2ESHA

Crystal structure of conserved protein of unknown function tm0937- a potential transcriptional factor
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
114
structure length
114
Chain Sequence
b'RGGRGFRGWWLASTILLLVAEKPSHGYELAERLAEFGIEIPGIGHMGNIYRVLADLEESGFLSTEWDTTVSPPRKIYRITPQGKLYLREILRSLEDMKRRIETLEERIKRVLQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein TM0937
publication title Crystal Structure of Conserved Hypothetical Protein TM0937
rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
total genus 35
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2005-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2eshA00
3EQLF 4AIJA 4UVCA 1LJ9A 1B9MA 1ZG5A 2PLYA 4E70A 3FHZA 1RUNA 1I1GA 2DI3A 4LG0A 5A2QZ 2NNYA 1MJAA 4L5JA 3FWEA 3J80Z 3JAMK 1WQ2A 1MKMA 4I02A 4N0BA 2CSOA 1E17A 2ZO4A 1YFHA 2BV6A 4EJOA 2CO5A 3PQKA 4CHUA 4S04A 2C6YA 3TDZC 4AIKA 3MCZA 5JHUA 2R7FA 2OZUA 2L02A 4IRHA 3E5UA 1NHAA 1YS7A 3GF2A 4UXNA 2O61A 4HOBA 2V79A 5ICCA 1XMKA 2HOEA 1R00A 2B0LA 5K5OA 1WKMA 5E1WA 1FSEA 2Q8KA 2FE3A 3R4KA 2F2EA 5ED4A 4KN4X 1FYKA 2V9VA 1CF7A 4HBLA 4A0ZA 1HXDA 2P5VA 3IKTA 2FMLA 3RYRA 4S05A 3VOEA 1HQCA 5F6FA 3BDDA 5ICEA 3E6CC 4EM1A 3KLOA 4ZYHA 2DQRA 1LDDA 2F5DA 2QQAA 3MFKA 1R5HA 2QUFA 1YQAA 4PDKA 3GZ5A 4AIHA 5E17F 4M74A 2D1VA 4HV5A 3L2CA 1SMYF 4TV7A 2D1HA 1KGSA 3B73A 3QAHA 5CVVA 1W7PD 1CGPA 3TO9A 3ZPLA 1S7OA 4Y15A 4L0ZB 3GW2A 1ZRFA 3K1MA 2RC4A 2UXNA 2HKOA 3HSFA 2XAHA 2LKPA 4L18B 3LQRA 1U2WA 2ELHA 2P5KA 4QLCU 4A5MA 3ZP5A 1Z6TA 1H9GA 4ESBA 3G73A 3MZHA 1FPQA 1XGNA 3TO6A 1F5TA 4LB5A 2OQGA 4FX0A 1I1SA 1SAXA 3FF5A 3LAJA 2P7VB 1KYWA 2VE8A 4KIGA 4MNUA 3FMRA 5L3DA 5D5WB 3E6DA 1ZYRF 1DDNA 3F8CA 1ULYA 3CUQC 1V3FA 4XSZF 4CZZA 2LF8A 1LVAA 3EETA 3TKYA 4GYGA 4K2EA 4U0WA 1W7PB 3V8LA 3NRVA 3R0AA 2MA3A 2GA1A 4B09A 3I71A 4FT8A 4KA4A 2QQBA 5DDGA 5E1ZB 2PJPA 3F8NA 3BJAA 1R58A 5D5VB 1AWCA 2XUBA 4KMUX 1LDJA 1D5VA 3HTUA 5J6XA 4EGYA 5LEJA 3I4PA 3TDUC 2OZ6A 3Q9VA 3R6SA 2DFIA 1OPCA 4EV0A 3TQNA 1HBXG 3C18A 4L9TA 3GFMA 4ENKA 3DP7A 1MDMA 3IRRA 2A6HF 3SZPA 1G3YA 3T1BA 3P9IA 1SFXA 1T39A 5K5RA 3DV8A 3NEUA 4HDUA 3CLOA 4RGRA 2NNNA 5JFRA 5A2QK 3KEOA 2D2WA 3J80K 1USTA 3SQNA 4MEXF 3C7JA 2ZNZA 5J8CA 2DPDA 3BY6A 3MEXA 1P6RA 2QENA 1WI9A 5CLSA 2UXXA 2HQNA 3IHUA 3L09A 5K1YA 1REPC 1R36A 5D6FA 2WTEA 2EFPA 4YG2F 3I59A 2QM3A 5E8GA 4KMFA 2DLLA 4OIOF 4M9ZA 1IN6A 2P6SA 2PMHA 2JRTA 2MH2A 1YYVA 2ADUA 4RGSA 1J0RA 2KRFA 4BQAA 3WGIA 2VT2A 1T38A 2ZKZA 4GXOA 2DO7A 2DK5A 3U9GA 2M5WA 3WU0A 1TBXA 1S7AA 4WF2A 2QBYA 3CJNA 1BIAA 4HYEA 4BH9A 3GZ6A 5FO5A 3ZMZA 5HLGA 5BPIA 5TJJA 4A12A 1MZBA 3F8MA 3HRSA 5KVRA 1P4AA 3WTVC 2EJRA 5DD4A 3L9FA 4BNCA 2DW4A 2GIVA 3M7GA 1Z9CA 1TNSA 1OKRA 4A0XA 1H9TA 4PGHA 1K78A 2FRHA 1QO0D 1KA8A 1F9NA 1B6AA 1FYMA 1S6LA 2BYVE 1C0WA 2A07F 3HHHA 3QU3A 4WXDA 1BI0A 5JVTA 4UV8A 1TQIA 2O8XA 2VBXA 2FXAA 2AS5F 3EUHA 1L0OC 2CYYA 2XAJA 4A5NA 1QQIA 3V8JA 2GAUA 1XB4A 4MQ9F 1Z1DA 1HKQA 3HRTA 4XRFA 3F23A 1FX7A 3LWFA 4U88A 4XBFA 2M8EA 2J5PA 2ZJ2A 4M9XA 5DCMB 1GHCA 2EV6A 5D4RA 1O7FA 1QPMA 4KN7X 2STTA 5HDGA 1QNTA 2HGCA 2QQ9A 2XAFA 3IL2A 3OOPA 3ROUA 4O5VA 4CGZA 1EH6A 2OD5A 4D0PA 3RIRA 1L3LA 2CW0F 2FBIA 2MLGA 1P92A 4KT5C 1O57A 5E20A 3GWZA 1Z91A 2V1XA 4U7DA 3Q9SA 2M87A 4OOIA 4LK1F 5HS8A 4L9VA 3EDPA 1TW3A 3E5QA 5H20A 4RAZA 4UUVA 1HKTA 3GX4X 1FP2A 1ZLJA 1FSHA 3TOBA 2RDPA 4L9JA 3JTGA 3V7RA 2K27A 3O3KA 3I54A 4DNCA 4CXFA 2KIUA 2ISZA 4EQQA 3V7SA 2STWA 5D5XB 2R3SA 3DPLC 5LGTA 4N9HA 5E1XA 1K7AA 2FEZA 3HIFA 3RJPA 1YLFA 3BOQA 3V4GA 3T0YA 3F21A 1V4RA 2ZBKA 3KP2A 4I98B 5HLIA 3E5XA 3RPQA 3I53A 1CF7B 4IHTA 4ZYEA 2ACJA 1QZYA 3FXUA 3H3ZA 1FT9A 3M1EA 3KP6A 2A3SA 4LK0F 4EJTA 5ERIA 2VONA 2V1UA 2H94A 2EWNA 1DPRA 1FBUA 1R1UA 2XVCA 2KIMA 4BYYA 1O3TA 3FZVA 3O2PE 3I0TA 4IRIA 1XMAA 5DYMA 4FHTA 2WC2A 2WV0A 3WTYC 2ZCWA 2KKOA 2JSCA 1YW8A 3V7CA 4UV9A 2UWMA 4UVBA 2GQQA 3ZN1A 3GFLA 5L3CA 1LDKB 2O3FA 3W6JB 2XAGA 3WTWC 2QWWA 2HTJA 2K7LA 2DBBA 2EA2A 5D6EA 1JE8A 2FBHA 3HYIA 4Q5SF 4MTEA 3TGNA 2JPBA 3I58A 4YFKF 1ONVA 2JTVA 2GZWA 2H6CA 1O3RA 2H09A 2Q2EA 5DV5A 2IRFG 2R7DA 3KZZA 3CUQA 2ESNA 4LGWA 2GXGA 1IN4A 5CVUA 1YS6A 3JSPA 1ODDA 5FGMA 2L4MA 3EYYA 2LDUA 5D4SA 2NS0A 4CICA 1FBSA 3KZYA 4Y13A 1UHMA 2HYGD 1B59A 2GXBA 2RKHA 5FFZA 4ASNA 4RB3C 4EMSA 1J7KA 4EM0B 2VC1A 1J2XA 1Y0UA 4MEYF 1G6NA 2VODA 5HOOA 3AAFA 2OU2A 1FP1D 3HHGA 2Y0MA 4YFNF 3L00A 2CGPA 2KJCA 1ZG1A 2CG4A 4IJAA 5AIQA 1PP8F 3R60A 1S29A 2VC0A 3BP8A 3I5UA 1IRFA 3V8KA 3VEPA 1ZARA 1T98A 4ON0A 5FFXA 4I2OA 3P9KA 4OMZA 5FB2A 4P5OA 1Z6RA 3GFIA 1TQPA 3J81Z 3KLNA 3F8FA 3DFGA 3GUDA 1R7JA 1J75A 3K69A 3U2RA 3JW4A 1ZH5A 5LGNA 2IVMA 3IWFA 4U0YA 3C3WA 2X4HA 2CQKA 4RGXA 3E6BA 2EV5A 3K9TA 1I6XA 4I0AA 2XGXA 2ZMEB 5HS9A 1P2FA 1MJ9A 3DXJF 2K4BA 4ENJA 3P9CA 5D8LB 2H27A 1PDNC 3BJ6A 1IXCA 3PFIA 2EFQA 5FD5A 5ILUA 2HQRA 3FMQA 3WTZA 3FM5A 1T2KA 1FWZA 1W5SA 5FLXZ 3NQOA 4G9YA 4ENMA 3GO5A 3WGGA 1GVJA 1ZRCA 4G6DA 5H6RA 3GLXA 1IN7A 1ZGAA 1B1BA 1KU7A 4RS8A 1USSA 3G3ZA 4HV6A 4Z2YA 5BPDA 3HSRA 1LB2A 3SXYA 2NRAC 3RDIA 1FBQA 3RKWA 3KP4A 5JI6A 5DD8A 1UB9A 3REOA 5BMZA 5J8FA 2JZYA 4AD9A 3MWMA 1U78A 1KQ8A 5HLHA 2BBYA 3LSTA 2TDXA 2V6CA 2K02A 2W57A 4HA8A 2P6TA 1GXPA 2BGCA 3QP6A 4AWXB 4HX8A 2EFWA 4O6JA 1XGMA 4FX4A 5HVQC 3QPHA 4WK8F 1XDSA 3K1NA 4KDPA 4ZZLA 2DK8A 1K78B 3MAJA 4ZYDA 3T8RA 3ULQB 4LD5A 4WCGA 3QRFF 4DQ2A 1EH7A 3WTXC 2K4JA 3CO6C 3JTHA 2FMYA 1S8NA 4AVPA 5E8IA 3Q5FA 3ECHA 1GXQA 3WE2A 2DPUA 2DQLA 1BBYA 4LLNA 3KCCA 5LGUA 2Q0OA 1OYIA 1YO5C 4U0VA 1BJAA 4M73A 1R1VA 1T6SA 1IXRC 5L3FA 4P96A 4LLLA 1WSUA 5LRRA 3IRQA 3ISPA 2UZKA 1H0MA 1BN5A 2RV8A 1O3QA 1SFUA 3VFZA 4I0BA 1TLHB 3SHFA 1U5TB 3I64A 4P9FA 2AXLA 1J59A 1LNWA 3ZMVA 2L4AA 5CVJA 4G6QA 1DPUA 1SFEA 2QZ8A 1SD5A 3DPTA 3HOSA 1HKSA 1EV7A 1IRGA 2OBPA 3F6VA 3K2ZA 1YG2A 3BZ6A 4Y17A 1XSDA 3HRMA 1TNTA 4BXUA 2W84A 2FOKA 3WTUC 1PUEE 4XSXF 1R1TA 2VOPA 3LAPA 1HW2A 2F5EA 3QP5A 2BEOA 5KK1A 1ZLKA 4A6DA 1HW1A 2OQRA 3T5XA 5H6QA 3GEZA 2BE5F 1IUYA 3M8FA 1SD6A 4G8XA 3KE2A 1FY7A 5BQTA 3DF8A 1G3TA 3ZMUA 2HTSA 5D8KB 4GO1A 5LLQA 4NB5A 4IRGA 3J81K 3RKYA 1FYLA 2PQ8A 3E3VA 2RGVA 3KP5A 3D0SA 2V1DA 4WXHA 1Z05A 2MLKA 1MJBA 4ETSA 3KP7A 1IXSB 2EFOA 4B8XA 3DKWA 1IN5A 1UFMA 5E18F 1B9NA 1UHWA 1YW7A 1DUXC 3CTAA 4LMYA 5LHGA 4KYWA 2IA2A 4XLNF 3M9AA 2VBWA 2H6BA 1JHFA 1XSVA 4LG0B 5FLXK 2ZFWA 3SFZA 3GFJA 1YIOA 3GVAA 2FNAA 2PMUA 2IW5A 1I27A 4F7ZA 3MQ0A 2RVCA 1OYYA 1ZRDA 1FNNA 3BJOA 1XCBA 4QWQA 3WGHA 4WWCA 1BI3A 2GWRA 1HSTA 1F4KA 1OYWA 1S3JA 3ERED 1D8JA 2YU3A 4JQFA 1TTYA 6PAXA 3E97A 3WE3A 2HKXA 2PFBA 4BHBA 2IP2A 2IA0A 4MTDA 3PQJA 3KEQA 1G4DA 3BWGA 1XGOA 1IN8A 5DCMA 4HQEA 2M30A 4RAYA 2XKPA 1QZZA 4HLXA 3N4MA 1G3SA 1W4MA 5IT3A 1U5TC 1FC3A 4UNOA 1IW7F 5EEGA 5CVIA 2XASA 4CYDA 4RB2C 3D5LA 3ELKA 3QPTA 3E6MA 4ENNA 2HS5A 3HTSB 3RYPA 5TRDA 4IF4A 2EFNA 2Y75A 4ZZDA 2EK5A 4BAYA 1PP7U 1KQ0A 4I7HA 2ZXJA 4EJWA 4L0YB 5LEKA 3LA2A 2W25A 1XN7A 2HYFA 2DTRA 1X3UA 2WWYA 3RTRA 1BC8C 1IF1A 3LQQA 4A2UA 4RB0A 1OMIA 2L54A 4HF1A 1ON1A 4EJVA 2ZNYA 2E1CA 3ZMTA 4OIRF 2CWEA 1XDUA 1RZ4A 4H0EA 3MZYA 3IWZA 4L5IA 2O6GE 4JK1X 2CFXA 3F8BA 1AOYA 2M1BA 2RN7A 1B4AA 2A68F 3ML6A 3RKXA 4U7BA 3LA3A 2GA2A 3W6KB 4EGZA 2YR2A 4IXAA 2FSWA 2Y48A 4KNYA 4M72A 2P5LC 3H92A 2RQPA 2Z5UA 3WODF 1LEAA 4ESFA 5L3GA 3K0LA 2MD5A 2LNBA 2XHKA 1R5GA 2PI0A 5ICGA 5L3EA 2J5OA 2E1NA 1JHHA 1W5TA 5BOXA 1ZG3A 3T8TA 3C1DA 5DEQA 1LQ1A 1A04A 3ABUA 1D3YA 2HDCA 2Z99A 1BI2A 3DEUA 1J9IA 3J7AO 3N97A 2Z33A 1U3EM 4P9UA 4CDGA 4P55A 2KIFA 1TQMA 4GGGA 2FBKA 4HF0A 5EEHA 5ICFA 5ILSA 3B02A 5IT9Z 3ABTA 2G9WA 1MDMB 3SZTA 1BM9A 3R61A 2X0LA 3R0JA 1TW2A 4ZH4F 1UCRA 2VE9A 2P4WA 4I09A 2MBFA 3KP3A 4O3MA 5ILVA 5HS7A 4OIQF 4M71A 4IHSA 2IPQX 1XD7A 4GYIA 3O6BB 3FXQA 3QU6A 2PN6A 2W24A 2YSRA 3COAC 3LA7A 1XCVA 1JXSA 3CO7C 4M9SA 4OIPF 1MD0A 4BHPA 3ZN0A 1T0FA 1Z7UA 3HSEA 5BS6A 2Z3YA 2A6EF 4M6XA 4HW0A 5FD6A 3BPXA 3I59B 2A5YB 4LLGF 1U8RA 3F22A 2D45A 2XKOA 2HEOA 2VN2A 1KU9A 4WXCA 2IA1A 3ZQ7A 5F1RA 3FX3A 3BPVA 2XAQA 3GYHX 2A69F 4KFCA 1ZN2A 2VXZA 3F3XA 4HZFA 1KU3A 3K1PA 5AIPA 4RB1A 4HAMA 1SD7A 2QBYB 1BC7C 4HDVA 2VBYA 4Q48A 3JSOA 2IT0A 4NQWA 1LEBA 2ESHA 2MH9A 2FNPA 1W7PA 1RI7A 5LHHA 4CO8A 5JR3A 3FXRA 1RUOA 3TO7A 1BOAA 2OA4A 4BHCA 4KUMA 1QGPA 2ZMEA 4JBAA 3IKVA 5LHIA 1YTYA 3LFKA 1ON2A 1BIBA 4N9IA 2W85A 4ESJA 3M8EA 4G7OF 2O03A 2YX4A 4EJUA 2MC3A 3HUGA 4YIIA 3BROA 2E7XA 2DT5A 3JAMZ 1K79A 2XV4S 4I01A 2EB7A 4HQMA 2XROA 5DUKA 3RPUA 1Q1HA 3OV8A 3ECOA 4RGUA 1G3WA 2LSOA 1ZREA 2QYOA 2XRNA 3WTTC 5CVRA 4OU0A 5DCFA 3TOAA 2VOOA 2F5FA 1IAWA 4GCVA 1R22A 1RNLA 2OAZA 3RI4A 2F5CA 2LF7A 2YPRA 4KIFA 3GXOA 1KYZA 3IC7A 1O3SA 2VT3A 1DP7P 2JPCA 3P7NA 3WG9A 4WX9A 2YX7A 4R8HA 2L3DA 4L9NA 1KU2A 4PZJA 2G7UA 3H3UA 5HDNA 4MGRA 4OINF 1MGTA 2ETHA 1BI1A 1ZGJA 3S2WA 1I5ZA 1RIOH 1SMTA 4YFXF 1JGSA 5DUIA 2HFHA 5HDKA 2L01A 4HF2A 4KICA 2XIGA 4EM2A 1P4XA 5IT9K 4NHJA 1ZAOA 5D5UB 1EH8A 1K6OA 4OMYA 3FM3A 4Q4ZF 4A0YA 4LFUA 3HRUA 2QLZA 4MQVA 2NAZA 1R23A 2HZTA 2EV0A 2K86A 2HR3A 4PGGA 5CYVA 2VBZA 3FMSA 4R1HA 2DAOA 1STZA 4M6YA 1XSXA 1D8KA 2P8TA 1U5TA 3KETA 4YIFA 1F1ZA 4KIBA 2IJLA 2PBIA 3KFWX 1ZHFA 2EA4A 5CJ9A 2DU9A 5L3BA 3ZMSA 2FA5A 2FU4A 2G7HA 3VODA 4IVNA 5K5QA 1FOKA 3CUOA 1VTNC 2Z9OA 2FQ3A 4XLPF 4HX7A 3VB2A 2A61A 2E7WA 5LRSA 1QBJA 4MHGA 1YW9A 4R79A 2NYXA 5AONA 2COMA 2O0YA 1FLIA 2QVOA 3F6OA 3F72A 1P4WA 3QOPA 4IPAA 1IZ1A 4UVAA 2KJBA 1WRJA 2PG4A 2M45A 3WTSC 4EVIA 4ZYGA 4G94A 1O7LA 1U6GA 1HW5A 1HSJA 3EYIA 2ISYA 2RNJA 2HWVA 1KQ9A 1OR7A 3WU1B 3DQVC 4HLYA 1XGSA 3ZMDA 2PEXA 3CDHA 5LBQA 4Q47A 5F64A 2JT1A 1J5YA 1WWXA 1FZPB 4PCQA 3CUQB 2P7CB 3HOTA 4G7ZF 4LB6B 4A6EA 4HX4A 1E2XA 3L7WA 4LJZF 1SD4A 2FF4A 3U1DA 4UHTA 4G7HF
chains in the Genus database with same CATH superfamily
3EQLF 4AIJA 4UVCA 1ETVA 1LJ9A 5GAGJ 2DT7B 1B9MA 1ZG5A 2PLYA 1UHSA 4E70A 3FHZA 1BL0A 1RUNA 3HOWJ 1I1GA 4ZTFA 2DI3A 4LG0A 5M5YJ 5A2QZ 4M6VA 2NNYA 1NG7A 1MJAA 2HI3A 3HB9A 4L5JA 3FWEA 4BQOA 1BOBA 3J80Z 2XB0X 3JAMK 2HQ5A 1WQ2A 1MKMA 4I02A 4N0BA 2CSOA 3W2VA 1E17A 1LPQA 2ZO4A 1YFHA 2BV6A 5E3NA 3OYIA 1U9OA 4EJOA 2CO5A 3PQKA 4FE4A 4CHUA 4S04A 3SYTA 4E7KA 3TDZC 4XLCA 2C6YA 4AIKA 4AUXA 3MCZA 5JHUA 2R7FA 2OZUA 3MZ8A 2L02A 4PSXA 3S14J 4IRHA 3E5UA 1NHAA 1ZGWA 4D7NA 1YS7A 3GF2A 4UXNA 2O61A 4HOBA 2V79A 2M4GA 5ICCA 1Q1VA 1XMKA 2HOEA 1R00A 3VYSB 1NTCA 2B0LA 5K7HA 4BJ6C 1SAUA 5K5OA 4OAYA 1WKMA 5E1WA 1FSEA 2Q8KA 2EILH 1E3HA 2FE3A 4OAZA 4A69C 3R4KA 3VWBA 3I56I 1Y6IA 2GLOA 2F2EA 5ED4A 4KN4X 1FYKA 1EA3A 4CUGA 1W5CC 2KHMA 2Y9YA 5KAFC 3FKJA 2V9VA 2R7QA 1CF7A 2DOEA 2ICWG 1G2HA 4HBLA 4A0ZA 2ID3A 2M7BA 1HXDA 2P5VA 3GTKJ 3IKTA 2FMLA 2EIJH 2JN6A 3RYRA 5F0FA 4D5FA 3N05A 2JMWA 4S05A 1IG7A 3VOEA 2QSFX 1GV5A 1HQCA 3W2WA 5F6FA 1QRYA 2XF5A 3BDDA 5ICEA 3E6CC 4EM1A 3KLOA 4XL9A 3LSMA 4ZYHA 2DQRA 1LDDA 2F5DA 1Z21A 2QQAA 3MFKA 1R5HA 3SDGA 1ERDA 5C4JJ 3A1YA 3DLAA 3K2AA 1K4TA 2L9RA 2QUFA 3S1MJ 1DGWY 2ZJPF 3FK6A 1R5ID 1YQAA 3FBNB 4PDKA 1A31A 4V2GA 3GZ5A 4AIHA 5E17F 4M74A 2D1VA 2XGCA 4HV5A 3L2CA 1SMYF 1SFKA 4TV7A 5F0HA 1ZR4A 1MNDA 2D1HA 4NC8A 1KGSA 3B73A 3QAHA 5CVVA 1W7PD 1CGPA 4XKCA 3TO9A 3ZPLA 1S7OA 4Y15A 3L1PA 2Y2ZA 3S1QJ 4L0ZB 4X1EA 3GW2A 1ZRFA 3OYLA 2WAEA 3K1MA 2CV2A 2X9DA 1Z3YA 2RC4A 2UXNA 1N78A 2HKOA 3DKYA 3HSFA 2XAHA 3CF2A 2EINH 3CMMA 3LSHA 2LKPA 4L18B 3LQRA 1U2WA 2ELHA 2DDBA 4AIDA 2KPMA 4IX7A 1VQ9I 5JLWA 3KEYA 2M2EA 2P5KA 4QLCU 4A5MA 3ZP5A 4OWRB 2X1CA 2X6YA 2JQ7A 3QPLA 1Z6TA 1H9GA 2P81A 4ESBA 1T33A 3EUAA 5FJ8J 3G73A 3MZHA 4NBQA 3DU6A 4BS9A 1FPQA 1XGNA 1WGXA 3TO6A 1F5TA 4LB5A 2OQGA 4FX0A 1I1SA 3GTGJ 1SAXA 3CJTB 2DT6A 3IH3A 1XG1A 2EH3A 3UKGA 3GMEA 3FF5A 3HBLA 3LAJA 3CCQI 1W0UA 3JRFA 2P7VB 1KYWA 2VE8A 4KIGA 2HXIA 4MNUA 3FMRA 2QSHX 5L3DA 5D5WB 3E6DA 3KYLA 1ZYRF 1DDNA 3F8CA 3AL0B 1IDZA 1OCTC 4ZDPA 2H8RA 5IP6A 3H9QA 3RPUD 