2VXDA

The structure of the c-terminal domain of nucleophosmin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
54
structure length
54
Chain Sequence
GGSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOPHOSMIN
publication title Structural Consequences of Nucleophosmin Mutations in Acute Myeloid Leukemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 15
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2008-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16276 NPM1-C Nucleophosmin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vxdA00
2VXDA
chains in the Genus database with same CATH superfamily
4IRGA 3WU1B 3SYTA 1TL8A 2E71A 3DBHB 3I71A 3K1NA 4XRSG 5KCMA 4EJOA 4M74A 3F8FA 2Y31A 1YS6A 1J75A 1BBYA 4QWQA 2QGUA 3OOUA 2E1OA 4YRVA 5HODA 1MH4A 3CJRB 3U9GA 4UV8A 1RETA 2NVQJ 2COMA 3SDGA 3SZPA 3IKTA 5KVRA 1P4WA 1WQ2A 3TP0A 2HVSA 1UB9A 1TZLA 2F5EA 1TQIA 4GO1A 2RGVA 2KRFA 3RKXA 4RBOA 3HOTA 4KMUX 4XK4A 3W6KB 2IS1A 5FLVA 1IDYA 4U0WA 3SDBA 2A68F 3M07A 3OYCA 1K4SA 4PJJA 5K5OA 5DEQA 3BZKA 3QOPA 3WTVC 2XRNA 5FD6A 2Q0OA 3HIFA 3QODA 2ELHA 4L0ZB 2M45A 3I54A 3T8TA 2DT6A 1HSJA 1WGXA 4EGZA 2RQPA 1O4XA 1V5FA 2X1CA 1SMTA 3GF2A 4QSHA 5IYBJ 5EYRA 4OOIA 2KFDA 1WJEA 2Y0SN 3I4PA 1P4XA 2EA2A 3UNGC 1IXSB 1QRYA 2QUFA 5JI6A 2VE9A 1PYVA 4HSRA 1OYWA 4ENJA 5L3DA 4E6KG 5FJ8J 4NDLA 4U87A 2B9SA 4ENNA 1ZR4A 3RJPA 3V42A 3OYDA 2L7KA 3EPZA 3VDXA 2N8GA 1HBXG 5LHIA 3K1PA 4X0GA 3WTYC 3OIQA 3JSPA 1X4PA 1STZA 2A6HF 2M34A 3R4KA 1QU3A 3O6BB 4HDUA 1KA8A 5FO5A 4S0HB 3Q0UA 1W4MA 4A3MJ 3E1SA 3L9FA 4BGDA 4CZZA 2J5OA 4OIOF 1WFXA 2BVMA 3IP4B 3CDLA 2L54A 2CV0A 2VXDA 3C2BA 5ICCA 2W24A 4W1UA 4AIDA 2ETHA 4H0EA 4HOBA 2LKPA 3A02A 1S7EA 1P7JA 5A2QK 4XKVA 2DFHA 1H8AC 1RESA 4Y3OA 1V55H 4CICA 3FM5A 3S32A 1O7FA 2ZSIB 2ID6A 2XUBA 1FIAA 2ZJQF 2FNPA 3ONQA 2DA2A 2RV8A 1BI3A 4PZJA 2R93J 1FYKA 1BR2A 4LMYA 4QLCU 3NWTA 5K1YA 1FOXA 2OZ6A 3L7WA 4U0VA 2QQBA 3HRTA 1J0RA 2DO7A 3CJQB 2W48A 1ZH5A 4I0BA 3KLOA 2XC7A 4A3KJ 5F27A 3VSLA 1G8XA 2E35A 3IUOA 4EM1A 2X6OA 3KX2A 4G7OF 4LK1F 2ZFUA 3HRMA 1P7IA 4IQJA 1D8KA 1GVDA 1ZGJA 2E1NA 2V7FA 3G71I 2OQRA 2LG4A 1KU3A 2HU9A 1T95A 2R5ZB 3FKJA 1J2XA 2XB0X 2VKHA 4ZTJA 1YW8A 2O5RA 2CQ7A 4UVAA 5GAEJ 3OYGA 1WI9A 3I64A 5E18F 4J19A 5LEJA 3E5UA 2WAEA 5KAIC 1E0EA 1BN5A 3Q5FA 1FY7A 1BW6A 4D7NA 4HX8A 2WBMA 2XGEA 3CP2A 2M87A 4UVBA 2DDBA 2QBYA 1UMQA 2GXGA 3JRBA 2RQQA 3HM5A 2VKVA 4XSXF 1QHGA 4ZYHA 2P6SA 4RM3A 1ON2A 1U2WA 3LQRA 4RA2A 2K27A 1W36C 4Q5SF 3TDUC 1IJWC 1LE8A 3ZGKA 3KP7A 3OSGA 3J80Z 2DPUA 2JA8J 5LRRA 1HKTA 2EH3A 4XN3A 4CCMA 5DUIA 3C3WA 2DFEA 3TW6A 3ZXSA 1IN6A 2XAGA 4UNOA 4XKWA 4F92B 5BPIA 1WJ5A 2Z5UA 3S93A 3G1MA 3BCBA 3HG9A 5FKNA 1IUYA 3RSNA 4DBRA 5DD8A 4FTHA 1CGPA 4A3IJ 4YEJA 2OQGA 2Y0SA 3H9GA 1G59A 4L9JA 2M0MA 4B3XA 1VQ9I 1NG6A 3PIPF 4P55A 2R7VA 1USTA 2HI3A 2V1DA 3OYKA 3HTUA 5EJCA 1P6RA 1TQPA 1IXCA 5H6QA 1Z1DA 1RRJA 4BXFA 4PSWA 3LFKA 3F72A 4LG0A 1ZHFA 4M3BA 2IA2A 3MEXA 1X1AA 4I01A 3JRHA 4M9ZA 5IT9Z 2NS8A 2HFHA 5TRDA 2ECBA 2JVGA 2MD5A 2PN6A 1K61A 1EKEA 4WXCA 5HLIA 5LRSA 1W7PA 1JKRC 4I2OA 1OCZH 2O7OA 2QBYB 2RKHA 3OV8A 2Z9OA 1DP3A 3E6CC 3C18A 3KEYA 4NB5A 2W7NA 1X1PA 3BCAA 1XMKA 2R4GA 4LG3A 2Z99A 2ZJ2A 2LVSA 2CRGA 2P0WA 1LE8B 2QA4I 2GA2A 4IO9F 1DGRM 1NG7A 5LLQA 2LF7A 3D0SA 4OIPF 1DQUA 2J5PA 1GT0C 1UG0A 3LSHA 5D8LB 1Y0UA 6PAXA 5ICEA 3PNYA 2NVTJ 4ETSA 3NQOA 2ESHA 2CQNA 1Z9CA 1OR7C 4JBAA 2R92J 3LL7A 3SFIA 2QENA 1IZ1A 1JUMA 3F8BA 4I0AA 2QSFX 4A3DJ 4BNCA 4LLLA 1O3SA 3GLXA 4B43A 3IKVA 1JHFA 2VB6A 1GVJA 5BS6A 1U8RA 4LITA 4WCGA 4I98B 1NK2P 2LY1A 4HEA2 2A69F 1IXRC 1OPCA 4HV5A 4BE2A 4XLHA 4MFDA 5IYDJ 2MFZA 3DPTA 4HV6A 1XCVA 3DPUA 4LG0B 2E1MC 2EJRA 1Z77A 2NOGA 3FXOA 2BVLA 2HOEA 2W4SA 3CMEI 1XSVA 4PSXA 1RNLA 2V6CA 2PJPA 3FBNB 4UVCA 3FXUA 1W7PB 3IAM2 3WTXC 5FKMA 3OIOA 4I02A 3SJMA 2KIMA 3DKYA 3UR3C 4IOCF 1ERDA 5L3FA 1TWHJ 3CO6C 3K2AA 3WHCA 2VPRA 2RNJA 2GLOA 1SFXA 1I39A 4TV7A 2OPTA 3EUAA 1YJ9I 3VWBA 2DT7B 5CVJA 3N4MA 2UWMA 5BOXA 1NH3A 1Z21A 3HBLA 3V7CA 4G6DA 1UHWA 1ZYRF 2YU3A 1D5VA 4P9FA 3L2RA 3FWEA 3CCVI 2ZO4A 4L5IA 5L3GA 4B8XA 4DQ2A 3HOYJ 1D8JA 1W36D 4C2UA 2ZBKA 1S5LC 1KYZA 2AQFA 1Q1HA 1ETWA 4CUGA 2ESNA 2L9NA 3NEUA 5ILSA 3H3UA 1MBKA 3HSFA 5DM6F 3RI4A 4MGRA 2XPUA 1R5ID 3RQIA 1YTYA 2DA7A 4FCYA 3C7JA 4EM0B 2AXTC 4BBRJ 3N97A 2Y9YA 1ZELA 3JRIA 4ESJA 1MMDA 2HTSA 2KQRA 2TCTA 1ZRDA 3BZ6A 4IJAA 1BR4A 2CG4A 2VQCA 4JX4A 4KNYA 3IV5A 3ERMA 3IAS2 3CTAA 2HQ5A 2XAJA 4XBFA 4C9YA 4R8HA 4EJTA 4ZYEA 3I9V2 4KT6A 5D4SA 2XV4S 3S3NA 1PUFA 2Q1ZB 4HX7A 2LMDA 2MC3A 3V8LA 3J7AO 2F5FA 3B6CA 4LLGF 5BQTA 4HF1A 3EUHA 3AG3H 4LB6B 4BXUA 3BR3A 2E2IJ 1ZLKA 1XDUA 2FOKA 1B9NA 4NC8A 2PX9A 1RZ4A 4XNFA 1VQ6I 4A3EJ 5CVVA 4B1RA 2R7DA 1HC8A 2F5CA 2IGOA 3ZMTA 3ZQIA 5DM7F 4P9UA 3A01A 3OYJA 1YQAA 3D1NI 3P7NA 2FBIA 1TWFJ 3GFJA 3K4CA 1I27A 2X1DA 3IWZA 3MMYB 1I6HJ 4QIWN 5KHDA 1H88C 2VPLA 4A3JJ 5B5EC 5C4JJ 3K7AJ 4RGSA 4RMNA 4YIIA 2CYYA 2EPFA 3MZ8A 1Z05A 2BY0A 3HDDA 2DA1A 3R0JA 1U8BA 4WX9A 3BTCA 4EM2A 2DMNA 3B73A 2Q2EA 4F3QA 3L2QA 2CQQA 4XICA 4D0PA 2GM4A 2EB7A 2PMZN 1FX7A 1P9QC 3WGHA 2E1MB 2EFWA 5CQGA 4PJMA 3KP2A 2XKPA 5D5XB 2P6TA 1BOAA 5FGMA 2RAEA 1HA8A 3E6MA 1ZGAA 2LLKA 4X1EA 4L9VA 1T33A 4C2MJ 1ZAOA 2A61A 2O0YA 4RAZA 2NYXA 2BY2A 5E79C 4A0YA 5J8CA 3NRVA 1TW3A 3W3CA 3KE2A 4YIFA 1PUFB 1ZRCA 2STTA 1MDMA 1LQ1A 1USSA 2CW7A 2VLAA 3TO6A 1FYMA 3OS2A 5JHFA 1MMNA 3RQ4A 2HGCA 2CWEA 4IHTA 2I10A 1A36A 1R6RA 2ZFWA 2DQRA 3A01B 2HVQA 2VIXA 4MO7A 2AHQA 3GZ6A 4P96A 2M2EA 4H4KC 2HYGD 3VFZA 3SZGA 2F5DA 3DFGA 4KUMA 5HS7A 4UXNA 3ZN0A 3KFWX 1CF7A 1RUOA 3K4LA 2BHYA 1LNWA 1YYVA 2OD5A 2Q2EB 1F36A 2CFXA 4A0XA 4AU7A 3W2AA 3PNTA 1WI3A 4ZDLA 2VBYA 3PUFA 3RIRA 1XC5A 1RI7A 1YW7A 2DODA 1T56A 3WTWC 4EMSA 1KU7A 1O3QA 3HKZN 2KRCA 2VBXA 5JR3A 1K6OA 4AM3A 5BNGA 3M3YJ 2QSGX 2COBA 3QU3A 3AG1H 3AG4H 3JW4A 2JMWA 3K10A 4NHJA 1MDMB 2R3SA 4HNVA 2RN7A 2KHMA 1E2XA 2EFNA 2R7FA 2VQLA 3KEOA 3MKWB 1OCCH 2HQNA 2ME0A 4A3FJ 2KLOA 5DYMA 1D5YA 1V5EA 3QAHA 3P9IA 2DA5A 1J59A 1X4OA 4KN4X 3HSEA 3HRSA 3LNQA 4GCVA 5CVRA 2R7RA 3QPLA 4CXFA 1SFUA 3W6VA 2MC4A 4MQ9F 3ZN1A 1BM9A 2CSOA 3SHFA 4KMFA 1FEXA 4BKXA 2XB5A 4A93J 1K4TA 1IN8A 1ZG3A 4M3EA 4ITVA 2KIFA 2X1EA 1SVLA 2JN6A 2LK2A 3OS1A 1CF7B 4MTEA 1R1VA 3BPXA 2OUMA 4ZDPA 1ETYA 2BXYA 3GTKJ 1FIPA 1ETOA 4OU0A 2EQRA 4WWCA 3IC7A 2ZKZA 4XOPA 4ASNA 4Y15A 2PMUA 2PMZA 3A0BC 4BL0B 1IN5A 4RM2A 3WTTC 2VBWA 2PLYA 2CUZA 2HNHA 5HLHA 2NS0A 1OMIA 5EEHA 2R0QC 2YS9A 4U88A 3E6BA 4DYRA 1R1UA 1HKQA 2CO5A 2GWRA 3GYHX 1I1GA 3OYNA 2H8RA 2DYRH 1TNTA 4DZPA 4XLPF 3RZDJ 3OYAA 2DYSH 2FMLA 5DUKA 3ESWB 2LH9A 2V79A 3H0DA 2DN0A 4AVZA 3MVPA 1WJBA 4BS9A 3LA3A 1X3UA 2F6CA 1FT9A 5L3EA 3K69A 5BPDA 2PJRA 1JT6A 2F2EA 2L4MA 2HYFA 4A6DA 2WWYA 1T38A 5F1JA 1X1BA 1QPIA 3AFHA 1HOMA 1MSFC 1BJAA 3GTJJ 3HUGA 4HW0A 4OWRB 1YJNI 1POGA 3WU2C 2HEOA 3D5SC 4E7IA 2CUJA 5E1ZB 2STWA 2VXZA 2A3SA 1TWGJ 3F23A 1P92A 3ABTA 3WE2A 1L3LA 3O8GA 2BBYA 3VOEA 4BH9A 4XLAA 4BHBA 1VQMI 2JA7J 2NNNA 1OYIA 4M72A 2AS5F 2EA4A 1Z67A 1MBFA 4LK0F 4NUBA 4J01A 2KZGA 1FTZA 2I8DA 2DOEA 1B1BA 4EV0A 2L7ZA 5B3SH 3GTGJ 4CSWA 3WHBA 2ID3A 3TEDA 1N78A 1BL0A 3QRFF 3RPQA 1LPQA 2RNGA 5K5RA 2MBFA 2BGCA 2Z16A 3DXJF 1C0WA 2FU4A 2X9DA 3HKZA 2LP0A 4L5JA 5IY5H 2NNYA 1OCRH 4IPAA 2CV2A 4DZJA 5F64A 2EZHA 3D5LA 3HOSA 2FBHA 4XR6A 1OKRA 1LDKB 3CF2A 5H2FC 1SD6A 3FDYA 3ZQCA 4D1QA 2OV7A 3MKYB 4A2UA 1AOYA 2EIKH 1YIOA 1MMAA 2LSOA 1MIJA 4JOMA 1JKQC 2VQGA 3HUGB 4UUTA 5IT3A 4KIBA 1YS7A 2WY8Q 3QYBA 2B0LA 4DOZA 4X6AJ 1DPUA 