  4MEX F;  3C3W A;  1R1T A;  4I09 A;  4KIF A;  2ZNY A;  3FM5 A;  4IPA A;  2OZU A;  5LRR A;  1XGS A;  5CVV A;  3KP3 A;  3TO6 A;  5L3B A;  4KMU X;  5DCM B;  5ED4 A;  1G3T A;  3RPQ A;  3IC7 A;  5KVR A;  3SZP A;  2M8E A;  3BDD A;  4CDG A;  4RGR A;  4IRH A;  1W7P D;  3RPU A;  1ZN2 A;  5LLQ A;  5A2Q K;  2HYG D;  3Q9V A;  2ISY A;  1T2K A;  2WTE A;  4LK1 F;  2DT5 A;  2W84 A;  4A6D A;  4N9H A;  4YG2 F;  3EUH A;  2VC1 A;  3LAP A;  4KN4 X;  3FHZ A;  2DO7 A;  2OAZ A;  4AIK A;  4CIC A;  3FWE A;  4PGH A;  3I58 A;  1XSD A;  3CUQ B;  4ZH4 F;  3D5L A;  2RNJ A;  2A69 F;  2VE8 A;  3QU6 A;  4U0Y A;  1XDU A;  1U78 A;  2LF8 A;  1GVJ A;  1H9T A;  1LDD A;  4BXU A;  1QZY A;  4UVB A;  4WXC A;  3RTR A;  3R60 A;  1SMY F;  1FC3 A;  3R0A A;  1EV7 A;  1R22 A;  3E97 A;  3JTH A;  1XGN A;  4M6X A;  2QM3 A;  3GF2 A;  2MA3 A;  1CGP A;  1I27 A;  1KQ9 A;  3Q5F A;  4OIQ F;  2FML A;  5D5U B;  3K1M A;  1IXR C;  2PEX A;  4ZYD A;  2EFN A;  4HV5 A;  2W25 A;  1YW9 A;  3L2C A;  1FYK A;  2JPC A;  4KIB A;  2OQR A;  3HHG A;  2CO5 A;  1JHH A;  2XKO A;  4AD9 A;  3HUG A;  1HW1 A;  1U3E M;  1R7J A;  1C0W A;  1HXD A;  2P7V B;  3MFK A;  2W85 A;  1SFU A;  5HLI A;  1QQI A;  4RB0 A;  1F9N A;  2AS5 F;  3GZ6 A;  1ZRF A;  1TQI A;  2EV6 A;  1FSE A;  2OA4 A;  4RAZ A;  1LEA A;  5ICE A;  3F8N A;  4YFK F;  2KRF A;  1AWC A;  2QQB A;  2IPQ X;  4M9Z A;  4I0A A;  5EEG A;  4UV9 A;  3LA7 A;  3IHU A;  1DPR A;  1P4A A;  4BAY A;  4A5M A;  2HS5 A;  5D6F A;  4XSZ F;  3T8T A;  1QNT A;  4P5O A;  3M8F A;  2X4H A;  3R6S A;  1U5T B;  4HX7 A;  4WX9 A;  3S2W A;  2IP2 A;  4ENN A;  4P9U A;  4EM0 B;  5FLX K;  1KYW A;  4FT8 A;  3FXQ A;  4LG0 A;  3RJP A;  1B6A A;  4GYG A;  2K4J A;  4KMF A;  4G7H F;  2H27 A;  1EH8 A;  4MTE A;  1XCV A;  2HQN A;  1ZG3 A;  2QUF A;  2RGV A;  1F1Z A;  4G9Y A;  4KNY A;  3VB2 A;  1FBQ A;  1W5S A;  2GXG A;  1HW5 A;  3V8K A;  3NRV A;  5LRS A;  3K9T A;  3TDZ C;  3IWF A;  2ZFW A;  5JI6 A;  5E8G A;  2V9V A;  3ZP5 A;  5BPD A;  4LB5 A;  4QWQ A;  1YTY A;  3ZQ7 A;  1WKM A;  3HSE A;  1ZAO A;  3E5X A;  2F5F A;  1YS6 A;  5CVJ A;  2HGC A;  4D0P A;  3WE2 A;  3MEX A;  1IRG A;  3LA2 A;  1Z9C A;  4ESF A;  2GZW A;  4MQV A;  1I6X A;  2PN6 A;  2NNN A;  2EWN A;  2UXX A;  2OBP A;  1O7L A;  4CGZ A;  5ICF A;  4L9J A;  4KN7 X;  2DAO A;  4KIG A;  2H6C A;  3C18 A;  3ULQ B;  4HF1 A;  1ZAR A;  3D0S A;  4M74 A;  1JE8 A;  3IWZ A;  5CJ9 A;  5HDG A;  2FXA A;  3K1N A;  1KA8 A;  5ILV A;  3SXY A;  3FM3 A;  3QOP A;  1XDS A;  2IW5 A;  1O7F A;  3P9K A;  3RDI A;  3ZMV A;  2E7W A;  5E8I A;  1JXS A;  3M7G A;  2A6E F;  2VBW A;  2VBY A;  2M87 A;  5ICG A;  4YII A;  5E20 A;  2QBY B;  4UUV A;  4LK0 F;  4EM1 A;  5LEJ A;  1MJA A;  1KU3 A;  1TTY A;  1ULY A;  2L4M A;  4G6Q A;  1ZYR F;  2RKH A;  2J5P A;  2L54 A;  2FNA A;  1BBY A;  4IVN A;  5D5W B;  3OV8 A;  5E1W A;  4PDK A;  4U0V A;  3SZT A;  1H9G A;  3RI4 A;  3I53 A;  3GZ5 A;  3N97 A;  2XAS A;  3J80 K;  2H94 A;  1KU9 A;  5J8F A;  2VT2 A;  3F72 A;  3HOS A;  3R4K A;  3SQN A;  2A3S A;  3I0T A;  2PQ8 A;  1OYY A;  1U8R A;  5E18 F;  2BV6 A;  2LKP A;  1U6G A;  1QGP A;  3KCC A;  1OMI A;  1R36 A;  3FMQ A;  3JW4 A;  2RVC A;  4KFC A;  1MKM A;  1T0F A;  4XRF A;  4NB5 A;  2ESN A;  1YQA A;  4PGG A;  3V7S A;  1R1U A;  1FBU A;  1PP8 F;  5KK1 A;  2PLY A;  2VON A;  1W5T A;  3FMS A;  5JHU A;  2ESH A;  2K86 A;  2IRF G;  1ZGJ A;  1SD5 A;  5EEH A;  4U88 A;  1SAX A;  4A0Y A;  2V79 A;  5ILU A;  1QO0 D;  1BOA A;  2FBK A;  3IRR A;  1KQ0 A;  3VFZ A;  2KJB A;  3BOQ A;  2HDC A;  1W4M A;  3O6B B;  1ZGA A;  3F8C A;  1YYV A;  4UVC A;  5FO5 A;  2JT1 A;  2LDU A;  2VXZ A;  2VOD A;  1FP2 A;  3EET A;  4IHS A;  1JHF A;  5ERI A;  3LAJ A;  3GUD A;  1MJB A;  3N4M A;  3RYP A;  1Z7U A;  6PAX A;  2M30 A;  4KYW A;  2RDP A;  4BNC A;  4HV6 A;  3TOB A;  2FBI A;  3L9F A;  4ZZD A;  3DKW A;  5FB2 A;  3KP2 A;  2Q8K A;  1BIA A;  2R7F A;  4IRI A;  2XAF A;  2O03 A;  4LJZ F;  1HBX G;  3T8R A;  3KP4 A;  5LGT A;  1USS A;  4ENJ A;  2UXN A;  4MEY F;  3P9I A;  1ZG5 A;  2W57 A;  2PFB A;  4YIF A;  2JTV A;  3QP5 A;  3GWZ A;  5DDG A;  1WQ2 A;  1D5V A;  3U2R A;  4HQM A;  1J59 A;  2EFP A;  5DV5 A;  3JSP A;  4RB3 C;  3Q9S A;  3F22 A;  5JVT A;  2EA4 A;  3EYI A;  1LDK B;  3OOP A;  1RUO A;  2LSO A;  3H3Z A;  3P9C A;  4IRG A;  4FX4 A;  1XMA A;  1SFX A;  4EVI A;  2M5W A;  4U7D A;  1P4W A;  3K69 A;  3QU3 A;  3ZMU A;  2BEO A;  1O3R A;  3BJO A;  3BPV A;  1BM9 A;  1CF7 A;  3GW2 A;  3WTY C;  3DXJ F;  5HS7 A;  5K5Q A;  2UWM A;  3H92 A;  3RKX A;  4EM2 A;  1V4R A;  1ZH5 A;  3WGH A;  1D8K A;  2EFQ A;  3E6M A;  2HYF A;  4KUM A;  3V7R A;  1I1G A;  1O3T A;  2PBI A;  3RYR A;  2Z9O A;  3JAM Z;  1O3Q A;  3KLN A;  5F1R A;  3DPT A;  2O3F A;  2QQ9 A;  1XD7 A;  1P4X A;  3GXO A;  4HYE A;  5HS9 A;  3W6J B;  4A0Z A;  3T1B A;  1BC8 C;  1UCR A;  2RV8 A;  3HRS A;  2CW0 F;  3J81 K;  1F5T A;  2P7C B;  5HVQ C;  1T98 A;  2Q2E A;  2M45 A;  4N0B A;  1S3J A;  1MZB A;  3HTU A;  4WXD A;  1IXS B;  2YX7 A;  3CDH A;  1U5T C;  5L3F A;  3DP7 A;  2FQ3 A;  1T6S A;  3QP6 A;  1ZRD A;  4S05 A;  4I2O A;  1KGS A;  3RKW A;  2GAU A;  1TW3 A;  1G3Y A;  2E1C A;  4GCV A;  1SD7 A;  3JTG A;  4HDV A;  1IN7 A;  1HKS A;  2CQK A;  3IKV A;  1J2X A;  4MTD A;  2EFW A;  2JRT A;  1YFH A;  2V1X A;  2YU3 A;  3R0J A;  3F8M A;  5HDN A;  3DF8 A;  3F8F A;  2DPU A;  4PCQ A;  4ZZL A;  2A61 A;  2OZ6 A;  5FFX A;  4HX8 A;  3FXR A;  3WGG A;  2KIM A;  4EGZ A;  1Z6R A;  1UB9 A;  3J80 Z;  2L02 A;  2XAJ A;  3K2Z A;  1OPC A;  2JPB A;  3TO9 A;  1D3Y A;  1J0R A;  4LLG F;  3CO7 C;  2NNY A;  1IZ1 A;  3WTZ A;  3KP7 A;  2X0L A;  2PG4 A;  1YW8 A;  3KP6 A;  2QYO A;  4CO8 A;  1DPU A;  1S7O A;  3PQJ A;  2XKP A;  3GFJ A;  4HLY A;  5E17 F;  1O3S A;  3NEU A;  3HRU A;  2ACJ A;  4A0X A;  3HYI A;  4ENM A;  3COA C;  4OOI A;  4LGW A;  2HKO A;  5LGN A;  2O8X A;  4AWX B;  5IT9 K;  4RGS A;  3KEQ A;  1KU7 A;  3HRT A;  4RGU A;  3L00 A;  1R5G A;  3J81 Z;  2KIF A;  5BMZ A;  3F8B A;  3V7C A;  2RC4 A;  1YO5 C;  2PMH A;  5FFZ A;  4AIJ A;  2ADU A;  4MQ9 F;  4O5V A;  3V8L A;  4U7B A;  2DFI A;  4XSX F;  3SHF A;  1T38 A;  1S29 A;  2VOO A;  3WTU C;  2DW4 A;  2FSW A;  4OU0 A;  1BC7 C;  4K2E A;  1SD4 A;  3KE2 A;  2J5O A;  3CJN A;  2NAZ A;  3LA3 A;  4MHG A;  2ISZ A;  5FLX Z;  4BQA A;  4L5J A;  5H6R A;  3WOD F;  1LEB A;  1RZ4 A;  5TRD A;  1LNW A;  2IA0 A;  1QZZ A;  1IF1 A;  2ZCW A;  3BP8 A;  1K79 A;  3MZH A;  2Z5U A;  4Q47 A;  4M6Y A;  2PJP A;  1TQP A;  2HFH A;  4N9I A;  3WTS C;  3E6D A;  4XLN F;  2OQG A;  5HLH A;  2ZNZ A;  1BI1 A;  2ZME B;  1R1V A;  4L0Y B;  2V1D A;  1I1S A;  4Y13 A;  3CLO A;  3GX4 X;  