2VXDA

The structure of the c-terminal domain of nucleophosmin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
54
structure length
54
Chain Sequence
GGSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords NUCLEOPHOSMIN
publication title Structural Consequences of Nucleophosmin Mutations in Acute Myeloid Leukemia.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2008-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16276 NPM1-C Nucleophosmin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vxdA00
2VXDA
chains in the Genus database with same CATH superfamily
3GTKJ 1JGSA 2L3DA 4A12A 2M3AA 2GAUA 1AHDP 3FXJA 4HQMA 3OYJA 2JUGA 1FZPB 3HUGB 4XKWA 1QA6A 1WJFA 1Y1VJ 1TWFJ 4RAYA 4ASNA 2B0LA 3E5XA 2VE9A 1A6IA 3K6GA 5IP6A 2ME0A 1ON2A 2HZTA 1E0EA 1EF4A 2CQQA 3KP3A 3WE2A 3GTOJ 3PSIA 3CTAA 3QYEA 4LOCA 4YG2F 3FXKA 3HEFA 4NC8A 3IKVA 4XORA 1FX7A 1FNNA 3MN2A 4E7SA 3FDYA 2QEXI 2LKXA 4XSXF 2ZB9A 1JHFA 4EJUA 1G3YA 4A2UA 2MBFA 4LIUA 4RGXA 2QWWA 5BPDA 1XN7A 1QPMA 2W82A 3M9AA 5K5RA 3PIOF 4XLAA 4ENNA 4EJOA 3T5XA 3KX2A 2EQRA 4YFKF 5ICGA 3BQZA 3DU6A 3EUAA 2BZTA 1OR7C 2IP2A 2D2WA 2IW5A 3HRUA 3WU1B 2X6WA 2CV1A 4LJZF 5HDKA 3IH2A 2O8KA 1P92A 3F0CA 1QZZA 1TQIA 3N05A 2V9KA 3I4NJ 4LLLA 1SFXA 2ID3A 2E1OA 1XGMA 1XMAA 2XSJC 2UV1A 1NH3A 1KQ0A 1Z3XA 2VQHA 4C2MJ 4HDUA 3AAFA 1K78B 1ZHFA 2QQ9A 2V1NA 4PGHA 3A1YA 3DEUA 1LPQA 1K6OA 2DYRH 4XK4A 2OZUA 3N97A 3DQVC 3CUOA 4LB5A 2IS2A 3LSKA 2Z9OA 3IP4B 4XN0A 5HNFA 1JKOC 2FQ3A 2DN0A 1G8XA 1HSTA 1Y6IA 2EPFA 2WA0A 1ETQA 2W1OA 4V19K 5HS8A 1W5TA 1Z67A 2EK5A 2VXDA 2LOOA 3L9FA 3W3CA 3FXRA 4PFOA 3HOSA 4V2GA 2GM4A 2Y0SN 2ZMEC 1A6QA 3O8HA 1DP3A 4ENMA 2F5VA 2RV8A 1P7JA 2VJ4A 1IXRC 1B8IA 4XRSG 4L18B 3A0HC 2LR8A 1BR1A 2VT3A 2Y75A 3FHNA 2E1NA 4BXXJ 2GA2A 2F5CA 4W97A 3B02A 1WI9A 2LY9A 4IPAA 5KAIC 3O3KA 1I3QJ 4IHYA 3HL2A 5DS9A 1GV5A 1VFCA 5DUKA 1BC8C 1V3FA 1GDTA 2OC6A 2VQCA 5GTIC 4XIDA 3PL8A 3BROA 2QLZA 3U21A 1D8KA 3F8BA 1MDMB 1SAUA 3AFHA 5GTHC 3HOTA 3ZQIA 3K70C 2WAQN 5BNGA 2CG4A 3AG1H 2W48A 2M34A 2QSHX 1MJ9A 2R93J 4HSRA 4DIQA 3KYLA 1APLC 4KUMA 2HOTA 5LHIA 4Y52J 3CCUI 2DA5A 4CUGA 1FYKA 2BVMA 1T2KA 1J5YA 1ZTRA 4FE4A 1SMYF 3OL3A 1LEAA 4ESFA 1DQUA 2FOWA 3ECOA 5EZHA 4E7KA 2CJJA 2Z33A 2UXXA 4PJMA 3I64A 3CZ6A 3ULQB 5D8LB 1H9TA 2D1VA 3QYFA 2EILH 4I02A 1F1ZA 5AIQA 5A2QK 3G6EI 1WJCA 2WTEA 2HGCA 3ZQQA 1W0UA 1YOVB 2NOJB 3IH4A 2Y69H 1L0OC 5H20A 3H5NA 1ZH5A 2KIUA 2K4JA 2PQ8A 4I2OA 3ZQFA 1V5EA 5EGOB 2L0KA 1Q1HA 2LBFB 1OKRA 3L00A 3G1OA 1L3LA 3WGGA 5TJJA 5E18F 5GAHJ 3IHUA 3HHGA 5EDNA 4RGUA 4DYQA 1Z3YA 1A04A 2VBXA 4Y15A 3UNGC 1WCMJ 2XB0X 5CPRB 3Q3SA 1OCPA 1RIOH 3ABTA 3ZMDA 1HC8A 1ONVA 4XICA 2E2HJ 4LLNA 4AWXB 4QWQA 2QF7A 3CCSI 2XAJA 3I71A 3WHBA 5B5EC 1GVDA 5FJ8J 2KP6A 2Y0MA 2Y0SA 3L2WA 3F8FA 1R7JA 2HDDA 2V1XA 2HVQA 2XGCA 3ZN1A 1YS6A 4P96A 1ZGWA 1HW2A 2ACJA 1B9NA 1MMDA 4CXFA 4ZDOA 1IZ1A 3FXLA 4M9ZA 1NG6A 2CV2A 1B9MA 5BOXA 4HEA2 3OL4A 1BR4A 2RQQA 2VJIA 2JVHA 3M7GA 4BS9A 1IN8A 2ZMEB 4FT8A 4A6EA 3SHFA 1KZHA 2X1DA 3K69A 4IXAA 1YIJI 4KMFA 3ZOBA 4LMYA 1PP7U 4O6JA 2ZJRF 5D6EA 1KYWA 2HEOA 4B48A 3H5AA 2L01A 1IW7F 1Z05A 4EVIA 3GFMA 3LQQA 5H6QA 2WAQA 4ITVA 2AXLA 5J40A 2OU2A 1VQLI 2ECBA 2KDOA 4CH7A 2HS5A 4HV5A 3WU0A 4DBQA 3JW4A 3L2UA 2CS3A 2F5FA 2PN6A 4MNUA 5CJ9A 2O5RA 1IGNA 1A36A 5IP7J 4D0PA 2CGPA 1OCOH 3I55I 2DMTA 3E97A 4DBRA 3IWZA 1I5ZA 3C1DA 1WH7A 3OYFA 2LF8A 2IS4A 4YFXF 3EDPA 3FIWA 4FTHA 1YRNB 1USSA 3QP5A 3SFIA 4XKCA 2DOFA 1FMWA 2CH0A 1C0WA 4FETA 4OOIA 3MZHA 4B44A 5JI6A 3DV8A 4PFPA 2OTLI 1ITYA 1MNDA 1UCRA 2PMUA 1BN5A 4LG3A 1MNMC 1USTA 4CGZA 3KP4A 5FLVA 2MH9A 3C3WA 5B3SH 2LK2A 4GYGA 2BBYA 1TTYA 5LBQA 3W6VA 4UUSB 3DKYA 2Q0OA 1W36D 3CUQA 5K7HA 4BQAA 1QVUA 3K1NA 4OIOF 5HS7A 2GOMA 2NS8A 4EJVA 3BY6A 2L4AA 5E3MA 3Q0WA 2W57A 4LD5A 1JTXA 4GXOA 1IF1A 3HC7A 5EF6A 2M2EA 3IC7A 2IGKA 3PO2J 4KYWA 2WV0A 5IYCJ 4HYEA 3WTXC 2ELKA 2ESNA 2Q8KA 4FX4A 2GA1A 3GFLA 3DPLC 2M4KA 3GVAA 3H3VK 3FMQA 4PJLA 4HBLA 3MVPA 4RBOA 4ZC3A 4LG0A 2F2EA 4CYCA 4AD9A 3E6CC 1LVKA 1R00A 3KPHA 1K79A 1OLTA 2E1MC 2VBWA 2NRAC 1A31A 4O3MA 5HVQC 3BJ6A 1E2XA 2AO9A 2QM3A 2ZBKA 3SZTA 2BEOA 2DK8A 1D3YA 4KT6A 5DV5A 1Z7LA 4UHTA 2OV7A 1EJ9A 1HDDC 1XDUA 1YW7A 4JX4A 4AU7A 2VXZA 2LH9A 3BG6A 1LFPA 4BXFA 2KDZA 2VPRA 1REPC 2A05A 1OJLA 2BHYA 1IAWA 1F4KA 1QQIA 1R49A 1WJBA 1R58A 3BR0A 4C30A 4D5FA 3I59A 4J01A 5EZGA 3RKWA 2QZ8A 1U5TA 1RNLA 2LTPA 3PO3J 1MBGA 2QGUA 3SZPA 2EA4A 4IKFA 4XBFA 3V7RA 2QUFA 5D4SA 3J80Z 3OWTA 3P9CA 2X1CA 2VN2A 3NARA 3MZYA 2ISZA 3HB9A 5CLSA 4BYYA 2JT1A 5HDGA 2RQPA 4ZTFA 3H36A 1SFEA 4UUTA 4P9UA 2H8RA 4D5CA 2XV4S 4P9FA 3LA3A 3GF2A 2ZFUA 1BIBA 3LSHA 3UR3C 4CSWA 2BW3B 1PP8F 2I10A 5CQEA 3M1CA 1U9OA 2QBYB 1T6SA 2H27A 2LMDA 1O7LA 2R3SA 1T39A 5H2FC 4QTRA 2BY0A 3BLYA 5IT9Z 5TRDA 2OUMA 3VEPA 3D1NI 1V5FA 3F9KA 3G73A 2MA3A 2XB5A 2FX0A 2MW8A 4A3DJ 3CQZJ 1X3WB 2STWA 1TC3C 5LEKA 1MMAA 5FKNA 4E7ZA 1GUUA 1X4PA 2K7LA 4XOPA 1Z21A 3H9QA 4IOAF 1NHAA 3VSKA 4UY8I 2CQNA 2XF5A 1HW1A 2P0WA 4I7HA 3JCUC 1PUFA 4DYRA 2E2IJ 4W1UA 1B59A 2PMZA 3H0DA 2K3FA 3IV5A 3LAJA 4J19A 1H0MA 3WTTC 2YUSA 4TV7A 3V7SA 3LOCA 2K9QA 3SFZA 4A69C 1D1CA 3H9JA 1YE9A 1VQ7I 1LE8A 4XLEA 2DU9A 3EUKL 5DCMA 5BPIA 2XSDC 3R4KA 4PCQA 1X2NA 2KIMA 2EIMH 3R6SA 4PJ0C 3S3OA 3PUBA 4Y7NJ 4YIIA 3JSPA 1TLHB 4CCLA 2L7FP 5DM6F 1VQKI 2QSFX 5HODA 4IRIA 2ZNYA 3C2GA 2XRLA 1FBQA 4RDUA 2KLOA 2K9LA 2M45A 5ILSA 4XKBA 1AKHB 2E1MB 3QYBA 1V5GA 2WBMA 5L3DA 4L9VA 1WJEA 1CF7A 2F5EA 1J9IA 4L9NA 3FM5A 2P8TA 3VODA 4X1EA 3TBIA 4XLNF 1OCRH 4FCYA 2VQGA 4I09A 2H6CA 2E19A 3V42A 4RB1A 4WWCA 3NQOA 2CQXA 3OR2C 2L7KA 1BC7C 4IQJA 1BBYA 3IKTA 3QP6A 1SD5A 2EZHA 5D4RA 3GZ6A 1OFCX 4M72A 2DO7A 4RM2A 2DOEA 2J5OA 5E3OA 4WX9A 2VI6A 3M8FA 3S16J 3SEZA 1H89C 2XAUA 4FISA 1MH4A 2R7FA 3L7WA 3PNVA 3KETA 3F22A 4ZYEA 1P4XA 2NYXA 2B63J 3LNQA 1FP1D 5C4XJ 2HWVA 2LFBA 2M1BA 2RAEA 1IN7A 1EH8A 2Q2EA 1HBXG 3A2KA 3GW2A 4IHVA 4HOBA 1E17A 4HSTA 2MG4A 1K4SA 2DTRA 3S1MJ 3HKZN 2MGQA 3D5SC 2CUEA 1IDYA 2OZ6A 3RQIA 3LSIA 4ZZDA 4RAZA 1MZBA 2VUMJ 3HUGA 2O0YA 1B72B 2A07F 2FEZA 4G12A 3FXOA 4HX7A 1PVEA 2CW7A 3LSPA 5FD6A 4U0WA 4MHGA 1R6RA 1RESA 1SANA 3FKJA 3HRSA 3RI4A 1VNDA 2YPRA 4F52A 3K4BA 4AVZA 1BI1A 2HVRA 1BM9A 2ICWG 2P7VB 3ZPLA 2XPVA 1TW2A 1E3HA 1YW8A 2ZFWA 3HYIA 4HNUA 1X58A 3WG9A 1Z0XA 3OR1C 4IL6C 1D5VA 3BOQA 5FROA 1JUSA 4M3BA 5FFXA 3VSLA 1WRJA 4IVNA 1XGNA 2QQ8A 4IHWA 3GCMA 2ZJQF 4A93J 2WC2A 1RPWA 2LP0A 3RZDJ 4CZZA 5B1AH 1D5YA 3OS0A 3BTCA 4CICA 4CYDA 1F43A 4ABZA 1PYVA 5BMZA 2COMA 3GZ5A 4PSXA 3IL2A 3QWLA 4RAGA 3V4GA 4EM0B 3ELKA 1LQ1A 4PZJA 1R4NB 1HLVA 2IA1A 1QO0D 1WFXA 4IF4A 5D5WB 1JT6A 2CSOA 5M5YJ 1DUXC 3GO5A 5L3CA 2VOOA 5F0HA 1U3EM 1SEUA 1ZK8A 2L7MP 1OCTC 1SFKA 3RSNA 3AG3H 4HDVA 1ETYA 1YS7A 1K78A 1UG0A 1HDPA 5A2QZ 1R5ID 4AM3A 4BQQA 1FJLA 2KRHA 1FP2A 2QSGX 3DKXA 4Q4ZF 3O8GA 2K85A 2RKHA 3TDUC 3WTYC 3A4CA 2ZXIA 1UHSA 2Z2SB 3H3ZA 3GUDA 3HOWJ 2A6EF 2FE3A 2QKLB 3U2RA 4XRMA 2CFOA 4NHJA 2IS1A 2LREA 3ISPA 3VYUB 5J1YA 1WZ2A 4OIQF 2K9SA 1Q1VA 4BEHB 1MW7A 4OAZA 5TGTA 2XKOA 2V7FA 2DA3A 1FSHA 4AUXA 1BOBA 3F3XA 4A6DA 3FXQA 4YELA 4M9SA 3VYSB 2XRNA 4GFBA 3CCRI 4L0YB 3A02A 2FNAA 1J0RA 2ELHA 1XB4A 3M07A 2FBIA 3IRRA 2RVCA 1VQ4I 1J75A 2HYFA 2C6YA 2W25A 2KMUA 1MKMA 3HKZA 3L2CA 1STZA 3BR1A 1I27A 4LFUA 1KONA 3TEDA 3BZ6A 2AXTC 2IXSA 2GIZA 2IAIA 4HA8A 2R7XA 4KICA 1KQ9A 2HZDA 2RNGA 2OQRA 1XMXA 2HU9A 2VJJA 4OIRF 4KIFA 5KHDA 2H09A 2J5PA 2ZCWA 4DZPA 1KYZA 3ZRGA 1MDMA 2BY1A 4Y4RA 3BG7A 4GGGA 2QVOA 3HG9A 1ZRDA 3M4OJ 2M5WA 