1E0EA

N-terminal zinc-binding hhcc domain of hiv-2 integrase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
FLEKIEPAQEEHEKYHSNVKELSHKFGIPNLVARQIVNSCAQCQQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Integrase
molecule keywords HUMAN IMMUNODEFICIENCY VIRUS TYPE 2 INTEGRASE
publication title Refined Solution Structure of the Dimeric N-Terminal Hhcc Domain of HIV-2 Integrase
pubmed doi rcsb
source organism Human immunodeficiency virus type 2 (isolate rod)
total genus 13
structure length 46
sequence length 46
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1e0eA00
1K6YA 1WJAA 1WJFA 3HPGA 4F3QA 3F9KA 1MW7A 3HPHA 1WJEA 1E0EA 1KONA 1LFPA 1WJBA 1WJDA 1WJCA
chains in the Genus database with same CATH superfamily
3BQZA 1H0MA 3DTEA 5E3LA 2X4HA 2HQ5A 2OA4A 5L3GA 2XB0X 1XMAA 5HDGA 3K4KA 4CH7A 4R79A 4D1QA 2ECCA 1T38A 4XSZF 2DA4A 4G8XA 4ON0A 2GXBA 4Q48A 4WXHA 3HUGB 5CVUA 3LSPA 2XF5A 3F0CA 3RTRA 4GGGA 2HYGD 2IBDA 4RLQA 2ZJQF 2M8EA 5ILSA 3OL3A 4KT6A 3PNVA 3F9KA 3IAS2 1VQ5I 2CS3A 5C3EJ 3M8EA 3S1RJ 1TNSA 3GFIA 4UB6C 3K1MA 4ESFA 1PUEE 2ELHA 4E7HA 4XOTA 5DM7F 3K70C 2BHZA 3CUQA 2E60A 1TC3C 2EWNA 4U7DA 4KMFA 1YX5A 1ZYRF 4JYKA 1XSVA 3N4MA 2A6HF 2ESNA 3BZCA 3VSLA 2OAZA 4I98B 1RRJA 2XDVA 2PJPA 1XDSA 2W25A 4F52A 4BL0B 5DD8A 5EG0B 1P4XA 5FLXK 2K9SA 2PN6A 4M73A 1BR4A 2WB1N 3H9GA 3W2WA 2BBYA 1W5TA 2CO5A 2JA8J 3HOYJ 2NS7A 2UXXA 1OKRA 5EEAA 2MYSA 1QZYA 2ZNZA 1I5ZA 2L5QA 1NG7A 1XCBA 4N9HA 4E6KG 4MFDA 5M5YJ 3LNQA 5K5OA 5K7FA 3K70D 3LSHA 3H5NA 2EBIA 1EH6A 4KN7X 4Y7NJ 2QQAA 3FX3A 4BJ5C 4IQ4A 2NOJB 2EFWA 3RDIA 4HBLA 3UKGA 2E1CA 1A5JA 3GLXA 1N77A 4KITB 1ORKA 1XD7A 3PUBA 2ACJA 4L0ZB 2IAIA 2O7OA 3JRCA 2ICWG 4OIPF 3UR3C 3MAJA 1JGGA 4W1UA 5K5QA 2EV6A 1DPRA 2K86A 3HRSA 4IKFA 1SFKA 3BTIA 3MFKA 1SD6A 5CQGA 4BXUA 2DJIA 3F8CA 2XRLA 4E7LA 2E36A 2DT6A 2RREA 5FRNA 2OCCH 5LRRA 2EFQA 3JR9A 3I3LA 4DBQA 2WADA 1P2FA 5BQTA 1H8AC 3M3YJ 4NNJA 1VQOI 3SDBA 1H9TA 2BXYA 2CW7A 4OAZA 2E1NA 4ETSA 2M2EA 4YIIA 5CKTA 4RAZA 2UXNA 3P5JA 5FFXA 4BY1J 4IOCF 3TQNA 4JK1X 4M6YA 1XSXA 2X85A 2BY0A 1RIOH 2MABA 2W48A 3LA7A 5D4RA 3ASNH 3DKYA 1W36C 4M6VA 3A01B 2H1KA 3KFWX 2MA3A 2MSYA 3E3VA 4BQNA 4B44A 3H9QA 4CCMA 5ICEA 2E1MC 2QWWA 5C4JJ 1K83J 2X1CA 4ZYHA 4XORA 3MWMA 3Q0WA 1G3SA 2D5VA 3W6JB 1K4SA 3TW6A 1W5SA 3ONQA 2KRFA 1Y8QB 1R6RA 4QIWN 2JA6J 4B43A 3OSFA 2BEOA 5KNLA 2BY2A 4HZFA 2CV0A 1ZQ3P 2XAJA 3R0JA 4XQFA 1TWFJ 5J4VA 5E79C 3FMRA 3S17J 2ZMEA 2AHQA 2WAQN 2YR2A 1U78A 3HOWJ 4G94A 2HDWA 4MTEA 3EUHC 5C4XJ 4LIUA 4Q4ZF 3J7YJ 1XB4A 1D1BA 2R5YA 4BYYA 2DYSH 2R5ZA 1RNLA 3UNGC 5D5UB 3VFZA 3A4CA 5LGNA 2FJ1A 4C2MJ 2OPTA 1SMTA 3FMSA 1U2WA 4HF0A 3S2WA 3PJRA 4HYEA 3BJ6A 5BPIA 3MKYB 3HYIA 5DS9A 4B3AA 3PIOF 4E7JA 3OR2C 4XK4A 1MNDA 3KYLA 1G4DA 1QHGA 3CCUI 1IG7A 4XR6A 1MBFA 1GHCA 3FIWA 4LG3A 3SDGA 4A6EA 4IZZA 1I27A 1LQ1A 1ZRCA 4OIOF 1J59A 3TP0A 1XSDA 2IA1A 4M3BA 1JJ8C 1ZH5A 1HQCA 2XPUA 4IHVA 4FE4A 3M8JA 1ZHFA 1G3TA 5D5XB 2HNHA 3HTUA 2X48A 3E0JB 1G3YA 2GA2A 1ETWA 3C18A 3S32A 1SFEA 2E34A 1R49A 1QA6A 3HEFA 1OYWA 4L5EA 4M71A 1P7JA 4PJJA 1X58A 3KP7A 3WTZA 5BOXA 3SZGA 1KU2A 1KYZA 5E1XA 1YS7A 2R7OA 5H20A 2WV0A 3OSGA 2O61A 1IV6A 1EV7A 5CVVA 3JREA 1AWCA 4Y3OA 4HOBA 5EZHA 2DODA 4UVCA 3LA3A 1B1BA 3M9AA 3CC4I 1F36A 1HDPA 1FP2A 2H1LA 2XGDA 5AIPA 1KZHA 3J7AO 2RGVA 4PJNA 5HLIA 2F5DA 1YJNI 4V2FA 1JKRC 2BOLA 3GMEA 4B47A 1UZCA 3HOVJ 2VT2A 4KJZA 2EQRA 2IVMA 1BIAA 2MGQA 1Z6RA 2HOEA 5AONA 2FOKA 3H0DA 1BM9A 2CFXA 5LBQA 5M5XJ 2X0LA 2E5ZA 1JJ6C 2TCTA 1U6GA 5DCMA 2PX9A 5LHHA 4U87A 3CMMA 5HNHA 3BZ6A 1Z21A 4LG0B 2WBMA 5GAEJ 5B66C 1WHUA 1LE8B 1Q1HA 2COMA 5EDNA 3N97A 1JTXA 2VJ4A 1Z3XA 3GO5A 2HEOA 1IN6A 2VKVA 2HPIA 4YEJA 3JW4A 5BPDA 3AKZA 4WXDA 3ZPLA 5HNFA 4YIFA 2BE5F 3ULQB 3ZRGA 2QYOA 4HDVA 2MD5A 2K9QA 3ZGKA 4IRHA 4ITVA 1Z7UA 5HLHA 3WTTC 2LREA 3VDXA 1SD5A 3ABUA 2A3SA 2XPVA 2W84A 4OIRF 2CQKA 2ELJA 2KZGA 2LFBA 3SZPA 2XC7A 3ZQ7A 2P5VA 5IYDJ 2E19A 4BJTA 2DPUA 1JT0A 3FDYA 3OYFA 2EIKH 3KYCB 1ZRFA 2JPBA 2HU9A 1BJZA 1R22A 2VBXA 1YQAA 2WY8Q 2E1OA 2LH9A 1HSJA 3IH2A 1VNDA 3S2DJ 2PMUA 1QHHD 2M45A 3HOTA 4G7ZF 3SHFA 2JUGA 1UG2A 4HQEA 1YHQI 1MDMA 4E7KA 4CGZA 1JHFA 2AXTC 4QPQA 4MQVA 5ILVA 5D6EA 4BH9A 5FLMJ 2QEXI 2PLYA 2K27A 4EM1A 2K9NA 5J40A 4EJWA 2R7ZJ 1TTYA 2DOEA 2IRFG 4ZYAA 2VBWA 3JSPA 3OOPA 2E71A 5J1UA 3F8FA 2M34A 4FHTA 5F64A 2XGCA 3ERMA 3Q3SA 1ETOA 1DU0A 3MKZA 1FT9A 1OR7C 3VYUB 1XGMA 3QP5A 1MSFC 1QBJA 3CP2A 3VOEA 4RB3C 4A3EJ 3LAJA 1K6OA 1LEAA 1HXDA 2Z3YA 1BW6A 3BG9A 3OWTA 3WTXC 2UUZA 2NNYA 4L9NA 3M8FA 5ICGA 1R4NB 1D1AA 2K9MA 3FXMA 1OCPA 2O0YA 3WHCA 3B6CA 3ASOH 2J5OA 1BL0A 4HV6A 1R00A 1J09A 4A3DJ 2ME0A 4A3LJ 3FBNB 2JTVA 4HLXA 1TWHJ 2VQLA 5LLQA 4B3XA 2CQ7A 2VASA 2KFDA 3HSFA 2H8RA 1VQ6I 4II2A 2Y2ZA 3CTAA 3EQLF 1SD7A 3NRVA 3HB9A 4ASNA 4U0WA 5IT3A 1X4OA 5FJ8J 4X1EA 1RKTA 4RGRA 5D8KB 2M0MA 2BW3B 3EPZA 4DIQA 3W6VA 1LJ9A 2XV4S 4RGXA 4QLCU 4H4KC 1QZEA 3H9JA 2PQ8A 5FLXZ 3S15J 1HKSA 2R7VA 1LKXA 2OZUA 3VYTB 1SD4A 2Y0SN 3CCEI 1T0FC 1MKMA 4G6QA 3VODA 5L3EA 2A07F 2ZCWA 4KYWA 4CUGA 3BT9A 5D8LB 2KDZA 2DFIA 3LSKA 1MBKA 2QBYB 1I6HJ 3IRRA 2DFFA 1HOMA 2ID3A 3OYAA 4IOAF 2R7UA 1M1EB 4FT8A 4KDPA 3CMAI 1TBXA 1A31A 4I99C 3OYIA 3KEYA 3U2RA 5EEHA 4RAGA 1P92A 2MLGA 3V8KA 4IL6C 1FIAA 2ZFUA 3KP6A 1SAXA 1PUFA 2VXZA 1FYMA 1D3YA 2QSGX 3H0GJ 5E8IA 4J19A 2W24A 4YG2F 1VTNC 1Z91A 4ZDOA 5J1YA 5E17F 3P9IA 2XVCA 5D5VB 2G9WA 2L7ZA 1CQTA 1UG0A 5F0CA 3DEEA 2VKEA 3OS1A 1UHSA 4BJ6C 3FHNA 5D5WB 3BTJA 3OYDA 2OJED 1O3QA 1KU9A 3E6CC 2R0QC 3TEDA 1LFUP 2CV2A 3KCCA 1BR2A 1YI2I 5GTIC 3L2UA 2O8KA 3K4NA 4RMNA 1ZTRA 1CF7A 2PJRA 2HOAA 3G2BA 1MMAA 3K9TA 1O7FA 3VYRB 1H88C 4MO7A 2VPRA 1TWGJ 3OYNA 3JRHA 2FMLA 1WJCA 3G6EI 2STTA 2XUBA 1OCOH 2JT1A 1JE8A 5GAHJ 1CGPA 2WTEA 2EIMH 2V9VA 2ECBA 1GUUA 5J47A 2KIFA 2A68F 4HLYA 2F5FA 2P0WA 3G1LA 2R7XA 3GTOJ 2K85A 2GWRA 1ETKA 1TZLA 1B8IB 2FNAA 1V5GA 2E7WA 2F48A 1WJBA 2RVCA 3LSTA 1D8KA 2HKOA 2KHMA 4P1WA 4BY7J 3EYIA 2V9KA 2F4MB 2XF6A 2O9LA 3WTUC 4Q5SF 4FX4A 3KYDB 1XG1A 3ELKA 4L9VA 3CCRI 3HOUJ 3FM5A 1UMQA 1QRYA 1MBGA 3PSFA 3OYLA 3HRTA 3SJMA 1TQIA 4CCKA 2E35A 3U1DA 1R5GA 2NYXA 1DGRM 3Q0UA 4A5MA 1VFCA 2EA2A 3SQNA 4BBSJ 1HC8A 3CJRB 4AYBN 2LKSA 3KEQA 3RPQA 1NHAA 2RQQA 2A69F 4NC6A 3COAC 1FEXA 2X9DA 3JTHA 4B1RA 1R1UA 4A12A 3BG3A 2O6GE 2L9RA 1HA8A 2R93J 3ZN1A 2E2HJ 2K4JA 1Y6IA 2QCOA 4CYCB 1G2HA 1YRNA 1OCRH 3RYPA 4AIHA 4LB5A 2PMZN 1J75A 2CQXA 4AWXB 3VYSB 3ZP5A 3K4BA 2DPDA 2K4BA 3IRQA 2VOPA 3TDZC 3ZQQA 4IRGA 5ILUA 1SAUA 1K78A 2VKHA 3DF8A 5JFRA 1JKQC 4Y15A 4Y17A 1AKHA 1TL8A 1MNEA 4IVNA 1JUPA 2K5CA 2D2WA 2XSDC 4RB1A 1HLVA 1ODDA 3NWTA 4YFNF 1FPQA 2D45A 3OIPA 4OAYA 2V1DA 3J7AY 1S7AA 4BXFA 1BC7C 2L9VA 3SEQA 2K7LA 2QQBA 1V3FA 3JRDA 3PM1A 1FIPA 2CFOA 2F4OB 4JX6A 3EDPA 1U3EM 4NC7A 2DTRA 2O5RA 2WY7Q 4BBRJ 5L3DA 4V2GA 1O3SA 5LGTA 1WCMJ 4PFPA 3LSJA 4XLEA 2HOTA 1BA5A 2Y69H 2B63J 5E8GA 3WG9A 2LY2A 4E70A 4C2UA 2V1NA 2R5YB 1F9NA 2R5ZB 5H2FC 3OY9A 1Z05A 1ETXA 2ME6A 2AO9A 2F6CA 3AG2H 4LOCA 4CHUA 4BU2A 2JSCA 1BR1A 1MNMC 1IC8A 2DFEA 2DMUA 4PUSA 2WV1A 4UHTA 3SFZA 2KIUA 1P7IA 4PSXA 6PAXA 4LITA 3D0SA 1RR8C 4HV5A 1AA7A 5HDKA 5F27A 1ETQA 1LDDA 4CZCA 5FKNA 1S9HA 3RIRA 3RKYA 1O57A 5L3FA 4KUMA 5IOYA 2CW8A 5J6XA 4NBQA 2XKOA 2EIJH 3F8NA 3CQZJ 2CYYA 1B72A 1F43A 2FQ3A 3M1EA 3GX4X 5IP9J 3KLOA 1LFBA 2ZXJA 2M87A 4LGWA 3K4LA 3LSRA 2FA5A 4X0GA 4NDLA 4ZYDA 1WSUA 1FMWA 2W82A 2DT5A 3JCUC 5FD5A 3G1MA 1TWAJ 2IJLA 3FF5A 2K40A 4XSXF 3JRBA 3REOA 3TO9A 1S7OA 4HEA2 1BBYA 1X3WB 3TMOA 1K61A 4UVAA 3CC7I 1WI3A 1R23A 2LY1A 4IEJA 