1E0EA

N-terminal zinc-binding hhcc domain of hiv-2 integrase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
FLEKIEPAQEEHEKYHSNVKELSHKFGIPNLVARQIVNSCAQCQQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN IMMUNODEFICIENCY VIRUS TYPE 2 INTEGRASE
publication title Refined Solution Structure of the Dimeric N-Terminal Hhcc Domain of HIV-2 Integrase
pubmed doi rcsb
source organism Human immunodeficiency virus type 2 (isolate rod)
molecule tags Integrase
total genus 13
structure length 46
sequence length 46
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1e0eA00
1WJDA 1WJFA 1WJBA 3HPHA 3HPGA 1E0EA 1MW7A 3F9KA 1WJCA 1LFPA 1WJEA 4F3QA 1K6YA 1WJAA 1KONA
chains in the Genus database with same CATH superfamily
1WJFA 2DFEA 3DEUA 3BG7A 2DN0A 3I5UA 3RYRA 3H0GJ 3ABTA 2L9RA 4FE4A 4CCLA 3G71I 3K2AA 2G0EA 4R8HA 1QGPA 2V7FA 4G8XA 4AYBN 2OBPA 1G3WA 1W36C 2OCCH 4E7LA 1R22A 3ZMSA 3ZMVA 4KIFA 3CCLI 2KZGA 2I10A 2FQ4A 2DW4A 4HF1A 2UWMA 2XKPA 4DZPA 3EETA 3HRMA 1H0MA 4C3HJ 1FBSA 3ML6A 4HX7A 4LB5A 2K7LA 3BTIA 2B63J 3GTMJ 4II2A 2CUJA 1D5VA 2DODA 2MH9A 5HLTA 4XMYA 1T08B 2LKPA 3RCOA 3RPQA 3U21A 1IW7F 2HOAA 3JR9A 5F08A 3S93A 2C6YA 1SAUA 4LK1F 2K27A 4YIRX 2VN2A 3ONQA 5E17F 1ETVA 1PVEA 2RQPA 2M0MA 1I5ZA 2OC6A 4CA0A 3EPZA 5FKLA 4DYQA 3DWLE 4HV5A 1Z67A 4C3JJ 4ANJA 1HKTA 2PI0A 3CMAI 3K10A 4Q5SF 1C0WA 1IGNA 4GCVA 5AIPA 2ME0A 4BDZA 4NC8A 4H0EA 4PDKA 2XDVA 5H6RA 3PIOF 1J9IA 1GVDA 3IP4B 4CO8A 4KIGA 2JA8J 4BBRJ 1B4AA 2W82A 1DDNA 2LY9A 3BR0A 1VQ7I 3M4OJ 2VJIA 1TWHJ 2Y31A 1R1UA 2CQ7A 4HX8A 5M3MJ 1Z6RA 3ZOBA 1YJWI 3R4KA 4KT6A 1OCRH 2EA2A 2OZUA 4DGWB 2D45A 1HCRA 2CUEA 5D5XB 2LDUA 3DV8A 2PMZN 4UB6C 1KA8A 2M34A 2IAIA 2NXNB 5AIQA 3GTQJ 4HNTA 1RZ4A 3I53A 3CUQA 1FEXA 1VF9A 3LA2A 3HDDA 4L0YB 2XPVA 4FQGA 2D5VA 1BIAA 4WF2A 3SQNA 1ETQA 2MW8A 5ILVA 1VQ9I 4CICA 3BDDA 4AYBA 2OU2A 3FXOA 2PMUA 3B73A 2HQRA 2Q2EB 5FLVA 3CC2I 1F5TA 1FT9A 2E1CA 2ZJPF 2HEOA 2FXAA 3W3CA 4IX7A 5DS9A 4XKVA 4LLLA 1GT0C 4UNOA 4B48A 5IT3A 2R5YB 3TL4X 1TTYA 2XRLA 2HVRA 2YU3A 5L3FA 4O3MA 3CCSI 5GAEJ 4HZFA 1IRGA 4CGZA 4OU0A 2WA0A 1XCBA 4AUXA 4A6DA 1D5YA 2HGCA 2F4IA 4PFOA 4BJ5C 1OCPA 2H6CA 1PDNC 3ASOH 3I55I 3BLYA 2CQXA 3Q9SA 4UVCA 3U2RA 5KK1A 1DU6A 4MFDA 1G3SA 4OAYA 1F36A 4IZZA 1JTXA 2EH3A 3ZN0A 4U7DA 4TV7A 3SEQA 1QRYA 3TW6A 5DDGA 3OYEA 2L2OA 4WXHA 3EUHC 3CCUI 4IRHA 4NB5A 4PK4A 3CMYA 1Z7LA 3OIPA 2E36A 2R7XA 4KJZA 1JGSA 5HDKA 1ACIA 3BT9A 1W0TA 1ZTRA 3W2AA 2ZFUA 3IWZA 2CWEA 2XSJC 3WHBA 3CP8A 4DBRA 5D6EA 4XN3A 1J2XA 1IN6A 4V2FA 1ETOA 5BMZA 3QPLA 2O61A 3S15J 2L9VA 1Z05A 1N78A 4MEXF 2PMZA 2ZC2A 1FYKA 2FMYA 2BXYA 3QRFF 3IH2A 4KN4X 1VQMI 5J40A 3IL2A 3WE2A 1BW6A 5K5QA 1BW5A 3FXUA 5KVRA 2QKLB 2H1KA 2YX7A 3DTIA 3G3ZA 4AIHA 1UFMA 1MBGA 2JA5J 1BN5A 1IRZA 4ENMA 1IV6A 5L3CA 2E60A 1BI0A 2TRTA 4F3QA 1EH8A 2NS8A 4Z2YA 1AWCA 1FBQA 2X85A 4B4CA 4KIBA 2F48A 3FM5A 5ICFA 1SFOJ 2ID6A 4HLXA 5M5WJ 3QOPA 3J7AO 5GPAA 4IHYA 3K1MA 2DJIA 1P7IA 1HBXG 1LFUP 2IW5A 4XN0A 3ZQ7A 4ZYDA 2VE9A 4U0VA 1TC3C 2CFXA 2DDAA 2IBDA 4CYCA 3J7AY 2H8WA 4BE1A 3QU3A 4LFUA 3ZP5A 2W1OA 1S29A 4GRIA 3ABMH 4LITA 3BQYA 4P55A 2B9SA 1O3QA 2L7MP 2X1EA 4KMUX 2QUFA 1D0XA 1E17A 3FM3A 2L4MA 3BG6A 4A12A 1YTYA 3K7AJ 4MGRA 1ZELA 3HXLA 4JX5A 2HPIA 2O0YA 4N0BA 1HOMA 1AA7A 3KYCB 3HB9A 4RLQA 3ISPA 3GZ6A 4ZJZA 1SD4A 3OYFA 2K4JA 4NQWB 4HSTA 1ONVA 3CESA 3OS0A 2FNPA 3K69A 3DTEA 1U9OA 4A0YA 1T98A 2AO9A 2QQ9A 1S9HA 3SFZA 3Q0VA 2BV6A 2R7TA 4D5CA 5B66C 3HPGA 4M3BA 3J80Z 4UXNA 1W5SA 1RUOA 4F55A 3L09A 1XDSA 3E1SA 1T6SA 2Y0MA 1FIAA 4QLCU 3LOCA 4ENNA 1K78A 2ZNYA 2W57A 1T0FA 1Q1HA 3OYGA 1KU9A 1WH5A 2DA1A 2Z9OA 1FJLA 3CDLA 3K9TA 4A69C 3BQZA 4NDLA 1FLIA 4HDVA 4M72A 5IYDJ 4GGGA 1ORKA 2UUZA 4MIMA 2LBFB 3K70D 3BJAA 3BWGA 3JTHA 2QA4I 1WVRA 2DA5A 1FZPB 4RS8A 3I71A 2HDDA 2DMUA 3CDHA 4HQMA 1K4SA 5C4JJ 3L2UA 5DM7F 2QQ8A 4XLNF 2DA3A 2JT1A 2XPWA 3SFIA 2GIVA 2NVXJ 1X4PA 2L5QA 2QLZA 4AIJA 1GHCA 3SHFA 4KDPA 4L18B 2IP2A 3N05A 5ILSA 5CPRB 4NBQA 4E70A 5J3LA 5HS9A 5FB2A 3KZZA 1DPUA 2CU7A 3GLXA 1A6IA 1SFUA 1W36D 5GP9A 1FMWA 2CV0A 2ELJA 1LUJB 2MC4A 1XTAA 3BC8A 4M71A 1SANA 1YRNB 3BR5A 1QPMA 4LD5A 1B59A 1SVLA 2JQ7A 4BAYA 2QSFX 1DGRM 3FK7A 4Z6YA 1WJCA 1TLHB 3HTSB 1KONA 3NEUA 4Y17A 4HA8A 3QU6A 1KU2A 4L9JA 4PJJA 5CQEA 2LD5A 1XSXA 3OL4A 3TP0A 4WXDA 2VQHA 3OS2A 1KU7A 2LY2A 4RA2A 2VASA 4D7NA 1REPC 1JHFA 3GFMA 3D1NI 1F4KA 3G6EI 2F5EA 1OYIA 4ZTJA 3UR3C 5LHIA 2ESHA 2EZIA 2QYOA 2R7FA 3QODA 4BQNA 4P5OA 1P2FA 4BDYA 3MKWB 3F3XA 2WAFA 3G4SI 1N75A 1WJEA 1FOKA 3SXYA 1QZYA 3FF5A 3M3YJ 4BXFA 3OSFA 3DQVC 3R61A 1XDUA 2AS5F 1XGOA 1R71A 2EK5A 2BE5F 2HTSA 4R79A 1WSUA 1IRXA 2M45A 4EJVA 4N4OB 3GFLA 1TQPA 3E5XA 3M1CA 3S1QJ 1YRNA 2RAEA 3P9IA 2IS6A 1GV2A 1ZRFA 1UG0A 2M5WA 4L5IA 2QM3A 2D2WA 4OIQF 4ABZA 4PGGA 4G7HF 3GTLJ 3G73A 4JK1X 1RETA 3FXQA 2VB6A 2KPMA 5GTHC 2VBYA 3E6CC 2D1HA 3KEOA 2IXSA 1LVAA 5IT9K 3TDUC 2OTLI 2HWVA 3RPUD 3MWMA 5IP6A 2KKOA 1ZREA 1BJZA 5F64A 1LE8A 2HR3A 1LDDA 1VI0A 2DQRA 2MGQA 2P5LC 2JA2A 3SDBA 2WY8Q 2IA1A 3HRUA 4KISA 4LB6B 5EG0B 5E18F 3C7JA 1DP7P 2YSRA 4GYIA 4RB0A 3VDXA 3CJQB 4KA4A 2VODA 3D5SC 2BY3A 1JI8A 4MTEA 2WWYA 2GBYA 4IHVA 5JFRA 2UZKA 3U1KA 2IGMA 3QYEA 2E7XA 4OAZA 1A31A 1SFEA 5F1RA 1S5LC 1B8IB 4ZYAA 1GLNA 1IN8A 1GXPA 2DMPA 4BYYA 3JRCA 4IO9F 3CUQC 2M8EA 1JT0A 2EZKA 4XLAA 1P7JA 1YI2I 1MD0A 2KRHA 5B1BH 5LEJA 3GW2A 2COBA 2XGEA 3Q5FA 3QP6A 2VT2A 1I3AA 1I50J 3I3LA 3M9AA 1E3HA 4XM3A 3ROUA 4CSWA 1N77A 4XKCA 1TZLA 1D0YA 1KYWA 1LDKB 2LF7A 4BUPA 4EQQA 1AKHA 1XMXA 3RKXA 3RSNA 1PUFA 3QPSA 2R5ZB 4P96A 2F4MB 3GFIA 3JW4A 2ECBA 5CVRA 3FXLA 1QVUA 2DBBA 4G9YA 1W5TA 1QHHD 1IRFA 5GPCA 2VPLA 3DF8A 1ON2A 2G7HA 3ABLH 5CJ9A 4GO1A 4I6ZA 1R5ID 1S6LA 3HKZN 1U6GA 3CP2A 1GVJA 2A6TA 2L9NA 2LNBA 2M1BA 5E8IA 2L3DA 3O8HA 4I98B 1VZ0A 1SEUA 1U5TB 2M87A 1I6XA 5EGOB 3DPLC 3EUAA 1P4AA 1AHDP 4BACA 4BXXJ 4M3GA 4ON0A 1ZR4A 4XLHA 3O3KA 2A3SA 2RKHA 2HTJA 1SVOA 2H6BA 3OYJA 1MJAA 3KPHA 3I59A 3ZQHA 1VQ5I 2H94A 5J1YA 1X1PA 1YW7A 2BW3B 1V5FA 1OR7A 5L3GA 3I64A 1YX3A 2JJ7A 3PFIA 1MZBA 4I76A 1MNDA 3TOBA 1R1VA 4A3CJ 2HYGD 3TGNA 3WU2C 1UELB 2W25A 1H9TA 4UUSB 1TL8A 1TNTA 3K1PA 5FKNA 1TWCJ 4HSRA 4UHTA 1G6NA 4DQ2A 4XR6A 4YG2F 1W7PB 5IY5H 1OMIA 4GXOA 2F5FA 1SD5A 1ZLKA 2BY2A 1J75A 1U2WA 1YQAA 2LTPA 4GDFA 1R58A 3GLLA 2DO7A 3MZYA 5F27A 2LH9A 5EGOA 4EJUA 2IA0A 1ZGWA 3TO6A 4KICA 1VQOI 2QSGX 3A4CA 2GOXB 1V5GA 1ZHFA 3DXJF 5FROA 5FO5A 5K7ZA 4CYDA 2E2IJ 2FA5A 4IOAF 5ILUA 1FP2A 4JYKA 2RDPA 4ESJA 4S05A 4E7KA 3M7GA 4V19K 1YG2A 4BXUA 2YR2A 1A04A 2HPMA 3L2VA 1O3SA 1UHSA 3JCUC 2BHYA 1XD7A 4BHCA 4O6JA 2V1UA 1SAXA 2Y9ZA 5J8CA 4PGHA 3SZPA 5HS8A 3HKZA 4V2GA 3CJTB 5IYCJ 1ETYA 3VYTB 2Z5UA 3JRDA 3GZ5A 3ZQGA 4MTDA 2UXNA 2GXAA 2RREA 3MD2A 3K4NA 3RYPA 3JRHA 3KIOA 4OOIA 3ULQB 3ELKA 4PZJA 5HLGA 3BCAA 2VJJA 5EZGA 3OS1A 1LVKA 2JRTA 4LG0A 2DXIA 2O6GE 1TP4A 1Z9CA 2M4KA 3LSKA 5J4VA 2WAEA 5KNLA 2CG4A 3H3UA 3QWLA 2IGOA 2PLYA 3VSLA 4WCGA 4EJTA 3OYDA 3BG5A 5F0CA 3H9GA 1ETWA 1LNWA 1X1BA 2X0LA 1RIOH 4A93J 3MMYB 1HC8A 2A07F 1D8KA 3K4BA 5LHHA 2HXOA 3RKYA 3VOEA 3LL7A 5GTIC 1WI3A 2FU4A 3L7WA 4XIDA 1L3LA 2VT3A 2VXDA 3LSTA 3LSMA 1OLTA 5L3BA 3OYMA 3TP3A 2L7FP 4QIWN 2XIGA 2G7UA 3PJRA 1KU3A 1LFBA 4XNFA 3RJPA 2ZSIB 2CO5A 4HPQA 2H1LA 5EJCA 2DT7B 1T0FC 4DBQA 4M3DA 3C2HA 2Z99A 4WXCA 1X4OA 2MD0A 1HKSA 5TRDA 1EF4A 2LLKA 5E1ZB 3CUQB 4EEFG 2UV1A 2FD5A 5IYBJ 4G7ZF 2MG4A 2BGCA 4GYGA 2V1XA 1QPIA 4LK0F 3CCVI 3HYIA 5F0FA 1R6RA 2CW7A 4C30A 5TISC 5FLXZ 1DPRA 1W7PD 2XAHA 3HOWJ 2E5ZA 4XKWA 2LRDA 3COAC 4XQFA 2CMPA 3S8PA 4KT5C 