2FBIA

The crystal structure of transcriptional regulator pa4135
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
136
structure length
136
Chain Sequence
RPSLTLTLLQAREAAMSFFRPSLNQHGLTEQQWRVIRILRQQGEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAPKDQRRVYVNLTEKGQQCFVSMSGDMEKNYQRIQERFGEEKLAQLLELLNELKKIKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords probable transcriptional regulator
publication title The crystal structure of transcriptional regulator PA4135
rcsb
source organism Pseudomonas aeruginosa
total genus 57
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fbiA00
2XAGA 2XAFA 1SD6A 1ZAOA 2COMA 5E17F 2GA1A 1UB9A 5BS6A 2M45A 5DYMA 1A04A 4DNCA 1B6AA 4ZYGA 1ZG5A 1TTYA 4A5NA 3Q9VA 1LEBA 1SMYF 1X3UA 2PG4A 4EGYA 2DLLA 2P5VA 3ZQ7A 3FM3A 3SQNA 3F23A 1MDMA 3M8FA 1O3QA 1ZREA 1FBQA 1XGMA 3LA7A 1BI1A 4DQ2A 4R8HA 2MH2A 4HBLA 2KIFA 3BZ6A 4S05A 4XRFA 1JE8A 2GAUA 1IN6A 2PQ8A 2EFWA 5HDKA 5HS8A 2PI0A 4ZZLA 1YW7A 1BC8C 4XLPF 2DU9A 3KFWX 4JK1X 2VBXA 1I6XA 5JHUA 3I64A 1J0RA 4HX8A 3RKXA 1MJAA 3V8JA 2V9VA 1TW3A 5KK1A 2XAQA 3GWZA 3IC7A 5LGUA 3OOPA 2VN2A 1R1TA 2NNYA 3PQJA 1QZYA 5LRRA 3BY6A 5E18F 4KN4X 2EA4A 2MBFA 1R23A 1YYVA 4WXCA 4LMYA 4MGRA 4LLLA 3BOQA 4JBAA 1XDSA 3HUGA 3K2ZA 3KCCA 2QWWA 3LSTA 1I27A 4UUVA 3TOAA 1LDKB 3K1NA 1ODDA 3WTSC 4EJTA 2ZMEB 3HOSA 2FF4A 4EM1A 1Q1HA 1KYWA 2W24A 4XSXF 1USSA 1PUEE 4LG0A 4L9JA 2JSCA 5IT3A 2XROA 4U7BA 2F5EA 2EV6A 2E7XA 5L3FA 4ZYEA 1LVAA 3CUQA 3KP3A 2P7VB 4YIIA 3F8BA 2RVCA 1O7LA 1GHCA 1SFUA 2W25A 1W5TA 1MZBA 1OMIA 3M1EA 3I71A 2V1UA 3RIRA 1TNTA 2P7CB 4QWQA 3HOTA 3RPQA 4FHTA 2GA2A 3N97A 3ZMDA 5FFXA 4LK0F 1Y0UA 3WODF 4RGXA 1DP7P 4U88A 2HEOA 2L02A 4A0ZA 5JFRA 4ON0A 5HLGA 3T8TA 4LB5A 5E8IA 1U6GA 3IKVA 4RB1A 3SZTA 2DK8A 2XAJA 2HR3A 2KRFA 2Q2EA 5DCMB 3WTTC 1BJAA 1G3WA 1IN7A 1FP2A 5LBQA 4UHTA 3WE3A 4MTEA 1RIOH 1HW1A 2ESNA 2R7DA 3QP5A 3K69A 3VEPA 1XGSA 5LHHA 3LA3A 4F7ZA 3GFMA 4D0PA 2IPQX 2Y75A 2XUBA 2J5OA 4HV6A 1K78A 2Y0MA 5LLQA 3FXUA 4EMSA 4PDKA 5F6FA 3O2PE 1XMAA 3ZMSA 1TLHB 3E6MA 1QQIA 5JI6A 2RKHA 4PCQA 5ICFA 2BGCA 4UVCA 4PGHA 3EETA 3AAFA 1FPQA 2XASA 2D45A 5ILSA 3KE2A 5FGMA 1USTA 4EJVA 3HTUA 1MGTA 3R0JA 4KIGA 4KIBA 4AVPA 1ZRCA 1HW5A 1MJ9A 2J5PA 2XIGA 1T6SA 1KQ9A 1XN7A 1EH8A 3SXYA 1S6LA 5IT9Z 2DBBA 2IA0A 4HX7A 1YW9A 2RN7A 2MLGA 2ISYA 4OU0A 5HDNA 2QZ8A 5JVTA 1ZH5A 2EB7A 3DQVC 3GW2A 2K86A 2OQGA 5DD4A 1KU3A 4GO1A 3GO5A 4B8XA 3GFLA 2CO5A 3MFKA 4KNYA 3MEXA 4FX0A 5DV5A 1W7PB 2XHKA 2H94A 4ESJA 3I54A 2FRHA 1IAWA 3ISPA 1LB2A 3RI4A 1TBXA 4L9VA 5EEGA 1G3SA 2P6SA 5BPDA 2R3SA 3F22A 1F4KA 4MTDA 2UXNA 2KKOA 5FLXK 1Z6RA 1XSDA 1GXPA 2NNNA 4ZYDA 1R36A 1KU7A 2AS5F 2HYGD 1YS7A 1L0OC 1FX7A 3U9GA 4HDUA 3FHZA 3KZYA 3I58A 5J8FA 2STTA 2OBPA 3T8RA 1CF7A 4Y15A 4O6JA 2RDPA 4BHBA 1IXRC 2Z3YA 4Y13A 3TGNA 3SZPA 4RB2C 5ICCA 1T98A 3LFKA 4RGSA 1O3SA 1CF7B 4LB6B 2FMLA 2PEXA 5A2QK 3I59A 1FSEA 3M7GA 1BIAA 2A5YB 2RNJA 4LLNA 2EV0A 4EM2A 2L54A 3JTHA 2QQAA 2F5DA 3V7SA 5BOXA 4U7DA 4NHJA 5BPIA 1VTNC 2G9WA 2A69F 2FXAA 1Z91A 3P7NA 3GZ5A 2IRFG 3WGIA 4HDVA 2BBYA 2DQRA 2Q8KA 1P4XA 2IW5A 1TW2A 2VT3A 2A61A 4ZZDA 4O3MA 4OIPF 4M9ZA 4IRIA 1XSVA 1O3TA 5IT9K 2TDXA 1R7JA 1O57A 2RV8A 2PFBA 5HDGA 4WF2A 4LFUA 4L0ZB 4M74A 1UFMA 5CYVA 4EJWA 1OYIA 1BOAA 1CGPA 3U1DA 4IHSA 3FZVA 3DPTA 3LWFA 2V6CA 4P96A 5K1YA 2HGCA 1ZGJA 3RKYA 4AWXB 3KP5A 3J80Z 5E1WA 3QPTA 5L3EA 2EV5A 3NEUA 1ZGAA 5D5UB 2HZTA 5KVRA 4P5OA 1SD5A 4HYEA 1SMTA 2KJBA 3ZN1A 4WCGA 2X0LA 3HIFA 2P5KA 5K5RA 4G7HF 1PP8F 4I02A 3ZMTA 2NRAC 1B9MA 1D3YA 2BYVE 3K1PA 1YIOA 3BROA 2IA1A 3G3ZA 2FOKA 2E1NA 4OMYA 3CUQC 4L5JA 2E1CA 3W6JB 3I5UA 4IJAA 5ICEA 3EYYA 3JTGA 1FZPB 3LAPA 1FYKA 3F8MA 1TQMA 4M73A 3JSPA 2VBYA 2O3FA 4R79A 3MZYA 4KDPA 2L01A 4CO8A 2QBYA 1S3JA 5AIQA 3MQ0A 2DFIA 1S8NA 3QRFF 2VONA 3ECHA 2P6TA 3HTSB 3N4MA 3VODA 4ASNA 3HHHA 1REPC 3BPXA 4CXFA 1FYLA 1MDMB 5LEJA 5DD8A 3TO9A 2WV0A 1JHFA 4WXHA 2JT1A 2L4AA 2JZYA 1V3FA 2ZXJA 4EQQA 4MHGA 2CWEA 5LGTA 2GXBA 3W6KB 4EVIA 2K4BA 3GFJA 1B59A 5ILUA 3DXJF 1XGOA 1ZG3A 2KIMA 1MD0A 3BWGA 3R4KA 3E6BA 4P9UA 5BMZA 1TQIA 2QVOA 3EDPA 3JAMK 3DV8A 1YFHA 2HQRA 4OIRF 5F1RA 2CGPA 3HRUA 1KQ0A 5HVQC 5J6XA 1XSXA 5DDGA 3IL2A 5DEQA 4M71A 3DP7A 1S7OA 3KP4A 2VBWA 2JRTA 3G73A 1YTYA 4M6XA 4G6QA 2CQKA 4CZZA 3J80K 2ZNZA 2ADUA 3BJ6A 4Q47A 1GXQA 1SAXA 2LF7A 4UXNA 3QOPA 4M9XA 3ZMZA 2KIUA 4OMZA 4EM0B 1F1ZA 4I0AA 2LNBA 2O8XA 2BEOA 3E3VA 3DEUA 3L7WA 3KP2A 1LDJA 5BQTA 2OQRA 3MCZA 2A3SA 4KT5C 2NS0A 2FEZA 3IWZA 1MKMA 5ILVA 3KEOA 4GYIA 1HKSA 3RJPA 1IXCA 1FP1D 1KQ8A 3E5XA 3KZZA 1HSJA 2HOEA 3K9TA 4G94A 4K2EA 2K27A 4HAMA 4LG0B 1G3YA 2NAZA 3F3XA 3WU0A 3ZMUA 2VXZA 5CJ9A 4KMUX 2LKPA 3CUQB 3LQRA 3BJAA 4Q4ZF 3KETA 3GYHX 5L3BA 2R7FA 4EJOA 1RNLA 1FC3A 2PJPA 3FXRA 1FT9A 1XCVA 2D1VA 1WSUA 3QPHA 5H6RA 2PN6A 5FLXZ 4O5VA 4XBFA 1HBXG 4G7OF 2FMYA 4IPAA 3CLOA 3CUOA 4LLGF 4BAYA 1BBYA 4RGRA 2F5FA 3FM5A 5HLIA 3VOEA 2QYOA 1RI7A 4MQ9F 1LQ1A 4H0EA 3H92A 3S2WA 3D5LA 1XD7A 4A5MA 2M87A 1ON2A 3DF8A 4KUMA 1K7AA 1P4WA 4UNOA 4HQMA 5CVVA 2ZJ2A 4HV5A 4L9TA 1WQ2A 1D8JA 3F72A 3WU1B 1FY7A 2HYFA 5TJJA 3QP6A 2Z33A 2FA5A 5A2QZ 2LF8A 2YR2A 2O03A 3I4PA 3GX4X 2A07F 3WE2A 5DUKA 4AIKA 5FD6A 4HF0A 1K78B 2E7WA 1Z05A 3R0AA 1J9IA 3Q5FA 2OZ6A 3O6BB 3HRMA 3EYIA 1JHHA 4YIFA 3H3ZA 2EWNA 1T38A 3COAC 3PFIA 3MZHA 2ZNYA 1YS6A 1EH6A 1G6NA 2HWVA 1Z1DA 3BPVA 5JR3A 3WTYC 4Y17A 4IF4A 3ZMVA 3B02A 4JQFA 1T0FA 4HQEA 3NRVA 5E20A 4YG2F 2LSOA 2DT5A 1EH7A 3F8FA 1WRJA 5ICGA 3HRSA 3T0YA 1MJBA 2P5LC 3R61A 3RYRA 4A0YA 3WTWC 2PLYA 1T39A 3D0SA 4YFNF 3WGGA 1XMKA 3E6DA 2RGVA 4IXAA 1ULYA 4IHTA 2MH9A 5F64A 4BHCA 2NYXA 4NB5A 4KA4A 2VOPA 3FX3A 3L00A 4I0BA 3J81Z 1D5VA 3HYIA 2YX7A 5CVIA 2IJLA 4Q5SF 1TNSA 4RS8A 3V8LA 2M5WA 1LNWA 1YW8A 1Z6TA 3JSOA 5ERIA 2JTVA 3SFZA 5J8CA 3FF5A 1V4RA 4N0BA 3M9AA 1BI3A 3FMQA 2D2WA 2DI3A 2Q0OA 1BI0A 3CTAA 4UV9A 2XVCA 2ZO4A 2A6HF 2ZCWA 1R5HA 1F5TA 6PAXA 1IXSB 4IRHA 2P4WA 2VT2A 1HSTA 5HOOA 2H27A 5LHGA 1R1VA 4G8XA 4RAZA 3F8NA 1R58A 4ESBA 2MLKA 2EA2A 1H9GA 2VE8A 3H3UA 1W7PD 4L18B 4HW0A 3L9FA 2ZFWA 3F21A 4M9SA 3R60A 1U5TA 3I59B 1BIBA 4RGUA 1QO0D 4QLCU 3J7AO 3BP8A 4P9FA 2HKOA 1B4AA 1XGNA 3CO6C 4G7ZF 2OU2A 2IT0A 1DUXC 1WWXA 1OYWA 3ELKA 3M8EA 2OAZA 2QM3A 4HLYA 4BYYA 1JXSA 1OKRA 1FWZA 1IRFA 2UXXA 5HS9A 1ZRDA 1XCBA 3JAMZ 2XKPA 3C3WA 3RDIA 3IRRA 1BM9A 3U2RA 2Z99A 3K1MA 3WTVC 2W85A 2L4MA 2CW0F 3ULQB 4L0YB 4AIHA 1QGPA 1AOYA 3R6SA 5HLHA 1SFEA 5LRSA 4GCVA 4FX4A 2DPUA 3V4GA 4LGWA 4MEXF 1B9NA 1YO5C 2CSOA 1ZHFA 2VBZA 2FBKA 5CVRA 4ENNA 3J81K 2C6YA 3CDHA 5H20A 3TDUC 3P9KA 1ZARA 5D8LB 1OR7A 1RZ4A 1FOKA 2V1XA 1I1GA 5K5OA 1ZG1A 4Z2YA 3TQNA 2OZUA 3QU6A 5DCFA 2WTEA 2KJCA 2EK5A 2DO7A 1UHWA 3GLXA 5D6FA 1P6RA 3C18A 1U8RA 1J5YA 2HQNA 1P2FA 2O61A 1GVJA 3FMSA 1WI9A 2RQPA 1LEAA 1E2XA 3I53A 1S29A 4CDGA 4I98B 1FLIA 1IF1A 4AIJA 1ZYRF 3WTUC 1D8KA 3VB2A 3L09A 2O6GE 4RAYA 5TRDA 3MWMA 1I5ZA 2DW4A 2F2EA 2FSWA 1DPRA 4GGGA 4A6DA 1BC7C 2FU4A 3RKWA 1E17A 2Y48A 2F5CA 2CYYA 5E1ZB 4A0XA 1RUNA 3LQQA 4HF2A 2DAOA 2QBYB 1BN5A 3IRQA 3DKWA 2MC3A 2ESHA 1WKMA 5CVJA 1H9TA 1NHAA 5DUIA 3V8KA 3RTRA 2EFPA 4ENMA 4I09A 1HW2A 1U78A 3KLOA 1FBUA 1HKQA 5L3CA 1U3EM 5FO5A 1YG2A 1ON1A 1OPCA 1FSHA 3WGHA 3ABTA 3E97A 4GXOA 2YU3A 4YFKF 1QBJA 3B73A 4FT8A 1P4AA 2VC1A 4OOIA 4YFXF 1F9NA 1P92A 3V7CA 3BDDA 3OV8A 3ZN0A 4UV8A 4TV7A 3HRTA 4UVBA 4ZH4F 2STWA 2AXLA 1G3TA 4ENKA 3F6OA 4KFCA 1UHMA 2FE3A 1DDNA 3FMRA 1ZRFA 1ZLJA 4I01A 4ZYHA 2PMUA 4OIQF 4WK8F 3TO7A 2B0LA 2Z5UA 2P8TA 2VC0A 1EV7A 2ZMEA 3QAHA 1IN5A 2FNAA 3SHFA 2K02A 1LJ9A 2ACJA 2GIVA 2EFNA 1HXDA 4N9HA 4I7HA 2BV6A 1ZN2A 3F6VA 4B09A 3GFIA 5AIPA 4HZFA 4ETSA 4IVNA 4L9NA 2EJRA 2HS5A 2FQ3A 2FBHA 3KP6A 2QQ9A 2HFHA 1O3RA 1J75A 4LK1F 5AONA 1IUYA 3GUDA 5D5WB 3DFGA 3LA2A 1J59A 5L3DA 3T5XA 3GVAA 1AWCA 3IKTA 4KYWA 1JGSA 4UVAA 1R1UA 3C7JA 2XV4S 1SD7A 2YX4A 2XGXA 2G7HA 3F8CA 2XRNA 4A6EA 2DTRA 3HSEA 1L3LA 3EUHA 1FYMA 3LAJA 4WX9A 5DCMA 4HX4A 1YLFA 4HLXA 4U0YA 3DPLC 5D5XB 2W84A 1KA8A 2A6EF 1KYZA 2K7LA 1UCRA 1O7FA 2H6CA 4E70A 2DK5A 3TKYA 2HKXA 4LJZF 1IRGA 4IRGA 5FFZA 3ZP5A 1XDUA 5LHIA 1U5TC 4PZJA 1C0WA 2PMHA 2ZBKA 3CO7C 1KGSA 5K5QA 2L3DA 2Z9OA 4NQWA 5FD5A 4PGGA 3FWEA 5E1XA 3QU3A 2M8EA 2OA4A 2BE5F 2UWMA 1W5SA 4KN7X 3TOBA 2QQBA 1IN8A 3GEZA 1LDDA 3T1BA 4CHUA 2VOOA 3HSFA 4U0WA 1QZZA 2GXGA 1J7KA 3E5QA 4BNCA 3HSRA 4BXUA 1Z7UA 3REOA 2MA3A 4ENJA 3ERED 1ZLKA 2K4JA 3KP7A 1S7AA 3P9CA 2ELHA 2QLZA 3WTZA 3FXQA 2DQLA 4R1HA 1IN4A 1Z9CA 5D8KB 2JPBA 4G6DA 2W57A 1IW7F 4LD5A 2M1BA 1SD4A 3P9IA 3ABUA 3MAJA 1T2KA 2GWRA 3C1DA 1KU2A 1PP7U 2HTSA 2VE9A 3RPUA 1HKTA 3WTXC 2XAHA 2OD5A 1IZ1A 1W7PA 4ESFA 3Q9SA 3ROUA 5E8GA 2LDUA 4A12A 1R22A 1YQAA 2RC4A 4I2OA 2H6BA 1QPMA 4HF1A 5CLSA 4S04A 5D4SA 1B1BA 3NQOA 2EFQA 4RB3C 1G4DA 4M72A 3ML6A 4OINF 1PDNC 5D5VB 3ZPLA 1W4MA 5ED4A 3TDZC 2FNPA 4MQVA 1KU9A 4XLNF 3GZ6A 2XKOA 2PBIA 2QENA 5LEKA 2VODA 3RYPA 1R5GA 2H09A 3CJNA 4CYDA 5EEHA 3O3KA 4MEYF 3EQLF 2IA2A 3TO6A 1RUOA 1TQPA 2GQQA 4BH9A 5LGNA 1U5TB 4CICA 3IWFA 4GYGA 3K0LA 4KMFA 2IVMA 3E6CC 2G7UA 4BQAA 2HTJA 1ONVA 4OIOF 5HS7A 4WWCA 2V79A 2CG4A 2YSRA 3VFZA 1QNTA 3GXOA 2WC2A 2GZWA 2MD5A 4A2UA 3HHGA 3WG9A 2DPDA 2UZKA 4P55A 4L5IA 4HA8A 1H0MA 5L3GA 3L2CA 1STZA 1XB4A 2X4HA 3IHUA 3PQKA 5D4RA 3BJOA 4BHPA 1FBSA 2CFXA 3KEQA 5D6EA 4EJUA 3KLNA 4EV0A 1K6OA 3E5UA 4KIFA 3I0TA 2HDCA 4RB0A 2YPRA 4WXDA 4XSZF 4M6YA 3JW4A 1BI2A 1U2WA 1K79A 2ETHA 1I1SA 5FB2A 2D1HA 3ECOA 5CVUA 2M30A 4HOBA 2ISZA 1FNNA 1SFXA 2A68F 3V7RA 4Q48A 1DPUA 4KICA 2ZKZA 4AD9A 3GF2A 1J2XA 4G9YA 1HQCA 2JPCA 2V1DA 2WWYA 4N9IA 1OYYA 1R00A 2QUFA 4U0VA 2FBIA 5H6QA 2O0YA 4MNUA 4EGZA 2IP2A 4CGZA 2EFOA
chains in the Genus database with same CATH superfamily
2XAGA 2XAFA 1SD6A 1ZAOA 3JCUC 2COMA 4RDUA 1B8IB 5E17F 1JKPC 2GA1A 3CMAI 1APLC 1UB9A 1IRXA 1YX5A 3PIOF 5BS6A 3PJRA 2M45A 2KP6A 5DYMA 1A04A 4DNCA 1QZEA 3S1MJ 1B6AA 4ZYGA 4B48A 3JRBA 4XN0A 3RSNA 3PIPF 1ZG5A 2Y0SN 1TTYA 2XPUA 3EUHC 4Y7NJ 3K2AA 4Y3OA 4A5NA 3Q9VA 1LEBA 1SMYF 3H5NA 1X3UA 2PG4A 3HXLA 4EGYA 2DLLA 2P5VA 2EINH 3ZQ7A 3FM3A 3HEFA 3SQNA 4DYCA 3F23A 1MDMA 3M8FA 4QPOA 5CKTA 1O3QA 1ZREA 1FBQA 2ZFUA 1E3OC 5J1RA 5GAHJ 1XGMA 1EA3A 1X3ZB 3LA7A 3H9JA 1BI1A 3MZ8A 4DQ2A 2LY1A 4R8HA 4A3GJ 2MH2A 3N05A 2KIFA 3BZ6A 4HBLA 4S05A 2O7OA 4XRFA 5IP6A 1JE8A 1T56A 2GAUA 2E71A 1IN6A 3EUKL 2M7BA 2PQ8A 2EFWA 1VQ7I 5HDKA 2QSHX 3ZGKA 5HS8A 2PI0A 4ZZLA 3S17J 1D1CA 3WG7H 2DOAA 1YW7A 1BC8C 4GDFA 4XLPF 2DU9A 3KFWX 5EG0A 4JK1X 2VBXA 3A03A 1I6XA 2L7KA 2JA5J 4M3GA 5JHUA 4CH7A 2XF5A 3I64A 1J0RA 4ANJA 4BJ6C 2HOTA 2DOEA 3I4MJ 4HX8A 3RKXA 1MJAA 2Y69H 2E60A 3VYUB 3BZKA 3V8JA 2V9VA 2IGKA 1TW3A 4YRVA 5KK1A 2XAQA 3GWZA 4XKCA 3IC7A 4JX4A 3K10A 3D5SC 3VYTB 2JK3A 4JX5A 1JUMA 3BR2A 2VN2A 3OOPA 5LGUA 1FJLA 1R1TA 4IQJA 2KFDA 2NNYA 3PQJA 3Q0UA 1QZYA 5LRRA 3BY6A 5E18F 4KN4X 2KRHA 2GXAA 4B1RA 2EA4A 2MBFA 1R23A 2LY2A 1YYVA 1XTAA 4JYKA 4WXCA 3JRIA 4LMYA 4MGRA 3CCQI 1VQOI 4LLLA 1IV8A 3BOQA 4JBAA 3ZQGA 1XDSA 1FTTA 2VQHA 3HUGA 3K2ZA 4P1WA 2JVHA 3CQZJ 2L2OA 3KCCA 2QWWA 3LSTA 1OCCH 4B44A 5JVGF 2HXOA 1PUFA 2JJ7A 1I27A 5B66C 2N8GA 3RZDJ 4UUVA 3DTEA 3TOAA 1RRJA 1LDKB 3K1NA 2LRDA 4AIDA 2OTLI 3KIOA 1ODDA 3WTSC 1GDTA 4MFDA 3QYEA 4EJTA 2ZMEB 2JA2A 1X58A 1PUFB 3HOSA 2FF4A 5EEAA 3K4CA 4ZDOA 2XPVA 4EM1A 1Q1HA 1KYWA 2W24A 1VQ4I 1UMQA 4XSXF 1USSA 2DDBA 1PUEE 4LG0A 1R71A 3LSIA 4L9JA 2JSCA 5IT3A 2XROA 4AM3A 5J1UA 4U7BA 2CJJA 2F5EA 2EV6A 2KIQA 2E7XA 1ZR4A 5L3FA 4LITA 4ZYEA 4X6AJ 2WAFA 1LVAA 3CUQA 3KP3A 1S7EA 1MW7A 2P7VB 3J7ZI 1V54H 4YIIA 3F8BA 2RVCA 3FBNB 1O7LA 4BDZA 4UB8C 1VQ9I 1X1DA 5DM6F 1GHCA 3HDDA 1Z0XA 3EPZA 1SFUA 1IV6A 2W25A 4BY7J 2LC2A 4JP0A 4E7SA 3DKXA 4CZCA 1W5TA 2H8RA 1MZBA 1OMIA 3M1EA 3I71A 3E1SA 4FQGA 1D5YA 3DCFA 2V1UA 2Y31A 1S72I 3RIRA 3O8HA 1Q1VA 1TNTA 2P7CB 4QWQA 1H8AC 