2FBIA

The crystal structure of transcriptional regulator pa4135
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
136
structure length
136
Chain Sequence
b'RPSLTLTLLQAREAAMSFFRPSLNQHGLTEQQWRVIRILRQQGEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAPKDQRRVYVNLTEKGQQCFVSMSGDMEKNYQRIQERFGEEKLAQLLELLNELKKIKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords probable transcriptional regulator
publication title The crystal structure of transcriptional regulator PA4135
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription
total genus 57
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fbiA00
5JVTA 1V4RA 2O3FA 4N9IA 1KYZA 1F5TA 1XD7A 2O8XA 3KP2A 3ROUA 1DDNA 1R5HA 4MEYF 1FYLA 1QNTA 1WI9A 3TO7A 2FBHA 3GO5A 3J80K 2FBKA 3D5LA 1YFHA 4JK1X 2HDCA 1FSEA 1LEAA 4IXAA 3K1NA 4ZYGA 1FBUA 5FFZA 2IA0A 4M71A 2GZWA 3BP8A 3E6MA 5L3EA 2BBYA 1B9MA 2QQBA 4NB5A 5HVQC 4LG0B 3GXOA 5JFRA 3IHUA 4KN7X 2FNPA 3TDUC 1TNSA 1B59A 1LQ1A 4HLXA 5BPDA 1ON1A 5LHHA 4CHUA 4UVAA 1OKRA 1J5YA 4EQQA 1UCRA 5CYVA 2PJPA 2H6BA 2VBYA 2JPBA 4HLYA 1ZYRF 1PP7U 2FNAA 2Q2EA 1B4AA 5AONA 2VE8A 2P8TA 1E2XA 4LB6B 3ABUA 2DI3A 2H94A 5H20A 5E8IA 4HYEA 2MLGA 1UFMA 2BYVE 2H09A 1XCVA 1FOKA 2O0YA 3FHZA 4XRFA 3LFKA 1ZG5A 1XMKA 1K7AA 4RGXA 4IVNA 2KIFA 3FXUA 3P9IA 5LHIA 2FF4A 1P6RA 2M30A 3E5UA 3KP4A 2HZTA 1XSDA 2IJLA 4RB3C 5K5OA 1LEBA 1YLFA 5LGNA 2FOKA 3VODA 1Z1DA 4U0WA 3L09A 2RC4A 3TQNA 2DK5A 3I64A 4M9SA 3E6DA 1FPQA 4BHPA 3K0LA 4KDPA 4F7ZA 1DPUA 2FXAA 4Z2YA 2JTVA 4A6EA 3DKWA 4UVCA 3QP6A 2DPDA 3KEOA 5ED4A 2NNNA 5D8KB 3FF5A 4G9YA 2VBWA 4UV9A 1GXPA 3V8KA 4AWXB 1HSTA 3E3VA 3HYIA 1BC7C 1G3WA 6PAXA 2OA4A 3NEUA 2ZNZA 4MGRA 2FSWA 1P4WA 2M1BA 5LEJA 1SFEA 3WG9A 2JSCA 1FSHA 1I6XA 2YSRA 4GGGA 3GW2A 2PEXA 3EYYA 1ODDA 3U9GA 4KN4X 2GXBA 1XCBA 3R6SA 4A0XA 4A6DA 5IT9Z 1ZG3A 1USTA 1YQAA 4WF2A 3RKYA 3EUHA 1KU9A 2FQ3A 3O6BB 2QZ8A 3KP6A 3SXYA 4M74A 2P4WA 5TJJA 5CVVA 2A6HF 2Z3YA 3QPTA 2TDXA 1SD4A 4KIFA 1SFXA 4EVIA 3GWZA 1G3YA 1ZH5A 1YS7A 3K1PA 1K79A 3CDHA 1BBYA 1FX7A 5FGMA 3IKVA 2MH9A 3WTYC 1TQIA 4L9TA 1R1VA 1QQIA 1SD7A 2NS0A 2JRTA 1D8JA 3KEQA 1KYWA 3BPXA 3ZP5A 4PGGA 1HBXG 2HWVA 2IPQX 3F6VA 4HX4A 2ZO4A 1R5GA 5D6EA 3JAMK 2Y0MA 2KJCA 2QBYA 3ZMVA 3FMQA 4GO1A 2E1CA 3MWMA 4KNYA 4O3MA 3ZMSA 1XSXA 2RGVA 5LBQA 3KP5A 2PFBA 4IJAA 1XGNA 2OBPA 4YFXF 1PUEE 2QM3A 3MEXA 4I02A 4I98B 1HSJA 3EETA 5DCMA 2VT2A 3H92A 2K4JA 3BWGA 2RNJA 4BYYA 4Q5SF 2XAGA 4RGSA 3CJNA 1SD5A 4KFCA 4HBLA 2PQ8A 2LDUA 5ICEA 2KKOA 2DFIA 2KJBA 1ZRDA 1FYKA 1O3TA 3BOQA 3V8JA 5LGTA 3KP7A 5JR3A 4HX7A 1ZLJA 3CO6C 3FZVA 1I5ZA 3ZMTA 5ILVA 4HDUA 3ECHA 3N4MA 4RAYA 3LQQA 3P9CA 3HOTA 5DDGA 2OQGA 1TNTA 3F72A 3P9KA 1P4XA 1BM9A 3ZMUA 3ERED 4RGRA 1RZ4A 1MJ9A 5DCMB 1FWZA 4CGZA 3GX4X 3WTXC 4WCGA 2Z5UA 2G7UA 3L2CA 1GVJA 2J5OA 4GYIA 3DF8A 5DD4A 4Y17A 4EV0A 3TOAA 2F5EA 1KU2A 2CFXA 4L0YB 5HLIA 5CVJA 1IN6A 2XAQA 2FA5A 2STWA 2GA2A 2HS5A 3RPQA 3CUQC 3KLOA 1ZARA 3IL2A 3F22A 4KIBA 1J7KA 2VONA 3V8LA 2W85A 2LF7A 2HQRA 3C18A 1REPC 5L3BA 4UV8A 3F8MA 1B6AA 4ENKA 2CGPA 4LLLA 2A07F 3SZPA 2EK5A 3WTVC 2DTRA 3K9TA 3DPLC 5D8LB 5A2QK 2CYYA 3BPVA 3PFIA 3KFWX 1F9NA 4UXNA 1P4AA 5EEHA 3GFLA 3H3UA 1F1ZA 4L5IA 3DXJF 3M7GA 3IRRA 4A12A 4BXUA 3TO9A 2DBBA 4R79A 3T8RA 1IXRC 1G3SA 5CVUA 1T6SA 2BGCA 2R3SA 5HS7A 2HGCA 1LB2A 1RUOA 3RDIA 3GFJA 1IRFA 4I09A 4P9UA 2STTA 3DV8A 1BN5A 4Y13A 2HYGD 2EV0A 4M72A 3WTUC 1RI7A 1HW5A 3MZHA 4G94A 4LGWA 4HZFA 2IA2A 4HF1A 4A0YA 1XSVA 3QP5A 3E5QA 2D45A 4D0PA 2NYXA 4PCQA 3WODF 4S04A 3C1DA 3R0AA 3KP3A 1OYWA 1TBXA 1Z6TA 2ZFWA 4UHTA 1D8KA 1ONVA 5F1RA 3F8CA 3BJ6A 4Q4ZF 3I5UA 2ACJA 3N97A 2ZMEA 4L5JA 3J81K 2WWYA 2XV4S 2QQ9A 1P92A 3BJOA 3I4PA 1YW7A 2W84A 5AIPA 2MBFA 5EEGA 2NNYA 4ESFA 4KA4A 4GCVA 2PMHA 5D5XB 2P6TA 1YIOA 3I54A 2O6GE 2P5KA 2HKXA 1HKQA 2GA1A 1RIOH 3ELKA 1IZ1A 1XDUA 4BAYA 4XSXF 3RYPA 2MH2A 2QQAA 4G7ZF 3ISPA 1IF1A 1ZRFA 4XLNF 3LSTA 3LAPA 4HV5A 3T5XA 3V7SA 3QOPA 2VBXA 4EJTA 2DT5A 4OIPF 3E6BA 5L3FA 4MQ9F 4Q48A 3CUQA 3VB2A 3WE3A 2P7CB 2DW4A 3FWEA 1BJAA 3Q9SA 2XIGA 4UNOA 5DUKA 5DCFA 1Q1HA 4ON0A 3QU6A 3C7JA 5ILSA 1BI3A 4ZZDA 1H9GA 2CWEA 3RJPA 4HV6A 1R00A 4EM2A 2LKPA 3VOEA 2RN7A 5CJ9A 5D5UB 4ASNA 3FXRA 4N0BA 1TTYA 5LEKA 3GZ6A 3SFZA 1SMTA 4XBFA 3CUOA 2FRHA 3HSRA 1U3EM 4FT8A 4R8HA 3NRVA 2M45A 5J8CA 2Q0OA 2YR2A 3ZMZA 1ZHFA 5ILUA 2A68F 2ZCWA 2V79A 2YX4A 3KZYA 4LJZF 3CUQB 4IRGA 4OMZA 2DLLA 2BE5F 4AVPA 3F8FA 2GAUA 3CTAA 3H3ZA 1BIAA 1U78A 5HDKA 4XLPF 1I1GA 3F3XA 1U6GA 3AAFA 2V9VA 1XMAA 3F21A 4WXCA 2ZBKA 2FEZA 1HQCA 3T8TA 2ZKZA 2Z99A 4ZYHA 5AIQA 3RI4A 1S3JA 3C3WA 2XKOA 3F6OA 4HAMA 4CICA 3HHHA 3HRSA 3WTZA 5DYMA 2AXLA 1YYVA 2FE3A 2P6SA 2O61A 3K2ZA 1QBJA 2D1VA 2COMA 1JE8A 1QO0D 3KLNA 1LVAA 3E6CC 2EJRA 2K4BA 5E1XA 1G6NA 1PP8F 1O57A 1IRGA 1BI2A 5F64A 3CLOA 3R60A 2ETHA 1Z91A 2VT3A 4CZZA 4FX4A 2QENA 5FLXZ 2YU3A 3IC7A 4I0BA 2HFHA 4G7OF 3J7AO 1XDSA 5E18F 3WE2A 4ESJA 4U7DA 4O6JA 2MC3A 1ZAOA 3QAHA 2M8EA 3GEZA 1LDKB 3ULQB 1NHAA 5LRSA 1WKMA 2F5FA 2IA1A 2FMYA 1CF7A 2L4AA 2PI0A 4HQMA 1AOYA 4IRHA 3HRTA 1J2XA 1XB4A 1G4DA 1KQ9A 4OIOF 3ZQ7A 2R7FA 5CLSA 2QWWA 2EWNA 2YPRA 4A2UA 1OYYA 4G6QA 1LDDA 2V6CA 4IF4A 1KQ0A 4A5MA 1LDJA 4UUVA 1QZZA 2K7LA 1VTNC 1MJAA 1BI0A 3I0TA 2OZ6A 3LAJA 1W7PA 4WXHA 1U5TC 4I2OA 2HQNA 3RKWA 5HLGA 3WGHA 2HTJA 2PN6A 1GXQA 4JBAA 2DAOA 3MFKA 4JQFA 3QRFF 2EFPA 3M8EA 4EM1A 4ENMA 4Q47A 5LHGA 4WX9A 1CF7B 3B02A 2QBYB 3RIRA 4IRIA 2VODA 1I1SA 3FM3A 4HF0A 5L3GA 2FBIA 2XGXA 1SMYF 2Y48A 3DEUA 2OU2A 4L9NA 2IVMA 4PZJA 1RUNA 1L0OC 1DPRA 2P7VB 4M9XA 3IWFA 3CO7C 3L00A 1JHFA 3ZPLA 5HLHA 2KIMA 1UB9A 1W7PB 1O3RA 2F5DA 1FBSA 4M73A 1YW9A 4EM0B 1XGMA 3EYIA 5E8GA 3BDDA 5DD8A 1KA8A 1HXDA 2Z33A 5BOXA 3MQ0A 1GHCA 2CO5A 1JGSA 1O7LA 2EFOA 2DPUA 1ZGJA 5D6FA 2EFQA 2A5YB 3B73A 5FD5A 4KMUX 2ESHA 1YO5C 5CVRA 2VOOA 1QPMA 3R61A 1V3FA 3I58A 1FY7A 4HOBA 4A5NA 4O5VA 2XROA 3QPHA 4BH9A 2VC1A 2XHKA 2WTEA 2XASA 2MD5A 5K5RA 2IT0A 4U0VA 4YIIA 1K6OA 2PBIA 2L54A 2D2WA 1T98A 2Z9OA 2AS5F 4P5OA 3WU0A 3W6JB 2GWRA 3GVAA 2VBZA 4MTEA 4MHGA 3VEPA 2WV0A 1BOAA 1TW2A 4L0ZB 4FX0A 3WTWC 2B0LA 4L9VA 3ZN1A 2XAHA 3DFGA 4I7HA 3V7RA 4PDKA 3SHFA 3ML6A 4HQEA 5KK1A 4OMYA 3F8BA 4ESBA 3KETA 2P5LC 2DO7A 2XVCA 1O3QA 1UHMA 3HUGA 2ZXJA 5FD6A 1LJ9A 2IW5A 2V1XA 2UXNA 3JSPA 2K86A 3WGIA 3KCCA 4M6XA 1YS6A 1HW1A 5IT9K 3M9AA 2HR3A 2GIVA 3TOBA 2P5VA 3BJAA 1R23A 4Y15A 2EFNA 3O3KA 4YFNF 1R58A 3LA2A 1YTYA 4HF2A 3COAC 3GFMA 2UWMA 1XN7A 4RS8A 5E20A 4I01A 1IXCA 1BI1A 1U5TA 3V7CA 1QGPA 1XGOA 1TLHB 3GFIA 4NHJA 1WSUA 3LA7A 2X4HA 1D3YA 1T2KA 2GXGA 2PMUA 2L01A 5KVRA 3S2WA 3ZMDA 2X0LA 4OU0A 4EGZA 4LK0F 4EJVA 3VFZA 1SAXA 2XAJA 1ZG1A 4OIRF 3DQVC 3JAMZ 2K02A 2BEOA 4OINF 3D0SA 2PLYA 2OAZA 4HX8A 1H0MA 4HA8A 3TGNA 1X3UA 5E1ZB 5H6QA 4L18B 4LLNA 4QLCU 1KQ8A 5BQTA 1J59A 3EDPA 2EFWA 5J6XA 4OOIA 4R1HA 1W4MA 1KU7A 5LRRA 1FP2A 2MA3A 5DV5A 4CO8A 3ABTA 3GZ5A 1MDMA 1U5TB 5ICFA 5FB2A 4CYDA 2QUFA 4MTDA 3QU3A 2UZKA 3LWFA 2EA4A 2R7DA 2ZMEB 3ECOA 4PGHA 4S05A 4KYWA 1STZA 5L3CA 1PDNC 3SQNA 2YX7A 3PQJA 1IAWA 4BNCA 3T0YA 2D1HA 3GYHX 2ESNA 4XSZF 3RKXA 3GUDA 3O2PE 2VC0A 1FBQA 1Z7UA 4KIGA 4L9JA 1FC3A 3L7WA 1JXSA 4EJOA 4LD5A 2QVOA 5D4RA 3R4KA 3KZZA 1U8RA 2OD5A 3RYRA 5JHUA 1R22A 2L4MA 4HW0A 5BS6A 1IXSB 1S7AA 3HSEA 4ZZLA 1MDMB 2G9WA 4ZH4F 1FLIA 2E7WA 4U7BA 4QWQA 3IKTA 2KIUA 4K2EA 3DP7A 4N9HA 2BV6A 4LMYA 3I59A 4EJUA 2XUBA 2VE9A 5FO5A 2H27A 2KRFA 4KUMA 3M1EA 4RB0A 1TQMA 4KICA 4KMFA 3OV8A 3JTHA 5E1WA 4WWCA 3WTSC 4MQVA 1W7PD 1YW8A 3V4GA 3MCZA 1EH6A 2A6EF 2RVCA 2EA2A 2GQQA 1OYIA 4IHSA 5DUIA 1R1TA 4OIQF 4UVBA 3E5XA 2IP2A 2J5PA 2Y75A 2C6YA 4P96A 4YG2F 2QYOA 1Z9CA 2EV5A 4EMSA 3MAJA 3OOPA 4G7HF 2F5CA 5D5WB 4IHTA 1E17A 2IRFG 3FM5A 4U88A 5HDNA 2CW0F 1ZLKA 1OMIA 5A2QZ 3I59B 3GF2A 1Z6RA 3BY6A 3HTSB 4I0AA 1T0FA 1S8NA 4P9FA 3G73A 1L3LA 4B09A 1BC8C 1SD6A 2NRAC 3I53A 5K1YA 2HKOA 3WU1B 2HEOA 4MNUA 4U0YA 2OQRA 2HTSA 3MZYA 2CQKA 2JZYA 2FMLA 2FU4A 4ENJA 1S7OA 5J8FA 1A04A 1WWXA 1MD0A 3LA3A 4LB5A 4WK8F 1W5SA 3Q5FA 3HRMA 2WC2A 1W5TA 4LLGF 4HDVA 1B9NA 1EV7A 1T39A 3TO6A 5CVIA 3U2RA 1FNNA 2CG4A 3TKYA 1MJBA 2DQRA 1DP7P 2LF8A 1IN8A 1Y0UA 1FYMA 4AD9A 1J9IA 2JPCA 3J81Z 1ZGAA 1J0RA 3BZ6A 5H6RA 1TQPA 5HDGA 4ZYEA 5L3DA 2ZNYA 3JTGA 1K78A 3J80Z 3JW4A 3JSOA 1UHWA 1OPCA 1R36A 4CDGA 3P7NA 1RNLA 5F6FA 1HKTA 5ERIA 2RV8A 2V1UA 4RGUA 4GYGA 3E97A 1IW7F 2A61A 1IN7A 2JT1A 3DPTA 4DQ2A 2XKPA 3HHGA 4LFUA 2DK8A 1FT9A 2EB7A 1MZBA 5LGUA 3ZN0A 1XGSA 1IN5A 2XRNA 2G7HA 4P55A 3GLXA 4RB1A 2W25A 5JI6A 5BMZA 1LNWA 5ICGA 5FFXA 1FZPB 3HRUA 4LK1F 2O03A 1AWCA 2ISYA 2ELHA 4BQAA 2Q8KA 2E1NA 2MLKA 2E7XA 5K5QA 1K78B 2QLZA 5D5VB 3LQRA 1EH7A 3HIFA 1WRJA 1ZN2A 5DEQA 2W57A 3U1DA 2VOPA 5E17F 2M5WA 5BPIA 3T1BA 2L3DA 2LSOA 4FHTA 3HOSA 2V1DA 3IWZA 3RTRA 1EH8A 2A69F 1ON2A 2EV6A 3HSFA 4GXOA 1R1UA 5ICCA 2PG4A 1U2WA 5D4SA 1SFUA 2W24A 4ZYDA 1QZYA 4M9ZA 3SZTA 1KU3A 3EQLF 3TDZC 1WQ2A 4E70A 5HS8A 3K69A 5LLQA 2DQLA 4NQWA 2ZJ2A 4ENNA 4TV7A 1B1BA 4AIHA 4IPAA 2H6CA 3FMRA 1OR7A 4CXFA 1FP1D 4M6YA 1JHHA 3HTUA 5TRDA 5HS9A 2RDPA 3R0JA 1S29A 1T38A 4YFKF 2DU9A 4G8XA 1ULYA 1R7JA 5IT3A 1H9TA 3WTTC 4AIKA 3I71A 5HOOA 3W6KB 4BHBA 1ZREA 2RKHA 2VXZA 2CSOA 4A0ZA 4DNCA 2RQPA 1I27A 2ISZA 2K27A 4YIFA 1CGPA 3K1MA 3FMSA 3F8NA 2OZUA 3G3ZA 2L02A 3IRQA 1HW2A 1IN4A 3L9FA 1HKSA 3Q9VA 1J75A 2ADUA 4EJWA 1MGTA 2A3SA 1P2FA 4B8XA 1O7FA 4G6DA 1DUXC 4AIJA 1O3SA 1D5VA 2M87A 2LNBA 3REOA 3RPUA 2NAZA 3FX3A 4RB2C 1G3TA 2F2EA 2UXXA 3BROA 2HYFA 4MEXF 1TW3A 1YG2A 2XAFA 4LG0A 1IUYA 4ETSA 4EGYA 1KGSA 1BIBA 1F4KA 5FLXK 3FXQA 4H0EA 1Z05A 3M8FA 3PQKA 2VN2A 3KE2A 1ZRCA 1S6LA 4KT5C 3WGGA 4BHCA 1MKMA 4WXDA 1C0WA 1USSA 3NQOA 4RAZA 3F23A 2HOEA
chains in the Genus database with same CATH superfamily
5JVTA 1V4RA 2O3FA 4N9IA 1YE9A 3EUHC 3Q0UA 1KYZA 1F5TA 1XD7A 2O8XA 4C2UA 3KP2A 2WY7Q 3ROUA 1DDNA 1R5HA 4MEYF 5FLVA 1U0JA 1FYLA 2AHQA 1QNTA 5GAGJ 1WI9A 3TO7A 2FBHA 2L9NA 3GO5A 3J80K 1NG6A 1VQ8I 2FBKA 3D5LA 1WJFA 1YFHA 4JK1X 2R5YB 3BG3A 1FSEA 1LEAA 5C3EJ 2HDCA 2LOOA 4IXAA 3AKZA 3K1NA 4ZYGA 2MYSA 1MH3A 2CQQA 1VFCA 3L2VA 1VQMI 1FBUA 3AG2H 2H1LA 4CSWA 5FFZA 2MD0A 2B63J 2IA0A 2VL8A 3LSIA 3QPSA 4Y3OA 4M71A 2GZWA 3BP8A 3HJEA 5JLWA 3E6MA 5L3EA 5BNGA 3HPHA 2BBYA 4GDFA 1B9MA 2QQBA 4NB5A 5HVQC 4LG0B 3GXOA 1DU0A 2K9MA 4CA0A 1VQ4I 2FQ4A 1NK3P 5JFRA 5IPAA 3IHUA 4KN7X 3CCLI 5C4JJ 2FNPA 1E3OC 3TDUC 3S15J 1TNSA 1B59A 1K4SA 2OCCH 1LQ1A 4HLXA 5BPDA 1ON1A 3D5RC 5LHHA 4CHUA 4UVAA 1OKRA 1J5YA 2W4SA 3TBIA 3UKGA 1P9QC 1UCRA 4EQQA 2HPMA 5CYVA 2B9SA 2JA5J 2PJPA 1ZR4A 2H6BA 2VBYA 2JPBA 2KISA 4RA2A 5EGOA 3H5RA 3D5SC 3OYJA 1W0TA 3CESA 4HLYA 4CZCA 3JRCA 1ZYRF 1PP7U 2FNAA 2Q2EA 1B4AA 1VQOI 1BOBA 1NTCA 1GUUA 3BR1A 2VE8A 5AONA 3OYAA 2P8TA 1IDZA 3OSFA 3BQYA 5B1BH 2V6EA 1E2XA 4LB6B 5K7FA 3ABUA 2DI3A 1K83J 2L9RA 2ZSHB 2H94A 3OR2C 2HQAA 2ZSIB 5H20A 5E8IA 4HYEA 2MLGA 4L5EA 2XPWA 1UFMA 2BYVE 2H09A 1XCVA 4FTHA 1FOKA 2O0YA 3C2HA 4B43A 3FHZA 4XRFA 4BXXJ 3LFKA 1ZG5A 2IGKA 2COBA 1XMKA 1K7AA 3CZ6A 2DMNA 4RGXA 4IVNA 1TP4A 2KIFA 3FXUA 3P9IA 5LHIA 2FF4A 4XKVA 5DTDA 2QSFX 3PL8A 1P6RA 2M30A 3E5UA 3GLLA 2M3AA 3KP4A 2HZTA 1XSDA 3CC7I 2IJLA 3S1QJ 3NWSA 4RB3C 1Y1WJ 1T8IA 4CUGA 5K5OA 3QYEA 1LEBA 1YLFA 3S1RJ 4XR6A 1ETQA 3BTCA 5LGNA 3OIPA 2FOKA 4J19A 3VODA 1Z1DA 2K40A 4Z6YA 1R49A 1WCMJ 4F91B 2WAQN 4U0WA 2DFFA 3L09A 2RC4A 3BCAA 3TQNA 3H0GJ 1N75A 2X6YA 2DK5A 2Q2EB 3I64A 3K7AJ 4M9SA 1X3WB 2DA1A 3E6DA 1FPQA 4BHPA 2K3PA 3ZQCA 3K0LA 4V2FA 4KDPA 4A3KJ 4A3CJ 2XPUA 1JJ6C 2FOWA 4F7ZA 1DPUA 3J7YJ 2VQHA 2XGCA 4C2MJ 3JR9A 3AFHA 1U9NA 2W48A 2FXAA 3KEYA 4Z2YA 3RQIA 2JTVA 3FIWA 3SZGA 4A6EA 5B3SH 2ID3A 3DKWA 4UVCA 1K61A 3QP6A 2DPDA 1G2HA 3VDXA 1UZCA 3RZOJ 3KEOA 5GTIC 2NNNA 2FJ1A 5D8KB 5ED4A 2DFEA 2KFDA 2DA5A 2BY3A 2Y31A 5E3OA 1POGA 3FF5A 4G9YA 2VBWA 2K9QA 4UV9A 5LFAA 1GXPA 3GTQJ 