2ESHA

Crystal structure of conserved protein of unknown function tm0937- a potential transcriptional factor
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
114
structure length
114
Chain Sequence
RGGRGFRGWWLASTILLLVAEKPSHGYELAERLAEFGIEIPGIGHMGNIYRVLADLEESGFLSTEWDTTVSPPRKIYRITPQGKLYLREILRSLEDMKRRIETLEERIKRVLQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Conserved Hypothetical Protein TM0937
rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein TM0937
total genus 35
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2005-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2eshA00
1UHWA 2ZO4A 1F1ZA 2H09A 1C0WA 4ESFA 4LLLA 3FZVA 3BPXA 3VOEA 4RB1A 4ZYGA 1TQIA 1DPRA 3QPTA 5E1WA 2EV0A 2PG4A 1IN7A 4B8XA 2O3FA 5CVUA 2EFNA 2FBIA 1ON1A 5FO5A 4CZZA 1QZYA 4PGHA 1J0RA 1MJAA 2RNJA 2DAOA 3WG9A 3HHHA 3RI4A 2L4AA 1TW2A 4KICA 4MHGA 4IXAA 2E1NA 4GYIA 1YFHA 3QU3A 4U7DA 1ZYRF 5FFXA 1LQ1A 4L18B 2DO7A 1OYWA 4Z2YA 3I53A 3REOA 4K2EA 3WTSC 3BY6A 4UVBA 2KIFA 1WSUA 3GFIA 4OINF 1JHFA 3T8TA 3MAJA 2FE3A 3R6SA 4IRIA 1FP2A 3BJOA 4IF4A 1S7AA 3WTWC 3ZMUA 3KCCA 3RIRA 3FMQA 2X4HA 1XCBA 5K5RA 2L02A 4FX4A 3LSTA 3ELKA 5E8GA 4S05A 3DF8A 1D8JA 2MA3A 2XROA 1O3TA 4OIPF 3CUQC 4G9YA 1PUEE 3SZTA 4EVIA 1U5TA 2DT5A 4MQ9F 3MEXA 3K69A 5CJ9A 1V3FA 2OAZA 3TGNA 1JE8A 2EA2A 1FZPB 3LA2A 1HKQA 3ECHA 1GHCA 1KU3A 1J59A 2TDXA 1RI7A 3I64A 1FT9A 2M30A 3SFZA 2RVCA 1T2KA 4M6XA 2HEOA 2F5EA 2QENA 1Q1HA 3GFJA 3DP7A 2O61A 2OZUA 3NQOA 4OIRF 4RS8A 1KGSA 2PBIA 1HW1A 2DBBA 3IWFA 2K4BA 1R1VA 3I5UA 1UFMA 2IW5A 3RKWA 1PP8F 1MD0A 2QM3A 5LHIA 3DV8A 1BN5A 4RGRA 2V79A 3FX3A 5JFRA 1DP7P 3E5XA 3EDPA 1B9MA 2P6TA 2UZKA 2JSCA 2QQAA 3QAHA 1IXRC 2ELHA 3LQQA 2PN6A 5F64A 2FSWA 3SHFA 3GZ6A 4HF2A 3CUQA 1R36A 1HSTA 1UB9A 5ICEA 3QRFF 3WGHA 3TKYA 5J6XA 2FQ3A 4YFNF 1R00A 2VXZA 1EH7A 1I1GA 2FA5A 1BIAA 5LHHA 2WTEA 5TJJA 2C6YA 4EM2A 2A69F 3E6MA 4CICA 1P4AA 1ZARA 3BPVA 5D8KB 4UV8A 5LHGA 5E1XA 4M9SA 3F8BA 2R7FA 1YTYA 3M9AA 4HA8A 2A07F 1ZG1A 2OBPA 2LF7A 2E1CA 3CO7C 4LK1F 3GX4X 5BPIA 2IA1A 4KIBA 3HYIA 2RN7A 1W7PB 1I1SA 3BZ6A 1KQ9A 1JHHA 2R3SA 3MCZA 5E20A 5HOOA 3RDIA 3CDHA 4BHPA 1S29A 2NYXA 5LGNA 4G6DA 4P55A 2VODA 4L0ZB 4ETSA 4FT8A 4CYDA 2K86A 3I59A 2K7LA 1YIOA 3KLNA 4O6JA 4HOBA 2RQPA 2BE5F 3K2ZA 2KJBA 2W84A 3K1PA 1XMKA 3K1MA 2IVMA 4HZFA 4IPAA 2RV8A 2DW4A 1HW2A 1J2XA 1ZLKA 3PFIA 4AD9A 2HZTA 1W7PD 2NS0A 3F3XA 4YG2F 2DU9A 1UHMA 2ISZA 1B6AA 4Q48A 5D6EA 2KKOA 3ABTA 3OOPA 2B0LA 1K78A 3GF2A 3KP3A 4A0XA 2EV5A 3GWZA 5H6RA 2GXGA 1TW3A 2MD5A 3TQNA 1R1TA 5A2QK 3FWEA 5D5UB 5L3CA 3H92A 1BC8C 2QBYA 3DXJF 5KK1A 1XDSA 1Z05A 4EJOA 2Z5UA 1U3EM 4WWCA 2ISYA 1CGPA 4WK8F 2OA4A 2VONA 2VBWA 2P5LC 2XUBA 2ESHA 2CFXA 3T1BA 3I0TA 1XD7A 1SD5A 2DK8A 4L5JA 3ZN1A 2DK5A 2V1UA 4LLGF 4U88A 5ICFA 1Z6TA 2XAFA 3EYYA 4B09A 1XN7A 3H3ZA 3RYRA 4HX7A 4HX8A 3P9CA 4R1HA 2O8XA 3TO6A 4JQFA 3LQRA 2OQRA 4EV0A 1OYIA 4Y15A 1U5TC 5L3GA 1LJ9A 4OIQF 3JSPA 3QPHA 2HFHA 4E70A 1IAWA 3TOAA 2RDPA 3WE3A 3I71A 4KFCA 3IL2A 4HBLA 4EGZA 2GA2A 4FX0A 4EMSA 4HF0A 4OOIA 2IP2A 5E8IA 1FP1D 1IW7F 5CYVA 5E18F 2EFWA 4HW0A 4BH9A 5DCMB 2F5CA 3KZYA 4GCVA 4ENJA 1ULYA 4OIOF 1RNLA 3Q9SA 5EEHA 4A6EA 4A5MA 4AWXB 1SFUA 4EJTA 3H3UA 2QYOA 5JR3A 3FHZA 2EA4A 1SD7A 2ZNYA 2VC0A 4TV7A 2LF8A 3GFLA 3FMSA 1QNTA 2W25A 1XGMA 5D5XB 3ZP5A 2ZFWA 2FBHA 3SXYA 1XDUA 3W6JB 2ZMEA 1AWCA 2PQ8A 4MTEA 4HV5A 1IN5A 4WXCA 2O03A 3I4PA 2XGXA 1S6LA 3SZPA 4HF1A 2XAHA 1ZH5A 2XKOA 1KYZA 3ULQB 3CTAA 4P9UA 4XSXF 3F72A 3WGGA 1IXCA 3PQJA 5J8CA 3ZMDA 5D5WB 1U5TB 2OQGA 4EM0B 3L9FA 1HKTA 4PZJA 3TOBA 1ODDA 5BPDA 1USSA 4L9TA 4U0VA 3WODF 4Q47A 2ZBKA 4UVCA 2ACJA 3DFGA 2YX7A 3L2CA 2NRAC 3GZ5A 4ENMA 1LNWA 4LB6B 4EQQA 4L9JA 5J8FA 2XHKA 4N9IA 4KNYA 3G3ZA 1TBXA 1FBQA 3I58A 1XSDA 3FXQA 4EM1A 2HDCA 3IC7A 1TTYA 2HQNA 4U0YA 2QLZA 1TLHB 5FLXZ 5DDGA 3HSRA 3ABUA 2GAUA 1ZG3A 3RTRA 4RB0A 2VT2A 4I0AA 4KDPA 5HVQC 3WU0A 2UXXA 3L00A 3FM5A 4RAZA 2FXAA 3EYIA 1FNNA 1WKMA 4HQMA 3LAPA 4NQWA 1Z91A 5K5OA 1STZA 1SD4A 2O6GE 4RB2C 3HOSA 1P4WA 4F7ZA 1QZZA 1LVAA 3HTUA 3PQKA 3C18A 3V7RA 4OMZA 2K27A 4AIKA 5FD5A 1FSHA 2Y0MA 1Y0UA 3HRUA 5FD6A 3WE2A 1SD6A 2LKPA 4XBFA 2YPRA 3WU1B 1XSVA 5A2QZ 5AIQA 3LFKA 1T38A 4EJUA 2XVCA 3F22A 4ZYEA 3HSFA 2RKHA 2MLKA 4CDGA 3ZQ7A 5JVTA 3HSEA 2BV6A 5D4RA 3F8FA 3M8EA 3F8CA 3HHGA 2QZ8A 2PJPA 1ONVA 4HAMA 4M72A 2R7DA 3JAMK 1E17A 2HR3A 5DD4A 3BDDA 2GXBA 1BC7C 1WRJA 4Q4ZF 4WF2A 3GLXA 1REPC 5H6QA 1IF1A 1ZRDA 2IPQX 1YYVA 4P96A 4MNUA 4RB3C 2MH2A 1I5ZA 3HRTA 1ZG5A 1R5HA 1HBXG 1HXDA 2OZ6A 3MQ0A 3J80Z 3G73A 1G3TA 4HX4A 4N0BA 2A61A 4UUVA 1UCRA 1JXSA 1GXQA 3QU6A 4ON0A 5EEGA 1KU7A 2VT3A 2FMLA 2PFBA 1MDMB 5CVIA 1IN4A 4EJWA 3HUGA 2RC4A 4QWQA 3R4KA 1D5VA 3DPLC 3R61A 2EK5A 2F2EA 1G3SA 2L54A 5HDKA 1R23A 1SFEA 2NAZA 3N4MA 4BHCA 3R60A 1IN6A 4PCQA 5ILUA 4AIJA 1IN8A 3MZYA 2EB7A 3M8FA 4IHSA 4AIHA 1TNSA 2A68F 3E6CC 2F5FA 5JI6A 3ROUA 3V4GA 5HS8A 3BJ6A 4IHTA 3GFMA 3WTTC 1HW5A 3GO5A 5DUIA 4D0PA 1KA8A 4L9VA 5AONA 3T5XA 3DPTA 5HDGA 1IUYA 2Y48A 1MJBA 4A2UA 1MZBA 3R0JA 4CXFA 4KMUX 1LB2A 2VBXA 3J7AO 2L4MA 4MEXF 5L3EA 3QP5A 2DPUA 5CLSA 5LEKA 3COAC 3F6OA 2FEZA 4EJVA 2MLGA 4ENNA 4LG0A 2XASA 3IKTA 1OR7A 3DKWA 1YW7A 2L3DA 4BYYA 4MEYF 5LGUA 3CUQB 4KIGA 2BYVE 2K02A 5HLIA 5DEQA 1K78B 4NHJA 3TO7A 2EWNA 3BROA 4XLNF 1TQMA 4LGWA 4H0EA 4AVPA 4M74A 1CF7B 2D1HA 2MC3A 2JZYA 2IT0A 1AOYA 1PP7U 2D2WA 4A0ZA 1BJAA 1T6SA 5LLQA 2IRFG 3KP4A 2FBKA 2D1VA 1ZLJA 1BI3A 3MZHA 1O3SA 5DCFA 4G7ZF 5IT9Z 2YSRA 5K5QA 2STWA 2P7VB 4LK0F 2WC2A 3TDZC 5ED4A 2Z3YA 1IXSB 1FC3A 1O7FA 3W6KB 2JT1A 2V1DA 2QQBA 2BGCA 4ENKA 3DQVC 3U2RA 5DD8A 2BBYA 2ESNA 3KP6A 2LNBA 1P92A 2EFOA 4ASNA 3GVAA 5K1YA 1R22A 2IA2A 4ESJA 1SMYF 2CG4A 3HRMA 4GYGA 2XAQA 3Q9VA 2CO5A 2YR2A 3N97A 2D45A 3VB2A 4YFXF 5LEJA 4CO8A 4XLPF 4LLNA 3LWFA 1S7OA 2Q8KA 3E6BA 4ESBA 3K1NA 1RUOA 4G7OF 1D8KA 3FF5A 1QGPA 4JK1X 3WGIA 2P7CB 2FNAA 3WTUC 1MGTA 4Q5SF 3HTSB 2CSOA 3EETA 4G8XA 3E3VA 2PEXA 5HDNA 3RKYA 1K6OA 1RIOH 1OPCA 5JHUA 1O57A 2P6SA 1ZAOA 5CVJA 4KA4A 2P5VA 4M6YA 1DDNA 5L3DA 3IWZA 2FRHA 2JPBA 2FMYA 5FB2A 4R8HA 1FYLA 3EQLF 1H9TA 2QWWA 2HQRA 1T0FA 2ZCWA 4U0WA 2XRNA 3ZPLA 3F21A 3U9GA 1PDNC 2MH9A 2VBYA 3BJAA 4LB5A 1GXPA 4KT5C 3IRRA 2PMUA 1WQ2A 3JAMZ 2CGPA 5F6FA 4YFKF 2CYYA 2LDUA 3D5LA 2KRFA 4GXOA 1Z7UA 5D6FA 1FSEA 3ECOA 3T0YA 5FFZA 1XB4A 2MBFA 3JSOA 1R58A 2ZMEB 2GWRA 2X0LA 5D4SA 2CW0F 2M1BA 3ZN0A 3C3WA 2Y75A 4RGSA 3FXUA 3WTZA 4EGYA 2RGVA 3R0AA 1XSXA 2DFIA 3CUOA 1WWXA 3P7NA 1O3QA 2H6CA 4MTDA 5LGTA 4IJAA 4UHTA 4WXDA 3S2WA 1BOAA 3KE2A 2HKOA 4P5OA 3VFZA 4A5NA 5DCMA 3L7WA 4I98B 5F1RA 5TRDA 1U8RA 2ZXJA 1W5TA 3GUDA 4KN7X 4MGRA 3M7GA 4I02A 1H0MA 1FY7A 5BQTA 2XAJA 1LEBA 3MFKA 1JGSA 4L0YB 2JTVA 4ZYDA 4OU0A 4ZZDA 3CJNA 1B59A 2J5PA 2DQRA 3K9TA 2BEOA 4UNOA 5FGMA 2JPCA 3HOTA 4FHTA 2COMA 2XIGA 1YS7A 4IVNA 3ZMTA 4UXNA 2KJCA 2O0YA 3P9IA 1LDJA 1S8NA 2KIUA 1SFXA 3TDUC 2VBZA 1MDMA 4QLCU 1J7KA 1MKMA 2VC1A 3KP2A 2AXLA 2VN2A 5H20A 1TQPA 1B9NA 3ZMSA 1W4MA 3GEZA 4BQAA 4YIIA 2K4JA 4N9HA 4KUMA 1XGOA 1BM9A 4HLXA 2VOPA 1A04A 1XGNA 3VODA 1MJ9A 3RPUA 1BI2A 3NRVA 4I2OA 3C7JA 2QUFA 4M9ZA 3M1EA 5AIPA 4YIFA 5BS6A 4Y17A 3O2PE 2QBYB 2VE8A 4RGUA 4ZH4F 1YW8A 2W57A 3RYPA 2FU4A 1T39A 1SMTA 3V8JA 2HTSA 2HWVA 2L01A 3T8RA 3ZMVA 4A0YA 4BNCA 1ZRCA 5HS7A 2EFPA 5BOXA 1BI1A 3GW2A 2FOKA 4M9XA 5IT3A 2Z9OA 3DEUA 5L3FA 1NHAA 3D0SA 3VEPA 4HQEA 2OU2A 1P4XA 2V1XA 1FOKA 1TNTA 3KZZA 4R79A 1J9IA 2F5DA 3F6VA 2M5WA 5IT9K 1XMAA 2GZWA 1FBSA 5ICGA 2XKPA 2H94A 5CVRA 2DPDA 3O3KA 1FBUA 2HYFA 4LJZF 3E5UA 5ERIA 3BP8A 4BHBA 3ZMZA 4WXHA 1K7AA 3ERED 2STTA 2P5KA 4I0BA 2QVOA 1VTNC 2DTRA 1T98A 4UVAA 1HQCA 3QOPA 3SQNA 3F8NA 2A6EF 4Y13A 1R1UA 1S3JA 5DUKA 1BI0A 1YO5C 1K79A 2XAGA 2GA1A 3E6DA 2V9VA 2A3SA 3FM3A 3J81K 5HLHA 2VOOA 1RZ4A 3I59B 2A6HF 4PGGA 1FX7A 1J5YA 4XRFA 2NNYA 4P9FA 3TO9A 3FXRA 3LA7A 1ZGAA 4WCGA 2HTJA 1W7PA 3FMRA 2ADUA 2EJRA 3IRQA 1OYYA 2AS5F 1XCVA 1B1BA 1HSJA 1QBJA 1Z9CA 1FYKA 3E97A 3L09A 1D3YA 3AAFA 3OV8A 5LRRA 2PLYA 2HGCA 4HDUA 5HLGA 4L9NA 1Z1DA 2DQLA 1SAXA 3GXOA 1KQ0A 1I6XA 3C1DA 2EFQA 4KIFA 3BWGA 3KP5A 1YG2A 3F23A 1R5GA 5L3BA 2KIMA 2NNNA 2H27A 2PI0A 1ZRFA 1F4KA 4I09A 2H6BA 1U78A 3J81Z 1F5TA 2PMHA 2WWYA 3LAJA 1P6RA 1LEAA 2Z33A 4UV9A 2UWMA 4RGXA 1V4RA 4O3MA 1L3LA 4CHUA 3O6BB 3ML6A 3B73A 1YQAA 2J5OA 4G6QA 4CGZA 3CO6C 3ISPA 4LFUA 1KU9A 2ETHA 1FLIA 6PAXA 4I01A 1I27A 3CLOA 2P8TA 1YS6A 3B02A 2OD5A 2DI3A 1EH8A 1B4AA 3BOQA 1CF7A 1QPMA 5ICCA 1F9NA 2YX4A 3EUHA 1RUNA 4G7HF 3JTGA 1LDDA 5E1ZB 3P9KA 1L0OC 3V7CA 2E7XA 2G7HA 5LBQA 2W24A 1ZHFA 3V8KA 4S04A 4GO1A 1O3RA 4LD5A 1EH6A 2G9WA 5DYMA 2YU3A 1USTA 2HYGD 5DV5A 2FNPA 2HKXA 3WTXC 1QQIA 2ZNZA 2CWEA 2P4WA 2GQQA 2ZKZA 2JRTA 5BMZA 4A12A 4HYEA 1KQ8A 1J75A 4KN4X 1DPUA 4BXUA 1FWZA 2W85A 2IJLA 1GVJA 3V7SA 1EV7A 3V8LA 1H9GA 1O7LA 1ZREA 4U7BA 2EV6A 1BIBA 3KFWX 4M71A 1P2FA 3GYHX 4L5IA 4LG0B 2M45A 1X3UA 2DLLA 5HS9A 4GGGA 1E2XA 5D8LB 4OMYA 3IHUA 5ILSA 3RPQA 3KETA 1BBYA 3Q5FA 4XSZF 1ON2A 1FPQA 1QO0D 3HRSA 2FF4A 2LSOA 2UXNA 1ZGJA 4HDVA 3KEQA 3WTVC 3MWMA 2CQKA 4PDKA 2V6CA 3JW4A 3QP6A 2M87A 3IKVA 1G3YA 5CVVA 3K0LA 4KYWA 4HLYA 4A6DA 5ILVA 4NB5A 2G7UA 3JTHA 2WV0A 2HS5A 2Q2EA 3RJPA 4MQVA 2XV4S 2GIVA 1KU2A 4KMFA 2A5YB 2Z99A 1DUXC 4ZZLA 2E7WA 1FYMA 3LA3A 1HKSA 1YW9A 2ZJ2A 4BAYA 4I7HA 1YLFA 3KEOA 3NEUA 5E17F 1IRFA 1IZ1A 1XGSA 3F8MA 4ZYHA 1G6NA 1IRGA 4DNCA 1OMIA 2Q0OA 1Z6RA 3KP7A 1KYWA 1LDKB 4IRGA 4DQ2A 2VE9A 4WX9A 4RAYA 1W5SA 1G4DA 3E5QA 4G94A 3I54A 1OKRA 2QQ9A 3KLOA 4HV6A 2HOEA 1U6GA 1U2WA 4JBAA 5FLXK 3J80K 4LMYA 5LRSA 1R7JA 2M8EA 4IRHA 1WI9A 4M73A 3HIFA 3WTYC 3RKXA 4O5VA 5D5VB 1ZN2A 3U1DA 5KVRA 1G3WA 2IA0A
chains in the Genus database with same CATH superfamily
1UHWA 3UR3C 2ZO4A 1F1ZA 2H09A 1C0WA 4F55A 3X2QH 4ESFA 1OR7C 4LLLA 3FZVA 3JRCA 3BPXA 1W36D 2QEXI 1JUPA 3VOEA 3IAS2 4RB1A 4ZYGA 1TQIA 2HVSA 1DPRA 3QPTA 5E1WA 2EV0A 2PG4A 1IN7A 4B8XA 5EJCA 4J01A 1DQUA 2O3FA 2R7OA 2HVRA 2ZSIB 5CVUA 4C3HJ 2EFNA 2FBIA 1ON1A 5FO5A 4CZZA 1QZYA 4PGHA 3VSLA 1J0RA 3J7YJ 1MJAA 2RNJA 2BW3A 1X3WB 1JTYA 2DAOA 3SDGA 2V6EA 3H5AA 3H5RA 3OIQA 3WG9A 1R4MB 4OAZA 3HHHA 3AKZA 1V55H 3RI4A 1R4NB 1S7EA 2KRCA 2L4AA 1F36A 4C30A 4I6ZA 1S9HA 1TW2A 3PSFA 4KICA 4X1EA 4MHGA 4IXAA 3BTIA 2OTJI 2Z16A 1R5ID 2L9VA 2E1NA 4GYIA 3IV5A 1YFHA 3QU3A 2YS9A 3M07A 4U7DA 4B4CA 4AIDA 1JI8A 1ZYRF 5FFXA 1LQ1A 4L18B 2Y2ZA 1OYWA 2DO7A 1K83J 4Z2YA 2Y30A 3I53A 3BR6A 3L1PA 3REOA 4ANJA 4K2EA 1DP3A 3WTSC 4C9YA 5BNGA 3BY6A 3PO3J 3HKZA 3OR2C 1G8XA 4UVBA 2NVUB 2L2OA 2KIFA 1WSUA 3GFIA 4W97A 4OINF 3ONQA 1K4TA 1JHFA 2VKDA 4XICA 3T8TA 4A3CJ 3MAJA 2FE3A 3R6SA 4IRIA 1FP2A 1GUUA 3MKYB 3BJOA 3AFHA 2ZJPF 4IF4A 1S7AA 3ZMUA 3WTWC 1RPWA 3KCCA 3RIRA 2XB5A 3J7AY 1MMNA 3FMQA 3K10A 2VPRA 3K4KA 2X4HA 2KMUA 1XCBA 2LMDA 5K5RA 3S1MJ 2L02A 4FX4A 3MKZA 3LSTA 2P81A 3ELKA 1BW6A 3S1RJ 2X1DA 3BR3A 5E8GA 4S05A 3DF8A 5CQGA 5FLVA 4BACA 4DZPA 2EILH 3ERMA 1D8JA 1BR1A 2MA3A 3HDDA 1Z21A 2XROA 1O3TA 1R71A 4OIPF 4A3LJ 3CUQC 4G9YA 4IHVA 1PUEE 3SZTA 4EVIA 1U5TA 2DT5A 1YJNI 3HC7A 4MQ9F 2K9MA 5FJ8J 2E2IJ 1JJ6C 4C2UA 3MEXA 3K69A 4JX6A 5CJ9A 3Q0UA 4JX4A 1X1PA 2EPFA 1ETVA 1XG1A 4AM3A 1V3FA 2OAZA 2CW7A 3TGNA 1QPIA 2E2HJ 2MD0A 3LFUA 5M3FJ 1JE8A 2EA2A 3LSRA 1FZPB 3LA2A 3QODA 1HKQA 3ECHA 1GHCA 2V4JC 4M3BA 1X2NA 4PFOA 4S0HB 1KU3A 1Y39A 1ERDA 2R92J 2VUMJ 3A4CA 1J59A 2JA6J 2TDXA 1RI7A 4DBQA 2LG4A 3I64A 1FT9A 2M30A 4CCOA 3SFZA 2RVCA 1OISA 2VASA 3M8JA 4M6XA 1T2KA 2HEOA 2F5EA 5B3SH 3BG6A 3HOVJ 2QENA 3TBIA 1Q1HA 3GFJA 2DMTA 4XLHA 3S17J 1PUFB 3FXLA 3DP7A 2O61A 2OZUA 3NQOA 5GTIC 5FRNA 3FK6A 3KEYA 4OIRF 4RS8A 1KGSA 4BY7J 2PBIA 3JRIA 1HW1A 2DJIA 2DBBA 3W6VA 4E7KA 3IWFA 3JREA 3B6CA 2K4BA 1GDTA 1R1VA 1QRYA 4CA0A 5GAHJ 3I5UA 3VSKA 4QIWN 4E7HA 4M6VA 1UFMA 2GOXB 2IW5A 3CJRB 3RKWA 1PP8F 1MD0A 3I55I 2QM3A 