2ESHA

Crystal structure of conserved protein of unknown function tm0937- a potential transcriptional factor
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
114
structure length
114
Chain Sequence
RGGRGFRGWWLASTILLLVAEKPSHGYELAERLAEFGIEIPGIGHMGNIYRVLADLEESGFLSTEWDTTVSPPRKIYRITPQGKLYLREILRSLEDMKRRIETLEERIKRVLQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein TM0937
publication title Crystal Structure of Conserved Hypothetical Protein TM0937
rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
total genus 35
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2005-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2eshA00
2Q0OA 1JGSA 4LLLA 2XRNA 3HHHA 2UXNA 2OA4A 3DQVC 5D5VB 4H0EA 3VOEA 1ZLJA 3F72A 3WTSC 1LDDA 3BJAA 1R36A 5EEGA 2HOEA 4NB5A 5H6QA 1O57A 3BDDA 1KU3A 5HS7A 4DQ2A 5IT9Z 3K1PA 2WWYA 3GWZA 2JRTA 5CVJA 3C1DA 3GVAA 4P96A 3ABUA 2CW0F 5AIPA 3N4MA 3U2RA 2P6SA 4GXOA 3CUQA 2AS5F 5LGUA 3G3ZA 4EM0B 4IHSA 1TBXA 2MLGA 2W57A 1G3YA 4LB6B 1TTYA 1J2XA 4I7HA 2FU4A 2EFOA 4BH9A 1FOKA 1I1GA 2ZNYA 3T0YA 2STWA 2FE3A 2QZ8A 3V8KA 4Q48A 5D6FA 1MKMA 1OKRA 4G94A 3WE2A 3J81Z 5DUIA 4AIJA 2X4HA 3LAJA 2EJRA 3COAC 3RYPA 5D8LB 2P8TA 5HLGA 4EV0A 2RDPA 1FP1D 3WODF 5KK1A 1FP2A 3K9TA 4CDGA 2W25A 3HSEA 4CXFA 2EA4A 3CUQB 3W6KB 4LLNA 4BAYA 2F5DA 2VE9A 3I0TA 5FFZA 1I6XA 3ISPA 1JHFA 3B02A 1AOYA 1U78A 3GO5A 3GFMA 4A5MA 3L9FA 2VBXA 3RYRA 1BOAA 5ILUA 3E3VA 3QRFF 2JTVA 2VODA 5LRRA 2CSOA 3E5QA 1D5VA 4WXDA 2F2EA 2L54A 5CVRA 1F5TA 3E5XA 2ZJ2A 2IA2A 3WTVC 1B4AA 2XHKA 4EM2A 5E18F 3O3KA 2XUBA 2QM3A 3ZP5A 4RGUA 3CO7C 2HGCA 3OV8A 1BC8C 2FSWA 2YX4A 2M8EA 4KNYA 2Z33A 4G7HF 5JR3A 1E17A 5DUKA 2JZYA 1H9GA 4OOIA 2LF7A 3LA2A 1X3UA 2P4WA 2QQ9A 3K2ZA 1QQIA 5KVRA 2D1HA 4CGZA 1UHMA 4RB3C 4IF4A 4O3MA 2QVOA 1HKTA 5BS6A 1W7PA 1PP7U 1J59A 2JSCA 5CVVA 2M30A 4M74A 3PFIA 3NRVA 3FXUA 1K78A 3QAHA 4LB5A 2EV6A 1D8KA 3V7CA 4BQAA 4I0AA 4BNCA 3LA7A 3R0AA 5DDGA 3KETA 1JHHA 3EYYA 3TGNA 3WE3A 4L18B 2DTRA 4OIQF 4HX8A 1SD7A 3ZMTA 4I02A 1YLFA 1TNSA 2M87A 4UVBA 1MDMB 3MZHA 1EH7A 2MLKA 2DO7A 1W7PB 4EM1A 2IT0A 2VN2A 1B1BA 4R79A 2KIFA 1KU2A 1LEAA 3FF5A 4M6YA 3VEPA 2CO5A 4AIKA 3KEQA 3DXJF 4UUVA 3M7GA 4XSXF 1YTYA 4MEXF 1K78B 1ZRFA 1D8JA 5FGMA 4G7ZF 4RB2C 1IW7F 3NEUA 4PDKA 1IRFA 3V8JA 2ZKZA 3RJPA 1XGNA 1U6GA 3KZZA 2FNAA 4ESFA 3KCCA 3J80K 1HKQA 4WWCA 2WV0A 2ESNA 5E8GA 2FOKA 3HHGA 4RGXA 1V3FA 2QYOA 3F23A 2M5WA 2HQRA 1BI3A 5E20A 1ZG5A 4EJUA 2YX7A 1IXCA 2LNBA 1EV7A 4UXNA 1BM9A 2HKXA 3KLOA 3WG9A 1OMIA 1ZAOA 3R61A 1EH6A 2ZMEB 1JXSA 2AXLA 3GEZA 2O6GE 3DPTA 5D8KB 2GXBA 2E7XA 3ERED 4MHGA 1LJ9A 4XRFA 3CUOA 1B59A 3QP6A 1TLHB 3L2CA 4HDUA 4MNUA 3F8FA 2GA1A 2L4MA 3TO6A 5ICGA 4LK1F 5D5WB 1YFHA 1R7JA 5LEJA 4CZZA 3P9KA 4OIOF 4Q47A 2VBYA 1DPRA 4NQWA 4UNOA 3MQ0A 4HA8A 1ON1A 3MWMA 2A3SA 3GZ6A 2MD5A 3DPLC 5J6XA 2A07F 3HTUA 3HSFA 3JAMK 3SZPA 1SMTA 1RNLA 4UVAA 4IRGA 1IN7A 1G6NA 3DKWA 1BIAA 1USSA 1KA8A 3BPVA 2PMHA 3IWZA 1USTA 4D0PA 3S2WA 1O3SA 4UV9A 5L3DA 2A5YB 2NNYA 5A2QZ 2QENA 1OYIA 4MQ9F 2OD5A 2VC0A 5DYMA 3V7SA 1P2FA 2V79A 2D1VA 2J5OA 2HDCA 4L5IA 3BWGA 4M72A 2QLZA 5LGTA 2EFNA 1J9IA 4U0WA 4HF1A 1KGSA 4Y15A 5JI6A 1HQCA 2HS5A 5H20A 2EFPA 2W85A 4ZZDA 1KQ8A 1HSJA 5E1XA 2B0LA 1GVJA 3DV8A 1F1ZA 5K5OA 4RAZA 4B8XA 2RKHA 5L3EA 1QNTA 3ZN1A 4YIFA 3BP8A 1BIBA 1QPMA 2QQAA 3F3XA 5HDGA 3RTRA 4E70A 1DP7P 4EJWA 3KP6A 5H6RA 2ADUA 2DAOA 4HF0A 1JE8A 1I5ZA 5HDNA 2DK8A 5IT3A 1YW7A 1LB2A 2A6HF 1FX7A 3VB2A 2W24A 3H3UA 2V1DA 3KP7A 1SD6A 2COMA 5BOXA 3CJNA 4LG0B 1IUYA 1IN8A 2MH2A 4YFXF 4RB0A 4IRIA 1BN5A 2CWEA 2YR2A 2IA0A 3J80Z 2G7HA 2F5CA 1YW8A 4ZYHA 2HTJA 4HX4A 2Q2EA 3HRSA 4RS8A 3HRTA 2XASA 4BHBA 1EH8A 2ZNZA 1T0FA 3FMQA 3DF8A 3L09A 5LRSA 1T6SA 2W84A 2PMUA 1OYYA 2EV5A 1ZH5A 3WTUC 2DBBA 2H94A 2KKOA 4KN4X 1TNTA 2NAZA 3EUHA 4UV8A 4ENJA 4GCVA 3FZVA 2XAQA 2GXGA 1H9TA 2BYVE 1SFXA 2F5EA 2OAZA 3ZMVA 1P6RA 4HQEA 3I5UA 1IXRC 3E6CC 3TQNA 5TJJA 4M9XA 4WXHA 1KU7A 4HZFA 4JQFA 5HOOA 2O03A 1PUEE 2OQRA 3L7WA 1J75A 3EETA 4A5NA 3DFGA 2RV8A 3HRMA 1FZPB 3KP4A 3EQLF 3ZN0A 2WTEA 1P4XA 3RKYA 4L9VA 4ENMA 3MAJA 3JW4A 5DEQA 4AD9A 1S29A 3ZMSA 5LHIA 1LNWA 1FYKA 2CFXA 5DV5A 3BZ6A 4L0ZB 2BV6A 2CQKA 2VC1A 2E7WA 5FFXA 2A69F 1O7FA 5LEKA 4HLXA 2P5VA 2J5PA 3C18A 4N9IA 5LGNA 3QPHA 1NHAA 1FLIA 5D6EA 3ZMDA 3ZMZA 1I1SA 2E1CA 4G6QA 4KFCA 3Q9SA 4LLGF 2YPRA 2BBYA 3ZMUA 5L3CA 1XDSA 2HYGD 5FD5A 2LF8A 3H92A 2K4JA 4I2OA 3FM5A 1ONVA 4ENKA 2OZUA 2VBWA 4NHJA 1WQ2A 4FX4A 3P9CA 3ULQB 2IVMA 4N0BA 4U0VA 4CO8A 2EK5A 5JFRA 1UCRA 2L02A 2V1XA 1L3LA 4MTDA 2FMLA 5BPDA 2ZBKA 2UXXA 1FBQA 3CTAA 1MDMA 2KJCA 1E2XA 4L9JA 3ML6A 3WU0A 4Q5SF 2V6CA 2LSOA 4P5OA 1O3QA 3ZQ7A 2EFQA 5FLXK 3FM3A 4FX0A 1ZG3A 2E1NA 2BE5F 1ZN2A 3LWFA 2JT1A 1U5TA 4A0YA 1C0WA 1BC7C 3I71A 1UHWA 5ILVA 3WTTC 1QGPA 3CLOA 3T1BA 2XGXA 2O3FA 1ZGAA 1O3TA 4ON0A 3SZTA 4KUMA 3WTWC 3QP5A 1R1TA 3T5XA 4AIHA 4UVCA 2L3DA 1CGPA 2Z5UA 1XDUA 4KMFA 4O5VA 4K2EA 1Z6RA 3KLNA 4ASNA 2L01A 2DK5A 3TDZC 3BJ6A 3SQNA 2D45A 5CLSA 3D5LA 2MH9A 4M73A 3WTYC 1U5TB 2ZMEA 2H6CA 3TOAA 1YIOA 3LQQA 4M6XA 1F9NA 1U8RA 1FYMA 4YIIA 1UFMA 4EMSA 2MC3A 3U1DA 1J5YA 5ICCA 4G9YA 3KFWX 2HTSA 2HWVA 2NNNA 1KU9A 1YQAA 2XAHA 2ISZA 3JSPA 5CVIA 4CICA 1R1VA 3F8CA 5CYVA 5JHUA 4CYDA 2H6BA 5HLIA 3KE2A 4S05A 5LBQA 1O3RA 5K1YA 3GLXA 4IJAA 5L3BA 1TW3A 4BXUA 2RQPA 4HF2A 5DCMB 1IN4A 3VODA 1YS7A 2Y0MA 3Q5FA 3J7AO 3E6MA 1QZYA 2UZKA 1ZGJA 1XSXA 1ULYA 5HVQC 3REOA 2VOPA 1ZRCA 3MZYA 4HW0A 3V7RA 1I27A 1KYWA 2GIVA 5E1WA 3CUQC 1CF7A 4KT5C 4KMUX 2G9WA 2K02A 2EWNA 4GYIA 3GFLA 2RNJA 3KP5A 2RVCA 5EEHA 3J81K 1V4RA 2DFIA 3H3ZA 3WGIA 2OBPA 2RC4A 1HW2A 4LGWA 3RIRA 3BROA 1FWZA 3I53A 3EDPA 3OOPA 2WC2A 3F8BA 3IRQA 1MD0A 4HQMA 5LHGA 3DP7A 4KIBA 3AAFA 1FYLA 4WK8F 2ZXJA 4KA4A 2IRFG 3C7JA 4EJTA 3GXOA 4ESJA 2XAFA 2VE8A 1FBSA 3P7NA 2CGPA 4R8HA 3BJOA 1CF7B 1Z6TA 5ICFA 3HUGA 4LJZF 4RAYA 4XLNF 1U2WA 3T8TA 3F8NA 2DT5A 1W5SA 3ZPLA 1XCBA 4OMZA 2F5FA 4G8XA 1RIOH 1DPUA 1OR7A 1SFUA 2DPUA 5AIQA 5J8FA 1XGSA 2STTA 5FLXZ 1ZREA 3LQRA 4Y17A 3I59B 2FBKA 1KYZA 1XSVA 5FD6A 4EJOA 3PQJA 2FF4A 4KIGA 4ENNA 4LG0A 1ZARA 1Y0UA 3F22A 4XLPF 3HRUA 1BI2A 4P55A 4OMYA 4U7BA 3DEUA 2IW5A 1P4AA 5HS9A 5CJ9A 5D4RA 2PI0A 3FXRA 3RPQA 3TKYA 1HSTA 1HW1A 5F6FA 1QBJA 1OPCA 4G6DA 5K5RA 1G3SA 3RPUA 5ICEA 4L9TA 3G73A 4HOBA 1PDNC 4OINF 2O61A 4N9HA 2GQQA 4Z2YA 5CVUA 1TW2A 2Y75A 1FT9A 3HSRA 4KDPA 1ON2A 1FNNA 4WX9A 2VT3A 2PJPA 3E6BA 4A2UA 1ZRDA 3MFKA 5F1RA 3MCZA 3FX3A 3R4KA 4I09A 4IXAA 1Z1DA 2L4AA 5E8IA 2IA1A 4ZH4F 1Z05A 4WXCA 1R58A 2K27A 3SHFA 4L0YB 2GA2A 3K1MA 5D4SA 2EB7A 3E97A 1IXSB 4HV6A 1R5GA 3IC7A 2DQLA 2HKOA 4G7OF 5J8CA 1YG2A 4S04A 3TOBA 2FBIA 3RKWA 3Q9VA 1BI0A 3RKXA 1YO5C 3IKTA 1T39A 1XCVA 1W4MA 5E17F 1D3YA 3O6BB 2P7CB 2PEXA 1MJBA 4XSZF 1S3JA 4U0YA 3GUDA 1ZHFA 5DD4A 3M8EA 4PGHA 2RGVA 2PG4A 2D2WA 4PGGA 2Z99A 1S8NA 2O0YA 2VBZA 5LLQA 1WI9A 1FPQA 1G3WA 1SMYF 5L3FA 1AWCA 1TQIA 1MZBA 1IN5A 1GXQA 4QWQA 2IP2A 3WGGA 4L9NA 5D5XB 5FO5A 5TRDA 1WWXA 2ZCWA 4EQQA 3QU3A 2P5KA 5HS8A 3JAMZ 3WGHA 1XMAA 4MGRA 2FNPA 4I98B 2P5LC 3FHZA 4CHUA 2M45A 1DUXC 4HBLA 3M8FA 2KIMA 4ETSA 1Q1HA 4R1HA 2PLYA 3JTGA 4RB1A 4O6JA 3ECOA 4BYYA 4M9SA 4LD5A 1RUOA 3QU6A 3JSOA 4P9FA 1IAWA 4IHTA 3VFZA 2R3SA 1XMKA 3IWFA 2V9VA 2FEZA 1U3EM 3NQOA 3KP3A 3GFJA 4LK0F 3KEOA 5HLHA 3HOTA 1W5TA 3F6VA 4A12A 3BPXA 3R0JA 1HXDA 3BY6A 1K7AA 3F8MA 1IZ1A 3TO9A 5BPIA 4A0ZA 2EV0A 2HEOA 3LSTA 2K86A 2PFBA 2IPQX 4TV7A 3CDHA 2V1UA 1OYWA 2DI3A 2HZTA 5JVTA 4UHTA 5L3GA 1FBUA 2OU2A 2ZO4A 1IN6A 1R22A 1YS6A 2H09A 2IJLA 2O8XA 2NRAC 2JPBA 3FMRA 2P6TA 1Z91A 5A2QK 3WU1B 1J7KA 3I64A 2ESHA 5ILSA 3ECHA 4YG2F 2XKOA 1REPC 1XGOA 3ELKA 2BGCA 2A61A 2JPCA 3E6DA 2QWWA 4RGSA 3ABTA 1S7OA 3K0LA 2EA2A 4MEYF 3HYIA 2HYFA 3F21A 3FWEA 2NS0A 2Z3YA 4HDVA 4OU0A 2FRHA 2GWRA 4P9UA 2VT2A 2K4BA 4JBAA 1O7LA 1Z7UA 2XKPA 1FSEA 4QLCU 3N97A 1ZG1A 1T2KA 1FSHA 5AONA 3MEXA 1XSDA 4MTEA 2Z9OA 4ZYDA 2PN6A 3GZ5A 3IHUA 3PQKA 2DPDA 4B09A 3M1EA 3B73A 2ISYA 4IRHA 3IRRA 3O2PE 3KP2A 1UB9A 1G4DA 1YYVA 3JTHA 1HKSA 3SXYA 2A6EF 5DCMA 2K7LA 4LMYA 4BHPA 1R23A 2DLLA 4RGRA 2DU9A 1K6OA 2QUFA 1HW5A 4BHCA 4A0XA 1LVAA 4KIFA 1GXPA 1WRJA 3KZYA 2A68F 1P92A 4WF2A 1RUNA 1Z9CA 1B9MA 2FQ3A 2XAJA 5ED4A 1STZA 1KQ9A 4HYEA 1QZZA 3WTXC 1SAXA 1R00A 1F4KA 1TQPA 2P7VB 3V8LA 2R7DA 3LAPA 5LHHA 3U9GA 3I54A 2KJBA 4IVNA 2TDXA 3T8RA 1LQ1A 5F64A 4M9ZA 1ZLKA 2ETHA 2FMYA 3RI4A 5IT9K 1WSUA 1LEBA 1R5HA 5ERIA 5BQTA 1IF1A 4DNCA 3GF2A 1FY7A 3GYHX 2XV4S 3W6JB 4XBFA 2HR3A 4HV5A 4HLYA 4MQVA 1A04A 3GFIA 2DW4A 1K79A 4ZYEA 1DDNA 4GYGA 3E5UA 3RDIA 3P9IA 3EYIA 3FXQA 1SD4A 2NYXA 3QPTA 2YU3A 5BMZA 4FT8A 2Q8KA 2CG4A 1P4WA 2ACJA 5DD8A 4YFNF 5DCFA 2PQ8A 2LDUA 4OIRF 2GZWA 3CO6C 1S7AA 3I59A 4AWXB 4EVIA 2ZFWA 4KYWA 2FXAA 4FHTA 1L0OC 4GO1A 1H0MA 4AVPA 2VXZA 2XROA 1ZYRF 1MJAA 3FMSA 4HAMA 2OQGA 4EGYA 2PBIA 3V4GA 1KQ0A 2KIUA 1QO0D 4L5JA 1XD7A 4OIPF 1T38A 2KRFA 3HTSB 4I01A 2VOOA 1SD5A 2OZ6A 1MJ9A 3TDUC 4Y13A 2H27A 1T98A 2HFHA 3GX4X 3D0SA 1XB4A 3R6SA 1IRGA 4EJVA 2FA5A 3L00A 2G7UA 3K69A 4PZJA 1LDJA 4A6EA 4EGZA 5E1ZB 3R60A 3BOQA 4Q4ZF 2M1BA 4ZYGA 1RI7A 1LDKB 5K5QA 1YW9A 2Y48A 4U88A 2MA3A 1FC3A 2GAUA 1MGTA 4PCQA 5HDKA 4IPAA 2X0LA 3K1NA 3ROUA 2C6YA 3QOPA 3SFZA 1XGMA 2MBFA 2YSRA 2VONA 4A6DA 1G3TA 4I0BA 2HQNA 1SFEA 2QBYA 1J0RA 4M71A 1VTNC 1B6AA 2QQBA 3I4PA 2XVCA 2R7FA 2FBHA 3HIFA 4GGGA 1BJAA 4KICA 2DQRA 2XAGA 2XIGA 3IL2A 3GW2A 5D5UB 1WKMA 6PAXA 4ESBA 2LKPA 4ZZLA 1TQMA 4HX7A 2EFWA 3I58A 4JK1X 4U7DA 1BI1A 1BBYA 3IKVA 3TO7A 4LFUA 2UWMA 2RN7A 3WTZA 4WCGA 1ODDA 2BEOA 1GHCA 3LA3A 2CYYA 1B9NA 4KN7X 4F7ZA 1XN7A 1R1UA 3LFKA 5FB2A 2ELHA 3HOSA 1S6LA 1U5TC 3F6OA 2QBYB 3C3WA 3M9AA 1HBXG 1W7PD 1RZ4A 1PP8F 4YFKF
chains in the Genus database with same CATH superfamily
2Q0OA 1JGSA 4LLLA 2VJJA 2XRNA 3HHHA 2UXNA 3L2UA 3SJMA 3LSKA 3BG9A 2OA4A 3FHNA 2V4JC 3DQVC 4GFBA 4LIUA 5D5VB 4II2A 4A3FJ 4BQQA 4ZTFA 4H0EA 3VOEA 1ZLJA 2M0MA 2DA4A 1LE8B 3F72A 5GADJ 2L9VA 3WTSC 2K5CA 3G2BA 1LDDA 1Z0XA 3BJAA 3DLAA 2EZLA 3QYEA 1N78A 4P1WA 1R36A 5EEGA 2HOEA 4NB5A 2LC2A 1TP4A 1UHSA 3GCMA 4IQ4A 5H6QA 1O57A 3BDDA 1KU3A 2B7EA 4W1UA 2BXYA 4PJ0C 5HS7A 5FROA 4DQ2A 1E0EA 1K6YA 5IT9Z 1OISA 3K1PA 1W5CC 2WWYA 3GWZA 2ID3A 2JRTA 5B1BH 5CVJA 4RM3A 3A02A 3C1DA 2F6CA 3FIWA 3G1MA 3GVAA 2JWTA 3PNTA 4P96A 4HRIA 3ABUA 1MMDA 3NAUA 3K70D 2CW0F 5AIPA 3HJEA 2E35A 3N4MA 2DJIA 3U2RA 2P6SA 1HC8A 4GXOA 4CA0A 3CUQA 2HOTA 2AS5F 5LGUA 3G3ZA 2WY7Q 4EM0B 4IHSA 4CCOA 1TBXA 2LBFA 2MLGA 2W57A 3H36A 1G3YA 4LB6B 4M3EA 1TTYA 3L2RA 2YU9J 1J2XA 4I7HA 2FU4A 5FRNA 4C2UA 2EFOA 4BH9A 1FOKA 3H5AA 1UG0A 2ZFUA 4JYKA 1I1GA 2LYCA 2ZNYA 4C3IJ 1NTCA 3T0YA 2STWA 2FE3A 1BJZA 2LG4A 1JT6A 4QSHA 2QZ8A 1HDPA 3V8KA 4Q48A 3CCRI 5D6FA 5GAGJ 1MKMA 2DMNA 1OKRA 4G94A 3WE2A 3J81Z 5DUIA 2VPLA 2FUG2 4AIJA 2X4HA 3LAJA 2EJRA 2WB1N 3FBIB 3COAC 3VWBA 2F4IA 3RYPA 5M5XJ 3LFUA 5D8LB 2P8TA 2VKEA 5HLGA 2HQ5A 2RDPA 4EV0A 2E2JJ 1FP1D 3WODF 5KK1A 4RAFA 1FP2A 3K9TA 4CDGA 3JRFA 2W25A 3K4KA 2DMUA 2HXOA 2L2OA 3HSEA 3K10A 4AM3A 3BZKA 2M3AA 3GZNB 4CXFA 2K9MA 2EA4A 3CUQB 4FCYA 4BEHA 3W6KB 2DDAA 4LLNA 4BAYA 2F5DA 2VE9A 3I0TA 2L5QA 5FFZA 2JA5J 1I6XA 3ISPA 1JTYA 1JHFA 3B02A 5DM6F 1AOYA 1U78A 2DDBA 3GO5A 2LKXA 2FQ4A 1WJEA 2RAEA 1U9NA 3GFMA 4A5MA 4A69C 4HPQA 1D0YA 3L9FA 2VBXA 3RYRA 1BOAA 2M4KA 2ECBA 1IUFA 3E3VA 3LSGA 5ILUA 3QRFF 2JTVA 4XLAA 2VODA 2HI3A 2JUGA 5E3MA 5LRRA 3S1QJ 2CSOA 3E5QA 2X48A 1D5VA 4WXDA 4YEJA 2F2EA 2L54A 1BW6A 5CVRA 4BY1J 1F5TA 1SVOA 3E5XA 2ZJ2A 3UNGC 2IA2A 2NVYJ 3H9QA 4BKXA 2FJ1A 3WTVC 1B4AA 1X4OA 1YHQI 1R4NB 3PUBA 4AUXA 2ZB9A 2XHKA 4DJAA 4CCNA 4NC7A 4IHYA 4BEHB 4GRIA 4DOZA 4EM2A 5E18F 1VF9A 3O3KA 2XUBA 4MFEA 2HXIA 2DA1A 2QM3A 3ZP5A 5GAEJ 4RGUA 2M2EA 3CO7C 2HGCA 3OV8A 1SANA 4BUPA 1T8IA 1BC8C 2FSWA 3K4BA 2YX4A 5H2FC 1OQYA 2M8EA 5K7ZA 3CC2I 