4LG0B

Structure of a ternary foxo1-ets1 dna complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
106
structure length
106
Chain Sequence
GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Forkhead box protein O1
publication title Structure of a ternary FOXO1-ETS1 DNA complex
rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 37
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2013-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4lg0B00
2DPDA 4HF2A 3ZMTA 3R61A 1TW2A 4MGRA 1MZBA 4FT8A 1FNNA 2HKXA 1IN8A 4P9FA 5DCMB 1U2WA 1MJAA 2NAZA 1W7PB 1MKMA 2W85A 1Z1DA 5DEQA 3D5LA 1R5GA 3JTGA 3I58A 2IP2A 1T2KA 2PN6A 2UXNA 4ZYGA 3LAJA 1BI0A 1IN6A 1Q1HA 3R6SA 2R3SA 4L0ZB 2HDCA 1CF7B 1YW9A 2COMA 1XCBA 5L3CA 1DUXC 1TQPA 2H09A 2Z9OA 3BOQA 5K5RA 1QBJA 2MH2A 5ILVA 1XCVA 3KP2A 1G3WA 4EM1A 1OMIA 2LKPA 2QLZA 3DEUA 3O3KA 1MDMA 1BI2A 3M9AA 5KK1A 2WWYA 2QM3A 2GWRA 5D5WB 3COAC 1YLFA 3HIFA 5ICEA 4KIFA 1JXSA 1U5TB 1XGOA 1JHHA 4ESFA 2P4WA 4CDGA 3KLOA 4CXFA 2Q0OA 3F21A 2XAHA 3T5XA 1LDDA 3E6DA 3BP8A 2DLLA 5J8CA 3HTSB 3GO5A 2EV5A 2V1XA 5D4SA 4OINF 4L9JA 3L9FA 2GIVA 3FMRA 2M5WA 3BPXA 5A2QZ 2D1VA 4S04A 1ZGAA 5ED4A 3JSPA 1KYZA 1UFMA 2DQLA 2PLYA 5CVIA 5E18F 3DKWA 1B6AA 1XSDA 1O3RA 4LLGF 1BBYA 4U88A 4G7ZF 4K2EA 4IRGA 2MA3A 3K2ZA 3W6KB 3ELKA 2GAUA 3K69A 3WU0A 3VEPA 4AIHA 4LGWA 1E2XA 2RQPA 1L0OC 4EM2A 3GFLA 2ZKZA 3V8JA 1J7KA 2UWMA 1I1SA 3B73A 1XN7A 5HLGA 3HRSA 1ZLKA 3IRRA 1XGNA 1BIAA 5IT3A 1UHMA 1ZREA 5E1ZB 3DPLC 2P5VA 1ZARA 4UHTA 3EYYA 3NRVA 2XAJA 1SFXA 4ENNA 4BAYA 4EJUA 4EJWA 1R1VA 3WTWC 1XMAA 4A0ZA 1D5VA 3HSRA 4DQ2A 1K6OA 4G8XA 2GA2A 3ZN1A 1FSEA 2Y0MA 1LDKB 2EFPA 3K0LA 4R8HA 3WGGA 5H6QA 3DP7A 2BYVE 5H6RA 3HTUA 2BEOA 2CW0F 4BHBA 1FYMA 1GXQA 2Z3YA 4L18B 4OIQF 4UUVA 1LVAA 1QZZA 2WTEA 2HZTA 2IA2A 3WE2A 2W57A 1MD0A 2FOKA 1BM9A 2OZUA 5L3GA 5BQTA 3GUDA 4ZYDA 2XUBA 2F2EA 5FO5A 2FBKA 1H9TA 1SD5A 2EFOA 4RGSA 1DP7P 3GW2A 4TV7A 4ENJA 1R7JA 1W7PD 2GXBA 1WRJA 1FC3A 4UNOA 1YW7A 3ZMDA 5JVTA 2ETHA 1LJ9A 2EA4A 4RS8A 3BZ6A 3TO6A 3QOPA 3T0YA 5EEHA 1OKRA 2VE8A 1H0MA 3SFZA 3S2WA 5HDNA 3TKYA 5J6XA 1DDNA 1ZAOA 1J5YA 1YS7A 1R58A 2QENA 4LK0F 3GWZA 2XKPA 3HOSA 2KIFA 2JPBA 2NYXA 2L3DA 1A04A 1USTA 2BE5F 4KUMA 2HKOA 2MBFA 5D5VB 3LWFA 4PDKA 4WK8F 2NS0A 4BHPA 1HXDA 2HOEA 4Y15A 4G6DA 3FMSA 5AIPA 1U8RA 1TW3A 3R60A 4R79A 2F5FA 2HQNA 1LEBA 3F8FA 5D6EA 3P9KA 2G9WA 3BDDA 2PJPA 1ON2A 3H3UA 1IXRC 3QU3A 1OYIA 4HLXA 1O3QA 3F6OA 3IL2A 2DK8A 1J59A 4AVPA 4YIIA 4WXHA 1L3LA 3JSOA 2VBXA 4CYDA 2ELHA 1HBXG 3H3ZA 2KJCA 2F5DA 3Q5FA 3BJ6A 4LLLA 2X0LA 3QP6A 1BC7C 3Q9SA 1Z9CA 2OD5A 3E3VA 3P7NA 4HA8A 2Y48A 3KFWX 4OIRF 2ZCWA 4FX4A 4L9NA 4GYGA 3QRFF 1BC8C 2LNBA 5E8IA 5FLXZ 3ERED 3LSTA 4ZZDA 4A0XA 1C0WA 5FFXA 1QZYA 3IKTA 4M9XA 2MLGA 3MZYA 2CFXA 1S29A 1B9NA 1MJ9A 2ESHA 5ILUA 2CSOA 3RKXA 4A0YA 4IRIA 5FD5A 2EV6A 1KQ8A 3BJOA 5KVRA 4WX9A 1XDUA 3H92A 3E6CC 1GVJA 2D1HA 3ZP5A 3WGHA 4P9UA 1KQ9A 5AONA 3J80Z 4MHGA 2H27A 1S6LA 2B0LA 1S7AA 3K9TA 4ESJA 4MEXF 4UV9A 3M8FA 3M1EA 2ZFWA 2Z33A 3RKYA 1Z6TA 4RB2C 3PQJA 1UCRA 3ABTA 4EV0A 4LMYA 3FF5A 1T6SA 4IJAA 1J75A 4I01A 1YQAA 4ESBA 1XMKA 4JK1X 1P6RA 5HS7A 2DBBA 2XROA 2E1NA 2XASA 3IWZA 4WWCA 4EJTA 5IT9K 2A61A 4M6XA 5E17F 5DD8A 5K5OA 4GCVA 3WTTC 5H20A 5CVRA 5HOOA 1TBXA 1RUOA 5LHGA 3T1BA 2K4JA 3LQRA 4CHUA 1H9GA 3CUQA 5DDGA 2WC2A 3CUQC 3E6BA 4LG0A 2P8TA 3RTRA 3L7WA 2VBZA 3U1DA 3W6JB 3CTAA 2QBYB 1ZH5A 3GEZA 1IZ1A 3MQ0A 2ISZA 4G7OF 2O6GE 1W5TA 1IF1A 1FLIA 1HSTA 2CQKA 2AXLA 3KE2A 2O8XA 2YX4A 4UV8A 2MD5A 3GVAA 4OMYA 3F3XA 2IRFG 3I54A 4BXUA 1O3TA 2L4AA 1SFUA 3DXJF 2J5PA 3FXRA 1SMTA 2ZNYA 4XSZF 1BI3A 1I27A 2YSRA 1SAXA 4U0WA 4Z2YA 4GXOA 2RGVA 3CO6C 4RGUA 2Z99A 4RAYA 3F22A 5LLQA 3M8EA 4FHTA 2HS5A 2VC1A 4NB5A 5L3DA 1V3FA 1SMYF 1U6GA 2FMYA 4G94A 5HDKA 4RB3C 2CGPA 4YIFA 2JRTA 4LLNA 3LA3A 4ENKA 2LSOA 3RIRA 4I7HA 3ZQ7A 4Q48A 2V79A 5FB2A 3LQQA 2VBWA 1ZRFA 5DUIA 2PEXA 2QZ8A 4XRFA 2HTJA 3GZ5A 1ONVA 1ZG3A 2O3FA 1FZPB 4MNUA 1R5HA 3G73A 3GFJA 1TQIA 4MEYF 5CVVA 4YFKF 1U5TC 3N97A 1EH6A 1QPMA 1BI1A 2MH9A 3ZMZA 5ILSA 2EFWA 2RNJA 5LGNA 3Q9VA 3F8MA 2HQRA 3FM5A 4ZH4F 3FXQA 3GF2A 3HOTA 1MDMB 4F7ZA 4ZYEA 3QP5A 2IW5A 2ZJ2A 4KYWA 2P6SA 1OPCA 1FWZA 3KCCA 3EDPA 2IT0A 1FBSA 2HYGD 3I71A 3JAMK 1R1UA 1ZRCA 1D8JA 3FWEA 4KN7X 2FNPA 4WXDA 4M9SA 2EK5A 3KETA 5D5UB 2FE3A 3IHUA 3V4GA 1Z7UA 4IPAA 2XV4S 2IPQX 1G3YA 2EFQA 5HS9A 1TNTA 4AIJA 1XSXA 2GXGA 4KDPA 1FT9A 1T0FA 3CO7C 2STTA 2A3SA 2QUFA 1P2FA 4U7DA 1K7AA 2Z5UA 3DV8A 1JE8A 3FZVA 3KP7A 1U78A 4KA4A 1YO5C 2ZMEA 1TQMA 2OAZA 5E1XA 2DQRA 2XKOA 4G9YA 2LF7A 4EGZA 3GZ6A 2VN2A 4HDUA 1D8KA 4KNYA 5ICGA 4HX7A 3QPTA 4EMSA 2HEOA 2E7WA 4XSXF 3VODA 1K78A 2FEZA 4MQ9F 1I5ZA 3IRQA 2J5OA 1R36A 2M45A 1IN4A 3JW4A 1W4MA 1QGPA 2VT2A 1I6XA 4I0AA 4Q47A 3MFKA 1WKMA 2A68F 4B09A 3V7CA 2XGXA 5CYVA 3VFZA 2P5KA 2BGCA 1JGSA 1XSVA 4RAZA 5DCFA 4L9VA 2HFHA 4A6DA 5D6FA 1D3YA 5LBQA 3HRMA 3KZZA 1QO0D 1USSA 4XBFA 4EJVA 5ICCA 1YG2A 4HX8A 2VT3A 1TNSA 3WTXC 2LF8A 4BQAA 3R4KA 2NRAC 4HQMA 3C7JA 4HLYA 2YX7A 5TJJA 2V1UA 2FF4A 3RJPA 5FFZA 4Q5SF 3QPHA 2OQRA 3MZHA 4HAMA 1J0RA 1O57A 2BBYA 1YYVA 4HX4A 4HBLA 5J8FA 2ESNA 2PFBA 3V8LA 2KIUA 4HDVA 4UXNA 4M9ZA 3J81K 4I02A 3ISPA 2XAGA 4NQWA 2ACJA 3E5UA 4ZZLA 3K1MA 3V7SA 3TQNA 2E7XA 1IXCA 2F5EA 3KP3A 5HVQC 1LQ1A 3RDIA 1HW5A 1J9IA 5HDGA 1FBUA 5DYMA 2TDXA 4IHTA 3L2CA 4KN4X 3WTSC 4A5NA 1F1ZA 4HV5A 2FNAA 2STWA 1RNLA 3I59A 2V9VA 2XIGA 1B59A 2UZKA 1YTYA 1HKQA 3BJAA 2FBIA 1XD7A 2M30A 1ZLJA 2CO5A 2FU4A 3N4MA 1RUNA 5FD6A 1ZN2A 4RB1A 1RIOH 1NHAA 2HGCA 5HS8A 3KP5A 2OA4A 2ZO4A 1R23A 3HRTA 4I98B 2PMUA 3EUHA 5L3FA 2FMLA 1ZHFA 1E17A 4BYYA 2KRFA 1RI7A 1P4WA 1ZGJA 5LRSA 3E6MA 2QQAA 4LFUA 1KU3A 2NNYA 3WTUC 3L00A 2XAFA 2ISYA 3CJNA 4KMFA 4GGGA 3C18A 1ZG1A 1AWCA 3F23A 2FA5A 3TO9A 3P9IA 1PUEE 2DAOA 2W84A 2H94A 3KEOA 1FX7A 2KJBA 1AOYA 3OOPA 2K4BA 5JR3A 1KA8A 2BV6A 3QU6A 1OYWA 3O6BB 4P55A 4I09A 3BROA 2XAQA 2ADUA 3RYPA 1KGSA 2JSCA 2V6CA 4CO8A 1O7LA 1S7OA 2ZNZA 5CVJA 1FYLA 1LEAA 2EV0A 2QWWA 5LEJA 1W5SA 4QWQA 2DFIA 4KT5C 4U7BA 1YS6A 2F5CA 3FMQA 2EJRA 4HV6A 1IXSB 1MGTA 4QLCU 4NHJA 2EFNA 1VTNC 3LA7A 5F64A 2L54A 1UB9A 5IT9Z 2QYOA 5CJ9A 4Y13A 3J80K 4L9TA 3GXOA 3ABUA 5TRDA 2A6HF 2L02A 3WTYC 4XLNF 4GYIA 4JBAA 3R0AA 5BOXA 5E8GA 4ASNA 4IXAA 3RYRA 1X3UA 3DQVC 2H6CA 4U0YA 3LAPA 2M87A 1J2XA 4IF4A 1K79A 2RVCA 2XVCA 4LK1F 3U2RA 1T39A 3TDUC 2E1CA 4HF0A 4A2UA 3L09A 1XB4A 2RKHA 3HSEA 4I0BA 1DPRA 1BIBA 5ICFA 4U0VA 3QAHA 2DO7A 3J7AO 5DD4A 4O3MA 5JFRA 4RB0A 5DCMA 3CUOA 1BOAA 3DFGA 5JHUA 4ON0A 1PDNC 1WQ2A 4BH9A 3CUQB 1W7PA 4P5OA 4Q4ZF 2RN7A 4UVAA 2C6YA 4DNCA 4LG0B 2D2WA 4GO1A 2G7UA 4IRHA 2CYYA 4UVBA 4OU0A 4EQQA 1B1BA 1IRFA 1YFHA 2FQ3A 2H6BA 2VOOA 1Z05A 1S3JA 3F6VA 3G3ZA 4H0EA 1CF7A 4CGZA 2P7CB 1OYYA 2VC0A 3TO7A 1Z91A 4E70A 2RV8A 4L5JA 5K1YA 1G3TA 3NEUA 5LRRA 3KP4A 2A07F 2AS5F 3WGIA 3EQLF 5LGTA 3GFMA 3GYHX 4HF1A 4EVIA 1ZYRF 4LD5A 2A5YB 4N9HA 1F5TA 3DPTA 4S05A 5E1WA 2GA1A 1HSJA 3T8RA 4HYEA 3ZN0A 5LEKA 1F9NA 1U5TA 3ZPLA 1Y0UA 3MCZA 5JI6A 3KEQA 5D5XB 3KZYA 1YIOA 1R00A 2PI0A 4CICA 3CDHA 3V7RA 3P9CA 3WTVC 1LDJA 1G6NA 2CWEA 4AD9A 1G4DA 4M71A 1RZ4A 3JAMZ 2GZWA 4WXCA 1KU9A 3ROUA 2YU3A 4R1HA 4A5MA 5LHIA 4G6QA 1V4RA 5D8LB 3WODF 3WU1B 2A69F 2QQ9A 1F4KA 2HR3A 2VXZA 3SZPA 1TLHB 6PAXA 3FM3A 4M74A 1BJAA 1PP8F 3PQKA 1U3EM 1REPC 2NNNA 4FX0A 3ZMSA 5D4RA 4CZZA 3RPQA 4RGXA 4M72A 1P92A 2VOPA 5BPIA 5BMZA 4P96A 4AWXB 1KU7A 1I1GA 2PQ8A 2KKOA 3M7GA 3PFIA 3C3WA 1GHCA 3REOA 5A2QK 3SHFA 3AAFA 1FY7A 3F8NA 3NQOA 2FRHA 2IA0A 2MLKA 4BNCA 1SD4A 2W25A 3TDZC 1YW8A 3MEXA 1EH7A 1GXPA 3F8BA 3TOAA 2Q8KA 3ZMVA 2M1BA 1MJBA 2ZXJA 2JPCA 1SD6A 2ZMEB 5D8KB 3FHZA 2DPUA 2L4MA 3I53A 2P7VB 4RGRA 5DV5A 3ECHA 3HHGA 5L3BA 3VOEA 1ZG5A 2VONA 3MWMA 3KP6A 1IN7A 4MTEA 1QQIA 3R0JA 1EH8A 2K86A 2DTRA 4I2OA 4ETSA 1XGMA 2R7DA 3WG9A 3C1DA 2Y75A 2JT1A 2RDPA 1K78B 3U9GA 3I4PA 3GLXA 3LA2A 2OBPA 1QNTA 2DI3A 4HOBA 1S8NA 2VE9A 4XLPF 5F6FA 3SZTA 4PGGA 3LFKA 5CLSA 2DU9A 3FXUA 2JZYA 3IC7A 4EGYA 4UVCA 2XRNA 3E5XA 2FXAA 3J81Z 5FGMA 4HQEA 3JTHA 1HQCA 4OIOF 2VBYA 2CG4A 3TOBA 1EV7A 4Y17A 3HRUA 5ERIA 1ULYA 2K7LA 2IA1A 1P4AA 3D0SA 4KMUX 2JTVA 3MAJA 3BY6A 4JQFA 1IAWA 4BHCA 2W24A 5L3EA 3F72A 4YFNF 1IN5A 1FPQA 4M6YA 5CVUA 2WV0A 1ZRDA 3HUGA 3T8TA 1P4XA 4WF2A 1KU2A 2P5LC 1WSUA 5LHHA 2DT5A 2O61A 2YPRA 2LDUA 5EEGA 3GX4X 2O0YA 2PG4A 2EWNA 3CLOA 4O6JA 1ON1A 1HKTA 3VB2A 3V8KA 4ZYHA 4ENMA 1KYWA 3O2PE 2FSWA 3DF8A 2ZBKA 3ECOA 1DPUA 4KFCA 4M73A 2R7FA 3I59B 3BPVA 1LNWA 3IWFA 5AIQA 1T38A 1LB2A 3EETA 4PZJA 4IHSA 2QQBA 3RI4A 1ODDA 2A6EF 1UHWA 3B02A 1Z6RA 1CGPA 1WWXA 3E5QA 3SQNA 3HHHA 1FOKA 3SXYA 2PMHA 2HYFA 1R22A 4OMZA 5BPDA 5HLHA 2GQQA 2K02A 3I5UA 4B8XA 2IVMA 4EJOA 4N9IA 3WE3A 1OR7A 4OIPF 2XHKA 1TTYA 2IJLA 2EB7A 3KLNA 5LGUA 2D45A 2VODA 4PGHA 4MQVA 2QVOA 1BN5A 4A12A 5DUKA 4EM0B 5FLXK 4YFXF 4HZFA 1T98A 3GFIA 2V1DA 1PP7U 1FP1D 3WTZA 1XGSA 4LJZF 2OQGA 2K27A 1STZA 4D0PA 1IUYA 4N0BA 3E97A 3F8CA 1IRGA 5E20A 2HWVA 2P6TA 2RC4A 4HW0A 1SD7A 1HKSA 3K1NA 2EA2A 1B4AA 4YG2F 2MC3A 1KQ0A 3I64A 2G7HA 2YR2A 5K5QA 2DW4A 2Q2EA 4IVNA 4KIGA 2X4HA 1FYKA 3HYIA 4KICA 1FSHA 2O03A 4AIKA 4L5IA 4MTDA 4A6EA 2KIMA 4PCQA 1FP2A 4LB5A 3OV8A 3FX3A 2UXXA 3RKWA 2QBYA 1IW7F 1XDSA 3K1PA 3RPUA 3BWGA 2OZ6A 2PBIA 3EYIA 3I0TA 1O7FA 3HSFA 4KIBA 1O3SA 1HW2A 5HLIA 5F1RA 4WCGA 1FBQA 4O5VA 4G7HF 4L0YB 3ML6A 2M8EA 1B9MA 2L01A 2DK5A 3IKVA 3TGNA 1JHFA 1R1TA 1HW1A 4OOIA 1G3SA 2HTSA 3ULQB 4LB6B 1SFEA 1WI9A 5BS6A 2OU2A 2FBHA 3ZMUA
chains in the Genus database with same CATH superfamily
1Y0NA 1HF0A 2CQXA 3BZKA 2DPDA 3LMMA 4HF2A 3ZMTA 4PSWA 1N75A 3TEDA 3R61A 1TW2A 3SJMA 4MGRA 1MZBA 4FT8A 1FNNA 2HKXA 1BA5A 1IN8A 1JJ8C 4P9FA 5DCMB 3VYRB 1U2WA 1MJAA 2NAZA 4B3AA 4FTHA 3BLYA 3GTGJ 1W7PB 4M3FA 5E3NA 1MKMA 3JRCA 2W85A 3HKZA 4XICA 3CCEI 3M4OJ 3LFUA 1Z1DA 5DEQA 4FASD 3D5LA 1R5GA 3JTGA 3I58A 2R5ZA 2DA2A 2KLOA 2IP2A 5EJCA 1T2KA 1QHGA 2GBYA 3QYFA 2PN6A 2UXNA 4ZYGA 3LAJA 1G2HA 1BI0A 1IN6A 2E1MB 1Q1HA 3KX2A 3R6SA 2R3SA 1IG7A 1MH3A 4L0ZB 1JTXA 1FEXA 2HDCA 1DP3A 1CF7B 1YW9A 2COMA 3GMEA 1XCBA 5L3CA 2A05A 1DUXC 4KISA 1TQPA 3VSLA 2H09A 2Z9OA 3BOQA 5K5RA 4BJTA 3A2KA 1QBJA 2MH2A 3BR2A 5ILVA 1JGGA 3TP0A 1XCVA 2QA4I 3KP2A 1G3WA 4EM1A 1OMIA 2R5ZB 2HVRA 2LKPA 2QLZA 3DEUA 3O3KA 1XC5A 3ONQA 1MDMA 3BR6A 1BI2A 3M9AA 4F91B 2KZVA 5KK1A 4RA2A 3K4CA 4JX4A 3H9JA 2X6XA 3I9V2 2WWYA 2QM3A 2GWRA 5D5WB 1HOMA 5J40A 3COAC 2DMNA 4MFEA 1X19A 2BW3A 1YLFA 3GTJJ 2ZJPF 1RR8C 3GTOJ 3CMYA 3HIFA 1Y1WJ 2VUMJ 3A01A 5ICEA 4KIFA 2KHMA 1JXSA 3A03A 3CJTB 4IOCF 1U5TB 1HA8A 2LP0A 2EZKA 1XGOA 1JHHA 4D7MA 3F0CA 2P4WA 2KQRA 4ESFA 5J4YA 4CDGA 3KLOA 4CXFA 3H5AA 2Q0OA 3F21A 2XAHA 3T5XA 1LDDA 2JN6A 3E6DA 3BP8A 2DLLA 2HXOA 3BCBA 4ZTFA 2KIQA 4HNVA 2CW7A 5J8CA 2BHYA 3E0JB 1LKXA 1B8IB 3GO5A 3MKWB 3HTSB 2EV5A 3SDBA 2V1XA 3CCSI 5D4SA 2HDWA 1MH4A 3EUKL 4OINF 2W82A 4L9JA 3L9FA 2GIVA 3FMRA 4IOAF 4C9YA 3AL0B 1SFKA 3BG9A 5F0FA 2M5WA 3AG1H 3BPXA 5J1YA 1JTYA 5A2QZ 1H88C 2D1VA 4S04A 1ZGAA 4DIQA 4AYBN 4ZTJA 5ED4A 3JSPA 1KYZA 2XPWA 1UFMA 2DQLA 4RLFA 2PLYA 5CVIA 3FDYA 5E18F 3DKWA 2I8DA 1B6AA 1XSDA 1O3RA 4LLGF 4FETA 2EZIA 1VQ4I 1BBYA 4U88A 4G7ZF 2E2IJ 3CCVI 2MABA 2QGUA 4K2EA 2L7MP 3FXJA 4IRGA 2MA3A 4J01A 4CUGA 3K2ZA 1Y8QB 5EG0A 4OAYA 3W6KB 3ELKA 1R5ID 2GAUA 3K69A 3WU0A 3VEPA 1MMDA 4LGWA 4AIHA 4BEHB 5IP6A 1E2XA 2EIJH 1L0OC 2RQPA 4EM2A 4A3JJ 1A35A 2X1CA 3S3MA 1LFBA 1OISA 1P7IA 3GFLA 2ZKZA 2KFDA 3HB9A 3V8JA 1J7KA 2VL8A 1LFPA 2UWMA 2JJ7A 1I1SA 3B73A 4I6ZA 4PUSA 1XN7A 5HLGA 3A0HC 3CP8A 3HRSA 1ZLKA 4N4OB 1GVDA 2L9RA 3IRRA 1XGNA 2X85A 3WHCA 3E7LA 1BIAA 3V42A 4MIMA 1S72I 3QYEA 5IT3A 1UHMA 5M3MJ 3JRFA 1TT5B 3CDIA 1ZREA 1MMNA 1A31A 5E1ZB 3DPLC 2P5VA 1ZARA 4UHTA 2X1DA 1D0XA 3LSIA 1FIAA 3EYYA 3NRVA 2XAJA 1SFXA 