3CCLI 4FX4A 3G1LA 2OTJI 5FD5A 1T8IA 1X19A 2BYVE 2K3FA 2AXLA 5ICGA 2NOJB 1VQ8I 1IRFA 1VFCA 5EEGA 4B47A 5GAGJ 5J1YA 3GTMJ 1YE9A 1RUNA 2ZXHA 2ECCA 2IA0A 1TQMA 3ROUA 3RPUD 3G6EI 2P5KA 1YI2I 4RAGA 3DU5A 1S7OA 3OWTA 3WODF 5HNHA 3JR9A 4BDYA 2KT0A 5FKOA 3MKZA 1N75A 2K02A 2VQHA 2ZXJA 1VI0A 2DDAA 1W0UA 4RB3C 3H9JA 3JREA 2A5YB 5B66C 3O3KA 4HNUA 2ZJRF 1JTYA 3F3XA 1IV6A 1Z7UA 3GZ5A 3TW7A 1D1CA 2K4JA 1XN7A 3LSMA 4F52A 3I3LA 1MJAA 1WRJA 2YX4A 4KT5C 2MW8A 3RKWA 4PGHA 1FP2A 1D1BA 4DW6A 5E8GA 2ICWG 3CESA 3OYEA 4N9HA 3BROA 4BQQA 2BOLA 1QNTA 5E3MA 3RYPA 1ON1A 3CMYA 3I56I 4M3DA 3HOUJ 2M5WA 3DKXA 2Y2ZA 4E7KA 1BJZA 4RGXA 4M6YA 4MHGA 1HW5A 1R36A 1R5HA 4GGGA 4E70A 1RKWA 3X2QH 4XLCA 3BTLA 1IF1A 1P4AA 4C3IJ 4NC6A 2HDDA 1N77A 1TBXA 1QVTA 1XB4A 3IH2A 3DBLB 3PUBA 4CYCA 5HLTA 4MIMA 2W1OA 1D3YA 2JJ7A 4RLFA 4AYBN 2HPIA 3TMOA 4QTRA 1YITI 2EIJH 1MJ9A 4EJVA 3DLAA 4EVIA 2W25A 3L00A 1SC7A 3WU0A 1B8IA 4Z2YA 1W5SA 2A6TA 2CFOA 2HQAA 3CP8A 3HEFA 4L9NA 1YO5C 3OL4A 4P1WA 1K78A 3TOBA 1FBUA 3ULQB 1FYLA 4GYIA 3LSJA 3T8RA 3HGGA 2Y48A 3VODA 3VEPA 1Z6RA 2MG4A 2XAQA 1H9GA 3HXLA 3I5UA 3TO9A 1Z0XA 2L01A 2MA3A 3GTLJ 5J8FA 1OFCX 3PNVA 5K7ZA 1EF4A 2JSPA 4I09A 1Y56A 1AKHA 1MMGA 1G2HA 4E7HA 1QQIA 3U1KA 2M8GX 2KIQA 4KDPA 4BEHA 2FOWA 2XGXA 2BW3A 2IJLA 2O3FA 5E8IA 1S3JA 4F93B 1ZN2A 4XRSA 1VQ5I 1XGOA 3BR1A 4PDKA 2OF7A 3KIOA 4BAYA 4EATA 5HLGA 1XSXA 2R5YA 1XGMA 4G9YA 3MCZA 1BC8C 3ASOH 1I5ZA 3ZMUA 2IPQX 2VT2A 5D6EA 4BE0A 2VE8A 1O7LA 3ML6A 1KYWA 1EA3A 2X6XA 5KAFC 1J5YA 1XDSA 1R23A 5K7FA 4BBSJ 2DQLA 1JJ6C 2VN2A 1HCRA 2LR8A 5GPAA 2D5VA 1MW7A 1T6SA 1Z3XA 1YX3A 3BC8A 2VL8A 3OYHA 4EQQA 2ZMEC 2GAUA 1B8IB 3U1DA 2DMTA 4UB6C 2HWVA 1R58A 5M3FJ 2ISYA 4WXDA 1K78B 1WVRA 5KK1A 1LDJA 1FPQA 3H5NA 1R4MB 1IRGA 2L5QA 1TWAJ 4FT8A 2Y9ZA 1WJCA 3BR2A 2F48A 4JX6A 3W2WA 3FISA 1AU7A 1FJLA 1RPWA 2EFOA 2M0CA 1UFMA 3RKQA 1AKHB 3M8EA 3E5QA 2V1XA 3OL3A 2BZTA 1WKMA 1QPMA 2M9HA 1G4DA 1MJBA 5JLWA 2GOXB 5CKTA 3BG9A 1WSUA 2P4WA 2WADA 3LA7A 4UV9A 3TP3A 2DTRA 4F91B 2JRMA 2KDZA 3RKYA 5GPCA 4XORA 2R5YB 5CQEA 5FLXZ 3QU6A 2E7XA 2KISA 2E7WA 4A5MA 1U9OA 3TQNA 4M6XA 2LF8A 2Z33A 2XAUA 1GUUA 1A6IA 2O61A 5FKKA 4RLQA 3HSRA 3HB9A 1Z3YA 3CDIA 4LGWA 3DEEA 1IC8A 2VODA 2B63J 1DUXC 2KJBA 3I4MJ 5FRMA 5DCFA 1V3FA 2LDUA 4AYBA 1UELB 2ZMEA 2EINH 2KL4A 3AKZA 3MFKA 4XLEA 4IL6C 2FNAA 3DTIA 3CCSI 2IW5A 5B1AH 3R60A 3BZCA 4XL9A 1D0XA 2WY7Q 5FKLA 4BQAA 1FLIA 2K9QA 1D1AA 3BG3A 3DU6A 4N9IA 3PIOF 1JKPC 2R7SA 3GTPJ 3MKLA 3BQZA 2OA4A 5F04A 4S04A 2F5VA 2LBFA 4IEJA 3JAMK 1XTAA 3RTRA 4BQOA 1XG1A 3C2HA 2MD0A 3JTHA 4M9SA 2KZVA 3HL2A 1MBHA 3J7ZI 1HQCA 3DTKA 3DV8A 3BG5A 2VOOA 3KYCB 1ACIA 2WV0A 4HF2A 4DYCA 5GTIC 2EV6A 2NS7A 2V1NA 3AL0C 1JJ8C 4DGWB 2HPMA 3ZP5A 3FBIB 2G9WA 2CGPA 4M71A 4M6VA 3ZMZA 4JP0A 5E3NA 4PCQA 1PUEE 4HDVA 3S2WA 4QPQA 3EUHC 3M7GA 5JFRA 2X48A 3WG7H 2O6GE 4ANJA 4GFBA 2YPRA 2LD5A 1W7PD 1WWXA 2LOOA 3BT9A 3FXRA 3KCCA 4OAYA 5J3LA 3BWGA 2BHZA 4BQNA 5GTHC 5EG0A 1OCPA 1JT0A 1GXPA 1CQTA 5LGUA 4HA8A 3M9AA 1MNMC 2V9VA 3SZTA 3DQVC 1X58A 1K7AA 4ZDOA 3MWMA 2ZMEB 3EQLF 2MABA 3KZYA 3H35A 2QQ8A 3T1BA 3HOVJ 4E7LA 3KZZA 3ZQLA 5CVIA 5BMZA 3OMYA 1WZ2A 1T2KA 2FQ4A 3WGIA 1J7KA 2ZCWA 1WJDA 5E1XA 3SXYA 3V8JA 2TRTA 4A0ZA 3BG7A 2LBFB 4BXXJ 1VNDA 3VPRA 4HZFA 1MSEC 3S8PA 4PFOA 5EZHA 4IHXA 3Q9SA 1NK3P 3JRAA 3HHGA 5FFXA 1WJFA 3L1PA 1VQ4I 2RDPA 1X2NA 3WE3A 2ADUA 3RYRA 2G7HA 5A2QZ 3HPGA 1YRNA 2CU7A 2M4KA 1ZG1A 2VASA 3FK6A 3OY9A 4B09A 4HPQA 4B48A 4D9JA 1U0JA 5K7HA 1TT0A 2E34A 1EH6A 2HKXA 3CD6I 3S14J 2K40A 1BI0A 5IP6A 1MNDA 4ZC3A 5TISC 1OCTC 2HZTA 5FB2A 1I3QJ 3GZNB 4UB8C 2GXBA 2Y75A 4CCLA 4AD9A 1KQ0A 4M9XA 3CC2I 2GIZA 1MD0A 3JRGA 1O3TA 3ZQ7A 2CW8A 1NHAA 1MBJA 1ETKA 2CW0F 1XSDA 1SAXA 1G3SA 3WTZA 3S3OA 5LFAA 1SMYF 4II2A 3V8KA 1ULYA 1IGNA 2HOTA 2QKLB 2LKXA 3BR5A 1G3TA 1IG7A 4IRIA 1Y1VJ 5D6FA 2EZKA 3HPHA 4LIUA 2HDCA 2L9RA 1TP4A 1RC9A 2CQXA 2V1UA 3H5RA 1LVAA 1R7JA 1SFKA 2Y69H 2EV0A 4HAMA 2EV5A 4WF2A 1FOKA 2QKMB 2DI3A 2E5NA 4PUSA 3CC7I 2WB1N 3DF8A 1OYYA 1QHHD 5D8KB 1QZEA 2M3AA 2GBYA 4P5OA 2GXAA 3FXKA 2L0KA 1YRNB 2ISZA 5JLXA 1MGTA 3CLOA 2JK3A 3DPLC 3GXOA 4V2GA 2H6CA 3AL0B 2LC2A 3DLLF 2MH9A 3R61A 3GX4X 1EV7A 2JRTA 3P9KA 4ZZDA 4ZJZA 3H1CA 3PM1A 3S15J 2H09A 1UAAA 3ABKH 2D45A 4EGYA 1DGWY 1VF9A 2IGKA 3H5AA 4AC0A 2DPDA 3A0HC 2Y30A 1FSEA 2EWNA 2VONA 2X6WA 3HRUA 3PO2J 1AA7A 2I5UA 3LFUA 4PFPA 2YX7A 3FK7A 2DU9A 2VJ4A 1FMWA 2DJIA 2O9LA 1IAWA 3OOPA 1ETXA 3ZOBA 1Y0NA 3VYUB 1LFUP 2LREA 3KP4A 2C6YA 2QZ8A 3S1NJ 2L2OA 2DFIA 1FSHA 1T0FA 2XDVA 2K9SA 4YFXF 3DEUA 4L5EA 1J9IA 3M1EA 2FE3A 5DCMA 2XAHA 3E3VA 4R1HA 1BIAA 2FQ3A 1IV8A 4CCNA 3IWFA 3K4KA 5ED4A 3LAPA 3L2WA 1JUPA 3ELKA 3PO3J 5M5XJ 2DT5A 4RB1A 1PDNC 1H9TA 5LD2C 3H9QA 5HNFA 1YG2A 1S29A 4MNUA 5K5QA 3M8FA 1ITYA 2GQQA 1VQPI 3Q3SA 2CUFA 4D5CA 3DWLE 4II3A 5EEAA 1F9NA 1O3RA 2VC1A 3S1QJ 5EDNA 3GBGA 3DTEA 3D5RC 4Q4ZF 4IKFA 3H92A 3CCYA 2HXIA 1A6QA 2IA1A 4Y4RA 5HDGA 1SFEA 3KZIC 1QVUA 1KGSA 3F8CA 5C44J 3QPTA 3GUDA 4I7HA 5ICFA 4FETA 1D0ZA 4NNJA 1A35A 5EZGA 1R22A 5EF6A 5DD4A 4FISA 3LQQA 2MLKA 5AONA 4BUPA 3KEQA 4ESFA 4ZTFA 2IBDA 1RIOH 5GADJ 1TNSA 4Z6YA 1REPC 4IHSA 4O6JA 4C3JJ 1SVMA 3IHUA 2XHKA 3ZQHA 4OMYA 3OSFA 4LB5A 5IP7J 5DCMB 2H8WA 1JGSA 1MKMA 1R00A 1X3ZB 4HQMA 3V7RA 3JAMZ 4L18B 3UKGA 3I53A 2JZYA 2ACJA 4ENMA 1VQKI 4WK8F 3BJAA 2XROA 1LJ9A 4HF0A 2VI6A 4KFCA 3VB2A 5EGOA 2WAFA 1FBSA 4RB2C 2L9SA 2A6EF 4A6EA 4A3GJ 3R0AA 1QZZA 2CMPA 3EYYA 4CA0A 4CHUA 1KU2A 2JWTA 3B6AA 3TL4X 2XRLA 2QVOA 2JA2A 2ELJA 2E2HJ 2M4GA 3LSKA 3DBRB 3QOEA 4B3AA 1SVOA 4BACA 2V4JC 2QEXI 3CCRI 2FMYA 3LMMA 1UHSA 1F43A 1K83J 2MYSA 2K86A 2FJ1A 5LHGA 1SAUA 1ONVA 2KKOA 4AUXA 3VYSB 1ZARA 1LEBA 3RDIA 1PP7U 1QO0D 1JXSA 3GW2A 2WV1A 2HKOA 3ZQGA 5C4XJ 1ETVA 5IT9K 4N4NB 1OISA 2MLGA 4D7MA 2W00A 4HG2A 1U6GA 4BY1J 1ZK8A 1JI8A 4MLOA 2RREA 1X3WB 1FZPB 4DJAA 2DK8A 4U0YA 4KITB 3DP7A 1HW1A 3FXQA 3K4MA 2KP6A 5J4VA 1YW9A 4G12A 1UHMA 2W85A 5E3LA 4F55A 1WJAA 5EGOB 2K9NA 1AHDP 3BY6A 1Y8RB 3FZVA 4I99C 2FEZA 2EILH 1R5GA 2W84A 2DFFA 5E1WA 4ENKA 3EDPA 2JQ7A 1Y39A 4N0BA 2ZXWH 5F0FA 1HF0A 1RKTA 3CF5F 2UUZA 3JSOA 4KJZA 3WG9A 2PJRB 4KIFA 1MZBA 1O57A 5F08A 3GCMA 5LGNA 2F4IA 3CCMI 4JK1X 2XGCA 1AWCA 2G7UA 3ZCOA 3GVAA 3REOA 3K2ZA 1W5TA 4NC7A 1DPRA 4W97A 3LAJA 2LY9A 5CLSA 4JX5A 4RS8A 4OAZA 4IVNA 3W2VA 1VZ0A 2D1HA 3K4NA 4M3GA 2KIUA 4HBLA 1UJ8A 3GTOJ 3JTGA 4RAYA 4U7DA 4C30A 5M3MJ 2EIMH 2XASA 3CCEI 2DA4A 3PSIA 2VKDA 3S1RJ 3HYIA 5J4YA 2M8EA 3SQNA 1LEAA 2IT0A 4B4CA 1MBEA 3T0YA 1ZREA 4GRIA 3RCOA 2FBKA 4CCOA 5IPAA 3IL2A 2QQ9A 3SFZA 2R7UA 3GTQJ 2JUCA 2P5VA 2XF6A 4PJLA 5AIPA 2X51A 2KJCA 1H89C 3BP8A 2FA5A 3S1MJ 4Q48A 2A05A 2K9LA 2Z3YA 4XIDA 3W6JB 4IX7A 3H3ZA 5C3EJ 1FTTA 3AAFA 4YFNF 2E36A 2EZLA 1T98A 4V19K 3CZ6A 5GP9A 2OU2A 3LA2A 1XGSA 2L4AA 1JKOC 3E0JB 3TDZC 1B72A 4Y17A 5JVTA 1QBJA 3S3MA 2R5ZA 9ANTA 4HSTA 3CLQA 2BEOA 1HW2A 2K5CA 3EYIA 1KQ9A 2LKSA 4CH7A 1ZQ3P 2K3PA 2VT3A 3BR6A 3PQKA 3S2DJ 2DJNA 1R9TJ 1F5TA 3QPHA 4HRIA 2RVCA 2HOSA 3FKIJ 2ZNYA 4ABZA 4DYQA 3FIWA 2CS3A 4Y33A 1GV2A 2DMQA 3QYEA 4EJWA 1TT5B 5IYCJ 3A4CA 1YJWI 2V26A 1A04A 3CMAI 4OMZA 1E3OC 1IRZA 2BXZA 3QP5A 3F21A 2DMPA 4MQVA 2GA1A 2NVXJ 1B4AA 3FXLA 1SD4A 3ZRGA 5J1RA 3MZHA 3F6OA 1IRXA 4ESBA 5D4RA 2NRAC 3KPHA 1B59A 5DDGA 2BY1A 1LDDA 2UXXA 3Q0VA 4LJZF 4DIQA 3NARA 3J81K 1VQ7I 4BJ6C 4MEYF 2XSDC 4RGUA 4CDGA 3KP6A 1SEUA 1FP1D 3ABLH 3BOQA 4HQEA 1I6XA 2IRFG 4C3HJ 3BDDA 5GAHJ 3BG6A 1U3EM 5FRNA 3G3ZA 5E3OA 5FROA 2GIVA 3K0LA 3WTSC 4L0YB 4KN7X 1B72B 4IHWA 3GWZA 5FFZA 3L2CA 4AIJA 3BR0A 