4KNYA 5M5YJ 2I5UA 1CQTA 2Z33A 2R7ZJ 4G7HF 5JR3A 1E17A 5DUKA 3TEDA 2JZYA 1H9GA 2YUSA 2LF7A 3HGGA 4OOIA 5HNHA 1ACIA 1X19A 2A5WA 1X3UA 2P4WA 2GIZA 3DKXA 3LA2A 2QQ9A 3K2ZA 1QQIA 1EA3A 5KVRA 2D1HA 4CGZA 1UHMA 4RB3C 4IF4A 1RRJA 4O3MA 2QVOA 4DGWB 1HKTA 5BS6A 2V9PA 2BHZA 3H9JA 1W7PA 1PP7U 2VB6A 2KHMA 1J59A 2JSCA 5CVVA 2HOSA 3C2BA 4CCLA 1GV5A 1W1WE 2R93J 5TISC 4FE7A 2M30A 1R6RA 4M74A 1OR7C 3PFIA 3NRVA 1K61A 2Y69H 2Q1ZB 4LIVA 3D1NI 1SC7A 3FXUA 1YRNA 3HKZA 1YI2I 2K9LA 4IEJA 1K78A 3QAHA 1LVKA 2EV6A 2VQGA 4LB5A 1D8KA 3V7CA 1I39A 1A36A 4IHVA 1XC5A 4BQAA 4I0AA 1QVTA 5IP9J 3OYCA 1XX5A 4BNCA 3LA7A 2NVQJ 3R0AA 4PJMA 5DDGA 2NVTJ 3JR9A 4A3JJ 1X3WB 2LKSA 1ZK8A 3HEFA 3KETA 1T33A 1JHHA 2X1EA 3EYYA 3TGNA 1X2NA 3WE3A 4L18B 2Y31A 3CF2A 4JX5A 2DTRA 3CESA 2DA2A 4OIQF 9ANTA 2PMZN 1V5FA 3H35A 1RR7A 4HX8A 2DA7A 1QHHD 2KPMA 1SD7A 2E5ZA 2XPVA 3ZMTA 4I02A 4MIMA 1YLFA 4DBQA 1TNSA 4RLFA 2M87A 2MYSA 1Z3XA 1X4PA 4MO7A 4UVBA 1MDMB 3MZHA 1EH7A 2MLKA 2DO7A 4CH7A 1W7PB 4EM1A 2DFHA 4IOAF 2IT0A 2VN2A 4BQNA 3NARA 3GTPJ 1B1BA 1MH3A 3CZ6A 4R79A 2KIFA 1NG7A 1KU2A 5M5WJ 1LEAA 2H8WA 3FF5A 3QOEA 4M6YA 2CO5A 3VEPA 4AIKA 4D9JA 3KEQA 3DXJF 4UUVA 4BE1A 1BL0A 3M7GA 4XSXF 1YRNB 1YTYA 2Y0SA 4V2FA 1K78B 4MEXF 1X1BA 1ZRFA 1ETVA 5IP7J 1D8JA 1Y39A 5FGMA 4C30A 4G7ZF 4RB2C 1PVEA 3ERMA 2GM4A 1IW7F 3NEUA 4PDKA 1IRFA 3WG7H 3V8JA 4XLEA 4HSTA 2ZKZA 4DIQA 2NXNB 3RJPA 3OYIA 1XGNA 4XIDA 1U6GA 3KZZA 2FNAA 2DA5A 4ESFA 3KCCA 3J80K 1HKQA 5CQEA 4WWCA 3RPUD 5FKMA 3DWLE 3ZQLA 1K4TA 2WV0A 2ESNA 5E8GA 2FOKA 3IAM2 4XRSG 3HHGA 2DCEA 1V3FA 4RGXA 3BR3A 2QYOA 3H0DA 3F23A 2M5WA 5K7FA 2HQRA 1BI3A 5E20A 4XK4A 1VZ0A 5IPAA 1ZG5A 4JP0A 4OAZA 4EJUA 2DOAA 2BXZA 3W6VA 2YX7A 2JRMA 1IXCA 2LNBA 1EV7A 4UXNA 3M8JA 1BM9A 2WAEA 2HKXA 3CCSI 3KLOA 3WG9A 1OMIA 1ZAOA 3R61A 1EH6A 2ZMEB 1JXSA 3DBHB 2AXLA 2DFFA 3GEZA 1MBKA 1P7IA 3DPTA 1YJ9I 1DQUA 2O6GE 5D8KB 2DMQA 4J00A 2LY2A 2UUZA 1QVUA 2GXBA 2E7XA 4MFDA 3ERED 2JA6J 1YITI 1HCRA 4MHGA 1LJ9A 4XRFA 1G2HA 4KJZA 3CUOA 1TWFJ 1ETOA 1MMNA 1H89C 1B59A 3QP6A 2DFEA 3BG5A 1TLHB 3L2CA 1MBHA 3PUFA 4HDUA 1OCRH 1UMQA 2M8GX 4MNUA 4F92B 3F8FA 5TGTA 5EGOA 3CCUI 2GA1A 2DN0A 1WJ5A 2L4MA 2X6XA 4BQOA 1VQKI 3TO6A 5ICGA 4LK1F 4B3XA 5D5WB 1MMAA 3IH4A 1IDZA 4DYCA 1YFHA 5B66C 1R7JA 5LEJA 1PYVA 1MBGA 3QQAA 3QWLA 2G0EA 3X2QH 4CZZA 3P9KA 2R7RA 1R71A 2RNGA 2EZKA 2FX0A 3BG7A 4OIOF 1NK2P 4Q47A 4XOTA 2KP6A 2K40A 3LL7A 2VBYA 1DPRA 4NQWA 4DYRA 4BJ6C 1XTAA 2IEKA 3FISA 3OOUA 1AKHA 4UNOA 3MQ0A 4HA8A 1A6QA 1U8BA 1ON1A 2MFZA 3MWMA 2VKDA 4UY8I 2A3SA 3GZ6A 1X3ZB 4Z6YA 5F04A 3VYRB 1I3QJ 2MD5A 3DPLC 5J6XA 3OYAA 1R9TJ 1MSFC 2A07F 4XLCA 1JT0A 1D1AA 1ENHA 3GLLA 2XAUA 2V1NA 1ZGWA 3HM5A 4XLFA 3HTUA 2ME6A 3HSFA 3JAMK 3SZPA 1SMTA 1RNLA 4UVAA 2QEXI 3KZIC 5EGOB 3CJRB 1ETKA 4IRGA 3RQ4A 1IN7A 1G6NA 3DKWA 1BIAA 4BL0B 1USSA 4BBRJ 1KA8A 3BPVA 3ZCOA 2PMHA 5B3SH 2DT7B 3IWZA 3OY9A 2HDDA 3K4JA 1USTA 4D0PA 3UKGA 3S2WA 3WU2C 1O3SA 2LD5A 3K4NA 4UV9A 3EUAA 5L3DA 3OIPA 1FJLA 5JLXA 2A5YB 2NNYA 5A2QZ 5M3FJ 2QENA 1OYIA 4Y3OA 5GP9A 4MQ9F 2OD5A 2VC0A 5DYMA 2R7WA 2BOLA 4NQWB 3OYKA 4UUTA 5GPAA 3V7SA 3HG9A 1P2FA 4A3DJ 2XRLA 5J1RA 4BJ5C 2V79A 3PL8A 2D1VA 4XKVA 2J5OA 1HA8A 1XS9A 2HDCA 4L5IA 2BHYA 4E7ZA 3JRAA 1SFOJ 3BWGA 4M72A 2NOJB 2L9NA 2QLZA 5LGTA 2EFNA 1J9IA 4U0WA 3OYGA 1JGGA 4HF1A 1KGSA 2EIJH 4Y15A 5JI6A 1HQCA 3CDIA 2HS5A 3DU6A 5H20A 4F91B 2EFPA 2X6OA 4LITA 4XL9A 4HNVA 5IOZA 2W85A 4ZZDA 3K4MA 1KQ8A 1HSJA 1D1CA 2HYJA 5E1XA 3ZXSA 3MKYB 2B0LA 1QRYA 1GVJA 3OL4A 3DV8A 4PJNA 2HPMA 1TT0A 1XPXA 3CF5F 1ZKGA 1SVMA 1F1ZA 2QSGX 5K5OA 4RAZA 4B8XA 4X6AJ 2RKHA 2K9QA 5L3EA 1QNTA 3ZN1A 4YIFA 3BP8A 4XKCA 3KYLA 1BIBA 1QPMA 2QQAA 3F3XA 5HDGA 3RTRA 3LSRA 1YE9A 4E70A 4C2TA 1DP7P 5F0FA 2LP0A 4Y7NJ 2HZDA 3TMOA 4EJWA 3KP6A 2JVHA 2W82A 5H6RA 2ADUA 2DAOA 4HF0A 3ABKH 1JE8A 4B1RA 1UELB 1I5ZA 2FD5A 5HDNA 1ERDA 2DK8A 1XG1A 3PJRA 5IT3A 1YW7A 2F48A 2CMPA 1LB2A 2DTZA 2A6HF 1FX7A 1A5JA 3VB2A 1S9HA 2E19A 2W24A 2WY8Q 3H3UA 2V1DA 5KAFC 1W36C 5EDNA 3JRGA 3KP7A 1SD6A 2COMA 3OR2C 2XDVA 4G6TB 3CJNA 5BOXA 4LG0B 1IUYA 3A01A 3JRBA 4UB8C 1IN8A 3VSKA 2MH2A 4YFXF 4RB0A 4IRIA 1BN5A 1PUFA 1ZELA 5IYBJ 2CWEA 2YR2A 3DBRB 2WA0A 2IA0A 3J80Z 2G7HA 5J4VA 2F5CA 1YW8A 2E1MC 4ZYHA 3HZJA 1X1DA 4BDZA 3E0JB 2RREA 2HTJA 4HX4A 2L7KA 2Q2EA 3HRSA 4EATA 3LSMA 5J3LA 4RS8A 3HRTA 5HLTA 2XASA 4BHBA 1EH8A 2ZNZA 1T0FA 3FMQA 4XN0A 3DF8A 4B44A 3L09A 5CKTA 4F55A 2CUZA 3J7YJ 1YJNI 2KISA 5LRSA 1T6SA 2W84A 1Z7LA 4E7SA 3S17J 1NK3P 2PMUA 2OF7A 1OYYA 2EV5A 2IS4A 3AG2H 1ZH5A 3WTUC 2DBBA 4N4OB 3JRIA 4BE0A 2H94A 2KKOA 4KN4X 1JKPC 1TNTA 2NAZA 3EUHA 4UV8A 4FE4A 2AXTC 1RPWA 2AQFA 3K4LA 4C3HJ 4ENJA 4E7HA 4GCVA 3FZVA 5C4JJ 2XAQA 2MSYA 2VJIA 3L1PA 4L5EA 2GXGA 1H9TA 4N4NB 2BYVE 2XF6A 1SFXA 3A01B 2F5EA 2OAZA 3ZMVA 1P6RA 3PIPF 2CQ7A 3I5UA 1IXRC 4XM3A 3E6CC 3TQNA 4HQEA 5TJJA 1F43A 3VPRA 2WV1A 4AVZA 1I6HJ 3QYBA 4PFOA 1PUFB 4M9XA 2LY1A 2OCCH 2ZXWH 1HLVA 3S1RJ 2W48A 4ZJZA 4WXHA 3Q0UA 1KU7A 2BY2A 3L2WA 1NG6A 3DCFA 3IAS2 2CFOA 2Q2EB 4HZFA 1W0UA 3HOZJ 4JQFA 5HOOA 1RKTA 2O03A 2OQRA 3J7ZI 1PUEE 1D5YA 1FOXA 3L7WA 1J75A 3EETA 2KFDA 4A5NA 1AHDP 3DFGA 5DS9A 2JVGA 2RV8A 3HRMA 1FZPB 4PSXA 3KP4A 1F36A 3CP2A 3EQLF 2LK2A 3ZN0A 2WTEA 4E6KG 2Z2SB 1P4XA 4M3GA 2H8RA 3BR0A 3RKYA 1WJDA 4L9VA 4ENMA 3MAJA 3JW4A 3OS2A 2MG4A 5DEQA 1LUJB 2XPWA 4AD9A 1S29A 3ZMSA 3SDGA 5LHIA 4U87A 1LNWA 2CQXA 1FYKA 2CFXA 3BQZA 3Q0WA 1LFBA 3BZ6A 5DV5A 4L0ZB 3H5NA 1N75A 1BA5A 2BV6A 3G1OA 3JRDA 2DJNA 2CQKA 2VC1A 3BR2A 5J1YA 3D5RC 2EQRA 3I9V2 4DW6A 2E7WA 5FFXA 1Z77A 4NUBA 4EEFG 1ZQ3P 4A3MJ 3AG3H 2A69F 1O7FA 3HGYA 5LEKA 4RDUA 3CCMI 4HLXA 1JUPA 2P5VA 1X2MA 2ICWG 5BNGA 2J5PA 3C18A 4N9IA 5LGNA 2JA2A 4RAGA 4XORA 3SZGA 3QPHA 2M7AA 1NHAA 1FLIA 5D6EA 3ZMDA 2CRGA 5M3MJ 3B6CA 3ZMZA 1VI0A 3CMYA 1I1SA 2E1CA 3W2VA 5E3OA 3RCOA 1UAAA 3ZR8X 4G6QA 1WH7A 4KFCA 3Q9SA 2KQRA 4LLGF 2YPRA 2BBYA 4IZZA 1JJ6C 4ZTJA 1Y8RB 3ZMUA 1WZ2A 4IL6C 5L3CA 2XGEA 3OYMA 1XDSA 2R7UA 2KMUA 2HYGD 1JUSA 1OCCH 3OR1C 4A3IJ 5FD5A 2KL4A 1G8XA 2LF8A 3H92A 2K4JA 4I6ZA 4PJJA 2IAIA 4I2OA 2WAQA 3FM5A 2NS7A 4XNFA 3PSFA 4C3JJ 1ONVA 4ENKA 2OZUA 2VBWA 4NHJA 1WQ2A 2CU7A 4FX4A 1WHUA 2QA4I 5LFAA 3OS0A 3P9CA 3A1YA 2O8KA 3ULQB 2IVMA 3H0GJ 3HC7A 4N0BA 4U0VA 4CO8A 3CCLI 4CYCA 2EK5A 5JFRA 1UCRA 1FOYA 2L02A 2V1XA 1L3LA 1DGRM 5JLWA 1MBFA 4MTDA 2FMLA 5BPDA 3M1CA 2ZBKA 2UXXA 3SDBA 4XRMA 1FBQA 2VL8A 3CTAA 1MDMA 1FEXA 1EKEA 2KJCA 1E2XA 4L9JA 1IG7A 3FBNB 3ML6A 3WU0A 4Q5SF 2V6CA 4B3AA 3OIQA 2LSOA 3DLLF 4P5OA 1O3QA 3G1LA 1APLC 3AL0B 3MKLA 1I50J 1DP3A 3ZQ7A 2EFQA 5FLXK 3FM3A 4FX0A 1ZG3A 2E1NA 2BE5F 1ZN2A 3LWFA 2JT1A 1U5TA 4A0YA 1C0WA 1BC7C 3HB9A 1P9QC 3I71A 1UHWA 5FKOA 5ILVA 3WTTC 1QGPA 3KEYA 1Y6IA 1Y1WJ 3CLOA 4FASD 3G71I 1BR4A 3T1BA 4XLHA 1M1EB 2XGXA 2O3FA 4QTRA 1R5ID 2MD0A 1ZGAA 2WADA 5B1AH 1O3TA 4ON0A 1FOWA 3SZTA 5HODA 2ZJPF 4KUMA 3WTWC 3QP5A 1R1TA 3T5XA 4AIHA 1RC9A 4UVCA 4A3KJ 2L3DA 1CGPA 4CYCB 2Z5UA 4V19K 4BXXJ 1XDUA 4C9YA 1IRXA 4RBOA 4IKFA 4KMFA 3BQYA 1EF4A 4O5VA 4K2EA 1Z6RA 3KLNA 4ASNA 2OV7A 2Y2ZA 5B5EC 4XICA 3S8PA 1K4SA 4KITB 2L01A 2CUJA 4B47A 1WCMJ 2DK5A 4IOCF 3TDZC 3OYJA 3BJ6A 3SQNA 4YIRX 3HOYJ 5EJCA 2D45A 5CLSA 3D5LA 1ZTRA 3CMEI 2MH9A 4M73A 2R5YA 4ABZA 2VASA 3WTYC 2V9KA 1U5TB 2ZMEA 2H6CA 4J19A 2PJRA 2XSJC 3TOAA 1YIOA 3CCYA 3LQQA 3WHBA 4M6XA 2XC7A 2KZVA 3ZQCA 3GTLJ 1WJAA 3VYSB 2CUEA 3JRHA 1F9NA 1U8RA 3A0HC 1FYMA 4YIIA 2L7FP 1UFMA 2IBDA 2NOGA 3KX2A 2MC3A 4UB6C 4EMSA 3U1DA 1J5YA 3IUOA 5FRMA 5ICCA 4G9YA 4BS9A 1KONA 3OYLA 3CMMA 3KYCB 3KFWX 4NC6A 5KAIC 2HTSA 2HWVA 2NNNA 3LSPA 1KU9A 1YQAA 1ETXA 2XF7A 3MKZA 2XAHA 2KLOA 2ZXHA 3BG6A 2MC4A 2ISZA 2KDZA 3W2WA 1JTXA 1XMXA 1JI8A 3TW7A 2EIMH 1YX3A 3KIOA 3JSPA 5CVIA 4CICA 1UZCA 1O4XA 4GDFA 2WB1A 4ITVA 1R1VA 3F8CA 2HU9A 5CYVA 1MMSA 2Z16A 2K9SA 5JHUA 2CW8A 1VQ4I 4CYDA 2H6BA 5HLIA 4B48A 3ZGKA 2R5YB 2E5NA 2VI6A 3KE2A 3VYUB 4S05A 3PIOF 5LBQA 2KZGA 3OYEA 1O3RA 5K1YA 3GLXA 4IJAA 5L3BA 3TL4X 1TW3A 2PJRB 4AYBN 4BXUA 3I56I 2RQPA 4HF2A 4NDLA 1W0TA 2E36A 5DCMB 5F1JA 1IN4A 3VODA 1YS7A 3M07A 2DT6A 1Z67A 1SVLA 1E3HA 2Y0MA 4B4CA 4ANJA 3SYTA 3K2AA 3Q5FA 3IH3A 2K9NA 3J7AO 3E6MA 1QZYA 2UZKA 1ZGJA 3EUHC 1XSXA 3HBLA 4JOMA 1ULYA 5HVQC 3DEWA 3REOA 3U1KA 2VOPA 3EUKL 3SEZA 2LFBA 1WGXA 2ELJA 1ZRCA 3JCUC 3C2GA 3MZYA 4HW0A 3V7RA 1E3OC 3LSIA 1PJRA 1I27A 1KYWA 1Z3YA 2GIVA 3CUQC 5E1WA 1CF7A 4KT5C 3FKJA 4KMUX 2TCTA 4XQFA 2G9WA 5E79C 1VQ7I 1X1CA 2K02A 2ZJQF 4M6VA 4A3GJ 2R7XA 2EWNA 3QYFA 4GYIA 5F08A 2HDWA 3GFLA 3OSGA 1VQ8I 2QGUA 4JX6A 3SFIA 2NVUB 3S2DJ 4PFPA 2RNJA 3KP5A 5HNFA 2RVCA 2P81A 5EEHA 3J81K 1V4RA 5F27A 3A03A 1QU3A 2MGQA 1TT5B 2IGMA 2DFIA 3H3ZA 2NVXJ 3EPZA 3WGIA 5FLMJ 2OBPA 2RC4A 2IS6A 1HW2A 4LGWA 1RR8C 3RIRA 4XRSA 1FTZA 3BROA 1FWZA 4HNTA 4A3EJ 3I53A 3LMMA 3EDPA 3OOPA 2WC2A 2DODA 1VFCA 2E2IJ 4OAYA 3F8BA 3IRQA 2QQ8A 5GAHJ 3FK7A 1MD0A 4HQMA 2GOXB 3DP7A 4KIBA 4D5CA 5LHGA 3AAFA 1YIJI 1FYLA 4WK8F 2ZXJA 1QPIA 4KA4A 2IRFG 5J40A 3JRCA 1IDYA 3C7JA 4EJTA 3OYFA 3GXOA 4X0GA 4ESJA 2CH0A 4A93J 3RSNA 2KRCA 2BZTA 2XAFA 2VE8A 3Q3SA 1A35A 1FBSA 3P7NA 2CGPA 2GXAA 4R8HA 3BJOA 5GPCA 3MKWB 1NH3A 1Z6TA 5ICFA 4BXFA 1CF7B 3HUGA 4LJZF 4RAYA 4XLNF 1U2WA 3T8TA 3F8NA 2DT5A 4DBRA 1HF0A 1W5SA 1HOMA 3ZPLA 3HXLA 1XCBA 3PO2J 2XSDC 2QF7A 3MZ8A 4OMZA 2WAFA 3HOXJ 4XN3A 2F5FA 4G8XA 2R0QC 1RIOH 1DPUA 1R4MB 3I55I 1OR7A 1SFUA 2DPUA 5AIQA 5J8FA 1XGSA 2LR8A 2STTA 3MMYB 5FLXZ 1ZREA 2X6WA 3LQRA 1DGWY 2W1OA 4Y17A 2DA6A 3I59B 2JQ7A 2FBKA 1LPQA 1KYZA 1XSVA 3ONQA 4CCJA 4IHXA 5FD6A 2CUFA 4EJOA 3PQJA 2GLOA 2HVRA 2FF4A 2QSFX 4KIGA 4ENNA 4LG0A 1JKRC 1MBEA 2VUMJ 3SEQA 2OC6A 4ZC3A 1WJCA 2AQEA 2PMZA 2A05A 1ZARA 1JJ8C 2VQCA 1Y0UA 3H5RA 2L7MP 3ABMH 2M9HA 3AL0C 3F22A 3E1SA 3OS1A 4XLPF 4BY7J 3HRUA 1BI2A 2X6YA 4P55A 4OMYA 4U7BA 1T56A 3HUGB 3DEUA 2F5VA 2ZSHB 5KCMA 2IW5A 1P4AA 3DKYA 4BACA 5HS9A 5CJ9A 5D4RA 2PI0A 2CQNA 4FTHA 4ZDLA 1VQ9I 1E3PA 3FXRA 3RPQA 3TKYA 3FXJA 1HSTA 1HW1A 5F6FA 1FIAA 3FXMA 1QBJA 1FTTA 1OPCA 4G6DA 5K5RA 1G3SA 3RPUA 5ICEA 1OCOH 4L9TA 2ZSIB 5C4XJ 3TBIA 3G73A 4HOBA 1IO2A 1D0ZA 4OINF 1PDNC 2W7NA 5FJ8J 1T08B 4N9HA 1VQPI 2O61A 2GQQA 2K3FA 5C3EJ 4Z2YA 3AG4H 5CVUA 2W4SA 1TW2A 2Y75A 1FT9A 3HSRA 4KDPA 2V26A 2VQLA 1WPKA 1Y0NA 2BW3A 1KZHA 1WJBA 1ON2A 1VQLI 1FNNA 2L9RA 3HOWJ 2Y30A 4WX9A 1YJWI 2VT3A 2PJPA 3V42A 3ZQIA 1T95A 2HVQA 3E6BA 4A2UA 2O9LA 2IGNA 1ZRDA 3MFKA 1W36D 5F1RA 3MCZA 3HKZN 3F9KA 1LFUP 3FX3A 3R4KA 2LH9A 2UV1A 2R5ZA 3GMEA 4I09A 4IXAA 1MW7A 1Z1DA 2L4AA 3A4CA 5KHDA 5E8IA 4IQJA 2IA1A 4V2GA 2RQQA 4ZH4F 1Z05A 3OSFA 5GTIC 4WXCA 1R58A 2K27A 3PNYA 3SHFA 4L0YB 2GA2A 1U0JA 4DZPA 2VJ4A 1OLTA 3K1MA 5D4SA 5LD2C 3BR6A 2EB7A 3E97A 3BTJA 1YOVB 1X1AA 1IXSB 4HV6A 1R5GA 1V54H 3IC7A 2DQLA 2E34A 5IYDJ 2EH3A 1H8AC 2HKOA 4AYBA 4G7OF 5J8CA 1YG2A 3LSJA 1X1PA 4RM2A 4S04A 1WI3A 3TOBA 1Z21A 1Y8QB 2FBIA 3BZCA 3K70C 3RKWA 2L9SA 5IP6A 2L7ZA 3Q9VA 1BI0A 3RQIA 3RKXA 1YO5C 2BW3B 3Q0VA 3IKTA 1T39A 2CV1A 4BDYA 3CD6I 2OTJI 4XONA 1XCVA 3TP3A 2EZIA 1W4MA 5E17F 1GVDA 4II3A 5EG0A 1D3YA 3O6BB 3DPUA 2P7CB 4E7LA 2PEXA 3QPLA 3BLYA 2ID6A 2ZMEC 4D5FA 1MJBA 2Y0SN 4XSZF 3ZQQA 1QZEA 1S3JA 4U0YA 2R5ZB 3MN2A 2LREA 3GUDA 1ZHFA 3W3CA 5DD4A 3RZDJ 3S3OA 2CQQA 3M8EA 4PGHA 2RGVA 2PG4A 2D2WA 4PGGA 2Z99A 1S8NA 2O0YA 1X58A 2VBZA 3FXLA 3ZRGA 3ZQHA 2X51A 5FLVA 5LLQA 1WI9A 4QPOA 1FPQA 4LOCA 1G3WA 4M3DA 3CLQA 1SMYF 1ZR4A 5L3FA 1AWCA 1TQIA 2KT0A 1MZBA 3OYDA 4PUSA 1IN5A 1GXQA 1VQ6I 2R7OA 4MLOA 5EZHA 3FDYA 3UR3C 4QWQA 5CQGA 2IP2A 3WGGA 5E3NA 3L2QA 2X1DA 5FKNA 1WVRA 2E2HJ 4L9NA 3CC4I 2LTPA 3CCVI 2KIQA 5D5XB 2V6EA 4M3FA 5FO5A 3S15J 1WWXA 5TRDA 3S32A 2ZCWA 4EQQA 3NWSA 5EG0B 3QU3A 2HVSA 2P5KA 5HS8A 5DM7F 3JAMZ 1JUMA 1OFCX 3WGHA 1XMAA 1IC8A 4MGRA 2FNPA 2QCOA 1VQOI 1WFXA 4I98B 3CCJI 3ABLH 3FHZA 2P5LC 3S3NA 1GT0C 4CHUA 2M45A 1DUXC 2QKMB 1B72A 