3HOTA 1QHGA 3ZQQA 3RPQA 4FHTA 3CCVI 1SANA 2GA2A 4NNJA 3N97A 3BG9A 3ZMDA 2R7WA 2M2EA 5FFXA 4LK0F 1Y0UA 1R6RA 5FROA 3WODF 4RGXA 1DP7P 4U88A 1U8BA 2HEOA 5KCMA 2L02A 4A0ZA 5JFRA 4ON0A 4XNFA 5HLGA 3T8TA 2WAQA 4LB5A 1OCOH 2BVMA 5E8IA 1U6GA 3IKVA 4RB1A 3SZTA 2IEKA 2DK8A 2XAJA 3PNVA 1UZCA 2HR3A 2KRFA 2Q2EA 5DCMB 4XLFA 5J4VA 3WTTC 4DIQA 1WJ5A 2Y9YA 1R4MB 3CP2A 1UELB 5KAIC 1BJAA 4A3IJ 1G3WA 4XIDA 1RR7A 1IN7A 3P5JA 3QWLA 4EEFG 5EDNA 1FP2A 5LBQA 1ETYA 3K6GA 4UHTA 3WE3A 3LSKA 2LKSA 3OYCA 2Q2EB 1ZGWA 3LOCA 4MTEA 1W36D 1RIOH 1HW1A 5F0HA 3HOWJ 2ESNA 4KITB 3U21A 3FXLA 3OS0A 2CQ7A 2VXDA 2R7DA 4AU7A 3I56I 3QP5A 3K69A 3VEPA 1XGSA 5LHHA 2JN6A 2KLOA 3LA3A 4F7ZA 3GFMA 4D0PA 2ZSIB 4QTRA 2IPQX 1NG6A 1IGNA 4Y52J 1YX3A 2LD5A 1FOYA 4C9YA 2Y75A 2XUBA 2AHQA 2LLKA 1JT6A 2J5OA 3S14J 4HV6A 1K78A 2Y0MA 1UHSA 4NQWB 5LLQA 3FXUA 1SVOA 4J00A 3BTLA 4A3EJ 1MMDA 2MD0A 4EMSA 4ZDPA 4PDKA 5F6FA 3ONQA 3WHBA 4IZZA 3O2PE 1XMAA 3ZMSA 5IOYA 2OCCH 3G6EI 3DU6A 4IEJA 4XLCA 1TLHB 2WY7Q 3E6MA 5F04A 1K61A 1QQIA 4ZDLA 2WAEA 5J47A 4V2GA 2KL4A 1MNEA 1Z3YA 5JI6A 2RKHA 4PCQA 1Y56A 4IQ4A 4F92B 2VKHA 1KZHA 5ICFA 2BGCA 2KHMA 3A01A 4D1QA 3G1OA 4UVCA 4PGHA 5CPRB 3EETA 3AAFA 5M3MJ 1FPQA 2XASA 2D45A 3AL0C 1X1BA 5ILSA 1FIPA 2DJIA 2Z2SB 3KE2A 5FGMA 1USTA 2FD5A 4EJVA 2K3PA 3HTUA 1MGTA 3R0JA 4KIGA 4KIBA 4AVPA 1ZRCA 1HW5A 3HC7A 1MJ9A 2J5PA 3OWTA 2XIGA 1T6SA 2KPMA 1KQ9A 1XN7A 1EH8A 2CQQA 2EZIA 1S6LA 3SXYA 5IT9Z 4XL9A 1FOWA 3K70C 2DBBA 2IA0A 4HX7A 2QQ8A 2QSGX 1YW9A 1N78A 1A36A 2RN7A 2MLGA 2X9DA 1D0ZA 1XG1A 2ISYA 4DYQA 3GTLJ 4OU0A 5HDNA 2QZ8A 4A3FJ 2DFEA 1UG2A 3F9KA 5JVTA 3MMYB 1ZH5A 2EB7A 3BTCA 3DQVC 3GW2A 2K86A 2OQGA 2X1DA 1XMXA 3LSHA 5DD4A 2E1MC 3AG4H 1KU3A 4GO1A 3GO5A 4B8XA 1VQNI 3SYTA 3FKJA 1MBFA 2XGEA 3GFLA 2CO5A 3MFKA 2V6EA 4KNYA 3MEXA 3GBGA 3JRHA 4IOAF 3HJEA 4FX0A 2FQ4A 2VKDA 4NC7A 1A35A 2HU9A 5DV5A 1W7PB 2XHKA 2H94A 2OPTA 4ESJA 2RNGA 3I54A 2FRHA 1IAWA 3ISPA 2QKMB 1VF9A 1LB2A 3RI4A 4I99C 2DJNA 3OR2C 1TBXA 4L9VA 5EEGA 1G3SA 3OR1C 2P6SA 5BPDA 2R3SA 3F22A 1F4KA 2Y0SA 4MTDA 2UXNA 2E2JJ 2KKOA 4KJZA 5TGTA 5FLXK 2DMUA 2P81A 5IY5H 1IC8A 1Z6RA 1K4SA 4FTHA 3DKYA 4B47A 1XSDA 1GXPA 4NC6A 2NNNA 4ZYDA 2QF7A 1R36A 1KU7A 1BOBA 3FXKA 2AS5F 2HYGD 4E6KG 1YS7A 3ZXSA 1L0OC 1MIJA 1PVEA 1FX7A 4H4KC 5F0CA 2VASA 2M8GX 4BACA 3U9GA 4HDUA 3L2WA 3FHZA 1JI8A 3KZYA 3GTKJ 3I58A 2DMQA 3PNTA 5J8FA 2STTA 2OBPA 3T8RA 1CF7A 3PNYA 4Y15A 4O6JA 1QHHD 2RDPA 4BHBA 1IXRC 2Z3YA 4X0GA 3HM5A 4Y13A 3OYAA 3JR9A 3TGNA 2K85A 3SZPA 4RB2C 5ICCA 2B7EA 1T98A 1WVRA 3S1NJ 5DTDA 1AA7A 4RMNA 3LFKA 2OCEA 4RGSA 1O3SA 5DS9A 5B3SH 1CF7B 4LB6B 3S8PA 2JA6J 1ETWA 4BEHB 2FMLA 2PEXA 5GTIC 3W2AA 2M0MA 5A2QK 3I59A 1FSEA 1LVKA 1NK3P 3M7GA 1BIAA 3LMMA 5J40A 2A5YB 4FCYA 2RNJA 4LLNA 2EV0A 2VLAA 4EM2A 3CCRI 3ZOBA 2JA8J 3IH2A 2VQCA 2L54A 4J19A 1FTZA 3M8JA 3JTHA 5FRNA 3C2GA 2QQAA 4UB6C 2F5DA 3V7SA 5BOXA 4U7DA 4NHJA 5BPIA 1VTNC 2G9WA 1I50J 2LG4A 2A69F 2FXAA 1Z91A 2IXSA 2MW8A 3NAUA 2ZC2A 3P7NA 3GZ5A 1JUPA 3W2VA 3OY9A 2IRFG 3B6CA 1RETA 3A0BC 3WGIA 4HDVA 1VQPI 1JTXA 2BBYA 1ZKGA 1OFCX 2DQRA 3IUOA 5E3LA 2Q8KA 3AG3H 1P7IA 1P4XA 2IW5A 2HNHA 1TW2A 2M3AA 2VT3A 3HG9A 1MH3A 3E7LA 2LP0A 2AXTC 2A61A 4ZZDA 2IAIA 1N75A 2QGUA 4O3MA 4OIPF 2ELJA 5IP9J 5EZGA 4M9ZA 4IRIA 3SDGA 1XSVA 1ITYA 1O3TA 5IT9K 3G4SI 1IDYA 1W5CC 3H35A 2TDXA 3LSGA 1R7JA 1O57A 1ETKA 2RV8A 2PFBA 5HDGA 1GLNA 4WF2A 4LFUA 4L0ZB 3A0HC 1ETQA 4M74A 5FLVA 3AL0B 3CZ6A 1UFMA 5CYVA 4EJWA 1OYIA 1OJLA 1BOAA 1GV5A 3HOZJ 5F08A 4IO9F 1CGPA 2R5ZB 3CMYA 4NUBA 3U1DA 4IHSA 2WV1A 4YELA 3FZVA 3VYRB 3DPTA 2LR8A 3AFHA 3LWFA 2DCEA 2V6CA 3GTJJ 4P96A 5K1YA 2HGCA 1QA6A 1ZGJA 5GTHC 2PJRB 3RKYA 4AWXB 3MKLA 2KZVA 3KP5A 3J80Z 5E1WA 2EIKH 2K9SA 4ABZA 3QPTA 5L3EA 4Z6YA 2EV5A 3NEUA 1ZGAA 4DJAA 2ME6A 5D5UB 2HZTA 5KVRA 4P5OA 1SD5A 2E1MB 4HYEA 1SMTA 2KJBA 3C2BA 1ETOA 3ZN1A 4RM2A 2ZSHB 2WBMA 4WCGA 4RM3A 3H9QA 2X0LA 3HIFA 4I76A 2CS3A 3PM1A 2P5KA 1MMNA 5K5RA 1LE8B 2NOGA 3GTPJ 4G7HF 1PP8F 3G1LA 4I02A 3ZMTA 1AKHB 2NRAC 3GTQJ 1B9MA 1D3YA 1VFCA 1WPKA 1G59A 2BYVE 3FISA 3K1PA 1YIOA 3BROA 1POGA 2IA1A 3ASNH 3G3ZA 4HPQA 2FOKA 2E1NA 4OMYA 3K4BA 3CUQC 4L5JA 1E3PA 1WFXA 4PSXA 5BNGA 1R5ID 2COBA 2X48A 1JJ8C 2E1CA 3FK7A 3W6JB 3I5UA 1HCRA 4IJAA 5ICEA 3EYYA 1LKXA 2B63J 2X1CA 3JTGA 1FZPB 1YRNA 3LAPA 4II2A 4M3BA 1EJ9A 1FYKA 2XDVA 3F8MA 1TQMA 3I55I 4M73A 2XRLA 4ZC3A 3MKYB 4BE1A 5J4YA 2R7TA 3JSPA 4BE0A 4C30A 2I10A 2VBYA 2O3FA 3S2HJ 3K70D 4DOZA 4R79A 3MZYA 5E3MA 4KDPA 2K3FA 1Y8RB 2L01A 4CO8A 2XF7A 2ZB9A 4DYRA 2QBYA 1S3JA 5AIQA 2RREA 3MQ0A 4HSTA 2DFIA 1VQLI 1S8NA 3QRFF 2VONA 3ECHA 2P6TA 3HTSB 3N4MA 4E7IA 3VODA 4ASNA 2AQEA 3HHHA 3OL4A 1REPC 4A3BJ 2YS9A 3BPXA 4CXFA 3ZQCA 1MNMC 2HPMA 2HVSA 4Y33A 4XKVA 5C44J 1FYLA 2MG4A 9ANTA 3JRFA 3CP8A 5LEJA 5DD8A 3TO9A 1MDMB 1Y39A 2WV0A 1FIAA 1WJAA 4XRSG 1JHFA 4WXHA 2UV1A 2JT1A 5FKLA 2L4AA 5M3FJ 2JZYA 4UUTA 4CA0A 4C2TA 2IGMA 4UY8I 1V3FA 2ZXJA 4EQQA 4MHGA 2CWEA 5LGTA 2GXBA 4B4CA 2X51A 2R7ZJ 1J09A 3W6KB 4EVIA 2K4BA 3L2QA 3GFJA 1B59A 3VSLA 5ILUA 3DXJF 4AUXA 2K9QA 1XGOA 1BW6A 4NDLA 5M5WJ 4IKFA 1ZG3A 2KIMA 1MD0A 2GLOA 3BWGA 3R4KA 3BR3A 3E6BA 3PL8A 1BR2A 4P9UA 5BMZA 1BA5A 1TQIA 2QVOA 3EDPA 3QYBA 3JAMK 2CU7A 1WH5A 3A02A 2R7SA 3JRDA 3DV8A 1X1CA 5EG0B 2NXNB 1JJ6C 1YFHA 2HQRA 4OIRF 1LFBA 5F1RA 3HRUA 5KAFC 3OYBA 1KQ0A 2CGPA 2XGDA 3FXOA 4EATA 1BR1A 3OIQA 3WU2C 5HVQC 1S9HA 5J6XA 2LBFA 3VPRA 1XSXA 3FIWA 2M4KA 4ITVA 4PSWA 1A6QA 4PUSA 5DDGA 3IL2A 2HI3A 5DEQA 2E1OA 4M71A 3DP7A 3G2BA 1S7OA 2R5YA 3UR3C 3CCLI 3KP4A 3TW6A 2VBWA 2KRCA 2ZXHA 2JRTA 3QPLA 2Y9ZA 3G73A 1YTYA 4M6XA 4G6QA 4BJTA 2CQKA 1EKEA 5FKMA 2HVQA 1XX5A 4CZZA 3J80K 3TW7A 3OSGA 2ZNZA 2ADUA 2PMZN 3BJ6A 3PSIA 4Q47A 3J7YJ 1GXQA 2EZKA 2QSFX 1SAXA 1G2HA 1TWCJ 2HOAA 2LF7A 4UXNA 3QOEA 3QOPA 1LPQA 4M9XA 3ZMZA 2KIUA 3KEYA 3PSFA 4OMZA 2BY1A 1DQUA 2VL8A 2VQLA 4KT6A 4EM0B 4E7KA 3FDYA 3M3YJ 1F1ZA 4DZJA 3PUFA 2DOFA 4OWRB 4I0AA 2LNBA 2O8XA 3HUGB 2BEOA 3E3VA 3DEUA 4C3JJ 3L7WA 2UUZA 3KP2A 1LDJA 5BQTA 1K4TA 4GFBA 2OQRA 2E35A 3MCZA 4IOCF 2A3SA 4KT5C 2NS0A 4XONA 2FEZA 3FHNA 4AYBN 1IO2A 3IWZA 5EJCA 1MKMA 1T08B 2KT0A 5ILVA 3CJRB 3IAM2 3KEOA 4GYIA 1HKSA 5FKNA 1IXCA 1FP1D 1QRYA 3RJPA 1KQ8A 3E5XA 4I6ZA 3KZZA 1HSJA 2HOEA 3HB9A 3K9TA 4G94A 4CCJA 2L9RA 1BL0A 1Y6IA 3TP0A 1NH3A 2E36A 4L5EA 2DMTA 4K2EA 4LOCA 2K27A 4HAMA 5E3NA 4LG0B 1G3YA 2NAZA 2DMPA 3OYMA 3BC8A 3F3XA 5K7ZA 4A3KJ 3WU0A 3ZMUA 2FJ1A 2VXZA 5CJ9A 2ICWG 4KMUX 2X6WA 1RESA 5LFAA 4OAYA 2LKPA 3CUQB 3LQRA 3BJAA 4NC8A 4Q4ZF 1R4NB 3KETA 5KHDA 2CQXA 1LFPA 4F91B 5L3BA 3GYHX 2R7FA 4EJOA 3CJTB 5B5EC 1UJ8A 1RNLA 1FC3A 1K6YA 3FXRA 3OYFA 2PJPA 3OYJA 2WADA 4FE7A 2EZHA 4BQNA 1FT9A 1XCVA 2D1VA 4V19K 4A3CJ 3M4OJ 3M1CA 1WSUA 1QPIA 3WHCA 4BS9A 3QPHA 2NVTJ 1AHDP 5H6RA 2PN6A 2OJED 5FLXZ 4O5VA 4XBFA 1HBXG 2LK2A 4G7OF 4BXXJ 2FMYA 3Q0WA 4Y4RA 4IPAA 3CLOA 2CUEA 3CUOA 2A05A 3BG6A 4LLGF 4BAYA 3VDXA 1SFOJ 1BBYA 4RGRA 2F5FA 4IHWA 3FM5A 3K4JA 5B1BH 5HLIA 2E34A 4DGWB 3VOEA 2JUCA 3RQ4A 2TCTA 1MNDA 2QYOA 1RI7A 3KX2A 2MYSA 4FETA 4MQ9F 4H0EA 3H92A 1LQ1A 3S2WA 3D5LA 4AC0A 1XD7A 2W00A 4A5MA 2M87A 1OISA 1OCZH 1ON2A 3DF8A 4KUMA 4FE4A 2XC7A 1K7AA 1P4WA 4UNOA 4HQMA 3BQYA 3Q0VA 3PO2J 4U87A 1NK2P 3MD2A 5CVVA 3CC7I 1G8XA 2ZJ2A 1YJWI 4HV5A 2W7NA 3CCUI 1QVTA 2ECCA 1HA8A 4A3DJ 4L9TA 4AVZA 3H0DA 1WQ2A 4RLFA 1D8JA 1BW5A 1V5EA 3F72A 3WU1B 3CMEI 4A3JJ 1FY7A 1AU7A 3HZJA 2JMWA 2L9SA 2HYFA 3ZQFA 3AG1H 5TJJA 3CCJI 3QP6A 2BY2A 2Z33A 2FA5A 1WJFA 5A2QZ 4E7HA 2LF8A 2V9PA 5GPCA 2YR2A 2IS4A 1X4PA 4CSWA 2O03A 3I4PA 3GX4X 2A07F 4XN3A 2IS6A 4G12A 3WE2A 2CV2A 5DUKA 4AIKA 5FD6A 1Y1WJ 2W48A 4HF0A 1K78B 2E7WA 1Z05A 2L9NA 1LFUP 1WJBA 3R0AA 3OIOA 1J9IA 3Q5FA 2OZ6A 3TL4X 1YIJI 1YJ9I 3O6BB 3HRMA 5K7FA 3EYIA 2CUZA 1JHHA 4YIFA 3H3ZA 3VSKA 4N4OB 4BUPA 2EWNA 1T38A 3COAC 5H2FC 3K4KA 2BZTA 1VQMI 2V26A 3PFIA 3MZHA 1A6IA 2ZNYA 5GPAA 4CCNA 1YS6A 4BXFA 1EH6A 1G6NA 2HWVA 1XPXA 2EBIA 3SEZA 1VNDA 1Z1DA 3BPVA 4FISA 4PFOA 2OTJI 1A31A 5JR3A 3A01B 2HDDA 3WTYC 3FBIB 3H5RA 3K7AJ 4Y17A 5GP9A 2EIMH 4IF4A 1D0YA 3B02A 3ZMVA 1B72A 4JQFA 1T0FA 4HQEA 5CQGA 3NRVA 1FMVA 5E20A 1V55H 4YG2F 2LSOA 2DT5A 1EH7A 3F8FA 1WRJA 5ICGA 3HRSA 3F0CA 3T0YA 4A69C 3L2RA 1MJBA 3C2HA 4PK4A 4F55A 2P5LC 3MKWB 3OYHA 1T8IA 3R61A 4XLEA 3RYRA 5JLXA 4A0YA 4F52A 3WTWC 2VPLA 1Y8QB 2MGQA 2PLYA 1T39A 3D0SA 4YFNF 2DA6A 3OS2A 3WGGA 1XMKA 3E6DA 5C4JJ 3DU5A 3ABMH 3PFYA 2RQQA 2RGVA 4IXAA 1ULYA 2E19A 2HXIA 1JKOC 2MH9A 4C3IJ 4IHTA 5F64A 3SFIA 4BHCA 2NYXA 3A4CA 1I39A 2CH0A 3W6VA 1O4XA 2E2HJ 1TP4A 2CW8A 1ZK8A 4NB5A 4CYCA 4MLOA 4KA4A 2VOPA 3FX3A 5C4XJ 1FEXA 3L00A 2NVXJ 3DBHB 4I0BA 3J81Z 2NVYJ 1ACIA 2E5ZA 4BGDA 1D5VA 1S5LC 3HYIA 5IYBJ 2YX7A 5CVIA 2IJLA 5FLMJ 3BCBA 4RBOA 1TNSA 4Q5SF 4XR6A 4RS8A 3V8LA 2M4GA 2ZJQF 2M5WA 1LNWA 1MMAA 1YW8A 1Z6TA 2BHZA 1X2MA 2CUJA 3DLLF 4DBQA 3JSOA 5ERIA 2QKLB 2JTVA 2VJ5A 4CCKA 3SFZA 4A3LJ 2K9MA 5J8CA 4XOTA 3FF5A 1V4RA 4N0BA 3M9AA 1U0JA 1WJEA 1BI3A 3FMQA 1YE9A 2D2WA 2O8KA 2GOXB 2DI3A 4PJNA 2Q0OA 1BI0A 3L1PA 2M7AA 1DGWY 3CTAA 3S15J 4UV9A 1WGXA 4PJLA 2XVCA 1ENHA 3A1YA 3AKZA 2ZO4A 4CCLA 2A6HF 2ZCWA 3J7AY 3V42A 1MMSA 1R5HA 1F5TA 6PAXA 1IXSB 4IRHA 1JUSA 2LYCA 2P4WA 2VT2A 1HSTA 5HOOA 4W1UA 3CCSI 2H27A 5GAEJ 5LHGA 2L7FP 1R1VA 4G8XA 4KISA 2KISA 4RAZA 3HPGA 3F8NA 1R58A 4ESBA 2EZLA 3RPUD 2MLKA 1SEUA 2EA2A 1YJNI 3OYIA 1H9GA 2DT6A 4C2MJ 2VE8A 3H3UA 1RPWA 1W7PD 4L18B 5F0FA 1OCPA 4HW0A 3L9FA 1TZLA 3QQAA 2CV0A 1ERDA 1T95A 1RKWA 5GADJ 2ZFWA 3F21A 4M9SA 3R60A 1U5TA 3K4MA 3I59B 1DP3A 1BIBA 2BVLA 4RGUA 4A93J 4M6VA 2CRGA 1QO0D 4QLCU 3J7AO 3BP8A 3BG7A 2ID6A 3HBLA 2EILH 3HOUJ 2KDZA 3NWSA 1IRZA 2HPIA 2K5CA 3IP4B 1ETXA 1TWFJ 4P9FA 2HKOA 1I3QJ 2L7ZA 1B4AA 4XRSA 3UKGA 2PMZA 1XGNA 3CO6C 4G7ZF 2L9VA 2OU2A 2IT0A 1DUXC 3HOYJ 1WWXA 1OYWA 2E2IJ 3BT9A 3ELKA 3M8EA 4FASD 2W4SA 2OAZA 5IPAA 3D1NI 2QM3A 3OYDA 4BYYA 4HLYA 1JXSA 1OKRA 3A2KA 1FWZA 1IRFA 2UXXA 3I9V2 5HS9A 1ZRDA 1XCBA 3JAMZ 1UAAA 2XKPA 3C3WA 3BR0A 3RDIA 3IRRA 4QIWN 1BM9A 3U2RA 2Z99A 1T33A 4AYBA 3IH3A 3OSFA 3K1MA 3WTVC 1ZR2A 2K40A 2P0WA 3Q3SA 2W85A 2L4MA 2CW0F 3ULQB 4RLQA 2DA3A 2HDWA 4L0YB 4AIHA 1QGPA 3BCAA 2GBYA 1AOYA 3R6SA 4BY1J 4YIRX 2JA7J 5HLHA 2F6CA 1SFEA 5LRSA 4C2UA 4GCVA 1F43A 1VQ6I 4FX4A 2DPUA 3V4GA 3JRCA 4LGWA 3FXMA 4MEXF 1B9NA 3DEEA 1YO5C 3LSMA 2CV1A 3ZR8X 2CSOA 1X2NA 1WI3A 2KDOA 1Z21A 1ZHFA 2VBZA 1VQKI 2FBKA 5CVRA 4ENNA 3E0JB 3J81K 4V2FA 2C6YA 3CDHA 5H20A 3TDUC 3P9KA 4D5FA 3S3OA 3LSJA 1WJCA 1ZARA 1D0XA 2JUGA 5D8LB 3KYLA 3MN2A 1OR7A 2BW3A 1RZ4A 3NARA 2XSDC 1FOKA 2V1XA 1I1GA 2LOOA 5K5OA 4PJMA 4DZPA 2CW7A 1ZG1A 4Z2YA 3KYCB 3TQNA 2LMDA 2OZUA 3QU6A 5DCFA 2WTEA 2KJCA 3W2WA 2BW3B 2EK5A 2DO7A 1UHWA 3GLXA 5D6FA 2LVSA 1P6RA 3C18A 1U8RA 1J5YA 4BU2A 2HQNA 1P2FA 5KNLA 1MBKA 2W1OA 2O61A 1GVJA 2GOMA 1GT0C 3FMSA 1N25A 1WI9A 1BJZA 3M07A 4N4NB 4YEJA 1SC7A 2RQPA 1LEAA 1E2XA 5HLTA 3BTIA 1S29A 3I53A 1WCMJ 4CDGA 5EGOA 4I98B 1FLIA 3DWLE 3RQIA 1IF1A 4AIJA 1ZYRF 3DBLB 3WTUC 1D8KA 2H1KA 3VB2A 3ZQIA 2VQGA 2XAUA 3L09A 2IS2A 3CCEI 2O6GE 2A6TA 4RAYA 5TRDA 1B8IA 2ZXIA 1ZELA 3MWMA 1I5ZA 2DW4A 2F2EA 1YRNB 2FSWA 1DPRA 4GGGA 4A6DA 1BC7C 3CC2I 2VUMJ 4MFEA 2A5WA 3BTJA 2FU4A 2VJJA 3RKWA 4BL0B 3LNQA 4NBQA 1E17A 2H8WA 2Y48A 4XKBA 1JKQC 3ABKH 2DTZA 2F5CA 2CYYA 1X4OA 2KMUA 5E1ZB 4A0XA 3JRGA 4QSHA 1RUNA 2LY9A 3LQQA 3GMEA 4HF2A 1SVMA 2DAOA 3HKZN 2QBYB 4HSRA 1BN5A 1WHUA 1CQTA 1UG0A 1TL8A 4HG2A 2LH9A 2WB1N 4X1EA 3PO3J 3S93A 2M0CA 3IRQA 3DKWA 4MO7A 4BBSJ 2MC3A 2ESHA 2VPRA 1V5FA 3TEDA 1WKMA 2Z1DA 5CVJA 1H9TA 3DBRB 3LFUA 1NHAA 2QCOA 5DUIA 2DMNA 1TWGJ 3V8KA 3OYEA 3RTRA 5GAGJ 2EFPA 4ENMA 4I09A 1MBHA 1U78A 1HW2A 3KLOA 1X19A 5IP7J 1FBUA 2V1NA 1HKQA 5L3CA 3CESA 1D1BA 1U3EM 4DBRA 2XPWA 5FO5A 2H1LA 2MABA 1HDPA 1YG2A 2WY8Q 2IGNA 3BG5A 1ON1A 1ZQ3P 1OPCA 4E4HA 3ERMA 3WGHA 1FSHA 