2FBIA

The crystal structure of transcriptional regulator pa4135
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
136
structure length
136
Chain Sequence
RPSLTLTLLQAREAAMSFFRPSLNQHGLTEQQWRVIRILRQQGEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAPKDQRRVYVNLTEKGQQCFVSMSGDMEKNYQRIQERFGEEKLAQLLELLNELKKIKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of transcriptional regulator PA4135
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription
molecule keywords probable transcriptional regulator
total genus 57
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fbiA00
2MH2A 4RGSA 3FZVA 1TQIA 1LEBA 3JW4A 3NQOA 4XLNF 1QZZA 2Q2EA 3TOBA 3ZMDA 1I5ZA 1O57A 1T39A 4CYDA 2OA4A 1XMKA 4I02A 4LG0B 3ZN0A 3IC7A 5FB2A 1DPUA 2XROA 4KIBA 1IXCA 2H6BA 2VT3A 5L3FA 2QLZA 1KU2A 4KA4A 3BPVA 2QM3A 1EV7A 4HV6A 1R1UA 1ULYA 3EYYA 1E2XA 1FBQA 3ECHA 2NYXA 3FMQA 3FWEA 2BYVE 4BNCA 5ERIA 1HSTA 2PN6A 3WGHA 3TO9A 4ETSA 2P6TA 1J0RA 2RV8A 3V8JA 3O6BB 1Y0UA 2E1NA 1QO0D 2HKOA 4M74A 4I09A 3ABUA 1L0OC 3KFWX 2HTSA 1B59A 1YG2A 2OAZA 1WWXA 2ZO4A 3OOPA 4HF0A 2XKPA 1O3TA 3COAC 3VEPA 5H6RA 3TO6A 4PCQA 4CHUA 4G9YA 3GZ6A 2WWYA 1ZGJA 4YFKF 3BDDA 3FMSA 2RKHA 1DUXC 5H20A 2O3FA 1LDJA 2M87A 2LNBA 1Z7UA 1UFMA 1XN7A 2VOOA 1U5TA 4Y17A 2HZTA 1CF7A 4F7ZA 4G7ZF 1YTYA 4MQVA 3BJ6A 3DKWA 4UUVA 4U0YA 3F22A 3IWFA 3B73A 3LA2A 2EFNA 3F3XA 2UZKA 1FOKA 1ZGAA 4L9NA 4ON0A 2MC3A 3J7AO 3MEXA 4EV0A 2PMUA 3QPHA 1XDSA 1MDMA 1AOYA 3BP8A 2HYGD 3M7GA 2KIMA 4JK1X 5LHHA 1FP2A 1KYWA 3K69A 4IHSA 4MHGA 1K78B 2PEXA 1J9IA 5D8KB 2PG4A 4B8XA 1WQ2A 4EGYA 3RDIA 1OYYA 3ELKA 1XSDA 3M9AA 2W25A 2Z9OA 3MZYA 3I59B 2D45A 4N9IA 2W24A 4NHJA 3ECOA 1K7AA 4JBAA 1D5VA 4O3MA 2Z33A 1TW2A 3BJOA 1BC8C 5JR3A 1O3RA 3KLOA 2JPBA 3SFZA 5JFRA 3WGIA 4WXCA 4AD9A 1REPC 1DDNA 2FBKA 3E97A 4NB5A 5E18F 3Q5FA 3WTXC 2R7DA 2W84A 1LDKB 5CVIA 2CQKA 1KU7A 2NS0A 4UVAA 1JGSA 3RJPA 1RI7A 1U2WA 1ZYRF 3FXUA 3ROUA 3RYRA 2ZXJA 2CWEA 1QZYA 2OU2A 2ZNYA 4ESFA 2CSOA 1HW2A 4U88A 1GHCA 1XD7A 5LRRA 4IXAA 1P4XA 1UHWA 2VOPA 3KP3A 2FEZA 5D4SA 1IN8A 3LFKA 4U7BA 1EH8A 5BPDA 1O7FA 2VC0A 1FZPB 5LEJA 2E7XA 1B9NA 1R1VA 1CGPA 2VBXA 2V1XA 3ZN1A 1B9MA 3K9TA 2QUFA 1QGPA 3GF2A 1BBYA 3BJAA 4I0AA 5TRDA 2BEOA 2HFHA 1OPCA 3QOPA 5LLQA 2XVCA 5J8CA 4IRGA 1Z05A 4KICA 3P7NA 4G8XA 1XCBA 2Z3YA 4M72A 1K79A 1USTA 2K4JA 1S7OA 4M73A 2DK5A 1F5TA 1I27A 3OV8A 4GXOA 3GEZA 3KP7A 2C6YA 5LBQA 5DCMB 5E8GA 1SMTA 2DU9A 1SD4A 5IT3A 3CUOA 2STWA 2HDCA 2Z99A 2UXXA 3PQJA 2R3SA 4ZYGA 3VFZA 3WTSC 4EJTA 1W5TA 4UVBA 1T38A 4HA8A 2CW0F 3KEOA 3CDHA 5HDKA 3BY6A 2PI0A 4WCGA 3CO6C 1I1SA 1H0MA 2Y0MA 1AWCA 3WGGA 2DPDA 4UV9A 2J5PA 2JT1A 1QBJA 1WRJA 1BIBA 2VBYA 5DYMA 3LAPA 5L3EA 5ILUA 2QQ9A 2M30A 5L3DA 4CGZA 1YFHA 4M9SA 2ZFWA 2L54A 2V1DA 3O2PE 3R61A 4LG0A 5DV5A 2VN2A 3MQ0A 2AS5F 2FRHA 1DPRA 3LQQA 3HOTA 2FMLA 1CF7B 3MCZA 1WI9A 3F6VA 1BI0A 4E70A 3MFKA 5E17F 3G3ZA 5BQTA 2M45A 4EJOA 4ESBA 2P7VB 1KQ8A 2DQLA 2UWMA 1F9NA 1P2FA 5HS9A 2MLKA 2MH9A 1R5HA 2VONA 2DAOA 4ZYHA 4OMYA 2V9VA 4IHTA 4GYGA 4CDGA 3WTVC 4MQ9F 3ZMVA 5LRSA 4Q5SF 2DTRA 1IW7F 1XSVA 3GW2A 3FX3A 3KCCA 1MZBA 2FBIA 2HOEA 2LF7A 4JQFA 3LA7A 1MJBA 4KIFA 4IRHA 2YX7A 3KP2A 2ZBKA 1OYWA 1TLHB 4AIJA 1P92A 4PZJA 5AONA 2FXAA 4IJAA 1R7JA 1R1TA 4BAYA 3QP5A 1E17A 1Z6TA 1Q1HA 1R5GA 6PAXA 3SHFA 5F64A 3V7RA 4RGXA 5BOXA 4L0YB 5IT9K 1FYKA 2DFIA 2GQQA 4YIIA 1TBXA 1KQ0A 2XGXA 2GXGA 1TNTA 1J75A 2RNJA 3RKXA 2GA1A 5CVUA 2O61A 1YS7A 3QPTA 3R0AA 2BBYA 4KT5C 4A5NA 4XLPF 5E20A 3S2WA 2DI3A 1HKTA 2HGCA 4HDVA 3FF5A 4R8HA 1TQPA 2F5EA 3WU0A 3ZMZA 3WTZA 2M8EA 1P6RA 3EUHA 1S29A 4XBFA 1LNWA 1R58A 1U5TB 2F5FA 2HQNA 1RUOA 2L01A 4GCVA 1BN5A 4AWXB 5JHUA 3HSFA 5JVTA 1HSJA 3ZMTA 3HTUA 2D1HA 4ENJA 2VE8A 4PGGA 4I7HA 1SFUA 2Q0OA 2VXZA 1F4KA 2IW5A 4UVCA 5ICEA 2CO5A 4U7DA 3L7WA 5D8LB 1LDDA 3CO7C 5DUIA 1PP7U 4ASNA 2CG4A 3I58A 5J8FA 5DDGA 1IZ1A 2EFQA 4Q47A 4HQMA 4HOBA 3RPQA 1ZRDA 4IVNA 3Q9SA 2F5DA 3T5XA 1W5SA 4L18B 3F8MA 4LD5A 2PQ8A 3C3WA 2ZJ2A 3RI4A 2KJBA 3L2CA 3G73A 3EQLF 3U9GA 4BQAA 1FBUA 4LLGF 2DW4A 4A0XA 1U3EM 3TKYA 5D5VB 3K1PA 1ZG5A 2XRNA 3FMRA 2P5VA 3M8FA 1MDMB 2ELHA 2TDXA 3L00A 1IRGA 2FNAA 3HYIA 5HVQC 4HW0A 3U1DA 2FSWA 3GFIA 1XGSA 5CVJA 4B09A 3EETA 4MGRA 5CYVA 3HUGA 5FO5A 4FX0A 4LK1F 5F1RA 5DUKA 4BYYA 2RC4A 4EM1A 3GZ5A 4OIRF 3HSEA 3JSOA 4N9HA 4YIFA 2JPCA 1LQ1A 2FU4A 1W7PA 1BC7C 4XRFA 2DLLA 5EEHA 3ERED 1EH7A 2NNYA 1G4DA 2EV0A 2XUBA 2VE9A 2A5YB 4K2EA 2L4AA 2M5WA 1GXQA 3D0SA 4HQEA 4M9ZA 2DPUA 3C18A 3CTAA 2EV5A 2OZUA 3HTSB 3DFGA 4M9XA 3N4MA 4KDPA 1OR7A 4RB3C 2V6CA 2QBYA 1HXDA 4P9FA 2E1CA 3REOA 2P5LC 3TOAA 4P55A 2MA3A 2PJPA 4N0BA 3MAJA 2GA2A 1ZG1A 3WTUC 1J2XA 3IWZA 5ED4A 3QAHA 2LKPA 4QLCU 1BI1A 2MBFA 2ISYA 1FC3A 1TTYA 1JXSA 3V8LA 5LGUA 4A12A 3KEQA 3F8BA 4ENNA 2IPQX 1IXRC 3R4KA 3U2RA 2JZYA 3I64A 3WODF 1ON2A 4ENMA 4EVIA 4WWCA 2K27A 3F8NA 3F23A 2ZNZA 5HDGA 5H6QA 3LQRA 4XSZF 5E1XA 3KZZA 4YG2F 5E1ZB 5FFXA 4MTEA 2VC1A 3D5LA 2XAFA 1G3SA 1XB4A 3WU1B 2EA4A 1MGTA 1OYIA 4P9UA 4HBLA 1ZRCA 2BE5F 1OMIA 2OZ6A 1GVJA 1UHMA 2V79A 3GUDA 4KMUX 1K6OA 3LA3A 2ISZA 1D3YA 1GXPA 3F72A 1FY7A 4KFCA 2VBZA 1HKSA 2EFWA 1BM9A 2HEOA 1OKRA 2A69F 2O8XA 4M6XA 3HRTA 3JAMZ 3E5UA 1FPQA 4A0ZA 2JTVA 2KIFA 1LJ9A 2R7FA 4I01A 2G7HA 2L4MA 3I5UA 1U8RA 2WV0A 3K2ZA 1JHHA 2Y75A 2FNPA 4EQQA 2XHKA 4FHTA 3RKYA 3H92A 3L9FA 4OIOF 3JSPA 3TO7A 3I53A 3CLOA 3RIRA 3VODA 1RNLA 5F6FA 5DD4A 3TDZC 3JTGA 3SZPA 3VOEA 1R22A 2D1VA 5E8IA 4ENKA 2FBHA 2O03A 3CUQA 3F21A 2DK8A 4LLNA 1U6GA 3WE2A 4OIQF 1I6XA 4D0PA 4BXUA 1USSA 1QQIA 2QYOA 1G3TA 5HLHA 2ZMEA 2NAZA 2CYYA 4BHPA 3O3KA 4IPAA 1IAWA 3QU6A 2FA5A 1U78A 1ZG3A 4KUMA 2GIVA 3KP6A 3I59A 2CFXA 1C0WA 5AIQA 4MEXF 1BI2A 2YSRA 4EJUA 2KIUA 1QPMA 5DCMA 2L3DA 1A04A 4M71A 4LLLA 2OD5A 4BHCA 3ZQ7A 1KU3A 4P5OA 4P96A 3ML6A 2P7CB 1IUYA 4WXHA 2MD5A 4Z2YA 1QNTA 1ZHFA 4UNOA 5BMZA 3DPTA 2XAJA 3J80Z 2X4HA 2EK5A 3TGNA 1YS6A 1BI3A 2XAGA 1IN4A 3C7JA 2FMYA 4I98B 3FHZA 2H09A 1SD7A 4RS8A 2P8TA 2ZMEB 3SQNA 4Q48A 4MTDA 3J81Z 3F8CA 4Y15A 1SD5A 3WTYC 2Q8KA 3LAJA 3F6OA 2A6HF 4KN7X 4MNUA 1WSUA 2FQ3A 4I2OA 1HKQA 2QQAA 4HF2A 1G6NA 1S8NA 2ESHA 4LMYA 3R0JA 1SD6A 1TNSA 2NRAC 1YO5C 1JE8A 3I4PA 4ZZLA 5AIPA 3ULQB 2EWNA 5CVVA 2P6SA 1LVAA 1LB2A 1U5TC 4UHTA 2EFOA 4PGHA 2WC2A 4IRIA 3GLXA 5FFZA 4G7OF 3W6KB 3BWGA 1ON1A 4ZH4F 1MJ9A 5D5XB 2VBWA 2FOKA 2A61A 2NNNA 2OQRA 2RQPA 2DQRA 1ONVA 3I54A 3J80K 3IKTA 3H3ZA 4R1HA 3GFMA 1STZA 4I0BA 4FT8A 1ZAOA 4AIKA 3F8FA 2HS5A 2W85A 3KP5A 5DD8A 2LF8A 5TJJA 5BS6A 2XAHA 2COMA 4WXDA 2G9WA 1HBXG 4HDUA 3VB2A 2JRTA 4LGWA 2P4WA 2LSOA 4KNYA 3P9IA 3V8KA 2H94A 2V1UA 2B0LA 2QVOA 3RYPA 4BHBA 4WK8F 1V4RA 5IT9Z 2QWWA 1O7LA 1ZLKA 3HOSA 1XGMA 1PP8F 2EA2A 1IXSB 4S04A 2P5KA 4IF4A 2QBYB 1HQCA 3DF8A 3IHUA 2XV4S 4RGRA 2EFPA 4YFNF 2ZKZA 1H9TA 3WE3A 5HDNA 3K1MA 3GVAA 5EEGA 2K86A 2MLGA 2IA0A 3TDUC 4XSXF 1FSHA 3KE2A 4HLXA 3K1NA 1D8JA 4L0ZB 4HYEA 4AIHA 4A2UA 5JI6A 3T8RA 1DP7P 2QENA 1MJAA 2XASA 2QQBA 3H3UA 2PBIA 3KETA 1B4AA 4AVPA 3AAFA 4CICA 5LHIA 2ACJA 1J7KA 4CZZA 1Z9CA 2FF4A 5K5OA 3Q9VA 3E6DA 3LWFA 4U0WA 5HLIA 1IN7A 2K7LA 2GAUA 2PLYA 4Q4ZF 4UV8A 5D5UB 4L9JA 2X0LA 3GO5A 5ICFA 4L5IA 1O3QA 1BOAA 4EMSA 2RDPA 1J5YA 1XMAA 1JHFA 4GGGA 4RAZA 3GYHX 1T2KA 3GXOA 2FE3A 3DPLC 5LEKA 2E7WA 4RB1A 4G7HF 5E1WA 1W7PD 5D4RA 2DO7A 1YQAA 1G3YA 5HLGA 3QRFF 4QWQA 2O6GE 5L3GA 4FX4A 2BGCA 3FXQA 3HSRA 2UXNA 2H6CA 4HV5A 1KGSA 3CUQC 3BPXA 1S3JA 2ADUA 5ILSA 2RVCA 3MZHA 4L5JA 2DT5A 1XDUA 4KN4X 2AXLA 4L9TA 4UXNA 1FSEA 2D2WA 3IRRA 3BROA 5K1YA 1EH6A 1B1BA 4A5MA 3JTHA 1YW7A 3B02A 5J6XA 1ZRFA 5FLXK 3DEUA 3IKVA 2RN7A 2EJRA 3CJNA 3IL2A 3V4GA 1ODDA 2A3SA 1TQMA 1FYMA 2LDUA 4RB2C 3NRVA 3GX4X 1RUNA 4LB5A 4RGUA 1FYLA 2VODA 1HW1A 4HX8A 3T0YA 1Z1DA 4KYWA 2HYFA 1FP1D 3HRMA 3FM5A 3J81K 1YYVA 4RB0A 3RKWA 5DEQA 4R79A 1FBSA 5D6EA 1SAXA 3CUQB 2G7UA 1G3WA 5K5RA 1W4MA 4ZYDA 1FWZA 3E6BA 5CVRA 3M1EA 1SFEA 2K4BA 3W6JB 4OOIA 1YW9A 1XGOA 2ESNA 3TQNA 3DXJF 3DV8A 3WTTC 2H27A 4Y13A 1ZN2A 1W7PB 1B6AA 1R00A 3KLNA 5FLXZ 5HOOA 2Y48A 2XKOA 5A2QK 4WX9A 1RZ4A 1J59A 3NEUA 5CJ9A 1V3FA 4LB6B 5ICCA 1IF1A 2J5OA 3P9KA 4L9VA 3PQKA 3E5QA 2JSCA 4PDKA 2YU3A 2GWRA 5FD6A 4HAMA 5ICGA 1R23A 1S6LA 2GZWA 4G6DA 4HX4A 2M1BA 5FD5A 5HS7A 1PDNC 5HS8A 2F2EA 1T98A 3QU3A 4M6YA 1S7AA 3C1DA 1X3UA 4HX7A 1FNNA 3FM3A 3DQVC 4OIPF 1UB9A 3ABTA 1VTNC 5FGMA 3E6MA 3L09A 4OMZA 3DP7A 2OBPA 3RTRA 2PMHA 2KKOA 4U0VA 3KZYA 3RPUA 4GO1A 4HLYA 2EV6A 5ILVA 2L02A 5A2QZ 2GXBA 2RGVA 3IRQA 4H0EA 4A6EA 1WKMA 3HRSA 3PFIA 1KQ9A 3JAMK 2YX4A 4EJWA 3E3VA 5L3CA 3N97A 4YFXF 5LGNA 3ZMSA 2K02A 4DQ2A 2ETHA 4EM0B 5BPIA 2CGPA 5D5WB 2HQRA 3R60A 3HIFA 1SFXA 1IRFA 3V7CA 4MEYF 5D6FA 3I71A 1FLIA 1L3LA 2IA2A 4ZZDA 2A07F 1IN5A 2OQGA 3HRUA 1MD0A 4O5VA 1UCRA 5KVRA 3ISPA 3BOQA 5L3BA 3K0LA 5DCFA 4ESJA 4ZYEA 4DNCA 4NQWA 1ZREA 2IP2A 1ZARA 1HW5A 2HR3A 3E5XA 3ZMUA 4G6QA 1P4WA 3P9CA 1PUEE 3T1BA 1XSXA 4G94A 1BIAA 3SXYA 3EYIA 1R36A 3T8TA 3R6SA 3M8EA 3MWMA 1Z6RA 4OINF 1YLFA 2IT0A 3V7SA 2KRFA 2QZ8A 4WF2A 5K5QA 4EGZA 3LSTA 1MKMA 2IVMA 5KK1A 2YPRA 5CLSA 1ZLJA 1XGNA 3ZP5A 1TW3A 2STTA 4TV7A 2VT2A 1H9GA 3GFLA 2HWVA 4A6DA 1O3SA 4BH9A 4EJVA 2Z5UA 3FXRA 4LJZF 1BJAA 1YIOA 2BV6A 1KA8A 4EM2A 1T6SA 1YW8A 4LK0F 3E6CC 3SZTA 2W57A 3BZ6A 4RAYA 4KMFA 1ZH5A 1K78A 3ZPLA 1FX7A 1IN6A 2DBBA 3KP4A 2A68F 1KU9A 2YR2A 2IJLA 4CO8A 1XCVA 3HHHA 3WG9A 4HF1A 1I1GA 2O0YA 4CXFA 4HZFA 2EB7A 2WTEA 4GYIA 3GWZA 4S05A 1F1ZA 1NHAA 3I0TA 4A0YA 3EDPA 2PFBA 1SMYF 5LGTA 4LFUA 4OU0A 3HHGA 2IA1A 1KYZA 1LEAA 4O6JA 1P4AA 3WTWC 2HTJA 2HKXA 2XAQA 1RIOH 5LHGA 2KJCA 1FT9A 2A6EF 1Z91A 2XIGA 2ZCWA 1T0FA 3GFJA 2F5CA 1D8KA 3QP6A 2IRFG 4KIGA
chains in the Genus database with same CATH superfamily
2MH2A 4RGSA 2NS7A 1B8IA 3FZVA 4W1UA 1TQIA 2HPMA 3S2DJ 3QYBA 2MG4A 1LEBA 2R7UA 3JW4A 3K70C 3NQOA 2LRDA 3L2WA 3FXMA 4XLNF 5F0CA 1QZZA 1X1AA 3FBNB 2VJ4A 1R71A 2Q2EA 3TOBA 3ZMDA 1I5ZA 2VLAA 1SEUA 1O57A 3LSKA 1T39A 2Z16A 4CYDA 3WU2C 5IYDJ 2OA4A 1XMKA 4I02A 3TL4X 4LG0B 3ZN0A 1O4XA 3KX2A 4XKCA 1T8IA 3DKXA 3AL0C 2PJRB 1P9QC 3G1MA 1PUFB 3IC7A 5FB2A 1DPUA 3BG6A 4X0GA 2XROA 1FTZA 2HDWA 4KIBA 3GTQJ 2W7NA 1HF0A 1IXCA 4XOPA 2FX0A 2L9RA 2WADA 2H6BA 2VT3A 2IAIA 2X51A 3K4BA 4KT6A 5L3FA 2QLZA 3KZIC 4XOTA 1KU2A 4KA4A 3BTIA 3BPVA 1DU6A 2QM3A 1EV7A 2G0EA 1R1UA 1ULYA 2K9LA 2XGDA 4HV6A 3CCVI 1BJZA 3EYYA 1E2XA 1FBQA 4J19A 3ECHA 1G59A 2NYXA 1PVEA 3BCAA 3DBRB 3FMQA 3FWEA 2BYVE 5FKKA 4BNCA 2R5ZA 3SZGA 2K5CA 5ERIA 1YOVB 4OAYA 1XG1A 2R92J 3HEFA 5KCMA 1VQLI 1HSTA 2AHQA 2PN6A 2LREA 3WGHA 1FOWA 4XLEA 4ZJZA 3JRHA 3TO9A 4ETSA 5CPRB 2P6TA 3GTJJ 4BJ6C 2R5YA 1FIAA 2NVYJ 4G6TB 1J0RA 2E2IJ 1XPXA 2RV8A 2DA7A 3V8JA 4IOAF 4L5EA 3GTKJ 3O6BB 1Y0UA 1JUSA 2E1NA 3PNTA 3V42A 1QO0D 2F5VA 2HKOA 4M74A 4XLCA 3NAUA 4I09A 2DMQA 3ABUA 1L0OC 3KFWX 2HTSA 3W2WA 4A3CJ 1B59A 1YG2A 2OAZA 1WWXA 2ZO4A 3OOPA 4HF0A 1DP3A 1NK3P 2XKPA 1O3TA 4V2FA 3CDIA 2E36A 3TP3A 3COAC 3VEPA 2I10A 5H6RA 3TO6A 4PCQA 4CHUA 4G9YA 5BNGA 3GZ6A 5E79C 2PX9A 2WWYA 2DFFA 1ZGJA 4YFKF 5FLMJ 3BDDA 3FMSA 2BVMA 2KRCA 2RKHA 1DUXC 5H20A 2YUSA 2O3FA 1LDJA 3CJRB 4HSTA 2L7FP 2M87A 4PJ0C 2MFZA 1UJ8A 4G12A 3SJMA 2K3PA 2LNBA 3HKZA 1Z7UA 2UV1A 3HKZN 1UFMA 3OYEA 1XN7A 2JA5J 2DXIA 2VOOA 1U5TA 4Y17A 2HZTA 1CF7A 4IHXA 4BJTA 4X6AJ 4F7ZA 4G7ZF 1YTYA 4MQVA 3BJ6A 3DKWA 4X1EA 4XORA 3IH3A 1EA3A 2M0MA 4BY7J 4UUVA 4DW6A 2FOWA 4U0YA 3F22A 3IWFA 2V1NA 3B73A 3LA2A 2EFNA 4B44A 2K9MA 3F3XA 4M3BA 3UKGA 2UZKA 3K6GA 1FOKA 1D0ZA 1ZGAA 3S1RJ 4L9NA 4ON0A 2MC3A 1OCCH 4BXFA 3J7AO 3MEXA 1WI3A 3S93A 1YX3A 1ETXA 4EV0A 1YJWI 2PMUA 3QPHA 3GBGA 1XDSA 1MDMA 4A3LJ 2DA4A 5EGOA 1AOYA 3BP8A 2HYGD 2ZJPF 4PFPA 3ABMH 3BR6A 3M7GA 2P0WA 2BY3A 2KIMA 4CCMA 4JK1X 5LHHA 1FP2A 1KYWA 3VSLA 4HG2A 3K69A 4IHSA 4MHGA 5C3EJ 1K78B 2PEXA 1J9IA 4XLFA 5D8KB 2PG4A 1QVTA 4B8XA 3CCMI 1WQ2A 