4HBLA 3M8FA 2KIMA 4ETSA 2I8DA 1Q1HA 4R1HA 2PLYA 3JTGA 2XB0X 4W97A 4RB1A 4O6JA 3ECOA 3CJQB 1IGNA 3I3LA 1AA7A 4NBQA 2LBFB 3ZQFA 4BYYA 3BC8A 4LD5A 4M9SA 1SEUA 1RUOA 1MBJA 3QU6A 3JSOA 3KPHA 2K3PA 4H4KC 5F0CA 2N8GA 2E71A 3BR1A 4P9FA 1IAWA 4IHTA 1D1BA 3VFZA 2R3SA 3H1CA 2IS2A 1FMWA 4DYQA 4QIWN 1AU7A 1A6IA 1XMKA 3IWFA 2V9VA 2FEZA 1U3EM 4RMNA 3NQOA 5J1UA 2QKLB 3KP3A 3GFJA 4LK0F 3KEOA 5HLHA 3HOTA 3TW6A 4KT6A 1BW5A 2DYSH 1MNDA 1Q1VA 2ELKA 3S2HJ 4CCKA 1W5TA 3F6VA 5GTHC 4A12A 3BPXA 3GTJJ 2E1OA 3CCEI 3R0JA 1FMVA 2OPTA 1HXDA 2EINH 3BY6A 1K7AA 3F8MA 1IZ1A 1V55H 3TO9A 5BPIA 4KISA 4A0ZA 2X85A 4IO9F 1DU6A 2EV0A 5FKLA 2HEOA 2JN6A 2HOAA 3LSTA 2K86A 2CV2A 2PFBA 1B72B 1ETWA 1BOBA 2IGKA 1MH4A 2LRDA 2IPQX 3K7AJ 3S14J 3AFHA 2KDOA 3HPHA 3ZOBA 4TV7A 3CDHA 4BE2A 2V1UA 2EZHA 1OYWA 2DI3A 2HZTA 2M0CA 2O5RA 5JVTA 3J7AY 3FXOA 4E7IA 3B6AA 4UHTA 5L3GA 1FBUA 3HOVJ 3IH2A 2OU2A 2ZO4A 4E7JA 1IN6A 1R22A 1YS6A 2H09A 2IJLA 3DEEA 3D5SC 2JJ7A 2O8XA 4BBSJ 1LKXA 2NRAC 2JPBA 3FMRA 2HPIA 2X1CA 2P6TA 1RETA 2XPUA 2D5VA 3DTEA 2KRHA 4YELA 4PSWA 1Z91A 5A2QK 3WU1B 4AC0A 1J7KA 2R4GA 3GTKJ 3RKQA 1TWCJ 1UG2A 3I64A 5KNLA 2ESHA 1EJ9A 3CCQI 4BGDA 5ILSA 3ECHA 4J01A 4YG2F 2XKOA 3G4SI 3CQZJ 1U9OA 1XGOA 2BY1A 2COBA 3BT9A 3G6EI 3C2HA 1REPC 3ELKA 2BGCA 3QODA 3BTIA 2A61A 2YS9A 2EIKH 3CC7I 2O7OA 2JPCA 3E6DA 2QWWA 4RGSA 3ABTA 2BVLA 1ETYA 3HDDA 1S7OA 3IP4B 3K0LA 2DXIA 2EA2A 4MEYF 4G12A 3H3VK 3HYIA 3LOCA 2HYFA 3ESWB 1B8IA 3F21A 3FWEA 1D0XA 2NS0A 1GDTA 4F3QA 1MNEA 1S72I 2Z3YA 4HDVA 4OU0A 2FRHA 2GWRA 2Z1DA 3MD2A 4P9UA 3O8GA 1S5LC 4LG3A 3AKZA 2VT2A 2X9DA 2DOEA 2VIXA 3BTCA 1ETQA 2K4BA 2DA3A 2VXDA 3ZQGA 4JBAA 1O7LA 4F93B 3ASNH 1Z7UA 2XKPA 2VLAA 1FSEA 5E3LA 4AIDA 4QLCU 3N97A 1ZG1A 1T2KA 1FSHA 5AONA 3DTKA 1OCTC 3MEXA 4BJTA 1XSDA 4MTEA 2Z9OA 4ZDOA 4ZYDA 3DU5A 3OL3A 4IX7A 3RZOJ 1UJ8A 4XKWA 3BG3A 3VDXA 3W2AA 2PN6A 3GZ5A 2XF5A 3IHUA 1QA6A 2VKHA 3GTOJ 3PQKA 2DPDA 4B09A 3M1EA 4JX4A 3B73A 2ISYA 3PNVA 4IRHA 3IRRA 2GBYA 4ZYAA 3O2PE 3KP2A 3GTMJ 1H88C 1YX5A 2EPFA 4XOPA 1UB9A 3BCAA 3P5JA 3QPSA 1G4DA 1FIPA 3DBLB 5F0HA 1SFKA 1YYVA 3JTHA 4ZDPA 1VNDA 1HKSA 1TWAJ 2IGOA 1MIJA 4A3BJ 3SXYA 1TWHJ 2A6EF 5DCMA 2K7LA 5DTDA 4LMYA 2F4MB 1GV2A 4BHPA 1R23A 2DLLA 4RGRA 2DU9A 1B8IB 3S1NJ 5EEAA 2VQHA 2V7FA 4PK4A 1K6OA 1BR2A 4FISA 2E1MB 2R92J 1N77A 2QUFA 1HW5A 3IV5A 4BHCA 2BVMA 1DU0A 5JVGF 1I3AA 3I4MJ 4A0XA 1K83J 1LVAA 4KIFA 1GXPA 3M4OJ 1WRJA 3KZYA 2JA8J 2A68F 1P92A 4WF2A 2LY9A 3BR5A 5IOYA 1WJFA 1RUNA 1Z9CA 1RESA 2JSPA 2EILH 1B9MA 2FQ3A 2XAJA 5ED4A 1STZA 1KQ9A 3H9GA 3HOUJ 4HYEA 1QZZA 1HDDC 3WTXC 4I99C 3PO3J 3OIOA 4B43A 1R00A 1SAXA 2R7SA 1F4KA 1Y1VJ 1TQPA 2P7VB 3V8LA 3FK6A 2M4GA 2R7DA 2ME0A 3LAPA 2OCEA 2B63J 2LOOA 5LHHA 3U9GA 3I54A 2KJBA 1G59A 4IVNA 2IS1A 2TDXA 3T8RA 1LQ1A 2DYRH 3KYDB 4FETA 3F0CA 5F64A 4M9ZA 2PX9A 1ZLKA 2ETHA 2BY0A 1T0FC 3GTGJ 1ORKA 2FMYA 2OJED 2XGCA 3RI4A 5IT9K 1P7JA 4D1QA 1WSUA 1LEBA 1R5HA 5ERIA 4F52A 3I4NJ 1VQMI 3JREA 5BQTA 1IF1A 4DNCA 2VKVA 3CJTB 3WHCA 2M7BA 3GF2A 1FY7A 3VYTB 3GYHX 2XV4S 5CPRB 3W6JB 4XBFA 3HL2A 3L2VA 2LMDA 3S3MA 2HR3A 3TP0A 4HV5A 4HLYA 3GBGA 4MQVA 2JUCA 3BTLA 3PSIA 4E4HA 1A04A 3AG1H 2M34A 3GFIA 2DW4A 1K79A 1IRZA 2L0KA 4ZYEA 3PM1A 4FQGA 1DDNA 2H1LA 4NC8A 2F4OB 1BR1A 4GYGA 3E5UA 1IJWC 3FKIJ 4M3BA 3RDIA 4PJLA 3P9IA 2ZJRF 3EYIA 3FXQA 5K7HA 1SD4A 2B9SA 2CV0A 2XGDA 2NYXA 2P0WA 3QPTA 2YU3A 2CJJA 3LSHA 4FT8A 5BMZA 2Y9ZA 2Q8KA 2OUMA 3K4CA 2CG4A 3LNQA 1P4WA 5C44J 2ACJA 5DD8A 4YFNF 1OCZH 2CW7A 2VPRA 4YRVA 5DCFA 2PQ8A 1MMGA 2LDUA 2AO9A 4OIRF 4XMYA 2GZWA 3CO6C 3CMAI 4A3LJ 2LLKA 3FXKA 4OWRB 4S0HB 1S7AA 3I59A 4AWXB 4EVIA 2AHQA 2ZFWA 2ZC2A 1ITYA 3OWTA 4KYWA 1QHGA 1V5EA 2FXAA 4FHTA 1L0OC 4GO1A 1H0MA 4AVPA 2H1KA 2NS8A 2VXZA 2MW8A 2XROA 1ZYRF 1MJAA 2WBMA 3FMSA 1IV6A 4HAMA 2OQGA 4EGYA 3DTIA 2PBIA 3V4GA 1KQ0A 3S1MJ 3OYNA 2HQAA 2KIUA 1QO0D 2GOMA 1XD7A 4L5JA 4OIPF 2JA7J 1TWGJ 1T38A 2KRFA 1RKWA 4UUSA 3HTSB 2HNHA 4I01A 1N25A 4RLQA 1J09A 2VOOA 1SD5A 4QPQA 4A3CJ 3OYBA 2CS3A 3ASOH 2OZ6A 5EF6A 1MJ9A 3N05A 1GUUA 1V5GA 3TDUC 4Y13A 1MSEC 1T98A 2H27A 4DZJA 4CCMA 2I10A 2OTLI 2HFHA 1R49A 3GX4X 3D0SA 2JMWA 1XB4A 2DOFA 3R6SA 1IRGA 4EJVA 2FA5A 4CZCA 3L00A 3M3YJ 3S93A 2G7UA 3K69A 4PZJA 5EYRA 1LDJA 2ZXIA 4A6EA 4EGZA 5E1ZB 4CSWA 1OCPA 3R60A 3BOQA 4E7KA 4Q4ZF 2M1BA 4ZYGA 2K85A 1RI7A 2R7QA 1TZLA 1AKHB 3S16J 4AU7A 1LDKB 5K5QA 1YW9A 2Y48A 2LVSA 5FKKA 4HNUA 4U88A 2MA3A 1FC3A 3K6GA 2GAUA 1MGTA 2ECCA 4PCQA 5HDKA 4IPAA 3E7LA 2X0LA 4D7MA 3K1NA 1Y56A 5J47A 1WH5A 3MVPA 3ROUA 2XB5A 2C6YA 1JKOC 3QOPA 2VJ5A 4HSRA 3SFZA 1IV8A 5EZGA 1XGMA 2MBFA 2YSRA 2VONA 4A6DA 1SAUA 4UUSB 1G3TA 4I0BA 2HQNA 1SFEA 3PFYA 1J0RA 4M71A 4Y4RA 2QBYA 2R7TA 1VTNC 1B6AA 2Y9YA 4CUGA 2QQBA 3I4PA 2WAQN 2XVCA 2R7FA 4D7NA 2MABA 1POGA 2BY3A 5IY5H 2FBHA 3CP8A 3HIFA 4GGGA 1BJAA 4KICA 2DQRA 2E60A 2XAGA 2IXSA 2XIGA 3GW2A 3IL2A 2JK3A 5D5UB 1OJLA 3A0BC 1WKMA 1LE8A 1ZR2A 5JHFA 1MNMC 1VQ5I 6PAXA 4BU2A 5J4YA 2DMPA 1JKQC 3CDLA 4ESBA 1TC3C 4IHWA 2FOWA 1TL8A 4I76A 2LKPA 4ZZLA 1TQMA 4HX7A 4RA2A 3NWTA 2EFWA 3O8HA 3OMYA 3I58A 2QSHX 4JK1X 4XKBA 4NNJA 4HG2A 4U7DA 1BI1A 1BBYA 3IKVA 3TO7A 5IYCJ 3U21A 2W00A 3HPGA 4LFUA 4Y33A 4XR6A 2UWMA 3A2KA 3OYHA 1S7EA 2RN7A 2DMTA 1VQNI 3WTZA 4WCGA 1ODDA 2A6TA 2BEOA 3VSLA 1GHCA 4Y52J 2EBIA 1A31A 2R7VA 3LA3A 2CYYA 1B9NA 2TRTA 4KN7X 1XN7A 4X1EA 4F7ZA 1R1UA 3LFKA 5FB2A 2ELHA 3HOSA 4C2MJ 1S6LA 1U5TC 3F6OA 4HEA2 3BCBA 1GLNA 2QBYB 3C3WA 3M9AA 1HBXG 3GTQJ 1W7PD 1RZ4A 1PP8F 1LFPA 4YFKF
chains in the Genus database with same CATH topology
2Q0OA 1JGSA 4LLLA 2XRNA 3HHHA 2UXNA 2OA4A 3DQVC 5D5VB 4H0EA 3VOEA 1ZLJA 3F72A 3WTSC 1LDDA 3BJAA 1R36A 5EEGA 2HOEA 4NB5A 5H6QA 1O57A 3BDDA 1KU3A 5HS7A 4DQ2A 5IT9Z 3K1PA 2WWYA 3GWZA 2JRTA 5CVJA 3C1DA 3GVAA 4P96A 3ABUA 2CW0F 5AIPA 3N4MA 3U2RA 2P6SA 4GXOA 3CUQA 2AS5F 5LGUA 3G3ZA 4EM0B 4IHSA 1TBXA 2MLGA 2W57A 1G3YA 4LB6B 1TTYA 1J2XA 4I7HA 2FU4A 2EFOA 4BH9A 1FOKA 1I1GA 2ZNYA 3T0YA 2STWA 2FE3A 2QZ8A 3V8KA 4Q48A 5D6FA 1MKMA 1OKRA 4G94A 3WE2A 3J81Z 5DUIA 4AIJA 2X4HA 3LAJA 2EJRA 3COAC 3RYPA 5D8LB 2P8TA 5HLGA 4EV0A 2RDPA 1FP1D 3WODF 5KK1A 1FP2A 3K9TA 4CDGA 2W25A 3HSEA 4CXFA 2EA4A 3CUQB 3W6KB 4LLNA 4BAYA 2F5DA 2VE9A 3I0TA 5FFZA 1I6XA 3ISPA 1JHFA 3B02A 1AOYA 1U78A 3GO5A 3GFMA 4A5MA 3L9FA 2VBXA 3RYRA 1BOAA 5ILUA 3E3VA 3QRFF 2JTVA 2VODA 5LRRA 2CSOA 3E5QA 1D5VA 4WXDA 2F2EA 2L54A 5CVRA 1F5TA 3E5XA 2ZJ2A 2IA2A 3WTVC 1B4AA 2XHKA 4EM2A 5E18F 3O3KA 2XUBA 2QM3A 3ZP5A 4RGUA 3CO7C 2HGCA 3OV8A 1BC8C 2FSWA 2YX4A 2M8EA 4KNYA 2Z33A 4G7HF 5JR3A 1E17A 5DUKA 2JZYA 1H9GA 4OOIA 2LF7A 3LA2A 1X3UA 2P4WA 2QQ9A 3K2ZA 1QQIA 5KVRA 2D1HA 4CGZA 1UHMA 4RB3C 4IF4A 4O3MA 2QVOA 1HKTA 5BS6A 1W7PA 1PP7U 1J59A 2JSCA 5CVVA 2M30A 4M74A 3PFIA 3NRVA 3FXUA 1K78A 3QAHA 4LB5A 2EV6A 1D8KA 3V7CA 4BQAA 4I0AA 4BNCA 3LA7A 3R0AA 5DDGA 3KETA 1JHHA 3EYYA 3TGNA 3WE3A 4L18B 2DTRA 4OIQF 4HX8A 1SD7A 3ZMTA 4I02A 1YLFA 1TNSA 2M87A 4UVBA 1MDMB 3MZHA 1EH7A 2MLKA 2DO7A 1W7PB 4EM1A 2IT0A 2VN2A 1B1BA 4R79A 2KIFA 1KU2A 1LEAA 3FF5A 4M6YA 3VEPA 2CO5A 4AIKA 3KEQA 3DXJF 4UUVA 3M7GA 4XSXF 1YTYA 4MEXF 1K78B 1ZRFA 1D8JA 5FGMA 4G7ZF 4RB2C 1IW7F 3NEUA 4PDKA 1IRFA 3V8JA 2ZKZA 3RJPA 1XGNA 1U6GA 3KZZA 2FNAA 4ESFA 3KCCA 3J80K 1HKQA 4WWCA 2WV0A 2ESNA 5E8GA 2FOKA 3HHGA 4RGXA 1V3FA 2QYOA 3F23A 2M5WA 2HQRA 1BI3A 5E20A 1ZG5A 4EJUA 2YX7A 1IXCA 2LNBA 1EV7A 4UXNA 1BM9A 2HKXA 3KLOA 3WG9A 1OMIA 1ZAOA 3R61A 1EH6A 2ZMEB 1JXSA 2AXLA 3GEZA 2O6GE 3DPTA 5D8KB 2GXBA 2E7XA 3ERED 4MHGA 1LJ9A 4XRFA 3CUOA 1B59A 3QP6A 1TLHB 3L2CA 4HDUA 4MNUA 3F8FA 2GA1A 2L4MA 3TO6A 5ICGA 4LK1F 5D5WB 1YFHA 1R7JA 5LEJA 4CZZA 3P9KA 4OIOF 4Q47A 2VBYA 1DPRA 4NQWA 4UNOA 3MQ0A 4HA8A 1ON1A 3MWMA 2A3SA 3GZ6A 2MD5A 3DPLC 5J6XA 2A07F 3HTUA 3HSFA 3JAMK 3SZPA 1SMTA 1RNLA 4UVAA 4IRGA 1IN7A 1G6NA 3DKWA 1BIAA 1USSA 1KA8A 3BPVA 2PMHA 3IWZA 1USTA 4D0PA 3S2WA 1O3SA 4UV9A 5L3DA 2A5YB 2NNYA 5A2QZ 2QENA 1OYIA 4MQ9F 2OD5A 2VC0A 5DYMA 3V7SA 1P2FA 2V79A 2D1VA 2J5OA 2HDCA 4L5IA 3BWGA 4M72A 2QLZA 5LGTA 2EFNA 1J9IA 4U0WA 4HF1A 1KGSA 4Y15A 5JI6A 1HQCA 2HS5A 5H20A 2EFPA 2W85A 4ZZDA 1KQ8A 1HSJA 5E1XA 2B0LA 1GVJA 3DV8A 1F1ZA 5K5OA 4RAZA 4B8XA 2RKHA 5L3EA 1QNTA 3ZN1A 4YIFA 3BP8A 1BIBA 1QPMA 2QQAA 3F3XA 5HDGA 3RTRA 4E70A 1DP7P 4EJWA 3KP6A 5H6RA 2ADUA 2DAOA 4HF0A 1JE8A 1I5ZA 5HDNA 2DK8A 5IT3A 1YW7A 1LB2A 2A6HF 1FX7A 3VB2A 2W24A 3H3UA 2V1DA 3KP7A 1SD6A 2COMA 5BOXA 3CJNA 4LG0B 1IUYA 1IN8A 2MH2A 4YFXF 4RB0A 4IRIA 1BN5A 2CWEA 2YR2A 2IA0A 3J80Z 2G7HA 2F5CA 1YW8A 4ZYHA 2HTJA 4HX4A 2Q2EA 3HRSA 4RS8A 3HRTA 2XASA 4BHBA 1EH8A 2ZNZA 1T0FA 3FMQA 3DF8A 3L09A 5LRSA 1T6SA 2W84A 2PMUA 1OYYA 2EV5A 1ZH5A 3WTUC 2DBBA 2H94A 2KKOA 4KN4X 1TNTA 2NAZA 3EUHA 4UV8A 4ENJA 4GCVA 3FZVA 2XAQA 2GXGA 1H9TA 2BYVE 1SFXA 2F5EA 2OAZA 3ZMVA 1P6RA 4HQEA 3I5UA 1IXRC 3E6CC 3TQNA 5TJJA 4M9XA 4WXHA 1KU7A 4HZFA 4JQFA 5HOOA 2O03A 1PUEE 2OQRA 3L7WA 1J75A 3EETA 4A5NA 3DFGA 2RV8A 3HRMA 1FZPB 3KP4A 3EQLF 3ZN0A 2WTEA 1P4XA 3RKYA 4L9VA 4ENMA 3MAJA 3JW4A 5DEQA 4AD9A 1S29A 3ZMSA 5LHIA 1LNWA 1FYKA 2CFXA 5DV5A 3BZ6A 4L0ZB 2BV6A 2CQKA 2VC1A 2E7WA 5FFXA 2A69F 1O7FA 5LEKA 4HLXA 2P5VA 2J5PA 3C18A 4N9IA 5LGNA 3QPHA 1NHAA 1FLIA 5D6EA 3ZMDA 3ZMZA 1I1SA 2E1CA 4G6QA 4KFCA 3Q9SA 4LLGF 2YPRA 2BBYA 3ZMUA 5L3CA 1XDSA 2HYGD 5FD5A 2LF8A 3H92A 2K4JA 4I2OA 3FM5A 1ONVA 4ENKA 2OZUA 2VBWA 4NHJA 1WQ2A 4FX4A 3P9CA 3ULQB 2IVMA 4N0BA 4U0VA 4CO8A 2EK5A 5JFRA 1UCRA 2L02A 2V1XA 1L3LA 4MTDA 2FMLA 5BPDA 2ZBKA 2UXXA 1FBQA 3CTAA 1MDMA 2KJCA 1E2XA 4L9JA 3ML6A 3WU0A 4Q5SF 2V6CA 2LSOA 4P5OA 1O3QA 3ZQ7A 2EFQA 5FLXK 3FM3A 4FX0A 1ZG3A 2E1NA 2BE5F 1ZN2A 3LWFA 2JT1A 1U5TA 4A0YA 1C0WA 1BC7C 3I71A 1UHWA 5ILVA 3WTTC 1QGPA 3CLOA 3T1BA 2XGXA 2O3FA 1ZGAA 1O3TA 4ON0A 3SZTA 4KUMA 3WTWC 3QP5A 1R1TA 3T5XA 4AIHA 4UVCA 2L3DA 1CGPA 2Z5UA 1XDUA 4KMFA 4O5VA 4K2EA 1Z6RA 3KLNA 4ASNA 2L01A 2DK5A 3TDZC 3BJ6A 3SQNA 2D45A 5CLSA 3D5LA 2MH9A 4M73A 3WTYC 1U5TB 2ZMEA 2H6CA 3TOAA 1YIOA 3LQQA 4M6XA 1F9NA 1U8RA 1FYMA 4YIIA 1UFMA 4EMSA 2MC3A 3U1DA 1J5YA 5ICCA 4G9YA 3KFWX 2HTSA 2HWVA 2NNNA 1KU9A 1YQAA 2XAHA 2ISZA 3JSPA 5CVIA 4CICA 1R1VA 3F8CA 5CYVA 5JHUA 4CYDA 2H6BA 5HLIA 3KE2A 4S05A 5LBQA 1O3RA 5K1YA 3GLXA 4IJAA 5L3BA 1TW3A 4BXUA 2RQPA 4HF2A 5DCMB 1IN4A 3VODA 1YS7A 2Y0MA 3Q5FA 3J7AO 3E6MA 1QZYA 2UZKA 1ZGJA 1XSXA 1ULYA 5HVQC 3REOA 2VOPA 1ZRCA 3MZYA 4HW0A 3V7RA 1I27A 1KYWA 2GIVA 5E1WA 3CUQC 1CF7A 4KT5C 4KMUX 2G9WA 2K02A 2EWNA 4GYIA 3GFLA 2RNJA 3KP5A 2RVCA 5EEHA 3J81K 1V4RA 2DFIA 3H3ZA 3WGIA 2OBPA 2RC4A 1HW2A 4LGWA 3RIRA 3BROA 1FWZA 3I53A 3EDPA 3OOPA 2WC2A 3F8BA 3IRQA 1MD0A 4HQMA 5LHGA 3DP7A 4KIBA 3AAFA 1FYLA 4WK8F 2ZXJA 4KA4A 2IRFG 3C7JA 4EJTA 3GXOA 4ESJA 2XAFA 2VE8A 1FBSA 3P7NA 2CGPA 4R8HA 3BJOA 1CF7B 1Z6TA 5ICFA 3HUGA 4LJZF 4RAYA 4XLNF 1U2WA 3T8TA 3F8NA 2DT5A 1W5SA 3ZPLA 1XCBA 4OMZA 2F5FA 4G8XA 1RIOH 1DPUA 1OR7A 1SFUA 2DPUA 5AIQA 5J8FA 1XGSA 2STTA 5FLXZ 1ZREA 3LQRA 4Y17A 3I59B 2FBKA 1KYZA 1XSVA 5FD6A 4EJOA 3PQJA 2FF4A 4KIGA 4ENNA 4LG0A 1ZARA 1Y0UA 3F22A 4XLPF 3HRUA 1BI2A 4P55A 4OMYA 4U7BA 3DEUA 2IW5A 1P4AA 5HS9A 5CJ9A 5D4RA 2PI0A 3FXRA 3RPQA 3TKYA 1HSTA 1HW1A 5F6FA 1QBJA 1OPCA 4G6DA 5K5RA 1G3SA 3RPUA 5ICEA 4L9TA 3G73A 4HOBA 1PDNC 4OINF 2O61A 4N9HA 2GQQA 4Z2YA 5CVUA 1TW2A 2Y75A 1FT9A 3HSRA 4KDPA 1ON2A 1FNNA 4WX9A 2VT3A 2PJPA 3E6BA 4A2UA 1ZRDA 3MFKA 5F1RA 3MCZA 3FX3A 3R4KA 4I09A 4IXAA 1Z1DA 2L4AA 5E8IA 2IA1A 4ZH4F 1Z05A 4WXCA 1R58A 2K27A 3SHFA 4L0YB 2GA2A 3K1MA 5D4SA 2EB7A 3E97A 1IXSB 4HV6A 1R5GA 3IC7A 2DQLA 2HKOA 4G7OF 5J8CA 1YG2A 4S04A 3TOBA 2FBIA 3RKWA 3Q9VA 1BI0A 3RKXA 1YO5C 3IKTA 1T39A 1XCVA 1W4MA 5E17F 1D3YA 3O6BB 2P7CB 2PEXA 1MJBA 4XSZF 1S3JA 4U0YA 3GUDA 1ZHFA 5DD4A 3M8EA 4PGHA 2RGVA 2PG4A 2D2WA 4PGGA 2Z99A 1S8NA 2O0YA 2VBZA 5LLQA 1WI9A 1FPQA 1G3WA 1SMYF 5L3FA 1AWCA 1TQIA 1MZBA 1IN5A 1GXQA 