3K10A 3OYHA 2JWTA 2Y48A 3G1MA 3L2VA 5FLXK 5CYVA 2EFQA 4OINF 1IC8A 1DGWY 3GTQJ 1X3UA 3RPUA 1OPCA 1S6LA 4ON0A 5H6RA 4HW0A 5FO5A 1ERDA 1Z6RA 4I98B 4KMUX 2MC3A 4A0ZA 4S0HB 3JRBA 3ERED 2CW8A 3KP2A 4U7DA 5KVRA 4Q5SF 1KU3A 2OJED 3LSMA 2DMQA 4M73A 4ENJA 2PJRB 2XHKA 2LVSA 4UVAA 4XMYA 3MD2A 5K7ZA 3J81K 3KLNA 1X1PA 4HF0A 1IDZA 1G3SA 3IAM2 2FXAA 1S8NA 3QRFF 2W24A 2P7CB 1RZ4A 1UHMA 2FRHA 3DXJF 3HTUA 3ZGKA 3Q5FA 2KISA 2STTA 4EV0A 1MMSA 5EGOA 1FC3A 3U1DA 3EYIA 2E60A 2LBFA 3VFZA 3ZQGA 4BE0A 3JAMZ 3QU6A 3S14J 1JKPC 4MEYF 4RGSA 4U87A 4ESBA 3OS1A 2OQGA 1JKRC 1ZREA 3A01B 4BY1J 2PFBA 1OISA 4OAYA 4CCKA 4JX5A 1I1SA 4CCNA 2PG4A 3SYTA 1SMTA 3RKYA 4L9TA 2ADUA 3CCJI 1R23A 3T8RA 3CLQA 1U9NA 3GTMJ 1T38A 4P1WA 4WXCA 1AOYA 1MIJA 3DPUA 2OF7A 1FTZA 3RPUD 1W1WE 2ID6A 1XS9A 3U9GA 1ETWA 1G6NA 1HXDA 1I3AA 1Y56A 2PEXA 4HV6A 5J4VA 2DCEA 1BI0A 4HG2A 4N0BA 3S3MA 4DOZA 3CCYA 2NVXJ 3JTHA 2CRGA 4A3EJ 3TKYA 4R1HA 1WGXA 4Z2YA 3CC2I 2X85A 3ZCOA 4MTDA 2CV0A 1ACIA 1I50J 1EA3A 1Z1DA 2JTVA 4LITA 4RLQA 4BQOA 2ZMEA 1UELB 4CCMA 3LSGA 5E3NA 1ETXA 4EJWA 1FOXA 4HX4A 5FFZA 4XRFA 3RPQA 1HQCA 3M8EA 1YYVA 1P7IA 4A3KJ 2NXNB 2Z1DA 3LSTA 2R4GA 2M8EA 1GT0C 2IPQX 1W7PD 5FKLA 3MWMA 1LKXA 3PNYA 1W4MA 1J2XA 4K2EA 2R7ZJ 2XASA 3ERMA 3ASNH 4IQ4A 4XRSA 2RC4A 4U88A 3VB2A 2DAOA 1HF0A 4A3GJ 4B8XA 1P9QC 1HOMA 2A5YB 2CWEA 1OCCH 1SD6A 1YJWI 2EV6A 5IPAA 3MKWB 1W7PB 2MFZA 3TOBA 2TCTA 3OSGA 2HTSA 1ZRCA 1T95A 1OMIA 1U8RA 3KP7A 4BDZA 1YRNA 3KZYA 1N25A 2H1LA 4G6QA 2NNYA 1ZYRF 4IX7A 5EG0B 4UUVA 2WAFA 2L2OA 1QPIA 4F7ZA 2HKOA 3GEZA 4X6AJ 2YX7A 1FTTA 1O4XA 1AA7A 2JK3A 4KT5C 2K40A 1ZELA 2HOEA 4M6YA 2OA4A 3C7JA 4F92B 2IS6A 2K27A 3BC8A 3PNTA 2JMWA 3OOPA 4XONA 4YRVA 4JOMA 2R7SA 2DA1A 3HOVJ 1SVMA 3H9GA 4P5OA 4M3FA 1YO5C 1X4OA 2XAHA 2KFDA 3K7AJ 1MGTA 4L5IA 4AIDA 5ICEA 4C9YA 4UUSA 2F4MB 4Y13A 3LFUA 2E34A 2ZSIB 3E3VA 5K5OA 2GZWA 2M4GA 5DUIA 2LY1A 3H0GJ 1ZG3A 2HQAA 4E7JA 1FMVA 1IO2A 2DDBA 3PFYA 2FSWA 4KITB 1N78A 2RGVA 4G7OF 3KEYA 1YI2I 5B1BH 3MMYB 4NDLA 4U7BA 2HQ5A 1VQMI 4M6XA 2XKPA 5IYDJ 3BR6A 3HPGA 2VJ5A 4KA4A 1BW5A 3K1PA 2ETHA 3K70D 4WF2A 2E7XA 1CQTA 2ELJA 2X0LA 2V1DA 1WJDA 4RB0A 2BHZA 3JRIA 2VODA 3M8JA 4U0VA 3DPTA 3OYCA 1EH7A 1T98A 2VKEA 4X0GA 2XAGA 3X2QH 3J7AY 2EINH 3I9V2 5E1WA 1LVAA 4HPQA 1EH6A 3OS2A 5J1UA 1DDNA 3O6BB 4I76A 4UVCA 1Z7UA 3BWGA 4BHPA 4MFDA 1TNTA 4E70A 4MQ9F 3VPRA 1EKEA 2E1CA 1S3JA 2JSCA 4HF2A 1X1BA 1VQ8I 1YX3A 1JI8A 2WV1A 2PJPA 2RN7A 2RNJA 9ANTA 4BE2A 2EV5A 4EATA 4UV8A 3ZP5A 3HOZJ 2IGNA 1SAXA 1S9HA 2W00A 1NK3P 1NTCA 1TBXA 5LRRA 5J6XA 3CCMI 3LMMA 5GPCA 1I6HJ 1ZKGA 4HNTA 1O7FA 4C3JJ 1P6RA 5CKTA 2MH2A 2GXBA 5DCFA 3GZNB 1ORKA 3BTJA 1ZR2A 2KHMA 3OYLA 2K02A 3CDLA 2MYSA 2K3PA 3M1EA 3OIPA 2V9PA 2L7ZA 3BR5A 3BG5A 1SVOA 1YIOA 2DMPA 3OIQA 3JRFA 4BE1A 3D0SA 1GXQA 4M3EA 3COAC 4L0ZB 3MKYB 1S7AA 2CQKA 1OQYA 2G9WA 1FIPA 2BW3A 3BT9A 3MEXA 2BY3A 1LDKB 1YX5A 2KZVA 3CDIA 2QBYA 3BQYA 3FK6A 5F04A 4WCGA 1X2MA 2HOAA 2EFWA 4Z6YA 2JZYA 2PMZN 2IA2A 2DMNA 3VOEA 3PM1A 1Z6TA 1R1TA 2DLLA 4RLFA 4G94A 5J1RA 3HOUJ 5LHHA 5J4YA 1FBSA 1HSJA 2R92J 2A5WA 3R0AA 3HIFA 5ED4A 1VF9A 2UXNA 1WKMA 4MEXF 1T33A 1X19A 5F64A 1IN4A 1LUJB 2DFEA 2PMHA 3A0BC 1T0FC 2EWNA 2PX9A 4ETSA 1TWAJ 1MMGA 2E35A 3WODF 3W2AA 2AQFA 4L5EA 1JJ8C 4KNYA 2X9DA 1GXPA 2E7WA 4HNVA 2IVMA 4A0XA 1TT5B 1WWXA 2FBKA 3QODA 4M6VA 3KEOA 3M3YJ 3MKZA 3KZZA 2HVSA 2KQRA 3AG4H 3OYGA 3CO7C 2B9SA 4Y3OA 2LF7A 3CDHA 2IJLA 1UMQA 4XSZF 4DNCA 1O3RA 2GWRA 2FUG2 5D8KB 3FXMA 5FKMA 4P55A 3SEQA 4S05A 4EGYA 3OIOA 4JYKA 3LSJA 1IUYA 5E1XA 5M5WJ 1ZARA 1AKHA 5FKKA 1O3SA 3S3NA 5ILUA 2NS0A 1WI3A 1S7OA 2ZXJA 1R4MB 2LKPA 3EUHC 4V2FA 5M5XJ 1Z91A 5HLTA 3JRCA 1DPUA 3FF5A 2HYGD 4RB2C 2R7UA 1ZLJA 1SVLA 3IAS2 3BCBA 4I0BA 5CQGA 1HKQA 4EQQA 2Y30A 3KE2A 3K9TA 1MSFC 3LAPA 4J00A 4BACA 4YEJA 3HGGA 3TL4X 2HPIA 2VONA 1HCRA 1NK2P 2W4SA 3TDZC 2DT6A 3AL0C 1WPKA 4G7ZF 1H88C 2LG4A 1G3WA 1YJNI 3ESWB 3DTIA 3UKGA 3EYYA 5L3FA 2FJ1A 2V6CA 3S93A 4MFEA 5JR3A 4U0YA 1E3PA 2K86A 4E7IA 3CJTB 4PSWA 2P5VA 3TOAA 3F8CA 4JP0A 2KIQA 3LL7A 5GP9A 1FOYA 5FLMJ 2DYSH 3C2HA 2JA7J 5GAEJ 3GTLJ 2QCOA 3E7LA 2CFXA 2H8WA 3BPXA 3D5LA 3HSFA 3ASOH 4O5VA 4E4HA 4HF1A 3KCCA 3CJRB 2WY7Q 3JRGA 3KLOA 1V55H 3HBLA 1PDNC 5LGTA 3F23A 4I99C 4BDYA 2ZSHB 3HTSB 1B72A 3FWEA 1BI3A 2VOPA 4XLHA 4II3A 4NNJA 1UHWA 2FA5A 4CDGA 3WGIA 4XLCA 2VIXA 1LFUP 4DJAA 3NRVA 4AC0A 2DA2A 5M3MJ 1JXSA 4IO9F 2ZKZA 2CMPA 1P4AA 2KJCA 3TO7A 5J3LA 1R22A 4KFCA 1TWGJ 1CGPA 2DPUA 4IHTA 1R1UA 2KRCA 5HLIA 2XGXA 3I58A 5DTDA 2O6GE 1IUFA 5FGMA 1ZGJA 2UZKA 3SJMA 4R8HA 4HLXA 1WHUA 1RUNA 3D5RC 2HDWA 5FLXZ 1MH3A 1R5GA 2VT2A 5J47A 4ENKA 2X48A 4OIPF 2F4IA 1GV2A 2ZXHA 3GTJJ 4A3CJ 1J7KA 2DQRA 3PQJA 4PJNA 4Y17A 4FHTA 1IG7A 5E8GA 2M87A 2LYCA 5LFAA 3PUFA 4G8XA 1YFHA 2VKVA 3BPVA 5HLHA 2F48A 5F27A 2HI3A 4XOTA 3ZMVA 3KIOA 2Q1ZB 3ABLH 2R7RA 2VASA 1E3OC 5D5VB 1UZCA 2ZXWH 4B43A 3F6OA 3I54A 1FEXA 5LRSA 4A3FJ 4IZZA 2UWMA 4NB5A 1T08B 4RA2A 1FYMA 5IY5H 4XLFA 1YQAA 5GADJ 5AONA 5ILVA 3REOA 2TDXA 1FYLA 2R5YB 1FOKA 3J7AO 3W2WA 1UFMA 2K4BA 3DKWA 4BEHA 2E71A 2KL4A 4NQWB 2R7QA 2Y31A 1BJZA 2BXYA 2K9NA 1Y39A 3QU3A 4M3DA 3EPZA 5E1ZB 3HDDA 1IRXA 3V8JA 3HZJA 1BOAA 3DLLF 4OWRB 3FXUA 5CVIA 3AKZA 4E6KG 1ON1A 3DFGA 5JHFA 3H3UA 3HGYA 3OYMA 3T8TA 3IRQA 2X1EA 2P6SA 5LLQA 2V26A 1MD0A 4BQNA 4D7NA 4BL0B 1UG2A 3OSFA 5IP9J 3P9IA 2E5NA 4WXHA 3RJPA 2XROA 2TRTA 5C44J 4LIVA 4IJAA 1U0JA 4B4CA 1DU6A 3NWTA 1RI7A 3BTLA 3ABKH 4H0EA 5L3GA 5KCMA 4KJZA 1XX5A 1XSVA 3S15J 3HSEA 1VI0A 3HSRA 3CMEI 3DLAA 4QSHA 4BY7J 5GAGJ 2DOAA 2A6TA 1G59A 1KQ8A 5GPAA 2V9VA 3S1NJ 4XN3A 3F8NA 3ZQLA 4KDPA 2VKHA 4E7LA 1VQPI 3T0YA 1KGSA 3ZR8X 2PJRA 1A5JA 3F6VA 5K5QA 4BNCA 3FK7A 2LD5A 4F55A 1VQ5I 3S8PA 4HQEA 2VLAA 4S04A 3E5UA 1FSEA 2LNBA 5ICFA 1XPXA 5IT9K 4HRIA 1WJ5A 4GO1A 2WWYA 2P81A 2VL8A 5E20A 3CF5F 2HYJA 2FMLA 1IRFA 2YSRA 3BDDA 4BJ5C 2FNPA 1JUMA 5DD4A 5LGUA 1HKTA 1KU9A 3N4MA 1LDDA 4N4OB 3A01A 3TO6A 2ZJ2A 2O8XA 3CMAI 2BVLA 3DEWA 3LQRA 4ZJZA 3CP8A 3BJOA 2JRTA 3H92A 5E8IA 3OYEA 2L9VA 2EZIA 4YIRX 3K0LA 3CJNA 3I3LA 2JPCA 4EM1A 2XUBA 5L3EA 4MQVA 3ZXSA 3VYTB 4XR6A 2DFHA 1Z9CA 2JVGA 2QKMB 1QGPA 1UB9A 3DU5A 3HHHA 1U8BA 4IHXA 2I8DA 3GYHX 2HXOA 1RKTA 3RTRA 3ZQCA 2BV6A 4DZJA 2V6EA 2PI0A 3K4MA 2IBDA 2DXIA 4DYCA 2KZGA 3HOXJ 1Y0NA 4GDFA 2MABA 3A03A 5K1YA 3F21A 5FKOA 2DMUA 2D1HA 3ZQ7A 5F6FA 4QPQA 2Y9ZA 4RGRA 1VQNI 2L4MA 1XTAA 1V54H 1WQ2A 3WGHA 4A0YA 1PUEE 2HOSA 3RDIA 1LEBA 2M7AA 3MKLA 1G2HA 1BJAA 1QHGA 1QZEA 3EETA 4LB6B 1UAAA 2YR2A 1IN5A 5KNLA 4L5JA 5EYRA 3BP8A 2EFOA 4G9YA 5F08A 4GYIA 4UB6C 4BUPA 1HA8A 3CMYA 2FD5A 3L1PA 4ZDPA 2HPMA 1XCBA 2JUCA 5HDNA 1VQ9I 3W2VA 5HLGA 3WHCA 1ZG5A 2DQLA 2MC4A 4HAMA 4BHCA 2XDVA 3FHZA 2DTZA 2EFNA 4EMSA 3L2RA 2W85A 4AYBA 2R5ZB 5EEAA 1S5LC 1W7PA 2O3FA 1IN6A 3H5RA 5BS6A 2JA2A 1MMNA 2NOGA 4JQFA 3VDXA 3S17J 1B1BA 4Q47A 3SDBA 1BR2A 4QIWN 5FB2A 3QOPA 3MFKA 2DODA 4I6ZA 1OR7A 1TZLA 3OYKA 2XF6A 3HJEA 5DDGA 2YU9J 2VKDA 5EG0A 1SD4A 2ZNZA 2ZJPF 2MD5A 2XPUA 1QRYA 2DJNA 4KN7X 4NC6A 4DQ2A 4ZDLA 4D9JA 4E7HA 2BYVE 2M9HA 2P4WA 2K5CA 4BJTA 1YTYA 4ZZLA 3KYDB 1S72I 1X1DA 2QENA 3DTEA 1S29A 3TP0A 4BBRJ 2NAZA 2GXAA 1SD7A 1JJ6C 1XGSA 2ME6A 1TWCJ 3DBHB 2A69F 4FE7A 3V8LA 2HNHA 2CW0F 2DBBA 2XGEA 2BGCA 2JPBA 2H94A 2MLGA 1UJ8A 2FU4A 3ML6A 3RCOA 4BH9A 4QLCU 1QZYA 1XGOA 4HZFA 3PIPF 1K7AA 2XGDA 1FT9A 3MAJA 2KRFA 2EV0A 2OAZA 3L2QA 2N8GA 4LK0F 1Y1WJ 2AS5F 1VTNC 2GXGA 4PGGA 3QQAA 2P5LC 2VB6A 3DEEA 3WTZA 2KIFA 3Q0UA 1IXCA 4M74A 1DU0A 1HKSA 3RYRA 2HQNA 1MJBA 2QQAA 3P9KA 4CCOA 4XLPF 