2VXDA

The structure of the c-terminal domain of nucleophosmin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
54
structure length
54
Chain Sequence
GGSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Consequences of Nucleophosmin Mutations in Acute Myeloid Leukemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
molecule keywords NUCLEOPHOSMIN
total genus 15
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2008-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16276 NPM1-C Nucleophosmin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vxdA00
2VXDA
chains in the Genus database with same CATH superfamily
4UUSA 4M6VA 3ABUA 2XV4S 3F8FA 3T8RA 1B1BA 3CLOA 2LSOA 3OYHA 1XSVA 2CW7A 4LJZF 1IUFA 3CMEI 3R4KA 4HBLA 1NG7A 2E1CA 4BY1J 3KZIC 3X2QH 1JGGA 4F55A 4LB6B 3RPUD 4FX0A 2NVUB 1X1PA 1T8IA 4E4HA 2VOPA 1XSDA 3BROA 1FP2A 1X1AA 1R49A 2H1KA 4C2UA 1ETQA 2MLGA 2QA4I 1CQTA 5H6RA 3DBHB 3ZMTA 2BZTA 4PFPA 1L3LA 4C30A 3Q0UA 3OYBA 3EYIA 1I3AA 2RKHA 3CJNA 3JRFA 2WY7Q 1LJ9A 1U9OA 3HEFA 1R9TJ 2R7VA 2YUSA 4L9JA 3JRCA 4BKXA 2ZNYA 5GADJ 4L5JA 4BBRJ 2MC4A 4XNFA 4HLXA 4BYYA 3W2VA 2G7HA 2DA1A 4Y4RA 1ETKA 3ABTA 2GIZA 2PN6A 3ZR8X 2VJ5A 2VKDA 3IP4B 4S04A 4AU7A 5LRSA 2NVXJ 4Z6YA 4AYBA 2NYXA 1LDDA 4HW0A 4Q47A 4KIGA 4C3HJ 1IXSB 4AM3A 4CYDA 3GO5A 3NWTA 1YJWI 4KN4X 4YEJA 2Q1ZB 4I98B 5HLGA 1YG2A 4C3JJ 1GV5A 5F0HA 3PSFA 4AC0A 2A5WA 1Z3YA 2GBYA 3QYEA 4PK4A 1E3OC 3CCEI 3CMAI 4EM1A 2FRHA 2Y0SA 4XONA 2M2EA 3NEUA 3OOUA 2FOWA 1MMDA 3C1DA 4U87A 2MABA 1OCRH 1JUMA 4ZZLA 2Y31A 3T1BA 5J1YA 3GW2A 2Y9ZA 3ESWB 3W2WA 1X58A 3WTZA 3T8TA 3KP3A 4CCJA 4BS9A 2XPWA 3H5AA 2VKEA 1DP7P 1RESA 3AG2H 5EG0B 3I71A 3KIOA 3JTGA 1K61A 5E3MA 4MQVA 2VC0A 3CQZJ 2WA0A 4QPQA 1AHDP 3H9GA 4NC6A 2KIMA 1OISA 4I7HA 2R93J 1LEBA 2VN2A 3ZRGA 3OYDA 2V4JC 2UZKA 2P7VB 4LIUA 1MNEA 5F64A 4JBAA 1P92A 1B9NA 2DA6A 2NS0A 4ZYDA 1DGRM 2XAJA 3CCSI 1D8KA 3HHHA 3H9JA 4U88A 4L5EA 2LH9A 5CYVA 5ED4A 4L0YB 1ZR4A 1X1BA 3JRBA 2EA2A 2CH0A 3M8EA 4OMYA 1ZGJA 3I56I 2R92J 1Z05A 5E1ZB 4OWRB 1XGNA 1V4RA 3PFIA 3LMMA 1E3HA 1MMNA 4BQNA 2OF7A 3HXLA 2ZXHA 4M3FA 5F0CA 1RR7A 3L2VA 4C2TA 2CO5A 3TQNA 3Q0WA 1JTYA 2F6CA 2LR8A 3QYFA 3SZPA 3OL3A 2W48A 3KP5A 1IZ1A 3O8GA 4ENNA 3GWZA 2M34A 4R8HA 4B44A 3RKQA 2H27A 1XG1A 1KA8A 5FB2A 4I0AA 5IP9J 1ULYA 3F9KA 3PNVA 3J81Z 1WCMJ 3M1EA 3OYKA 2XRNA 1ODDA 3F23A 1JGSA 3Q3SA 4E7HA 4ANJA 4B8XA 3K4KA 4UV8A 1HW1A 5K7ZA 3ZQGA 3V7RA 1F43A 2X4HA 5EZGA 2VPRA 3NQOA 4LLGF 3ZGKA 5ILSA 3HOXJ 4NC7A 2IA0A 4PUSA 1A31A 3LQRA 4IHYA 1TBXA 5J4YA 2BHYA 4LG0B 4RB1A 2KHMA 2V9KA 4U7BA 1PJRA 1A36A 3OS2A 2ADUA 3PUFA 4BUPA 1YE9A 2W24A 3AAFA 2CV1A 4HNUA 3ZMVA 1ZKGA 2ICWG 2I10A 3IWFA 2XGEA 2DOAA 2NOGA 4MO7A 5E79C 2DTZA 4Y17A 5FKKA 4I6ZA 2ECCA 2TCTA 3U1KA 5E3NA 4M9ZA 1LQ1A 2HU9A 4ZTJA 4XRFA 3DLAA 3S14J 2XF7A 4KITB 2GWRA 2ZJRF 2ELHA 4A93J 2DK8A 3FXKA 3MFKA 4HX7A 2Q2EA 1ZG1A 4XOPA 5K5QA 3FXMA 4IRGA 4KNYA 1TP4A 2LLKA 1IRZA 5D6FA 3G6EI 2K5CA 2WADA 1X19A 1G3WA 2BY0A 1OCCH 3G3ZA 4KT6A 1XGMA 4CA0A 5HDNA 3L2RA 2Z9OA 1Y0NA 4UVBA 3V4GA 2MH9A 5FKOA 2B0LA 3GUDA 3WGGA 3OR2C 3RKWA 1VQ6I 2XASA 1BW5A 1TTYA 2BXYA 2OC6A 3HRTA 1FBUA 4YFKF 2GA1A 3C2HA 3FMSA 4XN0A 2QSHX 1MBHA 3LSIA 4NQWA 4XKBA 2X9DA 4EJUA 5BPDA 2V26A 2ZMEC 5JLXA 4EM0B 3H35A 4V2GA 5HLIA 2IS4A 3EQLF 3JW4A 5IYBJ 3KE2A 1ZQ3P 3FM3A 5ILVA 4A3BJ 3R61A 2LFBA 4LGWA 1ON2A 2L5QA 5D8LB 3SQNA 2HR3A 1MH3A 5FLXZ 1JKPC 4XRSG 3IHUA 3B6AA 4XLCA 4DBQA 1X3UA 4OU0A 3Q5FA 1SVLA 3I4MJ 3W6KB 4GRIA 4A5MA 3AKZA 5CJ9A 1T6SA 2MA3A 1F4KA 1FLIA 2AS5F 1B9MA 3QU6A 1K7AA 2HI3A 5BQTA 1B8IB 2I8DA 2IS6A 2DU9A 3TW6A 2LY2A 3BCAA 2ID6A 4UUSB 4XR6A 2XVCA 1N77A 5HODA 2XB0X 2JT1A 1P2FA 2N8GA 4HG2A 1MIJA 4A0YA 4KFCA 2V9PA 3FXQA 4AD9A 3BTCA 1P4XA 3G71I 5E8IA 3LFKA 1O4XA 1Z91A 3CP8A 3DEWA 2KQRA 3KYCB 2IP2A 2A61A 4PFOA 1QVUA 4MTDA 3IWZA 2HWVA 3L2WA 3H92A 4ENJA 2KFDA 3GTPJ 1MNMC 3BR0A 1GXPA 3S8PA 2VQGA 4RLQA 3F72A 5ICCA 4A3CJ 2CUEA 3A0HC 2JQ7A 1D1AA 3BC8A 3VOEA 5HS8A 4CZCA 2P7CB 2A3SA 1GVJA 2Z3YA 1LE8A 2EPFA 2JN6A 1YW7A 2M3AA 1HDPA 2CW0F 1XN7A 4XLNF 5IYDJ 1X1CA 2RC4A 1XDUA 1ZAOA 2WTEA 2A07F 1NTCA 2VE8A 4I0BA 4ZYEA 2WAQA 1X2NA 4YRVA 4M9XA 3F22A 4HV6A 4KUMA 4Q4ZF 3L2CA 1IXRC 5AIPA 3ZMUA 3L1PA 1HW5A 4EV0A 1E17A 4JQFA 4E7ZA 5M5XJ 2FEZA 1IF1A 2LC2A 3PNTA 3ZN1A 1H89C 3EDPA 2KDOA 2M9HA 1FPQA 3CCJI 3E3VA 1LEAA 4JP0A 3P9IA 4EVIA 5LGNA 2QYOA 2L9VA 1T38A 3S3NA 1KQ0A 1OCTC 2MW8A 3KP6A 4GXOA 1MBGA 2VQLA 5CVJA 3C7JA 2ZJQF 3R0JA 1GHCA 3HUGB 3DLLF 4YIFA 3QU3A 1Z0XA 1RUOA 2KJBA 2YU3A 1LVKA 2DT6A 1XCVA 3LSJA 3UKGA 4A3KJ 4AIJA 3H36A 3VSLA 1FSHA 4ENMA 1JKRC 2HGCA 2OD5A 3H0DA 3DPUA 2VXZA 1KGSA 1WJEA 2DA3A 1VNDA 2R7RA 5LLQA 1Z7LA 3AG3H 4IL6C 4M3EA 4MQ9F 3NAUA 1XX5A 3BTJA 2YU9J 3WU0A 2ZMEA 2HNHA 3RZDJ 1CF7A 1IXCA 1JUSA 1YQAA 2FE3A 2A05A 3QWLA 4M3GA 2MG4A 5F08A 2P5KA 1SD4A 4RLFA 2JPBA 3CCRI 2EILH 2RQQA 1WJFA 3LSRA 5DUIA 4U0WA 3TOAA 3ZP5A 3GZNB 2VBXA 1ZH5A 2K3PA 2IGMA 3ONQA 2L7ZA 3LA7A 3BP8A 4A2UA 4EMSA 2FA5A 1OR7A 4QSHA 5D4SA 1EA3A 3IKVA 4ENKA 1ETOA 3FF5A 1QZEA 2FMYA 4L5IA 3WE2A 4CO8A 2VT2A 2K85A 3ZCOA 3DPLC 3AL0B 2IAIA 2RN7A 1IRFA 4ESFA 5IP6A 2YX7A 3J80K 4IZZA 4LOCA 4RA2A 4FTHA 2F5FA 1ZLJA 1WH7A 2CG4A 5CLSA 3FKJA 4KIFA 5F0FA 2LBFA 1R5HA 1RPWA 2UV1A 2VKHA 3U2RA 1ETYA 2DFHA 1XMAA 3HM5A 5HS7A 5M5YJ 2JA7J 1PVEA 2IVMA 3S15J 2E35A 2OCEA 2R7UA 5EGOB 5LHIA 3BG9A 5B3SH 1PDNC 3CF2A 3CO6C 4A3JJ 4DYRA 3RQ4A 3FIWA 3HOVJ 5C4XJ 3PNYA 2ZXIA 4F7ZA 3JRAA 5K5RA 1G4DA 4KIBA 3P9CA 3D5SC 1EF4A 3V8JA 2K4JA 3BDDA 1ZYRF 3GF2A 1MW7A 3MZYA 3SZTA 2CJJA 1R1UA 3LWFA 2CU7A 3TL4X 5D4RA 3DEEA 3DTIA 1J7KA 1IJWC 1WJBA 2VL8A 2O7OA 5HDGA 1H0MA 1ZARA 4D7MA 5LGTA 2HOAA 3KZYA 1TW2A 2IS1A 3KX2A 4XSXF 2LK2A 3PSIA 4MIMA 4OOIA 1Z9CA 2OU2A 4M72A 1X3ZB 3CC7I 5DYMA 3PJRA 2CSOA 3EYYA 2FQ3A 1GDTA 5AIQA 1N25A 2X6WA 4XLEA 3CUQB 4DZJA 1APLC 1G3YA 3MWMA 4XLHA 2P0WA 2H8WA 2BVLA 4QWQA 3BJAA 5CVVA 5DD4A 1T0FA 4DYCA 1W36D 1N75A 3MMYB 2ISZA 3CDLA 3FXOA 3FMQA 1X3WB 1B72A 4MLOA 5DDGA 3HGYA 1T39A 3J7AO 1R7JA 3HOUJ 5J4VA 3OWTA 3OYAA 1TWHJ 1I50J 2D1HA 4UUTA 5B5EC 2LTPA 4HAMA 4IJAA 4L9NA 4B09A 5J3LA 1RETA 3KP2A 2JK3A 2WBMA 4V2FA 3BR5A 2K9NA 3TO6A 2Z5UA 1QPIA 3QQAA 3SFIA 4EJVA 4IHSA 2EFNA 2RNGA 4OIRF 1VQ4I 2H09A 1QPMA 1TLHB 1IDYA 1LDKB 3F0CA 2L7FP 5E17F 1VF9A 3OMYA 2DQRA 3LQQA 4I99C 1QBJA 3HDDA 1TQPA 1TWGJ 2XKPA 5EEGA 4FETA 1FYLA 2DA7A 4LLNA 1YS7A 2DT7B 2HQNA 4E6KG 3MZHA 2DFIA 3EUKL 2OQRA 3QODA 2R7QA 2JJ7A 4BXFA 4XM3A 1YS6A 3F8CA 2K86A 4AIDA 2VBZA 2BVMA 1TNSA 4FISA 3E7LA 4Q48A 4C2MJ 4YFXF 1P7IA 3FK7A 4F93B 3F21A 2FBIA 1USTA 2HPIA 1BN5A 2EFOA 2KP6A 3WE3A 2P6TA 5JLWA 1IV6A 3A02A 4CSWA 1S6LA 4G6TB 3DU5A 2WB1N 1ZGWA 2R7SA 4ZYGA 3CCQI 1SFUA 1SFKA 2F5DA 3MKYB 1JHFA 4OMZA 3V7SA 2NS7A 4I76A 4A3LJ 4N9HA 4PJJA 1QZZA 2ZXWH 1U8BA 1CGPA 2B63J 3IH3A 2OA4A 3DEUA 3U21A 3H3UA 1K6YA 1T08B 1YX3A 3DFGA 4KYWA 2BXZA 2GAUA 2P6SA 4NQWB 3K1PA 3RZOJ 1G8XA 3FMRA 1O3QA 1FOKA 2CWEA 4ZDPA 1MBFA 4CYCB 2PJRA 4OAYA 2CQNA 1M1EB 3FKIJ 4QLCU 3MEXA 1YOVB 3MVPA 5DM6F 1FJLA 2KZVA 4B1RA 4IHXA 3BCBA 3BWGA 4BH9A 2VJJA 2HYGD 2E34A 2ID3A 5KAIC 4OIQF 2VPLA 3DKXA 2QSFX 4IQJA 1E0EA 2L9RA 3H5NA 1KU7A 1I27A 4HOBA 5BS6A 3I55I 4DZPA 1MMGA 3HTSB 2X1CA 5E18F 3NWSA 4GDFA 5J8CA 1TNTA 3FXLA 4UNOA 2OZUA 4LMYA 1FMWA 5J1UA 1SC7A 2M5WA 1Z7UA 3BR3A 1XGSA 3H0GJ 3I9V2 2FNAA 2RDPA 3ZQCA 3ASNH 3JRIA 1FTZA 3O3KA 3KPHA 4UB8C 4ZYAA 1Y1WJ 1GXQA 4MGRA 1I3QJ 1S8NA 2DJNA 2ZO4A 3CO7C 2LNBA 4RAZA 4J00A 2UUZA 2O3FA 3FXRA 1QA6A 5KAFC 1REPC 1OPCA 2LY9A 