1FTZA 2JSPA 2VUMJ 3V8KA 4AWXB 1HSTA 2BVMA 1I3AA 3E3VA 3HYIA 1BC7C 5F0FA 1G3WA 1Y1VJ 6PAXA 2R93J 2OA4A 3NEUA 3BG7A 3K6GA 2A6TA 2DMQA 2ZNZA 4MGRA 4EEFG 1A5JA 2FSWA 4E7KA 1P4WA 2M1BA 5LEJA 1SFEA 3WG9A 2JSCA 3OYBA 1APLC 1FSHA 2Y9ZA 1I6XA 4E7SA 4XLEA 2YSRA 2ZXIA 4DYCA 4BL0B 4GGGA 3GW2A 2PEXA 3EYYA 2NVTJ 4E4HA 4NC8A 2NS8A 5EEAA 2JVGA 1ODDA 4QPOA 3CMAI 3GMEA 3U9GA 2IS6A 1YJNI 3K70D 4KN4X 4IHXA 2GXBA 1XCBA 3R6SA 4A0XA 5KHDA 1QHGA 3X2QH 4A6DA 4KITB 5IT9Z 3IH3A 1NG7A 1ZG3A 3PUFA 4Y33A 1USTA 2HDWA 2MSYA 1YQAA 4WF2A 2BOLA 2OTLI 3RKYA 2I10A 3EUHA 1KU9A 3HPGA 4DJAA 2FQ3A 3NWTA 2Y30A 2LLKA 3O6BB 3OYFA 3BLYA 2QZ8A 3KP6A 3SXYA 4XRSG 4M74A 2P4WA 2KL4A 5TJJA 2CUEA 4FCYA 5CVVA 5EZGA 4JX6A 4V19K 2A6HF 4BQOA 2Z3YA 3QPTA 3A0BC 2JN6A 1MMSA 5FJ8J 2HXIA 2TDXA 4FISA 1SD4A 1WJBA 4KIFA 1SFXA 4XRSA 4EVIA 3GWZA 3VSLA 1G3YA 1ZH5A 4D1QA 1PUFA 1YS7A 3K1PA 1K79A 3CDHA 3H5NA 3LSRA 4ZDOA 4YELA 1BBYA 2LR8A 1FX7A 5FGMA 2DOEA 1QA6A 4JX4A 1GV2A 1UAAA 2DJIA 3IKVA 1X3ZB 2MH9A 1SVLA 2JJ7A 3WTYC 3PFYA 1TQIA 4L9TA 1R1VA 3FKIJ 2JQ7A 1QQIA 1SD7A 2NS0A 2JRTA 1D8JA 1S5LC 3KEQA 1X4PA 3ZQIA 4UB8C 1KYWA 3PM1A 4IHYA 1Z3XA 3BPXA 3ZP5A 3AL0B 2CQ7A 4PGGA 1HBXG 4J01A 2HWVA 2IPQX 3F6VA 4HX4A 4J00A 4A3JJ 2P0WA 2ZO4A 4A93J 3G4SI 4AYBN 1R5GA 2KHMA 3DEWA 4NC6A 5D6EA 3JAMK 2Y0MA 2KJCA 2BHZA 3ZMVA 2QBYA 2K85A 3FMQA 2HVRA 4GO1A 2X1CA 2E1CA 3MWMA 5JHFA 1A6IA 4KNYA 4O3MA 3ZMSA 1XSXA 1JKRC 2RGVA 5LBQA 5E79C 3KP5A 2PFBA 4IJAA 1XGNA 2OBPA 4YFXF 2EZIA 1PUEE 3H9QA 4F92B 2YU9J 1ZTRA 2V26A 2QM3A 3MEXA 1CQTA 1D1AA 1MNEA 4I02A 1FMWA 4I98B 1HSJA 3EETA 5DCMA 2VT2A 3H92A 1PUFB 2P81A 2VPRA 2K4JA 1V5GA 3BWGA 5EZHA 2RNJA 4BYYA 4DZPA 2H8WA 4CCOA 1NH3A 2XAGA 3WG7H 1IJWC 1W36C 4RGSA 3GTLJ 3CJNA 4Y7NJ 1SD5A 4KFCA 4HBLA 3H36A 3F0CA 3RSNA 2PQ8A 2LDUA 3DU6A 5ICEA 2BXZA 2KKOA 1OCCH 2DFIA 3OYMA 3CJTB 2KJBA 2TCTA 1A6QA 1ZRDA 1FYKA 3U1KA 1O3TA 2OPTA 5GAEJ 5HNHA 3BOQA 1PYVA 3V8JA 5LGTA 3CJQB 3L1PA 2FD5A 3PUBA 3KP7A 5JR3A 4HX7A 1MBKA 1ZLJA 3CO6C 3FZVA 3PIOF 1I5ZA 3CCYA 3ZR8X 3OOUA 3E7LA 3ZMTA 1B8IA 5ILVA 3D1NI 2V1NA 2WA0A 4HDUA 3A0HC 3ECHA 3N4MA 4RAYA 3NARA 2L7MP 3S32A 3LQQA 4NC7A 3P9CA 3HOTA 5DDGA 1W36D 5GP9A 3N05A 2OQGA 5EDNA 3OYIA 4DBQA 1TNTA 4ZTFA 3F72A 3P9KA 4MFDA 1A31A 2DOAA 5E3LA 1P4XA 1BM9A 3ZMUA 2KZGA 3ERED 4RGRA 1JTXA 3PO2J 3BTIA 1RZ4A 3GTOJ 1JUMA 2KZVA 1MJ9A 3S1MJ 5DCMB 1ITYA 1FWZA 4CGZA 2M0MA 3GX4X 3WTXC 4WCGA 1E0EA 2ZC2A 1MBFA 3OWTA 2Z5UA 2G7UA 4XM3A 3L2CA 2CH0A 1IUFA 1I3QJ 1XC5A 3OS0A 4NDLA 4GFBA 1GVJA 2J5OA 4GYIA 3DF8A 1I50J 5DD4A 4Y17A 3JRDA 1JGGA 4EV0A 3TOAA 2R7TA 2VXDA 3HDDA 2F5EA 1LFBA 1KU2A 2CFXA 4L0YB 2LVSA 2K3FA 5HLIA 5CVJA 1IN6A 4IKFA 5EG0B 2XAQA 2B7EA 4E6KG 2FA5A 2STWA 2GA2A 2HS5A 5GPCA 1BJZA 3RPQA 3CUQC 3VYSB 2CUZA 3KLOA 1ZARA 5FRMA 2DMPA 4I99C 4KT6A 2VJIA 2I5UA 3IH2A 3IL2A 3S3NA 2HYJA 4BXFA 1PJRA 2X1DA 3F22A 1SANA 2R5ZA 2Y0SA 3VYTB 4KIBA 2KQRA 2M7BA 5IYDJ 1J7KA 5IYBJ 4DOZA 3V8LA 2VONA 2W85A 2LF7A 2HQRA 3C18A 5H2FC 4X0GA 3CCQI 1REPC 5L3BA 4HNVA 3MD2A 3F8MA 1DGRM 4UV8A 2QEXI 4PSXA 3KYCB 2OTJI 2QSGX 1B6AA 4ENKA 2CGPA 2MABA 4LLLA 3OSGA 3CC2I 2A07F 3L2QA 2BY1A 2AQEA 2WB1A 1Z7LA 3SZPA 2EK5A 2XF6A 3EPZA 2X6XA 2LKXA 3WTVC 2DTRA 3K9TA 4IHVA 5EJCA 2VJ4A 3DPLC 4DBRA 1WH5A 1IRXA 5D8LB 5A2QK 2CYYA 3BPVA 3FDYA 1WHUA 3PFIA 3VYUB 2TRTA 3PO3J 2NVYJ 3KFWX 1F9NA 4UXNA 1P4AA 4XL9A 5EEHA 2KDZA 3GFLA 3H3UA 1F1ZA 3BG5A 2EIKH 4BEHA 4L5IA 4RAGA 3DXJF 2VQCA 3M7GA 3IRRA 4A12A 1D0XA 4BXUA 3TO9A 1LFPA 2DBBA 4HRIA 2O7OA 4R79A 3T8RA 1IXRC 1G3SA 5CVUA 1MBEA 4V2GA 3O8GA 2CFOA 1T6SA 2BGCA 2R5ZB 1XX5A 2R3SA 4X1EA 5HS7A 3BC8A 2HGCA 2LY9A 4BBSJ 1LB2A 2BW3A 2IS2A 1RUOA 2E19A 3RDIA 5J1YA 3M4OJ 2NVXJ 3GFJA 3PSIA 5F1JA 1IRFA 5FKMA 4I09A 4P9UA 3ABKH 2STTA 3DV8A 5DS9A 1BN5A 2WAEA 3C2BA 3P5JA 4RM3A 4Y13A 2ZJRF 2HYGD 3K4BA 2BXYA 1GDTA 2EV0A 3CCMI 1I39A 2L9VA 2Z16A 4M72A 3WTUC 2DMUA 1RI7A 1HW5A 4BJTA 3DKYA 2RNGA 4G94A 4LGWA 3MZHA 4HZFA 1JKQC 2IA2A 4HF1A 4A0YA 4RDUA 3SEQA 5K7HA 1XSVA 3A03A 3QP5A 4XONA 5IP9J 3E5QA 2O9LA 4M3EA 1FEXA 1VI0A 2GLOA 2D45A 4D0PA 2NYXA 4ZDPA 4PCQA 1DQUA 3WODF 3C1DA 3R0AA 4S04A 3KP3A 3JRAA 1OYWA 1TBXA 1T95A 1Z6TA 2ZFWA 4LG3A 4UHTA 3OS1A 1XS9A 2IS4A 1D8KA 1TC3C 3JREA 1R9TJ 1ONVA 1PVEA 5F1RA 2R7RA 2LBFA 3F8CA 4BEHB 3BJ6A 1H89C 4M3BA 4MIMA 1GVDA 4Q4ZF 3I5UA 2ACJA 3HB9A 3N97A 2ZMEA 3ASOH 4L5JA 3J81K 2WWYA 2XV4S 2QQ9A 1P92A 3BJOA 3G71I 1MNMC 2X6WA 3I4PA 3MKZA 2K9NA 1YW7A 2W84A 3FXJA 5AIPA 3DLAA 2MBFA 2BW3B 5EEGA 2NNYA 3OMYA 4ESFA 1BR4A 2M8GX 4KA4A 2L7ZA 1UG0A 2DN0A 3BR6A 4LITA 4GCVA 2MW8A 3RQ4A 1XPXA 5CQEA 2PMHA 3BTLA 5D5XB 2P6TA 1YIOA 2QQ8A 2M0CA 3I54A 2O6GE 2P5KA 1VNDA 3GTJJ 2HKXA 3IH4A 4XK4A 3PSFA 4OWRB 3W3CA 1HKQA 3UR3C 2GA1A 2M2EA 5F04A 3WHBA 2JVHA 1RIOH 3ELKA 3S3MA 3RZDJ 3IP4B 5HLTA 2CW8A 1IZ1A 1XDUA 1FOXA 3L2UA 4AM3A 3TP3A 4BAYA 2VJ5A 4U87A 4XSXF 3RYPA 4JYKA 2MH2A 1QVTA 3HGGA 2JUCA 2QQAA 5K7ZA 3JRFA 4G7ZF 1X1PA 3ISPA 3OYEA 1IF1A 1ZRFA 4D5FA 4XLNF 3CDIA 3LSTA 3HOVJ 3FHNA 3LAPA 1IGNA 3ERMA 4HV5A 3T5XA 3V7SA 1A36A 2LKSA 4DZJA 1YRNA 1P7JA 4BQNA 1MSFC 4E7HA 2R7WA 3QOPA 3VWBA 2L7KA 2EILH 4IQ4A 1XMXA 2VBXA 4EJTA 2ECBA 2DT5A 2JUGA 2PMZA 2PJRA 4XRMA 4OIPF 3FXKA 3E6BA 1R71A 3G1MA 2DA6A 5L3FA 4MQ9F 4Q48A 3CUQA 3VB2A 3HM5A 3WE3A 1T08B 4II3A 2E2IJ 2P7CB 2VPLA 2EZKA 2DW4A 3FWEA 1BJAA 3Q9SA 2XIGA 2DDAA 1TWGJ 2MGQA 4DIQA 4UNOA 2EIJH 5F08A 3PNVA 5DUKA 4YEJA 5DCFA 3OYNA 4BJ6C 1Q1HA 4BUPA 4ON0A 4UUSA 1Y6IA 3QU6A 3C7JA 5ILSA 1BI3A 2HPIA 4ZZDA 1H9GA 2CWEA 3JCUC 1ZK8A 3RJPA 3C2GA 2E2HJ 2OCEA 4HV6A 2F4IA 1V55H 1R00A 4EM2A 2LKPA 4AU7A 3VOEA 2RN7A 1Z3YA 2ZJQF 5CJ9A 5D5UB 1VF9A 4ASNA 3FXRA 4N0BA 1FIPA 1QU3A 1TTYA 5LEKA 3GZ6A 3SFZA 3ONQA 1SMTA 3CMEI 3BTJA 4XBFA 3CUOA 2FRHA 1TWFJ 3HSRA 4XQFA 1U3EM 4FT8A 4R8HA 3NRVA 2O8KA 5M5XJ 2M45A 4FE4A 4M3DA 5J8CA 2Q0OA 2W7NA 5E3MA 3OL4A 2YR2A 3ZMZA 4PK4A 3ZQHA 1N78A 5EGOB 1ZHFA 1WGXA 1QHHD 5ILUA 1RR8C 2GBYA 3ESWB 2A68F 2ZCWA 3L2WA 2V79A 3MN2A 1WH7A 3LSMA 2NVUB 2YX4A 3KZYA 4LJZF 3CUQB 3QYFA 4IRGA 3S16J 2AO9A 2CJJA 4OMZA 3MZ8A 2DLLA 2D5VA 3BZCA 2BE5F 2E71A 4ANJA 3K4MA 4NNJA 1H88C 2MC4A 4AVPA 3F8FA 1JTYA 2I8DA 2DODA 1YI2I 3OYDA 3DCFA 4IX7A 2UUZA 5HNFA 4Y4RA 4EATA 4UUSB 4ZYAA 2GAUA 3CTAA 3H3ZA 3LSHA 1BIAA 1LKXA 4F52A 5J4VA 1U78A 1HDPA 2NOGA 5HDKA 1HF0A 3S93A 1BW5A 1OISA 2OUMA 4XLPF 1I1GA 3F3XA 3G6EI 2IEKA 1U6GA 3AAFA 4PJ0C 2V9VA 4HNTA 1XMAA 1TT0A 2DXIA 3F21A 4XNFA 1TWCJ 2ZBKA 4WXCA 2E1MC 2FEZA 1U8BA 1F36A 1HQCA 3T8TA 1OCTC 3PIPF 2ZKZA 2Z99A 4W1UA 4ZYHA 5AIQA 3W2AA 3RI4A 3KYLA 4F55A 4BE2A 1S3JA 3RKQA 3C3WA 1WFXA 3A2KA 2XKOA 2XF7A 2H8RA 2XGDA 3F6OA 4HAMA 3S1NJ 1UHSA 2VKHA 4CICA 4RMNA 1F43A 3HHHA 3HRSA 5KAIC 4QPQA 2OJED 1H8AC 3DU5A 2JMWA 3WTZA 4F93B 2WBMA 1SFOJ 3FK7A 5DYMA 2AXLA 1N25A 2OF7A 1YYVA 3TL4X 4IO9F 1ENHA 2FE3A 2IXSA 2LK2A 2QSHX 1ZGWA 2P6SA 2Y0SN 2CQNA 4B3XA 2O61A 3I55I 3K2ZA 3B6AA 1QBJA 1YIJI 2D1VA 2COMA 1JKPC 3CDLA 3ZCOA 1I6HJ 1JE8A 1QO0D 2Z2SB 1A35A 5FKLA 3FXOA 3KLNA 1LVAA 3E6CC 1AA7A 2EJRA 3LL7A 4XN0A 5IY5H 1LPQA 2K4BA 5E1XA 1GT0C 1G6NA 1PP8F 1O57A 5J4YA 2VB6A 1IRGA 1BI2A 2WB1N 3CLOA 5F64A 9ANTA 3DPUA 1MMGA 3R60A 2ETHA 1NK2P 3HOWJ 4C30A 1Z91A 2VT3A 2RREA 3QOEA 4CZZA 2QGUA 4FX4A 2H1KA 1FJLA 2QENA 5FLXZ 1IC8A 2YU3A 3IC7A 3QQAA 4I0BA 5B5EC 2XSJC 3HC7A 2LD5A 2HFHA 4G7OF 3J7AO 1XDSA 2LY2A 3WE2A 5E18F 1BA5A 4ESJA 3OS2A 4U7DA 4O6JA 2MC3A 2JA7J 2ELKA 1ZAOA 4BY7J 3QAHA 2VIXA 4D5CA 2M8EA 3GEZA 1LDKB 3ULQB 2M9HA 1NHAA 5LRSA 1WKMA 2F5FA 2IA1A 2KRHA 1JUSA 2DA2A 2FMYA 1CF7A 2L4AA 3ZQFA 2PI0A 1Y8RB 2DA3A 1T33A 3MKLA 4HQMA 1AOYA 4IRHA 3ZXSA 2VLAA 2VI6A 1J2XA 3HRTA 3OYCA 4DGWB 2ZFUA 1XB4A 1G4DA 1KQ9A 3AG1H 4OIOF 1K6YA 3ZQ7A 2R7FA 5CLSA 2QCOA 3GTMJ 1RR7A 2QWWA 2L5QA 1MMDA 1U9OA 3BZKA 2EWNA 2XRLA 2YPRA 3CF5F 4A2UA 1OYYA 1OCOH 5M3MJ 1XG1A 4G6QA 1LDDA 2V6CA 4IF4A 1KQ0A 2GOXB 4A5MA 1OLTA 1LDJA 2VQLA 1R5ID 4UUVA 1V5EA 1QZZA 2K7LA 4PFOA 4BE0A 1VTNC 1KZHA 3CCUI 3FXMA 1KONA 4XOTA 1MJAA 2R7QA 1BI0A 3I0TA 3DTKA 2OZ6A 1P7IA 2OV7A 3LAJA 1W7PA 1W0UA 4WXHA 1U5TC 4PSWA 2EIMH 4I2OA 2HQNA 2M4GA 3RKWA 5HLGA 3WGHA 2HTJA 2JA6J 1MIJA 2PN6A 2XSDC 4CCJA 1GXQA 4JBAA 2DAOA 2E60A 3MFKA 4JQFA 3QRFF 2EFPA 1YOVB 3M8EA 3PNTA 2OC6A 4CYCA 4EM1A 3I56I 4Q47A 4QSHA 4E7LA 4ENMA 1ORKA 2YUSA 1WJCA 2JRMA 5LHGA 2ZMEC 2JA8J 4WX9A 2F5VA 1OQYA 3QODA 1IV6A 4LIUA 4XLCA 1Q1VA 4KISA 1CF7B 3B02A 2QBYB 3GBGA 2DMTA 3RIRA 4IRIA 2VODA 5CKTA 1I1SA 5HODA 1G8XA 2IGNA 2Z1DA 1OFCX 4W97A 3FM3A 4HF0A 5L3GA 2FBIA 3LNQA 2XGXA 1SMYF 2Y48A 3DEUA 2OU2A 2HNHA 4L9NA 2IVMA 4C3HJ 2DCEA 1MSEC 2DT6A 3A01A 4PZJA 1RUNA 1VQ7I 1FIAA 1L0OC 3GTPJ 1EA3A 3S2HJ 1WZ2A 1DPRA 1ZELA 2P7VB 4M9XA 3IWFA 2A05A 3CO7C 3L00A 3MVPA 2L7FP 1JHFA 5DM6F 2F6CA 3ZPLA 2LY1A 4A3LJ 5HLHA 2KIMA 1Y0NA 2F4MB 3LSKA 1UB9A 1W7PB 4ZJZA 4A69C 3TP0A 3WHCA 2F5DA 1FBSA 4M73A 4DYRA 1WI3A 1LVKA 3JRGA 1O3RA 1YW9A 1IRZA 4EM0B 1XGMA 3BT9A 3EYIA 2IGMA 3BDDA 5DD8A 2LTPA 5E8GA 4KJZA 3HOXJ 1KA8A 1HXDA 4B4CA 2Z33A 3DEEA 4C9YA 3H1CA 3OYLA 3MQ0A 5BOXA 2DTZA 4CYCB 2KLOA 1GHCA 1ETWA 5LD2C 1EKEA 3FK6A 2CO5A 4YIRX 5J1UA 1B8IB 1JGSA 3O8HA 1O7LA 2EFOA 2DPUA 1ZGJA 3DLLF 3HZJA 5D6FA 3CF2A 2EFQA 2PMZN 2A5YB 3MKYB 1S7EA 3B73A 1XTAA 2HI3A 4KMUX 5FD5A 2ESHA 5M3FJ 2ZB9A 1YO5C 3H3VK 5CVRA 2VOOA 1QPMA 2XDVA 3R61A 4JX5A 1V3FA 3I58A 1FY7A 4HOBA 4A5NA 2ID6A 4O5VA 3QPHA 4BH9A 2XROA 3A01B 5E3NA 2VC1A 2EZLA 2XHKA 1LE8A 1TT5B 1MH4A 2WTEA 2XASA 1AHDP 4XKBA 2MD5A 3TEDA 5FKOA 4XORA 3TMOA 5K5RA 2IT0A 4U0VA 4YIIA 2F4OB 1K6OA 2PBIA 3CP8A 2L54A 4LIVA 2D2WA 1T98A 2Z9OA 4E7IA 2AS5F 4P5OA 3WU0A 2E1OA 4BBRJ 3W6JB 2GWRA 3GVAA 1ZQ3P 2VBZA 2LG4A 1WJEA 2KPMA 4MTEA 4MHGA 4H4KC 3VEPA 1S72I 2WV0A 1BOAA 2E1MB 3A02A 4X6AJ 1TW2A 4A3DJ 3QWLA 4RAFA 4L0ZB 4FX0A 3WTWC 2R7XA 2B0LA 3TW7A 4L9VA 3ZN1A 4BKXA 2XAHA 3DFGA 1G59A 3PNYA 3K4NA 4M3GA 1IO2A 4I7HA 3V7RA 4PDKA 3KIOA 3SHFA 3ML6A 3H0DA 4HQEA 5KK1A 2VKEA 2E36A 2JWTA 4OMYA 5IOZA 3F8BA 1X2NA 4ESBA 4OAYA 3KETA 2P5LC 4IOCF 2CS3A 2DO7A 2XVCA 3U21A 4BGDA 1O3QA 1UHMA 3HUGA 2ELJA 2ZXJA 5FD6A 1LJ9A 3CCJI 2IW5A 2LP0A 2V1XA 2UXNA 3JSPA 1HC8A 2K86A 3WGIA 4I6ZA 2E5ZA 3KCCA 2X85A 4HEA2 1VQ6I 1X1DA 3HOYJ 4M6XA 3J7AY 1YS6A 1HW1A 5IT9K 4A3BJ 3BR2A 3M9AA 2HR3A 2GIVA 1LE8B 3TOBA 5FRNA 2P5VA 3BJAA 3FISA 4AVZA 1R23A 1TWHJ 3DTEA 5TISC 4IEJA 4Y15A 2RAEA 2EFNA 5J3LA 3O3KA 5J1RA 4YFNF 1R58A 1UG2A 3LA2A 1YTYA 4HF2A 3COAC 3GTKJ 2CU7A 4QIWN 3GFMA 2V7FA 4BDYA 2UWMA 1MBJA 1XN7A 4RS8A 2R92J 2NVQJ 1ETXA 1JT6A 5E20A 2EBIA 2HXOA 3W2WA 1JUPA 3LOCA 4I01A 2KMUA 2JK3A 1IXCA 3E1SA 1BI1A 1U5TA 3V7CA 3PJRA 2E2JJ 1FTTA 4RM2A 4AC0A 1QGPA 2ZXHA 2K9LA 1XGOA 1TLHB 3GFIA 4NHJA 1WSUA 3LA7A 2CUFA 2X4HA 3BQZA 3HKZA 1OJLA 4ZTJA 1D3YA 4ITVA 1GLNA 4BACA 1T2KA 2GXGA 4B3AA 2PMUA 3AG4H 2L01A 1UMQA 5KVRA 5F27A 3S2WA 3ZMDA 5C4XJ 2X0LA 2HOSA 3HUGB 4OU0A 4EGZA 4LK0F 4EJVA 1JT0A 3VFZA 2CW7A 4PJJA 1SAXA 2XAJA 1ZG1A 4AUXA 4OIRF 4C3IJ 3DQVC 3JAMZ 2K5CA 2WADA 2K02A 2BEOA 4OINF 3D0SA 5GADJ 1Z67A 2ZXWH 2PLYA 2OAZA 4HX8A 3CCEI 1H0MA 4HA8A 3EUKL 3Q3SA 4A3GJ 3TGNA 1SC7A 1X3UA 5E1ZB 4RLFA 5H6QA 1VQ9I 4L18B 4LLNA 1YJWI 4QLCU 1KQ8A 5BQTA 1WJDA 1J59A 3EDPA 2EFWA 2ME0A 3M1CA 5J6XA 4OOIA 2LYCA 3TW6A 4R1HA 4DYQA 1MBHA 1W4MA 4IOAF 1HOMA 1KU7A 5LRRA 1SAUA 1FP2A 3V42A 2MA3A 5DV5A 1LFUP 2W1OA 3HGYA 1JJ8C 4CO8A 3ABTA 3GZ5A 2ME6A 2X9DA 4FASD 1MDMA 1U5TB 2IGOA 5ICFA 5FB2A 4CYDA 1VQKI 2AXTC 4PJNA 5KAFC 2BY2A 2QUFA 4MTDA 1N77A 2XC7A 3QU3A 2UZKA 1AKHA 3LWFA 4UB6C 2EA4A 4M6VA 3IAM2 2DA4A 5CQGA 1YX5A 2LBFB 3S17J 2KP6A 3M8JA 2R7DA 3H9JA 2ZMEB 2FUG2 3ECOA 4HSTA 4PGHA 3FKJA 3F9KA 1X1CA 4S05A 2F48A 4KYWA 1STZA 2HDDA 5L3CA 1PDNC 3SQNA 4HSRA 4F3QA 2YX7A 3ABLH 3PQJA 2HU9A 1M1EB 2CRGA 1IAWA 4BNCA 1WPKA 1E3PA 3T0YA 2D1HA 1X2MA 1ERDA 3GYHX 2ESNA 4A3IJ 4XSZF 1DP3A 3RKXA 3GUDA 1X4OA 3H5AA 3O2PE 3S14J 