3OYCA 3WG9A 4B09A 1ERDA 3J81K 4CCOA 1LQ1A 3IKVA 2H27A 3V7RA 4HG2A 3LMMA 2DU9A 3B02A 1IG7A 1B72A 4ITVA 1X1DA 3H3ZA 4EM0B 2QF7A 4MFEA 3L2WA 3I56I 5FD6A 3WGIA 2XAFA 5M3FJ 3LFUA 4EGYA 2JPCA 2HVQA 2V1NA 3HZJA 1U0JA 2I5UA 1ENHA 1TQIA 2VBZA 2LYCA 3KP2A 4DJAA 3AL0B 4RGXA 4ESBA 4U88A 3ZMZA 3MZHA 2DT6A 2CQNA 4UVBA 4G12A 4B3XA 5TJJA 1K4TA 2O8XA 1H9GA 2ZB9A 1R4NB 3NAUA 3WTUC 2L02A 1TT0A 3DU6A 1HSJA 3OR1C 4Y4RA 5DCFA 3CC7I 2V26A 1J7KA 3IH4A 3GVAA 5AONA 3DKWA 5E3LA 2L0KA 2LOOA 1BOAA 3VEPA 4L0ZB 1BC7C 2FSWA 2O8KA 2M9HA 2E71A 3PQKA 3F8FA 4N9IA 1YLFA 5HNHA 3A01A 2GLOA 5LRSA 4IRIA 3Q9VA 2BHZA 3KP4A 5JLWA 1V54H 1QZZA 1AOYA 3F22A 3PUBA 1O4XA 4HDUA 3IKTA 3B6CA 1R49A 2VJ5A 4NC7A 2KJCA 2V6CA 1VQ6I 3OYBA 2W4SA 3RIRA 3K4LA 1ZK8A 2MH2A 3GXOA 1XMAA 4ENJA 1V4RA 1H89C 3BY6A 1IN4A 5KCMA 5B3SH 1MJBA 1ZG1A 2DOFA 1R9TJ 4CDGA 3GX4X 3ZQLA 2WB1N 4RMNA 3E6MA 4W97A 4WK8F 1R7JA 1Z7UA 3LSJA 2XAQA 3O2PE 1QQIA 3AFHA 1Y1VJ 4EMSA 5F0HA 2OTJI 3UNGC 1BC8C 1KQ9A 2BY0A 5GADJ 4CH7A 4J00A 4JQFA 3H35A 1P92A 4BS9A 2EFOA 5J8FA 4B47A 2E1NA 2LSOA 4PFPA 3TMOA 4E7HA 1NK2P 4Y13A 3E6BA 2QGUA 2BVMA 3OYIA 1IXCA 4PUSA 2EZHA 4UVAA 2AQEA 4A5NA 3WU1B 3FIWA 3IAM2 3QPHA 3CCRI 3AG2H 4ZYEA 3S16J 3G1OA 3CMEI 1OPCA 1RESA 2P81A 5D8LB 2ZXIA 1LEAA 1Z1DA 5J1UA 4CYCB 1X1CA 4FE7A 3NQOA 4FASD 4A3MJ 2HQNA 4IKFA 5BOXA 1BIBA 2FBKA 2PJRA 5IPAA 2XB5A 3ABUA 3W2WA 3S1MJ 3OOPA 4M6VA 1IDZA 1QO0D 4MO7A 3IUOA 4UB8C 2DFHA 2K3PA 3WTSC 2IJLA 2L7KA 2JSCA 2OJED 4I09A 2EBIA 5LLQA 4RM3A 1BM9A 1WI9A 3CTAA 2GAUA 2VPRA 1FP1D 3HUGA 3OSGA 2O03A 3HOYJ 4LLGF 2JRMA 2XPUA 3S3OA 4ZYGA 2R92J 3RKQA 5FKMA 1POGA 4MQVA 4EVIA 4IF4A 3ABKH 4CHUA 4UV8A 3PSFA 1Y0NA 3CDIA 3DCFA 3NWTA 1E3PA 4XL9A 2X6OA 3JSPA 1A5JA 1YIOA 4RGRA 4ZC3A 1ETKA 1GXQA 2K4BA 3HOVJ 2CSOA 1K78B 2WB1A 2JSPA 4MHGA 2VC0A 3JAMZ 1YIJI 2IA2A 3PSIA 1HW1A 3M8JA 2X1CA 1MSEC 2H09A 3JSOA 1FTZA 1XPXA 1FPQA 3S1NJ 3CCQI 3OMYA 4DW6A 2XGDA 1LFPA 1I1SA 1TT5B 4BL0B 2HDWA 2MA3A 2RN7A 4XRSA 1G2HA 1QNTA 2JPBA 2OQGA 2GIZA 3I0TA 3HOSA 5CVUA 5DCMA 1RR8C 1HW5A 1T56A 5DTDA 5K5OA 3H3VK 1FSEA 4AC0A 2K9LA 2DOEA 1YS6A 2RV8A 4ETSA 2NS0A 1Y56A 3C2GA 1CQTA 3CD6I 5E8GA 2PQ8A 1IO2A 2XAGA 5J47A 2E7WA 3OWTA 3SEZA 3S3NA 3DU5A 3OYNA 3CZ6A 1Y8RB 5LFAA 1Z3YA 1HDDC 2PJPA 3PO2J 3K4KA 1EV7A 1AU7A 2EB7A 1OR7C 2FX0A 2FE3A 2ZMEA 2ZXWH 4II3A 4BU2A 2HS5A 3EDPA 2K02A 2WADA 2QCOA 1O7FA 5H6QA 4CCNA 2L9SA 4M9SA 2ZJQF 2Z1DA 3HHHA 4UUVA 1IUFA 3R6SA 1ETXA 3F72A 2F5DA 2WY7Q 1G8XA 1TWAJ 2BY1A 3LA3A 2KL4A 4FX4A 2FBHA 1DQUA 3BZ6A 3FHNA 4UV9A 2NAZA 3LSGA 4YIFA 3WTYC 5ICEA 2MD5A 4NNJA 1MBEA 5A2QZ 4RDUA 4PSXA 2XGXA 3W6KB 4A6EA 2XV4S 3LNQA 1U5TC 3Q0WA 1QU3A 4QWQA 3JRFA 3A0HC 2CJJA 1HDPA 5JR3A 5LHGA 2LC2A 3MFKA 3E3VA 1YE9A 2DLLA 3CF2A 3HTUA 1UB9A 2CUZA 2QSHX 2MFZA 1A35A 1IV8A 3OY9A 2TDXA 4AIKA 4AWXB 5CVJA 3FISA 1F43A 5LEKA 1XG1A 4XSZF 3U1DA 3A2KA 4XOPA 2R7WA 1IAWA 2A5YB 3B6AA 2ICWG 2DA4A 4ZDOA 4YFXF 2WTEA 4JOMA 2M2EA 3HRSA 3WGGA 4PJ0C 3S3MA 3F0CA 4L9NA 1RPWA 3GWZA 1HXDA 4BE2A 4NHJA 3E6DA 2Y0SN 4BY7J 1ZAOA 2E34A 2WAQN 4U7BA 4BNCA 2DYSH 4I99C 2M8GX 2Y30A 1LJ9A 4AVZA 3CCEI 2KHMA 2RVCA 1OYWA 2R7DA 2HZTA 5D4SA 1RNLA 3FMQA 4XSXF 3VPRA 1I39A 3T5XA 4D0PA 3HHGA 1JKQC 3LWFA 3TBIA 1LE8B 3TOAA 1SC7A 2BEOA 5D5VB 3JRAA 2GXBA 4A3JJ 2HZDA 4HQEA 1YS7A 2IS1A 3T8RA 3RZOJ 4B43A 4F92B 1YFHA 3W2VA 2KZVA 3HSEA 4PCQA 4W1UA 3ZCOA 3CO7C 2KIMA 2LREA 1Z0XA 1MMSA 2DI3A 2PN6A 2LK2A 4LJZF 4G6TB 4BH9A 1OJLA 3RKWA 4XLCA 2X6YA 3R0AA 1U9NA 1USSA 4RLFA 3RTRA 3QOEA 1YO5C 3C2BA 4N4NB 4XORA 2EWNA 2HKXA 2O7OA 5D4RA 3VFZA 2NVUB 3F9KA 1Y1WJ 1FBUA 2D1VA 4PJLA 4F93B 1A36A 1X1AA 3VYUB 2CFOA 2F4OB 4I0BA 4BQOA 1IC8A 1NTCA 4XLFA 2P5KA 2W48A 4A3GJ 4B3AA 1JT6A 3KYDB 2PG4A 3ZPLA 2WC2A 3GMEA 3K4CA 3ZN1A 5E3MA 1CF7A 1D1BA 1P4XA 2HYFA 2X48A 5KAFC 3HC7A 1Y0UA 3U9GA 1W0UA 3VB2A 4HBLA 2M4GA 2W85A 2DYRH 1HLVA 2EINH 1T38A 2A05A 4U0YA 2K3FA 3DP7A 4K2EA 1AKHB 1XGMA 3IRRA 1PUFB 4DYRA 1GDTA 1QVTA 4IHSA 5KHDA 3BP8A 5L3DA 1VQNI 5K1YA 5DM6F 4C2MJ 2CRGA 3NARA 3O6BB 3A03A 5CLSA 1S7OA 5E20A 5BQTA 1BI2A 4LMYA 2VQCA 2Y0SA 3FXMA 3ZMTA 2Y2ZA 4X1EA 2DTZA 4QPQA 3HG9A 2WV0A 2WAQA 5LGUA 3LSIA 2HVSA 1XC5A 2DMQA 4XKBA 1ZH5A 4ENKA 1R36A 3I4NJ 3ERMA 4FT8A 5FLMJ 3RZDJ 5K7HA 1G4DA 4RAZA 1ZLJA 3TEDA 3I59B 4I2OA 4XICA 3P7NA 2EFWA 4A3FJ 1K6YA 1W5CC 3HBLA 3C3WA 1MDMA 1RKWA 3CJNA 2R3SA 4IPAA 3SZTA 5E1XA 1IZ1A 3S14J 1SVMA 3MCZA 2BYVE 1RI7A 2M3AA 2OQRA 2NYXA 4YRVA 1LPQA 4KUMA 1NK3P 2PEXA 3FXJA 1JUSA 3H9QA 5LRRA 3BOQA 3V8LA 4KN7X 5IP7J 1XN7A 2K9SA 3E0JB 1E3OC 3NWSA 4OIPF 2M30A 2JTVA 4L5EA 1V5EA 3F6VA 5E79C 4HOBA 4HW0A 1JXSA 2XAJA 4F7ZA 1R23A 3GF2A 3J80K 3MAJA 1U3EM 3AL0C 2BOLA 2DAOA 5EEHA 4X0GA 5HOOA 3HOTA 1L0OC 1OQYA 1IF1A 3ZQFA 3V8JA 3IC7A 1J5YA 1G59A 2JK3A 3BG9A 2Q1ZB 1S7AA 3MZ8A 1VQLI 2MLGA 2GA2A 1R4MB 1APLC 3FWEA 2ACJA 3KFWX 1B9MA 4HAMA 5J4YA 2VKDA 3ZQCA 5B5EC 3GFJA 3T1BA 3SYTA 5JHUA 4J01A 1Y39A 3L2QA 1OCZH 2AXLA 4JX6A 3ZRGA 4C3IJ 4P9UA 5LGTA 3OR2C 1EH7A 4RB1A 5M5YJ 4LGWA 3O8GA 1BR1A 1R00A 2VLAA 3F8MA 1YX5A 2CV1A 1OYYA 2LG4A 1MMDA 5FFXA 4OINF 1R5GA 1WQ2A 2DA2A 2W00A 1Z21A 1O3TA 3GEZA 1S8NA 1HSTA 2FBIA 3OYAA 2Z33A 1ULYA 4OMYA 4L9VA 4RGUA 2FMLA 1F1ZA 2K86A 2OV7A 2STTA 3DEEA 3GZNB 3RQ4A 4LG0B 3EQLF 1MKMA 1JJ8C 2VIXA 2X6WA 3Q3SA 4A3DJ 2F2EA 1BL0A 1T39A 1K83J 3I58A 2AHQA 2Y9YA 1UAAA 1FY7A 3BJOA 2R93J 4XLPF 3H92A 4QSHA 2ZJRF 4H4KC 3Q0UA 2ESNA 3F8NA 3BJ6A 1MSFC 3JTGA 3REOA 1VQPI 3N4MA 4IVNA 2EIMH 3H5AA 4L9TA 2W24A 3J7YJ 2JA6J 3DBLB 3PNVA 3DPTA 3KX2A 4OIOF 3KEQA 3CCJI 3M8FA 1E2XA 2K9NA 2Y69H 4HYEA 4CCJA 1FNNA 1WH7A 3KLNA 2VOOA 4M9XA 1MMGA 5HODA 5CKTA 2DA6A 1KQ0A 3VWBA 4EGZA 2A6EF 4Q48A 1EJ9A 3R0JA 1ZGAA 3G1LA 4YIIA 5FGMA 5E3OA 2JN6A 1FOYA 3DLAA 3K6GA 4I01A 4N9HA 3BTCA 4RBOA 1VQ4I 3FXKA 2IEKA 1E0EA 1SD7A 2E19A 1RRJA 4G6QA 2GQQA 3HL2A 4IJAA 2O3FA 3MQ0A 1B6AA 2KMUA 3HIFA 3WU0A 3GYHX 1B72B 1H88C 1A6QA 2JUGA 1D3YA 2COMA 2E2JJ 3D5RC 4BEHA 5D8KB 4CCKA 4FETA 5HNFA 2QEXI 2OZ6A 4KITB 2XUBA 2XRNA 1K61A 4LG3A 1QZEA 4RB3C 1D1CA 1JE8A 2ZMEC 4C9YA 2OUMA 3AKZA 3A0BC 2ISYA 5JVGF 3CJRB 4I0AA 3AG3H 2L01A 2VL8A 2RNGA 1Y6IA 2FEZA 2B0LA 2L7ZA 1ZG3A 5ED4A 1YJ9I 2ZCWA 1FIPA 4IL6C 3VYRB 1YITI 4M6YA 2XF7A 3KP3A 2KIQA 5H2FC 4M9ZA 2VJ4A 3CQZJ 2JVGA 1GV5A 1UMQA 3S1RJ 3JRIA 5KAIC 3G1MA 4D9JA 1VFCA 2X6XA 3A01B 2QBYA 4BHPA 2M0CA 3KP5A 3WE3A 1MBJA 2EQRA 2ZJ2A 2Q0OA 4KFCA 3KEYA 5BPIA 3H9JA 1FTTA 2QZ8A 1MH3A 3IH3A 3BR1A 4RM2A 1I1GA 5ICGA 4WWCA 1KYZA 2JVHA 3ZGKA 2V1DA 5D5WB 1X3UA 1W1WE 3EUKL 5FD5A 2YUSA 1NHAA 2DPDA 2W84A 1N25A 5D5UB 1WJAA 1QHGA 2EFNA 3C1DA 2Z16A 3FBIB 3LQRA 2HU9A 1U8BA 4WX9A 2X51A 3CF5F 2LFBA 2RQQA 5JVTA 3TDZC 2F5CA 3FMSA 2KT0A 5D6FA 3ECOA 4OIRF 4P9FA 2ISZA 3ZQQA 2R7RA 2NS7A 3OOUA 3V7CA 1G3YA 4YFNF 3JREA 2LKXA 4E7IA 1XGSA 4A0XA 1ZRCA 5HDGA 3WTTC 3KLOA 4IHTA 4YFKF 1TWFJ 4IQJA 5ICCA 2PBIA 2VQGA 4UY8I 1UHWA 1VTNC 2IPQX 4A5MA 5C3EJ 1ZYRF 2FJ1A 1F9NA 2HDCA 5JLXA 1J09A 2VE8A 2OCEA 3V8KA 1Q1VA 3L00A 2HOSA 2FOKA 1P9QC 3BG3A 2HOEA 3KZIC 4U87A 4L5JA 4I02A 1FOXA 1XSVA 2HXIA 1XX5A 1ZGJA 5HDNA 3HPHA 1BR2A 4YEJA 1Y8QB 4X6AJ 2EZLA 2MC3A 2PJRB 1HA8A 5IOYA 1KQ8A 2QVOA 2MABA 3WGHA 3DBHB 1B9NA 3V42A 3VODA 3HSRA 3ASNH 4CUGA 1WJ5A 4M6XA 3S2WA 4JX4A 2X4HA 1V3FA 2K9MA 3HOUJ 1XMKA 4Q47A 1YHQI 2M7AA 4EV0A 1JTYA 3M1EA 2NNYA 1O57A 5CYVA 4BJTA 2W7NA 3GTGJ 2XB0X 3W6JB 4PSWA 4BQQA 1Z91A 2DOAA 3HUGB 2K5CA 2XASA 2V9KA 1YYVA 4CZZA 3IV5A 4A0ZA 4HF2A 3RI4A 2HFHA 3DTKA 3K2ZA 3CCYA 1T33A 3MKYB 1QBJA 4XBFA 1FMVA 5F1JA 1ZR2A 3IWFA 2MSYA 1B1BA 5BNGA 1ZRDA 1WPKA 3MEXA 3DPUA 4IHXA 1D1AA 