3ABTA 3E97A 3AG2H 4GXOA 1KONA 3RKQA 3OS1A 2YU3A 4YFKF 1I3AA 1QBJA 3IH4A 3B73A 4M3DA 4IHXA 1Z3XA 4FT8A 1P4AA 2VC1A 2L0KA 4OOIA 1VQ5I 4YFXF 4HNTA 1F9NA 1P92A 2Q1ZB 3V7CA 2BY3A 3BDDA 3OV8A 1VI0A 2LBFB 1GVDA 3ZN0A 4UV8A 3DTIA 4TV7A 2R7UA 3HGYA 1WZ2A 3HRTA 1PJRA 1P7JA 2K9LA 4UVBA 1MBEA 4ZH4F 2STWA 3CF2A 1YITI 2AXLA 3O8GA 1G3TA 4BQOA 3F6OA 4ENKA 2R5YB 4KFCA 1TWHJ 1UHMA 2NVQJ 3S1QJ 1OCTC 2FE3A 1DDNA 4BJ5C 4II3A 2KQRA 3FMRA 1ZRFA 1E0EA 1ZLJA 4I01A 3NWTA 4ZYHA 2PMUA 4OIQF 1SAUA 4WK8F 2R7VA 1T0FC 3TO7A 2B0LA 2DA2A 2Z5UA 1LUJB 2P8TA 2NS8A 4ZTFA 1YI2I 4M3FA 2VC0A 1EV7A 2ZMEA 4BDYA 3QAHA 1IN5A 2FNAA 3SHFA 1R9TJ 4OAZA 3S16J 1GUUA 2K02A 3I4NJ 1LJ9A 2LFBA 4J01A 4XM3A 3S1RJ 2ACJA 4IL6C 2GIVA 2EFNA 1HXDA 3BR6A 1H88C 4HNVA 3H36A 2LTPA 2MFZA 2DT7B 2EQRA 4HEA2 4N9HA 4I7HA 1X1PA 2BV6A 1ZN2A 3BR5A 2DA1A 5HNHA 3F6VA 4PFPA 1D1AA 4B09A 3GFIA 3VWBA 5AIPA 4HZFA 1W0UA 4ETSA 2MSYA 1IG7A 1YOVB 1TT5B 4JX6A 2TRTA 4IVNA 4L9NA 2AO9A 1IUFA 1OQYA 2MC4A 2EJRA 2HS5A 2FQ3A 2FBHA 1H89C 3KP6A 2QQ9A 2HFHA 5EZHA 3UNGC 1O3RA 3GTMJ 2HQAA 1J75A 4LK1F 5K7HA 2LREA 3CJQB 5AONA 3RCOA 3GTOJ 1IUYA 3GUDA 1NTCA 1N77A 1YHQI 2W82A 5D5WB 3DFGA 3LA2A 3OYLA 5L3DA 1J59A 3T5XA 2YUSA 3GVAA 1AWCA 3CDLA 3IKTA 2OC6A 1Y1VJ 4KYWA 4LIUA 1JGSA 1Y0NA 3ZQLA 5FKKA 4UVAA 1MH4A 2ECBA 3HOVJ 1QU3A 1R1UA 3C7JA 2XV4S 1SD7A 2YX4A 2XGXA 1V5GA 2R93J 2G7HA 3F8CA 1QVUA 2B9SA 2XRNA 4A6EA 2DTRA 2VKVA 3HSEA 1L3LA 1WJDA 3EUHA 1WH7A 4HRIA 1FYMA 4D7MA 3LAJA 4WX9A 3BQZA 5DCMA 4HX4A 4IX7A 3CF5F 2DFHA 2I5UA 2K9NA 4ZTJA 1YLFA 4HLXA 1MSEC 2EPFA 4U0YA 3OYGA 3CDIA 3GCMA 4ZYAA 1JKRC 2L5QA 1W1WE 3OMYA 3DPLC 5D5XB 2W84A 5IOZA 3SEQA 5IYDJ 1KA8A 2A6EF 2R7XA 3IV5A 1KYZA 2K7LA 2CUFA 5E79C 3ABLH 2Y2ZA 1UCRA 1O7FA 3OYNA 2H6CA 4B43A 4E70A 2DK5A 3TKYA 1Z77A 2HKXA 4LJZF 2LKXA 4IRGA 1IRGA 2XF6A 5FFZA 3S32A 1ZTRA 2DA5A 3LSPA 3ZP5A 1XDUA 5LHIA 2HQ5A 1EF4A 1U5TC 4PZJA 1C0WA 3H0GJ 4XQFA 2PMHA 2ZBKA 2X6XA 4W97A 3CO7C 2AQFA 1KGSA 5K5QA 2O9LA 2OF7A 2L3DA 4BE2A 4LIVA 2Z9OA 4NQWA 4CCOA 1FOXA 5FD5A 4PGGA 3FWEA 5E1XA 3QU3A 1W0TA 2M8EA 5FRMA 4PJJA 2JSPA 2ZJRF 2OA4A 3G71I 2BE5F 4IHYA 2X6YA 2UWMA 3VYSB 1W5SA 2FOWA 4KN7X 4XK4A 2YU9J 3RZOJ 1DU0A 2JWTA 3TOBA 2ELKA 4XORA 3S2DJ 2QQBA 1IN8A 4E7LA 3GEZA 3OL3A 1LDDA 3T1BA 3L2UA 4CHUA 2ME0A 2VOOA 3HSFA 4U0WA 1QZZA 3D5RC 5M5XJ 2GXGA 1J7KA 3E5QA 4BNCA 3BR1A 3HSRA 4BXUA 5E3OA 2CFOA 1Z7UA 3REOA 5F27A 3LSRA 2MA3A 4ENJA 3ERED 1RR8C 1ZLKA 2BHYA 2K4JA 3KP7A 1S7AA 2VI6A 4C3HJ 2ZJPF 1HLVA 4BQQA 3P9CA 2ELHA 2QLZA 3WTZA 3H9GA 2EH3A 3FXQA 2DQLA 4R1HA 3KPHA 1IN4A 3ZRGA 5JHFA 3KYDB 5C3EJ 1E3HA 1Z9CA 1XC5A 1B72B 5D8KB 1Z67A 2JVGA 4BKXA 1OCRH 2JPBA 4G6DA 4BBRJ 2W57A 1IW7F 4LD5A 2PX9A 3ESWB 2M1BA 2BXZA 2JQ7A 1SD4A 3P9IA 1XS9A 3ABUA 2CQNA 4GRIA 3MAJA 1T2KA 1JT0A 2GWRA 3C1DA 1KU2A 1PP7U 1SVLA 3B6AA 1ORKA 1HC8A 2HTSA 2VE9A 2DYRH 3RPUA 4QPQA 4ZJZA 4CCMA 1OR7C 1HKTA 4XLAA 2R7OA 2XAHA 2OD5A 3WTXC 1IZ1A 3HGGA 2OUMA 1W7PA 4ESFA 1X1AA 2R92J 1HF0A 3Q9SA 1K83J 3ROUA 5JLWA 1U9NA 2XSJC 4UUSA 2IGOA 4B3XA 2DA4A 3QPSA 3GZNB 4CYCB 2R7RA 5E8GA 1IDZA 2IS1A 2LDUA 2NVUB 1HOMA 4A12A 1R22A 3X2QH 3MKZA 4PJ0C 2HZDA 2DN0A 4UUSB 3JREA 3ZCOA 1YQAA 2I8DA 2RC4A 4I2OA 2H6BA 3DLAA 1X3WB 3HKZA 1QPMA 4HF1A 2X85A 2DA7A 5M5YJ 5HNFA 2DDAA 2VKEA 5CLSA 4E7JA 3BG3A 2R4GA 3K4NA 5IYCJ 4S04A 5D4SA 2WB1A 1B1BA 3QYFA 3S3MA 4RAGA 2Z16A 3NQOA 2EFQA 1ETVA 4RB3C 2QEXI 5F1JA 1G4DA 4M72A 2FUG2 3ML6A 1JGGA 3JRAA 3DPUA 4OINF 2F5VA 1PDNC 5D5VB 2BXYA 4D7NA 1Z7LA 2QA4I 3HOXJ 3ZPLA 1W4MA 3FK6A 2DODA 3DEWA 3KZIC 1TWAJ 3TDZC 3U1KA 5ED4A 2FNPA 4MQVA 1IJWC 1KU9A 5CQEA 4BEHA 1P9QC 1U9OA 5B1AH 1PYVA 2F4OB 4XMYA 2V9KA 4XLNF 3GZ6A 3S3NA 2XKOA 2KZGA 5HODA 2PBIA 2QENA 5LEKA 2R0QC 2VODA 1F36A 3RYPA 2XB5A 3FXJA 1R5GA 1JTYA 3SZGA 2H09A 3CJNA 4CYDA 2XGCA 2CMPA 5EEHA 2D5VA 3GLLA 3O3KA 4MEYF 2M9HA 3EQLF 2IA2A 3MVPA 3TO6A 2DYSH 1RC9A 1RUOA 1TQPA 1HDDC 2GQQA 2O5RA 4BH9A 5LGNA 1U5TB 2WAQN 4CICA 3IWFA 3W3CA 4GYGA 4IHVA 2G0EA 3K0LA 4KMFA 5FJ8J 4MIMA 2IVMA 3E6CC 3PUBA 1A5JA 2NOJB 2G7UA 4BQAA 2V7FA 4JOMA 2X1EA 3K4LA 2HTJA 4A3MJ 1ONVA 2X6OA 4OIOF 5HS7A 3I3LA 5EYRA 4F93B 3H5AA 3G1MA 4WWCA 3TBIA 2V79A 2CG4A 2R7QA 2RAEA 2YSRA 3VFZA 1QNTA 3GXOA 3BLYA 2WC2A 2GZWA 3CMMA 2MD5A 4A2UA 1OLTA 2L7MP 3HHGA 4XLHA 1MSFC 3WG9A 4S0HB 1I6HJ 3HL2A 1DU6A 2DPDA 3OYKA 2BY0A 2UZKA 4P55A 4L5IA 4HA8A 1H0MA 2EIJH 2OV7A 3LL7A 5L3GA 2X4HA 1MMGA 1STZA 1XB4A 3IHUA 2F4MB 3QODA 3L2CA 3PQKA 4XKWA 4XRMA 3BJOA 5D4RA 3GTGJ 4BHPA 3DTKA 1FBSA 3CC4I 2DXIA 1DGRM 1BR4A 3OOUA 2CFXA 2R5ZA 3KEQA 5D6EA 4EJUA 2XB0X 2F48A 3H1CA 3OIPA 5J3LA 3IAS2 4D9JA 3KLNA 2NS7A 4EV0A 1K6OA 3E5UA 4KIFA 3I0TA 2HDCA 3BZCA 2GM4A 4M3EA 2ID3A 2FX0A 5TISC 4LG3A 4RAFA 3TP3A 1FMWA 4RB0A 2YPRA 5J1YA 4WXDA 4XSZF 4M6YA 2PJRA 1NG7A 3JW4A 4D5CA 3CCMI 1BI2A 1U2WA 1K79A 1VZ0A 2HYJA 5DM7F 2ETHA 1I1SA 2GIZA 2V4JC 2ZMEC 5FKOA 5FB2A 3SJMA 2D1HA 5EF6A 3ECOA 5CVUA 2M30A 1R49A 2IBDA 2HOSA 1GV2A 4HOBA 2VB6A 2E5NA 1RKTA 2ISZA 1FNNA 1SFXA 2A68F 3V7RA 4Q48A 1DPUA 1VQ8I 4RA2A 1TT0A 1LE8A 1MBGA 4DW6A 1AKHA 1MBJA 4KICA 1M1EB 3FKIJ 2ZKZA 4AD9A 3GF2A 1W36C 1J2XA 4G9YA 2WA0A 5LD2C 1HQCA 3H3VK 3L2VA 3CD6I 4HNUA 2ZXWH 2HVRA 4B3AA 2VJ4A 3CLQA 2JPCA 2V1DA 4XICA 2WWYA 2Y30A 4N9IA 1OYYA 1R00A 2QUFA 3SDBA 2JRMA 4CUGA 4U0VA 2FBIA 5H6QA 4F3QA 2O0YA 4MNUA 2F4IA 3ASOH 2VIXA 1SFKA 3TMOA 1TC3C 2M34A 2VJIA 4G6TB 3ZQHA 5EGOB 3EUAA 2BOLA 3CCYA 4EGZA 2IP2A 4XOPA 4CGZA 2EFOA 3HPHA 2DFFA 4E7ZA
chains in the Genus database with same CATH topology
2XAGA 2XAFA 1SD6A 1ZAOA 2COMA 5E17F 2GA1A 1UB9A 5BS6A 2M45A 5DYMA 1A04A 4DNCA 1B6AA 4ZYGA 1ZG5A 1TTYA 4A5NA 3Q9VA 1LEBA 1SMYF 1X3UA 2PG4A 4EGYA 2DLLA 2P5VA 3ZQ7A 3FM3A 3SQNA 3F23A 1MDMA 3M8FA 1O3QA 1ZREA 1FBQA 1XGMA 3LA7A 1BI1A 4DQ2A 4R8HA 2MH2A 4HBLA 2KIFA 3BZ6A 4S05A 4XRFA 1JE8A 2GAUA 1IN6A 2PQ8A 2EFWA 5HDKA 5HS8A 2PI0A 4ZZLA 1YW7A 1BC8C 4XLPF 2DU9A 3KFWX 4JK1X 2VBXA 1I6XA 5JHUA 3I64A 1J0RA 4HX8A 3RKXA 1MJAA 3V8JA 2V9VA 1TW3A 5KK1A 2XAQA 3GWZA 3IC7A 5LGUA 3OOPA 2VN2A 1R1TA 2NNYA 3PQJA 1QZYA 5LRRA 3BY6A 5E18F 4KN4X 2EA4A 2MBFA 1R23A 1YYVA 4WXCA 4LMYA 4MGRA 4LLLA 3BOQA 4JBAA 1XDSA 3HUGA 3K2ZA 3KCCA 2QWWA 3LSTA 1I27A 4UUVA 3TOAA 1LDKB 3K1NA 1ODDA 3WTSC 4EJTA 2ZMEB 3HOSA 2FF4A 4EM1A 1Q1HA 1KYWA 2W24A 4XSXF 1USSA 1PUEE 4LG0A 4L9JA 2JSCA 5IT3A 2XROA 4U7BA 2F5EA 2EV6A 2E7XA 5L3FA 4ZYEA 1LVAA 3CUQA 3KP3A 2P7VB 4YIIA 3F8BA 2RVCA 1O7LA 1GHCA 1SFUA 2W25A 1W5TA 1MZBA 1OMIA 3M1EA 3I71A 2V1UA 3RIRA 1TNTA 2P7CB 4QWQA 3HOTA 3RPQA 4FHTA 2GA2A 3N97A 3ZMDA 5FFXA 4LK0F 1Y0UA 3WODF 4RGXA 1DP7P 4U88A 2HEOA 2L02A 4A0ZA 5JFRA 4ON0A 5HLGA 3T8TA 4LB5A 5E8IA 1U6GA 3IKVA 4RB1A 3SZTA 2DK8A 2XAJA 2HR3A 2KRFA 2Q2EA 5DCMB 3WTTC 1BJAA 1G3WA 1IN7A 1FP2A 5LBQA 4UHTA 3WE3A 4MTEA 1RIOH 1HW1A 2ESNA 2R7DA 3QP5A 3K69A 3VEPA 1XGSA 5LHHA 3LA3A 4F7ZA 3GFMA 4D0PA 2IPQX 2Y75A 2XUBA 2J5OA 4HV6A 1K78A 2Y0MA 5LLQA 3FXUA 4EMSA 4PDKA 5F6FA 3O2PE 1XMAA 3ZMSA 1TLHB 3E6MA 1QQIA 5JI6A 2RKHA 4PCQA 5ICFA 2BGCA 4UVCA 4PGHA 3EETA 3AAFA 1FPQA 2XASA 2D45A 5ILSA 3KE2A 5FGMA 1USTA 4EJVA 3HTUA 1MGTA 3R0JA 4KIGA 4KIBA 4AVPA 1ZRCA 1HW5A 1MJ9A 2J5PA 2XIGA 1T6SA 1KQ9A 1XN7A 1EH8A 3SXYA 1S6LA 5IT9Z 2DBBA 2IA0A 4HX7A 1YW9A 2RN7A 2MLGA 2ISYA 4OU0A 5HDNA 2QZ8A 5JVTA 1ZH5A 2EB7A 3DQVC 3GW2A 2K86A 2OQGA 5DD4A 1KU3A 4GO1A 3GO5A 4B8XA 3GFLA 2CO5A 3MFKA 4KNYA 3MEXA 4FX0A 5DV5A 1W7PB 2XHKA 2H94A 4ESJA 3I54A 2FRHA 1IAWA 3ISPA 1LB2A 3RI4A 1TBXA 4L9VA 5EEGA 1G3SA 2P6SA 5BPDA 2R3SA 3F22A 1F4KA 4MTDA 2UXNA 2KKOA 5FLXK 1Z6RA 1XSDA 1GXPA 2NNNA 4ZYDA 1R36A 1KU7A 2AS5F 2HYGD 1YS7A 1L0OC 1FX7A 3U9GA 4HDUA 3FHZA 3KZYA 3I58A 5J8FA 2STTA 2OBPA 3T8RA 1CF7A 4Y15A 4O6JA 2RDPA 4BHBA 1IXRC 2Z3YA 4Y13A 3TGNA 3SZPA 4RB2C 5ICCA 1T98A 3LFKA 4RGSA 1O3SA 1CF7B 4LB6B 2FMLA 2PEXA 5A2QK 3I59A 1FSEA 3M7GA 1BIAA 2A5YB 2RNJA 4LLNA 2EV0A 4EM2A 2L54A 3JTHA 2QQAA 2F5DA 3V7SA 5BOXA 4U7DA 4NHJA 5BPIA 1VTNC 2G9WA 2A69F 2FXAA 1Z91A 3P7NA 3GZ5A 2IRFG 3WGIA 4HDVA 2BBYA 2DQRA 2Q8KA 1P4XA 2IW5A 1TW2A 2VT3A 2A61A 4ZZDA 4O3MA 4OIPF 4M9ZA 4IRIA 1XSVA 1O3TA 5IT9K 2TDXA 1R7JA 1O57A 2RV8A 2PFBA 5HDGA 4WF2A 4LFUA 4L0ZB 4M74A 1UFMA 5CYVA 4EJWA 1OYIA 1BOAA 1CGPA 3U1DA 4IHSA 3FZVA 3DPTA 3LWFA 2V6CA 4P96A 5K1YA 2HGCA 1ZGJA 3RKYA 4AWXB 3KP5A 3J80Z 5E1WA 3QPTA 5L3EA 2EV5A 3NEUA 1ZGAA 5D5UB 2HZTA 5KVRA 4P5OA 1SD5A 4HYEA 1SMTA 2KJBA 3ZN1A 4WCGA 2X0LA 3HIFA 2P5KA 5K5RA 4G7HF 1PP8F 4I02A 3ZMTA 2NRAC 1B9MA 1D3YA 2BYVE 3K1PA 1YIOA 3BROA 2IA1A 3G3ZA 2FOKA 2E1NA 4OMYA 3CUQC 4L5JA 2E1CA 3W6JB 3I5UA 4IJAA 5ICEA 3EYYA 3JTGA 1FZPB 3LAPA 1FYKA 3F8MA 1TQMA 4M73A 3JSPA 2VBYA 2O3FA 4R79A 3MZYA 4KDPA 2L01A 4CO8A 2QBYA 1S3JA 5AIQA 3MQ0A 2DFIA 1S8NA 3QRFF 2VONA 3ECHA 2P6TA 3HTSB 3N4MA 3VODA 4ASNA 3HHHA 1REPC 3BPXA 4CXFA 1FYLA 1MDMB 5LEJA 5DD8A 3TO9A 2WV0A 1JHFA 4WXHA 2JT1A 2L4AA 2JZYA 1V3FA 2ZXJA 4EQQA 4MHGA 2CWEA 5LGTA 2GXBA 3W6KB 4EVIA 2K4BA 3GFJA 1B59A 5ILUA 3DXJF 1XGOA 1ZG3A 2KIMA 1MD0A 3BWGA 3R4KA 3E6BA 4P9UA 5BMZA 1TQIA 2QVOA 3EDPA 3JAMK 3DV8A 1YFHA 2HQRA 4OIRF 5F1RA 2CGPA 3HRUA 1KQ0A 5HVQC 5J6XA 1XSXA 5DDGA 3IL2A 5DEQA 4M71A 3DP7A 1S7OA 3KP4A 2VBWA 2JRTA 3G73A 1YTYA 4M6XA 4G6QA 2CQKA 4CZZA 3J80K 2ZNZA 2ADUA 3BJ6A 4Q47A 1GXQA 1SAXA 2LF7A 4UXNA 3QOPA 4M9XA 3ZMZA 2KIUA 4OMZA 4EM0B 1F1ZA 4I0AA 2LNBA 2O8XA 2BEOA 3E3VA 3DEUA 3L7WA 3KP2A 1LDJA 5BQTA 2OQRA 3MCZA 2A3SA 4KT5C 2NS0A 2FEZA 3IWZA 1MKMA 5ILVA 3KEOA 4GYIA 1HKSA 3RJPA 1IXCA 1FP1D 1KQ8A 3E5XA 3KZZA 1HSJA 2HOEA 3K9TA 4G94A 4K2EA 2K27A 4HAMA 4LG0B 1G3YA 2NAZA 3F3XA 3WU0A 3ZMUA 2VXZA 5CJ9A 4KMUX 2LKPA 3CUQB 3LQRA 3BJAA 4Q4ZF 3KETA 3GYHX 5L3BA 2R7FA 4EJOA 1RNLA 1FC3A 2PJPA 3FXRA 1FT9A 1XCVA 2D1VA 1WSUA 3QPHA 5H6RA 2PN6A 5FLXZ 4O5VA 4XBFA 1HBXG 4G7OF 2FMYA 4IPAA 3CLOA 3CUOA 4LLGF 4BAYA 1BBYA 4RGRA 2F5FA 3FM5A 5HLIA 3VOEA 2QYOA 1RI7A 4MQ9F 1LQ1A 4H0EA 3H92A 3S2WA 3D5LA 1XD7A 4A5MA 2M87A 1ON2A 3DF8A 4KUMA 1K7AA 1P4WA 4UNOA 4HQMA 5CVVA 2ZJ2A 4HV5A 4L9TA 1WQ2A 1D8JA 3F72A 3WU1B 1FY7A 2HYFA 5TJJA 3QP6A 2Z33A 2FA5A 5A2QZ 2LF8A 2YR2A 2O03A 3I4PA 3GX4X 2A07F 3WE2A 5DUKA 4AIKA 5FD6A 4HF0A 1K78B 2E7WA 1Z05A 3R0AA 1J9IA 3Q5FA 2OZ6A 3O6BB 3HRMA 3EYIA 1JHHA 4YIFA 3H3ZA 2EWNA 1T38A 3COAC 3PFIA 3MZHA 2ZNYA 1YS6A 1EH6A 1G6NA 2HWVA 1Z1DA 3BPVA 5JR3A 3WTYC 4Y17A 4IF4A 3ZMVA 3B02A 4JQFA 1T0FA 4HQEA 3NRVA 5E20A 4YG2F 2LSOA 2DT5A 1EH7A 3F8FA 1WRJA 5ICGA 3HRSA 3T0YA 1MJBA 2P5LC 3R61A 3RYRA 4A0YA 3WTWC 2PLYA 1T39A 3D0SA 4YFNF 3WGGA 1XMKA 3E6DA 2RGVA 4IXAA 1ULYA 4IHTA 2MH9A 5F64A 4BHCA 2NYXA 4NB5A 4KA4A 2VOPA 3FX3A 3L00A 4I0BA 3J81Z 1D5VA 3HYIA 2YX7A 5CVIA 2IJLA 4Q5SF 1TNSA 4RS8A 3V8LA 2M5WA 1LNWA 1YW8A 1Z6TA 3JSOA 5ERIA 2JTVA 3SFZA 5J8CA 3FF5A 1V4RA 4N0BA 3M9AA 1BI3A 3FMQA 2D2WA 2DI3A 2Q0OA 1BI0A 3CTAA 4UV9A 2XVCA 2ZO4A 2A6HF 2ZCWA 1R5HA 1F5TA 6PAXA 1IXSB 4IRHA 2P4WA 2VT2A 1HSTA 5HOOA 2H27A 5LHGA 1R1VA 4G8XA 4RAZA 3F8NA 1R58A 4ESBA 2MLKA 2EA2A 1H9GA 2VE8A 3H3UA 1W7PD 4L18B 4HW0A 3L9FA 2ZFWA 3F21A 4M9SA 3R60A 1U5TA 3I59B 1BIBA 4RGUA 1QO0D 4QLCU 3J7AO 3BP8A 4P9FA 2HKOA 1B4AA 1XGNA 3CO6C 4G7ZF 2OU2A 2IT0A 1DUXC 1WWXA 1OYWA 3ELKA 3M8EA 2OAZA 2QM3A 4HLYA 4BYYA 1JXSA 1OKRA 1FWZA 1IRFA 2UXXA 5HS9A 1ZRDA 1XCBA 3JAMZ 2XKPA 3C3WA 3RDIA 3IRRA 1BM9A 3U2RA 2Z99A 3K1MA 3WTVC 2W85A 2L4MA 2CW0F 3ULQB 4L0YB 4AIHA 1QGPA 1AOYA 3R6SA 5HLHA 1SFEA 5LRSA 4GCVA 4FX4A 2DPUA 3V4GA 4LGWA 4MEXF 1B9NA 1YO5C 2CSOA 1ZHFA 2VBZA 2FBKA 5CVRA 4ENNA 3J81K 2C6YA 3CDHA 5H20A 3TDUC 3P9KA 1ZARA 5D8LB 1OR7A 1RZ4A 1FOKA 2V1XA 1I1GA 5K5OA 1ZG1A 4Z2YA 3TQNA 2OZUA 3QU6A 5DCFA 2WTEA 2KJCA 2EK5A 2DO7A 1UHWA 3GLXA 5D6FA 1P6RA 3C18A 1U8RA 1J5YA 2HQNA 1P2FA 2O61A 1GVJA 3FMSA 1WI9A 2RQPA 1LEAA 1E2XA 3I53A 1S29A 4CDGA 4I98B 1FLIA 1IF1A 4AIJA 1ZYRF 3WTUC 1D8KA 3VB2A 3L09A 2O6GE 4RAYA 5TRDA 3MWMA 1I5ZA 2DW4A 