2K7LA 1SVMA 3A03A 5K7FA 4UY8I 2CS3A 2CGPA 1QVTA 3K7AJ 2FU4A 5DEQA 5HS9A 1P7JA 1UHSA 1OKRA 1KU3A 2BW3A 5J6XA 5BOXA 2WC2A 3B6CA 3SDBA 5GAGJ 1NHAA 2GXBA 4FE4A 3MKWB 5M5WJ 1HSJA 4A0XA 1Z1DA 3JRDA 4OAZA 3DKYA 1HLVA 4JYKA 2HVRA 3A01B 1VQ7I 1ZG5A 1PUEE 2K9QA 1HKQA 1U3EM 1Z21A 3AG1H 2DLLA 1S29A 2L0KA 4D9JA 2VBWA 2K9SA 2KPMA 2RNJA 4YELA 5D5VB 3BJ6A 3EPZA 1XC5A 3GBGA 2BY3A 3WU2C 3U9GA 2QGUA 1NK2P 4IO9F 3IRQA 2PX9A 3RI4A 2HZTA 5ERIA 3T0YA 3K4CA 1K4SA 2CUFA 4DQ2A 4YIIA 2XSJC 1I39A 5EEHA 2GIVA 3O8HA 5KCMA 2QKLB 3SFZA 2O6GE 1R36A 2LMDA 5IY5H 3KYDB 4BXUA 1D1CA 2G7UA 2OTJI 5IYCJ 2J5OA 3GMEA 4O5VA 1HXDA 2Z2SB 1IGNA 2H6CA 4B4CA 3CCMI 3W6VA 4HNTA 5C4JJ 3BG6A 2R7TA 3LA2A 5DCFA 4RAGA 1P4AA 3G1LA 3M8FA 2EINH 2QKMB 3QAHA 5KK1A 4H0EA 1UFMA 4AWXB 4CUGA 1CF7B 1R5GA 3HOZJ 3RCOA 5L3CA 5LHGA 2X48A 3WU1B 4RS8A 2E71A 3BJOA 3GXOA 1VQPI 2XGCA 2BOLA 4M9SA 3HTUA 5IPAA 3VFZA 3IC7A 1ZELA 1EKEA 4P5OA 5IOZA 1R1VA 1ZLKA 3WTSC 2DYRH 3SYTA 3ULQB 2YPRA 4LIVA 4IOAF 2HOEA 3QRFF 6PAXA 2CV0A 4BJ6C 3BZKA 3MQ0A 2WAFA 4BHCA 4AIKA 2RGVA 4XLFA 2PMZA 1T33A 2VBYA 2NAZA 3VB2A 1RKTA 3A1YA 1V5GA 3SHFA 3V8KA 1HKSA 1OYIA 5L3BA 5C44J 1RKWA 2X1EA 2E2IJ 3I54A 1D1BA 3VSKA 4NB5A 3F8BA 1SANA 2W84A 5GPAA 1JKQC 1USSA 1U5TB 4EJTA 2F4IA 2BYVE 5D5UB 1B4AA 2RV8A 3Q0VA 3VEPA 2DFFA 1ZTRA 2KLOA 1RIOH 2ECBA 3G1MA 4KISA 3H3VK 1WJAA 1SFEA 4JX4A 1IRXA 3HJEA 3CJTB 3GTQJ 4RAFA 1YW8A 2D1VA 4FASD 4NDLA 2XROA 4KA4A 5FLMJ 4FQGA 3IAS2 5ILUA 3ZXSA 3JCUC 3RPUA 2HEOA 4YFNF 3WHBA 4EATA 1DQUA 3QPLA 3S3MA 1X4OA 5EZHA 3CLQA 2OBPA 2NVTJ 1UHWA 1OCPA 2ETHA 3KEYA 4XMYA 1A6QA 2P8TA 3KLOA 4E70A 3GFMA 4HEA2 4D7NA 2GOMA 1WJCA 3MKZA 2Q8KA 1O7FA 1XDSA 4A6EA 1WI3A 1ACIA 2R4GA 2ZXJA 1R22A 2BE5F 2GA2A 5B1AH 1J0RA 2EWNA 3LSHA 2JUCA 5M3MJ 2H6BA 2NNNA 4ZJZA 3DV8A 1GLNA 2JZYA 1FBQA 2A68F 1W1WE 3OS1A 1H88C 2PG4A 2X0LA 2DDAA 1U6GA 1VZ0A 1EH8A 2NOJB 2F4MB 4LFUA 3K4NA 4WXHA 2W00A 1WJ5A 2OQGA 2HKXA 4CCNA 4IHVA 2EZKA 4A69C 2HXIA 1R5ID 4NNJA 5K7HA 2LG4A 2MBFA 2QUFA 5DD8A 1BW6A 3HOWJ 3GTOJ 2Y48A 1KQ9A 1IUYA 1FY7A 2F5EA 2VLAA 2GZWA 4K2EA 4WX9A 2AXLA 4X6AJ 2R7DA 2YS9A 1SVOA 2TRTA 3HOTA 4S0HB 4M6YA 3OYGA 4HSTA 3I5UA 3OIOA 4N0BA 2JUGA 3ZN0A 1WQ2A 3OV8A 3UR3C 3IH2A 2L01A 1QGPA 3QOPA 1F36A 2VIXA 2D5VA 3GZ5A 2WWYA 2L3DA 2YR2A 3M07A 2O5RA 1W7PB 1XS9A 1LFBA 1AA7A 4CGZA 1WHUA 2DFEA 1WKMA 2M4KA 5EYRA 2MLKA 2VQCA 5EF6A 3N05A 5IP7J 1J9IA 1U2WA 3S2HJ 5EJCA 3LA3A 3S1MJ 1ZGAA 1GV2A 3I0TA 3GTKJ 2EH3A 2R7FA 3BZ6A 3E6BA 1UZCA 5F04A 1YITI 5F1JA 2FOKA 3K2ZA 3HL2A 1DDNA 1BI0A 5FLXK 2DMQA 3CZ6A 4XQFA 2Z1DA 1IN5A 2QQAA 3HSEA 1HCRA 1W36C 4HF2A 2HZDA 3WTXC 2QBYB 1FWZA 5IOYA 3CESA 3F8NA 4N9IA 3FX3A 2KJCA 4D5CA 1PUFB 1V3FA 2EBIA 5L3EA 1YHQI 5BMZA 2DAOA 1MMAA 1ZG3A 2KDZA 1XTAA 5LD2C 3SEZA 2W1OA 1JUPA 5FKLA 1P6RA 5GP9A 2ZB9A 2R3SA 1RR8C 1SMYF 5HLTA 4AVPA 2LOOA 2P81A 2MH2A 1YIJI 3HRUA 4JOMA 3S2DJ 2EV0A 3WTUC 1OYWA 3GTGJ 3GLXA 4G94A 4PDKA 1LDJA 4LG0A 2HQAA 1G3TA 1V55H 2IBDA 4UV9A 1FOWA 4AIHA 1MSFC 1GVDA 1GUUA 4KT5C 1F1ZA 3M3YJ 3DWLE 4XL9A 3CCLI 4F52A 3OL4A 5F27A 3I3LA 4G6QA 3DTKA 3JAMK 4IVNA 4BGDA 4QPOA 3R6SA 4A3DJ 2I5UA 1ZRFA 2DJIA 2LKXA 1YJNI 1D5VA 4FT8A 2LRDA 1OMIA 1UG2A 2KL4A 4IPAA 1WWXA 2JWTA 5FD6A 1TC3C 1Y39A 2BY2A 2R7ZJ 5FRNA 2KISA 1I5ZA 1WI9A 1K78A 2DYSH 1H9GA 1QHGA 2DDBA 1KYWA 2D2WA 3K70D 1TQIA 3ZQIA 3HKZA 1MH4A 1OQYA 1YYVA 3C2GA 1T2KA 2XB5A 1S7AA 2JA6J 4B43A 4BQOA 3EUHC 3PIOF 4IEJA 1T56A 3EUAA 2EB7A 3BQYA 4WWCA 3M8JA 2CFOA 1FYMA 5JR3A 3I64A 5JVTA 4QIWN 3SXYA 3RQIA 3WODF 2FD5A 4FX4A 2ZFWA 4RAYA 2RVCA 2VXDA 2ELKA 1OR7C 3G1OA 1X4PA 2EK5A 2ISYA 3K69A 2K9MA 2M8GX 2GLOA 3M9AA 2XGDA 1R58A 3LAPA 4HQMA 3S3OA 3GTJJ 1SFXA 1BJZA 4FE7A 2R5ZA 2ZSIB 2HFHA 1YW9A 1R6RA 2HQ5A 5FO5A 1R23A 4ZDLA 3LSMA 1UELB 5TJJA 2XC7A 1LNWA 2DBBA 3M1CA 4XBFA 4NHJA 1X2MA 3MN2A 3BR6A 3WTVC 4HDUA 1W7PA 2XAUA 2Z16A 2HTSA 1Y8QB 3B73A 2HOTA 4ABZA 2VT3A 3GTMJ 5AONA 1S72I 5CQEA 1W5CC 3AG4H 1BL0A 1XMKA 4G8XA 1DGWY 4UUVA 2XRLA 1J75A 1Z67A 3PIPF 1SD7A 1ORKA 2BW3B 1DPUA 1U5TA 1ZHFA 4BL0B 4P9FA 4II3A 3ZQLA 2YSRA 1ONVA 1VFCA 2X85A 3MZ8A 4WXDA 2A5YB 4NC8A 1UG0A 5HNFA 3RPQA 2DXIA 1VQOI 4LB5A 1BR4A 4GFBA 3ECOA 1QQIA 2UWMA 4CCMA 2XAHA 2K02A 3HSRA 3HZJA 4DBRA 4B3AA 3MCZA 4D5FA 2LF8A 5DCMA 1VQMI 5BNGA 5CKTA 5H2FC 5M3FJ 2PBIA 4Y15A 4PJ0C 2VJIA 2HQRA 2JSCA 2M0MA 3GYHX 2LP0A 4EQQA 4RM3A 1LUJB 3LSKA 3OS0A 1J59A 1YRNB 3J80Z 1TZLA 1ZR2A 1WZ2A 4I01A 3CTAA 4PSWA 3J7AY 2V1NA 2DA5A 3CCUI 1R00A 4IX7A 2IJLA 3OIPA 3HGGA 2V79A 4Z2YA 1I1SA 1E2XA 2VC1A 4LLLA 4A3GJ 5FFZA 3S16J 2HKOA 1I1GA 3OYFA 2H94A 3RTRA 4XRMA 4M6XA 4MHGA 3LSGA 2QBYA 3C3WA 1BI2A 3T5XA 4M3DA 2W82A 4IRHA 4TV7A 2X51A 5LEKA 3BPXA 2EJRA 5DV5A 4BHPA 2COMA 2G0EA 1SMTA 1ENHA 5JI6A 5DS9A 3RYPA 3CC2I 1PYVA 1S9HA 2XAGA 3CCVI 3LL7A 2FXAA 3ZMZA 3I4PA 3B02A 5EG0A 4E7JA 5GAHJ 4HX8A 5E3OA 1ETXA 5LFAA 4DNCA 3GCMA 4BE2A 1O3TA 3HG9A 4BQQA 1KONA 2FX0A 3VPRA 4RDUA 3K1NA 4XOTA 3RKYA 2WAEA 2A6TA 2X6YA 4RGSA 1FNNA 2X1DA 1H9TA 2F2EA 5FJ8J 4OIPF 1Y6IA 2XAFA 1U0JA 3BTIA 4PJNA 4MNUA 1P9QC 1D8JA 1MBKA 2XSDC 4C3IJ 4JX5A 4BU2A 1ZK8A 1L0OC 2GOXB 1LVAA 4XK4A 4PJLA 2ZJ2A 2ZSHB 2HDWA 3TKYA 3WGHA 2HS5A 1J2XA 4HV5A 3W6JB 3CC4I 2NRAC 2V6CA 3QYBA 1S5LC 4N4OB 5FGMA 3QPHA 2M7BA 2VQHA 2STWA 2E60A 2FUG2 3N97A 4E7LA 5D5WB 4F92B 1GT0C 3TW7A 3J81K 4IHTA 4II2A 3SDGA 2WB1A 4CZZA 4G6DA 1BOAA 4IRIA 2DOEA 3CP2A 4L18B 1Z6TA 2J5PA 5CPRB 3OYEA 1HC8A 5FKMA 2CQ7A 1K79A 2O03A 2DN0A 2E5ZA 3P5JA 4LG3A 2FJ1A 3HBLA 1IN6A 1WH5A 3E97A 2PEXA 3DPTA 4ESJA 1A5JA 1STZA 3WG7H 1IN7A 2CMPA 2GQQA 2QVOA 4J01A 2JA8J 3VYUB 2KT0A 5L3FA 1G6NA 1S7EA 4BEHB 1JI8A 1ZN2A 4FHTA 5ICGA 1C0WA 4PGGA 4XLAA 2L02A 1FOXA 3HUGA 5EGOA 2ZNZA 3SJMA 3JSOA 2W57A 5K5OA 5IT9Z 1A04A 1RI7A 1UAAA 1UJ8A 2XPVA 2ESHA 4RGRA 5JHFA 1H8AC 2KZGA 5GPCA 1HDDC 5L3DA 1EH6A 3E5UA 2EV6A 2NS8A 1I6XA 5D8KB 5FLVA 3QP6A 4Y33A 1SAXA 2RREA 1Y56A 1B59A 2Y0MA 3Q9VA 3BG3A 2GM4A 2Y75A 1UHMA 2BHZA 3EUHA 4ESBA 3Q9SA 1FBSA 4IHWA 1DP3A 2MFZA 5DTDA 5D5XB 2XF5A 3BR2A 1IN8A 2EV5A 3UNGC 4DJAA 3G4SI 2R7WA 3LNQA 1FZPB 4FCYA 1D0YA 1R1TA 3CJRB 5TRDA 2K9LA 4IXAA 2L7KA 5H20A 4CCLA 1YJ9I 3DBLB 3S1QJ 1XMXA 1MZBA 2Q0OA 4X0GA 1AKHA 3M7GA 2E5NA 2CV2A 2FSWA 4G12A 2ME0A 2M8EA 1RC9A 3LSTA 1QZYA 3KZZA 4KJZA 4PCQA 4A3IJ 1IN4A 1T95A 3H1CA 4CCKA 4BDYA 1VQ5I 3PM1A 1HA8A 3HOYJ 3E0JB 3RKXA 3WHCA 2CFXA 4BEHA 2TDXA 2R5YB 2ELJA 3VYRB 2CRGA 4BY7J 3CMMA 2DMNA 3LAJA 4LK0F 2YX4A 5FRMA 1HKTA 1BR2A 2NNYA 1A35A 1NH3A 3MAJA 2H8RA 3HKZN 3ERED 3FBIB 2F5CA 2HXOA 4A3EJ 4RGUA 2PJPA 3ZQQA 1Z3XA 1VQNI 2PLYA 3PO2J 1DUXC 1F5TA 3CCYA 3O2PE 5CVIA 4BJTA 2FQ4A 2M4GA 2QEXI 5EDNA 4P9UA 3H9QA 4LD5A 5K1YA 2JRTA 3ZOBA 3LOCA 1P4WA 4D1QA 2PMZN 2KIQA 3D0SA 3DBRB 2ACJA 1YX5A 2VOOA 2DA2A 2V1XA 3RIRA 4V19K 4CICA 1QHHD 3A2KA 3BQZA 2EIMH 3IRRA 1JE8A 2AXTC 1BM9A 3L9FA 2O61A 1PP8F 1SD5A 1XCBA 5JHUA 2O8KA 1WRJA 5B66C 2BEOA 5D6EA 3FWEA 3CMYA 4PJMA 2COBA 2VODA 2VE9A 4L9TA 4A12A 4EGZA 1O7LA 2IGNA 2XPUA 3K0LA 2QZ8A 1Z6RA 2IPQX 2UXNA 3HC7A 2EA4A 2MYSA 3HSFA 4P96A 1KU2A 4KMFA 1MD0A 4R79A 1LE8B 3ELKA 1LFUP 1U8RA 4KMUX 1BI1A 2LDUA 1BIAA 1KYZA 3KP4A 3TBIA 2VJ4A 1D5YA 4G7ZF 1X1DA 5F6FA 3ABKH 3HB9A 2AQEA 2LKSA 1FEXA 1O3SA 2K40A 1J5YA 4B3XA 3JRGA 3RSNA 2QM3A 1MNDA 2R7OA 3E6CC 3OIQA 3IUOA 4Y7NJ 4AYBN 3V8LA 2R5YA 4DW6A 2LREA 4BAYA 2L4AA 1Q1HA 2HYFA 3V7CA 4HZFA 1YO5C 2FF4A 3RYRA 3KEOA 1BIBA 3H3ZA 5FFXA 5KHDA 4XORA 2KRCA 2E1MC 4GYIA 1UB9A 3ML6A 2F5VA 2JA2A 5LHHA 1F9NA 4MTEA 3D5LA 1G59A 1YRNA 3HRMA 4BBSJ 3TP0A 3K4BA 1OCZH 3P9KA 2QQ8A 3LFUA 5JFRA 