2ESHA

Crystal structure of conserved protein of unknown function tm0937- a potential transcriptional factor
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
114
structure length
114
Chain Sequence
RGGRGFRGWWLASTILLLVAEKPSHGYELAERLAEFGIEIPGIGHMGNIYRVLADLEESGFLSTEWDTTVSPPRKIYRITPQGKLYLREILRSLEDMKRRIETLEERIKRVLQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein TM0937
publication title Crystal Structure of Conserved Hypothetical Protein TM0937
rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
total genus 35
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2005-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2eshA00
4ETSA 4HF2A 2NAZA 2H09A 3TKYA 4RGUA 2RVCA 1G4DA 2PN6A 3QU6A 3O3KA 5IT9K 2EV6A 5H6QA 3I71A 3ROUA 3HTSB 3CTAA 3B02A 3RTRA 3GFLA 1W5TA 2CWEA 2HQNA 4LFUA 1QBJA 4A5NA 1ODDA 5L3FA 3L00A 4CYDA 1U78A 3E3VA 4WXCA 1ZLJA 2QBYA 3TQNA 4JK1X 1RIOH 4BXUA 3NRVA 4LLGF 5LHHA 4RAYA 2DU9A 2ZBKA 3I59B 2IPQX 2VXZA 4I0BA 1QZZA 2AS5F 2PMHA 3GO5A 1IRFA 1X3UA 1MJAA 5F1RA 4KYWA 3K69A 1R36A 1WI9A 5DYMA 3IKVA 3E5QA 1KU2A 2EV0A 3LQRA 1ZLKA 1RUNA 4ENNA 2L02A 5F6FA 3I59A 2EWNA 2K4JA 3FX3A 4Y15A 2DQRA 4AIJA 2ZO4A 1LJ9A 3R0AA 5H6RA 1R1VA 2HYGD 1S3JA 1YYVA 3IL2A 2V1DA 1U6GA 1O57A 2QQBA 1SFUA 2FEZA 1Z1DA 1HBXG 3R4KA 3M8FA 3M7GA 2A68F 3WTTC 2KJCA 5FD5A 4MHGA 2R7FA 3RIRA 4BAYA 2Y0MA 2XROA 5ICFA 1FT9A 1E17A 3O6BB 4LK1F 5L3GA 1I27A 2F5CA 1R1TA 2EK5A 3SZTA 5FB2A 2JPCA 3T0YA 2HQRA 1V3FA 2FF4A 1P4WA 4OIPF 1FC3A 3MWMA 1O3QA 3KLNA 1OYYA 4EVIA 5E8IA 1O3TA 1PP7U 1S7OA 3BDDA 3EQLF 2DBBA 3N97A 2L4MA 5LRRA 5DUIA 1LQ1A 5E1ZB 5CLSA 3DPLC 2A6HF 3L7WA 3FHZA 1ZG1A 1KQ8A 1R23A 3E5XA 1XSVA 4K2EA 1XCBA 5CVIA 2FXAA 4U0VA 1IN4A 3V8JA 5JVTA 3SXYA 2VE8A 3FMRA 1WKMA 3WG9A 4L9JA 5DV5A 1QZYA 3RKWA 4MTDA 2FA5A 4I02A 1SD6A 3ZMVA 4HDUA 2VC1A 2G7UA 3KP2A 1FYMA 1DPRA 1XGNA 3IHUA 5D5UB 1R7JA 2HR3A 2JRTA 3ZMZA 5F64A 1BOAA 2ZMEB 5DDGA 6PAXA 1TQMA 3D5LA 3CO6C 3KP4A 2YR2A 2WTEA 3DF8A 5DCMB 3BJ6A 3I5UA 2C6YA 2JPBA 2XGXA 4YFNF 4EM0B 5JFRA 4L9TA 3LA3A 3RKXA 3GXOA 2E7XA 2ZMEA 4JBAA 3COAC 4U0WA 3SZPA 3C18A 3RPUA 4HYEA 3FXUA 4HV5A 4WCGA 4HX8A 3LA7A 2O8XA 1XB4A 1ZYRF 4KT5C 4R8HA 4AVPA 4P9FA 2EJRA 1TNTA 1HSTA 4CGZA 4M74A 1K78A 2K27A 4OMZA 3JAMK 3R6SA 2E1CA 3GW2A 3MFKA 2XKPA 4N9HA 4IVNA 4HOBA 5LLQA 1YO5C 3RYPA 1FOKA 2V1UA 3ZN0A 2W24A 3RI4A 4BHCA 1P92A 2OAZA 2BYVE 1IAWA 1CF7A 3U1DA 4HLYA 1GVJA 1SMTA 5ED4A 3C7JA 3JTHA 1G3TA 3F21A 1J75A 3LSTA 1K6OA 1XGMA 4I2OA 3RPQA 4L5IA 5HLHA 2OZ6A 2VBZA 1KYZA 4UVCA 4S04A 3VOEA 4M9ZA 4GYGA 2DPUA 2KIFA 1E2XA 2OD5A 4GCVA 1WRJA 1B9NA 3Q9SA 5HLGA 4BQAA 2H6CA 5EEGA 1BM9A 5DUKA 1BIAA 3SHFA 3F8CA 1GHCA 4DQ2A 4KMFA 4ENJA 3FXQA 5ILUA 1LEBA 1BC8C 3EDPA 2K7LA 2QENA 2P5KA 3REOA 1U3EM 3F22A 2HGCA 4A0YA 3WTSC 2P7VB 2VODA 3HRSA 4KUMA 1YW9A 3TOAA 1CGPA 1IF1A 2A6EF 5A2QK 2LF8A 1P6RA 2FBHA 4AIHA 3HRMA 2FOKA 5D5XB 2NS0A 5DD8A 1TQIA 3DQVC 2D1VA 3CUOA 4G6QA 1D5VA 2DQLA 4FX0A 4ESFA 4EQQA 3J80Z 3ZN1A 1I1SA 4XSXF 3F3XA 5LEKA 1H0MA 4ZYHA 1MGTA 1USSA 1WQ2A 2M30A 3O2PE 1MZBA 1XDSA 4UV9A 3E97A 3CUQB 3V7CA 1TNSA 3MEXA 3I58A 1QNTA 1ZGJA 3WU1B 3NQOA 4R1HA 1KQ0A 3MZHA 5FGMA 4L0ZB 1HKTA 4RB1A 2DT5A 5E18F 2D45A 4KN7X 3ECHA 4UVBA 5D8LB 4G7OF 3QAHA 2V1XA 3ECOA 1U8RA 1IZ1A 2UWMA 4HX4A 3K0LA 1J0RA 5HDNA 2OBPA 3QPTA 3RJPA 5HS7A 3ZP5A 5HDKA 4HV6A 1TW3A 3Q5FA 1UCRA 2CSOA 1R1UA 3WE3A 3WE2A 4CXFA 2QYOA 5D6EA 3QP6A 4MEXF 1Z7UA 3PQKA 2FBIA 5LRSA 1PDNC 3PFIA 3TGNA 1K7AA 2G9WA 4CHUA 1ZH5A 4M71A 4DNCA 4HF0A 1BI3A 3JTGA 2LKPA 2YSRA 1FP2A 1ON1A 1XD7A 1B9MA 1KGSA 4F7ZA 1ON2A 3ULQB 2JT1A 2GXBA 2PJPA 1B59A 1ZGAA 3WTWC 1L0OC 1KU9A 4LLLA 4ZH4F 2QM3A 1RI7A 1MJ9A 3P9IA 4U0YA 2CG4A 4GO1A 3BWGA 1IN8A 2QBYB 4P9UA 1D3YA 2CW0F 2DTRA 4LJZF 5E20A 4JQFA 5H20A 2XV4S 2LSOA 2OZUA 4L0YB 1OYWA 4A0ZA 3K1NA 2BBYA 2MLGA 3GF2A 4PGGA 5BPIA 4B09A 4Y13A 1DDNA 4KNYA 1J59A 2BV6A 1LDKB 2W25A 3WTYC 2RKHA 3KP7A 4FX4A 3ERED 1RUOA 4L18B 2YU3A 2O0YA 4KIGA 2O03A 1AOYA 2FRHA 4OIQF 4OINF 2KIMA 2E7WA 2LF7A 2HKOA 4IJAA 4L9VA 2W84A 2PFBA 3N4MA 3JW4A 1B1BA 2ISZA 1OYIA 3HOTA 2NRAC 4G6DA 1D8KA 4UHTA 4IF4A 2ZXJA 4WX9A 2JZYA 3HYIA 3GFMA 2NNYA 4Q5SF 2KKOA 1KA8A 1FBQA 4BNCA 2RGVA 2GZWA 4ZYDA 1F9NA 5LEJA 1ZG5A 3J7AO 3VFZA 3VODA 3GLXA 1TQPA 3H3ZA 4RB2C 2VE9A 2Y75A 4CO8A 2OQGA 2PI0A 1ZG3A 2MH2A 1ZRDA 2HTJA 2DFIA 2L3DA 4YFXF 5HVQC 2XAHA 4EJTA 3MAJA 2K4BA 3MCZA 3L2CA 4G8XA 2GQQA 4EM1A 5J8FA 1HW2A 1XGOA 4XBFA 1A04A 1YIOA 1SFXA 5EEHA 1KQ9A 1I6XA 2EA2A 4A12A 4OIOF 1XSDA 3R0JA 2PQ8A 2EV5A 1FNNA 2CGPA 5TJJA 3BJOA 3KEQA 1ZRCA 1FSEA 4G94A 2E1NA 5E17F 2HKXA 1Z6TA 2UZKA 3W6KB 1JXSA 2MH9A 2TDXA 4IRGA 1PP8F 2XASA 1O7LA 1F5TA 4XLNF 1KU3A 5FLXZ 5BOXA 1DPUA 3L9FA 2YX4A 1EH6A 4LK0F 3DP7A 3HSEA 1FYKA 2GWRA 3J81Z 2FQ3A 3GFJA 3JSPA 2HOEA 4UVAA 1LVAA 4UNOA 2F2EA 3LA2A 5D8KB 4L9NA 5BQTA 5FFZA 4M73A 1XSXA 4IXAA 5L3CA 2FNPA 3R61A 3WGIA 2ADUA 3GUDA 1EV7A 4YG2F 1IXRC 1W7PA 2CO5A 3T8RA 3RDIA 1W4MA 2O6GE 2P6SA 2VBXA 3E6MA 2GA2A 5E1XA 1FWZA 5ICGA 1EH7A 1BN5A 2XAQA 1QO0D 1T2KA 1K78B 3DXJF 3WGGA 4N9IA 2WC2A 4I98B 3ZPLA 1BBYA 1BC7C 3ISPA 2QZ8A 3KZZA 2VBWA 1JGSA 2Y48A 4U88A 2ESHA 3SQNA 1S29A 3EYYA 1OR7A 3W6JB 2Q8KA 2O3FA 1SD7A 1YG2A 1CF7B 2P6TA 5CVUA 2FNAA 2ZKZA 3E6DA 1K79A 1F4KA 3DKWA 1USTA 1B6AA 2Q2EA 2CFXA 1IW7F 4EJOA 4WF2A 3TDZC 1XMKA 4HZFA 4WXDA 1YTYA 3HOSA 2OA4A 2L54A 4RB0A 3DPTA 5KK1A 3U2RA 5HS8A 3F6OA 1DUXC 1BI1A 3OOPA 2F5FA 2XRNA 2L01A 3NEUA 4IRIA 3Q9VA 1UHMA 4EJWA 1FBSA 2RV8A 1DP7P 3F8MA 2XAGA 3ELKA 4IHSA 1OMIA 2ETHA 3TDUC 3CO7C 2HEOA 2X4HA 2HZTA 3E5UA 4TV7A 3QP5A 5KVRA 3E6BA 1I5ZA 4I01A 1MDMA 4LMYA 1U2WA 3HSRA 4HBLA 1IXSB 4AWXB 4M9XA 1R58A 2EA4A 3WU0A 2DK8A 2EFQA 3V8LA 1P4AA 2UXNA 5AIQA 3IWZA 1T39A 4P55A 3IC7A 1RZ4A 3TO6A 5D4SA 3F8NA 5K5QA 2OQRA 4KFCA 3LFKA 2KIUA 2PMUA 2VN2A 4R79A 3H92A 1LDJA 5HLIA 1KYWA 1XDUA 1MD0A 3U9GA 4HQMA 2QLZA 3M9AA 4GXOA 5IT9Z 4I09A 1IXCA 3FM5A 5DCFA 2GAUA 3PQJA 1MJBA 2H6BA 3ZMUA 5D5WB 2Z99A 1G3YA 2FU4A 2PG4A 3V8KA 1BI2A 3IRRA 2IA1A 5LGNA 2W57A 1O3SA 4D0PA 2LDUA 3HHGA 2ZNYA 1TLHB 4RAZA 3V4GA 3HHHA 1ZN2A 4P5OA 4OU0A 5LGTA 1VTNC 1IN5A 2KJBA 3VB2A 3KZYA 2H27A 4AD9A 2A69F 2FMLA 4AIKA 4BHBA 4EMSA 4EM2A 2A61A 3GVAA 2ELHA 2XVCA 1SMYF 1SFEA 3EUHA 1FBUA 4P96A 4BH9A 3KETA 5FD6A 2IRFG 1F1ZA 4KN4X 1B4AA 3CUQC 1G3SA 3LAPA 4MTEA 4ENMA 1QGPA 4I7HA 3ABTA 4LD5A 3I54A 1FX7A 5ICCA 2RN7A 3ABUA 4ZYEA 3K1MA 1ZARA 1R22A 1W5SA 4WWCA 4RGXA 2BE5F 3BPVA 4E70A 4IHTA 4IPAA 2HFHA 1T38A 4LB6B 4HX7A 3CJNA 2CYYA 1JHHA 2KRFA 1H9TA 2MC3A 2RC4A 4UV8A 1KU7A 3GYHX 2MLKA 4KMUX 5HOOA 5AONA 3J80K 1UB9A 2EFPA 2V79A 2RNJA 2JTVA 2DK5A 3GZ6A 2DPDA 3F8BA 2RDPA 1ONVA 1BJAA 3KLOA 2D2WA 2FSWA 4N0BA 1U5TA 1BIBA 3ZMSA 3AAFA 2VOOA 1R00A 4MQVA 2D1HA 1FPQA 2STTA 3FM3A 2ISYA 5DD4A 2IT0A 2P5VA 2M87A 4U7DA 1WSUA 1Z91A 3BY6A 5E8GA 4BHPA 4EV0A 2Z3YA 5IT3A 3HSFA 2ZNZA 2GIVA 1U5TC 4RGRA 5J8CA 1ZRFA 4FT8A 1SD4A 4G7HF 4ZZDA 1XMAA 4MEYF 5LHGA 3TOBA 4FHTA 1JHFA 3G73A 4I0AA 2MD5A 5ILSA 1C0WA 2ACJA 3JSOA 3BPXA 3QU3A 1S6LA 1HKQA 1ULYA 1L3LA 1LNWA 4Q48A 1YQAA 1T98A 3FWEA 1WWXA 5JHUA 3IWFA 2QVOA 1IRGA 3VEPA 3GZ5A 4YIIA 2YPRA 2DW4A 2X0LA 3L09A 4L5JA 3WODF 3OV8A 1OKRA 1XN7A 3KP6A 3DFGA 3TO7A 4YFKF 4A0XA 4PCQA 2VT3A 5HS9A 1BI0A 1MKMA 4PZJA 2WWYA 5ILVA 3E6CC 4RB3C 1O7FA 1FYLA 2ZCWA 3KEOA 4EJUA 4HA8A 3TO9A 5D6FA 2M5WA 3GFIA 4KDPA 1D8JA 4NB5A 2A3SA 3F6VA 5J6XA 4GYIA 4LGWA 4M6XA 3H3UA 2BGCA 2IP2A 3JAMZ 2IW5A 3RKYA 5LBQA 2GA1A 5DEQA 4UXNA 1R5GA 3DEUA 1J5YA 2XKOA 2XAJA 4A6EA 2V9VA 2PBIA 2M45A 4YIFA 1W7PB 3P9KA 2XIGA 3FMQA 4Y17A 4RGSA 5ERIA 5BS6A 4HAMA 4KICA 4M9SA 1YW7A 1QPMA 2ZFWA 2IJLA 2GXGA 5CYVA 4S05A 1P4XA 2K86A 4O5VA 3KCCA 2XUBA 5L3BA 2VC0A 4A2UA 2IVMA 4LG0B 3K1PA 4ZYGA 3FZVA 3F72A 4WXHA 4EGYA 1FY7A 4PDKA 2ZJ2A 3S2WA 1Q1HA 2HYFA 1T6SA 2DO7A 3LWFA 3T8TA 1IN7A 5FFXA 4HQEA 1R5HA 4HDVA 3HUGA 1G6NA 3EETA 4LG0A 4BYYA 2EB7A 2QUFA 3QRFF 4HF1A 1UFMA 1Y0UA 1FP1D 1J9IA 5A2QZ 3RYRA 1V4RA 2QQAA 1YS7A 3HRTA 1YLFA 1FZPB 5K1YA 2DI3A 3QOPA 1Z05A 2P8TA 4XLPF 3QPHA 4NHJA 3DV8A 2IA0A 5DCMA 1YW8A 2G7HA 2MA3A 4LB5A 3KP3A 3ZQ7A 4B8XA 1QQIA 2O61A 2J5PA 1P2FA 1JE8A 1HSJA 3B73A 5CVRA 3BZ6A 3FF5A 4KIBA 2HS5A 4ESJA 5E1WA 3HIFA 2FE3A 3C3WA 1STZA 2P4WA 1J2XA 3KFWX 3CLOA 4MGRA 3CDHA 4ESBA 5FLXK 5HDGA 3M1EA 2COMA 1OPCA 1Z9CA 5BMZA 3HTUA 1LDDA 4ASNA 1XCVA 2FMYA 1RNLA 4HLXA 3J81K 3KE2A 4KIFA 5BPDA 3I53A 1PUEE 3T5XA 5LGUA 3WTZA 1MDMB 2MBFA 3KP5A 3MZYA 3BJAA 1GXQA 1I1GA 5L3EA 3WTUC 2OU2A 2FBKA 4ON0A 2CQKA 1YS6A 3GX4X 1TBXA 4OMYA 5AIPA 2M1BA 4G7ZF 5JR3A 3BP8A 4M6YA 3BOQA 2AXLA 2VOPA 4KA4A 3F8FA 3K9TA 4Q4ZF 2NNNA 2LNBA 4OOIA 1IUYA 4QLCU 1SD5A 2BEOA 5K5RA 1FSHA 2STWA 2R3SA 1YFHA 2VT2A 3T1BA 4EGZA 1FLIA 1S7AA 4Q47A 4GGGA 3P7NA 2F5EA 4IRHA 5CJ9A 4O6JA 1LEAA 5D4RA 4QWQA 3GEZA 4CDGA 2JSCA 2VONA 2QWWA 4WK8F 2EFOA 2W85A 4NQWA 1SAXA 4A5MA 2XHKA 4U7BA 2ESNA 4M72A 3ZMTA 3G3ZA 3C1DA 4XSZF 1UHWA 1Z6RA 5FO5A 2Z33A 1HW1A 4HW0A 1J7KA 1GXPA 3I0TA 3V7SA 2EFWA 2QQ9A 2HDCA 2NYXA 1AWCA 4G9YA 3I64A 3IRQA 3BROA 1G3WA 1ZREA 2YX7A 3HRUA 4CICA 3IKTA 3I4PA 4H0EA 2PEXA 3FMSA 5CVVA 2Q0OA 3V7RA 1TW2A 1LB2A 3SFZA 1HXDA 3CUQA 2A5YB 4UUVA 4PGHA 4CZZA 1REPC 3FXRA 3F23A 3WTXC 4RS8A 5L3DA 4MNUA 3MQ0A 5D5VB 1HQCA 5LHIA 5JI6A 3LQQA 2DLLA 3WGHA 2Z9OA 3LAJA 4MQ9F 2V6CA 1HKSA 2M8EA 1T0FA 1XGSA 5TRDA 5K5OA 4LLNA 4OIRF 2H94A 2UXXA 5CVJA 2EFNA 2VBYA 2R7DA 1O3RA 2P7CB 2RQPA 3ML6A 2L4AA 2B0LA 4ENKA 3M8EA 2PLYA 3WTVC 3EYIA 1NHAA 3GWZA 1IN6A 1ZHFA 4Z2YA 4ZZLA 3P9CA 1S8NA 1U5TB 2HWVA 1EH8A 1TTYA 1HW5A 1H9GA 2IA2A 2K02A 1W7PD 2Z5UA 3D0SA 5ICEA 2XAFA 1ZAOA 2P5LC 4EJVA 2DAOA 2WV0A 2A07F 2J5OA 2HTSA 3R60A 3ZMDA 4A6DA 4O3MA 3K2ZA 2F5DA 4XRFA
chains in the Genus database with same CATH superfamily
4ETSA 1JJ6C 2FOWA 4HF2A 1DGRM 2NAZA 2H09A 3TKYA 1M1EB 4RGUA 5GTIC 3OYGA 2RVCA 4J00A 2Y9YA 1G4DA 4A93J 4F3QA 2PN6A 3QU6A 1MBJA 1OCZH 3O3KA 1HDDC 5IT9K 2K9SA 2EV6A 4A3MJ 5H6QA 3I71A 3ROUA 4DZJA 3HL2A 1IC8A 2IS1A 3ABMH 1TWHJ 3HTSB 3CTAA 3B02A 3RTRA 3GFLA 3ABLH 3AFHA 1W5TA 2CWEA 1MIJA 3QYBA 2LRDA 3ZQHA 2HQNA 4LFUA 1QBJA 1YRNB 4A5NA 1VQKI 1ODDA 4HNTA 5L3FA 2QCOA 3L00A 2E1MC 4CYDA 3LSIA 1U78A 3E3VA 4X6AJ 1FIAA 4WXCA 1ZLJA 2DOFA 3TQNA 2QBYA 4JK1X 1RIOH 1Y6IA 4BXUA 4M3DA 3NRVA 4LLGF 5LHHA 3HC7A 3HM5A 2DA1A 4RAYA 2DU9A 2ZBKA 2DMNA 3I59B 2VQCA 1XMXA 2IPQX 2VXZA 4E4HA 3MKZA 4I0BA 1QZZA 5TISC 2AS5F 2PMHA 3GO5A 2XSJC 2W4SA 1IRFA 5B1AH 1X3UA 2HU9A 3CCYA 1Y39A 1MJAA 5F1RA 4KYWA 3K69A 1R36A 4NNJA 1WI9A 5DYMA 3E1SA 3IKVA 3S3OA 3E5QA 1KU2A 2EV0A 3LQRA 4U87A 4CUGA 4XM3A 3I4MJ 1ZLKA 2F6CA 1RUNA 4ENNA 2L02A 5F6FA 3I59A 1JKOC 2EWNA 3H35A 2Y9ZA 2K4JA 3FX3A 4Y15A 2DQRA 4AIJA 1A5JA 1D0ZA 1WI3A 2ZO4A 1LJ9A 3R0AA 2P81A 2NXNB 4A3CJ 5K7ZA 4BE0A 5H6RA 1R1VA 2HYGD 1S3JA 1YYVA 1JKRC 2HQAA 3VSKA 1YI2I 3IL2A 2V1DA 1U6GA 2KMUA 1O57A 2QQBA 1SFUA 2EIJH 2FEZA 2XRLA 4C2UA 1Z1DA 1HBXG 3LL7A 3R4KA 1W5CC 3HOYJ 1V54H 3DBLB 3EUAA 2VQLA 3M7GA 3M8FA 1PVEA 2A68F 1MNDA 1KONA 4BBRJ 1K4TA 5EDNA 3WTTC 2KJCA 5FD5A 1X3WB 2V26A 4MHGA 4UUSB 2R7FA 3RIRA 4BAYA 2Y0MA 2R5YB 4CCOA 2XROA 5ICFA 1FT9A 1E17A 3O6BB 4M6VA 3CCQI 4LK1F 5GPAA 5L3GA 1B8IB 3H36A 1I27A 1VF9A 2F5CA 1H89C 1I6HJ 1R1TA 2EK5A 2R7QA 3SZTA 1H8AC 1JGGA 1TT5B 5FB2A 5E3MA 2JPCA 4AUXA 2ZXHA 3T0YA 2HQRA 4H4KC 1TP4A 1V3FA 2JN6A 5EEAA 2FF4A 1P4WA 1HA8A 4OIPF 1R9TJ 1E0EA 1FC3A 2BHYA 2CJJA 3MWMA 1O3QA 3KLNA 3JRHA 1OYYA 4F55A 1A36A 4EVIA 2CH0A 3FISA 5E8IA 1O3TA 2DYRH 1S7OA 1PP7U 2Y69H 2OTJI 3BDDA 2Y2ZA 3EQLF 3DTIA 2CU7A 2DBBA 3CJTB 3KX2A 4HNVA 3N97A 2CUFA 2L4MA 1JJ8C 2CQQA 5LRRA 5DUIA 3K7AJ 2HZDA 1LQ1A 5E1ZB 1IO2A 5CLSA 3DPLC 2XF6A 2A6HF 3DU5A 3IAS2 5E3LA 3L7WA 2DA2A 1QPIA 3FHZA 1ZG1A 3GTKJ 1KQ8A 1R23A 3E5XA 1XSVA 3TL4X 4K2EA 2LYCA 5IOYA 3K70D 1P7JA 1TWFJ 1XCBA 4BDYA 4IHVA 5CVIA 4FQGA 