1ORKA 2YUSA 4OINF 2F4OB 4KIGA 2E60A 3BLYA 3DCFA 1MMSA 5CPRB 4E7SA 5M5WJ 3V4GA 2OBPA 5HOOA 4E7JA 1ZG5A 3CMMA 4IXAA 4CYCB 4FHTA 5D5VB 2IS4A 4M73A 2ZXIA 5TJJA 2DLLA 2H1KA 3OR1C 1SANA 1TWCJ 4XMYA 3LSRA 2YU9J 2BE5F 1ODDA 2IXSA 2P7VB 3JCUC 3NAUA 3S17J 1E3HA 3GFMA 4AVPA 1I50J 2VBZA 1U9NA 1U5TC 1VQLI 2HOAA 4S05A 4B44A 4XRFA 3ZPLA 3Q9VA 4LLNA 4E7ZA 4JYKA 4FE7A 2QYOA 1L0OC 4BYYA 5HDNA 1KONA 1X1CA 2K7LA 3OYBA 2H6BA 2YSRA 1UZCA 4A69C 1VQOI 3M1CA 4IHYA 3I59A 1WH7A 4FQGA 2VKEA 2O8KA 3L09A 3ERED 3C1DA 1ZTRA 3E6DA 1OQYA 4XN0A 4A3BJ 1G3WA 1BOBA 3ISPA 4ZH4F 1R1TA 4BEHB 2BW3B 2NVYJ 2P5LC 4BHCA 4ON0A 3TKYA 3M8JA 4RB0A 1IN4A 4A12A 2L9VA 2MSYA 4UUVA 4EJUA 2IS6A 1R4NB 4MFEA 3PFYA 2OJED 2VJ5A 1W1WE 3A03A 1R49A 1WH5A 1HLVA 4HX4A 2CH0A 2UV1A 2XSJC 2XVCA 5ILVA 4NQWA 1W5CC 4GXOA 4G7ZF 3MZYA 2IVMA 1N25A 3J7YJ 4CCJA 2XIGA 1VTNC 2VUMJ 3HOZJ 5FLMJ 1V5GA 1LFPA 1LB2A 4M3FA 3GLLA 3CQZJ 3K4BA 3VYRB 3ZMDA 1BIBA 2EK5A 3IH3A 4RDUA 4XKCA 1U5TA 2NXNB 3U21A 2JSCA 2LNBA 4CCKA 2IEKA 4LD5A 5J1UA 2TDXA 2R7ZJ 5HS8A 2VC0A 1KU9A 2AO9A 2A5WA 3ZMSA 2OC6A 2DOFA 3QWLA 5JVGF 4EEFG 3I59B 2EZIA 1A31A 4KA4A 1OLTA 2DMUA 3OYMA 1GV5A 4Y13A 4UY8I 2PBIA 3F8NA 2OTLI 2H27A 3CUOA 4HNTA 2XKOA 4G6TB 3ASNH 5AIQA 5D5UB 4OIQF 3KYDB 4CO8A 3ZQQA 2IP2A 2A07F 1J09A 3CCJI 2WAQN 4XONA 2DXIA 3A1YA 5DV5A 3SEZA 3KETA 1GHCA 5L3BA 5D5WB 3LSTA 4J00A 1Y1WJ 2ZSHB 2R7WA 4NBQA 3ECOA 2E5ZA 3HJEA 1E3PA 2EBIA 3K4JA 4NQWB 4XQFA 3COAC 3ECHA 1QA6A 2YR2A 1EH8A 3O8HA 4WXHA 1WPKA 3K70C 5KNLA 1MH3A 3MN2A 5LGTA 1HDPA 1YIJI 3I4NJ 4LFUA 4U7BA 3MAJA 2LFBA 4XRMA 2IAIA 2NAZA 4N4OB 3MD2A 4BDZA 1U5TB 1DU6A 1MNEA 1XX5A 4V2FA 3I0TA 2R7OA 1BR1A 1S7AA 3GEZA 3TGNA 5M5YJ 4YELA 2FXAA 1FOWA 3BJ6A 3JRFA 2G0EA 3WGGA 2X0LA 3R6SA 1XD7A 3BJOA 2L7FP 2NVUB 1KZHA 1V54H 2HZDA 2RC4A 3HZJA 1OR7A 2KPMA 4I76A 4HLXA 1LVKA 3OYLA 4A3CJ 4BE1A 4D5FA 4PK4A 1I3AA 3C2GA 3G2BA 5CVUA 1I1SA 3G1OA 3FF5A 3G73A 4AWXB 3EUKL 2DTZA 2WC2A 5H6RA 2LY2A 3FHZA 3CJNA 2L7MP 2OCCH 4JQFA 1HDDC 1ZKGA 4HLYA 3E5XA 5LHHA 2DA3A 3QQAA 2OCEA 3BTJA 5F1RA 4YIRX 5IOZA 4FASD 1W0TA 1UCRA 4GYGA 3KP5A 2XAFA 2FX0A 5CJ9A 1E17A 2GOMA 2XGDA 4CYDA 3KLNA 2Q8KA 2IS2A 4QPOA 4E4HA 3J7AY 2XPWA 4KISA 2FD5A 3QPSA 5DS9A 3LSPA 3TBIA 1SFOJ 5EG0B 4MEXF 4RAFA 2PI0A 2ZC2A 1OJLA 3I55I 1JUSA 3JRDA 3CUQC 3H36A 2QLZA 4IF4A 1FOYA 2OAZA 3BPVA 2Z2SB 1LKXA 1IUFA 3ABMH 1X2MA 3OR2C 3KP3A 5IP9J 2DCEA 1GLNA 1UG2A 2D1VA 2K85A 5IOYA 3HOXJ 3PSFA 3HGYA 4GDFA 1IDZA 3J81Z 4AIHA 4LIVA 1T0FC 4G94A 3WTUC 3HTSB 3N05A 3VSKA 2CUEA 2EFQA 2O03A 2DK5A 2IGMA 2DOAA 1DP7P 4IHVA 1MBGA 3LSGA 2IGNA 2ME6A 2R7QA 4L9TA 3QP6A 2R7TA 5ILUA 1RR8C 3E97A 5J6XA 4YG2F 2P8TA 3PL8A 4IZZA 2H94A 4XOTA 1ZLJA 3EETA 1JE8A 3P5JA 1H0MA 5ERIA 4G8XA 2CV1A 2LTPA 3HOWJ 4IOAF 3IH4A 1EH7A 4PJNA 2VJIA 1F1ZA 2X85A 5HS9A 4ZYGA 3HHHA 1HKSA 4FX0A 2KDOA 2HYJA 5F0CA 2Y0MA 3CO7C 4UUSA 1EJ9A 1XPXA 1LUJB 1SD5A 1LFBA 5LBQA 2QF7A 3V7SA 4G6QA 3GFLA 2WAQA 1B6AA 1K6YA 1XMAA 4IQ4A 4YFKF 3PFIA 3S2HJ 3I58A 4PJ0C 3B02A 2L02A 2JVHA 3PQJA 1ENHA 2H1LA 4A5NA 5F0HA 3T5XA 4MTDA 2UZKA 1ETQA 3CUQA 4Y7NJ 1TLHB 1G6NA 2JA5J 3JRCA 1JHHA 3A2KA 2PG4A 2VJJA 2B7EA 3O2PE 1TC3C 3H0GJ 1B9MA 4PGGA 4K2EA 3SEQA 3K70D 1FC3A 1U78A 1M1EB 3E7LA 3MQ0A 1YOVB 2HVRA 4BY7J 3K6GA 3G4SI 4IRHA 2W82A 4LOCA 1QGPA 3K9TA 1S6LA 4XSZF 2BY3A 2PQ8A 5E20A 3BTIA 1Z7LA 2DA6A 1XCBA 2M30A 2P81A 1YHQI 2E2JJ 3ZR8X 4UHTA 1NTCA 1XGNA 2FRHA 4Q47A 2JT1A 3ABUA 1F4KA 3FMQA 3LWFA 3U2RA 5HDKA 2V9PA 1Q1VA 1JTXA 1PVEA 1X1DA 1GDTA 1BI1A 1KQ8A 1S8NA 4G7HF 4UUSB 2QM3A 2OZUA 3CDHA 2E1CA 3L2VA 2FUG2 3F9KA 2QWWA 2FSWA 1IN7A 4AIKA 2XF5A 3FMSA 2P7CB 2LRDA 3LSIA 1XS9A 1FMVA 2JPBA 3F8MA 4A3LJ 1A5JA 2JTVA 4Y52J 3ZQFA 2JA6J 3M4OJ 3QYFA 3FX3A 4DNCA 1Z6TA 4ZZLA 2DAOA 1PP8F 2GZWA 2XF7A 2L3DA 4R79A 2ZNZA 3CUQB 4F7ZA 1PJRA 1TTYA 1RR7A 3Q0WA 4CZCA 2AQEA 1HSTA 1XMXA 3FHNA 5L3CA 3HC7A 2V6EA 2XPVA 5LEKA 2KMUA 4OIRF 2QQAA 2QSHX 1HXDA 2WA0A 3OYFA 4ZYDA 2CQKA 3F0CA 3VYTB 4BJTA 4KYWA 3OYIA 2DBBA 3F6VA 1T39A 2K4BA 4DBQA 3P9CA 2HR3A 5TGTA 1Y8QB 5F6FA 1ZGWA 2F4MB 2HXOA 2ZJPF 4XLNF 2VOPA 3GMEA 1YLFA 4HYEA 3NWSA 2WB1A 2EFPA 1DDNA 2MGQA 2PMHA 3FMRA 4XM3A 4ZYAA 5J40A 3IRRA 1QZYA 2Z1DA 4O3MA 1FNNA 2HS5A 1WHUA 2X6YA 5CYVA 4C2TA 3ZMVA 2BV6A 3J80K 1TW2A 2M1BA 3FXMA 3CCQI 1K79A 5B1BH 2ZB9A 1Y6IA 1VQNI 2ELKA 1DU0A 1YX5A 3DEWA 1FWZA 2R7XA 2CJJA 2D2WA 3OS0A 1JGGA 5H20A 2JPCA 1WCMJ 1SD7A 2QCOA 4BJ5C 5J47A 2M7BA 2WTEA 2MH2A 2X4HA 3AG2H 2JUGA 2PEXA 1V4RA 5E17F 1BA5A 1APLC 3S16J 3DKWA 3OIPA 4FE4A 3K1MA 2LYCA 3GO5A 1S72I 3RZOJ 3LOCA 2FF4A 2O8XA 4BHPA 3L2UA 5DTDA 4CGZA 1YFHA 1T08B 1GXQA 3CJTB 3IRQA 1R71A 1BI2A 4XKBA 4KICA 3CCUI 3PJRA 1Z91A 1IO2A 2V9KA 4O5VA 5HVQC 4RGRA 3F22A 1BW5A 3TO7A 2DW4A 3BQYA 1IW7F 1ZRFA 2HDWA 3RPUA 3FM3A 1S9HA 1D0YA 2UXNA 3KYLA 1OCOH 1ZR2A 3FXJA 2HQRA 4XLFA 1BC7C 5FLXK 2KRHA 2M7AA 3TOAA 2E19A 2K9MA 1FBQA 3H3VK 2HTJA 3GFIA 4I6ZA 1G3YA 2PFBA 5JHUA 3CC4I 2W57A 4BU2A 1P2FA
chains in the Genus database with same CATH topology
3SYTA 5KCMA 2E60A 3BLYA 3K4LA 3DQVC 5CPRB 4ZDOA 2Q2EB 4E7SA 4AU7A 5HOOA 4E7JA 3W2AA 4YRVA 3CMMA 3OOUA 3PNTA 4ZDLA 2MABA 3H35A 2IS4A 3CJRB 4E7LA 2ZXIA 3OR1C 4XMYA 3OMYA 2IXSA 2KRCA 1WJDA 2HVSA 1TZLA 3BG7A 4B44A 2LBFB 3HOTA 4E7ZA 2IS1A 3K10A 4PFOA 3S8PA 2KHMA 1WJFA 2VQLA 3SDBA 3MKWB 3OYCA 1KONA 4PJJA 1X1CA 3OYBA 3M1CA 3HPGA 2KLOA 2M4KA 2VASA 3OY9A 4HPQA 1V5EA 4B48A 4D9JA 4XN0A 1BOBA 1X4OA 1U0JA 1TT0A 3QODA 2R7RA 4BEHB 1MNDA 2BW3B 2DT6A 2MC4A 4ZC3A 3M8JA 1V5FA 2X1CA 4CCLA 1WJEA 4ITVA 2IS6A 3UNGC 2X1EA 3PFYA 2CW8A 3OS1A 2VJ5A 1PYVA 4HSRA 4E6KG 3S3OA 5LFAA 2CH0A 2OUMA 2UV1A 4II2A 2XSJC 4U87A 4ZDPA 3V42A 3OYDA 2L7KA 3EPZA 3VDXA 4CCJA 2QKLB 1V5GA 1LFPA 4X0GA 3OIQA 3K4BA 4XOPA 3VYRB 1X4PA 2PMZA 3HPHA 4BL0B 1QU3A 4LIUA 4RM2A 2CUZA 2HNHA 3E1SA 3H5RA 4XKCA 4BGDA 3U21A 1SFKA 1WFXA 2BVMA 3IP4B 2QKMB 4CCKA 2CV0A 2VXDA 2E5NA 4PUSA 3OYNA 1QHHD 2A5WA 3OYAA 2OC6A 2M3AA 4P5OA 4XKVA 2LH9A 4Y3OA 3H0DA 4AVZA 3DPLC 1WJBA 3S32A 4BS9A 1OLTA 2ZSIB 2F6CA 3AL0B 3OYMA 2LC2A 3ONQA 2PJRA 4HNTA 4ZJZA 4G6TB 1BR2A 1X1BA 3AFHA 3ZQQA 3NWTA 1UAAA 4OWRB 1DGWY 1J09A 2IGKA 3H5AA 3CJQB 4XONA 3D5SC 4E7IA 2DXIA 2XC7A 3A1YA 2CUJA 3SEZA 2X6WA 2VXZA 4J00A 3VSLA 1G8XA 2ZSHB 3IUOA 1AA7A 2R7WA 3LFUA 4PFPA 2E5ZA 4XLAA 3KX2A 3K4JA 4XQFA 4NQWB 2VJ4A 1FMWA 2ZFUA 2DJIA 4IQJA 2V7FA 4NUBA 5KNLA 3K70C 4J01A 2LG4A 2HU9A 1T95A 2I8DA 3VYUB 2LREA 3FKJA 2L2OA 2VKHA 4ZTJA 2O5RA 2XDVA 4U7BA 4CSWA 1N78A 3OYGA 4N4OB 2RNGA 2Z16A 3MD2A 4BDZA 3HKZA 2WAEA 1E0EA 2CV2A 1MNEA 3D5LA 2WBMA 2R7OA 4CCNA 3HOSA 1BR1A 3CP2A 4XR6A 3K4KA 3L2WA 4YELA 1LDKB 2RQQA 3CF2A 2HZDA 3FDYA 1QHGA 5LD2C 3H9QA 4RM3A 4D1QA 5HNFA 2KPMA 1W36C 3OYLA 1LVKA 2OV7A 3MKYB 4BE1A 3ZGKA 4PK4A 3C2GA 3DWLE 3G2BA 4II3A 1MMAA 3EUKL 4JOMA 2VQGA 3GBGA 3DTEA 3D5RC 4XN3A 3HUGB 4CCMA 4IKFA 2LY2A 4Y4RA 4JQFA 3ZXSA 2WY8Q 3QYBA 4XKWA 4F92B 4DOZA 1WJ5A 3S93A 3BCBA 3HG9A 3RSNA 1X19A 4DBRA 4FASD 4FETA 1D0ZA 4YEJA 2NOJB 2Y0SA 3H9GA 1G59A 4NNJA 2M0MA 4B3XA 2GOMA 1NG6A 4B47A 2R7VA 2IS2A 4QPOA 4E4HA 3J7AY 4ZTFA 4BUPA 3OYKA 1YE9A 4KISA 2ZXHA 3TBIA 3RPUD 4BXFA 4PSWA 3DU5A 3OWTA 5HNHA 4BDYA 3MKZA 2Z2SB 1LKXA 1X1AA 1N75A 2VQHA 3OR2C 2DCEA 1GLNA 2JVGA 3PSFA 3H9JA 4LIVA 1T0FC 3N05A 4HNUA 3VSKA 2IGMA 2DOAA 1D1CA 1DP3A 3LSMA 4F52A 3I3LA 2IGNA 3LSGA 2WAFA 2R7QA 3KEYA 2L9SA 2W7NA 3BCAA 2R7TA 2R4GA 4LG3A 3PL8A 4IZZA 1D1BA 4XOTA 2CMPA 4CA0A 2P0WA 3CESA 3OYEA 1DGRM 1NG7A 4BQQA 2CV1A 2BOLA 1DQUA 4PJNA 2VJIA 1UG0A 3TL4X 3LSHA 2JA2A 2X85A 2ELJA 3DKXA 