2F2EA 2FSWA 1DPRA 4GGGA 4A6DA 1BC7C 2FU4A 3RKWA 1E17A 2Y48A 2F5CA 2CYYA 5E1ZB 4A0XA 1RUNA 3LQQA 4HF2A 2DAOA 2QBYB 1BN5A 3IRQA 3DKWA 2MC3A 2ESHA 1WKMA 5CVJA 1H9TA 1NHAA 5DUIA 3V8KA 3RTRA 2EFPA 4ENMA 4I09A 1HW2A 1U78A 3KLOA 1FBUA 1HKQA 5L3CA 1U3EM 5FO5A 1YG2A 1ON1A 1OPCA 1FSHA 3WGHA 3ABTA 3E97A 4GXOA 2YU3A 4YFKF 1QBJA 3B73A 4FT8A 1P4AA 2VC1A 4OOIA 4YFXF 1F9NA 1P92A 3V7CA 3BDDA 3OV8A 3ZN0A 4UV8A 4TV7A 3HRTA 4UVBA 4ZH4F 2STWA 2AXLA 1G3TA 4ENKA 3F6OA 4KFCA 1UHMA 2FE3A 1DDNA 3FMRA 1ZRFA 1ZLJA 4I01A 4ZYHA 2PMUA 4OIQF 4WK8F 3TO7A 2B0LA 2Z5UA 2P8TA 2VC0A 1EV7A 2ZMEA 3QAHA 1IN5A 2FNAA 3SHFA 2K02A 1LJ9A 2ACJA 2GIVA 2EFNA 1HXDA 4N9HA 4I7HA 2BV6A 1ZN2A 3F6VA 4B09A 3GFIA 5AIPA 4HZFA 4ETSA 4IVNA 4L9NA 2EJRA 2HS5A 2FQ3A 2FBHA 3KP6A 2QQ9A 2HFHA 1O3RA 1J75A 4LK1F 5AONA 1IUYA 3GUDA 5D5WB 3DFGA 3LA2A 1J59A 5L3DA 3T5XA 3GVAA 1AWCA 3IKTA 4KYWA 1JGSA 4UVAA 1R1UA 3C7JA 2XV4S 1SD7A 2YX4A 2XGXA 2G7HA 3F8CA 2XRNA 4A6EA 2DTRA 3HSEA 1L3LA 3EUHA 1FYMA 3LAJA 4WX9A 5DCMA 4HX4A 1YLFA 4HLXA 4U0YA 3DPLC 5D5XB 2W84A 1KA8A 2A6EF 1KYZA 2K7LA 1UCRA 1O7FA 2H6CA 4E70A 2DK5A 3TKYA 2HKXA 4LJZF 1IRGA 4IRGA 5FFZA 3ZP5A 1XDUA 5LHIA 1U5TC 4PZJA 1C0WA 2PMHA 2ZBKA 3CO7C 1KGSA 5K5QA 2L3DA 2Z9OA 4NQWA 5FD5A 4PGGA 3FWEA 5E1XA 3QU3A 2M8EA 2OA4A 2BE5F 2UWMA 1W5SA 4KN7X 3TOBA 2QQBA 1IN8A 3GEZA 1LDDA 3T1BA 4CHUA 2VOOA 3HSFA 4U0WA 1QZZA 2GXGA 1J7KA 3E5QA 4BNCA 3HSRA 4BXUA 1Z7UA 3REOA 2MA3A 4ENJA 3ERED 1ZLKA 2K4JA 3KP7A 1S7AA 3P9CA 2ELHA 2QLZA 3WTZA 3FXQA 2DQLA 4R1HA 1IN4A 1Z9CA 5D8KB 2JPBA 4G6DA 2W57A 1IW7F 4LD5A 2M1BA 1SD4A 3P9IA 3ABUA 3MAJA 1T2KA 2GWRA 3C1DA 1KU2A 1PP7U 2HTSA 2VE9A 3RPUA 1HKTA 3WTXC 2XAHA 2OD5A 1IZ1A 1W7PA 4ESFA 3Q9SA 3ROUA 5E8GA 2LDUA 4A12A 1R22A 1YQAA 2RC4A 4I2OA 2H6BA 1QPMA 4HF1A 5CLSA 4S04A 5D4SA 1B1BA 3NQOA 2EFQA 4RB3C 1G4DA 4M72A 3ML6A 4OINF 1PDNC 5D5VB 3ZPLA 1W4MA 5ED4A 3TDZC 2FNPA 4MQVA 1KU9A 4XLNF 3GZ6A 2XKOA 2PBIA 2QENA 5LEKA 2VODA 3RYPA 1R5GA 2H09A 3CJNA 4CYDA 5EEHA 3O3KA 4MEYF 3EQLF 2IA2A 3TO6A 1RUOA 1TQPA 2GQQA 4BH9A 5LGNA 1U5TB 4CICA 3IWFA 4GYGA 3K0LA 4KMFA 2IVMA 3E6CC 2G7UA 4BQAA 2HTJA 1ONVA 4OIOF 5HS7A 4WWCA 2V79A 2CG4A 2YSRA 3VFZA 1QNTA 3GXOA 2WC2A 2GZWA 2MD5A 4A2UA 3HHGA 3WG9A 2DPDA 2UZKA 4P55A 4L5IA 4HA8A 1H0MA 5L3GA 3L2CA 1STZA 1XB4A 2X4HA 3IHUA 3PQKA 5D4RA 3BJOA 4BHPA 1FBSA 2CFXA 3KEQA 5D6EA 4EJUA 3KLNA 4EV0A 1K6OA 3E5UA 4KIFA 3I0TA 2HDCA 4RB0A 2YPRA 4WXDA 4XSZF 4M6YA 3JW4A 1BI2A 1U2WA 1K79A 2ETHA 1I1SA 5FB2A 2D1HA 3ECOA 5CVUA 2M30A 4HOBA 2ISZA 1FNNA 1SFXA 2A68F 3V7RA 4Q48A 1DPUA 4KICA 2ZKZA 4AD9A 3GF2A 1J2XA 4G9YA 1HQCA 2JPCA 2V1DA 2WWYA 4N9IA 1OYYA 1R00A 2QUFA 4U0VA 2FBIA 5H6QA 2O0YA 4MNUA 4EGZA 2IP2A 4CGZA 2EFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XAG A;  2XAF A;  1SD6 A;  1ZAO A;  2COM A;  5E17 F;  2GA1 A;  1UB9 A;  5BS6 A;  2M45 A;  5DYM A;  1A04 A;  4DNC A;  1B6A A;  4ZYG A;  1ZG5 A;  1TTY A;  4A5N A;  3Q9V A;  1LEB A;  1SMY F;  1X3U A;  2PG4 A;  4EGY A;  2DLL A;  2P5V A;  3ZQ7 A;  3FM3 A;  3SQN A;  3F23 A;  1MDM A;  3M8F A;  1O3Q A;  1ZRE A;  1FBQ A;  1XGM A;  3LA7 A;  1BI1 A;  4DQ2 A;  4R8H A;  2MH2 A;  4HBL A;  2KIF A;  3BZ6 A;  4S05 A;  4XRF A;  1JE8 A;  2GAU A;  1IN6 A;  2PQ8 A;  2EFW A;  5HDK A;  5HS8 A;  2PI0 A;  4ZZL A;  1YW7 A;  1BC8 C;  4XLP F;  2DU9 A;  3KFW X;  4JK1 X;  2VBX A;  1I6X A;  5JHU A;  3I64 A;  1J0R A;  4HX8 A;  3RKX A;  1MJA A;  3V8J A;  2V9V A;  1TW3 A;  5KK1 A;  2XAQ A;  3GWZ A;  3IC7 A;  5LGU A;  3OOP A;  2VN2 A;  1R1T A;  2NNY A;  3PQJ A;  1QZY A;  5LRR A;  3BY6 A;  5E18 F;  4KN4 X;  2EA4 A;  2MBF A;  1R23 A;  1YYV A;  4WXC A;  4LMY A;  4MGR A;  4LLL A;  3BOQ A;  4JBA A;  1XDS A;  3HUG A;  3K2Z A;  3KCC A;  2QWW A;  3LST A;  1I27 A;  4UUV A;  3TOA A;  1LDK B;  3K1N A;  1ODD A;  3WTS C;  4EJT A;  2ZME B;  3HOS A;  2FF4 A;  4EM1 A;  1Q1H A;  1KYW A;  2W24 A;  4XSX F;  1USS A;  1PUE E;  4LG0 A;  4L9J A;  2JSC A;  5IT3 A;  2XRO A;  4U7B A;  2F5E A;  2EV6 A;  2E7X A;  5L3F A;  4ZYE A;  1LVA A;  3CUQ A;  3KP3 A;  2P7V B;  4YII A;  3F8B A;  2RVC A;  1O7L A;  1GHC A;  1SFU A;  2W25 A;  1W5T A;  1MZB A;  1OMI A;  3M1E A;  3I71 A;  2V1U A;  3RIR A;  1TNT A;  2P7C B;  4QWQ A;  3HOT A;  3RPQ A;  4FHT A;  2GA2 A;  3N97 A;  3ZMD A;  5FFX A;  4LK0 F;  1Y0U A;  3WOD F;  4RGX A;  1DP7 P;  4U88 A;  2HEO A;  2L02 A;  4A0Z A;  5JFR A;  4ON0 A;  5HLG A;  3T8T A;  4LB5 A;  5E8I A;  1U6G A;  3IKV A;  4RB1 A;  3SZT A;  2DK8 A;  2XAJ A;  2HR3 A;  2KRF A;  2Q2E A;  5DCM B;  3WTT C;  1BJA A;  1G3W A;  1IN7 A;  1FP2 A;  5LBQ A;  4UHT A;  3WE3 A;  4MTE A;  1RIO H;  1HW1 A;  2ESN A;  2R7D A;  3QP5 A;  3K69 A;  3VEP A;  1XGS A;  5LHH A;  3LA3 A;  4F7Z A;  3GFM A;  4D0P A;  2IPQ X;  2Y75 A;  2XUB A;  2J5O A;  4HV6 A;  1K78 A;  2Y0M A;  5LLQ A;  3FXU A;  4EMS A;  4PDK A;  5F6F A;  3O2P E;  1XMA A;  3ZMS A;  1TLH B;  3E6M A;  1QQI A;  5JI6 A;  2RKH A;  4PCQ A;  5ICF A;  2BGC A;  4UVC A;  4PGH A;  3EET A;  3AAF A;  1FPQ A;  2XAS A;  2D45 A;  5ILS A;  3KE2 A;  5FGM A;  1UST A;  4EJV A;  3HTU A;  1MGT A;  3R0J A;  4KIG A;  4KIB A;  4AVP A;  1ZRC A;  1HW5 A;  1MJ9 A;  2J5P A;  2XIG A;  1T6S A;  1KQ9 A;  1XN7 A;  1EH8 A;  3SXY A;  1S6L A;  5IT9 Z;  2DBB A;  2IA0 A;  4HX7 A;  1YW9 A;  2RN7 A;  2MLG A;  2ISY A;  4OU0 A;  5HDN A;  2QZ8 A;  5JVT A;  1ZH5 A;  2EB7 A;  3DQV C;  3GW2 A;  2K86 A;  2OQG A;  5DD4 A;  1KU3 A;  4GO1 A;  3GO5 A;  4B8X A;  3GFL A;  2CO5 A;  3MFK A;  4KNY A;  3MEX A;  4FX0 A;  5DV5 A;  1W7P B;  2XHK A;  2H94 A;  4ESJ A;  3I54 A;  2FRH A;  1IAW A;  3ISP A;  1LB2 A;  3RI4 A;  1TBX A;  4L9V A;  5EEG A;  1G3S A;  2P6S A;  5BPD A;  2R3S A;  3F22 A;  1F4K A;  4MTD A;  2UXN A;  2KKO A;  5FLX K;  1Z6R A;  1XSD A;  1GXP A;  2NNN A;  4ZYD A;  1R36 A;  1KU7 A;  2AS5 F;  2HYG D;  1YS7 A;  1L0O C;  1FX7 A;  3U9G A;  4HDU A;  3FHZ A;  3KZY A;  3I58 A;  5J8F A;  2STT A;  2OBP A;  3T8R A;  1CF7 A;  4Y15 A;  4O6J A;  2RDP A;  4BHB A;  1IXR C;  2Z3Y A;  4Y13 A;  3TGN A;  3SZP A;  4RB2 C;  5ICC A;  1T98 A;  3LFK A;  4RGS A;  1O3S A;  1CF7 B;  4LB6 B;  2FML A;  2PEX A;  5A2Q K;  3I59 A;  1FSE A;  3M7G A;  1BIA A;  2A5Y B;  2RNJ A;  4LLN A;  2EV0 A;  4EM2 A;  2L54 A;  3JTH A;  2QQA A;  2F5D A;  3V7S A;  5BOX A;  4U7D A;  4NHJ A;  5BPI A;  1VTN C;  2G9W A;  2A69 F;  2FXA A;  1Z91 A;  3P7N A;  3GZ5 A;  2IRF G;  3WGI A;  4HDV A;  2BBY A;  2DQR A;  2Q8K A;  1P4X A;  2IW5 A;  1TW2 A;  2VT3 A;  2A61 A;  4ZZD A;  4O3M A;  4OIP F;  4M9Z A;  4IRI A;  1XSV A;  1O3T A;  5IT9 K;  2TDX A;  1R7J A;  1O57 A;  2RV8 A;  2PFB A;  5HDG A;  4WF2 A;  4LFU A;  4L0Z B;  4M74 A;  1UFM A;  5CYV A;  4EJW A;  1OYI A;  1BOA A;  1CGP A;  3U1D A;  4IHS A;  3FZV A;  3DPT A;  3LWF A;  2V6C A;  4P96 A;  5K1Y A;  2HGC A;  1ZGJ A;  3RKY A;  4AWX B;  3KP5 A;  3J80 Z;  5E1W A;  3QPT A;  5L3E A;  2EV5 A;  3NEU A;  1ZGA A;  5D5U B;  2HZT A;  5KVR A;  4P5O A;  1SD5 A;  4HYE A;  1SMT A;  2KJB A;  3ZN1 A;  4WCG A;  2X0L A;  3HIF A;  2P5K A;  5K5R A;  4G7H F;  1PP8 F;  4I02 A;  3ZMT A;  2NRA C;  1B9M A;  1D3Y A;  2BYV E;  3K1P A;  1YIO A;  3BRO A;  2IA1 A;  3G3Z A;  2FOK A;  2E1N A;  4OMY A;  3CUQ C;  4L5J A;  2E1C A;  3W6J B;  3I5U A;  4IJA A;  5ICE A;  3EYY A;  3JTG A;  1FZP B;  3LAP A;  1FYK A;  3F8M A;  1TQM A;  4M73 A;  3JSP A;  2VBY A;  2O3F A;  4R79 A;  3MZY A;  4KDP A;  2L01 A;  4CO8 A;  2QBY A;  1S3J A;  5AIQ A;  3MQ0 A;  2DFI A;  1S8N A;  3QRF F;  2VON A;  3ECH A;  2P6T A;  3HTS B;  3N4M A;  3VOD A;  4ASN A;  3HHH A;  1REP C;  3BPX A;  4CXF A;  1FYL A;  1MDM B;  5LEJ A;  5DD8 A;  3TO9 A;  2WV0 A;  1JHF A;  4WXH A;  2JT1 A;  2L4A A;  2JZY A;  1V3F A;  2ZXJ A;  4EQQ A;  4MHG A;  2CWE A;  5LGT A;  2GXB A;  3W6K B;  4EVI A;  2K4B A;  3GFJ A;  1B59 A;  5ILU A;  3DXJ F;  1XGO A;  1ZG3 A;  2KIM A;  1MD0 A;  3BWG A;  3R4K A;  3E6B A;  4P9U A;  5BMZ A;  1TQI A;  2QVO A;  3EDP A;  3JAM K;  3DV8 A;  1YFH A;  2HQR A;  4OIR F;  5F1R A;  2CGP A;  3HRU A;  1KQ0 A;  5HVQ C;  5J6X A;  1XSX A;  5DDG A;  3IL2 A;  5DEQ A;  4M71 A;  3DP7 A;  1S7O A;  3KP4 A;  2VBW A;  2JRT A;  3G73 A;  1YTY A;  4M6X A;  4G6Q A;  2CQK A;  4CZZ A;  3J80 K;  2ZNZ A;  2ADU A;  3BJ6 A;  4Q47 A;  1GXQ A;  1SAX A;  2LF7 A;  4UXN A;  3QOP A;  4M9X A;  3ZMZ A;  2KIU A;  4OMZ A;  4EM0 B;  1F1Z A;  4I0A A;  2LNB A;  2O8X A;  2BEO A;  3E3V A;  3DEU A;  3L7W A;  3KP2 A;  1LDJ A;  5BQT A;  2OQR A;  3MCZ A;  2A3S A;  4KT5 C;  2NS0 A;  2FEZ A;  3IWZ A;  1MKM A;  5ILV A;  3KEO A;  4GYI A;  1HKS A;  3RJP A;  1IXC A;  1FP1 D;  1KQ8 A;  3E5X A;  3KZZ A;  1HSJ A;  2HOE A;  3K9T A;  4G94 A;  4K2E A;  2K27 A;  4HAM A;  4LG0 B;  1G3Y A;  2NAZ A;  3F3X A;  3WU0 A;  3ZMU A;  2VXZ A;  5CJ9 A;  4KMU X;  2LKP A;  3CUQ B;  3LQR A;  3BJA A;  4Q4Z F;  3KET A;  3GYH X;  5L3B A;  2R7F A;  4EJO A;  1RNL A;  1FC3 A;  2PJP A;  3FXR A;  1FT9 A;  1XCV A;  2D1V A;  1WSU A;  3QPH A;  5H6R A;  2PN6 A;  5FLX Z;  4O5V A;  4XBF A;  1HBX G;  4G7O F;  2FMY A;  4IPA A;  3CLO A;  3CUO A;  4LLG F;  4BAY A;  1BBY A;  4RGR A;  2F5F A;  3FM5 A;  5HLI A;  3VOE A;  2QYO A;  1RI7 A;  4MQ9 F;  1LQ1 A;  4H0E A;  3H92 A;  3S2W A;  3D5L A;  1XD7 A;  4A5M A;  2M87 A;  1ON2 A;  3DF8 A;  4KUM A;  1K7A A;  1P4W A;  4UNO A;  4HQM A;  5CVV A;  2ZJ2 A;  4HV5 A;  4L9T A;  1WQ2 A;  1D8J A;  3F72 A;  3WU1 B;  1FY7 A;  2HYF A;  5TJJ A;  3QP6 A;  2Z33 A;  2FA5 A;  5A2Q Z;  2LF8 A;  2YR2 A;  2O03 A;  3I4P A;  3GX4 X;  2A07 F;  3WE2 A;  5DUK A;  4AIK A;  5FD6 A;  4HF0 A;  1K78 B;  2E7W A;  1Z05 A;  3R0A A;  1J9I A;  3Q5F A;  2OZ6 A;  3O6B B;  3HRM A;  3EYI A;  1JHH A;  4YIF A;  3H3Z A;  2EWN A;  1T38 A;  3COA C;  3PFI A;  3MZH A;  2ZNY A;  1YS6 A;  1EH6 A;  1G6N A;  2HWV A;  1Z1D A;  3BPV A;  5JR3 A;  3WTY C;  4Y17 A;  4IF4 A;  3ZMV A;  3B02 A;  4JQF A;  1T0F A;  4HQE A;  3NRV A;  5E20 A;  4YG2 F;  2LSO A;  2DT5 A;  1EH7 A;  3F8F A;  1WRJ A;  5ICG A;  3HRS A;  3T0Y A;  1MJB A;  2P5L C;  3R61 A;  3RYR A;  4A0Y A;  3WTW C;  2PLY A;  1T39 A;  3D0S A;  4YFN F;  3WGG A;  1XMK A;  3E6D A;  2RGV A;  4IXA A;  1ULY A;  4IHT A;  2MH9 A;  5F64 A;  4BHC A;  2NYX A;  4NB5 A;  4KA4 A;  2VOP A;  3FX3 A;  3L00 A;  4I0B A;  3J81 Z;  1D5V A;  3HYI A;  2YX7 A;  5CVI A;  2IJL A;  4Q5S F;  1TNS A;  4RS8 A;  3V8L A;  2M5W A;  1LNW A;  1YW8 A;  1Z6T A;  3JSO A;  5ERI A;  2JTV A;  3SFZ A;  5J8C A;  3FF5 A;  1V4R A;  4N0B A;  3M9A A;  1BI3 A;  3FMQ A;  2D2W A;  2DI3 A;  2Q0O A;  1BI0 A;  3CTA A;  4UV9 A;  2XVC A;  2ZO4 A;  2A6H F;  2ZCW A;  1R5H A;  1F5T A;  6PAX A;  1IXS B;  4IRH A;  2P4W A;  2VT2 A;  1HST A;  5HOO A;  2H27 A;  5LHG A;  1R1V A;  4G8X A;  4RAZ A;  3F8N A;  1R58 A;  4ESB A;  2MLK A;  2EA2 A;  1H9G A;  2VE8 A;  3H3U A;  1W7P D;  4L18 B;  4HW0 A;  3L9F A;  2ZFW A;  3F21 A;  4M9S A;  3R60 A;  1U5T A;  3I59 B;  1BIB A;  4RGU A;  1QO0 D;  4QLC U;  3J7A O;  3BP8 A;  4P9F A;  2HKO A;  1B4A A;  1XGN A;  3CO6 C;  4G7Z F;  2OU2 A;  2IT0 A;  1DUX C;  1WWX A;  1OYW A;  3ELK A;  3M8E A;  2OAZ A;  2QM3 A;  4HLY A;  4BYY A;  1JXS A;  1OKR A;  1FWZ A;  1IRF A;  2UXX A;  5HS9 A;  1ZRD A;  1XCB A;  3JAM Z;  2XKP A;  3C3W A;  3RDI A;  3IRR A;  1BM9 A;  3U2R A;  2Z99 A;  3K1M A;  3WTV C;  2W85 A;  2L4M A;  2CW0 F;  3ULQ B;  4L0Y B;  4AIH A;  1QGP A;  1AOY A;  3R6S A;  5HLH A;  1SFE A;  5LRS A;  4GCV A;  4FX4 A;  2DPU A;  3V4G A;  4LGW A;  4MEX F;  1B9N A;  1YO5 C;  2CSO A;  1ZHF A;  2VBZ A;  2FBK A;  5CVR A;  4ENN A;  3J81 K;  2C6Y A;  3CDH A;  5H20 A;  3TDU C;  3P9K A;  1ZAR A;  5D8L B;  1OR7 A;  1RZ4 A;  1FOK A;  2V1X A;  1I1G A;  5K5O A;  1ZG1 A;  4Z2Y A;  3TQN A;  2OZU