3J7ZI 2IA0A 1I6XA 4MGRA 4JX6A 2M0CA 2CYYA 4XKVA 2VC0A 3MZ8A 5JVTA 1ETKA 2NVYJ 4JBAA 2HTJA 1RKWA 4I0AA 2V1UA 1SC7A 3WG7H 1M1EB 3HPHA 1EV7A 1WJAA 1TQMA 3FM3A 1F36A 4CO8A 6PAXA 3CC7I 3LA7A 4FX0A 2Y9YA 3E6MA 2CQ7A 4M9XA 1D8JA 2F4OB 1TW3A 2NNNA 2Z5UA 4G7HF 3KP5A 1Y8QB 2HR3A 3E5QA 2E5ZA 1D0ZA 4PK4A 1AWCA 5D5XB 1B8IB 4I01A 3BR3A 4YFNF 2OCEA 2JRMA 5EJCA 1YG2A 4PJJA 3O2PE 4A5NA 1W36C 2CUZA 1XSXA 3FZVA 2X4HA 1ZGAA 1D1BA 4EM2A 3ZN0A 5JVGF 4GRIA 4NUBA 4BBSJ 1T8IA 4AIHA 1R1VA 1OCZH 3BG9A 3TP3A 2FBHA 5J8FA 1MSEC 3JRAA 3PSFA 5JFRA 3V8KA 3GX4X 2XPWA 4UV9A 2MD0A 4A5MA 1JUPA 1GVJA 4B3XA 4AVPA 3JTGA 1MBKA 3SDGA 1IV6A 1O3TA 1FY7A 2Z16A 3LSRA 2I5UA 2L54A 2CUFA 4B47A 3S2DJ 3BZCA 4CZCA 3WU2C 4RAFA 4WXDA 2ZC2A 2DT5A 4LK1F 2A61A 1MBJA 3GXOA 1HW5A 4B09A 4DW6A 2VBZA 2LSOA 2L02A 2X6YA 4NBQA 4UB8C 1RUOA 1DPRA 3H35A 1O57A 3Q9SA 2EZLA 3S32A 4HX8A 3FX3A 2LRDA 3NAUA 1ZR4A 1YITI 4UXNA 2GLOA 3CD6I 1BA5A 2DA6A 3I4MJ 1I39A 1ZRFA 1JGGA 5JLXA 5HOOA 1QNTA 2NVTJ 1VQ6I 2HXIA 3JRDA 1JKQC 1JE8A 2VQLA 3CUQC 3R60A 3S2WA 1JHHA 5E3LA 5F1JA 4MIMA 5LGNA 3KP6A 2G7UA 3PJRA 5ERIA 2OTJI 1BIAA 2YS9A 4IEJA 2XAFA 3LA2A 4BHBA 1R5HA 1XDSA 1ZG1A 2O61A 1JT0A 4UNOA 3TQNA 1YLFA 3QPHA 3FISA 1ZLKA 3JAMK 4KISA 2P6TA 3I0TA 4IOCF 3DF8A 3T1BA 1U78A 3B6AA 3ABMH 2COBA 5J8CA 1TT0A 3BTIA 2X6OA 2EH3A 1N77A 5E79C 2JA5J 4FQGA 2EA2A 2UUZA 3OYBA 3PFIA 1FIAA 1ETVA 5HS9A 5K7FA 1VQOI 1WH5A 2A68F 3DWLE 3IUOA 4D7MA 3RYPA 2QYOA 4A3BJ 5DM7F 3FBIB 2L9NA 3TGNA 1B4AA 5E17F 2DJIA 2HQRA 4N4NB 2XF7A 5C3EJ 2BY2A 1BI2A 3TW7A 3HM5A 3HRMA 2NVQJ 1Z77A 2ISYA 3I56I 2Y2ZA 3CP2A 1ETOA 1WVRA 3ZMTA 1SFUA 2KT0A 5DEQA 4BAYA 1MBEA 1U5TC 3H1CA 3GWZA 5FD5A 2R7OA 1GHCA 5AIPA 2XAQA 3JSOA 3ZQHA 2M8GX 3B6CA 3OYDA 2V4JC 3RZOJ 2JQ7A 1DP7P 2WB1N 1V4RA 2OCCH 1O3QA 4A3MJ 2EJRA 2M7BA 1XCVA 4C2TA 3U1KA 3TO9A 3GFIA 2B7EA 4DGWB 3GMEA 2O7OA 3F72A 3RQ4A 3F8MA 2AQEA 4N9HA 3HXLA 2HDCA 2A3SA 3IH3A 2L9SA 3C18A 5IT3A 3OMYA 2KPMA 3KEQA 3KYCB 4MLOA 3JR9A 3AG2H 3I53A 2GIVA 4BXUA 1R36A 2L9RA 1PJRA 1LJ9A 4AIJA 2PBIA 3HRTA 3OOUA 3S1QJ 5L3BA 2BXZA 2LKSA 1ZQ3P 5EEHA 5KK1A 3G3ZA 1MJAA 3GLXA 3MCZA 1KA8A 2NVUB 2OD5A 4BGDA 1W0TA 3SXYA 5IOYA 2XC7A 2EBIA 3NWSA 2RDPA 3SQNA 2Z99A 1U2WA 4CCJA 1FLIA 2JN6A 5CVRA 1RRJA 2YX4A 1YHQI 4N9IA 4F3QA 4OMYA 3ZMUA 1H8AC 4AIKA 4ANJA 1VZ0A 3QAHA 3CESA 3CCVI 1OYIA 1T0FA 1H9GA 1X1AA 3RKXA 3VYRB 3CUQB 3ROUA 4G6DA 3L09A 1RR7A 3FMSA 4IRGA 1LDJA 2JSPA 4D1QA 4XNFA 3JREA 1Y8RB 1IXSB 5JLWA 1N75A 3GLLA 2BOLA 3NEUA 2IT0A 1K61A 1W5SA 3CC4I 4A3LJ 2KKOA 3K4LA 3LWFA 2CO5A 5D5UB 5FRMA 4WK8F 1R9TJ 1K83J 1TQPA 1FOWA 2YU3A 4CHUA 2DFFA 4GCVA 2VE8A 2EIKH 5CVUA 4BU2A 3KZIC 2GOXB 1RC9A 1BW6A 1IRGA 4ZYDA 5BQTA 4LG0B 3ECHA 4CYCB 4LLGF 1XSDA 1B6AA 4NC7A 1XD7A 2DFIA 4MO7A 3JRHA 1QVTA 2NS7A 3HOYJ 2OPTA 3EUHA 4IHSA 3RKQA 4B1RA 3DTKA 5JHUA 3CCQI 1DGRM 5HNHA 2R5YA 1A35A 4Q48A 4RMNA 5FRNA 3QOEA 3B73A 2PLYA 1SFOJ 1S7EA 4NQWA 2VBYA 3CCEI 1U6GA 3GBGA 4JK1X 3C2BA 1JTYA 1OYWA 2QQBA 1W5CC 1WSUA 2BE5F 2KJBA 3MQ0A 2F5DA 1LB2A 2CU7A 2G7HA 2R0QC 2WB1A 1ULYA 2E2JJ 1FBUA 2WADA 1R71A 5CVVA 3I59B 4F91B 4UVBA 3G71I 3WTSC 1P4WA 3G2BA 4KIBA 1QBJA 4RB3C 1U5TB 2GQQA 1K4TA 1AU7A 2P5KA 3ABUA 1Y0UA 3WE3A 3BJAA 3Q9VA 2X6XA 2DK5A 1D1AA 2HKXA 2LY2A 1IRZA 3WTUC 5B66C 5LEJA 2FQ4A 3E1SA 2DI3A 2EZKA 1XMKA 3K2ZA 1LFBA 3CLOA 1TNSA 5KAFC 2W84A 2DW4A 1TL8A 3ZMZA 4EEFG 1KU2A 2M0MA 4BKXA 3E0JB 1F5TA 2M30A 3ZMSA 3K2AA 4KN4X 2FOKA 4PDKA 2LLKA 4ESJA 2D45A 1D0XA 1RETA 2VC1A 4MTEA 3J81Z 3E6BA 1ENHA 3WTVC 3K1MA 1LNWA 5TISC 5C4JJ 3DBLB 5D6FA 3G4SI 4M71A 5LD2C 1K6YA 3LFKA 3S1RJ 1RR8C 4EGZA 3OV8A 2FMYA 2G0EA 4C3HJ 3BG3A 2F6CA 3BCAA 2LC2A 4QPOA 2QA4I 1YJ9I 2K9MA 5IOZA 3OYNA 3TW6A 3E6DA 4ZYHA 2DA7A 2HFHA 1QU3A 4ZYGA 1FWZA 4LGWA 3K4NA 2O9LA 4RS8A 3RIRA 3BR2A 5CVJA 4XQFA 3KFWX 2R7DA 3PQKA 3OY9A 1X3ZB 3ONQA 2XIGA 3GFJA 4ZTJA 1PUFB 3FMRA 4F93B 4HLYA 3G1LA 4Y33A 3R61A 1FPQA 4OMZA 3K4JA 2A6HF 4XM3A 2DT7B 5M3FJ 1KU7A 5F0FA 3AL0B 3TMOA 1POGA 1ODDA 2WAEA 3WTWC 3GTGJ 1T56A 2JA8J 1LE8B 1P2FA 1IV8A 2D5VA 3W6KB 2IGOA 1YW9A 4KIGA 5DCMB 2L5QA 2ECCA 2H6BA 2IGMA 2R7WA 1MBHA 3BZKA 3J7YJ 2MSYA 4IRHA 3OYIA 1I1GA 1G3TA 3Q0VA 5EEGA 3SZGA 1ZN2A 3V7CA 2VPLA 4OU0A 4II2A 2WY8Q 3OYAA 1ZAOA 2AHQA 3CO6C 3FKIJ 2W7NA 1XC5A 4RM3A 5IYBJ 4ZH4F 2ESHA 4CA0A 2V79A 3J80K 2EB7A 1QHHD 4G6TB 4PUSA 3I4PA 4B3AA 1OYYA 1GLNA 3EQLF 2E36A 3QPLA 2IRFG 3VWBA 3I5UA 1TWHJ 1CF7B 4C2UA 4AYBN 4XL9A 2X51A 2OBPA 2IEKA 3K4CA 3P7NA 3K4KA 1IJWC 4A3JJ 3CF2A 4H4KC 3DBRB 1TP4A 2RREA 2CUJA 2EFPA 1XG1A 1BL0A 1MNEA 3GTPJ 2MLKA 4BJ6C 2GBYA 3QPSA 5DD8A 5LHGA 2DA4A 2H1KA 2XVCA 2FF4A 2R7TA 3R0JA 4ZYAA 4A3IJ 3W6JB 3IWFA 1J59A 3S2HJ 2LDUA 3FBNB 2JJ7A 2DDAA 5ICCA 4EJTA 2EIJH 3P5JA 2JA6J 1G4DA 2R7VA 1NG7A 1X1CA 3CMMA 5F0CA 4C3IJ 2R5ZA 4L9JA 3CJQB 1F9NA 3CCLI 3DP7A 5F1RA 2Q2EB 4FASD 2ZO4A 2O03A 4YIFA 2Z3YA 1J09A 1D0YA 5DYMA 3QPTA 4R79A 2DPDA 4M3GA 1MBFA 3DCFA
chains in the Genus database with same CATH topology
1LDKB 1YX5A 2KZVA 4CCLA 2M3AA 4XKVA 3OYJA 3C2GA 2JUGA 3HUGB 2KLOA 2K9LA 4XKWA 1WJFA 4XKBA 2E1MB 3QYBA 1V5GA 3HPHA 2WBMA 1WJAA 1WJEA 4RLFA 3K6GA 1E0EA 2A5WA 3PSIA 3QYEA 3TBIA 2VQGA 4NC8A 4XORA 3V42A 4E7SA 2E5ZA 3FDYA 1D0ZA 3OR2C 4PK4A 1X19A 2L7KA 4IQJA 4RM2A 4PJJA 1W36C 4LIUA 3SEZA 2CUZA 2XAUA 1T0FC 1D1BA 2W82A 3PNVA 4XLAA 1MMGA 4GRIA 4NUBA 3W2AA 3KX2A 2AQFA 3DU6A 3EUAA 3QODA 1OR7C 3MKZA 2HVSA 2KQRA 3A2KA 3OYGA 2X6WA 3PSFA 2CV1A 4Y3OA 4HSTA 3D5SC 3N05A 2MD0A 2V9KA 2FUG2 4B3XA 3SEQA 2XSJC 2UV1A 3LSIA 1Z3XA 2VQHA 2Z16A 2V1NA 4B47A 3A1YA 4CZCA 3S3NA 2CW7A 3EUHC 3DQVC 5HLTA 1R6RA 2IS2A 3LSKA 3IP4B 3FKJA 2R7UA 2X6YA 4XN0A 4F52A 5HNFA 3K4BA 3H35A 3IAS2 3BCBA 4AVZA 2HVRA 5CQGA 1G8XA 1Y6IA 2WA0A 3S32A 2W1OA 4J00A 2LRDA 4HNUA 3HOSA 2VXDA 2LOOA 4YEJA 3W3CA 4BACA 4PFOA 3OR1C 3TL4X 2HPIA 5FROA 1DP3A 2F5VA 2VJ4A 3VSLA 5HOOA 2W4SA 2DT6A 3AL0C 2LG4A 1BR1A 3DTIA 2VQLA 3FHNA 3OS0A 3S93A 1PYVA 4E7IA 4PSWA 4PSXA 3PJRA 3LL7A 3C2HA 3HL2A 1WFXA 3D5LA 4E4HA 4KISA 2OC6A 2VQCA 3PL8A 3CJRB 2WY7Q 3U21A 1SFKA 3RSNA 1SAUA 3AFHA 3HOTA 3K70C 4BDYA 2ZSHB 1UG0A 1TT0A 1N77A 4BQQA 4HSRA 4XLHA 4DIQA 3KYLA 2KRHA 3DKXA 4II3A 4NNJA 2UUZA 3OYBA 3IUOA 4XLCA 3DWLE 4CUGA 2BVMA 2VIXA 3A4CA 2ZXIA 4DJAA 2Z2SB 3FBIB 2QKLB 2L9NA 3OL3A 2CFOA 2IS1A 2CMPA 2DJIA 2LREA 4N4NB 2XF7A 3VYUB 1DQUA 4E7KA 4BEHB 1MW7A 4OAZA 5TGTA 2KRCA 4PJMA 3CZ6A 2V7FA 1BOBA 3QYFA 4YELA 3CP2A 3VYSB 1WJCA 3ZQQA 2NOJB 3H5NA 3D5RC 2HDWA 2KMUA 1V5EA 2R7OA 3HKZA 2LBFB 3OYDA 1KONA 2F4IA 2IXSA 2V4JC 2ZXHA 2R7XA 2HZDA 2RNGA 2VJJA 2HU9A 2M7BA 4C2TA 5KHDA 1Z3YA 4DGWB 3UNGC 4PJNA 3ZRGA 5CPRB 2LYCA 3RQ4A 5LFAA 4Y4RA 3BG7A 3HG9A 2AQEA 3HXLA 3K10A 3OYHA 2L9SA 3L2VA 4XOTA 2R7RA 2Q1ZB 3OMYA 2VASA 2KPMA 1DGWY 2KP6A 4MLOA 1ERDA 2Y0SA 4B43A 3L2WA 1PJRA 2HVQA 4IZZA 2UWMA 2CW8A 3OOUA 4XLFA 3LSMA 2PJRB 3W2WA 1MMDA 4XMYA 4ZDOA 4BEHA 3MD2A 4BGDA 2KL4A 1NG6A 2CV2A 4NQWB 2XC7A 4HEA2 2R7QA 3OL4A 3NWSA 1BR4A 2RQQA 2VJIA 4CCJA 2JVHA 3EPZA 4BS9A 1IRXA 3IAM2 4OWRB 2X1DA 3AKZA 4E6KG 5JHFA 3ZGKA 4F3QA 4B48A 3H5AA 4ANJA 1VZ0A 2E60A 2LBFA 3CESA 3OYMA 4BE0A 2X1EA 1X1AA 2V26A 3VYRB 4BQNA 4BL0B 4U87A 3OS1A 4D1QA 2JSPA 4XNFA 2WAQA 1N75A 4ITVA 4OAYA 2BOLA 4CCKA 2E5NA 2KDOA 4CH7A 3K4LA 4CCNA 4LIVA 1U0JA 3SYTA 4DBQA 3NWTA 3L2UA 2CS3A 5FRMA 2O5RA 5KCMA 4KJZA 4P1WA 4BU2A 2GOXB 3DLAA 4DBRA 2DOAA 2A6TA 3DPUA 1G59A 3RPUD 4NC7A 3OYFA 2IS4A 1Y56A 4XN3A 2DCEA 2VKHA 4HG2A 4E7LA 3S3MA 4DOZA 4XKCA 3DTKA 1DGRM 3ZR8X 1FMWA 2CH0A 5HNHA 4FETA 2PJRA 5FRNA 3QOEA 4B44A 4PFPA 