3PNYA 2KDOA 1OR7C 2M4GA 3LL7A 3LSKA 4XLCA 3QOEA 1N77A 3PUBA 4B43A 2WAQA 4BACA 5HLTA 1K6YA 2V4JC 2VB6A 4IQ4A 2W1OA 3LMMA 4RLFA 4LITA 2MYSA 2HPIA 3TMOA 2LY1A 4HEA2 1SAUA 4BE2A 3DLAA 2JVHA 4XLHA 3VYSB 2MFZA 3DPTA 2A6TA 2CFOA 2HQAA 3CP8A 3DPUA 3OL4A 4P1WA 2E1MC 2BVLA 3A2KA 2W4SA 4N4NB 2VJJA 2W00A 4HG2A 4PSXA 1JI8A 4MLOA 3FBNB 3HXLA 2RREA 3SEQA 3K70D 4DJAA 3IAM2 4KITB 3PNVA 2HVRA 3K6GA 2JSPA 3K4MA 2KP6A 1Y56A 2W82A 3DKYA 3UR3C 4F55A 1ERDA 1MMGA 1WJAA 4E7HA 1Z7LA 4BEHA 4F93B 2BW3A 3ZR8X 3VWBA 3EUAA 2DT7B 2UWMA 1Z21A 4EATA 1X1DA 3L2RA 2UUZA 4KJZA 2FUG2 3F9KA 3L2VA 2PJRB 2XF5A 4BE0A 1W36D 2LRDA 3LSIA 4C2UA 1FMVA 1EA3A 2AQFA 2X6XA 2F4IA 4CUGA 2L9NA 3QYFA 3ZCOA 1MW7A 4NC7A 1Z3XA 1YX3A 3BC8A 2VL8A 3OYHA 4OAZA 3W2VA 2XF7A 1VZ0A 4R79A 3K4NA 1ZELA 1PJRA 1MMDA 2KQRA 1BR4A 2VQCA 3H5NA 4CZCA 2AQEA 2L5QA 3FHNA 3IAS2 1WJCA 4C30A 3HC7A 2V6EA 2KMUA 3W2WA 4C9YA 3PSIA 3I9V2 4KT6A 2VKDA 2WA0A 3OYFA 3S3NA 2Q1ZB 3VYTB 4BJTA 3OYIA 3OL3A 4GRIA 3RCOA 4CCOA 4DBQA 5TGTA 2R7UA 2XF6A 2GOXB 4PJLA 5CKTA 2X51A 3NWSA 2WADA 4NC8A 4XNFA 4F91B 2K9LA 2WB1A 4XORA 4IX7A 2IGOA 5CQEA 3OYJA 4XM3A 4ZYAA 3CZ6A 2Z1DA 2X6YA 3K4CA 4C2TA 2X1DA 3MMYB 2XAUA 3E0JB 5KHDA 2VPLA 4RLQA 3S3MA 1Z3YA 4HSTA 4RMNA 3DEEA 1Y6IA 1YX5A 2K5CA 5FRMA 2R7XA 4CH7A 2K3PA 4F3QA 4AYBA 3OS0A 1UELB 3L2QA 2KL4A 3AKZA 4XLEA 3DTIA 4HRIA 1P9QC 4BJ5C 2E1MB 2M7BA 2CS3A 2JUGA 4XL9A 4Y33A 1D0XA 2WY7Q 4PJMA 5CQGA 3OIPA 3QYEA 2LYCA 1D1AA 3DU6A 2R7SA 3A4CA 2V26A 1HA8A 3L2UA 2F5VA 2LBFA 4XKBA 3W3CA 3RTRA 3ZRGA 4BQOA 3C2HA 2MD0A 2CW7A 3PJRA 2V9KA 5HVQC 2VLAA 1IRXA 2KZVA 3OS2A 3HL2A 5JHFA 3DTKA 4DIQA 1MMNA 4BJ6C 3RQ4A 2HDWA 2V1NA 1S9HA 3AL0C 1R6RA 1D0YA 4DGWB 3KYLA 2HPMA 3FBIB 4XLFA 3BG6A 5FRNA 2KRHA 2HVQA 2VIXA 2M7AA 5FROA 2K9MA 4H4KC 4QPQA 3EUHC 3SZGA 4BU2A 4ANJA 2LOOA 4OAYA 4E7KA 4BQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VXD A; 
#chains in the Genus database with same CATH topology
 4IRG A;  3WU1 B;  3SYT A;  1TL8 A;  2E71 A;  3DBH B;  3I71 A;  3K1N A;  4XRS G;  5KCM A;  4EJO A;  4M74 A;  3F8F A;  2Y31 A;  1YS6 A;  1J75 A;  1BBY A;  4QWQ A;  2QGU A;  3OOU A;  2E1O A;  4YRV A;  5HOD A;  1MH4 A;  3CJR B;  3U9G A;  4UV8 A;  1RET A;  2NVQ J;  2COM A;  3SDG A;  3SZP A;  3IKT A;  5KVR A;  1P4W A;  1WQ2 A;  3TP0 A;  2HVS A;  1UB9 A;  1TZL A;  2F5E A;  1TQI A;  4GO1 A;  2RGV A;  2KRF A;  3RKX A;  4RBO A;  3HOT A;  4KMU X;  4XK4 A;  3W6K B;  2IS1 A;  5FLV A;  1IDY A;  4U0W A;  3SDB A;  2A68 F;  3M07 A;  3OYC A;  1K4S A;  4PJJ A;  5K5O A;  5DEQ A;  3BZK A;  3QOP A;  3WTV C;  2XRN A;  5FD6 A;  2Q0O A;  3HIF A;  3QOD A;  2ELH A;  4L0Z B;  2M45 A;  3I54 A;  3T8T A;  2DT6 A;  1HSJ A;  1WGX A;  4EGZ A;  2RQP A;  1O4X A;  1V5F A;  2X1C A;  1SMT A;  3GF2 A;  4QSH A;  5IYB J;  5EYR A;  4OOI A;  2KFD A;  1WJE A;  2Y0S N;  3I4P A;  1P4X A;  2EA2 A;  3UNG C;  1IXS B;  1QRY A;  2QUF A;  5JI6 A;  2VE9 A;  1PYV A;  4HSR A;  1OYW A;  4ENJ A;  5L3D A;  4E6K G;  5FJ8 J;  4NDL A;  4U87 A;  2B9S A;  4ENN A;  1ZR4 A;  3RJP A;  3V42 A;  3OYD A;  2L7K A;  3EPZ A;  3VDX A;  2N8G A;  1HBX G;  5LHI A;  3K1P A;  4X0G A;  3WTY C;  3OIQ A;  3JSP A;  1X4P A;  1STZ A;  2A6H F;  2M34 A;  3R4K A;  1QU3 A;  3O6B B;  4HDU A;  1KA8 A;  5FO5 A;  4S0H B;  3Q0U A;  1W4M A;  4A3M J;  3E1S A;  3L9F A;  4BGD A;  4CZZ A;  2J5O A;  4OIO F;  1WFX A;  2BVM A;  3IP4 B;  3CDL A;  2L54 A;  2CV0 A;  2VXD A;  3C2B A;  5ICC A;  2W24 A;  4W1U A;  4AID A;  2ETH A;  4H0E A;  4HOB A;  2LKP A;  3A02 A;  1S7E A;  1P7J A;  5A2Q K;  4XKV A;  2DFH A;  1H8A C;  1RES A;  4Y3O A;  1V55 H;  4CIC A;  3FM5 A;  3S32 A;  1O7F A;  2ZSI B;  2ID6 A;  2XUB A;  1FIA A;  2ZJQ F;  2FNP A;  3ONQ A;  2DA2 A;  2RV8 A;  1BI3 A;  4PZJ A;  2R93 J;  1FYK A;  1BR2 A;  4LMY A;  4QLC U;  3NWT A;  5K1Y A;  1FOX A;  2OZ6 A;  3L7W A;  4U0V A;  2QQB A;  3HRT A;  1J0R A;  2DO7 A;  3CJQ B;  2W48 A;  1ZH5 A;  4I0B A;  3KLO A;  2XC7 A;  4A3K J;  5F27 A;  3VSL A;  1G8X A;  2E35 A;  3IUO A;  4EM1 A;  2X6O A;  3KX2 A;  4G7O F;  4LK1 F;  2ZFU A;  3HRM A;  1P7I A;  4IQJ A;  1D8K A;  1GVD A;  1ZGJ A;  2E1N A;  2V7F A;  3G71 I;  2OQR A;  2LG4 A;  1KU3 A;  2HU9 A;  1T95 A;  2R5Z B;  3FKJ A;  1J2X A;  2XB0 X;  2VKH A;  4ZTJ A;  1YW8 A;  2O5R A;  2CQ7 A;  4UVA A;  5GAE J;  3OYG A;  1WI9 A;  3I64 A;  5E18 F;  4J19 A;  5LEJ A;  3E5U A;  2WAE A;  5KAI C;  1E0E A;  1BN5 A;  3Q5F A;  1FY7 A;  1BW6 A;  4D7N A;  4HX8 A;  2WBM A;  2XGE A;  3CP2 A;  2M87 A;  4UVB A;  2DDB A;  2QBY A;  1UMQ A;  2GXG A;  3JRB A;  2RQQ A;  3HM5 A;  2VKV A;  4XSX F;  1QHG A;  4ZYH A;  2P6S A;  4RM3 A;  1ON2 A;  1U2W A;  3LQR A;  4RA2 A;  2K27 A;  1W36 C;  4Q5S F;  3TDU C;  1IJW C;  1LE8 A;  3ZGK A;  3KP7 A;  3OSG A;  3J80 Z;  2DPU A;  2JA8 J;  5LRR A;  1HKT A;  2EH3 A;  4XN3 A;  4CCM A;  5DUI A;  3C3W A;  2DFE A;  3TW6 A;  3ZXS A;  1IN6 A;  2XAG A;  4UNO A;  4XKW A;  4F92 B;  5BPI A;  1WJ5 A;  2Z5U A;  3S93 A;  3G1M A;  3BCB A;  3HG9 A;  5FKN A;  1IUY A;  3RSN A;  4DBR A;  5DD8 A;  4FTH A;  1CGP A;  4A3I J;  4YEJ A;  2OQG A;  2Y0S A;  3H9G A;  1G59 A;  4L9J A;  2M0M A;  4B3X A;  1VQ9 I;  1NG6 A;  3PIP F;  4P55 A;  2R7V A;  1UST A;  2HI3 A;  2V1D A;  3OYK A;  3HTU A;  5EJC A;  1P6R A;  1TQP A;  1IXC A;  5H6Q A;  1Z1D A;  1RRJ A;  4BXF A;  4PSW A;  3LFK A;  3F72 A;  4LG0 A;  1ZHF A;  4M3B A;  2IA2 A;  3MEX A;  1X1A A;  4I01 A;  3JRH A;  4M9Z A;  5IT9 Z;  2NS8 A;  2HFH A;  5TRD A;  2ECB A;  2JVG A;  2MD5 A;  2PN6 A;  1K61 A;  1EKE A;  4WXC A;  5HLI A;  5LRS A;  1W7P A;  1JKR C;  4I2O A;  1OCZ H;  2O7O A;  2QBY B;  2RKH A;  3OV8 A;  2Z9O A;  1DP3 A;  3E6C C;  3C18 A;  3KEY A;  4NB5 A;  2W7N A;  1X1P A;  3BCA A;  1XMK A;  2R4G A;  4LG3 A;  2Z99 A;  2ZJ2 A;  2LVS A;  2CRG A;  2P0W A;  1LE8 B;  2QA4 I;  2GA2 A;  4IO9 F;  1DGR M;  1NG7 A;  5LLQ A;  2LF7 A;  3D0S A;  4OIP F;  1DQU A;  2J5P A;  1GT0 C;  1UG0 A;  3LSH A;  5D8L B;  1Y0U A;  6PAX A;  5ICE A;  3PNY A;  2NVT J;  4ETS A;  3NQO A;  2ESH A;  2CQN A;  1Z9C A;  1OR7 C;  4JBA A;  2R92 J;  3LL7 A;  3SFI A;  2QEN A;  1IZ1 A;  1JUM A;  3F8B A;  4I0A A;  2QSF X;  4A3D J;  4BNC A;  4LLL A;  1O3S A;  3GLX A;  4B43 A;  3IKV A;  1JHF A;  2VB6 A;  1GVJ A;  5BS6 A;  1U8R A;  4LIT A;  4WCG A;  4I98 B;  1NK2 P;  2LY1 A;  4HEA 2;  2A69 F;  1IXR C;  1OPC A;  4HV5 A;  4BE2 A;  4XLH A;  4MFD A;  5IYD J;  2MFZ A;  3DPT A;  4HV6 A;  1XCV A;  3DPU A;  4LG0 B;  2E1M C;  2EJR A;  1Z77 A;  2NOG A;  3FXO A;  2BVL A;  2HOE A;  2W4S A;  3CME I;  1XSV A;  4PSX A;  1RNL A;  2V6C A;  2PJP A;  3FBN B;  4UVC A;  3FXU A;  1W7P B;  3IAM 2;  3WTX C;  5FKM A;  3OIO A;  4I02 A;  3SJM A;  2KIM A;  3DKY A;  3UR3 C;  4IOC F;  1ERD A;  5L3F A;  1TWH J;  3CO6 C;  3K2A A;  3WHC A;  2VPR A;  2RNJ A;  2GLO A;  1SFX A;  1I39 A;  4TV7 A;  2OPT A;  3EUA A;  1YJ9 I;  3VWB A;  2DT7 B;  5CVJ A;  3N4M A;  2UWM A;  5BOX A;  1NH3 A;  1Z21 A;  3HBL A;  3V7C A;  4G6D A;  1UHW A;  1ZYR F;  2YU3 A;  1D5V A;  4P9F A;  3L2R A;  3FWE A;  3CCV I;  2ZO4 A;  4L5I A;  5L3G A;  4B8X A;  4DQ2 A;  3HOY J;  1D8J A;  1W36 D;  4C2U A;  2ZBK A;  1S5L C;  1KYZ A;  2AQF A;  1Q1H A;  1ETW A;  4CUG A;  2ESN A;  2L9N A;  3NEU A;  5ILS A;  3H3U A;  1MBK A;  3HSF A;  5DM6 F;  3RI4 A;  4MGR A;  2XPU A;  1R5I D;  3RQI A;  1YTY A;  2DA7 A;  4FCY A;  3C7J A;  4EM0 B;  2AXT C;  4BBR J;  3N97 A;  2Y9Y A;  1ZEL A;  3JRI A;  4ESJ A;  1MMD A;  2HTS