2FBIA

The crystal structure of transcriptional regulator pa4135
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
136
structure length
136
Chain Sequence
RPSLTLTLLQAREAAMSFFRPSLNQHGLTEQQWRVIRILRQQGEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAPKDQRRVYVNLTEKGQQCFVSMSGDMEKNYQRIQERFGEEKLAQLLELLNELKKIKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords probable transcriptional regulator
publication title The crystal structure of transcriptional regulator PA4135
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription
total genus 57
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fbiA00
1I5ZA 4AIKA 3GX4X 4BH9A 2QUFA 3I4PA 1FY7A 2IVMA 1FBSA 4IJAA 3DXJF 3EUHA 4MHGA 1HW1A 1HSTA 4A2UA 3L00A 4O6JA 1U6GA 2LF7A 1LDKB 1FX7A 2HTSA 1YS6A 1ZG5A 4KT5C 3P9IA 1S7AA 4PCQA 3ECHA 4M6YA 2ADUA 1RUNA 3W6JB 2FEZA 2KIMA 3WTZA 4MEXF 3KP2A 2NRAC 4ZZDA 1P2FA 1KU2A 2PMHA 3T0YA 1XGOA 2UWMA 4LG0A 4EGZA 5K1YA 3FXQA 3CO6C 4KICA 4LG0B 2X4HA 1G3WA 3F22A 2YX4A 4PGHA 3E5XA 4OIQF 2H09A 1DDNA 2UXNA 3K2ZA 2FNPA 1MJ9A 1LVAA 1FSHA 2XV4S 5E1XA 4LLGF 2VONA 5ICEA 1IN6A 2CW0F 3RIRA 2CGPA 2KIFA 4HA8A 1OYYA 3M9AA 4WK8F 1F9NA 2DTRA 3C3WA 2X0LA 2HQRA 4RS8A 4U0WA 1RNLA 3I58A 3RYPA 2XAGA 2GWRA 4HZFA 3MFKA 2F5FA 3KP4A 3QU6A 2M87A 1USTA 3CDHA 3I54A 3V7CA 3CUQA 2O61A 5D5VB 3U9GA 1D5VA 4JK1X 1VTNC 3I53A 5DCMB 4A0ZA 4HDVA 2XAHA 4AIHA 4L5JA 4OIPF 4LK1F 4GCVA 3FM5A 3RJPA 1S7OA 3I71A 2LKPA 5E18F 3MAJA 3ZMTA 1QZZA 1Z91A 1UHWA 2MH2A 2M5WA 4M9XA 4CHUA 1YIOA 4KN7X 4RGUA 4A12A 4N9HA 4YFXF 4EJVA 2QQAA 1YW9A 2CO5A 5ILUA 3F8CA 2LF8A 4KIBA 3ZPLA 2W57A 4U0VA 2JRTA 3LQQA 2OBPA 3HHGA 3TOAA 4A5NA 3RPQA 3F6VA 2Q8KA 5EEHA 2A07F 2DPUA 4EJOA 1J59A 1EH7A 3L9FA 3GYHX 5L3FA 5AIQA 5K5OA 2K4JA 3TDUC 2BEOA 3L7WA 3KE2A 1XMKA 5K5RA 5IT9K 1R5GA 3R4KA 1K78A 4PDKA 1C0WA 3DQVC 3C1DA 2VN2A 4UVAA 2KRFA 2NAZA 2EFOA 5LGNA 5DD8A 3WTTC 2DK5A 3U1DA 1JGSA 2IA2A 4IHSA 3VODA 1T39A 2ESHA 3JTHA 1CF7B 3MEXA 2CFXA 2ETHA 1QGPA 5DUKA 1G3TA 1UFMA 5ICCA 1U5TB 3WGHA 1XDSA 1YQAA 1E2XA 1IAWA 3GLXA 3HRTA 3ZMVA 3VEPA 2K86A 2EV0A 1ODDA 2Z5UA 1SFEA 3EQLF 2E1NA 2P4WA 1E17A 1MGTA 4KIFA 3OOPA 1FOKA 2D1VA 4HF2A 3IL2A 1JHFA 3KCCA 1KGSA 3M8FA 2A5YB 2ACJA 2Z3YA 5FLXZ 4LB6B 1ZHFA 4RB0A 3I0TA 4DNCA 1IN5A 4IPAA 1K6OA 1Q1HA 4AWXB 2VE8A 4CZZA 2A6EF 1XCVA 5AONA 5HS8A 3HHHA 2FBKA 1FP1D 4M72A 3LAJA 2QQBA 3WODF 1LNWA 5D4SA 4ZYEA 4CDGA 3F21A 1F5TA 4U7BA 3ZMDA 2V1XA 1B9MA 2O8XA 1SMTA 5L3BA 3I5UA 4ENKA 1W7PD 3KLNA 2DBBA 1QQIA 2FOKA 2EA4A 5HDGA 1KYWA 2W25A 3WTYC 5TJJA 2VT2A 1CGPA 3KP7A 2E7WA 4KNYA 1KYZA 2O6GE 1U5TC 3DKWA 2BBYA 4I98B 3IC7A 1FSEA 1KU7A 2PJPA 2NS0A 1I1SA 3LQRA 4R8HA 1I6XA 2QZ8A 5DCFA 1U8RA 2XRNA 4CO8A 2NNNA 3CLOA 1DPRA 1HXDA 3WU1B 1DPUA 2XAQA 3LAPA 1STZA 2G7UA 2HEOA 2LSOA 2P7VB 1FBQA 4MEYF 1MD0A 1O3QA 3NEUA 3EYYA 2DQLA 1ZRDA 1FPQA 2QBYB 2DT5A 4LFUA 2RGVA 3EDPA 3Q9SA 1MZBA 4CICA 2E1CA 2A68F 2TDXA 4CYDA 1SFUA 3ZN0A 1J0RA 5DEQA 2RC4A 5CVUA 1B4AA 2GA2A 1D8JA 1ON1A 3V7RA 1ZGAA 2FU4A 4RB2C 1BBYA 2FMYA 5LHGA 1ZGJA 1EV7A 3ZN1A 5E8IA 4OIRF 1Z05A 4WXDA 4O3MA 3ML6A 4HLYA 3GFMA 4ETSA 1KU9A 5JFRA 2VXZA 2DAOA 3BY6A 3KP6A 2QYOA 5FGMA 1G3YA 3ZMUA 1IXSB 3TO9A 1W4MA 3K1PA 1UHMA 3F8BA 3TQNA 4K2EA 3TOBA 1YLFA 1KU3A 2OU2A 2EWNA 2ZKZA 4XBFA 2GXGA 1W7PA 1WI9A 3WGIA 1BI1A 3WTWC 5H6RA 5ED4A 1FYKA 3RPUA 1PUEE 3HOSA 2YX7A 5IT3A 1L0OC 4AIJA 2VOPA 5AIPA 2WTEA 3FM3A 3FZVA 1FBUA 3HRMA 2L4MA 1I27A 2PLYA 3S2WA 3V7SA 3GWZA 3RDIA 1TTYA 5IT9Z 1TLHB 4L18B 2PI0A 2HR3A 3DEUA 2EFPA 2GZWA 2YR2A 4WF2A 2OZUA 3WGGA 1USSA 3CUOA 1O7LA 1HW2A 2GXBA 2BGCA 4WXHA 4M6XA 4KDPA 4KUMA 3RTRA 2PQ8A 2OA4A 4BAYA 2XIGA 5CYVA 3JAMK 3E3VA 3J81K 1R00A 3C7JA 5HS9A 1XSVA 5CJ9A 1QBJA 4M71A 3QU3A 3ROUA 5LGTA 4WCGA 1LJ9A 5KK1A 4MQVA 1BM9A 2FMLA 2FSWA 3LWFA 4CXFA 2EV5A 5BOXA 4G8XA 1J7KA 2DK8A 1BN5A 3DPTA 3MWMA 3LA3A 2DW4A 1D3YA 2IT0A 4OIOF 1T6SA 2Y75A 4LK0F 2ZCWA 4YFNF 4RB3C 4HOBA 3O2PE 4G9YA 3F8NA 1U78A 1P6RA 2CYYA 4WWCA 5CVIA 2MD5A 1JXSA 3GFIA 1TQIA 2H6BA 3LA7A 1SD4A 2ZNYA 2DU9A 1YTYA 2L02A 2P5KA 1Z6TA 2B0LA 4HV6A 2YSRA 3BDDA 1XSDA 2QLZA 4B8XA 4MTEA 2XVCA 5H20A 2EA2A 3H3UA 2O0YA 2D2WA 4P9UA 4NQWA 5LLQA 2F2EA 4HQMA 3F23A 1GXQA 1H9TA 2V1DA 1RUOA 1G6NA 3ABUA 2FQ3A 4Y13A 3TGNA 2ESNA 3CUQB 2DLLA 3GXOA 2IRFG 3U2RA 1D8KA 4WX9A 3G3ZA 4RAZA 3HSEA 3BJ6A 1T2KA 1GHCA 3KZZA 5D8LB 1TNSA 3C18A 4BHCA 4ENJA 3KFWX 5L3CA 2FBHA 1FT9A 3E97A 5JR3A 2GQQA 1IXCA 3EETA 4GO1A 4HX7A 2V79A 5E17F 3LSTA 4I09A 1H0MA 5DUIA 3GF2A 1BI2A 5HDKA 3H3ZA 3ERED 1ZYRF 2STTA 2ZO4A 1HKQA 5ILVA 5F64A 3SHFA 5LHIA 1ZRCA 5LGUA 2MLGA 3BP8A 3K9TA 2RNJA 4I0BA 4ZYDA 3JSOA 3H92A 3HIFA 2FRHA 2Z33A 1GXPA 2OD5A 3VB2A 1YG2A 1XDUA 1ZH5A 5FO5A 2RV8A 5HLHA 1DUXC 1K78B 5D6FA 1OPCA 4KYWA 4GXOA 2A3SA 3ZMSA 1R1TA 2GA1A 3PQJA 3CUQC 4HYEA 2JT1A 2ZJ2A 3P9CA 1XN7A 2R7FA 2P5LC 4HF1A 4H0EA 5CVJA 2OQRA 1MJAA 2MBFA 1QNTA 4A6EA 3MQ0A 4LB5A 2L3DA 3VOEA 5DDGA 3T1BA 2R3SA 2AS5F 1SD7A 4NHJA 3BOQA 3RI4A 1O3TA 1ONVA 2FXAA 4I7HA 3Q9VA 4MNUA 5HVQC 3P9KA 4UVCA 5D5XB 2VODA 4GGGA 4LLLA 2OAZA 1IRGA 4ZYGA 4PGGA 1IZ1A 1XGSA 3WU0A 3K1NA 4P5OA 1IRFA 4G7OF 1R1VA 3JW4A 3E6CC 3IWZA 2HS5A 2FA5A 2IJLA 1OKRA 1SMYF 2P6SA 4B09A 2KKOA 4ESBA 5LHHA 4Q5SF 1SAXA 4G7ZF 1FC3A 2ZBKA 1P4AA 3IHUA 3QP6A 3R6SA 2G9WA 4WXCA 3NQOA 1T98A 3E6DA 5ICFA 1LEBA 2FNAA 1BJAA 1P92A 4P55A 4BNCA 1J75A 3JAMZ 4OMZA 3Q5FA 4XLPF 2GIVA 5DYMA 3QP5A 5J6XA 3OV8A 3J81Z 1O3SA 1PP7U 2OQGA 2J5PA 4Y17A 2H6CA 2JPCA 2LDUA 1LDDA 4U88A 2UZKA 3GEZA 3DP7A 4N0BA 1ZLKA 2H94A 3HOTA 4DQ2A 3F8MA 3J80K 5H6QA 2F5CA 4L9VA 2D1HA 3GO5A 3BPXA 5ILSA 4BHPA 2CG4A 2UXXA 1JHHA 1ZREA 2XUBA 2BV6A 3BZ6A 1LEAA 5CVVA 3WE3A 4LD5A 4Q4ZF 2PMUA 3K1MA 4F7ZA 2HTJA 4S04A 3SFZA 2V1UA 2O03A 3SZTA 2FBIA 1FLIA 1WQ2A 1MKMA 1WSUA 2M1BA 3FMSA 4I2OA 3RKWA 1IW7F 5L3DA 1IN8A 3IKTA 2XROA 4YG2F 1OYIA 5JVTA 4KIGA 2QM3A 3DFGA 1BC7C 2K02A 2R7DA 4D0PA 2EB7A 2CSOA 2K7LA 3PQKA 1H9GA 4YFKF 1QPMA 5CVRA 4HX4A 1B1BA 4E70A 5FFXA 1S3JA 1WRJA 1REPC 2P7CB 2IPQX 2RN7A 1FNNA 2JSCA 3IRRA 3BJAA 4FT8A 2DPDA 4UNOA 2RVCA 4UHTA 2J5OA 3AAFA 2KJCA 1K7AA 3IRQA 5D5UB 4EVIA 3P7NA 3T5XA 3KEOA 1BOAA 3GZ5A 4IRGA 1B9NA 3FHZA 3SQNA 3BROA 1J9IA 2FE3A 2P8TA 4AVPA 4U0YA 3IKVA 1W7PB 3WTXC 2M8EA 4IVNA 2XGXA 4U7DA 2WC2A 2DQRA 1AWCA 3CO7C 2XASA 1JE8A 4XSXF 4YIFA 4TV7A 4ZH4F 1SD5A 2PN6A 1XCBA 5JI6A 4GYGA 4OOIA 1FYLA 3IWFA 4YIIA 2NNYA 2F5DA 2PBIA 3R60A 5LEJA 1DP7P 3BJOA 1BIAA 1XGNA 2CWEA 3RKXA 4HF0A 3T8RA 2ZMEA 1A04A 5HLGA 4N9IA 5FD6A 1Z7UA 4L0YB 3QRFF 3F72A 3G73A 3QPHA 3MZHA 1R7JA 3R61A 2BYVE 4L0ZB 1ZG3A 3VFZA 2ZNZA 3B73A 1LDJA 5DD4A 4EJWA 3F3XA 4Q47A 1KQ9A 3M7GA 2HZTA 3LA2A 2D45A 4EQQA 4MGRA 1BI3A 5A2QK 1XGMA 1R23A 1QO0D 1MDMA 4KMFA 4L5IA 1SD6A 1MDMB 3ZMZA 4BYYA 2MC3A 2MLKA 4ASNA 4KMUX 1W5SA 5D8KB 3JSPA 1OR7A 3M8EA 1J5YA 1YS7A 1TW2A 3GFLA 2EFWA 4L9JA 3WE2A 3EYIA 1KQ0A 1NHAA 3L2CA 4ENNA 5E1WA 5DV5A 4XSZF 3MZYA 3M1EA 5D6EA 1MJBA 4FHTA 1U3EM 2COMA 3RYRA 4NB5A 4XLNF 5L3EA 1G4DA 3WTVC 3COAC 3MCZA 5LBQA 1PDNC 5D5WB 3V4GA 1P4XA 2EJRA 3ISPA 4EMSA 4KFCA 3HRSA 1R22A 2GAUA 2XKPA 1R1UA 3K0LA 1X3UA 2IW5A 1O3RA 3W6KB 4G6DA 1V3FA 2M30A 4I01A 5HLIA 2QVOA 5E1ZB 2XKOA 1IUYA 3N4MA 4P96A 5F6FA 1XMAA 2HDCA 5HDNA 2HWVA 2PEXA 3I59A 3O6BB 1YW7A 3I59B 2CQKA 3FXUA 1TQMA 4IRIA 3SZPA 1G3SA 1Z9CA 3QPTA 4O5VA 3E5QA 3E6MA 3J80Z 2QWWA 1W5TA 4KA4A 4MTDA 5DCMA 4EJUA 1HQCA 1OMIA 4P9FA 1SFXA 3GZ6A 4GYIA 4OMYA 3CTAA 5J8CA 2ELHA 2L54A 5HOOA 4OINF 1U2WA 2A61A 2P5VA 3WTUC 4RGSA 4A5MA 2XAFA 2M45A 5TRDA 1WKMA 4UUVA 5ICGA 2F5EA 4G6QA 2VOOA 2HOEA 1KA8A 1Z1DA 2V9VA 3FF5A 2VBZA 2ISYA 3KP5A 3L09A 3R0AA 2C6YA 2Q0OA 2ZXJA 4HBLA 3FX3A 3HSFA 2RKHA 3N97A 4LGWA 1I1GA 4EM1A 4IHTA 6PAXA 4G7HF 2KJBA 3D0SA 4OU0A 2Z9OA 2ZFWA 4IRHA 4ENMA 3ULQB 2AXLA 4ZZLA 4BHBA 1YW8A 1IXRC 4MQ9F 2EK5A 2VE9A 4CGZA 3TDZC 2HGCA 3V8LA 1ZAOA 2XAJA 4AD9A 4Y15A 1B6AA 1R58A 2WWYA 2HKOA 5E8GA 1IN4A 2VC1A 2RQPA 3J7AO 2PFBA 1UCRA 1CF7A 4UV9A 4I02A 3PFIA 5CLSA 4Z2YA 3TO7A 1TBXA 1XSXA 4EM0B 2JTVA 1FWZA 2W84A 4M9ZA 4A0XA 1U5TA 5BPIA 3HRUA 5E20A 2DO7A 2IA0A 1L3LA 2HQNA 4R79A 5BS6A 3HTUA 3RKYA 5D4RA 1HW5A 3FXRA 2STWA 1F4KA 3V8KA 4EM2A 4QWQA 2JZYA 4HX8A 3O3KA 1ZARA 4A0YA 4BQAA 2H27A 2XHKA 1O7FA 4PZJA 3CJNA 2EV6A 3HSRA 2PG4A 4L9TA 4QLCU 5BPDA 5J8FA 4HW0A 2A69F 4RGRA 1ON2A 3KZYA 4S05A 1ZN2A 2FF4A 2DI3A 1EH8A 2EFNA 2HYFA 4LMYA 2Z99A 4HQEA 3HYIA 2WV0A 2VBXA 3WG9A 4ZYHA 3ABTA 4RGXA 2W24A 5LRRA 2E7XA 2VBYA 4UXNA 5F1RA 4HV5A 1HKSA 1OYWA 5HS7A 5A2QZ 2YPRA 2BE5F 3BWGA 5FB2A 4IF4A 1PP8F 4RAYA 5FD5A 3JTGA 2P6TA 2OZ6A 3ECOA 3R0JA 3I64A 4KN4X 3NRVA 3DV8A 3GFJA 3FMQA 3LFKA 1O57A 1BI0A 1XB4A 2ISZA 4XRFA 5K5QA 2JPBA 3FWEA 2NYXA 2W85A 1F1ZA 5LEKA 1FYMA 4R1HA 3D5LA 2HKXA 4I0AA 1WWXA 5BQTA 1LB2A 2QENA 5FFZA 2DFIA 1YFHA 4JQFA 4ON0A 4FX4A 3F6OA 4HLXA 1ZG1A 3K69A 1TNTA 3E6BA 1QZYA 1HBXG 1FZPB 4UVBA 3ZQ7A 1LQ1A 3KP3A 1T38A 4LLNA 1RI7A 1R5HA 1S6LA 2RDPA 3WTSC 1ULYA 3GVAA 3BPVA 1K79A 2K27A 3REOA 2QBYA 4RB1A 2VC0A 2A6HF 5LRSA 1BC8C 3ZP5A 3TO6A 1HKTA 1KQ8A 2KIUA 3T8TA 2G7HA 5L3GA 1J2XA 2VBWA 1R36A 4G94A 1B59A 2IP2A 2L01A 2VT3A 3E5UA 1XD7A 4L9NA 3KEQA 4BXUA 1V4RA 4M73A 1IN7A 1EH6A 4EV0A 4Q48A 1RIOH 2MA3A 2QQ9A 3GUDA 2Y48A 3KETA 4LJZF 3TKYA 3HTSB 1RZ4A 1S8NA 1UB9A 1TQPA 2EFQA 5EEGA 2MH9A 5ERIA 3SXYA 4ESFA 1S29A 2HFHA 2V6CA 4HDUA 1TW3A 2O3FA 5KVRA 1Y0UA 1ZLJA 4HAMA 3GW2A 3QAHA 1IF1A 4UV8A 3V8JA 4JBAA 5BMZA 3ELKA 4EJTA 2Q2EA 2Y0MA 1ZRFA 1AOYA 1GVJA 1T0FA 4FX0A 1YYVA 4EGYA 4A6DA 5JHUA 3FMRA 3F8FA 3B02A 3DPLC 5FLXK 1FP2A 1HSJA 2ZMEB 3HUGA 2K4BA 2HYGD 3DF8A 2YU3A 1P4WA 2IA1A 2LNBA 1Z6RA 3KLOA 1YO5C 4M74A 1BIBA 3QOPA 2L4AA 4M9SA 4ESJA 4IXAA
chains in the Genus database with same CATH superfamily
2CQ7A 3SZGA 1I5ZA 4AIKA 3GX4X 3JCUC 2OF7A 2QUFA 4BH9A 3I4PA 3OYFA 3W2AA 1FY7A 2G0EA 3LOCA 2IVMA 1XC5A 1FBSA 4IJAA 4HNTA 3DXJF 3NWSA 3EUHA 4PSXA 1NTCA 5E3NA 1V5GA 1XMXA 1X58A 1R6RA 2H8WA 1HW1A 4MHGA 3ZQFA 4BE0A 1HSTA 3H1CA 1IV8A 3L2RA 4A2UA 3L00A 3HZJA 2HYJA 4BE1A 4LIUA 4O6JA 3FBNB 3O8GA 3VDXA 2EIKH 4D7NA 1U6GA 2LF7A 3K4KA 1LDKB 2LY2A 2VQHA 4ABZA 1FX7A 1IG7A 2HTSA 3CF5F 1YS6A 1ZG5A 2CUFA 4KT5C 3P9IA 1S7AA 4PCQA 3ECHA 4M6YA 3ZQLA 2ADUA 1RUNA 3W6JB 2B9SA 4PJJA 2KRCA 2FEZA 4DBQA 1P9QC 2KIMA 2HQAA 4U87A 1HOMA 2CQXA 3WTZA 4MEXF 3KP2A 2NRAC 1OQYA 2LH9A 4IQJA 4ZZDA 1P2FA 1KU2A 4LITA 2PMHA 2DYRH 3KYCB 3T0YA 4QPOA 3S3MA 4PK4A 4C3IJ 1VQ6I 4DZJA 1XGOA 1SFOJ 2QSFX 1P7JA 2AXTC 2UWMA 2DMQA 2EILH 3CQZJ 4LG0A 2RQQA 4EGZA 3FXMA 3FXQA 5K1YA 3CO6C 4KICA 4LG0B 4C9YA 2X4HA 1UG0A 1G3WA 4OWRB 2MGQA 3F22A 1X1BA 2YX4A 3CJTB 4PGHA 4EATA 3E5XA 3WHBA 2H09A 4DIQA 3CMEI 4OIQF 2LC2A 1DDNA 2UXNA 2OCCH 2E1OA 3K2ZA 2FNPA 2O9LA 2NXNB 2YS9A 3O8HA 4KT6A 1I3AA 2Z2SB 1MJ9A 1LVAA 1FSHA 2XV4S 4JX4A 2R7TA 5E1XA 4LLGF 1VQ9I 2VONA 2HVSA 5ICEA 1IN6A 3PIOF 1RC9A 2CW0F 2W82A 3RIRA 2CGPA 2DTZA 2KIFA 1GV2A 4JX5A 4HA8A 1OYYA 2KL4A 3AFHA 3M9AA 2UV1A 2VIXA 4WK8F 1IRZA 1F9NA 2DTRA 3CF2A 1VQMI 3C2BA 2X0LA 3C3WA 2HQRA 2K85A 3OL4A 4RMNA 4RS8A 2EZKA 4U0WA 3K4CA 5C44J 4PFOA 2F4MB 4XRSG 4II3A 2CV1A 1RNLA 3I58A 3RYPA 4CUGA 3OY9A 2XAGA 1WJDA 2GWRA 2K9QA 4HZFA 3MFKA 2F5FA 3IP4B 5IYBJ 2IBDA 2K40A 2P0WA 3KP4A 3S93A 3QU6A 3BT9A 2M87A 2IGKA 4F55A 1USTA 4KJZA 3CDHA 1OCZH 3I54A 3V7CA 2KDZA 3A2KA 5J4YA 3CUQA 2O61A 5D5VB 3EPZA 3U9GA 3FHNA 1D5VA 2KP6A 2R7OA 4JK1X 3I53A 3CCQI 4ANJA 1OR7C 1VTNC 5F08A 3S32A 2HOSA 3LSHA 5DCMB 4A0ZA 4I76A 4HDVA 2XAHA 4AIHA 4F3QA 4L5JA 1H8AC 4OIPF 4LK1F 4GCVA 3FM5A 4PJMA 4HNUA 3RJPA 1S7OA 3DTKA 3I71A 2LKPA 2DN0A 1AA7A 4ITVA 4Y3OA 5E18F 2CU7A 3MAJA 3GTQJ 1OLTA 3ZMTA 4DW6A 1QZZA 2BY0A 2ZXWH 1HDDC 1YJNI 2GOXB 1Z91A 1UHWA 2R7ZJ 2MH2A 2M5WA 5EYRA 4M9XA 4CHUA 4A3GJ 2LREA 1YIOA 4KN7X 3HOZJ 4RGUA 4A12A 4N9HA 2M4KA 3UNGC 4YFXF 1X4OA 4EJVA 3EUKL 1LPQA 2X6XA 