2ESHA

Crystal structure of conserved protein of unknown function tm0937- a potential transcriptional factor
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
114
structure length
114
Chain Sequence
RGGRGFRGWWLASTILLLVAEKPSHGYELAERLAEFGIEIPGIGHMGNIYRVLADLEESGFLSTEWDTTVSPPRKIYRITPQGKLYLREILRSLEDMKRRIETLEERIKRVLQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Conserved Hypothetical Protein TM0937
rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein TM0937
total genus 35
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2005-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2eshA00
1FPQA 3GFMA 4RGUA 5LHGA 1XCVA 2XAGA 5JHUA 4LB5A 1S7AA 3E6CC 4KIFA 3FF5A 2XGXA 2MH2A 5DD4A 1IZ1A 1BI2A 4EM1A 1AWCA 5LBQA 5D4RA 1HQCA 3TO6A 4ENMA 2DQLA 2ZMEB 3R0JA 4MTEA 3AAFA 3B02A 5D5XB 3DPLC 2GIVA 3B73A 3L09A 2VT2A 4ZYEA 3NRVA 3BDDA 1W5SA 3EYIA 2UXXA 3BWGA 2KIUA 1K78B 4D0PA 1KU7A 2K4BA 2ZNZA 1TLHB 5JI6A 2FNPA 3FXUA 3BROA 2P8TA 2MH9A 2PN6A 2VBYA 4I7HA 1TQPA 2LSOA 5DCMA 3F8NA 4OIRF 1E2XA 5DD8A 4GXOA 1IXRC 1XMAA 1R36A 2RGVA 2W24A 5FLXZ 3KETA 1WRJA 4I98B 3RKXA 2A07F 3V7RA 4EJTA 1LDDA 2R7DA 2R7FA 2FMLA 2H6BA 2FE3A 1U6GA 2XROA 3BJ6A 3H92A 5DDGA 5LRSA 2Q8KA 2GZWA 4LLNA 2HEOA 1ZGAA 1IRGA 3F21A 3KEOA 3KE2A 4OMYA 4RB0A 3F72A 4A12A 4ESJA 1F5TA 1USTA 5DUKA 1MZBA 3CTAA 4BH9A 2ADUA 2KKOA 1T39A 1G3YA 4KN7X 1ZGJA 1SD7A 3I71A 3R6SA 4G7ZF 2M5WA 4IXAA 5FD5A 4ASNA 2MLGA 4HA8A 4R79A 2A68F 2ELHA 2DAOA 2CG4A 4WK8F 4Y15A 3RYRA 2JSCA 4Z2YA 4G6DA 4YIFA 3EUHA 2YSRA 3ZQ7A 1ZRCA 4AVPA 3GVAA 2HDCA 4I2OA 1J9IA 2O8XA 2DK5A 4HV5A 4S04A 3WE2A 2EK5A 3ECOA 4IHTA 4ZYDA 4YFKF 2DFIA 4TV7A 4AIKA 2AS5F 4HDUA 4DNCA 5K1YA 1MJ9A 4HX8A 3LA7A 3F8CA 5HS7A 4CXFA 1FYLA 2QVOA 2Z3YA 4LJZF 2Y75A 4R8HA 2UZKA 2JZYA 2F5CA 1X3UA 3GO5A 5L3BA 2EB7A 5BMZA 1XMKA 2ZFWA 1ZAOA 4EM2A 3E3VA 3BJOA 4YIIA 2A69F 3CO7C 4N9HA 2Y0MA 1SMYF 1KGSA 1JGSA 2QLZA 3SXYA 1MKMA 3DFGA 1IN5A 3PQKA 4EVIA 2XAJA 4I01A 4CICA 1BN5A 2Y48A 1BI1A 2RV8A 4P9FA 5JFRA 5K5OA 3RDIA 4UHTA 2MLKA 1W5TA 3ZMDA 3P9KA 2DI3A 1RIOH 4KDPA 4RGSA 2R3SA 4K2EA 3E5XA 3M9AA 3JTGA 2P5LC 3H3ZA 2NYXA 2M45A 2Z99A 1YS7A 1L3LA 2VOOA 2G9WA 3F8BA 2PBIA 3V4GA 1IF1A 1FSHA 1PUEE 3WTTC 2IVMA 1IW7F 4M9SA 2K4JA 1R5HA 5IT3A 4EGZA 4HLYA 1KYWA 1FWZA 3QU6A 3KP5A 3KP4A 4R1HA 1WI9A 3SQNA 1U5TA 3GFLA 1J75A 2ISYA 1FP1D 3I53A 2CO5A 3K9TA 1IN6A 4U7DA 1O57A 1Q1HA 3FXRA 3JAMK 2WTEA 1QZZA 1H0MA 4P96A 4EJOA 3COAC 2DPUA 1TBXA 2EA2A 1KU3A 2IP2A 4HQMA 1YFHA 2Q2EA 2PMUA 1LNWA 3VFZA 2V6CA 3O6BB 1XGOA 3L9FA 4BYYA 2FSWA 2A5YB 2A3SA 4B8XA 1FX7A 5LGUA 3DV8A 2DPDA 5JR3A 3ZPLA 3J81K 1D3YA 2YX7A 5D8LB 4GCVA 1RI7A 3HOSA 1W7PA 1HW2A 2WC2A 1FZPB 1FNNA 2CGPA 1MD0A 4DQ2A 2VONA 1FYKA 2PLYA 1TNSA 2HFHA 1O7FA 5LRRA 2MA3A 1YLFA 5FO5A 1KU2A 1P6RA 5LEJA 1KQ0A 2LKPA 2L4MA 1USSA 2WV0A 2FRHA 1XSDA 4A0YA 3CJNA 2W84A 4N0BA 1O3SA 2W85A 2E1NA 3QP6A 3CDHA 3GLXA 3JW4A 2KIFA 4LGWA 1J2XA 2M1BA 5ICFA 3V8LA 4CZZA 1LVAA 3Q9VA 2D1HA 3FMSA 2PMHA 4MNUA 3U1DA 3MCZA 2XAFA 4RAYA 2HOEA 2M8EA 2LDUA 5HOOA 1CF7A 4KFCA 5ILVA 1KQ9A 3GZ5A 2V79A 3WE3A 1U8RA 2QQ9A 5F6FA 5FLXK 3D5LA 1MDMA 2LF8A 1R5GA 3ECHA 1MJBA 2BV6A 1HKTA 1HSTA 3KEQA 3HHHA 2TDXA 2K7LA 1HKSA 4GYIA 1XCBA 5E1ZB 2P5VA 4FHTA 1ZN2A 4YG2F 3IWFA 4NHJA 1ODDA 2K02A 2NAZA 2ISZA 2FF4A 1GHCA 3KP6A 3MZHA 4EGYA 3DXJF 5CYVA 4KT5C 1KU9A 3PFIA 3IRQA 3LQQA 3OV8A 3FM5A 5KVRA 2VC0A 1ZYRF 1R1UA 1Z9CA 1LDKB 1RUOA 4M74A 3HRUA 3WTUC 4IHSA 5CVIA 4P9UA 1PP8F 2NNNA 2VE8A 1UCRA 4RS8A 3QU3A 5HDNA 5HLGA 3NEUA 4GGGA 3ULQB 3L2CA 5E17F 3EETA 4ZYGA 1U2WA 3U2RA 3EQLF 5L3CA 1ZG1A 5DYMA 1J0RA 1TQIA 2NS0A 1VTNC 2P6TA 1ON2A 2L01A 4XLNF 4S05A 3IL2A 2HKXA 1HSJA 4CYDA 5F64A 4U0VA 5ICEA 2A6HF 2DO7A 4PZJA 1G4DA 1G3WA 3EDPA 1CF7B 2AXLA 1I5ZA 5BOXA 2QQAA 1TQMA 3KP7A 1O3TA 1P2FA 1S7OA 5CVJA 2DW4A 1BIAA 4ZYHA 3E6MA 3ZN1A 3HSRA 1GVJA 2VN2A 2FBKA 4A6DA 3LWFA 3MAJA 2HS5A 4ETSA 3P9CA 5ILSA 4CO8A 2X4HA 3QOPA 3M8FA 4I09A 4G94A 2H94A 2YR2A 3ABTA 5KK1A 4ENKA 1ON1A 3JTHA 4UV9A 3JAMZ 3FMQA 4L5IA 2IT0A 4A5MA 3HSEA 1R22A 5K5QA 4HF2A 3V8JA 3I64A 2P6SA 3TO7A 1T0FA 2KRFA 4QLCU 3GZ6A 4HX4A 1Z91A 4NQWA 1BC7C 1SFUA 3IWZA 3R4KA 3HRSA 3WTZA 1W7PB 5LLQA 5HLIA 4U0YA 1YW9A 1AOYA 4UVBA 1P92A 1YG2A 2MD5A 4A0XA 4OMZA 2YU3A 3TDZC 2MBFA 2H27A 3BZ6A 1SD5A 1MJAA 2E7XA 3DP7A 2CW0F 4LG0A 1S6LA 3WU0A 4P55A 5E8GA 5TRDA 2STTA 1DUXC 1OMIA 1UHMA 4HAMA 1BJAA 1F1ZA 3E5QA 4KMFA 3QRFF 5FFZA 1K7AA 1EH6A 4RAZA 5FGMA 1OKRA 2CWEA 1O7LA 1JXSA 2EJRA 2XVCA 1RNLA 2DU9A 2ZNYA 2C6YA 3M1EA 3WTWC 4UNOA 5H6RA 5ERIA 1F9NA 1Z6RA 1XGMA 1FYMA 3F3XA 4KYWA 2O0YA 1OYIA 4IF4A 2OBPA 2V9VA 4O6JA 2KIMA 1Z7UA 4EJWA 4HOBA 5BPDA 3TOAA 1QBJA 5D6FA 1ULYA 2H09A 1D5VA 3BY6A 4ESBA 3HRTA 1JHHA 5E1XA 5CLSA 3WGGA 1IRFA 2D1VA 2O03A 4G9YA 3F23A 4PCQA 3FM3A 4F7ZA 3KCCA 2HZTA 3FHZA 3T5XA 1PP7U 3GWZA 1IUYA 1XGNA 1KQ8A 4Q48A 3VEPA 5JVTA 2IW5A 4RB3C 2UWMA 1EH8A 1RUNA 4BHBA 4WCGA 4M71A 5IT9K 4HZFA 2IA2A 1FSEA 2IA0A 1BIBA 2K86A 5E20A 4LMYA 1QNTA 2EV6A 1BM9A 2ZBKA 3RIRA 3TGNA 2BBYA 2VT3A 4UUVA 1W4MA 5BPIA 1GXPA 1B1BA 3LA2A 4ESFA 4O5VA 5K5RA 5DUIA 1I1GA 4M9ZA 4JBAA 3U9GA 1DP7P 5CVVA 3O2PE 1H9TA 5HS9A 1B9NA 3QPHA 3BP8A 4RGRA 4BXUA 2V1UA 3J81Z 2EA4A 4IPAA 3HHGA 3RKWA 1UB9A 1R1VA 3HTSB 5H20A 3R61A 1R58A 3R0AA 1FLIA 6PAXA 2GXBA 1U78A 2D2WA 2OZUA 3GEZA 4MQVA 2RVCA 5EEGA 5HDKA 3CUOA 2ACJA 1XB4A 2D45A 4A0ZA 1XSVA 4BHCA 1WKMA 4OU0A 2E1CA 3T1BA 4HV6A 1OYYA 1HW5A 5ICGA 3ERED 4AWXB 3DF8A 2P7CB 3GFJA 1YS6A 1HXDA 3KZYA 1TW2A 2XAHA 1ZG5A 1P4AA 1JHFA 4CHUA 4LK1F 4MHGA 3ML6A 5AONA 5DCMB 1QQIA 1YQAA 1IN8A 2DK8A 1YW7A 2PG4A 1S29A 1ZRDA 1IXSB 1NHAA 3EYYA 3I59B 2HWVA 1QZYA 5A2QZ 4M9XA 3KLOA 4UV8A 3HUGA 4HBLA 1B6AA 3RKYA 2GAUA 2BYVE 2ZO4A 4L0YB 3SZTA 2HQNA 3CLOA 4EV0A 1QPMA 1EH7A 4PDKA 2ESHA 5ED4A 2IPQX 3RPQA 4GO1A 4O3MA 4XSXF 5HLHA 1QO0D 1IN7A 3LQRA 2E7WA 2PJPA 3GYHX 3MEXA 3VODA 4ZZLA 5BQTA 1LDJA 1TNTA 4EQQA 4BNCA 4LLGF 2O61A 3OOPA 2HKOA 2QUFA 2QM3A 4G6QA 5DCFA 1DPRA 2UXNA 2EFWA 3S2WA 1I6XA 3MWMA 1FBQA 4WX9A 4EJVA 2J5OA 2EWNA 3L7WA 3LFKA 1H9GA 4N9IA 1DPUA 4ZZDA 5LGTA 2M30A 3ISPA 1Z1DA 2QYOA 3I54A 4LK0F 4B09A 2H6CA 3F22A 4ENNA 2P7VB 3E5UA 4Y17A 3Q9SA 3HTUA 1IN4A 1S3JA 4WWCA 3VOEA 3FWEA 5LEKA 5J8CA 2BGCA 3K0LA 5FD6A 3T8RA 1UHWA 1KYZA 3TOBA 5D5VB 4Q47A 5ILUA 2HTJA 2W25A 3HRMA 1W7PD 4KICA 4HDVA 4E70A 3K2ZA 1BI0A 5D8KB 4L9VA 2JPCA 3I58A 3BOQA 3SHFA 4ON0A 4ENJA 3REOA 1YO5C 5E8IA 3C7JA 1ZARA 4MEXF 3FXQA 1MDMB 3C18A 3H3UA 4NB5A 2F5DA 4WXHA 2A6EF 4P5OA 2VBXA 4KMUX 1SMTA 3T0YA 3D0SA 1ZLJA 4Q5SF 3N4MA 3KP2A 2GXGA 3K69A 2XKOA 4OIQF 3PQJA 1S8NA 1SD6A 3ZMVA 1FBUA 4KN4X 4AD9A 2L54A 2XKPA 5D5UB 2DTRA 2A61A 4CDGA 1TW3A 5J8FA 2FBIA 2Z33A 2WWYA 4LD5A 3WTSC 3IKVA 2O3FA 2EFQA 3LAPA 3J80K 1TTYA 2F2EA 3C1DA 4FX0A 3I59A 3K1MA 3F8MA 2CYYA 3DKWA 2OD5A 1BC8C 2QBYB 5E18F 2QZ8A 2DLLA 2VODA 4OIOF 2EFPA 4A2UA 1WSUA 5L3DA 3MQ0A 1CGPA 1YIOA 4WXCA 2BEOA 2OQRA 3FX3A 2L4AA 3WTVC 2L3DA 3IHUA 1B59A 4JQFA 5IT9Z 2VC1A 3I0TA 4H0EA 3ZMZA 3QP5A 3M8EA 2EFOA 2RC4A 1HKQA 2GWRA 4UVCA 3W6JB 2FQ3A 4OINF 3GW2A 2Q0OA 3FMRA 2KJBA 1G3SA 2P4WA 3HSFA 2FA5A 1J5YA 1BOAA 1DDNA 4M6YA 4Y13A 1U5TB 2EV5A 1PDNC 4G7HF 4RB2C 4L0ZB 1P4XA 2HYGD 3RPUA 3TKYA 3ZMUA 5L3GA 2L02A 1O3QA 4AIHA 5H6QA 4YFXF 1FT9A 4KIBA 2HGCA 1UFMA 1BBYA 2G7UA 5E1WA 2FXAA 3I5UA 1LQ1A 2V1DA 3LSTA 3WTXC 1XDSA 2VXZA 3VB2A 2QQBA 3R60A 2RDPA 4HW0A 2FMYA 2QBYA 4Q4ZF 2PEXA 3ZMTA 4MTDA 1IXCA 4KIGA 2XIGA 2FBHA 3SFZA 2EFNA 4MEYF 3KZZA 2EV0A 5D6EA 1SAXA 2GQQA 1ZG3A 1RZ4A 2RNJA 5DEQA 4EM0B 4PGGA 1I27A 3TDUC 3WGHA 3TO9A 1REPC 2YX4A 4OIPF 3F8FA 2CFXA 2GA1A 2P5KA 1C0WA 3V7SA 5A2QK 4G8XA 4HF0A 3DEUA 4IVNA 3Q5FA 1KA8A 3JSOA 3K1PA 4L9TA 2XUBA 4JK1X 2QENA 2G7HA 2NRAC 1R23A 5CVRA 5J6XA 2FOKA 1ZHFA 3JSPA 1WQ2A 1T2KA 3ABUA 2LF7A 3CUQC 4MGRA 3M7GA 4U0WA 2ETHA 4M6XA 1P4WA 2STWA 2ZMEA 4L9NA 3CO6C 2ZKZA 2OZ6A 3GUDA 1LB2A 4LLLA 3V7CA 4U7BA 2FEZA 1O3RA 1R1TA 2RN7A 5D5WB 3FZVA 3MFKA 2IJLA 5DV5A 3WU1B 1STZA 5HVQC 2RQPA 2QWWA 2B0LA 2FNAA 1K6OA 3NQOA 5ICCA 1LEBA 2JTVA 4EMSA 3LA3A 3WGIA 3ZN0A 1XN7A 3LAJA 1SD4A 2HTSA 3DQVC 2DBBA 3IRRA 3BJAA 3K1NA 4LFUA 4IJAA 4HYEA 1JE8A 2FU4A 4M73A 4LB6B 5FFXA 4BAYA 2NNYA 4I02A 4WXDA 1A04A 5EEHA 3N97A 4U88A 1WWXA 3F6OA 3ZMSA 3GF2A 1D8KA 1GXQA 5L3EA 3W6KB 2KJCA 1G6NA 1BI3A 4FT8A 2BE5F 2OU2A 1ZLKA 2Z9OA 4I0BA 3SZPA 2JRTA 4BHPA 1QGPA 2HR3A 1XD7A 5LHHA 5CVUA 2M87A 2XAQA 4A6EA 4IRHA 1U3EM 3DPTA 3WG9A 1T6SA 5AIQA 1YYVA 3KP3A 3HOTA 5LHIA 2GA2A 2OA4A 1R7JA 1V4RA 5F1RA 1F4KA 4HX7A 3RJPA 3RTRA 1FP2A 2JPBA 3E6BA 4I0AA 4HQEA 2JT1A 4M72A 1FOKA 3J80Z 4LG0B 2VOPA 2MC3A 2OAZA 3QAHA 3G3ZA 3IC7A 2F5EA 2VBWA 4L5JA 3TQNA 1LJ9A 2K27A 5FB2A 4KA4A 3L00A 5L3FA 2W57A 3BPVA 5CJ9A 1B9MA 4KUMA 3GXOA 1YW8A 4IRGA 2VE9A 2IA1A 2DT5A 2Z5UA 2LNBA 3ELKA 4EJUA 4XSZF 3WTYC 2ZXJA 3CUQA 2PFBA 4PGHA 4YFNF 3C3WA 2HYFA 1XDUA 2IRFG 4G7OF 5TJJA 1FBSA 5AIPA 1Y0UA 2ZCWA 1R00A 5HS8A 3GFIA 1L0OC 1FC3A 4QWQA 1OYWA 3BPXA 2CSOA 1EV7A 1J59A 5LGNA 2ESNA 3HIFA 1T38A 4OOIA 2RKHA 2DQRA 3G73A 3ROUA 1K78A 4GYGA 2PI0A 4FX4A 3RI4A 1E17A 3KLNA 2XHKA 1I1SA 2PQ8A 1V3FA 4ZH4F 1FY7A 1HW1A 5D4SA 2XRNA 1OPCA 4A5NA 3KFWX 4UVAA 1Z05A 2ZJ2A 1T98A 1MGTA 1G3TA 2COMA 4IRIA 4MQ9F 1HBXG 2CQKA 1U5TC 3E97A 1B4AA 2YPRA 3WODF 1D8JA 5HDGA 3F6VA 3T8TA 3V8KA 1XGSA 3GX4X 3RYPA 4UXNA 1ZREA 2HQRA 3HYIA 1IAWA 4HLXA 2V1XA 1SFEA 1LEAA 3ZP5A 3MZYA 4WF2A 4BQAA 1ZH5A 4HF1A 2XASA 3CUQB 4XRFA 4AIJA 1ZRFA 2O6GE 3P7NA 1SFXA 4CGZA 3IKTA 1Z6TA 1J7KA 2J5PA 1OR7A 2OQGA 3O3KA 2VBZA 1ONVA 4RB1A 4XLPF 1XSXA 4L18B 3E6DA 1YTYA 3I4PA 4KNYA 4L9JA 5BS6A 3P9IA 2XV4S 2X0LA 2F5FA 4XBFA 3J7AO 1K79A 3QPTA 4RGXA
chains in the Genus database with same CATH superfamily
1FPQA 1QHHD 3GFMA 4RGUA 5LHGA 1XCVA 1OFCX 1IDZA 2XGDA 1P9QC 1D1BA 2XAGA 2BY2A 2HVRA 5JHUA 4LB5A 1S7AA 3S15J 3E6CC 4KIFA 3FF5A 2XGXA 3LNQA 3JR9A 2MH2A 5DD4A 2V9PA 2FUG2 1QU3A 2M7AA 2AQFA 2DODA 1IZ1A 1BI2A 4EM1A 1AWCA 2CUEA 5F27A 4AU7A 3L2UA 3GCMA 5GADJ 5LBQA 5D4RA 1HQCA 1ETVA 5FKOA 3TO6A 4ENMA 2DQLA 4J19A 2ZMEB 3R0JA 2M7BA 4MTEA 3UNGC 3OYFA 3DLLF 3AAFA 1UJ8A 3B02A 5D5XB 4XN3A 1GV5A 4RMNA 3DPLC 2F5VA 1T56A 2ZJQF 2GIVA 3B73A 5C4JJ 5EGOB 3L09A 4FETA 2VT2A 4ZYEA 3NRVA 3BDDA 4W97A 2E71A 1W5SA 3EYIA 2UXXA 3OSFA 2CV0A 2E2IJ 3BWGA 3VPRA 2KIUA 1K78B 4D0PA 1KU7A 3MN2A 3OL3A 2K4BA 2O5RA 2ZNZA 1TLHB 2ZB9A 3I9V2 5JI6A 2FNPA 3FXUA 1HCRA 3BROA 2L7KA 2MG4A 2P8TA 2MH9A 3CF5F 2K3PA 3D5RC 2X51A 2PN6A 2VBYA 1TQPA 4I7HA 1Y56A 2LSOA 5DCMA 4IHYA 3F8NA 4OIRF 1E2XA 2MD0A 2O8KA 4F55A 3K10A 5DD8A 4GXOA 1IXRC 1XMAA 2EZIA 1R36A 2HDDA 2XGCA 2RGVA 2W24A 5FLMJ 2LKXA 2DMUA 2KLOA 5FLXZ 3KETA 3CCVI 1LKXA 1WRJA 3LSKA 4I98B 3RKXA 2A07F 1VNDA 3V7RA 3HC7A 4EJTA 1LDDA 2WAEA 2R7DA 2W4SA 2R7FA 3PNVA 2FMLA 1QVTA 3GTMJ 2H6BA 2FE3A 1U6GA 3CZ6A 1Y1WJ 2K3FA 3S1MJ 3MD2A 2XROA 3BJ6A 5B1BH 3F0CA 3H92A 5DDGA 2XAUA 4UUSA 1JUSA 5LRSA 2Q8KA 2GZWA 4Y3OA 4LLNA 2HEOA 1ZGAA 2XGEA 2M8GX 1IRGA 3F21A 3KEOA 3KE2A 3TW7A 1ZQ3P 2R7WA 5GPAA 4OMYA 5EYRA 1I3AA 4RB0A 3N05A 3F72A 4A12A 4ESJA 1F5TA 2MC4A 1USTA 5DUKA 1MZBA 3ZQFA 3CTAA 4D5FA 3RZDJ 4BH9A 3DBHB 3HJEA 3MKWB 2ADUA 5B3SH 4LITA 1MMDA 4ZC3A 2VKEA 2KKOA 2GBYA 1T39A 1G3YA 4KN7X 1ZGJA 2HQAA 1SD7A 3I71A 1TT0A 1NH3A 3R6SA 4G7ZF 2M5WA 4IXAA 4CUGA 5B1AH 3OMYA 3IP4B 5FD5A 3ZOBA 4ASNA 1IRZA 2MLGA 4HA8A 4R79A 2A68F 2ELHA 2DAOA 3K4NA 4NQWB 2CG4A 4E7JA 4WK8F 4Y15A 1H8AC 1R9TJ 4E7LA 2CW7A 3RYRA 4CYCA 2DT7B 3DKYA 1NK2P 1VQNI 3OWTA 2JSCA 4Z2YA 4G6DA 4YIFA 3EUHA 1YJWI 2YSRA 3ZQ7A 5IPAA 2R92J 1ZRCA 4AVPA 3GVAA 1XS9A 3OYKA 2HDCA 4I2OA 1J9IA 3Q0WA 2L5QA 2O8XA 3PL8A 3CF2A 5JVGF 2DK5A 4HV5A 4S04A 1S5LC 4I99C 3WE2A 2EK5A 1Y1VJ 3ECOA 2VJ5A 1Z21A 1UHSA 4IHTA 2I8DA 4ZYDA 4YFKF 2DFIA 4TV7A 4J01A 4AIKA 2AS5F 1SFKA 2VL8A 5M5WJ 1FOYA 1JKOC 3OYDA 4HDUA 4DNCA 