1BR4A 4ENNA 1JKRC 4BAYA 5F04A 3NWTA 4EJUA 4EJWA 2E60A 1R1VA 3WTWC 1Y1VJ 1XMAA 4A0ZA 1D5VA 5E79C 3HSRA 1YJ9I 2COBA 2DT6A 4DQ2A 1K6OA 4G8XA 3OYCA 2GA2A 3JR9A 3ZN1A 1FSEA 4A69C 4V2GA 4M6VA 3MN2A 2Y0MA 2E36A 1LDKB 3K70C 2EFPA 2KZGA 4DBQA 3ZOBA 3WU2C 4BE0A 3K0LA 4YELA 3OS0A 5F0HA 1YIJI 4R8HA 1QZEA 1R9TJ 2EIMH 4BQNA 4EATA 3WGGA 5H6QA 3DP7A 3KYLA 2BYVE 5H6RA 3HTUA 2BEOA 3GTMJ 2CW0F 2ID6A 2CFOA 4BHBA 4A3IJ 1FYMA 1GXQA 2Z3YA 3PUBA 4L18B 4OIQF 4UUVA 1H89C 1LVAA 1QZZA 1VNDA 1W36D 2D5VA 2WTEA 1UAAA 2HZTA 2IA2A 3WE2A 4G6TB 2QKLB 2E35A 2W57A 2CRGA 1U9NA 1MD0A 2XF7A 4P1WA 3IUOA 2FOKA 1BM9A 2OZUA 4XN0A 5L3GA 5C4JJ 3S17J 5BQTA 1X2MA 3GUDA 1YI2I 4ZYDA 2XUBA 1V5EA 4LG3A 5F0CA 3IV5A 4CH7A 2F2EA 1VQ6I 5FO5A 3MKLA 1X1DA 1MBFA 1Z7LA 2VB6A 3H3VK 1I3AA 2FBKA 2DA3A 5M5XJ 1H9TA 4DJAA 1SD5A 2EFOA 4RGSA 5FJ8J 1DP7P 3GW2A 3PO2J 4TV7A 1VQ9I 2MYSA 4ENJA 3QPSA 1R7JA 1W7PD 2GXBA 4Y3OA 1WRJA 2DFFA 2OPTA 3NARA 3ZRGA 1YRNA 1FC3A 2AQFA 4UNOA 1YW7A 2RNGA 3ZMDA 5JVTA 2ETHA 3MKYB 1LJ9A 2EA4A 2L9VA 4RS8A 3BZ6A 2Y69H 4B1RA 3TO6A 2YS9A 4RDUA 3QOPA 1XPXA 3T0YA 5EEHA 4DZPA 1Y56A 1OKRA 2VE8A 3C2BA 1H0MA 3CZ6A 3SFZA 1FOWA 4BUPA 2DODA 3QOEA 1ZGWA 3S2WA 5HDNA 4PJNA 3TKYA 5J6XA 1JT6A 1DDNA 4II3A 4BL0B 2QF7A 1ZAOA 2JQ7A 1J5YA 2CH0A 2M7AA 1YS7A 3AG4H 1R58A 2QENA 4LK0F 3GWZA 2XKPA 3HOSA 2KIFA 2WY8Q 5C4XJ 2JPBA 1FMVA 2NYXA 5B5EC 2L3DA 1A04A 1USTA 2BE5F 4KUMA 1WZ2A 2HKOA 1IJWC 2MBFA 2NXNB 3OSFA 5D5VB 3LWFA 4PDKA 2DOEA 1MSEC 1T95A 4WK8F 3VWBA 1SAUA 5IY5H 2NS0A 3ZQCA 4BHPA 1HXDA 2HOEA 1W1WE 4Y15A 4G6DA 1T08B 4XOTA 3FMSA 5AIPA 4BQOA 3HL2A 1U8RA 1OCCH 1TW3A 3GTQJ 3R60A 1R6RA 4R79A 2VXDA 3OIQA 2H8WA 2M9HA 2R7TA 2F5FA 2HQNA 1LEBA 3CESA 1AKHA 3OYNA 3F8FA 5D6EA 4HSTA 3HUGB 3P9KA 2F4MB 4BE2A 1YITI 1X1AA 2G9WA 3BDDA 2PJPA 1ON2A 3H3UA 3LSJA 4XNFA 1IXRC 3A02A 3QU3A 1OYIA 1R4MB 3L1PA 4HLXA 1O3QA 3F6OA 3IL2A 2IS1A 2DK8A 1XG1A 4BBRJ 1J59A 2PMZA 4AVPA 4YIIA 5EZHA 4WXHA 1L3LA 3JSOA 2K9NA 2LKXA 4IHVA 2VBXA 3OSGA 1ZKGA 4PFOA 4CYDA 2ELHA 1HBXG 2E2HJ 2GXAA 3RZDJ 2LG4A 1ITYA 3BG7A 4XOPA 3H3ZA 2R93J 3H0GJ 1QU3A 2KJCA 2XB5A 2F5DA 1ORKA 3Q5FA 2X48A 3BJ6A 3OYBA 2XDVA 4LLLA 3OR1C 1U0JA 2X0LA 4DW6A 3QP6A 3X2QH 2KPMA 1QVUA 4YIRX 1W0UA 2CW8A 1BC7C 3SEZA 3OYHA 3OMYA 3Q9SA 5IYCJ 4CCKA 1Z9CA 1K4SA 2OD5A 2VPLA 3E3VA 1WVRA 2B9SA 3P7NA 4HA8A 2R92J 2Y48A 3KFWX 4XKVA 1OJLA 3FBNB 4OIRF 3K4MA 3W3CA 2ZCWA 4FX4A 4L9NA 4GYGA 2M4KA 3QRFF 1BC8C 1WHUA 3PSIA 5JVGF 2LNBA 4XIDA 4E6KG 5E8IA 5FLXZ 3ERED 5FKKA 2LK2A 4NC6A 3LSTA 4ZZDA 4XKCA 3BQYA 4A0XA 3H0DA 1C0WA 5FFXA 1QZYA 3IKTA 2GOMA 4M9XA 1A6QA 2LMDA 2MLGA 3MZYA 2NOGA 2R7OA 2CFXA 1LE8A 3OYMA 1S29A 1B9NA 2QSHX 1MJ9A 1HDPA 2XPUA 2ESHA 5ILUA 2CSOA 2NVXJ 3RKXA 4A0YA 2HDDA 4IRIA 5FD5A 2EV6A 3FK6A 2ZFUA 1KQ8A 3BJOA 4AIDA 5KVRA 3JRHA 4WX9A 1XDUA 3H92A 3E6CC 1DQUA 3RCOA 2DOAA 3HOVJ 1GVJA 3L2WA 2D1HA 2H8RA 3ZP5A 1SVOA 2QKMB 3WGHA 4P9UA 1R49A 1KQ9A 5AONA 3CP2A 3ASOH 3J80Z 4MHGA 4UY8I 2H27A 4DYQA 3K4LA 2HOTA 1S6LA 2B0LA 4XK4A 2BXYA 1S7AA 3LSGA 2GIZA 2LY1A 3K9TA 3Q3SA 2CMPA 2MC4A 4XMYA 1SANA 4ESJA 3ZQFA 4MEXF 4UV9A 1RC9A 2TRTA 1JUMA 3M8FA 4C2TA 4RMNA 2K3PA 3DBLB 2PJRA 3M1EA 1X3WB 2ZFWA 3M8JA 2Z33A 3RKYA 1Z6TA 1SVLA 1ZR4A 4RB2C 2DA7A 3JRAA 1XMXA 3PQJA 1NK2P 1UCRA 5F1JA 3ABTA 4EV0A 4BE1A 4LMYA 2WV1A 1EA3A 4X0GA 3FF5A 3A1YA 1IO2A 1T6SA 2WB1N 3VYUB 2BZTA 4F92B 4IJAA 2R7WA 3OYIA 5IYBJ 1J75A 4I01A 2W1OA 5HLTA 1YQAA 2IEKA 4ESBA 4BXXJ 1XMKA 4JK1X 2H1LA 1P6RA 5HS7A 4HRIA 2DBBA 2XROA 2E1NA 2XASA 4FCYA 3IWZA 1PUFB 4WWCA 2EIKH 4EJTA 5IT9K 1X1PA 2A61A 3N05A 4M6XA 5E17F 2LYCA 2X6OA 2OC6A 5DD8A 5K5OA 3W2WA 4GCVA 1QRYA 2XPVA 2V26A 3OR2C 3D1NI 2M2EA 3WTTC 2Q2EB 5H20A 2DCEA 5CVRA 5HOOA 4X6AJ 1TBXA 1RUOA 5LHGA 3T1BA 1VQLI 1VI0A 2K4JA 3LQRA 2IS4A 4CHUA 3HXLA 4DYCA 1H9GA 2OJED 3HM5A 2O5RA 3CUQA 4AUXA 5CPRB 5DDGA 1MMSA 2XSDC 2M0MA 1XX5A 2LBFB 2WC2A 4KJZA 3Q0VA 3CUQC 4E7KA 5KNLA 3E6BA 4LG0A 1JUSA 1W36C 2P8TA 3RTRA 3L7WA 2VBZA 3U1DA 3W6JB 3S2HJ 2R7XA 3CTAA 2QBYB 1ZH5A 3GEZA 3AG3H 1IZ1A 2XRLA 2OTLI 3TP3A 3MQ0A 1NG7A 3G1OA 5LD2C 1U9OA 2ISZA 2XGCA 4G7OF 2IGKA 3I4NJ 2CUEA 2O6GE 1W5TA 1IF1A 1FLIA 2R5YB 1HSTA 2CQKA 1X4OA 2AXLA 2I10A 3KE2A 2O8XA 1GV5A 2YX4A 4UV8A 2Y31A 2MD5A 3GVAA 4OMYA 3F3XA 2IRFG 2ICWG 3RKQA 3I54A 4BXUA 1O3TA 2V9PA 4KT6A 5J1RA 2L4AA 1SFUA 3GLLA 1P7JA 3DXJF 2J5PA 3FXRA 1SMTA 2MW8A 2LTPA 3LOCA 2ZNYA 3MKZA 4XSZF 2NVYJ 3BG3A 1BI3A 3S1NJ 4CSWA 4Y4RA 1I27A 2YSRA 1ACIA 1SAXA 4U0WA 5FROA 4Z2YA 4GXOA 2HPMA 4IL6C 4IHWA 2E1MC 1ETXA 2RGVA 3WHBA 4RGUA 3CO6C 5FKLA 2Z99A 4RAYA 5IOZA 1VQ7I 3F22A 1K83J 5LLQA 5GAHJ 2HZDA 3M8EA 2Y9YA 4FHTA 3K4BA 2HS5A 2VC1A 1JKOC 3CCLI 2BHZA 3JRIA 4NB5A 4B3XA 5L3DA 5B3SH 1V3FA 2IGMA 4DBRA 4IQJA 1SMYF 3SYTA 1U6GA 4AM3A 2FMYA 4G94A 5HDKA 4RB3C 1S7EA 2CGPA 4YIFA 2JRTA 4LLNA 3LA3A 3ZQHA 2CU7A 4ENKA 1HC8A 2LSOA 1D1AA 2JVGA 3RIRA 4I7HA 3ZQ7A 5TISC 4PJ0C 4J19A 4Q48A 2V79A 5FB2A 3LQQA 1Z3YA 2VBWA 1ZRFA 1WJAA 5DUIA 2PEXA 2QZ8A 4M3GA 4U87A 4XRFA 2HTJA 3GZ5A 1ONVA 2LY9A 1ZG3A 2O3FA 2M8GX 1FZPB 1IRZA 4MNUA 2VIXA 2HOSA 1R5HA 3G73A 1RPWA 3CQZJ 3GFJA 1TQIA 4MEYF 2DDBA 5CVVA 2LOOA 4YFKF 1U5TC 3CF2A 3N97A 1EH6A 3KYCB 3HDDA 1QPMA 1BI1A 4L5EA 2MH9A 3ZMZA 5ILSA 5EF6A 2EFWA 2RNJA 5LGNA 3Q9VA 3F8MA 3SDGA 2HQRA 3FM5A 4ZH4F 1NK3P 3CMMA 3FXQA 5C3EJ 3J7ZI 3NWSA 2L7KA 1QA6A 3GF2A 4JOMA 3HOTA 1ETVA 1WJCA 2HXIA 1MDMB 3BR1A 2RREA 3FKIJ 4F7ZA 4ZYEA 4MFDA 3QP5A 1X58A 2IW5A 4FE7A 3CCRI 2ZJ2A 5H2FC 3HJEA 2QQ8A 4IHYA 1IDZA 2O9LA 2NVTJ 2BW3B 2VJJA 4KYWA 2P6SA 1OPCA 3ZCOA 1FWZA 3KCCA 2V7FA 2DA4A 1MBJA 3EDPA 2IT0A 5M5YJ 1FBSA 2HYGD 3I71A 3A01B 4IKFA 1I50J 5EEAA 1QPIA 3DBRB 3GZNB 1VQ5I 3JAMK 3BR5A 1NTCA 1R1UA 1ZRCA 4XN3A 4B44A 1D8JA 3FWEA 2EZLA 4KN7X 3CMAI 4NDLA 2R7RA 2FNPA 4WXDA 4BY7J 4M9SA 2EK5A 3KETA 3BT9A 1RR7A 5IPAA 4JP0A 5D5UB 2FE3A 3IHUA 3V4GA 1Z7UA 4IPAA 2XV4S 4IZZA 3JREA 4D7NA 2IPQX 3VSKA 1G3YA 1IC8A 2KRCA 4BQQA 2XAUA 4RAGA 2EFQA 2ZXWH 2HVSA 5HS9A 4M3BA 1TNTA 4AIJA 1XSXA 2GXGA 4HNTA 4KDPA 5FRNA 4B47A 2YU9J 1FT9A 1T0FA 3CO7C 1T8IA 2STTA 2A3SA 2F6CA 2QUFA 2FJ1A 1P2FA 4U7DA 4S0HB 1K7AA 2Z5UA 4EEFG 3DV8A 1T0FC 1JE8A 3S93A 5FLMJ 1Z67A 3FZVA 3KP7A 2M34A 1OLTA 1ETOA 4CCOA 1U78A 2R7ZJ 1ERDA 4KA4A 1YO5C 2ZMEA 1TQMA 1MNDA 2OAZA 5E1XA 3DKXA 4BBSJ 2VQHA 2ZMEC 4ABZA 4Z6YA 4PJJA 2IXSA 3HEFA 1TWAJ 2JSPA 5K7FA 3JRDA 1VQNI 5EG0B 3CLQA 1UELB 4XQFA 2DQRA 3ABKH 2E19A 2XKOA 4G9YA 2LF7A 4DZJA 4EGZA 1OCOH 3K4KA 2CUJA 1WGXA 5DTDA 3GZ6A 2VN2A 4HDUA 2ELKA 2JA6J 4N4NB 1TWCJ 1K61A 3OYDA 4UB8C 1D8KA 4KNYA 5F08A 4PFPA 5ICGA 4HX7A 1MIJA 1X2NA 3QPTA 4EMSA 2HEOA 2E7WA 2HNHA 4XSXF 3QWLA 3VODA 4CCJA 2EPFA 4Y7NJ 4XLCA 2NS7A 1K78A 2FEZA 3HKZN 2DYRH 4MQ9F 2DFHA 1I5ZA 2J5OA 3IRQA 2A5WA 1R36A 2M45A 1IN4A 3JW4A 4KITB 1W4MA 4F93B 2MD0A 1MBEA 1QGPA 2JA2A 2VT2A 5IP7J 1I6XA 4I0AA 4RM2A 5GAGJ 1E3PA 4Q47A 3S1MJ 3PO3J 3MFKA 1WKMA 2A68F 3C2GA 1CQTA 4B09A 2KL4A 3V7CA 2XGXA 5CYVA 3VFZA 2F4OB 2P5KA 2BGCA 1JGSA 1XSVA 4RAZA 5DCFA 5J1UA 4L9VA 4RM3A 2VQGA 2HFHA 4XRMA 4F3QA 4A6DA 5D6FA 1D3YA 5LBQA 3HRMA 1BL0A 4UB6C 3KZZA 1QO0D 1USSA 5TGTA 4XBFA 2W00A 4EJVA 2JUGA 2DJNA 1WH5A 3GTKJ 5ICCA 3TW7A 1YG2A 3LSRA 4HX8A 2VT3A 3TMOA 3SEQA 1TNSA 3HPHA 3WTXC 2LF8A 3UR3C 4BQAA 3R4KA 2NRAC 3O8GA 1GLNA 4HQMA 3C7JA 4HLYA 1IV8A 2NVQJ 2KDOA 2YX7A 5TJJA 2V1UA 3H35A 2CV0A 5GPAA 4CYCA 3H5RA 3QODA 1TZLA 4CZCA 3JRGA 3W6VA 2FF4A 3RJPA 5FFZA 1VFCA 3RQIA 2LY2A 4Q5SF 3QPHA 2OQRA 4BU2A 2JMWA 2L0KA 1S9HA 2Z16A 3MZHA 4HAMA 3PNVA 4XRSA 3J7AY 1J0RA 1G8XA 2Y0SN 1O57A 3DU5A 2BBYA 1YYVA 4HX4A 4A93J 4B48A 4HBLA 2KT0A 5J8FA 3DLLF 2ESNA 2PFBA 3OOUA 3V8LA 2KIUA 4IX7A 3EUAA 3ABMH 4HDVA 4UXNA 4M9ZA 3S8PA 1UG0A 3J81K 4A3BJ 4I02A 1BJZA 1IDYA 4AU7A 4CA0A 3CCJI 1YRNB 3OYKA 5DS9A 3ISPA 2XAGA 4NQWA 2ACJA 3QYBA 3E5UA 4ZZLA 3DTKA 3K1MA 1BW5A 3V7SA 3TQNA 2E7XA 3VYTB 1IXCA 4D5FA 4CYCB 3PM1A 2F5EA 3KP3A 3L2UA 5HVQC 4PSXA 1LQ1A 4BXFA 5F27A 3RDIA 1HW5A 2BXZA 2L5QA 1J9IA 1ZTRA 3J7YJ 4I99C 5HDGA 1FBUA 5DYMA 2Q1ZB 2TDXA 4H4KC 2WAQA 4IHTA 3L2CA 4KN4X 3WTSC 1GV2A 1D0YA 1VQ8I 4A5NA 1T33A 5CQGA 1F1ZA 4BS9A 4HV5A 2KISA 2FNAA 4NQWB 2EQRA 1LPQA 2STWA 2ZJRF 1NH3A 1RNLA 3I59A 2V9VA 2XIGA 2K5CA 1B59A 3CC4I 2UZKA 1YTYA 1HKQA 3BJAA 2FBIA 2CV2A 2DOFA 1XD7A 2M30A 1ZLJA 2CO5A 2FU4A 2IAIA 2X6WA 3UNGC 3I55I 2DXIA 1EF4A 3N4MA 5CQEA 1RUNA 5BNGA 5HNFA 5FD6A 1PYVA 3ASNH 5E3MA 1ZN2A 4RB1A 1R71A 2KMUA 2M0CA 1RIOH 5CKTA 1NHAA 1ETKA 2ECCA 4ZC3A 2LD5A 2HGCA 5HS8A 3FKJA 1TWHJ 1AKHB 3KP5A 4XM3A 2VI6A 3S1RJ 2IGNA 2OA4A 2JWTA 3PIOF 3CF5F 2BY0A 2ZO4A 1R23A 3HRTA 4I98B 2PMUA 3EUHA 3HPGA 3B6AA 2NOJB 2W4SA 4BJ5C 5L3FA 2FMLA 2ELJA 3S1QJ 3S14J 1E0EA 1ZHFA 1E17A 4BYYA 2KRFA 1RI7A 1POGA 3EUHC 2WAFA 4I76A 1P4WA 1ZGJA 5LRSA 3U21A 3E6MA 3DEEA 1BW6A 2WA0A 2AXTC 2QQAA 4LFUA 1KU3A 2NNYA 4QTRA 2XSJC 3WTUC 1IGNA 3L00A 2XAFA 1RKWA 2ISYA 3CJNA 4KMFA 4GGGA 3C18A 1ZG1A 2CS3A 5FKNA 1AWCA 3F23A 2FA5A 5J3LA 4BGDA 3TO9A 3P9IA 1PUEE 2DAOA 2W84A 2L9SA 3A4CA 3U1KA 4LIUA 2HOAA 1VQKI 1RETA 2H94A 3KEOA 1FX7A 2KJBA 1AOYA 3OOPA 2Z2SB 2K4BA 5JR3A 5EGOA 1KA8A 4A3MJ 2OUMA 1RRJA 3S3NA 2BV6A 2XGDA 4Y52J 3QU6A 3CDLA 3RSNA 1V55H 1ETYA 2DMQA 1OYWA 3O6BB 4P55A 3OL3A 4I09A 2R7VA 3BROA 2ZXHA 2V9KA 1TC3C 2BY1A 2DJIA 2XAQA 5FRMA 3DTEA 2ADUA 4BACA 3RYPA 1LVKA 1D0ZA 1V5FA 3JRBA 1KGSA 2JSCA 2DMUA 4JX5A 3QPLA 3HG9A 3F9KA 3HOUJ 2V6CA 4CO8A 1O7LA 1S7OA 3LSHA 4JYKA 5FKOA 2ZNZA 5IP9J 2ID3A 2NVUB 3BTCA 5CVJA 5EZGA 2LREA 3BTIA 2XGEA 3CMEI 1LE8B 5EGOB 1FYLA 4E7LA 3W2AA 1B72A 1LEAA 2DDAA 2EV0A 1K4TA 4NUBA 1WH7A 2QWWA 5LEJA 1ZR2A 1W5SA 2VJ4A 4LITA 4QWQA 1J09A 3H9QA 3S15J 1NG6A 3H9GA 3CJRB 2DFIA 4KT5C 1ENHA 4U7BA 1YS6A 2F5CA 2HU9A 3FMQA 4E7ZA 2EJRA 2A6TA 3DU6A 3A0BC 4HV6A 1IXSB 4XL9A 1MGTA 4QLCU 3I56I 4QIWN 1APLC 4NHJA 2EFNA 1V5GA 1VTNC 2VKDA 3LA7A 5F64A 1ETQA 2L54A 1UB9A 1XS9A 2HI3A 3PL8A 4D5CA 2JUCA 5IT9Z 1DGWY 2QYOA 2LFBA 2AQEA 4RAFA 2FUG2 5CJ9A 5EYRA 4Y13A 3J80K 2O8KA 5M3FJ 2IS2A 3P5JA 4L9TA 4RBOA 3GXOA 3ABUA 4OWRB 2A6HF 1BOBA 1WJFA 4E7HA 5TRDA 2L02A 2PJRB 4UUSA 3WTYC 4XLNF 4GYIA 4JBAA 3R0AA 5BOXA 5E8GA 1EJ9A 4ASNA 4IXAA 4B4CA 2BVLA 3RYRA 4ZDPA 3C2HA 1X3UA 3PIPF 3DQVC 4V2FA 2K9MA 2H6CA 4U0YA 3LAPA 2M87A 1J2XA 4IF4A 5K7ZA 4AYBA 1K79A 1LUJB 2RVCA 3LNQA 2XVCA 1MBGA 1WJBA 1AHDP 2LRDA 4LK1F 3U2RA 1TWFJ 1T39A 4BDZA 5KCMA 3TDUC 1UG2A 3HBLA 2E1CA 4HF0A 4A2UA 3L09A 1AU7A 1OCZH 1XB4A 3DCFA 2B63J 2RKHA 3HSEA 2V4JC 3SFIA 4I0BA 1DPRA 1BIBA 5ICFA 4F55A 4U0VA 3QAHA 2E34A 2PMZN 2DO7A 4MO7A 4XLHA 5GAEJ 3J7AO 4A3LJ 3AFHA 4YEJA 5DD4A 1FIPA 4O3MA 2HYJA 3DWLE 3BG6A 3FIWA 1A5JA 2R4GA 5JFRA 3KYDB 1Y8RB 2K3FA 4XKWA 2DA1A 4RB0A 5DCMA 3CUOA 1BOAA 3DFGA 5B1AH 5JHUA 4ON0A 1PDNC 1WQ2A 4BH9A 3CUQB 1W7PA 2LKSA 4P5OA 4Q4ZF 1AA7A 2RN7A 4UVAA 3JCUC 2C6YA 4DNCA 2JA5J 5JLXA 4LG0B 1ZK8A 3FBIB 1X1CA 2D2WA 4GO1A 2ME0A 5GADJ 2G7UA 4BY1J 3K2AA 4IRHA 1WJDA 2CYYA 2EILH 2B7EA 3RZOJ 4UVBA 4W1UA 2JVHA 4OU0A 3TL4X 4EQQA 1B1BA 4M3DA 2E71A 1IRFA 1YFHA 3FXOA 2FQ3A 2P81A 1O4XA 2H6BA 2LC2A 1VQMI 4UUTA 4Y33A 2VOOA 1FJLA 1TP4A 1Z05A 3DKYA 1S3JA 3HOZJ 3FHNA 3F6VA 3G3ZA 3M07A 4H0EA 1D5YA 1SC7A 3M1CA 1CF7A 4CGZA 1PVEA 2CJJA 2P7CB 2MSYA 2Y9ZA 5JLWA 3ABLH 2M3AA 1OYYA 2R0QC 2VC0A 5B1BH 3TO7A 3CD6I 2DN0A 5J4VA 1VQOI 4C30A 4XLEA 3ZQGA 1G59A 4BJ6C 2I5UA 1Z91A 4E70A 2RV8A 4L5JA 2CV1A 1A36A 5K1YA 1G3TA 3NEUA 2X9DA 5LRRA 3FXLA 5K7HA 3KP4A 3DEWA 3HC7A 2A07F 2AS5F 3IP4B 2K9SA 3WGIA 3EQLF 3ESWB 5LGTA 3GFMA 2VQCA 2VPRA 3QQAA 1SEUA 3BR0A 3GYHX 4HF1A 4EVIA 1ZYRF 2ZSIB 3MVPA 4LD5A 4C3JJ 2L7ZA 1JJ6C 2A5YB 4N9HA 2K9LA 1F5TA 2E5NA 2Y2ZA 2BY2A 3DPTA 4A3EJ 4NBQA 3DLAA 4S05A 5E1WA 1SFOJ 2R7UA 2GA1A 1HSJA 4MLOA 4HYEA 3T8RA 4GFBA 3ZN0A 5LEKA 1D1CA 1F9NA 2HVQA 2LH9A 1U5TA 3ZPLA 1Y0UA 1X3ZB 3HGGA 3MCZA 5JI6A 3KEQA 1UZCA 5D5XB 4E7JA 3KZYA 1YIOA 