5FRNA 2VC1A 3HJEA 3H0DA 2DCEA 4LIVA 5BS6A 2Z2SB 3GBGA 2HI3A 1WWXA 4B8XA 2DFFA 1U8RA 5M5XJ 3QP5A 2KDOA 4A2UA 1X19A 3F6OA 2OA4A 3GO5A 2R7UA 2RGVA 2IS2A 2Q2EA 1D0ZA 4QTRA 4GFBA 4RAGA 2MBFA 3KCCA 1I27A 5DCMB 2G9WA 2ADUA 1XB4A 5BPDA 2YU9J 2DT5A 1RC9A 1V55H 3KE2A 3RQIA 2R5YA 1JKPC 4G7OF 2CYYA 4G94A 3MVPA 2YS9A 1JUPA 2LF8A 2ETHA 4BHBA 2CGPA 5L3EA 1BA5A 1UZCA 4LOCA 2IRFG 4ASNA 1X2NA 2FF4A 3TO7A 2ZFWA 2N8GA 2E1MC 4Y52J 5IT9Z 2ZKZA 1P4WA 4A3KJ 1SD6A 5EF6A 1MBKA 2ZMEB 2HKOA 2EILH 2ZXHA 3BPXA 2BXZA 2A6HF 2A5WA 3FDYA 2K9QA 4EM2A 2OF7A 4HNVA 2DK8A 2FRHA 4DOZA 1IXSB 1IUYA 2GXGA 3F8CA 1FSHA 4DYCA 3HSFA 1CGPA 3FXRA 4M73A 3BTJA 4FTHA 3ESWB 3SZGA 3NRVA 2CW0F 2GM4A 4LLNA 1MMAA 4HRIA 2L4AA 4R1HA 5HS7A 3HEFA 5IP9J 2DK5A 3OYLA 4XRMA 3ZXSA 3QYBA 3LA7A 4BJ6C 3CC4I 1BR4A 2CQQA 2XROA 3HGYA 4ZZDA 2IVMA 2R7VA 3LSPA 2E35A 2IS4A 3P9KA 2A61A 3WG7H 1QA6A 3CO6C 2CW8A 2P0WA 2EJRA 2KLOA 3D0SA 4CZCA 2IGNA 5DV5A 3OYKA 5H20A 5EDNA 1VQ8I 1Z3XA 2P4WA 2X9DA 2GOMA 2MYSA 1UHMA 5FRMA 5HLHA 2VKHA 2VBWA 2NOGA 1PYVA 4PJNA 1XS9A 5FLXK 2LP0A 4CCMA 2QENA 4BE0A 2E5NA 1ZKGA 4I7HA 4MEYF 4RB2C 2P8TA 2DTRA 3X2QH 1VNDA 4DZJA 3K0LA 4RGSA 2LMDA 2NVYJ 2TCTA 3GTPJ 2DMTA 4XOTA 1R1TA 4E7ZA 3LAPA 3F23A 2K40A 3ECHA 3H1CA 3H5NA 2NRAC 2EV5A 3MN2A 3L2CA 3AG4H 3EYYA 2A69F 2J5PA 1MBHA 3FBNB 3VYSB 1IN7A 3D5LA 3F21A 3E7LA 4DNCA 1USTA 2CQKA 2XSDC 5K5RA 4B1RA 4IHWA 2IGKA 2DJNA 1DUXC 4O5VA 5EEGA 3TW7A 4BKXA 3MKZA 3S2DJ 2QKMB 2XKOA 2F5VA 1HW2A 2R7OA 2FUG2 1IXRC 3HGGA 4ZZLA 3SJMA 4RAYA 3SDGA 3ZMUA 4IOCF 1WKMA 4C2UA 2P7VB 3LSRA 2KP6A 3QAHA 3GTKJ 4F91B 2HYJA 3BPVA 4FX0A 3PUFA 1OISA 1Z77A 3W6VA 6PAXA 4A3BJ 3LAJA 1DGWY 4NQWA 4EATA 5FKOA 3PNYA 4U0WA 1GUUA 4BQAA 5EZHA 5GAGJ 3KYLA 2EIJH 4A3LJ 2YPRA 4M3EA 1FX7A 1J0RA 2GWRA 3IAS2 3AAFA 4Y3OA 2K85A 1ZQ3P 1MNMC 3P9CA 2BVLA 2R7QA 4EJWA 3HOXJ 1R5HA 3FHZA 3K4MA 2GZWA 2JUCA 1PJRA 1NG7A 1KGSA 4ZH4F 2HQAA 1TQMA 2VUMJ 1CF7B 3G2BA 3ERED 3A02A 3LQQA 1FC3A 1HKQA 1ODDA 4S04A 5DD8A 4G6DA 4XK4A 1X3ZB 3BROA 2KJBA 2V9PA 1LDJA 3KETA 1RR7A 2VQLA 4P1WA 2QWWA 2KIUA 1BJAA 3WHCA 2XGCA 3MKLA 4HEA2 4KNYA 2LBFA 4FISA 4IRGA 5K7FA 3UKGA 2L54A 4AM3A 3RPUA 2ZO4A 3HRTA 3BTLA 5FKKA 5DUKA 2LR8A 1SFKA 2DPUA 3CCMI 2VXZA 5LBQA 1MGTA 5ERIA 3JRGA 1TWGJ 3BCBA 3PFYA 5C4XJ 9ANTA 2ELHA 2KRFA 3PL8A 4Y33A 1XCVA 2ECCA 2VI6A 3WTVC 2KDZA 1O3RA 4EM1A 4OWRB 3CUOA 2AXTC 2I8DA 1KZHA 4Q4ZF 1I6HJ 3E5QA 2BBYA 3BZCA 3M07A 5HVQC 2E1MB 2RNJA 3OV8A 2EFQA 2FQ3A 1MDMB 1LEBA 1FYLA 3I9V2 1OKRA 4XONA 3A1YA 4D5FA 3K4JA 4MQ9F 1O7LA 3KP6A 3HOZJ 2R0QC 4IXAA 4JBAA 1IDYA 1X2MA 3FZVA 3BZKA 4FHTA 3VSKA 1XSDA 2DA7A 1MNEA 2XF6A 3FX3A 3KZYA 5DYMA 3RDIA 3ZR8X 2ZSHB 5J6XA 1WZ2A 5F6FA 1JKRC 1TW3A 1Z6TA 2LKSA 2UXXA 3HM5A 4Y15A 4PJMA 1HF0A 1BBYA 2KISA 1MH4A 1T95A 3L9FA 1J59A 1YW8A 3EUHA 1U78A 5F04A 3K1NA 4A3EJ 4BY1J 3BR6A 2XVCA 3PO3J 4D7MA 3CLQA 2J5OA 5CVIA 2P6TA 3PNTA 1X58A 2RC4A 1TBXA 3WTZA 1ITYA 4AVPA 2CH0A 1JKOC 1JJ6C 2NNNA 3I4MJ 4BGDA 5HLIA 4FCYA 2EV6A 2ID3A 3JAMK 2B7EA 2XAUA 2ZXJA 5JI6A 5J1RA 2JMWA 2WV1A 1WJDA 3QPTA 1D8JA 5TGTA 2R7ZJ 1G3TA 1S7EA 2F6CA 3DEWA 3P5JA 3V4GA 4E7SA 3J81Z 2MLKA 2P7CB 2R7SA 4HF0A 3QQAA 2NVTJ 2H8RA 3ZQIA 2NOJB 1OFCX 1EKEA 4NUBA 2BZTA 2OAZA 1SFXA 2FOWA 1T8IA 2CUFA 4CXFA 4ZTFA 4MNUA 3LSHA 5CVVA 2ME6A 5B1AH 3CMMA 1FOWA 4AD9A 3E97A 4D1QA 3DKXA 1BI1A 2P5VA 3I54A 5DD4A 2VBXA 3V7SA 1K79A 1ZG5A 4YELA 4MLOA 5FJ8J 1SMYF 2CS3A 3I4PA 1ZN2A 1OCOH 2Y75A 2STWA 4ZDLA 4Y7NJ 4B44A 1K7AA 1MIJA 2PX9A 4ZDPA 4KMFA 2PFBA 2OPTA 2ZNZA 2VOPA 1VQKI 1FWZA 1MJ9A 4HLYA 1IN5A 3OIQA 4XRSG 1ZARA 1LKXA 5EG0A 1IJWC 2V9VA 1I3QJ 1WJBA 1BI3A 5CQGA 4ESFA 3J7ZI 1NG6A 2EIKH 2ZBKA 1S3JA 1TW2A 1UJ8A 1WFXA 1X3WB 2HNHA 3AG1H 2KRCA 1MW7A 3L1PA 3S17J 1STZA 4XRFA 5A2QK 2HQ5A 1W4MA 3OYHA 3N97A 2NVQJ 3OIOA 2V6EA 4XLEA 1OCCH 1YW9A 1B8IA 1UCRA 2E1OA 1EA3A 2KQRA 2X1DA 4A3IJ 2A68F 2V4JC 2Y48A 2CV2A 1JGGA 1HQCA 2WBMA 2V79A 1PP7U 1FYMA 1TNSA 5JHFA 5FFZA 2PMHA 3BR3A 4OMZA 4F52A 3QYFA 5E1WA 4J19A 2EV0A 3LFKA 4HX4A 2ELKA 3FK6A 1JHHA 2DDBA 3IHUA 3FKJA 1SMTA 3TO9A 5LD2C 1RUNA 5DUIA 1DU0A 3DKYA 3M8EA 4E7JA 1ON1A 3DBRB 1NH3A 2R5ZA 2VKEA 2AQFA 3S2HJ 1PUEE 3EYIA 1JUMA 5GAHJ 3WODF 4AIDA 1WCMJ 3IRQA 5IOZA 2XC7A 3GTJJ 3OL3A 3H5RA 4KYWA 2LY1A 4BEHB 1LB2A 3H36A 3PIPF 2OD5A 4E4HA 4DIQA 2Z3YA 3T8TA 2M7BA 1PP8F 1WGXA 3KP7A 4ZYHA 4M3FA 1U5TA 3JRBA 3L2RA 4HNUA 2KFDA 3WTWC 1OCTC 3DLLF 3FKIJ 3S32A 4C2TA 2P6SA 5EEAA 3GUDA 3F8BA 4AU7A 5C44J 2O5RA 4M74A 2KIFA 2VKVA 1P6RA 3WTXC 1S72I 1WHUA 3E5UA 2GA1A 2BW3A 3C18A 3ZMDA 3PQJA 2DMNA 2E2HJ 2IT0A 2YX4A 4NC6A 1M1EB 1UG2A 5EYRA 5E3NA 2QBYB 1K6OA 4LIUA 2HOTA 4IQ4A 2XHKA 3PM1A 1H8AC 2QQBA 4UUSA 1DP3A 1YOVB 2QQAA 4BBSJ 3TQNA 1BOBA 1WRJA 2EPFA 2DQLA 1RKTA 2XF5A 3GCMA 3T0YA 3K70C 2DFIA 1T2KA 1W7PA 2JWTA 3DFGA 5LGNA 2LVSA 4UUTA 2R4GA 4HV6A 4EJOA 1YJNI 4E6KG 1MMNA 4IEJA 3GTOJ 3FMRA 2EA4A 3CLOA 3R60A 4RAFA 4QPOA 3TKYA 4JP0A 2Q8KA 2EFPA 4S0HB 1MBFA 1XGNA 5DEQA 1EH6A 2O9LA 2JA7J 2JZYA 3BR2A 2VONA 2FNAA
chains in the Genus database with same CATH topology
1WJFA 4XM3A 3I3LA 4CSWA 3BG7A 1N77A 4XKCA 1TZLA 3A2KA 1D0YA 1LDKB 4BUPA 2KDOA 4XOPA 2R7WA 1X19A 4CCLA 3RSNA 4ZDOA 2R7UA 2V7FA 2IS2A 4JOMA 1D0ZA 1W36C 4E7LA 3S3MA 1QHHD 2VPLA 4BE2A 2UWMA 3CP2A 2A6TA 2L9NA 1VZ0A 4U7BA 3DPLC 3EUAA 4II2A 4BACA 2CUJA 4AVZA 2KHMA 2E1MC 5HLTA 4XMYA 3RCOA 3U21A 4XLHA 3S93A 1SAUA 2ZXHA 3TBIA 3ONQA 2A5WA 3FDYA 3OYJA 4DOZA 2M0MA 2HZDA 2OC6A 4CA0A 3EPZA 2IS1A 3DWLE 2BW3B 1V5FA 4B43A 4ANJA 4F92B 1YX3A 3K10A 3W2VA 2KZVA 3ZCOA 2LREA 1MNDA 3SZGA 4BDZA 4G6TB 4NC8A 2XDVA 1MMAA 4HRIA 1UELB 4XLCA 2X6YA 3OYLA 3IP4B 3ZXSA 4RLFA 3QYBA 3RTRA 3QOEA 4N4NB 4XORA 4HSRA 4BJ6C 1BR4A 2W82A 4XR6A 2R7VA 2VJIA 2IS4A 3F9KA 4PJLA 4F93B 1X1AA 2CW8A 2CFOA 2P0WA 3VYUB 4BQOA 4XLFA 2KLOA 4KT6A 4CZCA 4DGWB 2IGNA 3OYKA 3K4CA 1Z3XA 2LH9A 1D1BA 2GOMA 2MYSA 4HNTA 3HC7A 5FRMA 2M4GA 3A4CA 2VKHA 2GOXB 1V5GA 5FROA 1PYVA 4PJNA 4BE0A 4CCMA 2E5NA 4AYBA 4E7KA 5KHDA 2Q2EB 2HPMA 3L2VA 4XOTA 4E7ZA 3W3CA 4IX7A 3H5NA 4XKVA 4B48A 2VQCA 2Y0SA 3HKZA 3TL4X 4QPQA 3HG9A 2HVRA 2WAQA 3VYTB 3LSIA 3FBNB 3VYSB 2HVSA 3D5LA 2RREA 2WA0A 4XKBA 3MD2A 3K4NA 2IGKA 3MKZA 3BCAA 2VJJA 2F4IA 4PFOA 2QKMB 4BJ5C 2F5VA 2R7OA 3OS1A 1LVKA 2FUG2 3BLYA 2DXIA 4C2UA 2M4KA 3LSKA 2KP6A 1K6YA 2WAEA 5KNLA 4OAYA 2IGOA 3VSLA 4IZZA 4F91B 3OYDA 3H9GA 1X1BA 3SEQA 3MMYB 3K4BA 2M3AA 4YRVA 3OYEA 3LL7A 2L2OA 3EUHC 1DGWY 4EATA 4PK4A 3PNYA 1Z7LA 2VXDA 3LSMA 1OLTA 3OIPA 2R7XA 3H9QA 4KJZA 3KYLA 3E0JB 3OYMA 3W2AA 3NWSA 2ZFUA 1V5EA 2XSJC 3IAS2 3PJRA 4XNFA 4Y3OA 3CP8A 2ZSIB 4HPQA 4DBRA 4XN3A 2DT7B 1T0FC 4DBQA 2BVLA 2R7QA 3C2HA 3K4MA 3AL0C 2BOLA 1X4OA 1N78A 2MD0A 1PJRA 2PMZA 1NG7A 4X0GA 2HQAA 5HOOA 3HOTA 3G2BA 2UV1A 1G59A 2Q1ZB 2QKLB 1R6RA 2CW7A 4C30A 3DTIA 2E5ZA 4P1WA 2VQLA 4XKWA 2LRDA 2VKDA 4XQFA 2CMPA 4HEA2 3S8PA 3SYTA 2E60A 3OYCA 4J01A 1ERDA 2LBFA 3L2QA 4CCOA 4F3QA 3ZRGA 3OR2C 4HG2A 3LMMA 2X85A 1SFKA 1BR1A 4ITVA 1X1DA 2VLAA 1YX5A 2CV1A 2VXZA 3L2WA 2LG4A 1MMDA 3LFUA 3BCBA 3PFYA 2HVQA 2DJIA 2W00A 2V1NA 1Z21A 3PL8A 4Y33A 1U0JA 3OYAA 4XN0A 2LYCA 4OWRB 4DJAA 3J7AY 2I8DA 2OV7A 3AL0B 4BE1A 3DEEA 2W1OA 4GRIA 4LITA 2DT6A 3RQ4A 4B3XA 2VIXA 2X6WA 5HVQC 2E1MB 2X1EA 1D0XA 3BG6A 1TT0A 3DU6A 3OR1C 4Y4RA 1ZELA 3I9V2 4XONA 3A1YA 3HXLA 2V26A 3K4JA 2HPIA 1UAAA 1AA7A 2LOOA 4RLQA 3VSKA 4ZJZA 2XF6A 1MNEA 4H4KC 5HNHA 3ZR8X 3OYFA 4NQWB 2ZSHB 4HSTA 3CESA 3OS0A 3DTEA 3PUBA 3H5AA 4PJMA 1T95A 2VJ5A 4NC7A 3PNVA 1S9HA 3DPTA 2W4SA 3KX2A 3OYBA 3K4LA 2R7TA 3HPGA 4CCJA 4F55A 5KCMA 3E1SA 3PNTA 1MMGA 5CKTA 