4AUXA 3H0GJ 2QQAA 1YW9A 2CO5A 5ILUA 1Y6IA 3F8CA 2LF8A 4KIBA 4Y33A 2HOAA 3ZPLA 1IC8A 3K70C 2W57A 4U0VA 3JR9A 2JRTA 2QF7A 2NVUB 2YU9J 3LQQA 3TBIA 1Q1VA 1T95A 2OBPA 3HHGA 3TOAA 1VF9A 3CCYA 4A5NA 4B3XA 3OYLA 2LKXA 3RPQA 4RAGA 4AVZA 2K9NA 3E7LA 3F6VA 3PSFA 2Q8KA 4EEFG 3ZXSA 2HU9A 1JT6A 5EEHA 4YRVA 2HDDA 3FBIB 4XLHA 2A07F 2DPUA 4EJOA 3C2HA 5B1AH 2ICWG 3MN2A 3ASNH 2VLAA 4B1RA 1J59A 4A3DJ 1EH7A 3L9FA 3QPSA 4BQQA 1LFBA 2Y31A 3GYHX 5L3FA 1JUMA 2OUMA 5AIQA 5K5OA 1T08B 2OTJI 2K4JA 4DYCA 2LKSA 5IP7J 1YRNA 4BXXJ 4HEA2 3TDUC 2ELKA 2X9DA 2BEOA 1OISA 3OOUA 4B4CA 4I6ZA 4FCYA 3L7WA 1ORKA 3KE2A 4HSRA 1XMKA 2KZGA 5K5RA 5IT9K 1R5GA 3R4KA 4OAZA 1K78A 1VQ5I 4PDKA 2LBFB 3DQVC 1C0WA 3C1DA 2VN2A 4UVAA 3H35A 2BZTA 2E5NA 2KRFA 2NAZA 3LSRA 1ZTRA 3FXKA 2EFOA 5LGNA 4W1UA 4YIRX 1ZR2A 5DD8A 3WTTC 1K4TA 2DK5A 1X4PA 3BR5A 2WY7Q 1FOYA 2BHZA 1JGSA 3U1DA 1Z3XA 1OCTC 2JQ7A 2MABA 2IA2A 4IHSA 3VODA 1T39A 2ESHA 3JTHA 1CF7B 3ASOH 4X6AJ 3MEXA 5CQEA 1B8IB 1DU6A 2CFXA 2ETHA 1QGPA 5DUKA 5F0FA 2HVRA 4IHWA 2MG4A 1G3TA 2W1OA 4N4OB 1UFMA 4MIMA 5ICCA 1U5TB 4M6VA 1DP3A 3WGHA 2E36A 3KYDB 1XDSA 1YQAA 1E2XA 1IAWA 2I5UA 4DBRA 2LY9A 4MFDA 2EZLA 4BQOA 3GLXA 4C3JJ 5IP6A 3HRTA 1BW6A 3ZMVA 3VEPA 2K86A 2EV0A 4PJ0C 4BE2A 3ZQCA 1ODDA 3TP3A 2Z5UA 1SFEA 4OAYA 4GDFA 4E7LA 3EQLF 2E1NA 1WJAA 2P4WA 1MGTA 4KIFA 1E17A 3A03A 3OOPA 1FOKA 2D1VA 4HF2A 3IL2A 2L7KA 1MMSA 3LFUA 2VPRA 2JUCA 1JHFA 3KCCA 1KGSA 3M8FA 2LG4A 1HA8A 2E2IJ 2A5YB 2ACJA 2Z3YA 5FLXZ 1U0JA 3CCMI 2WAEA 1D0YA 2DJIA 1VNDA 4LB6B 1A6IA 4UY8I 1ZHFA 1RRJA 4RLQA 4RB0A 2DCEA 3I0TA 4DNCA 1IN5A 1E0EA 2L7ZA 4IPAA 1N78A 1Z67A 1K6OA 1UAAA 1Q1HA 4AWXB 3S16J 1UZCA 3CCJI 2VE8A 1BJZA 2VKVA 4CZZA 2A6EF 1XCVA 3H36A 5AONA 5HS8A 3OYIA 5J3LA 3HHHA 2FBKA 1FP1D 4M72A 3SFIA 4CCLA 5E3MA 3LAJA 2QQBA 3WODF 1LNWA 5D4SA 1D1AA 4E7HA 1EJ9A 2WADA 4ZYEA 1MW7A 4CDGA 1JUPA 3DEWA 3F21A 2M8GX 1F5TA 4U7BA 3ZMDA 1LUJB 3S2HJ 3AL0C 3MZ8A 1JGGA 3RZDJ 4G12A 2Q1ZB 3BTIA 2V1XA 2BOLA 1B9MA 3K7AJ 3HDDA 2O8XA 5M5XJ 1SMTA 1LFUP 5CQGA 3I5UA 5L3BA 1ITYA 4ENKA 1W7PD 3KLNA 2DBBA 4D9JA 4UUTA 3A02A 2L9SA 4B47A 1TT5B 1QQIA 1WCMJ 3ZQGA 2DA5A 2FOKA 1TWFJ 2EA4A 5HDGA 1KYWA 2W25A 1JTXA 2VB6A 1TT0A 3WTYC 5TJJA 1OJLA 2VT2A 4CSWA 1CGPA 3KP7A 5J40A 3OSFA 2E7WA 4KNYA 1KYZA 1HCRA 2O6GE 1U5TC 3DKWA 3QWLA 2BBYA 4QPQA 3G1OA 4I98B 1WHUA 3QYBA 1X3WB 1X1AA 4D7MA 3RZOJ 3IC7A 1IJWC 3Q3SA 2M0MA 3GZNB 1FSEA 3DKXA 2ZJRF 1KU7A 4M3FA 3OSGA 3U1KA 3OYCA 2PJPA 2NS0A 4BQNA 1I1SA 1R4MB 3WG7H 5TISC 2K3PA 3LQRA 2R7RA 2I8DA 4BEHA 1TWGJ 3S3OA 1OCOH 4JX6A 2PMZA 4C30A 4R8HA 1I6XA 2QZ8A 4GRIA 2BVLA 5DCFA 1U8RA 1QRYA 3QYFA 1JKPC 2XRNA 4CO8A 2NNNA 3CLOA 1DPRA 1HXDA 3E0JB 3WU1B 1DPUA 4G6TB 2XAQA 2CQNA 1BOBA 3SJMA 2XPUA 1YITI 3LAPA 3GTJJ 3CLQA 1STZA 3L1PA 2G7UA 3K10A 2HEOA 3PNTA 2LSOA 4XR6A 1VQLI 2XF7A 2P7VB 3L2UA 3UR3C 1A6QA 1FBQA 2R7VA 4MEYF 1DGRM 3I3LA 1MD0A 1O3QA 3NEUA 1V5EA 3EYYA 2JA8J 2DQLA 1NK3P 1ZRDA 1FPQA 4AYBN 2QBYB 2DT5A 1Z3YA 4LFUA 2RGVA 3ERMA 1K61A 3EDPA 3Q9SA 1MZBA 4CICA 4MFEA 3S17J 2E1CA 2M7BA 2A68F 2M7AA 5F0CA 2TDXA 4A93J 4CYDA 1SFUA 3FXJA 3H9JA 2FQ4A 3ZN0A 3HB9A 2VKEA 1J0RA 5DEQA 2RC4A 5CVUA 4AYBA 1QVTA 2VJ4A 5B5EC 1B4AA 2XF5A 1W36C 4J00A 5FKNA 2GA2A 1MH4A 2DJNA 2QSHX 1HDPA 3LMMA 3M8JA 1D8JA 1W1WE 2L2OA 1ON1A 5DM7F 3V7RA 1ZGAA 2FU4A 4RB2C 1BBYA 2FMYA 1B72B 3OYKA 4MLOA 5LHGA 1ZGJA 1EV7A 3ZN1A 2VKHA 5E8IA 4OIRF 1Z05A 3ZOBA 4WXDA 4O3MA 2O7OA 3ML6A 4HLYA 3GFMA 4ETSA 4C2TA 2LMDA 3OS1A 3S1RJ 2ECCA 4C2UA 2MYSA 1KU9A 5JFRA 2VXZA 2DAOA 4PSWA 2E2JJ 1Y56A 3BY6A 1X1DA 1ZKGA 4ZC3A 3KP6A 4D1QA 4M3EA 3KPHA 2QYOA 5FKKA 5JHFA 4DGWB 3CD6I 4CCJA 3JRGA 1G59A 2H8RA 5FGMA 1G3YA 3ZMUA 1IXSB 3TO9A 5DM6F 2HVQA 4XOTA 3CCLI 1W4MA 4W97A 3X2QH 1WI3A 3K1PA 1UHMA 3F8BA 3JRHA 3TQNA 3OR1C 4LG3A 4K2EA 1QPIA 3TOBA 1YLFA 1OCRH 1KU3A 1U8BA 2OU2A 2IS2A 2EWNA 3PJRA 2ZKZA 2Q2EB 2OPTA 2E34A 4XBFA 2EBIA 2GXGA 1W7PA 2A6TA 1WI9A 3WGIA 1BI1A 4CYCA 3DBRB 1X3ZB 4BJTA 3LSGA 4E4HA 3WTWC 5H6RA 5FROA 5ED4A 1FYKA 3RPUA 1PUEE 3HOSA 2YX7A 1R49A 2GBYA 2JA2A 5IT3A 1L0OC 4DOZA 3OYAA 3HUGB 4AIJA 5AIPA 2KHMA 2WTEA 3FM3A 3CCSI 1Y8QB 4DYQA 3HOWJ 4BKXA 3FZVA 2HNHA 3HPGA 1FBUA 3HRMA 4BBSJ 2L4MA 3NARA 4A3IJ 5F04A 1I27A 2PLYA 2CFOA 1KZHA 4AU7A 1Z7LA 2ELJA 3KYLA 3JRDA 3S2WA 3V7SA 3GWZA 2P81A 3RDIA 1VQNI 1TTYA 5IT9Z 2CUZA 3G1LA 3P5JA 1YE9A 5EEAA 1TLHB 4L18B 5EGOB 2PI0A 3HC7A 2MFZA 2HR3A 3DEUA 2DDAA 2EFPA 4FETA 1ETWA 1SVOA 2GZWA 2YR2A 4WF2A 2MC4A 3OYDA 4XORA 2OZUA 2CV0A 3GBGA 2CV2A 3WGGA 3JRAA 1USSA 3A4CA 3CUOA 4RM2A 1O7LA 1U9NA 1HW2A 3Q0VA 4MO7A 4NDLA 2BGCA 2GXBA 4WXHA 3K4MA 4M6XA 4KDPA 4KUMA 1MH3A 2XPVA 2K9SA 1X2MA 3RTRA 2PQ8A 2OA4A 4BAYA 3E1SA 2XIGA 5F1JA 2UUZA 5CYVA 3JAMK 1MNMC 1DQUA 3E3VA 4V2GA 3IH4A 3GTKJ 1MBFA 1YJ9I 5E3OA 2AQFA 3J81K 3PNVA 1HF0A 1R00A 1I39A 3C7JA 3K6GA 4PUSA 5HS9A 2FX0A 1XSVA 2XPWA 5CJ9A 3GTMJ 1D5YA 3RQ4A 1QBJA 4M71A 3QU3A 3ROUA 1VQ8I 5LGTA 4WCGA 3B6CA 1LJ9A 2RREA 3CDIA 5KK1A 1APLC 3DEEA 3BZCA 1CQTA 1GV5A 3L2VA 1RESA 2BW3A 4MQVA 2BW3B 1T0FC 2M34A 1W0TA 4V19K 1BM9A 2WY8Q 2FMLA 1F36A 2FSWA 3LWFA 2FJ1A 3J7YJ 3BCBA 4UB8C 1YX5A 3V42A 4CXFA 2EV5A 5BOXA 4G8XA 1J7KA 4AC0A 2ZMEC 4XIDA 2DK8A 3CP2A 1BN5A 2ZFUA 3DU5A 1MMAA 3LSJA 4F92B 3OS0A 3DPTA 3MWMA 3LA3A 1OCCH 2DW4A 1D3YA 2XF6A 2IT0A 4OIOF 4J19A 1T6SA 2JVHA 2Y75A 2ZCWA 4LK0F 4YFNF 4RB3C 4HOBA 3O2PE 3W2VA 4G9YA 3F8NA 1U78A 1P6RA 2CYYA 4WWCA 5CVIA 4IEJA 4II2A 2MD5A 4Y52J 1JXSA 3D5RC 1TQIA 3NWTA 3GFIA 2H6BA 3LA7A 1SD4A 2ZNYA 2DU9A 1YTYA 4UUSA 2L02A 2P5KA 1Z6TA 2B0LA 4HV6A 2YSRA 3BDDA 1XSDA 2QLZA 2E35A 3CMMA 3DLAA 4B8XA 5J1UA 4MTEA 4XKWA 1GDTA 2XVCA 1QHHD 1TZLA 2EA2A 5H20A 3TEDA 2E2HJ 3H3UA 2O0YA 5GTIC 3EUHC 1ETOA 2D2WA 5FJ8J 3PO3J 5FKMA 4ZDPA 4P9UA 4NQWA 5LLQA 2F2EA 4HQMA 3F23A 1GXQA 1H9TA 2V1DA 1RUOA 1BR1A 1G6NA 1J09A 3ABUA 3HEFA 2FQ3A 4Y13A 3TGNA 2DMPA 2ESNA 2VASA 2DLLA 3CUQB 3GXOA 5FKOA 2IRFG 1X2NA 3U2RA 1JJ6C 4BY1J 3BCAA 1D8KA 4WX9A 4ZTJA 3G3ZA 4RAZA 3HSEA 3BJ6A 1T2KA 1GHCA 3KZZA 1MMDA 2LK2A 5D8LB 2HPIA 1TNSA 3C18A 3K4NA 4LIVA 1MNDA 4BHCA 4B48A 4ENJA 3KFWX 3HOXJ 4CZCA 5L3CA 2FBHA 3BZKA 1FT9A 1IDYA 3E97A 3WU2C 5JR3A 2GQQA 1IXCA 3EETA 3QPLA 4GO1A 3ABLH 4HX7A 1VI0A 2V79A 5E17F 4ZJZA 2X1CA 3LSTA 4I09A 3PNYA 5DUIA 1H0MA 1MIJA 3GF2A 1VZ0A 1BI2A 4ZDLA 2NVQJ 1NH3A 5FLMJ 3TW7A 4IZZA 5HDKA 3H3ZA 1MSFC 3ERED 1ZYRF 2STTA 1SAUA 1FOWA 2ZO4A 3GMEA 4ZTFA 4BY7J 3BC8A 1HKQA 4IQ4A 3VYSB 5ILVA 4FASD 5F64A 4C2MJ 5M5YJ 4IKFA 1E3OC 3SHFA 5LHIA 4BBRJ 2CW8A 3CMYA 1ZRCA 5LGUA 2MLGA 1WPKA 3AG4H 3BP8A 5KCMA 3K9TA 2RNJA 4I0BA 4ZYDA 2ZSHB 3JSOA 1WJ5A 3H92A 4YEJA 1JKOC 2VQLA 3HIFA 4CCKA 2FRHA 4B3AA 2Z33A 1GXPA 2BVMA 2OD5A 3VB2A 1YG2A 1FEXA 1YHQI 1YRNB 3IH2A 1XDUA 2WV1A 3G6EI 1ZH5A 2B63J 5FO5A 2F5VA 2RV8A 5HLHA 3WHCA 1DUXC 1K78B 3GTLJ 3ESWB 5D6FA 1OPCA 4FTHA 1RPWA 1VQOI 4KYWA 4GXOA 4BDZA 2WA0A 5M3MJ 2X51A 2A3SA 2ZSIB 3ZMSA 4BUPA 3L2WA 1TL8A 3GTGJ 1POGA 1R1TA 2GA1A 2HXIA 3PQJA 3CUQC 4HYEA 2JT1A 2ZJ2A 3P9CA 1XN7A 2R7FA 1RR7A 1UHSA 3K4LA 4F52A 2P5LC 4HF1A 2XGDA 3CC7I 4H0EA 5CVJA 3SEZA 2OQRA 3BTCA 1MJAA 1TWAJ 2MBFA 1QNTA 1HC8A 1S7EA 2MW8A 4A6EA 3MQ0A 4E6KG 2K3FA 3OYMA 4AM3A 4LB5A 1AKHA 1VQ7I 2L3DA 3VOEA 2VJIA 5DDGA 3W3CA 3T1BA 2R3SA 2AS5F 1SD7A 3OYBA 2MSYA 3NAUA 4HPQA 4NHJA 3BOQA 4CCOA 3RI4A 1O3TA 2Y0SN 2JA5J 3ZRGA 2DA7A 1WGXA 1ONVA 3GLLA 2FXAA 4I7HA 3LNQA 3DU6A 3Q9VA 2DODA 3FIWA 4MNUA 4IHVA 1PUFA 5HVQC 2HDWA 4M3BA 3P9KA 4UVCA 2W48A 5D5XB 1MBKA 2VODA 4GGGA 3J7AY 2JSPA 1GLNA 4LLLA 2OAZA 1A5JA 2W7NA 3PL8A 4ZYGA 2X6OA 3S1QJ 1IRGA 4PGGA 1IZ1A 1XGSA 3WU0A 3S14J 2Y0SA 3K1NA 4P5OA 1IRFA 4BL0B 4G7OF 1ZGWA 1R1VA 2LD5A 3JW4A 3E6CC 3IWZA 2HS5A 2FA5A 5B3SH 2BY3A 5GP9A 3ZGKA 3A0BC 4KISA 2QCOA 2IJLA 1OKRA 1SMYF 1BA5A 2P6SA 4B09A 2R4GA 2KKOA 4ESBA 4E7JA 5LHHA 1SC7A 4Q5SF 1SAXA 4G7ZF 3DLLF 2A05A 1FC3A 2IEKA 2ZBKA 2R92J 2L9NA 3VYUB 2EIJH 1P4AA 3IHUA 3QP6A 3Q0UA 3R6SA 2G9WA 2KISA 2E71A 3FISA 4WXCA 3NQOA 1X1PA 2WBMA 1T98A 3E6DA 5ICFA 4H4KC 1W5CC 3OIQA 1LEBA 5B1BH 2FNAA 2I10A 1BJAA 2X1DA 5JLXA 3MMYB 4RM3A 3RPUD 2HPMA 1P92A 4P55A 3CCEI 1JKRC 4BNCA 4GFBA 1J75A 3JAMZ 4OMZA 2JJ7A 4CCNA 3IV5A 5GAEJ 3Q5FA 4XLPF 2GIVA 3CZ6A 5DYMA 3QP5A 2AO9A 5J6XA 1K83J 1BL0A 3OV8A 3S8PA 3J81Z 3BQYA 1O3SA 3JREA 3AG3H 2OQGA 2J5PA 4Y17A 1PP7U 2V9PA 2NS8A 2H6CA 2JPCA 2LDUA 3BG5A 1LDDA 4U88A 2UZKA 4M3GA 2KLOA 3GEZA 3DP7A 1K6YA 4N0BA 2VQCA 5GPCA 1ZLKA 2EZIA 2H94A 5J1YA 3S1MJ 3HOTA 4DQ2A 3F8MA 5FRNA 1NG7A 2DFFA 4D5CA 5H6QA 3J80K 5M5WJ 2F5CA 3CP8A 4L9VA 1FIAA 4E7KA 3MKLA 2D1HA 3GO5A 2KPMA 3BPXA 2VKDA 2VUMJ 1A35A 2XGEA 5ILSA 4QTRA 4BHPA 1VFCA 2CG4A 4BEHB 2PJRA 2UXXA 3BQZA 1JHHA 1ZREA 3KIOA 2XUBA 2BV6A 3BZ6A 1LEAA 2VL8A 5JVGF 4XKVA 4BGDA 5CVVA 2L5QA 1VQKI 2IXSA 3WE3A 4LD5A 4Q4ZF 2L9VA 5K7FA 2PMUA 5IOZA 3K1MA 4FISA 4F7ZA 1EF4A 2QGUA 3RQIA 2HTJA 4S04A 4XLFA 3SFZA 2O03A 3SZTA 2V1UA 2LTPA 2FBIA 1FLIA 1JTYA 4HNVA 1WQ2A 3DWLE 2E19A 5F0HA 5K7ZA 4XN0A 4IHYA 1MKMA 1WSUA 2M1BA 3FMSA 4I2OA 1TWCJ 2L7MP 4JOMA 3RKWA 3BLYA 2MD0A 1IW7F 1G2HA 5IPAA 1MBHA 5L3DA 1IN8A 3IKTA 2LP0A 5M3FJ 2XROA 1QZEA 1FJLA 2OCEA 4YG2F 1OYIA 5JVTA 4KIGA 2QM3A 3DFGA 5CKTA 2RAEA 1BC7C 3DPUA 3LSMA 4M3DA 2K02A 2DMNA 2R7DA 1T8IA 1BW5A 4D0PA 2EB7A 2CSOA 1EKEA 2K7LA 3PQKA 1H9GA 4YFKF 1QPMA 2HXOA 3OMYA 5CVRA 4HX4A 1SEUA 1B1BA 4E70A 5FFXA 1S3JA 1WRJA 1REPC 4I99C 2P7CB 2IPQX 1LE8A 2RN7A 4HRIA 1FNNA 3HPHA 4IHXA 2JSCA 3IRRA 3BJAA 2XRLA 4FT8A 2DPDA 4UNOA 5BNGA 5FRMA 3LSKA 3FKIJ 2RVCA 4UHTA 3C2GA 2WB1N 2J5OA 3AAFA 2KJCA 3A1YA 1ZR4A 1K7AA 2JN6A 2CW7A 4C3HJ 3IRQA 2QA4I 5D5UB 2DA6A 4XLCA 4EVIA 3Q0WA 2JUGA 3P7NA 3K70D 4JP0A 1XS9A 3T5XA 1V54H 3KEOA 4RBOA 4FQGA 1BOAA 3GZ5A 2M2EA 1DU0A 1ZQ3P 3LSPA 3BR2A 4A3KJ 1UG2A 2LOOA 4RAFA 1JKQC 4IRGA 3ZR8X 1B9NA 1FIPA 3FHZA 3S3NA 3SQNA 3BROA 3VPRA 1GT0C 1J9IA 2FE3A 2P8TA 4AVPA 4U0YA 2R5ZA 5FLVA 3IKVA 1W7PB 3OWTA 3WTXC 2M8EA 4IVNA 2QKMB 2XGXA 4U7DA 2WC2A 2DQRA 3OL3A 1AWCA 2LFBA 3CO7C 1LKXA 2L7FP 4CYCB 3CCVI 1ETQA 2XASA 1JE8A 4XSXF 4YIFA 4A3BJ 4TV7A 1SANA 4XRMA 4QIWN 4ZH4F 4BACA 2WAFA 3OYHA 2R7UA 1SD5A 2PN6A 1XCBA 5JI6A 4A3FJ 4GYGA 4OOIA 1WJBA 1OCPA 1PYVA 3HM5A 3IWFA 1FYLA 4XL9A 4YIIA 5C3EJ 1IV6A 2NNYA 1ZK8A 3K4JA 2F5DA 2PBIA 3R60A 5LEJA 1DP7P 4E7IA 3PIPF 3BJOA 1VQPI 1BIAA 1XGNA 2CWEA 4J01A 4RLFA 1RKWA 4HF0A 3RKXA 3T8RA 4XOPA 5IYCJ 2ZMEA 1A04A 3H5NA 1SVMA 1QHGA 3KEYA 5HODA 5HLGA 4N9IA 3CMAI 3I4NJ 5FD6A 1K4SA 2KRHA 1Z7UA 4L0YB 3QRFF 3F72A 3G73A 3QPHA 2JK3A 3BG9A 1D1CA 2F4OB 3MZHA 4IOCF 1MBGA 3MKZA 5H2FC 3DTIA 3KX2A 3VSKA 1R7JA 3HGGA 3R61A 3PUBA 2BYVE 4X1EA 1ZG3A 4L0ZB 1WH5A 3VFZA 4BS9A 2HI3A 2M3AA 2ZNZA 2R5YA 1N75A 3B73A 1LDJA 5DD4A 4EJWA 1F43A 2DOFA 5JLWA 3F3XA 4Q47A 3JRBA 1KQ9A 3M7GA 5EF6A 3RKQA 2R93J 2FOWA 2HZTA 3VYRB 3LA2A 3OYEA 3OIOA 2D45A 1A36A 4EQQA 4FE4A 4MGRA 3IAS2 1BI3A 5A2QK 2DT6A 2D5VA 1XGMA 1R23A 1QO0D 3HGYA 1MDMA 3JRFA 4KMFA 2PX9A 2FD5A 2JA6J 2NOJB 4L5IA 1SD6A 1MDMB 3ZMZA 4BYYA 2MC3A 1I3QJ 3H5AA 3KZIC 1IGNA 3SDBA 2Y69H 1FMWA 3OYGA 1ETYA 2MLKA 4ASNA 4KMUX 2XSDC 1W5SA 5D8KB 3JSPA 1D0XA 1OR7A 3M8EA 1QA6A 1J5YA 1YS7A 4PJNA 1TW2A 2R7SA 3GFLA 2IGOA 5C4XJ 3FXOA 4NUBA 1VQ4I 2Z16A 2EFWA 2Y2ZA 4L9JA 3DBHB 2ZXIA 3WE2A 3UKGA 3EYIA 1KQ0A 3CDLA 2E1MB 1NHAA 2CQQA 3DKYA 3FXLA 1PVEA 1RETA 1S9HA 4KITB 3L2CA 2K5CA 5TGTA 4ENNA 5E1WA 4A3EJ 5DV5A 1ERDA 1BR4A 4XSZF 4ZDOA 3MZYA 3M1EA 5D6EA 1YIJI 1MJBA 2QKLB 3CESA 4FHTA 1U3EM 2COMA 4A3MJ 2NVTJ 3IH3A 4HSTA 3RYRA 4QSHA 4NB5A 4XLNF 5L3EA 1G4DA 3WTVC 3COAC 3K4BA 1S5LC 2OJED 5EDNA 5FKLA 3MCZA 5LBQA 1PDNC 3HOUJ 5D5WB 1PJRA 1ACIA 3V4GA 3J7ZI 1P4XA 2EJRA 3ISPA 5E3LA 4EMSA 4KFCA 3HRSA 2V6EA 1R22A 2GAUA 4X0GA 2XKPA 1R1UA 3K0LA 2F48A 2LYCA 1X3UA 2IW5A 2AQEA 2XGCA 3BR1A 3D1NI 4IO9F 1O3RA 1U9OA 3W6KB 3M4OJ 4G6DA 1V3FA 4UUSB 2JMWA 2M30A 3K2AA 1A31A 4I01A 5HLIA 2QVOA 