1E0EA

N-terminal zinc-binding hhcc domain of hiv-2 integrase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
FLEKIEPAQEEHEKYHSNVKELSHKFGIPNLVARQIVNSCAQCQQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined Solution Structure of the Dimeric N-Terminal Hhcc Domain of HIV-2 Integrase
pubmed doi rcsb
source organism Human immunodeficiency virus type 2 (isolate rod)
molecule tags Integrase
molecule keywords HUMAN IMMUNODEFICIENCY VIRUS TYPE 2 INTEGRASE
total genus 13
structure length 46
sequence length 46
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1e0eA00
1LFPA 1WJBA 3HPHA 1K6YA 1WJFA 1WJEA 1E0EA 1KONA 1MW7A 1WJCA 3F9KA 4F3QA 1WJDA 1WJAA 3HPGA
chains in the Genus database with same CATH superfamily
4FX4A 2X48A 2VQGA 4GGGA 1KU3A 4LG3A 4ZJZA 2VPLA 3OYIA 1TLHB 4IHTA 1MJ9A 2UUZA 1X1BA 2MD0A 1MBGA 3JRDA 3OYAA 3ERED 5HNHA 2HI3A 3H5RA 1MMNA 1ON2A 2CUZA 2Y31A 1KONA 4UV8A 3JRFA 2NVQJ 4A3LJ 1E3OC 5CVRA 1MDMA 2K9LA 3KFWX 4PJ0C 4AIJA 4S04A 1YTYA 1JGGA 4WWCA 4CSWA 4CUGA 2WB1N 4UUSB 1MZBA 1VTNC 5D5VB 2V9VA 1D0ZA 1ONVA 2JSPA 5ICFA 2KFDA 2V1UA 3VOEA 3WU2C 3E5QA 1HCRA 1GLNA 1SFEA 2QQ9A 2OJED 3K4CA 4KMFA 3CJQB 4EGYA 1RI7A 5FRNA 4AVPA 2ZSHB 5IOYA 2OCCH 2WAFA 3ROUA 3WTZA 3RI4A 3V8JA 4BE1A 2VJ5A 1CF7B 2CWEA 3WTWC 3CCJI 3TGNA 1D1CA 3LWFA 2V7FA 4Q48A 1ACIA 1F9NA 1OFCX 1S3JA 1Y8RB 3ZOBA 1FP2A 4CCKA 3GF2A 4L9NA 1KYWA 5HDKA 1PP8F 3LAJA 4MEXF 1T98A 1QQIA 3DLAA 1DGWY 2GQQA 3LSPA 5FD6A 5H2FC 3OL4A 2EIKH 5LGTA 2HNHA 1YS6A 4FHTA 3CCMI 3D0SA 1QBJA 1EH8A 2OUMA 1FSHA 2P8TA 4JQFA 3WTVC 1P4XA 2VXZA 3S1MJ 2M5WA 2R4GA 3DBLB 1B72B 4NHJA 3DU6A 4FX0A 1Z7UA 2MD5A 2EZKA 5LEJA 3S1QJ 4E7HA 3ZQIA 5DCMB 1LUJB 2YUSA 2ZJQF 2VUMJ 3OS1A 2VKEA 3N05A 3JW4A 2CMPA 2F6CA 4BQNA 5IT9Z 1KQ9A 2MSYA 1P92A 1XMAA 3LSMA 2RVCA 1Y0UA 2VKDA 3MD2A 2DK8A 1UCRA 2RAEA 2DT7B 4XLPF 4BHPA 3X2QH 2WBMA 1CGPA 2JPBA 2WWYA 2FNAA 4B47A 4EJVA 3D1NI 2BGCA 4EM0B 2WY7Q 3GTJJ 4AM3A 4GDFA 5J8FA 3T8TA 5DV5A 1DPRA 4GYIA 2KHMA 3DKXA 4A3MJ 1YITI 5D6EA 4B44A 3DKWA 2P4WA 2ECCA 2V79A 3OY9A 3S8PA 1WSUA 5FKKA 3S14J 4CCMA 3ZRGA 4A12A 2HDWA 2FUG2 2L4MA 4KYWA 2AO9A 2DDAA 4BDZA 2ADUA 2F4IA 4M9XA 1MBJA 3BDDA 2KZVA 4EV0A 1O3TA 2R92J 2W25A 2DPUA 2NS8A 3G73A 3TO7A 2M34A 4N4OB 5LFAA 3DTIA 1Z67A 2DDBA 2IP2A 3A2KA 5GTHC 5IOZA 1QA6A 3TBIA 3K2AA 1Z3YA 4KITB 3W6JB 2E60A 2CQXA 1PUEE 1XPXA 4I7HA 1GV2A 2XF5A 3B02A 3AG3H 3H36A 4LIVA 5J3LA 1W0TA 1L0OC 1YS7A 4CO8A 2D45A 4XONA 4RLQA 2JA8J 4AC0A 1RUNA 3PNYA 2DT6A 3QPSA 3HDDA 5D8LB 2L7KA 1QO0D 3QODA 4EGZA 5CQGA 3J81Z 1G6NA 2DYSH 3TP3A 2RQQA 5KAFC 3BROA 3FK7A 2PI0A 1ZRFA 2UXXA 2CRGA 4OIOF 1Z91A 3H3VK 2GIZA 2NOGA 3DPTA 2R7XA 3V8LA 3R6SA 2EFWA 3M7GA 2DCEA 1P4AA 3ZCOA 2NYXA 4Y17A 4WF2A 3ABUA 1RR7A 2CG4A 1XCBA 3B73A 5FD5A 4LG0A 4DYRA 1JT6A 2OAZA 3B6CA 4RGXA 1T08B 3KZYA 4NQWA 4BKXA 3V4GA 2VI6A 1M1EB 1MD0A 1FOWA 3FZVA 4QIWN 4QTRA 3OSFA 3S32A 4HX4A 4GO1A 3DEEA 3H9JA 4R79A 2COBA 3A03A 5E3MA 3Q9SA 3CCVI 1T2KA 4GXOA 3F8NA 2BOLA 1HQCA 3LA3A 3CJNA 1QHHD 2KIFA 2EWNA 3HOVJ 3LQQA 4CZCA 3CO6C 2V26A 1K4SA 2QQ8A 4C3JJ 2JWTA 2XGXA 2KRFA 2VQLA 1QZEA 4XKCA 3WTTC 4PDKA 2HR3A 3G3ZA 4I0AA 4J19A 2O7OA 1W7PD 4M3GA 3MVPA 1FSEA 2KIMA 1IF1A 4ABZA 1YYVA 4KIBA 1GVDA 5DYMA 1BI1A 2ZNZA 5E3LA 3IV5A 4C30A 2L7MP 3BLYA 4NB5A 2CQ7A 5J1YA 2KQRA 4E7ZA 4BE2A 4XORA 2H8RA 4EATA 2MLKA 3PQJA 4V2GA 2NS7A 1MBKA 1U2WA 4D1QA 1MBEA 2COMA 4G6DA 2W24A 1Q1VA 3E1SA 2IW5A 1IN4A 3K2ZA 2R5ZA 4L0YB 2QWWA 2XKPA 2OCEA 1ZREA 2XGCA 2XAHA 3G71I 2VONA 4N9HA 2EB7A 1X4OA 3T5XA 4RB0A 2E2JJ 3HTUA 1W0UA 1ETQA 1JTYA 3OV8A 2LTPA 2QGUA 3EUAA 3GXOA 1HKQA 2Y0SA 3V42A 2VC0A 2GIVA 5HS9A 3FM3A 2XPVA 2EK5A 1W7PA 1OCTC 3S1NJ 1K78B 2Z1DA 3TQNA 1I39A 1Z7LA 4IRIA 4I6ZA 2LLKA 5EGOB 2P6TA 5GP9A 4HX7A 3F22A 1I1SA 1WQ2A 2BHYA 1MDMB 4DYCA 2GXGA 4XICA 1N25A 4ZTJA 2O6GE 5M3MJ 3JREA 4ZH4F 3S93A 4BDYA 1FYMA 5L3EA 4BQQA 1S8NA 4XKBA 4LK1F 3ASNH 2KZGA 1JKRC 4MLOA 4BNCA 1B4AA 4M6YA 4XBFA 2K3PA 2E5ZA 2TCTA 1XGMA 3HB9A 3NWTA 5HLTA 1R49A 1JKOC 2WB1A 4AVZA 4G9YA 4OAYA 1Z77A 3C2HA 4BHBA 3SDGA 2E19A 2IBDA 5E1XA 1IRGA 4G7OF 3VDXA 4L0ZB 2FD5A 3HUGA 1HDDC 3A02A 2MLGA 5TJJA 3OOPA 1S72I 3OR2C 3ABMH 2YPRA 4Y3OA 5EF6A 9ANTA 2QZ8A 1FYLA 1RRJA 1CF7A 2FU4A 3HGGA 3BPXA 1IV8A 3MEXA 3R0AA 2AQEA 1XB4A 4AYBA 2VC1A 5FLVA 2M4KA 1MBHA 2RKHA 3H5NA 4A3FJ 1FOXA 1ERDA 2JK3A 1YIOA 4A3GJ 2ZKZA 1JT0A 2YR2A 5BS6A 4LLLA 4XR6A 2OZ6A 1W36D 1RR8C 3MFKA 4ANJA 1LKXA 2MBFA 1WI9A 4CXFA 4KUMA 2QQAA 3HPHA 2P0WA 1TWCJ 3ZQLA 5C4XJ 5F08A 2L7ZA 1XX5A 4ITVA 2FEZA 4UNOA 4I76A 2VJ4A 1EH7A 3C2BA 2R7ZJ 2P5LC 4G7HF 2QBYB 4HLYA 2QSFX 4BBSJ 5JFRA 1WJAA 3IH4A 1ZG5A 1FLIA 2RV8A 2PMZA 1V5FA 3LNQA 2STTA 1R7JA 1LDKB 1X3ZB 1O4XA 2DMUA 3ONQA 2ZO4A 3OYKA 1QZZA 3COAC 2F5FA 4M73A 1A04A 4ZDPA 4IF4A 3W2VA 4ZC3A 5K7FA 1LNWA 3I3LA 3LSRA 4JX5A 3IRRA 3G1OA 1TC3C 2XAJA 1USSA 4UVAA 3JCUC 2VODA 1V5EA 3JRBA 4FT8A 2LYCA 4OMYA 4CICA 4W97A 2YS9A 2CSOA 2HQNA 3BG3A 2O8XA 2BVMA 1G3SA 2KP6A 5HS8A 3OSGA 3V7RA 1FZPB 1NG6A 2XSJC 3EQLF 1G3YA 4I0BA 4CH7A 5FO5A 2CV2A 2QBYA 2OTJI 3KIOA 3FKJA 3OYFA 1Z21A 4R1HA 3ABLH 2GXBA 2DBBA 4H0EA 3I55I 3L2QA 1YO5C 1IAWA 4PJNA 4XRSA 1K7AA 1TNSA 5F0HA 1YHQI 1IXCA 2CJJA 1OISA 5GTIC 3BTCA 2JVGA 1J59A 1X2NA 2EV6A 3KETA 3DKYA 3NQOA 2L01A 3PUFA 5CYVA 1UB9A 2ZJ2A 3E6CC 1FOYA 1X58A 3OYHA 4AD9A 1P9QC 4HV5A 4LB6B 4AWXB 4M9SA 3KZZA 1YQAA 5LBQA 1OCZH 4N4NB 4U0YA 1WJBA 2RNJA 5F1RA 5HDNA 4XLNF 4RDUA 1IDZA 2XHKA 5BPIA 1X1CA 2EFNA 2FF4A 4CCNA 2X0LA 1J9IA 4FE7A 2ACJA 4ZYAA 4DOZA 1YW9A 5B66C 1QPIA 1GXQA 5TGTA 3ULQB 5J8CA 1LFUP 4HQMA 1WJCA 2CS3A 3BY6A 4X6AJ 3FWEA 1FTZA 2E1MB 2LREA 1FX7A 4XN3A 1MJAA 2E1OA 2R5YB 3TDZC 4G6QA 1TQPA 2D1HA 4XKVA 4JP0A 2E1MC 5FLMJ 4AIKA 1R5HA 1X1DA 2K85A 4G6TB 1X1AA 2LP0A 2LOOA 1YRNA 1QHGA 4L9JA 1R00A 2DN0A 4IHSA 1FBUA 1Y1VJ 3I59A 4XRFA 3I58A 4XSXF 4NBQA 1JUPA 5B1AH 1A31A 1ZG3A 2PQ8A 2Y0SN 3ZMSA 1IN8A 1TP4A 4I99C 3FBIB 5IP9J 1KU7A 1TWHJ 3B6AA 1EA3A 1OCOH 2CFXA 2ESHA 1GHCA 2DQLA 1BOBA 2M7BA 2DOFA 4OINF 2GAUA 3ISPA 2JZYA 3I5UA 2FA5A 4JYKA 4O3MA 1JGSA 1P4WA 1NTCA 4BACA 2X1DA 3H0GJ 5GADJ 2Y75A 1VQMI 2QVOA 3CMYA 2WADA 1REPC 4IEJA 4ASNA 3GZ6A 5BMZA 2LR8A 4WCGA 1K83J 2HTSA 3ERMA 3L09A 2ID3A 2QLZA 4BY7J 4BGDA 1VFCA 1FMVA 2JN6A 3I64A 3KP3A 1K79A 4CZZA 3E6BA 1O3RA 1ZK8A 3OS2A 2L7FP 3GFIA 2KDZA 4HAMA 4IPAA 3U1KA 3VSLA 3D5RC 2L0KA 3FKIJ 3ABTA 1ON1A 2DA1A 1ZHFA 5CVIA 4KN7X 2UWMA 1ZR2A 2LY2A 5D6FA 4HYEA 1WWXA 1S9HA 1QVTA 4I02A 2HOAA 2PJPA 1P7IA 3A01B 3BZKA 2KIQA 5ILUA 3S2HJ 4A3DJ 2PLYA 4NC6A 4G94A 4JK1X 1ZN2A 4LLGF 3E5UA 4B1RA 3TDUC 3K10A 3RPUD 1BR4A 2ICWG 3AKZA 3C1DA 2J5PA 2G7HA 2K5CA 2L9SA 2LBFA 5GPCA 2HVQA 2AXLA 2K40A 3OYJA 4Q47A 2F2EA 2F4OB 4G12A 4U7BA 1XGNA 1UJ8A 4KT5C 3M1EA 3HOYJ 3QRFF 2ZFUA 3CUQB 3Q0UA 4BXUA 2DFIA 1IXRC 1GVJA 4B4CA 4BQOA 5F0FA 5D8KB 1N78A 3E6DA 1D5YA 3J7AY 2L9VA 3M07A 2UXNA 3HKZA 1SEUA 1XC5A 2DYRH 3FXQA 3OR1C 2O9LA 2ME0A 2QENA 2CUJA 2LKPA 2XIGA 3ZQHA 3FXOA 4UHTA 1W5TA 4RM2A 3WODF 4FCYA 1FEXA 4YG2F 2D1VA 3GW2A 1DU6A 1TQMA 4MEYF 2QF7A 4PJLA 4RLFA 2JQ7A 4LFUA 5E79C 1T6SA 2UZKA 1S7OA 5JVGF 1KYZA 2JMWA 5M5XJ 2QSGX 2R7VA 3SEZA 2MA3A 3I0TA 5D4SA 5D5XB 5KNLA 2L4AA 2NVUB 1AU7A 2HOEA 5HLIA 4D5FA 1AOYA 4A69C 4B43A 2E35A 3F21A 5DTDA 4KFCA 3IL2A 1R9TJ 5EEAA 3HRSA 2NXNB 2JUGA 2R7DA 3K69A 1LQ1A 1TL8A 1QGPA 2B0LA 5M3FJ 1BIAA 2F5EA 1OYYA 1OKRA 3FISA 3HOSA 2L2OA 1FT9A 3WE3A 2Y9ZA 1WCMJ 4L9VA 5D4RA 1OLTA 4HA8A 3REOA 1GDTA 1JKQC 3BTLA 4KN4X 1B9MA 1HF0A 3WTUC 5K7ZA 1FOKA 3IRQA 2ZMEB 3I54A 2GBYA 1R4MB 1U6GA 1BW6A 2BY2A 