1PYVA 3CO6C 1Y56A 3R4KA 4F93B 4IXAA 1OQYA 4EM2A 3LWFA 1U5TC 2ZXHA 1TP4A 2IEKA 1SVMA 4ZDPA 3I9V2 1YO5C 2P4WA 1MMGA 2H6CA 3J80K 2VJIA 3S16J 3RZOJ 4IHTA 3ABLH 1OYIA 1WVRA 1XDUA 4PJLA 5JVTA 4MEXF 4XLPF 3HRMA 1YW9A 1A6IA 1U9NA 5D4SA 1GDTA 4PGGA 3HG9A 2YX4A 3DEWA 2Z16A 3JRFA 5F1RA 3S14J 4XLAA 4XM3A 1A36A 3E97A 3TW7A 3I4MJ 2VIXA 4A2UA 4RAFA 1S7EA 1XC5A 1B9MA 2Y9YA 3PNTA 4E7ZA 3FK7A 4XLFA 4AM3A 3C1DA 4NB5A 3MKLA 2Y0MA 3OS0A 5CLSA 1FSEA 2M4GA 3F3XA 3IP4B 3ZQFA 3WTYC 5LFAA 1YJ9I 1K79A 2GM4A 3L00A 3BC8A 1P4WA 3FZVA 3HHGA 3HM5A 1I6XA 3BQYA 2LRDA 4M3FA 5J4YA 5EF6A 4XRMA 1UHWA 2NNNA 2Q2EA 1IUYA 3Q9VA 2WA0A 1FP1D 1BC8C 3S3NA 4N9IA 3CMYA 3GEZA 1X1PA 1J5YA 1J0RA 4CCNA 4I2OA 3A03A 2MBFA 2X1DA 1XTAA 3O2PE 4II3A 2LK2A 4D9JA 3LMMA 1PP8F 5TGTA 5L3BA 5DEQA 3ZQCA 4ESBA 4RB2C 2EILH 5CQEA 3CCVI 2IGKA 4I01A 2H6BA 4UUSB 1S72I 1JGSA 5H6QA 5IP7J 3FKJA 2B9SA 2RKHA 1WRJA 1O3TA 1MH4A 4CA0A 3E5QA 3J7ZI 4KA4A 2ZC2A 2VLAA 3OYKA 4GRIA 2E2IJ 3ZMTA 4LK0F 3AG3H 4IPAA 4XRSG 4AVPA 4B8XA 2LKXA 1T6SA 2Y75A 1X19A 1W36D 2OUMA 1VQKI 4XN3A 3BR2A 4BHCA 5K1YA 1T8IA 1BI3A 3RSNA 3SEZA 4X6AJ 2RDPA 3NARA 3WTSC 4O3MA 2I10A 2RN7A 5LHGA 4F3QA 4M6XA 4EJUA 3RPUA 1OLTA 1IRFA 3A0HC 4D5FA 3EUHA 1DPUA 2HGCA 2CU7A 1YIJI 2KT0A 5CVRA 5KAFC 2GA1A 2IGMA 5ICFA 3S1MJ 4RM3A 2JSPA 2Q0OA 2HXOA 3NQOA 3T0YA 2F4IA 1U0JA 2DXIA 1POGA 3K7AJ 1KU7A 2GIVA 5FB2A 3LQQA 1IXCA 2TDXA 2KRCA 3OYJA 3RPUD 3SZTA 3T1BA 3GLLA 4Y4RA 2M8GX 2JRMA 2XGXA 1ZREA 3B6AA 2O03A 5B1AH 1TW2A 1BJAA 2BY3A 2QUFA 3GTKJ 4KN4X 4LK1F 3L2CA 1XCVA 3HRUA 3ECOA 5GADJ 4EATA 2UWMA 1WJFA 1QQIA 4XLNF 1FBUA 3KP5A 3I56I 4BKXA 5DUIA 3MN2A 5HODA 1MW7A 3H3UA 5LRSA 4HX8A 2VBYA 2ZJ2A 3TKYA 3L2VA 1GT0C 1EJ9A 1STZA 4IRIA 3GUDA 1Z1DA 2DA3A 3IC7A 2W00A 1FOWA 4KIGA 2Z33A 2BHYA 1K6YA 2E2JJ 5E18F 2IXSA 2HVSA 1MZBA 3LSIA 5FKLA 3S1NJ 3DU5A 3TGNA 3V42A 3DU6A 2LF7A 3VWBA 1SC7A 1BI0A 1HW1A 5E20A 5CJ9A 2G7HA 4HX7A 2I8DA 4PGHA 2XF7A 4ZZLA 1YTYA 2CSOA 1LUJB 4RA2A 1ZRDA 3JAMK 1MBJA 4NC8A 3U9GA 5EG0A 1AU7A 3QOEA 4Y33A 4P96A 4QWQA 3OOUA 2YS9A 5HLGA 2NS0A 4EV0A 4KNYA 2NVYJ 4A3FJ 2FBKA 4ZYEA 3WU0A 3FHZA 1IN5A 3DPLC 3V7RA 2LG4A 3BR3A 1EKEA 1KYWA 3P9KA 4LLGF 3V8LA 1O3RA 2HDCA 5FD6A 1KA8A 2GQQA 2P7VB 2LC2A 5BS6A 2EV0A 1XMKA 1W5CC 3GYHX 3R6SA 4I6ZA 1IV8A 4P9UA 3MZYA 1I50J 3M7GA 4I0BA 4ZZDA 2QSFX 2LOOA 3DWLE 1E3OC 3H5AA 4V19K 2V4JC 4HNUA 2JUCA 2LKPA 3RZDJ 3M07A 4DW6A 4MEYF 1XMXA 5BNGA 2NRAC 2FX0A 2OD5A 3I59A 3JRIA 4N4OB 2XIGA 4PDKA 1ZGAA 3C3WA 3GWZA 2L4MA 3C2GA 3QRFF 3PL8A 3CDLA 4J01A 1TT0A 4DNCA 2HKXA 1DQUA 3T8TA 1VQPI 3ABKH 2VN2A 2M3AA 1BIBA 4ANJA 2HI3A 4O5VA 1IZ1A 5E3NA 2R7DA 4DQ2A 1X1BA 2IA2A 3LSMA 4GCVA 4XKVA 4DYQA 1FOKA 1Z77A 1IN8A 2DCEA 2F5CA 3DEUA 1HCRA 1Z9CA 4XKBA 5K7ZA 1SFOJ 4Q47A 4AC0A 3PNYA 2ZNYA 4P9FA 5DTDA 1L0OC 1VZ0A 2VUMJ 2LTPA 3CJNA 3F21A 2NVXJ 1WJ5A 5EJCA 5HDNA 4JX4A 1T56A 2M4KA 3L9FA 3O8HA 3CP8A 3DTKA 4PSWA 1APLC 3RYRA 2ISZA 3S2HJ 5D6FA 1X2NA 3K1PA 3GCMA 3TOBA 4A0XA 4QTRA 1T33A 2DA1A 3EETA 1R5ID 2MD0A 3ZMVA 1UHMA 3QAHA 2X1EA 1YLFA 3A01A 2KQRA 3U21A 2K3PA 4U88A 4WXCA 1OMIA 1Y8RB 2Z1DA 4CCJA 1PP7U 5GPAA 1WJEA 4F91B 1Y39A 3TBIA 1PJRA 4BDZA 5ICCA 2B7EA 3FBIB 3BCAA 1I3AA 4D7NA 2XRNA 4ENNA 4HF2A 2BVMA 1Z7LA 2VE8A 4BS9A 1C0WA 2HXIA 3HDDA 1RZ4A 2LBFA 3CESA 3K4JA 3CLQA 3JRGA 4HW0A 3CD6I 1SMYF 1YRNB 3DXJF 2TRTA 3C2BA 4LB6B 1OR7A 1V55H 3ZCOA 5IYBJ 3KETA 4HDUA 1FTTA 1R1VA 2KIQA 2ADUA 2KLOA 3GBGA 3LAPA 3BPVA 1UCRA 4UNOA 5E1WA 2R7FA 2XAGA 1WQ2A 1FY7A 5HOOA 4UVBA 2HS5A 3S93A 2CUZA 1K78B 2DK5A 2MG4A 2XPWA 2JQ7A 2CQQA 3MQ0A 1Z67A 1AKHB 3L09A 5LEJA 1ZGJA 3DQVC 4I02A 4A5NA 1FBQA 2CW0F 3RI4A 3CDIA 1WZ2A 3CF2A 3EUKL 2GOMA 4OMYA 2OTJI 2MLKA 4XRSA 1G6NA 3I64A 1FX7A 4B09A 2DDAA 4BEHB 5F1JA 1FTZA 2JRTA 1ON2A 3J81K 2LP0A 3L7WA 3KZZA 4BNCA 1T98A 2CUEA 3DTIA 4CICA 2FD5A 4F7ZA 4G6TB 4L9TA 2RAEA 1WWXA 1R7JA 3PUFA 2ETHA 1G59A 2DU9A 2XAFA 3KEOA 4PJMA 1FWZA 2H27A 4OU0A 4XNFA 5KVRA 4C30A 2ELKA 4UB8C 1ACIA 2P5KA 3IKTA 1UFMA 4C3JJ 2G7UA 2M30A 2JN6A 1RUNA 1U8BA 4IHSA 1V54H 1T0FA 4XN0A 4C3IJ 1GVJA 3J80Z 3D5LA 4CCLA 3K6GA 3GW2A 2DJNA 3N05A 3QPHA 4FCYA 2HPMA 3OYHA 1RR7A 5J8CA 2F5VA 2GOXB 3ISPA 3K4MA 1KU3A 1TLHB 1XS9A 1ZAOA 2DK8A 2ESHA 1MBEA 3WE2A 1LNWA 5FGMA 3IWZA 3QYBA 2NVUB 1SFUA 1F5TA 4HG2A 4CCOA 3TP3A 1VQ9I 4HF1A 4OWRB 3WGIA 1H89C 2X6WA 3QPLA 4A3MJ 1ULYA 2EB7A 1WJDA 1KQ8A 3S3OA 2L4AA 2VJJA 2JWTA 2RQPA 2O8XA 3KPHA 4ZH4F 3OS2A 2BZTA 3CUQB 1B72B 5A2QK 3W2AA 3ZXSA 3TDUC 3LQRA 3O3KA 5KAIC 4LG0A 1R4MB 4G9YA 1LB2A 2CJJA 2HWVA 2QENA 4EQQA 3HBLA 1LE8A 4M9ZA 2XB5A 1MSEC 1IN7A 3GTLJ 3W2VA 1WPKA 4OMZA 2EK5A 3IH3A 4G7HF 4UUVA 1AHDP 1U8RA 3C2HA 3ESWB 1D5VA 1J9IA 5AIQA 4CO8A 5CVJA 1IUFA 1IW7F 3DCFA 3RCOA 4IO9F 1Y1WJ 1TW3A 2DYRH 3TO7A 3MMYB 1YOVB 1XGSA 4GO1A 3MZHA 4F92B 3OIOA 4L0YB 2A05A 1EF4A 2QM3A 5KK1A 3E5XA 2ZJPF 2EPFA 5IT9K 2OQRA 5FO5A 1NK2P 4Z6YA 1VQMI 3D5RC 2P6TA 1IGNA 3BPXA 4NQWA 4EMSA 5F6FA 4B48A 4XIDA 2H8WA 3A0BC 2CH0A 2DFHA 1NH3A 1FBSA 2HQRA 4OOIA 1Y0UA 1ZELA 1KQ9A 2WAFA 4BDYA 2A6TA 2DQRA 2CG4A 4D0PA 3FKIJ 4KIBA 1NG6A 2IS2A 1RUOA 2XKPA 2LLKA 2FXAA 2LNBA 2EFPA 1F1ZA 2CQNA 1S8NA 2XAQA 4U7BA 1GLNA 2W4SA 3ZR8X 5FKOA 1ZR2A 5HS7A 1P9QC 3G1OA 4JQFA 1R5HA 4UUTA 4HNTA 2ZKZA 1IF1A 2DA2A 3I53A 3V7CA 3BR5A 2VE9A 1QZZA 2EFNA 3R61A 4RM2A 5IPAA 2R7TA 2DDBA 5GAGJ 2IS6A 3ML6A 1FJLA 4CDGA 4S0HB 2BVLA 5JR3A 1RKWA 5DYMA 3BTLA 1SEUA 2FU4A 3U1KA 3DV8A 1DP7P 1QNTA 5IOZA 4A0YA 3GXOA 1W0UA 3L2RA 3WU1B 4A69C 1T39A 3IUOA 1MBHA 1K4TA 2MC4A 2IW5A 4HQMA 2D1VA 4KICA 2IPQX 3D1NI 3GTPJ 3WGHA 3JSOA 3QPSA 3IHUA 3OYCA 3QOPA 1ZG5A 4AIDA 1IXRC 3H1CA 5JVGF 4GXOA 4XKWA 3DP7A 3RQ4A 2MFZA 3HPGA 1S5LC 3BY6A 1B9NA 3SYTA 1FOYA 1YG2A 2E1MB 4MIMA 3V8JA 2CMPA 4NUBA 1TQMA 2HQAA 2ZMEB 1I1SA 5B5EC 4XMYA 3FXOA 4M72A 1FLIA 1RI7A 1RESA 1MGTA 3OV8A 4FETA 4PZJA 2BW3A 3LL7A 5JLXA 1QVTA 3H3ZA 4E7SA 5B3SH 4WF2A 2STWA 2CRGA 4AD9A 3JAMZ 2IA0A 5ED4A 1A35A 2ZBKA 1MMDA 2OU2A 4ENMA 3B02A 2J5PA 3HKZA 1W1WE 4MQ9F 4EJOA 3FXJA 4DYCA 2IGOA 4DZJA 3GF2A 4DBRA 1GV5A 3FXKA 1B4AA 3DLAA 3F8MA 2QBYA 4KISA 3KP2A 1VQ7I 2R3SA 5FKKA 4N4NB 1WKMA 1E3PA 3HHHA 3AL0B 2VC0A 1IDZA 2KJBA 3K10A 1USTA 2GBYA 2DOAA 1A6QA 4XRFA 1TQPA 4GYGA 4KMUX 3QU6A 1MD0A 4IHXA 4ZC3A 3S3MA 3K2AA 2L7KA 2XHKA 2JZYA 3OYGA 2M5WA 2N8GA 4WWCA 5CPRB 1D1CA 1FMVA 3T5XA 3PIPF 3BTCA 2HDDA 3CJQB 3CUQC 4I0AA 4JP0A 1VQ4I 2E7XA 2AQEA 2P6SA 5DCFA 4LIVA 1W7PA 3GTGJ 4DGWB 1FC3A 3OIQA 2HZTA 3SFIA 4QPOA 3OMYA 2YX7A 2R7RA 4I09A 2EFOA 3RKWA 1VI0A 3PQJA 2GXGA 2FBHA 3FWEA 5DM6F 2DLLA 4AVZA 3SXYA 1EH7A 2QA4I 3LSGA 3KP4A 1RC9A 1W7PD 4A93J 1ZK8A 2DN0A 1SVLA 2L0KA 2LR8A 2EINH 1LFPA 1HSTA 3HOZJ 1GXQA 4A3CJ 2DOFA 3KP3A 2DA5A 3CF5F 1HW5A 3L2WA 3IKVA 2L02A 5J8FA 2R4GA 1U5TA 2RC4A 3CCSI 5DCMB 1JKOC 3F22A 1ZG1A 4MTDA 2F5EA 2HR3A 2F2EA 1B8IA 3V4GA 3D5SC 2L7MP 3OYEA 1ETYA 4EGYA 3BR1A 1RPWA 3GFJA 3KZIC 2DMQA 3W6KB 1GVDA 2KMUA 2VC1A 3DLLF 4R1HA 4XLCA 3DKXA 3I59B 5CVIA 1ENHA 1XGOA 1XGNA 2L3DA 2WB1A 4ENKA 1JHHA 2UZKA 3WU2C 3ZOBA 1J2XA 1ZN2A 4LD5A 1T2KA 2XGEA 4WCGA 5EGOA 1EA3A 1IJWC 5F04A 4BHPA 4PJ0C 4L18B 3CCQI 5BMZA 2VQCA 3MVPA 1S29A 4KIFA 1OFCX 3VPRA 1E17A 1LVAA 2JA2A 2Y31A 2Y9ZA 1LDKB 3CCYA 4CYCA 2CUFA 3HSEA 3S1QJ 1U9OA 1FNNA 5DV5A 2KJCA 3P9CA 3G4SI 3LFKA 5FKMA 3X2QH 1FSHA 1D5YA 5DDGA 3IH4A 4A3KJ 2FOWA 5DUKA 4BQAA 1OPCA 2FBIA 1IRXA 2DA7A 2YU3A 2DAOA 4YIRX 1HBXG 1B59A 3H92A 3IAM2 4UXNA 2MH9A 1MDMB 3BJOA 3WHBA 2XROA 3GTQJ 3J81Z 1WJAA 5IYCJ 1K7AA 4KFCA 2H09A 3I58A 3AG1H 1BW5A 2COBA 2HYJA 2Z9OA 4LLNA 2KP6A 1ERDA 3HSRA 2HVQA 2YPRA 3HGYA 1UJ8A 3WODF 