2CW7A 3RSNA 4EGYA 3RDIA 1OYYA 3ELKA 2V4JC 1XSDA 4XLHA 3M9AA 2DFHA 2W25A 2Z9OA 5IPAA 2WAFA 4AU7A 3MZYA 3I59B 5CKTA 2D45A 2CQXA 2JA8J 5J1RA 4N9IA 1G8XA 2W24A 4NHJA 4C3IJ 1DU0A 3CJQB 1TWGJ 3ECOA 1NG7A 3L2QA 1K7AA 4JBAA 1W1WE 1D5VA 4O3MA 2Z33A 1TW2A 1LE8A 3FDYA 3BJOA 3FK6A 1BC8C 1FJLA 4BQOA 1X1PA 5JR3A 2ECCA 1O3RA 4DOZA 3KLOA 2BXYA 2JPBA 3QPSA 3SFZA 5JFRA 3WGIA 5J4VA 2O8KA 1LFBA 3W2VA 5EG0B 2LTPA 4WXCA 4AD9A 2DA2A 2CU7A 1DDNA 1REPC 2R7VA 4MFDA 2FBKA 3E97A 4NB5A 5E18F 4QIWN 3CP2A 3Q5FA 3WTXC 2R7DA 2W84A 1R4NB 2HVQA 1LDKB 5CVIA 2CQKA 1U9OA 2ZXIA 1KU7A 1OCOH 1B8IB 1OFCX 2NS0A 4MLOA 3NWSA 3FXKA 4UVAA 5M3MJ 4NC7A 1F36A 1JGSA 3RJPA 1GLNA 1RI7A 5H2FC 1U2WA 2XF7A 5F27A 1ZYRF 3FXUA 3S1NJ 3ROUA 4BL0B 3RYRA 3K4KA 2ZXJA 2LK2A 2CWEA 2XPUA 1QZYA 1QU3A 2OU2A 1LPQA 1RR8C 3JRAA 5KHDA 2ZNYA 1JJ6C 2F4MB 4ESFA 3RKQA 2CSOA 1HW2A 2XGCA 3OWTA 4U88A 1GHCA 2JA7J 3BG7A 1XD7A 5LRRA 4IXAA 2LD5A 3AFHA 3LSRA 1P4XA 1UG2A 1JUMA 3KEYA 3ZQQA 2R7XA 1UHWA 1X2MA 1ZKGA 2VOPA 2ZFUA 3KP3A 3HOXJ 2FEZA 3OYBA 5D4SA 3DTIA 1IN8A 3FKJA 3VYTB 3LFKA 2VJ5A 1ETYA 3ZQCA 3GTOJ 4U7BA 2W82A 3ZCOA 3PO3J 1EH8A 4DZPA 5BPDA 2L7ZA 4C3JJ 1O7FA 2VC0A 5FKNA 4XRSG 1FZPB 2W1OA 5LEJA 2E7XA 1B9NA 1R1VA 1CGPA 2DFEA 2EH3A 1WJCA 2VBXA 2V1XA 3ZN1A 4A3IJ 1B9MA 3K9TA 2HOSA 5TGTA 4BS9A 2E2JJ 2GM4A 1IDYA 2QUFA 1QGPA 1D0XA 3GF2A 3JCUC 2LBFA 5J47A 1BBYA 1D0YA 4JP0A 3BJAA 3RCOA 4I0AA 5TRDA 2BEOA 2HFHA 3K4MA 2OC6A 2DT6A 1OPCA 4II2A 4M3DA 3TMOA 3HOZJ 2OTJI 3QOPA 5LLQA 5E3NA 2XVCA 5J8CA 3O8HA 1IDZA 2VKHA 4IRGA 4BE2A 1Z05A 4KICA 4BE1A 3P7NA 4G8XA 2HOAA 1VQKI 4RMNA 1XCBA 1Q1VA 2Z3YA 4M72A 2MSYA 1K79A 1USTA 2M4KA 2EZLA 2K4JA 3MKWB 5B1BH 4AM3A 4E4HA 1S7OA 3H5NA 3MN2A 4MIMA 2Y9ZA 1SC7A 2GLOA 3OYIA 3MD2A 4M73A 2CFOA 5JLXA 4CCLA 2DK5A 1Z7LA 2X1CA 1F5TA 1IG7A 1I27A 4BBSJ 3OV8A 4Y52J 4GXOA 3GEZA 3KP7A 2C6YA 5LBQA 2E71A 5DCMB 5E8GA 1SMTA 5FJ8J 2DU9A 2BVLA 1SD4A 2ELJA 5IT3A 3CUOA 3HM5A 1K4SA 3MKYB 1BR2A 2STWA 2HDCA 4IKFA 3G4SI 2DMTA 2V26A 3FIWA 2Z99A 2UXXA 4XKBA 1RESA 3PQJA 2R3SA 4ZDPA 4ZYGA 3VFZA 2L7KA 4IHWA 2DT7B 3WTSC 1OLTA 5GP9A 2PMZN 4EJTA 3ZQGA 1W5TA 4UVBA 1T38A 4HA8A 5EGOB 3H0DA 2CW0F 3KEOA 3CDHA 2EPFA 3PNVA 3RZOJ 2BHYA 4BGDA 4ZC3A 2W48A 3E7LA 1Y8QB 3K2AA 5M5XJ 5HDKA 3HG9A 5GTHC 2LOOA 3BY6A 2W00A 1F43A 2PI0A 4WCGA 1JKPC 1VQOI 3CO6C 1Z21A 1I1SA 1H0MA 1ETQA 4CYCA 2GIZA 2Y0MA 3OR1C 1MW7A 1AWCA 1B72B 2ZXWH 3WGGA 4YEJA 4UV9A 2DPDA 2J5PA 2CQ7A 3TW7A 2JT1A 4DGWB 3BTJA 1QBJA 1VQNI 2DYRH 1WRJA 1BIBA 2VBYA 5DYMA 2KIQA 3LAPA 5L3EA 5GAEJ 5ILUA 2QQ9A 3JRDA 1P7IA 2M30A 5L3DA 4CGZA 1QHHD 3ABLH 1YFHA 3HOVJ 2F4OB 3DBLB 4M9SA 1TWFJ 2HVRA 2ZFWA 2HNHA 2L54A 2V1DA 3O2PE 3R61A 1MMGA 4LG0A 4IQJA 5DV5A 3OYCA 2VN2A 3MQ0A 2W4SA 2AS5F 2FRHA 1DPRA 1RKWA 3ESWB 3LQQA 3L2VA 3FHNA 4A3KJ 3HOTA 2K40A 1TWHJ 3ZOBA 2QKLB 3BT9A 2FJ1A 3KYLA 2FMLA 2CW8A 1CF7B 4RAFA 4UB6C 3MCZA 1WI9A 2NXNB 5JLWA 3F6VA 1BI0A 4E70A 4NQWB 3MFKA 4S0HB 5E17F 3G3ZA 1K4TA 5BQTA 5GPAA 2M45A 4EJOA 4ESBA 3BG5A 2P7VB 1KQ8A 4XRMA 1OCZH 2DQLA 5HNFA 2UWMA 1F9NA 2IS1A 1P2FA 5HS9A 2MLKA 1YI2I 3K4CA 2MH9A 1TWAJ 1OCRH 4ABZA 3OIQA 1R5HA 3IAM2 2DAOA 3L2UA 2VONA 1OCPA 1WJFA 4ZYHA 4OMYA 2VJIA 3PJRA 3F9KA 2V9VA 4FETA 3CF5F 4IHTA 1DGRM 3OYNA 4XKWA 4GYGA 4CDGA 3C2BA 1MH4A 3WTVC 4MQ9F 3VWBA 2HI3A 1X3ZB 3OYLA 3ZMVA 2JA2A 5LRSA 2XSJC 4Q5SF 3PNYA 2QSGX 2DTRA 3I4MJ 2OCCH 3DLLF 2O5RA 2LC2A 1IW7F 3ZR8X 3GW2A 1XSVA 3FXLA 3FX3A 3KCCA 1MZBA 4Y4RA 4BEHA 2FBIA 2HOEA 4CCKA 2XF5A 4HPQA 2LF7A 2LVSA 4JQFA 3LA7A 1WCMJ 1MJBA 4KIFA 3H0GJ 4IRHA 5KAFC 2DODA 2LY2A 2YX7A 3KP2A 2ZBKA 5FLVA 1OYWA 1TLHB 4AIJA 1P92A 4PZJA 2X48A 2KQRA 4PJNA 3ZQIA 5AONA 5FRMA 2FXAA 4IJAA 1R7JA 5KNLA 3GTMJ 3EPZA 3QODA 4C3HJ 4C2UA 1BW6A 1E3HA 1XTAA 2VUMJ 1X4PA 2XPWA 1R1TA 4XICA 4BAYA 1DGWY 1AHDP 3QP5A 5F1JA 1E17A 1Z6TA 2XB0X 1Q1HA 1R5GA 6PAXA 3SHFA 1MBJA 5F64A 4F93B 2E34A 3K7AJ 3V7RA 2VI6A 3H36A 3CCEI 4RGXA 3N05A 5BOXA 3NARA 4L0YB 3IAS2 2IGNA 2YU9J 5IT9K 3OYHA 1FYKA 2DFIA 2GQQA 2F48A 3FXOA 1N25A 4YIIA 1TBXA 1KQ0A 4BJ5C 3HDDA 2XGXA 2GXGA 1TNTA 1J75A 2RNJA 3RKXA 3J7AY 2EZKA 2GA1A 4RM3A 2O9LA 5CVUA 4B3XA 4RBOA 2O61A 2NVUB 1AKHB 2CV2A 1MMNA 1YS7A 3QPTA 3R0AA 4JX6A 3A03A 2BBYA 3FK7A 4KT5C 4A5NA 4XLPF 3OY9A 2OV7A 3HJEA 3JRFA 2MGQA 5E20A 3S2WA 2DI3A 2ID6A 1HKTA 3QWLA 3ASOH 2HGCA 4HDVA 3FF5A 3VYSB 3OYDA 4R8HA 2ZSIB 4E7KA 2MW8A 1CQTA 2DA5A 3X2QH 1TQPA 4RAGA 5GPCA 5DS9A 2WAQN 2ICWG 2KHMA 2R7TA 2I8DA 3LSHA 5CQGA 3S3OA 1X58A 4E7SA 2F5EA 3WU0A 3ONQA 3ZMZA 1WJ5A 3H5RA 3BC8A 3WTZA 2M8EA 1P6RA 3EUHA 1S29A 5B3SH 4RLQA 4XBFA 1LNWA 2EZIA 4B4CA 1R58A 1U5TB 2F5FA 2HQNA 1RUOA 1X19A 2E1OA 2L01A 4GCVA 2HQAA 1IJWC 4BY1J 1BN5A 4AWXB 4Z6YA 5JHUA 3HSFA 5JVTA 1HSJA 1FEXA 3SEZA 3ZMTA 3HTUA 2AQFA 2D1HA 4ENJA 5E3LA 3QQAA 2VE8A 4XQFA 4PGGA 4F92B 2HQ5A 4I7HA 1SFUA 2Q0OA 3CCLI 2VXZA 2HOTA 5IOYA 1F4KA 1EJ9A 2DDAA 2NVQJ 2IW5A 3DLAA 4UVCA 5ICEA 2CUZA 3TBIA 4V2GA 2CO5A 1M1EB 4U7DA 3L7WA 5D8LB 1LDDA 1ETWA 3CO7C 5DUIA 1MNEA 1PP7U 4ASNA 3S32A 2CG4A 3I58A 5J8FA 3QYFA 3CCYA 1FIPA 5DDGA 2B63J 1APLC 3AG3H 2VQHA 4ZDOA 1IV8A 1IZ1A 3DTEA 4YIRX 2EFQA 3LSJA 4Q47A 4BQNA 3GCMA 4HQMA 4XL9A 3IV5A 2HU9A 4HOBA 1BOBA 2DOEA 4XM3A 3RPQA 4LIUA 1ZRDA 3ZQLA 2JA6J 4IVNA 2HZDA 3Q9SA 2F5DA 4DYQA 3T5XA 1W5SA 4L18B 3F8MA 1HOMA 4LD5A 2PQ8A 3C3WA 1WGXA 2ZJ2A 1S72I 3RI4A 1Y56A 3AG2H 2KJBA 3L2CA 3G73A 3RQIA 3EQLF 3U9GA 4GFBA 4BQAA 1FBUA 4LLGF 1HC8A 2DW4A 2LBFB 4A0XA 1U3EM 3TKYA 5D5VB 2VKEA 3K1PA 5C4XJ 1ZG5A 2XRNA 3FMRA 3RQ4A 2HDDA 2BY1A 2P5VA 3M8FA 1VQMI 1MDMB 3KYCB 3ZQFA 4NDLA 1WH5A 2ELHA 1H8AC 1D5YA 2DMPA 2TDXA 3DEEA 4D7NA 1WJBA 3L00A 2M7BA 1IRGA 2FNAA 2H8WA 1Y39A 3OSFA 1R4MB 2COBA 3F0CA 3HYIA 5HVQC 3OYJA 4HW0A 4ZTFA 4B48A 3U1DA 5HNHA 2FSWA 5CVJA 1XGSA 4B09A 3GFIA 3EETA 5C4JJ 2E2HJ 1YIJI 4MGRA 5CYVA 3HUGA 1QPIA 3PO2J 4IL6C 2LKXA 3GMEA 5FO5A 4FX0A 3CMYA 4LK1F 5F1RA 2R5ZB 5DUKA 1NG6A 2R7SA 4BYYA 1R49A 2RC4A 3HOUJ 1PJRA 4EM1A 2XAUA 4W97A 3GZ5A 1TWCJ 4OIRF 3HSEA 4E7JA 3JSOA 1GV2A 4N9HA 4YIFA 4M3GA 2CUJA 4XR6A 3CCRI 2R4GA 2JPCA 3SDGA 5F0HA 2XRLA 2VASA 2LH9A 4EATA 1LQ1A 2E5ZA 1TZLA 3J7ZI 2FU4A 1Z67A 2QKMB 2VPLA 1W7PA 1BC7C 2ID3A 1IO2A 4XRFA 5E3MA 2DLLA 5EEHA 3ERED 1EH7A 2KZVA 4XK4A 4A3EJ 2NNYA 2GXAA 1G4DA 2VKDA 2EV0A 2XUBA 1MBGA 1JI8A 1UZCA 1HDPA 4RLFA 4B3AA 3M3YJ 1A35A 3QYEA 2EQRA 2VE9A 2A5YB 3HPGA 2A6TA 1XX5A 5M3FJ 4K2EA 1QRYA 2L4AA 3PM1A 1H89C 3HUGB 3BZCA 2M5WA 1GXQA 3D0SA 4D7MA 4HQEA 1BR1A 4M9ZA 2CV0A 2DPUA 3OS2A 1ZR2A 3C18A 3CTAA 3BLYA 1KONA 2EV5A 1RKTA 2OZUA 3HTSB 1I39A 3RPUD 3DFGA 4M9XA 3N4MA 2L9SA 1OR7A 4KDPA 4RB3C 1Y1WJ 2V6CA 3D1NI 2QBYA 3CC7I 3OIOA 1HXDA 2JJ7A 4MFEA 2F4IA 1LFPA 4P9FA 1JKQC 2LG4A 2E1CA 2M9HA 3REOA 2P5LC 2IBDA 1R6RA 3TOAA 4P55A 1BW5A 4XRSA 2GOMA 1Z3YA 2MA3A 5JVGF 1JKOC 2PJPA 4QSHA 4N0BA 3MAJA 2GA2A 1RC9A 2NOJB 4AC0A 1ZG1A 3WTUC 1J2XA 2EINH 1MNMC 3IWZA 5ED4A 3CLQA 1ENHA 2LKPA 2QGUA 3QAHA 1Y0NA 4QLCU 1BI1A 1X4OA 3MVPA 3GTGJ 2MBFA 1Z77A 4IZZA 1MH3A 1QZEA 2M3AA 3OS1A 3CMEI 1OQYA 2ISYA 2GOXB 1FC3A 4JX5A 1TTYA 2X6XA 1JXSA 3V8LA 5LGUA 4A12A 3KEQA 3G1LA 4PJMA 3F8BA 4ENNA 4I6ZA 1P7JA 2IPQX 1IGNA 3G6EI 1IXRC 3R4KA 1WVRA 3U2RA 2JZYA 3I64A 1PYVA 2NOGA 2KRHA 3WODF 1ON2A 1MSFC 4ENMA 3OOUA 4EVIA 4WWCA 4AYBN 2QEXI 2K27A 2BXZA 4CA0A 3F8NA 3F23A 1VFCA 2ZNZA 5HDGA 5H6QA 3LQRA 1WHUA 4XSZF 5E1XA 4BQQA 4HRIA 3KZZA 4YG2F 3L2RA 1FTTA 2DJIA 5E1ZB 3JRIA 3IP4B 5FFXA 4MTEA 2VC1A 1ETOA 2V6EA 1IUFA 3D5LA 3BQYA 2ZB9A 2XAFA 1G3SA 3G1OA 1XB4A 3WU1B 2EA4A 3S1MJ 4PJLA 3CCSI 3FISA 1MGTA 1OYIA 4P9UA 4ZYAA 3W3CA 4HBLA 1ZRCA 2BE5F 1OMIA 2OZ6A 1GVJA 1UHMA 2V79A 3GUDA 4A93J 3LSIA 4QPOA 2LKSA 4KMUX 1K6OA 1VQ4I 3LA3A 2ISZA 4AYBA 5F04A 1D3YA 3H9JA 1GXPA 2GBYA 3F72A 1FY7A 2DA1A 2E1MB 4KFCA 2VBZA 5J1YA 1HKSA 2EFWA 1BM9A 2KDOA 2HEOA 1OKRA 2A69F 2O8XA 4M6XA 4E7IA 3HRTA 3JAMZ 2X6WA 3E5UA 1FPQA 2VQGA 4A0ZA 2JTVA 1MBEA 4AUXA 2KIFA 1LJ9A 3DWLE 1N77A 2R7FA 4ANJA 1RETA 1JTYA 4I01A 2G7HA 2L4MA 1I50J 3I5UA 1U8RA 2WV0A 3K2ZA 1JHHA 2Y75A 2FNPA 4EQQA 2XHKA 4FHTA 2Q2EB 1QA6A 4FE4A 3RKYA 3CZ6A 4XLAA 4NC6A 2L5QA 3H92A 2CH0A 3L9FA 2OUMA 1TT0A 2L7MP 1UELB 4OIOF 3JSPA 3TO7A 3I53A 3CLOA 1VQ8I 3TEDA 3RIRA 1E3PA 2H8RA 5EJCA 3VODA 1RNLA 4XN0A 1ACIA 5F6FA 2BOLA 2EIKH 5DD4A 3BZKA 2QQ8A 3TDZC 1OJLA 5KAIC 3D5SC 3JTGA 4DYRA 3SZPA 3VOEA 3BTCA 3EUKL 1R22A 2D1VA 5E8IA 4ENKA 4EEFG 3Q0VA 5JHFA 2NVTJ 2FBHA 2KISA 2O03A 4D5FA 3CUQA 3F21A 2DA3A 2IS4A 2DK8A 4ZDLA 4LLNA 4PSWA 1U6GA 1SVLA 1Y6IA 1SFKA 1YRNB 3WE2A 4OIQF 1I6XA 4D0PA 4BXUA 3JRGA 1MBFA 3KIOA 1USSA 1Y1VJ 1V5FA 3CESA 3TW6A 1QQIA 5EZHA 2JQ7A 2MYSA 4BEHB 2QYOA 3FBIB 1G3TA 3Q0WA 1SFOJ 5HLHA 2ZMEA 3BR2A 4M6VA 2NAZA 3P5JA 3PIPF 2CYYA 3E1SA 4BHPA 2R5YB 3O3KA 1WFXA 4IPAA 2IXSA 1IAWA 3QU6A 2FA5A 4PUSA 2BHZA 1U78A 2R7ZJ 2X1DA 2PMZA 1ZG3A 4KUMA 3A01A 4M3FA 2GIVA 2XSDC 3KP6A 3I59A 2CFXA 1C0WA 2NVXJ 3HGYA 5AIQA 4MEXF 1BI2A 2YSRA 1JGGA 4EJUA 2QSFX 2KIUA 3SYTA 1QPMA 5DCMA 2L3DA 4UUSB 5LFAA 1A04A 4M71A 4LLLA 2OD5A 2HXIA 4XKVA 4BHCA 3ZQ7A 1KU3A 4P5OA 4P96A 3ML6A 5FRNA 2P7CB 1IUYA 4WXHA 1VI0A 2MD5A 3HOYJ 4YRVA 4Z2YA 3M8JA 5EYRA 2ZMEC 1QNTA 1ZHFA 4UNOA 2DYSH 5FKOA 5BMZA 3DPTA 2XAJA 3J80Z 2K9SA 3WHCA 2X4HA 2EK5A 4N4NB 1FOXA 3TGNA 1YS6A 1JT6A 1BI3A 1N75A 2XAGA 2F6CA 3PUFA 1IN4A 2MD0A 3C7JA 2FMYA 4I98B 4RDUA 2ZJQF 3FHZA 4F91B 1Z3XA 2H09A 1SD7A 1K61A 4RS8A 2P8TA 2ZMEB 3SQNA 4Q48A 4MTDA 5FKLA 1X2NA 2Y69H 3J81Z 3F8CA 4Y15A 1SD5A 3WTYC 2RREA 2Q8KA 1HDDC 3LAJA 3BG9A 3GLLA 2HYJA 1ZK8A 3F6OA 2A6HF 3I56I 4KN7X 4MNUA 1X3WB 2JVHA 1WSUA 2FQ3A 3CQZJ 1HKQA 4I2OA 2B9SA 2QQAA 4UB8C 1G6NA 3QOEA 1S8NA 3HXLA 4HF2A 2ESHA 4PK4A 4C9YA 4LMYA 2CQNA 2VL8A 2R7WA 3R0JA 2XB5A 2ME6A 1SD6A 1A31A 1TNSA 3PUBA 2NRAC 1YO5C 1TC3C 3KPHA 4NC8A 1JE8A 3CCUI 3I4PA 5HLTA 1QHGA 2CUEA 4ZZLA 2VPRA 2LMDA 4V19K 1W0UA 2JK3A 5AIPA 3ULQB 2EWNA 4A3GJ 2ECBA 1IRXA 2WB1N 5CVVA 5M5YJ 2P6SA 1LVAA 2FUG2 1LB2A 1U5TC 2O7OA 1AKHA 4GRIA 4UHTA 2EFOA 4PGHA 4CSWA 5IP9J 2WC2A 2OCEA 4C30A 1JT0A 1A6QA 4IRIA 3L1PA 4BDYA 3DU6A 3GLXA 2WA0A 4JX4A 5FFZA 4G7OF 2KP6A 2P81A 3W6KB 4KITB 1V54H 5EEAA 4H4KC 3OS0A 3JRBA 3BWGA 4D1QA 1ON1A 4ZH4F 1MJ9A 5D5XB 1YJ9I 2VBWA 3BQZA 3M07A 2ELKA 2FOKA 2A61A 2M2EA 2NNNA 3BR0A 2OQRA 3WG7H 2RQPA 1JUPA 2DQRA 1XC5A 4XONA 1DQUA 4P1WA 4A69C 3I4NJ 1ONVA 3I54A 3J80K 3IKTA 2R7RA 2Y0SA 3H3ZA 2Y0SN 2Y9YA 4Y7NJ 4I99C 3HBLA 1ITYA 4R1HA 3GFMA 1X1CA 1STZA 4I0BA 1W0TA 4FT8A 1LFUP 1ZAOA 4II3A 4AIKA 3IH4A 3F8FA 2HS5A 3BR1A 3ZQHA 2W85A 3KP5A 5DD8A 1HA8A 1HLVA 4MO7A 1VZ0A 4HSRA 2LF8A 4FE7A 3K4NA 3LMMA 1RR7A 2VB6A 5TJJA 3A2KA 5BS6A 2V7FA 2XAHA 3PSFA 2COMA 3SFIA 4WXDA 2G9WA 1HBXG 4HDUA 1JTXA 2KDZA 3VB2A 2JRTA 4LGWA 2DJNA 2P4WA 2NS8A 2LSOA 5B1AH 2E60A 4ZTJA 1BA5A 4KNYA 1E3OC 3P9IA 3V8KA 2H94A 3OYAA 2V1UA 4KISA 5F0FA 2B0LA 1TT5B 2QVOA 3RYPA 2N8GA 4BHBA 4WK8F 2FQ4A 1V4RA 5IT9Z 2QWWA 1O7LA 2IGOA 4CZCA 2X6YA 3DCFA 1ZLKA 3HOSA 1XGMA 1PP8F 2RAEA 2EA2A 1IXSB 1U0JA 4S04A 3H9QA 2P5KA 3SEQA 1D1CA 1YHQI 4IF4A 4IOCF 1MIJA 1VNDA 2QBYB 1HQCA 3DF8A 1IC8A 3IHUA 4HEA2 3I9V2 2ZXHA 5EF6A 2XV4S 1I6HJ 1UAAA 1H88C 4IHVA 4RGRA 2EFPA 4YFNF 3OYFA 4JYKA 2ZKZA 3PIOF 1H9TA 3CJTB 5IP7J 4IEJA 3ZRGA 5B5EC 3WE3A 2FD5A 5HDNA 3K1MA 3GVAA 4QTRA 3K4LA 5EEGA 3DEWA 1VQPI 2K86A 2MLGA 3NWTA 3H9GA 2IA0A 2R7QA 4XSXF 3TDUC 2E1MC 1FSHA 2R0QC 3KE2A 4HLXA 3K1NA 1D8JA 4L0ZB 4HYEA 4AIHA 4A2UA 5JI6A 1I3AA 3HL2A 3T8RA 4PFOA 1DP7P 2QENA 1MJAA 2XASA 2QQBA 3H3UA 2PBIA 3KETA 4B1RA 2V9KA 1B4AA 1X1BA 5GADJ 2IS2A 3SDBA 3Q3SA 3VPRA 4AVPA 3AAFA 4CICA 5LHIA 2Z2SB 2M4GA 2ACJA 3W6VA 2L9NA 4DZJA 1FMVA 1J7KA 4CZZA 1Z9CA 2FF4A 4E7ZA 3Q9VA 3E6DA 3LWFA 4U0WA 5K5OA 5HLIA 1IN7A 3QPLA 4XMYA 3VYRB 2K7LA 3OYMA 2GAUA 2PLYA 1A6IA 4AIDA 4Q4ZF 5GAHJ 2CRGA 4UV8A 2JN6A 5D5UB 4L9JA 3S14J 2CJJA 2X0LA 4AVZA 2OJED 3GO5A 5ICFA 4L5IA 2LY9A 