3G1LA 1R00A 3E1SA 4HG2A 1MW7A 1JT0A 1WJ5A 2PI0A 4CICA 3CDHA 1B8IA 2LLKA 1VQPI 1W5CC 3V7RA 3P9CA 4OAZA 3WTVC 1JKPC 3ZXSA 1JI8A 1LDJA 1G6NA 3KZIC 2CWEA 4AD9A 1G4DA 4M71A 1RZ4A 3JAMZ 1VF9A 1HDDC 2GZWA 4E7IA 4WXCA 5FLVA 2ECBA 1KU9A 3ROUA 3AL0C 2X6YA 3OL4A 2YU3A 3KPHA 3MMYB 4R1HA 4A5MA 5LHIA 4G6QA 2ZSHB 1MBHA 4CCMA 1V4RA 5D8LB 2Y0SA 2VQLA 2BY3A 2CQQA 3WODF 1IRXA 3WU1B 2A69F 2QQ9A 4BKXA 2F48A 1F4KA 2HR3A 2VXZA 3SZPA 1ZELA 1TLHB 6PAXA 5B66C 3FM3A 3IAM2 4M74A 4HNUA 5GPCA 1BJAA 3CCQI 3PNTA 3L2QA 1PP8F 2CQNA 3PQKA 1U3EM 1REPC 2QSGX 2NNNA 4FX0A 2E2JJ 2ZXIA 2GLOA 3O8HA 4BEHA 2FD5A 2XC7A 1YE9A 3ZMSA 5D4RA 1T56A 3TW6A 3OYAA 2ZB9A 1UHSA 3D5RC 2GM4A 2M7BA 4E7SA 4CZZA 3VPRA 3RPQA 2ME6A 2EBIA 2W48A 4RGXA 1WPKA 4M72A 1P92A 4PJMA 2VOPA 5BPIA 1D1BA 5BMZA 4W97A 4P96A 2MFZA 4AWXB 1KU7A 2VASA 2OCCH 1I1GA 2PQ8A 2KKOA 4XRSG 3M7GA 3FK7A 3PFIA 3HGYA 3C3WA 1GHCA 3REOA 5A2QK 5GP9A 3SHFA 3AAFA 3S32A 3PJRA 1X4PA 1FY7A 1OCPA 1Y6IA 3F8NA 3K4NA 3NQOA 2HPIA 1OFCX 3W2VA 2FRHA 2IA0A 2MLKA 4BNCA 4QPOA 3NAUA 1SD4A 2W25A 3TDZC 1MSFC 1YW8A 3MEXA 1EH7A 2XF6A 1GXPA 3F8BA 2TCTA 2UUZA 3TOAA 1I39A 2Q8KA 4PK4A 3ZMVA 1E3OC 4D1QA 2M1BA 1MJBA 2ZXJA 1MNMC 2JPCA 2KDZA 3ZQQA 1SD6A 3BCAA 4C3HJ 2ZMEB 5D8KB 3FHZA 4LOCA 3OWTA 3CC2I 2DPUA 5HODA 2L4MA 1WI3A 1RESA 2EH3A 3I53A 2P7VB 4RGRA 5DV5A 3ECHA 4XORA 2L7FP 4QSHA 1TL8A 4G12A 3HHGA 5L3BA 3VOEA 1ZG5A 3LSPA 4II2A 4XONA 3I4MJ 2DTZA 4V19K 4ZDOA 2VONA 3MWMA 3CC7I 3KP6A 2G0EA 1IN7A 2WY7Q 2XF5A 3IH4A 4MTEA 5E3LA 2ZC2A 1QQIA 5E3OA 3R0JA 3ZQIA 5KAIC 4A3FJ 2JA8J 1EH8A 2EINH 2K86A 2DTRA 3RPUD 4I2OA 4ETSA 1UJ8A 1XGMA 3GTLJ 2F5VA 2R7DA 4DYRA 1Z21A 3PSFA 1MNEA 2DA5A 3WG9A 3ZR8X 3C1DA 2Y75A 4FISA 2JT1A 2RDPA 1K78B 2VLAA 3U9GA 4HPQA 2WBMA 3I4PA 4A3DJ 2FOWA 3GLXA 1I3QJ 4GRIA 3LA2A 2OBPA 1QNTA 1LFUP 2DI3A 4HOBA 4ZYAA 5FKMA 1S8NA 4HEA2 2VE9A 3BTLA 2DYSH 1SVMA 2VKEA 4XLPF 5F6FA 3S16J 3OY9A 3SZTA 4PGGA 2X1EA 3LFKA 5CLSA 2DU9A 1TWGJ 3FXUA 2JZYA 3IC7A 4EGYA 2PX9A 3D5SC 4D9JA 4PJLA 4UVCA 2XRNA 3E5XA 2FXAA 2V1NA 3J81Z 4B43A 5FGMA 1VZ0A 4HQEA 3JTHA 3DBHB 1HQCA 4OIOF 2VBYA 4M3EA 1BR2A 2CG4A 1QVTA 3H5NA 3IH3A 3FXMA 1P9QC 4IEJA 5M5WJ 3TOBA 1EV7A 3BR3A 4Y17A 1N78A 3HRUA 5ERIA 1ULYA 4QPQA 2K7LA 5GTIC 1MMGA 1F43A 2IA1A 3ERMA 1P4AA 3D0SA 4KMUX 2JTVA 3MAJA 1YJNI 2X51A 3BY6A 4JQFA 1IAWA 4BHCA 4CCLA 3OIPA 3G4SI 2OV7A 2W24A 2LVSA 2W7NA 3PUFA 5DM6F 4XLFA 3OYGA 4FE4A 2NS8A 5L3EA 2EZHA 3F72A 4YFNF 1OQYA 1IN5A 1FPQA 4M6YA 4XR6A 5CVUA 2WV0A 3GBGA 5DM7F 3PNYA 1ZRDA 1TT0A 1R4NB 3HUGA 3T8TA 1P4XA 1YX5A 1BR1A 2WB1A 2L2OA 4XLAA 2FQ4A 2HQAA 4WF2A 1KU2A 2P5LC 1GDTA 9ANTA 1WSUA 5LHHA 2DT5A 3CCMI 2O61A 1YHQI 2AHQA 3BTJA 3HZJA 5C44J 4IO9F 2YPRA 3LL7A 1X1BA 2LDUA 3S2DJ 4NC8A 5EEGA 1FOYA 3GX4X 2O0YA 3ZQLA 2PG4A 1N77A 2EWNA 3CLOA 1ETWA 4O6JA 3G1MA 3CCUI 1ON1A 4A3GJ 2R7SA 3IH2A 3AG2H 1WJEA 1HKTA 3VB2A 4F52A 3M3YJ 2WAEA 3V8KA 3FXKA 2CUZA 4ZYHA 4ENMA 1KYWA 1E3HA 3O2PE 1FOXA 2FSWA 3L2VA 3DF8A 2VKHA 3FISA 4ANJA 2M4GA 2ZBKA 4C2MJ 3ECOA 5KAFC 2IS6A 3B6CA 4RLQA 2JK3A 1DPUA 2OTJI 4YRVA 1MMAA 4KFCA 1S5LC 1H8AC 3OYFA 3SZGA 4E4HA 4M73A 3K10A 5J47A 2R7FA 3I59B 3WG7H 2VJ5A 5EDNA 3K7AJ 3BPVA 1LNWA 3IWFA 5AIQA 1T38A 2K85A 4LIVA 1LB2A 3EETA 4PZJA 4IHSA 2JA7J 3OIOA 1GUUA 2QQBA 3RI4A 2DA6A 3BC8A 1ODDA 1IUFA 2A6EF 1HCRA 1UHWA 3K4JA 2E5ZA 2Y30A 1JUPA 3B02A 1WCMJ 1YX3A 1Z3XA 5IOYA 1Z6RA 4JX6A 1CGPA 2K40A 2KP6A 4CCNA 1WWXA 2UV1A 4DOZA 1DU0A 3GCMA 3E5QA 2DFEA 3SQNA 3VYSB 3HHHA 2LR8A 1FOKA 3SXYA 3IAS2 2GOXB 2L9NA 2PMHA 3ZGKA 2HYFA 1R22A 2FX0A 4OMZA 1RKTA 4IQ4A 5BPDA 5HLHA 1W0TA 2DT7B 2GQQA 2K02A 3I5UA 1FTTA 4B8XA 2IVMA 1I6HJ 2BVMA 4EJOA 3CCYA 4N9IA 3WE3A 1U8BA 5KHDA 2ZJQF 1OR7A 2RAEA 2XHKA 4OIPF 1FTZA 3MD2A 2R7QA 1TTYA 2IJLA 4BDYA 2EB7A 3KLNA 3MZ8A 5LGUA 1OR7C 2D45A 2VODA 4PGHA 4MQVA 2QVOA 3H36A 1BN5A 4A12A 1HLVA 2V6EA 4X1EA 5DUKA 4EM0B 3G2BA 5FLXK 2IBDA 3S3OA 4YFXF 1JKQC 2AO9A 2K9QA 4HZFA 1UMQA 1OCRH 1T98A 2Z1DA 1N25A 3GFIA 2V1DA 3OYJA 2RQQA 3CJQB 4XKBA 4NC7A 3OS1A 1FP1D 3WTZA 1XGSA 1PP7U 3Q0UA 2QEXI 4LJZF 4AC0A 2OQGA 2F4IA 1DGRM 4DGWB 2K27A 3BG5A 1STZA 3G71I 1M1EB 4D0PA 4AVZA 1OCTC 1KONA 3K6GA 2DMTA 1IUYA 3G6EI 4N0BA 3E97A 3F8CA 1IRGA 3K70D 5LFAA 1F36A 3DTIA 3HOYJ 2QCOA 1K6YA 5E20A 5JHFA 2HWVA 2BOLA 2P6TA 1YJWI 3BZCA 2RC4A 4HW0A 1Z0XA 1Y39A 2WADA 2N8GA 1SD7A 3EPZA 4ZDLA 1B72B 3H1CA 1HKSA 2E1OA 4FQGA 1PUFA 1KZHA 3K1NA 4A3KJ 2EA2A 1B4AA 4YG2F 4ITVA 2MC3A 1KQ0A 3L2RA 3I64A 2JRMA 2G7HA 1IV6A 1MBKA 2YR2A 3BQZA 5K5QA 2DW4A 5IYDJ 2Q2EA 1QHHD 3Q0WA 3RQ4A 3KEYA 2VJIA 2P0WA 3OS2A 2CQ7A 4IVNA 4KIGA 2X4HA 3TBIA 1GT0C 1FYKA 4C2UA 3PFYA 2VKVA 3HYIA 2CUFA 2WAQN 4KICA 3KIOA 1V54H 4IHXA 2XB0X 3AKZA 1FSHA 2O03A 1A6IA 4AIKA 4L5IA 4MTDA 1WFXA 1PJRA 2LBFA 2OCEA 2DMPA 3VDXA 1XTAA 4A6EA 2QSFX 2KIMA 4PCQA 2IGOA 3HOXJ 1FP2A 4LB5A 4J00A 3OV8A 3FX3A 2UXXA 3RKWA 2QBYA 1IW7F 1EKEA 2KRHA 3HOWJ 1XDSA 5HNHA 3K1PA 3RPUA 3UKGA 3BWGA 2H1KA 2OZ6A 2PBIA 4UUSB 3EYIA 1FMWA 3OYLA 3I0TA 1O7FA 3HSFA 4KIBA 1O3SA 4ZJZA 2R5YA 1HW2A 1DU6A 5HLIA 5F1RA 4WCGA 1FBQA 4O5VA 4C3IJ 4G7HF 4L0YB 3ML6A 2M8EA 1ZQ3P 1B9MA 2L01A 2O7OA 2MG4A 2DK5A 4A3CJ 3IKVA 4GDFA 1Z77A 3OYEA 3DPUA 3TGNA 1JHFA 1YOVB 1R1TA 1HW1A 3GTPJ 1Q1VA 4OOIA 3LSKA 2HQ5A 3I3LA 1G3SA 3LSMA 2HTSA 3ULQB 4LB6B 1SFEA 2OF7A 4HSRA 4NNJA 2YUSA 1WI9A 5BS6A 2MGQA 2OU2A 5GTHC 2FBHA 3ZMUA
chains in the Genus database with same CATH topology
2DPDA 4HF2A 3ZMTA 3R61A 1TW2A 4MGRA 1MZBA 4FT8A 1FNNA 2HKXA 1IN8A 4P9FA 5DCMB 1U2WA 1MJAA 2NAZA 1W7PB 1MKMA 2W85A 1Z1DA 5DEQA 3D5LA 1R5GA 3JTGA 3I58A 2IP2A 1T2KA 2PN6A 2UXNA 4ZYGA 3LAJA 1BI0A 1IN6A 1Q1HA 3R6SA 2R3SA 4L0ZB 2HDCA 1CF7B 1YW9A 2COMA 1XCBA 5L3CA 1DUXC 1TQPA 2H09A 2Z9OA 3BOQA 5K5RA 1QBJA 2MH2A 5ILVA 1XCVA 3KP2A 1G3WA 4EM1A 1OMIA 2LKPA 2QLZA 3DEUA 3O3KA 1MDMA 1BI2A 3M9AA 5KK1A 2WWYA 2QM3A 2GWRA 5D5WB 3COAC 1YLFA 3HIFA 5ICEA 4KIFA 1JXSA 1U5TB 1XGOA 1JHHA 4ESFA 2P4WA 4CDGA 3KLOA 4CXFA 2Q0OA 3F21A 2XAHA 3T5XA 1LDDA 3E6DA 3BP8A 2DLLA 5J8CA 3HTSB 3GO5A 2EV5A 2V1XA 5D4SA 4OINF 4L9JA 3L9FA 2GIVA 3FMRA 2M5WA 3BPXA 5A2QZ 2D1VA 4S04A 1ZGAA 5ED4A 3JSPA 1KYZA 1UFMA 2DQLA 2PLYA 5CVIA 5E18F 3DKWA 1B6AA 1XSDA 1O3RA 4LLGF 1BBYA 4U88A 4G7ZF 4K2EA 4IRGA 2MA3A 3K2ZA 3W6KB 3ELKA 2GAUA 3K69A 3WU0A 3VEPA 4AIHA 4LGWA 1E2XA 2RQPA 1L0OC 4EM2A 3GFLA 2ZKZA 3V8JA 1J7KA 2UWMA 1I1SA 3B73A 1XN7A 5HLGA 3HRSA 1ZLKA 3IRRA 1XGNA 1BIAA 5IT3A 1UHMA 1ZREA 5E1ZB 3DPLC 2P5VA 1ZARA 4UHTA 3EYYA 3NRVA 2XAJA 1SFXA 4ENNA 4BAYA 4EJUA 4EJWA 1R1VA 3WTWC 1XMAA 4A0ZA 1D5VA 3HSRA 4DQ2A 1K6OA 4G8XA 2GA2A 3ZN1A 1FSEA 2Y0MA 1LDKB 2EFPA 3K0LA 4R8HA 3WGGA 5H6QA 3DP7A 2BYVE 5H6RA 3HTUA 2BEOA 2CW0F 4BHBA 1FYMA 1GXQA 2Z3YA 4L18B 4OIQF 4UUVA 1LVAA 1QZZA 2WTEA 2HZTA 2IA2A 3WE2A 2W57A 1MD0A 2FOKA 1BM9A 2OZUA 5L3GA 5BQTA 3GUDA 4ZYDA 2XUBA 2F2EA 5FO5A 2FBKA 1H9TA 1SD5A 2EFOA 4RGSA 1DP7P 3GW2A 4TV7A 4ENJA 1R7JA 1W7PD 2GXBA 1WRJA 1FC3A 4UNOA 1YW7A 3ZMDA 5JVTA 2ETHA 1LJ9A 2EA4A 4RS8A 3BZ6A 3TO6A 3QOPA 3T0YA 5EEHA 1OKRA 2VE8A 1H0MA 3SFZA 3S2WA 5HDNA 3TKYA 5J6XA 1DDNA 1ZAOA 1J5YA 1YS7A 1R58A 2QENA 4LK0F 3GWZA 2XKPA 3HOSA 2KIFA 2JPBA 2NYXA 2L3DA 1A04A 1USTA 2BE5F 4KUMA 2HKOA 2MBFA 5D5VB 3LWFA 4PDKA 4WK8F 2NS0A 4BHPA 1HXDA 2HOEA 4Y15A 4G6DA 3FMSA 5AIPA 1U8RA 1TW3A 3R60A 4R79A 2F5FA 2HQNA 1LEBA 3F8FA 5D6EA 3P9KA 2G9WA 3BDDA 2PJPA 1ON2A 3H3UA 1IXRC 3QU3A 1OYIA 4HLXA 1O3QA 3F6OA 3IL2A 2DK8A 1J59A 4AVPA 4YIIA 4WXHA 1L3LA 3JSOA 2VBXA 4CYDA 2ELHA 1HBXG 3H3ZA 2KJCA 2F5DA 3Q5FA 3BJ6A 4LLLA 2X0LA 3QP6A 1BC7C 3Q9SA 1Z9CA 2OD5A 3E3VA 3P7NA 4HA8A 2Y48A 3KFWX 4OIRF 2ZCWA 4FX4A 4L9NA 4GYGA 3QRFF 1BC8C 2LNBA 5E8IA 5FLXZ 3ERED 3LSTA 4ZZDA 4A0XA 1C0WA 5FFXA 1QZYA 3IKTA 4M9XA 2MLGA 3MZYA 2CFXA 1S29A 1B9NA 1MJ9A 2ESHA 5ILUA 2CSOA 3RKXA 4A0YA 4IRIA 5FD5A 2EV6A 1KQ8A 3BJOA 5KVRA 4WX9A 1XDUA 3H92A 3E6CC 1GVJA 2D1HA 3ZP5A 3WGHA 4P9UA 1KQ9A 5AONA 3J80Z 4MHGA 2H27A 1S6LA 2B0LA 1S7AA 3K9TA 4ESJA 4MEXF 4UV9A 3M8FA 3M1EA 2ZFWA 2Z33A 3RKYA 1Z6TA 4RB2C 3PQJA 1UCRA 3ABTA 4EV0A 4LMYA 3FF5A 1T6SA 4IJAA 1J75A 4I01A 1YQAA 4ESBA 1XMKA 4JK1X 1P6RA 5HS7A 2DBBA 2XROA 2E1NA 2XASA 3IWZA 4WWCA 4EJTA 5IT9K 2A61A 4M6XA 5E17F 5DD8A 5K5OA 4GCVA 3WTTC 5H20A 5CVRA 5HOOA 1TBXA 1RUOA 5LHGA 3T1BA 2K4JA 3LQRA 4CHUA 1H9GA 3CUQA 5DDGA 2WC2A 3CUQC 3E6BA 4LG0A 2P8TA 3RTRA 3L7WA 2VBZA 3U1DA 3W6JB 3CTAA 2QBYB 1ZH5A 3GEZA 1IZ1A 3MQ0A 2ISZA 4G7OF 2O6GE 1W5TA 1IF1A 1FLIA 1HSTA 2CQKA 2AXLA 3KE2A 2O8XA 2YX4A 4UV8A 2MD5A 3GVAA 4OMYA 3F3XA 2IRFG 3I54A 4BXUA 1O3TA 2L4AA 1SFUA 3DXJF 2J5PA 3FXRA 1SMTA 2ZNYA 4XSZF 1BI3A 1I27A 2YSRA 1SAXA 4U0WA 4Z2YA 4GXOA 2RGVA 3CO6C 4RGUA 2Z99A 4RAYA 3F22A 5LLQA 3M8EA 4FHTA 2HS5A 2VC1A 4NB5A 5L3DA 1V3FA 1SMYF 1U6GA 2FMYA 4G94A 5HDKA 4RB3C 2CGPA 4YIFA 2JRTA 4LLNA 3LA3A 4ENKA 2LSOA 3RIRA 4I7HA 3ZQ7A 4Q48A 2V79A 5FB2A 3LQQA 2VBWA 1ZRFA 5DUIA 2PEXA 2QZ8A 4XRFA 2HTJA 3GZ5A 1ONVA 1ZG3A 2O3FA 1FZPB 4MNUA 1R5HA 3G73A 3GFJA 1TQIA 4MEYF 5CVVA 4YFKF 1U5TC 3N97A 1EH6A 1QPMA 1BI1A 2MH9A 3ZMZA 5ILSA 2EFWA 2RNJA 5LGNA 3Q9VA 3F8MA 2HQRA 3FM5A 4ZH4F 3FXQA 3GF2A 3HOTA 1MDMB 4F7ZA 4ZYEA 3QP5A 2IW5A 2ZJ2A 4KYWA 2P6SA 1OPCA 1FWZA 3KCCA 3EDPA 2IT0A 1FBSA 2HYGD 3I71A 3JAMK 1R1UA 1ZRCA 1D8JA 3FWEA 4KN7X 2FNPA 4WXDA 4M9SA 2EK5A 3KETA 5D5UB 2FE3A 3IHUA 3V4GA 1Z7UA 4IPAA 2XV4S 2IPQX 1G3YA 2EFQA 5HS9A 1TNTA 4AIJA 1XSXA 2GXGA 4KDPA 1FT9A 1T0FA 3CO7C 2STTA 2A3SA 2QUFA 1P2FA 4U7DA 1K7AA 2Z5UA 3DV8A 1JE8A 3FZVA 3KP7A 1U78A 4KA4A 1YO5C 2ZMEA 1TQMA 2OAZA 5E1XA 2DQRA 2XKOA 4G9YA 2LF7A 4EGZA 3GZ6A 2VN2A 4HDUA 1D8KA 4KNYA 5ICGA 4HX7A 3QPTA 4EMSA 2HEOA 2E7WA 4XSXF 3VODA 1K78A 2FEZA 4MQ9F 1I5ZA 3IRQA 2J5OA 1R36A 2M45A 1IN4A 3JW4A 1W4MA 1QGPA 2VT2A 1I6XA 4I0AA 4Q47A 3MFKA 1WKMA 2A68F 4B09A 3V7CA 2XGXA 5CYVA 3VFZA 2P5KA 2BGCA 1JGSA 1XSVA 4RAZA 5DCFA 4L9VA 2HFHA 4A6DA 5D6FA 1D3YA 5LBQA 3HRMA 3KZZA 1QO0D 1USSA 4XBFA 4EJVA 5ICCA 1YG2A 4HX8A 2VT3A 1TNSA 3WTXC 2LF8A 4BQAA 3R4KA 2NRAC 4HQMA 3C7JA 4HLYA 2YX7A 5TJJA 2V1UA 2FF4A 3RJPA 5FFZA 4Q5SF 3QPHA 2OQRA 3MZHA 4HAMA 1J0RA 1O57A 2BBYA 1YYVA 4HX4A 4HBLA 5J8FA 2ESNA 2PFBA 3V8LA 2KIUA 4HDVA 4UXNA 4M9ZA 3J81K 4I02A 3ISPA 2XAGA 4NQWA 2ACJA 3E5UA 4ZZLA 3K1MA 3V7SA 3TQNA 2E7XA 1IXCA 2F5EA 3KP3A 5HVQC 1LQ1A 3RDIA 1HW5A 1J9IA 5HDGA 1FBUA 5DYMA 2TDXA 4IHTA 3L2CA 4KN4X 3WTSC 4A5NA 1F1ZA 4HV5A 2FNAA 2STWA 1RNLA 3I59A 2V9VA 2XIGA 1B59A 2UZKA 1YTYA 1HKQA 3BJAA 2FBIA 1XD7A 2M30A 1ZLJA 2CO5A 2FU4A 3N4MA 1RUNA 5FD6A 1ZN2A 4RB1A 1RIOH 1NHAA 2HGCA 5HS8A 3KP5A 2OA4A 2ZO4A 1R23A 3HRTA 4I98B 2PMUA 3EUHA 5L3FA 2FMLA 1ZHFA 1E17A 4BYYA 2KRFA 1RI7A 1P4WA 1ZGJA 5LRSA 3E6MA 2QQAA 4LFUA 1KU3A 2NNYA 3WTUC 3L00A 2XAFA 2ISYA 3CJNA 4KMFA 4GGGA 3C18A 1ZG1A 1AWCA 3F23A 2FA5A 3TO9A 3P9IA 1PUEE 2DAOA 2W84A 2H94A 3KEOA 1FX7A 2KJBA 1AOYA 3OOPA 2K4BA 5JR3A 1KA8A 2BV6A 3QU6A 1OYWA 3O6BB 4P55A 4I09A 3BROA 2XAQA 2ADUA 3RYPA 1KGSA 2JSCA 2V6CA 4CO8A 1O7LA 1S7OA 2ZNZA 5CVJA 1FYLA 1LEAA 2EV0A 2QWWA 5LEJA 1W5SA 4QWQA 2DFIA 4KT5C 4U7BA 1YS6A 2F5CA 3FMQA 2EJRA 4HV6A 1IXSB 1MGTA 4QLCU 4NHJA 2EFNA 1VTNC 3LA7A 5F64A 2L54A 1UB9A 5IT9Z 2QYOA 5CJ9A 4Y13A 3J80K 4L9TA 3GXOA 3ABUA 5TRDA 2A6HF 2L02A 3WTYC 4XLNF 4GYIA 4JBAA 3R0AA 5BOXA 5E8GA 4ASNA 4IXAA 3RYRA 1X3UA 3DQVC 2H6CA 4U0YA 3LAPA 2M87A 1J2XA 4IF4A 1K79A 2RVCA 2XVCA 4LK1F 3U2RA 1T39A 3TDUC 2E1CA 4HF0A 4A2UA 3L09A 1XB4A 2RKHA 3HSEA 4I0BA 1DPRA 1BIBA 5ICFA 4U0VA 3QAHA 2DO7A 3J7AO 5DD4A 4O3MA 5JFRA 4RB0A 5DCMA 3CUOA 1BOAA 3DFGA 5JHUA 4ON0A 1PDNC 1WQ2A 4BH9A 3CUQB 1W7PA 4P5OA 4Q4ZF 2RN7A 4UVAA 2C6YA 4DNCA 4LG0B 2D2WA 4GO1A 2G7UA 4IRHA 2CYYA 4UVBA 4OU0A 4EQQA 1B1BA 1IRFA 1YFHA 2FQ3A 2H6BA 2VOOA 1Z05A 1S3JA 3F6VA 3G3ZA 4H0EA 1CF7A 4CGZA 2P7CB 1OYYA 2VC0A 3TO7A 1Z91A 4E70A 2RV8A 4L5JA 5K1YA 1G3TA 3NEUA 5LRRA 3KP4A 2A07F 2AS5F 