4HDU A;  1Z05 A;  2DQL A;  3TDU C;  2PMU A;  3KP5 A;  2W24 A;  1LJ9 A;  2XRN A;  4EMS A;  3WU1 B;  5FGM A;  2EV0 A;  1T39 A;  3GFI A;  2AXL A;  1S8N A;  1CF7 B;  4IJA A;  4L9N A;  4I01 A;  2DBB A;  1E2X A;  4HAM A;  1XSX A;  3TOA A;  1D8J A;  1E17 A;  1F4K A;  3ROU A;  1SD6 A;  4LG0 B;  4P55 A;  3F6V A;  3HSF A;  5FD5 A;  2MH9 A;  5BOX A;  1BI2 A;  1XGO A;  2NRA C;  3E6C C;  1DDN A;  2MH2 A;  4AIH A;  4IF4 A;  4I7H A;  3QPH A;  3WGI A;  1FT9 A;  1S7A A;  5FD6 A;  2P6T A;  3FZV A;  4S04 A;  3MZY A;  1DP7 P;  1K78 A;  3FF5 A;  4NQW A;  1FX7 A;  1ZRC A;  2KKO A;  1ZLJ A;  4EQQ A;  3T0Y A;  2EA2 A;  1B59 A;  4KA4 A;  3PQK A;  1V3F A;  3BJ6 A;  4GO1 A;  1YS7 A;  3ECO A;  1L3L A;  1XMK A;  1FLI A;  4M9X A;  1SMT A;  1FZP B;  3BY6 A;  3ERE D;  3GFM A;  3DPL C;  4RGX A;  2GA1 A;  2RN7 A;  4DQ2 A;  4EJV A;  3KFW X;  3LWF A;  5DYM A;  3CO6 C;  1XN7 A;  4FX0 A;  1IW7 F;  4IHT A;  1RI7 A;  3TGN A;  4B8X A;  1MDM A;  1Z6T A;  1S6L A;  3ZMZ A;  2GIV A;  2K02 A;  3GFL A;  1UFM A;  4ETS A;  2XVC A;  1IXC A;  3T5X A;  2WC2 A;  4EV0 A;  2R7D A;  3QAH A;  1ON2 A;  3LST A;  3VOD A;  2FNP A;  4LLL A;  2IJL A;  3QPT A;  1FYL A;  2YPR A;  1IN4 A;  4HX4 A;  2FBH A;  3ECH A;  1IRF A;  2Y75 A;  4GGG A;  5ILS A;  1OR7 A;  1WSU A;  2FRH A;  2HTJ A;  4G6D A;  4MGR A;  2GA2 A;  4O3M A;  1UHM A;  3LQQ A;  4I98 B;  4WK8 F;  2FE3 A;  5CLS A;  4Z2Y A;  2OD5 A;  2HWV A;  1BIB A;  4BYY A;  2DK8 A;  4BHB A;  3E6B A;  3F3X A;  2Q0O A;  3MWM A;  1IN8 A;  2XRO A;  1VTN C;  4ESB A;  4E70 A;  4HQE A;  1PDN C;  1IN6 A;  4A2U A;  2DPD A;  2ZME A;  4CZZ A;  1TW2 A;  1U2W A;  2YR2 A;  5AIP A;  4HA8 A;  2QVO A;  1Q1H A;  3B73 A;  2K4B A;  5BQT A;  3M1E A;  1BI0 A;  3RKY A;  5HLG A;  1R5H A;  4R79 A;  4LLN A;  2FA5 A;  4LMY A;  5LGU A;  3G3Z A;  2JZY A;  3REO A;  3DEU A;  3I59 A;  1JGS A;  3TO7 A;  2P5K A;  5J6X A;  3P7N A;  5H6Q A;  3J7A O;  2STT A;  2H09 A;  4JBA A;  3GLX A;  4F7Z A;  2FU4 A;  1R23 A;  3C7J A;  3HOT A;  1IUY A;  3L09 A;  1ONV A;  1R00 A;  2QQA A;  2VBX A;  1OYW A;  2M1B A;  4JQF A;  5CYV A;  4EJW A;  4Q48 A;  1XCB A;  2H6B A;  2DQR A;  1R58 A;  4G7O F;  2KJC A;  1BI3 A;  3BPX A;  3HRM A;  2K7L A;  4JK1 X;  3CUO A;  4QLC U;  2HR3 A;  4L18 B;  4DNC A;  3GYH X;  5ICC A;  2ETH A;  1GXP A;  3FXU A;  4CXF A;  1MDM B;  2B0L A;  4LD5 A;  3MQ0 A;  2CGP A;  3O3K A;  2Z33 A;  1TBX A;  1G6N A;  3JAM K;  2DLL A;  3BZ6 A;  2F5D A;  1HST A;  1X3U A;  5LHH A;  1HKQ A;  3ML6 A;  2YX4 A;  3DQV C;  3KLO A;  4P96 A;  1YIO A;  2KIU A;  1GHC A;  3O2P E;  3DV8 A;  3ABT A;  2A5Y B;  4A12 A;  2CWE A;  3WTT C;  2IA2 A;  2WWY A;  5JFR A;  1G3W A;  3I5U A;  3VOE A;  3K1P A;  1TQM A;  1FP1 D;  1W7P B;  2MLK A;  3NQO A;  4Q4Z F;  4I02 A;  1K7A A;  4HF2 A;  2E1N A;  4M72 A;  5BS6 A;  4CHU A;  4GXO A;  1J7K A;  3ABU A;  4HZF A;  4O6J A;  1IAW A;  2C6Y A;  4G94 A;  2EJR A;  4UVA A;  5F6F A;  2L4A A;  3LQR A;  1BJA A;  5BPI A;  2ZBK A;  3HHH A;  2K27 A;  5D5V B;  1LDJ A;  3TQN A;  2G7H A;  3U1D A;  1FBS A;  4HLX A;  1WRJ A;  2A68 F;  1Z1D A;  4KDP A;  5D4R A;  1FNN A;  3IKT A;  5IT3 A;  3W6K B;  4M71 A;  4FHT A;  4ZYH A;  3U9G A;  1NHA A;  2VE9 A;  2L01 A;  2XIG A;  3CUQ A;  5DD8 A;  3BJA A;  2EV5 A;  4UHT A;  2A07 F;  1G3S A;  2XAH A;  1J5Y A;  4G7Z F;  2MBF A;  3GVA A;  4OIR F;  5CVI A;  2D2W A;  5JR3 A;  4HBL A;  3K0L A;  2BBY A;  1HKT A;  1QBJ A;  5H20 A;  2O0Y A;  4M73 A;  4EJU A;  2P5V A;  3M9A A;  4H0E A;  5HDK A;  4KIC A;  3WTW C;  3ZPL A;  2G7U A;  4YFX F;  1A04 A;  3I59 B;  1YW7 A;  3SFZ A;  3TKY A;  4OMY A;  5D4S A;  2D45 A;  4HW0 A;  5DCM A;  2O6G E;  2F5E A;  4M9S A;  4AVP A;  1YG2 A;  1MGT A;  2QBY A;  1TNS A;  2F2E A;  4EJO A;  2QWW A;  5AON A;  3F21 A;  3MAJ A;  3I71 A;  5J8C A;  3WE3 A;  2LF7 A;  4TV7 A;  2IT0 A;  1J75 A;  1LB2 A;  5LHI A;  1ODD A;  4RS8 A;  3FMR A;  1TNT A;  2QEN A;  5AIQ A;  3CUQ C;  3L7W A;  2L3D A;  3BWG A;  2JSC A;  2E7X A;  5A2Q Z;  4YFN F;  2R3S A;  4LB6 B;  5L3C A;  4NHJ A;  3B02 A;  2NS0 A;  1G4D A;  4BHP A;  4HF0 A;  3I54 A;  4L0Z B;  4OIO F;  5HOO A;  3ELK A;  3HSR A;  5L3G A;  1I5Z A;  3WTX C;  1B9N A;  2GQQ A;  2FEZ A;  2CFX A;  3E3V A;  1FPQ A;  1PUE E;  1KU2 A;  1Y0U A;  4L9V A;  2GXB A;  2MLG A;  4RB2 C;  3WU0 A;  2Y48 A; 
#chains in the Genus database with same CATH topology
 4BHC A;  1RNL A;  4M3G A;  4E7J A;  4A5N A;  1YX5 A;  2HPI A;  4GYI A;  1KYZ A;  4ZYE A;  4NBQ A;  4P1W A;  1B4A A;  4EJT A;  4MIM A;  3HGY A;  4ESJ A;  2EB7 A;  1UST A;  2L2O A;  3H0G J;  2CSO A;  5L3E A;  4XOR A;  2M7A A;  2JA8 J;  2VC0 A;  3BG7 A;  1VQ8 I;  2VI6 A;  5DTD A;  3ZMD A;  2STW A;  2F4O B;  5D8L B;  1XC5 A;  4DYR A;  3F6O A;  2QZ8 A;  2WV0 A;  3JSO A;  5LHG A;  2KIQ A;  3OYL A;  1AOY A;  1P2F A;  5GAE J;  1HA8 A;  3BRO A;  2XGC A;  1X1C A;  1HW2 A;  2XPW A;  2CU7 A;  1R6R A;  4Y15 A;  2XUB A;  1ZG1 A;  2OU2 A;  4L9T A;  1BN5 A;  2O5R A;  2X6Y A;  4JX4 A;  3DFG A;  1D0Y A;  4S0H B;  1JT6 A;  2BGC A;  4Y7N J;  4L5I A;  2H8R A;  2KFD A;  1MJ9 A;  1EKE A;  3FX3 A;  1T33 A;  3DLA A;  3K2A A;  3FKJ A;  3H3U A;  3WTV C;  2UZK A;  5GAH J;  5IT9 Z;  2VOP A;  5F64 A;  2VBZ A;  3F23 A;  2P8T A;  2IA1 A;  4HSR A;  3VYT B;  2MG4 A;  4A6E A;  1EH7 A;  3BTL A;  1P7I A;  2F5C A;  1KQ8 A;  1BW6 A;  3MCZ A;  2ZKZ A;  1UHW A;  2QLZ A;  1O57 A;  3OYG A;  3D5S C;  1ENH A;  3ZRG A;  2ZJR F;  3DPU A;  2HKX A;  3FXL A;  3S1M J;  2G9W A;  4OAZ A;  2E35 A;  1XTA A;  3FXJ A;  4XBF A;  2EPF A;  2ZO4 A;  3S14 J;  3EDP A;  1A6Q A;  3ABL H;  2FMY A;  2VT3 A;  2XAG A;  2XV4 S;  4ON0 A;  3S3M A;  3D5R C;  4MNU A;  3H5N A;  2IS2 A;  2OTJ I;  4BQQ A;  3OSF A;  2NYX A;  2Y0S A;  2P4W A;  2PMZ N;  4G8X A;  5B3S H;  4IXA A;  4UNO A;  3M07 A;  4C2T A;  1SFK A;  2HOE A;  2ZXJ A;  2O61 A;  1HSJ A;  2HVQ A;  1TL8 A;  4BQN A;  1R4N B;  2WV1 A;  5DUK A;  3V4G A;  1JKQ C;  3DTK A;  3HTS B;  3S1R J;  2R5Y B;  3V8J A;  2HQR A;  2XDV A;  1ZR2 A;  1JGG A;  1FY7 A;  2Z3Y A;  4OIN F;  1JTX A;  3GBG A;  1YLF A;  5JVG F;  1V5F A;  5KAI C;  2DA1 A;  3AG3 H;  4CZC A;  4WF2 A;  1ZRE A;  1ZLK A;  4HG2 A;  1DU0 A;  3WHC A;  2COM A;  3EQL F;  1UHS A;  3DBH B;  3PFI A;  5FKN A;  1P92 A;  4BH9 A;  4B47 A;  4XL9 A;  5D8K B;  1BOB A;  4PK4 A;  2JJ7 A;  3ZMT A;  1ZHF A;  2OJE D;  1X3Z B;  3KZZ A;  3A0H C;  3E5Q A;  4XLP F;  1B1B A;  1TWG J;  1WJE A;  5DCF A;  4PZJ A;  1MD0 A;  5K7Z A;  4NUB A;  1RIO H;  1DUX C;  1BJZ A;  1FOK A;  3CF5 F;  3CCJ I;  4OAY A;  3CLQ A;  3EUK L;  1VQL I;  4OIP F;  3RIR A;  2P6S A;  4A3D J;  4AVZ A;  1YOV B;  2Z99 A;  4ASN A;  4V2F A;  1SFE A;  1NH3 A;  2EFO A;  5F27 A;  3KEO A;  5LBQ A;  4L5E A;  4WWC A;  3G73 A;  1STZ A;  1VQ9 I;  4RAY A;  5K5O A;  3C2B A;  4RB1 A;  2CH0 A;  4D9J A;  5DEQ A;  3ZMS A;  1Z3X A;  1FSH A;  1YJN I;  1GXQ A;  4P9F A;  4KJZ A;  2DK5 A;  4B09 A;  2HZT A;  1VQN I;  5K5R A;  2MD5 A;  2HEO A;  3C1D A;  2CQX A;  4IZZ A;  3JRA A;  3BT9 A;  3HM5 A;  3R61 A;  2BY2 A;  3M8J A;  2WAQ A;  1HF0 A;  4Y17 A;  5CKT A;  2FOK A;  3WG9 A;  2A6H F;  1S7E A;  3M8E A;  1SFO J;  2Y0M A;  4DYC A;  2EK5 A;  3AAF A;  1X1A A;  5D5X B;  2JWT A;  4ENK A;  2EH3 A;  1EH6 A;  4Y3O A;  2ELH A;  3OL4 A;  5K1Y A;  2BE5 F;  2DTR A;  2BXZ A;  2BHZ A;  1LFB A;  1GVD A;  2V1U A;  4A3E J;  2DXI A;  2HNH A;  2HTS A;  1TWA J;  4RLF A;  2IVM A;  5DD4 A;  4M3F A;  3OS2 A;  1TLH B;  1Z91 A;  4XLH A;  5DUI A;  3IL2 A;  1OLT A;  3DLL F;  2CG4 A;  3GO5 A;  3ISP A;  2ZB9 A;  2GWR A;  2QF7 A;  1HQC A;  3VSK A;  4XR6 A;  3ZGK A;  2Y2Z A;  4OWR B;  1H0M A;  3HIF A;  3JRC A;  1LQ1 A;  4EGY A;  3BLY A;  3KZY A;  3RKQ A;  1U5T A;  5CVR A;  4RBO A;  4CYD A;  1HDD C;  1LVA A;  1WVR A;  4UXN A;  4M3E A;  5KAF C;  1WWX A;  2KPM A;  3EYY A;  1FYM A;  1XGM A;  4RAF A;  5LEK A;  1IN5 A;  1X3W B;  5IYC J;  4U0W A;  2PI0 A;  3LFK A;  3L1P A;  1A6I A;  3K10 A;  3I4P A;  1OYI A;  5TIS C;  4WCG A;  1ON1 A;  1VF9 A;  2CRG A;  3K4C A;  3PIP F;  2XPV A;  4A3F J;  4OMZ A;  4UV8 A;  2ID6 A;  1R9T J;  4DW6 A;  2E1M C;  4Q5S F;  1ITY A;  1FWZ A;  2Z1D A;  2MC3 A;  3C2H A;  1XB4 A;  3ZN0 A;  2V4J C;  3NWT A;  3RZD J;  5E1X A;  2XHK A;  3E5U A;  3MZ8 A;  1XMX A;  2VN2 A;  3FXM A;  3QRF F;  3W2A A;  2BYV E;  1T8I A;  2KIS A;  4KT5 C;  5IP7 J;  1QPM A;  3NAU A;  1OCO H;  2MFZ A;  5CVU A;  5L3D A;  2XGX A;  1OR7 C;  4WXH A;  1X1B A;  4G6T B;  4IQJ A;  1OKR A;  3I64 A;  2V6C A;  2HVS A;  1WI9 A;  2D1V A;  2QQ8 A;  1X2M A;  3OIO A;  4XKW A;  4N4N B;  2XGE A;  4R1H A;  1HC8 A;  2CS3 A;  1W7P A;  4R8H A;  3IAM 2;  4IL6 C;  4BXF A;  4LFU A;  5TJJ A;  1K78 B;  3ZN1 A;  1B9M A;  5FLV A;  1OQY A;  2W48 A;  1RUN A;  1VQ6 I;  4YIR X;  2TDX A;  1WFX A;  3QYB A;  4BU2 A;  5KNL A;  3DCF A;  2W00 A;  2HDD A;  3CTA A;  4CCN A;  4ZYG A;  1J9I A;  2YSR A;  1SVO A;  3GEZ A;  3VEP A;  2FF4 A;  4MO7 A;  1PP7 U;  2RQP A;  5D6E A;  3IRQ A;  2P5L C;  4BS9 A;  3HPG A;  3CCY A;  4I0B A;  5E1Z B;  5EJC A;  1REP C;  2CYY A;  3I4N J;  2XAQ A;  1XSV A;  3PSF A;  1K6O A;  2ZJ2 A;  3HBL A;  3ZCO A;  4HEA 2;  2FD5 A;  1L0O C;  2LNB A;  1DU6 A;  4KIT B;  1P6R A;  2LMD A;  2K3P A;  2V9P A;  1VQ5 I;  5FRM A;  1DP3 A;  2AQE A;  2BVM A;  5HS8 A;  3KET A;  3LL7 A;  2D1H A;  2DU9 A;  4HOB A;  2DI3 A;  3G4S I;  4MEX F;  3C3W A;  1Y8Q B;  1R1T A;  4I09 A;  1YJW I;  4KIF A;  2ZNY A;  1K61 A;  1E3H A;  3RQI A;  2AO9 A;  3P5J A;  2Z16 A;  2JQ7 A;  4XQF A;  1W36 D;  2K9M A;  1PYV A;  2XF6 A;  4FCY A;  3OY9 A;  3FM5 A;  2GLO A;  3AL0 C;  5FKL A;  3KIO A;  4W1U A;  3M1C A;  1WJ5 A;  4IPA A;  2Y30 A;  4Z6Y A;  2OZU A;  5LRR A;  1PVE A;  1XGS A;  5CVV A;  3KP3 A;  3TO6 A;  1NK3 P;  2EIN H;  5L3B A;  4UY8 I;  1WI3 A;  2GOM A;  4KMU X;  2IEK A;  2H1K A;  5DCM B;  4CA0 A;  5ED4 A;  5C4J J;  4BE1 A;  5FKK A;  1XPX A;  2BHY A;  2VAS A;  3FHN A;  1VQK I;  3OYE A;  1G3T A;  1H8A C;  3RPQ A;  3IC7 A;  4F93 B;  5KVR A;  2LRD A;  4XLC A;  2MD0 A;  3SZP A;  2PX9 A;  5E3O A;  2M34 A;  2NVT J;  2M8E A;  3BDD A;  4CDG A;  2JA6 J;  1ZEL A;  4B3A A;  3H36 A;  4RGR A;  3Q0V A;  4IRH A;  2DFH A;  1GV5 A;  1W7P D;  4HPQ A;  1N77 A;  1JI8 A;  1ETQ A;  3O8H A;  3LSG A;  3RPU A;  3Q0W A;  2IGN A;  1ZN2 A;  1ETX A;  3VDX A;  5LLQ A;  5A2Q K;  3WU2 C;  2HYG D;  3CC7 I;  3Q9V A;  3A01 B;  2NVY J;  4D1Q A;  2ISY A;  3D1N I;  2KLO A;  3GTQ J;  4B48 A;  1T2K A;  2WTE A;  4BAC A;  1VZ0 A;  4LK1 F;  3CDI A;  2DT5 A;  2W84 A;  3UNG C;  4A6D A;  4N9H A;  4NQW B;  4YG2 F;  3EUH A;  3KPH A;  2VC1 A;  3LAP A;  4KN4 X;  2LKX A;  3FHZ A;  2DO7 A;  2OAZ A;  4A3J J;  3HOY J;  3K4N A;  4AIK A;  5CQE A;  3OIQ A;  2UUZ A;  4CIC A;  3FWE A;  4PGH A;  2B9S A;  3I58 A;  1XSD A;  2ZFU A;  3CUQ B;  3DBL B;  3OYB A;  4ZH4 F;  2E2H J;  3D5L A;  4ZC3 A;  1JUP A;  2RNJ A;  2VE8 A;  2A69 F;  2MAB A;  1U9O A;  2TCT A;  3PM1 A;  3QQA A;  3BQZ A;  3QU6 A;  3LNQ A;  5IP9 J;  4U0Y A;  1XDU A;  2WAQ N;  1W5C C;  3BG5 A;  2LF8 A;  1U78 A;  1GVJ A;  1H9T A;  3ZQL A;  1LDD A;  5DS9 A;  4BXU A;  1QZY A;  2R93 J;  2MYS A;  1O4X A;  4UVB A;  4WXC A;  3RTR A;  3R60 A;  1SMY F;  1FC3 A;  1FEX A;  3CJQ B;  2M0M A;  1T0F C;  3R0A A;  2F48 A;  3EUH C;  4XM3 A;  1D0X A;  1EV7 A;  1R22 A;  3S1N J;  3E97 A;  3JTH A;  1XGN A;  4M6X A;  5F1J A;  2QM3 A;  3GF2 A;  2MA3 A;  4IHV A;  2CUF A;  1CGP A;  1I27 A;  1KQ9 A;  2M9H A;  3Q5F A;  4OIQ F;  2FML A;  2R5Y A;  5D5U B;  3OYC A;  1IRX A;  3SYT A;  3K1M A;  1DGW Y;  3LSK A;  4A3B J;  1IXR C;  2PEX A;  1Y0N A;  4ZYD A;  2GM4 A;  4J01 A;  3S3O A;  2XF7 A;  4LIV A;  4C2U A;  2EFN A;  4HV5 A;  4U87 A;  2JUC A;  2OPT A;  5EG0 B;  2W25 A;  1MH3 A;  1YW9 A;  4NC8 A;  3L2C A;  3CCL I;  4HNU A;  2CFO A;  1FYK A;  2JPC A;  1KON A;  2KQR A;  2DMP A;  4KIB A;  1PJR A;  1WJD A;  2OQR A;  3HHG A;  2CO5 A;  1JHH A;  2XKO A;  2ME6 A;  4AD9 A;  3HUG A;  2FOW A;  1LE8 B;  1IDZ A;  1HW1 A;  1IJW C;  1U3E M;  3HKZ N;  1LE8 A;  1R7J A;  4II2 A;  3CCQ I;  1C0W A;  4YEL A;  1HXD A;  2P7V B;  3MFK A;  2W85 A;  3OYI A;  3JCU C;  1SFU A;  4DBR A;  5HLI A;  2MSY A;  1Y56 A;  1AKH B;  1QQI A;  4XOP A;  4PSX A;  3BR1 A;  5M3M J;  4RB0 A;  1F9N A;  2AS5 F;  2LBF B;  4F3Q A;  3GZ6 A;  3VYR B;  1ZRF A;  1TQI A;  2W4S A;  2EV6 A;  1FSE A;  2OA4 A;  3OIP A;  4RLQ A;  4RAZ A;  4X0G A;  1LKX A;  1LEA A;  4D5C A;  5ICE A;  3BG3 A;  3QPS A;  3F8N A;  1HDP A;  1MIJ A;  3TP0 A;  4LIT A;  1MND A;  3OR2 C;  3A4C A;  4C9Y A;  4E7L A;  1JJ8 C;  4YFK F;  2XGD A;  1E0E A;  2KRF A;  2O7O A;  1AWC A;  3OSG A;  1A31 A;  2QQB A;  1QA6 A;  1NK2 P;  2IPQ X;  4M9Z A;  3BCB A;  3DU6 A;  4I0A A;  5EEG A;  2DT6 A;  2EZK A;  4UV9 A;  4HNV A;  5HNH A;  3GTK J;  3CES A;  3LA7 A;  4PJN A;  1TZL A;  3IHU A;  1JUM A;  1DPR A;  1Y1V J;  5C44 J;  1P4A A;  4BAY A;  5GPA A;  2AQF A;  4A5M A;  3CMY A;  2HS5 A;  4C30 A;  2Y31 A;  1AA7 A;  5D6F A;  4XSZ F;  2Q1Z B;  5M5Y J;  1WH5 A;  3BQY A;  3T8T A;  1QNT A;  4P5O A;  3W2W A;  5M3F J;  4A69 C;  1OCP A;  3M8F A;  3S3N A;  1MSE C;  4GDF A;  2X4H A;  3R6S A;  1U5T B;  4DYQ A;  2PMZ A;  4HX7 A;  4IEJ A;  4WX9 A;  3S2W A;  2IP2 A;  2BXY A;  3CCV I;  4ENN A;  4P9U A;  2IGK A;  4EM0 B;  5FLX K;  1KYW A;  4FT8 A;  