2VXDA

The structure of the c-terminal domain of nucleophosmin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
54
structure length
54
Chain Sequence
b'GGSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOPHOSMIN
publication title Structural Consequences of Nucleophosmin Mutations in Acute Myeloid Leukemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 15
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2008-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16276 NPM1-C Nucleophosmin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vxdA00
2VXDA
chains in the Genus database with same CATH superfamily
5K1YA 2LBFA 1BJZA 2DA4A 4GO1A 4BDYA 4HOBA 1Z0XA 1WJCA 1W5SA 5J3LA 2A05A 4BKXA 1Y8RB 2DA2A 4XLHA 1TWFJ 1SFKA 4EJOA 3OWTA 5B1AH 2VJ5A 3WTXC 3OYMA 4C3HJ 5LLQA 1B9MA 4OIQF 3OYCA 1U0JA 2JMWA 1WJ5A 3FKJA 4F7ZA 1IW7F 1BI3A 3ZMDA 2H1LA 5DUIA 2E2JJ 2R0QC 1SVMA 1FY7A 2BOLA 1DPRA 1FWZA 1ZLKA 3W6KB 2VPRA 5GP9A 2MD0A 2IXSA 1ZARA 3S3MA 1K78A 4A3LJ 1RRJA 1MJBA 2ZSHB 3HTUA 2F5FA 4YFXF 4XKBA 1E3HA 1WI3A 3TDZC 3K1PA 4IOAF 2EINH 1IZ1A 4A3GJ 2WAQA 3DU5A 3FXRA 1MBGA 2VKHA 4PSXA 2DTRA 4HA8A 4W97A 3AG1H 4XRFA 1CQTA 3GZ6A 1IG7A 2XB5A 4N4NB 3IL2A 4E7IA 1ACIA 4U7BA 2CQXA 3JRGA 3H3VK 2YX7A 4PFOA 3LQQA 4L5JA 2B9SA 3HUGA 3R61A 3RKYA 3C2BA 2N8GA 4RB0A 3EUKL 5E1XA 4LK0F 3BR1A 4UVAA 1BC8C 2MG4A 4LG0A 2ELKA 4UUSA 1R4NB 2H6CA 4M6YA 3F8MA 3K9TA 4PZJA 1GHCA 2KT0A 3QP5A 3IAM2 3HOVJ 2VL8A 5M3FJ 3PQKA 5KCMA 4D9JA 2QBYB 2IS6A 2QLZA 5F6FA 2EFWA 2LKXA 1YLFA 2Y9ZA 4LK1F 4IPAA 3U21A 1BL0A 3GLXA 3H9JA 1QBJA 1QGPA 4B43A 1F36A 2DJIA 5E18F 4OAYA 2DPDA 2LKSA 2EFOA 5FKOA 2ZJQF 2W85A 2X1CA 5LGNA 4FE7A 4A3JJ 3G1MA 2NNNA 5E79C 4C30A 1DP7P 4A3IJ 2IP2A 4G7ZF 4L0YB 1WH7A 5CVJA 4BQQA 4KITB 2GXBA 1TTYA 4E7SA 2HPIA 3HKZA 2DA1A 2VQHA 3L00A 3KLNA 3NWSA 5IYCJ 1MSEC 1SFEA 1PUEE 4HG2A 3AKZA 4A3BJ 5E8IA 4ESFA 1NK2P 3J80K 5HLIA 4UVBA 5B3SH 1OJLA 4BJTA 2YPRA 3Q5FA 4P9FA 1VI0A 4GGGA 4M9ZA 1K7AA 2XSJC 4RAFA 5F0FA 1TC3C 3CJNA 3ZOBA 1JUPA 5KAIC 3GTOJ 2WV0A 1QQIA 5E3OA 5C44J 1YHQI 3Q3SA 3GTQJ 5LFAA 1I39A 3F21A 4LLLA 5EEAA 3I0TA 4A3DJ 2E34A 5DS9A 3K4CA 3RPQA 3H36A 2EZKA 3A01B 1IRZA 4DYRA 3QRFF 1MKMA 4EJUA 1U5TB 3E6BA 4A93J 2OCCH 4AM3A 3CESA 3CMEI 2W25A 4IJAA 3GF2A 3W6VA 1JJ6C 2CQKA 5M5WJ 4AYBA 1T0FA 3GZNB 2VC1A 3ZMTA 3LSPA 1LKXA 4V2GA 4JK1X 2CW0F 3CP8A 2M45A 4XLCA 1QRYA 1TQMA 2K3PA 4OIOF 2EV5A 2YU9J 1LQ1A 2DK8A 3HRSA 4PJMA 1K61A 1F5TA 5EG0A 4BE1A 2EILH 2V26A 4UY8I 2IT0A 5JI6A 4KN7X 4G6TB 2BE5F 2MA3A 3J81K 2Y0MA 1J9IA 3ZMZA 5HLHA 1R1UA 3OR2C 3I4MJ 1SFUA 2EBIA 1BOBA 2VT2A 2WB1A 5LHIA 2ZMEC 5F0CA 1R7JA 1R1TA 1S3JA 2V9KA 3IUOA 3C1DA 3OR1C 3D5RC 3KEOA 5DDGA 3J7AO 5IP9J 3U2RA 3S93A 1DU6A 3TOBA 1WCMJ 3E6CC 4I02A 2ZCWA 5E3LA 3FHNA 2E71A 4M73A 2M5WA 1R23A 2EB7A 3DKXA 2ZB9A 4CHUA 1HKTA 1W36D 3IWZA 4JP0A 4XKWA 5FO5A 2EZLA 5EGOA 3KZYA 3CCVI 2HYJA 3H5RA 2ACJA 1FC3A 3FF5A 3GXOA 1X2MA 1ON2A 2FBKA 3FBNB 1OCRH 2RN7A 3BQZA 2DCEA 4TV7A 3RQIA 5E1ZB 1MJ9A 1V55H 1JUMA 3AG2H 3EUHC 4J00A 3HRMA 4HX7A 2WB1N 1V4RA 2W82A 2NVTJ 3BZ6A 2V4JC 2IS1A 2Q1ZB 1QZYA 5B66C 5L3GA 3HSEA 2M4KA 3EDPA 3SZTA 2DODA 1VQPI 3PUFA 2JA8J 5A2QK 3OV8A 2PN6A 1OISA 4BDZA 2KJBA 3HHGA 3BG3A 2BW3B 3E5UA 2R7VA 3R4KA 3AG4H 3JSOA 3KP4A 2L9VA 5FROA 2F48A 1TT5B 1IN5A 1OYWA 3T1BA 3HOZJ 2G7HA 4L5IA 2O3FA 1OCCH 3DKYA 4XLEA 1HA8A 4KFCA 2P5KA 3H5NA 1USSA 5D5VB 2L3DA 5CVVA 3ZGKA 4E7JA 1NH3A 4ENMA 2XDVA 3CCUI 1RUNA 2QM3A 4HNUA 4ASNA 3WTYC 2O9LA 4BU2A 2E36A 4S05A 1B8IA 2VASA 4GDFA 1P4WA 3JRBA 3K4MA 3K70D 1H0MA 4L5EA 3MZ8A 4L9JA 4UB8C 1QHGA 2R7WA 1WJFA 3PL8A 2V1NA 2GXGA 1JKQC 1XCVA 3GTKJ 2PMHA 3PJRA 3L2VA 1ZR4A 3ZCOA 2HQRA 1UZCA 2HZTA 3MWMA 2COBA 2XRLA 1RETA 1FMVA 3SFZA 1DDNA 2VODA 5HS9A 1IAWA 2FA5A 5DEQA 1T6SA 3L1PA 2ZSIB 3BG9A 4AWXB 1T39A 2CV0A 1AU7A 2IS4A 2V1DA 2GLOA 2UUZA 2AXLA 1P9QC 1XDUA 3ASOH 3SHFA 3KFWX 3MAJA 4G6QA 3HEFA 4E70A 4HX4A 4XN0A 1JTXA 1MH3A 3MKWB 1DGRM 2L4AA 3REOA 2EA2A 2ESHA 1ENHA 3RYRA 5IP7J 3P5JA 2ISZA 3OS2A 2LREA 2C6YA 4IHXA 2F4OB 2FRHA 2VJJA 1KU7A 3ABKH 4S04A 4HLYA 4CDGA 3H3UA 5FD6A 1LFBA 1U9OA 1QO0D 4BQOA 3DPLC 4YFKF 2VB6A 1WFXA 1FTTA 3TO7A 4I6ZA 2LG4A 3M7GA 2M8GX 1IN7A 1R6RA 4HF2A 3PO2J 2AXTC 3TOAA 3I58A 3DLLF 1STZA 4LITA 1YYVA 2CH0A 2BY2A 4KT5C 4EGZA 3CLOA 3BDDA 3B6AA 2D1HA 2EZHA 5HNFA 1FJLA 4MTEA 5HS7A 4IO9F 3ZRGA 4EGYA 1KGSA 3TDUC 2XPUA 4LIVA 2PI0A 1POGA 1ZGAA 1MMDA 5D4RA 1ZG5A 2JA5J 4DYCA 1SD6A 3WGHA 2BY3A 4D1QA 5FLXZ 2X51A 3CF5F 3RPUA 3L9FA 3OS1A 1ZH5A 3KEYA 1RPWA 3R0AA 4RDUA 2IGOA 4A0ZA 4W1UA 3OIQA 1MNMC 4WK8F 3J7YJ 3FXKA 1U6GA 5CJ9A 1HW5A 4KT6A 3WGGA 2DPUA 2JRTA 4LJZF 1EF4A 4C3JJ 1YW8A 1R5ID 1FTZA 4IHTA 3JSPA 3F22A 2XGCA 2X9DA 4CXFA 3FMRA 2KIQA 2YUSA 3KYCB 2PBIA 3S2WA 2VJ4A 4KIBA 4R8HA 2BZTA 2Y2ZA 4BQNA 4KIFA 2WTEA 3IH3A 2EIKH 4I09A 4M9XA 3OS0A 4QIWN 1S7OA 4UHTA 1SAXA 3ECOA 3TP0A 4DZPA 2L9SA 5H20A 4XKCA 3D0SA 3K2AA 3IWFA 3RKWA 4ZYHA 3ONQA 2FQ3A 3FM3A 3E5XA 4RGUA 2E1OA 2QCOA 2E19A 2E1MB 2DA6A 4AIHA 1I6XA 3QP6A 5E8GA 1HQCA 3S2HJ 2ETHA 3FKIJ 4D5CA 2I8DA 4HNVA 1NTCA 2KL4A 4AIJA 2H8WA 2PMZA 3HJEA 2HEOA 2HQ5A 3WTWC 3PNVA 1SMTA 4DIQA 2NAZA 3E3VA 4LFUA 2XAGA 3BJ6A 5IT3A 1BA5A 1FYMA 4YEJA 3EYIA 3F8FA 2JPBA 4Y13A 3ZQFA 1ZG1A 3VOEA 3B6CA 1YOVB 4JX4A 2BY0A 2ZMEA 2XRNA 3M07A 4WXDA 1DU0A 3CCRI 1RUOA 1YQAA 3DKWA 3Q0WA 1IC8A 3FHZA 4BEHB 1JKOC 2DMTA 4PGGA 1JKPC 1XMAA 3HGYA 1QU3A 3L09A 4U87A 3MMYB 2GIZA 3DF8A 2M1BA 4A3MJ 5IT9Z 1X58A 4N0BA 2HFHA 2OC6A 2AQFA 5GPAA 1D1BA 3PQJA 2Y75A 3W6JB 2O8XA 2PG4A 1XGMA 5LHGA 4HPQA 1IGNA 4Y33A 1G3WA 3SZPA 2QKMB 2V6CA 3OYFA 2QA4I 4D7NA 2MGQA 1FSHA 1W7PB 2XAHA 2R5YA 1ETOA 3EUHA 4HV5A 3U9GA 1I3AA 1JXSA 1T56A 1IN6A 2RREA 3RI4A 1YW9A 2VUMJ 3S1MJ 3H92A 3OYGA 2ID6A 4BQAA 1XD7A 1HF0A 1RR7A 3D5SC 1R58A 1X1PA 4HQMA 4KNYA 2DA3A 3CP2A 3H9GA 2X1EA 2L54A 5EYRA 3UR3C 2MC3A 5ICGA 2GOXB 1LVAA 4IKFA 5D8KB 2QQAA 2CSOA 4S0HB 3L2CA 2WA0A 1U9NA 5D5UB 4XRSA 4A3CJ 1ZRFA 1VQLI 3VSKA 1E2XA 4AIDA 3WHBA 2BV6A 2M87A 3KLOA 2CV1A 3M8FA 2NRAC 4CICA 1T08B 5EEGA 3KETA 2DQLA 1SD4A 5FKNA 5IP6A 2GQQA 1XSXA 4AIKA 2XB0X 3ZR8X 3FXMA 3KIOA 1B72A 2F4IA 1TW3A 3KPHA 4CCNA 2OZUA 4KIGA 2L7KA 5DUKA 4ON0A 2DT7B 2JRMA 4BY7J 2X6OA 2O5RA 1K4TA 3BTJA 1G2HA 2WV1A 4AVPA 4NDLA 2M3AA 4LIUA 2KJCA 4QSHA 1A31A 3DBRB 5ICFA 2PLYA 4HQEA 4FISA 2P6TA 1GUUA 2IRFG 2HTJA 1I50J 4KMUX 5CVIA 3ZQIA 4OU0A 1JI8A 2LF8A 5J1YA 1MMSA 2XC7A 2DYSH 2WY8Q 5GAHJ 3GTMJ 3OYIA 1A6QA 2O61A 1RZ4A 5BPIA 4LG3A 2NVYJ 3SXYA 3E97A 2QQ9A 4YIIA 2VQLA 1FPQA 4D5FA 5GTHC 2R7SA 1ETKA 1X4OA 3S3NA 3HBLA 1SEUA 1ETXA 3I64A 4HF0A 2Z33A 1VQMI 1AHDP 3PFIA 3CCMI 3RZDJ 2R92J 3TW6A 5J8CA 3CTAA 3MKZA 3ZPLA 3KYDB 1FMWA 2JVHA 2LR8A 1WJBA 4ZDOA 2LKPA 1ORKA 2ECCA 3LSIA 2NOGA 1WZ2A 2WAEA 4Y52J 2X4HA 2JSCA 1OPCA 2E7XA 5CVRA 2QEXI 3BP8A 2KP6A 4NC7A 2DOAA 3LWFA 4BE2A 1ZELA 4A0XA 3IRQA 1CF7A 2XPWA 5K7ZA 1NHAA 4RBOA 1K83J 2F2EA 2XAQA 1BW5A 5C3EJ 4XICA 3GTLJ 2RNJA 1GXPA 3BR3A 4I0AA 1YITI 4CO8A 3CCEI 1EH6A 1W0UA 2EZIA 3JAMZ 3G1OA 3TW7A 1D5YA 1Z7LA 5HLTA 3GUDA 3KCCA 2ZBKA 1MNDA 2H1KA 1FT9A 1AKHA 4Y15A 3ZMVA 1Z1DA 2ECBA 2CFXA 3FISA 2R5ZA 2KDOA 2CO5A 4RM2A 3BQYA 4ETSA 3NAUA 1OFCX 2L7FP 5HOOA 1KU9A 3ABTA 3J80Z 3DFGA 3GX4X 4PDKA 1L0OC 5E20A 3LSTA 1ZREA 1X3ZB 1IXSB 3VEPA 2DA7A 3L2RA 2W84A 1R49A 5JLWA 3O3KA 1R5HA 3P9KA 2QENA 3NWTA 1DPUA 2BEOA 3CDLA 2HI3A 2K7LA 4BY1J 3CJQB 3C2HA 2LBFB 2XIGA 4JX5A 2VPLA 4KJZA 2NVXJ 1B4AA 2DJNA 3P9IA 1FZPB 5H6RA 1I3QJ 3CJRB 2ZXIA 1LFPA 2CQ7A 1P2FA 2Z16A 3PSIA 4QTRA 2MLKA 