3WGIA 3EQLF 5LGTA 3GFMA 3GYHX 4HF1A 4EVIA 1ZYRF 4LD5A 2A5YB 4N9HA 1F5TA 3DPTA 4S05A 5E1WA 2GA1A 1HSJA 3T8RA 4HYEA 3ZN0A 5LEKA 1F9NA 1U5TA 3ZPLA 1Y0UA 3MCZA 5JI6A 3KEQA 5D5XB 3KZYA 1YIOA 1R00A 2PI0A 4CICA 3CDHA 3V7RA 3P9CA 3WTVC 1LDJA 1G6NA 2CWEA 4AD9A 1G4DA 4M71A 1RZ4A 3JAMZ 2GZWA 4WXCA 1KU9A 3ROUA 2YU3A 4R1HA 4A5MA 5LHIA 4G6QA 1V4RA 5D8LB 3WODF 3WU1B 2A69F 2QQ9A 1F4KA 2HR3A 2VXZA 3SZPA 1TLHB 6PAXA 3FM3A 4M74A 1BJAA 1PP8F 3PQKA 1U3EM 1REPC 2NNNA 4FX0A 3ZMSA 5D4RA 4CZZA 3RPQA 4RGXA 4M72A 1P92A 2VOPA 5BPIA 5BMZA 4P96A 4AWXB 1KU7A 1I1GA 2PQ8A 2KKOA 3M7GA 3PFIA 3C3WA 1GHCA 3REOA 5A2QK 3SHFA 3AAFA 1FY7A 3F8NA 3NQOA 2FRHA 2IA0A 2MLKA 4BNCA 1SD4A 2W25A 3TDZC 1YW8A 3MEXA 1EH7A 1GXPA 3F8BA 3TOAA 2Q8KA 3ZMVA 2M1BA 1MJBA 2ZXJA 2JPCA 1SD6A 2ZMEB 5D8KB 3FHZA 2DPUA 2L4MA 3I53A 2P7VB 4RGRA 5DV5A 3ECHA 3HHGA 5L3BA 3VOEA 1ZG5A 2VONA 3MWMA 3KP6A 1IN7A 4MTEA 1QQIA 3R0JA 1EH8A 2K86A 2DTRA 4I2OA 4ETSA 1XGMA 2R7DA 3WG9A 3C1DA 2Y75A 2JT1A 2RDPA 1K78B 3U9GA 3I4PA 3GLXA 3LA2A 2OBPA 1QNTA 2DI3A 4HOBA 1S8NA 2VE9A 4XLPF 5F6FA 3SZTA 4PGGA 3LFKA 5CLSA 2DU9A 3FXUA 2JZYA 3IC7A 4EGYA 4UVCA 2XRNA 3E5XA 2FXAA 3J81Z 5FGMA 4HQEA 3JTHA 1HQCA 4OIOF 2VBYA 2CG4A 3TOBA 1EV7A 4Y17A 3HRUA 5ERIA 1ULYA 2K7LA 2IA1A 1P4AA 3D0SA 4KMUX 2JTVA 3MAJA 3BY6A 4JQFA 1IAWA 4BHCA 2W24A 5L3EA 3F72A 4YFNF 1IN5A 1FPQA 4M6YA 5CVUA 2WV0A 1ZRDA 3HUGA 3T8TA 1P4XA 4WF2A 1KU2A 2P5LC 1WSUA 5LHHA 2DT5A 2O61A 2YPRA 2LDUA 5EEGA 3GX4X 2O0YA 2PG4A 2EWNA 3CLOA 4O6JA 1ON1A 1HKTA 3VB2A 3V8KA 4ZYHA 4ENMA 1KYWA 3O2PE 2FSWA 3DF8A 2ZBKA 3ECOA 1DPUA 4KFCA 4M73A 2R7FA 3I59B 3BPVA 1LNWA 3IWFA 5AIQA 1T38A 1LB2A 3EETA 4PZJA 4IHSA 2QQBA 3RI4A 1ODDA 2A6EF 1UHWA 3B02A 1Z6RA 1CGPA 1WWXA 3E5QA 3SQNA 3HHHA 1FOKA 3SXYA 2PMHA 2HYFA 1R22A 4OMZA 5BPDA 5HLHA 2GQQA 2K02A 3I5UA 4B8XA 2IVMA 4EJOA 4N9IA 3WE3A 1OR7A 4OIPF 2XHKA 1TTYA 2IJLA 2EB7A 3KLNA 5LGUA 2D45A 2VODA 4PGHA 4MQVA 2QVOA 1BN5A 4A12A 5DUKA 4EM0B 5FLXK 4YFXF 4HZFA 1T98A 3GFIA 2V1DA 1PP7U 1FP1D 3WTZA 1XGSA 4LJZF 2OQGA 2K27A 1STZA 4D0PA 1IUYA 4N0BA 3E97A 3F8CA 1IRGA 5E20A 2HWVA 2P6TA 2RC4A 4HW0A 1SD7A 1HKSA 3K1NA 2EA2A 1B4AA 4YG2F 2MC3A 1KQ0A 3I64A 2G7HA 2YR2A 5K5QA 2DW4A 2Q2EA 4IVNA 4KIGA 2X4HA 1FYKA 3HYIA 4KICA 1FSHA 2O03A 4AIKA 4L5IA 4MTDA 4A6EA 2KIMA 4PCQA 1FP2A 4LB5A 3OV8A 3FX3A 2UXXA 3RKWA 2QBYA 1IW7F 1XDSA 3K1PA 3RPUA 3BWGA 2OZ6A 2PBIA 3EYIA 3I0TA 1O7FA 3HSFA 4KIBA 1O3SA 1HW2A 5HLIA 5F1RA 4WCGA 1FBQA 4O5VA 4G7HF 4L0YB 3ML6A 2M8EA 1B9MA 2L01A 2DK5A 3IKVA 3TGNA 1JHFA 1R1TA 1HW1A 4OOIA 1G3SA 2HTSA 3ULQB 4LB6B 1SFEA 1WI9A 5BS6A 2OU2A 2FBHA 3ZMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DPD A;  4HF2 A;  3ZMT A;  3R61 A;  1TW2 A;  4MGR A;  1MZB A;  4FT8 A;  1FNN A;  2HKX A;  1IN8 A;  4P9F A;  5DCM B;  1U2W A;  1MJA A;  2NAZ A;  1W7P B;  1MKM A;  2W85 A;  1Z1D A;  5DEQ A;  3D5L A;  1R5G A;  3JTG A;  3I58 A;  2IP2 A;  1T2K A;  2PN6 A;  2UXN A;  4ZYG A;  3LAJ A;  1BI0 A;  1IN6 A;  1Q1H A;  3R6S A;  2R3S A;  4L0Z B;  2HDC A;  1CF7 B;  1YW9 A;  2COM A;  1XCB A;  5L3C A;  1DUX C;  1TQP A;  2H09 A;  2Z9O A;  3BOQ A;  5K5R A;  1QBJ A;  2MH2 A;  5ILV A;  1XCV A;  3KP2 A;  1G3W A;  4EM1 A;  1OMI A;  2LKP A;  2QLZ A;  3DEU A;  3O3K A;  1MDM A;  1BI2 A;  3M9A A;  5KK1 A;  2WWY A;  2QM3 A;  2GWR A;  5D5W B;  3COA C;  1YLF A;  3HIF A;  5ICE A;  4KIF A;  1JXS A;  1U5T B;  1XGO A;  1JHH A;  4ESF A;  2P4W A;  4CDG A;  3KLO A;  4CXF A;  2Q0O A;  3F21 A;  2XAH A;  3T5X A;  1LDD A;  3E6D A;  3BP8 A;  2DLL A;  5J8C A;  3HTS B;  3GO5 A;  2EV5 A;  2V1X A;  5D4S A;  4OIN F;  4L9J A;  3L9F A;  2GIV A;  3FMR A;  2M5W A;  3BPX A;  5A2Q Z;  2D1V A;  4S04 A;  1ZGA A;  5ED4 A;  3JSP A;  1KYZ A;  1UFM A;  2DQL A;  2PLY A;  5CVI A;  5E18 F;  3DKW A;  1B6A A;  1XSD A;  1O3R A;  4LLG F;  1BBY A;  4U88 A;  4G7Z F;  4K2E A;  4IRG A;  2MA3 A;  3K2Z A;  3W6K B;  3ELK A;  2GAU A;  3K69 A;  3WU0 A;  3VEP A;  4AIH A;  4LGW A;  1E2X A;  2RQP A;  1L0O C;  4EM2 A;  3GFL A;  2ZKZ A;  3V8J A;  1J7K A;  2UWM A;  1I1S A;  3B73 A;  1XN7 A;  5HLG A;  3HRS A;  1ZLK A;  3IRR A;  1XGN A;  1BIA A;  5IT3 A;  1UHM A;  1ZRE A;  5E1Z B;  3DPL C;  2P5V A;  1ZAR A;  4UHT A;  3EYY A;  3NRV A;  2XAJ A;  1SFX A;  4ENN A;  4BAY A;  4EJU A;  4EJW A;  1R1V A;  3WTW C;  1XMA A;  4A0Z A;  1D5V A;  3HSR A;  4DQ2 A;  1K6O A;  4G8X A;  2GA2 A;  3ZN1 A;  1FSE A;  2Y0M A;  1LDK B;  2EFP A;  3K0L A;  4R8H A;  3WGG A;  5H6Q A;  3DP7 A;  2BYV E;  5H6R A;  3HTU A;  2BEO A;  2CW0 F;  4BHB A;  1FYM A;  1GXQ A;  2Z3Y A;  4L18 B;  4OIQ F;  4UUV A;  1LVA A;  1QZZ A;  2WTE A;  2HZT A;  2IA2 A;  3WE2 A;  2W57 A;  1MD0 A;  2FOK A;  1BM9 A;  2OZU A;  5L3G A;  5BQT A;  3GUD A;  4ZYD A;  2XUB A;  2F2E A;  5FO5 A;  2FBK A;  1H9T A;  1SD5 A;  2EFO A;  4RGS A;  1DP7 P;  3GW2 A;  4TV7 A;  4ENJ A;  1R7J A;  1W7P D;  2GXB A;  1WRJ A;  1FC3 A;  4UNO A;  1YW7 A;  3ZMD A;  5JVT A;  2ETH A;  1LJ9 A;  2EA4 A;  4RS8 A;  3BZ6 A;  3TO6 A;  3QOP A;  3T0Y A;  5EEH A;  1OKR A;  2VE8 A;  1H0M A;  3SFZ A;  3S2W A;  5HDN A;  3TKY A;  5J6X A;  1DDN A;  1ZAO A;  1J5Y A;  1YS7 A;  1R58 A;  2QEN A;  4LK0 F;  3GWZ A;  2XKP A;  3HOS A;  2KIF A;  2JPB A;  2NYX A;  2L3D A;  1A04 A;  1UST A;  2BE5 F;  4KUM A;  2HKO A;  2MBF A;  5D5V B;  3LWF A;  4PDK A;  4WK8 F;  2NS0 A;  4BHP A;  1HXD A;  2HOE A;  4Y15 A;  4G6D A;  3FMS A;  5AIP A;  1U8R A;  1TW3 A;  3R60 A;  4R79 A;  2F5F A;  2HQN A;  1LEB A;  3F8F A;  5D6E A;  3P9K A;  2G9W A;  3BDD A;  2PJP A;  1ON2 A;  3H3U A;  1IXR C;  3QU3 A;  1OYI A;  4HLX A;  1O3Q A;  3F6O A;  3IL2 A;  2DK8 A;  1J59 A;  4AVP A;  4YII A;  4WXH A;  1L3L A;  3JSO A;  2VBX A;  4CYD A;  2ELH A;  1HBX G;  3H3Z A;  2KJC A;  2F5D A;  3Q5F A;  3BJ6 A;  4LLL A;  2X0L A;  3QP6 A;  1BC7 C;  3Q9S A;  1Z9C A;  2OD5 A;  3E3V A;  3P7N A;  4HA8 A;  2Y48 A;  3KFW X;  4OIR F;  2ZCW A;  4FX4 A;  4L9N A;  4GYG A;  3QRF F;  1BC8 C;  2LNB A;  5E8I A;  5FLX Z;  3ERE D;  3LST A;  4ZZD A;  4A0X A;  1C0W A;  5FFX A;  1QZY A;  3IKT A;  4M9X A;  2MLG A;  3MZY A;  2CFX A;  1S29 A;  1B9N A;  1MJ9 A;  2ESH A;  5ILU A;  2CSO A;  3RKX A;  4A0Y A;  4IRI A;  5FD5 A;  2EV6 A;  1KQ8 A;  3BJO A;  5KVR A;  4WX9 A;  1XDU A;  3H92 A;  3E6C C;  1GVJ A;  2D1H A;  3ZP5 A;  3WGH A;  4P9U A;  1KQ9 A;  5AON A;  3J80 Z;  4MHG A;  2H27 A;  1S6L A;  2B0L A;  1S7A A;  3K9T A;  4ESJ A;  4MEX F;  4UV9 A;  3M8F A;  3M1E A;  2ZFW A;  2Z33 A;  3RKY A;  1Z6T A;  4RB2 C;  3PQJ A;  1UCR A;  3ABT A;  4EV0 A;  4LMY A;  3FF5 A;  1T6S A;  4IJA A;  1J75 A;  4I01 A;  1YQA A;  4ESB A;  1XMK A;  4JK1 X;  1P6R A;  5HS7 A;  2DBB A;  2XRO A;  2E1N A;  2XAS A;  3IWZ A;  4WWC A;  4EJT A;  5IT9 K;  2A61 A;  4M6X A;  5E17 F;  5DD8 A;  5K5O A;  4GCV A;  3WTT C;  5H20 A;  5CVR A;  5HOO A;  1TBX A;  1RUO A;  5LHG A;  3T1B A;  2K4J A;  3LQR A;  4CHU A;  1H9G A;  3CUQ A;  5DDG A;  2WC2 A;  3CUQ C;  3E6B A;  4LG0 A;  2P8T A;  3RTR A;  3L7W A;  2VBZ A;  3U1D A;  3W6J B;  3CTA A;  2QBY B;  1ZH5 A;  3GEZ A;  1IZ1 A;  3MQ0 A;  2ISZ A;  4G7O F;  2O6G E;  1W5T A;  1IF1 A;  1FLI A;  1HST A;  2CQK A;  2AXL A;  3KE2 A;  2O8X A;  2YX4 A;  4UV8 A;  2MD5 A;  3GVA A;  4OMY A;  3F3X A;  2IRF G;  3I54 A;  4BXU A;  1O3T A;  2L4A A;  1SFU A;  3DXJ F;  2J5P A;  3FXR A;  1SMT A;  2ZNY A;  4XSZ F;  1BI3 A;  1I27 A;  2YSR A;  1SAX A;  4U0W A;  4Z2Y A;  4GXO A;  2RGV A;  3CO6 C;  4RGU A;  2Z99 A;  4RAY A;  3F22 A;  5LLQ A;  3M8E A;  4FHT A;  2HS5 A;  2VC1 A;  4NB5 A;  5L3D A;  1V3F A;  1SMY F;  1U6G A;  2FMY A;  4G94 A;  5HDK A;  4RB3 C;  2CGP A;  4YIF A;  2JRT A;  4LLN A;  3LA3 A;  4ENK A;  2LSO A;  3RIR A;  4I7H A;  3ZQ7 A;  4Q48 A;  2V79 A;  5FB2 A;  3LQQ A;  2VBW A;  1ZRF A;  5DUI A;  2PEX A;  2QZ8 A;  4XRF A;  2HTJ A;  3GZ5 A;  1ONV A;  1ZG3 A;  2O3F A;  1FZP B;  4MNU A;  1R5H A;  3G73 A;  3GFJ A;  1TQI A;  4MEY F;  5CVV A;  4YFK F;  1U5T C;  3N97 A;  1EH6 A;  1QPM A;  1BI1 A;  2MH9 A;  3ZMZ A;  5ILS A;  2EFW A;  2RNJ A;  5LGN A;  3Q9V A;  3F8M A;  2HQR A;  3FM5 A;  4ZH4 F;  3FXQ A;  3GF2 A;  3HOT A;  1MDM B;  4F7Z A;  4ZYE A;  3QP5 A;  2IW5 A;  2ZJ2 A;  4KYW A;  2P6S A;  1OPC A;  1FWZ A;  3KCC A;  3EDP A;  2IT0 A;  1FBS A;  2HYG D;  3I71 A;  3JAM K;  1R1U A;  1ZRC A;  1D8J A;  3FWE A;  4KN7 X;  2FNP A;  4WXD A;  4M9S A;  2EK5 A;  3KET A;  5D5U B;  2FE3 A;  3IHU A;  3V4G A;  1Z7U A;  4IPA A;  2XV4 S;  2IPQ X;  1G3Y A;  2EFQ A;  5HS9 A;  1TNT A;  4AIJ A;  1XSX A;  2GXG A;  4KDP A;  1FT9 A;  1T0F A;  3CO7 C;  2STT A;  2A3S A;  2QUF A;  1P2F A;  4U7D A;  1K7A A;  2Z5U A;  3DV8 A;  1JE8 A;  3FZV A;  3KP7 A;  1U78 A;  4KA4 A;  1YO5 C;  2ZME A;  1TQM A;  2OAZ A;  5E1X A;  2DQR A;  2XKO A;  4G9Y A;  2LF7 A;  4EGZ A;  3GZ6 A;  2VN2 A;  4HDU A;  1D8K A;  4KNY A;  5ICG A;  4HX7 A;  3QPT A;  4EMS A;  2HEO A;  2E7W A;  4XSX F;  3VOD A;  1K78 A;  2FEZ A;  4MQ9 F;  1I5Z A;  3IRQ A;  2J5O A;  1R36 A;  2M45 A;  1IN4 A;  3JW4 A;  1W4M A;  1QGP A;  2VT2 A;  1I6X A;  4I0A A;  4Q47 A;  3MFK A;  1WKM A;  2A68 F;  4B09 A;  3V7C A;  2XGX A;  5CYV A;  3VFZ A;  2P5K A;  2BGC A;  1JGS A;  1XSV A;  4RAZ A;  5DCF A;  4L9V A;  2HFH A;  4A6D A;  5D6F A;  1D3Y A;  5LBQ A;  3HRM A;  3KZZ A;  1QO0 D;  1USS A;  4XBF A;  4EJV A;  5ICC A;  1YG2 A;  4HX8 A;  2VT3 A;  1TNS A;  3WTX C;  2LF8 A;  4BQA A;  3R4K A;  2NRA C;  4HQM A;  3C7J A;  4HLY A;  2YX7 A;  5TJJ A;  2V1U A;  2FF4 A;  3RJP A;  5FFZ A;  4Q5S F;  3QPH A;  2OQR A;  3MZH A;  4HAM A;  1J0R A;  1O57 A;  2BBY A;  1YYV A;  4HX4 A;  4HBL A;  5J8F A;  2ESN A;  2PFB A;  3V8L A;  2KIU A;  4HDV A;  4UXN A;  4M9Z A;  3J81 K;  4I02 A;  3ISP A;  2XAG A;  4NQW A;  2ACJ A;  3E5U A;  4ZZL A;  3K1M A;  3V7S A;  3TQN A;  2E7X A;  1IXC A;  2F5E A;  3KP3 A;  5HVQ C;  1LQ1 A;  3RDI A;  1HW5 A;  1J9I A;  5HDG A;  1FBU A;  5DYM A;  2TDX A;  4IHT A;  3L2C A;  4KN4 X;  3WTS C;  4A5N A;  1F1Z A;  4HV5 A;  2FNA A;  2STW A;  1RNL A;  3I59 A;  2V9V A;  2XIG A;  1B59 A;  2UZK A;  1YTY A;  1HKQ A;  3BJA A;  2FBI A;  1XD7 A;  2M30 A;  1ZLJ A;  2CO5 A;  2FU4 A;  3N4M A;  1RUN A;  5FD6 A;  1ZN2 A;  4RB1 A;  1RIO H;  1NHA A;  2HGC A;  5HS8 A;  3KP5 A;  2OA4 A;  2ZO4 A;  1R23 A;  3HRT A;  4I98 B;  2PMU A;  3EUH A;  5L3F A;  2FML A;  1ZHF A;  1E17 A;  4BYY A;  2KRF A;  1RI7 A;  1P4W A;  1ZGJ A;  5LRS A;  3E6M A;  2QQA A;  4LFU A;  1KU3 A;  2NNY A;  3WTU C;  3L00 A;  2XAF A;  2ISY A;  3CJN A;  4KMF A;  4GGG A;  3C18 A;  1ZG1 A;  1AWC A;  3F23 A;  2FA5 A;  3TO9 A;  3P9I A;  1PUE E;  2DAO A;  2W84 A;  2H94 A;  3KEO A;  1FX7 A;  2KJB A;  1AOY A;  3OOP A;  2K4B A;  5JR3 A;  1KA8 A;  2BV6 A;  3QU6 A;  1OYW A;  3O6B B;  4P55 A;  4I09 A;  3BRO A;  2XAQ A;  2ADU A;  3RYP A;  1KGS A;  2JSC A;  2V6C A;  4CO8 A;  1O7L A;  1S7O A;  2ZNZ A;  5CVJ A;  1FYL A;  1LEA A;  2EV0 A;  2QWW A;  5LEJ A;  1W5S A;  4QWQ A;  2DFI A;  4KT5 C;  4U7B A;  1YS6 A;  2F5C A;  3FMQ A;  2EJR A;  4HV6 A;  1IXS B;  1MGT A;  4QLC U;  4NHJ A;  2EFN A;  1VTN C;  3LA7 A;  5F64 A;  2L54 A;  1UB9 A;  5IT9 Z;  2QYO A;  5CJ9 A;  4Y13 A;  3J80 K;  4L9T A;  3GXO A;  3ABU A;  5TRD A;  2A6H F;  2L02 A;  3WTY C;  4XLN F;  4GYI A;  4JBA A;  3R0A A;  5BOX A;  5E8G A;  4ASN A;  4IXA A;  3RYR A;  1X3U A;  3DQV C;  2H6C A;  4U0Y A;  3LAP A;  2M87 A;  1J2X A;  4IF4 A;  1K79 A;  2RVC A;  2XVC A;  4LK1 F;  3U2R A;  1T39 A;  3TDU C;  2E1C A;  4HF0 A;  4A2U A;  3L09 A;  1XB4 A;  2RKH A;  3HSE A;  4I0B A;  1DPR A;  1BIB A;  5ICF A;  4U0V A;  3QAH A;  2DO7 A;  3J7A O;  5DD4 A;  4O3M A;  5JFR A;  4RB0 A;  5DCM A;  3CUO A;  1BOA A;  3DFG A;  5JHU A;  4ON0 A;  