2LY9A 2VL8A 2P8TA 4XICA 4R8HA 5HS9A 5TISC 4ESJA 2L54A 2RNGA 3EUAA 3OYMA 4DJAA 4J00A 2ZMEC 2AS5F 5E3MA 1HKQA 4YFKF 5TRDA 3QP6A 3NEUA 1BI1A 3F6VA 3FMQA 3A2KA 2G0EA 3ABMH 2NOGA 2LBFB 5FRMA 2XAHA 4G12A 1BOAA 2V9PA 3E6BA 2WC2A 3T8RA 2JVGA 3WTVC 1W4MA 1GV2A 1MJ9A 3HZJA 3BROA 3GFMA 2L9SA 4LLLA 3ZMDA 4BQOA 4W97A 3ERED 3DBRB 1ZR4A 3IWFA 3QQAA 2H94A 2HZDA 3PFYA 1ETVA 3DBHB 1MMSA 4IF4A 2OTLI 2W1OA 3ZQLA 2CGPA 3BR6A 4M3DA 5B1BH 5HVQC 4BHBA 1OCTC 1XN7A 1VF9A 1R71A 3AL0C 2XSJC 4EJVA 1R9TJ 3JTGA 1I3QJ 1YE9A 2BYVE 2DO7A 2K3FA 3HUGA 3ZQIA 5JHUA 4AIKA 5A2QZ 1USSA 3P7NA 4U0VA 3MEXA 3K4CA 4G6DA 2FEZA 4AIJA 5J1RA 3QWLA 1N25A 2GZWA 2OZ6A 1N75A 2WAQA 2C6YA 2R7WA 3QYFA 4WK8F 2DMNA 2IS4A 1QO0D 3ECHA 3H35A 2FF4A 4F55A 5TJJA 3KIOA 3RJPA 1BN5A 2LD5A 1A04A 1QVUA 3F72A 1J7KA 4P55A 1QU3A 1TT5B 2QGUA 3M1CA 3Q0VA 4OINF 4ZTJA 4S05A 2D1HA 3K1NA 3VSKA 1B6AA 2HOSA 2L01A 2JA5J 2HTSA 2EV5A 5GP9A 4FASD 3WE3A 2EZHA 5IT9Z 2VI6A 1KONA 1WGXA 2VXDA 1X2MA 3I0TA 3ZMUA 4ZDLA 2HVRA 1FOXA 4JOMA 2FMYA 2X6YA 1S3JA 1IDYA 2A6EF 2VKDA 3DBLB 4XONA 2K02A 1JXSA 1PUFB 3FISA 2V7FA 4CYDA 1WFXA 4BE1A 1R1TA 4YELA 2PBIA 3BCBA 3PFIA 1YX3A 1TNTA 4CSWA 5F08A 2Z5UA 1X1AA 2DTZA 2UV1A 3FXQA 3DPUA 3H36A 2NVQJ 2NS8A 4Y13A 2DW4A 2PFBA 3HXLA 4DYRA 2M7AA 4MNUA 1ZKGA 2OF7A 1SVOA 3PSIA 4FTHA 2IT0A 1N78A 1WH5A 4LJZF 2YU9J 1D8JA 4I7HA 3CCMI 2EZKA 3DKWA 4RS8A 1CF7B 2PJRB 1V5FA 2R92J 4JBAA 2P7CB 4XOPA 4BQQA 3DFGA 2QSHX 3ABTA 2ZO4A 1UB9A 3CO7C 2QVOA 1VQNI 3FK6A 4WX9A 2JVHA 3BLYA 1DDNA 4HNVA 3E1SA 2K9LA 5JHFA 3AAFA 3QPTA 5M3MJ 1UELB 1LPQA 4HRIA 1YIOA 3I4NJ 2LYCA 3CCLI 3CDHA 4FX0A 3B73A 3RQIA 3KX2A 5HLTA 2PMHA 4LFUA 3GTMJ 2PEXA 3TO6A 1YW7A 1T95A 1XX5A 2KPMA 2VB6A 1G3WA 4QSHA 2ZSIB 2IGNA 4A6DA 3HC7A 2OQGA 1OCCH 1V4RA 2XAUA 4BUPA 1OCZH 5K5RA 1IRGA 3CUOA 2LF8A 2BGCA 3O6BB 2V1UA 2JK3A 1P4AA 4NQWB 1AOYA 2DMTA 5H6RA 4A3IJ 3GZ5A 1FZPB 2R7SA 3AFHA 5LHIA 2ZJRF 4UUSA 2QQ9A 2VBZA 2HQNA 3E6MA 1I1GA 3GVAA 3I71A 3Q9SA 4M74A 2NXNB 4YRVA 5LGUA 5LEKA 4Z2YA 2OBPA 1RETA 5FLVA 4ENJA 4CZZA 3KZYA 3ZN0A 4U0YA 2DA6A 3CLOA 3GFLA 1ON1A 4L5IA 4M9XA 4RGUA 2X6XA 3G71I 2V1XA 3HGGA 4I76A 4C2TA 1PVEA 1DUXC 3PO3J 5FROA 5M3FJ 2I5UA 5EYRA 3FM3A 3I55I 2EA4A 2P5LC 1JT6A 2YSRA 2Z2SB 3BG6A 3L1PA 2CUJA 2GIZA 3MD2A 5J3LA 4PCQA 4KT5C 1GXPA 2BXZA 4O6JA 4GFBA 4RLFA 1X3UA 4TV7A 2M0CA 2CV1A 4UV9A 3WTWC 4JX5A 3OR1C 3CJTB 3PQKA 5LD2C 1JTYA 5KHDA 1Q1VA 2FRHA 2GAUA 1MIJA 2HYFA 3E6DA 5M5WJ 4E7IA 5E1ZB 1TWCJ 4HA8A 4XLHA 2VODA 3BWGA 4Y52J 3K69A 3E7LA 3KE2A 2KDOA 4XL9A 2FUG2 2L7FP 4HSTA 2QKLB 4M9SA 1MMNA 4B4CA 1OYYA 3HL2A 4M3EA 1REPC 1SFXA 2DMPA 1ZLJA 4H0EA 4ZJZA 1LEBA 4D7MA 4D5CA 1I39A 1NTCA 5F0HA 5EEGA 2WAEA 1YW8A 3KLNA 3NAUA 3BDDA 2A61A 3HPHA 1HDDC 4UY8I 4PFOA 2NVTJ 2MC3A 3VEPA 4S04A 3NWSA 1DP3A 4G7OF 2ZSHB 4C9YA 3H3VK 2FNPA 2OV7A 1X4PA 1S6LA 2W7NA 3BZKA 3ZMZA 1QPMA 1ZGWA 4RGSA 5E3OA 4ZTFA 2YUSA 3TOAA 1H9GA 1JUSA 1WH7A 1ZARA 2ZB9A 4P5OA 3ZMSA 3I5UA 1O4XA 1ZLKA 1X3ZB 2LVSA 4HAMA 2QZ8A 2LMDA 4MLOA 2Q8KA 3OYBA 1YJWI 4DOZA 2DBBA 4GYIA 4RBOA 3S8PA 4EEFG 3Q5FA 1VQLI 2ZXIA 2BY1A 1WI9A 3BR0A 3K0LA 3MCZA 4RAYA 4OIQF 2FE3A 1R36A 5CYVA 4IHYA 2JPCA 1HF0A 4ZYGA 1BOBA 4BGDA 4LMYA 1VQ8I 3FXUA 1E3HA 3R0AA 1ONVA 2Q1ZB 3IL2A 3CCJI 2X51A 3O8GA 2R7QA 2ID6A 2P81A 2Y48A 1Z0XA 4DZPA 2LDUA 1JUMA 3QODA 1IN4A 4A0ZA 5DD4A 4K2EA 5C44J 1E0EA 1KGSA 4L5JA 4AUXA 2JJ7A 1KQ0A 1V5EA 2DQLA 4BAYA 2B0LA 1IO2A 3FXLA 3ZQHA 1D0XA 2Y0SA 4AU7A 4A3GJ 2E5NA 3HIFA 3RKQA 2ZXWH 3JRAA 1W7PB 2JMWA 2V6CA 2V6EA 2KL4A 1DGWY 2KRHA 3DPTA 1SANA 3R60A 1JI8A 1MJAA 2EZLA 1Z3YA 5EZGA 2VOOA 1DU6A 1ZG3A 2X6OA 2QLZA 1X1CA 3LFUA 1MJBA 2PI0A 2MW8A 3K2ZA 1G8XA 2ISYA 1YYVA 1IAWA 4UV8A 2M9HA 3F23A 1FYLA 4BE2A 4BACA 3BP8A 3I4PA 2VQGA 2A5WA 3CC2I 4FISA 3CMEI 3GZ6A 2L2OA 3BG5A 5L3CA 1U5TB 2A5YB 2QKMB 4IHWA 2KIMA 1ITYA 2OC6A 4C3HJ 1YS6A 3LOCA 2L9NA 3G73A 4IJAA 2IS1A 4MFEA 4RDUA 4BE0A 2O3FA 4EVIA 2OCEA 3HTSB 4EGZA 4HPQA 4EJTA 1MH3A 3MZ8A 3VB2A 1HW2A 5JLWA 2KKOA 3ZQGA 3HOXJ 1PDNC 2FQ4A 3PO2J 2VQHA 4XKCA 4RB0A 3FXRA 4BXXJ 3OL4A 4L9JA 3ROUA 3BOQA 1T08B 1R58A 2MH2A 4CXFA 3AG4H 5FFZA 1YFHA 2Q2EB 1D0YA 3QYEA 2CWEA 2NAZA 1OISA 1QGPA 2AQFA 1LDJA 3EYYA 2IP2A 4GDFA 2BV6A 1P6RA 1E2XA 3F8BA 1BI2A 2KZVA 4E4HA 2V79A 5EGOB 2KISA 4PK4A 5IY5H 4A3JJ 2QQ8A 2V26A 3G3ZA 3CZ6A 1LVKA 1X1DA 2FSWA 2LSOA 1Z6TA 4HSRA 4ABZA 2Y30A 1O7LA 4N0BA 1QPIA 2JA7J 2PG4A 4M3GA 3WG7H 3GTJJ 3LA2A 1Y0NA 3BJAA 4FE7A 3C7JA 5IP6A 2QF7A 2RNJA 3HJEA 3F6OA 4FQGA 1FYKA 1JKPC 2HFHA 3V7SA 2ZFWA 3H5RA 1OJLA 5KCMA 5GTHC 3HOSA 1UAAA 3MKWB 3HKZN 3BG7A 2HTJA 1F4KA 5ERIA 1Y1VJ 2AXLA 3IV5A 3I54A 3A1YA 1L3LA 2VONA 4A3BJ 3M4OJ 2VPLA 4AYBA 1YITI 3GZNB 3W3CA 2RV8A 2VJ5A 4MGRA 3A02A 2DT7B 2VT3A 4EM0B 1IRZA 2EJRA 2M7BA 9ANTA 5JI6A 2GXAA 2M1BA 2DI3A 3E5UA 3WGGA 5HS8A 1W0TA 1IXSB 3RKXA 1EH8A 4BEHA 3TL4X 1HKTA 2PMZA 4YFXF 4IX7A 5GPCA 1XPXA 2XASA 4XBFA 2GLOA 2W85A 2W57A 4IQJA 3QU3A 2WWYA 1D0ZA 1NK3P 2Z99A 2EZIA 5F0FA 2EH3A 3L2QA 5K7HA 4HX4A 4NHJA 4MHGA
chains in the Genus database with same CATH topology
3OYDA 4XKBA 3DTEA 2RNGA 3EUAA 3OYMA 4DJAA 4J00A 2CV2A 3PNYA 1BR2A 3K4KA 4CH7A 3L2UA 1VZ0A 3K4NA 4RMNA 4R79A 4D1QA 2PJRA 1WJ5A 3A2KA 3G2BA 2M4KA 1MMAA 3CP8A 3DTKA 4PSWA 2LBFB 3VYRB 5FRMA 3HUGB 2XF5A 3OYNA 3RTRA 2MD0A 1WJCA 4RLQA 2X1EA 2JVGA 2KQRA 3OL3A 4KT6A 3PNVA 3F9KA 3IAS2 3U21A 2K3PA 2CS3A 2L9SA 4BQOA 2Z1DA 4CCJA 1WJEA 4F91B 2HZDA 2P0WA 3PFYA 2R7XA 4E7HA 4XOTA 3TBIA 1PJRA 2W1OA 4BDZA 3K70C 1TZLA 3FBIB 2E60A 3BCAA 1V5GA 5HVQC 1YX5A 1WJBA 3AL0C 2XSJC 2BVMA 1Z7LA 4BS9A 2KHMA 2LBFA 3CESA 3K4JA 4P1WA 1YE9A 2V9KA 2XF6A 3VSLA 3K4CA 2XDVA 4F52A 4BL0B 3OYLA 3PSFA 3ZCOA 4CCKA 2WAQA 1N75A 2KLOA 3GBGA 2R7WA 3QYFA 1BR4A 3H9GA 3W2WA 1DGRM 2IS4A 5HOOA 3H35A 3S93A 2CUZA 4F55A 3CJRB 2MYSA 2L5QA 1QU3A 3M1CA 1NG7A 4E6KG 2RQQA 4ZTJA 3K70D 3DQVC 3LSHA 3H5NA 3VSKA 1HA8A 3CF2A 4BJ5C 3EUKL 4IQ4A 2NOJB 1Y6IA 2GOMA 4FASD 1N77A 4KITB 3PUBA 1KONA 2VXDA 4BEHB 3UR3C 3VYSB 3K4BA 4ZDLA 2HVRA 4JOMA 2VKDA 2X6YA 4XONA 3ZQQA 3DTIA 4IKFA 1SAUA 1SFKA 2V7FA 4G6TB 2VKHA 1WFXA 5CQGA 4BE1A 2DJIA 4YELA 4E7LA 1G59A 3BCBA 2DT6A 2RREA 1YX3A 5FRNA 4CSWA 4PJMA 1MNEA 1X1AA 2UV1A 3I3LA 4XNFA 3DPUA 4DBQA 2WADA 4C30A 2K5CA 4NNJA 3HXLA 3SDBA 2M7AA 3NWTA 2CW7A 3OIPA 4OAZA 4OAYA 3J7AY 4XN0A 4BXFA 3PSIA 5CKTA 3SEQA 1N78A 3D5LA 4CCLA 3K6GA 2PJRB 1V5FA 2CFOA 2X85A 3N05A 4XOPA 4BQQA 2HPMA 3OYHA 4NC7A 2F5VA 2GOXB 2MABA 2O5RA 2WY7Q 3K4MA 1W36C 3DKYA 2JVHA 4PFPA 3BLYA 4XLEA 3E1SA 2K9LA 5JHFA 3QYBA 4HG2A 4CCOA 1UELB 4HRIA 2LY2A 4OWRB 4C2UA 2X6WA 4BQNA 2LYCA 2V1NA 3H9QA 1WJDA 4B44A 4CCMA 3OY9A 3S3OA 2E1MC 3KX2A 5HLTA 2VJJA 2X1CA 2F6CA 4XORA 4BU2A 1T95A 2KPMA 1BR1A 3OS2A 2VB6A 2ZSIB 2IGNA 3ONQA 4PUSA 3W2AA 1R6RA 3HC7A 3ZXSA 4B43A 4PSXA 5KNLA 2XAUA 4BUPA 2CV0A 4LITA 4XQFA 4NQWB 1AA7A 3W2VA 2HDWA 2R7SA 3EUHC 3AFHA 3C2HA 4LIUA 4CZCA 1D1BA 1S9HA 3RCOA 4YRVA 3UNGC 3MMYB 3A4CA 4F92B 2CW8A 3PJRA 3MKYB 2X6XA 4E7JA 3OR2C 4C2TA 1MNDA 3KYLA 3D5RC 3K4LA 1QHGA 4X0GA 5FROA 4XR6A 4B48A 4LG3A 1FMWA 2W82A 2CH0A 4IZZA 2Z2SB 3BG6A 2CUJA 3MD2A 4HEA2 3TMOA 1ZELA 2WAFA 4BDYA 2A6TA 2LY1A 4RLFA 1PYVA 3M8JA 1Y56A 1NG6A 2CV1A 2IS2A 4F93B 4U7BA 2ZXHA 2HNHA 3OR1C 1GLNA 2W4SA 5LD2C 4ZDPA 3E0JB 3I9V2 5KHDA 3ZR8X 1MMGA 1P9QC 4JQFA 3S32A 4E7IA 2VJIA 4XLHA 4HNTA 4PJLA 4PJJA 2KDOA 3SZGA 4XL9A 2FUG2 4HSTA 2QKLB 1MMNA 2R7OA 4RM2A 3HL2A 3HG9A 2Z16A 2R7TA 4Y3OA 2IS6A 4XLAA 4XM3A 4ZJZA 2VIXA 2BVLA 3PNTA 4E7ZA 4XLFA 2WAEA 4PJNA 3OS0A 2M4GA 3IP4B 3HPHA 5LFAA 3BC8A 4PFOA 2BOLA 2LRDA 4B47A 3NWSA 