1MNDA 2X85A 3ZCOA 4F55A 2CV0A 3S8PA 2VLAA 1EA3A 3GBGA 4LITA 4LG3A 4RLQA 4BQOA 4HRIA 1UELB 1WJ5A 3LSGA 4CCMA 2VL8A 2WB1A 2WADA 3DKYA 4BJ5C 1W36D 2Z1DA 4F91B 2R4GA 2GOMA 3G2BA 4N4OB 1LKXA 3PNYA 2BVLA 4IQ4A 4ZJZA 2X6XA 3CP8A 3HC7A 1D1AA 2LY2A 3OYEA 2IGKA 3E1SA 1P9QC 3I3LA 3DPLC 2M4KA 3MKWB 3ZXSA 4PJLA 2MFZA 3VYTB 4XR6A 2M0MA 3E0JB 2JVGA 2QKMB 4ZC3A 3DU5A 2I8DA 1T95A 3RTRA 1LVKA 4BDZA 1OLTA 2E1MC 1D0XA 2V6EA 4IX7A 2WAFA 2L2OA 3K4MA 2DXIA 5HVQC 2MABA 1AA7A 5LD2C 1ZELA 1K6YA 4KT6A 4F92B 1Z7LA 2OV7A 4QPQA 2IS6A 3BC8A 2F6CA 3BCAA 3PNTA 4AU7A 4XONA 2LC2A 4QPOA 4YRVA 4JOMA 2VXZA 2M7AA 2R7SA 2K9MA 2LH9A 1QHGA 3BG6A 3OYNA 1LFPA 3H9GA 4BXFA 4P5OA 1UAAA 1QU3A 1X4OA 5KNLA 3K4NA 1WJBA 4C9YA 4C30A 4XQFA 3LFUA 4J01A 3OY9A 1HA8A 4BUPA 2ZSIB 3ONQA 4ZTJA 4ZDPA 2HPMA 2M4GA 4F93B 4Y33A 2LY1A 3W2VA 2HQAA 4E7JA 1FMVA 3K4JA 4XM3A 4IKFA 3PFYA 2MC4A 4KITB 1N78A 2XDVA 2DT7B 3KEYA 3OWTA 2X1CA 3AL0B 3TMOA 2WAEA 3L2RA 4AYBA 3MMYB 4U7BA 3H5RA 2IGOA 4ZTFA 2JA2A 1MMNA 4JQFA 3VDXA 3HPGA 2VJ5A 2L5QA 2IGMA 2R7WA 3SDBA 3K70D 1BR2A 2ZFUA 2ELJA 3LSHA 3UR3C 1WJDA 4CSWA 2BW3B 3OYIA 5CQEA 1TZLA 3M1CA 2XF6A 3SZGA 3OYKA 2VPLA 2VKDA 2WY8Q 3M8JA 4II2A 3DPTA 3OYAA 3OYCA 4X0GA 2W7NA 3J7AY 3BLYA 4RM3A 3I9V2 3OS2A 4HPQA 4CA0A 2OUMA 4ZDLA 4D9JA 4E7HA 1V5FA 3F9KA 1QHHD 4G6TB 4PUSA 2K5CA 1GLNA 3VWBA 4C2UA 4BJTA 1MMAA 4E7ZA 1X1DA 4XL9A 2X51A 3K4CA 3DTEA 1X4PA 3K4KA 1X1BA 4XOPA 3CF2A 1Z21A 1YX3A 4H4KC 3H9QA 1JI8A 2RREA 2CUJA 4BE2A 4EATA 2IGNA 2HNHA 1S9HA 1MNEA 2W00A 3VSKA 4BJ6C 2XF5A 2P0WA 3LMMA 4HNTA 3RCOA 2R7TA 5CKTA 4ZYAA 2PMZA 3H0DA 3FBNB 2KHMA 3OYLA 2MYSA 2R7VA 1NG7A 3L2QA 1X1CA 1D1CA 3CMMA 3H9JA 2K3PA 1YE9A 3CJQB 3OIPA 2Q2EB 2VB6A 3DEEA 3OIQA 4FASD 4XLEA 3EUKL 1J09A 4BE1A 1D0YA 4CCOA 3MKYB 4R79A 2BW3A 4RMNA 3S3OA 3PUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VXD A; 
#chains in the Genus database with same CATH topology
 3GTK J;  1JGS A;  2L3D A;  4A12 A;  2M3A A;  2GAU A;  1AHD P;  3FXJ A;  4HQM A;  3OYJ A;  2JUG A;  1FZP B;  3HUG B;  4XKW A;  1QA6 A;  1WJF A;  1Y1V J;  1TWF J;  4RAY A;  4ASN A;  2B0L A;  3E5X A;  2VE9 A;  1A6I A;  3K6G A;  5IP6 A;  2ME0 A;  1ON2 A;  2HZT A;  1E0E A;  1EF4 A;  2CQQ A;  3KP3 A;  3WE2 A;  3GTO J;  3PSI A;  3CTA A;  3QYE A;  4LOC A;  4YG2 F;  3FXK A;  3HEF A;  4NC8 A;  3IKV A;  4XOR A;  1FX7 A;  1FNN A;  3MN2 A;  4E7S A;  3FDY A;  2QEX I;  2LKX A;  4XSX F;  2ZB9 A;  1JHF A;  4EJU A;  1G3Y A;  4A2U A;  2MBF A;  4LIU A;  4RGX A;  2QWW A;  5BPD A;  1XN7 A;  1QPM A;  2W82 A;  3M9A A;  5K5R A;  3PIO F;  4XLA A;  4ENN A;  4EJO A;  3T5X A;  3KX2 A;  2EQR A;  4YFK F;  5ICG A;  3BQZ A;  3DU6 A;  3EUA A;  2BZT A;  1OR7 C;  2IP2 A;  2D2W A;  2IW5 A;  3HRU A;  3WU1 B;  2X6W A;  2CV1 A;  4LJZ F;  5HDK A;  3IH2 A;  2O8K A;  1P92 A;  3F0C A;  1QZZ A;  1TQI A;  3N05 A;  2V9K A;  3I4N J;  4LLL A;  1SFX A;  2ID3 A;  2E1O A;  1XGM A;  1XMA A;  2XSJ C;  2UV1 A;  1NH3 A;  1KQ0 A;  1Z3X A;  2VQH A;  4C2M J;  4HDU A;  3AAF A;  1K78 B;  1ZHF A;  2QQ9 A;  2V1N A;  4PGH A;  3A1Y A;  3DEU A;  1LPQ A;  1K6O A;  2DYR H;  4XK4 A;  2OZU A;  3N97 A;  3DQV C;  3CUO A;  4LB5 A;  2IS2 A;  3LSK A;  2Z9O A;  3IP4 B;  4XN0 A;  5HNF A;  1JKO C;  2FQ3 A;  2DN0 A;  1G8X A;  1HST A;  1Y6I A;  2EPF A;  2WA0 A;  1ETQ A;  2W1O A;  4V19 K;  5HS8 A;  1W5T A;  1Z67 A;  2EK5 A;  2VXD A;  2LOO A;  3L9F A;  3W3C A;  3FXR A;  4PFO A;  3HOS A;  4V2G A;  2GM4 A;  2Y0S N;  2ZME C;  1A6Q A;  3O8H A;  1DP3 A;  4ENM A;  2F5V A;  2RV8 A;  1P7J A;  2VJ4 A;  1IXR C;  1B8I A;  4XRS G;  4L18 B;  3A0H C;  2LR8 A;  1BR1 A;  2VT3 A;  2Y75 A;  3FHN A;  2E1N A;  4BXX J;  2GA2 A;  2F5C A;  4W97 A;  3B02 A;  1WI9 A;  2LY9 A;  4IPA A;  5KAI C;  3O3K A;  1I3Q J;  4IHY A;  3HL2 A;  5DS9 A;  1GV5 A;  1VFC A;  5DUK A;  1BC8 C;  1V3F A;  1GDT A;  2OC6 A;  2VQC A;  5GTI C;  4XID A;  3PL8 A;  3BRO A;  2QLZ A;  3U21 A;  1D8K A;  3F8B A;  1MDM B;  1SAU A;  3AFH A;  5GTH C;  3HOT A;  3ZQI A;  3K70 C;  2WAQ N;  5BNG A;  2CG4 A;  3AG1 H;  2W48 A;  2M34 A;  2QSH X;  1MJ9 A;  2R93 J;  4HSR A;  4DIQ A;  3KYL A;  1APL C;  4KUM A;  2HOT A;  5LHI A;  4Y52 J;  3CCU I;  2DA5 A;  4CUG A;  1FYK A;  2BVM A;  1T2K A;  1J5Y A;  1ZTR A;  4FE4 A;  1SMY F;  3OL3 A;  1LEA A;  4ESF A;  1DQU A;  2FOW A;  3ECO A;  5EZH A;  4E7K A;  2CJJ A;  2Z33 A;  2UXX A;  4PJM A;  3I64 A;  3CZ6 A;  3ULQ B;  5D8L B;  1H9T A;  2D1V A;  3QYF A;  2EIL H;  4I02 A;  1F1Z A;  5AIQ A;  5A2Q K;  3G6E I;  1WJC A;  2WTE A;  2HGC A;  3ZQQ A;  1W0U A;  1YOV B;  2NOJ B;  3IH4 A;  2Y69 H;  1L0O C;  5H20 A;  3H5N A;  1ZH5 A;  2KIU A;  2K4J A;  2PQ8 A;  4I2O A;  3ZQF A;  1V5E A;  5EGO B;  2L0K A;  1Q1H A;  2LBF B;  1OKR A;  3L00 A;  3G1O A;  1L3L A;  3WGG A;  5TJJ A;  5E18 F;  5GAH J;  3IHU A;  3HHG A;  5EDN A;  4RGU A;  4DYQ A;  1Z3Y A;  1A04 A;  2VBX A;  4Y15 A;  3UNG C;  1WCM J;  2XB0 X;  5CPR B;  3Q3S A;  1OCP A;  1RIO H;  3ABT A;  3ZMD A;  1HC8 A;  1ONV A;  4XIC A;  2E2H J;  4LLN A;  4AWX B;  4QWQ A;  2QF7 A;  3CCS I;  2XAJ A;  3I71 A;  3WHB A;  5B5E C;  1GVD A;  5FJ8 J;  2KP6 A;  2Y0M A;  2Y0S A;  3L2W A;  3F8F A;  1R7J A;  2HDD A;  2V1X A;  2HVQ A;  2XGC A;  3ZN1 A;  1YS6 A;  4P96 A;  1ZGW A;  1HW2 A;  2ACJ A;  1B9N A;  1MMD A;  4CXF A;  4ZDO A;  1IZ1 A;  3FXL A;  4M9Z A;  1NG6 A;  2CV2 A;  1B9M A;  5BOX A;  4HEA 2;  3OL4 A;  1BR4 A;  2RQQ A;  2VJI A;  2JVH A;  3M7G A;  4BS9 A;  1IN8 A;  2ZME B;  4FT8 A;  4A6E A;  3SHF A;  1KZH A;  2X1D A;  3K69 A;  4IXA A;  1YIJ I;  4KMF A;  3ZOB A;  4LMY A;  1PP7 U;  4O6J A;  2ZJR F;  5D6E A;  1KYW A;  2HEO A;  4B48 A;  3H5A A;  2L01 A;  1IW7 F;  1Z05 A;  4EVI A;  3GFM A;  3LQQ A;  5H6Q A;  2WAQ A;  4ITV A;  2AXL A;  5J40 A;  2OU2 A;  1VQL I;  2ECB A;  2KDO A;  4CH7 A;  2HS5 A;  4HV5 A;  3WU0 A;  4DBQ A;  3JW4 A;  3L2U A;  2CS3 A;  2F5F A;  2PN6 A;  4MNU A;  5CJ9 A;  2O5R A;  1IGN A;  1A36 A;  5IP7 J;  4D0P A;  2CGP A;  1OCO H;  3I55 I;  2DMT A;  3E97 A;  4DBR A;  3IWZ A;  1I5Z A;  3C1D A;  1WH7 A;  3OYF A;  2LF8 A;  2IS4 A;  4YFX F;  3EDP A;  3FIW A;  4FTH A;  1YRN B;  1USS A;  3QP5 A;  3SFI A;  4XKC A;  2DOF A;  1FMW A;  2CH0 A;  1C0W A;  4FET A;  4OOI A;  3MZH A;  4B44 A;  5JI6 A;  3DV8 A;  4PFP A;  2OTL I;  1ITY A;  1MND A;  1UCR A;  2PMU A;  1BN5 A;  4LG3 A;  1MNM C;  1UST A;  4CGZ A;  3KP4 A;  5FLV A;  2MH9 A;  3C3W A;  5B3S H;  2LK2 A;  4GYG A;  2BBY A;  1TTY A;  5LBQ A;  3W6V A;  4UUS B;  3DKY A;  2Q0O A;  1W36 D;  3CUQ A;  5K7H A;  4BQA A;  1QVU A;  3K1N A;  4OIO F;  5HS7 A;  2GOM A;  2NS8 A;  4EJV A;  3BY6 A;  2L4A A;  5E3M A;  3Q0W A;  2W57 A;  4LD5 A;  1JTX A;  4GXO A;  1IF1 A;  3HC7 A;  5EF6 A;  2M2E A;  3IC7 A;  2IGK A;  3PO2 J;  4KYW A;  2WV0 A;  5IYC J;  4HYE A;  3WTX C;  2ELK A;  2ESN A;  2Q8K A;  4FX4 A;  2GA1 A;  3GFL A;  3DPL C;  2M4K A;  3GVA A;  3H3V K;  3FMQ A;  4PJL A;  4HBL A;  3MVP A;  4RBO A;  4ZC3 A;  4LG0 A;  2F2E A;  4CYC A;  4AD9 A;  3E6C C;  1LVK A;  1R00 A;  3KPH A;  1K79 A;  1OLT A;  2E1M C;  2VBW A;  2NRA C;  1A31 A;  4O3M A;  5HVQ C;  3BJ6 A;  1E2X A;  2AO9 A;  2QM3 A;  2ZBK A;  3SZT A;  2BEO A;  2DK8 A;  1D3Y A;  4KT6 A;  5DV5 A;  1Z7L A;  4UHT A;  2OV7 A;  1EJ9 A;  1HDD C;  1XDU A;  1YW7 A;  4JX4 A;  4AU7 A;  2VXZ A;  2LH9 A;  3BG6 A;  1LFP A;  4BXF A;  2KDZ A;  2VPR A;  1REP C;  2A05 A;  1OJL A;  2BHY A;  1IAW A;  1F4K A;  1QQI A;  1R49 A;  1WJB A;  