2FXAA 2M0MA 3FDYA 4U0VA 1OJLA 3S1NJ 1IN4A 3V8JA 5JVTA 3SXYA 3JRGA 1MBGA 4AVZA 2JA2A 2VE8A 3BQYA 3FMRA 3QODA 1WKMA 3WG9A 3HDDA 4L9JA 3OOUA 3K4JA 5DV5A 1QZYA 3S3NA 3RKWA 4MTDA 4BEHB 2FA5A 3TP0A 4I02A 4IZZA 1SD6A 2BW3A 3ZMVA 4C3JJ 4HDUA 2VC1A 2G7UA 2PMZA 3HUGB 2RREA 4RDUA 2ZB9A 1T08B 3KP2A 1FYMA 2DDAA 1DPRA 1XGNA 4BE1A 3IHUA 1VFCA 5D5UB 1R7JA 1A35A 1IDZA 2BVMA 2XB0X 2HR3A 2CV0A 3S3MA 2JRTA 3ZMZA 5B1BH 3K2AA 5F64A 5IYCJ 1BOAA 2ZMEB 3BZCA 2W7NA 2LK2A 5DDGA 2HPIA 4HRIA 6PAXA 3L2RA 1TQMA 3D5LA 3CO6C 2Y30A 1WJCA 1X2NA 1Z7LA 3KP4A 2YR2A 2WTEA 2L7FP 3PIPF 3UR3C 3DF8A 5DCMB 4AC0A 2K9LA 3E7LA 3BJ6A 4M3GA 3H9GA 3I5UA 2C6YA 2VASA 2JPBA 2XGXA 2DN0A 1XG1A 4YFNF 1VQOI 3L2WA 4E7HA 4DYQA 2TCTA 4EM0B 2QKMB 5JFRA 4L9TA 2WADA 3EUKL 3LA3A 3RKXA 3GXOA 2R7UA 2E7XA 1BJZA 2ZMEA 4JBAA 5J1RA 3B6AA 3AG1H 3COAC 4U0WA 1OCCH 3SZPA 3ZXSA 2VKHA 3C18A 4XMYA 3RPUA 1HCRA 4HYEA 3M4OJ 3FXMA 2PX9A 3FXUA 2IS6A 4HV5A 1ERDA 3QWLA 4WCGA 4HX8A 3OYNA 1GV2A 3HG9A 2DTZA 3LA7A 2O8XA 3OYBA 1XB4A 1ZYRF 4KT5C 1GVDA 4R8HA 1AKHB 2HYJA 4AVPA 2KDOA 3OS0A 5FKKA 3RQIA 4P9FA 3L2QA 1VQMI 3S1RJ 4E7IA 2QA4I 5CQGA 2EJRA 5B3SH 1TNTA 4RMNA 1HSTA 4CGZA 3O8HA 2BXZA 2OC6A 4M74A 1K78A 3ZR8X 4V19K 2K27A 4OMZA 4FE4A 3JAMK 4D1QA 3R6SA 2E1CA 3GW2A 3MFKA 2XKPA 1LFUP 4N9HA 2X85A 4IVNA 4D7NA 4HOBA 5LLQA 3TEDA 1VI0A 5CQEA 2HVRA 3OL4A 3RYPA 1YO5C 5CPRB 1FOKA 2V1UA 3ZN0A 5LFAA 4X0GA 2W24A 1WJDA 1TC3C 3CCJI 3RI4A 3HOXJ 2FX0A 4BHCA 1TWGJ 2R7TA 1P92A 2OAZA 2BYVE 3LSRA 1E3HA 1OR7C 4GRIA 2M34A 1IAWA 1CF7A 2E19A 1VQ5I 3U1DA 4HLYA 1GVJA 1SMTA 5ED4A 3BZKA 3C7JA 4CZCA 3JTHA 3WHBA 1G3TA 3FXLA 4YRVA 3F21A 3SEQA 1ZR2A 1PUFA 5M5YJ 4PJNA 1J75A 3LSTA 3W3CA 1K6OA 1XGMA 2WB1A 4I2OA 1V55H 3RPQA 4L5IA 2F5VA 5E79C 5HLHA 3IUOA 4BXXJ 2OZ6A 2VBZA 4EATA 1KYZA 1D1CA 4UVCA 2XPUA 2ECBA 1BL0A 4S04A 3VOEA 4M9ZA 4GYGA 2DPUA 2KIFA 3JRDA 1E2XA 1UZCA 3JRAA 1U9OA 3LNQA 1D0XA 2OD5A 2QF7A 2CV2A 3ASNH 4GCVA 1WRJA 1B9NA 2W82A 3BR6A 3Q9SA 4OWRB 5HLGA 3PM1A 3FKJA 4BQAA 2H6CA 3S16J 5EEGA 5DM6F 3VYSB 1BM9A 5DUKA 1S72I 2HOSA 1BIAA 3SHFA 3F8CA 1W0TA 2AQEA 4DQ2A 2HVSA 1GHCA 4KMFA 2GBYA 3SJMA 4ENJA 1OCTC 1OCRH 2GM4A 3FXQA 2V4JC 4RLFA 5ILUA 3GBGA 2R0QC 2F48A 1LEBA 4KT6A 4A3LJ 1BC8C 2M7BA 3VYUB 3EDPA 2K7LA 5FLVA 3SYTA 1LFBA 2QENA 2P5KA 5HNFA 3REOA 1U3EM 1MBHA 4NQWB 1Y56A 3NWSA 2ZJPF 3F22A 4XLCA 2MYSA 1YE9A 2HGCA 4B4CA 1JT0A 4A0YA 3WTSC 4JOMA 2P7VB 2VODA 3HRSA 4KUMA 1ETVA 1YW9A 3TOAA 2DT6A 1CGPA 1IF1A 3PO3J 4II2A 5F27A 2A6EF 2R5ZA 2ELJA 5A2QK 1U9NA 2FUG2 2LF8A 1P6RA 2BY1A 2DJNA 2FBHA 3M1CA 4AIHA 3HRMA 2FOKA 4IHXA 3OIOA 5D5XB 4XIDA 3LSHA 1YITI 1VQ8I 2R92J 2NS0A 4ZC3A 5DD8A 1TQIA 3DQVC 2D1VA 3CUOA 1MNEA 2ME0A 4G6QA 1TWCJ 1D5VA 3OYIA 2DQLA 4FX0A 3DU6A 5M3MJ 3RZDJ 3CMMA 4ESFA 4UB6C 2EIKH 3K4LA 2UV1A 3S93A 4EQQA 1FTZA 3J80Z 3A2KA 4XNFA 1JTYA 4F91B 1EF4A 1UHSA 3ZN1A 1I1SA 4XSXF 4I76A 5EZHA 3S32A 2K9MA 3F3XA 2ZC2A 5LEKA 1H0MA 4ZYHA 2VLAA 1MGTA 1USSA 1WQ2A 2EINH 2M30A 3O2PE 1MZBA 4AYBN 4EEFG 1XDSA 4UV9A 1RRJA 3E97A 5K7FA 3CUQB 3FIWA 3V7CA 3G1MA 4B3AA 1TNSA 3MEXA 3OIQA 3I58A 3OYEA 1W36D 2LKSA 1QNTA 5FJ8J 3A0HC 4FCYA 3K4KA 1ZGJA 3WU1B 3PNVA 3NQOA 4R1HA 1KQ0A 3CQZJ 3OYFA 3MZHA 5FGMA 4CCMA 2RAEA 3BTJA 4L0ZB 5IYBJ 1HKTA 5E3OA 4RB1A 2DT5A 5FRMA 1IJWC 3KIOA 5E18F 2D45A 2A05A 4KN7X 3ECHA 4UVBA 5D8LB 2DJIA 2YUSA 4G7OF 1ZQ3P 2XPVA 2VJ4A 3QAHA 5FLMJ 4JX5A 3F9KA 1K61A 2V1XA 3ECOA 2E71A 4XLEA 4XL9A 1U8RA 1IZ1A 3H0GJ 4QPOA 1VQ9I 2UWMA 4HX4A 1R4MB 3K0LA 1J0RA 5HDNA 1WVRA 1HOMA 2OBPA 3QPTA 5LD2C 3LFUA 2KISA 3RJPA 1WJEA 3LSPA 1NG7A 5HS7A 3ZP5A 5HDKA 2ME6A 1ETWA 4D9JA 2W48A 1GUUA 4HV6A 2LVSA 2DA3A 1TW3A 3Q5FA 1EKEA 3ZCOA 1UCRA 2WAQA 2CSOA 1R1UA 4XKBA 3WE3A 3WE2A 4CXFA 2LY1A 1S5LC 2Z16A 2CW7A 3MD2A 2QYOA 1LFPA 1VQ7I 5D6EA 3QP6A 3S1MJ 4MEXF 1Z7UA 3QYFA 2O8KA 3PQKA 1K83J 2FBIA 5LRSA 1PDNC 3S17J 3PFIA 3TGNA 1XTAA 1K7AA 2G9WA 2K9QA 4CHUA 1ZH5A 4M71A 2HVQA 4DNCA 4HF0A 1BI3A 3JTGA 4BBSJ 3NARA 2LKPA 2WAFA 2NOJB 1UG0A 2VXDA 2YSRA 3DPUA 1FP2A 1ON1A 1XD7A 3QYEA 5F0CA 3TW6A 3EUHC 1B9MA 1W1WE 4B1RA 1XS9A 1KGSA 1TZLA 4XK4A 1NK2P 4F7ZA 1ON2A 4DYRA 3ULQB 2VB6A 2JT1A 2GXBA 2PJPA 1B59A 1OFCX 1ZGAA 3WTWC 4J01A 2HI3A 1HC8A 3GTPJ 1D5YA 1L0OC 1KU9A 4LLLA 2CW8A 3G4SI 4ZH4F 2FD5A 2QM3A 1RI7A 1MJ9A 3SFIA 4Y33A 3P9IA 2LTPA 4U0YA 2KZGA 4OAZA 1R49A 2CG4A 4GO1A 4ABZA 3QOEA 3BWGA 1IN8A 4QTRA 2OJED 5BNGA 2QBYB 2BY0A 2L9RA 3DKYA 2DXIA 4P9UA 1D3YA 2CW0F 3KZIC 2DTRA 2QSGX 4LJZF 1X3ZB 5E20A 2NOGA 4JQFA 5H20A 1W0UA 2XV4S 2LSOA 2DA6A 1WFXA 3FK7A 3UNGC 5EG0A 2OZUA 3JR9A 3LSJA 4L0YB 5GTHC 1OCPA 3HOZJ 1OYWA 2L9SA 3RPUD 4A0ZA 3K1NA 1YIJI 1RPWA 3TP3A 2BBYA 1FMVA 2MLGA 3GF2A 4PGGA 5BPIA 3I4NJ 4B09A 4Y13A 1DDNA 4KNYA 1J59A 4Z6YA 2BV6A 4PJ0C 1LDKB 2X1CA 2W25A 4XKWA 4LIVA 3WTYC 2RKHA 3KP7A 3LOCA 3ERED 4FX4A 1OQYA 3HJEA 2Y31A 1RUOA 4L18B 2GOXB 4V2FA 4RBOA 3JRIA 2VPRA 2YU3A 3Q3SA 2O0YA 4KIGA 2O03A 1AOYA 2FRHA 5EGOA 4OIQF 1UJ8A 2A5WA 4OINF 2KIMA 2E7WA 1JTXA 2HDDA 2LF7A 2HKOA 3HXLA 4IJAA 1PYVA 2E60A 4L9VA 4BJ6C 2W84A 2KHMA 1ETOA 3GCMA 2PFBA 3N4MA 4I99C 1OISA 3JW4A 1B1BA 1MMNA 2ISZA 4FETA 4PFOA 2I8DA 4N4OB 1OYIA 3HOTA 2NRAC 2W00A 4G6DA 1D8KA 4UHTA 1GT0C 5J4VA 1QRYA 5M3FJ 4IF4A 2ZXJA 3CDLA 2Z2SB 2JZYA 4WX9A 3HYIA 3DEEA 3GFMA 2CS3A 2DA5A 3OR2C 3HEFA 3OYKA 2NNYA 2E2JJ 4Q5SF 1A6IA 3BG6A 2KKOA 1KA8A 2ID3A 1FBQA 4BNCA 2RGVA 2GZWA 4ZYDA 4NC7A 5FRNA 2D5VA 1F9NA 5LEJA 1ZG5A 1UAAA 3J7AO 2R7ZJ 1Y8RB 3VFZA 4FE7A 3VODA 3MZ8A 3GLXA 1TQPA 1SVOA 5FKLA 3AL0C 1JUMA 3H3ZA 4RB2C 1UELB 2VE9A 3MKWB 2Y75A 3VYTB 3GTMJ 4MFDA 2E5ZA 4CO8A 1LVKA 2OQGA 2PI0A 1ZG3A 4DJAA 2WY8Q 3LSMA 2AQFA 2MH2A 1ZELA 1ZRDA 1J09A 2HTJA 2DFIA 2L3DA 4HPQA 4YFXF 4J19A 5HVQC 2XAHA 4EJTA 3PJRA 3MAJA 2K4BA 3OYJA 3MCZA 3L2CA 5F04A 3D1NI 4G8XA 4YIRX 4UUTA 3PIOF 3W2VA 3J7YJ 2GQQA 1V5EA 3G6EI 1IG7A 3KPHA 4EM1A 1GV5A 5J8FA 3ABKH 1Z3XA 1HW2A 1XGOA 3A03A 4XBFA 1A04A 4PJLA 1XC5A 2IS2A 4PSXA 1YIOA 3P5JA 4B43A 4IOAF 1SFXA 3OS1A 5EEHA 2ECCA 1KQ9A 4JYKA 1I6XA 4Y52J 2IGKA 2EA2A 4A12A 1WPKA 1VQLI 4DW6A 4OIOF 5C44J 1MMDA 1XSDA 1WCMJ 3R0JA 4L5EA 2PQ8A 1SVMA 2QGUA 2KQRA 2CQ7A 2EV5A 1FNNA 4C30A 3I9V2 2CGPA 1BR4A 5TJJA 3BJOA 3BR3A 1Z67A 2K40A 3KEQA 1ZRCA 1FSEA 5IPAA 4G94A 2E1NA 5E17F 2HKXA 5B5EC 3SEZA 1Z6TA 2UZKA 2BW3B 3W6KB 1JXSA 2MH9A 2TDXA 3M07A 4IRGA 4DGWB 1PP8F 1TL8A 2XASA 5K7HA 1O7LA 1F5TA 2EBIA 4HNUA 2LH9A 2XF7A 4XLNF 4XOPA 5C4XJ 1KU3A 5FLXZ 1SVLA 1AA7A 4KISA 4LG3A 5BOXA 1RETA 2BHZA 2JA5J 1DPUA 4B3XA 3U1KA 4P1WA 1I3QJ 2GLOA 3IAM2 1ZR4A 3L9FA 2YX4A 1EH6A 4LK0F 3GTGJ 3DP7A 3HSEA 1FYKA 2GWRA 3J81Z 2FQ3A 2EZIA 2X6XA 2CRGA 2HOEA 3GFJA 4UVAA 3WU2C 3JSPA 5J40A 3PO2J 1LVAA 3K6GA 1LUJB 1X1CA 3OY9A 4UNOA 4HSTA 2F2EA 3LA2A 3S15J 3CCVI 5D8KB 4L9NA 5BQTA 5FFZA 2MSYA 4M73A 1XSXA 3IH3A 3CCEI 4IXAA 5H2FC 5L3CA 1RC9A 4IX7A 2FNPA 3R61A 3WGIA 2ADUA 3GUDA 1EV7A 3KEYA 1R4NB 2KLOA 4YG2F 3PUFA 3H9QA 1IXRC 1W7PA 2CO5A 4RA2A 3T8RA 2CUJA 3RDIA 5F1JA 4M3BA 4BQOA 1XPXA 1W4MA 2O6GE 2P6SA 2KT0A 2VBXA 4ZTFA 5EF6A 3E6MA 2LR8A 1IGNA 2GA2A 5E1XA 1ZTRA 1FWZA 2VI6A 5ICGA 2E2HJ 1EH7A 1JUSA 2V6EA 5GP9A 1BN5A 2XAQA 1QO0D 1T2KA 1K78B 2LOOA 3DXJF 3WGGA 3HBLA 4N9IA 2R7WA 3M8JA 2WC2A 3C2GA 2QKLB 4I98B 4KITB 3ZPLA 4XOTA 1BBYA 1BC7C 3ISPA 2DFHA 2QZ8A 3TBIA 4Y3OA 3CCRI 3KZZA 2VBWA 2Q2EB 1JGSA 2K3FA 2GXAA 2Y48A 4U88A 2Y0SN 2ESHA 3BQZA 3SQNA 3DKXA 1S29A 4A3FJ 1NG6A 3EYYA 4IHWA 1OR7A 4A3EJ 3W6JB 4A69C 2Q8KA 5M5WJ 2O3FA 3CCLI 3KYDB 1SD7A 1YG2A 1EJ9A 1CF7B 2P6TA 1YX3A 4E7KA 2LREA 5CVUA 2FNAA 3DLLF 2OUMA 1HF0A 2KL4A 2ZKZA 3E6DA 1K79A 1F4KA 3GLLA 2X51A 3DKWA 2VIXA 1PUFB 1K6YA 1Z77A 1USTA 1B6AA 2DMPA 2E5NA 4NBQA 2Q2EA 2CFXA 1IW7F 1H88C 4EJOA 2KDZA 2ID6A 3FKIJ 1HDPA 2JA7J 4E6KG 4WF2A 3TDZC 2VKVA 1XMKA 2ZJRF 4HZFA 4WXDA 3D5SC 1YTYA 3HOSA 2OA4A 4RM3A 3FXOA 2L54A 4RB0A 3DPTA 5KK1A 3U2RA 5HS8A 3F6OA 1DUXC 3OS2A 1BI1A 3OOPA 2F5FA 2XRNA 2L01A 4XR6A 1MH4A 4MO7A 4E7ZA 3H1CA 2DMUA 3NEUA 4IRIA 3Q9VA 3PFYA 2IXSA 1UHMA 5HNHA 2VL8A 3HPGA 4EJWA 1I3AA 1WZ2A 1T56A 3DWLE 1FBSA 2RV8A 4M3EA 1DP7P 3F8MA 2XAGA 3ELKA 5J47A 4BJTA 4IHSA 1UMQA 4QIWN 1X58A 1Y1VJ 3OIPA 3B6CA 1U8BA 1OMIA 2ETHA 4XICA 1Q1VA 2KP6A 1DP3A 3HZJA 4IQJA 2JVHA 1QVTA 2WBMA 2R5ZB 3TDUC 3CO7C 2K3PA 2E1OA 4HG2A 3GTQJ 2HEOA 1U0JA 3HPHA 2X4HA 3CZ6A 2JVGA 4A3KJ 2R93J 2XDVA 2AHQA 2DFFA 3PNTA 4CCNA 2HZTA 2YU9J 1QZEA 1F36A 3E5UA 3GTLJ 4TV7A 3QP5A 1E3OC 2L9VA 4XQFA 1BW6A 3U21A 5KVRA 2IEKA 3E6BA 4XONA 1I5ZA 4I01A 1MDMA 4LMYA 2P0WA 1O4XA 2KRHA 4DBRA 1U2WA 3HSRA 4XRSG 4HBLA 1IXSB 3CLQA 4AWXB 1YJ9I 1SFKA 3OSFA 2K5CA 4C9YA 5DS9A 4M9XA 1R58A 2XPWA 1CQTA 2EA4A 4E7LA 3IH2A 3WU0A 2DK8A 2EFQA 3V8LA 1P4AA 2UXNA 4CCJA 5AIQA 3ZQGA 2OCCH 3IWZA 3JRCA 2GIZA 2NVQJ 9ANTA 3SDGA 5IP7J 1T39A 4P55A 3IC7A 1A6QA 1RZ4A 3TO6A 2L7KA 3UKGA 1X1DA 5D4SA 3F8NA 3F0CA 5K5QA 2OQRA 1N25A 4KFCA 5JLXA 3LFKA 2O9LA 4DZPA 2AO9A 1SAUA 2KIUA 1BW5A 4CYCA 3HKZN 3HGYA 4NC6A 2H1LA 2PMUA 1P7IA 2LY2A 2VN2A 4A3BJ 3G71I 4R79A 3H92A 1LDJA 2QQ8A 4MFEA 5HLIA 5DM7F 4ITVA 1KYWA 1XDUA 3C2HA 2LKXA 1MD0A 1G2HA 3GTJJ 3U9GA 4HQMA 1BOBA 2QLZA 4M3FA 2NVXJ 1MBEA 3PSIA 1BR2A 3DBRB 3M9AA 4GXOA 5IT9Z 4I09A 3H3VK 1IXCA 2GOMA 3FM5A 5DCFA 1SC7A 2GAUA 3PQJA 1MJBA 2H6BA 3ZMUA 2Z99A 1G3YA 2FU4A 2PG4A 5D5WB 4IOCF 2VKEA 3V8KA 1PJRA 3S8PA 1BI2A 3K70C 2EIMH 2RNGA 3S14J 3IRRA 2IS4A 2IA1A 2LFBA 2W57A 5LGNA 1O3SA 2XGDA 4D0PA 2LDUA 3HHGA 2ZNYA 2L2OA 3ZQIA 1TLHB 1IDYA 1ETYA 4RAZA 4ZDLA 3V4GA 1B72B 3HHHA 1ZN2A 1MBFA 1GDTA 4P5OA 4OU0A 5LGTA 1VTNC 1IN5A 2KJBA 2DYSH 1UG2A 3VB2A 3RKQA 3KZYA 2DT7B 2H27A 4AD9A 2A69F 1BR1A 2FMLA 5FKNA 2ZFUA 4AIKA 4BHBA 3CP8A 2LBFB 4EM2A 2A61A 4EMSA 3GVAA 2ELHA 2XVCA 1SMYF 1Z0XA 1SFEA 3MMYB 3EUHA 1FBUA 4XKCA 3PL8A 1Y8QB 2MD0A 4LOCA 4P96A 4BH9A 3KETA 1A31A 4D7MA 2ZXIA 1B72A 3J7AY 5FD6A 4PFPA 4C3IJ 1X4OA 2H8RA 2IRFG 3BR0A 3ZRGA 4RAFA 3ONQA 4I6ZA 1F1ZA 4KN4X 1IUFA 2X1EA 4CCLA 1B4AA 3CUQC 1G3SA 3LAPA 3BLYA 4QPQA 4MTEA 3BG7A 4ENMA 1QGPA 2M7AA 2LBFA 4I7HA 3ABTA 4LD5A 3I54A 1FX7A 1VNDA 5E3NA 1I50J 5ICCA 2RN7A 3ABUA 4ZYEA 2E1MB 3K1MA 1MMSA 4AYBA 1ZARA 1R22A 1W5SA 4WWCA 4RGXA 1LKXA 2BE5F 4UB8C 4OAYA 3BPVA 4E70A 4IHTA 1MSFC 4IPAA 2HFHA 1T38A 4LB6B 1N77A 4HX7A 3LMMA 3CJNA 2F4OB 3CD6I 3JREA 2CYYA 1JHHA 1T0FC 2KRFA 1JT6A 2L7ZA 2Q1ZB 3FK6A 3A02A 1H9TA 2MC3A 5EG0B 2BY3A 2IBDA 2RC4A 4UV8A 1KU7A 1ZKGA 5KAIC 4DIQA 4DOZA 3GYHX 2MLKA 4YELA 5J1YA 1ETXA 4KMUX 5HOOA 5AONA 4XKVA 3VPRA 2N8GA 3AG4H 2KZVA 2M0CA 3J80K 1QA6A 1UB9A 1MMGA 2EFPA 4PSWA 1MBKA 2V79A 2RNJA 3BG5A 2JTVA 2K85A 3K4NA 2JUGA 1GLNA 2HXIA 2VQHA 1X4PA 2DK5A 3WHCA 4AM3A 3GZ6A 2DPDA 3F8BA 2RDPA 2LD5A 3GZNB 1ONVA 1BJAA 3KLOA 4CA0A 4BGDA 2D2WA 2FSWA 3BTLA 1ZGWA 1MH3A 3A0BC 4N0BA 1U5TA 1BIBA 3ZMSA 3AAFA 2VOOA 3OYMA 4XRMA 5IP6A 1IV8A 5EGOB 5KNLA 1R00A 1P9QC 1FOWA 2D1HA 1FPQA 4MQVA 3X2QH 3NAUA 2STTA 2ZSIB 2V7FA 3FM3A 2ZSHB 2ISYA 5CKTA 1SEUA 1WJFA 5DD4A 4MIMA 2IT0A 1FOXA 2P5VA 2M87A 4U7DA 3AL0B 4G12A 1Y1WJ 3ZGKA 3AG2H 1WSUA 1Z91A 2DFEA 3BY6A 5E8GA 2TRTA 3L2VA 4BHPA 2VJJA 3CP2A 4EV0A 1VQ4I 1MW7A 2Z3YA 5IT3A 3HSFA 2ZNZA 2GIVA 1YOVB 4ZYAA 1YJNI 1U5TC 2VJIA 3OSGA 4RGRA 5J8CA 2Z1DA 1FMWA 1ZRFA 2L7MP 4YEJA 4RAGA 3HOVJ 1RR7A 3Q0VA 4FT8A 3OWTA 1SD4A 1Z21A 5KAFC 1T33A 4CH7A 4G7HF 2M4GA 4ZZDA 1XMAA 2M8GX 2HNHA 2DMTA 3K4BA 4MEYF 3CC4I 1YRNA 1FTTA 5LHGA 3TOBA 3DLAA 1WJBA 4FHTA 3HB9A 5IOZA 2WY7Q 2I10A 1JHFA 1R6RA 1RKWA 3G73A 4I0AA 3OMYA 1V5FA 3SDBA 2MD5A 2NS8A 4AU7A 4B44A 5ILSA 1C0WA 2ACJA 2NVUB 3BPXA 3JSOA 1AHDP 3QU3A 4F52A 4BY7J 4FTHA 2CV1A 1S6LA 1HKQA 2DA4A 2X6OA 4XLFA 2JUCA 1ULYA 1L3LA 1LNWA 1YX5A 3JCUC 4Q48A 1YQAA 1T98A 1QHHD 3CJQB 3FWEA 2LP0A 1WWXA 5JHUA 3IWFA 4GDFA 4IEJA 2QVOA 3PNYA 1IRGA 3VEPA 3GZ5A 4YIIA 4E7JA 1ACIA 4FISA 1N78A 1FEXA 2YPRA 4BACA 2DW4A 4A3GJ 2X0LA 1VZ0A 1X2MA 1R71A 2QEXI 3L09A 4L5JA 3WODF 3OV8A 