3DBHB 2IGKA 1BOAA 4EMSA 3LSPA 1O3QA 3Q0UA 1GVDA 2RDPA 1J5YA 1UMQA 3EUAA 1XMAA 3S1QJ 1JHFA 4GGGA 1LE8B 4RAZA 3GYHX 3KYDB 2DOFA 3B6CA 1T2KA 3H35A 5DM6F 3GXOA 1V5GA 1W5CC 2FE3A 3DPLC 5LEKA 2E7WA 4I76A 4IHYA 4RB1A 4G7HF 5E1WA 1W7PD 5D4RA 2OTLI 4FQGA 4BDZA 1YQAA 2DO7A 2V9PA 1KZHA 5C44J 1G3YA 3C2HA 5HLGA 3QRFF 4QWQA 2O6GE 3MKLA 5L3GA 4FX4A 2BGCA 2L9VA 3FXQA 3ZGKA 5CQEA 3HSRA 1JKRC 2UXNA 4OWRB 2H6CA 4HV5A 1V5EA 2YS9A 2WBMA 1KGSA 3CUQC 1VQ6I 3BPXA 1S3JA 4F52A 3B6AA 3VDXA 1NK2P 1S5LC 2ADUA 2RVCA 2M0CA 5ILSA 3K10A 5TISC 4A3JJ 3MZHA 4L5JA 2DT5A 1T08B 1WJAA 2WAEA 1XDUA 4F55A 2CQQA 1T95A 4KN4X 2K9QA 1BL0A 3HGGA 2AXLA 2E35A 2M7AA 4L9TA 1T33A 4UXNA 1FSEA 2D2WA 1NH3A 3IRRA 3BROA 5K1YA 3A01B 1UHSA 2DMUA 3BR5A 3CDLA 1EH6A 3BG3A 2BY0A 1X1DA 2X9DA 1B1BA 1FMWA 2AXTC 4PJJA 4A5MA 1B72A 3BR3A 2VQLA 2X85A 1YW7A 2XF6A 3B02A 3JTHA 5J6XA 1ZRFA 5FLXK 3DEUA 3IKVA 4U87A 2HXOA 2LFBA 5EZGA 2RN7A 1I3QJ 3G2BA 2EJRA 3CJNA 5B66C 2JUCA 2DCEA 1Y8RB 3IL2A 4Y3OA 1IRZA 4CCOA 3V4GA 4DYCA 1ODDA 2A3SA 2VXDA 2PJRA 1TQMA 1FYMA 2LDUA 1TL8A 4RB2C 3ASNH 3NRVA 3GX4X 1RUNA 4LOCA 4LB5A 4RGUA 1FYLA 4XN3A 2H1KA 2VODA 3LSMA 1HW1A 4HX8A 3T0YA 1Z1DA 4KYWA 2HYFA 2Y2ZA 2JWTA 3CC4I 4A3DJ 1FP1D 3HRMA 3FM5A 1R9TJ 3HPHA 2RQQA 3J81K 1YYVA 3CCJI 3CMMA 4RB0A 4A3FJ 3H3VK 3RKWA 3CCQI 4HNUA 4LG3A 5DEQA 4R79A 1FBSA 5F08A 5D6EA 4GDFA 4D5CA 1SAXA 3OYKA 2WY8Q 3CUQB 2G7UA 3FKIJ 4IQ4A 1G3WA 2KZGA 3I3LA 5K5RA 1W4MA 3OL4A 4ZYDA 1FWZA 3E6BA 5CVRA 2Y31A 3M1EA 2M34A 3C2GA 3DKYA 1SFEA 2K4BA 2IGMA 1UG0A 3EUHC 3W6JB 4OOIA 1YW9A 1XGOA 2ESNA 2ME0A 3TQNA 3DXJF 4FISA 2HVSA 1YE9A 3DV8A 2EBIA 3WTTC 3U1KA 1TP4A 5EDNA 5E3OA 3GTPJ 2BW3B 1VQ9I 2H27A 4Y13A 1MBKA 1ZN2A 1W7PB 1B6AA 3CMAI 1R00A 3KLNA 2R93J 4BBRJ 3WHBA 2BZTA 1MBHA 5FLXZ 2KLOA 5J40A 5J1UA 4E7HA 3VSKA 5HOOA 2LY1A 2XKOA 2Y48A 3AG1H 5A2QK 4WX9A 3W2AA 3AG4H 1SAUA 2D5VA 1RZ4A 2LP0A 1J59A 2JSPA 2WB1A 4F3QA 3NEUA 3RZDJ 5CJ9A 5M5WJ 1V3FA 2R7OA 4LB6B 3O8GA 5GTIC 5ICCA 4BUPA 2TCTA 1IF1A 2J5OA 3MMYB 3P9KA 4L9VA 1RRJA 5IYCJ 3LFUA 3PQKA 3ZXSA 3E5QA 4KJZA 1OISA 2JSCA 2JUGA 2DOAA 4PDKA 2DTZA 1VF9A 2YU3A 2GWRA 5FD6A 4Y33A 1SVMA 4HAMA 2KPMA 2LLKA 5ICGA 1R23A 1LVKA 1S6LA 2DDBA 2GZWA 4G6DA 2L2OA 1OR7C 4HX4A 4BACA 1HCRA 2M1BA 2K85A 5FD5A 5HS7A 1PDNC 5LD2C 3GTLJ 5J4YA 5HS8A 1MMSA 2DA6A 3ABKH 3OYGA 2F2EA 2QA4I 2XPVA 2Y30A 5FKMA 5IOZA 3J7YJ 1T98A 3QU3A 4M6YA 4BE0A 3LSGA 4IX7A 4NNJA 1WPKA 1VQ5I 1S7AA 3C1DA 1ZGWA 1J09A 1N78A 1X3UA 4CYCB 4HX7A 3TP0A 4BKXA 2L0KA 1FNNA 3FM3A 2XGEA 5IY5H 3DQVC 1UB9A 4OIPF 3ABTA 1VTNC 1T56A 3LL7A 1T0FC 5FGMA 3E6MA 3L09A 1U8BA 4OMZA 1FOYA 3UNGC 4DIQA 5DM7F 1R5ID 3BTLA 3DP7A 3HB9A 3DPUA 1IV6A 2OBPA 5K7ZA 3S2HJ 3M4OJ 3RTRA 5EG0A 2PMHA 1MSEC 2KKOA 4U0VA 3KZYA 3RPUA 2JRMA 4GO1A 1PUFA 1SANA 4HLYA 2M8GX 3LNQA 2EV6A 2MABA 4BU2A 2B7EA 1AU7A 5ILVA 4D9JA 2L02A 1K83J 1LKXA 5A2QZ 2GXBA 2RGVA 3CP8A 4DBRA 1VQ7I 3IRQA 4H0EA 1V55H 4NUBA 4CUGA 2KL4A 3IUOA 1GT0C 4A6EA 1SVOA 1WKMA 4DJAA 3A0HC 3HRSA 3OMYA 3PFIA 2HPIA 1KQ9A 3GZNB 3LOCA 5K7FA 3JAMK 3I55I 3MKZA 2YX4A 4J01A 1A5JA 4B43A 3E3VA 4EJWA 5L3CA 3N97A 4YFXF 1ZELA 5LGNA 2KMUA 4XIDA 3ZMSA 2K02A 4DQ2A 2ETHA 4EM0B 3UR3C 5BPIA 1JJ8C 2CGPA 3CF2A 5D5WB 2HQRA 3R60A 3HIFA 1SFXA 3S8PA 2QF7A 1IRFA 1BR4A 1EKEA 1LUJB 4MEYF 5D6FA 3V7CA 3I71A 2EIJH 1FLIA 2A5WA 1GDTA 1L3LA 2IA2A 4ZZDA 2ZSHB 1OCTC 3HC7A 2A07F 1W36D 3K4JA 1IN5A 3HRUA 2OQGA 2VQCA 3A4CA 2K3FA 1ETVA 1MD0A 4O5VA 1UCRA 1MMDA 2JVGA 5KVRA 3PSIA 5IYBJ 3ISPA 4LITA 3BOQA 5L3BA 1A36A 4BXXJ 3K0LA 4B47A 1Z0XA 2E19A 1YJNI 3A02A 2A05A 5DCFA 4ESJA 4ZYEA 4DNCA 4NQWA 5J3LA 4A3MJ 1ZREA 4UUTA 3A0BC 1ZR4A 1G2HA 4E7LA 2EZHA 2IP2A 4FTHA 1ZARA 2EILH 2E5NA 3AL0B 1HW5A 2HR3A 3E5XA 3ZMUA 4C2TA 4FASD 4G6QA 4YELA 2QCOA 1P4WA 4ITVA 3P9CA 2XC7A 3JRCA 1W36C 2QSHX 2H1LA 3DU5A 3OSGA 1XS9A 1PUEE 1WH7A 3IH2A 3T1BA 1XSXA 2K9NA 4G94A 2ZC2A 3S16J 3U21A 2UUZA 1BIAA 3SXYA 3EYIA 1R36A 3T8TA 2CV1A 3R6SA 4C2MJ 3M8EA 3HZJA 4OAZA 3MWMA 1Z6RA 4CCJA 3S17J 4OINF 1RPWA 2CS3A 1YLFA 3AKZA 1WZ2A 2IT0A 4A3BJ 3V7SA 2KRFA 2QZ8A 4WF2A 3MZ8A 5K5QA 3FXJA 4EGZA 9ANTA 3LSTA 1MKMA 3OIPA 2DMNA 1XMXA 3PFYA 2IVMA 1ERDA 1GUUA 3H5AA 5KK1A 2YPRA 5CLSA 2WV1A 1ZLJA 4PSXA 3S3NA 1XGNA 1S9HA 1TW3A 2BW3A 2EIMH 3ZP5A 2STTA 1D1AA 1ETKA 2AQEA 1H9GA 2IEKA 2VT2A 4TV7A 4RA2A 4RM2A 3GFLA 3CC2I 2Z1DA 2OPTA 2HWVA 2VIXA 1ZQ3P 5IP6A 4A6DA 2OF7A 1ZTRA 1O3SA 3A1YA 4BH9A 5HODA 2ZJRF 4EJVA 3CD6I 1K6YA 1QVUA 2CUFA 2VJJA 2Z5UA 3OR2C 3FXRA 4LJZF 1BJAA 2Q1ZB 1EF4A 1YIOA 2WY7Q 4NBQA 2BV6A 1KA8A 4EM2A 1T6SA 1YRNA 2WAQA 1YITI 1YW8A 2CMPA 1MMAA 4LK0F 3SZTA 3E6CC 2W57A 3BZ6A 3E0JB 4RAYA 4KMFA 2I5UA 1ZH5A 4JOMA 1K78A 3ZPLA 1FX7A 5K7HA 3JR9A 4UUSA 1IN6A 3G71I 3S3MA 4CH7A 4FCYA 2DBBA 3HOWJ 3KP4A 2A68F 1KU9A 1U9NA 2YR2A 4M3EA 2DN0A 4N4OB 2IJLA 4CO8A 1XCVA 2KT0A 2AO9A 3HHHA 4CCNA 3WG9A 4UY8I 4HF1A 1NTCA 4DBQA 3DTKA 1I1GA 3VYUB 2O0YA 4CXFA 4HZFA 2EB7A 4HNTA 2KFDA 3BCBA 1WJEA 2RNGA 2WTEA 1GV5A 4QPQA 4E6KG 2MC4A 4GYIA 3GWZA 2X1EA 3H1CA 4LIVA 4S05A 1F1ZA 1NHAA 3I0TA 3PL8A 5FROA 1AA7A 2X6OA 4A0YA 3EDPA 2LYCA 3D5RC 2LR8A 2JMWA 3K70D 2PFBA 1SMYF 5LGTA 2VKVA 1WJDA 4LFUA 1ORKA 2XDVA 2TRTA 4OU0A 3HHGA 2IA1A 1KYZA 1LEAA 1MNDA 4O6JA 4HNVA 1YX5A 1P4AA 3OL3A 3WTWC 1E0EA 3JREA 4IO9F 5GAGJ 2HTJA 1POGA 2HKXA 2XAQA 1RIOH 5LHGA 3M1CA 5DTDA 2KJCA 1FT9A 1D1BA 4J00A 3S15J 2A6EF 1Z91A 1S7EA 3ERMA 2XIGA 2ZCWA 1T0FA 3GFJA 2F5CA 1D8KA 3QP6A 2IRFG 4KIGA 4XNFA 2IS6A 2BY2A
chains in the Genus database with same CATH topology
2MH2A 4RGSA 3FZVA 1TQIA 1LEBA 3JW4A 3NQOA 4XLNF 1QZZA 2Q2EA 3TOBA 3ZMDA 1I5ZA 1O57A 1T39A 4CYDA 2OA4A 1XMKA 4I02A 4LG0B 3ZN0A 3IC7A 5FB2A 1DPUA 2XROA 4KIBA 1IXCA 2H6BA 2VT3A 5L3FA 2QLZA 1KU2A 4KA4A 3BPVA 2QM3A 1EV7A 4HV6A 1R1UA 1ULYA 3EYYA 1E2XA 1FBQA 3ECHA 2NYXA 3FMQA 3FWEA 2BYVE 4BNCA 5ERIA 1HSTA 2PN6A 3WGHA 3TO9A 4ETSA 2P6TA 1J0RA 2RV8A 3V8JA 3O6BB 1Y0UA 2E1NA 1QO0D 2HKOA 4M74A 4I09A 3ABUA 1L0OC 3KFWX 2HTSA 1B59A 1YG2A 2OAZA 1WWXA 2ZO4A 3OOPA 4HF0A 2XKPA 1O3TA 3COAC 3VEPA 5H6RA 3TO6A 4PCQA 4CHUA 4G9YA 3GZ6A 2WWYA 1ZGJA 4YFKF 3BDDA 3FMSA 2RKHA 1DUXC 5H20A 2O3FA 1LDJA 2M87A 2LNBA 1Z7UA 1UFMA 1XN7A 2VOOA 1U5TA 4Y17A 2HZTA 1CF7A 4F7ZA 4G7ZF 1YTYA 4MQVA 3BJ6A 3DKWA 4UUVA 4U0YA 3F22A 3IWFA 3B73A 3LA2A 2EFNA 3F3XA 2UZKA 1FOKA 1ZGAA 4L9NA 4ON0A 2MC3A 3J7AO 3MEXA 4EV0A 2PMUA 3QPHA 1XDSA 1MDMA 1AOYA 3BP8A 2HYGD 3M7GA 2KIMA 4JK1X 5LHHA 1FP2A 1KYWA 3K69A 4IHSA 4MHGA 1K78B 2PEXA 1J9IA 5D8KB 2PG4A 4B8XA 1WQ2A 4EGYA 3RDIA 1OYYA 3ELKA 1XSDA 3M9AA 2W25A 2Z9OA 3MZYA 3I59B 2D45A 4N9IA 2W24A 4NHJA 3ECOA 1K7AA 4JBAA 1D5VA 4O3MA 2Z33A 1TW2A 3BJOA 1BC8C 5JR3A 1O3RA 3KLOA 2JPBA 3SFZA 5JFRA 3WGIA 4WXCA 4AD9A 1REPC 1DDNA 2FBKA 3E97A 4NB5A 5E18F 3Q5FA 3WTXC 2R7DA 2W84A 1LDKB 5CVIA 2CQKA 1KU7A 2NS0A 4UVAA 1JGSA 3RJPA 1RI7A 1U2WA 1ZYRF 3FXUA 3ROUA 3RYRA 2ZXJA 2CWEA 1QZYA 2OU2A 2ZNYA 4ESFA 2CSOA 1HW2A 4U88A 1GHCA 1XD7A 5LRRA 4IXAA 1P4XA 1UHWA 2VOPA 3KP3A 2FEZA 5D4SA 1IN8A 3LFKA 4U7BA 1EH8A 5BPDA 1O7FA 2VC0A 1FZPB 5LEJA 2E7XA 1B9NA 1R1VA 1CGPA 2VBXA 2V1XA 3ZN1A 1B9MA 3K9TA 2QUFA 1QGPA 3GF2A 1BBYA 3BJAA 4I0AA 5TRDA 2BEOA 2HFHA 1OPCA 3QOPA 5LLQA 2XVCA 5J8CA 4IRGA 1Z05A 4KICA 3P7NA 4G8XA 1XCBA 2Z3YA 4M72A 1K79A 1USTA 2K4JA 1S7OA 4M73A 2DK5A 1F5TA 1I27A 3OV8A 4GXOA 3GEZA 3KP7A 2C6YA 5LBQA 5DCMB 5E8GA 1SMTA 2DU9A 1SD4A 5IT3A 3CUOA 2STWA 2HDCA 2Z99A 2UXXA 3PQJA 2R3SA 4ZYGA 3VFZA 3WTSC 4EJTA 1W5TA 4UVBA 1T38A 4HA8A 2CW0F 3KEOA 3CDHA 5HDKA 3BY6A 2PI0A 4WCGA 3CO6C 1I1SA 1H0MA 2Y0MA 1AWCA 3WGGA 2DPDA 4UV9A 2J5PA 2JT1A 1QBJA 1WRJA 1BIBA 2VBYA 5DYMA 3LAPA 5L3EA 5ILUA 2QQ9A 2M30A 5L3DA 4CGZA 1YFHA 4M9SA 2ZFWA 2L54A 2V1DA 3O2PE 3R61A 4LG0A 5DV5A 2VN2A 3MQ0A 2AS5F 2FRHA 1DPRA 3LQQA 3HOTA 2FMLA 1CF7B 3MCZA 1WI9A 3F6VA 1BI0A 4E70A 3MFKA 5E17F 3G3ZA 5BQTA 2M45A 4EJOA 4ESBA 2P7VB 1KQ8A 2DQLA 2UWMA 1F9NA 1P2FA 5HS9A 2MLKA 2MH9A 1R5HA 2VONA 2DAOA 4ZYHA 4OMYA 2V9VA 4IHTA 4GYGA 4CDGA 3WTVC 4MQ9F 3ZMVA 5LRSA 4Q5SF 2DTRA 1IW7F 1XSVA 3GW2A 3FX3A 3KCCA 1MZBA 2FBIA 2HOEA 2LF7A 4JQFA 3LA7A 1MJBA 4KIFA 4IRHA 2YX7A 3KP2A 2ZBKA 1OYWA 1TLHB 4AIJA 1P92A 4PZJA 5AONA 2FXAA 4IJAA 1R7JA 1R1TA 4BAYA 3QP5A 1E17A 1Z6TA 1Q1HA 1R5GA 6PAXA 3SHFA 5F64A 3V7RA 4RGXA 5BOXA 4L0YB 5IT9K 1FYKA 2DFIA 2GQQA 4YIIA 1TBXA 1KQ0A 2XGXA 2GXGA 1TNTA 1J75A 2RNJA 3RKXA 2GA1A 5CVUA 2O61A 1YS7A 3QPTA 3R0AA 2BBYA 4KT5C 4A5NA 4XLPF 5E20A 3S2WA 2DI3A 1HKTA 2HGCA 4HDVA 3FF5A 4R8HA 1TQPA 2F5EA 3WU0A 3ZMZA 3WTZA 2M8EA 1P6RA 3EUHA 1S29A 4XBFA 1LNWA 1R58A 1U5TB 2F5FA 2HQNA 1RUOA 2L01A 4GCVA 1BN5A 4AWXB 5JHUA 3HSFA 5JVTA 1HSJA 3ZMTA 3HTUA 2D1HA 4ENJA 2VE8A 4PGGA 4I7HA 1SFUA 2Q0OA 2VXZA 1F4KA 2IW5A 4UVCA 5ICEA 2CO5A 4U7DA 3L7WA 5D8LB 1LDDA 3CO7C 5DUIA 1PP7U 4ASNA 2CG4A 3I58A 5J8FA 5DDGA 1IZ1A 2EFQA 4Q47A 4HQMA 4HOBA 3RPQA 1ZRDA 4IVNA 3Q9SA 2F5DA 3T5XA 1W5SA 4L18B 3F8MA 4LD5A 2PQ8A 3C3WA 2ZJ2A 3RI4A 2KJBA 3L2CA 3G73A 3EQLF 3U9GA 4BQAA 1FBUA 4LLGF 2DW4A 4A0XA 1U3EM 3TKYA 5D5VB 3K1PA 1ZG5A 2XRNA 3FMRA 2P5VA 3M8FA 1MDMB 2ELHA 2TDXA 3L00A 1IRGA 2FNAA 3HYIA 5HVQC 4HW0A 3U1DA 2FSWA 3GFIA 1XGSA 5CVJA 4B09A 3EETA 4MGRA 5CYVA 3HUGA 5FO5A 4FX0A 4LK1F 5F1RA 5DUKA 4BYYA 2RC4A 4EM1A 3GZ5A 4OIRF 3HSEA 3JSOA 4N9HA 4YIFA 2JPCA 1LQ1A 2FU4A 1W7PA 1BC7C 4XRFA 2DLLA 5EEHA 3ERED 1EH7A 2NNYA 1G4DA 2EV0A 2XUBA 2VE9A 2A5YB 4K2EA 2L4AA 2M5WA 1GXQA 3D0SA 4HQEA 4M9ZA 2DPUA 3C18A 3CTAA 2EV5A 2OZUA 3HTSB 3DFGA 4M9XA 3N4MA 4KDPA 1OR7A 4RB3C 2V6CA 2QBYA 1HXDA 4P9FA 2E1CA 3REOA 2P5LC 3TOAA 4P55A 2MA3A 2PJPA 4N0BA 3MAJA 2GA2A 1ZG1A 3WTUC 1J2XA 3IWZA 5ED4A 3QAHA 2LKPA 4QLCU 1BI1A 2MBFA 2ISYA 1FC3A 1TTYA 1JXSA 3V8LA 5LGUA 4A12A 3KEQA 3F8BA 4ENNA 2IPQX 1IXRC 3R4KA 3U2RA 2JZYA 3I64A 3WODF 1ON2A 4ENMA 4EVIA 4WWCA 2K27A 3F8NA 3F23A 2ZNZA 5HDGA 5H6QA 3LQRA 4XSZF 5E1XA 3KZZA 4YG2F 5E1ZB 5FFXA 4MTEA 2VC1A 3D5LA 2XAFA 1G3SA 1XB4A 3WU1B 2EA4A 1MGTA 1OYIA 4P9UA 4HBLA 1ZRCA 2BE5F 1OMIA 2OZ6A 1GVJA 1UHMA 2V79A 3GUDA 4KMUX 1K6OA 3LA3A 2ISZA 1D3YA 1GXPA 3F72A 1FY7A 4KFCA 2VBZA 1HKSA 2EFWA 1BM9A 2HEOA 1OKRA 2A69F 2O8XA 4M6XA 3HRTA 3JAMZ 3E5UA 1FPQA 4A0ZA 2JTVA 2KIFA 1LJ9A 2R7FA 4I01A 2G7HA 2L4MA 3I5UA 1U8RA 2WV0A 3K2ZA 1JHHA 2Y75A 2FNPA 4EQQA 2XHKA 4FHTA 3RKYA 3H92A 3L9FA 4OIOF 3JSPA 3TO7A 3I53A 3CLOA 3RIRA 3VODA 1RNLA 5F6FA 5DD4A 3TDZC 3JTGA 3SZPA 3VOEA 1R22A 2D1VA 5E8IA 4ENKA 2FBHA 2O03A 3CUQA 3F21A 2DK8A 4LLNA 1U6GA 3WE2A 4OIQF 1I6XA 4D0PA 4BXUA 1USSA 1QQIA 2QYOA 1G3TA 5HLHA 2ZMEA 2NAZA 2CYYA 4BHPA 3O3KA 4IPAA 1IAWA 3QU6A 2FA5A 1U78A 1ZG3A 4KUMA 2GIVA 3KP6A 3I59A 2CFXA 1C0WA 5AIQA 4MEXF 1BI2A 2YSRA 4EJUA 2KIUA 1QPMA 5DCMA 2L3DA 1A04A 4M71A 4LLLA 2OD5A 4BHCA 3ZQ7A 1KU3A 4P5OA 4P96A 3ML6A 2P7CB 1IUYA 4WXHA 2MD5A 4Z2YA 1QNTA 1ZHFA 4UNOA 5BMZA 3DPTA 2XAJA 3J80Z 2X4HA 2EK5A 3TGNA 1YS6A 1BI3A 2XAGA 1IN4A 3C7JA 2FMYA 4I98B 3FHZA 2H09A 1SD7A 4RS8A 2P8TA 2ZMEB 3SQNA 4Q48A 4MTDA 3J81Z 3F8CA 4Y15A 1SD5A 3WTYC 2Q8KA 3LAJA 3F6OA 2A6HF 4KN7X 4MNUA 1WSUA 2FQ3A 4I2OA 1HKQA 2QQAA 4HF2A 1G6NA 1S8NA 2ESHA 4LMYA 3R0JA 1SD6A 1TNSA 2NRAC 1YO5C 1JE8A 3I4PA 4ZZLA 5AIPA 3ULQB 2EWNA 5CVVA 2P6SA 1LVAA 1LB2A 1U5TC 4UHTA 2EFOA 4PGHA 2WC2A 4IRIA 3GLXA 5FFZA 4G7OF 3W6KB 3BWGA 1ON1A 4ZH4F 1MJ9A 5D5XB 2VBWA 2FOKA 2A61A 2NNNA 2OQRA 2RQPA 2DQRA 1ONVA 3I54A 3J80K 3IKTA 3H3ZA 4R1HA 3GFMA 1STZA 4I0BA 4FT8A 1ZAOA 4AIKA 3F8FA 2HS5A 2W85A 3KP5A 5DD8A 2LF8A 5TJJA 5BS6A 2XAHA 2COMA 4WXDA 2G9WA 1HBXG 4HDUA 3VB2A 2JRTA 4LGWA 2P4WA 2LSOA 4KNYA 3P9IA 3V8KA 2H94A 2V1UA 2B0LA 2QVOA 3RYPA 4BHBA 4WK8F 1V4RA 5IT9Z 2QWWA 1O7LA 1ZLKA 3HOSA 1XGMA 1PP8F 2EA2A 1IXSB 4S04A 2P5KA 4IF4A 2QBYB 1HQCA 3DF8A 3IHUA 2XV4S 4RGRA 2EFPA 4YFNF 2ZKZA 1H9TA 3WE3A 5HDNA 3K1MA 3GVAA 5EEGA 2K86A 2MLGA 2IA0A 3TDUC 4XSXF 1FSHA 3KE2A 4HLXA 3K1NA 1D8JA 4L0ZB 4HYEA 4AIHA 