3KX2A 2K9NA 3GTOJ 5K1YA 3JRGA 1MJ9A 4BBRJ 4HX8A 3LA7A 3W3CA 3F8CA 5HS7A 4CXFA 1FYLA 1EJ9A 2QVOA 2Z3YA 4LJZF 3EPZA 2Y75A 3GTKJ 4R8HA 2UZKA 3CMAI 1RESA 2JZYA 5HLTA 2F5CA 3CJQB 1X3UA 4II2A 4RDUA 3GO5A 5L3BA 2EB7A 1E3PA 2QCOA 5BMZA 1MMGA 2A05A 3C2GA 4M6VA 1XMKA 3RZOJ 2CQNA 2ZFWA 1ZAOA 3JRAA 3OYNA 3ZR8X 3HOXJ 2DMTA 4EM2A 3H9JA 3E3VA 3BJOA 4YIIA 3CLQA 2A69F 4XLFA 3CO7C 2DT6A 4IOAF 2X48A 3M3YJ 2L7FP 2AXTC 4N9HA 2Y0MA 1SMYF 1KGSA 1MMAA 5EGOA 4BBSJ 1JGSA 3A0HC 3KIOA 2QLZA 3SXYA 4YRVA 3DCFA 2VIXA 1MKMA 2JK3A 2X85A 3BQZA 2WV1A 3DFGA 3A1YA 2KHMA 1IN5A 3PQKA 3M8JA 4EVIA 2R7TA 2XAJA 1IV8A 4I01A 4CICA 1ERDA 3X2QH 1BN5A 2Y48A 1BI1A 2RV8A 4P9FA 5JFRA 5K5OA 2ELJA 1WJBA 4DJAA 4E7KA 3DWLE 5CQGA 4IO9F 3L2VA 3RDIA 3CCQI 1Z7LA 4UHTA 4DYQA 2DMPA 2MLKA 4XQFA 1W5TA 4HPQA 3ZMDA 3P9KA 2DI3A 1RIOH 4KDPA 2XSJC 4LIUA 2W7NA 4RGSA 2R3SA 4K2EA 3E5XA 3M9AA 3JTGA 2P5LC 3FBIB 3H3ZA 1VQMI 2NYXA 3ESWB 2M45A 2Z99A 1YS7A 1L3LA 2VOOA 3S2HJ 2G9WA 2I10A 4FE4A 2XF6A 3F8BA 2PBIA 4F3QA 5H2FC 3V4GA 3K70D 4XMYA 2M4KA 1IF1A 4V19K 1PUEE 3H5RA 1FSHA 5GP9A 2IVMA 1TWAJ 3WTTC 1A6IA 3ABKH 1IW7F 2FD5A 3M4OJ 5GAGJ 4M9SA 2K4JA 1R5HA 1Z77A 1X4PA 3HPGA 5IT3A 3ZXSA 4EGZA 4HLYA 3HUGB 3BR5A 1KYWA 4E7SA 4XKBA 1FWZA 3QU6A 3KP5A 3SZGA 3KP4A 4R1HA 1WI9A 3SQNA 2EZLA 1U5TA 2OC6A 5K7HA 2IS1A 4FCYA 3GFLA 2UV1A 1J75A 2ISYA 3K4MA 1GDTA 1FP1D 2DYRH 3I53A 1U9OA 2CO5A 3K9TA 1IN6A 2F4OB 3ZQGA 4U7DA 5K7FA 2DDAA 3OL4A 1FTZA 1FTTA 2M0CA 4M3FA 1FMWA 3K2AA 2YU9J 3H1CA 2Y69H 1O57A 3CCMI 2K40A 1Q1HA 3FXRA 3JAMK 4A3KJ 4RA2A 2WTEA 1QZZA 2KMUA 1H0MA 1LPQA 4P96A 4EJOA 3COAC 2DPUA 1TBXA 2EA2A 4F92B 3VWBA 1KU3A 2IP2A 3E1SA 4HQMA 1YFHA 2Q2EA 3U1KA 2PMUA 5LFAA 2WB1N 1LNWA 3VFZA 2V6CA 3O6BB 2CU7A 1XGOA 2ID3A 4DBRA 3L9FA 2KQRA 4BYYA 2FSWA 2A5YB 1D0ZA 1YE9A 4BS9A 3DTIA 2W00A 2A3SA 1VFCA 4B8XA 1MBHA 5F0FA 1FX7A 1MW7A 5LGUA 1BA5A 3DV8A 2DPDA 5JR3A 1FMVA 3UKGA 3ZPLA 3A02A 3J81K 1D3YA 2YX7A 4FISA 5D8LB 2AHQA 2BHZA 4GCVA 2XPUA 1RI7A 3HOSA 1N75A 1W7PA 2ZSIB 4QPOA 1HW2A 2WC2A 1MBEA 4AM3A 2WY7Q 1FZPB 1FNNA 2EBIA 1ETOA 1PYVA 3PO3J 2CGPA 3DU5A 3G71I 1MD0A 2MFZA 4OAYA 4DQ2A 2VONA 3FISA 1FYKA 1RETA 4M3EA 1TNSA 2HFHA 2PLYA 1O7FA 3OOUA 5LRRA 2MA3A 1YLFA 3HOYJ 2CUFA 1VQPI 5FO5A 5CPRB 1KU2A 1P6RA 1IJWC 1RKTA 3BG3A 5LEJA 1GVDA 2KRHA 1R49A 3C2HA 3M1CA 3PNTA 1KQ0A 2LKPA 3NWSA 2A6TA 2L4MA 1USSA 4QPQA 2WV0A 2FRHA 5FKNA 1XSDA 4A0YA 3CJNA 2W84A 1KONA 4N0BA 3OYEA 5EG0B 1O3SA 3AG4H 4C30A 2W85A 2EH3A 2E1NA 2KISA 4X0GA 3QP6A 3CDHA 4KISA 3GLXA 3JW4A 3H3VK 2KIFA 4LGWA 4BEHB 1J2XA 2M1BA 5ICFA 3V8LA 4CZZA 4HNVA 4GRIA 1LVAA 5DS9A 2IGOA 3Q9VA 2D1HA 3FMSA 2PMHA 4MNUA 3U1DA 3S3MA 3MCZA 2HOSA 2XAFA 4RAYA 2HOEA 2M8EA 2LDUA 5HOOA 2KFDA 1JT6A 3I55I 1CF7A 3OYJA 4KFCA 3DBRB 2HVQA 3FIWA 5ILVA 1KQ9A 2VQLA 3DKXA 3GZ5A 4G12A 2V79A 3WE3A 1U8RA 3CP8A 2QEXI 2JQ7A 4HG2A 2QQ9A 3KPHA 5F6FA 2LBFB 5FLXK 2VKHA 3D5LA 2NVQJ 2ECBA 1MDMA 2LF8A 4H4KC 1JI8A 3BTIA 3H5NA 1R5GA 3ECHA 1MJBA 2BV6A 1HKTA 1HSTA 2EIJH 3Q0UA 3KEQA 4E7HA 2CUZA 3HHHA 2TDXA 2EPFA 1WJDA 3G1OA 4II3A 2K7LA 3SFIA 1HKSA 4GYIA 2JMWA 1XCBA 5LD2C 2Y30A 5E1ZB 2P5VA 2Q2EB 2WAFA 3MVPA 4FHTA 2DA4A 2JVGA 5M5XJ 1ZN2A 2H8WA 4YG2F 3IWFA 4NHJA 1ODDA 1XPXA 1W0UA 1SFOJ 2K02A 2NAZA 2ISZA 2FF4A 2LOOA 3IH4A 3KP6A 1GHCA 5TISC 1ITYA 3MZHA 4EGYA 1MNDA 3DXJF 5CYVA 3JREA 4E7ZA 1ETKA 2AQEA 2OF7A 1KU9A 2VB6A 2KPMA 3PFIA 4KT5C 3IRQA 2PX9A 3LQQA 3S1NJ 3OV8A 3FM5A 2NS8A 4U87A 4A3FJ 5KVRA 2VC0A 1JKRC 1ZYRF 1R1UA 2QSHX 1Z9CA 1YX3A 1XG1A 1LDKB 1RUOA 4M74A 3HRUA 2LK2A 1X1PA 2F48A 4XORA 1S72I 2BVMA 3K4KA 3J7YJ 3WTUC 5TGTA 4IHSA 3J7ZI 1I6HJ 5CVIA 4P9UA 1BR1A 2NNNA 1PP8F 2VE8A 1UCRA 4RS8A 3QU3A 5HDNA 2IGKA 5HLGA 2X1DA 3NEUA 4GGGA 5IYCJ 1EA3A 3ULQB 4CCOA 1FOXA 1WHUA 3L2CA 4F52A 5E17F 3AG3H 2QF7A 3LSRA 3EETA 4ZYGA 2WB1A 2ZMEC 3RCOA 3E7LA 5EDNA 4IEJA 1T95A 1U2WA 2XPVA 3TP3A 4HNTA 4D9JA 3U2RA 5KNLA 1OCTC 3EQLF 1GT0C 4A3LJ 3CCLI 1TWCJ 2QSGX 3TP0A 5L3CA 1ZG1A 3OIOA 5DYMA 1J0RA 1TQIA 1VZ0A 3VYRB 1TZLA 3HL2A 3S8PA 1ZKGA 2NS0A 1VTNC 3RQ4A 2P6TA 1ON2A 3RPUD 2L01A 4XLNF 1F36A 4S05A 5F04A 3IL2A 1OQYA 2HZDA 3OS2A 2NVUB 2HKXA 2QKLB 2GIZA 1HSJA 4CYDA 5F64A 3JRHA 1SANA 4U0VA 5IY5H 2VJJA 4PFPA 5ICEA 5IOZA 1BR4A 2A6HF 3GZNB 3CESA 2IS6A 2DO7A 2KDZA 4PZJA 1G4DA 1GLNA 1G3WA 3EDPA 1X2MA 2DOFA 5C3EJ 1CF7B 3S17J 2AXLA 1I5ZA 2E5ZA 5BOXA 5IYDJ 2QQAA 4NC8A 1TQMA 3KP7A 3LSPA 2E36A 1V5EA 1O3TA 1P2FA 2ZJRF 2VKVA 2LY9A 1S7OA 1I3QJ 5CVJA 2DW4A 1BIAA 2IS2A 2DXIA 4ZYHA 3BC8A 3E6MA 4LOCA 3ZN1A 2DYSH 2ID6A 4CCMA 1OJLA 2EZHA 3HSRA 3I4NJ 2BY1A 1GVJA 3ZCOA 3A0BC 2VN2A 2FBKA 4ZDOA 4A6DA 3LWFA 3CMYA 2B7EA 4CYCB 5IP6A 3MAJA 5EG0A 2DA7A 2HS5A 4ETSA 1QRYA 3P9CA 3O8HA 5ILSA 4CO8A 1A31A 2X4HA 3QOPA 3M8FA 3VYTB 4I09A 5EZHA 5M5YJ 4G94A 5M3FJ 2H94A 2YR2A 1XTAA 3ABTA 5KK1A 5FKMA 4ENKA 2H1KA 1LFBA 1ON1A 2X6XA 3JTHA 3HM5A 4UV9A 1D1CA 3JAMZ 3PNYA 3S1QJ 3FMQA 2L9RA 3HEFA 4L5IA 2R7SA 4KITB 2M4GA 1BW5A 3AKZA 2IT0A 3V42A 2X9DA 3E0JB 4A5MA 3OYAA 3HSEA 3BG6A 1MBFA 5KAIC 4NC7A 3CCYA 1R22A 5JLWA 2VLAA 4XKWA 5K5QA 4HF2A 2DOEA 2Y2ZA 3BR3A 3V8JA 1RKWA 3I64A 3CC7I 2P6SA 3TO7A 1WFXA 1V55H 1T0FA 2DA1A 2KRFA 4XKVA 4RAGA 4QLCU 4HX4A 3GZ6A 1OCCH 1NG7A 1Z91A 2NXNB 3C2BA 4NQWA 1IV6A 4N4NB 1V54H 1BC7C 1SFUA 3IWZA 1R71A 1ZTRA 3R4KA 1FIPA 2R7VA 3HRSA 3HBLA 3WTZA 1W7PB 5LLQA 5HLIA 4U0YA 1YW9A 5GAEJ 3QYBA 4FTHA 1AOYA 4UVBA 1P92A 1YG2A 2O7OA 1VQ4I 2MD5A 3BZCA 4A0XA 1OCZH 4OMZA 2YU3A 3BQYA 1NG6A 3TDZC 2HOTA 1OLTA 4BEHA 2MBFA 2NVYJ 3I56I 2H27A 1X3ZB 1MH4A 3BR0A 4MO7A 3BZ6A 4XNFA 1TT5B 3L2WA 1SD5A 1MJAA 2L9VA 2E7XA 3DP7A 4UUSB 2CW0F 4LG0A 2P81A 1O4XA 2ZJPF 3RQIA 3LFUA 3HKZA 4UB8C 3LOCA 1P7IA 1S6LA 1K6YA 3WU0A 2LYCA 4XIDA 4P55A 5E8GA 5TRDA 2QGUA 4IL6C 2STTA 2KIQA 1DUXC 3S14J 3OYMA 4C9YA 1IDYA 4I6ZA 1JKQC 1OMIA 1UHMA 4HAMA 3CCSI 1BJAA 5IP9J 1XMXA 1F1ZA 4A3DJ 3OS0A 3E5QA 1NTCA 2R7XA 4KMFA 3QRFF 5FFZA 4C2MJ 2MYSA 2BVLA 4J00A 1MIJA 2DCEA 1K7AA 1EH6A 4RAZA 5FGMA 4ZDPA 1OKRA 2CWEA 2KDOA 3DBLB 1O7LA 1JXSA 2EJRA 2XVCA 1V5FA 1RNLA 4DIQA 5KHDA 2DU9A 3AL0C 2EINH 2ZNYA 2C6YA 2JA7J 4F93B 2ECCA 3M1EA 3FXOA 1EKEA 5E3NA 1MNMC 3WTWC 4UNOA 5H6RA 4OWRB 5ERIA 1F9NA 4PSXA 3BG9A 4AVZA 3ASNH 1Z6RA 4A3IJ 4JX5A 1XGMA 1FYMA 3F3XA 2HVSA 1LFPA 5M3MJ 4KYWA 2O0YA 1OYIA 4IF4A 3HOWJ 4MFDA 1OCRH 2HXIA 4B43A 1MBGA 2OBPA 2V9VA 2Y0SA 4O6JA 2EIKH 4BQOA 4NC6A 2KIMA 1Z7UA 5FROA 5GTHC 2FX0A 4BQNA 2PJRA 4EJWA 3VYUB 3A01A 4HOBA 5BPDA 3TOAA 2KL4A 2TCTA 1QBJA 1T33A 5D6FA 4CCNA 1ULYA 2JA5J 5CQEA 2H09A 1S9HA 3MKZA 2WAQN 2DFFA 1D5VA 1WGXA 3BY6A 2DA2A 4P1WA 3HRTA 1JHHA 5E1XA 5CLSA 2JSPA 4BY7J 3TW6A 3WGGA 1IRFA 3SJMA 1Y8QB 4BE0A 2CV2A 2KZVA 2K9LA 1AU7A 2D1VA 2O03A 4G9YA 3F23A 3CDLA 4BDYA 4PCQA 3FM3A 5E3MA 1ORKA 4F7ZA 3HKZN 3KCCA 2HZTA 2PMZN 2W1OA 3FHZA 1R6RA 3T5XA 4XLHA 1PP7U 4EEFG 3GWZA 3TMOA 3D5SC 3IAS2 1IUYA 1XGNA 1Z3YA 5J1YA 1KQ8A 4I76A 4Q48A 2L9NA 3VEPA 5JVTA 2Y31A 2IW5A 4RB3C 2UWMA 2HPMA 1WZ2A 1EH8A 5DTDA 1PVEA 1RUNA 4XLCA 4FE7A 4BHBA 4WCGA 5FJ8J 2LBFA 5F1JA 4M71A 5IT9K 2LREA 2ZC2A 4HZFA 1VQOI 2IA2A 3MMYB 1FSEA 2IA0A 2VQHA 3MZ8A 1BIBA 4FASD 2OJED 1MMNA 3JRBA 1A35A 2K86A 3EUAA 5E20A 4LMYA 1QNTA 3CD6I 2EV6A 1BM9A 2ZBKA 3ZQQA 3RIRA 3TGNA 3HGYA 1Y8RB 2DOAA 2BBYA 1NK3P 2VT3A 2LP0A 4UUVA 1W4MA 3AFHA 2CRGA 1M1EB 2BXYA 4G6TB 5BPIA 1GXPA 1B1BA 3LA2A 4ESFA 4O5VA 5K5RA 5DUIA 1I1GA 2EIMH 4M9ZA 3ONQA 4C3JJ 4DW6A 1HOMA 2NVXJ 1HF0A 1JUMA 1OR7C 4JBAA 2D5VA 2GM4A 4AYBN 2WY8Q 3U9GA 3H0DA 1DP7P 1QHGA 4L5EA 5CVVA 3O2PE 4DBQA 2JUGA 3WHBA 4E6KG 1H9TA 2XDVA 1OISA 5HS9A 1B9NA 3QPHA 2WADA 3BP8A 4RGRA 4ESBA 4BXUA 4XN0A 2V1UA 2RAEA 2Y9YA 3FK7A 3K4BA 2EA4A 3J81Z 3PJRA 4IPAA 2JA6J 3HHGA 3RKWA 1UB9A 1R1VA 4DGWB 3HTSB 1D1AA 5H20A 4ABZA 5HODA 2E2HJ 1D0XA 3R61A 1JUPA 1R58A 3R0AA 1FLIA 6PAXA 2OPTA 2GXBA 2IAIA 1U78A 3IH2A 2D2WA 2OZUA 3GEZA 4JYKA 4B4CA 4MQVA 2RVCA 5EEGA 5HDKA 3CUOA 2ACJA 3IV5A 1XB4A 3A03A 4MLOA 2D45A 4A0ZA 1XSVA 2XB5A 4BHCA 1WKMA 4OU0A 2E1CA 3BT9A 3T1BA 3JRIA 2LMDA 4HV6A 4BJ6C 4GDFA 4E7IA 1OYYA 1HW5A 1PUFB 4C2TA 1Y6IA 5ICGA 4AWXB 3ERED 3DF8A 4BU2A 2P7CB 2W82A 3GFJA 1YS6A 1HXDA 3KZYA 4BJTA 2DMNA 3G4SI 1TW2A 5E3LA 2XAHA 1ZG5A 2V1NA 1P4AA 1JHFA 4CHUA 4LK1F 4XOPA 4MHGA 3ML6A 3W2VA 3HOUJ 2H1LA 5AONA 5DCMB 3VSKA 1QQIA 1YQAA 1VQ6I 4HNUA 4N4OB 1IN8A 2B63J 2DK8A 4HRIA 1VQ8I 1YW7A 2PG4A 1S29A 5K7ZA 4PSWA 2E1MB 4IHVA 1ZRDA 1IXSB 1NHAA 3EYYA 1X3WB 2L0KA 3I59B 2HWVA 1QZYA 5A2QZ 4M9XA 3KLOA 4MIMA 1SVLA 2VI6A 3H0GJ 4UV8A 2OCCH 3KEYA 4B3XA 3HUGA 2WA0A 4HBLA 1B6AA 1N77A 4NUBA 3RKYA 2GAUA 2E60A 2BYVE 2JN6A 2Z16A 2ZO4A 4L0YB 3SZTA 3CP2A 3L1PA 3FXJA 2R93J 2HQNA 2QQ8A 4AC0A 5F0HA 3CLOA 4EV0A 1QPMA 3ERMA 1EH7A 4PDKA 2ESHA 2HXOA 3FK6A 2IGNA 1QZEA 3SYTA 4B1RA 5ED4A 1A5JA 2IPQX 4X6AJ 1J09A 3RPQA 2L7ZA 1WJEA 5C44J 1TWGJ 5DM6F 4GO1A 5IYBJ 1Z67A 4O3MA 3G1MA 5FKKA 4XSXF 5GAHJ 5HLHA 1QO0D 1IN7A 3LQRA 2E7WA 2PJPA 2LLKA 3GYHX 4C2UA 3MEXA 3VODA 2XC7A 4ZZLA 1WJFA 4CZCA 1DU0A 5BQTA 1SVMA 1E0EA 1LDJA 1TNTA 2OCEA 2VJIA 4HEA2 3CCEI 4EQQA 2H8RA 5J47A 3OR1C 3H5AA 4BNCA 4A3EJ 4LLGF 3LSJA 2O61A 2DFHA 3OOPA 4C3HJ 1B8IB 4BQQA 2HKOA 4IKFA 2QUFA 2QM3A 4G6QA 4CH7A 5DCFA 1DPRA 2UXNA 2DTZA 2N8GA 3A4CA 4RM3A 2EFWA 3S2WA 1E3OC 1I6XA 3MWMA 2CUJA 3HGGA 1FBQA 4Y7NJ 4WX9A 3A01B 3LSIA 4EJVA 2J5OA 2EWNA 3L7WA 1RRJA 3JRDA 3MKLA 1AA7A 3LFKA 1H9GA 4N9IA 1DPUA 3H9GA 4ZZDA 4KJZA 2I5UA 5LGTA 3FXLA 2M30A 2K9MA 2X1CA 3ISPA 3EUKL 4YEJA 2BY3A 1Z1DA 1HDDC 4BXXJ 2QYOA 2BY0A 3I54A 4D7MA 3ZQLA 4LK0F 2BOLA 3QYFA 4B09A 4E4HA 2H6CA 3F22A 4ENNA 2P7VB 3E5UA 4Y17A 2DDBA 3Q9SA 3HTUA 4PJNA 1IN4A 2ICWG 5FKLA 3AL0B 2EZKA 4XLEA 1S3JA 5F0CA 4WWCA 4IQ4A 3KYLA 4CA0A 3VOEA 3FWEA 1W36D 5LEKA 1SAUA 1DQUA 4B48A 3ZQHA 4A3GJ 5J8CA 2BGCA 2KRCA 3K0LA 5FD6A 3T8RA 3TL4X 1UHWA 4IX7A 2L7MP 5J4YA 1KYZA 4B3AA 2YS9A 3TOBA 2O9LA 3WG7H 5D5VB 4Q47A 5ILUA 2HTJA 3PIOF 2W25A 2BW3B 2M2EA 4DYRA 3HRMA 4BACA 1W7PD 1AKHB 3GTGJ 3BCBA 4PJJA 1G2HA 1X58A 4KICA 1YIJI 4HDVA 4JOMA 2VXDA 4E70A 3K2ZA 2F6CA 5E79C 1BI0A 5D8KB 4L9VA 2JPCA 1UG2A 4XK4A 3I58A 3BOQA 3SHFA 3BTJA 4ON0A 4ENJA 3REOA 4PUSA 3NAUA 1Y39A 1X19A 1YO5C 5E8IA 2Y9ZA 3C7JA 1WCMJ 3PSIA 2IXSA 1B72B 1ZARA 4EATA 5HNHA 2HQ5A 3BR1A 4MEXF 1ETXA 3CJTB 3FXQA 1MDMB 1QVUA 3C18A 1X1BA 3HOZJ 3NWTA 2VPRA 1YRNB 3H3UA 1OCPA 3CMMA 4RM2A 4NB5A 3OYBA 2F5DA 4WXHA 2A6EF 4Y52J 4P5OA 2VBXA 4KMUX 4IHWA 1SMTA 3T0YA 3D0SA 3QPLA 1U9NA 2UUZA 1ZLJA 4Q5SF 1RC9A 3N4MA 2XSDC 3KP2A 2GXGA 1U0JA 3ABLH 4Y33A 4UY8I 4ZDLA 2PMZA 2F4IA 3K69A 3TBIA 5JHFA 1F43A 4JX4A 2XKOA 2EQRA 2R0QC 4OIQF 3PQJA 1S8NA 5EEAA 1UELB 2JJ7A 2VKDA 1SD6A 4Y4RA 3ZMVA 4NNJA 1FBUA 3K6GA 2LY2A 2K9QA 4KN4X 4AD9A 1YITI 3O8GA 1JGGA 2L54A 3ASOH 2A5WA 2XKPA 2JA2A 1LFUP 3H9QA 5D5UB 3QODA 2DTRA 2A61A 4JP0A 1VF9A 1K83J 4CDGA 1TW3A 1MBJA 4DOZA 5J8FA 3BTLA 1ENHA 2FBIA 2Z33A 3VSLA 3K70C 2LY1A 2X6WA 3FXKA 1JKPC 3OYIA 2WWYA 2E1OA 1PUFA 4LD5A 3WTSC 3IKVA 5FLVA 2XPWA 2ZXHA 2O3FA 5J4VA 4ZTJA 2EFQA 3PM1A 4YIRX 1YI2I 2LVSA 1HA8A 1N78A 1IC8A 2DA6A 5IOYA 3LAPA 3PIPF 3J80K 1TTYA 2F2EA 3C1DA 1DGRM 3IAM2 4FX0A 3DEEA 1UAAA 3I59A 3K1MA 3OIQA 2X6OA 3F8MA 2CYYA 1POGA 3DKWA 2OD5A 1BC8C 2V26A 2CMPA 4IQJA 2FOWA 2DN0A 4C3IJ 3QWLA 4XOTA 2IGMA 2CS3A 2QBYB 4LIVA 5E18F 2Z2SB 2QZ8A 2DLLA 2V9KA 1ZGWA 1VQKI 3PUFA 1S7EA 2VODA 1G8XA 3OYGA 4OIOF 2EFPA 2W48A 4XR6A 3W2WA 4ITVA 4A2UA 3CC2I 1W0TA 3GTLJ 1WSUA 5L3DA 3MQ0A 1W1WE 1QA6A 2XRLA 3W6VA 1CGPA 1N25A 4BGDA 1BJZA 1YIOA 2BEOA 2E35A 4WXCA 2OQRA 1VQ5I 3BG5A 2ZSHB 3LL7A 4PK4A 1YRNA 3FX3A 2OUMA 4M3GA 4MFEA 4PJ0C 2L4AA 3WTVC 2L3DA 3Q3SA 3IHUA 1B59A 4JQFA 5IT9Z 1B72A 4RAFA 2K5CA 2MGQA 2VC1A 3BCAA 3I0TA 1X1AA 3L2QA 3L2RA 1FIAA 1VI0A 4H0EA 3GLLA 4D7NA 4XM3A 3ZMZA 3QP5A 3M8EA 2EFOA 2RC4A 1YOVB 1HKQA 2GWRA 4AYBA 2M34A 4DZJA 2BZTA 4UVCA 2GOMA 3W6JB 2VPLA 3DPUA 2FQ3A 4OINF 3GW2A 