4RM3A 3DQVC 4XOTA 1MGTA 5IYDJ 2E5ZA 1W36C 3GFIA 5DV5A 4IX7A 1BW6A 1RKWA 1K78B 1HKSA 2JK3A 4XN3A 1EV7A 5KHDA 1BR1A 3U1DA 4BGDA 3CCQI 2LP0A 4BH9A 3QOEA 2VBXA 1D5VA 2LFBA 1IDYA 1YJ9I 3FIWA 4PK4A 1S7AA 4DYQA 5AIQA 2BHZA 2YU3A 2GZWA 3VYTB 2QVOA 1FIPA 2HQNA 1IN8A 1VQ5I 3JRFA 1YIJI 4IEJA 1YS6A 2RDPA 2R7XA 2R7TA 3O2PE 4HDUA 2LLKA 3HG9A 3HUGB 2K9SA 4V19K 2P5VA 2Q2EA 4R1HA 4LG0B 2W4SA 4UUSB 1MIJA 3ELKA 5E3MA 2OJED 4WXCA 4XONA 3T5XA 5AIPA 3R6SA 1K6OA 3FX3A 1B1BA 2ZJPF 4XSZF 1BN5A 3HPGA 1SMYF 3K4KA 4RA2A 4ANJA 2FD5A 3EETA 3BCAA 3W3CA 3ROUA 3AL0B 1Y0UA 1XPXA 1HOMA 4A2UA 3BTLA 3H3ZA 2LY2A 2XGEA 3Q9VA 2QKLB 2Y9YA 2FE3A 4BYYA 1H88C 1FP2A 1HW1A 4O5VA 5J47A 2MH9A 4J19A 3BZKA 3TBIA 2F5VA 1HXDA 2Q2EB 1D1AA 2Z99A 4IHWA 2BXZA 2LK2A 4E7KA 1Z67A 2A5YB 1UG0A 4X1EA 1JT6A 2P0WA 3K70C 4RAYA 4NQWA 1XC5A 2V7FA 4XSXF 4F93B 1PP7U 1A35A 4I76A 1LB2A 4CYCA 1T38A 5FRNA 2VBYA 2MBFA 5BQTA 2HVSA 2JTVA 5F1RA 5DM7F 2M0MA 1MMAA 1P4AA 2CRGA 4MFDA 3S32A 5JVTA 2UZKA 2K9LA 2ZNYA 1W4MA 1GV2A 1JT0A 3F3XA 5EZGA 4B8XA 4G9YA 4Z2YA 3SJMA 5TGTA 3QPSA 4YIRX 4IRHA 1F4KA 3E6MA 2QUFA 1N78A 4BS9A 4C2MJ 4DZJA 4PCQA 1UFMA 1YX5A 2MYSA 2KHMA 5DD4A 1MBHA 1YX3A 1TZLA 2A6HF 3DCFA 4GYGA 3V8LA 3DEEA 1BJAA 3GZ5A 1Z91A 4E7LA 4E6KG 3V4GA 5JHFA 1H8AC 2TDXA 5FFZA 4FE4A 2O7OA 2CJJA 3E1SA 2PFBA 4XK4A 4MO7A 1K4SA 1GV5A 3HOSA 2DMNA 2BXYA 2KKOA 5JLXA 2Z9OA 1UB9A 3K69A 1MBJA 2Z5UA 2DFIA 1D0YA 1NG6A 5BMZA 1YRNA 2EJRA 3WTUC 1V5EA 1RC9A 3RSNA 2IPQX 3QWLA 1J0RA 4WWCA 1SD5A 2R7UA 2QZ8A 2DLLA 4ABZA 3EYYA 3RDIA 3VFZA 3BROA 2OUMA 1RNLA 4Y7NJ 2VBZA 2KZGA 1PVEA 2DDAA 2MABA 4OIRF 4XLNF 3DPUA 5CQGA 2QSFX 2OCEA 3HXLA 1AWCA 5EG0B 3CMAI 2K9MA 2ELHA 4Y3OA 5EDNA 1J75A 3VYSB 3H5AA 2ZFWA 2QSGX 2JA7J 4KA4A 3GTGJ 2DTZA 3P9CA 1T2KA 1GLNA 3HOYJ 2GA1A 3F72A 2E2IJ 2WC2A 3A0BC 1X2NA 4MFEA 3M9AA 4N9IA 3I4NJ 3MN2A 3QPTA 4UUTA 1OMIA 1U8BA 1PP8F 3T8TA 3K1NA 1QZEA 2OPTA 4MQVA 5EGOB 3V8JA 3ZXSA 4ENJA 2BGCA 1WKMA 1BOAA 3MCZA 4M6VA 2E2HJ 1RI7A 3PNYA 4Q48A 1XTAA 4BAYA 3OYHA 4OIPF 4EV0A 1MBFA 2EIJH 3PSFA 3RIRA 4WCGA 2XKOA 4AUXA 4RGSA 2VLAA 3FXQA 1U8RA 2V9VA 2HOTA 3F23A 4QPOA 3M1CA 3T0YA 1VF9A 1MD0A 5K5OA 1WJAA 1IJWC 2MD5A 4XQFA 2CU7A 1EH8A 1Z6RA 4XKVA 2H8RA 2HDDA 4FX0A 4BBSJ 2FNAA 2FUG2 2VI6A 4GRIA 5DD8A 1QZZA 3F8NA 5ILUA 4IQJA 1N25A 2PEXA 3BJAA 1V5FA 2RQQA 2Z2SB 4D7MA 1BC7C 5LRRA 2PJRA 4M3FA 4B09A 3PO3J 1G59A 4ESJA 3ML6A 3DP7A 1MMGA 3DU6A 1UMQA 4M6XA 5K7FA 3O8GA 2VQCA 2J5PA 2FXAA 1O3TA 4EJVA 4F91B 1Y6IA 3JRDA 2M9HA 5F64A 1APLC 3FZVA 1ZG3A 3SFIA 2XAUA 4A5NA 3DWLE 1WHUA 3QAHA 1AOYA 1X1CA 1O3SA 4I0BA 5D8LB 1OQYA 3IHUA 4UUVA 1OCPA 4L9VA 2F5DA 3PUBA 5TJJA 2O8KA 4G7HF 4CCKA 2Y31A 2GIVA 4A6EA 3IH4A 4HSRA 1QA6A 1Y8QB 1VQOI 2MC4A 4UV9A 1B8IB 3BTIA 3G73A 2ZNZA 1XS9A 5HLGA 3R60A 2OAZA 5FFXA 3JTHA 3UNGC 2DK5A 2HVRA 9ANTA 1IRGA 5L3FA 1XB4A 2Y0SA 1TNTA 4XBFA 2CUFA 3I71A 4EJWA 1S5LC 2K85A 1UELB 1VNDA 2PQ8A 1Z05A 3G6EI 5HDGA 3KP7A 4UVCA 3SQNA 3I59A 3JTGA 1XGNA 5H6QA 4MQ9F 2R7RA 2P7CB 4WX9A 3NQOA 1EH7A 1X1DA 2F5CA 2ME0A 1R00A 2WBMA 3H1CA 3VDXA 1SC7A 2L9NA 1D3YA 1Y1WJ 3NEUA 1G8XA 1OCTC 1E3OC 2K40A 4EQQA 2DOEA 3TL4X 5K5QA 4IVNA 2KIFA 3BR0A 2V1XA 1XGOA 1ETWA 3RKXA 1YG2A 2UXNA 4GXOA 3HC7A 1RIOH 1ZRDA 3D1NI 2CYYA 2RQPA 1J09A 1W7PD 2L02A 2Y0SN 4ZYGA 4P1WA 3BZCA 3ERMA 1XCBA 2W48A 2A3SA 4B3XA 1DGWY 4IF4A 4L0ZB 2RNGA 1VQNI 4LLGF 4Y4RA 4U0WA 4ESBA 2AS5F 1DP3A 1GXQA 2DW4A 3OYDA 3WE2A 1XGSA 3WODF 5H2FC 5D4SA 3CMMA 4CCMA 3RZOJ 5F0HA 4DGWB 4H4KC 2K4BA 2L7MP 2DAOA 1IV6A 2P7VB 2QQ8A 3I53A 2LH9A 3J7ZI 2ZC2A 3LA3A 2X48A 2M4GA 4II3A 2L4MA 2K9QA 1X3UA 2ICWG 1ERDA 5F04A 1RR8C 2PJPA 4XR6A 3GYHX 4PFPA 1NG7A 2QSHX 2EK5A 3AFHA 4HRIA 2KPMA 1WRJA 2VONA 1R22A 1Z3YA 2IJLA 4FASD 1ZAOA 5ILSA 2R7DA 2MSYA 3H0DA 3DV8A 2KZVA 3CCYA 1YJWI 2O03A 5DCMA 4CGZA 4UB6C 1R71A 2CG4A 3OSFA 1Y1VJ 2COMA 3GFJA 3F8BA 3WE3A 4HEA2 4YG2F 1FLIA 1VQ9I 4DJAA 4FTHA 5GADJ 4LMYA 3HOWJ 2K5CA 3WTVC 4CCJA 4E4HA 1I6HJ 1D0XA 4BXFA 2QF7A 3ZQHA 2WWYA 3CUQA 4HNTA 5CYVA 2D2WA 3LSMA 1IF1A 2EPFA 1FOYA 3TMOA 3S1QJ 1X1AA 1MZBA 2XUBA 3A1YA 2Z3YA 2KMUA 1WSUA 2JSPA 1VTNC 2XPVA 2BHYA 3E7LA 2EV0A 4JYKA 3LMMA 3CC7I 4CSWA 2A07F 4M71A 2XF7A 3JR9A 2R7OA 4GCVA 4X6AJ 5CPRB 4JBAA 4Q4ZF 1D1CA 4JOMA 2NS8A 2LNBA 2HPMA 1S29A 1A6IA 1KQ9A 3OMYA 1UHMA 5L3BA 2OTLI 3GTJJ 1XMKA 2E60A 1PYVA 4N9HA 1BBYA 2G7UA 1USTA 4GFBA 3QYEA 4OMZA 2XHKA 2AHQA 5FGMA 4OMYA 4AC0A 1S6LA 2K27A 3HM5A 4A3FJ 2L01A 4KUMA 2IA2A 2CW8A 5KAFC 3OYEA 5FLXK 2ZMEB 5FD5A 2BVMA 2DA5A 3M4OJ 3B02A 1W0TA 5HNHA 3S14J 5J6XA 5F1JA 2GBYA 1L3LA 2GWRA 1HKQA 2DQRA 4HDVA 3ZQ7A 4RGXA 1O3QA 1KYWA 1TW2A 2DYRH 3GBGA 3LSGA 4B44A 3PIOF 4A5MA 3QYFA 3CMYA 3JW4A 3BG7A 2M8EA 4KYWA 2FEZA 4ZTFA 3CC4I 1T8IA 3CCLI 2XAJA 2AO9A 3ZP5A 1I1GA 2OF7A 3KE2A 5KVRA 1VQ4I 3DEUA 2DFEA 4LB6B 4U0YA 1BIBA 1V5GA 2GOMA 3Q0UA 3SDBA 2Q8KA 5KK1A 5HODA 3OSGA 1PDNC 1YO5C 4FETA 2B0LA 4O6JA 2HQAA 3V7CA 3ZQCA 1O3RA 4HSTA 2R5YB 1YE9A 3QPHA 1N75A 2FX0A 2JN6A 4XNFA 5B5EC 1WI9A 1JTYA 1ZYRF 1G3SA 2WADA 1G3TA 3GFMA 4G8XA 4M9SA 3DBHB 2L2OA 4JQFA 2ZJRF 1XSDA 4A69C 1B59A 1H9GA 4M72A 3RYPA 3OIOA 1T98A 2CFOA 2HZDA 3J7AY 1P7JA 4NBQA 4YRVA 1IDZA 3G3ZA 2H09A 3ZMSA 1ZN2A 2MH2A 2LY9A 2MLGA 3F0CA 3I55I 1QPIA 4BNCA 1HDPA 1BI1A 2GXAA 3BLYA 2STTA 2X0LA 3RTRA 2GA2A 3GLLA 1UJ8A 1E17A 3ECHA 4M3EA 1DQUA 3JREA 2ESNA 3EQLF 3CQZJ 2XF5A 2IBDA 3OOUA 4XL9A 3GTPJ 2XASA 1UHWA 2W57A 5D5WB 1JGGA 2V1UA 4P55A 2V9PA 5LGTA 1B72B 3CO6C 3I54A 5ILVA 2GM4A 2VN2A 5E1WA 4I7HA 4M74A 5KNLA 1QVUA 3MKYB 3SZGA 4CCOA 2DMQA 2W1OA 4IOCF 3N05A 1ZGWA 3LSJA 2HOAA 2VXDA 3N97A 5FKMA 2BYVE 2F6CA 2KLOA 3DTKA 2UXXA 1Q1VA 3M8EA 5JR3A 1TP4A 1JHFA 2WAFA 3I9V2 4MEXF 2MW8A 1PJRA 4Y17A 5CLSA 5HDKA 5IT9K 3IKTA 3ERED 4YFNF 1XN7A 2HNHA 4LOCA 3JRIA 2ZXJA 4IZZA 5C4XJ 3C3WA 2B7EA 2RKHA 4H0EA 1JE8A 3SYTA 2HOEA 3DBLB 1Y56A 2R7FA 1Z3XA 3P7NA 5M5YJ 4CZCA 2RV8A 4HW0A 2JA2A 3FXOA 4OOIA 4XORA 1ZTRA 2A5WA 3C2GA 1OR7C 4ZYDA 2EA4A 4K2EA 3BG5A 4ZZLA 2ELJA 2L0KA 3F9KA 4UXNA 4I98B 2FSWA 1S7EA 3L2WA 1YJNI 3VSLA 1K79A 1Y39A 2OZ6A 3M1EA 3GMEA 4ITVA 1NK3P 5GTIC 4BJ6C 5HDNA 5C4JJ 5B1BH 5K5RA 2LTPA 2CWEA 3WU0A 1CF7B 4FX4A 2FF4A 1EA3A 2LSOA 5IPAA 1HW2A 2ZFUA 4ENNA 2YS9A 4WXHA 3TO9A 2DU9A 3WG7H 3K1MA 3CDHA 1ZQ3P 2FBIA 2FU4A 5BS6A 3JRCA 2Y69H 3V7RA 5F08A 2BY1A 4BE0A 2HYFA 3LA7A 3MD2A 2RGVA 3G2BA 3IRRA 4LD5A 2CGPA 2HVQA 2OU2A 2QWWA 3HB9A 4E7HA 1AKHB 3S1RJ 4Q5SF 2R5ZB 2O6GE 1YS7A 2XKPA 2E7WA 3RQ4A 2Z1DA 2VOOA 3TGNA 4KISA 1I1SA 4HZFA 3VPRA 2W24A 3S3OA 5CVUA 3I3LA 3K4JA 2VIXA 1BM9A 3O6BB 2IA0A 4DNCA 4IHVA 3HYIA 3HPHA 5BOXA 2R93J 3ABLH 2KRCA 2XGDA 2HKXA 3GWZA 3OYKA 1PUFA 3DPTA 2FJ1A 2VKVA 3CUOA 4XLPF 1QHHD 5IOYA 3LOCA 3CDIA 2HR3A 2Q0OA 2QBYA 3CD6I 1VZ0A 4HV6A 3GFLA 2YX4A 3CC2I 2FOKA 4DQ2A 1V3FA 4MHGA 2A6EF 2LD5A 4U7DA 1P7IA 2LY1A 3JCUC 3HTSB 1O57A 1OCZH 2VC0A 2VE8A 2VJIA 3FMQA 2EFNA 1KU3A 1YIOA 3IKVA 3J81Z 2NS7A 3I5UA 1ZRCA 1XMXA 1LDDA 4I99C 4B3AA 5D6FA 1TT0A 3KEQA 3WTZA 3M3YJ 5J4VA 4ZYAA 2M30A 4XMYA 2ISYA 1IN4A 2VXZA 2LOOA 3C18A 4IQ4A 2HWVA 3BOQA 3IV5A 1PUFB 1WGXA 1T33A 3ASNH 2CUEA 4G94A 1FIAA 4R79A 5DCFA 4IL6C 5DTDA 4DBRA 4IHYA 1O7FA 2WAQN 3HHHA 4BHPA 1TWAJ 1ZK8A 2CMPA 2H6BA 3SEQA 2DFHA 5FKLA 3F6VA 3GW2A 3FMSA 3CCJI 1DUXC 1IUFA 3JAMK 5L3CA 4CUGA 3IAS2 5FKKA 4E7ZA 3PM1A 3GVAA 1D8KA 4II2A 2DOFA 5HS8A 1ZGJA 3A0HC 1LVKA 4RMNA 4BL0B 2KQRA 3BY6A 3BT9A 1ETYA 2K4JA 5BNGA 1LPQA 2KDZA 3KZIC 3V42A 1SVLA 1LE8A 1J7KA 4DW6A 2K9NA 1BI2A 3A01A 2G9WA 2E1MC 3N4MA 2NOJB 1U5TA 2XGXA 3OL4A 1WJEA 3X2QH 5FLVA 3S1NJ 