4QWQA 2IP2A 3WGGA 4L9NA 5D5XB 5FO5A 5TRDA 1WWXA 2ZCWA 4EQQA 3QU3A 2P5KA 5HS8A 3JAMZ 3WGHA 1XMAA 4MGRA 2FNPA 4I98B 2P5LC 3FHZA 4CHUA 2M45A 1DUXC 4HBLA 3M8FA 2KIMA 4ETSA 1Q1HA 4R1HA 2PLYA 3JTGA 4RB1A 4O6JA 3ECOA 4BYYA 4M9SA 4LD5A 1RUOA 3QU6A 3JSOA 4P9FA 1IAWA 4IHTA 3VFZA 2R3SA 1XMKA 3IWFA 2V9VA 2FEZA 1U3EM 3NQOA 3KP3A 3GFJA 4LK0F 3KEOA 5HLHA 3HOTA 1W5TA 3F6VA 4A12A 3BPXA 3R0JA 1HXDA 3BY6A 1K7AA 3F8MA 1IZ1A 3TO9A 5BPIA 4A0ZA 2EV0A 2HEOA 3LSTA 2K86A 2PFBA 2IPQX 4TV7A 3CDHA 2V1UA 1OYWA 2DI3A 2HZTA 5JVTA 4UHTA 5L3GA 1FBUA 2OU2A 2ZO4A 1IN6A 1R22A 1YS6A 2H09A 2IJLA 2O8XA 2NRAC 2JPBA 3FMRA 2P6TA 1Z91A 5A2QK 3WU1B 1J7KA 3I64A 2ESHA 5ILSA 3ECHA 4YG2F 2XKOA 1REPC 1XGOA 3ELKA 2BGCA 2A61A 2JPCA 3E6DA 2QWWA 4RGSA 3ABTA 1S7OA 3K0LA 2EA2A 4MEYF 3HYIA 2HYFA 3F21A 3FWEA 2NS0A 2Z3YA 4HDVA 4OU0A 2FRHA 2GWRA 4P9UA 2VT2A 2K4BA 4JBAA 1O7LA 1Z7UA 2XKPA 1FSEA 4QLCU 3N97A 1ZG1A 1T2KA 1FSHA 5AONA 3MEXA 1XSDA 4MTEA 2Z9OA 4ZYDA 2PN6A 3GZ5A 3IHUA 3PQKA 2DPDA 4B09A 3M1EA 3B73A 2ISYA 4IRHA 3IRRA 3O2PE 3KP2A 1UB9A 1G4DA 1YYVA 3JTHA 1HKSA 3SXYA 2A6EF 5DCMA 2K7LA 4LMYA 4BHPA 1R23A 2DLLA 4RGRA 2DU9A 1K6OA 2QUFA 1HW5A 4BHCA 4A0XA 1LVAA 4KIFA 1GXPA 1WRJA 3KZYA 2A68F 1P92A 4WF2A 1RUNA 1Z9CA 1B9MA 2FQ3A 2XAJA 5ED4A 1STZA 1KQ9A 4HYEA 1QZZA 3WTXC 1SAXA 1R00A 1F4KA 1TQPA 2P7VB 3V8LA 2R7DA 3LAPA 5LHHA 3U9GA 3I54A 2KJBA 4IVNA 2TDXA 3T8RA 1LQ1A 5F64A 4M9ZA 1ZLKA 2ETHA 2FMYA 3RI4A 5IT9K 1WSUA 1LEBA 1R5HA 5ERIA 5BQTA 1IF1A 4DNCA 3GF2A 1FY7A 3GYHX 2XV4S 3W6JB 4XBFA 2HR3A 4HV5A 4HLYA 4MQVA 1A04A 3GFIA 2DW4A 1K79A 4ZYEA 1DDNA 4GYGA 3E5UA 3RDIA 3P9IA 3EYIA 3FXQA 1SD4A 2NYXA 3QPTA 2YU3A 5BMZA 4FT8A 2Q8KA 2CG4A 1P4WA 2ACJA 5DD8A 4YFNF 5DCFA 2PQ8A 2LDUA 4OIRF 2GZWA 3CO6C 1S7AA 3I59A 4AWXB 4EVIA 2ZFWA 4KYWA 2FXAA 4FHTA 1L0OC 4GO1A 1H0MA 4AVPA 2VXZA 2XROA 1ZYRF 1MJAA 3FMSA 4HAMA 2OQGA 4EGYA 2PBIA 3V4GA 1KQ0A 2KIUA 1QO0D 4L5JA 1XD7A 4OIPF 1T38A 2KRFA 3HTSB 4I01A 2VOOA 1SD5A 2OZ6A 1MJ9A 3TDUC 4Y13A 2H27A 1T98A 2HFHA 3GX4X 3D0SA 1XB4A 3R6SA 1IRGA 4EJVA 2FA5A 3L00A 2G7UA 3K69A 4PZJA 1LDJA 4A6EA 4EGZA 5E1ZB 3R60A 3BOQA 4Q4ZF 2M1BA 4ZYGA 1RI7A 1LDKB 5K5QA 1YW9A 2Y48A 4U88A 2MA3A 1FC3A 2GAUA 1MGTA 4PCQA 5HDKA 4IPAA 2X0LA 3K1NA 3ROUA 2C6YA 3QOPA 3SFZA 1XGMA 2MBFA 2YSRA 2VONA 4A6DA 1G3TA 4I0BA 2HQNA 1SFEA 2QBYA 1J0RA 4M71A 1VTNC 1B6AA 2QQBA 3I4PA 2XVCA 2R7FA 2FBHA 3HIFA 4GGGA 1BJAA 4KICA 2DQRA 2XAGA 2XIGA 3IL2A 3GW2A 5D5UB 1WKMA 6PAXA 4ESBA 2LKPA 4ZZLA 1TQMA 4HX7A 2EFWA 3I58A 4JK1X 4U7DA 1BI1A 1BBYA 3IKVA 3TO7A 4LFUA 2UWMA 2RN7A 3WTZA 4WCGA 1ODDA 2BEOA 1GHCA 3LA3A 2CYYA 1B9NA 4KN7X 4F7ZA 1XN7A 1R1UA 3LFKA 5FB2A 2ELHA 3HOSA 1S6LA 1U5TC 3F6OA 2QBYB 3C3WA 3M9AA 1HBXG 1W7PD 1RZ4A 1PP8F 4YFKF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q0O A;  1JGS A;  4LLL A;  2XRN A;  3HHH A;  2UXN A;  2OA4 A;  3DQV C;  5D5V B;  4H0E A;  3VOE A;  1ZLJ A;  3F72 A;  3WTS C;  1LDD A;  3BJA A;  1R36 A;  5EEG A;  2HOE A;  4NB5 A;  5H6Q A;  1O57 A;  3BDD A;  1KU3 A;  5HS7 A;  4DQ2 A;  5IT9 Z;  3K1P A;  2WWY A;  3GWZ A;  2JRT A;  5CVJ A;  3C1D A;  3GVA A;  4P96 A;  3ABU A;  2CW0 F;  5AIP A;  3N4M A;  3U2R A;  2P6S A;  4GXO A;  3CUQ A;  2AS5 F;  5LGU A;  3G3Z A;  4EM0 B;  4IHS A;  1TBX A;  2MLG A;  2W57 A;  1G3Y A;  4LB6 B;  1TTY A;  1J2X A;  4I7H A;  2FU4 A;  2EFO A;  4BH9 A;  1FOK A;  1I1G A;  2ZNY A;  3T0Y A;  2STW A;  2FE3 A;  2QZ8 A;  3V8K A;  4Q48 A;  5D6F A;  1MKM A;  1OKR A;  4G94 A;  3WE2 A;  3J81 Z;  5DUI A;  4AIJ A;  2X4H A;  3LAJ A;  2EJR A;  3COA C;  3RYP A;  5D8L B;  2P8T A;  5HLG A;  4EV0 A;  2RDP A;  1FP1 D;  3WOD F;  5KK1 A;  1FP2 A;  3K9T A;  4CDG A;  2W25 A;  3HSE A;  4CXF A;  2EA4 A;  3CUQ B;  3W6K B;  4LLN A;  4BAY A;  2F5D A;  2VE9 A;  3I0T A;  5FFZ A;  1I6X A;  3ISP A;  1JHF A;  3B02 A;  1AOY A;  1U78 A;  3GO5 A;  3GFM A;  4A5M A;  3L9F A;  2VBX A;  3RYR A;  1BOA A;  5ILU A;  3E3V A;  3QRF F;  2JTV A;  2VOD A;  5LRR A;  2CSO A;  3E5Q A;  1D5V A;  4WXD A;  2F2E A;  2L54 A;  5CVR A;  1F5T A;  3E5X A;  2ZJ2 A;  2IA2 A;  3WTV C;  1B4A A;  2XHK A;  4EM2 A;  5E18 F;  3O3K A;  2XUB A;  2QM3 A;  3ZP5 A;  4RGU A;  3CO7 C;  2HGC A;  3OV8 A;  1BC8 C;  2FSW A;  2YX4 A;  2M8E A;  4KNY A;  2Z33 A;  4G7H F;  5JR3 A;  1E17 A;  5DUK A;  2JZY A;  1H9G A;  4OOI A;  2LF7 A;  3LA2 A;  1X3U A;  2P4W A;  2QQ9 A;  3K2Z A;  1QQI A;  5KVR A;  2D1H A;  4CGZ A;  1UHM A;  4RB3 C;  4IF4 A;  4O3M A;  2QVO A;  1HKT A;  5BS6 A;  1W7P A;  1PP7 U;  1J59 A;  2JSC A;  5CVV A;  2M30 A;  4M74 A;  3PFI A;  3NRV A;  3FXU A;  1K78 A;  3QAH A;  4LB5 A;  2EV6 A;  1D8K A;  3V7C A;  4BQA A;  4I0A A;  4BNC A;  3LA7 A;  3R0A A;  5DDG A;  3KET A;  1JHH A;  3EYY A;  3TGN A;  3WE3 A;  4L18 B;  2DTR A;  4OIQ F;  4HX8 A;  1SD7 A;  3ZMT A;  4I02 A;  1YLF A;  1TNS A;  2M87 A;  4UVB A;  1MDM B;  3MZH A;  1EH7 A;  2MLK A;  2DO7 A;  1W7P B;  4EM1 A;  2IT0 A;  2VN2 A;  1B1B A;  4R79 A;  2KIF A;  1KU2 A;  1LEA A;  3FF5 A;  4M6Y A;  3VEP A;  2CO5 A;  4AIK A;  3KEQ A;  3DXJ F;  4UUV A;  3M7G A;  4XSX F;  1YTY A;  4MEX F;  1K78 B;  1ZRF A;  1D8J A;  5FGM A;  4G7Z F;  4RB2 C;  1IW7 F;  3NEU A;  4PDK A;  1IRF A;  3V8J A;  2ZKZ A;  3RJP A;  1XGN A;  1U6G A;  3KZZ A;  2FNA A;  4ESF A;  3KCC A;  3J80 K;  1HKQ A;  4WWC A;  2WV0 A;  2ESN A;  5E8G A;  2FOK A;  3HHG A;  4RGX A;  1V3F A;  2QYO A;  3F23 A;  2M5W A;  2HQR A;  1BI3 A;  5E20 A;  1ZG5 A;  4EJU A;  2YX7 A;  1IXC A;  2LNB A;  1EV7 A;  4UXN A;  1BM9 A;  2HKX A;  3KLO A;  3WG9 A;  1OMI A;  1ZAO A;  3R61 A;  1EH6 A;  2ZME B;  1JXS A;  2AXL A;  3GEZ A;  2O6G E;  3DPT A;  5D8K B;  2GXB A;  2E7X A;  3ERE D;  4MHG A;  1LJ9 A;  4XRF A;  3CUO A;  1B59 A;  3QP6 A;  1TLH B;  3L2C A;  4HDU A;  4MNU A;  3F8F A;  2GA1 A;  2L4M A;  3TO6 A;  5ICG A;  4LK1 F;  5D5W B;  1YFH A;  1R7J A;  5LEJ A;  4CZZ A;  3P9K A;  4OIO F;  4Q47 A;  2VBY A;  1DPR A;  4NQW A;  4UNO A;  3MQ0 A;  4HA8 A;  1ON1 A;  3MWM A;  2A3S A;  3GZ6 A;  2MD5 A;  3DPL C;  5J6X A;  2A07 F;  3HTU A;  3HSF A;  3JAM K;  3SZP A;  1SMT A;  1RNL A;  4UVA A;  4IRG A;  1IN7 A;  1G6N A;  3DKW A;  1BIA A;  1USS A;  1KA8 A;  3BPV A;  2PMH A;  3IWZ A;  1UST A;  4D0P A;  3S2W A;  1O3S A;  4UV9 A;  5L3D A;  2A5Y B;  2NNY A;  5A2Q Z;  2QEN A;  1OYI A;  4MQ9 F;  2OD5 A;  2VC0 A;  5DYM A;  3V7S A;  1P2F A;  2V79 A;  2D1V A;  2J5O A;  2HDC A;  4L5I A;  3BWG A;  4M72 A;  2QLZ A;  5LGT A;  2EFN A;  1J9I A;  4U0W A;  4HF1 A;  1KGS A;  4Y15 A;  5JI6 A;  1HQC A;  2HS5 A;  5H20 A;  2EFP A;  2W85 A;  4ZZD A;  1KQ8 A;  1HSJ A;  5E1X A;  2B0L A;  1GVJ A;  3DV8 A;  1F1Z A;  5K5O A;  4RAZ A;  4B8X A;  2RKH A;  5L3E A;  1QNT A;  3ZN1 A;  4YIF A;  3BP8 A;  1BIB A;  1QPM A;  2QQA A;  3F3X A;  5HDG A;  3RTR A;  4E70 A;  1DP7 P;  4EJW A;  3KP6 A;  5H6R A;  2ADU A;  2DAO A;  4HF0 A;  1JE8 A;  1I5Z A;  5HDN A;  2DK8 A;  5IT3 A;  1YW7 A;  1LB2 A;  2A6H F;  1FX7 A;  3VB2 A;  2W24 A;  3H3U A;  2V1D A;  3KP7 A;  1SD6 A;  2COM A;  5BOX A;  3CJN A;  4LG0 B;  1IUY A;  1IN8 A;  2MH2 A;  4YFX F;  4RB0 A;  4IRI A;  1BN5 A;  2CWE A;  2YR2 A;  2IA0 A;  3J80 Z;  2G7H A;  2F5C A;  1YW8 A;  4ZYH A;  2HTJ A;  4HX4 A;  2Q2E A;  3HRS A;  4RS8 A;  3HRT A;  2XAS A;  4BHB A;  1EH8 A;  2ZNZ A;  1T0F A;  3FMQ A;  3DF8 A;  3L09 A;  5LRS A;  1T6S A;  2W84 A;  2PMU A;  1OYY A;  2EV5 A;  1ZH5 A;  3WTU C;  2DBB A;  2H94 A;  2KKO A;  4KN4 X;  1TNT A;  2NAZ A;  3EUH A;  4UV8 A;  4ENJ A;  4GCV A;  3FZV A;  2XAQ A;  2GXG A;  1H9T A;  2BYV E;  1SFX A;  2F5E A;  2OAZ A;  3ZMV A;  1P6R A;  4HQE A;  3I5U A;  1IXR C;  3E6C C;  3TQN A;  5TJJ A;  4M9X A;  4WXH A;  1KU7 A;  4HZF A;  4JQF A;  5HOO A;  2O03 A;  1PUE E;  2OQR A;  3L7W A;  1J75 A;  3EET A;  4A5N A;  3DFG A;  2RV8 A;  3HRM A;  1FZP B;  3KP4 A;  3EQL F;  3ZN0 A;  2WTE A;  1P4X A;  3RKY A;  4L9V A;  4ENM A;  3MAJ A;  3JW4 A;  5DEQ A;  4AD9 A;  1S29 A;  3ZMS A;  5LHI A;  1LNW A;  1FYK A;  2CFX A;  5DV5 A;  3BZ6 A;  4L0Z B;  2BV6 A;  2CQK A;  2VC1 A;  2E7W A;  5FFX A;  2A69 F;  1O7F A;  5LEK A;  4HLX A;  2P5V A;  2J5P A;  3C18 A;  4N9I A;  5LGN A;  3QPH A;  1NHA A;  1FLI A;  5D6E A;  3ZMD A;  3ZMZ A;  1I1S A;  2E1C A;  4G6Q A;  4KFC A;  3Q9S A;  4LLG F;  2YPR A;  2BBY A;  3ZMU A;  5L3C A;  1XDS A;  2HYG D;  5FD5 A;  2LF8 A;  3H92 A;  2K4J A;  4I2O A;  3FM5 A;  1ONV A;  4ENK A;  2OZU A;  2VBW A;  4NHJ A;  1WQ2 A;  4FX4 A;  3P9C A;  3ULQ B;  2IVM A;  4N0B A;  4U0V A;  4CO8 A;  2EK5 A;  5JFR A;  1UCR A;  2L02 A;  2V1X A;  1L3L A;  4MTD A;  2FML A;  5BPD A;  2ZBK A;  2UXX A;  1FBQ A;  3CTA A;  1MDM A;  2KJC A;  1E2X A;  4L9J A;  3ML6 A;  3WU0 A;  4Q5S F;  2V6C A;  2LSO A;  4P5O A;  1O3Q A;  3ZQ7 A;  2EFQ A;  5FLX K;  3FM3 A;  4FX0 A;  1ZG3 A;  2E1N A;  2BE5 F;  1ZN2 A;  3LWF A;  2JT1 A;  1U5T A;  4A0Y A;  1C0W A;  1BC7 C;  3I71 A;  1UHW A;  5ILV A;  3WTT C;  1QGP A;  3CLO A;  3T1B A;  2XGX A;  2O3F A;  1ZGA A;  1O3T A;  4ON0 A;  3SZT A;  4KUM A;  3WTW C;  3QP5 A;  1R1T A;  3T5X A;  4AIH A;  4UVC A;  2L3D A;  1CGP A;  2Z5U A;  1XDU A;  4KMF A;  4O5V A;  4K2E A;  1Z6R A;  3KLN A;  4ASN A;  2L01 A;  2DK5 A;  3TDZ C;  3BJ6 A;  3SQN A;  2D45 A;  5CLS A;  3D5L A;  2MH9 A;  4M73 A;  3WTY C;  1U5T B;  2ZME A;  2H6C A;  3TOA A;  1YIO A;  3LQQ A;  4M6X A;  1F9N A;  1U8R A;  1FYM A;  4YII A;  1UFM A;  4EMS A;  2MC3 A;  3U1D A;  1J5Y A;  5ICC A;  4G9Y A;  3KFW X;  2HTS A;  2HWV A;  2NNN A;  1KU9 A;  1YQA A;  2XAH A;  2ISZ A;  3JSP A;  5CVI A;  4CIC A;  1R1V A;  3F8C A;  5CYV A;  5JHU A;  4CYD A;  2H6B A;  5HLI A;  3KE2 A;  4S05 A;  5LBQ A;  1O3R A;  5K1Y A;  3GLX A;  4IJA A;  5L3B A;  1TW3 A;  4BXU A;  2RQP A;  4HF2 A;  5DCM B;  1IN4 A;  3VOD A;  1YS7 A;  2Y0M A;  3Q5F A;  3J7A O;  3E6M A;  1QZY A;  2UZK A;  1ZGJ A;  1XSX A;  1ULY A;  5HVQ C;  3REO A;  2VOP A;  1ZRC A;  3MZY A;  4HW0 A;  3V7R A;  1I27 A;  1KYW A;  2GIV A;  5E1W A;  3CUQ C;  1CF7 A;  4KT5 C;  4KMU X;  2G9W A;  2K02 A;  2EWN A;  4GYI A;  3GFL A;  2RNJ A;  3KP5 A;  2RVC A;  5EEH A;  3J81 K;  1V4R A;  2DFI A;  3H3Z A;  3WGI A;  2OBP A;  2RC4 A;  1HW2 A;  4LGW A;  3RIR A;  3BRO A;  1FWZ A;  3I53 A;  3EDP A;  3OOP A;  2WC2 A;  3F8B A;  3IRQ A;  1MD0 A;  4HQM A;  5LHG A;  3DP7 A;  4KIB A;  3AAF A;  1FYL A;  4WK8 F;  2ZXJ A;  4KA4 A;  2IRF G;  3C7J A;  4EJT A;  3GXO A;  4ESJ A;  2XAF A;  2VE8 A;  1FBS A;  3P7N A;  2CGP A;  4R8H A;  3BJO A;  1CF7 B;  1Z6T A;  5ICF A;  3HUG A;  4LJZ F;  4RAY A;  4XLN F;  1U2W A;  3T8T A;  3F8N A;  2DT5 A;  1W5S A;  3ZPL A;  1XCB A;  4OMZ A;  2F5F A;  4G8X A;  1RIO H;  1DPU A;  1OR7 A;  1SFU A;  2DPU A;  5AIQ A;  5J8F A;  1XGS A;  2STT A;  5FLX Z;  1ZRE A;  3LQR A;  4Y17 A;  3I59 B;  2FBK A;  1KYZ A;  1XSV A;  5FD6 A;  4EJO A;  3PQJ A;  2FF4 A;  4KIG A;  4ENN A;  4LG0 A;  1ZAR A;  1Y0U A;  3F22 A;  4XLP F;  3HRU A;  1BI2 A;  4P55 A;  4OMY A;  4U7B A;  3DEU A;  2IW5 A;  1P4A A;  5HS9 A;  5CJ9 A;  5D4R A;  2PI0 A;  3FXR A;  3RPQ A;  3TKY A;  1HST A;  1HW1 A;  5F6F A;  1QBJ A;  1OPC A;  4G6D A;  5K5R A;  1G3S A;  3RPU A;  5ICE A;  4L9T A;  3G73 A;  4HOB A;  1PDN C;  4OIN F;  2O61 A;  4N9H A;  2GQQ A;  4Z2Y A;  5CVU A;  1TW2 A;  2Y75 A;  1FT9 A;  3HSR A;  4KDP A;  1ON2 A;  1FNN A;  4WX9 A;  2VT3 A;  2PJP A;  3E6B A;  4A2U A;  1ZRD A;  3MFK A;  5F1R A;  3MCZ A;  3FX3 A;  3R4K A;  4I09 A;  4IXA A;  1Z1D A;  2L4A A;  5E8I A;  2IA1 A;  4ZH4 F;  1Z05 A;  4WXC A;  1R58 A;  2K27 A;  3SHF A;  4L0Y B;  2GA2 A;  3K1M A;  5D4S A;  2EB7 A;  3E97 A;  1IXS B;  4HV6 A;  1R5G A;  3IC7 A;  2DQL A;  2HKO A;  4G7O F;  5J8C A;  1YG2 A;  4S04 A;  3TOB A;  2FBI A;  3RKW A;  3Q9V A;  1BI0 A;  