5DM7F 4NUBA 1R4MB 2GXGA 3AFHA 3CDIA 4E7KA 3AL0C 5DCMB 3LSPA 3FM5A 4I09A 4AUXA 3C2BA 2P4WA 2H1LA 5FKNA 1HW2A 2DPDA 3SEQA 3TO7A 1WVRA 5HDKA 2NXNB 3RDIA 4CCOA 3R0AA 1XPXA 3GLLA 3I59A 3WTTC 3NARA 2DA4A 2P5LC 4U0VA 2NVQJ 2Y2ZA 2AHQA 4M74A 1KQ8A 4BQAA 2E19A 3F6OA 2CUJA 3TEDA 3P7NA 1DU0A 2EIJH 3VDXA 3BY6A 4HX4A 3OYJA 3COAC 2B9SA 2O9LA 4MFEA 3IH4A 2MSYA 1MJBA 2A6HF 2OJED 4RB0A 3GVAA 4O3MA 3DF8A 4BACA 4RB2C 2BV6A 2HDDA 3ROUA 4PGHA 3FHZA 3BR1A 2XHKA 1ON1A 2PFBA 3S2WA 1ZREA 3HIFA 4G9YA 4PSXA 1ZRCA 4ZZDA 3CUOA 5CVUA 4EM2A 1UCRA 3CUQA 4HNVA 1MDMA 3ZQHA 3ERMA 3L2QA 2V1UA 2PMUA 2WV0A 1NK3P 1MKMA 1G2HA 3C18A 2CQQA 4IOCF 3K1MA 2EIKH 2M87A 2RAEA 1Y8RB 3MKLA 3E6DA 4XICA 2ME6A 2KKOA 2W85A 1WJDA 4BNCA 1IV8A 3DKWA 4CYCA 4OIOF 3TDUC 2W7NA 1FP1D 3IL2A 4G7OF 4CDGA 4B47A 5J1RA 1JT6A 2IS2A 1BI3A 1QRYA 1FMVA 3BLYA 2DMTA 2BGCA 1HF0A 1Q1VA 1SFOJ 1D0ZA 4F3QA 4M71A 3ZQ7A 2CYYA 2DPUA 1D0XA 5A2QK 4JX6A 2DI3A 1LKXA 4ZYHA 3ZMSA 5IT9K 3SZGA 3TO9A 1KU9A 3FISA 3S1NJ 2FBHA 2LBFB 3RJPA 4BHBA 3WGIA 3KETA 3BOQA 1JKOC 4I2OA 1IAWA 1VQLI 1RZ4A 1I6HJ 2VI6A 4E7SA 4RGXA 2GXAA 2CUZA 1AOYA 2QQ9A 1IC8A 2EFWA 2QENA 3KEQA 3TP3A 3L2UA 4BDZA 3OYLA 2ZBKA 3GX4X 1MJ9A 1OFCX 3GEZA 3KYLA 1TT0A 5TISC 1S3JA 3DP7A 2R5ZB 3CUQC 2EZIA 4YIRX 2JVHA 3BG5A 3GZ6A 2VASA 1UMQA 5F1RA 1JTXA 5GTHC 1QU3A 2Z99A 1BC7C 3J7YJ 1XD7A 3K6GA 1IG7A 2HOSA 1W0UA 3HYIA 1WFXA 4X1EA 3ZPLA 1POGA 2OCCH 1K83J 4MEXF 1BBYA 4HF0A 4D0PA 1JJ8C 1JT0A 3W3CA 3K4LA 1U5TC 2ZKZA 4WXCA 2LYCA 4LK1F 3E1SA 2ZC2A 5E20A 1FT9A 1RRJA 3FDYA 3ABMH 2AO9A 3BTLA 1WPKA 5J8FA 1W5TA 2HDCA 1FOYA 2B7EA 3DTEA 2D45A 4C9YA 2E2HJ 1FTTA 4UXNA 3ISPA 3F8MA 4BJ5C 9ANTA 2V9VA 2JMWA 1EH7A 3E6MA 3PO3J 1BOBA 4HDVA 4I02A 2QCOA 5A2QZ 3QOEA 2E7XA 2KIFA 3S32A 4RBOA 4HLYA 1MBEA 3I59B 2EFPA 2L9NA 3E5QA 2V6EA 4HPQA 4UB6C 2E1MB 3S93A 3DU6A 3U1DA 5HOOA 1A6IA 1QNTA 1B8IA 3TMOA 2VONA 4ZC3A 2PMHA 2Y69H 4BE1A 4UVCA 2MGQA 2IW5A 4WF2A 1K6OA 2E36A 5GAEJ 4ETSA 1ETWA 3K10A 3HPHA 4A5NA 4Y3OA 5H6QA 4L9VA 5EEAA 3JSPA 1FYKA 2DMUA 3OOPA 1TL8A 2OTLI 2DOFA 2VKVA 4G7HF 1E3PA 5HLHA 2P5VA 2FBKA 1XGOA 1FIPA 5B1BH 4ZDOA 5BPIA 2RQPA 1OLTA 2DTRA 2XKOA 2VUMJ 3KFWX 4IF4A 3I53A 4N4NB 3I58A 4ON0A 3MD2A 3DQVC 5J40A 5LRRA 4PZJA 1K78B 2LVSA 4U0YA 2DK5A 3WG9A 3FK6A 2IA1A 2XF6A 2Y0SN 4CHUA 4Y52J 1YI2I 5LBQA 1SD6A 4XKCA 2ZJPF 2PI0A 3OYNA 3S1RJ 1W5SA 4A6DA 1OYYA 4ZTFA 3VODA 3D5RC 1IRGA 1NG6A 2M7AA 1MBJA 1FC3A 2HPMA 1IW7F 4YG2F 4A3FJ 1TWFJ 2CQKA 3ABLH 3K2AA 2FMLA 1TQMA 3OR1C 3PUBA 4WCGA 2IA2A 2BBYA 2OV7A 5TGTA 1IO2A 3ZMDA 3QPTA 2JTVA 1XB4A 2XGXA 2JSPA 3ECHA 3L7WA 2LF7A 2M45A 1T0FC 3FBNB 2M30A 4UVAA 4DIQA 1YLFA 1AWCA 1ETVA 4Q5SF 2EQRA 1HBXG 1S7OA 1VI0A 1YIOA 1Y1VJ 2QF7A 4ITVA 1TWCJ 4XIDA 5JVGF 2CQXA 1EJ9A 1D3YA 3V42A 3OYCA 1LPQA 3J7ZI 2R0QC 4U7DA 1TWAJ 4HYEA 3TOBA 3FZVA 2LKPA 3OY9A 4M3BA 3OSFA 4XSZF 3K4MA 2EFQA 3KLNA 4QTRA 5FD5A 5C3EJ 1V5FA 1JHHA 2PQ8A 2QWWA 4EJWA 2F48A 3JREA 1U78A 1RUNA 3VWBA 2NVYJ 3TGNA 3D1NI 3KP7A 3S17J 3HOSA 5KVRA 5CQGA 2CW8A 2QLZA 2O0YA 3K9TA 1VTNC 1V5EA 2XAQA 4LITA 2K27A 1MMSA 2WY8Q 1XSXA 3G2BA 4BE0A 1AU7A 4DGWB 4NBQA 1ERDA 5FROA 4UHTA 4HSRA 2ZFUA 3JAMZ 1PP7U 1FSEA 1YTYA 3JTHA 1W4MA 3A0BC 4KICA 2X6OA 3L09A 2STTA 2MC3A 1HQCA 2O8XA 3K4JA 3HHGA 3ZQFA 2VB6A 1BJAA 1TW3A 2E1OA 4HQEA 1B6AA 4E7IA 2LD5A 3BT9A 4P1WA 3HPGA 2HVQA 5E8GA 1JXSA 2DT5A 1FIAA 2G9WA 4MEYF 4MFDA 3M4OJ 4GO1A 3W2AA 4H4KC 3PL8A 3DXJF 1VQ9I 2QSGX 2R7XA 2E7WA 3IV5A 1DPRA 3CD6I 3F6VA 4XRSA 4EEFG 4GCVA 1W0TA 2KRHA 2LY1A 5ICFA 3EETA 2BY1A 4EJOA 4XKVA 2L4MA 1OJLA 3QPSA 2E2JJ 2UXXA 3A01A 2XDVA 4F91B 2L2OA 4XKWA 1QO0D 2K3FA 3GFJA 3IKTA 3PQJA 4DOZA 1BA5A 2HTJA 3VYSB 4HA8A 3WTYC 2Y30A 4W1UA 5L3GA 4KDPA 2Z33A 1WGXA 3K70C 2K4BA 5E1WA 3GFLA 5CVRA 5J47A 3N4MA 4HF1A 5E3LA 2F4OB 1O3RA 5E1XA 3IAM2 3VYTB 2IGOA 4DYQA 3OYIA 2M1BA 2KIUA 2DMPA 3R60A 2EZHA 5IT3A 2DO7A 2Y9YA 4W97A 2L9SA 1U9NA 4L0ZB 1R4NB 2L7MP 4BXXJ 3OSGA 4CH7A 5GTIC 2JRMA 3JRHA 1Z77A 4Y13A 1AKHB 1OCOH 2M0CA 4EGYA 1LB2A 2DQLA 2WV1A 1HOMA 3REOA 3NRVA 1J09A 1V54H 5DUKA 2V7FA 4RMNA 1K4TA 1Y0UA 1WSUA 4XLPF 2JPCA 3H5RA 4A0ZA 3GTLJ 3I4NJ 4J19A 5LEJA 4M73A 3TDZC 3OYMA 2EZLA 1ITYA 5LGUA 1PUFA 4KN7X 5HVQC 3DCFA 2DODA 2Q2EB 5ICEA 2OPTA 1VQ8I 3CJQB 4S05A 1MDMB 2A6EF 1VQKI 3GFIA 4HRIA 4O6JA 4OINF 2DCEA 3FXJA 1IDZA 4RM2A 2OUMA 3O6BB 1EV7A 4GGGA 4JK1X 1MSEC 3BPVA 1MJAA 1MGTA 2HYJA 1G3SA 3L00A 2IT0A 3F3XA 3A4CA 2W25A 2PJRB 2ZMEB 1SEUA 2AQFA 2FNPA 1TT5B 1RNLA 2OAZA 4GYGA 3CDHA 2E1NA 2IRFG 4ZH4F 2C6YA 3E5XA 3WTWC 3JR9A 1W7PD 2KMUA 2XIGA 2JVGA 2ZCWA 2X6XA 2DW4A 1B72B 4RB3C 1DU6A 4CXFA 1HSTA 3FXUA 2HVSA 2OZ6A 2W4SA 2MD5A 5HNHA 1N78A 1JJ6C 4IKFA 1T98A 5KNLA 4R1HA 3CF5F 1BR1A 2KRFA 2V1DA 2ESNA 4XN3A 2QQBA 3PQKA 3BG7A 2L54A 4B48A 2WAQN 2A69F 3KCCA 1R71A 3QP5A 4P55A 4AVZA 3FHNA 1O57A 1BC8C 3PFYA 3HRSA 3G73A 2IEKA 2IGKA 3ASOH 1KZHA 4A3MJ 2JA5J 4ASNA 1LFPA 1SAUA 2MD0A 1YFHA 4IQ4A 1ZRDA 2IXSA 1FX7A 4WK8F 2XUBA 3BZCA
chains in the Genus database with same CATH topology
2CUJA 3VDXA 1MW7A 3OYJA 4JOMA 3TL4X 3OYHA 3DEEA 3DTIA 1WJBA 2CW7A 2VL8A 2HQAA 1NG7A 4BACA 2IS1A 3KX2A 4F55A 3PSIA 3RPUD 3DWLE 4XL9A 4E4HA 4PSXA 4F52A 3PJRA 3OL4A 3I3LA 3DTKA 4BGDA 1X1AA 4QPOA 4C2UA 3L2QA 2DJIA 2X6WA 4PFPA 4C30A 2LRDA 4XLEA 3OYBA 2KL4A 2WY7Q 4XLHA 5FRNA 2R7VA 2P0WA 2BVLA 1QHGA 1WJDA 1W36D 1N75A 3MMYB 2MC4A 4XNFA 3W2VA 3K70D 4MLOA 4Y4RA 3HKZA 2W7NA 3ZR8X 3C2GA 3OWTA 3OYAA 2VJ5A 4B47A 2VKDA 3IP4B 2IS2A 4B43A 4AU7A 1FMVA 3BLYA 4BQOA 3EUHC 3EUAA 2WBMA 4AYBA 1D0ZA 3M8JA 4F3QA 2CFOA 1D0XA 3NWTA 4YEJA 2Q1ZB 2RNGA 1LKXA 3SZGA 1LDKB 3PSFA 3OMYA 2A5WA 2VXDA 1OR7C 1Z3YA 1X4PA 3QYEA 4PK4A 2K9MA 2LBFB 3S3OA 4FETA 4E7SA 2Y0SA 4XONA 3OOUA 2ZSIB 1MMDA 2DT7B 4U87A 2CUZA 4E6KG 1R6RA 4ZDLA 2MABA 3EUKL 3LSMA 1UELB 3QODA 2R7QA 4BXFA 3OYLA 2XC7A 3L2UA 4BDZA 3KYLA 3M1CA 4XM3A 1TT0A 3W2WA 2BVMA 4CCJA 4BS9A 2JVHA 3H5AA 4F93B 2XAUA 2HPIA 2VASA 2Z16A 2KP6A 1QU3A 3K6GA 5CQEA 2WA0A 1WFXA 1DGWY 4QPQA 4CSWA 4G6TB 3DU5A 3H9GA 2R7SA 2BW3B 1SFKA 3ZRGA 4BL0B 3W3CA 3K4LA 2V4JC 4II3A 3OYDA 4LIUA 3MKYB 1MNEA 2LYCA 4PJJA 3E1SA 2X85A 4NC8A 5HNFA 1DGRM 1UG0A 2DXIA 3FDYA 1BR4A 3H9JA 3U21A 4CCMA 2UWMA 1K6YA 2LH9A 4DBRA 1YX3A 3DTEA 1X1BA 5CKTA 4C9YA 4NQWB 1G8XA 2CH0A 4BJ5C 4ZDPA 2VJIA 2M0MA 1BOBA 4OWRB 4RM3A 2PJRA 3LSKA 4OAYA 3LMMA 1MMNA 3QOEA 3OS0A 4BQNA 1TZLA 3HXLA 2ZXHA 3S32A 2KZVA 4PSWA 3J7AY 2V1NA 3BCBA 3L2VA 4IX7A 2VJJA 2L9NA 3OIPA 4C2TA 2V6EA 3QYFA 2F6CA 3OL3A 4HPQA 2VPLA 2E1MB 3DKXA 3S93A 4IQJA 3OYFA 3DU6A 1E0EA 3H5NA 5HOOA 3RTRA 4B44A 3TMOA 3LSGA 4ZC3A 1MMGA 2X1CA 4BE1A 3NWSA 3F9KA 2W82A 3PNVA 2X51A 1FMWA 3OYKA 3K10A 4E7HA 3HPHA 4ANJA 3K4KA 3I9V2 1PYVA 1S9HA 4Y3OA 3LL7A 4ZYAA 3ZGKA 4E7JA 4NC7A 4PUSA 4BE2A 5LFAA 3HG9A 2KHMA 2V9KA 4U7BA 4BQQA 1PJRA 4ZDOA 1KONA 3OS2A 4J00A 2UUZA 4BUPA 1YE9A 4XOTA 2WAEA 2A6TA 2CV1A 2X6YA 4HNUA 2X1DA 1OLTA 1Y6IA 4N4NB 1U0JA 2DOAA 4PJNA 3MD2A 1P9QC 3DQVC 4BU2A 2CS3A 2GOXB 2HU9A 4PJLA 2BW3A 4ZTJA 2ZSHB 2HDWA 3DLAA 2XF6A 2XF7A 3SDBA 4KITB 3MKWB 4XKCA 3QYBA 3OYNA 4N4OB 2M7BA 2VQHA 4ZTFA 4XOPA 3D5RC 2E60A 2FUG2 1NG6A 4E7LA 4OAZA 4F92B 2M7AA 2HPMA 2K5CA 2WADA 3DKYA 4II2A 2WB1A 2HVRA 1X19A 3CP2A 5CPRB 3OYEA 3OR1C 3PUBA 4KT6A 4CA0A 3L2RA 2OV7A 1Z21A 5TGTA 4D9JA 4YELA 2KPMA 2E5ZA 3OR2C 4LG3A 3EPZA 2JSPA 3GBGA 2OC6A 3C2HA 4XN0A 1T0FC 3FBNB 3LSIA 4XKBA 3DPTA 4DIQA 2CMPA 2V26A 3K4CA 4J01A 3H35A 3VYUB 2XSJC 4BEHB 1JI8A 2IS4A 4ITVA 4XLAA 5KCMA 3V42A 2L5QA 3OYCA 2QKLB 1UAAA 1D1CA 3OY9A 5JHFA 3K4MA 4XLCA 2Z2SB 4DBQA 