4A2UA 5JI6A 3T8RA 1DP7P 2QENA 1MJAA 2XASA 2QQBA 3H3UA 2PBIA 3KETA 1B4AA 4AVPA 3AAFA 4CICA 5LHIA 2ACJA 1J7KA 4CZZA 1Z9CA 2FF4A 5K5OA 3Q9VA 3E6DA 3LWFA 4U0WA 5HLIA 1IN7A 2K7LA 2GAUA 2PLYA 4Q4ZF 4UV8A 5D5UB 4L9JA 2X0LA 3GO5A 5ICFA 4L5IA 1O3QA 1BOAA 4EMSA 2RDPA 1J5YA 1XMAA 1JHFA 4GGGA 4RAZA 3GYHX 1T2KA 3GXOA 2FE3A 3DPLC 5LEKA 2E7WA 4RB1A 4G7HF 5E1WA 1W7PD 5D4RA 2DO7A 1YQAA 1G3YA 5HLGA 3QRFF 4QWQA 2O6GE 5L3GA 4FX4A 2BGCA 3FXQA 3HSRA 2UXNA 2H6CA 4HV5A 1KGSA 3CUQC 3BPXA 1S3JA 2ADUA 5ILSA 2RVCA 3MZHA 4L5JA 2DT5A 1XDUA 4KN4X 2AXLA 4L9TA 4UXNA 1FSEA 2D2WA 3IRRA 3BROA 5K1YA 1EH6A 1B1BA 4A5MA 3JTHA 1YW7A 3B02A 5J6XA 1ZRFA 5FLXK 3DEUA 3IKVA 2RN7A 2EJRA 3CJNA 3IL2A 3V4GA 1ODDA 2A3SA 1TQMA 1FYMA 2LDUA 4RB2C 3NRVA 3GX4X 1RUNA 4LB5A 4RGUA 1FYLA 2VODA 1HW1A 4HX8A 3T0YA 1Z1DA 4KYWA 2HYFA 1FP1D 3HRMA 3FM5A 3J81K 1YYVA 4RB0A 3RKWA 5DEQA 4R79A 1FBSA 5D6EA 1SAXA 3CUQB 2G7UA 1G3WA 5K5RA 1W4MA 4ZYDA 1FWZA 3E6BA 5CVRA 3M1EA 1SFEA 2K4BA 3W6JB 4OOIA 1YW9A 1XGOA 2ESNA 3TQNA 3DXJF 3DV8A 3WTTC 2H27A 4Y13A 1ZN2A 1W7PB 1B6AA 1R00A 3KLNA 5FLXZ 5HOOA 2Y48A 2XKOA 5A2QK 4WX9A 1RZ4A 1J59A 3NEUA 5CJ9A 1V3FA 4LB6B 5ICCA 1IF1A 2J5OA 3P9KA 4L9VA 3PQKA 3E5QA 2JSCA 4PDKA 2YU3A 2GWRA 5FD6A 4HAMA 5ICGA 1R23A 1S6LA 2GZWA 4G6DA 4HX4A 2M1BA 5FD5A 5HS7A 1PDNC 5HS8A 2F2EA 1T98A 3QU3A 4M6YA 1S7AA 3C1DA 1X3UA 4HX7A 1FNNA 3FM3A 3DQVC 4OIPF 1UB9A 3ABTA 1VTNC 5FGMA 3E6MA 3L09A 4OMZA 3DP7A 2OBPA 3RTRA 2PMHA 2KKOA 4U0VA 3KZYA 3RPUA 4GO1A 4HLYA 2EV6A 5ILVA 2L02A 5A2QZ 2GXBA 2RGVA 3IRQA 4H0EA 4A6EA 1WKMA 3HRSA 3PFIA 1KQ9A 3JAMK 2YX4A 4EJWA 3E3VA 5L3CA 3N97A 4YFXF 5LGNA 3ZMSA 2K02A 4DQ2A 2ETHA 4EM0B 5BPIA 2CGPA 5D5WB 2HQRA 3R60A 3HIFA 1SFXA 1IRFA 3V7CA 4MEYF 5D6FA 3I71A 1FLIA 1L3LA 2IA2A 4ZZDA 2A07F 1IN5A 2OQGA 3HRUA 1MD0A 4O5VA 1UCRA 5KVRA 3ISPA 3BOQA 5L3BA 3K0LA 5DCFA 4ESJA 4ZYEA 4DNCA 4NQWA 1ZREA 2IP2A 1ZARA 1HW5A 2HR3A 3E5XA 3ZMUA 4G6QA 1P4WA 3P9CA 1PUEE 3T1BA 1XSXA 4G94A 1BIAA 3SXYA 3EYIA 1R36A 3T8TA 3R6SA 3M8EA 3MWMA 1Z6RA 4OINF 1YLFA 2IT0A 3V7SA 2KRFA 2QZ8A 4WF2A 5K5QA 4EGZA 3LSTA 1MKMA 2IVMA 5KK1A 2YPRA 5CLSA 1ZLJA 1XGNA 3ZP5A 1TW3A 2STTA 4TV7A 2VT2A 1H9GA 3GFLA 2HWVA 4A6DA 1O3SA 4BH9A 4EJVA 2Z5UA 3FXRA 4LJZF 1BJAA 1YIOA 2BV6A 1KA8A 4EM2A 1T6SA 1YW8A 4LK0F 3E6CC 3SZTA 2W57A 3BZ6A 4RAYA 4KMFA 1ZH5A 1K78A 3ZPLA 1FX7A 1IN6A 2DBBA 3KP4A 2A68F 1KU9A 2YR2A 2IJLA 4CO8A 1XCVA 3HHHA 3WG9A 4HF1A 1I1GA 2O0YA 4CXFA 4HZFA 2EB7A 2WTEA 4GYIA 3GWZA 4S05A 1F1ZA 1NHAA 3I0TA 4A0YA 3EDPA 2PFBA 1SMYF 5LGTA 4LFUA 4OU0A 3HHGA 2IA1A 1KYZA 1LEAA 4O6JA 1P4AA 3WTWC 2HTJA 2HKXA 2XAQA 1RIOH 5LHGA 2KJCA 1FT9A 2A6EF 1Z91A 2XIGA 2ZCWA 1T0FA 3GFJA 2F5CA 1D8KA 3QP6A 2IRFG 4KIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MH2 A;  4RGS A;  3FZV A;  1TQI A;  1LEB A;  3JW4 A;  3NQO A;  4XLN F;  1QZZ A;  2Q2E A;  3TOB A;  3ZMD A;  1I5Z A;  1O57 A;  1T39 A;  4CYD A;  2OA4 A;  1XMK A;  4I02 A;  4LG0 B;  3ZN0 A;  3IC7 A;  5FB2 A;  1DPU A;  2XRO A;  4KIB A;  1IXC A;  2H6B A;  2VT3 A;  5L3F A;  2QLZ A;  1KU2 A;  4KA4 A;  3BPV A;  2QM3 A;  1EV7 A;  4HV6 A;  1R1U A;  1ULY A;  3EYY A;  1E2X A;  1FBQ A;  3ECH A;  2NYX A;  3FMQ A;  3FWE A;  2BYV E;  4BNC A;  5ERI A;  1HST A;  2PN6 A;  3WGH A;  3TO9 A;  4ETS A;  2P6T A;  1J0R A;  2RV8 A;  3V8J A;  3O6B B;  1Y0U A;  2E1N A;  1QO0 D;  2HKO A;  4M74 A;  4I09 A;  3ABU A;  1L0O C;  3KFW X;  2HTS A;  1B59 A;  1YG2 A;  2OAZ A;  1WWX A;  2ZO4 A;  3OOP A;  4HF0 A;  2XKP A;  1O3T A;  3COA C;  3VEP A;  5H6R A;  3TO6 A;  4PCQ A;  4CHU A;  4G9Y A;  3GZ6 A;  2WWY A;  1ZGJ A;  4YFK F;  3BDD A;  3FMS A;  2RKH A;  1DUX C;  5H20 A;  2O3F A;  1LDJ A;  2M87 A;  2LNB A;  1Z7U A;  1UFM A;  1XN7 A;  2VOO A;  1U5T A;  4Y17 A;  2HZT A;  1CF7 A;  4F7Z A;  4G7Z F;  1YTY A;  4MQV A;  3BJ6 A;  3DKW A;  4UUV A;  4U0Y A;  3F22 A;  3IWF A;  3B73 A;  3LA2 A;  2EFN A;  3F3X A;  2UZK A;  1FOK A;  1ZGA A;  4L9N A;  4ON0 A;  2MC3 A;  3J7A O;  3MEX A;  4EV0 A;  2PMU A;  3QPH A;  1XDS A;  1MDM A;  1AOY A;  3BP8 A;  2HYG D;  3M7G A;  2KIM A;  4JK1 X;  5LHH A;  1FP2 A;  1KYW A;  3K69 A;  4IHS A;  4MHG A;  1K78 B;  2PEX A;  1J9I A;  5D8K B;  2PG4 A;  4B8X A;  1WQ2 A;  4EGY A;  3RDI A;  1OYY A;  3ELK A;  1XSD A;  3M9A A;  2W25 A;  2Z9O A;  3MZY A;  3I59 B;  2D45 A;  4N9I A;  2W24 A;  4NHJ A;  3ECO A;  1K7A A;  4JBA A;  1D5V A;  4O3M A;  2Z33 A;  1TW2 A;  3BJO A;  1BC8 C;  5JR3 A;  1O3R A;  3KLO A;  2JPB A;  3SFZ A;  5JFR A;  3WGI A;  4WXC A;  4AD9 A;  1REP C;  1DDN A;  2FBK A;  3E97 A;  4NB5 A;  5E18 F;  3Q5F A;  3WTX C;  2R7D A;  2W84 A;  1LDK B;  5CVI A;  2CQK A;  1KU7 A;  2NS0 A;  4UVA A;  1JGS A;  3RJP A;  1RI7 A;  1U2W A;  1ZYR F;  3FXU A;  3ROU A;  3RYR A;  2ZXJ A;  2CWE A;  1QZY A;  2OU2 A;  2ZNY A;  4ESF A;  2CSO A;  1HW2 A;  4U88 A;  1GHC A;  1XD7 A;  5LRR A;  4IXA A;  1P4X A;  1UHW A;  2VOP A;  3KP3 A;  2FEZ A;  5D4S A;  1IN8 A;  3LFK A;  4U7B A;  1EH8 A;  5BPD A;  1O7F A;  2VC0 A;  1FZP B;  5LEJ A;  2E7X A;  1B9N A;  1R1V A;  1CGP A;  2VBX A;  2V1X A;  3ZN1 A;  1B9M A;  3K9T A;  2QUF A;  1QGP A;  3GF2 A;  1BBY A;  3BJA A;  4I0A A;  5TRD A;  2BEO A;  2HFH A;  1OPC A;  3QOP A;  5LLQ A;  2XVC A;  5J8C A;  4IRG A;  1Z05 A;  4KIC A;  3P7N A;  4G8X A;  1XCB A;  2Z3Y A;  4M72 A;  1K79 A;  1UST A;  2K4J A;  1S7O A;  4M73 A;  2DK5 A;  1F5T A;  1I27 A;  3OV8 A;  4GXO A;  3GEZ A;  3KP7 A;  2C6Y A;  5LBQ A;  5DCM B;  5E8G A;  1SMT A;  2DU9 A;  1SD4 A;  5IT3 A;  3CUO A;  2STW A;  2HDC A;  2Z99 A;  2UXX A;  3PQJ A;  2R3S A;  4ZYG A;  3VFZ A;  3WTS C;  4EJT A;  1W5T A;  4UVB A;  1T38 A;  4HA8 A;  2CW0 F;  3KEO A;  3CDH A;  5HDK A;  3BY6 A;  2PI0 A;  4WCG A;  3CO6 C;  1I1S A;  1H0M A;  2Y0M A;  1AWC A;  3WGG A;  2DPD A;  4UV9 A;  2J5P A;  2JT1 A;  1QBJ A;  1WRJ A;  1BIB A;  2VBY A;  5DYM A;  3LAP A;  5L3E A;  5ILU A;  2QQ9 A;  2M30 A;  5L3D A;  4CGZ A;  1YFH A;  4M9S A;  2ZFW A;  2L54 A;  2V1D A;  3O2P E;  3R61 A;  4LG0 A;  5DV5 A;  2VN2 A;  3MQ0 A;  2AS5 F;  2FRH A;  1DPR A;  3LQQ A;  3HOT A;  2FML A;  1CF7 B;  3MCZ A;  1WI9 A;  3F6V A;  1BI0 A;  4E70 A;  3MFK A;  5E17 F;  3G3Z A;  5BQT A;  2M45 A;  4EJO A;  4ESB A;  2P7V B;  1KQ8 A;  2DQL A;  2UWM A;  1F9N A;  1P2F A;  5HS9 A;  2MLK A;  2MH9 A;  1R5H A;  2VON A;  2DAO A;  4ZYH A;  4OMY A;  2V9V A;  4IHT A;  4GYG A;  4CDG A;  3WTV C;  4MQ9 F;  3ZMV A;  5LRS A;  4Q5S F;  2DTR A;  1IW7 F;  1XSV A;  3GW2 A;  3FX3 A;  3KCC A;  1MZB A;  2FBI A;  2HOE A;  2LF7 A;  4JQF A;  3LA7 A;  1MJB A;  4KIF A;  4IRH A;  2YX7 A;  3KP2 A;  2ZBK A;  1OYW A;  1TLH B;  4AIJ A;  1P92 A;  4PZJ A;  5AON A;  2FXA A;  4IJA A;  1R7J A;  1R1T A;  4BAY A;  3QP5 A;  1E17 A;  1Z6T A;  1Q1H A;  1R5G A;  6PAX A;  3SHF A;  5F64 A;  3V7R A;  4RGX A;  5BOX A;  4L0Y B;  5IT9 K;  1FYK A;  2DFI A;  2GQQ A;  4YII A;  1TBX A;  1KQ0 A;  2XGX A;  2GXG A;  1TNT A;  1J75 A;  2RNJ A;  3RKX A;  2GA1 A;  5CVU A;  2O61 A;  1YS7 A;  3QPT A;  3R0A A;  2BBY A;  4KT5 C;  4A5N A;  4XLP F;  5E20 A;  3S2W A;  2DI3 A;  1HKT A;  2HGC A;  4HDV A;  3FF5 A;  4R8H A;  1TQP A;  2F5E A;  3WU0 A;  3ZMZ A;  3WTZ A;  2M8E A;  1P6R A;  3EUH A;  1S29 A;  4XBF A;  1LNW A;  1R58 A;  1U5T B;  2F5F A;  2HQN A;  1RUO A;  2L01 A;  4GCV A;  1BN5 A;  4AWX B;  5JHU A;  3HSF A;  5JVT A;  1HSJ A;  3ZMT A;  3HTU A;  2D1H A;  4ENJ A;  2VE8 A;  4PGG A;  4I7H A;  1SFU A;  2Q0O A;  2VXZ A;  1F4K A;  2IW5 A;  4UVC A;  5ICE A;  2CO5 A;  4U7D A;  3L7W A;  5D8L B;  1LDD A;  3CO7 C;  5DUI A;  1PP7 U;  4ASN A;  2CG4 A;  3I58 A;  5J8F A;  5DDG A;  1IZ1 A;  2EFQ A;  4Q47 A;  4HQM A;  4HOB A;  3RPQ A;  1ZRD A;  4IVN A;  3Q9S A;  2F5D A;  3T5X A;  1W5S A;  4L18 B;  3F8M A;  4LD5 A;  2PQ8 A;  3C3W A;  2ZJ2 A;  3RI4 A;  2KJB A;  3L2C A;  3G73 A;  3EQL F;  3U9G A;  4BQA A;  1FBU A;  4LLG F;  2DW4 A;  4A0X A;  1U3E M;  3TKY A;  5D5V B;  3K1P A;  1ZG5 A;  2XRN A;  3FMR A;  2P5V A;  3M8F A;  1MDM B;  2ELH A;  2TDX A;  3L00 A;  1IRG A;  2FNA A;  3HYI A;  5HVQ C;  4HW0 A;  3U1D A;  2FSW A;  3GFI A;  1XGS A;  5CVJ A;  4B09 A;  3EET A;  4MGR A;  5CYV A;  3HUG A;  5FO5 A;  4FX0 A;  4LK1 F;  5F1R A;  5DUK A;  4BYY A;  2RC4 A;  4EM1 A;  3GZ5 A;  4OIR F;  3HSE A;  3JSO A;  4N9H A;  4YIF A;  2JPC A;  1LQ1 A;  2FU4 A;  1W7P A;  1BC7 C;  4XRF A;  2DLL A;  5EEH A;  3ERE D;  1EH7 A;  2NNY A;  1G4D A;  2EV0 A;  2XUB A;  2VE9 A;  2A5Y B;  4K2E A;  2L4A A;  2M5W A;  1GXQ A;  3D0S A;  4HQE A;  4M9Z A;  2DPU A;  3C18 A;  3CTA A;  2EV5 A;  2OZU A;  3HTS B;  3DFG A;  4M9X A;  3N4M A;  4KDP A;  1OR7 A;  4RB3 C;  2V6C A;  2QBY A;  1HXD A;  4P9F A;  2E1C A;  3REO A;  2P5L C;  3TOA A;  4P55 A;  2MA3 A;  2PJP A;  4N0B A;  3MAJ A;  2GA2 A;  1ZG1 A;  3WTU C;  1J2X A;  3IWZ A;  5ED4 A;  3QAH A;  2LKP A;  4QLC U;  1BI1 A;  2MBF A;  2ISY A;  1FC3 A;  1TTY A;  1JXS A;  3V8L A;  5LGU A;  4A12 A;  3KEQ A;  3F8B A;  4ENN A;  2IPQ X;  1IXR C;  3R4K A;  3U2R A;  2JZY A;  3I64 A;  3WOD F;  1ON2 A;  4ENM A;  4EVI A;  4WWC A;  2K27 A;  3F8N A;  3F23 A;  2ZNZ A;  5HDG A;  5H6Q A;  3LQR A;  4XSZ F;  5E1X A;  3KZZ A;  4YG2 F;  5E1Z B;  5FFX A;  4MTE A;  2VC1 A;  3D5L A;  2XAF A;  1G3S A;  1XB4 A;  3WU1 B;  2EA4 A;  1MGT A;  1OYI A;  4P9U A;  4HBL A;  1ZRC A;  2BE5 F;  1OMI A;  2OZ6 A;  1GVJ A;  1UHM A;  2V79 A;  3GUD A;  4KMU X;  1K6O A;  3LA3 A;  2ISZ A;  1D3Y A;  1GXP A;  3F72 A;  1FY7 A;  4KFC A;  2VBZ A;  1HKS A;  2EFW A;  1BM9 A;  2HEO A;  1OKR A;  2A69 F;  2O8X A;  4M6X A;  3HRT A;  3JAM Z;  3E5U A;  1FPQ A;  4A0Z A;  2JTV A;  2KIF A;  1LJ9 A;  2R7F A;  4I01 A;  2G7H A;  2L4M A;  3I5U A;  1U8R A;  2WV0 A;  3K2Z A;  1JHH A;  2Y75 A;  2FNP A;  4EQQ A;  2XHK A;  4FHT A;  3RKY A;  3H92 A;  3L9F A;  4OIO F;  3JSP A;  3TO7 A;  3I53 A;  3CLO A;  3RIR A;  3VOD A;  1RNL A;  5F6F A;  5DD4 A;  3TDZ C;  3JTG A;  3SZP A;  3VOE A;  1R22 A;  2D1V A;  5E8I A;  4ENK A;  2FBH A;  2O03 A;  3CUQ A;  3F21 A;  2DK8 A;  4LLN A;  1U6G A;  3WE2 A;  4OIQ F;  1I6X A;  4D0P A;  4BXU A;  1USS A;  1QQI A;  2QYO A;  1G3T A;  5HLH A;  2ZME A;  2NAZ A;  2CYY A;  4BHP A;  3O3K A;  4IPA A;  1IAW A;  3QU6 A;  2FA5 A;  1U78 A;  1ZG3 A;  4KUM A;  2GIV A;  3KP6 A;  3I59 A;  2CFX A;  1C0W A;  5AIQ A;  4MEX F;  1BI2 A;  2YSR A;  4EJU A;  2KIU A;  1QPM A;  5DCM A;  2L3D A;  1A04 A;  4M71 A;  4LLL A;  2OD5 A;  4BHC A;  3ZQ7 A;  1KU3 A;  4P5O A;  4P96 A;  3ML6 A;  2P7C B;  1IUY A;  4WXH A;  2MD5 A;  4Z2Y A;  1QNT A;  1ZHF A;  4UNO A;  5BMZ A;  3DPT A;  2XAJ A;  3J80 Z;  2X4H A;  2EK5 A;  3TGN A;  1YS6 A;  1BI3 A;  2XAG A;  1IN4 A;  3C7J A;  2FMY A;  4I98 B;  3FHZ A;  2H09 A;  1SD7 A;  4RS8 A;  2P8T A;  2ZME B;  3SQN A;  4Q48 A;  4MTD A;  3J81 Z;  3F8C A;  4Y15 A;  1SD5 A;  3WTY C;  2Q8K A;  3LAJ A;  3F6O A;  2A6H F;  4KN7 X;  4MNU A;  1WSU A;  2FQ3 A;  4I2O A;  1HKQ A;  2QQA A;  4HF2 A;  1G6N A;  1S8N A;  2ESH A;  4LMY A;  3R0J A;  1SD6 A;  1TNS A;  2NRA C;  1YO5 C;  1JE8 A;  3I4P A;  4ZZL A;  5AIP A;  3ULQ B;  2EWN A;  5CVV A;  2P6S A;  1LVA A;  1LB2 A;  1U5T C;  4UHT A;  2EFO A;  4PGH A;  2WC2 A;  4IRI A;  3GLX A;  5FFZ A;  4G7O F;  3W6K B;  3BWG A;  1ON1 A;  4ZH4 F;  1MJ9 A;  5D5X B;  2VBW A;  2FOK A;  2A61 A;  2NNN A;  2OQR A;  2RQP A;  2DQR A;  1ONV A;  3I54 A;  3J80 K;  3IKT A;  3H3Z A;  4R1H A;  3GFM A;  1STZ A;  4I0B A;  4FT8 A;  1ZAO A;  4AIK A;  3F8F A;  2HS5 A;  2W85 A;  3KP5 A;  5DD8 A;  2LF8 A;  5TJJ A;  5BS6 A;  2XAH A;  2COM A;  4WXD A;  2G9W A;  1HBX G;  4HDU A;  3VB2 A;  2JRT A;  4LGW A;  2P4W A;  2LSO A;  4KNY A;  3P9I A;  3V8K A;  2H94 A;  2V1U A;  2B0L A;  2QVO A;  3RYP A;  4BHB A;  4WK8 F;  