2HYGD 2XV4S 5A2QZ 3QU3A 2UWMA 2D1VA 1J5YA 5D5XB 4C9YA 1CGPA 3L2UA 2HXOA 1IO2A 1FOWA 2P81A 1FNNA 3LFUA 3DLAA 2A6TA 3BR5A 3K2ZA 4RLQA 4N4OB 4RB1A 4XM3A 3RJPA 2VT3A 2M7AA 4NUBA 3L7WA 4NQWB 1FYLA 1Z77A 2DXIA 2CQQA 3CF2A 3CUQC 1LE8B 4CYCB 3OYLA 2CV2A 4MLOA 1IV8A 4MNUA 3K6GA 3HKZN 3TP3A 2D45A 1ZHFA 2OD5A 2VKDA 3AG3H 4F3QA 2EFPA 3IP4B 4QPQA 2X85A 2K02A 1WJDA 4I2OA 2VOPA 4CCLA 2NYXA 2FOWA 3VYUB 4FT8A 6PAXA 1JUSA 4ZDPA 4C2TA 3S15J 1SD7A 4BBRJ 3KP5A 4MEYF 3HZJA 3MVPA 2IVMA 3BR6A 3ESWB 4UV8A 1B9NA 2E5NA 3ZQLA 4CYDA 1M1EB 1GDTA 3HOTA 2NVUB 4M3BA 2X6WA 4BUPA 3WG9A 1KA8A 3S2DJ 2FBHA 4D0PA 2HDCA 1HSTA 2E1CA 2EIMH 1EKEA 2IGKA 3A02A 3HL2A 1VQ8I 4B4CA 2XVCA 3GCMA 3LSRA 4PJJA 1KYZA 3Q9SA 2ZO4A 1FOKA 2ZXWH 3MQ0A 1Z6TA 1R4MB 2KIMA 1YRNB 1LNWA 4ZH4F 4RB3C 3ISPA 3HSFA 4NC8A 5EF6A 1R36A 4AYBN 3FXJA 1MH4A 1D0ZA 2EH3A 2IAIA 3ZN1A 1TQIA 2CW7A 1F9NA 1WVRA 3LAJA 4JX6A 1U78A 2A61A 4L9NA 3ABUA 4CA0A 4Z6YA 1GVDA 1P6RA 2BW3A 3ZQGA 4EVIA 5L3EA 4P5OA 5IY5H 3CO7C 4IXAA 1QPMA 2BVLA 1ON1A 4EEFG 4MTDA 3RKQA 3HOUJ 2W7NA 5TISC 1Z9CA 4J01A 3F6OA 1RESA 3K4BA 4AVZA 2LYCA 2DFFA 2ZXHA 3NRVA 4CH7A 3PIPF 3VODA 1MBEA 1OR7A 1HLVA 2B63J 2A69F 4X0GA 1UAAA 2EQRA 4OAZA 4XRSG 2JT1A 2PX9A 4QLCU 3COAC 2QQBA 2XSDC 2STWA 2R7ZJ 1YW7A 3FK7A 3CJTB 3QPLA 2RAEA 2VKEA 4HBLA 1IRXA 4RLFA 5M5XJ 1TL8A 2V79A 2CQNA 3W2VA 3A4CA 2P5LC 3RPUD 1SFOJ 1FSEA 4YIFA 1MDMA 4BHBA 2H94A 5IOZA 1TWHJ 2LRDA 4QWQA 2LC2A 1FBSA 3ABMH 5EEHA 5M3MJ 3FXLA 1LDKB 2CUZA 2FQ4A 1YI2I 1UCRA 2EV6A 2HKOA 1WQ2A 4LGWA 5ICEA 4PJLA 4DOZA 3CCSI 4C3IJ 3LQRA 2ID3A 1FEXA 2DDBA 1VQ6I 2A68F 2R3SA 1MBKA 1XG1A 5GAEJ 3C7JA 3MZHA 2JWTA 3ZQQA 2M0CA 2HS5A 3OL3A 1MDMB 2M7BA 3FBIB 3JRHA 1XSVA 3EPZA 4KDPA 1TQPA 1SFXA 2PJRB 3LSHA 5L3DA 2FMLA 2HOSA 2JUCA 3QOPA 1FP1D 1A04A 5J1UA 3W2AA 5CKTA 3WTSC 2QGUA 1FBQA 5FLMJ 3WTTC 2ADUA 4EMSA 1XX5A 3LSKA 3HOXJ 2DO7A 4BACA 2R4GA 5ICCA 2V6EA 5E3NA 3FM5A 3A2KA 3MKLA 2HXIA 3FXUA 3K4NA 2J5OA 3OOPA 3I56I 1VQ7I 2LMDA 4PGHA 3ZMUA 2D5VA 3OYAA 4HYEA 3ZN0A 2IS2A 1ETVA 3FK6A 4C2UA 3TKYA 3KYLA 2KRFA 4BHCA 4YELA 2L9RA 3TQNA 1C0WA 4A6DA 3DEWA 2FNPA 4B47A 4PJNA 4BXXJ 3KP2A 2P4WA 4AD9A 3LFKA 3HDDA 4B1RA 3CZ6A 4IRIA 1WH5A 1X1BA 3LAPA 5FJ8J 2E1NA 1KQ8A 3MEXA 4FHTA 2TRTA 4V2FA 1ULYA 4A12A 2JA6J 3Q0VA 3F8CA 3E5QA 4RB2C 1BIAA 1YTYA 1Y0NA 2KRHA 3PFYA 2P6SA 3H35A 3I59B 4WF2A 3R0JA 1BR4A 1P92A 2RC4A 1GT0C 1HCRA 1MW7A 3I4PA 3WGIA 3B73A 5E17F 3OYNA 4G7OF 2BBYA 1S72I 5FRMA 1R1VA 1MNEA 3HIFA 2M34A 3VYRB 5JHUA 3K10A 2W00A 3K4LA 4EM1A 5LEJA 4IHSA 1BI0A 2GAUA 3VB2A 1VFCA 4HX8A 3TEDA 4A3KJ 5TRDA 2CUJA 5CQEA 2JQ7A 2M2EA 4HAMA 1WPKA 4F52A 1J2XA 1SANA 3OIPA 4KN4X 4BXUA 4MIMA 5LD2C 3V8KA 4A0YA 1MJAA 2QYOA 3UKGA 2ZKZA 1LFUP 3BPXA 1W5TA 4AU7A 5LBQA 4I01A 4KMFA 3W2WA 4U0VA 4M3GA 3KP3A 2H27A 1ODDA 4G6DA 1REPC 1BR2A 3DTIA 1VQKI 3HRUA 2P8TA 1OYYA 3PNTA 3L2QA 3KP6A 1FYKA 4HF1A 2DN0A 1V54H 1A36A 2DMUA 1LUJB 2WY7Q 5LRSA 4ZZDA 1KU2A 2O0YA 2HDWA 2ME6A 1N77A 4NB5A 1X19A 4PJ0C 1ETQA 2KIUA 5DM6F 1IUYA 2RVCA 1HDDC 1OKRA 4ZJZA 2TCTA 3GO5A 3WU1B 5DCMB 5FB2A 2EFQA 1TWCJ 2YR2A 2LF7A 1G6NA 3BR2A 1MSFC 1KZHA 3WHCA 1JKRC 2XAFA 2AQEA 2NS0A 5LHHA 4BEHA 3WU2C 1X4PA 4EJTA 3AL0C 1OYIA 5JVGF 1G3YA 5LGUA 4RS8A 2IGMA 5EJCA 5BPDA 1SAUA 2E35A 4ZC3A 4LB5A 1ITYA 2KFDA 3RCOA 3BJOA 5GPCA 1HSJA 1I5ZA 5J4YA 2F5EA 3A03A 3CUQB 1U3EM 4BJ5C 1S9HA 2LVSA 4LLNA 3DTEA 4B48A 2CS3A 3BCBA 2OTJI 2ZJ2A 1SVOA 1XDSA 1I27A 2JZYA 1E3PA 4MGRA 1R9TJ 2IGNA 1O7LA 1W1WE 1JJ8C 3D5LA 4FQGA 1W7PA 1AA7A 1OLTA 3LNQA 1U2WA 2XROA 4RAGA 3CLQA 4RGRA 5ED4A 1MMNA 2DBBA 1QVTA 3G1LA 4FCYA 1W5CC 1LEBA 4ENKA 1KONA 1U5TC 4ZYEA 4L9TA 2IW5A 3QODA 1YFHA 4G12A 1EJ9A 5AONA 4HLXA 1X3WB 1Z7UA 2JUGA 2R7QA 4EM0B 4ZTJA 2L5QA 2PMZN 2OQGA 3HRTA 2NVQJ 1ZKGA 1E0EA 1RKTA 4M3DA 2Y30A 3K7AJ 5GAGJ 4F55A 3BG6A 1D8JA 1B6AA 4XLAA 1WWXA 2JJ7A 4L18B 2OA4A 3JRAA 1UHSA 4NNJA 1F1ZA 4OWRB 1UG2A 1JHHA 3V7SA 5JFRA 1HC8A 2HU9A 2X1DA 2Y48A 4OINF 3KX2A 1G4DA 2PMUA 2OBPA 3QQAA 4XLFA 1FBUA 3EUAA 3H9QA 3MZYA 1A5JA 1T0FC 2IEKA 4KICA 2NXNB 1JGSA 3O8HA 3FWEA 3GEZA 2NNYA 3TO6A 1IXCA 3E6DA 4O3MA 5ERIA 5D6EA 3DXJF 1P4XA 2X6XA 3AAFA 3HGGA 3QU6A 4UNOA 1Q1HA 1H9TA 2MFZA 2DT5A 4U88A 2HGCA 3BWGA 3HSRA 3U1KA 2DMPA 1LJ9A 2L7ZA 3IH2A 4XRMA 2VE9A 3IC7A 1TBXA 2K3FA 4PSWA 3KZZA 2KISA 3SDGA 4NC6A 1R5GA 2OV7A 3M8JA 2X6YA 2JPCA 2F4MB 3G4SI 3NARA 5K7HA 2VQGA 3T8RA 3QYBA 1S8NA 5IYBJ 3OY9A 1KQ0A 2LDUA 1O4XA 1TWGJ 4ZDLA 1TLHB 4P96A 4DBQA 2DT6A 2I10A 1TNSA 2VBWA 1T95A 4CZZA 4F92B 1IRFA 3BC8A 5J8FA 4IRGA 3OYJA 4PUSA 3ULQB 3E0JB 1IXRC 5DYMA 4EATA 1QNTA 3G71I 2EWNA 2I5UA 1Z21A 1F43A 4P9UA 1ZR2A 3H0GJ 3OYBA 1HBXG 2K86A 3S17J 2FMYA 4XOPA 4Q47A 5HVQC 5LEKA 5J40A 5J1RA 5F27A 2DI3A 3BPVA 2XF6A 4XIDA 3FDYA 1GVJA 2UV1A 1LEAA 2YSRA 1LDJA 2G0EA 1H89C 4EM2A 3BTCA 1K6YA 2HTSA 4GYIA 3S8PA 3VWBA 1OCOH 4RAZA 3K0LA 3S16J 5EZHA 1ONVA 4NHJA 2JVGA 3LA2A 3MFKA 1J59A 2IA1A 1ZLJA 4A3EJ 3LL7A 1FX7A 3SEZA 1FOXA 2OQRA
chains in the Genus database with same CATH topology
2Y0SA 2LBFA 2OC6A 4BDYA 2AQFA 2VKDA 4F3QA 1WJCA 1D1BA 3IP4B 4QPQA 2X85A 4XLHA 1UELB 1SFKA 1WJDA 3OWTA 2VJ5A 3OYMA 4CCLA 4HPQA 3VYUB 3OYCA 1U0JA 1WJ5A 3FKJA 4ZDPA 4C2TA 4Y33A 2QKMB 3OYFA 2R7RA 2BOLA 1X1DA 2E5NA 2WBMA 3VDXA 2MD0A 2IXSA 2L9NA 2RREA 3S3MA 3HOTA 1G8XA 2ZSHB 3OYGA 2X6WA 4BUPA 3D5SC 4XKBA 3TL4X 2WAQA 3DU5A 3CP2A 3H9GA 2X1EA 3HL2A 2IGKA 3UR3C 3HC7A 2GOXB 4PJJA 2VKHA 4PSXA 4IKFA 1J09A 2WA0A 4P1WA 3VSKA 4N4NB 4E7IA 4NC8A 4B3XA 1DGWY 2CV1A 4U7BA 2RNGA 4PFOA 1D0ZA 4Y4RA 2CW7A 1DP3A 3ZR8X 3OYDA 3EUKL 2F4IA 4CCNA 3CMMA 4CA0A 2BW3A 2L7KA 4CCMA 2DT7B 2O5RA 4DGWB 4H4KC 4P5OA 3IAM2 2M3AA 4LIUA 2BVLA 2LH9A 2VL8A 2W7NA 5KCMA 2M4GA 4II3A 4J01A 4D9JA 1ERDA 2IS6A 3K4BA 4AVZA 4XR6A 2LYCA 2ZXHA 4CH7A 1JI8A 4PFPA 1NG7A 3U21A 3AFHA 4HRIA 2XC7A 2WY8Q 2KPMA 3H9JA 4X0GA 3OYIA 1Z3YA 4B43A 4OAZA 1UAAA 4FASD 2DJIA 4OAYA 3H0DA 4LG3A 2KZVA 2X1CA 1IRXA 2VQLA 4RLFA 2R7SA 1X4OA 4C30A 3S3NA 3W2VA 3A4CA 3RPUD 4HEA2 4BQQA 4KITB 3MKZA 4E7SA 4DJAA 2HPIA 3HKZA 2VQHA 1FMWA 2JVHA 2LRDA 1WJBA 3NWSA 4ZDOA 2K5CA 2LC2A 4CCJA 4HG2A 3AKZA 3LSIA 4E4HA 1D0XA 2WAEA 4BXFA 1LDKB 2CUZA 4HNTA 3LSMA 3TMOA 2KP6A 4NC7A 1X1AA 2DOAA 4PJLA 4DOZA 3A1YA 4BJTA 4BE2A 2KMUA 1ZELA 2JSPA 2XSJC 3LMMA 4CSWA 3ZQQA 2XF7A 3OL3A 2R7OA 2M7BA 3FBIB 5CPRB 5LFAA 3EPZA 2PJRB 3LSHA 1D1CA 4JOMA 2HPMA 3W2AA 5CKTA 3OMYA 3K4CA 2E60A 1PYVA 3LSKA 1Z7LA 5HLTA 4BACA 2R4GA 2V6EA 1MNDA 3CESA 3QYEA 3A2KA 3K4NA 4AYBA 2KDOA 4RM2A 1LKXA 2CW8A 3OYEA 2BVMA 3CP8A 3OYAA 5HOOA 4XLCA 5HNHA 2IS2A 2K3PA 4C2UA 3KYLA 4PJMA 4YELA 3L2RA 4B47A 4BE1A 2V26A 4PJNA 3GBGA 3LSGA 4G6TB 3NWTA 4B44A 3QYFA 3BG7A 3CJQB 3C2HA 3OR2C 2LBFB 4ZTFA 3CZ6A 1BOBA 2WB1A 2VPLA 1X1BA 4KJZA 3CJRB 2ZXIA 1LFPA 2KRHA 2V9KA 3PFYA 3IUOA 3OR1C 3D5RC 3H35A 2Z16A 1V5GA 2GOMA 3PSIA 3S93A 3SDBA 1BR4A 4RM3A 4FETA 3DQVC 4XOTA 3FHNA 2HQAA 4HSTA 2E5ZA 1YE9A 1MW7A 1W36C 1N75A 3DKXA 4IX7A 4XNFA 1W36D 3OYNA 4XKWA 5FRMA 2WADA 1MNEA 4XN3A 3VYRB 5KHDA 1BR1A 3K10A 2L2OA 2W00A 4JQFA 4BGDA 3K4LA 3H5RA 3QOEA 2CFOA 3J7AY 2HZDA 3FBNB 4YRVA 2DCEA 2CUJA 4PK4A 5CQEA 4F52A 3OIPA 3BLYA 3EUHC 4J00A 5LD2C 3VYTB 3RTRA 2W82A 1DQUA 2V4JC 2IS1A 2Q1ZB 2R7XA 2XF5A 4AU7A 3OOUA 2R7TA 4XL9A 2M4KA 3W2WA 3HUGB 3HG9A 1BR2A 3DTIA 4BDZA 2W4SA 2BW3B 3PNTA 3L2QA 4XONA 2R7VA 5KNLA 3MKYB 3SZGA 4CCOA 2W1OA 3N05A 2VXDA 2WY7Q 3HPGA 5FROA 3K4KA 4ANJA 2HDWA 2F6CA 2KLOA 3DTKA 3BCAA 3W3CA 1N77A 3AL0B 1X19A 3DKYA 4XLEA 1HA8A 2WAFA 2LY2A 3I9V2 2QKLB 3H5NA 1PJRA 3ZGKA 4E7JA 2HNHA 2XDVA 