1DP3A 4KJZA 2ZSHB 4C9YA 3L2RA 3IUOA 2OV7A 1X4PA 2W7NA 2MC4A 2WA0A 3S3NA 3OYCA 3H0DA 4ZTFA 2E5ZA 4P5OA 4XKWA 3RQ4A 2MFZA 3HPGA 4CCNA 4MLOA 3OYBA 4U87A 3CMMA 5HNHA 3SYTA 1Z21A 2X1DA 4DOZA 2WBMA 4II3A 2E1MB 4D9JA 3LMMA 3S8PA 5TGTA 2CMPA 2ZXIA 4NUBA 2VJ4A 1Z3XA 2HQAA 4XMYA 5CQEA 2IGKA 2HPIA 4YEJA 1BOBA 4BGDA 3AKZA 4FETA 2BW3A 2Q1ZB 3LL7A 5HNFA 2X51A 3ZRGA 2R7QA 3FKJA 4E7SA 3QODA 4CA0A 3ZGKA 4ITVA 1MMDA 1E0EA 3HKZA 2VLAA 3OYKA 4GRIA 1V5EA 2LREA 3VDXA 1D0XA 2IGOA 2Y0SA 4AU7A 2E5NA 4DBRA 2ELJA 2XC7A 3DLAA 1X19A 2V6EA 1W36D 2OUMA 2KL4A 1DGWY 4XN3A 4BJTA 4KISA 2KRHA 3DPTA 3FDYA 3OYFA 4N4NB 1JI8A 3RSNA 3AL0B 1Z3YA 2HU9A 3SEZA 2WY8Q 3K10A 2LH9A 1X1CA 3LFUA 2DOAA 4F3QA 1QHHD 3HOTA 1OLTA 1G8XA 4ZC3A 3S3MA 2JUGA 2L7KA 3OYGA 4E7KA 2IGMA 4RM3A 2JSPA 4QPQA 4BACA 5CPRB 4BE2A 1D1CA 1FMVA 2VQGA 2A5WA 2F4IA 3CJQB 1U0JA 2DXIA 2AQEA 2L2OA 4LIVA 4DGWB 4ZYAA 2KRCA 2QKMB 3OIQA 3OYJA 3RPUD 4QPOA 3OMYA 2OC6A 2R7RA 4Y4RA 2L9NA 2IS1A 4BE0A 3MKZA 1OR7C 3VYUB 4AVZA 4HPQA 3CP2A 3LSGA 2UWMA 4EATA 1WJFA 3OWTA 2UUZA 1LFPA 2VQHA 4XKCA 1MW7A 3OL4A 3L2VA 1D1AA 2K9MA 1D0YA 2Q2EB 3QYEA 3L2WA 2R4GA 2AQFA 2W00A 1J09A 2KZVA 1K6YA 2HVSA 2IXSA 4E4HA 3LSIA 3FBNB 3DU5A 2VQLA 4PK4A 2V26A 3V42A 3DU6A 4B3XA 3CZ6A 2VASA 1LVKA 1X1DA 3D5SC 3OYEA 3VWBA 4II2A 4HSRA 2I8DA 2XF7A 1X4OA 2KMUA 4NC8A 2M0MA 2BW3B 3EPZA 3QOEA 4DIQA 4XLCA 4Y33A 3H5RA 3DKXA 3OOUA 5KCMA 3HOSA 1UAAA 3MKWB 3BG7A 4H4KC 3H9JA 2WB1A 3DPLC 2LG4A 2R7VA 1LKXA 3VYTB 1EA3A 3A1YA 1T0FC 2LC2A 2VPLA 4AYBA 2VQCA 3W3CA 2VJ5A 4CUGA 2JA2A 2DT7B 3LSKA 1LDKB 2LOOA 3DWLE 2M7BA 3OYAA 3H5AA 2R7UA 2V4JC 4HNUA 4BEHA 3OYIA 3TL4X 3KEYA 2PMZA 4N4OB 4IX7A 1IRXA 2ZFUA 3C2GA 2VXZA 3IAM2 3PL8A 4J01A 1TT0A 4IQJA 1D0ZA 4ZDOA 1DQUA 1WJAA 4ANJA 2M3AA 1X1BA 2KP6A 3LSMA 1UG0A 3L2QA 1ERDA 3DEEA 4XKVA 2HVQA 2DCEA 3OS1A 2VL8A 4BJ6C 3FHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K6Y A;  1WJA A;  1WJF A;  3HPG A;  4F3Q A;  3F9K A;  1MW7 A;  3HPH A;  1WJE A;  1E0E A;  1KON A;  1LFP A;  1WJB A;  1WJD A;  1WJC A; 
#chains in the Genus database with same CATH topology
 3BQZ A;  1H0M A;  3DTE A;  5E3L A;  2X4H A;  2HQ5 A;  2OA4 A;  5L3G A;  2XB0 X;  1XMA A;  5HDG A;  3K4K A;  4CH7 A;  4R79 A;  4D1Q A;  2ECC A;  1T38 A;  4XSZ F;  2DA4 A;  4G8X A;  4ON0 A;  2GXB A;  4Q48 A;  4WXH A;  3HUG B;  5CVU A;  3LSP A;  2XF5 A;  3F0C A;  3RTR A;  4GGG A;  2HYG D;  2IBD A;  4RLQ A;  2ZJQ F;  2M8E A;  5ILS A;  3OL3 A;  4KT6 A;  3PNV A;  3F9K A;  3IAS 2;  1VQ5 I;  2CS3 A;  5C3E J;  3M8E A;  3S1R J;  1TNS A;  3GFI A;  4UB6 C;  3K1M A;  4ESF A;  1PUE E;  2ELH A;  4E7H A;  4XOT A;  5DM7 F;  3K70 C;  2BHZ A;  3CUQ A;  2E60 A;  1TC3 C;  2EWN A;  4U7D A;  4KMF A;  1YX5 A;  1ZYR F;  4JYK A;  1XSV A;  3N4M A;  2A6H F;  2ESN A;  3BZC A;  3VSL A;  2OAZ A;  4I98 B;  1RRJ A;  2XDV A;  2PJP A;  1XDS A;  2W25 A;  4F52 A;  4BL0 B;  5DD8 A;  5EG0 B;  1P4X A;  5FLX K;  2K9S A;  2PN6 A;  4M73 A;  1BR4 A;  2WB1 N;  3H9G A;  3W2W A;  2BBY A;  1W5T A;  2CO5 A;  2JA8 J;  3HOY J;  2NS7 A;  2UXX A;  1OKR A;  5EEA A;  2MYS A;  1QZY A;  2ZNZ A;  1I5Z A;  2L5Q A;  1NG7 A;  1XCB A;  4N9H A;  4E6K G;  4MFD A;  5M5Y J;  3LNQ A;  5K5O A;  5K7F A;  3K70 D;  3LSH A;  3H5N A;  2EBI A;  1EH6 A;  4KN7 X;  4Y7N J;  2QQA A;  3FX3 A;  4BJ5 C;  4IQ4 A;  2NOJ B;  2EFW A;  3RDI A;  4HBL A;  3UKG A;  2E1C A;  1A5J A;  3GLX A;  1N77 A;  4KIT B;  1ORK A;  1XD7 A;  3PUB A;  2ACJ A;  4L0Z B;  2IAI A;  2O7O A;  3JRC A;  2ICW G;  4OIP F;  3UR3 C;  3MAJ A;  1JGG A;  4W1U A;  5K5Q A;  2EV6 A;  1DPR A;  2K86 A;  3HRS A;  4IKF A;  1SFK A;  3BTI A;  3MFK A;  1SD6 A;  5CQG A;  4BXU A;  2DJI A;  3F8C A;  2XRL A;  4E7L A;  2E36 A;  2DT6 A;  2RRE A;  5FRN A;  2OCC H;  5LRR A;  2EFQ A;  3JR9 A;  3I3L A;  4DBQ A;  2WAD A;  1P2F A;  5BQT A;  1H8A C;  3M3Y J;  4NNJ A;  1VQO I;  3SDB A;  1H9T A;  2BXY A;  2CW7 A;  4OAZ A;  2E1N A;  4ETS A;  2M2E A;  4YII A;  5CKT A;  4RAZ A;  2UXN A;  3P5J A;  5FFX A;  4BY1 J;  4IOC F;  3TQN A;  4JK1 X;  4M6Y A;  1XSX A;  2X85 A;  2BY0 A;  1RIO H;  2MAB A;  2W48 A;  3LA7 A;  5D4R A;  3ASN H;  3DKY A;  1W36 C;  4M6V A;  3A01 B;  2H1K A;  3KFW X;  2MA3 A;  2MSY A;  3E3V A;  4BQN A;  4B44 A;  3H9Q A;  4CCM A;  5ICE A;  2E1M C;  2QWW A;  5C4J J;  1K83 J;  2X1C A;  4ZYH A;  4XOR A;  3MWM A;  3Q0W A;  1G3S A;  2D5V A;  3W6J B;  1K4S A;  3TW6 A;  1W5S A;  3ONQ A;  2KRF A;  1Y8Q B;  1R6R A;  4QIW N;  2JA6 J;  4B43 A;  3OSF A;  2BEO A;  5KNL A;  2BY2 A;  4HZF A;  2CV0 A;  1ZQ3 P;  2XAJ A;  3R0J A;  4XQF A;  1TWF J;  5J4V A;  5E79 C;  3FMR A;  3S17 J;  2ZME A;  2AHQ A;  2WAQ N;  2YR2 A;  1U78 A;  3HOW J;  4G94 A;  2HDW A;  4MTE A;  3EUH C;  5C4X J;  4LIU A;  4Q4Z F;  3J7Y J;  1XB4 A;  1D1B A;  2R5Y A;  4BYY A;  2DYS H;  2R5Z A;  1RNL A;  3UNG C;  5D5U B;  3VFZ A;  3A4C A;  5LGN A;  2FJ1 A;  4C2M J;  2OPT A;  1SMT A;  3FMS A;  1U2W A;  4HF0 A;  3S2W A;  3PJR A;  4HYE A;  3BJ6 A;  5BPI A;  3MKY B;  3HYI A;  5DS9 A;  4B3A A;  3PIO F;  4E7J A;  3OR2 C;  4XK4 A;  1MND A;  3KYL A;  1G4D A;  1QHG A;  3CCU I;  1IG7 A;  4XR6 A;  1MBF A;  1GHC A;  3FIW A;  4LG3 A;  3SDG A;  4A6E A;  4IZZ A;  1I27 A;  1LQ1 A;  1ZRC A;  4OIO F;  1J59 A;  3TP0 A;  1XSD A;  2IA1 A;  4M3B A;  1JJ8 C;  1ZH5 A;  1HQC A;  2XPU A;  4IHV A;  4FE4 A;  3M8J A;  1ZHF A;  1G3T A;  5D5X B;  2HNH A;  3HTU A;  2X48 A;  3E0J B;  1G3Y A;  2GA2 A;  1ETW A;  3C18 A;  3S32 A;  1SFE A;  2E34 A;  1R49 A;  1QA6 A;  3HEF A;  1OYW A;  4L5E A;  4M71 A;  1P7J A;  4PJJ A;  1X58 A;  3KP7 A;  3WTZ A;  5BOX A;  3SZG A;  1KU2 A;  1KYZ A;  5E1X A;  1YS7 A;  2R7O A;  5H20 A;  2WV0 A;  3OSG A;  2O61 A;  1IV6 A;  1EV7 A;  5CVV A;  3JRE A;  1AWC A;  4Y3O A;  4HOB A;  5EZH A;  2DOD A;  4UVC A;  3LA3 A;  1B1B A;  3M9A A;  3CC4 I;  1F36 A;  1HDP A;  1FP2 A;  2H1L A;  2XGD A;  5AIP A;  1KZH A;  3J7A O;  2RGV A;  4PJN A;  5HLI A;  2F5D A;  1YJN I;  4V2F A;  1JKR C;  2BOL A;  3GME A;  4B47 A;  1UZC A;  3HOV J;  2VT2 A;  4KJZ A;  2EQR A;  2IVM A;  1BIA A;  2MGQ A;  1Z6R A;  2HOE A;  5AON A;  2FOK A;  3H0D A;  1BM9 A;  2CFX A;  5LBQ A;  5M5X J;  2X0L A;  2E5Z A;  1JJ6 C;  2TCT A;  1U6G A;  5DCM A;  2PX9 A;  5LHH A;  4U87 A;  3CMM A;  5HNH A;  3BZ6 A;  1Z21 A;  4LG0 B;  2WBM A;  5GAE J;  5B66 C;  1WHU A;  1LE8 B;  1Q1H A;  2COM A;  5EDN A;  3N97 A;  1JTX A;  2VJ4 A;  1Z3X A;  3GO5 A;  2HEO A;  1IN6 A;  2VKV A;  2HPI A;  4YEJ A;  3JW4 A;  5BPD A;  3AKZ A;  4WXD A;  3ZPL A;  5HNF A;  4YIF A;  2BE5 F;  3ULQ B;  3ZRG A;  2QYO A;  4HDV A;  2MD5 A;  2K9Q A;  3ZGK A;  4IRH A;  4ITV A;  1Z7U A;  5HLH A;  3WTT C;  2LRE A;  3VDX A;  1SD5 A;  3ABU A;  2A3S A;  2XPV A;  2W84 A;  4OIR F;  2CQK A;  2ELJ A;  2KZG A;  2LFB A;  3SZP A;  2XC7 A;  3ZQ7 A;  2P5V A;  5IYD J;  2E19 A;  4BJT A;  2DPU A;  1JT0 A;  3FDY A;  3OYF A;  2EIK H;  3KYC B;  1ZRF A;  2JPB A;  2HU9 A;  1BJZ A;  1R22 A;  2VBX A;  1YQA A;  2WY8 Q;  2E1O A;  2LH9 A;  1HSJ A;  3IH2 A;  1VND A;  3S2D J;  2PMU A;  1QHH D;  2M45 A;  3HOT A;  4G7Z F;  3SHF A;  2JUG A;  1UG2 A;  4HQE A;  1YHQ I;  1MDM A;  4E7K A;  4CGZ A;  1JHF A;  2AXT C;  4QPQ A;  4MQV A;  5ILV A;  5D6E A;  4BH9 A;  5FLM J;  2QEX I;  2PLY A;  2K27 A;  4EM1 A;  2K9N A;  5J40 A;  4EJW A;  2R7Z J;  1TTY A;  2DOE A;  2IRF G;  4ZYA A;  2VBW A;  3JSP A;  3OOP A;  2E71 A;  5J1U A;  3F8F A;  2M34 A;  4FHT A;  5F64 A;  2XGC A;  3ERM A;  3Q3S A;  1ETO A;  1DU0 A;  3MKZ A;  1FT9 A;  1OR7 C;  3VYU B;  1XGM A;  3QP5 A;  1MSF C;  1QBJ A;  3CP2 A;  3VOE A;  4RB3 C;  4A3E J;  3LAJ A;  1K6O A;  1LEA A;  1HXD A;  2Z3Y A;  1BW6 A;  3BG9 A;  3OWT A;  3WTX C;  2UUZ A;  2NNY A;  4L9N A;  3M8F A;  5ICG A;  1R4N B;  1D1A A;  2K9M A;  3FXM A;  1OCP A;  2O0Y A;  3WHC A;  3B6C A;  3ASO H;  2J5O A;  1BL0 A;  4HV6 A;  1R00 A;  1J09 A;  4A3D J;  2ME0 A;  4A3L J;  3FBN B;  2JTV A;  4HLX A;  1TWH J;  2VQL A;  5LLQ A;  4B3X A;  2CQ7 A;  2VAS A;  2KFD A;  3HSF A;  2H8R A;  1VQ6 I;  4II2 A;  2Y2Z A;  3CTA A;  3EQL F;  1SD7 A;  3NRV A;  3HB9 A;  4ASN A;  4U0W A;  5IT3 A;  1X4O A;  5FJ8 J;  4X1E A;  1RKT A;  4RGR A;  5D8K B;  2M0M A;  2BW3 B;  3EPZ A;  4DIQ A;  3W6V A;  1LJ9 A;  2XV4 S;  4RGX A;  4QLC U;  4H4K C;  1QZE A;  3H9J A;  2PQ8 A;  5FLX Z;  3S15 J;  1HKS A;  2R7V A;  1LKX A;  2OZU A;  3VYT B;  1SD4 A;  2Y0S N;  3CCE I;  1T0F C;  1MKM A;  4G6Q A;  3VOD A;  5L3E A;  2A07 F;  2ZCW A;  4KYW A;  4CUG A;  3BT9 A;  5D8L B;  2KDZ A;  2DFI A;  3LSK A;  1MBK A;  2QBY B;  1I6H J;  3IRR A;  2DFF A;  1HOM A;  2ID3 A;  3OYA A;  4IOA F;  2R7U A;  1M1E B;  4FT8 A;  4KDP A;  3CMA I;  1TBX A;  1A31 A;  4I99 C;  3OYI A;  3KEY A;  3U2R A;  5EEH A;  4RAG A;  1P92 A;  2MLG A;  3V8K A;  4IL6 C;  1FIA A;  2ZFU A;  3KP6 A;  1SAX A;  1PUF A;  2VXZ A;  1FYM A;  1D3Y A;  2QSG X;  3H0G J;  5E8I A;  4J19 A;  2W24 A;  4YG2 F;  1VTN C;  1Z91 A;  4ZDO A;  5J1Y A;  5E17 F;  3P9I A;  2XVC A;  5D5V B;  2G9W A;  2L7Z A;  1CQT A;  1UG0 A;  5F0C A;  3DEE A;  2VKE A;  3OS1 A;  1UHS A;  4BJ6 C;  3FHN A;  5D5W B;  3BTJ A;  3OYD A;  2OJE D;  1O3Q A;  1KU9 A;  3E6C C;  2R0Q C;  3TED A;  1LFU P;  2CV2 A;  3KCC A;  1BR2 A;  1YI2 I;  5GTI C;  3L2U A;  2O8K A;  3K4N A;  4RMN A;  1ZTR A;  1CF7 A;  2PJR A;  2HOA A;  3G2B A;  1MMA A;  3K9T A;  1O7F A;  3VYR B;  1H88 C;  4MO7 A;  2VPR A;  1TWG J;  3OYN A;  3JRH A;  2FML A;  1WJC A;  3G6E I;  2STT A;  2XUB A;  1OCO H;  2JT1 A;  1JE8 A;  5GAH J;  1CGP A;  2WTE A;  2EIM H;  2V9V A;  2ECB A;  1GUU A;  5J47 A;  2KIF A;  2A68 F;  4HLY A;  2F5F A;  2P0W A;  3G1L A;  2R7X A;  3GTO J;  2K85 A;  2GWR A;  1ETK A;  1TZL A;  1B8I B;  2FNA A;  1V5G A;  2E7W A;  2F48 A;  1WJB A;  2RVC A;  3LST A;  1D8K A;  2HKO A;  2KHM A;  4P1W A;  4BY7 J;  3EYI A;  2V9K A;  2F4M B;  2XF6 A;  2O9L A;  3WTU C;  4Q5S F;  4FX4 A;  3KYD B;  1XG1 A;  3ELK A;  4L9V A;  3CCR I;  3HOU J;  3FM5 A;  1UMQ A;  1QRY A;  1MBG A;  3PSF A;  3OYL A;  3HRT A;  3SJM A;  1TQI A;  4CCK A;  2E35 A;  3U1D A;  1R5G A;  2NYX A;  1DGR M;  3Q0U A;  4A5M A;  1VFC A;  2EA2 A;  3SQN A;  4BBS J;  1HC8 A;  3CJR B;  4AYB N;  2LKS A;  3KEQ A;  3RPQ A;  1NHA A;  2RQQ A;  2A69 F;  4NC6 A;  3COA C;  1FEX A;  2X9D A;  3JTH A;  4B1R A;  1R1U A;  4A12 A;  3BG3 A;  2O6G E;  2L9R A;  1HA8 A;  2R93 J;  3ZN1 A;  2E2H J;  2K4J A;  1Y6I A;  2QCO A;  4CYC B;  1G2H A;  1YRN A;  1OCR H;  3RYP A;  4AIH A;  4LB5 A;  2PMZ N;  1J75 A;  2CQX A;  4AWX B;  3VYS B;  3ZP5 A;  3K4B A;  2DPD A;  2K4B A;  3IRQ A;  2VOP A;  3TDZ C;  3ZQQ A;  4IRG A;  5ILU A;  1SAU A;  1K78 A;  2VKH A;  3DF8 A;  5JFR A;  1JKQ C;  4Y15 A;  4Y17 A;  1AKH A;  1TL8 A;  1MNE A;  4IVN A;  1JUP A;  2K5C A;  2D2W A;  2XSD C;  4RB1 A;  1HLV A;  1ODD A;  3NWT A;  4YFN F;  1FPQ A;  2D45 A;  3OIP A;  4OAY A;  2V1D A;  3J7A Y;  1S7A A;  4BXF A;  1BC7 C;  2L9V A;  3SEQ A;  2K7L A;  2QQB A;  1V3F A;  3JRD A;  3PM1 A;  1FIP A;  2CFO A;  2F4O B;  4JX6 A;  3EDP A;  1U3E M;  4NC7 A;  2DTR A;  2O5R A;  2WY7 Q;  4BBR J;  5L3D A;  4V2G A;  1O3S A;  5LGT A;  1WCM J;  4PFP A;  3LSJ A;  4XLE A;  2HOT A;  1BA5 A;  2Y69 H;  2B63 J;  5E8G A;  3WG9 A;  2LY2 A;  4E70 A;  4C2U A;  2V1N A;  2R5Y B;  1F9N A;  2R5Z B;  5H2F C;  3OY9 A;  1Z05 A;  1ETX A;  2ME6 A;  2AO9 A;  2F6C A;  3AG2 H;  4LOC A;  4CHU A;  4BU2 A;  2JSC A;  1BR1 A;  1MNM C;  1IC8 A;  2DFE A;  2DMU A;  4PUS A;  2WV1 A;  4UHT A;  3SFZ A;  2KIU A;  1P7I A;  4PSX A;  6PAX A;  4LIT A;  3D0S A;  1RR8 C;  4HV5 A;  1AA7 A;  5HDK A;  5F27 A;  1ETQ A;  1LDD A;  4CZC A;  5FKN A;  1S9H A;  3RIR A;  3RKY A;  1O57 A;  5L3F A;  4KUM A;  5IOY A;  2CW8 A;  5J6X A;  4NBQ A;  2XKO A;  2EIJ H;  3F8N A;  3CQZ J;  2CYY A;  1B72 A;  1F43 A;  2FQ3 A;  3M1E A;  3GX4 X;  5IP9 J;  3KLO A;  1LFB A;  2ZXJ A;  2M87 A;  4LGW A;  3K4L A;  3LSR A;  2FA5 A;  4X0G A;  4NDL A;  4ZYD A;  1WSU A;  1FMW A;  2W82 A;  2DT5 A;  3JCU C;  5FD5 A;  3G1M A;  1TWA J;  2IJL A;  3FF5 A;  2K40 A;  4XSX F;  3JRB A;  3REO A;  3TO9 A;  1S7O A;  4HEA 2;  1BBY A;  1X3W B;  3TMO A;  1K61 A;  4UVA A;  3CC7 I;  1WI3 A;  1R23 A;  2LY1 A;  4IEJ A;  1PYV A;  3CO6 C;  1Y56 A;  3R4K A;  4F93 B;  4IXA A;  1OQY A;  4EM2 A;  3LWF A;  1U5T C;  2ZXH A;  1TP4 A;  2IEK A;  1SVM A;  4ZDP A;  3I9V 2;  1YO5 C;  2P4W A;  1MMG A;  2H6C A;  3J80 K;  2VJI A;  3S16 J;  3RZO J;  4IHT A;  3ABL H;  1OYI A;  1WVR A;  1XDU A;  4PJL A;  5JVT A;  4MEX F;  4XLP F;  3HRM A;  1YW9 A;  1A6I A;  1U9N A;  5D4S A;  1GDT A;  4PGG A;  3HG9 A;  2YX4 A;  3DEW A;  2Z16 A;  3JRF A;  5F1R A;  3S14 J;  4XLA A;  4XM3 A;  1A36 A;  3E97 A;  3TW7 A;  3I4M J;  2VIX A;  4A2U A;  4RAF A;  1S7E A;  1XC5 A;  1B9M A;  2Y9Y A;  3PNT A;  4E7Z A;  3FK7 A;  4XLF A;  4AM3 A;  3C1D A;  4NB5 A;  3MKL A;  2Y0M A;  3OS0 A;  5CLS A;  1FSE A;  2M4G A;  3F3X A;  3IP4 B;  3ZQF A;  3WTY C;  5LFA A;  1YJ9 I;  1K79 A;  2GM4 A;  3L00 A;  3BC8 A;  1P4W A;  3FZV A;  3HHG A;  3HM5 A;  1I6X A;  3BQY A;  2LRD A;  4M3F A;  5J4Y A;  5EF6 A;  4XRM A;  1UHW A;  2NNN A;  2Q2E A;  1IUY A;  3Q9V A;  2WA0 A;  1FP1 D;  1BC8 C;  3S3N A;  4N9I A;  3CMY A;  3GEZ A;  1X1P A;  1J5Y A;  1J0R A;  4CCN A;  4I2O A;  3A03 A;  2MBF A;  2X1D A;  1XTA A;  3O2P E;  4II3 A;  2LK2 A;  4D9J A;  3LMM A;  1PP8 F;  5TGT A;  5L3B A;  5DEQ A;  3ZQC A;  4ESB A;  4RB2 C;  2EIL H;  5CQE A;  3CCV I;  2IGK A;  4I01 A;  2H6B A;  4UUS B;  1S72 I;  1JGS A;  5H6Q A;  5IP7 J;  3FKJ A;  2B9S A;  2RKH A;  1WRJ A;  1O3T A;  1MH4 A;  4CA0 A;  3E5Q A;  3J7Z I;  4KA4 A;  2ZC2 A;  2VLA A;  3OYK A;  4GRI A;  2E2I J;  3ZMT A;  4LK0 F;  3AG3 H;  4IPA A;  4XRS G;  4AVP A;  4B8X A;  2LKX A;  1T6S A;  2Y75 A;  1X19 A;  1W36 D;  2OUM A;  1VQK I;  4XN3 A;  3BR2 A;  4BHC A;  5K1Y A;  1T8I A;  1BI3 A;  3RSN A;  3SEZ A;  4X6A J;  2RDP A;  3NAR A;  3WTS C;  4O3M A;  2I10 A;  2RN7 A;  5LHG A;  4F3Q A;  4M6X A;  4EJU A;  3RPU A;  1OLT A;  1IRF A;  3A0H C;  4D5F A;  3EUH A;  1DPU A;  2HGC A;  2CU7 A;  1YIJ I;  2KT0 A;  5CVR A;  5KAF C;  2GA1 A;  2IGM A;  5ICF A;  3S1M J;  4RM3 A;  2JSP A;  2Q0O A;  2HXO A;  3NQO A;  3T0Y A;  2F4I A;  1U0J A;  2DXI A;  1POG A;  3K7A J;  1KU7 A;  2GIV A;  5FB2 A;  3LQQ A;  1IXC A;  2TDX A;  2KRC A;  3OYJ A;  3RPU D;  3SZT A;  3T1B A;  3GLL A;  4Y4R A;  2M8G X;  2JRM A;  2XGX A;  1ZRE A;  3B6A A;  2O03 A;  5B1A H;  1TW2 A;  1BJA A;  2BY3 A;  2QUF A;  3GTK J;  4KN4 X;  4LK1 F;  3L2C A;  1XCV A;  3HRU A;  3ECO A;  5GAD J;  4EAT A;  2UWM A;  1WJF A;  1QQI A;  4XLN F;  1FBU A;  3KP5 A;  3I56 I;  4BKX A;  5DUI A;  3MN2 A;  5HOD A;  1MW7 A;  3H3U A;  5LRS A;  4HX8 A;  2VBY A;  2ZJ2 A;  3TKY A;  3L2V A;  1GT0 C;  1EJ9 A;  1STZ A;  4IRI A;  3GUD A;  1Z1D A;  2DA3 A;  3IC7 A;  2W00 A;  1FOW A;  4KIG A;  2Z33 A;  2BHY A;  1K6Y A;  2E2J J;  5E18 F;  2IXS A;  2HVS A;  1MZB A;  3LSI A;  5FKL A;  3S1N J;  3DU5 A;  3TGN A;  3V42 A;  3DU6 A;  2LF7 A;  3VWB A;  