1OKRA 1XN7A 3KP6A 3DFGA 3TO7A 5F08A 4YFKF 4A0XA 4PCQA 2KFDA 2UUZA 2MFZA 2VT3A 5HS9A 2PMZN 1BI0A 1MKMA 2LC2A 3CESA 4PZJA 2WWYA 2DDBA 5ILVA 2DA7A 4XN3A 2EQRA 3E6CC 1YHQI 4RB3C 1O7FA 4CCKA 1FYLA 1DGWY 2PJRB 2ZCWA 3KEOA 4EJUA 3M3YJ 4HA8A 3TO9A 3N05A 5D6FA 4BQNA 3DEWA 5GAEJ 3OR1C 2CMPA 2M5WA 2M4KA 3H5AA 3GFIA 4KDPA 2R7OA 1D8JA 2MC4A 4NB5A 2A3SA 2L5QA 3F6VA 2DOAA 1NK3P 4UUSA 4BS9A 1WJ5A 5J6XA 4GYIA 4LGWA 4C3HJ 4M6XA 3H3UA 2R5YA 2EZKA 3FBIB 2BGCA 2K9NA 2IP2A 3JAMZ 2IW5A 3LSKA 3RKYA 1W36C 3HOWJ 2CUZA 5DTDA 2A6TA 4PJMA 3RCOA 3H0DA 1B8IA 2PJRA 3CMYA 2B7EA 5LBQA 2GA1A 2LY9A 2KIQA 3WG7H 3OYDA 4CSWA 5DEQA 4UXNA 3G1LA 3E0JB 2X1DA 2CUEA 1R5GA 5JLWA 4XLAA 3DEUA 1J5YA 4XORA 2G0EA 5EJCA 4G6TB 2L9NA 2BOLA 3QPSA 2V9KA 2XKOA 2ELKA 2VJ5A 2XAJA 4A6EA 2M3AA 2NVYJ 2V9VA 3BR1A 3BR5A 2YS9A 2MW8A 4GFBA 5FROA 2NVTJ 2PBIA 4BY1J 2M45A 1BA5A 4BQQA 4BKXA 3RSNA 4YIFA 1W7PB 3P9KA 1EA3A 4NC8A 4Y4RA 1KZHA 3ZQQA 2XIGA 4A3IJ 3FBNB 1WGXA 1XX5A 3FMQA 5C3EJ 3L1PA 4Y17A 2LMDA 4BDZA 3BG9A 5HODA 4RGSA 2RQQA 1WH5A 2AXTC 5ERIA 3L2UA 5BS6A 3CCMI 4HAMA 3A01B 4KICA 2EILH 1FIPA 4M9SA 4LITA 1YW7A 3GMEA 3OYLA 1QPMA 2ZJQF 2ZFWA 3ASOH 3W2AA 2IJLA 2GXGA 5CYVA 4S05A 1P4XA 2K86A 3MVPA 4O5VA 3KCCA 2XUBA 5L3BA 2MGQA 2VC0A 4A2UA 2DOEA 2IVMA 4LG0B 4N4NB 3K1PA 3BTIA 4ZYGA 3FZVA 3F72A 4WXHA 4EGYA 1FY7A 1ENHA 4DYCA 4PDKA 4BXFA 2ZJ2A 2B9SA 4B47A 3DCFA 3S2WA 1Q1HA 2HYFA 1T6SA 2DO7A 3A01A 2BVLA 3LWFA 1AU7A 1TT0A 4AIDA 3CMEI 2EPFA 3LSGA 3QQAA 5JVGF 5IP9J 3T8TA 4BEHA 1IN7A 5FFXA 2CQNA 1R5HA 2WB1N 4HQEA 2VUMJ 2E2IJ 4HDVA 3I56I 3HUGA 1G6NA 3EETA 4LG0A 4BYYA 2EB7A 2QUFA 3QRFF 4HF1A 2OF7A 1UFMA 1Y0UA 1RESA 3S2HJ 1FP1D 5GAHJ 1D0YA 2X6YA 3H5RA 1J9IA 4A3DJ 5A2QZ 3RYRA 2ICWG 2LLKA 1V4RA 2QQAA 3VSLA 5KHDA 3W2WA 1YS7A 3CF2A 3HRTA 1YLFA 2MABA 2JA6J 2E35A 3I55I 2OPTA 4ZTJA 4XLHA 5K1YA 1FZPB 2DI3A 3QOPA 4PJJA 1Z05A 3BCBA 2P8TA 4XLPF 2O5RA 3QPHA 2JJ7A 4NHJA 4S0HB 4PK4A 3DV8A 5C4JJ 1D1AA 2IA0A 2X9DA 5DCMA 1WH7A 1YW8A 3BCAA 2R7SA 2G7HA 5JHFA 4IO9F 1MNMC 2MA3A 1LE8B 3MN2A 3ZOBA 3JRFA 1X1BA 3RQ4A 4LB5A 3HOUJ 3CCUI 3KP3A 3ZQ7A 2BZTA 2EZLA 1QQIA 4B8XA 1JKQC 4LIUA 2O61A 2J5PA 1G8XA 1P2FA 1JE8A 1HSJA 3B73A 1V5GA 5CVRA 1X19A 4JP0A 1QU3A 2ZMEC 3BZ6A 3FF5A 3QPLA 4KIBA 2HS5A 2HOAA 2QSFX 4HEA2 2XGCA 3CCSI 4ESJA 2DMQA 5E1WA 3HIFA 2FE3A 2JK3A 3C3WA 3K10A 1STZA 1APLC 3BG3A 2P4WA 1J2XA 1LE8A 1AKHA 3KFWX 3CLOA 2JSPA 4MGRA 1FJLA 3BT9A 2XB5A 4C2MJ 3CDHA 4ESBA 5FLXK 2M9HA 5HDGA 3M1EA 2COMA 1VQNI 1T95A 2JMWA 1OPCA 1ORKA 1Z9CA 1LPQA 5BMZA 3KYLA 2H8WA 3HTUA 2JRMA 1POGA 1LDDA 5KCMA 2W1OA 5F0FA 4ASNA 1YJWI 1XCVA 2XAUA 2FMYA 1RNLA 4HLXA 3J81K 2OTLI 2I5UA 3IH4A 3KE2A 1E3PA 3O8GA 3CJRB 4BL0B 3OYAA 4KIFA 5BPDA 2X6WA 3CF5F 1SANA 2M2EA 3I53A 3ZQFA 1PUEE 3H5NA 3T5XA 5LGUA 3WTZA 2VKDA 1MDMB 2MBFA 2BY2A 4JX6A 3KP5A 3MZYA 3BJAA 2JA8J 2NS7A 1GXQA 4ANJA 3OYCA 1I1GA 5L3EA 3WTUC 2X48A 2OU2A 2XSDC 2XF5A 4RM2A 3CMAI 2FBKA 2E36A 2CQKA 1YS6A 4ON0A 3GX4X 2VPLA 1JI8A 1TBXA 4OMYA 4W1UA 5AIPA 2M1BA 2Y0SA 3BR2A 1MSEC 5GAGJ 2HDWA 4G7ZF 2R7VA 5J1UA 2H1KA 4X1EA 3FXKA 5JR3A 3BP8A 4M6YA 3BOQA 1Z3YA 2AXLA 3Q0WA 2VOPA 4BE2A 4KA4A 3F8FA 3TW7A 3K9TA 4Q4ZF 2NNNA 2LNBA 4OOIA 3W6VA 1IUYA 5J3LA 4QLCU 3OYHA 3FXJA 1SD5A 1S7EA 2BEOA 4CYCB 3PUBA 4V2GA 3DBHB 5K5RA 1RR8C 1FSHA 4UY8I 2CFOA 3OL3A 4D5FA 2STWA 4MLOA 2R3SA 1YFHA 1IRZA 4BJ5C 2VQGA 2VT2A 2L0KA 4BUPA 2R4GA 3K4MA 3T1BA 3ZQLA 4EGZA 3D5RC 4W97A 1FLIA 1S7AA 4Q47A 3IP4B 2HPMA 4GGGA 3P7NA 3V42A 2F5EA 5F0HA 4IRHA 1D1BA 2BXYA 1Y0NA 5CJ9A 4O6JA 2WAQN 2HOTA 1LEAA 3ZQCA 3J7ZI 5D4RA 4QWQA 3GEZA 4CDGA 2JSCA 2OV7A 2VONA 5B66C 2QWWA 5FKMA 4WK8F 2EFOA 2OCEA 2W85A 3CDIA 4NQWA 1SAXA 1G59A 1R5ID 2QSHX 1NH3A 4A5MA 2XHKA 2KPMA 4U7BA 1TWAJ 2ESNA 1X1AA 4M72A 3BTCA 3ZMTA 1WJAA 3G3ZA 2V9PA 3A4CA 3C1DA 3RZOJ 1N75A 3AG3H 2JWTA 4XSZF 3ERMA 4QSHA 1UHWA 3DTEA 1Z6RA 5FO5A 2Z33A 1HW1A 2O7OA 4HW0A 3GTOJ 1JUPA 1J7KA 2KRCA 3C2BA 5FKOA 1IV6A 1GXPA 3I0TA 1VQ6I 1I39A 3V7SA 4C2TA 2EFWA 3SZGA 5IYDJ 2WA0A 2IGMA 2QQ9A 4IL6C 2HDCA 2NYXA 1AWCA 4F92B 4G9YA 2HQ5A 1DU0A 3I64A 3IRQA 3BROA 1G3WA 2V1NA 4ZDPA 5GADJ 1ZREA 3AKZA 2EH3A 2YX7A 3H9JA 3HRUA 4CICA 4F93B 1S9HA 3ESWB 2FQ4A 3IKTA 3I4PA 2PEXA 5CVVA 3FMSA 5J4YA 4H0EA 5GPCA 2Q0OA 2F4MB 3V7RA 4HSRA 4ZDOA 4JX4A 3A1YA 1TW2A 1LB2A 3SFZA 1HXDA 4II3A 4FASD 3CUQA 2A5YB 4PUSA 5M5XJ 4PGHA 4UUVA 1QVUA 4CZZA 4DBQA 1REPC 2COBA 3FXRA 1NTCA 3F23A 1VQPI 4B48A 4RS8A 3WTXC 1DU6A 4NDLA 5L3DA 4XRSA 4MNUA 1SFOJ 3MQ0A 5HLTA 1X1PA 2WAEA 5D5VB 4IKFA 1FOYA 1HQCA 5LHIA 5JI6A 2CQXA 3LQQA 2DLLA 1K4SA 2DODA 3WGHA 2Z9OA 3PSFA 3LAJA 5EZGA 4IHYA 3DTKA 4KJZA 3VYRB 2MG4A 4MQ9F 2V6CA 3NWTA 1HKSA 3IV5A 2M8EA 1ETQA 1T8IA 4RLQA 1F43A 1T0FA 4IQ4A 1XGSA 3JRBA 2JQ7A 5TRDA 2LG4A 5K5OA 2EZHA 4LLNA 3Q0UA 1QHGA 4OIRF 3MKLA 3HKZA 2H94A 2UXXA 2DCEA 5IY5H 5TGTA 5CVJA 2EFNA 2VBYA 1OCOH 2IAIA 1IRXA 2R7DA 1O3RA 3EPZA 1HLVA 2P7CB 2RQPA 3K4CA 3ML6A 2L4AA 3MKYB 3G1OA 1OLTA 2B0LA 4ENKA 3M8EA 4Y7NJ 4A3JJ 1MMAA 4XN0A 3G2BA 2IGNA 2PLYA 3WTVC 3EYIA 1NHAA 3BC8A 4E7SA 3GWZA 1IN6A 1ZHFA 4Z2YA 4D5CA 4ZZLA 3P9CA 3FHNA 1S8NA 2R7RA 1WHUA 3S2DJ 3CC2I 1ITYA 1ETKA 1U5TB 2HWVA 3VWBA 4ZJZA 1EH8A 1TTYA 1RKTA 1HW5A 2R7XA 4NUBA 3TMOA 1H9GA 2IA2A 2K02A 1W7PD 2Z5UA 1JKPC 3D0SA 2HXOA 2B63J 5ICEA 2F4IA 2XAFA 1ZAOA 2P5LC 1ZK8A 4EJVA 2DAOA 2WV0A 3HGGA 2A07F 2J5OA 2E34A 1DQUA 2XC7A 2FJ1A 2HTSA 3VDXA 3R60A 2IGOA 3ZMDA 4A6DA 4O3MA 2WV1A 3K2ZA 3KYCB 5EYRA 2XGEA 3S1QJ 3I3LA 2F5DA 4BU2A 2ZXWH 3CC7I 4XRFA
chains in the Genus database with same CATH topology
4ETSA 4HF2A 2NAZA 2H09A 3TKYA 4RGUA 2RVCA 1G4DA 2PN6A 3QU6A 3O3KA 5IT9K 2EV6A 5H6QA 3I71A 3ROUA 3HTSB 3CTAA 3B02A 3RTRA 3GFLA 1W5TA 2CWEA 2HQNA 4LFUA 1QBJA 4A5NA 1ODDA 5L3FA 3L00A 4CYDA 1U78A 3E3VA 4WXCA 1ZLJA 2QBYA 3TQNA 4JK1X 1RIOH 4BXUA 3NRVA 4LLGF 5LHHA 4RAYA 2DU9A 2ZBKA 3I59B 2IPQX 2VXZA 4I0BA 1QZZA 2AS5F 2PMHA 3GO5A 1IRFA 1X3UA 1MJAA 5F1RA 4KYWA 3K69A 1R36A 1WI9A 5DYMA 3IKVA 3E5QA 1KU2A 2EV0A 3LQRA 1ZLKA 1RUNA 4ENNA 2L02A 5F6FA 3I59A 2EWNA 2K4JA 3FX3A 4Y15A 2DQRA 4AIJA 2ZO4A 1LJ9A 3R0AA 5H6RA 1R1VA 2HYGD 1S3JA 1YYVA 3IL2A 2V1DA 1U6GA 1O57A 2QQBA 1SFUA 2FEZA 1Z1DA 1HBXG 3R4KA 3M8FA 3M7GA 2A68F 3WTTC 2KJCA 5FD5A 4MHGA 2R7FA 3RIRA 4BAYA 2Y0MA 2XROA 5ICFA 1FT9A 1E17A 3O6BB 4LK1F 5L3GA 1I27A 2F5CA 1R1TA 2EK5A 3SZTA 5FB2A 2JPCA 3T0YA 2HQRA 1V3FA 2FF4A 1P4WA 4OIPF 1FC3A 3MWMA 1O3QA 3KLNA 1OYYA 4EVIA 5E8IA 1O3TA 1PP7U 1S7OA 3BDDA 3EQLF 2DBBA 3N97A 2L4MA 5LRRA 5DUIA 1LQ1A 5E1ZB 5CLSA 3DPLC 2A6HF 3L7WA 3FHZA 1ZG1A 1KQ8A 1R23A 3E5XA 1XSVA 4K2EA 1XCBA 5CVIA 2FXAA 4U0VA 1IN4A 3V8JA 5JVTA 3SXYA 2VE8A 3FMRA 1WKMA 3WG9A 4L9JA 5DV5A 1QZYA 3RKWA 4MTDA 2FA5A 4I02A 1SD6A 3ZMVA 4HDUA 2VC1A 2G7UA 3KP2A 1FYMA 1DPRA 1XGNA 3IHUA 5D5UB 1R7JA 2HR3A 2JRTA 3ZMZA 5F64A 1BOAA 2ZMEB 5DDGA 6PAXA 1TQMA 3D5LA 3CO6C 3KP4A 2YR2A 2WTEA 3DF8A 5DCMB 3BJ6A 3I5UA 2C6YA 2JPBA 2XGXA 4YFNF 4EM0B 5JFRA 4L9TA 3LA3A 3RKXA 3GXOA 2E7XA 2ZMEA 4JBAA 3COAC 4U0WA 3SZPA 3C18A 3RPUA 4HYEA 3FXUA 4HV5A 4WCGA 4HX8A 3LA7A 2O8XA 1XB4A 1ZYRF 4KT5C 4R8HA 4AVPA 4P9FA 2EJRA 1TNTA 1HSTA 4CGZA 4M74A 1K78A 2K27A 4OMZA 3JAMK 3R6SA 2E1CA 3GW2A 3MFKA 2XKPA 4N9HA 4IVNA 4HOBA 5LLQA 1YO5C 3RYPA 1FOKA 2V1UA 3ZN0A 2W24A 3RI4A 4BHCA 1P92A 2OAZA 2BYVE 1IAWA 1CF7A 3U1DA 4HLYA 1GVJA 1SMTA 5ED4A 3C7JA 3JTHA 1G3TA 3F21A 1J75A 3LSTA 1K6OA 1XGMA 4I2OA 3RPQA 4L5IA 5HLHA 2OZ6A 2VBZA 1KYZA 4UVCA 4S04A 3VOEA 4M9ZA 4GYGA 2DPUA 2KIFA 1E2XA 2OD5A 4GCVA 1WRJA 1B9NA 3Q9SA 5HLGA 4BQAA 2H6CA 5EEGA 1BM9A 5DUKA 1BIAA 3SHFA 3F8CA 1GHCA 4DQ2A 4KMFA 4ENJA 3FXQA 5ILUA 1LEBA 1BC8C 3EDPA 2K7LA 2QENA 2P5KA 3REOA 1U3EM 3F22A 2HGCA 4A0YA 3WTSC 2P7VB 2VODA 3HRSA 4KUMA 1YW9A 3TOAA 1CGPA 1IF1A 2A6EF 5A2QK 2LF8A 1P6RA 2FBHA 4AIHA 3HRMA 2FOKA 5D5XB 2NS0A 5DD8A 1TQIA 3DQVC 2D1VA 3CUOA 4G6QA 1D5VA 2DQLA 4FX0A 4ESFA 4EQQA 3J80Z 3ZN1A 1I1SA 4XSXF 3F3XA 5LEKA 1H0MA 4ZYHA 1MGTA 1USSA 1WQ2A 2M30A 3O2PE 1MZBA 1XDSA 4UV9A 3E97A 3CUQB 3V7CA 1TNSA 3MEXA 3I58A 1QNTA 1ZGJA 3WU1B 3NQOA 4R1HA 1KQ0A 3MZHA 5FGMA 4L0ZB 1HKTA 4RB1A 2DT5A 5E18F 2D45A 4KN7X 3ECHA 4UVBA 5D8LB 4G7OF 3QAHA 2V1XA 3ECOA 1U8RA 1IZ1A 2UWMA 4HX4A 3K0LA 1J0RA 5HDNA 2OBPA 3QPTA 3RJPA 5HS7A 3ZP5A 5HDKA 4HV6A 1TW3A 3Q5FA 1UCRA 2CSOA 1R1UA 3WE3A 3WE2A 4CXFA 2QYOA 5D6EA 3QP6A 4MEXF 1Z7UA 3PQKA 2FBIA 5LRSA 1PDNC 3PFIA 3TGNA 1K7AA 2G9WA 4CHUA 1ZH5A 4M71A 4DNCA 4HF0A 1BI3A 3JTGA 2LKPA 2YSRA 1FP2A 1ON1A 1XD7A 1B9MA 1KGSA 4F7ZA 1ON2A 3ULQB 2JT1A 2GXBA 2PJPA 1B59A 1ZGAA 3WTWC 1L0OC 1KU9A 4LLLA 4ZH4F 2QM3A 1RI7A 1MJ9A 3P9IA 4U0YA 2CG4A 4GO1A 3BWGA 1IN8A 2QBYB 4P9UA 1D3YA 2CW0F 2DTRA 4LJZF 5E20A 4JQFA 5H20A 2XV4S 2LSOA 2OZUA 4L0YB 1OYWA 4A0ZA 3K1NA 2BBYA 2MLGA 3GF2A 4PGGA 5BPIA 4B09A 4Y13A 1DDNA 4KNYA 1J59A 2BV6A 1LDKB 2W25A 3WTYC 2RKHA 3KP7A 4FX4A 3ERED 1RUOA 4L18B 2YU3A 2O0YA 4KIGA 2O03A 1AOYA 2FRHA 4OIQF 4OINF 2KIMA 2E7WA 2LF7A 2HKOA 4IJAA 4L9VA 2W84A 2PFBA 3N4MA 3JW4A 1B1BA 2ISZA 1OYIA 3HOTA 2NRAC 4G6DA 1D8KA 4UHTA 4IF4A 2ZXJA 4WX9A 2JZYA 3HYIA 3GFMA 2NNYA 4Q5SF 2KKOA 1KA8A 1FBQA 4BNCA 2RGVA 2GZWA 4ZYDA 1F9NA 5LEJA 1ZG5A 3J7AO 3VFZA 3VODA 3GLXA 1TQPA 3H3ZA 4RB2C 2VE9A 2Y75A 4CO8A 2OQGA 2PI0A 1ZG3A 2MH2A 1ZRDA 2HTJA 2DFIA 2L3DA 4YFXF 5HVQC 2XAHA 4EJTA 3MAJA 2K4BA 3MCZA 3L2CA 4G8XA 2GQQA 4EM1A 5J8FA 1HW2A 1XGOA 4XBFA 1A04A 1YIOA 1SFXA 5EEHA 1KQ9A 1I6XA 2EA2A 4A12A 4OIOF 1XSDA 3R0JA 2PQ8A 2EV5A 1FNNA 2CGPA 5TJJA 3BJOA 3KEQA 1ZRCA 1FSEA 4G94A 2E1NA 5E17F 2HKXA 1Z6TA 2UZKA 3W6KB 1JXSA 2MH9A 2TDXA 4IRGA 1PP8F 2XASA 1O7LA 1F5TA 4XLNF 1KU3A 5FLXZ 5BOXA 1DPUA 3L9FA 2YX4A 1EH6A 4LK0F 3DP7A 3HSEA 1FYKA 2GWRA 3J81Z 2FQ3A 3GFJA 3JSPA 2HOEA 4UVAA 1LVAA 4UNOA 2F2EA 3LA2A 5D8KB 4L9NA 5BQTA 5FFZA 4M73A 1XSXA 4IXAA 5L3CA 2FNPA 3R61A 3WGIA 2ADUA 3GUDA 1EV7A 4YG2F 1IXRC 1W7PA 2CO5A 3T8RA 3RDIA 1W4MA 2O6GE 2P6SA 2VBXA 3E6MA 2GA2A 5E1XA 1FWZA 5ICGA 1EH7A 1BN5A 2XAQA 1QO0D 1T2KA 1K78B 3DXJF 3WGGA 4N9IA 2WC2A 4I98B 3ZPLA 1BBYA 1BC7C 3ISPA 2QZ8A 3KZZA 2VBWA 1JGSA 2Y48A 4U88A 2ESHA 3SQNA 1S29A 3EYYA 1OR7A 3W6JB 2Q8KA 2O3FA 1SD7A 1YG2A 1CF7B 2P6TA 5CVUA 2FNAA 2ZKZA 3E6DA 1K79A 1F4KA 3DKWA 1USTA 1B6AA 2Q2EA 2CFXA 1IW7F 4EJOA 4WF2A 3TDZC 1XMKA 4HZFA 4WXDA 1YTYA 3HOSA 2OA4A 2L54A 4RB0A 3DPTA 5KK1A 3U2RA 5HS8A 3F6OA 1DUXC 1BI1A 3OOPA 2F5FA 2XRNA 2L01A 3NEUA 4IRIA 3Q9VA 1UHMA 4EJWA 1FBSA 2RV8A 1DP7P 3F8MA 2XAGA 3ELKA 4IHSA 1OMIA 2ETHA 3TDUC 3CO7C 2HEOA 2X4HA 2HZTA 3E5UA 4TV7A 3QP5A 5KVRA 3E6BA 1I5ZA 4I01A 1MDMA 4LMYA 1U2WA 3HSRA 4HBLA 1IXSB 4AWXB 4M9XA 1R58A 2EA4A 3WU0A 2DK8A 2EFQA 3V8LA 1P4AA 2UXNA 5AIQA 3IWZA 1T39A 4P55A 3IC7A 1RZ4A 3TO6A 5D4SA 3F8NA 5K5QA 2OQRA 4KFCA 3LFKA 2KIUA 2PMUA 2VN2A 4R79A 3H92A 1LDJA 5HLIA 1KYWA 1XDUA 1MD0A 3U9GA 4HQMA 2QLZA 3M9AA 4GXOA 5IT9Z 4I09A 1IXCA 3FM5A 5DCFA 2GAUA 3PQJA 1MJBA 2H6BA 3ZMUA 5D5WB 2Z99A 1G3YA 2FU4A 2PG4A 3V8KA 1BI2A 3IRRA 2IA1A 5LGNA 2W57A 1O3SA 4D0PA 2LDUA 3HHGA 2ZNYA 1TLHB 4RAZA 3V4GA 3HHHA 1ZN2A 4P5OA 4OU0A 5LGTA 1VTNC 1IN5A 2KJBA 3VB2A 3KZYA 2H27A 4AD9A 2A69F 2FMLA 4AIKA 4BHBA 4EMSA 4EM2A 2A61A 3GVAA 2ELHA 2XVCA 1SMYF 1SFEA 3EUHA 1FBUA 4P96A 4BH9A 3KETA 5FD6A 2IRFG 1F1ZA 4KN4X 1B4AA 3CUQC 1G3SA 3LAPA 4MTEA 4ENMA 1QGPA 4I7HA 3ABTA 4LD5A 3I54A 1FX7A 5ICCA 2RN7A 3ABUA 4ZYEA 3K1MA 1ZARA 1R22A 1W5SA 4WWCA 4RGXA 2BE5F 3BPVA 4E70A 4IHTA 4IPAA 2HFHA 1T38A 4LB6B 4HX7A 3CJNA 2CYYA 1JHHA 2KRFA 1H9TA 2MC3A 2RC4A 4UV8A 1KU7A 3GYHX 2MLKA 4KMUX 5HOOA 5AONA 3J80K 1UB9A 2EFPA 2V79A 2RNJA 2JTVA 2DK5A 3GZ6A 2DPDA 3F8BA 2RDPA 1ONVA 1BJAA 3KLOA 2D2WA 2FSWA 4N0BA 1U5TA 1BIBA 3ZMSA 3AAFA 2VOOA 1R00A 4MQVA 2D1HA 1FPQA 2STTA 3FM3A 2ISYA 5DD4A 2IT0A 2P5VA 2M87A 4U7DA 1WSUA 1Z91A 3BY6A 5E8GA 4BHPA 4EV0A 2Z3YA 5IT3A 3HSFA 2ZNZA 2GIVA 1U5TC 4RGRA 5J8CA 1ZRFA 4FT8A 1SD4A 4G7HF 