5E1ZB 1YX3A 3M3YJ 2XKOA 2XAUA 1IUYA 3N4MA 4BU2A 4DZPA 4XN3A 4P96A 5EZGA 1YOVB 5F6FA 1XMAA 4UB6C 2HDCA 4Y4RA 4CH7A 2EIMH 5HDNA 2GOMA 2HWVA 4NQWB 2PEXA 3I59A 3O6BB 1YW7A 3I59B 2DMUA 1IUFA 1R71A 2CQKA 3GTOJ 1Y1VJ 4NC7A 3FXUA 4RDUA 1WJEA 1TQMA 2KDOA 4IRIA 3SZPA 4BXFA 1XG1A 1G3SA 1XPXA 1Z0XA 4BJ5C 1WH7A 1Z9CA 3QPTA 4O5VA 2BY1A 3E5QA 3E6MA 5K7HA 3J80Z 2VPLA 2QWWA 4XQFA 4AIDA 3I9V2 3OYJA 1FTTA 1MNEA 1W5TA 1D0ZA 4KA4A 3H5RA 2AHQA 4MTDA 4Y7NJ 5DCMA 1MSEC 4EJUA 2GIZA 1HQCA 3ABMH 1R9TJ 4L5EA 3G4SI 3BR3A 1OMIA 4P9FA 1SFXA 1WVRA 2N8GA 2IAIA 1TWHJ 2EH3A 2IGNA 1WFXA 3GZ6A 2E1MC 4GYIA 3S15J 4OMYA 5DS9A 4F91B 3CTAA 5J8CA 2ELHA 3G71I 2L54A 5HOOA 1MBJA 4OINF 3PO2J 1ENHA 1U2WA 1NG6A 2A61A 3VYTB 2P5VA 1JUSA 3WTUC 1RKTA 4PJLA 4RGSA 3TL4X 1W36D 1EA3A 4A5MA 1MMNA 2XSJC 4NC6A 1AU7A 2XAFA 2M45A 5TRDA 2COBA 1IO2A 1FTZA 1WKMA 4UUVA 5ICGA 2ZXHA 2F5EA 4G6QA 2VOOA 1ZELA 2HOEA 2V9KA 1HLVA 3D5SC 2FUG2 1KA8A 1Z1DA 2V9VA 3QYEA 3FF5A 3G1MA 2VBZA 2ISYA 5KHDA 3F9KA 3TMOA 5J47A 3KP5A 3L09A 5LFAA 3HOVJ 3R0AA 2C6YA 3LSIA 2Z1DA 3OIPA 2Q0OA 2ZXJA 4HBLA 2H1KA 3FX3A 3CJRB 3HSFA 2R7QA 2VI6A 2CUEA 2RKHA 3HXLA 3N97A 2EPFA 4LGWA 1I1GA 4EM1A 3OYNA 4IHTA 3H0DA 6PAXA 2XB0X 2OC6A 4G7HF 3I56I 2EINH 2EQRA 3ABKH 4PFPA 5IY5H 5F27A 5EJCA 3DCFA 2KJBA 4CCMA 3D0SA 4OU0A 2Z9OA 1OFCX 2ZFWA 5CPRB 4IRHA 2JWTA 4ENMA 3ULQB 2AXLA 4ZZLA 4BHBA 1YW8A 1IXRC 4MQ9F 1H89C 2EK5A 1FMVA 2X85A 3H9QA 1V55H 2VE9A 3AL0B 2QSGX 1MBEA 4CGZA 3TDZC 2HGCA 2LBFA 2BXYA 2DA2A 3V8LA 3B6AA 3N05A 1ZAOA 2XAJA 4AD9A 4Y15A 1B6AA 3OS2A 1R58A 3HKZN 2WWYA 3FDYA 1WJFA 2HKOA 2KZVA 5E8GA 1IN4A 2KT0A 2VC1A 2E60A 2RQPA 2GM4A 3J7AO 2PFBA 1UCRA 3PUFA 1CF7A 4UV9A 3M07A 3DBLB 4I02A 3PFIA 5CLSA 1B8IA 4A3LJ 4Z2YA 3TO7A 3AKZA 1TBXA 1XSXA 2BHYA 4EM0B 1AKHB 2JTVA 1FWZA 2W84A 4M9ZA 4A0XA 1U5TA 3HKZA 5BPIA 5E79C 3ZQQA 3HRUA 5E20A 2DO7A 2IA0A 1L3LA 4DYRA 1Y0NA 2HQNA 3QQAA 4R79A 3HG9A 5BS6A 3HTUA 1JI8A 3RKYA 1UMQA 5D4RA 2V1NA 1HW5A 3FXRA 2STWA 5EG0A 1E3PA 1F4KA 2HZDA 3DTEA 1X19A 3V8KA 3AG1H 5EG0B 4EM2A 1PUFB 2A5WA 4QWQA 1SFKA 2JZYA 4HX8A 2DOEA 3BTJA 3O3KA 3IUOA 1ZARA 4A0YA 3QODA 4BQAA 2H27A 2XHKA 1O7FA 4PZJA 3CJNA 2NS7A 1T56A 1AHDP 3ONQA 3BR6A 4E7SA 2EV6A 3HSRA 2PG4A 4L9TA 5EZHA 2RNGA 1JT0A 1YI2I 3CC4I 1GUUA 4QLCU 5BPDA 5J8FA 2V7FA 5HNHA 3FK6A 2LR8A 4HW0A 1XTAA 2A69F 2ECBA 4RGRA 1ON2A 2TRTA 3KZYA 4S05A 1ZN2A 5C4JJ 2FF4A 2DI3A 1EH8A 2EFNA 2HYFA 4LMYA 1ETVA 3S2DJ 2Z99A 1ETKA 2O5RA 2EZHA 2X6YA 5GTHC 2NVYJ 2F4IA 4HQEA 3BR0A 4XRSA 3HYIA 2WV0A 2VBXA 4NBQA 4XMYA 2KMUA 2R7XA 2M4GA 4E7ZA 3WG9A 4ZYHA 3ABTA 4RGXA 2W24A 2R0QC 3PFYA 3OR2C 5LRRA 2DA3A 4IOAF 2E7XA 2VBYA 5GAGJ 2O8KA 3I55I 4FE7A 4UXNA 1UELB 1I50J 5F1RA 4HV5A 4XLEA 1IDZA 3PM1A 4Z6YA 1HKSA 1OYWA 5HS7A 5J4VA 5A2QZ 2YPRA 3H9GA 3I4MJ 2BE5F 1QVUA 2KQRA 3CJQB 3BWGA 1GVDA 2KFDA 5FB2A 2VJ5A 1E3HA 2CUJA 1UJ8A 2DT7B 4IF4A 4XK4A 1PP8F 4RAYA 1MMGA 5FD5A 3JTGA 3HBLA 2DOAA 2X1EA 2P6TA 2WAQN 4HG2A 2OZ6A 3ECOA 3R0JA 2DFEA 3I64A 4KN4X 2F6CA 3NRVA 1NK2P 1QU3A 3DV8A 3GFJA 3FMQA 3MKWB 2LRDA 2ZB9A 3S1NJ 2M0CA 3LFKA 3MVPA 1T33A 1O57A 2ZJPF 3EUAA 2JVGA 2DYSH 5J1RA 1KONA 4IX7A 2KIQA 2PMZN 3VSLA 2WAQA 1BI0A 3JRCA 3A0HC 1XB4A 2PJRB 3SDGA 2ISZA 4XRFA 1O4XA 1G8XA 2OV7A 2TCTA 4RA2A 3TP0A 3JRIA 5K5QA 2JPBA 3FWEA 2HOTA 2NYXA 3QOEA 3RSNA 2W85A 1H88C 2XDVA 2IS6A 1Y8RB 4V2FA 1F1ZA 5LEKA 2B7EA 3BTLA 4A3JJ 3F0CA 1FYMA 1XX5A 4R1HA 3D5LA 2HKXA 4I0AA 2CJJA 1WWXA 5BQTA 2L0KA 1LB2A 4NNJA 2QENA 5FFZA 2DFIA 1YFHA 1LFPA 4JQFA 4ON0A 4FX4A 2IS4A 3F6OA 1ETXA 4HLXA 1ZG1A 3K69A 1TNTA 2YUSA 3E6BA 1QZYA 1JJ8C 1HBXG 2LY1A 1FZPB 4IL6C 4UVBA 1Y39A 3ZQ7A 1IRXA 1LQ1A 2HQ5A 3BG3A 3KP3A 1T38A 4NC8A 5KAIC 3HJEA 4XKCA 4BJ6C 4LLNA 1RI7A 1R5HA 1S6LA 2VJJA 2RDPA 1WJCA 1WZ2A 2DFHA 1TP4A 2QQ8A 1ULYA 3GVAA 3WTSC 2DMTA 3BPVA 3MKYB 2XC7A 3FKJA 2CH0A 1N77A 2K27A 3REOA 1K79A 2QBYA 2L9RA 9ANTA 5IP9J 4RB1A 2CS3A 3CCRI 1I6HJ 4DJAA 2VC0A 2A6HF 3FK7A 5LRSA 1BC8C 3ZP5A 3TO6A 1N25A 1HKTA 1KQ8A 2KIUA 2BXZA 3T8TA 2G7HA 5GAHJ 4ZYAA 5L3GA 1J2XA 2VBWA 2JRMA 5LD2C 2CRGA 1R36A 2CMPA 2DA4A 1LE8B 2ME6A 1P7IA 4G94A 1DGWY 5HNFA 1B59A 3SEQA 2IP2A 2L01A 1W0UA 3IAM2 2VT3A 3E5UA 4XNFA 1XD7A 4L9NA 3L2QA 3KEQA 4BXUA 5IOYA 1V4RA 4M73A 3BG6A 2GXAA 1IN7A 2JA7J 1EH6A 1BR2A 4EV0A 4Q48A 2DXIA 1RIOH 1B72A 1R5ID 2MA3A 2LVSA 2QQ9A 3HL2A 1TC3C 2Y30A 5B66C 3GUDA 3W2WA 2Y48A 4B43A 5KNLA 3KETA 1X1CA 5HLTA 2VOPA 1M1EB 4LJZF 3TKYA 3HTSB 1RZ4A 1S8NA 3TW6A 1UB9A 2X48A 4XLAA 1TQPA 2EFQA 5EEGA 4XM3A 2WB1A 2DA1A 2MH9A 1Z77A 2X6WA 3LL7A 1R4NB 5ERIA 2W4SA 1Y1WJ 3SXYA 3CC2I 1Z21A 4ESFA 1S29A 2HFHA 4XKBA 2Y9ZA 1RR8C 4BDYA 4CA0A 2V6CA 3M1CA 4JYKA 1V5FA 2ME0A 4YELA 2BY2A 2R5ZB 4HDUA 1TW3A 2O3FA 4D5FA 5KVRA 4S0HB 2NOGA 4A3CJ 1Y0UA 1ZLJA 4HAMA 3HOYJ 2K9LA 3GW2A 3QAHA 1IF1A 3BG7A 4UV8A 3V8JA 2VQGA 4JBAA 2ZJQF 5BMZA 2GLOA 3VWBA 3ELKA 4EJTA 2QEXI 2V4JC 5KAFC 2Q2EA 1FOXA 3GCMA 3CCUI 2ID6A 1D1BA 1LVKA 2VXDA 5DTDA 2H1LA 2Y0MA 5GADJ 1ZRFA 1AOYA 3U21A 3ZCOA 1GVJA 1T0FA 4XONA 2K9MA 4FX0A 1YYVA 4EGYA 2XB5A 2Y9YA 4P1WA 4A6DA 3ZQIA 2R7WA 5JHUA 3FMRA 3F8FA 3B02A 3DPLC 2NVXJ 3A01A 5FLXK 1FP2A 1SVLA 3W6VA 5GPAA 1HSJA 2ZMEB 3HUGA 4XICA 3A01B 4B44A 2K4BA 1S72I 2HYGD 3SYTA 3DF8A 2YU3A 1P4WA 2IA1A 2LNBA 1Z6RA 1YJWI 2M9HA 2IS1A 4F93B 3PSIA 2V26A 3GTPJ 2LLKA 4N4NB 3AG2H 3KLOA 3ZQHA 1YO5C 4M74A 2OTLI 4LOCA 1BIBA 3QOPA 5IYDJ 2IGMA 2ID3A 3RCOA 2ZC2A 2L4AA 4M9SA 3MD2A 2R5YB 5EGOA 2E5ZA 2DDBA 4ESJA 2W00A 3G2BA 4IXAA 3H3VK 4A69C
chains in the Genus database with same CATH topology
1I5ZA 4AIKA 3GX4X 4BH9A 2QUFA 3I4PA 1FY7A 2IVMA 1FBSA 4IJAA 3DXJF 3EUHA 4MHGA 1HW1A 1HSTA 4A2UA 3L00A 4O6JA 1U6GA 2LF7A 1LDKB 1FX7A 2HTSA 1YS6A 1ZG5A 4KT5C 3P9IA 1S7AA 4PCQA 3ECHA 4M6YA 2ADUA 1RUNA 3W6JB 2FEZA 2KIMA 3WTZA 4MEXF 3KP2A 2NRAC 4ZZDA 1P2FA 1KU2A 2PMHA 3T0YA 1XGOA 2UWMA 4LG0A 4EGZA 5K1YA 3FXQA 3CO6C 4KICA 4LG0B 2X4HA 1G3WA 3F22A 2YX4A 4PGHA 3E5XA 4OIQF 2H09A 1DDNA 2UXNA 3K2ZA 2FNPA 1MJ9A 1LVAA 1FSHA 2XV4S 5E1XA 4LLGF 2VONA 5ICEA 1IN6A 2CW0F 3RIRA 2CGPA 2KIFA 4HA8A 1OYYA 3M9AA 4WK8F 1F9NA 2DTRA 3C3WA 2X0LA 2HQRA 4RS8A 4U0WA 1RNLA 3I58A 3RYPA 2XAGA 2GWRA 4HZFA 3MFKA 2F5FA 3KP4A 3QU6A 2M87A 1USTA 3CDHA 3I54A 3V7CA 3CUQA 2O61A 5D5VB 3U9GA 1D5VA 4JK1X 1VTNC 3I53A 5DCMB 4A0ZA 4HDVA 2XAHA 4AIHA 4L5JA 4OIPF 4LK1F 4GCVA 3FM5A 3RJPA 1S7OA 3I71A 2LKPA 5E18F 3MAJA 3ZMTA 1QZZA 1Z91A 1UHWA 2MH2A 2M5WA 4M9XA 4CHUA 1YIOA 4KN7X 4RGUA 4A12A 4N9HA 4YFXF 4EJVA 2QQAA 1YW9A 2CO5A 5ILUA 3F8CA 2LF8A 4KIBA 3ZPLA 2W57A 4U0VA 2JRTA 3LQQA 2OBPA 3HHGA 3TOAA 4A5NA 3RPQA 3F6VA 2Q8KA 5EEHA 2A07F 2DPUA 4EJOA 1J59A 1EH7A 3L9FA 3GYHX 5L3FA 5AIQA 5K5OA 2K4JA 3TDUC 2BEOA 3L7WA 3KE2A 1XMKA 5K5RA 5IT9K 1R5GA 3R4KA 1K78A 4PDKA 1C0WA 3DQVC 3C1DA 2VN2A 4UVAA 2KRFA 2NAZA 2EFOA 5LGNA 5DD8A 3WTTC 2DK5A 3U1DA 1JGSA 2IA2A 4IHSA 3VODA 1T39A 2ESHA 3JTHA 1CF7B 3MEXA 2CFXA 2ETHA 1QGPA 5DUKA 1G3TA 1UFMA 5ICCA 1U5TB 3WGHA 1XDSA 1YQAA 1E2XA 1IAWA 3GLXA 3HRTA 3ZMVA 3VEPA 2K86A 2EV0A 1ODDA 2Z5UA 1SFEA 3EQLF 2E1NA 2P4WA 1E17A 1MGTA 4KIFA 3OOPA 1FOKA 2D1VA 4HF2A 3IL2A 1JHFA 3KCCA 1KGSA 3M8FA 2A5YB 2ACJA 2Z3YA 5FLXZ 4LB6B 1ZHFA 4RB0A 3I0TA 4DNCA 1IN5A 4IPAA 1K6OA 1Q1HA 4AWXB 2VE8A 4CZZA 2A6EF 1XCVA 5AONA 5HS8A 3HHHA 2FBKA 1FP1D 4M72A 3LAJA 2QQBA 3WODF 1LNWA 5D4SA 4ZYEA 4CDGA 3F21A 1F5TA 4U7BA 3ZMDA 2V1XA 1B9MA 2O8XA 1SMTA 5L3BA 3I5UA 4ENKA 1W7PD 3KLNA 2DBBA 1QQIA 2FOKA 2EA4A 5HDGA 1KYWA 2W25A 3WTYC 5TJJA 2VT2A 1CGPA 3KP7A 2E7WA 4KNYA 1KYZA 2O6GE 1U5TC 3DKWA 2BBYA 4I98B 3IC7A 1FSEA 1KU7A 2PJPA 2NS0A 1I1SA 3LQRA 4R8HA 1I6XA 2QZ8A 5DCFA 1U8RA 2XRNA 4CO8A 2NNNA 3CLOA 1DPRA 1HXDA 3WU1B 1DPUA 2XAQA 3LAPA 1STZA 2G7UA 2HEOA 2LSOA 2P7VB 1FBQA 4MEYF 1MD0A 1O3QA 3NEUA 3EYYA 2DQLA 1ZRDA 1FPQA 2QBYB 2DT5A 4LFUA 2RGVA 3EDPA 3Q9SA 1MZBA 4CICA 2E1CA 2A68F 2TDXA 4CYDA 1SFUA 3ZN0A 1J0RA 5DEQA 2RC4A 5CVUA 1B4AA 2GA2A 1D8JA 1ON1A 3V7RA 1ZGAA 2FU4A 4RB2C 1BBYA 2FMYA 5LHGA 1ZGJA 1EV7A 3ZN1A 5E8IA 4OIRF 1Z05A 4WXDA 4O3MA 3ML6A 4HLYA 3GFMA 4ETSA 1KU9A 5JFRA 2VXZA 2DAOA 3BY6A 3KP6A 2QYOA 5FGMA 1G3YA 3ZMUA 1IXSB 3TO9A 1W4MA 3K1PA 1UHMA 3F8BA 3TQNA 4K2EA 3TOBA 1YLFA 1KU3A 2OU2A 2EWNA 2ZKZA 4XBFA 2GXGA 1W7PA 1WI9A 3WGIA 1BI1A 3WTWC 5H6RA 5ED4A 1FYKA 3RPUA 1PUEE 3HOSA 2YX7A 5IT3A 1L0OC 4AIJA 2VOPA 5AIPA 2WTEA 3FM3A 3FZVA 1FBUA 3HRMA 2L4MA 1I27A 2PLYA 3S2WA 3V7SA 3GWZA 3RDIA 1TTYA 5IT9Z 1TLHB 4L18B 2PI0A 2HR3A 3DEUA 2EFPA 2GZWA 2YR2A 4WF2A 2OZUA 3WGGA 1USSA 3CUOA 1O7LA 1HW2A 2GXBA 2BGCA 4WXHA 4M6XA 4KDPA 4KUMA 3RTRA 2PQ8A 2OA4A 4BAYA 2XIGA 5CYVA 3JAMK 3E3VA 3J81K 1R00A 3C7JA 5HS9A 1XSVA 5CJ9A 1QBJA 4M71A 3QU3A 3ROUA 5LGTA 4WCGA 1LJ9A 5KK1A 4MQVA 1BM9A 2FMLA 2FSWA 3LWFA 4CXFA 2EV5A 5BOXA 4G8XA 1J7KA 2DK8A 1BN5A 3DPTA 3MWMA 3LA3A 2DW4A 1D3YA 2IT0A 4OIOF 1T6SA 2Y75A 4LK0F 2ZCWA 4YFNF 4RB3C 4HOBA 3O2PE 4G9YA 3F8NA 1U78A 1P6RA 2CYYA 4WWCA 5CVIA 2MD5A 1JXSA 3GFIA 1TQIA 2H6BA 3LA7A 1SD4A 2ZNYA 2DU9A 1YTYA 2L02A 2P5KA 1Z6TA 2B0LA 4HV6A 2YSRA 3BDDA 1XSDA 2QLZA 4B8XA 4MTEA 2XVCA 5H20A 2EA2A 3H3UA 2O0YA 2D2WA 4P9UA 4NQWA 5LLQA 2F2EA 4HQMA 3F23A 1GXQA 1H9TA 2V1DA 1RUOA 1G6NA 3ABUA 2FQ3A 4Y13A 3TGNA 2ESNA 3CUQB 2DLLA 3GXOA 2IRFG 3U2RA 1D8KA 4WX9A 3G3ZA 4RAZA 3HSEA 3BJ6A 1T2KA 1GHCA 3KZZA 5D8LB 1TNSA 3C18A 4BHCA 4ENJA 3KFWX 5L3CA 2FBHA 1FT9A 3E97A 5JR3A 2GQQA 1IXCA 3EETA 4GO1A 4HX7A 2V79A 5E17F 3LSTA 4I09A 1H0MA 5DUIA 3GF2A 1BI2A 5HDKA 3H3ZA 3ERED 1ZYRF 2STTA 2ZO4A 1HKQA 5ILVA 5F64A 3SHFA 5LHIA 1ZRCA 5LGUA 2MLGA 3BP8A 3K9TA 2RNJA 4I0BA 4ZYDA 3JSOA 3H92A 3HIFA 2FRHA 2Z33A 1GXPA 2OD5A 3VB2A 1YG2A 1XDUA 1ZH5A 5FO5A 2RV8A 5HLHA 1DUXC 1K78B 5D6FA 1OPCA 4KYWA 4GXOA 2A3SA 3ZMSA 1R1TA 2GA1A 3PQJA 3CUQC 4HYEA 2JT1A 2ZJ2A 3P9CA 1XN7A 2R7FA 2P5LC 4HF1A 4H0EA 5CVJA 2OQRA 1MJAA 2MBFA 1QNTA 4A6EA 3MQ0A 4LB5A 2L3DA 3VOEA 5DDGA 3T1BA 2R3SA 2AS5F 1SD7A 4NHJA 3BOQA 3RI4A 1O3TA 1ONVA 2FXAA 4I7HA 3Q9VA 4MNUA 5HVQC 3P9KA 4UVCA 5D5XB 2VODA 4GGGA 4LLLA 2OAZA 1IRGA 4ZYGA 4PGGA 1IZ1A 1XGSA 3WU0A 3K1NA 4P5OA 1IRFA 4G7OF 1R1VA 3JW4A 3E6CC 3IWZA 2HS5A 2FA5A 2IJLA 1OKRA 1SMYF 2P6SA 4B09A 2KKOA 4ESBA 5LHHA 4Q5SF 1SAXA 4G7ZF 1FC3A 2ZBKA 1P4AA 3IHUA 3QP6A 3R6SA 2G9WA 4WXCA 3NQOA 1T98A 3E6DA 5ICFA 1LEBA 2FNAA 1BJAA 1P92A 4P55A 4BNCA 1J75A 3JAMZ 4OMZA 3Q5FA 4XLPF 2GIVA 5DYMA 3QP5A 5J6XA 3OV8A 3J81Z 1O3SA 1PP7U 2OQGA 2J5PA 4Y17A 2H6CA 2JPCA 2LDUA 1LDDA 4U88A 2UZKA 3GEZA 3DP7A 4N0BA 1ZLKA 2H94A 3HOTA 4DQ2A 3F8MA 3J80K 5H6QA 2F5CA 4L9VA 2D1HA 3GO5A 3BPXA 5ILSA 4BHPA 2CG4A 2UXXA 1JHHA 1ZREA 2XUBA 2BV6A 3BZ6A 1LEAA 5CVVA 3WE3A 4LD5A 4Q4ZF 2PMUA 3K1MA 4F7ZA 2HTJA 4S04A 3SFZA 2V1UA 2O03A 3SZTA 2FBIA 1FLIA 1WQ2A 1MKMA 1WSUA 2M1BA 3FMSA 4I2OA 3RKWA 1IW7F 5L3DA 1IN8A 3IKTA 2XROA 4YG2F 1OYIA 5JVTA 4KIGA 2QM3A 3DFGA 1BC7C 2K02A 2R7DA 4D0PA 2EB7A 2CSOA 2K7LA 3PQKA 1H9GA 4YFKF 1QPMA 5CVRA 4HX4A 1B1BA 4E70A 5FFXA 1S3JA 1WRJA 1REPC 2P7CB 2IPQX 2RN7A 1FNNA 2JSCA 3IRRA 3BJAA 4FT8A 2DPDA 4UNOA 2RVCA 4UHTA 2J5OA 3AAFA 2KJCA 1K7AA 3IRQA 5D5UB 4EVIA 3P7NA 3T5XA 3KEOA 1BOAA 3GZ5A 4IRGA 1B9NA 3FHZA 3SQNA 3BROA 1J9IA 2FE3A 2P8TA 4AVPA 4U0YA 3IKVA 1W7PB 3WTXC 2M8EA 4IVNA 2XGXA 4U7DA 2WC2A 2DQRA 1AWCA 3CO7C 2XASA 1JE8A 4XSXF 4YIFA 4TV7A 4ZH4F 1SD5A 2PN6A 1XCBA 5JI6A 4GYGA 4OOIA 1FYLA 3IWFA 4YIIA 2NNYA 2F5DA 2PBIA 3R60A 5LEJA 1DP7P 3BJOA 1BIAA 1XGNA 2CWEA 3RKXA 4HF0A 3T8RA 2ZMEA 1A04A 5HLGA 4N9IA 5FD6A 1Z7UA 4L0YB 3QRFF 3F72A 3G73A 3QPHA 3MZHA 1R7JA 3R61A 2BYVE 4L0ZB 1ZG3A 3VFZA 2ZNZA 3B73A 1LDJA 5DD4A 4EJWA 3F3XA 4Q47A 1KQ9A 3M7GA 2HZTA 3LA2A 2D45A 4EQQA 4MGRA 1BI3A 5A2QK 1XGMA 1R23A 1QO0D 1MDMA 4KMFA 4L5IA 1SD6A 1MDMB 3ZMZA 4BYYA 2MC3A 2MLKA 4ASNA 4KMUX 1W5SA 5D8KB 3JSPA 1OR7A 3M8EA 1J5YA 1YS7A 1TW2A 3GFLA 2EFWA 4L9JA 3WE2A 3EYIA 1KQ0A 1NHAA 3L2CA 4ENNA 5E1WA 5DV5A 4XSZF 3MZYA 