2Q0OA 3FMRA 2KJBA 1G3SA 2P4WA 3HSFA 3DTEA 2FA5A 4NBQA 1J5YA 1BOAA 1ZK8A 1DDNA 3DTKA 3RKQA 1BL0A 5GTIC 4A3MJ 4QSHA 3FXMA 4M6YA 3S93A 4Y13A 2QA4I 2BXZA 3U21A 4AIDA 1U5TB 2EV5A 1D5YA 1PDNC 4G7HF 2Z1DA 1R5ID 2FJ1A 4IZZA 2HNHA 1RR8C 1VQ9I 4XICA 4RB2C 3BG7A 4XRSG 1P4XA 2HYGD 4M3BA 4L0ZB 3RPUA 1D0YA 4ZJZA 3GBGA 5F08A 2M3AA 2RQQA 3TKYA 1IO2A 3OR2C 5KCMA 3ZMUA 1JTYA 2L02A 5L3GA 4AIHA 5H6QA 1O3QA 3HDDA 4YFXF 1FT9A 2JRMA 3CQZJ 4KIBA 2HGCA 2DA3A 1UFMA 2CH0A 5EZGA 3LMMA 1UMQA 2DJNA 1BBYA 2G7UA 4IOCF 5E1WA 2CJJA 4UUTA 2FXAA 3I5UA 1LQ1A 2K9SA 1PJRA 2V1DA 3LSTA 3SDGA 4V2FA 2JUCA 3WTXC 1XDSA 1BR2A 4HSTA 3ZGKA 2VXZA 3VB2A 2QQBA 3I3LA 1TP4A 3R60A 2RDPA 4HW0A 2FMYA 2QBYA 5CKTA 3OYHA 1G59A 2NOGA 1Z3XA 4Q4ZF 3OYCA 3D1NI 4CSWA 4RBOA 2PEXA 3ZMTA 4MTDA 1IXCA 4KIGA 2CQ7A 2VUMJ 1W5CC 2Y0SN 2JA8J 1WVRA 2XIGA 1IG7A 2FBHA 3SFZA 5B66C 2EFNA 2OTLI 2AO9A 4MEYF 3KZZA 2EV0A 5D6EA 1SAXA 2GQQA 4D5CA 1ZG3A 4DZPA 2ZXWH 2V6EA 1RZ4A 2RNJA 5DEQA 1YJ9I 3S2DJ 4EM0B 4PGGA 1I27A 3TDUC 3WGHA 3TO9A 1REPC 4JX6A 2YX4A 4OIPF 1YX5A 1Y0NA 3F8FA 4CCJA 4A3CJ 3OSGA 2XF7A 3TEDA 2IEKA 2ZFUA 2CFXA 1JJ8C 2GA1A 2P5KA 1SVOA 2IBDA 3QYEA 2CQQA 1C0WA 1XX5A 3V7SA 1T0FC 2HI3A 3H36A 5A2QK 4G8XA 4HF0A 2KP6A 3DEUA 4IVNA 4BE2A 3Q5FA 1KA8A 2M9HA 3JSOA 3PO2J 3K1PA 4L9TA 2XUBA 3CCUI 1K61A 1GUUA 9ANTA 4JK1X 3S16J 2QENA 2G7HA 2NRAC 3CDIA 1R23A 3KYCB 3IH3A 5CVRA 2FOKA 5J6XA 1ZHFA 1SC7A 3WHCA 3JSPA 3G2BA 1WQ2A 5IP7J 3WU2C 3Q0VA 2LD5A 1T2KA 3ABUA 3IUOA 2LF7A 3B6CA 5BNGA 3CUQC 4MGRA 1B8IA 3M7GA 4U0WA 2ETHA 1RR7A 2Q1ZB 4M6XA 3NARA 1MH3A 1P4WA 1W36C 1TWFJ 2HDWA 2STWA 2ZMEA 4L9NA 1WH5A 3CO6C 1ETQA 4PJMA 1QPIA 2ZKZA 2VQGA 2OZ6A 2E2JJ 3GUDA 3PFYA 1LB2A 3AG1H 4LLLA 3V7CA 4U7BA 2FEZA 1O3RA 2V4JC 3FDYA 3K7AJ 1UG0A 3S1RJ 1R1TA 1Z0XA 2RN7A 3JRFA 1X1DA 1MSFC 1A36A 3QPSA 2E34A 1AHDP 2LR8A 1MBKA 2VASA 5D5WB 3FZVA 3HXLA 3MFKA 1ETYA 1HC8A 3P5JA 2IJLA 5DV5A 4ZTFA 3WU1B 1STZA 5HVQC 4BUPA 5EJCA 2RQPA 2QWWA 1H88C 4QIWN 2B0LA 1P7JA 1X4OA 2FNAA 5FRNA 1K6OA 2CFOA 3NQOA 5ICCA 3BTCA 4CCKA 4HSRA 3K4LA 1LEBA 3K4JA 3CCRI 2JTVA 1KZHA 4EMSA 3LA3A 3WGIA 3ZN0A 1XN7A 3PSFA 3LAJA 1TWHJ 5J40A 3CC4I 3GTJJ 1SD4A 2HTSA 3DQVC 2DBBA 4IHXA 3IRRA 3HB9A 3BJAA 3K1NA 4BKXA 4LFUA 4IJAA 4HYEA 1JE8A 2E19A 2FU4A 2PJRB 2P0WA 1ETWA 3OIPA 2YUSA 4M73A 2ZXIA 4LB6B 3VYSB 5FFXA 3ZRGA 3OS1A 4BAYA 1HLVA 2TRTA 2BW3A 3QOEA 5JLXA 2EILH 2NNYA 4I02A 1VQ7I 3ZQCA 4WXDA 1A04A 2LTPA 1I50J 2DJIA 5EEHA 3FBNB 4RLQA 3N97A 4U88A 1WWXA 3F6OA 3LSHA 3GF2A 3ZMSA 1YJNI 1D8KA 1GXQA 5L3EA 3OY9A 4BE1A 2CV1A 4BJ5C 1DU6A 1ZR4A 3W6KB 3H35A 3PUBA 3OYLA 2KJCA 1H89C 1G6NA 5GPCA 3ABMH 1A6QA 1BI3A 2LFBA 2LG4A 4FT8A 4XLAA 4W1UA 2BE5F 2NOJB 1HDPA 2JVHA 2OU2A 1ZLKA 2Z9OA 4I0BA 2MABA 3SZPA 3CCJI 2JRTA 4BHPA 2HU9A 1QGPA 1LVKA 4XRSA 2HR3A 2R7ZJ 1XD7A 5LHHA 5E3OA 5CVUA 3S3OA 3J7AY 4B47A 2M87A 2XAQA 4A6EA 1T8IA 4IRHA 1U3EM 3DPTA 2R7QA 1BW6A 3GTPJ 3WG9A 2R7RA 1T6SA 5AIQA 1YYVA 2R5YB 3KP3A 3HOTA 5LHIA 2GA2A 2OA4A 3F9KA 2M0MA 1WJAA 1VQLI 1BOBA 1R7JA 1V4RA 5F1RA 1F4KA 4HX7A 3RJPA 3RTRA 2RNGA 1FP2A 2JPBA 3E6BA 4I0AA 1JTXA 4HQEA 4A3BJ 2JT1A 2NS7A 3BR6A 2G0EA 2NVTJ 4M72A 1MSEC 1IRXA 3J80Z 1FOKA 4LG0B 3GTQJ 2VOPA 2MC3A 2OV7A 3FKJA 2B9SA 4YELA 2OAZA 2XF5A 3G6EI 2LC2A 3QAHA 3G3ZA 3IC7A 2F5EA 2ME0A 2MSYA 3DLAA 1X1CA 2HPIA 2VBWA 2KZGA 3CMEI 2QSFX 4L5JA 2ME6A 1TL8A 3BZKA 3TQNA 1UZCA 4AUXA 1LJ9A 2K27A 5FB2A 2L9SA 4KA4A 3L00A 3BR2A 5J3LA 2LH9A 5L3FA 3S3NA 4DYCA 4B44A 1ZR2A 3DU6A 2W57A 3BPVA 1K4SA 5CJ9A 2DMQA 1IGNA 4XL9A 4BDZA 4PFOA 5FRMA 1B9MA 4KUMA 3GXOA 1YW8A 2K85A 4IRGA 4BY1J 3W2AA 3G1LA 2BHYA 2VE9A 2WAQA 3HG9A 2CQXA 2VJ4A 2IA1A 3AG2H 2DFEA 3CJRB 2DT5A 1I39A 1R4NB 3M07A 2Z5UA 2LNBA 3ELKA 4EJUA 4D1QA 1RPWA 4XSZF 3QQAA 5B5EC 3WTYC 3HPHA 2ZXJA 3CUQA 2V7FA 3SEZA 2PFBA 1TC3C 4PGHA 4YFNF 3C3WA 2HYFA 3B6AA 1XDUA 2GLOA 2XB0X 1FOWA 2IRFG 4A69C 2X6YA 4G7OF 4OAZA 5C4XJ 5TJJA 2X1EA 1X2NA 4X1EA 1FBSA 3KYDB 2LRDA 1WJ5A 4RLFA 5AIPA 1LE8A 1JT0A 1Y0UA 2ZCWA 1R00A 4CCLA 5HS8A 1L0OC 3GFIA 1FC3A 2IS4A 4QWQA 1SEUA 2LKSA 1OYWA 3BPXA 2CSOA 1U8BA 3I4MJ 4FQGA 1EV7A 1J59A 5LGNA 3SEQA 1WH7A 2ESNA 3HIFA 3UR3C 1T38A 3SDBA 2KT0A 4OOIA 1LUJB 1WI3A 2RKHA 5DM7F 2DQRA 3G73A 2WBMA 3ROUA 3HZJA 2R5ZA 1DGWY 2OTJI 1K78A 1R4MB 2HOAA 4GYGA 2E1MC 2F4MB 4ZYAA 1JJ6C 2PI0A 2R5ZB 4FX4A 3RI4A 2DA5A 1E17A 3KLNA 2XHKA 4XONA 1I1SA 1FEXA 1DP3A 2PQ8A 1V3FA 3GMEA 4ZH4F 1FY7A 3KZIC 1HW1A 5D4SA 4A3JJ 3BLYA 1CQTA 2XRNA 2RREA 1OPCA 4A5NA 3KFWX 2MW8A 4UVAA 4F91B 1Z05A 2ZJ2A 4M3DA 1T98A 3FKIJ 1XC5A 1MGTA 1ZELA 1G3TA 3VDXA 1EF4A 2COMA 1FJLA 4IRIA 2R7OA 4MQ9F 4BXFA 2R5YA 3MKYB 2CQKA 1HBXG 3EUHC 2HYJA 1IUFA 1U5TC 3E97A 3HOVJ 1B4AA 2YPRA 3WODF 3A2KA 1D8JA 5HDGA 3F6VA 3T8TA 3V8KA 3JCUC 5HNFA 1XGSA 3GX4X 2CW8A 3ZQIA 3RYPA 2ELKA 4UXNA 2HQRA 3HYIA 1YHQI 1IAWA 1ZREA 1T08B 1AKHA 2JWTA 1LE8B 4HLXA 4V2GA 1ACIA 2V1XA 1SFEA 5J1RA 3K4CA 2COBA 4PJLA 2R7UA 1LEAA 1GV2A 3ZP5A 3MZYA 4WF2A 4BQAA 1V5GA 1ZH5A 4HF1A 4UB6C 2XASA 4A93J 3CUQB 4XRFA 4AIJA 1ZRFA 2O6GE 3P7NA 4XKCA 4S0HB 4Z6YA 4LG3A 4NDLA 4XRMA 3DEWA 1SFXA 4CGZA 3FHNA 1Z6TA 3IKTA 1J7KA 2GOXB 2J5PA 1OR7A 2OQGA 1WJCA 1MMSA 3O3KA 3JRCA 2VBZA 3LSMA 1ONVA 4RB1A 4ANJA 5J1UA 1MNEA 4XLPF 2FQ4A 4KT6A 1E3HA 1XSXA 2E5NA 3RSNA 4GFBA 4L18B 2QKMB 3E6DA 1YTYA 3I4PA 1Q1VA 4KNYA 4L9JA 5BS6A 1K4TA 2VQCA 3P9IA 2R4GA 2XV4S 3S32A 1APLC 3LSGA 2X0LA 4BL0B 5KAFC 2L2OA 5EF6A 2F5FA 2GXAA 4XBFA 1OCOH 4QTRA 3J7AO 1K79A 3QPTA 4RGXA 1WPKA
chains in the Genus database with same CATH topology
1FPQA 3GFMA 4RGUA 5LHGA 1XCVA 2XAGA 5JHUA 4LB5A 1S7AA 3E6CC 4KIFA 3FF5A 2XGXA 2MH2A 5DD4A 1IZ1A 1BI2A 4EM1A 1AWCA 5LBQA 5D4RA 1HQCA 3TO6A 4ENMA 2DQLA 2ZMEB 3R0JA 4MTEA 3AAFA 3B02A 5D5XB 3DPLC 2GIVA 3B73A 3L09A 2VT2A 4ZYEA 3NRVA 3BDDA 1W5SA 3EYIA 2UXXA 3BWGA 2KIUA 1K78B 4D0PA 1KU7A 2K4BA 2ZNZA 1TLHB 5JI6A 2FNPA 3FXUA 3BROA 2P8TA 2MH9A 2PN6A 2VBYA 4I7HA 1TQPA 2LSOA 5DCMA 3F8NA 4OIRF 1E2XA 5DD8A 4GXOA 1IXRC 1XMAA 1R36A 2RGVA 2W24A 5FLXZ 3KETA 1WRJA 4I98B 3RKXA 2A07F 3V7RA 4EJTA 1LDDA 2R7DA 2R7FA 2FMLA 2H6BA 2FE3A 1U6GA 2XROA 3BJ6A 3H92A 5DDGA 5LRSA 2Q8KA 2GZWA 4LLNA 2HEOA 1ZGAA 1IRGA 3F21A 3KEOA 3KE2A 4OMYA 4RB0A 3F72A 4A12A 4ESJA 1F5TA 1USTA 5DUKA 1MZBA 3CTAA 4BH9A 2ADUA 2KKOA 1T39A 1G3YA 4KN7X 1ZGJA 1SD7A 3I71A 3R6SA 4G7ZF 2M5WA 4IXAA 5FD5A 4ASNA 2MLGA 4HA8A 4R79A 2A68F 2ELHA 2DAOA 2CG4A 4WK8F 4Y15A 3RYRA 2JSCA 4Z2YA 4G6DA 4YIFA 3EUHA 2YSRA 3ZQ7A 1ZRCA 4AVPA 3GVAA 2HDCA 4I2OA 1J9IA 2O8XA 2DK5A 4HV5A 4S04A 3WE2A 2EK5A 3ECOA 4IHTA 4ZYDA 4YFKF 2DFIA 4TV7A 4AIKA 2AS5F 4HDUA 4DNCA 5K1YA 1MJ9A 4HX8A 3LA7A 3F8CA 5HS7A 4CXFA 1FYLA 2QVOA 2Z3YA 4LJZF 2Y75A 4R8HA 2UZKA 2JZYA 2F5CA 1X3UA 3GO5A 5L3BA 2EB7A 5BMZA 1XMKA 2ZFWA 1ZAOA 4EM2A 3E3VA 3BJOA 4YIIA 2A69F 3CO7C 4N9HA 2Y0MA 1SMYF 1KGSA 1JGSA 2QLZA 3SXYA 1MKMA 3DFGA 1IN5A 3PQKA 4EVIA 2XAJA 4I01A 4CICA 1BN5A 2Y48A 1BI1A 2RV8A 4P9FA 5JFRA 5K5OA 3RDIA 4UHTA 2MLKA 1W5TA 3ZMDA 3P9KA 2DI3A 1RIOH 4KDPA 4RGSA 2R3SA 4K2EA 3E5XA 3M9AA 3JTGA 2P5LC 3H3ZA 2NYXA 2M45A 2Z99A 1YS7A 1L3LA 2VOOA 2G9WA 3F8BA 2PBIA 3V4GA 1IF1A 1FSHA 1PUEE 3WTTC 2IVMA 1IW7F 4M9SA 2K4JA 1R5HA 5IT3A 4EGZA 4HLYA 1KYWA 1FWZA 3QU6A 3KP5A 3KP4A 4R1HA 1WI9A 3SQNA 1U5TA 3GFLA 1J75A 2ISYA 1FP1D 3I53A 2CO5A 3K9TA 1IN6A 4U7DA 1O57A 1Q1HA 3FXRA 3JAMK 2WTEA 1QZZA 1H0MA 4P96A 4EJOA 3COAC 2DPUA 1TBXA 2EA2A 1KU3A 2IP2A 4HQMA 1YFHA 2Q2EA 2PMUA 1LNWA 3VFZA 2V6CA 3O6BB 1XGOA 3L9FA 4BYYA 2FSWA 2A5YB 2A3SA 4B8XA 1FX7A 5LGUA 3DV8A 2DPDA 5JR3A 3ZPLA 3J81K 1D3YA 2YX7A 5D8LB 4GCVA 1RI7A 3HOSA 1W7PA 1HW2A 2WC2A 1FZPB 1FNNA 2CGPA 1MD0A 4DQ2A 2VONA 1FYKA 2PLYA 1TNSA 2HFHA 1O7FA 5LRRA 2MA3A 1YLFA 5FO5A 1KU2A 1P6RA 5LEJA 1KQ0A 2LKPA 2L4MA 1USSA 2WV0A 2FRHA 1XSDA 4A0YA 3CJNA 2W84A 4N0BA 1O3SA 2W85A 2E1NA 3QP6A 3CDHA 3GLXA 3JW4A 2KIFA 4LGWA 1J2XA 2M1BA 5ICFA 3V8LA 4CZZA 1LVAA 3Q9VA 2D1HA 3FMSA 2PMHA 4MNUA 3U1DA 3MCZA 2XAFA 4RAYA 2HOEA 2M8EA 2LDUA 5HOOA 1CF7A 4KFCA 5ILVA 1KQ9A 3GZ5A 2V79A 3WE3A 1U8RA 2QQ9A 5F6FA 5FLXK 3D5LA 1MDMA 2LF8A 1R5GA 3ECHA 1MJBA 2BV6A 1HKTA 1HSTA 3KEQA 3HHHA 2TDXA 2K7LA 1HKSA 4GYIA 1XCBA 5E1ZB 2P5VA 4FHTA 1ZN2A 4YG2F 3IWFA 4NHJA 1ODDA 2K02A 2NAZA 2ISZA 2FF4A 1GHCA 3KP6A 3MZHA 4EGYA 3DXJF 5CYVA 4KT5C 1KU9A 3PFIA 3IRQA 3LQQA 3OV8A 3FM5A 5KVRA 2VC0A 1ZYRF 1R1UA 1Z9CA 1LDKB 1RUOA 4M74A 3HRUA 3WTUC 4IHSA 5CVIA 4P9UA 1PP8F 2NNNA 2VE8A 1UCRA 4RS8A 3QU3A 5HDNA 5HLGA 3NEUA 4GGGA 3ULQB 3L2CA 5E17F 3EETA 4ZYGA 1U2WA 3U2RA 3EQLF 5L3CA 1ZG1A 5DYMA 1J0RA 1TQIA 2NS0A 1VTNC 2P6TA 1ON2A 2L01A 4XLNF 4S05A 3IL2A 2HKXA 1HSJA 4CYDA 5F64A 4U0VA 5ICEA 2A6HF 2DO7A 4PZJA 1G4DA 1G3WA 3EDPA 1CF7B 2AXLA 1I5ZA 5BOXA 2QQAA 1TQMA 3KP7A 1O3TA 1P2FA 1S7OA 5CVJA 2DW4A 1BIAA 4ZYHA 3E6MA 3ZN1A 3HSRA 1GVJA 2VN2A 2FBKA 4A6DA 3LWFA 3MAJA 2HS5A 4ETSA 3P9CA 5ILSA 4CO8A 2X4HA 3QOPA 3M8FA 4I09A 4G94A 2H94A 2YR2A 3ABTA 5KK1A 4ENKA 1ON1A 3JTHA 4UV9A 3JAMZ 3FMQA 4L5IA 2IT0A 4A5MA 3HSEA 1R22A 5K5QA 4HF2A 3V8JA 3I64A 2P6SA 3TO7A 1T0FA 2KRFA 4QLCU 3GZ6A 4HX4A 1Z91A 4NQWA 1BC7C 1SFUA 3IWZA 3R4KA 3HRSA 3WTZA 1W7PB 5LLQA 5HLIA 4U0YA 1YW9A 1AOYA 4UVBA 1P92A 1YG2A 2MD5A 4A0XA 4OMZA 2YU3A 3TDZC 2MBFA 2H27A 3BZ6A 1SD5A 1MJAA 2E7XA 3DP7A 2CW0F 4LG0A 1S6LA 3WU0A 4P55A 5E8GA 5TRDA 2STTA 1DUXC 1OMIA 1UHMA 4HAMA 1BJAA 1F1ZA 3E5QA 4KMFA 3QRFF 5FFZA 1K7AA 1EH6A 4RAZA 5FGMA 1OKRA 2CWEA 1O7LA 1JXSA 2EJRA 2XVCA 1RNLA 2DU9A 2ZNYA 2C6YA 3M1EA 3WTWC 4UNOA 5H6RA 5ERIA 1F9NA 1Z6RA 1XGMA 1FYMA 3F3XA 4KYWA 2O0YA 1OYIA 4IF4A 2OBPA 2V9VA 4O6JA 2KIMA 1Z7UA 4EJWA 4HOBA 5BPDA 3TOAA 1QBJA 5D6FA 1ULYA 2H09A 1D5VA 3BY6A 4ESBA 3HRTA 1JHHA 5E1XA 5CLSA 3WGGA 1IRFA 2D1VA 2O03A 4G9YA 3F23A 4PCQA 3FM3A 4F7ZA 3KCCA 2HZTA 3FHZA 3T5XA 1PP7U 3GWZA 1IUYA 1XGNA 1KQ8A 4Q48A 3VEPA 5JVTA 2IW5A 4RB3C 2UWMA 1EH8A 1RUNA 4BHBA 4WCGA 4M71A 5IT9K 4HZFA 2IA2A 1FSEA 2IA0A 1BIBA 2K86A 5E20A 4LMYA 1QNTA 2EV6A 1BM9A 2ZBKA 3RIRA 3TGNA 2BBYA 2VT3A 4UUVA 1W4MA 5BPIA 1GXPA 1B1BA 3LA2A 4ESFA 4O5VA 5K5RA 5DUIA 1I1GA 4M9ZA 4JBAA 3U9GA 1DP7P 5CVVA 3O2PE 1H9TA 5HS9A 1B9NA 3QPHA 3BP8A 4RGRA 4BXUA 2V1UA 3J81Z 2EA4A 4IPAA 3HHGA 3RKWA 1UB9A 1R1VA 3HTSB 5H20A 3R61A 1R58A 3R0AA 1FLIA 6PAXA 2GXBA 1U78A 2D2WA 2OZUA 3GEZA 4MQVA 2RVCA 5EEGA 5HDKA 3CUOA 2ACJA 1XB4A 2D45A 4A0ZA 1XSVA 4BHCA 1WKMA 4OU0A 2E1CA 3T1BA 4HV6A 1OYYA 1HW5A 5ICGA 3ERED 4AWXB 3DF8A 2P7CB 3GFJA 1YS6A 1HXDA 3KZYA 1TW2A 2XAHA 1ZG5A 1P4AA 1JHFA 4CHUA 4LK1F 4MHGA 3ML6A 5AONA 5DCMB 1QQIA 1YQAA 1IN8A 2DK8A 1YW7A 2PG4A 1S29A 1ZRDA 1IXSB 1NHAA 3EYYA 3I59B 2HWVA 1QZYA 5A2QZ 4M9XA 3KLOA 4UV8A 3HUGA 4HBLA 1B6AA 3RKYA 2GAUA 2BYVE 2ZO4A 4L0YB 3SZTA 2HQNA 3CLOA 4EV0A 1QPMA 1EH7A 4PDKA 2ESHA 5ED4A 2IPQX 3RPQA 4GO1A 4O3MA 4XSXF 5HLHA 1QO0D 1IN7A 3LQRA 2E7WA 2PJPA 3GYHX 3MEXA 3VODA 4ZZLA 5BQTA 1LDJA 1TNTA 4EQQA 4BNCA 4LLGF 2O61A 3OOPA 2HKOA 2QUFA 2QM3A 4G6QA 5DCFA 1DPRA 2UXNA 2EFWA 3S2WA 1I6XA 3MWMA 1FBQA 4WX9A 4EJVA 2J5OA 2EWNA 3L7WA 3LFKA 1H9GA 4N9IA 1DPUA 4ZZDA 5LGTA 2M30A 3ISPA 1Z1DA 2QYOA 3I54A 4LK0F 4B09A 2H6CA 3F22A 4ENNA 2P7VB 3E5UA 4Y17A 3Q9SA 3HTUA 1IN4A 1S3JA 4WWCA 3VOEA 3FWEA 5LEKA 5J8CA 2BGCA 3K0LA 5FD6A 3T8RA 1UHWA 1KYZA 3TOBA 5D5VB 4Q47A 5ILUA 2HTJA 2W25A 3HRMA 1W7PD 4KICA 4HDVA 4E70A 3K2ZA 1BI0A 5D8KB 4L9VA 2JPCA 3I58A 3BOQA 3SHFA 4ON0A 4ENJA 3REOA 1YO5C 5E8IA 3C7JA 1ZARA 4MEXF 3FXQA 1MDMB 3C18A 3H3UA 4NB5A 2F5DA 4WXHA 2A6EF 4P5OA 2VBXA 4KMUX 1SMTA 3T0YA 3D0SA 1ZLJA 4Q5SF 3N4MA 3KP2A 2GXGA 3K69A 2XKOA 4OIQF 3PQJA 1S8NA 1SD6A 3ZMVA 1FBUA 4KN4X 4AD9A 2L54A 2XKPA 5D5UB 2DTRA 2A61A 4CDGA 1TW3A 5J8FA 2FBIA 2Z33A 2WWYA 4LD5A 3WTSC 3IKVA 2O3FA 2EFQA 3LAPA 3J80K 1TTYA 2F2EA 3C1DA 4FX0A 3I59A 3K1MA 3F8MA 2CYYA 3DKWA 2OD5A 1BC8C 2QBYB 5E18F 2QZ8A 2DLLA 2VODA 4OIOF 2EFPA 4A2UA 1WSUA 5L3DA 3MQ0A 1CGPA 1YIOA 4WXCA 