1BN5A 1T33A 2VE9A 1XSXA 1YE9A 4B48A 3HRTA 3VYRB 4U87A 2CQNA 5FB2A 2KL4A 2XRLA 4A5NA 2FMYA 3ZR8X 4DBQA 1N75A 1G3TA 2L5QA 2EJRA 3WHCA 4HSRA 3DEUA 2O0YA 1U5TC 2L9NA 3N97A 2P6SA 4BAYA 3U21A 5K5RA 2IGNA 2ZMEC 3CC7I 2ZXIA 4KMUX 3QYFA 4Y4RA 2R0QC 1DQUA 2EFPA 4XQFA 1S5LC 2LNBA 1VQPI 3VFZA 4IXAA 4WXHA 4HF1A 4EM1A 1I6HJ 2GA2A 1U8BA 1ULYA 4C2MJ 1JE8A 1OJLA 2VBYA 1BI3A 4V19K 4XN0A 2DODA 2VQCA 1KZHA 2HYFA 1APLC 4L18B 3TW6A 4K2EA 5J4VA 1O3QA 3OMYA 2ESNA 4XLHA 4Q4ZF 2EILH 4ETSA 5BNGA 3W6KB 4P96A 2RNGA 1VQOI 2HWVA 3RZOJ 1ETVA 2NVTJ 5E3NA 1AWCA 1SD5A 2MABA 2OZUA 4D7MA 3RYPA 4E7IA 3HSEA 4YFNF 1ZH5A 5DDGA 3KPHA 3SZGA 3S3OA 1D0YA 2HPMA 4XMYA 5DUIA 1G4DA 1WJFA 1W1WE 2HTJA 4Y15A 3FMRA 4RGRA 3RJPA 2I10A 3EYYA 3F8BA 3GLLA 3PUBA 3S3NA 4CCLA 1ZR4A 2XPWA 4I98B 5TISC 4M3DA 3KP7A 5J6XA 5DCMA 2M4GA 4CYCB 1K78A 1B9NA 3RZDJ 5FGMA 4N0BA 2BXZA 3GFLA 4PSWA 1HSJA 5ICGA 4IQJA 2M30A 4PGGA 1TT5B 1V3FA 3W2AA 1R1UA 2NS0A 4MTEA 5BQTA 1UZCA 1CQTA 1W4MA 3T8RA 3CF2A 1RPWA 1VQ7I 2Z9OA 2M0CA 5KCMA 3L1PA 3HJEA 5CQEA 2ID6A 4C3HJ 2ELHA 1BI0A 3GVAA 1K4TA 2EINH 2K9QA 1BI2A 1VQ5I 2IA1A 4XRSG 5F27A 2ZCWA 1AA7A 2EZLA 1XD7A 3CP2A 5HOOA 2HEOA 1I50J 1XSDA 3CD6I 3RPUA 2XKOA 2HKOA 5LRSA 2E71A 3RYRA 5EGOA 1MGTA 2K4JA 3QPHA 1U0JA 3CDLA 4M71A 4B3AA 2JRMA 1YI2I 4BY1J 2TRTA 1PDNC 3N4MA 1I3AA 4II3A 5L3DA 5FROA 2WY8Q 3KP6A 3K4KA 4CGZA 4MO7A 4PZJA 2K7LA 1DPUA 2DW4A 3VYTB 2O8KA 3JSPA 2VB6A 4HF0A 4BXXJ 4Y33A 2BBYA 2JVHA 2Y9YA 3HGYA 3PFYA 2V1DA 3V7CA 2VPRA 1MNEA 4XIDA 4U7DA 3S17J 2AHQA 1J7KA 1DUXC 3Q9VA 2GOMA 5EG0A 3HEFA 1QRYA 2W48A 3QP6A 3RIRA 1LVAA 1YIJI 3KEYA 3PIOF 1XCVA 4G7ZF 4UXNA 1LB2A 4LG0B 3GX4X 3LSJA 3CESA 3MQ0A 1MJBA 1FBSA 1ZTRA 5ED4A 3WU1B 3BP8A 1BOAA 4CYCA 3CUQC 3H5AA 4Y52J 3H3ZA 2E36A 5FFXA 2D2WA 2W57A 1YW8A 4IZZA 2RGVA 4NDLA 4MQ9F 1U9OA 2CW7A 3ZQGA 3U9GA 1WRJA 4BBRJ 3QPLA 1HDPA 5JR3A 1S7EA 1XGSA 4HLXA 1JKPC 3QOEA 3HTSB 2M87A 1T8IA 1WGXA 2HYJA 2EA2A 3CCYA 2OC6A 2XGEA 1SVMA 1IO2A 1ZYRF 4HDVA 4C2TA 1BL0A 2VKHA 1U9NA 3H3UA 3L2UA 3A0BC 4PSXA 3GUDA 2P7CB 1ZKGA 2LC2A 5J47A 3K4BA 4ESJA 5E8GA 3QU3A 3K70D 4KA4A 1E2XA 1U5TB 2BE5F 1T39A 4IJAA 2UV1A 3WGHA 4F52A 4XNFA 1P7JA 3C18A 5ICEA 4BUPA 1S7AA 1BC7C 4HPQA 5DEQA 3BTJA 5L3GA 4MFEA 3VWBA 3F8FA 3BJAA 3GTMJ 1WJ5A 1SFXA 4UVBA 3SQNA 2E1CA 1D8KA 4D5CA 2KT0A 3SDBA 4D0PA 1U8RA 4WXDA 1XTAA 2HS5A 2KMUA 4W1UA 1TNTA 3NWSA 4E4HA 2ZJRF 2XF6A 3LSIA 2A6HF 4Q5SF 1I5ZA 2BY1A 3DPUA 3I4PA 1T38A 1XDUA 1MSEC 4BHCA 2X6YA 5A2QZ 3BTIA 5JLXA 4F3QA 2Z33A 1NG7A 2P5KA 1T0FA 1BR2A 2X1CA 3K1PA 4EVIA 4U0VA 3ZN0A 1NK2P 1D8JA 2E5NA 3JRIA 3J7YJ 2JTVA 1XMXA 2PBIA 2H6CA 2LF7A 3TW7A 2A5WA 3BR0A 1FJLA 2IRFG 4FETA 3UR3C 4CCOA 4QPOA 3O3KA 1HW2A 1FMWA 3P5JA 2Y2ZA 3S2WA 3JRGA 3PL8A 3ZPLA 1VZ0A 5ICCA 1TBXA 2MFZA 5KHDA 4TV7A 5HODA 1RETA 3MZ8A 3HIFA 3EPZA 1YOVB 2ZJPF 4EM2A 1SD6A 1QNTA 2DQRA 1LDJA 5E17F 2BY0A 3IUOA 1POGA 1BJAA 3BT9A 3DEWA 3DQVC 1E3HA 2NVYJ 2VL8A 1KA8A 1MIJA 2JA2A 5LGNA 1X1PA 3ZMUA 5ILVA 2W7NA 2FJ1A 1QU3A 5F64A 4I2OA 2RREA 2D5VA 2CQQA 3KEOA 1X19A 2RN7A 3A4CA 1SANA 2OU2A 3BG7A 2BYVE 3O8HA 3JR9A 3WGGA 3LQRA 2XDVA 4C9YA 4X0GA 2ZBKA 3K4NA 4L5JA 3GYHX 3ZQCA 2VIXA 2GWRA 1TW2A 4WXCA 2YU9J 1RESA 1IJWC 2NVXJ 4HW0A 3CDHA 2LH9A 2RQPA 5CKTA 1R1VA 1ITYA 2PMHA 3I53A 4A3CJ 1G3WA 2EV0A 1HC8A 2IS1A 2GM4A 2L3DA 5DD4A 1OQYA 4YEJA 1A6QA 3SJMA 3R0JA 5ILSA 5CJ9A 1C0WA 3I4NJ 3DTKA 4RA2A 4IHYA 2PX9A 4YIIA 2EZHA 3WU0A 2QKMB 4A6EA 2M8EA 5L3FA 2VBWA 4M3EA 5FRMA 1RZ4A 2FBKA 3FMSA 4A0XA 2DK5A 3VB2A 4AIDA 1Z3XA 2MH2A 3M4OJ 2LF8A 4DYQA 4D7NA 5DM7F 4O6JA 3MZHA 1A35A 1H88C 3VODA 2EIJH 1I27A 3GLXA 1SVLA 2BXYA 5E20A 4UB6C 1MMAA 4FTHA 2VN2A 2HVSA 2AS5F 2CW0F 2NOJB 2R7WA 1OR7C 1YRNB 4ZDLA 5GPAA 4X1EA 1D1AA 5JVTA 4CCJA 4RMNA 2CUFA 3L2CA 2BY3A 1LE8B 5J1UA 2CGPA 2DU9A 2DJNA 4O5VA 4UVCA 2LSOA 2R7FA 3IAS2 4ON0A 4BJ5C 4BH9A 1KGSA 4EJUA 3OYLA 1V54H 4A3EJ 2PJRA 1DDNA 2DI3A 4OAZA 2H09A 4NC8A 2XAGA 4ESBA 5TRDA 5BOXA 4WX9A 4IHWA 1JJ8C 1ZLKA 2DA3A 3IWZA 4XL9A 3EYIA 4IRGA 3KCCA 2VJJA 1IC8A 2FRHA 3RKYA 1JJ6C 3WTXC 1KQ0A 2FMLA 1EJ9A 2KKOA 4LOCA 5JHUA 3S1RJ 5FFZA 1IRXA 3I4MJ 4F91B 4B09A 5KVRA 1FBQA 1EKEA 2DA5A 3G1LA 3DXJF 3BZCA 3ZN1A 3TKYA 4M3BA 2QCOA 1XDSA 3MKLA 4IX7A 1D0XA 3E0JB 2XVCA 1W5SA 2G0EA 5IP7J 3FF5A 3PQKA 2BHZA 2H27A 2Y30A 2Z99A 3C2GA 3E3VA 3LFUA 1I3QJ 2K86A 2ZB9A 3TO9A 2HOSA 3AL0C 1JXSA 2K9SA 2LY1A 1S29A 1TWGJ 2DA2A 3ESWB 4RAFA 3RCOA 3JAMK 2E2IJ 3BR5A 2HQRA 5CLSA 5DCFA 2FX0A 3GZ5A 1GV5A 3LFKA 5L3CA 1ZAOA 2R7TA 2L54A 2X6WA 1ZRDA 4DZPA 5EJCA 2HQ5A 3FK6A 3HSFA 4XKWA 3LSTA 2LKSA 4XRMA 1SAXA 5DM6F 3HRUA 1A36A 1VI0A 2P5VA 1O7FA 3CQZJ 5EG0B 3Q0VA 3FHNA 4KICA 4ZDOA 2EPFA 4N9IA 4UB8C 3ECOA 4OMZA 1ZGAA 1BIBA 3WTYC 1O3SA 2OQRA 1I1GA 1P2FA 4MHGA 2MC4A 2V6CA 3PNVA 5KK1A 1SMYF 1NH3A 2IS2A 4PGHA 3FHZA 4LIUA 2JPCA 1IRFA 5GAGJ 5H6RA 2PMZN 3OYDA 2MYSA 2Y69H 5IYDJ 2XB0X 1MW7A 1OCPA 5JLWA 1Y8QB 4RAGA 1B72A 3PSIA 1WH5A 1K61A 4PCQA 2DMPA 3OL3A 2VLAA 2XC7A 2R93J 1NHAA 1N77A 3DWLE 3LMMA 4BEHA 2IS4A 5FKLA 3C7JA 2XRNA 1ZRCA 4ENKA 5GAHJ 4BJTA 5IT3A 1D3YA 2QA4I 3S2DJ 3LSGA 4KJZA 3SZPA 3L2WA 1EF4A 4QLCU 3D5LA 1BA5A 2LDUA 2HXOA 2IAIA 3LSHA 2JSCA 1PJRA 2IEKA 3E7LA 3P7NA 1Y0NA 1Z1DA 2A69F 2DLLA 1LPQA 4S05A 2F5VA 2M7AA 3TOBA 3F9KA 5IYBJ 3I59B 4HV6A 2DA4A 1FWZA 2PMUA 3BR1A 2V1NA 1RC9A 2IT0A 3MWMA 1AKHB 1YX3A 2R7SA 4RAYA 1ETYA 2CYYA 2K4BA 3CTAA 3AG1H 2R3SA 4HSTA 1X2MA 2E1NA 4LLNA 3MZYA 1WPKA 3F72A 5IT9K 3E97A 2ETHA 3FBNB 4XLAA 2R5YA 1R22A 4QWQA 1FY7A 3KYLA 1RKWA 1VF9A 2LVSA 4DW6A 2X4HA 1V55H 3WG9A 4M9ZA 1ZGJA 4U0WA 1MKMA 2BW3B 2ZXJA 4MTDA 1RUOA 4EJWA 5FLXZ 4HRIA 2JRTA 4FISA 2QSHX 4DGWB 3MAJA 3JSOA 2DMQA 3MN2A 5B5EC 2M45A 3TMOA 4PUSA 1IRZA 1HKSA 3GTOJ 4KISA 4KIFA 1Y1WJ 4HQEA 1VNDA 2WV1A 1IN7A 3OYMA 1TW3A 1QZYA 1ZG1A 4CDGA 2IXSA 4FASD 4Y7NJ 4ZTFA 3E6MA 3QP5A 4PJMA 1ZLJA 5GAEJ 3PFIA 1OR7A 1UELB 2F4MB 3GWZA 4OOIA 3GCMA 2WV0A 2EZIA 2HU9A 3OYCA 2XPUA 3TEDA 3FMQA 4MIMA 1H9GA 1V4RA 1XG1A 1IZ1A 1DGRM 2JT1A 1RIOH 1LEBA 5FKOA 3L2VA 1V5GA 3FXLA 1R58A 3CO7C 3KLNA 3CJTB 2ZC2A 1F1ZA 1UMQA 4UUSA 1RKTA 2B7EA 4ZYEA 1STZA 1X4PA 4RGSA 1F36A 4XLFA 3HSRA 4KDPA 2HYGD 2PG4A 3IP4B 2A6TA 4BU2A 1WFXA 3FXKA 5D5WB 4A0YA 5LLQA 4FE4A 1FYKA 1J0RA 2RC4A 3M8JA 2VT3A 3CP8A 2W00A 3CCSI 4E6KG 3E5XA 2KIUA 2KJBA 3IC7A 3OIOA 2XAQA 2Y0MA 4F55A 3F6VA 1F5TA 4JOMA 2DOEA 1E0EA 1R23A 2DT5A 2VT2A 3L2RA 5HNFA 5J1RA 4BE0A 2STWA 2P7VB 4U88A 2A61A 3BJOA 4IO9F 5LD2C 2OQGA 3MKYB 3GTPJ 2EV5A 2W84A 4P9FA 4IHVA 2HZTA 3KYCB 3DCFA 2HZDA 4F93B 3HOTA 3CCEI 3VYSB 1WJDA 5FLXK 3QPTA 4MGRA 5E8IA 2XF7A 1TT0A 1OMIA 4XM3A 1YFHA 2A68F 3HBLA 4YELA 2DFHA 2W4SA 2V9KA 2ELKA 2Q2EB 1WHUA 2X1EA 2ZFWA 4OIQF 3F8MA 4J01A 5F6FA 4J00A 2R7UA 1SMTA 3M9AA 1HOMA 4M6XA 3BQYA 1E3PA 5ERIA 2HXIA 4A3IJ 3J7AO 2PN6A 3G4SI 2NNNA 1ORKA 3P9CA 2JA7J 1UHMA 3KP4A 2R5ZB 3K0LA 4NC7A 2Z5UA 4P1WA 4WK8F 3SZTA 5E1WA 1U5TA 3WE2A 5LHGA 3K7AJ 1NK3P 4DQ2A 3F8CA 2DMTA 2A07F 3DFGA 1OCCH 3VSKA 4EMSA 3MKZA 5HS7A 5JI6A 1VQKI 2F5CA 2K9MA 4ENMA 1R6RA 5IY5H 2PFBA 3HOUJ 2MG4A 3QQAA 2ZXWH 4L5IA 1SFOJ 2IS6A 3PSFA 4HBLA 5E3OA 3NRVA 3Q5FA 5K1YA 4JX4A 2R7RA 3HM5A 1W7PB 2XB5A 4OIRF 2DTZA 4ZYGA 2W82A 3GFMA 2KRHA 3LA7A 3FXMA 3W3CA 1MSFC 3FXUA 3QYBA 3DP7A 4DBRA 4YFXF 4ZZDA 4P55A 1PP7U 4IOAF 4AUXA 1QPMA 4MQVA 2HKXA 2X6XA 1UAAA 2FQ3A 2Q1ZB 3ABKH 2M9HA 2Z16A 3CLOA 5F04A 2LMDA 4IQ4A 3AL0B 1DU0A 2EQRA 2IGOA 3KP2A 4RB3C 2XV4S 3CF5F 1DP7P 3HL2A 3TL4X 2MW8A 4XOPA 3RDIA 3GTGJ 2W85A 2IPQX 3JAMZ 1YG2A 3PNTA 1R1TA 4XK4A 1H8AC 4AYBN 2A6EF 4HEA2 1Z0XA 3OOUA 1I6XA 4RB1A 3PJRA 2KISA 3HUGB 