4IZZA 4ZJZA 3TBIA 2F5VA 2Q2EB 1D1AA 3SYTA 4HNUA 1Y56A 2AQEA 4BU2A 4E7KA 1UG0A 4BEHA 1Z3XA 1X4PA 2P0WA 3K70C 2VASA 3AL0C 2V7FA 3K4MA 4CZCA 4F93B 3K70D 2JA2A 1QHGA 4XORA 2A5WA 3C2GA 1WJFA 1OR7C 2R7WA 5FRNA 3PL8A 2V1NA 2IGMA 1SAUA 4ZC3A 2HVSA 2ELJA 3F9KA 2M0MA 1MMAA 3RCOA 3PJRA 3S32A 3L2WA 2K9LA 3VSLA 3L2VA 4BJ5C 3ZCOA 4ITVA 1S9HA 4BJ6C 3DTEA 4B48A 2CS3A 1FMVA 3BCBA 5TGTA 1N78A 2IGNA 1EA3A 2ZSIB 3D5LA 4BS9A 2ZFUA 1YX5A 2MYSA 2KHMA 1YX3A 1TZLA 1AA7A 1OLTA 3DEEA 2CV0A 2IS4A 1MMNA 2UUZA 4E7LA 4E6KG 1P9QC 5JHFA 1KONA 4BE0A 3QODA 4XN0A 3MKWB 1DGRM 2JUGA 2R7QA 3E1SA 3MD2A 3G2BA 3HOSA 2L5QA 4ZTJA 3OS2A 1E0EA 2LREA 2HVQA 4E7HA 2VJJA 1D0YA 1NG6A 4F55A 3BG6A 4XLAA 4BQOA 1V5EA 3DPLC 2VB6A 3RSNA 1WFXA 3RQ4A 2LG4A 2Z1DA 1R6RA 4NNJA 4KISA 4LITA 4OWRB 2CH0A 2R7UA 3S3OA 3I3LA 3K4JA 2VIXA 2OUMA 2HU9A 2MABA 5HNFA 2X1DA 3DPUA 5CQGA 3HXLA 3ZRGA 3KX2A 3HPHA 2K9MA 4LIVA 2KRCA 1MMDA 4XLFA 4Y3OA 3EUAA 3H9QA 3OYKA 1T0FC 3DPTA 1QHHD 4D1QA 3VYSB 2X51A 3H5AA 3OS1A 3KEYA 1VZ0A 2IGOA 1GLNA 3OIQA 2X6XA 2LY1A 4KT6A 2VJIA 2MFZA 1TT0A 4ZYAA 4XMYA 4PSWA 2VXZA 2LOOA 4IQ4A 3ZXSA 2OV7A 3M8JA 2VJ4A 2X6YA 4BQNA 3PNYA 3OYHA 4R79A 2VQGA 3QYBA 4DBRA 3OY9A 3PSFA 3OS0A 2CMPA 4ZDLA 2VLAA 3SEQA 2L9SA 4DBQA 4XKCA 2DT6A 4QPOA 3M1CA 3ONQA 1T95A 4F92B 1WJAA 3BC8A 2E1MB 4XQFA 4CUGA 3IAS2 3OYJA 4PUSA 4XKVA 3E0JB 4E7ZA 4EATA 2FUG2 4GRIA 4IQJA 1Z21A 4II2A 1LVKA 4RMNA 2Z2SB 1V5FA 2RQQA 2KQRA 4BL0B 2I8DA 2PJRA 1G59A 2KL4A 3OYBA 2PMZA 3V42A 1MMGA 3PNVA 3DU6A 2VQCA 2E1MC 4XOPA 4DIQA 2NOJB 3OL4A 4F91B 4YEJA 1WJEA 1Y6IA 5HVQC 2XF6A 2XAUA 3FDYA 2UV1A 3DWLE 2UWMA 4C9YA 1X1CA 3L2UA 1K6YA 3LFUA 3S8PA 3VWBA 3PUBA 3DLAA 2A6TA 4CCKA 4RLQA 4N4OB 4BEHB 4HSRA 4XM3A 2JVGA 2MC4A 2M7AA 4NUBA 4NQWB 2DXIA 1QU3A 4U87A 3MMYB 3CF2A 2CV2A 3OYLA 3LL7A 4MLOA 3SEZA 3UNGC 2HVRA 3K6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VXD A; 
#chains in the Genus database with same CATH topology
 5K1Y A;  2LBF A;  1BJZ A;  2DA4 A;  4GO1 A;  4BDY A;  4HOB A;  1Z0X A;  1WJC A;  1W5S A;  5J3L A;  2A05 A;  4BKX A;  1Y8R B;  2DA2 A;  4XLH A;  1TWF J;  1SFK A;  4EJO A;  3OWT A;  5B1A H;  2VJ5 A;  3WTX C;  3OYM A;  4C3H J;  5LLQ A;  1B9M A;  4OIQ F;  3OYC A;  1U0J A;  2JMW A;  1WJ5 A;  3FKJ A;  4F7Z A;  1IW7 F;  1BI3 A;  3ZMD A;  2H1L A;  5DUI A;  2E2J J;  2R0Q C;  1SVM A;  1FY7 A;  2BOL A;  1DPR A;  1FWZ A;  1ZLK A;  3W6K B;  2VPR A;  5GP9 A;  2MD0 A;  2IXS A;  1ZAR A;  3S3M A;  1K78 A;  4A3L J;  1RRJ A;  1MJB A;  2ZSH B;  3HTU A;  2F5F A;  4YFX F;  4XKB A;  1E3H A;  1WI3 A;  3TDZ C;  3K1P A;  4IOA F;  2EIN H;  1IZ1 A;  4A3G J;  2WAQ A;  3DU5 A;  3FXR A;  1MBG A;  2VKH A;  4PSX A;  2DTR A;  4HA8 A;  4W97 A;  3AG1 H;  4XRF A;  1CQT A;  3GZ6 A;  1IG7 A;  2XB5 A;  4N4N B;  3IL2 A;  4E7I A;  1ACI A;  4U7B A;  2CQX A;  3JRG A;  3H3V K;  2YX7 A;  4PFO A;  3LQQ A;  4L5J A;  2B9S A;  3HUG A;  3R61 A;  3RKY A;  3C2B A;  2N8G A;  4RB0 A;  3EUK L;  5E1X A;  4LK0 F;  3BR1 A;  4UVA A;  1BC8 C;  2MG4 A;  4LG0 A;  2ELK A;  4UUS A;  1R4N B;  2H6C A;  4M6Y A;  3F8M A;  3K9T A;  4PZJ A;  1GHC A;  2KT0 A;  3QP5 A;  3IAM 2;  3HOV J;  2VL8 A;  5M3F J;  3PQK A;  5KCM A;  4D9J A;  2QBY B;  2IS6 A;  2QLZ A;  5F6F A;  2EFW A;  2LKX A;  1YLF A;  2Y9Z A;  4LK1 F;  4IPA A;  3U21 A;  1BL0 A;  3GLX A;  3H9J A;  1QBJ A;  1QGP A;  4B43 A;  1F36 A;  2DJI A;  5E18 F;  4OAY A;  2DPD A;  2LKS A;  2EFO A;  5FKO A;  2ZJQ F;  2W85 A;  2X1C A;  5LGN A;  4FE7 A;  4A3J J;  3G1M A;  2NNN A;  5E79 C;  4C30 A;  1DP7 P;  4A3I J;  2IP2 A;  4G7Z F;  4L0Y B;  1WH7 A;  5CVJ A;  4BQQ A;  4KIT B;  2GXB A;  1TTY A;  4E7S A;  2HPI A;  3HKZ A;  2DA1 A;  2VQH A;  3L00 A;  3KLN A;  3NWS A;  5IYC J;  1MSE C;  1SFE A;  1PUE E;  4HG2 A;  3AKZ A;  4A3B J;  5E8I A;  4ESF A;  1NK2 P;  3J80 K;  5HLI A;  4UVB A;  5B3S H;  1OJL A;  4BJT A;  2YPR A;  3Q5F A;  4P9F A;  1VI0 A;  4GGG A;  4M9Z A;  1K7A A;  2XSJ C;  4RAF A;  5F0F A;  1TC3 C;  3CJN A;  3ZOB A;  1JUP A;  5KAI C;  3GTO J;  2WV0 A;  1QQI A;  5E3O A;  5C44 J;  1YHQ I;  3Q3S A;  3GTQ J;  5LFA A;  1I39 A;  3F21 A;  4LLL A;  5EEA A;  3I0T A;  4A3D J;  2E34 A;  5DS9 A;  3K4C A;  3RPQ A;  3H36 A;  2EZK A;  3A01 B;  1IRZ A;  4DYR A;  3QRF F;  1MKM A;  4EJU A;  1U5T B;  3E6B A;  4A93 J;  2OCC H;  4AM3 A;  3CES A;  3CME I;  2W25 A;  4IJA A;  3GF2 A;  3W6V A;  1JJ6 C;  2CQK A;  5M5W J;  4AYB A;  1T0F A;  3GZN B;  2VC1 A;  3ZMT A;  3LSP A;  1LKX A;  4V2G A;  4JK1 X;  2CW0 F;  3CP8 A;  2M45 A;  4XLC A;  1QRY A;  1TQM A;  2K3P A;  4OIO F;  2EV5 A;  2YU9 J;  1LQ1 A;  2DK8 A;  3HRS A;  4PJM A;  1K61 A;  1F5T A;  5EG0 A;  4BE1 A;  2EIL H;  2V26 A;  4UY8 I;  2IT0 A;  5JI6 A;  4KN7 X;  4G6T B;  2BE5 F;  2MA3 A;  3J81 K;  2Y0M A;  1J9I A;  3ZMZ A;  5HLH A;  1R1U A;  3OR2 C;  3I4M J;  1SFU A;  2EBI A;  1BOB A;  2VT2 A;  2WB1 A;  5LHI A;  2ZME C;  5F0C A;  1R7J A;  1R1T A;  1S3J A;  2V9K A;  3IUO A;  3C1D A;  3OR1 C;  3D5R C;  3KEO A;  5DDG A;  3J7A O;  5IP9 J;  3U2R A;  3S93 A;  1DU6 A;  3TOB A;  1WCM J;  3E6C C;  4I02 A;  2ZCW A;  5E3L A;  3FHN A;  2E71 A;  4M73 A;  2M5W A;  1R23 A;  2EB7 A;  3DKX A;  2ZB9 A;  4CHU A;  1HKT A;  1W36 D;  3IWZ A;  4JP0 A;  4XKW A;  5FO5 A;  2EZL A;  5EGO A;  3KZY A;  3CCV I;  2HYJ A;  3H5R A;  2ACJ A;  1FC3 A;  3FF5 A;  3GXO A;  1X2M A;  1ON2 A;  2FBK A;  3FBN B;  1OCR H;  2RN7 A;  3BQZ A;  2DCE A;  4TV7 A;  3RQI A;  5E1Z B;  1MJ9 A;  1V55 H;  1JUM A;  3AG2 H;  3EUH C;  4J00 A;  3HRM A;  4HX7 A;  2WB1 N;  1V4R A;  2W82 A;  2NVT J;  3BZ6 A;  2V4J C;  2IS1 A;  2Q1Z B;  1QZY A;  5B66 C;  5L3G A;  3HSE A;  2M4K A;  3EDP A;  3SZT A;  2DOD A;  1VQP I;  3PUF A;  2JA8 J;  5A2Q K;  3OV8 A;  2PN6 A;  1OIS A;  4BDZ A;  2KJB A;  3HHG A;  3BG3 A;  2BW3 B;  3E5U A;  2R7V A;  3R4K A;  3AG4 H;  3JSO A;  3KP4 A;  2L9V A;  5FRO A;  2F48 A;  1TT5 B;  1IN5 A;  1OYW A;  3T1B A;  3HOZ J;  2G7H A;  4L5I A;  2O3F A;  1OCC H;  3DKY A;  4XLE A;  1HA8 A;  4KFC A;  2P5K A;  3H5N A;  1USS A;  5D5V B;  2L3D A;  5CVV A;  3ZGK A;  4E7J A;  1NH3 A;  4ENM A;  2XDV A;  3CCU I;  1RUN A;  2QM3 A;  4HNU A;  4ASN A;  3WTY C;  2O9L A;  4BU2 A;  2E36 A;  4S05 A;  1B8I A;  2VAS A;  4GDF A;  1P4W A;  3JRB A;  3K4M A;  3K70 D;  1H0M A;  4L5E A;  3MZ8 A;  4L9J A;  4UB8 C;  1QHG A;  2R7W A;  1WJF A;  3PL8 A;  2V1N A;  2GXG A;  1JKQ C;  1XCV A;  3GTK J;  2PMH A;  3PJR A;  3L2V A;  1ZR4 A;  3ZCO A;  2HQR A;  1UZC A;  2HZT A;  3MWM A;  2COB A;  2XRL A;  1RET A;  1FMV A;  3SFZ A;  1DDN A;  2VOD A;  5HS9 A;  1IAW A;  2FA5 A;  5DEQ A;  1T6S A;  3L1P A;  2ZSI B;  3BG9 A;  4AWX B;  1T39 A;  2CV0 A;  1AU7 A;  2IS4 A;  2V1D A;  2GLO A;  2UUZ A;  2AXL A;  1P9Q C;  1XDU A;  3ASO H;  3SHF A;  3KFW X;  3MAJ A;  4G6Q A;  3HEF A;  4E70 A;  4HX4 A;  4XN0 A;  1JTX A;  1MH3 A;  3MKW B;  1DGR M;  2L4A A;  3REO A;  2EA2 A;  2ESH A;  1ENH A;  3RYR A;  5IP7 J;  3P5J A;  2ISZ A;  3OS2 A;  2LRE A;  2C6Y A;  4IHX A;  2F4O B;  2FRH A;  2VJJ A;  1KU7 A;  3ABK H;  4S04 A;  4HLY A;  4CDG A;  3H3U A;  5FD6 A;  1LFB A;  1U9O A;  1QO0 D;  4BQO A;  3DPL C;  4YFK F;  2VB6 A;  1WFX A;  1FTT A;  3TO7 A;  4I6Z A;  2LG4 A;  3M7G A;  2M8G X;  1IN7 A;  1R6R A;  4HF2 A;  3PO2 J;  2AXT C;  3TOA A;  3I58 A;  3DLL F;  1STZ A;  4LIT A;  1YYV A;  2CH0 A;  2BY2 A;  4KT5 C;  4EGZ A;  3CLO A;  3BDD A;  3B6A A;  2D1H A;  2EZH A;  5HNF A;  1FJL A;  4MTE A;  5HS7 A;  4IO9 F;  3ZRG