1E0EA

N-terminal zinc-binding hhcc domain of hiv-2 integrase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
b'FLEKIEPAQEEHEKYHSNVKELSHKFGIPNLVARQIVNSCAQCQQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN IMMUNODEFICIENCY VIRUS TYPE 2 INTEGRASE
publication title Refined Solution Structure of the Dimeric N-Terminal Hhcc Domain of HIV-2 Integrase
pubmed doi rcsb
source organism Human immunodeficiency virus type 2 (isolate rod)
molecule tags Integrase
total genus 13
structure length 46
sequence length 46
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1e0eA00
1WJFA 3HPHA 1K6YA 1WJBA 3F9KA 1WJAA 1WJCA 1MW7A 3HPGA 1LFPA 4F3QA 1WJEA 1E0EA 1WJDA 1KONA
chains in the Genus database with same CATH superfamily
2LYCA 2NS8A 2HQNA 2W24A 5ED4A 2LK2A 4PDKA 1B1BA 2MC4A 4B1RA 1A6IA 1UFMA 1NHAA 1ZK8A 1XPXA 4CCOA 1DP7P 3HRMA 2GXAA 2K9MA 1V5GA 4HLXA 1GDTA 5JLXA 2LTPA 1MH3A 2C6YA 1LJ9A 3FBNB 5D8LB 2IBDA 2HNHA 3O8HA 4XRFA 3OYEA 2PMUA 3Q9SA 4E7LA 4BYYA 3JAMZ 2UXNA 1UHSA 1FIAA 3I4NJ 1R23A 3VSLA 2XASA 1WQ2A 4S04A 3F21A 3J7AO 3AG1H 1R22A 3QPSA 2W48A 3F8FA 4A3MJ 3E6CC 1MMGA 2VXDA 1Q1HA 4EEFG 4FX4A 2MC3A 1UG0A 3GXOA 1WJ5A 3I54A 3GWZA 4DZJA 1BR2A 1S5LC 4P55A 2X9DA 2Y2ZA 5LGTA 1U8RA 1B72B 3F22A 3CDIA 4IVNA 4KUMA 2BZTA 2JWTA 3FM3A 1WJAA 3HRTA 4QIWN 1Y1VJ 2CSOA 1REPC 2DA7A 3UR3C 3CCUI 4D9JA 2VXZA 4PSXA 2RQQA 3HIFA 1JUPA 1LFPA 1G6NA 4FE4A 3A03A 2L9VA 4KICA 1HLVA 1SD6A 4ZC3A 2GOMA 2XUBA 3LNQA 1XSDA 2HXIA 3BDDA 4F7ZA 1YIOA 2LRDA 2JPBA 3DEEA 1G8XA 3GUDA 3HBLA 1ONVA 4CXFA 5F1JA 2X51A 3L2CA 2VJ5A 2ZMEA 4M3DA 1UMQA 5BQTA 1TNTA 5BOXA 1OYIA 2OZ6A 4UVAA 3DBHB 3KP7A 3VYSB 1RUOA 1QPMA 5F64A 3AL0B 2Y0SA 3WGIA 3FMSA 2FU4A 1X4OA 3KZIC 1ZG5A 3O2PE 1YJWI 4CZZA 4RB1A 2VJJA 1MBGA 1JTYA 1Z67A 5GTHC 1W4MA 2EZHA 3KP6A 1K61A 1WH7A 1BJAA 1H9GA 1B9NA 2V1DA 4E70A 3EYYA 2W85A 3ONQA 2HZTA 2QENA 4A93J 4Y3OA 3K4CA 3PFYA 3CCYA 4NDLA 3S1MJ 2EA4A 3ZMTA 3H1CA 4JX4A 2W84A 5DCMA 5K5OA 1MBKA 3QOPA 4L9VA 2HDDA 4RS8A 1RESA 1A31A 2XC7A 4BDYA 3RKYA 1F4KA 4J01A 2DMTA 3O8GA 3U1DA 3I3LA 5KVRA 5H20A 4HX4A 5JLWA 2PBIA 4L9TA 4RB3C 3CCEI 3IHUA 3BLYA 1JI8A 2YSRA 2CG4A 1CF7B 4BJ5C 4YFXF 4HDUA 1I1SA 1ETVA 2VJIA 4JOMA 3ZPLA 2DT6A 3KFWX 4S0HB 4C3HJ 4B09A 3KP4A 1SFEA 3LOCA 4FISA 3DTIA 4XRMA 3JRCA 3QP6A 4DBRA 1VQ7I 2KIUA 1AWCA 3OMYA 5E1XA 4PJJA 3QODA 1QZZA 2MH9A 2MD5A 1N77A 2M5WA 2X85A 3KEQA 3E0JB 1FOXA 3TP3A 1X1DA 2XKPA 2W7NA 5LRSA 1JTXA 1UELB 1W5CC 2M4GA 4PZJA 1MBEA 2HQAA 3V42A 2G7HA 1SD4A 3ZOBA 1J2XA 1Z1DA 2F5DA 3BPVA 4RGUA 3RYPA 4L5IA 4BQNA 2OC6A 2DMUA 5EZHA 4CO8A 3AL0C 4UV8A 3NRVA 2LKSA 1ETXA 1G3SA 4H4KC 2PJRA 2XAHA 3GZ5A 4A3FJ 1T0FC 4HA8A 3AAFA 2LD5A 2AXTC 4DW6A 3F8BA 1Z3XA 3RZDJ 3EQLF 1FBUA 2D1VA 4LJZF 2OD5A 4O6JA 4FE7A 1K78B 2LP0A 4JP0A 1SMTA 3HXLA 2FF4A 2EFPA 1YQAA 4II2A 4A0YA 4FCYA 2TDXA 3A4CA 1K79A 1XB4A 3B02A 3GTLJ 3G4SI 4Z2YA 2CUJA 2FXAA 5FD6A 2IRFG 3M8EA 2K02A 3RDIA 3ESWB 4PK4A 2XB5A 3CP8A 1FC3A 1FY7A 3TOAA 1XCBA 2M0CA 1I5ZA 3WGHA 2HOTA 2MGQA 3QU6A 2XF6A 4F55A 4RAZA 2GQQA 2RDPA 4WWCA 1TC3C 2R5ZA 2H1LA 4MQVA 1U78A 3Q0UA 1LUJB 1D5YA 1BI2A 2G9WA 2GOXB 3KP3A 4NC7A 4ENJA 2CU7A 2DMNA 2Z5UA 3U1KA 4HNTA 3CMAI 1O57A 3FMRA 3BJOA 4P5OA 3ZQHA 5HS7A 5B66C 4I02A 1ETWA 4C2MJ 4I98B 4L9JA 1T8IA 1WH5A 1XDSA 3JSPA 2XPWA 2OA4A 3EPZA 2VC1A 4DYQA 2ZJ2A 3KYLA 3VOEA 1XGSA 1BW6A 1SAUA 4NB5A 3HEFA 1S8NA 3E6BA 3WODF 3ZMZA 4EJUA 2PMZA 3I9V2 3F8MA 5GTIC 2RAEA 1VQPI 1RNLA 2LLKA 2OZUA 1V5EA 5E8IA 5ILUA 3AKZA 1G2HA 4ESBA 3H3UA 4WF2A 1YX3A 3J7YJ 5FB2A 5J3LA 2QLZA 2DK5A 4A5NA 4HNVA 1X3ZB 1ZQ3P 1XSVA 2EFNA 1QHGA 3T0YA 1FPQA 4UUSA 1UJ8A 4NC8A 2FSWA 1SAXA 3MKZA 5LFAA 1I3AA 4IEJA 1YS6A 4OWRB 1BJZA 4Z6YA 2VPRA 1OFCX 1B6AA 2EIJH 3M8FA 5F1RA 5ICCA 2ZJQF 2WAQA 1KQ0A 2W57A 4CH7A 1ZH5A 2CQNA 1MBHA 1G3TA 1U9OA 1YITI 2VOPA 3G3ZA 2FNAA 4N9IA 5M5YJ 4HOBA 4I99C 3SJMA 4AIDA 3OYDA 5K5QA 2E7WA 4IRIA 4HF2A 2X6YA 5FLVA 1VQ6I 4N4NB 1Q1VA 1SANA 2HS5A 1ON2A 2ZJRF 3VSKA 5DYMA 1WJFA 1IW7F 2FUG2 1K6OA 4Y7NJ 1VQ8I 2JMWA 5CVJA 1ULYA 2ZXIA 1FOYA 2COBA 1E3PA 3HOZJ 3RJPA 2K40A 2DCEA 2XIGA 4ZYHA 1XTAA 2EINH 2RQPA 2M4KA 2K3PA 4D0PA 4LIUA 4AIKA 2CMPA 1W36D 3LMMA 4A0ZA 3CUQB 5LHGA 5IP6A 3HDDA 2A5YB 1UAAA 1EA3A 4PJLA 5F6FA 5J6XA 2KL4A 3KP2A 4U87A 2DA5A 4BKXA 3HG9A 1D0YA 2X0LA 2H27A 4HX8A 4JK1X 3BC8A 2E35A 3I71A 2CFXA 3SDBA 3GFIA 3FK7A 1FTTA 2MH2A 1T38A 4A3CJ 1T33A 2ZMEB 4FHTA 5FKMA 1QZEA 3QPHA 3R0AA 3S3OA 1IV8A 2IGMA 2XF5A 2IS4A 4JBAA 3EUKL 1BC7C 2R7TA 2QZ8A 2L7ZA 1GLNA 3WU1B 5HLTA 3HOWJ 1EV7A 4UXNA 2DA2A 5C44J 1NG6A 5J4YA 1WHUA 2O8XA 5DEQA 1BR4A 2JA7J 1OISA 1U2WA 5KAFC 3D5RC 4A6EA 2DBBA 1A6QA 4U7DA 2L0KA 1X1AA 3HM5A 2NNNA 3RPUD 2ZSHB 3S2WA 3J81K 5JI6A 1MD0A 1LEBA 2IXSA 1B72A 2DLLA 2Z2SB 2ZB9A 2FMYA 4UB8C 4BL0B 2E2HJ 2UUZA 2R7OA 2KIMA 3P9IA 4A2UA 2VQHA 4ANJA 3TMOA 5DCMB 1HA8A 2NVUB 2L4MA 4CYCB 2JVHA 3GLXA 3HTSB 1SC7A 1G3WA 3QWLA 4IHXA 3ZRGA 3I59B 4RBOA 1RKWA 1MMDA 2CUFA 3I0TA 3O6BB 5FLMJ 2D45A 4LLLA 2XAFA 3TO9A 4BHBA 1EH6A 2JT1A 3QYFA 3OYHA 5B1BH 1IXSB 1T2KA 1P7JA 2L9NA 3FBIB 3OYAA 3R6SA 1X2NA 3HHHA 4BDZA 1HBXG 2HGCA 4ZH4F 3MKYB 3HSEA 5KCMA 3JRIA 1IV6A 4A0XA 1FYMA 1PYVA 2JRMA 1MJAA 2HTSA 1JT6A 1YE9A 2Q0OA 2R7UA 4KITB 2Z16A 1BC8C 2ZXWH 1B9MA 3RZOJ 2E1NA 2ECBA 3PSFA 5IYCJ 4F93B 2HVQA 3TOBA 2O8KA 2QSHX 3JAMK 5E79C 1ZYRF 2BE5F 4M3EA 3BG3A 3BZ6A 2ZMEC 3KYDB 3VB2A 3QRFF 2DFFA 1VZ0A 3BCAA 4AYBN 2MYSA 3BR1A 3V4GA 3KX2A 2OCCH 3WTUC 4HPQA 3OYKA 1QZYA 3CQZJ 2XGEA 3LFUA 4UVCA 3RPUA 1IN8A 5J8FA 4TV7A 4BQQA 1G59A 2F5FA 1QRYA 1FBSA 4XIDA 1TZLA 3BT9A 5BPIA 4DGWB 1L3LA 2LOOA 2VUMJ 3E1SA 3PIPF 1D1CA 2BY1A 2NOGA 4A3KJ 1S7OA 5DDGA 4KIFA 3TO7A 2YU9J 3TQNA 4KN4X 1SD7A 2F48A 3GZ6A 2DA4A 1WVRA 3KZZA 4HW0A 1YO5C 3IWZA 3Q9VA 2LF8A 1GV5A 4IO9F 2B7EA 2R7QA 3LA7A 2FQ3A 2X6WA 2E7XA 3BOQA 1CF7A 2GA1A 1XGOA 3IV5A 3WHBA 4BQAA 2JUGA 2ZCWA 4E7ZA 3ZMVA 3M07A 5BPDA 2YUSA 4XOPA 1XSXA 1HCRA 3TEDA 1B8IA 3QAHA 1WJEA 2F5CA 3GYHX 1IUYA 5E8GA 2R5ZB 2BHYA 2WAFA 2DMQA 4ESJA 3PUBA 3PL8A 1A35A 2X6XA 5HLGA 4BY1J 4UNOA 3HOXJ 1ZRFA 3GZNB 5CQGA 1KA8A 3LSGA 5JVGF 2HU9A 3S1QJ 4RAFA 1J7KA 3CJQB 9ANTA 2F2EA 3R0JA 1R4MB 5IT9K 2CH0A 3CZ6A 4OOIA 4Y17A 2V1XA 4AWXB 4Y13A 3OYBA 2XPUA 4OAYA 1ZARA 2E1OA 1V3FA 3Q5FA 1HDPA 2DJNA 4HLYA 4PJNA 3A02A 3OR1C 3K4KA 3VYTB 1FBQA 2WAEA 4M3BA 2DYSH 2BY2A 4UVBA 4RGSA 4BE0A 4M9ZA 4D1QA 2JA8J 2FBIA 3HOUJ 3A0HC 3PNTA 2CWEA 2E71A 1AU7A 5CJ9A 4KT6A 2BXZA 4FT8A 3FXQA 4XM3A 3DKYA 2CW0F 1OMIA 1SFOJ 4MO7A 2K9QA 1LE8A 3QU3A 1IN5A 5IPAA 3KZYA 3P9KA 3FXRA 1SFUA 3CJRB 1ZLKA 2DU9A 1FP1D 5E20A 3MMYB 2ISZA 1KU3A 2UZKA 1I6XA 2OJED 2E1CA 3M3YJ 2MBFA 4IRGA 3K4MA 2LBFA 4HV5A 5L3FA 1UCRA 1T98A 4IOCF 2OPTA 3L9FA 3MZ8A 2JZYA 2W00A 4IQ4A 3TDZC 4E7IA 5HS8A 2R7VA 4XMYA 2DT5A 3DTKA 4X0GA 1R5HA 1FX7A 3FDYA 4O5VA 4OIRF 1QGPA 2LNBA 4HYEA 3SQNA 2KFDA 1RR8C 5IY5H 1FIPA 2QVOA 1SFXA 2ZC2A 3M8JA 2K4JA 1ZELA 4G7OF 5FKNA 2K85A 1TWGJ 1IAWA 1TWHJ 1TWAJ 4MEXF 3OOUA 3QYEA 1VQMI 4NUBA 4YEJA 3I53A 1ZGJA 4ZYEA 3I55I 1A5JA 4KA4A 3SZGA 2DTRA 1Z91A 2XRNA 4BBRJ 1BI0A 1ERDA 1RKTA 4MIMA 1RR7A 3LSRA 3DCFA 3B6AA 2EH3A 4BQOA 3OYGA 3DBRB 4QLCU 1NG7A 3CDLA 3JR9A 1ETKA 2AO9A 5IYBJ 4CCLA 4KISA 4OU0A 2EV6A 2O61A 1IRZA 1OJLA 1D0XA 2YX4A 2ZBKA 4ESFA 1E17A 3CP2A 5F08A 1ETOA 4MTEA 2J5PA 1X1BA 2PMHA 2FX0A 1XGNA 1YG2A 2LC2A 4KIGA 3M4OJ 1WI3A 1ZG3A 3S2HJ 3JRHA 1ZREA 1TT0A 1WJDA 1I1GA 2PLYA 3DPUA 1AOYA 1F9NA 1H88C 3SZTA 3WTZA 5LGNA 1V5FA 2JK3A 4U0WA 4G7ZF 1D3YA 1JE8A 2NVQJ 1D0ZA 4WXDA 1A36A 3AG4H 2N8GA 3MEXA 1Y8RB 2R4GA 3M7GA 2OCEA 1D1BA 