1PDN C;  1WQ2 A;  4BH9 A;  3CUQ B;  1W7P A;  4P5O A;  4Q4Z F;  2RN7 A;  4UVA A;  2C6Y A;  4DNC A;  4LG0 B;  2D2W A;  4GO1 A;  2G7U A;  4IRH A;  2CYY A;  4UVB A;  4OU0 A;  4EQQ A;  1B1B A;  1IRF A;  1YFH A;  2FQ3 A;  2H6B A;  2VOO A;  1Z05 A;  1S3J A;  3F6V A;  3G3Z A;  4H0E A;  1CF7 A;  4CGZ A;  2P7C B;  1OYY A;  2VC0 A;  3TO7 A;  1Z91 A;  4E70 A;  2RV8 A;  4L5J A;  5K1Y A;  1G3T A;  3NEU A;  5LRR A;  3KP4 A;  2A07 F;  2AS5 F;  3WGI A;  3EQL F;  5LGT A;  3GFM A;  3GYH X;  4HF1 A;  4EVI A;  1ZYR F;  4LD5 A;  2A5Y B;  4N9H A;  1F5T A;  3DPT A;  4S05 A;  5E1W A;  2GA1 A;  1HSJ A;  3T8R A;  4HYE A;  3ZN0 A;  5LEK A;  1F9N A;  1U5T A;  3ZPL A;  1Y0U A;  3MCZ A;  5JI6 A;  3KEQ A;  5D5X B;  3KZY A;  1YIO A;  1R00 A;  2PI0 A;  4CIC A;  3CDH A;  3V7R A;  3P9C A;  3WTV C;  1LDJ A;  1G6N A;  2CWE A;  4AD9 A;  1G4D A;  4M71 A;  1RZ4 A;  3JAM Z;  2GZW A;  4WXC A;  1KU9 A;  3ROU A;  2YU3 A;  4R1H A;  4A5M A;  5LHI A;  4G6Q A;  1V4R A;  5D8L B;  3WOD F;  3WU1 B;  2A69 F;  2QQ9 A;  1F4K A;  2HR3 A;  2VXZ A;  3SZP A;  1TLH B;  6PAX A;  3FM3 A;  4M74 A;  1BJA A;  1PP8 F;  3PQK A;  1U3E M;  1REP C;  2NNN A;  4FX0 A;  3ZMS A;  5D4R A;  4CZZ A;  3RPQ A;  4RGX A;  4M72 A;  1P92 A;  2VOP A;  5BPI A;  5BMZ A;  4P96 A;  4AWX B;  1KU7 A;  1I1G A;  2PQ8 A;  2KKO A;  3M7G A;  3PFI A;  3C3W A;  1GHC A;  3REO A;  5A2Q K;  3SHF A;  3AAF A;  1FY7 A;  3F8N A;  3NQO A;  2FRH A;  2IA0 A;  2MLK A;  4BNC A;  1SD4 A;  2W25 A;  3TDZ C;  1YW8 A;  3MEX A;  1EH7 A;  1GXP A;  3F8B A;  3TOA A;  2Q8K A;  3ZMV A;  2M1B A;  1MJB A;  2ZXJ A;  2JPC A;  1SD6 A;  2ZME B;  5D8K B;  3FHZ A;  2DPU A;  2L4M A;  3I53 A;  2P7V B;  4RGR A;  5DV5 A;  3ECH A;  3HHG A;  5L3B A;  3VOE A;  1ZG5 A;  2VON A;  3MWM A;  3KP6 A;  1IN7 A;  4MTE A;  1QQI A;  3R0J A;  1EH8 A;  2K86 A;  2DTR A;  4I2O A;  4ETS A;  1XGM A;  2R7D A;  3WG9 A;  3C1D A;  2Y75 A;  2JT1 A;  2RDP A;  1K78 B;  3U9G A;  3I4P A;  3GLX A;  3LA2 A;  2OBP A;  1QNT A;  2DI3 A;  4HOB A;  1S8N A;  2VE9 A;  4XLP F;  5F6F A;  3SZT A;  4PGG A;  3LFK A;  5CLS A;  2DU9 A;  3FXU A;  2JZY A;  3IC7 A;  4EGY A;  4UVC A;  2XRN A;  3E5X A;  2FXA A;  3J81 Z;  5FGM A;  4HQE A;  3JTH A;  1HQC A;  4OIO F;  2VBY A;  2CG4 A;  3TOB A;  1EV7 A;  4Y17 A;  3HRU A;  5ERI A;  1ULY A;  2K7L A;  2IA1 A;  1P4A A;  3D0S A;  4KMU X;  2JTV A;  3MAJ A;  3BY6 A;  4JQF A;  1IAW A;  4BHC A;  2W24 A;  5L3E A;  3F72 A;  4YFN F;  1IN5 A;  1FPQ A;  4M6Y A;  5CVU A;  2WV0 A;  1ZRD A;  3HUG A;  3T8T A;  1P4X A;  4WF2 A;  1KU2 A;  2P5L C;  1WSU A;  5LHH A;  2DT5 A;  2O61 A;  2YPR A;  2LDU A;  5EEG A;  3GX4 X;  2O0Y A;  2PG4 A;  2EWN A;  3CLO A;  4O6J A;  1ON1 A;  1HKT A;  3VB2 A;  3V8K A;  4ZYH A;  4ENM A;  1KYW A;  3O2P E;  2FSW A;  3DF8 A;  2ZBK A;  3ECO A;  1DPU A;  4KFC A;  4M73 A;  2R7F A;  3I59 B;  3BPV A;  1LNW A;  3IWF A;  5AIQ A;  1T38 A;  1LB2 A;  3EET A;  4PZJ A;  4IHS A;  2QQB A;  3RI4 A;  1ODD A;  2A6E F;  1UHW A;  3B02 A;  1Z6R A;  1CGP A;  1WWX A;  3E5Q A;  3SQN A;  3HHH A;  1FOK A;  3SXY A;  2PMH A;  2HYF A;  1R22 A;  4OMZ A;  5BPD A;  5HLH A;  2GQQ A;  2K02 A;  3I5U A;  4B8X A;  2IVM A;  4EJO A;  4N9I A;  3WE3 A;  1OR7 A;  4OIP F;  2XHK A;  1TTY A;  2IJL A;  2EB7 A;  3KLN A;  5LGU A;  2D45 A;  2VOD A;  4PGH A;  4MQV A;  2QVO A;  1BN5 A;  4A12 A;  5DUK A;  4EM0 B;  5FLX K;  4YFX F;  4HZF A;  1T98 A;  3GFI A;  2V1D A;  1PP7 U;  1FP1 D;  3WTZ A;  1XGS A;  4LJZ F;  2OQG A;  2K27 A;  1STZ A;  4D0P A;  1IUY A;  4N0B A;  3E97 A;  3F8C A;  1IRG A;  5E20 A;  2HWV A;  2P6T A;  2RC4 A;  4HW0 A;  1SD7 A;  1HKS A;  3K1N A;  2EA2 A;  1B4A A;  4YG2 F;  2MC3 A;  1KQ0 A;  3I64 A;  2G7H A;  2YR2 A;  5K5Q A;  2DW4 A;  2Q2E A;  4IVN A;  4KIG A;  2X4H A;  1FYK A;  3HYI A;  4KIC A;  1FSH A;  2O03 A;  4AIK A;  4L5I A;  4MTD A;  4A6E A;  2KIM A;  4PCQ A;  1FP2 A;  4LB5 A;  3OV8 A;  3FX3 A;  2UXX A;  3RKW A;  2QBY A;  1IW7 F;  1XDS A;  3K1P A;  3RPU A;  3BWG A;  2OZ6 A;  2PBI A;  3EYI A;  3I0T A;  1O7F A;  3HSF A;  4KIB A;  1O3S A;  1HW2 A;  5HLI A;  5F1R A;  4WCG A;  1FBQ A;  4O5V A;  4G7H F;  4L0Y B;  3ML6 A;  2M8E A;  1B9M A;  2L01 A;  2DK5 A;  3IKV A;  3TGN A;  1JHF A;  1R1T A;  1HW1 A;  4OOI A;  1G3S A;  2HTS A;  3ULQ B;  4LB6 B;  1SFE A;  1WI9 A;  5BS6 A;  2OU2 A;  2FBH A;  3ZMU A; 
#chains in the Genus database with same CATH topology
 1Y0N A;  1HF0 A;  2CQX A;  3BZK A;  2DPD A;  3LMM A;  4HF2 A;  3ZMT A;  4PSW A;  1N75 A;  3TED A;  3R61 A;  1TW2 A;  3SJM A;  4MGR A;  1MZB A;  4FT8 A;  1FNN A;  2HKX A;  1BA5 A;  1IN8 A;  1JJ8 C;  4P9F A;  5DCM B;  3VYR B;  1U2W A;  1MJA A;  2NAZ A;  4B3A A;  4FTH A;  3BLY A;  3GTG J;  1W7P B;  4M3F A;  5E3N A;  1MKM A;  3JRC A;  2W85 A;  3HKZ A;  4XIC A;  3CCE I;  3M4O J;  3LFU A;  1Z1D A;  5DEQ A;  4FAS D;  3D5L A;  1R5G A;  3JTG A;  3I58 A;  2R5Z A;  2DA2 A;  2KLO A;  2IP2 A;  5EJC A;  1T2K A;  1QHG A;  2GBY A;  3QYF A;  2PN6 A;  2UXN A;  4ZYG A;  3LAJ A;  1G2H A;  1BI0 A;  1IN6 A;  2E1M B;  1Q1H A;  3KX2 A;  3R6S A;  2R3S A;  1IG7 A;  1MH3 A;  4L0Z B;  1JTX A;  1FEX A;  2HDC A;  1DP3 A;  1CF7 B;  1YW9 A;  2COM A;  3GME A;  1XCB A;  5L3C A;  2A05 A;  1DUX C;  4KIS A;  1TQP A;  3VSL A;  2H09 A;  2Z9O A;  3BOQ A;  5K5R A;  4BJT A;  3A2K A;  1QBJ A;  2MH2 A;  3BR2 A;  5ILV A;  1JGG A;  3TP0 A;  1XCV A;  2QA4 I;  3KP2 A;  1G3W A;  4EM1 A;  1OMI A;  2R5Z B;  2HVR A;  2LKP A;  2QLZ A;  3DEU A;  3O3K A;  1XC5 A;  3ONQ A;  1MDM A;  3BR6 A;  1BI2 A;  3M9A A;  4F91 B;  2KZV A;  5KK1 A;  4RA2 A;  3K4C A;  4JX4 A;  3H9J A;  2X6X A;  3I9V 2;  2WWY A;  2QM3 A;  2GWR A;  5D5W B;  1HOM A;  5J40 A;  3COA C;  2DMN A;  4MFE A;  1X19 A;  2BW3 A;  1YLF A;  3GTJ J;  2ZJP F;  1RR8 C;  3GTO J;  3CMY A;  3HIF A;  1Y1W J;  2VUM J;  3A01 A;  5ICE A;  4KIF A;  2KHM A;  1JXS A;  3A03 A;  3CJT B;  4IOC F;  1U5T B;  1HA8 A;  2LP0 A;  2EZK A;  1XGO A;  1JHH A;  4D7M A;  3F0C A;  2P4W A;  2KQR A;  4ESF A;  5J4Y A;  4CDG A;  3KLO A;  4CXF A;  3H5A A;  2Q0O A;  3F21 A;  2XAH A;  3T5X A;  1LDD A;  2JN6 A;  3E6D A;  3BP8 A;  2DLL A;  2HXO A;  3BCB A;  4ZTF A;  2KIQ A;  4HNV A;  2CW7 A;  5J8C A;  2BHY A;  3E0J B;  1LKX A;  1B8I B;  3GO5 A;  3MKW B;  3HTS B;  2EV5 A;  3SDB A;  2V1X A;  3CCS I;  5D4S A;  2HDW A;  1MH4 A;  3EUK L;  4OIN F;  2W82 A;  4L9J A;  3L9F A;  2GIV A;  3FMR A;  4IOA F;  4C9Y A;  3AL0 B;  1SFK A;  3BG9 A;  5F0F A;  2M5W A;  3AG1 H;  3BPX A;  5J1Y A;  1JTY A;  5A2Q Z;  1H88 C;  2D1V A;  4S04 A;  1ZGA A;  4DIQ A;  4AYB N;  4ZTJ A;  5ED4 A;  3JSP A;  1KYZ A;  2XPW A;  1UFM A;  2DQL A;  4RLF A;  2PLY A;  5CVI A;  3FDY A;  5E18 F;  3DKW A;  2I8D A;  1B6A A;  1XSD A;  1O3R A;  4LLG F;  4FET A;  2EZI A;  1VQ4 I;  1BBY A;  4U88 A;  4G7Z F;  2E2I J;  3CCV I;  2MAB A;  2QGU A;  4K2E A;  2L7M P;  3FXJ A;  4IRG A;  2MA3 A;  4J01 A;  4CUG A;  3K2Z A;  1Y8Q B;  5EG0 A;  4OAY A;  3W6K B;  3ELK A;  1R5I D;  2GAU A;  3K69 A;  3WU0 A;  3VEP A;  1MMD A;  4LGW A;  4AIH A;  4BEH B;  5IP6 A;  1E2X A;  2EIJ H;  1L0O C;  2RQP A;  4EM2 A;  4A3J J;  1A35 A;  2X1C A;  3S3M A;  1LFB A;  1OIS A;  1P7I A;  3GFL A;  2ZKZ A;  2KFD A;  3HB9 A;  3V8J A;  1J7K A;  2VL8 A;  1LFP A;  2UWM A;  2JJ7 A;  1I1S A;  3B73 A;  4I6Z A;  4PUS A;  1XN7 A;  5HLG A;  3A0H C;  3CP8 A;  3HRS A;  1ZLK A;  4N4O B;  1GVD A;  2L9R A;  3IRR A;  1XGN A;  2X85 A;  3WHC A;  3E7L A;  1BIA A;  3V42 A;  4MIM A;  1S72 I;  3QYE A;  5IT3 A;  1UHM A;  5M3M J;  3JRF A;  1TT5 B;  3CDI A;  1ZRE A;  1MMN A;  1A31 A;  5E1Z B;  3DPL C;  2P5V A;  1ZAR A;  4UHT A;  2X1D A;  1D0X A;  3LSI A;  1FIA A;  3EYY A;  3NRV A;  2XAJ A;  1SFX A;  1BR4 A;  4ENN A;  1JKR C;  4BAY A;  5F04 A;  3NWT A;  4EJU A;  4EJW A;  2E60 A;  1R1V A;  3WTW C;  1Y1V J;  1XMA A;  4A0Z A;  1D5V A;  5E79 C;  3HSR A;  1YJ9 I;  2COB A;  2DT6 A;  4DQ2 A;  1K6O A;  4G8X A;  3OYC A;  2GA2 A;  3JR9 A;  3ZN1 A;  1FSE A;  4A69 C;  4V2G A;  4M6V A;  3MN2 A;  2Y0M A;  2E36 A;  1LDK B;  3K70 C;  2EFP A;  2KZG A;  4DBQ A;  3ZOB A;  3WU2 C;  4BE0 A;  3K0L A;  4YEL A;  3OS0 A;  5F0H A;  1YIJ I;  4R8H A;  1QZE A;  1R9T J;  2EIM H;  4BQN A;  4EAT A;  3WGG A;  5H6Q A;  3DP7 A;  3KYL A;  2BYV E;  5H6R A;  3HTU A;  2BEO A;  3GTM J;  2CW0 F;  2ID6 A;  2CFO A;  4BHB A;  4A3I J;  1FYM A;  1GXQ A;  2Z3Y A;  3PUB A;  4L18 B;  4OIQ F;  4UUV A;  1H89 C;  1LVA A;  1QZZ A;  1VND A;  1W36 D;  2D5V A;  2WTE A;  1UAA A;  2HZT A;  2IA2 A;  3WE2 A;  4G6T B;  2QKL B;  2E35 A;  2W57 A;  2CRG A;  1U9N A;  1MD0 A;  2XF7 A;  4P1W A;  3IUO A;  2FOK A;  1BM9 A;  2OZU A;  4XN0 A;  5L3G A;  5C4J J;  3S17 J;  5BQT A;  1X2M A;  3GUD A;  1YI2 I;  4ZYD A;  2XUB A;  1V5E A;  4LG3 A;  5F0C A;  3IV5 A;  4CH7 A;  2F2E A;  1VQ6 I;  5FO5 A;  3MKL A;  1X1D A;  1MBF A;  1Z7L A;  2VB6 A;  3H3V K;  1I3A A;  2FBK A;  2DA3 A;  5M5X J;  1H9T A;  4DJA A;  1SD5 A;  2EFO A;  4RGS A;  5FJ8 J;  1DP7 P;  3GW2 A;  3PO2 J;  4TV7 A;  1VQ9 I;  2MYS A;  4ENJ A;  3QPS A;  1R7J A;  1W7P D;  2GXB A;  4Y3O A;  1WRJ A;  2DFF A;  2OPT A;  3NAR A;  3ZRG A;  1YRN A;  1FC3 A;  2AQF A;  4UNO A;  1YW7 A;  2RNG A;  3ZMD A;  5JVT A;  2ETH A;  3MKY B;  1LJ9 A;  2EA4 A;  2L9V A;  4RS8 A;  3BZ6 A;  2Y69 H;  4B1R A;  3TO6 A;  2YS9 A;  4RDU A;  3QOP A;  1XPX A;  3T0Y A;  5EEH A;  4DZP A;  1Y56 A;  1OKR A;  2VE8 A;  3C2B A;  1H0M A;  3CZ6 A;  3SFZ A;  1FOW A;  4BUP A;  2DOD A;  3QOE A;  1ZGW A;  3S2W A;  5HDN A;  4PJN A;  3TKY A;  5J6X A;  1JT6 A;  1DDN A;  4II3 A;  4BL0 B;  2QF7 A;  1ZAO A;  2JQ7 A;  1J5Y A;  2CH0 A;  2M7A A;  1YS7 A;  3AG4 H;  1R58 A;  2QEN A;  4LK0 F;  3GWZ A;  2XKP A;  3HOS A;  2KIF A;  2WY8 Q;  5C4X J;  2JPB A;  1FMV A;  2NYX A;  5B5E C;  2L3D A;  1A04 A;  1UST A;  2BE5 F;  4KUM A;  1WZ2 A;  2HKO A;  1IJW C;  2MBF A;  2NXN B;  3OSF A;  5D5V B;  3LWF A;  4PDK A;  2DOE A;  1MSE C;  1T95 A;  4WK8 F;  3VWB A;  1SAU A;  5IY5 H;  2NS0 A;  3ZQC A;  4BHP A;  1HXD A;  2HOE A;  1W1W E;  4Y15 A;  4G6D A;  1T08 B;  4XOT A;  3FMS A;  5AIP A;  4BQO A;  3HL2 A;  1U8R A;  1OCC H;  1TW3 A;  3GTQ J;  3R60 A;  1R6R A;  4R79 A;  2VXD A;  3OIQ A;  2H8W A;  2M9H A;  2R7T A;  2F5F A;  2HQN A;  1LEB A;  3CES A;  1AKH A;  3OYN A;  3F8F A;  5D6E A;  4HST A;  3HUG B;  3P9K A;  2F4M B;  4BE2 A;  1YIT I;  1X1A A;  2G9W A;  3BDD A;  2PJP A;  1ON2 A;  3H3U A;  3LSJ A;  4XNF A;  1IXR C;  3A02 A;  3QU3 A;  1OYI A;  1R4M B;  3L1P A;  4HLX A;  1O3Q A;  3F6O A;  3IL2 A;  2IS1 A;  2DK8 A;  1XG1 A;  4BBR J;  1J59 A;  2PMZ A;  4AVP A;  4YII A;  5EZH A;  4WXH A;  1L3L A;  3JSO A;  2K9N A;  2LKX A;  4IHV A;  2VBX A;  3OSG A;  1ZKG A;  4PFO A;  4CYD A;  2ELH A;  1HBX G;  2E2H J;  2GXA A;  3RZD J;  2LG4 A;  1ITY A;  3BG7 A;  4XOP A;  3H3Z A;  2R93 J;  3H0G J;  1QU3 A;  2KJC A;  2XB5 A;  2F5D A;  1ORK A;  3Q5F A;  2X48 A;  3BJ6 A;  3OYB A;  2XDV A;  4LLL A;  3OR1 C;  1U0J A;  2X0L A;  4DW6 A;  3QP6 A;  3X2Q H;  2KPM A;  1QVU A;  4YIR X;  1W0U A;  2CW8 A;  1BC7 C;  3SEZ A;  3OYH A;  3OMY A;  3Q9S A;  5IYC J;  4CCK A;  1Z9C A;  1K4S A;  2OD5 A;  2VPL A;  3E3V A;  1WVR A;  2B9S A;  3P7N A;  4HA8 A;  2R92 J;  2Y48 A;  3KFW X;  4XKV A;  1OJL A;  3FBN B;  4OIR F;  3K4M A;  3W3C A;  2ZCW A;  4FX4 A;  4L9N A;  4GYG A;  2M4K A;  3QRF F;  1BC8 C;  1WHU A;  3PSI A;  5JVG F;  2LNB A;  4XID A;  4E6K G;  5E8I A;  5FLX Z;  3ERE D;  5FKK A;  2LK2 A;  4NC6 A;  3LST A;  4ZZD A;  4XKC A;  3BQY A;  4A0X A;  3H0D A;  1C0W A;  5FFX A;  1QZY A;  3IKT A;  2GOM A;  4M9X A;  1A6Q A;  2LMD A;  2MLG A;  3MZY A;  2NOG A;  2R7O A;  2CFX A;  1LE8 