2CH0A 4RMNA 4BGDA 3VWBA 2XAUA 3OYGA 1WJDA 3DLAA 5TGTA 3AFHA 3K6GA 2F6CA 3UNGC 1E0EA 2UUZA 4E7SA 2LBFB 4CH7A 3K70D 4JQFA 3H35A 3HL2A 4J00A 2R7SA 4BS9A 4B47A 2KMUA 2NOJB 4PFPA 3TMOA 2JUGA 4E7HA 4NUBA 3D5RC 4BEHA 4CCKA 2BVMA 4FETA 5HNFA 3OYIA 4KITB 3L2UA 4PUSA 4LG3A 2AQEA 4ZTFA 3IAM2 3LSHA 1D1CA 3CMMA 4C9YA 2OUMA 3AKZA 1X4PA 2L5QA 3DKXA 2ZXIA 4D1QA 1X1CA 3CJRB 4FASD 4IKFA 4YELA 2VL8A 3N05A 2RNGA 2PJRA 1Y6IA 5CPRB 4MLOA 2CS3A 3W2WA 4ZDLA 3IUOA 3VYRB 4B44A 2K3PA 1W36D 2XF7A 4ZDPA 1FMWA 2L7KA 2ELJA 2CV0A 2VJ4A 2MC4A 2JVGA 3OIQA 3BC8A 4RM3A 4D9JA 2X6XA 1LKXA 1WJBA 5CQGA 1DGRM 3S3OA 1WJCA 1NG6A 3KEYA 1WFXA 3H9JA 2HNHA 2KRCA 1KONA 1MW7A 4RM2A 3OYHA 5CQEA 4PJJA 2JVHA 2V6EA 3ZGKA 4XLEA 3OL4A 2VQHA 3OS2A 3EUKL 2LY2A 3PSFA 2VASA 1EA3A 2KQRA 2X1DA 3NWTA 2V4JC 4XL9A 2CV2A 1WJAA 1QHGA 2WBMA 4ZC3A 2Z16A 3FBIB 4ZTJA 3UR3C 5JHFA 2HU9A 2WB1A 2JSPA 3QODA 2X51A 4BQNA 2RQQA 4F52A 3QYFA 4P5OA 4BDYA 3MKWB 3PSIA 3M8JA 2WAFA 1N75A 1WJEA 2X1CA 3ZQQA 2R7RA 4BXFA 3FKJA 3DQVC 3OOUA 5LD2C 4E7IA 3OMYA 3DKYA 4E7JA 1LFPA 4BL0B 4R79A 2HDWA 2AQFA 1IRXA 4N4OB 4IQJA 3M1CA 2VQGA 2XC7A 3HOSA 3OL3A 3H5RA 2IS6A 2LY1A 4BEHB 1J09A 1UG0A 2K9LA 4E4HA 1P9QC 1Y56A 3C2GA 4DIQA 2M7BA 4U87A 3OWTA 3SEZA 3S3NA 3L2RA 3DU5A 4HNUA 3HPHA 1BR2A 2KPMA 2VB6A 3OYNA 3CZ6A 4YEJA 5LFAA 1Z3YA 1HA8A 2PJRB 2IXSA 3K4KA 3S32A 4C2TA 2MABA 3RPUD 1OR7C 4II3A 3V42A 4AU7A 2O5RA 4BU2A 4CUGA 1WJ5A 2WADA 2JA2A 2K9MA 3SDBA 4CCNA 2L9SA 2M7AA 2Z1DA 2WY8Q 4BJTA 2BW3A 2W7NA 4PSWA 4BQQA 4KISA 2WY7Q 1G8XA 2DOAA 3HUGB 2KL4A 2K5CA 2V9KA 4LIUA 4IQ4A 1DQUA 3VDXA 3CJQB 3FHNA 1DP3A 3D5SC 1JI8A 3LSGA 3DTKA 1BOBA 3MKYB 4NNJA 1FMVA 2XF5A 2IGMA 3K70C 3QYEA 4PSXA 4OAZA 1QU3A 4ZYAA 1GLNA 2R4GA 4E6KG 2LC2A 1MMNA 3DPUA 1YE9A 1D1AA 3CF2A 4XLAA 5FRNA 2CUZA 4QPOA 2KRHA 2MFZA 3H0DA 2DCEA 4LIVA 2Z2SB 3OY9A 3GBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJD A;  1WJF A;  1WJB A;  3HPH A;  3HPG A;  1E0E A;  1MW7 A;  3F9K A;  1WJC A;  1LFP A;  1WJE A;  4F3Q A;  1K6Y A;  1WJA A;  1KON A; 
#chains in the Genus database with same CATH topology
 1WJF A;  2DFE A;  3DEU A;  3BG7 A;  2DN0 A;  3I5U A;  3RYR A;  3H0G J;  3ABT A;  2L9R A;  4FE4 A;  4CCL A;  3G71 I;  3K2A A;  2G0E A;  4R8H A;  1QGP A;  2V7F A;  4G8X A;  4AYB N;  2OBP A;  1G3W A;  1W36 C;  2OCC H;  4E7L A;  1R22 A;  3ZMS A;  3ZMV A;  4KIF A;  3CCL I;  2KZG A;  2I10 A;  2FQ4 A;  2DW4 A;  4HF1 A;  2UWM A;  2XKP A;  4DZP A;  3EET A;  3HRM A;  1H0M A;  4C3H J;  1FBS A;  3ML6 A;  4HX7 A;  4LB5 A;  2K7L A;  3BTI A;  2B63 J;  3GTM J;  4II2 A;  2CUJ A;  1D5V A;  2DOD A;  2MH9 A;  5HLT A;  4XMY A;  1T08 B;  2LKP A;  3RCO A;  3RPQ A;  3U21 A;  1IW7 F;  2HOA A;  3JR9 A;  5F08 A;  3S93 A;  2C6Y A;  1SAU A;  4LK1 F;  2K27 A;  4YIR X;  2VN2 A;  3ONQ A;  5E17 F;  1ETV A;  1PVE A;  2RQP A;  2M0M A;  1I5Z A;  2OC6 A;  4CA0 A;  3EPZ A;  5FKL A;  4DYQ A;  3DWL E;  4HV5 A;  1Z67 A;  4C3J J;  4ANJ A;  1HKT A;  2PI0 A;  3CMA I;  3K10 A;  4Q5S F;  1C0W A;  1IGN A;  4GCV A;  5AIP A;  2ME0 A;  4BDZ A;  4NC8 A;  4H0E A;  4PDK A;  2XDV A;  5H6R A;  3PIO F;  1J9I A;  1GVD A;  3IP4 B;  4CO8 A;  4KIG A;  2JA8 J;  4BBR J;  1B4A A;  2W82 A;  1DDN A;  2LY9 A;  3BR0 A;  1VQ7 I;  3M4O J;  2VJI A;  1TWH J;  2Y31 A;  1R1U A;  2CQ7 A;  4HX8 A;  5M3M J;  1Z6R A;  3ZOB A;  1YJW I;  3R4K A;  4KT6 A;  1OCR H;  2EA2 A;  2OZU A;  4DGW B;  2D45 A;  1HCR A;  2CUE A;  5D5X B;  2LDU A;  3DV8 A;  2PMZ N;  4UB6 C;  1KA8 A;  2M34 A;  2IAI A;  2NXN B;  5AIQ A;  3GTQ J;  4HNT A;  1RZ4 A;  3I53 A;  3CUQ A;  1FEX A;  1VF9 A;  3LA2 A;  3HDD A;  4L0Y B;  2XPV A;  4FQG A;  2D5V A;  1BIA A;  4WF2 A;  3SQN A;  1ETQ A;  2MW8 A;  5ILV A;  1VQ9 I;  4CIC A;  3BDD A;  4AYB A;  2OU2 A;  3FXO A;  2PMU A;  3B73 A;  2HQR A;  2Q2E B;  5FLV A;  3CC2 I;  1F5T A;  1FT9 A;  2E1C A;  2ZJP F;  2HEO A;  2FXA A;  3W3C A;  4IX7 A;  5DS9 A;  4XKV A;  4LLL A;  1GT0 C;  4UNO A;  4B48 A;  5IT3 A;  2R5Y B;  3TL4 X;  1TTY A;  2XRL A;  2HVR A;  2YU3 A;  5L3F A;  4O3M A;  3CCS I;  5GAE J;  4HZF A;  1IRG A;  4CGZ A;  4OU0 A;  2WA0 A;  1XCB A;  4AUX A;  4A6D A;  1D5Y A;  2HGC A;  2F4I A;  4PFO A;  4BJ5 C;  1OCP A;  2H6C A;  1PDN C;  3ASO H;  3I55 I;  3BLY A;  2CQX A;  3Q9S A;  4UVC A;  3U2R A;  5KK1 A;  1DU6 A;  4MFD A;  1G3S A;  4OAY A;  1F36 A;  4IZZ A;  1JTX A;  2EH3 A;  3ZN0 A;  4U7D A;  4TV7 A;  3SEQ A;  1QRY A;  3TW6 A;  5DDG A;  3OYE A;  2L2O A;  4WXH A;  3EUH C;  3CCU I;  4IRH A;  4NB5 A;  4PK4 A;  3CMY A;  1Z7L A;  3OIP A;  2E36 A;  2R7X A;  4KJZ A;  1JGS A;  5HDK A;  1ACI A;  3BT9 A;  1W0T A;  1ZTR A;  3W2A A;  2ZFU A;  3IWZ A;  2CWE A;  2XSJ C;  3WHB A;  3CP8 A;  4DBR A;  5D6E A;  4XN3 A;  1J2X A;  1IN6 A;  4V2F A;  1ETO A;  5BMZ A;  3QPL A;  2O61 A;  3S15 J;  2L9V A;  1Z05 A;  1N78 A;  4MEX F;  2PMZ A;  2ZC2 A;  1FYK A;  2FMY A;  2BXY A;  3QRF F;  3IH2 A;  4KN4 X;  1VQM I;  5J40 A;  3IL2 A;  3WE2 A;  1BW6 A;  5K5Q A;  1BW5 A;  3FXU A;  5KVR A;  2QKL B;  2H1K A;  2YX7 A;  3DTI A;  3G3Z A;  4AIH A;  1UFM A;  1MBG A;  2JA5 J;  1BN5 A;  1IRZ A;  4ENM A;  1IV6 A;  5L3C A;  2E60 A;  1BI0 A;  2TRT A;  4F3Q A;  1EH8 A;  2NS8 A;  4Z2Y A;  1AWC A;  1FBQ A;  2X85 A;  4B4C A;  4KIB A;  2F48 A;  3FM5 A;  5ICF A;  1SFO J;  2ID6 A;  4HLX A;  5M5W J;  3QOP A;  3J7A O;  5GPA A;  4IHY A;  3K1M A;  2DJI A;  1P7I A;  1HBX G;  1LFU P;  2IW5 A;  4XN0 A;  3ZQ7 A;  4ZYD A;  2VE9 A;  4U0V A;  1TC3 C;  2CFX A;  2DDA A;  2IBD A;  4CYC A;  3J7A Y;  2H8W A;  4BE1 A;  3QU3 A;  4LFU A;  3ZP5 A;  2W1O A;  1S29 A;  4GRI A;  3ABM H;  4LIT A;  3BQY A;  4P55 A;  2B9S A;  1O3Q A;  2L7M P;  2X1E A;  4KMU X;  2QUF A;  1D0X A;  1E17 A;  3FM3 A;  2L4M A;  3BG6 A;  4A12 A;  1YTY A;  3K7A J;  4MGR A;  1ZEL A;  3HXL A;  4JX5 A;  2HPI A;  2O0Y A;  4N0B A;  1HOM A;  1AA7 A;  3KYC B;  3HB9 A;  4RLQ A;  3ISP A;  3GZ6 A;  4ZJZ A;  1SD4 A;  3OYF A;  2K4J A;  4NQW B;  4HST A;  1ONV A;  3CES A;  3OS0 A;  2FNP A;  3K69 A;  3DTE A;  1U9O A;  4A0Y A;  1T98 A;  2AO9 A;  2QQ9 A;  1S9H A;  3SFZ A;  3Q0V A;  2BV6 A;  2R7T A;  4D5C A;  5B66 C;  3HPG A;  4M3B A;  3J80 Z;  4UXN A;  1W5S A;  1RUO A;  4F55 A;  3L09 A;  1XDS A;  3E1S A;  1T6S A;  2Y0M A;  1FIA A;  4QLC U;  3LOC A;  4ENN A;  1K78 A;  2ZNY A;  2W57 A;  1T0F A;  1Q1H A;  3OYG A;  1KU9 A;  1WH5 A;  2DA1 A;  2Z9O A;  1FJL A;  3CDL A;  3K9T A;  4A69 C;  3BQZ A;  4NDL A;  1FLI A;  4HDV A;  4M72 A;  5IYD J;  4GGG A;  1ORK A;  2UUZ A;  4MIM A;  2LBF B;  3K70 D;  3BJA A;  3BWG A;  3JTH A;  2QA4 I;  1WVR A;  2DA5 A;  1FZP B;  4RS8 A;  3I71 A;  2HDD A;  2DMU A;  3CDH A;  4HQM A;  1K4S A;  5C4J J;  3L2U A;  5DM7 F;  2QQ8 A;  4XLN F;  2DA3 A;  2JT1 A;  2XPW A;  3SFI A;  2GIV A;  2NVX J;  1X4P A;  2L5Q A;  2QLZ A;  4AIJ A;  1GHC A;  3SHF A;  4KDP A;  4L18 B;  2IP2 A;  3N05 A;  5ILS A;  5CPR B;  4NBQ A;  4E70 A;  5J3L A;  5HS9 A;  5FB2 A;  3KZZ A;  1DPU A;  2CU7 A;  3GLX A;  1A6I A;  1SFU A;  1W36 D;  5GP9 A;  1FMW A;  2CV0 A;  2ELJ A;  1LUJ B;  2MC4 A;  1XTA A;  3BC8 A;  4M71 A;  1SAN A;  1YRN B;  3BR5 A;  1QPM A;  4LD5 A;  1B59 A;  1SVL A;  2JQ7 A;  4BAY A;  2QSF X;  1DGR M;  3FK7 A;  4Z6Y A;  1WJC A;  1TLH B;  3HTS B;  1KON A;  3NEU A;  4Y17 A;  4HA8 A;  3QU6 A;  1KU2 A;  4L9J A;  4PJJ A;  5CQE A;  2LD5 A;  1XSX A;  3OL4 A;  3TP0 A;  4WXD A;  2VQH A;  3OS2 A;  1KU7 A;  2LY2 A;  4RA2 A;  2VAS A;  4D7N A;  1REP C;  1JHF A;  3GFM A;  3D1N I;  1F4K A;  