3BG5A 3C2HA 2XGCA 1RC9A 1R49A 2DOEA 2P5VA 3CLOA 5J4VA 1AHDP 3DLLF 1MSEC 1QA6A 1F36A 3C2BA 1O3TA 1ZG1A 2BBYA 2M34A 5ICGA 2VIXA 4YFNF 1GUUA 1KONA 5J40A 1G3YA 4GFBA 1Y6IA 1R5GA 1JKRC 2WY8Q 1R6RA 1TW2A 3ZGKA 3JRGA 3RCOA 2JQ7A 3E6MA 1OLTA 3COAC 3OSFA 1BOAA 3SFZA 2R7SA 1QHHD 2YS9A 4BJTA 3CUQA 4XN0A 3MWMA 1QVTA 3OWTA 1P4AA 2VI6A 3ZN0A 1TNSA 4LD5A 1IN6A 4BS9A 2EBIA 2LR8A 1D8JA 1FMWA 5FLXZ 4M9SA 4WK8F 3CJNA 2XV4S 3LSHA 3CCSI 2QUFA 1KGSA 4UB6C 2MA3A 2QQAA 4XLNF 4BGDA 4RM3A 2BVLA 3HJEA 3BTCA 2GA2A 3S16J 2KQRA 4FQGA 4AIJA 1ZN2A 5BNGA 2BOLA 2OQGA 3BR6A 4XLCA 3AFHA 4IOAF 4P96A 4QPQA 5FRNA 3J80K 1ZR4A 2AHQA 5M3FJ 4CCNA 3A2KA 4M6YA 1DUXC 1TW3A 1FSEA 2K5CA 1R4NB 1P92A 2VLAA 5BMZA 1ZTRA 3CCQI 2F5EA 1U9NA 2HDWA 2X4HA 3K10A 1JHHA 3HB9A 2ADUA 3TDUC 1LPQA 3X2QH 2A6EF 3V7SA 4RMNA 4II3A 3PJRA 1K6YA 5CYVA 4EJVA 4A69C 1M1EB 1P4WA 3DPTA 4JQFA 1J9IA 3RTRA 2M7AA 2R93J 3BQZA 1IRXA 1QQIA 2Y69H 1JGGA 1Y0NA 4YIFA 4CYCA 3MKWB 2HWVA 4WXHA 4MTDA 1T08B 5FKLA 5IYDJ 3QOEA 1TP4A 1FSHA 3I59A 1P7IA 3NWTA 2EILH 2A05A 2E5ZA 3FISA 1ENHA 1PUEE 3DXJF 1D5VA 3AG2H 4PFOA 2CW7A 3WE2A 1QPIA 2EV5A 2P8TA 1IF1A 4JX6A 1STZA 1VI0A 3G1MA 4F52A 1BR1A 2HTJA 2EQRA 4CCKA 2DA1A 2W82A 2ZO4A 2CV1A 3HSFA 3SHFA 2DA3A 3IKTA 3MQ0A 5GAGJ 2XAGA 1BM9A 1BW5A 3HKZN 4A3DJ 2R7DA 2Z9OA 3RKQA 1B8IB 3GX4X 3JCUC 2X1EA 1W36C 4XSXF 2ZNZA 4H0EA 4J19A 4EGZA 4BE2A 1IN4A 2BEOA 4OMZA 1OCCH 3GTMJ 2K9LA 2E19A 1TQMA 2V9VA 4NHJA 5C4XJ 2P5LC 4BNCA 2ZXJA 3RI4A 5J47A 2CUEA 2H09A 4YFKF 3EETA 2KLOA 2XGDA 2Y30A 4I6ZA 3R60A 3S14J 3S8PA 1MW7A 5GPAA 1PVEA 1E0EA 2LFBA 2QYOA 2VB6A 3DTEA 5LRRA 1YLFA 2KHMA 3CDHA 3RSNA 5TJJA 1W0TA 1HC8A 4N4OB 4YELA 2H1KA 2VE9A 2OTJI 1W1WE 2NNYA 2STWA 1U5TB 2FE3A 3IAM2 1LKXA 2ZJPF 2HZDA 2BVMA 1J59A 1XMKA 1VTNC 2L5QA 4BUPA 2LREA 2XPVA 4GO1A 1MKMA 2JPCA 3HRSA 4GDFA 3ZMDA 2QF7A 4WX9A 3WTTC 4P9UA 5LEJA 2M87A 3GBGA 3K4JA 1LE8B 1S9HA 1SVLA 2EZIA 1K4TA 1OQYA 2DK8A 2A68F 3K1MA 4ASNA 1OR7A 2R5YB 1U8BA 2ME0A 2R7FA 2WB1N 3L2QA 2ACJA 2LBFB 4FETA 4LLGF 5E17F 5IOZA 2B63J 1WKMA 3ZQIA 4LGWA 2VKEA 2H8RA 3QP5A 4QPOA 1XCVA 5DV5A 3IH3A 2XRLA 2I8DA 3H0DA 1FLIA 3BG6A 1O3RA 1RZ4A 1HOMA 1S7EA 2DOAA 3LL7A 4EMSA 4U7BA 4PJ0C 1IXRC 2HR3A 3TW6A 4HF0A 5EF6A 4RGRA 1SVMA 4EATA 1FYKA 2JA5J 1YW9A 3N05A 4LITA 1GXPA 1WGXA 2LSOA 3E6DA 2JA2A 1X3UA 2L4AA 2DQRA 2UV1A 5HOOA 3FF5A 3OYLA 2DFEA 1U6GA 3P9CA 4IF4A 3V7RA 2VBXA 5EG0A 2E60A 2HYGD 2RKHA 3U9GA 4PGHA 2EA2A 5CKTA 3HOSA 3MD2A 5D6FA 5D5XB 2EK5A 4E6KG 2DMPA 2MW8A 3GF2A 4D5FA 2HVRA 2L9RA 1J5YA 3H0GJ 1ZGAA 3K69A 2P7CB 2VODA 3F6VA 4G8XA 1U5TC 2LY2A 5CVVA 4XBFA 3BR2A 1OYYA 5HNFA 3IL2A 2X6OA 3OR2C 2K9SA 5DS9A 2KJBA 2VBZA 4OIQF 1USSA 2AQEA 5ILSA 4ZZDA 2X48A 3L1PA 1L0OC 1PJRA 2IS2A 5EGOB 2P81A 2V9PA 2BGCA 3ZP5A 4G12A 4EGYA 4Q48A 4M72A 4XKWA 2GIZA 1I50J 2GAUA 3OL4A 4L5EA 3SXYA 3D1NI 3IUOA 2XDVA 2Z99A 2ZFWA 4YRVA 2L54A 2DT7B 3IKVA 4G9YA 4W1UA 4ABZA 3NAUA 4EJTA 3WTXC 2M1BA 4XKBA 4IHTA 4AC0A 4ENKA 2V9KA 3DLAA 3MVPA 3LFKA 5ERIA 3BR3A 2FBKA 3P7NA 4K2EA 3L7WA 1GV2A 3BTLA 2HQRA 1HSJA 3BJAA 3FXKA 3HOVJ 3SDGA 3BPXA 1DGWY 4I2OA 3CD6I 4F3QA 3CMMA 5K1YA 4C3JJ 2O6GE 2WV0A 3FX3A 4C30A 4A12A 4XLAA 3E5QA 2W4SA 2DI3A 3V8KA 4KNYA 2EFOA 4LG3A 1X1PA 2Z3YA 5DUIA 2R7ZJ 1WCMJ 3Q0WA 4HRIA 2KRFA 2Z33A 1CQTA 1HXDA 4HX7A 1XC5A 1QBJA 3LWFA 4A3EJ 3FZVA 3JTHA 3OIQA 4HAMA 3TP0A 1C0WA 2FNPA 2WBMA 1U0JA 1HSTA 1IUFA 3OV8A 1LEAA 2V79A 2KJCA 1XG1A 5KK1A 1XGMA 1TQPA 2BW3A 1H9TA 5KNLA 4AVPA 2IA0A 4L0YB 4IHVA 3H3ZA 4L0ZB 2L01A 3OL3A 2NAZA 3E7LA 1I39A 4ZDOA 2ZFUA 4HQEA 5D4SA 1FJLA 1OCTC 4C9YA 3H9QA 2GXGA 3WHCA 4RM2A 3QPTA 1R58A 3D5SC 1Z0XA 4V2FA 3FKIJ 2KDZA 2FQ4A 2KIFA 1FOWA 3B73A 2PX9A 2CUZA 3F0CA 5GADJ 3TBIA 2NS7A 3L09A 4M3GA 1W7PB 2GWRA 1FWZA 1IO2A 1Z6RA 3K70D 5BS6A 4UV9A 1X4PA 1ZKGA 4PGGA 2Y9ZA 2M9HA 3KLOA 2VT3A 1BIBA 2M30A 5F0HA 5TISC 1FTZA 3H3VK 4G6TB 3FIWA 3R4KA 4NQWB 4LB5A 1Z7UA 1WI9A 2R7XA 5JR3A 1XN7A 2IGOA 1MNDA 4M74A 1AKHA 4A5MA 2D5VA 4DNCA 4M71A 1Z9CA 2R3SA 3GVAA 4PSWA 1O7LA 2DXIA 3CC4I 3OYIA 2QBYB 3M9AA 4C2UA 3NWSA 2DDBA 3KIOA 2HVSA 1GVDA 3V7CA 3J7AY 4I01A 3IH4A 2HKXA 3K4NA 5F0FA 3TW7A 2RREA 3CUQC 2AQFA 1BA5A 4A6DA 5FFXA 4A3IJ 1Z77A 3IWFA 2Y48A 2PJPA 4GGGA 3E97A 1TQIA 2O03A 4I0AA 3JSOA 1SVOA 3G73A 2JSCA 3F8NA 4G6QA 4N0BA 4DYCA 4KMFA 1HW5A 3K1NA 2JN6A 4XL9A 4LIVA 1KYZA 4GRIA 3GFMA 1UG2A 5LHHA 4CA0A 1XS9A 2M3AA 1O3SA 3FXUA 5CQEA 2E1MB 4CSWA 2A5WA 1WWXA 1SFKA 4BAYA 1DQUA 4LFUA 4KT5C 4BXUA 1GHCA 1OYWA 2JA6J 1ZGWA 5GP9A 3CCMI 2YPRA 1UZCA 5FKKA 4XLFA 3CCLI 1RIOH 3ASNH 1YS7A 3PQKA 4G94A 1IDZA 5D4RA 2VKDA 3PFIA 5DM6F 2BYVE 3WU0A 2GZWA 3N97A 4ON0A 3U21A 2D1HA 3B6CA 5K5RA 4Q4ZF 5LEKA 5CVRA 2DODA 2DPUA 2QWWA 4XKVA 5ILVA 3JTGA 2QKMB 3VFZA 1K4SA 1ZRDA 2OAZA 4XOTA 1NH3A 4B44A 1V55H 3MAJA 5EEGA 2Q2EA 5DD4A 3G2BA 2CGPA 3E3VA 2WY7Q 1DDNA 4RAGA 2R92J 3SEQA 3N4MA 4IKFA 1FMVA 3W3CA 2Y0MA 4BACA 4IHWA 3CESA 2IJLA 3RQIA 4CYDA 2F4IA 3MCZA 4EM2A 5JVTA 1RETA 3K9TA 5GPCA 1QNTA 1I3QJ 1D1AA 3DP7A 3MKLA 3CMYA 5CLSA 4B4CA 1IJWC 2HOSA 3FXLA 3HGYA 4PFPA 5J1UA 2EFWA 4HSRA 3LA3A 5K7HA 5HVQC 4M9XA 3KCCA 1FNNA 2RVCA 2NS0A 4V19K 3CCRI 1Z21A 1MIJA 4ENMA 2HOAA 2YX7A 2ZXHA 1TWCJ 3TO6A 2IVMA 4GXOA 1KYWA 3E5XA 1LDJA 3BR5A 3S32A 1GXQA 2DDAA 2CFOA 2VBYA 3GTJJ 3F3XA 3GTKJ 3G1OA 4KDPA 3HOYJ 2WA0A 4AM3A 1ZAOA 3W2VA 4L9NA 3KETA 1U5TA 4B3AA 3IRRA 2E1MC 4E7SA 4FX0A 2M2EA 1RRJA 1MMSA 2IA2A 2CS3A 5EG0B 3GTGJ 4RDUA 4XSZF 2UXXA 3GFLA 1MDMA 1IDYA 2ELJA 3L00A 3LSTA 4NNJA 3WTYC 2QQ8A 2EIKH 3WE3A 3PIOF 2XGXA 3A0BC 4G7HF 2KISA 4XORA 4NC6A 5TRDA 4AUXA 4CGZA 1NTCA 4HG2A 1J09A 2RC4A 3I64A 2R5YA 3SZPA 2IPQX 1I6HJ 2G7UA 5C4JJ 1E3OC 4I76A 1YRNA 3ABMH 4D7NA 1BI1A 3RQ4A 5FRMA 4XLEA 1MBJA 1F1ZA 2KRCA 4DIQA 2EFQA 3ECHA 4RB2C 4WXCA 2PQ8A 5AONA 3BG7A 3VYUB 5FD5A 3DFGA 2XROA 1OR7C 3I5UA 2KRHA 3LSIA 1ZRCA 3DKWA 3MN2A 4B8XA 5HLHA 5EJCA 3KEOA 3PO3J 4M73A 2A07F 3GW2A 2H6BA 2DN0A 2M8GX 3M1CA 3V8JA 3CC7I 1YFHA 2L7MP 2KT0A 5J8CA 3TGNA 1S7AA 2NYXA 3H5NA 4Y33A 2QA4I 1Z05A 2NOJB 4LG0A 4AYBA 2CQQA 3DWLE 2Z1DA 2CQKA 2JJ7A 2FOKA 1AA7A 3ZQQA 2RNGA 3FHNA 5KHDA 2LKPA 2QQBA 2E36A 2F4OB 2RV8A 1YX5A 4DJAA 3QQAA 3CJTB 2VL8A 2HYJA 4DQ2A 1RPWA 2V1NA 5CVUA 1MBFA 3VEPA 2HYFA 1R1TA 5EGOA 4RGXA 2BW3B 2K7LA 1OCZH 2VKVA 1U3EM 4RAYA 5FFZA 2VPLA 3ZXSA 4IHYA 5EZGA 4HNUA 3BJ6A 3K4LA 4A3LJ 2DW4A 2IGNA 1ZR2A 1PDNC 2DA6A 3S1RJ 1W5TA 2LKXA 3BR0A 5M5WJ 2HKOA 2O5RA 3EUHA 5FGMA 1MSFC 1VQKI 3HUGB 5DUKA 4B3XA 4HSTA 1TL8A 1W7PD 4JX5A 2EWNA 2HFHA 2JVGA 2VQLA 5B3SH 4XRSG 1NK3P 2QSFX 2KZGA 4L5JA 4Y4RA 3F23A 4IZZA 4C2TA 5C3EJ 4HV6A 3G1LA 3ABTA 2UWMA 3CCJI 3JW4A 5B1AH 2Y75A 3VDXA 3UNGC 5A2QZ 4E7HA 1Y8QB 3ELKA 2VJ4A 4UUVA 4XQFA 2PFBA 2NVXJ 2QSGX 4UUTA 5DTDA 4EM1A 2RN7A 3IC7A 5KAIC 1KQ9A 1J75A 4IQJA 2V6CA 4BE1A 1VQ5I 1AKHB 2LMDA 1G4DA 2L3DA 4G6DA 1JT0A 2G0EA 1YIJI 2M7BA 4XN3A 3S3NA 2IW5A 1R7JA 2F6CA 2K86A 3HPGA 2OTLI 3FHZA 1UB9A 1ZLJA 2MD0A 4ZDPA 3HOTA 4LK0F 5IP7J 1R5ID 3HL2A 5DM7F 3KPHA 2R0QC 3GO5A 1UHWA 2O3FA 2VQCA 2V6EA 1YYVA 2FD5A 2KPMA 2HPIA 3KLNA 2V1UA 1PUFA 3CUOA 4DZPA 5HDNA 1ODDA 5E1ZB 2A61A 2CQXA 2KKOA 3W6KB 2L7KA 2VN2A 4Y15A 2L9SA 4XR6A 3DEWA 1TT5B 2IGKA 4LLNA 1T56A 4X1EA 1GT0C 1OPCA 2LDUA 1W7PA 4UY8I 4KYWA 2M0MA 1MJ9A 5JHUA 3OS0A 3H5AA 3DPLC 3F72A 1BIAA 4XKCA 4QSHA 1F43A 4MNUA 2ME6A 3ULQB 4A3BJ 1USTA 2HQ5A 3OS2A 1PP7U 5D6EA 1DU0A 4NQWA 4PJMA 5IT9Z 2PMZN 3U2RA 2EZKA 1F5TA 3ZMUA 1VQOI 3L2UA 2QCOA 4IL6C 2HOEA 2FEZA 3EDPA 1LFUP 3ABUA 3FKJA 5F0CA 4ZTFA 4Y52J 3C2GA 4KFCA 3S1NJ 1XD7A 1OCPA 5IP9J 2QBYA 2Q2EB 3SFIA 1MGTA 3RKWA 6PAXA 