1SD4A 4B3XA 3LAPA 3OYEA 4QSHA 2V9PA 1FC3A 1SAUA 3M1CA 3ML6A 2XROA 2F5DA 2BZTA 3BCAA 2VJIA 4LJZF 5IPAA 3CC2I 4UUVA 1HXDA 1WKMA 2MH9A 3O2PE 3V8KA 3ZQFA 4QPQA 1Y39A 3S3MA 1H0MA 3EDPA 3EUHA 1TQIA 1IG7A 2DXIA 1YJNI 3K4LA 1Y6IA 2FBHA 2XAFA 1PUFB 3QWLA 1FIAA 2H94A 4DNCA 3J80Z 3EUHC 2DA6A 5D5UB 4OIPF 1R71A 1EH6A 1OPCA 1WVRA 4HOBA 1UG0A 3VEPA 1IN5A 4KNYA 1X3WB 2NAZA 3GBGA 4AIHA 5KAIC 1J75A 2EA4A 2JUCA 2OF7A 1A5JA 3IKVA 3K4JA 1TZLA 1PYVA 1T0FC 1BBYA 3BG5A 2HOTA 2H1LA 3H9QA 3UNGC 4HNVA 1R36A 1OYIA 2A05A 2H1KA 1XSVA 2KRCA 1VQ8I 4EJTA 4JX6A 3A01A 2VE8A 3HPGA 4IOCF 1LJ9A 1YJWI 3J81K 2V4JC 3ZQQA 1ETKA 4BEHB 3SXYA 1VQ6I 3G6EI 3CLQA 1U3EM 3Q3SA 3NAUA 2OTLI 3KYDB 2VOPA 2CQKA 1K6OA 1YJ9I 5DUKA 3LOCA 4LMYA 2FE3A 2JJ7A 4LITA 3K70C 2EFQA 4BS9A 3I9V2 4E7LA 3KLOA 3JTHA 2DA7A 2H8WA 2QM3A 4DJAA 2O61A 1HA8A 1GUUA 4Z2YA 3MCZA 2Y48A 1T56A 4F7ZA 4M74A 4EQQA 1Z6TA 3AG2H 3F3XA 3W2WA 2IA2A 1VQ4I 2IGMA 2CU7A 2MGQA 4NNJA 3FIWA 4HX8A 1J09A 1JUMA 2E7WA 2DTRA 1SC7A 2DFEA 1OCRH 1ODDA 1YW7A 1R5GA 2CO5A 4BL0B 1VQLI 2QUFA 4ZYDA 3A1YA 3JRAA 2HDCA 2M2EA 5LEKA 3GTLJ 5F0CA 1FTTA 2O03A 3SFIA 2F48A 4BJ6C 5JHFA 4GYGA 1JI8A 3ZP5A 1A6IA 2YSRA 2FOWA 3HKZN 3JTGA 5F1JA 2FNPA 1O7LA 3KX2A 1ETXA 3P9KA 3KE2A 3HOZJ 1BW5A 6PAXA 1LFBA 3K1MA 3PM1A 1KQ8A 1B8IA 2GA1A 2OV7A 1IUYA 3BR2A 2HQAA 3U2RA 4ESFA 2K3FA 5CVVA 1FIPA 2DFFA 3LSKA 2FOKA 5BPDA 2YU3A 1XN7A 3DLLF 3I56I 3ASOH 2VQHA 3SHFA 2KLOA 1BM9A 3T1BA 3BR6A 3FM5A 2O3FA 1B59A 3CMMA 1MMSA 4I09A 4DZJA 3SYTA 3OS0A 2ZMEA 5B3SH 1WJEA 2M0MA 4S0HB 1MMDA 4UY8I 2O5RA 5LHIA 3H9GA 4GRIA 3AFHA 5HLGA 3AG4H 2BVLA 5J40A 2WAEA 3CJRB 5EZGA 4PK4A 2P81A 3DTEA 5CPRB 5LRRA 3M3YJ 4F92B 3QOPA 5EYRA 4AU7A 2GOXB 3BC8A 3TOAA 3BG9A 1HW5A 3FDYA 4RM3A 3GO5A 2LFBA 1SFUA 2WAQA 3DV8A 4XSZF 2K02A 3NEUA 2HGCA 2IGKA 5H20A 2OPTA 4IRHA 2XSDC 4XLCA 4YIRX 2QEXI 3RKQA 1YLFA 2GXAA 5K5QA 5A2QK 3BCBA 3M8FA 1HLVA 1LDDA 5M5WJ 4G8XA 1IUFA 5EEGA 5C44J 2QYOA 2LKXA 2G7UA 2CH0A 2LRDA 3H0DA 4OWRB 3J7ZI 1FNNA 2HPIA 4E7JA 1K6YA 1DP3A 4DIQA 3WG7H 3JRHA 1SVOA 1SD7A 1XS9A 1BC8C 3DU5A 2YX7A 3DBHB 2GLOA 3L00A 2A5YB 5LGUA 3DBRB 1MNDA 3HC7A 3RPQA 3BG6A 2M1BA 2ZXHA 2HVRA 3AAFA 1G2HA 1TWAJ 1ZGWA 4BYYA 2DO7A 1BR1A 1IDYA 1UFMA 3FX3A 1JTXA 4Z6YA 3HHHA 2VBXA 4M6VA 2OD5A 1JHHA 4GCVA 5C4JJ 1XGOA 1B6AA 1HSTA 5J4YA 4XOTA 1S6LA 2E7XA 3CC4I 1VQNI 4II2A 1USTA 1Z6RA 5CVJA 3CDIA 3O6BB 2BV6A 3F0CA 4C3IJ 2IA0A 4PJJA 2M3AA 3TO6A 2N8GA 3R4KA 4HF2A 4P9UA 3WTSC 1PVEA 1UHWA 3BPVA 4KT6A 1IXSB 3BZ6A 4YIFA 2LBFB 5CVUA 3IKTA 3IH2A 4FQGA 2I5UA 3G2BA 2PEXA 3SEQA 4A6DA 3PO2J 4ENJA 4RBOA 3IWFA 1IN6A 1F4KA 2FBIA 4B8XA 3CUOA 3CUQA 1ETOA 2NRAC 2CW8A 1FP1D 3OWTA 3HZJA 1AKHA 3MKWB 2Z2SB 2X6OA 4IVNA 4D9JA 2X9DA 3K1NA 2WTEA 1HBXG 1JUSA 4A5MA 1F43A 3P9IA 1QVUA 1MNMC 3H1CA 1RNLA 1TTYA 3TP0A 2ZSIB 3ZXSA 3BWGA 2CV1A 1JHFA 1ZELA 4UUTA 3ZMDA 2WA0A 1KU2A 2V1XA 2Z3YA 4L5EA 2PJRB 2LK2A 3HYIA 5AIPA 4ZZLA 2AQFA 3J80K 2CUEA 2K9NA 1ETWA 4NUBA 5E1ZB 4E70A 3JRCA 2X51A 3EETA 3ZMVA 1E17A 2DAOA 3CCUI 4A3JJ 1VQ9I 4ZYHA 5B1BH 1PUFA 5FJ8J 4IKFA 3BJ6A 4A3BJ 3L7WA 1IGNA 1L3LA 2L02A 2BEOA 3CMAI 1MMGA 1U78A 3Q0WA 3RKWA 4LK0F 4GFBA 2KDOA 2WC2A 1GT0C 4H4KC 3ELKA 4UV9A 1T95A 2EFOA 1HKTA 4A3KJ 4JBAA 3RSNA 3OIQA 2LY9A 2IVMA 4A0ZA 4HDUA 3GMEA 1LE8A 1W36C 3NARA 5E18F 2ISYA 5IYCJ 2QQBA 1EV7A 3IHUA 5DS9A 1TWFJ 2WAQN 1HW1A 3QAHA 3RKXA 4LGWA 2RDPA 3EUKL 1B1BA 1ZARA 3LA2A 1LEAA 2V6EA 3ECHA 3GZNB 4CA0A 2FSWA 2YX4A 3HRMA 3PIPF 3HOXJ 5M5YJ 1Z05A 2G9WA 2IJLA 2MC3A 2DJIA 4KIGA 3GEZA 1IV6A 2LD5A 3WGIA 2E2HJ 2CFOA 4A93J 4M3FA 2HFHA 5FKMA 3DF8A 2M8GX 1W5CC 1KU9A 1MH4A 1J5YA 3RQIA 2EH3A 2XGDA 4A2UA 5EDNA 3FXRA 4HG2A 1J2XA 1FPQA 2B9SA 2VOOA 5K7HA 3K9TA 3A0HC 3H35A 1SFKA 3IAM2 3M8EA 4HZFA 2HDDA 2AXTC 3DPLC 1H9TA 4YFKF 3LL7A 3QU6A 5LHHA 3F6OA 2VXDA 2KJCA 3W6VA 4PFPA 1X3UA 3KP5A 3GFJA 1R4NB 5IP6A 3R61A 5AIQA 3RTRA 2R7QA 5AONA 1UG2A 2VKVA 3K4MA 1LVKA 1AHDP 3H92A 5DD8A 3CZ6A 3V7SA 2ELJA 4RS8A 3U1DA 5L3BA 1MBFA 3ZMTA 2LG4A 1WI3A 3CMEI 5HLHA 4PFOA 1LFPA 4XLEA 3RQ4A 3SFZA 4RAZA 1D5VA 2DMNA 1B8IB 4LB5A 2E34A 1WZ2A 1R5ID 3R60A 4LD5A 4BXFA 1OYWA 4CYDA 4RB2C 2C6YA 3FXJA 2VBZA 3PO3J 3I71A 2OBPA 2XAUA 2Q2EA 1WH7A 3UKGA 4I01A 2JA5J 4MFDA 5HVQC 3HHGA 4YRVA 4C2UA 1D1BA 3L9FA 4R8HA 1BJZA 2B63J 3ZMZA 2K27A 2Q0OA 3QYEA 1IW7F 2J5OA 3OYBA 3BR3A 5EEHA 5K5OA 3CCRI 2KPMA 3D5SC 3HG9A 3IH3A 2QKLB 2XUBA 5FKNA 2CV0A 4NQWB 3CCLI 2DOAA 1G59A 3G1MA 5EZHA 2R7OA 2ZNYA 3GTQJ 2L9RA 3ZGKA 3OYGA 4E7SA 4IHXA 1MH3A 4E7KA 4RGUA 1G8XA 4HNTA 3K6GA 2X85A 3VPRA 3WHBA 2A3SA 2H6BA 2ME6A 2GZWA 4L9TA 3VYUB 4EJOA 1ZQ3P 3T0YA 4Y13A 2XASA 5C3EJ 2ISZA 4V2FA 2I8DA 2VASA 3OYNA 3BOQA 4M72A 4EEFG 3ZQ7A 1P6RA 2EBIA 3HXLA 4HNUA 1UHSA 2TDXA 4BQAA 3KEQA 2OA4A 5HDGA 3S16J 1Y56A 2DPDA 4IL6C 3MMYB 1Z9CA 2FQ4A 2W1OA 5H6QA 2EIMH 1YX5A 2JA6J 3OIPA 2ECBA 3HOWJ 3CCQI 3F23A 2FXAA 2NNYA 4P5OA 3C3WA 4OU0A 2BW3A 3O8GA 1GXPA 1H89C 3S15J 1XMKA 3GTKJ 4ENNA 1Q1HA 4CHUA 2Q8KA 3KZIC 3BQZA 1ENHA 1O57A 4MNUA
chains in the Genus database with same CATH topology
3K4LA 2VQGA 1Y6IA 3EUHC 4LG3A 3EPZA 2JVGA 4ZJZA 2VPLA 3OYIA 1UG0A 3DKYA 2UUZA 1X1BA 2MD0A 3IUOA 3OYAA 3DQVC 2VL8A 5HNHA 3GBGA 3OYHA 2JA2A 1P9QC 3H5RA 1MMNA 2CUZA 2W7NA 1KONA 3K4JA 1QU3A 4N4NB 1TZLA 2RREA 1PYVA 1WJBA 1X19A 1T0FC 2K9LA 3A4CA 3BG7A 3H9QA 3UNGC 4CSWA 4CUGA 2XDVA 1X1CA 4C9YA 2KRCA 4X0GA 4CCNA 3K4NA 1D0ZA 2JSPA 4ZYAA 4DOZA 3HPGA 2VIXA 5TGTA 2V4JC 1WJCA 5CKTA 1GLNA 2CS3A 2LH9A 3ZQQA 4BEHB 2E1MB 2IS1A 2LREA 4XN3A 4YEJA 3K4CA 3CJQB 3DTKA 5FRNA 4XKVA 2ZSHB 2E1MC 2WAFA 2QKMB 4LITA 4BE1A 3K70C 1X1DA 4BS9A 2VJ5A 3I9V2 1X1AA 4G6TB 4E7LA 2LOOA 1QHGA 5FRMA 4DJAA 1HA8A 1D1CA 1Z3XA 2V7FA 3W2WA 2IGMA 4NNJA 1J09A 4CCKA 3FBIB 3DLAA 1EA3A 1MMAA 2HVSA 1DGWY 3OL4A 1BOBA 2M7BA 2NOJB 5KHDA 2R7WA 1OR7C 2HNHA 4BL0B 4ZDLA 2OUMA 3A1YA 4JQFA 2VXZA 1D1AA 2R4GA 4BACA 4CCJA 2X1DA 4RMNA 2WADA 3DU6A 4BJ6C 4BJ5C 5JHFA 1JI8A 3IAS2 4E7HA 3OYLA 2PJRA 3KX2A 4OAZA 4BGDA 4NC8A 1FMVA 3OS1A 3OS2A 3N05A 2OV7A 4XL9A 2CMPA 2F6CA 2HQAA 4BQNA 3VSLA 3D5RC 2VJJA 3LSMA 3LSKA 2VKDA 2UWMA 3MD2A 2LY2A 2VQHA 2DT7B 1S9HA 1IRXA 2KLOA 4F91B 2WBMA 4B47A 3CMMA 3SYTA 2WY7Q 3OS0A 3K10A 3RPUD 1BR4A 3AKZA 2KHMA 3DKXA 4B44A 2K5CA 1WJEA 2M0MA 4IX7A 1D0XA 1MMDA 2L9SA 2LBFA 3E0JB 3S8PA 2HVQA 3OY9A 2O5RA 3OYJA 4CCMA 3H9GA 2R7UA 3ZRGA 3LFUA 3C2GA 2HDWA 4GRIA 3AFHA 2FUG2 3AL0C 4U7BA 2BVLA 2WAEA 3CJRB 4BDZA 2LY1A 4PK4A 3RCOA 2F4IA 3DTEA 5CPRB 2ZFUA 2KZVA 4F92B 4AU7A 4N4OB 2R7TA 4BQOA 2X6WA 5LFAA 1N78A 3DTIA 4XKWA 3J7AY 2GOXB 3BC8A 3A2KA 3TBIA 3FDYA 4RM3A 3HKZA 2WAQA 3FHNA 3OR1C 4ZDOA 2IGKA 1Z3YA 2CUJA 4KITB 4XLCA 2E60A 2MC4A 4RM2A 3PNVA 2XF5A 2IS2A 4LIVA 3BCBA 4PJLA 4RLFA 4LIUA 4XONA 4RLQA 2R7VA 2CH0A 2LRDA 3SEZA 5KNLA 3H0DA 4OWRB 3OYDA 2MYSA 2HPIA 4E7JA 1DP3A 1K6YA 3PNYA 2DT6A 4DIQA 1MW7A 3PSIA 3DU5A 4B43A 2L7KA 3QODA 5CQGA 2JUGA 1MNDA 3HC7A 3OL3A 2RQQA 3BG6A 2VLAA 2ZXHA 2HVRA 2XC7A 1N77A 3DWLE 3LMMA 4BEHA 2IS4A 2R7XA 3HOSA 2L2OA 3DPTA 1BR1A 2DCEA 4BJTA 3ZCOA 1OLTA 3LSGA 4KJZA 3L2WA 3D5LA 3LSHA 4XOTA 1PJRA 4II2A 1YE9A 3S32A 2F5VA 4B48A 2M7AA 3DEEA 3H9JA 4R79A 3VYRB 4U87A 3F9KA 2KL4A 4PJJA 2M3AA 3ZR8X 2BOLA 1N75A 2V1NA 4DBQA 2L5QA 1YX3A 4KT6A 4HSRA 1QHHD 2R7SA 2L9NA 2LBFB 3U21A 2IGNA 4HSTA 3G2BA 3SEQA 4CZCA 2ZXIA 2V26A 3QYFA 4Y4RA 1DQUA 3FBNB 4XLAA 4XQFA 2VQLA 4XKCA 3KYLA 2CW8A 3OWTA 3MKWB 2Z2SB 4D9JA 2BW3B 4XN0A 2VQCA 4HRIA 4DGWB 2ZSIB 3OMYA 4XLHA 3ZXSA 2CV1A 1ZELA 2WA0A 4C30A 3TMOA 3BLYA 4PUSA 2RNGA 2KQRA 4E7ZA 4BE2A 4XORA 2PJRB 4EATA 4KISA 2AQFA 4NUBA 