3M1EA 5D6EA 1MJBA 4FHTA 1U3EM 2COMA 3RYRA 4NB5A 4XLNF 5L3EA 1G4DA 3WTVC 3COAC 3MCZA 5LBQA 1PDNC 5D5WB 3V4GA 1P4XA 2EJRA 3ISPA 4EMSA 4KFCA 3HRSA 1R22A 2GAUA 2XKPA 1R1UA 3K0LA 1X3UA 2IW5A 1O3RA 3W6KB 4G6DA 1V3FA 2M30A 4I01A 5HLIA 2QVOA 5E1ZB 2XKOA 1IUYA 3N4MA 4P96A 5F6FA 1XMAA 2HDCA 5HDNA 2HWVA 2PEXA 3I59A 3O6BB 1YW7A 3I59B 2CQKA 3FXUA 1TQMA 4IRIA 3SZPA 1G3SA 1Z9CA 3QPTA 4O5VA 3E5QA 3E6MA 3J80Z 2QWWA 1W5TA 4KA4A 4MTDA 5DCMA 4EJUA 1HQCA 1OMIA 4P9FA 1SFXA 3GZ6A 4GYIA 4OMYA 3CTAA 5J8CA 2ELHA 2L54A 5HOOA 4OINF 1U2WA 2A61A 2P5VA 3WTUC 4RGSA 4A5MA 2XAFA 2M45A 5TRDA 1WKMA 4UUVA 5ICGA 2F5EA 4G6QA 2VOOA 2HOEA 1KA8A 1Z1DA 2V9VA 3FF5A 2VBZA 2ISYA 3KP5A 3L09A 3R0AA 2C6YA 2Q0OA 2ZXJA 4HBLA 3FX3A 3HSFA 2RKHA 3N97A 4LGWA 1I1GA 4EM1A 4IHTA 6PAXA 4G7HF 2KJBA 3D0SA 4OU0A 2Z9OA 2ZFWA 4IRHA 4ENMA 3ULQB 2AXLA 4ZZLA 4BHBA 1YW8A 1IXRC 4MQ9F 2EK5A 2VE9A 4CGZA 3TDZC 2HGCA 3V8LA 1ZAOA 2XAJA 4AD9A 4Y15A 1B6AA 1R58A 2WWYA 2HKOA 5E8GA 1IN4A 2VC1A 2RQPA 3J7AO 2PFBA 1UCRA 1CF7A 4UV9A 4I02A 3PFIA 5CLSA 4Z2YA 3TO7A 1TBXA 1XSXA 4EM0B 2JTVA 1FWZA 2W84A 4M9ZA 4A0XA 1U5TA 5BPIA 3HRUA 5E20A 2DO7A 2IA0A 1L3LA 2HQNA 4R79A 5BS6A 3HTUA 3RKYA 5D4RA 1HW5A 3FXRA 2STWA 1F4KA 3V8KA 4EM2A 4QWQA 2JZYA 4HX8A 3O3KA 1ZARA 4A0YA 4BQAA 2H27A 2XHKA 1O7FA 4PZJA 3CJNA 2EV6A 3HSRA 2PG4A 4L9TA 4QLCU 5BPDA 5J8FA 4HW0A 2A69F 4RGRA 1ON2A 3KZYA 4S05A 1ZN2A 2FF4A 2DI3A 1EH8A 2EFNA 2HYFA 4LMYA 2Z99A 4HQEA 3HYIA 2WV0A 2VBXA 3WG9A 4ZYHA 3ABTA 4RGXA 2W24A 5LRRA 2E7XA 2VBYA 4UXNA 5F1RA 4HV5A 1HKSA 1OYWA 5HS7A 5A2QZ 2YPRA 2BE5F 3BWGA 5FB2A 4IF4A 1PP8F 4RAYA 5FD5A 3JTGA 2P6TA 2OZ6A 3ECOA 3R0JA 3I64A 4KN4X 3NRVA 3DV8A 3GFJA 3FMQA 3LFKA 1O57A 1BI0A 1XB4A 2ISZA 4XRFA 5K5QA 2JPBA 3FWEA 2NYXA 2W85A 1F1ZA 5LEKA 1FYMA 4R1HA 3D5LA 2HKXA 4I0AA 1WWXA 5BQTA 1LB2A 2QENA 5FFZA 2DFIA 1YFHA 4JQFA 4ON0A 4FX4A 3F6OA 4HLXA 1ZG1A 3K69A 1TNTA 3E6BA 1QZYA 1HBXG 1FZPB 4UVBA 3ZQ7A 1LQ1A 3KP3A 1T38A 4LLNA 1RI7A 1R5HA 1S6LA 2RDPA 3WTSC 1ULYA 3GVAA 3BPVA 1K79A 2K27A 3REOA 2QBYA 4RB1A 2VC0A 2A6HF 5LRSA 1BC8C 3ZP5A 3TO6A 1HKTA 1KQ8A 2KIUA 3T8TA 2G7HA 5L3GA 1J2XA 2VBWA 1R36A 4G94A 1B59A 2IP2A 2L01A 2VT3A 3E5UA 1XD7A 4L9NA 3KEQA 4BXUA 1V4RA 4M73A 1IN7A 1EH6A 4EV0A 4Q48A 1RIOH 2MA3A 2QQ9A 3GUDA 2Y48A 3KETA 4LJZF 3TKYA 3HTSB 1RZ4A 1S8NA 1UB9A 1TQPA 2EFQA 5EEGA 2MH9A 5ERIA 3SXYA 4ESFA 1S29A 2HFHA 2V6CA 4HDUA 1TW3A 2O3FA 5KVRA 1Y0UA 1ZLJA 4HAMA 3GW2A 3QAHA 1IF1A 4UV8A 3V8JA 4JBAA 5BMZA 3ELKA 4EJTA 2Q2EA 2Y0MA 1ZRFA 1AOYA 1GVJA 1T0FA 4FX0A 1YYVA 4EGYA 4A6DA 5JHUA 3FMRA 3F8FA 3B02A 3DPLC 5FLXK 1FP2A 1HSJA 2ZMEB 3HUGA 2K4BA 2HYGD 3DF8A 2YU3A 1P4WA 2IA1A 2LNBA 1Z6RA 3KLOA 1YO5C 4M74A 1BIBA 3QOPA 2L4AA 4M9SA 4ESJA 4IXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I5Z A;  4AIK A;  3GX4 X;  4BH9 A;  2QUF A;  3I4P A;  1FY7 A;  2IVM A;  1FBS A;  4IJA A;  3DXJ F;  3EUH A;  4MHG A;  1HW1 A;  1HST A;  4A2U A;  3L00 A;  4O6J A;  1U6G A;  2LF7 A;  1LDK B;  1FX7 A;  2HTS A;  1YS6 A;  1ZG5 A;  4KT5 C;  3P9I A;  1S7A A;  4PCQ A;  3ECH A;  4M6Y A;  2ADU A;  1RUN A;  3W6J B;  2FEZ A;  2KIM A;  3WTZ A;  4MEX F;  3KP2 A;  2NRA C;  4ZZD A;  1P2F A;  1KU2 A;  2PMH A;  3T0Y A;  1XGO A;  2UWM A;  4LG0 A;  4EGZ A;  5K1Y A;  3FXQ A;  3CO6 C;  4KIC A;  4LG0 B;  2X4H A;  1G3W A;  3F22 A;  2YX4 A;  4PGH A;  3E5X A;  4OIQ F;  2H09 A;  1DDN A;  2UXN A;  3K2Z A;  2FNP A;  1MJ9 A;  1LVA A;  1FSH A;  2XV4 S;  5E1X A;  4LLG F;  2VON A;  5ICE A;  1IN6 A;  2CW0 F;  3RIR A;  2CGP A;  2KIF A;  4HA8 A;  1OYY A;  3M9A A;  4WK8 F;  1F9N A;  2DTR A;  3C3W A;  2X0L A;  2HQR A;  4RS8 A;  4U0W A;  1RNL A;  3I58 A;  3RYP A;  2XAG A;  2GWR A;  4HZF A;  3MFK A;  2F5F A;  3KP4 A;  3QU6 A;  2M87 A;  1UST A;  3CDH A;  3I54 A;  3V7C A;  3CUQ A;  2O61 A;  5D5V B;  3U9G A;  1D5V A;  4JK1 X;  1VTN C;  3I53 A;  5DCM B;  4A0Z A;  4HDV A;  2XAH A;  4AIH A;  4L5J A;  4OIP F;  4LK1 F;  4GCV A;  3FM5 A;  3RJP A;  1S7O A;  3I71 A;  2LKP A;  5E18 F;  3MAJ A;  3ZMT A;  1QZZ A;  1Z91 A;  1UHW A;  2MH2 A;  2M5W A;  4M9X A;  4CHU A;  1YIO A;  4KN7 X;  4RGU A;  4A12 A;  4N9H A;  4YFX F;  4EJV A;  2QQA A;  1YW9 A;  2CO5 A;  5ILU A;  3F8C A;  2LF8 A;  4KIB A;  3ZPL A;  2W57 A;  4U0V A;  2JRT A;  3LQQ A;  2OBP A;  3HHG A;  3TOA A;  4A5N A;  3RPQ A;  3F6V A;  2Q8K A;  5EEH A;  2A07 F;  2DPU A;  4EJO A;  1J59 A;  1EH7 A;  3L9F A;  3GYH X;  5L3F A;  5AIQ A;  5K5O A;  2K4J A;  3TDU C;  2BEO A;  3L7W A;  3KE2 A;  1XMK A;  5K5R A;  5IT9 K;  1R5G A;  3R4K A;  1K78 A;  4PDK A;  1C0W A;  3DQV C;  3C1D A;  2VN2 A;  4UVA A;  2KRF A;  2NAZ A;  2EFO A;  5LGN A;  5DD8 A;  3WTT C;  2DK5 A;  3U1D A;  1JGS A;  2IA2 A;  4IHS A;  3VOD A;  1T39 A;  2ESH A;  3JTH A;  1CF7 B;  3MEX A;  2CFX A;  2ETH A;  1QGP A;  5DUK A;  1G3T A;  1UFM A;  5ICC A;  1U5T B;  3WGH A;  1XDS A;  1YQA A;  1E2X A;  1IAW A;  3GLX A;  3HRT A;  3ZMV A;  3VEP A;  2K86 A;  2EV0 A;  1ODD A;  2Z5U A;  1SFE A;  3EQL F;  2E1N A;  2P4W A;  1E17 A;  1MGT A;  4KIF A;  3OOP A;  1FOK A;  2D1V A;  4HF2 A;  3IL2 A;  1JHF A;  3KCC A;  1KGS A;  3M8F A;  2A5Y B;  2ACJ A;  2Z3Y A;  5FLX Z;  4LB6 B;  1ZHF A;  4RB0 A;  3I0T A;  4DNC A;  1IN5 A;  4IPA A;  1K6O A;  1Q1H A;  4AWX B;  2VE8 A;  4CZZ A;  2A6E F;  1XCV A;  5AON A;  5HS8 A;  3HHH A;  2FBK A;  1FP1 D;  4M72 A;  3LAJ A;  2QQB A;  3WOD F;  1LNW A;  5D4S A;  4ZYE A;  4CDG A;  3F21 A;  1F5T A;  4U7B A;  3ZMD A;  2V1X A;  1B9M A;  2O8X A;  1SMT A;  5L3B A;  3I5U A;  4ENK A;  1W7P D;  3KLN A;  2DBB A;  1QQI A;  2FOK A;  2EA4 A;  5HDG A;  1KYW A;  2W25 A;  3WTY C;  5TJJ A;  2VT2 A;  1CGP A;  3KP7 A;  2E7W A;  4KNY A;  1KYZ A;  2O6G E;  1U5T C;  3DKW A;  2BBY A;  4I98 B;  3IC7 A;  1FSE A;  1KU7 A;  2PJP A;  2NS0 A;  1I1S A;  3LQR A;  4R8H A;  1I6X A;  2QZ8 A;  5DCF A;  1U8R A;  2XRN A;  4CO8 A;  2NNN A;  3CLO A;  1DPR A;  1HXD A;  3WU1 B;  1DPU A;  2XAQ A;  3LAP A;  1STZ A;  2G7U A;  2HEO A;  2LSO A;  2P7V B;  1FBQ A;  4MEY F;  1MD0 A;  1O3Q A;  3NEU A;  3EYY A;  2DQL A;  1ZRD A;  1FPQ A;  2QBY B;  2DT5 A;  4LFU A;  2RGV A;  3EDP A;  3Q9S A;  1MZB A;  4CIC A;  2E1C A;  2A68 F;  2TDX A;  4CYD A;  1SFU A;  3ZN0 A;  1J0R A;  5DEQ A;  2RC4 A;  5CVU A;  1B4A A;  2GA2 A;  1D8J A;  1ON1 A;  3V7R A;  1ZGA A;  2FU4 A;  4RB2 C;  1BBY A;  2FMY A;  5LHG A;  1ZGJ A;  1EV7 A;  3ZN1 A;  5E8I A;  4OIR F;  1Z05 A;  4WXD A;  4O3M A;  3ML6 A;  4HLY A;  3GFM A;  4ETS A;  1KU9 A;  5JFR A;  2VXZ A;  2DAO A;  3BY6 A;  3KP6 A;  2QYO A;  5FGM A;  1G3Y A;  3ZMU A;  1IXS B;  3TO9 A;  1W4M A;  3K1P A;  1UHM A;  3F8B A;  3TQN A;  4K2E A;  3TOB A;  1YLF A;  1KU3 A;  2OU2 A;  2EWN A;  2ZKZ A;  4XBF A;  2GXG A;  1W7P A;  1WI9 A;  3WGI A;  1BI1 A;  3WTW C;  5H6R A;  5ED4 A;  1FYK A;  3RPU A;  1PUE E;  3HOS A;  2YX7 A;  5IT3 A;  1L0O C;  4AIJ A;  2VOP A;  5AIP A;  2WTE A;  3FM3 A;  3FZV A;  1FBU A;  3HRM A;  2L4M A;  1I27 A;  2PLY A;  3S2W A;  3V7S A;  3GWZ A;  3RDI A;  1TTY A;  5IT9 Z;  1TLH B;  4L18 B;  2PI0 A;  2HR3 A;  3DEU A;  2EFP A;  2GZW A;  2YR2 A;  4WF2 A;  2OZU A;  3WGG A;  1USS A;  3CUO A;  1O7L A;  1HW2 A;  2GXB A;  2BGC A;  4WXH A;  4M6X A;  4KDP A;  4KUM A;  3RTR A;  2PQ8 A;  2OA4 A;  4BAY A;  2XIG A;  5CYV A;  3JAM K;  3E3V A;  3J81 K;  1R00 A;  3C7J A;  5HS9 A;  1XSV A;  5CJ9 A;  1QBJ A;  4M71 A;  3QU3 A;  3ROU A;  5LGT A;  4WCG A;  1LJ9 A;  5KK1 A;  4MQV A;  1BM9 A;  2FML A;  2FSW A;  3LWF A;  4CXF A;  2EV5 A;  5BOX A;  4G8X A;  1J7K A;  2DK8 A;  1BN5 A;  3DPT A;  3MWM A;  3LA3 A;  2DW4 A;  1D3Y A;  2IT0 A;  4OIO F;  1T6S A;  2Y75 A;  4LK0 F;  2ZCW A;  4YFN F;  4RB3 C;  4HOB A;  3O2P E;  4G9Y A;  3F8N A;  1U78 A;  1P6R A;  2CYY A;  4WWC A;  5CVI A;  2MD5 A;  1JXS A;  3GFI A;  1TQI A;  2H6B A;  3LA7 A;  1SD4 A;  2ZNY A;  2DU9 A;  1YTY A;  2L02 A;  2P5K A;  1Z6T A;  2B0L A;  4HV6 A;  2YSR A;  3BDD A;  1XSD A;  2QLZ A;  4B8X A;  4MTE A;  2XVC A;  5H20 A;  2EA2 A;  3H3U A;  2O0Y A;  2D2W A;  4P9U A;  4NQW A;  5LLQ A;  2F2E A;  4HQM A;  3F23 A;  1GXQ A;  1H9T A;  2V1D A;  1RUO A;  1G6N A;  3ABU A;  2FQ3 A;  4Y13 A;  3TGN A;  2ESN A;  3CUQ B;  2DLL A;  3GXO A;  2IRF G;  3U2R A;  1D8K A;  4WX9 A;  3G3Z A;  4RAZ A;  3HSE A;  3BJ6 A;  1T2K A;  1GHC A;  3KZZ A;  5D8L B;  1TNS A;  3C18 A;  4BHC A;  4ENJ A;  3KFW X;  5L3C A;  2FBH A;  1FT9 A;  3E97 A;  5JR3 A;  2GQQ A;  1IXC A;  3EET A;  4GO1 A;  4HX7 A;  2V79 A;  5E17 F;  3LST A;  4I09 A;  1H0M A;  5DUI A;  3GF2 A;  1BI2 A;  5HDK A;  3H3Z A;  3ERE D;  1ZYR F;  2STT A;  2ZO4 A;  1HKQ A;  5ILV A;  5F64 A;  3SHF A;  5LHI A;  1ZRC A;  5LGU A;  2MLG A;  3BP8 A;  3K9T A;  2RNJ A;  4I0B A;  4ZYD A;  3JSO A;  3H92 A;  3HIF A;  2FRH A;  2Z33 A;  1GXP A;  2OD5 A;  3VB2 A;  1YG2 A;  1XDU A;  1ZH5 A;  5FO5 A;  2RV8 A;  5HLH A;  1DUX C;  1K78 B;  5D6F A;  1OPC A;  4KYW A;  4GXO A;  2A3S A;  3ZMS A;  1R1T A;  2GA1 A;  3PQJ A;  3CUQ C;  4HYE A;  2JT1 A;  2ZJ2 A;  3P9C A;  1XN7 A;  2R7F A;  2P5L C;  4HF1 A;  4H0E A;  5CVJ A;  2OQR A;  1MJA A;  2MBF A;  1QNT A;  4A6E A;  3MQ0 A;  4LB5 A;  2L3D A;  3VOE A;  5DDG A;  3T1B A;  2R3S A;  2AS5 F;  1SD7 A;  4NHJ A;  3BOQ A;  3RI4 A;  1O3T A;  1ONV A;  2FXA A;  4I7H A;  3Q9V A;  4MNU A;  5HVQ C;  3P9K A;  4UVC A;  5D5X B;  2VOD A;  4GGG A;  4LLL A;  2OAZ A;  1IRG A;  4ZYG A;  4PGG A;  1IZ1 A;  1XGS A;  3WU0 A;  3K1N A;  4P5O A;  1IRF A;  4G7O F;  1R1V A;  3JW4 A;  3E6C C;  3IWZ A;  2HS5 A;  2FA5 A;  2IJL A;  1OKR A;  1SMY F;  2P6S A;  4B09 A;  2KKO A;  4ESB A;  5LHH A;  4Q5S F;  1SAX A;  4G7Z F;  1FC3 A;  2ZBK A;  1P4A A;  3IHU A;  3QP6 A;  3R6S A;  2G9W A;  4WXC A;  3NQO A;  1T98 A;  3E6D A;  5ICF A;  1LEB A;  2FNA A;  1BJA A;  1P92 A;  4P55 A;  4BNC A;  1J75 A;  3JAM Z;  4OMZ A;  3Q5F A;  4XLP F;  2GIV A;  5DYM A;  3QP5 A;  5J6X A;  3OV8 A;  3J81 Z;  1O3S A;  1PP7 U;  2OQG A;  2J5P A;  4Y17 A;  2H6C A;  2JPC A;  2LDU A;  1LDD A;  4U88 A;  2UZK A;  3GEZ A;  3DP7 A;  4N0B A;  1ZLK A;  2H94 A;  3HOT A;  4DQ2 A;  3F8M A;  3J80 K;  5H6Q A;  2F5C A;  4L9V A;  2D1H A;  3GO5 A;  3BPX A;  5ILS A;  4BHP A;  2CG4 A;  2UXX A;  1JHH A;  1ZRE A;  2XUB A;  2BV6 A;  3BZ6 A;  1LEA A;  5CVV A;  3WE3 A;  4LD5 A;  4Q4Z F;  2PMU A;  3K1M A;  4F7Z A;  2HTJ A;  4S04 A;  3SFZ A;  2V1U A;  2O03 A;  3SZT A;  2FBI A;  1FLI A;  1WQ2 A;  1MKM A;  1WSU A;  2M1B A;  3FMS A;  4I2O A;  3RKW A;  1IW7 F;  5L3D A;  1IN8 A;  3IKT A;  2XRO A;  4YG2 F;  1OYI A;  5JVT A;  4KIG A;  2QM3 A;  3DFG A;  1BC7 C;  2K02 A;  2R7D A;  4D0P A;  2EB7 A;  2CSO A;  2K7L A;  3PQK A;  1H9G A;  4YFK F;  1QPM A;  5CVR A;  4HX4 A;  1B1B A;  4E70 A;  5FFX A;  1S3J A;  1WRJ A;  1REP C;  2P7C B;  2IPQ X;  2RN7 A;  1FNN A;  2JSC A;  3IRR A;  3BJA A;  4FT8 A;  2DPD A;  4UNO A;  2RVC A;  4UHT A;  2J5O A;  3AAF A;  2KJC A;  1K7A A;  3IRQ A;  5D5U B;  4EVI A;  3P7N A;  3T5X A;  3KEO A;  1BOA A;  3GZ5 A;  4IRG A;  1B9N A;  3FHZ A;  3SQN A;  3BRO A;  1J9I A;  2FE3 A;  2P8T A;  4AVP A;  4U0Y A;  3IKV A;  1W7P B;  3WTX C;  2M8E A;  4IVN A;  2XGX A;  4U7D A;  2WC2 A;  2DQR A;  1AWC A;  3CO7 C;  2XAS A;  1JE8 A;  4XSX F;  4YIF A;  4TV7 A;  4ZH4 F;  1SD5 A;  2PN6 A;  1XCB A;  5JI6 A;  4GYG A;  4OOI A;  1FYL A;  3IWF A;  4YII A;  2NNY A;  2F5D A;  2PBI A;  3R60 A;  5LEJ A;  1DP7 P;  3BJO A;  1BIA A;  1XGN A;  2CWE A;  3RKX A;  4HF0 A;  3T8R A;  2ZME A;  1A04 A;  5HLG A;  4N9I A;  5FD6 A;  1Z7U A;  4L0Y B;  3QRF F;  3F72 A;  3G73 A;  3QPH A;  3MZH A;  1R7J A;  3R61 A;  2BYV E;  4L0Z B;  1ZG3 A;  3VFZ A;  2ZNZ A;  3B73 A;  1LDJ A;  5DD4 A;  4EJW A;  3F3X A;  4Q47 A;  1KQ9 A;  3M7G A;  2HZT A;  3LA2 A;  2D45 