A;  3QU6 A;  5DCF A;  2WTE A;  2KJC A;  2EK5 A;  2DO7 A;  1UHW A;  3GLX A;  5D6F A;  1P6R A;  3C18 A;  1U8R A;  1J5Y A;  2HQN A;  1P2F A;  2O61 A;  1GVJ A;  3FMS A;  1WI9 A;  2RQP A;  1LEA A;  1E2X A;  3I53 A;  1S29 A;  4CDG A;  4I98 B;  1FLI A;  1IF1 A;  4AIJ A;  1ZYR F;  3WTU C;  1D8K A;  3VB2 A;  3L09 A;  2O6G E;  4RAY A;  5TRD A;  3MWM A;  1I5Z A;  2DW4 A;  2F2E A;  2FSW A;  1DPR A;  4GGG A;  4A6D A;  1BC7 C;  2FU4 A;  3RKW A;  1E17 A;  2Y48 A;  2F5C A;  2CYY A;  5E1Z B;  4A0X A;  1RUN A;  3LQQ A;  4HF2 A;  2DAO A;  2QBY B;  1BN5 A;  3IRQ A;  3DKW A;  2MC3 A;  2ESH A;  1WKM A;  5CVJ A;  1H9T A;  1NHA A;  5DUI A;  3V8K A;  3RTR A;  2EFP A;  4ENM A;  4I09 A;  1HW2 A;  1U78 A;  3KLO A;  1FBU A;  1HKQ A;  5L3C A;  1U3E M;  5FO5 A;  1YG2 A;  1ON1 A;  1OPC A;  1FSH A;  3WGH A;  3ABT A;  3E97 A;  4GXO A;  2YU3 A;  4YFK F;  1QBJ A;  3B73 A;  4FT8 A;  1P4A A;  2VC1 A;  4OOI A;  4YFX F;  1F9N A;  1P92 A;  3V7C A;  3BDD A;  3OV8 A;  3ZN0 A;  4UV8 A;  4TV7 A;  3HRT A;  4UVB A;  4ZH4 F;  2STW A;  2AXL A;  1G3T A;  4ENK A;  3F6O A;  4KFC A;  1UHM A;  2FE3 A;  1DDN A;  3FMR A;  1ZRF A;  1ZLJ A;  4I01 A;  4ZYH A;  2PMU A;  4OIQ F;  4WK8 F;  3TO7 A;  2B0L A;  2Z5U A;  2P8T A;  2VC0 A;  1EV7 A;  2ZME A;  3QAH A;  1IN5 A;  2FNA A;  3SHF A;  2K02 A;  1LJ9 A;  2ACJ A;  2GIV A;  2EFN A;  1HXD A;  4N9H A;  4I7H A;  2BV6 A;  1ZN2 A;  3F6V A;  4B09 A;  3GFI A;  5AIP A;  4HZF A;  4ETS A;  4IVN A;  4L9N A;  2EJR A;  2HS5 A;  2FQ3 A;  2FBH A;  3KP6 A;  2QQ9 A;  2HFH A;  1O3R A;  1J75 A;  4LK1 F;  5AON A;  1IUY A;  3GUD A;  5D5W B;  3DFG A;  3LA2 A;  1J59 A;  5L3D A;  3T5X A;  3GVA A;  1AWC A;  3IKT A;  4KYW A;  1JGS A;  4UVA A;  1R1U A;  3C7J A;  2XV4 S;  1SD7 A;  2YX4 A;  2XGX A;  2G7H A;  3F8C A;  2XRN A;  4A6E A;  2DTR A;  3HSE A;  1L3L A;  3EUH A;  1FYM A;  3LAJ A;  4WX9 A;  5DCM A;  4HX4 A;  1YLF A;  4HLX A;  4U0Y A;  3DPL C;  5D5X B;  2W84 A;  1KA8 A;  2A6E F;  1KYZ A;  2K7L A;  1UCR A;  1O7F A;  2H6C A;  4E70 A;  2DK5 A;  3TKY A;  2HKX A;  4LJZ F;  1IRG A;  4IRG A;  5FFZ A;  3ZP5 A;  1XDU A;  5LHI A;  1U5T C;  4PZJ A;  1C0W A;  2PMH A;  2ZBK A;  3CO7 C;  1KGS A;  5K5Q A;  2L3D A;  2Z9O A;  4NQW A;  5FD5 A;  4PGG A;  3FWE A;  5E1X A;  3QU3 A;  2M8E A;  2OA4 A;  2BE5 F;  2UWM A;  1W5S A;  4KN7 X;  3TOB A;  2QQB A;  1IN8 A;  3GEZ A;  1LDD A;  3T1B A;  4CHU A;  2VOO A;  3HSF A;  4U0W A;  1QZZ A;  2GXG A;  1J7K A;  3E5Q A;  4BNC A;  3HSR A;  4BXU A;  1Z7U A;  3REO A;  2MA3 A;  4ENJ A;  3ERE D;  1ZLK A;  2K4J A;  3KP7 A;  1S7A A;  3P9C A;  2ELH A;  2QLZ A;  3WTZ A;  3FXQ A;  2DQL A;  4R1H A;  1IN4 A;  1Z9C A;  5D8K B;  2JPB A;  4G6D A;  2W57 A;  1IW7 F;  4LD5 A;  2M1B A;  1SD4 A;  3P9I A;  3ABU A;  3MAJ A;  1T2K A;  2GWR A;  3C1D A;  1KU2 A;  1PP7 U;  2HTS A;  2VE9 A;  3RPU A;  1HKT A;  3WTX C;  2XAH A;  2OD5 A;  1IZ1 A;  1W7P A;  4ESF A;  3Q9S A;  3ROU A;  5E8G A;  2LDU A;  4A12 A;  1R22 A;  1YQA A;  2RC4 A;  4I2O A;  2H6B A;  1QPM A;  4HF1 A;  5CLS A;  4S04 A;  5D4S A;  1B1B A;  3NQO A;  2EFQ A;  4RB3 C;  1G4D A;  4M72 A;  3ML6 A;  4OIN F;  1PDN C;  5D5V B;  3ZPL A;  1W4M A;  5ED4 A;  3TDZ C;  2FNP A;  4MQV A;  1KU9 A;  4XLN F;  3GZ6 A;  2XKO A;  2PBI A;  2QEN A;  5LEK A;  2VOD A;  3RYP A;  1R5G A;  2H09 A;  3CJN A;  4CYD A;  5EEH A;  3O3K A;  4MEY F;  3EQL F;  2IA2 A;  3TO6 A;  1RUO A;  1TQP A;  2GQQ A;  4BH9 A;  5LGN A;  1U5T B;  4CIC A;  3IWF A;  4GYG A;  3K0L A;  4KMF A;  2IVM A;  3E6C C;  2G7U A;  4BQA A;  2HTJ A;  1ONV A;  4OIO F;  5HS7 A;  4WWC A;  2V79 A;  2CG4 A;  2YSR A;  3VFZ A;  1QNT A;  3GXO A;  2WC2 A;  2GZW A;  2MD5 A;  4A2U A;  3HHG A;  3WG9 A;  2DPD A;  2UZK A;  4P55 A;  4L5I A;  4HA8 A;  1H0M A;  5L3G A;  3L2C A;  1STZ A;  1XB4 A;  2X4H A;  3IHU A;  3PQK A;  5D4R A;  3BJO A;  4BHP A;  1FBS A;  2CFX A;  3KEQ A;  5D6E A;  4EJU A;  3KLN A;  4EV0 A;  1K6O A;  3E5U A;  4KIF A;  3I0T A;  2HDC A;  4RB0 A;  2YPR A;  4WXD A;  4XSZ F;  4M6Y A;  3JW4 A;  1BI2 A;  1U2W A;  1K79 A;  2ETH A;  1I1S A;  5FB2 A;  2D1H A;  3ECO A;  5CVU A;  2M30 A;  4HOB A;  2ISZ A;  1FNN A;  1SFX A;  2A68 F;  3V7R A;  4Q48 A;  1DPU A;  4KIC A;  2ZKZ A;  4AD9 A;  3GF2 A;  1J2X A;  4G9Y A;  1HQC A;  2JPC A;  2V1D A;  2WWY A;  4N9I A;  1OYY A;  1R00 A;  2QUF A;  4U0V A;  2FBI A;  5H6Q A;  2O0Y A;  4MNU A;  4EGZ A;  2IP2 A;  4CGZ A;  2EFO A; 
#chains in the Genus database with same CATH topology
 2XAG A;  2XAF A;  1SD6 A;  1ZAO A;  3JCU C;  2COM A;  4RDU A;  1B8I B;  5E17 F;  1JKP C;  2GA1 A;  3CMA I;  1APL C;  1UB9 A;  1IRX A;  1YX5 A;  3PIO F;  5BS6 A;  3PJR A;  2M45 A;  2KP6 A;  5DYM A;  1A04 A;  4DNC A;  1QZE A;  3S1M J;  1B6A A;  4ZYG A;  4B48 A;  3JRB A;  4XN0 A;  3RSN A;  3PIP F;  1ZG5 A;  2Y0S N;  1TTY A;  2XPU A;  3EUH C;  4Y7N J;  3K2A A;  4Y3O A;  4A5N A;  3Q9V A;  1LEB A;  1SMY F;  3H5N A;  1X3U A;  2PG4 A;  3HXL A;  4EGY A;  2DLL A;  2P5V A;  2EIN H;  3ZQ7 A;  3FM3 A;  3HEF A;  3SQN A;  4DYC A;  3F23 A;  1MDM A;  3M8F A;  4QPO A;  5CKT A;  1O3Q A;  1ZRE A;  1FBQ A;  2ZFU A;  1E3O C;  5J1R A;  5GAH J;  1XGM A;  1EA3 A;  1X3Z B;  3LA7 A;  3H9J A;  1BI1 A;  3MZ8 A;  4DQ2 A;  2LY1 A;  4R8H A;  4A3G J;  2MH2 A;  3N05 A;  2KIF A;  3BZ6 A;  4HBL A;  4S05 A;  2O7O A;  4XRF A;  5IP6 A;  1JE8 A;  1T56 A;  2GAU A;  2E71 A;  1IN6 A;  3EUK L;  2M7B A;  2PQ8 A;  2EFW A;  1VQ7 I;  5HDK A;  2QSH X;  3ZGK A;  5HS8 A;  2PI0 A;  4ZZL A;  3S17 J;  1D1C A;  3WG7 H;  2DOA A;  1YW7 A;  1BC8 C;  4GDF A;  4XLP F;  2DU9 A;  3KFW X;  5EG0 A;  4JK1 X;  2VBX A;  3A03 A;  1I6X A;  2L7K A;  2JA5 J;  4M3G A;  5JHU A;  4CH7 A;  2XF5 A;  3I64 A;  1J0R A;  4ANJ A;  4BJ6 C;  2HOT A;  2DOE A;  3I4M J;  4HX8 A;  3RKX A;  1MJA A;  2Y69 H;  2E60 A;  3VYU B;  3BZK A;  3V8J A;  2V9V A;  2IGK A;  1TW3 A;  4YRV A;  5KK1 A;  2XAQ A;  3GWZ A;  4XKC A;  3IC7 A;  4JX4 A;  3K10 A;  3D5S C;  3VYT B;  2JK3 A;  4JX5 A;  1JUM A;  3BR2 A;  2VN2 A;  3OOP A;  5LGU A;  1FJL A;  1R1T A;  4IQJ A;  2KFD A;  2NNY A;  3PQJ A;  3Q0U A;  1QZY A;  5LRR A;  3BY6 A;  5E18 F;  4KN4 X;  2KRH A;  2GXA A;  4B1R A;  2EA4 A;  2MBF A;  1R23 A;  2LY2 A;  1YYV A;  1XTA A;  4JYK A;  4WXC A;  3JRI A;  4LMY A;  4MGR A;  3CCQ I;  1VQO I;  4LLL A;  1IV8 A;  3BOQ A;  4JBA A;  3ZQG A;  1XDS A;  1FTT A;  2VQH A;  3HUG A;  3K2Z A;  4P1W A;  2JVH A;  3CQZ J;  2L2O A;  3KCC A;  2QWW A;  3LST A;  1OCC H;  4B44 A;  5JVG F;  2HXO A;  1PUF A;  2JJ7 A;  1I27 A;  5B66 C;  2N8G A;  3RZD J;  4UUV A;  3DTE A;  3TOA A;  1RRJ A;  1LDK B;  3K1N A;  2LRD A;  4AID A;  2OTL I;  3KIO A;  1ODD A;  3WTS C;  1GDT A;  4MFD A;  3QYE A;  4EJT A;  2ZME B;  2JA2 A;  1X58 A;  1PUF B;  3HOS A;  2FF4 A;  5EEA A;  3K4C A;  4ZDO A;  2XPV A;  4EM1 A;  1Q1H A;  1KYW A;  2W24 A;  1VQ4 I;  1UMQ A;  4XSX F;  1USS A;  2DDB A;  1PUE E;  4LG0 A;  1R71 A;  3LSI A;  4L9J A;  2JSC A;  5IT3 A;  2XRO A;  4AM3 A;  5J1U A;  4U7B A;  2CJJ A;  2F5E A;  2EV6 A;  2KIQ A;  2E7X A;  1ZR4 A;  5L3F A;  4LIT A;  4ZYE A;  4X6A J;  2WAF A;  1LVA A;  3CUQ A;  3KP3 A;  1S7E A;  1MW7 A;  2P7V B;  3J7Z I;  1V54 H;  4YII A;  3F8B A;  2RVC A;  3FBN B;  1O7L A;  4BDZ A;  4UB8 C;  1VQ9 I;  1X1D A;  5DM6 F;  1GHC A;  3HDD A;  1Z0X A;  3EPZ A;  1SFU A;  1IV6 A;  2W25 A;  4BY7 J;  2LC2 A;  4JP0 A;  4E7S A;  3DKX A;  4CZC A;  1W5T A;  2H8R A;  1MZB A;  1OMI A;  3M1E A;  3I71 A;  3E1S A;  4FQG A;  1D5Y A;  3DCF A;  2V1U A;  2Y31 A;  1S72 I;  3RIR A;  3O8H A;  1Q1V A;  1TNT A;  2P7C B;  4QWQ A;  1H8A C;  3HOT A;  1QHG A;  3ZQQ A;  3RPQ A;  4FHT A;  3CCV I;  1SAN A;  2GA2 A;  4NNJ A;  3N97 A;  3BG9 A;  3ZMD A;  2R7W A;  2M2E A;  5FFX A;  4LK0 F;  1Y0U A;  1R6R A;  5FRO A;  3WOD F;  4RGX A;  1DP7 P;  4U88 A;  1U8B A;  2HEO A;  5KCM A;  2L02 A;  4A0Z A;  5JFR A;  4ON0 A;  4XNF A;  5HLG A;  3T8T A;  2WAQ A;  4LB5 A;  1OCO H;  2BVM A;  5E8I A;  1U6G A;  3IKV A;  4RB1 A;  3SZT A;  2IEK A;  2DK8 A;  2XAJ A;  3PNV A;  1UZC A;  2HR3 A;  2KRF A;  2Q2E A;  5DCM B;  4XLF A;  5J4V A;  3WTT C;  4DIQ A;  1WJ5 A;  2Y9Y A;  1R4M B;  3CP2 A;  1UEL B;  5KAI C;  1BJA A;  4A3I J;  1G3W A;  4XID A;  1RR7 A;  1IN7 A;  3P5J A;  3QWL A;  4EEF G;  5EDN A;  1FP2 A;  5LBQ A;  1ETY A;  3K6G A;  4UHT A;  3WE3 A;  3LSK A;  2LKS A;  3OYC A;  2Q2E B;  1ZGW A;  3LOC A;  4MTE A;  1W36 D;  1RIO H;  1HW1 A;  5F0H A;  3HOW J;  2ESN A;  4KIT B;  3U21 A;  3FXL A;  3OS0 A;  2CQ7 A;  2VXD A;  2R7D A;  4AU7 A;  3I56 I;  3QP5 A;  3K69 A;  3VEP A;  1XGS A;  5LHH A;  2JN6 A;  2KLO A;  3LA3 A;  4F7Z A;  3GFM A;  4D0P A;  2ZSI B;  4QTR A;  2IPQ X;  1NG6 A;  1IGN A;  4Y52 J;  1YX3 A;  2LD5 A;  1FOY A;  4C9Y A;  2Y75 A;  2XUB A;  2AHQ A;  2LLK A;  1JT6 A;  2J5O A;  3S14 J;  4HV6 A;  1K78 A;  2Y0M A;  1UHS A;  4NQW B;  5LLQ A;  3FXU A;  1SVO A;  4J00 A;  3BTL A;  4A3E J;  1MMD A;  2MD0 A;  4EMS A;  4ZDP A;  4PDK A;  5F6F A;  3ONQ A;  3WHB A;  4IZZ A;  3O2P E;  1XMA A;  3ZMS A;  5IOY A;  2OCC H;  3G6E I;  3DU6 A;  4IEJ A;  4XLC A;  1TLH B;  2WY7 Q;  3E6M A;  5F04 A;  1K61 A;  1QQI A;  4ZDL A;  2WAE A;  5J47 A;  4V2G A;  2KL4 A;  1MNE A;  1Z3Y A;  5JI6 A;  2RKH A;  4PCQ A;  1Y56 A;  4IQ4 A;  4F92 B;  2VKH A;  1KZH A;  5ICF A;  2BGC A;  2KHM A;  3A01 A;  4D1Q A;  3G1O A;  4UVC A;  4PGH A;  5CPR B;  3EET A;  3AAF A;  5M3M J;  1FPQ A;  2XAS A;  2D45 A;  3AL0 C;  1X1B A;  5ILS A;  1FIP A;  2DJI A;  2Z2S B;  3KE2 A;  5FGM A;  1UST A;  2FD5 A;  4EJV A;  2K3P A;  3HTU A;  1MGT A;  3R0J A;  4KIG A;  4KIB A;  4AVP A;  1ZRC A;  1HW5 A;  3HC7 A;  1MJ9 A;  2J5P A;  3OWT A;  2XIG A;  1T6S A;  2KPM A;  1KQ9 A;  1XN7 A;  1EH8 A;  2CQQ A;  2EZI A;  1S6L A;  3SXY A;  5IT9 Z;  4XL9 A;  1FOW A;  3K70 C;  2DBB A;  2IA0 A;  4HX7 A;  2QQ8 A;  2QSG X;  1YW9 A;  1N78 A;  1A36 A;  2RN7 A;  2MLG A;  2X9D A;  1D0Z A;  1XG1 A;  2ISY A;  4DYQ A;  3GTL J;  4OU0 A;  5HDN A;  2QZ8 A;  4A3F J;  2DFE A;  1UG2 A;  3F9K A;  5JVT A;  3MMY B;  1ZH5 A;  2EB7 A;  3BTC A;  3DQV C;  3GW2 A;  2K86 A;  2OQG A;  2X1D A;  1XMX A;  3LSH A;  5DD4 A;  2E1M C;  3AG4 H;  1KU3 A;  4GO1 A;  3GO5 A;  4B8X A;  1VQN I;  3SYT A;  3FKJ A;  1MBF A;  2XGE A;  3GFL A;  2CO5 A;  3MFK A;  2V6E A;  4KNY A;  3MEX A;  3GBG A;  3JRH A;  4IOA F;  3HJE A;  4FX0 A;  2FQ4 A;  2VKD A;  4NC7 A;  1A35 A;  2HU9 A;  5DV5 A;  1W7P B;  2XHK A;  2H94 A;  2OPT A;  4ESJ A;  2RNG A;  3I54 A;  2FRH A;  1IAW A;  3ISP A;  2QKM B;  1VF9 A;  1LB2 A;  3RI4 A;  4I99 C;  2DJN A;  3OR2 C;  1TBX A;  4L9V A;  5EEG A;  1G3S A;  3OR1 C;  2P6S A;  5BPD A;  2R3S A;  3F22 A;  1F4K A;  2Y0S A;  4MTD A;  2UXN A;  2E2J J;  2KKO A;  4KJZ A;  5TGT A;  5FLX K;  2DMU A;  2P81 A;  5IY5 H;  1IC8 A;  1Z6R A;  1K4S A;  4FTH A;  3DKY A;  4B47 A;  1XSD A;  1GXP A;  4NC6 A;  2NNN A;  4ZYD A;  2QF7 A;  1R36 A;  1KU7 A;  1BOB A;  3FXK A;  2AS5 F;  2HYG D;  4E6K G;  1YS7 A;  3ZXS A;  1L0O C;  1MIJ A;  1PVE A;  1FX7 A;  4H4K C;  5F0C A;  2VAS A;  2M8G X;  4BAC A;  3U9G A;  4HDU A;  3L2W A;  3FHZ A;  1JI8 A;  3KZY A;  3GTK J;  3I58 A;  2DMQ A;  3PNT A;  5J8F A;  2STT A;  2OBP A;  3T8R A;  1CF7 A;  3PNY A;  4Y15 A;  4O6J A;  1QHH D;  2RDP A;  4BHB A;  1IXR C;  2Z3Y A;  4X0G A;  3HM5 A;  4Y13 A;  3OYA A;  3JR9 A;  3TGN A;  2K85 A;  3SZP A;  4RB2 C;  5ICC A;  2B7E A;  1T98 A;  1WVR A;  3S1N J;  5DTD A;  1AA7 A;  4RMN A;  3LFK A;  2OCE A;  4RGS A;  1O3S A;  5DS9 A;  5B3S H;  1CF7 B;  4LB6 B;  3S8P A;  2JA6 J;  1ETW A;  4BEH B;  2FML A;  2PEX A;  5GTI C;  3W2A A;  2M0M A;  5A2Q K;  3I59 A;  1FSE A;  1LVK A;  1NK3 P;  3M7G A;  1BIA A;  3LMM A;  