2XAQA 1YHQI 5HS9A 3I4PA 3AG3H 3DEUA 2BXYA 3H92A 4I09A 4XNFA 3T1BA 2A69F 2AS5F 3A01B 3LSJA 4RLFA 2VT2A 3EYIA 2GIVA 4CHUA 2FMLA 3FMQA 3BY6A 4I0BA 3FXOA 1MZBA 1PP8F 4XK4A 3CO6C 2WAQN 1TBXA 4E7KA 3OY9A 2DYRH 2ECCA 3JREA 3SYTA 5D5WB 1KU2A 3JRBA 4MFEA 3LSMA 1EH7A 3PO2J 4E4HA 2LF7A 5D5UB 1R1VA 4DBQA 3WTWC 1Y0UA 2L2OA 5HLIA 2IT0A 1YJNI 5FO5A 1HKTA 1S3JA 4Q5SF 2P5KA 2R7WA 2IEKA 3HRUA 3H5RA 1E3HA 1HKQA 3HTUA 2WV1A 1N25A 3BG9A 4HEA2 4MFDA 4XICA 2MLKA 5L3EA 1IGNA 3MZYA 5DCFA 1JUMA 2IP2A 2DJIA 2LY9A 2W25A 3ZQGA 2X1CA 5H6RA 2V7FA 4B43A 2Q8KA 4LMYA 3ZQ7A 4RB0A 2K4BA 4IX7A 1W5SA 2BV6A 4WCGA 3OYMA 4E7JA 4KIBA 1BL0A 1QU3A 1EF4A 1WZ2A 3RYRA 1OKRA 1MDMB 1V4RA 5E1WA 1Z7LA 2J5OA 3K70C 4XONA 2QKLB 5L3GA 2B0LA 1DPUA 5HODA 1SEUA 3LSPA 1X19A 3ZCOA 4ITVA 2B9SA 4IHSA 3OYJA 1R9TJ 3ABLH 4Q47A 4V2GA 1YI2I 3K2AA 2ZNYA 4MEYF 3LSKA 4QTRA 4ZYAA 5M5XJ 5HDGA 4M6VA 1YRNB 2Y9YA 3PNYA 3VYRB 4FTHA 1S6LA 1FT9A 4ZYDA 1ORKA 1N78A 5LD2C 3W2AA 2TRTA 3PNVA 5CVIA 2LH9A 5JHFA 2D2WA 2OU2A 4FASD 2QQ9A 2VKHA 4BY7J 1MMAA 5E3NA 2RNJA 4D5CA 5ICEA 4JYKA 4BBSJ 1JHFA 2KP6A 2WADA 1JGSA 2JRTA 5EEHA 5F04A 4MHGA 3HHGA 2DO7A 2LVSA 2IS1A 5TGTA 1IRFA 2XKOA 5H6QA 1KU9A 2GBYA 4GYIA 4XLPF 3FXMA 4BU2A 2DOFA 1POGA 3KEYA 1MMNA 2XF7A 1IRGA 2AXLA 2ELKA 3OYNA 3WTSC 4AVZA 1LB2A 4LG0B 4S05A 3I4MJ 1N75A 1NK2P 3S3MA 2EPFA 1HW1A 2CRGA 2DTZA 3ZR8X 3CO7C 2WC2A 4MQ9F 2V26A 2GLOA 3HSRA 3GCMA 3ISPA 2VASA 4LOCA 3C3WA 1CGPA 1D8KA 4CCMA 5L3DA 3PUFA 2I5UA 1VNDA 5GAEJ 2H94A 2EB7A 4A3JJ 5LBQA 1MNEA 4M3FA 1FZPB 3C18A 4IJAA 2I10A 1UHMA 3KE2A 4MLOA 3FXJA 2GXBA 5D8KB 2QEXI 3F6OA 4U0VA 2HEOA 1ETYA 1X1CA 2M8EA 4YIRX 1XMAA 1MJBA 3JRAA 1WSUA 2MLGA 1DU6A 2OBPA 1KU7A 3T8TA 3S17J 2BY0A 3OIPA 3MFKA 3WGGA 3R61A 4BH9A 3VODA 3HKZA 3K0LA 3JRFA 2CQ7A 2NRAC 1FP2A 1R36A 2IAIA 2WTEA 3Q0VA 3IH2A 5B5EC 3J80Z 5AIPA 1SD5A 3VWBA 4D7MA 4BJ6C 1IZ1A 3CF2A 3BP8A 4M6XA 2NVYJ 1H0MA 2NVTJ 2Q1ZB 1VQ9I 1TWFJ 4KN7X 2L02A 2EV0A 4F91B 5JFRA 3DU6A 1A04A 1S29A 4P1WA 2ELHA 1FEXA 3FWEA 2O7OA 3K6GA 2CO5A 2HDCA 2ETHA 2ICWG 5E3LA 2PG4A 3JRDA 3HZJA 5HDKA 3EUAA 4LB6B 5D5VB 2XAJA 1P2FA 3KP5A 3DF8A 4BEHA 2A6TA 3I56I 1K83J 2ID3A 2VBWA 2PN6A 3OOPA 1IXCA 4HQMA 4UHTA 3RIRA 3W6VA 4HZFA 4ZJZA 1Z3YA 2PI0A 5FKOA 5L3BA 1KQ8A 1IN7A 2FRHA 3M1EA 1DGRM 1LVAA 2ESNA 3RKXA 4IXAA 3T8RA 1ETQA 1PUFB 2XB0X 3PM1A 3W6JB 3FK6A 2WB1A 3HUGA 1T39A 4CUGA 1YTYA 3F9KA 4EJWA 1OCRH 2BY3A 4IRHA 2M45A 1QO0D 1JKPC 3CCVI 3ERED 2A6HF 3GTOJ 4IPAA 1EH8A 1IC8A 1HKSA 2DAOA 4W97A 3CC2I 1JJ6C 4ENNA 1P9QC 3TKYA 2FJ1A 3OIOA 1O4XA 4EVIA 3GTPJ 4OINF 2A3SA 3KYCB 3EUHC 2EJRA 2P4WA 3K4BA 2E34A 1P6RA 2QGUA 2VE8A 3L2WA 2ZKZA 3L2RA 1R1UA 2DFHA 2KIQA 5EEAA 1JKQC 2OUMA 2TCTA 4R1HA 3LAJA 4X6AJ 3CMEI 1SMYF 2KDOA 2O0YA 3WTVC 2CV2A 1ZHFA 1FOKA 4F92B 3S15J 5LHIA 3HC7A 1X2MA 2FOWA 2JTVA 3OYCA 2XSJC 4MGRA 1RUNA 2FA5A 4U88A 1XMXA 1KZHA 2X1DA 3BROA 4ZYGA 3DV8A 3F8CA 1LDKB 5M3MJ 5ICFA 4AIHA 3C7JA 5GAHJ 3OYFA 3S2DJ 1JUSA 4OIOF 3BCBA 2EZLA 3NARA 4C3IJ 3SEZA 1LVKA 1Y56A 3UKGA 5IT3A 4DOZA 2ISYA 4OIPF 3Q3SA 1DP3A 1OCOH 1WPKA 2KZVA 4BXXJ 4AD9A 3IRQA 3FM5A 1S72I 4BHPA 2JSPA 3ZMSA 1HW2A 2STTA 1T95A 1HF0A 3V8LA 2R7RA 1R00A 3S93A 1FYLA 1BI3A 1B59A 3H9GA 2P0WA 1YJ9I 4PCQA 4B48A 3K2ZA 2H8WA 4J00A 1YOVB 4ZZLA 1R71A 3LQRA 3WG9A 3H35A 3H9JA 3C1DA 1T0FA 5LGUA 3OSGA 2YR2A 5A2QK 2H6CA 1V54H 5FROA 1VQ4I 2VONA 4A3GJ 3L2VA 1T6SA 3I58A 3BQYA 2OV7A 5J1YA 1YW8A 2NXNB 3PSIA 1LQ1A 3O3KA 4CZCA 4RA2A 2HI3A 5E3OA 4P9FA 2KMUA 5DD8A 2PJRB 2VQGA 2FBHA 3NQOA 5FLXK 2GM4A 3ABKH 3A01A 3K1PA 3ERMA 5CPRB 1LFBA 3RPQA 4ETSA 1E2XA 2HXOA 2E2JJ 3GFJA 1BBYA 1W0UA 2Y31A 5EDNA 5J1RA 5K7ZA 3BTIA 1RI7A 2CV0A 3DKXA 1WRJA 4I7HA 3G6EI 2CW8A 2DQLA 3GMEA 1LNWA 1VQLI 4L18B 2W1OA 1ACIA 2K9NA 1DPRA 3ML6A 4XRSA 5IOYA 2QM3A 4OAZA 1H8AC 1MNMC 3IAS2 2VC0A 3CLQA 4XLHA 3IP4B 1Z6TA 3ASOH 2CJJA 4HF1A 4ZDLA 3D0SA 1XX5A 4EV0A 1ITYA 2IA1A 2LY1A 2XHKA 1EKEA 3BWGA 1BN5A 4N9HA 4RLQA 4KJZA 4EJOA 3H36A 3TL4X 3J7ZI 2WWYA 5FJ8J 4R8HA 3REOA 1YW7A 2V4JC 1WJBA 3A1YA 2E2IJ 2ZSIB 4R79A 1X3WB 2XSDC 3QYBA 2COMA 3VPRA 2XAUA 4CDGA 1VQNI 1TTYA 1O7FA 3W2WA 1VF9A 3MZHA 3DU5A 3ECOA 4O3MA 1HQCA 4HBLA 3WU2C 1I27A 2F4MB 2LG4A 3WG7H 4CICA 3BZCA 2CYYA 4KMUX 2EIMH 5LLQA 1P4XA 2ID6A 5H2FC 3D5LA 1K78A 4BXFA 4HDVA 1MH4A 4NBQA 2MABA 3ZQCA 3PQJA 2XVCA 5E3MA 2DPDA 3OS1A 4CCJA 2ESHA 4DYRA 2YU3A 2K27A 3G71I 2PEXA 3CF5F 5E18F 3ROUA 4UUSB 4QWQA 3DQVC 1WJCA 1JXSA 1JKOC 1O3QA 2Y0SN 2DFIA 5HNHA 3P5JA 1LDDA 3CTAA 3GLLA 3GEZA 3NEUA 1XDUA 1J0RA 2L7FP 1APLC 2MG4A 3BZKA 3LA2A 4OMYA 4U0YA 2OF7A 2RGVA 1QVUA 4ZTJA 3QPLA 3HGGA 2E5NA 2K3FA 1IG7A 5L3CA 3DBLB 4PUSA 3ZN1A 2P7VB 2IS6A 2P6TA 2HPMA 3HYIA 4EM0B 3E5UA 2MFZA 2O9LA 3J81Z 4GYGA 1Y39A 5EYRA 4B47A 1TLHB 1HDDC 4LK1F 3ZQLA 1VFCA 3HPHA 1X58A 3T5XA 2MSYA 3BTJA 4BEHB 4EQQA 2F5VA 1H89C 1ON1A 4AU7A 4BHCA 1WFXA 5K7FA 1JJ8C 1EJ9A 3LAPA 1B4AA 4YG2F 3K7AJ 2VOOA 1Y1WJ 3GTQJ 2BHZA 4GCVA 3ZQFA 5AIQA 2P6SA 1GVJA 4YIIA 1BOBA 2OQRA 1K7AA 5F27A 2JUCA 3LQQA
chains in the Genus database with same CATH topology
2LYCA 4DGWB 2LOOA 3LSMA 3E1SA 1D1CA 4E4HA 2MC4A 1DGWY 4DBQA 3CMMA 4F3QA 2L2OA 4CCOA 4C30A 2R7WA 4XLAA 2W4SA 3H5RA 2K9MA 1V5GA 4LG3A 2R7QA 4HEA2 2X6WA 4HRIA 3FBNB 2DJIA 2HNHA 2X1CA 2V7FA 3OYEA 3OIQA 4B43A 2JUGA 4E7LA 4E7ZA 4IX7A 3OYMA 4E7JA 1QU3A 2WBMA 4XOPA 1U0JA 3VSLA 1WJEA 2BW3A 1MMGA 1Z7LA 2VXDA 2WAFA 5KNLA 3K70C 3PUBA 4XONA 1UG0A 3PL8A 2QKLB 1WJ5A 2X6XA 1BR2A 3OL3A 1X19A 5CQGA 3ZCOA 3LSGA 4ITVA 3OYJA 4ZDOA 2HU9A 3LSKA 2ZFUA 4ZYAA 3CJQB 4C9YA 2CH0A 3CZ6A 3OYBA 3PNYA 3VYRB 3H9QA 4OAYA 4RM2A 1N78A 5LD2C 3D5SC 1WJAA 3W2AA 3PNVA 2LH9A 4PJNA 3OR1C 3UR3C 5JHFA 3K4KA 3VYTB 4D9JA 4FASD 2WAEA 2CUZA 2VKHA 2VXZA 3TBIA 4PSXA 1MMAA 4BE0A 2RQQA 1LFPA 3K70D 4D1QA 2KP6A 2WADA 1X4PA 4ZC3A 2GOMA 3PNTA 4KT6A 2IS1A 4XM3A 5TGTA 2LRDA 3DEEA 1G8XA 3DKYA 4G6TB 4NQWB 2X51A 2R7XA 4BU2A 2VJ5A 2IGOA 1MNDA 3KEYA 1MMNA 3CJRB 2XF7A 3MMYB 3OYNA 4PSWA 4AVZA 3VYSB 3K4MA 2DXIA 1N75A 2LBFA 3OYIA 4C2UA 3AL0B 2Y0SA 3NWSA 3ZR8X 3S3MA 2HVSA 1X4OA 2V26A 2W00A 4IQ4A 3J7AY 2VASA 4E7IA 2R7VA 4XMYA 2VJJA 3K4NA 3DTKA 4X0GA 4CCMA 3FDYA 2RREA 2AQFA 1MNEA 3M8JA 3ONQA 4MLOA 1ZELA 3K4CA 4Y3OA 3PFYA 1X1CA 4XL9A 3OOUA 4LIVA 3QYEA 4GRIA 4NUBA 4YEJA 4CA0A 2XC7A 4BDYA 2M3AA 4J01A 5CQEA 2E1MB 3SZGA 4CSWA 3I3LA 2A5WA 1ERDA 1SFKA 3OIPA 1DQUA 4BQOA 3OYGA 3HKZA 1NG7A 4XLFA 3BLYA 1JI8A 4BJ5C 2VJIA 4JOMA 2DT6A 2VKDA 3U21A 4CCLA 3VWBA 4KISA 4BJ6C 3CF2A 3DTIA 1D0XA 2Q1ZB 4XKVA 2QKMB 4XOTA 3CP2A 4F91B 4B44A 3DU6A 4DBRA 3OMYA 4P1WA 4PJJA 3QODA 1X1BA 2LC2A 1N77A 3K6GA 3G2BA 1TT0A 1WJDA 2WY7Q 2X85A 3DPUA 3SEQA 3E0JB 1X1DA 1V5FA 2W7NA 3EUAA 1UELB 2M4GA 4IKFA 1FMVA 2HQAA 3W3CA 3V42A 1D0ZA 4BACA 4BEHA 2A6TA 3CESA 2F4IA 2R4GA 1D1BA 3C2HA 4BQNA 2OC6A 4ZJZA 1D1AA 3AL0C 1Z3YA 4H4KC 2PJRA 4PFPA 1T0FC 4HSRA 1Z3XA 5HVQC 2VIXA 1DGRM 1KONA 1Z21A 1Y6IA 3HXLA 2ZXHA 2WY8Q 1R6RA 3ZGKA 2WB1A 4II2A 4CUGA 3A4CA 3F9KA 3RCOA 3S32A 1OLTA 2CFOA 2CUJA 2R7SA 1QHHD 2WA0A 3W2VA 4BJTA 4PK4A 4XN0A 3CP8A 3OWTA 4BS9A 1P9QC 2E1MC 4E7SA 2CS3A 1FMWA 3LSHA 2XF6A 3EUHC 2ELJA 4F55A 3K4BA 4BGDA 4RM3A 3L2WA 4NNJA 2BVLA 3L2RA 2OUMA 2KQRA 4XORA 2BOLA 2GOXB 4HG2A 4NC7A 1J09A 4XLCA 2KDOA 3AFHA 2CV2A 4F92B 4QPQA 5FRNA 4HNTA 3HC7A 4P5OA 4CCNA 3A2KA 3OYCA 2XSJC 2K5CA 3EPZA 3RQ4A 5FRMA 2VLAA 2X1DA 4XLEA 3KYLA 2KRCA 2HDWA 1LDKB 3K10A 1SAUA 4DIQA 3OYFA 2PMZA 3BG7A 3BCBA 3I9V2 3VYUB 1OR7C 2KRHA 3LSIA 4RMNA 3SEZA 4II3A 3PJRA 1K6YA 1LVKA 1V5EA 1Y56A 3AKZA 4DOZA 4JQFA 3DPTA 1YX3A 3RTRA 2M7AA 1DP3A 2KZVA 1IRXA 2JSPA 