1SC7 A;  1BI0 A;  1HW1 A;  5E20 A;  5CJ9 A;  2G7H A;  4HX7 A;  2I8D A;  4PGH A;  2XF7 A;  4ZZL A;  1YTY A;  2CSO A;  1LUJ B;  4RA2 A;  1ZRD A;  3JAM K;  1MBJ A;  4NC8 A;  3U9G A;  5EG0 A;  1AU7 A;  3QOE A;  4Y33 A;  4P96 A;  4QWQ A;  3OOU A;  2YS9 A;  5HLG A;  2NS0 A;  4EV0 A;  4KNY A;  2NVY J;  4A3F J;  2FBK A;  4ZYE A;  3WU0 A;  3FHZ A;  1IN5 A;  3DPL C;  3V7R A;  2LG4 A;  3BR3 A;  1EKE A;  1KYW A;  3P9K A;  4LLG F;  3V8L A;  1O3R A;  2HDC A;  5FD6 A;  1KA8 A;  2GQQ A;  2P7V B;  2LC2 A;  5BS6 A;  2EV0 A;  1XMK A;  1W5C C;  3GYH X;  3R6S A;  4I6Z A;  1IV8 A;  4P9U A;  3MZY A;  1I50 J;  3M7G A;  4I0B A;  4ZZD A;  2QSF X;  2LOO A;  3DWL E;  1E3O C;  3H5A A;  4V19 K;  2V4J C;  4HNU A;  2JUC A;  2LKP A;  3RZD J;  3M07 A;  4DW6 A;  4MEY F;  1XMX A;  5BNG A;  2NRA C;  2FX0 A;  2OD5 A;  3I59 A;  3JRI A;  4N4O B;  2XIG A;  4PDK A;  1ZGA A;  3C3W A;  3GWZ A;  2L4M A;  3C2G A;  3QRF F;  3PL8 A;  3CDL A;  4J01 A;  1TT0 A;  4DNC A;  2HKX A;  1DQU A;  3T8T A;  1VQP I;  3ABK H;  2VN2 A;  2M3A A;  1BIB A;  4ANJ A;  2HI3 A;  4O5V A;  1IZ1 A;  5E3N A;  2R7D A;  4DQ2 A;  1X1B A;  2IA2 A;  3LSM A;  4GCV A;  4XKV A;  4DYQ A;  1FOK A;  1Z77 A;  1IN8 A;  2DCE A;  2F5C A;  3DEU A;  1HCR A;  1Z9C A;  4XKB A;  5K7Z A;  1SFO J;  4Q47 A;  4AC0 A;  3PNY A;  2ZNY A;  4P9F A;  5DTD A;  1L0O C;  1VZ0 A;  2VUM J;  2LTP A;  3CJN A;  3F21 A;  2NVX J;  1WJ5 A;  5EJC A;  5HDN A;  4JX4 A;  1T56 A;  2M4K A;  3L9F A;  3O8H A;  3CP8 A;  3DTK A;  4PSW A;  1APL C;  3RYR A;  2ISZ A;  3S2H J;  5D6F A;  1X2N A;  3K1P A;  3GCM A;  3TOB A;  4A0X A;  4QTR A;  1T33 A;  2DA1 A;  3EET A;  1R5I D;  2MD0 A;  3ZMV A;  1UHM A;  3QAH A;  2X1E A;  1YLF A;  3A01 A;  2KQR A;  3U21 A;  2K3P A;  4U88 A;  4WXC A;  1OMI A;  1Y8R B;  2Z1D A;  4CCJ A;  1PP7 U;  5GPA A;  1WJE A;  4F91 B;  1Y39 A;  3TBI A;  1PJR A;  4BDZ A;  5ICC A;  2B7E A;  3FBI B;  3BCA A;  1I3A A;  4D7N A;  2XRN A;  4ENN A;  4HF2 A;  2BVM A;  1Z7L A;  2VE8 A;  4BS9 A;  1C0W A;  2HXI A;  3HDD A;  1RZ4 A;  2LBF A;  3CES A;  3K4J A;  3CLQ A;  3JRG A;  4HW0 A;  3CD6 I;  1SMY F;  1YRN B;  3DXJ F;  2TRT A;  3C2B A;  4LB6 B;  1OR7 A;  1V55 H;  3ZCO A;  5IYB J;  3KET A;  4HDU A;  1FTT A;  1R1V A;  2KIQ A;  2ADU A;  2KLO A;  3GBG A;  3LAP A;  3BPV A;  1UCR A;  4UNO A;  5E1W A;  2R7F A;  2XAG A;  1WQ2 A;  1FY7 A;  5HOO A;  4UVB A;  2HS5 A;  3S93 A;  2CUZ A;  1K78 B;  2DK5 A;  2MG4 A;  2XPW A;  2JQ7 A;  2CQQ A;  3MQ0 A;  1Z67 A;  1AKH B;  3L09 A;  5LEJ A;  1ZGJ A;  3DQV C;  4I02 A;  4A5N A;  1FBQ A;  2CW0 F;  3RI4 A;  3CDI A;  1WZ2 A;  3CF2 A;  3EUK L;  2GOM A;  4OMY A;  2OTJ I;  2MLK A;  4XRS A;  1G6N A;  3I64 A;  1FX7 A;  4B09 A;  2DDA A;  4BEH B;  5F1J A;  1FTZ A;  2JRT A;  1ON2 A;  3J81 K;  2LP0 A;  3L7W A;  3KZZ A;  4BNC A;  1T98 A;  2CUE A;  3DTI A;  4CIC A;  2FD5 A;  4F7Z A;  4G6T B;  4L9T A;  2RAE A;  1WWX A;  1R7J A;  3PUF A;  2ETH A;  1G59 A;  2DU9 A;  2XAF A;  3KEO A;  4PJM A;  1FWZ A;  2H27 A;  4OU0 A;  4XNF A;  5KVR A;  4C30 A;  2ELK A;  4UB8 C;  1ACI A;  2P5K A;  3IKT A;  1UFM A;  4C3J J;  2G7U A;  2M30 A;  2JN6 A;  1RUN A;  1U8B A;  4IHS A;  1V54 H;  1T0F A;  4XN0 A;  4C3I J;  1GVJ A;  3J80 Z;  3D5L A;  4CCL A;  3K6G A;  3GW2 A;  2DJN A;  3N05 A;  3QPH A;  4FCY A;  2HPM A;  3OYH A;  1RR7 A;  5J8C A;  2F5V A;  2GOX B;  3ISP A;  3K4M A;  1KU3 A;  1TLH B;  1XS9 A;  1ZAO A;  2DK8 A;  2ESH A;  1MBE A;  3WE2 A;  1LNW A;  5FGM A;  3IWZ A;  3QYB A;  2NVU B;  1SFU A;  1F5T A;  4HG2 A;  4CCO A;  3TP3 A;  1VQ9 I;  4HF1 A;  4OWR B;  3WGI A;  1H89 C;  2X6W A;  3QPL A;  4A3M J;  1ULY A;  2EB7 A;  1WJD A;  1KQ8 A;  3S3O A;  2L4A A;  2VJJ A;  2JWT A;  2RQP A;  2O8X A;  3KPH A;  4ZH4 F;  3OS2 A;  2BZT A;  3CUQ B;  1B72 B;  5A2Q K;  3W2A A;  3ZXS A;  3TDU C;  3LQR A;  3O3K A;  5KAI C;  4LG0 A;  1R4M B;  4G9Y A;  1LB2 A;  2CJJ A;  2HWV A;  2QEN A;  4EQQ A;  3HBL A;  1LE8 A;  4M9Z A;  2XB5 A;  1MSE C;  1IN7 A;  3GTL J;  3W2V A;  1WPK A;  4OMZ A;  2EK5 A;  3IH3 A;  4G7H F;  4UUV A;  1AHD P;  1U8R A;  3C2H A;  3ESW B;  1D5V A;  1J9I A;  5AIQ A;  4CO8 A;  5CVJ A;  1IUF A;  1IW7 F;  3DCF A;  3RCO A;  4IO9 F;  1Y1W J;  1TW3 A;  2DYR H;  3TO7 A;  3MMY B;  1YOV B;  1XGS A;  4GO1 A;  3MZH A;  4F92 B;  3OIO A;  4L0Y B;  2A05 A;  1EF4 A;  2QM3 A;  5KK1 A;  3E5X A;  2ZJP F;  2EPF A;  5IT9 K;  2OQR A;  5FO5 A;  1NK2 P;  4Z6Y A;  1VQM I;  3D5R C;  2P6T A;  1IGN A;  3BPX A;  4NQW A;  4EMS A;  5F6F A;  4B48 A;  4XID A;  2H8W A;  3A0B C;  2CH0 A;  2DFH A;  1NH3 A;  1FBS A;  2HQR A;  4OOI A;  1Y0U A;  1ZEL A;  1KQ9 A;  2WAF A;  4BDY A;  2A6T A;  2DQR A;  2CG4 A;  4D0P A;  3FKI J;  4KIB A;  1NG6 A;  2IS2 A;  1RUO A;  2XKP A;  2LLK A;  2FXA A;  2LNB A;  2EFP A;  1F1Z A;  2CQN A;  1S8N A;  2XAQ A;  4U7B A;  1GLN A;  2W4S A;  3ZR8 X;  5FKO A;  1ZR2 A;  5HS7 A;  1P9Q C;  3G1O A;  4JQF A;  1R5H A;  4UUT A;  4HNT A;  2ZKZ A;  1IF1 A;  2DA2 A;  3I53 A;  3V7C A;  3BR5 A;  2VE9 A;  1QZZ A;  2EFN A;  3R61 A;  4RM2 A;  5IPA A;  2R7T A;  2DDB A;  5GAG J;  2IS6 A;  3ML6 A;  1FJL A;  4CDG A;  4S0H B;  2BVL A;  5JR3 A;  1RKW A;  5DYM A;  3BTL A;  1SEU A;  2FU4 A;  3U1K A;  3DV8 A;  1DP7 P;  1QNT A;  5IOZ A;  4A0Y A;  3GXO A;  1W0U A;  3L2R A;  3WU1 B;  4A69 C;  1T39 A;  3IUO A;  1MBH A;  1K4T A;  2MC4 A;  2IW5 A;  4HQM A;  2D1V A;  4KIC A;  2IPQ X;  3D1N I;  3GTP J;  3WGH A;  3JSO A;  3QPS A;  3IHU A;  3OYC A;  3QOP A;  1ZG5 A;  4AID A;  1IXR C;  3H1C A;  5JVG F;  4GXO A;  4XKW A;  3DP7 A;  3RQ4 A;  2MFZ A;  3HPG A;  1S5L C;  3BY6 A;  1B9N A;  3SYT A;  1FOY A;  1YG2 A;  2E1M B;  4MIM A;  3V8J A;  2CMP A;  4NUB A;  1TQM A;  2HQA A;  2ZME B;  1I1S A;  5B5E C;  4XMY A;  3FXO A;  4M72 A;  1FLI A;  1RI7 A;  1RES A;  1MGT A;  3OV8 A;  4FET A;  4PZJ A;  2BW3 A;  3LL7 A;  5JLX A;  1QVT A;  3H3Z A;  4E7S A;  5B3S H;  4WF2 A;  2STW A;  2CRG A;  4AD9 A;  3JAM Z;  2IA0 A;  5ED4 A;  1A35 A;  2ZBK A;  1MMD A;  2OU2 A;  4ENM A;  3B02 A;  2J5P A;  3HKZ A;  1W1W E;  4MQ9 F;  4EJO A;  3FXJ A;  4DYC A;  2IGO A;  4DZJ A;  3GF2 A;  4DBR A;  1GV5 A;  3FXK A;  1B4A A;  3DLA A;  3F8M A;  2QBY A;  4KIS A;  3KP2 A;  1VQ7 I;  2R3S A;  5FKK A;  4N4N B;  1WKM A;  1E3P A;  3HHH A;  3AL0 B;  2VC0 A;  1IDZ A;  2KJB A;  3K10 A;  1UST A;  2GBY A;  2DOA A;  1A6Q A;  4XRF A;  1TQP A;  4GYG A;  4KMU X;  3QU6 A;  1MD0 A;  4IHX A;  4ZC3 A;  3S3M A;  3K2A A;  2L7K A;  2XHK A;  2JZY A;  3OYG A;  2M5W A;  2N8G A;  4WWC A;  5CPR B;  1D1C A;  1FMV A;  3T5X A;  3PIP F;  3BTC A;  2HDD A;  3CJQ B;  3CUQ C;  4I0A A;  4JP0 A;  1VQ4 I;  2E7X A;  2AQE A;  2P6S A;  5DCF A;  4LIV A;  1W7P A;  3GTG J;  4DGW B;  1FC3 A;  3OIQ A;  2HZT A;  3SFI A;  4QPO A;  3OMY A;  2YX7 A;  2R7R A;  4I09 A;  2EFO A;  3RKW A;  1VI0 A;  3PQJ A;  2GXG A;  2FBH A;  3FWE A;  5DM6 F;  2DLL A;  4AVZ A;  3SXY A;  1EH7 A;  2QA4 I;  3LSG A;  3KP4 A;  1RC9 A;  1W7P D;  4A93 J;  1ZK8 A;  2DN0 A;  1SVL A;  2L0K A;  2LR8 A;  2EIN H;  1LFP A;  1HST A;  3HOZ J;  1GXQ A;  4A3C J;  2DOF A;  3KP3 A;  2DA5 A;  3CF5 F;  1HW5 A;  3L2W A;  3IKV A;  2L02 A;  5J8F A;  2R4G A;  1U5T A;  2RC4 A;  3CCS I;  5DCM B;  1JKO C;  3F22 A;  1ZG1 A;  4MTD A;  2F5E A;  2HR3 A;  2F2E A;  1B8I A;  3V4G A;  3D5S C;  2L7M P;  3OYE A;  1ETY A;  4EGY A;  3BR1 A;  1RPW A;  3GFJ A;  3KZI C;  2DMQ A;  3W6K B;  1GVD A;  2KMU A;  2VC1 A;  3DLL F;  4R1H A;  4XLC A;  3DKX A;  3I59 B;  