2VC0A 1FBQA 1Z7UA 2HVQA 5IYCJ 1ETOA 3KX2A 4XICA 2LC2A 3OYHA 4KIGA 4L9JA 1FC3A 4ZDLA 3L7WA 1VQ5I 4RBOA 2Q1ZB 1JXSA 4EJOA 2QKLB 4LD5A 3SDBA 4MFEA 2QVOA 5D4RA 3R4KA 2DT7B 3KZZA 3FBNB 1U8RA 5B66C 3K4JA 1MW7A 1QPIA 2OD5A 1IV8A 3RYRA 1R22A 2L4MA 4HW0A 1SFKA 5JHUA 5BS6A 1IXSB 1S7AA 2ICWG 3HSEA 4B1RA 4ZZLA 4E7ZA 3ZQLA 1MDMB 1T56A 2G9WA 1FOYA 4ZH4F 2NOJB 1MMNA 1FLIA 2E7WA 3K4KA 1VQPI 1TL8A 4G6TB 4U7BA 4QWQA 4A3EJ 3IKTA 2KIUA 1UELB 2YS9A 4K2EA 1AKHB 1E3HA 1YRNB 3DP7A 4N9HA 2LRDA 2VJJA 1AU7A 1VQNI 2BV6A 4LMYA 3I59A 2MG4A 4EJUA 2XUBA 2PJRB 2VE9A 5FO5A 2H27A 2KRFA 4UUTA 3DBHB 3OIOA 3VYRB 3HOZJ 4KUMA 3M1EA 4RB0A 4XLFA 2WV1A 1TQMA 4KICA 4KMFA 2DJNA 3H9GA 2R4GA 3S8PA 3OV8A 2XPVA 2VKDA 3JTHA 5E1WA 4WWCA 2XB0X 3ZQQA 3WTSC 4MQVA 1W7PD 1YW8A 4ZC3A 2XF5A 1D1BA 3V4GA 3CJRB 3MCZA 1EH6A 3L2RA 4DW6A 3A4CA 3HOUJ 2EQRA 2CUJA 2A6EF 2RVCA 4XIDA 2XGEA 2EA2A 2GQQA 1OYIA 4IHSA 1RRJA 5DUIA 1R1TA 2Y69H 4OIQF 1W1WE 1YHQI 4UVBA 1YITI 1X1AA 3DTIA 4IZZA 3E5XA 2IP2A 1RC9A 2J5PA 2Y75A 3BR0A 4P96A 2C6YA 4YG2F 2QYOA 1Z9CA 2EV5A 1VQLI 1B72A 1R4NB 2E5NA 3K70C 2HOAA 4EMSA 5FKNA 3GCMA 1D0ZA 1RETA 3HEFA 2G0EA 3MAJA 3OOPA 4G7HF 2F5CA 5D5WB 4IHTA 3ASNH 4PJLA 1OCZH 1E17A 2QF7A 2IRFG 2KRCA 3FM5A 4A3FJ 4FQGA 3SFIA 2IAIA 1SVMA 3ZGKA 3LSPA 3M07A 4U88A 3DBLB 1R4MB 5HDNA 2CW0F 1ZLKA 1OMIA 5A2QZ 1YJ9I 2EINH 4PJMA 3I59B 4D7MA 3GF2A 2DYSH 1Z77A 3KPHA 5F0CA 1Z6RA 2CMPA 3BY6A 3VSKA 5EF6A 3HTSB 5M5WJ 4N4NB 4B47A 4I0AA 4D7NA 2R7SA 2L0KA 2LFBA 1T0FA 1SVOA 5FKKA 5C44J 3CMYA 1OCPA 1HLVA 3G2BA 1S8NA 4P9FA 3G73A 1L3LA 4XKCA 4B09A 1BC8C 4G12A 1ACIA 1SD6A 5JVGF 1OR7C 2NRAC 3S3OA 2W00A 2ZJPF 2L2OA 2DYRH 3DBRB 3B6CA 3I53A 3LMMA 5K1YA 2HKOA 4BS9A 3MMYB 3WU1B 2K9SA 2V9PA 2HEOA 4MNUA 1FMVA 1WVRA 4U0YA 3SJMA 3CC4I 3ABMH 3A1YA 2OQRA 2HTSA 3MZYA 4Q5SF 1HA8A 5IOYA 2CQKA 2E35A 2JZYA 2FMLA 2FU4A 3SDGA 1S7OA 4ENJA 5J8FA 1B72B 1A04A 2GOMA 2DDBA 1D0YA 1MD0A 1WWXA 2X1EA 3I9V2 3IUOA 3LA3A 1MNDA 4LB5A 4AIDA 4JP0A 3W6VA 4WK8F 2Y2ZA 1W5SA 2XB5A 3Q5FA 3OL3A 4D9JA 2DFHA 3OYGA 4XLAA 3H35A 3GZNB 3HRMA 2WC2A 1W5TA 4I76A 4LLGF 4HDVA 1B9NA 1FOWA 1EV7A 1MBGA 1T39A 3TO6A 3LFUA 5CVIA 3U2RA 1FNNA 2CG4A 2HVSA 3TKYA 1MJBA 2VASA 2DQRA 1DP7P 4OAZA 2LF8A 3FBIB 1IN8A 4IL6C 4MO7A 2R0QC 2R7ZJ 1Y0UA 1BR2A 4XKWA 1FYMA 1BL0A 4AD9A 1J9IA 2JPCA 3J81Z 1O4XA 1ZGAA 1J0RA 1IDYA 3BZ6A 4P1WA 5GPAA 3Q0VA 1JKOC 4A3MJ 2X48A 1TQPA 1TWAJ 3CLQA 5H6RA 2FX0A 5HDGA 1D1CA 2NXNB 4RLQA 3HBLA 4ZYEA 1Z21A 5L3DA 1ETVA 3CCSI 2ZNYA 3JTGA 1K78A 1Y8QB 3Q0WA 2HZDA 4CCNA 3G1LA 5J47A 3J80Z 3JW4A 3JSOA 1UHWA 2GXAA 5J40A 1OPCA 1X58A 5GAHJ 4YRVA 1R36A 4CDGA 3QPLA 4HG2A 3OIQA 3UNGC 3P7NA 1RNLA 5F6FA 4Y52J 2E34A 1HKTA 5ERIA 2RV8A 2V1UA 4RGUA 2N8GA 4GYGA 3E97A 1IW7F 3JRBA 2A61A 4XMYA 1IN7A 2JT1A 3DPTA 4DQ2A 1WJ5A 2XKPA 3HHGA 4LFUA 2DK8A 2R7VA 1FT9A 2EB7A 1MZBA 5LGUA 3ZN0A 2EZHA 1XGSA 1ZR2A 1IN5A 2XRNA 2IS1A 3HKZN 4E7JA 2G7HA 4UY8I 4B44A 4P55A 3GLXA 4RB1A 2W25A 3M3YJ 5JI6A 5BMZA 1LNWA 4HNUA 2DOFA 2V9KA 3RCOA 4PFPA 5ICGA 5FFXA 1FZPB 3FXLA 3HRUA 4LK1F 1WJAA 2O03A 1AWCA 2XAUA 2ISYA 2ELHA 2WAQA 2Q8KA 4BQAA 2E1NA 4CCKA 4CCLA 2LREA 3ZOBA 5EG0A 3I4NJ 3RPUD 2MLKA 2BY0A 2E7XA 5K5QA 1K78B 2QLZA 5D5VB 3LQRA 1EH7A 3HIFA 1WRJA 1ZN2A 5DEQA 2W57A 4BY1J 3U1DA 2O5RA 2VOPA 1ETKA 5E17F 2M5WA 5BPIA 3BG9A 3T1BA 2PX9A 2L3DA 5EYRA 3CD6I 2LSOA 1YX3A 2M34A 4FHTA 3IAS2 3HOSA 2V1DA 3IWZA 3RTRA 1HDDC 1EH8A 2A69F 1ON2A 2RQQA 5DM7F 2EV6A 4XN3A 1TZLA 3HSFA 4GXOA 1R1UA 1Y56A 3OYKA 5ICCA 2PG4A 1RESA 1OCRH 1U2WA 5D4SA 1SFUA 5B1AH 2W24A 3OY9A 4B48A 1J09A 4ZYDA 1QZYA 4GRIA 2W82A 3HL2A 4M9ZA 3SZTA 1KU3A 3EQLF 3LSJA 1WQ2A 3TDZC 4E70A 2WAFA 4C3JJ 3I3LA 5HS8A 1R6RA 1BW6A 3JRIA 1Y39A 3K69A 4BDZA 1Z0XA 5LLQA 2R7UA 1VZ0A 1EF4A 2DQLA 4NQWA 3HG9A 2ZJ2A 4ENNA 2CQXA 1S9HA 4TV7A 2KDOA 3I4MJ 1B1BA 2JA2A 3GTGJ 1DU6A 4AIHA 4IPAA 3S2DJ 3KZIC 2H6CA 4QTRA 3FMRA 1K4TA 1OR7A 5IP7J 5KNLA 2CV0A 3E0JB 1RKWA 2CV1A 4II2A 4CXFA 1FP1D 4M6YA 1QRYA 1JHHA 3MKWB 1IG7A 2ECCA 3HTUA 5TRDA 1X1BA 3CP2A 5HS9A 2UV1A 2RDPA 3R0JA 1S29A 1T38A 4JOMA 2KT0A 3DWLE 3QYBA 1EJ9A 4FE7A 3G1OA 4YFKF 2DU9A 4PUSA 4FETA 4G8XA 3LSGA 1ULYA 2HOTA 1QVUA 3BCBA 1R7JA 1V5FA 5IT3A 1H9TA 3WTTC 3VPRA 4AIKA 1MMAA 3I71A 2AQFA 5M5YJ 5HOOA 4MLOA 3EUAA 4ABZA 3W6KB 3KYDB 1ZKGA 4BHBA 1ZREA 2RKHA 1GV5A 2VXZA 2CSOA 4A0ZA 4CH7A 3NAUA 1LUJB 2A5WA 5FROA 4BQQA 2DA7A 4DNCA 2RQPA 2MFZA 1I27A 2ISZA 1UJ8A 1D5YA 2K27A 2VQGA 4YIFA 1CGPA 4NQWB 3K1MA 2HQ5A 3FMSA 3OR1C 3F8NA 1DGWY 2OZUA 3G3ZA 2L02A 4BU2A 3IRQA 2QA4I 1HW2A 1RPWA 2LH9A 1X19A 2NS7A 4AYBA 2Y9YA 3W2VA 4NBQA 3HXLA 1RKTA 1W5CC 1IN4A 3L9FA 2EPFA 2BVLA 4XLHA 3SEZA 1HKSA 3DKXA 5F0HA 2X6OA 2CV2A 2GM4A 3Q9VA 5JLXA 4IQJA 1V54H 1J75A 2ADUA 1QZEA 5CPRB 5KCMA 4EJWA 1MGTA 4IHWA 4HPQA 2A3SA 1P2FA 4B8XA 5IP6A 1HCRA 3CCRI 3JRHA 1BR1A 1O7FA 4G6DA 1DUXC 4AIJA 1O3SA 1JI8A 1D5VA 2VKVA 3IV5A 2WY8Q 4BE1A 4NUBA 3K4LA 3CCVI 2X51A 2M87A 2R5YA 2L9SA 3AG3H 2LNBA 3REOA 3RPUA 2BZTA 2NAZA 4CCMA 3FX3A 4RB2C 1G3TA 2F2EA 2UXXA 3BR3A 3BROA 2HYFA 4MEXF 1TW3A 1YG2A 2XAFA 1ETYA 4XOPA 4LG0A 5FLMJ 1IUYA 4ETSA 3K2AA 3J7ZI 4EGYA 2GIZA 5TGTA 5GTHC 3K10A 1KGSA 1BIBA 1F4KA 1T0FC 3CMMA 3BG6A 3FXQA 4H0EA 5FLXK 1Z05A 3M8FA 3PQKA 3ZQGA 2IBDA 2VN2A 3KE2A 3WU2C 1ZRCA 4S0HB 1S6LA 2BHYA 4KT5C 3ZRGA 3WGGA 4BHCA 4BJ5C 1SEUA 1MKMA 3K4CA 2EH3A 4LOCA 4WXDA 2M7AA 3AL0C 2M4KA 2KIQA 3SYTA 4C2TA 1C0WA 2R7OA 4N4OB 2QKMB 1USSA 2LMDA 3NQOA 4RAZA 3F23A 2HOEA 3CQZJ 3BR5A 2V4JC 4M3FA
chains in the Genus database with same CATH topology
5JVTA 1V4RA 2O3FA 4N9IA 1KYZA 1F5TA 1XD7A 2O8XA 3KP2A 3ROUA 1DDNA 1R5HA 4MEYF 1FYLA 1QNTA 1WI9A 3TO7A 2FBHA 3GO5A 3J80K 2FBKA 3D5LA 1YFHA 4JK1X 2HDCA 1FSEA 1LEAA 4IXAA 3K1NA 4ZYGA 1FBUA 5FFZA 2IA0A 4M71A 2GZWA 3BP8A 3E6MA 5L3EA 2BBYA 1B9MA 2QQBA 4NB5A 5HVQC 4LG0B 3GXOA 5JFRA 3IHUA 4KN7X 2FNPA 3TDUC 1TNSA 1B59A 1LQ1A 4HLXA 5BPDA 1ON1A 5LHHA 4CHUA 4UVAA 1OKRA 1J5YA 4EQQA 1UCRA 5CYVA 2PJPA 2H6BA 2VBYA 2JPBA 4HLYA 1ZYRF 1PP7U 2FNAA 2Q2EA 1B4AA 5AONA 2VE8A 2P8TA 1E2XA 4LB6B 3ABUA 2DI3A 2H94A 5H20A 5E8IA 4HYEA 2MLGA 1UFMA 2BYVE 2H09A 1XCVA 1FOKA 2O0YA 3FHZA 4XRFA 3LFKA 1ZG5A 1XMKA 1K7AA 4RGXA 4IVNA 2KIFA 3FXUA 3P9IA 5LHIA 2FF4A 1P6RA 2M30A 3E5UA 3KP4A 2HZTA 1XSDA 2IJLA 4RB3C 5K5OA 1LEBA 1YLFA 5LGNA 2FOKA 3VODA 1Z1DA 4U0WA 3L09A 2RC4A 3TQNA 2DK5A 3I64A 4M9SA 3E6DA 1FPQA 4BHPA 3K0LA 4KDPA 4F7ZA 1DPUA 2FXAA 4Z2YA 2JTVA 4A6EA 3DKWA 4UVCA 3QP6A 2DPDA 3KEOA 5ED4A 2NNNA 5D8KB 3FF5A 4G9YA 2VBWA 4UV9A 1GXPA 3V8KA 4AWXB 1HSTA 3E3VA 3HYIA 1BC7C 1G3WA 6PAXA 2OA4A 3NEUA 2ZNZA 4MGRA 2FSWA 1P4WA 2M1BA 5LEJA 1SFEA 3WG9A 2JSCA 1FSHA 1I6XA 2YSRA 4GGGA 3GW2A 2PEXA 3EYYA 1ODDA 3U9GA 4KN4X 2GXBA 1XCBA 3R6SA 4A0XA 4A6DA 5IT9Z 1ZG3A 1USTA 1YQAA 4WF2A 3RKYA 3EUHA 1KU9A 2FQ3A 3O6BB 2QZ8A 3KP6A 3SXYA 4M74A 2P4WA 5TJJA 5CVVA 2A6HF 2Z3YA 3QPTA 2TDXA 1SD4A 4KIFA 1SFXA 4EVIA 3GWZA 1G3YA 1ZH5A 1YS7A 3K1PA 1K79A 3CDHA 1BBYA 1FX7A 5FGMA 3IKVA 2MH9A 3WTYC 1TQIA 4L9TA 1R1VA 1QQIA 1SD7A 2NS0A 2JRTA 1D8JA 3KEQA 1KYWA 3BPXA 3ZP5A 4PGGA 1HBXG 2HWVA 2IPQX 3F6VA 4HX4A 2ZO4A 1R5GA 5D6EA 3JAMK 2Y0MA 2KJCA 2QBYA 3ZMVA 3FMQA 4GO1A 2E1CA 3MWMA 4KNYA 4O3MA 3ZMSA 1XSXA 2RGVA 5LBQA 3KP5A 2PFBA 4IJAA 1XGNA 2OBPA 4YFXF 1PUEE 2QM3A 3MEXA 4I02A 4I98B 1HSJA 3EETA 5DCMA 2VT2A 3H92A 2K4JA 3BWGA 2RNJA 4BYYA 4Q5SF 2XAGA 4RGSA 3CJNA 1SD5A 4KFCA 4HBLA 2PQ8A 2LDUA 5ICEA 2KKOA 2DFIA 2KJBA 1ZRDA 1FYKA 1O3TA 3BOQA 3V8JA 5LGTA 3KP7A 5JR3A 4HX7A 1ZLJA 3CO6C 3FZVA 1I5ZA 3ZMTA 5ILVA 4HDUA 3ECHA 3N4MA 4RAYA 3LQQA 3P9CA 3HOTA 5DDGA 2OQGA 1TNTA 3F72A 3P9KA 1P4XA 1BM9A 3ZMUA 3ERED 4RGRA 1RZ4A 1MJ9A 5DCMB 1FWZA 4CGZA 3GX4X 3WTXC 4WCGA 2Z5UA 2G7UA 3L2CA 1GVJA 2J5OA 4GYIA 3DF8A 5DD4A 4Y17A 4EV0A 3TOAA 2F5EA 1KU2A 2CFXA 4L0YB 5HLIA 5CVJA 1IN6A 2XAQA 2FA5A 2STWA 2GA2A 2HS5A 3RPQA 3CUQC 3KLOA 1ZARA 3IL2A 3F22A 4KIBA 1J7KA 2VONA 3V8LA 2W85A 2LF7A 2HQRA 3C18A 1REPC 5L3BA 4UV8A 3F8MA 1B6AA 4ENKA 2CGPA 4LLLA 2A07F 3SZPA 2EK5A 3WTVC 2DTRA 3K9TA 3DPLC 5D8LB 5A2QK 2CYYA 3BPVA 3PFIA 3KFWX 1F9NA 4UXNA 1P4AA 5EEHA 3GFLA 3H3UA 1F1ZA 4L5IA 3DXJF 3M7GA 3IRRA 4A12A 4BXUA 3TO9A 2DBBA 4R79A 3T8RA 1IXRC 1G3SA 5CVUA 1T6SA 2BGCA 2R3SA 5HS7A 2HGCA 1LB2A 1RUOA 3RDIA 3GFJA 1IRFA 4I09A 4P9UA 2STTA 3DV8A 1BN5A 4Y13A 2HYGD 2EV0A 4M72A 3WTUC 1RI7A 1HW5A 3MZHA 4G94A 4LGWA 4HZFA 2IA2A 4HF1A 4A0YA 1XSVA 3QP5A 3E5QA 2D45A 4D0PA 2NYXA 4PCQA 3WODF 4S04A 3C1DA 3R0AA 3KP3A 1OYWA 1TBXA 1Z6TA 2ZFWA 4UHTA 1D8KA 1ONVA 5F1RA 3F8CA 3BJ6A 4Q4ZF 3I5UA 2ACJA 3N97A 2ZMEA 4L5JA 3J81K 2WWYA 2XV4S 2QQ9A 1P92A 3BJOA 3I4PA 1YW7A 2W84A 5AIPA 2MBFA 5EEGA 2NNYA 4ESFA 4KA4A 4GCVA 2PMHA 5D5XB 2P6TA 1YIOA 3I54A 2O6GE 2P5KA 2HKXA 1HKQA 2GA1A 1RIOH 3ELKA 1IZ1A 1XDUA 4BAYA 4XSXF 3RYPA 2MH2A 2QQAA 4G7ZF 3ISPA 1IF1A 1ZRFA 4XLNF 3LSTA 3LAPA 4HV5A 3T5XA 3V7SA 3QOPA 2VBXA 4EJTA 2DT5A 4OIPF 3E6BA 5L3FA 4MQ9F 4Q48A 3CUQA 3VB2A 3WE3A 2P7CB 2DW4A 3FWEA 1BJAA 3Q9SA 2XIGA 4UNOA 5DUKA 5DCFA 1Q1HA 4ON0A 3QU6A 3C7JA 5ILSA 1BI3A 4ZZDA 1H9GA 2CWEA 3RJPA 4HV6A 1R00A 4EM2A 2LKPA 3VOEA 2RN7A 5CJ9A 5D5UB 4ASNA 3FXRA 4N0BA 1TTYA 5LEKA 3GZ6A 3SFZA 1SMTA 4XBFA 3CUOA 2FRHA 3HSRA 1U3EM 4FT8A 4R8HA 3NRVA 2M45A 5J8CA 2Q0OA 2YR2A 3ZMZA 1ZHFA 5ILUA 2A68F 2ZCWA 2V79A 2YX4A 3KZYA 4LJZF 3CUQB 4IRGA 4OMZA 2DLLA 2BE5F 4AVPA 3F8FA 2GAUA 3CTAA 3H3ZA 1BIAA 1U78A 5HDKA 4XLPF 1I1GA 3F3XA 1U6GA 3AAFA 2V9VA 1XMAA 3F21A 4WXCA 2ZBKA 2FEZA 1HQCA 3T8TA 2ZKZA 2Z99A 4ZYHA 5AIQA 3RI4A 1S3JA 3C3WA 2XKOA 3F6OA 4HAMA 4CICA 3HHHA 3HRSA 3WTZA 5DYMA 2AXLA 1YYVA 2FE3A 2P6SA 2O61A 3K2ZA 1QBJA 2D1VA 2COMA 1JE8A 1QO0D 3KLNA 1LVAA 3E6CC 2EJRA 2K4BA 5E1XA 1G6NA 1PP8F 1O57A 1IRGA 1BI2A 5F64A 3CLOA 3R60A 2ETHA 1Z91A 2VT3A 4CZZA 4FX4A 2QENA 5FLXZ 2YU3A 3IC7A 4I0BA 2HFHA 4G7OF 3J7AO 1XDSA 5E18F 3WE2A 4ESJA 4U7DA 4O6JA 2MC3A 1ZAOA 3QAHA 2M8EA 3GEZA 1LDKB 3ULQB 1NHAA 5LRSA 1WKMA 2F5FA 2IA1A 2FMYA 1CF7A 2L4AA 2PI0A 4HQMA 1AOYA 4IRHA 3HRTA 1J2XA 1XB4A 1G4DA 1KQ9A 4OIOF 3ZQ7A 2R7FA 5CLSA 2QWWA 2EWNA 2YPRA 4A2UA 1OYYA 4G6QA 1LDDA 2V6CA 4IF4A 1KQ0A 4A5MA 1LDJA 4UUVA 1QZZA 2K7LA 1VTNC 1MJAA 1BI0A 3I0TA 2OZ6A 3LAJA 1W7PA 4WXHA 1U5TC 4I2OA 2HQNA 3RKWA 5HLGA 3WGHA 2HTJA 2PN6A 1GXQA 4JBAA 2DAOA 3MFKA 4JQFA 3QRFF 2EFPA 3M8EA 4EM1A 4ENMA 4Q47A 5LHGA 4WX9A 1CF7B 3B02A 2QBYB 3RIRA 4IRIA 2VODA 1I1SA 3FM3A 4HF0A 5L3GA 2FBIA 2XGXA 1SMYF 2Y48A 3DEUA 2OU2A 4L9NA 2IVMA 4PZJA 1RUNA 1L0OC 1DPRA 2P7VB 4M9XA 3IWFA 3CO7C 3L00A 1JHFA 3ZPLA 5HLHA 2KIMA 1UB9A 1W7PB 1O3RA 2F5DA 1FBSA 4M73A 1YW9A 4EM0B 1XGMA 3EYIA 5E8GA 3BDDA 5DD8A 1KA8A 1HXDA 2Z33A 5BOXA 3MQ0A 1GHCA 2CO5A 1JGSA 1O7LA 2EFOA 2DPUA 1ZGJA 5D6FA 2EFQA 2A5YB 3B73A 5FD5A 4KMUX 2ESHA 1YO5C 5CVRA 2VOOA 1QPMA 3R61A 1V3FA 3I58A 1FY7A 4HOBA 4A5NA 4O5VA 2XROA 3QPHA 4BH9A 2VC1A 2XHKA 2WTEA 2XASA 2MD5A 5K5RA 2IT0A 4U0VA 4YIIA 1K6OA 2PBIA 2L54A 2D2WA 1T98A 2Z9OA 2AS5F 4P5OA 3WU0A 3W6JB 2GWRA 3GVAA 2VBZA 4MTEA 4MHGA 3VEPA 2WV0A 1BOAA 1TW2A 4L0ZB 4FX0A 3WTWC 2B0LA 4L9VA 3ZN1A 2XAHA 3DFGA 4I7HA 3V7RA 4PDKA 3SHFA 3ML6A 4HQEA 5KK1A 4OMYA 3F8BA 4ESBA 3KETA 2P5LC 2DO7A 2XVCA 1O3QA 1UHMA 3HUGA 2ZXJA 5FD6A 1LJ9A 2IW5A 2V1XA 2UXNA 3JSPA 2K86A 3WGIA 3KCCA 4M6XA 1YS6A 1HW1A 5IT9K 3M9AA 2HR3A 2GIVA 3TOBA 2P5VA 3BJAA 1R23A 4Y15A 2EFNA 3O3KA 4YFNF 1R58A 3LA2A 1YTYA 4HF2A 3COAC 3GFMA 2UWMA 1XN7A 4RS8A 5E20A 4I01A 1IXCA 1BI1A 1U5TA 3V7CA 1QGPA 1XGOA 1TLHB 3GFIA 4NHJA 1WSUA 3LA7A 2X4HA 1D3YA 1T2KA 2GXGA 2PMUA 2L01A 5KVRA 3S2WA 3ZMDA 2X0LA 4OU0A 4EGZA 4LK0F 4EJVA 3VFZA 1SAXA 2XAJA 1ZG1A 4OIRF 3DQVC 3JAMZ 2K02A 2BEOA 4OINF 3D0SA 2PLYA 2OAZA 4HX8A 1H0MA 4HA8A 3TGNA 1X3UA 5E1ZB 5H6QA 4L18B 4LLNA 4QLCU 1KQ8A 5BQTA 1J59A 3EDPA 2EFWA 5J6XA 4OOIA 4R1HA 1W4MA 1KU7A 5LRRA 1FP2A 2MA3A 5DV5A 4CO8A 3ABTA 3GZ5A 1MDMA 1U5TB 5ICFA 5FB2A 4CYDA 