5J40 A;  2A5Y B;  4FCY A;  2RNJ A;  4LLN A;  2EV0 A;  2VLA A;  4EM2 A;  3CCR I;  3ZOB A;  2JA8 J;  3IH2 A;  2VQC A;  2L54 A;  4J19 A;  1FTZ A;  3M8J A;  3JTH A;  5FRN A;  3C2G A;  2QQA A;  4UB6 C;  2F5D A;  3V7S A;  5BOX A;  4U7D A;  4NHJ A;  5BPI A;  1VTN C;  2G9W A;  1I50 J;  2LG4 A;  2A69 F;  2FXA A;  1Z91 A;  2IXS A;  2MW8 A;  3NAU A;  2ZC2 A;  3P7N A;  3GZ5 A;  1JUP A;  3W2V A;  3OY9 A;  2IRF G;  3B6C A;  1RET A;  3A0B C;  3WGI A;  4HDV A;  1VQP I;  1JTX A;  2BBY A;  1ZKG A;  1OFC X;  2DQR A;  3IUO A;  5E3L A;  2Q8K A;  3AG3 H;  1P7I A;  1P4X A;  2IW5 A;  2HNH A;  1TW2 A;  2M3A A;  2VT3 A;  3HG9 A;  1MH3 A;  3E7L A;  2LP0 A;  2AXT C;  2A61 A;  4ZZD A;  2IAI A;  1N75 A;  2QGU A;  4O3M A;  4OIP F;  2ELJ A;  5IP9 J;  5EZG A;  4M9Z A;  4IRI A;  3SDG A;  1XSV A;  1ITY A;  1O3T A;  5IT9 K;  3G4S I;  1IDY A;  1W5C C;  3H35 A;  2TDX A;  3LSG A;  1R7J A;  1O57 A;  1ETK A;  2RV8 A;  2PFB A;  5HDG A;  1GLN A;  4WF2 A;  4LFU A;  4L0Z B;  3A0H C;  1ETQ A;  4M74 A;  5FLV A;  3AL0 B;  3CZ6 A;  1UFM A;  5CYV A;  4EJW A;  1OYI A;  1OJL A;  1BOA A;  1GV5 A;  3HOZ J;  5F08 A;  4IO9 F;  1CGP A;  2R5Z B;  3CMY A;  4NUB A;  3U1D A;  4IHS A;  2WV1 A;  4YEL A;  3FZV A;  3VYR B;  3DPT A;  2LR8 A;  3AFH A;  3LWF A;  2DCE A;  2V6C A;  3GTJ J;  4P96 A;  5K1Y A;  2HGC A;  1QA6 A;  1ZGJ A;  5GTH C;  2PJR B;  3RKY A;  4AWX B;  3MKL A;  2KZV A;  3KP5 A;  3J80 Z;  5E1W A;  2EIK H;  2K9S A;  4ABZ A;  3QPT A;  5L3E A;  4Z6Y A;  2EV5 A;  3NEU A;  1ZGA A;  4DJA A;  2ME6 A;  5D5U B;  2HZT A;  5KVR A;  4P5O A;  1SD5 A;  2E1M B;  4HYE A;  1SMT A;  2KJB A;  3C2B A;  1ETO A;  3ZN1 A;  4RM2 A;  2ZSH B;  2WBM A;  4WCG A;  4RM3 A;  3H9Q A;  2X0L A;  3HIF A;  4I76 A;  2CS3 A;  3PM1 A;  2P5K A;  1MMN A;  5K5R A;  1LE8 B;  2NOG A;  3GTP J;  4G7H F;  1PP8 F;  3G1L A;  4I02 A;  3ZMT A;  1AKH B;  2NRA C;  3GTQ J;  1B9M A;  1D3Y A;  1VFC A;  1WPK A;  1G59 A;  2BYV E;  3FIS A;  3K1P A;  1YIO A;  3BRO A;  1POG A;  2IA1 A;  3ASN H;  3G3Z A;  4HPQ A;  2FOK A;  2E1N A;  4OMY A;  3K4B A;  3CUQ C;  4L5J A;  1E3P A;  1WFX A;  4PSX A;  5BNG A;  1R5I D;  2COB A;  2X48 A;  1JJ8 C;  2E1C A;  3FK7 A;  3W6J B;  3I5U A;  1HCR A;  4IJA A;  5ICE A;  3EYY A;  1LKX A;  2B63 J;  2X1C A;  3JTG A;  1FZP B;  1YRN A;  3LAP A;  4II2 A;  4M3B A;  1EJ9 A;  1FYK A;  2XDV A;  3F8M A;  1TQM A;  3I55 I;  4M73 A;  2XRL A;  4ZC3 A;  3MKY B;  4BE1 A;  5J4Y A;  2R7T A;  3JSP A;  4BE0 A;  4C30 A;  2I10 A;  2VBY A;  2O3F A;  3S2H J;  3K70 D;  4DOZ A;  4R79 A;  3MZY A;  5E3M A;  4KDP A;  2K3F A;  1Y8R B;  2L01 A;  4CO8 A;  2XF7 A;  2ZB9 A;  4DYR A;  2QBY A;  1S3J A;  5AIQ A;  2RRE A;  3MQ0 A;  4HST A;  2DFI A;  1VQL I;  1S8N A;  3QRF F;  2VON A;  3ECH A;  2P6T A;  3HTS B;  3N4M A;  4E7I A;  3VOD A;  4ASN A;  2AQE A;  3HHH A;  3OL4 A;  1REP C;  4A3B J;  2YS9 A;  3BPX A;  4CXF A;  3ZQC A;  1MNM C;  2HPM A;  2HVS A;  4Y33 A;  4XKV A;  5C44 J;  1FYL A;  2MG4 A;  9ANT A;  3JRF A;  3CP8 A;  5LEJ A;  5DD8 A;  3TO9 A;  1MDM B;  1Y39 A;  2WV0 A;  1FIA A;  1WJA A;  4XRS G;  1JHF A;  4WXH A;  2UV1 A;  2JT1 A;  5FKL A;  2L4A A;  5M3F J;  2JZY A;  4UUT A;  4CA0 A;  4C2T A;  2IGM A;  4UY8 I;  1V3F A;  2ZXJ A;  4EQQ A;  4MHG A;  2CWE A;  5LGT A;  2GXB A;  4B4C A;  2X51 A;  2R7Z J;  1J09 A;  3W6K B;  4EVI A;  2K4B A;  3L2Q A;  3GFJ A;  1B59 A;  3VSL A;  5ILU A;  3DXJ F;  4AUX A;  2K9Q A;  1XGO A;  1BW6 A;  4NDL A;  5M5W J;  4IKF A;  1ZG3 A;  2KIM A;  1MD0 A;  2GLO A;  3BWG A;  3R4K A;  3BR3 A;  3E6B A;  3PL8 A;  1BR2 A;  4P9U A;  5BMZ A;  1BA5 A;  1TQI A;  2QVO A;  3EDP A;  3QYB A;  3JAM K;  2CU7 A;  1WH5 A;  3A02 A;  2R7S A;  3JRD A;  3DV8 A;  1X1C A;  5EG0 B;  2NXN B;  1JJ6 C;  1YFH A;  2HQR A;  4OIR F;  1LFB A;  5F1R A;  3HRU A;  5KAF C;  3OYB A;  1KQ0 A;  2CGP A;  2XGD A;  3FXO A;  4EAT A;  1BR1 A;  3OIQ A;  3WU2 C;  5HVQ C;  1S9H A;  5J6X A;  2LBF A;  3VPR A;  1XSX A;  3FIW A;  2M4K A;  4ITV A;  4PSW A;  1A6Q A;  4PUS A;  5DDG A;  3IL2 A;  2HI3 A;  5DEQ A;  2E1O A;  4M71 A;  3DP7 A;  3G2B A;  1S7O A;  2R5Y A;  3UR3 C;  3CCL I;  3KP4 A;  3TW6 A;  2VBW A;  2KRC A;  2ZXH A;  2JRT A;  3QPL A;  2Y9Z A;  3G73 A;  1YTY A;  4M6X A;  4G6Q A;  4BJT A;  2CQK A;  1EKE A;  5FKM A;  2HVQ A;  1XX5 A;  4CZZ A;  3J80 K;  3TW7 A;  3OSG A;  2ZNZ A;  2ADU A;  2PMZ N;  3BJ6 A;  3PSI A;  4Q47 A;  3J7Y J;  1GXQ A;  2EZK A;  2QSF X;  1SAX A;  1G2H A;  1TWC J;  2HOA A;  2LF7 A;  4UXN A;  3QOE A;  3QOP A;  1LPQ A;  4M9X A;  3ZMZ A;  2KIU A;  3KEY A;  3PSF A;  4OMZ A;  2BY1 A;  1DQU A;  2VL8 A;  2VQL A;  4KT6 A;  4EM0 B;  4E7K A;  3FDY A;  3M3Y J;  1F1Z A;  4DZJ A;  3PUF A;  2DOF A;  4OWR B;  4I0A A;  2LNB A;  2O8X A;  3HUG B;  2BEO A;  3E3V A;  3DEU A;  4C3J J;  3L7W A;  2UUZ A;  3KP2 A;  1LDJ A;  5BQT A;  1K4T A;  4GFB A;  2OQR A;  2E35 A;  3MCZ A;  4IOC F;  2A3S A;  4KT5 C;  2NS0 A;  4XON A;  2FEZ A;  3FHN A;  4AYB N;  1IO2 A;  3IWZ A;  5EJC A;  1MKM A;  1T08 B;  2KT0 A;  5ILV A;  3CJR B;  3IAM 2;  3KEO A;  4GYI A;  1HKS A;  5FKN A;  1IXC A;  1FP1 D;  1QRY A;  3RJP A;  1KQ8 A;  3E5X A;  4I6Z A;  3KZZ A;  1HSJ A;  2HOE A;  3HB9 A;  3K9T A;  4G94 A;  4CCJ A;  2L9R A;  1BL0 A;  1Y6I A;  3TP0 A;  1NH3 A;  2E36 A;  4L5E A;  2DMT A;  4K2E A;  4LOC A;  2K27 A;  4HAM A;  5E3N A;  4LG0 B;  1G3Y A;  2NAZ A;  2DMP A;  3OYM A;  3BC8 A;  3F3X A;  5K7Z A;  4A3K J;  3WU0 A;  3ZMU A;  2FJ1 A;  2VXZ A;  5CJ9 A;  2ICW G;  4KMU X;  2X6W A;  1RES A;  5LFA A;  4OAY A;  2LKP A;  3CUQ B;  3LQR A;  3BJA A;  4NC8 A;  4Q4Z F;  1R4N B;  3KET A;  5KHD A;  2CQX A;  1LFP A;  4F91 B;  5L3B A;  3GYH X;  2R7F A;  4EJO A;  3CJT B;  5B5E C;  1UJ8 A;  1RNL A;  1FC3 A;  1K6Y A;  3FXR A;  3OYF A;  2PJP A;  3OYJ A;  2WAD A;  4FE7 A;  2EZH A;  4BQN A;  1FT9 A;  1XCV A;  2D1V A;  4V19 K;  4A3C J;  3M4O J;  3M1C A;  1WSU A;  1QPI A;  3WHC A;  4BS9 A;  3QPH A;  2NVT J;  1AHD P;  5H6R A;  2PN6 A;  2OJE D;  5FLX Z;  4O5V A;  4XBF A;  1HBX G;  2LK2 A;  4G7O F;  4BXX J;  2FMY A;  3Q0W A;  4Y4R A;  4IPA A;  3CLO A;  2CUE A;  3CUO A;  2A05 A;  3BG6 A;  4LLG F;  4BAY A;  3VDX A;  1SFO J;  1BBY A;  4RGR A;  2F5F A;  4IHW A;  3FM5 A;  3K4J A;  5B1B H;  5HLI A;  2E34 A;  4DGW B;  3VOE A;  2JUC A;  3RQ4 A;  2TCT A;  1MND A;  2QYO A;  1RI7 A;  3KX2 A;  2MYS A;  4FET A;  4MQ9 F;  4H0E A;  3H92 A;  1LQ1 A;  3S2W A;  3D5L A;  4AC0 A;  1XD7 A;  2W00 A;  4A5M A;  2M87 A;  1OIS A;  1OCZ H;  1ON2 A;  3DF8 A;  4KUM A;  4FE4 A;  2XC7 A;  1K7A A;  1P4W A;  4UNO A;  4HQM A;  3BQY A;  3Q0V A;  3PO2 J;  4U87 A;  1NK2 P;  3MD2 A;  5CVV A;  3CC7 I;  1G8X A;  2ZJ2 A;  1YJW I;  4HV5 A;  2W7N A;  3CCU I;  1QVT A;  2ECC A;  1HA8 A;  4A3D J;  4L9T A;  4AVZ A;  3H0D A;  1WQ2 A;  4RLF A;  1D8J A;  1BW5 A;  1V5E A;  3F72 A;  3WU1 B;  3CME I;  4A3J J;  1FY7 A;  1AU7 A;  3HZJ A;  2JMW A;  2L9S A;  2HYF A;  3ZQF A;  3AG1 H;  5TJJ A;  3CCJ I;  3QP6 A;  2BY2 A;  2Z33 A;  2FA5 A;  1WJF A;  5A2Q Z;  4E7H A;  2LF8 A;  2V9P A;  5GPC A;  2YR2 A;  2IS4 A;  1X4P A;  4CSW A;  2O03 A;  3I4P A;  3GX4 X;  2A07 F;  4XN3 A;  2IS6 A;  4G12 A;  3WE2 A;  2CV2 A;  5DUK A;  4AIK A;  5FD6 A;  1Y1W J;  2W48 A;  4HF0 A;  1K78 B;  2E7W A;  1Z05 A;  2L9N A;  1LFU P;  1WJB A;  3R0A A;  3OIO A;  1J9I A;  3Q5F A;  2OZ6 A;  3TL4 X;  1YIJ I;  1YJ9 I;  3O6B B;  3HRM A;  5K7F A;  3EYI A;  2CUZ A;  1JHH A;  4YIF A;  3H3Z A;  3VSK A;  4N4O B;  4BUP A;  2EWN A;  1T38 A;  3COA C;  5H2F C;  3K4K A;  2BZT A;  1VQM I;  2V26 A;  3PFI A;  3MZH A;  1A6I A;  2ZNY A;  5GPA A;  4CCN A;  1YS6 A;  4BXF A;  1EH6 A;  1G6N A;  2HWV A;  1XPX A;  2EBI A;  3SEZ A;  1VND A;  1Z1D A;  3BPV A;  4FIS A;  4PFO A;  2OTJ I;  1A31 A;  5JR3 A;  3A01 B;  2HDD A;  3WTY C;  3FBI B;  3H5R A;  3K7A J;  4Y17 A;  5GP9 A;  2EIM H;  4IF4 A;  1D0Y A;  3B02 A;  3ZMV A;  1B72 A;  4JQF A;  1T0F A;  4HQE A;  5CQG A;  3NRV A;  1FMV A;  5E20 A;  1V55 H;  4YG2 F;  2LSO A;  2DT5 A;  1EH7 A;  3F8F A;  1WRJ A;  5ICG A;  3HRS A;  3F0C A;  3T0Y A;  4A69 C;  3L2R A;  1MJB A;  3C2H A;  4PK4 A;  4F55 A;  2P5L C;  3MKW B;  3OYH A;  1T8I A;  3R61 A;  4XLE A;  3RYR A;  5JLX A;  4A0Y A;  4F52 A;  3WTW C;  2VPL A;  1Y8Q B;  2MGQ A;  2PLY A;  1T39 A;  3D0S A;  4YFN F;  2DA6 A;  3OS2 A;  3WGG A;  1XMK A;  3E6D A;  5C4J J;  3DU5 A;  3ABM H;  3PFY A;  2RQQ A;  2RGV A;  4IXA A;  1ULY A;  2E19 A;  2HXI A;  1JKO C;  2MH9 A;  4C3I J;  4IHT A;  5F64 A;  3SFI A;  4BHC A;  2NYX A;  3A4C A;  1I39 A;  2CH0 A;  3W6V A;  1O4X A;  2E2H J;  1TP4 A;  2CW8 A;  1ZK8 A;  4NB5 A;  4CYC A;  4MLO A;  4KA4 A;  2VOP A;  3FX3 A;  5C4X J;  1FEX A;  3L00 A;  2NVX J;  3DBH B;  4I0B A;  3J81 Z;  2NVY J;  1ACI A;  2E5Z A;  4BGD A;  1D5V A;  1S5L C;  3HYI A;  5IYB J;  2YX7 A;  5CVI A;  2IJL A;  5FLM J;  3BCB A;  4RBO A;  1TNS A;  4Q5S F;  4XR6 A;  4RS8 A;  3V8L A;  2M4G A;  2ZJQ F;  2M5W A;  1LNW A;  1MMA A;  1YW8 A;  1Z6T A;  2BHZ A;  1X2M A;  2CUJ A;  3DLL F;  4DBQ A;  3JSO A;  5ERI A;  2QKL B;  2JTV A;  2VJ5 A;  4CCK A;  3SFZ A;  4A3L J;  2K9M A;  5J8C A;  4XOT A;  3FF5 A;  1V4R A;  4N0B A;  3M9A A;  1U0J A;  1WJE A;  1BI3 A;  3FMQ A;  1YE9 A;  2D2W A;  2O8K A;  2GOX B;  2DI3 A;  4PJN A;  2Q0O A;  1BI0 A;  3L1P A;  2M7A A;  1DGW Y;  3CTA A;  3S15 J;  4UV9 A;  1WGX A;  4PJL A;  2XVC A;  1ENH A;  3A1Y A;  3AKZ A;  2ZO4 A;  4CCL A;  2A6H F;  2ZCW A;  3J7A Y;  3V42 A;  1MMS A;  1R5H A;  1F5T A;  6PAX A;  1IXS B;  4IRH A;  1JUS A;  2LYC A;  2P4W A;  2VT2 A;  1HST A;  5HOO A;  4W1U A;  3CCS I;  2H27 A;  5GAE J;  5LHG A;  2L7F P;  1R1V A;  4G8X A;  4KIS A;  2KIS A;  4RAZ A;  3HPG A;  3F8N A;  1R58 A;  4ESB A;  2EZL A;  3RPU D;  2MLK A;  1SEU A;  2EA2 A;  1YJN I;  3OYI A;  1H9G A;  2DT6 A;  4C2M J;  2VE8 A;  3H3U A;  1RPW A;  1W7P D;  4L18 B;  5F0F A;  1OCP A;  4HW0 A;  3L9F A;  1TZL A;  3QQA A;  2CV0 A;  1ERD A;  1T95 A;  1RKW A;  5GAD J;  2ZFW A;  3F21 A;  4M9S A;  3R60 A;  1U5T A;  3K4M A;  3I59 B;  1DP3 A;  1BIB A;  2BVL A;  4RGU A;  4A93 J;  4M6V A;  2CRG A;  1QO0 D;  4QLC U;  3J7A O;  3BP8 A;  3BG7 A;  2ID6 A;  3HBL A;  2EIL H;  3HOU J;  2KDZ A;  3NWS A;  1IRZ A;  2HPI A;  2K5C A;  3IP4 B;  1ETX A;  1TWF J;  4P9F A;  2HKO A;  1I3Q J;  2L7Z A;  1B4A A;  4XRS A;  3UKG A;  2PMZ A;  1XGN A;  3CO6 C;  4G7Z F;  2L9V A;  2OU2 A;  2IT0 A;  1DUX C;  3HOY J;  1WWX A;  1OYW A;  2E2I J;  3BT9 A;  3ELK A;  3M8E A;  4FAS D;  2W4S A;  2OAZ A;  5IPA A;  3D1N I;  2QM3 A;  3OYD A;  4BYY A;  4HLY A;  1JXS A;  1OKR A;  3A2K A;  1FWZ A;  1IRF A;  2UXX A;  3I9V 2;  5HS9 A;  1ZRD A;  1XCB A;  3JAM Z;  1UAA A;  2XKP A;  3C3W A;  3BR0 A;  3RDI A;  3IRR A;  4QIW N;  1BM9 A;  3U2R A;  2Z99 A;  1T33 A;  4AYB A;  3IH3 A;  3OSF A;  3K1M A;  3WTV C;  1ZR2 A;  2K40 A;  2P0W A;  3Q3S A;  2W85 A;  2L4M A;  2CW0 F;  3ULQ B;  4RLQ A;  2DA3 A;  2HDW A;  4L0Y B;  4AIH A;  1QGP A;  3BCA A;  2GBY A;  1AOY A;  3R6S A;  4BY1 J;  4YIR X;  2JA7 J;  5HLH A;  2F6C A;  1SFE A;  5LRS A;  4C2U A;  4GCV A;  1F43 A;  1VQ6 I;  4FX4 A;  2DPU A;  3V4G A;  3JRC A;  4LGW A;  3FXM A;  4MEX F;  1B9N A;  3DEE A;  1YO5 C;  3LSM A;  2CV1 A;  3ZR8 X;  2CSO A;  1X2N A;  1WI3 A;  2KDO A;  1Z21 A;  1ZHF A;  2VBZ A;  1VQK I;  2FBK A;  5CVR A;  4ENN A;  3E0J B;  3J81 K;  4V2F A;  2C6Y A;  3CDH A;  5H20 A;  3TDU C;  3P9K A;  4D5F A;  3S3O A;  3LSJ A;  1WJC A;  1ZAR A;  1D0X A;  2JUG A;  5D8L B;  3KYL A;  3MN2 A;  1OR7 A;  2BW3 A;  1RZ4 A;  3NAR A;  2XSD C;  1FOK A;  2V1X A;  1I1G A;  2LOO A;  5K5O A;  4PJM A;  4DZP A;  2CW7 A;  1ZG1 A;  4Z2Y A;  3KYC B;  3TQN A;  2LMD A;  2OZU