A;  4EQQ A;  4MGR A;  1BI3 A;  5A2Q K;  1XGM A;  1R23 A;  1QO0 D;  1MDM A;  4KMF A;  4L5I A;  1SD6 A;  1MDM B;  3ZMZ A;  4BYY A;  2MC3 A;  2MLK A;  4ASN A;  4KMU X;  1W5S A;  5D8K B;  3JSP A;  1OR7 A;  3M8E A;  1J5Y A;  1YS7 A;  1TW2 A;  3GFL A;  2EFW A;  4L9J A;  3WE2 A;  3EYI A;  1KQ0 A;  1NHA A;  3L2C A;  4ENN A;  5E1W A;  5DV5 A;  4XSZ F;  3MZY A;  3M1E A;  5D6E A;  1MJB A;  4FHT A;  1U3E M;  2COM A;  3RYR A;  4NB5 A;  4XLN F;  5L3E A;  1G4D A;  3WTV C;  3COA C;  3MCZ A;  5LBQ A;  1PDN C;  5D5W B;  3V4G A;  1P4X A;  2EJR A;  3ISP A;  4EMS A;  4KFC A;  3HRS A;  1R22 A;  2GAU A;  2XKP A;  1R1U A;  3K0L A;  1X3U A;  2IW5 A;  1O3R A;  3W6K B;  4G6D A;  1V3F A;  2M30 A;  4I01 A;  5HLI A;  2QVO A;  5E1Z B;  2XKO A;  1IUY A;  3N4M A;  4P96 A;  5F6F A;  1XMA A;  2HDC A;  5HDN A;  2HWV A;  2PEX A;  3I59 A;  3O6B B;  1YW7 A;  3I59 B;  2CQK A;  3FXU A;  1TQM A;  4IRI A;  3SZP A;  1G3S A;  1Z9C A;  3QPT A;  4O5V A;  3E5Q A;  3E6M A;  3J80 Z;  2QWW A;  1W5T A;  4KA4 A;  4MTD A;  5DCM A;  4EJU A;  1HQC A;  1OMI A;  4P9F A;  1SFX A;  3GZ6 A;  4GYI A;  4OMY A;  3CTA A;  5J8C A;  2ELH A;  2L54 A;  5HOO A;  4OIN F;  1U2W A;  2A61 A;  2P5V A;  3WTU C;  4RGS A;  4A5M A;  2XAF A;  2M45 A;  5TRD A;  1WKM A;  4UUV A;  5ICG A;  2F5E A;  4G6Q A;  2VOO A;  2HOE A;  1KA8 A;  1Z1D A;  2V9V A;  3FF5 A;  2VBZ A;  2ISY A;  3KP5 A;  3L09 A;  3R0A A;  2C6Y A;  2Q0O A;  2ZXJ A;  4HBL A;  3FX3 A;  3HSF A;  2RKH A;  3N97 A;  4LGW A;  1I1G A;  4EM1 A;  4IHT A;  6PAX A;  4G7H F;  2KJB A;  3D0S A;  4OU0 A;  2Z9O A;  2ZFW A;  4IRH A;  4ENM A;  3ULQ B;  2AXL A;  4ZZL A;  4BHB A;  1YW8 A;  1IXR C;  4MQ9 F;  2EK5 A;  2VE9 A;  4CGZ A;  3TDZ C;  2HGC A;  3V8L A;  1ZAO A;  2XAJ A;  4AD9 A;  4Y15 A;  1B6A A;  1R58 A;  2WWY A;  2HKO A;  5E8G A;  1IN4 A;  2VC1 A;  2RQP A;  3J7A O;  2PFB A;  1UCR A;  1CF7 A;  4UV9 A;  4I02 A;  3PFI A;  5CLS A;  4Z2Y A;  3TO7 A;  1TBX A;  1XSX A;  4EM0 B;  2JTV A;  1FWZ A;  2W84 A;  4M9Z A;  4A0X A;  1U5T A;  5BPI A;  3HRU A;  5E20 A;  2DO7 A;  2IA0 A;  1L3L A;  2HQN A;  4R79 A;  5BS6 A;  3HTU A;  3RKY A;  5D4R A;  1HW5 A;  3FXR A;  2STW A;  1F4K A;  3V8K A;  4EM2 A;  4QWQ A;  2JZY A;  4HX8 A;  3O3K A;  1ZAR A;  4A0Y A;  4BQA A;  2H27 A;  2XHK A;  1O7F A;  4PZJ A;  3CJN A;  2EV6 A;  3HSR A;  2PG4 A;  4L9T A;  4QLC U;  5BPD A;  5J8F A;  4HW0 A;  2A69 F;  4RGR A;  1ON2 A;  3KZY A;  4S05 A;  1ZN2 A;  2FF4 A;  2DI3 A;  1EH8 A;  2EFN A;  2HYF A;  4LMY A;  2Z99 A;  4HQE A;  3HYI A;  2WV0 A;  2VBX A;  3WG9 A;  4ZYH A;  3ABT A;  4RGX A;  2W24 A;  5LRR A;  2E7X A;  2VBY A;  4UXN A;  5F1R A;  4HV5 A;  1HKS A;  1OYW A;  5HS7 A;  5A2Q Z;  2YPR A;  2BE5 F;  3BWG A;  5FB2 A;  4IF4 A;  1PP8 F;  4RAY A;  5FD5 A;  3JTG A;  2P6T A;  2OZ6 A;  3ECO A;  3R0J A;  3I64 A;  4KN4 X;  3NRV A;  3DV8 A;  3GFJ A;  3FMQ A;  3LFK A;  1O57 A;  1BI0 A;  1XB4 A;  2ISZ A;  4XRF A;  5K5Q A;  2JPB A;  3FWE A;  2NYX A;  2W85 A;  1F1Z A;  5LEK A;  1FYM A;  4R1H A;  3D5L A;  2HKX A;  4I0A A;  1WWX A;  5BQT A;  1LB2 A;  2QEN A;  5FFZ A;  2DFI A;  1YFH A;  4JQF A;  4ON0 A;  4FX4 A;  3F6O A;  4HLX A;  1ZG1 A;  3K69 A;  1TNT A;  3E6B A;  1QZY A;  1HBX G;  1FZP B;  4UVB A;  3ZQ7 A;  1LQ1 A;  3KP3 A;  1T38 A;  4LLN A;  1RI7 A;  1R5H A;  1S6L A;  2RDP A;  3WTS C;  1ULY A;  3GVA A;  3BPV A;  1K79 A;  2K27 A;  3REO A;  2QBY A;  4RB1 A;  2VC0 A;  2A6H F;  5LRS A;  1BC8 C;  3ZP5 A;  3TO6 A;  1HKT A;  1KQ8 A;  2KIU A;  3T8T A;  2G7H A;  5L3G A;  1J2X A;  2VBW A;  1R36 A;  4G94 A;  1B59 A;  2IP2 A;  2L01 A;  2VT3 A;  3E5U A;  1XD7 A;  4L9N A;  3KEQ A;  4BXU A;  1V4R A;  4M73 A;  1IN7 A;  1EH6 A;  4EV0 A;  4Q48 A;  1RIO H;  2MA3 A;  2QQ9 A;  3GUD A;  2Y48 A;  3KET A;  4LJZ F;  3TKY A;  3HTS B;  1RZ4 A;  1S8N A;  1UB9 A;  1TQP A;  2EFQ A;  5EEG A;  2MH9 A;  5ERI A;  3SXY A;  4ESF A;  1S29 A;  2HFH A;  2V6C A;  4HDU A;  1TW3 A;  2O3F A;  5KVR A;  1Y0U A;  1ZLJ A;  4HAM A;  3GW2 A;  3QAH A;  1IF1 A;  4UV8 A;  3V8J A;  4JBA A;  5BMZ A;  3ELK A;  4EJT A;  2Q2E A;  2Y0M A;  1ZRF A;  1AOY A;  1GVJ A;  1T0F A;  4FX0 A;  1YYV A;  4EGY A;  4A6D A;  5JHU A;  3FMR A;  3F8F A;  3B02 A;  3DPL C;  5FLX K;  1FP2 A;  1HSJ A;  2ZME B;  3HUG A;  2K4B A;  2HYG D;  3DF8 A;  2YU3 A;  1P4W A;  2IA1 A;  2LNB A;  1Z6R A;  3KLO A;  1YO5 C;  4M74 A;  1BIB A;  3QOP A;  2L4A A;  4M9S A;  4ESJ A;  4IXA A; 
#chains in the Genus database with same CATH topology
 2CQ7 A;  3SZG A;  1I5Z A;  4AIK A;  3GX4 X;  3JCU C;  2OF7 A;  2QUF A;  4BH9 A;  3I4P A;  3OYF A;  3W2A A;  1FY7 A;  2G0E A;  3LOC A;  2IVM A;  1XC5 A;  1FBS A;  4IJA A;  4HNT A;  3DXJ F;  3NWS A;  3EUH A;  4PSX A;  1NTC A;  5E3N A;  1V5G A;  1XMX A;  1X58 A;  1R6R A;  2H8W A;  1HW1 A;  4MHG A;  3ZQF A;  4BE0 A;  1HST A;  3H1C A;  1IV8 A;  3L2R A;  4A2U A;  3L00 A;  3HZJ A;  2HYJ A;  4BE1 A;  4LIU A;  4O6J A;  3FBN B;  3O8G A;  3VDX A;  2EIK H;  4D7N A;  1U6G A;  2LF7 A;  3K4K A;  1LDK B;  2LY2 A;  2VQH A;  4ABZ A;  1FX7 A;  1IG7 A;  2HTS A;  3CF5 F;  1YS6 A;  1ZG5 A;  2CUF A;  4KT5 C;  3P9I A;  1S7A A;  4PCQ A;  3ECH A;  4M6Y A;  3ZQL A;  2ADU A;  1RUN A;  3W6J B;  2B9S A;  4PJJ A;  2KRC A;  2FEZ A;  4DBQ A;  1P9Q C;  2KIM A;  2HQA A;  4U87 A;  1HOM A;  2CQX A;  3WTZ A;  4MEX F;  3KP2 A;  2NRA C;  1OQY A;  2LH9 A;  4IQJ A;  4ZZD A;  1P2F A;  1KU2 A;  4LIT A;  2PMH A;  2DYR H;  3KYC B;  3T0Y A;  4QPO A;  3S3M A;  4PK4 A;  4C3I J;  1VQ6 I;  4DZJ A;  1XGO A;  1SFO J;  2QSF X;  1P7J A;  2AXT C;  2UWM A;  2DMQ A;  2EIL H;  3CQZ J;  4LG0 A;  2RQQ A;  4EGZ A;  3FXM A;  3FXQ A;  5K1Y A;  3CO6 C;  4KIC A;  4LG0 B;  4C9Y A;  2X4H A;  1UG0 A;  1G3W A;  4OWR B;  2MGQ A;  3F22 A;  1X1B A;  2YX4 A;  3CJT B;  4PGH A;  4EAT A;  3E5X A;  3WHB A;  2H09 A;  4DIQ A;  3CME I;  4OIQ F;  2LC2 A;  1DDN A;  2UXN A;  2OCC H;  2E1O A;  3K2Z A;  2FNP A;  2O9L A;  2NXN B;  2YS9 A;  3O8H A;  4KT6 A;  1I3A A;  2Z2S B;  1MJ9 A;  1LVA A;  1FSH A;  2XV4 S;  4JX4 A;  2R7T A;  5E1X A;  4LLG F;  1VQ9 I;  2VON A;  2HVS A;  5ICE A;  1IN6 A;  3PIO F;  1RC9 A;  2CW0 F;  2W82 A;  3RIR A;  2CGP A;  2DTZ A;  2KIF A;  1GV2 A;  4JX5 A;  4HA8 A;  1OYY A;  2KL4 A;  3AFH A;  3M9A A;  2UV1 A;  2VIX A;  4WK8 F;  1IRZ A;  1F9N A;  2DTR A;  3CF2 A;  1VQM I;  3C2B A;  2X0L A;  3C3W A;  2HQR A;  2K85 A;  3OL4 A;  4RMN A;  4RS8 A;  2EZK A;  4U0W A;  3K4C A;  5C44 J;  4PFO A;  2F4M B;  4XRS G;  4II3 A;  2CV1 A;  1RNL A;  3I58 A;  3RYP A;  4CUG A;  3OY9 A;  2XAG A;  1WJD A;  2GWR A;  2K9Q A;  4HZF A;  3MFK A;  2F5F A;  3IP4 B;  5IYB J;  2IBD A;  2K40 A;  2P0W A;  3KP4 A;  3S93 A;  3QU6 A;  3BT9 A;  2M87 A;  2IGK A;  4F55 A;  1UST A;  4KJZ A;  3CDH A;  1OCZ H;  3I54 A;  3V7C A;  2KDZ A;  3A2K A;  5J4Y A;  3CUQ A;  2O61 A;  5D5V B;  3EPZ A;  3U9G A;  3FHN A;  1D5V A;  2KP6 A;  2R7O A;  4JK1 X;  3I53 A;  3CCQ I;  4ANJ A;  1OR7 C;  1VTN C;  5F08 A;  3S32 A;  2HOS A;  3LSH A;  5DCM B;  4A0Z A;  4I76 A;  4HDV A;  2XAH A;  4AIH A;  4F3Q A;  4L5J A;  1H8A C;  4OIP F;  4LK1 F;  4GCV A;  3FM5 A;  4PJM A;  4HNU A;  3RJP A;  1S7O A;  3DTK A;  3I71 A;  2LKP A;  2DN0 A;  1AA7 A;  4ITV A;  4Y3O A;  5E18 F;  2CU7 A;  3MAJ A;  3GTQ J;  1OLT A;  3ZMT A;  4DW6 A;  1QZZ A;  2BY0 A;  2ZXW H;  1HDD C;  1YJN I;  2GOX B;  1Z91 A;  1UHW A;  2R7Z J;  2MH2 A;  2M5W A;  5EYR A;  4M9X A;  4CHU A;  4A3G J;  2LRE A;  1YIO A;  4KN7 X;  3HOZ J;  4RGU A;  4A12 A;  4N9H A;  2M4K A;  3UNG C;  4YFX F;  1X4O A;  4EJV A;  3EUK L;  1LPQ A;  2X6X A;  4AUX A;  3H0G J;  2QQA A;  1YW9 A;  2CO5 A;  5ILU A;  1Y6I A;  3F8C A;  2LF8 A;  4KIB A;  4Y33 A;  2HOA A;  3ZPL A;  1IC8 A;  3K70 C;  2W57 A;  4U0V A;  3JR9 A;  2JRT A;  2QF7 A;  2NVU B;  2YU9 J;  3LQQ A;  3TBI A;  1Q1V A;  1T95 A;  2OBP A;  3HHG A;  3TOA A;  1VF9 A;  3CCY A;  4A5N A;  4B3X A;  3OYL A;  2LKX A;  3RPQ A;  4RAG A;  4AVZ A;  2K9N A;  3E7L A;  3F6V A;  3PSF A;  2Q8K A;  4EEF G;  3ZXS A;  2HU9 A;  1JT6 A;  5EEH A;  4YRV A;  2HDD A;  3FBI B;  4XLH A;  2A07 F;  2DPU A;  4EJO A;  3C2H A;  5B1A H;  2ICW G;  3MN2 A;  3ASN H;  2VLA A;  4B1R A;  1J59 A;  4A3D J;  1EH7 A;  3L9F A;  3QPS A;  4BQQ A;  1LFB A;  2Y31 A;  3GYH X;  5L3F A;  1JUM A;  2OUM A;  5AIQ A;  5K5O A;  1T08 B;  2OTJ I;  2K4J A;  4DYC A;  2LKS A;  5IP7 J;  1YRN A;  4BXX J;  4HEA 2;  3TDU C;  2ELK A;  2X9D A;  2BEO A;  1OIS A;  3OOU A;  4B4C A;  4I6Z A;  4FCY A;  3L7W A;  1ORK A;  3KE2 A;  4HSR A;  1XMK A;  2KZG A;  5K5R A;  5IT9 K;  1R5G A;  3R4K A;  4OAZ A;  1K78 A;  1VQ5 I;  4PDK A;  2LBF B;  3DQV C;  1C0W A;  3C1D A;  2VN2 A;  4UVA A;  3H35 A;  2BZT A;  2E5N A;  2KRF A;  2NAZ A;  3LSR A;  1ZTR A;  3FXK A;  2EFO A;  5LGN A;  4W1U A;  4YIR X;  1ZR2 A;  5DD8 A;  3WTT C;  1K4T A;  2DK5 A;  1X4P A;  3BR5 A;  2WY7 Q;  1FOY A;  2BHZ A;  1JGS A;  3U1D A;  1Z3X A;  1OCT C;  2JQ7 A;  2MAB A;  2IA2 A;  4IHS A;  3VOD A;  1T39 A;  2ESH A;  3JTH A;  1CF7 B;  3ASO H;  4X6A J;  3MEX A;  5CQE A;  1B8I B;  1DU6 A;  2CFX A;  2ETH A;  1QGP A;  5DUK A;  5F0F A;  2HVR A;  4IHW A;  2MG4 A;  1G3T A;  2W1O A;  4N4O B;  1UFM A;  4MIM A;  5ICC A;  1U5T B;  4M6V A;  1DP3 A;  3WGH A;  2E36 A;  3KYD B;  1XDS A;  1YQA A;  1E2X A;  1IAW A;  2I5U A;  4DBR A;  2LY9 A;  4MFD A;  2EZL A;  4BQO A;  3GLX A;  4C3J J;  5IP6 A;  3HRT A;  1BW6 A;  3ZMV A;  3VEP A;  2K86 A;  2EV0 A;  4PJ0 C;  4BE2 A;  3ZQC A;  1ODD A;  3TP3 A;  2Z5U A;  1SFE A;  4OAY A;  4GDF A;  4E7L A;  3EQL F;  2E1N A;  1WJA A;  2P4W A;  1MGT A;  4KIF A;  1E17 A;  3A03 A;  3OOP A;  1FOK A;  2D1V A;  4HF2 A;  3IL2 A;  2L7K A;  1MMS A;  3LFU A;  2VPR A;  2JUC A;  1JHF A;  3KCC A;  1KGS A;  3M8F A;  2LG4 A;  1HA8 A;  2E2I J;  2A5Y B;  2ACJ A;  2Z3Y A;  5FLX Z;  1U0J A;  3CCM I;  2WAE A;  1D0Y A;  2DJI A;  1VND A;  4LB6 B;  1A6I A;  4UY8 I;  1ZHF A;  1RRJ A;  4RLQ A;  4RB0 A;  2DCE A;  3I0T A;  4DNC A;  1IN5 A;  1E0E A;  2L7Z A;  4IPA A;  1N78 A;  1Z67 A;  1K6O A;  1UAA A;  1Q1H A;  4AWX B;  3S16 J;  1UZC A;  3CCJ I;  2VE8 A;  1BJZ A;  2VKV A;  4CZZ A;  2A6E F;  1XCV A;  3H36 A;  5AON A;  5HS8 A;  3OYI A;  5J3L A;  3HHH A;  2FBK A;  1FP1 D;  4M72 A;  3SFI A;  4CCL A;  5E3M A;  3LAJ A;  2QQB A;  3WOD F;  1LNW A;  5D4S A;  1D1A A;  4E7H A;  1EJ9 A;  2WAD A;  4ZYE A;  1MW7 A;  4CDG A;  1JUP A;  3DEW A;  3F21 A;  2M8G X;  1F5T A;  4U7B A;  3ZMD A;  1LUJ B;  3S2H J;  3AL0 C;  3MZ8 A;  1JGG A;  3RZD J;  4G12 A;  2Q1Z B;  3BTI A;  2V1X A;  2BOL A;  1B9M A;  3K7A J;  3HDD A;  2O8X A;  5M5X J;  1SMT A;  1LFU P;  5CQG A;  3I5U A;  5L3B A;  1ITY A;  4ENK A;  1W7P D;  3KLN A;  2DBB A;  4D9J A;  4UUT A;  3A02 A;  2L9S A;  4B47 A;  1TT5 B;  1QQI A;  1WCM J;  3ZQG A;  2DA5 A;  2FOK A;  1TWF J;  2EA4 A;  5HDG A;  1KYW A;  2W25 A;  1JTX A;  2VB6 A;  1TT0 A;  3WTY C;  5TJJ A;  1OJL A;  2VT2 A;  4CSW A;  1CGP A;  3KP7 A;  5J40 A;  3OSF A;  2E7W A;  4KNY A;  1KYZ A;  1HCR A;  2O6G E;  1U5T C;  3DKW A;  3QWL A;  2BBY A;  4QPQ A;  3G1O A;  4I98 B;  1WHU A;  3QYB A;  1X3W B;  1X1A A;  4D7M A;  3RZO J;  3IC7 A;  1IJW C;  3Q3S A;  2M0M A;  3GZN B;  1FSE A;  3DKX A;  2ZJR F;  1KU7 A;  4M3F A;  3OSG A;  3U1K A;  3OYC A;  2PJP A;  2NS0 A;  4BQN A;  1I1S A;  1R4M B;  3WG7 H;  5TIS C;  2K3P A;  3LQR A;  2R7R A;  2I8D A;  4BEH A;  1TWG J;  3S3O A;  1OCO H;  4JX6 A;  2PMZ A;  4C30 A;  4R8H A;  1I6X A;  2QZ8 A;  4GRI A;  2BVL A;  5DCF A;  1U8R A;  1QRY A;  3QYF A;  1JKP C;  2XRN A;  4CO8 A;  2NNN A;  3CLO A;  1DPR A;  1HXD A;  3E0J B;  3WU1 B;  1DPU A;  4G6T B;  2XAQ A;  2CQN A;  1BOB A;  3SJM A;  2XPU A;  1YIT I;  3LAP