3G6E I;  2F5E A;  1OYI A;  4ZTJ A;  3UR3 C;  5LHI A;  2ESH A;  2EZI A;  2QYO A;  2R7F A;  3QOD A;  4BQN A;  4P5O A;  1P2F A;  4BDY A;  3MKW B;  3F3X A;  2WAF A;  3G4S I;  1N75 A;  1WJE A;  1FOK A;  3SXY A;  1QZY A;  3FF5 A;  3M3Y J;  4BXF A;  3OSF A;  3DQV C;  3R61 A;  1XDU A;  2AS5 F;  1XGO A;  1R71 A;  2EK5 A;  2BE5 F;  2HTS A;  4R79 A;  1WSU A;  1IRX A;  2M45 A;  4EJV A;  4N4O B;  3GFL A;  1TQP A;  3E5X A;  3M1C A;  3S1Q J;  1YRN A;  2RAE A;  3P9I A;  2IS6 A;  1GV2 A;  1ZRF A;  1UG0 A;  2M5W A;  4L5I A;  2QM3 A;  2D2W A;  4OIQ F;  4ABZ A;  4PGG A;  4G7H F;  3GTL J;  3G73 A;  4JK1 X;  1RET A;  3FXQ A;  2VB6 A;  2KPM A;  5GTH C;  2VBY A;  3E6C C;  2D1H A;  3KEO A;  2IXS A;  1LVA A;  5IT9 K;  3TDU C;  2OTL I;  2HWV A;  3RPU D;  3MWM A;  5IP6 A;  2KKO A;  1ZRE A;  1BJZ A;  5F64 A;  1LE8 A;  2HR3 A;  1LDD A;  1VI0 A;  2DQR A;  2MGQ A;  2P5L C;  2JA2 A;  3SDB A;  2WY8 Q;  2IA1 A;  3HRU A;  4KIS A;  4LB6 B;  5EG0 B;  5E18 F;  3C7J A;  1DP7 P;  2YSR A;  4GYI A;  4RB0 A;  3VDX A;  3CJQ B;  4KA4 A;  2VOD A;  3D5S C;  2BY3 A;  1JI8 A;  4MTE A;  2WWY A;  2GBY A;  4IHV A;  5JFR A;  2UZK A;  3U1K A;  2IGM A;  3QYE A;  2E7X A;  4OAZ A;  1A31 A;  1SFE A;  5F1R A;  1S5L C;  1B8I B;  4ZYA A;  1GLN A;  1IN8 A;  1GXP A;  2DMP A;  4BYY A;  3JRC A;  4IO9 F;  3CUQ C;  2M8E A;  1JT0 A;  2EZK A;  4XLA A;  1P7J A;  1YI2 I;  1MD0 A;  2KRH A;  5B1B H;  5LEJ A;  3GW2 A;  2COB A;  2XGE A;  3Q5F A;  3QP6 A;  2VT2 A;  1I3A A;  1I50 J;  3I3L A;  3M9A A;  1E3H A;  4XM3 A;  3ROU A;  4CSW A;  1N77 A;  4XKC A;  1TZL A;  1D0Y A;  1KYW A;  1LDK B;  2LF7 A;  4BUP A;  4EQQ A;  1AKH A;  1XMX A;  3RKX A;  3RSN A;  1PUF A;  3QPS A;  2R5Z B;  4P96 A;  2F4M B;  3GFI A;  3JW4 A;  2ECB A;  5CVR A;  3FXL A;  1QVU A;  2DBB A;  4G9Y A;  1W5T A;  1QHH D;  1IRF A;  5GPC A;  2VPL A;  3DF8 A;  1ON2 A;  2G7H A;  3ABL H;  5CJ9 A;  4GO1 A;  4I6Z A;  1R5I D;  1S6L A;  3HKZ N;  1U6G A;  3CP2 A;  1GVJ A;  2A6T A;  2L9N A;  2LNB A;  2M1B A;  5E8I A;  2L3D A;  3O8H A;  4I98 B;  1VZ0 A;  1SEU A;  1U5T B;  2M87 A;  1I6X A;  5EGO B;  3DPL C;  3EUA A;  1P4A A;  1AHD P;  4BAC A;  4BXX J;  4M3G A;  4ON0 A;  1ZR4 A;  4XLH A;  3O3K A;  2A3S A;  2RKH A;  2HTJ A;  1SVO A;  2H6B A;  3OYJ A;  1MJA A;  3KPH A;  3I59 A;  3ZQH A;  1VQ5 I;  2H94 A;  5J1Y A;  1X1P A;  1YW7 A;  2BW3 B;  1V5F A;  1OR7 A;  5L3G A;  3I64 A;  1YX3 A;  2JJ7 A;  3PFI A;  1MZB A;  4I76 A;  1MND A;  3TOB A;  1R1V A;  4A3C J;  2HYG D;  3TGN A;  3WU2 C;  1UEL B;  2W25 A;  1H9T A;  4UUS B;  1TL8 A;  1TNT A;  3K1P A;  5FKN A;  1TWC J;  4HSR A;  4UHT A;  1G6N A;  4DQ2 A;  4XR6 A;  4YG2 F;  1W7P B;  5IY5 H;  1OMI A;  4GXO A;  2F5F A;  1SD5 A;  1ZLK A;  2BY2 A;  1J75 A;  1U2W A;  1YQA A;  2LTP A;  4GDF A;  1R58 A;  3GLL A;  2DO7 A;  3MZY A;  5F27 A;  2LH9 A;  5EGO A;  4EJU A;  2IA0 A;  1ZGW A;  3TO6 A;  4KIC A;  1VQO I;  2QSG X;  3A4C A;  2GOX B;  1V5G A;  1ZHF A;  3DXJ F;  5FRO A;  5FO5 A;  5K7Z A;  4CYD A;  2E2I J;  2FA5 A;  4IOA F;  5ILU A;  1FP2 A;  4JYK A;  2RDP A;  4ESJ A;  4S05 A;  4E7K A;  3M7G A;  4V19 K;  1YG2 A;  4BXU A;  2YR2 A;  1A04 A;  2HPM A;  3L2V A;  1O3S A;  1UHS A;  3JCU C;  2BHY A;  1XD7 A;  4BHC A;  4O6J A;  2V1U A;  1SAX A;  2Y9Z A;  5J8C A;  4PGH A;  3SZP A;  5HS8 A;  3HKZ A;  4V2G A;  3CJT B;  5IYC J;  1ETY A;  3VYT B;  2Z5U A;  3JRD A;  3GZ5 A;  3ZQG A;  4MTD A;  2UXN A;  2GXA A;  2RRE A;  3MD2 A;  3K4N A;  3RYP A;  3JRH A;  3KIO A;  4OOI A;  3ULQ B;  3ELK A;  4PZJ A;  5HLG A;  3BCA A;  2VJJ A;  5EZG A;  3OS1 A;  1LVK A;  2JRT A;  4LG0 A;  2DXI A;  2O6G E;  1TP4 A;  1Z9C A;  2M4K A;  3LSK A;  5J4V A;  2WAE A;  5KNL A;  2CG4 A;  3H3U A;  3QWL A;  2IGO A;  2PLY A;  3VSL A;  4WCG A;  4EJT A;  3OYD A;  3BG5 A;  5F0C A;  3H9G A;  1ETW A;  1LNW A;  1X1B A;  2X0L A;  1RIO H;  4A93 J;  3MMY B;  1HC8 A;  2A07 F;  1D8K A;  3K4B A;  5LHH A;  2HXO A;  3RKY A;  3VOE A;  3LL7 A;  5GTI C;  1WI3 A;  2FU4 A;  3L7W A;  4XID A;  1L3L A;  2VT3 A;  2VXD A;  3LST A;  3LSM A;  1OLT A;  5L3B A;  3OYM A;  3TP3 A;  2L7F P;  4QIW N;  2XIG A;  2G7U A;  3PJR A;  1KU3 A;  1LFB A;  4XNF A;  3RJP A;  2ZSI B;  2CO5 A;  4HPQ A;  2H1L A;  5EJC A;  2DT7 B;  1T0F C;  4DBQ A;  4M3D A;  3C2H A;  2Z99 A;  4WXC A;  1X4O A;  2MD0 A;  1HKS A;  5TRD A;  1EF4 A;  2LLK A;  5E1Z B;  3CUQ B;  4EEF G;  2UV1 A;  2FD5 A;  5IYB J;  4G7Z F;  2MG4 A;  2BGC A;  4GYG A;  2V1X A;  1QPI A;  4LK0 F;  3CCV I;  3HYI A;  5F0F A;  1R6R A;  2CW7 A;  4C30 A;  5TIS C;  5FLX Z;  1DPR A;  1W7P D;  2XAH A;  3HOW J;  2E5Z A;  4XKW A;  2LRD A;  3COA C;  4XQF A;  2CMP A;  3S8P A;  4KT5 C;  3OYC A;  3WG9 A;  4B09 A;  1ERD A;  3J81 K;  4CCO A;  1LQ1 A;  3IKV A;  2H27 A;  3V7R A;  4HG2 A;  3LMM A;  2DU9 A;  3B02 A;  1IG7 A;  1B72 A;  4ITV A;  1X1D A;  3H3Z A;  4EM0 B;  2QF7 A;  4MFE A;  3L2W A;  3I56 I;  5FD6 A;  3WGI A;  2XAF A;  5M3F J;  3LFU A;  4EGY A;  2JPC A;  2HVQ A;  2V1N A;  3HZJ A;  1U0J A;  2I5U A;  1ENH A;  1TQI A;  2VBZ A;  2LYC A;  3KP2 A;  4DJA A;  3AL0 B;  4RGX A;  4ESB A;  4U88 A;  3ZMZ A;  3MZH A;  2DT6 A;  2CQN A;  4UVB A;  4G12 A;  4B3X A;  5TJJ A;  1K4T A;  2O8X A;  1H9G A;  2ZB9 A;  1R4N B;  3NAU A;  3WTU C;  2L02 A;  1TT0 A;  3DU6 A;  1HSJ A;  3OR1 C;  4Y4R A;  5DCF A;  3CC7 I;  2V26 A;  1J7K A;  3IH4 A;  3GVA A;  5AON A;  3DKW A;  5E3L A;  2L0K A;  2LOO A;  1BOA A;  3VEP A;  4L0Z B;  1BC7 C;  2FSW A;  2O8K A;  2M9H A;  2E71 A;  3PQK A;  3F8F A;  4N9I A;  1YLF A;  5HNH A;  3A01 A;  2GLO A;  5LRS A;  4IRI A;  3Q9V A;  2BHZ A;  3KP4 A;  5JLW A;  1V54 H;  1QZZ A;  1AOY A;  3F22 A;  3PUB A;  1O4X A;  4HDU A;  3IKT A;  3B6C A;  1R49 A;  2VJ5 A;  4NC7 A;  2KJC A;  2V6C A;  1VQ6 I;  3OYB A;  2W4S A;  3RIR A;  3K4L A;  1ZK8 A;  2MH2 A;  3GXO A;  1XMA A;  4ENJ A;  1V4R A;  1H89 C;  3BY6 A;  1IN4 A;  5KCM A;  5B3S H;  1MJB A;  1ZG1 A;  2DOF A;  1R9T J;  4CDG A;  3GX4 X;  3ZQL A;  2WB1 N;  4RMN A;  3E6M A;  4W97 A;  4WK8 F;  1R7J A;  1Z7U A;  3LSJ A;  2XAQ A;  3O2P E;  1QQI A;  3AFH A;  1Y1V J;  4EMS A;  5F0H A;  2OTJ I;  3UNG C;  1BC8 C;  1KQ9 A;  2BY0 A;  5GAD J;  4CH7 A;  4J00 A;  4JQF A;  3H35 A;  1P92 A;  4BS9 A;  2EFO A;  5J8F A;  4B47 A;  2E1N A;  2LSO A;  4PFP A;  3TMO A;  4E7H A;  1NK2 P;  4Y13 A;  3E6B A;  2QGU A;  2BVM A;  3OYI A;  1IXC A;  4PUS A;  2EZH A;  4UVA A;  2AQE A;  4A5N A;  3WU1 B;  3FIW A;  3IAM 2;  3QPH A;  3CCR I;  3AG2 H;  4ZYE A;  3S16 J;  3G1O A;  3CME I;  1OPC A;  1RES A;  2P81 A;  5D8L B;  2ZXI A;  1LEA A;  1Z1D A;  5J1U A;  4CYC B;  1X1C A;  4FE7 A;  3NQO A;  4FAS D;  4A3M J;  2HQN A;  4IKF A;  5BOX A;  1BIB A;  2FBK A;  2PJR A;  5IPA A;  2XB5 A;  3ABU A;  3W2W A;  3S1M J;  3OOP A;  4M6V A;  1IDZ A;  1QO0 D;  4MO7 A;  3IUO A;  4UB8 C;  2DFH A;  2K3P A;  3WTS C;  2IJL A;  2L7K A;  2JSC A;  2OJE D;  4I09 A;  2EBI A;  5LLQ A;  4RM3 A;  1BM9 A;  1WI9 A;  3CTA A;  2GAU A;  2VPR A;  1FP1 D;  3HUG A;  3OSG A;  2O03 A;  3HOY J;  4LLG F;  2JRM A;  2XPU A;  3S3O A;  4ZYG A;  2R92 J;  3RKQ A;  5FKM A;  1POG A;  4MQV A;  4EVI A;  4IF4 A;  3ABK H;  4CHU A;  4UV8 A;  3PSF A;  1Y0N A;  3CDI A;  3DCF A;  3NWT A;  1E3P A;  4XL9 A;  2X6O A;  3JSP A;  1A5J A;  1YIO A;  4RGR A;  4ZC3 A;  1ETK A;  1GXQ A;  2K4B A;  3HOV J;  2CSO A;  1K78 B;  2WB1 A;  2JSP A;  4MHG A;  2VC0 A;  3JAM Z;  1YIJ I;  2IA2 A;  3PSI A;  1HW1 A;  3M8J A;  2X1C A;  1MSE C;  2H09 A;  3JSO