3FXQ A;  4LG0 A;  3VSL A;  1JUS A;  3RJP A;  3OS0 A;  4BDZ A;  5LD2 C;  2WY7 Q;  1B6A A;  3G1M A;  4GYG A;  2KZG A;  2K4J A;  4KMF A;  4XIC A;  4G7H F;  2H27 A;  1EH8 A;  4MTE A;  2DOF A;  1XCV A;  2HQN A;  1ZG3 A;  3AG2 H;  1VQP I;  3TBI A;  2QUF A;  3HZJ A;  2RGV A;  1F1Z A;  3H5R A;  3DEW A;  4G9Y A;  4QIW N;  2YU9 J;  4KNY A;  2EIJ H;  4IX7 A;  2D5V A;  3VB2 A;  1FBQ A;  1W5S A;  4E7H A;  2GXG A;  1HW5 A;  2LRE A;  4RMN A;  3NRV A;  3V8K A;  5LRS A;  4BDY A;  3K9T A;  3TDZ C;  2X6O A;  3IWF A;  2ZFW A;  5JI6 A;  5E8G A;  2V9V A;  3ZP5 A;  5BPD A;  2CQ7 A;  4E6K G;  4XKC A;  4LB5 A;  3HOW J;  4QWQ A;  1YTY A;  1SAN A;  3ZQ7 A;  4ABZ A;  1UAA A;  1WKM A;  3HSE A;  1ZAO A;  1EJ9 A;  3E5X A;  5EDN A;  3HOV J;  2F5F A;  4BEH B;  1BR1 A;  1YS6 A;  5CVJ A;  2HGC A;  4D0P A;  3WE2 A;  4DIQ A;  3MEX A;  4ZDL A;  3FBN B;  1IRG A;  2VQH A;  3LA2 A;  2DA4 A;  4DJA A;  2VPL A;  1Z9C A;  4ESF A;  2E5Z A;  2KDZ A;  2GZW A;  3KYD B;  4MQV A;  1I6X A;  2PN6 A;  2NNN A;  1KZH A;  3LOC A;  2EWN A;  3LSH A;  1MH4 A;  2UXX A;  3OL3 A;  1VQM I;  2OBP A;  4HST A;  1QVT A;  1QVU A;  1APL C;  4CYC A;  1O7L A;  4CGZ A;  5ICF A;  4L9J A;  3M3Y J;  4KN7 X;  1R71 A;  1Z3Y A;  2DAO A;  3OMY A;  4KIG A;  1ETY A;  2H6C A;  4RM3 A;  3C18 A;  3ULQ B;  5LFA A;  4HF1 A;  3SEZ A;  1ZAR A;  3D0S A;  4M74 A;  1JE8 A;  1YIT I;  2HXI A;  3IWZ A;  2ID3 A;  2K9Q A;  5CJ9 A;  5HDG A;  2FXA A;  3B6A A;  1X4O A;  3K1N A;  2ECB A;  3PNY A;  1KA8 A;  2VPR A;  5ILV A;  2JVH A;  4KIS A;  3SXY A;  3FM3 A;  3QOP A;  3GTO J;  1XDS A;  2IW5 A;  1O7F A;  2Q2E B;  4FE7 A;  3P9K A;  3RDI A;  3TW7 A;  3ZMV A;  2E7W A;  3J7Y J;  5E8I A;  4NC6 A;  1JXS A;  1OCR H;  2LD5 A;  3M7G A;  2W7N A;  1D1A A;  2E2I J;  3PSI A;  3ZQC A;  4H4K C;  2A6E F;  2VBW A;  5FRN A;  2VBY A;  2M87 A;  2QSG X;  5ICG A;  2L7M P;  2ZSI B;  2WB1 N;  4YII A;  1MSF C;  5E20 A;  2QBY B;  4UUV A;  1HOM A;  4LK0 F;  4EM1 A;  5KHD A;  1J09 A;  2WY8 Q;  2QSF X;  5LEJ A;  1U8B A;  3TED A;  1MJA A;  1QHH D;  1VI0 A;  4X1E A;  1KU3 A;  1GDT A;  2QA4 I;  2ECC A;  3MKY B;  2R7S A;  3GCM A;  1TTY A;  3NAR A;  2R5Z B;  4CSW A;  1ULY A;  2L4M A;  4G6Q A;  1ZYR F;  3ONQ A;  3DTE A;  2DDA A;  4MFE A;  2RKH A;  2R5Z A;  1FMV A;  2J5P A;  3PJR A;  3MMY B;  4UUT A;  1LFU P;  2L54 A;  1ZK8 A;  2FNA A;  2HPM A;  1BBY A;  4IVN A;  5D5W B;  3OV8 A;  5IP6 A;  4J19 A;  1H89 C;  3TW6 A;  5E1W A;  4PDK A;  4U0V A;  3QOD A;  3SZT A;  1H9G A;  3RI4 A;  2HQA A;  3I53 A;  1TT5 B;  3GZ5 A;  3A01 A;  3N97 A;  1RC9 A;  3UR3 C;  1Y39 A;  4E7K A;  2XAS A;  4F92 B;  3J80 K;  3MN2 A;  5E3L A;  1X4P A;  2H94 A;  1KU9 A;  1YJ9 I;  4IHX A;  5J8F A;  3DWL E;  5GTI C;  3RCO A;  3AL0 B;  2VT2 A;  3F72 A;  1RET A;  3HOS A;  3R4K A;  3SQN A;  2A3S A;  2QGU A;  3I0T A;  4NNJ A;  2PQ8 A;  1OYY A;  1U8R A;  5E18 F;  2HQ5 A;  2BV6 A;  2LKP A;  2BW3 A;  1U6G A;  2VQG A;  1QGP A;  3CZ6 A;  3RSN A;  1VND A;  3KCC A;  4CCM A;  1OMI A;  1R36 A;  2WBM A;  3FMQ A;  3JW4 A;  2E2J J;  4BXX J;  2OV7 A;  2RVC A;  4KFC A;  4FET A;  1MKM A;  3IH3 A;  1T0F A;  4XRF A;  4NB5 A;  5BNG A;  4DGW B;  2ESN A;  1YQA A;  3O8G A;  4PGG A;  4XKV A;  3V7S A;  1R1U A;  2HXO A;  4M6V A;  1FBU A;  2A6T A;  5DM7 F;  1WZ2 A;  1NG7 A;  2M4G A;  1PP8 F;  3SFI A;  3L2R A;  3QPL A;  5KK1 A;  5B1B H;  2PLY A;  4J00 A;  2VON A;  2L5Q A;  1W5T A;  2VIX A;  3S16 J;  4XON A;  2GOX B;  2L9S A;  3FMS A;  5JHU A;  4FTH A;  2ESH A;  2K86 A;  3JR9 A;  4QTR A;  1UJ8 A;  2EBI A;  2RRE A;  2IRF G;  1ZGJ A;  1SD5 A;  2NS7 A;  5EEH A;  3CCM I;  4U88 A;  1SAX A;  2K3F A;  1IRZ A;  4A0Y A;  1MBH A;  2HI3 A;  2IBD A;  2V79 A;  3SJM A;  5ILU A;  1QO0 D;  2ZXH A;  1BOA A;  1RKW A;  3HXL A;  3W6V A;  4GRI A;  2FBK A;  3IRR A;  1U9N A;  1I39 A;  1KQ0 A;  3HDD A;  4XLA A;  3BR5 A;  3VFZ A;  2KJB A;  2IS6 A;  1X19 A;  1XS9 A;  3KYL A;  3BOQ A;  2HDC A;  1WH7 A;  3CDL A;  1W4M A;  3O6B B;  2VQC A;  1ZGA A;  3F8C A;  3KEY A;  2DMU A;  1YYV A;  5J1R A;  4UVC A;  1MW7 A;  3BTC A;  5FO5 A;  2JT1 A;  3JRE A;  4IKF A;  3FBI B;  3S2H J;  3H35 A;  4RDU A;  2LDU A;  2VXZ A;  2VOD A;  1FP2 A;  3EET A;  4PFP A;  1FMW A;  1PUF B;  2HDW A;  4IHS A;  1JHF A;  5ERI A;  1K83 J;  2XB5 A;  3K4K A;  3LAJ A;  3GUD A;  3N05 A;  3ZQG A;  1MJB A;  2EQR A;  2KDO A;  4NDL A;  3N4M A;  3H9G A;  2LC2 A;  1E3P A;  1OFC X;  1WCM J;  3RYP A;  1Z7U A;  5GAG J;  6PAX A;  3E0J B;  1XG1 A;  2M30 A;  4AU7 A;  4KYW A;  1ZTR A;  5J4V A;  2R7X A;  2RDP A;  4BNC A;  1FOX A;  4HV6 A;  3FIS A;  3TOB A;  2FBI A;  3L9F A;  2G0E A;  1MNM C;  4ZZD A;  3DKW A;  4B3X A;  4A3C J;  5FB2 A;  2BVL A;  2L0K A;  3KP2 A;  2Q8K A;  1BIA A;  2R7F A;  3PNV A;  4IRI A;  3HPH A;  4LOC A;  2XAF A;  2O03 A;  4LJZ F;  2V7F A;  4CCJ A;  3T8R A;  1HBX G;  4G12 A;  1X1P A;  4CCO A;  4I76 A;  2K85 A;  3KP4 A;  5LGT A;  1USS A;  4ENJ A;  3BZC A;  2UXN A;  2H8W A;  4MEY F;  3P9I A;  1ZG5 A;  1TWH J;  3HC7 A;  1YRN A;  2W57 A;  2PFB A;  4Y4R A;  4BY7 J;  4YIF A;  1WJA A;  4B43 A;  2JTV A;  3QP5 A;  2ZSH B;  1OCT C;  3GWZ A;  1WQ2 A;  5DDG A;  1D5V A;  3U2R A;  2R7Z J;  4HQM A;  2DA3 A;  3QWL A;  1K4S A;  1J59 A;  2EFP A;  1IG7 A;  5DV5 A;  3JSP A;  5GAD J;  3B6C A;  4RB3 C;  3Q9S A;  3F22 A;  5JVT A;  5HLT A;  2N8G A;  2EA4 A;  2I8D A;  2V26 A;  3EYI A;  4D7M A;  5M5X J;  1LDK B;  2R7T A;  3OOP A;  1RUO A;  2V6E A;  2LSO A;  3H3Z A;  4BQO A;  3P9C A;  4IRG A;  3JRD A;  4FX4 A;  1XMA A;  4ZTJ A;  1SFX A;  4EVI A;  3GTG J;  2M5W A;  4U7D A;  1P4W A;  3K69 A;  3QU3 A;  3ZMU A;  2BEO A;  1O3R A;  3BJO A;  3VWB A;  2LG4 A;  3BPV A;  1BM9 A;  1CF7 A;  3GW2 A;  1IV6 A;  3E1S A;  5CPR B;  3WTY C;  3DXJ F;  5HS7 A;  2I5U A;  5GP9 A;  5K5Q A;  2UWM A;  3S1Q J;  3H92 A;  3RKX A;  2DMQ A;  2R0Q C;  1RR8 C;  4EM2 A;  1V4R A;  1ZH5 A;  3WGH A;  1D8K A;  2EFQ A;  2M2E A;  1A36 A;  2L9R A;  3E6M A;  5EF6 A;  2HYF A;  4KUM A;  3V7R A;  1I1G A;  1O3T A;  4A3L J;  2PBI A;  3CCS I;  3CJR B;  3RYR A;  2DA6 A;  4B1R A;  2Z9O A;  3JAM Z;  4YRV A;  1O3Q A;  3KLN A;  3AG4 H;  2R7U A;  4BBR J;  1FTZ A;  1DGR M;  4PUS A;  1K4T A;  5F1R A;  1ETW A;  3DPT A;  4RM2 A;  2E19 A;  2P81 A;  2O3F A;  2QQ9 A;  1XD7 A;  2OUM A;  2LH9 A;  2L9V A;  1P4X A;  3GXO A;  4HYE A;  5HS9 A;  1QPI A;  3W6J B;  4A0Z A;  3T1B A;  1BC8 C;  1UCR A;  2MW8 A;  2RV8 A;  3HRS A;  2CW0 F;  4XRM A;  3J81 K;  1F5T A;  1S9H A;  2IGM A;  3AFH A;  2WAF A;  2P7C B;  3AG1 H;  5HVQ C;  1T98 A;  2Q2E A;  2M45 A;  4N0B A;  1P7J A;  1S3J A;  1MZB A;  3HTU A;  2RAE A;  4WXD A;  