3MKWB 1QHGA 3M1CA 1T95A 4NC8A 3QOEA 2R7RA 3NWTA 3MKZA 5LFAA 2E5ZA 3H5NA 4Y33A 3S93A 2NOJB 4OWRB 4PFOA 4AYBA 2CW7A 3DWLE 2Z1DA 2P0WA 3H9GA 4B48A 1AA7A 4J00A 3ZQQA 4F52A 2RNGA 1BR1A 2WAQA 3FHNA 5KHDA 3H35A 3H9JA 4CCKA 2W82A 4CH7A 2CV1A 5FROA 3L2VA 2OV7A 1YX5A 4DJAA 2VL8A 3PSIA 1W36C 2V1NA 2X1EA 4CZCA 3OYDA 2KMUA 2BW3B 2X6YA 4BE2A 4N4NB 2PJRB 2VQGA 2VPLA 3ZXSA 3VSKA 4HNUA 2K9LA 3K4LA 1WJFA 2IGNA 2FUG2 5CPRB 2ZXIA 2KLOA 2CV0A 3DKXA 2O5RA 2DCEA 2CW8A 1MW7A 3HUGB 3S8PA 4B3XA 4HSTA 1E0EA 2VB6A 3RSNA 3DTEA 2KHMA 2JVGA 2VQLA 2W1OA 4N4OB 4YELA 2M4KA 4Y4RA 2K3PA 1W36D 4LIUA 4IZZA 2CMPA 4C2TA 3IAM2 3LMMA 1LKXA 2UWMA 2HZDA 1UAAA 2BVMA 4OAZA 1EA3A 4PJLA 3IAS2 4XLHA 2KL4A 3UNGC 3VDXA 4E7HA 3IP4B 4U87A 2L5QA 4BUPA 2LREA 3HG9A 2VJ4A 1D0YA 4XQFA 4ZDLA 2LY1A 3BC8A 4RLQA 3SDBA 3GBGA 4IQJA 4KJZA 4BE1A 3K4JA 1S9HA 3TL4X 2V4JC 1WJBA 3S3OA 2IGMA 2XF5A 3A1YA 2IS4A 3L2QA 2ZSIB 3EUKL 4R79A 2R7TA 2M7BA 4XN3A 3S3NA 2LBFB 3QYBA 4FETA 1GLNA 2F6CA 5HLTA 2XAUA 3HPGA 3W2WA 1NG6A 1BR4A 3DU5A 2MD0A 4ZDPA 3HOTA 2LG4A 3D5RC 4QPOA 2I8DA 3H0DA 1X1AA 3HL2A 3BG6A 3RPUD 2ZSHB 2VQCA 2V6EA 2DOAA 3LL7A 4U7BA 2KPMA 2HPIA 2IXSA 3D5LA 2Z2SB 4BL0B 4BXFA 2UUZA 2R7OA 2MABA 2VQHA 4ANJA 3TMOA 4EATA 2L7KA 3OS1A 1HA8A 2L9SA 4XR6A 3N05A 4CCJA 4LITA 2JVHA 2IGKA 2JA2A 2M0MA 3ZRGA 2UV1A 3DQVC 5HOOA 1MMDA 3OYLA 1WJCA 3OS0A 3H5AA 3DPLC 5HNHA 3OYHA 2E60A 3QYFA 4XKCA 5CKTA 2L9NA 3HOSA 3FBIB 3OYAA 3MD2A 4E6KG 4BDZA 3OS2A 2HVRA 3MKYB 4PJMA 5KCMA 4ZTJA 1PYVA 2LY2A 3L2UA 5HNFA 2E5NA 1YE9A 3OR2C 3FKJA 2R7UA 4KITB 4ZTFA 4PUSA 3C2GA 2IS6A 2AQEA 2Z16A 2HPMA 1PJRA 2MFZA 2IS2A 2Q2EB 3PSFA 4F93B 2HVQA 4XKWA 4B47A 4XNFA 3HPHA 3OL4A 4RLFA 3IUOA 2XDVA 4YRVA 4BEHB 1VZ0A 3BCAA 2F5VA 2MYSA 2DT7B 3KX2A 4AU7A 3OYKA 4HPQA 1WFXA 3LFUA 4XKBA 4E7KA 3OY9A 4BQQA 1G59A 1BOBA 2V9KA 3DLAA 3SYTA 1TZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJF A;  3HPH A;  1K6Y A;  1WJB A;  3F9K A;  1WJA A;  1WJC A;  1MW7 A;  3HPG A;  1LFP A;  4F3Q A;  1WJE A;  1E0E A;  1WJD A;  1KON A; 
#chains in the Genus database with same CATH topology
 2LYC A;  2NS8 A;  2HQN A;  2W24 A;  5ED4 A;  2LK2 A;  4PDK A;  1B1B A;  2MC4 A;  4B1R A;  1A6I A;  1UFM A;  1NHA A;  1ZK8 A;  1XPX A;  4CCO A;  1DP7 P;  3HRM A;  2GXA A;  2K9M A;  1V5G A;  4HLX A;  1GDT A;  5JLX A;  2LTP A;  1MH3 A;  2C6Y A;  1LJ9 A;  3FBN B;  5D8L B;  2IBD A;  2HNH A;  3O8H A;  4XRF A;  3OYE A;  2PMU A;  3Q9S A;  4E7L A;  4BYY A;  3JAM Z;  2UXN A;  1UHS A;  1FIA A;  3I4N J;  1R23 A;  3VSL A;  2XAS A;  1WQ2 A;  4S04 A;  3F21 A;  3J7A O;  3AG1 H;  1R22 A;  3QPS A;  2W48 A;  3F8F A;  4A3M J;  3E6C C;  1MMG A;  2VXD A;  1Q1H A;  4EEF G;  4FX4 A;  2MC3 A;  1UG0 A;  3GXO A;  1WJ5 A;  3I54 A;  3GWZ A;  4DZJ A;  1BR2 A;  1S5L C;  4P55 A;  2X9D A;  2Y2Z A;  5LGT A;  1U8R A;  1B72 B;  3F22 A;  3CDI A;  4IVN A;  4KUM A;  2BZT A;  2JWT A;  3FM3 A;  1WJA A;  3HRT A;  4QIW N;  1Y1V J;  2CSO A;  1REP C;  2DA7 A;  3UR3 C;  3CCU I;  4D9J A;  2VXZ A;  4PSX A;  2RQQ A;  3HIF A;  1JUP A;  1LFP A;  1G6N A;  4FE4 A;  3A03 A;  2L9V A;  4KIC A;  1HLV A;  1SD6 A;  4ZC3 A;  2GOM A;  2XUB A;  3LNQ A;  1XSD A;  2HXI A;  3BDD A;  4F7Z A;  1YIO A;  2LRD A;  2JPB A;  3DEE A;  1G8X A;  3GUD A;  3HBL A;  1ONV A;  4CXF A;  5F1J A;  2X51 A;  3L2C A;  2VJ5 A;  2ZME A;  4M3D A;  1UMQ A;  5BQT A;  1TNT A;  5BOX A;  1OYI A;  2OZ6 A;  4UVA A;  3DBH B;  3KP7 A;  3VYS B;  1RUO A;  1QPM A;  5F64 A;  3AL0 B;  2Y0S A;  3WGI A;  3FMS A;  2FU4 A;  1X4O A;  3KZI C;  1ZG5 A;  3O2P E;  1YJW I;  4CZZ A;  4RB1 A;  2VJJ A;  1MBG A;  1JTY A;  1Z67 A;  5GTH C;  1W4M A;  2EZH A;  3KP6 A;  1K61 A;  1WH7 A;  1BJA A;  1H9G A;  1B9N A;  2V1D A;  4E70 A;  3EYY A;  2W85 A;  3ONQ A;  2HZT A;  2QEN A;  4A93 J;  4Y3O A;  3K4C A;  3PFY A;  3CCY A;  4NDL A;  3S1M J;  2EA4 A;  3ZMT A;  3H1C A;  4JX4 A;  2W84 A;  5DCM A;  5K5O A;  1MBK A;  3QOP A;  4L9V A;  2HDD A;  4RS8 A;  1RES A;  1A31 A;  2XC7 A;  4BDY A;  3RKY A;  1F4K A;  4J01 A;  2DMT A;  3O8G A;  3U1D A;  3I3L A;  5KVR A;  5H20 A;  4HX4 A;  5JLW A;  2PBI A;  4L9T A;  4RB3 C;  3CCE I;  3IHU A;  3BLY A;  1JI8 A;  2YSR A;  2CG4 A;  1CF7 B;  4BJ5 C;  4YFX F;  4HDU A;  1I1S A;  1ETV A;  2VJI A;  4JOM A;  3ZPL A;  2DT6 A;  3KFW X;  4S0H B;  4C3H J;  4B09 A;  3KP4 A;  1SFE A;  3LOC A;  4FIS A;  3DTI A;  4XRM A;  3JRC A;  3QP6 A;  4DBR A;  1VQ7 I;  2KIU A;  1AWC A;  3OMY A;  5E1X A;  4PJJ A;  3QOD A;  1QZZ A;  2MH9 A;  2MD5 A;  1N77 A;  2M5W A;  2X85 A;  3KEQ A;  3E0J B;  1FOX A;  3TP3 A;  1X1D A;  2XKP A;  2W7N A;  5LRS A;  1JTX A;  1UEL B;  1W5C C;  2M4G A;  4PZJ A;  1MBE A;  2HQA A;  3V42 A;  2G7H A;  1SD4 A;  3ZOB A;  1J2X A;  1Z1D A;  2F5D A;  3BPV A;  4RGU A;  3RYP A;  4L5I A;  4BQN A;  2OC6 A;  2DMU A;  5EZH A;  4CO8 A;  3AL0 C;  4UV8 A;  3NRV A;  2LKS A;  1ETX A;  1G3S A;  4H4K C;  2PJR A;  2XAH A;  3GZ5 A;  4A3F J;  1T0F C;  4HA8 A;  3AAF A;  2LD5 A;  2AXT C;  4DW6 A;  3F8B A;  1Z3X A;  3RZD J;  3EQL F;  1FBU A;  2D1V A;  4LJZ F;  2OD5 A;  4O6J A;  4FE7 A;  1K78 B;  2LP0 A;  4JP0 A;  1SMT A;  3HXL A;  2FF4 A;  2EFP A;  1YQA A;  4II2 A;  4A0Y A;  4FCY A;  2TDX A;  3A4C A;  1K79 A;  1XB4 A;  3B02 A;  3GTL J;  3G4S I;  4Z2Y A;  2CUJ A;  2FXA A;  5FD6 A;  2IRF G;  3M8E A;  2K02 A;  3RDI A;  3ESW B;  4PK4 A;  2XB5 A;  3CP8 A;  1FC3 A;  1FY7 A;  3TOA A;  1XCB A;  2M0C A;  1I5Z A;  3WGH A;  2HOT A;  2MGQ A;  3QU6 A;  2XF6 A;  4F55 A;  4RAZ A;  2GQQ A;  2RDP A;  4WWC A;  1TC3 C;  2R5Z A;  2H1L A;  4MQV A;  1U78 A;  3Q0U A;  1LUJ B;  1D5Y A;  1BI2 A;  2G9W A;  2GOX B;  3KP3 A;  4NC7 A;  4ENJ A;  2CU7 A;  2DMN A;  2Z5U A;  3U1K A;  4HNT A;  3CMA I;  1O57 A;  3FMR A;  3BJO A;  4P5O A;  3ZQH A;  5HS7 A;  5B66 C;  4I02 A;  1ETW A;  4C2M J;  4I98 B;  4L9J A;  1T8I A;  1WH5 A;  1XDS A;  3JSP A;  2XPW A;  2OA4 A;  3EPZ A;  2VC1 A;  4DYQ A;  2ZJ2 A;  3KYL A;  3VOE A;  1XGS A;  1BW6 A;  1SAU A;  4NB5 A;  3HEF A;  1S8N A;  3E6B A;  3WOD F;  3ZMZ A;  4EJU A;  2PMZ A;  3I9V 2;  3F8M A;  5GTI C;  2RAE A;  1VQP I;  1RNL A;  2LLK A;  2OZU A;  1V5E A;  5E8I A;  5ILU A;  3AKZ A;  1G2H A;  4ESB A;  3H3U A;  4WF2 A;  1YX3 A;  3J7Y J;  5FB2 A;  5J3L A;  2QLZ A;  2DK5 A;  4A5N A;  4HNV A;  1X3Z B;  1ZQ3 P;  1XSV A;  2EFN A;  1QHG A;  3T0Y A;  1FPQ A;  4UUS A;  1UJ8 A;  4NC8 A;  2FSW A;  1SAX A;  3MKZ A;  5LFA A;  1I3A A;  4IEJ A;  1YS6 A;  4OWR B;  1BJZ A;  4Z6Y A;  2VPR A;  1OFC X;  1B6A A;  2EIJ H;  3M8F A;  5F1R A;  5ICC A;  2ZJQ F;  2WAQ A;  1KQ0 A;  2W57 A;  4CH7 A;  1ZH5 A;  2CQN A;  1MBH A;  1G3T A;  1U9O A;  1YIT I;  2VOP A;  3G3Z A;  2FNA A;  4N9I A;  5M5Y J;  4HOB A;  4I99 C;  3SJM A;  4AID A;  3OYD A;  5K5Q A;  2E7W A;  4IRI A;  4HF2 A;  2X6Y A;  5FLV A;  1VQ6 I;  4N4N B;  1Q1V A;  1SAN A;  2HS5 A;  1ON2 A;  2ZJR F;  3VSK A;  5DYM A;  1WJF A;  1IW7 F;  2FUG 2;  1K6O A;  4Y7N J;  1VQ8 I;  2JMW A;  5CVJ A;  1ULY A;  2ZXI A;  1FOY A;  2COB A;  1E3P A;  3HOZ J;  3RJP A;  2K40 A;  2DCE A;  2XIG A;  4ZYH A;  1XTA A;  2EIN H;  2RQP A;  2M4K A;  2K3P A;  4D0P A;  4LIU A;  4AIK A;  2CMP A;  1W36 D;  3LMM A;  4A0Z A;  3CUQ B;  5LHG A;  5IP6 A;  3HDD A;  2A5Y B;  1UAA A;  1EA3 A;  4PJL A;  5F6F A;  5J6X A;  2KL4 A;  3KP2 A;  4U87 A;  2DA5 A;  4BKX A;  3HG9 A;  1D0Y A;  2X0L A;  2H27 A;  4HX8 A;  4JK1 X;  3BC8 A;  2E35 A;  3I71 A;  2CFX A;  3SDB A;  3GFI A;  3FK7 A;  1FTT A;  2MH2 A;  1T38 A;  4A3C J;  