4ZZDA 1XMAA 4MEYF 5LHGA 3TOBA 4FHTA 1JHFA 3G73A 4I0AA 2MD5A 5ILSA 1C0WA 2ACJA 3JSOA 3BPXA 3QU3A 1S6LA 1HKQA 1ULYA 1L3LA 1LNWA 4Q48A 1YQAA 1T98A 3FWEA 1WWXA 5JHUA 3IWFA 2QVOA 1IRGA 3VEPA 3GZ5A 4YIIA 2YPRA 2DW4A 2X0LA 3L09A 4L5JA 3WODF 3OV8A 1OKRA 1XN7A 3KP6A 3DFGA 3TO7A 4YFKF 4A0XA 4PCQA 2VT3A 5HS9A 1BI0A 1MKMA 4PZJA 2WWYA 5ILVA 3E6CC 4RB3C 1O7FA 1FYLA 2ZCWA 3KEOA 4EJUA 4HA8A 3TO9A 5D6FA 2M5WA 3GFIA 4KDPA 1D8JA 4NB5A 2A3SA 3F6VA 5J6XA 4GYIA 4LGWA 4M6XA 3H3UA 2BGCA 2IP2A 3JAMZ 2IW5A 3RKYA 5LBQA 2GA1A 5DEQA 4UXNA 1R5GA 3DEUA 1J5YA 2XKOA 2XAJA 4A6EA 2V9VA 2PBIA 2M45A 4YIFA 1W7PB 3P9KA 2XIGA 3FMQA 4Y17A 4RGSA 5ERIA 5BS6A 4HAMA 4KICA 4M9SA 1YW7A 1QPMA 2ZFWA 2IJLA 2GXGA 5CYVA 4S05A 1P4XA 2K86A 4O5VA 3KCCA 2XUBA 5L3BA 2VC0A 4A2UA 2IVMA 4LG0B 3K1PA 4ZYGA 3FZVA 3F72A 4WXHA 4EGYA 1FY7A 4PDKA 2ZJ2A 3S2WA 1Q1HA 2HYFA 1T6SA 2DO7A 3LWFA 3T8TA 1IN7A 5FFXA 4HQEA 1R5HA 4HDVA 3HUGA 1G6NA 3EETA 4LG0A 4BYYA 2EB7A 2QUFA 3QRFF 4HF1A 1UFMA 1Y0UA 1FP1D 1J9IA 5A2QZ 3RYRA 1V4RA 2QQAA 1YS7A 3HRTA 1YLFA 1FZPB 5K1YA 2DI3A 3QOPA 1Z05A 2P8TA 4XLPF 3QPHA 4NHJA 3DV8A 2IA0A 5DCMA 1YW8A 2G7HA 2MA3A 4LB5A 3KP3A 3ZQ7A 4B8XA 1QQIA 2O61A 2J5PA 1P2FA 1JE8A 1HSJA 3B73A 5CVRA 3BZ6A 3FF5A 4KIBA 2HS5A 4ESJA 5E1WA 3HIFA 2FE3A 3C3WA 1STZA 2P4WA 1J2XA 3KFWX 3CLOA 4MGRA 3CDHA 4ESBA 5FLXK 5HDGA 3M1EA 2COMA 1OPCA 1Z9CA 5BMZA 3HTUA 1LDDA 4ASNA 1XCVA 2FMYA 1RNLA 4HLXA 3J81K 3KE2A 4KIFA 5BPDA 3I53A 1PUEE 3T5XA 5LGUA 3WTZA 1MDMB 2MBFA 3KP5A 3MZYA 3BJAA 1GXQA 1I1GA 5L3EA 3WTUC 2OU2A 2FBKA 4ON0A 2CQKA 1YS6A 3GX4X 1TBXA 4OMYA 5AIPA 2M1BA 4G7ZF 5JR3A 3BP8A 4M6YA 3BOQA 2AXLA 2VOPA 4KA4A 3F8FA 3K9TA 4Q4ZF 2NNNA 2LNBA 4OOIA 1IUYA 4QLCU 1SD5A 2BEOA 5K5RA 1FSHA 2STWA 2R3SA 1YFHA 2VT2A 3T1BA 4EGZA 1FLIA 1S7AA 4Q47A 4GGGA 3P7NA 2F5EA 4IRHA 5CJ9A 4O6JA 1LEAA 5D4RA 4QWQA 3GEZA 4CDGA 2JSCA 2VONA 2QWWA 4WK8F 2EFOA 2W85A 4NQWA 1SAXA 4A5MA 2XHKA 4U7BA 2ESNA 4M72A 3ZMTA 3G3ZA 3C1DA 4XSZF 1UHWA 1Z6RA 5FO5A 2Z33A 1HW1A 4HW0A 1J7KA 1GXPA 3I0TA 3V7SA 2EFWA 2QQ9A 2HDCA 2NYXA 1AWCA 4G9YA 3I64A 3IRQA 3BROA 1G3WA 1ZREA 2YX7A 3HRUA 4CICA 3IKTA 3I4PA 4H0EA 2PEXA 3FMSA 5CVVA 2Q0OA 3V7RA 1TW2A 1LB2A 3SFZA 1HXDA 3CUQA 2A5YB 4UUVA 4PGHA 4CZZA 1REPC 3FXRA 3F23A 3WTXC 4RS8A 5L3DA 4MNUA 3MQ0A 5D5VB 1HQCA 5LHIA 5JI6A 3LQQA 2DLLA 3WGHA 2Z9OA 3LAJA 4MQ9F 2V6CA 1HKSA 2M8EA 1T0FA 1XGSA 5TRDA 5K5OA 4LLNA 4OIRF 2H94A 2UXXA 5CVJA 2EFNA 2VBYA 2R7DA 1O3RA 2P7CB 2RQPA 3ML6A 2L4AA 2B0LA 4ENKA 3M8EA 2PLYA 3WTVC 3EYIA 1NHAA 3GWZA 1IN6A 1ZHFA 4Z2YA 4ZZLA 3P9CA 1S8NA 1U5TB 2HWVA 1EH8A 1TTYA 1HW5A 1H9GA 2IA2A 2K02A 1W7PD 2Z5UA 3D0SA 5ICEA 2XAFA 1ZAOA 2P5LC 4EJVA 2DAOA 2WV0A 2A07F 2J5OA 2HTSA 3R60A 3ZMDA 4A6DA 4O3MA 3K2ZA 2F5DA 4XRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ETS A;  4HF2 A;  2NAZ A;  2H09 A;  3TKY A;  4RGU A;  2RVC A;  1G4D A;  2PN6 A;  3QU6 A;  3O3K A;  5IT9 K;  2EV6 A;  5H6Q A;  3I71 A;  3ROU A;  3HTS B;  3CTA A;  3B02 A;  3RTR A;  3GFL A;  1W5T A;  2CWE A;  2HQN A;  4LFU A;  1QBJ A;  4A5N A;  1ODD A;  5L3F A;  3L00 A;  4CYD A;  1U78 A;  3E3V A;  4WXC A;  1ZLJ A;  2QBY A;  3TQN A;  4JK1 X;  1RIO H;  4BXU A;  3NRV A;  4LLG F;  5LHH A;  4RAY A;  2DU9 A;  2ZBK A;  3I59 B;  2IPQ X;  2VXZ A;  4I0B A;  1QZZ A;  2AS5 F;  2PMH A;  3GO5 A;  1IRF A;  1X3U A;  1MJA A;  5F1R A;  4KYW A;  3K69 A;  1R36 A;  1WI9 A;  5DYM A;  3IKV A;  3E5Q A;  1KU2 A;  2EV0 A;  3LQR A;  1ZLK A;  1RUN A;  4ENN A;  2L02 A;  5F6F A;  3I59 A;  2EWN A;  2K4J A;  3FX3 A;  4Y15 A;  2DQR A;  4AIJ A;  2ZO4 A;  1LJ9 A;  3R0A A;  5H6R A;  1R1V A;  2HYG D;  1S3J A;  1YYV A;  3IL2 A;  2V1D A;  1U6G A;  1O57 A;  2QQB A;  1SFU A;  2FEZ A;  1Z1D A;  1HBX G;  3R4K A;  3M8F A;  3M7G A;  2A68 F;  3WTT C;  2KJC A;  5FD5 A;  4MHG A;  2R7F A;  3RIR A;  4BAY A;  2Y0M A;  2XRO A;  5ICF A;  1FT9 A;  1E17 A;  3O6B B;  4LK1 F;  5L3G A;  1I27 A;  2F5C A;  1R1T A;  2EK5 A;  3SZT A;  5FB2 A;  2JPC A;  3T0Y A;  2HQR A;  1V3F A;  2FF4 A;  1P4W A;  4OIP F;  1FC3 A;  3MWM A;  1O3Q A;  3KLN A;  1OYY A;  4EVI A;  5E8I A;  1O3T A;  1PP7 U;  1S7O A;  3BDD A;  3EQL F;  2DBB A;  3N97 A;  2L4M A;  5LRR A;  5DUI A;  1LQ1 A;  5E1Z B;  5CLS A;  3DPL C;  2A6H F;  3L7W A;  3FHZ A;  1ZG1 A;  1KQ8 A;  1R23 A;  3E5X A;  1XSV A;  4K2E A;  1XCB A;  5CVI A;  2FXA A;  4U0V A;  1IN4 A;  3V8J A;  5JVT A;  3SXY A;  2VE8 A;  3FMR A;  1WKM A;  3WG9 A;  4L9J A;  5DV5 A;  1QZY A;  3RKW A;  4MTD A;  2FA5 A;  4I02 A;  1SD6 A;  3ZMV A;  4HDU A;  2VC1 A;  2G7U A;  3KP2 A;  1FYM A;  1DPR A;  1XGN A;  3IHU A;  5D5U B;  1R7J A;  2HR3 A;  2JRT A;  3ZMZ A;  5F64 A;  1BOA A;  2ZME B;  5DDG A;  6PAX A;  1TQM A;  3D5L A;  3CO6 C;  3KP4 A;  2YR2 A;  2WTE A;  3DF8 A;  5DCM B;  3BJ6 A;  3I5U A;  2C6Y A;  2JPB A;  2XGX A;  4YFN F;  4EM0 B;  5JFR A;  4L9T A;  3LA3 A;  3RKX A;  3GXO A;  2E7X A;  2ZME A;  4JBA A;  3COA C;  4U0W A;  3SZP A;  3C18 A;  3RPU A;  4HYE A;  3FXU A;  4HV5 A;  4WCG A;  4HX8 A;  3LA7 A;  2O8X A;  1XB4 A;  1ZYR F;  4KT5 C;  4R8H A;  4AVP A;  4P9F A;  2EJR A;  1TNT A;  1HST A;  4CGZ A;  4M74 A;  1K78 A;  2K27 A;  4OMZ A;  3JAM K;  3R6S A;  2E1C A;  3GW2 A;  3MFK A;  2XKP A;  4N9H A;  4IVN A;  4HOB A;  5LLQ A;  1YO5 C;  3RYP A;  1FOK A;  2V1U A;  3ZN0 A;  2W24 A;  3RI4 A;  4BHC A;  1P92 A;  2OAZ A;  2BYV E;  1IAW A;  1CF7 A;  3U1D A;  4HLY A;  1GVJ A;  1SMT A;  5ED4 A;  3C7J A;  3JTH A;  1G3T A;  3F21 A;  1J75 A;  3LST A;  1K6O A;  1XGM A;  4I2O A;  3RPQ A;  4L5I A;  5HLH A;  2OZ6 A;  2VBZ A;  1KYZ A;  4UVC A;  4S04 A;  3VOE A;  4M9Z A;  4GYG A;  2DPU A;  2KIF A;  1E2X A;  2OD5 A;  4GCV A;  1WRJ A;  1B9N A;  3Q9S A;  5HLG A;  4BQA A;  2H6C A;  5EEG A;  1BM9 A;  5DUK A;  1BIA A;  3SHF A;  3F8C A;  1GHC A;  4DQ2 A;  4KMF A;  4ENJ A;  3FXQ A;  5ILU A;  1LEB A;  1BC8 C;  3EDP A;  2K7L A;  2QEN A;  2P5K A;  3REO A;  1U3E M;  3F22 A;  2HGC A;  4A0Y A;  3WTS C;  2P7V B;  2VOD A;  3HRS A;  4KUM A;  1YW9 A;  3TOA A;  1CGP A;  1IF1 A;  2A6E F;  5A2Q K;  2LF8 A;  1P6R A;  2FBH A;  4AIH A;  3HRM A;  2FOK A;  5D5X B;  2NS0 A;  5DD8 A;  1TQI A;  3DQV C;  2D1V A;  3CUO A;  4G6Q A;  1D5V A;  2DQL A;  4FX0 A;  4ESF A;  4EQQ A;  3J80 Z;  3ZN1 A;  1I1S A;  4XSX F;  3F3X A;  5LEK A;  1H0M A;  4ZYH A;  1MGT A;  1USS A;  1WQ2 A;  2M30 A;  3O2P E;  1MZB A;  1XDS A;  4UV9 A;  3E97 A;  3CUQ B;  3V7C A;  1TNS A;  3MEX A;  3I58 A;  1QNT A;  1ZGJ A;  3WU1 B;  3NQO A;  4R1H A;  1KQ0 A;  3MZH A;  5FGM A;  4L0Z B;  1HKT A;  4RB1 A;  2DT5 A;  5E18 F;  2D45 A;  4KN7 X;  3ECH A;  4UVB A;  5D8L B;  4G7O F;  3QAH A;  2V1X A;  3ECO A;  1U8R A;  1IZ1 A;  2UWM A;  4HX4 A;  3K0L A;  1J0R A;  5HDN A;  2OBP A;  3QPT A;  3RJP A;  5HS7 A;  3ZP5 A;  5HDK A;  4HV6 A;  1TW3 A;  3Q5F A;  1UCR A;  2CSO A;  1R1U A;  3WE3 A;  3WE2 A;  4CXF A;  2QYO A;  5D6E A;  3QP6 A;  4MEX F;  1Z7U A;  3PQK A;  2FBI A;  5LRS A;  1PDN C;  3PFI A;  3TGN A;  1K7A A;  2G9W A;  4CHU A;  1ZH5 A;  4M71 A;  4DNC A;  4HF0 A;  1BI3 A;  3JTG A;  2LKP A;  2YSR A;  1FP2 A;  1ON1 A;  1XD7 A;  1B9M A;  1KGS A;  4F7Z A;  1ON2 A;  3ULQ B;  2JT1 A;  2GXB A;  2PJP A;  1B59 A;  1ZGA A;  3WTW C;  1L0O C;  1KU9 A;  4LLL A;  4ZH4 F;  2QM3 A;  1RI7 A;  1MJ9 A;  3P9I A;  4U0Y A;  2CG4 A;  4GO1 A;  3BWG A;  1IN8 A;  2QBY B;  4P9U A;  1D3Y A;  2CW0 F;  2DTR A;  4LJZ F;  5E20 A;  4JQF A;  5H20 A;  2XV4 S;  2LSO A;  2OZU A;  4L0Y B;  1OYW A;  4A0Z A;  3K1N A;  2BBY A;  2MLG A;  3GF2 A;  4PGG A;  5BPI A;  4B09 A;  4Y13 A;  1DDN A;  4KNY A;  1J59 A;  2BV6 A;  1LDK B;  2W25 A;  3WTY C;  2RKH A;  3KP7 A;  4FX4 A;  3ERE D;  1RUO A;  4L18 B;  2YU3 A;  2O0Y A;  4KIG A;  2O03 A;  1AOY A;  2FRH A;  4OIQ F;  4OIN F;  2KIM A;  2E7W A;  2LF7 A;  2HKO A;  4IJA A;  4L9V A;  2W84 A;  2PFB A;  3N4M A;  3JW4 A;  1B1B A;  2ISZ A;  1OYI A;  3HOT A;  2NRA C;  4G6D A;  1D8K A;  4UHT A;  4IF4 A;  2ZXJ A;  4WX9 A;  2JZY A;  3HYI A;  3GFM A;  2NNY A;  4Q5S F;  2KKO A;  1KA8 A;  1FBQ A;  4BNC A;  2RGV A;  2GZW A;  4ZYD A;  1F9N A;  5LEJ A;  1ZG5 A;  3J7A O;  3VFZ A;  3VOD A;  3GLX A;  1TQP A;  3H3Z A;  4RB2 C;  2VE9 A;  2Y75 A;  4CO8 A;  2OQG A;  2PI0 A;  1ZG3 A;  2MH2 A;  1ZRD A;  2HTJ A;  2DFI A;  2L3D A;  4YFX F;  5HVQ C;  2XAH A;  4EJT A;  3MAJ A;  2K4B A;  3MCZ A;  3L2C A;  4G8X A;  2GQQ A;  4EM1 A;  5J8F A;  1HW2 A;  1XGO A;  4XBF A;  1A04 A;  1YIO A;  1SFX A;  5EEH A;  1KQ9 A;  1I6X A;  2EA2 A;  4A12 A;  4OIO F;  1XSD A;  3R0J A;  2PQ8 A;  2EV5 A;  1FNN A;  2CGP A;  5TJJ A;  3BJO A;  3KEQ A;  1ZRC A;  1FSE A;  4G94 A;  2E1N A;  5E17 F;  2HKX A;  1Z6T A;  2UZK A;  3W6K B;  1JXS A;  2MH9 A;  2TDX A;  4IRG A;  1PP8 F;  2XAS A;  1O7L A;  1F5T A;  4XLN F;  1KU3 A;  5FLX Z;  5BOX A;  1DPU A;  3L9F A;  2YX4 A;  1EH6 A;  4LK0 F;  3DP7 A;  3HSE A;  1FYK A;  2GWR A;  3J81 Z;  2FQ3 A;  3GFJ A;  3JSP A;  2HOE A;  4UVA A;  1LVA A;  4UNO A;  2F2E A;  3LA2 A;  5D8K B;  4L9N A;  5BQT A;  5FFZ A;  4M73 A;  1XSX A;  4IXA A;  5L3C A;  2FNP A;  3R61 A;  3WGI A;  2ADU A;  3GUD A;  1EV7 A;  4YG2 F;  1IXR C;  1W7P A;  2CO5 A;  3T8R A;  3RDI A;  1W4M A;  2O6G E;  2P6S A;  2VBX A;  3E6M A;  2GA2 A;  5E1X A;  1FWZ A;  5ICG A;  1EH7 A;  1BN5 A;  2XAQ A;  1QO0 D;  1T2K A;  1K78 B;  3DXJ F;  3WGG A;  4N9I A;  2WC2 A;  4I98 B;  3ZPL A;  1BBY A;  1BC7 C;  3ISP A;  2QZ8 A;  3KZZ A;  2VBW A;  1JGS A;  2Y48 A;  4U88 A;  2ESH A;  3SQN A;  1S29 A;  3EYY A;  1OR7 A;  3W6J B;  2Q8K A;  2O3F A;  1SD7 A;  1YG2 A;  1CF7 B;  2P6T A;  5CVU A;  2FNA A;  2ZKZ A;  3E6D A;  1K79 A;  1F4K A;  3DKW A;  1UST A;  1B6A A;  2Q2E A;  2CFX A;  1IW7 F;  4EJO A;  4WF2 A;  3TDZ C;  1XMK A;  4HZF A;  4WXD A;  1YTY A;  3HOS A;  2OA4 A;  2L54 A;  4RB0 A;  3DPT A;  5KK1 A;  3U2R A;  5HS8 A;  3F6O A;  1DUX C;  1BI1 A;  3OOP A;  2F5F A;  2XRN A;  2L01 A;  3NEU A;  4IRI A;  3Q9V A;  1UHM A;  4EJW A;  1FBS A;  2RV8 A;  1DP7 P;  3F8M A;  2XAG A;  3ELK A;  4IHS A;  1OMI A;  2ETH A;  3TDU C;  3CO7 C;  2HEO A;  2X4H A;  2HZT A;  3E5U A;  4TV7 A;  3QP5 A;  5KVR A;  3E6B A;  1I5Z A;  4I01 A;  1MDM A;  4LMY A;  1U2W A;  3HSR A;  4HBL A;  1IXS B;  4AWX B;  4M9X A;  1R58 A;  2EA4 A;  3WU0 A;  2DK8 A;  2EFQ A;  3V8L A;  1P4A A;  2UXN A;  5AIQ A;  3IWZ A;  1T39 A;  4P55 A;  3IC7 A;  1RZ4 A;  3TO6 A;  5D4S A;  3F8N A;  5K5Q A;  2OQR A;  4KFC A;  3LFK A;  2KIU A;  2PMU A;  2VN2 A;  4R79 A;  3H92 A;  1LDJ A;  5HLI A;  1KYW A;  1XDU A;  1MD0 A;  3U9G A;  4HQM A;  2QLZ A;  3M9A A;  4GXO A;  5IT9 Z;  4I09 A;  1IXC A;  3FM5 A;  5DCF A;  2GAU A;  3PQJ A;  1MJB A;  2H6B A;  3ZMU A;  5D5W B;  2Z99 A;  1G3Y A;  2FU4 A;  2PG4 A;  3V8K A;  1BI2 A;  3IRR A;  2IA1 A;  5LGN A;  2W57 A;  1O3S A;  4D0P A;  2LDU A;  3HHG A;  2ZNY A;  1TLH B;  4RAZ A;  3V4G A;  3HHH A;  1ZN2 A;  4P5O A;  4OU0 A;  5LGT A;  1VTN C;  1IN5 A;  2KJB A;  3VB2 A;  3KZY A;  2H27 A;  4AD9 A;  2A69 F;  2FML A;  4AIK A;  4BHB A;  4EMS A;  4EM2 A;  2A61 A;  3GVA A;  2ELH A;  2XVC A;  1SMY F;  1SFE A;  3EUH A;  1FBU A;  4P96 A;  4BH9 A;  3KET A;  5FD6 A;  2IRF G;  1F1Z A;  4KN4 X;  1B4A A;  3CUQ C;  1G3S A;  3LAP A;  4MTE A;  4ENM A;  1QGP A;  4I7H A;  3ABT A;  4LD5 A;  3I54 A;  1FX7 A;  5ICC A;  2RN7 A;  3ABU A;  4ZYE A;  3K1M A;  1ZAR A;  1R22 A;  1W5S A;  4WWC A;  4RGX A;  2BE5 F;  3BPV A;  4E70 A;  4IHT A;  4IPA A;  2HFH A;  1T38 A;  4LB6 B;  4HX7 A;  3CJN A;  2CYY A;  1JHH A;  2KRF A;  1H9T A;  2MC3 A;  2RC4 A;  4UV8 A;  1KU7 A;  3GYH X;  2MLK A;  4KMU X;  5HOO A;  5AON A;  3J80 K;  1UB9 A;  2EFP A;  2V79 A;  2RNJ A;  2JTV A;  2DK5 A;  3GZ6 A;  2DPD A;  3F8B A;  2RDP A;  1ONV A;  1BJA A;  3KLO A;  