2BEOA 2OQRA 3FX3A 2L4AA 3WTVC 2L3DA 3IHUA 1B59A 4JQFA 5IT9Z 2VC1A 3I0TA 4H0EA 3ZMZA 3QP5A 3M8EA 2EFOA 2RC4A 1HKQA 2GWRA 4UVCA 3W6JB 2FQ3A 4OINF 3GW2A 2Q0OA 3FMRA 2KJBA 1G3SA 2P4WA 3HSFA 2FA5A 1J5YA 1BOAA 1DDNA 4M6YA 4Y13A 1U5TB 2EV5A 1PDNC 4G7HF 4RB2C 4L0ZB 1P4XA 2HYGD 3RPUA 3TKYA 3ZMUA 5L3GA 2L02A 1O3QA 4AIHA 5H6QA 4YFXF 1FT9A 4KIBA 2HGCA 1UFMA 1BBYA 2G7UA 5E1WA 2FXAA 3I5UA 1LQ1A 2V1DA 3LSTA 3WTXC 1XDSA 2VXZA 3VB2A 2QQBA 3R60A 2RDPA 4HW0A 2FMYA 2QBYA 4Q4ZF 2PEXA 3ZMTA 4MTDA 1IXCA 4KIGA 2XIGA 2FBHA 3SFZA 2EFNA 4MEYF 3KZZA 2EV0A 5D6EA 1SAXA 2GQQA 1ZG3A 1RZ4A 2RNJA 5DEQA 4EM0B 4PGGA 1I27A 3TDUC 3WGHA 3TO9A 1REPC 2YX4A 4OIPF 3F8FA 2CFXA 2GA1A 2P5KA 1C0WA 3V7SA 5A2QK 4G8XA 4HF0A 3DEUA 4IVNA 3Q5FA 1KA8A 3JSOA 3K1PA 4L9TA 2XUBA 4JK1X 2QENA 2G7HA 2NRAC 1R23A 5CVRA 5J6XA 2FOKA 1ZHFA 3JSPA 1WQ2A 1T2KA 3ABUA 2LF7A 3CUQC 4MGRA 3M7GA 4U0WA 2ETHA 4M6XA 1P4WA 2STWA 2ZMEA 4L9NA 3CO6C 2ZKZA 2OZ6A 3GUDA 1LB2A 4LLLA 3V7CA 4U7BA 2FEZA 1O3RA 1R1TA 2RN7A 5D5WB 3FZVA 3MFKA 2IJLA 5DV5A 3WU1B 1STZA 5HVQC 2RQPA 2QWWA 2B0LA 2FNAA 1K6OA 3NQOA 5ICCA 1LEBA 2JTVA 4EMSA 3LA3A 3WGIA 3ZN0A 1XN7A 3LAJA 1SD4A 2HTSA 3DQVC 2DBBA 3IRRA 3BJAA 3K1NA 4LFUA 4IJAA 4HYEA 1JE8A 2FU4A 4M73A 4LB6B 5FFXA 4BAYA 2NNYA 4I02A 4WXDA 1A04A 5EEHA 3N97A 4U88A 1WWXA 3F6OA 3ZMSA 3GF2A 1D8KA 1GXQA 5L3EA 3W6KB 2KJCA 1G6NA 1BI3A 4FT8A 2BE5F 2OU2A 1ZLKA 2Z9OA 4I0BA 3SZPA 2JRTA 4BHPA 1QGPA 2HR3A 1XD7A 5LHHA 5CVUA 2M87A 2XAQA 4A6EA 4IRHA 1U3EM 3DPTA 3WG9A 1T6SA 5AIQA 1YYVA 3KP3A 3HOTA 5LHIA 2GA2A 2OA4A 1R7JA 1V4RA 5F1RA 1F4KA 4HX7A 3RJPA 3RTRA 1FP2A 2JPBA 3E6BA 4I0AA 4HQEA 2JT1A 4M72A 1FOKA 3J80Z 4LG0B 2VOPA 2MC3A 2OAZA 3QAHA 3G3ZA 3IC7A 2F5EA 2VBWA 4L5JA 3TQNA 1LJ9A 2K27A 5FB2A 4KA4A 3L00A 5L3FA 2W57A 3BPVA 5CJ9A 1B9MA 4KUMA 3GXOA 1YW8A 4IRGA 2VE9A 2IA1A 2DT5A 2Z5UA 2LNBA 3ELKA 4EJUA 4XSZF 3WTYC 2ZXJA 3CUQA 2PFBA 4PGHA 4YFNF 3C3WA 2HYFA 1XDUA 2IRFG 4G7OF 5TJJA 1FBSA 5AIPA 1Y0UA 2ZCWA 1R00A 5HS8A 3GFIA 1L0OC 1FC3A 4QWQA 1OYWA 3BPXA 2CSOA 1EV7A 1J59A 5LGNA 2ESNA 3HIFA 1T38A 4OOIA 2RKHA 2DQRA 3G73A 3ROUA 1K78A 4GYGA 2PI0A 4FX4A 3RI4A 1E17A 3KLNA 2XHKA 1I1SA 2PQ8A 1V3FA 4ZH4F 1FY7A 1HW1A 5D4SA 2XRNA 1OPCA 4A5NA 3KFWX 4UVAA 1Z05A 2ZJ2A 1T98A 1MGTA 1G3TA 2COMA 4IRIA 4MQ9F 1HBXG 2CQKA 1U5TC 3E97A 1B4AA 2YPRA 3WODF 1D8JA 5HDGA 3F6VA 3T8TA 3V8KA 1XGSA 3GX4X 3RYPA 4UXNA 1ZREA 2HQRA 3HYIA 1IAWA 4HLXA 2V1XA 1SFEA 1LEAA 3ZP5A 3MZYA 4WF2A 4BQAA 1ZH5A 4HF1A 2XASA 3CUQB 4XRFA 4AIJA 1ZRFA 2O6GE 3P7NA 1SFXA 4CGZA 3IKTA 1Z6TA 1J7KA 2J5PA 1OR7A 2OQGA 3O3KA 2VBZA 1ONVA 4RB1A 4XLPF 1XSXA 4L18B 3E6DA 1YTYA 3I4PA 4KNYA 4L9JA 5BS6A 3P9IA 2XV4S 2X0LA 2F5FA 4XBFA 3J7AO 1K79A 3QPTA 4RGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FPQ A;  3GFM A;  4RGU A;  5LHG A;  1XCV A;  2XAG A;  5JHU A;  4LB5 A;  1S7A A;  3E6C C;  4KIF A;  3FF5 A;  2XGX A;  2MH2 A;  5DD4 A;  1IZ1 A;  1BI2 A;  4EM1 A;  1AWC A;  5LBQ A;  5D4R A;  1HQC A;  3TO6 A;  4ENM A;  2DQL A;  2ZME B;  3R0J A;  4MTE A;  3AAF A;  3B02 A;  5D5X B;  3DPL C;  2GIV A;  3B73 A;  3L09 A;  2VT2 A;  4ZYE A;  3NRV A;  3BDD A;  1W5S A;  3EYI A;  2UXX A;  3BWG A;  2KIU A;  1K78 B;  4D0P A;  1KU7 A;  2K4B A;  2ZNZ A;  1TLH B;  5JI6 A;  2FNP A;  3FXU A;  3BRO A;  2P8T A;  2MH9 A;  2PN6 A;  2VBY A;  4I7H A;  1TQP A;  2LSO A;  5DCM A;  3F8N A;  4OIR F;  1E2X A;  5DD8 A;  4GXO A;  1IXR C;  1XMA A;  1R36 A;  2RGV A;  2W24 A;  5FLX Z;  3KET A;  1WRJ A;  4I98 B;  3RKX A;  2A07 F;  3V7R A;  4EJT A;  1LDD A;  2R7D A;  2R7F A;  2FML A;  2H6B A;  2FE3 A;  1U6G A;  2XRO A;  3BJ6 A;  3H92 A;  5DDG A;  5LRS A;  2Q8K A;  2GZW A;  4LLN A;  2HEO A;  1ZGA A;  1IRG A;  3F21 A;  3KEO A;  3KE2 A;  4OMY A;  4RB0 A;  3F72 A;  4A12 A;  4ESJ A;  1F5T A;  1UST A;  5DUK A;  1MZB A;  3CTA A;  4BH9 A;  2ADU A;  2KKO A;  1T39 A;  1G3Y A;  4KN7 X;  1ZGJ A;  1SD7 A;  3I71 A;  3R6S A;  4G7Z F;  2M5W A;  4IXA A;  5FD5 A;  4ASN A;  2MLG A;  4HA8 A;  4R79 A;  2A68 F;  2ELH A;  2DAO A;  2CG4 A;  4WK8 F;  4Y15 A;  3RYR A;  2JSC A;  4Z2Y A;  4G6D A;  4YIF A;  3EUH A;  2YSR A;  3ZQ7 A;  1ZRC A;  4AVP A;  3GVA A;  2HDC A;  4I2O A;  1J9I A;  2O8X A;  2DK5 A;  4HV5 A;  4S04 A;  3WE2 A;  2EK5 A;  3ECO A;  4IHT A;  4ZYD A;  4YFK F;  2DFI A;  4TV7 A;  4AIK A;  2AS5 F;  4HDU A;  4DNC A;  5K1Y A;  1MJ9 A;  4HX8 A;  3LA7 A;  3F8C A;  5HS7 A;  4CXF A;  1FYL A;  2QVO A;  2Z3Y A;  4LJZ F;  2Y75 A;  4R8H A;  2UZK A;  2JZY A;  2F5C A;  1X3U A;  3GO5 A;  5L3B A;  2EB7 A;  5BMZ A;  1XMK A;  2ZFW A;  1ZAO A;  4EM2 A;  3E3V A;  3BJO A;  4YII A;  2A69 F;  3CO7 C;  4N9H A;  2Y0M A;  1SMY F;  1KGS A;  1JGS A;  2QLZ A;  3SXY A;  1MKM A;  3DFG A;  1IN5 A;  3PQK A;  4EVI A;  2XAJ A;  4I01 A;  4CIC A;  1BN5 A;  2Y48 A;  1BI1 A;  2RV8 A;  4P9F A;  5JFR A;  5K5O A;  3RDI A;  4UHT A;  2MLK A;  1W5T A;  3ZMD A;  3P9K A;  2DI3 A;  1RIO H;  4KDP A;  4RGS A;  2R3S A;  4K2E A;  3E5X A;  3M9A A;  3JTG A;  2P5L C;  3H3Z A;  2NYX A;  2M45 A;  2Z99 A;  1YS7 A;  1L3L A;  2VOO A;  2G9W A;  3F8B A;  2PBI A;  3V4G A;  1IF1 A;  1FSH A;  1PUE E;  3WTT C;  2IVM A;  1IW7 F;  4M9S A;  2K4J A;  1R5H A;  5IT3 A;  4EGZ A;  4HLY A;  1KYW A;  1FWZ A;  3QU6 A;  3KP5 A;  3KP4 A;  4R1H A;  1WI9 A;  3SQN A;  1U5T A;  3GFL A;  1J75 A;  2ISY A;  1FP1 D;  3I53 A;  2CO5 A;  3K9T A;  1IN6 A;  4U7D A;  1O57 A;  1Q1H A;  3FXR A;  3JAM K;  2WTE A;  1QZZ A;  1H0M A;  4P96 A;  4EJO A;  3COA C;  2DPU A;  1TBX A;  2EA2 A;  1KU3 A;  2IP2 A;  4HQM A;  1YFH A;  2Q2E A;  2PMU A;  1LNW A;  3VFZ A;  2V6C A;  3O6B B;  1XGO A;  3L9F A;  4BYY A;  2FSW A;  2A5Y B;  2A3S A;  4B8X A;  1FX7 A;  5LGU A;  3DV8 A;  2DPD A;  5JR3 A;  3ZPL A;  3J81 K;  1D3Y A;  2YX7 A;  5D8L B;  4GCV A;  1RI7 A;  3HOS A;  1W7P A;  1HW2 A;  2WC2 A;  1FZP B;  1FNN A;  2CGP A;  1MD0 A;  4DQ2 A;  2VON A;  1FYK A;  2PLY A;  1TNS A;  2HFH A;  1O7F A;  5LRR A;  2MA3 A;  1YLF A;  5FO5 A;  1KU2 A;  1P6R A;  5LEJ A;  1KQ0 A;  2LKP A;  2L4M A;  1USS A;  2WV0 A;  2FRH A;  1XSD A;  4A0Y A;  3CJN A;  2W84 A;  4N0B A;  1O3S A;  2W85 A;  2E1N A;  3QP6 A;  3CDH A;  3GLX A;  3JW4 A;  2KIF A;  4LGW A;  1J2X A;  2M1B A;  5ICF A;  3V8L A;  4CZZ A;  1LVA A;  3Q9V A;  2D1H A;  3FMS A;  2PMH A;  4MNU A;  3U1D A;  3MCZ A;  2XAF A;  4RAY A;  2HOE A;  2M8E A;  2LDU A;  5HOO A;  1CF7 A;  4KFC A;  5ILV A;  1KQ9 A;  3GZ5 A;  2V79 A;  3WE3 A;  1U8R A;  2QQ9 A;  5F6F A;  5FLX K;  3D5L A;  1MDM A;  2LF8 A;  1R5G A;  3ECH A;  1MJB A;  2BV6 A;  1HKT A;  1HST A;  3KEQ A;  3HHH A;  2TDX A;  2K7L A;  1HKS A;  4GYI A;  1XCB A;  5E1Z B;  2P5V A;  4FHT A;  1ZN2 A;  4YG2 F;  3IWF A;  4NHJ A;  1ODD A;  2K02 A;  2NAZ A;  2ISZ A;  2FF4 A;  1GHC A;  3KP6 A;  3MZH A;  4EGY A;  3DXJ F;  5CYV A;  4KT5 C;  1KU9 A;  3PFI A;  3IRQ A;  3LQQ A;  3OV8 A;  3FM5 A;  5KVR A;  2VC0 A;  1ZYR F;  1R1U A;  1Z9C A;  1LDK B;  1RUO A;  4M74 A;  3HRU A;  3WTU C;  4IHS A;  5CVI A;  4P9U A;  1PP8 F;  2NNN A;  2VE8 A;  1UCR A;  4RS8 A;  3QU3 A;  5HDN A;  5HLG A;  3NEU A;  4GGG A;  3ULQ B;  3L2C A;  5E17 F;  3EET A;  4ZYG A;  1U2W A;  3U2R A;  3EQL F;  5L3C A;  1ZG1 A;  5DYM A;  1J0R A;  1TQI A;  2NS0 A;  1VTN C;  2P6T A;  1ON2 A;  2L01 A;  4XLN F;  4S05 A;  3IL2 A;  2HKX A;  1HSJ A;  4CYD A;  5F64 A;  4U0V A;  5ICE A;  2A6H F;  2DO7 A;  4PZJ A;  1G4D A;  1G3W A;  3EDP A;  1CF7 B;  2AXL A;  1I5Z A;  5BOX A;  2QQA A;  1TQM A;  3KP7 A;  1O3T A;  1P2F A;  1S7O A;  5CVJ A;  2DW4 A;  1BIA A;  4ZYH A;  3E6M A;  3ZN1 A;  3HSR A;  1GVJ A;  2VN2 A;  2FBK A;  4A6D A;  3LWF A;  3MAJ A;  2HS5 A;  4ETS A;  3P9C A;  5ILS A;  4CO8 A;  2X4H A;  3QOP A;  3M8F A;  4I09 A;  4G94 A;  2H94 A;  2YR2 A;  3ABT A;  5KK1 A;  4ENK A;  1ON1 A;  3JTH A;  4UV9 A;  3JAM Z;  3FMQ A;  4L5I A;  2IT0 A;  4A5M A;  3HSE A;  1R22 A;  5K5Q A;  4HF2 A;  3V8J A;  3I64 A;  2P6S A;  3TO7 A;  1T0F A;  2KRF A;  4QLC U;  3GZ6 A;  4HX4 A;  1Z91 A;  4NQW A;  1BC7 C;  1SFU A;  3IWZ A;  3R4K A;  3HRS A;  3WTZ A;  1W7P B;  5LLQ A;  5HLI A;  4U0Y A;  1YW9 A;  1AOY A;  4UVB A;  1P92 A;  1YG2 A;  2MD5 A;  4A0X A;  4OMZ A;  2YU3 A;  3TDZ C;  2MBF A;  2H27 A;  3BZ6 A;  1SD5 A;  1MJA A;  2E7X A;  3DP7 A;  2CW0 F;  4LG0 A;  1S6L A;  3WU0 A;  4P55 A;  5E8G A;  5TRD A;  2STT A;  1DUX C;  1OMI A;  1UHM A;  4HAM A;  1BJA A;  1F1Z A;  3E5Q A;  4KMF A;  3QRF F;  5FFZ A;  1K7A A;  1EH6 A;  4RAZ A;  5FGM A;  1OKR A;  2CWE A;  1O7L A;  1JXS A;  2EJR A;  2XVC A;  1RNL A;  2DU9 A;  2ZNY A;  2C6Y A;  3M1E A;  3WTW C;  4UNO A;  5H6R A;  5ERI A;  1F9N A;  1Z6R A;  1XGM A;  1FYM A;  3F3X A;  4KYW A;  2O0Y A;  1OYI A;  4IF4 A;  2OBP A;  2V9V A;  4O6J A;  2KIM A;  1Z7U A;  4EJW A;  4HOB A;  5BPD A;  3TOA A;  1QBJ A;  5D6F A;  1ULY A;  2H09 A;  1D5V A;  3BY6 A;  4ESB A;  3HRT A;  1JHH A;  5E1X A;  5CLS A;  3WGG A;  1IRF A;  2D1V A;  2O03 A;  4G9Y A;  3F23 A;  4PCQ A;  3FM3 A;  4F7Z A;  3KCC A;  2HZT A;  3FHZ A;  3T5X A;  1PP7 U;  3GWZ A;  1IUY A;  1XGN A;  1KQ8 A;  4Q48 A;  3VEP A;  5JVT A;  2IW5 A;  4RB3 C;  2UWM A;  1EH8 A;  1RUN A;  4BHB A;  4WCG A;  4M71 A;  5IT9 K;  4HZF A;  2IA2 A;  1FSE A;  2IA0 A;  1BIB A;  2K86 A;  5E20 A;  4LMY A;  1QNT A;  2EV6 A;  1BM9 A;  2ZBK A;  3RIR A;  3TGN A;  2BBY A;  2VT3 A;  4UUV A;  1W4M A;  5BPI A;  1GXP A;  1B1B A;  3LA2 A;  4ESF A;  4O5V A;  5K5R A;  5DUI A;  1I1G A;  4M9Z A;  4JBA A;  3U9G A;  1DP7 P;  5CVV A;  3O2P E;  1H9T A;  5HS9 A;  1B9N A;  3QPH A;  3BP8 A;  4RGR A;  4BXU A;  2V1U A;  3J81 Z;  2EA4 A;  4IPA A;  3HHG A;  3RKW A;  1UB9 A;  1R1V A;  3HTS B;  5H20 A;  3R61 A;  1R58 A;  3R0A A;  1FLI A;  6PAX A;  2GXB A;  1U78 A;  2D2W A;  2OZU A;  3GEZ A;  4MQV A;  2RVC A;  5EEG A;  5HDK A;  3CUO A;  2ACJ A;  1XB4 A;  2D45 A;  4A0Z A;  1XSV A;  4BHC A;  1WKM A;  4OU0 A;  2E1C A;  3T1B A;  4HV6 A;  1OYY A;  1HW5 A;  5ICG A;  3ERE D;  4AWX B;  3DF8 A;  2P7C B;  3GFJ A;  1YS6 A;  1HXD A;  3KZY A;  1TW2 A;  2XAH A;  1ZG5 A;  1P4A A;  1JHF A;  4CHU A;  4LK1 F;  4MHG A;  3ML6 A;  5AON A;  5DCM B;  1QQI A;  1YQA A;  1IN8 A;  2DK8 A;  1YW7 A;  2PG4 A;  1S29 A;  1ZRD A;  1IXS B;  1NHA A;  3EYY A;  3I59 B;  2HWV A;  1QZY A;  5A2Q Z;  4M9X A;  3KLO A;  4UV8 A;  3HUG A;  4HBL A;  1B6A A;  3RKY A;  2GAU A;  2BYV E;  2ZO4 A;  4L0Y B;  3SZT A;  2HQN A;  3CLO A;  4EV0 A;  1QPM A;  1EH7 A;  4PDK A;  2ESH A;  5ED4 A;  2IPQ X;  3RPQ A;  4GO1 A;  4O3M A;  4XSX F;  5HLH A;  1QO0 D;  1IN7 A;  3LQR A;  2E7W A;  2PJP A;  3GYH X;  3MEX A;  3VOD A;  4ZZL A;  5BQT A;  1LDJ A;  1TNT A;  4EQQ A;  4BNC A;  4LLG F;  2O61 A;  3OOP A;  2HKO A;  2QUF A;  2QM3 A;  4G6Q A;  5DCF A;  1DPR A;  2UXN A;  2EFW A;  3S2W A;  1I6X A;  3MWM A;  1FBQ A;  4WX9 A;  4EJV A;  2J5O A;  2EWN A;  3L7W A;  3LFK A;  1H9G A;  4N9I A;  1DPU A;  4ZZD A;  5LGT A;  2M30 A;  3ISP A;  1Z1D A;  2QYO A;  3I54 A;  4LK0 F;  4B09 A;  2H6C A;  3F22 A;  4ENN A;  2P7V B;  3E5U A;  4Y17 A;  3Q9S A;  3HTU A;  1IN4 A;  1S3J A;  4WWC A;  3VOE A;  3FWE A;  5LEK A;  5J8C A;  2BGC A;  3K0L A;  5FD6 A;  3T8R A;  1UHW A;  1KYZ A;  3TOB A;  5D5V B;  4Q47 A;  5ILU A;  2HTJ A;  2W25 A;  3HRM A;  1W7P D;  4KIC A;  4HDV A;  4E70 A;  3K2Z A;  1BI0 A;  5D8K B;  4L9V A;  2JPC A;  3I58 A;  3BOQ A;  3SHF A;  4ON0 A;  4ENJ A;  3REO A;  1YO5 C;  5E8I A;  3C7J A;  1ZAR A;  4MEX F;  3FXQ A;  1MDM B;  3C18 A;  3H3U A;  4NB5 A;  2F5D A;  4WXH A;  2A6E F;  4P5O A;  2VBX A;  4KMU X;  1SMT A;  3T0Y A;  3D0S A;  1ZLJ A;  4Q5S F;  3N4M A;  3KP2 A;  2GXG A;  3K69 A;  2XKO A;  4OIQ F;  3PQJ A;  1S8N A;  1SD6 A;  3ZMV A;  1FBU A;  4KN4 X;  4AD9 A;  2L54 A;  2XKP A;  