1IXS B;  2O9L A;  2IS4 A;  2YX7 A;  3BR0 A;  3CDH A;  3LSI A;  4W97 A;  3RPU D;  1U5T C;  4A3G J;  4X6A J;  5L3F A;  3K4B A;  1T56 A;  3DP7 A;  2FQ3 A;  3LSM A;  1T6S A;  2RQQ A;  3QP6 A;  4ZTF A;  1ZRD A;  4S05 A;  2KT0 A;  2GIZ A;  4I2O A;  1KGS A;  3OYM A;  1G59 A;  3RKW A;  1TWF J;  1IC8 A;  2GAU A;  2JSP A;  1TW3 A;  2Y0S N;  1G3Y A;  1I50 J;  2E1C A;  4GCV A;  1SD7 A;  3JTG A;  4HDV A;  2PJR A;  1IN7 A;  2DOE A;  3MD2 A;  1W36 C;  1HKS A;  2CQK A;  2VXD A;  1J2X A;  3IKV A;  3J7A Y;  4AUX A;  5HOD A;  4MTD A;  5F0F A;  1G8X A;  3JRI A;  2EFW A;  2JRT A;  1YFH A;  2WAD A;  5B5E C;  2V1X A;  1JTY A;  2YU3 A;  5IY5 H;  3R0J A;  3F8M A;  5HDN A;  3F8F A;  3DF8 A;  4XK4 A;  4PCQ A;  2DPU A;  3BG6 A;  1YX3 A;  4ZZL A;  2A61 A;  1F43 A;  1ETV A;  2MC4 A;  2JUG A;  2LTP A;  2OZ6 A;  5FKO A;  3TP3 A;  3U1K A;  5FFX A;  4HX8 A;  3X2Q H;  3FXR A;  1RR7 A;  3WGG A;  4BE0 A;  1HLV A;  2LOO A;  3KX2 A;  2KIM A;  1QZE A;  4EGZ A;  1Z6R A;  2NS8 A;  2BY3 A;  1UB9 A;  1OCC H;  3J80 Z;  2L02 A;  1MMG A;  2XAJ A;  3K2Z A;  4AM3 A;  1OPC A;  3HOU J;  1I3Q J;  2ICW G;  2JPB A;  2LFB A;  2COB A;  5J1U A;  3TO9 A;  3S2D J;  1D3Y A;  1J0R A;  1B8I A;  1YIJ I;  1UMQ A;  2R7R A;  3A02 A;  4ZDO A;  1MNE A;  4LLG F;  3CO7 C;  3TL4 X;  3I55 I;  1IZ1 A;  3WTZ A;  2NNY A;  3KP7 A;  1B8I B;  2CUJ A;  4F52 A;  2Y9Z A;  2HZD A;  2X0L A;  3PL8 A;  3PIO F;  2PG4 A;  1YW8 A;  3KP6 A;  1CQT A;  2QYO A;  4N4O B;  3SEQ A;  3OOU A;  1S72 I;  4CO8 A;  1DPU A;  1S7O A;  2HYJ A;  2QKL B;  3C2G A;  3PQJ A;  1LPQ A;  2DJI A;  2XKP A;  3OYD A;  3GFJ A;  4HLY A;  5E17 F;  3S8P A;  1O3S A;  3NEU A;  1V54 H;  3HRU A;  4C3I J;  4BKX A;  2M4K A;  2ACJ A;  2A05 A;  4A0X A;  2E5N A;  3HYI A;  1N78 A;  4ENM A;  3COA C;  4OOI A;  4LGW A;  2HKO A;  5LGN A;  2O8X A;  4AWX B;  2NVX J;  5IT9 K;  4RGS A;  3KEQ A;  2BOL A;  1KU7 A;  3HRT A;  4RGU A;  4D5F A;  4JX5 A;  3L00 A;  1R5G A;  2A5W A;  2LVS A;  3PO2 J;  3J81 Z;  2KIF A;  5BMZ A;  3F8B A;  2ELJ A;  3V7C A;  2KZV A;  2RC4 A;  4YEJ A;  1YO5 C;  2PMH A;  3ZR8 X;  3IUO A;  5FFZ A;  4AIJ A;  2OTL I;  2ADU A;  4MQ9 F;  4O5V A;  3V8L A;  4U7B A;  1IDY A;  4CCK A;  2DFI A;  2VJJ A;  1X2N A;  3NWS A;  3FKI J;  4XSX F;  3SHF A;  1T38 A;  1GT0 C;  3CC2 I;  2CUE A;  1S29 A;  2DFE A;  1SVL A;  1N25 A;  2OCC H;  2VOO A;  3FIW A;  3H1C A;  4PJJ A;  3WTU C;  2DW4 A;  4ZYA A;  2EZH A;  2FSW A;  4OU0 A;  5IOZ A;  1BC7 C;  2IXS A;  4K2E A;  4F91 B;  3BCA A;  1SD4 A;  4DZJ A;  3KE2 A;  3QYE A;  3I9V 2;  3PNT A;  3S32 A;  2J5O A;  2CV1 A;  2CW8 A;  3CJN A;  2NAZ A;  2K9N A;  3LA3 A;  1Y1W J;  3ZQQ A;  3AKZ A;  1GV2 A;  2CW7 A;  1Z67 A;  4MHG A;  3PUF A;  1XX5 A;  2HVR A;  3OYN A;  2Y69 H;  2ISZ A;  5FLX Z;  4BQA A;  2CUZ A;  3WHB A;  4AYB N;  4JOM A;  5GPC A;  4L5J A;  1V5E A;  5H6R A;  3WOD F;  2VB6 A;  5F04 A;  1LEB A;  3L2U A;  2X48 A;  1R49 A;  1RZ4 A;  3I56 I;  4B4C A;  5TRD A;  4A3I J;  1FIA A;  4FE4 A;  5JLW A;  1TC3 C;  2XAU A;  4V2G A;  2DJN A;  1LNW A;  2E1M B;  3BTI A;  2LY2 A;  4C3H J;  4BGD A;  5H2F C;  5C3E J;  2IA0 A;  4Y33 A;  1QZZ A;  1IF1 A;  2ZCW A;  2VJI A;  3BP8 A;  2LBF A;  2ZJQ F;  1K79 A;  2JVG A;  4EEF G;  5B1A H;  4XID A;  4HNT A;  3MZH A;  2Z5U A;  4Q47 A;  5HNF A;  2GBY A;  4M6Y A;  2DYR H;  2PJP A;  2LK2 A;  1SVM A;  1TQP A;  2HFH A;  3CD6 I;  4N9I A;  3WTS C;  3E6D A;  4PFO A;  4XLN F;  4JYK A;  2OQG A;  5HLH A;  2VLA A;  2ZNZ A;  1BI1 A;  2ZME B;  4A3K J;  1R1V A;  4L0Y B;  4V19 K;  2MGQ A;  3CMM A;  2V1D A;  2E1O A;  1GLN A;  4Y13 A;  3CLO A;  2DT7 B;  4ANJ A;  2R4G A;  1I1S A;  3K7A J;  3GX4 X;  4HDU A;  1Z05 A;  2K5C A;  1IV8 A;  4F55 A;  3K6G A;  2DQL A;  2JRM A;  3TDU C;  2PMU A;  3KP5 A;  5IPA A;  2W24 A;  1LJ9 A;  1X58 A;  2XRN A;  1Z77 A;  1ZKG A;  5J1Y A;  4EMS A;  3WU1 B;  3PO3 J;  5FGM A;  2EV0 A;  1T39 A;  3GFI A;  2AXL A;  1U0J A;  1S8N A;  1CF7 B;  4IJA A;  2QKM B;  1UEL B;  4L9N A;  4I01 A;  2DBB A;  1E2X A;  3H5A A;  1AU7 A;  4HAM A;  3BR6 A;  3CCU I;  1BR4 A;  2BY1 A;  1XSX A;  3CQZ J;  4MLO A;  3TOA A;  3OYJ A;  3VPR A;  2R7Q A;  1WJB A;  2WB1 A;  1JJ6 C;  1D8J A;  1E17 A;  1T95 A;  2FUG 2;  1F4K A;  3FXK A;  3ROU A;  3GTP J;  2XRL A;  3BR3 A;  4BBS J;  1SD6 A;  2EZI A;  4LG0 B;  4P55 A;  3HG9 A;  4CCL A;  1TP4 A;  2B7E A;  3F6V A;  3HSF A;  2DCE A;  5J47 A;  2K9S A;  2E71 A;  5FD5 A;  2MH9 A;  3QOE A;  5BOX A;  1BI2 A;  2IGO A;  2M3A A;  1XGO A;  3IV5 A;  3GLL A;  3ZQI A;  2NRA C;  3E6C C;  3K4M A;  1DDN A;  2MH2 A;  4AIH A;  4IF4 A;  1I6H J;  4I7H A;  3QPH A;  3WGI A;  4A93 J;  1FT9 A;  2ELK A;  2KL4 A;  1S7A A;  3LFU A;  5FD6 A;  2P6T A;  2VJ4 A;  3FZV A;  4S04 A;  3MZY A;  2GXA A;  4Y52 J;  3CF2 A;  1DP7 P;  4NC7 A;  4UB8 C;  1K78 A;  2W1O A;  3FF5 A;  3E7L A;  4NQW A;  1FX7 A;  4RA2 A;  1ZRC A;  2E60 A;  2M8G X;  1RES A;  2KKO A;  4QPQ A;  1ZLJ A;  4EQQ A;  3T0Y A;  1ETO A;  1B59 A;  2EA2 A;  2F4I A;  4KA4 A;  2KMU A;  3PQK A;  1D0Z A;  5EYR A;  5FJ8 J;  1V3F A;  2BW3 B;  3BJ6 A;  4GO1 A;  1YS7 A;  3ECO A;  1L3L A;  1XMK A;  1FLI A;  1EA3 A;  4JX6 A;  4M9X A;  1SMT A;  3OYF A;  1FZP B;  3BY6 A;  1YI2 I;  2ZC2 A;  3ERE D;  3IH2 A;  3GFM A;  3DPL C;  4RGX A;  2GA1 A;  2RN7 A;  4DQ2 A;  4EJV A;  3KFW X;  3F9K A;  3LWF A;  5DYM A;  3MKZ A;  1RRJ A;  3CO6 C;  1XN7 A;  2Z2S B;  1IW7 F;  4FX0 A;  4IHT A;  1RI7 A;  2R7V A;  1P9Q C;  3TGN A;  4B8X A;  1MDM A;  2VJ5 A;  1S6L A;  1Z6T A;  1NTC A;  1LUJ B;  3ZMZ A;  2GIV A;  3ZOB A;  2ZJP F;  2DA2 A;  2K02 A;  3GFL A;  5EZG A;  2DOA A;  1VQO I;  2IS1 A;  1IO2 A;  1UFM A;  2XVC A;  4ETS A;  2R92 J;  1IXC A;  3T5X A;  2KHM A;  2WC2 A;  4EV0 A;  2R7D A;  1FOW A;  3QAH A;  4UUS B;  4D7N A;  4I6Z A;  1ON2 A;  2X9D A;  3LST A;  3VOD A;  2FNP A;  4LLL A;  2IJL A;  3QPT A;  2M0C A;  4QPO A;  2VKD A;  1FYL A;  4XOT A;  2YPR A;  4CH7 A;  2X51 A;  3S15 J;  1FTT A;  1IN4 A;  2CV2 A;  2VKH A;  3BZK A;  1JKP C;  2Y9Y A;  4HX4 A;  2KP6 A;  3HOZ J;  2FBH A;  3ECH A;  3SZG A;  1IRF A;  2Y75 A;  4GGG A;  3FK7 A;  5ILS A;  1OR7 A;  1WSU A;  1N75 A;  2FRH A;  3MKL A;  2HTJ A;  4M3D A;  2R7W A;  2JA2 A;  4G6D A;  2B63 J;  2JK3 A;  4MGR A;  2GA2 A;  1D1C A;  4O3M A;  1UHM A;  3LQQ A;  2EZL A;  5DM6 F;  2O8K A;  5KCM A;  4E4H A;  1VFC A;  4I98 B;  4WK8 F;  2FE3 A;  5FRO A;  5CLS A;  2VL8 A;  2L9N A;  5IOY A;  4AID A;  3L2W A;  4Z2Y A;  2F4M B;  2OD5 A;  4AYB A;  4C3J J;  3ABM H;  2HWV A;  1UZC A;  2XSJ C;  3GTM J;  1BIB A;  1S5L C;  4BYY A;  1DQU A;  2DK8 A;  4BHB A;  4IO9 F;  4MFD A;  4XLE A;  3E6B A;  2QSH