2QUFA 4MTDA 3QU3A 2UZKA 3LWFA 2EA4A 2R7DA 2ZMEB 3ECOA 4PGHA 4S05A 4KYWA 1STZA 5L3CA 1PDNC 3SQNA 2YX7A 3PQJA 1IAWA 4BNCA 3T0YA 2D1HA 3GYHX 2ESNA 4XSZF 3RKXA 3GUDA 3O2PE 2VC0A 1FBQA 1Z7UA 4KIGA 4L9JA 1FC3A 3L7WA 1JXSA 4EJOA 4LD5A 2QVOA 5D4RA 3R4KA 3KZZA 1U8RA 2OD5A 3RYRA 5JHUA 1R22A 2L4MA 4HW0A 5BS6A 1IXSB 1S7AA 3HSEA 4ZZLA 1MDMB 2G9WA 4ZH4F 1FLIA 2E7WA 4U7BA 4QWQA 3IKTA 2KIUA 4K2EA 3DP7A 4N9HA 2BV6A 4LMYA 3I59A 4EJUA 2XUBA 2VE9A 5FO5A 2H27A 2KRFA 4KUMA 3M1EA 4RB0A 1TQMA 4KICA 4KMFA 3OV8A 3JTHA 5E1WA 4WWCA 3WTSC 4MQVA 1W7PD 1YW8A 3V4GA 3MCZA 1EH6A 2A6EF 2RVCA 2EA2A 2GQQA 1OYIA 4IHSA 5DUIA 1R1TA 4OIQF 4UVBA 3E5XA 2IP2A 2J5PA 2Y75A 2C6YA 4P96A 4YG2F 2QYOA 1Z9CA 2EV5A 4EMSA 3MAJA 3OOPA 4G7HF 2F5CA 5D5WB 4IHTA 1E17A 2IRFG 3FM5A 4U88A 5HDNA 2CW0F 1ZLKA 1OMIA 5A2QZ 3I59B 3GF2A 1Z6RA 3BY6A 3HTSB 4I0AA 1T0FA 1S8NA 4P9FA 3G73A 1L3LA 4B09A 1BC8C 1SD6A 2NRAC 3I53A 5K1YA 2HKOA 3WU1B 2HEOA 4MNUA 4U0YA 2OQRA 2HTSA 3MZYA 2CQKA 2JZYA 2FMLA 2FU4A 4ENJA 1S7OA 5J8FA 1A04A 1WWXA 1MD0A 3LA3A 4LB5A 4WK8F 1W5SA 3Q5FA 3HRMA 2WC2A 1W5TA 4LLGF 4HDVA 1B9NA 1EV7A 1T39A 3TO6A 5CVIA 3U2RA 1FNNA 2CG4A 3TKYA 1MJBA 2DQRA 1DP7P 2LF8A 1IN8A 1Y0UA 1FYMA 4AD9A 1J9IA 2JPCA 3J81Z 1ZGAA 1J0RA 3BZ6A 5H6RA 1TQPA 5HDGA 4ZYEA 5L3DA 2ZNYA 3JTGA 1K78A 3J80Z 3JW4A 3JSOA 1UHWA 1OPCA 1R36A 4CDGA 3P7NA 1RNLA 5F6FA 1HKTA 5ERIA 2RV8A 2V1UA 4RGUA 4GYGA 3E97A 1IW7F 2A61A 1IN7A 2JT1A 3DPTA 4DQ2A 2XKPA 3HHGA 4LFUA 2DK8A 1FT9A 2EB7A 1MZBA 5LGUA 3ZN0A 1XGSA 1IN5A 2XRNA 2G7HA 4P55A 3GLXA 4RB1A 2W25A 5JI6A 5BMZA 1LNWA 5ICGA 5FFXA 1FZPB 3HRUA 4LK1F 2O03A 1AWCA 2ISYA 2ELHA 4BQAA 2Q8KA 2E1NA 2MLKA 2E7XA 5K5QA 1K78B 2QLZA 5D5VB 3LQRA 1EH7A 3HIFA 1WRJA 1ZN2A 5DEQA 2W57A 3U1DA 2VOPA 5E17F 2M5WA 5BPIA 3T1BA 2L3DA 2LSOA 4FHTA 3HOSA 2V1DA 3IWZA 3RTRA 1EH8A 2A69F 1ON2A 2EV6A 3HSFA 4GXOA 1R1UA 5ICCA 2PG4A 1U2WA 5D4SA 1SFUA 2W24A 4ZYDA 1QZYA 4M9ZA 3SZTA 1KU3A 3EQLF 3TDZC 1WQ2A 4E70A 5HS8A 3K69A 5LLQA 2DQLA 4NQWA 2ZJ2A 4ENNA 4TV7A 1B1BA 4AIHA 4IPAA 2H6CA 3FMRA 1OR7A 4CXFA 1FP1D 4M6YA 1JHHA 3HTUA 5TRDA 5HS9A 2RDPA 3R0JA 1S29A 1T38A 4YFKF 2DU9A 4G8XA 1ULYA 1R7JA 5IT3A 1H9TA 3WTTC 4AIKA 3I71A 5HOOA 3W6KB 4BHBA 1ZREA 2RKHA 2VXZA 2CSOA 4A0ZA 4DNCA 2RQPA 1I27A 2ISZA 2K27A 4YIFA 1CGPA 3K1MA 3FMSA 3F8NA 2OZUA 3G3ZA 2L02A 3IRQA 1HW2A 1IN4A 3L9FA 1HKSA 3Q9VA 1J75A 2ADUA 4EJWA 1MGTA 2A3SA 1P2FA 4B8XA 1O7FA 4G6DA 1DUXC 4AIJA 1O3SA 1D5VA 2M87A 2LNBA 3REOA 3RPUA 2NAZA 3FX3A 4RB2C 1G3TA 2F2EA 2UXXA 3BROA 2HYFA 4MEXF 1TW3A 1YG2A 2XAFA 4LG0A 1IUYA 4ETSA 4EGYA 1KGSA 1BIBA 1F4KA 5FLXK 3FXQA 4H0EA 1Z05A 3M8FA 3PQKA 2VN2A 3KE2A 1ZRCA 1S6LA 4KT5C 3WGGA 4BHCA 1MKMA 4WXDA 1C0WA 1USSA 3NQOA 4RAZA 3F23A 2HOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JVT A;  1V4R A;  2O3F A;  4N9I A;  1KYZ A;  1F5T A;  1XD7 A;  2O8X A;  3KP2 A;  3ROU A;  1DDN A;  1R5H A;  4MEY F;  1FYL A;  1QNT A;  1WI9 A;  3TO7 A;  2FBH A;  3GO5 A;  3J80 K;  2FBK A;  3D5L A;  1YFH A;  4JK1 X;  2HDC A;  1FSE A;  1LEA A;  4IXA A;  3K1N A;  4ZYG A;  1FBU A;  5FFZ A;  2IA0 A;  4M71 A;  2GZW A;  3BP8 A;  3E6M A;  5L3E A;  2BBY A;  1B9M A;  2QQB A;  4NB5 A;  5HVQ C;  4LG0 B;  3GXO A;  5JFR A;  3IHU A;  4KN7 X;  2FNP A;  3TDU C;  1TNS A;  1B59 A;  1LQ1 A;  4HLX A;  5BPD A;  1ON1 A;  5LHH A;  4CHU A;  4UVA A;  1OKR A;  1J5Y A;  4EQQ A;  1UCR A;  5CYV A;  2PJP A;  2H6B A;  2VBY A;  2JPB A;  4HLY A;  1ZYR F;  1PP7 U;  2FNA A;  2Q2E A;  1B4A A;  5AON A;  2VE8 A;  2P8T A;  1E2X A;  4LB6 B;  3ABU A;  2DI3 A;  2H94 A;  5H20 A;  5E8I A;  4HYE A;  2MLG A;  1UFM A;  2BYV E;  2H09 A;  1XCV A;  1FOK A;  2O0Y A;  3FHZ A;  4XRF A;  3LFK A;  1ZG5 A;  1XMK A;  1K7A A;  4RGX A;  4IVN A;  2KIF A;  3FXU A;  3P9I A;  5LHI A;  2FF4 A;  1P6R A;  2M30 A;  3E5U A;  3KP4 A;  2HZT A;  1XSD A;  2IJL A;  4RB3 C;  5K5O A;  1LEB A;  1YLF A;  5LGN A;  2FOK A;  3VOD A;  1Z1D A;  4U0W A;  3L09 A;  2RC4 A;  3TQN A;  2DK5 A;  3I64 A;  4M9S A;  3E6D A;  1FPQ A;  4BHP A;  3K0L A;  4KDP A;  4F7Z A;  1DPU A;  2FXA A;  4Z2Y A;  2JTV A;  4A6E A;  3DKW A;  4UVC A;  3QP6 A;  2DPD A;  3KEO A;  5ED4 A;  2NNN A;  5D8K B;  3FF5 A;  4G9Y A;  2VBW A;  4UV9 A;  1GXP A;  3V8K A;  4AWX B;  1HST A;  3E3V A;  3HYI A;  1BC7 C;  1G3W A;  6PAX A;  2OA4 A;  3NEU A;  2ZNZ A;  4MGR A;  2FSW A;  1P4W A;  2M1B A;  5LEJ A;  1SFE A;  3WG9 A;  2JSC A;  1FSH A;  1I6X A;  2YSR A;  4GGG A;  3GW2 A;  2PEX A;  3EYY A;  1ODD A;  3U9G A;  4KN4 X;  2GXB A;  1XCB A;  3R6S A;  4A0X A;  4A6D A;  5IT9 Z;  1ZG3 A;  1UST A;  1YQA A;  4WF2 A;  3RKY A;  3EUH A;  1KU9 A;  2FQ3 A;  3O6B B;  2QZ8 A;  3KP6 A;  3SXY A;  4M74 A;  2P4W A;  5TJJ A;  5CVV A;  2A6H F;  2Z3Y A;  3QPT A;  2TDX A;  1SD4 A;  4KIF A;  1SFX A;  4EVI A;  3GWZ A;  1G3Y A;  1ZH5 A;  1YS7 A;  3K1P A;  1K79 A;  3CDH A;  1BBY A;  1FX7 A;  5FGM A;  3IKV A;  2MH9 A;  3WTY C;  1TQI A;  4L9T A;  1R1V A;  1QQI A;  1SD7 A;  2NS0 A;  2JRT A;  1D8J A;  3KEQ A;  1KYW A;  3BPX A;  3ZP5 A;  4PGG A;  1HBX G;  2HWV A;  2IPQ X;  3F6V A;  4HX4 A;  2ZO4 A;  1R5G A;  5D6E A;  3JAM K;  2Y0M A;  2KJC A;  2QBY A;  3ZMV A;  3FMQ A;  4GO1 A;  2E1C A;  3MWM A;  4KNY A;  4O3M A;  3ZMS A;  1XSX A;  2RGV A;  5LBQ A;  3KP5 A;  2PFB A;  4IJA A;  1XGN A;  2OBP A;  4YFX F;  1PUE E;  2QM3 A;  3MEX A;  4I02 A;  4I98 B;  1HSJ A;  3EET A;  5DCM A;  2VT2 A;  3H92 A;  2K4J A;  3BWG A;  2RNJ A;  4BYY A;  4Q5S F;  2XAG A;  4RGS A;  3CJN A;  1SD5 A;  4KFC A;  4HBL A;  2PQ8 A;  2LDU A;  5ICE A;  2KKO A;  2DFI A;  2KJB A;  1ZRD A;  1FYK A;  1O3T A;  3BOQ A;  3V8J A;  5LGT A;  3KP7 A;  5JR3 A;  4HX7 A;  1ZLJ A;  3CO6 C;  3FZV A;  1I5Z A;  3ZMT A;  5ILV A;  4HDU A;  3ECH A;  3N4M A;  4RAY A;  3LQQ A;  3P9C A;  3HOT A;  5DDG A;  2OQG A;  1TNT A;  3F72 A;  3P9K A;  1P4X A;  1BM9 A;  3ZMU A;  3ERE D;  4RGR A;  1RZ4 A;  1MJ9 A;  5DCM B;  1FWZ A;  4CGZ A;  3GX4 X;  3WTX C;  4WCG A;  2Z5U A;  2G7U A;  3L2C A;  1GVJ A;  2J5O A;  4GYI A;  3DF8 A;  5DD4 A;  4Y17 A;  4EV0 A;  3TOA A;  2F5E A;  1KU2 A;  2CFX A;  4L0Y B;  5HLI A;  5CVJ A;  1IN6 A;  2XAQ A;  2FA5 A;  2STW A;  2GA2 A;  2HS5 A;  3RPQ A;  3CUQ C;  3KLO A;  1ZAR A;  3IL2 A;  3F22 A;  4KIB A;  1J7K A;  2VON A;  3V8L A;  2W85 A;  2LF7 A;  2HQR A;  3C18 A;  1REP C;  5L3B A;  4UV8 A;  3F8M A;  1B6A A;  4ENK A;  2CGP A;  4LLL A;  2A07 F;  3SZP A;  2EK5 A;  3WTV C;  2DTR A;  3K9T A;  3DPL C;  5D8L B;  5A2Q K;  2CYY A;  3BPV A;  3PFI A;  3KFW X;  1F9N A;  4UXN A;  1P4A A;  5EEH A;  3GFL A;  3H3U A;  1F1Z A;  4L5I A;  3DXJ F;  3M7G A;  3IRR A;  4A12 A;  4BXU A;  3TO9 A;  2DBB A;  4R79 A;  3T8R A;  1IXR C;  1G3S A;  5CVU A;  1T6S A;  2BGC A;  2R3S A;  5HS7 A;  2HGC A;  1LB2 A;  1RUO A;  3RDI A;  3GFJ A;  1IRF A;  4I09 A;  4P9U A;  2STT A;  3DV8 A;  1BN5 A;  4Y13 A;  2HYG D;  2EV0 A;  4M72 A;  3WTU C;  1RI7 A;  1HW5 A;  3MZH A;  4G94 A;  4LGW A;  4HZF A;  2IA2 A;  4HF1 A;  4A0Y A;  1XSV A;  3QP5 A;  3E5Q A;  2D45 A;  4D0P A;  2NYX A;  4PCQ A;  3WOD F;  4S04 A;  3C1D A;  3R0A A;  3KP3 A;  1OYW A;  1TBX A;  1Z6T A;  2ZFW A;  4UHT A;  1D8K A;  1ONV A;  5F1R A;  3F8C A;  3BJ6 A;  4Q4Z F;  3I5U A;  2ACJ A;  3N97 A;  2ZME A;  4L5J A;  3J81 K;  2WWY A;  2XV4 S;  2QQ9 A;  1P92 A;  3BJO A;  3I4P A;  1YW7 A;  2W84 A;  5AIP A;  2MBF A;  5EEG A;  2NNY A;  4ESF A;  4KA4 A;  4GCV A;  2PMH A;  5D5X B;  2P6T A;  1YIO A;  3I54 A;  2O6G E;  2P5K A;  2HKX A;  1HKQ A;  2GA1 A;  1RIO H;  3ELK A;  1IZ1 A;  1XDU A;  4BAY A;  4XSX F;  3RYP A;  2MH2 A;  2QQA A;  4G7Z F;  3ISP A;  1IF1 A;  1ZRF A;  4XLN F;  3LST A;  3LAP A;  4HV5 A;  3T5X A;  3V7S A;  3QOP A;  2VBX A;  4EJT A;  2DT5 A;  4OIP F;  3E6B A;  5L3F A;  4MQ9 F;  4Q48 A;  3CUQ A;  3VB2 A;  3WE3 A;  2P7C B;  2DW4 A;  3FWE A;  1BJA A;  3Q9S A;  2XIG A;  4UNO A;  5DUK A;  5DCF A;  1Q1H A;  4ON0 A;  3QU6 A;  3C7J A;  5ILS A;  1BI3 A;  4ZZD A;  1H9G A;  2CWE A;  3RJP A;  4HV6 A;  1R00 A;  4EM2 A;  2LKP A;  3VOE A;  2RN7 A;  5CJ9 A;  5D5U B;  4ASN A;  3FXR A;  4N0B A;  1TTY A;  5LEK A;  3GZ6 A;  3SFZ A;  1SMT A;  4XBF A;  3CUO A;  2FRH A;  3HSR A;  1U3E M;  4FT8 A;  4R8H A;  3NRV A;  2M45 A;  5J8C A;  2Q0O A;  2YR2 A;  3ZMZ A;  1ZHF A;  5ILU A;  2A68 F;  2ZCW A;  2V79 A;  2YX4 A;  3KZY A;  4LJZ F;  3CUQ B;  4IRG A;  4OMZ A;  2DLL A;  2BE5 F;  4AVP A;  3F8F A;  2GAU A;  3CTA A;  3H3Z A;  1BIA A;  1U78 A;  5HDK A;  4XLP F;  1I1G A;  3F3X A;  1U6G A;  3AAF A;  2V9V A;  1XMA A;  3F21 A;  4WXC A;  2ZBK A;  2FEZ A;  1HQC A;  3T8T A;  2ZKZ A;  2Z99 A;  4ZYH A;  5AIQ A;  3RI4 A;  1S3J A;  3C3W A;  2XKO A;  3F6O A;  4HAM A;  4CIC A;  3HHH A;  3HRS A;  3WTZ A;  5DYM A;  2AXL A;  1YYV A;  2FE3 A;  2P6S A;  2O61 A;  3K2Z A;  1QBJ A;  2D1V A;  2COM A;  1JE8 A;  1QO0 D;  3KLN A;  1LVA A;  3E6C C;  2EJR A;  2K4B A;  5E1X A;  1G6N A;  1PP8 F;  1O57 A;  1IRG A;  1BI2 A;  5F64 A;  3CLO A;  3R60 A;  2ETH A;  1Z91 A;  2VT3 A;  4CZZ A;  4FX4 A;  2QEN A;  5FLX Z;  2YU3 A;  3IC7 A;  4I0B A;  2HFH A;  4G7O F;  3J7A O;  1XDS A;  5E18 F;  3WE2 A;  4ESJ A;  4U7D A;  4O6J A;  2MC3 A;  1ZAO A;  3QAH A;  2M8E A;  3GEZ A;  1LDK B;  3ULQ B;  1NHA A;  5LRS A;  1WKM A;  2F5F A;  2IA1 A;  2FMY A;  1CF7 A;  2L4A A;  2PI0 A;  4HQM A;  1AOY A;  4IRH A;  3HRT A;  1J2X A;  1XB4 A;  1G4D A;  1KQ9 A;  4OIO F;  3ZQ7 A;  2R7F A;  5CLS A;  2QWW A;  2EWN A;  2YPR A;  4A2U A;  1OYY A;  4G6Q A;  1LDD A;  2V6C A;  4IF4 A;  1KQ0 A;  4A5M A;  1LDJ A;  4UUV A;  1QZZ A;  2K7L A;  1VTN C;  1MJA A;  1BI0 A;  3I0T A;  2OZ6 A;  3LAJ A;  1W7P A;  4WXH A;  1U5T C;  4I2O A;  2HQN A;  3RKW A;  5HLG A;  3WGH A;  2HTJ A;  2PN6 A;  1GXQ A;  4JBA A;  2DAO A;  3MFK A;  4JQF A;  3QRF F;  2EFP A;  3M8E A;  4EM1 A;  4ENM A;  4Q47 A;  5LHG A;  4WX9 A;  1CF7 B;  3B02 A;  2QBY B;  3RIR A;  4IRI A;  2VOD A;  1I1S A;  3FM3 A;  4HF0 A;  5L3G A;  2FBI A;  2XGX A;  1SMY F;  2Y48 A;  3DEU A;  2OU2 A;  4L9N A;  2IVM A;  4PZJ A;  1RUN A;  1L0O C;  1DPR A;  2P7V B;  4M9X A;  3IWF A;  3CO7 C;  3L00 A;  1JHF A;  3ZPL A;  5HLH A;  2KIM A;  1UB9 A;  1W7P B;  1O3R A;  2F5D A;  1FBS A;  4M73 A;  1YW9 A;  4EM0 B;  1XGM A;  3EYI A;  5E8G A;  3BDD A;  5DD8 A;  1KA8 A;  1HXD A;  2Z33 A;  5BOX A;  3MQ0 A;  1GHC A;  2CO5 A;  1JGS A;  1O7L A;  2EFO A;  2DPU A;  1ZGJ A;  5D6F A;  2EFQ A;  2A5Y B;  3B73 A;  5FD5 A;  4KMU X;  2ESH A;  1YO5 C;  5CVR A;  2VOO A;  1QPM A;  3R61 A;  1V3F A;  3I58 A;  1FY7 A;  4HOB A;  4A5N A;  4O5V A;  2XRO A;  3QPH A;  4BH9 A;  2VC1 A;  2XHK A;  2WTE A;  2XAS A;  2MD5 A;  5K5R A;  2IT0 A;  4U0V A;  4YII A;  1K6O A;  2PBI A;  2L54 A;  2D2W A;  1T98 A;  2Z9O A;  2AS5 F;  4P5O A;  3WU0 A;  3W6J B;  2GWR A;  3GVA A;  2VBZ A;  4MTE A;  4MHG A;  3VEP A;  2WV0 A;  1BOA A;  1TW2 A;  4L0Z B;  4FX0 A;  3WTW C;  2B0L A;  4L9V A;  3ZN1 A;  2XAH A;  3DFG A;  4I7H A;  3V7R A;  4PDK A;  3SHF A;  3ML6 A;  4HQE A;  5KK1 A;  4OMY A;  3F8B A;  4ESB A;  3KET A;  2P5L C;  2DO7 A;  2XVC A;  1O3Q A;  1UHM A;  3HUG A;  2ZXJ A;  5FD6 A;  1LJ9 A;  2IW5 A;  2V1X A;  2UXN A;  3JSP A;  2K86 A;  3WGI A;  3KCC A;  4M6X A;  1YS6 A;  1HW1 A;  5IT9 K;  3M9A A;  2HR3 A;  2GIV A;  3TOB A;  2P5V A;  3BJA A;  1R23 A;  4Y15 A;  2EFN A;  3O3K A;  4YFN F;  1R58 A;  3LA2 A;  1YTY A;  4HF2 A;  3COA C;  3GFM A;  2UWM A;  1XN7 A;  4RS8 A;  5E20 A;  4I01 A;  1IXC A;  1BI1 A;  1U5T A;  3V7C A;  1QGP A;  1XGO A;  1TLH B;  3GFI A;  4NHJ A;  1WSU A;  3LA7 A;  2X4H A;  1D3Y A;  1T2K A;  2GXG A;  2PMU A;  2L01 A;  5KVR A;  3S2W A;  3ZMD A;  2X0L A;  4OU0 A;  4EGZ A;  4LK0 F;  4EJV A;  3VFZ A;  1SAX A;  2XAJ A;  1ZG1 A;  4OIR F;  3DQV