1T33 A;  2ZME B;  4FHT A;  5FKM A;  1QZE A;  3QPH A;  3R0A A;  3S3O A;  1IV8 A;  2IGM A;  2XF5 A;  2IS4 A;  4JBA A;  3EUK L;  1BC7 C;  2R7T A;  2QZ8 A;  2L7Z A;  1GLN A;  3WU1 B;  5HLT A;  3HOW J;  1EV7 A;  4UXN A;  2DA2 A;  5C44 J;  1NG6 A;  5J4Y A;  1WHU A;  2O8X A;  5DEQ A;  1BR4 A;  2JA7 J;  1OIS A;  1U2W A;  5KAF C;  3D5R C;  4A6E A;  2DBB A;  1A6Q A;  4U7D A;  2L0K A;  1X1A A;  3HM5 A;  2NNN A;  3RPU D;  2ZSH B;  3S2W A;  3J81 K;  5JI6 A;  1MD0 A;  1LEB A;  2IXS A;  1B72 A;  2DLL A;  2Z2S B;  2ZB9 A;  2FMY A;  4UB8 C;  4BL0 B;  2E2H J;  2UUZ A;  2R7O A;  2KIM A;  3P9I A;  4A2U A;  2VQH A;  4ANJ A;  3TMO A;  5DCM B;  1HA8 A;  2NVU B;  2L4M A;  4CYC B;  2JVH A;  3GLX A;  3HTS B;  1SC7 A;  1G3W A;  3QWL A;  4IHX A;  3ZRG A;  3I59 B;  4RBO A;  1RKW A;  1MMD A;  2CUF A;  3I0T A;  3O6B B;  5FLM J;  2D45 A;  4LLL A;  2XAF A;  3TO9 A;  4BHB A;  1EH6 A;  2JT1 A;  3QYF A;  3OYH A;  5B1B H;  1IXS B;  1T2K A;  1P7J A;  2L9N A;  3FBI B;  3OYA A;  3R6S A;  1X2N A;  3HHH A;  4BDZ A;  1HBX G;  2HGC A;  4ZH4 F;  3MKY B;  3HSE A;  5KCM A;  3JRI A;  1IV6 A;  4A0X A;  1FYM A;  1PYV A;  2JRM A;  1MJA A;  2HTS A;  1JT6 A;  1YE9 A;  2Q0O A;  2R7U A;  4KIT B;  2Z16 A;  1BC8 C;  2ZXW H;  1B9M A;  3RZO J;  2E1N A;  2ECB A;  3PSF A;  5IYC J;  4F93 B;  2HVQ A;  3TOB A;  2O8K A;  2QSH X;  3JAM K;  5E79 C;  1ZYR F;  2BE5 F;  4M3E A;  3BG3 A;  3BZ6 A;  2ZME C;  3KYD B;  3VB2 A;  3QRF F;  2DFF A;  1VZ0 A;  3BCA A;  4AYB N;  2MYS A;  3BR1 A;  3V4G A;  3KX2 A;  2OCC H;  3WTU C;  4HPQ A;  3OYK A;  1QZY A;  3CQZ J;  2XGE A;  3LFU A;  4UVC A;  3RPU A;  1IN8 A;  5J8F A;  4TV7 A;  4BQQ A;  1G59 A;  2F5F A;  1QRY A;  1FBS A;  4XID A;  1TZL A;  3BT9 A;  5BPI A;  4DGW B;  1L3L A;  2LOO A;  2VUM J;  3E1S A;  3PIP F;  1D1C A;  2BY1 A;  2NOG A;  4A3K J;  1S7O A;  5DDG A;  4KIF A;  3TO7 A;  2YU9 J;  3TQN A;  4KN4 X;  1SD7 A;  2F48 A;  3GZ6 A;  2DA4 A;  1WVR A;  3KZZ A;  4HW0 A;  1YO5 C;  3IWZ A;  3Q9V A;  2LF8 A;  1GV5 A;  4IO9 F;  2B7E A;  2R7Q A;  3LA7 A;  2FQ3 A;  2X6W A;  2E7X A;  3BOQ A;  1CF7 A;  2GA1 A;  1XGO A;  3IV5 A;  3WHB A;  4BQA A;  2JUG A;  2ZCW A;  4E7Z A;  3ZMV A;  3M07 A;  5BPD A;  2YUS A;  4XOP A;  1XSX A;  1HCR A;  3TED A;  1B8I A;  3QAH A;  1WJE A;  2F5C A;  3GYH X;  1IUY A;  5E8G A;  2R5Z B;  2BHY A;  2WAF A;  2DMQ A;  4ESJ A;  3PUB A;  3PL8 A;  1A35 A;  2X6X A;  5HLG A;  4BY1 J;  4UNO A;  3HOX J;  1ZRF A;  3GZN B;  5CQG A;  1KA8 A;  3LSG A;  5JVG F;  2HU9 A;  3S1Q J;  4RAF A;  1J7K A;  3CJQ B;  9ANT A;  2F2E A;  3R0J A;  1R4M B;  5IT9 K;  2CH0 A;  3CZ6 A;  4OOI A;  4Y17 A;  2V1X A;  4AWX B;  4Y13 A;  3OYB A;  2XPU A;  4OAY A;  1ZAR A;  2E1O A;  1V3F A;  3Q5F A;  1HDP A;  2DJN A;  4HLY A;  4PJN A;  3A02 A;  3OR1 C;  3K4K A;  3VYT B;  1FBQ A;  2WAE A;  4M3B A;  2DYS H;  2BY2 A;  4UVB A;  4RGS A;  4BE0 A;  4M9Z A;  4D1Q A;  2JA8 J;  2FBI A;  3HOU J;  3A0H C;  3PNT A;  2CWE A;  2E71 A;  1AU7 A;  5CJ9 A;  4KT6 A;  2BXZ A;  4FT8 A;  3FXQ A;  4XM3 A;  3DKY A;  2CW0 F;  1OMI A;  1SFO J;  4MO7 A;  2K9Q A;  1LE8 A;  3QU3 A;  1IN5 A;  5IPA A;  3KZY A;  3P9K A;  3FXR A;  1SFU A;  3CJR B;  1ZLK A;  2DU9 A;  1FP1 D;  5E20 A;  3MMY B;  2ISZ A;  1KU3 A;  2UZK A;  1I6X A;  2OJE D;  2E1C A;  3M3Y J;  2MBF A;  4IRG A;  3K4M A;  2LBF A;  4HV5 A;  5L3F A;  1UCR A;  1T98 A;  4IOC F;  2OPT A;  3L9F A;  3MZ8 A;  2JZY A;  2W00 A;  4IQ4 A;  3TDZ C;  4E7I A;  5HS8 A;  2R7V A;  4XMY A;  2DT5 A;  3DTK A;  4X0G A;  1R5H A;  1FX7 A;  3FDY A;  4O5V A;  4OIR F;  1QGP A;  2LNB A;  4HYE A;  3SQN A;  2KFD A;  1RR8 C;  5IY5 H;  1FIP A;  2QVO A;  1SFX A;  2ZC2 A;  3M8J A;  2K4J A;  1ZEL A;  4G7O F;  5FKN A;  2K85 A;  1TWG J;  1IAW A;  1TWH J;  1TWA J;  4MEX F;  3OOU A;  3QYE A;  1VQM I;  4NUB A;  4YEJ A;  3I53 A;  1ZGJ A;  4ZYE A;  3I55 I;  1A5J A;  4KA4 A;  3SZG A;  2DTR A;  1Z91 A;  2XRN A;  4BBR J;  1BI0 A;  1ERD A;  1RKT A;  4MIM A;  1RR7 A;  3LSR A;  3DCF A;  3B6A A;  2EH3 A;  4BQO A;  3OYG A;  3DBR B;  4QLC U;  1NG7 A;  3CDL A;  3JR9 A;  1ETK A;  2AO9 A;  5IYB J;  4CCL A;  4KIS A;  4OU0 A;  2EV6 A;  2O61 A;  1IRZ A;  1OJL A;  1D0X A;  2YX4 A;  2ZBK A;  4ESF A;  1E17 A;  3CP2 A;  5F08 A;  1ETO A;  4MTE A;  2J5P A;  1X1B A;  2PMH A;  2FX0 A;  1XGN A;  1YG2 A;  2LC2 A;  4KIG A;  3M4O J;  1WI3 A;  1ZG3 A;  3S2H J;  3JRH A;  1ZRE A;  1TT0 A;  1WJD A;  1I1G A;  2PLY A;  3DPU A;  1AOY A;  1F9N A;  1H88 C;  3SZT A;  3WTZ A;  5LGN A;  1V5F A;  2JK3 A;  4U0W A;  4G7Z F;  1D3Y A;  1JE8 A;  2NVQ J;  1D0Z A;  4WXD A;  1A36 A;  3AG4 H;  2N8G A;  3MEX A;  1Y8R B;  2R4G A;  3M7G A;  2OCE A;  1D1B A;  3BG5 A;  3C2H A;  2XGC A;  1RC9 A;  1R49 A;  2DOE A;  2P5V A;  3CLO A;  5J4V A;  1AHD P;  3DLL F;  1MSE C;  1QA6 A;  1F36 A;  3C2B A;  1O3T A;  1ZG1 A;  2BBY A;  2M34 A;  5ICG A;  2VIX A;  4YFN F;  1GUU A;  1KON A;  5J40 A;  1G3Y A;  4GFB A;  1Y6I A;  1R5G A;  1JKR C;  2WY8 Q;  1R6R A;  1TW2 A;  3ZGK A;  3JRG A;  3RCO A;  2JQ7 A;  3E6M A;  1OLT A;  3COA C;  3OSF A;  1BOA A;  3SFZ A;  2R7S A;  1QHH D;  2YS9 A;  4BJT A;  3CUQ A;  4XN0 A;  3MWM A;  1QVT A;  3OWT A;  1P4A A;  2VI6 A;  3ZN0 A;  1TNS A;  4LD5 A;  1IN6 A;  4BS9 A;  2EBI A;  2LR8 A;  1D8J A;  1FMW A;  5FLX Z;  4M9S A;  4WK8 F;  3CJN A;  2XV4 S;  3LSH A;  3CCS I;  2QUF A;  1KGS A;  4UB6 C;  2MA3 A;  2QQA A;  4XLN F;  4BGD A;  4RM3 A;  2BVL A;  3HJE A;  3BTC A;  2GA2 A;  3S16 J;  2KQR A;  4FQG A;  4AIJ A;  1ZN2 A;  5BNG A;  2BOL A;  2OQG A;  3BR6 A;  4XLC A;  3AFH A;  4IOA F;  4P96 A;  4QPQ A;  5FRN A;  3J80 K;  1ZR4 A;  2AHQ A;  5M3F J;  4CCN A;  3A2K A;  4M6Y A;  1DUX C;  1TW3 A;  1FSE A;  2K5C A;  1R4N B;  1P92 A;  2VLA A;  5BMZ A;  1ZTR A;  3CCQ I;  2F5E A;  1U9N A;  2HDW A;  2X4H A;  3K10 A;  1JHH A;  3HB9 A;  2ADU A;  3TDU C;  1LPQ A;  3X2Q H;  2A6E F;  3V7S A;  4RMN A;  4II3 A;  3PJR A;  1K6Y A;  5CYV A;  4EJV A;  4A69 C;  1M1E B;  1P4W A;  3DPT A;  4JQF A;  1J9I A;  3RTR A;  2M7A A;  2R93 J;  3BQZ A;  1IRX A;  1QQI A;  2Y69 H;  1JGG A;  1Y0N A;  4YIF A;  4CYC A;  3MKW B;  2HWV A;  4WXH A;  4MTD A;  1T08 B;  5FKL A;  5IYD J;  3QOE A;  1TP4 A;  1FSH A;  3I59 A;  1P7I A;  3NWT A;  2EIL H;  2A05 A;  2E5Z A;  3FIS A;  1ENH A;  1PUE E;  3DXJ F;  1D5V A;  3AG2 H;  4PFO A;  2CW7 A;  3WE2 A;  1QPI A;  2EV5 A;  2P8T A;  1IF1 A;  4JX6 A;  1STZ A;  1VI0 A;  3G1M A;  4F52 A;  1BR1 A;  2HTJ A;  2EQR A;  4CCK A;  2DA1 A;  2W82 A;  2ZO4 A;  2CV1 A;  3HSF A;  3SHF A;  2DA3 A;  3IKT A;  3MQ0 A;  5GAG J;  2XAG A;  1BM9 A;  1BW5 A;  3HKZ N;  4A3D J;  2R7D A;  2Z9O A;  3RKQ A;  1B8I B;  3GX4 X;  3JCU C;  2X1E A;  1W36 C;  4XSX F;  2ZNZ A;  4H0E A;  4J19 A;  4EGZ A;  4BE2 A;  1IN4 A;  2BEO A;  4OMZ A;  1OCC H;  3GTM J;  2K9L A;  2E19 A;  1TQM A;  2V9V A;  4NHJ A;  5C4X J;  2P5L C;  4BNC A;  2ZXJ A;  3RI4 A;  5J47 A;  2CUE A;  2H09 A;  4YFK F;  3EET A;  2KLO A;  2XGD A;  2Y30 A;  4I6Z A;  3R60 A;  3S14 J;  3S8P A;  1MW7 A;  5GPA A;  1PVE A;  1E0E A;  2LFB A;  2QYO A;  2VB6 A;  3DTE A;  5LRR A;  1YLF A;  2KHM A;  3CDH A;  3RSN A;  5TJJ A;  1W0T A;  1HC8 A;  4N4O B;  4YEL A;  2H1K A;  2VE9 A;  2OTJ I;  1W1W E;  2NNY A;  2STW A;  1U5T B;  2FE3 A;  3IAM 2;  1LKX A;  2ZJP F;  2HZD A;  2BVM A;  1J59 A;  1XMK A;  1VTN C;  2L5Q A;  4BUP A;  2LRE A;  2XPV A;  4GO1 A;  1MKM A;  2JPC A;  3HRS A;  4GDF A;  3ZMD A;  2QF7 A;  4WX9 A;  3WTT C;  4P9U A;  5LEJ A;  2M87 