2D2W A;  2FSW A;  4N0B A;  1U5T A;  1BIB A;  3ZMS A;  3AAF A;  2VOO A;  1R00 A;  4MQV A;  2D1H A;  1FPQ A;  2STT A;  3FM3 A;  2ISY A;  5DD4 A;  2IT0 A;  2P5V A;  2M87 A;  4U7D A;  1WSU A;  1Z91 A;  3BY6 A;  5E8G A;  4BHP A;  4EV0 A;  2Z3Y A;  5IT3 A;  3HSF A;  2ZNZ A;  2GIV A;  1U5T C;  4RGR A;  5J8C A;  1ZRF A;  4FT8 A;  1SD4 A;  4G7H F;  4ZZD A;  1XMA A;  4MEY F;  5LHG A;  3TOB A;  4FHT A;  1JHF A;  3G73 A;  4I0A A;  2MD5 A;  5ILS A;  1C0W A;  2ACJ A;  3JSO A;  3BPX A;  3QU3 A;  1S6L A;  1HKQ A;  1ULY A;  1L3L A;  1LNW A;  4Q48 A;  1YQA A;  1T98 A;  3FWE A;  1WWX A;  5JHU A;  3IWF A;  2QVO A;  1IRG A;  3VEP A;  3GZ5 A;  4YII A;  2YPR A;  2DW4 A;  2X0L A;  3L09 A;  4L5J A;  3WOD F;  3OV8 A;  1OKR A;  1XN7 A;  3KP6 A;  3DFG A;  3TO7 A;  4YFK F;  4A0X A;  4PCQ A;  2VT3 A;  5HS9 A;  1BI0 A;  1MKM A;  4PZJ A;  2WWY A;  5ILV A;  3E6C C;  4RB3 C;  1O7F A;  1FYL A;  2ZCW A;  3KEO A;  4EJU A;  4HA8 A;  3TO9 A;  5D6F A;  2M5W A;  3GFI A;  4KDP A;  1D8J A;  4NB5 A;  2A3S A;  3F6V A;  5J6X A;  4GYI A;  4LGW A;  4M6X A;  3H3U A;  2BGC A;  2IP2 A;  3JAM Z;  2IW5 A;  3RKY A;  5LBQ A;  2GA1 A;  5DEQ A;  4UXN A;  1R5G A;  3DEU A;  1J5Y A;  2XKO A;  2XAJ A;  4A6E A;  2V9V A;  2PBI A;  2M45 A;  4YIF A;  1W7P B;  3P9K A;  2XIG A;  3FMQ A;  4Y17 A;  4RGS A;  5ERI A;  5BS6 A;  4HAM A;  4KIC A;  4M9S A;  1YW7 A;  1QPM A;  2ZFW A;  2IJL A;  2GXG A;  5CYV A;  4S05 A;  1P4X A;  2K86 A;  4O5V A;  3KCC A;  2XUB A;  5L3B A;  2VC0 A;  4A2U A;  2IVM A;  4LG0 B;  3K1P A;  4ZYG A;  3FZV A;  3F72 A;  4WXH A;  4EGY A;  1FY7 A;  4PDK A;  2ZJ2 A;  3S2W A;  1Q1H A;  2HYF A;  1T6S A;  2DO7 A;  3LWF A;  3T8T A;  1IN7 A;  5FFX A;  4HQE A;  1R5H A;  4HDV A;  3HUG A;  1G6N A;  3EET A;  4LG0 A;  4BYY A;  2EB7 A;  2QUF A;  3QRF F;  4HF1 A;  1UFM A;  1Y0U A;  1FP1 D;  1J9I A;  5A2Q Z;  3RYR A;  1V4R A;  2QQA A;  1YS7 A;  3HRT A;  1YLF A;  1FZP B;  5K1Y A;  2DI3 A;  3QOP A;  1Z05 A;  2P8T A;  4XLP F;  3QPH A;  4NHJ A;  3DV8 A;  2IA0 A;  5DCM A;  1YW8 A;  2G7H A;  2MA3 A;  4LB5 A;  3KP3 A;  3ZQ7 A;  4B8X A;  1QQI A;  2O61 A;  2J5P A;  1P2F A;  1JE8 A;  1HSJ A;  3B73 A;  5CVR A;  3BZ6 A;  3FF5 A;  4KIB A;  2HS5 A;  4ESJ A;  5E1W A;  3HIF A;  2FE3 A;  3C3W A;  1STZ A;  2P4W A;  1J2X A;  3KFW X;  3CLO A;  4MGR A;  3CDH A;  4ESB A;  5FLX K;  5HDG A;  3M1E A;  2COM A;  1OPC A;  1Z9C A;  5BMZ A;  3HTU A;  1LDD A;  4ASN A;  1XCV A;  2FMY A;  1RNL A;  4HLX A;  3J81 K;  3KE2 A;  4KIF A;  5BPD A;  3I53 A;  1PUE E;  3T5X A;  5LGU A;  3WTZ A;  1MDM B;  2MBF A;  3KP5 A;  3MZY A;  3BJA A;  1GXQ A;  1I1G A;  5L3E A;  3WTU C;  2OU2 A;  2FBK A;  4ON0 A;  2CQK A;  1YS6 A;  3GX4 X;  1TBX A;  4OMY A;  5AIP A;  2M1B A;  4G7Z F;  5JR3 A;  3BP8 A;  4M6Y A;  3BOQ A;  2AXL A;  2VOP A;  4KA4 A;  3F8F A;  3K9T A;  4Q4Z F;  2NNN A;  2LNB A;  4OOI A;  1IUY A;  4QLC U;  1SD5 A;  2BEO A;  5K5R A;  1FSH A;  2STW A;  2R3S A;  1YFH A;  2VT2 A;  3T1B A;  4EGZ A;  1FLI A;  1S7A A;  4Q47 A;  4GGG A;  3P7N A;  2F5E A;  4IRH A;  5CJ9 A;  4O6J A;  1LEA A;  5D4R A;  4QWQ A;  3GEZ A;  4CDG A;  2JSC A;  2VON A;  2QWW A;  4WK8 F;  2EFO A;  2W85 A;  4NQW A;  1SAX A;  4A5M A;  2XHK A;  4U7B A;  2ESN A;  4M72 A;  3ZMT A;  3G3Z A;  3C1D A;  4XSZ F;  1UHW A;  1Z6R A;  5FO5 A;  2Z33 A;  1HW1 A;  4HW0 A;  1J7K A;  1GXP A;  3I0T A;  3V7S A;  2EFW A;  2QQ9 A;  2HDC A;  2NYX A;  1AWC A;  4G9Y A;  3I64 A;  3IRQ A;  3BRO A;  1G3W A;  1ZRE A;  2YX7 A;  3HRU A;  4CIC A;  3IKT A;  3I4P A;  4H0E A;  2PEX A;  3FMS A;  5CVV A;  2Q0O A;  3V7R A;  1TW2 A;  1LB2 A;  3SFZ A;  1HXD A;  3CUQ A;  2A5Y B;  4UUV A;  4PGH A;  4CZZ A;  1REP C;  3FXR A;  3F23 A;  3WTX C;  4RS8 A;  5L3D A;  4MNU A;  3MQ0 A;  5D5V B;  1HQC A;  5LHI A;  5JI6 A;  3LQQ A;  2DLL A;  3WGH A;  2Z9O A;  3LAJ A;  4MQ9 F;  2V6C A;  1HKS A;  2M8E A;  1T0F A;  1XGS A;  5TRD A;  5K5O A;  4LLN A;  4OIR F;  2H94 A;  2UXX A;  5CVJ A;  2EFN A;  2VBY A;  2R7D A;  1O3R A;  2P7C B;  2RQP A;  3ML6 A;  2L4A A;  2B0L A;  4ENK A;  3M8E A;  2PLY A;  3WTV C;  3EYI A;  1NHA A;  3GWZ A;  1IN6 A;  1ZHF A;  4Z2Y A;  4ZZL A;  3P9C A;  1S8N A;  1U5T B;  2HWV A;  1EH8 A;  1TTY A;  1HW5 A;  1H9G A;  2IA2 A;  2K02 A;  1W7P D;  2Z5U A;  3D0S A;  5ICE A;  2XAF A;  1ZAO A;  2P5L C;  4EJV A;  2DAO A;  2WV0 A;  2A07 F;  2J5O A;  2HTS A;  3R60 A;  3ZMD A;  4A6D A;  4O3M A;  3K2Z A;  2F5D A;  4XRF A; 
#chains in the Genus database with same CATH topology
 4ETS A;  1JJ6 C;  2FOW A;  4HF2 A;  1DGR M;  2NAZ A;  2H09 A;  3TKY A;  1M1E B;  4RGU A;  5GTI C;  3OYG A;  2RVC A;  4J00 A;  2Y9Y A;  1G4D A;  4A93 J;  4F3Q A;  2PN6 A;  3QU6 A;  1MBJ A;  1OCZ H;  3O3K A;  1HDD C;  5IT9 K;  2K9S A;  2EV6 A;  4A3M J;  5H6Q A;  3I71 A;  3ROU A;  4DZJ A;  3HL2 A;  1IC8 A;  2IS1 A;  3ABM H;  1TWH J;  3HTS B;  3CTA A;  3B02 A;  3RTR A;  3GFL A;  3ABL H;  3AFH A;  1W5T A;  2CWE A;  1MIJ A;  3QYB A;  2LRD A;  3ZQH A;  2HQN A;  4LFU A;  1QBJ A;  1YRN B;  4A5N A;  1VQK I;  1ODD A;  4HNT A;  5L3F A;  2QCO A;  3L00 A;  2E1M C;  4CYD A;  3LSI A;  1U78 A;  3E3V A;  4X6A J;  1FIA A;  4WXC A;  1ZLJ A;  2DOF A;  3TQN A;  2QBY A;  4JK1 X;  1RIO H;  1Y6I A;  4BXU A;  4M3D A;  3NRV A;  4LLG F;  5LHH A;  3HC7 A;  3HM5 A;  2DA1 A;  4RAY A;  2DU9 A;  2ZBK A;  2DMN A;  3I59 B;  2VQC A;  1XMX A;  2IPQ X;  2VXZ A;  4E4H A;  3MKZ A;  4I0B A;  1QZZ A;  5TIS C;  2AS5 F;  2PMH A;  3GO5 A;  2XSJ C;  2W4S A;  1IRF A;  5B1A H;  1X3U A;  2HU9 A;  3CCY A;  1Y39 A;  1MJA A;  5F1R A;  4KYW A;  3K69 A;  1R36 A;  4NNJ A;  1WI9 A;  5DYM A;  3E1S A;  3IKV A;  3S3O A;  3E5Q A;  1KU2 A;  2EV0 A;  3LQR A;  4U87 A;  4CUG A;  4XM3 A;  3I4M J;  1ZLK A;  2F6C A;  1RUN A;  4ENN A;  2L02 A;  5F6F A;  3I59 A;  1JKO C;  2EWN A;  3H35 A;  2Y9Z A;  2K4J A;  3FX3 A;  4Y15 A;  2DQR A;  4AIJ A;  1A5J A;  1D0Z A;  1WI3 A;  2ZO4 A;  1LJ9 A;  3R0A A;  2P81 A;  2NXN B;  4A3C J;  5K7Z A;  4BE0 A;  5H6R A;  1R1V A;  2HYG D;  1S3J A;  1YYV A;  1JKR C;  2HQA A;  3VSK A;  1YI2 I;  3IL2 A;  2V1D A;  1U6G A;  2KMU A;  1O57 A;  2QQB A;  1SFU A;  2EIJ H;  2FEZ A;  2XRL A;  4C2U A;  1Z1D A;  1HBX G;  3LL7 A;  3R4K A;  1W5C C;  3HOY J;  1V54 H;  3DBL B;  3EUA A;  2VQL A;  3M7G A;  3M8F A;  1PVE A;  2A68 F;  1MND A;  1KON A;  4BBR J;  1K4T A;  5EDN A;  3WTT C;  2KJC A;  5FD5 A;  1X3W B;  2V26 A;  4MHG A;  4UUS B;  2R7F A;  3RIR A;  4BAY A;  2Y0M A;  2R5Y B;  4CCO A;  2XRO A;  5ICF A;  1FT9 A;  1E17 A;  3O6B B;  4M6V A;  3CCQ I;  4LK1 F;  5GPA A;  5L3G A;  1B8I B;  3H36 A;  1I27 A;  1VF9 A;  2F5C A;  1H89 C;  1I6H J;  1R1T A;  2EK5 A;  2R7Q A;  3SZT A;  1H8A C;  1JGG A;  1TT5 B;  5FB2 A;  5E3M A;  2JPC A;  4AUX A;  2ZXH A;  3T0Y A;  2HQR A;  4H4K C;  1TP4 A;  1V3F A;  2JN6 A;  5EEA A;  2FF4 A;  1P4W A;  1HA8 A;  4OIP F;  1R9T J;  1E0E A;  1FC3 A;  2BHY A;  2CJJ A;  3MWM A;  1O3Q A;  3KLN A;  3JRH A;  1OYY A;  4F55 A;  1A36 A;  4EVI A;  2CH0 A;  3FIS A;  5E8I A;  1O3T A;  2DYR H;  1S7O A;  1PP7 U;  2Y69 H;  2OTJ I;  3BDD A;  2Y2Z A;  3EQL F;  3DTI A;  2CU7 A;  2DBB A;  3CJT B;  3KX2 A;  4HNV A;  3N97 A;  2CUF A;  2L4M A;  1JJ8 C;  2CQQ A;  5LRR A;  5DUI A;  3K7A J;  2HZD A;  1LQ1 A;  5E1Z B;  1IO2 A;  5CLS A;  3DPL C;  2XF6 A;  2A6H F;  3DU5 A;  3IAS 2;  5E3L A;  3L7W A;  2DA2 A;  1QPI A;  3FHZ A;  1ZG1 A;  3GTK J;  1KQ8 A;  1R23 A;  3E5X A;  1XSV A;  3TL4 X;  4K2E A;  2LYC A;  5IOY A;  3K70 D;  1P7J A;  1TWF J;  1XCB A;  4BDY A;  4IHV A;  5CVI A;  4FQG A;  2FXA A;  2M0M A;  3FDY A;  4U0V A;  1OJL A;  3S1N J;  1IN4 A;  3V8J A;  5JVT A;  3SXY A;  3JRG A;  1MBG A;  4AVZ A;  2JA2 A;  2VE8 A;  3BQY A;  3FMR A;  3QOD A;  1WKM A;  3WG9 A;  3HDD A;  4L9J A;  3OOU A;  3K4J A;  5DV5 A;  1QZY A;  3S3N A;  3RKW A;  4MTD A;  4BEH B;  2FA5 A;  3TP0 A;  4I02 A;  4IZZ A;  1SD6 A;  2BW3 A;  3ZMV A;  4C3J J;  4HDU A;  2VC1 A;  2G7U A;  2PMZ A;  3HUG B;  2RRE A;  4RDU A;  2ZB9 A;  1T08 B;  3KP2 A;  1FYM A;  2DDA A;  1DPR A;  1XGN A;  4BE1 A;  3IHU A;  1VFC A;  5D5U B;  1R7J A;  1A35 A;  1IDZ A;  2BVM A;  2XB0 X;  2HR3 A;  2CV0 A;  3S3M A;  2JRT A;  3ZMZ A;  5B1B H;  3K2A A;  5F64 A;  5IYC J;  1BOA A;  2ZME B;  3BZC A;  2W7N A;  2LK2 A;  5DDG A;  2HPI A;  4HRI A;  6PAX A;  3L2R A;  1TQM A;  3D5L A;  3CO6 C;  2Y30 A;  1WJC A;  1X2N A;  1Z7L A;  3KP4 A;  2YR2 A;  2WTE A;  2L7F P;  3PIP F;  3UR3 C;  3DF8 A;  5DCM B;  4AC0 A;  2K9L A;  3E7L A;  3BJ6 A;  4M3G A;  3H9G A;  3I5U A;  2C6Y A;  2VAS A;  2JPB A;  2XGX A;  2DN0 A;  1XG1 A;  4YFN F;  1VQO I;  3L2W A;  4E7H A;  4DYQ A;  2TCT A;  4EM0 B;  2QKM B;  5JFR A;  4L9T A;  2WAD A;  3EUK L;  3LA3 A;  3RKX A;  3GXO A;  2R7U A;  2E7X A;  1BJZ A;  2ZME A;  4JBA A;  5J1R A;  3B6A A;  3AG1 H;  3COA C;  4U0W A;  1OCC H;  3SZP A;  3ZXS A;  2VKH A;  3C18 A;  4XMY A;  3RPU A;  1HCR A;  4HYE A;  3M4O J;  3FXM A;  2PX9 A;  3FXU A;  2IS6 A;  4HV5 A;  1ERD A;  3QWL A;  4WCG A;  4HX8 A;  3OYN A;  1GV2 A;  3HG9 A;  2DTZ A;  3LA7 A;  2O8X A;  3OYB A;  1XB4 A;  1ZYR F;  4KT5 C;  1GVD A;  4R8H A;  1AKH B;  2HYJ A;  4AVP A;  2KDO A;  3OS0 A;  5FKK A;  3RQI A;  4P9F A;  3L2Q A;  1VQM I;  3S1R J;  4E7I A;  2QA4 I;  5CQG A;  2EJR A;  5B3S H;  1TNT A;  4RMN A;  1HST A;  4CGZ A;  3O8H A;  2BXZ A;  2OC6 A;  4M74 A;  1K78 A;  3ZR8 X;  4V19 K;  2K27 A;  4OMZ A;  4FE4 A;  3JAM K;  4D1Q A;  3R6S A;  2E1C A;  3GW2 A;  3MFK A;  2XKP A;  1LFU P;  4N9H A;  2X85 A;  4IVN A;  4D7N A;  4HOB A;  5LLQ A;  3TED A;  1VI0 A;  5CQE A;  2HVR A;  3OL4 A;  3RYP A;  1YO5 C;  5CPR B;  1FOK A;  2V1U A;  3ZN0 A;  5LFA A;  4X0G A;  2W24 A;  1WJD A;  1TC3 C;  3CCJ I;  3RI4 A;  3HOX J;  2FX0 A;  4BHC A;  1TWG J;  2R7T A;  1P92 A;  2OAZ A;  2BYV E;  3LSR A;  1E3H A;  1OR7 C;  4GRI A;  2M34 A;  1IAW A;  1CF7 A;  2E19 A;  1VQ5 I;  3U1D A;  4HLY A;  1GVJ A;  1SMT A;  5ED4 A;  3BZK A;  3C7J A;  4CZC A;  3JTH A;  3WHB A;  1G3T A;  3FXL A;  4YRV A;  3F21 A;  3SEQ A;  1ZR2 A;  1PUF A;  5M5Y J;  4PJN A;  1J75 A;  3LST A;  3W3C A;  1K6O A;  1XGM A;  2WB1 A;  4I2O A;  1V55 H;  3RPQ A;  4L5I A;  2F5V A;  5E79 C;  5HLH A;  3IUO A;  4BXX J;  2OZ6 A;  2VBZ A;  4EAT A;  1KYZ A;  1D1C A;  4UVC A;  2XPU A;  2ECB A;  1BL0 A;  4S04 A;  3VOE A;  4M9Z A;  4GYG A;  2DPU A;  2KIF A;  3JRD A;  1E2X A;  1UZC A;  3JRA A;  1U9O A;  3LNQ A;  1D0X A;  2OD5 A;  2QF7 A;  2CV2 A;  3ASN H;  4GCV A;  1WRJ A;  1B9N A;  2W82 A;  3BR6 A;  3Q9S A;  4OWR B;  5HLG A;  3PM1 A;  3FKJ A;  4BQA A;  2H6C A;  3S16 J;  5EEG A;  5DM6 F;  3VYS B;  1BM9 A;  5DUK A;  1S72 I;  2HOS A;  1BIA A;  3SHF A;  3F8C A;  1W0T A;  2AQE A;  4DQ2 A;  2HVS A;  1GHC A;  4KMF A;  2GBY A;  3SJM A;  4ENJ A;  1OCT C;  1OCR H;  2GM4 A;  3FXQ A;  2V4J C;  4RLF A;  5ILU A;  3GBG A;  2R0Q C;  2F48 A;  1LEB A;  4KT6 A;  4A3L J;  1BC8 C;  2M7B A;  3VYU B;  3EDP A;  2K7L A;  5FLV A;  3SYT A;  1LFB A;  2QEN A;  2P5K A;  5HNF A;  3REO A;  1U3E M;  1MBH A;  4NQW B;  1Y56 A;  3NWS A;  2ZJP F;  3F22 A;  4XLC A;  2MYS A;  1YE9 A;  2HGC A;  4B4C A;  1JT0 A;  4A0Y A;  3WTS C;  4JOM A;  2P7V B;  2VOD A;  3HRS A;  4KUM A;  1ETV A;  1YW9 A;  3TOA A;  2DT6 A;  1CGP A;  1IF1 A;  3PO3 J;  4II2 A;  5F27 A;  2A6E F;  2R5Z A;  2ELJ A;  5A2Q K;  1U9N A;  2FUG 2;  2LF8 A;  1P6R A;  2BY1 A;  2DJN A;  2FBH A;  3M1C A;  4AIH A;  3HRM A;  2FOK A;  4IHX A;  3OIO A;  5D5X B;  4XID A;  3LSH A;  1YIT I;  1VQ8 I;  2R92 J;  2NS0 A;  4ZC3 A;  5DD8 A;  1TQI A;  3DQV C;  2D1V A;  3CUO A;  1MNE A;  2ME0 A;  4G6Q A;  1TWC J;  1D5V A;  3OYI A;  2DQL A;  4FX0 A;  3DU6 A;  5M3M J;  3RZD J;  3CMM A;  