3RKX A;  1YO5 C;  3IKT A;  1T39 A;  1XCV A;  1W4M A;  5E17 F;  1D3Y A;  3O6B B;  2P7C B;  2PEX A;  1MJB A;  4XSZ F;  1S3J A;  4U0Y A;  3GUD A;  1ZHF A;  5DD4 A;  3M8E A;  4PGH A;  2RGV A;  2PG4 A;  2D2W A;  4PGG A;  2Z99 A;  1S8N A;  2O0Y A;  2VBZ A;  5LLQ A;  1WI9 A;  1FPQ A;  1G3W A;  1SMY F;  5L3F A;  1AWC A;  1TQI A;  1MZB A;  1IN5 A;  1GXQ A;  4QWQ A;  2IP2 A;  3WGG A;  4L9N A;  5D5X B;  5FO5 A;  5TRD A;  1WWX A;  2ZCW A;  4EQQ A;  3QU3 A;  2P5K A;  5HS8 A;  3JAM Z;  3WGH A;  1XMA A;  4MGR A;  2FNP A;  4I98 B;  2P5L C;  3FHZ A;  4CHU A;  2M45 A;  1DUX C;  4HBL A;  3M8F A;  2KIM A;  4ETS A;  1Q1H A;  4R1H A;  2PLY A;  3JTG A;  4RB1 A;  4O6J A;  3ECO A;  4BYY A;  4M9S A;  4LD5 A;  1RUO A;  3QU6 A;  3JSO A;  4P9F A;  1IAW A;  4IHT A;  3VFZ A;  2R3S A;  1XMK A;  3IWF A;  2V9V A;  2FEZ A;  1U3E M;  3NQO A;  3KP3 A;  3GFJ A;  4LK0 F;  3KEO A;  5HLH A;  3HOT A;  1W5T A;  3F6V A;  4A12 A;  3BPX A;  3R0J A;  1HXD A;  3BY6 A;  1K7A A;  3F8M A;  1IZ1 A;  3TO9 A;  5BPI A;  4A0Z A;  2EV0 A;  2HEO A;  3LST A;  2K86 A;  2PFB A;  2IPQ X;  4TV7 A;  3CDH A;  2V1U A;  1OYW A;  2DI3 A;  2HZT A;  5JVT A;  4UHT A;  5L3G A;  1FBU A;  2OU2 A;  2ZO4 A;  1IN6 A;  1R22 A;  1YS6 A;  2H09 A;  2IJL A;  2O8X A;  2NRA C;  2JPB A;  3FMR A;  2P6T A;  1Z91 A;  5A2Q K;  3WU1 B;  1J7K A;  3I64 A;  2ESH A;  5ILS A;  3ECH A;  4YG2 F;  2XKO A;  1REP C;  1XGO A;  3ELK A;  2BGC A;  2A61 A;  2JPC A;  3E6D A;  2QWW A;  4RGS A;  3ABT A;  1S7O A;  3K0L A;  2EA2 A;  4MEY F;  3HYI A;  2HYF A;  3F21 A;  3FWE A;  2NS0 A;  2Z3Y A;  4HDV A;  4OU0 A;  2FRH A;  2GWR A;  4P9U A;  2VT2 A;  2K4B A;  4JBA A;  1O7L A;  1Z7U A;  2XKP A;  1FSE A;  4QLC U;  3N97 A;  1ZG1 A;  1T2K A;  1FSH A;  5AON A;  3MEX A;  1XSD A;  4MTE A;  2Z9O A;  4ZYD A;  2PN6 A;  3GZ5 A;  3IHU A;  3PQK A;  2DPD A;  4B09 A;  3M1E A;  3B73 A;  2ISY A;  4IRH A;  3IRR A;  3O2P E;  3KP2 A;  1UB9 A;  1G4D A;  1YYV A;  3JTH A;  1HKS A;  3SXY A;  2A6E F;  5DCM A;  2K7L A;  4LMY A;  4BHP A;  1R23 A;  2DLL A;  4RGR A;  2DU9 A;  1K6O A;  2QUF A;  1HW5 A;  4BHC A;  4A0X A;  1LVA A;  4KIF A;  1GXP A;  1WRJ A;  3KZY A;  2A68 F;  1P92 A;  4WF2 A;  1RUN A;  1Z9C A;  1B9M A;  2FQ3 A;  2XAJ A;  5ED4 A;  1STZ A;  1KQ9 A;  4HYE A;  1QZZ A;  3WTX C;  1SAX A;  1R00 A;  1F4K A;  1TQP A;  2P7V B;  3V8L A;  2R7D A;  3LAP A;  5LHH A;  3U9G A;  3I54 A;  2KJB A;  4IVN A;  2TDX A;  3T8R A;  1LQ1 A;  5F64 A;  4M9Z A;  1ZLK A;  2ETH A;  2FMY A;  3RI4 A;  5IT9 K;  1WSU A;  1LEB A;  1R5H A;  5ERI A;  5BQT A;  1IF1 A;  4DNC A;  3GF2 A;  1FY7 A;  3GYH X;  2XV4 S;  3W6J B;  4XBF A;  2HR3 A;  4HV5 A;  4HLY A;  4MQV A;  1A04 A;  3GFI A;  2DW4 A;  1K79 A;  4ZYE A;  1DDN A;  4GYG A;  3E5U A;  3RDI A;  3P9I A;  3EYI A;  3FXQ A;  1SD4 A;  2NYX A;  3QPT A;  2YU3 A;  5BMZ A;  4FT8 A;  2Q8K A;  2CG4 A;  1P4W A;  2ACJ A;  5DD8 A;  4YFN F;  5DCF A;  2PQ8 A;  2LDU A;  4OIR F;  2GZW A;  3CO6 C;  1S7A A;  3I59 A;  4AWX B;  4EVI A;  2ZFW A;  4KYW A;  2FXA A;  4FHT A;  1L0O C;  4GO1 A;  1H0M A;  4AVP A;  2VXZ A;  2XRO A;  1ZYR F;  1MJA A;  3FMS A;  4HAM A;  2OQG A;  4EGY A;  2PBI A;  3V4G A;  1KQ0 A;  2KIU A;  1QO0 D;  4L5J A;  1XD7 A;  4OIP F;  1T38 A;  2KRF A;  3HTS B;  4I01 A;  2VOO A;  1SD5 A;  2OZ6 A;  1MJ9 A;  3TDU C;  4Y13 A;  2H27 A;  1T98 A;  2HFH A;  3GX4 X;  3D0S A;  1XB4 A;  3R6S A;  1IRG A;  4EJV A;  2FA5 A;  3L00 A;  2G7U A;  3K69 A;  4PZJ A;  1LDJ A;  4A6E A;  4EGZ A;  5E1Z B;  3R60 A;  3BOQ A;  4Q4Z F;  2M1B A;  4ZYG A;  1RI7 A;  1LDK B;  5K5Q A;  1YW9 A;  2Y48 A;  4U88 A;  2MA3 A;  1FC3 A;  2GAU A;  1MGT A;  4PCQ A;  5HDK A;  4IPA A;  2X0L A;  3K1N A;  3ROU A;  2C6Y A;  3QOP A;  3SFZ A;  1XGM A;  2MBF A;  2YSR A;  2VON A;  4A6D A;  1G3T A;  4I0B A;  2HQN A;  1SFE A;  2QBY A;  1J0R A;  4M71 A;  1VTN C;  1B6A A;  2QQB A;  3I4P A;  2XVC A;  2R7F A;  2FBH A;  3HIF A;  4GGG A;  1BJA A;  4KIC A;  2DQR A;  2XAG A;  2XIG A;  3IL2 A;  3GW2 A;  5D5U B;  1WKM A;  6PAX A;  4ESB A;  2LKP A;  4ZZL A;  1TQM A;  4HX7 A;  2EFW A;  3I58 A;  4JK1 X;  4U7D A;  1BI1 A;  1BBY A;  3IKV A;  3TO7 A;  4LFU A;  2UWM A;  2RN7 A;  3WTZ A;  4WCG A;  1ODD A;  2BEO A;  1GHC A;  3LA3 A;  2CYY A;  1B9N A;  4KN7 X;  4F7Z A;  1XN7 A;  1R1U A;  3LFK A;  5FB2 A;  2ELH A;  3HOS A;  1S6L A;  1U5T C;  3F6O A;  2QBY B;  3C3W A;  3M9A A;  1HBX G;  1W7P D;  1RZ4 A;  1PP8 F;  4YFK F; 
#chains in the Genus database with same CATH topology
 2Q0O A;  1JGS A;  4LLL A;  2VJJ A;  2XRN A;  3HHH A;  2UXN A;  3L2U A;  3SJM A;  3LSK A;  3BG9 A;  2OA4 A;  3FHN A;  2V4J C;  3DQV C;  4GFB A;  4LIU A;  5D5V B;  4II2 A;  4A3F J;  4BQQ A;  4ZTF A;  4H0E A;  3VOE A;  1ZLJ A;  2M0M A;  2DA4 A;  1LE8 B;  3F72 A;  5GAD J;  2L9V A;  3WTS C;  2K5C A;  3G2B A;  1LDD A;  1Z0X A;  3BJA A;  3DLA A;  2EZL A;  3QYE A;  1N78 A;  4P1W A;  1R36 A;  5EEG A;  2HOE A;  4NB5 A;  2LC2 A;  1TP4 A;  1UHS A;  3GCM A;  4IQ4 A;  5H6Q A;  1O57 A;  3BDD A;  1KU3 A;  2B7E A;  4W1U A;  2BXY A;  4PJ0 C;  5HS7 A;  5FRO A;  4DQ2 A;  1E0E A;  1K6Y A;  5IT9 Z;  1OIS A;  3K1P A;  1W5C C;  2WWY A;  3GWZ A;  2ID3 A;  2JRT A;  5B1B H;  5CVJ A;  4RM3 A;  3A02 A;  3C1D A;  2F6C A;  3FIW A;  3G1M A;  3GVA A;  2JWT A;  3PNT A;  4P96 A;  4HRI A;  3ABU A;  1MMD A;  3NAU A;  3K70 D;  2CW0 F;  5AIP A;  3HJE A;  2E35 A;  3N4M A;  2DJI A;  3U2R A;  2P6S A;  1HC8 A;  4GXO A;  4CA0 A;  3CUQ A;  2HOT A;  2AS5 F;  5LGU A;  3G3Z A;  2WY7 Q;  4EM0 B;  4IHS A;  4CCO A;  1TBX A;  2LBF A;  2MLG A;  2W57 A;  3H36 A;  1G3Y A;  4LB6 B;  4M3E A;  1TTY A;  3L2R A;  2YU9 J;  1J2X A;  4I7H A;  2FU4 A;  5FRN A;  4C2U A;  2EFO A;  4BH9 A;  1FOK A;  3H5A A;  1UG0 A;  2ZFU A;  4JYK A;  1I1G A;  2LYC A;  2ZNY A;  4C3I J;  1NTC A;  3T0Y A;  2STW A;  2FE3 A;  1BJZ A;  2LG4 A;  1JT6 A;  4QSH A;  2QZ8 A;  1HDP A;  3V8K A;  4Q48 A;  3CCR I;  5D6F A;  5GAG J;  1MKM A;  2DMN A;  1OKR A;  4G94 A;  3WE2 A;  3J81 Z;  5DUI A;  2VPL A;  2FUG 2;  4AIJ A;  2X4H A;  3LAJ A;  2EJR A;  2WB1 N;  3FBI B;  3COA C;  3VWB A;  2F4I A;  3RYP A;  5M5X J;  3LFU A;  5D8L B;  2P8T A;  2VKE A;  5HLG A;  2HQ5 A;  2RDP A;  4EV0 A;  2E2J J;  1FP1 D;  3WOD F;  5KK1 A;  4RAF A;  1FP2 A;  3K9T A;  4CDG A;  3JRF A;  2W25 A;  3K4K A;  2DMU A;  2HXO A;  2L2O A;  3HSE A;  3K10 A;  4AM3 A;  3BZK A;  2M3A A;  3GZN B;  4CXF A;  2K9M A;  2EA4 A;  3CUQ B;  4FCY A;  4BEH A;  3W6K B;  2DDA A;  4LLN A;  4BAY A;  2F5D A;  2VE9 A;  3I0T A;  2L5Q A;  5FFZ A;  2JA5 J;  1I6X A;  3ISP A;  1JTY A;  1JHF A;  3B02 A;  5DM6 F;  1AOY A;  1U78 A;  2DDB A;  3GO5 A;  2LKX A;  2FQ4 A;  1WJE A;  2RAE A;  1U9N A;  3GFM A;  4A5M A;  4A69 C;  4HPQ A;  1D0Y A;  3L9F A;  2VBX A;  3RYR A;  1BOA A;  2M4K A;  2ECB A;  1IUF A;  3E3V A;  3LSG A;  5ILU A;  3QRF F;  2JTV A;  4XLA A;  2VOD A;  2HI3 A;  2JUG A;  5E3M A;  5LRR A;  3S1Q J;  2CSO A;  3E5Q A;  2X48 A;  1D5V A;  4WXD A;  4YEJ A;  2F2E A;  2L54 A;  1BW6 A;  5CVR A;  4BY1 J;  1F5T A;  1SVO A;  3E5X A;  2ZJ2 A;  3UNG C;  2IA2 A;  2NVY J;  3H9Q A;  4BKX A;  2FJ1 A;  3WTV C;  1B4A A;  1X4O A;  1YHQ I;  1R4N B;  3PUB A;  4AUX A;  2ZB9 A;  2XHK A;  4DJA A;  4CCN A;  4NC7 A;  4IHY A;  4BEH B;  4GRI A;  4DOZ A;  4EM2 A;  5E18 F;  1VF9 A;  3O3K A;  2XUB A;  4MFE A;  2HXI A;  2DA1 A;  2QM3 A;  3ZP5 A;  5GAE J;  4RGU A;  2M2E A;  3CO7 C;  2HGC A;  3OV8 A;  1SAN A;  4BUP A;  1T8I A;  1BC8 C;  2FSW A;  3K4B A;  2YX4 A;  5H2F C;  1OQY A;  2M8E A;  5K7Z A;  3CC2 I;  4KNY A;  5M5Y J;  2I5U A;  1CQT A;  2Z33 A;  2R7Z J;  4G7H F;  5JR3 A;  1E17 A;  5DUK A;  3TED A;  2JZY A;  1H9G A;  2YUS A;  2LF7 A;  3HGG A;  4OOI A;  5HNH A;  1ACI A;  1X19 A;  2A5W A;  1X3U A;  2P4W A;  2GIZ A;  3DKX A;  3LA2 A;  2QQ9 A;  3K2Z A;  1QQI A;  1EA3 A;  5KVR A;  2D1H A;  4CGZ A;  1UHM A;  4RB3 C;  4IF4 A;  1RRJ A;  4O3M A;  2QVO A;  4DGW B;  1HKT A;  5BS6 A;  2V9P A;  2BHZ A;  3H9J A;  1W7P A;  1PP7 U;  2VB6 A;  2KHM A;  1J59 A;  2JSC A;  5CVV A;  2HOS A;  3C2B A;  4CCL A;  1GV5 A;  1W1W E;  2R93 J;  5TIS C;  4FE7 A;  2M30 A;  1R6R A;  4M74 A;  1OR7 C;  3PFI A;  3NRV A;  1K61 A;  2Y69 H;  2Q1Z B;  4LIV A;  3D1N I;  1SC7 A;  3FXU A;  1YRN A;  3HKZ A;  1YI2 I;  2K9L A;  4IEJ A;  1K78 A;  3QAH A;  1LVK A;  2EV6 A;  2VQG A;  4LB5 A;  1D8K A;  3V7C A;  1I39 A;  1A36 A;  4IHV A;  1XC5 A;  4BQA A;  4I0A A;  1QVT A;  5IP9 J;  3OYC A;  1XX5 A;  4BNC A;  3LA7 A;  2NVQ J;  3R0A A;  4PJM A;  5DDG A;  2NVT J;  3JR9 A;  4A3J J;  1X3W B;  2LKS A;  1ZK8 A;  3HEF A;  3KET A;  1T33 A;  1JHH A;  2X1E A;  3EYY A;  3TGN A;  1X2N A;  3WE3 A;  4L18 B;  2Y31 A;  3CF2 A;  4JX5 A;  2DTR A;  3CES A;  2DA2 A;  4OIQ F;  9ANT A;  2PMZ N;  1V5F A;  3H35 A;  1RR7 A;  4HX8 A;  2DA7 A;  1QHH D;  2KPM A;  1SD7 A;  2E5Z A;  2XPV A;  3ZMT A;  4I02 A;  4MIM A;  1YLF A;  4DBQ A;  1TNS A;  4RLF A;  2M87 A;  2MYS A;  1Z3X A;  1X4P A;  4MO7 A;  4UVB A;  1MDM B;  3MZH A;  1EH7 A;  2MLK A;  2DO7 A;  4CH7 A;  1W7P B;  4EM1 A;  2DFH A;  4IOA F;  2IT0 A;  2VN2 A;  4BQN A;  3NAR A;  3GTP J;  1B1B A;  1MH3 A;  3CZ6 A;  4R79 A;  2KIF A;  1NG7 A;  1KU2 A;  5M5W J;  1LEA A;  2H8W A;  3FF5 A;  3QOE A;  4M6Y A;  2CO5 A;  3VEP A;  4AIK A;  4D9J A;  3KEQ A;  3DXJ F;  4UUV A;  4BE1 A;  1BL0 A;  3M7G A;  4XSX F;  1YRN B;  1YTY A;  2Y0S A;  4V2F A;  1K78 B;  4MEX F;  1X1B A;  1ZRF A;  1ETV A;  5IP7 J;  1D8J A;  1Y39 A;  5FGM A;  4C30 A;  4G7Z F;  4RB2 C;  1PVE A;  3ERM A;  2GM4 A;  1IW7 F;  3NEU A;  4PDK A;  1IRF A;  3WG7 H;  3V8J A;  4XLE A;  4HST A;  2ZKZ A;  4DIQ A;  2NXN B;  3RJP A;  3OYI A;  1XGN A;  4XID A;  1U6G A;  3KZZ A;  2FNA A;  2DA5 A;  4ESF A;  3KCC A;  3J80 K;  1HKQ A;  5CQE A;  4WWC A;  3RPU D;  5FKM A;  3DWL E;  3ZQL A;  1K4T A;  2WV0 A;  2ESN A;  5E8G A;  2FOK A;  3IAM 2;  4XRS G;  3HHG A;  2DCE A;  1V3F A;  4RGX A;  3BR3 A;  2QYO A;  3H0D A;  3F23 A;  2M5W A;  5K7F A;  2HQR A;  1BI3 A;  5E20 A;  4XK4 A;  1VZ0 A;  5IPA A;  1ZG5 A;  4JP0 A;  4OAZ A;  4EJU A;  2DOA A;  2BXZ A;  3W6V A;  2YX7 A;  2JRM A;  1IXC A;  2LNB A;  1EV7 A;  4UXN A;  3M8J A;  1BM9 A;  2WAE A;  2HKX A;  3CCS I;  3KLO A;  3WG9 A;  1OMI A;  1ZAO A;  3R61 A;  1EH6 A;  2ZME B;  1JXS A;  3DBH B;  2AXL A;  2DFF A;  3GEZ A;  1MBK A;  1P7I A;  3DPT A;  1YJ9 I;  1DQU A;  2O6G E;  5D8K B;  2DMQ A;  4J00 A;  2LY2 A;  2UUZ A;  1QVU A;  2GXB A;  2E7X A;  4MFD A;  3ERE D;  2JA6 J;  1YIT I;  1HCR A;  4MHG A;  1LJ9 A;  4XRF A;  1G2H A;  4KJZ A;  3CUO A;  1TWF J;  1ETO A;  1MMN A;  1H89 C;  1B59 A;  3QP6 A;  2DFE A;  3BG5 A;  1TLH B;  3L2C A;  1MBH A;  3PUF A;  4HDU A;  1OCR H;  1UMQ A;  2M8G X;  4MNU A;  4F92 B;  3F8F A;  5TGT A;  5EGO A;  3CCU I;  2GA1 A;  2DN0 A;  1WJ5 A;  2L4M A;  2X6X A;  4BQO A;  1VQK I;  3TO6 A;  5ICG A;  4LK1 F;  4B3X A;  5D5W B;  1MMA A;  3IH4 A;  1IDZ A;  4DYC A;  1YFH A;  5B66 C;  1R7J A;  5LEJ A;  1PYV A;  1MBG A;  3QQA A;  3QWL A;  2G0E A;  3X2Q H;  4CZZ A;  3P9K A;  2R7R A;  1R71 A;  2RNG A;  2EZK A;  2FX0 A;  3BG7 A;  4OIO F;  1NK2 P;  4Q47 A;  4XOT A;  2KP6 A;  2K40 A;  3LL7 A;  2VBY A;  1DPR A;  4NQW A;  4DYR A;  4BJ6 C;  1XTA A;  2IEK A;  3FIS A;  3OOU A;  1AKH A;  4UNO A;  3MQ0 A;  4HA8 A;  1A6Q A;  1U8B A;  1ON1 A;  2MFZ A;  3MWM A;  2VKD A;  4UY8 I;  2A3S A;  3GZ6 A;  1X3Z B;  4Z6Y A;  5F04 A;  3VYR B;  1I3Q J;  2MD5 A;  3DPL C;  5J6X A;  3OYA A;  1R9T J;  1MSF C;  2A07 F;  4XLC A;  1JT0 A;  1D1A A;  1ENH A;  3GLL A;  2XAU A;  2V1N A;  1ZGW A;  3HM5 A;  4XLF A;  3HTU A;  2ME6 A;  3HSF A;  3JAM K;  3SZP A;  1SMT A;  1RNL A;  4UVA A;  2QEX I;  