C;  3JAM Z;  2K02 A;  2BEO A;  4OIN F;  3D0S A;  2PLY A;  2OAZ A;  4HX8 A;  1H0M A;  4HA8 A;  3TGN A;  1X3U A;  5E1Z B;  5H6Q A;  4L18 B;  4LLN A;  4QLC U;  1KQ8 A;  5BQT A;  1J59 A;  3EDP A;  2EFW A;  5J6X A;  4OOI A;  4R1H A;  1W4M A;  1KU7 A;  5LRR A;  1FP2 A;  2MA3 A;  5DV5 A;  4CO8 A;  3ABT A;  3GZ5 A;  1MDM A;  1U5T B;  5ICF A;  5FB2 A;  4CYD A;  2QUF A;  4MTD A;  3QU3 A;  2UZK A;  3LWF A;  2EA4 A;  2R7D A;  2ZME B;  3ECO A;  4PGH A;  4S05 A;  4KYW A;  1STZ A;  5L3C A;  1PDN C;  3SQN A;  2YX7 A;  3PQJ A;  1IAW A;  4BNC A;  3T0Y A;  2D1H A;  3GYH X;  2ESN A;  4XSZ F;  3RKX A;  3GUD A;  3O2P E;  2VC0 A;  1FBQ A;  1Z7U A;  4KIG A;  4L9J A;  1FC3 A;  3L7W A;  1JXS A;  4EJO A;  4LD5 A;  2QVO A;  5D4R A;  3R4K A;  3KZZ A;  1U8R A;  2OD5 A;  3RYR A;  5JHU A;  1R22 A;  2L4M A;  4HW0 A;  5BS6 A;  1IXS B;  1S7A A;  3HSE A;  4ZZL A;  1MDM B;  2G9W A;  4ZH4 F;  1FLI A;  2E7W A;  4U7B A;  4QWQ A;  3IKT A;  2KIU A;  4K2E A;  3DP7 A;  4N9H A;  2BV6 A;  4LMY A;  3I59 A;  4EJU A;  2XUB A;  2VE9 A;  5FO5 A;  2H27 A;  2KRF A;  4KUM A;  3M1E A;  4RB0 A;  1TQM A;  4KIC A;  4KMF A;  3OV8 A;  3JTH A;  5E1W A;  4WWC A;  3WTS C;  4MQV A;  1W7P D;  1YW8 A;  3V4G A;  3MCZ A;  1EH6 A;  2A6E F;  2RVC A;  2EA2 A;  2GQQ A;  1OYI A;  4IHS A;  5DUI A;  1R1T A;  4OIQ F;  4UVB A;  3E5X A;  2IP2 A;  2J5P A;  2Y75 A;  2C6Y A;  4P96 A;  4YG2 F;  2QYO A;  1Z9C A;  2EV5 A;  4EMS A;  3MAJ A;  3OOP A;  4G7H F;  2F5C A;  5D5W B;  4IHT A;  1E17 A;  2IRF G;  3FM5 A;  4U88 A;  5HDN A;  2CW0 F;  1ZLK A;  1OMI A;  5A2Q Z;  3I59 B;  3GF2 A;  1Z6R A;  3BY6 A;  3HTS B;  4I0A A;  1T0F A;  1S8N A;  4P9F A;  3G73 A;  1L3L A;  4B09 A;  1BC8 C;  1SD6 A;  2NRA C;  3I53 A;  5K1Y A;  2HKO A;  3WU1 B;  2HEO A;  4MNU A;  4U0Y A;  2OQR A;  2HTS A;  3MZY A;  2CQK A;  2JZY A;  2FML A;  2FU4 A;  4ENJ A;  1S7O A;  5J8F A;  1A04 A;  1WWX A;  1MD0 A;  3LA3 A;  4LB5 A;  4WK8 F;  1W5S A;  3Q5F A;  3HRM A;  2WC2 A;  1W5T A;  4LLG F;  4HDV A;  1B9N A;  1EV7 A;  1T39 A;  3TO6 A;  5CVI A;  3U2R A;  1FNN A;  2CG4 A;  3TKY A;  1MJB A;  2DQR A;  1DP7 P;  2LF8 A;  1IN8 A;  1Y0U A;  1FYM A;  4AD9 A;  1J9I A;  2JPC A;  3J81 Z;  1ZGA A;  1J0R A;  3BZ6 A;  5H6R A;  1TQP A;  5HDG A;  4ZYE A;  5L3D A;  2ZNY A;  3JTG A;  1K78 A;  3J80 Z;  3JW4 A;  3JSO A;  1UHW A;  1OPC A;  1R36 A;  4CDG A;  3P7N A;  1RNL A;  5F6F A;  1HKT A;  5ERI A;  2RV8 A;  2V1U A;  4RGU A;  4GYG A;  3E97 A;  1IW7 F;  2A61 A;  1IN7 A;  2JT1 A;  3DPT A;  4DQ2 A;  2XKP A;  3HHG A;  4LFU A;  2DK8 A;  1FT9 A;  2EB7 A;  1MZB A;  5LGU A;  3ZN0 A;  1XGS A;  1IN5 A;  2XRN A;  2G7H A;  4P55 A;  3GLX A;  4RB1 A;  2W25 A;  5JI6 A;  5BMZ A;  1LNW A;  5ICG A;  5FFX A;  1FZP B;  3HRU A;  4LK1 F;  2O03 A;  1AWC A;  2ISY A;  2ELH A;  4BQA A;  2Q8K A;  2E1N A;  2MLK A;  2E7X A;  5K5Q A;  1K78 B;  2QLZ A;  5D5V B;  3LQR A;  1EH7 A;  3HIF A;  1WRJ A;  1ZN2 A;  5DEQ A;  2W57 A;  3U1D A;  2VOP A;  5E17 F;  2M5W A;  5BPI A;  3T1B A;  2L3D A;  2LSO A;  4FHT A;  3HOS A;  2V1D A;  3IWZ A;  3RTR A;  1EH8 A;  2A69 F;  1ON2 A;  2EV6 A;  3HSF A;  4GXO A;  1R1U A;  5ICC A;  2PG4 A;  1U2W A;  5D4S A;  1SFU A;  2W24 A;  4ZYD A;  1QZY A;  4M9Z A;  3SZT A;  1KU3 A;  3EQL F;  3TDZ C;  1WQ2 A;  4E70 A;  5HS8 A;  3K69 A;  5LLQ A;  2DQL A;  4NQW A;  2ZJ2 A;  4ENN A;  4TV7 A;  1B1B A;  4AIH A;  4IPA A;  2H6C A;  3FMR A;  1OR7 A;  4CXF A;  1FP1 D;  4M6Y A;  1JHH A;  3HTU A;  5TRD A;  5HS9 A;  2RDP A;  3R0J A;  1S29 A;  1T38 A;  4YFK F;  2DU9 A;  4G8X A;  1ULY A;  1R7J A;  5IT3 A;  1H9T A;  3WTT C;  4AIK A;  3I71 A;  5HOO A;  3W6K B;  4BHB A;  1ZRE A;  2RKH A;  2VXZ A;  2CSO A;  4A0Z A;  4DNC A;  2RQP A;  1I27 A;  2ISZ A;  2K27 A;  4YIF A;  1CGP A;  3K1M A;  3FMS A;  3F8N A;  2OZU A;  3G3Z A;  2L02 A;  3IRQ A;  1HW2 A;  1IN4 A;  3L9F A;  1HKS A;  3Q9V A;  1J75 A;  2ADU A;  4EJW A;  1MGT A;  2A3S A;  1P2F A;  4B8X A;  1O7F A;  4G6D A;  1DUX C;  4AIJ A;  1O3S A;  1D5V A;  2M87 A;  2LNB A;  3REO A;  3RPU A;  2NAZ A;  3FX3 A;  4RB2 C;  1G3T A;  2F2E A;  2UXX A;  3BRO A;  2HYF A;  4MEX F;  1TW3 A;  1YG2 A;  2XAF A;  4LG0 A;  1IUY A;  4ETS A;  4EGY A;  1KGS A;  1BIB A;  1F4K A;  5FLX K;  3FXQ A;  4H0E A;  1Z05 A;  3M8F A;  3PQK A;  2VN2 A;  3KE2 A;  1ZRC A;  1S6L A;  4KT5 C;  3WGG A;  4BHC A;  1MKM A;  4WXD A;  1C0W A;  1USS A;  3NQO A;  4RAZ A;  3F23 A;  2HOE A; 
#chains in the Genus database with same CATH topology
 5JVT A;  1V4R A;  2O3F A;  4N9I A;  1YE9 A;  3EUH C;  3Q0U A;  1KYZ A;  1F5T A;  1XD7 A;  2O8X A;  4C2U A;  3KP2 A;  2WY7 Q;  3ROU A;  1DDN A;  1R5H A;  4MEY F;  5FLV A;  1U0J A;  1FYL A;  2AHQ A;  1QNT A;  5GAG J;  1WI9 A;  3TO7 A;  2FBH A;  2L9N A;  3GO5 A;  3J80 K;  1NG6 A;  1VQ8 I;  2FBK A;  3D5L A;  1WJF A;  1YFH A;  4JK1 X;  2R5Y B;  3BG3 A;  1FSE A;  1LEA A;  5C3E J;  2HDC A;  2LOO A;  4IXA A;  3AKZ A;  3K1N A;  4ZYG A;  2MYS A;  1MH3 A;  2CQQ A;  1VFC A;  3L2V A;  1VQM I;  1FBU A;  3AG2 H;  2H1L A;  4CSW A;  5FFZ A;  2MD0 A;  2B63 J;  2IA0 A;  2VL8 A;  3LSI A;  3QPS A;  4Y3O A;  4M71 A;  2GZW A;  3BP8 A;  3HJE A;  5JLW A;  3E6M A;  5L3E A;  5BNG A;  3HPH A;  2BBY A;  4GDF A;  1B9M A;  2QQB A;  4NB5 A;  5HVQ C;  4LG0 B;  3GXO A;  1DU0 A;  2K9M A;  4CA0 A;  1VQ4 I;  2FQ4 A;  1NK3 P;  5JFR A;  5IPA A;  3IHU A;  4KN7 X;  3CCL I;  5C4J J;  2FNP A;  1E3O C;  3TDU C;  3S15 J;  1TNS A;  1B59 A;  1K4S A;  2OCC H;  1LQ1 A;  4HLX A;  5BPD A;  1ON1 A;  3D5R C;  5LHH A;  4CHU A;  4UVA A;  1OKR A;  1J5Y A;  2W4S A;  3TBI A;  3UKG A;  1P9Q C;  1UCR A;  4EQQ A;  2HPM A;  5CYV A;  2B9S A;  2JA5 J;  2PJP A;  1ZR4 A;  2H6B A;  2VBY A;  2JPB A;  2KIS A;  4RA2 A;  5EGO A;  3H5R A;  3D5S C;  3OYJ A;  1W0T A;  3CES A;  4HLY A;  4CZC A;  3JRC A;  1ZYR F;  1PP7 U;  2FNA A;  2Q2E A;  1B4A A;  1VQO I;  1BOB A;  1NTC A;  1GUU A;  3BR1 A;  2VE8 A;  5AON A;  3OYA A;  2P8T A;  1IDZ A;  3OSF A;  3BQY A;  5B1B H;  2V6E A;  1E2X A;  4LB6 B;  5K7F A;  3ABU A;  2DI3 A;  1K83 J;  2L9R A;  2ZSH B;  2H94 A;  3OR2 C;  2HQA A;  2ZSI B;  5H20 A;  5E8I A;  4HYE A;  2MLG A;  4L5E A;  2XPW A;  1UFM A;  2BYV E;  2H09 A;  1XCV A;  4FTH A;  1FOK A;  2O0Y A;  3C2H A;  4B43 A;  3FHZ A;  4XRF A;  4BXX J;  3LFK A;  1ZG5 A;  2IGK A;  2COB A;  1XMK A;  1K7A A;  3CZ6 A;  2DMN A;  4RGX A;  4IVN A;  1TP4 A;  2KIF A;  3FXU A;  3P9I A;  5LHI A;  2FF4 A;  4XKV A;  5DTD A;  2QSF X;  3PL8 A;  1P6R A;  2M30 A;  3E5U A;  3GLL A;  2M3A A;  3KP4 A;  2HZT A;  1XSD A;  3CC7 I;  2IJL A;  3S1Q J;  3NWS A;  4RB3 C;  1Y1W J;  1T8I A;  4CUG A;  5K5O A;  3QYE A;  1LEB A;  1YLF A;  3S1R J;  4XR6 A;  1ETQ A;  3BTC A;  5LGN A;  3OIP A;  2FOK A;  4J19 A;  3VOD A;  1Z1D A;  2K40 A;  4Z6Y A;  1R49 A;  1WCM J;  4F91 B;  2WAQ N;  4U0W A;  2DFF A;  3L09 A;  2RC4 A;  3BCA A;  3TQN A;  3H0G J;  1N75 A;  2X6Y A;  2DK5 A;  2Q2E B;  3I64 A;  3K7A J;  4M9S A;  1X3W B;  2DA1 A;  3E6D A;  1FPQ A;  4BHP A;  2K3P A;  3ZQC A;  3K0L A;  4V2F A;  4KDP A;  4A3K J;  4A3C J;  2XPU A;  1JJ6 C;  2FOW A;  4F7Z A;  1DPU A;  3J7Y J;  2VQH A;  2XGC A;  4C2M J;  3JR9 A;  3AFH A;  1U9N A;  2W48 A;  2FXA A;  3KEY A;  4Z2Y A;  3RQI A;  2JTV A;  3FIW A;  3SZG A;  4A6E A;  5B3S H;  2ID3 A;  3DKW A;  4UVC A;  1K61 A;  3QP6 A;  2DPD A;  1G2H A;  3VDX A;  1UZC A;  3RZO J;  3KEO A;  5GTI C;  2NNN A;  2FJ1 A;  5D8K B;  5ED4 A;  2DFE A;  2KFD A;  2DA5 A;  2BY3 A;  2Y31 A;  5E3O A;  1POG A;  3FF5 A;  4G9Y A;  2VBW A;  2K9Q A;  4UV9 A;  5LFA A;  1GXP A;  3GTQ J;  1FTZ A;  2JSP A;  2VUM J;  3V8K A;  4AWX B;  1HST A;  2BVM A;  1I3A A;  3E3V A;  3HYI A;  1BC7 C;  5F0F A;  1G3W A;  1Y1V J;  6PAX A;  2R93 J;  2OA4 A;  3NEU A;  3BG7 A;  3K6G A;  2A6T A;  2DMQ A;  2ZNZ A;  4MGR A;  4EEF G;  1A5J A;  2FSW A;  4E7K A;  1P4W A;  2M1B A;  5LEJ A;  1SFE A;  3WG9 A;  2JSC A;  3OYB A;  1APL C;  1FSH A;  2Y9Z A;  1I6X A;  4E7S A;  4XLE A;  2YSR A;  2ZXI A;  4DYC A;  4BL0 B;  4GGG A;  3GW2 A;  2PEX A;  3EYY A;  2NVT J;  4E4H A;  4NC8 A;  2NS8 A;  5EEA A;  2JVG A;  1ODD A;  4QPO A;  3CMA I;  3GME A;  3U9G A;  2IS6 A;  1YJN I;  3K70 D;  4KN4 X;  4IHX A;  2GXB A;  1XCB A;  3R6S A;  4A0X A;  5KHD A;  1QHG A;  3X2Q H;  4A6D A;  4KIT B;  5IT9 Z;  3IH3 A;  1NG7 A;  1ZG3 A;  3PUF A;  4Y33 A;  1UST A;  2HDW A;  2MSY A;  1YQA A;  4WF2 A;  2BOL A;  2OTL I;  3RKY A;  2I10 A;  3EUH A;  1KU9 A;  3HPG A;  4DJA A;  2FQ3 A;  3NWT A;  2Y30 A;  2LLK A;  3O6B B;  3OYF A;  3BLY A;  2QZ8 A;  3KP6 A;  3SXY A;  4XRS G;  4M74 A;  2P4W A;  2KL4 A;  5TJJ A;  2CUE A;  4FCY A;  5CVV A;  5EZG A;  4JX6 A;  4V19 K;  2A6H F;  4BQO A;  2Z3Y A;  3QPT A;  3A0B C;  2JN6 A;  1MMS A;  5FJ8 J;  2HXI A;  2TDX A;  4FIS A;  1SD4 A;  1WJB A;  4KIF A;  1SFX A;  4XRS A;  4EVI A;  3GWZ A;  3VSL A;  1G3Y A;  1ZH5 A;  4D1Q A;  1PUF A;  1YS7 A;  3K1P A;  1K79 A;  3CDH A;  3H5N A;  3LSR A;  4ZDO A;  4YEL A;  1BBY A;  2LR8 A;  1FX7 A;  5FGM A;  2DOE A;  1QA6 A;  4JX4 A;  1GV2 A;  1UAA A;  2DJI A;  3IKV A;  1X3Z B;  2MH9 A;  1SVL A;  2JJ7 A;  3WTY C;  3PFY A;  1TQI A;  4L9T A;  1R1V A;  3FKI J;  2JQ7 A;  1QQI A;  1SD7 A;  2NS0 A;  2JRT A;  1D8J A;  1S5L C;  3KEQ A;  1X4P A;  3ZQI A;  4UB8 C;  1KYW A;  3PM1 A;  4IHY A;  1Z3X A;  3BPX A;  3ZP5 A;  3AL0 B;  2CQ7 A;  4PGG A;  1HBX G;  4J01 A;  2HWV A;  2IPQ X;  3F6V A;  4HX4 A;  4J00 A;  4A3J J;  2P0W A;  2ZO4 A;  4A93 J;  3G4S I;  4AYB N;  1R5G A;  2KHM A;  3DEW A;  4NC6 A;  5D6E A;  3JAM K;  2Y0M A;  2KJC A;  2BHZ A;  3ZMV A;  2QBY A;  2K85 A;  3FMQ A;  2HVR A;  4GO1 A;  2X1C A;  2E1C A;  3MWM A;  5JHF A;  1A6I A;  4KNY A;  4O3M A;  3ZMS A;  1XSX A;  1JKR C;  2RGV A;  5LBQ A;  5E79 C;  3KP5 A;  2PFB A;  4IJA A;  1XGN A;  2OBP A;  4YFX F;  2EZI A;  1PUE E;  3H9Q A;  4F92 B;  2YU9 J;  1ZTR A;  2V26 A;  2QM3 A;  3MEX A;  1CQT A;  1D1A A;  1MNE A;  4I02 A;  1FMW A;  4I98 B;  1HSJ A;  3EET A;  5DCM A;  2VT2 A;  3H92 A;  1PUF B;  2P81 A;  2VPR A;  2K4J A;  1V5G A;  3BWG A;  5EZH A;  2RNJ A;  4BYY A;  4DZP A;  2H8W A;  4CCO A;  1NH3 A;  2XAG A;  3WG7 H;  1IJW C;  1W36 C;  4RGS A;  3GTL J;  3CJN A;  4Y7N J;  1SD5 A;  4KFC A;  4HBL A;  3H36 A;  3F0C A;  3RSN A;  2PQ8 A;  2LDU A;  3DU6 A;  5ICE A;  2BXZ A;  2KKO A;  1OCC H;  2DFI A;  3OYM A;  3CJT B;  2KJB A;  2TCT A;  1A6Q A;  1ZRD A;  1FYK A;  3U1K A;  1O3T A;  2OPT A;  5GAE J;  5HNH A;  3BOQ A;  1PYV A;  3V8J A;  5LGT A;  3CJQ B;  3L1P A;  2FD5 A;  3PUB A;  3KP7 A;  5JR3 A;  4HX7 A;  1MBK A;  1ZLJ A;  3CO6 C;  3FZV A;  3PIO F;  1I5Z A;  3CCY A;  3ZR8 X;  3OOU A;  3E7L A;  3ZMT A;  1B8I A;  5ILV A;  3D1N I;  2V1N A;  2WA0 A;  4HDU A;  3A0H C;  3ECH A;  3N4M A;  4RAY A;  3NAR A;  2L7M P;  3S32 A;  3LQQ A;  4NC7 A;  3P9C A;  3HOT A;  5DDG A;  1W36 D;  5GP9 A;  3N05 A;  2OQG A;  5EDN A;  3OYI A;  4DBQ A;  1TNT A;  4ZTF A;  3F72 A;  3P9K A;  4MFD A;  1A31 A;  2DOA A;  5E3L A;  1P4X A;  1BM9 A;  3ZMU A;  2KZG A;  3ERE D;  4RGR A;  1JTX A;  3PO2 J;  3BTI A;  1RZ4 A;  3GTO J;  1JUM A;  2KZV A;  1MJ9 A;  3S1M J;  5DCM B;  1ITY A;  1FWZ A;  4CGZ A;  2M0M A;  3GX4 X;  3WTX C;  4WCG A;  1E0E A;  2ZC2 A;  1MBF A;  3OWT A;  2Z5U A;  2G7U A;  4XM3 A;  3L2C A;  2CH0 A;  1IUF A;  1I3Q J;  1XC5 A;  3OS0 A;  4NDL A;  4GFB A;  1GVJ A;  2J5O A;  4GYI A;  3DF8 A;  1I50 J;  5DD4 A;  4Y17 A;  3JRD A;  1JGG A;  4EV0 A;  3TOA A;  2R7T A;  2VXD A;  3HDD A;  2F5E A;  1LFB A;  1KU2 A;  2CFX A;  4L0Y B;  2LVS A;  2K3F A;  5HLI A;  5CVJ A;  1IN6 A;  4IKF A;  5EG0 B;  2XAQ A;  2B7E A;  4E6K G;  2FA5 A;  2STW A;  2GA2 A;  2HS5 A;  5GPC A;  1BJZ A;  