4ESF A;  4UB6 C;  2EIK H;  3K4L A;  2UV1 A;  3S93 A;  4EQQ A;  1FTZ A;  3J80 Z;  3A2K A;  4XNF A;  1JTY A;  4F91 B;  1EF4 A;  1UHS A;  3ZN1 A;  1I1S A;  4XSX F;  4I76 A;  5EZH A;  3S32 A;  2K9M A;  3F3X A;  2ZC2 A;  5LEK A;  1H0M A;  4ZYH A;  2VLA A;  1MGT A;  1USS A;  1WQ2 A;  2EIN H;  2M30 A;  3O2P E;  1MZB A;  4AYB N;  4EEF G;  1XDS A;  4UV9 A;  1RRJ A;  3E97 A;  5K7F A;  3CUQ B;  3FIW A;  3V7C A;  3G1M A;  4B3A A;  1TNS A;  3MEX A;  3OIQ A;  3I58 A;  3OYE A;  1W36 D;  2LKS A;  1QNT A;  5FJ8 J;  3A0H C;  4FCY A;  3K4K A;  1ZGJ A;  3WU1 B;  3PNV A;  3NQO A;  4R1H A;  1KQ0 A;  3CQZ J;  3OYF A;  3MZH A;  5FGM A;  4CCM A;  2RAE A;  3BTJ A;  4L0Z B;  5IYB J;  1HKT A;  5E3O A;  4RB1 A;  2DT5 A;  5FRM A;  1IJW C;  3KIO A;  5E18 F;  2D45 A;  2A05 A;  4KN7 X;  3ECH A;  4UVB A;  5D8L B;  2DJI A;  2YUS A;  4G7O F;  1ZQ3 P;  2XPV A;  2VJ4 A;  3QAH A;  5FLM J;  4JX5 A;  3F9K A;  1K61 A;  2V1X A;  3ECO A;  2E71 A;  4XLE A;  4XL9 A;  1U8R A;  1IZ1 A;  3H0G J;  4QPO A;  1VQ9 I;  2UWM A;  4HX4 A;  1R4M B;  3K0L A;  1J0R A;  5HDN A;  1WVR A;  1HOM A;  2OBP A;  3QPT A;  5LD2 C;  3LFU A;  2KIS A;  3RJP A;  1WJE A;  3LSP A;  1NG7 A;  5HS7 A;  3ZP5 A;  5HDK A;  2ME6 A;  1ETW A;  4D9J A;  2W48 A;  1GUU A;  4HV6 A;  2LVS A;  2DA3 A;  1TW3 A;  3Q5F A;  1EKE A;  3ZCO A;  1UCR A;  2WAQ A;  2CSO A;  1R1U A;  4XKB A;  3WE3 A;  3WE2 A;  4CXF A;  2LY1 A;  1S5L C;  2Z16 A;  2CW7 A;  3MD2 A;  2QYO A;  1LFP A;  1VQ7 I;  5D6E A;  3QP6 A;  3S1M J;  4MEX F;  1Z7U A;  3QYF A;  2O8K A;  3PQK A;  1K83 J;  2FBI A;  5LRS A;  1PDN C;  3S17 J;  3PFI A;  3TGN A;  1XTA A;  1K7A A;  2G9W A;  2K9Q A;  4CHU A;  1ZH5 A;  4M71 A;  2HVQ A;  4DNC A;  4HF0 A;  1BI3 A;  3JTG A;  4BBS J;  3NAR A;  2LKP A;  2WAF A;  2NOJ B;  1UG0 A;  2VXD A;  2YSR A;  3DPU A;  1FP2 A;  1ON1 A;  1XD7 A;  3QYE A;  5F0C A;  3TW6 A;  3EUH C;  1B9M A;  1W1W E;  4B1R A;  1XS9 A;  1KGS A;  1TZL A;  4XK4 A;  1NK2 P;  4F7Z A;  1ON2 A;  4DYR A;  3ULQ B;  2VB6 A;  2JT1 A;  2GXB A;  2PJP A;  1B59 A;  1OFC X;  1ZGA A;  3WTW C;  4J01 A;  2HI3 A;  1HC8 A;  3GTP J;  1D5Y A;  1L0O C;  1KU9 A;  4LLL A;  2CW8 A;  3G4S I;  4ZH4 F;  2FD5 A;  2QM3 A;  1RI7 A;  1MJ9 A;  3SFI A;  4Y33 A;  3P9I A;  2LTP A;  4U0Y A;  2KZG A;  4OAZ A;  1R49 A;  2CG4 A;  4GO1 A;  4ABZ A;  3QOE A;  3BWG A;  1IN8 A;  4QTR A;  2OJE D;  5BNG A;  2QBY B;  2BY0 A;  2L9R A;  3DKY A;  2DXI A;  4P9U A;  1D3Y A;  2CW0 F;  3KZI C;  2DTR A;  2QSG X;  4LJZ F;  1X3Z B;  5E20 A;  2NOG A;  4JQF A;  5H20 A;  1W0U A;  2XV4 S;  2LSO A;  2DA6 A;  1WFX A;  3FK7 A;  3UNG C;  5EG0 A;  2OZU A;  3JR9 A;  3LSJ A;  4L0Y B;  5GTH C;  1OCP A;  3HOZ J;  1OYW A;  2L9S A;  3RPU D;  4A0Z A;  3K1N A;  1YIJ I;  1RPW A;  3TP3 A;  2BBY A;  1FMV A;  2MLG A;  3GF2 A;  4PGG A;  5BPI A;  3I4N J;  4B09 A;  4Y13 A;  1DDN A;  4KNY A;  1J59 A;  4Z6Y A;  2BV6 A;  4PJ0 C;  1LDK B;  2X1C A;  2W25 A;  4XKW A;  4LIV A;  3WTY C;  2RKH A;  3KP7 A;  3LOC A;  3ERE D;  4FX4 A;  1OQY A;  3HJE A;  2Y31 A;  1RUO A;  4L18 B;  2GOX B;  4V2F A;  4RBO A;  3JRI A;  2VPR A;  2YU3 A;  3Q3S A;  2O0Y A;  4KIG A;  2O03 A;  1AOY A;  2FRH A;  5EGO A;  4OIQ F;  1UJ8 A;  2A5W A;  4OIN F;  2KIM A;  2E7W A;  1JTX A;  2HDD A;  2LF7 A;  2HKO A;  3HXL A;  4IJA A;  1PYV A;  2E60 A;  4L9V A;  4BJ6 C;  2W84 A;  2KHM A;  1ETO A;  3GCM A;  2PFB A;  3N4M A;  4I99 C;  1OIS A;  3JW4 A;  1B1B A;  1MMN A;  2ISZ A;  4FET A;  4PFO A;  2I8D A;  4N4O B;  1OYI A;  3HOT A;  2NRA C;  2W00 A;  4G6D A;  1D8K A;  4UHT A;  1GT0 C;  5J4V A;  1QRY A;  5M3F J;  4IF4 A;  2ZXJ A;  3CDL A;  2Z2S B;  2JZY A;  4WX9 A;  3HYI A;  3DEE A;  3GFM A;  2CS3 A;  2DA5 A;  3OR2 C;  3HEF A;  3OYK A;  2NNY A;  2E2J J;  4Q5S F;  1A6I A;  3BG6 A;  2KKO A;  1KA8 A;  2ID3 A;  1FBQ A;  4BNC A;  2RGV A;  2GZW A;  4ZYD A;  4NC7 A;  5FRN A;  2D5V A;  1F9N A;  5LEJ A;  1ZG5 A;  1UAA A;  3J7A O;  2R7Z J;  1Y8R B;  3VFZ A;  4FE7 A;  3VOD A;  3MZ8 A;  3GLX A;  1TQP A;  1SVO A;  5FKL A;  3AL0 C;  1JUM A;  3H3Z A;  4RB2 C;  1UEL B;  2VE9 A;  3MKW B;  2Y75 A;  3VYT B;  3GTM J;  4MFD A;  2E5Z A;  4CO8 A;  1LVK A;  2OQG A;  2PI0 A;  1ZG3 A;  4DJA A;  2WY8 Q;  3LSM A;  2AQF A;  2MH2 A;  1ZEL A;  1ZRD A;  1J09 A;  2HTJ A;  2DFI A;  2L3D A;  4HPQ A;  4YFX F;  4J19 A;  5HVQ C;  2XAH A;  4EJT A;  3PJR A;  3MAJ A;  2K4B A;  3OYJ A;  3MCZ A;  3L2C A;  5F04 A;  3D1N I;  4G8X A;  4YIR X;  4UUT A;  3PIO F;  3W2V A;  3J7Y J;  2GQQ A;  1V5E A;  3G6E I;  1IG7 A;  3KPH A;  4EM1 A;  1GV5 A;  5J8F A;  3ABK H;  1Z3X A;  1HW2 A;  1XGO A;  3A03 A;  4XBF A;  1A04 A;  4PJL A;  1XC5 A;  2IS2 A;  4PSX A;  1YIO A;  3P5J A;  4B43 A;  4IOA F;  1SFX A;  3OS1 A;  5EEH A;  2ECC A;  1KQ9 A;  4JYK A;  1I6X A;  4Y52 J;  2IGK A;  2EA2 A;  4A12 A;  1WPK A;  1VQL I;  4DW6 A;  4OIO F;  5C44 J;  1MMD A;  1XSD A;  1WCM J;  3R0J A;  4L5E A;  2PQ8 A;  1SVM A;  2QGU A;  2KQR A;  2CQ7 A;  2EV5 A;  1FNN A;  4C30 A;  3I9V 2;  2CGP A;  1BR4 A;  5TJJ A;  3BJO A;  3BR3 A;  1Z67 A;  2K40 A;  3KEQ A;  1ZRC A;  1FSE A;  5IPA A;  4G94 A;  2E1N A;  5E17 F;  2HKX A;  5B5E C;  3SEZ A;  1Z6T A;  2UZK A;  2BW3 B;  3W6K B;  1JXS A;  2MH9 A;  2TDX A;  3M07 A;  4IRG A;  4DGW B;  1PP8 F;  1TL8 A;  2XAS A;  5K7H A;  1O7L A;  1F5T A;  2EBI A;  4HNU A;  2LH9 A;  2XF7 A;  4XLN F;  4XOP A;  5C4X J;  1KU3 A;  5FLX Z;  1SVL A;  1AA7 A;  4KIS A;  4LG3 A;  5BOX A;  1RET A;  2BHZ A;  2JA5 J;  1DPU A;  4B3X A;  3U1K A;  4P1W A;  1I3Q J;  2GLO A;  3IAM 2;  1ZR4 A;  3L9F A;  2YX4 A;  1EH6 A;  4LK0 F;  3GTG J;  3DP7 A;  3HSE A;  1FYK A;  2GWR A;  3J81 Z;  2FQ3 A;  2EZI A;  2X6X A;  2CRG A;  2HOE A;  3GFJ A;  4UVA A;  3WU2 C;  3JSP A;  5J40 A;  3PO2 J;  1LVA A;  3K6G A;  1LUJ B;  1X1C A;  3OY9 A;  4UNO A;  4HST A;  2F2E A;  3LA2 A;  3S15 J;  3CCV I;  5D8K B;  4L9N A;  5BQT A;  5FFZ A;  2MSY A;  4M73 A;  1XSX A;  3IH3 A;  3CCE I;  4IXA A;  5H2F C;  5L3C A;  1RC9 A;  4IX7 A;  2FNP A;  3R61 A;  3WGI A;  2ADU A;  3GUD A;  1EV7 A;  3KEY A;  1R4N B;  2KLO A;  4YG2 F;  3PUF A;  3H9Q A;  1IXR C;  1W7P A;  2CO5 A;  4RA2 A;  3T8R A;  2CUJ A;  3RDI A;  5F1J A;  4M3B A;  4BQO A;  1XPX A;  1W4M A;  2O6G E;  2P6S A;  2KT0 A;  2VBX A;  4ZTF A;  5EF6 A;  3E6M A;  2LR8 A;  1IGN A;  2GA2 A;  5E1X A;  1ZTR A;  1FWZ A;  2VI6 A;  5ICG A;  2E2H J;  1EH7 A;  1JUS A;  2V6E A;  5GP9 A;  1BN5 A;  2XAQ A;  1QO0 D;  1T2K A;  1K78 B;  2LOO A;  3DXJ F;  3WGG A;  3HBL A;  4N9I A;  2R7W A;  3M8J A;  2WC2 A;  3C2G A;  2QKL B;  4I98 B;  4KIT B;  3ZPL A;  4XOT A;  1BBY A;  1BC7 C;  3ISP A;  2DFH A;  2QZ8 A;  3TBI A;  4Y3O A;  3CCR I;  3KZZ A;  2VBW A;  2Q2E B;  1JGS A;  2K3F A;  2GXA A;  2Y48 A;  4U88 A;  2Y0S N;  2ESH A;  3BQZ A;  3SQN A;  3DKX A;  1S29 A;  4A3F J;  1NG6 A;  3EYY A;  4IHW A;  1OR7 A;  4A3E J;  3W6J B;  4A69 C;  2Q8K A;  5M5W J;  2O3F A;  3CCL I;  3KYD B;  1SD7 A;  1YG2 A;  1EJ9 A;  1CF7 B;  2P6T A;  1YX3 A;  4E7K A;  2LRE A;  5CVU A;  2FNA A;  3DLL F;  2OUM A;  1HF0 A;  2KL4 A;  2ZKZ A;  3E6D A;  1K79 A;  1F4K A;  3GLL A;  2X51 A;  3DKW A;  2VIX A;  1PUF B;  1K6Y A;  1Z77 A;  1UST A;  1B6A A;  2DMP A;  2E5N A;  4NBQ A;  2Q2E A;  2CFX A;  1IW7 F;  1H88 C;  4EJO A;  2KDZ A;  2ID6 A;  3FKI J;  1HDP A;  2JA7 J;  4E6K G;  4WF2 A;  3TDZ C;  2VKV A;  1XMK A;  2ZJR F;  4HZF A;  4WXD A;  3D5S C;  1YTY A;  3HOS A;  2OA4 A;  4RM3 A;  3FXO A;  2L54 A;  4RB0 A;  3DPT A;  5KK1 A;  3U2R A;  5HS8 A;  3F6O A;  1DUX C;  3OS2 A;  1BI1 A;  3OOP A;  2F5F A;  2XRN A;  2L01 A;  4XR6 A;  1MH4 A;  4MO7 A;  4E7Z A;  3H1C A;  2DMU A;  3NEU A;  4IRI A;  3Q9V A;  3PFY A;  2IXS A;  1UHM A;  5HNH A;  2VL8 A;  3HPG A;  4EJW A;  1I3A A;  1WZ2 A;  1T56 A;  3DWL E;  1FBS A;  2RV8 A;  4M3E A;  1DP7 P;  3F8M A;  2XAG A;  3ELK A;  5J47 A;  4BJT A;  4IHS A;  1UMQ A;  4QIW N;  1X58 A;  1Y1V J;  3OIP A;  3B6C A;  1U8B A;  1OMI A;  2ETH A;  4XIC A;  1Q1V A;  2KP6 A;  1DP3 A;  3HZJ A;  4IQJ A;  2JVH A;  1QVT A;  2WBM A;  2R5Z B;  3TDU C;  3CO7 C;  2K3P A;  2E1O A;  4HG2 A;  3GTQ J;  2HEO A;  1U0J A;  3HPH A;  2X4H A;  3CZ6 A;  2JVG A;  4A3K J;  2R93 J;  2XDV A;  2AHQ A;  2DFF A;  3PNT A;  4CCN A;  2HZT A;  2YU9 J;  1QZE A;  1F36 A;  3E5U A;  3GTL J;  4TV7 A;  3QP5 A;  1E3O C;  2L9V A;  4XQF A;  1BW6 A;  3U21 A;  5KVR A;  2IEK A;  3E6B A;  4XON A;  1I5Z A;  4I01 A;  1MDM A;  4LMY A;  2P0W A;  1O4X A;  2KRH A;  4DBR A;  1U2W A;  3HSR A;  4XRS G;  4HBL A;  1IXS B;  3CLQ A;  4AWX B;  1YJ9 I;  1SFK A;  3OSF A;  2K5C A;  4C9Y A;  5DS9 A;  4M9X A;  1R58 A;  2XPW A;  1CQT A;  2EA4 A;  4E7L A;  3IH2 A;  3WU0 A;  2DK8 A;  2EFQ A;  3V8L A;  1P4A A;  2UXN A;  4CCJ A;  5AIQ A;  3ZQG A;  2OCC H;  3IWZ A;  3JRC A;  2GIZ A;  2NVQ J;  9ANT A;  3SDG A;  5IP7 J;  1T39 A;  4P55 A;  3IC7 A;  1A6Q A;  1RZ4 A;  3TO6 A;  2L7K A;  3UKG A;  1X1D A;  5D4S A;  3F8N A;  3F0C A;  5K5Q A;  2OQR A;  1N25 A;  4KFC A;  5JLX A;  3LFK A;  2O9L A;  4DZP A;  2AO9 A;  1SAU A;  2KIU A;  1BW5 A;  4CYC A;  3HKZ N;  3HGY A;  4NC6 A;  2H1L A;  2PMU A;  1P7I A;  2LY2 A;  2VN2 A;  4A3B J;  3G71 I;  4R79 A;  3H92 A;  1LDJ A;  2QQ8 A;  4MFE A;  5HLI A;  5DM7 F;  4ITV A;  1KYW A;  1XDU A;  3C2H A;  2LKX A;  1MD0 A;  1G2H A;  3GTJ J;  3U9G A;  4HQM A;  1BOB A;  2QLZ A;  4M3F A;  2NVX J;  1MBE A;  3PSI A;  1BR2 A;  3DBR B;  3M9A A;  4GXO A;  5IT9 Z;  4I09 A;  3H3V K;  1IXC A;  2GOM A;  3FM5 A;  5DCF A;  1SC7 A;  2GAU A;  3PQJ A;  1MJB A;  2H6B A;  3ZMU A;  2Z99 A;  1G3Y A;  2FU4 A;  2PG4 A;  5D5W B;  4IOC F;  2VKE A;  3V8K A;  1PJR A;  3S8P A;  1BI2 A;  3K70 C;  2EIM H;  2RNG A;  3S14 J;  3IRR A;  2IS4 A;  2IA1 A;  2LFB A;  2W57 A;  5LGN A;  1O3S A;  2XGD A;  4D0P A;  2LDU A;  3HHG A;  2ZNY A;  2L2O A;  3ZQI A;  1TLH B;  1IDY A;  1ETY A;  4RAZ A;  4ZDL A;  3V4G A;  1B72 B;  3HHH A;  1ZN2 A;  1MBF A;  1GDT A;  4P5O A;  4OU0 A;  5LGT A;  1VTN C;  1IN5 A;  2KJB A;  2DYS H;  1UG2 A;  3VB2 A;  3RKQ A;  3KZY A;  2DT7 B;  2H27 A;  4AD9 A;  2A69 F;  1BR1 A;  2FML A;  5FKN A;  2ZFU A;  4AIK A;  4BHB A;  3CP8 A;  2LBF B;  4EM2 A;  2A61 A;  4EMS A;  3GVA A;  2ELH A;  2XVC A;  1SMY F;  1Z0X A;  1SFE A;  3MMY B;  3EUH A;  1FBU A;  4XKC A;  3PL8 A;  1Y8Q B;  2MD0 A;  4LOC A;  4P96 A;  4BH9 A;  3KET A;  1A31 A;  4D7M A;  2ZXI A;  1B72 A;  3J7A Y;  5FD6 A;  4PFP A;  4C3I J;  1X4O A;  2H8R A;  2IRF G;  3BR0 A;  3ZRG A;  4RAF A;  3ONQ A;  4I6Z A;  1F1Z A;  4KN4 X;  1IUF A;  2X1E A;  4CCL A;  1B4A A;  3CUQ C;  1G3S A;  3LAP A;  3BLY A;  4QPQ A;  4MTE A;  3BG7 A;  4ENM A;  1QGP A;  2M7A A;  2LBF A;  4I7H A;  3ABT A;  4LD5 A;  3I54 A;  1FX7 A;  1VND A;  5E3N A;  1I50 J;  5ICC A;  2RN7 A;  3ABU A;  4ZYE A;  2E1M B;  3K1M A;  1MMS A;  4AYB A;  1ZAR A;  1R22 A;  1W5S A;  4WWC A;  4RGX A;  1LKX A;  2BE5 F;  4UB8 C;  4OAY A;  3BPV A;  4E70 A;  4IHT A;  1MSF C;  4IPA A;  2HFH A;  1T38 A;  4LB6 B;  1N77 A;  4HX7 A;  3LMM A;  3CJN A;  2F4O B;  3CD6 I;  3JRE A;  2CYY A;  1JHH A;  1T0F C;  2KRF A;  1JT6 A;  2L7Z A;  2Q1Z B;  3FK6 A;  3A02 A;  1H9T A;  2MC3 A;  5EG0 B;  2BY3 A;  2IBD A;  2RC4 A;  4UV8 A;  1KU7 A;  1ZKG A;  5KAI C;  4DIQ A;  4DOZ A;  3GYH X;  2MLK A;  4YEL A;  5J1Y A;  1ETX A;  4KMU X;  5HOO A;  5AON A;  4XKV A;  3VPR A;  2N8G A;  3AG4 H;  2KZV A;  2M0C A;  3J80 K;  1QA6 A;  1UB9 A;  1MMG A;  2EFP A;  4PSW A;  1MBK A;  2V79 A;  2RNJ A;  3BG5 A;  2JTV A;  2K85 A;  3K4N A;  2JUG A;  1GLN A;  2HXI A;  2VQH A;  1X4P A;  2DK5 A;  3WHC A;  4AM3 A;  3GZ6 A;  2DPD A;  3F8B A;  2RDP A;  2LD5 A;  3GZN B;  1ONV A;  1BJA A;  3KLO A;  4CA0 A;  4BGD A;  2D2W