3KZI C;  5EGO B;  3CJR B;  1ETK A;  4IRG A;  3RQ4 A;  1IN7 A;  1G6N A;  3DKW A;  1BIA A;  4BL0 B;  1USS A;  4BBR J;  1KA8 A;  3BPV A;  3ZCO A;  2PMH A;  5B3S H;  2DT7 B;  3IWZ A;  3OY9 A;  2HDD A;  3K4J A;  1UST A;  4D0P A;  3UKG A;  3S2W A;  3WU2 C;  1O3S A;  2LD5 A;  3K4N A;  4UV9 A;  3EUA A;  5L3D A;  3OIP A;  1FJL A;  5JLX A;  2A5Y B;  2NNY A;  5A2Q Z;  5M3F J;  2QEN A;  1OYI A;  4Y3O A;  5GP9 A;  4MQ9 F;  2OD5 A;  2VC0 A;  5DYM A;  2R7W A;  2BOL A;  4NQW B;  3OYK A;  4UUT A;  5GPA A;  3V7S A;  3HG9 A;  1P2F A;  4A3D J;  2XRL A;  5J1R A;  4BJ5 C;  2V79 A;  3PL8 A;  2D1V A;  4XKV A;  2J5O A;  1HA8 A;  1XS9 A;  2HDC A;  4L5I A;  2BHY A;  4E7Z A;  3JRA A;  1SFO J;  3BWG A;  4M72 A;  2NOJ B;  2L9N A;  2QLZ A;  5LGT A;  2EFN A;  1J9I A;  4U0W A;  3OYG A;  1JGG A;  4HF1 A;  1KGS A;  2EIJ H;  4Y15 A;  5JI6 A;  1HQC A;  3CDI A;  2HS5 A;  3DU6 A;  5H20 A;  4F91 B;  2EFP A;  2X6O A;  4LIT A;  4XL9 A;  4HNV A;  5IOZ A;  2W85 A;  4ZZD A;  3K4M A;  1KQ8 A;  1HSJ A;  1D1C A;  2HYJ A;  5E1X A;  3ZXS A;  3MKY B;  2B0L A;  1QRY A;  1GVJ A;  3OL4 A;  3DV8 A;  4PJN A;  2HPM A;  1TT0 A;  1XPX A;  3CF5 F;  1ZKG A;  1SVM A;  1F1Z A;  2QSG X;  5K5O A;  4RAZ A;  4B8X A;  4X6A J;  2RKH A;  2K9Q A;  5L3E A;  1QNT A;  3ZN1 A;  4YIF A;  3BP8 A;  4XKC A;  3KYL A;  1BIB A;  1QPM A;  2QQA A;  3F3X A;  5HDG A;  3RTR A;  3LSR A;  1YE9 A;  4E70 A;  4C2T A;  1DP7 P;  5F0F A;  2LP0 A;  4Y7N J;  2HZD A;  3TMO A;  4EJW A;  3KP6 A;  2JVH A;  2W82 A;  5H6R A;  2ADU A;  2DAO A;  4HF0 A;  3ABK H;  1JE8 A;  4B1R A;  1UEL B;  1I5Z A;  2FD5 A;  5HDN A;  1ERD A;  2DK8 A;  1XG1 A;  3PJR A;  5IT3 A;  1YW7 A;  2F48 A;  2CMP A;  1LB2 A;  2DTZ A;  2A6H F;  1FX7 A;  1A5J A;  3VB2 A;  1S9H A;  2E19 A;  2W24 A;  2WY8 Q;  3H3U A;  2V1D A;  5KAF C;  1W36 C;  5EDN A;  3JRG A;  3KP7 A;  1SD6 A;  2COM A;  3OR2 C;  2XDV A;  4G6T B;  3CJN A;  5BOX A;  4LG0 B;  1IUY A;  3A01 A;  3JRB A;  4UB8 C;  1IN8 A;  3VSK A;  2MH2 A;  4YFX F;  4RB0 A;  4IRI A;  1BN5 A;  1PUF A;  1ZEL A;  5IYB J;  2CWE A;  2YR2 A;  3DBR B;  2WA0 A;  2IA0 A;  3J80 Z;  2G7H A;  5J4V A;  2F5C A;  1YW8 A;  2E1M C;  4ZYH A;  3HZJ A;  1X1D A;  4BDZ A;  3E0J B;  2RRE A;  2HTJ A;  4HX4 A;  2L7K A;  2Q2E A;  3HRS A;  4EAT A;  3LSM A;  5J3L A;  4RS8 A;  3HRT A;  5HLT A;  2XAS A;  4BHB A;  1EH8 A;  2ZNZ A;  1T0F A;  3FMQ A;  4XN0 A;  3DF8 A;  4B44 A;  3L09 A;  5CKT A;  4F55 A;  2CUZ A;  3J7Y J;  1YJN I;  2KIS A;  5LRS A;  1T6S A;  2W84 A;  1Z7L A;  4E7S A;  3S17 J;  1NK3 P;  2PMU A;  2OF7 A;  1OYY A;  2EV5 A;  2IS4 A;  3AG2 H;  1ZH5 A;  3WTU C;  2DBB A;  4N4O B;  3JRI A;  4BE0 A;  2H94 A;  2KKO A;  4KN4 X;  1JKP C;  1TNT A;  2NAZ A;  3EUH A;  4UV8 A;  4FE4 A;  2AXT C;  1RPW A;  2AQF A;  3K4L A;  4C3H J;  4ENJ A;  4E7H A;  4GCV A;  3FZV A;  5C4J J;  2XAQ A;  2MSY A;  2VJI A;  3L1P A;  4L5E A;  2GXG A;  1H9T A;  4N4N B;  2BYV E;  2XF6 A;  1SFX A;  3A01 B;  2F5E A;  2OAZ A;  3ZMV A;  1P6R A;  3PIP F;  2CQ7 A;  3I5U A;  1IXR C;  4XM3 A;  3E6C C;  3TQN A;  4HQE A;  5TJJ A;  1F43 A;  3VPR A;  2WV1 A;  4AVZ A;  1I6H J;  3QYB A;  4PFO A;  1PUF B;  4M9X A;  2LY1 A;  2OCC H;  2ZXW H;  1HLV A;  3S1R J;  2W48 A;  4ZJZ A;  4WXH A;  3Q0U A;  1KU7 A;  2BY2 A;  3L2W A;  1NG6 A;  3DCF A;  3IAS 2;  2CFO A;  2Q2E B;  4HZF A;  1W0U A;  3HOZ J;  4JQF A;  5HOO A;  1RKT A;  2O03 A;  2OQR A;  3J7Z I;  1PUE E;  1D5Y A;  1FOX A;  3L7W A;  1J75 A;  3EET A;  2KFD A;  4A5N A;  1AHD P;  3DFG A;  5DS9 A;  2JVG A;  2RV8 A;  3HRM A;  1FZP B;  4PSX A;  3KP4 A;  1F36 A;  3CP2 A;  3EQL F;  2LK2 A;  3ZN0 A;  2WTE A;  4E6K G;  2Z2S B;  1P4X A;  4M3G A;  2H8R A;  3BR0 A;  3RKY A;  1WJD A;  4L9V A;  4ENM A;  3MAJ A;  3JW4 A;  3OS2 A;  2MG4 A;  5DEQ A;  1LUJ B;  2XPW A;  4AD9 A;  1S29 A;  3ZMS A;  3SDG A;  5LHI A;  4U87 A;  1LNW A;  2CQX A;  1FYK A;  2CFX A;  3BQZ A;  3Q0W A;  1LFB A;  3BZ6 A;  5DV5 A;  4L0Z B;  3H5N A;  1N75 A;  1BA5 A;  2BV6 A;  3G1O A;  3JRD A;  2DJN A;  2CQK A;  2VC1 A;  3BR2 A;  5J1Y A;  3D5R C;  2EQR A;  3I9V 2;  4DW6 A;  2E7W A;  5FFX A;  1Z77 A;  4NUB A;  4EEF G;  1ZQ3 P;  4A3M J;  3AG3 H;  2A69 F;  1O7F A;  3HGY A;  5LEK A;  4RDU A;  3CCM I;  4HLX A;  1JUP A;  2P5V A;  1X2M A;  2ICW G;  5BNG A;  2J5P A;  3C18 A;  4N9I A;  5LGN A;  2JA2 A;  4RAG A;  4XOR A;  3SZG A;  3QPH A;  2M7A A;  1NHA A;  1FLI A;  5D6E A;  3ZMD A;  2CRG A;  5M3M J;  3B6C A;  3ZMZ A;  1VI0 A;  3CMY A;  1I1S A;  2E1C A;  3W2V A;  5E3O A;  3RCO A;  1UAA A;  3ZR8 X;  4G6Q A;  1WH7 A;  4KFC A;  3Q9S A;  2KQR A;  4LLG F;  2YPR A;  2BBY A;  4IZZ A;  1JJ6 C;  4ZTJ A;  1Y8R B;  3ZMU A;  1WZ2 A;  4IL6 C;  5L3C A;  2XGE A;  3OYM A;  1XDS A;  2R7U A;  2KMU A;  2HYG D;  1JUS A;  1OCC H;  3OR1 C;  4A3I J;  5FD5 A;  2KL4 A;  1G8X A;  2LF8 A;  3H92 A;  2K4J A;  4I6Z A;  4PJJ A;  2IAI A;  4I2O A;  2WAQ A;  3FM5 A;  2NS7 A;  4XNF A;  3PSF A;  4C3J J;  1ONV A;  4ENK A;  2OZU A;  2VBW A;  4NHJ A;  1WQ2 A;  2CU7 A;  4FX4 A;  1WHU A;  2QA4 I;  5LFA A;  3OS0 A;  3P9C A;  3A1Y A;  2O8K A;  3ULQ B;  2IVM A;  3H0G J;  3HC7 A;  4N0B A;  4U0V A;  4CO8 A;  3CCL I;  4CYC A;  2EK5 A;  5JFR A;  1UCR A;  1FOY A;  2L02 A;  2V1X A;  1L3L A;  1DGR M;  5JLW A;  1MBF A;  4MTD A;  2FML A;  5BPD A;  3M1C A;  2ZBK A;  2UXX A;  3SDB A;  4XRM A;  1FBQ A;  2VL8 A;  3CTA A;  1MDM A;  1FEX A;  1EKE A;  2KJC A;  1E2X A;  4L9J A;  1IG7 A;  3FBN B;  3ML6 A;  3WU0 A;  4Q5S F;  2V6C A;  4B3A A;  3OIQ A;  2LSO A;  3DLL F;  4P5O A;  1O3Q A;  3G1L A;  1APL C;  3AL0 B;  3MKL A;  1I50 J;  1DP3 A;  3ZQ7 A;  2EFQ A;  5FLX K;  3FM3 A;  4FX0 A;  1ZG3 A;  2E1N A;  2BE5 F;  1ZN2 A;  3LWF A;  2JT1 A;  1U5T A;  4A0Y A;  1C0W A;  1BC7 C;  3HB9 A;  1P9Q C;  3I71 A;  1UHW A;  5FKO A;  5ILV A;  3WTT C;  1QGP A;  3KEY A;  1Y6I A;  1Y1W J;  3CLO A;  4FAS D;  3G71 I;  1BR4 A;  3T1B A;  4XLH A;  1M1E B;  2XGX A;  2O3F A;  4QTR A;  1R5I D;  2MD0 A;  1ZGA A;  2WAD A;  5B1A H;  1O3T A;  4ON0 A;  1FOW A;  3SZT A;  5HOD A;  2ZJP F;  4KUM A;  3WTW C;  3QP5 A;  1R1T A;  3T5X A;  4AIH A;  1RC9 A;  4UVC A;  4A3K J;  2L3D A;  1CGP A;  4CYC B;  2Z5U A;  4V19 K;  4BXX J;  1XDU A;  4C9Y A;  1IRX A;  4RBO A;  4IKF A;  4KMF A;  3BQY A;  1EF4 A;  4O5V A;  4K2E A;  1Z6R A;  3KLN A;  4ASN A;  2OV7 A;  2Y2Z A;  5B5E C;  4XIC A;  3S8P A;  1K4S A;  4KIT B;  2L01 A;  2CUJ A;  4B47 A;  1WCM J;  2DK5 A;  4IOC F;  3TDZ C;  3OYJ A;  3BJ6 A;  3SQN A;  4YIR X;  3HOY J;  5EJC A;  2D45 A;  5CLS A;  3D5L A;  1ZTR A;  3CME I;  2MH9 A;  4M73 A;  2R5Y A;  4ABZ A;  2VAS A;  3WTY C;  2V9K A;  1U5T B;  2ZME A;  2H6C A;  4J19 A;  2PJR A;  2XSJ C;  3TOA A;  1YIO A;  3CCY A;  3LQQ A;  3WHB A;  4M6X A;  2XC7 A;  2KZV A;  3ZQC A;  3GTL J;  1WJA A;  3VYS B;  2CUE A;  3JRH A;  1F9N A;  1U8R A;  3A0H C;  1FYM A;  4YII A;  2L7F P;  1UFM A;  2IBD A;  2NOG A;  3KX2 A;  2MC3 A;  4UB6 C;  4EMS A;  3U1D A;  1J5Y A;  3IUO A;  5FRM A;  5ICC A;  4G9Y A;  4BS9 A;  1KON A;  3OYL A;  3CMM A;  3KYC B;  3KFW X;  4NC6 A;  5KAI C;  2HTS A;  2HWV A;  2NNN A;  3LSP A;  1KU9 A;  1YQA A;  1ETX A;  2XF7 A;  3MKZ A;  2XAH A;  2KLO A;  2ZXH A;  3BG6 A;  2MC4 A;  2ISZ A;  2KDZ A;  3W2W A;  1JTX A;  1XMX A;  1JI8 A;  3TW7 A;  2EIM H;  1YX3 A;  3KIO A;  3JSP A;  5CVI A;  4CIC A;  1UZC A;  1O4X A;  4GDF A;  2WB1 A;  4ITV A;  1R1V A;  3F8C A;  2HU9 A;  5CYV A;  1MMS A;  2Z16 A;  2K9S A;  5JHU A;  2CW8 A;  1VQ4 I;  4CYD A;  2H6B A;  5HLI A;  4B48 A;  3ZGK A;  2R5Y B;  2E5N A;  2VI6 A;  3KE2 A;  3VYU B;  4S05 A;  3PIO F;  5LBQ A;  2KZG A;  3OYE A;  1O3R A;  5K1Y A;  3GLX A;  4IJA A;  5L3B A;  3TL4 X;  1TW3 A;  2PJR B;  4AYB N;  4BXU A;  3I56 I;  2RQP A;  4HF2 A;  4NDL A;  1W0T A;  2E36 A;  5DCM B;  5F1J A;  1IN4 A;  3VOD A;  1YS7 A;  3M07 A;  2DT6 A;  1Z67 A;  1SVL A;  1E3H A;  2Y0M A;  4B4C A;  4ANJ A;  3SYT A;  3K2A A;  3Q5F A;  3IH3 A;  2K9N A;  3J7A O;  3E6M A;  1QZY A;  2UZK A;  1ZGJ A;  3EUH C;  1XSX A;  3HBL A;  4JOM A;  1ULY A;  5HVQ C;  3DEW A;  3REO A;  3U1K A;  2VOP A;  3EUK L;  3SEZ A;  2LFB A;  1WGX A;  2ELJ A;  1ZRC A;  3JCU C;  3C2G A;  3MZY A;  4HW0 A;  3V7R A;  1E3O C;  3LSI A;  1PJR A;  1I27 A;  1KYW A;  1Z3Y A;  2GIV A;  3CUQ C;  5E1W A;  1CF7 A;  4KT5 C;  3FKJ A;  4KMU X;  2TCT A;  4XQF A;  2G9W A;  5E79 C;  1VQ7 I;  1X1C A;  2K02 A;  2ZJQ F;  4M6V A;  4A3G J;  2R7X A;  2EWN A;  3QYF A;  4GYI A;  5F08 A;  2HDW A;  3GFL A;  3OSG A;  1VQ8 I;  2QGU A;  4JX6 A;  3SFI A;  2NVU B;  3S2D J;  4PFP A;  2RNJ A;  3KP5 A;  5HNF A;  2RVC A;  2P81 A;  5EEH A;  3J81 K;  1V4R A;  5F27 A;  3A03 A;  1QU3 A;  2MGQ A;  1TT5 B;  2IGM A;  2DFI A;  3H3Z A;  2NVX J;  3EPZ A;  3WGI A;  5FLM J;  2OBP A;  2RC4 A;  2IS6 A;  1HW2 A;  4LGW A;  1RR8 C;  3RIR A;  4XRS A;  1FTZ A;  3BRO A;  1FWZ A;  4HNT A;  4A3E J;  3I53 A;  3LMM A;  3EDP A;  3OOP A;  2WC2 A;  2DOD A;  1VFC A;  2E2I J;  4OAY A;  3F8B A;  3IRQ A;  2QQ8 A;  5GAH J;  3FK7 A;  1MD0 A;  4HQM A;  2GOX B;  3DP7 A;  4KIB A;  4D5C A;  5LHG A;  3AAF A;  1YIJ I;  1FYL A;  4WK8 F;  2ZXJ A;  1QPI A;  4KA4 A;  2IRF G;  5J40 A;  3JRC A;  1IDY A;  3C7J A;  4EJT A;  3OYF A;  3GXO A;  4X0G A;  4ESJ A;  2CH0 A;  4A93 J;  3RSN A;  2KRC A;  2BZT A;  2XAF A;  2VE8 A;  3Q3S A;  1A35 A;  1FBS A;  3P7N A;  2CGP A;  2GXA A;  4R8H A;  3BJO A;  5GPC A;  3MKW B;  1NH3 A;  1Z6T A;  5ICF A;  4BXF A;  1CF7 B;  3HUG A;  4LJZ F;  4RAY A;  4XLN F;  1U2W A;  3T8T A;  3F8N A;  2DT5 A;  4DBR A;  1HF0 A;  1W5S A;  1HOM A;  3ZPL A;  3HXL A;  1XCB A;  3PO2 J;  2XSD C;  2QF7 A;  3MZ8 A;  4OMZ A;  2WAF A;  3HOX J;  4XN3 A;  2F5F A;  4G8X A;  2R0Q C;  1RIO H;  1DPU A;  1R4M B;  3I55 I;  1OR7 A;  1SFU A;  2DPU A;  5AIQ A;  5J8F A;  1XGS A;  2LR8 A;  2STT A;  3MMY B;  5FLX Z;  1ZRE A;  2X6W A;  3LQR A;  1DGW Y;  2W1O A;  4Y17 A;  2DA6 A;  3I59 B;  2JQ7 A;  2FBK A;  1LPQ A;  1KYZ A;  1XSV A;  3ONQ A;  4CCJ A;  4IHX A;  5FD6 A;  2CUF A;  4EJO A;  3PQJ A;  2GLO A;  2HVR A;  2FF4 A;  2QSF X;  4KIG A;  4ENN A;  4LG0 A;  1JKR C;  1MBE A;  2VUM J;  3SEQ A;  2OC6 A;  4ZC3 A;  1WJC A;  2AQE A;  2PMZ A;  2A05 A;  1ZAR A;  1JJ8 C;  2VQC A;  1Y0U A;  3H5R A;  2L7M P;  3ABM H;  2M9H A;  3AL0 C;  3F22 A;  3E1S A;  3OS1 A;  4XLP F;  4BY7 J;  3HRU A;  1BI2 A;  2X6Y A;  4P55 A;  4OMY A;  4U7B A;  1T56 A;  3HUG B;  3DEU A;  2F5V A;  2ZSH B;  5KCM A;  2IW5 A;  1P4A A;  3DKY A;  4BAC A;  5HS9 A;  5CJ9 A;  5D4R A;  2PI0 A;  2CQN A;  4FTH A;  4ZDL A;  1VQ9 I;  1E3P A;  3FXR A;  3RPQ A;  3TKY A;  3FXJ A;  1HST A;  1HW1 A;  5F6F A;  1FIA A;  3FXM A;  1QBJ A;  1FTT A;  1OPC A;  4G6D A;  5K5R A;  1G3S A;  3RPU A;  5ICE A;  1OCO H;  4L9T A;  2ZSI B;  5C4X J;  3TBI A;  3G73 A;  4HOB A;  1IO2 A;  1D0Z A;  4OIN F;  1PDN C;  2W7N A;  5FJ8 J;  1T08 B;  4N9H A;  1VQP I;  2O61 A;  2GQQ A;  2K3F A;  5C3E J;  4Z2Y A;  3AG4 H;  5CVU A;  2W4S A;  1TW2 A;  2Y75 A;  1FT9 A;  3HSR A;  4KDP A;  2V26 A;  2VQL A;  1WPK A;  1Y0N A;  2BW3 A;  1KZH A;  1WJB A;  1ON2 A;  1VQL I;  1FNN A;  2L9R A;  3HOW J;  2Y30 A;  4WX9 A;  1YJW I;  2VT3 A;  2PJP A;  3V42 A;  3ZQI A;  1T95 A;  2HVQ A;  3E6B A;  4A2U A;  2O9L A;  2IGN A;  1ZRD A;  3MFK A;  1W36 D;  5F1R A;  3MCZ A;  3HKZ N;  3F9K A;  1LFU P;  3FX3 A;  3R4K A;  2LH9 A;  2UV1 A;  2R5Z A;  3GME A;  4I09 A;  4IXA A;  1MW7 A;  1Z1D A;  2L4A A;  3A4C A;  5KHD A;  5E8I A;  4IQJ A;  2IA1 A;  4V2G A;  2RQQ A;  4ZH4 F;  1Z05 A;  3OSF A;  5GTI C;  4WXC A;  1R58 A;  2K27 A;  3PNY A;  3SHF A;  4L0Y B;  2GA2 A;  1U0J A;  4DZP A;  2VJ4 A;  1OLT A;  3K1M A;  5D4S A;  5LD2 C;  3BR6 A;  2EB7 