5D5U B;  2DTR A;  2A61 A;  4CDG A;  1TW3 A;  5J8F A;  2FBI A;  2Z33 A;  2WWY A;  4LD5 A;  3WTS C;  3IKV A;  2O3F A;  2EFQ A;  3LAP A;  3J80 K;  1TTY A;  2F2E A;  3C1D A;  4FX0 A;  3I59 A;  3K1M A;  3F8M A;  2CYY A;  3DKW A;  2OD5 A;  1BC8 C;  2QBY B;  5E18 F;  2QZ8 A;  2DLL A;  2VOD A;  4OIO F;  2EFP A;  4A2U A;  1WSU A;  5L3D A;  3MQ0 A;  1CGP A;  1YIO A;  4WXC A;  2BEO A;  2OQR A;  3FX3 A;  2L4A A;  3WTV C;  2L3D A;  3IHU A;  1B59 A;  4JQF A;  5IT9 Z;  2VC1 A;  3I0T A;  4H0E A;  3ZMZ A;  3QP5 A;  3M8E A;  2EFO A;  2RC4 A;  1HKQ A;  2GWR A;  4UVC A;  3W6J B;  2FQ3 A;  4OIN F;  3GW2 A;  2Q0O A;  3FMR A;  2KJB A;  1G3S A;  2P4W A;  3HSF A;  2FA5 A;  1J5Y A;  1BOA A;  1DDN A;  4M6Y A;  4Y13 A;  1U5T B;  2EV5 A;  1PDN C;  4G7H F;  4RB2 C;  4L0Z B;  1P4X A;  2HYG D;  3RPU A;  3TKY A;  3ZMU A;  5L3G A;  2L02 A;  1O3Q A;  4AIH A;  5H6Q A;  4YFX F;  1FT9 A;  4KIB A;  2HGC A;  1UFM A;  1BBY A;  2G7U A;  5E1W A;  2FXA A;  3I5U A;  1LQ1 A;  2V1D A;  3LST A;  3WTX C;  1XDS A;  2VXZ A;  3VB2 A;  2QQB A;  3R60 A;  2RDP A;  4HW0 A;  2FMY A;  2QBY A;  4Q4Z F;  2PEX A;  3ZMT A;  4MTD A;  1IXC A;  4KIG A;  2XIG A;  2FBH A;  3SFZ A;  2EFN A;  4MEY F;  3KZZ A;  2EV0 A;  5D6E A;  1SAX A;  2GQQ A;  1ZG3 A;  1RZ4 A;  2RNJ A;  5DEQ A;  4EM0 B;  4PGG A;  1I27 A;  3TDU C;  3WGH A;  3TO9 A;  1REP C;  2YX4 A;  4OIP F;  3F8F A;  2CFX A;  2GA1 A;  2P5K A;  1C0W A;  3V7S A;  5A2Q K;  4G8X A;  4HF0 A;  3DEU A;  4IVN A;  3Q5F A;  1KA8 A;  3JSO A;  3K1P A;  4L9T A;  2XUB A;  4JK1 X;  2QEN A;  2G7H A;  2NRA C;  1R23 A;  5CVR A;  5J6X A;  2FOK A;  1ZHF A;  3JSP A;  1WQ2 A;  1T2K A;  3ABU A;  2LF7 A;  3CUQ C;  4MGR A;  3M7G A;  4U0W A;  2ETH A;  4M6X A;  1P4W A;  2STW A;  2ZME A;  4L9N A;  3CO6 C;  2ZKZ A;  2OZ6 A;  3GUD A;  1LB2 A;  4LLL A;  3V7C A;  4U7B A;  2FEZ A;  1O3R A;  1R1T A;  2RN7 A;  5D5W B;  3FZV A;  3MFK A;  2IJL A;  5DV5 A;  3WU1 B;  1STZ A;  5HVQ C;  2RQP A;  2QWW A;  2B0L A;  2FNA A;  1K6O A;  3NQO A;  5ICC A;  1LEB A;  2JTV A;  4EMS A;  3LA3 A;  3WGI A;  3ZN0 A;  1XN7 A;  3LAJ A;  1SD4 A;  2HTS A;  3DQV C;  2DBB A;  3IRR A;  3BJA A;  3K1N A;  4LFU A;  4IJA A;  4HYE A;  1JE8 A;  2FU4 A;  4M73 A;  4LB6 B;  5FFX A;  4BAY A;  2NNY A;  4I02 A;  4WXD A;  1A04 A;  5EEH A;  3N97 A;  4U88 A;  1WWX A;  3F6O A;  3ZMS A;  3GF2 A;  1D8K A;  1GXQ A;  5L3E A;  3W6K B;  2KJC A;  1G6N A;  1BI3 A;  4FT8 A;  2BE5 F;  2OU2 A;  1ZLK A;  2Z9O A;  4I0B A;  3SZP A;  2JRT A;  4BHP A;  1QGP A;  2HR3 A;  1XD7 A;  5LHH A;  5CVU A;  2M87 A;  2XAQ A;  4A6E A;  4IRH A;  1U3E M;  3DPT A;  3WG9 A;  1T6S A;  5AIQ A;  1YYV A;  3KP3 A;  3HOT A;  5LHI A;  2GA2 A;  2OA4 A;  1R7J A;  1V4R A;  5F1R A;  1F4K A;  4HX7 A;  3RJP A;  3RTR A;  1FP2 A;  2JPB A;  3E6B A;  4I0A A;  4HQE A;  2JT1 A;  4M72 A;  1FOK A;  3J80 Z;  4LG0 B;  2VOP A;  2MC3 A;  2OAZ A;  3QAH A;  3G3Z A;  3IC7 A;  2F5E A;  2VBW A;  4L5J A;  3TQN A;  1LJ9 A;  2K27 A;  5FB2 A;  4KA4 A;  3L00 A;  5L3F A;  2W57 A;  3BPV A;  5CJ9 A;  1B9M A;  4KUM A;  3GXO A;  1YW8 A;  4IRG A;  2VE9 A;  2IA1 A;  2DT5 A;  2Z5U A;  2LNB A;  3ELK A;  4EJU A;  4XSZ F;  3WTY C;  2ZXJ A;  3CUQ A;  2PFB A;  4PGH A;  4YFN F;  3C3W A;  2HYF A;  1XDU A;  2IRF G;  4G7O F;  5TJJ A;  1FBS A;  5AIP A;  1Y0U A;  2ZCW A;  1R00 A;  5HS8 A;  3GFI A;  1L0O C;  1FC3 A;  4QWQ A;  1OYW A;  3BPX A;  2CSO A;  1EV7 A;  1J59 A;  5LGN A;  2ESN A;  3HIF A;  1T38 A;  4OOI A;  2RKH A;  2DQR A;  3G73 A;  3ROU A;  1K78 A;  4GYG A;  2PI0 A;  4FX4 A;  3RI4 A;  1E17 A;  3KLN A;  2XHK A;  1I1S A;  2PQ8 A;  1V3F A;  4ZH4 F;  1FY7 A;  1HW1 A;  5D4S A;  2XRN A;  1OPC A;  4A5N A;  3KFW X;  4UVA A;  1Z05 A;  2ZJ2 A;  1T98 A;  1MGT A;  1G3T A;  2COM A;  4IRI A;  4MQ9 F;  1HBX G;  2CQK A;  1U5T C;  3E97 A;  1B4A A;  2YPR A;  3WOD F;  1D8J A;  5HDG A;  3F6V A;  3T8T A;  3V8K A;  1XGS A;  3GX4 X;  3RYP A;  4UXN A;  1ZRE A;  2HQR A;  3HYI A;  1IAW A;  4HLX A;  2V1X A;  1SFE A;  1LEA A;  3ZP5 A;  3MZY A;  4WF2 A;  4BQA A;  1ZH5 A;  4HF1 A;  2XAS A;  3CUQ B;  4XRF A;  4AIJ A;  1ZRF A;  2O6G E;  3P7N A;  1SFX A;  4CGZ A;  3IKT A;  1Z6T A;  1J7K A;  2J5P A;  1OR7 A;  2OQG A;  3O3K A;  2VBZ A;  1ONV A;  4RB1 A;  4XLP F;  1XSX A;  4L18 B;  3E6D A;  1YTY A;  3I4P A;  4KNY A;  4L9J A;  5BS6 A;  3P9I A;  2XV4 S;  2X0L A;  2F5F A;  4XBF A;  3J7A O;  1K79 A;  3QPT A;  4RGX A; 
#chains in the Genus database with same CATH topology
 1FPQ A;  1QHH D;  3GFM A;  4RGU A;  5LHG A;  1XCV A;  1OFC X;  1IDZ A;  2XGD A;  1P9Q C;  1D1B A;  2XAG A;  2BY2 A;  2HVR A;  5JHU A;  4LB5 A;  1S7A A;  3S15 J;  3E6C C;  4KIF A;  3FF5 A;  2XGX A;  3LNQ A;  3JR9 A;  2MH2 A;  5DD4 A;  2V9P A;  2FUG 2;  1QU3 A;  2M7A A;  2AQF A;  2DOD A;  1IZ1 A;  1BI2 A;  4EM1 A;  1AWC A;  2CUE A;  5F27 A;  4AU7 A;  3L2U A;  3GCM A;  5GAD J;  5LBQ A;  5D4R A;  1HQC A;  1ETV A;  5FKO A;  3TO6 A;  4ENM A;  2DQL A;  4J19 A;  2ZME B;  3R0J A;  2M7B A;  4MTE A;  3UNG C;  3OYF A;  3DLL F;  3AAF A;  1UJ8 A;  3B02 A;  5D5X B;  4XN3 A;  1GV5 A;  4RMN A;  3DPL C;  2F5V A;  1T56 A;  2ZJQ F;  2GIV A;  3B73 A;  5C4J J;  5EGO B;  3L09 A;  4FET A;  2VT2 A;  4ZYE A;  3NRV A;  3BDD A;  4W97 A;  2E71 A;  1W5S A;  3EYI A;  2UXX A;  3OSF A;  2CV0 A;  2E2I J;  3BWG A;  3VPR A;  2KIU A;  1K78 B;  4D0P A;  1KU7 A;  3MN2 A;  3OL3 A;  2K4B A;  2O5R A;  2ZNZ A;  1TLH B;  2ZB9 A;  3I9V 2;  5JI6 A;  2FNP A;  3FXU A;  1HCR A;  3BRO A;  2L7K A;  2MG4 A;  2P8T A;  2MH9 A;  3CF5 F;  2K3P A;  3D5R C;  2X51 A;  2PN6 A;  2VBY A;  1TQP A;  4I7H A;  1Y56 A;  2LSO A;  5DCM A;  4IHY A;  3F8N A;  4OIR F;  1E2X A;  2MD0 A;  2O8K A;  4F55 A;  3K10 A;  5DD8 A;  4GXO A;  1IXR C;  1XMA A;  2EZI A;  1R36 A;  2HDD A;  2XGC A;  2RGV A;  2W24 A;  5FLM J;  2LKX A;  2DMU A;  2KLO A;  5FLX Z;  3KET A;  3CCV I;  1LKX A;  1WRJ A;  3LSK A;  4I98 B;  3RKX A;  2A07 F;  1VND A;  3V7R A;  3HC7 A;  4EJT A;  1LDD A;  2WAE A;  2R7D A;  2W4S A;  2R7F A;  3PNV A;  2FML A;  1QVT A;  3GTM J;  2H6B A;  2FE3 A;  1U6G A;  3CZ6 A;  1Y1W J;  2K3F A;  3S1M J;  3MD2 A;  2XRO A;  3BJ6 A;  5B1B H;  3F0C A;  3H92 A;  5DDG A;  2XAU A;  4UUS A;  1JUS A;  5LRS A;  2Q8K A;  2GZW A;  4Y3O A;  4LLN A;  2HEO A;  1ZGA A;  2XGE A;  2M8G X;  1IRG A;  3F21 A;  3KEO A;  3KE2 A;  3TW7 A;  1ZQ3 P;  2R7W A;  5GPA A;  4OMY A;  5EYR A;  1I3A A;  4RB0 A;  3N05 A;  3F72 A;  4A12 A;  4ESJ A;  1F5T A;  2MC4 A;  1UST A;  5DUK A;  1MZB A;  3ZQF A;  3CTA A;  4D5F A;  3RZD J;  4BH9 A;  3DBH B;  3HJE A;  3MKW B;  2ADU A;  5B3S H;  4LIT A;  1MMD A;  4ZC3 A;  2VKE A;  2KKO A;  2GBY A;  1T39 A;  1G3Y A;  4KN7 X;  1ZGJ A;  2HQA A;  1SD7 A;  3I71 A;  1TT0 A;  1NH3 A;  3R6S A;  4G7Z F;  2M5W A;  4IXA A;  4CUG A;  5B1A H;  3OMY A;  3IP4 B;  5FD5 A;  3ZOB A;  4ASN A;  1IRZ A;  2MLG A;  4HA8 A;  4R79 A;  2A68 F;  2ELH A;  2DAO A;  3K4N A;  4NQW B;  2CG4 A;  4E7J A;  4WK8 F;  4Y15 A;  1H8A C;  1R9T J;  4E7L A;  2CW7 A;  3RYR A;  4CYC A;  2DT7 B;  3DKY A;  1NK2 P;  1VQN I;  3OWT A;  2JSC A;  4Z2Y A;  4G6D A;  4YIF A;  3EUH A;  1YJW I;  2YSR A;  3ZQ7 A;  5IPA A;  2R92 J;  1ZRC A;  4AVP A;  3GVA A;  1XS9 A;  3OYK A;  2HDC A;  4I2O A;  1J9I A;  3Q0W A;  2L5Q A;  2O8X A;  3PL8 A;  3CF2 A;  5JVG F;  2DK5 A;  4HV5 A;  4S04 A;  1S5L C;  4I99 C;  3WE2 A;  2EK5 A;  1Y1V J;  3ECO A;  2VJ5 A;  1Z21 A;  1UHS A;  4IHT A;  2I8D A;  4ZYD A;  4YFK F;  2DFI A;  4TV7 A;  4J01 A;  4AIK A;  2AS5 F;  1SFK A;  2VL8 A;  5M5W J;  1FOY A;  1JKO C;  3OYD A;  4HDU A;  4DNC A;  3KX2 A;  2K9N A;  3GTO J;  5K1Y A;  3JRG A;  1MJ9 A;  4BBR J;  4HX8 A;  3LA7 A;  3W3C A;  3F8C A;  5HS7 A;  4CXF A;  1FYL A;  1EJ9 A;  2QVO A;  2Z3Y A;  4LJZ F;  3EPZ A;  2Y75 A;  3GTK J;  4R8H A;  2UZK A;  3CMA I;  1RES A;  2JZY A;  5HLT A;  2F5C A;  3CJQ B;  1X3U A;  4II2 A;  4RDU A;  3GO5 A;  5L3B A;  2EB7 A;  1E3P A;  2QCO A;  5BMZ A;  1MMG A;  2A05 A;  3C2G A;  4M6V A;  1XMK A;  3RZO J;  2CQN A;  2ZFW A;  1ZAO A;  3JRA A;  3OYN A;  3ZR8 X;  3HOX J;  2DMT A;  4EM2 A;  3H9J A;  3E3V A;  3BJO A;  4YII A;  3CLQ A;  2A69 F;  4XLF A;  3CO7 C;  2DT6 A;  4IOA F;  2X48 A;  3M3Y J;  2L7F P;  2AXT C;  4N9H A;  2Y0M A;  1SMY F;  1KGS A;  1MMA A;  5EGO A;  4BBS J;  1JGS A;  3A0H C;  3KIO A;  2QLZ A;  3SXY A;  4YRV A;  3DCF A;  2VIX A;  1MKM A;  2JK3 A;  2X85 A;  3BQZ A;  2WV1 A;  3DFG A;  3A1Y A;  2KHM A;  1IN5 A;  3PQK A;  3M8J A;  4EVI A;  2R7T A;  2XAJ A;  1IV8 A;  4I01 A;  4CIC A;  1ERD A;  3X2Q H;  1BN5 A;  2Y48 A;  1BI1 A;  2RV8 A;  4P9F A;  5JFR A;  5K5O A;  2ELJ A;  1WJB A;  4DJA A;  4E7K A;  3DWL E;  5CQG A;  4IO9 F;  3L2V A;  3RDI A;  3CCQ I;  1Z7L A;  4UHT A;  4DYQ A;  2DMP A;  2MLK A;  4XQF A;  1W5T A;  4HPQ A;  3ZMD A;  3P9K A;  2DI3 A;  1RIO H;  4KDP A;  2XSJ C;  4LIU A;  2W7N A;  4RGS A;  2R3S A;  4K2E A;  3E5X A;  3M9A A;  3JTG A;  2P5L C;  3FBI B;  3H3Z A;  1VQM I;  2NYX A;  3ESW B;  2M45 A;  2Z99 A;  1YS7 A;  1L3L A;  2VOO A;  3S2H J;  2G9W A;  2I10 A;  4FE4 A;  2XF6 A;  3F8B A;  2PBI A;  4F3Q A;  5H2F C;  3V4G A;  3K70 D;  4XMY A;  2M4K A;  1IF1 A;  4V19 K;  1PUE E;  3H5R A;  1FSH A;  5GP9 A;  2IVM A;  1TWA J;  3WTT C;  1A6I A;  3ABK H;  1IW7 F;  2FD5 A;  3M4O J;  5GAG J;  4M9S A;  2K4J A;  1R5H A;  1Z77 A;  1X4P A;  3HPG A;  5IT3 A;  3ZXS A;  4EGZ A;  4HLY A;  3HUG B;  3BR5 A;  1KYW A;  4E7S A;  4XKB A;  1FWZ A;  3QU6 A;  3KP5 A;  3SZG A;  3KP4 A;  4R1H A;  1WI9 A;  3SQN A;  2EZL A;  1U5T A;  2OC6 A;  5K7H A;  2IS1 A;  4FCY A;  3GFL A;  2UV1 A;  1J75 A;  2ISY A;  3K4M A;  1GDT A;  1FP1 D;  2DYR H;  3I53 A;  1U9O A;  2CO5 A;  3K9T A;  1IN6 A;  2F4O B;  3ZQG A;  4U7D A;  5K7F A;  2DDA A;  3OL4 A;  1FTZ A;  1FTT A;  2M0C A;  4M3F A;  1FMW A;  3K2A A;  2YU9 J;  3H1C A;  2Y69 H;  1O57 A;  3CCM I;  2K40 A;  1Q1H A;  3FXR A;  3JAM K;  4A3K J;  4RA2 A;  2WTE A;  1QZZ A;  2KMU A;  1H0M A;  1LPQ A;  4P96 A;  4EJO A;  3COA C;  2DPU A;  1TBX A;  2EA2 A;  4F92 B;  3VWB A;  1KU3 A;  2IP2 A;  3E1S A;  4HQM A;  1YFH A;  2Q2E A;  3U1K A;  2PMU A;  5LFA A;  2WB1 N;  1LNW A;  3VFZ A;  2V6C A;  3O6B B;  2CU7 A;  1XGO A;  2ID3 A;  4DBR A;  3L9F A;  2KQR A;  4BYY A;  2FSW A;  2A5Y B;  1D0Z A;  1YE9 A;  4BS9 A;  3DTI A;  2W00 A;  2A3S A;  1VFC A;  4B8X A;  1MBH A;  5F0F A;  1FX7 A;  1MW7 A;  5LGU A;  1BA5 A;  3DV8 A;  2DPD A;  5JR3 A;  1FMV A;  3UKG A;  3ZPL A;  3A02 A;  3J81 K;  1D3Y A;  2YX7 A;  4FIS A;  5D8L B;  2AHQ A;  2BHZ A;  4GCV A;  2XPU A;  1RI7 A;  3HOS A;  1N75 A;  1W7P A;  2ZSI B;  4QPO A;  1HW2 A;  2WC2 A;  1MBE A;  4AM3 A;  2WY7 Q;  1FZP B;  1FNN A;  2EBI A;  1ETO A;  1PYV A;  3PO3 J;  2CGP A;  3DU5 A;  3G71 I;  1MD0 A;  2MFZ A;  4OAY A;  4DQ2 A;  2VON A;  3FIS A;  1FYK A;  1RET A;  4M3E A;  1TNS A;  2HFH A;  2PLY A;  1O7F A;  3OOU A;  5LRR A;  2MA3 A;  1YLF A;  3HOY J;  2CUF A;  1VQP I;  5FO5 A;  5CPR B;  1KU2 A;  1P6R A;  1IJW C;  1RKT A;  3BG3 A;  5LEJ A;  1GVD A;  2KRH A;  1R49 A;  3C2H A;  3M1C A;  3PNT A;  1KQ0 A;  2LKP A;  3NWS A;  2A6T A;  2L4M A;  1USS A;  4QPQ A;  2WV0 A;  2FRH A;  5FKN A;  1XSD A;  4A0Y A;  3CJN A;  2W84 A;  1KON A;  4N0B A;  3OYE A;  5EG0 B;  1O3S A;  3AG4 H;  4C30 A;  2W85 A;  2EH3 A;  2E1N A;  2KIS A;  4X0G A;  3QP6 A;  3CDH A;  4KIS A;  3GLX A;  3JW4 A;  3H3V K;  2KIF A;  4LGW A;  4BEH B;  1J2X A;  2M1B A;  5ICF A;  3V8L A;  4CZZ A;  4HNV A;  4GRI A;  1LVA A;  5DS9 A;  2IGO A;  3Q9V A;  2D1H A;  3FMS A;  2PMH A;  4MNU A;  3U1D A;  3S3M A;  3MCZ A;  2HOS A;  2XAF A;  4RAY A;  2HOE A;  2M8E A;  2LDU A;  5HOO A;  2KFD A;  1JT6 A;  3I55 I;  