A;  4EGY A;  1KGS A;  3TDU C;  2XPU A;  4LIV A;  2PI0 A;  1POG A;  1ZGA A;  1MMD A;  5D4R A;  1ZG5 A;  2JA5 J;  4DYC A;  1SD6 A;  3WGH A;  2BY3 A;  4D1Q A;  5FLX Z;  2X51 A;  3CF5 F;  3RPU A;  3L9F A;  3OS1 A;  1ZH5 A;  3KEY A;  1RPW A;  3R0A A;  4RDU A;  2IGO A;  4A0Z A;  4W1U A;  3OIQ A;  1MNM C;  4WK8 F;  3J7Y J;  3FXK A;  1U6G A;  5CJ9 A;  1HW5 A;  4KT6 A;  3WGG A;  2DPU A;  2JRT A;  4LJZ F;  1EF4 A;  4C3J J;  1YW8 A;  1R5I D;  1FTZ A;  4IHT A;  3JSP A;  3F22 A;  2XGC A;  2X9D A;  4CXF A;  3FMR A;  2KIQ A;  2YUS A;  3KYC B;  2PBI A;  3S2W A;  2VJ4 A;  4KIB A;  4R8H A;  2BZT A;  2Y2Z A;  4BQN A;  4KIF A;  2WTE A;  3IH3 A;  2EIK H;  4I09 A;  4M9X A;  3OS0 A;  4QIW N;  1S7O A;  4UHT A;  1SAX A;  3ECO A;  3TP0 A;  4DZP A;  2L9S A;  5H20 A;  4XKC A;  3D0S A;  3K2A A;  3IWF A;  3RKW A;  4ZYH A;  3ONQ A;  2FQ3 A;  3FM3 A;  3E5X A;  4RGU A;  2E1O A;  2QCO A;  2E19 A;  2E1M B;  2DA6 A;  4AIH A;  1I6X A;  3QP6 A;  5E8G A;  1HQC A;  3S2H J;  2ETH A;  3FKI J;  4D5C A;  2I8D A;  4HNV A;  1NTC A;  2KL4 A;  4AIJ A;  2H8W A;  2PMZ A;  3HJE A;  2HEO A;  2HQ5 A;  3WTW C;  3PNV A;  1SMT A;  4DIQ A;  2NAZ A;  3E3V A;  4LFU A;  2XAG A;  3BJ6 A;  5IT3 A;  1BA5 A;  1FYM A;  4YEJ A;  3EYI A;  3F8F A;  2JPB A;  4Y13 A;  3ZQF A;  1ZG1 A;  3VOE A;  3B6C A;  1YOV B;  4JX4 A;  2BY0 A;  2ZME A;  2XRN A;  3M07 A;  4WXD A;  1DU0 A;  3CCR I;  1RUO A;  1YQA A;  3DKW A;  3Q0W A;  1IC8 A;  3FHZ A;  4BEH B;  1JKO C;  2DMT A;  4PGG A;  1JKP C;  1XMA A;  3HGY A;  1QU3 A;  3L09 A;  4U87 A;  3MMY B;  2GIZ A;  3DF8 A;  2M1B A;  4A3M J;  5IT9 Z;  1X58 A;  4N0B A;  2HFH A;  2OC6 A;  2AQF A;  5GPA A;  1D1B A;  3PQJ A;  2Y75 A;  3W6J B;  2O8X A;  2PG4 A;  1XGM A;  5LHG A;  4HPQ A;  1IGN A;  4Y33 A;  1G3W A;  3SZP A;  2QKM B;  2V6C A;  3OYF A;  2QA4 I;  4D7N A;  2MGQ A;  1FSH A;  1W7P B;  2XAH A;  2R5Y A;  1ETO A;  3EUH A;  4HV5 A;  3U9G A;  1I3A A;  1JXS A;  1T56 A;  1IN6 A;  2RRE A;  3RI4 A;  1YW9 A;  2VUM J;  3S1M J;  3H92 A;  3OYG A;  2ID6 A;  4BQA A;  1XD7 A;  1HF0 A;  1RR7 A;  3D5S C;  1R58 A;  1X1P A;  4HQM A;  4KNY A;  2DA3 A;  3CP2 A;  3H9G A;  2X1E A;  2L54 A;  5EYR A;  3UR3 C;  2MC3 A;  5ICG A;  2GOX B;  1LVA A;  4IKF A;  5D8K B;  2QQA A;  2CSO A;  4S0H B;  3L2C A;  2WA0 A;  1U9N A;  5D5U B;  4XRS A;  4A3C J;  1ZRF A;  1VQL I;  3VSK A;  1E2X A;  4AID A;  3WHB A;  2BV6 A;  2M87 A;  3KLO A;  2CV1 A;  3M8F A;  2NRA C;  4CIC A;  1T08 B;  5EEG A;  3KET A;  2DQL A;  1SD4 A;  5FKN A;  5IP6 A;  2GQQ A;  1XSX A;  4AIK A;  2XB0 X;  3ZR8 X;  3FXM A;  3KIO A;  1B72 A;  2F4I A;  1TW3 A;  3KPH A;  4CCN A;  2OZU A;  4KIG A;  2L7K A;  5DUK A;  4ON0 A;  2DT7 B;  2JRM A;  4BY7 J;  2X6O A;  2O5R A;  1K4T A;  3BTJ A;  1G2H A;  2WV1 A;  4AVP A;  4NDL A;  2M3A A;  4LIU A;  2KJC A;  4QSH A;  1A31 A;  3DBR B;  5ICF A;  2PLY A;  4HQE A;  4FIS A;  2P6T A;  1GUU A;  2IRF G;  2HTJ A;  1I50 J;  4KMU X;  5CVI A;  3ZQI A;  4OU0 A;  1JI8 A;  2LF8 A;  5J1Y A;  1MMS A;  2XC7 A;  2DYS H;  2WY8 Q;  5GAH J;  3GTM J;  3OYI A;  1A6Q A;  2O61 A;  1RZ4 A;  5BPI A;  4LG3 A;  2NVY J;  3SXY A;  3E97 A;  2QQ9 A;  4YII A;  2VQL A;  1FPQ A;  4D5F A;  5GTH C;  2R7S A;  1ETK A;  1X4O A;  3S3N A;  3HBL A;  1SEU A;  1ETX A;  3I64 A;  4HF0 A;  2Z33 A;  1VQM I;  1AHD P;  3PFI A;  3CCM I;  3RZD J;  2R92 J;  3TW6 A;  5J8C A;  3CTA A;  3MKZ A;  3ZPL A;  3KYD B;  1FMW A;  2JVH A;  2LR8 A;  1WJB A;  4ZDO A;  2LKP A;  1ORK A;  2ECC A;  3LSI A;  2NOG A;  1WZ2 A;  2WAE A;  4Y52 J;  2X4H A;  2JSC A;  1OPC A;  2E7X A;  5CVR A;  2QEX I;  3BP8 A;  2KP6 A;  4NC7 A;  2DOA A;  3LWF A;  4BE2 A;  1ZEL A;  4A0X A;  3IRQ A;  1CF7 A;  2XPW A;  5K7Z A;  1NHA A;  4RBO A;  1K83 J;  2F2E A;  2XAQ A;  1BW5 A;  5C3E J;  4XIC A;  3GTL J;  2RNJ A;  1GXP A;  3BR3 A;  4I0A A;  1YIT I;  4CO8 A;  3CCE I;  1EH6 A;  1W0U A;  2EZI A;  3JAM Z;  3G1O A;  3TW7 A;  1D5Y A;  1Z7L A;  5HLT A;  3GUD A;  3KCC A;  2ZBK A;  1MND A;  2H1K A;  1FT9 A;  1AKH A;  4Y15 A;  3ZMV A;  1Z1D A;  2ECB A;  2CFX A;  3FIS A;  2R5Z A;  2KDO A;  2CO5 A;  4RM2 A;  3BQY A;  4ETS A;  3NAU A;  1OFC X;  2L7F P;  5HOO A;  1KU9 A;  3ABT A;  3J80 Z;  3DFG A;  3GX4 X;  4PDK A;  1L0O C;  5E20 A;  3LST A;  1ZRE A;  1X3Z B;  1IXS B;  3VEP A;  2DA7 A;  3L2R A;  2W84 A;  1R49 A;  5JLW A;  3O3K A;  1R5H A;  3P9K A;  2QEN A;  3NWT A;  1DPU A;  2BEO A;  3CDL A;  2HI3 A;  2K7L A;  4BY1 J;  3CJQ B;  3C2H A;  2LBF B;  2XIG A;  4JX5 A;  2VPL A;  4KJZ A;  2NVX J;  1B4A A;  2DJN A;  3P9I A;  1FZP B;  5H6R A;  1I3Q J;  3CJR B;  2ZXI A;  1LFP A;  2CQ7 A;  1P2F A;  2Z16 A;  3PSI A;  4QTR A;  2MLK A;  4RM3 A;  3DQV C;  4XOT A;  1MGT A;  5IYD J;  2E5Z A;  1W36 C;  3GFI A;  5DV5 A;  4IX7 A;  1BW6 A;  1RKW A;  1K78 B;  1HKS A;  2JK3 A;  4XN3 A;  1EV7 A;  5KHD A;  1BR1 A;  3U1D A;  4BGD A;  3CCQ I;  2LP0 A;  4BH9 A;  3QOE A;  2VBX A;  1D5V A;  2LFB A;  1IDY A;  1YJ9 I;  3FIW A;  4PK4 A;  1S7A A;  4DYQ A;  5AIQ A;  2BHZ A;  2YU3 A;  2GZW A;  3VYT B;  2QVO A;  1FIP A;  2HQN A;  1IN8 A;  1VQ5 I;  3JRF A;  1YIJ I;  4IEJ A;  1YS6 A;  2RDP A;  2R7X A;  2R7T A;  3O2P E;  4HDU A;  2LLK A;  3HG9 A;  3HUG B;  2K9S A;  4V19 K;  2P5V A;  2Q2E A;  4R1H A;  4LG0 B;  2W4S A;  4UUS B;  1MIJ A;  3ELK A;  5E3M A;  2OJE D;  4WXC A;  4XON A;  3T5X A;  5AIP A;  3R6S A;  1K6O A;  3FX3 A;  1B1B A;  2ZJP F;  4XSZ F;  1BN5 A;  3HPG A;  1SMY F;  3K4K A;  4RA2 A;  4ANJ A;  2FD5 A;  3EET A;  3BCA A;  3W3C A;  3ROU A;  3AL0 B;  1Y0U A;  1XPX A;  1HOM A;  4A2U A;  3BTL A;  3H3Z A;  2LY2 A;  2XGE A;  3Q9V A;  2QKL B;  2Y9Y A;  2FE3 A;  4BYY A;  1H88 C;  1FP2 A;  1HW1 A;  4O5V A;  5J47 A;  2MH9 A;  4J19 A;  3BZK A;  3TBI A;  2F5V A;  1HXD A;  2Q2E B;  1D1A A;  2Z99 A;  4IHW A;  2BXZ A;  2LK2 A;  4E7K A;  1Z67 A;  2A5Y B;  1UG0 A;  4X1E A;  1JT6 A;  2P0W A;  3K70 C;  4RAY A;  4NQW A;  1XC5 A;  2V7F A;  4XSX F;  4F93 B;  1PP7 U;  1A35 A;  4I76 A;  1LB2 A;  4CYC A;  1T38 A;  5FRN A;  2VBY A;  2MBF A;  5BQT A;  2HVS A;  2JTV A;  5F1R A;  5DM7 F;  2M0M A;  1MMA A;  1P4A A;  2CRG A;  4MFD A;  3S32 A;  5JVT A;  2UZK A;  2K9L A;  2ZNY A;  1W4M A;  1GV2 A;  1JT0 A;  3F3X A;  5EZG A;  4B8X A;  4G9Y A;  4Z2Y A;  3SJM A;  5TGT A;  3QPS A;  4YIR X;  4IRH A;  1F4K A;  3E6M A;  2QUF A;  1N78 A;  4BS9 A;  4C2M J;  4DZJ A;  4PCQ A;  1UFM A;  1YX5 A;  2MYS A;  2KHM A;  5DD4 A;  1MBH A;  1YX3 A;  1TZL A;  2A6H F;  3DCF A;  4GYG A;  3V8L A;  3DEE A;  1BJA A;  3GZ5 A;  1Z91 A;  4E7L A;  4E6K G;  3V4G A;  5JHF A;  1H8A C;  2TDX A;  5FFZ A;  4FE4 A;  2O7O A;  2CJJ A;  3E1S A;  2PFB A;  4XK4 A;  4MO7 A;  1K4S A;  1GV5 A;  3HOS A;  2DMN A;  2BXY A;  2KKO A;  5JLX A;  2Z9O A;  1UB9 A;  3K69 A;  1MBJ A;  2Z5U A;  2DFI A;  1D0Y A;  1NG6 A;  5BMZ A;  1YRN A;  2EJR A;  3WTU C;  1V5E A;  1RC9 A;  3RSN A;  2IPQ X;  3QWL A;  1J0R A;  4WWC A;  1SD5 A;  2R7U A;  2QZ8 A;  2DLL A;  4ABZ A;  3EYY A;  3RDI A;  3VFZ A;  3BRO A;  2OUM A;  1RNL A;  4Y7N J;  2VBZ A;  2KZG A;  1PVE A;  2DDA A;  2MAB A;  4OIR F;  4XLN F;  3DPU A;  5CQG A;  2QSF X;  2OCE A;  3HXL A;  1AWC A;  5EG0 B;  3CMA I;  2K9M A;  2ELH A;  4Y3O A;  5EDN A;  1J75 A;  3VYS B;  3H5A A;  2ZFW A;  2QSG X;  2JA7 J;  4KA4 A;  3GTG J;  2DTZ A;  3P9C A;  1T2K A;  1GLN A;  3HOY J;  2GA1 A;  3F72 A;  2E2I J;  2WC2 A;  3A0B C;  1X2N A;  4MFE A;  3M9A A;  4N9I A;  3I4N J;  3MN2 A;  3QPT