A;  3GTJ J;  3CLQ A;  1STZ A;  3L1P A;  2G7U A;  3K10 A;  2HEO A;  3PNT A;  2LSO A;  4XR6 A;  1VQL I;  2XF7 A;  2P7V B;  3L2U A;  3UR3 C;  1A6Q A;  1FBQ A;  2R7V A;  4MEY F;  1DGR M;  3I3L A;  1MD0 A;  1O3Q A;  3NEU A;  1V5E A;  3EYY A;  2JA8 J;  2DQL A;  1NK3 P;  1ZRD A;  1FPQ A;  4AYB N;  2QBY B;  2DT5 A;  1Z3Y A;  4LFU A;  2RGV A;  3ERM A;  1K61 A;  3EDP A;  3Q9S A;  1MZB A;  4CIC A;  4MFE A;  3S17 J;  2E1C A;  2M7B A;  2A68 F;  2M7A A;  5F0C A;  2TDX A;  4A93 J;  4CYD A;  1SFU A;  3FXJ A;  3H9J A;  2FQ4 A;  3ZN0 A;  3HB9 A;  2VKE A;  1J0R A;  5DEQ A;  2RC4 A;  5CVU A;  4AYB A;  1QVT A;  2VJ4 A;  5B5E C;  1B4A A;  2XF5 A;  1W36 C;  4J00 A;  5FKN A;  2GA2 A;  1MH4 A;  2DJN A;  2QSH X;  1HDP A;  3LMM A;  3M8J A;  1D8J A;  1W1W E;  2L2O A;  1ON1 A;  5DM7 F;  3V7R A;  1ZGA A;  2FU4 A;  4RB2 C;  1BBY A;  2FMY A;  1B72 B;  3OYK A;  4MLO A;  5LHG A;  1ZGJ A;  1EV7 A;  3ZN1 A;  2VKH A;  5E8I A;  4OIR F;  1Z05 A;  3ZOB A;  4WXD A;  4O3M A;  2O7O A;  3ML6 A;  4HLY A;  3GFM A;  4ETS A;  4C2T A;  2LMD A;  3OS1 A;  3S1R J;  2ECC A;  4C2U A;  2MYS A;  1KU9 A;  5JFR A;  2VXZ A;  2DAO A;  4PSW A;  2E2J J;  1Y56 A;  3BY6 A;  1X1D A;  1ZKG A;  4ZC3 A;  3KP6 A;  4D1Q A;  4M3E A;  3KPH A;  2QYO A;  5FKK A;  5JHF A;  4DGW B;  3CD6 I;  4CCJ A;  3JRG A;  1G59 A;  2H8R A;  5FGM A;  1G3Y A;  3ZMU A;  1IXS B;  3TO9 A;  5DM6 F;  2HVQ A;  4XOT A;  3CCL I;  1W4M A;  4W97 A;  3X2Q H;  1WI3 A;  3K1P A;  1UHM A;  3F8B A;  3JRH A;  3TQN A;  3OR1 C;  4LG3 A;  4K2E A;  1QPI A;  3TOB A;  1YLF A;  1OCR H;  1KU3 A;  1U8B A;  2OU2 A;  2IS2 A;  2EWN A;  3PJR A;  2ZKZ A;  2Q2E B;  2OPT A;  2E34 A;  4XBF A;  2EBI A;  2GXG A;  1W7P A;  2A6T A;  1WI9 A;  3WGI A;  1BI1 A;  4CYC A;  3DBR B;  1X3Z B;  4BJT A;  3LSG A;  4E4H A;  3WTW C;  5H6R A;  5FRO A;  5ED4 A;  1FYK A;  3RPU A;  1PUE E;  3HOS A;  2YX7 A;  1R49 A;  2GBY A;  2JA2 A;  5IT3 A;  1L0O C;  4DOZ A;  3OYA A;  3HUG B;  4AIJ A;  5AIP A;  2KHM A;  2WTE A;  3FM3 A;  3CCS I;  1Y8Q B;  4DYQ A;  3HOW J;  4BKX A;  3FZV A;  2HNH A;  3HPG A;  1FBU A;  3HRM A;  4BBS J;  2L4M A;  3NAR A;  4A3I J;  5F04 A;  1I27 A;  2PLY A;  2CFO A;  1KZH A;  4AU7 A;  1Z7L A;  2ELJ A;  3KYL A;  3JRD A;  3S2W A;  3V7S A;  3GWZ A;  2P81 A;  3RDI A;  1VQN I;  1TTY A;  5IT9 Z;  2CUZ A;  3G1L A;  3P5J A;  1YE9 A;  5EEA A;  1TLH B;  4L18 B;  5EGO B;  2PI0 A;  3HC7 A;  2MFZ A;  2HR3 A;  3DEU A;  2DDA A;  2EFP A;  4FET A;  1ETW A;  1SVO A;  2GZW A;  2YR2 A;  4WF2 A;  2MC4 A;  3OYD A;  4XOR A;  2OZU A;  2CV0 A;  3GBG A;  2CV2 A;  3WGG A;  3JRA A;  1USS A;  3A4C A;  3CUO A;  4RM2 A;  1O7L A;  1U9N A;  1HW2 A;  3Q0V A;  4MO7 A;  4NDL A;  2BGC A;  2GXB A;  4WXH A;  3K4M A;  4M6X A;  4KDP A;  4KUM A;  1MH3 A;  2XPV A;  2K9S A;  1X2M A;  3RTR A;  2PQ8 A;  2OA4 A;  4BAY A;  3E1S A;  2XIG A;  5F1J A;  2UUZ A;  5CYV A;  3JAM K;  1MNM C;  1DQU A;  3E3V A;  4V2G A;  3IH4 A;  3GTK J;  1MBF A;  1YJ9 I;  5E3O A;  2AQF A;  3J81 K;  3PNV A;  1HF0 A;  1R00 A;  1I39 A;  3C7J A;  3K6G A;  4PUS A;  5HS9 A;  2FX0 A;  1XSV A;  2XPW A;  5CJ9 A;  3GTM J;  1D5Y A;  3RQ4 A;  1QBJ A;  4M71 A;  3QU3 A;  3ROU A;  1VQ8 I;  5LGT A;  4WCG A;  3B6C A;  1LJ9 A;  2RRE A;  3CDI A;  5KK1 A;  1APL C;  3DEE A;  3BZC A;  1CQT A;  1GV5 A;  3L2V A;  1RES A;  2BW3 A;  4MQV A;  2BW3 B;  1T0F C;  2M34 A;  1W0T A;  4V19 K;  1BM9 A;  2WY8 Q;  2FML A;  1F36 A;  2FSW A;  3LWF A;  2FJ1 A;  3J7Y J;  3BCB A;  4UB8 C;  1YX5 A;  3V42 A;  4CXF A;  2EV5 A;  5BOX A;  4G8X A;  1J7K A;  4AC0 A;  2ZME C;  4XID A;  2DK8 A;  3CP2 A;  1BN5 A;  2ZFU A;  3DU5 A;  1MMA A;  3LSJ A;  4F92 B;  3OS0 A;  3DPT A;  3MWM A;  3LA3 A;  1OCC H;  2DW4 A;  1D3Y A;  2XF6 A;  2IT0 A;  4OIO F;  4J19 A;  1T6S A;  2JVH A;  2Y75 A;  2ZCW A;  4LK0 F;  4YFN F;  4RB3 C;  4HOB A;  3O2P E;  3W2V A;  4G9Y A;  3F8N A;  1U78 A;  1P6R A;  2CYY A;  4WWC A;  5CVI A;  4IEJ A;  4II2 A;  2MD5 A;  4Y52 J;  1JXS A;  3D5R C;  1TQI A;  3NWT A;  3GFI A;  2H6B A;  3LA7 A;  1SD4 A;  2ZNY A;  2DU9 A;  1YTY A;  4UUS A;  2L02 A;  2P5K A;  1Z6T A;  2B0L A;  4HV6 A;  2YSR A;  3BDD A;  1XSD A;  2QLZ A;  2E35 A;  3CMM A;  3DLA A;  4B8X A;  5J1U A;  4MTE A;  4XKW A;  1GDT A;  2XVC A;  1QHH D;  1TZL A;  2EA2 A;  5H20 A;  3TED A;  2E2H J;  3H3U A;  2O0Y A;  5GTI C;  3EUH C;  1ETO A;  2D2W A;  5FJ8 J;  3PO3 J;  5FKM A;  4ZDP A;  4P9U A;  4NQW A;  5LLQ A;  2F2E A;  4HQM A;  3F23 A;  1GXQ A;  1H9T A;  2V1D A;  1RUO A;  1BR1 A;  1G6N A;  1J09 A;  3ABU A;  3HEF A;  2FQ3 A;  4Y13 A;  3TGN A;  2DMP A;  2ESN A;  2VAS A;  2DLL A;  3CUQ B;  3GXO A;  5FKO A;  2IRF G;  1X2N A;  3U2R A;  1JJ6 C;  4BY1 J;  3BCA A;  1D8K A;  4WX9 A;  4ZTJ A;  3G3Z A;  4RAZ A;  3HSE A;  3BJ6 A;  1T2K A;  1GHC A;  3KZZ A;  1MMD A;  2LK2 A;  5D8L B;  2HPI A;  1TNS A;  3C18 A;  3K4N A;  4LIV A;  1MND A;  4BHC A;  4B48 A;  4ENJ A;  3KFW X;  3HOX J;  4CZC A;  5L3C A;  2FBH A;  3BZK A;  1FT9 A;  1IDY A;  3E97 A;  3WU2 C;  5JR3 A;  2GQQ A;  1IXC A;  3EET A;  3QPL A;  4GO1 A;  3ABL H;  4HX7 A;  1VI0 A;  2V79 A;  5E17 F;  4ZJZ A;  2X1C A;  3LST A;  4I09 A;  3PNY A;  5DUI A;  1H0M A;  1MIJ A;  3GF2 A;  1VZ0 A;  1BI2 A;  4ZDL A;  2NVQ J;  1NH3 A;  5FLM J;  3TW7 A;  4IZZ A;  5HDK A;  3H3Z A;  1MSF C;  3ERE D;  1ZYR F;  2STT A;  1SAU A;  1FOW A;  2ZO4 A;  3GME A;  4ZTF A;  4BY7 J;  3BC8 A;  1HKQ A;  4IQ4 A;  3VYS B;  5ILV A;  4FAS D;  5F64 A;  4C2M J;  5M5Y J;  4IKF A;  1E3O C;  3SHF A;  5LHI A;  4BBR J;  2CW8 A;  3CMY A;  1ZRC A;  5LGU A;  2MLG A;  1WPK A;  3AG4 H;  3BP8 A;  5KCM A;  3K9T A;  2RNJ A;  4I0B A;  4ZYD A;  2ZSH B;  3JSO A;  1WJ5 A;  3H92 A;  4YEJ A;  1JKO C;  2VQL A;  3HIF A;  4CCK A;  2FRH A;  4B3A A;  2Z33 A;  1GXP A;  2BVM A;  2OD5 A;  3VB2 A;  1YG2 A;  1FEX A;  1YHQ I;  1YRN B;  3IH2 A;  1XDU A;  2WV1 A;  3G6E I;  1ZH5 A;  2B63 J;  5FO5 A;  2F5V A;  2RV8 A;  5HLH A;  3WHC A;  1DUX C;  1K78 B;  3GTL J;  3ESW B;  5D6F A;  1OPC A;  4FTH A;  1RPW A;  1VQO I;  4KYW A;  4GXO A;  4BDZ A;  2WA0 A;  5M3M J;  2X51 A;  2A3S A;  2ZSI B;  3ZMS A;  4BUP A;  3L2W A;  1TL8 A;  3GTG J;  1POG A;  1R1T A;  2GA1 A;  2HXI A;  3PQJ A;  3CUQ C;  4HYE A;  2JT1 A;  2ZJ2 A;  3P9C A;  1XN7 A;  2R7F A;  1RR7 A;  1UHS A;  3K4L A;  4F52 A;  2P5L C;  4HF1 A;  2XGD A;  3CC7 I;  4H0E A;  5CVJ A;  3SEZ A;  2OQR A;  3BTC A;  1MJA A;  1TWA J;  2MBF A;  1QNT A;  1HC8 A;  1S7E A;  2MW8 A;  4A6E A;  3MQ0 A;  4E6K G;  2K3F A;  3OYM A;  4AM3 A;  4LB5 A;  1AKH A;  1VQ7 I;  2L3D A;  3VOE A;  2VJI A;  5DDG A;  3W3C A;  3T1B A;  2R3S A;  2AS5 F;  1SD7 A;  3OYB A;  2MSY A;  3NAU A;  4HPQ A;  4NHJ A;  3BOQ A;  4CCO A;  3RI4 A;  1O3T A;  2Y0S N;  2JA5 J;  3ZRG A;  2DA7 A;  1WGX A;  1ONV A;  3GLL A;  2FXA A;  4I7H A;  3LNQ A;  3DU6 A;  3Q9V A;  2DOD A;  3FIW A;  4MNU A;  4IHV A;  1PUF A;  5HVQ C;  2HDW A;  4M3B A;  3P9K A;  4UVC A;  2W48 A;  5D5X B;  1MBK A;  2VOD A;  4GGG A;  3J7A Y;  2JSP A;  1GLN A;  4LLL A;  2OAZ A;  1A5J A;  2W7N A;  3PL8 A;  4ZYG A;  2X6O A;  3S1Q J;  1IRG A;  4PGG A;  1IZ1 A;  1XGS A;  3WU0 A;  3S14 J;  2Y0S A;  3K1N A;  4P5O A;  1IRF A;  4BL0 B;  4G7O F;  1ZGW A;  1R1V A;  2LD5 A;  3JW4 A;  3E6C C;  3IWZ A;  2HS5 A;  2FA5 A;  5B3S H;  2BY3 A;  5GP9 A;  3ZGK A;  3A0B C;  4KIS A;  2QCO A;  2IJL A;  1OKR A;  1SMY F;  1BA5 A;  2P6S A;  4B09 A;  2R4G A;  2KKO A;  4ESB A;  4E7J A;  5LHH A;  1SC7 A;  4Q5S F;  1SAX A;  4G7Z F;  3DLL F;  2A05 A;  1FC3 A;  2IEK A;  2ZBK A;  2R92 J;  2L9N A;  3VYU B;  2EIJ H;  1P4A A;  3IHU A;  3QP6 A;  3Q0U A;  3R6S A;  2G9W A;  2KIS A;  2E71 A;  3FIS A;  4WXC A;  3NQO A;  1X1P A;  2WBM A;  1T98 A;  3E6D A;  5ICF A;  4H4K C;  1W5C C;  3OIQ A;  1LEB A;  5B1B H;  2FNA A;  2I10 A;  1BJA A;  2X1D A;  5JLX A;  3MMY B;  4RM3 A;  3RPU D;  2HPM A;  1P92 A;  4P55 A;  3CCE I;  1JKR C;  4BNC A;  4GFB A;  1J75 A;  3JAM Z;  4OMZ A;  2JJ7 A;  4CCN A;  3IV5 A;  5GAE J;  3Q5F A;  4XLP F;  2GIV A;  3CZ6 A;  5DYM A;  3QP5 A;  2AO9 A;  5J6X A;  1K83 J;  1BL0 A;  3OV8 A;  3S8P A;  3J81 Z;  3BQY A;  1O3S A;  3JRE A;  3AG3 H;  2OQG A;  2J5P A;  4Y17 A;  1PP7 U;  2V9P A;  2NS8 A;  2H6C A;  2JPC A;  2LDU A;  3BG5 A;  1LDD A;  4U88 A;  2UZK A;  4M3G A;  2KLO A;  3GEZ A;  3DP7 A;  1K6Y A;  4N0B A;  2VQC A;  5GPC A;  1ZLK A;  2EZI A;  2H94 A;  5J1Y A;  3S1M J;  3HOT A;  4DQ2 A;  3F8M A;  5FRN A;  1NG7 A;  2DFF A;  4D5C A;  5H6Q A;  3J80 K;  5M5W J;  2F5C A;  3CP8 A;  4L9V A;  1FIA A;  4E7K A;  3MKL A;  2D1H A;  3GO5 A;  2KPM A;  3BPX A;  2VKD A;  2VUM J;  1A35 A;  2XGE A;  5ILS A;  4QTR A;  4BHP A;  1VFC A;  2CG4 A;  4BEH B;  2PJR A;  2UXX A;  3BQZ A;  1JHH A;  1ZRE A;  3KIO A;  2XUB A;  2BV6 A;  3BZ6 A;  1LEA A;  2VL8 A;  5JVG F;  4XKV A;  4BGD A;  5CVV A;  2L5Q A;  1VQK I;  2IXS A;  3WE3 A;  4LD5 A;  4Q4Z F;  2L9V A;  5K7F A;  2PMU A;  5IOZ A;  3K1M A;  4FIS A;  4F7Z A;  1EF4 A;  2QGU A;  3RQI A;  2HTJ A;  4S04 A;  4XLF A;  3SFZ A;  2O03 A;  3SZT A;  2V1U A;  2LTP A;  2FBI A;  1FLI A;  1JTY A;  4HNV A;  1WQ2 A;  3DWL E;  2E19 A;  5F0H A;  5K7Z A;  4XN0 A;  4IHY A;  1MKM A;  1WSU A;  2M1B A;  3FMS A;  4I2O A;  1TWC J;  2L7M P;  4JOM A;  3RKW A;  3BLY A;  2MD0 A;  1IW7 F;  1G2H A;  5IPA A;  1MBH A;  5L3D A;  1IN8 A;  3IKT A;  2LP0 A;  5M3F J;  2XRO A;  1QZE A;  1FJL A;  2OCE A;  4YG2 F;  1OYI A;  5JVT A;  4KIG A;  2QM3 A;  3DFG A;  5CKT A;  2RAE A;  1BC7 C;  3DPU A;  3LSM A;  4M3D A;  2K02 A;  2DMN A;  2R7D A;  1T8I A;  1BW5 A;  4D0P A;  2EB7 A;  2CSO A;  1EKE A;  2K7L A;  3PQK A;  1H9G A;  4YFK F;  1QPM A;  2HXO A;  3OMY A;  5CVR A;  4HX4 A;  1SEU A;  1B1B A;  4E70 A;  5FFX A;  1S3J A;  1WRJ A;  1REP C;  4I99 C;  2P7C B;  2IPQ X;  1LE8 A;  2RN7 A;  4HRI A;  1FNN A;  3HPH A;  4IHX A;  2JSC A;  3IRR A;  3BJA A;  2XRL A;  4FT8 A;  2DPD A;  4UNO A;  5BNG A;  5FRM A;  3LSK A;  3FKI J;  2RVC A;  4UHT A;  3C2G A;  2WB1 N;  2J5O A;  3AAF A;  2KJC A;  3A1Y A;  1ZR4 A;  1K7A A;  2JN6 A;  2CW7 A;  4C3H J;  3IRQ A;  2QA4 I;  5D5U B;  2DA6 A;  4XLC A;  4EVI A;  3Q0W A;  2JUG A;  3P7N A;  3K70 D;  4JP0 A;  1XS9 A;  3T5X A;  1V54 H;  3KEO A;  4RBO A;  4FQG A;  1BOA A;  3GZ5 A;  2M2E A;  1DU0 A;  1ZQ3 P;  3LSP A;  3BR2 A;  4A3K J;  1UG2 A;  2LOO A;  4RAF A;  1JKQ C;  4IRG A;  3ZR8 X;  1B9N A;  1FIP A;  3FHZ A;  3S3N A;  3SQN A;  3BRO A;  3VPR A;  1GT0 C;  1J9I A;  2FE3 A;  2P8T A;  4AVP A;  4U0Y A;  2R5Z A;  5FLV A;  3IKV A;  1W7P B;  3OWT A;  3WTX C;  2M8E A;  4IVN A;  2QKM B;  2XGX A;  4U7D A;  2WC2 A;  2DQR A;  3OL3 A;  1AWC A;  2LFB A;  3CO7 C;  1LKX A;  2L7F P;  4CYC B;  3CCV I;  1ETQ A;  2XAS A;  1JE8 A;  4XSX F;  4YIF A;  4A3B J;  4TV7 A;  1SAN A;  4XRM A;  4QIW N;  4ZH4 F;  4BAC A;  2WAF A;  3OYH A;  2R7U A;  1SD5 A;  2PN6 A;  1XCB A;  5JI6 A;  4A3F J;  4GYG A;  4OOI A;  1WJB A;  1OCP A;  1PYV A;  3HM5 A;  3IWF A;  1FYL A;  4XL9 A;  4YII A;  5C3E J;  1IV6 A;  2NNY A;  1ZK8 A;  3K4J A;  2F5D A;  2PBI A;  3R60 A;  5LEJ A;  1DP7 P;  4E7I A;  3PIP F;  3BJO A;  1VQP I;  1BIA A;  1XGN A;  2CWE A;  4J01 A;  4RLF A;  1RKW A;  4HF0 A;  3RKX A;  3T8R A;  4XOP A;  5IYC J;  2ZME A;  1A04 A;  3H5N A;  1SVM A;  1QHG A;  3KEY A;  5HOD A;  5HLG A;  4N9I A;  3CMA I;  3I4N J;  5FD6 A;  1K4S A;  2KRH A;  1Z7U A;  4L0Y B;  3QRF F;  3F72 A;  3G73 A;  3QPH A;  2JK3 A;  3BG9 A;  1D1C A;  2F4O B;  3MZH A;  4IOC F;  1MBG A;  3MKZ A;  5H2F C;  3DTI A;  3KX2 A;  3VSK A;  1R7J A;  3HGG A;  3R61 A;  3PUB A;  2BYV E;  4X1E A;  1ZG3 A;  4L0Z B;  1WH5 A;  3VFZ A;  4BS9 A;  2HI3 A;  2M3A A;  2ZNZ A;  2R5Y A;  1N75 A;  