2X51A 2MABA 3OYMA 4E7IA 3SZGA 2IXSA 4D1QA 3S3OA 4FASD 1D0YA 2HPMA 4XMYA 4ZTFA 4PJMA 1WJFA 4IKFA 3E1SA 1UELB 3PUBA 1MMGA 4CCLA 3S3NA 2HU9A 2KDOA 3OYCA 4H4KC 1DGRM 1T95A 2M4GA 3RSNA 3OIQA 1X4OA 1W36C 3L2VA 1V5GA 4PSWA 3EUAA 4IQJA 2Y0SA 3V42A 3EUKL 3W2AA 2V6EA 3CF2A 1X4PA 4CA0A 5KCMA 2Z1DA 4XLFA 3IP4B 1Z7LA 2DJIA 2A6TA 4BU2A 1WFXA 5CQEA 2CFOA 3M8JA 4ZTJA 3CP8A 2W00A 1AA7A 4HG2A 5HOOA 3CP2A 4E6KG 3S93A 4BDYA 4BQQA 4F55A 3H35A 1SFKA 3IAM2 4XKBA 4MLOA 4JOMA 1E0EA 1U0JA 3DPLC 2K3PA 2E5ZA 3L2RA 3LL7A 3NWTA 5HLTA 5HNFA 4BE0A 2VXDA 2WB1A 4PFPA 4AVZA 4II3A 4OAYA 5LD2C 3MKYB 5FROA 3RTRA 3C2HA 2R7QA 2WY8Q 3K4KA 3K4MA 2HZDA 3VDXA 4F93B 1LVKA 3HOTA 3VYSB 3VYTB 1WJDA 3CZ6A 3OR2C 2XF7A 2VB6A 1TT0A 4Y3OA 2ELJA 4XM3A 2JVHA 4Y33A 3PFYA 4YELA 1MNEA 2W4SA 2LG4A 2V9KA 2Q2EB 2X1EA 2GOMA 4PFOA 1LFPA 2AQEA 4XLEA 4AYBA 3RQ4A 4J01A 3KEYA 4J00A 2M4KA 3H5NA 3CESA 1ERDA 4BXFA 3H5AA 4IZZA 4XR6A 1W36D 2XAUA 2CW7A 4NC7A 4P1WA 4ANJA 5HVQC 1LKXA 4C2UA 4YRVA 1D1BA 3HPHA 2P0WA 3QOEA 4ITVA 3VSKA 3MKZA 2OC6A 2VJ4A 4C2TA 3QYEA 2K9MA 1R6RA 3OYBA 2VKHA 3L2UA 4PSXA 1WJAA 2IS6A 3PSFA 2LC2A 2KPMA 3K4BA 2PMZA 2R7RA 1V5FA 3D5SC 3HG9A 2QKLB 3K70D 2CV0A 2W82A 4NQWB 1LDKB 2DOAA 2KRHA 1G59A 2UV1A 3W3CA 2R7OA 4F52A 3QYBA 4XNFA 3ONQA 3ZGKA 4DBRA 3OYGA 4E7SA 3OYKA 4BUPA 4E7KA 1G8XA 4HNTA 4HPQA 3K6GA 2X85A 3VWBA 4ZDPA 3W2VA 1WJ5A 4ZC3A 3VYUB 1UAAA 2X6XA 3I3LA 3SDBA 2Q1ZB 3OYNA 2I8DA 2VASA 2Z16A 3AL0B 4IQ4A 3HXLA 2KMUA 4HNUA 2IGOA 3NWSA 4E4HA 1V5EA 3HL2A 3TL4X 4XOPA 2XF6A 3LSIA 2LYCA 1Y56A 3DPUA 3MMYB 2X6YA 2W1OA 2BVMA 2KP6A 3PNTA 4F3QA 1YX5A 1NG7A 2X1CA 1BR2A 3OIPA 4HEA2 1NG6A 2XSJC 3OOUA 4CH7A 3PJRA 2CV2A 3HUGB 2E5NA 4B3XA 3FKJA 4P5OA 3OYEA 3OYFA 1Z21A 2A5WA 1SAUA 2BW3A 4FETA 3M1CA 3UR3C 4QPOA 4CCOA 3L2QA 3BCAA 1FMWA 2VJIA 4PJNA 3PL8A 1VZ0A 4QPQA 3S3MA 2MFZA 2DXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LFP A;  1WJB A;  3HPH A;  1K6Y A;  1WJF A;  1WJE A;  1E0E A;  1KON A;  1MW7 A;  1WJC A;  3F9K A;  4F3Q A;  1WJD A;  1WJA A;  3HPG A; 
#chains in the Genus database with same CATH topology
 4FX4 A;  2X48 A;  2VQG A;  4GGG A;  1KU3 A;  4LG3 A;  4ZJZ A;  2VPL A;  3OYI A;  1TLH B;  4IHT A;  1MJ9 A;  2UUZ A;  1X1B A;  2MD0 A;  1MBG A;  3JRD A;  3OYA A;  3ERE D;  5HNH A;  2HI3 A;  3H5R A;  1MMN A;  1ON2 A;  2CUZ A;  2Y31 A;  1KON A;  4UV8 A;  3JRF A;  2NVQ J;  4A3L J;  1E3O C;  5CVR A;  1MDM A;  2K9L A;  3KFW X;  4PJ0 C;  4AIJ A;  4S04 A;  1YTY A;  1JGG A;  4WWC A;  4CSW A;  4CUG A;  2WB1 N;  4UUS B;  1MZB A;  1VTN C;  5D5V B;  2V9V A;  1D0Z A;  1ONV A;  2JSP A;  5ICF A;  2KFD A;  2V1U A;  3VOE A;  3WU2 C;  3E5Q A;  1HCR A;  1GLN A;  1SFE A;  2QQ9 A;  2OJE D;  3K4C A;  4KMF A;  3CJQ B;  4EGY A;  1RI7 A;  5FRN A;  4AVP A;  2ZSH B;  5IOY A;  2OCC H;  2WAF A;  3ROU A;  3WTZ A;  3RI4 A;  3V8J A;  4BE1 A;  2VJ5 A;  1CF7 B;  2CWE A;  3WTW C;  3CCJ I;  3TGN A;  1D1C A;  3LWF A;  2V7F A;  4Q48 A;  1ACI A;  1F9N A;  1OFC X;  1S3J A;  1Y8R B;  3ZOB A;  1FP2 A;  4CCK A;  3GF2 A;  4L9N A;  1KYW A;  5HDK A;  1PP8 F;  3LAJ A;  4MEX F;  1T98 A;  1QQI A;  3DLA A;  1DGW Y;  2GQQ A;  3LSP A;  5FD6 A;  5H2F C;  3OL4 A;  2EIK H;  5LGT A;  2HNH A;  1YS6 A;  4FHT A;  3CCM I;  3D0S A;  1QBJ A;  1EH8 A;  2OUM A;  1FSH A;  2P8T A;  4JQF A;  3WTV C;  1P4X A;  2VXZ A;  3S1M J;  2M5W A;  2R4G A;  3DBL B;  1B72 B;  4NHJ A;  3DU6 A;  4FX0 A;  1Z7U A;  2MD5 A;  2EZK A;  5LEJ A;  3S1Q J;  4E7H A;  3ZQI A;  5DCM B;  1LUJ B;  2YUS A;  2ZJQ F;  2VUM J;  3OS1 A;  2VKE A;  3N05 A;  3JW4 A;  2CMP A;  2F6C A;  4BQN A;  5IT9 Z;  1KQ9 A;  2MSY A;  1P92 A;  1XMA A;  3LSM A;  2RVC A;  1Y0U A;  2VKD A;  3MD2 A;  2DK8 A;  1UCR A;  2RAE A;  2DT7 B;  4XLP F;  4BHP A;  3X2Q H;  2WBM A;  1CGP A;  2JPB A;  2WWY A;  2FNA A;  4B47 A;  4EJV A;  3D1N I;  2BGC A;  4EM0 B;  2WY7 Q;  3GTJ J;  4AM3 A;  4GDF A;  5J8F A;  3T8T A;  5DV5 A;  1DPR A;  4GYI A;  2KHM A;  3DKX A;  4A3M J;  1YIT I;  5D6E A;  4B44 A;  3DKW A;  2P4W A;  2ECC A;  2V79 A;  3OY9 A;  3S8P A;  1WSU A;  5FKK A;  3S14 J;  4CCM A;  3ZRG A;  4A12 A;  2HDW A;  2FUG 2;  2L4M A;  4KYW A;  2AO9 A;  2DDA A;  4BDZ A;  2ADU A;  2F4I A;  4M9X A;  1MBJ A;  3BDD A;  2KZV A;  4EV0 A;  1O3T A;  2R92 J;  2W25 A;  2DPU A;  2NS8 A;  3G73 A;  3TO7 A;  2M34 A;  4N4O B;  5LFA A;  3DTI A;  1Z67 A;  2DDB A;  2IP2 A;  3A2K A;  5GTH C;  5IOZ A;  1QA6 A;  3TBI A;  3K2A A;  1Z3Y A;  4KIT B;  3W6J B;  2E60 A;  2CQX A;  1PUE E;  1XPX A;  4I7H A;  1GV2 A;  2XF5 A;  3B02 A;  3AG3 H;  3H36 A;  4LIV A;  5J3L A;  1W0T A;  1L0O C;  1YS7 A;  4CO8 A;  2D45 A;  4XON A;  4RLQ A;  2JA8 J;  4AC0 A;  1RUN A;  3PNY A;  2DT6 A;  3QPS A;  3HDD A;  5D8L B;  2L7K A;  1QO0 D;  3QOD A;  4EGZ A;  5CQG A;  3J81 Z;  1G6N A;  2DYS H;  3TP3 A;  2RQQ A;  5KAF C;  3BRO A;  3FK7 A;  2PI0 A;  1ZRF A;  2UXX A;  2CRG A;  4OIO F;  1Z91 A;  3H3V K;  2GIZ A;  2NOG A;  3DPT A;  2R7X A;  3V8L A;  3R6S A;  2EFW A;  3M7G A;  2DCE A;  1P4A A;  3ZCO A;  2NYX A;  4Y17 A;  4WF2 A;  3ABU A;  1RR7 A;  2CG4 A;  1XCB A;  3B73 A;  5FD5 A;  4LG0 A;  4DYR A;  1JT6 A;  2OAZ A;  3B6C A;  4RGX A;  1T08 B;  3KZY A;  4NQW A;  4BKX A;  3V4G A;  2VI6 A;  1M1E B;  1MD0 A;  1FOW A;  3FZV A;  4QIW N;  4QTR A;  3OSF A;  3S32 A;  4HX4 A;  4GO1 A;  3DEE A;  3H9J A;  4R79 A;  2COB A;  3A03 A;  5E3M A;  3Q9S A;  3CCV I;  1T2K A;  4GXO A;  3F8N A;  2BOL A;  1HQC A;  3LA3 A;  3CJN A;  1QHH D;  2KIF A;  2EWN A;  3HOV J;  3LQQ A;  4CZC A;  3CO6 C;  2V26 A;  1K4S A;  2QQ8 A;  4C3J J;  2JWT A;  2XGX A;  2KRF A;  2VQL A;  1QZE A;  4XKC A;  3WTT C;  4PDK A;  2HR3 A;  3G3Z A;  4I0A A;  4J19 A;  2O7O A;  1W7P D;  4M3G A;  3MVP A;  1FSE A;  2KIM A;  1IF1 A;  4ABZ A;  1YYV A;  4KIB A;  1GVD A;  5DYM A;  1BI1 A;  2ZNZ A;  5E3L A;  3IV5 A;  4C30 A;  2L7M P;  3BLY A;  4NB5 A;  2CQ7 A;  5J1Y A;  2KQR A;  4E7Z A;  4BE2 A;  4XOR A;  2H8R A;  4EAT A;  2MLK A;  3PQJ A;  4V2G A;  2NS7 A;  1MBK A;  1U2W A;  4D1Q A;  1MBE A;  2COM A;  4G6D A;  2W24 A;  1Q1V A;  3E1S A;  2IW5 A;  1IN4 A;  3K2Z A;  2R5Z A;  4L0Y B;  2QWW A;  2XKP A;  2OCE A;  1ZRE A;  2XGC A;  2XAH A;  3G71 I;  2VON A;  4N9H A;  2EB7 A;  1X4O A;  3T5X A;  4RB0 A;  2E2J J;  3HTU A;  1W0U A;  1ETQ A;  1JTY A;  3OV8 A;  2LTP A;  2QGU A;  3EUA A;  3GXO A;  1HKQ A;  2Y0S A;  3V42 A;  2VC0 A;  2GIV A;  5HS9 A;  3FM3 A;  2XPV A;  2EK5 A;  1W7P A;  1OCT C;  3S1N J;  1K78 B;  2Z1D A;  3TQN A;  1I39 A;  1Z7L A;  4IRI A;  4I6Z A;  2LLK A;  5EGO B;  2P6T A;  5GP9 A;  4HX7 A;  3F22 A;  1I1S A;  1WQ2 A;  2BHY A;  1MDM B;  4DYC A;  2GXG A;  4XIC A;  1N25 A;  4ZTJ A;  2O6G E;  5M3M J;  3JRE A;  4ZH4 F;  3S93 A;  4BDY A;  1FYM A;  5L3E A;  4BQQ A;  1S8N A;  4XKB A;  4LK1 F;  3ASN H;  2KZG A;  1JKR C;  4MLO A;  4BNC A;  1B4A A;  4M6Y A;  4XBF A;  2K3P A;  2E5Z A;  2TCT A;  1XGM A;  3HB9 A;  3NWT A;  5HLT A;  1R49 A;  1JKO C;  2WB1 A;  4AVZ A;  4G9Y A;  4OAY A;  1Z77 A;  3C2H A;  4BHB A;  3SDG A;  2E19 A;  2IBD A;  5E1X A;  1IRG A;  4G7O F;  3VDX A;  4L0Z B;  2FD5 A;  3HUG A;  1HDD C;  3A02 A;  2MLG A;  5TJJ A;  3OOP A;  1S72 I;  3OR2 C;  3ABM H;  2YPR A;  4Y3O A;  5EF6 A;  9ANT A;  2QZ8 A;  1FYL A;  1RRJ A;  1CF7 A;  2FU4 A;  3HGG A;  3BPX A;  1IV8 A;  3MEX A;  3R0A A;  2AQE A;  1XB4 A;  4AYB A;  2VC1 A;  5FLV A;  2M4K A;  1MBH A;  2RKH A;  3H5N A;  4A3F J;  1FOX A;  1ERD A;  2JK3 A;  1YIO A;  4A3G J;  2ZKZ A;  1JT0 A;  2YR2 A;  