A;  3GBG A;  3K4J A;  1LE8 B;  1S9H A;  1SVL A;  2EZI A;  1K4T A;  1OQY A;  2DK8 A;  2A68 F;  3K1M A;  4ASN A;  1OR7 A;  2R5Y B;  1U8B A;  2ME0 A;  2R7F A;  2WB1 N;  3L2Q A;  2ACJ A;  2LBF B;  4FET A;  4LLG F;  5E17 F;  5IOZ A;  2B63 J;  1WKM A;  3ZQI A;  4LGW A;  2VKE A;  2H8R A;  3QP5 A;  4QPO A;  1XCV A;  5DV5 A;  3IH3 A;  2XRL A;  2I8D A;  3H0D A;  1FLI A;  3BG6 A;  1O3R A;  1RZ4 A;  1HOM A;  1S7E A;  2DOA A;  3LL7 A;  4EMS A;  4U7B A;  4PJ0 C;  1IXR C;  2HR3 A;  3TW6 A;  4HF0 A;  5EF6 A;  4RGR A;  1SVM A;  4EAT A;  1FYK A;  2JA5 J;  1YW9 A;  3N05 A;  4LIT A;  1GXP A;  1WGX A;  2LSO A;  3E6D A;  2JA2 A;  1X3U A;  2L4A A;  2DQR A;  2UV1 A;  5HOO A;  3FF5 A;  3OYL A;  2DFE A;  1U6G A;  3P9C A;  4IF4 A;  3V7R A;  2VBX A;  5EG0 A;  2E60 A;  2HYG D;  2RKH A;  3U9G A;  4PGH A;  2EA2 A;  5CKT A;  3HOS A;  3MD2 A;  5D6F A;  5D5X B;  2EK5 A;  4E6K G;  2DMP A;  2MW8 A;  3GF2 A;  4D5F A;  2HVR A;  2L9R A;  1J5Y A;  3H0G J;  1ZGA A;  3K69 A;  2P7C B;  2VOD A;  3F6V A;  4G8X A;  1U5T C;  2LY2 A;  5CVV A;  4XBF A;  3BR2 A;  1OYY A;  5HNF A;  3IL2 A;  2X6O A;  3OR2 C;  2K9S A;  5DS9 A;  2KJB A;  2VBZ A;  4OIQ F;  1USS A;  2AQE A;  5ILS A;  4ZZD A;  2X48 A;  3L1P A;  1L0O C;  1PJR A;  2IS2 A;  5EGO B;  2P81 A;  2V9P A;  2BGC A;  3ZP5 A;  4G12 A;  4EGY A;  4Q48 A;  4M72 A;  4XKW A;  2GIZ A;  1I50 J;  2GAU A;  3OL4 A;  4L5E A;  3SXY A;  3D1N I;  3IUO A;  2XDV A;  2Z99 A;  2ZFW A;  4YRV A;  2L54 A;  2DT7 B;  3IKV A;  4G9Y A;  4W1U A;  4ABZ A;  3NAU A;  4EJT A;  3WTX C;  2M1B A;  4XKB A;  4IHT A;  4AC0 A;  4ENK A;  2V9K A;  3DLA A;  3MVP A;  3LFK A;  5ERI A;  3BR3 A;  2FBK A;  3P7N A;  4K2E A;  3L7W A;  1GV2 A;  3BTL A;  2HQR A;  1HSJ A;  3BJA A;  3FXK A;  3HOV J;  3SDG A;  3BPX A;  1DGW Y;  4I2O A;  3CD6 I;  4F3Q A;  3CMM A;  5K1Y A;  4C3J J;  2O6G E;  2WV0 A;  3FX3 A;  4C30 A;  4A12 A;  4XLA A;  3E5Q A;  2W4S A;  2DI3 A;  3V8K A;  4KNY A;  2EFO A;  4LG3 A;  1X1P A;  2Z3Y A;  5DUI A;  2R7Z J;  1WCM J;  3Q0W A;  4HRI A;  2KRF A;  2Z33 A;  1CQT A;  1HXD A;  4HX7 A;  1XC5 A;  1QBJ A;  3LWF A;  4A3E J;  3FZV A;  3JTH A;  3OIQ A;  4HAM A;  3TP0 A;  1C0W A;  2FNP A;  2WBM A;  1U0J A;  1HST A;  1IUF A;  3OV8 A;  1LEA A;  2V79 A;  2KJC A;  1XG1 A;  5KK1 A;  1XGM A;  1TQP A;  2BW3 A;  1H9T A;  5KNL A;  4AVP A;  2IA0 A;  4L0Y B;  4IHV A;  3H3Z A;  4L0Z B;  2L01 A;  3OL3 A;  2NAZ A;  3E7L A;  1I39 A;  4ZDO A;  2ZFU A;  4HQE A;  5D4S A;  1FJL A;  1OCT C;  4C9Y A;  3H9Q A;  2GXG A;  3WHC A;  4RM2 A;  3QPT A;  1R58 A;  3D5S C;  1Z0X A;  4V2F A;  3FKI J;  2KDZ A;  2FQ4 A;  2KIF A;  1FOW A;  3B73 A;  2PX9 A;  2CUZ A;  3F0C A;  5GAD J;  3TBI A;  2NS7 A;  3L09 A;  4M3G A;  1W7P B;  2GWR A;  1FWZ A;  1IO2 A;  1Z6R A;  3K70 D;  5BS6 A;  4UV9 A;  1X4P A;  1ZKG A;  4PGG A;  2Y9Z A;  2M9H A;  3KLO A;  2VT3 A;  1BIB A;  2M30 A;  5F0H A;  5TIS C;  1FTZ A;  3H3V K;  4G6T B;  3FIW A;  3R4K A;  4NQW B;  4LB5 A;  1Z7U A;  1WI9 A;  2R7X A;  5JR3 A;  1XN7 A;  2IGO A;  1MND A;  4M74 A;  1AKH A;  4A5M A;  2D5V A;  4DNC A;  4M71 A;  1Z9C A;  2R3S A;  3GVA A;  4PSW A;  1O7L A;  2DXI A;  3CC4 I;  3OYI A;  2QBY B;  3M9A A;  4C2U A;  3NWS A;  2DDB A;  3KIO A;  2HVS A;  1GVD A;  3V7C A;  3J7A Y;  4I01 A;  3IH4 A;  2HKX A;  3K4N A;  5F0F A;  3TW7 A;  2RRE A;  3CUQ C;  2AQF A;  1BA5 A;  4A6D A;  5FFX A;  4A3I J;  1Z77 A;  3IWF A;  2Y48 A;  2PJP A;  4GGG A;  3E97 A;  1TQI A;  2O03 A;  4I0A A;  3JSO A;  1SVO A;  3G73 A;  2JSC A;  3F8N A;  4G6Q A;  4N0B A;  4DYC A;  4KMF A;  1HW5 A;  3K1N A;  2JN6 A;  4XL9 A;  4LIV A;  1KYZ A;  4GRI A;  3GFM A;  1UG2 A;  5LHH A;  4CA0 A;  1XS9 A;  2M3A A;  1O3S A;  3FXU A;  5CQE A;  2E1M B;  4CSW A;  2A5W A;  1WWX A;  1SFK A;  4BAY A;  1DQU A;  4LFU A;  4KT5 C;  4BXU A;  1GHC A;  1OYW A;  2JA6 J;  1ZGW A;  5GP9 A;  3CCM I;  2YPR A;  1UZC A;  5FKK A;  4XLF A;  3CCL I;  1RIO H;  3ASN H;  1YS7 A;  3PQK A;  4G94 A;  1IDZ A;  5D4R A;  2VKD A;  3PFI A;  5DM6 F;  2BYV E;  3WU0 A;  2GZW A;  3N97 A;  4ON0 A;  3U21 A;  2D1H A;  3B6C A;  5K5R A;  4Q4Z F;  5LEK A;  5CVR A;  2DOD A;  2DPU A;  2QWW A;  4XKV A;  5ILV A;  3JTG A;  2QKM B;  3VFZ A;  1K4S A;  1ZRD A;  2OAZ A;  4XOT A;  1NH3 A;  4B44 A;  1V55 H;  3MAJ A;  5EEG A;  2Q2E A;  5DD4 A;  3G2B A;  2CGP A;  3E3V A;  2WY7 Q;  1DDN A;  4RAG A;  2R92 J;  3SEQ A;  3N4M A;  4IKF A;  1FMV A;  3W3C A;  2Y0M A;  4BAC A;  4IHW A;  3CES A;  2IJL A;  3RQI A;  4CYD A;  2F4I A;  3MCZ A;  4EM2 A;  5JVT A;  1RET A;  3K9T A;  5GPC A;  1QNT A;  1I3Q J;  1D1A A;  3DP7 A;  3MKL A;  3CMY A;  5CLS A;  4B4C A;  1IJW C;  2HOS A;  3FXL A;  3HGY A;  4PFP A;  5J1U A;  2EFW A;  4HSR A;  3LA3 A;  5K7H A;  5HVQ C;  4M9X A;  3KCC A;  1FNN A;  2RVC A;  2NS0 A;  4V19 K;  3CCR I;  1Z21 A;  1MIJ A;  4ENM A;  2HOA A;  2YX7 A;  2ZXH A;  1TWC J;  3TO6 A;  2IVM A;  4GXO A;  1KYW A;  3E5X A;  1LDJ A;  3BR5 A;  3S32 A;  1GXQ A;  2DDA A;  2CFO A;  2VBY A;  3GTJ J;  3F3X A;  3GTK J;  3G1O A;  4KDP A;  3HOY J;  2WA0 A;  4AM3 A;  1ZAO A;  3W2V A;  4L9N A;  3KET A;  1U5T A;  4B3A A;  3IRR A;  2E1M C;  4E7S A;  4FX0 A;  2M2E A;  1RRJ A;  1MMS A;  2IA2 A;  2CS3 A;  5EG0 B;  3GTG J;  4RDU A;  4XSZ F;  2UXX A;  3GFL A;  1MDM A;  1IDY A;  2ELJ A;  3L00 A;  3LST A;  4NNJ A;  3WTY C;  2QQ8 A;  2EIK H;  3WE3 A;  3PIO F;  2XGX A;  3A0B C;  4G7H F;  2KIS A;  4XOR A;  4NC6 A;  5TRD A;  4AUX A;  4CGZ A;  1NTC A;  4HG2 A;  1J09 A;  2RC4 A;  3I64 A;  2R5Y A;  3SZP A;  2IPQ X;  1I6H J;  2G7U A;  5C4J J;  1E3O C;  4I76 A;  1YRN A;  3ABM H;  4D7N A;  1BI1 A;  3RQ4 A;  5FRM A;  4XLE A;  1MBJ A;  1F1Z A;  2KRC A;  4DIQ A;  2EFQ A;  3ECH A;  4RB2 C;  4WXC A;  2PQ8 A;  5AON A;  3BG7 A;  3VYU B;  5FD5 A;  3DFG A;  2XRO A;  1OR7 C;  3I5U A;  2KRH A;  3LSI A;  1ZRC A;  3DKW A;  3MN2 A;  4B8X A;  5HLH A;  5EJC A;  3KEO A;  3PO3 J;  4M73 A;  2A07 F;  3GW2 A;  2H6B A;  2DN0 A;  2M8G X;  3M1C A;  3V8J A;  3CC7 I;  1YFH A;  2L7M P;  2KT0 A;  5J8C A;  3TGN A;  1S7A A;  2NYX A;  3H5N A;  4Y33 A;  2QA4 I;  1Z05 A;  2NOJ B;  4LG0 A;  4AYB A;  2CQQ A;  3DWL E;  2Z1D A;  2CQK A;  2JJ7 A;  2FOK A;  1AA7 A;  3ZQQ A;  2RNG A;  3FHN A;  5KHD A;  2LKP A;  2QQB A;  2E36 A;  2F4O B;  2RV8 A;  1YX5 A;  4DJA A;  3QQA A;  3CJT B;  2VL8 A;  2HYJ A;  4DQ2 A;  1RPW A;  2V1N A;  5CVU A;  1MBF A;  3VEP A;  2HYF A;  1R1T A;  5EGO A;  4RGX A;  2BW3 B;  2K7L A;  1OCZ H;  2VKV A;  1U3E M;  4RAY A;  5FFZ A;  2VPL A;  3ZXS A;  4IHY A;  5EZG A;  4HNU A;  3BJ6 A;  3K4L A;  4A3L J;  2DW4 A;  2IGN A;  1ZR2 A;  1PDN C;  2DA6 A;  3S1R J;  1W5T A;  2LKX A;  3BR0 A;  5M5W J;  2HKO A;  2O5R A;  3EUH A;  5FGM A;  1MSF C;  1VQK I;  3HUG B;  5DUK A;  4B3X A;  4HST A;  1TL8 A;  1W7P D;  4JX5 A;  2EWN A;  2HFH A;  2JVG A;  2VQL A;  5B3S H;  4XRS G;  1NK3 P;  2QSF X;  2KZG A;  4L5J A;  4Y4R A;  3F23 A;  4IZZ A;  4C2T A;  5C3E J;  4HV6 A;  3G1L A;  3ABT A;  2UWM A;  3CCJ I;  3JW4 A;  5B1A H;  2Y75 A;  3VDX A;  3UNG C;  5A2Q Z;  4E7H A;  1Y8Q B;  3ELK A;  2VJ4 A;  4UUV A;  4XQF A;  2PFB A;  2NVX J;  2QSG X;  4UUT A;  5DTD A;  4EM1 A;  2RN7 A;  3IC7 A;  5KAI C;  1KQ9 A;  1J75 A;  4IQJ A;  2V6C A;  4BE1 A;  1VQ5 I;  1AKH B;  2LMD A;  1G4D A;  2L3D A;  4G6D A;  1JT0 A;  2G0E A;  1YIJ I;  2M7B A;  4XN3 A;  3S3N A;  2IW5 A;  1R7J A;  2F6C A;  2K86 A;  3HPG A;  2OTL I;  3FHZ A;  1UB9 A;  1ZLJ A;  2MD0 A;  4ZDP A;  3HOT A;  4LK0 