4CUGA 4FASD 5LHIA 2KDZA 3DV8A 4IKFA 3E1SA 1BN5A 4ITVA 4RGRA 3ABMH 2V79A 3FX3A 3LSPA 1SVOA 3DTKA 5JFRA 1DP7P 2M8GX 3E5XA 3EDPA 1WJEA 3NAUA 1B9MA 2ICWG 2P6TA 1OFCX 2UZKA 2JSCA 3ABLH 2QQAA 1TWCJ 1QHGA 3RQ4A 3QAHA 1A35A 2HU9A 1U9NA 2BW3B 1IXRC 2ELHA 3LQQA 5IYCJ 2PN6A 5F64A 2FSWA 2LD5A 3PIOF 3SHFA 2ZXWH 1SEUA 3GZ6A 4HF2A 2HZDA 3CUQA 4C2TA 3L2QA 1R36A 2NVXJ 3BCBA 1HSTA 2IAIA 3K4JA 1UB9A 4A3EJ 3PNYA 5ICEA 3QOEA 3O8GA 3QRFF 3WGHA 1Z3XA 3TKYA 5J6XA 3S1QJ 2FQ3A 1WPKA 4YFNF 1XC5A 1FOWA 1R00A 2VXZA 3RSNA 1EH7A 1ETKA 1I1GA 3MMYB 4QTRA 1YI2I 1TWHJ 2FA5A 1YJWI 1J09A 1WJFA 4BQQA 1BIAA 3TP0A 2WTEA 5TJJA 5LHHA 4EM2A 2A69F 2M7AA 2C6YA 3E6MA 4CICA 1P4AA 3ZQIA 4NDLA 1ZARA 2ZSHB 3BPVA 2KDOA 2W00A 4BXXJ 1YOVB 5D8KB 4UV8A 3BR1A 5LHGA 4N4NB 2LYCA 5E1XA 4M9SA 1TWGJ 3NWTA 2XF7A 3ZQGA 5EDNA 5KAIC 2AQEA 4F93B 2IS4A 4AU7A 3F8BA 2R7FA 2V26A 2LY1A 4BY1J 1YTYA 2EH3A 3M9AA 3WHCA 4HA8A 2VIXA 2A07F 1ZG1A 2BHZA 2FD5A 1E0EA 2OBPA 2LF7A 2E1CA 3CJQB 3CO7C 2M7BA 3CD6I 4HSRA 1X4PA 3OYBA 4LK1F 3HGYA 5EGOB 3HB9A 3GX4X 3K4LA 5BPIA 2IA1A 4KIBA 3HYIA 1LPQA 2RN7A 1W7PB 1I1SA 3BZ6A 1KQ9A 1JHHA 2YU9J 2WBMA 2QKLB 2R3SA 3HJEA 3MCZA 2XSJC 5E20A 5J4YA 5HOOA 3RDIA 2VQGA 4BJTA 2XB0X 3CDHA 4BHPA 1S29A 2NYXA 3KIOA 5LGNA 4G6DA 4PUSA 4P55A 2VODA 4L0ZB 4ETSA 4FT8A 1A36A 2Y9YA 3AG1H 4CYDA 2M4GA 2K86A 3I59A 2K7LA 3DU6A 1YIOA 3KLNA 1H8AC 4O6JA 4HOBA 2RQPA 2E19A 5LFAA 2BE5F 1LFPA 3K2ZA 4V19K 2KJBA 4A93J 2W84A 3K1PA 3H5NA 1XMKA 3K1MA 2IVMA 1W1WE 4HZFA 3OS1A 1AU7A 2ID6A 4IPAA 2RV8A 3JRFA 2DW4A 2HOSA 3ASOH 1HW2A 1J2XA 4RAGA 1ZLKA 3PFIA 2VKVA 4AD9A 3U21A 2HZTA 1RC9A 2R7RA 1W7PD 2DA7A 4HEA2 2NS0A 3F3XA 5CKTA 4YG2F 1LFUP 2DU9A 4RLQA 2K9LA 2MC4A 2IS1A 1UHMA 2ELJA 1ZTRA 3CCJI 2ISZA 1QA6A 1B6AA 2KPMA 4Q48A 4E7SA 1OCOH 2X85A 5D6EA 2RAEA 2KKOA 1DGWY 2K40A 3ABTA 4DZJA 3OOPA 1RKTA 2B0LA 1K78A 3GF2A 2CW8A 3KP3A 1FMVA 3CMMA 4A0XA 2EV5A 2AHQA 2O8KA 3GWZA 2QKMB 1N77A 3TW6A 3GTMJ 5H6RA 4XLEA 3GTKJ 2GXGA 1TW3A 2MD5A 3TQNA 1JKPC 1R1TA 5A2QK 1H88C 3FWEA 2H8WA 5D5UB 2EZHA 4V2GA 5J3LA 2HYJA 2VKHA 5L3CA 5DS9A 3H92A 3HUGB 4BXFA 3QYBA 1BC8C 2WAQN 2EZLA 2QBYA 2FOWA 3KYCB 3DXJF 3H0GJ 3OYCA 5TISC 5KK1A 1XDSA 1Z05A 4EJOA 2Z5UA 1U3EM 4WWCA 2ISYA 2EQRA 1CGPA 2KRHA 2LH9A 3SJMA 4XR6A 4WK8F 2OA4A 3FXJA 2VONA 2VBWA 4FTHA 2P5LC 2XUBA 2ESHA 2CFXA 3T1BA 3I0TA 1XD7A 1E3HA 4Y52J 1SD5A 2DK8A 4XLCA 4L5JA 3ZN1A 2DK5A 3OY9A 2V1UA 3QYFA 3IP4B 5FKOA 4LLGF 4U88A 5ICFA 1Z6TA 2XAFA 3EYYA 3MKLA 2CV2A 4B09A 2IBDA 1XN7A 3ASNH 1K6YA 3H3ZA 2R93J 4M3GA 4HX7A 3RYRA 4HX8A 2L9NA 2BVMA 2LOOA 1TL8A 3P9CA 4R1HA 2O8XA 2CUEA 2DJNA 3TO6A 4JQFA 3LQRA 5B1BH 2Z2SB 4BQOA 2OQRA 3I3LA 4EV0A 2H1KA 1OYIA 2OJED 1VQOI 4Y15A 1ETXA 3DBHB 1U5TC 2K9SA 5L3GA 1LJ9A 2L9RA 4OIQF 2PJRB 1WH5A 3PL8A 3JSPA 1WJCA 3QPHA 3ZQFA 2X1EA 2HFHA 4E70A 1IAWA 3TOAA 2RDPA 3WE3A 3I71A 5F0CA 4KFCA 3IL2A 4HBLA 4AVZA 4EGZA 2GA2A 4FX0A 1SC7A 4EMSA 4HF0A 4OOIA 3KYLA 3TEDA 2IP2A 5E8IA 4NC8A 1FP1D 1FTTA 1IW7F 2F6CA 5CYVA 1K4SA 5E18F 1VZ0A 4M3EA 2EFWA 4RLFA 4HW0A 4BH9A 1FJLA 2HXOA 3CJTB 4IOAF 5DCMB 2OTLI 2R7VA 3TL4X 3VYTB 2F5CA 1W36C 3KZYA 4GCVA 3OYHA 4DGWB 4ENJA 1ULYA 4OIOF 1IDZA 1RNLA 4E7IA 3Q9SA 5EEHA 4XOTA 3CMAI 4YELA 2A6TA 1FMWA 2B9SA 4A6EA 4A5MA 2JUGA 4AWXB 1SFUA 1T95A 4EJTA 3BC8A 3H3UA 1VQMI 2QYOA 5JR3A 4DW6A 4IHWA 3FHZA 2EA4A 4JX5A 1SD7A 2ZNYA 3BTLA 4PJ0C 2VC0A 1SFKA 3OYKA 2V9KA 4TV7A 2HQ5A 4KITB 2LF8A 3GFLA 3FMSA 1QNTA 2W25A 2DODA 1TP4A 2MSYA 4BDYA 1M1EB 1ETOA 5J47A 3A2KA 1ZGWA 4MFDA 2M0CA 5M3MJ 1XGMA 3PIPF 2JA2A 2EZIA 5D5XB 3OYGA 4XLFA 4JP0A 3ZP5A 2ZFWA 2FBHA 2X6XA 3SXYA 1XDUA 2IXSA 3W6JB 2ZMEA 3EUAA 1AWCA 4LITA 2PQ8A 4MTEA 3DKXA 4HV5A 3MD2A 1VQ5I 1IN5A 4WXCA 2O03A 3I4PA 2A05A 3P5JA 3BG3A 1SVMA 3BG9A 1S6LA 2XGXA 4RM2A 3G4SI 4W1UA 2JSPA 4BEHA 3CDIA 2W48A 1JJ8C 3SZPA 4E7JA 2XAHA 4HF1A 1ZH5A 1YE9A 2V9PA 2F48A 3HPHA 1LVKA 1LFBA 3C2BA 4BU2A 1LKXA 1UMQA 2XKOA 1KYZA 2L5QA 3LL7A 3ULQB 5M5XJ 2XGDA 4P1WA 3CTAA 1YJ9I 4P9UA 3PO2J 1IGNA 2R7ZJ 4XSXF 3EUKL 5EF6A 2QF7A 2GIZA 3F72A 3HOWJ 3WGGA 4M3FA 3HGGA 1IXCA 4D7MA 3PQJA 2DMQA 5J8CA 3ZMDA 2R7TA 1VQNI 2NXNB 5D5WB 1U5TB 4BL0B 2OQGA 2R5YA 3S3MA 1APLC 1WH7A 4EM0B 1X1AA 3L9FA 4XKCA 1HKTA 4PZJA 2F4IA 3TOBA 1ODDA 5BPDA 1USSA 4L9TA 4U0VA 3WODF 3W2AA 4Q47A 1S72I 2ZBKA 4UVCA 1I3QJ 2ACJA 4XONA 1WJ5A 2X6WA 3DFGA 1UAAA 3VPRA 2YX7A 3L2CA 1VQ8I 3ZGKA 2NRAC 1JUMA 3OIOA 3GZ5A 4PK4A 4ENMA 3NWSA 1LNWA 4LB6B 4EQQA 1YHQI 2TCTA 3S3NA 4L9JA 5J8FA 2XHKA 4N9IA 3WHBA 3G1MA 5IOYA 4KNYA 3G3ZA 2Q1ZB 2HPIA 1TBXA 1MNMC 1FBQA 3I58A 4XKBA 1XSDA 3FXQA 4EM1A 2HDCA 3BTJA 1MMDA 4D7NA 1B72B 1D0XA 3ZOBA 3IC7A 1OCZH 1TTYA 2ID3A 2HQNA 2O7OA 4PSWA 4U0YA 1PJRA 3ZR8X 2QLZA 4BUPA 1Y8RB 3N05A 1ZK8A 1TLHB 3L2WA 5FLXZ 5DDGA 3HSRA 3ABUA 2GAUA 1ZG3A 2R7SA 3FXKA 3RTRA 4RB0A 3S93A 2VT2A 4I0AA 4XORA 4KDPA 5HVQC 2LY9A 3HZJA 2E2JJ 3WU0A 3CMYA 2UXXA 3L00A 3FM5A 4RAZA 4G12A 2FXAA 3EYIA 4II2A 3DLAA 1FNNA 1WKMA 4HQMA 3IH4A 4NQWA 3LAPA 1LE8B 3GTLJ 2LBFA 3ZCOA 2WAFA 1Z91A 3BR5A 1STZA 5K5OA 2JA8J 1SD4A 2OUMA 2O6GE 4RB2C 1EF4A 1IV8A 4C3JJ 3HOSA 1B72A 1P4WA 3MZ8A 5F27A 2NVQJ 2L7MP 4F7ZA 1QZZA 2KP6A 2EIJH 3CF2A 4BKXA 1LVAA 3HTUA 3PQKA 5IYBJ 3H9QA 3C18A 5DM6F 3V7RA 4NBQA 3PJRA 4OMZA 4MLOA 2W4SA 1N78A 2K27A 4AIKA 4B44A 3DBRB 5FD5A 1FSHA 2Y0MA 4UB6C 4JYKA 1Y0UA 1T08B 3HRUA 5FD6A 3WE2A 1SD6A 2LKPA 1D1BA 1HLVA 3ZQHA 5E3MA 2H1LA 4XBFA 5B66C 1RRJA 3BR0A 4DIQA 5F1JA 3OSFA 2YPRA 3WU1B 1XSVA 2L0KA 1Z0XA 5A2QZ 4XM3A 5AIQA 3LFKA 3A1YA 2VQLA 4II3A 2E1MB 5DTDA 1MH3A 1T38A 3AG4H 4EJUA 4BS9A 3H0DA 3OSGA 2XVCA 2BVLA 2PX9A 5HODA 3F22A 4ZYEA 3HSFA 2RKHA 2MLKA 2JJ7A 4CDGA 1H89C 3ZQ7A 5JVTA 1U8BA 2PMZA 3HSEA 3OYFA 3VYSB 3L2VA 2BV6A 4X6AJ 5D4RA 3F8FA 3M8EA 3F8CA 2LLKA 3HHGA 2QZ8A 4HPQA 2PJPA 3M1CA 1ONVA 4HAMA 3BG7A 4M72A 3H1CA 5J4VA 3S2HJ 3OWTA 4ZDOA 3HBLA 3KZIC 3S32A 2R7DA 3MN2A 3DKYA 4XK4A 3JAMK 2DFEA 1E17A 1ACIA 3KYDB 2HR3A 4RA2A 5DD4A 1SANA 3BDDA 5J1YA 2GXBA 4A3IJ 1BC7C 1WGXA 1WRJA 3K4NA 4Q4ZF 4WF2A 2VJ5A 3GLXA 1REPC 1I6HJ 4DYRA 5H6QA 1IF1A 2I8DA 1OQYA 3U1KA 2X6OA 1ZRDA 2IPQX 1V5EA 1YYVA 4P96A 4MNUA 4RB3C 2MH2A 4G6TB 1I5ZA 3HRTA 2CQQA 1ZG5A 2CH0A 1KZHA 2XC7A 3FBNB 1IJWC 1R5HA 1HBXG 1HXDA 2OZ6A 1LUJB 1HA8A 3MQ0A 3J80Z 3G73A 1G3TA 4HX4A 1A6QA 4ZDPA 4KISA 4N0BA 2A61A 3ESWB 1U0JA 4H4KC 4EATA 4UUVA 1UCRA 1JXSA 1GXQA 5KCMA 4Y7NJ 3QU6A 4ON0A 1I39A 3PNVA 5EEGA 1KU7A 2I10A 2VT3A 2FMLA 2PFBA 2VQHA 1HCRA 5F0HA 1MDMB 3SFIA 3BTCA 2GXAA 5CVIA 1IN4A 4EJWA 4UUSB 3HUGA 1XPXA 1XMXA 2ME6A 1K61A 5FROA 2RC4A 4QWQA 1PYVA 2HOTA 3R4KA 2NOGA 1D5VA 4IO9F 4AC0A 2XGCA 3DPUA 3CCSI 3DPLC 3R61A 3BR2A 3CQZJ 2EK5A 4A3FJ 2F2EA 1CQTA 1G3SA 2L54A 5HDKA 1MSEC 5GAEJ 1R23A 1SFEA 2DN0A 2NAZA 5EZHA 4FCYA 3N4MA 4BHCA 2DTZA 2VJ4A 3R60A 1IN6A 4PCQA 1Y56A 1TWFJ 3CC2I 5ILUA 1T0FC 4AIJA 4PJLA 5C3EJ 1IN8A 1GV5A 2LVSA 3MZYA 2WAQA 2EB7A 3M8FA 4A3KJ 4AIHA 4IHSA 1X1BA 1JT6A 1TNSA 2A68F 3PFYA 4HG2A 3E6CC 2F5FA 5JI6A 2Y69H 3ROUA 3K4BA 1P7JA 1ETQA 2CFOA 3V4GA 2JN6A 4QPOA 4EEFG 4XQFA 5HS8A 2JA7J 3BJ6A 4IHTA 2FQ4A 3GFMA 3BZCA 2CUJA 3WTTC 1HW5A 3GO5A 5DUIA 1BL0A 4D0PA 4HNVA 1ORKA 1KA8A 4L9VA 5F08A 5AONA 2E1OA 3T5XA 3DPTA 3CP2A 5HDGA 1IUYA 5GP9A 2Y48A 1MJBA 4A2UA 1PVEA 2M3AA 1MZBA 3R0JA 4CXFA 3OYEA 1BR4A 4KMUX 4AYBN 1LB2A 4D1QA 1VQKI 4DYCA 2VBXA 1YRNA 3J7AO 2DOFA 2L4MA 1XS9A 5FKKA 4MEXF 5L3EA 4ZC3A 4F92B 4RBOA 3QP5A 2GBYA 4ZJZA 2DPUA 4BQNA 2DDAA 2MFZA 2VI6A 5CLSA 3ABKH 3OR1C 5LEKA 5EYRA 3COAC 3F6OA 3A01A 2FEZA 3LOCA 4EJVA 1Z67A 2MLGA 4ENNA 4LG0A 2DA6A 2XASA 3LSKA 3IKTA 2JMWA 1OR7A 3S3OA 1MMAA 3DKWA 1I50J 4CH7A 2R7XA 4I99C 1YW7A 2HNHA 2L3DA 3MKWB 4GFBA 3K4MA 4BYYA 4IZZA 2KQRA 3A0HC 4MEYF 5LGUA 1R49A 5JLXA 3OYLA 1GVDA 3CUQB 4KIGA 4U87A 2BYVE 2CUZA 2K02A 2Y0SA 5HLIA 5E79C 3DLLF 2F4OB 5DEQA 1K78B 4NHJA 2XPVA 3TO7A 3SDBA 2EWNA 2FJ1A 3BROA 4XLNF 3K70D 5EG0A 1TQMA 5EGOA 4LGWA 2UV1A 2BOLA 1D0YA 4H0EA 4Y33A 4AVPA 4M74A 1CF7B 4BE0A 4B47A 1Y8QB 2BXYA 1VI0A 4HRIA 2WB1A 3FKIJ 2JVHA 2D1HA 2MC3A 2JZYA 4CCMA 2IT0A 1AOYA 1PP7U 3G71I 2D2WA 4A0ZA 3FKJA 1MBEA 1BJAA 1T6SA 2V7FA 3WG7H 5LLQA 2IRFG 3KP4A 2FBKA 4XRSA 2KT0A 3TP3A 3GTQJ 4PJJA 2DA3A 4ZDLA 4IOCF 2D1VA 1ZLJA 1BI3A 1D1CA 2CQ7A 2PMZN 3MZHA 1X19A 1O3SA 5DCFA 4G7ZF 5IT9Z 2YSRA 2HDWA 5K5QA 2XPWA 2ZJRF 2RREA 1DU0A 2K5CA 2STWA 4IHXA 2P7VB 1RR7A 4LK0F 2WC2A 3LSIA 1HDDC 3TDZC 1WHUA 3O8HA 2VKEA 5ED4A 2Z3YA 1IXSB 2M9HA 1FC3A 4NUBA 3E7LA 1O7FA 3W6KB 2JT1A 2V1DA 2QQBA 2E1MC 2BGCA 4ENKA 2WV1A 3DQVC 2ZB9A 3U2RA 1Z3YA 5IOZA 5DD8A 4CYCA 2BBYA 2ESNA 3KP6A 2LNBA 1P92A 1X1DA 2EFOA 4ASNA 3GVAA 1S5LC 1X2MA 5FKLA 5K1YA 9ANTA 3EPZA 1R22A 1N75A 2LK2A 2IA2A 5JLWA 3M4OJ 4ESJA 1SMYF 2CG4A 4NNJA 3FXOA 3L2UA 3HRMA 4IEJA 2CMPA 2X9DA 4MO7A 2DA5A 4GYGA 2QSGX 2FX0A 5FKNA 2COBA 4A3DJ 1HDPA 2XAQA 3Q9VA 2CO5A 2YR2A 3DEWA 3N97A 2D45A 1D0ZA 3QQAA 3VB2A 4YFXF 2ZFUA 3JRGA 5LEJA 3JR9A 4J19A 2MW8A 3W2WA 1OCTC 2N8GA 1TT0A 4CO8A 4XLPF 3WU2C 2CV1A 3CP8A 5KNLA 4LLNA 3LWFA 4PFPA 2R4GA 1S7OA 3PNTA 2Q8KA 3E6BA 4E7ZA 4ESBA 3CZ6A 3K1NA 1RUOA 4G7OF 4JOMA 2BY1A 1D8KA 3FF5A 5FLMJ 2QSFX 1QGPA 1RETA 2CQXA 4JK1X 3WGIA 3RZDJ 2YUSA 2P7CB 2MG4A 2FNAA 3WTUC 1UZCA 1MGTA 4Q5SF 2HOAA 3HTSB 1GV2A 2CSOA 2EIKH 3EETA 4G8XA 3E3VA 3HEFA 2PEXA 3Q0WA 1Y6IA 5HDNA 2P0WA 3RKYA 2VL8A 1K6OA 3LSMA 4IQJA 1OLTA 2BY0A 5KHDA 1RIOH 1OPCA 4BGDA 5JHUA 2W82A 2BXZA 2KZGA 1O57A 2BY3A 1A5JA 2NOJB 2DOAA 2MYSA 2KISA 2P6SA 1ZAOA 5CVJA 4KA4A 3FBIB 1WJBA 2P5VA 4DYQA 4M6YA 4MIMA 1DDNA 4XRSG 5L3DA 5B1AH 1XTAA 2QCOA 2Y0SN 4MFEA 4X0GA 4Y3OA 3IWZA 2OCCH 2FRHA 2JPBA 2L7KA 4FISA 3W3CA 2FMYA 5FB2A 4CYCB 1ZR4A 1ETWA 4R8HA 3RKQA 1FYLA 4Z6YA 2WY7Q 3EQLF 1H9TA 5C44J 1A6IA 5IY5H 2QWWA 5HNHA 1X3ZB 2HQRA 1YITI 4XL9A 1T0FA 5J1UA 2DDBA 2IS6A 5E3NA 2ZCWA 3OYJA 3LMMA 1HC8A 4U0WA 2XRNA 3ZPLA 3A0BC 2F5VA 2DMNA 1JGGA 1WJAA 1POGA 3F21A 3U9GA 5LD2C 1PDNC 3AL0C 2Y9ZA 2KL4A 2MH9A 2VBYA 3BJAA 1NH3A 1GXPA 1T56A 4KT5C 4LB5A 1UHSA 2RQQA 4E4HA 2ZC2A 3RPUD 2RNGA 3BCAA 5H2FC 3IRRA 2PMUA 1QHHD 3DU5A 3L2RA 1WQ2A 2W1OA 3JAMZ 2CGPA 4CCLA 5F6FA 2OPTA 4YFKF 2CYYA 3QPLA 4GRIA 4PSXA 2LDUA 3S14J 3D5LA 2KRFA 4GDFA 4J00A 4GXOA 1Z7UA 2HPMA 2W7NA 5D6FA 1JKOC 1FSEA 3ECOA 3UKGA 2LR8A 1W5CC 3JRAA 3T0YA 5FFZA 1XB4A 1E3PA 2IGKA 2KFDA 2MBFA 5CQEA 3JSOA 2JRMA 1R58A 3CLQA 1UG0A 1FOXA 1TZLA 3OS2A 2LFBA 2IGMA 2ZMEB 3OYIA 2GWRA 2X0LA 5D4SA 3W2VA 2CW0F 2M1BA 3ZN0A 3C3WA 2Y75A 4RGSA 5HNFA 3SEQA 3ZQCA 3FXUA 2FUG2 2RGVA 1SAUA 3LSGA 3R0AA 3WTZA 1XSXA 2DFIA 3CUOA 4EGYA 2QSHX 1WWXA 2AQFA 3P7NA 1O3QA 1WFXA 2H6CA 4ZYAA 4IHYA 2WAEA 4MTDA 5LGTA 4IJAA 4XIDA 2K9QA 4F52A 4UHTA 4WXDA 3S2WA 1BOAA 3Q3SA 2L7FP 2HKOA 3KE2A 1X4OA 4I76A 3S16J 2AO9A 2QGUA 3BT9A 3OMYA 4P5OA 3VFZA 4A5NA 5DCMA 3L7WA 4I98B 5F1RA 3A01B 5TRDA 2DT7B 1U8RA 2X51A 2ZXJA 1W5TA 2JQ7A 1UELB 3GUDA 2VLAA 4DJAA 2LTPA 4KN7X 1VNDA 2B7EA 4MGRA 3H9GA 2VXDA 3M7GA 1JKRC 4I02A 1H0MA 1FY7A 5BQTA 1MW7A 2XAJA 2GOMA 2GLOA 1LEBA 4CCKA 3MFKA 1HOMA 4RM3A 1MSFC 2JVGA 5JHFA 1JGSA 2HVQA 4L0YB 3BG5A 2Z1DA 3AG3H 4XKWA 2JTVA 4ZYDA 5B5EC 4OU0A 4ZZDA 3D1NI 1BJZA 4D5CA 3CJNA 2D5VA 1B59A 2J5PA 2DQRA 2R0QC 3K9TA 2BEOA 5K7FA 3CF5F 2CRGA 4UNOA 3FXMA 4B43A 5FGMA 1SFOJ 2JPCA 3HOTA 2EIMH 1O4XA 4FHTA 2COMA 5J1RA 3SYTA 2XIGA 1YS7A 4IVNA 3ZMTA 3TW7A 2R5ZA 1MNDA 4UXNA 1QVUA 2KJCA 2O0YA 4BBRJ 2LC2A 3P9IA 1LDJA 1S8NA 3RQIA 2KIUA 1SFXA 3TDUC 2VBZA 1GLNA 2LREA 2X48A 1MDMA 4QLCU 1J7KA 1MKMA 5IP7J 2VC1A 1R9TJ 2EINH 4DOZA 3KP2A 1IO2A 2AXLA 2VN2A 2CU7A 4BJ6C 3PM1A 4A3BJ 5H20A 4QSHA 1EJ9A 1TQPA 1B9NA 3EUHC 3ZMSA 3H9JA 1V54H 1W4MA 3GEZA 2VJIA 4BQAA 4Y4RA 5GTHC 2DYRH 4YIIA 2K4JA 1YX3A 4N9HA 1G2HA 4KUMA 1XGOA 1BM9A 4HLXA 2NVTJ 2VOPA 1A04A 1XGNA 3VODA 2PJRA 1MJ9A 4LG3A 3RPUA 3A02A 1BW5A 1BI2A 2LY2A 3NRVA 4I2OA 2VB6A 3C7JA 3GTPJ 1MMSA 1KONA 2QUFA 4M9ZA 1VF9A 1W0UA 