A;  4UUT A;  1OMI A;  1U8B A;  1PP8 F;  3T8T A;  3K1N A;  1QZE A;  2OPT A;  4MQV A;  5EGO B;  3V8J A;  3ZXS A;  4ENJ A;  2BGC A;  1WKM A;  1BOA A;  3MCZ A;  4M6V A;  2E2H J;  1RI7 A;  3PNY A;  4Q48 A;  1XTA A;  4BAY A;  3OYH A;  4OIP F;  4EV0 A;  1MBF A;  2EIJ H;  3PSF A;  3RIR A;  4WCG A;  2XKO A;  4AUX A;  4RGS A;  2VLA A;  3FXQ A;  1U8R A;  2V9V A;  2HOT A;  3F23 A;  4QPO A;  3M1C A;  3T0Y A;  1VF9 A;  1MD0 A;  5K5O A;  1WJA A;  1IJW C;  2MD5 A;  4XQF A;  2CU7 A;  1EH8 A;  1Z6R A;  4XKV A;  2H8R A;  2HDD A;  4FX0 A;  4BBS J;  2FNA A;  2FUG 2;  2VI6 A;  4GRI A;  5DD8 A;  1QZZ A;  3F8N A;  5ILU A;  4IQJ A;  1N25 A;  2PEX A;  3BJA A;  1V5F A;  2RQQ A;  2Z2S B;  4D7M A;  1BC7 C;  5LRR A;  2PJR A;  4M3F A;  4B09 A;  3PO3 J;  1G59 A;  4ESJ A;  3ML6 A;  3DP7 A;  1MMG A;  3DU6 A;  1UMQ A;  4M6X A;  5K7F A;  3O8G A;  2VQC A;  2J5P A;  2FXA A;  1O3T A;  4EJV A;  4F91 B;  1Y6I A;  3JRD A;  2M9H A;  5F64 A;  1APL C;  3FZV A;  1ZG3 A;  3SFI A;  2XAU A;  4A5N A;  3DWL E;  1WHU A;  3QAH A;  1AOY A;  1X1C A;  1O3S A;  4I0B A;  5D8L B;  1OQY A;  3IHU A;  4UUV A;  1OCP A;  4L9V A;  2F5D A;  3PUB A;  5TJJ A;  2O8K A;  4G7H F;  4CCK A;  2Y31 A;  2GIV A;  4A6E A;  3IH4 A;  4HSR A;  1QA6 A;  1Y8Q B;  1VQO I;  2MC4 A;  4UV9 A;  1B8I B;  3BTI A;  3G73 A;  2ZNZ A;  1XS9 A;  5HLG A;  3R60 A;  2OAZ A;  5FFX A;  3JTH A;  3UNG C;  2DK5 A;  2HVR A;  9ANT A;  1IRG A;  5L3F A;  1XB4 A;  2Y0S A;  1TNT A;  4XBF A;  2CUF A;  3I71 A;  4EJW A;  1S5L C;  2K85 A;  1UEL B;  1VND A;  2PQ8 A;  1Z05 A;  3G6E I;  5HDG A;  3KP7 A;  4UVC A;  3SQN A;  3I59 A;  3JTG A;  1XGN A;  5H6Q A;  4MQ9 F;  2R7R A;  2P7C B;  4WX9 A;  3NQO A;  1EH7 A;  1X1D A;  2F5C A;  2ME0 A;  1R00 A;  2WBM A;  3H1C A;  3VDX A;  1SC7 A;  2L9N A;  1D3Y A;  1Y1W J;  3NEU A;  1G8X A;  1OCT C;  1E3O C;  2K40 A;  4EQQ A;  2DOE A;  3TL4 X;  5K5Q A;  4IVN A;  2KIF A;  3BR0 A;  2V1X A;  1XGO A;  1ETW A;  3RKX A;  1YG2 A;  2UXN A;  4GXO A;  3HC7 A;  1RIO H;  1ZRD A;  3D1N I;  2CYY A;  2RQP A;  1J09 A;  1W7P D;  2L02 A;  2Y0S N;  4ZYG A;  4P1W A;  3BZC A;  3ERM A;  1XCB A;  2W48 A;  2A3S A;  4B3X A;  1DGW Y;  4IF4 A;  4L0Z B;  2RNG A;  1VQN I;  4LLG F;  4Y4R A;  4U0W A;  4ESB A;  2AS5 F;  1DP3 A;  1GXQ A;  2DW4 A;  3OYD A;  3WE2 A;  1XGS A;  3WOD F;  5H2F C;  5D4S A;  3CMM A;  4CCM A;  3RZO J;  5F0H A;  4DGW B;  4H4K C;  2K4B A;  2L7M P;  2DAO A;  1IV6 A;  2P7V B;  2QQ8 A;  3I53 A;  2LH9 A;  3J7Z I;  2ZC2 A;  3LA3 A;  2X48 A;  2M4G A;  4II3 A;  2L4M A;  2K9Q A;  1X3U A;  2ICW G;  1ERD A;  5F04 A;  1RR8 C;  2PJP A;  4XR6 A;  3GYH X;  4PFP A;  1NG7 A;  2QSH X;  2EK5 A;  3AFH A;  4HRI A;  2KPM A;  1WRJ A;  2VON A;  1R22 A;  1Z3Y A;  2IJL A;  4FAS D;  1ZAO A;  5ILS A;  2R7D A;  2MSY A;  3H0D A;  3DV8 A;  2KZV A;  3CCY A;  1YJW I;  2O03 A;  5DCM A;  4CGZ A;  4UB6 C;  1R71 A;  2CG4 A;  3OSF A;  1Y1V J;  2COM A;  3GFJ A;  3F8B A;  3WE3 A;  4HEA 2;  4YG2 F;  1FLI A;  1VQ9 I;  4DJA A;  4FTH A;  5GAD J;  4LMY A;  3HOW J;  2K5C A;  3WTV C;  4CCJ A;  4E4H A;  1I6H J;  1D0X A;  4BXF A;  2QF7 A;  3ZQH A;  2WWY A;  3CUQ A;  4HNT A;  5CYV A;  2D2W A;  3LSM A;  1IF1 A;  2EPF A;  1FOY A;  3TMO A;  3S1Q J;  1X1A A;  1MZB A;  2XUB A;  3A1Y A;  2Z3Y A;  2KMU A;  1WSU A;  2JSP A;  1VTN C;  2XPV A;  2BHY A;  3E7L A;  2EV0 A;  4JYK A;  3LMM A;  3CC7 I;  4CSW A;  2A07 F;  4M71 A;  2XF7 A;  3JR9 A;  2R7O A;  4GCV A;  4X6A J;  5CPR B;  4JBA A;  4Q4Z F;  1D1C A;  4JOM A;  2NS8 A;  2LNB A;  2HPM A;  1S29 A;  1A6I A;  1KQ9 A;  3OMY A;  1UHM A;  5L3B A;  2OTL I;  3GTJ J;  1XMK A;  2E60 A;  1PYV A;  4N9H A;  1BBY A;  2G7U A;  1UST A;  4GFB A;  3QYE A;  4OMZ A;  2XHK A;  2AHQ A;  5FGM A;  4OMY A;  4AC0 A;  1S6L A;  2K27 A;  3HM5 A;  4A3F J;  2L01 A;  4KUM A;  2IA2 A;  2CW8 A;  5KAF C;  3OYE A;  5FLX K;  2ZME B;  5FD5 A;  2BVM A;  2DA5 A;  3M4O J;  3B02 A;  1W0T A;  5HNH A;  3S14 J;  5J6X A;  5F1J A;  2GBY A;  1L3L A;  2GWR A;  1HKQ A;  2DQR A;  4HDV A;  3ZQ7 A;  4RGX A;  1O3Q A;  1KYW A;  1TW2 A;  2DYR H;  3GBG A;  3LSG A;  4B44 A;  3PIO F;  4A5M A;  3QYF A;  3CMY A;  3JW4 A;  3BG7 A;  2M8E A;  4KYW A;  2FEZ A;  4ZTF A;  3CC4 I;  1T8I A;  3CCL I;  2XAJ A;  2AO9 A;  3ZP5 A;  1I1G A;  2OF7 A;  3KE2 A;  5KVR A;  1VQ4 I;  3DEU A;  2DFE A;  4LB6 B;  4U0Y A;  1BIB A;  1V5G A;  2GOM A;  3Q0U A;  3SDB A;  2Q8K A;  5KK1 A;  5HOD A;  3OSG A;  1PDN C;  1YO5 C;  4FET A;  2B0L A;  4O6J A;  2HQA A;  3V7C A;  3ZQC A;  1O3R A;  4HST A;  2R5Y B;  1YE9 A;  3QPH A;  1N75 A;  2FX0 A;  2JN6 A;  4XNF A;  5B5E C;  1WI9 A;  1JTY A;  1ZYR F;  1G3S A;  2WAD A;  1G3T A;  3GFM A;  4G8X A;  4M9S A;  3DBH B;  2L2O A;  4JQF A;  2ZJR F;  1XSD A;  4A69 C;  1B59 A;  1H9G A;  4M72 A;  3RYP A;  3OIO A;  1T98 A;  2CFO A;  2HZD A;  3J7A Y;  1P7J A;  4NBQ A;  4YRV A;  1IDZ A;  3G3Z A;  2H09 A;  3ZMS A;  1ZN2 A;  2MH2 A;  2LY9 A;  2MLG A;  3F0C A;  3I55 I;  1QPI A;  4BNC A;  1HDP A;  1BI1 A;  2GXA A;  3BLY A;  2STT A;  2X0L A;  3RTR A;  2GA2 A;  3GLL A;  1UJ8 A;  1E17 A;  3ECH A;  4M3E A;  1DQU A;  3JRE A;  2ESN A;  3EQL F;  3CQZ J;  2XF5 A;  2IBD A;  3OOU A;  4XL9 A;  3GTP J;  2XAS A;  1UHW A;  2W57 A;  5D5W B;  1JGG A;  2V1U A;  4P55 A;  2V9P A;  5LGT A;  1B72 B;  3CO6 C;  3I54 A;  5ILV A;  2GM4 A;  2VN2 A;  5E1W A;  4I7H A;  4M74 A;  5KNL A;  1QVU A;  3MKY B;  3SZG A;  4CCO A;  2DMQ A;  2W1O A;  4IOC F;  3N05 A;  1ZGW A;  3LSJ A;  2HOA A;  2VXD A;  3N97 A;  5FKM A;  2BYV E;  2F6C A;  2KLO A;  3DTK A;  2UXX A;  1Q1V A;  3M8E A;  5JR3 A;  1TP4 A;  1JHF A;  2WAF A;  3I9V 2;  4MEX F;  2MW8 A;  1PJR A;  4Y17 A;  5CLS A;  5HDK A;  5IT9 K;  3IKT A;  3ERE D;  4YFN F;  1XN7 A;  2HNH A;  4LOC A;  3JRI A;  2ZXJ A;  4IZZ A;  5C4X J;  3C3W A;  2B7E A;  2RKH A;  4H0E A;  1JE8 A;  3SYT A;  2HOE A;  3DBL B;  1Y56 A;  2R7F A;  1Z3X A;  3P7N A;  5M5Y J;  4CZC A;  2RV8 A;  4HW0 A;  2JA2 A;  3FXO A;  4OOI A;  4XOR A;  1ZTR A;  2A5W A;  3C2G A;  1OR7 C;  4ZYD A;  2EA4 A;  4K2E A;  3BG5 A;  4ZZL A;  2ELJ A;  2L0K A;  3F9K A;  4UXN A;  4I98 B;  2FSW A;  1S7E A;  3L2W A;  1YJN I;  3VSL A;  1K79 A;  1Y39 A;  2OZ6 A;  3M1E A;  3GME A;  4ITV A;  1NK3 P;  5GTI C;  4BJ6 C;  5HDN A;  5C4J J;  5B1B H;  5K5R A;  2LTP A;  2CWE A;  3WU0 A;  1CF7 B;  4FX4 A;  2FF4 A;  1EA3 A;  2LSO A;  5IPA A;  1HW2 A;  2ZFU A;  4ENN A;  2YS9 A;  4WXH A;  3TO9 A;  2DU9 A;  3WG7 H;  3K1M A;  3CDH A;  1ZQ3 P;  2FBI A;  2FU4 A;  5BS6 A;  3JRC A;  2Y69 H;  3V7R A;  5F08 A;  2BY1 A;  4BE0 A;  2HYF A;  3LA7 A;  3MD2 A;  2RGV A;  3G2B A;  3IRR A;  4LD5 A;  2CGP A;  2HVQ A;  2OU2 A;  2QWW A;  3HB9 A;  4E7H A;  1AKH B;  3S1R J;  4Q5S F;  2R5Z B;  2O6G E;  1YS7 A;  2XKP A;  2E7W A;  3RQ4 A;  2Z1D A;  2VOO A;  3TGN A;  4KIS A;  1I1S A;  4HZF A;  3VPR A;  2W24 A;  3S3O A;  5CVU A;  3I3L A;  3K4J A;  2VIX A;  1BM9 A;  3O6B B;  2IA0 A;  4DNC A;  4IHV A;  3HYI A;  3HPH A;  5BOX A;  2R93 J;  3ABL H;  2KRC A;  2XGD A;  2HKX A;  3GWZ A;  3OYK A;  1PUF A;  3DPT A;  2FJ1 A;  2VKV A;  3CUO A;  4XLP F;  1QHH D;  5IOY A;  3LOC A;  3CDI A;  2HR3 A;  2Q0O A;  2QBY A;  3CD6 I;  1VZ0 A;  4HV6 A;  3GFL A;  2YX4 A;  3CC2 I;  2FOK A;  4DQ2 A;  1V3F A;  4MHG A;  2A6E F;  2LD5 A;  4U7D A;  1P7I A;  2LY1 A;  3JCU C;  3HTS B;  1O57 A;  1OCZ H;  2VC0 A;  2VE8 A;  2VJI A;  3FMQ A;  2EFN A;  1KU3 A;  1YIO A;  3IKV A;  3J81 Z;  2NS7 