X;  2HOA A;  2VKV A;  3F3X A;  1JKR C;  1Z7L A;  2Q0O A;  4BY1 J;  3MWM A;  3H0D A;  2V9K A;  3GTJ J;  5EZH A;  2HOS A;  2X1C A;  5E3N A;  1IN8 A;  5F08 A;  2XSD C;  2XRO A;  3F0C A;  1VTN C;  2UV1 A;  4ESB A;  4E70 A;  4HQE A;  1PDN C;  1IN6 A;  4A2U A;  2XPU A;  2ZXI A;  2ZME A;  3JRF A;  2DPD A;  3RZO J;  5IYD J;  1B72 B;  3HL2 A;  4CZZ A;  1TW2 A;  1U2W A;  2YR2 A;  2BY0 A;  5EEA A;  4M3B A;  1F36 A;  4A3M J;  2FX0 A;  5AIP A;  2EIK H;  2FQ4 A;  4HA8 A;  2DA7 A;  1UG2 A;  4FIS A;  2QVO A;  1Q1H A;  2JA7 J;  3B73 A;  2CMP A;  2K4B A;  5BQT A;  3M1E A;  2DMN A;  2LY9 A;  1BI0 A;  3RKY A;  4ITV A;  1MMS A;  3FK6 A;  2L7F P;  5F0C A;  5HLG A;  1R5I D;  1M1E B;  1R5H A;  1OIS A;  4R79 A;  2VKE A;  4LLN A;  2FA5 A;  4LMY A;  5LGU A;  3G3Z A;  2XF5 A;  2JZY A;  4DOZ A;  1OJL A;  3REO A;  3DEU A;  3CMA I;  2W82 A;  2TRT A;  3PUB A;  1MMA A;  4QSH A;  3I59 A;  1OCZ H;  1SEU A;  1JGS A;  3TO7 A;  2P5K A;  5J6X A;  3ZXS A;  3EUA A;  1QHG A;  3P7N A;  5H6Q A;  3J7A O;  3A1Y A;  2STT A;  4LIU A;  5IYB J;  2RNG A;  4PJ0 C;  2DN0 A;  2H09 A;  3L2V A;  1BR2 A;  3G71 I;  5B66 C;  1QRY A;  2KRH A;  4JBA A;  2WA0 A;  3GLX A;  3ZQH A;  1POG A;  4F7Z A;  2FU4 A;  3I4M J;  1R23 A;  2ZME C;  3C7J A;  3HOT A;  1IUY A;  3L09 A;  3MKW B;  1ONV A;  3ESW B;  5K7F A;  1R00 A;  3OS1 A;  2QQA A;  1WJC A;  1UG0 A;  2VBX A;  1OYW A;  2LY1 A;  2M1B A;  2FJ1 A;  3ERM A;  4JQF A;  4JP0 A;  5CYV A;  4EJW A;  1MBJ A;  4Q48 A;  3HOX J;  5GTH C;  3CC4 I;  1XCB A;  2H6B A;  5EGO B;  2DQR A;  3CP2 A;  1R58 A;  4G7O F;  3BG9 A;  2I10 A;  5EGO A;  2KJC A;  1WGX A;  3Q3S A;  1BI3 A;  4PJM A;  4XMY A;  3BPX A;  3HRM A;  3OWT A;  1HCR A;  2OC6 A;  1AKH A;  2CJJ A;  1JT0 A;  2CV0 A;  2K7L A;  4JK1 X;  3H3V K;  2NOJ B;  3CUO A;  2YS9 A;  3PFY A;  4QLC U;  2HR3 A;  1WJF A;  3I3L A;  4L18 B;  4IOC F;  3ABK H;  3K70 C;  4DNC A;  1V55 H;  1FIP A;  3GYH X;  3VYS B;  3A03 A;  5ICC A;  2ETH A;  2DFF A;  1GXP A;  3FXU A;  4CXF A;  2QEX I;  1MDM B;  1GUU A;  2B0L A;  4B44 A;  2X85 A;  4LD5 A;  3SDG A;  3MQ0 A;  4E7I A;  2CGP A;  1A5J A;  3O3K A;  2Z33 A;  1TBX A;  3EPZ A;  2WAE A;  3HGG A;  1G6N A;  4CYC B;  2VUM J;  3JAM K;  2DLL A;  3BZ6 A;  1AHD P;  2P0W A;  3L2Q A;  2F5D A;  1SC7 A;  1B72 A;  2VQL A;  1HST A;  5C4X J;  2HU9 A;  1X3U A;  5F0H A;  5LHH A;  3OYH A;  1YHQ I;  1HKQ A;  3ML6 A;  1Q1V A;  2YX4 A;  3DQV C;  4XN3 A;  3KLO A;  4P96 A;  3GME A;  1YIO A;  2KIU A;  4DBQ A;  1GHC A;  2CQQ A;  5K7H A;  3HEF A;  3O2P E;  3DV8 A;  2DA5 A;  2DYS H;  2PJR B;  3ABT A;  1E3O C;  2A5Y B;  1BW5 A;  2X1E A;  4A12 A;  3CCE I;  5E79 C;  3Q0U A;  1R4M B;  3DTI A;  5FLM J;  2NVQ J;  4I99 C;  5J4Y A;  3ZQF A;  4GFB A;  2CWE A;  3WTT C;  2IA2 A;  2WWY A;  3CCR I;  4XKB A;  5JFR A;  1G3W A;  1BL0 A;  1ZR4 A;  1MMN A;  1ZGW A;  3HUG B;  3I5U A;  3VOE A;  4XRS G;  3K1P A;  3MVP A;  1TQM A;  3G1O A;  3KYC B;  1FP1 D;  1W7P B;  2MLK A;  2X6X A;  2ME0 A;  3NQO A;  4Q4Z F;  1FOY A;  4I02 A;  4IQ4 A;  1T08 B;  1Z0X A;  3QYF A;  1K7A A;  1MBG A;  4HF2 A;  2E1N A;  2NOG A;  4M72 A;  5BS6 A;  1QU3 A;  4CHU A;  4GXO A;  1J7K A;  1W0T A;  3ABU A;  4FAS D;  3ASO H;  4HZF A;  2L7Z A;  1LVK A;  3HB9 A;  3JRB A;  4O6J A;  3OYK A;  1IAW A;  4II3 A;  2C6Y A;  4G94 A;  1ZQ3 P;  2EJR A;  2XB0 X;  4UVA A;  3K70 D;  5F6F A;  2L4A A;  4AC0 A;  3LQR A;  1BJA A;  1TT0 A;  3IP4 B;  5TGT A;  5BPI A;  2ZBK A;  3BR2 A;  1VQ4 I;  1D1B A;  3HHH A;  9ANT A;  4BJ6 C;  2K27 A;  3CJT B;  3ASN H;  5D5V B;  1LDJ A;  1TWC J;  3A0B C;  3TQN A;  3HJE A;  2G7H A;  2IAI A;  3U1D A;  3W2V A;  1FBS A;  4HLX A;  3K4J A;  1WRJ A;  2A68 F;  1Z1D A;  4BL0 B;  2JA5 J;  2E36 A;  4KDP A;  4IOA F;  1JKO C;  3G2B A;  5JLX A;  2AHQ A;  5D4R A;  4PJL A;  1FNN A;  3IKT A;  2OCE A;  5IT3 A;  3W6K B;  4M71 A;  4FHT A;  2EIL H;  2X1D A;  1H88 C;  4ZYH A;  2H1L A;  1NHA A;  3U9G A;  2VE9 A;  1Y8R B;  4BJ5 C;  3H9Q A;  2L01 A;  4IHY A;  3IAS 2;  3CUQ A;  2KRC A;  2JN6 A;  2XIG A;  5DD8 A;  2JMW A;  1W0U A;  3FXO A;  3BJA A;  3OR1 C;  1FJL A;  2LLK A;  2EV5 A;  4BUP A;  1NG6 A;  1ORK A;  2DOD A;  1I3A A;  1X1D A;  4UHT A;  4BJT A;  2XC7 A;  3G6E I;  1MMD A;  2A07 F;  1G3S A;  1W1W E;  1J5Y A;  2XAH A;  5J3L A;  3OYA A;  4G7Z F;  5JHF A;  1ERD A;  1Z21 A;  2MBF A;  2LP0 A;  3V42 A;  2NXN B;  3LMM A;  4LG3 A;  3GVA A;  1IGN A;  4OIR F;  3VYU B;  5CVI A;  3U21 A;  1MBF A;  4EAT A;  3GZN B;  2D2W A;  5JR3 A;  4HBL A;  3K0L A;  2BBY A;  1HKT A;  5J40 A;  1QBJ A;  3BC8 A;  5H20 A;  3HKZ A;  3TMO A;  2O0Y A;  4M73 A;  4UUS A;  4KT6 A;  3GTL J;  3LSJ A;  1RPW A;  5FKM A;  4EJU A;  1WHU A;  1YRN B;  2P5V A;  3LSP A;  3M9A A;  1EF4 A;  4H0E A;  5HDK A;  4ZJZ A;  4KIC A;  2L7K A;  4RAG A;  3S93 A;  3SDB A;  1RKT A;  3WTW C;  3ZPL A;  2X6W A;  2EIM H;  2G7U A;  5E3M A;  2NVU B;  4YFX F;  1A04 A;  5EG0 A;  1BA5 A;  3I59 B;  1YW7 A;  3G1L A;  3SFZ A;  3TKY A;  4CUG A;  4OMY A;  5D4S A;  2D45 A;  2CQN A;  2M7B A;  4HW0 A;  5DCM A;  2O6G E;  2F5E A;  4M9S A;  4AVP A;  3UKG A;  3LSR A;  2E34 A;  1YG2 A;  4IHW A;  4HRI A;  1MGT A;  2QBY A;  2ZXW H;  1LFP A;  4BEH A;  3KZI C;  4PSW A;  1TNS A;  2F2E A;  4ZDP A;  2K9L A;  3FDY A;  1IUF A;  2YUS A;  4EJO A;  2QWW A;  5AON A;  3F21 A;  3MAJ A;  4C2M J;  1ETK A;  3I71 A;  1K6Y A;  3WE3 A;  5J8C A;  2LF7 A;  2F6C A;  2AXT C;  1PUF A;  2DDB A;  3RQ4 A;  4TV7 A;  5CQG A;  4FQG A;  2IT0 A;  2LYC A;  3W3C A;  5M5W J;  1J75 A;  1LB2 A;  2QCO A;  5LHI A;  1G2H A;  1ODD A;  4RS8 A;  1SAU A;  3DU5 A;  3FMR A;  1MBE A;  2R7O A;  3WG7 H;  3S17 J;  1TNT A;  2QEN A;  4XRS A;  4E7S A;  5AIQ A;  3CUQ C;  4DZP A;  2OF7 A;  3BTJ A;  2F5V A;  3L7W A;  1WPK A;  2L3D A;  3BWG A;  2JSC A;  2E7X A;  3A2K A;  1Y6I A;  1A35 A;  5A2Q Z;  4YFN F;  2R3S A;  4XNF A;  4LB6 B;  3DBR B;  2DTZ A;  4UB6 C;  5L3C A;  4NHJ A;  3H9J A;  3B02 A;  2NS0 A;  1G4D A;  4BHP A;  2DMT A;  3CP8 A;  4HF0 A;  2K40 A;  3I54 A;  4L0Z B;  1YE9 A;  2V1N A;  2BZT A;  4OIO F;  3DKY A;  4XN0 A;  4XLF A;  2LKS A;  3K4L A;  3JRG A;  5HOO A;  3ELK A;  3HSR A;  5L3G A;  1I5Z A;  2LR8 A;  3WTX C;  1B9N A;  3DEE A;  2GQQ A;  2CFX A;  2FEZ A;  3DKX A;  3E3V A;  1MBK A;  1FPQ A;  3M4O J;  2HOT A;  3JRH A;  1KU2 A;  1PUE E;  3J7Z I;  1Y0U A;  4L9V A;  2GXB A;  1V5G A;  2MLG A;  1D5Y A;  1VQ7 I;  4RB2 C;  3IH4 A;  3WU0 A;  1ACI A;  3CME I;  4BE2 A;  4E7Z A;  2Y48 A; 
#chains in the Genus database with same CATH homology