3M1EA 2XGEA 2WADA 5AIPA 4YIFA 5BS6A 4XNFA 4Y17A 2XSDC 3O2PE 1YIJI 2QBYB 2VE8A 4RGUA 2QA4I 4KT6A 4ZH4F 1YW8A 2W57A 3RYPA 2FU4A 1T39A 1SMTA 3V8JA 4UY8I 3CCMI 4C2MJ 1VQLI 2IGOA 2HTSA 2HWVA 2L01A 1LE8A 4RMNA 3T8RA 3ZMVA 4A0YA 4BNCA 2HI3A 2BZTA 3CDLA 1ZRCA 5HS7A 2EFPA 3GMEA 4AYBA 5BOXA 1BI1A 3GW2A 1Z7LA 2FOKA 4A3MJ 4M9XA 5IT3A 2O9LA 3HOZJ 2ELKA 2JA5J 2NS8A 2LKXA 2Z9OA 3I9V2 4KJZA 4N4OB 3DEUA 3FDYA 5L3FA 1NHAA 2ECBA 3D0SA 2G0EA 1P7IA 3VEPA 4HQEA 2OU2A 3IUOA 3OS0A 1P4XA 3GCMA 2V1XA 1FOKA 2NS7A 1TNTA 2ZMEC 3KX2A 1VQ4I 5M5WJ 3KZZA 4R79A 1J9IA 2CJJA 3DEEA 2F5DA 3K4CA 3RZOJ 1RKWA 3F6VA 2M5WA 1FIAA 2JK3A 3H35A 3JRDA 5IT9K 1AHDP 1XMAA 2GZWA 5CPRB 3I4NJ 5IP9J 5C4XJ 1FBSA 1I3AA 2H8RA 2OF7A 2M2EA 2VJJA 1UG2A 5ICGA 2XKPA 2H94A 5CVRA 2DPDA 1T33A 3O3KA 3V42A 1FBUA 2HYFA 4LJZF 3OYAA 2DFHA 1QZEA 3B6AA 3E5UA 5ERIA 4B3AA 3BP8A 4BHBA 3ZMZA 3I4MJ 4WXHA 1MMGA 3DTIA 1K7AA 3ERED 4E6KG 1ZELA 3CC7I 2STTA 2P5KA 4I0BA 2QVOA 1VTNC 1WI3A 1ENHA 2DTRA 1T98A 2X1CA 3ZQQA 3DWLE 4UVAA 1EA3A 3OYDA 4BE1A 1HQCA 2WA0A 3QOPA 4UB8C 1PUFA 4ZTFA 3SQNA 3F8NA 2A6EF 4LOCA 4Y13A 1R1UA 1S3JA 3S15J 5DUKA 1P9QC 3F9KA 1BI0A 3HG9A 3K70C 1N25A 1YO5C 1K79A 3M3YJ 1MNEA 1TC3C 2XAGA 2GA1A 3E6DA 2V9VA 2MABA 2A3SA 3FM3A 4RAFA 2M4KA 3J81K 5HLHA 5IPAA 1RZ4A 3I59B 2A6HF 2VOOA 4AUXA 1Z77A 4BE2A 2B63J 1MH4A 1FIPA 3PSIA 4PGGA 4IQ4A 1FX7A 1J5YA 4XRFA 4XN0A 1HF0A 2NNYA 4P9FA 3TO9A 1FEXA 3VYUB 3FXRA 2LBFB 2DYSH 3LA7A 2MGQA 4XLAA 1ZGAA 3IH3A 1JTXA 4WCGA 5K7HA 2HTJA 1VQ7I 1W7PA 3FMRA 2ADUA 2EJRA 3IRQA 2BHYA 1OYYA 1JKQC 2V1NA 2AS5F 1DU6A 1XCVA 1OCPA 4FE4A 1B1BA 1HSJA 1QBJA 2M34A 3HOUJ 4F91B 1Z9CA 1FYKA 1IC8A 3E97A 3L09A 1D3YA 3AAFA 3S1NJ 3OYMA 3OV8A 5LRRA 1ZQ3P 2OCEA 2PLYA 3S2DJ 2HGCA 4BBSJ 3HXLA 4HDUA 2TRTA 4D9JA 1Y0NA 5HLGA 4NQWB 2DA1A 4L9NA 1Z1DA 2DQLA 3FISA 3GXOA 2R5YB 1SAXA 1KQ0A 1I6XA 3QPSA 3C1DA 2EFQA 1JUSA 2XAUA 4KIFA 3BWGA 2E35A 3KP5A 2K3FA 1AA7A 1YG2A 4XN3A 1FOYA 3F23A 1R5GA 3FHNA 1R6RA 1AKHB 1IRXA 3IAM2 4NC7A 1B8IA 5L3BA 2HQAA 2KIMA 2DOEA 2NNNA 1D1AA 1OCRH 2H27A 2PI0A 5C4JJ 2XF5A 2E36A 1ZRFA 4XRMA 2IS2A 1F4KA 4I09A 4F3QA 2Y31A 3CCYA 1B8IB 2H6BA 3DTEA 1U78A 3J81Z 3JRBA 1F5TA 2DA2A 2EBIA 3LNQA 2PMHA 2WWYA 2KHMA 3LAJA 1JT0A 1P6RA 1LEAA 5GPAA 2Z33A 4UV9A 2UWMA 2DXIA 2AXTC 1FTZA 4RGXA 1V4RA 4O3MA 1L3LA 2X6YA 4CHUA 2XDVA 2IEKA 3F0CA 1WCMJ 3O6BB 3ML6A 1YX5A 4OWRB 2E5ZA 3B73A 2DT6A 3GZNB 1X58A 1YQAA 3C2GA 2UUZA 2J5OA 3TMOA 2JWTA 3H36A 2DMPA 4G6QA 4CSWA 2I5UA 3BQYA 2HXIA 4CGZA 3CO6C 3ISPA 4LFUA 1MBHA 2GM4A 3ZXSA 1KU9A 3J7ZI 2ETHA 1FLIA 4XKVA 6PAXA 3PUBA 4L5EA 1Q1VA 4I01A 1I27A 3OL3A 3CLOA 5HLTA 4BEHB 3MVPA 1WJDA 2P8TA 3CMEI 4A3JJ 1NTCA 2DMUA 1IUFA 1YS6A 3B02A 2ECCA 2OD5A 3HPGA 2CUFA 2DI3A 1QVTA 3JRHA 3FIWA 3VDXA 1EH8A 4PJMA 1B4AA 4BJ5C 4ZTJA 3BOQA 2M0MA 3I56I 1TT5B 1F43A 3CC4I 1CF7A 1QPMA 2E5NA 2KIQA 3D5RC 5ICCA 1F9NA 2YX4A 3SZGA 3EUHA 1RUNA 1E3OC 2BY2A 4B3XA 4G7HF 3JTGA 1LDDA 5E1ZB 1V5GA 1ETYA 3P9KA 5IYDJ 1L0OC 3V7CA 2E7XA 2G7HA 4CCJA 1NK3P 5LBQA 1BA5A 2W24A 1ZHFA 3V8KA 5IP6A 4S04A 1MBGA 4UUTA 4GO1A 4LIVA 1O3RA 1BOBA 4LD5A 2LKSA 1EH6A 1MIJA 2G9WA 3G6EI 5DYMA 1RESA 5GPCA 1QU3A 2YU3A 1SVLA 3GLLA 3HOYJ 1BR2A 3CCEI 1USTA 2R7UA 2HYGD 5E3LA 5DV5A 3BZKA 1VQ6I 2FNPA 1ZR2A 4NC6A 2HKXA 3WTXC 3CCLI 1QQIA 2ZNZA 2CWEA 2P4WA 2GQQA 2L9SA 1EKEA 2ZKZA 5EG0B 2IGNA 2JRTA 4M3DA 2CQNA 5FRMA 2LP0A 3FK7A 2K9NA 4HNUA 3RCOA 4A12A 5BMZA 1AKHA 4HYEA 1KQ8A 1J75A 4KN4X 1DPUA 1Y1VJ 4BDZA 3GTGJ 2ZXHA 5J40A 2NVYJ 4BXUA 1FWZA 2W85A 1W0TA 3BLYA 4CZCA 3QWLA 1X1CA 1D5YA 1NK2P 2IJLA 4IX7A 3HL2A 1GVJA 1V5FA 3V7SA 1RR8C 1EV7A 3V8LA 5JVGF 1H9GA 3IH2A 1O7LA 4UUSA 3QYEA 1ZREA 4V2FA 2ZXIA 4U7BA 1WVRA 2EV6A 2DFFA 3K2AA 1BIBA 3CCUI 5FKMA 4D5FA 3ZQLA 3KFWX 4M71A 4LIUA 3OL4A 3Q0VA 1P2FA 4XMYA 3GYHX 4L5IA 4LG0B 2M45A 2DCEA 1X3UA 2DLLA 5HS9A 4GGGA 1ZKGA 1E2XA 5EZGA 5D8LB 4HSTA 4OMYA 3IHUA 2WY8Q 5ILSA 3RPQA 2E71A 5GAGJ 3KETA 1BBYA 2R7WA 3Q5FA 4XSZF 1ON2A 1OCCH 3CCVI 1FPQA 1QO0D 3HRSA 1IRZA 2FF4A 3JCUC 4CCNA 2LSOA 2XPUA 2UXNA 2WB1N 1ZGJA 4A69C 1A31A 3GBGA 4HDVA 3KEQA 1MBKA 3WTVC 3MWMA 3CCRI 2JUCA 4E7LA 2CQKA 1DGRM 2V6CA 3JW4A 3QP6A 4PDKA 1GT0C 4HNTA 2ME0A 2HDDA 3K7AJ 2M87A 3IKVA 1G3YA 5CVVA 1TWAJ 3OIPA 4OAYA 3UNGC 3K0LA 4KYWA 4HLYA 3G1OA 3ZRGA 4A6DA 5EEAA 2R7QA 5ILVA 3HKZN 4NB5A 2G7UA 3JTHA 1YRNB 3C2HA 2WV0A 3AL0B 1Y1WJ 3G1LA 1IG7A 4B48A 2HS5A 2Q2EA 4FE7A 3RJPA 4MQVA 3GTOJ 2XV4S 2GIVA 1KU2A 3GTJJ 2OC6A 4KMFA 1VFCA 4FQGA 2R5ZB 2A5YB 3KPHA 3G2BA 2Z99A 1DUXC 4ZZLA 2E7WA 1FYMA 3LA3A 5TGTA 1HKSA 4FETA 4B1RA 1YW9A 3H3VK 2VQCA 2ZJ2A 3LSJA 4I7HA 4BAYA 1T8IA 1ITYA 1G59A 1YLFA 3KEOA 4A3GJ 1WZ2A 2QQ8A 3NEUA 5E17F 1VQ9I 3K6GA 3S8PA 3OOUA 1IRFA 1IZ1A 5E3OA 1XGSA 3F8MA 1IDYA 3SEZA 5KAFC 3NARA 3DBLB 2O5RA 4ZYHA 4C3IJ 2E60A 5K7ZA 2L7ZA 1G6NA 2CV0A 1IRGA 2OV7A 2Q2EB 3LSHA 2CS3A 2K85A 1OMIA 2Q0OA 4DNCA 1Z6RA 3KP7A 1KYWA 3A03A 2KLOA 1LDKB 4IRGA 3HOXJ 2XF6A 2LRDA 2A5WA 3D5SC 4DQ2A 2VE9A 1NG7A 4WX9A 1XX5A 2VPLA 4RAYA 1UJ8A 5GADJ 1W5SA 1G4DA 3VYRB 2E34A 3E5QA 4YRVA 4QPQA 4G94A 1VQPI 3I54A 1MBFA 1OKRA 2QQ9A 1MBJA 3KLOA 4HV6A 2HOEA 5M5YJ 2ZJQF 5F04A 3BQZA 1U6GA 1U2WA 4JBAA 5F0FA 5FLXK 2XRLA 5DM7F 3J80K 4LMYA 5LRSA 3OYNA 3PUFA 2F4MB 1R7JA 2M8EA 2DA4A 4IRHA 4PJNA 1WI9A 3CCQI 4ABZA 4M73A 3HM5A 4DBRA 3VWBA 2K3PA 4YIRX 1IV6A 3CESA 3HIFA 3WTYC 4RDUA 1OJLA 4YEJA 4XOPA 1U9OA 2EZKA 2KZVA 1NG6A 3RKXA 4O5VA 5D5VB 1ZN2A 3U1DA 3DCFA 4IL6C 5KVRA 1G3WA 3AG2H 2IA0A 3E0JB
chains in the Genus database with same CATH topology
1UHWA 2ZO4A 1F1ZA 2H09A 1C0WA 4ESFA 4LLLA 3FZVA 3BPXA 3VOEA 4RB1A 4ZYGA 1TQIA 1DPRA 3QPTA 5E1WA 2EV0A 2PG4A 1IN7A 4B8XA 2O3FA 5CVUA 2EFNA 2FBIA 1ON1A 5FO5A 4CZZA 1QZYA 4PGHA 1J0RA 1MJAA 2RNJA 2DAOA 3WG9A 3HHHA 3RI4A 2L4AA 1TW2A 4KICA 4MHGA 4IXAA 2E1NA 4GYIA 1YFHA 3QU3A 4U7DA 1ZYRF 5FFXA 1LQ1A 4L18B 2DO7A 1OYWA 4Z2YA 3I53A 3REOA 4K2EA 3WTSC 3BY6A 4UVBA 2KIFA 1WSUA 3GFIA 4OINF 1JHFA 3T8TA 3MAJA 2FE3A 3R6SA 4IRIA 1FP2A 3BJOA 4IF4A 1S7AA 3WTWC 3ZMUA 3KCCA 3RIRA 3FMQA 2X4HA 1XCBA 5K5RA 2L02A 4FX4A 3LSTA 3ELKA 5E8GA 4S05A 3DF8A 1D8JA 2MA3A 2XROA 1O3TA 4OIPF 3CUQC 4G9YA 1PUEE 3SZTA 4EVIA 1U5TA 2DT5A 4MQ9F 3MEXA 3K69A 5CJ9A 1V3FA 2OAZA 3TGNA 1JE8A 2EA2A 1FZPB 3LA2A 1HKQA 3ECHA 1GHCA 1KU3A 1J59A 2TDXA 1RI7A 3I64A 1FT9A 2M30A 3SFZA 2RVCA 1T2KA 4M6XA 2HEOA 2F5EA 2QENA 1Q1HA 3GFJA 3DP7A 2O61A 2OZUA 3NQOA 4OIRF 4RS8A 1KGSA 2PBIA 1HW1A 2DBBA 3IWFA 2K4BA 1R1VA 3I5UA 1UFMA 2IW5A 3RKWA 1PP8F 1MD0A 2QM3A 5LHIA 3DV8A 1BN5A 4RGRA 2V79A 3FX3A 5JFRA 1DP7P 3E5XA 3EDPA 1B9MA 2P6TA 2UZKA 2JSCA 2QQAA 3QAHA 1IXRC 2ELHA 3LQQA 2PN6A 5F64A 2FSWA 3SHFA 3GZ6A 4HF2A 3CUQA 1R36A 1HSTA 1UB9A 5ICEA 3QRFF 3WGHA 3TKYA 5J6XA 2FQ3A 4YFNF 1R00A 2VXZA 1EH7A 1I1GA 2FA5A 1BIAA 5LHHA 2WTEA 5TJJA 2C6YA 4EM2A 2A69F 3E6MA 4CICA 1P4AA 1ZARA 3BPVA 5D8KB 4UV8A 5LHGA 5E1XA 4M9SA 3F8BA 2R7FA 1YTYA 3M9AA 4HA8A 2A07F 1ZG1A 2OBPA 2LF7A 2E1CA 3CO7C 4LK1F 3GX4X 5BPIA 2IA1A 4KIBA 3HYIA 2RN7A 1W7PB 1I1SA 3BZ6A 1KQ9A 1JHHA 2R3SA 3MCZA 5E20A 5HOOA 3RDIA 3CDHA 4BHPA 1S29A 2NYXA 5LGNA 4G6DA 4P55A 2VODA 4L0ZB 4ETSA 4FT8A 4CYDA 2K86A 3I59A 2K7LA 1YIOA 3KLNA 4O6JA 4HOBA 2RQPA 2BE5F 3K2ZA 2KJBA 2W84A 3K1PA 1XMKA 3K1MA 2IVMA 4HZFA 4IPAA 2RV8A 2DW4A 1HW2A 1J2XA 1ZLKA 3PFIA 4AD9A 2HZTA 1W7PD 2NS0A 3F3XA 4YG2F 2DU9A 1UHMA 2ISZA 1B6AA 4Q48A 5D6EA 2KKOA 3ABTA 3OOPA 2B0LA 1K78A 3GF2A 3KP3A 4A0XA 2EV5A 3GWZA 5H6RA 2GXGA 1TW3A 2MD5A 3TQNA 1R1TA 5A2QK 3FWEA 5D5UB 5L3CA 3H92A 1BC8C 2QBYA 3DXJF 5KK1A 1XDSA 1Z05A 4EJOA 2Z5UA 1U3EM 4WWCA 2ISYA 1CGPA 4WK8F 2OA4A 2VONA 2VBWA 2P5LC 2XUBA 2ESHA 2CFXA 3T1BA 3I0TA 1XD7A 1SD5A 2DK8A 4L5JA 3ZN1A 2DK5A 2V1UA 4LLGF 4U88A 5ICFA 1Z6TA 2XAFA 3EYYA 4B09A 1XN7A 3H3ZA 3RYRA 4HX7A 4HX8A 3P9CA 4R1HA 2O8XA 3TO6A 4JQFA 3LQRA 2OQRA 4EV0A 1OYIA 4Y15A 1U5TC 5L3GA 1LJ9A 4OIQF 3JSPA 3QPHA 2HFHA 4E70A 1IAWA 3TOAA 2RDPA 3WE3A 3I71A 4KFCA 3IL2A 4HBLA 4EGZA 2GA2A 4FX0A 4EMSA 4HF0A 4OOIA 2IP2A 5E8IA 1FP1D 1IW7F 5CYVA 5E18F 2EFWA 4HW0A 4BH9A 5DCMB 2F5CA 3KZYA 4GCVA 4ENJA 1ULYA 4OIOF 1RNLA 3Q9SA 5EEHA 4A6EA 4A5MA 4AWXB 1SFUA 4EJTA 3H3UA 2QYOA 5JR3A 3FHZA 2EA4A 1SD7A 2ZNYA 2VC0A 4TV7A 2LF8A 3GFLA 3FMSA 1QNTA 2W25A 1XGMA 5D5XB 3ZP5A 2ZFWA 2FBHA 3SXYA 1XDUA 3W6JB 2ZMEA 1AWCA 2PQ8A 4MTEA 4HV5A 1IN5A 4WXCA 2O03A 3I4PA 2XGXA 1S6LA 3SZPA 4HF1A 2XAHA 1ZH5A 2XKOA 1KYZA 3ULQB 3CTAA 4P9UA 4XSXF 3F72A 3WGGA 1IXCA 3PQJA 5J8CA 3ZMDA 5D5WB 1U5TB 2OQGA 4EM0B 3L9FA 1HKTA 4PZJA 3TOBA 1ODDA 5BPDA 1USSA 4L9TA 4U0VA 3WODF 4Q47A 2ZBKA 4UVCA 2ACJA 3DFGA 2YX7A 3L2CA 2NRAC 3GZ5A 4ENMA 1LNWA 4LB6B 4EQQA 4L9JA 5J8FA 2XHKA 4N9IA 4KNYA 3G3ZA 1TBXA 1FBQA 3I58A 1XSDA 3FXQA 4EM1A 2HDCA 3IC7A 1TTYA 2HQNA 4U0YA 2QLZA 1TLHB 5FLXZ 5DDGA 3HSRA 3ABUA 2GAUA 1ZG3A 3RTRA 4RB0A 2VT2A 4I0AA 4KDPA 5HVQC 3WU0A 2UXXA 3L00A 3FM5A 4RAZA 2FXAA 3EYIA 1FNNA 1WKMA 4HQMA 3LAPA 4NQWA 1Z91A 5K5OA 1STZA 1SD4A 2O6GE 4RB2C 3HOSA 1P4WA 4F7ZA 1QZZA 1LVAA 3HTUA 3PQKA 3C18A 3V7RA 4OMZA 2K27A 4AIKA 5FD5A 1FSHA 2Y0MA 1Y0UA 3HRUA 5FD6A 3WE2A 1SD6A 2LKPA 4XBFA 2YPRA 3WU1B 1XSVA 5A2QZ 5AIQA 3LFKA 1T38A 4EJUA 2XVCA 3F22A 4ZYEA 3HSFA 2RKHA 2MLKA 4CDGA 3ZQ7A 5JVTA 3HSEA 2BV6A 5D4RA 3F8FA 3M8EA 3F8CA 3HHGA 2QZ8A 2PJPA 1ONVA 4HAMA 4M72A 2R7DA 3JAMK 1E17A 2HR3A 5DD4A 3BDDA 2GXBA 1BC7C 1WRJA 4Q4ZF 4WF2A 3GLXA 1REPC 5H6QA 1IF1A 1ZRDA 2IPQX 1YYVA 4P96A 4MNUA 4RB3C 2MH2A 1I5ZA 3HRTA 1ZG5A 1R5HA 1HBXG 1HXDA 2OZ6A 3MQ0A 3J80Z 3G73A 1G3TA 4HX4A 4N0BA 2A61A 4UUVA 1UCRA 1JXSA 1GXQA 3QU6A 4ON0A 5EEGA 1KU7A 2VT3A 2FMLA 2PFBA 1MDMB 5CVIA 1IN4A 4EJWA 3HUGA 2RC4A 4QWQA 3R4KA 1D5VA 3DPLC 3R61A 2EK5A 2F2EA 1G3SA 2L54A 5HDKA 1R23A 1SFEA 2NAZA 3N4MA 4BHCA 3R60A 1IN6A 4PCQA 5ILUA 4AIJA 1IN8A 3MZYA 2EB7A 3M8FA 4IHSA 4AIHA 1TNSA 2A68F 3E6CC 2F5FA 5JI6A 3ROUA 3V4GA 5HS8A 3BJ6A 4IHTA 3GFMA 3WTTC 1HW5A 3GO5A 5DUIA 4D0PA 1KA8A 4L9VA 5AONA 3T5XA 3DPTA 5HDGA 1IUYA 2Y48A 1MJBA 4A2UA 1MZBA 3R0JA 4CXFA 4KMUX 1LB2A 2VBXA 3J7AO 2L4MA 4MEXF 5L3EA 3QP5A 2DPUA 5CLSA 5LEKA 3COAC 3F6OA 2FEZA 4EJVA 2MLGA 4ENNA 4LG0A 2XASA 3IKTA 1OR7A 3DKWA 1YW7A 2L3DA 4BYYA 4MEYF 5LGUA 3CUQB 4KIGA 2BYVE 2K02A 5HLIA 5DEQA 1K78B 4NHJA 3TO7A 2EWNA 3BROA 4XLNF 1TQMA 4LGWA 4H0EA 4AVPA 4M74A 1CF7B 2D1HA 2MC3A 2JZYA 2IT0A 1AOYA 1PP7U 2D2WA 4A0ZA 1BJAA 1T6SA 5LLQA 2IRFG 3KP4A 2FBKA 2D1VA 1ZLJA 1BI3A 3MZHA 1O3SA 5DCFA 4G7ZF 5IT9Z 2YSRA 5K5QA 2STWA 2P7VB 4LK0F 2WC2A 3TDZC 5ED4A 2Z3YA 1IXSB 1FC3A 1O7FA 3W6KB 2JT1A 2V1DA 2QQBA 2BGCA 4ENKA 3DQVC 3U2RA 5DD8A 2BBYA 2ESNA 3KP6A 2LNBA 1P92A 2EFOA 4ASNA 3GVAA 5K1YA 1R22A 2IA2A 4ESJA 1SMYF 2CG4A 3HRMA 4GYGA 2XAQA 3Q9VA 2CO5A 2YR2A 3N97A 2D45A 3VB2A 4YFXF 5LEJA 4CO8A 4XLPF 4LLNA 3LWFA 1S7OA 2Q8KA 3E6BA 4ESBA 3K1NA 1RUOA 4G7OF 1D8KA 3FF5A 1QGPA 4JK1X 3WGIA 2P7CB 2FNAA 3WTUC 1MGTA 4Q5SF 3HTSB 2CSOA 3EETA 4G8XA 3E3VA 2PEXA 5HDNA 3RKYA 1K6OA 1RIOH 1OPCA 5JHUA 1O57A 2P6SA 1ZAOA 5CVJA 4KA4A 2P5VA 4M6YA 1DDNA 5L3DA 3IWZA 2FRHA 2JPBA 2FMYA 5FB2A 4R8HA 1FYLA 3EQLF 1H9TA 2QWWA 2HQRA 1T0FA 2ZCWA 4U0WA 2XRNA 3ZPLA 3F21A 3U9GA 1PDNC 2MH9A 2VBYA 3BJAA 4LB5A 1GXPA 4KT5C 3IRRA 2PMUA 1WQ2A 3JAMZ 2CGPA 5F6FA 4YFKF 2CYYA 2LDUA 3D5LA 2KRFA 4GXOA 1Z7UA 5D6FA 1FSEA 3ECOA 3T0YA 5FFZA 1XB4A 2MBFA 3JSOA 1R58A 2ZMEB 2GWRA 2X0LA 5D4SA 2CW0F 2M1BA 3ZN0A 3C3WA 2Y75A 4RGSA 3FXUA 3WTZA 4EGYA 2RGVA 3R0AA 1XSXA 2DFIA 3CUOA 1WWXA 3P7NA 1O3QA 2H6CA 4MTDA 5LGTA 4IJAA 4UHTA 4WXDA 3S2WA 1BOAA 3KE2A 2HKOA 4P5OA 3VFZA 4A5NA 5DCMA 3L7WA 4I98B 5F1RA 5TRDA 1U8RA 2ZXJA 1W5TA 3GUDA 4KN7X 4MGRA 3M7GA 4I02A 1H0MA 1FY7A 5BQTA 2XAJA 1LEBA 3MFKA 1JGSA 4L0YB 2JTVA 4ZYDA 4OU0A 4ZZDA 3CJNA 1B59A 2J5PA 2DQRA 3K9TA 2BEOA 4UNOA 5FGMA 2JPCA 3HOTA 4FHTA 2COMA 2XIGA 1YS7A 4IVNA 3ZMTA 4UXNA 2KJCA 2O0YA 3P9IA 1LDJA 1S8NA 2KIUA 1SFXA 3TDUC 2VBZA 1MDMA 4QLCU 