A;  3I5U A;  1ZRC A;  1XMX A;  1LDD A;  4I99 C;  4B3A A;  5D6F A;  1TT0 A;  3KEQ A;  3WTZ A;  3M3Y J;  5J4V A;  4ZYA A;  2M30 A;  4XMY A;  2ISY A;  1IN4 A;  2VXZ A;  2LOO A;  3C18 A;  4IQ4 A;  2HWV A;  3BOQ A;  3IV5 A;  1PUF B;  1WGX A;  1T33 A;  3ASN H;  2CUE A;  4G94 A;  1FIA A;  4R79 A;  5DCF A;  4IL6 C;  5DTD A;  4DBR A;  4IHY A;  1O7F A;  2WAQ N;  3HHH A;  4BHP A;  1TWA J;  1ZK8 A;  2CMP A;  2H6B A;  3SEQ A;  2DFH A;  5FKL A;  3F6V A;  3GW2 A;  3FMS A;  3CCJ I;  1DUX C;  1IUF A;  3JAM K;  5L3C A;  4CUG A;  3IAS 2;  5FKK A;  4E7Z A;  3PM1 A;  3GVA A;  1D8K A;  4II2 A;  2DOF A;  5HS8 A;  1ZGJ A;  3A0H C;  1LVK A;  4RMN A;  4BL0 B;  2KQR A;  3BY6 A;  3BT9 A;  1ETY A;  2K4J A;  5BNG A;  1LPQ A;  2KDZ A;  3KZI C;  3V42 A;  1SVL A;  1LE8 A;  1J7K A;  4DW6 A;  2K9N A;  1BI2 A;  3A01 A;  2G9W A;  2E1M C;  3N4M A;  2NOJ B;  1U5T A;  2XGX A;  3OL4 A;  1WJE A;  3X2Q H;  5FLV A;  3S1N J;  2HYG D;  2XV4 S;  5A2Q Z;  3QU3 A;  2UWM A;  2D1V A;  1J5Y A;  5D5X B;  4C9Y A;  1CGP A;  3L2U A;  2HXO A;  1IO2 A;  1FOW A;  2P81 A;  1FNN A;  3LFU A;  3DLA A;  2A6T A;  3BR5 A;  3K2Z A;  4RLQ A;  4N4O B;  4RB1 A;  4XM3 A;  3RJP A;  2VT3 A;  2M7A A;  4NUB A;  3L7W A;  4NQW B;  1FYL A;  1Z77 A;  2DXI A;  2CQQ A;  3CF2 A;  3CUQ C;  1LE8 B;  4CYC B;  3OYL A;  2CV2 A;  4MLO A;  1IV8 A;  4MNU A;  3K6G A;  3HKZ N;  3TP3 A;  2D45 A;  1ZHF A;  2OD5 A;  2VKD A;  3AG3 H;  4F3Q A;  2EFP A;  3IP4 B;  4QPQ A;  2X85 A;  2K02 A;  1WJD A;  4I2O A;  2VOP A;  4CCL A;  2NYX A;  2FOW A;  3VYU B;  4FT8 A;  6PAX A;  1JUS A;  4ZDP A;  4C2T A;  3S15 J;  1SD7 A;  4BBR J;  3KP5 A;  4MEY F;  3HZJ A;  3MVP A;  2IVM A;  3BR6 A;  3ESW B;  4UV8 A;  1B9N A;  2E5N A;  3ZQL A;  4CYD A;  1M1E B;  1GDT A;  3HOT A;  2NVU B;  4M3B A;  2X6W A;  4BUP A;  3WG9 A;  1KA8 A;  3S2D J;  2FBH A;  4D0P A;  2HDC A;  1HST A;  2E1C A;  2EIM H;  1EKE A;  2IGK A;  3A02 A;  3HL2 A;  1VQ8 I;  4B4C A;  2XVC A;  3GCM A;  3LSR A;  4PJJ A;  1KYZ A;  3Q9S A;  2ZO4 A;  1FOK A;  2ZXW H;  3MQ0 A;  1Z6T A;  1R4M B;  2KIM A;  1YRN B;  1LNW A;  4ZH4 F;  4RB3 C;  3ISP A;  3HSF A;  4NC8 A;  5EF6 A;  1R36 A;  4AYB N;  3FXJ A;  1MH4 A;  1D0Z A;  2EH3 A;  2IAI A;  3ZN1 A;  1TQI A;  2CW7 A;  1F9N A;  1WVR A;  3LAJ A;  4JX6 A;  1U78 A;  2A61 A;  4L9N A;  3ABU A;  4CA0 A;  4Z6Y A;  1GVD A;  1P6R A;  2BW3 A;  3ZQG A;  4EVI A;  5L3E A;  4P5O A;  5IY5 H;  3CO7 C;  4IXA A;  1QPM A;  2BVL A;  1ON1 A;  4EEF G;  4MTD A;  3RKQ A;  3HOU J;  2W7N A;  5TIS C;  1Z9C A;  4J01 A;  3F6O A;  1RES A;  3K4B A;  4AVZ A;  2LYC A;  2DFF A;  2ZXH A;  3NRV A;  4CH7 A;  3PIP F;  3VOD A;  1MBE A;  1OR7 A;  1HLV A;  2B63 J;  2A69 F;  4X0G A;  1UAA A;  2EQR A;  4OAZ A;  4XRS G;  2JT1 A;  2PX9 A;  4QLC U;  3COA C;  2QQB A;  2XSD C;  2STW A;  2R7Z J;  1YW7 A;  3FK7 A;  3CJT B;  3QPL A;  2RAE A;  2VKE A;  4HBL A;  1IRX A;  4RLF A;  5M5X J;  1TL8 A;  2V79 A;  2CQN A;  3W2V A;  3A4C A;  2P5L C;  3RPU D;  1SFO J;  1FSE A;  4YIF A;  1MDM A;  4BHB A;  2H94 A;  5IOZ A;  1TWH J;  2LRD A;  4QWQ A;  2LC2 A;  1FBS A;  3ABM H;  5EEH A;  5M3M J;  3FXL A;  1LDK B;  2CUZ A;  2FQ4 A;  1YI2 I;  1UCR A;  2EV6 A;  2HKO A;  1WQ2 A;  4LGW A;  5ICE A;  4PJL A;  4DOZ A;  3CCS I;  4C3I J;  3LQR A;  2ID3 A;  1FEX A;  2DDB A;  1VQ6 I;  2A68 F;  2R3S A;  1MBK A;  1XG1 A;  5GAE J;  3C7J A;  3MZH A;  2JWT A;  3ZQQ A;  2M0C A;  2HS5 A;  3OL3 A;  1MDM B;  2M7B A;  3FBI B;  3JRH A;  1XSV A;  3EPZ A;  4KDP A;  1TQP A;  1SFX A;  2PJR B;  3LSH A;  5L3D A;  2FML A;  2HOS A;  2JUC A;  3QOP A;  1FP1 D;  1A04 A;  5J1U A;  3W2A A;  5CKT A;  3WTS C;  2QGU A;  1FBQ A;  5FLM J;  3WTT C;  2ADU A;  4EMS A;  1XX5 A;  3LSK A;  3HOX J;  2DO7 A;  4BAC A;  2R4G A;  5ICC A;  2V6E A;  5E3N A;  3FM5 A;  3A2K A;  3MKL A;  2HXI A;  3FXU A;  3K4N A;  2J5O A;  3OOP A;  3I56 I;  1VQ7 I;  2LMD A;  4PGH A;  3ZMU A;  2D5V A;  3OYA A;  4HYE A;  3ZN0 A;  2IS2 A;  1ETV A;  3FK6 A;  4C2U A;  3TKY A;  3KYL A;  2KRF A;  4BHC A;  4YEL A;  2L9R A;  3TQN A;  1C0W A;  4A6D A;  3DEW A;  2FNP A;  4B47 A;  4PJN A;  4BXX J;  3KP2 A;  2P4W A;  4AD9 A;  3LFK A;  3HDD A;  4B1R A;  3CZ6 A;  4IRI A;  1WH5 A;  1X1B A;  3LAP A;  5FJ8 J;  2E1N A;  1KQ8 A;  3MEX A;  4FHT A;  2TRT A;  4V2F A;  1ULY A;  4A12 A;  2JA6 J;  3Q0V A;  3F8C A;  3E5Q A;  4RB2 C;  1BIA A;  1YTY A;  1Y0N A;  2KRH A;  3PFY A;  2P6S A;  3H35 A;  3I59 B;  4WF2 A;  3R0J A;  1BR4 A;  1P92 A;  2RC4 A;  1GT0 C;  1HCR A;  1MW7 A;  3I4P A;  3WGI A;  3B73 A;  5E17 F;  3OYN A;  4G7O F;  2BBY A;  1S72 I;  5FRM A;  1R1V A;  1MNE A;  3HIF A;  2M34 A;  3VYR B;  5JHU A;  3K10 A;  2W00 A;  3K4L A;  4EM1 A;  5LEJ A;  4IHS A;  1BI0 A;  2GAU A;  3VB2 A;  1VFC A;  4HX8 A;  3TED A;  4A3K J;  5TRD A;  2CUJ A;  5CQE A;  2JQ7 A;  2M2E A;  4HAM A;  1WPK A;  4F52 A;  1J2X A;  1SAN A;  3OIP A;  4KN4 X;  4BXU A;  4MIM A;  5LD2 C;  3V8K A;  4A0Y A;  1MJA A;  2QYO A;  3UKG A;  2ZKZ A;  1LFU P;  3BPX A;  1W5T A;  4AU7 A;  5LBQ A;  4I01 A;  4KMF A;  3W2W A;  4U0V A;  4M3G A;  3KP3 A;  2H27 A;  1ODD A;  4G6D A;  1REP C;  1BR2 A;  3DTI A;  1VQK I;  3HRU A;  2P8T A;  1OYY A;  3PNT A;  3L2Q A;  3KP6 A;  1FYK A;  4HF1 A;  2DN0 A;  1V54 H;  1A36 A;  2DMU A;  1LUJ B;  2WY7 Q;  5LRS A;  4ZZD A;  1KU2 A;  2O0Y A;  2HDW A;  2ME6 A;  1N77 A;  4NB5 A;  1X19 A;  4PJ0 C;  1ETQ A;  2KIU A;  5DM6 F;  1IUY A;  2RVC A;  1HDD C;  1OKR A;  4ZJZ A;  2TCT A;  3GO5 A;  3WU1 B;  5DCM B;  5FB2 A;  2EFQ A;  1TWC J;  2YR2 A;  2LF7 A;  1G6N A;  3BR2 A;  1MSF C;  1KZH A;  3WHC A;  1JKR C;  2XAF A;  2AQE A;  2NS0 A;  5LHH A;  4BEH A;  3WU2 C;  1X4P A;  4EJT A;  3AL0 C;  1OYI A;  5JVG F;  1G3Y A;  5LGU A;  4RS8 A;  2IGM A;  5EJC A;  5BPD A;  1SAU A;  2E35 A;  4ZC3 A;  4LB5 A;  1ITY A;  2KFD A;  3RCO A;  3BJO A;  5GPC A;  1HSJ A;  1I5Z A;  5J4Y A;  2F5E A;  3A03 A;  3CUQ B;  1U3E M;  4BJ5 C;  1S9H A;  2LVS A;  4LLN A;  3DTE A;  4B48 A;  2CS3 A;  3BCB A;  2OTJ I;  2ZJ2 A;  1SVO A;  1XDS A;  1I27 A;  2JZY A;  1E3P A;  4MGR A;  1R9T J;  2IGN A;  1O7L A;  1W1W E;  1JJ8 C;  3D5L A;  4FQG A;  1W7P A;  1AA7 A;  1OLT A;  3LNQ A;  1U2W A;  2XRO A;  4RAG A;  3CLQ A;  4RGR A;  5ED4 A;  1MMN A;  2DBB A;  1QVT A;  3G1L A;  4FCY A;  1W5C C;  1LEB A;  4ENK A;  1KON A;  1U5T C;  4ZYE A;  4L9T A;  2IW5 A;  3QOD A;  1YFH A;  4G12 A;  1EJ9 A;  5AON A;  4HLX A;  1X3W B;  1Z7U A;  2JUG A;  2R7Q A;  4EM0 B;  4ZTJ A;  2L5Q A;  2PMZ N;  2OQG A;  3HRT A;  2NVQ J;  1ZKG A;  1E0E A;  1RKT A;  4M3D A;  2Y30 A;  3K7A J;  5GAG J;  4F55 A;  3BG6 A;  1D8J A;  1B6A A;  4XLA A;  1WWX A;  2JJ7 A;  4L18 B;  2OA4 A;  3JRA A;  1UHS A;  4NNJ A;  1F1Z A;  4OWR B;  1UG2 A;  1JHH A;  3V7S A;  5JFR A;  1HC8 A;  2HU9 A;  2X1D A;  2Y48 A;  4OIN F;  3KX2 A;  1G4D A;  2PMU A;  2OBP A;  3QQA A;  4XLF A;  1FBU A;  3EUA A;  3H9Q A;  3MZY A;  1A5J A;  1T0F C;  2IEK A;  4KIC A;  2NXN B;  1JGS A;  3O8H A;  3FWE A;  3GEZ A;  2NNY A;  3TO6 A;  1IXC A;  3E6D A;  4O3M A;  5ERI A;  5D6E A;  3DXJ F;  1P4X A;  2X6X A;  3AAF A;  3HGG A;  3QU6 A;  4UNO A;  1Q1H A;  1H9T A;  2MFZ A;  2DT5 A;  4U88 A;  2HGC A;  3BWG A;  3HSR A;  3U1K A;  2DMP A;  1LJ9 A;  2L7Z A;  3IH2 A;  4XRM A;  2VE9 A;  3IC7 A;  1TBX A;  2K3F A;  4PSW A;  3KZZ A;  2KIS A;  3SDG A;  4NC6 A;  1R5G A;  2OV7 A;  3M8J A;  2X6Y A;  2JPC A;  2F4M B;  3G4S I;  3NAR A;  5K7H A;  2VQG A;  3T8R A;  3QYB A;  1S8N A;  5IYB J;  3OY9 A;  1KQ0 A;  2LDU A;  1O4X A;  1TWG J;  4ZDL A;  1TLH B;  4P96 A;  4DBQ A;  2DT6 A;  2I10 A;  1TNS A;  2VBW A;  1T95 A;  4CZZ A;  4F92 B;  1IRF A;  3BC8 A;  5J8F A;  4IRG A;  3OYJ A;  4PUS A;  3ULQ B;  3E0J B;  1IXR C;  5DYM A;  4EAT A;  1QNT A;  3G71 I;  2EWN A;  2I5U A;  1Z21 A;  1F43 A;  4P9U A;  1ZR2 A;  3H0G J;  3OYB A;  1HBX G;  2K86 A;  3S17 J;  2FMY A;  4XOP A;  4Q47 A;  5HVQ C;  5LEK A;  5J40 A;  5J1R A;  5F27 A;  2DI3 A;  3BPV A;  2XF6 A;  4XID A;  3FDY A;  1GVJ A;  2UV1 A;  1LEA A;  2YSR A;  1LDJ A;  2G0E A;  1H89 C;  4EM2 A;  3BTC A;  1K6Y A;  2HTS A;  4GYI A;  3S8P A;  3VWB A;  1OCO H;  4RAZ A;  3K0L A;  3S16 J;  5EZH A;  1ONV A;  4NHJ A;  2JVG A;  3LA2 A;  3MFK A;  1J59 A;  2IA1 A;  1ZLJ A;  4A3E J;  3LL7 A;  1FX7 A;  3SEZ A;  1FOX A;  2OQR A; 