 4BHC A;  1RNL A;  4A5N A;  4GYI A;  1KYZ A;  4ZYE A;  1B4A A;  4EJT A;  4ESJ A;  2EB7 A;  1UST A;  5L3E A;  2CSO A;  2VC0 A;  3ZMD A;  2STW A;  5D8L B;  3F6O A;  2QZ8 A;  2WV0 A;  3JSO A;  5LHG A;  1AOY A;  1P2F A;  3BRO A;  1HW2 A;  4Y15 A;  2XUB A;  1ZG1 A;  2OU2 A;  4L9T A;  1BN5 A;  3DFG A;  2BGC A;  4L5I A;  1MJ9 A;  3FX3 A;  3H3U A;  3WTV C;  2UZK A;  5IT9 Z;  2VOP A;  5F64 A;  2VBZ A;  3F23 A;  2P8T A;  2IA1 A;  4A6E A;  1EH7 A;  2F5C A;  1KQ8 A;  3MCZ A;  2ZKZ A;  1UHW A;  2QLZ A;  1O57 A;  2HKX A;  2G9W A;  4XBF A;  2ZO4 A;  3EDP A;  2FMY A;  2VT3 A;  2XAG A;  2XV4 S;  4ON0 A;  4MNU A;  2NYX A;  2P4W A;  4G8X A;  4UNO A;  4IXA A;  2HOE A;  2O61 A;  2ZXJ A;  1HSJ A;  5DUK A;  3V4G A;  3HTS B;  3V8J A;  2HQR A;  1FY7 A;  2Z3Y A;  4OIN F;  1YLF A;  1ZRE A;  4WF2 A;  1ZLK A;  2COM A;  3EQL F;  3PFI A;  1P92 A;  4BH9 A;  5D8K B;  3ZMT A;  1ZHF A;  3KZZ A;  3E5Q A;  4XLP F;  1B1B A;  5DCF A;  4PZJ A;  1MD0 A;  1RIO H;  1DUX C;  1FOK A;  4OIP F;  3RIR A;  2P6S A;  2Z99 A;  4ASN A;  1SFE A;  2EFO A;  3KEO A;  5LBQ A;  4WWC A;  3G73 A;  1STZ A;  4RAY A;  5K5O A;  4RB1 A;  5DEQ A;  3ZMS A;  1FSH A;  1GXQ A;  4P9F A;  2DK5 A;  4B09 A;  2HZT A;  5K5R A;  2MD5 A;  2HEO A;  3C1D A;  3R61 A;  4Y17 A;  3WG9 A;  2FOK A;  2A6H F;  3M8E A;  2Y0M A;  2EK5 A;  3AAF A;  5D5X B;  4ENK A;  1EH6 A;  2ELH A;  5K1Y A;  2BE5 F;  2DTR A;  2V1U A;  2HTS A;  2IVM A;  5DD4 A;  1TLH B;  1Z91 A;  5DUI A;  3IL2 A;  2CG4 A;  3GO5 A;  3ISP A;  2GWR A;  1HQC A;  1LQ1 A;  1H0M A;  3HIF A;  4EGY A;  3KZY A;  1U5T A;  5CVR A;  4CYD A;  1LVA A;  4UXN A;  1WWX A;  3EYY A;  1FYM A;  1XGM A;  5LEK A;  1IN5 A;  4U0W A;  2PI0 A;  3LFK A;  3I4P A;  1OYI A;  4WCG A;  1ON1 A;  4OMZ A;  4UV8 A;  4Q5S F;  1FWZ A;  2MC3 A;  3ZN0 A;  1XB4 A;  5E1X A;  2XHK A;  3E5U A;  2VN2 A;  3QRF F;  2BYV E;  4KT5 C;  1QPM A;  5CVU A;  5L3D A;  2XGX A;  4WXH A;  1OKR A;  3I64 A;  2V6C A;  1WI9 A;  2D1V A;  4R1H A;  1W7P A;  4R8H A;  4LFU A;  5TJJ A;  1K78 B;  3ZN1 A;  1B9M A;  1RUN A;  2TDX A;  3CTA A;  4ZYG A;  1J9I A;  2YSR A;  3VEP A;  3GEZ A;  2FF4 A;  1PP7 U;  2RQP A;  5D6E A;  3IRQ A;  2P5L C;  4I0B A;  5E1Z B;  1REP C;  2CYY A;  2XAQ A;  1XSV A;  1K6O A;  2ZJ2 A;  1L0O C;  2LNB A;  1P6R A;  5HS8 A;  3KET A;  4HOB A;  2D1H A;  2DU9 A;  2DI3 A;  4MEX F;  3C3W A;  1R1T A;  4I09 A;  4KIF A;  2ZNY A;  3FM5 A;  4IPA A;  2OZU A;  5LRR A;  1XGS A;  5CVV A;  3KP3 A;  3TO6 A;  5L3B A;  4KMU X;  5DCM B;  5ED4 A;  1G3T A;  3RPQ A;  3IC7 A;  5KVR A;  3SZP A;  2M8E A;  3BDD A;  4CDG A;  4RGR A;  4IRH A;  1W7P D;  3RPU A;  1ZN2 A;  5LLQ A;  5A2Q K;  2HYG D;  3Q9V A;  2ISY A;  1T2K A;  2WTE A;  4LK1 F;  2DT5 A;  2W84 A;  4A6D A;  4N9H A;  4YG2 F;  3EUH A;  2VC1 A;  3LAP A;  4KN4 X;  3FHZ A;  2DO7 A;  2OAZ A;  4AIK A;  4CIC A;  3FWE A;  4PGH A;  3I58 A;  1XSD A;  3CUQ B;  4ZH4 F;  3D5L A;  2RNJ A;  2A69 F;  2VE8 A;  3QU6 A;  4U0Y A;  1XDU A;  1U78 A;  2LF8 A;  1GVJ A;  1H9T A;  1LDD A;  4BXU A;  1QZY A;  4UVB A;  4WXC A;  3RTR A;  3R60 A;  1SMY F;  1FC3 A;  3R0A A;  1EV7 A;  1R22 A;  3E97 A;  3JTH A;  1XGN A;  4M6X A;  2QM3 A;  3GF2 A;  2MA3 A;  1CGP A;  1I27 A;  1KQ9 A;  3Q5F A;  4OIQ F;  2FML A;  5D5U B;  3K1M A;  1IXR C;  2PEX A;  4ZYD A;  2EFN A;  4HV5 A;  2W25 A;  1YW9 A;  3L2C A;  1FYK A;  2JPC A;  4KIB A;  2OQR A;  3HHG A;  2CO5 A;  1JHH A;  2XKO A;  4AD9 A;  3HUG A;  1HW1 A;  1U3E M;  1R7J A;  1C0W A;  1HXD A;  2P7V B;  3MFK A;  2W85 A;  1SFU A;  5HLI A;  1QQI A;  4RB0 A;  1F9N A;  2AS5 F;  3GZ6 A;  1ZRF A;  1TQI A;  2EV6 A;  1FSE A;  2OA4 A;  4RAZ A;  1LEA A;  5ICE A;  3F8N A;  4YFK F;  2KRF A;  1AWC A;  2QQB A;  2IPQ X;  4M9Z A;  4I0A A;  5EEG A;  4UV9 A;  3LA7 A;  3IHU A;  1DPR A;  1P4A A;  4BAY A;  4A5M A;  2HS5 A;  5D6F A;  4XSZ F;  3T8T A;  1QNT A;  4P5O A;  3M8F A;  2X4H A;  3R6S A;  1U5T B;  4HX7 A;  4WX9 A;  3S2W A;  2IP2 A;  4ENN A;  4P9U A;  4EM0 B;  5FLX K;  1KYW A;  4FT8 A;  3FXQ A;  4LG0 A;  3RJP A;  1B6A A;  4GYG A;  2K4J A;  4KMF A;  4G7H F;  2H27 A;  1EH8 A;  4MTE A;  1XCV A;  2HQN A;  1ZG3 A;  2QUF A;  2RGV A;  1F1Z A;  4G9Y A;  4KNY A;  3VB2 A;  1FBQ A;  1W5S A;  2GXG A;  1HW5 A;  3V8K A;  3NRV A;  5LRS A;  3K9T A;  3TDZ C;  3IWF A;  2ZFW A;  5JI6 A;  5E8G A;  2V9V A;  3ZP5 A;  5BPD A;  4LB5 A;  4QWQ A;  1YTY A;  3ZQ7 A;  1WKM A;  3HSE A;  1ZAO A;  3E5X A;  2F5F A;  1YS6 A;  5CVJ A;  2HGC A;  4D0P A;  3WE2 A;  3MEX A;  1IRG A;  3LA2 A;  1Z9C A;  4ESF A;  2GZW A;  4MQV A;  1I6X A;  2PN6 A;  2NNN A;  2EWN A;  2UXX A;  2OBP A;  1O7L A;  4CGZ A;  5ICF A;  4L9J A;  4KN7 X;  2DAO A;  4KIG A;  2H6C A;  3C18 A;  3ULQ B;  4HF1 A;  1ZAR A;  3D0S A;  4M74 A;  1JE8 A;  3IWZ A;  5CJ9 A;  5HDG A;  2FXA A;  3K1N A;  1KA8 A;  5ILV A;  3SXY A;  3FM3 A;  3QOP A;  1XDS A;  2IW5 A;  1O7F A;  3P9K A;  3RDI A;  3ZMV A;  2E7W A;  5E8I A;  1JXS A;  3M7G A;  2A6E F;  2VBW A;  2VBY A;  2M87 A;  5ICG A;  4YII A;  5E20 A;  2QBY B;  4UUV A;  4LK0 F;  4EM1 A;  5LEJ A;  1MJA A;  1KU3 A;  1TTY A;  1ULY A;  2L4M A;  4G6Q A;  1ZYR F;  2RKH A;  2J5P A;  2L54 A;  2FNA A;  1BBY A;  4IVN A;  5D5W B;  3OV8 A;  5E1W A;  4PDK A;  4U0V A;  3SZT A;  1H9G A;  3RI4 A;  3I53 A;  3GZ5 A;  3N97 A;  2XAS A;  3J80 K;  2H94 A;  1KU9 A;  5J8F A;  2VT2 A;  3F72 A;  3HOS A;  3R4K A;  3SQN A;  2A3S A;  3I0T A;  2PQ8 A;  1OYY A;  1U8R A;  5E18 F;  2BV6 A;  2LKP A;  1U6G A;  1QGP A;  3KCC A;  1OMI A;  1R36 A;  3FMQ A;  3JW4 A;  2RVC A;  4KFC A;  1MKM A;  1T0F A;  4XRF A;  4NB5 A;  2ESN A;  1YQA A;  4PGG A;  3V7S A;  1R1U A;  1FBU A;  1PP8 F;  5KK1 A;  2PLY A;  2VON A;  1W5T A;  3FMS A;  5JHU A;  2ESH A;  2K86 A;  2IRF G;  1ZGJ A;  1SD5 A;  5EEH A;  4U88 A;  1SAX A;  4A0Y A;  2V79 A;  5ILU A;  1QO0 D;  1BOA A;  2FBK A;  3IRR A;  1KQ0 A;  3VFZ A;  2KJB A;  3BOQ A;  2HDC A;  1W4M A;  3O6B B;  1ZGA A;  3F8C A;  1YYV A;  4UVC A;  5FO5 A;  2JT1 A;  2LDU A;  2VXZ A;  2VOD A;  1FP2 A;  3EET A;  4IHS A;  1JHF A;  5ERI A;  3LAJ A;  3GUD A;  1MJB A;  3N4M A;  3RYP A;  1Z7U A;  6PAX A;  2M30 A;  4KYW A;  2RDP A;  4BNC A;  4HV6 A;  3TOB A;  2FBI A;  3L9F A;  4ZZD A;  3DKW A;  5FB2 A;  3KP2 A;  2Q8K A;  1BIA A;  2R7F A;  4IRI A;  2XAF A;  2O03 A;  4LJZ F;  1HBX G;  3T8R A;  3KP4 A;  5LGT A;  1USS A;  4ENJ A;  2UXN A;  4MEY F;  3P9I A;  1ZG5 A;  2W57 A;  2PFB A;  4YIF A;  2JTV A;  3QP5 A;  3GWZ A;  5DDG A;  1WQ2 A;  1D5V A;  3U2R A;  4HQM A;  1J59 A;  2EFP A;  5DV5 A;  3JSP A;  4RB3 C;  3Q9S A;  3F22 A;  5JVT A;  2EA4 A;  3EYI A;  1LDK B;  3OOP A;  1RUO A;  2LSO A;  3H3Z A;  3P9C A;  4IRG A;  4FX4 A;  1XMA A;  1SFX A;  4EVI A;  2M5W A;  4U7D A;  1P4W A;  3K69 