4GRIA 4HNTA 4Y33A 3AKZA 2RREA 3BG6A 2R7TA 1Y56A 1V5FA 2IS6A 2I8DA 1DP3A 2MFZA 2QKMB 2LY2A 2XF5A 3BCAA 4CUGA 3VWBA 4XR6A 3UNGC 2R7WA 3RCOA 4DJAA 1N77A 3HOSA 5CQGA 1D0YA 3CJRB 4HG2A 2CW8A 2K9LA 2L7KA 2BOLA 1V5EA 4LITA 1ZELA 2WY8Q 4CCLA 3G2BA 4P5OA 4BE0A 3CP8A 2KQRA 3SYTA 4DGWB 4X0GA 1ERDA 2E5NA 4PFOA 5FROA 2CV2A 4LIVA 4HSRA 3L2WA 2CV0A 2ZFUA 4BJ6C 4KJZA 2WAFA 4CCKA 1T95A 4XLFA 2PMZA 3S8PA 4BDYA 1HA8A 2VQGA 3A1YA 1V5GA 3E0JB 4RLQA 4BEHA 3K4JA 2ELJA 2VB6A 3VYRB 1D1AA 2X1EA 3BC8A 3CMMA 1D1BA 4E7IA 3VSKA 4CZCA 5FRMA 4P1WA 1BR2A 3HPGA 2HVQA 2F4IA 2M3AA 2KLOA 3W2AA 3FBIB 4H4KC 3PL8A 4KISA 3ZQQA 2R7XA 1Z3XA 1WJAA 1X1CA 1IRXA 4BJTA 2KRHA 4FASD 2LY1A 2M4GA 2WAQA 4YRVA 3IAS2 4XKVA 3H9QA 3ZXSA 2XDVA 4F91B 4D1QA 4EATA 2L2OA 4XKWA 4JQFA 1DQUA 3S3MA 4E7ZA 1X4OA 1YX5A 2LC2A 3PNTA 3KEYA 2KDOA 4DOZA 4XMYA 1QHHD 3A2KA 3VYSB 4HEA2 2GOMA 1WJCA 3MKZA 3S3NA 3K70C 2R4GA 3LSHA 2VQLA 3IAM2 3VYTB 2IGOA 3OYIA 4ZJZA 3HUGB 1GLNA 4PJMA 2L9SA 1LVKA 2IGNA 2DT6A 3OS1A 4CH7A 1VZ0A 2NOJB 3HC7A 2MYSA 3K4NA 2W00A 1WJ5A 4CCNA 3VSLA 3H0DA 4R79A 3DPUA 2VXZA 4NNJA 1J09A 1WJEA 2LG4A 2V7FA 4RMNA 2R7RA 1Z7LA 3H5RA 3TBIA 3OYMA 2VJ4A 1X1DA 2HNHA 5HVQC 2VLAA 2Q2EB 2AQEA 3CJQB 4HRIA 2DCEA 4RLFA 4B3XA 3HOTA 3RSNA 2RQQA 4HSTA 3OYGA 1MNDA 2R7OA 1WJFA 3OIQA 4RM2A 3IUOA 2OUMA 2JUGA 2LREA 3UR3C 2K3PA 2IGMA 3ONQA 3A4CA 2VIXA 4XORA 5KHDA 2KRCA 2E1MC 2PJRB 2F5VA 2AQFA 2JA2A 2O5RA 3D5LA 1G59A 1AA7A 3K4BA 1EA3A 2KMUA 2JVGA 2M4KA 3LFUA 2X6XA 4NUBA 2VQCA 3N05A 3ZCOA 3DPLC 3AFHA 3AL0B 2HVSA 4E7KA 1N78A 2W4SA 5HNHA 3AL0C 4IZZA 4IKFA 5KNLA 3HL2A 1BR1A 4XN3A 3FKJA 3CZ6A 2LBFA 4XQFA 2UV1A 2VKHA 2Z1DA 3BG7A 3SEQA 4B48A 1W36C 2HZDA 2R7UA 4AVZA 3CESA 3FHNA 4CCOA 3PFYA 3CF2A 2IGKA 3RQ4A 1MMAA 3PNYA 5LD2C 2ZXIA 3SEZA 1LFPA 1SAUA 2W1OA 2MD0A 4IQ4A 2IXSA 3D5SC 5HLTA 2LOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VXD A; 
#chains in the Genus database with same CATH topology
 4UUS A;  4M6V A;  3ABU A;  2XV4 S;  3F8F A;  3T8R A;  1B1B A;  3CLO A;  2LSO A;  3OYH A;  1XSV A;  2CW7 A;  4LJZ F;  1IUF A;  3CME I;  3R4K A;  4HBL A;  1NG7 A;  2E1C A;  4BY1 J;  3KZI C;  3X2Q H;  1JGG A;  4F55 A;  4LB6 B;  3RPU D;  4FX0 A;  2NVU B;  1X1P A;  1T8I A;  4E4H A;  2VOP A;  1XSD A;  3BRO A;  1FP2 A;  1X1A A;  1R49 A;  2H1K A;  4C2U A;  1ETQ A;  2MLG A;  2QA4 I;  1CQT A;  5H6R A;  3DBH B;  3ZMT A;  2BZT A;  4PFP A;  1L3L A;  4C30 A;  3Q0U A;  3OYB A;  3EYI A;  1I3A A;  2RKH A;  3CJN A;  3JRF A;  2WY7 Q;  1LJ9 A;  1U9O A;  3HEF A;  1R9T J;  2R7V A;  2YUS A;  4L9J A;  3JRC A;  4BKX A;  2ZNY A;  5GAD J;  4L5J A;  4BBR J;  2MC4 A;  4XNF A;  4HLX A;  4BYY A;  3W2V A;  2G7H A;  2DA1 A;  4Y4R A;  1ETK A;  3ABT A;  2GIZ A;  2PN6 A;  3ZR8 X;  2VJ5 A;  2VKD A;  3IP4 B;  4S04 A;  4AU7 A;  5LRS A;  2NVX J;  4Z6Y A;  4AYB A;  2NYX A;  1LDD A;  4HW0 A;  4Q47 A;  4KIG A;  4C3H J;  1IXS B;  4AM3 A;  4CYD A;  3GO5 A;  3NWT A;  1YJW I;  4KN4 X;  4YEJ A;  2Q1Z B;  4I98 B;  5HLG A;  1YG2 A;  4C3J J;  1GV5 A;  5F0H A;  3PSF A;  4AC0 A;  2A5W A;  1Z3Y A;  2GBY A;  3QYE A;  4PK4 A;  1E3O C;  3CCE I;  3CMA I;  4EM1 A;  2FRH A;  2Y0S A;  4XON A;  2M2E A;  3NEU A;  3OOU A;  2FOW A;  1MMD A;  3C1D A;  4U87 A;  2MAB A;  1OCR H;  1JUM A;  4ZZL A;  2Y31 A;  3T1B A;  5J1Y A;  3GW2 A;  2Y9Z A;  3ESW B;  3W2W A;  1X58 A;  3WTZ A;  3T8T A;  3KP3 A;  4CCJ A;  4BS9 A;  2XPW A;  3H5A A;  2VKE A;  1DP7 P;  1RES A;  3AG2 H;  5EG0 B;  3I71 A;  3KIO A;  3JTG A;  1K61 A;  5E3M A;  4MQV A;  2VC0 A;  3CQZ J;  2WA0 A;  4QPQ A;  1AHD P;  3H9G A;  4NC6 A;  2KIM A;  1OIS A;  4I7H A;  2R93 J;  1LEB A;  2VN2 A;  3ZRG A;  3OYD A;  2V4J C;  2UZK A;  2P7V B;  4LIU A;  1MNE A;  5F64 A;  4JBA A;  1P92 A;  1B9N A;  2DA6 A;  2NS0 A;  4ZYD A;  1DGR M;  2XAJ A;  3CCS I;  1D8K A;  3HHH A;  3H9J A;  4U88 A;  4L5E A;  2LH9 A;  5CYV A;  5ED4 A;  4L0Y B;  1ZR4 A;  1X1B A;  3JRB A;  2EA2 A;  2CH0 A;  3M8E A;  4OMY A;  1ZGJ A;  3I56 I;  2R92 J;  1Z05 A;  5E1Z B;  4OWR B;  1XGN A;  1V4R A;  3PFI A;  3LMM A;  1E3H A;  1MMN A;  4BQN A;  2OF7 A;  3HXL A;  2ZXH A;  4M3F A;  5F0C A;  1RR7 A;  3L2V A;  4C2T A;  2CO5 A;  3TQN A;  3Q0W A;  1JTY A;  2F6C A;  2LR8 A;  3QYF A;  3SZP A;  3OL3 A;  2W48 A;  3KP5 A;  1IZ1 A;  3O8G A;  4ENN A;  3GWZ A;  2M34 A;  4R8H A;  4B44 A;  3RKQ A;  2H27 A;  1XG1 A;  1KA8 A;  5FB2 A;  4I0A A;  5IP9 J;  1ULY A;  3F9K A;  3PNV A;  3J81 Z;  1WCM J;  3M1E A;  3OYK A;  2XRN A;  1ODD A;  3F23 A;  1JGS A;  3Q3S A;  4E7H A;  4ANJ A;  4B8X A;  3K4K A;  4UV8 A;  1HW1 A;  5K7Z A;  3ZQG A;  3V7R A;  1F43 A;  2X4H A;  5EZG A;  2VPR A;  3NQO A;  4LLG F;  3ZGK A;  5ILS A;  3HOX J;  4NC7 A;  2IA0 A;  4PUS A;  1A31 A;  3LQR A;  4IHY A;  1TBX A;  5J4Y A;  2BHY A;  4LG0 B;  4RB1 A;  2KHM A;  2V9K A;  4U7B A;  1PJR A;  1A36 A;  3OS2 A;  2ADU A;  3PUF A;  4BUP A;  1YE9 A;  2W24 A;  3AAF A;  2CV1 A;  4HNU A;  3ZMV A;  1ZKG A;  2ICW G;  2I10 A;  3IWF A;  2XGE A;  2DOA A;  2NOG A;  4MO7 A;  5E79 C;  2DTZ A;  4Y17 A;  5FKK A;  4I6Z A;  2ECC A;  2TCT A;  3U1K A;  5E3N A;  4M9Z A;  1LQ1 A;  2HU9 A;  4ZTJ A;  4XRF A;  3DLA A;  3S14 J;  2XF7 A;  4KIT B;  2GWR A;  2ZJR F;  2ELH A;  4A93 J;  2DK8 A;  3FXK A;  3MFK A;  4HX7 A;  2Q2E A;  1ZG1 A;  4XOP A;  5K5Q A;  3FXM A;  4IRG A;  4KNY A;  1TP4 A;  2LLK A;  1IRZ A;  5D6F A;  3G6E I;  2K5C A;  2WAD A;  1X19 A;  1G3W A;  2BY0 A;  1OCC H;  3G3Z A;  4KT6 A;  1XGM A;  4CA0 A;  5HDN A;  3L2R A;  2Z9O A;  1Y0N A;  4UVB A;  3V4G A;  2MH9 A;  5FKO A;  2B0L A;  3GUD A;  3WGG A;  3OR2 C;  3RKW A;  1VQ6 I;  2XAS A;  1BW5 A;  1TTY A;  2BXY A;  2OC6 A;  3HRT A;  1FBU A;  4YFK F;  2GA1 A;  3C2H A;  3FMS A;  4XN0 A;  2QSH X;  1MBH A;  3LSI A;  4NQW A;  4XKB A;  2X9D A;  4EJU A;  5BPD A;  2V26 A;  2ZME C;  5JLX A;  4EM0 B;  3H35 A;  4V2G A;  5HLI A;  2IS4 A;  3EQL F;  3JW4 A;  5IYB J;  3KE2 A;  1ZQ3 P;  3FM3 A;  5ILV A;  4A3B J;  3R61 A;  2LFB A;  4LGW A;  1ON2 A;  2L5Q A;  5D8L B;  3SQN A;  2HR3 A;  1MH3 A;  5FLX Z;  1JKP C;  4XRS G;  3IHU A;  3B6A A;  4XLC A;  4DBQ A;  1X3U A;  4OU0 A;  3Q5F A;  1SVL A;  3I4M J;  3W6K B;  4GRI A;  4A5M A;  3AKZ A;  5CJ9 A;  1T6S A;  2MA3 A;  1F4K A;  1FLI A;  2AS5 F;  1B9M A;  3QU6 A;  1K7A A;  2HI3 A;  5BQT A;  1B8I B;  2I8D A;  2IS6 A;  2DU9 A;  3TW6 A;  2LY2 A;  3BCA A;  2ID6 A;  4UUS B;  4XR6 A;  2XVC A;  1N77 A;  5HOD A;  2XB0 X;  2JT1 A;  1P2F A;  2N8G A;  4HG2 A;  1MIJ A;  4A0Y A;  4KFC A;  2V9P A;  3FXQ A;  4AD9 A;  3BTC A;  1P4X A;  3G71 I;  5E8I A;  3LFK A;  1O4X A;  1Z91 A;  3CP8 A;  3DEW A;  2KQR A;  3KYC B;  2IP2 A;  2A61 A;  4PFO A;  1QVU A;  4MTD A;  3IWZ A;  2HWV A;  3L2W A;  3H92 A;  4ENJ A;  2KFD A;  3GTP J;  1MNM C;  3BR0 A;  1GXP A;  3S8P A;  2VQG A;  4RLQ A;  3F72 A;  5ICC A;  4A3C J;  2CUE A;  3A0H C;  2JQ7 A;  1D1A A;  3BC8 A;  3VOE A;  5HS8 A;  4CZC A;  2P7C B;  2A3S A;  1GVJ A;  2Z3Y A;  1LE8 A;  2EPF A;  2JN6 A;  1YW7 A;  2M3A A;  1HDP A;  2CW0 F;  1XN7 A;  4XLN F;  5IYD J;  1X1C A;  2RC4 A;  1XDU A;  1ZAO A;  2WTE A;  2A07 F;  1NTC A;  2VE8 A;  4I0B A;  4ZYE A;  2WAQ A;  1X2N A;  4YRV A;  4M9X A;  3F22 A;  4HV6 A;  4KUM A;  4Q4Z F;  3L2C A;  1IXR C;  5AIP A;  3ZMU A;  3L1P A;  1HW5 A;  4EV0 A;  1E17 A;  4JQF A;  4E7Z A;  5M5X J;  2FEZ A;  1IF1 A;  2LC2 A;  3PNT A;  3ZN1 A;  1H89 C;  3EDP A;  2KDO A;  2M9H A;  1FPQ A;  3CCJ I;  3E3V A;  1LEA A;  4JP0 A;  3P9I