A;  1FTZ A;  1XPX A;  1FPQ A;  3S1N J;  3CCQ I;  3OMY A;  4DW6 A;  2XGD A;  1LFP A;  1I1S A;  1TT5 B;  4BL0 B;  2HDW A;  2MA3 A;  2RN7 A;  4XRS A;  1G2H A;  1QNT A;  2JPB A;  2OQG A;  2GIZ A;  3I0T A;  3HOS A;  5CVU A;  5DCM A;  1RR8 C;  1HW5 A;  1T56 A;  5DTD A;  5K5O A;  3H3V K;  1FSE A;  4AC0 A;  2K9L A;  2DOE A;  1YS6 A;  2RV8 A;  4ETS A;  2NS0 A;  1Y56 A;  3C2G A;  1CQT A;  3CD6 I;  5E8G A;  2PQ8 A;  1IO2 A;  2XAG A;  5J47 A;  2E7W A;  3OWT A;  3SEZ A;  3S3N A;  3DU5 A;  3OYN A;  3CZ6 A;  1Y8R B;  5LFA A;  1Z3Y A;  1HDD C;  2PJP A;  3PO2 J;  3K4K A;  1EV7 A;  1AU7 A;  2EB7 A;  1OR7 C;  2FX0 A;  2FE3 A;  2ZME A;  2ZXW H;  4II3 A;  4BU2 A;  2HS5 A;  3EDP A;  2K02 A;  2WAD A;  2QCO A;  1O7F A;  5H6Q A;  4CCN A;  2L9S A;  4M9S A;  2ZJQ F;  2Z1D A;  3HHH A;  4UUV A;  1IUF A;  3R6S A;  1ETX A;  3F72 A;  2F5D A;  2WY7 Q;  1G8X A;  1TWA J;  2BY1 A;  3LA3 A;  2KL4 A;  4FX4 A;  2FBH A;  1DQU A;  3BZ6 A;  3FHN A;  4UV9 A;  2NAZ A;  3LSG A;  4YIF A;  3WTY C;  5ICE A;  2MD5 A;  4NNJ A;  1MBE A;  5A2Q Z;  4RDU A;  4PSX A;  2XGX A;  3W6K B;  4A6E A;  2XV4 S;  3LNQ A;  1U5T C;  3Q0W A;  1QU3 A;  4QWQ A;  3JRF A;  3A0H C;  2CJJ A;  1HDP A;  5JR3 A;  5LHG A;  2LC2 A;  3MFK A;  3E3V A;  1YE9 A;  2DLL A;  3CF2 A;  3HTU A;  1UB9 A;  2CUZ A;  2QSH X;  2MFZ A;  1A35 A;  1IV8 A;  3OY9 A;  2TDX A;  4AIK A;  4AWX B;  5CVJ A;  3FIS A;  1F43 A;  5LEK A;  1XG1 A;  4XSZ F;  3U1D A;  3A2K A;  4XOP A;  2R7W A;  1IAW A;  2A5Y B;  3B6A A;  2ICW G;  2DA4 A;  4ZDO A;  4YFX F;  2WTE A;  4JOM A;  2M2E A;  3HRS A;  3WGG A;  4PJ0 C;  3S3M A;  3F0C A;  4L9N A;  1RPW A;  3GWZ A;  1HXD A;  4BE2 A;  4NHJ A;  3E6D A;  2Y0S N;  4BY7 J;  1ZAO A;  2E34 A;  2WAQ N;  4U7B A;  4BNC A;  2DYS H;  4I99 C;  2M8G X;  2Y30 A;  1LJ9 A;  4AVZ A;  3CCE I;  2KHM A;  2RVC A;  1OYW A;  2R7D A;  2HZT A;  5D4S A;  1RNL A;  3FMQ A;  4XSX F;  3VPR A;  1I39 A;  3T5X A;  4D0P A;  3HHG A;  1JKQ C;  3LWF A;  3TBI A;  1LE8 B;  3TOA A;  1SC7 A;  2BEO A;  5D5V B;  3JRA A;  2GXB A;  4A3J J;  2HZD A;  4HQE A;  1YS7 A;  2IS1 A;  3T8R A;  3RZO J;  4B43 A;  4F92 B;  1YFH A;  3W2V A;  2KZV A;  3HSE A;  4PCQ A;  4W1U A;  3ZCO A;  3CO7 C;  2KIM A;  2LRE A;  1Z0X A;  1MMS A;  2DI3 A;  2PN6 A;  2LK2 A;  4LJZ F;  4G6T B;  4BH9 A;  1OJL A;  3RKW A;  4XLC A;  2X6Y A;  3R0A A;  1U9N A;  1USS A;  4RLF A;  3RTR A;  3QOE A;  1YO5 C;  3C2B A;  4N4N B;  4XOR A;  2EWN A;  2HKX A;  2O7O A;  5D4R A;  3VFZ A;  2NVU B;  3F9K A;  1Y1W J;  1FBU A;  2D1V A;  4PJL A;  4F93 B;  1A36 A;  1X1A A;  3VYU B;  2CFO A;  2F4O B;  4I0B A;  4BQO A;  1IC8 A;  1NTC A;  4XLF A;  2P5K A;  2W48 A;  4A3G J;  4B3A A;  1JT6 A;  3KYD B;  2PG4 A;  3ZPL A;  2WC2 A;  3GME A;  3K4C A;  3ZN1 A;  5E3M A;  1CF7 A;  1D1B A;  1P4X A;  2HYF A;  2X48 A;  5KAF C;  3HC7 A;  1Y0U A;  3U9G A;  1W0U A;  3VB2 A;  4HBL A;  2M4G A;  2W85 A;  2DYR H;  1HLV A;  2EIN H;  1T38 A;  2A05 A;  4U0Y A;  2K3F A;  3DP7 A;  4K2E A;  1AKH B;  1XGM A;  3IRR A;  1PUF B;  4DYR A;  1GDT A;  1QVT A;  4IHS A;  5KHD A;  3BP8 A;  5L3D A;  1VQN I;  5K1Y A;  5DM6 F;  4C2M J;  2CRG A;  3NAR A;  3O6B B;  3A03 A;  5CLS A;  1S7O A;  5E20 A;  5BQT A;  1BI2 A;  4LMY A;  2VQC A;  2Y0S A;  3FXM A;  3ZMT A;  2Y2Z A;  4X1E A;  2DTZ A;  4QPQ A;  3HG9 A;  2WV0 A;  2WAQ A;  5LGU A;  3LSI A;  2HVS A;  1XC5 A;  2DMQ A;  4XKB A;  1ZH5 A;  4ENK A;  1R36 A;  3I4N J;  3ERM A;  4FT8 A;  5FLM J;  3RZD J;  5K7H A;  1G4D A;  4RAZ A;  1ZLJ A;  3TED A;  3I59 B;  4I2O A;  4XIC A;  3P7N A;  2EFW A;  4A3F J;  1K6Y A;  1W5C C;  3HBL A;  3C3W A;  1MDM A;  1RKW A;  3CJN A;  2R3S A;  4IPA A;  3SZT A;  5E1X A;  1IZ1 A;  3S14 J;  1SVM A;  3MCZ A;  2BYV E;  1RI7 A;  2M3A A;  2OQR A;  2NYX A;  4YRV A;  1LPQ A;  4KUM A;  1NK3 P;  2PEX A;  3FXJ A;  1JUS A;  3H9Q A;  5LRR A;  3BOQ A;  3V8L A;  4KN7 X;  5IP7 J;  1XN7 A;  2K9S A;  3E0J B;  1E3O C;  3NWS A;  4OIP F;  2M30 A;  2JTV A;  4L5E A;  1V5E A;  3F6V A;  5E79 C;  4HOB A;  4HW0 A;  1JXS A;  2XAJ A;  4F7Z A;  1R23 A;  3GF2 A;  3J80 K;  3MAJ A;  1U3E M;  3AL0 C;  2BOL A;  2DAO A;  5EEH A;  4X0G A;  5HOO A;  3HOT A;  1L0O C;  1OQY A;  1IF1 A;  3ZQF A;  3V8J A;  3IC7 A;  1J5Y A;  1G59 A;  2JK3 A;  3BG9 A;  2Q1Z B;  1S7A A;  3MZ8 A;  1VQL I;  2MLG A;  2GA2 A;  1R4M B;  1APL C;  3FWE A;  2ACJ A;  3KFW X;  1B9M A;  4HAM A;  5J4Y A;  2VKD A;  3ZQC A;  5B5E C;  3GFJ A;  3T1B A;  3SYT A;  5JHU A;  4J01 A;  1Y39 A;  3L2Q A;  1OCZ H;  2AXL A;  4JX6 A;  3ZRG A;  4C3I J;  4P9U A;  5LGT A;  3OR2 C;  1EH7 A;  4RB1 A;  5M5Y J;  4LGW A;  3O8G A;  1BR1 A;  1R00 A;  2VLA A;  3F8M A;  1YX5 A;  2CV1 A;  1OYY A;  2LG4 A;  1MMD A;  5FFX A;  4OIN F;  1R5G A;  1WQ2 A;  2DA2 A;  2W00 A;  1Z21 A;  1O3T A;  3GEZ A;  1S8N A;  1HST A;  2FBI A;  3OYA A;  2Z33 A;  1ULY A;  4OMY A;  4L9V A;  4RGU A;  2FML A;  1F1Z A;  2K86 A;  2OV7 A;  2STT A;  3DEE A;  3GZN B;  3RQ4 A;  4LG0 B;  3EQL F;  1MKM A;  1JJ8 C;  2VIX A;  2X6W A;  3Q3S A;  4A3D J;  2F2E A;  1BL0 A;  1T39 A;  1K83 J;  3I58 A;  2AHQ A;  2Y9Y A;  1UAA A;  1FY7 A;  3BJO A;  2R93 J;  4XLP F;  3H92 A;  4QSH A;  2ZJR F;  4H4K C;  3Q0U A;  2ESN A;  3F8N A;  3BJ6 A;  1MSF C;  3JTG A;  3REO A;  1VQP I;  3N4M A;  4IVN A;  2EIM H;  3H5A A;  4L9T A;  2W24 A;  3J7Y J;  2JA6 J;  3DBL B;  3PNV A;  3DPT A;  3KX2 A;  4OIO F;  3KEQ A;  3CCJ I;  3M8F A;  1E2X A;  2K9N A;  2Y69 H;  4HYE A;  4CCJ A;  1FNN A;  1WH7 A;  3KLN A;  2VOO A;  4M9X A;  1MMG A;  5HOD A;  5CKT A;  2DA6 A;  1KQ0 A;  3VWB A;  4EGZ A;  2A6E F;  4Q48 A;  1EJ9 A;  3R0J A;  1ZGA A;  3G1L A;  4YII A;  5FGM A;  5E3O A;  2JN6 A;  1FOY A;  3DLA A;  3K6G A;  4I01 A;  4N9H A;  3BTC A;  4RBO A;  1VQ4 I;  3FXK A;  2IEK A;  1E0E A;  1SD7 A;  2E19 A;  1RRJ A;  4G6Q A;  2GQQ A;  3HL2 A;  4IJA A;  2O3F A;  3MQ0 A;  1B6A A;  2KMU A;  3HIF A;  3WU0 A;  3GYH X;  1B72 B;  1H88 C;  1A6Q A;  2JUG A;  1D3Y A;  2COM A;  2E2J J;  3D5R C;  4BEH A;  5D8K B;  4CCK A;  4FET A;  5HNF A;  2QEX I;  2OZ6 A;  4KIT B;  2XUB A;  2XRN A;  1K61 A;  4LG3 A;  1QZE A;  4RB3 C;  1D1C A;  1JE8 A;  2ZME C;  4C9Y A;  2OUM A;  3AKZ A;  3A0B C;  2ISY A;  5JVG F;  3CJR B;  4I0A A;  3AG3 H;  2L01 A;  2VL8 A;  2RNG A;  1Y6I A;  2FEZ A;  2B0L A;  2L7Z A;  1ZG3 A;  5ED4 A;  1YJ9 I;  2ZCW A;  1FIP A;  4IL6 C;  3VYR B;  1YIT I;  4M6Y A;  2XF7 A;  3KP3 A;  2KIQ A;  5H2F C;  4M9Z A;  2VJ4 A;  3CQZ J;  2JVG A;  1GV5 A;  1UMQ A;  3S1R J;  3JRI A;  5KAI C;  3G1M A;  4D9J A;  1VFC A;  2X6X A;  3A01 B;  2QBY A;  4BHP A;  2M0C A;  3KP5 A;  3WE3 A;  1MBJ A;  2EQR A;  2ZJ2 A;  2Q0O A;  4KFC A;  3KEY A;  5BPI A;  3H9J A;  1FTT A;  2QZ8 A;  1MH3 A;  3IH3 A;  3BR1 A;  4RM2 A;  1I1G A;  5ICG A;  4WWC A;  1KYZ A;  2JVH A;  3ZGK A;  2V1D A;  5D5W B;  1X3U A;  1W1W E;  3EUK L;  5FD5 A;  2YUS A;  1NHA A;  2DPD A;  2W84 A;  1N25 A;  5D5U B;  1WJA A;  1QHG A;  2EFN A;  3C1D A;  2Z16 A;  3FBI B;  3LQR A;  2HU9 A;  1U8B A;  4WX9 A;  2X51 A;  3CF5 F;  2LFB A;  2RQQ A;  5JVT A;  3TDZ C;  2F5C A;  3FMS A;  2KT0 A;  5D6F A;  3ECO A;  4OIR F;  4P9F A;  2ISZ A;  3ZQQ A;  2R7R A;  2NS7 A;  3OOU A;  3V7C A;  1G3Y A;  4YFN F;  3JRE A;  2LKX A;  4E7I A;  1XGS A;  4A0X A;  1ZRC A;  5HDG A;  3WTT C;  3KLO A;  4IHT A;  4YFK F;  1TWF J;  4IQJ A;  5ICC A;  2PBI A;  2VQG A;  4UY8 I;  1UHW A;  1VTN C;  2IPQ X;  4A5M A;  5C3E J;  1ZYR F;  2FJ1 A;  1F9N A;  2HDC A;  5JLX A;  1J09 