A;  3QU6 A;  5DCF A;  2WTE A;  2KJC A;  3W2W A;  2BW3 B;  2EK5 A;  2DO7 A;  1UHW A;  3GLX A;  5D6F A;  2LVS A;  1P6R A;  3C18 A;  1U8R A;  1J5Y A;  4BU2 A;  2HQN A;  1P2F A;  5KNL A;  1MBK A;  2W1O A;  2O61 A;  1GVJ A;  2GOM A;  1GT0 C;  3FMS A;  1N25 A;  1WI9 A;  1BJZ A;  3M07 A;  4N4N B;  4YEJ A;  1SC7 A;  2RQP A;  1LEA A;  1E2X A;  5HLT A;  3BTI A;  1S29 A;  3I53 A;  1WCM J;  4CDG A;  5EGO A;  4I98 B;  1FLI A;  3DWL E;  3RQI A;  1IF1 A;  4AIJ A;  1ZYR F;  3DBL B;  3WTU C;  1D8K A;  2H1K A;  3VB2 A;  3ZQI A;  2VQG A;  2XAU A;  3L09 A;  2IS2 A;  3CCE I;  2O6G E;  2A6T A;  4RAY A;  5TRD A;  1B8I A;  2ZXI A;  1ZEL A;  3MWM A;  1I5Z A;  2DW4 A;  2F2E A;  1YRN B;  2FSW A;  1DPR A;  4GGG A;  4A6D A;  1BC7 C;  3CC2 I;  2VUM J;  4MFE A;  2A5W A;  3BTJ A;  2FU4 A;  2VJJ A;  3RKW A;  4BL0 B;  3LNQ A;  4NBQ A;  1E17 A;  2H8W A;  2Y48 A;  4XKB A;  1JKQ C;  3ABK H;  2DTZ A;  2F5C A;  2CYY A;  1X4O A;  2KMU A;  5E1Z B;  4A0X A;  3JRG A;  4QSH A;  1RUN A;  2LY9 A;  3LQQ A;  3GME A;  4HF2 A;  1SVM A;  2DAO A;  3HKZ N;  2QBY B;  4HSR A;  1BN5 A;  1WHU A;  1CQT A;  1UG0 A;  1TL8 A;  4HG2 A;  2LH9 A;  2WB1 N;  4X1E A;  3PO3 J;  3S93 A;  2M0C A;  3IRQ A;  3DKW A;  4MO7 A;  4BBS J;  2MC3 A;  2ESH A;  2VPR A;  1V5F A;  3TED A;  1WKM A;  2Z1D A;  5CVJ A;  1H9T A;  3DBR B;  3LFU A;  1NHA A;  2QCO A;  5DUI A;  2DMN A;  1TWG J;  3V8K A;  3OYE A;  3RTR A;  5GAG J;  2EFP A;  4ENM A;  4I09 A;  1MBH A;  1U78 A;  1HW2 A;  3KLO A;  1X19 A;  5IP7 J;  1FBU A;  2V1N A;  1HKQ A;  5L3C A;  3CES A;  1D1B A;  1U3E M;  4DBR A;  2XPW A;  5FO5 A;  2H1L A;  2MAB A;  1HDP A;  1YG2 A;  2WY8 Q;  2IGN A;  3BG5 A;  1ON1 A;  1ZQ3 P;  1OPC A;  4E4H A;  3ERM A;  3WGH A;  1FSH A;  3ABT A;  3E97 A;  3AG2 H;  4GXO A;  1KON A;  3RKQ A;  3OS1 A;  2YU3 A;  4YFK F;  1I3A A;  1QBJ A;  3IH4 A;  3B73 A;  4M3D A;  4IHX A;  1Z3X A;  4FT8 A;  1P4A A;  2VC1 A;  2L0K A;  4OOI A;  1VQ5 I;  4YFX F;  4HNT A;  1F9N A;  1P92 A;  2Q1Z B;  3V7C A;  2BY3 A;  3BDD A;  3OV8 A;  1VI0 A;  2LBF B;  1GVD A;  3ZN0 A;  4UV8 A;  3DTI A;  4TV7 A;  2R7U A;  3HGY A;  1WZ2 A;  3HRT A;  1PJR A;  1P7J A;  2K9L A;  4UVB A;  1MBE A;  4ZH4 F;  2STW A;  3CF2 A;  1YIT I;  2AXL A;  3O8G A;  1G3T A;  4BQO A;  3F6O A;  4ENK A;  2R5Y B;  4KFC A;  1TWH J;  1UHM A;  2NVQ J;  3S1Q J;  1OCT C;  2FE3 A;  1DDN A;  4BJ5 C;  4II3 A;  2KQR A;  3FMR A;  1ZRF A;  1E0E A;  1ZLJ A;  4I01 A;  3NWT A;  4ZYH A;  2PMU A;  4OIQ F;  1SAU A;  4WK8 F;  2R7V A;  1T0F C;  3TO7 A;  2B0L A;  2DA2 A;  2Z5U A;  1LUJ B;  2P8T A;  2NS8 A;  4ZTF A;  1YI2 I;  4M3F A;  2VC0 A;  1EV7 A;  2ZME A;  4BDY A;  3QAH A;  1IN5 A;  2FNA A;  3SHF A;  1R9T J;  4OAZ A;  3S16 J;  1GUU A;  2K02 A;  3I4N J;  1LJ9 A;  2LFB A;  4J01 A;  4XM3 A;  3S1R J;  2ACJ A;  4IL6 C;  2GIV A;  2EFN A;  1HXD A;  3BR6 A;  1H88 C;  4HNV A;  3H36 A;  2LTP A;  2MFZ A;  2DT7 B;  2EQR A;  4HEA 2;  4N9H A;  4I7H A;  1X1P A;  2BV6 A;  1ZN2 A;  3BR5 A;  2DA1 A;  5HNH A;  3F6V A;  4PFP A;  1D1A A;  4B09 A;  3GFI A;  3VWB A;  5AIP A;  4HZF A;  1W0U A;  4ETS A;  2MSY A;  1IG7 A;  1YOV B;  1TT5 B;  4JX6 A;  2TRT A;  4IVN A;  4L9N A;  2AO9 A;  1IUF A;  1OQY A;  2MC4 A;  2EJR A;  2HS5 A;  2FQ3 A;  2FBH A;  1H89 C;  3KP6 A;  2QQ9 A;  2HFH A;  5EZH A;  3UNG C;  1O3R A;  3GTM J;  2HQA A;  1J75 A;  4LK1 F;  5K7H A;  2LRE A;  3CJQ B;  5AON A;  3RCO A;  3GTO J;  1IUY A;  3GUD A;  1NTC A;  1N77 A;  1YHQ I;  2W82 A;  5D5W B;  3DFG A;  3LA2 A;  3OYL A;  5L3D A;  1J59 A;  3T5X A;  2YUS A;  3GVA A;  1AWC A;  3CDL A;  3IKT A;  2OC6 A;  1Y1V J;  4KYW A;  4LIU A;  1JGS A;  1Y0N A;  3ZQL A;  5FKK A;  4UVA A;  1MH4 A;  2ECB A;  3HOV J;  1QU3 A;  1R1U A;  3C7J A;  2XV4 S;  1SD7 A;  2YX4 A;  2XGX A;  1V5G A;  2R93 J;  2G7H A;  3F8C A;  1QVU A;  2B9S A;  2XRN A;  4A6E A;  2DTR A;  2VKV A;  3HSE A;  1L3L A;  1WJD A;  3EUH A;  1WH7 A;  4HRI A;  1FYM A;  4D7M A;  3LAJ A;  4WX9 A;  3BQZ A;  5DCM A;  4HX4 A;  4IX7 A;  3CF5 F;  2DFH A;  2I5U A;  2K9N A;  4ZTJ A;  1YLF A;  4HLX A;  1MSE C;  2EPF A;  4U0Y A;  3OYG A;  3CDI A;  3GCM A;  4ZYA A;  1JKR C;  2L5Q A;  1W1W E;  3OMY A;  3DPL C;  5D5X B;  2W84 A;  5IOZ A;  3SEQ A;  5IYD J;  1KA8 A;  2A6E F;  2R7X A;  3IV5 A;  1KYZ A;  2K7L A;  2CUF A;  5E79 C;  3ABL H;  2Y2Z A;  1UCR A;  1O7F A;  3OYN A;  2H6C A;  4B43 A;  4E70 A;  2DK5 A;  3TKY A;  1Z77 A;  2HKX A;  4LJZ F;  2LKX A;  4IRG A;  1IRG A;  2XF6 A;  5FFZ A;  3S32 A;  1ZTR A;  2DA5 A;  3LSP A;  3ZP5 A;  1XDU A;  5LHI A;  2HQ5 A;  1EF4 A;  1U5T C;  4PZJ A;  1C0W A;  3H0G J;  4XQF A;  2PMH A;  2ZBK A;  2X6X A;  4W97 A;  3CO7 C;  2AQF A;  1KGS A;  5K5Q A;  2O9L A;  2OF7 A;  2L3D A;  4BE2 A;  4LIV A;  2Z9O A;  4NQW A;  4CCO A;  1FOX A;  5FD5 A;  4PGG A;  3FWE A;  5E1X A;  3QU3 A;  1W0T A;  2M8E A;  5FRM A;  4PJJ A;  2JSP A;  2ZJR F;  2OA4 A;  3G71 I;  2BE5 F;  4IHY A;  2X6Y A;  2UWM A;  3VYS B;  1W5S A;  2FOW A;  4KN7 X;  4XK4 A;  2YU9 J;  3RZO J;  1DU0 A;  2JWT A;  3TOB A;  2ELK A;  4XOR A;  3S2D J;  2QQB A;  1IN8 A;  4E7L A;  3GEZ A;  3OL3 A;  1LDD A;  3T1B A;  3L2U A;  4CHU A;  2ME0 A;  2VOO A;  3HSF A;  4U0W A;  1QZZ A;  3D5R C;  5M5X J;  2GXG A;  1J7K A;  3E5Q A;  4BNC A;  3BR1 A;  3HSR A;  4BXU A;  5E3O A;  2CFO A;  1Z7U A;  3REO A;  5F27 A;  3LSR A;  2MA3 A;  4ENJ A;  3ERE D;  1RR8 C;  1ZLK A;  2BHY A;  2K4J A;  3KP7 A;  1S7A A;  2VI6 A;  4C3H J;  2ZJP F;  1HLV A;  4BQQ A;  3P9C A;  2ELH A;  2QLZ A;  3WTZ A;  3H9G A;  2EH3 A;  3FXQ A;  2DQL A;  4R1H A;  3KPH A;  1IN4 A;  3ZRG A;  5JHF A;  3KYD B;  5C3E J;  1E3H A;  1Z9C A;  1XC5 A;  1B72 B;  5D8K B;  1Z67 A;  2JVG A;  4BKX A;  1OCR H;  2JPB A;  4G6D A;  4BBR J;  2W57 A;  1IW7 F;  4LD5 A;  2PX9 A;  3ESW B;  2M1B A;  2BXZ A;  2JQ7 A;  1SD4 A;  3P9I A;  1XS9 A;  3ABU A;  2CQN A;  4GRI A;  3MAJ A;  1T2K A;  1JT0 A;  2GWR A;  3C1D A;  1KU2 A;  1PP7 U;  1SVL A;  3B6A A;  1ORK A;  1HC8 A;  2HTS A;  2VE9 A;  2DYR H;  3RPU A;  4QPQ A;  4ZJZ A;  4CCM A;  1OR7 C;  1HKT A;  4XLA A;  2R7O A;  2XAH A;  2OD5 A;  3WTX C;  1IZ1 A;  3HGG A;  2OUM A;  1W7P A;  4ESF A;  1X1A A;  2R92 J;  1HF0 A;  3Q9S A;  1K83 J;  3ROU A;  5JLW A;  1U9N A;  2XSJ C;  4UUS A;  2IGO A;  4B3X A;  2DA4 A;  3QPS A;  3GZN B;  4CYC B;  2R7R A;  5E8G A;  1IDZ A;  2IS1 A;  2LDU A;  2NVU B;  1HOM A;  4A12 A;  1R22 A;  3X2Q H;  3MKZ A;  4PJ0 C;  2HZD A;  2DN0 A;  4UUS B;  3JRE A;  3ZCO A;  1YQA A;  2I8D A;  2RC4 A;  4I2O A;  2H6B A;  3DLA A;  1X3W B;  3HKZ A;  1QPM A;  4HF1 A;  2X85 A;  2DA7 A;  5M5Y J;  5HNF A;  2DDA A;  2VKE A;  5CLS A;  4E7J A;  3BG3 A;  2R4G A;  3K4N A;  5IYC J;  4S04 A;  5D4S A;  2WB1 A;  1B1B A;  3QYF A;  3S3M A;  4RAG A;  2Z16 A;  3NQO A;  2EFQ A;  1ETV A;  4RB3 C;  2QEX I;  5F1J A;  1G4D A;  4M72 A;  2FUG 2;  3ML6 A;  1JGG A;  3JRA A;  3DPU A;  4OIN F;  2F5V A;  1PDN C;  5D5V B;  2BXY A;  4D7N A;  1Z7L A;  2QA4 I;  3HOX J;  3ZPL A;  1W4M A;  3FK6 A;  2DOD A;  3DEW A;  3KZI C;  1TWA J;  3TDZ C;  3U1K A;  5ED4 A;  2FNP A;  4MQV A;  1IJW C;  1KU9 A;  5CQE A;  4BEH A;  1P9Q C;  1U9O A;  5B1A H;  1PYV A;  2F4O B;  4XMY A;  2V9K A;  4XLN F;  3GZ6 A;  3S3N A;  2XKO A;  2KZG A;  5HOD A;  2PBI A;  2QEN A;  5LEK A;  2R0Q C;  2VOD A;  1F36 A;  3RYP A;  2XB5 A;  3FXJ A;  1R5G A;  1JTY A;  3SZG A;  2H09 A;  3CJN A;  4CYD A;  2XGC A;  2CMP A;  5EEH A;  2D5V A;  3GLL A;  3O3K A;  4MEY F;  2M9H A;  3EQL F;  2IA2 A;  3MVP A;  3TO6 A;  2DYS H;  1RC9 A;  1RUO A;  1TQP A;  1HDD C;  2GQQ A;  2O5R A;  4BH9 A;  5LGN A;  1U5T B;  2WAQ N;  4CIC A;  3IWF A;  3W3C A;  4GYG A;  4IHV A;  2G0E A;  3K0L A;  4KMF A;  5FJ8 J;  4MIM A;  2IVM A;  3E6C C;  3PUB A;  1A5J A;  2NOJ B;  2G7U A;  4BQA A;  2V7F A;  4JOM A;  2X1E A;  3K4L A;  2HTJ A;  4A3M J;  1ONV A;  2X6O A;  4OIO F;  5HS7 A;  3I3L A;  5EYR A;  4F93 B;  3H5A A;  3G1M A;  4WWC A;  3TBI A;  2V79 A;  2CG4 A;  2R7Q A;  2RAE A;  2YSR A;  3VFZ A;  1QNT A;  3GXO A;  3BLY A;  2WC2 A;  2GZW A;  3CMM A;  2MD5 A;  4A2U A;  1OLT A;  2L7M P;  3HHG A;  4XLH A;  1MSF C;  3WG9 A;  4S0H B;  1I6H J;  3HL2 A;  1DU6 A;  2DPD A;  3OYK A;  2BY0 A;  2UZK A;  4P55 A;  4L5I A;  4HA8 A;  1H0M A;  2EIJ H;  2OV7 A;  3LL7 A;  5L3G A;  2X4H A;  1MMG A;  1STZ A;  1XB4 A;  3IHU A;  2F4M B;  3QOD A;  3L2C A;  3PQK A;  4XKW A;  4XRM A;  3BJO A;  5D4R A;  3GTG J;  4BHP A;  3DTK A;  1FBS A;  3CC4 I;  2DXI A;  1DGR M;  1BR4 A;  3OOU A;  2CFX A;  2R5Z A;  3KEQ A;  5D6E A;  4EJU A;  2XB0 X;  2F48 A;  3H1C A;  3OIP A;  5J3L A;  3IAS 2;  4D9J A;  3KLN A;  2NS7 A;  4EV0 A;  1K6O A;  3E5U A;  4KIF A;  3I0T A;  2HDC A;  3BZC A;  2GM4 A;  4M3E A;  2ID3 A;  2FX0 A;  5TIS C;  4LG3 A;  4RAF A;  3TP3 A;  1FMW A;  4RB0 A;  2YPR A;  5J1Y A;  4WXD A;  4XSZ F;  4M6Y A;  2PJR A;  1NG7 A;  3JW4 A;  4D5C A;  3CCM I;  1BI2 A;  1U2W A;  1K79 A;  1VZ0 A;  2HYJ A;  5DM7 F;  2ETH A;  1I1S A;  2GIZ A;  2V4J C;  2ZME C;  5FKO A;  5FB2 A;  3SJM A;  2D1H A;  5EF6 A;  3ECO A;  5CVU A;  2M30 A;  1R49 A;  2IBD A;  2HOS A;  1GV2 A;  4HOB A;  2VB6 A;  2E5N A;  1RKT A;  2ISZ A;  1FNN A;  1SFX A;  2A68 F;  3V7R A;  4Q48 A;  1DPU A;  1VQ8 I;  4RA2 A;  1TT0 A;  1LE8 A;  1MBG A;  4DW6 A;  1AKH A;  1MBJ A;  4KIC A;  1M1E B;  3FKI J;  2ZKZ A;  4AD9 A;  3GF2 A;  1W36 C;  1J2X A;  4G9Y A;  2WA0 A;  5LD2 C;  1HQC A;  3H3V K;  3L2V A;  3CD6 I;  4HNU A;  2ZXW H;  2HVR A;  4B3A A;  2VJ4 A;  3CLQ A;  2JPC A;  2V1D A;  4XIC A;  2WWY A;  2Y30 A;  4N9I A;  1OYY A;  1R00 A;  2QUF A;  3SDB A;  2JRM A;  4CUG A;  4U0V A;  2FBI A;  5H6Q A;  4F3Q A;  2O0Y A;  4MNU A;  2F4I A;  3ASO H;  2VIX A;  1SFK A;  3TMO A;  1TC3 C;  2M34 A;  2VJI A;  4G6T B;  3ZQH A;  5EGO B;  3EUA A;  2BOL A;  3CCY A;  4EGZ A;  2IP2 A;  4XOP A;  4CGZ A;  2EFO A;  3HPH A;  2DFF A;  4E7Z A; 
#chains in the Genus database with same CATH homology