F;  5IP7 J;  1R5I D;  3HL2 A;  5DM7 F;  3KPH A;  2R0Q C;  3GO5 A;  1UHW A;  2O3F A;  2VQC A;  2V6E A;  1YYV A;  2FD5 A;  2KPM A;  2HPI A;  3KLN A;  2V1U A;  1PUF A;  3CUO A;  4DZP A;  5HDN A;  1ODD A;  5E1Z B;  2A61 A;  2CQX A;  2KKO A;  3W6K B;  2L7K A;  2VN2 A;  4Y15 A;  2L9S A;  4XR6 A;  3DEW A;  1TT5 B;  2IGK A;  4LLN A;  1T56 A;  4X1E A;  1GT0 C;  1OPC A;  2LDU A;  1W7P A;  4UY8 I;  4KYW A;  2M0M A;  1MJ9 A;  5JHU A;  3OS0 A;  3H5A A;  3DPL C;  3F72 A;  1BIA A;  4XKC A;  4QSH A;  1F43 A;  4MNU A;  2ME6 A;  3ULQ B;  4A3B J;  1UST A;  2HQ5 A;  3OS2 A;  1PP7 U;  5D6E A;  1DU0 A;  4NQW A;  4PJM A;  5IT9 Z;  2PMZ N;  3U2R A;  2EZK A;  1F5T A;  3ZMU A;  1VQO I;  3L2U A;  2QCO A;  4IL6 C;  2HOE A;  2FEZ A;  3EDP A;  1LFU P;  3ABU A;  3FKJ A;  5F0C A;  4ZTF A;  4Y52 J;  3C2G A;  4KFC A;  3S1N J;  1XD7 A;  1OCP A;  5IP9 J;  2QBY A;  2Q2E B;  3SFI A;  1MGT A;  3RKW A;  6PAX A;  2XAQ A;  1YHQ I;  5HS9 A;  3I4P A;  3AG3 H;  3DEU A;  2BXY A;  3H92 A;  4I09 A;  4XNF A;  3T1B A;  2A69 F;  2AS5 F;  3A01 B;  3LSJ A;  4RLF A;  2VT2 A;  3EYI A;  2GIV A;  4CHU A;  2FML A;  3FMQ A;  3BY6 A;  4I0B A;  3FXO A;  1MZB A;  1PP8 F;  4XK4 A;  3CO6 C;  2WAQ N;  1TBX A;  4E7K A;  3OY9 A;  2DYR H;  2ECC A;  3JRE A;  3SYT A;  5D5W B;  1KU2 A;  3JRB A;  4MFE A;  3LSM A;  1EH7 A;  3PO2 J;  4E4H A;  2LF7 A;  5D5U B;  1R1V A;  4DBQ A;  3WTW C;  1Y0U A;  2L2O A;  5HLI A;  2IT0 A;  1YJN I;  5FO5 A;  1HKT A;  1S3J A;  4Q5S F;  2P5K A;  2R7W A;  2IEK A;  3HRU A;  3H5R A;  1E3H A;  1HKQ A;  3HTU A;  2WV1 A;  1N25 A;  3BG9 A;  4HEA 2;  4MFD A;  4XIC A;  2MLK A;  5L3E A;  1IGN A;  3MZY A;  5DCF A;  1JUM A;  2IP2 A;  2DJI A;  2LY9 A;  2W25 A;  3ZQG A;  2X1C A;  5H6R A;  2V7F A;  4B43 A;  2Q8K A;  4LMY A;  3ZQ7 A;  4RB0 A;  2K4B A;  4IX7 A;  1W5S A;  2BV6 A;  4WCG A;  3OYM A;  4E7J A;  4KIB A;  1BL0 A;  1QU3 A;  1EF4 A;  1WZ2 A;  3RYR A;  1OKR A;  1MDM B;  1V4R A;  5E1W A;  1Z7L A;  2J5O A;  3K70 C;  4XON A;  2QKL B;  5L3G A;  2B0L A;  1DPU A;  5HOD A;  1SEU A;  3LSP A;  1X19 A;  3ZCO A;  4ITV A;  2B9S A;  4IHS A;  3OYJ A;  1R9T J;  3ABL H;  4Q47 A;  4V2G A;  1YI2 I;  3K2A A;  2ZNY A;  4MEY F;  3LSK A;  4QTR A;  4ZYA A;  5M5X J;  5HDG A;  4M6V A;  1YRN B;  2Y9Y A;  3PNY A;  3VYR B;  4FTH A;  1S6L A;  1FT9 A;  4ZYD A;  1ORK A;  1N78 A;  5LD2 C;  3W2A A;  2TRT A;  3PNV A;  5CVI A;  2LH9 A;  5JHF A;  2D2W A;  2OU2 A;  4FAS D;  2QQ9 A;  2VKH A;  4BY7 J;  1MMA A;  5E3N A;  2RNJ A;  4D5C A;  5ICE A;  4JYK A;  4BBS J;  1JHF A;  2KP6 A;  2WAD A;  1JGS A;  2JRT A;  5EEH A;  5F04 A;  4MHG A;  3HHG A;  2DO7 A;  2LVS A;  2IS1 A;  5TGT A;  1IRF A;  2XKO A;  5H6Q A;  1KU9 A;  2GBY A;  4GYI A;  4XLP F;  3FXM A;  4BU2 A;  2DOF A;  1POG A;  3KEY A;  1MMN A;  2XF7 A;  1IRG A;  2AXL A;  2ELK A;  3OYN A;  3WTS C;  4AVZ A;  1LB2 A;  4LG0 B;  4S05 A;  3I4M J;  1N75 A;  1NK2 P;  3S3M A;  2EPF A;  1HW1 A;  2CRG A;  2DTZ A;  3ZR8 X;  3CO7 C;  2WC2 A;  4MQ9 F;  2V26 A;  2GLO A;  3HSR A;  3GCM A;  3ISP A;  2VAS A;  4LOC A;  3C3W A;  1CGP A;  1D8K A;  4CCM A;  5L3D A;  3PUF A;  2I5U A;  1VND A;  5GAE J;  2H94 A;  2EB7 A;  4A3J J;  5LBQ A;  1MNE A;  4M3F A;  1FZP B;  3C18 A;  4IJA A;  2I10 A;  1UHM A;  3KE2 A;  4MLO A;  3FXJ A;  2GXB A;  5D8K B;  2QEX I;  3F6O A;  4U0V A;  2HEO A;  1ETY A;  1X1C A;  2M8E A;  4YIR X;  1XMA A;  1MJB A;  3JRA A;  1WSU A;  2MLG A;  1DU6 A;  2OBP A;  1KU7 A;  3T8T A;  3S17 J;  2BY0 A;  3OIP A;  3MFK A;  3WGG A;  3R61 A;  4BH9 A;  3VOD A;  3HKZ A;  3K0L A;  3JRF A;  2CQ7 A;  2NRA C;  1FP2 A;  1R36 A;  2IAI A;  2WTE A;  3Q0V A;  3IH2 A;  5B5E C;  3J80 Z;  5AIP A;  1SD5 A;  3VWB A;  4D7M A;  4BJ6 C;  1IZ1 A;  3CF2 A;  3BP8 A;  4M6X A;  2NVY J;  1H0M A;  2NVT J;  2Q1Z B;  1VQ9 I;  1TWF J;  4KN7 X;  2L02 A;  2EV0 A;  4F91 B;  5JFR A;  3DU6 A;  1A04 A;  1S29 A;  4P1W A;  2ELH A;  1FEX A;  3FWE A;  2O7O A;  3K6G A;  2CO5 A;  2HDC A;  2ETH A;  2ICW G;  5E3L A;  2PG4 A;  3JRD A;  3HZJ A;  5HDK A;  3EUA A;  4LB6 B;  5D5V B;  2XAJ A;  1P2F A;  3KP5 A;  3DF8 A;  4BEH A;  2A6T A;  3I56 I;  1K83 J;  2ID3 A;  2VBW A;  2PN6 A;  3OOP A;  1IXC A;  4HQM A;  4UHT A;  3RIR A;  3W6V A;  4HZF A;  4ZJZ A;  1Z3Y A;  2PI0 A;  5FKO A;  5L3B A;  1KQ8 A;  1IN7 A;  2FRH A;  3M1E A;  1DGR M;  1LVA A;  2ESN A;  3RKX A;  4IXA A;  3T8R A;  1ETQ A;  1PUF B;  2XB0 X;  3PM1 A;  3W6J B;  3FK6 A;  2WB1 A;  3HUG A;  1T39 A;  4CUG A;  1YTY A;  3F9K A;  4EJW A;  1OCR H;  2BY3 A;  4IRH A;  2M45 A;  1QO0 D;  1JKP C;  3CCV I;  3ERE D;  2A6H F;  3GTO J;  4IPA A;  1EH8 A;  1IC8 A;  1HKS A;  2DAO A;  4W97 A;  3CC2 I;  1JJ6 C;  4ENN A;  1P9Q C;  3TKY A;  2FJ1 A;  3OIO A;  1O4X A;  4EVI A;  3GTP J;  4OIN F;  2A3S A;  3KYC B;  3EUH C;  2EJR A;  2P4W A;  3K4B A;  2E34 A;  1P6R A;  2QGU A;  2VE8 A;  3L2W A;  2ZKZ A;  3L2R A;  1R1U A;  2DFH A;  2KIQ A;  5EEA A;  1JKQ C;  2OUM A;  2TCT A;  4R1H A;  3LAJ A;  4X6A J;  3CME I;  1SMY F;  2KDO A;  2O0Y A;  3WTV C;  2CV2 A;  1ZHF A;  1FOK A;  4F92 B;  3S15 J;  5LHI A;  3HC7 A;  1X2M A;  2FOW A;  2JTV A;  3OYC A;  2XSJ C;  4MGR A;  1RUN A;  2FA5 A;  4U88 A;  1XMX A;  1KZH A;  2X1D A;  3BRO A;  4ZYG A;  3DV8 A;  3F8C A;  1LDK B;  5M3M J;  5ICF A;  4AIH A;  3C7J A;  5GAH J;  3OYF A;  3S2D J;  1JUS A;  4OIO F;  3BCB A;  2EZL A;  3NAR A;  4C3I J;  3SEZ A;  1LVK A;  1Y56 A;  3UKG A;  5IT3 A;  4DOZ A;  2ISY A;  4OIP F;  3Q3S A;  1DP3 A;  1OCO H;  1WPK A;  2KZV A;  4BXX J;  4AD9 A;  3IRQ A;  3FM5 A;  1S72 I;  4BHP A;  2JSP A;  3ZMS A;  1HW2 A;  2STT A;  1T95 A;  1HF0 A;  3V8L A;  2R7R A;  1R00 A;  3S93 A;  1FYL A;  1BI3 A;  1B59 A;  3H9G A;  2P0W A;  1YJ9 I;  4PCQ A;  4B48 A;  3K2Z A;  2H8W A;  4J00 A;  1YOV B;  4ZZL A;  1R71 A;  3LQR A;  3WG9 A;  3H35 A;  3H9J A;  3C1D A;  1T0F A;  5LGU A;  3OSG A;  2YR2 A;  5A2Q K;  2H6C A;  1V54 H;  5FRO A;  1VQ4 I;  2VON A;  4A3G J;  3L2V A;  1T6S A;  3I58 A;  3BQY A;  2OV7 A;  5J1Y A;  1YW8 A;  2NXN B;  3PSI A;  1LQ1 A;  3O3K A;  4CZC A;  4RA2 A;  2HI3 A;  5E3O A;  4P9F A;  2KMU A;  5DD8 A;  2PJR B;  2VQG A;  2FBH A;  3NQO A;  5FLX K;  2GM4 A;  3ABK H;  3A01 A;  3K1P A;  3ERM A;  5CPR B;  1LFB A;  3RPQ A;  4ETS A;  1E2X A;  2HXO A;  2E2J J;  3GFJ A;  1BBY A;  1W0U A;  2Y31 A;  5EDN A;  5J1R A;  5K7Z A;  3BTI A;  1RI7 A;  2CV0 A;  3DKX A;  1WRJ A;  4I7H A;  3G6E I;  2CW8 A;  2DQL A;  3GME A;  1LNW A;  1VQL I;  4L18 B;  2W1O A;  1ACI A;  2K9N A;  1DPR A;  3ML6 A;  4XRS A;  5IOY A;  2QM3 A;  4OAZ A;  1H8A C;  1MNM C;  3IAS 2;  2VC0 A;  3CLQ A;  4XLH A;  3IP4 B;  1Z6T A;  3ASO H;  2CJJ A;  4HF1 A;  4ZDL A;  3D0S A;  1XX5 A;  4EV0 A;  1ITY A;  2IA1 A;  2LY1 A;  2XHK A;  1EKE A;  3BWG A;  1BN5 A;  4N9H A;  4RLQ A;  4KJZ A;  4EJO A;  3H36 A;  3TL4 X;  3J7Z I;  2WWY A;  5FJ8 J;  4R8H A;  3REO A;  1YW7 A;  2V4J C;  1WJB A;  3A1Y A;  2E2I J;  2ZSI B;  4R79 A;  1X3W B;  2XSD C;  3QYB A;  2COM A;  3VPR A;  2XAU A;  4CDG A;  1VQN I;  1TTY A;  1O7F A;  3W2W A;  1VF9 A;  3MZH A;  3DU5 A;  3ECO A;  4O3M A;  1HQC A;  4HBL A;  3WU2 C;  1I27 A;  2F4M B;  2LG4 A;  3WG7 H;  4CIC A;  3BZC A;  2CYY A;  4KMU X;  2EIM H;  5LLQ A;  1P4X A;  2ID6 A;  5H2F C;  3D5L A;  1K78 A;  4BXF A;  4HDV A;  1MH4 A;  4NBQ A;  2MAB A;  3ZQC A;  3PQJ A;  2XVC A;  5E3M A;  2DPD A;  3OS1 A;  4CCJ A;  2ESH A;  4DYR A;  2YU3 A;  2K27 A;  3G71 I;  2PEX A;  3CF5 F;  5E18 F;  3ROU A;  4UUS B;  4QWQ A;  3DQV C;  1WJC A;  1JXS A;  1JKO C;  1O3Q A;  2Y0S N;  2DFI A;  5HNH A;  3P5J A;  1LDD A;  3CTA A;  3GLL A;  3GEZ A;  3NEU A;  1XDU A;  1J0R A;  2L7F P;  1APL C;  2MG4 A;  3BZK A;  3LA2 A;  4OMY A;  4U0Y A;  2OF7 A;  2RGV A;  1QVU A;  4ZTJ A;  3QPL A;  3HGG A;  2E5N A;  2K3F A;  1IG7 A;  5L3C A;  3DBL B;  4PUS A;  3ZN1 A;  2P7V B;  2IS6 A;  2P6T A;  2HPM A;  3HYI A;  4EM0 B;  3E5U A;  2MFZ A;  2O9L A;  3J81 Z;  4GYG A;  1Y39 A;  5EYR A;  4B47 A;  1TLH B;  1HDD C;  4LK1 F;  3ZQL A;  1VFC A;  3HPH A;  1X58 A;  3T5X A;  2MSY A;  3BTJ A;  4BEH B;  4EQQ A;  2F5V A;  1H89 C;  1ON1 A;  4AU7 A;  4BHC A;  1WFX A;  5K7F A;  1JJ8 C;  1EJ9 A;  3LAP A;  1B4A A;  4YG2 F;  3K7A J;  2VOO A;  1Y1W J;  3GTQ J;  2BHZ A;  4GCV A;  3ZQF A;  5AIQ A;  2P6S A;  1GVJ A;  4YII A;  1BOB A;  2OQR A;  1K7A A;  5F27 A;  2JUC A;  3LQQ A; 