A;  2VE8 A;  2OCE A;  3V8K A;  1Q1V A;  3L00 A;  2HOS A;  2FOK A;  1P9Q C;  3BG3 A;  2HOE A;  3KZI C;  4U87 A;  4L5J A;  4I02 A;  1FOX A;  1XSV A;  2HXI A;  1XX5 A;  1ZGJ A;  5HDN A;  3HPH A;  1BR2 A;  4YEJ A;  1Y8Q B;  4X6A J;  2EZL A;  2MC3 A;  2PJR B;  1HA8 A;  5IOY A;  1KQ8 A;  2QVO A;  2MAB A;  3WGH A;  3DBH B;  1B9N A;  3V42 A;  3VOD A;  3HSR A;  3ASN H;  4CUG A;  1WJ5 A;  4M6X A;  3S2W A;  4JX4 A;  2X4H A;  1V3F A;  2K9M A;  3HOU J;  1XMK A;  4Q47 A;  1YHQ I;  2M7A A;  4EV0 A;  1JTY A;  3M1E A;  2NNY A;  1O57 A;  5CYV A;  4BJT A;  2W7N A;  3GTG J;  2XB0 X;  3W6J B;  4PSW A;  4BQQ A;  1Z91 A;  2DOA A;  3HUG B;  2K5C A;  2XAS A;  2V9K A;  1YYV A;  4CZZ A;  3IV5 A;  4A0Z A;  4HF2 A;  3RI4 A;  2HFH A;  3DTK A;  3K2Z A;  3CCY A;  1T33 A;  3MKY B;  1QBJ A;  4XBF A;  1FMV A;  5F1J A;  1ZR2 A;  3IWF A;  2MSY A;  1B1B A;  5BNG A;  1ZRD A;  1WPK A;  3MEX A;  3DPU A;  4IHX A;  1D1A A;  5FRN A;  2VC1 A;  3HJE A;  3H0D A;  2DCE A;  4LIV A;  5BS6 A;  2Z2S B;  3GBG A;  2HI3 A;  1WWX A;  4B8X A;  2DFF A;  1U8R A;  5M5X J;  3QP5 A;  2KDO A;  4A2U A;  1X19 A;  3F6O A;  2OA4 A;  3GO5 A;  2R7U A;  2RGV A;  2IS2 A;  2Q2E A;  1D0Z A;  4QTR A;  4GFB A;  4RAG A;  2MBF A;  3KCC A;  1I27 A;  5DCM B;  2G9W A;  2ADU A;  1XB4 A;  5BPD A;  2YU9 J;  2DT5 A;  1RC9 A;  1V55 H;  3KE2 A;  3RQI A;  2R5Y A;  1JKP C;  4G7O F;  2CYY A;  4G94 A;  3MVP A;  2YS9 A;  1JUP A;  2LF8 A;  2ETH A;  4BHB A;  2CGP A;  5L3E A;  1BA5 A;  1UZC A;  4LOC A;  2IRF G;  4ASN A;  1X2N A;  2FF4 A;  3TO7 A;  2ZFW A;  2N8G A;  2E1M C;  4Y52 J;  5IT9 Z;  2ZKZ A;  1P4W A;  4A3K J;  1SD6 A;  5EF6 A;  1MBK A;  2ZME B;  2HKO A;  2EIL H;  2ZXH A;  3BPX A;  2BXZ A;  2A6H F;  2A5W A;  3FDY A;  2K9Q A;  4EM2 A;  2OF7 A;  4HNV A;  2DK8 A;  2FRH A;  4DOZ A;  1IXS B;  1IUY A;  2GXG A;  3F8C A;  1FSH A;  4DYC A;  3HSF A;  1CGP A;  3FXR A;  4M73 A;  3BTJ A;  4FTH A;  3ESW B;  3SZG A;  3NRV A;  2CW0 F;  2GM4 A;  4LLN A;  1MMA A;  4HRI A;  2L4A A;  4R1H A;  5HS7 A;  3HEF A;  5IP9 J;  2DK5 A;  3OYL A;  4XRM A;  3ZXS A;  3QYB A;  3LA7 A;  4BJ6 C;  3CC4 I;  1BR4 A;  2CQQ A;  2XRO A;  3HGY A;  4ZZD A;  2IVM A;  2R7V A;  3LSP A;  2E35 A;  2IS4 A;  3P9K A;  2A61 A;  3WG7 H;  1QA6 A;  3CO6 C;  2CW8 A;  2P0W A;  2EJR A;  2KLO A;  3D0S A;  4CZC A;  2IGN A;  5DV5 A;  3OYK A;  5H20 A;  5EDN A;  1VQ8 I;  1Z3X A;  2P4W A;  2X9D A;  2GOM A;  2MYS A;  1UHM A;  5FRM A;  5HLH A;  2VKH A;  2VBW A;  2NOG A;  1PYV A;  4PJN A;  1XS9 A;  5FLX K;  2LP0 A;  4CCM A;  2QEN A;  4BE0 A;  2E5N A;  1ZKG A;  4I7H A;  4MEY F;  4RB2 C;  2P8T A;  2DTR A;  3X2Q H;  1VND A;  4DZJ A;  3K0L A;  4RGS A;  2LMD A;  2NVY J;  2TCT A;  3GTP J;  2DMT A;  4XOT A;  1R1T A;  4E7Z A;  3LAP A;  3F23 A;  2K40 A;  3ECH A;  3H1C A;  3H5N A;  2NRA C;  2EV5 A;  3MN2 A;  3L2C A;  3AG4 H;  3EYY A;  2A69 F;  2J5P A;  1MBH A;  3FBN B;  3VYS B;  1IN7 A;  3D5L A;  3F21 A;  3E7L A;  4DNC A;  1UST A;  2CQK A;  2XSD C;  5K5R A;  4B1R A;  4IHW A;  2IGK A;  2DJN A;  1DUX C;  4O5V A;  5EEG A;  3TW7 A;  4BKX A;  3MKZ A;  3S2D J;  2QKM B;  2XKO A;  2F5V A;  1HW2 A;  2R7O A;  2FUG 2;  1IXR C;  3HGG A;  4ZZL A;  3SJM A;  4RAY A;  3SDG A;  3ZMU A;  4IOC F;  1WKM A;  4C2U A;  2P7V B;  3LSR A;  2KP6 A;  3QAH A;  3GTK J;  4F91 B;  2HYJ A;  3BPV A;  4FX0 A;  3PUF A;  1OIS A;  1Z77 A;  3W6V A;  6PAX A;  4A3B J;  3LAJ A;  1DGW Y;  4NQW A;  4EAT A;  5FKO A;  3PNY A;  4U0W A;  1GUU A;  4BQA A;  5EZH A;  5GAG J;  3KYL A;  2EIJ H;  4A3L J;  2YPR A;  4M3E A;  1FX7 A;  1J0R A;  2GWR A;  3IAS 2;  3AAF A;  4Y3O A;  2K85 A;  1ZQ3 P;  1MNM C;  3P9C A;  2BVL A;  2R7Q A;  4EJW A;  3HOX J;  1R5H A;  3FHZ A;  3K4M A;  2GZW A;  2JUC A;  1PJR A;  1NG7 A;  1KGS A;  4ZH4 F;  2HQA A;  1TQM A;  2VUM J;  1CF7 B;  3G2B A;  3ERE D;  3A02 A;  3LQQ A;  1FC3 A;  1HKQ A;  1ODD A;  4S04 A;  5DD8 A;  4G6D A;  4XK4 A;  1X3Z B;  3BRO A;  2KJB A;  2V9P A;  1LDJ A;  3KET A;  1RR7 A;  2VQL A;  4P1W A;  2QWW A;  2KIU A;  1BJA A;  3WHC A;  2XGC A;  3MKL A;  4HEA 2;  4KNY A;  2LBF A;  4FIS A;  4IRG A;  5K7F A;  3UKG A;  2L54 A;  4AM3 A;  3RPU A;  2ZO4 A;  3HRT A;  3BTL A;  5FKK A;  5DUK A;  2LR8 A;  1SFK A;  2DPU A;  3CCM I;  2VXZ A;  5LBQ A;  1MGT A;  5ERI A;  3JRG A;  1TWG J;  3BCB A;  3PFY A;  5C4X J;  9ANT A;  2ELH A;  2KRF A;  3PL8 A;  4Y33 A;  1XCV A;  2ECC A;  2VI6 A;  3WTV C;  2KDZ A;  1O3R A;  4EM1 A;  4OWR B;  3CUO A;  2AXT C;  2I8D A;  1KZH A;  4Q4Z F;  1I6H J;  3E5Q A;  2BBY A;  3BZC A;  3M07 A;  5HVQ C;  2E1M B;  2RNJ A;  3OV8 A;  2EFQ A;  2FQ3 A;  1MDM B;  1LEB A;  1FYL A;  3I9V 2;  1OKR A;  4XON A;  3A1Y A;  4D5F A;  3K4J A;  4MQ9 F;  1O7L A;  3KP6 A;  3HOZ J;  2R0Q C;  4IXA A;  4JBA A;  1IDY A;  1X2M A;  3FZV A;  3BZK A;  4FHT A;  3VSK A;  1XSD A;  2DA7 A;  1MNE A;  2XF6 A;  3FX3 A;  3KZY A;  5DYM A;  3RDI A;  3ZR8 X;  2ZSH B;  5J6X A;  1WZ2 A;  5F6F A;  1JKR C;  1TW3 A;  1Z6T A;  2LKS A;  2UXX A;  3HM5 A;  4Y15 A;  4PJM A;  1HF0 A;  1BBY A;  2KIS A;  1MH4 A;  1T95 A;  3L9F A;  1J59 A;  1YW8 A;  3EUH A;  1U78 A;  5F04 A;  3K1N A;  4A3E J;  4BY1 J;  3BR6 A;  2XVC A;  3PO3 J;  4D7M A;  3CLQ A;  2J5O A;  5CVI A;  2P6T A;  3PNT A;  1X58 A;  2RC4 A;  1TBX A;  3WTZ A;  1ITY A;  4AVP A;  2CH0 A;  1JKO C;  1JJ6 C;  2NNN A;  3I4M J;  4BGD A;  5HLI A;  4FCY A;  2EV6 A;  2ID3 A;  3JAM K;  2B7E A;  2XAU A;  2ZXJ A;  5JI6 A;  5J1R A;  2JMW A;  2WV1 A;  1WJD A;  3QPT A;  1D8J A;  5TGT A;  2R7Z J;  1G3T A;  1S7E A;  2F6C A;  3DEW A;  3P5J A;  3V4G A;  4E7S A;  3J81 Z;  2MLK A;  2P7C B;  2R7S A;  4HF0 A;  3QQA A;  2NVT J;  2H8R A;  3ZQI A;  2NOJ B;  1OFC X;  1EKE A;  4NUB A;  2BZT A;  2OAZ A;  1SFX A;  2FOW A;  1T8I A;  2CUF A;  4CXF A;  4ZTF A;  4MNU A;  3LSH A;  5CVV A;  2ME6 A;  5B1A H;  3CMM A;  1FOW A;  4AD9 A;  3E97 A;  4D1Q A;  3DKX A;  1BI1 A;  2P5V A;  3I54 A;  5DD4 A;  2VBX A;  3V7S A;  1K79 A;  1ZG5 A;  4YEL A;  4MLO A;  5FJ8 J;  1SMY F;  2CS3 A;  3I4P A;  1ZN2 A;  1OCO H;  2Y75 A;  2STW A;  4ZDL A;  4Y7N J;  4B44 A;  1K7A A;  1MIJ A;  2PX9 A;  4ZDP A;  4KMF A;  2PFB A;  2OPT A;  2ZNZ A;  2VOP A;  1VQK I;  1FWZ A;  1MJ9 A;  4HLY A;  1IN5 A;  3OIQ A;  4XRS G;  1ZAR A;  1LKX A;  5EG0 A;  1IJW C;  2V9V A;  1I3Q J;  1WJB A;  1BI3 A;  5CQG A;  4ESF A;  3J7Z I;  1NG6 A;  2EIK H;  2ZBK A;  1S3J A;  1TW2 A;  1UJ8 A;  1WFX A;  1X3W B;  2HNH A;  3AG1 H;  2KRC A;  1MW7 A;  3L1P A;  3S17 J;  1STZ A;  4XRF A;  5A2Q K;  2HQ5 A;  1W4M A;  3OYH A;  3N97 A;  2NVQ J;  3OIO A;  2V6E A;  4XLE A;  1OCC H;  1YW9 A;  1B8I A;  1UCR A;  2E1O A;  1EA3 A;  2KQR A;  2X1D A;  4A3I J;  2A68 F;  2V4J C;  2Y48 A;  2CV2 A;  1JGG A;  1HQC A;  2WBM A;  2V79 A;  1PP7 U;  1FYM A;  1TNS A;  5JHF A;  5FFZ A;  2PMH A;  3BR3 A;  4OMZ A;  4F52 A;  3QYF A;  5E1W A;  4J19 A;  2EV0 A;  3LFK A;  4HX4 A;  2ELK A;  3FK6 A;  1JHH A;  2DDB A;  3IHU A;  3FKJ A;  1SMT A;  3TO9 A;  5LD2 C;  1RUN A;  5DUI A;  1DU0 A;  3DKY A;  3M8E A;  4E7J A;  1ON1 A;  3DBR B;  1NH3 A;  2R5Z A;  2VKE A;  2AQF A;  3S2H J;  1PUE E;  3EYI A;  1JUM A;  5GAH J;  3WOD F;  4AID A;  1WCM J;  3IRQ A;  5IOZ A;  2XC7 A;  3GTJ J;  3OL3 A;  3H5R A;  4KYW A;  2LY1 A;  4BEH B;  1LB2 A;  3H36 A;  3PIP F;  2OD5 A;  4E4H A;  4DIQ A;  2Z3Y A;  3T8T A;  2M7B A;  1PP8 F;  1WGX A;  3KP7 A;  4ZYH A;  4M3F A;  1U5T A;  3JRB A;  3L2R A;  4HNU A;  2KFD A;  3WTW C;  1OCT C;  3DLL F;  3FKI J;  3S32 A;  4C2T A;  2P6S A;  5EEA A;  3GUD A;  3F8B A;  4AU7 A;  5C44 J;  2O5R A;  4M74 A;  2KIF A;  2VKV A;  1P6R A;  3WTX C;  1S72 I;  1WHU A;  3E5U A;  2GA1 A;  2BW3 A;  3C18 A;  3ZMD A;  3PQJ A;  2DMN A;  2E2H J;  2IT0 A;  2YX4 A;  4NC6 A;  1M1E B;  1UG2 A;  5EYR A;  5E3N A;  2QBY B;  1K6O A;  4LIU A;  2HOT A;  4IQ4 A;  2XHK A;  3PM1 A;  1H8A C;  2QQB A;  4UUS A;  1DP3 A;  1YOV B;  2QQA A;  4BBS J;  3TQN A;  1BOB A;  1WRJ A;  2EPF A;  2DQL A;  1RKT A;  2XF5 A;  3GCM A;  3T0Y A;  3K70 C;  2DFI A;  1T2K A;  1W7P A;  2JWT A;  3DFG A;  5LGN A;  2LVS A;  4UUT A;  2R4G A;  4HV6 A;  4EJO A;  1YJN I;  4E6K G;  1MMN A;  4IEJ A;  3GTO J;  3FMR A;  2EA4 A;  3CLO A;  3R60 A;  4RAF A;  4QPO A;  3TKY A;  4JP0 A;  2Q8K A;  2EFP A;  4S0H B;  1MBF A;  1XGN A;  5DEQ A;  1EH6 A;  2O9L A;  2JA7 J;  2JZY A;  3BR2 A;  2VON A;  2FNA A; 