1J7KA 1MKMA 2VC1A 3KP2A 2AXLA 2VN2A 5H20A 1TQPA 1B9NA 3ZMSA 1W4MA 3GEZA 4BQAA 4YIIA 2K4JA 4N9HA 4KUMA 1XGOA 1BM9A 4HLXA 2VOPA 1A04A 1XGNA 3VODA 1MJ9A 3RPUA 1BI2A 3NRVA 4I2OA 3C7JA 2QUFA 4M9ZA 3M1EA 5AIPA 4YIFA 5BS6A 4Y17A 3O2PE 2QBYB 2VE8A 4RGUA 4ZH4F 1YW8A 2W57A 3RYPA 2FU4A 1T39A 1SMTA 3V8JA 2HTSA 2HWVA 2L01A 3T8RA 3ZMVA 4A0YA 4BNCA 1ZRCA 5HS7A 2EFPA 5BOXA 1BI1A 3GW2A 2FOKA 4M9XA 5IT3A 2Z9OA 3DEUA 5L3FA 1NHAA 3D0SA 3VEPA 4HQEA 2OU2A 1P4XA 2V1XA 1FOKA 1TNTA 3KZZA 4R79A 1J9IA 2F5DA 3F6VA 2M5WA 5IT9K 1XMAA 2GZWA 1FBSA 5ICGA 2XKPA 2H94A 5CVRA 2DPDA 3O3KA 1FBUA 2HYFA 4LJZF 3E5UA 5ERIA 3BP8A 4BHBA 3ZMZA 4WXHA 1K7AA 3ERED 2STTA 2P5KA 4I0BA 2QVOA 1VTNC 2DTRA 1T98A 4UVAA 1HQCA 3QOPA 3SQNA 3F8NA 2A6EF 4Y13A 1R1UA 1S3JA 5DUKA 1BI0A 1YO5C 1K79A 2XAGA 2GA1A 3E6DA 2V9VA 2A3SA 3FM3A 3J81K 5HLHA 2VOOA 1RZ4A 3I59B 2A6HF 4PGGA 1FX7A 1J5YA 4XRFA 2NNYA 4P9FA 3TO9A 3FXRA 3LA7A 1ZGAA 4WCGA 2HTJA 1W7PA 3FMRA 2ADUA 2EJRA 3IRQA 1OYYA 2AS5F 1XCVA 1B1BA 1HSJA 1QBJA 1Z9CA 1FYKA 3E97A 3L09A 1D3YA 3AAFA 3OV8A 5LRRA 2PLYA 2HGCA 4HDUA 5HLGA 4L9NA 1Z1DA 2DQLA 1SAXA 3GXOA 1KQ0A 1I6XA 3C1DA 2EFQA 4KIFA 3BWGA 3KP5A 1YG2A 3F23A 1R5GA 5L3BA 2KIMA 2NNNA 2H27A 2PI0A 1ZRFA 1F4KA 4I09A 2H6BA 1U78A 3J81Z 1F5TA 2PMHA 2WWYA 3LAJA 1P6RA 1LEAA 2Z33A 4UV9A 2UWMA 4RGXA 1V4RA 4O3MA 1L3LA 4CHUA 3O6BB 3ML6A 3B73A 1YQAA 2J5OA 4G6QA 4CGZA 3CO6C 3ISPA 4LFUA 1KU9A 2ETHA 1FLIA 6PAXA 4I01A 1I27A 3CLOA 2P8TA 1YS6A 3B02A 2OD5A 2DI3A 1EH8A 1B4AA 3BOQA 1CF7A 1QPMA 5ICCA 1F9NA 2YX4A 3EUHA 1RUNA 4G7HF 3JTGA 1LDDA 5E1ZB 3P9KA 1L0OC 3V7CA 2E7XA 2G7HA 5LBQA 2W24A 1ZHFA 3V8KA 4S04A 4GO1A 1O3RA 4LD5A 1EH6A 2G9WA 5DYMA 2YU3A 1USTA 2HYGD 5DV5A 2FNPA 2HKXA 3WTXC 1QQIA 2ZNZA 2CWEA 2P4WA 2GQQA 2ZKZA 2JRTA 5BMZA 4A12A 4HYEA 1KQ8A 1J75A 4KN4X 1DPUA 4BXUA 1FWZA 2W85A 2IJLA 1GVJA 3V7SA 1EV7A 3V8LA 1H9GA 1O7LA 1ZREA 4U7BA 2EV6A 1BIBA 3KFWX 4M71A 1P2FA 3GYHX 4L5IA 4LG0B 2M45A 1X3UA 2DLLA 5HS9A 4GGGA 1E2XA 5D8LB 4OMYA 3IHUA 5ILSA 3RPQA 3KETA 1BBYA 3Q5FA 4XSZF 1ON2A 1FPQA 1QO0D 3HRSA 2FF4A 2LSOA 2UXNA 1ZGJA 4HDVA 3KEQA 3WTVC 3MWMA 2CQKA 4PDKA 2V6CA 3JW4A 3QP6A 2M87A 3IKVA 1G3YA 5CVVA 3K0LA 4KYWA 4HLYA 4A6DA 5ILVA 4NB5A 2G7UA 3JTHA 2WV0A 2HS5A 2Q2EA 3RJPA 4MQVA 2XV4S 2GIVA 1KU2A 4KMFA 2A5YB 2Z99A 1DUXC 4ZZLA 2E7WA 1FYMA 3LA3A 1HKSA 1YW9A 2ZJ2A 4BAYA 4I7HA 1YLFA 3KEOA 3NEUA 5E17F 1IRFA 1IZ1A 1XGSA 3F8MA 4ZYHA 1G6NA 1IRGA 4DNCA 1OMIA 2Q0OA 1Z6RA 3KP7A 1KYWA 1LDKB 4IRGA 4DQ2A 2VE9A 4WX9A 4RAYA 1W5SA 1G4DA 3E5QA 4G94A 3I54A 1OKRA 2QQ9A 3KLOA 4HV6A 2HOEA 1U6GA 1U2WA 4JBAA 5FLXK 3J80K 4LMYA 5LRSA 1R7JA 2M8EA 4IRHA 1WI9A 4M73A 3HIFA 3WTYC 3RKXA 4O5VA 5D5VB 1ZN2A 3U1DA 5KVRA 1G3WA 2IA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHW A;  2ZO4 A;  1F1Z A;  2H09 A;  1C0W A;  4ESF A;  4LLL A;  3FZV A;  3BPX A;  3VOE A;  4RB1 A;  4ZYG A;  1TQI A;  1DPR A;  3QPT A;  5E1W A;  2EV0 A;  2PG4 A;  1IN7 A;  4B8X A;  2O3F A;  5CVU A;  2EFN A;  2FBI A;  1ON1 A;  5FO5 A;  4CZZ A;  1QZY A;  4PGH A;  1J0R A;  1MJA A;  2RNJ A;  2DAO A;  3WG9 A;  3HHH A;  3RI4 A;  2L4A A;  1TW2 A;  4KIC A;  4MHG A;  4IXA A;  2E1N A;  4GYI A;  1YFH A;  3QU3 A;  4U7D A;  1ZYR F;  5FFX A;  1LQ1 A;  4L18 B;  2DO7 A;  1OYW A;  4Z2Y A;  3I53 A;  3REO A;  4K2E A;  3WTS C;  3BY6 A;  4UVB A;  2KIF A;  1WSU A;  3GFI A;  4OIN F;  1JHF A;  3T8T A;  3MAJ A;  2FE3 A;  3R6S A;  4IRI A;  1FP2 A;  3BJO A;  4IF4 A;  1S7A A;  3WTW C;  3ZMU A;  3KCC A;  3RIR A;  3FMQ A;  2X4H A;  1XCB A;  5K5R A;  2L02 A;  4FX4 A;  3LST A;  3ELK A;  5E8G A;  4S05 A;  3DF8 A;  1D8J A;  2MA3 A;  2XRO A;  1O3T A;  4OIP F;  3CUQ C;  4G9Y A;  1PUE E;  3SZT A;  4EVI A;  1U5T A;  2DT5 A;  4MQ9 F;  3MEX A;  3K69 A;  5CJ9 A;  1V3F A;  2OAZ A;  3TGN A;  1JE8 A;  2EA2 A;  1FZP B;  3LA2 A;  1HKQ A;  3ECH A;  1GHC A;  1KU3 A;  1J59 A;  2TDX A;  1RI7 A;  3I64 A;  1FT9 A;  2M30 A;  3SFZ A;  2RVC A;  1T2K A;  4M6X A;  2HEO A;  2F5E A;  2QEN A;  1Q1H A;  3GFJ A;  3DP7 A;  2O61 A;  2OZU A;  3NQO A;  4OIR F;  4RS8 A;  1KGS A;  2PBI A;  1HW1 A;  2DBB A;  3IWF A;  2K4B A;  1R1V A;  3I5U A;  1UFM A;  2IW5 A;  3RKW A;  1PP8 F;  1MD0 A;  2QM3 A;  5LHI A;  3DV8 A;  1BN5 A;  4RGR A;  2V79 A;  3FX3 A;  5JFR A;  1DP7 P;  3E5X A;  3EDP A;  1B9M A;  2P6T A;  2UZK A;  2JSC A;  2QQA A;  3QAH A;  1IXR C;  2ELH A;  3LQQ A;  2PN6 A;  5F64 A;  2FSW A;  3SHF A;  3GZ6 A;  4HF2 A;  3CUQ A;  1R36 A;  1HST A;  1UB9 A;  5ICE A;  3QRF F;  3WGH A;  3TKY A;  5J6X A;  2FQ3 A;  4YFN F;  1R00 A;  2VXZ A;  1EH7 A;  1I1G A;  2FA5 A;  1BIA A;  5LHH A;  2WTE A;  5TJJ A;  2C6Y A;  4EM2 A;  2A69 F;  3E6M A;  4CIC A;  1P4A A;  1ZAR A;  3BPV A;  5D8K B;  4UV8 A;  5LHG A;  5E1X A;  4M9S A;  3F8B A;  2R7F A;  1YTY A;  3M9A A;  4HA8 A;  2A07 F;  1ZG1 A;  2OBP A;  2LF7 A;  2E1C A;  3CO7 C;  4LK1 F;  3GX4 X;  5BPI A;  2IA1 A;  4KIB A;  3HYI A;  2RN7 A;  1W7P B;  1I1S A;  3BZ6 A;  1KQ9 A;  1JHH A;  2R3S A;  3MCZ A;  5E20 A;  5HOO A;  3RDI A;  3CDH A;  4BHP A;  1S29 A;  2NYX A;  5LGN A;  4G6D A;  4P55 A;  2VOD A;  4L0Z B;  4ETS A;  4FT8 A;  4CYD A;  2K86 A;  3I59 A;  2K7L A;  1YIO A;  3KLN A;  4O6J A;  4HOB A;  2RQP A;  2BE5 F;  3K2Z A;  2KJB A;  2W84 A;  3K1P A;  1XMK A;  3K1M A;  2IVM A;  4HZF A;  4IPA A;  2RV8 A;  2DW4 A;  1HW2 A;  1J2X A;  1ZLK A;  3PFI A;  4AD9 A;  2HZT A;  1W7P D;  2NS0 A;  3F3X A;  4YG2 F;  2DU9 A;  1UHM A;  2ISZ A;  1B6A A;  4Q48 A;  5D6E A;  2KKO A;  3ABT A;  3OOP A;  2B0L A;  1K78 A;  3GF2 A;  3KP3 A;  4A0X A;  2EV5 A;  3GWZ A;  5H6R A;  2GXG A;  1TW3 A;  2MD5 A;  3TQN A;  1R1T A;  5A2Q K;  3FWE A;  5D5U B;  5L3C A;  3H92 A;  1BC8 C;  2QBY A;  3DXJ F;  5KK1 A;  1XDS A;  1Z05 A;  4EJO A;  2Z5U A;  1U3E M;  4WWC A;  2ISY A;  1CGP A;  4WK8 F;  2OA4 A;  2VON A;  2VBW A;  2P5L C;  2XUB A;  2ESH A;  2CFX A;  3T1B A;  3I0T A;  1XD7 A;  1SD5 A;  2DK8 A;  4L5J A;  3ZN1 A;  2DK5 A;  2V1U A;  4LLG F;  4U88 A;  5ICF A;  1Z6T A;  2XAF A;  3EYY A;  4B09 A;  1XN7 A;  3H3Z A;  3RYR A;  4HX7 A;  4HX8 A;  3P9C A;  4R1H A;  2O8X A;  3TO6 A;  4JQF A;  3LQR A;  2OQR A;  4EV0 A;  1OYI A;  4Y15 A;  1U5T C;  5L3G A;  1LJ9 A;  4OIQ F;  3JSP A;  3QPH A;  2HFH A;  4E70 A;  1IAW A;  3TOA A;  2RDP A;  3WE3 A;  3I71 A;  4KFC A;  3IL2 A;  4HBL A;  4EGZ A;  2GA2 A;  4FX0 A;  4EMS A;  4HF0 A;  4OOI A;  2IP2 A;  5E8I A;  1FP1 D;  1IW7 F;  5CYV A;  5E18 F;  2EFW A;  4HW0 A;  4BH9 A;  5DCM B;  2F5C A;  3KZY A;  4GCV A;  4ENJ A;  1ULY A;  4OIO F;  1RNL A;  3Q9S A;  5EEH A;  4A6E A;  4A5M A;  4AWX B;  1SFU A;  4EJT A;  3H3U A;  2QYO A;  5JR3 A;  3FHZ A;  2EA4 A;  1SD7 A;  2ZNY A;  2VC0 A;  4TV7 A;  2LF8 A;  3GFL A;  3FMS A;  1QNT A;  2W25 A;  1XGM A;  5D5X B;  3ZP5 A;  2ZFW A;  2FBH A;  3SXY A;  1XDU A;  3W6J B;  2ZME A;  1AWC A;  2PQ8 A;  4MTE A;  4HV5 A;  1IN5 A;  4WXC A;  2O03 A;  3I4P A;  2XGX A;  1S6L A;  3SZP A;  4HF1 A;  2XAH A;  1ZH5 A;  2XKO A;  1KYZ A;  3ULQ B;  3CTA A;  4P9U A;  4XSX F;  3F72 A;  3WGG A;  1IXC A;  3PQJ A;  5J8C A;  3ZMD A;  5D5W B;  1U5T B;  2OQG A;  4EM0 B;  3L9F A;  1HKT A;  4PZJ A;  3TOB A;  1ODD A;  5BPD A;  1USS A;  4L9T A;  4U0V A;  3WOD F;  4Q47 A;  2ZBK A;  4UVC A;  2ACJ A;  3DFG A;  2YX7 A;  3L2C A;  2NRA C;  3GZ5 A;  4ENM A;  1LNW A;  4LB6 B;  4EQQ A;  4L9J A;  5J8F A;  2XHK A;  4N9I A;  4KNY A;  3G3Z A;  1TBX A;  1FBQ A;  3I58 A;  1XSD A;  3FXQ A;  4EM1 A;  2HDC A;  3IC7 A;  1TTY A;  2HQN A;  4U0Y A;  2QLZ A;  1TLH B;  5FLX Z;  5DDG A;  3HSR A;  3ABU A;  2GAU A;  1ZG3 A;  3RTR A;  4RB0 A;  2VT2 A;  4I0A A;  4KDP A;  5HVQ C;  3WU0 A;  2UXX A;  3L00 A;  3FM5 A;  4RAZ A;  2FXA A;  3EYI A;  1FNN A;  1WKM A;  4HQM A;  3LAP A;  4NQW A;  1Z91 A;  5K5O A;  1STZ A;  1SD4 A;  2O6G E;  4RB2 C;  3HOS A;  1P4W A;  4F7Z A;  1QZZ A;  1LVA A;  3HTU A;  3PQK A;  3C18 A;  3V7R A;  4OMZ A;  2K27 A;  4AIK A;  5FD5 A;  1FSH A;  2Y0M A;  1Y0U A;  3HRU A;  5FD6 A;  3WE2 A;  1SD6 A;  2LKP A;  4XBF A;  2YPR A;  3WU1 B;  1XSV A;  5A2Q Z;  5AIQ A;  3LFK A;  1T38 A;  4EJU A;  2XVC A;  3F22 A;  4ZYE A;  3HSF A;  2RKH A;  2MLK A;  4CDG A;  3ZQ7 A;  5JVT A;  3HSE A;  2BV6 A;  5D4R A;  3F8F A;  3M8E A;  3F8C A;  3HHG A;  2QZ8 A;  2PJP A;  1ONV A;  4HAM A;  4M72 A;  2R7D A;  3JAM K;  1E17 A;  2HR3 A;  5DD4 A;  3BDD A;  2GXB A;  1BC7 C;  1WRJ A;  4Q4Z F;  4WF2 A;  3GLX A;  1REP C;  5H6Q A;  1IF1 A;  1ZRD A;  2IPQ X;  1YYV A;  4P96 A;  4MNU A;  4RB3 C;  2MH2 A;  1I5Z A;  3HRT A;  1ZG5 A;  1R5H A;  1HBX G;  1HXD A;  2OZ6 A;  3MQ0 A;  3J80 Z;  3G73 A;  1G3T A;  4HX4 A;  4N0B A;  2A61 A;  4UUV A;  1UCR A;  1JXS A;  1GXQ A;  3QU6 A;  4ON0 A;  5EEG A;  1KU7 A;  2VT3 A;  2FML A;  2PFB A;  1MDM B;  5CVI A;  1IN4 A;  4EJW A;  3HUG A;  2RC4 A;  4QWQ A;  3R4K A;  1D5V A;  3DPL C;  3R61 A;  2EK5 A;  2F2E A;  1G3S A;  2L54 A;  5HDK A;  1R23 A;  1SFE A;  2NAZ A;  3N4M A;  4BHC A;  3R60 A;  1IN6 A;  4PCQ A;  5ILU A;  4AIJ A;  1IN8 A;  3MZY A;  2EB7 A;  3M8F A;  4IHS A;  4AIH A;  1TNS A;  2A68 F;  3E6C C;  2F5F A;  5JI6 A;  3ROU A;  3V4G A;  5HS8 A;  3BJ6 A;  4IHT A;  3GFM A;  3WTT C;  1HW5 A;  3GO5 A;  5DUI A;  4D0P A;  1KA8 A;  4L9V A;  5AON A;  3T5X A;  3DPT A;  5HDG A;  1IUY A;  2Y48 A;  1MJB A;  4A2U A;  1MZB A;  3R0J A;  4CXF A;  4KMU X;  1LB2 A;  2VBX A;  3J7A O;  2L4M A;  4MEX F;  5L3E A;  3QP5 A;  2DPU A;  5CLS A;  5LEK A;  3COA C;  3F6O A;  2FEZ A;  4EJV A;  2MLG A;  4ENN A;  4LG0 A;  2XAS A;  3IKT A;  1OR7 A;  3DKW A;  1YW7 A;  2L3D A;  4BYY A;  4MEY F;  5LGU A;  3CUQ B;  4KIG A;  2BYV E;  2K02 A;  5HLI A;  5DEQ A;  1K78 B;  4NHJ A;  3TO7 A;  2EWN A;  3BRO A;  4XLN F;  1TQM A;  4LGW A;  4H0E A;  4AVP A;  4M74 A;  1CF7 B;  2D1H A;  2MC3 A;  2JZY A;  2IT0 A;  1AOY A;  1PP7 U;  2D2W A;  4A0Z A;  1BJA A;  1T6S A;  5LLQ A;  2IRF G;  3KP4 A;  2FBK A;  2D1V A;  1ZLJ A;  1BI3 A;  3MZH A;  1O3S A;  5DCF A;  4G7Z F;  5IT9 Z;  2YSR A;  5K5Q A;  2STW A;  2P7V B;  4LK0 F;  2WC2 A;  3TDZ C;  5ED4 A;  2Z3Y A;  1IXS B;  1FC3 A;  1O7F A;  3W6K B;  2JT1 A;  2V1D A;  2QQB A;  2BGC A;  4ENK A;  3DQV C;  3U2R A;  5DD8 A;  2BBY A;  2ESN A;  3KP6 A;  2LNB A;  1P92 A;  2EFO A;  4ASN A;  3GVA A;  5K1Y A;  1R22 A;  2IA2 A;  4ESJ A;  1SMY F;  2CG4 A;  3HRM A;  4GYG A;  2XAQ A;  3Q9V A;  2CO5 A;  2YR2 A;  3N97 A;  2D45 A;  3VB2 A;  4YFX F;  5LEJ A;  4CO8 A;  4XLP F;  4LLN A;  3LWF A;  1S7O A;  2Q8K A;  3E6B A;  4ESB A;  3K1N A;  1RUO A;  4G7O F;  1D8K A;  3FF5 A;  1QGP A;  4JK1 X;  3WGI A;  2P7C B;  2FNA A;  3WTU C;  1MGT A;  4Q5S F;  3HTS B;  2CSO A;  3EET A;  4G8X A;  3E3V A;  2PEX A;  5HDN A;  3RKY A;  1K6O A;  1RIO H;  1OPC A;  5JHU A;  1O57 A;  2P6S A;  1ZAO A;  5CVJ A;  4KA4 A;  2P5V A;  4M6Y A;  1DDN A;  5L3D A;  3IWZ A;  2FRH A;  2JPB A;  2FMY A;  5FB2 A;  4R8H A;  1FYL A;  3EQL F;  1H9T A;  2QWW A;  2HQR A;  1T0F A;  2ZCW A;  4U0W A;  2XRN A;  3ZPL A;  3F21 A;  3U9G A;  1PDN C;  2MH9 A;  2VBY A;  3BJA A;  4LB5 A;  1GXP A;  4KT5 C;  3IRR A;  2PMU A;  1WQ2 A;  3JAM Z;  2CGP A;  5F6F A;  4YFK F;  2CYY A;  2LDU A;  3D5L A;  2KRF A;  4GXO A;  1Z7U A;  5D6F A;  1FSE A;  3ECO A;  3T0Y A;  5FFZ A;  1XB4 A;  2MBF A;  3JSO A;  1R58 A;  2ZME B;  2GWR A;  2X0L A;  5D4S A;  2CW0 F;  2M1B A;  3ZN0 A;  3C3W A;  2Y75 A;  4RGS A;  3FXU A;  3WTZ A;  4EGY A;  2RGV A;  3R0A A;  1XSX A;  2DFI A;  3CUO A;  1WWX A;  3P7N A;  1O3Q A;  2H6C A;  4MTD A;  5LGT A;  4IJA A;  4UHT A;  4WXD A;  3S2W A;  1BOA A;  3KE2 A;  2HKO A;  4P5O A;  3VFZ A;  4A5N A;  5DCM A;  3L7W A;  4I98 B;  5F1R A;  5TRD A;  1U8R A;  2ZXJ A;  1W5T A;  3GUD A;  4KN7 X;  4MGR A;  3M7G A;  4I02 