5BS6 A;  4LLL A;  4XR6 A;  2OZ6 A;  1W36 D;  1RR8 C;  3MFK A;  4ANJ A;  1LKX A;  2MBF A;  1WI9 A;  4CXF A;  4KUM A;  2QQA A;  3HPH A;  2P0W A;  1TWC J;  3ZQL A;  5C4X J;  5F08 A;  2L7Z A;  1XX5 A;  4ITV A;  2FEZ A;  4UNO A;  4I76 A;  2VJ4 A;  1EH7 A;  3C2B A;  2R7Z J;  2P5L C;  4G7H F;  2QBY B;  4HLY A;  2QSF X;  4BBS J;  5JFR A;  1WJA A;  3IH4 A;  1ZG5 A;  1FLI A;  2RV8 A;  2PMZ A;  1V5F A;  3LNQ A;  2STT A;  1R7J A;  1LDK B;  1X3Z B;  1O4X A;  2DMU A;  3ONQ A;  2ZO4 A;  3OYK A;  1QZZ A;  3COA C;  2F5F A;  4M73 A;  1A04 A;  4ZDP A;  4IF4 A;  3W2V A;  4ZC3 A;  5K7F A;  1LNW A;  3I3L A;  3LSR A;  4JX5 A;  3IRR A;  3G1O A;  1TC3 C;  2XAJ A;  1USS A;  4UVA A;  3JCU C;  2VOD A;  1V5E A;  3JRB A;  4FT8 A;  2LYC A;  4OMY A;  4CIC A;  4W97 A;  2YS9 A;  2CSO A;  2HQN A;  3BG3 A;  2O8X A;  2BVM A;  1G3S A;  2KP6 A;  5HS8 A;  3OSG A;  3V7R A;  1FZP B;  1NG6 A;  2XSJ C;  3EQL F;  1G3Y A;  4I0B A;  4CH7 A;  5FO5 A;  2CV2 A;  2QBY A;  2OTJ I;  3KIO A;  3FKJ A;  3OYF A;  1Z21 A;  4R1H A;  3ABL H;  2GXB A;  2DBB A;  4H0E A;  3I55 I;  3L2Q A;  1YO5 C;  1IAW A;  4PJN A;  4XRS A;  1K7A A;  1TNS A;  5F0H A;  1YHQ I;  1IXC A;  2CJJ A;  1OIS A;  5GTI C;  3BTC A;  2JVG A;  1J59 A;  1X2N A;  2EV6 A;  3KET A;  3DKY A;  3NQO A;  2L01 A;  3PUF A;  5CYV A;  1UB9 A;  2ZJ2 A;  3E6C C;  1FOY A;  1X58 A;  3OYH A;  4AD9 A;  1P9Q C;  4HV5 A;  4LB6 B;  4AWX B;  4M9S A;  3KZZ A;  1YQA A;  5LBQ A;  1OCZ H;  4N4N B;  4U0Y A;  1WJB A;  2RNJ A;  5F1R A;  5HDN A;  4XLN F;  4RDU A;  1IDZ A;  2XHK A;  5BPI A;  1X1C A;  2EFN A;  2FF4 A;  4CCN A;  2X0L A;  1J9I A;  4FE7 A;  2ACJ A;  4ZYA A;  4DOZ A;  1YW9 A;  5B66 C;  1QPI A;  1GXQ A;  5TGT A;  3ULQ B;  5J8C A;  1LFU P;  4HQM A;  1WJC A;  2CS3 A;  3BY6 A;  4X6A J;  3FWE A;  1FTZ A;  2E1M B;  2LRE A;  1FX7 A;  4XN3 A;  1MJA A;  2E1O A;  2R5Y B;  3TDZ C;  4G6Q A;  1TQP A;  2D1H A;  4XKV A;  4JP0 A;  2E1M C;  5FLM J;  4AIK A;  1R5H A;  1X1D A;  2K85 A;  4G6T B;  1X1A A;  2LP0 A;  2LOO A;  1YRN A;  1QHG A;  4L9J A;  1R00 A;  2DN0 A;  4IHS A;  1FBU A;  1Y1V J;  3I59 A;  4XRF A;  3I58 A;  4XSX F;  4NBQ A;  1JUP A;  5B1A H;  1A31 A;  1ZG3 A;  2PQ8 A;  2Y0S N;  3ZMS A;  1IN8 A;  1TP4 A;  4I99 C;  3FBI B;  5IP9 J;  1KU7 A;  1TWH J;  3B6A A;  1EA3 A;  1OCO H;  2CFX A;  2ESH A;  1GHC A;  2DQL A;  1BOB A;  2M7B A;  2DOF A;  4OIN F;  2GAU A;  3ISP A;  2JZY A;  3I5U A;  2FA5 A;  4JYK A;  4O3M A;  1JGS A;  1P4W A;  1NTC A;  4BAC A;  2X1D A;  3H0G J;  5GAD J;  2Y75 A;  1VQM I;  2QVO A;  3CMY A;  2WAD A;  1REP C;  4IEJ A;  4ASN A;  3GZ6 A;  5BMZ A;  2LR8 A;  4WCG A;  1K83 J;  2HTS A;  3ERM A;  3L09 A;  2ID3 A;  2QLZ A;  4BY7 J;  4BGD A;  1VFC A;  1FMV A;  2JN6 A;  3I64 A;  3KP3 A;  1K79 A;  4CZZ A;  3E6B A;  1O3R A;  1ZK8 A;  3OS2 A;  2L7F P;  3GFI A;  2KDZ A;  4HAM A;  4IPA A;  3U1K A;  3VSL A;  3D5R C;  2L0K A;  3FKI J;  3ABT A;  1ON1 A;  2DA1 A;  1ZHF A;  5CVI A;  4KN7 X;  2UWM A;  1ZR2 A;  2LY2 A;  5D6F A;  4HYE A;  1WWX A;  1S9H A;  1QVT A;  4I02 A;  2HOA A;  2PJP A;  1P7I A;  3A01 B;  3BZK A;  2KIQ A;  5ILU A;  3S2H J;  4A3D J;  2PLY A;  4NC6 A;  4G94 A;  4JK1 X;  1ZN2 A;  4LLG F;  3E5U A;  4B1R A;  3TDU C;  3K10 A;  3RPU D;  1BR4 A;  2ICW G;  3AKZ A;  3C1D A;  2J5P A;  2G7H A;  2K5C A;  2L9S A;  2LBF A;  5GPC A;  2HVQ A;  2AXL A;  2K40 A;  3OYJ A;  4Q47 A;  2F2E A;  2F4O B;  4G12 A;  4U7B A;  1XGN A;  1UJ8 A;  4KT5 C;  3M1E A;  3HOY J;  3QRF F;  2ZFU A;  3CUQ B;  3Q0U A;  4BXU A;  2DFI A;  1IXR C;  1GVJ A;  4B4C A;  4BQO A;  5F0F A;  5D8K B;  1N78 A;  3E6D A;  1D5Y A;  3J7A Y;  2L9V A;  3M07 A;  2UXN A;  3HKZ A;  1SEU A;  1XC5 A;  2DYR H;  3FXQ A;  3OR1 C;  2O9L A;  2ME0 A;  2QEN A;  2CUJ A;  2LKP A;  2XIG A;  3ZQH A;  3FXO A;  4UHT A;  1W5T A;  4RM2 A;  3WOD F;  4FCY A;  1FEX A;  4YG2 F;  2D1V A;  3GW2 A;  1DU6 A;  1TQM A;  4MEY F;  2QF7 A;  4PJL A;  4RLF A;  2JQ7 A;  4LFU A;  5E79 C;  1T6S A;  2UZK A;  1S7O A;  5JVG F;  1KYZ A;  2JMW A;  5M5X J;  2QSG X;  2R7V A;  3SEZ A;  2MA3 A;  3I0T A;  5D4S A;  5D5X B;  5KNL A;  2L4A A;  2NVU B;  1AU7 A;  2HOE A;  5HLI A;  4D5F A;  1AOY A;  4A69 C;  4B43 A;  2E35 A;  3F21 A;  5DTD A;  4KFC A;  3IL2 A;  1R9T J;  5EEA A;  3HRS A;  2NXN B;  2JUG A;  2R7D A;  3K69 A;  1LQ1 A;  1TL8 A;  1QGP A;  2B0L A;  5M3F J;  1BIA A;  2F5E A;  1OYY A;  1OKR A;  3FIS A;  3HOS A;  2L2O A;  1FT9 A;  3WE3 A;  2Y9Z A;  1WCM J;  4L9V A;  5D4R A;  1OLT A;  4HA8 A;  3REO A;  1GDT A;  1JKQ C;  3BTL A;  4KN4 X;  1B9M A;  1HF0 A;  3WTU C;  5K7Z A;  1FOK A;  3IRQ A;  2ZME B;  3I54 A;  2GBY A;  1R4M B;  1U6G A;  1BW6 A;  2BY2 A;  1BN5 A;  1T33 A;  2VE9 A;  1XSX A;  1YE9 A;  4B48 A;  3HRT A;  3VYR B;  4U87 A;  2CQN A;  5FB2 A;  2KL4 A;  2XRL A;  4A5N A;  2FMY A;  3ZR8 X;  4DBQ A;  1N75 A;  1G3T A;  2L5Q A;  2EJR A;  3WHC A;  4HSR A;  3DEU A;  2O0Y A;  1U5T C;  2L9N A;  3N97 A;  2P6S A;  4BAY A;  3U21 A;  5K5R A;  2IGN A;  2ZME C;  3CC7 I;  2ZXI A;  4KMU X;  3QYF A;  4Y4R A;  2R0Q C;  1DQU A;  2EFP A;  4XQF A;  1S5L C;  2LNB A;  1VQP I;  3VFZ A;  4IXA A;  4WXH A;  4HF1 A;  4EM1 A;  1I6H J;  2GA2 A;  1U8B A;  1ULY A;  4C2M J;  1JE8 A;  1OJL A;  2VBY A;  1BI3 A;  4V19 K;  4XN0 A;  2DOD A;  2VQC A;  1KZH A;  2HYF A;  1APL C;  4L18 B;  3TW6 A;  4K2E A;  5J4V A;  1O3Q A;  3OMY A;  2ESN A;  4XLH A;  4Q4Z F;  2EIL H;  4ETS A;  5BNG A;  3W6K B;  4P96 A;  2RNG A;  1VQO I;  2HWV A;  3RZO J;  1ETV A;  2NVT J;  5E3N A;  1AWC A;  1SD5 A;  2MAB A;  2OZU A;  4D7M A;  3RYP A;  4E7I A;  3HSE A;  4YFN F;  1ZH5 A;  5DDG A;  3KPH A;  3SZG A;  3S3O A;  1D0Y A;  2HPM A;  4XMY A;  5DUI A;  1G4D A;  1WJF A;  1W1W E;  2HTJ A;  4Y15 A;  3FMR A;  4RGR A;  3RJP A;  2I10 A;  3EYY A;  3F8B A;  3GLL A;  3PUB A;  3S3N A;  4CCL A;  1ZR4 A;  2XPW A;  4I98 B;  5TIS C;  4M3D A;  3KP7 A;  5J6X A;  5DCM A;  2M4G A;  4CYC B;  1K78 A;  1B9N A;  3RZD J;  5FGM A;  4N0B A;  2BXZ A;  3GFL A;  4PSW A;  1HSJ A;  5ICG A;  4IQJ A;  2M30 A;  4PGG A;  1TT5 B;  1V3F A;  3W2A A;  1R1U A;  2NS0 A;  4MTE A;  5BQT A;  1UZC A;  1CQT A;  1W4M A;  3T8R A;  3CF2 A;  1RPW A;  1VQ7 I;  2Z9O A;  2M0C A;  5KCM A;  3L1P A;  3HJE A;  5CQE A;  2ID6 A;  4C3H J;  2ELH A;  1BI0 A;  3GVA A;  1K4T A;  2EIN H;  2K9Q A;  1BI2 A;  1VQ5 I;  2IA1 A;  4XRS G;  5F27 A;  2ZCW A;  1AA7 A;  2EZL A;  1XD7 A;  3CP2 A;  5HOO A;  2HEO A;  1I50 J;  1XSD A;  3CD6 I;  3RPU A;  2XKO A;  2HKO A;  5LRS A;  2E71 A;  3RYR A;  5EGO A;  1MGT A;  2K4J A;  3QPH A;  1U0J A;  3CDL A;  4M71 A;  4B3A A;  2JRM A;  1YI2 I;  4BY1 J;  2TRT A;  1PDN C;  3N4M A;  1I3A A;  4II3 A;  5L3D A;  5FRO A;  2WY8 Q;  3KP6 A;  3K4K A;  4CGZ A;  4MO7 A;  4PZJ A;  2K7L A;  1DPU A;  2DW4 A;  3VYT B;  2O8K A;  3JSP A;  2VB6 A;  4HF0 A;  4BXX J;  4Y33 A;  2BBY A;  2JVH A;  2Y9Y A;  3HGY A;  3PFY A;  2V1D A;  3V7C A;  2VPR A;  1MNE A;  4XID A;  4U7D A;  3S17 J;  2AHQ A;  1J7K A;  1DUX C;  3Q9V A;  2GOM A;  5EG0 A;  3HEF A;  1QRY A;  2W48 A;  3QP6 A;  3RIR A;  1LVA A;  1YIJ I;  3KEY A;  3PIO F;  1XCV A;  4G7Z F;  4UXN A;  1LB2 A;  4LG0 B;  3GX4 X;  3LSJ A;  3CES A;  3MQ0 A;  1MJB A;  1FBS A;  1ZTR A;  5ED4 A;  3WU1 B;  3BP8 A;  1BOA A;  4CYC A;  3CUQ C;  3H5A A;  4Y52 J;  3H3Z A;  2E36 A;  5FFX A;  2D2W A;  2W57 A;  1YW8 A;  4IZZ A;  2RGV A;  4NDL A;  4MQ9 F;  1U9O A;  2CW7 A;  3ZQG A;  3U9G A;  1WRJ A;  4BBR J;  3QPL A;  1HDP A;  5JR3 A;  1S7E