A;  2KQR A;  2TCT A;  1ZRD A;  3BZ6 A;  4IJA A;  1BR4 A;  2CG4 A;  2VQC A;  4JX4 A;  4KNY A;  3IV5 A;  3ERM A;  3IAS 2;  3CTA A;  2HQ5 A;  2XAJ A;  4XBF A;  4C9Y A;  4R8H A;  4EJT A;  4ZYE A;  3I9V 2;  4KT6 A;  5D4S A;  2XV4 S;  3S3N A;  1PUF A;  2Q1Z B;  4HX7 A;  2LMD A;  2MC3 A;  3V8L A;  3J7A O;  2F5F A;  3B6C A;  4LLG F;  5BQT A;  4HF1 A;  3EUH A;  3AG3 H;  4LB6 B;  4BXU A;  3BR3 A;  2E2I J;  1ZLK A;  1XDU A;  2FOK A;  1B9N A;  4NC8 A;  2PX9 A;  1RZ4 A;  4XNF A;  1VQ6 I;  4A3E J;  5CVV A;  4B1R A;  2R7D A;  1HC8 A;  2F5C A;  2IGO A;  3ZMT A;  3ZQI A;  5DM7 F;  4P9U A;  3A01 A;  3OYJ A;  1YQA A;  3D1N I;  3P7N A;  2FBI A;  1TWF J;  3GFJ A;  3K4C A;  1I27 A;  2X1D A;  3IWZ A;  3MMY B;  1I6H J;  4QIW N;  5KHD A;  1H88 C;  2VPL A;  4A3J J;  5B5E C;  5C4J J;  3K7A J;  4RGS A;  4RMN A;  4YII A;  2CYY A;  2EPF A;  3MZ8 A;  1Z05 A;  2BY0 A;  3HDD A;  2DA1 A;  3R0J A;  1U8B A;  4WX9 A;  3BTC A;  4EM2 A;  2DMN A;  3B73 A;  2Q2E A;  4F3Q A;  3L2Q A;  2CQQ A;  4XIC A;  4D0P A;  2GM4 A;  2EB7 A;  2PMZ N;  1FX7 A;  1P9Q C;  3WGH A;  2E1M B;  2EFW A;  5CQG A;  4PJM A;  3KP2 A;  2XKP A;  5D5X B;  2P6T A;  1BOA A;  5FGM A;  2RAE A;  1HA8 A;  3E6M A;  1ZGA A;  2LLK A;  4X1E A;  4L9V A;  1T33 A;  4C2M J;  1ZAO A;  2A61 A;  2O0Y A;  4RAZ A;  2NYX A;  2BY2 A;  5E79 C;  4A0Y A;  5J8C A;  3NRV A;  1TW3 A;  3W3C A;  3KE2 A;  4YIF A;  1PUF B;  1ZRC A;  2STT A;  1MDM A;  1LQ1 A;  1USS A;  2CW7 A;  2VLA A;  3TO6 A;  1FYM A;  3OS2 A;  5JHF A;  1MMN A;  3RQ4 A;  2HGC A;  2CWE A;  4IHT A;  2I10 A;  1A36 A;  1R6R A;  2ZFW A;  2DQR A;  3A01 B;  2HVQ A;  2VIX A;  4MO7 A;  2AHQ A;  3GZ6 A;  4P96 A;  2M2E A;  4H4K C;  2HYG D;  3VFZ A;  3SZG A;  2F5D A;  3DFG A;  4KUM A;  5HS7 A;  4UXN A;  3ZN0 A;  3KFW X;  1CF7 A;  1RUO A;  3K4L A;  2BHY A;  1LNW A;  1YYV A;  2OD5 A;  2Q2E B;  1F36 A;  2CFX A;  4A0X A;  4AU7 A;  3W2A A;  3PNT A;  1WI3 A;  4ZDL A;  2VBY A;  3PUF A;  3RIR A;  1XC5 A;  1RI7 A;  1YW7 A;  2DOD A;  1T56 A;  3WTW C;  4EMS A;  1KU7 A;  1O3Q A;  3HKZ N;  2KRC A;  2VBX A;  5JR3 A;  1K6O A;  4AM3 A;  5BNG A;  3M3Y J;  2QSG X;  2COB A;  3QU3 A;  3AG1 H;  3AG4 H;  3JW4 A;  2JMW A;  3K10 A;  4NHJ A;  1MDM B;  2R3S A;  4HNV A;  2RN7 A;  2KHM A;  1E2X A;  2EFN A;  2R7F A;  2VQL A;  3KEO A;  3MKW B;  1OCC H;  2HQN A;  2ME0 A;  4A3F J;  2KLO A;  5DYM A;  1D5Y A;  1V5E A;  3QAH A;  3P9I A;  2DA5 A;  1J59 A;  1X4O A;  4KN4 X;  3HSE A;  3HRS A;  3LNQ A;  4GCV A;  5CVR A;  2R7R A;  3QPL A;  4CXF A;  1SFU A;  3W6V A;  2MC4 A;  4MQ9 F;  3ZN1 A;  1BM9 A;  2CSO A;  3SHF A;  4KMF A;  1FEX A;  4BKX A;  2XB5 A;  4A93 J;  1K4T A;  1IN8 A;  1ZG3 A;  4M3E A;  4ITV A;  2KIF A;  2X1E A;  1SVL A;  2JN6 A;  2LK2 A;  3OS1 A;  1CF7 B;  4MTE A;  1R1V A;  3BPX A;  2OUM A;  4ZDP A;  1ETY A;  2BXY A;  3GTK J;  1FIP A;  1ETO A;  4OU0 A;  2EQR A;  4WWC A;  3IC7 A;  2ZKZ A;  4XOP A;  4ASN A;  4Y15 A;  2PMU A;  2PMZ A;  3A0B C;  4BL0 B;  1IN5 A;  4RM2 A;  3WTT C;  2VBW A;  2PLY A;  2CUZ A;  2HNH A;  5HLH A;  2NS0 A;  1OMI A;  5EEH A;  2R0Q C;  2YS9 A;  4U88 A;  3E6B A;  4DYR A;  1R1U A;  1HKQ A;  2CO5 A;  2GWR A;  3GYH X;  1I1G A;  3OYN A;  2H8R A;  2DYR H;  1TNT A;  4DZP A;  4XLP F;  3RZD J;  3OYA A;  2DYS H;  2FML A;  5DUK A;  3ESW B;  2LH9 A;  2V79 A;  3H0D A;  2DN0 A;  4AVZ A;  3MVP A;  1WJB A;  4BS9 A;  3LA3 A;  1X3U A;  2F6C A;  1FT9 A;  5L3E A;  3K69 A;  5BPD A;  2PJR A;  1JT6 A;  2F2E A;  2L4M A;  2HYF A;  4A6D A;  2WWY A;  1T38 A;  5F1J A;  1X1B A;  1QPI A;  3AFH A;  1HOM A;  1MSF C;  1BJA A;  3GTJ J;  3HUG A;  4HW0 A;  4OWR B;  1YJN I;  1POG A;  3WU2 C;  2HEO A;  3D5S C;  4E7I A;  2CUJ A;  5E1Z B;  2STW A;  2VXZ A;  2A3S A;  1TWG J;  3F23 A;  1P92 A;  3ABT A;  3WE2 A;  1L3L A;  3O8G A;  2BBY A;  3VOE A;  4BH9 A;  4XLA A;  4BHB A;  1VQM I;  2JA7 J;  2NNN A;  1OYI A;  4M72 A;  2AS5 F;  2EA4 A;  1Z67 A;  1MBF A;  4LK0 F;  4NUB A;  4J01 A;  2KZG A;  1FTZ A;  2I8D A;  2DOE A;  1B1B A;  4EV0 A;  2L7Z A;  5B3S H;  3GTG J;  4CSW A;  3WHB A;  2ID3 A;  3TED A;  1N78 A;  1BL0 A;  3QRF F;  3RPQ A;  1LPQ A;  2RNG A;  5K5R A;  2MBF A;  2BGC A;  2Z16 A;  3DXJ F;  1C0W A;  2FU4 A;  2X9D A;  3HKZ A;  2LP0 A;  4L5J A;  5IY5 H;  2NNY A;  1OCR H;  4IPA A;  2CV2 A;  4DZJ A;  5F64 A;  2EZH A;  3D5L A;  3HOS A;  2FBH A;  4XR6 A;  1OKR A;  1LDK B;  3CF2 A;  5H2F C;  1SD6 A;  3FDY A;  3ZQC A;  4D1Q A;  2OV7 A;  3MKY B;  4A2U A;  1AOY A;  2EIK H;  1YIO A;  1MMA A;  2LSO A;  1MIJ A;  4JOM A;  1JKQ C;  2VQG A;  3HUG B;  4UUT A;  5IT3 A;  4KIB A;  1YS7 A;  2WY8 Q;  3QYB A;  2B0L A;  4DOZ A;  4X6A J;  1DPU A;  3CCL I;  4FX4 A;  3G1L A;  2OTJ I;  5FD5 A;  1T8I A;  1X19 A;  2BYV E;  2K3F A;  2AXL A;  5ICG A;  2NOJ B;  1VQ8 I;  1IRF A;  1VFC A;  5EEG A;  4B47 A;  5GAG J;  5J1Y A;  3GTM J;  1YE9 A;  1RUN A;  2ZXH A;  2ECC A;  2IA0 A;  1TQM A;  3ROU A;  3RPU D;  3G6E I;  2P5K A;  1YI2 I;  4RAG A;  3DU5 A;  1S7O A;  3OWT A;  3WOD F;  5HNH A;  3JR9 A;  4BDY A;  2KT0 A;  5FKO A;  3MKZ A;  1N75 A;  2K02 A;  2VQH A;  2ZXJ A;  1VI0 A;  2DDA A;  1W0U A;  4RB3 C;  3H9J A;  3JRE A;  2A5Y B;  5B66 C;  3O3K A;  4HNU A;  2ZJR F;  1JTY A;  3F3X A;  1IV6 A;  1Z7U A;  3GZ5 A;  3TW7 A;  1D1C A;  2K4J A;  1XN7 A;  3LSM A;  4F52 A;  3I3L A;  1MJA A;  1WRJ A;  2YX4 A;  4KT5 C;  2MW8 A;  3RKW A;  4PGH A;  1FP2 A;  1D1B A;  4DW6 A;  5E8G A;  2ICW G;  3CES A;  3OYE A;  4N9H A;  3BRO A;  4BQQ A;  2BOL A;  1QNT A;  5E3M A;  3RYP A;  1ON1 A;  3CMY A;  3I56 I;  4M3D A;  3HOU J;  2M5W A;  3DKX A;  2Y2Z A;  4E7K A;  1BJZ A;  4RGX A;  4M6Y A;  4MHG A;  1HW5 A;  1R36 A;  1R5H A;  4GGG A;  4E70 A;  1RKW A;  3X2Q H;  4XLC A;  3BTL A;  1IF1 A;  1P4A A;  4C3I J;  4NC6 A;  2HDD A;  1N77 A;  1TBX A;  1QVT A;  1XB4 A;  3IH2 A;  3DBL B;  3PUB A;  4CYC A;  5HLT A;  4MIM A;  2W1O A;  1D3Y A;  2JJ7 A;  4RLF A;  4AYB N;  2HPI A;  3TMO A;  4QTR A;  1YIT I;  2EIJ H;  1MJ9 A;  4EJV A;  3DLA A;  4EVI A;  2W25 A;  3L00 A;  1SC7 A;  3WU0 A;  1B8I A;  4Z2Y A;  1W5S A;  2A6T A;  2CFO A;  2HQA A;  3CP8 A;  3HEF A;  4L9N A;  1YO5 C;  3OL4 A;  4P1W A;  1K78 A;  3TOB A;  1FBU A;  3ULQ B;  1FYL A;  4GYI A;  3LSJ A;  3T8R A;  3HGG A;  2Y48 A;  3VOD A;  3VEP A;  1Z6R A;  2MG4 A;  2XAQ A;  1H9G A;  3HXL A;  3I5U A;  3TO9 A;  1Z0X A;  2L01 A;  2MA3 A;  3GTL J;  5J8F A;  1OFC X;  3PNV A;  5K7Z A;  1EF4 A;  2JSP A;  4I09 A;  1Y56 A;  1AKH A;  1MMG A;  1G2H A;  4E7H A;  1QQI A;  3U1K A;  2M8G X;  2KIQ A;  4KDP A;  4BEH A;  2FOW A;  2XGX A;  2BW3 A;  2IJL A;  2O3F A;  5E8I A;  1S3J A;  4F93 B;  1ZN2 A;  4XRS A;  1VQ5 I;  1XGO A;  3BR1 A;  4PDK A;  2OF7 A;  3KIO A;  4BAY A;  4EAT A;  5HLG A;  1XSX A;  2R5Y A;  1XGM A;  4G9Y A;  3MCZ A;  1BC8 C;  3ASO H;  1I5Z A;  3ZMU A;  2IPQ X;  2VT2 A;  5D6E A;  4BE0 A;  2VE8 A;  1O7L A;  3ML6 A;  1KYW A;  1EA3 A;  2X6X A;  5KAF C;  1J5Y A;  1XDS A;  1R23 A;  5K7F A;  4BBS J;  2DQL A;  1JJ6 C;  2VN2 A;  1HCR A;  2LR8 A;  5GPA A;  2D5V A;  1MW7 A;  1T6S A;  1Z3X A;  1YX3 A;  3BC8 A;  2VL8 A;  3OYH A;  4EQQ A;  2ZME C;  2GAU A;  1B8I B;  3U1D A;  2DMT A;  4UB6 C;  2HWV A;  1R58 A;  5M3F J;  2ISY A;  4WXD A;  1K78 B;  1WVR A;  5KK1 A;  1LDJ A;  1FPQ A;  3H5N A;  1R4M B;  1IRG A;  2L5Q A;  1TWA J;  4FT8 A;  2Y9Z A;  1WJC A;  3BR2 A;  2F48 A;  4JX6 A;  3W2W A;  3FIS A;  1AU7 A;  1FJL A;  1RPW A;  2EFO A;  2M0C