A;  3OYM A;  1S29 A;  1B9N A;  2QSH X;  1MJ9 A;  1HDP A;  2XPU A;  2ESH A;  5ILU A;  2CSO A;  2NVX J;  3RKX A;  4A0Y A;  2HDD A;  4IRI A;  5FD5 A;  2EV6 A;  3FK6 A;  2ZFU A;  1KQ8 A;  3BJO A;  4AID A;  5KVR A;  3JRH A;  4WX9 A;  1XDU A;  3H92 A;  3E6C C;  1DQU A;  3RCO A;  2DOA A;  3HOV J;  1GVJ A;  3L2W A;  2D1H A;  2H8R A;  3ZP5 A;  1SVO A;  2QKM B;  3WGH A;  4P9U A;  1R49 A;  1KQ9 A;  5AON A;  3CP2 A;  3ASO H;  3J80 Z;  4MHG A;  4UY8 I;  2H27 A;  4DYQ A;  3K4L A;  2HOT A;  1S6L A;  2B0L A;  4XK4 A;  2BXY A;  1S7A A;  3LSG A;  2GIZ A;  2LY1 A;  3K9T A;  3Q3S A;  2CMP A;  2MC4 A;  4XMY A;  1SAN A;  4ESJ A;  3ZQF A;  4MEX F;  4UV9 A;  1RC9 A;  2TRT A;  1JUM A;  3M8F A;  4C2T A;  4RMN A;  2K3P A;  3DBL B;  2PJR A;  3M1E A;  1X3W B;  2ZFW A;  3M8J A;  2Z33 A;  3RKY A;  1Z6T A;  1SVL A;  1ZR4 A;  4RB2 C;  2DA7 A;  3JRA A;  1XMX A;  3PQJ A;  1NK2 P;  1UCR A;  5F1J A;  3ABT A;  4EV0 A;  4BE1 A;  4LMY A;  2WV1 A;  1EA3 A;  4X0G A;  3FF5 A;  3A1Y A;  1IO2 A;  1T6S A;  2WB1 N;  3VYU B;  2BZT A;  4F92 B;  4IJA A;  2R7W A;  3OYI A;  5IYB J;  1J75 A;  4I01 A;  2W1O A;  5HLT A;  1YQA A;  2IEK A;  4ESB A;  4BXX J;  1XMK A;  4JK1 X;  2H1L A;  1P6R A;  5HS7 A;  4HRI A;  2DBB A;  2XRO A;  2E1N A;  2XAS A;  4FCY A;  3IWZ A;  1PUF B;  4WWC A;  2EIK H;  4EJT A;  5IT9 K;  1X1P A;  2A61 A;  3N05 A;  4M6X A;  5E17 F;  2LYC A;  2X6O A;  2OC6 A;  5DD8 A;  5K5O A;  3W2W A;  4GCV A;  1QRY A;  2XPV A;  2V26 A;  3OR2 C;  3D1N I;  2M2E A;  3WTT C;  2Q2E B;  5H20 A;  2DCE A;  5CVR A;  5HOO A;  4X6A J;  1TBX A;  1RUO A;  5LHG A;  3T1B A;  1VQL I;  1VI0 A;  2K4J A;  3LQR A;  2IS4 A;  4CHU A;  3HXL A;  4DYC A;  1H9G A;  2OJE D;  3HM5 A;  2O5R A;  3CUQ A;  4AUX A;  5CPR B;  5DDG A;  1MMS A;  2XSD C;  2M0M A;  1XX5 A;  2LBF B;  2WC2 A;  4KJZ A;  3Q0V A;  3CUQ C;  4E7K A;  5KNL A;  3E6B A;  4LG0 A;  1JUS A;  1W36 C;  2P8T A;  3RTR A;  3L7W A;  2VBZ A;  3U1D A;  3W6J B;  3S2H J;  2R7X A;  3CTA A;  2QBY B;  1ZH5 A;  3GEZ A;  3AG3 H;  1IZ1 A;  2XRL A;  2OTL I;  3TP3 A;  3MQ0 A;  1NG7 A;  3G1O A;  5LD2 C;  1U9O A;  2ISZ A;  2XGC A;  4G7O F;  2IGK A;  3I4N J;  2CUE A;  2O6G E;  1W5T A;  1IF1 A;  1FLI A;  2R5Y B;  1HST A;  2CQK A;  1X4O A;  2AXL A;  2I10 A;  3KE2 A;  2O8X A;  1GV5 A;  2YX4 A;  4UV8 A;  2Y31 A;  2MD5 A;  3GVA A;  4OMY A;  3F3X A;  2IRF G;  2ICW G;  3RKQ A;  3I54 A;  4BXU A;  1O3T A;  2V9P A;  4KT6 A;  5J1R A;  2L4A A;  1SFU A;  3GLL A;  1P7J A;  3DXJ F;  2J5P A;  3FXR A;  1SMT A;  2MW8 A;  2LTP A;  3LOC A;  2ZNY A;  3MKZ A;  4XSZ F;  2NVY J;  3BG3 A;  1BI3 A;  3S1N J;  4CSW A;  4Y4R A;  1I27 A;  2YSR A;  1ACI A;  1SAX A;  4U0W A;  5FRO A;  4Z2Y A;  4GXO A;  2HPM A;  4IL6 C;  4IHW A;  2E1M C;  1ETX A;  2RGV A;  3WHB A;  4RGU A;  3CO6 C;  5FKL A;  2Z99 A;  4RAY A;  5IOZ A;  1VQ7 I;  3F22 A;  1K83 J;  5LLQ A;  5GAH J;  2HZD A;  3M8E A;  2Y9Y A;  4FHT A;  3K4B A;  2HS5 A;  2VC1 A;  1JKO C;  3CCL I;  2BHZ A;  3JRI A;  4NB5 A;  4B3X A;  5L3D A;  5B3S H;  1V3F A;  2IGM A;  4DBR A;  4IQJ A;  1SMY F;  3SYT A;  1U6G A;  4AM3 A;  2FMY A;  4G94 A;  5HDK A;  4RB3 C;  1S7E A;  2CGP A;  4YIF A;  2JRT A;  4LLN A;  3LA3 A;  3ZQH A;  2CU7 A;  4ENK A;  1HC8 A;  2LSO A;  1D1A A;  2JVG A;  3RIR A;  4I7H A;  3ZQ7 A;  5TIS C;  4PJ0 C;  4J19 A;  4Q48 A;  2V79 A;  5FB2 A;  3LQQ A;  1Z3Y A;  2VBW A;  1ZRF A;  1WJA A;  5DUI A;  2PEX A;  2QZ8 A;  4M3G A;  4U87 A;  4XRF A;  2HTJ A;  3GZ5 A;  1ONV A;  2LY9 A;  1ZG3 A;  2O3F A;  2M8G X;  1FZP B;  1IRZ A;  4MNU A;  2VIX A;  2HOS A;  1R5H A;  3G73 A;  1RPW A;  3CQZ J;  3GFJ A;  1TQI A;  4MEY F;  2DDB A;  5CVV A;  2LOO A;  4YFK F;  1U5T C;  3CF2 A;  3N97 A;  1EH6 A;  3KYC B;  3HDD A;  1QPM A;  1BI1 A;  4L5E A;  2MH9 A;  3ZMZ A;  5ILS A;  5EF6 A;  2EFW A;  2RNJ A;  5LGN A;  3Q9V A;  3F8M A;  3SDG A;  2HQR A;  3FM5 A;  4ZH4 F;  1NK3 P;  3CMM A;  3FXQ A;  5C3E J;  3J7Z I;  3NWS A;  2L7K A;  1QA6 A;  3GF2 A;  4JOM A;  3HOT A;  1ETV A;  1WJC A;  2HXI A;  1MDM B;  3BR1 A;  2RRE A;  3FKI J;  4F7Z A;  4ZYE A;  4MFD A;  3QP5 A;  1X58 A;  2IW5 A;  4FE7 A;  3CCR I;  2ZJ2 A;  5H2F C;  3HJE A;  2QQ8 A;  4IHY A;  1IDZ A;  2O9L A;  2NVT J;  2BW3 B;  2VJJ A;  4KYW A;  2P6S A;  1OPC A;  3ZCO A;  1FWZ A;  3KCC A;  2V7F A;  2DA4 A;  1MBJ A;  3EDP A;  2IT0 A;  5M5Y J;  1FBS A;  2HYG D;  3I71 A;  3A01 B;  4IKF A;  1I50 J;  5EEA A;  1QPI A;  3DBR B;  3GZN B;  1VQ5 I;  3JAM K;  3BR5 A;  1NTC A;  1R1U A;  1ZRC A;  4XN3 A;  4B44 A;  1D8J A;  3FWE A;  2EZL A;  4KN7 X;  3CMA I;  4NDL A;  2R7R A;  2FNP A;  4WXD A;  4BY7 J;  4M9S A;  2EK5 A;  3KET A;  3BT9 A;  1RR7 A;  5IPA A;  4JP0 A;  5D5U B;  2FE3 A;  3IHU A;  3V4G A;  1Z7U A;  4IPA A;  2XV4 S;  4IZZ A;  3JRE A;  4D7N A;  2IPQ X;  3VSK A;  1G3Y A;  1IC8 A;  2KRC A;  4BQQ A;  2XAU A;  4RAG A;  2EFQ A;  2ZXW H;  2HVS A;  5HS9 A;  4M3B A;  1TNT A;  4AIJ A;  1XSX A;  2GXG A;  4HNT A;  4KDP A;  5FRN A;  4B47 A;  2YU9 J;  1FT9 A;  1T0F A;  3CO7 C;  1T8I A;  2STT A;  2A3S A;  2F6C A;  2QUF A;  2FJ1 A;  1P2F A;  4U7D A;  4S0H B;  1K7A A;  2Z5U A;  4EEF G;  3DV8 A;  1T0F C;  1JE8 A;  3S93 A;  5FLM J;  1Z67 A;  3FZV A;  3KP7 A;  2M34 A;  1OLT A;  1ETO A;  4CCO A;  1U78 A;  2R7Z J;  1ERD A;  4KA4 A;  1YO5 C;  2ZME A;  1TQM A;  1MND A;  2OAZ A;  5E1X A;  3DKX A;  4BBS J;  2VQH A;  2ZME C;  4ABZ A;  4Z6Y A;  4PJJ A;  2IXS A;  3HEF A;  1TWA J;  2JSP A;  5K7F A;  3JRD A;  1VQN I;  5EG0 B;  3CLQ A;  1UEL B;  4XQF A;  2DQR A;  3ABK H;  2E19 A;  2XKO A;  4G9Y A;  2LF7 A;  4DZJ A;  4EGZ A;  1OCO H;  3K4K A;  2CUJ A;  1WGX A;  5DTD A;  3GZ6 A;  2VN2 A;  4HDU A;  2ELK A;  2JA6 J;  4N4N B;  1TWC J;  1K61 A;  3OYD A;  4UB8 C;  1D8K A;  4KNY A;  5F08 A;  4PFP A;  5ICG A;  4HX7 A;  1MIJ A;  1X2N A;  3QPT A;  4EMS A;  2HEO A;  2E7W A;  2HNH A;  4XSX F;  3QWL A;  3VOD A;  4CCJ A;  2EPF A;  4Y7N J;  4XLC A;  2NS7 A;  1K78 A;  2FEZ A;  3HKZ N;  2DYR H;  4MQ9 F;  2DFH A;  1I5Z A;  2J5O A;  3IRQ A;  2A5W A;  1R36 A;  2M45 A;  1IN4 A;  3JW4 A;  4KIT B;  1W4M A;  4F93 B;  2MD0 A;  1MBE A;  1QGP A;  2JA2 A;  2VT2 A;  5IP7 J;  1I6X A;  4I0A A;  4RM2 A;  5GAG J;  1E3P A;  4Q47 A;  3S1M J;  3PO3 J;  3MFK A;  1WKM A;  2A68 F;  3C2G A;  1CQT A;  4B09 A;  2KL4 A;  3V7C A;  2XGX A;  5CYV A;  3VFZ A;  2F4O B;  2P5K A;  2BGC A;  1JGS A;  1XSV A;  4RAZ A;  5DCF A;  5J1U A;  4L9V A;  4RM3 A;  2VQG A;  2HFH A;  4XRM A;  4F3Q A;  4A6D A;  5D6F A;  1D3Y A;  5LBQ A;  3HRM A;  1BL0 A;  4UB6 C;  3KZZ A;  1QO0 D;  1USS A;  5TGT A;  4XBF A;  2W00 A;  4EJV A;  2JUG A;  2DJN A;  1WH5 A;  3GTK J;  5ICC A;  3TW7 A;  1YG2 A;  3LSR A;  4HX8 A;  2VT3 A;  3TMO A;  3SEQ A;  1TNS A;  3HPH A;  3WTX C;  2LF8 A;  3UR3 C;  4BQA A;  3R4K A;  2NRA C;  3O8G A;  1GLN A;  4HQM A;  3C7J A;  4HLY A;  1IV8 A;  2NVQ J;  2KDO A;  2YX7 A;  5TJJ A;  2V1U A;  3H35 A;  2CV0 A;  5GPA A;  4CYC A;  3H5R A;  3QOD A;  1TZL A;  4CZC A;  3JRG A;  3W6V A;  2FF4 A;  3RJP A;  5FFZ A;  1VFC A;  3RQI A;  2LY2 A;  4Q5S F;  3QPH A;  2OQR A;  4BU2 A;  2JMW A;  2L0K A;  1S9H A;  2Z16 A;  3MZH A;  4HAM A;  3PNV A;  4XRS A;  3J7A Y;  1J0R A;  1G8X A;  2Y0S N;  1O57 A;  3DU5 A;  2BBY A;  1YYV A;  4HX4 A;  4A93 J;  4B48 A;  4HBL A;  2KT0 A;  5J8F A;  3DLL F;  2ESN A;  2PFB A;  3OOU A;  3V8L A;  2KIU A;  4IX7 A;  3EUA A;  3ABM H;  4HDV A;  4UXN A;  4M9Z A;  3S8P A;  1UG0 A;  3J81 K;  4A3B J;  4I02 A;  1BJZ A;  1IDY A;  4AU7 A;  4CA0 A;  3CCJ I;  1YRN B;  3OYK A;  5DS9 A;  3ISP A;  2XAG A;  4NQW A;  2ACJ A;  3QYB A;  3E5U A;  4ZZL A;  3DTK A;  3K1M A;  1BW5 A;  3V7S A;  3TQN A;  2E7X A;  3VYT B;  1IXC A;  4D5F A;  4CYC B;  3PM1 A;  2F5E A;  3KP3 A;  3L2U A;  5HVQ C;  4PSX A;  1LQ1 A;  4BXF A;  5F27 A;  3RDI A;  1HW5 A;  2BXZ A;  2L5Q A;  1J9I A;  1ZTR A;  3J7Y J;  4I99 C;  5HDG A;  1FBU A;  5DYM A;  2Q1Z B;  2TDX A;  4H4K C;  2WAQ A;  4IHT A;  3L2C A;  4KN4 X;  3WTS C;  1GV2 A;  1D0Y A;  1VQ8 I;  4A5N A;  1T33 A;  5CQG A;  1F1Z A;  4BS9 A;  4HV5 A;  2KIS A;  2FNA A;  4NQW B;  2EQR A;  1LPQ A;  2STW A;  2ZJR F;  1NH3 A;  1RNL A;  3I59 A;  2V9V A;  2XIG A;  2K5C A;  1B59 A;  3CC4 I;  2UZK A;  1YTY A;  1HKQ A;  3BJA A;  2FBI A;  2CV2 A;  2DOF A;  1XD7 A;  2M30 A;  1ZLJ A;  2CO5 A;  2FU4 A;  2IAI A;  2X6W A;  3UNG C;  3I55 I;  2DXI A;  1EF4 A;  3N4M A;  5CQE A;  1RUN A;  5BNG A;  5HNF A;  5FD6 A;  1PYV A;  3ASN H;  5E3M A;  1ZN2 A;  4RB1 A;  1R71 A;  2KMU A;  2M0C A;  1RIO H;  5CKT A;  1NHA A;  1ETK A;  2ECC A;  4ZC3 A;  2LD5 A;  2HGC A;  5HS8 A;  3FKJ A;  1TWH J;  1AKH B;  3KP5 A;  4XM3 A;  2VI6 A;  3S1R J;  2IGN A;  2OA4 A;  2JWT A;  3PIO F;  3CF5 F;  2BY0 A;  2ZO4 A;  1R23 A;  3HRT A;  4I98 B;  2PMU A;  3EUH A;  3HPG A;  3B6A A;  2NOJ B;  2W4S A;  4BJ5 C;  5L3F A;  2FML A;  2ELJ A;  3S1Q J;  3S14 J;  1E0E A;  1ZHF A;  1E17 A;  4BYY A;  2KRF A;  1RI7 A;  1POG A;  3EUH C;  2WAF A;  4I76 A;  1P4W A;  1ZGJ A;  5LRS A;  3U21 A;  3E6M A;  3DEE A;  1BW6 A;  2WA0 A;  2AXT C;  2QQA A;  4LFU A;  1KU3 A;  2NNY A;  4QTR A;  2XSJ C;  3WTU C;  1IGN A;  3L00 A;  2XAF A;  1RKW A;  2ISY A;  3CJN A;  4KMF A;  4GGG A;  3C18 A;  1ZG1 A;  2CS3 A;  5FKN A;  1AWC A;  3F23 A;  2FA5 A;  5J3L A;  4BGD A;  3TO9 A;  3P9I A;  1PUE E;  2DAO A;  2W84 A;  2L9S A;  3A4C A;  3U1K A;  4LIU A;  2HOA A;  1VQK I;  1RET A;  2H94 A;  3KEO A;  1FX7 A;  2KJB A;  1AOY A;  3OOP A;  2Z2S B;  2K4B A;  5JR3 A;  5EGO A;  1KA8 A;  4A3M J;  2OUM A;  1RRJ A;  3S3N A;  2BV6 A;  2XGD A;  4Y52 J;  3QU6 A;  3CDL A;  3RSN A;  1V55 H;  1ETY A;  2DMQ A;  1OYW A;  3O6B B;  4P55 A;  3OL3 A;  4I09 A;  2R7V A;  3BRO A;  2ZXH A;  2V9K A;  1TC3 C;  2BY1 A;  2DJI A;  2XAQ A;  5FRM A;  3DTE A;  2ADU A;  4BAC A;  3RYP A;  1LVK A;  1D0Z A;  1V5F A;  3JRB A;  1KGS A;  2JSC A;  2DMU A;  4JX5 A;  3QPL A;  3HG9 A;  3F9K A;  3HOU J;  2V6C A;  4CO8 A;  1O7L A;  1S7O A;  3LSH A;  4JYK A;  5FKO A;  2ZNZ A;  5IP9 J;  2ID3 A;  2NVU B;  3BTC A;  5CVJ A;  5EZG A;  2LRE A;  3BTI A;  2XGE A;  3CME I;  1LE8 B;  5EGO B;  1FYL A;  4E7L A;  3W2A A;  1B72 A;  1LEA A;  2DDA A;  2EV0 A;  1K4T A;  4NUB A;  1WH7 A;  2QWW A;  5LEJ A;  1ZR2 A;  1W5S A;  2VJ4 A;  4LIT A;  4QWQ A;  1J09 A;  3H9Q A;  3S15 J;  1NG6 A;  3H9G A;  3CJR B;  2DFI A;  4KT5 C;  1ENH A;  4U7B A;  1YS6 A;  2F5C A;  2HU9 A;  3FMQ A;  4E7Z A;  2EJR A;  2A6T A;  3DU6 A;  3A0B C;  4HV6 A;  1IXS B;  4XL9 A;  1MGT A;  4QLC U;  3I56 I;  4QIW N;  1APL C;  4NHJ A;  2EFN A;  1V5G A;  1VTN C;  2VKD A;  3LA7 A;  5F64 A;  1ETQ A;  2L54 A;  1UB9 A;  1XS9 A;  2HI3 A;  3PL8 A;  4D5C A;  2JUC A;  5IT9 Z;  1DGW Y;  2QYO A;  2LFB A;  2AQE A;  4RAF A;  2FUG 2;  5CJ9 A;  5EYR A;  4Y13 A;  3J80 K;  2O8K A;  5M3F J;  2IS2 A;  3P5J A;  4L9T A;  4RBO A;  3GXO A;  3ABU A;  4OWR B;  2A6H F;  1BOB A;  1WJF A;  4E7H A;  5TRD A;  2L02 A;  2PJR B;  4UUS A;  3WTY C;  4XLN F;  4GYI A;  4JBA A;  3R0A A;  5BOX A;  5E8G A;  1EJ9 A;  4ASN A;  4IXA A;  4B4C A;  2BVL A;  3RYR A;  4ZDP A;  3C2H A;  1X3U A;  3PIP F;  3DQV C;  4V2F A;  2K9M A;  2H6C A;  4U0Y A;  3LAP A;  2M87 A;  1J2X A;  4IF4 A;  5K7Z A;  4AYB A;  1K79 A;  1LUJ B;  2RVC A;  3LNQ A;  2XVC A;  1MBG A;  1WJB A;  1AHD P;  2LRD A;  4LK1 F;  3U2R A;  1TWF J;  1T39 A;  4BDZ A;  5KCM A;  3TDU C;  1UG2 A;  3HBL A;  2E1C A;  4HF0 A;  4A2U A;  3L09 A;  1AU7 A;  1OCZ H;  1XB4 A;  3DCF A;  2B63 J;  2RKH A;  3HSE A;  2V4J C;  3SFI A;  4I0B A;  1DPR A;  1BIB A;  5ICF A;  4F55 A;  4U0V A;  3QAH A;  2E34 A;  2PMZ N;  2DO7 A;  4MO7 A;  4XLH A;  5GAE J;  3J7A O;  4A3L J;  3AFH