#chains in the Genus database with same CATH homology
 2Y0S A;  2LBF A;  2OC6 A;  4BDY A;  2AQF A;  2VKD A;  4F3Q A;  1WJC A;  1D1B A;  3IP4 B;  4QPQ A;  2X85 A;  4XLH A;  1UEL B;  1SFK A;  1WJD A;  3OWT A;  2VJ5 A;  3OYM A;  4CCL A;  4HPQ A;  3VYU B;  3OYC A;  1U0J A;  1WJ5 A;  3FKJ A;  4ZDP A;  4C2T A;  4Y33 A;  2QKM B;  3OYF A;  2R7R A;  2BOL A;  1X1D A;  2E5N A;  2WBM A;  3VDX A;  2MD0 A;  2IXS A;  2L9N A;  2RRE A;  3S3M A;  3HOT A;  1G8X A;  2ZSH B;  3OYG A;  2X6W A;  4BUP A;  3D5S C;  4XKB A;  3TL4 X;  2WAQ A;  3DU5 A;  3CP2 A;  3H9G A;  2X1E A;  3HL2 A;  2IGK A;  3UR3 C;  3HC7 A;  2GOX B;  4PJJ A;  2VKH A;  4PSX A;  4IKF A;  1J09 A;  2WA0 A;  4P1W A;  3VSK A;  4N4N B;  4E7I A;  4NC8 A;  4B3X A;  1DGW Y;  2CV1 A;  4U7B A;  2RNG A;  4PFO A;  1D0Z A;  4Y4R A;  2CW7 A;  1DP3 A;  3ZR8 X;  3OYD A;  3EUK L;  2F4I A;  4CCN A;  3CMM A;  4CA0 A;  2BW3 A;  2L7K A;  4CCM A;  2DT7 B;  2O5R A;  4DGW B;  4H4K C;  4P5O A;  3IAM 2;  2M3A A;  4LIU A;  2BVL A;  2LH9 A;  2VL8 A;  2W7N A;  5KCM A;  2M4G A;  4II3 A;  4J01 A;  4D9J A;  1ERD A;  2IS6 A;  3K4B A;  4AVZ A;  4XR6 A;  2LYC A;  2ZXH A;  4CH7 A;  1JI8 A;  4PFP A;  1NG7 A;  3U21 A;  3AFH A;  4HRI A;  2XC7 A;  2WY8 Q;  2KPM A;  3H9J A;  4X0G A;  3OYI A;  1Z3Y A;  4B43 A;  4OAZ A;  1UAA A;  4FAS D;  2DJI A;  4OAY A;  3H0D A;  4LG3 A;  2KZV A;  2X1C A;  1IRX A;  2VQL A;  4RLF A;  2R7S A;  1X4O A;  4C30 A;  3S3N A;  3W2V A;  3A4C A;  3RPU D;  4HEA 2;  4BQQ A;  4KIT B;  3MKZ A;  4E7S A;  4DJA A;  2HPI A;  3HKZ A;  2VQH A;  1FMW A;  2JVH A;  2LRD A;  1WJB A;  3NWS A;  4ZDO A;  2K5C A;  2LC2 A;  4CCJ A;  4HG2 A;  3AKZ A;  3LSI A;  4E4H A;  1D0X A;  2WAE A;  4BXF A;  1LDK B;  2CUZ A;  4HNT A;  3LSM A;  3TMO A;  2KP6 A;  4NC7 A;  1X1A A;  2DOA A;  4PJL A;  4DOZ A;  3A1Y A;  4BJT A;  4BE2 A;  2KMU A;  1ZEL A;  2JSP A;  2XSJ C;  3LMM A;  4CSW A;  3ZQQ A;  2XF7 A;  3OL3 A;  2R7O A;  2M7B A;  3FBI B;  5CPR B;  5LFA A;  3EPZ A;  2PJR B;  3LSH A;  1D1C A;  4JOM A;  2HPM A;  3W2A A;  5CKT A;  3OMY A;  3K4C A;  2E60 A;  1PYV A;  3LSK A;  1Z7L A;  5HLT A;  4BAC A;  2R4G A;  2V6E A;  1MND A;  3CES A;  3QYE A;  3A2K A;  3K4N A;  4AYB A;  2KDO A;  4RM2 A;  1LKX A;  2CW8 A;  3OYE A;  2BVM A;  3CP8 A;  3OYA A;  5HOO A;  4XLC A;  5HNH A;  2IS2 A;  2K3P A;  4C2U A;  3KYL A;  4PJM A;  4YEL A;  3L2R A;  4B47 A;  4BE1 A;  2V26 A;  4PJN A;  3GBG A;  3LSG A;  4G6T B;  3NWT A;  4B44 A;  3QYF A;  3BG7 A;  3CJQ B;  3C2H A;  3OR2 C;  2LBF B;  4ZTF A;  3CZ6 A;  1BOB A;  2WB1 A;  2VPL A;  1X1B A;  4KJZ A;  3CJR B;  2ZXI A;  1LFP A;  2KRH A;  2V9K A;  3PFY A;  3IUO A;  3OR1 C;  3D5R C;  3H35 A;  2Z16 A;  1V5G A;  2GOM A;  3PSI A;  3S93 A;  3SDB A;  1BR4 A;  4RM3 A;  4FET A;  3DQV C;  4XOT A;  3FHN A;  2HQA A;  4HST A;  2E5Z A;  1YE9 A;  1MW7 A;  1W36 C;  1N75 A;  3DKX A;  4IX7 A;  4XNF A;  1W36 D;  3OYN A;  4XKW A;  5FRM A;  2WAD A;  1MNE A;  4XN3 A;  3VYR B;  5KHD A;  1BR1 A;  3K10 A;  2L2O A;  2W00 A;  4JQF A;  4BGD A;  3K4L A;  3H5R A;  3QOE A;  2CFO A;  3J7A Y;  2HZD A;  3FBN B;  4YRV A;  2DCE A;  2CUJ A;  4PK4 A;  5CQE A;  4F52 A;  3OIP A;  3BLY A;  3EUH C;  4J00 A;  5LD2 C;  3VYT B;  3RTR A;  2W82 A;  1DQU A;  2V4J C;  2IS1 A;  2Q1Z B;  2R7X A;  2XF5 A;  4AU7 A;  3OOU A;  2R7T A;  4XL9 A;  2M4K A;  3W2W A;  3HUG B;  3HG9 A;  1BR2 A;  3DTI A;  4BDZ A;  2W4S A;  2BW3 B;  3PNT A;  3L2Q A;  4XON A;  2R7V A;  5KNL A;  3MKY B;  3SZG A;  4CCO A;  2W1O A;  3N05 A;  2VXD A;  2WY7 Q;  3HPG A;  5FRO A;  3K4K A;  4ANJ A;  2HDW A;  2F6C A;  2KLO A;  3DTK A;  3BCA A;  3W3C A;  1N77 A;  3AL0 B;  1X19 A;  3DKY A;  4XLE A;  1HA8 A;  2WAF A;  2LY2 A;  3I9V 2;  2QKL B;  3H5N A;  1PJR A;  3ZGK A;  4E7J A;  2HNH A;  2XDV A;  4IZZ A;  4ZJZ A;  3TBI A;  2F5V A;  2Q2E B;  1D1A A;  3SYT A;  4HNU A;  1Y56 A;  2AQE A;  4BU2 A;  4E7K A;  1UG0 A;  4BEH A;  1Z3X A;  1X4P A;  2P0W A;  3K70 C;  2VAS A;  3AL0 C;  2V7F A;  3K4M A;  4CZC A;  4F93 B;  3K70 D;  2JA2 A;  1QHG A;  4XOR A;  2A5W A;  3C2G A;  1WJF A;  1OR7 C;  2R7W A;  5FRN A;  3PL8 A;  2V1N A;  2IGM A;  1SAU A;  4ZC3 A;  2HVS A;  2ELJ A;  3F9K A;  2M0M A;  1MMA A;  3RCO A;  3PJR A;  3S32 A;  3L2W A;  2K9L A;  3VSL A;  3L2V A;  4BJ5 C;  3ZCO A;  4ITV A;  1S9H A;  4BJ6 C;  3DTE A;  4B48 A;  2CS3 A;  1FMV A;  3BCB A;  5TGT A;  1N78 A;  2IGN A;  1EA3 A;  2ZSI B;  3D5L A;  4BS9 A;  2ZFU A;  1YX5 A;  2MYS A;  2KHM A;  1YX3 A;  1TZL A;  1AA7 A;  1OLT A;  3DEE A;  2CV0 A;  2IS4 A;  1MMN A;  2UUZ A;  4E7L A;  4E6K G;  1P9Q C;  5JHF A;  1KON A;  4BE0 A;  3QOD A;  4XN0 A;  3MKW B;  1DGR M;  2JUG A;  2R7Q A;  3E1S A;  3MD2 A;  3G2B A;  3HOS A;  2L5Q A;  4ZTJ A;  3OS2 A;  1E0E A;  2LRE A;  2HVQ A;  4E7H A;  2VJJ A;  1D0Y A;  1NG6 A;  4F55 A;  3BG6 A;  4XLA A;  4BQO A;  1V5E A;  3DPL C;  2VB6 A;  3RSN A;  1WFX A;  3RQ4 A;  2LG4 A;  2Z1D A;  1R6R A;  4NNJ A;  4KIS A;  4LIT A;  4OWR B;  2CH0 A;  2R7U A;  3S3O A;  3I3L A;  3K4J A;  2VIX A;  2OUM A;  2HU9 A;  2MAB A;  5HNF A;  2X1D A;  3DPU A;  5CQG A;  3HXL A;  3ZRG A;  3KX2 A;  3HPH A;  2K9M A;  4LIV A;  2KRC A;  1MMD A;  4XLF A;  4Y3O A;  3EUA A;  3H9Q A;  3OYK A;  1T0F C;  3DPT A;  1QHH D;  4D1Q A;  3VYS B;  2X51 A;  3H5A A;  3OS1 A;  3KEY A;  1VZ0 A;  2IGO A;  1GLN A;  3OIQ A;  2X6X A;  2LY1 A;  4KT6 A;  2VJI A;  2MFZ A;  1TT0 A;  4ZYA A;  4XMY A;  4PSW A;  2VXZ A;  2LOO A;  4IQ4 A;  3ZXS A;  2OV7 A;  3M8J A;  2VJ4 A;  2X6Y A;  4BQN A;  3PNY A;  3OYH A;  4R79 A;  2VQG A;  3QYB A;  4DBR A;  3OY9 A;  3PSF A;  3OS0 A;  2CMP A;  4ZDL A;  2VLA A;  3SEQ A;  2L9S A;  4DBQ A;  4XKC A;  2DT6 A;  4QPO A;  3M1C A;  3ONQ A;  1T95 A;  4F92 B;  1WJA A;  3BC8 A;  2E1M B;  4XQF A;  4CUG A;  3IAS 2;  3OYJ A;  4PUS A;  4XKV A;  3E0J B;  4E7Z A;  4EAT A;  2FUG 2;  4GRI A;  4IQJ A;  1Z21 A;  4II2 A;  1LVK A;  4RMN A;  2Z2S B;  1V5F A;  2RQQ A;  2KQR A;  4BL0 B;  2I8D A;  2PJR A;  1G59 A;  2KL4 A;  3OYB A;  2PMZ A;  3V42 A;  1MMG A;  3PNV A;  3DU6 A;  2VQC A;  2E1M C;  4XOP A;  4DIQ A;  2NOJ B;  3OL4 A;  4F91 B;  4YEJ A;  1WJE A;  1Y6I A;  5HVQ C;  2XF6 A;  2XAU A;  3FDY A;  2UV1 A;  3DWL E;  2UWM A;  4C9Y A;  1X1C A;  3L2U A;  1K6Y A;  3LFU A;  3S8P A;  3VWB A;  3PUB A;  3DLA A;  2A6T A;  4CCK A;  4RLQ A;  4N4O B;  4BEH B;  4HSR A;  4XM3 A;  2JVG A;  2MC4 A;  2M7A A;  4NUB A;  4NQW B;  2DXI A;  1QU3 A;  4U87 A;  3MMY B;  3CF2 A;  2CV2 A;  3OYL A;  3LL7 A;  4MLO A;  3SEZ A;  3UNG C;  2HVR A;  3K6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...