A;  1UFM A;  3RKQ A;  1AKH B;  3M8E A;  3E5Q A;  2V1X A;  3OL3 A;  2BZT A;  1WKM A;  1QPM A;  2M9H A;  1G4D A;  1MJB A;  5JLW A;  2GOX B;  5CKT A;  3BG9 A;  1WSU A;  2P4W A;  2WAD A;  3LA7 A;  4UV9 A;  3TP3 A;  2DTR A;  4F91 B;  2JRM A;  2KDZ A;  3RKY A;  5GPC A;  4XOR A;  2R5Y B;  5CQE A;  5FLX Z;  3QU6 A;  2E7X A;  2KIS A;  2E7W A;  4A5M A;  1U9O A;  3TQN A;  4M6X A;  2LF8 A;  2Z33 A;  2XAU A;  1GUU A;  1A6I A;  2O61 A;  5FKK A;  4RLQ A;  3HSR A;  3HB9 A;  1Z3Y A;  3CDI A;  4LGW A;  3DEE A;  1IC8 A;  2VOD A;  2B63 J;  1DUX C;  2KJB A;  3I4M J;  5FRM A;  5DCF A;  1V3F A;  2LDU A;  4AYB A;  1UEL B;  2ZME A;  2EIN H;  2KL4 A;  3AKZ A;  3MFK A;  4XLE A;  4IL6 C;  2FNA A;  3DTI A;  3CCS I;  2IW5 A;  5B1A H;  3R60 A;  3BZC A;  4XL9 A;  1D0X A;  2WY7 Q;  5FKL A;  4BQA A;  1FLI A;  2K9Q A;  1D1A A;  3BG3 A;  3DU6 A;  4N9I A;  3PIO F;  1JKP C;  2R7S A;  3GTP J;  3MKL A;  3BQZ A;  2OA4 A;  5F04 A;  4S04 A;  2F5V A;  2LBF A;  4IEJ A;  3JAM K;  1XTA A;  3RTR A;  4BQO A;  1XG1 A;  3C2H A;  2MD0 A;  3JTH A;  4M9S A;  2KZV A;  3HL2 A;  1MBH A;  3J7Z I;  1HQC A;  3DTK A;  3DV8 A;  3BG5 A;  2VOO A;  3KYC B;  1ACI A;  2WV0 A;  4HF2 A;  4DYC A;  5GTI C;  2EV6 A;  2NS7 A;  2V1N A;  3AL0 C;  1JJ8 C;  4DGW B;  2HPM A;  3ZP5 A;  3FBI B;  2G9W A;  2CGP A;  4M71 A;  4M6V A;  3ZMZ A;  4JP0 A;  5E3N A;  4PCQ A;  1PUE E;  4HDV A;  3S2W A;  4QPQ A;  3EUH C;  3M7G A;  5JFR A;  2X48 A;  3WG7 H;  2O6G E;  4ANJ A;  4GFB A;  2YPR A;  2LD5 A;  1W7P D;  1WWX A;  2LOO A;  3BT9 A;  3FXR A;  3KCC A;  4OAY A;  5J3L A;  3BWG A;  2BHZ A;  4BQN A;  5GTH C;  5EG0 A;  1OCP A;  1JT0 A;  1GXP A;  1CQT A;  5LGU A;  4HA8 A;  3M9A A;  1MNM C;  2V9V A;  3SZT A;  3DQV C;  1X58 A;  1K7A A;  4ZDO A;  3MWM A;  2ZME B;  3EQL F;  2MAB A;  3KZY A;  3H35 A;  2QQ8 A;  3T1B A;  3HOV J;  4E7L A;  3KZZ A;  3ZQL A;  5CVI A;  5BMZ A;  3OMY A;  1WZ2 A;  1T2K A;  2FQ4 A;  3WGI A;  1J7K A;  2ZCW A;  1WJD A;  5E1X A;  3SXY A;  3V8J A;  2TRT A;  4A0Z A;  3BG7 A;  2LBF B;  4BXX J;  1VND A;  3VPR A;  4HZF A;  1MSE C;  3S8P A;  4PFO A;  5EZH A;  4IHX A;  3Q9S A;  1NK3 P;  3JRA A;  3HHG A;  5FFX A;  1WJF A;  3L1P A;  1VQ4 I;  2RDP A;  1X2N A;  3WE3 A;  2ADU A;  3RYR A;  2G7H A;  5A2Q Z;  3HPG A;  1YRN A;  2CU7 A;  2M4K A;  1ZG1 A;  2VAS A;  3FK6 A;  3OY9 A;  4B09 A;  4HPQ A;  4B48 A;  4D9J A;  1U0J A;  5K7H A;  1TT0 A;  2E34 A;  1EH6 A;  2HKX A;  3CD6 I;  3S14 J;  2K40 A;  1BI0 A;  5IP6 A;  1MND A;  4ZC3 A;  5TIS C;  1OCT C;  2HZT A;  5FB2 A;  1I3Q J;  3GZN B;  4UB8 C;  2GXB A;  2Y75 A;  4CCL A;  4AD9 A;  1KQ0 A;  4M9X A;  3CC2 I;  2GIZ A;  1MD0 A;  3JRG A;  1O3T A;  3ZQ7 A;  2CW8 A;  1NHA A;  1MBJ A;  1ETK A;  2CW0 F;  1XSD A;  1SAX A;  1G3S A;  3WTZ A;  3S3O A;  5LFA A;  1SMY F;  4II2 A;  3V8K A;  1ULY A;  1IGN A;  2HOT A;  2QKL B;  2LKX A;  3BR5 A;  1G3T A;  1IG7 A;  4IRI A;  1Y1V J;  5D6F A;  2EZK A;  3HPH A;  4LIU A;  2HDC A;  2L9R A;  1TP4 A;  1RC9 A;  2CQX A;  2V1U A;  3H5R A;  1LVA A;  1R7J A;  1SFK A;  2Y69 H;  2EV0 A;  4HAM A;  2EV5 A;  4WF2 A;  1FOK A;  2QKM B;  2DI3 A;  2E5N A;  4PUS A;  3CC7 I;  2WB1 N;  3DF8 A;  1OYY A;  1QHH D;  5D8K B;  1QZE A;  2M3A A;  2GBY A;  4P5O A;  2GXA A;  3FXK A;  2L0K A;  1YRN B;  2ISZ A;  5JLX A;  1MGT A;  3CLO A;  2JK3 A;  3DPL C;  3GXO A;  4V2G A;  2H6C A;  3AL0 B;  2LC2 A;  3DLL F;  2MH9 A;  3R61 A;  3GX4 X;  1EV7 A;  2JRT A;  3P9K A;  4ZZD A;  4ZJZ A;  3H1C A;  3PM1 A;  3S15 J;  2H09 A;  1UAA A;  3ABK H;  2D45 A;  4EGY A;  1DGW Y;  1VF9 A;  2IGK A;  3H5A A;  4AC0 A;  2DPD A;  3A0H C;  2Y30 A;  1FSE A;  2EWN A;  2VON A;  2X6W A;  3HRU A;  3PO2 J;  1AA7 A;  2I5U A;  3LFU A;  4PFP A;  2YX7 A;  3FK7 A;  2DU9 A;  2VJ4 A;  1FMW A;  2DJI A;  2O9L A;  1IAW A;  3OOP A;  1ETX A;  3ZOB A;  1Y0N A;  3VYU B;  1LFU P;  2LRE A;  3KP4 A;  2C6Y A;  2QZ8 A;  3S1N J;  2L2O A;  2DFI A;  1FSH A;  1T0F A;  2XDV A;  2K9S A;  4YFX F;  3DEU A;  4L5E A;  1J9I A;  3M1E A;  2FE3 A;  5DCM A;  2XAH A;  3E3V A;  4R1H A;  1BIA A;  2FQ3 A;  1IV8 A;  4CCN A;  3IWF A;  3K4K A;  5ED4 A;  3LAP A;  3L2W A;  1JUP A;  3ELK A;  3PO3 J;  5M5X J;  2DT5 A;  4RB1 A;  1PDN C;  1H9T A;  5LD2 C;  3H9Q A;  5HNF A;  1YG2 A;  1S29 A;  4MNU A;  5K5Q A;  3M8F A;  1ITY A;  2GQQ A;  1VQP I;  3Q3S A;  2CUF A;  4D5C A;  3DWL E;  4II3 A;  5EEA A;  1F9N A;  1O3R A;  2VC1 A;  3S1Q J;  5EDN A;  3GBG A;  3DTE A;  3D5R C;  4Q4Z F;  4IKF A;  3H92 A;  3CCY A;  2HXI A;  1A6Q A;  2IA1 A;  4Y4R A;  5HDG A;  1SFE A;  3KZI C;  1QVU A;  1KGS A;  3F8C A;  5C44 J;  3QPT A;  3GUD A;  4I7H A;  5ICF A;  4FET A;  1D0Z A;  4NNJ A;  1A35 A;  5EZG A;  1R22 A;  5EF6 A;  5DD4 A;  4FIS A;  3LQQ A;  2MLK A;  5AON A;  4BUP A;  3KEQ A;  4ESF A;  4ZTF A;  2IBD A;  1RIO H;  5GAD J;  1TNS A;  4Z6Y A;  1REP C;  4IHS A;  4O6J A;  4C3J J;  1SVM A;  3IHU A;  2XHK A;  3ZQH A;  4OMY A;  3OSF A;  4LB5 A;  5IP7 J;  5DCM B;  2H8W A;  1JGS A;  1MKM A;  1R00 A;  1X3Z B;  4HQM A;  3V7R A;  3JAM Z;  4L18 B;  3UKG A;  3I53 A;  2JZY A;  2ACJ A;  4ENM A;  1VQK I;  4WK8 F;  3BJA A;  2XRO A;  1LJ9 A;  4HF0 A;  2VI6 A;  4KFC A;  3VB2 A;  5EGO A;  2WAF A;  1FBS A;  4RB2 C;  2L9S A;  2A6E F;  4A6E A;  4A3G J;  3R0A A;  1QZZ A;  2CMP A;  3EYY A;  4CA0 A;  4CHU A;  1KU2 A;  2JWT A;  3B6A A;  3TL4 X;  2XRL A;  2QVO A;  2JA2 A;  2ELJ A;  2E2H J;  2M4G A;  3LSK A;  3DBR B;  3QOE A;  4B3A A;  1SVO A;  4BAC A;  2V4J C;  2QEX I;  3CCR I;  2FMY A;  3LMM A;  1UHS A;  1F43 A;  1K83 J;  2MYS A;  2K86 A;  2FJ1 A;  5LHG A;  1SAU A;  1ONV A;  2KKO A;  4AUX A;  3VYS B;  1ZAR A;  1LEB A;  3RDI A;  1PP7 U;  1QO0 D;  1JXS A;  3GW2 A;  2WV1 A;  2HKO A;  3ZQG A;  5C4X J;  1ETV A;  5IT9 K;  4N4N B;  1OIS A;  2MLG A;  4D7M A;  2W00 A;  4HG2 A;  1U6G A;  4BY1 J;  1ZK8 A;  1JI8 A;  4MLO A;  2RRE A;  1X3W B;  1FZP B;  4DJA A;  2DK8 A;  4U0Y A;  4KIT B;  3DP7 A;  1HW1 A;  3FXQ A;  3K4M A;  2KP6 A;  5J4V A;  1YW9 A;  4G12 A;  1UHM A;  2W85 A;  5E3L A;  4F55 A;  1WJA A;  5EGO B;  2K9N A;  1AHD P;  3BY6 A;  1Y8R B;  3FZV A;  4I99 C;  2FEZ A;  2EIL H;  1R5G A;  2W84 A;  2DFF A;  5E1W A;  4ENK A;  3EDP A;  2JQ7 A;  1Y39 A;  4N0B A;  2ZXW H;  5F0F A;  1HF0 A;  1RKT A;  3CF5 F;  2UUZ A;  3JSO A;  4KJZ A;  3WG9 A;  2PJR B;  4KIF A;  1MZB A;  1O57 A;  5F08 A;  3GCM A;  5LGN A;  2F4I A;  3CCM I;  4JK1 X;  2XGC A;  1AWC A;  2G7U A;  3ZCO A;  3GVA A;  3REO A;  3K2Z A;  1W5T A;  4NC7 A;  1DPR A;  4W97 A;  3LAJ A;  2LY9 A;  5CLS A;  4JX5 A;  4RS8 A;  4OAZ A;  4IVN A;  3W2V A;  1VZ0 A;  2D1H A;  3K4N A;  4M3G A;  2KIU A;  4HBL A;  1UJ8 A;  3GTO J;  3JTG A;  4RAY A;  4U7D A;  4C30 A;  5M3M J;  2EIM H;  2XAS A;  3CCE I;  2DA4 A;  3PSI A;  2VKD A;  3S1R J;  3HYI A;  5J4Y A;  2M8E A;  3SQN A;  1LEA A;  2IT0 A;  4B4C A;  1MBE A;  3T0Y A;  1ZRE A;  4GRI A;  3RCO A;  2FBK A;  4CCO A;  5IPA A;  3IL2 A;  2QQ9 A;  3SFZ A;  2R7U A;  3GTQ J;  2JUC A;  2P5V A;  2XF6 A;  4PJL A;  5AIP A;  2X51 A;  2KJC A;  1H89 C;  3BP8 A;  2FA5 A;  3S1M J;  4Q48 A;  2A05 A;  2K9L A;  2Z3Y A;  4XID A;  3W6J B;  4IX7 A;  3H3Z A;  5C3E J;  1FTT A;  3AAF A;  4YFN F;  2E36 A;  2EZL A;  1T98 A;  4V19 K;  3CZ6 A;  5GP9 A;  2OU2 A;  3LA2 A;  1XGS A;  2L4A A;  1JKO C;  3E0J B;  3TDZ C;  1B72 A;  4Y17 A;  5JVT A;  1QBJ A;  3S3M A;  2R5Z A;  9ANT A;  4HST A;  3CLQ A;  2BEO A;  1HW2 A;  2K5C A;  3EYI A;  1KQ9 