1ULYA 3CUQC 1V3FA 1X58A 4XSZF 1XPXA 3B6CA 3GZNB 4CZZA 2HDWA 2LF8A 4NQWB 1FEXA 1LVAA 3EETA 3TKYA 4GYGA 4K2EA 4U0WA 1W7PB 3V8LA 4XMYA 3NRVA 2XPWA 3R0AA 2DA4A 2GA1A 2MA3A 4B09A 4ABZA 1YI2I 2Y9ZA 1MIJA 5HLTA 3S16J 3I71A 3A01B 4FT8A 2ME0A 2L0KA 2M7AA 5EJCA 4KA4A 2QQBA 3S32A 5EEAA 3OR2C 5DDGA 1GLNA 3HDDA 5E1ZB 4XORA 4RMNA 2WY8Q 2PJPA 3F8NA 5JLXA 4A3IJ 3S1NJ 1ETOA 3CDLA 2AQFA 4FQGA 3BJAA 1R58A 5D5VB 1AWCA 4H4KC 3QODA 3ZQLA 5F1JA 2XUBA 1X1PA 2CUFA 4KMUX 1R4MB 1LKXA 2PJRB 1IV8A 1LDJA 4CCOA 4CYCA 3OYGA 1D5VA 3G4SI 3HTUA 5J6XA 4EGYA 5LEJA 4CCLA 2LVSA 4I6ZA 3I4PA 3TDUC 2OZ6A 3KIOA 3Q9VA 1FIAA 4XM3A 3R6SA 2DMPA 2DFIA 1OPCA 4EV0A 5CPRB 1YE9A 2LY9A 4PJJA 2ZXHA 3TQNA 1HBXG 3C18A 3O8HA 3CESA 4L9TA 3GFMA 2QA4I 4ENKA 1S7EA 3DP7A 1MDMA 2VIXA 3M3YJ 3IRRA 1IRZA 2A6HF 3SZPA 1G3YA 3T1BA 4AYBN 5F0CA 5IP7J 3P9IA 1SFXA 1T39A 5K5RA 3DV8A 3NEUA 1LFBA 4RA2A 3CLOA 3F9KA 4RGRA 4HDUA 3A02A 2NNNA 1YHQI 1VQ8I 5JFRA 5A2QK 3HC7A 3KEOA 2D2WA 3EPZA 5J1YA 1USTA 3SQNA 3ZOBA 3J80K 4MEXF 5M5WJ 4F52A 3BCAA 3C7JA 2ZNZA 5J8CA 2DPDA 3BY6A 3MEXA 5B3SH 3GTPJ 1P6RA 2QENA 1RESA 5JHFA 2R93J 1WI9A 1BR1A 1PVEA 5CLSA 2UXXA 5TGTA 1TZLA 1RKTA 5M3MJ 2HQNA 1S72I 3IHUA 1XMXA 3L09A 2R5YB 5K1YA 1REPC 2BVLA 2NVUB 1IUFA 1R36A 5D6FA 2WTEA 2EFPA 2BY0A 1YITI 1G59A 4YG2F 1FOXA 4V19K 3I59A 3ZQQA 3H3VK 1X1BA 2QM3A 2X48A 1DU0A 5E8GA 4KMFA 2E35A 4UY8I 2DLLA 4OIOF 1IN6A 4M9ZA 4QTRA 2P6SA 2PMHA 2JRTA 1RKWA 2MH2A 1YYVA 2E2HJ 3DU5A 1SVMA 2ADUA 1MH4A 1YJWI 4XIDA 3PL8A 4RGSA 2R5ZB 3FKIJ 1J0RA 4GRIA 5F08A 1WJDA 3EUKL 2KRFA 5JVGF 4AM3A 4BQAA 1MBKA 2VT2A 3WGIA 1T38A 3BR0A 3AG2H 2UUZA 2ZKZA 5J4VA 4KJZA 4GXOA 2DO7A 2DK5A 2R7WA 4II2A 2VJJA 1TL8A 3BTIA 3U9GA 2DTZA 2M5WA 3B6AA 1A5JA 3QQAA 4A3GJ 3WU0A 2IGMA 1TBXA 2DA3A 1S7AA 2G0EA 4WF2A 2VKDA 2QBYA 3CJNA 2W7NA 1BIAA 4HYEA 1RR7A 4BH9A 1EKEA 2EZIA 1DP3A 3GZ6A 5FO5A 4N4NB 3ZMZA 2ID6A 1RPWA 4Y33A 5HLGA 5BPIA 3RZOJ 2CV1A 1D5YA 3AL0C 2OV7A 1WJCA 5TJJA 4A12A 4DZPA 2WB1N 1MZBA 3F8MA 3HRSA 5DM7F 5KVRA 1P4AA 2CW7A 2R7ZJ 3WTVC 2EJRA 5DD4A 3L9FA 4BNCA 2DW4A 2GIVA 1BW6A 2LYCA 1X2MA 2XGEA 3M7GA 3VSLA 3S8PA 1QZEA 5GPAA 2JJ7A 1OCCH 1ZTRA 3CD6I 2WY7Q 2IGOA 2KZGA 1WFXA 4XOPA 2BW3A 1Z9CA 3PUBA 5B1BH 4YELA 2R7TA 5FRNA 1TNSA 4IQ4A 5KNLA 1OKRA 1ORKA 4XLEA 4A0XA 1W1WE 1H9TA 3OSGA 3LMMA 1PUFB 5FLVA 2V6EA 4NC7A 4PGHA 1NK3P 2JSPA 5EYRA 1W36C 1K78A 2FRHA 1VNDA 3GTLJ 1QO0D 1KA8A 3DWLE 3H0DA 1F9NA 2ZSIB 1MSEC 4LOCA 3C2GA 3BZKA 1B6AA 1UJ8A 5IOZA 1S6LA 1FYMA 5FROA 2BYVE 1C0WA 2A07F 3HHHA 2K40A 3DPUA 3QU3A 4G12A 3G71I 4WXDA 2GIZA 3H35A 1V5GA 1BI0A 5JVTA 4UV8A 1TQIA 2IGNA 1UELB 2XF7A 3BQZA 2V9PA 2O8XA 2VBXA 2FXAA 2AS5F 3IUOA 3EUHA 4U87A 1L0OC 1X4PA 2CYYA 2XAJA 2O9LA 4XLAA 4A5NA 1QQIA 1XX5A 3V8JA 5B66C 2GAUA 4IHYA 1XB4A 3H36A 4MQ9F 4PUSA 2E2JJ 1Z1DA 1DGRM 1HKQA 1N25A 2VJ4A 3HRTA 3VYRB 3BG9A 4XRFA 3F23A 1FX7A 3AG4H 1HOMA 3HEFA 4EATA 1W0TA 3LWFA 4U88A 4XBFA 1TP4A 2M8EA 2J5PA 3L2WA 2ZJ2A 4M9XA 4DBRA 4XK4A 5DCMB 1H8AC 2EV6A 1GHCA 3K4CA 5IYCJ 3H9GA 3QPSA 4DYRA 4BKXA 3LOCA 5D4RA 1O7FA 1QPMA 4KN7X 2STTA 5HDGA 1TT0A 2E19A 1QNTA 1I39A 2HGCA 2QQ9A 2XAFA 2ZB9A 3IL2A 3WHCA 4B4CA 2K3PA 3OOPA 3ROUA 2CUJA 4O5VA 4CCJA 4CGZA 4XICA 4IOAF 1EH6A 1B72B 4HEA2 2OD5A 4D0PA 3RIRA 2DYSH 1Y39A 2XPVA 1L3LA 2CW0F 3CCJI 3IAM2 3K4MA 2FBIA 2MLGA 3DCFA 3BR3A 1P92A 4KT5C 3K10A 3DTKA 1O57A 4D5CA 1DQUA 1V5FA 5E20A 3GWZA 2XC7A 1Z91A 2V1XA 4U7DA 2BZTA 3S3NA 1CQTA 3Q9SA 1BJZA 2M87A 4OOIA 5FLMJ 4LK1F 2IS1A 3HM5A 4XRSG 2Z1DA 5HS8A 3GTOJ 4L9VA 3EDPA 4CZCA 1TW3A 2HPMA 3E5QA 5H20A 2BY1A 4RAZA 4UUVA 1HKTA 3GX4X 1FP2A 1ZLJA 3OYCA 3CF5F 4Y52J 1FSHA 1TWAJ 3TOBA 2RDPA 4L9JA 3JTGA 4YIRX 5CQEA 3V7RA 2K27A 3O3KA 5EGOB 4E4HA 3I54A 4MIMA 4DNCA 4CXFA 5E3OA 2KIUA 3LSRA 5J40A 4EQQA 1D1AA 2ISZA 1WH7A 1R9TJ 4E7HA 3V7SA 2STWA 3MVPA 5D5XB 2R3SA 3DPLC 1VI0A 5BNGA 5LGTA 1VQOI 3TBIA 2NVTJ 4N9HA 2E1MC 2E5NA 3FISA 3S1RJ 2M4KA 5E1XA 4E7JA 3KPHA 4FETA 1D1CA 1K7AA 2FEZA 3HIFA 3RJPA 3MN2A 1YLFA 3BOQA 1Y0NA 5GTIC 3V4GA 2ELKA 3OYJA 3T0YA 1V4RA 3F21A 2ZBKA 4DGWB 2VQGA 3KP2A 3D5SC 4I98B 2AHQA 5HLIA 2PX9A 3E5XA 1LE8A 3RPQA 3I53A 1CF7B 4IHTA 2IXSA 1Y1VJ 4ZYEA 2ACJA 2WV1A 3RQIA 4YRVA 3CDIA 1QZYA 3FXUA 3H3ZA 1FT9A 1IDYA 3M1EA 3KP6A 2A3SA 2Q1ZB 2R7UA 2L2OA 4LK0F 5EZHA 3H5AA 4EJTA 5ERIA 2VONA 2V1UA 1ETWA 3OS0A 4BJTA 2H94A 2EWNA 1DPRA 1FBUA 1R1UA 1X3WB 2XVCA 2KIMA 3KZIC 1BA5A 4BYYA 1O3TA 1VZ0A 3FZVA 3O2PE 1VQNI 3I0TA 4IRIA 1XMAA 3IP4B 5DYMA 2JUGA 4B1RA 4FHTA 2WC2A 2WV0A 3A0HC 4DIQA 3WTYC 2ZCWA 2KKOA 1K61A 1MMGA 3M4OJ 2JSCA 1YW8A 3V7CA 4UV9A 2OTJI 4LIVA 3J7ZI 1FTTA 4XOTA 2UWMA 4UVBA 2GQQA 3ZN1A 3GFLA 5L3CA 1LDKB 3ZQHA 4IOCF 2O3FA 3W6JB 4JX5A 2XAGA 2R7XA 3WTWC 2DJIA 3VYTB 1ZELA 2HVSA 1K4SA 2ME6A 1GVDA 1YRNA 4CCNA 2QWWA 5FRMA 1TT5B 3U21A 3DEEA 4NNJA 2IEKA 2HTJA 2K7LA 1UG2A 2DBBA 1JKRC 1ENHA 2YS9A 2EA2A 5D6EA 4RM3A 2GBYA 1JE8A 2Y31A 2FBHA 3OWTA 3OSFA 4E6KG 5DS9A 3HYIA 2EIKH 4XKVA 2CJJA 4Q5SF 4MTEA 3TGNA 2GXAA 2JPBA 3K70C 1M1EB 3I58A 4YFKF 3BC8A 1ONVA 2JTVA 2KIQA 3PO3J 3NWTA 2GZWA 4B3XA 3HOVJ 3JRGA 2H6CA 2M3AA 1O3RA 4B44A 2E60A 2H09A 2Q2EA 2X6OA 4BEHA 2DN0A 5F04A 2P0WA 4E7IA 5DV5A 4NUBA 2FX0A 1QA6A 1JKOC 2IRFG 2R7DA 4CH7A 3KZZA 3CUQA 2ESNA 4LGWA 4QIWN 2LFBA 4W97A 2GXGA 4GFBA 1IN4A 5CVUA 1TWCJ 1YS6A 3JSPA 5CQGA 1ODDA 4C3JJ 2PMZA 2XPUA 2VKEA 5FGMA 2L4MA 3EYYA 2LDUA 5D4SA 2K9LA 4M3FA 2NS0A 4CICA 4KITB 2MGQA 3FXMA 1FBSA 3KZYA 3OS2A 4Y13A 1UHMA 2HYGD 1B59A 2GXBA 3DBHB 2LMDA 1I6HJ 1T56A 2RKHA 5FFZA 5TISC 4ASNA 1ZKGA 2WAQN 4RB3C 4A3LJ 4EMSA 1J7KA 2DMNA 4EM0B 2NVQJ 3BG3A 2EZKA 3AKZA 3J7AY 2CQ7A 2EZHA 3OIPA 2VC1A 1EJ9A 3Q3SA 1JGGA 1J2XA 1Y0UA 3I9V2 4MEYF 1Y1WJ 1G6NA 2VODA 5HOOA 5KHDA 1JUSA 3AAFA 3LSGA 2OU2A 1FP1D 1RC9A 3H1CA 3HHGA 3CCRI 2F48A 4S0HB 4BUPA 2Y0MA 4YFNF 3L00A 4ITVA 3LSPA 2CGPA 3BG6A 5C3EJ 4XRSA 5IYBJ 2IAIA 1R71A 2KJCA 1VQPI 1VQKI 1ZG1A 2ECCA 2CG4A 4IJAA 5AIQA 1NH3A 2E1OA 4V2FA 2DA1A 1PP8F 1FOYA 1ZQ3P 3R60A 1S29A 2VQLA 4IO9F 2VC0A 4A3JJ 4BXXJ 3BP8A 5GPCA 1V5EA 4B47A 2MABA 1SC7A 3I5UA 2DXIA 1IRFA 3V8KA 3VEPA 2LD5A 3BTJA 3ABKH 1ZARA 1T98A 4ON0A 1AKHA 1MMNA 3BQYA 3E7LA 5FFXA 3CCEI 2LOOA 4I2OA 3P9KA 2JA8J 4OMZA 5FB2A 4P5OA 2OJED 1EF4A 1Z6RA 3GFIA 1U8BA 1RR8C 1TQPA 3J81Z 3KLNA 2HU9A 2LREA 3F8FA 1T8IA 3LSKA 4XLHA 3DFGA 3GUDA 1JJ6C 2HOTA 1R7JA 3QWLA 1J75A 3K69A 4ZDOA 3U2RA 1S5LC 3JW4A 1ZH5A 4BL0B 5LGNA 2IVMA 5J1UA 3TP3A 4ZTJA 1HCRA 3IWFA 3HPHA 4U0YA 2N8GA 3C3WA 2X4HA 4LITA 2CQKA 2X6WA 4RGXA 3M8JA 2MC4A 3E6BA 4ZYAA 3WG7H 2EV5A 3K9TA 1VQLI 1I6XA 4I0AA 2XGXA 2ZMEB 5HS9A 1P2FA 1MJ9A 3DXJF 1IJWC 1F43A 3GBGA 2K4BA 4ENJA 3CP8A 2R0QC 3FIWA 3P9CA 3QYBA 5D8LB 5B5EC 4PK4A 2H27A 1PDNC 3ZQFA 4RM2A 3BJ6A 1IXCA 1UZCA 2EFQA 3PFIA 5FD5A 5ILUA 2HQRA 3FMQA 3WTZA 3FM5A 1U9NA 1T2KA 1FWZA 3HUGB 1W5SA 1JTXA 5FLXZ 3NQOA 2RQQA 4G9YA 4ENMA 3GO5A 1E3OC 3WGGA 2OUMA 4XONA 4C3IJ 3VSKA 2VKVA 2MW8A 2DA2A 1WCMJ 2EPFA 3TMOA 1IC8A 1GVJA 1ZRCA 3BG7A 3PJRA 2LKSA 2XGDA 4G6DA 1ETXA 2W1OA 3K4LA 3GLXA 1IN7A 1ZGAA 1B1BA 5H6RA 1KU7A 3CLQA 4RS8A 1USSA 3G3ZA 4J00A 4HV6A 4Z2YA 5BPDA 1JKPC 2E2IJ 5K7FA 3HSRA 1LB2A 3SXYA 2CU7A 2KLOA 3H5RA 4IHVA 3CCVI 5DTDA 2NRAC 3MKLA 5K7ZA 2CQXA 1TWGJ 1QVUA 2CRGA 4BQQA 3OYKA 3RDIA 4BBSJ 1X19A 1FBQA 3RKWA 3KP4A 1X3ZB 5JI6A 5DD8A 2LKXA 1UB9A 1X4OA 2JVGA 2RAEA 3L2RA 3REOA 5BMZA 5J8FA 2JZYA 1MNMC 1Y8QB 2LR8A 3TW6A 2BHYA 4AD9A 3MWMA 3BR5A 5FKNA 3OL3A 1U78A 1KQ8A 2L7MP 3VPRA 5HLHA 2BBYA 1UAAA 1A6IA 1Z0XA 2QCOA 3O8GA 3LSTA 1HC8A 2TDXA 4IQJA 2V6CA 2K02A 2XSJC 2LBFA 2W57A 1F36A 4XNFA 3ZXSA 4HA8A 2P6TA 1GXPA 2CH0A 4M3BA 2K9MA 3W6VA 4IKFA 4B3AA 2BGCA 3OMYA 4XRMA 2HDDA 1MSFC 2E71A 3A01A 3QP6A 4AWXB 4HX8A 3JRAA 2EFWA 3CP2A 4O6JA 1MBFA 4KISA 4BACA 4BQNA 3DLLF 1XGMA 1T0FC 1JTYA 4B48A 1YX5A 2QKMB 4FX4A 5HVQC 3QPHA 1S9HA 4WK8F 3FBIB 3PUFA 1XS9A 1XDSA 3K1NA 2ECBA 3HOYJ 2Y0SA 4KDPA 4ZZLA 2X51A 2IS6A 4L5EA 2JK3A 2DK8A 5IPAA 1LFPA 1B8IB 2YUSA 4UUSB 1K78B 1IO2A 2NOJB 4FE7A 3MAJA 4ZYDA 3T8RA 3ULQB 4LD5A 4WCGA 1Y8RB 4PJLA 3QRFF 4P1WA 3K4BA 3SEZA 4DQ2A 1EH7A 3WTXC 2K4JA 2DYRH 3HGGA 3AG1H 3CO6C 3JTHA 2FMYA 3U1KA 1POGA 1S8NA 4AVPA 2A5WA 5E8IA 5EG0B 3Q5FA 3ECHA 1GXQA 2F6CA 3WE2A 2DQLA 1BBYA 2DPUA 4LLNA 4F91B 3KCCA 2R7RA 5LGUA 1MH3A 1OYIA 2HYJA 2Q0OA 4BE1A 3M07A 4U0VA 1YO5C 1BJAA 3TL4X 4CCKA 3JRBA 4M73A 1R1VA 1T6SA 1IXRC 5L3FA 4C2MJ 4P96A 4HG2A 2JVHA 4LLLA 5B1AH 1WSUA 2XB5A 1WI3A 5LRRA 1OISA 3I3LA 4A3KJ 3IRQA 3ISPA 2VQHA 3PSFA 4BGDA 2UZKA 1YIJI 1BN5A 3BZCA 1H0MA 2RV8A 1O3QA 5FKOA 2X1DA 2QSGX 4A93J 1JUMA 1T08B 4QPOA 3VFZA 1SFUA 4I0BA 3CMYA 1FTZA 1XTAA 2WBMA 4DBQA 4RBOA 5C4XJ 4MO7A 1TLHB 3SHFA 1U5TB 3I64A 4P9FA 2AXLA 1J59A 3JRCA 3ZGKA 2DFEA 1LNWA 3JRIA 1E0EA 4AU7A 1AA7A 2E34A 3E1SA 3ZMVA 1JT6A 2L4AA 5CVJA 2H1KA 4G6QA 5FKMA 1DPUA 1SFEA 4HNVA 1I50J 3SJMA 2QZ8A 1JI8A 1SD5A 2VJ5A 3DPTA 3HOSA 1HKSA 4ZJZA 1EV7A 1IRGA 4JOMA 2OBPA 2MG4A 3F6VA 4F92B 3ASNH 3FXKA 3K2ZA 1YG2A 2ZMEC 3BZ6A 4Y17A 1XSDA 3Q0UA 3HRMA 4RLQA 3CMEI 2I5UA 3FK7A 4A3BJ 1TNTA 2E5ZA 4BXUA 3QYEA 2LP0A 2W84A 2FOKA 3WTUC 2R5ZA 5DM6F 1BW5A 1PUEE 2BVMA 4XSXF 4BU2A 1R1TA 2RNGA 3LAPA 3MKWB 2F5EA 1HW2A 2VOPA 2ZC2A 5GAHJ 3RZDJ 3QP5A 3JRDA 4JX4A 1X1AA 1WPKA 1WJAA 2BEOA 5KK1A 1ZLKA 4C30A 4A6DA 3Q0VA 1HW1A 3VYUB 2OQRA 3H5NA 1MBHA 3T5XA 4CA0A 1R6RA 5H6QA 3GEZA 2BE5F 3HKZA 1VQ6I 3M8FA 1IUYA 1SD6A 4G8XA 3KE2A 3K7AJ 1FY7A 3I4MJ 5BQTA 1MBEA 3DF8A 1G3TA 3ZMUA 2HTSA 5D8KB 4GO1A 5E3MA 5LLQA 4NB5A 4A3MJ 1WJ5A 2NOGA 4IRGA 3J81K 3RKYA 1HF0A 4MFEA 2PQ8A 4DYQA 1FYLA 3OYNA 1PYVA 3E3VA 3NAUA 2Z2SB 2RGVA 3KP5A 3D0SA 1IGNA 4HNTA 2V1DA 4WXHA 1Z05A 2MLKA 4XN3A 3CC4I 2E36A 1MJBA 4ETSA 3KP7A 1Z67A 1IXSB 2EFOA 5IP9J 1OCZH 2QEXI 4B8XA 3DKWA 1IN5A 1UFMA 4QPQA 1BR2A 5E18F 1B9NA 1U0JA 1GV2A 5EZGA 1UHWA 2CQNA 1HDPA 2TRTA 1YW7A 4UUTA 2VB6A 1DUXC 3CTAA 4LMYA 5LHGA 1O4XA 4KYWA 2IA2A 4XLNF 1PUFA 3M9AA 2DDAA 2W48A 1WH5A 1OCOH 2VBWA 2H6BA 1JHFA 1XSVA 3PO2J 4LG0B 4BE2A 5FLXK 5J3LA 1UG0A 3PIPF 2L9NA 2ZFWA 3W3CA 3SFZA 3G1OA 5LD2C 3GFJA 1H88C 1YIOA 3OYMA 4J19A 3GVAA 2FNAA 2PMUA 2IW5A 3TEDA 1I27A 4F7ZA 2L5QA 2YU9J 1LFUP 3MQ0A 2RVCA 4J01A 1VF9A 1KONA 3PSIA 3BR2A 2IS4A 1OYYA 1OQYA 1ZRDA 1FNNA 3BJOA 1GT0C 1XCBA 5GADJ 4QWQA 1MBJA 3WGHA 4WWCA 2OC6A 1BI3A 2GWRA 4ZC3A 1HSTA 2HQAA 1F4KA 2X1EA 1HA8A 2WADA 3WHBA 1OYWA 2XSDC 3NWSA 1S3JA 3ERED 1D8JA 2YU3A 4JQFA 3BT9A 3DTIA 3LL7A 1TTYA 1Z77A 3L2UA 6PAXA 3E97A 3WE3A 2HKXA 2PFBA 4BHBA 1T95A 2KT0A 2KRCA 1MW7A 3PM1A 4BY7J 2IP2A 2IA0A 4MTDA 4X0GA 5GTHC 3PQJA 2OPTA 3KEQA 1G4DA 3BWGA 1XGOA 1IN8A 5DCMA 1I3QJ 4HQEA 3BG5A 3HXLA 2M30A 4RAYA 3S3OA 2XKPA 2KMUA 2B9SA 2COBA 2L7KA 4C2UA 4YEJA 3VDXA 2OF7A 2LRDA 5F27A 1QZZA 4HLXA 3N4MA 1G3SA 1W4MA 5IT3A 2XRLA 4PJNA 4PFPA 3X2QH 4C2TA 2F4IA 1U5TC 3FXJA 1FC3A 4UNOA 1IW7F 5EEGA 5CVIA 2BXYA 2XASA 2DODA 4CYDA 3D5LA 4RB2C 1ITYA 3ELKA 3QPTA 4XR6A 1YJ9I 3E6MA 4JP0A 2L9SA 4ENNA 2OTLI 2Y69H 4CCMA 2HS5A 1K83J 3HTSB 2JWTA 3CC7I 2KFDA 3RYPA 1GDTA 3A2KA 4F93B 5TRDA 4HSRA 2X85A 3HOZJ 4IF4A 2EFNA 2Y75A 2DFHA 4ZZDA 4RLFA 1J09A 2EK5A 2HOAA 4BAYA 2X6XA 2BY2A 1PP7U 1FMVA 2VPRA 1KQ0A 4I7HA 4D1QA 2ZXJA 4B43A 1HLVA 4EJWA 3KX2A 4XLFA 4L0YB 5LEKA 4G6TB 2R4GA 3LA2A 2W25A 1XN7A 3RKQA 2HYFA 2IBDA 2W82A 1TWHJ 2DTRA 3OYHA 5EGOA 1X3UA 3CMAI 4FASD 4A3FJ 2LLKA 3AFHA 3RTRA 2WWYA 1BC8C 3CCYA 3LQQA 2LY2A 1IF1A 3QYFA 4A2UA 2HPIA 4RB0A 1OMIA 3IH4A 2L54A 4RDUA 3LSIA 4HF1A 1ON1A 1OLTA 4EJVA 5EF6A 4DOZA 2ZNYA 2E1CA 3ZMTA 4A3CJ 3HGYA 4OIRF 1OJLA 2DFFA 3BR1A 2CWEA 1XDUA 1RZ4A 4H0EA 3MZYA 3IWZA 4F3QA 1FMWA 2A05A 4L5IA 3OYFA 2O6GE 3JREA 1BR4A 4JK1X 2CFXA 1RRJA 3KYCB 1VQMI 1N77A 1X1DA 1OR7C 3F8BA 2FJ1A 1AOYA 2M1BA 3HL2A 2RN7A 2V26A 4II3A 3CCUI 1ACIA 1X1CA 1B4AA 4MFDA 2IS2A 4PSWA 2A68F 3AG3H 3S3MA 3ML6A 3RKXA 3BLYA 1WJFA 4U7BA 1AKHB 2ZJRF 3ERMA 3LA3A 2GA2A 3BTLA 