1R58 A;  3BR0 A;  4C30 A;  4D5F A;  3I59 A;  4J01 A;  5EZG A;  3RKW A;  2QZ8 A;  1U5T A;  1RNL A;  2LTP A;  3PO3 J;  1MBG A;  2QGU A;  3SZP A;  2EA4 A;  4IKF A;  4XBF A;  3V7R A;  2QUF A;  5D4S A;  3J80 Z;  3OWT A;  3P9C A;  2X1C A;  2VN2 A;  3NAR A;  3MZY A;  2ISZ A;  3HB9 A;  5CLS A;  4BYY A;  2JT1 A;  5HDG A;  2RQP A;  4ZTF A;  3H36 A;  1SFE A;  4UUT A;  4P9U A;  2H8R A;  4D5C A;  2XV4 S;  4P9F A;  3LA3 A;  3GF2 A;  2ZFU A;  1BIB A;  3LSH A;  3UR3 C;  4CSW A;  2BW3 B;  1PP8 F;  2I10 A;  5CQE A;  3M1C A;  1U9O A;  2QBY B;  1T6S A;  2H27 A;  2LMD A;  1O7L A;  2R3S A;  1T39 A;  5H2F C;  4QTR A;  2BY0 A;  3BLY A;  5IT9 Z;  5TRD A;  2OUM A;  3VEP A;  3D1N I;  1V5F A;  3F9K A;  3G73 A;  2MA3 A;  2XB5 A;  2FX0 A;  2MW8 A;  4A3D J;  3CQZ J;  1X3W B;  2STW A;  1TC3 C;  5LEK A;  1MMA A;  5FKN A;  4E7Z A;  1GUU A;  1X4P A;  2K7L A;  4XOP A;  1Z21 A;  3H9Q A;  4IOA F;  1NHA A;  3VSK A;  4UY8 I;  2CQN A;  2XF5 A;  1HW1 A;  2P0W A;  4I7H A;  3JCU C;  1PUF A;  4DYR A;  2E2I J;  4W1U A;  1B59 A;  2PMZ A;  3H0D A;  2K3F A;  3IV5 A;  3LAJ A;  4J19 A;  1H0M A;  3WTT C;  2YUS A;  4TV7 A;  3V7S A;  3LOC A;  2K9Q A;  3SFZ A;  4A69 C;  1D1C A;  3H9J A;  1YE9 A;  1VQ7 I;  1LE8 A;  4XLE A;  2DU9 A;  3EUK L;  5DCM A;  5BPI A;  2XSD C;  3R4K A;  4PCQ A;  1X2N A;  2KIM A;  2EIM H;  3R6S A;  4PJ0 C;  3S3O A;  3PUB A;  4Y7N J;  4YII A;  3JSP A;  1TLH B;  4CCL A;  2L7F P;  5DM6 F;  1VQK I;  2QSF X;  5HOD A;  4IRI A;  2ZNY A;  3C2G A;  2XRL A;  1FBQ A;  4RDU A;  2KLO A;  2K9L A;  2M45 A;  5ILS A;  4XKB A;  1AKH B;  2E1M B;  3QYB A;  1V5G A;  2WBM A;  5L3D A;  4L9V A;  1WJE A;  1CF7 A;  2F5E A;  1J9I A;  4L9N A;  3FM5 A;  2P8T A;  3VOD A;  4X1E A;  3TBI A;  4XLN F;  1OCR H;  4FCY A;  2VQG A;  4I09 A;  2H6C A;  2E19 A;  3V42 A;  4RB1 A;  4WWC A;  3NQO A;  2CQX A;  3OR2 C;  2L7K A;  1BC7 C;  4IQJ A;  1BBY A;  3IKT A;  3QP6 A;  1SD5 A;  2EZH A;  5D4R A;  3GZ6 A;  1OFC X;  4M72 A;  2DO7 A;  4RM2 A;  2DOE A;  2J5O A;  5E3O A;  4WX9 A;  2VI6 A;  3M8F A;  3S16 J;  3SEZ A;  1H89 C;  2XAU A;  4FIS A;  1MH4 A;  2R7F A;  3L7W A;  3PNV A;  3KET A;  3F22 A;  4ZYE A;  1P4X A;  2NYX A;  2B63 J;  3LNQ A;  1FP1 D;  5C4X J;  2HWV A;  2LFB A;  2M1B A;  2RAE A;  1IN7 A;  1EH8 A;  2Q2E A;  1HBX G;  3A2K A;  3GW2 A;  4IHV A;  4HOB A;  1E17 A;  4HST A;  2MG4 A;  1K4S A;  2DTR A;  3S1M J;  3HKZ N;  2MGQ A;  3D5S C;  2CUE A;  1IDY A;  2OZ6 A;  3RQI A;  3LSI A;  4ZZD A;  4RAZ A;  1MZB A;  2VUM J;  3HUG A;  2O0Y A;  1B72 B;  2A07 F;  2FEZ A;  4G12 A;  3FXO A;  4HX7 A;  1PVE A;  2CW7 A;  3LSP A;  5FD6 A;  4U0W A;  4MHG A;  1R6R A;  1RES A;  1SAN A;  3FKJ A;  3HRS A;  3RI4 A;  1VND A;  2YPR A;  4F52 A;  3K4B A;  4AVZ A;  1BI1 A;  2HVR A;  1BM9 A;  2ICW G;  2P7V B;  3ZPL A;  2XPV A;  1TW2 A;  1E3H A;  1YW8 A;  2ZFW A;  3HYI A;  4HNU A;  1X58 A;  3WG9 A;  1Z0X A;  3OR1 C;  4IL6 C;  1D5V A;  3BOQ A;  5FRO A;  1JUS A;  4M3B A;  5FFX A;  3VSL A;  1WRJ A;  4IVN A;  1XGN A;  2QQ8 A;  4IHW A;  3GCM A;  2ZJQ F;  4A93 J;  2WC2 A;  1RPW A;  2LP0 A;  3RZD J;  4CZZ A;  5B1A H;  1D5Y A;  3OS0 A;  3BTC A;  4CIC A;  4CYD A;  1F43 A;  4ABZ A;  1PYV A;  5BMZ A;  2COM A;  3GZ5 A;  4PSX A;  3IL2 A;  3QWL A;  4RAG A;  3V4G A;  4EM0 B;  3ELK A;  1LQ1 A;  4PZJ A;  1R4N B;  1HLV A;  2IA1 A;  1QO0 D;  1WFX A;  4IF4 A;  5D5W B;  1JT6 A;  2CSO A;  5M5Y J;  1DUX C;  3GO5 A;  5L3C A;  2VOO A;  5F0H A;  1U3E M;  1SEU A;  1ZK8 A;  2L7M P;  1OCT C;  1SFK A;  3RSN A;  3AG3 H;  4HDV A;  1ETY A;  1YS7 A;  1K78 A;  1UG0 A;  1HDP A;  5A2Q Z;  1R5I D;  4AM3 A;  4BQQ A;  1FJL A;  2KRH A;  1FP2 A;  2QSG X;  3DKX A;  4Q4Z F;  3O8G A;  2K85 A;  2RKH A;  3TDU C;  3WTY C;  3A4C A;  2ZXI A;  1UHS A;  2Z2S B;  3H3Z A;  3GUD A;  3HOW J;  2A6E F;  2FE3 A;  2QKL B;  3U2R A;  4XRM A;  2CFO A;  4NHJ A;  2IS1 A;  2LRE A;  3ISP A;  3VYU B;  5J1Y A;  1WZ2 A;  4OIQ F;  2K9S A;  1Q1V A;  4BEH B;  1MW7 A;  4OAZ A;  5TGT A;  2XKO A;  2V7F A;  2DA3 A;  1FSH A;  4AUX A;  1BOB A;  3F3X A;  4A6D A;  3FXQ A;  4YEL A;  4M9S A;  3VYS B;  2XRN A;  4GFB A;  3CCR I;  4L0Y B;  3A02 A;  2FNA A;  1J0R A;  2ELH A;  1XB4 A;  3M07 A;  2FBI A;  3IRR A;  2RVC A;  1VQ4 I;  1J75 A;  2HYF A;  2C6Y A;  2W25 A;  2KMU A;  1MKM A;  3HKZ A;  3L2C A;  1STZ A;  3BR1 A;  1I27 A;  4LFU A;  1KON A;  3TED A;  3BZ6 A;  2AXT C;  2IXS A;  2GIZ A;  2IAI A;  4HA8 A;  2R7X A;  4KIC A;  1KQ9 A;  2HZD A;  2RNG A;  2OQR A;  1XMX A;  2HU9 A;  2VJJ A;  4OIR F;  4KIF A;  5KHD A;  2H09 A;  2J5P A;  2ZCW A;  4DZP A;  1KYZ A;  3ZRG A;  1MDM A;  2BY1 A;  4Y4R A;  3BG7 A;  4GGG A;  2QVO A;  3HG9 A;  1ZRD A;  3M4O J;  2M5W A;  3K10 A;  3OYH A;  2JWT A;  2Y48 A;  3G1M A;  3L2V A;  5FLX K;  5CYV A;  2EFQ A;  4OIN F;  1IC8 A;  1DGW Y;  3GTQ J;  1X3U A;  3RPU A;  1OPC A;  1S6L A;  4ON0 A;  5H6R A;  4HW0 A;  5FO5 A;  1ERD A;  1Z6R A;  4I98 B;  4KMU X;  2MC3 A;  4A0Z A;  4S0H B;  3JRB A;  3ERE D;  2CW8 A;  3KP2 A;  4U7D A;  5KVR A;  4Q5S F;  1KU3 A;  2OJE D;  3LSM A;  2DMQ A;  4M73 A;  4ENJ A;  2PJR B;  2XHK A;  2LVS A;  4UVA A;  4XMY A;  3MD2 A;  5K7Z A;  3J81 K;  3KLN A;  1X1P A;  4HF0 A;  1IDZ A;  1G3S A;  3IAM 2;  2FXA A;  1S8N A;  3QRF F;  2W24 A;  2P7C B;  1RZ4 A;  1UHM A;  2FRH A;  3DXJ F;  3HTU A;  3ZGK A;  3Q5F A;  2KIS A;  2STT A;  4EV0 A;  1MMS A;  5EGO A;  1FC3 A;  3U1D A;  3EYI A;  2E60 A;  2LBF A;  3VFZ A;  3ZQG A;  4BE0 A;  3JAM Z;  3QU6 A;  3S14 J;  1JKP C;  4MEY F;  4RGS A;  4U87 A;  4ESB A;  3OS1 A;  2OQG A;  1JKR C;  1ZRE A;  3A01 B;  4BY1 J;  2PFB A;  1OIS A;  4OAY A;  4CCK A;  4JX5 A;  1I1S A;  4CCN A;  2PG4 A;  3SYT A;  1SMT A;  3RKY A;  4L9T A;  2ADU A;  3CCJ I;  1R23 A;  3T8R A;  3CLQ A;  1U9N A;  3GTM J;  1T38 A;  4P1W A;  4WXC A;  1AOY A;  1MIJ A;  3DPU A;  2OF7 A;  1FTZ A;  3RPU D;  1W1W E;  2ID6 A;  1XS9 A;  3U9G A;  1ETW A;  1G6N A;  1HXD A;  1I3A A;  1Y56 A;  2PEX A;  4HV6 A;  5J4V A;  2DCE A;  1BI0 A;  4HG2 A;  4N0B A;  3S3M A;  4DOZ A;  3CCY A;  2NVX J;  3JTH A;  2CRG A;  4A3E J;  3TKY A;  4R1H A;  1WGX A;  4Z2Y A;  3CC2 I;  2X85 A;  3ZCO A;  4MTD A;  2CV0 A;  1ACI A;  1I50 J;  1EA3 A;  1Z1D A;  2JTV A;  4LIT A;  4RLQ A;  4BQO A;  2ZME A;  1UEL B;  4CCM A;  3LSG A;  5E3N A;  1ETX A;  4EJW A;  1FOX A;  4HX4 A;  5FFZ A;  4XRF A;  3RPQ A;  1HQC A;  3M8E A;  1YYV A;  1P7I A;  4A3K J;  2NXN B;  2Z1D A;  3LST A;  2R4G A;  2M8E A;  1GT0 C;  2IPQ X;  1W7P D;  5FKL A;  3MWM A;  1LKX A;  3PNY A;  1W4M A;  1J2X A;  4K2E A;  2R7Z J;  2XAS A;  3ERM A;  3ASN H;  4IQ4 A;  4XRS A;  2RC4 A;  4U88 A;  3VB2 A;  2DAO A;  1HF0 A;  4A3G J;  4B8X A;  1P9Q C;  1HOM A;  2A5Y B;  2CWE A;  1OCC H;  1SD6 A;  1YJW I;  2EV6 A;  5IPA A;  3MKW B;  1W7P B;  2MFZ A;  3TOB A;  2TCT A;  3OSG A;  2HTS A;  1ZRC A;  1T95 A;  1OMI A;  1U8R A;  3KP7 A;  4BDZ A;  1YRN A;  3KZY A;  1N25 A;  2H1L A;  4G6Q A;  2NNY A;  1ZYR F;  4IX7 A;  5EG0 B;  4UUV A;  2WAF A;  2L2O A;  1QPI A;  4F7Z A;  2HKO A;  3GEZ A;  4X6A J;  2YX7 A;  1FTT A;  1O4X A;  1AA7 A;  2JK3 A;  4KT5 C;  2K40 A;  1ZEL A;  2HOE A;  4M6Y A;  2OA4 A;  3C7J A;  4F92 B;  2IS6 A;  2K27 A;  3BC8 A;  3PNT A;  2JMW A;  3OOP A;  4XON A;  4YRV A;  4JOM A;  2R7S A;  2DA1 A;  3HOV J;  1SVM A;  3H9G A;  4P5O A;  4M3F A;  1YO5 C;  1X4O A;  2XAH A;  2KFD A;  3K7A J;  1MGT A;  4L5I A;  4AID A;  5ICE A;  4C9Y A;  4UUS A;  2F4M