A;  1XGS A;  4HLX A;  1JKP C;  3QOE A;  3HTS B;  2M87 A;  1T8I A;  1WGX A;  2HYJ A;  2EA2 A;  3CCY A;  2OC6 A;  2XGE A;  1SVM A;  1IO2 A;  1ZYR F;  4HDV A;  4C2T A;  1BL0 A;  2VKH A;  1U9N A;  3H3U A;  3L2U A;  3A0B C;  4PSX A;  3GUD A;  2P7C B;  1ZKG A;  2LC2 A;  5J47 A;  3K4B A;  4ESJ A;  5E8G A;  3QU3 A;  3K70 D;  4KA4 A;  1E2X A;  1U5T B;  2BE5 F;  1T39 A;  4IJA A;  2UV1 A;  3WGH A;  4F52 A;  4XNF A;  1P7J A;  3C18 A;  5ICE A;  4BUP A;  1S7A A;  1BC7 C;  4HPQ A;  5DEQ A;  3BTJ A;  5L3G A;  4MFE A;  3VWB A;  3F8F A;  3BJA A;  3GTM J;  1WJ5 A;  1SFX A;  4UVB A;  3SQN A;  2E1C A;  1D8K A;  4D5C A;  2KT0 A;  3SDB A;  4D0P A;  1U8R A;  4WXD A;  1XTA A;  2HS5 A;  2KMU A;  4W1U A;  1TNT A;  3NWS A;  4E4H A;  2ZJR F;  2XF6 A;  3LSI A;  2A6H F;  4Q5S F;  1I5Z A;  2BY1 A;  3DPU A;  3I4P A;  1T38 A;  1XDU A;  1MSE C;  4BHC A;  2X6Y A;  5A2Q Z;  3BTI A;  5JLX A;  4F3Q A;  2Z33 A;  1NG7 A;  2P5K A;  1T0F A;  1BR2 A;  2X1C A;  3K1P A;  4EVI A;  4U0V A;  3ZN0 A;  1NK2 P;  1D8J A;  2E5N A;  3JRI A;  3J7Y J;  2JTV A;  1XMX A;  2PBI A;  2H6C A;  2LF7 A;  3TW7 A;  2A5W A;  3BR0 A;  1FJL A;  2IRF G;  4FET A;  3UR3 C;  4CCO A;  4QPO A;  3O3K A;  1HW2 A;  1FMW A;  3P5J A;  2Y2Z A;  3S2W A;  3JRG A;  3PL8 A;  3ZPL A;  1VZ0 A;  5ICC A;  1TBX A;  2MFZ A;  5KHD A;  4TV7 A;  5HOD A;  1RET A;  3MZ8 A;  3HIF A;  3EPZ A;  1YOV B;  2ZJP F;  4EM2 A;  1SD6 A;  1QNT A;  2DQR A;  1LDJ A;  5E17 F;  2BY0 A;  3IUO A;  1POG A;  1BJA A;  3BT9 A;  3DEW A;  3DQV C;  1E3H A;  2NVY J;  2VL8 A;  1KA8 A;  1MIJ A;  2JA2 A;  5LGN A;  1X1P A;  3ZMU A;  5ILV A;  2W7N A;  2FJ1 A;  1QU3 A;  5F64 A;  4I2O A;  2RRE A;  2D5V A;  2CQQ A;  3KEO A;  1X19 A;  2RN7 A;  3A4C A;  1SAN A;  2OU2 A;  3BG7 A;  2BYV E;  3O8H A;  3JR9 A;  3WGG A;  3LQR A;  2XDV A;  4C9Y A;  4X0G A;  2ZBK A;  3K4N A;  4L5J A;  3GYH X;  3ZQC A;  2VIX A;  2GWR A;  1TW2 A;  4WXC A;  2YU9 J;  1RES A;  1IJW C;  2NVX J;  4HW0 A;  3CDH A;  2LH9 A;  2RQP A;  5CKT A;  1R1V A;  1ITY A;  2PMH A;  3I53 A;  4A3C J;  1G3W A;  2EV0 A;  1HC8 A;  2IS1 A;  2GM4 A;  2L3D A;  5DD4 A;  1OQY A;  4YEJ A;  1A6Q A;  3SJM A;  3R0J A;  5ILS A;  5CJ9 A;  1C0W A;  3I4N J;  3DTK A;  4RA2 A;  4IHY A;  2PX9 A;  4YII A;  2EZH A;  3WU0 A;  2QKM B;  4A6E A;  2M8E A;  5L3F A;  2VBW A;  4M3E A;  5FRM A;  1RZ4 A;  2FBK A;  3FMS A;  4A0X A;  2DK5 A;  3VB2 A;  4AID A;  1Z3X A;  2MH2 A;  3M4O J;  2LF8 A;  4DYQ A;  4D7N A;  5DM7 F;  4O6J A;  3MZH A;  1A35 A;  1H88 C;  3VOD A;  2EIJ H;  1I27 A;  3GLX A;  1SVL A;  2BXY A;  5E20 A;  4UB6 C;  1MMA A;  4FTH A;  2VN2 A;  2HVS A;  2AS5 F;  2CW0 F;  2NOJ B;  2R7W A;  1OR7 C;  1YRN B;  4ZDL A;  5GPA A;  4X1E A;  1D1A A;  5JVT A;  4CCJ A;  4RMN A;  2CUF A;  3L2C A;  2BY3 A;  1LE8 B;  5J1U A;  2CGP A;  2DU9 A;  2DJN A;  4O5V A;  4UVC A;  2LSO A;  2R7F A;  3IAS 2;  4ON0 A;  4BJ5 C;  4BH9 A;  1KGS A;  4EJU A;  3OYL A;  1V54 H;  4A3E J;  2PJR A;  1DDN A;  2DI3 A;  4OAZ A;  2H09 A;  4NC8 A;  2XAG A;  4ESB A;  5TRD A;  5BOX A;  4WX9 A;  4IHW A;  1JJ8 C;  1ZLK A;  2DA3 A;  3IWZ A;  4XL9 A;  3EYI A;  4IRG A;  3KCC A;  2VJJ A;  1IC8 A;  2FRH A;  3RKY A;  1JJ6 C;  3WTX C;  1KQ0 A;  2FML A;  1EJ9 A;  2KKO A;  4LOC A;  5JHU A;  3S1R J;  5FFZ A;  1IRX A;  3I4M J;  4F91 B;  4B09 A;  5KVR A;  1FBQ A;  1EKE A;  2DA5 A;  3G1L A;  3DXJ F;  3BZC A;  3ZN1 A;  3TKY A;  4M3B A;  2QCO A;  1XDS A;  3MKL A;  4IX7 A;  1D0X A;  3E0J B;  2XVC A;  1W5S A;  2G0E A;  5IP7 J;  3FF5 A;  3PQK A;  2BHZ A;  2H27 A;  2Y30 A;  2Z99 A;  3C2G A;  3E3V A;  3LFU A;  1I3Q J;  2K86 A;  2ZB9 A;  3TO9 A;  2HOS A;  3AL0 C;  1JXS A;  2K9S A;  2LY1 A;  1S29 A;  1TWG J;  2DA2 A;  3ESW B;  4RAF A;  3RCO A;  3JAM K;  2E2I J;  3BR5 A;  2HQR A;  5CLS A;  5DCF A;  2FX0 A;  3GZ5 A;  1GV5 A;  3LFK A;  5L3C A;  1ZAO A;  2R7T A;  2L54 A;  2X6W A;  1ZRD A;  4DZP A;  5EJC A;  2HQ5 A;  3FK6 A;  3HSF A;  4XKW A;  3LST A;  2LKS A;  4XRM A;  1SAX A;  5DM6 F;  3HRU A;  1A36 A;  1VI0 A;  2P5V A;  1O7F A;  3CQZ J;  5EG0 B;  3Q0V A;  3FHN A;  4KIC A;  4ZDO A;  2EPF A;  4N9I A;  4UB8 C;  3ECO A;  4OMZ A;  1ZGA A;  1BIB A;  3WTY C;  1O3S A;  2OQR A;  1I1G A;  1P2F A;  4MHG A;  2MC4 A;  2V6C A;  3PNV A;  5KK1 A;  1SMY F;  1NH3 A;  2IS2 A;  4PGH A;  3FHZ A;  4LIU A;  2JPC A;  1IRF A;  5GAG J;  5H6R A;  2PMZ N;  3OYD A;  2MYS A;  2Y69 H;  5IYD J;  2XB0 X;  1MW7 A;  1OCP A;  5JLW A;  1Y8Q B;  4RAG A;  1B72 A;  3PSI A;  1WH5 A;  1K61 A;  4PCQ A;  2DMP A;  3OL3 A;  2VLA A;  2XC7 A;  2R93 J;  1NHA A;  1N77 A;  3DWL E;  3LMM A;  4BEH A;  2IS4 A;  5FKL A;  3C7J A;  2XRN A;  1ZRC A;  4ENK A;  5GAH J;  4BJT A;  5IT3 A;  1D3Y A;  2QA4 I;  3S2D J;  3LSG A;  4KJZ A;  3SZP A;  3L2W A;  1EF4 A;  4QLC U;  3D5L A;  1BA5 A;  2LDU A;  2HXO A;  2IAI A;  3LSH A;  2JSC A;  1PJR A;  2IEK A;  3E7L A;  3P7N A;  1Y0N A;  1Z1D A;  2A69 F;  2DLL A;  1LPQ A;  4S05 A;  2F5V A;  2M7A A;  3TOB A;  3F9K A;  5IYB J;  3I59 B;  4HV6 A;  2DA4 A;  1FWZ A;  2PMU A;  3BR1 A;  2V1N A;  1RC9 A;  2IT0 A;  3MWM A;  1AKH B;  1YX3 A;  2R7S A;  4RAY A;  1ETY A;  2CYY A;  2K4B A;  3CTA A;  3AG1 H;  2R3S A;  4HST A;  1X2M A;  2E1N A;  4LLN A;  3MZY A;  1WPK A;  3F72 A;  5IT9 K;  3E97 A;  2ETH A;  3FBN B;  4XLA A;  2R5Y A;  1R22 A;  4QWQ A;  1FY7 A;  3KYL A;  1RKW A;  1VF9 A;  2LVS A;  4DW6 A;  2X4H A;  1V55 H;  3WG9 A;  4M9Z A;  1ZGJ A;  4U0W A;  1MKM A;  2BW3 B;  2ZXJ A;  4MTD A;  1RUO A;  4EJW A;  5FLX Z;  4HRI A;  2JRT A;  4FIS A;  2QSH X;  4DGW B;  3MAJ A;  3JSO A;  2DMQ A;  3MN2 A;  5B5E C;  2M45 A;  3TMO A;  4PUS A;  1IRZ A;  1HKS A;  3GTO J;  4KIS A;  4KIF A;  1Y1W J;  4HQE A;  1VND A;  2WV1 A;  1IN7 A;  3OYM A;  1TW3 A;  1QZY A;  1ZG1 A;  4CDG A;  2IXS A;  4FAS D;  4Y7N J;  4ZTF A;  3E6M A;  3QP5 A;  4PJM A;  1ZLJ A;  5GAE J;  3PFI A;  1OR7 A;  1UEL B;  2F4M B;  3GWZ A;  4OOI A;  3GCM A;  2WV0 A;  2EZI A;  2HU9 A;  3OYC A;  2XPU A;  3TED A;  3FMQ A;  4MIM A;  1H9G A;  1V4R A;  1XG1 A;  1IZ1 A;  1DGR M;  2JT1 A;  1RIO H;  1LEB A;  5FKO A;  3L2V A;  1V5G A;  3FXL A;  1R58 A;  3CO7 C;  3KLN A;  3CJT B;  2ZC2 A;  1F1Z A;  1UMQ A;  4UUS A;  1RKT A;  2B7E A;  4ZYE A;  1STZ A;  1X4P A;  4RGS A;  1F36 A;  4XLF A;  3HSR A;  4KDP A;  2HYG D;  2PG4 A;  3IP4 B;  2A6T A;  4BU2 A;  1WFX A;  3FXK A;  5D5W B;  4A0Y A;  5LLQ A;  4FE4 A;  1FYK A;  1J0R A;  2RC4 A;  3M8J A;  2VT3 A;  3CP8 A;  2W00 A;  3CCS I;  4E6K G;  3E5X A;  2KIU A;  2KJB A;  3IC7 A;  3OIO A;  2XAQ A;  2Y0M A;  4F55 A;  3F6V A;  1F5T A;  4JOM A;  2DOE A;  1E0E A;  1R23 A;  2DT5 A;  2VT2 A;  3L2R A;  5HNF A;  5J1R A;  4BE0 A;  2STW A;  2P7V B;  4U88 A;  2A61 A;  3BJO A;  4IO9 F;  5LD2 C;  2OQG A;  3MKY B;  3GTP J;  2EV5 A;  2W84 A;  4P9F A;  4IHV A;  2HZT A;  3KYC B;  3DCF A;  2HZD A;  4F93 B;  3HOT A;  3CCE I;  3VYS B;  1WJD A;  5FLX K;  3QPT A;  4MGR A;  5E8I A;  2XF7 A;  1TT0 A;  1OMI A;  4XM3 A;  1YFH A;  2A68 F;  3HBL A;  4YEL A;  2DFH A;  2W4S A;  2V9K A;  2ELK A;  2Q2E B;  1WHU A;  2X1E A;  2ZFW A;  4OIQ F;  3F8M A;  4J01 A;  5F6F A;  4J00 A;  2R7U A;  1SMT A;  3M9A A;  1HOM A;  4M6X A;  3BQY A;  1E3P A;  5ERI A;  2HXI A;  4A3I J;  3J7A O;  2PN6 A;  3G4S I;  2NNN A;  1ORK A;  3P9C A;  2JA7 J;  1UHM A;  3KP4 A;  2R5Z B;  3K0L A;  4NC7 A;  2Z5U A;  4P1W A;  4WK8 F;  3SZT A;  5E1W A;  1U5T A;  3WE2 A;  5LHG A;  3K7A J;  1NK3 P;  4DQ2 A;  3F8C A;  2DMT A;  2A07 