3B73 A;  1LDJ A;  5DD4 A;  4EJW A;  1F43 A;  2DOF A;  5JLW A;  3F3X A;  4Q47 A;  3JRB A;  1KQ9 A;  3M7G A;  5EF6 A;  3RKQ A;  2R93 J;  2FOW A;  2HZT A;  3VYR B;  3LA2 A;  3OYE A;  3OIO A;  2D45 A;  1A36 A;  4EQQ A;  4FE4 A;  4MGR A;  3IAS 2;  1BI3 A;  5A2Q K;  2DT6 A;  2D5V A;  1XGM A;  1R23 A;  1QO0 D;  3HGY A;  1MDM A;  3JRF A;  4KMF A;  2PX9 A;  2FD5 A;  2JA6 J;  2NOJ B;  4L5I A;  1SD6 A;  1MDM B;  3ZMZ A;  4BYY A;  2MC3 A;  1I3Q J;  3H5A A;  3KZI C;  1IGN A;  3SDB A;  2Y69 H;  1FMW A;  3OYG A;  1ETY A;  2MLK A;  4ASN A;  4KMU X;  2XSD C;  1W5S A;  5D8K B;  3JSP A;  1D0X A;  1OR7 A;  3M8E A;  1QA6 A;  1J5Y A;  1YS7 A;  4PJN A;  1TW2 A;  2R7S A;  3GFL A;  2IGO A;  5C4X J;  3FXO A;  4NUB A;  1VQ4 I;  2Z16 A;  2EFW A;  2Y2Z A;  4L9J A;  3DBH B;  2ZXI A;  3WE2 A;  3UKG A;  3EYI A;  1KQ0 A;  3CDL A;  2E1M B;  1NHA A;  2CQQ A;  3DKY A;  3FXL A;  1PVE A;  1RET A;  1S9H A;  4KIT B;  3L2C A;  2K5C A;  5TGT A;  4ENN A;  5E1W A;  4A3E J;  5DV5 A;  1ERD A;  1BR4 A;  4XSZ F;  4ZDO A;  3MZY A;  3M1E A;  5D6E A;  1YIJ I;  1MJB A;  2QKL B;  3CES A;  4FHT A;  1U3E M;  2COM A;  4A3M J;  2NVT J;  3IH3 A;  4HST A;  3RYR A;  4QSH A;  4NB5 A;  4XLN F;  5L3E A;  1G4D A;  3WTV C;  3COA C;  3K4B A;  1S5L C;  2OJE D;  5EDN A;  5FKL A;  3MCZ A;  5LBQ A;  1PDN C;  3HOU J;  5D5W B;  1PJR A;  1ACI A;  3V4G A;  3J7Z I;  1P4X A;  2EJR A;  3ISP A;  5E3L A;  4EMS A;  4KFC A;  3HRS A;  2V6E A;  1R22 A;  2GAU A;  4X0G A;  2XKP A;  1R1U A;  3K0L A;  2F48 A;  2LYC A;  1X3U A;  2IW5 A;  2AQE A;  2XGC A;  3BR1 A;  3D1N I;  4IO9 F;  1O3R A;  1U9O A;  3W6K B;  3M4O J;  4G6D A;  1V3F A;  4UUS B;  2JMW A;  2M30 A;  3K2A A;  1A31 A;  4I01 A;  5HLI A;  2QVO A;  5E1Z B;  1YX3 A;  3M3Y J;  2XKO A;  2XAU A;  1IUY A;  3N4M A;  4BU2 A;  4DZP A;  4XN3 A;  4P96 A;  5EZG A;  1YOV B;  5F6F A;  1XMA A;  4UB6 C;  2HDC A;  4Y4R A;  4CH7 A;  2EIM H;  5HDN A;  2GOM A;  2HWV A;  4NQW B;  2PEX A;  3I59 A;  3O6B B;  1YW7 A;  3I59 B;  2DMU A;  1IUF A;  1R71 A;  2CQK A;  3GTO J;  1Y1V J;  4NC7 A;  3FXU A;  4RDU A;  1WJE A;  1TQM A;  2KDO A;  4IRI A;  3SZP A;  4BXF A;  1XG1 A;  1G3S A;  1XPX A;  1Z0X A;  4BJ5 C;  1WH7 A;  1Z9C A;  3QPT A;  4O5V A;  2BY1 A;  3E5Q A;  3E6M A;  5K7H A;  3J80 Z;  2VPL A;  2QWW A;  4XQF A;  4AID A;  3I9V 2;  3OYJ A;  1FTT A;  1MNE A;  1W5T A;  1D0Z A;  4KA4 A;  3H5R A;  2AHQ A;  4MTD A;  4Y7N J;  5DCM A;  1MSE C;  4EJU A;  2GIZ A;  1HQC A;  3ABM H;  1R9T J;  4L5E A;  3G4S I;  3BR3 A;  1OMI A;  4P9F A;  1SFX A;  1WVR A;  2N8G A;  2IAI A;  1TWH J;  2EH3 A;  2IGN A;  1WFX A;  3GZ6 A;  2E1M C;  4GYI A;  3S15 J;  4OMY A;  5DS9 A;  4F91 B;  3CTA A;  5J8C A;  2ELH A;  3G71 I;  2L54 A;  5HOO A;  1MBJ A;  4OIN F;  3PO2 J;  1ENH A;  1U2W A;  1NG6 A;  2A61 A;  3VYT B;  2P5V A;  1JUS A;  3WTU C;  1RKT A;  4PJL A;  4RGS A;  3TL4 X;  1W36 D;  1EA3 A;  4A5M A;  1MMN A;  2XSJ C;  4NC6 A;  1AU7 A;  2XAF A;  2M45 A;  5TRD A;  2COB A;  1IO2 A;  1FTZ A;  1WKM A;  4UUV A;  5ICG A;  2ZXH A;  2F5E A;  4G6Q A;  2VOO A;  1ZEL A;  2HOE A;  2V9K A;  1HLV A;  3D5S C;  2FUG 2;  1KA8 A;  1Z1D A;  2V9V A;  3QYE A;  3FF5 A;  3G1M A;  2VBZ A;  2ISY A;  5KHD A;  3F9K A;  3TMO A;  5J47 A;  3KP5 A;  3L09 A;  5LFA A;  3HOV J;  3R0A A;  2C6Y A;  3LSI A;  2Z1D A;  3OIP A;  2Q0O A;  2ZXJ A;  4HBL A;  2H1K A;  3FX3 A;  3CJR B;  3HSF A;  2R7Q A;  2VI6 A;  2CUE A;  2RKH A;  3HXL A;  3N97 A;  2EPF A;  4LGW A;  1I1G A;  4EM1 A;  3OYN A;  4IHT A;  3H0D A;  6PAX A;  2XB0 X;  2OC6 A;  4G7H F;  3I56 I;  2EIN H;  2EQR A;  3ABK H;  4PFP A;  5IY5 H;  5F27 A;  5EJC A;  3DCF A;  2KJB A;  4CCM A;  3D0S A;  4OU0 A;  2Z9O A;  1OFC X;  2ZFW A;  5CPR B;  4IRH A;  2JWT A;  4ENM A;  3ULQ B;  2AXL A;  4ZZL A;  4BHB A;  1YW8 A;  1IXR C;  4MQ9 F;  1H89 C;  2EK5 A;  1FMV A;  2X85 A;  3H9Q A;  1V55 H;  2VE9 A;  3AL0 B;  2QSG X;  1MBE A;  4CGZ A;  3TDZ C;  2HGC A;  2LBF A;  2BXY A;  2DA2 A;  3V8L A;  3B6A A;  3N05 A;  1ZAO A;  2XAJ A;  4AD9 A;  4Y15 A;  1B6A A;  3OS2 A;  1R58 A;  3HKZ N;  2WWY A;  3FDY A;  1WJF A;  2HKO A;  2KZV A;  5E8G A;  1IN4 A;  2KT0 A;  2VC1 A;  2E60 A;  2RQP A;  2GM4 A;  3J7A O;  2PFB A;  1UCR A;  3PUF A;  1CF7 A;  4UV9 A;  3M07 A;  3DBL B;  4I02 A;  3PFI A;  5CLS A;  1B8I A;  4A3L J;  4Z2Y A;  3TO7 A;  3AKZ A;  1TBX A;  1XSX A;  2BHY A;  4EM0 B;  1AKH B;  2JTV A;  1FWZ A;  2W84 A;  4M9Z A;  4A0X A;  1U5T A;  3HKZ A;  5BPI A;  5E79 C;  3ZQQ A;  3HRU A;  5E20 A;  2DO7 A;  2IA0 A;  1L3L A;  4DYR A;  1Y0N A;  2HQN A;  3QQA A;  4R79 A;  3HG9 A;  5BS6 A;  3HTU A;  1JI8 A;  3RKY A;  1UMQ A;  5D4R A;  2V1N A;  1HW5 A;  3FXR A;  2STW A;  5EG0 A;  1E3P A;  1F4K A;  2HZD A;  3DTE A;  1X19 A;  3V8K A;  3AG1 H;  5EG0 B;  4EM2 A;  1PUF B;  2A5W A;  4QWQ A;  1SFK A;  2JZY A;  4HX8 A;  2DOE A;  3BTJ A;  3O3K A;  3IUO A;  1ZAR A;  4A0Y A;  3QOD A;  4BQA A;  2H27 A;  2XHK A;  1O7F A;  4PZJ A;  3CJN A;  2NS7 A;  1T56 A;  1AHD P;  3ONQ A;  3BR6 A;  4E7S A;  2EV6 A;  3HSR A;  2PG4 A;  4L9T A;  5EZH A;  2RNG A;  1JT0 A;  1YI2 I;  3CC4 I;  1GUU A;  4QLC U;  5BPD A;  5J8F A;  2V7F A;  5HNH A;  3FK6 A;  2LR8 A;  4HW0 A;  1XTA A;  2A69 F;  2ECB A;  4RGR A;  1ON2 A;  2TRT A;  3KZY A;  4S05 A;  1ZN2 A;  5C4J J;  2FF4 A;  2DI3 A;  1EH8 A;  2EFN A;  2HYF A;  4LMY A;  1ETV A;  3S2D J;  2Z99 A;  1ETK A;  2O5R A;  2EZH A;  2X6Y A;  5GTH C;  2NVY J;  2F4I A;  4HQE A;  3BR0 A;  4XRS A;  3HYI A;  2WV0 A;  2VBX A;  4NBQ A;  4XMY A;  2KMU A;  2R7X A;  2M4G A;  4E7Z A;  3WG9 A;  4ZYH A;  3ABT A;  4RGX A;  2W24 A;  2R0Q C;  3PFY A;  3OR2 C;  5LRR A;  2DA3 A;  4IOA F;  2E7X A;  2VBY A;  5GAG J;  2O8K A;  3I55 I;  4FE7 A;  4UXN A;  1UEL B;  1I50 J;  5F1R A;  4HV5 A;  4XLE A;  1IDZ A;  3PM1 A;  4Z6Y A;  1HKS A;  1OYW A;  5HS7 A;  5J4V A;  5A2Q Z;  2YPR A;  3H9G A;  3I4M J;  2BE5 F;  1QVU A;  2KQR A;  3CJQ B;  3BWG A;  1GVD A;  2KFD A;  5FB2 A;  2VJ5 A;  1E3H A;  2CUJ A;  1UJ8 A;  2DT7 B;  4IF4 A;  4XK4 A;  1PP8 F;  4RAY A;  1MMG A;  5FD5 A;  3JTG A;  3HBL A;  2DOA A;  2X1E A;  2P6T A;  2WAQ N;  4HG2 A;  2OZ6 A;  3ECO A;  3R0J A;  2DFE A;  3I64 A;  4KN4 X;  2F6C A;  3NRV A;  1NK2 P;  1QU3 A;  3DV8 A;  3GFJ A;  3FMQ A;  3MKW B;  2LRD A;  2ZB9 A;  3S1N J;  2M0C A;  3LFK A;  3MVP A;  1T33 A;  1O57 A;  2ZJP F;  3EUA A;  2JVG A;  2DYS H;  5J1R A;  1KON A;  4IX7 A;  2KIQ A;  2PMZ N;  3VSL A;  2WAQ A;  1BI0 A;  3JRC A;  3A0H C;  1XB4 A;  2PJR B;  3SDG A;  2ISZ A;  4XRF A;  1O4X A;  1G8X A;  2OV7 A;  2TCT A;  4RA2 A;  3TP0 A;  3JRI A;  5K5Q A;  2JPB A;  3FWE A;  2HOT A;  2NYX A;  3QOE A;  3RSN A;  2W85 A;  1H88 C;  2XDV A;  2IS6 A;  1Y8R B;  4V2F A;  1F1Z A;  5LEK A;  2B7E A;  3BTL A;  4A3J J;  3F0C A;  1FYM A;  1XX5 A;  4R1H A;  3D5L A;  2HKX A;  4I0A A;  2CJJ A;  1WWX A;  5BQT A;  2L0K A;  1LB2 A;  4NNJ A;  2QEN A;  5FFZ A;  2DFI A;  1YFH A;  1LFP A;  4JQF A;  4ON0 A;  4FX4 A;  2IS4 A;  3F6O A;  1ETX A;  4HLX A;  1ZG1 A;  3K69 A;  1TNT A;  2YUS A;  3E6B A;  1QZY A;  1JJ8 C;  1HBX G;  2LY1 A;  1FZP B;  4IL6 C;  4UVB A;  1Y39 A;  3ZQ7 A;  1IRX A;  1LQ1 A;  2HQ5 A;  3BG3 A;  3KP3 A;  1T38 A;  4NC8 A;  5KAI C;  3HJE A;  4XKC A;  4BJ6 C;  4LLN A;  1RI7 A;  1R5H A;  1S6L A;  2VJJ A;  2RDP A;  1WJC A;  1WZ2 A;  2DFH A;  1TP4 A;  2QQ8 A;  1ULY A;  3GVA A;  3WTS C;  2DMT A;  3BPV A;  3MKY B;  2XC7 A;  3FKJ A;  2CH0 A;  1N77 A;  2K27 A;  3REO A;  1K79 A;  2QBY A;  2L9R A;  9ANT A;  5IP9 J;  4RB1 A;  2CS3 A;  3CCR I;  1I6H J;  4DJA A;  2VC0 A;  2A6H F;  3FK7 A;  5LRS A;  1BC8 C;  3ZP5 A;  3TO6 A;  1N25 A;  1HKT A;  1KQ8 A;  2KIU A;  2BXZ A;  3T8T A;  2G7H A;  5GAH J;  4ZYA A;  5L3G A;  1J2X A;  2VBW A;  2JRM A;  5LD2 C;  2CRG A;  1R36 A;  2CMP A;  2DA4 A;  1LE8 B;  2ME6 A;  1P7I A;  4G94 A;  1DGW Y;  5HNF A;  1B59 A;  3SEQ A;  2IP2 A;  2L01 A;  1W0U A;  3IAM 2;  2VT3 A;  3E5U A;  4XNF A;  1XD7 A;  4L9N A;  3L2Q A;  3KEQ A;  4BXU A;  5IOY A;  1V4R A;  4M73 A;  3BG6 A;  2GXA A;  1IN7 A;  2JA7 J;  1EH6 A;  1BR2 A;  4EV0 A;  4Q48 A;  2DXI A;  1RIO H;  1B72 A;  1R5I D;  2MA3 A;  2LVS A;  2QQ9 A;  3HL2 A;  1TC3 C;  2Y30 A;  5B66 C;  3GUD A;  3W2W A;  2Y48 A;  4B43 A;  5KNL A;  3KET A;  1X1C A;  5HLT A;  2VOP A;  1M1E B;  4LJZ F;  3TKY A;  3HTS B;  1RZ4 A;  1S8N A;  3TW6 A;  1UB9 A;  2X48 A;  4XLA A;  1TQP A;  2EFQ A;  5EEG A;  4XM3 A;  2WB1 A;  2DA1 A;  2MH9 A;  1Z77 A;  2X6W A;  3LL7 A;  1R4N B;  5ERI A;  2W4S A;  1Y1W J;  3SXY A;  3CC2 I;  1Z21 A;  4ESF A;  1S29 A;  2HFH A;  4XKB A;  2Y9Z A;  1RR8 C;  4BDY A;  4CA0 A;  2V6C A;  3M1C A;  4JYK A;  1V5F A;  2ME0 A;  4YEL A;  2BY2 A;  2R5Z B;  4HDU A;  1TW3 A;  2O3F A;  4D5F A;  5KVR A;  4S0H B;  2NOG A;  4A3C J;  1Y0U A;  1ZLJ A;  4HAM A;  3HOY J;  2K9L A;  3GW2 A;  3QAH A;  1IF1 A;  3BG7 A;  4UV8 A;  3V8J A;  2VQG A;  4JBA A;  2ZJQ F;  5BMZ A;  2GLO A;  3VWB A;  3ELK A;  4EJT A;  2QEX I;  2V4J C;  5KAF C;  2Q2E A;  1FOX A;  3GCM A;  3CCU I;  2ID6 A;  1D1B A;  1LVK A;  2VXD A;  5DTD A;  2H1L A;  2Y0M A;  5GAD J;  1ZRF A;  1AOY A;  3U21 A;  3ZCO A;  1GVJ A;  1T0F A;  4XON A;  2K9M A;  4FX0 A;  1YYV A;  4EGY A;  2XB5 A;  2Y9Y A;  4P1W A;  4A6D A;  3ZQI A;  2R7W A;  5JHU A;  3FMR A;  3F8F A;  3B02 A;  3DPL C;  2NVX J;  3A01 A;  5FLX K;  1FP2 A;  1SVL A;  3W6V A;  5GPA A;  1HSJ A;  2ZME B;  3HUG A;  4XIC A;  3A01 B;  4B44 A;  2K4B A;  1S72 I;  2HYG D;  3SYT A;  3DF8 A;  2YU3 A;  1P4W A;  2IA1 A;  2LNB A;  1Z6R A;  1YJW I;  2M9H A;  2IS1 A;  4F93 B;  3PSI A;  2V26 A;  3GTP J;  2LLK A;  4N4N B;  3AG2 H;  3KLO A;  3ZQH A;  1YO5 C;  4M74 A;  2OTL I;  4LOC A;  1BIB A;  3QOP A;  5IYD J;  2IGM A;  2ID3 A;  3RCO A;  2ZC2 A;  2L4A A;  4M9S A;  3MD2 A;  2R5Y B;  5EGO A;  2E5Z A;  2DDB A;  4ESJ A;  2W00 A;  3G2B A;  4IXA A;  3H3V K;  4A69 C; 
#chains in the Genus database with same CATH homology