A;  3E97 A;  3BTJ A;  1YOV B;  1X1A A;  1IXS B;  4HV6 A;  1R5G A;  1V54 H;  3IC7 A;  2DQL A;  2E34 A;  5IYD J;  2EH3 A;  1H8A C;  2HKO A;  4AYB A;  4G7O F;  5J8C A;  1YG2 A;  3LSJ A;  1X1P A;  4RM2 A;  4S04 A;  1WI3 A;  3TOB A;  1Z21 A;  1Y8Q B;  2FBI A;  3BZC A;  3K70 C;  3RKW A;  2L9S A;  5IP6 A;  2L7Z A;  3Q9V A;  1BI0 A;  3RQI A;  3RKX A;  1YO5 C;  2BW3 B;  3Q0V A;  3IKT A;  1T39 A;  2CV1 A;  4BDY A;  3CD6 I;  2OTJ I;  4XON A;  1XCV A;  3TP3 A;  2EZI A;  1W4M A;  5E17 F;  1GVD A;  4II3 A;  5EG0 A;  1D3Y A;  3O6B B;  3DPU A;  2P7C B;  4E7L A;  2PEX A;  3QPL A;  3BLY A;  2ID6 A;  2ZME C;  4D5F A;  1MJB A;  2Y0S N;  4XSZ F;  3ZQQ A;  1QZE A;  1S3J A;  4U0Y A;  2R5Z B;  3MN2 A;  2LRE A;  3GUD A;  1ZHF A;  3W3C A;  5DD4 A;  3RZD J;  3S3O A;  2CQQ A;  3M8E A;  4PGH A;  2RGV A;  2PG4 A;  2D2W A;  4PGG A;  2Z99 A;  1S8N A;  2O0Y A;  1X58 A;  2VBZ A;  3FXL A;  3ZRG A;  3ZQH A;  2X51 A;  5FLV A;  5LLQ A;  1WI9 A;  4QPO A;  1FPQ A;  4LOC A;  1G3W A;  4M3D A;  3CLQ A;  1SMY F;  1ZR4 A;  5L3F A;  1AWC A;  1TQI A;  2KT0 A;  1MZB A;  3OYD A;  4PUS A;  1IN5 A;  1GXQ A;  1VQ6 I;  2R7O A;  4MLO A;  5EZH A;  3FDY A;  3UR3 C;  4QWQ A;  5CQG A;  2IP2 A;  3WGG A;  5E3N A;  3L2Q A;  2X1D A;  5FKN A;  1WVR A;  2E2H J;  4L9N A;  3CC4 I;  2LTP A;  3CCV I;  2KIQ A;  5D5X B;  2V6E A;  4M3F A;  5FO5 A;  3S15 J;  1WWX A;  5TRD A;  3S32 A;  2ZCW A;  4EQQ A;  3NWS A;  5EG0 B;  3QU3 A;  2HVS A;  2P5K A;  5HS8 A;  5DM7 F;  3JAM Z;  1JUM A;  1OFC X;  3WGH A;  1XMA A;  1IC8 A;  4MGR A;  2FNP A;  2QCO A;  1VQO I;  1WFX A;  4I98 B;  3CCJ I;  3ABL H;  3FHZ A;  2P5L C;  3S3N A;  1GT0 C;  4CHU A;  2M45 A;  1DUX C;  2QKM B;  1B72 A;  4HBL A;  3M8F A;  2KIM A;  4ETS A;  2I8D A;  1Q1H A;  4R1H A;  2PLY A;  3JTG A;  2XB0 X;  4W97 A;  4RB1 A;  4O6J A;  3ECO A;  3CJQ B;  1IGN A;  3I3L A;  1AA7 A;  4NBQ A;  2LBF B;  3ZQF A;  4BYY A;  3BC8 A;  4LD5 A;  4M9S A;  1SEU A;  1RUO A;  1MBJ A;  3QU6 A;  3JSO A;  3KPH A;  2K3P A;  4H4K C;  5F0C A;  2N8G A;  2E71 A;  3BR1 A;  4P9F A;  1IAW A;  4IHT A;  1D1B A;  3VFZ A;  2R3S A;  3H1C A;  2IS2 A;  1FMW A;  4DYQ A;  4QIW N;  1AU7 A;  1A6I A;  1XMK A;  3IWF A;  2V9V A;  2FEZ A;  1U3E M;  4RMN A;  3NQO A;  5J1U A;  2QKL B;  3KP3 A;  3GFJ A;  4LK0 F;  3KEO A;  5HLH A;  3HOT A;  3TW6 A;  4KT6 A;  1BW5 A;  2DYS H;  1MND A;  1Q1V A;  2ELK A;  3S2H J;  4CCK A;  1W5T A;  3F6V A;  5GTH C;  4A12 A;  3BPX A;  3GTJ J;  2E1O A;  3CCE I;  3R0J A;  1FMV A;  2OPT A;  1HXD A;  2EIN H;  3BY6 A;  1K7A A;  3F8M A;  1IZ1 A;  1V55 H;  3TO9 A;  5BPI A;  4KIS A;  4A0Z A;  2X85 A;  4IO9 F;  1DU6 A;  2EV0 A;  5FKL A;  2HEO A;  2JN6 A;  2HOA A;  3LST A;  2K86 A;  2CV2 A;  2PFB A;  1B72 B;  1ETW A;  1BOB A;  2IGK A;  1MH4 A;  2LRD A;  2IPQ X;  3K7A J;  3S14 J;  3AFH A;  2KDO A;  3HPH A;  3ZOB A;  4TV7 A;  3CDH A;  4BE2 A;  2V1U A;  2EZH A;  1OYW A;  2DI3 A;  2HZT A;  2M0C A;  2O5R A;  5JVT A;  3J7A Y;  3FXO A;  4E7I A;  3B6A A;  4UHT A;  5L3G A;  1FBU A;  3HOV J;  3IH2 A;  2OU2 A;  2ZO4 A;  4E7J A;  1IN6 A;  1R22 A;  1YS6 A;  2H09 A;  2IJL A;  3DEE A;  3D5S C;  2JJ7 A;  2O8X A;  4BBS J;  1LKX A;  2NRA C;  2JPB A;  3FMR A;  2HPI A;  2X1C A;  2P6T A;  1RET A;  2XPU A;  2D5V A;  3DTE A;  2KRH A;  4YEL A;  4PSW A;  1Z91 A;  5A2Q K;  3WU1 B;  4AC0 A;  1J7K A;  2R4G A;  3GTK J;  3RKQ A;  1TWC J;  1UG2 A;  3I64 A;  5KNL A;  2ESH A;  1EJ9 A;  3CCQ I;  4BGD A;  5ILS A;  3ECH A;  4J01 A;  4YG2 F;  2XKO A;  3G4S I;  3CQZ J;  1U9O A;  1XGO A;  2BY1 A;  2COB A;  3BT9 A;  3G6E I;  3C2H A;  1REP C;  3ELK A;  2BGC A;  3QOD A;  3BTI A;  2A61 A;  2YS9 A;  2EIK H;  3CC7 I;  2O7O A;  2JPC A;  3E6D A;  2QWW A;  4RGS A;  3ABT A;  2BVL A;  1ETY A;  3HDD A;  1S7O A;  3IP4 B;  3K0L A;  2DXI A;  2EA2 A;  4MEY F;  4G12 A;  3H3V K;  3HYI A;  3LOC A;  2HYF A;  3ESW B;  1B8I A;  3F21 A;  3FWE A;  1D0X A;  2NS0 A;  1GDT A;  4F3Q A;  1MNE A;  1S72 I;  2Z3Y A;  4HDV A;  4OU0 A;  2FRH A;  2GWR A;  2Z1D A;  3MD2 A;  4P9U A;  3O8G A;  1S5L C;  4LG3 A;  3AKZ A;  2VT2 A;  2X9D A;  2DOE A;  2VIX A;  3BTC A;  1ETQ A;  2K4B A;  2DA3 A;  2VXD A;  3ZQG A;  4JBA A;  1O7L A;  4F93 B;  3ASN H;  1Z7U A;  2XKP A;  2VLA A;  1FSE A;  5E3L A;  4AID A;  4QLC U;  3N97 A;  1ZG1 A;  1T2K A;  1FSH A;  5AON A;  3DTK A;  1OCT C;  3MEX A;  4BJT A;  1XSD A;  4MTE A;  2Z9O A;  4ZDO A;  4ZYD A;  3DU5 A;  3OL3 A;  4IX7 A;  3RZO J;  1UJ8 A;  4XKW A;  3BG3 A;  3VDX A;  3W2A A;  2PN6 A;  3GZ5 A;  2XF5 A;  3IHU A;  1QA6 A;  2VKH A;  3GTO J;  3PQK A;  2DPD A;  4B09 A;  3M1E A;  4JX4 A;  3B73 A;  2ISY A;  3PNV A;  4IRH A;  3IRR A;  2GBY A;  4ZYA A;  3O2P E;  3KP2 A;  3GTM J;  1H88 C;  1YX5 A;  2EPF A;  4XOP A;  1UB9 A;  3BCA A;  3P5J A;  3QPS A;  1G4D A;  1FIP A;  3DBL B;  5F0H A;  1SFK A;  1YYV A;  3JTH A;  4ZDP A;  1VND A;  1HKS A;  1TWA J;  2IGO A;  1MIJ A;  4A3B J;  3SXY A;  1TWH J;  2A6E F;  5DCM A;  2K7L A;  5DTD A;  4LMY A;  2F4M B;  1GV2 A;  4BHP A;  1R23 A;  2DLL A;  4RGR A;  2DU9 A;  1B8I B;  3S1N J;  5EEA A;  2VQH A;  2V7F A;  4PK4 A;  1K6O A;  1BR2 A;  4FIS A;  2E1M B;  2R92 J;  1N77 A;  2QUF A;  1HW5 A;  3IV5 A;  4BHC A;  2BVM A;  1DU0 A;  5JVG F;  1I3A A;  3I4M J;  4A0X A;  1K83 J;  1LVA A;  4KIF A;  1GXP A;  3M4O J;  1WRJ A;  3KZY A;  2JA8 J;  2A68 F;  1P92 A;  4WF2 A;  2LY9 A;  3BR5 A;  5IOY A;  1WJF A;  1RUN A;  1Z9C A;  1RES A;  2JSP A;  2EIL H;  1B9M A;  2FQ3 A;  2XAJ A;  5ED4 A;  1STZ A;  1KQ9 A;  3H9G A;  3HOU J;  4HYE A;  1QZZ A;  1HDD C;  3WTX C;  4I99 C;  3PO3 J;  3OIO A;  4B43 A;  1R00 A;  1SAX A;  2R7S A;  1F4K A;  1Y1V J;  1TQP A;  2P7V B;  3V8L A;  3FK6 A;  2M4G A;  2R7D A;  2ME0 A;  3LAP A;  2OCE A;  2B63 J;  2LOO A;  5LHH A;  3U9G A;  3I54 A;  2KJB A;  1G59 A;  4IVN A;  2IS1 A;  2TDX A;  3T8R A;  1LQ1 A;  2DYR H;  3KYD B;  4FET A;  3F0C A;  5F64 A;  4M9Z A;  2PX9 A;  1ZLK A;  2ETH A;  2BY0 A;  1T0F C;  3GTG J;  1ORK A;  2FMY A;  2OJE D;  2XGC A;  3RI4 A;  5IT9 K;  1P7J A;  4D1Q A;  1WSU A;  1LEB A;  1R5H A;  5ERI A;  4F52 A;  3I4N J;  1VQM I;  3JRE A;  5BQT A;  1IF1 A;  4DNC A;  2VKV A;  3CJT B;  3WHC A;  2M7B A;  3GF2 A;  1FY7 A;  3VYT B;  3GYH X;  2XV4 S;  5CPR B;  3W6J B;  4XBF A;  3HL2 A;  3L2V A;  2LMD A;  3S3M A;  2HR3 A;  3TP0 A;  4HV5 A;  4HLY A;  3GBG A;  4MQV A;  2JUC A;  3BTL A;  3PSI A;  4E4H A;  1A04 A;  3AG1 H;  2M34 A;  3GFI A;  2DW4 A;  1K79 A;  1IRZ A;  2L0K A;  4ZYE A;  3PM1 A;  4FQG A;  1DDN A;  2H1L A;  4NC8 A;  2F4O B;  1BR1 A;  4GYG A;  3E5U A;  1IJW C;  3FKI J;  4M3B A;  3RDI A;  4PJL A;  3P9I A;  2ZJR F;  3EYI A;  3FXQ A;  5K7H A;  1SD4 A;  2B9S A;  2CV0 A;  2XGD A;  2NYX A;  2P0W A;  3QPT A;  2YU3 A;  2CJJ A;  3LSH A;  4FT8 A;  5BMZ A;  2Y9Z A;  2Q8K A;  2OUM A;  3K4C A;  2CG4 A;  3LNQ A;  1P4W A;  5C44 J;  2ACJ A;  5DD8 A;  4YFN F;  1OCZ H;  2CW7 A;  2VPR A;  4YRV A;  5DCF A;  2PQ8 A;  1MMG A;  2LDU A;  2AO9 A;  4OIR F;  4XMY A;  2GZW A;  3CO6 C;  3CMA I;  4A3L J;  2LLK A;  3FXK A;  4OWR B;  4S0H B;  1S7A A;  3I59 A;  4AWX B;  4EVI A;  2AHQ A;  2ZFW A;  2ZC2 A;  1ITY A;  3OWT A;  4KYW A;  1QHG A;  1V5E A;  2FXA A;  4FHT A;  1L0O C;  4GO1 A;  1H0M A;  4AVP A;  2H1K A;  2NS8 A;  2VXZ A;  2MW8 A;  2XRO A;  1ZYR F;  1MJA A;  2WBM A;  3FMS A;  1IV6 A;  4HAM A;  2OQG A;  4EGY A;  3DTI A;  2PBI A;  3V4G A;  1KQ0 A;  3S1M J;  3OYN A;  2HQA A;  2KIU A;  1QO0 D;  2GOM A;  1XD7 A;  4L5J A;  4OIP F;  2JA7 J;  1TWG J;  1T38 A;  2KRF A;  1RKW A;  4UUS A;  3HTS B;  2HNH A;  4I01 A;  1N25 A;  4RLQ A;  1J09 A;  2VOO A;  1SD5 A;  4QPQ A;  4A3C J;  3OYB A;  2CS3 A;  3ASO H;  2OZ6 A;  5EF6 A;  1MJ9 A;  3N05 A;  1GUU A;  1V5G A;  3TDU C;  4Y13 A;  1MSE C;  1T98 A;  2H27 A;  4DZJ A;  4CCM A;  2I10 A;  2OTL I;  2HFH A;  1R49 A;  3GX4 X;  3D0S A;  2JMW A;  1XB4 A;  2DOF A;  3R6S A;  1IRG A;  4EJV A;  2FA5 A;  4CZC A;  3L00 A;  3M3Y J;  3S93 A;  2G7U A;  3K69 A;  4PZJ A;  5EYR A;  1LDJ A;  2ZXI A;  4A6E A;  4EGZ A;  5E1Z B;  4CSW A;  1OCP A;  3R60 A;  3BOQ A;  4E7K A;  4Q4Z F;  2M1B A;  4ZYG A;  2K85 A;  1RI7 A;  2R7Q A;  1TZL A;  1AKH B;  3S16 J;  4AU7 A;  1LDK B;  5K5Q A;  1YW9 A;  2Y48 A;  2LVS A;  5FKK A;  4HNU A;  4U88 A;  2MA3 A;  1FC3 A;  3K6G A;  2GAU A;  1MGT A;  2ECC A;  4PCQ A;  5HDK A;  4IPA A;  3E7L A;  2X0L A;  4D7M A;  3K1N A;  1Y56 A;  5J47 A;  1WH5 A;  3MVP A;  3ROU A;  2XB5 A;  2C6Y A;  1JKO C;  3QOP A;  2VJ5 A;  4HSR A;  3SFZ A;  1IV8 A;  5EZG A;  1XGM A;  2MBF A;  2YSR A;  2VON A;  4A6D A;  1SAU A;  4UUS B;  1G3T A;  4I0B A;  2HQN A;  1SFE A;  3PFY A;  1J0R A;  4M71 A;  4Y4R A;  2QBY A;  2R7T A;  1VTN C;  1B6A A;  2Y9Y A;  4CUG A;  2QQB A;  3I4P A;  2WAQ N;  2XVC A;  2R7F A;  4D7N A;  2MAB A;  1POG A;  2BY3 A;  5IY5 H;  2FBH A;  3CP8 A;  3HIF A;  4GGG A;  1BJA A;  4KIC A;  2DQR A;  2E60 A;  2XAG A;  2IXS A;  2XIG A;  3GW2 A;  3IL2 A;  2JK3 A;  5D5U B;  1OJL A;  3A0B C;  1WKM A;  1LE8 A;  1ZR2 A;  5JHF A;  1MNM C;  1VQ5 I;  6PAX A;  4BU2 A;  5J4Y A;  2DMP A;  1JKQ C;  3CDL A;  4ESB A;  1TC3 C;  4IHW A;  2FOW A;  1TL8 A;  4I76 A;  2LKP A;  4ZZL A;  1TQM A;  4HX7 A;  4RA2 A;  3NWT A;  2EFW A;  3O8H A;  3OMY A;  3I58 A;  2QSH X;  4JK1 X;  4XKB A;  4NNJ A;  4HG2 A;  4U7D A;  1BI1 A;  1BBY A;  3IKV A;  3TO7 A;  5IYC J;  3U21 A;  2W00 A;  3HPG A;  4LFU A;  4Y33 A;  4XR6 A;  2UWM A;  3A2K A;  3OYH A;  1S7E A;  2RN7 A;  2DMT A;  1VQN I;  3WTZ A;  4WCG A;  1ODD A;  2A6T A;  2BEO A;  3VSL A;  1GHC A;  4Y52 J;  2EBI A;  1A31 A;  2R7V A;  3LA3 A;  2CYY A;  1B9N A;  2TRT A;  4KN7 X;  1XN7 A;  4X1E A;  4F7Z A;  1R1U A;  3LFK A;  5FB2 A;  2ELH A;  3HOS A;  4C2M J;  1S6L A;  1U5T C;  3F6O A;  4HEA 2;  3BCB A;  1GLN A;  2QBY B;  3C3W A;  3M9A A;  1HBX G;  3GTQ J;  1W7P D;  1RZ4 A;  1PP8 F;  1LFP A;  4YFK F; 
#chains in the Genus database with same CATH homology