A;  4EVI A;  5LGN A;  2QYO A;  2L9V A;  1T38 A;  3S3N A;  1KQ0 A;  1OCT C;  2MW8 A;  3KP6 A;  4GXO A;  1MBG A;  2VQL A;  5CVJ A;  3C7J A;  2ZJQ F;  3R0J A;  1GHC A;  3HUG B;  3DLL F;  4YIF A;  3QU3 A;  1Z0X A;  1RUO A;  2KJB A;  2YU3 A;  1LVK A;  2DT6 A;  1XCV A;  3LSJ A;  3UKG A;  4A3K J;  4AIJ A;  3H36 A;  3VSL A;  1FSH A;  4ENM A;  1JKR C;  2HGC A;  2OD5 A;  3H0D A;  3DPU A;  2VXZ A;  1KGS A;  1WJE A;  2DA3 A;  1VND A;  2R7R A;  5LLQ A;  1Z7L A;  3AG3 H;  4IL6 C;  4M3E A;  4MQ9 F;  3NAU A;  1XX5 A;  3BTJ A;  2YU9 J;  3WU0 A;  2ZME A;  2HNH A;  3RZD J;  1CF7 A;  1IXC A;  1JUS A;  1YQA A;  2FE3 A;  2A05 A;  3QWL A;  4M3G A;  2MG4 A;  5F08 A;  2P5K A;  1SD4 A;  4RLF A;  2JPB A;  3CCR I;  2EIL H;  2RQQ A;  1WJF A;  3LSR A;  5DUI A;  4U0W A;  3TOA A;  3ZP5 A;  3GZN B;  2VBX A;  1ZH5 A;  2K3P A;  2IGM A;  3ONQ A;  2L7Z A;  3LA7 A;  3BP8 A;  4A2U A;  4EMS A;  2FA5 A;  1OR7 A;  4QSH A;  5D4S A;  1EA3 A;  3IKV A;  4ENK A;  1ETO A;  3FF5 A;  1QZE A;  2FMY A;  4L5I A;  3WE2 A;  4CO8 A;  2VT2 A;  2K85 A;  3ZCO A;  3DPL C;  3AL0 B;  2IAI A;  2RN7 A;  1IRF A;  4ESF A;  5IP6 A;  2YX7 A;  3J80 K;  4IZZ A;  4LOC A;  4RA2 A;  4FTH A;  2F5F A;  1ZLJ A;  1WH7 A;  2CG4 A;  5CLS A;  3FKJ A;  4KIF A;  5F0F A;  2LBF A;  1R5H A;  1RPW A;  2UV1 A;  2VKH A;  3U2R A;  1ETY A;  2DFH A;  1XMA A;  3HM5 A;  5HS7 A;  5M5Y J;  2JA7 J;  1PVE A;  2IVM A;  3S15 J;  2E35 A;  2OCE A;  2R7U A;  5EGO B;  5LHI A;  3BG9 A;  5B3S H;  1PDN C;  3CF2 A;  3CO6 C;  4A3J J;  4DYR A;  3RQ4 A;  3FIW A;  3HOV J;  5C4X J;  3PNY A;  2ZXI A;  4F7Z A;  3JRA A;  5K5R A;  1G4D A;  4KIB A;  3P9C A;  3D5S C;  1EF4 A;  3V8J A;  2K4J A;  3BDD A;  1ZYR F;  3GF2 A;  1MW7 A;  3MZY A;  3SZT A;  2CJJ A;  1R1U A;  3LWF A;  2CU7 A;  3TL4 X;  5D4R A;  3DEE A;  3DTI A;  1J7K A;  1IJW C;  1WJB A;  2VL8 A;  2O7O A;  5HDG A;  1H0M A;  1ZAR A;  4D7M A;  5LGT A;  2HOA A;  3KZY A;  1TW2 A;  2IS1 A;  3KX2 A;  4XSX F;  2LK2 A;  3PSI A;  4MIM A;  4OOI A;  1Z9C A;  2OU2 A;  4M72 A;  1X3Z B;  3CC7 I;  5DYM A;  3PJR A;  2CSO A;  3EYY A;  2FQ3 A;  1GDT A;  5AIQ A;  1N25 A;  2X6W A;  4XLE A;  3CUQ B;  4DZJ A;  1APL C;  1G3Y A;  3MWM A;  4XLH A;  2P0W A;  2H8W A;  2BVL A;  4QWQ A;  3BJA A;  5CVV A;  5DD4 A;  1T0F A;  4DYC A;  1W36 D;  1N75 A;  3MMY B;  2ISZ A;  3CDL A;  3FXO A;  3FMQ A;  1X3W B;  1B72 A;  4MLO A;  5DDG A;  3HGY A;  1T39 A;  3J7A O;  1R7J A;  3HOU J;  5J4V A;  3OWT A;  3OYA A;  1TWH J;  1I50 J;  2D1H A;  4UUT A;  5B5E C;  2LTP A;  4HAM A;  4IJA A;  4L9N A;  4B09 A;  5J3L A;  1RET A;  3KP2 A;  2JK3 A;  2WBM A;  4V2F A;  3BR5 A;  2K9N A;  3TO6 A;  2Z5U A;  1QPI A;  3QQA A;  3SFI A;  4EJV A;  4IHS A;  2EFN A;  2RNG A;  4OIR F;  1VQ4 I;  2H09 A;  1QPM A;  1TLH B;  1IDY A;  1LDK B;  3F0C A;  2L7F P;  5E17 F;  1VF9 A;  3OMY A;  2DQR A;  3LQQ A;  4I99 C;  1QBJ A;  3HDD A;  1TQP A;  1TWG J;  2XKP A;  5EEG A;  4FET A;  1FYL A;  2DA7 A;  4LLN A;  1YS7 A;  2DT7 B;  2HQN A;  4E6K G;  3MZH A;  2DFI A;  3EUK L;  2OQR A;  3QOD A;  2R7Q A;  2JJ7 A;  4BXF A;  4XM3 A;  1YS6 A;  3F8C A;  2K86 A;  4AID A;  2VBZ A;  2BVM A;  1TNS A;  4FIS A;  3E7L A;  4Q48 A;  4C2M J;  4YFX F;  1P7I A;  3FK7 A;  4F93 B;  3F21 A;  2FBI A;  1UST A;  2HPI A;  1BN5 A;  2EFO A;  2KP6 A;  3WE3 A;  2P6T A;  5JLW A;  1IV6 A;  3A02 A;  4CSW A;  1S6L A;  4G6T B;  3DU5 A;  2WB1 N;  1ZGW A;  2R7S A;  4ZYG A;  3CCQ I;  1SFU A;  1SFK A;  2F5D A;  3MKY B;  1JHF A;  4OMZ A;  3V7S A;  2NS7 A;  4I76 A;  4A3L J;  4N9H A;  4PJJ A;  1QZZ A;  2ZXW H;  1U8B A;  1CGP A;  2B63 J;  3IH3 A;  2OA4 A;  3DEU A;  3U21 A;  3H3U A;  1K6Y A;  1T08 B;  1YX3 A;  3DFG A;  4KYW A;  2BXZ A;  2GAU A;  2P6S A;  4NQW B;  3K1P A;  3RZO J;  1G8X A;  3FMR A;  1O3Q A;  1FOK A;  2CWE A;  4ZDP A;  1MBF A;  4CYC B;  2PJR A;  4OAY A;  2CQN A;  1M1E B;  3FKI J;  4QLC U;  3MEX A;  1YOV B;  3MVP A;  5DM6 F;  1FJL A;  2KZV A;  4B1R A;  4IHX A;  3BCB A;  3BWG A;  4BH9 A;  2VJJ A;  2HYG D;  2E34 A;  2ID3 A;  5KAI C;  4OIQ F;  2VPL A;  3DKX A;  2QSF X;  4IQJ A;  1E0E A;  2L9R A;  3H5N A;  1KU7 A;  1I27 A;  4HOB A;  5BS6 A;  3I55 I;  4DZP A;  1MMG A;  3HTS B;  2X1C A;  5E18 F;  3NWS A;  4GDF A;  5J8C A;  1TNT A;  3FXL A;  4UNO A;  2OZU A;  4LMY A;  1FMW A;  5J1U A;  1SC7 A;  2M5W A;  1Z7U A;  3BR3 A;  1XGS A;  3H0G J;  3I9V 2;  2FNA A;  2RDP A;  3ZQC A;  3ASN H;  3JRI A;  1FTZ A;  3O3K A;  3KPH A;  4UB8 C;  4ZYA A;  1Y1W J;  1GXQ A;  4MGR A;  1I3Q J;  1S8N A;  2DJN A;  2ZO4 A;  3CO7 C;  2LNB A;  4RAZ A;  4J00 A;  2UUZ A;  2O3F A;  3FXR A;  1QA6 A;  5KAF C;  1REP C;  1OPC A;  2LY9 A;  2K7L A;  1SVM A;  3A03 A;  5K7F A;  4UY8 I;  2CS3 A;  2CGP A;  1QVT A;  3K7A J;  2FU4 A;  5DEQ A;  5HS9 A;  1P7J A;  1UHS A;  1OKR A;  1KU3 A;  2BW3 A;  5J6X A;  5BOX A;  2WC2 A;  3B6C A;  3SDB A;  5GAG J;  1NHA A;  2GXB A;  4FE4 A;  3MKW B;  5M5W J;  1HSJ A;  4A0X A;  1Z1D A;  3JRD A;  4OAZ A;  3DKY A;  1HLV A;  4JYK A;  2HVR A;  3A01 B;  1VQ7 I;  1ZG5 A;  1PUE E;  2K9Q A;  1HKQ A;  1U3E M;  1Z21 A;  3AG1 H;  2DLL A;  1S29 A;  2L0K A;  4D9J A;  2VBW A;  2K9S A;  2KPM A;  2RNJ A;  4YEL A;  5D5V B;  3BJ6 A;  3EPZ A;  1XC5 A;  3GBG A;  2BY3 A;  3WU2 C;  3U9G A;  2QGU A;  1NK2 P;  4IO9 F;  3IRQ A;  2PX9 A;  3RI4 A;  2HZT A;  5ERI A;  3T0Y A;  3K4C A;  1K4S A;  2CUF A;  4DQ2 A;  4YII A;  2XSJ C;  1I39 A;  5EEH A;  2GIV A;  3O8H A;  5KCM A;  2QKL B;  3SFZ A;  2O6G E;  1R36 A;  2LMD A;  5IY5 H;  3KYD B;  4BXU A;  1D1C A;  2G7U A;  2OTJ I;  5IYC J;  2J5O A;  3GME A;  4O5V A;  1HXD A;  2Z2S B;  1IGN A;  2H6C A;  4B4C A;  3CCM I;  3W6V A;  4HNT A;  5C4J J;  3BG6 A;  2R7T A;  3LA2 A;  5DCF A;  4RAG A;  1P4A A;  3G1L A;  3M8F A;  2EIN H;  2QKM B;  3QAH A;  5KK1 A;  4H0E A;  1UFM A;  4AWX B;  4CUG A;  1CF7 B;  1R5G A;  3HOZ J;  3RCO A;  5L3C A;  5LHG A;  2X48 A;  3WU1 B;  4RS8 A;  2E71 A;  3BJO A;  3GXO A;  1VQP I;  2XGC A;  2BOL A;  4M9S A;  3HTU A;  5IPA A;  3VFZ A;  3IC7 A;  1ZEL A;  1EKE A;  4P5O A;  5IOZ A;  1R1V A;  1ZLK A;  3WTS C;  2DYR H;  3SYT A;  3ULQ B;  2YPR A;  4LIV A;  4IOA F;  2HOE A;  3QRF F;  6PAX A;  2CV0 A;  4BJ6 C;  3BZK A;  3MQ0 A;  2WAF A;  4BHC A;  4AIK A;  2RGV A;  4XLF A;  2PMZ A;  1T33 A;  2VBY A;  2NAZ A;  3VB2 A;  1RKT A;  3A1Y A;  1V5G A;  3SHF A;  3V8K A;  1HKS A;  1OYI A;  5L3B A;  5C44 J;  1RKW A;  2X1E A;  2E2I J;  3I54 A;  1D1B A;  3VSK A;  4NB5 A;  3F8B A;  1SAN A;  2W84 A;  5GPA A;  1JKQ C;  1USS A;  1U5T B;  4EJT A;  2F4I A;  2BYV E;  5D5U B;  1B4A A;  2RV8 A;  3Q0V A;  3VEP A;  2DFF A;  1ZTR A;  2KLO A;  1RIO H;  2ECB A;  3G1M A;  4KIS A;  3H3V K;  1WJA A;  1SFE A;  4JX4 A;  1IRX A;  3HJE A;  3CJT B;  3GTQ J;  4RAF A;  1YW8 A;  2D1V A;  4FAS D;  4NDL A;  2XRO A;  4KA4 A;  5FLM J;  4FQG A;  3IAS 2;  5ILU A;  3ZXS A;  3JCU C;  3RPU A;  2HEO A;  4YFN F;  3WHB A;  4EAT A;  1DQU A;  3QPL A;  3S3M A;  1X4O A;  5EZH A;  3CLQ A;  2OBP A;  2NVT J;  1UHW A;  1OCP A;  2ETH A;  3KEY A;  4XMY A;  1A6Q A;  2P8T A;  3KLO A;  4E70 A;  3GFM A;  4HEA 2;  4D7N A;  2GOM A;  1WJC A;  3MKZ A;  2Q8K A;  1O7F A;  1XDS A;  4A6E A;  1WI3 A;  1ACI A;  2R4G A;  2ZXJ A;  1R22 A;  2BE5 F;  2GA2 A;  5B1A H;  1J0R A;  2EWN A;  3LSH A;  2JUC A;  5M3M J;  2H6B A;  2NNN A;  4ZJZ A;  3DV8 A;  1GLN A;  2JZY A;  1FBQ A;  2A68 F;  1W1W E;  3OS1 A;  1H88 C;  2PG4 A;  2X0L A;  2DDA A;  1U6G