A;  2LKS A;  4CH7 A;  1ZQ3 P;  2K3P A;  2VT3 A;  3BR6 A;  3PQK A;  3S2D J;  2DJN A;  1R9T J;  1F5T A;  3QPH A;  4HRI A;  2RVC A;  2HOS A;  3FKI J;  2ZNY A;  4ABZ A;  4DYQ A;  3FIW A;  2CS3 A;  4Y33 A;  1GV2 A;  2DMQ A;  3QYE A;  4EJW A;  1TT5 B;  5IYC J;  3A4C A;  1YJW I;  2V26 A;  1A04 A;  3CMA I;  4OMZ A;  1E3O C;  1IRZ A;  2BXZ A;  3QP5 A;  3F21 A;  2DMP A;  4MQV A;  2GA1 A;  2NVX J;  1B4A A;  3FXL A;  1SD4 A;  3ZRG A;  5J1R A;  3MZH A;  3F6O A;  1IRX A;  4ESB A;  5D4R A;  2NRA C;  3KPH A;  1B59 A;  5DDG A;  2BY1 A;  1LDD A;  2UXX A;  3Q0V A;  4LJZ F;  4DIQ A;  3NAR A;  3J81 K;  1VQ7 I;  4BJ6 C;  4MEY F;  2XSD C;  4RGU A;  4CDG A;  3KP6 A;  1SEU A;  1FP1 D;  3ABL H;  3BOQ A;  4HQE A;  1I6X A;  2IRF G;  4C3H J;  3BDD A;  5GAH J;  3BG6 A;  1U3E M;  5FRN A;  3G3Z A;  5E3O A;  5FRO A;  2GIV A;  3K0L A;  3WTS C;  4L0Y B;  4KN7 X;  1B72 B;  4IHW A;  3GWZ A;  5FFZ A;  3L2C A;  4AIJ A;  3BR0 A;  1ORK A;  2YUS A;  4OIN F;  2F4O B;  4KIG A;  2E60 A;  3BLY A;  3DCF A;  1MMS A;  5CPR B;  4E7S A;  5M5W J;  3V4G A;  2OBP A;  5HOO A;  4E7J A;  1ZG5 A;  3CMM A;  4IXA A;  4CYC B;  4FHT A;  5D5V B;  2IS4 A;  4M73 A;  2ZXI A;  5TJJ A;  2DLL A;  2H1K A;  3OR1 C;  1SAN A;  1TWC J;  4XMY A;  3LSR A;  2YU9 J;  2BE5 F;  1ODD A;  2IXS A;  2P7V B;  3JCU C;  3NAU A;  3S17 J;  1E3H A;  3GFM A;  4AVP A;  1I50 J;  2VBZ A;  1U9N A;  1U5T C;  1VQL I;  2HOA A;  4S05 A;  4B44 A;  4XRF A;  3ZPL A;  3Q9V A;  4LLN A;  4E7Z A;  4JYK A;  4FE7 A;  2QYO A;  1L0O C;  4BYY A;  5HDN A;  1KON A;  1X1C A;  2K7L A;  3OYB A;  2H6B A;  2YSR A;  1UZC A;  4A69 C;  1VQO I;  3M1C A;  4IHY A;  3I59 A;  1WH7 A;  4FQG A;  2VKE A;  2O8K A;  3L09 A;  3ERE D;  3C1D A;  1ZTR A;  3E6D A;  1OQY A;  4XN0 A;  4A3B J;  1G3W A;  1BOB A;  3ISP A;  4ZH4 F;  1R1T A;  4BEH B;  2BW3 B;  2NVY J;  2P5L C;  4BHC A;  4ON0 A;  3TKY A;  3M8J A;  4RB0 A;  1IN4 A;  4A12 A;  2L9V A;  2MSY A;  4UUV A;  4EJU A;  2IS6 A;  1R4N B;  4MFE A;  3PFY A;  2OJE D;  2VJ5 A;  1W1W E;  3A03 A;  1R49 A;  1WH5 A;  1HLV A;  4HX4 A;  2CH0 A;  2UV1 A;  2XSJ C;  2XVC A;  5ILV A;  4NQW A;  1W5C C;  4GXO A;  4G7Z F;  3MZY A;  2IVM A;  1N25 A;  3J7Y J;  4CCJ A;  2XIG A;  1VTN C;  2VUM J;  3HOZ J;  5FLM J;  1V5G A;  1LFP A;  1LB2 A;  4M3F A;  3GLL A;  3CQZ J;  3K4B A;  3VYR B;  3ZMD A;  1BIB A;  2EK5 A;  3IH3 A;  4RDU A;  4XKC A;  1U5T A;  2NXN B;  3U21 A;  2JSC A;  2LNB A;  4CCK A;  2IEK A;  4LD5 A;  5J1U A;  2TDX A;  2R7Z J;  5HS8 A;  2VC0 A;  1KU9 A;  2AO9 A;  2A5W A;  3ZMS A;  2OC6 A;  2DOF A;  3QWL A;  5JVG F;  4EEF G;  3I59 B;  2EZI A;  1A31 A;  4KA4 A;  1OLT A;  2DMU A;  3OYM A;  1GV5 A;  4Y13 A;  4UY8 I;  2PBI A;  3F8N A;  2OTL I;  2H27 A;  3CUO A;  4HNT A;  2XKO A;  4G6T B;  3ASN H;  5AIQ A;  5D5U B;  4OIQ F;  3KYD B;  4CO8 A;  3ZQQ A;  2IP2 A;  2A07 F;  1J09 A;  3CCJ I;  2WAQ N;  4XON A;  2DXI A;  3A1Y A;  5DV5 A;  3SEZ A;  3KET A;  1GHC A;  5L3B A;  5D5W B;  3LST A;  4J00 A;  1Y1W J;  2ZSH B;  2R7W A;  4NBQ A;  3ECO A;  2E5Z A;  3HJE A;  1E3P A;  2EBI A;  3K4J A;  4NQW B;  4XQF A;  3COA C;  3ECH A;  1QA6 A;  2YR2 A;  1EH8 A;  3O8H A;  4WXH A;  1WPK A;  3K70 C;  5KNL A;  1MH3 A;  3MN2 A;  5LGT A;  1HDP A;  1YIJ I;  3I4N J;  4LFU A;  4U7B A;  3MAJ A;  2LFB A;  4XRM A;  2IAI A;  2NAZ A;  4N4O B;  3MD2 A;  4BDZ A;  1U5T B;  1DU6 A;  1MNE A;  1XX5 A;  4V2F A;  3I0T A;  2R7O A;  1BR1 A;  1S7A A;  3GEZ A;  3TGN A;  5M5Y J;  4YEL A;  2FXA A;  1FOW A;  3BJ6 A;  3JRF A;  2G0E A;  3WGG A;  2X0L A;  3R6S A;  1XD7 A;  3BJO A;  2L7F P;  2NVU B;  1KZH A;  1V54 H;  2HZD A;  2RC4 A;  3HZJ A;  1OR7 A;  2KPM A;  4I76 A;  4HLX A;  1LVK A;  3OYL A;  4A3C J;  4BE1 A;  4D5F A;  4PK4 A;  1I3A A;  3C2G A;  3G2B A;  5CVU A;  1I1S A;  3G1O A;  3FF5 A;  3G73 A;  4AWX B;  3EUK L;  2DTZ A;  2WC2 A;  5H6R A;  2LY2 A;  3FHZ A;  3CJN A;  2L7M P;  2OCC H;  4JQF A;  1HDD C;  1ZKG A;  4HLY A;  3E5X A;  5LHH A;  2DA3 A;  3QQA A;  2OCE A;  3BTJ A;  5F1R A;  4YIR X;  5IOZ A;  4FAS D;  1W0T A;  1UCR A;  4GYG A;  3KP5 A;  2XAF A;  2FX0 A;  5CJ9 A;  1E17 A;  2GOM A;  2XGD A;  4CYD A;  3KLN A;  2Q8K A;  2IS2 A;  4QPO A;  4E4H A;  3J7A Y;  2XPW A;  4KIS A;  2FD5 A;  3QPS A;  5DS9 A;  3LSP A;  3TBI A;  1SFO J;  5EG0 B;  4MEX F;  4RAF A;  2PI0 A;  2ZC2 A;  1OJL A;  3I55 I;  1JUS A;  3JRD A;  3CUQ C;  3H36 A;  2QLZ A;  4IF4 A;  1FOY A;  2OAZ A;  3BPV A;  2Z2S B;  1LKX A;  1IUF A;  3ABM H;  1X2M A;  3OR2 C;  3KP3 A;  5IP9 J;  2DCE A;  1GLN A;  1UG2 A;  2D1V A;  2K85 A;  5IOY A;  3HOX J;  3PSF A;  3HGY A;  4GDF A;  1IDZ A;  3J81 Z;  4AIH A;  4LIV A;  1T0F C;  4G94 A;  3WTU C;  3HTS B;  3N05 A;  3VSK A;  2CUE A;  2EFQ A;  2O03 A;  2DK5 A;  2IGM A;  2DOA A;  1DP7 P;  4IHV A;  1MBG A;  3LSG A;  2IGN A;  2ME6 A;  2R7Q A;  4L9T A;  3QP6 A;  2R7T A;  5ILU A;  1RR8 C;  3E97 A;  5J6X A;  4YG2 F;  2P8T A;  3PL8 A;  4IZZ A;  2H94 A;  4XOT A;  1ZLJ A;  3EET A;  1JE8 A;  3P5J A;  1H0M A;  5ERI A;  4G8X A;  2CV1 A;  2LTP A;  3HOW J;  4IOA F;  3IH4 A;  1EH7 A;  4PJN A;  2VJI A;  1F1Z A;  2X85 A;  5HS9 A;  4ZYG A;  3HHH A;  1HKS A;  4FX0 A;  2KDO A;  2HYJ A;  5F0C A;  2Y0M A;  3CO7 C;  4UUS A;  1EJ9 A;  1XPX A;  1LUJ B;  1SD5 A;  1LFB A;  5LBQ A;  2QF7 A;  3V7S A;  4G6Q A;  3GFL A;  2WAQ A;  1B6A A;  1K6Y A;  1XMA A;  4IQ4 A;  4YFK F;  3PFI A;  3S2H J;  3I58 A;  4PJ0 C;  3B02 A;  2L02 A;  2JVH A;  3PQJ A;  1ENH A;  2H1L A;  4A5N A;  5F0H A;  3T5X A;  4MTD A;  2UZK A;  1ETQ A;  3CUQ A;  4Y7N J;  1TLH B;  1G6N A;  2JA5 J;  3JRC A;  1JHH A;  3A2K A;  2PG4 A;  2VJJ A;  2B7E A;  3O2P E;  1TC3 C;  3H0G J;  1B9M A;  4PGG A;  4K2E A;  3SEQ A;  3K70 D;  1FC3 A;  1U78 A;  1M1E B;  3E7L A;  3MQ0 A;  1YOV B;  2HVR A;  4BY7 J;  3K6G A;  3G4S I;  4IRH A;  2W82 A;  4LOC A;  1QGP A;  3K9T A;  1S6L A;  4XSZ F;  2BY3 A;  2PQ8 A;  5E20 A;  3BTI A;  1Z7L A;  2DA6 A;  1XCB A;  2M30 A;  2P81 A;  1YHQ I;  2E2J J;  3ZR8 X;  4UHT A;  1NTC A;  1XGN A;  2FRH A;  4Q47 A;  2JT1 A;  3ABU A;  1F4K A;  3FMQ A;  3LWF A;  3U2R A;  5HDK A;  2V9P A;  1Q1V A;  1JTX A;  1PVE A;  1X1D A;  1GDT A;  1BI1 A;  1KQ8 A;  1S8N A;  4G7H F;  4UUS B;  2QM3 A;  2OZU A;  3CDH A;  2E1C A;  3L2V A;  2FUG 2;  3F9K A;  2QWW A;  2FSW A;  1IN7 A;  4AIK A;  2XF5 A;  3FMS A;  2P7C B;  2LRD A;  3LSI A;  1XS9 A;  1FMV A;  2JPB A;  3F8M A;  4A3L J;  1A5J A;  2JTV A;  4Y52 J;  3ZQF A;  2JA6 J;  3M4O J;  3QYF A;  3FX3 A;  4DNC A;  1Z6T A;  4ZZL A;  2DAO A;  1PP8 F;  2GZW A;  2XF7 A;  2L3D A;  4R79 A;  2ZNZ A;  3CUQ B;  4F7Z A;  1PJR A;  1TTY A;  1RR7 A;  3Q0W A;  4CZC A;  2AQE A;  1HST A;  1XMX A;  3FHN A;  5L3C A;  3HC7 A;  2V6E A;  2XPV A;  5LEK A;  2KMU A;  4OIR F;  2QQA A;  2QSH X;  1HXD A;  2WA0 A;  3OYF A;  4ZYD A;  2CQK A;  3F0C A;  3VYT B;  4BJT A;  4KYW A;  3OYI A;  2DBB A;  3F6V A;  1T39 A;  2K4B A;  4DBQ A;  3P9C A;  2HR3 A;  5TGT A;  1Y8Q B;  5F6F A;  1ZGW A;  2F4M B;  2HXO A;  2ZJP F;  4XLN F;  2VOP A;  3GME A;  1YLF A;  4HYE A;  3NWS A;  2WB1 A;  2EFP A;  1DDN A;  2MGQ A;  2PMH A;  3FMR A;  4XM3 A;  4ZYA A;  5J40 A;  3IRR A;  1QZY A;  2Z1D A;  4O3M A;  1FNN A;  2HS5 A;  1WHU A;  2X6Y A;  5CYV A;  4C2T A;  3ZMV A;  2BV6 A;  3J80 K;  1TW2 A;  2M1B A;  3FXM A;  3CCQ I;  1K79 A;  5B1B H;  2ZB9 A;  1Y6I A;  1VQN I;  2ELK A;  1DU0 A;  1YX5 A;  3DEW A;  1FWZ A;  2R7X A;  2CJJ A;  2D2W A;  3OS0 A;  1JGG A;  5H20 A;  2JPC A;  1WCM J;  1SD7 A;  2QCO A;  4BJ5 C;  5J47 A;  2M7B A;  2WTE A;  2MH2 A;  2X4H A;  3AG2 H;  2JUG A;  2PEX A;  1V4R A;  5E17 F;  1BA5 A;  1APL C;  3S16 J;  3DKW A;  3OIP A;  4FE4 A;  3K1M A;  2LYC A;  3GO5 A;  1S72 I;  3RZO J;  3LOC A;  2FF4 A;  2O8X A;  4BHP A;  3L2U A;  5DTD A;  4CGZ A;  1YFH A;  1T08 B;  1GXQ A;  3CJT B;  3IRQ A;  1R71 A;  1BI2 A;  4XKB A;  4KIC A;  3CCU I;  3PJR A;  1Z91 A;  1IO2 A;  2V9K A;  4O5V A;  5HVQ C;  4RGR A;  3F22 A;  1BW5 A;  3TO7 A;  2DW4 A;  3BQY A;  1IW7 F;  1ZRF A;  2HDW A;  3RPU A;  3FM3 A;  1S9H A;  1D0Y A;  2UXN A;  3KYL A;  1OCO H;  1ZR2 A;  3FXJ A;  2HQR A;  4XLF A;  1BC7 C;  5FLX K;  2KRH A;  2M7A A;  3TOA A;  2E19 A;  2K9M A;  1FBQ A;  3H3V K;  2HTJ A;  3GFI A;  4I6Z A;  1G3Y A;  2PFB A;  5JHU A;  3CC4 I;  2W57 A;  4BU2 A;  1P2F A; 