3RPQ A;  3CUQ C;  3VYS B;  2CUZ A;  3KLO A;  1ZAR A;  5FRM A;  2DMP A;  4I99 C;  4KT6 A;  2VJI A;  2I5U A;  3IH2 A;  3IL2 A;  3S3N A;  2HYJ A;  4BXF A;  1PJR A;  2X1D A;  3F22 A;  1SAN A;  2R5Z A;  2Y0S A;  3VYT B;  4KIB A;  2KQR A;  2M7B A;  5IYD J;  1J7K A;  5IYB J;  4DOZ A;  3V8L A;  2VON A;  2W85 A;  2LF7 A;  2HQR A;  3C18 A;  5H2F C;  4X0G A;  3CCQ I;  1REP C;  5L3B A;  4HNV A;  3MD2 A;  3F8M A;  1DGR M;  4UV8 A;  2QEX I;  4PSX A;  3KYC B;  2OTJ I;  2QSG X;  1B6A A;  4ENK A;  2CGP A;  2MAB A;  4LLL A;  3OSG A;  3CC2 I;  2A07 F;  3L2Q A;  2BY1 A;  2AQE A;  2WB1 A;  1Z7L A;  3SZP A;  2EK5 A;  2XF6 A;  3EPZ A;  2X6X A;  2LKX A;  3WTV C;  2DTR A;  3K9T A;  4IHV A;  5EJC A;  2VJ4 A;  3DPL C;  4DBR A;  1WH5 A;  1IRX A;  5D8L B;  5A2Q K;  2CYY A;  3BPV A;  3FDY A;  1WHU A;  3PFI A;  3VYU B;  2TRT A;  3PO3 J;  2NVY J;  3KFW X;  1F9N A;  4UXN A;  1P4A A;  4XL9 A;  5EEH A;  2KDZ A;  3GFL A;  3H3U A;  1F1Z A;  3BG5 A;  2EIK H;  4BEH A;  4L5I A;  4RAG A;  3DXJ F;  2VQC A;  3M7G A;  3IRR A;  4A12 A;  1D0X A;  4BXU A;  3TO9 A;  1LFP A;  2DBB A;  4HRI A;  2O7O A;  4R79 A;  3T8R A;  1IXR C;  1G3S A;  5CVU A;  1MBE A;  4V2G A;  3O8G A;  2CFO A;  1T6S A;  2BGC A;  2R5Z B;  1XX5 A;  2R3S A;  4X1E A;  5HS7 A;  3BC8 A;  2HGC A;  2LY9 A;  4BBS J;  1LB2 A;  2BW3 A;  2IS2 A;  1RUO A;  2E19 A;  3RDI A;  5J1Y A;  3M4O J;  2NVX J;  3GFJ A;  3PSI A;  5F1J A;  1IRF A;  5FKM A;  4I09 A;  4P9U A;  3ABK H;  2STT A;  3DV8 A;  5DS9 A;  1BN5 A;  2WAE A;  3C2B A;  3P5J A;  4RM3 A;  4Y13 A;  2ZJR F;  2HYG D;  3K4B A;  2BXY A;  1GDT A;  2EV0 A;  3CCM I;  1I39 A;  2L9V A;  2Z16 A;  4M72 A;  3WTU C;  2DMU A;  1RI7 A;  1HW5 A;  4BJT A;  3DKY A;  2RNG A;  4G94 A;  4LGW A;  3MZH A;  4HZF A;  1JKQ C;  2IA2 A;  4HF1 A;  4A0Y A;  4RDU A;  3SEQ A;  5K7H A;  1XSV A;  3A03 A;  3QP5 A;  4XON A;  5IP9 J;  3E5Q A;  2O9L A;  4M3E A;  1FEX A;  1VI0 A;  2GLO A;  2D45 A;  4D0P A;  2NYX A;  4ZDP A;  4PCQ A;  1DQU A;  3WOD F;  3C1D A;  3R0A A;  4S04 A;  3KP3 A;  3JRA A;  1OYW A;  1TBX A;  1T95 A;  1Z6T A;  2ZFW A;  4LG3 A;  4UHT A;  3OS1 A;  1XS9 A;  2IS4 A;  1D8K A;  1TC3 C;  3JRE A;  1R9T J;  1ONV A;  1PVE A;  5F1R A;  2R7R A;  2LBF A;  3F8C A;  4BEH B;  3BJ6 A;  1H89 C;  4M3B A;  4MIM A;  1GVD A;  4Q4Z F;  3I5U A;  2ACJ A;  3HB9 A;  3N97 A;  2ZME A;  3ASO H;  4L5J A;  3J81 K;  2WWY A;  2XV4 S;  2QQ9 A;  1P92 A;  3BJO A;  3G71 I;  1MNM C;  2X6W A;  3I4P A;  3MKZ A;  2K9N A;  1YW7 A;  2W84 A;  3FXJ A;  5AIP A;  3DLA A;  2MBF A;  2BW3 B;  5EEG A;  2NNY A;  3OMY A;  4ESF A;  1BR4 A;  2M8G X;  4KA4 A;  2L7Z A;  1UG0 A;  2DN0 A;  3BR6 A;  4LIT A;  4GCV A;  2MW8 A;  3RQ4 A;  1XPX A;  5CQE A;  2PMH A;  3BTL A;  5D5X B;  2P6T A;  1YIO A;  2QQ8 A;  2M0C A;  3I54 A;  2O6G E;  2P5K A;  1VND A;  3GTJ J;  2HKX A;  3IH4 A;  4XK4 A;  3PSF A;  4OWR B;  3W3C A;  1HKQ A;  3UR3 C;  2GA1 A;  2M2E A;  5F04 A;  3WHB A;  2JVH A;  1RIO H;  3ELK A;  3S3M A;  3RZD J;  3IP4 B;  5HLT A;  2CW8 A;  1IZ1 A;  1XDU A;  1FOX A;  3L2U A;  4AM3 A;  3TP3 A;  4BAY A;  2VJ5 A;  4U87 A;  4XSX F;  3RYP A;  4JYK A;  2MH2 A;  1QVT A;  3HGG A;  2JUC A;  2QQA A;  5K7Z A;  3JRF A;  4G7Z F;  1X1P A;  3ISP A;  3OYE A;  1IF1 A;  1ZRF A;  4D5F A;  4XLN F;  3CDI A;  3LST A;  3HOV J;  3FHN A;  3LAP A;  1IGN A;  3ERM A;  4HV5 A;  3T5X A;  3V7S A;  1A36 A;  2LKS A;  4DZJ A;  1YRN A;  1P7J A;  4BQN A;  1MSF C;  4E7H A;  2R7W A;  3QOP A;  3VWB A;  2L7K A;  2EIL H;  4IQ4 A;  1XMX A;  2VBX A;  4EJT A;  2ECB A;  2DT5 A;  2JUG A;  2PMZ A;  2PJR A;  4XRM A;  4OIP F;  3FXK A;  3E6B A;  1R71 A;  3G1M A;  2DA6 A;  5L3F A;  4MQ9 F;  4Q48 A;  3CUQ A;  3VB2 A;  3HM5 A;  3WE3 A;  1T08 B;  4II3 A;  2E2I J;  2P7C B;  2VPL A;  2EZK A;  2DW4 A;  3FWE A;  1BJA A;  3Q9S A;  2XIG A;  2DDA A;  1TWG J;  2MGQ A;  4DIQ A;  4UNO A;  2EIJ H;  5F08 A;  3PNV A;  5DUK A;  4YEJ A;  5DCF A;  3OYN A;  4BJ6 C;  1Q1H A;  4BUP A;  4ON0 A;  4UUS A;  1Y6I A;  3QU6 A;  3C7J A;  5ILS A;  1BI3 A;  2HPI A;  4ZZD A;  1H9G A;  2CWE A;  3JCU C;  1ZK8 A;  3RJP A;  3C2G A;  2E2H J;  2OCE A;  4HV6 A;  2F4I A;  1V55 H;  1R00 A;  4EM2 A;  2LKP A;  4AU7 A;  3VOE A;  2RN7 A;  1Z3Y A;  2ZJQ F;  5CJ9 A;  5D5U B;  1VF9 A;  4ASN A;  3FXR A;  4N0B A;  1FIP A;  1QU3 A;  1TTY A;  5LEK A;  3GZ6 A;  3SFZ A;  3ONQ A;  1SMT A;  3CME I;  3BTJ A;  4XBF A;  3CUO A;  2FRH A;  1TWF J;  3HSR A;  4XQF A;  1U3E M;  4FT8 A;  4R8H A;  3NRV A;  2O8K A;  5M5X J;  2M45 A;  4FE4 A;  4M3D A;  5J8C A;  2Q0O A;  2W7N A;  5E3M A;  3OL4 A;  2YR2 A;  3ZMZ A;  4PK4 A;  3ZQH A;  1N78 A;  5EGO B;  1ZHF A;  1WGX A;  1QHH D;  5ILU A;  1RR8 C;  2GBY A;  3ESW B;  2A68 F;  2ZCW A;  3L2W A;  2V79 A;  3MN2 A;  1WH7 A;  3LSM A;  2NVU B;  2YX4 A;  3KZY A;  4LJZ F;  3CUQ B;  3QYF A;  4IRG A;  3S16 J;  2AO9 A;  2CJJ A;  4OMZ A;  3MZ8 A;  2DLL A;  2D5V A;  3BZC A;  2BE5 F;  2E71 A;  4ANJ A;  3K4M A;  4NNJ A;  1H88 C;  2MC4 A;  4AVP A;  3F8F A;  1JTY A;  2I8D A;  2DOD A;  1YI2 I;  3OYD A;  3DCF A;  4IX7 A;  2UUZ A;  5HNF A;  4Y4R A;  4EAT A;  4UUS B;  4ZYA A;  2GAU A;  3CTA A;  3H3Z A;  3LSH A;  1BIA A;  1LKX A;  4F52 A;  5J4V A;  1U78 A;  1HDP A;  2NOG A;  5HDK A;  1HF0 A;  3S93 A;  1BW5 A;  1OIS A;  2OUM A;  4XLP F;  1I1G A;  3F3X A;  3G6E I;  2IEK A;  1U6G A;  3AAF A;  4PJ0 C;  2V9V A;  4HNT A;  1XMA A;  1TT0 A;  2DXI A;  3F21 A;  4XNF A;  1TWC J;  2ZBK A;  4WXC A;  2E1M C;  2FEZ A;  1U8B A;  1F36 A;  1HQC A;  3T8T A;  1OCT C;  3PIP F;  2ZKZ A;  2Z99 A;  4W1U A;  4ZYH A;  5AIQ A;  3W2A A;  3RI4 A;  3KYL A;  4F55 A;  4BE2 A;  1S3J A;  3RKQ A;  3C3W A;  1WFX A;  3A2K A;  2XKO A;  2XF7 A;  2H8R A;  2XGD A;  3F6O A;  4HAM A;  3S1N J;  1UHS A;  2VKH A;  4CIC A;  4RMN A;  1F43 A;  3HHH A;  3HRS A;  5KAI C;  4QPQ A;  2OJE D;  1H8A C;  3DU5 A;  2JMW A;  3WTZ A;  4F93 B;  2WBM A;  1SFO J;  3FK7 A;  5DYM A;  2AXL A;  1N25 A;  2OF7 A;  1YYV A;  3TL4 X;  4IO9 F;  1ENH A;  2FE3 A;  2IXS A;  2LK2 A;  2QSH X;  1ZGW A;  2P6S A;  2Y0S N;  2CQN A;  4B3X A;  2O61 A;  3I55 I;  3K2Z A;  3B6A A;  1QBJ A;  1YIJ I;  2D1V A;  2COM A;  1JKP C;  3CDL A;  3ZCO A;  1I6H J;  1JE8 A;  1QO0 D;  2Z2S B;  1A35 A;  5FKL A;  3FXO A;  3KLN A;  1LVA A;  3E6C C;  1AA7 A;  2EJR A;  3LL7 A;  4XN0 A;  5IY5 H;  1LPQ A;  2K4B A;  5E1X A;  1GT0 C;  1G6N A;  1PP8 F;  1O57 A;  5J4Y A;  2VB6 A;  1IRG A;  1BI2 A;  2WB1 N;  3CLO A;  5F64 A;  9ANT A;  3DPU A;  1MMG A;  3R60 A;  2ETH A;  1NK2 P;  3HOW J;  4C30 A;  1Z91 A;  2VT3 A;  2RRE A;  3QOE A;  4CZZ A;  2QGU A;  4FX4 A;  2H1K A;  1FJL A;  2QEN A;  5FLX Z;  1IC8 A;  2YU3 A;  3IC7 A;  3QQA A;  4I0B A;  5B5E C;  2XSJ C;  3HC7 A;  2LD5 A;  2HFH A;  4G7O F;  3J7A O;  1XDS A;  2LY2 A;  3WE2 A;  5E18 F;  1BA5 A;  4ESJ A;  3OS2 A;  4U7D A;  4O6J A;  2MC3 A;  2JA7 J;  2ELK A;  1ZAO A;  4BY7 J;  3QAH A;  2VIX A;  4D5C A;  2M8E A;  3GEZ A;  1LDK B;  3ULQ B;  2M9H A;  1NHA A;  5LRS A;  1WKM A;  2F5F A;  2IA1 A;  2KRH A;  1JUS A;  2DA2 A;  2FMY A;  1CF7 A;  2L4A A;  3ZQF A;  2PI0 A;  1Y8R B;  2DA3 A;  1T33 A;  3MKL A;  4HQM A;  1AOY A;  4IRH A;  3ZXS A;  2VLA A;  2VI6 A;  1J2X A;  3HRT A;  3OYC A;  4DGW B;  2ZFU A;  1XB4 A;  1G4D A;  1KQ9 A;  3AG1 H;  4OIO F;  1K6Y A;  3ZQ7 A;  2R7F A;  5CLS A;  2QCO A;  3GTM J;  1RR7 A;  2QWW A;  2L5Q A;  1MMD A;  1U9O A;  3BZK A;  2EWN A;  2XRL A;  2YPR A;  3CF5 F;  4A2U A;  1OYY A;  1OCO H;  5M3M J;  1XG1 A;  4G6Q A;  1LDD A;  2V6C A;  4IF4 A;  1KQ0 A;  2GOX B;  4A5M A;  1OLT A;  1LDJ A;  2VQL A;  1R5I D;  4UUV A;  1V5E A;  1QZZ A;  2K7L A;  4PFO A;  4BE0 A;  1VTN C;  1KZH A;  3CCU I;  3FXM A;  1KON A;  4XOT A;  1MJA A;  2R7Q A;  1BI0 A;  3I0T A;  3DTK A;  2OZ6 A;  1P7I A;  2OV7 A;  3LAJ A;  1W7P A;  1W0U A;  4WXH A;  1U5T C;  4PSW A;  2EIM H;  4I2O A;  2HQN A;  2M4G A;  3RKW A;  5HLG A;  3WGH A;  2HTJ A;  2JA6 J;  1MIJ A;  2PN6 A;  2XSD C;  4CCJ A;  1GXQ A;  4JBA A;  2DAO A;  2E60 A;  3MFK A;  4JQF A;  3QRF F;  2EFP A;  1YOV B;  3M8E A;  3PNT A;  2OC6 A;  4CYC A;  4EM1 A;  3I56 I;  4Q47 A;  4QSH A;  4E7L A;  4ENM A;  1ORK A;  2YUS A;  1WJC A;  2JRM A;  5LHG A;  2ZME C;  2JA8 J;  4WX9 A;  2F5V A;  1OQY A;  3QOD A;  1IV6 A;  4LIU A;  4XLC A;  1Q1V A;  4KIS A;  1CF7 B;  3B02 A;  2QBY B;  3GBG A;  2DMT A;  3RIR A;  4IRI A;  2VOD A;  5CKT A;  1I1S A;  5HOD A;  1G8X A;  2IGN A;  2Z1D A;  1OFC X;  4W97 A;  3FM3 A;  4HF0 A;  5L3G A;  2FBI A;  3LNQ A;  2XGX A;  1SMY F;  2Y48 A;  3DEU A;  2OU2 A;  2HNH A;  4L9N A;  2IVM A;  4C3H J;  2DCE A;  1MSE C;  2DT6 A;  3A01 A;  4PZJ A;  1RUN A;  1VQ7 I;  1FIA A;  1L0O C;  3GTP J;  1EA3 A;  3S2H J;  1WZ2 A;  1DPR A;  1ZEL A;  2P7V B;  4M9X A;  3IWF A;  2A05 A;  3CO7 C;  3L00 A;  3MVP A;  2L7F P;  1JHF A;  5DM6 F;  2F6C A;  3ZPL A;  2LY1 A;  4A3L J;  5HLH A;  2KIM A;  1Y0N A;  2F4M B;  3LSK A;  1UB9 A;  1W7P B;  4ZJZ A;  4A69 C;  3TP0 A;  3WHC A;  2F5D A;  1FBS A;  4M73 A;  4DYR A;  1WI3 A;  1LVK A;  3JRG A;  1O3R A;  1YW9 A;  1IRZ A;  4EM0 B;  1XGM A;  3BT9 A;  3EYI A;  2IGM A;  3BDD A;  5DD8 A;  2LTP A;  5E8G A;  4KJZ A;  3HOX J;  1KA8 A;  1HXD A;  4B4C A;  2Z33 A;  3DEE A;  4C9Y A;  3H1C A;  3OYL A;  3MQ0 A;  5BOX A;  2DTZ A;  4CYC B;  2KLO A;  1GHC A;  1ETW A;  5LD2 C;  1EKE A;  3FK6 A;  2CO5 A;  4YIR X;  5J1U A;  1B8I B;  1JGS A;  3O8H A;  1O7L A;  2EFO A;  2DPU A;  1ZGJ A;  3DLL F;  3HZJ A;  5D6F A;  3CF2 A;  2EFQ A;  2PMZ N;  2A5Y B;  3MKY B;  1S7E A;  3B73 A;  1XTA A;  2HI3 A;  4KMU X;  5FD5 A;  2ESH A;  5M3F J;  2ZB9 A;  1YO5 C;  3H3V K;  5CVR A;  2VOO A;  1QPM A;  2XDV A;  3R61 A;  4JX5 A;  1V3F A;  3I58 A;  1FY7 A;  4HOB A;  4A5N A;  2ID6 A;  4O5V A;  3QPH A;  4BH9 A;  2XRO A;  3A01 B;  5E3N A;  2VC1 A;  2EZL A;  2XHK A;  1LE8 A;  1TT5 B;  1MH4 A;  2WTE A;  2XAS A;  1AHD P;  4XKB A;  2MD5 A;  3TED A;  5FKO A;  4XOR A;  3TMO A;  5K5R A;  2IT0 A;  4U0V A;  4YII A;  2F4O B;  1K6O A;  2PBI A;  3CP8 A;  2L54 A;  4LIV A;  2D2W A;  1T98 A;  2Z9O A;  4E7I A;  2AS5 F;  4P5O A;  3WU0 A;  2E1O A;  4BBR J;  3W6J B;  2GWR A;  3GVA A;  1ZQ3 P;  2VBZ A;  2LG4 A;  1WJE A;  2KPM A;  4MTE A;  4MHG A;  4H4K C;  3VEP A;  1S72 I;  2WV0 A;  1BOA A;  2E1M B;  3A02 A;  4X6A J;  1TW2 A;  4A3D J;  3QWL A;  4RAF A;  4L0Z B;  4FX0 A;  3WTW C;  2R7X A;  2B0L A;  3TW7 A;  4L9V A;  3ZN1 A;  4BKX A;  2XAH A;  3DFG A;  1G59 A;  3PNY A;  3K4N A;  4M3G A;  1IO2 A;  4I7H A;  3V7R A;  4PDK A;  3KIO A;  3SHF A;  3ML6 A;  3H0D A;  4HQE A;  5KK1 A;  2VKE A;  2E36 A;  2JWT A;  4OMY A;  5IOZ A;  3F8B A;  1X2N A;  4ESB A;  4OAY A;  3KET A;  2P5L C;  4IOC F;  2CS3 A;  2DO7 A;  2XVC A;  3U21 A;  4BGD A;  1O3Q A;  1UHM A;  3HUG A;  2ELJ A;  2ZXJ A;  5FD6 A;  1LJ9 A;  3CCJ I;  2IW5 A;  2LP0 A;  2V1X A;  2UXN A;  3JSP A;  1HC8 A;  2K86 A;  3WGI A;  4I6Z A;  2E5Z A;  3KCC A;  2X85 A;  4HEA 2;  1VQ6 I;  1X1D A;  3HOY J;  4M6X A;  3J7A Y;  1YS6 A;  1HW1 A;  5IT9 K;  4A3B J;  3BR2 A;  3M9A A;  2HR3 A;  2GIV A;  1LE8 B;  3TOB A;  5FRN A;  2P5V A;  3BJA A;  3FIS A;  4AVZ A;  1R23 A;  1TWH J;  3DTE A;  5TIS C;  4IEJ A;  4Y15 A;  2RAE A;  2EFN A;  5J3L A;  3O3K A;  5J1R A;  4YFN F;  1R58 A;  1UG2 A;  3LA2 A;  1YTY A;  4HF2 A;  3COA C;  3GTK J;  2CU7 A;  4QIW N;  3GFM A;  2V7F A;  4BDY A;  2UWM A;  1MBJ A;  1XN7 A;  4RS8 A;  2R92 J;  2NVQ J;  1ETX A;  1JT6 A;  5E20 A;  2EBI A;  2HXO A;  3W2W A;  1JUP A;  3LOC A;  4I01 A;  2KMU A;  2JK3 A;  1IXC A;  3E1S A;  1BI1 A;  1U5T A;  3V7C A;  3PJR A;  2E2J J;  1FTT A;  4RM2 A;  4AC0 A;  1QGP A;  2ZXH A;  2K9L A;  1XGO A;  1TLH B;  3GFI A;  