A;  1VZ0 A;  1EH8 A;  2NOJ B;  2F4M B;  4LFU A;  3K4N A;  4WXH A;  2W00 A;  1WJ5 A;  2OQG A;  2HKX A;  4CCN A;  4IHV A;  2EZK A;  4A69 C;  2HXI A;  1R5I D;  4NNJ A;  5K7H A;  2LG4 A;  2MBF A;  2QUF A;  5DD8 A;  1BW6 A;  3HOW J;  3GTO J;  2Y48 A;  1KQ9 A;  1IUY A;  1FY7 A;  2F5E A;  2VLA A;  2GZW A;  4K2E A;  4WX9 A;  2AXL A;  4X6A J;  2R7D A;  2YS9 A;  1SVO A;  2TRT A;  3HOT A;  4S0H B;  4M6Y A;  3OYG A;  4HST A;  3I5U A;  3OIO A;  4N0B A;  2JUG A;  3ZN0 A;  1WQ2 A;  3OV8 A;  3UR3 C;  3IH2 A;  2L01 A;  1QGP A;  3QOP A;  1F36 A;  2VIX A;  2D5V A;  3GZ5 A;  2WWY A;  2L3D A;  2YR2 A;  3M07 A;  2O5R A;  1W7P B;  1XS9 A;  1LFB A;  1AA7 A;  4CGZ A;  1WHU A;  2DFE A;  1WKM A;  2M4K A;  5EYR A;  2MLK A;  2VQC A;  5EF6 A;  3N05 A;  5IP7 J;  1J9I A;  1U2W A;  3S2H J;  5EJC A;  3LA3 A;  3S1M J;  1ZGA A;  1GV2 A;  3I0T A;  3GTK J;  2EH3 A;  2R7F A;  3BZ6 A;  3E6B A;  1UZC A;  5F04 A;  1YIT I;  5F1J A;  2FOK A;  3K2Z A;  3HL2 A;  1DDN A;  1BI0 A;  5FLX K;  2DMQ A;  3CZ6 A;  4XQF A;  2Z1D A;  1IN5 A;  2QQA A;  3HSE A;  1HCR A;  1W36 C;  4HF2 A;  2HZD A;  3WTX C;  2QBY B;  1FWZ A;  5IOY A;  3CES A;  3F8N A;  4N9I A;  3FX3 A;  2KJC A;  4D5C A;  1PUF B;  1V3F A;  2EBI A;  5L3E A;  1YHQ I;  5BMZ A;  2DAO A;  1MMA A;  1ZG3 A;  2KDZ A;  1XTA A;  5LD2 C;  3SEZ A;  2W1O A;  1JUP A;  5FKL A;  1P6R A;  5GP9 A;  2ZB9 A;  2R3S A;  1RR8 C;  1SMY F;  5HLT A;  4AVP A;  2LOO A;  2P81 A;  2MH2 A;  1YIJ I;  3HRU A;  4JOM A;  3S2D J;  2EV0 A;  3WTU C;  1OYW A;  3GTG J;  3GLX A;  4G94 A;  4PDK A;  1LDJ A;  4LG0 A;  2HQA A;  1G3T A;  1V55 H;  2IBD A;  4UV9 A;  1FOW A;  4AIH A;  1MSF C;  1GVD A;  1GUU A;  4KT5 C;  1F1Z A;  3M3Y J;  3DWL E;  4XL9 A;  3CCL I;  4F52 A;  3OL4 A;  5F27 A;  3I3L A;  4G6Q A;  3DTK A;  3JAM K;  4IVN A;  4BGD A;  4QPO A;  3R6S A;  4A3D J;  2I5U A;  1ZRF A;  2DJI A;  2LKX A;  1YJN I;  1D5V A;  4FT8 A;  2LRD A;  1OMI A;  1UG2 A;  2KL4 A;  4IPA A;  1WWX A;  2JWT A;  5FD6 A;  1TC3 C;  1Y39 A;  2BY2 A;  2R7Z J;  5FRN A;  2KIS A;  1I5Z A;  1WI9 A;  1K78 A;  2DYS H;  1H9G A;  1QHG A;  2DDB A;  1KYW A;  2D2W A;  3K70 D;  1TQI A;  3ZQI A;  3HKZ A;  1MH4 A;  1OQY A;  1YYV A;  3C2G A;  1T2K A;  2XB5 A;  1S7A A;  2JA6 J;  4B43 A;  4BQO A;  3EUH C;  3PIO F;  4IEJ A;  1T56 A;  3EUA A;  2EB7 A;  3BQY A;  4WWC A;  3M8J A;  2CFO A;  1FYM A;  5JR3 A;  3I64 A;  5JVT A;  4QIW N;  3SXY A;  3RQI A;  3WOD F;  2FD5 A;  4FX4 A;  2ZFW A;  4RAY A;  2RVC A;  2VXD A;  2ELK A;  1OR7 C;  3G1O A;  1X4P A;  2EK5 A;  2ISY A;  3K69 A;  2K9M A;  2M8G X;  2GLO A;  3M9A A;  2XGD A;  1R58 A;  3LAP A;  4HQM A;  3S3O A;  3GTJ J;  1SFX A;  1BJZ A;  4FE7 A;  2R5Z A;  2ZSI B;  2HFH A;  1YW9 A;  1R6R A;  2HQ5 A;  5FO5 A;  1R23 A;  4ZDL A;  3LSM A;  1UEL B;  5TJJ A;  2XC7 A;  1LNW A;  2DBB A;  3M1C A;  4XBF A;  4NHJ A;  1X2M A;  3MN2 A;  3BR6 A;  3WTV C;  4HDU A;  1W7P A;  2XAU A;  2Z16 A;  2HTS A;  1Y8Q B;  3B73 A;  2HOT A;  4ABZ A;  2VT3 A;  3GTM J;  5AON A;  1S72 I;  5CQE A;  1W5C C;  3AG4 H;  1BL0 A;  1XMK A;  4G8X A;  1DGW Y;  4UUV A;  2XRL A;  1J75 A;  1Z67 A;  3PIP F;  1SD7 A;  1ORK A;  2BW3 B;  1DPU A;  1U5T A;  1ZHF A;  4BL0 B;  4P9F A;  4II3 A;  3ZQL A;  2YSR A;  1ONV A;  1VFC A;  2X85 A;  3MZ8 A;  4WXD A;  2A5Y B;  4NC8 A;  1UG0 A;  5HNF A;  3RPQ A;  2DXI A;  1VQO I;  4LB5 A;  1BR4 A;  4GFB A;  3ECO A;  1QQI A;  2UWM A;  4CCM A;  2XAH A;  2K02 A;  3HSR A;  3HZJ A;  4DBR A;  4B3A A;  3MCZ A;  4D5F A;  2LF8 A;  5DCM A;  1VQM I;  5BNG A;  5CKT A;  5H2F C;  5M3F J;  2PBI A;  4Y15 A;  4PJ0 C;  2VJI A;  2HQR A;  2JSC A;  2M0M A;  3GYH X;  2LP0 A;  4EQQ A;  4RM3 A;  1LUJ B;  3LSK A;  3OS0 A;  1J59 A;  1YRN B;  3J80 Z;  1TZL A;  1ZR2 A;  1WZ2 A;  4I01 A;  3CTA A;  4PSW A;  3J7A Y;  2V1N A;  2DA5 A;  3CCU I;  1R00 A;  4IX7 A;  2IJL A;  3OIP A;  3HGG A;  2V79 A;  4Z2Y A;  1I1S A;  1E2X A;  2VC1 A;  4LLL A;  4A3G J;  5FFZ A;  3S16 J;  2HKO A;  1I1G A;  3OYF A;  2H94 A;  3RTR A;  4XRM A;  4M6X A;  4MHG A;  3LSG A;  2QBY A;  3C3W A;  1BI2 A;  3T5X A;  4M3D A;  2W82 A;  4IRH A;  4TV7 A;  2X51 A;  5LEK A;  3BPX A;  2EJR A;  5DV5 A;  4BHP A;  2COM A;  2G0E A;  1SMT A;  1ENH A;  5JI6 A;  5DS9 A;  3RYP A;  3CC2 I;  1PYV A;  1S9H A;  2XAG A;  3CCV I;  3LL7 A;  2FXA A;  3ZMZ A;  3I4P A;  3B02 A;  5EG0 A;  4E7J A;  5GAH J;  4HX8 A;  5E3O A;  1ETX A;  5LFA A;  4DNC A;  3GCM A;  4BE2 A;  1O3T A;  3HG9 A;  4BQQ A;  1KON A;  2FX0 A;  3VPR A;  4RDU A;  3K1N A;  4XOT A;  3RKY A;  2WAE A;  2A6T A;  2X6Y A;  4RGS A;  1FNN A;  2X1D A;  1H9T A;  2F2E A;  5FJ8 J;  4OIP F;  1Y6I A;  2XAF A;  1U0J A;  3BTI A;  4PJN A;  4MNU A;  1P9Q C;  1D8J A;  1MBK A;  2XSD C;  4C3I J;  4JX5 A;  4BU2 A;  1ZK8 A;  1L0O C;  2GOX B;  1LVA A;  4XK4 A;  4PJL A;  2ZJ2 A;  2ZSH B;  2HDW A;  3TKY A;  3WGH A;  2HS5 A;  1J2X A;  4HV5 A;  3W6J B;  3CC4 I;  2NRA C;  2V6C A;  3QYB A;  1S5L C;  4N4O B;  5FGM A;  3QPH A;  2M7B A;  2VQH A;  2STW A;  2E60 A;  2FUG 2;  3N97 A;  4E7L A;  5D5W B;  4F92 B;  1GT0 C;  3TW7 A;  3J81 K;  4IHT A;  4II2 A;  3SDG A;  2WB1 A;  4CZZ A;  4G6D A;  1BOA A;  4IRI A;  2DOE A;  3CP2 A;  4L18 B;  1Z6T A;  2J5P A;  5CPR B;  3OYE A;  1HC8 A;  5FKM A;  2CQ7 A;  1K79 A;  2O03 A;  2DN0 A;  2E5Z A;  3P5J A;  4LG3 A;  2FJ1 A;  3HBL A;  1IN6 A;  1WH5 A;  3E97 A;  2PEX A;  3DPT A;  4ESJ A;  1A5J A;  1STZ A;  3WG7 H;  1IN7 A;  2CMP A;  2GQQ A;  2QVO A;  4J01 A;  2JA8 J;  3VYU B;  2KT0 A;  5L3F A;  1G6N A;  1S7E A;  4BEH B;  1JI8 A;  1ZN2 A;  4FHT A;  5ICG A;  1C0W A;  4PGG A;  4XLA A;  2L02 A;  1FOX A;  3HUG A;  5EGO A;  2ZNZ A;  3SJM A;  3JSO A;  2W57 A;  5K5O A;  5IT9 Z;  1A04 A;  1RI7 A;  1UAA A;  1UJ8 A;  2XPV A;  2ESH A;  4RGR A;  5JHF A;  1H8A C;  2KZG A;  5GPC A;  1HDD C;  5L3D A;  1EH6 A;  3E5U A;  2EV6 A;  2NS8 A;  1I6X A;  5D8K B;  5FLV A;  3QP6 A;  4Y33 A;  1SAX A;  2RRE A;  1Y56 A;  1B59 A;  2Y0M A;  3Q9V A;  3BG3 A;  2GM4 A;  2Y75 A;  1UHM A;  2BHZ A;  3EUH A;  4ESB A;  3Q9S A;  1FBS A;  4IHW A;  1DP3 A;  2MFZ A;  5DTD A;  5D5X B;  2XF5 A;  3BR2 A;  1IN8 A;  2EV5 A;  3UNG C;  4DJA A;  3G4S I;  2R7W A;  3LNQ A;  1FZP B;  4FCY A;  1D0Y A;  1R1T A;  3CJR B;  5TRD A;  2K9L A;  4IXA A;  2L7K A;  5H20 A;  4CCL A;  1YJ9 I;  3DBL B;  3S1Q J;  1XMX A;  1MZB A;  2Q0O A;  4X0G A;  1AKH A;  3M7G A;  2E5N A;  2CV2 A;  2FSW A;  4G12 A;  2ME0 A;  2M8E A;  1RC9 A;  3LST A;  1QZY A;  3KZZ A;  4KJZ A;  4PCQ A;  4A3I J;  1IN4 A;  1T95 A;  3H1C A;  4CCK A;  4BDY A;  1VQ5 I;  3PM1 A;  1HA8 A;  3HOY J;  3E0J B;  3RKX A;  3WHC A;  2CFX A;  4BEH A;  2TDX A;  2R5Y B;  2ELJ A;  3VYR B;  2CRG A;  4BY7 J;  3CMM A;  2DMN A;  3LAJ A;  4LK0 F;  2YX4 A;  5FRM A;  1HKT A;  1BR2 A;  2NNY A;  1A35 A;  1NH3 A;  3MAJ A;  2H8R A;  3HKZ N;  3ERE D;  3FBI B;  2F5C A;  2HXO A;  4A3E J;  4RGU A;  2PJP A;  3ZQQ A;  1Z3X A;  1VQN I;  2PLY A;  3PO2 J;  1DUX C;  1F5T A;  3CCY A;  3O2P E;  5CVI A;  4BJT A;  2FQ4 A;  2M4G A;  2QEX I;  5EDN A;  4P9U A;  3H9Q A;  4LD5 A;  5K1Y A;  2JRT A;  3ZOB A;  3LOC A;  1P4W A;  4D1Q A;  2PMZ N;  2KIQ A;  3D0S A;  3DBR B;  2ACJ A;  1YX5 A;  2VOO A;  2DA2 A;  2V1X A;  3RIR A;  4V19 K;  4CIC A;  1QHH D;  3A2K A;  3BQZ A;  2EIM H;  3IRR A;  1JE8 A;  2AXT C;  1BM9 A;  3L9F A;  2O61 A;  1PP8 F;  1SD5 A;  1XCB A;  5JHU A;  2O8K A;  1WRJ A;  5B66 C;  2BEO A;  5D6E A;  3FWE A;  3CMY A;  4PJM