#chains in the Genus database with same CATH homology
 3SYT A;  5KCM A;  2E60 A;  3BLY A;  3K4L A;  3DQV C;  5CPR B;  4ZDO A;  2Q2E B;  4E7S A;  4AU7 A;  5HOO A;  4E7J A;  3W2A A;  4YRV A;  3CMM A;  3OOU A;  3PNT A;  4ZDL A;  2MAB A;  3H35 A;  2IS4 A;  3CJR B;  4E7L A;  2ZXI A;  3OR1 C;  4XMY A;  3OMY A;  2IXS A;  2KRC A;  1WJD A;  2HVS A;  1TZL A;  3BG7 A;  4B44 A;  2LBF B;  3HOT A;  4E7Z A;  2IS1 A;  3K10 A;  4PFO A;  3S8P A;  2KHM A;  1WJF A;  2VQL A;  3SDB A;  3MKW B;  3OYC A;  1KON A;  4PJJ A;  1X1C A;  3OYB A;  3M1C A;  3HPG A;  2KLO A;  2M4K A;  2VAS A;  3OY9 A;  4HPQ A;  1V5E A;  4B48 A;  4D9J A;  4XN0 A;  1BOB A;  1X4O A;  1U0J A;  1TT0 A;  3QOD A;  2R7R A;  4BEH B;  1MND A;  2BW3 B;  2DT6 A;  2MC4 A;  4ZC3 A;  3M8J A;  1V5F A;  2X1C A;  4CCL A;  1WJE A;  4ITV A;  2IS6 A;  3UNG C;  2X1E A;  3PFY A;  2CW8 A;  3OS1 A;  2VJ5 A;  1PYV A;  4HSR A;  4E6K G;  3S3O A;  5LFA A;  2CH0 A;  2OUM A;  2UV1 A;  4II2 A;  2XSJ C;  4U87 A;  4ZDP A;  3V42 A;  3OYD A;  2L7K A;  3EPZ A;  3VDX A;  4CCJ A;  2QKL B;  1V5G A;  1LFP A;  4X0G A;  3OIQ A;  3K4B A;  4XOP A;  3VYR B;  1X4P A;  2PMZ A;  3HPH A;  4BL0 B;  1QU3 A;  4LIU A;  4RM2 A;  2CUZ A;  2HNH A;  3E1S A;  3H5R A;  4XKC A;  4BGD A;  3U21 A;  1SFK A;  1WFX A;  2BVM A;  3IP4 B;  2QKM B;  4CCK A;  2CV0 A;  2VXD A;  2E5N A;  4PUS A;  3OYN A;  1QHH D;  2A5W A;  3OYA A;  2OC6 A;  2M3A A;  4P5O A;  4XKV A;  2LH9 A;  4Y3O A;  3H0D A;  4AVZ A;  3DPL C;  1WJB A;  3S32 A;  4BS9 A;  1OLT A;  2ZSI B;  2F6C A;  3AL0 B;  3OYM A;  2LC2 A;  3ONQ A;  2PJR A;  4HNT A;  4ZJZ A;  4G6T B;  1BR2 A;  1X1B A;  3AFH A;  3ZQQ A;  3NWT A;  1UAA A;  4OWR B;  1DGW Y;  1J09 A;  2IGK A;  3H5A A;  3CJQ B;  4XON A;  3D5S C;  4E7I A;  2DXI A;  2XC7 A;  3A1Y A;  2CUJ A;  3SEZ A;  2X6W A;  2VXZ A;  4J00 A;  3VSL A;  1G8X A;  2ZSH B;  3IUO A;  1AA7 A;  2R7W A;  3LFU A;  4PFP A;  2E5Z A;  4XLA A;  3KX2 A;  3K4J A;  4XQF A;  4NQW B;  2VJ4 A;  1FMW A;  2ZFU A;  2DJI A;  4IQJ A;  2V7F A;  4NUB A;  5KNL A;  3K70 C;  4J01 A;  2LG4 A;  2HU9 A;  1T95 A;  2I8D A;  3VYU B;  2LRE A;  3FKJ A;  2L2O A;  2VKH A;  4ZTJ A;  2O5R A;  2XDV A;  4U7B A;  4CSW A;  1N78 A;  3OYG A;  4N4O B;  2RNG A;  2Z16 A;  3MD2 A;  4BDZ A;  3HKZ A;  2WAE A;  1E0E A;  2CV2 A;  1MNE A;  3D5L A;  2WBM A;  2R7O A;  4CCN A;  3HOS A;  1BR1 A;  3CP2 A;  4XR6 A;  3K4K A;  3L2W A;  4YEL A;  1LDK B;  2RQQ A;  3CF2 A;  2HZD A;  3FDY A;  1QHG A;  5LD2 C;  3H9Q A;  4RM3 A;  4D1Q A;  5HNF A;  2KPM A;  1W36 C;  3OYL A;  1LVK A;  2OV7 A;  3MKY B;  4BE1 A;  3ZGK A;  4PK4 A;  3C2G A;  3DWL E;  3G2B A;  4II3 A;  1MMA A;  3EUK L;  4JOM A;  2VQG A;  3GBG A;  3DTE A;  3D5R C;  4XN3 A;  3HUG B;  4CCM A;  4IKF A;  2LY2 A;  4Y4R A;  4JQF A;  3ZXS A;  2WY8 Q;  3QYB A;  4XKW A;  4F92 B;  4DOZ A;  1WJ5 A;  3S93 A;  3BCB A;  3HG9 A;  3RSN A;  1X19 A;  4DBR A;  4FAS D;  4FET A;  1D0Z A;  4YEJ A;  2NOJ B;  2Y0S A;  3H9G A;  1G59 A;  4NNJ A;  2M0M A;  4B3X A;  2GOM A;  1NG6 A;  4B47 A;  2R7V A;  2IS2 A;  4QPO A;  4E4H A;  3J7A Y;  4ZTF A;  4BUP A;  3OYK A;  1YE9 A;  4KIS A;  2ZXH A;  3TBI A;  3RPU D;  4BXF A;  4PSW A;  3DU5 A;  3OWT A;  5HNH A;  4BDY A;  3MKZ A;  2Z2S B;  1LKX A;  1X1A A;  1N75 A;  2VQH A;  3OR2 C;  2DCE A;  1GLN A;  2JVG A;  3PSF A;  3H9J A;  4LIV A;  1T0F C;  3N05 A;  4HNU A;  3VSK A;  2IGM A;  2DOA A;  1D1C A;  1DP3 A;  3LSM A;  4F52 A;  3I3L A;  2IGN A;  3LSG A;  2WAF A;  2R7Q A;  3KEY A;  2L9S A;  2W7N A;  3BCA A;  2R7T A;  2R4G A;  4LG3 A;  3PL8 A;  4IZZ A;  1D1B A;  4XOT A;  2CMP A;  4CA0 A;  2P0W A;  3CES A;  3OYE A;  1DGR M;  1NG7 A;  4BQQ A;  2CV1 A;  2BOL A;  1DQU A;  4PJN A;  2VJI A;  1UG0 A;  3TL4 X;  3LSH A;  2JA2 A;  2X85 A;  2ELJ A;  3DKX A;  3PNY A;  2KDO A;  1OR7 C;  2M4G A;  3LL7 A;  3LSK A;  4XLC A;  3QOE A;  1N77 A;  3PUB A;  4B43 A;  2WAQ A;  4BAC A;  5HLT A;  1K6Y A;  2V4J C;  2VB6 A;  4IQ4 A;  2W1O A;  3LMM A;  4RLF A;  4LIT A;  2MYS A;  2HPI A;  3TMO A;  2LY1 A;  4HEA 2;  1SAU A;  4BE2 A;  3DLA A;  2JVH A;  4XLH A;  3VYS B;  2MFZ A;  3DPT A;  2A6T A;  2CFO A;  2HQA A;  3CP8 A;  3DPU A;  3OL4 A;  4P1W A;  2E1M C;  2BVL A;  3A2K A;  2W4S A;  4N4N B;  2VJJ A;  2W00 A;  4HG2 A;  4PSX A;  1JI8 A;  4MLO A;  3FBN B;  3HXL A;  2RRE A;  3SEQ A;  3K70 D;  4DJA A;  3IAM 2;  4KIT B;  3PNV A;  2HVR A;  3K6G A;  2JSP A;  3K4M A;  2KP6 A;  1Y56 A;  2W82 A;  3DKY A;  3UR3 C;  4F55 A;  1ERD A;  1MMG A;  1WJA A;  4E7H A;  1Z7L A;  4BEH A;  4F93 B;  2BW3 A;  3ZR8 X;  3VWB A;  3EUA A;  2DT7 B;  2UWM A;  1Z21 A;  4EAT A;  1X1D A;  3L2R A;  2UUZ A;  4KJZ A;  2FUG 2;  3F9K A;  3L2V A;  2PJR B;  2XF5 A;  4BE0 A;  1W36 D;  2LRD A;  3LSI A;  4C2U A;  1FMV A;  1EA3 A;  2AQF A;  2X6X A;  2F4I A;  4CUG A;  2L9N A;  3QYF A;  3ZCO A;  1MW7 A;  4NC7 A;  1Z3X A;  1YX3 A;  3BC8 A;  2VL8 A;  3OYH A;  4OAZ A;  3W2V A;  2XF7 A;  1VZ0 A;  4R79 A;  3K4N A;  1ZEL A;  1PJR A;  1MMD A;  2KQR A;  1BR4 A;  2VQC A;  3H5N A;  4CZC A;  2AQE A;  2L5Q A;  3FHN A;  3IAS 2;  1WJC A;  4C30 A;  3HC7 A;  2V6E A;  2KMU A;  3W2W A;  4C9Y A;  3PSI A;  3I9V 2;  4KT6 A;  2VKD A;  2WA0 A;  3OYF A;  3S3N A;  2Q1Z B;  3VYT B;  4BJT A;  3OYI A;  3OL3 A;  4GRI A;  3RCO A;  4CCO A;  4DBQ A;  5TGT A;  2R7U A;  2XF6 A;  2GOX B;  4PJL A;  5CKT A;  2X51 A;  3NWS A;  2WAD A;  4NC8 A;  4XNF A;  4F91 B;  2K9L A;  2WB1 A;  4XOR A;  4IX7 A;  2IGO A;  5CQE A;  3OYJ A;  4XM3 A;  4ZYA A;  3CZ6 A;  2Z1D A;  2X6Y A;  3K4C A;  4C2T A;  2X1D A;  3MMY B;  2XAU A;  3E0J B;  5KHD A;  2VPL A;  4RLQ A;  3S3M A;  1Z3Y A;  4HST A;  4RMN A;  3DEE A;  1Y6I A;  1YX5 A;  2K5C A;  5FRM A;  2R7X A;  4CH7 A;  2K3P A;  4F3Q A;  4AYB A;  3OS0 A;  1UEL B;  3L2Q A;  2KL4 A;  3AKZ A;  4XLE A;  3DTI A;  4HRI A;  1P9Q C;  4BJ5 C;  2E1M B;  2M7B A;  2CS3 A;  2JUG A;  4XL9 A;  4Y33 A;  1D0X A;  2WY7 Q;  4PJM A;  5CQG A;  3OIP A;  3QYE A;  2LYC A;  1D1A A;  3DU6 A;  2R7S A;  3A4C A;  2V26 A;  1HA8 A;  3L2U A;  2F5V A;  2LBF A;  4XKB A;  3W3C A;  3RTR A;  3ZRG A;  4BQO A;  3C2H A;  2MD0 A;  2CW7 A;  3PJR A;  2V9K A;  5HVQ C;  2VLA A;  1IRX A;  2KZV A;  3OS2 A;  3HL2 A;  5JHF A;  3DTK A;  4DIQ A;  1MMN A;  4BJ6 C;  3RQ4 A;  2HDW A;  2V1N A;  1S9H A;  3AL0 C;  1R6R A;  1D0Y A;  4DGW B;  3KYL A;  2HPM A;  3FBI B;  4XLF A;  3BG6 A;  5FRN A;  2KRH A;  2HVQ A;  2VIX A;  2M7A A;  5FRO A;  2K9M A;  4H4K C;  4QPQ A;  3EUH C;  3SZG A;  4BU2 A;  4ANJ A;  2LOO A;  4OAY A;  4E7K A;  4BQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...