1SVOA 5E79C 2YR2A 3W6KB 2VLAA 1QVTA 4EGZA 3PNVA 2EIMH 3CJQB 3HOXJ 4IXAA 2R7VA 2VQCA 2FSWA 2Y48A 4I76A 4KNYA 4M72A 2P5LC 2V9KA 3OL4A 3SFIA 1QHGA 3H92A 2RQPA 1P7IA 2Z5UA 3WODF 1LEAA 2PMZN 4ESFA 3JRHA 5L3GA 3K0LA 3G6EI 2MD5A 2LNBA 3HJEA 2XHKA 1APLC 1R5GA 2PI0A 5CKTA 2WAQA 3CJRB 5ICGA 3RQ4A 5L3EA 2J5OA 3G1MA 2E1NA 1JHHA 2VPLA 1W5TA 5GP9A 1LVKA 4F55A 3LSJA 5BOXA 4C3HJ 2JA7J 1ZG3A 4UB6C 3K6GA 3I4NJ 1MMSA 3T8TA 4NC6A 2VXDA 2FOWA 3C1DA 5DEQA 1LQ1A 1A04A 1HDDC 4IZZA 3ABUA 1D3YA 1AHDP 2HDCA 4DJAA 2M0CA 1Z7LA 2OCEA 4BE0A 3PNTA 1JT0A 3S2DJ 2Z99A 4IHXA 1BI2A 3DEUA 1J9IA 1YOVB 3DBRB 3J7AO 3N97A 4X6AJ 2Z33A 2AQEA 3ESWB 4CYCB 1U3EM 3ZQCA 3OYAA 1ETKA 2LG4A 1W36D 4EEFG 4P9UA 4CDGA 2I8DA 2DCEA 4XKWA 4Y4RA 3PNYA 4P55A 1QHHD 2BY3A 3HPGA 2KIFA 4IL6C 1TQMA 4GGGA 4GDFA 2XDVA 2FBKA 3MKYB 2UV1A 2MD0A 3MMYB 3ASOH 5FKKA 4HF0A 5EEHA 5ICFA 5ILSA 2IGKA 4PFOA 4D7MA 5GAEJ 3B02A 4E7SA 2H1LA 3FXLA 5IT9Z 2MFZA 3ABTA 4JYKA 2G9WA 1MDMB 3SZTA 2GM4A 4DYCA 1BM9A 1NG6A 3R61A 3L2VA 2X0LA 3R0JA 1TW2A 1MMDA 4ZH4F 1UCRA 1A36A 1D1BA 5KCMA 2VE9A 2P4WA 4FTHA 4I09A 2MBFA 3ZCOA 3KP3A 2JA6J 4KT6A 4O3MA 5ILVA 3HZJA 5M5XJ 5HS7A 4OIQF 2M34A 4M71A 4BXFA 4IHSA 2IPQX 1XD7A 4GYIA 2L7FP 3RSNA 3O6BB 3FXQA 2MSYA 3QU6A 3GTQJ 4AC0A 2GOXB 2PN6A 2W24A 2YSRA 3COAC 3LA7A 2GOMA 1XCVA 3ABMH 4NDLA 2JA5J 2HZDA 3CC2I 1JXSA 3CO7C 1VQ5I 3K4KA 2CMPA 4M9SA 2LBFB 4OIPF 1MD0A 2R7OA 4BHPA 3ZN0A 1QPIA 3TW7A 2FD5A 1T0FA 1Z7UA 3HSEA 5BS6A 2Z3YA 2A6EF 4M6XA 4XQFA 4HW0A 2KRHA 3BPXA 4DZJA 5FD6A 3ABLH 3LFUA 1ZR2A 3I59B 4BBRJ 2A5YB 3JR9A 1IV6A 4LLGF 3FHNA 5KAIC 1U8RA 3F22A 2D45A 3A03A 2JUCA 1OCPA 1NK2P 1FJLA 2XKOA 2HEOA 4LG3A 4IEJA 2VN2A 2AO9A 1KU9A 2EZLA 2KL4A 1G8XA 4WXCA 3OS1A 2RREA 2IA1A 2WA0A 2VJIA 4PJMA 3ZQ7A 2CFOA 5HODA 5F1RA 3G1LA 1N75A 3FX3A 3C2BA 3BPVA 2XAQA 2ZXWH 2DOFA 3GYHX 2A69F 4KFCA 1ZN2A 2MYSA 2VXZA 3S17J 3F3XA 4HZFA 2KZVA 4AYBA 2L7ZA 4HSTA 1KU3A 1R4NB 3DTEA 2CV0A 2NVXJ 3MKZA 2NS7A 3K1PA 3QOEA 5AIPA 5EDNA 4RB1A 4HAMA 1SD7A 2QBYB 1BC7C 4I99C 4HDVA 2VBYA 4BDZA 4Q48A 1X2NA 3K4JA 2XAUA 3JSOA 3NARA 3H0GJ 4C9YA 2IT0A 2LH9A 1R49A 3P5JA 4NQWA 1TC3C 3J7YJ 1LEBA 2ESHA 3PFYA 2MH9A 2FNPA 4DW6A 1W7PA 3M1CA 1RI7A 2DA6A 5LHHA 4CO8A 5JR3A 3FXRA 2LK2A 1RUOA 2FQ4A 2HNHA 3ZR8X 2NS8A 3SZGA 3TO7A 1WJEA 2KISA 1BOAA 2NVYJ 2OA4A 4BHCA 4KUMA 4E7LA 2DA5A 1JJ8C 1QGPA 2BW3B 4D9JA 1WHUA 2DMUA 2I10A 9ANTA 3WU2C 2VUMJ 2F4MB 3HOUJ 2OCCH 2ZMEA 2V7FA 4JBAA 4CSWA 3IKVA 5LHIA 1YTYA 3LFKA 1P7JA 1ON2A 3BCBA 1BIBA 1MBGA 3IH2A 3OYEA 4N9IA 2DMTA 4JX6A 3V42A 2PJRA 3OOUA 2W85A 1I3AA 2AXTC 4ESJA 1SFOJ 1SANA 3M8EA 4G7OF 2O03A 1ETQA 2YX4A 4EJUA 2MC3A 3HUGA 4UB8C 4YIIA 5IOYA 5C44J 3BROA 3W2AA 2E7XA 2VL8A 2DT5A 4LIUA 3JAMZ 2Z16A 4RAGA 1JUPA 2L9VA 2KQRA 2XV4S 4I01A 1K79A 2EB7A 2K5CA 2CW8A 4HQMA 2A6TA 2Y0SN 5E3LA 3PIOF 1D0XA 3A0BC 2XROA 3SDBA 2DJNA 3S93A 4BJ5C 5DUKA 5HNFA 4AVZA 3IV5A 3RPUA 1Q1HA 3BTCA 3KYDB 3OV8A 2R7SA 2QKLB 3ECOA 4RGUA 3ONQA 3S2HJ 4ANJA 1G3WA 1YX3A 2LSOA 4BDYA 2E1MB 2CUEA 4A3DJ 1ZK8A 1ZREA 2DA7A 3GTJJ 2QYOA 2XRNA 3HG9A 3WTTC 2LTPA 1GUUA 5CVRA 2LY1A 3GCMA 2VKHA 4HRIA 4ZDLA 2HXOA 5J4YA 2VASA 4OU0A 3DKXA 2ELJA 5DCFA 3TOAA 4RAFA 1D0ZA 1FOWA 2VOOA 2F5FA 2M0MA 4GCVA 2K3FA 2WB1A 1IAWA 1R22A 1RNLA 2OAZA 3RI4A 2F5CA 2LF7A 2QQ8A 2YPRA 3K70D 4N4OB 4FCYA 4KIFA 1A35A 2W4SA 3GXOA 1KYZA 1P9QC 3JCUC 3IC7A 1O3SA 2VT3A 2KDOA 1DP7P 3DEWA 2KP6A 2JPCA 3P7NA 3WG9A 4Y3OA 2F5VA 4WX9A 2M8GX 2R5YA 3CQZJ 2YX7A 1FIPA 4R8HA 3G2BA 3CCLI 2L3DA 3TP0A 2EBIA 4L9NA 1KU2A 4PZJA 2B7EA 3E0JB 3OR1C 2G7UA 3H3UA 2HVRA 2BXZA 3Q0WA 5HDNA 4QSHA 5LFAA 4BY1J 2QF7A 5M3FJ 3L2QA 4MGRA 1IRXA 2ZSHB 3H9JA 4M3EA 4OINF 1MGTA 2ETHA 1BI1A 1ZGJA 2K9QA 1SVLA 4M3DA 3S2WA 1B8IA 3OYBA 3S15J 4UUSA 1I5ZA 3OIQA 1RIOH 1SMTA 4YFXF 1JGSA 5J47A 1OFCX 1PJRA 1MMAA 5DUIA 2R92J 2HFHA 3ZRGA 5HDKA 2JA2A 2L01A 1E3PA 4KICA 4HF2A 2F4OB 2XIGA 4EM2A 4HNUA 3ZQGA 2BOLA 2QGUA 2O7OA 1P4XA 3FXOA 5IT9K 2CUZA 5IY5H 2WAFA 4NHJA 1ZAOA 5D5UB 2NXNB 5EG0A 1SEUA 1EH8A 1D0YA 4PJ0C 3RCOA 2B63J 1K6OA 2BHZA 4OMYA 3FM3A 3F0CA 4Q4ZF 1JKQC 3HKZN 4A0YA 4LFUA 3HRUA 2QLZA 2FUG2 4MQVA 2NAZA 1R23A 1ETYA 2ZFUA 3DBLB 1KZHA 2KDZA 2HZTA 1A6QA 2EV0A 2XF6A 2K86A 2HVQA 2HR3A 4PGGA 5CYVA 2VBZA 3FMSA 4R1HA 2DAOA 1STZA 1XC5A 4M6YA 1XSXA 1LE8B 1D8KA 1H89C 4MLOA 2P8TA 1U5TA 3KETA 4YIFA 1F1ZA 4FISA 4KIBA 2EQRA 4XKBA 2IJLA 2PBIA 3KFWX 1ZHFA 2EA4A 5CJ9A 4Y7NJ 2DU9A 2CS3A 5L3BA 3ZMSA 2FA5A 2FU4A 2G7HA 3VODA 4IVNA 5K5QA 1FOKA 3GLLA 3A4CA 3CUOA 1WJBA 2DOAA 2O5RA 3K4NA 3CCSI 1VTNC 2Z9OA 2FQ3A 4XLPF 4M3GA 4HX7A 2CQQA 3VB2A 2A61A 2E7WA 5LRSA 1QBJA 5IYDJ 4MHGA 1YW9A 2NYXA 4R79A 1V55H 5AONA 2ZJQF 2COMA 2K9SA 2VI6A 3D5RC 2HOSA 2O0YA 4Z6YA 4IHWA 1FLIA 2QVOA 3F6OA 2M9HA 3SEQA 3F72A 1VQ7I 1OCRH 1P4WA 3QOPA 1DU6A 1WVRA 3OY9A 4IPAA 5J1RA 3IAS2 2W00A 1IZ1A 2Y30A 1TWFJ 2V1NA 1YJNI 4UVAA 2KJBA 1WRJA 2PG4A 2H8WA 2DMQA 2M45A 3WTSC 1YRNB 3GTMJ 4EVIA 2K9NA 3UR3C 2K85A 4ZYGA 4G94A 1Y56A 3D1NI 4HPQA 3BR6A 4A3EJ 1MNEA 1QU3A 1O7LA 1U6GA 1HW5A 1HSJA 3OYDA 1UMQA 2O8KA 2ZXIA 3EUHC 3EYIA 2ISYA 5HNHA 2RNJA 2HWVA 1K6YA 1KQ9A 1OR7A 3ZQIA 3WU1B 2JRMA 3DQVC 2D5VA 4HLYA 1XGSA 1Z3XA 1LUJB 2Q2EB 3ZMDA 1WZ2A 4BEHB 1RETA 1AU7A 2PEXA 3CDHA 3OIOA 5LBQA 5H2FC 5FKLA 4Q47A 5F64A 2JT1A 4XN0A 1J5YA 1WWXA 4W1UA 1FZPB 1V54H 4PCQA 3C2HA 3CUQB 3UNGC 2P7CB 3HOTA 4E7ZA 3I55I 4G7ZF 1VFCA 1VQ4I 3CZ6A 3MD2A 4LB6B 3LNQA 2LC2A 1B72A 4A6EA 4HX4A 1E2XA 3L7WA 4LJZF 1SD4A 3CCMI 2FF4A 3U1DA 3FDYA 4UHTA 2TCTA 2V4JC 4G7HF
chains in the Genus database with same CATH topology
3EQLF 4AIJA 4UVCA 1LJ9A 1B9MA 1ZG5A 2PLYA 4E70A 3FHZA 1RUNA 1I1GA 2DI3A 4LG0A 5A2QZ 2NNYA 1MJAA 4L5JA 3FWEA 3J80Z 3JAMK 1WQ2A 1MKMA 4I02A 4N0BA 2CSOA 1E17A 2ZO4A 1YFHA 2BV6A 4EJOA 2CO5A 3PQKA 4CHUA 4S04A 2C6YA 3TDZC 4AIKA 3MCZA 5JHUA 2R7FA 2OZUA 2L02A 4IRHA 3E5UA 1NHAA 1YS7A 3GF2A 4UXNA 2O61A 4HOBA 2V79A 5ICCA 1XMKA 2HOEA 1R00A 2B0LA 5K5OA 1WKMA 5E1WA 1FSEA 2Q8KA 2FE3A 3R4KA 2F2EA 5ED4A 4KN4X 1FYKA 2V9VA 1CF7A 4HBLA 4A0ZA 1HXDA 2P5VA 3IKTA 2FMLA 3RYRA 4S05A 3VOEA 1HQCA 5F6FA 3BDDA 5ICEA 3E6CC 4EM1A 3KLOA 4ZYHA 2DQRA 1LDDA 2F5DA 2QQAA 3MFKA 1R5HA 2QUFA 1YQAA 4PDKA 3GZ5A 4AIHA 5E17F 4M74A 2D1VA 4HV5A 3L2CA 1SMYF 4TV7A 2D1HA 1KGSA 3B73A 3QAHA 5CVVA 1W7PD 1CGPA 3TO9A 3ZPLA 1S7OA 4Y15A 4L0ZB 3GW2A 1ZRFA 3K1MA 2RC4A 2UXNA 2HKOA 3HSFA 2XAHA 2LKPA 4L18B 3LQRA 1U2WA 2ELHA 2P5KA 4QLCU 4A5MA 3ZP5A 1Z6TA 1H9GA 4ESBA 3G73A 3MZHA 1FPQA 1XGNA 3TO6A 1F5TA 4LB5A 2OQGA 4FX0A 1I1SA 1SAXA 3FF5A 3LAJA 2P7VB 1KYWA 2VE8A 4KIGA 4MNUA 3FMRA 5L3DA 5D5WB 3E6DA 1ZYRF 1DDNA 3F8CA 1ULYA 3CUQC 1V3FA 4XSZF 4CZZA 2LF8A 1LVAA 3EETA 3TKYA 4GYGA 4K2EA 4U0WA 1W7PB 3V8LA 3NRVA 3R0AA 2MA3A 2GA1A 4B09A 3I71A 4FT8A 4KA4A 2QQBA 5DDGA 5E1ZB 2PJPA 3F8NA 3BJAA 1R58A 5D5VB 1AWCA 2XUBA 4KMUX 1LDJA 1D5VA 3HTUA 5J6XA 4EGYA 5LEJA 3I4PA 3TDUC 2OZ6A 3Q9VA 3R6SA 2DFIA 1OPCA 4EV0A 3TQNA 1HBXG 3C18A 4L9TA 3GFMA 4ENKA 3DP7A 1MDMA 3IRRA 2A6HF 3SZPA 1G3YA 3T1BA 3P9IA 1SFXA 1T39A 5K5RA 3DV8A 3NEUA 4HDUA 3CLOA 4RGRA 2NNNA 5JFRA 5A2QK 3KEOA 2D2WA 3J80K 1USTA 3SQNA 4MEXF 3C7JA 2ZNZA 5J8CA 2DPDA 3BY6A 3MEXA 1P6RA 2QENA 1WI9A 5CLSA 2UXXA 2HQNA 3IHUA 3L09A 5K1YA 1REPC 1R36A 5D6FA 2WTEA 2EFPA 4YG2F 3I59A 2QM3A 5E8GA 4KMFA 2DLLA 4OIOF 4M9ZA 1IN6A 2P6SA 2PMHA 2JRTA 2MH2A 1YYVA 2ADUA 4RGSA 1J0RA 2KRFA 4BQAA 3WGIA 2VT2A 1T38A 2ZKZA 4GXOA 2DO7A 2DK5A 3U9GA 2M5WA 3WU0A 1TBXA 1S7AA 4WF2A 2QBYA 3CJNA 1BIAA 4HYEA 4BH9A 3GZ6A 5FO5A 3ZMZA 5HLGA 5BPIA 5TJJA 4A12A 1MZBA 3F8MA 3HRSA 5KVRA 1P4AA 3WTVC 2EJRA 5DD4A 3L9FA 4BNCA 2DW4A 2GIVA 3M7GA 1Z9CA 1TNSA 1OKRA 4A0XA 1H9TA 4PGHA 1K78A 2FRHA 1QO0D 1KA8A 1F9NA 1B6AA 1FYMA 1S6LA 2BYVE 1C0WA 2A07F 3HHHA 3QU3A 4WXDA 1BI0A 5JVTA 4UV8A 1TQIA 2O8XA 2VBXA 2FXAA 2AS5F 3EUHA 1L0OC 2CYYA 2XAJA 4A5NA 1QQIA 3V8JA 2GAUA 1XB4A 4MQ9F 1Z1DA 1HKQA 3HRTA 4XRFA 3F23A 1FX7A 3LWFA 4U88A 4XBFA 2M8EA 2J5PA 2ZJ2A 4M9XA 5DCMB 1GHCA 2EV6A 5D4RA 1O7FA 1QPMA 4KN7X 2STTA 5HDGA 1QNTA 2HGCA 2QQ9A 2XAFA 3IL2A 3OOPA 3ROUA 4O5VA 4CGZA 1EH6A 2OD5A 4D0PA 3RIRA 1L3LA 2CW0F 2FBIA 2MLGA 1P92A 4KT5C 1O57A 5E20A 3GWZA 1Z91A 2V1XA 4U7DA 3Q9SA 2M87A 4OOIA 4LK1F 5HS8A 4L9VA 3EDPA 1TW3A 3E5QA 5H20A 4RAZA 4UUVA 1HKTA 3GX4X 1FP2A 1ZLJA 1FSHA 3TOBA 2RDPA 4L9JA 3JTGA 3V7RA 2K27A 3O3KA 3I54A 4DNCA 4CXFA 2KIUA 2ISZA 4EQQA 3V7SA 2STWA 5D5XB 2R3SA 3DPLC 5LGTA 4N9HA 5E1XA 1K7AA 2FEZA 3HIFA 3RJPA 1YLFA 3BOQA 3V4GA 3T0YA 3F21A 1V4RA 2ZBKA 3KP2A 4I98B 5HLIA 3E5XA 3RPQA 3I53A 1CF7B 4IHTA 4ZYEA 2ACJA 1QZYA 3FXUA 3H3ZA 1FT9A 3M1EA 3KP6A 2A3SA 4LK0F 4EJTA 5ERIA 2VONA 2V1UA 2H94A 2EWNA 1DPRA 1FBUA 1R1UA 2XVCA 2KIMA 4BYYA 1O3TA 3FZVA 3O2PE 3I0TA 4IRIA 1XMAA 5DYMA 4FHTA 2WC2A 2WV0A 3WTYC 2ZCWA 2KKOA 2JSCA 1YW8A 3V7CA 4UV9A 2UWMA 4UVBA 2GQQA 3ZN1A 3GFLA 5L3CA 1LDKB 2O3FA 3W6JB 2XAGA 3WTWC 2QWWA 2HTJA 2K7LA 2DBBA 2EA2A 5D6EA 1JE8A 2FBHA 3HYIA 4Q5SF 4MTEA 3TGNA 2JPBA 3I58A 4YFKF 1ONVA 2JTVA 2GZWA 2H6CA 1O3RA 2H09A 2Q2EA 5DV5A 2IRFG 2R7DA 3KZZA 3CUQA 2ESNA 4LGWA 2GXGA 1IN4A 5CVUA 1YS6A 3JSPA 1ODDA 5FGMA 2L4MA 3EYYA 2LDUA 5D4SA 2NS0A 4CICA 1FBSA 3KZYA 4Y13A 1UHMA 2HYGD 1B59A 2GXBA 2RKHA 5FFZA 4ASNA 4RB3C 4EMSA 1J7KA 4EM0B 2VC1A 1J2XA 1Y0UA 4MEYF 1G6NA 2VODA 5HOOA 3AAFA 2OU2A 1FP1D 3HHGA 2Y0MA 4YFNF 3L00A 2CGPA 2KJCA 1ZG1A 2CG4A 4IJAA 5AIQA 1PP8F 3R60A 1S29A 2VC0A 3BP8A 3I5UA 1IRFA 3V8KA 3VEPA 1ZARA 1T98A 4ON0A 5FFXA 4I2OA 3P9KA 4OMZA 5FB2A 4P5OA 1Z6RA 3GFIA 1TQPA 3J81Z 3KLNA 3F8FA 3DFGA 3GUDA 1R7JA 1J75A 3K69A 3U2RA 3JW4A 1ZH5A 5LGNA 2IVMA 3IWFA 4U0YA 3C3WA 2X4HA 2CQKA 4RGXA 3E6BA 2EV5A 3K9TA 1I6XA 4I0AA 2XGXA 2ZMEB 5HS9A 1P2FA 1MJ9A 3DXJF 2K4BA 4ENJA 3P9CA 5D8LB 2H27A 1PDNC 3BJ6A 1IXCA 3PFIA 2EFQA 5FD5A 5ILUA 2HQRA 3FMQA 3WTZA 3FM5A 1T2KA 1FWZA 1W5SA 5FLXZ 3NQOA 4G9YA 4ENMA 3GO5A 3WGGA 1GVJA 1ZRCA 4G6DA 5H6RA 3GLXA 1IN7A 1ZGAA 1B1BA 1KU7A 4RS8A 1USSA 3G3ZA 4HV6A 4Z2YA 5BPDA 3HSRA 1LB2A 3SXYA 2NRAC 3RDIA 1FBQA 3RKWA 3KP4A 5JI6A 5DD8A 1UB9A 3REOA 5BMZA 5J8FA 2JZYA 4AD9A 3MWMA 1U78A 1KQ8A 5HLHA 2BBYA 3LSTA 2TDXA 2V6CA 2K02A 2W57A 4HA8A 2P6TA 1GXPA 2BGCA 3QP6A 4AWXB 4HX8A 2EFWA 4O6JA 1XGMA 4FX4A 5HVQC 3QPHA 4WK8F 1XDSA 3K1NA 4KDPA 4ZZLA 2DK8A 1K78B 3MAJA 4ZYDA 3T8RA 3ULQB 4LD5A 4WCGA 3QRFF 4DQ2A 1EH7A 3WTXC 2K4JA 3CO6C 3JTHA 2FMYA 1S8NA 4AVPA 5E8IA 3Q5FA 3ECHA 1GXQA 3WE2A 2DPUA 2DQLA 1BBYA 4LLNA 3KCCA 5LGUA 2Q0OA 1OYIA 1YO5C 4U0VA 1BJAA 4M73A 1R1VA 1T6SA 1IXRC 5L3FA 4P96A 4LLLA 1WSUA 5LRRA 3IRQA 3ISPA 2UZKA 1H0MA 1BN5A 2RV8A 1O3QA 1SFUA 3VFZA 4I0BA 1TLHB 3SHFA 1U5TB 3I64A 4P9FA 2AXLA 1J59A 1LNWA 3ZMVA 2L4AA 5CVJA 4G6QA 1DPUA 1SFEA 2QZ8A 1SD5A 3DPTA 3HOSA 1HKSA 1EV7A 1IRGA 2OBPA 3F6VA 3K2ZA 1YG2A 3BZ6A 4Y17A 1XSDA 3HRMA 1TNTA 4BXUA 2W84A 2FOKA 3WTUC 1PUEE 4XSXF 1R1TA 2VOPA 3LAPA 1HW2A 2F5EA 3QP5A 2BEOA 5KK1A 1ZLKA 4A6DA 1HW1A 2OQRA 3T5XA 5H6QA 3GEZA 2BE5F 1IUYA 3M8FA 1SD6A 4G8XA 3KE2A 1FY7A 5BQTA 3DF8A 1G3TA 3ZMUA 2HTSA 5D8KB 4GO1A 5LLQA 4NB5A 4IRGA 3J81K 3RKYA 1FYLA 2PQ8A 3E3VA 2RGVA 3KP5A 3D0SA 2V1DA 4WXHA 1Z05A 2MLKA 1MJBA 4ETSA 3KP7A 1IXSB 2EFOA 4B8XA 3DKWA 1IN5A 1UFMA 5E18F 1B9NA 1UHWA 1YW7A 1DUXC 3CTAA 4LMYA 5LHGA 4KYWA 2IA2A 4XLNF 3M9AA 2VBWA 2H6BA 1JHFA 1XSVA 4LG0B 5FLXK 2ZFWA 3SFZA 3GFJA 1YIOA 3GVAA 2FNAA 2PMUA 2IW5A 1I27A 4F7ZA 3MQ0A 2RVCA 1OYYA 1ZRDA 1FNNA 3BJOA 1XCBA 4QWQA 3WGHA 4WWCA 1BI3A 2GWRA 1HSTA 1F4KA 1OYWA 1S3JA 3ERED 1D8JA 2YU3A 4JQFA 1TTYA 6PAXA 3E97A 3WE3A 2HKXA 2PFBA 4BHBA 2IP2A 2IA0A 4MTDA 3PQJA 3KEQA 1G4DA 3BWGA 1XGOA 1IN8A 5DCMA 4HQEA 2M30A 4RAYA 2XKPA 1QZZA 4HLXA 3N4MA 1G3SA 1W4MA 5IT3A 1U5TC 1FC3A 4UNOA 1IW7F 5EEGA 5CVIA 2XASA 4CYDA 4RB2C 3D5LA 3ELKA 3QPTA 3E6MA 4ENNA 2HS5A 3HTSB 3RYPA 5TRDA 4IF4A 2EFNA 2Y75A 4ZZDA 2EK5A 4BAYA 1PP7U 1KQ0A 4I7HA 2ZXJA 4EJWA 4L0YB 5LEKA 3LA2A 2W25A 1XN7A 2HYFA 