B;  4Y13 A;  3LFU A;  2E34 A;  2ZSI B;  3E3V A;  5K5O A;  2GZW A;  2M4G A;  5DUI A;  2LY1 A;  3H0G J;  1ZG3 A;  2HQA A;  4E7J A;  1FMV A;  1IO2 A;  2DDB A;  3PFY A;  2FSW A;  4KIT B;  1N78 A;  2RGV A;  4G7O F;  3KEY A;  1YI2 I;  5B1B H;  3MMY B;  4NDL A;  4U7B A;  2HQ5 A;  1VQM I;  4M6X A;  2XKP A;  5IYD J;  3BR6 A;  3HPG A;  2VJ5 A;  4KA4 A;  1BW5 A;  3K1P A;  2ETH A;  3K70 D;  4WF2 A;  2E7X A;  1CQT A;  2ELJ A;  2X0L A;  2V1D A;  1WJD A;  4RB0 A;  2BHZ A;  3JRI A;  2VOD A;  3M8J A;  4U0V A;  3DPT A;  3OYC A;  1EH7 A;  1T98 A;  2VKE A;  4X0G A;  2XAG A;  3X2Q H;  3J7A Y;  2EIN H;  3I9V 2;  5E1W A;  1LVA A;  4HPQ A;  1EH6 A;  3OS2 A;  5J1U A;  1DDN A;  3O6B B;  4I76 A;  4UVC A;  1Z7U A;  3BWG A;  4BHP A;  4MFD A;  1TNT A;  4E70 A;  4MQ9 F;  3VPR A;  1EKE A;  2E1C A;  1S3J A;  2JSC A;  4HF2 A;  1X1B A;  1VQ8 I;  1YX3 A;  1JI8 A;  2WV1 A;  2PJP A;  2RN7 A;  2RNJ A;  9ANT A;  4BE2 A;  2EV5 A;  4EAT A;  4UV8 A;  3ZP5 A;  3HOZ J;  2IGN A;  1SAX A;  1S9H A;  2W00 A;  1NK3 P;  1NTC A;  1TBX A;  5LRR A;  5J6X A;  3CCM I;  3LMM A;  5GPC A;  1I6H J;  1ZKG A;  4HNT A;  1O7F A;  4C3J J;  1P6R A;  5CKT A;  2MH2 A;  2GXB A;  5DCF A;  3GZN B;  1ORK A;  3BTJ A;  1ZR2 A;  2KHM A;  3OYL A;  2K02 A;  3CDL A;  2MYS A;  2K3P A;  3M1E A;  3OIP A;  2V9P A;  2L7Z A;  3BR5 A;  3BG5 A;  1SVO A;  1YIO A;  2DMP A;  3OIQ A;  3JRF A;  4BE1 A;  3D0S A;  1GXQ A;  4M3E A;  3COA C;  4L0Z B;  3MKY B;  1S7A A;  2CQK A;  1OQY A;  2G9W A;  1FIP A;  2BW3 A;  3BT9 A;  3MEX A;  2BY3 A;  1LDK B;  1YX5 A;  2KZV A;  3CDI A;  2QBY A;  3BQY A;  3FK6 A;  5F04 A;  4WCG A;  1X2M A;  2HOA A;  2EFW A;  4Z6Y A;  2JZY A;  2PMZ N;  2IA2 A;  2DMN A;  3VOE A;  3PM1 A;  1Z6T A;  1R1T A;  2DLL A;  4RLF A;  4G94 A;  5J1R A;  3HOU J;  5LHH A;  5J4Y A;  1FBS A;  1HSJ A;  2R92 J;  2A5W A;  3R0A A;  3HIF A;  5ED4 A;  1VF9 A;  2UXN A;  1WKM A;  4MEX F;  1T33 A;  1X19 A;  5F64 A;  1IN4 A;  1LUJ B;  2DFE A;  2PMH A;  3A0B C;  1T0F C;  2EWN A;  2PX9 A;  4ETS A;  1TWA J;  1MMG A;  2E35 A;  3WOD F;  3W2A A;  2AQF A;  4L5E A;  1JJ8 C;  4KNY A;  2X9D A;  1GXP A;  2E7W A;  4HNV A;  2IVM A;  4A0X A;  1TT5 B;  1WWX A;  2FBK A;  3QOD A;  4M6V A;  3KEO A;  3M3Y J;  3MKZ A;  3KZZ A;  2HVS A;  2KQR A;  3AG4 H;  3OYG A;  3CO7 C;  2B9S A;  4Y3O A;  2LF7 A;  3CDH A;  2IJL A;  1UMQ A;  4XSZ F;  4DNC A;  1O3R A;  2GWR A;  2FUG 2;  5D8K B;  3FXM A;  5FKM A;  4P55 A;  3SEQ A;  4S05 A;  4EGY A;  3OIO A;  4JYK A;  3LSJ A;  1IUY A;  5E1X A;  5M5W J;  1ZAR A;  1AKH A;  5FKK A;  1O3S A;  3S3N A;  5ILU A;  2NS0 A;  1WI3 A;  1S7O A;  2ZXJ A;  1R4M B;  2LKP A;  3EUH C;  4V2F A;  5M5X J;  1Z91 A;  5HLT A;  3JRC A;  1DPU A;  3FF5 A;  2HYG D;  4RB2 C;  2R7U A;  1ZLJ A;  1SVL A;  3IAS 2;  3BCB A;  4I0B A;  5CQG A;  1HKQ A;  4EQQ A;  2Y30 A;  3KE2 A;  3K9T A;  1MSF C;  3LAP A;  4J00 A;  4BAC A;  4YEJ A;  3HGG A;  3TL4 X;  2HPI A;  2VON A;  1HCR A;  1NK2 P;  2W4S A;  3TDZ C;  2DT6 A;  3AL0 C;  1WPK A;  4G7Z F;  1H88 C;  2LG4 A;  1G3W A;  1YJN I;  3ESW B;  3DTI A;  3UKG A;  3EYY A;  5L3F A;  2FJ1 A;  2V6C A;  3S93 A;  4MFE A;  5JR3 A;  4U0Y A;  1E3P A;  2K86 A;  4E7I A;  3CJT B;  4PSW A;  2P5V A;  3TOA A;  3F8C A;  4JP0 A;  2KIQ A;  3LL7 A;  5GP9 A;  1FOY A;  5FLM J;  2DYS H;  3C2H A;  2JA7 J;  5GAE J;  3GTL J;  2QCO A;  3E7L A;  2CFX A;  2H8W A;  3BPX A;  3D5L A;  3HSF A;  3ASO H;  4O5V A;  4E4H A;  4HF1 A;  3KCC A;  3CJR B;  2WY7 Q;  3JRG A;  3KLO A;  1V55 H;  3HBL A;  1PDN C;  5LGT A;  3F23 A;  4I99 C;  4BDY A;  2ZSH B;  3HTS B;  1B72 A;  3FWE A;  1BI3 A;  2VOP A;  4XLH A;  4II3 A;  4NNJ A;  1UHW A;  2FA5 A;  4CDG A;  3WGI A;  4XLC A;  2VIX A;  1LFU P;  4DJA A;  3NRV A;  4AC0 A;  2DA2 A;  5M3M J;  1JXS A;  4IO9 F;  2ZKZ A;  2CMP A;  1P4A A;  2KJC A;  3TO7 A;  5J3L A;  1R22 A;  4KFC A;  1TWG J;  1CGP A;  2DPU A;  4IHT A;  1R1U A;  2KRC A;  5HLI A;  2XGX A;  3I58 A;  5DTD A;  2O6G E;  1IUF A;  5FGM A;  1ZGJ A;  2UZK A;  3SJM A;  4R8H A;  4HLX A;  1WHU A;  1RUN A;  3D5R C;  2HDW A;  5FLX Z;  1MH3 A;  1R5G A;  2VT2 A;  5J47 A;  4ENK A;  2X48 A;  4OIP F;  2F4I A;  1GV2 A;  2ZXH A;  3GTJ J;  4A3C J;  1J7K A;  2DQR A;  3PQJ A;  4PJN A;  4Y17 A;  4FHT A;  1IG7 A;  5E8G A;  2M87 A;  2LYC A;  5LFA A;  3PUF A;  4G8X A;  1YFH A;  2VKV A;  3BPV A;  5HLH A;  2F48 A;  5F27 A;  2HI3 A;  4XOT A;  3ZMV A;  3KIO A;  2Q1Z B;  3ABL H;  2R7R A;  2VAS A;  1E3O C;  5D5V B;  1UZC A;  2ZXW H;  4B43 A;  3F6O A;  3I54 A;  1FEX A;  5LRS A;  4A3F J;  4IZZ A;  2UWM A;  4NB5 A;  1T08 B;  4RA2 A;  1FYM A;  5IY5 H;  4XLF A;  1YQA A;  5GAD J;  5AON A;  5ILV A;  3REO A;  2TDX A;  1FYL A;  2R5Y B;  1FOK A;  3J7A O;  3W2W A;  1UFM A;  2K4B A;  3DKW A;  4BEH A;  2E71 A;  2KL4 A;  4NQW B;  2R7Q A;  2Y31 A;  1BJZ A;  2BXY A;  2K9N A;  1Y39 A;  3QU3 A;  4M3D A;  3EPZ A;  5E1Z B;  3HDD A;  1IRX A;  3V8J A;  3HZJ A;  1BOA A;  3DLL F;  4OWR B;  3FXU A;  5CVI A;  3AKZ A;  4E6K G;  1ON1 A;  3DFG A;  5JHF A;  3H3U A;  3HGY A;  3OYM A;  3T8T A;  3IRQ A;  2X1E A;  2P6S A;  5LLQ A;  2V26 A;  1MD0 A;  4BQN A;  4D7N A;  4BL0 B;  1UG2 A;  3OSF A;  5IP9 J;  3P9I A;  2E5N A;  4WXH A;  3RJP A;  2XRO A;  2TRT A;  5C44 J;  4LIV A;  4IJA A;  1U0J A;  4B4C A;  1DU6 A;  3NWT A;  1RI7 A;  3BTL A;  3ABK H;  4H0E A;  5L3G A;  5KCM A;  4KJZ A;  1XX5 A;  1XSV A;  3S15 J;  3HSE A;  1VI0 A;  3HSR A;  3CME I;  3DLA A;  4QSH A;  4BY7 J;  5GAG J;  2DOA A;  2A6T A;  1G59 A;  1KQ8 A;  5GPA A;  2V9V A;  3S1N J;  4XN3 A;  3F8N A;  3ZQL A;  4KDP A;  2VKH A;  4E7L A;  1VQP I;  3T0Y A;  1KGS A;  3ZR8 X;  2PJR A;  1A5J A;  3F6V A;  5K5Q A;  4BNC A;  3FK7 A;  2LD5 A;  4F55 A;  1VQ5 I;  3S8P A;  4HQE A;  2VLA A;  4S04 A;  3E5U A;  1FSE A;  2LNB A;  5ICF A;  1XPX A;  5IT9 K;  4HRI A;  1WJ5 A;  4GO1 A;  2WWY A;  2P81 A;  2VL8 A;  5E20 A;  3CF5 F;  2HYJ A;  2FML A;  1IRF A;  2YSR A;  3BDD A;  4BJ5 C;  2FNP A;  1JUM A;  5DD4 A;  5LGU A;  1HKT A;  1KU9 A;  3N4M A;  1LDD A;  4N4O B;  3A01 A;  3TO6 A;  2ZJ2 A;  2O8X A;  3CMA I;  2BVL A;  3DEW A;  3LQR A;  4ZJZ A;  3CP8 A;  3BJO A;  2JRT A;  3H92 A;  5E8I A;  3OYE A;  2L9V A;  2EZI A;  4YIR X;  3K0L A;  3CJN A;  3I3L A;  2JPC A;  4EM1 A;  2XUB A;  5L3E A;  4MQV A;  3ZXS A;  3VYT B;  4XR6 A;  2DFH A;  1Z9C A;  2JVG A;  2QKM B;  1QGP A;  1UB9 A;  3DU5 A;  3HHH A;  1U8B A;  4IHX A;  2I8D A;  3GYH X;  2HXO A;  1RKT A;  3RTR A;  3ZQC A;  2BV6 A;  4DZJ A;  2V6E A;  2PI0 A;  3K4M A;  2IBD A;  2DXI A;  4DYC A;  2KZG A;  3HOX J;  1Y0N A;  4GDF A;  2MAB A;  3A03 A;  5K1Y A;  3F21 A;  5FKO A;  2DMU A;  2D1H A;  3ZQ7 A;  5F6F A;  4QPQ A;  2Y9Z A;  4RGR A;  1VQN I;  2L4M A;  1XTA A;  1V54 H;  1WQ2 A;  3WGH A;  4A0Y A;  1PUE E;  2HOS A;  3RDI A;  1LEB A;  2M7A A;  3MKL A;  1G2H A;  1BJA A;  1QHG A;  1QZE A;  3EET A;  4LB6 B;  1UAA A;  2YR2 A;  1IN5 A;  5KNL A;  4L5J A;  5EYR A;  3BP8 A;  2EFO A;  4G9Y A;  5F08 A;  4GYI A;  4UB6 C;  4BUP A;  1HA8 A;  3CMY A;  2FD5 A;  3L1P A;  4ZDP A;  2HPM A;  1XCB A;  2JUC A;  5HDN A;  1VQ9 I;  3W2V A;  5HLG A;  3WHC A;  1ZG5 A;  2DQL A;  2MC4 A;  4HAM A;  4BHC A;  2XDV A;  3FHZ A;  2DTZ A;  2EFN A;  4EMS A;  3L2R A;  2W85 A;  4AYB A;  2R5Z B;  5EEA A;  1S5L C;  1W7P A;  2O3F A;  1IN6 A;  3H5R A;  5BS6 A;  2JA2 A;  1MMN A;  2NOG A;  4JQF A;  3VDX A;  3S17 J;  1B1B A;  4Q47 A;  3SDB A;  1BR2 A;  4QIW N;  