A;  4YEJ A;  5DD4 A;  1FIP A;  4O3M A;  2HYJ A;  3DWL E;  3BG6 A;  3FIW A;  1A5J A;  2R4G A;  5JFR A;  3KYD B;  1Y8R B;  2K3F A;  4XKW A;  2DA1 A;  4RB0 A;  5DCM A;  3CUO A;  1BOA A;  3DFG A;  5B1A H;  5JHU A;  4ON0 A;  1PDN C;  1WQ2 A;  4BH9 A;  3CUQ B;  1W7P A;  2LKS A;  4P5O A;  4Q4Z F;  1AA7 A;  2RN7 A;  4UVA A;  3JCU C;  2C6Y A;  4DNC A;  2JA5 J;  5JLX A;  4LG0 B;  1ZK8 A;  3FBI B;  1X1C A;  2D2W A;  4GO1 A;  2ME0 A;  5GAD J;  2G7U A;  4BY1 J;  3K2A A;  4IRH A;  1WJD A;  2CYY A;  2EIL H;  2B7E A;  3RZO J;  4UVB A;  4W1U A;  2JVH A;  4OU0 A;  3TL4 X;  4EQQ A;  1B1B A;  4M3D A;  2E71 A;  1IRF A;  1YFH A;  3FXO A;  2FQ3 A;  2P81 A;  1O4X A;  2H6B A;  2LC2 A;  1VQM I;  4UUT A;  4Y33 A;  2VOO A;  1FJL A;  1TP4 A;  1Z05 A;  3DKY A;  1S3J A;  3HOZ J;  3FHN A;  3F6V A;  3G3Z A;  3M07 A;  4H0E A;  1D5Y A;  1SC7 A;  3M1C A;  1CF7 A;  4CGZ A;  1PVE A;  2CJJ A;  2P7C B;  2MSY A;  2Y9Z A;  5JLW A;  3ABL H;  2M3A A;  1OYY A;  2R0Q C;  2VC0 A;  5B1B H;  3TO7 A;  3CD6 I;  2DN0 A;  5J4V A;  1VQO I;  4C30 A;  4XLE A;  3ZQG A;  1G59 A;  4BJ6 C;  2I5U A;  1Z91 A;  4E70 A;  2RV8 A;  4L5J A;  2CV1 A;  1A36 A;  5K1Y A;  1G3T A;  3NEU A;  2X9D A;  5LRR A;  3FXL A;  5K7H A;  3KP4 A;  3DEW A;  3HC7 A;  2A07 F;  2AS5 F;  3IP4 B;  2K9S A;  3WGI A;  3EQL F;  3ESW B;  5LGT A;  3GFM A;  2VQC A;  2VPR A;  3QQA A;  1SEU A;  3BR0 A;  3GYH X;  4HF1 A;  4EVI A;  1ZYR F;  2ZSI B;  3MVP A;  4LD5 A;  4C3J J;  2L7Z A;  1JJ6 C;  2A5Y B;  4N9H A;  2K9L A;  1F5T A;  2E5N A;  2Y2Z A;  2BY2 A;  3DPT A;  4A3E J;  4NBQ A;  3DLA A;  4S05 A;  5E1W A;  1SFO J;  2R7U A;  2GA1 A;  1HSJ A;  4MLO A;  4HYE A;  3T8R A;  4GFB A;  3ZN0 A;  5LEK A;  1D1C A;  1F9N A;  2HVQ A;  2LH9 A;  1U5T A;  3ZPL A;  1Y0U A;  1X3Z B;  3HGG A;  3MCZ A;  5JI6 A;  3KEQ A;  1UZC A;  5D5X B;  4E7J A;  3KZY A;  1YIO A;  3G1L A;  1R00 A;  3E1S A;  4HG2 A;  1MW7 A;  1JT0 A;  1WJ5 A;  2PI0 A;  4CIC A;  3CDH A;  1B8I A;  2LLK A;  1VQP I;  1W5C C;  3V7R A;  3P9C A;  4OAZ A;  3WTV C;  1JKP C;  3ZXS A;  1JI8 A;  1LDJ A;  1G6N A;  3KZI C;  2CWE A;  4AD9 A;  1G4D A;  4M71 A;  1RZ4 A;  3JAM Z;  1VF9 A;  1HDD C;  2GZW A;  4E7I A;  4WXC A;  5FLV A;  2ECB A;  1KU9 A;  3ROU A;  3AL0 C;  2X6Y A;  3OL4 A;  2YU3 A;  3KPH A;  3MMY B;  4R1H A;  4A5M A;  5LHI A;  4G6Q A;  2ZSH B;  1MBH A;  4CCM A;  1V4R A;  5D8L B;  2Y0S A;  2VQL A;  2BY3 A;  2CQQ A;  3WOD F;  1IRX A;  3WU1 B;  2A69 F;  2QQ9 A;  4BKX A;  2F48 A;  1F4K A;  2HR3 A;  2VXZ A;  3SZP A;  1ZEL A;  1TLH B;  6PAX A;  5B66 C;  3FM3 A;  3IAM 2;  4M74 A;  4HNU A;  5GPC A;  1BJA A;  3CCQ I;  3PNT A;  3L2Q A;  1PP8 F;  2CQN A;  3PQK A;  1U3E M;  1REP C;  2QSG X;  2NNN A;  4FX0 A;  2E2J J;  2ZXI A;  2GLO A;  3O8H A;  4BEH A;  2FD5 A;  2XC7 A;  1YE9 A;  3ZMS A;  5D4R A;  1T56 A;  3TW6 A;  3OYA A;  2ZB9 A;  1UHS A;  3D5R C;  2GM4 A;  2M7B A;  4E7S A;  4CZZ A;  3VPR A;  3RPQ A;  2ME6 A;  2EBI A;  2W48 A;  4RGX A;  1WPK A;  4M72 A;  1P92 A;  4PJM A;  2VOP A;  5BPI A;  1D1B A;  5BMZ A;  4W97 A;  4P96 A;  2MFZ A;  4AWX B;  1KU7 A;  2VAS A;  2OCC H;  1I1G A;  2PQ8 A;  2KKO A;  4XRS G;  3M7G A;  3FK7 A;  3PFI A;  3HGY A;  3C3W A;  1GHC A;  3REO A;  5A2Q K;  5GP9 A;  3SHF A;  3AAF A;  3S32 A;  3PJR A;  1X4P A;  1FY7 A;  1OCP A;  1Y6I A;  3F8N A;  3K4N A;  3NQO A;  2HPI A;  1OFC X;  3W2V A;  2FRH A;  2IA0 A;  2MLK A;  4BNC A;  4QPO A;  3NAU A;  1SD4 A;  2W25 A;  3TDZ C;  1MSF C;  1YW8 A;  3MEX A;  1EH7 A;  2XF6 A;  1GXP A;  3F8B A;  2TCT A;  2UUZ A;  3TOA A;  1I39 A;  2Q8K A;  4PK4 A;  3ZMV A;  1E3O C;  4D1Q A;  2M1B A;  1MJB A;  2ZXJ A;  1MNM C;  2JPC A;  2KDZ A;  3ZQQ A;  1SD6 A;  3BCA A;  4C3H J;  2ZME B;  5D8K B;  3FHZ A;  4LOC A;  3OWT A;  3CC2 I;  2DPU A;  5HOD A;  2L4M A;  1WI3 A;  1RES A;  2EH3 A;  3I53 A;  2P7V B;  4RGR A;  5DV5 A;  3ECH A;  4XOR A;  2L7F P;  4QSH A;  1TL8 A;  4G12 A;  3HHG A;  5L3B A;  3VOE A;  1ZG5 A;  3LSP A;  4II2 A;  4XON A;  3I4M J;  2DTZ A;  4V19 K;  4ZDO A;  2VON A;  3MWM A;  3CC7 I;  3KP6 A;  2G0E A;  1IN7 A;  2WY7 Q;  2XF5 A;  3IH4 A;  4MTE A;  5E3L A;  2ZC2 A;  1QQI A;  5E3O A;  3R0J A;  3ZQI A;  5KAI C;  4A3F J;  2JA8 J;  1EH8 A;  2EIN H;  2K86 A;  2DTR A;  3RPU D;  4I2O A;  4ETS A;  1UJ8 A;  1XGM A;  3GTL J;  2F5V A;  2R7D A;  4DYR A;  1Z21 A;  3PSF A;  1MNE A;  2DA5 A;  3WG9 A;  3ZR8 X;  3C1D A;  2Y75 A;  4FIS A;  2JT1 A;  2RDP A;  1K78 B;  2VLA A;  3U9G A;  4HPQ A;  2WBM A;  3I4P A;  4A3D J;  2FOW A;  3GLX A;  1I3Q J;  4GRI A;  3LA2 A;  2OBP A;  1QNT A;  1LFU P;  2DI3 A;  4HOB A;  4ZYA A;  5FKM A;  1S8N A;  4HEA 2;  2VE9 A;  3BTL A;  2DYS H;  1SVM A;  2VKE A;  4XLP F;  5F6F A;  3S16 J;  3OY9 A;  3SZT A;  4PGG A;  2X1E A;  3LFK A;  5CLS A;  2DU9 A;  1TWG J;  3FXU A;  2JZY A;  3IC7 A;  4EGY A;  2PX9 A;  3D5S C;  4D9J A;  4PJL A;  4UVC A;  2XRN A;  3E5X A;  2FXA A;  2V1N A;  3J81 Z;  4B43 A;  5FGM A;  1VZ0 A;  4HQE A;  3JTH A;  3DBH B;  1HQC A;  4OIO F;  2VBY A;  4M3E A;  1BR2 A;  2CG4 A;  1QVT A;  3H5N A;  3IH3 A;  3FXM A;  1P9Q C;  4IEJ A;  5M5W J;  3TOB A;  1EV7 A;  3BR3 A;  4Y17 A;  1N78 A;  3HRU A;  5ERI A;  1ULY A;  4QPQ A;  2K7L A;  5GTI C;  1MMG A;  1F43 A;  2IA1 A;  3ERM A;  1P4A A;  3D0S A;  4KMU X;  2JTV A;  3MAJ A;  1YJN I;  2X51 A;  3BY6 A;  4JQF A;  1IAW A;  4BHC A;  4CCL A;  3OIP A;  3G4S I;  2OV7 A;  2W24 A;  2LVS A;  2W7N A;  3PUF A;  5DM6 F;  4XLF A;  3OYG A;  4FE4 A;  2NS8 A;  5L3E A;  2EZH A;  3F72 A;  4YFN F;  1OQY A;  1IN5 A;  1FPQ A;  4M6Y A;  4XR6 A;  5CVU A;  2WV0 A;  3GBG A;  5DM7 F;  3PNY A;  1ZRD A;  1TT0 A;  1R4N B;  3HUG A;  3T8T A;  1P4X A;  1YX5 A;  1BR1 A;  2WB1 A;  2L2O A;  4XLA A;  2FQ4 A;  2HQA A;  4WF2 A;  1KU2 A;  2P5L C;  1GDT A;  9ANT A;  1WSU A;  5LHH A;  2DT5 A;  3CCM I;  2O61 A;  1YHQ I;  2AHQ A;  3BTJ A;  3HZJ A;  5C44 J;  4IO9 F;  2YPR A;  3LL7 A;  1X1B A;  2LDU A;  3S2D J;  4NC8 A;  5EEG A;  1FOY A;  3GX4 X;  2O0Y A;  3ZQL A;  2PG4 A;  1N77 A;  2EWN A;  3CLO A;  1ETW A;  4O6J A;  3G1M A;  3CCU I;  1ON1 A;  4A3G J;  2R7S A;  3IH2 A;  3AG2 H;  1WJE A;  1HKT A;  3VB2 A;  4F52 A;  3M3Y J;  2WAE A;  3V8K A;  3FXK A;  2CUZ A;  4ZYH A;  4ENM A;  1KYW A;  1E3H A;  3O2P E;  1FOX A;  2FSW A;  3L2V A;  3DF8 A;  2VKH A;  3FIS A;  4ANJ A;  2M4G A;  2ZBK A;  4C2M J;  3ECO A;  5KAF C;  2IS6 A;  3B6C A;  4RLQ A;  2JK3 A;  1DPU A;  2OTJ I;  4YRV A;  1MMA A;  4KFC A;  1S5L C;  1H8A C;  3OYF A;  3SZG A;  4E4H A;  4M73 A;  3K10 A;  5J47 A;  2R7F A;  3I59 B;  3WG7 H;  2VJ5 A;  5EDN A;  3K7A J;  3BPV A;  1LNW A;  3IWF A;  5AIQ A;  1T38 A;  2K85 A;  4LIV A;  1LB2 A;  3EET A;  4PZJ A;  4IHS A;  2JA7 J;  3OIO A;  1GUU A;  2QQB A;  3RI4 A;  2DA6 A;  3BC8 A;  1ODD A;  1IUF A;  2A6E F;  1HCR A;  1UHW A;  3K4J A;  2E5Z A;  2Y30 A;  1JUP A;  3B02 A;  1WCM J;  1YX3 A;  1Z3X A;  5IOY A;  1Z6R A;  4JX6 A;  1CGP A;  2K40 A;  2KP6 A;  4CCN A;  1WWX A;  2UV1 A;  4DOZ A;  1DU0 A;  3GCM A;  3E5Q A;  2DFE A;  3SQN A;  3VYS B;  3HHH A;  2LR8 A;  1FOK A;  3SXY A;  3IAS 2;  2GOX B;  2L9N A;  2PMH A;  3ZGK A;  2HYF A;  1R22 A;  2FX0 A;  4OMZ A;  1RKT A;  4IQ4 A;  5BPD A;  5HLH A;  1W0T A;  2DT7 B;  2GQQ A;  2K02 A;  3I5U A;  1FTT A;  4B8X A;  2IVM A;  1I6H J;  2BVM A;  4EJO A;  3CCY A;  4N9I A;  3WE3 A;  1U8B A;  5KHD A;  2ZJQ F;  1OR7 A;  2RAE A;  2XHK A;  4OIP F;  1FTZ A;  3MD2 A;  2R7Q A;  1TTY A;  2IJL A;  4BDY A;  2EB7 A;  3KLN A;  3MZ8 A;  5LGU A;  1OR7 C;  2D45 A;  2VOD A;  4PGH A;  4MQV A;  2QVO A;  3H36 A;  1BN5 A;  4A12 A;  1HLV A;  2V6E A;  4X1E A;  5DUK A;  4EM0 B;  3G2B A;  5FLX K;  2IBD A;  3S3O A;  4YFX F;  1JKQ C;  2AO9 A;  2K9Q A;  4HZF A;  1UMQ A;  1OCR H;  1T98 A;  2Z1D A;  1N25 A;  3GFI A;  2V1D A;  3OYJ A;  2RQQ A;  3CJQ B;  4XKB A;  4NC7 A;  3OS1 A;  1FP1 D;  3WTZ A;  1XGS A;  1PP7 U;  3Q0U A;  2QEX I;  4LJZ F;  4AC0 A;  2OQG A;  2F4I A;  1DGR M;  4DGW B;  2K27 A;  3BG5 A;  1STZ A;  3G71 I;  1M1E B;  4D0P A;  4AVZ A;  1OCT C;  1KON A;  3K6G A;  2DMT A;  1IUY A;  3G6E I;  4N0B A;  3E97 A;  3F8C A;  1IRG A;  3K70 D;  5LFA A;  1F36 A;  3DTI A;  3HOY J;  2QCO A;  1K6Y A;  5E20 A;  5JHF A;  2HWV A;  2BOL A;  2P6T A;  1YJW I;  3BZC A;  2RC4 A;  4HW0 A;  1Z0X A;  1Y39 A;  2WAD A;  2N8G A;  1SD7 A;  3EPZ A;  4ZDL A;  1B72 B;  3H1C A;  1HKS A;  2E1O A;  4FQG A;  1PUF A;  1KZH A;  3K1N A;  4A3K J;  2EA2 A;  1B4A A;  4YG2 F;  4ITV A;  2MC3 A;  1KQ0 A;  3L2R A;  3I64 A;  2JRM A;  2G7H A;  1IV6 A;  1MBK A;  2YR2 A;  3BQZ A;  5K5Q A;  2DW4 A;  5IYD J;  2Q2E A;  1QHH D;  3Q0W A;  3RQ4 A;  3KEY A;  2VJI A;  2P0W A;  3OS2 A;  2CQ7 A;  4IVN A;  4KIG A;  2X4H A;  3TBI A;  1GT0 C;  1FYK A;  4C2U A;  3PFY A;  2VKV A;  3HYI A;  2CUF A;  2WAQ N;  4KIC A;  3KIO A;  1V54 H;  4IHX A;  2XB0 X;  3AKZ A;  1FSH A;  2O03 A;  1A6I A;  4AIK A;  4L5I A;  4MTD A;  1WFX A;  1PJR A;  2LBF A;  2OCE A;  2DMP A;  3VDX A;  1XTA A;  4A6E A;  2QSF X;  2KIM A;  4PCQ A;  2IGO A;  3HOX J;  1FP2 A;  4LB5 A;  4J00 A;  3OV8 A;  3FX3 A;  2UXX A;  3RKW A;  2QBY A;  1IW7 F;  1EKE A;  2KRH A;  3HOW J;  1XDS A;  5HNH A;  3K1P A;  3RPU A;  3UKG A;  3BWG A;  2H1K A;  2OZ6 A;  2PBI A;  4UUS B;  3EYI A;  1FMW A;  3OYL A;  3I0T A;  1O7F A;  3HSF A;  4KIB A;  1O3S A;  4ZJZ A;  2R5Y A;  1HW2 A;  1DU6 A;  5HLI A;  5F1R A;  4WCG A;  1FBQ A;  4O5V A;  4C3I J;  4G7H F;  4L0Y B;  3ML6 A;  2M8E A;  1ZQ3 P;  1B9M A;  2L01 A;  2O7O A;  2MG4 A;  2DK5 A;  4A3C J;  3IKV A;  4GDF A;  1Z77 A;  3OYE A;  3DPU A;  3TGN A;  1JHF A;  1YOV B;  1R1T A;  1HW1 A;  3GTP J;  1Q1V A;  4OOI A;  3LSK A;  2HQ5 A;  3I3L A;  1G3S A;  3LSM A;  2HTS A;  3ULQ B;  4LB6 B;  1SFE A;  2OF7 A;  4HSR A;  4NNJ A;  2YUS A;  1WI9 A;  5BS6 A;  2MGQ A;  2OU2 A;  5GTH C;  2FBH A;  3ZMU A; 
#chains in the Genus database with same CATH homology
 2DPD A;  4HF2 A;  3ZMT A;  3R61 A;  1TW2 A;  4MGR A;  1MZB A;  4FT8 A;  1FNN A;  2HKX A;  1IN8 A;  4P9F A;  5DCM B;  1U2W A;  1MJA A;  2NAZ A;  1W7P B;  1MKM A;  2W85 A;  1Z1D A;  5DEQ A;  3D5L A;  1R5G A;  3JTG A;  3I58 A;  2IP2 A;  1T2K A;  2PN6 A;  2UXN A;  4ZYG A;  3LAJ A;  1BI0 A;  1IN6 A;  1Q1H A;  3R6S A;  2R3S A;  4L0Z B;  2HDC A;  1CF7 B;  1YW9 A;  2COM A;  1XCB A;  5L3C A;  1DUX C;  1TQP A;  2H09 A;  2Z9O A;  3BOQ A;  5K5R A;  1QBJ A;  2MH2 A;  5ILV A;  1XCV A;  3KP2 A;  1G3W A;  4EM1 A;  1OMI A;  2LKP A;  2QLZ A;  3DEU A;  3O3K A;  1MDM A;  1BI2 A;  3M9A A;  5KK1 A;  2WWY A;  2QM3 A;  2GWR A;  5D5W B;  3COA C;  1YLF A;  3HIF A;  5ICE A;  4KIF A;  1JXS A;  1U5T B;  1XGO A;  1JHH A;  4ESF A;  2P4W A;  4CDG A;  3KLO A;  4CXF A;  2Q0O A;  3F21 A;  2XAH A;  3T5X A;  1LDD A;  3E6D A;  3BP8 A;  2DLL A;  5J8C A;  3HTS B;  3GO5 A;  2EV5 A;  2V1X A;  5D4S A;  4OIN F;  4L9J A;  3L9F A;  2GIV A;  3FMR A;  2M5W A;  3BPX A;  5A2Q Z;  2D1V A;  4S04 A;  1ZGA A;  5ED4 A;  3JSP A;  1KYZ A;  1UFM A;  2DQL A;  2PLY A;  5CVI A;  5E18 F;  3DKW A;  1B6A A;  1XSD A;  1O3R A;  4LLG F;  1BBY A;  4U88 A;  4G7Z F;  4K2E A;  4IRG A;  2MA3 A;  3K2Z A;  3W6K B;  3ELK A;  2GAU A;  3K69 A;  3WU0 A;  3VEP A;  4AIH A;  4LGW A;  1E2X A;  2RQP A;  1L0O C;  4EM2 A;  3GFL A;  2ZKZ A;  3V8J A;  1J7K A;  2UWM A;  1I1S A;  3B73 A;  1XN7 A;  5HLG A;  3HRS A;  1ZLK A;  3IRR A;  1XGN A;  1BIA A;  5IT3 A;  1UHM A;  1ZRE A;  5E1Z B;  3DPL C;  2P5V A;  1ZAR A;  4UHT A;  3EYY A;  3NRV A;  2XAJ A;  1SFX A;  4ENN A;  4BAY A;  4EJU A;  4EJW A;  1R1V A;  3WTW C;  1XMA A;  4A0Z A;  1D5V A;  3HSR A;  4DQ2 A;  1K6O A;  4G8X A;  2GA2 A;  3ZN1 A;  1FSE A;  2Y0M A;  1LDK B;  