F;  3DFG A;  1OCC H;  3VSK A;  4EMS A;  3MKZ A;  5HS7 A;  5JI6 A;  1VQK I;  2F5C A;  2K9M A;  4ENM A;  1R6R A;  5IY5 H;  2PFB A;  3HOU J;  2MG4 A;  3QQA A;  2ZXW H;  4L5I A;  1SFO J;  2IS6 A;  3PSF A;  4HBL A;  5E3O A;  3NRV A;  3Q5F A;  5K1Y A;  4JX4 A;  2R7R A;  3HM5 A;  1W7P B;  2XB5 A;  4OIR F;  2DTZ A;  4ZYG A;  2W82 A;  3GFM A;  2KRH A;  3LA7 A;  3FXM A;  3W3C A;  1MSF C;  3FXU A;  3QYB A;  3DP7 A;  4DBR A;  4YFX F;  4ZZD A;  4P55 A;  1PP7 U;  4IOA F;  4AUX A;  1QPM A;  4MQV A;  2HKX A;  2X6X A;  1UAA A;  2FQ3 A;  2Q1Z B;  3ABK H;  2M9H A;  2Z16 A;  3CLO A;  5F04 A;  2LMD A;  4IQ4 A;  3AL0 B;  1DU0 A;  2EQR A;  2IGO A;  3KP2 A;  4RB3 C;  2XV4 S;  3CF5 F;  1DP7 P;  3HL2 A;  3TL4 X;  2MW8 A;  4XOP A;  3RDI A;  3GTG J;  2W85 A;  2IPQ X;  3JAM Z;  1YG2 A;  3PNT A;  1R1T A;  4XK4 A;  1H8A C;  4AYB N;  2A6E F;  4HEA 2;  1Z0X A;  3OOU A;  1I6X A;  4RB1 A;  3PJR A;  2KIS A;  3HUG B;  1SD4 A;  4B3X A;  3LAP A;  3OYE A;  4QSH A;  2V9P A;  1FC3 A;  1SAU A;  3M1C A;  3ML6 A;  2XRO A;  2F5D A;  2BZT A;  3BCA A;  2VJI A;  4LJZ F;  5IPA A;  3CC2 I;  4UUV A;  1HXD A;  1WKM A;  2MH9 A;  3O2P E;  3V8K A;  3ZQF A;  4QPQ A;  1Y39 A;  3S3M A;  1H0M A;  3EDP A;  3EUH A;  1TQI A;  1IG7 A;  2DXI A;  1YJN I;  3K4L A;  1Y6I A;  2FBH A;  2XAF A;  1PUF B;  3QWL A;  1FIA A;  2H94 A;  4DNC A;  3J80 Z;  3EUH C;  2DA6 A;  5D5U B;  4OIP F;  1R71 A;  1EH6 A;  1OPC A;  1WVR A;  4HOB A;  1UG0 A;  3VEP A;  1IN5 A;  4KNY A;  1X3W B;  2NAZ A;  3GBG A;  4AIH A;  5KAI C;  1J75 A;  2EA4 A;  2JUC A;  2OF7 A;  1A5J A;  3IKV A;  3K4J A;  1TZL A;  1PYV A;  1T0F C;  1BBY A;  3BG5 A;  2HOT A;  2H1L A;  3H9Q A;  3UNG C;  4HNV A;  1R36 A;  1OYI A;  2A05 A;  2H1K A;  1XSV A;  2KRC A;  1VQ8 I;  4EJT A;  4JX6 A;  3A01 A;  2VE8 A;  3HPG A;  4IOC F;  1LJ9 A;  1YJW I;  3J81 K;  2V4J C;  3ZQQ A;  1ETK A;  4BEH B;  3SXY A;  1VQ6 I;  3G6E I;  3CLQ A;  1U3E M;  3Q3S A;  3NAU A;  2OTL I;  3KYD B;  2VOP A;  2CQK A;  1K6O A;  1YJ9 I;  5DUK A;  3LOC A;  4LMY A;  2FE3 A;  2JJ7 A;  4LIT A;  3K70 C;  2EFQ A;  4BS9 A;  3I9V 2;  4E7L A;  3KLO A;  3JTH A;  2DA7 A;  2H8W A;  2QM3 A;  4DJA A;  2O61 A;  1HA8 A;  1GUU A;  4Z2Y A;  3MCZ A;  2Y48 A;  1T56 A;  4F7Z A;  4M74 A;  4EQQ A;  1Z6T A;  3AG2 H;  3F3X A;  3W2W A;  2IA2 A;  1VQ4 I;  2IGM A;  2CU7 A;  2MGQ A;  4NNJ A;  3FIW A;  4HX8 A;  1J09 A;  1JUM A;  2E7W A;  2DTR A;  1SC7 A;  2DFE A;  1OCR H;  1ODD A;  1YW7 A;  1R5G A;  2CO5 A;  4BL0 B;  1VQL I;  2QUF A;  4ZYD A;  3A1Y A;  3JRA A;  2HDC A;  2M2E A;  5LEK A;  3GTL J;  5F0C A;  1FTT A;  2O03 A;  3SFI A;  2F48 A;  4BJ6 C;  5JHF A;  4GYG A;  1JI8 A;  3ZP5 A;  1A6I A;  2YSR A;  2FOW A;  3HKZ N;  3JTG A;  5F1J A;  2FNP A;  1O7L A;  3KX2 A;  1ETX A;  3P9K A;  3KE2 A;  3HOZ J;  1BW5 A;  6PAX A;  1LFB A;  3K1M A;  3PM1 A;  1KQ8 A;  1B8I A;  2GA1 A;  2OV7 A;  1IUY A;  3BR2 A;  2HQA A;  3U2R A;  4ESF A;  2K3F A;  5CVV A;  1FIP A;  2DFF A;  3LSK A;  2FOK A;  5BPD A;  2YU3 A;  1XN7 A;  3DLL F;  3I56 I;  3ASO H;  2VQH A;  3SHF A;  2KLO A;  1BM9 A;  3T1B A;  3BR6 A;  3FM5 A;  2O3F A;  1B59 A;  3CMM A;  1MMS A;  4I09 A;  4DZJ A;  3SYT A;  3OS0 A;  2ZME A;  5B3S H;  1WJE A;  2M0M A;  4S0H B;  1MMD A;  4UY8 I;  2O5R A;  5LHI A;  3H9G A;  4GRI A;  3AFH A;  5HLG A;  3AG4 H;  2BVL A;  5J40 A;  2WAE A;  3CJR B;  5EZG A;  4PK4 A;  2P81 A;  3DTE A;  5CPR B;  5LRR A;  3M3Y J;  4F92 B;  3QOP A;  5EYR A;  4AU7 A;  2GOX B;  3BC8 A;  3TOA A;  3BG9 A;  1HW5 A;  3FDY A;  4RM3 A;  3GO5 A;  2LFB A;  1SFU A;  2WAQ A;  3DV8 A;  4XSZ F;  2K02 A;  3NEU A;  2HGC A;  2IGK A;  5H20 A;  2OPT A;  4IRH A;  2XSD C;  4XLC A;  4YIR X;  2QEX I;  3RKQ A;  1YLF A;  2GXA A;  5K5Q A;  5A2Q K;  3BCB A;  3M8F A;  1HLV A;  1LDD A;  5M5W J;  4G8X A;  1IUF A;  5EEG A;  5C44 J;  2QYO A;  2LKX A;  2G7U A;  2CH0 A;  2LRD A;  3H0D A;  4OWR B;  3J7Z I;  1FNN A;  2HPI A;  4E7J A;  1K6Y A;  1DP3 A;  4DIQ A;  3WG7 H;  3JRH A;  1SVO A;  1SD7 A;  1XS9 A;  1BC8 C;  3DU5 A;  2YX7 A;  3DBH B;  2GLO A;  3L00 A;  2A5Y B;  5LGU A;  3DBR B;  1MND A;  3HC7 A;  3RPQ A;  3BG6 A;  2M1B A;  2ZXH A;  2HVR A;  3AAF A;  1G2H A;  1TWA J;  1ZGW A;  4BYY A;  2DO7 A;  1BR1 A;  1IDY A;  1UFM A;  3FX3 A;  1JTX A;  4Z6Y A;  3HHH A;  2VBX A;  4M6V A;  2OD5 A;  1JHH A;  4GCV A;  5C4J J;  1XGO A;  1B6A A;  1HST A;  5J4Y A;  4XOT A;  1S6L A;  2E7X A;  3CC4 I;  1VQN I;  4II2 A;  1UST A;  1Z6R A;  5CVJ A;  3CDI A;  3O6B B;  2BV6 A;  3F0C A;  4C3I J;  2IA0 A;  4PJJ A;  2M3A A;  3TO6 A;  2N8G A;  3R4K A;  4HF2 A;  4P9U A;  3WTS C;  1PVE A;  1UHW A;  3BPV A;  4KT6 A;  1IXS B;  3BZ6 A;  4YIF A;  2LBF B;  5CVU A;  3IKT A;  3IH2 A;  4FQG A;  2I5U A;  3G2B A;  2PEX A;  3SEQ A;  4A6D A;  3PO2 J;  4ENJ A;  4RBO A;  3IWF A;  1IN6 A;  1F4K A;  2FBI A;  4B8X A;  3CUO A;  3CUQ A;  1ETO A;  2NRA C;  2CW8 A;  1FP1 D;  3OWT A;  3HZJ A;  1AKH A;  3MKW B;  2Z2S B;  2X6O A;  4IVN A;  4D9J A;  2X9D A;  3K1N A;  2WTE A;  1HBX G;  1JUS A;  4A5M A;  1F43 A;  3P9I A;  1QVU A;  1MNM C;  3H1C A;  1RNL A;  1TTY A;  3TP0 A;  2ZSI B;  3ZXS A;  3BWG A;  2CV1 A;  1JHF A;  1ZEL A;  4UUT A;  3ZMD A;  2WA0 A;  1KU2 A;  2V1X A;  2Z3Y A;  4L5E A;  2PJR B;  2LK2 A;  3HYI A;  5AIP A;  4ZZL A;  2AQF A;  3J80 K;  2CUE A;  2K9N A;  1ETW A;  4NUB A;  5E1Z B;  4E70 A;  3JRC A;  2X51 A;  3EET A;  3ZMV A;  1E17 A;  2DAO A;  3CCU I;  4A3J J;  1VQ9 I;  4ZYH A;  5B1B H;  1PUF A;  5FJ8 J;  4IKF A;  3BJ6 A;  4A3B J;  3L7W A;  1IGN A;  1L3L A;  2L02 A;  2BEO A;  3CMA I;  1MMG A;  1U78 A;  3Q0W A;  3RKW A;  4LK0 F;  4GFB A;  2KDO A;  2WC2 A;  1GT0 C;  4H4K C;  3ELK A;  4UV9 A;  1T95 A;  2EFO A;  1HKT A;  4A3K J;  4JBA A;  3RSN A;  3OIQ A;  2LY9 A;  2IVM A;  4A0Z A;  4HDU A;  3GME A;  1LE8 A;  1W36 C;  3NAR A;  5E18 F;  2ISY A;  5IYC J;  2QQB A;  1EV7 A;  3IHU A;  5DS9 A;  1TWF J;  2WAQ N;  1HW1 A;  3QAH A;  3RKX A;  4LGW A;  2RDP A;  3EUK L;  1B1B A;  1ZAR A;  3LA2 A;  1LEA A;  2V6E A;  3ECH A;  3GZN B;  4CA0 A;  2FSW A;  2YX4 A;  3HRM A;  3PIP F;  3HOX J;  5M5Y J;  1Z05 A;  2G9W A;  2IJL A;  2MC3 A;  2DJI A;  4KIG A;  3GEZ A;  1IV6 A;  2LD5 A;  3WGI A;  2E2H J;  2CFO A;  4A93 J;  4M3F A;  2HFH A;  5FKM A;  3DF8 A;  2M8G X;  1W5C C;  1KU9 A;  1MH4 A;  1J5Y A;  3RQI A;  2EH3 A;  2XGD A;  4A2U A;  5EDN A;  3FXR A;  4HG2 A;  1J2X A;  1FPQ A;  2B9S A;  2VOO A;  5K7H A;  3K9T A;  3A0H C;  3H35 A;  1SFK A;  3IAM 2;  3M8E A;  4HZF A;  2HDD A;  2AXT C;  3DPL C;  1H9T A;  4YFK F;  3LL7 A;  3QU6 A;  5LHH A;  3F6O A;  2VXD A;  2KJC A;  3W6V A;  4PFP A;  1X3U A;  3KP5 A;  3GFJ A;  1R4N B;  5IP6 A;  3R61 A;  5AIQ A;  3RTR A;  2R7Q A;  5AON A;  1UG2 A;  2VKV A;  3K4M A;  1LVK A;  1AHD P;  3H92 A;  5DD8 A;  3CZ6 A;  3V7S A;  2ELJ A;  4RS8 A;  3U1D A;  5L3B A;  1MBF A;  3ZMT A;  2LG4 A;  1WI3 A;  3CME I;  5HLH A;  4PFO A;  1LFP A;  4XLE A;  3RQ4 A;  3SFZ A;  4RAZ A;  1D5V A;  2DMN A;  1B8I B;  4LB5 A;  2E34 A;  1WZ2 A;  1R5I D;  3R60 A;  4LD5 A;  4BXF A;  1OYW A;  4CYD A;  4RB2 C;  2C6Y A;  3FXJ A;  2VBZ A;  3PO3 J;  3I71 A;  2OBP A;  2XAU A;  2Q2E A;  1WH7 A;  3UKG A;  4I01 A;  2JA5 J;  4MFD A;  5HVQ C;  3HHG A;  4YRV A;  4C2U A;  1D1B A;  3L9F A;  4R8H A;  1BJZ A;  2B63 J;  3ZMZ A;  2K27 A;  2Q0O A;  3QYE A;  1IW7 F;  2J5O A;  3OYB A;  3BR3 A;  5EEH A;  5K5O A;  3CCR I;  2KPM A;  3D5S C;  3HG9 A;  3IH3 A;  2QKL B;  2XUB A;  5FKN A;  2CV0 A;  4NQW B;  3CCL I;  2DOA A;  1G59 A;  3G1M A;  5EZH A;  2R7O A;  2ZNY A;  3GTQ J;  2L9R A;  3ZGK A;  3OYG A;  4E7S A;  4IHX A;  1MH3 A;  4E7K A;  4RGU A;  1G8X A;  4HNT A;  3K6G A;  2X85 A;  3VPR A;  3WHB A;  2A3S A;  2H6B A;  2ME6 A;  2GZW A;  4L9T A;  3VYU B;  4EJO A;  1ZQ3 P;  3T0Y A;  4Y13 A;  2XAS A;  5C3E J;  2ISZ A;  4V2F A;  2I8D A;  2VAS A;  3OYN A;  3BOQ A;  4M72 A;  4EEF G;  3ZQ7 A;  1P6R A;  2EBI A;  3HXL A;  4HNU A;  1UHS A;  2TDX A;  4BQA A;  3KEQ A;  2OA4 A;  5HDG A;  3S16 J;  1Y56 A;  2DPD A;  4IL6 C;  3MMY B;  1Z9C A;  2FQ4 A;  2W1O A;  5H6Q A;  2EIM H;  1YX5 A;  2JA6 J;  3OIP A;  2ECB A;  3HOW J;  3CCQ I;  3F23 A;  2FXA A;  2NNY A;  4P5O A;  3C3W A;  4OU0 A;  2BW3 A;  3O8G A;  1GXP A;  1H89 C;  3S15 J;  1XMK A;  3GTK J;  4ENN A;  1Q1H A;  4CHU A;  2Q8K A;  3KZI C;  3BQZ A;  1ENH A;  1O57 A;  4MNU A; 