5CVI A;  1ENH A;  1XGO A;  1XGN A;  2L3D A;  2WB1 A;  4ENK A;  1JHH A;  2UZK A;  3WU2 C;  3ZOB A;  1J2X A;  1ZN2 A;  4LD5 A;  1T2K A;  2XGE A;  4WCG A;  5EGO A;  1EA3 A;  1IJW C;  5F04 A;  4BHP A;  4PJ0 C;  4L18 B;  3CCQ I;  5BMZ A;  2VQC A;  3MVP A;  1S29 A;  4KIF A;  1OFC X;  3VPR A;  1E17 A;  1LVA A;  2JA2 A;  2Y31 A;  2Y9Z A;  1LDK B;  3CCY A;  4CYC A;  2CUF A;  3HSE A;  3S1Q J;  1U9O A;  1FNN A;  5DV5 A;  2KJC A;  3P9C A;  3G4S I;  3LFK A;  5FKM A;  3X2Q H;  1FSH A;  1D5Y A;  5DDG A;  3IH4 A;  4A3K J;  2FOW A;  5DUK A;  4BQA A;  1OPC A;  2FBI A;  1IRX A;  2DA7 A;  2YU3 A;  2DAO A;  4YIR X;  1HBX G;  1B59 A;  3H92 A;  3IAM 2;  4UXN A;  2MH9 A;  1MDM B;  3BJO A;  3WHB A;  2XRO A;  3GTQ J;  3J81 Z;  1WJA A;  5IYC J;  1K7A A;  4KFC A;  2H09 A;  3I58 A;  3AG1 H;  1BW5 A;  2COB A;  2HYJ A;  2Z9O A;  4LLN A;  2KP6 A;  1ERD A;  3HSR A;  2HVQ A;  2YPR A;  3HGY A;  1UJ8 A;  3WOD F;  2LY9 A;  2VL8 A;  2P8T A;  4XIC A;  4R8H A;  5HS9 A;  5TIS C;  4ESJ A;  2L54 A;  2RNG A;  3EUA A;  3OYM A;  4DJA A;  4J00 A;  2ZME C;  2AS5 F;  5E3M A;  1HKQ A;  4YFK F;  5TRD A;  3QP6 A;  3NEU A;  1BI1 A;  3F6V A;  3FMQ A;  3A2K A;  2G0E A;  3ABM H;  2NOG A;  2LBF B;  5FRM A;  2XAH A;  4G12 A;  1BOA A;  2V9P A;  3E6B A;  2WC2 A;  3T8R A;  2JVG A;  3WTV C;  1W4M A;  1GV2 A;  1MJ9 A;  3HZJ A;  3BRO A;  3GFM A;  2L9S A;  4LLL A;  3ZMD A;  4BQO A;  4W97 A;  3ERE D;  3DBR B;  1ZR4 A;  3IWF A;  3QQA A;  2H94 A;  2HZD A;  3PFY A;  1ETV A;  3DBH B;  1MMS A;  4IF4 A;  2OTL I;  2W1O A;  3ZQL A;  2CGP A;  3BR6 A;  4M3D A;  5B1B H;  5HVQ C;  4BHB A;  1OCT C;  1XN7 A;  1VF9 A;  1R71 A;  3AL0 C;  2XSJ C;  4EJV A;  1R9T J;  3JTG A;  1I3Q J;  1YE9 A;  2BYV E;  2DO7 A;  2K3F A;  3HUG A;  3ZQI A;  5JHU A;  4AIK A;  5A2Q Z;  1USS A;  3P7N A;  4U0V A;  3MEX A;  3K4C A;  4G6D A;  2FEZ A;  4AIJ A;  5J1R A;  3QWL A;  1N25 A;  2GZW A;  2OZ6 A;  1N75 A;  2WAQ A;  2C6Y A;  2R7W A;  3QYF A;  4WK8 F;  2DMN A;  2IS4 A;  1QO0 D;  3ECH A;  3H35 A;  2FF4 A;  4F55 A;  5TJJ A;  3KIO A;  3RJP A;  1BN5 A;  2LD5 A;  1A04 A;  1QVU A;  3F72 A;  1J7K A;  4P55 A;  1QU3 A;  1TT5 B;  2QGU A;  3M1C A;  3Q0V A;  4OIN F;  4ZTJ A;  4S05 A;  2D1H A;  3K1N A;  3VSK A;  1B6A A;  2HOS A;  2L01 A;  2JA5 J;  2HTS A;  2EV5 A;  5GP9 A;  4FAS D;  3WE3 A;  2EZH A;  5IT9 Z;  2VI6 A;  1KON A;  1WGX A;  2VXD A;  1X2M A;  3I0T A;  3ZMU A;  4ZDL A;  2HVR A;  1FOX A;  4JOM A;  2FMY A;  2X6Y A;  1S3J A;  1IDY A;  2A6E F;  2VKD A;  3DBL B;  4XON A;  2K02 A;  1JXS A;  1PUF B;  3FIS A;  2V7F A;  4CYD A;  1WFX A;  4BE1 A;  1R1T A;  4YEL A;  2PBI A;  3BCB A;  3PFI A;  1YX3 A;  1TNT A;  4CSW A;  5F08 A;  2Z5U A;  1X1A A;  2DTZ A;  2UV1 A;  3FXQ A;  3DPU A;  3H36 A;  2NVQ J;  2NS8 A;  4Y13 A;  2DW4 A;  2PFB A;  3HXL A;  4DYR A;  2M7A A;  4MNU A;  1ZKG A;  2OF7 A;  1SVO A;  3PSI A;  4FTH A;  2IT0 A;  1N78 A;  1WH5 A;  4LJZ F;  2YU9 J;  1D8J A;  4I7H A;  3CCM I;  2EZK A;  3DKW A;  4RS8 A;  1CF7 B;  2PJR B;  1V5F A;  2R92 J;  4JBA A;  2P7C B;  4XOP A;  4BQQ A;  3DFG A;  2QSH X;  3ABT A;  2ZO4 A;  1UB9 A;  3CO7 C;  2QVO A;  1VQN I;  3FK6 A;  4WX9 A;  2JVH A;  3BLY A;  1DDN A;  4HNV A;  3E1S A;  2K9L A;  5JHF A;  3AAF A;  3QPT A;  5M3M J;  1UEL B;  1LPQ A;  4HRI A;  1YIO A;  3I4N J;  2LYC A;  3CCL I;  3CDH A;  4FX0 A;  3B73 A;  3RQI A;  3KX2 A;  5HLT A;  2PMH A;  4LFU A;  3GTM J;  2PEX A;  3TO6 A;  1YW7 A;  1T95 A;  1XX5 A;  2KPM A;  2VB6 A;  1G3W A;  4QSH A;  2ZSI B;  2IGN A;  4A6D A;  3HC7 A;  2OQG A;  1OCC H;  1V4R A;  2XAU A;  4BUP A;  1OCZ H;  5K5R A;  1IRG A;  3CUO A;  2LF8 A;  2BGC A;  3O6B B;  2V1U A;  2JK3 A;  1P4A A;  4NQW B;  1AOY A;  2DMT A;  5H6R A;  4A3I J;  3GZ5 A;  1FZP B;  2R7S A;  3AFH A;  5LHI A;  2ZJR F;  4UUS A;  2QQ9 A;  2VBZ A;  2HQN A;  3E6M A;  1I1G A;  3GVA A;  3I71 A;  3Q9S A;  4M74 A;  2NXN B;  4YRV A;  5LGU A;  5LEK A;  4Z2Y A;  2OBP A;  1RET A;  5FLV A;  4ENJ A;  4CZZ A;  3KZY A;  3ZN0 A;  4U0Y A;  2DA6 A;  3CLO A;  3GFL A;  1ON1 A;  4L5I A;  4M9X A;  4RGU A;  2X6X A;  3G71 I;  2V1X A;  3HGG A;  4I76 A;  4C2T A;  1PVE A;  1DUX C;  3PO3 J;  5FRO A;  5M3F J;  2I5U A;  5EYR A;  3FM3 A;  3I55 I;  2EA4 A;  2P5L C;  1JT6 A;  2YSR A;  2Z2S B;  3BG6 A;  3L1P A;  2CUJ A;  2GIZ A;  3MD2 A;  5J3L A;  4PCQ A;  4KT5 C;  1GXP A;  2BXZ A;  4O6J A;  4GFB A;  4RLF A;  1X3U A;  4TV7 A;  2M0C A;  2CV1 A;  4UV9 A;  3WTW C;  4JX5 A;  3OR1 C;  3CJT B;  3PQK A;  5LD2 C;  1JTY A;  5KHD A;  1Q1V A;  2FRH A;  2GAU A;  1MIJ A;  2HYF A;  3E6D A;  5M5W J;  4E7I A;  5E1Z B;  1TWC J;  4HA8 A;  4XLH A;  2VOD A;  3BWG A;  4Y52 J;  3K69 A;  3E7L A;  3KE2 A;  2KDO A;  4XL9 A;  2FUG 2;  2L7F P;  4HST A;  2QKL B;  4M9S A;  1MMN A;  4B4C A;  1OYY A;  3HL2 A;  4M3E A;  1REP C;  1SFX A;  2DMP A;  1ZLJ A;  4H0E A;  4ZJZ A;  1LEB A;  4D7M A;  4D5C A;  1I39 A;  1NTC A;  5F0H A;  5EEG A;  2WAE A;  1YW8 A;  3KLN A;  3NAU A;  3BDD A;  2A61 A;  3HPH A;  1HDD C;  4UY8 I;  4PFO A;  2NVT J;  2MC3 A;  3VEP A;  4S04 A;  3NWS A;  1DP3 A;  4G7O F;  2ZSH B;  4C9Y A;  3H3V K;  2FNP A;  2OV7 A;  1X4P A;  1S6L A;  2W7N A;  3BZK A;  3ZMZ A;  1QPM A;  1ZGW A;  4RGS A;  5E3O A;  4ZTF A;  2YUS A;  3TOA A;  1H9G A;  1JUS A;  1WH7 A;  1ZAR A;  2ZB9 A;  4P5O A;  3ZMS A;  3I5U A;  1O4X A;  1ZLK A;  1X3Z B;  2LVS A;  4HAM A;  2QZ8 A;  2LMD A;  4MLO A;  2Q8K A;  3OYB A;  1YJW I;  4DOZ A;  2DBB A;  4GYI A;  4RBO A;  3S8P A;  4EEF G;  3Q5F A;  1VQL I;  2ZXI A;  2BY1 A;  1WI9 A;  3BR0 A;  3K0L A;  3MCZ A;  4RAY A;  4OIQ F;  2FE3 A;  1R36 A;  5CYV A;  4IHY A;  2JPC A;  1HF0 A;  4ZYG A;  1BOB A;  4BGD A;  4LMY A;  1VQ8 I;  3FXU A;  1E3H A;  3R0A A;  1ONV A;  2Q1Z B;  3IL2 A;  3CCJ I;  2X51 A;  3O8G A;  2R7Q A;  2ID6 A;  2P81 A;  2Y48 A;  1Z0X A;  4DZP A;  2LDU A;  1JUM A;  3QOD A;  1IN4 A;  4A0Z A;  5DD4 A;  4K2E A;  5C44 J;  1E0E A;  1KGS A;  4L5J A;  4AUX A;  2JJ7 A;  1KQ0 A;  1V5E A;  2DQL A;  4BAY A;  2B0L A;  1IO2 A;  3FXL A;  3ZQH A;  1D0X A;  2Y0S A;  4AU7 A;  4A3G J;  2E5N A;  3HIF A;  3RKQ A;  2ZXW H;  3JRA A;  1W7P B;  2JMW A;  2V6C A;  2V6E A;  2KL4 A;  1DGW Y;  2KRH A;  3DPT A;  1SAN A;  3R60 A;  1JI8 A;  1MJA A;  2EZL A;  1Z3Y A;  5EZG A;  2VOO A;  1DU6 A;  1ZG3 A;  2X6O A;  2QLZ A;  1X1C A;  3LFU A;  1MJB A;  2PI0 A;  2MW8 A;  3K2Z A;  1G8X A;  2ISY A;  1YYV A;  1IAW A;  4UV8 A;  2M9H A;  3F23 A;  1FYL A;  4BE2 A;  4BAC A;  3BP8 A;  3I4P A;  2VQG A;  2A5W A;  3CC2 I;  4FIS A;  3CME I;  3GZ6 A;  2L2O A;  3BG5 A;  5L3C A;  1U5T B;  2A5Y B;  2QKM B;  4IHW A;  2KIM A;  1ITY A;  2OC6 A;  4C3H J;  1YS6 A;  3LOC A;  2L9N A;  3G73 A;  4IJA A;  2IS1 A;  4MFE A;  4RDU A;  4BE0 A;  2O3F A;  4EVI A;  2OCE A;  3HTS B;  4EGZ A;  4HPQ A;  4EJT A;  1MH3 A;  3MZ8 A;  3VB2 A;  1HW2 A;  5JLW A;  2KKO A;  3ZQG A;  3HOX J;  1PDN C;  2FQ4 A;  3PO2 J;  2VQH A;  4XKC A;  4RB0 A;  3FXR A;  4BXX J;  3OL4 A;  4L9J A;  3ROU A;  3BOQ A;  1T08 B;  1R58 A;  2MH2 A;  4CXF A;  3AG4 H;  5FFZ A;  1YFH A;  2Q2E B;  1D0Y A;  3QYE A;  2CWE A;  2NAZ A;  1OIS A;  1QGP A;  2AQF A;  1LDJ A;  3EYY A;  2IP2 A;  4GDF A;  2BV6 A;  1P6R A;  1E2X A;  3F8B A;  1BI2 A;  2KZV A;  4E4H A;  2V79 A;  5EGO B;  2KIS A;  4PK4 A;  5IY5 H;  4A3J J;  2QQ8 A;  2V26 A;  3G3Z A;  3CZ6 A;  1LVK A;  1X1D A;  2FSW A;  2LSO A;  1Z6T A;  4HSR A;  4ABZ A;  2Y30 A;  1O7L A;  4N0B A;  1QPI A;  2JA7 J;  2PG4 A;  4M3G A;  3WG7 H;  3GTJ J;  3LA2 A;  1Y0N A;  3BJA A;  4FE7 A;  3C7J A;  5IP6 A;  2QF7 A;  2RNJ A;  3HJE A;  3F6O A;  4FQG A;  1FYK A;  1JKP C;  2HFH A;  3V7S A;  2ZFW A;  3H5R A;  1OJL A;  5KCM A;  5GTH C;  3HOS A;  1UAA A;  3MKW B;  3HKZ N;  3BG7 A;  2HTJ A;  1F4K A;  5ERI A;  1Y1V J;  2AXL A;  3IV5 A;  3I54 A;  3A1Y A;  1L3L A;  2VON A;  4A3B J;  3M4O J;  2VPL A;  4AYB A;  1YIT I;  3GZN B;  3W3C A;  2RV8 A;  2VJ5 A;  4MGR A;  3A02 A;  2DT7 B;  2VT3 A;  4EM0 B;  1IRZ A;  2EJR A;  2M7B A;  9ANT A;  5JI6 A;  2GXA A;  2M1B A;  2DI3 A;  3E5U A;  3WGG A;  5HS8 A;  1W0T A;  1IXS B;  3RKX A;  1EH8 A;  4BEH A;  3TL4 X;  1HKT A;  2PMZ A;  4YFX F;  4IX7 A;  5GPC A;  1XPX A;  2XAS A;  4XBF A;  2GLO A;  2W85 A;  2W57 A;  4IQJ A;  3QU3 A;  2WWY A;  1D0Z A;  1NK3 P;  2Z99 A;  2EZI A;  5F0F A;  2EH3 A;  3L2Q A;  5K7H A;  4HX4 A;  4NHJ A;  4MHG A; 