A;  1H0M A;  1FY7 A;  5BQT A;  2XAJ A;  1LEB A;  3MFK A;  1JGS A;  4L0Y B;  2JTV A;  4ZYD A;  4OU0 A;  4ZZD A;  3CJN A;  1B59 A;  2J5P A;  2DQR A;  3K9T A;  2BEO A;  4UNO A;  5FGM A;  2JPC A;  3HOT A;  4FHT A;  2COM A;  2XIG A;  1YS7 A;  4IVN A;  3ZMT A;  4UXN A;  2KJC A;  2O0Y A;  3P9I A;  1LDJ A;  1S8N A;  2KIU A;  1SFX A;  3TDU C;  2VBZ A;  1MDM A;  4QLC U;  1J7K A;  1MKM A;  2VC1 A;  3KP2 A;  2AXL A;  2VN2 A;  5H20 A;  1TQP A;  1B9N A;  3ZMS A;  1W4M A;  3GEZ A;  4BQA A;  4YII A;  2K4J A;  4N9H A;  4KUM A;  1XGO A;  1BM9 A;  4HLX A;  2VOP A;  1A04 A;  1XGN A;  3VOD A;  1MJ9 A;  3RPU A;  1BI2 A;  3NRV A;  4I2O A;  3C7J A;  2QUF A;  4M9Z A;  3M1E A;  5AIP A;  4YIF A;  5BS6 A;  4Y17 A;  3O2P E;  2QBY B;  2VE8 A;  4RGU A;  4ZH4 F;  1YW8 A;  2W57 A;  3RYP A;  2FU4 A;  1T39 A;  1SMT A;  3V8J A;  2HTS A;  2HWV A;  2L01 A;  3T8R A;  3ZMV A;  4A0Y A;  4BNC A;  1ZRC A;  5HS7 A;  2EFP A;  5BOX A;  1BI1 A;  3GW2 A;  2FOK A;  4M9X A;  5IT3 A;  2Z9O A;  3DEU A;  5L3F A;  1NHA A;  3D0S A;  3VEP A;  4HQE A;  2OU2 A;  1P4X A;  2V1X A;  1FOK A;  1TNT A;  3KZZ A;  4R79 A;  1J9I A;  2F5D A;  3F6V A;  2M5W A;  5IT9 K;  1XMA A;  2GZW A;  1FBS A;  5ICG A;  2XKP A;  2H94 A;  5CVR A;  2DPD A;  3O3K A;  1FBU A;  2HYF A;  4LJZ F;  3E5U A;  5ERI A;  3BP8 A;  4BHB A;  3ZMZ A;  4WXH A;  1K7A A;  3ERE D;  2STT A;  2P5K A;  4I0B A;  2QVO A;  1VTN C;  2DTR A;  1T98 A;  4UVA A;  1HQC A;  3QOP A;  3SQN A;  3F8N A;  2A6E F;  4Y13 A;  1R1U A;  1S3J A;  5DUK A;  1BI0 A;  1YO5 C;  1K79 A;  2XAG A;  2GA1 A;  3E6D A;  2V9V A;  2A3S A;  3FM3 A;  3J81 K;  5HLH A;  2VOO A;  1RZ4 A;  3I59 B;  2A6H F;  4PGG A;  1FX7 A;  1J5Y A;  4XRF A;  2NNY A;  4P9F A;  3TO9 A;  3FXR A;  3LA7 A;  1ZGA A;  4WCG A;  2HTJ A;  1W7P A;  3FMR A;  2ADU A;  2EJR A;  3IRQ A;  1OYY A;  2AS5 F;  1XCV A;  1B1B A;  1HSJ A;  1QBJ A;  1Z9C A;  1FYK A;  3E97 A;  3L09 A;  1D3Y A;  3AAF A;  3OV8 A;  5LRR A;  2PLY A;  2HGC A;  4HDU A;  5HLG A;  4L9N A;  1Z1D A;  2DQL A;  1SAX A;  3GXO A;  1KQ0 A;  1I6X A;  3C1D A;  2EFQ A;  4KIF A;  3BWG A;  3KP5 A;  1YG2 A;  3F23 A;  1R5G A;  5L3B A;  2KIM A;  2NNN A;  2H27 A;  2PI0 A;  1ZRF A;  1F4K A;  4I09 A;  2H6B A;  1U78 A;  3J81 Z;  1F5T A;  2PMH A;  2WWY A;  3LAJ A;  1P6R A;  1LEA A;  2Z33 A;  4UV9 A;  2UWM A;  4RGX A;  1V4R A;  4O3M A;  1L3L A;  4CHU A;  3O6B B;  3ML6 A;  3B73 A;  1YQA A;  2J5O A;  4G6Q A;  4CGZ A;  3CO6 C;  3ISP A;  4LFU A;  1KU9 A;  2ETH A;  1FLI A;  6PAX A;  4I01 A;  1I27 A;  3CLO A;  2P8T A;  1YS6 A;  3B02 A;  2OD5 A;  2DI3 A;  1EH8 A;  1B4A A;  3BOQ A;  1CF7 A;  1QPM A;  5ICC A;  1F9N A;  2YX4 A;  3EUH A;  1RUN A;  4G7H F;  3JTG A;  1LDD A;  5E1Z B;  3P9K A;  1L0O C;  3V7C A;  2E7X A;  2G7H A;  5LBQ A;  2W24 A;  1ZHF A;  3V8K A;  4S04 A;  4GO1 A;  1O3R A;  4LD5 A;  1EH6 A;  2G9W A;  5DYM A;  2YU3 A;  1UST A;  2HYG D;  5DV5 A;  2FNP A;  2HKX A;  3WTX C;  1QQI A;  2ZNZ A;  2CWE A;  2P4W A;  2GQQ A;  2ZKZ A;  2JRT A;  5BMZ A;  4A12 A;  4HYE A;  1KQ8 A;  1J75 A;  4KN4 X;  1DPU A;  4BXU A;  1FWZ A;  2W85 A;  2IJL A;  1GVJ A;  3V7S A;  1EV7 A;  3V8L A;  1H9G A;  1O7L A;  1ZRE A;  4U7B A;  2EV6 A;  1BIB A;  3KFW X;  4M71 A;  1P2F A;  3GYH X;  4L5I A;  4LG0 B;  2M45 A;  1X3U A;  2DLL A;  5HS9 A;  4GGG A;  1E2X A;  5D8L B;  4OMY A;  3IHU A;  5ILS A;  3RPQ A;  3KET A;  1BBY A;  3Q5F A;  4XSZ F;  1ON2 A;  1FPQ A;  1QO0 D;  3HRS A;  2FF4 A;  2LSO A;  2UXN A;  1ZGJ A;  4HDV A;  3KEQ A;  3WTV C;  3MWM A;  2CQK A;  4PDK A;  2V6C A;  3JW4 A;  3QP6 A;  2M87 A;  3IKV A;  1G3Y A;  5CVV A;  3K0L A;  4KYW A;  4HLY A;  4A6D A;  5ILV A;  4NB5 A;  2G7U A;  3JTH A;  2WV0 A;  2HS5 A;  2Q2E A;  3RJP A;  4MQV A;  2XV4 S;  2GIV A;  1KU2 A;  4KMF A;  2A5Y B;  2Z99 A;  1DUX C;  4ZZL A;  2E7W A;  1FYM A;  3LA3 A;  1HKS A;  1YW9 A;  2ZJ2 A;  4BAY A;  4I7H A;  1YLF A;  3KEO A;  3NEU A;  5E17 F;  1IRF A;  1IZ1 A;  1XGS A;  3F8M A;  4ZYH A;  1G6N A;  1IRG A;  4DNC A;  1OMI A;  2Q0O A;  1Z6R A;  3KP7 A;  1KYW A;  1LDK B;  4IRG A;  4DQ2 A;  2VE9 A;  4WX9 A;  4RAY A;  1W5S A;  1G4D A;  3E5Q A;  4G94 A;  3I54 A;  1OKR A;  2QQ9 A;  3KLO A;  4HV6 A;  2HOE A;  1U6G A;  1U2W A;  4JBA A;  5FLX K;  3J80 K;  4LMY A;  5LRS A;  1R7J A;  2M8E A;  4IRH A;  1WI9 A;  4M73 A;  3HIF A;  3WTY C;  3RKX A;  4O5V A;  5D5V B;  1ZN2 A;  3U1D A;  5KVR A;  1G3W A;  2IA0 A; 
#chains in the Genus database with same CATH topology
 1UHW A;  3UR3 C;  2ZO4 A;  1F1Z A;  2H09 A;  1C0W A;  4F55 A;  3X2Q H;  4ESF A;  1OR7 C;  4LLL A;  3FZV A;  3JRC A;  3BPX A;  1W36 D;  2QEX I;  1JUP A;  3VOE A;  3IAS 2;  4RB1 A;  4ZYG A;  1TQI A;  2HVS A;  1DPR A;  3QPT A;  5E1W A;  2EV0 A;  2PG4 A;  1IN7 A;  4B8X A;  5EJC A;  4J01 A;  1DQU A;  2O3F A;  2R7O A;  2HVR A;  2ZSI B;  5CVU A;  4C3H J;  2EFN A;  2FBI A;  1ON1 A;  5FO5 A;  4CZZ A;  1QZY A;  4PGH A;  3VSL A;  1J0R A;  3J7Y J;  1MJA A;  2RNJ A;  2BW3 A;  1X3W B;  1JTY A;  2DAO A;  3SDG A;  2V6E A;  3H5A A;  3H5R A;  3OIQ A;  3WG9 A;  1R4M B;  4OAZ A;  3HHH A;  3AKZ A;  1V55 H;  3RI4 A;  1R4N B;  1S7E A;  2KRC A;  2L4A A;  1F36 A;  4C30 A;  4I6Z A;  1S9H A;  1TW2 A;  3PSF A;  4KIC A;  4X1E A;  4MHG A;  4IXA A;  3BTI A;  2OTJ I;  2Z16 A;  1R5I D;  2L9V A;  2E1N A;  4GYI A;  3IV5 A;  1YFH A;  3QU3 A;  2YS9 A;  3M07 A;  4U7D A;  4B4C A;  4AID A;  1JI8 A;  1ZYR F;  5FFX A;  1LQ1 A;  4L18 B;  2Y2Z A;  1OYW A;  2DO7 A;  1K83 J;  4Z2Y A;  2Y30 A;  3I53 A;  3BR6 A;  3L1P A;  3REO A;  4ANJ A;  4K2E A;  1DP3 A;  3WTS C;  4C9Y A;  5BNG A;  3BY6 A;  3PO3 J;  3HKZ A;  3OR2 C;  1G8X A;  4UVB A;  2NVU B;  2L2O A;  2KIF A;  1WSU A;  3GFI A;  4W97 A;  4OIN F;  3ONQ A;  1K4T A;  1JHF A;  2VKD A;  4XIC A;  3T8T A;  4A3C J;  3MAJ A;  2FE3 A;  3R6S A;  4IRI A;  1FP2 A;  1GUU A;  3MKY B;  3BJO A;  3AFH A;  2ZJP F;  4IF4 A;  1S7A A;  3ZMU A;  3WTW C;  1RPW A;  3KCC A;  3RIR A;  2XB5 A;  3J7A Y;  1MMN A;  3FMQ A;  3K10 A;  2VPR A;  3K4K A;  2X4H A;  2KMU A;  1XCB A;  2LMD A;  5K5R A;  3S1M J;  2L02 A;  4FX4 A;  3MKZ A;  3LST A;  2P81 A;  3ELK A;  1BW6 A;  3S1R J;  2X1D A;  3BR3 A;  5E8G A;  4S05 A;  3DF8 A;  5CQG A;  5FLV A;  4BAC A;  4DZP A;  2EIL H;  3ERM A;  1D8J A;  1BR1 A;  2MA3 A;  3HDD A;  1Z21 A;  2XRO A;  1O3T A;  1R71 A;  4OIP F;  4A3L J;  3CUQ C;  4G9Y A;  4IHV A;  1PUE E;  3SZT A;  4EVI A;  1U5T A;  2DT5 A;  1YJN I;  3HC7 A;  4MQ9 F;  2K9M A;  5FJ8 J;  2E2I J;  1JJ6 C;  4C2U A;  3MEX A;  3K69 A;  4JX6 A;  5CJ9 A;  3Q0U A;  4JX4 A;  1X1P A;  2EPF A;  1ETV A;  1XG1 A;  4AM3 A;  1V3F A;  2OAZ A;  2CW7 A;  3TGN A;  1QPI A;  2E2H J;  2MD0 A;  3LFU A;  5M3F J;  1JE8 A;  2EA2 A;  3LSR A;  1FZP B;  3LA2 A;  3QOD A;  1HKQ A;  3ECH A;  1GHC A;  2V4J C;  4M3B A;  1X2N A;  4PFO A;  4S0H B;  1KU3 A;  1Y39 A;  1ERD A;  2R92 J;  2VUM J;  3A4C A;  1J59 A;  2JA6 J;  2TDX A;  1RI7 A;  4DBQ A;  2LG4 A;  3I64 A;  1FT9 A;  2M30 A;  4CCO A;  3SFZ A;  2RVC A;  1OIS A;  2VAS A;  3M8J A;  4M6X A;  1T2K A;  2HEO A;  2F5E A;  5B3S H;  3BG6 A;  3HOV J;  2QEN A;  3TBI A;  1Q1H A;  3GFJ A;  2DMT A;  4XLH A;  3S17 J;  1PUF B;  3FXL A;  3DP7 A;  2O61 A;  2OZU A;  3NQO A;  5GTI C;  5FRN A;  3FK6 A;  3KEY A;  4OIR F;  4RS8 A;  1KGS A;  4BY7 J;  2PBI A;  3JRI A;  1HW1 A;  2DJI A;  2DBB A;  3W6V A;  4E7K A;  3IWF A;  3JRE A;  3B6C A;  2K4B A;  1GDT A;  1R1V A;  1QRY A;  4CA0 A;  5GAH J;  3I5U A;  3VSK A;  4QIW N;  4E7H A;  4M6V A;  1UFM A;  2GOX B;  2IW5 A;  3CJR B;  3RKW A;  1PP8 F;  1MD0 A;  3I55 I;  2QM3 A;  4CUG A;  4FAS D;  5LHI A;  2KDZ A;  3DV8 A;  4IKF A;  3E1S A;  1BN5 A;  4ITV A;  4RGR A;  3ABM H;  2V79 A;  3FX3 A;  3LSP A;  1SVO A;  3DTK A;  5JFR A;  1DP7 P;  2M8G X;  3E5X A;  3EDP A;  1WJE A;  3NAU A;  1B9M A;  2ICW G;  2P6T A;  1OFC X;  2UZK A;  2JSC A;  3ABL H;  2QQA A;  1TWC J;  1QHG A;  3RQ4 A;  3QAH A;  1A35 A;  2HU9 A;  1U9N A;  2BW3 B;  1IXR C;  2ELH A;  3LQQ A;  5IYC J;  2PN6 A;  5F64 A;  2FSW A;  2LD5 A;  3PIO F;  3SHF A;  2ZXW H;  1SEU A;  3GZ6 A;  4HF2 A;  2HZD A;  3CUQ A;  4C2T A;  3L2Q A;  1R36 A;  2NVX J;  3BCB A;  1HST A;  2IAI A;  3K4J A;  1UB9 A;  4A3E J;  3PNY A;  5ICE A;  3QOE A;  3O8G A;  3QRF F;  3WGH A;  1Z3X A;  3TKY A;  5J6X A;  3S1Q J;  2FQ3 A;  1WPK A;  4YFN F;  1XC5 A;  1FOW A;  1R00 A;  2VXZ A;  3RSN A;  1EH7 A;  1ETK A;  1I1G A;  3MMY B;  4QTR A;  1YI2 I;  1TWH J;  2FA5 A;  1YJW I;  1J09 A;  1WJF A;  4BQQ A;  1BIA A;  3TP0 A;  2WTE A;  5TJJ A;  5LHH A;  4EM2 A;  2A69 F;  2M7A A;  2C6Y A;  3E6M A;  4CIC A;  1P4A A;  3ZQI A;  4NDL A;  1ZAR A;  2ZSH B;  3BPV A;  2KDO A;  2W00 A;  4BXX J;  1YOV B;  5D8K B;  4UV8 A;  3BR1 A;  5LHG A;  4N4N B;  2LYC A;  5E1X A;  4M9S A;  1TWG J;  3NWT A;  2XF7 A;  3ZQG A;  5EDN A;  5KAI C;  2AQE A;  4F93 B;  2IS4 A;  4AU7 A;  3F8B A;  2R7F A;  2V26 A;  2LY1 A;  4BY1 J;  1YTY A;  2EH3 A;  3M9A A;  3WHC A;  4HA8 A;  2VIX A;  2A07 F;  1ZG1 A;  2BHZ A;  2FD5 A;  1E0E A;  2OBP A;  2LF7 A;  2E1C A;  3CJQ B;  3CO7 C;  2M7B A;  3CD6 I;  4HSR A;  1X4P A;  3OYB A;  4LK1 F;  3HGY A;  5EGO B;  3HB9 A;  3GX4 X;  3K4L A;  5BPI A;  2IA1 A;  4KIB A;  3HYI A;  1LPQ A;  2RN7 A;  1W7P B;  1I1S A;  3BZ6 A;  1KQ9 A;  1JHH A;  2YU9 J;  2WBM A;  2QKL B;  2R3S A;  3HJE A;  3MCZ A;  2XSJ C;  5E20 A;  5J4Y A;  5HOO A;  3RDI A;  2VQG A;  4BJT A;  2XB0 X;  3CDH A;  4BHP A;  1S29 A;  2NYX A;  3KIO A;  5LGN A;  4G6D A;  4PUS A;  4P55 A;  2VOD A;  4L0Z B;  4ETS A;  4FT8 A;  1A36 A;  2Y9Y A;  3AG1 H;  4CYD A;  2M4G A;  2K86 A;  3I59 A;  2K7L A;  3DU6 A;  1YIO A;  3KLN A;  1H8A C;  4O6J A;  4HOB A;  2RQP A;  2E19 A;  5LFA A;  2BE5 F;  1LFP A;  3K2Z A;  4V19 K;  2KJB A;  4A93 J;  2W84 A;  3K1P A;  3H5N A;  1XMK A;  3K1M A;  2IVM A;  1W1W E;  4HZF A;  3OS1 A;  1AU7 A;  2ID6 A;  4IPA A;  2RV8 A;  3JRF A;  2DW4 A;  2HOS A;  3ASO H;  1HW2 A;  1J2X A;  4RAG A;  1ZLK A;  3PFI A;  2VKV A;  4AD9 A;  3U21 A;  2HZT A;  1RC9 A;  2R7R A;  1W7P D;  2DA7 A;  4HEA 2;  2NS0 A;  3F3X A;  5CKT A;  4YG2 F;  1LFU P;  2DU9 A;  4RLQ A;  2K9L A;  2MC4 A;  2IS1 A;  1UHM A;  2ELJ A;  1ZTR A;  3CCJ I;  2ISZ A;  1QA6 A;  1B6A A;  2KPM A;  4Q48 A;  4E7S A;  1OCO H;  2X85 A;  5D6E A;  2RAE A;  2KKO A;  1DGW Y;  2K40 A;  3ABT A;  4DZJ A;  3OOP A;  1RKT A;  2B0L A;  1K78 A;  3GF2 A;  2CW8 A;  3KP3 A;  1FMV A;  3CMM A;  4A0X A;  2EV5 A;  2AHQ A;  2O8K A;  3GWZ A;  2QKM B;  1N77 A;  3TW6 A;  3GTM J;  5H6R A;  4XLE A;  3GTK J;  2GXG A;  1TW3 A;  2MD5 A;  3TQN A;  1JKP C;  1R1T A;  5A2Q K;  1H88 C;  3FWE A;  2H8W A;  5D5U B;  2EZH A;  4V2G A;  5J3L A;  2HYJ A;  2VKH A;  5L3C A;  5DS9 A;  3H92 A;  3HUG B;  4BXF A;  3QYB A;  1BC8 C;  2WAQ N;  2EZL A;  2QBY A;  2FOW A;  3KYC B;  3DXJ F;  3H0G J;  3OYC A;  5TIS C;  5KK1 A;  1XDS A;  1Z05 A;  4EJO A;  2Z5U A;  1U3E M;  4WWC A;  2ISY A;  2EQR A;  1CGP A;  2KRH A;  2LH9 A;  3SJM A;  4XR6 A;  4WK8 F;  2OA4 A;  3FXJ A;  2VON A;  2VBW A;  4FTH A;  2P5L C;  2XUB A;  2ESH A;  2CFX A;  3T1B A;  3I0T A;  1XD7 A;  1E3H A;  4Y52 J;  1SD5 A;  2DK8 A;  4XLC A;  4L5J A;  3ZN1 A;  2DK5 A;  3OY9 A;  2V1U A;  3QYF A;  3IP4 B;  5FKO A;  4LLG F;  4U88 A;  5ICF A;  1Z6T A;  2XAF A;  3EYY A;  3MKL A;  2CV2 A;  4B09 A;  2IBD A;  1XN7 A;  3ASN H;  1K6Y A;  3H3Z A;  2R93 J;  4M3G A;  4HX7 A;  3RYR A;  4HX8 A;  2L9N A;  2BVM A;  2LOO A;  1TL8 A;  3P9C A;  4R1H A;  2O8X A;  2CUE A;  2DJN A;  3TO6 A;  4JQF A;  3LQR A;  5B1B H;  2Z2S B;  4BQO A;  2OQR A;  3I3L A;  4EV0 A;  2H1K A;  1OYI A;  2OJE D;  1VQO I;  4Y15 A;  1ETX A;  3DBH B;  1U5T C;  2K9S A;  5L3G A;  