 1I5Z A;  4AIK A;  3GX4 X;  4BH9 A;  2QUF A;  3I4P A;  1FY7 A;  2IVM A;  1FBS A;  4IJA A;  3DXJ F;  3EUH A;  4MHG A;  1HW1 A;  1HST A;  4A2U A;  3L00 A;  4O6J A;  1U6G A;  2LF7 A;  1LDK B;  1FX7 A;  2HTS A;  1YS6 A;  1ZG5 A;  4KT5 C;  3P9I A;  1S7A A;  4PCQ A;  3ECH A;  4M6Y A;  2ADU A;  1RUN A;  3W6J B;  2FEZ A;  2KIM A;  3WTZ A;  4MEX F;  3KP2 A;  2NRA C;  4ZZD A;  1P2F A;  1KU2 A;  2PMH A;  3T0Y A;  1XGO A;  2UWM A;  4LG0 A;  4EGZ A;  5K1Y A;  3FXQ A;  3CO6 C;  4KIC A;  4LG0 B;  2X4H A;  1G3W A;  3F22 A;  2YX4 A;  4PGH A;  3E5X A;  4OIQ F;  2H09 A;  1DDN A;  2UXN A;  3K2Z A;  2FNP A;  1MJ9 A;  1LVA A;  1FSH A;  2XV4 S;  5E1X A;  4LLG F;  2VON A;  5ICE A;  1IN6 A;  2CW0 F;  3RIR A;  2CGP A;  2KIF A;  4HA8 A;  1OYY A;  3M9A A;  4WK8 F;  1F9N A;  2DTR A;  3C3W A;  2X0L A;  2HQR A;  4RS8 A;  4U0W A;  1RNL A;  3I58 A;  3RYP A;  2XAG A;  2GWR A;  4HZF A;  3MFK A;  2F5F A;  3KP4 A;  3QU6 A;  2M87 A;  1UST A;  3CDH A;  3I54 A;  3V7C A;  3CUQ A;  2O61 A;  5D5V B;  3U9G A;  1D5V A;  4JK1 X;  1VTN C;  3I53 A;  5DCM B;  4A0Z A;  4HDV A;  2XAH A;  4AIH A;  4L5J A;  4OIP F;  4LK1 F;  4GCV A;  3FM5 A;  3RJP A;  1S7O A;  3I71 A;  2LKP A;  5E18 F;  3MAJ A;  3ZMT A;  1QZZ A;  1Z91 A;  1UHW A;  2MH2 A;  2M5W A;  4M9X A;  4CHU A;  1YIO A;  4KN7 X;  4RGU A;  4A12 A;  4N9H A;  4YFX F;  4EJV A;  2QQA A;  1YW9 A;  2CO5 A;  5ILU A;  3F8C A;  2LF8 A;  4KIB A;  3ZPL A;  2W57 A;  4U0V A;  2JRT A;  3LQQ A;  2OBP A;  3HHG A;  3TOA A;  4A5N A;  3RPQ A;  3F6V A;  2Q8K A;  5EEH A;  2A07 F;  2DPU A;  4EJO A;  1J59 A;  1EH7 A;  3L9F A;  3GYH X;  5L3F A;  5AIQ A;  5K5O A;  2K4J A;  3TDU C;  2BEO A;  3L7W A;  3KE2 A;  1XMK A;  5K5R A;  5IT9 K;  1R5G A;  3R4K A;  1K78 A;  4PDK A;  1C0W A;  3DQV C;  3C1D A;  2VN2 A;  4UVA A;  2KRF A;  2NAZ A;  2EFO A;  5LGN A;  5DD8 A;  3WTT C;  2DK5 A;  3U1D A;  1JGS A;  2IA2 A;  4IHS A;  3VOD A;  1T39 A;  2ESH A;  3JTH A;  1CF7 B;  3MEX A;  2CFX A;  2ETH A;  1QGP A;  5DUK A;  1G3T A;  1UFM A;  5ICC A;  1U5T B;  3WGH A;  1XDS A;  1YQA A;  1E2X A;  1IAW A;  3GLX A;  3HRT A;  3ZMV A;  3VEP A;  2K86 A;  2EV0 A;  1ODD A;  2Z5U A;  1SFE A;  3EQL F;  2E1N A;  2P4W A;  1E17 A;  1MGT A;  4KIF A;  3OOP A;  1FOK A;  2D1V A;  4HF2 A;  3IL2 A;  1JHF A;  3KCC A;  1KGS A;  3M8F A;  2A5Y B;  2ACJ A;  2Z3Y A;  5FLX Z;  4LB6 B;  1ZHF A;  4RB0 A;  3I0T A;  4DNC A;  1IN5 A;  4IPA A;  1K6O A;  1Q1H A;  4AWX B;  2VE8 A;  4CZZ A;  2A6E F;  1XCV A;  5AON A;  5HS8 A;  3HHH A;  2FBK A;  1FP1 D;  4M72 A;  3LAJ A;  2QQB A;  3WOD F;  1LNW A;  5D4S A;  4ZYE A;  4CDG A;  3F21 A;  1F5T A;  4U7B A;  3ZMD A;  2V1X A;  1B9M A;  2O8X A;  1SMT A;  5L3B A;  3I5U A;  4ENK A;  1W7P D;  3KLN A;  2DBB A;  1QQI A;  2FOK A;  2EA4 A;  5HDG A;  1KYW A;  2W25 A;  3WTY C;  5TJJ A;  2VT2 A;  1CGP A;  3KP7 A;  2E7W A;  4KNY A;  1KYZ A;  2O6G E;  1U5T C;  3DKW A;  2BBY A;  4I98 B;  3IC7 A;  1FSE A;  1KU7 A;  2PJP A;  2NS0 A;  1I1S A;  3LQR A;  4R8H A;  1I6X A;  2QZ8 A;  5DCF A;  1U8R A;  2XRN A;  4CO8 A;  2NNN A;  3CLO A;  1DPR A;  1HXD A;  3WU1 B;  1DPU A;  2XAQ A;  3LAP A;  1STZ A;  2G7U A;  2HEO A;  2LSO A;  2P7V B;  1FBQ A;  4MEY F;  1MD0 A;  1O3Q A;  3NEU A;  3EYY A;  2DQL A;  1ZRD A;  1FPQ A;  2QBY B;  2DT5 A;  4LFU A;  2RGV A;  3EDP A;  3Q9S A;  1MZB A;  4CIC A;  2E1C A;  2A68 F;  2TDX A;  4CYD A;  1SFU A;  3ZN0 A;  1J0R A;  5DEQ A;  2RC4 A;  5CVU A;  1B4A A;  2GA2 A;  1D8J A;  1ON1 A;  3V7R A;  1ZGA A;  2FU4 A;  4RB2 C;  1BBY A;  2FMY A;  5LHG A;  1ZGJ A;  1EV7 A;  3ZN1 A;  5E8I A;  4OIR F;  1Z05 A;  4WXD A;  4O3M A;  3ML6 A;  4HLY A;  3GFM A;  4ETS A;  1KU9 A;  5JFR A;  2VXZ A;  2DAO A;  3BY6 A;  3KP6 A;  2QYO A;  5FGM A;  1G3Y A;  3ZMU A;  1IXS B;  3TO9 A;  1W4M A;  3K1P A;  1UHM A;  3F8B A;  3TQN A;  4K2E A;  3TOB A;  1YLF A;  1KU3 A;  2OU2 A;  2EWN A;  2ZKZ A;  4XBF A;  2GXG A;  1W7P A;  1WI9 A;  3WGI A;  1BI1 A;  3WTW C;  5H6R A;  5ED4 A;  1FYK A;  3RPU A;  1PUE E;  3HOS A;  2YX7 A;  5IT3 A;  1L0O C;  4AIJ A;  2VOP A;  5AIP A;  2WTE A;  3FM3 A;  3FZV A;  1FBU A;  3HRM A;  2L4M A;  1I27 A;  2PLY A;  3S2W A;  3V7S A;  3GWZ A;  3RDI A;  1TTY A;  5IT9 Z;  1TLH B;  4L18 B;  2PI0 A;  2HR3 A;  3DEU A;  2EFP A;  2GZW A;  2YR2 A;  4WF2 A;  2OZU A;  3WGG A;  1USS A;  3CUO A;  1O7L A;  1HW2 A;  2GXB A;  2BGC A;  4WXH A;  4M6X A;  4KDP A;  4KUM A;  3RTR A;  2PQ8 A;  2OA4 A;  4BAY A;  2XIG A;  5CYV A;  3JAM K;  3E3V A;  3J81 K;  1R00 A;  3C7J A;  5HS9 A;  1XSV A;  5CJ9 A;  1QBJ A;  4M71 A;  3QU3 A;  3ROU A;  5LGT A;  4WCG A;  1LJ9 A;  5KK1 A;  4MQV A;  1BM9 A;  2FML A;  2FSW A;  3LWF A;  4CXF A;  2EV5 A;  5BOX A;  4G8X A;  1J7K A;  2DK8 A;  1BN5 A;  3DPT A;  3MWM A;  3LA3 A;  2DW4 A;  1D3Y A;  2IT0 A;  4OIO F;  1T6S A;  2Y75 A;  4LK0 F;  2ZCW A;  4YFN F;  4RB3 C;  4HOB A;  3O2P E;  4G9Y A;  3F8N A;  1U78 A;  1P6R A;  2CYY A;  4WWC A;  5CVI A;  2MD5 A;  1JXS A;  3GFI A;  1TQI A;  2H6B A;  3LA7 A;  1SD4 A;  2ZNY A;  2DU9 A;  1YTY A;  2L02 A;  2P5K A;  1Z6T A;  2B0L A;  4HV6 A;  2YSR A;  3BDD A;  1XSD A;  2QLZ A;  4B8X A;  4MTE A;  2XVC A;  5H20 A;  2EA2 A;  3H3U A;  2O0Y A;  2D2W A;  4P9U A;  4NQW A;  5LLQ A;  2F2E A;  4HQM A;  3F23 A;  1GXQ A;  1H9T A;  2V1D A;  1RUO A;  1G6N A;  3ABU A;  2FQ3 A;  4Y13 A;  3TGN A;  2ESN A;  3CUQ B;  2DLL A;  3GXO A;  2IRF G;  3U2R A;  1D8K A;  4WX9 A;  3G3Z A;  4RAZ A;  3HSE A;  3BJ6 A;  1T2K A;  1GHC A;  3KZZ A;  5D8L B;  1TNS A;  3C18 A;  4BHC A;  4ENJ A;  3KFW X;  5L3C A;  2FBH A;  1FT9 A;  3E97 A;  5JR3 A;  2GQQ A;  1IXC A;  3EET A;  4GO1 A;  4HX7 A;  2V79 A;  5E17 F;  3LST A;  4I09 A;  1H0M A;  5DUI A;  3GF2 A;  1BI2 A;  5HDK A;  3H3Z A;  3ERE D;  1ZYR F;  2STT A;  2ZO4 A;  1HKQ A;  5ILV A;  5F64 A;  3SHF A;  5LHI A;  1ZRC A;  5LGU A;  2MLG A;  3BP8 A;  3K9T A;  2RNJ A;  4I0B A;  4ZYD A;  3JSO A;  3H92 A;  3HIF A;  2FRH A;  2Z33 A;  1GXP A;  2OD5 A;  3VB2 A;  1YG2 A;  1XDU A;  1ZH5 A;  5FO5 A;  2RV8 A;  5HLH A;  1DUX C;  1K78 B;  5D6F A;  1OPC A;  4KYW A;  4GXO A;  2A3S A;  3ZMS A;  1R1T A;  2GA1 A;  3PQJ A;  3CUQ C;  4HYE A;  2JT1 A;  2ZJ2 A;  3P9C A;  1XN7 A;  2R7F A;  2P5L C;  4HF1 A;  4H0E A;  5CVJ A;  2OQR A;  1MJA A;  2MBF A;  1QNT A;  4A6E A;  3MQ0 A;  4LB5 A;  2L3D A;  3VOE A;  5DDG A;  3T1B A;  2R3S A;  2AS5 F;  1SD7 A;  4NHJ A;  3BOQ A;  3RI4 A;  1O3T A;  1ONV A;  2FXA A;  4I7H A;  3Q9V A;  4MNU A;  5HVQ C;  3P9K A;  4UVC A;  5D5X B;  2VOD A;  4GGG A;  4LLL A;  2OAZ A;  1IRG A;  4ZYG A;  4PGG A;  1IZ1 A;  1XGS A;  3WU0 A;  3K1N A;  4P5O A;  1IRF A;  4G7O F;  1R1V A;  3JW4 A;  3E6C C;  3IWZ A;  2HS5 A;  2FA5 A;  2IJL A;  1OKR A;  1SMY F;  2P6S A;  4B09 A;  2KKO A;  4ESB A;  5LHH A;  4Q5S F;  1SAX A;  4G7Z F;  1FC3 A;  2ZBK A;  1P4A A;  3IHU A;  3QP6 A;  3R6S A;  2G9W A;  4WXC A;  3NQO A;  1T98 A;  3E6D A;  5ICF A;  1LEB A;  2FNA A;  1BJA A;  1P92 A;  4P55 A;  4BNC A;  1J75 A;  3JAM Z;  4OMZ A;  3Q5F A;  4XLP F;  2GIV A;  5DYM A;  3QP5 A;  5J6X A;  3OV8 A;  3J81 Z;  1O3S A;  1PP7 U;  2OQG A;  2J5P A;  4Y17 A;  2H6C A;  2JPC A;  2LDU A;  1LDD A;  4U88 A;  2UZK A;  3GEZ A;  3DP7 A;  4N0B A;  1ZLK A;  2H94 A;  3HOT A;  4DQ2 A;  3F8M A;  3J80 K;  5H6Q A;  2F5C A;  4L9V A;  2D1H A;  3GO5 A;  3BPX A;  5ILS A;  4BHP A;  2CG4 A;  2UXX A;  1JHH A;  1ZRE A;  2XUB A;  2BV6 A;  3BZ6 A;  1LEA A;  5CVV A;  3WE3 A;  4LD5 A;  4Q4Z F;  2PMU A;  3K1M A;  4F7Z A;  2HTJ A;  4S04 A;  3SFZ A;  2V1U A;  2O03 A;  3SZT A;  2FBI A;  1FLI A;  1WQ2 A;  1MKM A;  1WSU A;  2M1B A;  3FMS A;  4I2O A;  3RKW A;  1IW7 F;  5L3D A;  1IN8 A;  3IKT A;  2XRO A;  4YG2 F;  1OYI A;  5JVT A;  4KIG A;  2QM3 A;  3DFG A;  1BC7 C;  2K02 A;  2R7D A;  4D0P A;  2EB7 A;  2CSO A;  2K7L A;  3PQK A;  1H9G A;  4YFK F;  1QPM A;  5CVR A;  4HX4 A;  1B1B A;  4E70 A;  5FFX A;  1S3J A;  1WRJ A;  1REP C;  2P7C B;  2IPQ X;  2RN7 A;  1FNN A;  2JSC A;  3IRR A;  3BJA A;  4FT8 A;  2DPD A;  4UNO A;  2RVC A;  4UHT A;  2J5O A;  3AAF A;  2KJC A;  1K7A A;  3IRQ A;  5D5U B;  4EVI A;  3P7N A;  3T5X A;  3KEO A;  1BOA A;  3GZ5 A;  4IRG A;  1B9N A;  3FHZ A;  3SQN A;  3BRO A;  1J9I A;  2FE3 A;  2P8T A;  4AVP A;  4U0Y A;  3IKV A;  1W7P B;  3WTX C;  2M8E A;  4IVN A;  2XGX A;  4U7D A;  2WC2 A;  2DQR A;  1AWC A;  3CO7 C;  2XAS A;  1JE8 A;  4XSX F;  4YIF A;  4TV7 A;  4ZH4 F;  1SD5 A;  2PN6 A;  1XCB A;  5JI6 A;  4GYG A;  4OOI A;  1FYL A;  3IWF A;  4YII A;  2NNY A;  2F5D A;  2PBI A;  3R60 A;  5LEJ A;  1DP7 P;  3BJO A;  1BIA A;  1XGN A;  2CWE A;  3RKX A;  4HF0 A;  3T8R A;  2ZME A;  1A04 A;  5HLG A;  4N9I A;  5FD6 A;  1Z7U A;  4L0Y B;  3QRF F;  3F72 A;  3G73 A;  3QPH A;  3MZH A;  1R7J A;  3R61 A;  2BYV E;  4L0Z B;  1ZG3 A;  3VFZ A;  2ZNZ A;  3B73 A;  1LDJ A;  5DD4 A;  4EJW A;  3F3X A;  4Q47 A;  1KQ9 A;  3M7G A;  2HZT A;  3LA2 A;  2D45 A;  4EQQ A;  4MGR A;  1BI3 A;  5A2Q K;  1XGM A;  1R23 A;  1QO0 D;  1MDM A;  4KMF A;  4L5I A;  1SD6 A;  1MDM B;  3ZMZ A;  4BYY A;  2MC3 A;  2MLK A;  4ASN A;  4KMU X;  1W5S A;  5D8K B;  3JSP A;  1OR7 A;  3M8E A;  1J5Y A;  1YS7 A;  1TW2 A;  3GFL A;  2EFW A;  4L9J A;  3WE2 A;  3EYI A;  1KQ0 A;  1NHA A;  3L2C A;  4ENN A;  5E1W A;  5DV5 A;  4XSZ F;  3MZY A;  3M1E A;  5D6E A;  1MJB A;  4FHT A;  1U3E M;  2COM A;  3RYR A;  4NB5 A;  4XLN F;  5L3E A;  1G4D A;  3WTV C;  3COA C;  3MCZ A;  5LBQ A;  1PDN C;  5D5W B;  3V4G A;  1P4X A;  2EJR A;  3ISP A;  4EMS A;  4KFC A;  3HRS A;  1R22 A;  2GAU A;  2XKP A;  1R1U A;  3K0L A;  1X3U A;  2IW5 A;  1O3R A;  3W6K B;  4G6D A;  1V3F A;  2M30 A;  4I01 A;  5HLI A;  2QVO A;  5E1Z B;  2XKO A;  1IUY A;  3N4M A;  4P96 A;  5F6F A;  1XMA A;  2HDC A;  5HDN A;  2HWV A;  2PEX A;  3I59 A;  3O6B B;  1YW7 A;  3I59 B;  2CQK A;  3FXU A;  1TQM A;  4IRI A;  3SZP A;  1G3S A;  1Z9C A;  3QPT A;  4O5V A;  3E5Q A;  3E6M A;  3J80 Z;  2QWW A;  1W5T A;  4KA4 A;  4MTD A;  5DCM A;  4EJU A;  1HQC A;  1OMI A;  4P9F A;  1SFX A;  3GZ6 A;  4GYI A;  4OMY A;  3CTA A;  5J8C A;  2ELH A;  2L54 A;  5HOO A;  4OIN F;  1U2W A;  2A61 A;  2P5V A;  3WTU C;  4RGS A;  4A5M A;  2XAF A;  2M45 A;  5TRD A;  1WKM A;  4UUV A;  5ICG A;  2F5E A;  4G6Q A;  2VOO A;  2HOE A;  1KA8 A;  1Z1D A;  2V9V A;  3FF5 A;  2VBZ A;  2ISY A;  3KP5 A;  3L09 A;  3R0A A;  2C6Y A;  2Q0O A;  2ZXJ A;  4HBL A;  3FX3 A;  3HSF A;  2RKH A;  3N97 A;  4LGW A;  1I1G A;  4EM1 A;  4IHT A;  6PAX A;  4G7H F;  2KJB A;  3D0S A;  4OU0 A;  2Z9O A;  2ZFW A;  4IRH A;  4ENM A;  3ULQ B;  2AXL A;  4ZZL A;  4BHB A;  1YW8 A;  1IXR C;  4MQ9 F;  2EK5 A;  2VE9 A;  4CGZ A;  3TDZ C;  2HGC A;  3V8L A;  1ZAO A;  2XAJ A;  4AD9 A;  4Y15 A;  1B6A A;  1R58 A;  2WWY A;  2HKO A;  5E8G A;  1IN4 A;  2VC1 A;  2RQP A;  3J7A O;  2PFB A;  1UCR A;  1CF7 A;  4UV9 A;  4I02 A;  3PFI A;  5CLS A;  4Z2Y A;  3TO7 A;  1TBX A;  1XSX A;  4EM0 B;  2JTV A;  1FWZ A;  2W84 A;  4M9Z A;  4A0X A;  1U5T A;  5BPI A;  3HRU A;  5E20 A;  2DO7 A;  2IA0 A;  1L3L A;  2HQN A;  4R79 A;  5BS6 A;  3HTU A;  3RKY A;  5D4R A;  1HW5 A;  3FXR A;  2STW A;  1F4K A;  3V8K A;  4EM2 A;  4QWQ A;  2JZY A;  4HX8 A;  3O3K A;  1ZAR A;  4A0Y A;  4BQA A;  2H27 A;  2XHK A;  1O7F A;  4PZJ A;  3CJN A;  2EV6 A;  3HSR A;  2PG4 A;  4L9T A;  4QLC U;  5BPD A;  5J8F A;  4HW0 A;  2A69 F;  4RGR A;  1ON2 A;  3KZY A;  4S05 A;  1ZN2 A;  2FF4 A;  2DI3 A;  1EH8 A;  2EFN A;  2HYF A;  4LMY A;  2Z99 A;  4HQE A;  3HYI A;  2WV0 A;  2VBX A;  3WG9 A;  4ZYH A;  3ABT A;  4RGX A;  2W24 A;  5LRR A;  2E7X A;  2VBY A;  4UXN A;  5F1R A;  4HV5 A;  1HKS A;  1OYW A;  5HS7 A;  5A2Q Z;  2YPR A;  2BE5 F;  3BWG A;  5FB2 A;  4IF4 A;  1PP8 F;  4RAY A;  5FD5 A;  3JTG A;  2P6T A;  2OZ6 A;  3ECO A;  3R0J A;  3I64 A;  4KN4 X;  3NRV A;  3DV8 A;  3GFJ A;  3FMQ A;  3LFK A;  1O57 A;  1BI0 A;  1XB4 A;  2ISZ A;  4XRF A;  5K5Q A;  2JPB A;  3FWE A;  2NYX A;  2W85 A;  1F1Z A;  5LEK A;  1FYM A;  4R1H A;  3D5L A;  2HKX A;  4I0A A;  1WWX A;  5BQT A;  1LB2 A;  2QEN A;  5FFZ A;  2DFI A;  1YFH A;  4JQF A;  4ON0 A;  4FX4 A;  3F6O A;  4HLX A;  1ZG1 A;  3K69 A;  1TNT A;  3E6B A;  1QZY A;  1HBX G;  1FZP B;  4UVB A;  3ZQ7 A;  1LQ1 A;  3KP3 A;  1T38 A;  4LLN A;  1RI7 A;  1R5H A;  1S6L A;  2RDP A;  3WTS C;  1ULY A;  3GVA A;  3BPV A;  1K79 A;  2K27 A;  3REO A;  2QBY A;  4RB1 A;  2VC0 A;  2A6H F;  5LRS A;  1BC8 C;  3ZP5 A;  3TO6 A;  1HKT A;  1KQ8 A;  2KIU A;  3T8T A;  2G7H A;  5L3G A;  1J2X A;  2VBW A;  1R36 A;  4G94 A;  1B59 A;  2IP2 A;  2L01 A;  2VT3 A;  3E5U A;  1XD7 A;  4L9N A;  3KEQ A;  4BXU A;  1V4R A;  4M73 A;  1IN7 A;  1EH6 A;  4EV0 A;  4Q48 A;  1RIO H;  2MA3 A;  2QQ9 A;  3GUD A;  2Y48 A;  3KET A;  4LJZ F;  3TKY A;  3HTS B;  1RZ4 A;  1S8N A;  1UB9 A;  1TQP A;  2EFQ A;  5EEG A;  2MH9 A;  5ERI A;  3SXY A;  4ESF A;  1S29 A;  2HFH A;  2V6C A;  4HDU A;  1TW3 A;  2O3F A;  5KVR A;  1Y0U A;  1ZLJ A;  4HAM A;  3GW2 A;  3QAH A;  1IF1 A;  4UV8 A;  3V8J A;  4JBA A;  5BMZ A;  3ELK A;  4EJT A;  2Q2E A;  2Y0M A;  1ZRF A;  1AOY A;  1GVJ A;  1T0F A;  4FX0 A;  1YYV A;  4EGY A;  4A6D A;  5JHU A;  3FMR A;  3F8F A;  3B02 A;  3DPL C;  5FLX K;  1FP2 A;  1HSJ A;  2ZME B;  3HUG A;  2K4B A;  2HYG D;  3DF8 A;  2YU3 A;  1P4W A;  2IA1 A;  2LNB A;  1Z6R A;  3KLO A;  1YO5 C;  4M74 A;  1BIB A;  3QOP A;  2L4A A;  4M9S A;  4ESJ A;  4IXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...