4NHJ A;  1WSU A;  3LA7 A;  2CUF A;  2X4H A;  3BQZ A;  3HKZ A;  1OJL A;  4ZTJ A;  1D3Y A;  4ITV A;  1GLN A;  4BAC A;  1T2K A;  2GXG A;  4B3A A;  2PMU A;  3AG4 H;  2L01 A;  1UMQ A;  5KVR A;  5F27 A;  3S2W A;  3ZMD A;  5C4X J;  2X0L A;  2HOS A;  3HUG B;  4OU0 A;  4EGZ A;  4LK0 F;  4EJV A;  1JT0 A;  3VFZ A;  2CW7 A;  4PJJ A;  1SAX A;  2XAJ A;  1ZG1 A;  4AUX A;  4OIR F;  4C3I J;  3DQV C;  3JAM Z;  2K5C A;  2WAD A;  2K02 A;  2BEO A;  4OIN F;  3D0S A;  5GAD J;  1Z67 A;  2ZXW H;  2PLY A;  2OAZ A;  4HX8 A;  3CCE I;  1H0M A;  4HA8 A;  3EUK L;  3Q3S A;  4A3G J;  3TGN A;  1SC7 A;  1X3U A;  5E1Z B;  4RLF A;  5H6Q A;  1VQ9 I;  4L18 B;  4LLN A;  1YJW I;  4QLC U;  1KQ8 A;  5BQT A;  1WJD A;  1J59 A;  3EDP A;  2EFW A;  2ME0 A;  3M1C A;  5J6X A;  4OOI A;  2LYC A;  3TW6 A;  4R1H A;  4DYQ A;  1MBH A;  1W4M A;  4IOA F;  1HOM A;  1KU7 A;  5LRR A;  1SAU A;  1FP2 A;  3V42 A;  2MA3 A;  5DV5 A;  1LFU P;  2W1O A;  3HGY A;  1JJ8 C;  4CO8 A;  3ABT A;  3GZ5 A;  2ME6 A;  2X9D A;  4FAS D;  1MDM A;  1U5T B;  2IGO A;  5ICF A;  5FB2 A;  4CYD A;  1VQK I;  2AXT C;  4PJN A;  5KAF C;  2BY2 A;  2QUF A;  4MTD A;  1N77 A;  2XC7 A;  3QU3 A;  2UZK A;  1AKH A;  3LWF A;  4UB6 C;  2EA4 A;  4M6V A;  3IAM 2;  2DA4 A;  5CQG A;  1YX5 A;  2LBF B;  3S17 J;  2KP6 A;  3M8J A;  2R7D A;  3H9J A;  2ZME B;  2FUG 2;  3ECO A;  4HST A;  4PGH A;  3FKJ A;  3F9K A;  1X1C A;  4S05 A;  2F48 A;  4KYW A;  1STZ A;  2HDD A;  5L3C A;  1PDN C;  3SQN A;  4HSR A;  4F3Q A;  2YX7 A;  3ABL H;  3PQJ A;  2HU9 A;  1M1E B;  2CRG A;  1IAW A;  4BNC A;  1WPK A;  1E3P A;  3T0Y A;  2D1H A;  1X2M A;  1ERD A;  3GYH X;  2ESN A;  4A3I J;  4XSZ F;  1DP3 A;  3RKX A;  3GUD A;  1X4O A;  3H5A A;  3O2P E;  3S14 J;  2VC0 A;  1FBQ A;  1Z7U A;  2HVQ A;  5IYC J;  1ETO A;  3KX2 A;  4XIC A;  2LC2 A;  3OYH A;  4KIG A;  4L9J A;  1FC3 A;  4ZDL A;  3L7W A;  1VQ5 I;  4RBO A;  2Q1Z B;  1JXS A;  4EJO A;  2QKL B;  4LD5 A;  3SDB A;  4MFE A;  2QVO A;  5D4R A;  3R4K A;  2DT7 B;  3KZZ A;  3FBN B;  1U8R A;  5B66 C;  3K4J A;  1MW7 A;  1QPI A;  2OD5 A;  1IV8 A;  3RYR A;  1R22 A;  2L4M A;  4HW0 A;  1SFK A;  5JHU A;  5BS6 A;  1IXS B;  1S7A A;  2ICW G;  3HSE A;  4B1R A;  4ZZL A;  4E7Z A;  3ZQL A;  1MDM B;  1T56 A;  2G9W A;  1FOY A;  4ZH4 F;  2NOJ B;  1MMN A;  1FLI A;  2E7W A;  3K4K A;  1VQP I;  1TL8 A;  4G6T B;  4U7B A;  4QWQ A;  4A3E J;  3IKT A;  2KIU A;  1UEL B;  2YS9 A;  4K2E A;  1AKH B;  1E3H A;  1YRN B;  3DP7 A;  4N9H A;  2LRD A;  2VJJ A;  1AU7 A;  1VQN I;  2BV6 A;  4LMY A;  3I59 A;  2MG4 A;  4EJU A;  2XUB A;  2PJR B;  2VE9 A;  5FO5 A;  2H27 A;  2KRF A;  4UUT A;  3DBH B;  3OIO A;  3VYR B;  3HOZ J;  4KUM A;  3M1E A;  4RB0 A;  4XLF A;  2WV1 A;  1TQM A;  4KIC A;  4KMF A;  2DJN A;  3H9G A;  2R4G A;  3S8P A;  3OV8 A;  2XPV A;  2VKD A;  3JTH A;  5E1W A;  4WWC A;  2XB0 X;  3ZQQ A;  3WTS C;  4MQV A;  1W7P D;  1YW8 A;  4ZC3 A;  2XF5 A;  1D1B A;  3V4G A;  3CJR B;  3MCZ A;  1EH6 A;  3L2R A;  4DW6 A;  3A4C A;  3HOU J;  2EQR A;  2CUJ A;  2A6E F;  2RVC A;  4XID A;  2XGE A;  2EA2 A;  2GQQ A;  1OYI A;  4IHS A;  1RRJ A;  5DUI A;  1R1T A;  2Y69 H;  4OIQ F;  1W1W E;  1YHQ I;  4UVB A;  1YIT I;  1X1A A;  3DTI A;  4IZZ A;  3E5X A;  2IP2 A;  1RC9 A;  2J5P A;  2Y75 A;  3BR0 A;  4P96 A;  2C6Y A;  4YG2 F;  2QYO A;  1Z9C A;  2EV5 A;  1VQL I;  1B72 A;  1R4N B;  2E5N A;  3K70 C;  2HOA A;  4EMS A;  5FKN A;  3GCM A;  1D0Z A;  1RET A;  3HEF A;  2G0E A;  3MAJ A;  3OOP A;  4G7H F;  2F5C A;  5D5W B;  4IHT A;  3ASN H;  4PJL A;  1OCZ H;  1E17 A;  2QF7 A;  2IRF G;  2KRC A;  3FM5 A;  4A3F J;  4FQG A;  3SFI A;  2IAI A;  1SVM A;  3ZGK A;  3LSP A;  3M07 A;  4U88 A;  3DBL B;  1R4M B;  5HDN A;  2CW0 F;  1ZLK A;  1OMI A;  5A2Q Z;  1YJ9 I;  2EIN H;  4PJM A;  3I59 B;  4D7M A;  3GF2 A;  2DYS H;  1Z77 A;  3KPH A;  5F0C A;  1Z6R A;  2CMP A;  3BY6 A;  3VSK A;  5EF6 A;  3HTS B;  5M5W J;  4N4N B;  4B47 A;  4I0A A;  4D7N A;  2R7S A;  2L0K A;  2LFB A;  1T0F A;  1SVO A;  5FKK A;  5C44 J;  3CMY A;  1OCP A;  1HLV A;  3G2B A;  1S8N A;  4P9F A;  3G73 A;  1L3L A;  4XKC A;  4B09 A;  1BC8 C;  4G12 A;  1ACI A;  1SD6 A;  5JVG F;  1OR7 C;  2NRA C;  3S3O A;  2W00 A;  2ZJP F;  2L2O A;  2DYR H;  3DBR B;  3B6C A;  3I53 A;  3LMM A;  5K1Y A;  2HKO A;  4BS9 A;  3MMY B;  3WU1 B;  2K9S A;  2V9P A;  2HEO A;  4MNU A;  1FMV A;  1WVR A;  4U0Y A;  3SJM A;  3CC4 I;  3ABM H;  3A1Y A;  2OQR A;  2HTS A;  3MZY A;  4Q5S F;  1HA8 A;  5IOY A;  2CQK A;  2E35 A;  2JZY A;  2FML A;  2FU4 A;  3SDG A;  1S7O A;  4ENJ A;  5J8F A;  1B72 B;  1A04 A;  2GOM A;  2DDB A;  1D0Y A;  1MD0 A;  1WWX A;  2X1E A;  3I9V 2;  3IUO A;  3LA3 A;  1MND A;  4LB5 A;  4AID A;  4JP0 A;  3W6V A;  4WK8 F;  2Y2Z A;  1W5S A;  2XB5 A;  3Q5F A;  3OL3 A;  4D9J A;  2DFH A;  3OYG A;  4XLA A;  3H35 A;  3GZN B;  3HRM A;  2WC2 A;  1W5T A;  4I76 A;  4LLG F;  4HDV A;  1B9N A;  1FOW A;  1EV7 A;  1MBG A;  1T39 A;  3TO6 A;  3LFU A;  5CVI A;  3U2R A;  1FNN A;  2CG4 A;  2HVS A;  3TKY A;  1MJB A;  2VAS A;  2DQR A;  1DP7 P;  4OAZ A;  2LF8 A;  3FBI B;  1IN8 A;  4IL6 C;  4MO7 A;  2R0Q C;  2R7Z J;  1Y0U A;  1BR2 A;  4XKW A;  1FYM A;  1BL0 A;  4AD9 A;  1J9I A;  2JPC A;  3J81 Z;  1O4X A;  1ZGA A;  1J0R A;  1IDY A;  3BZ6 A;  4P1W A;  5GPA A;  3Q0V A;  1JKO C;  4A3M J;  2X48 A;  1TQP A;  1TWA J;  3CLQ A;  5H6R A;  2FX0 A;  5HDG A;  1D1C A;  2NXN B;  4RLQ A;  3HBL A;  4ZYE A;  1Z21 A;  5L3D A;  1ETV A;  3CCS I;  2ZNY A;  3JTG A;  1K78 A;  1Y8Q B;  3Q0W A;  2HZD A;  4CCN A;  3G1L A;  5J47 A;  3J80 Z;  3JW4 A;  3JSO A;  1UHW A;  2GXA A;  5J40 A;  1OPC A;  1X58 A;  5GAH J;  4YRV A;  1R36 A;  4CDG A;  3QPL A;  4HG2 A;  3OIQ A;  3UNG C;  3P7N A;  1RNL A;  5F6F A;  4Y52 J;  2E34 A;  1HKT A;  5ERI A;  2RV8 A;  2V1U A;  4RGU A;  2N8G A;  4GYG A;  3E97 A;  1IW7 F;  3JRB A;  2A61 A;  4XMY A;  1IN7 A;  2JT1 A;  3DPT A;  4DQ2 A;  1WJ5 A;  2XKP A;  3HHG A;  4LFU A;  2DK8 A;  2R7V A;  1FT9 A;  2EB7 A;  1MZB A;  5LGU A;  3ZN0 A;  2EZH A;  1XGS A;  1ZR2 A;  1IN5 A;  2XRN A;  2IS1 A;  3HKZ N;  4E7J A;  2G7H A;  4UY8 I;  4B44 A;  4P55 A;  3GLX A;  4RB1 A;  2W25 A;  3M3Y J;  5JI6 A;  5BMZ A;  1LNW A;  4HNU A;  2DOF A;  2V9K A;  3RCO A;  4PFP A;  5ICG A;  5FFX A;  1FZP B;  3FXL A;  3HRU A;  4LK1 F;  1WJA A;  2O03 A;  1AWC A;  2XAU A;  2ISY A;  2ELH A;  2WAQ A;  2Q8K A;  4BQA A;  2E1N A;  4CCK A;  4CCL A;  2LRE A;  3ZOB A;  5EG0 A;  3I4N J;  3RPU D;  2MLK A;  2BY0 A;  2E7X A;  5K5Q A;  1K78 B;  2QLZ A;  5D5V B;  3LQR A;  1EH7 A;  3HIF A;  1WRJ A;  1ZN2 A;  5DEQ A;  2W57 A;  4BY1 J;  3U1D A;  2O5R A;  2VOP A;  1ETK A;  5E17 F;  2M5W A;  5BPI A;  3BG9 A;  3T1B A;  2PX9 A;  2L3D A;  5EYR A;  3CD6 I;  2LSO A;  1YX3 A;  2M34 A;  4FHT A;  3IAS 2;  3HOS A;  2V1D A;  3IWZ A;  3RTR A;  1HDD C;  1EH8 A;  2A69 F;  1ON2 A;  2RQQ A;  5DM7 F;  2EV6 A;  4XN3 A;  1TZL A;  3HSF A;  4GXO A;  1R1U A;  1Y56 A;  3OYK A;  5ICC A;  2PG4 A;  1RES A;  1OCR H;  1U2W A;  5D4S A;  1SFU A;  5B1A H;  2W24 A;  3OY9 A;  4B48 A;  1J09 A;  4ZYD A;  1QZY A;  4GRI A;  2W82 A;  3HL2 A;  4M9Z A;  3SZT A;  1KU3 A;  3EQL F;  3LSJ A;  1WQ2 A;  3TDZ C;  4E70 A;  2WAF A;  4C3J J;  3I3L A;  5HS8 A;  1R6R A;  1BW6 A;  3JRI A;  1Y39 A;  3K69 A;  4BDZ A;  1Z0X A;  5LLQ A;  2R7U A;  1VZ0 A;  1EF4 A;  2DQL A;  4NQW A;  3HG9 A;  2ZJ2 A;  4ENN A;  2CQX A;  1S9H A;  4TV7 A;  2KDO A;  3I4M J;  1B1B A;  2JA2 A;  3GTG J;  1DU6 A;  4AIH A;  4IPA A;  3S2D J;  3KZI C;  2H6C A;  4QTR A;  3FMR A;  1K4T A;  1OR7 A;  5IP7 J;  5KNL A;  2CV0 A;  3E0J B;  1RKW A;  2CV1 A;  4II2 A;  4CXF A;  1FP1 D;  4M6Y A;  1QRY A;  1JHH A;  3MKW B;  1IG7 A;  2ECC A;  3HTU A;  5TRD A;  1X1B A;  3CP2 A;  5HS9 A;  2UV1 A;  2RDP A;  3R0J A;  1S29 A;  1T38 A;  4JOM A;  2KT0 A;  3DWL E;  3QYB A;  1EJ9 A;  4FE7 A;  3G1O A;  4YFK F;  2DU9 A;  4PUS A;  4FET A;  4G8X A;  3LSG A;  1ULY A;  2HOT A;  1QVU A;  3BCB A;  1R7J A;  1V5F A;  5IT3 A;  1H9T A;  3WTT C;  3VPR A;  4AIK A;  1MMA A;  3I71 A;  2AQF A;  5M5Y J;  5HOO A;  4MLO A;  3EUA A;  4ABZ A;  3W6K B;  3KYD B;  1ZKG A;  4BHB A;  1ZRE A;  2RKH A;  1GV5 A;  2VXZ A;  2CSO A;  4A0Z A;  4CH7 A;  3NAU A;  1LUJ B;  2A5W A;  5FRO A;  4BQQ A;  2DA7 A;  4DNC A;  2RQP A;  2MFZ A;  1I27 A;  2ISZ A;  1UJ8 A;  1D5Y A;  2K27 A;  2VQG A;  4YIF A;  1CGP A;  4NQW B;  3K1M A;  2HQ5 A;  3FMS A;  3OR1 C;  3F8N A;  1DGW Y;  2OZU A;  3G3Z A;  2L02 A;  4BU2 A;  3IRQ A;  2QA4 I;  1HW2 A;  1RPW A;  2LH9 A;  1X19 A;  2NS7 A;  4AYB A;  2Y9Y A;  3W2V A;  4NBQ A;  3HXL A;  1RKT A;  1W5C C;  1IN4 A;  3L9F A;  2EPF A;  2BVL A;  4XLH A;  3SEZ A;  1HKS A;  3DKX A;  5F0H A;  2X6O A;  2CV2 A;  2GM4 A;  3Q9V A;  5JLX A;  4IQJ A;  1V54 H;  1J75 A;  2ADU A;  1QZE A;  5CPR B;  5KCM A;  4EJW A;  1MGT A;  4IHW A;  4HPQ A;  2A3S A;  1P2F A;  4B8X A;  5IP6 A;  1HCR A;  3CCR I;  3JRH A;  1BR1 A;  1O7F A;  4G6D A;  1DUX C;  4AIJ A;  1O3S A;  1JI8 A;  1D5V A;  2VKV A;  3IV5 A;  2WY8 Q;  4BE1 A;  4NUB A;  3K4L A;  3CCV I;  2X51 A;  2M87 A;  2R5Y A;  2L9S A;  3AG3 H;  2LNB A;  3REO A;  3RPU A;  2BZT A;  2NAZ A;  4CCM A;  3FX3 A;  4RB2 C;  1G3T A;  2F2E A;  2UXX A;  3BR3 A;  3BRO A;  2HYF A;  4MEX F;  1TW3 A;  1YG2 A;  2XAF A;  1ETY A;  4XOP A;  4LG0 A;  5FLM J;  1IUY A;  4ETS A;  3K2A A;  3J7Z I;  4EGY A;  2GIZ A;  5TGT A;  5GTH C;  3K10 A;  1KGS A;  1BIB A;  1F4K A;  1T0F C;  3CMM A;  3BG6 A;  3FXQ A;  4H0E A;  5FLX K;  1Z05 A;  3M8F A;  3PQK A;  3ZQG A;  2IBD A;  2VN2 A;  3KE2 A;  3WU2 C;  1ZRC A;  4S0H B;  1S6L A;  2BHY A;  4KT5 C;  3ZRG A;  3WGG A;  4BHC A;  4BJ5 C;  1SEU A;  1MKM A;  3K4C A;  2EH3 A;  4LOC A;  4WXD A;  2M7A A;  3AL0 C;  2M4K A;  2KIQ A;  3SYT A;  4C2T A;  1C0W A;  2R7O A;  4N4O B;  2QKM B;  1USS A;  2LMD A;  3NQO A;  4RAZ A;  3F23 A;  2HOE A;  3CQZ J;  3BR5 A;  2V4J C;  4M3F A; 
#chains in the Genus database with same CATH homology