1LJ9 A;  2L9R A;  4OIQ F;  2PJR B;  1WH5 A;  3PL8 A;  3JSP A;  1WJC A;  3QPH A;  3ZQF A;  2X1E A;  2HFH A;  4E70 A;  1IAW A;  3TOA A;  2RDP A;  3WE3 A;  3I71 A;  5F0C A;  4KFC A;  3IL2 A;  4HBL A;  4AVZ A;  4EGZ A;  2GA2 A;  4FX0 A;  1SC7 A;  4EMS A;  4HF0 A;  4OOI A;  3KYL A;  3TED A;  2IP2 A;  5E8I A;  4NC8 A;  1FP1 D;  1FTT A;  1IW7 F;  2F6C A;  5CYV A;  1K4S A;  5E18 F;  1VZ0 A;  4M3E A;  2EFW A;  4RLF A;  4HW0 A;  4BH9 A;  1FJL A;  2HXO A;  3CJT B;  4IOA F;  5DCM B;  2OTL I;  2R7V A;  3TL4 X;  3VYT B;  2F5C A;  1W36 C;  3KZY A;  4GCV A;  3OYH A;  4DGW B;  4ENJ A;  1ULY A;  4OIO F;  1IDZ A;  1RNL A;  4E7I A;  3Q9S A;  5EEH A;  4XOT A;  3CMA I;  4YEL A;  2A6T A;  1FMW A;  2B9S A;  4A6E A;  4A5M A;  2JUG A;  4AWX B;  1SFU A;  1T95 A;  4EJT A;  3BC8 A;  3H3U A;  1VQM I;  2QYO A;  5JR3 A;  4DW6 A;  4IHW A;  3FHZ A;  2EA4 A;  4JX5 A;  1SD7 A;  2ZNY A;  3BTL A;  4PJ0 C;  2VC0 A;  1SFK A;  3OYK A;  2V9K A;  4TV7 A;  2HQ5 A;  4KIT B;  2LF8 A;  3GFL A;  3FMS A;  1QNT A;  2W25 A;  2DOD A;  1TP4 A;  2MSY A;  4BDY A;  1M1E B;  1ETO A;  5J47 A;  3A2K A;  1ZGW A;  4MFD A;  2M0C A;  5M3M J;  1XGM A;  3PIP F;  2JA2 A;  2EZI A;  5D5X B;  3OYG A;  4XLF A;  4JP0 A;  3ZP5 A;  2ZFW A;  2FBH A;  2X6X A;  3SXY A;  1XDU A;  2IXS A;  3W6J B;  2ZME A;  3EUA A;  1AWC A;  4LIT A;  2PQ8 A;  4MTE A;  3DKX A;  4HV5 A;  3MD2 A;  1VQ5 I;  1IN5 A;  4WXC A;  2O03 A;  3I4P A;  2A05 A;  3P5J A;  3BG3 A;  1SVM A;  3BG9 A;  1S6L A;  2XGX A;  4RM2 A;  3G4S I;  4W1U A;  2JSP A;  4BEH A;  3CDI A;  2W48 A;  1JJ8 C;  3SZP A;  4E7J A;  2XAH A;  4HF1 A;  1ZH5 A;  1YE9 A;  2V9P A;  2F48 A;  3HPH A;  1LVK A;  1LFB A;  3C2B A;  4BU2 A;  1LKX A;  1UMQ A;  2XKO A;  1KYZ A;  2L5Q A;  3LL7 A;  3ULQ B;  5M5X J;  2XGD A;  4P1W A;  3CTA A;  1YJ9 I;  4P9U A;  3PO2 J;  1IGN A;  2R7Z J;  4XSX F;  3EUK L;  5EF6 A;  2QF7 A;  2GIZ A;  3F72 A;  3HOW J;  3WGG A;  4M3F A;  3HGG A;  1IXC A;  4D7M A;  3PQJ A;  2DMQ A;  5J8C A;  3ZMD A;  2R7T A;  1VQN I;  2NXN B;  5D5W B;  1U5T B;  4BL0 B;  2OQG A;  2R5Y A;  3S3M A;  1APL C;  1WH7 A;  4EM0 B;  1X1A A;  3L9F A;  4XKC A;  1HKT A;  4PZJ A;  2F4I A;  3TOB A;  1ODD A;  5BPD A;  1USS A;  4L9T A;  4U0V A;  3WOD F;  3W2A A;  4Q47 A;  1S72 I;  2ZBK A;  4UVC A;  1I3Q J;  2ACJ A;  4XON A;  1WJ5 A;  2X6W A;  3DFG A;  1UAA A;  3VPR A;  2YX7 A;  3L2C A;  1VQ8 I;  3ZGK A;  2NRA C;  1JUM A;  3OIO A;  3GZ5 A;  4PK4 A;  4ENM A;  3NWS A;  1LNW A;  4LB6 B;  4EQQ A;  1YHQ I;  2TCT A;  3S3N A;  4L9J A;  5J8F A;  2XHK A;  4N9I A;  3WHB A;  3G1M A;  5IOY A;  4KNY A;  3G3Z A;  2Q1Z B;  2HPI A;  1TBX A;  1MNM C;  1FBQ A;  3I58 A;  4XKB A;  1XSD A;  3FXQ A;  4EM1 A;  2HDC A;  3BTJ A;  1MMD A;  4D7N A;  1B72 B;  1D0X A;  3ZOB A;  3IC7 A;  1OCZ H;  1TTY A;  2ID3 A;  2HQN A;  2O7O A;  4PSW A;  4U0Y A;  1PJR A;  3ZR8 X;  2QLZ A;  4BUP A;  1Y8R B;  3N05 A;  1ZK8 A;  1TLH B;  3L2W A;  5FLX Z;  5DDG A;  3HSR A;  3ABU A;  2GAU A;  1ZG3 A;  2R7S A;  3FXK A;  3RTR A;  4RB0 A;  3S93 A;  2VT2 A;  4I0A A;  4XOR A;  4KDP A;  5HVQ C;  2LY9 A;  3HZJ A;  2E2J J;  3WU0 A;  3CMY A;  2UXX A;  3L00 A;  3FM5 A;  4RAZ A;  4G12 A;  2FXA A;  3EYI A;  4II2 A;  3DLA A;  1FNN A;  1WKM A;  4HQM A;  3IH4 A;  4NQW A;  3LAP A;  1LE8 B;  3GTL J;  2LBF A;  3ZCO A;  2WAF A;  1Z91 A;  3BR5 A;  1STZ A;  5K5O A;  2JA8 J;  1SD4 A;  2OUM A;  2O6G E;  4RB2 C;  1EF4 A;  1IV8 A;  4C3J J;  3HOS A;  1B72 A;  1P4W A;  3MZ8 A;  5F27 A;  2NVQ J;  2L7M P;  4F7Z A;  1QZZ A;  2KP6 A;  2EIJ H;  3CF2 A;  4BKX A;  1LVA A;  3HTU A;  3PQK A;  5IYB J;  3H9Q A;  3C18 A;  5DM6 F;  3V7R A;  4NBQ A;  3PJR A;  4OMZ A;  4MLO A;  2W4S A;  1N78 A;  2K27 A;  4AIK A;  4B44 A;  3DBR B;  5FD5 A;  1FSH A;  2Y0M A;  4UB6 C;  4JYK A;  1Y0U A;  1T08 B;  3HRU A;  5FD6 A;  3WE2 A;  1SD6 A;  2LKP A;  1D1B A;  1HLV A;  3ZQH A;  5E3M A;  2H1L A;  4XBF A;  5B66 C;  1RRJ A;  3BR0 A;  4DIQ A;  5F1J A;  3OSF A;  2YPR A;  3WU1 B;  1XSV A;  2L0K A;  1Z0X A;  5A2Q Z;  4XM3 A;  5AIQ A;  3LFK A;  3A1Y A;  2VQL A;  4II3 A;  2E1M B;  5DTD A;  1MH3 A;  1T38 A;  3AG4 H;  4EJU A;  4BS9 A;  3H0D A;  3OSG A;  2XVC A;  2BVL A;  2PX9 A;  5HOD A;  3F22 A;  4ZYE A;  3HSF A;  2RKH A;  2MLK A;  2JJ7 A;  4CDG A;  1H89 C;  3ZQ7 A;  5JVT A;  1U8B A;  2PMZ A;  3HSE A;  3OYF A;  3VYS B;  3L2V A;  2BV6 A;  4X6A J;  5D4R A;  3F8F A;  3M8E A;  3F8C A;  2LLK A;  3HHG A;  2QZ8 A;  4HPQ A;  2PJP A;  3M1C A;  1ONV A;  4HAM A;  3BG7 A;  4M72 A;  3H1C A;  5J4V A;  3S2H J;  3OWT A;  4ZDO A;  3HBL A;  3KZI C;  3S32 A;  2R7D A;  3MN2 A;  3DKY A;  4XK4 A;  3JAM K;  2DFE A;  1E17 A;  1ACI A;  3KYD B;  2HR3 A;  4RA2 A;  5DD4 A;  1SAN A;  3BDD A;  5J1Y A;  2GXB A;  4A3I J;  1BC7 C;  1WGX A;  1WRJ A;  3K4N A;  4Q4Z F;  4WF2 A;  2VJ5 A;  3GLX A;  1REP C;  1I6H J;  4DYR A;  5H6Q A;  1IF1 A;  2I8D A;  1OQY A;  3U1K A;  2X6O A;  1ZRD A;  2IPQ X;  1V5E A;  1YYV A;  4P96 A;  4MNU A;  4RB3 C;  2MH2 A;  4G6T B;  1I5Z A;  3HRT A;  2CQQ A;  1ZG5 A;  2CH0 A;  1KZH A;  2XC7 A;  3FBN B;  1IJW C;  1R5H A;  1HBX G;  1HXD A;  2OZ6 A;  1LUJ B;  1HA8 A;  3MQ0 A;  3J80 Z;  3G73 A;  1G3T A;  4HX4 A;  1A6Q A;  4ZDP A;  4KIS A;  4N0B A;  2A61 A;  3ESW B;  1U0J A;  4H4K C;  4EAT A;  4UUV A;  1UCR A;  1JXS A;  1GXQ A;  5KCM A;  4Y7N J;  3QU6 A;  4ON0 A;  1I39 A;  3PNV A;  5EEG A;  1KU7 A;  2I10 A;  2VT3 A;  2FML A;  2PFB A;  2VQH A;  1HCR A;  5F0H A;  1MDM B;  3SFI A;  3BTC A;  2GXA A;  5CVI A;  1IN4 A;  4EJW A;  4UUS B;  3HUG A;  1XPX A;  1XMX A;  2ME6 A;  1K61 A;  5FRO A;  2RC4 A;  4QWQ A;  1PYV A;  2HOT A;  3R4K A;  2NOG A;  1D5V A;  4IO9 F;  4AC0 A;  2XGC A;  3DPU A;  3CCS I;  3DPL C;  3R61 A;  3BR2 A;  3CQZ J;  2EK5 A;  4A3F J;  2F2E A;  1CQT A;  1G3S A;  2L54 A;  5HDK A;  1MSE C;  5GAE J;  1R23 A;  1SFE A;  2DN0 A;  2NAZ A;  5EZH A;  4FCY A;  3N4M A;  4BHC A;  2DTZ A;  2VJ4 A;  3R60 A;  1IN6 A;  4PCQ A;  1Y56 A;  1TWF J;  3CC2 I;  5ILU A;  1T0F C;  4AIJ A;  4PJL A;  5C3E J;  1IN8 A;  1GV5 A;  2LVS A;  3MZY A;  2WAQ A;  2EB7 A;  3M8F A;  4A3K J;  4AIH A;  4IHS A;  1X1B A;  1JT6 A;  1TNS A;  2A68 F;  3PFY A;  4HG2 A;  3E6C C;  2F5F A;  5JI6 A;  2Y69 H;  3ROU A;  3K4B A;  1P7J A;  1ETQ A;  2CFO A;  3V4G A;  2JN6 A;  4QPO A;  4EEF G;  4XQF A;  5HS8 A;  2JA7 J;  3BJ6 A;  4IHT A;  2FQ4 A;  3GFM A;  3BZC A;  2CUJ A;  3WTT C;  1HW5 A;  3GO5 A;  5DUI A;  1BL0 A;  4D0P A;  4HNV A;  1ORK A;  1KA8 A;  4L9V A;  5F08 A;  5AON A;  2E1O A;  3T5X A;  3DPT A;  3CP2 A;  5HDG A;  1IUY A;  5GP9 A;  2Y48 A;  1MJB A;  4A2U A;  1PVE A;  2M3A A;  1MZB A;  3R0J A;  4CXF A;  3OYE A;  1BR4 A;  4KMU X;  4AYB N;  1LB2 A;  4D1Q A;  1VQK I;  4DYC A;  2VBX A;  1YRN A;  3J7A O;  2DOF A;  2L4M A;  1XS9 A;  5FKK A;  4MEX F;  5L3E A;  4ZC3 A;  4F92 B;  4RBO A;  3QP5 A;  2GBY A;  4ZJZ A;  2DPU A;  4BQN A;  2DDA A;  2MFZ A;  2VI6 A;  5CLS A;  3ABK H;  3OR1 C;  5LEK A;  5EYR A;  3COA C;  3F6O A;  3A01 A;  2FEZ A;  3LOC A;  4EJV A;  1Z67 A;  2MLG A;  4ENN A;  4LG0 A;  2DA6 A;  2XAS A;  3LSK A;  3IKT A;  2JMW A;  1OR7 A;  3S3O A;  1MMA A;  3DKW A;  1I50 J;  4CH7 A;  2R7X A;  4I99 C;  1YW7 A;  2HNH A;  2L3D A;  3MKW B;  4GFB A;  3K4M A;  4BYY A;  4IZZ A;  2KQR A;  3A0H C;  4MEY F;  5LGU A;  1R49 A;  5JLX A;  3OYL A;  1GVD A;  3CUQ B;  4KIG A;  4U87 A;  2BYV E;  2CUZ A;  2K02 A;  2Y0S A;  5HLI A;  5E79 C;  3DLL F;  2F4O B;  5DEQ A;  1K78 B;  4NHJ A;  2XPV A;  3TO7 A;  3SDB A;  2EWN A;  2FJ1 A;  3BRO A;  4XLN F;  3K70 D;  5EG0 A;  1TQM A;  5EGO A;  4LGW A;  2UV1 A;  2BOL A;  1D0Y A;  4H0E A;  4Y33 A;  4AVP A;  4M74 A;  1CF7 B;  4BE0 A;  4B47 A;  1Y8Q B;  2BXY A;  1VI0 A;  4HRI A;  2WB1 A;  3FKI J;  2JVH A;  2D1H A;  2MC3 A;  2JZY A;  4CCM A;  2IT0 A;  1AOY A;  1PP7 U;  3G71 I;  2D2W A;  4A0Z A;  3FKJ A;  1MBE A;  1BJA A;  1T6S A;  2V7F A;  3WG7 H;  5LLQ A;  2IRF G;  3KP4 A;  2FBK A;  4XRS A;  2KT0 A;  3TP3 A;  3GTQ J;  4PJJ A;  2DA3 A;  4ZDL A;  4IOC F;  2D1V A;  1ZLJ A;  1BI3 A;  1D1C A;  2CQ7 A;  2PMZ N;  3MZH A;  1X19 A;  1O3S A;  5DCF A;  4G7Z F;  5IT9 Z;  2YSR A;  2HDW A;  5K5Q A;  2XPW A;  2ZJR F;  2RRE A;  1DU0 A;  2K5C A;  2STW A;  4IHX A;  2P7V B;  1RR7 A;  4LK0 F;  2WC2 A;  3LSI A;  1HDD C;  3TDZ C;  1WHU A;  3O8H A;  2VKE A;  5ED4 A;  2Z3Y A;  1IXS B;  2M9H A;  1FC3 A;  4NUB A;  3E7L A;  1O7F A;  3W6K B;  2JT1 A;  2V1D A;  2QQB A;  2E1M C;  2BGC A;  4ENK A;  2WV1 A;  3DQV C;  2ZB9 A;  3U2R A;  1Z3Y A;  5IOZ A;  5DD8 A;  4CYC A;  2BBY A;  2ESN A;  3KP6 A;  2LNB A;  1P92 A;  1X1D A;  2EFO A;  4ASN A;  3GVA A;  1S5L C;  1X2M A;  5FKL A;  5K1Y A;  9ANT A;  3EPZ A;  1R22 A;  1N75 A;  2LK2 A;  2IA2 A;  5JLW A;  3M4O J;  4ESJ A;  1SMY F;  2CG4 A;  4NNJ A;  3FXO A;  3L2U A;  3HRM A;  4IEJ A;  2CMP A;  2X9D A;  4MO7 A;  2DA5 A;  4GYG A;  2QSG X;  2FX0 A;  5FKN A;  2COB A;  4A3D J;  1HDP A;  2XAQ A;  3Q9V A;  2CO5 A;  2YR2 A;  3DEW A;  3N97 A;  2D45 A;  1D0Z A;  3QQA A;  3VB2 A;  4YFX F;  2ZFU A;  3JRG A;  5LEJ A;  3JR9 A;  4J19 A;  2MW8 A;  3W2W A;  1OCT C;  2N8G A;  1TT0 A;  4CO8 A;  4XLP F;  3WU2 C;  2CV1 A;  3CP8 A;  5KNL A;  4LLN A;  3LWF A;  4PFP A;  2R4G A;  1S7O A;  3PNT A;  2Q8K A;  3E6B A;  4E7Z A;  4ESB A;  3CZ6 A;  3K1N A;  1RUO A;  4G7O F;  4JOM A;  2BY1 A;  1D8K A;  3FF5 A;  5FLM J;  2QSF X;  1QGP A;  1RET A;  2CQX A;  4JK1 X;  3WGI A;  3RZD J;  2YUS A;  2P7C B;  2MG4 A;  2FNA A;  3WTU C;  1UZC A;  1MGT A;  4Q5S F;  2HOA A;  3HTS B;  1GV2 A;  2CSO A;  2EIK H;  3EET A;  4G8X A;  3E3V A;  3HEF A;  2PEX A;  3Q0W A;  1Y6I A;  5HDN A;  2P0W A;  3RKY A;  2VL8 A;  1K6O A;  3LSM A;  4IQJ A;  1OLT A;  2BY0 A;  5KHD A;  1RIO H;  1OPC A;  4BGD A;  5JHU A;  2W82 A;  2BXZ A;  2KZG A;  1O57 A;  2BY3 A;  1A5J A;  2NOJ B;  2DOA A;  2MYS A;  2KIS A;  2P6S A;  1ZAO A;  5CVJ A;  4KA4 A;  3FBI B;  1WJB A;  2P5V A;  4DYQ A;  4M6Y A;  4MIM A;  1DDN A;  4XRS G;  5L3D A;  5B1A H;  1XTA A;  2QCO A;  2Y0S N;  4MFE A;  4X0G A;  4Y3O A;  3IWZ A;  2OCC H;  2FRH A;  2JPB A;  2L7K A;  4FIS A;  3W3C A;  2FMY A;  5FB2 A;  4CYC B;  1ZR4 A;  1ETW A;  4R8H A;  3RKQ A;  1FYL A;  4Z6Y A;  2WY7 Q;  3EQL F;  1H9T A;  5C44 J;  1A6I A;  5IY5 H;  2QWW A;  5HNH A;  1X3Z B;  2HQR A;  1YIT I;  4XL9 A;  1T0F A;  5J1U A;  2DDB A;  2IS6 A;  5E3N A;  2ZCW A;  3OYJ A;  3LMM A;  1HC8 A;  4U0W A;  2XRN A;  3ZPL A;  3A0B C;  2F5V A;  2DMN A;  1JGG A;  1WJA A;  1POG A;  3F21 A;  3U9G A;  5LD2 C;  1PDN C;  3AL0 C;  2Y9Z A;  2KL4 A;  2MH9 A;  2VBY A;  3BJA A;  1NH3 A;  1GXP A;  1T56 A;  4KT5 C;  4LB5 A;  1UHS A;  2RQQ A;  4E4H A;  2ZC2 A;  3RPU D;  2RNG A;  3BCA A;  5H2F C;  3IRR A;  2PMU A;  1QHH D;  3DU5 A;  3L2R A;  1WQ2 A;  2W1O A;  3JAM Z;  2CGP A;  4CCL A;  5F6F A;  2OPT A;  4YFK F;  2CYY A;  3QPL A;  4GRI A;  4PSX A;  2LDU A;  3S14 J;  3D5L A;  2KRF A;  4GDF A;  4J00 A;  4GXO A;  1Z7U A;  2HPM A;  2W7N A;  5D6F A;  1JKO C;  1FSE A;  3ECO A;  3UKG A;  2LR8 A;  1W5C C;  3JRA A;  3T0Y A;  5FFZ A;  1XB4 A;  1E3P A;  2IGK A;  2KFD A;  2MBF A;  5CQE A;  3JSO A;  2JRM A;  1R58 A;  3CLQ A;  1UG0 A;  1FOX A;  1TZL A;  3OS2 A;  2LFB A;  2IGM A;  2ZME B;  3OYI A;  2GWR A;  2X0L A;  5D4S A;  3W2V A;  2CW0 F;  2M1B A;  3ZN0 A;  3C3W A;  2Y75 A;  4RGS A;  5HNF A;  3SEQ A;  3ZQC A;  3FXU A;  2FUG 2;  2RGV A;  1SAU A;  3LSG A;  3R0A A;  3WTZ A;  1XSX A;  2DFI A;  3CUO A;  4EGY A;  2QSH X;  1WWX A;  2AQF A;  3P7N A;  1O3Q A;  1WFX A;  2H6C A;  4ZYA A;  4IHY A;  2WAE A;  4MTD A;  5LGT A;  4IJA A;  4XID A;  2K9Q A;  4F52 A;  4UHT A;  4WXD A;  3S2W A;  1BOA A;  3Q3S