1V4R A;  5IT9 Z;  2QWW A;  1O7L A;  1ZLK A;  3HOS A;  1XGM A;  1PP8 F;  2EA2 A;  1IXS B;  4S04 A;  2P5K A;  4IF4 A;  2QBY B;  1HQC A;  3DF8 A;  3IHU A;  2XV4 S;  4RGR A;  2EFP A;  4YFN F;  2ZKZ A;  1H9T A;  3WE3 A;  5HDN A;  3K1M A;  3GVA A;  5EEG A;  2K86 A;  2MLG A;  2IA0 A;  3TDU C;  4XSX F;  1FSH A;  3KE2 A;  4HLX A;  3K1N A;  1D8J A;  4L0Z B;  4HYE A;  4AIH A;  4A2U A;  5JI6 A;  3T8R A;  1DP7 P;  2QEN A;  1MJA A;  2XAS A;  2QQB A;  3H3U A;  2PBI A;  3KET A;  1B4A A;  4AVP A;  3AAF A;  4CIC A;  5LHI A;  2ACJ A;  1J7K A;  4CZZ A;  1Z9C A;  2FF4 A;  5K5O A;  3Q9V A;  3E6D A;  3LWF A;  4U0W A;  5HLI A;  1IN7 A;  2K7L A;  2GAU A;  2PLY A;  4Q4Z F;  4UV8 A;  5D5U B;  4L9J A;  2X0L A;  3GO5 A;  5ICF A;  4L5I A;  1O3Q A;  1BOA A;  4EMS A;  2RDP A;  1J5Y A;  1XMA A;  1JHF A;  4GGG A;  4RAZ A;  3GYH X;  1T2K A;  3GXO A;  2FE3 A;  3DPL C;  5LEK A;  2E7W A;  4RB1 A;  4G7H F;  5E1W A;  1W7P D;  5D4R A;  2DO7 A;  1YQA A;  1G3Y A;  5HLG A;  3QRF F;  4QWQ A;  2O6G E;  5L3G A;  4FX4 A;  2BGC A;  3FXQ A;  3HSR A;  2UXN A;  2H6C A;  4HV5 A;  1KGS A;  3CUQ C;  3BPX A;  1S3J A;  2ADU A;  5ILS A;  2RVC A;  3MZH A;  4L5J A;  2DT5 A;  1XDU A;  4KN4 X;  2AXL A;  4L9T A;  4UXN A;  1FSE A;  2D2W A;  3IRR A;  3BRO A;  5K1Y A;  1EH6 A;  1B1B A;  4A5M A;  3JTH A;  1YW7 A;  3B02 A;  5J6X A;  1ZRF A;  5FLX K;  3DEU A;  3IKV A;  2RN7 A;  2EJR A;  3CJN A;  3IL2 A;  3V4G A;  1ODD A;  2A3S A;  1TQM A;  1FYM A;  2LDU A;  4RB2 C;  3NRV A;  3GX4 X;  1RUN A;  4LB5 A;  4RGU A;  1FYL A;  2VOD A;  1HW1 A;  4HX8 A;  3T0Y A;  1Z1D A;  4KYW A;  2HYF A;  1FP1 D;  3HRM A;  3FM5 A;  3J81 K;  1YYV A;  4RB0 A;  3RKW A;  5DEQ A;  4R79 A;  1FBS A;  5D6E A;  1SAX A;  3CUQ B;  2G7U A;  1G3W A;  5K5R A;  1W4M A;  4ZYD A;  1FWZ A;  3E6B A;  5CVR A;  3M1E A;  1SFE A;  2K4B A;  3W6J B;  4OOI A;  1YW9 A;  1XGO A;  2ESN A;  3TQN A;  3DXJ F;  3DV8 A;  3WTT C;  2H27 A;  4Y13 A;  1ZN2 A;  1W7P B;  1B6A A;  1R00 A;  3KLN A;  5FLX Z;  5HOO A;  2Y48 A;  2XKO A;  5A2Q K;  4WX9 A;  1RZ4 A;  1J59 A;  3NEU A;  5CJ9 A;  1V3F A;  4LB6 B;  5ICC A;  1IF1 A;  2J5O A;  3P9K A;  4L9V A;  3PQK A;  3E5Q A;  2JSC A;  4PDK A;  2YU3 A;  2GWR A;  5FD6 A;  4HAM A;  5ICG A;  1R23 A;  1S6L A;  2GZW A;  4G6D A;  4HX4 A;  2M1B A;  5FD5 A;  5HS7 A;  1PDN C;  5HS8 A;  2F2E A;  1T98 A;  3QU3 A;  4M6Y A;  1S7A A;  3C1D A;  1X3U A;  4HX7 A;  1FNN A;  3FM3 A;  3DQV C;  4OIP F;  1UB9 A;  3ABT A;  1VTN C;  5FGM A;  3E6M A;  3L09 A;  4OMZ A;  3DP7 A;  2OBP A;  3RTR A;  2PMH A;  2KKO A;  4U0V A;  3KZY A;  3RPU A;  4GO1 A;  4HLY A;  2EV6 A;  5ILV A;  2L02 A;  5A2Q Z;  2GXB A;  2RGV A;  3IRQ A;  4H0E A;  4A6E A;  1WKM A;  3HRS A;  3PFI A;  1KQ9 A;  3JAM K;  2YX4 A;  4EJW A;  3E3V A;  5L3C A;  3N97 A;  4YFX F;  5LGN A;  3ZMS A;  2K02 A;  4DQ2 A;  2ETH A;  4EM0 B;  5BPI A;  2CGP A;  5D5W B;  2HQR A;  3R60 A;  3HIF A;  1SFX A;  1IRF A;  3V7C A;  4MEY F;  5D6F A;  3I71 A;  1FLI A;  1L3L A;  2IA2 A;  4ZZD A;  2A07 F;  1IN5 A;  2OQG A;  3HRU A;  1MD0 A;  4O5V A;  1UCR A;  5KVR A;  3ISP A;  3BOQ A;  5L3B A;  3K0L A;  5DCF A;  4ESJ A;  4ZYE A;  4DNC A;  4NQW A;  1ZRE A;  2IP2 A;  1ZAR A;  1HW5 A;  2HR3 A;  3E5X A;  3ZMU A;  4G6Q A;  1P4W A;  3P9C A;  1PUE E;  3T1B A;  1XSX A;  4G94 A;  1BIA A;  3SXY A;  3EYI A;  1R36 A;  3T8T A;  3R6S A;  3M8E A;  3MWM A;  1Z6R A;  4OIN F;  1YLF A;  2IT0 A;  3V7S A;  2KRF A;  2QZ8 A;  4WF2 A;  5K5Q A;  4EGZ A;  3LST A;  1MKM A;  2IVM A;  5KK1 A;  2YPR A;  5CLS A;  1ZLJ A;  1XGN A;  3ZP5 A;  1TW3 A;  2STT A;  4TV7 A;  2VT2 A;  1H9G A;  3GFL A;  2HWV A;  4A6D A;  1O3S A;  4BH9 A;  4EJV A;  2Z5U A;  3FXR A;  4LJZ F;  1BJA A;  1YIO A;  2BV6 A;  1KA8 A;  4EM2 A;  1T6S A;  1YW8 A;  4LK0 F;  3E6C C;  3SZT A;  2W57 A;  3BZ6 A;  4RAY A;  4KMF A;  1ZH5 A;  1K78 A;  3ZPL A;  1FX7 A;  1IN6 A;  2DBB A;  3KP4 A;  2A68 F;  1KU9 A;  2YR2 A;  2IJL A;  4CO8 A;  1XCV A;  3HHH A;  3WG9 A;  4HF1 A;  1I1G A;  2O0Y A;  4CXF A;  4HZF A;  2EB7 A;  2WTE A;  4GYI A;  3GWZ A;  4S05 A;  1F1Z A;  1NHA A;  3I0T A;  4A0Y A;  3EDP A;  2PFB A;  1SMY F;  5LGT A;  4LFU A;  4OU0 A;  3HHG A;  2IA1 A;  1KYZ A;  1LEA A;  4O6J A;  1P4A A;  3WTW C;  2HTJ A;  2HKX A;  2XAQ A;  1RIO H;  5LHG A;  2KJC A;  1FT9 A;  2A6E F;  1Z91 A;  2XIG A;  2ZCW A;  1T0F A;  3GFJ A;  2F5C A;  1D8K A;  3QP6 A;  2IRF G;  4KIG A; 
#chains in the Genus database with same CATH topology
 2MH2 A;  4RGS A;  2NS7 A;  1B8I A;  3FZV A;  4W1U A;  1TQI A;  2HPM A;  3S2D J;  3QYB A;  2MG4 A;  1LEB A;  2R7U A;  3JW4 A;  3K70 C;  3NQO A;  2LRD A;  3L2W A;  3FXM A;  4XLN F;  5F0C A;  1QZZ A;  1X1A A;  3FBN B;  2VJ4 A;  1R71 A;  2Q2E A;  3TOB A;  3ZMD A;  1I5Z A;  2VLA A;  1SEU A;  1O57 A;  3LSK A;  1T39 A;  2Z16 A;  4CYD A;  3WU2 C;  5IYD J;  2OA4 A;  1XMK A;  4I02 A;  3TL4 X;  4LG0 B;  3ZN0 A;  1O4X A;  3KX2 A;  4XKC A;  1T8I A;  3DKX A;  3AL0 C;  2PJR B;  1P9Q C;  3G1M A;  1PUF B;  3IC7 A;  5FB2 A;  1DPU A;  3BG6 A;  4X0G A;  2XRO A;  1FTZ A;  2HDW A;  4KIB A;  3GTQ J;  2W7N A;  1HF0 A;  1IXC A;  4XOP A;  2FX0 A;  2L9R A;  2WAD A;  2H6B A;  2VT3 A;  2IAI A;  2X51 A;  3K4B A;  4KT6 A;  5L3F A;  2QLZ A;  3KZI C;  4XOT A;  1KU2 A;  4KA4 A;  3BTI A;  3BPV A;  1DU6 A;  2QM3 A;  1EV7 A;  2G0E A;  1R1U A;  1ULY A;  2K9L A;  2XGD A;  4HV6 A;  3CCV I;  1BJZ A;  3EYY A;  1E2X A;  1FBQ A;  4J19 A;  3ECH A;  1G59 A;  2NYX A;  1PVE A;  3BCA A;  3DBR B;  3FMQ A;  3FWE A;  2BYV E;  5FKK A;  4BNC A;  2R5Z A;  3SZG A;  2K5C A;  5ERI A;  1YOV B;  4OAY A;  1XG1 A;  2R92 J;  3HEF A;  5KCM A;  1VQL I;  1HST A;  2AHQ A;  2PN6 A;  2LRE A;  3WGH A;  1FOW A;  4XLE A;  4ZJZ A;  3JRH A;  3TO9 A;  4ETS A;  5CPR B;  2P6T A;  3GTJ J;  4BJ6 C;  2R5Y A;  1FIA A;  2NVY J;  4G6T B;  1J0R A;  2E2I J;  1XPX A;  2RV8 A;  2DA7 A;  3V8J A;  4IOA F;  4L5E A;  3GTK J;  3O6B B;  1Y0U A;  1JUS A;  2E1N A;  3PNT A;  3V42 A;  1QO0 D;  2F5V A;  2HKO A;  4M74 A;  4XLC A;  3NAU A;  4I09 A;  2DMQ A;  3ABU A;  1L0O C;  3KFW X;  2HTS A;  3W2W A;  4A3C J;  1B59 A;  1YG2 A;  2OAZ A;  1WWX A;  2ZO4 A;  3OOP A;  4HF0 A;  1DP3 A;  1NK3 P;  2XKP A;  1O3T A;  4V2F A;  3CDI A;  2E36 A;  3TP3 A;  3COA C;  3VEP A;  2I10 A;  5H6R A;  3TO6 A;  4PCQ A;  4CHU A;  4G9Y A;  5BNG A;  3GZ6 A;  5E79 C;  2PX9 A;  2WWY A;  2DFF A;  1ZGJ A;  4YFK F;  5FLM J;  3BDD A;  3FMS A;  2BVM A;  2KRC A;  2RKH A;  1DUX C;  5H20 A;  2YUS A;  2O3F A;  1LDJ A;  3CJR B;  4HST A;  2L7F P;  2M87 A;  4PJ0 C;  2MFZ A;  1UJ8 A;  4G12 A;  3SJM A;  2K3P A;  2LNB A;  3HKZ A;  1Z7U A;  2UV1 A;  3HKZ N;  1UFM A;  3OYE A;  1XN7 A;  2JA5 J;  2DXI A;  2VOO A;  1U5T A;  4Y17 A;  2HZT A;  1CF7 A;  4IHX A;  4BJT A;  4X6A J;  4F7Z A;  4G7Z F;  1YTY A;  4MQV A;  3BJ6 A;  3DKW A;  4X1E A;  4XOR A;  3IH3 A;  1EA3 A;  2M0M A;  4BY7 J;  4UUV A;  4DW6 A;  2FOW A;  4U0Y A;  3F22 A;  3IWF A;  2V1N A;  3B73 A;  3LA2 A;  2EFN A;  4B44 A;  2K9M A;  3F3X A;  4M3B A;  3UKG A;  2UZK A;  3K6G A;  1FOK A;  1D0Z A;  1ZGA A;  3S1R J;  4L9N A;  4ON0 A;  2MC3 A;  1OCC H;  4BXF A;  3J7A O;  3MEX A;  1WI3 A;  3S93 A;  1YX3 A;  1ETX A;  4EV0 A;  1YJW I;  2PMU A;  3QPH A;  3GBG A;  1XDS A;  1MDM A;  4A3L J;  2DA4 A;  5EGO A;  1AOY A;  3BP8 A;  2HYG D;  2ZJP F;  4PFP A;  3ABM H;  3BR6 A;  3M7G A;  2P0W A;  2BY3 A;  2KIM A;  4CCM A;  4JK1 X;  5LHH A;  1FP2 A;  1KYW A;  3VSL A;  4HG2 A;  3K69 A;  4IHS A;  4MHG A;  5C3E J;  1K78 B;  2PEX A;  1J9I A;  4XLF A;  5D8K B;  2PG4 A;  1QVT A;  4B8X A;  3CCM I;  1WQ2 A;  2CW7 A;  3RSN A;  4EGY A;  3RDI A;  1OYY A;  3ELK A;  2V4J C;  1XSD A;  4XLH A;  3M9A A;  2DFH A;  2W25 A;  2Z9O A;  5IPA A;  2WAF A;  4AU7 A;  3MZY A;  3I59 B;  5CKT A;  2D45 A;  2CQX A;  2JA8 J;  5J1R A;  4N9I A;  1G8X A;  2W24 A;  4NHJ A;  4C3I J;  1DU0 A;  3CJQ B;  1TWG J;  3ECO A;  1NG7 A;  3L2Q A;  1K7A A;  4JBA A;  1W1W E;  1D5V A;  4O3M A;  2Z33 A;  1TW2 A;  1LE8 A;  3FDY A;  3BJO A;  3FK6 A;  1BC8 C;  1FJL A;  4BQO A;  1X1P A;  5JR3 A;  2ECC A;  1O3R A;  4DOZ A;  3KLO A;  2BXY A;  2JPB A;  3QPS A;  3SFZ A;  5JFR A;  3WGI A;  5J4V A;  2O8K A;  1LFB A;  3W2V A;  5EG0 B;  2LTP A;  4WXC A;  4AD9 A;  2DA2 A;  2CU7 A;  1DDN A;  1REP C;  2R7V A;  4MFD A;  2FBK A;  3E97 A;  4NB5 A;  5E18 F;  4QIW N;  3CP2 A;  3Q5F A;  3WTX C;  2R7D A;  2W84 A;  1R4N B;  2HVQ A;  1LDK B;  5CVI A;  2CQK A;  1U9O A;  2ZXI A;  1KU7 A;  1OCO H;  1B8I B;  1OFC X;  2NS0 A;  4MLO A;  3NWS A;  3FXK A;  4UVA A;  5M3M J;  4NC7 A;  1F36 A;  1JGS A;  3RJP A;  1GLN A;  1RI7 A;  5H2F C;  1U2W A;  2XF7 A;  5F27 A;  1ZYR F;  3FXU A;  3S1N J;  3ROU A;  4BL0 B;  3RYR A;  3K4K A;  2ZXJ A;  2LK2 A;  2CWE A;  2XPU A;  1QZY A;  1QU3 A;  2OU2 A;  1LPQ A;  1RR8 C;  3JRA A;  5KHD A;  2ZNY A;  1JJ6 C;  2F4M B;  4ESF A;  3RKQ A;  2CSO A;  1HW2 A;  2XGC A;  3OWT A;  4U88 A;  1GHC A;  2JA7 J;  3BG7 A;  1XD7 A;  5LRR A;  4IXA A;  2LD5 A;  3AFH A;  3LSR A;  1P4X A;  1UG2 A;  1JUM A;  3KEY A;  3ZQQ A;  2R7X A;  1UHW A;  1X2M A;  1ZKG A;  2VOP A;  2ZFU A;  3KP3 A;  3HOX J;  2FEZ A;  3OYB A;  5D4S A;  3DTI A;  1IN8 A;  3FKJ A;  3VYT B;  3LFK A;  2VJ5 A;  1ETY A;  3ZQC A;  3GTO J;  4U7B A;  2W82 A;  3ZCO A;  3PO3 J;  1EH8 A;  4DZP A;  5BPD A;  2L7Z A;  4C3J J;  1O7F A;  2VC0 A;  5FKN A;  4XRS G;  1FZP B;  2W1O A;  5LEJ A;  2E7X A;  1B9N A;  1R1V A;  1CGP A;  2DFE A;  2EH3 A;  1WJC A;  2VBX A;  2V1X A;  3ZN1 A;  4A3I J;  1B9M A;  3K9T A;  2HOS A;  5TGT A;  4BS9 A;  2E2J J;  2GM4 A;  1IDY A;  2QUF A;  1QGP A;  1D0X A;  3GF2 A;  3JCU C;  2LBF A;  5J47 A;  1BBY A;  1D0Y A;  4JP0 A;  3BJA A;  3RCO A;  4I0A A;  5TRD A;  2BEO A;  2HFH A;  3K4M A;  2OC6 A;  2DT6 A;  1OPC A;  4II2 A;  4M3D A;  3TMO A;  3HOZ J;  2OTJ I;  3QOP A;  5LLQ A;  5E3N A;  2XVC A;  5J8C A;  3O8H A;  1IDZ A;  2VKH A;  4IRG A;  4BE2 A;  1Z05 A;  4KIC A;  4BE1 A;  3P7N A;  4G8X A;  2HOA A;  1VQK I;  4RMN A;  1XCB A;  1Q1V A;  2Z3Y A;  4M72 A;  2MSY A;  1K79 A;  1UST A;  2M4K A;  2EZL A;  2K4J A;  3MKW B;  5B1B H;  4AM3 A;  4E4H A;  1S7O A;  3H5N A;  3MN2 A;  4MIM A;  2Y9Z A;  1SC7 A;  2GLO A;  3OYI A;  3MD2 A;  4M73 A;  2CFO A;  5JLX A;  4CCL A;  2DK5 A;  1Z7L A;  2X1C A;  1F5T A;  1IG7 A;  1I27 A;  4BBS J;  3OV8 A;  4Y52 J;  4GXO A;  3GEZ A;  3KP7 A;  2C6Y A;  5LBQ A;  2E71 A;  5DCM B;  5E8G A;  1SMT A;  5FJ8 J;  2DU9 A;  2BVL A;  1SD4 A;  2ELJ A;  5IT3 A;  3CUO A;  3HM5 A;  1K4S A;  3MKY B;  1BR2 A;  2STW A;  2HDC A;  4IKF A;  3G4S I;  2DMT A;  2V26 A;  3FIW A;  2Z99 A;  2UXX A;  4XKB A;  1RES A;  3PQJ A;  2R3S A;  4ZDP A;  4ZYG A;  3VFZ A;  2L7K A;  4IHW A;  2DT7 B;  3WTS C;  1OLT A;  5GP9 A;  2PMZ N;  4EJT A;  3ZQG A;  1W5T A;  4UVB A;  1T38 A;  4HA8 A;  5EGO B;  3H0D A;  2CW0 F;  3KEO A;  3CDH A;  2EPF A;  3PNV A;  3RZO J;  2BHY A;  4BGD A;  4ZC3 A;  2W48 A;  3E7L A;  1Y8Q B;  3K2A A;  5M5X J;  5HDK A;  3HG9 A;  5GTH C;  2LOO A;  3BY6 A;  2W00 A;  1F43 A;  2PI0 A;  4WCG A;  1JKP C;  1VQO I;  3CO6 C;  1Z21 A;  1I1S A;  1H0M A;  1ETQ A;  4CYC A;  2GIZ A;  2Y0M A;  3OR1 C;  1MW7 A;  1AWC A;  1B72 B;  2ZXW H;  3WGG A;  4YEJ A;  4UV9 A;  2DPD A;  2J5P A;  2CQ7 A;  3TW7 A;  2JT1 A;  4DGW B;  3BTJ A;  1QBJ A;  1VQN I;  2DYR H;  1WRJ A;  1BIB A;  2VBY A;  5DYM A;  2KIQ A;  3LAP A;  5L3E A;  5GAE J;  5ILU A;  2QQ9 A;  3JRD A;  1P7I A;  2M30 A;  5L3D A;  4CGZ A;  1QHH D;  3ABL H;  1YFH A;  3HOV J;  2F4O B;  3DBL B;  4M9S A;  1TWF J;  2HVR A;  2ZFW A;  2HNH A;  2L54 A;  2V1D A;  3O2P E;  3R61 A;  1MMG A;  4LG0 A;  4IQJ A;  5DV5 A;  3OYC A;  2VN2 A;  3MQ0 