5FB2 A;  3QOP A;  3MFK A;  2DOD A;  4I6Z A;  1OR7 A;  1TZL A;  3OYK A;  2XF6 A;  3HJE A;  5DDG A;  2YU9 J;  2VKD A;  5EG0 A;  1SD4 A;  2ZNZ A;  2ZJP F;  2MD5 A;  2XPU A;  1QRY A;  2DJN A;  4KN7 X;  4NC6 A;  4DQ2 A;  4ZDL A;  4D9J A;  4E7H A;  2BYV E;  2M9H A;  2P4W A;  2K5C A;  4BJT A;  1YTY A;  4ZZL A;  3KYD B;  1S72 I;  1X1D A;  2QEN A;  3DTE A;  1S29 A;  3TP0 A;  4BBR J;  2NAZ A;  2GXA A;  1SD7 A;  1JJ6 C;  1XGS A;  2ME6 A;  1TWC J;  3DBH B;  2A69 F;  4FE7 A;  3V8L A;  2HNH A;  2CW0 F;  2DBB A;  2XGE A;  2BGC A;  2JPB A;  2H94 A;  2MLG A;  1UJ8 A;  2FU4 A;  3ML6 A;  3RCO A;  4BH9 A;  4QLC U;  1QZY A;  1XGO A;  4HZF A;  3PIP F;  1K7A A;  2XGD A;  1FT9 A;  3MAJ A;  2KRF A;  2EV0 A;  2OAZ A;  3L2Q A;  2N8G A;  4LK0 F;  1Y1W J;  2AS5 F;  1VTN C;  2GXG A;  4PGG A;  3QQA A;  2P5L C;  2VB6 A;  3DEE A;  3WTZ A;  2KIF A;  3Q0U A;  1IXC A;  4M74 A;  1DU0 A;  1HKS A;  3RYR A;  2HQN A;  1MJB A;  2QQA A;  3P9K A;  4CCO A;  4XLP F;  3J7Z I;  2IA0 A;  1I6X A;  4MGR A;  4JX6 A;  2M0C A;  2CYY A;  4XKV A;  2VC0 A;  3MZ8 A;  5JVT A;  1ETK A;  2NVY J;  4JBA A;  2HTJ A;  1RKW A;  4I0A A;  2V1U A;  1SC7 A;  3WG7 H;  1M1E B;  3HPH A;  1EV7 A;  1WJA A;  1TQM A;  3FM3 A;  1F36 A;  4CO8 A;  6PAX A;  3CC7 I;  3LA7 A;  4FX0 A;  2Y9Y A;  3E6M A;  2CQ7 A;  4M9X A;  1D8J A;  2F4O B;  1TW3 A;  2NNN A;  2Z5U A;  4G7H F;  3KP5 A;  1Y8Q B;  2HR3 A;  3E5Q A;  2E5Z A;  1D0Z A;  4PK4 A;  1AWC A;  5D5X B;  1B8I B;  4I01 A;  3BR3 A;  4YFN F;  2OCE A;  2JRM A;  5EJC A;  1YG2 A;  4PJJ A;  3O2P E;  4A5N A;  1W36 C;  2CUZ A;  1XSX A;  3FZV A;  2X4H A;  1ZGA A;  1D1B A;  4EM2 A;  3ZN0 A;  5JVG F;  4GRI A;  4NUB A;  4BBS J;  1T8I A;  4AIH A;  1R1V A;  1OCZ H;  3BG9 A;  3TP3 A;  2FBH A;  5J8F A;  1MSE C;  3JRA A;  3PSF A;  5JFR A;  3V8K A;  3GX4 X;  2XPW A;  4UV9 A;  2MD0 A;  4A5M A;  1JUP A;  1GVJ A;  4B3X A;  4AVP A;  3JTG A;  1MBK A;  3SDG A;  1IV6 A;  1O3T A;  1FY7 A;  2Z16 A;  3LSR A;  2I5U A;  2L54 A;  2CUF A;  4B47 A;  3S2D J;  3BZC A;  4CZC A;  3WU2 C;  4RAF A;  4WXD A;  2ZC2 A;  2DT5 A;  4LK1 F;  2A61 A;  1MBJ A;  3GXO A;  1HW5 A;  4B09 A;  4DW6 A;  2VBZ A;  2LSO A;  2L02 A;  2X6Y A;  4NBQ A;  4UB8 C;  1RUO A;  1DPR A;  3H35 A;  1O57 A;  3Q9S A;  2EZL A;  3S32 A;  4HX8 A;  3FX3 A;  2LRD A;  3NAU A;  1ZR4 A;  1YIT I;  4UXN A;  2GLO A;  3CD6 I;  1BA5 A;  2DA6 A;  3I4M J;  1I39 A;  1ZRF A;  1JGG A;  5JLX A;  5HOO A;  1QNT A;  2NVT J;  1VQ6 I;  2HXI A;  3JRD A;  1JKQ C;  1JE8 A;  2VQL A;  3CUQ C;  3R60 A;  3S2W A;  1JHH A;  5E3L A;  5F1J A;  4MIM A;  5LGN A;  3KP6 A;  2G7U A;  3PJR A;  5ERI A;  2OTJ I;  1BIA A;  2YS9 A;  4IEJ A;  2XAF A;  3LA2 A;  4BHB A;  1R5H A;  1XDS A;  1ZG1 A;  2O61 A;  1JT0 A;  4UNO A;  3TQN A;  1YLF A;  3QPH A;  3FIS A;  1ZLK A;  3JAM K;  4KIS A;  2P6T A;  3I0T A;  4IOC F;  3DF8 A;  3T1B A;  1U78 A;  3B6A A;  3ABM H;  2COB A;  5J8C A;  1TT0 A;  3BTI A;  2X6O A;  2EH3 A;  1N77 A;  5E79 C;  2JA5 J;  4FQG A;  2EA2 A;  2UUZ A;  3OYB A;  3PFI A;  1FIA A;  1ETV A;  5HS9 A;  5K7F A;  1VQO I;  1WH5 A;  2A68 F;  3DWL E;  3IUO A;  4D7M A;  3RYP A;  2QYO A;  4A3B J;  5DM7 F;  3FBI B;  2L9N A;  3TGN A;  1B4A A;  5E17 F;  2DJI A;  2HQR A;  4N4N B;  2XF7 A;  5C3E J;  2BY2 A;  1BI2 A;  3TW7 A;  3HM5 A;  3HRM A;  2NVQ J;  1Z77 A;  2ISY A;  3I56 I;  2Y2Z A;  3CP2 A;  1ETO A;  1WVR A;  3ZMT A;  1SFU A;  2KT0 A;  5DEQ A;  4BAY A;  1MBE A;  1U5T C;  3H1C A;  3GWZ A;  5FD5 A;  2R7O A;  1GHC A;  5AIP A;  2XAQ A;  3JSO A;  3ZQH A;  2M8G X;  3B6C A;  3OYD A;  2V4J C;  3RZO J;  2JQ7 A;  1DP7 P;  2WB1 N;  1V4R A;  2OCC H;  1O3Q A;  4A3M J;  2EJR A;  2M7B A;  1XCV A;  4C2T A;  3U1K A;  3TO9 A;  3GFI A;  2B7E A;  4DGW B;  3GME A;  2O7O A;  3F72 A;  3RQ4 A;  3F8M A;  2AQE A;  4N9H A;  3HXL A;  2HDC A;  2A3S A;  3IH3 A;  2L9S A;  3C18 A;  5IT3 A;  3OMY A;  2KPM A;  3KEQ A;  3KYC B;  4MLO A;  3JR9 A;  3AG2 H;  3I53 A;  2GIV A;  4BXU A;  1R36 A;  2L9R A;  1PJR A;  1LJ9 A;  4AIJ A;  2PBI A;  3HRT A;  3OOU A;  3S1Q J;  5L3B A;  2BXZ A;  2LKS A;  1ZQ3 P;  5EEH A;  5KK1 A;  3G3Z A;  1MJA A;  3GLX A;  3MCZ A;  1KA8 A;  2NVU B;  2OD5 A;  4BGD A;  1W0T A;  3SXY A;  5IOY A;  2XC7 A;  2EBI A;  3NWS A;  2RDP A;  3SQN A;  2Z99 A;  1U2W A;  4CCJ A;  1FLI A;  2JN6 A;  5CVR A;  1RRJ A;  2YX4 A;  1YHQ I;  4N9I A;  4F3Q A;  4OMY A;  3ZMU A;  1H8A C;  4AIK A;  4ANJ A;  1VZ0 A;  3QAH A;  3CES A;  3CCV I;  1OYI A;  1T0F A;  1H9G A;  1X1A A;  3RKX A;  3VYR B;  3CUQ B;  3ROU A;  4G6D A;  3L09 A;  1RR7 A;  3FMS A;  4IRG A;  1LDJ A;  2JSP A;  4D1Q A;  4XNF A;  3JRE A;  1Y8R B;  1IXS B;  5JLW A;  1N75 A;  3GLL A;  2BOL A;  3NEU A;  2IT0 A;  1K61 A;  1W5S A;  3CC4 I;  4A3L J;  2KKO A;  3K4L A;  3LWF A;  2CO5 A;  5D5U B;  5FRM A;  4WK8 F;  1R9T J;  1K83 J;  1TQP A;  1FOW A;  2YU3 A;  4CHU A;  2DFF A;  4GCV A;  2VE8 A;  2EIK H;  5CVU A;  4BU2 A;  3KZI C;  2GOX B;  1RC9 A;  1BW6 A;  1IRG A;  4ZYD A;  5BQT A;  4LG0 B;  3ECH A;  4CYC B;  4LLG F;  1XSD A;  1B6A A;  4NC7 A;  1XD7 A;  2DFI A;  4MO7 A;  3JRH A;  1QVT A;  2NS7 A;  3HOY J;  2OPT A;  3EUH A;  4IHS A;  3RKQ A;  4B1R A;  3DTK A;  5JHU A;  3CCQ I;  1DGR M;  5HNH A;  2R5Y A;  1A35 A;  4Q48 A;  4RMN A;  5FRN A;  3QOE A;  3B73 A;  2PLY A;  1SFO J;  1S7E A;  4NQW A;  2VBY A;  3CCE I;  1U6G A;  3GBG A;  4JK1 X;  3C2B A;  1JTY A;  1OYW A;  2QQB A;  1W5C C;  1WSU A;  2BE5 F;  2KJB A;  3MQ0 A;  2F5D A;  1LB2 A;  2CU7 A;  2G7H A;  2R0Q C;  2WB1 A;  1ULY A;  2E2J J;  1FBU A;  2WAD A;  1R71 A;  5CVV A;  3I59 B;  4F91 B;  4UVB A;  3G71 I;  3WTS C;  1P4W A;  3G2B A;  4KIB A;  1QBJ A;  4RB3 C;  1U5T B;  2GQQ A;  1K4T A;  1AU7 A;  2P5K A;  3ABU A;  1Y0U A;  3WE3 A;  3BJA A;  3Q9V A;  2X6X A;  2DK5 A;  1D1A A;  2HKX A;  2LY2 A;  1IRZ A;  3WTU C;  5B66 C;  5LEJ A;  2FQ4 A;  3E1S A;  2DI3 A;  2EZK A;  1XMK A;  3K2Z A;  1LFB A;  3CLO A;  1TNS A;  5KAF C;  2W84 A;  2DW4 A;  1TL8 A;  3ZMZ A;  4EEF G;  1KU2 A;  2M0M A;  4BKX A;  3E0J B;  1F5T A;  2M30 A;  3ZMS A;  3K2A A;  4KN4 X;  2FOK A;  4PDK A;  2LLK A;  4ESJ A;  2D45 A;  1D0X A;  1RET A;  2VC1 A;  4MTE A;  3J81 Z;  3E6B A;  1ENH A;  3WTV C;  3K1M A;  1LNW A;  5TIS C;  5C4J J;  3DBL B;  5D6F A;  3G4S I;  4M71 A;  5LD2 C;  1K6Y A;  3LFK A;  3S1R J;  1RR8 C;  4EGZ A;  3OV8 A;  2FMY A;  2G0E A;  4C3H J;  3BG3 A;  2F6C A;  3BCA A;  2LC2 A;  4QPO A;  2QA4 I;  1YJ9 I;  2K9M A;  5IOZ A;  3OYN A;  3TW6 A;  3E6D A;  4ZYH A;  2DA7 A;  2HFH A;  1QU3 A;  4ZYG A;  1FWZ A;  4LGW A;  3K4N A;  2O9L A;  4RS8 A;  3RIR A;  3BR2 A;  5CVJ A;  4XQF A;  3KFW X;  2R7D A;  3PQK A;  3OY9 A;  1X3Z B;  3ONQ A;  2XIG A;  3GFJ A;  4ZTJ A;  1PUF B;  3FMR A;  4F93 B;  4HLY A;  3G1L A;  4Y33 A;  3R61 A;  1FPQ A;  4OMZ A;  3K4J A;  2A6H F;  4XM3 A;  2DT7 B;  5M3F J;  1KU7 A;  5F0F A;  3AL0 B;  3TMO A;  1POG A;  1ODD A;  2WAE A;  3WTW C;  3GTG J;  1T56 A;  2JA8 J;  1LE8 B;  1P2F A;  1IV8 A;  2D5V A;  3W6K B;  2IGO A;  1YW9 A;  4KIG A;  5DCM B;  2L5Q A;  2ECC A;  2H6B A;  2IGM A;  2R7W A;  1MBH A;  3BZK A;  3J7Y J;  2MSY A;  4IRH A;  3OYI A;  1I1G A;  1G3T A;  3Q0V A;  5EEG A;  3SZG A;  1ZN2 A;  3V7C A;  2VPL A;  4OU0 A;  4II2 A;  2WY8 Q;  3OYA A;  1ZAO A;  2AHQ A;  3CO6 C;  3FKI J;  2W7N A;  1XC5 A;  4RM3 A;  5IYB J;  4ZH4 F;  2ESH A;  4CA0 A;  2V79 A;  3J80 K;  2EB7 A;  1QHH D;  4G6T B;  4PUS A;  3I4P A;  4B3A A;  1OYY A;  1GLN A;  3EQL F;  2E36 A;  3QPL A;  2IRF G;  3VWB A;  3I5U A;  1TWH J;  1CF7 B;  4C2U A;  4AYB N;  4XL9 A;  2X51 A;  2OBP A;  2IEK A;  3K4C A;  3P7N A;  3K4K A;  1IJW C;  4A3J J;  3CF2 A;  4H4K C;  3DBR B;  1TP4 A;  2RRE A;  2CUJ A;  2EFP A;  1XG1 A;  1BL0 A;  1MNE A;  3GTP J;  2MLK A;  4BJ6 C;  2GBY A;  3QPS A;  5DD8 A;  5LHG A;  2DA4 A;  2H1K A;  2XVC A;  2FF4 A;  2R7T A;  3R0J A;  4ZYA A;  4A3I J;  3W6J B;  3IWF A;  1J59 A;  3S2H J;  2LDU A;  3FBN B;  2JJ7 A;  2DDA A;  5ICC A;  4EJT A;  2EIJ H;  3P5J A;  2JA6 J;  1G4D A;  2R7V A;  1NG7 A;  1X1C A;  3CMM A;  5F0C A;  4C3I J;  2R5Z A;  4L9J A;  3CJQ B;  1F9N A;  3CCL I;  3DP7 A;  5F1R A;  2Q2E B;  4FAS D;  2ZO4 A;  2O03 A;  4YIF A;  2Z3Y A;  1J09 A;  1D0Y A;  5DYM A;  3QPT A;  4R79 A;  2DPD A;  4M3G A;  1MBF A;  3DCF A; 