1CF7 A;  3OYJ A;  4KFC A;  3DBR B;  2HVQ A;  3FIW A;  5ILV A;  1KQ9 A;  2VQL A;  3DKX A;  3GZ5 A;  4G12 A;  2V79 A;  3WE3 A;  1U8R A;  3CP8 A;  2QEX I;  2JQ7 A;  4HG2 A;  2QQ9 A;  3KPH A;  5F6F A;  2LBF B;  5FLX K;  2VKH A;  3D5L A;  2NVQ J;  2ECB A;  1MDM A;  2LF8 A;  4H4K C;  1JI8 A;  3BTI A;  3H5N A;  1R5G A;  3ECH A;  1MJB A;  2BV6 A;  1HKT A;  1HST A;  2EIJ H;  3Q0U A;  3KEQ A;  4E7H A;  2CUZ A;  3HHH A;  2TDX A;  2EPF A;  1WJD A;  3G1O A;  4II3 A;  2K7L A;  3SFI A;  1HKS A;  4GYI A;  2JMW A;  1XCB A;  5LD2 C;  2Y30 A;  5E1Z B;  2P5V A;  2Q2E B;  2WAF A;  3MVP A;  4FHT A;  2DA4 A;  2JVG A;  5M5X J;  1ZN2 A;  2H8W A;  4YG2 F;  3IWF A;  4NHJ A;  1ODD A;  1XPX A;  1W0U A;  1SFO J;  2K02 A;  2NAZ A;  2ISZ A;  2FF4 A;  2LOO A;  3IH4 A;  3KP6 A;  1GHC A;  5TIS C;  1ITY A;  3MZH A;  4EGY A;  1MND A;  3DXJ F;  5CYV A;  3JRE A;  4E7Z A;  1ETK A;  2AQE A;  2OF7 A;  1KU9 A;  2VB6 A;  2KPM A;  3PFI A;  4KT5 C;  3IRQ A;  2PX9 A;  3LQQ A;  3S1N J;  3OV8 A;  3FM5 A;  2NS8 A;  4U87 A;  4A3F J;  5KVR A;  2VC0 A;  1JKR C;  1ZYR F;  1R1U A;  2QSH X;  1Z9C A;  1YX3 A;  1XG1 A;  1LDK B;  1RUO A;  4M74 A;  3HRU A;  2LK2 A;  1X1P A;  2F48 A;  4XOR A;  1S72 I;  2BVM A;  3K4K A;  3J7Y J;  3WTU C;  5TGT A;  4IHS A;  3J7Z I;  1I6H J;  5CVI A;  4P9U A;  1BR1 A;  2NNN A;  1PP8 F;  2VE8 A;  1UCR A;  4RS8 A;  3QU3 A;  5HDN A;  2IGK A;  5HLG A;  2X1D A;  3NEU A;  4GGG A;  5IYC J;  1EA3 A;  3ULQ B;  4CCO A;  1FOX A;  1WHU A;  3L2C A;  4F52 A;  5E17 F;  3AG3 H;  2QF7 A;  3LSR A;  3EET A;  4ZYG A;  2WB1 A;  2ZME C;  3RCO A;  3E7L A;  5EDN A;  4IEJ A;  1T95 A;  1U2W A;  2XPV A;  3TP3 A;  4HNT A;  4D9J A;  3U2R A;  5KNL A;  1OCT C;  3EQL F;  1GT0 C;  4A3L J;  3CCL I;  1TWC J;  2QSG X;  3TP0 A;  5L3C A;  1ZG1 A;  3OIO A;  5DYM A;  1J0R A;  1TQI A;  1VZ0 A;  3VYR B;  1TZL A;  3HL2 A;  3S8P A;  1ZKG A;  2NS0 A;  1VTN C;  3RQ4 A;  2P6T A;  1ON2 A;  3RPU D;  2L01 A;  4XLN F;  1F36 A;  4S05 A;  5F04 A;  3IL2 A;  1OQY A;  2HZD A;  3OS2 A;  2NVU B;  2HKX A;  2QKL B;  2GIZ A;  1HSJ A;  4CYD A;  5F64 A;  3JRH A;  1SAN A;  4U0V A;  5IY5 H;  2VJJ A;  4PFP A;  5ICE A;  5IOZ A;  1BR4 A;  2A6H F;  3GZN B;  3CES A;  2IS6 A;  2DO7 A;  2KDZ A;  4PZJ A;  1G4D A;  1GLN A;  1G3W A;  3EDP A;  1X2M A;  2DOF A;  5C3E J;  1CF7 B;  3S17 J;  2AXL A;  1I5Z A;  2E5Z A;  5BOX A;  5IYD J;  2QQA A;  4NC8 A;  1TQM A;  3KP7 A;  3LSP A;  2E36 A;  1V5E A;  1O3T A;  1P2F A;  2ZJR F;  2VKV A;  2LY9 A;  1S7O A;  1I3Q J;  5CVJ A;  2DW4 A;  1BIA A;  2IS2 A;  2DXI A;  4ZYH A;  3BC8 A;  3E6M A;  4LOC A;  3ZN1 A;  2DYS H;  2ID6 A;  4CCM A;  1OJL A;  2EZH A;  3HSR A;  3I4N J;  2BY1 A;  1GVJ A;  3ZCO A;  3A0B C;  2VN2 A;  2FBK A;  4ZDO A;  4A6D A;  3LWF A;  3CMY A;  2B7E A;  4CYC B;  5IP6 A;  3MAJ A;  5EG0 A;  2DA7 A;  2HS5 A;  4ETS A;  1QRY A;  3P9C A;  3O8H A;  5ILS A;  4CO8 A;  1A31 A;  2X4H A;  3QOP A;  3M8F A;  3VYT B;  4I09 A;  5EZH A;  5M5Y J;  4G94 A;  5M3F J;  2H94 A;  2YR2 A;  1XTA A;  3ABT A;  5KK1 A;  5FKM A;  4ENK A;  2H1K A;  1LFB A;  1ON1 A;  2X6X A;  3JTH A;  3HM5 A;  4UV9 A;  1D1C A;  3JAM Z;  3PNY A;  3S1Q J;  3FMQ A;  2L9R A;  3HEF A;  4L5I A;  2R7S A;  4KIT B;  2M4G A;  1BW5 A;  3AKZ A;  2IT0 A;  3V42 A;  2X9D A;  3E0J B;  4A5M A;  3OYA A;  3HSE A;  3BG6 A;  1MBF A;  5KAI C;  4NC7 A;  3CCY A;  1R22 A;  5JLW A;  2VLA A;  4XKW A;  5K5Q A;  4HF2 A;  2DOE A;  2Y2Z A;  3BR3 A;  3V8J A;  1RKW A;  3I64 A;  3CC7 I;  2P6S A;  3TO7 A;  1WFX A;  1V55 H;  1T0F A;  2DA1 A;  2KRF A;  4XKV A;  4RAG A;  4QLC U;  4HX4 A;  3GZ6 A;  1OCC H;  1NG7 A;  1Z91 A;  2NXN B;  3C2B A;  4NQW A;  1IV6 A;  4N4N B;  1V54 H;  1BC7 C;  1SFU A;  3IWZ A;  1R71 A;  1ZTR A;  3R4K A;  1FIP A;  2R7V A;  3HRS A;  3HBL A;  3WTZ A;  1W7P B;  5LLQ A;  5HLI A;  4U0Y A;  1YW9 A;  5GAE J;  3QYB A;  4FTH A;  1AOY A;  4UVB A;  1P92 A;  1YG2 A;  2O7O A;  1VQ4 I;  2MD5 A;  3BZC A;  4A0X A;  1OCZ H;  4OMZ A;  2YU3 A;  3BQY A;  1NG6 A;  3TDZ C;  2HOT A;  1OLT A;  4BEH A;  2MBF A;  2NVY J;  3I56 I;  2H27 A;  1X3Z B;  1MH4 A;  3BR0 A;  4MO7 A;  3BZ6 A;  4XNF A;  1TT5 B;  3L2W A;  1SD5 A;  1MJA A;  2L9V A;  2E7X A;  3DP7 A;  4UUS B;  2CW0 F;  4LG0 A;  2P81 A;  1O4X A;  2ZJP F;  3RQI A;  3LFU A;  3HKZ A;  4UB8 C;  3LOC A;  1P7I A;  1S6L A;  1K6Y A;  3WU0 A;  2LYC A;  4XID A;  4P55 A;  5E8G A;  5TRD A;  2QGU A;  4IL6 C;  2STT A;  2KIQ A;  1DUX C;  3S14 J;  3OYM A;  4C9Y A;  1IDY A;  4I6Z A;  1JKQ C;  1OMI A;  1UHM A;  4HAM A;  3CCS I;  1BJA A;  5IP9 J;  1XMX A;  1F1Z A;  4A3D J;  3OS0 A;  3E5Q A;  1NTC A;  2R7X A;  4KMF A;  3QRF F;  5FFZ A;  4C2M J;  2MYS A;  2BVL A;  4J00 A;  1MIJ A;  2DCE A;  1K7A A;  1EH6 A;  4RAZ A;  5FGM A;  4ZDP A;  1OKR A;  2CWE A;  2KDO A;  3DBL B;  1O7L A;  1JXS A;  2EJR A;  2XVC A;  1V5F A;  1RNL A;  4DIQ A;  5KHD A;  2DU9 A;  3AL0 C;  2EIN H;  2ZNY A;  2C6Y A;  2JA7 J;  4F93 B;  2ECC A;  3M1E A;  3FXO A;  1EKE A;  5E3N A;  1MNM C;  3WTW C;  4UNO A;  5H6R A;  4OWR B;  5ERI A;  1F9N A;  4PSX A;  3BG9 A;  4AVZ A;  3ASN H;  1Z6R A;  4A3I J;  4JX5 A;  1XGM A;  1FYM A;  3F3X A;  2HVS A;  1LFP A;  5M3M J;  4KYW A;  2O0Y A;  1OYI A;  4IF4 A;  3HOW J;  4MFD A;  1OCR H;  2HXI A;  4B43 A;  1MBG A;  2OBP A;  2V9V A;  2Y0S A;  4O6J A;  2EIK H;  4BQO A;  4NC6 A;  2KIM A;  1Z7U A;  5FRO A;  5GTH C;  2FX0 A;  4BQN A;  2PJR A;  4EJW A;  3VYU B;  3A01 A;  4HOB A;  5BPD A;  3TOA A;  2KL4 A;  2TCT A;  1QBJ A;  1T33 A;  5D6F A;  4CCN A;  1ULY A;  2JA5 J;  5CQE A;  2H09 A;  1S9H A;  3MKZ A;  2WAQ N;  2DFF A;  1D5V A;  1WGX A;  3BY6 A;  2DA2 A;  4P1W A;  3HRT A;  1JHH A;  5E1X A;  5CLS A;  2JSP A;  4BY7 J;  3TW6 A;  3WGG A;  1IRF A;  3SJM A;  1Y8Q B;  4BE0 A;  2CV2 A;  2KZV A;  2K9L A;  1AU7 A;  2D1V A;  2O03 A;  4G9Y A;  3F23 A;  3CDL A;  4BDY A;  4PCQ A;  3FM3 A;  5E3M A;  1ORK A;  4F7Z A;  3HKZ N;  3KCC A;  2HZT A;  2PMZ N;  2W1O A;  3FHZ A;  1R6R A;  3T5X A;  4XLH A;  1PP7 U;  4EEF G;  3GWZ A;  3TMO A;  3D5S C;  3IAS 2;  1IUY A;  1XGN A;  1Z3Y A;  5J1Y A;  1KQ8 A;  4I76 A;  4Q48 A;  2L9N A;  3VEP A;  5JVT A;  2Y31 A;  2IW5 A;  4RB3 C;  2UWM A;  2HPM A;  1WZ2 A;  1EH8 A;  5DTD A;  1PVE A;  1RUN A;  4XLC A;  4FE7 A;  4BHB A;  4WCG A;  5FJ8 J;  2LBF A;  5F1J A;  4M71 A;  5IT9 K;  2LRE A;  2ZC2 A;  4HZF A;  1VQO I;  2IA2 A;  3MMY B;  1FSE A;  2IA0 A;  2VQH A;  3MZ8 A;  1BIB A;  4FAS D;  2OJE D;  1MMN A;  3JRB A;  1A35 A;  2K86 A;  3EUA A;  5E20 A;  4LMY A;  1QNT A;  3CD6 I;  2EV6 A;  1BM9 A;  2ZBK A;  3ZQQ A;  3RIR A;  3TGN A;  3HGY A;  1Y8R B;  2DOA A;  2BBY A;  1NK3 P;  2VT3 A;  2LP0 A;  4UUV A;  1W4M A;  3AFH A;  2CRG A;  1M1E B;  2BXY A;  4G6T B;  5BPI A;  1GXP A;  1B1B A;  3LA2 A;  4ESF A;  4O5V A;  5K5R A;  5DUI A;  1I1G A;  2EIM H;  4M9Z A;  3ONQ A;  4C3J J;  4DW6 A;  1HOM A;  2NVX J;  1HF0 A;  1JUM A;  1OR7 C;  4JBA A;  2D5V A;  2GM4 A;  4AYB N;  2WY8 Q;  3U9G A;  3H0D A;  1DP7 P;  1QHG A;  4L5E A;  5CVV A;  3O2P E;  4DBQ A;  2JUG A;  3WHB A;  4E6K G;  1H9T A;  2XDV A;  1OIS A;  5HS9 A;  1B9N A;  3QPH A;  2WAD A;  3BP8 A;  4RGR A;  4ESB A;  4BXU A;  4XN0 A;  2V1U A;  2RAE A;  2Y9Y A;  3FK7 A;  3K4B A;  2EA4 A;  3J81 Z;  3PJR A;  4IPA A;  2JA6 J;  3HHG A;  3RKW A;  1UB9 A;  1R1V A;  4DGW B;  3HTS B;  1D1A A;  5H20 A;  4ABZ A;  5HOD A;  2E2H J;  1D0X A;  3R61 A;  1JUP A;  1R58 A;  3R0A A;  1FLI A;  6PAX A;  2OPT A;  2GXB A;  2IAI A;  1U78 A;  3IH2 A;  2D2W A;  2OZU A;  3GEZ A;  4JYK A;  4B4C A;  4MQV A;  2RVC A;  5EEG A;  5HDK A;  3CUO A;  2ACJ A;  3IV5 A;  1XB4 A;  3A03 A;  4MLO A;  2D45 A;  4A0Z A;  1XSV A;  2XB5 A;  4BHC A;  1WKM A;  4OU0 A;  2E1C A;  3BT9 A;  3T1B A;  3JRI A;  2LMD A;  4HV6 A;  4BJ6 C;  4GDF A;  4E7I A;  1OYY A;  1HW5 A;  1PUF B;  4C2T A;  1Y6I A;  5ICG A;  4AWX B;  3ERE D;  3DF8 A;  4BU2 A;  2P7C B;  2W82 A;  3GFJ A;  1YS6 A;  1HXD A;  3KZY A;  4BJT A;  2DMN A;  3G4S I;  1TW2 A;  5E3L A;  2XAH A;  1ZG5 A;  2V1N A;  1P4A A;  1JHF A;  4CHU A;  4LK1 F;  4XOP A;  4MHG A;  3ML6 A;  3W2V A;  3HOU J;  2H1L A;  5AON A;  5DCM B;  3VSK A;  1QQI A;  1YQA A;  1VQ6 I;  4HNU A;  4N4O B;  1IN8 A;  2B63 J;  2DK8 A;  4HRI A;  1VQ8 I;  1YW7 A;  2PG4 A;  1S29 A;  5K7Z A;  4PSW A;  2E1M B;  4IHV A;  1ZRD A;  1IXS B;  1NHA A;  3EYY A;  1X3W B;  2L0K A;  3I59 B;  2HWV A;  1QZY A;  5A2Q Z;  4M9X A;  3KLO A;  4MIM A;  1SVL A;  2VI6 A;  3H0G J;  4UV8 A;  2OCC H;  3KEY A;  4B3X A;  3HUG A;  2WA0 A;  4HBL A;  1B6A A;  1N77 A;  4NUB A;  3RKY A;  2GAU A;  2E60 A;  2BYV E;  2JN6 A;  2Z16 A;  2ZO4 A;  4L0Y B;  3SZT A;  3CP2 A;  3L1P A;  3FXJ A;  2R93 J;  2HQN A;  2QQ8 A;  4AC0 A;  5F0H A;  3CLO A;  4EV0 A;  1QPM A;  3ERM A;  1EH7 A;  4PDK A;  2ESH A;  2HXO A;  3FK6 A;  2IGN A;  1QZE A;  3SYT A;  4B1R A;  5ED4 A;  1A5J A;  2IPQ X;  4X6A J;  1J09 A;  3RPQ A;  2L7Z A;  1WJE A;  5C44 J;  1TWG J;  5DM6 F;  4GO1 A;  5IYB J;  1Z67 A;  4O3M A;  3G1M A;  5FKK A;  4XSX F;  5GAH J;  5HLH A;  1QO0 D;  1IN7 A;  3LQR A;  2E7W A;  2PJP A;  2LLK A;  3GYH X;  4C2U A;  3MEX A;  3VOD A;  2XC7 A;  4ZZL A;  1WJF A;  4CZC A;  1DU0 A;  5BQT A;  1SVM A;  1E0E A;  1LDJ A;  1TNT A;  2OCE A;  2VJI A;  4HEA 2;  3CCE I;  4EQQ A;  2H8R A;  5J47 A;  3OR1 C;  3H5A A;  4BNC A;  4A3E J;  4LLG F;  3LSJ A;  2O61 A;  2DFH A;  3OOP A;  4C3H J;  1B8I B;  4BQQ A;  2HKO A;  4IKF A;  2QUF A;  2QM3 A;  4G6Q A;  4CH7 A;  5DCF A;  1DPR A;  2UXN A;  2DTZ A;  2N8G A;  3A4C A;  4RM3 A;  2EFW A;  3S2W A;  1E3O C;  1I6X A;  3MWM A;  2CUJ A;  3HGG A;  1FBQ A;  4Y7N J;  4WX9 A;  3A01 B;  3LSI A;  4EJV A;  2J5O A;  2EWN A;  3L7W A;  1RRJ A;  3JRD A;  3MKL A;  1AA7 A;  3LFK A;  1H9G A;  4N9I A;  1DPU A;  3H9G A;  4ZZD A;  4KJZ A;  2I5U A;  5LGT A;  3FXL A;  2M30 A;  2K9M A;  2X1C A;  3ISP A;  3EUK L;  4YEJ A;  2BY3 A;  1Z1D A;  1HDD C;  4BXX J;  2QYO A;  2BY0 A;  3I54 A;  4D7M A;  3ZQL A;  4LK0 F;  2BOL A;  3QYF A;  4B09 A;  4E4H A;  2H6C A;  3F22 A;  4ENN A;  2P7V B;  3E5U A;  4Y17 A;  2DDB A;  3Q9S A;  3HTU A;  4PJN A;  1IN4 A;  2ICW G;  5FKL A;  3AL0 B;  2EZK A;  4XLE A;  1S3J A;  5F0C A;  4WWC A;  4IQ4 A;  3KYL A;  4CA0 A;  3VOE A;  3FWE A;  1W36 D;  5LEK A;  1SAU A;  1DQU A;  4B48 A;  3ZQH A;  4A3G J;  5J8C A;  2BGC A;  2KRC A;  3K0L A;  5FD6 A;  3T8R A;  3TL4 X;  1UHW A;  4IX7 A;  2L7M P;  5J4Y A;  1KYZ A;  4B3A A;  2YS9 A;  3TOB A;  2O9L A;  3WG7 H;  5D5V B;  4Q47 A;  5ILU A;  2HTJ A;  3PIO F;  2W25 A;  2BW3 B;  2M2E A;  4DYR A;  3HRM A;  4BAC A;  1W7P D;  1AKH B;  3GTG J;  3BCB A;  4PJJ A;  1G2H A;  1X58 A;  4KIC A;  1YIJ I;  4HDV A;  4JOM A;  2VXD A;  4E70 A;  3K2Z A;  2F6C A;  5E79 C;  1BI0 A;  5D8K B;  4L9V A;  2JPC A;  1UG2 A;  4XK4 A;  3I58 A;  3BOQ A;  3SHF A;  3BTJ A;  4ON0 A;  4ENJ A;  3REO A;  4PUS A;  3NAU A;  1Y39 A;  1X19 A;  1YO5 C;  5E8I A;  2Y9Z A;  3C7J A;  1WCM J;  3PSI A;  2IXS A;  1B72 B;  1ZAR A;  4EAT A;  5HNH A;  2HQ5 A;  3BR1 A;  4MEX F;  1ETX A;  3CJT B;  3FXQ A;  1MDM B;  1QVU A;  3C18 A;  1X1B A;  3HOZ J;  3NWT A;  2VPR A;  1YRN B;  3H3U A;  1OCP A;  3CMM A;  4RM2 A;  4NB5 A;  3OYB A;  2F5D A;  4WXH A;  2A6E F;  4Y52 J;  4P5O A;  2VBX A;  4KMU X;  4IHW A;  1SMT A;  3T0Y A;  3D0S A;  3QPL A;  1U9N A;  2UUZ A;  1ZLJ A;  4Q5S F;  1RC9 A;  3N4M A;  2XSD C;  3KP2 A;  2GXG A;  1U0J A;  3ABL H;  4Y33 A;  4UY8 I;  4ZDL A;  2PMZ A;  2F4I A;  3K69 A;  3TBI A;  5JHF A;  1F43 A;  4JX4 A;  2XKO A;  2EQR A;  2R0Q C;  4OIQ F;  3PQJ A;  1S8N A;  5EEA A;  1UEL B;  2JJ7 A;  2VKD A;  1SD6 A;  4Y4R A;  3ZMV A;  4NNJ A;  1FBU A;  3K6G A;  2LY2 