#chains in the Genus database with same CATH homology
 3OYD A;  4XKB A;  3DTE A;  2RNG A;  3EUA A;  3OYM A;  4DJA A;  4J00 A;  2CV2 A;  3PNY A;  1BR2 A;  3K4K A;  4CH7 A;  3L2U A;  1VZ0 A;  3K4N A;  4RMN A;  4R79 A;  4D1Q A;  2PJR A;  1WJ5 A;  3A2K A;  3G2B A;  2M4K A;  1MMA A;  3CP8 A;  3DTK A;  4PSW A;  2LBF B;  3VYR B;  5FRM A;  3HUG B;  2XF5 A;  3OYN A;  3RTR A;  2MD0 A;  1WJC A;  4RLQ A;  2X1E A;  2JVG A;  2KQR A;  3OL3 A;  4KT6 A;  3PNV A;  3F9K A;  3IAS 2;  3U21 A;  2K3P A;  2CS3 A;  2L9S A;  4BQO A;  2Z1D A;  4CCJ A;  1WJE A;  4F91 B;  2HZD A;  2P0W A;  3PFY A;  2R7X A;  4E7H A;  4XOT A;  3TBI A;  1PJR A;  2W1O A;  4BDZ A;  3K70 C;  1TZL A;  3FBI B;  2E60 A;  3BCA A;  1V5G A;  5HVQ C;  1YX5 A;  1WJB A;  3AL0 C;  2XSJ C;  2BVM A;  1Z7L A;  4BS9 A;  2KHM A;  2LBF A;  3CES A;  3K4J A;  4P1W A;  1YE9 A;  2V9K A;  2XF6 A;  3VSL A;  3K4C A;  2XDV A;  4F52 A;  4BL0 B;  3OYL A;  3PSF A;  3ZCO A;  4CCK A;  2WAQ A;  1N75 A;  2KLO A;  3GBG A;  2R7W A;  3QYF A;  1BR4 A;  3H9G A;  3W2W A;  1DGR M;  2IS4 A;  5HOO A;  3H35 A;  3S93 A;  2CUZ A;  4F55 A;  3CJR B;  2MYS A;  2L5Q A;  1QU3 A;  3M1C A;  1NG7 A;  4E6K G;  2RQQ A;  4ZTJ A;  3K70 D;  3DQV C;  3LSH A;  3H5N A;  3VSK A;  1HA8 A;  3CF2 A;  4BJ5 C;  3EUK L;  4IQ4 A;  2NOJ B;  1Y6I A;  2GOM A;  4FAS D;  1N77 A;  4KIT B;  3PUB A;  1KON A;  2VXD A;  4BEH B;  3UR3 C;  3VYS B;  3K4B A;  4ZDL A;  2HVR A;  4JOM A;  2VKD A;  2X6Y A;  4XON A;  3ZQQ A;  3DTI A;  4IKF A;  1SAU A;  1SFK A;  2V7F A;  4G6T B;  2VKH A;  1WFX A;  5CQG A;  4BE1 A;  2DJI A;  4YEL A;  4E7L A;  1G59 A;  3BCB A;  2DT6 A;  2RRE A;  1YX3 A;  5FRN A;  4CSW A;  4PJM A;  1MNE A;  1X1A A;  2UV1 A;  3I3L A;  4XNF A;  3DPU A;  4DBQ A;  2WAD A;  4C30 A;  2K5C A;  4NNJ A;  3HXL A;  3SDB A;  2M7A A;  3NWT A;  2CW7 A;  3OIP A;  4OAZ A;  4OAY A;  3J7A Y;  4XN0 A;  4BXF A;  3PSI A;  5CKT A;  3SEQ A;  1N78 A;  3D5L A;  4CCL A;  3K6G A;  2PJR B;  1V5F A;  2CFO A;  2X85 A;  3N05 A;  4XOP A;  4BQQ A;  2HPM A;  3OYH A;  4NC7 A;  2F5V A;  2GOX B;  2MAB A;  2O5R A;  2WY7 Q;  3K4M A;  1W36 C;  3DKY A;  2JVH A;  4PFP A;  3BLY A;  4XLE A;  3E1S A;  2K9L A;  5JHF A;  3QYB A;  4HG2 A;  4CCO A;  1UEL B;  4HRI A;  2LY2 A;  4OWR B;  4C2U A;  2X6W A;  4BQN A;  2LYC A;  2V1N A;  3H9Q A;  1WJD A;  4B44 A;  4CCM A;  3OY9 A;  3S3O A;  2E1M C;  3KX2 A;  5HLT A;  2VJJ A;  2X1C A;  2F6C A;  4XOR A;  4BU2 A;  1T95 A;  2KPM A;  1BR1 A;  3OS2 A;  2VB6 A;  2ZSI B;  2IGN A;  3ONQ A;  4PUS A;  3W2A A;  1R6R A;  3HC7 A;  3ZXS A;  4B43 A;  4PSX A;  5KNL A;  2XAU A;  4BUP A;  2CV0 A;  4LIT A;  4XQF A;  4NQW B;  1AA7 A;  3W2V A;  2HDW A;  2R7S A;  3EUH C;  3AFH A;  3C2H A;  4LIU A;  4CZC A;  1D1B A;  1S9H A;  3RCO A;  4YRV A;  3UNG C;  3MMY B;  3A4C A;  4F92 B;  2CW8 A;  3PJR A;  3MKY B;  2X6X A;  4E7J A;  3OR2 C;  4C2T A;  1MND A;  3KYL A;  3D5R C;  3K4L A;  1QHG A;  4X0G A;  5FRO A;  4XR6 A;  4B48 A;  4LG3 A;  1FMW A;  2W82 A;  2CH0 A;  4IZZ A;  2Z2S B;  3BG6 A;  2CUJ A;  3MD2 A;  4HEA 2;  3TMO A;  1ZEL A;  2WAF A;  4BDY A;  2A6T A;  2LY1 A;  4RLF A;  1PYV A;  3M8J A;  1Y56 A;  1NG6 A;  2CV1 A;  2IS2 A;  4F93 B;  4U7B A;  2ZXH A;  2HNH A;  3OR1 C;  1GLN A;  2W4S A;  5LD2 C;  4ZDP A;  3E0J B;  3I9V 2;  5KHD A;  3ZR8 X;  1MMG A;  1P9Q C;  4JQF A;  3S32 A;  4E7I A;  2VJI A;  4XLH A;  4HNT A;  4PJL A;  4PJJ A;  2KDO A;  3SZG A;  4XL9 A;  2FUG 2;  4HST A;  2QKL B;  1MMN A;  2R7O A;  4RM2 A;  3HL2 A;  3HG9 A;  2Z16 A;  2R7T A;  4Y3O A;  2IS6 A;  4XLA A;  4XM3 A;  4ZJZ A;  2VIX A;  2BVL A;  3PNT A;  4E7Z A;  4XLF A;  2WAE A;  4PJN A;  3OS0 A;  2M4G A;  3IP4 B;  3HPH A;  5LFA A;  3BC8 A;  4PFO A;  2BOL A;  2LRD A;  4B47 A;  3NWS A;  1DP3 A;  4KJZ A;  2ZSH B;  4C9Y A;  3L2R A;  3IUO A;  2OV7 A;  1X4P A;  2W7N A;  2MC4 A;  2WA0 A;  3S3N A;  3OYC A;  3H0D A;  4ZTF A;  2E5Z A;  4P5O A;  4XKW A;  3RQ4 A;  2MFZ A;  3HPG A;  4CCN A;  4MLO A;  3OYB A;  4U87 A;  3CMM A;  5HNH A;  3SYT A;  1Z21 A;  2X1D A;  4DOZ A;  2WBM A;  4II3 A;  2E1M B;  4D9J A;  3LMM A;  3S8P A;  5TGT A;  2CMP A;  2ZXI A;  4NUB A;  2VJ4 A;  1Z3X A;  2HQA A;  4XMY A;  5CQE A;  2IGK A;  2HPI A;  4YEJ A;  1BOB A;  4BGD A;  3AKZ A;  4FET A;  2BW3 A;  2Q1Z B;  3LL7 A;  5HNF A;  2X51 A;  3ZRG A;  2R7Q A;  3FKJ A;  4E7S A;  3QOD A;  4CA0 A;  3ZGK A;  4ITV A;  1MMD A;  1E0E A;  3HKZ A;  2VLA A;  3OYK A;  4GRI A;  1V5E A;  2LRE A;  3VDX A;  1D0X A;  2IGO A;  2Y0S A;  4AU7 A;  2E5N A;  4DBR A;  2ELJ A;  2XC7 A;  3DLA A;  1X19 A;  2V6E A;  1W36 D;  2OUM A;  2KL4 A;  1DGW Y;  4XN3 A;  4BJT A;  4KIS A;  2KRH A;  3DPT A;  3FDY A;  3OYF A;  4N4N B;  1JI8 A;  3RSN A;  3AL0 B;  1Z3Y A;  2HU9 A;  3SEZ A;  2WY8 Q;  3K10 A;  2LH9 A;  1X1C A;  3LFU A;  2DOA A;  4F3Q A;  1QHH D;  3HOT A;  1OLT A;  1G8X A;  4ZC3 A;  3S3M A;  2JUG A;  2L7K A;  3OYG A;  4E7K A;  2IGM A;  4RM3 A;  2JSP A;  4QPQ A;  4BAC A;  5CPR B;  4BE2 A;  1D1C A;  1FMV A;  2VQG A;  2A5W A;  2F4I A;  3CJQ B;  1U0J A;  2DXI A;  2AQE A;  2L2O A;  4LIV A;  4DGW B;  4ZYA A;  2KRC A;  2QKM B;  3OIQ A;  3OYJ A;  3RPU D;  4QPO A;  3OMY A;  2OC6 A;  2R7R A;  4Y4R A;  2L9N A;  2IS1 A;  4BE0 A;  3MKZ A;  1OR7 C;  3VYU B;  4AVZ A;  4HPQ A;  3CP2 A;  3LSG A;  2UWM A;  4EAT A;  1WJF A;  3OWT A;  2UUZ A;  1LFP A;  2VQH A;  4XKC A;  1MW7 A;  3OL4 A;  3L2V A;  1D1A A;  2K9M A;  1D0Y A;  2Q2E B;  3QYE A;  3L2W A;  2R4G A;  2AQF A;  2W00 A;  1J09 A;  2KZV A;  1K6Y A;  2HVS A;  2IXS A;  4E4H A;  3LSI A;  3FBN B;  3DU5 A;  2VQL A;  4PK4 A;  2V26 A;  3V42 A;  3DU6 A;  4B3X A;  3CZ6 A;  2VAS A;  1LVK A;  1X1D A;  3D5S C;  3OYE A;  3VWB A;  4II2 A;  4HSR A;  2I8D A;  2XF7 A;  1X4O A;  2KMU A;  4NC8 A;  2M0M A;  2BW3 B;  3EPZ A;  3QOE A;  4DIQ A;  4XLC A;  4Y33 A;  3H5R A;  3DKX A;  3OOU A;  5KCM A;  3HOS A;  1UAA A;  3MKW B;  3BG7 A;  4H4K C;  3H9J A;  2WB1 A;  3DPL C;  2LG4 A;  2R7V A;  1LKX A;  3VYT B;  1EA3 A;  3A1Y A;  1T0F C;  2LC2 A;  2VPL A;  4AYB A;  2VQC A;  3W3C A;  2VJ5 A;  4CUG A;  2JA2 A;  2DT7 B;  3LSK A;  1LDK B;  2LOO A;  3DWL E;  2M7B A;  3OYA A;  3H5A A;  2R7U A;  2V4J C;  4HNU A;  4BEH A;  3OYI A;  3TL4 X;  3KEY A;  2PMZ A;  4N4O B;  4IX7 A;  1IRX A;  2ZFU A;  3C2G A;  2VXZ A;  3IAM 2;  3PL8 A;  4J01 A;  1TT0 A;  4IQJ A;  1D0Z A;  4ZDO A;  1DQU A;  1WJA A;  4ANJ A;  2M3A A;  1X1B A;  2KP6 A;  3LSM A;  1UG0 A;  3L2Q A;  1ERD A;  3DEE A;  4XKV A;  2HVQ A;  2DCE A;  3OS1 A;  2VL8 A;  4BJ6 C;  3FHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...