A;  2FSW A;  3BTL A;  1ZGW A;  1MH3 A;  3A0B C;  4N0B A;  1U5T A;  1BIB A;  3ZMS A;  3AAF A;  2VOO A;  3OYM A;  4XRM A;  5IP6 A;  1IV8 A;  5EGO B;  5KNL A;  1R00 A;  1P9Q C;  1FOW A;  2D1H A;  1FPQ A;  4MQV A;  3X2Q H;  3NAU A;  2STT A;  2ZSI B;  2V7F A;  3FM3 A;  2ZSH B;  2ISY A;  5CKT A;  1SEU A;  1WJF A;  5DD4 A;  4MIM A;  2IT0 A;  1FOX A;  2P5V A;  2M87 A;  4U7D A;  3AL0 B;  4G12 A;  1Y1W J;  3ZGK A;  3AG2 H;  1WSU A;  1Z91 A;  2DFE A;  3BY6 A;  5E8G A;  2TRT A;  3L2V A;  4BHP A;  2VJJ A;  3CP2 A;  4EV0 A;  1VQ4 I;  1MW7 A;  2Z3Y A;  5IT3 A;  3HSF A;  2ZNZ A;  2GIV A;  1YOV B;  4ZYA A;  1YJN I;  1U5T C;  2VJI A;  3OSG A;  4RGR A;  5J8C A;  2Z1D A;  1FMW A;  1ZRF A;  2L7M P;  4YEJ A;  4RAG A;  3HOV J;  1RR7 A;  3Q0V A;  4FT8 A;  3OWT A;  1SD4 A;  1Z21 A;  5KAF C;  1T33 A;  4CH7 A;  4G7H F;  2M4G A;  4ZZD A;  1XMA A;  2M8G X;  2HNH A;  2DMT A;  3K4B A;  4MEY F;  3CC4 I;  1YRN A;  1FTT A;  5LHG A;  3TOB A;  3DLA A;  1WJB A;  4FHT A;  3HB9 A;  5IOZ A;  2WY7 Q;  2I10 A;  1JHF A;  1R6R A;  1RKW A;  3G73 A;  4I0A A;  3OMY A;  1V5F A;  3SDB A;  2MD5 A;  2NS8 A;  4AU7 A;  4B44 A;  5ILS A;  1C0W A;  2ACJ A;  2NVU B;  3BPX A;  3JSO A;  1AHD P;  3QU3 A;  4F52 A;  4BY7 J;  4FTH A;  2CV1 A;  1S6L A;  1HKQ A;  2DA4 A;  2X6O A;  4XLF A;  2JUC A;  1ULY A;  1L3L A;  1LNW A;  1YX5 A;  3JCU C;  4Q48 A;  1YQA A;  1T98 A;  1QHH D;  3CJQ B;  3FWE A;  2LP0 A;  1WWX A;  5JHU A;  3IWF A;  4GDF A;  4IEJ A;  2QVO A;  3PNY A;  1IRG A;  3VEP A;  3GZ5 A;  4YII A;  4E7J A;  1ACI A;  4FIS A;  1N78 A;  1FEX A;  2YPR A;  4BAC A;  2DW4 A;  4A3G J;  2X0L A;  1VZ0 A;  1X2M A;  1R71 A;  2QEX I;  3L09 A;  4L5J A;  3WOD F;  3OV8 A;  1OKR A;  1XN7 A;  3KP6 A;  3DFG A;  3TO7 A;  5F08 A;  4YFK F;  4A0X A;  4PCQ A;  2KFD A;  2UUZ A;  2MFZ A;  2VT3 A;  5HS9 A;  2PMZ N;  1BI0 A;  1MKM A;  2LC2 A;  3CES A;  4PZJ A;  2WWY A;  2DDB A;  5ILV A;  2DA7 A;  4XN3 A;  2EQR A;  3E6C C;  1YHQ I;  4RB3 C;  1O7F A;  4CCK A;  1FYL A;  1DGW Y;  2PJR B;  2ZCW A;  3KEO A;  4EJU A;  3M3Y J;  4HA8 A;  3TO9 A;  3N05 A;  5D6F A;  4BQN A;  3DEW A;  5GAE J;  3OR1 C;  2CMP A;  2M5W A;  2M4K A;  3H5A A;  3GFI A;  4KDP A;  2R7O A;  1D8J A;  2MC4 A;  4NB5 A;  2A3S A;  2L5Q A;  3F6V A;  2DOA A;  1NK3 P;  4UUS A;  4BS9 A;  1WJ5 A;  5J6X A;  4GYI A;  4LGW A;  4C3H J;  4M6X A;  3H3U A;  2R5Y A;  2EZK A;  3FBI B;  2BGC A;  2K9N A;  2IP2 A;  3JAM Z;  2IW5 A;  3LSK A;  3RKY A;  1W36 C;  3HOW J;  2CUZ A;  5DTD A;  2A6T A;  4PJM A;  3RCO A;  3H0D A;  1B8I A;  2PJR A;  3CMY A;  2B7E A;  5LBQ A;  2GA1 A;  2LY9 A;  2KIQ A;  3WG7 H;  3OYD A;  4CSW A;  5DEQ A;  4UXN A;  3G1L A;  3E0J B;  2X1D A;  2CUE A;  1R5G A;  5JLW A;  4XLA A;  3DEU A;  1J5Y A;  4XOR A;  2G0E A;  5EJC A;  4G6T B;  2L9N A;  2BOL A;  3QPS A;  2V9K A;  2XKO A;  2ELK A;  2VJ5 A;  2XAJ A;  4A6E A;  2M3A A;  2NVY J;  2V9V A;  3BR1 A;  3BR5 A;  2YS9 A;  2MW8 A;  4GFB A;  5FRO A;  2NVT J;  2PBI A;  4BY1 J;  2M45 A;  1BA5 A;  4BQQ A;  4BKX A;  3RSN A;  4YIF A;  1W7P B;  3P9K A;  1EA3 A;  4NC8 A;  4Y4R A;  1KZH A;  3ZQQ A;  2XIG A;  4A3I J;  3FBN B;  1WGX A;  1XX5 A;  3FMQ A;  5C3E J;  3L1P A;  4Y17 A;  2LMD A;  4BDZ A;  3BG9 A;  5HOD A;  4RGS A;  2RQQ A;  1WH5 A;  2AXT C;  5ERI A;  3L2U A;  5BS6 A;  3CCM I;  4HAM A;  3A01 B;  4KIC A;  2EIL H;  1FIP A;  4M9S A;  4LIT A;  1YW7 A;  3GME A;  3OYL A;  1QPM A;  2ZJQ F;  2ZFW A;  3ASO H;  3W2A A;  2IJL A;  2GXG A;  5CYV A;  4S05 A;  1P4X A;  2K86 A;  3MVP A;  4O5V A;  3KCC A;  2XUB A;  5L3B A;  2MGQ A;  2VC0 A;  4A2U A;  2DOE A;  2IVM A;  4LG0 B;  4N4N B;  3K1P A;  3BTI A;  4ZYG A;  3FZV A;  3F72 A;  4WXH A;  4EGY A;  1FY7 A;  1ENH A;  4DYC A;  4PDK A;  4BXF A;  2ZJ2 A;  2B9S A;  4B47 A;  3DCF A;  3S2W A;  1Q1H A;  2HYF A;  1T6S A;  2DO7 A;  3A01 A;  2BVL A;  3LWF A;  1AU7 A;  1TT0 A;  4AID A;  3CME I;  2EPF A;  3LSG A;  3QQA A;  5JVG F;  5IP9 J;  3T8T A;  4BEH A;  1IN7 A;  5FFX A;  2CQN A;  1R5H A;  2WB1 N;  4HQE A;  2VUM J;  2E2I J;  4HDV A;  3I56 I;  3HUG A;  1G6N A;  3EET A;  4LG0 A;  4BYY A;  2EB7 A;  2QUF A;  3QRF F;  4HF1 A;  2OF7 A;  1UFM A;  1Y0U A;  1RES A;  3S2H J;  1FP1 D;  5GAH J;  1D0Y A;  2X6Y A;  3H5R A;  1J9I A;  4A3D J;  5A2Q Z;  3RYR A;  2ICW G;  2LLK A;  1V4R A;  2QQA A;  3VSL A;  5KHD A;  3W2W A;  1YS7 A;  3CF2 A;  3HRT A;  1YLF A;  2MAB A;  2JA6 J;  2E35 A;  3I55 I;  2OPT A;  4ZTJ A;  4XLH A;  5K1Y A;  1FZP B;  2DI3 A;  3QOP A;  4PJJ A;  1Z05 A;  3BCB A;  2P8T A;  4XLP F;  2O5R A;  3QPH A;  2JJ7 A;  4NHJ A;  4S0H B;  4PK4 A;  3DV8 A;  5C4J J;  1D1A A;  2IA0 A;  2X9D A;  5DCM A;  1WH7 A;  1YW8 A;  3BCA A;  2R7S A;  2G7H A;  5JHF A;  4IO9 F;  1MNM C;  2MA3 A;  1LE8 B;  3MN2 A;  3ZOB A;  3JRF A;  1X1B A;  3RQ4 A;  4LB5 A;  3HOU J;  3CCU I;  3KP3 A;  3ZQ7 A;  2BZT A;  2EZL A;  1QQI A;  4B8X A;  1JKQ C;  4LIU A;  2O61 A;  2J5P A;  1G8X A;  1P2F A;  1JE8 A;  1HSJ A;  3B73 A;  1V5G A;  5CVR A;  1X19 A;  4JP0 A;  1QU3 A;  2ZME C;  3BZ6 A;  3FF5 A;  3QPL A;  4KIB A;  2HS5 A;  2HOA A;  2QSF X;  4HEA 2;  2XGC A;  3CCS I;  4ESJ A;  2DMQ A;  5E1W A;  3HIF A;  2FE3 A;  2JK3 A;  3C3W A;  3K10 A;  1STZ A;  1APL C;  3BG3 A;  2P4W A;  1J2X A;  1LE8 A;  1AKH A;  3KFW X;  3CLO A;  2JSP A;  4MGR A;  1FJL A;  3BT9 A;  2XB5 A;  4C2M J;  3CDH A;  4ESB A;  5FLX K;  2M9H A;  5HDG A;  3M1E A;  2COM A;  1VQN I;  1T95 A;  2JMW A;  1OPC A;  1ORK A;  1Z9C A;  1LPQ A;  5BMZ A;  3KYL A;  2H8W A;  3HTU A;  2JRM A;  1POG A;  1LDD A;  5KCM A;  2W1O A;  5F0F A;  4ASN A;  1YJW I;  1XCV A;  2XAU A;  2FMY A;  1RNL A;  4HLX A;  3J81 K;  2OTL I;  2I5U A;  3IH4 A;  3KE2 A;  1E3P A;  3O8G A;  3CJR B;  4BL0 B;  3OYA A;  4KIF A;  5BPD A;  2X6W A;  3CF5 F;  1SAN A;  2M2E A;  3I53 A;  3ZQF A;  1PUE E;  3H5N A;  3T5X A;  5LGU A;  3WTZ A;  2VKD A;  1MDM B;  2MBF A;  2BY2 A;  4JX6 A;  3KP5 A;  3MZY A;  3BJA A;  2JA8 J;  2NS7 A;  1GXQ A;  4ANJ A;  3OYC A;  1I1G A;  5L3E A;  3WTU C;  2X48 A;  2OU2 A;  2XSD C;  2XF5 A;  4RM2 A;  3CMA I;  2FBK A;  2E36 A;  2CQK A;  1YS6 A;  4ON0 A;  3GX4 X;  2VPL A;  1JI8 A;  1TBX A;  4OMY A;  4W1U A;  5AIP A;  2M1B A;  2Y0S A;  3BR2 A;  1MSE C;  5GAG J;  2HDW A;  4G7Z F;  2R7V A;  5J1U A;  2H1K A;  4X1E A;  3FXK A;  5JR3 A;  3BP8 A;  4M6Y A;  3BOQ A;  1Z3Y A;  2AXL A;  3Q0W A;  2VOP A;  4BE2 A;  4KA4 A;  3F8F A;  3TW7 A;  3K9T A;  4Q4Z F;  2NNN A;  2LNB A;  4OOI A;  3W6V A;  1IUY A;  5J3L A;  4QLC U;  3OYH A;  3FXJ A;  1SD5 A;  1S7E A;  2BEO A;  4CYC B;  3PUB A;  4V2G A;  3DBH B;  5K5R A;  1RR8 C;  1FSH A;  4UY8 I;  2CFO A;  3OL3 A;  4D5F A;  2STW A;  4MLO A;  2R3S A;  1YFH A;  1IRZ A;  4BJ5 C;  2VQG A;  2VT2 A;  2L0K A;  4BUP A;  2R4G A;  3K4M A;  3T1B A;  3ZQL A;  4EGZ A;  3D5R C;  4W97 A;  1FLI A;  1S7A A;  4Q47 A;  3IP4 B;  2HPM A;  4GGG A;  3P7N A;  3V42 A;  2F5E A;  5F0H A;  4IRH A;  1D1B A;  2BXY A;  1Y0N A;  5CJ9 A;  4O6J A;  2WAQ N;  2HOT A;  1LEA A;  3ZQC A;  3J7Z I;  5D4R A;  4QWQ A;  3GEZ A;  4CDG A;  2JSC A;  2OV7 A;  2VON A;  5B66 C;  2QWW A;  5FKM A;  4WK8 F;  2EFO A;  2OCE A;  2W85 A;  3CDI A;  4NQW A;  1SAX A;  1G59 A;  1R5I D;  2QSH X;  1NH3 A;  4A5M A;  2XHK A;  2KPM A;  4U7B A;  1TWA J;  2ESN A;  1X1A A;  4M72 A;  3BTC A;  3ZMT A;  1WJA A;  3G3Z A;  2V9P A;  3A4C A;  3C1D A;  3RZO J;  1N75 A;  3AG3 H;  2JWT A;  4XSZ F;  3ERM A;  4QSH A;  1UHW A;  3DTE A;  1Z6R A;  5FO5 A;  2Z33 A;  1HW1 A;  2O7O A;  4HW0 A;  3GTO J;  1JUP A;  1J7K A;  2KRC A;  3C2B A;  5FKO A;  1IV6 A;  1GXP A;  3I0T A;  1VQ6 I;  1I39 A;  3V7S A;  4C2T A;  2EFW A;  3SZG A;  5IYD J;  2WA0 A;  2IGM A;  2QQ9 A;  4IL6 C;  2HDC A;  2NYX A;  1AWC A;  4F92 B;  4G9Y A;  2HQ5 A;  1DU0 A;  3I64 A;  3IRQ A;  3BRO A;  1G3W A;  2V1N A;  4ZDP A;  5GAD J;  1ZRE A;  3AKZ A;  2EH3 A;  2YX7 A;  3H9J A;  3HRU A;  4CIC A;  4F93 B;  1S9H A;  3ESW B;  2FQ4 A;  3IKT A;  3I4P A;  2PEX A;  5CVV A;  3FMS A;  5J4Y A;  4H0E A;  5GPC A;  2Q0O A;  2F4M B;  3V7R A;  4HSR A;  4ZDO A;  4JX4 A;  3A1Y A;  1TW2 A;  1LB2 A;  3SFZ A;  1HXD A;  4II3 A;  4FAS D;  3CUQ A;  2A5Y B;  4PUS A;  5M5X J;  4PGH A;  4UUV A;  1QVU A;  4CZZ A;  4DBQ A;  1REP C;  2COB A;  3FXR A;  1NTC A;  3F23 A;  1VQP I;  4B48 A;  4RS8 A;  3WTX C;  1DU6 A;  4NDL A;  5L3D A;  4XRS A;  4MNU A;  1SFO J;  3MQ0 A;  5HLT A;  1X1P A;  2WAE A;  5D5V B;  4IKF A;  1FOY A;  1HQC A;  5LHI A;  5JI6 A;  2CQX A;  3LQQ A;  2DLL A;  1K4S A;  2DOD A;  3WGH A;  2Z9O A;  3PSF A;  3LAJ A;  5EZG A;  4IHY A;  3DTK A;  4KJZ A;  3VYR B;  2MG4 A;  4MQ9 F;  2V6C A;  3NWT A;  1HKS A;  3IV5 A;  2M8E A;  1ETQ A;  1T8I A;  4RLQ A;  1F43 A;  1T0F A;  4IQ4 A;  1XGS A;  3JRB A;  2JQ7 A;  5TRD A;  2LG4 A;  5K5O A;  2EZH A;  4LLN A;  3Q0U A;  1QHG A;  4OIR F;  3MKL A;  3HKZ A;  2H94 A;  2UXX A;  2DCE A;  5IY5 H;  5TGT A;  5CVJ A;  2EFN A;  2VBY A;  1OCO H;  2IAI A;  1IRX A;  2R7D A;  1O3R A;  3EPZ A;  1HLV A;  2P7C B;  2RQP A;  3K4C A;  3ML6 A;  2L4A A;  3MKY B;  3G1O A;  1OLT A;  2B0L A;  4ENK A;  3M8E A;  4Y7N J;  4A3J J;  1MMA A;  4XN0 A;  3G2B A;  2IGN A;  2PLY A;  3WTV C;  3EYI A;  1NHA A;  3BC8 A;  4E7S A;  3GWZ A;  1IN6 A;  1ZHF A;  4Z2Y A;  4D5C A;  4ZZL A;  3P9C A;  3FHN A;  1S8N A;  2R7R A;  1WHU A;  3S2D J;  3CC2 I;  1ITY A;  1ETK A;  1U5T B;  2HWV A;  3VWB A;  4ZJZ A;  1EH8 A;  1TTY A;  1RKT A;  1HW5 A;  2R7X A;  4NUB A;  3TMO A;  1H9G A;  2IA2 A;  2K02 A;  1W7P D;  2Z5U A;  1JKP C;  3D0S A;  2HXO A;  2B63 J;  5ICE A;  2F4I A;  2XAF A;  1ZAO A;  2P5L C;  1ZK8 A;  4EJV A;  2DAO A;  2WV0 A;  3HGG A;  2A07 F;  2J5O A;  2E34 A;  1DQU A;  2XC7 A;  2FJ1 A;  2HTS A;  3VDX A;  3R60 A;  2IGO A;  3ZMD A;  4A6D A;  4O3M A;  2WV1 A;  3K2Z A;  3KYC B;  5EYR A;  2XGE A;  3S1Q J;  3I3L A;  2F5D A;  4BU2 A;  2ZXW H;  3CC7 I;  4XRF A; 
#chains in the Genus database with same CATH homology