A;  2K9Q A;  4KN4 X;  4AD9 A;  1YIT I;  3O8G A;  1JGG A;  2L54 A;  3ASO H;  2A5W A;  2XKP A;  2JA2 A;  1LFU P;  3H9Q A;  5D5U B;  3QOD A;  2DTR A;  2A61 A;  4JP0 A;  1VF9 A;  1K83 J;  4CDG A;  1TW3 A;  1MBJ A;  4DOZ A;  5J8F A;  3BTL A;  1ENH A;  2FBI A;  2Z33 A;  3VSL A;  3K70 C;  2LY1 A;  2X6W A;  3FXK A;  1JKP C;  3OYI A;  2WWY A;  2E1O A;  1PUF A;  4LD5 A;  3WTS C;  3IKV A;  5FLV A;  2XPW A;  2ZXH A;  2O3F A;  5J4V A;  4ZTJ A;  2EFQ A;  3PM1 A;  4YIR X;  1YI2 I;  2LVS A;  1HA8 A;  1N78 A;  1IC8 A;  2DA6 A;  5IOY A;  3LAP A;  3PIP F;  3J80 K;  1TTY A;  2F2E A;  3C1D A;  1DGR M;  3IAM 2;  4FX0 A;  3DEE A;  1UAA A;  3I59 A;  3K1M A;  3OIQ A;  2X6O A;  3F8M A;  2CYY A;  1POG A;  3DKW A;  2OD5 A;  1BC8 C;  2V26 A;  2CMP A;  4IQJ A;  2FOW A;  2DN0 A;  4C3I J;  3QWL A;  4XOT A;  2IGM A;  2CS3 A;  2QBY B;  4LIV A;  5E18 F;  2Z2S B;  2QZ8 A;  2DLL A;  2V9K A;  1ZGW A;  1VQK I;  3PUF A;  1S7E A;  2VOD A;  1G8X A;  3OYG A;  4OIO F;  2EFP A;  2W48 A;  4XR6 A;  3W2W A;  4ITV A;  4A2U A;  3CC2 I;  1W0T A;  3GTL J;  1WSU A;  5L3D A;  3MQ0 A;  1W1W E;  1QA6 A;  2XRL A;  3W6V A;  1CGP A;  1N25 A;  4BGD A;  1BJZ A;  1YIO A;  2BEO A;  2E35 A;  4WXC A;  2OQR A;  1VQ5 I;  3BG5 A;  2ZSH B;  3LL7 A;  4PK4 A;  1YRN A;  3FX3 A;  2OUM A;  4M3G A;  4MFE A;  4PJ0 C;  2L4A A;  3WTV C;  2L3D A;  3Q3S A;  3IHU A;  1B59 A;  4JQF A;  5IT9 Z;  1B72 A;  4RAF A;  2K5C A;  2MGQ A;  2VC1 A;  3BCA A;  3I0T A;  1X1A A;  3L2Q A;  3L2R A;  1FIA A;  1VI0 A;  4H0E A;  3GLL A;  4D7N A;  4XM3 A;  3ZMZ A;  3QP5 A;  3M8E A;  2EFO A;  2RC4 A;  1YOV B;  1HKQ A;  2GWR A;  4AYB A;  2M34 A;  4DZJ A;  2BZT A;  4UVC A;  2GOM A;  3W6J B;  2VPL A;  3DPU A;  2FQ3 A;  4OIN F;  3GW2 A;  2Q0O A;  3FMR A;  2KJB A;  1G3S A;  2P4W A;  3HSF A;  3DTE A;  2FA5 A;  4NBQ A;  1J5Y A;  1BOA A;  1ZK8 A;  1DDN A;  3DTK A;  3RKQ A;  1BL0 A;  5GTI C;  4A3M J;  4QSH A;  3FXM A;  4M6Y A;  3S93 A;  4Y13 A;  2QA4 I;  2BXZ A;  3U21 A;  4AID A;  1U5T B;  2EV5 A;  1D5Y A;  1PDN C;  4G7H F;  2Z1D A;  1R5I D;  2FJ1 A;  4IZZ A;  2HNH A;  1RR8 C;  1VQ9 I;  4XIC A;  4RB2 C;  3BG7 A;  4XRS G;  1P4X A;  2HYG D;  4M3B A;  4L0Z B;  3RPU A;  1D0Y A;  4ZJZ A;  3GBG A;  5F08 A;  2M3A A;  2RQQ A;  3TKY A;  1IO2 A;  3OR2 C;  5KCM A;  3ZMU A;  1JTY A;  2L02 A;  5L3G A;  4AIH A;  5H6Q A;  1O3Q A;  3HDD A;  4YFX F;  1FT9 A;  2JRM A;  3CQZ J;  4KIB A;  2HGC A;  2DA3 A;  1UFM A;  2CH0 A;  5EZG A;  3LMM A;  1UMQ A;  2DJN A;  1BBY A;  2G7U A;  4IOC F;  5E1W A;  2CJJ A;  4UUT A;  2FXA A;  3I5U A;  1LQ1 A;  2K9S A;  1PJR A;  2V1D A;  3LST A;  3SDG A;  4V2F A;  2JUC A;  3WTX C;  1XDS A;  1BR2 A;  4HST A;  3ZGK A;  2VXZ A;  3VB2 A;  2QQB A;  3I3L A;  1TP4 A;  3R60 A;  2RDP A;  4HW0 A;  2FMY A;  2QBY A;  5CKT A;  3OYH A;  1G59 A;  2NOG A;  1Z3X A;  4Q4Z F;  3OYC A;  3D1N I;  4CSW A;  4RBO A;  2PEX A;  3ZMT A;  4MTD A;  1IXC A;  4KIG A;  2CQ7 A;  2VUM J;  1W5C C;  2Y0S N;  2JA8 J;  1WVR A;  2XIG A;  1IG7 A;  2FBH A;  3SFZ A;  5B66 C;  2EFN A;  2OTL I;  2AO9 A;  4MEY F;  3KZZ A;  2EV0 A;  5D6E A;  1SAX A;  2GQQ A;  4D5C A;  1ZG3 A;  4DZP A;  2ZXW H;  2V6E A;  1RZ4 A;  2RNJ A;  5DEQ A;  1YJ9 I;  3S2D J;  4EM0 B;  4PGG A;  1I27 A;  3TDU C;  3WGH A;  3TO9 A;  1REP C;  4JX6 A;  2YX4 A;  4OIP F;  1YX5 A;  1Y0N A;  3F8F A;  4CCJ A;  4A3C J;  3OSG A;  2XF7 A;  3TED A;  2IEK A;  2ZFU A;  2CFX A;  1JJ8 C;  2GA1 A;  2P5K A;  1SVO A;  2IBD A;  3QYE A;  2CQQ A;  1C0W A;  1XX5 A;  3V7S A;  1T0F C;  2HI3 A;  3H36 A;  5A2Q K;  4G8X A;  4HF0 A;  2KP6 A;  3DEU A;  4IVN A;  4BE2 A;  3Q5F A;  1KA8 A;  2M9H A;  3JSO A;  3PO2 J;  3K1P A;  4L9T A;  2XUB A;  3CCU I;  1K61 A;  1GUU A;  9ANT A;  4JK1 X;  3S16 J;  2QEN A;  2G7H A;  2NRA C;  3CDI A;  1R23 A;  3KYC B;  3IH3 A;  5CVR A;  2FOK A;  5J6X A;  1ZHF A;  1SC7 A;  3WHC A;  3JSP A;  3G2B A;  1WQ2 A;  5IP7 J;  3WU2 C;  3Q0V A;  2LD5 A;  1T2K A;  3ABU A;  3IUO A;  2LF7 A;  3B6C A;  5BNG A;  3CUQ C;  4MGR A;  1B8I A;  3M7G A;  4U0W A;  2ETH A;  1RR7 A;  2Q1Z B;  4M6X A;  3NAR A;  1MH3 A;  1P4W A;  1W36 C;  1TWF J;  2HDW A;  2STW A;  2ZME A;  4L9N A;  1WH5 A;  3CO6 C;  1ETQ A;  4PJM A;  1QPI A;  2ZKZ A;  2VQG A;  2OZ6 A;  2E2J J;  3GUD A;  3PFY A;  1LB2 A;  3AG1 H;  4LLL A;  3V7C A;  4U7B A;  2FEZ A;  1O3R A;  2V4J C;  3FDY A;  3K7A J;  1UG0 A;  3S1R J;  1R1T A;  1Z0X A;  2RN7 A;  3JRF A;  1X1D A;  1MSF C;  1A36 A;  3QPS A;  2E34 A;  1AHD P;  2LR8 A;  1MBK A;  2VAS A;  5D5W B;  3FZV A;  3HXL A;  3MFK A;  1ETY A;  1HC8 A;  3P5J A;  2IJL A;  5DV5 A;  4ZTF A;  3WU1 B;  1STZ A;  5HVQ C;  4BUP A;  5EJC A;  2RQP A;  2QWW A;  1H88 C;  4QIW N;  2B0L A;  1P7J A;  1X4O A;  2FNA A;  5FRN A;  1K6O A;  2CFO A;  3NQO A;  5ICC A;  3BTC A;  4CCK A;  4HSR A;  3K4L A;  1LEB A;  3K4J A;  3CCR I;  2JTV A;  1KZH A;  4EMS A;  3LA3 A;  3WGI A;  3ZN0 A;  1XN7 A;  3PSF A;  3LAJ A;  1TWH J;  5J40 A;  3CC4 I;  3GTJ J;  1SD4 A;  2HTS A;  3DQV C;  2DBB A;  4IHX A;  3IRR A;  3HB9 A;  3BJA A;  3K1N A;  4BKX A;  4LFU A;  4IJA A;  4HYE A;  1JE8 A;  2E19 A;  2FU4 A;  2PJR B;  2P0W A;  1ETW A;  3OIP A;  2YUS A;  4M73 A;  2ZXI A;  4LB6 B;  3VYS B;  5FFX A;  3ZRG A;  3OS1 A;  4BAY A;  1HLV A;  2TRT A;  2BW3 A;  3QOE A;  5JLX A;  2EIL H;  2NNY A;  4I02 A;  1VQ7 I;  3ZQC A;  4WXD A;  1A04 A;  2LTP A;  1I50 J;  2DJI A;  5EEH A;  3FBN B;  4RLQ A;  3N97 A;  4U88 A;  1WWX A;  3F6O A;  3LSH A;  3GF2 A;  3ZMS A;  1YJN I;  1D8K A;  1GXQ A;  5L3E A;  3OY9 A;  4BE1 A;  2CV1 A;  4BJ5 C;  1DU6 A;  1ZR4 A;  3W6K B;  3H35 A;  3PUB A;  3OYL A;  2KJC A;  1H89 C;  1G6N A;  5GPC A;  3ABM H;  1A6Q A;  1BI3 A;  2LFB A;  2LG4 A;  4FT8 A;  4XLA A;  4W1U A;  2BE5 F;  2NOJ B;  1HDP A;  2JVH A;  2OU2 A;  1ZLK A;  2Z9O A;  4I0B A;  2MAB A;  3SZP A;  3CCJ I;  2JRT A;  4BHP A;  2HU9 A;  1QGP A;  1LVK A;  4XRS A;  2HR3 A;  2R7Z J;  1XD7 A;  5LHH A;  5E3O A;  5CVU A;  3S3O A;  3J7A Y;  4B47 A;  2M87 A;  2XAQ A;  4A6E A;  1T8I A;  4IRH A;  1U3E M;  3DPT A;  2R7Q A;  1BW6 A;  3GTP J;  3WG9 A;  2R7R A;  1T6S A;  5AIQ A;  1YYV A;  2R5Y B;  3KP3 A;  3HOT A;  5LHI A;  2GA2 A;  2OA4 A;  3F9K A;  2M0M A;  1WJA A;  1VQL I;  1BOB A;  1R7J A;  1V4R A;  5F1R A;  1F4K A;  4HX7 A;  3RJP A;  3RTR A;  2RNG A;  1FP2 A;  2JPB A;  3E6B A;  4I0A A;  1JTX A;  4HQE A;  4A3B J;  2JT1 A;  2NS7 A;  3BR6 A;  2G0E A;  2NVT J;  4M72 A;  1MSE C;  1IRX A;  3J80 Z;  1FOK A;  4LG0 B;  3GTQ J;  2VOP A;  2MC3 A;  2OV7 A;  3FKJ A;  2B9S A;  4YEL A;  2OAZ A;  2XF5 A;  3G6E I;  2LC2 A;  3QAH A;  3G3Z A;  3IC7 A;  2F5E A;  2ME0 A;  2MSY A;  3DLA A;  1X1C A;  2HPI A;  2VBW A;  2KZG A;  3CME I;  2QSF X;  4L5J A;  2ME6 A;  1TL8 A;  3BZK A;  3TQN A;  1UZC A;  4AUX A;  1LJ9 A;  2K27 A;  5FB2 A;  2L9S A;  4KA4 A;  3L00 A;  3BR2 A;  5J3L A;  2LH9 A;  5L3F A;  3S3N A;  4DYC A;  4B44 A;  1ZR2 A;  3DU6 A;  2W57 A;  3BPV A;  1K4S A;  5CJ9 A;  2DMQ A;  1IGN A;  4XL9 A;  4BDZ A;  4PFO A;  5FRM A;  1B9M A;  4KUM A;  3GXO A;  1YW8 A;  2K85 A;  4IRG A;  4BY1 J;  3W2A A;  3G1L A;  2BHY A;  2VE9 A;  2WAQ A;  3HG9 A;  2CQX A;  2VJ4 A;  2IA1 A;  3AG2 H;  2DFE A;  3CJR B;  2DT5 A;  1I39 A;  1R4N B;  3M07 A;  2Z5U A;  2LNB A;  3ELK A;  4EJU A;  4D1Q A;  1RPW A;  4XSZ F;  3QQA A;  5B5E C;  3WTY C;  3HPH A;  2ZXJ A;  3CUQ A;  2V7F A;  3SEZ A;  2PFB A;  1TC3 C;  4PGH A;  4YFN F;  3C3W A;  2HYF A;  3B6A A;  1XDU A;  2GLO A;  2XB0 X;  1FOW A;  2IRF G;  4A69 C;  2X6Y A;  4G7O F;  4OAZ A;  5C4X J;  5TJJ A;  2X1E A;  1X2N A;  4X1E A;  1FBS A;  3KYD B;  2LRD A;  1WJ5 A;  4RLF A;  5AIP A;  1LE8 A;  1JT0 A;  1Y0U A;  2ZCW A;  1R00 A;  4CCL A;  5HS8 A;  1L0O C;  3GFI A;  1FC3 A;  2IS4 A;  4QWQ A;  1SEU A;  2LKS A;  1OYW A;  3BPX A;  2CSO A;  1U8B A;  3I4M J;  4FQG A;  1EV7 A;  1J59 A;  5LGN A;  3SEQ A;  1WH7 A;  2ESN A;  3HIF A;  3UR3 C;  1T38 A;  3SDB A;  2KT0 A;  4OOI A;  1LUJ B;  1WI3 A;  2RKH A;  5DM7 F;  2DQR A;  3G73 A;  2WBM A;  3ROU A;  3HZJ A;  2R5Z A;  1DGW Y;  2OTJ I;  1K78 A;  1R4M B;  2HOA A;  4GYG A;  2E1M C;  2F4M B;  4ZYA A;  1JJ6 C;  2PI0 A;  2R5Z B;  4FX4 A;  3RI4 A;  2DA5 A;  1E17 A;  3KLN A;  2XHK A;  4XON A;  1I1S A;  1FEX A;  1DP3 A;  2PQ8 A;  1V3F A;  3GME A;  4ZH4 F;  1FY7 A;  3KZI C;  1HW1 A;  5D4S A;  4A3J J;  3BLY A;  1CQT A;  2XRN A;  2RRE A;  1OPC A;  4A5N A;  3KFW X;  2MW8 A;  4UVA A;  4F91 B;  1Z05 A;  2ZJ2 A;  4M3D A;  1T98 A;  3FKI J;  1XC5 A;  1MGT A;  1ZEL A;  1G3T A;  3VDX A;  1EF4 A;  2COM A;  1FJL A;  4IRI A;  2R7O A;  4MQ9 F;  4BXF A;  2R5Y A;  3MKY B;  2CQK A;  1HBX G;  3EUH C;  2HYJ A;  1IUF A;  1U5T C;  3E97 A;  3HOV J;  1B4A A;  2YPR A;  3WOD F;  3A2K A;  1D8J A;  5HDG A;  3F6V A;  3T8T A;  3V8K A;  3JCU C;  5HNF A;  1XGS A;  3GX4 X;  2CW8 A;  3ZQI A;  3RYP A;  2ELK A;  4UXN A;  2HQR A;  3HYI A;  1YHQ I;  1IAW A;  1ZRE A;  1T08 B;  1AKH A;  2JWT A;  1LE8 B;  4HLX A;  4V2G A;  1ACI A;  2V1X A;  1SFE A;  5J1R A;  3K4C A;  2COB A;  4PJL A;  2R7U A;  1LEA A;  1GV2 A;  3ZP5 A;  3MZY A;  4WF2 A;  4BQA A;  1V5G A;  1ZH5 A;  4HF1 A;  4UB6 C;  2XAS A;  4A93 J;  3CUQ B;  4XRF A;  4AIJ A;  1ZRF A;  2O6G E;  3P7N A;  4XKC A;  4S0H B;  4Z6Y A;  4LG3 A;  4NDL A;  4XRM A;  3DEW A;  1SFX A;  4CGZ A;  3FHN A;  1Z6T A;  3IKT A;  1J7K A;  2GOX B;  2J5P A;  1OR7 A;  2OQG A;  1WJC A;  1MMS A;  3O3K A;  3JRC A;  2VBZ A;  3LSM A;  1ONV A;  4RB1 A;  4ANJ A;  5J1U A;  1MNE A;  4XLP F;  2FQ4 A;  4KT6 A;  1E3H A;  1XSX A;  2E5N A;  3RSN A;  4GFB A;  4L18 B;  2QKM B;  3E6D A;  1YTY A;  3I4P A;  1Q1V A;  4KNY A;  4L9J A;  5BS6 A;  1K4T A;  2VQC A;  3P9I A;  2R4G A;  2XV4 S;  3S32 A;  1APL C;  3LSG A;  2X0L A;  4BL0 B;  5KAF C;  2L2O A;  5EF6 A;  2F5F A;  2GXA A;  4XBF A;  1OCO H;  4QTR A;  3J7A O;  1K79 A;  3QPT A;  4RGX A;  1WPK A; 
#chains in the Genus database with same CATH homology