A;  2W4S A;  2AS5 F;  2FRH A;  1DPR A;  1RKW A;  3ESW B;  3LQQ A;  3L2V A;  3FHN A;  4A3K J;  3HOT A;  2K40 A;  1TWH J;  3ZOB A;  2QKL B;  3BT9 A;  2FJ1 A;  3KYL A;  2FML A;  2CW8 A;  1CF7 B;  4RAF A;  4UB6 C;  3MCZ A;  1WI9 A;  2NXN B;  5JLW A;  3F6V A;  1BI0 A;  4E70 A;  4NQW B;  3MFK A;  4S0H B;  5E17 F;  3G3Z A;  1K4T A;  5BQT A;  5GPA A;  2M45 A;  4EJO A;  4ESB A;  3BG5 A;  2P7V B;  1KQ8 A;  4XRM A;  1OCZ H;  2DQL A;  5HNF A;  2UWM A;  1F9N A;  2IS1 A;  1P2F A;  5HS9 A;  2MLK A;  1YI2 I;  3K4C A;  2MH9 A;  1TWA J;  1OCR H;  4ABZ A;  3OIQ A;  1R5H A;  3IAM 2;  2DAO A;  3L2U A;  2VON A;  1OCP A;  1WJF A;  4ZYH A;  4OMY A;  2VJI A;  3PJR A;  3F9K A;  2V9V A;  4FET A;  3CF5 F;  4IHT A;  1DGR M;  3OYN A;  4XKW A;  4GYG A;  4CDG A;  3C2B A;  1MH4 A;  3WTV C;  4MQ9 F;  3VWB A;  2HI3 A;  1X3Z B;  3OYL A;  3ZMV A;  2JA2 A;  5LRS A;  2XSJ C;  4Q5S F;  3PNY A;  2QSG X;  2DTR A;  3I4M J;  2OCC H;  3DLL F;  2O5R A;  2LC2 A;  1IW7 F;  3ZR8 X;  3GW2 A;  1XSV A;  3FXL A;  3FX3 A;  3KCC A;  1MZB A;  4Y4R A;  4BEH A;  2FBI A;  2HOE A;  4CCK A;  2XF5 A;  4HPQ A;  2LF7 A;  2LVS A;  4JQF A;  3LA7 A;  1WCM J;  1MJB A;  4KIF A;  3H0G J;  4IRH A;  5KAF C;  2DOD A;  2LY2 A;  2YX7 A;  3KP2 A;  2ZBK A;  5FLV A;  1OYW A;  1TLH B;  4AIJ A;  1P92 A;  4PZJ A;  2X48 A;  2KQR A;  4PJN A;  3ZQI A;  5AON A;  5FRM A;  2FXA A;  4IJA A;  1R7J A;  5KNL A;  3GTM J;  3EPZ A;  3QOD A;  4C3H J;  4C2U A;  1BW6 A;  1E3H A;  1XTA A;  2VUM J;  1X4P A;  2XPW A;  1R1T A;  4XIC A;  4BAY A;  1DGW Y;  1AHD P;  3QP5 A;  5F1J A;  1E17 A;  1Z6T A;  2XB0 X;  1Q1H A;  1R5G A;  6PAX A;  3SHF A;  1MBJ A;  5F64 A;  4F93 B;  2E34 A;  3K7A J;  3V7R A;  2VI6 A;  3H36 A;  3CCE I;  4RGX A;  3N05 A;  5BOX A;  3NAR A;  4L0Y B;  3IAS 2;  2IGN A;  2YU9 J;  5IT9 K;  3OYH A;  1FYK A;  2DFI A;  2GQQ A;  2F48 A;  3FXO A;  1N25 A;  4YII A;  1TBX A;  1KQ0 A;  4BJ5 C;  3HDD A;  2XGX A;  2GXG A;  1TNT A;  1J75 A;  2RNJ A;  3RKX A;  3J7A Y;  2EZK A;  2GA1 A;  4RM3 A;  2O9L A;  5CVU A;  4B3X A;  4RBO A;  2O61 A;  2NVU B;  1AKH B;  2CV2 A;  1MMN A;  1YS7 A;  3QPT A;  3R0A A;  4JX6 A;  3A03 A;  2BBY A;  3FK7 A;  4KT5 C;  4A5N A;  4XLP F;  3OY9 A;  2OV7 A;  3HJE A;  3JRF A;  2MGQ A;  5E20 A;  3S2W A;  2DI3 A;  2ID6 A;  1HKT A;  3QWL A;  3ASO H;  2HGC A;  4HDV A;  3FF5 A;  3VYS B;  3OYD A;  4R8H A;  2ZSI B;  4E7K A;  2MW8 A;  1CQT A;  2DA5 A;  3X2Q H;  1TQP A;  4RAG A;  5GPC A;  5DS9 A;  2WAQ N;  2ICW G;  2KHM A;  2R7T A;  2I8D A;  3LSH A;  5CQG A;  3S3O A;  1X58 A;  4E7S A;  2F5E A;  3WU0 A;  3ONQ A;  3ZMZ A;  1WJ5 A;  3H5R A;  3BC8 A;  3WTZ A;  2M8E A;  1P6R A;  3EUH A;  1S29 A;  5B3S H;  4RLQ A;  4XBF A;  1LNW A;  2EZI A;  4B4C A;  1R58 A;  1U5T B;  2F5F A;  2HQN A;  1RUO A;  1X19 A;  2E1O A;  2L01 A;  4GCV A;  2HQA A;  1IJW C;  4BY1 J;  1BN5 A;  4AWX B;  4Z6Y A;  5JHU A;  3HSF A;  5JVT A;  1HSJ A;  1FEX A;  3SEZ A;  3ZMT A;  3HTU A;  2AQF A;  2D1H A;  4ENJ A;  5E3L A;  3QQA A;  2VE8 A;  4XQF A;  4PGG A;  4F92 B;  2HQ5 A;  4I7H A;  1SFU A;  2Q0O A;  3CCL I;  2VXZ A;  2HOT A;  5IOY A;  1F4K A;  1EJ9 A;  2DDA A;  2NVQ J;  2IW5 A;  3DLA A;  4UVC A;  5ICE A;  2CUZ A;  3TBI A;  4V2G A;  2CO5 A;  1M1E B;  4U7D A;  3L7W A;  5D8L B;  1LDD A;  1ETW A;  3CO7 C;  5DUI A;  1MNE A;  1PP7 U;  4ASN A;  3S32 A;  2CG4 A;  3I58 A;  5J8F A;  3QYF A;  3CCY A;  1FIP A;  5DDG A;  2B63 J;  1APL C;  3AG3 H;  2VQH A;  4ZDO A;  1IV8 A;  1IZ1 A;  3DTE A;  4YIR X;  2EFQ A;  3LSJ A;  4Q47 A;  4BQN A;  3GCM A;  4HQM A;  4XL9 A;  3IV5 A;  2HU9 A;  4HOB A;  1BOB A;  2DOE A;  4XM3 A;  3RPQ A;  4LIU A;  1ZRD A;  3ZQL A;  2JA6 J;  4IVN A;  2HZD A;  3Q9S A;  2F5D A;  4DYQ A;  3T5X A;  1W5S A;  4L18 B;  3F8M A;  1HOM A;  4LD5 A;  2PQ8 A;  3C3W A;  1WGX A;  2ZJ2 A;  1S72 I;  3RI4 A;  1Y56 A;  3AG2 H;  2KJB A;  3L2C A;  3G73 A;  3RQI A;  3EQL F;  3U9G A;  4GFB A;  4BQA A;  1FBU A;  4LLG F;  1HC8 A;  2DW4 A;  2LBF B;  4A0X A;  1U3E M;  3TKY A;  5D5V B;  2VKE A;  3K1P A;  5C4X J;  1ZG5 A;  2XRN A;  3FMR A;  3RQ4 A;  2HDD A;  2BY1 A;  2P5V A;  3M8F A;  1VQM I;  1MDM B;  3KYC B;  3ZQF A;  4NDL A;  1WH5 A;  2ELH A;  1H8A C;  1D5Y A;  2DMP A;  2TDX A;  3DEE A;  4D7N A;  1WJB A;  3L00 A;  2M7B A;  1IRG A;  2FNA A;  2H8W A;  1Y39 A;  3OSF A;  1R4M B;  2COB A;  3F0C A;  3HYI A;  5HVQ C;  3OYJ A;  4HW0 A;  4ZTF A;  4B48 A;  3U1D A;  5HNH A;  2FSW A;  5CVJ A;  1XGS A;  4B09 A;  3GFI A;  3EET A;  5C4J J;  2E2H J;  1YIJ I;  4MGR A;  5CYV A;  3HUG A;  1QPI A;  3PO2 J;  4IL6 C;  2LKX A;  3GME A;  5FO5 A;  4FX0 A;  3CMY A;  4LK1 F;  5F1R A;  2R5Z B;  5DUK A;  1NG6 A;  2R7S A;  4BYY A;  1R49 A;  2RC4 A;  3HOU J;  1PJR A;  4EM1 A;  2XAU A;  4W97 A;  3GZ5 A;  1TWC J;  4OIR F;  3HSE A;  4E7J A;  3JSO A;  1GV2 A;  4N9H A;  4YIF A;  4M3G A;  2CUJ A;  4XR6 A;  3CCR I;  2R4G A;  2JPC A;  3SDG A;  5F0H A;  2XRL A;  2VAS A;  2LH9 A;  4EAT A;  1LQ1 A;  2E5Z A;  1TZL A;  3J7Z I;  2FU4 A;  1Z67 A;  2QKM B;  2VPL A;  1W7P A;  1BC7 C;  2ID3 A;  1IO2 A;  4XRF A;  5E3M A;  2DLL A;  5EEH A;  3ERE D;  1EH7 A;  2KZV A;  4XK4 A;  4A3E J;  2NNY A;  2GXA A;  1G4D A;  2VKD A;  2EV0 A;  2XUB A;  1MBG A;  1JI8 A;  1UZC A;  1HDP A;  4RLF A;  4B3A A;  3M3Y J;  1A35 A;  3QYE A;  2EQR A;  2VE9 A;  2A5Y B;  3HPG A;  2A6T A;  1XX5 A;  5M3F J;  4K2E A;  1QRY A;  2L4A A;  3PM1 A;  1H89 C;  3HUG B;  3BZC A;  2M5W A;  1GXQ A;  3D0S A;  4D7M A;  4HQE A;  1BR1 A;  4M9Z A;  2CV0 A;  2DPU A;  3OS2 A;  1ZR2 A;  3C18 A;  3CTA A;  3BLY A;  1KON A;  2EV5 A;  1RKT A;  2OZU A;  3HTS B;  1I39 A;  3RPU D;  3DFG A;  4M9X A;  3N4M A;  2L9S A;  1OR7 A;  4KDP A;  4RB3 C;  1Y1W J;  2V6C A;  3D1N I;  2QBY A;  3CC7 I;  3OIO A;  1HXD A;  2JJ7 A;  4MFE A;  2F4I A;  1LFP A;  4P9F A;  1JKQ C;  2LG4 A;  2E1C A;  2M9H A;  3REO A;  2P5L C;  2IBD A;  1R6R A;  3TOA A;  4P55 A;  1BW5 A;  4XRS A;  2GOM A;  1Z3Y A;  2MA3 A;  5JVG F;  1JKO C;  2PJP A;  4QSH A;  4N0B A;  3MAJ A;  2GA2 A;  1RC9 A;  2NOJ B;  4AC0 A;  1ZG1 A;  3WTU C;  1J2X A;  2EIN H;  1MNM C;  3IWZ A;  5ED4 A;  3CLQ A;  1ENH A;  2LKP A;  2QGU A;  3QAH A;  1Y0N A;  4QLC U;  1BI1 A;  1X4O A;  3MVP A;  3GTG J;  2MBF A;  1Z77 A;  4IZZ A;  1MH3 A;  1QZE A;  2M3A A;  3OS1 A;  3CME I;  1OQY A;  2ISY A;  2GOX B;  1FC3 A;  4JX5 A;  1TTY A;  2X6X A;  1JXS A;  3V8L A;  5LGU A;  4A12 A;  3KEQ A;  3G1L A;  4PJM A;  3F8B A;  4ENN A;  4I6Z A;  1P7J A;  2IPQ X;  1IGN A;  3G6E I;  1IXR C;  3R4K A;  1WVR A;  3U2R A;  2JZY A;  3I64 A;  1PYV A;  2NOG A;  2KRH A;  3WOD F;  1ON2 A;  1MSF C;  4ENM A;  3OOU A;  4EVI A;  4WWC A;  4AYB N;  2QEX I;  2K27 A;  2BXZ A;  4CA0 A;  3F8N A;  3F23 A;  1VFC A;  2ZNZ A;  5HDG A;  5H6Q A;  3LQR A;  1WHU A;  4XSZ F;  5E1X A;  4BQQ A;  4HRI A;  3KZZ A;  4YG2 F;  3L2R A;  1FTT A;  2DJI A;  5E1Z B;  3JRI A;  3IP4 B;  5FFX A;  4MTE A;  2VC1 A;  1ETO A;  2V6E A;  1IUF A;  3D5L A;  3BQY A;  2ZB9 A;  2XAF A;  1G3S A;  3G1O A;  1XB4 A;  3WU1 B;  2EA4 A;  3S1M J;  4PJL A;  3CCS I;  3FIS A;  1MGT A;  1OYI A;  4P9U A;  4ZYA A;  3W3C A;  4HBL A;  1ZRC A;  2BE5 F;  1OMI A;  2OZ6 A;  1GVJ A;  1UHM A;  2V79 A;  3GUD A;  4A93 J;  3LSI A;  4QPO A;  2LKS A;  4KMU X;  1K6O A;  1VQ4 I;  3LA3 A;  2ISZ A;  4AYB A;  5F04 A;  1D3Y A;  3H9J A;  1GXP A;  2GBY A;  3F72 A;  1FY7 A;  2DA1 A;  2E1M B;  4KFC A;  2VBZ A;  5J1Y A;  1HKS A;  2EFW A;  1BM9 A;  2KDO A;  2HEO A;  1OKR A;  2A69 F;  2O8X A;  4M6X A;  4E7I A;  3HRT A;  3JAM Z;  2X6W A;  3E5U A;  1FPQ A;  2VQG A;  4A0Z A;  2JTV A;  1MBE A;  4AUX A;  2KIF A;  1LJ9 A;  3DWL E;  1N77 A;  2R7F A;  4ANJ A;  1RET A;  1JTY A;  4I01 A;  2G7H A;  2L4M A;  1I50 J;  3I5U A;  1U8R A;  2WV0 A;  3K2Z A;  1JHH A;  2Y75 A;  2FNP A;  4EQQ A;  2XHK A;  4FHT A;  2Q2E B;  1QA6 A;  4FE4 A;  3RKY A;  3CZ6 A;  4XLA A;  4NC6 A;  2L5Q A;  3H92 A;  2CH0 A;  3L9F A;  2OUM A;  1TT0 A;  2L7M P;  1UEL B;  4OIO F;  3JSP A;  3TO7 A;  3I53 A;  3CLO A;  1VQ8 I;  3TED A;  3RIR A;  1E3P A;  2H8R A;  5EJC A;  3VOD A;  1RNL A;  4XN0 A;  1ACI A;  5F6F A;  2BOL A;  2EIK H;  5DD4 A;  3BZK A;  2QQ8 A;  3TDZ C;  1OJL A;  5KAI C;  3D5S C;  3JTG A;  4DYR A;  3SZP A;  3VOE A;  3BTC A;  3EUK L;  1R22 A;  2D1V A;  5E8I A;  4ENK A;  4EEF G;  3Q0V A;  5JHF A;  2NVT J;  2FBH A;  2KIS A;  2O03 A;  4D5F A;  3CUQ A;  3F21 A;  2DA3 A;  2IS4 A;  2DK8 A;  4ZDL A;  4LLN A;  4PSW A;  1U6G A;  1SVL A;  1Y6I A;  1SFK A;  1YRN B;  3WE2 A;  4OIQ F;  1I6X A;  4D0P A;  4BXU A;  3JRG A;  1MBF A;  3KIO A;  1USS A;  1Y1V J;  1V5F A;  3CES A;  3TW6 A;  1QQI A;  5EZH A;  2JQ7 A;  2MYS A;  4BEH B;  2QYO A;  3FBI B;  1G3T A;  3Q0W A;  1SFO J;  5HLH A;  2ZME A;  3BR2 A;  4M6V A;  2NAZ A;  3P5J A;  3PIP F;  2CYY A;  3E1S A;  4BHP A;  2R5Y B;  3O3K A;  1WFX A;  4IPA A;  2IXS A;  1IAW A;  3QU6 A;  2FA5 A;  4PUS A;  2BHZ A;  1U78 A;  2R7Z J;  2X1D A;  2PMZ A;  1ZG3 A;  4KUM A;  3A01 A;  4M3F A;  2GIV A;  2XSD C;  3KP6 A;  3I59 A;  2CFX A;  1C0W A;  2NVX J;  3HGY A;  5AIQ A;  4MEX F;  1BI2 A;  2YSR A;  1JGG A;  4EJU A;  2QSF X;  2KIU A;  3SYT A;  1QPM A;  5DCM A;  2L3D A;  4UUS B;  5LFA A;  1A04 A;  4M71 A;  4LLL A;  2OD5 A;  2HXI A;  4XKV A;  4BHC A;  3ZQ7 A;  1KU3 A;  4P5O A;  4P96 A;  3ML6 A;  5FRN A;  2P7C B;  1IUY A;  4WXH A;  1VI0 A;  2MD5 A;  3HOY J;  4YRV A;  4Z2Y A;  3M8J A;  5EYR A;  2ZME C;  1QNT A;  1ZHF A;  4UNO A;  2DYS H;  5FKO A;  5BMZ A;  3DPT A;  2XAJ A;  3J80 Z;  2K9S A;  3WHC A;  2X4H A;  2EK5 A;  4N4N B;  1FOX A;  3TGN A;  1YS6 A;  1JT6 A;  1BI3 A;  1N75 A;  2XAG A;  2F6C A;  3PUF A;  1IN4 A;  2MD0 A;  3C7J A;  2FMY A;  4I98 B;  4RDU A;  2ZJQ F;  3FHZ A;  4F91 B;  1Z3X A;  2H09 A;  1SD7 A;  1K61 A;  4RS8 A;  2P8T A;  2ZME B;  3SQN A;  4Q48 A;  4MTD A;  5FKL A;  1X2N A;  2Y69 H;  3J81 Z;  3F8C A;  4Y15 A;  1SD5 A;  3WTY C;  2RRE A;  2Q8K A;  1HDD C;  3LAJ A;  3BG9 A;  3GLL A;  2HYJ A;  1ZK8 A;  3F6O A;  2A6H F;  3I56 I;  4KN7 X;  4MNU A;  1X3W B;  2JVH A;  1WSU A;  2FQ3 A;  3CQZ J;  1HKQ A;  4I2O A;  2B9S A;  2QQA A;  4UB8 C;  1G6N A;  3QOE A;  1S8N A;  3HXL A;  4HF2 A;  2ESH A;  4PK4 A;  4C9Y A;  4LMY A;  2CQN A;  2VL8 A;  2R7W A;  3R0J A;  2XB5 A;  2ME6 A;  1SD6 A;  1A31 A;  1TNS A;  3PUB A;  2NRA C;  1YO5 C;  1TC3 C;  3KPH A;  4NC8 A;  1JE8 A;  3CCU I;  3I4P A;  5HLT A;  1QHG A;  2CUE A;  4ZZL A;  2VPR A;  2LMD A;  4V19 K;  1W0U A;  2JK3 A;  5AIP A;  3ULQ B;  2EWN A;  4A3G J;  2ECB A;  1IRX A;  2WB1 N;  5CVV A;  5M5Y J;  2P6S A;  1LVA A;  2FUG 2;  1LB2 A;  1U5T C;  2O7O A;  1AKH A;  4GRI A;  4UHT A;  2EFO A;  4PGH A;  4CSW A;  5IP9 J;  2WC2 A;  2OCE A;  4C30 A;  1JT0 A;  1A6Q A;  4IRI A;  3L1P A;  4BDY A;  3DU6 A;  3GLX A;  2WA0 A;  4JX4 A;  5FFZ A;  4G7O F;  2KP6 A;  2P81 A;  3W6K B;  4KIT B;  1V54 H;  5EEA A;  4H4K C;  3OS0 A;  3JRB A;  3BWG A;  4D1Q A;  1ON1 A;  4ZH4 F;  1MJ9 A;  5D5X B;  1YJ9 I;  2VBW A;  3BQZ A;  3M07 A;  2ELK A;  2FOK A;  2A61 A;  2M2E A;  2NNN A;  3BR0 A;  2OQR A;  3WG7 H;  2RQP A;  1JUP A;  2DQR A;  1XC5 A;  4XON A;  1DQU A;  4P1W A;  4A69 C;  3I4N J;  1ONV A;  3I54 A;  3J80 K;  3IKT A;  2R7R A;  2Y0S A;  3H3Z A;  2Y0S N;  2Y9Y A;  4Y7N J;  4I99 C;  3HBL A;  1ITY A;  4R1H A;  3GFM A;  1X1C A;  1STZ A;  4I0B A;  1W0T A;  4FT8 A;  1LFU P;  1ZAO A;  4II3 A;  4AIK A;  3IH4 A;  3F8F A;  2HS5 A;  3BR1 A;  3ZQH A;  2W85 A;  3KP5 A;  5DD8 A;  1HA8 A;  1HLV A;  4MO7 A;  1VZ0 A;  4HSR A;  2LF8 A;  4FE7 A;  3K4N A;  3LMM A;  1RR7 A;  2VB6 A;  5TJJ A;  3A2K A;  5BS6 A;  2V7F A;  2XAH A;  3PSF A;  2COM A;  3SFI A;  4WXD A;  