2DTRA 1X3UA 2WWYA 3RTRA 1BC8C 1IF1A 3LQQA 4A2UA 4RB0A 1OMIA 2L54A 4HF1A 1ON1A 4EJVA 2ZNYA 2E1CA 3ZMTA 4OIRF 2CWEA 1XDUA 1RZ4A 4H0EA 3MZYA 3IWZA 4L5IA 2O6GE 4JK1X 2CFXA 3F8BA 1AOYA 2M1BA 2RN7A 1B4AA 2A68F 3ML6A 3RKXA 4U7BA 3LA3A 2GA2A 3W6KB 4EGZA 2YR2A 4IXAA 2FSWA 2Y48A 4KNYA 4M72A 2P5LC 3H92A 2RQPA 2Z5UA 3WODF 1LEAA 4ESFA 5L3GA 3K0LA 2MD5A 2LNBA 2XHKA 1R5GA 2PI0A 5ICGA 5L3EA 2J5OA 2E1NA 1JHHA 1W5TA 5BOXA 1ZG3A 3T8TA 3C1DA 5DEQA 1LQ1A 1A04A 3ABUA 1D3YA 2HDCA 2Z99A 1BI2A 3DEUA 1J9IA 3J7AO 3N97A 2Z33A 1U3EM 4P9UA 4CDGA 4P55A 2KIFA 1TQMA 4GGGA 2FBKA 4HF0A 5EEHA 5ICFA 5ILSA 3B02A 5IT9Z 3ABTA 2G9WA 1MDMB 3SZTA 1BM9A 3R61A 2X0LA 3R0JA 1TW2A 4ZH4F 1UCRA 2VE9A 2P4WA 4I09A 2MBFA 3KP3A 4O3MA 5ILVA 5HS7A 4OIQF 4M71A 4IHSA 2IPQX 1XD7A 4GYIA 3O6BB 3FXQA 3QU6A 2PN6A 2W24A 2YSRA 3COAC 3LA7A 1XCVA 1JXSA 3CO7C 4M9SA 4OIPF 1MD0A 4BHPA 3ZN0A 1T0FA 1Z7UA 3HSEA 5BS6A 2Z3YA 2A6EF 4M6XA 4HW0A 5FD6A 3BPXA 3I59B 2A5YB 4LLGF 1U8RA 3F22A 2D45A 2XKOA 2HEOA 2VN2A 1KU9A 4WXCA 2IA1A 3ZQ7A 5F1RA 3FX3A 3BPVA 2XAQA 3GYHX 2A69F 4KFCA 1ZN2A 2VXZA 3F3XA 4HZFA 1KU3A 3K1PA 5AIPA 4RB1A 4HAMA 1SD7A 2QBYB 1BC7C 4HDVA 2VBYA 4Q48A 3JSOA 2IT0A 4NQWA 1LEBA 2ESHA 2MH9A 2FNPA 1W7PA 1RI7A 5LHHA 4CO8A 5JR3A 3FXRA 1RUOA 3TO7A 1BOAA 2OA4A 4BHCA 4KUMA 1QGPA 2ZMEA 4JBAA 3IKVA 5LHIA 1YTYA 3LFKA 1ON2A 1BIBA 4N9IA 2W85A 4ESJA 3M8EA 4G7OF 2O03A 2YX4A 4EJUA 2MC3A 3HUGA 4YIIA 3BROA 2E7XA 2DT5A 3JAMZ 1K79A 2XV4S 4I01A 2EB7A 4HQMA 2XROA 5DUKA 3RPUA 1Q1HA 3OV8A 3ECOA 4RGUA 1G3WA 2LSOA 1ZREA 2QYOA 2XRNA 3WTTC 5CVRA 4OU0A 5DCFA 3TOAA 2VOOA 2F5FA 1IAWA 4GCVA 1R22A 1RNLA 2OAZA 3RI4A 2F5CA 2LF7A 2YPRA 4KIFA 3GXOA 1KYZA 3IC7A 1O3SA 2VT3A 1DP7P 2JPCA 3P7NA 3WG9A 4WX9A 2YX7A 4R8HA 2L3DA 4L9NA 1KU2A 4PZJA 2G7UA 3H3UA 5HDNA 4MGRA 4OINF 1MGTA 2ETHA 1BI1A 1ZGJA 3S2WA 1I5ZA 1RIOH 1SMTA 4YFXF 1JGSA 5DUIA 2HFHA 5HDKA 2L01A 4HF2A 4KICA 2XIGA 4EM2A 1P4XA 5IT9K 4NHJA 1ZAOA 5D5UB 1EH8A 1K6OA 4OMYA 3FM3A 4Q4ZF 4A0YA 4LFUA 3HRUA 2QLZA 4MQVA 2NAZA 1R23A 2HZTA 2EV0A 2K86A 2HR3A 4PGGA 5CYVA 2VBZA 3FMSA 4R1HA 2DAOA 1STZA 4M6YA 1XSXA 1D8KA 2P8TA 1U5TA 3KETA 4YIFA 1F1ZA 4KIBA 2IJLA 2PBIA 3KFWX 1ZHFA 2EA4A 5CJ9A 2DU9A 5L3BA 3ZMSA 2FA5A 2FU4A 2G7HA 3VODA 4IVNA 5K5QA 1FOKA 3CUOA 1VTNC 2Z9OA 2FQ3A 4XLPF 4HX7A 3VB2A 2A61A 2E7WA 5LRSA 1QBJA 4MHGA 1YW9A 4R79A 2NYXA 5AONA 2COMA 2O0YA 1FLIA 2QVOA 3F6OA 3F72A 1P4WA 3QOPA 4IPAA 1IZ1A 4UVAA 2KJBA 1WRJA 2PG4A 2M45A 3WTSC 4EVIA 4ZYGA 4G94A 1O7LA 1U6GA 1HW5A 1HSJA 3EYIA 2ISYA 2RNJA 2HWVA 1KQ9A 1OR7A 3WU1B 3DQVC 4HLYA 1XGSA 3ZMDA 2PEXA 3CDHA 5LBQA 4Q47A 5F64A 2JT1A 1J5YA 1WWXA 1FZPB 4PCQA 3CUQB 2P7CB 3HOTA 4G7ZF 4LB6B 4A6EA 4HX4A 1E2XA 3L7WA 4LJZF 1SD4A 2FF4A 3U1DA 4UHTA 4G7HF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EQL F;  4AIJ A;  4UVC A;  1LJ9 A;  1B9M A;  1ZG5 A;  2PLY A;  4E70 A;  3FHZ A;  1RUN A;  1I1G A;  2DI3 A;  4LG0 A;  5A2Q Z;  2NNY A;  1MJA A;  4L5J A;  3FWE A;  3J80 Z;  3JAM K;  1WQ2 A;  1MKM A;  4I02 A;  4N0B A;  2CSO A;  1E17 A;  2ZO4 A;  1YFH A;  2BV6 A;  4EJO A;  2CO5 A;  3PQK A;  4CHU A;  4S04 A;  2C6Y A;  3TDZ C;  4AIK A;  3MCZ A;  5JHU A;  2R7F A;  2OZU A;  2L02 A;  4IRH A;  3E5U A;  1NHA A;  1YS7 A;  3GF2 A;  4UXN A;  2O61 A;  4HOB A;  2V79 A;  5ICC A;  1XMK A;  2HOE A;  1R00 A;  2B0L A;  5K5O A;  1WKM A;  5E1W A;  1FSE A;  2Q8K A;  2FE3 A;  3R4K A;  2F2E A;  5ED4 A;  4KN4 X;  1FYK A;  2V9V A;  1CF7 A;  4HBL A;  4A0Z A;  1HXD A;  2P5V A;  3IKT A;  2FML A;  3RYR A;  4S05 A;  3VOE A;  1HQC A;  5F6F A;  3BDD A;  5ICE A;  3E6C C;  4EM1 A;  3KLO A;  4ZYH A;  2DQR A;  1LDD A;  2F5D A;  2QQA A;  3MFK A;  1R5H A;  2QUF A;  1YQA A;  4PDK A;  3GZ5 A;  4AIH A;  5E17 F;  4M74 A;  2D1V A;  4HV5 A;  3L2C A;  1SMY F;  4TV7 A;  2D1H A;  1KGS A;  3B73 A;  3QAH A;  5CVV A;  1W7P D;  1CGP A;  3TO9 A;  3ZPL A;  1S7O A;  4Y15 A;  4L0Z B;  3GW2 A;  1ZRF A;  3K1M A;  2RC4 A;  2UXN A;  2HKO A;  3HSF A;  2XAH A;  2LKP A;  4L18 B;  3LQR A;  1U2W A;  2ELH A;  2P5K A;  4QLC U;  4A5M A;  3ZP5 A;  1Z6T A;  1H9G A;  4ESB A;  3G73 A;  3MZH A;  1FPQ A;  1XGN A;  3TO6 A;  1F5T A;  4LB5 A;  2OQG A;  4FX0 A;  1I1S A;  1SAX A;  3FF5 A;  3LAJ A;  2P7V B;  1KYW A;  2VE8 A;  4KIG A;  4MNU A;  3FMR A;  5L3D A;  5D5W B;  3E6D A;  1ZYR F;  1DDN A;  3F8C A;  1ULY A;  3CUQ C;  1V3F A;  4XSZ F;  4CZZ A;  2LF8 A;  1LVA A;  3EET A;  3TKY A;  4GYG A;  4K2E A;  4U0W A;  1W7P B;  3V8L A;  3NRV A;  3R0A A;  2MA3 A;  2GA1 A;  4B09 A;  3I71 A;  4FT8 A;  4KA4 A;  2QQB A;  5DDG A;  5E1Z B;  2PJP A;  3F8N A;  3BJA A;  1R58 A;  5D5V B;  1AWC A;  2XUB A;  4KMU X;  1LDJ A;  1D5V A;  3HTU A;  5J6X A;  4EGY A;  5LEJ A;  3I4P A;  3TDU C;  2OZ6 A;  3Q9V A;  3R6S A;  2DFI A;  1OPC A;  4EV0 A;  3TQN A;  1HBX G;  3C18 A;  4L9T A;  3GFM A;  4ENK A;  3DP7 A;  1MDM A;  3IRR A;  2A6H F;  3SZP A;  1G3Y A;  3T1B A;  3P9I A;  1SFX A;  1T39 A;  5K5R A;  3DV8 A;  3NEU A;  4HDU A;  3CLO A;  4RGR A;  2NNN A;  5JFR A;  5A2Q K;  3KEO A;  2D2W A;  3J80 K;  1UST A;  3SQN A;  4MEX F;  3C7J A;  2ZNZ A;  5J8C A;  2DPD A;  3BY6 A;  3MEX A;  1P6R A;  2QEN A;  1WI9 A;  5CLS A;  2UXX A;  2HQN A;  3IHU A;  3L09 A;  5K1Y A;  1REP C;  1R36 A;  5D6F A;  2WTE A;  2EFP A;  4YG2 F;  3I59 A;  2QM3 A;  5E8G A;  4KMF A;  2DLL A;  4OIO F;  4M9Z A;  1IN6 A;  2P6S A;  2PMH A;  2JRT A;  2MH2 A;  1YYV A;  2ADU A;  4RGS A;  1J0R A;  2KRF A;  4BQA A;  3WGI A;  2VT2 A;  1T38 A;  2ZKZ A;  4GXO A;  2DO7 A;  2DK5 A;  3U9G A;  2M5W A;  3WU0 A;  1TBX A;  1S7A A;  4WF2 A;  2QBY A;  3CJN A;  1BIA A;  4HYE A;  4BH9 A;  3GZ6 A;  5FO5 A;  3ZMZ A;  5HLG A;  5BPI A;  5TJJ A;  4A12 A;  1MZB A;  3F8M A;  3HRS A;  5KVR A;  1P4A A;  3WTV C;  2EJR A;  5DD4 A;  3L9F A;  4BNC A;  2DW4 A;  2GIV A;  3M7G A;  1Z9C A;  1TNS A;  1OKR A;  4A0X A;  1H9T A;  4PGH A;  1K78 A;  2FRH A;  1QO0 D;  1KA8 A;  1F9N A;  1B6A A;  1FYM A;  1S6L A;  2BYV E;  1C0W A;  2A07 F;  3HHH A;  3QU3 A;  4WXD A;  1BI0 A;  5JVT A;  4UV8 A;  1TQI A;  2O8X A;  2VBX A;  2FXA A;  2AS5 F;  3EUH A;  1L0O C;  2CYY A;  2XAJ A;  4A5N A;  1QQI A;  3V8J A;  2GAU A;  1XB4 A;  4MQ9 F;  1Z1D A;  1HKQ A;  3HRT A;  4XRF A;  3F23 A;  1FX7 A;  3LWF A;  4U88 A;  4XBF A;  2M8E A;  2J5P A;  2ZJ2 A;  4M9X A;  5DCM B;  1GHC A;  2EV6 A;  5D4R A;  1O7F A;  1QPM A;  4KN7 X;  2STT A;  5HDG A;  1QNT A;  2HGC A;  2QQ9 A;  2XAF A;  3IL2 A;  3OOP A;  3ROU A;  4O5V A;  4CGZ A;  1EH6 A;  2OD5 A;  4D0P A;  3RIR A;  1L3L A;  2CW0 F;  2FBI A;  2MLG A;  1P92 A;  4KT5 C;  1O57 A;  5E20 A;  3GWZ A;  1Z91 A;  2V1X A;  4U7D A;  3Q9S A;  2M87 A;  4OOI A;  4LK1 F;  5HS8 A;  4L9V A;  3EDP A;  1TW3 A;  3E5Q A;  5H20 A;  4RAZ A;  4UUV A;  1HKT A;  3GX4 X;  1FP2 A;  1ZLJ A;  1FSH A;  3TOB A;  2RDP A;  4L9J A;  3JTG A;  3V7R A;  2K27 A;  3O3K A;  3I54 A;  4DNC A;  4CXF A;  2KIU A;  2ISZ A;  4EQQ A;  3V7S A;  2STW A;  5D5X B;  2R3S A;  3DPL C;  5LGT A;  4N9H A;  5E1X A;  1K7A A;  2FEZ A;  3HIF A;  3RJP A;  1YLF A;  3BOQ A;  3V4G A;  3T0Y A;  3F21 A;  1V4R A;  2ZBK A;  3KP2 A;  4I98 B;  5HLI A;  3E5X A;  3RPQ A;  3I53 A;  1CF7 B;  4IHT A;  4ZYE A;  2ACJ A;  1QZY A;  3FXU A;  3H3Z A;  1FT9 A;  3M1E A;  3KP6 A;  2A3S A;  4LK0 F;  4EJT A;  5ERI A;  2VON A;  2V1U A;  2H94 A;  2EWN A;  1DPR A;  1FBU A;  1R1U A;  2XVC A;  2KIM A;  4BYY A;  1O3T A;  3FZV A;  3O2P E;  3I0T A;  4IRI A;  1XMA A;  5DYM A;  4FHT A;  2WC2 A;  2WV0 A;  3WTY C;  2ZCW A;  2KKO A;  2JSC A;  1YW8 A;  3V7C A;  4UV9 A;  2UWM A;  4UVB A;  2GQQ A;  3ZN1 A;  3GFL A;  5L3C A;  1LDK B;  2O3F A;  3W6J B;  2XAG A;  3WTW C;  2QWW A;  2HTJ A;  2K7L A;  2DBB A;  2EA2 A;  5D6E A;  1JE8 A;  2FBH A;  3HYI A;  4Q5S F;  4MTE A;  3TGN A;  2JPB A;  3I58 A;  4YFK F;  1ONV A;  2JTV A;  2GZW A;  2H6C A;  1O3R A;  2H09 A;  2Q2E A;  5DV5 A;  2IRF G;  2R7D A;  3KZZ A;  3CUQ A;  2ESN A;  4LGW A;  2GXG A;  1IN4 A;  5CVU A;  1YS6 A;  3JSP A;  1ODD A;  5FGM A;  2L4M A;  3EYY A;  2LDU A;  5D4S A;  2NS0 A;  4CIC A;  1FBS A;  3KZY A;  4Y13 A;  1UHM A;  2HYG D;  1B59 A;  2GXB A;  2RKH A;  5FFZ A;  4ASN A;  4RB3 C;  4EMS A;  1J7K A;  4EM0 B;  2VC1 A;  1J2X A;  1Y0U A;  4MEY F;  1G6N A;  2VOD A;  5HOO A;  3AAF A;  2OU2 A;  1FP1 D;  3HHG A;  2Y0M A;  4YFN F;  3L00 A;  2CGP A;  2KJC A;  1ZG1 A;  2CG4 A;  4IJA A;  5AIQ A;  1PP8 F;  3R60 A;  1S29 A;  2VC0 A;  3BP8 A;  3I5U A;  1IRF A;  3V8K A;  3VEP A;  1ZAR A;  1T98 A;  4ON0 A;  5FFX A;  4I2O A;  3P9K A;  4OMZ A;  5FB2 A;  4P5O A;  1Z6R A;  3GFI A;  1TQP A;  3J81 Z;  3KLN A;  3F8F A;  3DFG A;  3GUD A;  1R7J A;  1J75 A;  3K69 A;  3U2R A;  3JW4 A;  1ZH5 A;  5LGN A;  2IVM A;  3IWF A;  4U0Y A;  3C3W A;  2X4H A;  2CQK A;  4RGX A;  3E6B A;  2EV5 A;  3K9T A;  1I6X A;  4I0A A;  2XGX A;  2ZME B;  5HS9 A;  1P2F A;  1MJ9 A;  3DXJ F;  2K4B A;  4ENJ A;  3P9C A;  5D8L B;  2H27 A;  1PDN C;  3BJ6 A;  1IXC A;  3PFI A;  2EFQ A;  5FD5 A;  5ILU A;  2HQR A;  3FMQ A;  3WTZ A;  3FM5 A;  1T2K A;  1FWZ A;  1W5S A;  5FLX Z;  3NQO A;  4G9Y A;  4ENM A;  3GO5 A;  3WGG A;  1GVJ A;  1ZRC A;  4G6D A;  5H6R A;  3GLX A;  1IN7 A;  1ZGA A;  1B1B A;  1KU7 A;  4RS8 A;  1USS A;  3G3Z A;  4HV6 A;  4Z2Y A;  5BPD A;  3HSR A;  1LB2 A;  3SXY A;  2NRA C;  3RDI A;  1FBQ A;  3RKW A;  3KP4 A;  5JI6 A;  5DD8 A;  1UB9 A;  3REO A;  5BMZ A;  5J8F A;  2JZY A;  4AD9 A;  3MWM A;  1U78 A;  1KQ8 A;  5HLH A;  2BBY A;  3LST A;  2TDX A;  2V6C A;  2K02 A;  2W57 A;  4HA8 A;  2P6T A;  1GXP A;  2BGC A;  3QP6 A;  4AWX B;  4HX8 A;  2EFW A;  4O6J A;  1XGM A;  4FX4 A;  5HVQ C;  3QPH A;  4WK8 F;  1XDS A;  3K1N A;  4KDP A;  4ZZL A;  2DK8 A;  1K78 B;  3MAJ A;  4ZYD A;  3T8R A;  3ULQ B;  4LD5 A;  4WCG A;  3QRF F;  4DQ2 A;  1EH7 A;  3WTX C;  2K4J A;  3CO6 C;  3JTH A;  2FMY A;  1S8N A;  4AVP A;  5E8I A;  3Q5F A;  3ECH A;  1GXQ A;  3WE2 A;  2DPU A;  2DQL A;  1BBY A;  4LLN A;  3KCC A;  5LGU A;  2Q0O A;  1OYI A;  1YO5 C;  4U0V A;  1BJA A;  4M73 A;  1R1V A;  1T6S A;  1IXR C;  5L3F A;  4P96 A;  4LLL A;  1WSU A;  5LRR A;  3IRQ A;  3ISP A;  2UZK A;  1H0M A;  1BN5 A;  2RV8 A;  1O3Q A;  1SFU A;  3VFZ A;  4I0B A;  1TLH B;  3SHF A;  1U5T B;  3I64 A;  4P9F A;  2AXL A;  1J59 A;  1LNW A;  3ZMV A;  2L4A A;  5CVJ A;  4G6Q A;  1DPU A;  1SFE A;  2QZ8 A;  1SD5 A;  3DPT A;  3HOS A;  1HKS A;  1EV7 A;  1IRG A;  2OBP A;  3F6V A;  3K2Z A;  1YG2 A;  3BZ6 A;  4Y17 A;  1XSD A;  3HRM A;  1TNT A;  4BXU A;  2W84 A;  2FOK A;  3WTU C;  1PUE E;  4XSX F;  1R1T A;  2VOP A;  3LAP A;  1HW2 A;  2F5E A;  3QP5 A;  2BEO A;  5KK1 A;  1ZLK A;  4A6D A;  1HW1 A;  2OQR A;  3T5X A;  5H6Q A;  3GEZ A;  2BE5 F;  1IUY A;  3M8F A;  1SD6 A;  4G8X A;  3KE2 A;  1FY7 A;  5BQT A;  3DF8 A;  1G3T A;  3ZMU A;  2HTS A;  5D8K B;  4GO1 A;  5LLQ A;  4NB5 A;  4IRG A;  3J81 K;  3RKY A;  1FYL A;  2PQ8 A;  3E3V A;  2RGV A;  3KP5 A;  3D0S A;  2V1D A;  4WXH A;  1Z05 A;  2MLK A;  1MJB A;  4ETS A;  3KP7 A;  1IXS B;  2EFO A;  4B8X A;  3DKW A;  1IN5 A;  1UFM A;  5E18 F;  1B9N A;  1UHW A;  1YW7 A;  1DUX C;  3CTA A;  4LMY A;  5LHG A;  4KYW A;  2IA2 A;  4XLN F;  3M9A A;  2VBW A;  2H6B A;  1JHF A;  1XSV A;  4LG0 B;  5FLX K;  2ZFW A;  3SFZ A;  3GFJ A;  1YIO A;  3GVA A;  2FNA A;  2PMU A;  2IW5 A;  1I27 A;  4F7Z A;  3MQ0 A;  2RVC A;  1OYY A;  1ZRD A;  1FNN A;  3BJO A;  1XCB A;  4QWQ A;  3WGH A;  4WWC A;  1BI3 A;  2GWR A;  1HST A;  1F4K A;  1OYW A;  1S3J A;  3ERE D;  1D8J A;  2YU3 A;  4JQF A;  1TTY A;  6PAX A;  3E97 A;  3WE3 A;  2HKX A;  2PFB A;  4BHB A;  2IP2 A;  2IA0 A;  4MTD A;  3PQJ A;  3KEQ A;  1G4D A;  3BWG A;  1XGO A;  1IN8 A;  5DCM A;  4HQE A;  2M30 A;  4RAY A;  2XKP A;  1QZZ A;  4HLX A;  