A;  2L7F P;  2HKO A;  3KE2 A;  1X4O A;  4I76 A;  3S16 J;  2AO9 A;  2QGU A;  3BT9 A;  3OMY A;  4P5O A;  3VFZ A;  4A5N A;  5DCM A;  3L7W A;  4I98 B;  5F1R A;  3A01 B;  5TRD A;  2DT7 B;  1U8R A;  2X51 A;  2ZXJ A;  1W5T A;  2JQ7 A;  1UEL B;  3GUD A;  2VLA A;  4DJA A;  2LTP A;  4KN7 X;  1VND A;  2B7E A;  4MGR A;  3H9G A;  2VXD A;  3M7G A;  1JKR C;  4I02 A;  1H0M A;  1FY7 A;  5BQT A;  1MW7 A;  2XAJ A;  2GOM A;  2GLO A;  1LEB A;  4CCK A;  3MFK A;  1HOM A;  4RM3 A;  1MSF C;  2JVG A;  5JHF A;  1JGS A;  2HVQ A;  4L0Y B;  3BG5 A;  2Z1D A;  3AG3 H;  4XKW A;  2JTV A;  4ZYD A;  5B5E C;  4OU0 A;  4ZZD A;  3D1N I;  1BJZ A;  4D5C A;  3CJN A;  2D5V A;  1B59 A;  2J5P A;  2DQR A;  2R0Q C;  3K9T A;  2BEO A;  5K7F A;  3CF5 F;  2CRG A;  4UNO A;  3FXM A;  4B43 A;  5FGM A;  1SFO J;  2JPC A;  3HOT A;  2EIM H;  1O4X A;  4FHT A;  2COM A;  5J1R A;  3SYT A;  2XIG A;  1YS7 A;  4IVN A;  3ZMT A;  3TW7 A;  2R5Z A;  1MND A;  4UXN A;  1QVU A;  2KJC A;  2O0Y A;  4BBR J;  2LC2 A;  3P9I A;  1LDJ A;  1S8N A;  3RQI A;  2KIU A;  1SFX A;  3TDU C;  2VBZ A;  1GLN A;  2LRE A;  2X48 A;  1MDM A;  4QLC U;  1J7K A;  1MKM A;  5IP7 J;  2VC1 A;  1R9T J;  2EIN H;  4DOZ A;  3KP2 A;  1IO2 A;  2AXL A;  2VN2 A;  2CU7 A;  4BJ6 C;  3PM1 A;  4A3B J;  5H20 A;  4QSH A;  1EJ9 A;  1TQP A;  1B9N A;  3EUH C;  3ZMS A;  3H9J A;  1V54 H;  1W4M A;  3GEZ A;  2VJI A;  4BQA A;  4Y4R A;  5GTH C;  2DYR H;  4YII A;  2K4J A;  1YX3 A;  4N9H A;  1G2H A;  4KUM A;  1XGO A;  1BM9 A;  4HLX A;  2NVT J;  2VOP A;  1A04 A;  1XGN A;  3VOD A;  2PJR A;  1MJ9 A;  4LG3 A;  3RPU A;  3A02 A;  1BW5 A;  1BI2 A;  2LY2 A;  3NRV A;  4I2O A;  2VB6 A;  3C7J A;  3GTP J;  1MMS A;  1KON A;  2QUF A;  4M9Z A;  1VF9 A;  1W0U A;  3M1E A;  2XGE A;  2WAD A;  5AIP A;  4YIF A;  5BS6 A;  4XNF A;  4Y17 A;  2XSD C;  3O2P E;  1YIJ I;  2QBY B;  2VE8 A;  4RGU A;  2QA4 I;  4KT6 A;  4ZH4 F;  1YW8 A;  2W57 A;  3RYP A;  2FU4 A;  1T39 A;  1SMT A;  3V8J A;  4UY8 I;  3CCM I;  4C2M J;  1VQL I;  2IGO A;  2HTS A;  2HWV A;  2L01 A;  1LE8 A;  4RMN A;  3T8R A;  3ZMV A;  4A0Y A;  4BNC A;  2HI3 A;  2BZT A;  3CDL A;  1ZRC A;  5HS7 A;  2EFP A;  3GME A;  4AYB A;  5BOX A;  1BI1 A;  3GW2 A;  1Z7L A;  2FOK A;  4A3M J;  4M9X A;  5IT3 A;  2O9L A;  3HOZ J;  2ELK A;  2JA5 J;  2NS8 A;  2LKX A;  2Z9O A;  3I9V 2;  4KJZ A;  4N4O B;  3DEU A;  3FDY A;  5L3F A;  1NHA A;  2ECB A;  3D0S A;  2G0E A;  1P7I A;  3VEP A;  4HQE A;  2OU2 A;  3IUO A;  3OS0 A;  1P4X A;  3GCM A;  2V1X A;  1FOK A;  2NS7 A;  1TNT A;  2ZME C;  3KX2 A;  1VQ4 I;  5M5W J;  3KZZ A;  4R79 A;  1J9I A;  2CJJ A;  3DEE A;  2F5D A;  3K4C A;  3RZO J;  1RKW A;  3F6V A;  2M5W A;  1FIA A;  2JK3 A;  3H35 A;  3JRD A;  5IT9 K;  1AHD P;  1XMA A;  2GZW A;  5CPR B;  3I4N J;  5IP9 J;  5C4X J;  1FBS A;  1I3A A;  2H8R A;  2OF7 A;  2M2E A;  2VJJ A;  1UG2 A;  5ICG A;  2XKP A;  2H94 A;  5CVR A;  2DPD A;  1T33 A;  3O3K A;  3V42 A;  1FBU A;  2HYF A;  4LJZ F;  3OYA A;  2DFH A;  1QZE A;  3B6A A;  3E5U A;  5ERI A;  4B3A A;  3BP8 A;  4BHB A;  3ZMZ A;  3I4M J;  4WXH A;  1MMG A;  3DTI A;  1K7A A;  3ERE D;  4E6K G;  1ZEL A;  3CC7 I;  2STT A;  2P5K A;  4I0B A;  2QVO A;  1VTN C;  1WI3 A;  1ENH A;  2DTR A;  1T98 A;  2X1C A;  3ZQQ A;  3DWL E;  4UVA A;  1EA3 A;  3OYD A;  4BE1 A;  1HQC A;  2WA0 A;  3QOP A;  4UB8 C;  1PUF A;  4ZTF A;  3SQN A;  3F8N A;  2A6E F;  4LOC A;  4Y13 A;  1R1U A;  1S3J A;  3S15 J;  5DUK A;  1P9Q C;  3F9K A;  1BI0 A;  3HG9 A;  3K70 C;  1N25 A;  1YO5 C;  1K79 A;  3M3Y J;  1MNE A;  1TC3 C;  2XAG A;  2GA1 A;  3E6D A;  2V9V A;  2MAB A;  2A3S A;  3FM3 A;  4RAF A;  2M4K A;  3J81 K;  5HLH A;  5IPA A;  1RZ4 A;  3I59 B;  2A6H F;  2VOO A;  4AUX A;  1Z77 A;  4BE2 A;  2B63 J;  1MH4 A;  1FIP A;  3PSI A;  4PGG A;  4IQ4 A;  1FX7 A;  1J5Y A;  4XRF A;  4XN0 A;  1HF0 A;  2NNY A;  4P9F A;  3TO9 A;  1FEX A;  3VYU B;  3FXR A;  2LBF B;  2DYS H;  3LA7 A;  2MGQ A;  4XLA A;  1ZGA A;  3IH3 A;  1JTX A;  4WCG A;  5K7H A;  2HTJ A;  1VQ7 I;  1W7P A;  3FMR A;  2ADU A;  2EJR A;  3IRQ A;  2BHY A;  1OYY A;  1JKQ C;  2V1N A;  2AS5 F;  1DU6 A;  1XCV A;  1OCP A;  4FE4 A;  1B1B A;  1HSJ A;  1QBJ A;  2M34 A;  3HOU J;  4F91 B;  1Z9C A;  1FYK A;  1IC8 A;  3E97 A;  3L09 A;  1D3Y A;  3AAF A;  3S1N J;  3OYM A;  3OV8 A;  5LRR A;  1ZQ3 P;  2OCE A;  2PLY A;  3S2D J;  2HGC A;  4BBS J;  3HXL A;  4HDU A;  2TRT A;  4D9J A;  1Y0N A;  5HLG A;  4NQW B;  2DA1 A;  4L9N A;  1Z1D A;  2DQL A;  3FIS A;  3GXO A;  2R5Y B;  1SAX A;  1KQ0 A;  1I6X A;  3QPS A;  3C1D A;  2EFQ A;  1JUS A;  2XAU A;  4KIF A;  3BWG A;  2E35 A;  3KP5 A;  2K3F A;  1AA7 A;  1YG2 A;  4XN3 A;  1FOY A;  3F23 A;  1R5G A;  3FHN A;  1R6R A;  1AKH B;  1IRX A;  3IAM 2;  4NC7 A;  1B8I A;  5L3B A;  2HQA A;  2KIM A;  2DOE A;  2NNN A;  1D1A A;  1OCR H;  2H27 A;  2PI0 A;  5C4J J;  2XF5 A;  2E36 A;  1ZRF A;  4XRM A;  2IS2 A;  1F4K A;  4I09 A;  4F3Q A;  2Y31 A;  3CCY A;  1B8I B;  2H6B A;  3DTE A;  1U78 A;  3J81 Z;  3JRB A;  1F5T A;  2DA2 A;  2EBI A;  3LNQ A;  2PMH A;  2WWY A;  2KHM A;  3LAJ A;  1JT0 A;  1P6R A;  1LEA A;  5GPA A;  2Z33 A;  4UV9 A;  2UWM A;  2DXI A;  2AXT C;  1FTZ A;  4RGX A;  1V4R A;  4O3M A;  1L3L A;  2X6Y A;  4CHU A;  2XDV A;  2IEK A;  3F0C A;  1WCM J;  3O6B B;  3ML6 A;  1YX5 A;  4OWR B;  2E5Z A;  3B73 A;  2DT6 A;  3GZN B;  1X58 A;  1YQA A;  3C2G A;  2UUZ A;  2J5O A;  3TMO A;  2JWT A;  3H36 A;  2DMP A;  4G6Q A;  4CSW A;  2I5U A;  3BQY A;  2HXI A;  4CGZ A;  3CO6 C;  3ISP A;  4LFU A;  1MBH A;  2GM4 A;  3ZXS A;  1KU9 A;  3J7Z I;  2ETH A;  1FLI A;  4XKV A;  6PAX A;  3PUB A;  4L5E A;  1Q1V A;  4I01 A;  1I27 A;  3OL3 A;  3CLO A;  5HLT A;  4BEH B;  3MVP A;  1WJD A;  2P8T A;  3CME I;  4A3J J;  1NTC A;  2DMU A;  1IUF A;  1YS6 A;  3B02 A;  2ECC A;  2OD5 A;  3HPG A;  2CUF A;  2DI3 A;  1QVT A;  3JRH A;  3FIW A;  3VDX A;  1EH8 A;  4PJM A;  1B4A A;  4BJ5 C;  4ZTJ A;  3BOQ A;  2M0M A;  3I56 I;  1TT5 B;  1F43 A;  3CC4 I;  1CF7 A;  1QPM A;  2E5N A;  2KIQ A;  3D5R C;  5ICC A;  1F9N A;  2YX4 A;  3SZG A;  3EUH A;  1RUN A;  1E3O C;  2BY2 A;  4B3X A;  4G7H F;  3JTG A;  1LDD A;  5E1Z B;  1V5G A;  1ETY A;  3P9K A;  5IYD J;  1L0O C;  3V7C A;  2E7X A;  2G7H A;  4CCJ A;  1NK3 P;  5LBQ A;  1BA5 A;  2W24 A;  1ZHF A;  3V8K A;  5IP6 A;  4S04 A;  1MBG A;  4UUT A;  4GO1 A;  4LIV A;  1O3R A;  1BOB A;  4LD5 A;  2LKS A;  1EH6 A;  1MIJ A;  2G9W A;  3G6E I;  5DYM A;  1RES A;  5GPC A;  1QU3 A;  2YU3 A;  1SVL A;  3GLL A;  3HOY J;  1BR2 A;  3CCE I;  1UST A;  2R7U A;  2HYG D;  5E3L A;  5DV5 A;  3BZK A;  1VQ6 I;  2FNP A;  1ZR2 A;  4NC6 A;  2HKX A;  3WTX C;  3CCL I;  1QQI A;  2ZNZ A;  2CWE A;  2P4W A;  2GQQ A;  2L9S A;  1EKE A;  2ZKZ A;  5EG0 B;  2IGN A;  2JRT A;  4M3D A;  2CQN A;  5FRM A;  2LP0 A;  3FK7 A;  2K9N A;  4HNU A;  3RCO A;  4A12 A;  5BMZ A;  1AKH A;  4HYE A;  1KQ8 A;  1J75 A;  4KN4 X;  1DPU A;  1Y1V J;  4BDZ A;  3GTG J;  2ZXH A;  5J40 A;  2NVY J;  4BXU A;  1FWZ A;  2W85 A;  1W0T A;  3BLY A;  4CZC A;  3QWL A;  1X1C A;  1D5Y A;  1NK2 P;  2IJL A;  4IX7 A;  3HL2 A;  1GVJ A;  1V5F A;  3V7S A;  1RR8 C;  1EV7 A;  3V8L A;  5JVG F;  1H9G A;  3IH2 A;  1O7L A;  4UUS A;  3QYE A;  1ZRE A;  4V2F A;  2ZXI A;  4U7B A;  1WVR A;  2EV6 A;  2DFF A;  3K2A A;  1BIB A;  3CCU I;  5FKM A;  4D5F A;  3ZQL A;  3KFW X;  4M71 A;  4LIU A;  3OL4 A;  3Q0V A;  1P2F A;  4XMY A;  3GYH X;  4L5I A;  4LG0 B;  2M45 A;  2DCE A;  1X3U A;  2DLL A;  5HS9 A;  4GGG A;  1ZKG A;  1E2X A;  5EZG A;  5D8L B;  4HST A;  4OMY A;  3IHU A;  2WY8 Q;  5ILS A;  3RPQ A;  2E71 A;  5GAG J;  3KET A;  1BBY A;  2R7W A;  3Q5F A;  4XSZ F;  1ON2 A;  1OCC H;  3CCV I;  1FPQ A;  1QO0 D;  3HRS A;  1IRZ A;  2FF4 A;  3JCU C;  4CCN A;  2LSO A;  2XPU A;  2UXN A;  2WB1 N;  1ZGJ A;  4A69 C;  1A31 A;  3GBG A;  4HDV A;  3KEQ A;  1MBK A;  3WTV C;  3MWM A;  3CCR I;  2JUC A;  4E7L A;  2CQK A;  1DGR M;  2V6C A;  3JW4 A;  3QP6 A;  4PDK A;  1GT0 C;  4HNT A;  2ME0 A;  2HDD A;  3K7A J;  2M87 A;  3IKV A;  1G3Y A;  5CVV A;  1TWA J;  3OIP A;  4OAY A;  3UNG C;  3K0L A;  4KYW A;  4HLY A;  3G1O A;  3ZRG A;  4A6D A;  5EEA A;  2R7Q A;  5ILV A;  3HKZ N;  4NB5 A;  2G7U A;  3JTH A;  1YRN B;  3C2H A;  2WV0 A;  3AL0 B;  1Y1W J;  3G1L A;  1IG7 A;  4B48 A;  2HS5 A;  2Q2E A;  4FE7 A;  3RJP A;  4MQV A;  3GTO J;  2XV4 S;  2GIV A;  1KU2 A;  3GTJ J;  2OC6 A;  4KMF A;  1VFC A;  4FQG A;  2R5Z B;  2A5Y B;  3KPH A;  3G2B A;  2Z99 A;  1DUX C;  4ZZL A;  2E7W A;  1FYM A;  3LA3 A;  5TGT A;  1HKS A;  4FET A;  4B1R A;  1YW9 A;  3H3V K;  2VQC A;  2ZJ2 A;  3LSJ A;  4I7H A;  4BAY A;  1T8I A;  1ITY A;  1G59 A;  1YLF A;  3KEO A;  4A3G J;  1WZ2 A;  2QQ8 A;  3NEU A;  5E17 F;  1VQ9 I;  3K6G A;  3S8P A;  3OOU A;  1IRF A;  1IZ1 A;  5E3O A;  1XGS A;  3F8M A;  1IDY A;  3SEZ A;  5KAF C;  3NAR A;  3DBL B;  2O5R A;  4ZYH A;  4C3I J;  2E60 A;  5K7Z A;  2L7Z A;  1G6N A;  2CV0 A;  1IRG A;  2OV7 A;  2Q2E B;  3LSH A;  2CS3 A;  2K85 A;  1OMI A;  2Q0O A;  4DNC A;  1Z6R A;  3KP7 A;  1KYW A;  3A03 A;  2KLO A;  1LDK B;  4IRG A;  3HOX J;  2XF6 A;  2LRD A;  2A5W A;  3D5S C;  4DQ2 A;  2VE9 A;  1NG7 A;  4WX9 A;  1XX5 A;  2VPL A;  4RAY A;  1UJ8 A;  5GAD J;  1W5S A;  1G4D A;  3VYR B;  2E34 A;  3E5Q A;  4YRV A;  4QPQ A;  4G94 A;  1VQP I;  3I54 A;  1MBF A;  1OKR A;  2QQ9 A;  1MBJ A;  3KLO A;  4HV6 A;  2HOE A;  5M5Y J;  2ZJQ F;  5F04 A;  3BQZ A;  1U6G A;  1U2W A;  4JBA A;  5F0F A;  5FLX K;  2XRL A;  5DM7 F;  3J80 K;  4LMY A;  5LRS A;  3OYN A;  3PUF A;  2F4M B;  1R7J A;  2M8E A;  2DA4 A;  4IRH A;  4PJN A;  1WI9 A;  3CCQ I;  4ABZ A;  4M73 A;  3HM5 A;  4DBR A;  3VWB A;  2K3P A;  4YIR X;  1IV6 A;  3CES A;  3HIF A;  3WTY C;  4RDU A;  1OJL A;  4YEJ A;  4XOP A;  1U9O A;  2EZK A;  2KZV A;  1NG6 A;  3RKX A;  4O5V A;  5D5V B;  1ZN2 A;  3U1D A;  3DCF A;  4IL6 C;  5KVR A;  1G3W A;  3AG2 H;  2IA0 A;  3E0J B; 
#chains in the Genus database with same CATH homology