2G9W A;  1HBX G;  4HDU A;  1JTX A;  2KDZ A;  3VB2 A;  2JRT A;  4LGW A;  2DJN A;  2P4W A;  2NS8 A;  2LSO A;  5B1A H;  2E60 A;  4ZTJ A;  1BA5 A;  4KNY A;  1E3O C;  3P9I A;  3V8K A;  2H94 A;  3OYA A;  2V1U A;  4KIS A;  5F0F A;  2B0L A;  1TT5 B;  2QVO A;  3RYP A;  2N8G A;  4BHB A;  4WK8 F;  2FQ4 A;  1V4R A;  5IT9 Z;  2QWW A;  1O7L A;  2IGO A;  4CZC A;  2X6Y A;  3DCF A;  1ZLK A;  3HOS A;  1XGM A;  1PP8 F;  2RAE A;  2EA2 A;  1IXS B;  1U0J A;  4S04 A;  3H9Q A;  2P5K A;  3SEQ A;  1D1C A;  1YHQ I;  4IF4 A;  4IOC F;  1MIJ A;  1VND A;  2QBY B;  1HQC A;  3DF8 A;  1IC8 A;  3IHU A;  4HEA 2;  3I9V 2;  2ZXH A;  5EF6 A;  2XV4 S;  1I6H J;  1UAA A;  1H88 C;  4IHV A;  4RGR A;  2EFP A;  4YFN F;  3OYF A;  4JYK A;  2ZKZ A;  3PIO F;  1H9T A;  3CJT B;  5IP7 J;  4IEJ A;  3ZRG A;  5B5E C;  3WE3 A;  2FD5 A;  5HDN A;  3K1M A;  3GVA A;  4QTR A;  3K4L A;  5EEG A;  3DEW A;  1VQP I;  2K86 A;  2MLG A;  3NWT A;  3H9G A;  2IA0 A;  2R7Q A;  4XSX F;  3TDU C;  2E1M C;  1FSH A;  2R0Q C;  3KE2 A;  4HLX A;  3K1N A;  1D8J A;  4L0Z B;  4HYE A;  4AIH A;  4A2U A;  5JI6 A;  1I3A A;  3HL2 A;  3T8R A;  4PFO A;  1DP7 P;  2QEN A;  1MJA A;  2XAS A;  2QQB A;  3H3U A;  2PBI A;  3KET A;  4B1R A;  2V9K A;  1B4A A;  1X1B A;  5GAD J;  2IS2 A;  3SDB A;  3Q3S A;  3VPR A;  4AVP A;  3AAF A;  4CIC A;  5LHI A;  2Z2S B;  2M4G A;  2ACJ A;  3W6V A;  2L9N A;  4DZJ A;  1FMV A;  1J7K A;  4CZZ A;  1Z9C A;  2FF4 A;  4E7Z A;  3Q9V A;  3E6D A;  3LWF A;  4U0W A;  5K5O A;  5HLI A;  1IN7 A;  3QPL A;  4XMY A;  3VYR B;  2K7L A;  3OYM A;  2GAU A;  2PLY A;  1A6I A;  4AID A;  4Q4Z F;  5GAH J;  2CRG A;  4UV8 A;  2JN6 A;  5D5U B;  4L9J A;  3S14 J;  2CJJ A;  2X0L A;  4AVZ A;  2OJE D;  3GO5 A;  5ICF A;  4L5I A;  2LY9 A;  3DBH B;  2IGK A;  1BOA A;  4EMS A;  3LSP A;  1O3Q A;  3Q0U A;  1GVD A;  2RDP A;  1J5Y A;  1UMQ A;  3EUA A;  1XMA A;  3S1Q J;  1JHF A;  4GGG A;  1LE8 B;  4RAZ A;  3GYH X;  3KYD B;  2DOF A;  3B6C A;  1T2K A;  3H35 A;  5DM6 F;  3GXO A;  1V5G A;  1W5C C;  2FE3 A;  3DPL C;  5LEK A;  2E7W A;  4I76 A;  4IHY A;  4RB1 A;  4G7H F;  5E1W A;  1W7P D;  5D4R A;  2OTL I;  4FQG A;  4BDZ A;  1YQA A;  2DO7 A;  2V9P A;  1KZH A;  5C44 J;  1G3Y A;  3C2H A;  5HLG A;  3QRF F;  4QWQ A;  2O6G E;  3MKL A;  5L3G A;  4FX4 A;  2BGC A;  2L9V A;  3FXQ A;  3ZGK A;  5CQE A;  3HSR A;  1JKR C;  2UXN A;  4OWR B;  2H6C A;  4HV5 A;  1V5E A;  2YS9 A;  2WBM A;  1KGS A;  3CUQ C;  1VQ6 I;  3BPX A;  1S3J A;  4F52 A;  3B6A A;  3VDX A;  1NK2 P;  1S5L C;  2ADU A;  2RVC A;  2M0C A;  5ILS A;  3K10 A;  5TIS C;  4A3J J;  3MZH A;  4L5J A;  2DT5 A;  1T08 B;  1WJA A;  2WAE A;  1XDU A;  4F55 A;  2CQQ A;  1T95 A;  4KN4 X;  2K9Q A;  1BL0 A;  3HGG A;  2AXL A;  2E35 A;  2M7A A;  4L9T A;  1T33 A;  4UXN A;  1FSE A;  2D2W A;  1NH3 A;  3IRR A;  3BRO A;  5K1Y A;  3A01 B;  1UHS A;  2DMU A;  3BR5 A;  3CDL A;  1EH6 A;  3BG3 A;  2BY0 A;  1X1D A;  2X9D A;  1B1B A;  1FMW A;  2AXT C;  4PJJ A;  4A5M A;  1B72 A;  3BR3 A;  2VQL A;  2X85 A;  1YW7 A;  2XF6 A;  3B02 A;  3JTH A;  5J6X A;  1ZRF A;  5FLX K;  3DEU A;  3IKV A;  4U87 A;  2HXO A;  2LFB A;  5EZG A;  2RN7 A;  1I3Q J;  3G2B A;  2EJR A;  3CJN A;  5B66 C;  2JUC A;  2DCE A;  1Y8R B;  3IL2 A;  4Y3O A;  1IRZ A;  4CCO A;  3V4G A;  4DYC A;  1ODD A;  2A3S A;  2VXD A;  2PJR A;  1TQM A;  1FYM A;  2LDU A;  1TL8 A;  4RB2 C;  3ASN H;  3NRV A;  3GX4 X;  1RUN A;  4LOC A;  4LB5 A;  4RGU A;  1FYL A;  4XN3 A;  2H1K A;  2VOD A;  3LSM A;  1HW1 A;  4HX8 A;  3T0Y A;  1Z1D A;  4KYW A;  2HYF A;  2Y2Z A;  2JWT A;  3CC4 I;  4A3D J;  1FP1 D;  3HRM A;  3FM5 A;  1R9T J;  3HPH A;  2RQQ A;  3J81 K;  1YYV A;  3CCJ I;  3CMM A;  4RB0 A;  4A3F J;  3H3V K;  3RKW A;  3CCQ I;  4HNU A;  4LG3 A;  5DEQ A;  4R79 A;  1FBS A;  5F08 A;  5D6E A;  4GDF A;  4D5C A;  1SAX A;  3OYK A;  2WY8 Q;  3CUQ B;  2G7U A;  3FKI J;  4IQ4 A;  1G3W A;  2KZG A;  3I3L A;  5K5R A;  1W4M A;  3OL4 A;  4ZYD A;  1FWZ A;  3E6B A;  5CVR A;  2Y31 A;  3M1E A;  2M34 A;  3C2G A;  3DKY A;  1SFE A;  2K4B A;  2IGM A;  1UG0 A;  3EUH C;  3W6J B;  4OOI A;  1YW9 A;  1XGO A;  2ESN A;  2ME0 A;  3TQN A;  3DXJ F;  4FIS A;  2HVS A;  1YE9 A;  3DV8 A;  2EBI A;  3WTT C;  3U1K A;  1TP4 A;  5EDN A;  5E3O A;  3GTP J;  2BW3 B;  1VQ9 I;  2H27 A;  4Y13 A;  1MBK A;  1ZN2 A;  1W7P B;  1B6A A;  3CMA I;  1R00 A;  3KLN A;  2R93 J;  4BBR J;  3WHB A;  2BZT A;  1MBH A;  5FLX Z;  2KLO A;  5J40 A;  5J1U A;  4E7H A;  3VSK A;  5HOO A;  2LY1 A;  2XKO A;  2Y48 A;  3AG1 H;  5A2Q K;  4WX9 A;  3W2A A;  3AG4 H;  1SAU A;  2D5V A;  1RZ4 A;  2LP0 A;  1J59 A;  2JSP A;  2WB1 A;  4F3Q A;  3NEU A;  3RZD J;  5CJ9 A;  5M5W J;  1V3F A;  2R7O A;  4LB6 B;  3O8G A;  5GTI C;  5ICC A;  4BUP A;  2TCT A;  1IF1 A;  2J5O A;  3MMY B;  3P9K A;  4L9V A;  1RRJ A;  5IYC J;  3LFU A;  3PQK A;  3ZXS A;  3E5Q A;  4KJZ A;  1OIS A;  2JSC A;  2JUG A;  2DOA A;  4PDK A;  2DTZ A;  1VF9 A;  2YU3 A;  2GWR A;  5FD6 A;  4Y33 A;  1SVM A;  4HAM A;  2KPM A;  2LLK A;  5ICG A;  1R23 A;  1LVK A;  1S6L A;  2DDB A;  2GZW A;  4G6D A;  2L2O A;  1OR7 C;  4HX4 A;  4BAC A;  1HCR A;  2M1B A;  2K85 A;  5FD5 A;  5HS7 A;  1PDN C;  5LD2 C;  3GTL J;  5J4Y A;  5HS8 A;  1MMS A;  2DA6 A;  3ABK H;  3OYG A;  2F2E A;  2QA4 I;  2XPV A;  2Y30 A;  5FKM A;  5IOZ A;  3J7Y J;  1T98 A;  3QU3 A;  4M6Y A;  4BE0 A;  3LSG A;  4IX7 A;  4NNJ A;  1WPK A;  1VQ5 I;  1S7A A;  3C1D A;  1ZGW A;  1J09 A;  1N78 A;  1X3U A;  4CYC B;  4HX7 A;  3TP0 A;  4BKX A;  2L0K A;  1FNN A;  3FM3 A;  2XGE A;  5IY5 H;  3DQV C;  1UB9 A;  4OIP F;  3ABT A;  1VTN C;  1T56 A;  3LL7 A;  1T0F C;  5FGM A;  3E6M A;  3L09 A;  1U8B A;  4OMZ A;  1FOY A;  3UNG C;  4DIQ A;  5DM7 F;  1R5I D;  3BTL A;  3DP7 A;  3HB9 A;  3DPU A;  1IV6 A;  2OBP A;  5K7Z A;  3S2H J;  3M4O J;  3RTR A;  5EG0 A;  2PMH A;  1MSE C;  2KKO A;  4U0V A;  3KZY A;  3RPU A;  2JRM A;  4GO1 A;  1PUF A;  1SAN A;  4HLY A;  2M8G X;  3LNQ A;  2EV6 A;  2MAB A;  4BU2 A;  2B7E A;  1AU7 A;  5ILV A;  4D9J A;  2L02 A;  1K83 J;  1LKX A;  5A2Q Z;  2GXB A;  2RGV A;  3CP8 A;  4DBR A;  1VQ7 I;  3IRQ A;  4H0E A;  1V55 H;  4NUB A;  4CUG A;  2KL4 A;  3IUO A;  1GT0 C;  4A6E A;  1SVO A;  1WKM A;  4DJA A;  3A0H C;  3HRS A;  3OMY A;  3PFI A;  2HPI A;  1KQ9 A;  3GZN B;  3LOC A;  5K7F A;  3JAM K;  3I55 I;  3MKZ A;  2YX4 A;  4J01 A;  1A5J A;  4B43 A;  3E3V A;  4EJW A;  5L3C A;  3N97 A;  4YFX F;  1ZEL A;  5LGN A;  2KMU A;  4XID A;  3ZMS A;  2K02 A;  4DQ2 A;  2ETH A;  4EM0 B;  3UR3 C;  5BPI A;  1JJ8 C;  2CGP A;  3CF2 A;  5D5W B;  2HQR A;  3R60 A;  3HIF A;  1SFX A;  3S8P A;  2QF7 A;  1IRF A;  1BR4 A;  1EKE A;  1LUJ B;  4MEY F;  5D6F A;  3V7C A;  3I71 A;  2EIJ H;  1FLI A;  2A5W A;  1GDT A;  1L3L A;  2IA2 A;  4ZZD A;  2ZSH B;  1OCT C;  3HC7 A;  2A07 F;  1W36 D;  3K4J A;  1IN5 A;  3HRU A;  2OQG A;  2VQC A;  3A4C A;  2K3F A;  1ETV A;  1MD0 A;  4O5V A;  1UCR A;  1MMD A;  2JVG A;  5KVR A;  3PSI A;  5IYB J;  3ISP A;  4LIT A;  3BOQ A;  5L3B A;  1A36 A;  4BXX J;  3K0L A;  4B47 A;  1Z0X A;  2E19 A;  1YJN I;  3A02 A;  2A05 A;  5DCF A;  4ESJ A;  4ZYE A;  4DNC A;  4NQW A;  5J3L A;  4A3M J;  1ZRE A;  4UUT A;  3A0B C;  1ZR4 A;  1G2H A;  4E7L A;  2EZH A;  2IP2 A;  4FTH A;  1ZAR A;  2EIL H;  2E5N A;  3AL0 B;  1HW5 A;  2HR3 A;  3E5X A;  3ZMU A;  4C2T A;  4FAS D;  4G6Q A;  4YEL A;  2QCO A;  1P4W A;  4ITV A;  3P9C A;  2XC7 A;  3JRC A;  1W36 C;  2QSH X;  2H1L A;  3DU5 A;  3OSG A;  1XS9 A;  1PUE E;  1WH7 A;  3IH2 A;  3T1B A;  1XSX A;  2K9N A;  4G94 A;  2ZC2 A;  3S16 J;  3U21 A;  2UUZ A;  1BIA A;  3SXY A;  3EYI A;  1R36 A;  3T8T A;  2CV1 A;  3R6S A;  4C2M J;  3M8E A;  3HZJ A;  4OAZ A;  3MWM A;  1Z6R A;  4CCJ A;  3S17 J;  4OIN F;  1RPW A;  2CS3 A;  1YLF A;  3AKZ A;  1WZ2 A;  2IT0 A;  4A3B J;  3V7S A;  2KRF A;  2QZ8 A;  4WF2 A;  3MZ8 A;  5K5Q A;  3FXJ A;  4EGZ A;  9ANT A;  3LST A;  1MKM A;  3OIP A;  2DMN A;  1XMX A;  3PFY A;  2IVM A;  1ERD A;  1GUU A;  3H5A A;  5KK1 A;  2YPR A;  5CLS A;  2WV1 A;  1ZLJ A;  4PSX A;  3S3N A;  1XGN A;  1S9H A;  1TW3 A;  2BW3 A;  2EIM H;  3ZP5 A;  2STT A;  1D1A A;  1ETK A;  2AQE A;  1H9G A;  2IEK A;  2VT2 A;  4TV7 A;  4RA2 A;  4RM2 A;  3GFL A;  3CC2 I;  2Z1D A;  2OPT A;  2HWV A;  2VIX A;  1ZQ3 P;  5IP6 A;  4A6D A;  2OF7 A;  1ZTR A;  1O3S A;  3A1Y A;  4BH9 A;  5HOD A;  2ZJR F;  4EJV A;  3CD6 I;  1K6Y A;  1QVU A;  2CUF A;  2VJJ A;  2Z5U A;  3OR2 C;  3FXR A;  4LJZ F;  1BJA A;  2Q1Z B;  1EF4 A;  1YIO A;  2WY7 Q;  4NBQ A;  2BV6 A;  1KA8 A;  4EM2 A;  1T6S A;  1YRN A;  2WAQ A;  1YIT I;  1YW8 A;  2CMP A;  1MMA A;  4LK0 F;  3SZT A;  3E6C C;  2W57 A;  3BZ6 A;  3E0J B;  4RAY A;  4KMF A;  2I5U A;  1ZH5 A;  4JOM A;  1K78 A;  3ZPL A;  1FX7 A;  5K7H A;  3JR9 A;  4UUS A;  1IN6 A;  3G71 I;  3S3M A;  4CH7 A;  4FCY A;  2DBB A;  3HOW J;  3KP4 A;  2A68 F;  1KU9 A;  1U9N A;  2YR2 A;  4M3E A;  2DN0 A;  4N4O B;  2IJL A;  4CO8 A;  1XCV A;  2KT0 A;  2AO9 A;  3HHH A;  4CCN A;  3WG9 A;  4UY8 I;  4HF1 A;  1NTC A;  4DBQ A;  3DTK A;  1I1G A;  3VYU B;  2O0Y A;  4CXF A;  4HZF A;  2EB7 A;  4HNT A;  2KFD A;  3BCB A;  1WJE A;  2RNG A;  2WTE A;  1GV5 A;  4QPQ A;  4E6K G;  2MC4 A;  4GYI A;  3GWZ A;  2X1E A;  3H1C A;  4LIV A;  4S05 A;  1F1Z A;  1NHA A;  3I0T A;  3PL8 A;  5FRO A;  1AA7 A;  2X6O A;  4A0Y A;  3EDP A;  2LYC A;  3D5R C;  2LR8 A;  2JMW A;  3K70 D;  2PFB A;  1SMY F;  5LGT A;  2VKV A;  1WJD A;  4LFU A;  1ORK A;  2XDV A;  2TRT A;  4OU0 A;  3HHG A;  2IA1 A;  1KYZ A;  1LEA A;  1MND A;  4O6J A;  4HNV A;  1YX5 A;  1P4A A;  3OL3 A;  3WTW C;  1E0E A;  3JRE A;  4IO9 F;  5GAG J;  2HTJ A;  1POG A;  2HKX A;  2XAQ A;  1RIO H;  5LHG A;  3M1C A;  5DTD A;  2KJC A;  1FT9 A;  1D1B A;  4J00 A;  3S15 J;  2A6E F;  1Z91 A;  1S7E A;  3ERM A;  2XIG A;  2ZCW A;  1T0F A;  3GFJ A;  2F5C A;  1D8K A;  3QP6 A;  2IRF G;  4KIG A;  4XNF A;  2IS6 A;  2BY2 A; 
#chains in the Genus database with same CATH homology