3N4M A;  1G3S A;  1W4M A;  5IT3 A;  1U5T C;  1FC3 A;  4UNO A;  1IW7 F;  5EEG A;  5CVI A;  2XAS A;  4CYD A;  4RB2 C;  3D5L A;  3ELK A;  3QPT A;  3E6M A;  4ENN A;  2HS5 A;  3HTS B;  3RYP A;  5TRD A;  4IF4 A;  2EFN A;  2Y75 A;  4ZZD A;  2EK5 A;  4BAY A;  1PP7 U;  1KQ0 A;  4I7H A;  2ZXJ A;  4EJW A;  4L0Y B;  5LEK A;  3LA2 A;  2W25 A;  1XN7 A;  2HYF A;  2DTR A;  1X3U A;  2WWY A;  3RTR A;  1BC8 C;  1IF1 A;  3LQQ A;  4A2U A;  4RB0 A;  1OMI A;  2L54 A;  4HF1 A;  1ON1 A;  4EJV A;  2ZNY A;  2E1C A;  3ZMT A;  4OIR F;  2CWE A;  1XDU A;  1RZ4 A;  4H0E A;  3MZY A;  3IWZ A;  4L5I A;  2O6G E;  4JK1 X;  2CFX A;  3F8B A;  1AOY A;  2M1B A;  2RN7 A;  1B4A A;  2A68 F;  3ML6 A;  3RKX A;  4U7B A;  3LA3 A;  2GA2 A;  3W6K B;  4EGZ A;  2YR2 A;  4IXA A;  2FSW A;  2Y48 A;  4KNY A;  4M72 A;  2P5L C;  3H92 A;  2RQP A;  2Z5U A;  3WOD F;  1LEA A;  4ESF A;  5L3G A;  3K0L A;  2MD5 A;  2LNB A;  2XHK A;  1R5G A;  2PI0 A;  5ICG A;  5L3E A;  2J5O A;  2E1N A;  1JHH A;  1W5T A;  5BOX A;  1ZG3 A;  3T8T A;  3C1D A;  5DEQ A;  1LQ1 A;  1A04 A;  3ABU A;  1D3Y A;  2HDC A;  2Z99 A;  1BI2 A;  3DEU A;  1J9I A;  3J7A O;  3N97 A;  2Z33 A;  1U3E M;  4P9U A;  4CDG A;  4P55 A;  2KIF A;  1TQM A;  4GGG A;  2FBK A;  4HF0 A;  5EEH A;  5ICF A;  5ILS A;  3B02 A;  5IT9 Z;  3ABT A;  2G9W A;  1MDM B;  3SZT A;  1BM9 A;  3R61 A;  2X0L A;  3R0J A;  1TW2 A;  4ZH4 F;  1UCR A;  2VE9 A;  2P4W A;  4I09 A;  2MBF A;  3KP3 A;  4O3M A;  5ILV A;  5HS7 A;  4OIQ F;  4M71 A;  4IHS A;  2IPQ X;  1XD7 A;  4GYI A;  3O6B B;  3FXQ A;  3QU6 A;  2PN6 A;  2W24 A;  2YSR A;  3COA C;  3LA7 A;  1XCV A;  1JXS A;  3CO7 C;  4M9S A;  4OIP F;  1MD0 A;  4BHP A;  3ZN0 A;  1T0F A;  1Z7U A;  3HSE A;  5BS6 A;  2Z3Y A;  2A6E F;  4M6X A;  4HW0 A;  5FD6 A;  3BPX A;  3I59 B;  2A5Y B;  4LLG F;  1U8R A;  3F22 A;  2D45 A;  2XKO A;  2HEO A;  2VN2 A;  1KU9 A;  4WXC A;  2IA1 A;  3ZQ7 A;  5F1R A;  3FX3 A;  3BPV A;  2XAQ A;  3GYH X;  2A69 F;  4KFC A;  1ZN2 A;  2VXZ A;  3F3X A;  4HZF A;  1KU3 A;  3K1P A;  5AIP A;  4RB1 A;  4HAM A;  1SD7 A;  2QBY B;  1BC7 C;  4HDV A;  2VBY A;  4Q48 A;  3JSO A;  2IT0 A;  4NQW A;  1LEB A;  2ESH A;  2MH9 A;  2FNP A;  1W7P A;  1RI7 A;  5LHH A;  4CO8 A;  5JR3 A;  3FXR A;  1RUO A;  3TO7 A;  1BOA A;  2OA4 A;  4BHC A;  4KUM A;  1QGP A;  2ZME A;  4JBA A;  3IKV A;  5LHI A;  1YTY A;  3LFK A;  1ON2 A;  1BIB A;  4N9I A;  2W85 A;  4ESJ A;  3M8E A;  4G7O F;  2O03 A;  2YX4 A;  4EJU A;  2MC3 A;  3HUG A;  4YII A;  3BRO A;  2E7X A;  2DT5 A;  3JAM Z;  1K79 A;  2XV4 S;  4I01 A;  2EB7 A;  4HQM A;  2XRO A;  5DUK A;  3RPU A;  1Q1H A;  3OV8 A;  3ECO A;  4RGU A;  1G3W A;  2LSO A;  1ZRE A;  2QYO A;  2XRN A;  3WTT C;  5CVR A;  4OU0 A;  5DCF A;  3TOA A;  2VOO A;  2F5F A;  1IAW A;  4GCV A;  1R22 A;  1RNL A;  2OAZ A;  3RI4 A;  2F5C A;  2LF7 A;  2YPR A;  4KIF A;  3GXO A;  1KYZ A;  3IC7 A;  1O3S A;  2VT3 A;  1DP7 P;  2JPC A;  3P7N A;  3WG9 A;  4WX9 A;  2YX7 A;  4R8H A;  2L3D A;  4L9N A;  1KU2 A;  4PZJ A;  2G7U A;  3H3U A;  5HDN A;  4MGR A;  4OIN F;  1MGT A;  2ETH A;  1BI1 A;  1ZGJ A;  3S2W A;  1I5Z A;  1RIO H;  1SMT A;  4YFX F;  1JGS A;  5DUI A;  2HFH A;  5HDK A;  2L01 A;  4HF2 A;  4KIC A;  2XIG A;  4EM2 A;  1P4X A;  5IT9 K;  4NHJ A;  1ZAO A;  5D5U B;  1EH8 A;  1K6O A;  4OMY A;  3FM3 A;  4Q4Z F;  4A0Y A;  4LFU A;  3HRU A;  2QLZ A;  4MQV A;  2NAZ A;  1R23 A;  2HZT A;  2EV0 A;  2K86 A;  2HR3 A;  4PGG A;  5CYV A;  2VBZ A;  3FMS A;  4R1H A;  2DAO A;  1STZ A;  4M6Y A;  1XSX A;  1D8K A;  2P8T A;  1U5T A;  3KET A;  4YIF A;  1F1Z A;  4KIB A;  2IJL A;  2PBI A;  3KFW X;  1ZHF A;  2EA4 A;  5CJ9 A;  2DU9 A;  5L3B A;  3ZMS A;  2FA5 A;  2FU4 A;  2G7H A;  3VOD A;  4IVN A;  5K5Q A;  1FOK A;  3CUO A;  1VTN C;  2Z9O A;  2FQ3 A;  4XLP F;  4HX7 A;  3VB2 A;  2A61 A;  2E7W A;  5LRS A;  1QBJ A;  4MHG A;  1YW9 A;  4R79 A;  2NYX A;  5AON A;  2COM A;  2O0Y A;  1FLI A;  2QVO A;  3F6O A;  3F72 A;  1P4W A;  3QOP A;  4IPA A;  1IZ1 A;  4UVA A;  2KJB A;  1WRJ A;  2PG4 A;  2M45 A;  3WTS C;  4EVI A;  4ZYG A;  4G94 A;  1O7L A;  1U6G A;  1HW5 A;  1HSJ A;  3EYI A;  2ISY A;  2RNJ A;  2HWV A;  1KQ9 A;  1OR7 A;  3WU1 B;  3DQV C;  4HLY A;  1XGS A;  3ZMD A;  2PEX A;  3CDH A;  5LBQ A;  4Q47 A;  5F64 A;  2JT1 A;  1J5Y A;  1WWX A;  1FZP B;  4PCQ A;  3CUQ B;  2P7C B;  3HOT A;  4G7Z F;  4LB6 B;  4A6E A;  4HX4 A;  1E2X A;  3L7W A;  4LJZ F;  1SD4 A;  2FF4 A;  3U1D A;  4UHT A;  4G7H F; 
#chains in the Genus database with same CATH topology
 3EQL F;  4AIJ A;  4UVC A;  1ETV A;  1LJ9 A;  5GAG J;  2DT7 B;  1B9M A;  1ZG5 A;  2PLY A;  1UHS A;  4E70 A;  3FHZ A;  1BL0 A;  1RUN A;  3HOW J;  1I1G A;  4ZTF A;  2DI3 A;  4LG0 A;  5M5Y J;  5A2Q Z;  4M6V A;  2NNY A;  1NG7 A;  1MJA A;  2HI3 A;  3HB9 A;  4L5J A;  3FWE A;  4BQO A;  1BOB A;  3J80 Z;  2XB0 X;  3JAM K;  2HQ5 A;  1WQ2 A;  1MKM A;  4I02 A;  4N0B A;  2CSO A;  3W2V A;  1E17 A;  1LPQ A;  2ZO4 A;  1YFH A;  2BV6 A;  5E3N A;  3OYI A;  1U9O A;  4EJO A;  2CO5 A;  3PQK A;  4FE4 A;  4CHU A;  4S04 A;  3SYT A;  4E7K A;  3TDZ C;  4XLC A;  2C6Y A;  4AIK A;  4AUX A;  3MCZ A;  5JHU A;  2R7F A;  2OZU A;  3MZ8 A;  2L02 A;  4PSX A;  3S14 J;  4IRH A;  3E5U A;  1NHA A;  1ZGW A;  4D7N A;  1YS7 A;  3GF2 A;  4UXN A;  2O61 A;  4HOB A;  2V79 A;  2M4G A;  5ICC A;  1Q1V A;  1XMK A;  2HOE A;  1R00 A;  3VYS B;  1NTC A;  2B0L A;  5K7H A;  4BJ6 C;  1SAU A;  5K5O A;  4OAY A;  1WKM A;  5E1W A;  1FSE A;  2Q8K A;  2EIL H;  1E3H A;  2FE3 A;  4OAZ A;  4A69 C;  3R4K A;  3VWB A;  3I56 I;  1Y6I A;  2GLO A;  2F2E A;  5ED4 A;  4KN4 X;  1FYK A;  1EA3 A;  4CUG A;  1W5C C;  2KHM A;  2Y9Y A;  5KAF C;  3FKJ A;  2V9V A;  2R7Q A;  1CF7 A;  2DOE A;  2ICW G;  1G2H A;  4HBL A;  4A0Z A;  2ID3 A;  2M7B A;  1HXD A;  2P5V A;  3GTK J;  3IKT A;  2FML A;  2EIJ H;  2JN6 A;  3RYR A;  5F0F A;  4D5F A;  3N05 A;  2JMW A;  4S05 A;  1IG7 A;  3VOE A;  2QSF X;  1GV5 A;  1HQC A;  3W2W A;  5F6F A;  1QRY A;  2XF5 A;  3BDD A;  5ICE A;  3E6C C;  4EM1 A;  3KLO A;  4XL9 A;  3LSM A;  4ZYH A;  2DQR A;  1LDD A;  2F5D A;  1Z21 A;  2QQA A;  3MFK A;  1R5H A;  3SDG A;  1ERD A;  5C4J J;  3A1Y A;  3DLA A;  3K2A A;  1K4T A;  2L9R A;  2QUF A;  3S1M J;  1DGW Y;  2ZJP F;  3FK6 A;  1R5I D;  1YQA A;  3FBN B;  4PDK A;  1A31 A;  4V2G A;  3GZ5 A;  4AIH A;  5E17 F;  4M74 A;  2D1V A;  2XGC A;  4HV5 A;  3L2C A;  1SMY F;  1SFK A;  4TV7 A;  5F0H A;  1ZR4 A;  1MND A;  2D1H A;  4NC8 A;  1KGS A;  3B73 A;  3QAH A;  5CVV A;  1W7P D;  1CGP A;  4XKC A;  3TO9 A;  3ZPL A;  1S7O A;  4Y15 A;  3L1P A;  2Y2Z A;  3S1Q J;  4L0Z B;  4X1E A;  3GW2 A;  1ZRF A;  3OYL A;  2WAE A;  3K1M A;  2CV2 A;  2X9D A;  1Z3Y A;  2RC4 A;  2UXN A;  1N78 A;  2HKO A;  3DKY A;  3HSF A;  2XAH A;  3CF2 A;  2EIN H;  3CMM A;  3LSH A;  2LKP A;  4L18 B;  3LQR A;  1U2W A;  2ELH A;  2DDB A;  4AID A;  2KPM A;  4IX7 A;  1VQ9 I;  5JLW A;  3KEY A;  2M2E A;  2P5K A;  4QLC U;  4A5M A;  3ZP5 A;  4OWR B;  2X1C A;  2X6Y A;  2JQ7 A;  3QPL A;  1Z6T A;  1H9G A;  2P81 A;  4ESB A;  1T33 A;  3EUA A;  5FJ8 J;  3G73 A;  3MZH A;  4NBQ A;  3DU6 A;  4BS9 A;  1FPQ A;  1XGN A;  1WGX A;  3TO6 A;  1F5T A;  4LB5 A;  2OQG A;  4FX0 A;  1I1S A;  3GTG J;  1SAX A;  3CJT B;  2DT6 A;  3IH3 A;  1XG1 A;  2EH3 A;  3UKG A;  3GME A;  3FF5 A;  3HBL A;  3LAJ A;  3CCQ I;  1W0U A;  3JRF A;  2P7V B;  1KYW A;  2VE8 A;  4KIG A;  2HXI A;  4MNU A;  3FMR A;  2QSH X;  5L3D A;  5D5W B;  3E6D A;  3KYL A;  1ZYR F;  1DDN A;  3F8C A;  3AL0 B;  1IDZ A;  1OCT C;  4ZDP A;  2H8R A;  5IP6 A;  3H9Q A;  3RPU D;  1ULY A;  3CUQ C;  1V3F A;  1X58 A;  4XSZ F;  1XPX A;  3B6C A;  3GZN B;  4CZZ A;  2HDW A;  2LF8 A;  4NQW B;  1FEX A;  1LVA A;  3EET A;  3TKY A;  4GYG A;  4K2E A;  4U0W A;  1W7P B;  3V8L A;  4XMY A;  3NRV A;  2XPW A;  3R0A A;  2DA4 A;  2GA1 A;  2MA3 A;  4B09 A;  4ABZ A;  1YI2 I;  2Y9Z A;  1MIJ A;  5HLT A;  3S16 J;  3I71 A;  3A01 B;  4FT8 A;  2ME0 A;  2L0K A;  2M7A A;  5EJC A;  4KA4 A;  2QQB A;  3S32 A;  5EEA A;  3OR2 C;  5DDG A;  1GLN A;  3HDD A;  5E1Z B;  4XOR A;  4RMN A;  2WY8 Q;  2PJP A;  3F8N A;  5JLX A;  4A3I J;  3S1N J;  1ETO A;  3CDL A;  2AQF A;  4FQG A;  3BJA A;  1R58 A;  5D5V B;  1AWC A;  4H4K C;  3QOD A;  3ZQL A;  5F1J A;  2XUB A;  1X1P A;  2CUF A;  4KMU X;  1R4M B;  1LKX A;  2PJR B;  1IV8 A;  1LDJ A;  4CCO A;  4CYC A;  3OYG A;  1D5V A;  3G4S I;  3HTU A;  5J6X A;  4EGY A;  5LEJ A;  4CCL A;  2LVS A;  4I6Z A;  3I4P A;  3TDU C;  2OZ6 A;  3KIO A;  3Q9V A;  1FIA A;  4XM3 A;  3R6S A;  2DMP A;  2DFI A;  1OPC A;  4EV0 A;  5CPR B;  1YE9 A;  2LY9 A;  4PJJ A;  2ZXH A;  3TQN A;  1HBX G;  3C18 A;  3O8H A;  3CES A;  4L9T A;  3GFM A;  2QA4 I;  4ENK A;  1S7E A;  3DP7 A;  1MDM A;  2VIX A;  3M3Y J;  3IRR A;  1IRZ A;  2A6H F;  3SZP A;  1G3Y A;  3T1B A;  4AYB N;  5F0C A;  5IP7 J;  3P9I A;  1SFX A;  1T39 A;  5K5R A;  3DV8 A;  3NEU A;  1LFB A;  4RA2 A;  3CLO A;  3F9K A;  4RGR A;  4HDU A;  3A02 A;  2NNN A;  1YHQ I;  1VQ8 I;  5JFR A;  5A2Q K;  3HC7 A;  3KEO A;  2D2W A;  3EPZ A;  5J1Y A;  1UST A;  3SQN A;  3ZOB A;  3J80 K;  4MEX F;  5M5W J;  4F52 A;  3BCA A;  3C7J A;  2ZNZ A;  5J8C A;  2DPD A;  3BY6 A;  3MEX A;  5B3S H;  3GTP J;  1P6R A;  2QEN A;  1RES A;  5JHF A;  2R93 J;  1WI9 A;  1BR1 A;  1PVE A;  5CLS A;  2UXX A;  5TGT A;  1TZL A;  1RKT A;  5M3M J;  2HQN A;  1S72 I;  3IHU A;  1XMX A;  3L09 A;  2R5Y B;  5K1Y A;  1REP C;  2BVL A;  2NVU B;  1IUF A;  1R36 A;  5D6F A;  2WTE A;  2EFP A;  2BY0 A;  1YIT I;  1G59 A;  4YG2 F;  1FOX A;  4V19 K;  3I59 A;  3ZQQ A;  3H3V K;  1X1B A;  2QM3 A;  2X48 A;  1DU0 A;  5E8G A;  4KMF A;  2E35 A;  4UY8 I;  2DLL A;  4OIO F;  1IN6 A;  4M9Z A;  4QTR A;  2P6S A;  2PMH A;  2JRT A;  1RKW A;  2MH2 A;  1YYV A;  2E2H J;  3DU5 A;  1SVM A;  2ADU A;  1MH4 A;  1YJW I;  4XID A;  3PL8 A;  4RGS A;  2R5Z B;  3FKI J;  1J0R A;  4GRI A;  5F08 A;  1WJD A;  3EUK L;  2KRF A;  5JVG F;  4AM3 A;  4BQA A;  1MBK A;  2VT2 A;  3WGI A;  1T38 A;  3BR0 A;  3AG2 H;  2UUZ A;  2ZKZ A;  5J4V A;  4KJZ A;  4GXO A;  2DO7 A;  2DK5 A;  2R7W A;  4II2 A;  2VJJ A;  1TL8 A;  3BTI A;  3U9G A;  2DTZ A;  2M5W A;  3B6A A;  1A5J A;  3QQA A;  4A3G J;  3WU0 A;  2IGM A;  1TBX A;  2DA3 A;  1S7A A;  2G0E A;  4WF2 A;  2VKD A;  2QBY A;  3CJN A;  2W7N A;  1BIA A;  4HYE A;  1RR7 A;  4BH9 A;  1EKE A;  2EZI A;  1DP3 A;  3GZ6 A;  5FO5 A;  4N4N B;  3ZMZ A;  2ID6 A;  1RPW A;  4Y33 A;  5HLG A;  5BPI A;  3RZO J;  2CV1 A;  1D5Y A;  3AL0 C;  2OV7 A;  1WJC A;  5TJJ A;  4A12 A;  4DZP A;  2WB1 N;  1MZB A;  3F8M A;  3HRS A;  5DM7 F;  5KVR A;  1P4A A;  2CW7 A;  2R7Z J;  3WTV C;  2EJR A;  5DD4 A;  3L9F A;  4BNC A;  2DW4 A;  2GIV A;  1BW6 A;  2LYC A;  1X2M A;  2XGE A;  3M7G A;  3VSL A;  3S8P A;  1QZE A;  5GPA A;  2JJ7 A;  1OCC H;  1ZTR A;  3CD6 I;  2WY7 Q;  2IGO A;  2KZG A;  1WFX A;  4XOP A;  2BW3 A;  1Z9C A;  3PUB A;  5B1B H;  4YEL A;  2R7T A;  5FRN A;  1TNS A;  4IQ4 A;  5KNL A;  1OKR A;  1ORK A;  4XLE A;  4A0X A;  1W1W E;  1H9T A;  3OSG A;  3LMM A;  1PUF B;  5FLV A;  2V6E A;  4NC7 A;  4PGH A;  1NK3 P;  2JSP A;  5EYR A;  1W36 C;  1K78 A;  2FRH A;  1VND A;  3GTL J;  1QO0 D;  1KA8 A;  3DWL E;  3H0D A;  1F9N A;  2ZSI B;  1MSE C;  4LOC A;  3C2G A;  3BZK A;  1B6A A;  1UJ8 A;  5IOZ A;  1S6L A;  1FYM A;  5FRO A;  2BYV E;  1C0W A;  2A07 F;  3HHH A;  2K40 A;  3DPU A;  3QU3 A;  4G12 A;  3G71 I;  4WXD A;  2GIZ A;  3H35 A;  1V5G A;  1BI0 A;  5JVT A;  4UV8 A;  1TQI A;  2IGN A;  1UEL B;  2XF7 A;  3BQZ A;  2V9P A;  2O8X A;  2VBX A;  2FXA A;  2AS5 F;  3IUO A;  3EUH A;  4U87 A;  1L0O C;  1X4P A;  2CYY A;  2XAJ A;  2O9L A;  4XLA A;  4A5N A;  1QQI A;  1XX5 A;  3V8J A;  5B66 C;  2GAU A;  