#chains in the Genus database with same CATH homology
 2LYC A;  4DGW B;  2LOO A;  3LSM A;  3E1S A;  1D1C A;  4E4H A;  2MC4 A;  1DGW Y;  4DBQ A;  3CMM A;  4F3Q A;  2L2O A;  4CCO A;  4C30 A;  2R7W A;  4XLA A;  2W4S A;  3H5R A;  2K9M A;  1V5G A;  4LG3 A;  2R7Q A;  4HEA 2;  2X6W A;  4HRI A;  3FBN B;  2DJI A;  2HNH A;  2X1C A;  2V7F A;  3OYE A;  3OIQ A;  4B43 A;  2JUG A;  4E7L A;  4E7Z A;  4IX7 A;  3OYM A;  4E7J A;  1QU3 A;  2WBM A;  4XOP A;  1U0J A;  3VSL A;  1WJE A;  2BW3 A;  1MMG A;  1Z7L A;  2VXD A;  2WAF A;  5KNL A;  3K70 C;  3PUB A;  4XON A;  1UG0 A;  3PL8 A;  2QKL B;  1WJ5 A;  2X6X A;  1BR2 A;  3OL3 A;  1X19 A;  5CQG A;  3ZCO A;  3LSG A;  4ITV A;  3OYJ A;  4ZDO A;  2HU9 A;  3LSK A;  2ZFU A;  4ZYA A;  3CJQ B;  4C9Y A;  2CH0 A;  3CZ6 A;  3OYB A;  3PNY A;  3VYR B;  3H9Q A;  4OAY A;  4RM2 A;  1N78 A;  5LD2 C;  3D5S C;  1WJA A;  3W2A A;  3PNV A;  2LH9 A;  4PJN A;  3OR1 C;  3UR3 C;  5JHF A;  3K4K A;  3VYT B;  4D9J A;  4FAS D;  2WAE A;  2CUZ A;  2VKH A;  2VXZ A;  3TBI A;  4PSX A;  1MMA A;  4BE0 A;  2RQQ A;  1LFP A;  3K70 D;  4D1Q A;  2KP6 A;  2WAD A;  1X4P A;  4ZC3 A;  2GOM A;  3PNT A;  4KT6 A;  2IS1 A;  4XM3 A;  5TGT A;  2LRD A;  3DEE A;  1G8X A;  3DKY A;  4G6T B;  4NQW B;  2X51 A;  2R7X A;  4BU2 A;  2VJ5 A;  2IGO A;  1MND A;  3KEY A;  1MMN A;  3CJR B;  2XF7 A;  3MMY B;  3OYN A;  4PSW A;  4AVZ A;  3VYS B;  3K4M A;  2DXI A;  1N75 A;  2LBF A;  3OYI A;  4C2U A;  3AL0 B;  2Y0S A;  3NWS A;  3ZR8 X;  3S3M A;  2HVS A;  1X4O A;  2V26 A;  2W00 A;  4IQ4 A;  3J7A Y;  2VAS A;  4E7I A;  2R7V A;  4XMY A;  2VJJ A;  3K4N A;  3DTK A;  4X0G A;  4CCM A;  3FDY A;  2RRE A;  2AQF A;  1MNE A;  3M8J A;  3ONQ A;  4MLO A;  1ZEL A;  3K4C A;  4Y3O A;  3PFY A;  1X1C A;  4XL9 A;  3OOU A;  4LIV A;  3QYE A;  4GRI A;  4NUB A;  4YEJ A;  4CA0 A;  2XC7 A;  4BDY A;  2M3A A;  4J01 A;  5CQE A;  2E1M B;  3SZG A;  4CSW A;  3I3L A;  2A5W A;  1ERD A;  1SFK A;  3OIP A;  1DQU A;  4BQO A;  3OYG A;  3HKZ A;  1NG7 A;  4XLF A;  3BLY A;  1JI8 A;  4BJ5 C;  2VJI A;  4JOM A;  2DT6 A;  2VKD A;  3U21 A;  4CCL A;  3VWB A;  4KIS A;  4BJ6 C;  3CF2 A;  3DTI A;  1D0X A;  2Q1Z B;  4XKV A;  2QKM B;  4XOT A;  3CP2 A;  4F91 B;  4B44 A;  3DU6 A;  4DBR A;  3OMY A;  4P1W A;  4PJJ A;  3QOD A;  1X1B A;  2LC2 A;  1N77 A;  3K6G A;  3G2B A;  1TT0 A;  1WJD A;  2WY7 Q;  2X85 A;  3DPU A;  3SEQ A;  3E0J B;  1X1D A;  1V5F A;  2W7N A;  3EUA A;  1UEL B;  2M4G A;  4IKF A;  1FMV A;  2HQA A;  3W3C A;  3V42 A;  1D0Z A;  4BAC A;  4BEH A;  2A6T A;  3CES A;  2F4I A;  2R4G A;  1D1B A;  3C2H A;  4BQN A;  2OC6 A;  4ZJZ A;  1D1A A;  3AL0 C;  1Z3Y A;  4H4K C;  2PJR A;  4PFP A;  1T0F C;  4HSR A;  1Z3X A;  5HVQ C;  2VIX A;  1DGR M;  1KON A;  1Z21 A;  1Y6I A;  3HXL A;  2ZXH A;  2WY8 Q;  1R6R A;  3ZGK A;  2WB1 A;  4II2 A;  4CUG A;  3A4C A;  3F9K A;  3RCO A;  3S32 A;  1OLT A;  2CFO A;  2CUJ A;  2R7S A;  1QHH D;  2WA0 A;  3W2V A;  4BJT A;  4PK4 A;  4XN0 A;  3CP8 A;  3OWT A;  4BS9 A;  1P9Q C;  2E1M C;  4E7S A;  2CS3 A;  1FMW A;  3LSH A;  2XF6 A;  3EUH C;  2ELJ A;  4F55 A;  3K4B A;  4BGD A;  4RM3 A;  3L2W A;  4NNJ A;  2BVL A;  3L2R A;  2OUM A;  2KQR A;  4XOR A;  2BOL A;  2GOX B;  4HG2 A;  4NC7 A;  1J09 A;  4XLC A;  2KDO A;  3AFH A;  2CV2 A;  4F92 B;  4QPQ A;  5FRN A;  4HNT A;  3HC7 A;  4P5O A;  4CCN A;  3A2K A;  3OYC A;  2XSJ C;  2K5C A;  3EPZ A;  3RQ4 A;  5FRM A;  2VLA A;  2X1D A;  4XLE A;  3KYL A;  2KRC A;  2HDW A;  1LDK B;  3K10 A;  1SAU A;  4DIQ A;  3OYF A;  2PMZ A;  3BG7 A;  3BCB A;  3I9V 2;  3VYU B;  1OR7 C;  2KRH A;  3LSI A;  4RMN A;  3SEZ A;  4II3 A;  3PJR A;  1K6Y A;  1LVK A;  1V5E A;  1Y56 A;  3AKZ A;  4DOZ A;  4JQF A;  3DPT A;  1YX3 A;  3RTR A;  2M7A A;  1DP3 A;  2KZV A;  1IRX A;  2JSP A;  3MKW B;  1QHG A;  3M1C A;  1T95 A;  4NC8 A;  3QOE A;  2R7R A;  3NWT A;  3MKZ A;  5LFA A;  2E5Z A;  3H5N A;  4Y33 A;  3S93 A;  2NOJ B;  4OWR B;  4PFO A;  4AYB A;  2CW7 A;  3DWL E;  2Z1D A;  2P0W A;  3H9G A;  4B48 A;  1AA7 A;  4J00 A;  3ZQQ A;  4F52 A;  2RNG A;  1BR1 A;  2WAQ A;  3FHN A;  5KHD A;  3H35 A;  3H9J A;  4CCK A;  2W82 A;  4CH7 A;  2CV1 A;  5FRO A;  3L2V A;  2OV7 A;  1YX5 A;  4DJA A;  2VL8 A;  3PSI A;  1W36 C;  2V1N A;  2X1E A;  4CZC A;  3OYD A;  2KMU A;  2BW3 B;  2X6Y A;  4BE2 A;  4N4N B;  2PJR B;  2VQG A;  2VPL A;  3ZXS A;  3VSK A;  4HNU A;  2K9L A;  3K4L A;  1WJF A;  2IGN A;  2FUG 2;  5CPR B;  2ZXI A;  2KLO A;  2CV0 A;  3DKX A;  2O5R A;  2DCE A;  2CW8 A;  1MW7 A;  3HUG B;  3S8P A;  4B3X A;  4HST A;  1E0E A;  2VB6 A;  3RSN A;  3DTE A;  2KHM A;  2JVG A;  2VQL A;  2W1O A;  4N4O B;  4YEL A;  2M4K A;  4Y4R A;  2K3P A;  1W36 D;  4LIU A;  4IZZ A;  2CMP A;  4C2T A;  3IAM 2;  3LMM A;  1LKX A;  2UWM A;  2HZD A;  1UAA A;  2BVM A;  4OAZ A;  1EA3 A;  4PJL A;  3IAS 2;  4XLH A;  2KL4 A;  3UNG C;  3VDX A;  4E7H A;  3IP4 B;  4U87 A;  2L5Q A;  4BUP A;  2LRE A;  3HG9 A;  2VJ4 A;  1D0Y A;  4XQF A;  4ZDL A;  2LY1 A;  3BC8 A;  4RLQ A;  3SDB A;  3GBG A;  4IQJ A;  4KJZ A;  4BE1 A;  3K4J A;  1S9H A;  3TL4 X;  2V4J C;  1WJB A;  3S3O A;  2IGM A;  2XF5 A;  3A1Y A;  2IS4 A;  3L2Q A;  2ZSI B;  3EUK L;  4R79 A;  2R7T A;  2M7B A;  4XN3 A;  3S3N A;  2LBF B;  3QYB A;  4FET A;  1GLN A;  2F6C A;  5HLT A;  2XAU A;  3HPG A;  3W2W A;  1NG6 A;  1BR4 A;  3DU5 A;  2MD0 A;  4ZDP A;  3HOT A;  2LG4 A;  3D5R C;  4QPO A;  2I8D A;  3H0D A;  1X1A A;  3HL2 A;  3BG6 A;  3RPU D;  2ZSH B;  2VQC A;  2V6E A;  2DOA A;  3LL7 A;  4U7B A;  2KPM A;  2HPI A;  2IXS A;  3D5L A;  2Z2S B;  4BL0 B;  4BXF A;  2UUZ A;  2R7O A;  2MAB A;  2VQH A;  4ANJ A;  3TMO A;  4EAT A;  2L7K A;  3OS1 A;  1HA8 A;  2L9S A;  4XR6 A;  3N05 A;  4CCJ A;  4LIT A;  2JVH A;  2IGK A;  2JA2 A;  2M0M A;  3ZRG A;  2UV1 A;  3DQV C;  5HOO A;  1MMD A;  3OYL A;  1WJC A;  3OS0 A;  3H5A A;  3DPL C;  5HNH A;  3OYH A;  2E60 A;  3QYF A;  4XKC A;  5CKT A;  2L9N A;  3HOS A;  3FBI B;  3OYA A;  3MD2 A;  4E6K G;  4BDZ A;  3OS2 A;  2HVR A;  3MKY B;  4PJM A;  5KCM A;  4ZTJ A;  1PYV A;  2LY2 A;  3L2U A;  5HNF A;  2E5N A;  1YE9 A;  3OR2 C;  3FKJ A;  2R7U A;  4KIT B;  4ZTF A;  4PUS A;  3C2G A;  2IS6 A;  2AQE A;  2Z16 A;  2HPM A;  1PJR A;  2MFZ A;  2IS2 A;  2Q2E B;  3PSF A;  4F93 B;  2HVQ A;  4XKW A;  4B47 A;  4XNF A;  3HPH A;  3OL4 A;  4RLF A;  3IUO A;  2XDV A;  4YRV A;  4BEH B;  1VZ0 A;  3BCA A;  2F5V A;  2MYS A;  2DT7 B;  3KX2 A;  4AU7 A;  3OYK A;  4HPQ A;  1WFX A;  3LFU A;  4XKB A;  4E7K A;  3OY9 A;  4BQQ A;  1G59 A;  1BOB A;  2V9K A;  3DLA A;  3SYT A;  1TZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...