2EFP A;  3K0L A;  4R8H A;  3WGG A;  5H6Q A;  3DP7 A;  2BYV E;  5H6R A;  3HTU A;  2BEO A;  2CW0 F;  4BHB A;  1FYM A;  1GXQ A;  2Z3Y A;  4L18 B;  4OIQ F;  4UUV A;  1LVA A;  1QZZ A;  2WTE A;  2HZT A;  2IA2 A;  3WE2 A;  2W57 A;  1MD0 A;  2FOK A;  1BM9 A;  2OZU A;  5L3G A;  5BQT A;  3GUD A;  4ZYD A;  2XUB A;  2F2E A;  5FO5 A;  2FBK A;  1H9T A;  1SD5 A;  2EFO A;  4RGS A;  1DP7 P;  3GW2 A;  4TV7 A;  4ENJ A;  1R7J A;  1W7P D;  2GXB A;  1WRJ A;  1FC3 A;  4UNO A;  1YW7 A;  3ZMD A;  5JVT A;  2ETH A;  1LJ9 A;  2EA4 A;  4RS8 A;  3BZ6 A;  3TO6 A;  3QOP A;  3T0Y A;  5EEH A;  1OKR A;  2VE8 A;  1H0M A;  3SFZ A;  3S2W A;  5HDN A;  3TKY A;  5J6X A;  1DDN A;  1ZAO A;  1J5Y A;  1YS7 A;  1R58 A;  2QEN A;  4LK0 F;  3GWZ A;  2XKP A;  3HOS A;  2KIF A;  2JPB A;  2NYX A;  2L3D A;  1A04 A;  1UST A;  2BE5 F;  4KUM A;  2HKO A;  2MBF A;  5D5V B;  3LWF A;  4PDK A;  4WK8 F;  2NS0 A;  4BHP A;  1HXD A;  2HOE A;  4Y15 A;  4G6D A;  3FMS A;  5AIP A;  1U8R A;  1TW3 A;  3R60 A;  4R79 A;  2F5F A;  2HQN A;  1LEB A;  3F8F A;  5D6E A;  3P9K A;  2G9W A;  3BDD A;  2PJP A;  1ON2 A;  3H3U A;  1IXR C;  3QU3 A;  1OYI A;  4HLX A;  1O3Q A;  3F6O A;  3IL2 A;  2DK8 A;  1J59 A;  4AVP A;  4YII A;  4WXH A;  1L3L A;  3JSO A;  2VBX A;  4CYD A;  2ELH A;  1HBX G;  3H3Z A;  2KJC A;  2F5D A;  3Q5F A;  3BJ6 A;  4LLL A;  2X0L A;  3QP6 A;  1BC7 C;  3Q9S A;  1Z9C A;  2OD5 A;  3E3V A;  3P7N A;  4HA8 A;  2Y48 A;  3KFW X;  4OIR F;  2ZCW A;  4FX4 A;  4L9N A;  4GYG A;  3QRF F;  1BC8 C;  2LNB A;  5E8I A;  5FLX Z;  3ERE D;  3LST A;  4ZZD A;  4A0X A;  1C0W A;  5FFX A;  1QZY A;  3IKT A;  4M9X A;  2MLG A;  3MZY A;  2CFX A;  1S29 A;  1B9N A;  1MJ9 A;  2ESH A;  5ILU A;  2CSO A;  3RKX A;  4A0Y A;  4IRI A;  5FD5 A;  2EV6 A;  1KQ8 A;  3BJO A;  5KVR A;  4WX9 A;  1XDU A;  3H92 A;  3E6C C;  1GVJ A;  2D1H A;  3ZP5 A;  3WGH A;  4P9U A;  1KQ9 A;  5AON A;  3J80 Z;  4MHG A;  2H27 A;  1S6L A;  2B0L A;  1S7A A;  3K9T A;  4ESJ A;  4MEX F;  4UV9 A;  3M8F A;  3M1E A;  2ZFW A;  2Z33 A;  3RKY A;  1Z6T A;  4RB2 C;  3PQJ A;  1UCR A;  3ABT A;  4EV0 A;  4LMY A;  3FF5 A;  1T6S A;  4IJA A;  1J75 A;  4I01 A;  1YQA A;  4ESB A;  1XMK A;  4JK1 X;  1P6R A;  5HS7 A;  2DBB A;  2XRO A;  2E1N A;  2XAS A;  3IWZ A;  4WWC A;  4EJT A;  5IT9 K;  2A61 A;  4M6X A;  5E17 F;  5DD8 A;  5K5O A;  4GCV A;  3WTT C;  5H20 A;  5CVR A;  5HOO A;  1TBX A;  1RUO A;  5LHG A;  3T1B A;  2K4J A;  3LQR A;  4CHU A;  1H9G A;  3CUQ A;  5DDG A;  2WC2 A;  3CUQ C;  3E6B A;  4LG0 A;  2P8T A;  3RTR A;  3L7W A;  2VBZ A;  3U1D A;  3W6J B;  3CTA A;  2QBY B;  1ZH5 A;  3GEZ A;  1IZ1 A;  3MQ0 A;  2ISZ A;  4G7O F;  2O6G E;  1W5T A;  1IF1 A;  1FLI A;  1HST A;  2CQK A;  2AXL A;  3KE2 A;  2O8X A;  2YX4 A;  4UV8 A;  2MD5 A;  3GVA A;  4OMY A;  3F3X A;  2IRF G;  3I54 A;  4BXU A;  1O3T A;  2L4A A;  1SFU A;  3DXJ F;  2J5P A;  3FXR A;  1SMT A;  2ZNY A;  4XSZ F;  1BI3 A;  1I27 A;  2YSR A;  1SAX A;  4U0W A;  4Z2Y A;  4GXO A;  2RGV A;  3CO6 C;  4RGU A;  2Z99 A;  4RAY A;  3F22 A;  5LLQ A;  3M8E A;  4FHT A;  2HS5 A;  2VC1 A;  4NB5 A;  5L3D A;  1V3F A;  1SMY F;  1U6G A;  2FMY A;  4G94 A;  5HDK A;  4RB3 C;  2CGP A;  4YIF A;  2JRT A;  4LLN A;  3LA3 A;  4ENK A;  2LSO A;  3RIR A;  4I7H A;  3ZQ7 A;  4Q48 A;  2V79 A;  5FB2 A;  3LQQ A;  2VBW A;  1ZRF A;  5DUI A;  2PEX A;  2QZ8 A;  4XRF A;  2HTJ A;  3GZ5 A;  1ONV A;  1ZG3 A;  2O3F A;  1FZP B;  4MNU A;  1R5H A;  3G73 A;  3GFJ A;  1TQI A;  4MEY F;  5CVV A;  4YFK F;  1U5T C;  3N97 A;  1EH6 A;  1QPM A;  1BI1 A;  2MH9 A;  3ZMZ A;  5ILS A;  2EFW A;  2RNJ A;  5LGN A;  3Q9V A;  3F8M A;  2HQR A;  3FM5 A;  4ZH4 F;  3FXQ A;  3GF2 A;  3HOT A;  1MDM B;  4F7Z A;  4ZYE A;  3QP5 A;  2IW5 A;  2ZJ2 A;  4KYW A;  2P6S A;  1OPC A;  1FWZ A;  3KCC A;  3EDP A;  2IT0 A;  1FBS A;  2HYG D;  3I71 A;  3JAM K;  1R1U A;  1ZRC A;  1D8J A;  3FWE A;  4KN7 X;  2FNP A;  4WXD A;  4M9S A;  2EK5 A;  3KET A;  5D5U B;  2FE3 A;  3IHU A;  3V4G A;  1Z7U A;  4IPA A;  2XV4 S;  2IPQ X;  1G3Y A;  2EFQ A;  5HS9 A;  1TNT A;  4AIJ A;  1XSX A;  2GXG A;  4KDP A;  1FT9 A;  1T0F A;  3CO7 C;  2STT A;  2A3S A;  2QUF A;  1P2F A;  4U7D A;  1K7A A;  2Z5U A;  3DV8 A;  1JE8 A;  3FZV A;  3KP7 A;  1U78 A;  4KA4 A;  1YO5 C;  2ZME A;  1TQM A;  2OAZ A;  5E1X A;  2DQR A;  2XKO A;  4G9Y A;  2LF7 A;  4EGZ A;  3GZ6 A;  2VN2 A;  4HDU A;  1D8K A;  4KNY A;  5ICG A;  4HX7 A;  3QPT A;  4EMS A;  2HEO A;  2E7W A;  4XSX F;  3VOD A;  1K78 A;  2FEZ A;  4MQ9 F;  1I5Z A;  3IRQ A;  2J5O A;  1R36 A;  2M45 A;  1IN4 A;  3JW4 A;  1W4M A;  1QGP A;  2VT2 A;  1I6X A;  4I0A A;  4Q47 A;  3MFK A;  1WKM A;  2A68 F;  4B09 A;  3V7C A;  2XGX A;  5CYV A;  3VFZ A;  2P5K A;  2BGC A;  1JGS A;  1XSV A;  4RAZ A;  5DCF A;  4L9V A;  2HFH A;  4A6D A;  5D6F A;  1D3Y A;  5LBQ A;  3HRM A;  3KZZ A;  1QO0 D;  1USS A;  4XBF A;  4EJV A;  5ICC A;  1YG2 A;  4HX8 A;  2VT3 A;  1TNS A;  3WTX C;  2LF8 A;  4BQA A;  3R4K A;  2NRA C;  4HQM A;  3C7J A;  4HLY A;  2YX7 A;  5TJJ A;  2V1U A;  2FF4 A;  3RJP A;  5FFZ A;  4Q5S F;  3QPH A;  2OQR A;  3MZH A;  4HAM A;  1J0R A;  1O57 A;  2BBY A;  1YYV A;  4HX4 A;  4HBL A;  5J8F A;  2ESN A;  2PFB A;  3V8L A;  2KIU A;  4HDV A;  4UXN A;  4M9Z A;  3J81 K;  4I02 A;  3ISP A;  2XAG A;  4NQW A;  2ACJ A;  3E5U A;  4ZZL A;  3K1M A;  3V7S A;  3TQN A;  2E7X A;  1IXC A;  2F5E A;  3KP3 A;  5HVQ C;  1LQ1 A;  3RDI A;  1HW5 A;  1J9I A;  5HDG A;  1FBU A;  5DYM A;  2TDX A;  4IHT A;  3L2C A;  4KN4 X;  3WTS C;  4A5N A;  1F1Z A;  4HV5 A;  2FNA A;  2STW A;  1RNL A;  3I59 A;  2V9V A;  2XIG A;  1B59 A;  2UZK A;  1YTY A;  1HKQ A;  3BJA A;  2FBI A;  1XD7 A;  2M30 A;  1ZLJ A;  2CO5 A;  2FU4 A;  3N4M A;  1RUN A;  5FD6 A;  1ZN2 A;  4RB1 A;  1RIO H;  1NHA A;  2HGC A;  5HS8 A;  3KP5 A;  2OA4 A;  2ZO4 A;  1R23 A;  3HRT A;  4I98 B;  2PMU A;  3EUH A;  5L3F A;  2FML A;  1ZHF A;  1E17 A;  4BYY A;  2KRF A;  1RI7 A;  1P4W A;  1ZGJ A;  5LRS A;  3E6M A;  2QQA A;  4LFU A;  1KU3 A;  2NNY A;  3WTU C;  3L00 A;  2XAF A;  2ISY A;  3CJN A;  4KMF A;  4GGG A;  3C18 A;  1ZG1 A;  1AWC A;  3F23 A;  2FA5 A;  3TO9 A;  3P9I A;  1PUE E;  2DAO A;  2W84 A;  2H94 A;  3KEO A;  1FX7 A;  2KJB A;  1AOY A;  3OOP A;  2K4B A;  5JR3 A;  1KA8 A;  2BV6 A;  3QU6 A;  1OYW A;  3O6B B;  4P55 A;  4I09 A;  3BRO A;  2XAQ A;  2ADU A;  3RYP A;  1KGS A;  2JSC A;  2V6C A;  4CO8 A;  1O7L A;  1S7O A;  2ZNZ A;  5CVJ A;  1FYL A;  1LEA A;  2EV0 A;  2QWW A;  5LEJ A;  1W5S A;  4QWQ A;  2DFI A;  4KT5 C;  4U7B A;  1YS6 A;  2F5C A;  3FMQ A;  2EJR A;  4HV6 A;  1IXS B;  1MGT A;  4QLC U;  4NHJ A;  2EFN A;  1VTN C;  3LA7 A;  5F64 A;  2L54 A;  1UB9 A;  5IT9 Z;  2QYO A;  5CJ9 A;  4Y13 A;  3J80 K;  4L9T A;  3GXO A;  3ABU A;  5TRD A;  2A6H F;  2L02 A;  3WTY C;  4XLN F;  4GYI A;  4JBA A;  3R0A A;  5BOX A;  5E8G A;  4ASN A;  4IXA A;  3RYR A;  1X3U A;  3DQV C;  2H6C A;  4U0Y A;  3LAP A;  2M87 A;  1J2X A;  4IF4 A;  1K79 A;  2RVC A;  2XVC A;  4LK1 F;  3U2R A;  1T39 A;  3TDU C;  2E1C A;  4HF0 A;  4A2U A;  3L09 A;  1XB4 A;  2RKH A;  3HSE A;  4I0B A;  1DPR A;  1BIB A;  5ICF A;  4U0V A;  3QAH A;  2DO7 A;  3J7A O;  5DD4 A;  4O3M A;  5JFR A;  4RB0 A;  5DCM A;  3CUO A;  1BOA A;  3DFG A;  5JHU A;  4ON0 A;  1PDN C;  1WQ2 A;  4BH9 A;  3CUQ B;  1W7P A;  4P5O A;  4Q4Z F;  2RN7 A;  4UVA A;  2C6Y A;  4DNC A;  4LG0 B;  2D2W A;  4GO1 A;  2G7U A;  4IRH A;  2CYY A;  4UVB A;  4OU0 A;  4EQQ A;  1B1B A;  1IRF A;  1YFH A;  2FQ3 A;  2H6B A;  2VOO A;  1Z05 A;  1S3J A;  3F6V A;  3G3Z A;  4H0E A;  1CF7 A;  4CGZ A;  2P7C B;  1OYY A;  2VC0 A;  3TO7 A;  1Z91 A;  4E70 A;  2RV8 A;  4L5J A;  5K1Y A;  1G3T A;  3NEU A;  5LRR A;  3KP4 A;  2A07 F;  2AS5 F;  3WGI A;  3EQL F;  5LGT A;  3GFM A;  3GYH X;  4HF1 A;  4EVI A;  1ZYR F;  4LD5 A;  2A5Y B;  4N9H A;  1F5T A;  3DPT A;  4S05 A;  5E1W A;  2GA1 A;  1HSJ A;  3T8R A;  4HYE A;  3ZN0 A;  5LEK A;  1F9N A;  1U5T A;  3ZPL A;  1Y0U A;  3MCZ A;  5JI6 A;  3KEQ A;  5D5X B;  3KZY A;  1YIO A;  1R00 A;  2PI0 A;  4CIC A;  3CDH A;  3V7R A;  3P9C A;  3WTV C;  1LDJ A;  1G6N A;  2CWE A;  4AD9 A;  1G4D A;  4M71 A;  1RZ4 A;  3JAM Z;  2GZW A;  4WXC A;  1KU9 A;  3ROU A;  2YU3 A;  4R1H A;  4A5M A;  5LHI A;  4G6Q A;  1V4R A;  5D8L B;  3WOD F;  3WU1 B;  2A69 F;  2QQ9 A;  1F4K A;  2HR3 A;  2VXZ A;  3SZP A;  1TLH B;  6PAX A;  3FM3 A;  4M74 A;  1BJA A;  1PP8 F;  3PQK A;  1U3E M;  1REP C;  2NNN A;  4FX0 A;  3ZMS A;  5D4R A;  4CZZ A;  3RPQ A;  4RGX A;  4M72 A;  1P92 A;  2VOP A;  5BPI A;  5BMZ A;  4P96 A;  4AWX B;  1KU7 A;  1I1G A;  2PQ8 A;  2KKO A;  3M7G A;  3PFI A;  3C3W A;  1GHC A;  3REO A;  5A2Q K;  3SHF A;  3AAF A;  1FY7 A;  3F8N A;  3NQO A;  2FRH A;  2IA0 A;  2MLK A;  4BNC A;  1SD4 A;  2W25 A;  3TDZ C;  1YW8 A;  3MEX A;  1EH7 A;  1GXP A;  3F8B A;  3TOA A;  2Q8K A;  3ZMV A;  2M1B A;  1MJB A;  2ZXJ A;  2JPC A;  1SD6 A;  2ZME B;  5D8K B;  3FHZ A;  2DPU A;  2L4M A;  3I53 A;  2P7V B;  4RGR A;  5DV5 A;  3ECH A;  3HHG A;  5L3B A;  3VOE A;  1ZG5 A;  2VON A;  3MWM A;  3KP6 A;  1IN7 A;  4MTE A;  1QQI A;  3R0J A;  1EH8 A;  2K86 A;  2DTR A;  4I2O A;  4ETS A;  1XGM A;  2R7D A;  3WG9 A;  3C1D A;  2Y75 A;  2JT1 A;  2RDP A;  1K78 B;  3U9G A;  3I4P A;  3GLX A;  3LA2 A;  2OBP A;  1QNT A;  2DI3 A;  4HOB A;  1S8N A;  2VE9 A;  4XLP F;  5F6F A;  3SZT A;  4PGG A;  3LFK A;  5CLS A;  2DU9 A;  3FXU A;  2JZY A;  3IC7 A;  4EGY A;  4UVC A;  2XRN A;  3E5X A;  2FXA A;  3J81 Z;  5FGM A;  4HQE A;  3JTH A;  1HQC A;  4OIO F;  2VBY A;  2CG4 A;  3TOB A;  1EV7 A;  4Y17 A;  3HRU A;  5ERI A;  1ULY A;  2K7L A;  2IA1 A;  1P4A A;  3D0S A;  4KMU X;  2JTV A;  3MAJ A;  3BY6 A;  4JQF A;  1IAW A;  4BHC A;  2W24 A;  5L3E A;  3F72 A;  4YFN F;  1IN5 A;  1FPQ A;  4M6Y A;  5CVU A;  2WV0 A;  1ZRD A;  3HUG A;  3T8T A;  1P4X A;  4WF2 A;  1KU2 A;  2P5L C;  1WSU A;  5LHH A;  2DT5 A;  2O61 A;  2YPR A;  2LDU A;  5EEG A;  3GX4 X;  2O0Y A;  2PG4 A;  2EWN A;  3CLO A;  4O6J A;  1ON1 A;  1HKT A;  3VB2 A;  3V8K A;  4ZYH A;  4ENM A;  1KYW A;  3O2P E;  2FSW A;  3DF8 A;  2ZBK A;  3ECO A;  1DPU A;  4KFC A;  4M73 A;  2R7F A;  3I59 B;  3BPV A;  1LNW A;  3IWF A;  5AIQ A;  1T38 A;  1LB2 A;  3EET A;  4PZJ A;  4IHS A;  2QQB A;  3RI4 A;  1ODD A;  2A6E F;  1UHW A;  3B02 A;  1Z6R A;  1CGP A;  1WWX A;  3E5Q A;  3SQN A;  3HHH A;  1FOK A;  3SXY A;  2PMH A;  2HYF A;  1R22 A;  4OMZ A;  5BPD A;  5HLH A;  2GQQ A;  2K02 A;  3I5U A;  4B8X A;  2IVM A;  4EJO A;  4N9I A;  3WE3 A;  1OR7 A;  4OIP F;  2XHK A;  1TTY A;  2IJL A;  2EB7 A;  3KLN A;  5LGU A;  2D45 A;  2VOD A;  4PGH A;  4MQV A;  2QVO A;  1BN5 A;  4A12 A;  5DUK A;  4EM0 B;  5FLX K;  4YFX F;  4HZF A;  1T98 A;  3GFI A;  2V1D A;  1PP7 U;  1FP1 D;  3WTZ A;  1XGS A;  4LJZ F;  2OQG A;  2K27 A;  1STZ A;  4D0P A;  1IUY A;  4N0B A;  3E97 A;  3F8C A;  1IRG A;  5E20 A;  2HWV A;  2P6T A;  2RC4 A;  4HW0 A;  1SD7 A;  1HKS A;  3K1N A;  2EA2 A;  1B4A A;  4YG2 F;  2MC3 A;  1KQ0 A;  3I64 A;  2G7H A;  2YR2 A;  5K5Q A;  2DW4 A;  2Q2E A;  4IVN A;  4KIG A;  2X4H A;  1FYK A;  3HYI A;  4KIC A;  1FSH A;  2O03 A;  4AIK A;  4L5I A;  4MTD A;  4A6E A;  2KIM A;  4PCQ A;  1FP2 A;  4LB5 A;  3OV8 A;  3FX3 A;  2UXX A;  3RKW A;  2QBY A;  1IW7 F;  1XDS A;  3K1P A;  3RPU A;  3BWG A;  2OZ6 A;  2PBI A;  3EYI A;  3I0T A;  1O7F A;  3HSF A;  4KIB A;  1O3S A;  1HW2 A;  5HLI A;  5F1R A;  4WCG A;  1FBQ A;  4O5V A;  4G7H F;  4L0Y B;  3ML6 A;  2M8E A;  1B9M A;  2L01 A;  2DK5 A;  3IKV A;  3TGN A;  1JHF A;  1R1T A;  1HW1 A;  4OOI A;  1G3S A;  2HTS A;  3ULQ B;  4LB6 B;  1SFE A;  1WI9 A;  5BS6 A;  2OU2 A;  2FBH A;  3ZMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...