4IHY A;  1XB4 A;  3H36 A;  4MQ9 F;  4PUS A;  2E2J J;  1Z1D A;  1DGR M;  1HKQ A;  1N25 A;  2VJ4 A;  3HRT A;  3VYR B;  3BG9 A;  4XRF A;  3F23 A;  1FX7 A;  3AG4 H;  1HOM A;  3HEF A;  4EAT A;  1W0T A;  3LWF A;  4U88 A;  4XBF A;  1TP4 A;  2M8E A;  2J5P A;  3L2W A;  2ZJ2 A;  4M9X A;  4DBR A;  4XK4 A;  5DCM B;  1H8A C;  2EV6 A;  1GHC A;  3K4C A;  5IYC J;  3H9G A;  3QPS A;  4DYR A;  4BKX A;  3LOC A;  5D4R A;  1O7F A;  1QPM A;  4KN7 X;  2STT A;  5HDG A;  1TT0 A;  2E19 A;  1QNT A;  1I39 A;  2HGC A;  2QQ9 A;  2XAF A;  2ZB9 A;  3IL2 A;  3WHC A;  4B4C A;  2K3P A;  3OOP A;  3ROU A;  2CUJ A;  4O5V A;  4CCJ A;  4CGZ A;  4XIC A;  4IOA F;  1EH6 A;  1B72 B;  4HEA 2;  2OD5 A;  4D0P A;  3RIR A;  2DYS H;  1Y39 A;  2XPV A;  1L3L A;  2CW0 F;  3CCJ I;  3IAM 2;  3K4M A;  2FBI A;  2MLG A;  3DCF A;  3BR3 A;  1P92 A;  4KT5 C;  3K10 A;  3DTK A;  1O57 A;  4D5C A;  1DQU A;  1V5F A;  5E20 A;  3GWZ A;  2XC7 A;  1Z91 A;  2V1X A;  4U7D A;  2BZT A;  3S3N A;  1CQT A;  3Q9S A;  1BJZ A;  2M87 A;  4OOI A;  5FLM J;  4LK1 F;  2IS1 A;  3HM5 A;  4XRS G;  2Z1D A;  5HS8 A;  3GTO J;  4L9V A;  3EDP A;  4CZC A;  1TW3 A;  2HPM A;  3E5Q A;  5H20 A;  2BY1 A;  4RAZ A;  4UUV A;  1HKT A;  3GX4 X;  1FP2 A;  1ZLJ A;  3OYC A;  3CF5 F;  4Y52 J;  1FSH A;  1TWA J;  3TOB A;  2RDP A;  4L9J A;  3JTG A;  4YIR X;  5CQE A;  3V7R A;  2K27 A;  3O3K A;  5EGO B;  4E4H A;  3I54 A;  4MIM A;  4DNC A;  4CXF A;  5E3O A;  2KIU A;  3LSR A;  5J40 A;  4EQQ A;  1D1A A;  2ISZ A;  1WH7 A;  1R9T J;  4E7H A;  3V7S A;  2STW A;  3MVP A;  5D5X B;  2R3S A;  3DPL C;  1VI0 A;  5BNG A;  5LGT A;  1VQO I;  3TBI A;  2NVT J;  4N9H A;  2E1M C;  2E5N A;  3FIS A;  3S1R J;  2M4K A;  5E1X A;  4E7J A;  3KPH A;  4FET A;  1D1C A;  1K7A A;  2FEZ A;  3HIF A;  3RJP A;  3MN2 A;  1YLF A;  3BOQ A;  1Y0N A;  5GTI C;  3V4G A;  2ELK A;  3OYJ A;  3T0Y A;  1V4R A;  3F21 A;  2ZBK A;  4DGW B;  2VQG A;  3KP2 A;  3D5S C;  4I98 B;  2AHQ A;  5HLI A;  2PX9 A;  3E5X A;  1LE8 A;  3RPQ A;  3I53 A;  1CF7 B;  4IHT A;  2IXS A;  1Y1V J;  4ZYE A;  2ACJ A;  2WV1 A;  3RQI A;  4YRV A;  3CDI A;  1QZY A;  3FXU A;  3H3Z A;  1FT9 A;  1IDY A;  3M1E A;  3KP6 A;  2A3S A;  2Q1Z B;  2R7U A;  2L2O A;  4LK0 F;  5EZH A;  3H5A A;  4EJT A;  5ERI A;  2VON A;  2V1U A;  1ETW A;  3OS0 A;  4BJT A;  2H94 A;  2EWN A;  1DPR A;  1FBU A;  1R1U A;  1X3W B;  2XVC A;  2KIM A;  3KZI C;  1BA5 A;  4BYY A;  1O3T A;  1VZ0 A;  3FZV A;  3O2P E;  1VQN I;  3I0T A;  4IRI A;  1XMA A;  3IP4 B;  5DYM A;  2JUG A;  4B1R A;  4FHT A;  2WC2 A;  2WV0 A;  3A0H C;  4DIQ A;  3WTY C;  2ZCW A;  2KKO A;  1K61 A;  1MMG A;  3M4O J;  2JSC A;  1YW8 A;  3V7C A;  4UV9 A;  2OTJ I;  4LIV A;  3J7Z I;  1FTT A;  4XOT A;  2UWM A;  4UVB A;  2GQQ A;  3ZN1 A;  3GFL A;  5L3C A;  1LDK B;  3ZQH A;  4IOC F;  2O3F A;  3W6J B;  4JX5 A;  2XAG A;  2R7X A;  3WTW C;  2DJI A;  3VYT B;  1ZEL A;  2HVS A;  1K4S A;  2ME6 A;  1GVD A;  1YRN A;  4CCN A;  2QWW A;  5FRM A;  1TT5 B;  3U21 A;  3DEE A;  4NNJ A;  2IEK A;  2HTJ A;  2K7L A;  1UG2 A;  2DBB A;  1JKR C;  1ENH A;  2YS9 A;  2EA2 A;  5D6E A;  4RM3 A;  2GBY A;  1JE8 A;  2Y31 A;  2FBH A;  3OWT A;  3OSF A;  4E6K G;  5DS9 A;  3HYI A;  2EIK H;  4XKV A;  2CJJ A;  4Q5S F;  4MTE A;  3TGN A;  2GXA A;  2JPB A;  3K70 C;  1M1E B;  3I58 A;  4YFK F;  3BC8 A;  1ONV A;  2JTV A;  2KIQ A;  3PO3 J;  3NWT A;  2GZW A;  4B3X A;  3HOV J;  3JRG A;  2H6C A;  2M3A A;  1O3R A;  4B44 A;  2E60 A;  2H09 A;  2Q2E A;  2X6O A;  4BEH A;  2DN0 A;  5F04 A;  2P0W A;  4E7I A;  5DV5 A;  4NUB A;  2FX0 A;  1QA6 A;  1JKO C;  2IRF G;  2R7D A;  4CH7 A;  3KZZ A;  3CUQ A;  2ESN A;  4LGW A;  4QIW N;  2LFB A;  4W97 A;  2GXG A;  4GFB A;  1IN4 A;  5CVU A;  1TWC J;  1YS6 A;  3JSP A;  5CQG A;  1ODD A;  4C3J J;  2PMZ A;  2XPU A;  2VKE A;  5FGM A;  2L4M A;  3EYY A;  2LDU A;  5D4S A;  2K9L A;  4M3F A;  2NS0 A;  4CIC A;  4KIT B;  2MGQ A;  3FXM A;  1FBS A;  3KZY A;  3OS2 A;  4Y13 A;  1UHM A;  2HYG D;  1B59 A;  2GXB A;  3DBH B;  2LMD A;  1I6H J;  1T56 A;  2RKH A;  5FFZ A;  5TIS C;  4ASN A;  1ZKG A;  2WAQ N;  4RB3 C;  4A3L J;  4EMS A;  1J7K A;  2DMN A;  4EM0 B;  2NVQ J;  3BG3 A;  2EZK A;  3AKZ A;  3J7A Y;  2CQ7 A;  2EZH A;  3OIP A;  2VC1 A;  1EJ9 A;  3Q3S A;  1JGG A;  1J2X A;  1Y0U A;  3I9V 2;  4MEY F;  1Y1W J;  1G6N A;  2VOD A;  5HOO A;  5KHD A;  1JUS A;  3AAF A;  3LSG A;  2OU2 A;  1FP1 D;  1RC9 A;  3H1C A;  3HHG A;  3CCR I;  2F48 A;  4S0H B;  4BUP A;  2Y0M A;  4YFN F;  3L00 A;  4ITV A;  3LSP A;  2CGP A;  3BG6 A;  5C3E J;  4XRS A;  5IYB J;  2IAI A;  1R71 A;  2KJC A;  1VQP I;  1VQK I;  1ZG1 A;  2ECC A;  2CG4 A;  4IJA A;  5AIQ A;  1NH3 A;  2E1O A;  4V2F A;  2DA1 A;  1PP8 F;  1FOY A;  1ZQ3 P;  3R60 A;  1S29 A;  2VQL A;  4IO9 F;  2VC0 A;  4A3J J;  4BXX J;  3BP8 A;  5GPC A;  1V5E A;  4B47 A;  2MAB A;  1SC7 A;  3I5U A;  2DXI A;  1IRF A;  3V8K A;  3VEP A;  2LD5 A;  3BTJ A;  3ABK H;  1ZAR A;  1T98 A;  4ON0 A;  1AKH A;  1MMN A;  3BQY A;  3E7L A;  5FFX A;  3CCE I;  2LOO A;  4I2O A;  3P9K A;  2JA8 J;  4OMZ A;  5FB2 A;  4P5O A;  2OJE D;  1EF4 A;  1Z6R A;  3GFI A;  1U8B A;  1RR8 C;  1TQP A;  3J81 Z;  3KLN A;  2HU9 A;  2LRE A;  3F8F A;  1T8I A;  3LSK A;  4XLH A;  3DFG A;  3GUD A;  1JJ6 C;  2HOT A;  1R7J A;  3QWL A;  1J75 A;  3K69 A;  4ZDO A;  3U2R A;  1S5L C;  3JW4 A;  1ZH5 A;  4BL0 B;  5LGN A;  2IVM A;  5J1U A;  3TP3 A;  4ZTJ A;  1HCR A;  3IWF A;  3HPH A;  4U0Y A;  2N8G A;  3C3W A;  2X4H A;  4LIT A;  2CQK A;  2X6W A;  4RGX A;  3M8J A;  2MC4 A;  3E6B A;  4ZYA A;  3WG7 H;  2EV5 A;  3K9T A;  1VQL I;  1I6X A;  4I0A A;  2XGX A;  2ZME B;  5HS9 A;  1P2F A;  1MJ9 A;  3DXJ F;  1IJW C;  1F43 A;  3GBG A;  2K4B A;  4ENJ A;  3CP8 A;  2R0Q C;  3FIW A;  3P9C A;  3QYB A;  5D8L B;  5B5E C;  4PK4 A;  2H27 A;  1PDN C;  3ZQF A;  4RM2 A;  3BJ6 A;  1IXC A;  1UZC A;  2EFQ A;  3PFI A;  5FD5 A;  5ILU A;  2HQR A;  3FMQ A;  3WTZ A;  3FM5 A;  1U9N A;  1T2K A;  1FWZ A;  3HUG B;  1W5S A;  1JTX A;  5FLX Z;  3NQO A;  2RQQ A;  4G9Y A;  4ENM A;  3GO5 A;  1E3O C;  3WGG A;  2OUM A;  4XON A;  4C3I J;  3VSK A;  2VKV A;  2MW8 A;  2DA2 A;  1WCM J;  2EPF A;  3TMO A;  1IC8 A;  1GVJ A;  1ZRC A;  3BG7 A;  3PJR A;  2LKS A;  2XGD A;  4G6D A;  1ETX A;  2W1O A;  3K4L A;  3GLX A;  1IN7 A;  1ZGA A;  1B1B A;  5H6R A;  1KU7 A;  3CLQ A;  4RS8 A;  1USS A;  3G3Z A;  4J00 A;  4HV6 A;  4Z2Y A;  5BPD A;  1JKP C;  2E2I J;  5K7F A;  3HSR A;  1LB2 A;  3SXY A;  2CU7 A;  2KLO A;  3H5R A;  4IHV A;  3CCV I;  5DTD A;  2NRA C;  3MKL A;  5K7Z A;  2CQX A;  1TWG J;  1QVU A;  2CRG A;  4BQQ A;  3OYK A;  3RDI A;  4BBS J;  1X19 A;  1FBQ A;  3RKW A;  3KP4 A;  1X3Z B;  5JI6 A;  5DD8 A;  2LKX A;  1UB9 A;  1X4O A;  2JVG A;  2RAE A;  3L2R A;  3REO A;  5BMZ A;  5J8F A;  2JZY A;  1MNM C;  1Y8Q B;  2LR8 A;  3TW6 A;  2BHY A;  4AD9 A;  3MWM A;  3BR5 A;  5FKN A;  3OL3 A;  1U78 A;  1KQ8 A;  2L7M P;  3VPR A;  5HLH A;  2BBY A;  1UAA A;  1A6I A;  1Z0X A;  2QCO A;  3O8G A;  3LST A;  1HC8 A;  2TDX A;  4IQJ A;  2V6C A;  2K02 A;  2XSJ C;  2LBF A;  2W57 A;  1F36 A;  4XNF A;  3ZXS A;  4HA8 A;  2P6T A;  1GXP A;  2CH0 A;  4M3B A;  2K9M A;  3W6V A;  4IKF A;  4B3A A;  2BGC A;  3OMY A;  4XRM A;  2HDD A;  1MSF C;  2E71 A;  3A01 A;  3QP6 A;  4AWX B;  4HX8 A;  3JRA A;  2EFW A;  3CP2 A;  4O6J A;  1MBF A;  4KIS A;  4BAC A;  4BQN A;  3DLL F;  1XGM A;  1T0F C;  1JTY A;  4B48 A;  1YX5 A;  2QKM B;  4FX4 A;  5HVQ C;  3QPH A;  1S9H A;  4WK8 F;  3FBI B;  3PUF A;  1XS9 A;  1XDS A;  3K1N A;  2ECB A;  3HOY J;  2Y0S A;  4KDP A;  4ZZL A;  2X51 A;  2IS6 A;  4L5E A;  2JK3 A;  2DK8 A;  5IPA A;  1LFP A;  1B8I B;  2YUS A;  4UUS B;  1K78 B;  1IO2 A;  2NOJ B;  4FE7 A;  3MAJ A;  4ZYD A;  3T8R A;  3ULQ B;  4LD5 A;  4WCG A;  1Y8R B;  4PJL A;  3QRF F;  4P1W A;  3K4B A;  3SEZ A;  4DQ2 A;  1EH7 A;  3WTX C;  2K4J A;  2DYR H;  3HGG A;  3AG1 H;  3CO6 C;  3JTH A;  2FMY A;  3U1K A;  1POG A;  1S8N A;  4AVP A;  2A5W A;  5E8I A;  5EG0 B;  3Q5F A;  3ECH A;  1GXQ A;  2F6C A;  3WE2 A;  2DQL A;  1BBY A;  2DPU A;  4LLN A;  4F91 B;  3KCC A;  2R7R A;  5LGU A;  1MH3 A;  1OYI A;  2HYJ A;  2Q0O A;  4BE1 A;  3M07 A;  4U0V A;  1YO5 C;  1BJA A;  3TL4 X;  4CCK A;  3JRB A;  4M73 A;  1R1V A;  1T6S A;  1IXR C;  5L3F A;  4C2M J;  4P96 A;  4HG2 A;  2JVH A;  4LLL A;  5B1A H;  1WSU A;  2XB5 A;  1WI3 A;  5LRR A;  1OIS A;  3I3L A;  4A3K J;  3IRQ A;  3ISP A;  2VQH A;  3PSF A;  4BGD A;  2UZK A;  1YIJ I;  1BN5 A;  3BZC A;  1H0M A;  2RV8 A;  1O3Q A;  5FKO A;  2X1D A;  2QSG X;  4A93 J;  1JUM A;  1T08 B;  4QPO A;  3VFZ A;  1SFU A;  4I0B A;  3CMY A;  1FTZ A;  1XTA A;  2WBM A;  4DBQ A;  4RBO A;  5C4X J;  4MO7 A;  1TLH B;  3SHF A;  1U5T B;  3I64 A;  4P9F A;  2AXL A;  1J59 A;  3JRC A;  3ZGK A;  2DFE A;  1LNW A;  3JRI A;  1E0E A;  4AU7 A;  1AA7 A;  2E34 A;  3E1S A;  3ZMV A;  1JT6 A;  2L4A A;  5CVJ A;  2H1K A;  4G6Q A;  5FKM A;  1DPU A;  1SFE A;  4HNV A;  1I50 J;  3SJM A;  2QZ8 A;  1JI8 A;  1SD5 A;  2VJ5 A;  3DPT A;  3HOS A;  1HKS A;  4ZJZ A;  1EV7 A;  1IRG A;  4JOM A;  2OBP A;  2MG4 A;  3F6V A;  4F92 B;  3ASN H;  3FXK A;  3K2Z A;  1YG2 A;  2ZME C;  3BZ6 A;  4Y17 A;  1XSD A;  3Q0U A;  3HRM A;  4RLQ A;  3CME I;  2I5U A;  3FK7 A;  4A3B J;  1TNT A;  2E5Z A;  4BXU A;  3QYE A;  2LP0 A;  2W84 A;  2FOK A;  3WTU C;  2R5Z A;  5DM6 F;  1BW5 A;  1PUE E;  2BVM A;  4XSX F;  4BU2 A;  1R1T A;  2RNG A;  3LAP A;  3MKW B;  2F5E A;  1HW2 A;  2VOP A;  2ZC2 A;  5GAH J;  3RZD J;  3QP5 A;  3JRD A;  4JX4 A;  1X1A A;  1WPK A;  1WJA A;  2BEO A;  5KK1 A;  1ZLK A;  4C30 A;  4A6D A;  3Q0V A;  1HW1 A;  3VYU B;  2OQR A;  3H5N A;  1MBH A;  3T5X A;  4CA0 A;  1R6R A;  5H6Q A;  3GEZ A;  2BE5 F;  3HKZ A;  1VQ6 I;  3M8F A;  1IUY A;  1SD6 A;  4G8X A;  3KE2 A;  3K7A J;  1FY7 A;  3I4M J;  5BQT A;  1MBE A;  3DF8 A;  1G3T A;  3ZMU A;  2HTS A;  5D8K B;  4GO1 A;  5E3M A;  5LLQ A;  4NB5 A;  4A3M J;  1WJ5 A;  2NOG A;  4IRG A;  3J81 K;  3RKY A;  1HF0 A;  4MFE A;  2PQ8 A;  4DYQ A;  1FYL A;  3OYN A;  1PYV A;  3E3V A;  3NAU A;  2Z2S B;  2RGV A;  3KP5 A;  3D0S A;  1IGN A;  4HNT A;  2V1D A;  4WXH A;  1Z05 A;  2MLK A;  4XN3 A;  3CC4 I;  2E36 A;  1MJB A;  4ETS A;  3KP7 A;  1Z67 A;  1IXS B;  2EFO A;  5IP9 J;  1OCZ H;  2QEX I;  4B8X A;  3DKW A;  1IN5 A;  1UFM A;  4QPQ A;  1BR2 A;  5E18 F;  1B9N A;  1U0J A;  1GV2 A;  5EZG A;  1UHW A;  2CQN A;  1HDP A;  2TRT A;  1YW7 A;  4UUT A;  2VB6 A;  1DUX C;  3CTA A;  4LMY A;  5LHG A;  1O4X A;  4KYW A;  2IA2 A;  4XLN F;  1PUF A;  3M9A A;  2DDA A;  2W48 A;  1WH5 A;  1OCO H;  2VBW A;  2H6B A;  1JHF A;  1XSV A;  3PO2 J;  4LG0 B;  4BE2 A;  5FLX K;  5J3L A;  1UG0 A;  3PIP F;  2L9N A;  2ZFW A;  3W3C A;  3SFZ A;  3G1O A;  5LD2 C;  3GFJ A;  1H88 C;  1YIO A;  3OYM A;  4J19 A;  3GVA A;  2FNA A;  2PMU A;  2IW5 A;  3TED A;  1I27 A;  4F7Z A;  2L5Q A;  2YU9 J;  1LFU P;  3MQ0 A;  2RVC A;  4J01 A;  1VF9 A;  1KON A;  3PSI A;  3BR2 A;  2IS4 A;  1OYY A;  1OQY A;  1ZRD A;  1FNN A;  3BJO A;  1GT0 C;  1XCB A;  5GAD J;  4QWQ A;  1MBJ A;  3WGH A;  4WWC A;  2OC6 A;  1BI3 A;  2GWR A;  4ZC3 A;  1HST A;  2HQA A;  1F4K A;  2X1E A;  1HA8 A;  2WAD A;  3WHB A;  1OYW A;  2XSD C;  3NWS A;  1S3J A;  3ERE D;  1D8J A;  2YU3 A;  4JQF A;  3BT9 A;  3DTI A;  3LL7 A;  1TTY A;  1Z77 A;  3L2U A;  6PAX A;  3E97 A;  3WE3 A;  2HKX A;  2PFB A;  4BHB A;  1T95 A;  2KT0 A;  2KRC A;  1MW7 A;  3PM1 A;  4BY7 J;  2IP2 A;  2IA0 A;  4MTD A;  4X0G A;  5GTH C;  3PQJ A;  2OPT A;  3KEQ A;  1G4D A;  3BWG A;  1XGO A;  1IN8 A;  5DCM A;  1I3Q J;  4HQE A;  3BG5 A;  3HXL A;  2M30 A;  4RAY A;  3S3O A;  2XKP A;  2KMU A;  2B9S A;  2COB A;  2L7K A;  4C2U A;  4YEJ A;  3VDX A;  2OF7 A;  2LRD