 2XAG A;  2XAF A;  1SD6 A;  1ZAO A;  2COM A;  5E17 F;  2GA1 A;  1UB9 A;  5BS6 A;  2M45 A;  5DYM A;  1A04 A;  4DNC A;  1B6A A;  4ZYG A;  1ZG5 A;  1TTY A;  4A5N A;  3Q9V A;  1LEB A;  1SMY F;  1X3U A;  2PG4 A;  4EGY A;  2DLL A;  2P5V A;  3ZQ7 A;  3FM3 A;  3SQN A;  3F23 A;  1MDM A;  3M8F A;  1O3Q A;  1ZRE A;  1FBQ A;  1XGM A;  3LA7 A;  1BI1 A;  4DQ2 A;  4R8H A;  2MH2 A;  4HBL A;  2KIF A;  3BZ6 A;  4S05 A;  4XRF A;  1JE8 A;  2GAU A;  1IN6 A;  2PQ8 A;  2EFW A;  5HDK A;  5HS8 A;  2PI0 A;  4ZZL A;  1YW7 A;  1BC8 C;  4XLP F;  2DU9 A;  3KFW X;  4JK1 X;  2VBX A;  1I6X A;  5JHU A;  3I64 A;  1J0R A;  4HX8 A;  3RKX A;  1MJA A;  3V8J A;  2V9V A;  1TW3 A;  5KK1 A;  2XAQ A;  3GWZ A;  3IC7 A;  5LGU A;  3OOP A;  2VN2 A;  1R1T A;  2NNY A;  3PQJ A;  1QZY A;  5LRR A;  3BY6 A;  5E18 F;  4KN4 X;  2EA4 A;  2MBF A;  1R23 A;  1YYV A;  4WXC A;  4LMY A;  4MGR A;  4LLL A;  3BOQ A;  4JBA A;  1XDS A;  3HUG A;  3K2Z A;  3KCC A;  2QWW A;  3LST A;  1I27 A;  4UUV A;  3TOA A;  1LDK B;  3K1N A;  1ODD A;  3WTS C;  4EJT A;  2ZME B;  3HOS A;  2FF4 A;  4EM1 A;  1Q1H A;  1KYW A;  2W24 A;  4XSX F;  1USS A;  1PUE E;  4LG0 A;  4L9J A;  2JSC A;  5IT3 A;  2XRO A;  4U7B A;  2F5E A;  2EV6 A;  2E7X A;  5L3F A;  4ZYE A;  1LVA A;  3CUQ A;  3KP3 A;  2P7V B;  4YII A;  3F8B A;  2RVC A;  1O7L A;  1GHC A;  1SFU A;  2W25 A;  1W5T A;  1MZB A;  1OMI A;  3M1E A;  3I71 A;  2V1U A;  3RIR A;  1TNT A;  2P7C B;  4QWQ A;  3HOT A;  3RPQ A;  4FHT A;  2GA2 A;  3N97 A;  3ZMD A;  5FFX A;  4LK0 F;  1Y0U A;  3WOD F;  4RGX A;  1DP7 P;  4U88 A;  2HEO A;  2L02 A;  4A0Z A;  5JFR A;  4ON0 A;  5HLG A;  3T8T A;  4LB5 A;  5E8I A;  1U6G A;  3IKV A;  4RB1 A;  3SZT A;  2DK8 A;  2XAJ A;  2HR3 A;  2KRF A;  2Q2E A;  5DCM B;  3WTT C;  1BJA A;  1G3W A;  1IN7 A;  1FP2 A;  5LBQ A;  4UHT A;  3WE3 A;  4MTE A;  1RIO H;  1HW1 A;  2ESN A;  2R7D A;  3QP5 A;  3K69 A;  3VEP A;  1XGS A;  5LHH A;  3LA3 A;  4F7Z A;  3GFM A;  4D0P A;  2IPQ X;  2Y75 A;  2XUB A;  2J5O A;  4HV6 A;  1K78 A;  2Y0M A;  5LLQ A;  3FXU A;  4EMS A;  4PDK A;  5F6F A;  3O2P E;  1XMA A;  3ZMS A;  1TLH B;  3E6M A;  1QQI A;  5JI6 A;  2RKH A;  4PCQ A;  5ICF A;  2BGC A;  4UVC A;  4PGH A;  3EET A;  3AAF A;  1FPQ A;  2XAS A;  2D45 A;  5ILS A;  3KE2 A;  5FGM A;  1UST A;  4EJV A;  3HTU A;  1MGT A;  3R0J A;  4KIG A;  4KIB A;  4AVP A;  1ZRC A;  1HW5 A;  1MJ9 A;  2J5P A;  2XIG A;  1T6S A;  1KQ9 A;  1XN7 A;  1EH8 A;  3SXY A;  1S6L A;  5IT9 Z;  2DBB A;  2IA0 A;  4HX7 A;  1YW9 A;  2RN7 A;  2MLG A;  2ISY A;  4OU0 A;  5HDN A;  2QZ8 A;  5JVT A;  1ZH5 A;  2EB7 A;  3DQV C;  3GW2 A;  2K86 A;  2OQG A;  5DD4 A;  1KU3 A;  4GO1 A;  3GO5 A;  4B8X A;  3GFL A;  2CO5 A;  3MFK A;  4KNY A;  3MEX A;  4FX0 A;  5DV5 A;  1W7P B;  2XHK A;  2H94 A;  4ESJ A;  3I54 A;  2FRH A;  1IAW A;  3ISP A;  1LB2 A;  3RI4 A;  1TBX A;  4L9V A;  5EEG A;  1G3S A;  2P6S A;  5BPD A;  2R3S A;  3F22 A;  1F4K A;  4MTD A;  2UXN A;  2KKO A;  5FLX K;  1Z6R A;  1XSD A;  1GXP A;  2NNN A;  4ZYD A;  1R36 A;  1KU7 A;  2AS5 F;  2HYG D;  1YS7 A;  1L0O C;  1FX7 A;  3U9G A;  4HDU A;  3FHZ A;  3KZY A;  3I58 A;  5J8F A;  2STT A;  2OBP A;  3T8R A;  1CF7 A;  4Y15 A;  4O6J A;  2RDP A;  4BHB A;  1IXR C;  2Z3Y A;  4Y13 A;  3TGN A;  3SZP A;  4RB2 C;  5ICC A;  1T98 A;  3LFK A;  4RGS A;  1O3S A;  1CF7 B;  4LB6 B;  2FML A;  2PEX A;  5A2Q K;  3I59 A;  1FSE A;  3M7G A;  1BIA A;  2A5Y B;  2RNJ A;  4LLN A;  2EV0 A;  4EM2 A;  2L54 A;  3JTH A;  2QQA A;  2F5D A;  3V7S A;  5BOX A;  4U7D A;  4NHJ A;  5BPI A;  1VTN C;  2G9W A;  2A69 F;  2FXA A;  1Z91 A;  3P7N A;  3GZ5 A;  2IRF G;  3WGI A;  4HDV A;  2BBY A;  2DQR A;  2Q8K A;  1P4X A;  2IW5 A;  1TW2 A;  2VT3 A;  2A61 A;  4ZZD A;  4O3M A;  4OIP F;  4M9Z A;  4IRI A;  1XSV A;  1O3T A;  5IT9 K;  2TDX A;  1R7J A;  1O57 A;  2RV8 A;  2PFB A;  5HDG A;  4WF2 A;  4LFU A;  4L0Z B;  4M74 A;  1UFM A;  5CYV A;  4EJW A;  1OYI A;  1BOA A;  1CGP A;  3U1D A;  4IHS A;  3FZV A;  3DPT A;  3LWF A;  2V6C A;  4P96 A;  5K1Y A;  2HGC A;  1ZGJ A;  3RKY A;  4AWX B;  3KP5 A;  3J80 Z;  5E1W A;  3QPT A;  5L3E A;  2EV5 A;  3NEU A;  1ZGA A;  5D5U B;  2HZT A;  5KVR A;  4P5O A;  1SD5 A;  4HYE A;  1SMT A;  2KJB A;  3ZN1 A;  4WCG A;  2X0L A;  3HIF A;  2P5K A;  5K5R A;  4G7H F;  1PP8 F;  4I02 A;  3ZMT A;  2NRA C;  1B9M A;  1D3Y A;  2BYV E;  3K1P A;  1YIO A;  3BRO A;  2IA1 A;  3G3Z A;  2FOK A;  2E1N A;  4OMY A;  3CUQ C;  4L5J A;  2E1C A;  3W6J B;  3I5U A;  4IJA A;  5ICE A;  3EYY A;  3JTG A;  1FZP B;  3LAP A;  1FYK A;  3F8M A;  1TQM A;  4M73 A;  3JSP A;  2VBY A;  2O3F A;  4R79 A;  3MZY A;  4KDP A;  2L01 A;  4CO8 A;  2QBY A;  1S3J A;  5AIQ A;  3MQ0 A;  2DFI A;  1S8N A;  3QRF F;  2VON A;  3ECH A;  2P6T A;  3HTS B;  3N4M A;  3VOD A;  4ASN A;  3HHH A;  1REP C;  3BPX A;  4CXF A;  1FYL A;  1MDM B;  5LEJ A;  5DD8 A;  3TO9 A;  2WV0 A;  1JHF A;  4WXH A;  2JT1 A;  2L4A A;  2JZY A;  1V3F A;  2ZXJ A;  4EQQ A;  4MHG A;  2CWE A;  5LGT A;  2GXB A;  3W6K B;  4EVI A;  2K4B A;  3GFJ A;  1B59 A;  5ILU A;  3DXJ F;  1XGO A;  1ZG3 A;  2KIM A;  1MD0 A;  3BWG A;  3R4K A;  3E6B A;  4P9U A;  5BMZ A;  1TQI A;  2QVO A;  3EDP A;  3JAM K;  3DV8 A;  1YFH A;  2HQR A;  4OIR F;  5F1R A;  2CGP A;  3HRU A;  1KQ0 A;  5HVQ C;  5J6X A;  1XSX A;  5DDG A;  3IL2 A;  5DEQ A;  4M71 A;  3DP7 A;  1S7O A;  3KP4 A;  2VBW A;  2JRT A;  3G73 A;  1YTY A;  4M6X A;  4G6Q A;  2CQK A;  4CZZ A;  3J80 K;  2ZNZ A;  2ADU A;  3BJ6 A;  4Q47 A;  1GXQ A;  1SAX A;  2LF7 A;  4UXN A;  3QOP A;  4M9X A;  3ZMZ A;  2KIU A;  4OMZ A;  4EM0 B;  1F1Z A;  4I0A A;  2LNB A;  2O8X A;  2BEO A;  3E3V A;  3DEU A;  3L7W A;  3KP2 A;  1LDJ A;  5BQT A;  2OQR A;  3MCZ A;  2A3S A;  4KT5 C;  2NS0 A;  2FEZ A;  3IWZ A;  1MKM A;  5ILV A;  3KEO A;  4GYI A;  1HKS A;  3RJP A;  1IXC A;  1FP1 D;  1KQ8 A;  3E5X A;  3KZZ A;  1HSJ A;  2HOE A;  3K9T A;  4G94 A;  4K2E A;  2K27 A;  4HAM A;  4LG0 B;  1G3Y A;  2NAZ A;  3F3X A;  3WU0 A;  3ZMU A;  2VXZ A;  5CJ9 A;  4KMU X;  2LKP A;  3CUQ B;  3LQR A;  3BJA A;  4Q4Z F;  3KET A;  3GYH X;  5L3B A;  2R7F A;  4EJO A;  1RNL A;  1FC3 A;  2PJP A;  3FXR A;  1FT9 A;  1XCV A;  2D1V A;  1WSU A;  3QPH A;  5H6R A;  2PN6 A;  5FLX Z;  4O5V A;  4XBF A;  1HBX G;  4G7O F;  2FMY A;  4IPA A;  3CLO A;  3CUO A;  4LLG F;  4BAY A;  1BBY A;  4RGR A;  2F5F A;  3FM5 A;  5HLI A;  3VOE A;  2QYO A;  1RI7 A;  4MQ9 F;  1LQ1 A;  4H0E A;  3H92 A;  3S2W A;  3D5L A;  1XD7 A;  4A5M A;  2M87 A;  1ON2 A;  3DF8 A;  4KUM A;  1K7A A;  1P4W A;  4UNO A;  4HQM A;  5CVV A;  2ZJ2 A;  4HV5 A;  4L9T A;  1WQ2 A;  1D8J A;  3F72 A;  3WU1 B;  1FY7 A;  2HYF A;  5TJJ A;  3QP6 A;  2Z33 A;  2FA5 A;  5A2Q Z;  2LF8 A;  2YR2 A;  2O03 A;  3I4P A;  3GX4 X;  2A07 F;  3WE2 A;  5DUK A;  4AIK A;  5FD6 A;  4HF0 A;  1K78 B;  2E7W A;  1Z05 A;  3R0A A;  1J9I A;  3Q5F A;  2OZ6 A;  3O6B B;  3HRM A;  3EYI A;  1JHH A;  4YIF A;  3H3Z A;  2EWN A;  1T38 A;  3COA C;  3PFI A;  3MZH A;  2ZNY A;  1YS6 A;  1EH6 A;  1G6N A;  2HWV A;  1Z1D A;  3BPV A;  5JR3 A;  3WTY C;  4Y17 A;  4IF4 A;  3ZMV A;  3B02 A;  4JQF A;  1T0F A;  4HQE A;  3NRV A;  5E20 A;  4YG2 F;  2LSO A;  2DT5 A;  1EH7 A;  3F8F A;  1WRJ A;  5ICG A;  3HRS A;  3T0Y A;  1MJB A;  2P5L C;  3R61 A;  3RYR A;  4A0Y A;  3WTW C;  2PLY A;  1T39 A;  3D0S A;  4YFN F;  3WGG A;  1XMK A;  3E6D A;  2RGV A;  4IXA A;  1ULY A;  4IHT A;  2MH9 A;  5F64 A;  4BHC A;  2NYX A;  4NB5 A;  4KA4 A;  2VOP A;  3FX3 A;  3L00 A;  4I0B A;  3J81 Z;  1D5V A;  3HYI A;  2YX7 A;  5CVI A;  2IJL A;  4Q5S F;  1TNS A;  4RS8 A;  3V8L A;  2M5W A;  1LNW A;  1YW8 A;  1Z6T A;  3JSO A;  5ERI A;  2JTV A;  3SFZ A;  5J8C A;  3FF5 A;  1V4R A;  4N0B A;  3M9A A;  1BI3 A;  3FMQ A;  2D2W A;  2DI3 A;  2Q0O A;  1BI0 A;  3CTA A;  4UV9 A;  2XVC A;  2ZO4 A;  2A6H F;  2ZCW A;  1R5H A;  1F5T A;  6PAX A;  1IXS B;  4IRH A;  2P4W A;  2VT2 A;  1HST A;  5HOO A;  2H27 A;  5LHG A;  1R1V A;  4G8X A;  4RAZ A;  3F8N A;  1R58 A;  4ESB A;  2MLK A;  2EA2 A;  1H9G A;  2VE8 A;  3H3U A;  1W7P D;  4L18 B;  4HW0 A;  3L9F A;  2ZFW A;  3F21 A;  4M9S A;  3R60 A;  1U5T A;  3I59 B;  1BIB A;  4RGU A;  1QO0 D;  4QLC U;  3J7A O;  3BP8 A;  4P9F A;  2HKO A;  1B4A A;  1XGN A;  3CO6 C;  4G7Z F;  2OU2 A;  2IT0 A;  1DUX C;  1WWX A;  1OYW A;  3ELK A;  3M8E A;  2OAZ A;  2QM3 A;  4HLY A;  4BYY A;  1JXS A;  1OKR A;  1FWZ A;  1IRF A;  2UXX A;  5HS9 A;  1ZRD A;  1XCB A;  3JAM Z;  2XKP A;  3C3W A;  3RDI A;  3IRR A;  1BM9 A;  3U2R A;  2Z99 A;  3K1M A;  3WTV C;  2W85 A;  2L4M A;  2CW0 F;  3ULQ B;  4L0Y B;  4AIH A;  1QGP A;  1AOY A;  3R6S A;  5HLH A;  1SFE A;  5LRS A;  4GCV A;  4FX4 A;  2DPU A;  3V4G A;  4LGW A;  4MEX F;  1B9N A;  1YO5 C;  2CSO A;  1ZHF A;  2VBZ A;  2FBK A;  5CVR A;  4ENN A;  3J81 K;  2C6Y A;  3CDH A;  5H20 A;  3TDU C;  3P9K A;  1ZAR A;  5D8L B;  1OR7 A;  1RZ4 A;  1FOK A;  2V1X A;  1I1G A;  5K5O A;  1ZG1 A;  4Z2Y A;  3TQN A;  2OZU A;  3QU6 A;  5DCF A;  2WTE A;  2KJC A;  2EK5 A;  2DO7 A;  1UHW A;  3GLX A;  5D6F A;  1P6R A;  3C18 A;  1U8R A;  1J5Y A;  2HQN A;  1P2F A;  2O61 A;  1GVJ A;  3FMS A;  1WI9 A;  2RQP A;  1LEA A;  1E2X A;  3I53 A;  1S29 A;  4CDG A;  4I98 B;  1FLI A;  1IF1 A;  4AIJ A;  1ZYR F;  3WTU C;  1D8K A;  3VB2 A;  3L09 A;  2O6G E;  4RAY A;  5TRD A;  3MWM A;  1I5Z A;  2DW4 A;  2F2E A;  2FSW A;  1DPR A;  4GGG A;  4A6D A;  1BC7 C;  2FU4 A;  3RKW A;  1E17 A;  2Y48 A;  2F5C A;  2CYY A;  5E1Z B;  4A0X A;  1RUN A;  3LQQ A;  4HF2 A;  2DAO A;  2QBY B;  1BN5 A;  3IRQ A;  3DKW A;  2MC3 A;  2ESH A;  1WKM A;  5CVJ A;  1H9T A;  1NHA A;  5DUI A;  3V8K A;  3RTR A;  2EFP A;  4ENM A;  4I09 A;  1HW2 A;  1U78 A;  3KLO A;  1FBU A;  1HKQ A;  5L3C A;  1U3E M;  5FO5 A;  1YG2 A;  1ON1 A;  1OPC A;  1FSH A;  3WGH A;  3ABT A;  3E97 A;  4GXO A;  2YU3 A;  4YFK F;  1QBJ A;  3B73 A;  4FT8 A;  1P4A A;  2VC1 A;  4OOI A;  4YFX F;  1F9N A;  1P92 A;  3V7C A;  3BDD A;  3OV8 A;  3ZN0 A;  4UV8 A;  4TV7 A;  3HRT A;  4UVB A;  4ZH4 F;  2STW A;  2AXL A;  1G3T A;  4ENK A;  3F6O A;  4KFC A;  1UHM A;  2FE3 A;  1DDN A;  3FMR A;  1ZRF A;  1ZLJ A;  4I01 A;  4ZYH A;  2PMU A;  4OIQ F;  4WK8 F;  3TO7 A;  2B0L A;  2Z5U A;  2P8T A;  2VC0 A;  1EV7 A;  2ZME A;  3QAH A;  1IN5 A;  2FNA A;  3SHF A;  2K02 A;  1LJ9 A;  2ACJ A;  2GIV A;  2EFN A;  1HXD A;  4N9H A;  4I7H A;  2BV6 A;  1ZN2 A;  3F6V A;  4B09 A;  3GFI A;  5AIP A;  4HZF A;  4ETS A;  4IVN A;  4L9N A;  2EJR A;  2HS5 A;  2FQ3 A;  2FBH A;  3KP6 A;  2QQ9 A;  2HFH A;  1O3R A;  1J75 A;  4LK1 F;  5AON A;  1IUY A;  3GUD A;  5D5W B;  3DFG A;  3LA2 A;  1J59 A;  5L3D A;  3T5X A;  3GVA A;  1AWC A;  3IKT A;  4KYW A;  1JGS A;  4UVA A;  1R1U A;  3C7J A;  2XV4 S;  1SD7 A;  2YX4 A;  2XGX A;  2G7H A;  3F8C A;  2XRN A;  4A6E A;  2DTR A;  3HSE A;  1L3L A;  3EUH A;  1FYM A;  3LAJ A;  4WX9 A;  5DCM A;  4HX4 A;  1YLF A;  4HLX A;  4U0Y A;  3DPL C;  5D5X B;  2W84 A;  1KA8 A;  2A6E F;  1KYZ A;  2K7L A;  1UCR A;  1O7F A;  2H6C A;  4E70 A;  2DK5 A;  3TKY A;  2HKX A;  4LJZ F;  1IRG A;  4IRG A;  5FFZ A;  3ZP5 A;  1XDU A;  5LHI A;  1U5T C;  4PZJ A;  1C0W A;  2PMH A;  2ZBK A;  3CO7 C;  1KGS A;  5K5Q A;  2L3D A;  2Z9O A;  4NQW A;  5FD5 A;  4PGG A;  3FWE A;  5E1X A;  3QU3 A;  2M8E A;  2OA4 A;  2BE5 F;  2UWM A;  1W5S A;  4KN7 X;  3TOB A;  2QQB A;  1IN8 A;  3GEZ A;  1LDD A;  3T1B A;  4CHU A;  2VOO A;  3HSF A;  4U0W A;  1QZZ A;  2GXG A;  1J7K A;  3E5Q A;  4BNC A;  3HSR A;  4BXU A;  1Z7U A;  3REO A;  2MA3 A;  4ENJ A;  3ERE D;  1ZLK A;  2K4J A;  3KP7 A;  1S7A A;  3P9C A;  2ELH A;  2QLZ A;  3WTZ A;  3FXQ A;  2DQL A;  4R1H A;  1IN4 A;  1Z9C A;  5D8K B;  2JPB A;  4G6D A;  2W57 A;  1IW7 F;  4LD5 A;  2M1B A;  1SD4 A;  3P9I A;  3ABU A;  3MAJ A;  1T2K A;  2GWR A;  3C1D A;  1KU2 A;  1PP7 U;  2HTS A;  2VE9 A;  3RPU A;  1HKT A;  3WTX C;  2XAH A;  2OD5 A;  1IZ1 A;  1W7P A;  4ESF A;  3Q9S A;  3ROU A;  5E8G A;  2LDU A;  4A12 A;  1R22 A;  1YQA A;  2RC4 A;  4I2O A;  2H6B A;  1QPM A;  4HF1 A;  5CLS A;  4S04 A;  5D4S A;  1B1B A;  3NQO A;  2EFQ A;  4RB3 C;  1G4D A;  4M72 A;  3ML6 A;  4OIN F;  1PDN C;  5D5V B;  3ZPL A;  1W4M A;  5ED4 A;  3TDZ C;  2FNP A;  4MQV A;  1KU9 A;  4XLN F;  3GZ6 A;  2XKO A;  2PBI A;  2QEN A;  5LEK A;  2VOD A;  3RYP A;  1R5G A;  2H09 A;  3CJN A;  4CYD A;  5EEH A;  3O3K A;  4MEY F;  3EQL F;  2IA2 A;  3TO6 A;  1RUO A;  1TQP A;  2GQQ A;  4BH9 A;  5LGN A;  1U5T B;  4CIC A;  3IWF A;  4GYG A;  3K0L A;  4KMF A;  2IVM A;  3E6C C;  2G7U A;  4BQA A;  2HTJ A;  1ONV A;  4OIO F;  5HS7 A;  4WWC A;  2V79 A;  2CG4 A;  2YSR A;  3VFZ A;  1QNT A;  3GXO A;  2WC2 A;  2GZW A;  2MD5 A;  4A2U A;  3HHG A;  3WG9 A;  2DPD A;  2UZK A;  4P55 A;  4L5I A;  4HA8 A;  1H0M A;  5L3G A;  3L2C A;  1STZ A;  1XB4 A;  2X4H A;  3IHU A;  3PQK A;  5D4R A;  3BJO A;  4BHP A;  1FBS A;  2CFX A;  3KEQ A;  5D6E A;  4EJU A;  3KLN A;  4EV0 A;  1K6O A;  3E5U A;  4KIF A;  3I0T A;  2HDC A;  4RB0 A;  2YPR A;  4WXD A;  4XSZ F;  4M6Y A;  3JW4 A;  1BI2 A;  1U2W A;  1K79 A;  2ETH A;  1I1S A;  5FB2 A;  2D1H A;  3ECO A;  5CVU A;  2M30 A;  4HOB A;  2ISZ A;  1FNN A;  1SFX A;  2A68 F;  3V7R A;  4Q48 A;  1DPU A;  4KIC A;  2ZKZ A;  4AD9 A;  3GF2 A;  1J2X A;  4G9Y A;  1HQC A;  2JPC A;  2V1D A;  2WWY A;  4N9I A;  1OYY A;  1R00 A;  2QUF A;  4U0V A;  2FBI A;  5H6Q A;  2O0Y A;  4MNU A;  4EGZ A;  2IP2 A;  4CGZ A;  2EFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...