 1FPQ A;  3GFM A;  4RGU A;  5LHG A;  1XCV A;  2XAG A;  5JHU A;  4LB5 A;  1S7A A;  3E6C C;  4KIF A;  3FF5 A;  2XGX A;  2MH2 A;  5DD4 A;  1IZ1 A;  1BI2 A;  4EM1 A;  1AWC A;  5LBQ A;  5D4R A;  1HQC A;  3TO6 A;  4ENM A;  2DQL A;  2ZME B;  3R0J A;  4MTE A;  3AAF A;  3B02 A;  5D5X B;  3DPL C;  2GIV A;  3B73 A;  3L09 A;  2VT2 A;  4ZYE A;  3NRV A;  3BDD A;  1W5S A;  3EYI A;  2UXX A;  3BWG A;  2KIU A;  1K78 B;  4D0P A;  1KU7 A;  2K4B A;  2ZNZ A;  1TLH B;  5JI6 A;  2FNP A;  3FXU A;  3BRO A;  2P8T A;  2MH9 A;  2PN6 A;  2VBY A;  4I7H A;  1TQP A;  2LSO A;  5DCM A;  3F8N A;  4OIR F;  1E2X A;  5DD8 A;  4GXO A;  1IXR C;  1XMA A;  1R36 A;  2RGV A;  2W24 A;  5FLX Z;  3KET A;  1WRJ A;  4I98 B;  3RKX A;  2A07 F;  3V7R A;  4EJT A;  1LDD A;  2R7D A;  2R7F A;  2FML A;  2H6B A;  2FE3 A;  1U6G A;  2XRO A;  3BJ6 A;  3H92 A;  5DDG A;  5LRS A;  2Q8K A;  2GZW A;  4LLN A;  2HEO A;  1ZGA A;  1IRG A;  3F21 A;  3KEO A;  3KE2 A;  4OMY A;  4RB0 A;  3F72 A;  4A12 A;  4ESJ A;  1F5T A;  1UST A;  5DUK A;  1MZB A;  3CTA A;  4BH9 A;  2ADU A;  2KKO A;  1T39 A;  1G3Y A;  4KN7 X;  1ZGJ A;  1SD7 A;  3I71 A;  3R6S A;  4G7Z F;  2M5W A;  4IXA A;  5FD5 A;  4ASN A;  2MLG A;  4HA8 A;  4R79 A;  2A68 F;  2ELH A;  2DAO A;  2CG4 A;  4WK8 F;  4Y15 A;  3RYR A;  2JSC A;  4Z2Y A;  4G6D A;  4YIF A;  3EUH A;  2YSR A;  3ZQ7 A;  1ZRC A;  4AVP A;  3GVA A;  2HDC A;  4I2O A;  1J9I A;  2O8X A;  2DK5 A;  4HV5 A;  4S04 A;  3WE2 A;  2EK5 A;  3ECO A;  4IHT A;  4ZYD A;  4YFK F;  2DFI A;  4TV7 A;  4AIK A;  2AS5 F;  4HDU A;  4DNC A;  5K1Y A;  1MJ9 A;  4HX8 A;  3LA7 A;  3F8C A;  5HS7 A;  4CXF A;  1FYL A;  2QVO A;  2Z3Y A;  4LJZ F;  2Y75 A;  4R8H A;  2UZK A;  2JZY A;  2F5C A;  1X3U A;  3GO5 A;  5L3B A;  2EB7 A;  5BMZ A;  1XMK A;  2ZFW A;  1ZAO A;  4EM2 A;  3E3V A;  3BJO A;  4YII A;  2A69 F;  3CO7 C;  4N9H A;  2Y0M A;  1SMY F;  1KGS A;  1JGS A;  2QLZ A;  3SXY A;  1MKM A;  3DFG A;  1IN5 A;  3PQK A;  4EVI A;  2XAJ A;  4I01 A;  4CIC A;  1BN5 A;  2Y48 A;  1BI1 A;  2RV8 A;  4P9F A;  5JFR A;  5K5O A;  3RDI A;  4UHT A;  2MLK A;  1W5T A;  3ZMD A;  3P9K A;  2DI3 A;  1RIO H;  4KDP A;  4RGS A;  2R3S A;  4K2E A;  3E5X A;  3M9A A;  3JTG A;  2P5L C;  3H3Z A;  2NYX A;  2M45 A;  2Z99 A;  1YS7 A;  1L3L A;  2VOO A;  2G9W A;  3F8B A;  2PBI A;  3V4G A;  1IF1 A;  1FSH A;  1PUE E;  3WTT C;  2IVM A;  1IW7 F;  4M9S A;  2K4J A;  1R5H A;  5IT3 A;  4EGZ A;  4HLY A;  1KYW A;  1FWZ A;  3QU6 A;  3KP5 A;  3KP4 A;  4R1H A;  1WI9 A;  3SQN A;  1U5T A;  3GFL A;  1J75 A;  2ISY A;  1FP1 D;  3I53 A;  2CO5 A;  3K9T A;  1IN6 A;  4U7D A;  1O57 A;  1Q1H A;  3FXR A;  3JAM K;  2WTE A;  1QZZ A;  1H0M A;  4P96 A;  4EJO A;  3COA C;  2DPU A;  1TBX A;  2EA2 A;  1KU3 A;  2IP2 A;  4HQM A;  1YFH A;  2Q2E A;  2PMU A;  1LNW A;  3VFZ A;  2V6C A;  3O6B B;  1XGO A;  3L9F A;  4BYY A;  2FSW A;  2A5Y B;  2A3S A;  4B8X A;  1FX7 A;  5LGU A;  3DV8 A;  2DPD A;  5JR3 A;  3ZPL A;  3J81 K;  1D3Y A;  2YX7 A;  5D8L B;  4GCV A;  1RI7 A;  3HOS A;  1W7P A;  1HW2 A;  2WC2 A;  1FZP B;  1FNN A;  2CGP A;  1MD0 A;  4DQ2 A;  2VON A;  1FYK A;  2PLY A;  1TNS A;  2HFH A;  1O7F A;  5LRR A;  2MA3 A;  1YLF A;  5FO5 A;  1KU2 A;  1P6R A;  5LEJ A;  1KQ0 A;  2LKP A;  2L4M A;  1USS A;  2WV0 A;  2FRH A;  1XSD A;  4A0Y A;  3CJN A;  2W84 A;  4N0B A;  1O3S A;  2W85 A;  2E1N A;  3QP6 A;  3CDH A;  3GLX A;  3JW4 A;  2KIF A;  4LGW A;  1J2X A;  2M1B A;  5ICF A;  3V8L A;  4CZZ A;  1LVA A;  3Q9V A;  2D1H A;  3FMS A;  2PMH A;  4MNU A;  3U1D A;  3MCZ A;  2XAF A;  4RAY A;  2HOE A;  2M8E A;  2LDU A;  5HOO A;  1CF7 A;  4KFC A;  5ILV A;  1KQ9 A;  3GZ5 A;  2V79 A;  3WE3 A;  1U8R A;  2QQ9 A;  5F6F A;  5FLX K;  3D5L A;  1MDM A;  2LF8 A;  1R5G A;  3ECH A;  1MJB A;  2BV6 A;  1HKT A;  1HST A;  3KEQ A;  3HHH A;  2TDX A;  2K7L A;  1HKS A;  4GYI A;  1XCB A;  5E1Z B;  2P5V A;  4FHT A;  1ZN2 A;  4YG2 F;  3IWF A;  4NHJ A;  1ODD A;  2K02 A;  2NAZ A;  2ISZ A;  2FF4 A;  1GHC A;  3KP6 A;  3MZH A;  4EGY A;  3DXJ F;  5CYV A;  4KT5 C;  1KU9 A;  3PFI A;  3IRQ A;  3LQQ A;  3OV8 A;  3FM5 A;  5KVR A;  2VC0 A;  1ZYR F;  1R1U A;  1Z9C A;  1LDK B;  1RUO A;  4M74 A;  3HRU A;  3WTU C;  4IHS A;  5CVI A;  4P9U A;  1PP8 F;  2NNN A;  2VE8 A;  1UCR A;  4RS8 A;  3QU3 A;  5HDN A;  5HLG A;  3NEU A;  4GGG A;  3ULQ B;  3L2C A;  5E17 F;  3EET A;  4ZYG A;  1U2W A;  3U2R A;  3EQL F;  5L3C A;  1ZG1 A;  5DYM A;  1J0R A;  1TQI A;  2NS0 A;  1VTN C;  2P6T A;  1ON2 A;  2L01 A;  4XLN F;  4S05 A;  3IL2 A;  2HKX A;  1HSJ A;  4CYD A;  5F64 A;  4U0V A;  5ICE A;  2A6H F;  2DO7 A;  4PZJ A;  1G4D A;  1G3W A;  3EDP A;  1CF7 B;  2AXL A;  1I5Z A;  5BOX A;  2QQA A;  1TQM A;  3KP7 A;  1O3T A;  1P2F A;  1S7O A;  5CVJ A;  2DW4 A;  1BIA A;  4ZYH A;  3E6M A;  3ZN1 A;  3HSR A;  1GVJ A;  2VN2 A;  2FBK A;  4A6D A;  3LWF A;  3MAJ A;  2HS5 A;  4ETS A;  3P9C A;  5ILS A;  4CO8 A;  2X4H A;  3QOP A;  3M8F A;  4I09 A;  4G94 A;  2H94 A;  2YR2 A;  3ABT A;  5KK1 A;  4ENK A;  1ON1 A;  3JTH A;  4UV9 A;  3JAM Z;  3FMQ A;  4L5I A;  2IT0 A;  4A5M A;  3HSE A;  1R22 A;  5K5Q A;  4HF2 A;  3V8J A;  3I64 A;  2P6S A;  3TO7 A;  1T0F A;  2KRF A;  4QLC U;  3GZ6 A;  4HX4 A;  1Z91 A;  4NQW A;  1BC7 C;  1SFU A;  3IWZ A;  3R4K A;  3HRS A;  3WTZ A;  1W7P B;  5LLQ A;  5HLI A;  4U0Y A;  1YW9 A;  1AOY A;  4UVB A;  1P92 A;  1YG2 A;  2MD5 A;  4A0X A;  4OMZ A;  2YU3 A;  3TDZ C;  2MBF A;  2H27 A;  3BZ6 A;  1SD5 A;  1MJA A;  2E7X A;  3DP7 A;  2CW0 F;  4LG0 A;  1S6L A;  3WU0 A;  4P55 A;  5E8G A;  5TRD A;  2STT A;  1DUX C;  1OMI A;  1UHM A;  4HAM A;  1BJA A;  1F1Z A;  3E5Q A;  4KMF A;  3QRF F;  5FFZ A;  1K7A A;  1EH6 A;  4RAZ A;  5FGM A;  1OKR A;  2CWE A;  1O7L A;  1JXS A;  2EJR A;  2XVC A;  1RNL A;  2DU9 A;  2ZNY A;  2C6Y A;  3M1E A;  3WTW C;  4UNO A;  5H6R A;  5ERI A;  1F9N A;  1Z6R A;  1XGM A;  1FYM A;  3F3X A;  4KYW A;  2O0Y A;  1OYI A;  4IF4 A;  2OBP A;  2V9V A;  4O6J A;  2KIM A;  1Z7U A;  4EJW A;  4HOB A;  5BPD A;  3TOA A;  1QBJ A;  5D6F A;  1ULY A;  2H09 A;  1D5V A;  3BY6 A;  4ESB A;  3HRT A;  1JHH A;  5E1X A;  5CLS A;  3WGG A;  1IRF A;  2D1V A;  2O03 A;  4G9Y A;  3F23 A;  4PCQ A;  3FM3 A;  4F7Z A;  3KCC A;  2HZT A;  3FHZ A;  3T5X A;  1PP7 U;  3GWZ A;  1IUY A;  1XGN A;  1KQ8 A;  4Q48 A;  3VEP A;  5JVT A;  2IW5 A;  4RB3 C;  2UWM A;  1EH8 A;  1RUN A;  4BHB A;  4WCG A;  4M71 A;  5IT9 K;  4HZF A;  2IA2 A;  1FSE A;  2IA0 A;  1BIB A;  2K86 A;  5E20 A;  4LMY A;  1QNT A;  2EV6 A;  1BM9 A;  2ZBK A;  3RIR A;  3TGN A;  2BBY A;  2VT3 A;  4UUV A;  1W4M A;  5BPI A;  1GXP A;  1B1B A;  3LA2 A;  4ESF A;  4O5V A;  5K5R A;  5DUI A;  1I1G A;  4M9Z A;  4JBA A;  3U9G A;  1DP7 P;  5CVV A;  3O2P E;  1H9T A;  5HS9 A;  1B9N A;  3QPH A;  3BP8 A;  4RGR A;  4BXU A;  2V1U A;  3J81 Z;  2EA4 A;  4IPA A;  3HHG A;  3RKW A;  1UB9 A;  1R1V A;  3HTS B;  5H20 A;  3R61 A;  1R58 A;  3R0A A;  1FLI A;  6PAX A;  2GXB A;  1U78 A;  2D2W A;  2OZU A;  3GEZ A;  4MQV A;  2RVC A;  5EEG A;  5HDK A;  3CUO A;  2ACJ A;  1XB4 A;  2D45 A;  4A0Z A;  1XSV A;  4BHC A;  1WKM A;  4OU0 A;  2E1C A;  3T1B A;  4HV6 A;  1OYY A;  1HW5 A;  5ICG A;  3ERE D;  4AWX B;  3DF8 A;  2P7C B;  3GFJ A;  1YS6 A;  1HXD A;  3KZY A;  1TW2 A;  2XAH A;  1ZG5 A;  1P4A A;  1JHF A;  4CHU A;  4LK1 F;  4MHG A;  3ML6 A;  5AON A;  5DCM B;  1QQI A;  1YQA A;  1IN8 A;  2DK8 A;  1YW7 A;  2PG4 A;  1S29 A;  1ZRD A;  1IXS B;  1NHA A;  3EYY A;  3I59 B;  2HWV A;  1QZY A;  5A2Q Z;  4M9X A;  3KLO A;  4UV8 A;  3HUG A;  4HBL A;  1B6A A;  3RKY A;  2GAU A;  2BYV E;  2ZO4 A;  4L0Y B;  3SZT A;  2HQN A;  3CLO A;  4EV0 A;  1QPM A;  1EH7 A;  4PDK A;  2ESH A;  5ED4 A;  2IPQ X;  3RPQ A;  4GO1 A;  4O3M A;  4XSX F;  5HLH A;  1QO0 D;  1IN7 A;  3LQR A;  2E7W A;  2PJP A;  3GYH X;  3MEX A;  3VOD A;  4ZZL A;  5BQT A;  1LDJ A;  1TNT A;  4EQQ A;  4BNC A;  4LLG F;  2O61 A;  3OOP A;  2HKO A;  2QUF A;  2QM3 A;  4G6Q A;  5DCF A;  1DPR A;  2UXN A;  2EFW A;  3S2W A;  1I6X A;  3MWM A;  1FBQ A;  4WX9 A;  4EJV A;  2J5O A;  2EWN A;  3L7W A;  3LFK A;  1H9G A;  4N9I A;  1DPU A;  4ZZD A;  5LGT A;  2M30 A;  3ISP A;  1Z1D A;  2QYO A;  3I54 A;  4LK0 F;  4B09 A;  2H6C A;  3F22 A;  4ENN A;  2P7V B;  3E5U A;  4Y17 A;  3Q9S A;  3HTU A;  1IN4 A;  1S3J A;  4WWC A;  3VOE A;  3FWE A;  5LEK A;  5J8C A;  2BGC A;  3K0L A;  5FD6 A;  3T8R A;  1UHW A;  1KYZ A;  3TOB A;  5D5V B;  4Q47 A;  5ILU A;  2HTJ A;  2W25 A;  3HRM A;  1W7P D;  4KIC A;  4HDV A;  4E70 A;  3K2Z A;  1BI0 A;  5D8K B;  4L9V A;  2JPC A;  3I58 A;  3BOQ A;  3SHF A;  4ON0 A;  4ENJ A;  3REO A;  1YO5 C;  5E8I A;  3C7J A;  1ZAR A;  4MEX F;  3FXQ A;  1MDM B;  3C18 A;  3H3U A;  4NB5 A;  2F5D A;  4WXH A;  2A6E F;  4P5O A;  2VBX A;  4KMU X;  1SMT A;  3T0Y A;  3D0S A;  1ZLJ A;  4Q5S F;  3N4M A;  3KP2 A;  2GXG A;  3K69 A;  2XKO A;  4OIQ F;  3PQJ A;  1S8N A;  1SD6 A;  3ZMV A;  1FBU A;  4KN4 X;  4AD9 A;  2L54 A;  2XKP A;  5D5U B;  2DTR A;  2A61 A;  4CDG A;  1TW3 A;  5J8F A;  2FBI A;  2Z33 A;  2WWY A;  4LD5 A;  3WTS C;  3IKV A;  2O3F A;  2EFQ A;  3LAP A;  3J80 K;  1TTY A;  2F2E A;  3C1D A;  4FX0 A;  3I59 A;  3K1M A;  3F8M A;  2CYY A;  3DKW A;  2OD5 A;  1BC8 C;  2QBY B;  5E18 F;  2QZ8 A;  2DLL A;  2VOD A;  4OIO F;  2EFP A;  4A2U A;  1WSU A;  5L3D A;  3MQ0 A;  1CGP A;  1YIO A;  4WXC A;  2BEO A;  2OQR A;  3FX3 A;  2L4A A;  3WTV C;  2L3D A;  3IHU A;  1B59 A;  4JQF A;  5IT9 Z;  2VC1 A;  3I0T A;  4H0E A;  3ZMZ A;  3QP5 A;  3M8E A;  2EFO A;  2RC4 A;  1HKQ A;  2GWR A;  4UVC A;  3W6J B;  2FQ3 A;  4OIN F;  3GW2 A;  2Q0O A;  3FMR A;  2KJB A;  1G3S A;  2P4W A;  3HSF A;  2FA5 A;  1J5Y A;  1BOA A;  1DDN A;  4M6Y A;  4Y13 A;  1U5T B;  2EV5 A;  1PDN C;  4G7H F;  4RB2 C;  4L0Z B;  1P4X A;  2HYG D;  3RPU A;  3TKY A;  3ZMU A;  5L3G A;  2L02 A;  1O3Q A;  4AIH A;  5H6Q A;  4YFX F;  1FT9 A;  4KIB A;  2HGC A;  1UFM A;  1BBY A;  2G7U A;  5E1W A;  2FXA A;  3I5U A;  1LQ1 A;  2V1D A;  3LST A;  3WTX C;  1XDS A;  2VXZ A;  3VB2 A;  2QQB A;  3R60 A;  2RDP A;  4HW0 A;  2FMY A;  2QBY A;  4Q4Z F;  2PEX A;  3ZMT A;  4MTD A;  1IXC A;  4KIG A;  2XIG A;  2FBH A;  3SFZ A;  2EFN A;  4MEY F;  3KZZ A;  2EV0 A;  5D6E A;  1SAX A;  2GQQ A;  1ZG3 A;  1RZ4 A;  2RNJ A;  5DEQ A;  4EM0 B;  4PGG A;  1I27 A;  3TDU C;  3WGH A;  3TO9 A;  1REP C;  2YX4 A;  4OIP F;  3F8F A;  2CFX A;  2GA1 A;  2P5K A;  1C0W A;  3V7S A;  5A2Q K;  4G8X A;  4HF0 A;  3DEU A;  4IVN A;  3Q5F A;  1KA8 A;  3JSO A;  3K1P A;  4L9T A;  2XUB A;  4JK1 X;  2QEN A;  2G7H A;  2NRA C;  1R23 A;  5CVR A;  5J6X A;  2FOK A;  1ZHF A;  3JSP A;  1WQ2 A;  1T2K A;  3ABU A;  2LF7 A;  3CUQ C;  4MGR A;  3M7G A;  4U0W A;  2ETH A;  4M6X A;  1P4W A;  2STW A;  2ZME A;  4L9N A;  3CO6 C;  2ZKZ A;  2OZ6 A;  3GUD A;  1LB2 A;  4LLL A;  3V7C A;  4U7B A;  2FEZ A;  1O3R A;  1R1T A;  2RN7 A;  5D5W B;  3FZV A;  3MFK A;  2IJL A;  5DV5 A;  3WU1 B;  1STZ A;  5HVQ C;  2RQP A;  2QWW A;  2B0L A;  2FNA A;  1K6O A;  3NQO A;  5ICC A;  1LEB A;  2JTV A;  4EMS A;  3LA3 A;  3WGI A;  3ZN0 A;  1XN7 A;  3LAJ A;  1SD4 A;  2HTS A;  3DQV C;  2DBB A;  3IRR A;  3BJA A;  3K1N A;  4LFU A;  4IJA A;  4HYE A;  1JE8 A;  2FU4 A;  4M73 A;  4LB6 B;  5FFX A;  4BAY A;  2NNY A;  4I02 A;  4WXD A;  1A04 A;  5EEH A;  3N97 A;  4U88 A;  1WWX A;  3F6O A;  3ZMS A;  3GF2 A;  1D8K A;  1GXQ A;  5L3E A;  3W6K B;  2KJC A;  1G6N A;  1BI3 A;  4FT8 A;  2BE5 F;  2OU2 A;  1ZLK A;  2Z9O A;  4I0B A;  3SZP A;  2JRT A;  4BHP A;  1QGP A;  2HR3 A;  1XD7 A;  5LHH A;  5CVU A;  2M87 A;  2XAQ A;  4A6E A;  4IRH A;  1U3E M;  3DPT A;  3WG9 A;  1T6S A;  5AIQ A;  1YYV A;  3KP3 A;  3HOT A;  5LHI A;  2GA2 A;  2OA4 A;  1R7J A;  1V4R A;  5F1R A;  1F4K A;  4HX7 A;  3RJP A;  3RTR A;  1FP2 A;  2JPB A;  3E6B A;  4I0A A;  4HQE A;  2JT1 A;  4M72 A;  1FOK A;  3J80 Z;  4LG0 B;  2VOP A;  2MC3 A;  2OAZ A;  3QAH A;  3G3Z A;  3IC7 A;  2F5E A;  2VBW A;  4L5J A;  3TQN A;  1LJ9 A;  2K27 A;  5FB2 A;  4KA4 A;  3L00 A;  5L3F A;  2W57 A;  3BPV A;  5CJ9 A;  1B9M A;  4KUM A;  3GXO A;  1YW8 A;  4IRG A;  2VE9 A;  2IA1 A;  2DT5 A;  2Z5U A;  2LNB A;  3ELK A;  4EJU A;  4XSZ F;  3WTY C;  2ZXJ A;  3CUQ A;  2PFB A;  4PGH A;  4YFN F;  3C3W A;  2HYF A;  1XDU A;  2IRF G;  4G7O F;  5TJJ A;  1FBS A;  5AIP A;  1Y0U A;  2ZCW A;  1R00 A;  5HS8 A;  3GFI A;  1L0O C;  1FC3 A;  4QWQ A;  1OYW A;  3BPX A;  2CSO A;  1EV7 A;  1J59 A;  5LGN A;  2ESN A;  3HIF A;  1T38 A;  4OOI A;  2RKH A;  2DQR A;  3G73 A;  3ROU A;  1K78 A;  4GYG A;  2PI0 A;  4FX4 A;  3RI4 A;  1E17 A;  3KLN A;  2XHK A;  1I1S A;  2PQ8 A;  1V3F A;  4ZH4 F;  1FY7 A;  1HW1 A;  5D4S A;  2XRN A;  1OPC A;  4A5N A;  3KFW X;  4UVA A;  1Z05 A;  2ZJ2 A;  1T98 A;  1MGT A;  1G3T A;  2COM A;  4IRI A;  4MQ9 F;  1HBX G;  2CQK A;  1U5T C;  3E97 A;  1B4A A;  2YPR A;  3WOD F;  1D8J A;  5HDG A;  3F6V A;  3T8T A;  3V8K A;  1XGS A;  3GX4 X;  3RYP A;  4UXN A;  1ZRE A;  2HQR A;  3HYI A;  1IAW A;  4HLX A;  2V1X A;  1SFE A;  1LEA A;  3ZP5 A;  3MZY A;  4WF2 A;  4BQA A;  1ZH5 A;  4HF1 A;  2XAS A;  3CUQ B;  4XRF A;  4AIJ A;  1ZRF A;  2O6G E;  3P7N A;  1SFX A;  4CGZ A;  3IKT A;  1Z6T A;  1J7K A;  2J5P A;  1OR7 A;  2OQG A;  3O3K A;  2VBZ A;  1ONV A;  4RB1 A;  4XLP F;  1XSX A;  4L18 B;  3E6D A;  1YTY A;  3I4P A;  4KNY A;  4L9J A;  5BS6 A;  3P9I A;  2XV4 S;  2X0L A;  2F5F A;  4XBF A;  3J7A O;  1K79 A;  3QPT A;  4RGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...