A;  5F27 A;  1QZZ A;  4HLX A;  3N4M A;  1G3S A;  1W4M A;  5IT3 A;  2XRL A;  4PJN A;  4PFP A;  3X2Q H;  4C2T A;  2F4I A;  1U5T C;  3FXJ A;  1FC3 A;  4UNO A;  1IW7 F;  5EEG A;  5CVI A;  2BXY A;  2XAS A;  2DOD A;  4CYD A;  3D5L A;  4RB2 C;  1ITY A;  3ELK A;  3QPT A;  4XR6 A;  1YJ9 I;  3E6M A;  4JP0 A;  2L9S A;  4ENN A;  2OTL I;  2Y69 H;  4CCM A;  2HS5 A;  1K83 J;  3HTS B;  2JWT A;  3CC7 I;  2KFD A;  3RYP A;  1GDT A;  3A2K A;  4F93 B;  5TRD A;  4HSR A;  2X85 A;  3HOZ J;  4IF4 A;  2EFN A;  2Y75 A;  2DFH A;  4ZZD A;  4RLF A;  1J09 A;  2EK5 A;  2HOA A;  4BAY A;  2X6X A;  2BY2 A;  1PP7 U;  1FMV A;  2VPR A;  1KQ0 A;  4I7H A;  4D1Q A;  2ZXJ A;  4B43 A;  1HLV A;  4EJW A;  3KX2 A;  4XLF A;  4L0Y B;  5LEK A;  4G6T B;  2R4G A;  3LA2 A;  2W25 A;  1XN7 A;  3RKQ A;  2HYF A;  2IBD A;  2W82 A;  1TWH J;  2DTR A;  3OYH A;  5EGO A;  1X3U A;  3CMA I;  4FAS D;  4A3F J;  2LLK A;  3AFH A;  3RTR A;  2WWY A;  1BC8 C;  3CCY A;  3LQQ A;  2LY2 A;  1IF1 A;  3QYF A;  4A2U A;  2HPI A;  4RB0 A;  1OMI A;  3IH4 A;  2L54 A;  4RDU A;  3LSI A;  4HF1 A;  1ON1 A;  1OLT A;  4EJV A;  5EF6 A;  4DOZ A;  2ZNY A;  2E1C A;  3ZMT A;  4A3C J;  3HGY A;  4OIR F;  1OJL A;  2DFF A;  3BR1 A;  2CWE A;  1XDU A;  1RZ4 A;  4H0E A;  3MZY A;  3IWZ A;  4F3Q A;  1FMW A;  2A05 A;  4L5I A;  3OYF A;  2O6G E;  3JRE A;  1BR4 A;  4JK1 X;  2CFX A;  1RRJ A;  3KYC B;  1VQM I;  1N77 A;  1X1D A;  1OR7 C;  3F8B A;  2FJ1 A;  1AOY A;  2M1B A;  3HL2 A;  2RN7 A;  2V26 A;  4II3 A;  3CCU I;  1ACI A;  1X1C A;  1B4A A;  4MFD A;  2IS2 A;  4PSW A;  2A68 F;  3AG3 H;  3S3M A;  3ML6 A;  3RKX A;  3BLY A;  1WJF A;  4U7B A;  1AKH B;  2ZJR F;  3ERM A;  3LA3 A;  2GA2 A;  3BTL A;  1SVO A;  5E79 C;  2YR2 A;  3W6K B;  2VLA A;  1QVT A;  4EGZ A;  3PNV A;  2EIM H;  3CJQ B;  3HOX J;  4IXA A;  2R7V A;  2VQC A;  2FSW A;  2Y48 A;  4I76 A;  4KNY A;  4M72 A;  2P5L C;  2V9K A;  3OL4 A;  3SFI A;  1QHG A;  3H92 A;  2RQP A;  1P7I A;  2Z5U A;  3WOD F;  1LEA A;  2PMZ N;  4ESF A;  3JRH A;  5L3G A;  3K0L A;  3G6E I;  2MD5 A;  2LNB A;  3HJE A;  2XHK A;  1APL C;  1R5G A;  2PI0 A;  5CKT A;  2WAQ A;  3CJR B;  5ICG A;  3RQ4 A;  5L3E A;  2J5O A;  3G1M A;  2E1N A;  1JHH A;  2VPL A;  1W5T A;  5GP9 A;  1LVK A;  4F55 A;  3LSJ A;  5BOX A;  4C3H J;  2JA7 J;  1ZG3 A;  4UB6 C;  3K6G A;  3I4N J;  1MMS A;  3T8T A;  4NC6 A;  2VXD A;  2FOW A;  3C1D A;  5DEQ A;  1LQ1 A;  1A04 A;  1HDD C;  4IZZ A;  3ABU A;  1D3Y A;  1AHD P;  2HDC A;  4DJA A;  2M0C A;  1Z7L A;  2OCE A;  4BE0 A;  3PNT A;  1JT0 A;  3S2D J;  2Z99 A;  4IHX A;  1BI2 A;  3DEU A;  1J9I A;  1YOV B;  3DBR B;  3J7A O;  3N97 A;  4X6A J;  2Z33 A;  2AQE A;  3ESW B;  4CYC B;  1U3E M;  3ZQC A;  3OYA A;  1ETK A;  2LG4 A;  1W36 D;  4EEF G;  4P9U A;  4CDG A;  2I8D A;  2DCE A;  4XKW A;  4Y4R A;  3PNY A;  4P55 A;  1QHH D;  2BY3 A;  3HPG A;  2KIF A;  4IL6 C;  1TQM A;  4GGG A;  4GDF A;  2XDV A;  2FBK A;  3MKY B;  2UV1 A;  2MD0 A;  3MMY B;  3ASO H;  5FKK A;  4HF0 A;  5EEH A;  5ICF A;  5ILS A;  2IGK A;  4PFO A;  4D7M A;  5GAE J;  3B02 A;  4E7S A;  2H1L A;  3FXL A;  5IT9 Z;  2MFZ A;  3ABT A;  4JYK A;  2G9W A;  1MDM B;  3SZT A;  2GM4 A;  4DYC A;  1BM9 A;  1NG6 A;  3R61 A;  3L2V A;  2X0L A;  3R0J A;  1TW2 A;  1MMD A;  4ZH4 F;  1UCR A;  1A36 A;  1D1B A;  5KCM A;  2VE9 A;  2P4W A;  4FTH A;  4I09 A;  2MBF A;  3ZCO A;  3KP3 A;  2JA6 J;  4KT6 A;  4O3M A;  5ILV A;  3HZJ A;  5M5X J;  5HS7 A;  4OIQ F;  2M34 A;  4M71 A;  4BXF A;  4IHS A;  2IPQ X;  1XD7 A;  4GYI A;  2L7F P;  3RSN A;  3O6B B;  3FXQ A;  2MSY A;  3QU6 A;  3GTQ J;  4AC0 A;  2GOX B;  2PN6 A;  2W24 A;  2YSR A;  3COA C;  3LA7 A;  2GOM A;  1XCV A;  3ABM H;  4NDL A;  2JA5 J;  2HZD A;  3CC2 I;  1JXS A;  3CO7 C;  1VQ5 I;  3K4K A;  2CMP A;  4M9S A;  2LBF B;  4OIP F;  1MD0 A;  2R7O A;  4BHP A;  3ZN0 A;  1QPI A;  3TW7 A;  2FD5 A;  1T0F A;  1Z7U A;  3HSE A;  5BS6 A;  2Z3Y A;  2A6E F;  4M6X A;  4XQF A;  4HW0 A;  2KRH A;  3BPX A;  4DZJ A;  5FD6 A;  3ABL H;  3LFU A;  1ZR2 A;  3I59 B;  4BBR J;  2A5Y B;  3JR9 A;  1IV6 A;  4LLG F;  3FHN A;  5KAI C;  1U8R A;  3F22 A;  2D45 A;  3A03 A;  2JUC A;  1OCP A;  1NK2 P;  1FJL A;  2XKO A;  2HEO A;  4LG3 A;  4IEJ A;  2VN2 A;  2AO9 A;  1KU9 A;  2EZL A;  2KL4 A;  1G8X A;  4WXC A;  3OS1 A;  2RRE A;  2IA1 A;  2WA0 A;  2VJI A;  4PJM A;  3ZQ7 A;  2CFO A;  5HOD A;  5F1R A;  3G1L A;  1N75 A;  3FX3 A;  3C2B A;  3BPV A;  2XAQ A;  2ZXW H;  2DOF A;  3GYH X;  2A69 F;  4KFC A;  1ZN2 A;  2MYS A;  2VXZ A;  3S17 J;  3F3X A;  4HZF A;  2KZV A;  4AYB A;  2L7Z A;  4HST A;  1KU3 A;  1R4N B;  3DTE A;  2CV0 A;  2NVX J;  3MKZ A;  2NS7 A;  3K1P A;  3QOE A;  5AIP A;  5EDN A;  4RB1 A;  4HAM A;  1SD7 A;  2QBY B;  1BC7 C;  4I99 C;  4HDV A;  2VBY A;  4BDZ A;  4Q48 A;  1X2N A;  3K4J A;  2XAU A;  3JSO A;  3NAR A;  3H0G J;  4C9Y A;  2IT0 A;  2LH9 A;  1R49 A;  3P5J A;  4NQW A;  1TC3 C;  3J7Y J;  1LEB A;  2ESH A;  3PFY A;  2MH9 A;  2FNP A;  4DW6 A;  1W7P A;  3M1C A;  1RI7 A;  2DA6 A;  5LHH A;  4CO8 A;  5JR3 A;  3FXR A;  2LK2 A;  1RUO A;  2FQ4 A;  2HNH A;  3ZR8 X;  2NS8 A;  3SZG A;  3TO7 A;  1WJE A;  2KIS A;  1BOA A;  2NVY J;  2OA4 A;  4BHC A;  4KUM A;  4E7L A;  2DA5 A;  1JJ8 C;  1QGP A;  2BW3 B;  4D9J A;  1WHU A;  2DMU A;  2I10 A;  9ANT A;  3WU2 C;  2VUM J;  2F4M B;  3HOU J;  2OCC H;  2ZME A;  2V7F A;  4JBA A;  4CSW A;  3IKV A;  5LHI A;  1YTY A;  3LFK A;  1P7J A;  1ON2 A;  3BCB A;  1BIB A;  1MBG A;  3IH2 A;  3OYE A;  4N9I A;  2DMT A;  4JX6 A;  3V42 A;  2PJR A;  3OOU A;  2W85 A;  1I3A A;  2AXT C;  4ESJ A;  1SFO J;  1SAN A;  3M8E A;  4G7O F;  2O03 A;  1ETQ A;  2YX4 A;  4EJU A;  2MC3 A;  3HUG A;  4UB8 C;  4YII A;  5IOY A;  5C44 J;  3BRO A;  3W2A A;  2E7X A;  2VL8 A;  2DT5 A;  4LIU A;  3JAM Z;  2Z16 A;  4RAG A;  1JUP A;  2L9V A;  2KQR A;  2XV4 S;  4I01 A;  1K79 A;  2EB7 A;  2K5C A;  2CW8 A;  4HQM A;  2A6T A;  2Y0S N;  5E3L A;  3PIO F;  1D0X A;  3A0B C;  2XRO A;  3SDB A;  2DJN A;  3S93 A;  4BJ5 C;  5DUK A;  5HNF A;  4AVZ A;  3IV5 A;  3RPU A;  1Q1H A;  3BTC A;  3KYD B;  3OV8 A;  2R7S A;  2QKL B;  3ECO A;  4RGU A;  3ONQ A;  3S2H J;  4ANJ A;  1G3W A;  1YX3 A;  2LSO A;  4BDY A;  2E1M B;  2CUE A;  4A3D J;  1ZK8 A;  1ZRE A;  2DA7 A;  3GTJ J;  2QYO A;  2XRN A;  3HG9 A;  3WTT C;  2LTP A;  1GUU A;  5CVR A;  2LY1 A;  3GCM A;  2VKH A;  4HRI A;  4ZDL A;  2HXO A;  5J4Y A;  2VAS A;  4OU0 A;  3DKX A;  2ELJ A;  5DCF A;  3TOA A;  4RAF A;  1D0Z A;  1FOW A;  2VOO A;  2F5F A;  2M0M A;  4GCV A;  2K3F A;  2WB1 A;  1IAW A;  1R22 A;  1RNL A;  2OAZ A;  3RI4 A;  2F5C A;  2LF7 A;  2QQ8 A;  2YPR A;  3K70 D;  4N4O B;  4FCY A;  4KIF A;  1A35 A;  2W4S A;  3GXO A;  1KYZ A;  1P9Q C;  3JCU C;  3IC7 A;  1O3S A;  2VT3 A;  2KDO A;  1DP7 P;  3DEW A;  2KP6 A;  2JPC A;  3P7N A;  3WG9 A;  4Y3O A;  2F5V A;  4WX9 A;  2M8G X;  2R5Y A;  3CQZ J;  2YX7 A;  1FIP A;  4R8H A;  3G2B A;  3CCL I;  2L3D A;  3TP0 A;  2EBI A;  4L9N A;  1KU2 A;  4PZJ A;  2B7E A;  3E0J B;  3OR1 C;  2G7U A;  3H3U A;  2HVR A;  2BXZ A;  3Q0W A;  5HDN A;  4QSH A;  5LFA A;  4BY1 J;  2QF7 A;  5M3F J;  3L2Q A;  4MGR A;  1IRX A;  2ZSH B;  3H9J A;  4M3E A;  4OIN F;  1MGT A;  2ETH A;  1BI1 A;  1ZGJ A;  2K9Q A;  1SVL A;  4M3D A;  3S2W A;  1B8I A;  3OYB A;  3S15 J;  4UUS A;  1I5Z A;  3OIQ A;  1RIO H;  1SMT A;  4YFX F;  1JGS A;  5J47 A;  1OFC X;  1PJR A;  1MMA A;  5DUI A;  2R92 J;  2HFH A;  3ZRG A;  5HDK A;  2JA2 A;  2L01 A;  1E3P A;  4KIC A;  4HF2 A;  2F4O B;  2XIG A;  4EM2 A;  4HNU A;  3ZQG A;  2BOL A;  2QGU A;  2O7O A;  1P4X A;  3FXO A;  5IT9 K;  2CUZ A;  5IY5 H;  2WAF A;  4NHJ A;  1ZAO A;  5D5U B;  2NXN B;  5EG0 A;  1SEU A;  1EH8 A;  1D0Y A;  4PJ0 C;  3RCO A;  2B63 J;  1K6O A;  2BHZ A;  4OMY A;  3FM3 A;  3F0C A;  4Q4Z F;  1JKQ C;  3HKZ N;  4A0Y A;  4LFU A;  3HRU A;  2QLZ A;  2FUG 2;  4MQV A;  2NAZ A;  1R23 A;  1ETY A;  2ZFU A;  3DBL B;  1KZH A;  2KDZ A;  2HZT A;  1A6Q A;  2EV0 A;  2XF6 A;  2K86 A;  2HVQ A;  2HR3 A;  4PGG A;  5CYV A;  2VBZ A;  3FMS A;  4R1H A;  2DAO A;  1STZ A;  1XC5 A;  4M6Y A;  1XSX A;  1LE8 B;  1D8K A;  1H89 C;  4MLO A;  2P8T A;  1U5T A;  3KET A;  4YIF A;  1F1Z A;  4FIS A;  4KIB A;  2EQR A;  4XKB A;  2IJL A;  2PBI A;  3KFW X;  1ZHF A;  2EA4 A;  5CJ9 A;  4Y7N J;  2DU9 A;  2CS3 A;  5L3B A;  3ZMS A;  2FA5 A;  2FU4 A;  2G7H A;  3VOD A;  4IVN A;  5K5Q A;  1FOK A;  3GLL A;  3A4C A;  3CUO A;  1WJB A;  2DOA A;  2O5R A;  3K4N A;  3CCS I;  1VTN C;  2Z9O A;  2FQ3 A;  4XLP F;  4M3G A;  4HX7 A;  2CQQ A;  3VB2 A;  2A61 A;  2E7W A;  5LRS A;  1QBJ A;  5IYD J;  4MHG A;  1YW9 A;  2NYX A;  4R79 A;  1V55 H;  5AON A;  2ZJQ F;  2COM A;  2K9S A;  2VI6 A;  3D5R C;  2HOS A;  2O0Y A;  4Z6Y A;  4IHW A;  1FLI A;  2QVO A;  3F6O A;  2M9H A;  3SEQ A;  3F72 A;  1VQ7 I;  1OCR H;  1P4W A;  3QOP A;  1DU6 A;  1WVR A;  3OY9 A;  4IPA A;  5J1R A;  3IAS 2;  2W00 A;  1IZ1 A;  2Y30 A;  1TWF J;  2V1N A;  1YJN I;  4UVA A;  2KJB A;  1WRJ A;  2PG4 A;  2H8W A;  2DMQ A;  2M45 A;  3WTS C;  1YRN B;  3GTM J;  4EVI A;  2K9N A;  3UR3 C;  2K85 A;  4ZYG A;  4G94 A;  1Y56 A;  3D1N I;  4HPQ A;  3BR6 A;  4A3E J;  1MNE A;  1QU3 A;  1O7L A;  1U6G A;  1HW5 A;  1HSJ A;  3OYD A;  1UMQ A;  2O8K A;  2ZXI A;  3EUH C;  3EYI A;  2ISY A;  5HNH A;  2RNJ A;  2HWV A;  1K6Y A;  1KQ9 A;  1OR7 A;  3ZQI A;  3WU1 B;  2JRM A;  3DQV C;  2D5V A;  4HLY A;  1XGS A;  1Z3X A;  1LUJ B;  2Q2E B;  3ZMD A;  1WZ2 A;  4BEH B;  1RET A;  1AU7 A;  2PEX A;  3CDH A;  3OIO A;  5LBQ A;  5H2F C;  5FKL A;  4Q47 A;  5F64 A;  2JT1 A;  4XN0 A;  1J5Y A;  1WWX A;  4W1U A;  1FZP B;  1V54 H;  4PCQ A;  3C2H A;  3CUQ B;  3UNG C;  2P7C B;  3HOT A;  4E7Z A;  3I55 I;  4G7Z F;  1VFC A;  1VQ4 I;  3CZ6 A;  3MD2 A;  4LB6 B;  3LNQ A;  2LC2 A;  1B72 A;  4A6E A;  4HX4 A;  1E2X A;  3L7W A;  4LJZ F;  1SD4 A;  3CCM I;  2FF4 A;  3U1D A;  3FDY A;  4UHT A;  2TCT A;  2V4J C;  4G7H F; 
#chains in the Genus database with same CATH homology