#chains in the Genus database with same CATH homology
 1LDK B;  1YX5 A;  2KZV A;  4CCL A;  2M3A A;  4XKV A;  3OYJ A;  3C2G A;  2JUG A;  3HUG B;  2KLO A;  2K9L A;  4XKW A;  1WJF A;  4XKB A;  2E1M B;  3QYB A;  1V5G A;  3HPH A;  2WBM A;  1WJA A;  1WJE A;  4RLF A;  3K6G A;  1E0E A;  2A5W A;  3PSI A;  3QYE A;  3TBI A;  2VQG A;  4NC8 A;  4XOR A;  3V42 A;  4E7S A;  2E5Z A;  3FDY A;  1D0Z A;  3OR2 C;  4PK4 A;  1X19 A;  2L7K A;  4IQJ A;  4RM2 A;  4PJJ A;  1W36 C;  4LIU A;  3SEZ A;  2CUZ A;  2XAU A;  1T0F C;  1D1B A;  2W82 A;  3PNV A;  4XLA A;  1MMG A;  4GRI A;  4NUB A;  3W2A A;  3KX2 A;  2AQF A;  3DU6 A;  3EUA A;  3QOD A;  1OR7 C;  3MKZ A;  2HVS A;  2KQR A;  3A2K A;  3OYG A;  2X6W A;  3PSF A;  2CV1 A;  4Y3O A;  4HST A;  3D5S C;  3N05 A;  2MD0 A;  2V9K A;  2FUG 2;  4B3X A;  3SEQ A;  2XSJ C;  2UV1 A;  3LSI A;  1Z3X A;  2VQH A;  2Z16 A;  2V1N A;  4B47 A;  3A1Y A;  4CZC A;  3S3N A;  2CW7 A;  3EUH C;  3DQV C;  5HLT A;  1R6R A;  2IS2 A;  3LSK A;  3IP4 B;  3FKJ A;  2R7U A;  2X6Y A;  4XN0 A;  4F52 A;  5HNF A;  3K4B A;  3H35 A;  3IAS 2;  3BCB A;  4AVZ A;  2HVR A;  5CQG A;  1G8X A;  1Y6I A;  2WA0 A;  3S32 A;  2W1O A;  4J00 A;  2LRD A;  4HNU A;  3HOS A;  2VXD A;  2LOO A;  4YEJ A;  3W3C A;  4BAC A;  4PFO A;  3OR1 C;  3TL4 X;  2HPI A;  5FRO A;  1DP3 A;  2F5V A;  2VJ4 A;  3VSL A;  5HOO A;  2W4S A;  2DT6 A;  3AL0 C;  2LG4 A;  1BR1 A;  3DTI A;  2VQL A;  3FHN A;  3OS0 A;  3S93 A;  1PYV A;  4E7I A;  4PSW A;  4PSX A;  3PJR A;  3LL7 A;  3C2H A;  3HL2 A;  1WFX A;  3D5L A;  4E4H A;  4KIS A;  2OC6 A;  2VQC A;  3PL8 A;  3CJR B;  2WY7 Q;  3U21 A;  1SFK A;  3RSN A;  1SAU A;  3AFH A;  3HOT A;  3K70 C;  4BDY A;  2ZSH B;  1UG0 A;  1TT0 A;  1N77 A;  4BQQ A;  4HSR A;  4XLH A;  4DIQ A;  3KYL A;  2KRH A;  3DKX A;  4II3 A;  4NNJ A;  2UUZ A;  3OYB A;  3IUO A;  4XLC A;  3DWL E;  4CUG A;  2BVM A;  2VIX A;  3A4C A;  2ZXI A;  4DJA A;  2Z2S B;  3FBI B;  2QKL B;  2L9N A;  3OL3 A;  2CFO A;  2IS1 A;  2CMP A;  2DJI A;  2LRE A;  4N4N B;  2XF7 A;  3VYU B;  1DQU A;  4E7K A;  4BEH B;  1MW7 A;  4OAZ A;  5TGT A;  2KRC A;  4PJM A;  3CZ6 A;  2V7F A;  1BOB A;  3QYF A;  4YEL A;  3CP2 A;  3VYS B;  1WJC A;  3ZQQ A;  2NOJ B;  3H5N A;  3D5R C;  2HDW A;  2KMU A;  1V5E A;  2R7O A;  3HKZ A;  2LBF B;  3OYD A;  1KON A;  2F4I A;  2IXS A;  2V4J C;  2ZXH A;  2R7X A;  2HZD A;  2RNG A;  2VJJ A;  2HU9 A;  2M7B A;  4C2T A;  5KHD A;  1Z3Y A;  4DGW B;  3UNG C;  4PJN A;  3ZRG A;  5CPR B;  2LYC A;  3RQ4 A;  5LFA A;  4Y4R A;  3BG7 A;  3HG9 A;  2AQE A;  3HXL A;  3K10 A;  3OYH A;  2L9S A;  3L2V A;  4XOT A;  2R7R A;  2Q1Z B;  3OMY A;  2VAS A;  2KPM A;  1DGW Y;  2KP6 A;  4MLO A;  1ERD A;  2Y0S A;  4B43 A;  3L2W A;  1PJR A;  2HVQ A;  4IZZ A;  2UWM A;  2CW8 A;  3OOU A;  4XLF A;  3LSM A;  2PJR B;  3W2W A;  1MMD A;  4XMY A;  4ZDO A;  4BEH A;  3MD2 A;  4BGD A;  2KL4 A;  1NG6 A;  2CV2 A;  4NQW B;  2XC7 A;  4HEA 2;  2R7Q A;  3OL4 A;  3NWS A;  1BR4 A;  2RQQ A;  2VJI A;  4CCJ A;  2JVH A;  3EPZ A;  4BS9 A;  1IRX A;  3IAM 2;  4OWR B;  2X1D A;  3AKZ A;  4E6K G;  5JHF A;  3ZGK A;  4F3Q A;  4B48 A;  3H5A A;  4ANJ A;  1VZ0 A;  2E60 A;  2LBF A;  3CES A;  3OYM A;  4BE0 A;  2X1E A;  1X1A A;  2V26 A;  3VYR B;  4BQN A;  4BL0 B;  4U87 A;  3OS1 A;  4D1Q A;  2JSP A;  4XNF A;  2WAQ A;  1N75 A;  4ITV A;  4OAY A;  2BOL A;  4CCK A;  2E5N A;  2KDO A;  4CH7 A;  3K4L A;  4CCN A;  4LIV A;  1U0J A;  3SYT A;  4DBQ A;  3NWT A;  3L2U A;  2CS3 A;  5FRM A;  2O5R A;  5KCM A;  4KJZ A;  4P1W A;  4BU2 A;  2GOX B;  3DLA A;  4DBR A;  2DOA A;  2A6T A;  3DPU A;  1G59 A;  3RPU D;  4NC7 A;  3OYF A;  2IS4 A;  1Y56 A;  4XN3 A;  2DCE A;  2VKH A;  4HG2 A;  4E7L A;  3S3M A;  4DOZ A;  4XKC A;  3DTK A;  1DGR M;  3ZR8 X;  1FMW A;  2CH0 A;  5HNH A;  4FET A;  2PJR A;  5FRN A;  3QOE A;  4B44 A;  4PFP A;  1MND A;  2X85 A;  3ZCO A;  4F55 A;  2CV0 A;  3S8P A;  2VLA A;  1EA3 A;  3GBG A;  4LIT A;  4LG3 A;  4RLQ A;  4BQO A;  4HRI A;  1UEL B;  1WJ5 A;  3LSG A;  4CCM A;  2VL8 A;  2WB1 A;  2WAD A;  3DKY A;  4BJ5 C;  1W36 D;  2Z1D A;  4F91 B;  2R4G A;  2GOM A;  3G2B A;  4N4O B;  1LKX A;  3PNY A;  2BVL A;  4IQ4 A;  4ZJZ A;  2X6X A;  3CP8 A;  3HC7 A;  1D1A A;  2LY2 A;  3OYE A;  2IGK A;  3E1S A;  1P9Q C;  3I3L A;  3DPL C;  2M4K A;  3MKW B;  3ZXS A;  4PJL A;  2MFZ A;  3VYT B;  4XR6 A;  2M0M A;  3E0J B;  2JVG A;  2QKM B;  4ZC3 A;  3DU5 A;  2I8D A;  1T95 A;  3RTR A;  1LVK A;  4BDZ A;  1OLT A;  2E1M C;  1D0X A;  2V6E A;  4IX7 A;  2WAF A;  2L2O A;  3K4M A;  2DXI A;  5HVQ C;  2MAB A;  1AA7 A;  5LD2 C;  1ZEL A;  1K6Y A;  4KT6 A;  4F92 B;  1Z7L A;  2OV7 A;  4QPQ A;  2IS6 A;  3BC8 A;  2F6C A;  3BCA A;  3PNT A;  4AU7 A;  4XON A;  2LC2 A;  4QPO A;  4YRV A;  4JOM A;  2VXZ A;  2M7A A;  2R7S A;  2K9M A;  2LH9 A;  1QHG A;  3BG6 A;  3OYN A;  1LFP A;  3H9G A;  4BXF A;  4P5O A;  1UAA A;  1QU3 A;  1X4O A;  5KNL A;  3K4N A;  1WJB A;  4C9Y A;  4C30 A;  4XQF A;  3LFU A;  4J01 A;  3OY9 A;  1HA8 A;  4BUP A;  2ZSI B;  3ONQ A;  4ZTJ A;  4ZDP A;  2HPM A;  2M4G A;  4F93 B;  4Y33 A;  2LY1 A;  3W2V A;  2HQA A;  4E7J A;  1FMV A;  3K4J A;  4XM3 A;  4IKF A;  3PFY A;  2MC4 A;  4KIT B;  1N78 A;  2XDV A;  2DT7 B;  3KEY A;  3OWT A;  2X1C A;  3AL0 B;  3TMO A;  2WAE A;  3L2R A;  4AYB A;  3MMY B;  4U7B A;  3H5R A;  2IGO A;  4ZTF A;  2JA2 A;  1MMN A;  4JQF A;  3VDX A;  3HPG A;  2VJ5 A;  2L5Q A;  2IGM A;  2R7W A;  3SDB A;  3K70 D;  1BR2 A;  2ZFU A;  2ELJ A;  3LSH A;  3UR3 C;  1WJD A;  4CSW A;  2BW3 B;  3OYI A;  5CQE A;  1TZL A;  3M1C A;  2XF6 A;  3SZG A;  3OYK A;  2VPL A;  2VKD A;  2WY8 Q;  3M8J A;  4II2 A;  3DPT A;  3OYA A;  3OYC A;  4X0G A;  2W7N A;  3J7A Y;  3BLY A;  4RM3 A;  3I9V 2;  3OS2 A;  4HPQ A;  4CA0 A;  2OUM A;  4ZDL A;  4D9J A;  4E7H A;  1V5F A;  3F9K A;  1QHH D;  4G6T B;  4PUS A;  2K5C A;  1GLN A;  3VWB A;  4C2U A;  4BJT A;  1MMA A;  4E7Z A;  1X1D A;  4XL9 A;  2X51 A;  3K4C A;  3DTE A;  1X4P A;  3K4K A;  1X1B A;  4XOP A;  3CF2 A;  1Z21 A;  1YX3 A;  4H4K C;  3H9Q A;  1JI8 A;  2RRE A;  2CUJ A;  4BE2 A;  4EAT A;  2IGN A;  2HNH A;  1S9H A;  1MNE A;  2W00 A;  3VSK A;  4BJ6 C;  2XF5 A;  2P0W A;  3LMM A;  4HNT A;  3RCO A;  2R7T A;  5CKT A;  4ZYA A;  2PMZ A;  3H0D A;  3FBN B;  2KHM A;  3OYL A;  2MYS A;  2R7V A;  1NG7 A;  3L2Q A;  1X1C A;  1D1C A;  3CMM A;  3H9J A;  2K3P A;  1YE9 A;  3CJQ B;  3OIP A;  2Q2E B;  2VB6 A;  3DEE A;  3OIQ A;  4FAS D;  4XLE A;  3EUK L;  1J09 A;  4BE1 A;  1D0Y A;  4CCO A;  3MKY B;  4R79 A;  2BW3 A;  4RMN A;  3S3O A;  3PUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...