 1UHW A;  2ZO4 A;  1F1Z A;  2H09 A;  1C0W A;  4ESF A;  4LLL A;  3FZV A;  3BPX A;  3VOE A;  4RB1 A;  4ZYG A;  1TQI A;  1DPR A;  3QPT A;  5E1W A;  2EV0 A;  2PG4 A;  1IN7 A;  4B8X A;  2O3F A;  5CVU A;  2EFN A;  2FBI A;  1ON1 A;  5FO5 A;  4CZZ A;  1QZY A;  4PGH A;  1J0R A;  1MJA A;  2RNJ A;  2DAO A;  3WG9 A;  3HHH A;  3RI4 A;  2L4A A;  1TW2 A;  4KIC A;  4MHG A;  4IXA A;  2E1N A;  4GYI A;  1YFH A;  3QU3 A;  4U7D A;  1ZYR F;  5FFX A;  1LQ1 A;  4L18 B;  2DO7 A;  1OYW A;  4Z2Y A;  3I53 A;  3REO A;  4K2E A;  3WTS C;  3BY6 A;  4UVB A;  2KIF A;  1WSU A;  3GFI A;  4OIN F;  1JHF A;  3T8T A;  3MAJ A;  2FE3 A;  3R6S A;  4IRI A;  1FP2 A;  3BJO A;  4IF4 A;  1S7A A;  3WTW C;  3ZMU A;  3KCC A;  3RIR A;  3FMQ A;  2X4H A;  1XCB A;  5K5R A;  2L02 A;  4FX4 A;  3LST A;  3ELK A;  5E8G A;  4S05 A;  3DF8 A;  1D8J A;  2MA3 A;  2XRO A;  1O3T A;  4OIP F;  3CUQ C;  4G9Y A;  1PUE E;  3SZT A;  4EVI A;  1U5T A;  2DT5 A;  4MQ9 F;  3MEX A;  3K69 A;  5CJ9 A;  1V3F A;  2OAZ A;  3TGN A;  1JE8 A;  2EA2 A;  1FZP B;  3LA2 A;  1HKQ A;  3ECH A;  1GHC A;  1KU3 A;  1J59 A;  2TDX A;  1RI7 A;  3I64 A;  1FT9 A;  2M30 A;  3SFZ A;  2RVC A;  1T2K A;  4M6X A;  2HEO A;  2F5E A;  2QEN A;  1Q1H A;  3GFJ A;  3DP7 A;  2O61 A;  2OZU A;  3NQO A;  4OIR F;  4RS8 A;  1KGS A;  2PBI A;  1HW1 A;  2DBB A;  3IWF A;  2K4B A;  1R1V A;  3I5U A;  1UFM A;  2IW5 A;  3RKW A;  1PP8 F;  1MD0 A;  2QM3 A;  5LHI A;  3DV8 A;  1BN5 A;  4RGR A;  2V79 A;  3FX3 A;  5JFR A;  1DP7 P;  3E5X A;  3EDP A;  1B9M A;  2P6T A;  2UZK A;  2JSC A;  2QQA A;  3QAH A;  1IXR C;  2ELH A;  3LQQ A;  2PN6 A;  5F64 A;  2FSW A;  3SHF A;  3GZ6 A;  4HF2 A;  3CUQ A;  1R36 A;  1HST A;  1UB9 A;  5ICE A;  3QRF F;  3WGH A;  3TKY A;  5J6X A;  2FQ3 A;  4YFN F;  1R00 A;  2VXZ A;  1EH7 A;  1I1G A;  2FA5 A;  1BIA A;  5LHH A;  2WTE A;  5TJJ A;  2C6Y A;  4EM2 A;  2A69 F;  3E6M A;  4CIC A;  1P4A A;  1ZAR A;  3BPV A;  5D8K B;  4UV8 A;  5LHG A;  5E1X A;  4M9S A;  3F8B A;  2R7F A;  1YTY A;  3M9A A;  4HA8 A;  2A07 F;  1ZG1 A;  2OBP A;  2LF7 A;  2E1C A;  3CO7 C;  4LK1 F;  3GX4 X;  5BPI A;  2IA1 A;  4KIB A;  3HYI A;  2RN7 A;  1W7P B;  1I1S A;  3BZ6 A;  1KQ9 A;  1JHH A;  2R3S A;  3MCZ A;  5E20 A;  5HOO A;  3RDI A;  3CDH A;  4BHP A;  1S29 A;  2NYX A;  5LGN A;  4G6D A;  4P55 A;  2VOD A;  4L0Z B;  4ETS A;  4FT8 A;  4CYD A;  2K86 A;  3I59 A;  2K7L A;  1YIO A;  3KLN A;  4O6J A;  4HOB A;  2RQP A;  2BE5 F;  3K2Z A;  2KJB A;  2W84 A;  3K1P A;  1XMK A;  3K1M A;  2IVM A;  4HZF A;  4IPA A;  2RV8 A;  2DW4 A;  1HW2 A;  1J2X A;  1ZLK A;  3PFI A;  4AD9 A;  2HZT A;  1W7P D;  2NS0 A;  3F3X A;  4YG2 F;  2DU9 A;  1UHM A;  2ISZ A;  1B6A A;  4Q48 A;  5D6E A;  2KKO A;  3ABT A;  3OOP A;  2B0L A;  1K78 A;  3GF2 A;  3KP3 A;  4A0X A;  2EV5 A;  3GWZ A;  5H6R A;  2GXG A;  1TW3 A;  2MD5 A;  3TQN A;  1R1T A;  5A2Q K;  3FWE A;  5D5U B;  5L3C A;  3H92 A;  1BC8 C;  2QBY A;  3DXJ F;  5KK1 A;  1XDS A;  1Z05 A;  4EJO A;  2Z5U A;  1U3E M;  4WWC A;  2ISY A;  1CGP A;  4WK8 F;  2OA4 A;  2VON A;  2VBW A;  2P5L C;  2XUB A;  2ESH A;  2CFX A;  3T1B A;  3I0T A;  1XD7 A;  1SD5 A;  2DK8 A;  4L5J A;  3ZN1 A;  2DK5 A;  2V1U A;  4LLG F;  4U88 A;  5ICF A;  1Z6T A;  2XAF A;  3EYY A;  4B09 A;  1XN7 A;  3H3Z A;  3RYR A;  4HX7 A;  4HX8 A;  3P9C A;  4R1H A;  2O8X A;  3TO6 A;  4JQF A;  3LQR A;  2OQR A;  4EV0 A;  1OYI A;  4Y15 A;  1U5T C;  5L3G A;  1LJ9 A;  4OIQ F;  3JSP A;  3QPH A;  2HFH A;  4E70 A;  1IAW A;  3TOA A;  2RDP A;  3WE3 A;  3I71 A;  4KFC A;  3IL2 A;  4HBL A;  4EGZ A;  2GA2 A;  4FX0 A;  4EMS A;  4HF0 A;  4OOI A;  2IP2 A;  5E8I A;  1FP1 D;  1IW7 F;  5CYV A;  5E18 F;  2EFW A;  4HW0 A;  4BH9 A;  5DCM B;  2F5C A;  3KZY A;  4GCV A;  4ENJ A;  1ULY A;  4OIO F;  1RNL A;  3Q9S A;  5EEH A;  4A6E A;  4A5M A;  4AWX B;  1SFU A;  4EJT A;  3H3U A;  2QYO A;  5JR3 A;  3FHZ A;  2EA4 A;  1SD7 A;  2ZNY A;  2VC0 A;  4TV7 A;  2LF8 A;  3GFL A;  3FMS A;  1QNT A;  2W25 A;  1XGM A;  5D5X B;  3ZP5 A;  2ZFW A;  2FBH A;  3SXY A;  1XDU A;  3W6J B;  2ZME A;  1AWC A;  2PQ8 A;  4MTE A;  4HV5 A;  1IN5 A;  4WXC A;  2O03 A;  3I4P A;  2XGX A;  1S6L A;  3SZP A;  4HF1 A;  2XAH A;  1ZH5 A;  2XKO A;  1KYZ A;  3ULQ B;  3CTA A;  4P9U A;  4XSX F;  3F72 A;  3WGG A;  1IXC A;  3PQJ A;  5J8C A;  3ZMD A;  5D5W B;  1U5T B;  2OQG A;  4EM0 B;  3L9F A;  1HKT A;  4PZJ A;  3TOB A;  1ODD A;  5BPD A;  1USS A;  4L9T A;  4U0V A;  3WOD F;  4Q47 A;  2ZBK A;  4UVC A;  2ACJ A;  3DFG A;  2YX7 A;  3L2C A;  2NRA C;  3GZ5 A;  4ENM A;  1LNW A;  4LB6 B;  4EQQ A;  4L9J A;  5J8F A;  2XHK A;  4N9I A;  4KNY A;  3G3Z A;  1TBX A;  1FBQ A;  3I58 A;  1XSD A;  3FXQ A;  4EM1 A;  2HDC A;  3IC7 A;  1TTY A;  2HQN A;  4U0Y A;  2QLZ A;  1TLH B;  5FLX Z;  5DDG A;  3HSR A;  3ABU A;  2GAU A;  1ZG3 A;  3RTR A;  4RB0 A;  2VT2 A;  4I0A A;  4KDP A;  5HVQ C;  3WU0 A;  2UXX A;  3L00 A;  3FM5 A;  4RAZ A;  2FXA A;  3EYI A;  1FNN A;  1WKM A;  4HQM A;  3LAP A;  4NQW A;  1Z91 A;  5K5O A;  1STZ A;  1SD4 A;  2O6G E;  4RB2 C;  3HOS A;  1P4W A;  4F7Z A;  1QZZ A;  1LVA A;  3HTU A;  3PQK A;  3C18 A;  3V7R A;  4OMZ A;  2K27 A;  4AIK A;  5FD5 A;  1FSH A;  2Y0M A;  1Y0U A;  3HRU A;  5FD6 A;  3WE2 A;  1SD6 A;  2LKP A;  4XBF A;  2YPR A;  3WU1 B;  1XSV A;  5A2Q Z;  5AIQ A;  3LFK A;  1T38 A;  4EJU A;  2XVC A;  3F22 A;  4ZYE A;  3HSF A;  2RKH A;  2MLK A;  4CDG A;  3ZQ7 A;  5JVT A;  3HSE A;  2BV6 A;  5D4R A;  3F8F A;  3M8E A;  3F8C A;  3HHG A;  2QZ8 A;  2PJP A;  1ONV A;  4HAM A;  4M72 A;  2R7D A;  3JAM K;  1E17 A;  2HR3 A;  5DD4 A;  3BDD A;  2GXB A;  1BC7 C;  1WRJ A;  4Q4Z F;  4WF2 A;  3GLX A;  1REP C;  5H6Q A;  1IF1 A;  1ZRD A;  2IPQ X;  1YYV A;  4P96 A;  4MNU A;  4RB3 C;  2MH2 A;  1I5Z A;  3HRT A;  1ZG5 A;  1R5H A;  1HBX G;  1HXD A;  2OZ6 A;  3MQ0 A;  3J80 Z;  3G73 A;  1G3T A;  4HX4 A;  4N0B A;  2A61 A;  4UUV A;  1UCR A;  1JXS A;  1GXQ A;  3QU6 A;  4ON0 A;  5EEG A;  1KU7 A;  2VT3 A;  2FML A;  2PFB A;  1MDM B;  5CVI A;  1IN4 A;  4EJW A;  3HUG A;  2RC4 A;  4QWQ A;  3R4K A;  1D5V A;  3DPL C;  3R61 A;  2EK5 A;  2F2E A;  1G3S A;  2L54 A;  5HDK A;  1R23 A;  1SFE A;  2NAZ A;  3N4M A;  4BHC A;  3R60 A;  1IN6 A;  4PCQ A;  5ILU A;  4AIJ A;  1IN8 A;  3MZY A;  2EB7 A;  3M8F A;  4IHS A;  4AIH A;  1TNS A;  2A68 F;  3E6C C;  2F5F A;  5JI6 A;  3ROU A;  3V4G A;  5HS8 A;  3BJ6 A;  4IHT A;  3GFM A;  3WTT C;  1HW5 A;  3GO5 A;  5DUI A;  4D0P A;  1KA8 A;  4L9V A;  5AON A;  3T5X A;  3DPT A;  5HDG A;  1IUY A;  2Y48 A;  1MJB A;  4A2U A;  1MZB A;  3R0J A;  4CXF A;  4KMU X;  1LB2 A;  2VBX A;  3J7A O;  2L4M A;  4MEX F;  5L3E A;  3QP5 A;  2DPU A;  5CLS A;  5LEK A;  3COA C;  3F6O A;  2FEZ A;  4EJV A;  2MLG A;  4ENN A;  4LG0 A;  2XAS A;  3IKT A;  1OR7 A;  3DKW A;  1YW7 A;  2L3D A;  4BYY A;  4MEY F;  5LGU A;  3CUQ B;  4KIG A;  2BYV E;  2K02 A;  5HLI A;  5DEQ A;  1K78 B;  4NHJ A;  3TO7 A;  2EWN A;  3BRO A;  4XLN F;  1TQM A;  4LGW A;  4H0E A;  4AVP A;  4M74 A;  1CF7 B;  2D1H A;  2MC3 A;  2JZY A;  2IT0 A;  1AOY A;  1PP7 U;  2D2W A;  4A0Z A;  1BJA A;  1T6S A;  5LLQ A;  2IRF G;  3KP4 A;  2FBK A;  2D1V A;  1ZLJ A;  1BI3 A;  3MZH A;  1O3S A;  5DCF A;  4G7Z F;  5IT9 Z;  2YSR A;  5K5Q A;  2STW A;  2P7V B;  4LK0 F;  2WC2 A;  3TDZ C;  5ED4 A;  2Z3Y A;  1IXS B;  1FC3 A;  1O7F A;  3W6K B;  2JT1 A;  2V1D A;  2QQB A;  2BGC A;  4ENK A;  3DQV C;  3U2R A;  5DD8 A;  2BBY A;  2ESN A;  3KP6 A;  2LNB A;  1P92 A;  2EFO A;  4ASN A;  3GVA A;  5K1Y A;  1R22 A;  2IA2 A;  4ESJ A;  1SMY F;  2CG4 A;  3HRM A;  4GYG A;  2XAQ A;  3Q9V A;  2CO5 A;  2YR2 A;  3N97 A;  2D45 A;  3VB2 A;  4YFX F;  5LEJ A;  4CO8 A;  4XLP F;  4LLN A;  3LWF A;  1S7O A;  2Q8K A;  3E6B A;  4ESB A;  3K1N A;  1RUO A;  4G7O F;  1D8K A;  3FF5 A;  1QGP A;  4JK1 X;  3WGI A;  2P7C B;  2FNA A;  3WTU C;  1MGT A;  4Q5S F;  3HTS B;  2CSO A;  3EET A;  4G8X A;  3E3V A;  2PEX A;  5HDN A;  3RKY A;  1K6O A;  1RIO H;  1OPC A;  5JHU A;  1O57 A;  2P6S A;  1ZAO A;  5CVJ A;  4KA4 A;  2P5V A;  4M6Y A;  1DDN A;  5L3D A;  3IWZ A;  2FRH A;  2JPB A;  2FMY A;  5FB2 A;  4R8H A;  1FYL A;  3EQL F;  1H9T A;  2QWW A;  2HQR A;  1T0F A;  2ZCW A;  4U0W A;  2XRN A;  3ZPL A;  3F21 A;  3U9G A;  1PDN C;  2MH9 A;  2VBY A;  3BJA A;  4LB5 A;  1GXP A;  4KT5 C;  3IRR A;  2PMU A;  1WQ2 A;  3JAM Z;  2CGP A;  5F6F A;  4YFK F;  2CYY A;  2LDU A;  3D5L A;  2KRF A;  4GXO A;  1Z7U A;  5D6F A;  1FSE A;  3ECO A;  3T0Y A;  5FFZ A;  1XB4 A;  2MBF A;  3JSO A;  1R58 A;  2ZME B;  2GWR A;  2X0L A;  5D4S A;  2CW0 F;  2M1B A;  3ZN0 A;  3C3W A;  2Y75 A;  4RGS A;  3FXU A;  3WTZ A;  4EGY A;  2RGV A;  3R0A A;  1XSX A;  2DFI A;  3CUO A;  1WWX A;  3P7N A;  1O3Q A;  2H6C A;  4MTD A;  5LGT A;  4IJA A;  4UHT A;  4WXD A;  3S2W A;  1BOA A;  3KE2 A;  2HKO A;  4P5O A;  3VFZ A;  4A5N A;  5DCM A;  3L7W A;  4I98 B;  5F1R A;  5TRD A;  1U8R A;  2ZXJ A;  1W5T A;  3GUD A;  4KN7 X;  4MGR A;  3M7G A;  4I02 A;  1H0M A;  1FY7 A;  5BQT A;  2XAJ A;  1LEB A;  3MFK A;  1JGS A;  4L0Y B;  2JTV A;  4ZYD A;  4OU0 A;  4ZZD A;  3CJN A;  1B59 A;  2J5P A;  2DQR A;  3K9T A;  2BEO A;  4UNO A;  5FGM A;  2JPC A;  3HOT A;  4FHT A;  2COM A;  2XIG A;  1YS7 A;  4IVN A;  3ZMT A;  4UXN A;  2KJC A;  2O0Y A;  3P9I A;  1LDJ A;  1S8N A;  2KIU A;  1SFX A;  3TDU C;  2VBZ A;  1MDM A;  4QLC U;  1J7K A;  1MKM A;  2VC1 A;  3KP2 A;  2AXL A;  2VN2 A;  5H20 A;  1TQP A;  1B9N A;  3ZMS A;  1W4M A;  3GEZ A;  4BQA A;  4YII A;  2K4J A;  4N9H A;  4KUM A;  1XGO A;  1BM9 A;  4HLX A;  2VOP A;  1A04 A;  1XGN A;  3VOD A;  1MJ9 A;  3RPU A;  1BI2 A;  3NRV A;  4I2O A;  3C7J A;  2QUF A;  4M9Z A;  3M1E A;  5AIP A;  4YIF A;  5BS6 A;  4Y17 A;  3O2P E;  2QBY B;  2VE8 A;  4RGU A;  4ZH4 F;  1YW8 A;  2W57 A;  3RYP A;  2FU4 A;  1T39 A;  1SMT A;  3V8J A;  2HTS A;  2HWV A;  2L01 A;  3T8R A;  3ZMV A;  4A0Y A;  4BNC A;  1ZRC A;  5HS7 A;  2EFP A;  5BOX A;  1BI1 A;  3GW2 A;  2FOK A;  4M9X A;  5IT3 A;  2Z9O A;  3DEU A;  5L3F A;  1NHA A;  3D0S A;  3VEP A;  4HQE A;  2OU2 A;  1P4X A;  2V1X A;  1FOK A;  1TNT A;  3KZZ A;  4R79 A;  1J9I A;  2F5D A;  3F6V A;  2M5W A;  5IT9 K;  1XMA A;  2GZW A;  1FBS A;  5ICG A;  2XKP A;  2H94 A;  5CVR A;  2DPD A;  3O3K A;  1FBU A;  2HYF A;  4LJZ F;  3E5U A;  5ERI A;  3BP8 A;  4BHB A;  3ZMZ A;  4WXH A;  1K7A A;  3ERE D;  2STT A;  2P5K A;  4I0B A;  2QVO A;  1VTN C;  2DTR A;  1T98 A;  4UVA A;  1HQC A;  3QOP A;  3SQN A;  3F8N A;  2A6E F;  4Y13 A;  1R1U A;  1S3J A;  5DUK A;  1BI0 A;  1YO5 C;  1K79 A;  2XAG A;  2GA1 A;  3E6D A;  2V9V A;  2A3S A;  3FM3 A;  3J81 K;  5HLH A;  2VOO A;  1RZ4 A;  3I59 B;  2A6H F;  4PGG A;  1FX7 A;  1J5Y A;  4XRF A;  2NNY A;  4P9F A;  3TO9 A;  3FXR A;  3LA7 A;  1ZGA A;  4WCG A;  2HTJ A;  1W7P A;  3FMR A;  2ADU A;  2EJR A;  3IRQ A;  1OYY A;  2AS5 F;  1XCV A;  1B1B A;  1HSJ A;  1QBJ A;  1Z9C A;  1FYK A;  3E97 A;  3L09 A;  1D3Y A;  3AAF A;  3OV8 A;  5LRR A;  2PLY A;  2HGC A;  4HDU A;  5HLG A;  4L9N A;  1Z1D A;  2DQL A;  1SAX A;  3GXO A;  1KQ0 A;  1I6X A;  3C1D A;  2EFQ A;  4KIF A;  3BWG A;  3KP5 A;  1YG2 A;  3F23 A;  1R5G A;  5L3B A;  2KIM A;  2NNN A;  2H27 A;  2PI0 A;  1ZRF A;  1F4K A;  4I09 A;  2H6B A;  1U78 A;  3J81 Z;  1F5T A;  2PMH A;  2WWY A;  3LAJ A;  1P6R A;  1LEA A;  2Z33 A;  4UV9 A;  2UWM A;  4RGX A;  1V4R A;  4O3M A;  1L3L A;  4CHU A;  3O6B B;  3ML6 A;  3B73 A;  1YQA A;  2J5O A;  4G6Q A;  4CGZ A;  3CO6 C;  3ISP A;  4LFU A;  1KU9 A;  2ETH A;  1FLI A;  6PAX A;  4I01 A;  1I27 A;  3CLO A;  2P8T A;  1YS6 A;  3B02 A;  2OD5 A;  2DI3 A;  1EH8 A;  1B4A A;  3BOQ A;  1CF7 A;  1QPM A;  5ICC A;  1F9N A;  2YX4 A;  3EUH A;  1RUN A;  4G7H F;  3JTG A;  1LDD A;  5E1Z B;  3P9K A;  1L0O C;  3V7C A;  2E7X A;  2G7H A;  5LBQ A;  2W24 A;  1ZHF A;  3V8K A;  4S04 A;  4GO1 A;  1O3R A;  4LD5 A;  1EH6 A;  2G9W A;  5DYM A;  2YU3 A;  1UST A;  2HYG D;  5DV5 A;  2FNP A;  2HKX A;  3WTX C;  1QQI A;  2ZNZ A;  2CWE A;  2P4W A;  2GQQ A;  2ZKZ A;  2JRT A;  5BMZ A;  4A12 A;  4HYE A;  1KQ8 A;  1J75 A;  4KN4 X;  1DPU A;  4BXU A;  1FWZ A;  2W85 A;  2IJL A;  1GVJ A;  3V7S A;  1EV7 A;  3V8L A;  1H9G A;  1O7L A;  1ZRE A;  4U7B A;  2EV6 A;  1BIB A;  3KFW X;  4M71 A;  1P2F A;  3GYH X;  4L5I A;  4LG0 B;  2M45 A;  1X3U A;  2DLL A;  5HS9 A;  4GGG A;  1E2X A;  5D8L B;  4OMY A;  3IHU A;  5ILS A;  3RPQ A;  3KET A;  1BBY A;  3Q5F A;  4XSZ F;  1ON2 A;  1FPQ A;  1QO0 D;  3HRS A;  2FF4 A;  2LSO A;  2UXN A;  1ZGJ A;  4HDV A;  3KEQ A;  3WTV C;  3MWM A;  2CQK A;  4PDK A;  2V6C A;  3JW4 A;  3QP6 A;  2M87 A;  3IKV A;  1G3Y A;  5CVV A;  3K0L A;  4KYW A;  4HLY A;  4A6D A;  5ILV A;  4NB5 A;  2G7U A;  3JTH A;  2WV0 A;  2HS5 A;  2Q2E A;  3RJP A;  4MQV A;  2XV4 S;  2GIV A;  1KU2 A;  4KMF A;  2A5Y B;  2Z99 A;  1DUX C;  4ZZL A;  2E7W A;  1FYM A;  3LA3 A;  1HKS A;  1YW9 A;  2ZJ2 A;  4BAY A;  4I7H A;  1YLF A;  3KEO A;  3NEU A;  5E17 F;  1IRF A;  1IZ1 A;  1XGS A;  3F8M A;  4ZYH A;  1G6N A;  1IRG A;  4DNC A;  1OMI A;  2Q0O A;  1Z6R A;  3KP7 A;  1KYW A;  1LDK B;  4IRG A;  4DQ2 A;  2VE9 A;  4WX9 A;  4RAY A;  1W5S A;  1G4D A;  3E5Q A;  4G94 A;  3I54 A;  1OKR A;  2QQ9 A;  3KLO A;  4HV6 A;  2HOE A;  1U6G A;  1U2W A;  4JBA A;  5FLX K;  3J80 K;  4LMY A;  5LRS A;  1R7J A;  2M8E A;  4IRH A;  1WI9 A;  4M73 A;  3HIF A;  3WTY C;  3RKX A;  4O5V A;  5D5V B;  1ZN2 A;  3U1D A;  5KVR A;  1G3W A;  2IA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...