 3EQL F;  4AIJ A;  4UVC A;  1LJ9 A;  1B9M A;  1ZG5 A;  2PLY A;  4E70 A;  3FHZ A;  1RUN A;  1I1G A;  2DI3 A;  4LG0 A;  5A2Q Z;  2NNY A;  1MJA A;  4L5J A;  3FWE A;  3J80 Z;  3JAM K;  1WQ2 A;  1MKM A;  4I02 A;  4N0B A;  2CSO A;  1E17 A;  2ZO4 A;  1YFH A;  2BV6 A;  4EJO A;  2CO5 A;  3PQK A;  4CHU A;  4S04 A;  2C6Y A;  3TDZ C;  4AIK A;  3MCZ A;  5JHU A;  2R7F A;  2OZU A;  2L02 A;  4IRH A;  3E5U A;  1NHA A;  1YS7 A;  3GF2 A;  4UXN A;  2O61 A;  4HOB A;  2V79 A;  5ICC A;  1XMK A;  2HOE A;  1R00 A;  2B0L A;  5K5O A;  1WKM A;  5E1W A;  1FSE A;  2Q8K A;  2FE3 A;  3R4K A;  2F2E A;  5ED4 A;  4KN4 X;  1FYK A;  2V9V A;  1CF7 A;  4HBL A;  4A0Z A;  1HXD A;  2P5V A;  3IKT A;  2FML A;  3RYR A;  4S05 A;  3VOE A;  1HQC A;  5F6F A;  3BDD A;  5ICE A;  3E6C C;  4EM1 A;  3KLO A;  4ZYH A;  2DQR A;  1LDD A;  2F5D A;  2QQA A;  3MFK A;  1R5H A;  2QUF A;  1YQA A;  4PDK A;  3GZ5 A;  4AIH A;  5E17 F;  4M74 A;  2D1V A;  4HV5 A;  3L2C A;  1SMY F;  4TV7 A;  2D1H A;  1KGS A;  3B73 A;  3QAH A;  5CVV A;  1W7P D;  1CGP A;  3TO9 A;  3ZPL A;  1S7O A;  4Y15 A;  4L0Z B;  3GW2 A;  1ZRF A;  3K1M A;  2RC4 A;  2UXN A;  2HKO A;  3HSF A;  2XAH A;  2LKP A;  4L18 B;  3LQR A;  1U2W A;  2ELH A;  2P5K A;  4QLC U;  4A5M A;  3ZP5 A;  1Z6T A;  1H9G A;  4ESB A;  3G73 A;  3MZH A;  1FPQ A;  1XGN A;  3TO6 A;  1F5T A;  4LB5 A;  2OQG A;  4FX0 A;  1I1S A;  1SAX A;  3FF5 A;  3LAJ A;  2P7V B;  1KYW A;  2VE8 A;  4KIG A;  4MNU A;  3FMR A;  5L3D A;  5D5W B;  3E6D A;  1ZYR F;  1DDN A;  3F8C A;  1ULY A;  3CUQ C;  1V3F A;  4XSZ F;  4CZZ A;  2LF8 A;  1LVA A;  3EET A;  3TKY A;  4GYG A;  4K2E A;  4U0W A;  1W7P B;  3V8L A;  3NRV A;  3R0A A;  2MA3 A;  2GA1 A;  4B09 A;  3I71 A;  4FT8 A;  4KA4 A;  2QQB A;  5DDG A;  5E1Z B;  2PJP A;  3F8N A;  3BJA A;  1R58 A;  5D5V B;  1AWC A;  2XUB A;  4KMU X;  1LDJ A;  1D5V A;  3HTU A;  5J6X A;  4EGY A;  5LEJ A;  3I4P A;  3TDU C;  2OZ6 A;  3Q9V A;  3R6S A;  2DFI A;  1OPC A;  4EV0 A;  3TQN A;  1HBX G;  3C18 A;  4L9T A;  3GFM A;  4ENK A;  3DP7 A;  1MDM A;  3IRR A;  2A6H F;  3SZP A;  1G3Y A;  3T1B A;  3P9I A;  1SFX A;  1T39 A;  5K5R A;  3DV8 A;  3NEU A;  4HDU A;  3CLO A;  4RGR A;  2NNN A;  5JFR A;  5A2Q K;  3KEO A;  2D2W A;  3J80 K;  1UST A;  3SQN A;  4MEX F;  3C7J A;  2ZNZ A;  5J8C A;  2DPD A;  3BY6 A;  3MEX A;  1P6R A;  2QEN A;  1WI9 A;  5CLS A;  2UXX A;  2HQN A;  3IHU A;  3L09 A;  5K1Y A;  1REP C;  1R36 A;  5D6F A;  2WTE A;  2EFP A;  4YG2 F;  3I59 A;  2QM3 A;  5E8G A;  4KMF A;  2DLL A;  4OIO F;  4M9Z A;  1IN6 A;  2P6S A;  2PMH A;  2JRT A;  2MH2 A;  1YYV A;  2ADU A;  4RGS A;  1J0R A;  2KRF A;  4BQA A;  3WGI A;  2VT2 A;  1T38 A;  2ZKZ A;  4GXO A;  2DO7 A;  2DK5 A;  3U9G A;  2M5W A;  3WU0 A;  1TBX A;  1S7A A;  4WF2 A;  2QBY A;  3CJN A;  1BIA A;  4HYE A;  4BH9 A;  3GZ6 A;  5FO5 A;  3ZMZ A;  5HLG A;  5BPI A;  5TJJ A;  4A12 A;  1MZB A;  3F8M A;  3HRS A;  5KVR A;  1P4A A;  3WTV C;  2EJR A;  5DD4 A;  3L9F A;  4BNC A;  2DW4 A;  2GIV A;  3M7G A;  1Z9C A;  1TNS A;  1OKR A;  4A0X A;  1H9T A;  4PGH A;  1K78 A;  2FRH A;  1QO0 D;  1KA8 A;  1F9N A;  1B6A A;  1FYM A;  1S6L A;  2BYV E;  1C0W A;  2A07 F;  3HHH A;  3QU3 A;  4WXD A;  1BI0 A;  5JVT A;  4UV8 A;  1TQI A;  2O8X A;  2VBX A;  2FXA A;  2AS5 F;  3EUH A;  1L0O C;  2CYY A;  2XAJ A;  4A5N A;  1QQI A;  3V8J A;  2GAU A;  1XB4 A;  4MQ9 F;  1Z1D A;  1HKQ A;  3HRT A;  4XRF A;  3F23 A;  1FX7 A;  3LWF A;  4U88 A;  4XBF A;  2M8E A;  2J5P A;  2ZJ2 A;  4M9X A;  5DCM B;  1GHC A;  2EV6 A;  5D4R A;  1O7F A;  1QPM A;  4KN7 X;  2STT A;  5HDG A;  1QNT A;  2HGC A;  2QQ9 A;  2XAF A;  3IL2 A;  3OOP A;  3ROU A;  4O5V A;  4CGZ A;  1EH6 A;  2OD5 A;  4D0P A;  3RIR A;  1L3L A;  2CW0 F;  2FBI A;  2MLG A;  1P92 A;  4KT5 C;  1O57 A;  5E20 A;  3GWZ A;  1Z91 A;  2V1X A;  4U7D A;  3Q9S A;  2M87 A;  4OOI A;  4LK1 F;  5HS8 A;  4L9V A;  3EDP A;  1TW3 A;  3E5Q A;  5H20 A;  4RAZ A;  4UUV A;  1HKT A;  3GX4 X;  1FP2 A;  1ZLJ A;  1FSH A;  3TOB A;  2RDP A;  4L9J A;  3JTG A;  3V7R A;  2K27 A;  3O3K A;  3I54 A;  4DNC A;  4CXF A;  2KIU A;  2ISZ A;  4EQQ A;  3V7S A;  2STW A;  5D5X B;  2R3S A;  3DPL C;  5LGT A;  4N9H A;  5E1X A;  1K7A A;  2FEZ A;  3HIF A;  3RJP A;  1YLF A;  3BOQ A;  3V4G A;  3T0Y A;  3F21 A;  1V4R A;  2ZBK A;  3KP2 A;  4I98 B;  5HLI A;  3E5X A;  3RPQ A;  3I53 A;  1CF7 B;  4IHT A;  4ZYE A;  2ACJ A;  1QZY A;  3FXU A;  3H3Z A;  1FT9 A;  3M1E A;  3KP6 A;  2A3S A;  4LK0 F;  4EJT A;  5ERI A;  2VON A;  2V1U A;  2H94 A;  2EWN A;  1DPR A;  1FBU A;  1R1U A;  2XVC A;  2KIM A;  4BYY A;  1O3T A;  3FZV A;  3O2P E;  3I0T A;  4IRI A;  1XMA A;  5DYM A;  4FHT A;  2WC2 A;  2WV0 A;  3WTY C;  2ZCW A;  2KKO A;  2JSC A;  1YW8 A;  3V7C A;  4UV9 A;  2UWM A;  4UVB A;  2GQQ A;  3ZN1 A;  3GFL A;  5L3C A;  1LDK B;  2O3F A;  3W6J B;  2XAG A;  3WTW C;  2QWW A;  2HTJ A;  2K7L A;  2DBB A;  2EA2 A;  5D6E A;  1JE8 A;  2FBH A;  3HYI A;  4Q5S F;  4MTE A;  3TGN A;  2JPB A;  3I58 A;  4YFK F;  1ONV A;  2JTV A;  2GZW A;  2H6C A;  1O3R A;  2H09 A;  2Q2E A;  5DV5 A;  2IRF G;  2R7D A;  3KZZ A;  3CUQ A;  2ESN A;  4LGW A;  2GXG A;  1IN4 A;  5CVU A;  1YS6 A;  3JSP A;  1ODD A;  5FGM A;  2L4M A;  3EYY A;  2LDU A;  5D4S A;  2NS0 A;  4CIC A;  1FBS A;  3KZY A;  4Y13 A;  1UHM A;  2HYG D;  1B59 A;  2GXB A;  2RKH A;  5FFZ A;  4ASN A;  4RB3 C;  4EMS A;  1J7K A;  4EM0 B;  2VC1 A;  1J2X A;  1Y0U A;  4MEY F;  1G6N A;  2VOD A;  5HOO A;  3AAF A;  2OU2 A;  1FP1 D;  3HHG A;  2Y0M A;  4YFN F;  3L00 A;  2CGP A;  2KJC A;  1ZG1 A;  2CG4 A;  4IJA A;  5AIQ A;  1PP8 F;  3R60 A;  1S29 A;  2VC0 A;  3BP8 A;  3I5U A;  1IRF A;  3V8K A;  3VEP A;  1ZAR A;  1T98 A;  4ON0 A;  5FFX A;  4I2O A;  3P9K A;  4OMZ A;  5FB2 A;  4P5O A;  1Z6R A;  3GFI A;  1TQP A;  3J81 Z;  3KLN A;  3F8F A;  3DFG A;  3GUD A;  1R7J A;  1J75 A;  3K69 A;  3U2R A;  3JW4 A;  1ZH5 A;  5LGN A;  2IVM A;  3IWF A;  4U0Y A;  3C3W A;  2X4H A;  2CQK A;  4RGX A;  3E6B A;  2EV5 A;  3K9T A;  1I6X A;  4I0A A;  2XGX A;  2ZME B;  5HS9 A;  1P2F A;  1MJ9 A;  3DXJ F;  2K4B A;  4ENJ A;  3P9C A;  5D8L B;  2H27 A;  1PDN C;  3BJ6 A;  1IXC A;  3PFI A;  2EFQ A;  5FD5 A;  5ILU A;  2HQR A;  3FMQ A;  3WTZ A;  3FM5 A;  1T2K A;  1FWZ A;  1W5S A;  5FLX Z;  3NQO A;  4G9Y A;  4ENM A;  3GO5 A;  3WGG A;  1GVJ A;  1ZRC A;  4G6D A;  5H6R A;  3GLX A;  1IN7 A;  1ZGA A;  1B1B A;  1KU7 A;  4RS8 A;  1USS A;  3G3Z A;  4HV6 A;  4Z2Y A;  5BPD A;  3HSR A;  1LB2 A;  3SXY A;  2NRA C;  3RDI A;  1FBQ A;  3RKW A;  3KP4 A;  5JI6 A;  5DD8 A;  1UB9 A;  3REO A;  5BMZ A;  5J8F A;  2JZY A;  4AD9 A;  3MWM A;  1U78 A;  1KQ8 A;  5HLH A;  2BBY A;  3LST A;  2TDX A;  2V6C A;  2K02 A;  2W57 A;  4HA8 A;  2P6T A;  1GXP A;  2BGC A;  3QP6 A;  4AWX B;  4HX8 A;  2EFW A;  4O6J A;  1XGM A;  4FX4 A;  5HVQ C;  3QPH A;  4WK8 F;  1XDS A;  3K1N A;  4KDP A;  4ZZL A;  2DK8 A;  1K78 B;  3MAJ A;  4ZYD A;  3T8R A;  3ULQ B;  4LD5 A;  4WCG A;  3QRF F;  4DQ2 A;  1EH7 A;  3WTX C;  2K4J A;  3CO6 C;  3JTH A;  2FMY A;  1S8N A;  4AVP A;  5E8I A;  3Q5F A;  3ECH A;  1GXQ A;  3WE2 A;  2DPU A;  2DQL A;  1BBY A;  4LLN A;  3KCC A;  5LGU A;  2Q0O A;  1OYI A;  1YO5 C;  4U0V A;  1BJA A;  4M73 A;  1R1V A;  1T6S A;  1IXR C;  5L3F A;  4P96 A;  4LLL A;  1WSU A;  5LRR A;  3IRQ A;  3ISP A;  2UZK A;  1H0M A;  1BN5 A;  2RV8 A;  1O3Q A;  1SFU A;  3VFZ A;  4I0B A;  1TLH B;  3SHF A;  1U5T B;  3I64 A;  4P9F A;  2AXL A;  1J59 A;  1LNW A;  3ZMV A;  2L4A A;  5CVJ A;  4G6Q A;  1DPU A;  1SFE A;  2QZ8 A;  1SD5 A;  3DPT A;  3HOS A;  1HKS A;  1EV7 A;  1IRG A;  2OBP A;  3F6V A;  3K2Z A;  1YG2 A;  3BZ6 A;  4Y17 A;  1XSD A;  3HRM A;  1TNT A;  4BXU A;  2W84 A;  2FOK A;  3WTU C;  1PUE E;  4XSX F;  1R1T A;  2VOP A;  3LAP A;  1HW2 A;  2F5E A;  3QP5 A;  2BEO A;  5KK1 A;  1ZLK A;  4A6D A;  1HW1 A;  2OQR A;  3T5X A;  5H6Q A;  3GEZ A;  2BE5 F;  1IUY A;  3M8F A;  1SD6 A;  4G8X A;  3KE2 A;  1FY7 A;  5BQT A;  3DF8 A;  1G3T A;  3ZMU A;  2HTS A;  5D8K B;  4GO1 A;  5LLQ A;  4NB5 A;  4IRG A;  3J81 K;  3RKY A;  1FYL A;  2PQ8 A;  3E3V A;  2RGV A;  3KP5 A;  3D0S A;  2V1D A;  4WXH A;  1Z05 A;  2MLK A;  1MJB A;  4ETS A;  3KP7 A;  1IXS B;  2EFO A;  4B8X A;  3DKW A;  1IN5 A;  1UFM A;  5E18 F;  1B9N A;  1UHW A;  1YW7 A;  1DUX C;  3CTA A;  4LMY A;  5LHG A;  4KYW A;  2IA2 A;  4XLN F;  3M9A A;  2VBW A;  2H6B A;  1JHF A;  1XSV A;  4LG0 B;  5FLX K;  2ZFW A;  3SFZ A;  3GFJ A;  1YIO A;  3GVA A;  2FNA A;  2PMU A;  2IW5 A;  1I27 A;  4F7Z A;  3MQ0 A;  2RVC A;  1OYY A;  1ZRD A;  1FNN A;  3BJO A;  1XCB A;  4QWQ A;  3WGH A;  4WWC A;  1BI3 A;  2GWR A;  1HST A;  1F4K A;  1OYW A;  1S3J A;  3ERE D;  1D8J A;  2YU3 A;  4JQF A;  1TTY A;  6PAX A;  3E97 A;  3WE3 A;  2HKX A;  2PFB A;  4BHB A;  2IP2 A;  2IA0 A;  4MTD A;  3PQJ A;  3KEQ A;  1G4D A;  3BWG A;  1XGO A;  1IN8 A;  5DCM A;  4HQE A;  2M30 A;  4RAY A;  2XKP A;  1QZZ A;  4HLX A;  3N4M A;  1G3S A;  1W4M A;  5IT3 A;  1U5T C;  1FC3 A;  4UNO A;  1IW7 F;  5EEG A;  5CVI A;  2XAS A;  4CYD A;  4RB2 C;  3D5L A;  3ELK A;  3QPT A;  3E6M A;  4ENN A;  2HS5 A;  3HTS B;  3RYP A;  5TRD A;  4IF4 A;  2EFN A;  2Y75 A;  4ZZD A;  2EK5 A;  4BAY A;  1PP7 U;  1KQ0 A;  4I7H A;  2ZXJ A;  4EJW A;  4L0Y B;  5LEK A;  3LA2 A;  2W25 A;  1XN7 A;  2HYF A;  2DTR A;  1X3U A;  2WWY A;  3RTR A;  1BC8 C;  1IF1 A;  3LQQ A;  4A2U A;  4RB0 A;  1OMI A;  2L54 A;  4HF1 A;  1ON1 A;  4EJV A;  2ZNY A;  2E1C A;  3ZMT A;  4OIR F;  2CWE A;  1XDU A;  1RZ4 A;  4H0E A;  3MZY A;  3IWZ A;  4L5I A;  2O6G E;  4JK1 X;  2CFX A;  3F8B A;  1AOY A;  2M1B A;  2RN7 A;  1B4A A;  2A68 F;  3ML6 A;  3RKX A;  4U7B A;  3LA3 A;  2GA2 A;  3W6K B;  4EGZ A;  2YR2 A;  4IXA A;  2FSW A;  2Y48 A;  4KNY A;  4M72 A;  2P5L C;  3H92 A;  2RQP A;  2Z5U A;  3WOD F;  1LEA A;  4ESF A;  5L3G A;  3K0L A;  2MD5 A;  2LNB A;  2XHK A;  1R5G A;  2PI0 A;  5ICG A;  5L3E A;  2J5O A;  2E1N A;  1JHH A;  1W5T A;  5BOX A;  1ZG3 A;  3T8T A;  3C1D A;  5DEQ A;  1LQ1 A;  1A04 A;  3ABU A;  1D3Y A;  2HDC A;  2Z99 A;  1BI2 A;  3DEU A;  1J9I A;  3J7A O;  3N97 A;  2Z33 A;  1U3E M;  4P9U A;  4CDG A;  4P55 A;  2KIF A;  1TQM A;  4GGG A;  2FBK A;  4HF0 A;  5EEH A;  5ICF A;  5ILS A;  3B02 A;  5IT9 Z;  3ABT A;  2G9W A;  1MDM B;  3SZT A;  1BM9 A;  3R61 A;  2X0L A;  3R0J A;  1TW2 A;  4ZH4 F;  1UCR A;  2VE9 A;  2P4W A;  4I09 A;  2MBF A;  3KP3 A;  4O3M A;  5ILV A;  5HS7 A;  4OIQ F;  4M71 A;  4IHS A;  2IPQ X;  1XD7 A;  4GYI A;  3O6B B;  3FXQ A;  3QU6 A;  2PN6 A;  2W24 A;  2YSR A;  3COA C;  3LA7 A;  1XCV A;  1JXS A;  3CO7 C;  4M9S A;  4OIP F;  1MD0 A;  4BHP A;  3ZN0 A;  1T0F A;  1Z7U A;  3HSE A;  5BS6 A;  2Z3Y A;  2A6E F;  4M6X A;  4HW0 A;  5FD6 A;  3BPX A;  3I59 B;  2A5Y B;  4LLG F;  1U8R A;  3F22 A;  2D45 A;  2XKO A;  2HEO A;  2VN2 A;  1KU9 A;  4WXC A;  2IA1 A;  3ZQ7 A;  5F1R A;  3FX3 A;  3BPV A;  2XAQ A;  3GYH X;  2A69 F;  4KFC A;  1ZN2 A;  2VXZ A;  3F3X A;  4HZF A;  1KU3 A;  3K1P A;  5AIP A;  4RB1 A;  4HAM A;  1SD7 A;  2QBY B;  1BC7 C;  4HDV A;  2VBY A;  4Q48 A;  3JSO A;  2IT0 A;  4NQW A;  1LEB A;  2ESH A;  2MH9 A;  2FNP A;  1W7P A;  1RI7 A;  5LHH A;  4CO8 A;  5JR3 A;  3FXR A;  1RUO A;  3TO7 A;  1BOA A;  2OA4 A;  4BHC A;  4KUM A;  1QGP A;  2ZME A;  4JBA A;  3IKV A;  5LHI A;  1YTY A;  3LFK A;  1ON2 A;  1BIB A;  4N9I A;  2W85 A;  4ESJ A;  3M8E A;  4G7O F;  2O03 A;  2YX4 A;  4EJU A;  2MC3 A;  3HUG A;  4YII A;  3BRO A;  2E7X A;  2DT5 A;  3JAM Z;  1K79 A;  2XV4 S;  4I01 A;  2EB7 A;  4HQM A;  2XRO A;  5DUK A;  3RPU A;  1Q1H A;  3OV8 A;  3ECO A;  4RGU A;  1G3W A;  2LSO A;  1ZRE A;  2QYO A;  2XRN A;  3WTT C;  5CVR A;  4OU0 A;  5DCF A;  3TOA A;  2VOO A;  2F5F A;  1IAW A;  4GCV A;  1R22 A;  1RNL A;  2OAZ A;  3RI4 A;  2F5C A;  2LF7 A;  2YPR A;  4KIF A;  3GXO A;  1KYZ A;  3IC7 A;  1O3S A;  2VT3 A;  1DP7 P;  2JPC A;  3P7N A;  3WG9 A;  4WX9 A;  2YX7 A;  4R8H A;  2L3D A;  4L9N A;  1KU2 A;  4PZJ A;  2G7U A;  3H3U A;  5HDN A;  4MGR A;  4OIN F;  1MGT A;  2ETH A;  1BI1 A;  1ZGJ A;  3S2W A;  1I5Z A;  1RIO H;  1SMT A;  4YFX F;  1JGS A;  5DUI A;  2HFH A;  5HDK A;  2L01 A;  4HF2 A;  4KIC A;  2XIG A;  4EM2 A;  1P4X A;  5IT9 K;  4NHJ A;  1ZAO A;  5D5U B;  1EH8 A;  1K6O A;  4OMY A;  3FM3 A;  4Q4Z F;  4A0Y A;  4LFU A;  3HRU A;  2QLZ A;  4MQV A;  2NAZ A;  1R23 A;  2HZT A;  2EV0 A;  2K86 A;  2HR3 A;  4PGG A;  5CYV A;  2VBZ A;  3FMS A;  4R1H A;  2DAO A;  1STZ A;  4M6Y A;  1XSX A;  1D8K A;  2P8T A;  1U5T A;  3KET A;  4YIF A;  1F1Z A;  4KIB A;  2IJL A;  2PBI A;  3KFW X;  1ZHF A;  2EA4 A;  5CJ9 A;  2DU9 A;  5L3B A;  3ZMS A;  2FA5 A;  2FU4 A;  2G7H A;  3VOD A;  4IVN A;  5K5Q A;  1FOK A;  3CUO A;  1VTN C;  2Z9O A;  2FQ3 A;  4XLP F;  4HX7 A;  3VB2 A;  2A61 A;  2E7W A;  5LRS A;  1QBJ A;  4MHG A;  1YW9 A;  4R79 A;  2NYX A;  5AON A;  2COM A;  2O0Y A;  1FLI A;  2QVO A;  3F6O A;  3F72 A;  1P4W A;  3QOP A;  4IPA A;  1IZ1 A;  4UVA A;  2KJB A;  1WRJ A;  2PG4 A;  2M45 A;  3WTS C;  4EVI A;  4ZYG A;  4G94 A;  1O7L A;  1U6G A;  1HW5 A;  1HSJ A;  3EYI A;  2ISY A;  2RNJ A;  2HWV A;  1KQ9 A;  1OR7 A;  3WU1 B;  3DQV C;  4HLY A;  1XGS A;  3ZMD A;  2PEX A;  3CDH A;  5LBQ A;  4Q47 A;  5F64 A;  2JT1 A;  1J5Y A;  1WWX A;  1FZP B;  4PCQ A;  3CUQ B;  2P7C B;  3HOT A;  4G7Z F;  4LB6 B;  4A6E A;  4HX4 A;  1E2X A;  3L7W A;  4LJZ F;  1SD4 A;  2FF4 A;  3U1D A;  4UHT A;  4G7H F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...