 4ETS A;  4HF2 A;  2NAZ A;  2H09 A;  3TKY A;  4RGU A;  2RVC A;  1G4D A;  2PN6 A;  3QU6 A;  3O3K A;  5IT9 K;  2EV6 A;  5H6Q A;  3I71 A;  3ROU A;  3HTS B;  3CTA A;  3B02 A;  3RTR A;  3GFL A;  1W5T A;  2CWE A;  2HQN A;  4LFU A;  1QBJ A;  4A5N A;  1ODD A;  5L3F A;  3L00 A;  4CYD A;  1U78 A;  3E3V A;  4WXC A;  1ZLJ A;  2QBY A;  3TQN A;  4JK1 X;  1RIO H;  4BXU A;  3NRV A;  4LLG F;  5LHH A;  4RAY A;  2DU9 A;  2ZBK A;  3I59 B;  2IPQ X;  2VXZ A;  4I0B A;  1QZZ A;  2AS5 F;  2PMH A;  3GO5 A;  1IRF A;  1X3U A;  1MJA A;  5F1R A;  4KYW A;  3K69 A;  1R36 A;  1WI9 A;  5DYM A;  3IKV A;  3E5Q A;  1KU2 A;  2EV0 A;  3LQR A;  1ZLK A;  1RUN A;  4ENN A;  2L02 A;  5F6F A;  3I59 A;  2EWN A;  2K4J A;  3FX3 A;  4Y15 A;  2DQR A;  4AIJ A;  2ZO4 A;  1LJ9 A;  3R0A A;  5H6R A;  1R1V A;  2HYG D;  1S3J A;  1YYV A;  3IL2 A;  2V1D A;  1U6G A;  1O57 A;  2QQB A;  1SFU A;  2FEZ A;  1Z1D A;  1HBX G;  3R4K A;  3M8F A;  3M7G A;  2A68 F;  3WTT C;  2KJC A;  5FD5 A;  4MHG A;  2R7F A;  3RIR A;  4BAY A;  2Y0M A;  2XRO A;  5ICF A;  1FT9 A;  1E17 A;  3O6B B;  4LK1 F;  5L3G A;  1I27 A;  2F5C A;  1R1T A;  2EK5 A;  3SZT A;  5FB2 A;  2JPC A;  3T0Y A;  2HQR A;  1V3F A;  2FF4 A;  1P4W A;  4OIP F;  1FC3 A;  3MWM A;  1O3Q A;  3KLN A;  1OYY A;  4EVI A;  5E8I A;  1O3T A;  1PP7 U;  1S7O A;  3BDD A;  3EQL F;  2DBB A;  3N97 A;  2L4M A;  5LRR A;  5DUI A;  1LQ1 A;  5E1Z B;  5CLS A;  3DPL C;  2A6H F;  3L7W A;  3FHZ A;  1ZG1 A;  1KQ8 A;  1R23 A;  3E5X A;  1XSV A;  4K2E A;  1XCB A;  5CVI A;  2FXA A;  4U0V A;  1IN4 A;  3V8J A;  5JVT A;  3SXY A;  2VE8 A;  3FMR A;  1WKM A;  3WG9 A;  4L9J A;  5DV5 A;  1QZY A;  3RKW A;  4MTD A;  2FA5 A;  4I02 A;  1SD6 A;  3ZMV A;  4HDU A;  2VC1 A;  2G7U A;  3KP2 A;  1FYM A;  1DPR A;  1XGN A;  3IHU A;  5D5U B;  1R7J A;  2HR3 A;  2JRT A;  3ZMZ A;  5F64 A;  1BOA A;  2ZME B;  5DDG A;  6PAX A;  1TQM A;  3D5L A;  3CO6 C;  3KP4 A;  2YR2 A;  2WTE A;  3DF8 A;  5DCM B;  3BJ6 A;  3I5U A;  2C6Y A;  2JPB A;  2XGX A;  4YFN F;  4EM0 B;  5JFR A;  4L9T A;  3LA3 A;  3RKX A;  3GXO A;  2E7X A;  2ZME A;  4JBA A;  3COA C;  4U0W A;  3SZP A;  3C18 A;  3RPU A;  4HYE A;  3FXU A;  4HV5 A;  4WCG A;  4HX8 A;  3LA7 A;  2O8X A;  1XB4 A;  1ZYR F;  4KT5 C;  4R8H A;  4AVP A;  4P9F A;  2EJR A;  1TNT A;  1HST A;  4CGZ A;  4M74 A;  1K78 A;  2K27 A;  4OMZ A;  3JAM K;  3R6S A;  2E1C A;  3GW2 A;  3MFK A;  2XKP A;  4N9H A;  4IVN A;  4HOB A;  5LLQ A;  1YO5 C;  3RYP A;  1FOK A;  2V1U A;  3ZN0 A;  2W24 A;  3RI4 A;  4BHC A;  1P92 A;  2OAZ A;  2BYV E;  1IAW A;  1CF7 A;  3U1D A;  4HLY A;  1GVJ A;  1SMT A;  5ED4 A;  3C7J A;  3JTH A;  1G3T A;  3F21 A;  1J75 A;  3LST A;  1K6O A;  1XGM A;  4I2O A;  3RPQ A;  4L5I A;  5HLH A;  2OZ6 A;  2VBZ A;  1KYZ A;  4UVC A;  4S04 A;  3VOE A;  4M9Z A;  4GYG A;  2DPU A;  2KIF A;  1E2X A;  2OD5 A;  4GCV A;  1WRJ A;  1B9N A;  3Q9S A;  5HLG A;  4BQA A;  2H6C A;  5EEG A;  1BM9 A;  5DUK A;  1BIA A;  3SHF A;  3F8C A;  1GHC A;  4DQ2 A;  4KMF A;  4ENJ A;  3FXQ A;  5ILU A;  1LEB A;  1BC8 C;  3EDP A;  2K7L A;  2QEN A;  2P5K A;  3REO A;  1U3E M;  3F22 A;  2HGC A;  4A0Y A;  3WTS C;  2P7V B;  2VOD A;  3HRS A;  4KUM A;  1YW9 A;  3TOA A;  1CGP A;  1IF1 A;  2A6E F;  5A2Q K;  2LF8 A;  1P6R A;  2FBH A;  4AIH A;  3HRM A;  2FOK A;  5D5X B;  2NS0 A;  5DD8 A;  1TQI A;  3DQV C;  2D1V A;  3CUO A;  4G6Q A;  1D5V A;  2DQL A;  4FX0 A;  4ESF A;  4EQQ A;  3J80 Z;  3ZN1 A;  1I1S A;  4XSX F;  3F3X A;  5LEK A;  1H0M A;  4ZYH A;  1MGT A;  1USS A;  1WQ2 A;  2M30 A;  3O2P E;  1MZB A;  1XDS A;  4UV9 A;  3E97 A;  3CUQ B;  3V7C A;  1TNS A;  3MEX A;  3I58 A;  1QNT A;  1ZGJ A;  3WU1 B;  3NQO A;  4R1H A;  1KQ0 A;  3MZH A;  5FGM A;  4L0Z B;  1HKT A;  4RB1 A;  2DT5 A;  5E18 F;  2D45 A;  4KN7 X;  3ECH A;  4UVB A;  5D8L B;  4G7O F;  3QAH A;  2V1X A;  3ECO A;  1U8R A;  1IZ1 A;  2UWM A;  4HX4 A;  3K0L A;  1J0R A;  5HDN A;  2OBP A;  3QPT A;  3RJP A;  5HS7 A;  3ZP5 A;  5HDK A;  4HV6 A;  1TW3 A;  3Q5F A;  1UCR A;  2CSO A;  1R1U A;  3WE3 A;  3WE2 A;  4CXF A;  2QYO A;  5D6E A;  3QP6 A;  4MEX F;  1Z7U A;  3PQK A;  2FBI A;  5LRS A;  1PDN C;  3PFI A;  3TGN A;  1K7A A;  2G9W A;  4CHU A;  1ZH5 A;  4M71 A;  4DNC A;  4HF0 A;  1BI3 A;  3JTG A;  2LKP A;  2YSR A;  1FP2 A;  1ON1 A;  1XD7 A;  1B9M A;  1KGS A;  4F7Z A;  1ON2 A;  3ULQ B;  2JT1 A;  2GXB A;  2PJP A;  1B59 A;  1ZGA A;  3WTW C;  1L0O C;  1KU9 A;  4LLL A;  4ZH4 F;  2QM3 A;  1RI7 A;  1MJ9 A;  3P9I A;  4U0Y A;  2CG4 A;  4GO1 A;  3BWG A;  1IN8 A;  2QBY B;  4P9U A;  1D3Y A;  2CW0 F;  2DTR A;  4LJZ F;  5E20 A;  4JQF A;  5H20 A;  2XV4 S;  2LSO A;  2OZU A;  4L0Y B;  1OYW A;  4A0Z A;  3K1N A;  2BBY A;  2MLG A;  3GF2 A;  4PGG A;  5BPI A;  4B09 A;  4Y13 A;  1DDN A;  4KNY A;  1J59 A;  2BV6 A;  1LDK B;  2W25 A;  3WTY C;  2RKH A;  3KP7 A;  4FX4 A;  3ERE D;  1RUO A;  4L18 B;  2YU3 A;  2O0Y A;  4KIG A;  2O03 A;  1AOY A;  2FRH A;  4OIQ F;  4OIN F;  2KIM A;  2E7W A;  2LF7 A;  2HKO A;  4IJA A;  4L9V A;  2W84 A;  2PFB A;  3N4M A;  3JW4 A;  1B1B A;  2ISZ A;  1OYI A;  3HOT A;  2NRA C;  4G6D A;  1D8K A;  4UHT A;  4IF4 A;  2ZXJ A;  4WX9 A;  2JZY A;  3HYI A;  3GFM A;  2NNY A;  4Q5S F;  2KKO A;  1KA8 A;  1FBQ A;  4BNC A;  2RGV A;  2GZW A;  4ZYD A;  1F9N A;  5LEJ A;  1ZG5 A;  3J7A O;  3VFZ A;  3VOD A;  3GLX A;  1TQP A;  3H3Z A;  4RB2 C;  2VE9 A;  2Y75 A;  4CO8 A;  2OQG A;  2PI0 A;  1ZG3 A;  2MH2 A;  1ZRD A;  2HTJ A;  2DFI A;  2L3D A;  4YFX F;  5HVQ C;  2XAH A;  4EJT A;  3MAJ A;  2K4B A;  3MCZ A;  3L2C A;  4G8X A;  2GQQ A;  4EM1 A;  5J8F A;  1HW2 A;  1XGO A;  4XBF A;  1A04 A;  1YIO A;  1SFX A;  5EEH A;  1KQ9 A;  1I6X A;  2EA2 A;  4A12 A;  4OIO F;  1XSD A;  3R0J A;  2PQ8 A;  2EV5 A;  1FNN A;  2CGP A;  5TJJ A;  3BJO A;  3KEQ A;  1ZRC A;  1FSE A;  4G94 A;  2E1N A;  5E17 F;  2HKX A;  1Z6T A;  2UZK A;  3W6K B;  1JXS A;  2MH9 A;  2TDX A;  4IRG A;  1PP8 F;  2XAS A;  1O7L A;  1F5T A;  4XLN F;  1KU3 A;  5FLX Z;  5BOX A;  1DPU A;  3L9F A;  2YX4 A;  1EH6 A;  4LK0 F;  3DP7 A;  3HSE A;  1FYK A;  2GWR A;  3J81 Z;  2FQ3 A;  3GFJ A;  3JSP A;  2HOE A;  4UVA A;  1LVA A;  4UNO A;  2F2E A;  3LA2 A;  5D8K B;  4L9N A;  5BQT A;  5FFZ A;  4M73 A;  1XSX A;  4IXA A;  5L3C A;  2FNP A;  3R61 A;  3WGI A;  2ADU A;  3GUD A;  1EV7 A;  4YG2 F;  1IXR C;  1W7P A;  2CO5 A;  3T8R A;  3RDI A;  1W4M A;  2O6G E;  2P6S A;  2VBX A;  3E6M A;  2GA2 A;  5E1X A;  1FWZ A;  5ICG A;  1EH7 A;  1BN5 A;  2XAQ A;  1QO0 D;  1T2K A;  1K78 B;  3DXJ F;  3WGG A;  4N9I A;  2WC2 A;  4I98 B;  3ZPL A;  1BBY A;  1BC7 C;  3ISP A;  2QZ8 A;  3KZZ A;  2VBW A;  1JGS A;  2Y48 A;  4U88 A;  2ESH A;  3SQN A;  1S29 A;  3EYY A;  1OR7 A;  3W6J B;  2Q8K A;  2O3F A;  1SD7 A;  1YG2 A;  1CF7 B;  2P6T A;  5CVU A;  2FNA A;  2ZKZ A;  3E6D A;  1K79 A;  1F4K A;  3DKW A;  1UST A;  1B6A A;  2Q2E A;  2CFX A;  1IW7 F;  4EJO A;  4WF2 A;  3TDZ C;  1XMK A;  4HZF A;  4WXD A;  1YTY A;  3HOS A;  2OA4 A;  2L54 A;  4RB0 A;  3DPT A;  5KK1 A;  3U2R A;  5HS8 A;  3F6O A;  1DUX C;  1BI1 A;  3OOP A;  2F5F A;  2XRN A;  2L01 A;  3NEU A;  4IRI A;  3Q9V A;  1UHM A;  4EJW A;  1FBS A;  2RV8 A;  1DP7 P;  3F8M A;  2XAG A;  3ELK A;  4IHS A;  1OMI A;  2ETH A;  3TDU C;  3CO7 C;  2HEO A;  2X4H A;  2HZT A;  3E5U A;  4TV7 A;  3QP5 A;  5KVR A;  3E6B A;  1I5Z A;  4I01 A;  1MDM A;  4LMY A;  1U2W A;  3HSR A;  4HBL A;  1IXS B;  4AWX B;  4M9X A;  1R58 A;  2EA4 A;  3WU0 A;  2DK8 A;  2EFQ A;  3V8L A;  1P4A A;  2UXN A;  5AIQ A;  3IWZ A;  1T39 A;  4P55 A;  3IC7 A;  1RZ4 A;  3TO6 A;  5D4S A;  3F8N A;  5K5Q A;  2OQR A;  4KFC A;  3LFK A;  2KIU A;  2PMU A;  2VN2 A;  4R79 A;  3H92 A;  1LDJ A;  5HLI A;  1KYW A;  1XDU A;  1MD0 A;  3U9G A;  4HQM A;  2QLZ A;  3M9A A;  4GXO A;  5IT9 Z;  4I09 A;  1IXC A;  3FM5 A;  5DCF A;  2GAU A;  3PQJ A;  1MJB A;  2H6B A;  3ZMU A;  5D5W B;  2Z99 A;  1G3Y A;  2FU4 A;  2PG4 A;  3V8K A;  1BI2 A;  3IRR A;  2IA1 A;  5LGN A;  2W57 A;  1O3S A;  4D0P A;  2LDU A;  3HHG A;  2ZNY A;  1TLH B;  4RAZ A;  3V4G A;  3HHH A;  1ZN2 A;  4P5O A;  4OU0 A;  5LGT A;  1VTN C;  1IN5 A;  2KJB A;  3VB2 A;  3KZY A;  2H27 A;  4AD9 A;  2A69 F;  2FML A;  4AIK A;  4BHB A;  4EMS A;  4EM2 A;  2A61 A;  3GVA A;  2ELH A;  2XVC A;  1SMY F;  1SFE A;  3EUH A;  1FBU A;  4P96 A;  4BH9 A;  3KET A;  5FD6 A;  2IRF G;  1F1Z A;  4KN4 X;  1B4A A;  3CUQ C;  1G3S A;  3LAP A;  4MTE A;  4ENM A;  1QGP A;  4I7H A;  3ABT A;  4LD5 A;  3I54 A;  1FX7 A;  5ICC A;  2RN7 A;  3ABU A;  4ZYE A;  3K1M A;  1ZAR A;  1R22 A;  1W5S A;  4WWC A;  4RGX A;  2BE5 F;  3BPV A;  4E70 A;  4IHT A;  4IPA A;  2HFH A;  1T38 A;  4LB6 B;  4HX7 A;  3CJN A;  2CYY A;  1JHH A;  2KRF A;  1H9T A;  2MC3 A;  2RC4 A;  4UV8 A;  1KU7 A;  3GYH X;  2MLK A;  4KMU X;  5HOO A;  5AON A;  3J80 K;  1UB9 A;  2EFP A;  2V79 A;  2RNJ A;  2JTV A;  2DK5 A;  3GZ6 A;  2DPD A;  3F8B A;  2RDP A;  1ONV A;  1BJA A;  3KLO A;  2D2W A;  2FSW A;  4N0B A;  1U5T A;  1BIB A;  3ZMS A;  3AAF A;  2VOO A;  1R00 A;  4MQV A;  2D1H A;  1FPQ A;  2STT A;  3FM3 A;  2ISY A;  5DD4 A;  2IT0 A;  2P5V A;  2M87 A;  4U7D A;  1WSU A;  1Z91 A;  3BY6 A;  5E8G A;  4BHP A;  4EV0 A;  2Z3Y A;  5IT3 A;  3HSF A;  2ZNZ A;  2GIV A;  1U5T C;  4RGR A;  5J8C A;  1ZRF A;  4FT8 A;  1SD4 A;  4G7H F;  4ZZD A;  1XMA A;  4MEY F;  5LHG A;  3TOB A;  4FHT A;  1JHF A;  3G73 A;  4I0A A;  2MD5 A;  5ILS A;  1C0W A;  2ACJ A;  3JSO A;  3BPX A;  3QU3 A;  1S6L A;  1HKQ A;  1ULY A;  1L3L A;  1LNW A;  4Q48 A;  1YQA A;  1T98 A;  3FWE A;  1WWX A;  5JHU A;  3IWF A;  2QVO A;  1IRG A;  3VEP A;  3GZ5 A;  4YII A;  2YPR A;  2DW4 A;  2X0L A;  3L09 A;  4L5J A;  3WOD F;  3OV8 A;  1OKR A;  1XN7 A;  3KP6 A;  3DFG A;  3TO7 A;  4YFK F;  4A0X A;  4PCQ A;  2VT3 A;  5HS9 A;  1BI0 A;  1MKM A;  4PZJ A;  2WWY A;  5ILV A;  3E6C C;  4RB3 C;  1O7F A;  1FYL A;  2ZCW A;  3KEO A;  4EJU A;  4HA8 A;  3TO9 A;  5D6F A;  2M5W A;  3GFI A;  4KDP A;  1D8J A;  4NB5 A;  2A3S A;  3F6V A;  5J6X A;  4GYI A;  4LGW A;  4M6X A;  3H3U A;  2BGC A;  2IP2 A;  3JAM Z;  2IW5 A;  3RKY A;  5LBQ A;  2GA1 A;  5DEQ A;  4UXN A;  1R5G A;  3DEU A;  1J5Y A;  2XKO A;  2XAJ A;  4A6E A;  2V9V A;  2PBI A;  2M45 A;  4YIF A;  1W7P B;  3P9K A;  2XIG A;  3FMQ A;  4Y17 A;  4RGS A;  5ERI A;  5BS6 A;  4HAM A;  4KIC A;  4M9S A;  1YW7 A;  1QPM A;  2ZFW A;  2IJL A;  2GXG A;  5CYV A;  4S05 A;  1P4X A;  2K86 A;  4O5V A;  3KCC A;  2XUB A;  5L3B A;  2VC0 A;  4A2U A;  2IVM A;  4LG0 B;  3K1P A;  4ZYG A;  3FZV A;  3F72 A;  4WXH A;  4EGY A;  1FY7 A;  4PDK A;  2ZJ2 A;  3S2W A;  1Q1H A;  2HYF A;  1T6S A;  2DO7 A;  3LWF A;  3T8T A;  1IN7 A;  5FFX A;  4HQE A;  1R5H A;  4HDV A;  3HUG A;  1G6N A;  3EET A;  4LG0 A;  4BYY A;  2EB7 A;  2QUF A;  3QRF F;  4HF1 A;  1UFM A;  1Y0U A;  1FP1 D;  1J9I A;  5A2Q Z;  3RYR A;  1V4R A;  2QQA A;  1YS7 A;  3HRT A;  1YLF A;  1FZP B;  5K1Y A;  2DI3 A;  3QOP A;  1Z05 A;  2P8T A;  4XLP F;  3QPH A;  4NHJ A;  3DV8 A;  2IA0 A;  5DCM A;  1YW8 A;  2G7H A;  2MA3 A;  4LB5 A;  3KP3 A;  3ZQ7 A;  4B8X A;  1QQI A;  2O61 A;  2J5P A;  1P2F A;  1JE8 A;  1HSJ A;  3B73 A;  5CVR A;  3BZ6 A;  3FF5 A;  4KIB A;  2HS5 A;  4ESJ A;  5E1W A;  3HIF A;  2FE3 A;  3C3W A;  1STZ A;  2P4W A;  1J2X A;  3KFW X;  3CLO A;  4MGR A;  3CDH A;  4ESB A;  5FLX K;  5HDG A;  3M1E A;  2COM A;  1OPC A;  1Z9C A;  5BMZ A;  3HTU A;  1LDD A;  4ASN A;  1XCV A;  2FMY A;  1RNL A;  4HLX A;  3J81 K;  3KE2 A;  4KIF A;  5BPD A;  3I53 A;  1PUE E;  3T5X A;  5LGU A;  3WTZ A;  1MDM B;  2MBF A;  3KP5 A;  3MZY A;  3BJA A;  1GXQ A;  1I1G A;  5L3E A;  3WTU C;  2OU2 A;  2FBK A;  4ON0 A;  2CQK A;  1YS6 A;  3GX4 X;  1TBX A;  4OMY A;  5AIP A;  2M1B A;  4G7Z F;  5JR3 A;  3BP8 A;  4M6Y A;  3BOQ A;  2AXL A;  2VOP A;  4KA4 A;  3F8F A;  3K9T A;  4Q4Z F;  2NNN A;  2LNB A;  4OOI A;  1IUY A;  4QLC U;  1SD5 A;  2BEO A;  5K5R A;  1FSH A;  2STW A;  2R3S A;  1YFH A;  2VT2 A;  3T1B A;  4EGZ A;  1FLI A;  1S7A A;  4Q47 A;  4GGG A;  3P7N A;  2F5E A;  4IRH A;  5CJ9 A;  4O6J A;  1LEA A;  5D4R A;  4QWQ A;  3GEZ A;  4CDG A;  2JSC A;  2VON A;  2QWW A;  4WK8 F;  2EFO A;  2W85 A;  4NQW A;  1SAX A;  4A5M A;  2XHK A;  4U7B A;  2ESN A;  4M72 A;  3ZMT A;  3G3Z A;  3C1D A;  4XSZ F;  1UHW A;  1Z6R A;  5FO5 A;  2Z33 A;  1HW1 A;  4HW0 A;  1J7K A;  1GXP A;  3I0T A;  3V7S A;  2EFW A;  2QQ9 A;  2HDC A;  2NYX A;  1AWC A;  4G9Y A;  3I64 A;  3IRQ A;  3BRO A;  1G3W A;  1ZRE A;  2YX7 A;  3HRU A;  4CIC A;  3IKT A;  3I4P A;  4H0E A;  2PEX A;  3FMS A;  5CVV A;  2Q0O A;  3V7R A;  1TW2 A;  1LB2 A;  3SFZ A;  1HXD A;  3CUQ A;  2A5Y B;  4UUV A;  4PGH A;  4CZZ A;  1REP C;  3FXR A;  3F23 A;  3WTX C;  4RS8 A;  5L3D A;  4MNU A;  3MQ0 A;  5D5V B;  1HQC A;  5LHI A;  5JI6 A;  3LQQ A;  2DLL A;  3WGH A;  2Z9O A;  3LAJ A;  4MQ9 F;  2V6C A;  1HKS A;  2M8E A;  1T0F A;  1XGS A;  5TRD A;  5K5O A;  4LLN A;  4OIR F;  2H94 A;  2UXX A;  5CVJ A;  2EFN A;  2VBY A;  2R7D A;  1O3R A;  2P7C B;  2RQP A;  3ML6 A;  2L4A A;  2B0L A;  4ENK A;  3M8E A;  2PLY A;  3WTV C;  3EYI A;  1NHA A;  3GWZ A;  1IN6 A;  1ZHF A;  4Z2Y A;  4ZZL A;  3P9C A;  1S8N A;  1U5T B;  2HWV A;  1EH8 A;  1TTY A;  1HW5 A;  1H9G A;  2IA2 A;  2K02 A;  1W7P D;  2Z5U A;  3D0S A;  5ICE A;  2XAF A;  1ZAO A;  2P5L C;  4EJV A;  2DAO A;  2WV0 A;  2A07 F;  2J5O A;  2HTS A;  3R60 A;  3ZMD A;  4A6D A;  4O3M A;  3K2Z A;  2F5D A;  4XRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...