#chains in the Genus database with same CATH homology
 3K4L A;  2VQG A;  1Y6I A;  3EUH C;  4LG3 A;  3EPZ A;  2JVG A;  4ZJZ A;  2VPL A;  3OYI A;  1UG0 A;  3DKY A;  2UUZ A;  1X1B A;  2MD0 A;  3IUO A;  3OYA A;  3DQV C;  2VL8 A;  5HNH A;  3GBG A;  3OYH A;  2JA2 A;  1P9Q C;  3H5R A;  1MMN A;  2CUZ A;  2W7N A;  1KON A;  3K4J A;  1QU3 A;  4N4N B;  1TZL A;  2RRE A;  1PYV A;  1WJB A;  1X19 A;  1T0F C;  2K9L A;  3A4C A;  3BG7 A;  3H9Q A;  3UNG C;  4CSW A;  4CUG A;  2XDV A;  1X1C A;  4C9Y A;  2KRC A;  4X0G A;  4CCN A;  3K4N A;  1D0Z A;  2JSP A;  4ZYA A;  4DOZ A;  3HPG A;  2VIX A;  5TGT A;  2V4J C;  1WJC A;  5CKT A;  1GLN A;  2CS3 A;  2LH9 A;  3ZQQ A;  4BEH B;  2E1M B;  2IS1 A;  2LRE A;  4XN3 A;  4YEJ A;  3K4C A;  3CJQ B;  3DTK A;  5FRN A;  4XKV A;  2ZSH B;  2E1M C;  2WAF A;  2QKM B;  4LIT A;  4BE1 A;  3K70 C;  1X1D A;  4BS9 A;  2VJ5 A;  3I9V 2;  1X1A A;  4G6T B;  4E7L A;  2LOO A;  1QHG A;  5FRM A;  4DJA A;  1HA8 A;  1D1C A;  1Z3X A;  2V7F A;  3W2W A;  2IGM A;  4NNJ A;  1J09 A;  4CCK A;  3FBI B;  3DLA A;  1EA3 A;  1MMA A;  2HVS A;  1DGW Y;  3OL4 A;  1BOB A;  2M7B A;  2NOJ B;  5KHD A;  2R7W A;  1OR7 C;  2HNH A;  4BL0 B;  4ZDL A;  2OUM A;  3A1Y A;  4JQF A;  2VXZ A;  1D1A A;  2R4G A;  4BAC A;  4CCJ A;  2X1D A;  4RMN A;  2WAD A;  3DU6 A;  4BJ6 C;  4BJ5 C;  5JHF A;  1JI8 A;  3IAS 2;  4E7H A;  3OYL A;  2PJR A;  3KX2 A;  4OAZ A;  4BGD A;  4NC8 A;  1FMV A;  3OS1 A;  3OS2 A;  3N05 A;  2OV7 A;  4XL9 A;  2CMP A;  2F6C A;  2HQA A;  4BQN A;  3VSL A;  3D5R C;  2VJJ A;  3LSM A;  3LSK A;  2VKD A;  2UWM A;  3MD2 A;  2LY2 A;  2VQH A;  2DT7 B;  1S9H A;  1IRX A;  2KLO A;  4F91 B;  2WBM A;  4B47 A;  3CMM A;  3SYT A;  2WY7 Q;  3OS0 A;  3K10 A;  3RPU D;  1BR4 A;  3AKZ A;  2KHM A;  3DKX A;  4B44 A;  2K5C A;  1WJE A;  2M0M A;  4IX7 A;  1D0X A;  1MMD A;  2L9S A;  2LBF A;  3E0J B;  3S8P A;  2HVQ A;  3OY9 A;  2O5R A;  3OYJ A;  4CCM A;  3H9G A;  2R7U A;  3ZRG A;  3LFU A;  3C2G A;  2HDW A;  4GRI A;  3AFH A;  2FUG 2;  3AL0 C;  4U7B A;  2BVL A;  2WAE A;  3CJR B;  4BDZ A;  2LY1 A;  4PK4 A;  3RCO A;  2F4I A;  3DTE A;  5CPR B;  2ZFU A;  2KZV A;  4F92 B;  4AU7 A;  4N4O B;  2R7T A;  4BQO A;  2X6W A;  5LFA A;  1N78 A;  3DTI A;  4XKW A;  3J7A Y;  2GOX B;  3BC8 A;  3A2K A;  3TBI A;  3FDY A;  4RM3 A;  3HKZ A;  2WAQ A;  3FHN A;  3OR1 C;  4ZDO A;  2IGK A;  1Z3Y A;  2CUJ A;  4KIT B;  4XLC A;  2E60 A;  2MC4 A;  4RM2 A;  3PNV A;  2XF5 A;  2IS2 A;  4LIV A;  3BCB A;  4PJL A;  4RLF A;  4LIU A;  4XON A;  4RLQ A;  2R7V A;  2CH0 A;  2LRD A;  3SEZ A;  5KNL A;  3H0D A;  4OWR B;  3OYD A;  2MYS A;  2HPI A;  4E7J A;  1DP3 A;  1K6Y A;  3PNY A;  2DT6 A;  4DIQ A;  1MW7 A;  3PSI A;  3DU5 A;  4B43 A;  2L7K A;  3QOD A;  5CQG A;  2JUG A;  1MND A;  3HC7 A;  3OL3 A;  2RQQ A;  3BG6 A;  2VLA A;  2ZXH A;  2HVR A;  2XC7 A;  1N77 A;  3DWL E;  3LMM A;  4BEH A;  2IS4 A;  2R7X A;  3HOS A;  2L2O A;  3DPT A;  1BR1 A;  2DCE A;  4BJT A;  3ZCO A;  1OLT A;  3LSG A;  4KJZ A;  3L2W A;  3D5L A;  3LSH A;  4XOT A;  1PJR A;  4II2 A;  1YE9 A;  3S32 A;  2F5V A;  4B48 A;  2M7A A;  3DEE A;  3H9J A;  4R79 A;  3VYR B;  4U87 A;  3F9K A;  2KL4 A;  4PJJ A;  2M3A A;  3ZR8 X;  2BOL A;  1N75 A;  2V1N A;  4DBQ A;  2L5Q A;  1YX3 A;  4KT6 A;  4HSR A;  1QHH D;  2R7S A;  2L9N A;  2LBF B;  3U21 A;  2IGN A;  4HST A;  3G2B A;  3SEQ A;  4CZC A;  2ZXI A;  2V26 A;  3QYF A;  4Y4R A;  1DQU A;  3FBN B;  4XLA A;  4XQF A;  2VQL A;  4XKC A;  3KYL A;  2CW8 A;  3OWT A;  3MKW B;  2Z2S B;  4D9J A;  2BW3 B;  4XN0 A;  2VQC A;  4HRI A;  4DGW B;  2ZSI B;  3OMY A;  4XLH A;  3ZXS A;  2CV1 A;  1ZEL A;  2WA0 A;  4C30 A;  3TMO A;  3BLY A;  4PUS A;  2RNG A;  2KQR A;  4E7Z A;  4BE2 A;  4XOR A;  2PJR B;  4EAT A;  4KIS A;  2AQF A;  4NUB A;  2X51 A;  2MAB A;  3OYM A;  4E7I A;  3SZG A;  2IXS A;  4D1Q A;  3S3O A;  4FAS D;  1D0Y A;  2HPM A;  4XMY A;  4ZTF A;  4PJM A;  1WJF A;  4IKF A;  3E1S A;  1UEL B;  3PUB A;  1MMG A;  4CCL A;  3S3N A;  2HU9 A;  2KDO A;  3OYC A;  4H4K C;  1DGR M;  1T95 A;  2M4G A;  3RSN A;  3OIQ A;  1X4O A;  1W36 C;  3L2V A;  1V5G A;  4PSW A;  3EUA A;  4IQJ A;  2Y0S A;  3V42 A;  3EUK L;  3W2A A;  2V6E A;  3CF2 A;  1X4P A;  4CA0 A;  5KCM A;  2Z1D A;  4XLF A;  3IP4 B;  1Z7L A;  2DJI A;  2A6T A;  4BU2 A;  1WFX A;  5CQE A;  2CFO A;  3M8J A;  4ZTJ A;  3CP8 A;  2W00 A;  1AA7 A;  4HG2 A;  5HOO A;  3CP2 A;  4E6K G;  3S93 A;  4BDY A;  4BQQ A;  4F55 A;  3H35 A;  1SFK A;  3IAM 2;  4XKB A;  4MLO A;  4JOM A;  1E0E A;  1U0J A;  3DPL C;  2K3P A;  2E5Z A;  3L2R A;  3LL7 A;  3NWT A;  5HLT A;  5HNF A;  4BE0 A;  2VXD A;  2WB1 A;  4PFP A;  4AVZ A;  4II3 A;  4OAY A;  5LD2 C;  3MKY B;  5FRO A;  3RTR A;  3C2H A;  2R7Q A;  2WY8 Q;  3K4K A;  3K4M A;  2HZD A;  3VDX A;  4F93 B;  1LVK A;  3HOT A;  3VYS B;  3VYT B;  1WJD A;  3CZ6 A;  3OR2 C;  2XF7 A;  2VB6 A;  1TT0 A;  4Y3O A;  2ELJ A;  4XM3 A;  2JVH A;  4Y33 A;  3PFY A;  4YEL A;  1MNE A;  2W4S A;  2LG4 A;  2V9K A;  2Q2E B;  2X1E A;  2GOM A;  4PFO A;  1LFP A;  2AQE A;  4XLE A;  4AYB A;  3RQ4 A;  4J01 A;  3KEY A;  4J00 A;  2M4K A;  3H5N A;  3CES A;  1ERD A;  4BXF A;  3H5A A;  4IZZ A;  4XR6 A;  1W36 D;  2XAU A;  2CW7 A;  4NC7 A;  4P1W A;  4ANJ A;  5HVQ C;  1LKX A;  4C2U A;  4YRV A;  1D1B A;  3HPH A;  2P0W A;  3QOE A;  4ITV A;  3VSK A;  3MKZ A;  2OC6 A;  2VJ4 A;  4C2T A;  3QYE A;  2K9M A;  1R6R A;  3OYB A;  2VKH A;  3L2U A;  4PSX A;  1WJA A;  2IS6 A;  3PSF A;  2LC2 A;  2KPM A;  3K4B A;  2PMZ A;  2R7R A;  1V5F A;  3D5S C;  3HG9 A;  2QKL B;  3K70 D;  2CV0 A;  2W82 A;  4NQW B;  1LDK B;  2DOA A;  2KRH A;  1G59 A;  2UV1 A;  3W3C A;  2R7O A;  4F52 A;  3QYB A;  4XNF A;  3ONQ A;  3ZGK A;  4DBR A;  3OYG A;  4E7S A;  3OYK A;  4BUP A;  4E7K A;  1G8X A;  4HNT A;  4HPQ A;  3K6G A;  2X85 A;  3VWB A;  4ZDP A;  3W2V A;  1WJ5 A;  4ZC3 A;  3VYU B;  1UAA A;  2X6X A;  3I3L A;  3SDB A;  2Q1Z B;  3OYN A;  2I8D A;  2VAS A;  2Z16 A;  3AL0 B;  4IQ4 A;  3HXL A;  2KMU A;  4HNU A;  2IGO A;  3NWS A;  4E4H A;  1V5E A;  3HL2 A;  3TL4 X;  4XOP A;  2XF6 A;  3LSI A;  2LYC A;  1Y56 A;  3DPU A;  3MMY B;  2X6Y A;  2W1O A;  2BVM A;  2KP6 A;  3PNT A;  4F3Q A;  1YX5 A;  1NG7 A;  2X1C A;  1BR2 A;  3OIP A;  4HEA 2;  1NG6 A;  2XSJ C;  3OOU A;  4CH7 A;  3PJR A;  2CV2 A;  3HUG B;  2E5N A;  4B3X A;  3FKJ A;  4P5O A;  3OYE A;  3OYF A;  1Z21 A;  2A5W A;  1SAU A;  2BW3 A;  4FET A;  3M1C A;  3UR3 C;  4QPO A;  4CCO A;  3L2Q A;  3BCA A;  1FMW A;  2VJI A;  4PJN A;  3PL8 A;  1VZ0 A;  4QPQ A;  3S3M A;  2MFZ A;  2DXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...