 2Q0O A;  1JGS A;  4LLL A;  2XRN A;  3HHH A;  2UXN A;  2OA4 A;  3DQV C;  5D5V B;  4H0E A;  3VOE A;  1ZLJ A;  3F72 A;  3WTS C;  1LDD A;  3BJA A;  1R36 A;  5EEG A;  2HOE A;  4NB5 A;  5H6Q A;  1O57 A;  3BDD A;  1KU3 A;  5HS7 A;  4DQ2 A;  5IT9 Z;  3K1P A;  2WWY A;  3GWZ A;  2JRT A;  5CVJ A;  3C1D A;  3GVA A;  4P96 A;  3ABU A;  2CW0 F;  5AIP A;  3N4M A;  3U2R A;  2P6S A;  4GXO A;  3CUQ A;  2AS5 F;  5LGU A;  3G3Z A;  4EM0 B;  4IHS A;  1TBX A;  2MLG A;  2W57 A;  1G3Y A;  4LB6 B;  1TTY A;  1J2X A;  4I7H A;  2FU4 A;  2EFO A;  4BH9 A;  1FOK A;  1I1G A;  2ZNY A;  3T0Y A;  2STW A;  2FE3 A;  2QZ8 A;  3V8K A;  4Q48 A;  5D6F A;  1MKM A;  1OKR A;  4G94 A;  3WE2 A;  3J81 Z;  5DUI A;  4AIJ A;  2X4H A;  3LAJ A;  2EJR A;  3COA C;  3RYP A;  5D8L B;  2P8T A;  5HLG A;  4EV0 A;  2RDP A;  1FP1 D;  3WOD F;  5KK1 A;  1FP2 A;  3K9T A;  4CDG A;  2W25 A;  3HSE A;  4CXF A;  2EA4 A;  3CUQ B;  3W6K B;  4LLN A;  4BAY A;  2F5D A;  2VE9 A;  3I0T A;  5FFZ A;  1I6X A;  3ISP A;  1JHF A;  3B02 A;  1AOY A;  1U78 A;  3GO5 A;  3GFM A;  4A5M A;  3L9F A;  2VBX A;  3RYR A;  1BOA A;  5ILU A;  3E3V A;  3QRF F;  2JTV A;  2VOD A;  5LRR A;  2CSO A;  3E5Q A;  1D5V A;  4WXD A;  2F2E A;  2L54 A;  5CVR A;  1F5T A;  3E5X A;  2ZJ2 A;  2IA2 A;  3WTV C;  1B4A A;  2XHK A;  4EM2 A;  5E18 F;  3O3K A;  2XUB A;  2QM3 A;  3ZP5 A;  4RGU A;  3CO7 C;  2HGC A;  3OV8 A;  1BC8 C;  2FSW A;  2YX4 A;  2M8E A;  4KNY A;  2Z33 A;  4G7H F;  5JR3 A;  1E17 A;  5DUK A;  2JZY A;  1H9G A;  4OOI A;  2LF7 A;  3LA2 A;  1X3U A;  2P4W A;  2QQ9 A;  3K2Z A;  1QQI A;  5KVR A;  2D1H A;  4CGZ A;  1UHM A;  4RB3 C;  4IF4 A;  4O3M A;  2QVO A;  1HKT A;  5BS6 A;  1W7P A;  1PP7 U;  1J59 A;  2JSC A;  5CVV A;  2M30 A;  4M74 A;  3PFI A;  3NRV A;  3FXU A;  1K78 A;  3QAH A;  4LB5 A;  2EV6 A;  1D8K A;  3V7C A;  4BQA A;  4I0A A;  4BNC A;  3LA7 A;  3R0A A;  5DDG A;  3KET A;  1JHH A;  3EYY A;  3TGN A;  3WE3 A;  4L18 B;  2DTR A;  4OIQ F;  4HX8 A;  1SD7 A;  3ZMT A;  4I02 A;  1YLF A;  1TNS A;  2M87 A;  4UVB A;  1MDM B;  3MZH A;  1EH7 A;  2MLK A;  2DO7 A;  1W7P B;  4EM1 A;  2IT0 A;  2VN2 A;  1B1B A;  4R79 A;  2KIF A;  1KU2 A;  1LEA A;  3FF5 A;  4M6Y A;  3VEP A;  2CO5 A;  4AIK A;  3KEQ A;  3DXJ F;  4UUV A;  3M7G A;  4XSX F;  1YTY A;  4MEX F;  1K78 B;  1ZRF A;  1D8J A;  5FGM A;  4G7Z F;  4RB2 C;  1IW7 F;  3NEU A;  4PDK A;  1IRF A;  3V8J A;  2ZKZ A;  3RJP A;  1XGN A;  1U6G A;  3KZZ A;  2FNA A;  4ESF A;  3KCC A;  3J80 K;  1HKQ A;  4WWC A;  2WV0 A;  2ESN A;  5E8G A;  2FOK A;  3HHG A;  4RGX A;  1V3F A;  2QYO A;  3F23 A;  2M5W A;  2HQR A;  1BI3 A;  5E20 A;  1ZG5 A;  4EJU A;  2YX7 A;  1IXC A;  2LNB A;  1EV7 A;  4UXN A;  1BM9 A;  2HKX A;  3KLO A;  3WG9 A;  1OMI A;  1ZAO A;  3R61 A;  1EH6 A;  2ZME B;  1JXS A;  2AXL A;  3GEZ A;  2O6G E;  3DPT A;  5D8K B;  2GXB A;  2E7X A;  3ERE D;  4MHG A;  1LJ9 A;  4XRF A;  3CUO A;  1B59 A;  3QP6 A;  1TLH B;  3L2C A;  4HDU A;  4MNU A;  3F8F A;  2GA1 A;  2L4M A;  3TO6 A;  5ICG A;  4LK1 F;  5D5W B;  1YFH A;  1R7J A;  5LEJ A;  4CZZ A;  3P9K A;  4OIO F;  4Q47 A;  2VBY A;  1DPR A;  4NQW A;  4UNO A;  3MQ0 A;  4HA8 A;  1ON1 A;  3MWM A;  2A3S A;  3GZ6 A;  2MD5 A;  3DPL C;  5J6X A;  2A07 F;  3HTU A;  3HSF A;  3JAM K;  3SZP A;  1SMT A;  1RNL A;  4UVA A;  4IRG A;  1IN7 A;  1G6N A;  3DKW A;  1BIA A;  1USS A;  1KA8 A;  3BPV A;  2PMH A;  3IWZ A;  1UST A;  4D0P A;  3S2W A;  1O3S A;  4UV9 A;  5L3D A;  2A5Y B;  2NNY A;  5A2Q Z;  2QEN A;  1OYI A;  4MQ9 F;  2OD5 A;  2VC0 A;  5DYM A;  3V7S A;  1P2F A;  2V79 A;  2D1V A;  2J5O A;  2HDC A;  4L5I A;  3BWG A;  4M72 A;  2QLZ A;  5LGT A;  2EFN A;  1J9I A;  4U0W A;  4HF1 A;  1KGS A;  4Y15 A;  5JI6 A;  1HQC A;  2HS5 A;  5H20 A;  2EFP A;  2W85 A;  4ZZD A;  1KQ8 A;  1HSJ A;  5E1X A;  2B0L A;  1GVJ A;  3DV8 A;  1F1Z A;  5K5O A;  4RAZ A;  4B8X A;  2RKH A;  5L3E A;  1QNT A;  3ZN1 A;  4YIF A;  3BP8 A;  1BIB A;  1QPM A;  2QQA A;  3F3X A;  5HDG A;  3RTR A;  4E70 A;  1DP7 P;  4EJW A;  3KP6 A;  5H6R A;  2ADU A;  2DAO A;  4HF0 A;  1JE8 A;  1I5Z A;  5HDN A;  2DK8 A;  5IT3 A;  1YW7 A;  1LB2 A;  2A6H F;  1FX7 A;  3VB2 A;  2W24 A;  3H3U A;  2V1D A;  3KP7 A;  1SD6 A;  2COM A;  5BOX A;  3CJN A;  4LG0 B;  1IUY A;  1IN8 A;  2MH2 A;  4YFX F;  4RB0 A;  4IRI A;  1BN5 A;  2CWE A;  2YR2 A;  2IA0 A;  3J80 Z;  2G7H A;  2F5C A;  1YW8 A;  4ZYH A;  2HTJ A;  4HX4 A;  2Q2E A;  3HRS A;  4RS8 A;  3HRT A;  2XAS A;  4BHB A;  1EH8 A;  2ZNZ A;  1T0F A;  3FMQ A;  3DF8 A;  3L09 A;  5LRS A;  1T6S A;  2W84 A;  2PMU A;  1OYY A;  2EV5 A;  1ZH5 A;  3WTU C;  2DBB A;  2H94 A;  2KKO A;  4KN4 X;  1TNT A;  2NAZ A;  3EUH A;  4UV8 A;  4ENJ A;  4GCV A;  3FZV A;  2XAQ A;  2GXG A;  1H9T A;  2BYV E;  1SFX A;  2F5E A;  2OAZ A;  3ZMV A;  1P6R A;  4HQE A;  3I5U A;  1IXR C;  3E6C C;  3TQN A;  5TJJ A;  4M9X A;  4WXH A;  1KU7 A;  4HZF A;  4JQF A;  5HOO A;  2O03 A;  1PUE E;  2OQR A;  3L7W A;  1J75 A;  3EET A;  4A5N A;  3DFG A;  2RV8 A;  3HRM A;  1FZP B;  3KP4 A;  3EQL F;  3ZN0 A;  2WTE A;  1P4X A;  3RKY A;  4L9V A;  4ENM A;  3MAJ A;  3JW4 A;  5DEQ A;  4AD9 A;  1S29 A;  3ZMS A;  5LHI A;  1LNW A;  1FYK A;  2CFX A;  5DV5 A;  3BZ6 A;  4L0Z B;  2BV6 A;  2CQK A;  2VC1 A;  2E7W A;  5FFX A;  2A69 F;  1O7F A;  5LEK A;  4HLX A;  2P5V A;  2J5P A;  3C18 A;  4N9I A;  5LGN A;  3QPH A;  1NHA A;  1FLI A;  5D6E A;  3ZMD A;  3ZMZ A;  1I1S A;  2E1C A;  4G6Q A;  4KFC A;  3Q9S A;  4LLG F;  2YPR A;  2BBY A;  3ZMU A;  5L3C A;  1XDS A;  2HYG D;  5FD5 A;  2LF8 A;  3H92 A;  2K4J A;  4I2O A;  3FM5 A;  1ONV A;  4ENK A;  2OZU A;  2VBW A;  4NHJ A;  1WQ2 A;  4FX4 A;  3P9C A;  3ULQ B;  2IVM A;  4N0B A;  4U0V A;  4CO8 A;  2EK5 A;  5JFR A;  1UCR A;  2L02 A;  2V1X A;  1L3L A;  4MTD A;  2FML A;  5BPD A;  2ZBK A;  2UXX A;  1FBQ A;  3CTA A;  1MDM A;  2KJC A;  1E2X A;  4L9J A;  3ML6 A;  3WU0 A;  4Q5S F;  2V6C A;  2LSO A;  4P5O A;  1O3Q A;  3ZQ7 A;  2EFQ A;  5FLX K;  3FM3 A;  4FX0 A;  1ZG3 A;  2E1N A;  2BE5 F;  1ZN2 A;  3LWF A;  2JT1 A;  1U5T A;  4A0Y A;  1C0W A;  1BC7 C;  3I71 A;  1UHW A;  5ILV A;  3WTT C;  1QGP A;  3CLO A;  3T1B A;  2XGX A;  2O3F A;  1ZGA A;  1O3T A;  4ON0 A;  3SZT A;  4KUM A;  3WTW C;  3QP5 A;  1R1T A;  3T5X A;  4AIH A;  4UVC A;  2L3D A;  1CGP A;  2Z5U A;  1XDU A;  4KMF A;  4O5V A;  4K2E A;  1Z6R A;  3KLN A;  4ASN A;  2L01 A;  2DK5 A;  3TDZ C;  3BJ6 A;  3SQN A;  2D45 A;  5CLS A;  3D5L A;  2MH9 A;  4M73 A;  3WTY C;  1U5T B;  2ZME A;  2H6C A;  3TOA A;  1YIO A;  3LQQ A;  4M6X A;  1F9N A;  1U8R A;  1FYM A;  4YII A;  1UFM A;  4EMS A;  2MC3 A;  3U1D A;  1J5Y A;  5ICC A;  4G9Y A;  3KFW X;  2HTS A;  2HWV A;  2NNN A;  1KU9 A;  1YQA A;  2XAH A;  2ISZ A;  3JSP A;  5CVI A;  4CIC A;  1R1V A;  3F8C A;  5CYV A;  5JHU A;  4CYD A;  2H6B A;  5HLI A;  3KE2 A;  4S05 A;  5LBQ A;  1O3R A;  5K1Y A;  3GLX A;  4IJA A;  5L3B A;  1TW3 A;  4BXU A;  2RQP A;  4HF2 A;  5DCM B;  1IN4 A;  3VOD A;  1YS7 A;  2Y0M A;  3Q5F A;  3J7A O;  3E6M A;  1QZY A;  2UZK A;  1ZGJ A;  1XSX A;  1ULY A;  5HVQ C;  3REO A;  2VOP A;  1ZRC A;  3MZY A;  4HW0 A;  3V7R A;  1I27 A;  1KYW A;  2GIV A;  5E1W A;  3CUQ C;  1CF7 A;  4KT5 C;  4KMU X;  2G9W A;  2K02 A;  2EWN A;  4GYI A;  3GFL A;  2RNJ A;  3KP5 A;  2RVC A;  5EEH A;  3J81 K;  1V4R A;  2DFI A;  3H3Z A;  3WGI A;  2OBP A;  2RC4 A;  1HW2 A;  4LGW A;  3RIR A;  3BRO A;  1FWZ A;  3I53 A;  3EDP A;  3OOP A;  2WC2 A;  3F8B A;  3IRQ A;  1MD0 A;  4HQM A;  5LHG A;  3DP7 A;  4KIB A;  3AAF A;  1FYL A;  4WK8 F;  2ZXJ A;  4KA4 A;  2IRF G;  3C7J A;  4EJT A;  3GXO A;  4ESJ A;  2XAF A;  2VE8 A;  1FBS A;  3P7N A;  2CGP A;  4R8H A;  3BJO A;  1CF7 B;  1Z6T A;  5ICF A;  3HUG A;  4LJZ F;  4RAY A;  4XLN F;  1U2W A;  3T8T A;  3F8N A;  2DT5 A;  1W5S A;  3ZPL A;  1XCB A;  4OMZ A;  2F5F A;  4G8X A;  1RIO H;  1DPU A;  1OR7 A;  1SFU A;  2DPU A;  5AIQ A;  5J8F A;  1XGS A;  2STT A;  5FLX Z;  1ZRE A;  3LQR A;  4Y17 A;  3I59 B;  2FBK A;  1KYZ A;  1XSV A;  5FD6 A;  4EJO A;  3PQJ A;  2FF4 A;  4KIG A;  4ENN A;  4LG0 A;  1ZAR A;  1Y0U A;  3F22 A;  4XLP F;  3HRU A;  1BI2 A;  4P55 A;  4OMY A;  4U7B A;  3DEU A;  2IW5 A;  1P4A A;  5HS9 A;  5CJ9 A;  5D4R A;  2PI0 A;  3FXR A;  3RPQ A;  3TKY A;  1HST A;  1HW1 A;  5F6F A;  1QBJ A;  1OPC A;  4G6D A;  5K5R A;  1G3S A;  3RPU A;  5ICE A;  4L9T A;  3G73 A;  4HOB A;  1PDN C;  4OIN F;  2O61 A;  4N9H A;  2GQQ A;  4Z2Y A;  5CVU A;  1TW2 A;  2Y75 A;  1FT9 A;  3HSR A;  4KDP A;  1ON2 A;  1FNN A;  4WX9 A;  2VT3 A;  2PJP A;  3E6B A;  4A2U A;  1ZRD A;  3MFK A;  5F1R A;  3MCZ A;  3FX3 A;  3R4K A;  4I09 A;  4IXA A;  1Z1D A;  2L4A A;  5E8I A;  2IA1 A;  4ZH4 F;  1Z05 A;  4WXC A;  1R58 A;  2K27 A;  3SHF A;  4L0Y B;  2GA2 A;  3K1M A;  5D4S A;  2EB7 A;  3E97 A;  1IXS B;  4HV6 A;  1R5G A;  3IC7 A;  2DQL A;  2HKO A;  4G7O F;  5J8C A;  1YG2 A;  4S04 A;  3TOB A;  2FBI A;  3RKW A;  3Q9V A;  1BI0 A;  3RKX A;  1YO5 C;  3IKT A;  1T39 A;  1XCV A;  1W4M A;  5E17 F;  1D3Y A;  3O6B B;  2P7C B;  2PEX A;  1MJB A;  4XSZ F;  1S3J A;  4U0Y A;  3GUD A;  1ZHF A;  5DD4 A;  3M8E A;  4PGH A;  2RGV A;  2PG4 A;  2D2W A;  4PGG A;  2Z99 A;  1S8N A;  2O0Y A;  2VBZ A;  5LLQ A;  1WI9 A;  1FPQ A;  1G3W A;  1SMY F;  5L3F A;  1AWC A;  1TQI A;  1MZB A;  1IN5 A;  1GXQ A;  4QWQ A;  2IP2 A;  3WGG A;  4L9N A;  5D5X B;  5FO5 A;  5TRD A;  1WWX A;  2ZCW A;  4EQQ A;  3QU3 A;  2P5K A;  5HS8 A;  3JAM Z;  3WGH A;  1XMA A;  4MGR A;  2FNP A;  4I98 B;  2P5L C;  3FHZ A;  4CHU A;  2M45 A;  1DUX C;  4HBL A;  3M8F A;  2KIM A;  4ETS A;  1Q1H A;  4R1H A;  2PLY A;  3JTG A;  4RB1 A;  4O6J A;  3ECO A;  4BYY A;  4M9S A;  4LD5 A;  1RUO A;  3QU6 A;  3JSO A;  4P9F A;  1IAW A;  4IHT A;  3VFZ A;  2R3S A;  1XMK A;  3IWF A;  2V9V A;  2FEZ A;  1U3E M;  3NQO A;  3KP3 A;  3GFJ A;  4LK0 F;  3KEO A;  5HLH A;  3HOT A;  1W5T A;  3F6V A;  4A12 A;  3BPX A;  3R0J A;  1HXD A;  3BY6 A;  1K7A A;  3F8M A;  1IZ1 A;  3TO9 A;  5BPI A;  4A0Z A;  2EV0 A;  2HEO A;  3LST A;  2K86 A;  2PFB A;  2IPQ X;  4TV7 A;  3CDH A;  2V1U A;  1OYW A;  2DI3 A;  2HZT A;  5JVT A;  4UHT A;  5L3G A;  1FBU A;  2OU2 A;  2ZO4 A;  1IN6 A;  1R22 A;  1YS6 A;  2H09 A;  2IJL A;  2O8X A;  2NRA C;  2JPB A;  3FMR A;  2P6T A;  1Z91 A;  5A2Q K;  3WU1 B;  1J7K A;  3I64 A;  2ESH A;  5ILS A;  3ECH A;  4YG2 F;  2XKO A;  1REP C;  1XGO A;  3ELK A;  2BGC A;  2A61 A;  2JPC A;  3E6D A;  2QWW A;  4RGS A;  3ABT A;  1S7O A;  3K0L A;  2EA2 A;  4MEY F;  3HYI A;  2HYF A;  3F21 A;  3FWE A;  2NS0 A;  2Z3Y A;  4HDV A;  4OU0 A;  2FRH A;  2GWR A;  4P9U A;  2VT2 A;  2K4B A;  4JBA A;  1O7L A;  1Z7U A;  2XKP A;  1FSE A;  4QLC U;  3N97 A;  1ZG1 A;  1T2K A;  1FSH A;  5AON A;  3MEX A;  1XSD A;  4MTE A;  2Z9O A;  4ZYD A;  2PN6 A;  3GZ5 A;  3IHU A;  3PQK A;  2DPD A;  4B09 A;  3M1E A;  3B73 A;  2ISY A;  4IRH A;  3IRR A;  3O2P E;  3KP2 A;  1UB9 A;  1G4D A;  1YYV A;  3JTH A;  1HKS A;  3SXY A;  2A6E F;  5DCM A;  2K7L A;  4LMY A;  4BHP A;  1R23 A;  2DLL A;  4RGR A;  2DU9 A;  1K6O A;  2QUF A;  1HW5 A;  4BHC A;  4A0X A;  1LVA A;  4KIF A;  1GXP A;  1WRJ A;  3KZY A;  2A68 F;  1P92 A;  4WF2 A;  1RUN A;  1Z9C A;  1B9M A;  2FQ3 A;  2XAJ A;  5ED4 A;  1STZ A;  1KQ9 A;  4HYE A;  1QZZ A;  3WTX C;  1SAX A;  1R00 A;  1F4K A;  1TQP A;  2P7V B;  3V8L A;  2R7D A;  3LAP A;  5LHH A;  3U9G A;  3I54 A;  2KJB A;  4IVN A;  2TDX A;  3T8R A;  1LQ1 A;  5F64 A;  4M9Z A;  1ZLK A;  2ETH A;  2FMY A;  3RI4 A;  5IT9 K;  1WSU A;  1LEB A;  1R5H A;  5ERI A;  5BQT A;  1IF1 A;  4DNC A;  3GF2 A;  1FY7 A;  3GYH X;  2XV4 S;  3W6J B;  4XBF A;  2HR3 A;  4HV5 A;  4HLY A;  4MQV A;  1A04 A;  3GFI A;  2DW4 A;  1K79 A;  4ZYE A;  1DDN A;  4GYG A;  3E5U A;  3RDI A;  3P9I A;  3EYI A;  3FXQ A;  1SD4 A;  2NYX A;  3QPT A;  2YU3 A;  5BMZ A;  4FT8 A;  2Q8K A;  2CG4 A;  1P4W A;  2ACJ A;  5DD8 A;  4YFN F;  5DCF A;  2PQ8 A;  2LDU A;  4OIR F;  2GZW A;  3CO6 C;  1S7A A;  3I59 A;  4AWX B;  4EVI A;  2ZFW A;  4KYW A;  2FXA A;  4FHT A;  1L0O C;  4GO1 A;  1H0M A;  4AVP A;  2VXZ A;  2XRO A;  1ZYR F;  1MJA A;  3FMS A;  4HAM A;  2OQG A;  4EGY A;  2PBI A;  3V4G A;  1KQ0 A;  2KIU A;  1QO0 D;  4L5J A;  1XD7 A;  4OIP F;  1T38 A;  2KRF A;  3HTS B;  4I01 A;  2VOO A;  1SD5 A;  2OZ6 A;  1MJ9 A;  3TDU C;  4Y13 A;  2H27 A;  1T98 A;  2HFH A;  3GX4 X;  3D0S A;  1XB4 A;  3R6S A;  1IRG A;  4EJV A;  2FA5 A;  3L00 A;  2G7U A;  3K69 A;  4PZJ A;  1LDJ A;  4A6E A;  4EGZ A;  5E1Z B;  3R60 A;  3BOQ A;  4Q4Z F;  2M1B A;  4ZYG A;  1RI7 A;  1LDK B;  5K5Q A;  1YW9 A;  2Y48 A;  4U88 A;  2MA3 A;  1FC3 A;  2GAU A;  1MGT A;  4PCQ A;  5HDK A;  4IPA A;  2X0L A;  3K1N A;  3ROU A;  2C6Y A;  3QOP A;  3SFZ A;  1XGM A;  2MBF A;  2YSR A;  2VON A;  4A6D A;  1G3T A;  4I0B A;  2HQN A;  1SFE A;  2QBY A;  1J0R A;  4M71 A;  1VTN C;  1B6A A;  2QQB A;  3I4P A;  2XVC A;  2R7F A;  2FBH A;  3HIF A;  4GGG A;  1BJA A;  4KIC A;  2DQR A;  2XAG A;  2XIG A;  3IL2 A;  3GW2 A;  5D5U B;  1WKM A;  6PAX A;  4ESB A;  2LKP A;  4ZZL A;  1TQM A;  4HX7 A;  2EFW A;  3I58 A;  4JK1 X;  4U7D A;  1BI1 A;  1BBY A;  3IKV A;  3TO7 A;  4LFU A;  2UWM A;  2RN7 A;  3WTZ A;  4WCG A;  1ODD A;  2BEO A;  1GHC A;  3LA3 A;  2CYY A;  1B9N A;  4KN7 X;  4F7Z A;  1XN7 A;  1R1U A;  3LFK A;  5FB2 A;  2ELH A;  3HOS A;  1S6L A;  1U5T C;  3F6O A;  2QBY B;  3C3W A;  3M9A A;  1HBX G;  1W7P D;  1RZ4 A;  1PP8 F;  4YFK F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...