 5JVT A;  1V4R A;  2O3F A;  4N9I A;  1KYZ A;  1F5T A;  1XD7 A;  2O8X A;  3KP2 A;  3ROU A;  1DDN A;  1R5H A;  4MEY F;  1FYL A;  1QNT A;  1WI9 A;  3TO7 A;  2FBH A;  3GO5 A;  3J80 K;  2FBK A;  3D5L A;  1YFH A;  4JK1 X;  2HDC A;  1FSE A;  1LEA A;  4IXA A;  3K1N A;  4ZYG A;  1FBU A;  5FFZ A;  2IA0 A;  4M71 A;  2GZW A;  3BP8 A;  3E6M A;  5L3E A;  2BBY A;  1B9M A;  2QQB A;  4NB5 A;  5HVQ C;  4LG0 B;  3GXO A;  5JFR A;  3IHU A;  4KN7 X;  2FNP A;  3TDU C;  1TNS A;  1B59 A;  1LQ1 A;  4HLX A;  5BPD A;  1ON1 A;  5LHH A;  4CHU A;  4UVA A;  1OKR A;  1J5Y A;  4EQQ A;  1UCR A;  5CYV A;  2PJP A;  2H6B A;  2VBY A;  2JPB A;  4HLY A;  1ZYR F;  1PP7 U;  2FNA A;  2Q2E A;  1B4A A;  5AON A;  2VE8 A;  2P8T A;  1E2X A;  4LB6 B;  3ABU A;  2DI3 A;  2H94 A;  5H20 A;  5E8I A;  4HYE A;  2MLG A;  1UFM A;  2BYV E;  2H09 A;  1XCV A;  1FOK A;  2O0Y A;  3FHZ A;  4XRF A;  3LFK A;  1ZG5 A;  1XMK A;  1K7A A;  4RGX A;  4IVN A;  2KIF A;  3FXU A;  3P9I A;  5LHI A;  2FF4 A;  1P6R A;  2M30 A;  3E5U A;  3KP4 A;  2HZT A;  1XSD A;  2IJL A;  4RB3 C;  5K5O A;  1LEB A;  1YLF A;  5LGN A;  2FOK A;  3VOD A;  1Z1D A;  4U0W A;  3L09 A;  2RC4 A;  3TQN A;  2DK5 A;  3I64 A;  4M9S A;  3E6D A;  1FPQ A;  4BHP A;  3K0L A;  4KDP A;  4F7Z A;  1DPU A;  2FXA A;  4Z2Y A;  2JTV A;  4A6E A;  3DKW A;  4UVC A;  3QP6 A;  2DPD A;  3KEO A;  5ED4 A;  2NNN A;  5D8K B;  3FF5 A;  4G9Y A;  2VBW A;  4UV9 A;  1GXP A;  3V8K A;  4AWX B;  1HST A;  3E3V A;  3HYI A;  1BC7 C;  1G3W A;  6PAX A;  2OA4 A;  3NEU A;  2ZNZ A;  4MGR A;  2FSW A;  1P4W A;  2M1B A;  5LEJ A;  1SFE A;  3WG9 A;  2JSC A;  1FSH A;  1I6X A;  2YSR A;  4GGG A;  3GW2 A;  2PEX A;  3EYY A;  1ODD A;  3U9G A;  4KN4 X;  2GXB A;  1XCB A;  3R6S A;  4A0X A;  4A6D A;  5IT9 Z;  1ZG3 A;  1UST A;  1YQA A;  4WF2 A;  3RKY A;  3EUH A;  1KU9 A;  2FQ3 A;  3O6B B;  2QZ8 A;  3KP6 A;  3SXY A;  4M74 A;  2P4W A;  5TJJ A;  5CVV A;  2A6H F;  2Z3Y A;  3QPT A;  2TDX A;  1SD4 A;  4KIF A;  1SFX A;  4EVI A;  3GWZ A;  1G3Y A;  1ZH5 A;  1YS7 A;  3K1P A;  1K79 A;  3CDH A;  1BBY A;  1FX7 A;  5FGM A;  3IKV A;  2MH9 A;  3WTY C;  1TQI A;  4L9T A;  1R1V A;  1QQI A;  1SD7 A;  2NS0 A;  2JRT A;  1D8J A;  3KEQ A;  1KYW A;  3BPX A;  3ZP5 A;  4PGG A;  1HBX G;  2HWV A;  2IPQ X;  3F6V A;  4HX4 A;  2ZO4 A;  1R5G A;  5D6E A;  3JAM K;  2Y0M A;  2KJC A;  2QBY A;  3ZMV A;  3FMQ A;  4GO1 A;  2E1C A;  3MWM A;  4KNY A;  4O3M A;  3ZMS A;  1XSX A;  2RGV A;  5LBQ A;  3KP5 A;  2PFB A;  4IJA A;  1XGN A;  2OBP A;  4YFX F;  1PUE E;  2QM3 A;  3MEX A;  4I02 A;  4I98 B;  1HSJ A;  3EET A;  5DCM A;  2VT2 A;  3H92 A;  2K4J A;  3BWG A;  2RNJ A;  4BYY A;  4Q5S F;  2XAG A;  4RGS A;  3CJN A;  1SD5 A;  4KFC A;  4HBL A;  2PQ8 A;  2LDU A;  5ICE A;  2KKO A;  2DFI A;  2KJB A;  1ZRD A;  1FYK A;  1O3T A;  3BOQ A;  3V8J A;  5LGT A;  3KP7 A;  5JR3 A;  4HX7 A;  1ZLJ A;  3CO6 C;  3FZV A;  1I5Z A;  3ZMT A;  5ILV A;  4HDU A;  3ECH A;  3N4M A;  4RAY A;  3LQQ A;  3P9C A;  3HOT A;  5DDG A;  2OQG A;  1TNT A;  3F72 A;  3P9K A;  1P4X A;  1BM9 A;  3ZMU A;  3ERE D;  4RGR A;  1RZ4 A;  1MJ9 A;  5DCM B;  1FWZ A;  4CGZ A;  3GX4 X;  3WTX C;  4WCG A;  2Z5U A;  2G7U A;  3L2C A;  1GVJ A;  2J5O A;  4GYI A;  3DF8 A;  5DD4 A;  4Y17 A;  4EV0 A;  3TOA A;  2F5E A;  1KU2 A;  2CFX A;  4L0Y B;  5HLI A;  5CVJ A;  1IN6 A;  2XAQ A;  2FA5 A;  2STW A;  2GA2 A;  2HS5 A;  3RPQ A;  3CUQ C;  3KLO A;  1ZAR A;  3IL2 A;  3F22 A;  4KIB A;  1J7K A;  2VON A;  3V8L A;  2W85 A;  2LF7 A;  2HQR A;  3C18 A;  1REP C;  5L3B A;  4UV8 A;  3F8M A;  1B6A A;  4ENK A;  2CGP A;  4LLL A;  2A07 F;  3SZP A;  2EK5 A;  3WTV C;  2DTR A;  3K9T A;  3DPL C;  5D8L B;  5A2Q K;  2CYY A;  3BPV A;  3PFI A;  3KFW X;  1F9N A;  4UXN A;  1P4A A;  5EEH A;  3GFL A;  3H3U A;  1F1Z A;  4L5I A;  3DXJ F;  3M7G A;  3IRR A;  4A12 A;  4BXU A;  3TO9 A;  2DBB A;  4R79 A;  3T8R A;  1IXR C;  1G3S A;  5CVU A;  1T6S A;  2BGC A;  2R3S A;  5HS7 A;  2HGC A;  1LB2 A;  1RUO A;  3RDI A;  3GFJ A;  1IRF A;  4I09 A;  4P9U A;  2STT A;  3DV8 A;  1BN5 A;  4Y13 A;  2HYG D;  2EV0 A;  4M72 A;  3WTU C;  1RI7 A;  1HW5 A;  3MZH A;  4G94 A;  4LGW A;  4HZF A;  2IA2 A;  4HF1 A;  4A0Y A;  1XSV A;  3QP5 A;  3E5Q A;  2D45 A;  4D0P A;  2NYX A;  4PCQ A;  3WOD F;  4S04 A;  3C1D A;  3R0A A;  3KP3 A;  1OYW A;  1TBX A;  1Z6T A;  2ZFW A;  4UHT A;  1D8K A;  1ONV A;  5F1R A;  3F8C A;  3BJ6 A;  4Q4Z F;  3I5U A;  2ACJ A;  3N97 A;  2ZME A;  4L5J A;  3J81 K;  2WWY A;  2XV4 S;  2QQ9 A;  1P92 A;  3BJO A;  3I4P A;  1YW7 A;  2W84 A;  5AIP A;  2MBF A;  5EEG A;  2NNY A;  4ESF A;  4KA4 A;  4GCV A;  2PMH A;  5D5X B;  2P6T A;  1YIO A;  3I54 A;  2O6G E;  2P5K A;  2HKX A;  1HKQ A;  2GA1 A;  1RIO H;  3ELK A;  1IZ1 A;  1XDU A;  4BAY A;  4XSX F;  3RYP A;  2MH2 A;  2QQA A;  4G7Z F;  3ISP A;  1IF1 A;  1ZRF A;  4XLN F;  3LST A;  3LAP A;  4HV5 A;  3T5X A;  3V7S A;  3QOP A;  2VBX A;  4EJT A;  2DT5 A;  4OIP F;  3E6B A;  5L3F A;  4MQ9 F;  4Q48 A;  3CUQ A;  3VB2 A;  3WE3 A;  2P7C B;  2DW4 A;  3FWE A;  1BJA A;  3Q9S A;  2XIG A;  4UNO A;  5DUK A;  5DCF A;  1Q1H A;  4ON0 A;  3QU6 A;  3C7J A;  5ILS A;  1BI3 A;  4ZZD A;  1H9G A;  2CWE A;  3RJP A;  4HV6 A;  1R00 A;  4EM2 A;  2LKP A;  3VOE A;  2RN7 A;  5CJ9 A;  5D5U B;  4ASN A;  3FXR A;  4N0B A;  1TTY A;  5LEK A;  3GZ6 A;  3SFZ A;  1SMT A;  4XBF A;  3CUO A;  2FRH A;  3HSR A;  1U3E M;  4FT8 A;  4R8H A;  3NRV A;  2M45 A;  5J8C A;  2Q0O A;  2YR2 A;  3ZMZ A;  1ZHF A;  5ILU A;  2A68 F;  2ZCW A;  2V79 A;  2YX4 A;  3KZY A;  4LJZ F;  3CUQ B;  4IRG A;  4OMZ A;  2DLL A;  2BE5 F;  4AVP A;  3F8F A;  2GAU A;  3CTA A;  3H3Z A;  1BIA A;  1U78 A;  5HDK A;  4XLP F;  1I1G A;  3F3X A;  1U6G A;  3AAF A;  2V9V A;  1XMA A;  3F21 A;  4WXC A;  2ZBK A;  2FEZ A;  1HQC A;  3T8T A;  2ZKZ A;  2Z99 A;  4ZYH A;  5AIQ A;  3RI4 A;  1S3J A;  3C3W A;  2XKO A;  3F6O A;  4HAM A;  4CIC A;  3HHH A;  3HRS A;  3WTZ A;  5DYM A;  2AXL A;  1YYV A;  2FE3 A;  2P6S A;  2O61 A;  3K2Z A;  1QBJ A;  2D1V A;  2COM A;  1JE8 A;  1QO0 D;  3KLN A;  1LVA A;  3E6C C;  2EJR A;  2K4B A;  5E1X A;  1G6N A;  1PP8 F;  1O57 A;  1IRG A;  1BI2 A;  5F64 A;  3CLO A;  3R60 A;  2ETH A;  1Z91 A;  2VT3 A;  4CZZ A;  4FX4 A;  2QEN A;  5FLX Z;  2YU3 A;  3IC7 A;  4I0B A;  2HFH A;  4G7O F;  3J7A O;  1XDS A;  5E18 F;  3WE2 A;  4ESJ A;  4U7D A;  4O6J A;  2MC3 A;  1ZAO A;  3QAH A;  2M8E A;  3GEZ A;  1LDK B;  3ULQ B;  1NHA A;  5LRS A;  1WKM A;  2F5F A;  2IA1 A;  2FMY A;  1CF7 A;  2L4A A;  2PI0 A;  4HQM A;  1AOY A;  4IRH A;  3HRT A;  1J2X A;  1XB4 A;  1G4D A;  1KQ9 A;  4OIO F;  3ZQ7 A;  2R7F A;  5CLS A;  2QWW A;  2EWN A;  2YPR A;  4A2U A;  1OYY A;  4G6Q A;  1LDD A;  2V6C A;  4IF4 A;  1KQ0 A;  4A5M A;  1LDJ A;  4UUV A;  1QZZ A;  2K7L A;  1VTN C;  1MJA A;  1BI0 A;  3I0T A;  2OZ6 A;  3LAJ A;  1W7P A;  4WXH A;  1U5T C;  4I2O A;  2HQN A;  3RKW A;  5HLG A;  3WGH A;  2HTJ A;  2PN6 A;  1GXQ A;  4JBA A;  2DAO A;  3MFK A;  4JQF A;  3QRF F;  2EFP A;  3M8E A;  4EM1 A;  4ENM A;  4Q47 A;  5LHG A;  4WX9 A;  1CF7 B;  3B02 A;  2QBY B;  3RIR A;  4IRI A;  2VOD A;  1I1S A;  3FM3 A;  4HF0 A;  5L3G A;  2FBI A;  2XGX A;  1SMY F;  2Y48 A;  3DEU A;  2OU2 A;  4L9N A;  2IVM A;  4PZJ A;  1RUN A;  1L0O C;  1DPR A;  2P7V B;  4M9X A;  3IWF A;  3CO7 C;  3L00 A;  1JHF A;  3ZPL A;  5HLH A;  2KIM A;  1UB9 A;  1W7P B;  1O3R A;  2F5D A;  1FBS A;  4M73 A;  1YW9 A;  4EM0 B;  1XGM A;  3EYI A;  5E8G A;  3BDD A;  5DD8 A;  1KA8 A;  1HXD A;  2Z33 A;  5BOX A;  3MQ0 A;  1GHC A;  2CO5 A;  1JGS A;  1O7L A;  2EFO A;  2DPU A;  1ZGJ A;  5D6F A;  2EFQ A;  2A5Y B;  3B73 A;  5FD5 A;  4KMU X;  2ESH A;  1YO5 C;  5CVR A;  2VOO A;  1QPM A;  3R61 A;  1V3F A;  3I58 A;  1FY7 A;  4HOB A;  4A5N A;  4O5V A;  2XRO A;  3QPH A;  4BH9 A;  2VC1 A;  2XHK A;  2WTE A;  2XAS A;  2MD5 A;  5K5R A;  2IT0 A;  4U0V A;  4YII A;  1K6O A;  2PBI A;  2L54 A;  2D2W A;  1T98 A;  2Z9O A;  2AS5 F;  4P5O A;  3WU0 A;  3W6J B;  2GWR A;  3GVA A;  2VBZ A;  4MTE A;  4MHG A;  3VEP A;  2WV0 A;  1BOA A;  1TW2 A;  4L0Z B;  4FX0 A;  3WTW C;  2B0L A;  4L9V A;  3ZN1 A;  2XAH A;  3DFG A;  4I7H A;  3V7R A;  4PDK A;  3SHF A;  3ML6 A;  4HQE A;  5KK1 A;  4OMY A;  3F8B A;  4ESB A;  3KET A;  2P5L C;  2DO7 A;  2XVC A;  1O3Q A;  1UHM A;  3HUG A;  2ZXJ A;  5FD6 A;  1LJ9 A;  2IW5 A;  2V1X A;  2UXN A;  3JSP A;  2K86 A;  3WGI A;  3KCC A;  4M6X A;  1YS6 A;  1HW1 A;  5IT9 K;  3M9A A;  2HR3 A;  2GIV A;  3TOB A;  2P5V A;  3BJA A;  1R23 A;  4Y15 A;  2EFN A;  3O3K A;  4YFN F;  1R58 A;  3LA2 A;  1YTY A;  4HF2 A;  3COA C;  3GFM A;  2UWM A;  1XN7 A;  4RS8 A;  5E20 A;  4I01 A;  1IXC A;  1BI1 A;  1U5T A;  3V7C A;  1QGP A;  1XGO A;  1TLH B;  3GFI A;  4NHJ A;  1WSU A;  3LA7 A;  2X4H A;  1D3Y A;  1T2K A;  2GXG A;  2PMU A;  2L01 A;  5KVR A;  3S2W A;  3ZMD A;  2X0L A;  4OU0 A;  4EGZ A;  4LK0 F;  4EJV A;  3VFZ A;  1SAX A;  2XAJ A;  1ZG1 A;  4OIR F;  3DQV C;  3JAM Z;  2K02 A;  2BEO A;  4OIN F;  3D0S A;  2PLY A;  2OAZ A;  4HX8 A;  1H0M A;  4HA8 A;  3TGN A;  1X3U A;  5E1Z B;  5H6Q A;  4L18 B;  4LLN A;  4QLC U;  1KQ8 A;  5BQT A;  1J59 A;  3EDP A;  2EFW A;  5J6X A;  4OOI A;  4R1H A;  1W4M A;  1KU7 A;  5LRR A;  1FP2 A;  2MA3 A;  5DV5 A;  4CO8 A;  3ABT A;  3GZ5 A;  1MDM A;  1U5T B;  5ICF A;  5FB2 A;  4CYD A;  2QUF A;  4MTD A;  3QU3 A;  2UZK A;  3LWF A;  2EA4 A;  2R7D A;  2ZME B;  3ECO A;  4PGH A;  4S05 A;  4KYW A;  1STZ A;  5L3C A;  1PDN C;  3SQN A;  2YX7 A;  3PQJ A;  1IAW A;  4BNC A;  3T0Y A;  2D1H A;  3GYH X;  2ESN A;  4XSZ F;  3RKX A;  3GUD A;  3O2P E;  2VC0 A;  1FBQ A;  1Z7U A;  4KIG A;  4L9J A;  1FC3 A;  3L7W A;  1JXS A;  4EJO A;  4LD5 A;  2QVO A;  5D4R A;  3R4K A;  3KZZ A;  1U8R A;  2OD5 A;  3RYR A;  5JHU A;  1R22 A;  2L4M A;  4HW0 A;  5BS6 A;  1IXS B;  1S7A A;  3HSE A;  4ZZL A;  1MDM B;  2G9W A;  4ZH4 F;  1FLI A;  2E7W A;  4U7B A;  4QWQ A;  3IKT A;  2KIU A;  4K2E A;  3DP7 A;  4N9H A;  2BV6 A;  4LMY A;  3I59 A;  4EJU A;  2XUB A;  2VE9 A;  5FO5 A;  2H27 A;  2KRF A;  4KUM A;  3M1E A;  4RB0 A;  1TQM A;  4KIC A;  4KMF A;  3OV8 A;  3JTH A;  5E1W A;  4WWC A;  3WTS C;  4MQV A;  1W7P D;  1YW8 A;  3V4G A;  3MCZ A;  1EH6 A;  2A6E F;  2RVC A;  2EA2 A;  2GQQ A;  1OYI A;  4IHS A;  5DUI A;  1R1T A;  4OIQ F;  4UVB A;  3E5X A;  2IP2 A;  2J5P A;  2Y75 A;  2C6Y A;  4P96 A;  4YG2 F;  2QYO A;  1Z9C A;  2EV5 A;  4EMS A;  3MAJ A;  3OOP A;  4G7H F;  2F5C A;  5D5W B;  4IHT A;  1E17 A;  2IRF G;  3FM5 A;  4U88 A;  5HDN A;  2CW0 F;  1ZLK A;  1OMI A;  5A2Q Z;  3I59 B;  3GF2 A;  1Z6R A;  3BY6 A;  3HTS B;  4I0A A;  1T0F A;  1S8N A;  4P9F A;  3G73 A;  1L3L A;  4B09 A;  1BC8 C;  1SD6 A;  2NRA C;  3I53 A;  5K1Y A;  2HKO A;  3WU1 B;  2HEO A;  4MNU A;  4U0Y A;  2OQR A;  2HTS A;  3MZY A;  2CQK A;  2JZY A;  2FML A;  2FU4 A;  4ENJ A;  1S7O A;  5J8F A;  1A04 A;  1WWX A;  1MD0 A;  3LA3 A;  4LB5 A;  4WK8 F;  1W5S A;  3Q5F A;  3HRM A;  2WC2 A;  1W5T A;  4LLG F;  4HDV A;  1B9N A;  1EV7 A;  1T39 A;  3TO6 A;  5CVI A;  3U2R A;  1FNN A;  2CG4 A;  3TKY A;  1MJB A;  2DQR A;  1DP7 P;  2LF8 A;  1IN8 A;  1Y0U A;  1FYM A;  4AD9 A;  1J9I A;  2JPC A;  3J81 Z;  1ZGA A;  1J0R A;  3BZ6 A;  5H6R A;  1TQP A;  5HDG A;  4ZYE A;  5L3D A;  2ZNY A;  3JTG A;  1K78 A;  3J80 Z;  3JW4 A;  3JSO A;  1UHW A;  1OPC A;  1R36 A;  4CDG A;  3P7N A;  1RNL A;  5F6F A;  1HKT A;  5ERI A;  2RV8 A;  2V1U A;  4RGU A;  4GYG A;  3E97 A;  1IW7 F;  2A61 A;  1IN7 A;  2JT1 A;  3DPT A;  4DQ2 A;  2XKP A;  3HHG A;  4LFU A;  2DK8 A;  1FT9 A;  2EB7 A;  1MZB A;  5LGU A;  3ZN0 A;  1XGS A;  1IN5 A;  2XRN A;  2G7H A;  4P55 A;  3GLX A;  4RB1 A;  2W25 A;  5JI6 A;  5BMZ A;  1LNW A;  5ICG A;  5FFX A;  1FZP B;  3HRU A;  4LK1 F;  2O03 A;  1AWC A;  2ISY A;  2ELH A;  4BQA A;  2Q8K A;  2E1N A;  2MLK A;  2E7X A;  5K5Q A;  1K78 B;  2QLZ A;  5D5V B;  3LQR A;  1EH7 A;  3HIF A;  1WRJ A;  1ZN2 A;  5DEQ A;  2W57 A;  3U1D A;  2VOP A;  5E17 F;  2M5W A;  5BPI A;  3T1B A;  2L3D A;  2LSO A;  4FHT A;  3HOS A;  2V1D A;  3IWZ A;  3RTR A;  1EH8 A;  2A69 F;  1ON2 A;  2EV6 A;  3HSF A;  4GXO A;  1R1U A;  5ICC A;  2PG4 A;  1U2W A;  5D4S A;  1SFU A;  2W24 A;  4ZYD A;  1QZY A;  4M9Z A;  3SZT A;  1KU3 A;  3EQL F;  3TDZ C;  1WQ2 A;  4E70 A;  5HS8 A;  3K69 A;  5LLQ A;  2DQL A;  4NQW A;  2ZJ2 A;  4ENN A;  4TV7 A;  1B1B A;  4AIH A;  4IPA A;  2H6C A;  3FMR A;  1OR7 A;  4CXF A;  1FP1 D;  4M6Y A;  1JHH A;  3HTU A;  5TRD A;  5HS9 A;  2RDP A;  3R0J A;  1S29 A;  1T38 A;  4YFK F;  2DU9 A;  4G8X A;  1ULY A;  1R7J A;  5IT3 A;  1H9T A;  3WTT C;  4AIK A;  3I71 A;  5HOO A;  3W6K B;  4BHB A;  1ZRE A;  2RKH A;  2VXZ A;  2CSO A;  4A0Z A;  4DNC A;  2RQP A;  1I27 A;  2ISZ A;  2K27 A;  4YIF A;  1CGP A;  3K1M A;  3FMS A;  3F8N A;  2OZU A;  3G3Z A;  2L02 A;  3IRQ A;  1HW2 A;  1IN4 A;  3L9F A;  1HKS A;  3Q9V A;  1J75 A;  2ADU A;  4EJW A;  1MGT A;  2A3S A;  1P2F A;  4B8X A;  1O7F A;  4G6D A;  1DUX C;  4AIJ A;  1O3S A;  1D5V A;  2M87 A;  2LNB A;  3REO A;  3RPU A;  2NAZ A;  3FX3 A;  4RB2 C;  1G3T A;  2F2E A;  2UXX A;  3BRO A;  2HYF A;  4MEX F;  1TW3 A;  1YG2 A;  2XAF A;  4LG0 A;  1IUY A;  4ETS A;  4EGY A;  1KGS A;  1BIB A;  1F4K A;  5FLX K;  3FXQ A;  4H0E A;  1Z05 A;  3M8F A;  3PQK A;  2VN2 A;  3KE2 A;  1ZRC A;  1S6L A;  4KT5 C;  3WGG A;  4BHC A;  1MKM A;  4WXD A;  1C0W A;  1USS A;  3NQO A;  4RAZ A;  3F23 A;  2HOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...