A;  2COB A;  2VOD A;  2VE9 A;  4L9T A;  4A12 A;  4EGZ A;  1O7L A;  2IGN A;  2XPU A;  3K0L A;  2QZ8 A;  1Z6R A;  2IPQ X;  2UXN A;  3HC7 A;  2EA4 A;  2MYS A;  3HSF A;  4P96 A;  1KU2 A;  4KMF A;  1MD0 A;  4R79 A;  1LE8 B;  3ELK A;  1LFU P;  1U8R A;  4KMU X;  1BI1 A;  2LDU A;  1BIA A;  1KYZ A;  3KP4 A;  3TBI A;  2VJ4 A;  1D5Y A;  4G7Z F;  1X1D A;  5F6F A;  3ABK H;  3HB9 A;  2AQE A;  2LKS A;  1FEX A;  1O3S A;  2K40 A;  1J5Y A;  4B3X A;  3JRG A;  3RSN A;  2QM3 A;  1MND A;  2R7O A;  3E6C C;  3OIQ A;  3IUO A;  4Y7N J;  4AYB N;  3V8L A;  2R5Y A;  4DW6 A;  2LRE A;  4BAY A;  2L4A A;  1Q1H A;  2HYF A;  3V7C A;  4HZF A;  1YO5 C;  2FF4 A;  3RYR A;  3KEO A;  1BIB A;  3H3Z A;  5FFX A;  5KHD A;  4XOR A;  2KRC A;  2E1M C;  4GYI A;  1UB9 A;  3ML6 A;  2F5V A;  2JA2 A;  5LHH A;  1F9N A;  4MTE A;  3D5L A;  1G59 A;  1YRN A;  3HRM A;  4BBS J;  3TP0 A;  3K4B A;  1OCZ H;  3P9K A;  2QQ8 A;  3LFU A;  5JFR A;  5DM7 F;  4NUB A;  1R4M B;  2GXG A;  3AFH A;  3CDI A;  4E7K A;  3AL0 C;  5DCM B;  3LSP A;  3FM5 A;  4I09 A;  4AUX A;  3C2B A;  2P4W A;  2H1L A;  5FKN A;  1HW2 A;  2DPD A;  3SEQ A;  3TO7 A;  1WVR A;  5HDK A;  2NXN B;  3RDI A;  4CCO A;  3R0A A;  1XPX A;  3GLL A;  3I59 A;  3WTT C;  3NAR A;  2DA4 A;  2P5L C;  4U0V A;  2NVQ J;  2Y2Z A;  2AHQ A;  4M74 A;  1KQ8 A;  4BQA A;  2E19 A;  3F6O A;  2CUJ A;  3TED A;  3P7N A;  1DU0 A;  2EIJ H;  3VDX A;  3BY6 A;  4HX4 A;  3OYJ A;  3COA C;  2B9S A;  2O9L A;  4MFE A;  3IH4 A;  2MSY A;  1MJB A;  2A6H F;  2OJE D;  4RB0 A;  3GVA A;  4O3M A;  3DF8 A;  4BAC A;  4RB2 C;  2BV6 A;  2HDD A;  3ROU A;  4PGH A;  3FHZ A;  3BR1 A;  2XHK A;  1ON1 A;  2PFB A;  3S2W A;  1ZRE A;  3HIF A;  4G9Y A;  4PSX A;  1ZRC A;  4ZZD A;  3CUO A;  5CVU A;  4EM2 A;  1UCR A;  3CUQ A;  4HNV A;  1MDM A;  3ZQH A;  3ERM A;  3L2Q A;  2V1U A;  2PMU A;  2WV0 A;  1NK3 P;  1MKM A;  1G2H A;  3C18 A;  2CQQ A;  4IOC F;  3K1M A;  2EIK H;  2M87 A;  2RAE A;  1Y8R B;  3MKL A;  3E6D A;  4XIC A;  2ME6 A;  2KKO A;  2W85 A;  1WJD A;  4BNC A;  1IV8 A;  3DKW A;  4CYC A;  4OIO F;  3TDU C;  2W7N A;  1FP1 D;  3IL2 A;  4G7O F;  4CDG A;  4B47 A;  5J1R A;  1JT6 A;  2IS2 A;  1BI3 A;  1QRY A;  1FMV A;  3BLY A;  2DMT A;  2BGC A;  1HF0 A;  1Q1V A;  1SFO J;  1D0Z A;  4F3Q A;  4M71 A;  3ZQ7 A;  2CYY A;  2DPU A;  1D0X A;  5A2Q K;  4JX6 A;  2DI3 A;  1LKX A;  4ZYH A;  3ZMS A;  5IT9 K;  3SZG A;  3TO9 A;  1KU9 A;  3FIS A;  3S1N J;  2FBH A;  2LBF B;  3RJP A;  4BHB A;  3WGI A;  3KET A;  3BOQ A;  1JKO C;  4I2O A;  1IAW A;  1VQL I;  1RZ4 A;  1I6H J;  2VI6 A;  4E7S A;  4RGX A;  2GXA A;  2CUZ A;  1AOY A;  2QQ9 A;  1IC8 A;  2EFW A;  2QEN A;  3KEQ A;  3TP3 A;  3L2U A;  4BDZ A;  3OYL A;  2ZBK A;  3GX4 X;  1MJ9 A;  1OFC X;  3GEZ A;  3KYL A;  1TT0 A;  5TIS C;  1S3J A;  3DP7 A;  2R5Z B;  3CUQ C;  2EZI A;  4YIR X;  2JVH A;  3BG5 A;  3GZ6 A;  2VAS A;  1UMQ A;  5F1R A;  1JTX A;  5GTH C;  1QU3 A;  2Z99 A;  1BC7 C;  3J7Y J;  1XD7 A;  3K6G A;  1IG7 A;  2HOS A;  1W0U A;  3HYI A;  1WFX A;  4X1E A;  3ZPL A;  1POG A;  2OCC H;  1K83 J;  4MEX F;  1BBY A;  4HF0 A;  4D0P A;  1JJ8 C;  1JT0 A;  3W3C A;  3K4L A;  1U5T C;  2ZKZ A;  4WXC A;  2LYC A;  4LK1 F;  3E1S A;  2ZC2 A;  5E20 A;  1FT9 A;  1RRJ A;  3FDY A;  3ABM H;  2AO9 A;  3BTL A;  1WPK A;  5J8F A;  1W5T A;  2HDC A;  1FOY A;  2B7E A;  3DTE A;  2D45 A;  4C9Y A;  2E2H J;  1FTT A;  4UXN A;  3ISP A;  3F8M A;  4BJ5 C;  9ANT A;  2V9V A;  2JMW A;  1EH7 A;  3E6M A;  3PO3 J;  1BOB A;  4HDV A;  4I02 A;  2QCO A;  5A2Q Z;  3QOE A;  2E7X A;  2KIF A;  3S32 A;  4RBO A;  4HLY A;  1MBE A;  3I59 B;  2EFP A;  2L9N A;  3E5Q A;  2V6E A;  4HPQ A;  4UB6 C;  2E1M B;  3S93 A;  3DU6 A;  3U1D A;  5HOO A;  1A6I A;  1QNT A;  1B8I A;  3TMO A;  2VON A;  4ZC3 A;  2PMH A;  2Y69 H;  4BE1 A;  4UVC A;  2MGQ A;  2IW5 A;  4WF2 A;  1K6O A;  2E36 A;  5GAE J;  4ETS A;  1ETW A;  3K10 A;  3HPH A;  4A5N A;  4Y3O A;  5H6Q A;  4L9V A;  5EEA A;  3JSP A;  1FYK A;  2DMU A;  3OOP A;  1TL8 A;  2OTL I;  2DOF A;  2VKV A;  4G7H F;  1E3P A;  5HLH A;  2P5V A;  2FBK A;  1XGO A;  1FIP A;  5B1B H;  4ZDO A;  5BPI A;  2RQP A;  1OLT A;  2DTR A;  2XKO A;  2VUM J;  3KFW X;  4IF4 A;  3I53 A;  4N4N B;  3I58 A;  4ON0 A;  3MD2 A;  3DQV C;  5J40 A;  5LRR A;  4PZJ A;  1K78 B;  2LVS A;  4U0Y A;  2DK5 A;  3WG9 A;  3FK6 A;  2IA1 A;  2XF6 A;  2Y0S N;  4CHU A;  4Y52 J;  1YI2 I;  5LBQ A;  1SD6 A;  4XKC A;  2ZJP F;  2PI0 A;  3OYN A;  3S1R J;  1W5S A;  4A6D A;  1OYY A;  4ZTF A;  3VOD A;  3D5R C;  1IRG A;  1NG6 A;  2M7A A;  1MBJ A;  1FC3 A;  2HPM A;  1IW7 F;  4YG2 F;  4A3F J;  1TWF J;  2CQK A;  3ABL H;  3K2A A;  2FML A;  1TQM A;  3OR1 C;  3PUB A;  4WCG A;  2IA2 A;  2BBY A;  2OV7 A;  5TGT A;  1IO2 A;  3ZMD A;  3QPT A;  2JTV A;  1XB4 A;  2XGX A;  2JSP A;  3ECH A;  3L7W A;  2LF7 A;  2M45 A;  1T0F C;  3FBN B;  2M30 A;  4UVA A;  4DIQ A;  1YLF A;  1AWC A;  1ETV A;  4Q5S F;  2EQR A;  1HBX G;  1S7O A;  1VI0 A;  1YIO A;  1Y1V J;  2QF7 A;  4ITV A;  1TWC J;  4XID A;  5JVG F;  2CQX A;  1EJ9 A;  1D3Y A;  3V42 A;  3OYC A;  1LPQ A;  3J7Z I;  2R0Q C;  4U7D A;  1TWA J;  4HYE A;  3TOB A;  3FZV A;  2LKP A;  3OY9 A;  4M3B A;  3OSF A;  4XSZ F;  3K4M A;  2EFQ A;  3KLN A;  4QTR A;  5FD5 A;  5C3E J;  1V5F A;  1JHH A;  2PQ8 A;  2QWW A;  4EJW A;  2F48 A;  3JRE A;  1U78 A;  1RUN A;  3VWB A;  2NVY J;  3TGN A;  3D1N I;  3KP7 A;  3S17 J;  3HOS A;  5KVR A;  5CQG A;  2CW8 A;  2QLZ A;  2O0Y A;  3K9T A;  1VTN C;  1V5E A;  2XAQ A;  4LIT A;  2K27 A;  1MMS A;  2WY8 Q;  1XSX A;  3G2B A;  4BE0 A;  1AU7 A;  4DGW B;  4NBQ A;  1ERD A;  5FRO A;  4UHT A;  4HSR A;  2ZFU A;  3JAM Z;  1PP7 U;  1FSE A;  1YTY A;  3JTH A;  1W4M A;  3A0B C;  4KIC A;  2X6O A;  3L09 A;  2STT A;  2MC3 A;  1HQC A;  2O8X A;  3K4J A;  3HHG A;  3ZQF A;  2VB6 A;  1BJA A;  1TW3 A;  2E1O A;  4HQE A;  1B6A A;  4E7I A;  2LD5 A;  3BT9 A;  4P1W A;  3HPG A;  2HVQ A;  5E8G A;  1JXS A;  2DT5 A;  1FIA A;  2G9W A;  4MEY F;  4MFD A;  3M4O J;  4GO1 A;  3W2A A;  4H4K C;  3PL8 A;  3DXJ F;  1VQ9 I;  2QSG X;  2R7X A;  2E7W A;  3IV5 A;  1DPR A;  3CD6 I;  3F6V A;  4XRS A;  4EEF G;  4GCV A;  1W0T A;  2KRH A;  2LY1 A;  5ICF A;  3EET A;  2BY1 A;  4EJO A;  4XKV A;  2L4M A;  1OJL A;  3QPS A;  2E2J J;  2UXX A;  3A01 A;  2XDV A;  4F91 B;  2L2O A;  4XKW A;  1QO0 D;  2K3F A;  3GFJ A;  3IKT A;  3PQJ A;  4DOZ A;  1BA5 A;  2HTJ A;  3VYS B;  4HA8 A;  3WTY C;  2Y30 A;  4W1U A;  5L3G A;  4KDP A;  2Z33 A;  1WGX A;  3K70 C;  2K4B A;  5E1W A;  3GFL A;  5CVR A;  5J47 A;  3N4M A;  4HF1 A;  5E3L A;  2F4O B;  1O3R A;  5E1X A;  3IAM 2;  3VYT B;  2IGO A;  4DYQ A;  3OYI A;  2M1B A;  2KIU A;  2DMP A;  3R60 A;  2EZH A;  5IT3 A;  2DO7 A;  2Y9Y A;  4W97 A;  2L9S A;  1U9N A;  4L0Z B;  1R4N B;  2L7M P;  4BXX J;  3OSG A;  4CH7 A;  5GTI C;  2JRM A;  3JRH A;  1Z77 A;  4Y13 A;  1AKH B;  1OCO H;  2M0C A;  4EGY A;  1LB2 A;  2DQL A;  2WV1 A;  1HOM A;  3REO A;  3NRV A;  1J09 A;  1V54 H;  5DUK A;  2V7F A;  4RMN A;  1K4T A;  1Y0U A;  1WSU A;  4XLP F;  2JPC A;  3H5R A;  4A0Z A;  3GTL J;  3I4N J;  4J19 A;  5LEJ A;  4M73 A;  3TDZ C;  3OYM A;  2EZL A;  1ITY A;  5LGU A;  1PUF A;  4KN7 X;  5HVQ C;  3DCF A;  2DOD A;  2Q2E B;  5ICE A;  2OPT A;  1VQ8 I;  3CJQ B;  4S05 A;  1MDM B;  2A6E F;  1VQK I;  3GFI A;  4HRI A;  4O6J A;  4OIN F;  2DCE A;  3FXJ A;  1IDZ A;  4RM2 A;  2OUM A;  3O6B B;  1EV7 A;  4GGG A;  4JK1 X;  1MSE C;  3BPV A;  1MJA A;  1MGT A;  2HYJ A;  1G3S A;  3L00 A;  2IT0 A;  3F3X A;  3A4C A;  2W25 A;  2PJR B;  2ZME B;  1SEU A;  2AQF A;  2FNP A;  1TT5 B;  1RNL A;  2OAZ A;  4GYG A;  3CDH A;  2E1N A;  2IRF G;  4ZH4 F;  2C6Y A;  3E5X A;  3WTW C;  3JR9 A;  1W7P D;  2KMU A;  2XIG A;  2JVG A;  2ZCW A;  2X6X A;  2DW4 A;  1B72 B;  4RB3 C;  1DU6 A;  4CXF A;  1HST A;  3FXU A;  2HVS A;  2OZ6 A;  2W4S A;  2MD5 A;  5HNH A;  1N78 A;  1JJ6 C;  4IKF A;  1T98 A;  5KNL A;  4R1H A;  3CF5 F;  1BR1 A;  2KRF A;  2V1D A;  2ESN A;  4XN3 A;  2QQB A;  3PQK A;  3BG7 A;  2L54 A;  4B48 A;  2WAQ N;  2A69 F;  3KCC A;  1R71 A;  3QP5 A;  4P55 A;  4AVZ A;  3FHN A;  1O57 A;  1BC8 C;  3PFY A;  3HRS A;  3G73 A;  2IEK A;  2IGK A;  3ASO H;  1KZH A;  4A3M J;  2JA5 J;  4ASN A;  1LFP A;  1SAU A;  2MD0 A;  1YFH A;  4IQ4 A;  1ZRD A;  2IXS A;  1FX7 A;  4WK8 F;  2XUB A;  3BZC A; 