A;  3QU3 A;  3ZMU A;  2BEO A;  1O3R A;  3BJO A;  3BPV A;  1BM9 A;  1CF7 A;  3GW2 A;  3WTY C;  3DXJ F;  5HS7 A;  5K5Q A;  2UWM A;  3H92 A;  3RKX A;  4EM2 A;  1V4R A;  1ZH5 A;  3WGH A;  1D8K A;  2EFQ A;  3E6M A;  2HYF A;  4KUM A;  3V7R A;  1I1G A;  1O3T A;  2PBI A;  3RYR A;  2Z9O A;  3JAM Z;  1O3Q A;  3KLN A;  5F1R A;  3DPT A;  2O3F A;  2QQ9 A;  1XD7 A;  1P4X A;  3GXO A;  4HYE A;  5HS9 A;  3W6J B;  4A0Z A;  3T1B A;  1BC8 C;  1UCR A;  2RV8 A;  3HRS A;  2CW0 F;  3J81 K;  1F5T A;  2P7C B;  5HVQ C;  1T98 A;  2Q2E A;  2M45 A;  4N0B A;  1S3J A;  1MZB A;  3HTU A;  4WXD A;  1IXS B;  2YX7 A;  3CDH A;  1U5T C;  5L3F A;  3DP7 A;  2FQ3 A;  1T6S A;  3QP6 A;  1ZRD A;  4S05 A;  4I2O A;  1KGS A;  3RKW A;  2GAU A;  1TW3 A;  1G3Y A;  2E1C A;  4GCV A;  1SD7 A;  3JTG A;  4HDV A;  1IN7 A;  1HKS A;  2CQK A;  3IKV A;  1J2X A;  4MTD A;  2EFW A;  2JRT A;  1YFH A;  2V1X A;  2YU3 A;  3R0J A;  3F8M A;  5HDN A;  3DF8 A;  3F8F A;  2DPU A;  4PCQ A;  4ZZL A;  2A61 A;  2OZ6 A;  5FFX A;  4HX8 A;  3FXR A;  3WGG A;  2KIM A;  4EGZ A;  1Z6R A;  1UB9 A;  3J80 Z;  2L02 A;  2XAJ A;  3K2Z A;  1OPC A;  2JPB A;  3TO9 A;  1D3Y A;  1J0R A;  4LLG F;  3CO7 C;  2NNY A;  1IZ1 A;  3WTZ A;  3KP7 A;  2X0L A;  2PG4 A;  1YW8 A;  3KP6 A;  2QYO A;  4CO8 A;  1DPU A;  1S7O A;  3PQJ A;  2XKP A;  3GFJ A;  4HLY A;  5E17 F;  1O3S A;  3NEU A;  3HRU A;  2ACJ A;  4A0X A;  3HYI A;  4ENM A;  3COA C;  4OOI A;  4LGW A;  2HKO A;  5LGN A;  2O8X A;  4AWX B;  5IT9 K;  4RGS A;  3KEQ A;  1KU7 A;  3HRT A;  4RGU A;  3L00 A;  1R5G A;  3J81 Z;  2KIF A;  5BMZ A;  3F8B A;  3V7C A;  2RC4 A;  1YO5 C;  2PMH A;  5FFZ A;  4AIJ A;  2ADU A;  4MQ9 F;  4O5V A;  3V8L A;  4U7B A;  2DFI A;  4XSX F;  3SHF A;  1T38 A;  1S29 A;  2VOO A;  3WTU C;  2DW4 A;  2FSW A;  4OU0 A;  1BC7 C;  4K2E A;  1SD4 A;  3KE2 A;  2J5O A;  3CJN A;  2NAZ A;  3LA3 A;  4MHG A;  2ISZ A;  5FLX Z;  4BQA A;  4L5J A;  5H6R A;  3WOD F;  1LEB A;  1RZ4 A;  5TRD A;  1LNW A;  2IA0 A;  1QZZ A;  1IF1 A;  2ZCW A;  3BP8 A;  1K79 A;  3MZH A;  2Z5U A;  4Q47 A;  4M6Y A;  2PJP A;  1TQP A;  2HFH A;  4N9I A;  3WTS C;  3E6D A;  4XLN F;  2OQG A;  5HLH A;  2ZNZ A;  1BI1 A;  2ZME B;  1R1V A;  4L0Y B;  2V1D A;  1I1S A;  4Y13 A;  3CLO A;  3GX4 X;  4HDU A;  1Z05 A;  2DQL A;  3TDU C;  2PMU A;  3KP5 A;  2W24 A;  1LJ9 A;  2XRN A;  4EMS A;  3WU1 B;  5FGM A;  2EV0 A;  1T39 A;  3GFI A;  2AXL A;  1S8N A;  1CF7 B;  4IJA A;  4L9N A;  4I01 A;  2DBB A;  1E2X A;  4HAM A;  1XSX A;  3TOA A;  1D8J A;  1E17 A;  1F4K A;  3ROU A;  1SD6 A;  4LG0 B;  4P55 A;  3F6V A;  3HSF A;  5FD5 A;  2MH9 A;  5BOX A;  1BI2 A;  1XGO A;  2NRA C;  3E6C C;  1DDN A;  2MH2 A;  4AIH A;  4IF4 A;  4I7H A;  3QPH A;  3WGI A;  1FT9 A;  1S7A A;  5FD6 A;  2P6T A;  3FZV A;  4S04 A;  3MZY A;  1DP7 P;  1K78 A;  3FF5 A;  4NQW A;  1FX7 A;  1ZRC A;  2KKO A;  1ZLJ A;  4EQQ A;  3T0Y A;  2EA2 A;  1B59 A;  4KA4 A;  3PQK A;  1V3F A;  3BJ6 A;  4GO1 A;  1YS7 A;  3ECO A;  1L3L A;  1XMK A;  1FLI A;  4M9X A;  1SMT A;  1FZP B;  3BY6 A;  3ERE D;  3GFM A;  3DPL C;  4RGX A;  2GA1 A;  2RN7 A;  4DQ2 A;  4EJV A;  3KFW X;  3LWF A;  5DYM A;  3CO6 C;  1XN7 A;  4FX0 A;  1IW7 F;  4IHT A;  1RI7 A;  3TGN A;  4B8X A;  1MDM A;  1Z6T A;  1S6L A;  3ZMZ A;  2GIV A;  2K02 A;  3GFL A;  1UFM A;  4ETS A;  2XVC A;  1IXC A;  3T5X A;  2WC2 A;  4EV0 A;  2R7D A;  3QAH A;  1ON2 A;  3LST A;  3VOD A;  2FNP A;  4LLL A;  2IJL A;  3QPT A;  1FYL A;  2YPR A;  1IN4 A;  4HX4 A;  2FBH A;  3ECH A;  1IRF A;  2Y75 A;  4GGG A;  5ILS A;  1OR7 A;  1WSU A;  2FRH A;  2HTJ A;  4G6D A;  4MGR A;  2GA2 A;  4O3M A;  1UHM A;  3LQQ A;  4I98 B;  4WK8 F;  2FE3 A;  5CLS A;  4Z2Y A;  2OD5 A;  2HWV A;  1BIB A;  4BYY A;  2DK8 A;  4BHB A;  3E6B A;  3F3X A;  2Q0O A;  3MWM A;  1IN8 A;  2XRO A;  1VTN C;  4ESB A;  4E70 A;  4HQE A;  1PDN C;  1IN6 A;  4A2U A;  2DPD A;  2ZME A;  4CZZ A;  1TW2 A;  1U2W A;  2YR2 A;  5AIP A;  4HA8 A;  2QVO A;  1Q1H A;  3B73 A;  2K4B A;  5BQT A;  3M1E A;  1BI0 A;  3RKY A;  5HLG A;  1R5H A;  4R79 A;  4LLN A;  2FA5 A;  4LMY A;  5LGU A;  3G3Z A;  2JZY A;  3REO A;  3DEU A;  3I59 A;  1JGS A;  3TO7 A;  2P5K A;  5J6X A;  3P7N A;  5H6Q A;  3J7A O;  2STT A;  2H09 A;  4JBA A;  3GLX A;  4F7Z A;  2FU4 A;  1R23 A;  3C7J A;  3HOT A;  1IUY A;  3L09 A;  1ONV A;  1R00 A;  2QQA A;  2VBX A;  1OYW A;  2M1B A;  4JQF A;  5CYV A;  4EJW A;  4Q48 A;  1XCB A;  2H6B A;  2DQR A;  1R58 A;  4G7O F;  2KJC A;  1BI3 A;  3BPX A;  3HRM A;  2K7L A;  4JK1 X;  3CUO A;  4QLC U;  2HR3 A;  4L18 B;  4DNC A;  3GYH X;  5ICC A;  2ETH A;  1GXP A;  3FXU A;  4CXF A;  1MDM B;  2B0L A;  4LD5 A;  3MQ0 A;  2CGP A;  3O3K A;  2Z33 A;  1TBX A;  1G6N A;  3JAM K;  2DLL A;  3BZ6 A;  2F5D A;  1HST A;  1X3U A;  5LHH A;  1HKQ A;  3ML6 A;  2YX4 A;  3DQV C;  3KLO A;  4P96 A;  1YIO A;  2KIU A;  1GHC A;  3O2P E;  3DV8 A;  3ABT A;  2A5Y B;  4A12 A;  2CWE A;  3WTT C;  2IA2 A;  2WWY A;  5JFR A;  1G3W A;  3I5U A;  3VOE A;  3K1P A;  1TQM A;  1FP1 D;  1W7P B;  2MLK A;  3NQO A;  4Q4Z F;  4I02 A;  1K7A A;  4HF2 A;  2E1N A;  4M72 A;  5BS6 A;  4CHU A;  4GXO A;  1J7K A;  3ABU A;  4HZF A;  4O6J A;  1IAW A;  2C6Y A;  4G94 A;  2EJR A;  4UVA A;  5F6F A;  2L4A A;  3LQR A;  1BJA A;  5BPI A;  2ZBK A;  3HHH A;  2K27 A;  5D5V B;  1LDJ A;  3TQN A;  2G7H A;  3U1D A;  1FBS A;  4HLX A;  1WRJ A;  2A68 F;  1Z1D A;  4KDP A;  5D4R A;  1FNN A;  3IKT A;  5IT3 A;  3W6K B;  4M71 A;  4FHT A;  4ZYH A;  3U9G A;  1NHA A;  2VE9 A;  2L01 A;  2XIG A;  3CUQ A;  5DD8 A;  3BJA A;  2EV5 A;  4UHT A;  2A07 F;  1G3S A;  2XAH A;  1J5Y A;  4G7Z F;  2MBF A;  3GVA A;  4OIR F;  5CVI A;  2D2W A;  5JR3 A;  4HBL A;  3K0L A;  2BBY A;  1HKT A;  1QBJ A;  5H20 A;  2O0Y A;  4M73 A;  4EJU A;  2P5V A;  3M9A A;  4H0E A;  5HDK A;  4KIC A;  3WTW C;  3ZPL A;  2G7U A;  4YFX F;  1A04 A;  3I59 B;  1YW7 A;  3SFZ A;  3TKY A;  4OMY A;  5D4S A;  2D45 A;  4HW0 A;  5DCM A;  2O6G E;  2F5E A;  4M9S A;  4AVP A;  1YG2 A;  1MGT A;  2QBY A;  1TNS A;  2F2E A;  4EJO A;  2QWW A;  5AON A;  3F21 A;  3MAJ A;  3I71 A;  5J8C A;  3WE3 A;  2LF7 A;  4TV7 A;  2IT0 A;  1J75 A;  1LB2 A;  5LHI A;  1ODD A;  4RS8 A;  3FMR A;  1TNT A;  2QEN A;  5AIQ A;  3CUQ C;  3L7W A;  2L3D A;  3BWG A;  2JSC A;  2E7X A;  5A2Q Z;  4YFN F;  2R3S A;  4LB6 B;  5L3C A;  4NHJ A;  3B02 A;  2NS0 A;  1G4D A;  4BHP A;  4HF0 A;  3I54 A;  4L0Z B;  4OIO F;  5HOO A;  3ELK A;  3HSR A;  5L3G A;  1I5Z A;  3WTX C;  1B9N A;  2GQQ A;  2FEZ A;  2CFX A;  3E3V A;  1FPQ A;  1PUE E;  1KU2 A;  1Y0U A;  4L9V A;  2GXB A;  2MLG A;  4RB2 C;  3WU0 A;  2Y48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...