#chains in the Genus database with same CATH homology
 1WJF A;  4XM3 A;  3I3L A;  4CSW A;  3BG7 A;  1N77 A;  4XKC A;  1TZL A;  3A2K A;  1D0Y A;  1LDK B;  4BUP A;  2KDO A;  4XOP A;  2R7W A;  1X19 A;  4CCL A;  3RSN A;  4ZDO A;  2R7U A;  2V7F A;  2IS2 A;  4JOM A;  1D0Z A;  1W36 C;  4E7L A;  3S3M A;  1QHH D;  2VPL A;  4BE2 A;  2UWM A;  3CP2 A;  2A6T A;  2L9N A;  1VZ0 A;  4U7B A;  3DPL C;  3EUA A;  4II2 A;  4BAC A;  2CUJ A;  4AVZ A;  2KHM A;  2E1M C;  5HLT A;  4XMY A;  3RCO A;  3U21 A;  4XLH A;  3S93 A;  1SAU A;  2ZXH A;  3TBI A;  3ONQ A;  2A5W A;  3FDY A;  3OYJ A;  4DOZ A;  2M0M A;  2HZD A;  2OC6 A;  4CA0 A;  3EPZ A;  2IS1 A;  3DWL E;  2BW3 B;  1V5F A;  4B43 A;  4ANJ A;  4F92 B;  1YX3 A;  3K10 A;  3W2V A;  2KZV A;  3ZCO A;  2LRE A;  1MND A;  3SZG A;  4BDZ A;  4G6T B;  4NC8 A;  2XDV A;  1MMA A;  4HRI A;  1UEL B;  4XLC A;  2X6Y A;  3OYL A;  3IP4 B;  3ZXS A;  4RLF A;  3QYB A;  3RTR A;  3QOE A;  4N4N B;  4XOR A;  4HSR A;  4BJ6 C;  1BR4 A;  2W82 A;  4XR6 A;  2R7V A;  2VJI A;  2IS4 A;  3F9K A;  4PJL A;  4F93 B;  1X1A A;  2CW8 A;  2CFO A;  2P0W A;  3VYU B;  4BQO A;  4XLF A;  2KLO A;  4KT6 A;  4CZC A;  4DGW B;  2IGN A;  3OYK A;  3K4C A;  1Z3X A;  2LH9 A;  1D1B A;  2GOM A;  2MYS A;  4HNT A;  3HC7 A;  5FRM A;  2M4G A;  3A4C A;  2VKH A;  2GOX B;  1V5G A;  5FRO A;  1PYV A;  4PJN A;  4BE0 A;  4CCM A;  2E5N A;  4AYB A;  4E7K A;  5KHD A;  2Q2E B;  2HPM A;  3L2V A;  4XOT A;  4E7Z A;  3W3C A;  4IX7 A;  3H5N A;  4XKV A;  4B48 A;  2VQC A;  2Y0S A;  3HKZ A;  3TL4 X;  4QPQ A;  3HG9 A;  2HVR A;  2WAQ A;  3VYT B;  3LSI A;  3FBN B;  3VYS B;  2HVS A;  3D5L A;  2RRE A;  2WA0 A;  4XKB A;  3MD2 A;  3K4N A;  2IGK A;  3MKZ A;  3BCA A;  2VJJ A;  2F4I A;  4PFO A;  2QKM B;  4BJ5 C;  2F5V A;  2R7O A;  3OS1 A;  1LVK A;  2FUG 2;  3BLY A;  2DXI A;  4C2U A;  2M4K A;  3LSK A;  2KP6 A;  1K6Y A;  2WAE A;  5KNL A;  4OAY A;  2IGO A;  3VSL A;  4IZZ A;  4F91 B;  3OYD A;  3H9G A;  1X1B A;  3SEQ A;  3MMY B;  3K4B A;  2M3A A;  4YRV A;  3OYE A;  3LL7 A;  2L2O A;  3EUH C;  1DGW Y;  4EAT A;  4PK4 A;  3PNY A;  1Z7L A;  2VXD A;  3LSM A;  1OLT A;  3OIP A;  2R7X A;  3H9Q A;  4KJZ A;  3KYL A;  3E0J B;  3OYM A;  3W2A A;  3NWS A;  2ZFU A;  1V5E A;  2XSJ C;  3IAS 2;  3PJR A;  4XNF A;  4Y3O A;  3CP8 A;  2ZSI B;  4HPQ A;  4DBR A;  4XN3 A;  2DT7 B;  1T0F C;  4DBQ A;  2BVL A;  2R7Q A;  3C2H A;  3K4M A;  3AL0 C;  2BOL A;  1X4O A;  1N78 A;  2MD0 A;  1PJR A;  2PMZ A;  1NG7 A;  4X0G A;  2HQA A;  5HOO A;  3HOT A;  3G2B A;  2UV1 A;  1G59 A;  2Q1Z B;  2QKL B;  1R6R A;  2CW7 A;  4C30 A;  3DTI A;  2E5Z A;  4P1W A;  2VQL A;  4XKW A;  2LRD A;  2VKD A;  4XQF A;  2CMP A;  4HEA 2;  3S8P A;  3SYT A;  2E60 A;  3OYC A;  4J01 A;  1ERD A;  2LBF A;  3L2Q A;  4CCO A;  4F3Q A;  3ZRG A;  3OR2 C;  4HG2 A;  3LMM A;  2X85 A;  1SFK A;  1BR1 A;  4ITV A;  1X1D A;  2VLA A;  1YX5 A;  2CV1 A;  2VXZ A;  3L2W A;  2LG4 A;  1MMD A;  3LFU A;  3BCB A;  3PFY A;  2HVQ A;  2DJI A;  2W00 A;  2V1N A;  1Z21 A;  3PL8 A;  4Y33 A;  1U0J A;  3OYA A;  4XN0 A;  2LYC A;  4OWR B;  4DJA A;  3J7A Y;  2I8D A;  2OV7 A;  3AL0 B;  4BE1 A;  3DEE A;  2W1O A;  4GRI A;  4LIT A;  2DT6 A;  3RQ4 A;  4B3X A;  2VIX A;  2X6W A;  5HVQ C;  2E1M B;  2X1E A;  1D0X A;  3BG6 A;  1TT0 A;  3DU6 A;  3OR1 C;  4Y4R A;  1ZEL A;  3I9V 2;  4XON A;  3A1Y A;  3HXL A;  2V26 A;  3K4J A;  2HPI A;  1UAA A;  1AA7 A;  2LOO A;  4RLQ A;  3VSK A;  4ZJZ A;  2XF6 A;  1MNE A;  4H4K C;  5HNH A;  3ZR8 X;  3OYF A;  4NQW B;  2ZSH B;  4HST A;  3CES A;  3OS0 A;  3DTE A;  3PUB A;  3H5A A;  4PJM A;  1T95 A;  2VJ5 A;  4NC7 A;  3PNV A;  1S9H A;  3DPT A;  2W4S A;  3KX2 A;  3OYB A;  3K4L A;  2R7T A;  3HPG A;  4CCJ A;  4F55 A;  5KCM A;  3E1S A;  3PNT A;  1MMG A;  5CKT A;  2CH0 A;  4RMN A;  4BGD A;  3VWB A;  2XAU A;  3OYG A;  1WJD A;  3DLA A;  5TGT A;  3AFH A;  3K6G A;  2F6C A;  3UNG C;  1E0E A;  2UUZ A;  4E7S A;  2LBF B;  4CH7 A;  3K70 D;  4JQF A;  3H35 A;  3HL2 A;  4J00 A;  2R7S A;  4BS9 A;  4B47 A;  2KMU A;  2NOJ B;  4PFP A;  3TMO A;  2JUG A;  4E7H A;  4NUB A;  3D5R C;  4BEH A;  4CCK A;  2BVM A;  4FET A;  5HNF A;  3OYI A;  4KIT B;  3L2U A;  4PUS A;  4LG3 A;  2AQE A;  4ZTF A;  3IAM 2;  3LSH A;  1D1C A;  3CMM A;  4C9Y A;  2OUM A;  3AKZ A;  1X4P A;  2L5Q A;  3DKX A;  2ZXI A;  4D1Q A;  1X1C A;  3CJR B;  4FAS D;  4IKF A;  4YEL A;  2VL8 A;  3N05 A;  2RNG A;  2PJR A;  1Y6I A;  5CPR B;  4MLO A;  2CS3 A;  3W2W A;  4ZDL A;  3IUO A;  3VYR B;  4B44 A;  2K3P A;  1W36 D;  2XF7 A;  4ZDP A;  1FMW A;  2L7K A;  2ELJ A;  2CV0 A;  2VJ4 A;  2MC4 A;  2JVG A;  3OIQ A;  3BC8 A;  4RM3 A;  4D9J A;  2X6X A;  1LKX A;  1WJB A;  5CQG A;  1DGR M;  3S3O A;  1WJC A;  1NG6 A;  3KEY A;  1WFX A;  3H9J A;  2HNH A;  2KRC A;  1KON A;  1MW7 A;  4RM2 A;  3OYH A;  5CQE A;  4PJJ A;  2JVH A;  2V6E A;  3ZGK A;  4XLE A;  3OL4 A;  2VQH A;  3OS2 A;  3EUK L;  2LY2 A;  3PSF A;  2VAS A;  1EA3 A;  2KQR A;  2X1D A;  3NWT A;  2V4J C;  4XL9 A;  2CV2 A;  1WJA A;  1QHG A;  2WBM A;  4ZC3 A;  2Z16 A;  3FBI B;  4ZTJ A;  3UR3 C;  5JHF A;  2HU9 A;  2WB1 A;  2JSP A;  3QOD A;  2X51 A;  4BQN A;  2RQQ A;  4F52 A;  3QYF A;  4P5O A;  4BDY A;  3MKW B;  3PSI A;  3M8J A;  2WAF A;  1N75 A;  1WJE A;  2X1C A;  3ZQQ A;  2R7R A;  4BXF A;  3FKJ A;  3DQV C;  3OOU A;  5LD2 C;  4E7I A;  3OMY A;  3DKY A;  4E7J A;  1LFP A;  4BL0 B;  4R79 A;  2HDW A;  2AQF A;  1IRX A;  4N4O B;  4IQJ A;  3M1C A;  2VQG A;  2XC7 A;  3HOS A;  3OL3 A;  3H5R A;  2IS6 A;  2LY1 A;  4BEH B;  1J09 A;  1UG0 A;  2K9L A;  4E4H A;  1P9Q C;  1Y56 A;  3C2G A;  4DIQ A;  2M7B A;  4U87 A;  3OWT A;  3SEZ A;  3S3N A;  3L2R A;  3DU5 A;  4HNU A;  3HPH A;  1BR2 A;  2KPM A;  2VB6 A;  3OYN A;  3CZ6 A;  4YEJ A;  5LFA A;  1Z3Y A;  1HA8 A;  2PJR B;  2IXS A;  3K4K A;  3S32 A;  4C2T A;  2MAB A;  3RPU D;  1OR7 C;  4II3 A;  3V42 A;  4AU7 A;  2O5R A;  4BU2 A;  4CUG A;  1WJ5 A;  2WAD A;  2JA2 A;  2K9M A;  3SDB A;  4CCN A;  2L9S A;  2M7A A;  2Z1D A;  2WY8 Q;  4BJT A;  2BW3 A;  2W7N A;  4PSW A;  4BQQ A;  4KIS A;  2WY7 Q;  1G8X A;  2DOA A;  3HUG B;  2KL4 A;  2K5C A;  2V9K A;  4LIU A;  4IQ4 A;  1DQU A;  3VDX A;  3CJQ B;  3FHN A;  1DP3 A;  3D5S C;  1JI8 A;  3LSG A;  3DTK A;  1BOB A;  3MKY B;  4NNJ A;  1FMV A;  2XF5 A;  2IGM A;  3K70 C;  3QYE A;  4PSX A;  4OAZ A;  1QU3 A;  4ZYA A;  1GLN A;  2R4G A;  4E6K G;  2LC2 A;  1MMN A;  3DPU A;  1YE9 A;  1D1A A;  3CF2 A;  4XLA A;  5FRN A;  2CUZ A;  4QPO A;  2KRH A;  2MFZ A;  3H0D A;  2DCE A;  4LIV A;  2Z2S B;  3OY9 A;  3GBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...