#chains in the Genus database with same CATH homology
 2CUJ A;  3VDX A;  1MW7 A;  3OYJ A;  4JOM A;  3TL4 X;  3OYH A;  3DEE A;  3DTI A;  1WJB A;  2CW7 A;  2VL8 A;  2HQA A;  1NG7 A;  4BAC A;  2IS1 A;  3KX2 A;  4F55 A;  3PSI A;  3RPU D;  3DWL E;  4XL9 A;  4E4H A;  4PSX A;  4F52 A;  3PJR A;  3OL4 A;  3I3L A;  3DTK A;  4BGD A;  1X1A A;  4QPO A;  4C2U A;  3L2Q A;  2DJI A;  2X6W A;  4PFP A;  4C30 A;  2LRD A;  4XLE A;  3OYB A;  2KL4 A;  2WY7 Q;  4XLH A;  5FRN A;  2R7V A;  2P0W A;  2BVL A;  1QHG A;  1WJD A;  1W36 D;  1N75 A;  3MMY B;  2MC4 A;  4XNF A;  3W2V A;  3K70 D;  4MLO A;  4Y4R A;  3HKZ A;  2W7N A;  3ZR8 X;  3C2G A;  3OWT A;  3OYA A;  2VJ5 A;  4B47 A;  2VKD A;  3IP4 B;  2IS2 A;  4B43 A;  4AU7 A;  1FMV A;  3BLY A;  4BQO A;  3EUH C;  3EUA A;  2WBM A;  4AYB A;  1D0Z A;  3M8J A;  4F3Q A;  2CFO A;  1D0X A;  3NWT A;  4YEJ A;  2Q1Z B;  2RNG A;  1LKX A;  3SZG A;  1LDK B;  3PSF A;  3OMY A;  2A5W A;  2VXD A;  1OR7 C;  1Z3Y A;  1X4P A;  3QYE A;  4PK4 A;  2K9M A;  2LBF B;  3S3O A;  4FET A;  4E7S A;  2Y0S A;  4XON A;  3OOU A;  2ZSI B;  1MMD A;  2DT7 B;  4U87 A;  2CUZ A;  4E6K G;  1R6R A;  4ZDL A;  2MAB A;  3EUK L;  3LSM A;  1UEL B;  3QOD A;  2R7Q A;  4BXF A;  3OYL A;  2XC7 A;  3L2U A;  4BDZ A;  3KYL A;  3M1C A;  4XM3 A;  1TT0 A;  3W2W A;  2BVM A;  4CCJ A;  4BS9 A;  2JVH A;  3H5A A;  4F93 B;  2XAU A;  2HPI A;  2VAS A;  2Z16 A;  2KP6 A;  1QU3 A;  3K6G A;  5CQE A;  2WA0 A;  1WFX A;  1DGW Y;  4QPQ A;  4CSW A;  4G6T B;  3DU5 A;  3H9G A;  2R7S A;  2BW3 B;  1SFK A;  3ZRG A;  4BL0 B;  3W3C A;  3K4L A;  2V4J C;  4II3 A;  3OYD A;  4LIU A;  3MKY B;  1MNE A;  2LYC A;  4PJJ A;  3E1S A;  2X85 A;  4NC8 A;  5HNF A;  1DGR M;  1UG0 A;  2DXI A;  3FDY A;  1BR4 A;  3H9J A;  3U21 A;  4CCM A;  2UWM A;  1K6Y A;  2LH9 A;  4DBR A;  1YX3 A;  3DTE A;  1X1B A;  5CKT A;  4C9Y A;  4NQW B;  1G8X A;  2CH0 A;  4BJ5 C;  4ZDP A;  2VJI A;  2M0M A;  1BOB A;  4OWR B;  4RM3 A;  2PJR A;  3LSK A;  4OAY A;  3LMM A;  1MMN A;  3QOE A;  3OS0 A;  4BQN A;  1TZL A;  3HXL A;  2ZXH A;  3S32 A;  2KZV A;  4PSW A;  3J7A Y;  2V1N A;  3BCB A;  3L2V A;  4IX7 A;  2VJJ A;  2L9N A;  3OIP A;  4C2T A;  2V6E A;  3QYF A;  2F6C A;  3OL3 A;  4HPQ A;  2VPL A;  2E1M B;  3DKX A;  3S93 A;  4IQJ A;  3OYF A;  3DU6 A;  1E0E A;  3H5N A;  5HOO A;  3RTR A;  4B44 A;  3TMO A;  3LSG A;  4ZC3 A;  1MMG A;  2X1C A;  4BE1 A;  3NWS A;  3F9K A;  2W82 A;  3PNV A;  2X51 A;  1FMW A;  3OYK A;  3K10 A;  4E7H A;  3HPH A;  4ANJ A;  3K4K A;  3I9V 2;  1PYV A;  1S9H A;  4Y3O A;  3LL7 A;  4ZYA A;  3ZGK A;  4E7J A;  4NC7 A;  4PUS A;  4BE2 A;  5LFA A;  3HG9 A;  2KHM A;  2V9K A;  4U7B A;  4BQQ A;  1PJR A;  4ZDO A;  1KON A;  3OS2 A;  4J00 A;  2UUZ A;  4BUP A;  1YE9 A;  4XOT A;  2WAE A;  2A6T A;  2CV1 A;  2X6Y A;  4HNU A;  2X1D A;  1OLT A;  1Y6I A;  4N4N B;  1U0J A;  2DOA A;  4PJN A;  3MD2 A;  1P9Q C;  3DQV C;  4BU2 A;  2CS3 A;  2GOX B;  2HU9 A;  4PJL A;  2BW3 A;  4ZTJ A;  2ZSH B;  2HDW A;  3DLA A;  2XF6 A;  2XF7 A;  3SDB A;  4KIT B;  3MKW B;  4XKC A;  3QYB A;  3OYN A;  4N4O B;  2M7B A;  2VQH A;  4ZTF A;  4XOP A;  3D5R C;  2E60 A;  2FUG 2;  1NG6 A;  4E7L A;  4OAZ A;  4F92 B;  2M7A A;  2HPM A;  2K5C A;  2WAD A;  3DKY A;  4II2 A;  2WB1 A;  2HVR A;  1X19 A;  3CP2 A;  5CPR B;  3OYE A;  3OR1 C;  3PUB A;  4KT6 A;  4CA0 A;  3L2R A;  2OV7 A;  1Z21 A;  5TGT A;  4D9J A;  4YEL A;  2KPM A;  2E5Z A;  3OR2 C;  4LG3 A;  3EPZ A;  2JSP A;  3GBG A;  2OC6 A;  3C2H A;  4XN0 A;  1T0F C;  3FBN B;  3LSI A;  4XKB A;  3DPT A;  4DIQ A;  2CMP A;  2V26 A;  3K4C A;  4J01 A;  3H35 A;  3VYU B;  2XSJ C;  4BEH B;  1JI8 A;  2IS4 A;  4ITV A;  4XLA A;  5KCM A;  3V42 A;  2L5Q A;  3OYC A;  2QKL B;  1UAA A;  1D1C A;  3OY9 A;  5JHF A;  3K4M A;  4XLC A;  2Z2S B;  4DBQ A;  4GRI A;  4HNT A;  4Y33 A;  3AKZ A;  2RRE A;  3BG6 A;  2R7T A;  1Y56 A;  1V5F A;  2IS6 A;  2I8D A;  1DP3 A;  2MFZ A;  2QKM B;  2LY2 A;  2XF5 A;  3BCA A;  4CUG A;  3VWB A;  4XR6 A;  3UNG C;  2R7W A;  3RCO A;  4DJA A;  1N77 A;  3HOS A;  5CQG A;  1D0Y A;  3CJR B;  4HG2 A;  2CW8 A;  2K9L A;  2L7K A;  2BOL A;  1V5E A;  4LIT A;  1ZEL A;  2WY8 Q;  4CCL A;  3G2B A;  4P5O A;  4BE0 A;  3CP8 A;  2KQR A;  3SYT A;  4DGW B;  4X0G A;  1ERD A;  2E5N A;  4PFO A;  5FRO A;  2CV2 A;  4LIV A;  4HSR A;  3L2W A;  2CV0 A;  2ZFU A;  4BJ6 C;  4KJZ A;  2WAF A;  4CCK A;  1T95 A;  4XLF A;  2PMZ A;  3S8P A;  4BDY A;  1HA8 A;  2VQG A;  3A1Y A;  1V5G A;  3E0J B;  4RLQ A;  4BEH A;  3K4J A;  2ELJ A;  2VB6 A;  3VYR B;  1D1A A;  2X1E A;  3BC8 A;  3CMM A;  1D1B A;  4E7I A;  3VSK A;  4CZC A;  5FRM A;  4P1W A;  1BR2 A;  3HPG A;  2HVQ A;  2F4I A;  2M3A A;  2KLO A;  3W2A A;  3FBI B;  4H4K C;  3PL8 A;  4KIS A;  3ZQQ A;  2R7X A;  1Z3X A;  1WJA A;  1X1C A;  1IRX A;  4BJT A;  2KRH A;  4FAS D;  2LY1 A;  2M4G A;  2WAQ A;  4YRV A;  3IAS 2;  4XKV A;  3H9Q A;  3ZXS A;  2XDV A;  4F91 B;  4D1Q A;  4EAT A;  2L2O A;  4XKW A;  4JQF A;  1DQU A;  3S3M A;  4E7Z A;  1X4O A;  1YX5 A;  2LC2 A;  3PNT A;  3KEY A;  2KDO A;  4DOZ A;  4XMY A;  1QHH D;  3A2K A;  3VYS B;  4HEA 2;  2GOM A;  1WJC A;  3MKZ A;  3S3N A;  3K70 C;  2R4G A;  3LSH A;  2VQL A;  3IAM 2;  3VYT B;  2IGO A;  3OYI A;  4ZJZ A;  3HUG B;  1GLN A;  4PJM A;  2L9S A;  1LVK A;  2IGN A;  2DT6 A;  3OS1 A;  4CH7 A;  1VZ0 A;  2NOJ B;  3HC7 A;  2MYS A;  3K4N A;  2W00 A;  1WJ5 A;  4CCN A;  3VSL A;  3H0D A;  4R79 A;  3DPU A;  2VXZ A;  4NNJ A;  1J09 A;  1WJE A;  2LG4 A;  2V7F A;  4RMN A;  2R7R A;  1Z7L A;  3H5R A;  3TBI A;  3OYM A;  2VJ4 A;  1X1D A;  2HNH A;  5HVQ C;  2VLA A;  2Q2E B;  2AQE A;  3CJQ B;  4HRI A;  2DCE A;  4RLF A;  4B3X A;  3HOT A;  3RSN A;  2RQQ A;  4HST A;  3OYG A;  1MND A;  2R7O A;  1WJF A;  3OIQ A;  4RM2 A;  3IUO A;  2OUM A;  2JUG A;  2LRE A;  3UR3 C;  2K3P A;  2IGM A;  3ONQ A;  3A4C A;  2VIX A;  4XOR A;  5KHD A;  2KRC A;  2E1M C;  2PJR B;  2F5V A;  2AQF A;  2JA2 A;  2O5R A;  3D5L A;  1G59 A;  1AA7 A;  3K4B A;  1EA3 A;  2KMU A;  2JVG A;  2M4K A;  3LFU A;  2X6X A;  4NUB A;  2VQC A;  3N05 A;  3ZCO A;  3DPL C;  3AFH A;  3AL0 B;  2HVS A;  4E7K A;  1N78 A;  2W4S A;  5HNH A;  3AL0 C;  4IZZ A;  4IKF A;  5KNL A;  3HL2 A;  1BR1 A;  4XN3 A;  3FKJ A;  3CZ6 A;  2LBF A;  4XQF A;  2UV1 A;  2VKH A;  2Z1D A;  3BG7 A;  3SEQ A;  4B48 A;  1W36 C;  2HZD A;  2R7U A;  4AVZ A;  3CES A;  3FHN A;  4CCO A;  3PFY A;  3CF2 A;  2IGK A;  3RQ4 A;  1MMA A;  3PNY A;  5LD2 C;  2ZXI A;  3SEZ A;  1LFP A;  1SAU A;  2W1O A;  2MD0 A;  4IQ4 A;  2IXS A;  3D5S C;  5HLT A;  2LOO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...