 2MH2 A;  4RGS A;  3FZV A;  1TQI A;  1LEB A;  3JW4 A;  3NQO A;  4XLN F;  1QZZ A;  2Q2E A;  3TOB A;  3ZMD A;  1I5Z A;  1O57 A;  1T39 A;  4CYD A;  2OA4 A;  1XMK A;  4I02 A;  4LG0 B;  3ZN0 A;  3IC7 A;  5FB2 A;  1DPU A;  2XRO A;  4KIB A;  1IXC A;  2H6B A;  2VT3 A;  5L3F A;  2QLZ A;  1KU2 A;  4KA4 A;  3BPV A;  2QM3 A;  1EV7 A;  4HV6 A;  1R1U A;  1ULY A;  3EYY A;  1E2X A;  1FBQ A;  3ECH A;  2NYX A;  3FMQ A;  3FWE A;  2BYV E;  4BNC A;  5ERI A;  1HST A;  2PN6 A;  3WGH A;  3TO9 A;  4ETS A;  2P6T A;  1J0R A;  2RV8 A;  3V8J A;  3O6B B;  1Y0U A;  2E1N A;  1QO0 D;  2HKO A;  4M74 A;  4I09 A;  3ABU A;  1L0O C;  3KFW X;  2HTS A;  1B59 A;  1YG2 A;  2OAZ A;  1WWX A;  2ZO4 A;  3OOP A;  4HF0 A;  2XKP A;  1O3T A;  3COA C;  3VEP A;  5H6R A;  3TO6 A;  4PCQ A;  4CHU A;  4G9Y A;  3GZ6 A;  2WWY A;  1ZGJ A;  4YFK F;  3BDD A;  3FMS A;  2RKH A;  1DUX C;  5H20 A;  2O3F A;  1LDJ A;  2M87 A;  2LNB A;  1Z7U A;  1UFM A;  1XN7 A;  2VOO A;  1U5T A;  4Y17 A;  2HZT A;  1CF7 A;  4F7Z A;  4G7Z F;  1YTY A;  4MQV A;  3BJ6 A;  3DKW A;  4UUV A;  4U0Y A;  3F22 A;  3IWF A;  3B73 A;  3LA2 A;  2EFN A;  3F3X A;  2UZK A;  1FOK A;  1ZGA A;  4L9N A;  4ON0 A;  2MC3 A;  3J7A O;  3MEX A;  4EV0 A;  2PMU A;  3QPH A;  1XDS A;  1MDM A;  1AOY A;  3BP8 A;  2HYG D;  3M7G A;  2KIM A;  4JK1 X;  5LHH A;  1FP2 A;  1KYW A;  3K69 A;  4IHS A;  4MHG A;  1K78 B;  2PEX A;  1J9I A;  5D8K B;  2PG4 A;  4B8X A;  1WQ2 A;  4EGY A;  3RDI A;  1OYY A;  3ELK A;  1XSD A;  3M9A A;  2W25 A;  2Z9O A;  3MZY A;  3I59 B;  2D45 A;  4N9I A;  2W24 A;  4NHJ A;  3ECO A;  1K7A A;  4JBA A;  1D5V A;  4O3M A;  2Z33 A;  1TW2 A;  3BJO A;  1BC8 C;  5JR3 A;  1O3R A;  3KLO A;  2JPB A;  3SFZ A;  5JFR A;  3WGI A;  4WXC A;  4AD9 A;  1REP C;  1DDN A;  2FBK A;  3E97 A;  4NB5 A;  5E18 F;  3Q5F A;  3WTX C;  2R7D A;  2W84 A;  1LDK B;  5CVI A;  2CQK A;  1KU7 A;  2NS0 A;  4UVA A;  1JGS A;  3RJP A;  1RI7 A;  1U2W A;  1ZYR F;  3FXU A;  3ROU A;  3RYR A;  2ZXJ A;  2CWE A;  1QZY A;  2OU2 A;  2ZNY A;  4ESF A;  2CSO A;  1HW2 A;  4U88 A;  1GHC A;  1XD7 A;  5LRR A;  4IXA A;  1P4X A;  1UHW A;  2VOP A;  3KP3 A;  2FEZ A;  5D4S A;  1IN8 A;  3LFK A;  4U7B A;  1EH8 A;  5BPD A;  1O7F A;  2VC0 A;  1FZP B;  5LEJ A;  2E7X A;  1B9N A;  1R1V A;  1CGP A;  2VBX A;  2V1X A;  3ZN1 A;  1B9M A;  3K9T A;  2QUF A;  1QGP A;  3GF2 A;  1BBY A;  3BJA A;  4I0A A;  5TRD A;  2BEO A;  2HFH A;  1OPC A;  3QOP A;  5LLQ A;  2XVC A;  5J8C A;  4IRG A;  1Z05 A;  4KIC A;  3P7N A;  4G8X A;  1XCB A;  2Z3Y A;  4M72 A;  1K79 A;  1UST A;  2K4J A;  1S7O A;  4M73 A;  2DK5 A;  1F5T A;  1I27 A;  3OV8 A;  4GXO A;  3GEZ A;  3KP7 A;  2C6Y A;  5LBQ A;  5DCM B;  5E8G A;  1SMT A;  2DU9 A;  1SD4 A;  5IT3 A;  3CUO A;  2STW A;  2HDC A;  2Z99 A;  2UXX A;  3PQJ A;  2R3S A;  4ZYG A;  3VFZ A;  3WTS C;  4EJT A;  1W5T A;  4UVB A;  1T38 A;  4HA8 A;  2CW0 F;  3KEO A;  3CDH A;  5HDK A;  3BY6 A;  2PI0 A;  4WCG A;  3CO6 C;  1I1S A;  1H0M A;  2Y0M A;  1AWC A;  3WGG A;  2DPD A;  4UV9 A;  2J5P A;  2JT1 A;  1QBJ A;  1WRJ A;  1BIB A;  2VBY A;  5DYM A;  3LAP A;  5L3E A;  5ILU A;  2QQ9 A;  2M30 A;  5L3D A;  4CGZ A;  1YFH A;  4M9S A;  2ZFW A;  2L54 A;  2V1D A;  3O2P E;  3R61 A;  4LG0 A;  5DV5 A;  2VN2 A;  3MQ0 A;  2AS5 F;  2FRH A;  1DPR A;  3LQQ A;  3HOT A;  2FML A;  1CF7 B;  3MCZ A;  1WI9 A;  3F6V A;  1BI0 A;  4E70 A;  3MFK A;  5E17 F;  3G3Z A;  5BQT A;  2M45 A;  4EJO A;  4ESB A;  2P7V B;  1KQ8 A;  2DQL A;  2UWM A;  1F9N A;  1P2F A;  5HS9 A;  2MLK A;  2MH9 A;  1R5H A;  2VON A;  2DAO A;  4ZYH A;  4OMY A;  2V9V A;  4IHT A;  4GYG A;  4CDG A;  3WTV C;  4MQ9 F;  3ZMV A;  5LRS A;  4Q5S F;  2DTR A;  1IW7 F;  1XSV A;  3GW2 A;  3FX3 A;  3KCC A;  1MZB A;  2FBI A;  2HOE A;  2LF7 A;  4JQF A;  3LA7 A;  1MJB A;  4KIF A;  4IRH A;  2YX7 A;  3KP2 A;  2ZBK A;  1OYW A;  1TLH B;  4AIJ A;  1P92 A;  4PZJ A;  5AON A;  2FXA A;  4IJA A;  1R7J A;  1R1T A;  4BAY A;  3QP5 A;  1E17 A;  1Z6T A;  1Q1H A;  1R5G A;  6PAX A;  3SHF A;  5F64 A;  3V7R A;  4RGX A;  5BOX A;  4L0Y B;  5IT9 K;  1FYK A;  2DFI A;  2GQQ A;  4YII A;  1TBX A;  1KQ0 A;  2XGX A;  2GXG A;  1TNT A;  1J75 A;  2RNJ A;  3RKX A;  2GA1 A;  5CVU A;  2O61 A;  1YS7 A;  3QPT A;  3R0A A;  2BBY A;  4KT5 C;  4A5N A;  4XLP F;  5E20 A;  3S2W A;  2DI3 A;  1HKT A;  2HGC A;  4HDV A;  3FF5 A;  4R8H A;  1TQP A;  2F5E A;  3WU0 A;  3ZMZ A;  3WTZ A;  2M8E A;  1P6R A;  3EUH A;  1S29 A;  4XBF A;  1LNW A;  1R58 A;  1U5T B;  2F5F A;  2HQN A;  1RUO A;  2L01 A;  4GCV A;  1BN5 A;  4AWX B;  5JHU A;  3HSF A;  5JVT A;  1HSJ A;  3ZMT A;  3HTU A;  2D1H A;  4ENJ A;  2VE8 A;  4PGG A;  4I7H A;  1SFU A;  2Q0O A;  2VXZ A;  1F4K A;  2IW5 A;  4UVC A;  5ICE A;  2CO5 A;  4U7D A;  3L7W A;  5D8L B;  1LDD A;  3CO7 C;  5DUI A;  1PP7 U;  4ASN A;  2CG4 A;  3I58 A;  5J8F A;  5DDG A;  1IZ1 A;  2EFQ A;  4Q47 A;  4HQM A;  4HOB A;  3RPQ A;  1ZRD A;  4IVN A;  3Q9S A;  2F5D A;  3T5X A;  1W5S A;  4L18 B;  3F8M A;  4LD5 A;  2PQ8 A;  3C3W A;  2ZJ2 A;  3RI4 A;  2KJB A;  3L2C A;  3G73 A;  3EQL F;  3U9G A;  4BQA A;  1FBU A;  4LLG F;  2DW4 A;  4A0X A;  1U3E M;  3TKY A;  5D5V B;  3K1P A;  1ZG5 A;  2XRN A;  3FMR A;  2P5V A;  3M8F A;  1MDM B;  2ELH A;  2TDX A;  3L00 A;  1IRG A;  2FNA A;  3HYI A;  5HVQ C;  4HW0 A;  3U1D A;  2FSW A;  3GFI A;  1XGS A;  5CVJ A;  4B09 A;  3EET A;  4MGR A;  5CYV A;  3HUG A;  5FO5 A;  4FX0 A;  4LK1 F;  5F1R A;  5DUK A;  4BYY A;  2RC4 A;  4EM1 A;  3GZ5 A;  4OIR F;  3HSE A;  3JSO A;  4N9H A;  4YIF A;  2JPC A;  1LQ1 A;  2FU4 A;  1W7P A;  1BC7 C;  4XRF A;  2DLL A;  5EEH A;  3ERE D;  1EH7 A;  2NNY A;  1G4D A;  2EV0 A;  2XUB A;  2VE9 A;  2A5Y B;  4K2E A;  2L4A A;  2M5W A;  1GXQ A;  3D0S A;  4HQE A;  4M9Z A;  2DPU A;  3C18 A;  3CTA A;  2EV5 A;  2OZU A;  3HTS B;  3DFG A;  4M9X A;  3N4M A;  4KDP A;  1OR7 A;  4RB3 C;  2V6C A;  2QBY A;  1HXD A;  4P9F A;  2E1C A;  3REO A;  2P5L C;  3TOA A;  4P55 A;  2MA3 A;  2PJP A;  4N0B A;  3MAJ A;  2GA2 A;  1ZG1 A;  3WTU C;  1J2X A;  3IWZ A;  5ED4 A;  3QAH A;  2LKP A;  4QLC U;  1BI1 A;  2MBF A;  2ISY A;  1FC3 A;  1TTY A;  1JXS A;  3V8L A;  5LGU A;  4A12 A;  3KEQ A;  3F8B A;  4ENN A;  2IPQ X;  1IXR C;  3R4K A;  3U2R A;  2JZY A;  3I64 A;  3WOD F;  1ON2 A;  4ENM A;  4EVI A;  4WWC A;  2K27 A;  3F8N A;  3F23 A;  2ZNZ A;  5HDG A;  5H6Q A;  3LQR A;  4XSZ F;  5E1X A;  3KZZ A;  4YG2 F;  5E1Z B;  5FFX A;  4MTE A;  2VC1 A;  3D5L A;  2XAF A;  1G3S A;  1XB4 A;  3WU1 B;  2EA4 A;  1MGT A;  1OYI A;  4P9U A;  4HBL A;  1ZRC A;  2BE5 F;  1OMI A;  2OZ6 A;  1GVJ A;  1UHM A;  2V79 A;  3GUD A;  4KMU X;  1K6O A;  3LA3 A;  2ISZ A;  1D3Y A;  1GXP A;  3F72 A;  1FY7 A;  4KFC A;  2VBZ A;  1HKS A;  2EFW A;  1BM9 A;  2HEO A;  1OKR A;  2A69 F;  2O8X A;  4M6X A;  3HRT A;  3JAM Z;  3E5U A;  1FPQ A;  4A0Z A;  2JTV A;  2KIF A;  1LJ9 A;  2R7F A;  4I01 A;  2G7H A;  2L4M A;  3I5U A;  1U8R A;  2WV0 A;  3K2Z A;  1JHH A;  2Y75 A;  2FNP A;  4EQQ A;  2XHK A;  4FHT A;  3RKY A;  3H92 A;  3L9F A;  4OIO F;  3JSP A;  3TO7 A;  3I53 A;  3CLO A;  3RIR A;  3VOD A;  1RNL A;  5F6F A;  5DD4 A;  3TDZ C;  3JTG A;  3SZP A;  3VOE A;  1R22 A;  2D1V A;  5E8I A;  4ENK A;  2FBH A;  2O03 A;  3CUQ A;  3F21 A;  2DK8 A;  4LLN A;  1U6G A;  3WE2 A;  4OIQ F;  1I6X A;  4D0P A;  4BXU A;  1USS A;  1QQI A;  2QYO A;  1G3T A;  5HLH A;  2ZME A;  2NAZ A;  2CYY A;  4BHP A;  3O3K A;  4IPA A;  1IAW A;  3QU6 A;  2FA5 A;  1U78 A;  1ZG3 A;  4KUM A;  2GIV A;  3KP6 A;  3I59 A;  2CFX A;  1C0W A;  5AIQ A;  4MEX F;  1BI2 A;  2YSR A;  4EJU A;  2KIU A;  1QPM A;  5DCM A;  2L3D A;  1A04 A;  4M71 A;  4LLL A;  2OD5 A;  4BHC A;  3ZQ7 A;  1KU3 A;  4P5O A;  4P96 A;  3ML6 A;  2P7C B;  1IUY A;  4WXH A;  2MD5 A;  4Z2Y A;  1QNT A;  1ZHF A;  4UNO A;  5BMZ A;  3DPT A;  2XAJ A;  3J80 Z;  2X4H A;  2EK5 A;  3TGN A;  1YS6 A;  1BI3 A;  2XAG A;  1IN4 A;  3C7J A;  2FMY A;  4I98 B;  3FHZ A;  2H09 A;  1SD7 A;  4RS8 A;  2P8T A;  2ZME B;  3SQN A;  4Q48 A;  4MTD A;  3J81 Z;  3F8C A;  4Y15 A;  1SD5 A;  3WTY C;  2Q8K A;  3LAJ A;  3F6O A;  2A6H F;  4KN7 X;  4MNU A;  1WSU A;  2FQ3 A;  4I2O A;  1HKQ A;  2QQA A;  4HF2 A;  1G6N A;  1S8N A;  2ESH A;  4LMY A;  3R0J A;  1SD6 A;  1TNS A;  2NRA C;  1YO5 C;  1JE8 A;  3I4P A;  4ZZL A;  5AIP A;  3ULQ B;  2EWN A;  5CVV A;  2P6S A;  1LVA A;  1LB2 A;  1U5T C;  4UHT A;  2EFO A;  4PGH A;  2WC2 A;  4IRI A;  3GLX A;  5FFZ A;  4G7O F;  3W6K B;  3BWG A;  1ON1 A;  4ZH4 F;  1MJ9 A;  5D5X B;  2VBW A;  2FOK A;  2A61 A;  2NNN A;  2OQR A;  2RQP A;  2DQR A;  1ONV A;  3I54 A;  3J80 K;  3IKT A;  3H3Z A;  4R1H A;  3GFM A;  1STZ A;  4I0B A;  4FT8 A;  1ZAO A;  4AIK A;  3F8F A;  2HS5 A;  2W85 A;  3KP5 A;  5DD8 A;  2LF8 A;  5TJJ A;  5BS6 A;  2XAH A;  2COM A;  4WXD A;  2G9W A;  1HBX G;  4HDU A;  3VB2 A;  2JRT A;  4LGW A;  2P4W A;  2LSO A;  4KNY A;  3P9I A;  3V8K A;  2H94 A;  2V1U A;  2B0L A;  2QVO A;  3RYP A;  4BHB A;  4WK8 F;  1V4R A;  5IT9 Z;  2QWW A;  1O7L A;  1ZLK A;  3HOS A;  1XGM A;  1PP8 F;  2EA2 A;  1IXS B;  4S04 A;  2P5K A;  4IF4 A;  2QBY B;  1HQC A;  3DF8 A;  3IHU A;  2XV4 S;  4RGR A;  2EFP A;  4YFN F;  2ZKZ A;  1H9T A;  3WE3 A;  5HDN A;  3K1M A;  3GVA A;  5EEG A;  2K86 A;  2MLG A;  2IA0 A;  3TDU C;  4XSX F;  1FSH A;  3KE2 A;  4HLX A;  3K1N A;  1D8J A;  4L0Z B;  4HYE A;  4AIH A;  4A2U A;  5JI6 A;  3T8R A;  1DP7 P;  2QEN A;  1MJA A;  2XAS A;  2QQB A;  3H3U A;  2PBI A;  3KET A;  1B4A A;  4AVP A;  3AAF A;  4CIC A;  5LHI A;  2ACJ A;  1J7K A;  4CZZ A;  1Z9C A;  2FF4 A;  5K5O A;  3Q9V A;  3E6D A;  3LWF A;  4U0W A;  5HLI A;  1IN7 A;  2K7L A;  2GAU A;  2PLY A;  4Q4Z F;  4UV8 A;  5D5U B;  4L9J A;  2X0L A;  3GO5 A;  5ICF A;  4L5I A;  1O3Q A;  1BOA A;  4EMS A;  2RDP A;  1J5Y A;  1XMA A;  1JHF A;  4GGG A;  4RAZ A;  3GYH X;  1T2K A;  3GXO A;  2FE3 A;  3DPL C;  5LEK A;  2E7W A;  4RB1 A;  4G7H F;  5E1W A;  1W7P D;  5D4R A;  2DO7 A;  1YQA A;  1G3Y A;  5HLG A;  3QRF F;  4QWQ A;  2O6G E;  5L3G A;  4FX4 A;  2BGC A;  3FXQ A;  3HSR A;  2UXN A;  2H6C A;  4HV5 A;  1KGS A;  3CUQ C;  3BPX A;  1S3J A;  2ADU A;  5ILS A;  2RVC A;  3MZH A;  4L5J A;  2DT5 A;  1XDU A;  4KN4 X;  2AXL A;  4L9T A;  4UXN A;  1FSE A;  2D2W A;  3IRR A;  3BRO A;  5K1Y A;  1EH6 A;  1B1B A;  4A5M A;  3JTH A;  1YW7 A;  3B02 A;  5J6X A;  1ZRF A;  5FLX K;  3DEU A;  3IKV A;  2RN7 A;  2EJR A;  3CJN A;  3IL2 A;  3V4G A;  1ODD A;  2A3S A;  1TQM A;  1FYM A;  2LDU A;  4RB2 C;  3NRV A;  3GX4 X;  1RUN A;  4LB5 A;  4RGU A;  1FYL A;  2VOD A;  1HW1 A;  4HX8 A;  3T0Y A;  1Z1D A;  4KYW A;  2HYF A;  1FP1 D;  3HRM A;  3FM5 A;  3J81 K;  1YYV A;  4RB0 A;  3RKW A;  5DEQ A;  4R79 A;  1FBS A;  5D6E A;  1SAX A;  3CUQ B;  2G7U A;  1G3W A;  5K5R A;  1W4M A;  4ZYD A;  1FWZ A;  3E6B A;  5CVR A;  3M1E A;  1SFE A;  2K4B A;  3W6J B;  4OOI A;  1YW9 A;  1XGO A;  2ESN A;  3TQN A;  3DXJ F;  3DV8 A;  3WTT C;  2H27 A;  4Y13 A;  1ZN2 A;  1W7P B;  1B6A A;  1R00 A;  3KLN A;  5FLX Z;  5HOO A;  2Y48 A;  2XKO A;  5A2Q K;  4WX9 A;  1RZ4 A;  1J59 A;  3NEU A;  5CJ9 A;  1V3F A;  4LB6 B;  5ICC A;  1IF1 A;  2J5O A;  3P9K A;  4L9V A;  3PQK A;  3E5Q A;  2JSC A;  4PDK A;  2YU3 A;  2GWR A;  5FD6 A;  4HAM A;  5ICG A;  1R23 A;  1S6L A;  2GZW A;  4G6D A;  4HX4 A;  2M1B A;  5FD5 A;  5HS7 A;  1PDN C;  5HS8 A;  2F2E A;  1T98 A;  3QU3 A;  4M6Y A;  1S7A A;  3C1D A;  1X3U A;  4HX7 A;  1FNN A;  3FM3 A;  3DQV C;  4OIP F;  1UB9 A;  3ABT A;  1VTN C;  5FGM A;  3E6M A;  3L09 A;  4OMZ A;  3DP7 A;  2OBP A;  3RTR A;  2PMH A;  2KKO A;  4U0V A;  3KZY A;  3RPU A;  4GO1 A;  4HLY A;  2EV6 A;  5ILV A;  2L02 A;  5A2Q Z;  2GXB A;  2RGV A;  3IRQ A;  4H0E A;  4A6E A;  1WKM A;  3HRS A;  3PFI A;  1KQ9 A;  3JAM K;  2YX4 A;  4EJW A;  3E3V A;  5L3C A;  3N97 A;  4YFX F;  5LGN A;  3ZMS A;  2K02 A;  4DQ2 A;  2ETH A;  4EM0 B;  5BPI A;  2CGP A;  5D5W B;  2HQR A;  3R60 A;  3HIF A;  1SFX A;  1IRF A;  3V7C A;  4MEY F;  5D6F A;  3I71 A;  1FLI A;  1L3L A;  2IA2 A;  4ZZD A;  2A07 F;  1IN5 A;  2OQG A;  3HRU A;  1MD0 A;  4O5V A;  1UCR A;  5KVR A;  3ISP A;  3BOQ A;  5L3B A;  3K0L A;  5DCF A;  4ESJ A;  4ZYE A;  4DNC A;  4NQW A;  1ZRE A;  2IP2 A;  1ZAR A;  1HW5 A;  2HR3 A;  3E5X A;  3ZMU A;  4G6Q A;  1P4W A;  3P9C A;  1PUE E;  3T1B A;  1XSX A;  4G94 A;  1BIA A;  3SXY A;  3EYI A;  1R36 A;  3T8T A;  3R6S A;  3M8E A;  3MWM A;  1Z6R A;  4OIN F;  1YLF A;  2IT0 A;  3V7S A;  2KRF A;  2QZ8 A;  4WF2 A;  5K5Q A;  4EGZ A;  3LST A;  1MKM A;  2IVM A;  5KK1 A;  2YPR A;  5CLS A;  1ZLJ A;  1XGN A;  3ZP5 A;  1TW3 A;  2STT A;  4TV7 A;  2VT2 A;  1H9G A;  3GFL A;  2HWV A;  4A6D A;  1O3S A;  4BH9 A;  4EJV A;  2Z5U A;  3FXR A;  4LJZ F;  1BJA A;  1YIO A;  2BV6 A;  1KA8 A;  4EM2 A;  1T6S A;  1YW8 A;  4LK0 F;  3E6C C;  3SZT A;  2W57 A;  3BZ6 A;  4RAY A;  4KMF A;  1ZH5 A;  1K78 A;  3ZPL A;  1FX7 A;  1IN6 A;  2DBB A;  3KP4 A;  2A68 F;  1KU9 A;  2YR2 A;  2IJL A;  4CO8 A;  1XCV A;  3HHH A;  3WG9 A;  4HF1 A;  1I1G A;  2O0Y A;  4CXF A;  4HZF A;  2EB7 A;  2WTE A;  4GYI A;  3GWZ A;  4S05 A;  1F1Z A;  1NHA A;  3I0T A;  4A0Y A;  3EDP A;  2PFB A;  1SMY F;  5LGT A;  4LFU A;  4OU0 A;  3HHG A;  2IA1 A;  1KYZ A;  1LEA A;  4O6J A;  1P4A A;  3WTW C;  2HTJ A;  2HKX A;  2XAQ A;  1RIO H;  5LHG A;  2KJC A;  1FT9 A;  2A6E F;  1Z91 A;  2XIG A;  2ZCW A;  1T0F A;  3GFJ A;  2F5C A;  1D8K A;  3QP6 A;  2IRF G;  4KIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...