2ESHA

Crystal structure of conserved protein of unknown function tm0937- a potential transcriptional factor
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
114
structure length
114
Chain Sequence
RGGRGFRGWWLASTILLLVAEKPSHGYELAERLAEFGIEIPGIGHMGNIYRVLADLEESGFLSTEWDTTVSPPRKIYRITPQGKLYLREILRSLEDMKRRIETLEERIKRVLQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein TM0937
publication title Crystal Structure of Conserved Hypothetical Protein TM0937
rcsb
source organism Thermotoga maritima
total genus 35
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2005-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2eshA00
5DEQA 2A68F 3ZP5A 3DFGA 2XRNA 3GYHX 3OV8A 5HLHA 3RKWA 4MEYF 2R3SA 1O3QA 3SXYA 4HYEA 2RN7A 3BY6A 2K27A 3VODA 2FEZA 3C1DA 1U78A 1IN8A 3R0AA 3I4PA 3EQLF 1XGNA 1YS7A 2IP2A 3FMSA 3FM3A 1Z91A 1FOKA 4L9VA 3E5UA 4EJTA 3FM5A 3ZMSA 1FPQA 4UUVA 1R00A 3COAC 1XSXA 1P4AA 3JTGA 2HS5A 3S2WA 2OQGA 4CO8A 1XGSA 2X0LA 4I2OA 1I1GA 2PBIA 4L9TA 3GZ6A 5K5RA 4A5MA 1P2FA 4G6QA 2KIUA 1GHCA 4G7OF 2V9VA 4HX8A 2EV6A 3F6OA 1CGPA 3FXRA 1G4DA 4L0YB 1UB9A 2IA0A 4EM0B 2HWVA 4AWXB 4UVBA 3TGNA 1DDNA 2EK5A 1LVAA 3QRFF 4XLPF 3KEQA 3P9IA 4ENMA 4IRGA 2F2EA 2K4BA 3ROUA 4M9SA 1JGSA 4ZYDA 2XHKA 1S8NA 4FT8A 1U5TB 1S29A 1BC8C 1ZHFA 5FGMA 4I0AA 4B8XA 5FLXZ 3LA2A 4EM1A 3GXOA 1O3RA 3CUQB 2FQ3A 4K2EA 3W6KB 1TBXA 2J5OA 3MWMA 5D5VB 1W7PD 5F64A 3C18A 3R6SA 5AONA 1JE8A 2HEOA 1IRFA 2D2WA 5DD8A 2HTSA 4XSXF 1RNLA 1B9NA 1BJAA 2X4HA 4EJOA 1TLHB 1DPRA 3EUHA 1XGOA 4O5VA 4MTDA 3BJAA 3DP7A 3FXQA 4M6XA 1IN7A 4KUMA 2VODA 4HDUA 5E17F 3Q9VA 4ESBA 2FOKA 1S7OA 3VB2A 2QYOA 2HYFA 2B0LA 3HHHA 3KFWX 1O7LA 4PGGA 2FSWA 4WF2A 1ON2A 3R0JA 3CTAA 3E3VA 1K78B 5CVVA 4G9YA 1LNWA 4EVIA 3KLOA 5FD6A 2YX4A 4Y17A 3LA7A 3IRRA 2Z9OA 1VTNC 2VOPA 1XDUA 3RI4A 3FZVA 3NEUA 2XKOA 1BI3A 2DPUA 2R7DA 2VBYA 3J80Z 5D5WB 1FP2A 2OZUA 4WXDA 2OD5A 2J5PA 3WTSC 3M8EA 3FXUA 2FNAA 2PLYA 1ZG3A 1Z6RA 2HQNA 1G3YA 4N9IA 5E1WA 5JR3A 4M73A 4KIFA 2VBWA 3T8TA 1XGMA 5L3GA 1HW2A 4UVCA 4MTEA 4RB2C 1FYMA 2MH2A 1IZ1A 2XAHA 4P9UA 1LDKB 1ULYA 2CG4A 4LLGF 3J7AO 1IF1A 3EYYA 5TRDA 3ZQ7A 2DK5A 2IJLA 2P4WA 2A5YB 2FMYA 4G8XA 1MDMB 1EV7A 2KKOA 2W24A 4HX4A 1J5YA 1SFEA 1ZH5A 1XSVA 1HKSA 4HLYA 3IRQA 2QQBA 4P96A 5E20A 3I5UA 4WK8F 1CF7A 5F6FA 4Q47A 3HRSA 1ZLKA 1I6XA 4WCGA 4BNCA 4ZZDA 2F5EA 1W7PB 2VC0A 2P6SA 4AVPA 2ZXJA 1QPMA 4OIPF 3V7CA 4KFCA 5D6FA 5E1ZB 2O8XA 5FB2A 3JTHA 1R5GA 3QPHA 1TQIA 4M9ZA 3ULQB 3B02A 2GA2A 5FFXA 2CO5A 3L9FA 3F22A 2VOOA 4RGSA 4ZYHA 2ZBKA 1ZN2A 3QPTA 3IC7A 3IWFA 3R60A 2EB7A 1YW9A 3H3UA 4I02A 2M5WA 1JHFA 2KIFA 4L9JA 1JXSA 4YG2F 3RIRA 1HSTA 3BZ6A 4M72A 5LRSA 3GX4X 5CVJA 3BPXA 5HLGA 3E5QA 3BPVA 2RQPA 5BQTA 1T98A 4O3MA 1FX7A 3FWEA 1Q1HA 2L3DA 2A69F 4I7HA 1T6SA 4ASNA 2C6YA 1R22A 5E8GA 4LFUA 1FBQA 2HKXA 2O6GE 5E18F 5A2QK 4R1HA 4ZYEA 2NS0A 3I71A 5BMZA 4YFNF 3WU1B 3CO7C 1ZRCA 1FYKA 2GA1A 2XAFA 2ZNZA 3I53A 3LFKA 1BIBA 4LB6B 4IXAA 3TOBA 3L00A 1F4KA 2FBKA 4A6EA 4RGRA 4U7DA 3ZMDA 1PP8F 2RC4A 2CYYA 1U5TA 4OMZA 4KYWA 2BEOA 4OOIA 2Q2EA 1G3WA 3VEPA 2EA2A 5LHGA 2L4MA 4PZJA 3VOEA 4CZZA 3BWGA 1B6AA 2A61A 3CUQA 4F7ZA 5ILSA 1SMTA 2XASA 3E5XA 2V1UA 1P4XA 3K0LA 4HBLA 4RAYA 1B1BA 3B73A 1FP1D 1ZYRF 4LGWA 4RS8A 3WU0A 2MLGA 4IPAA 3GFJA 2Z5UA 3ZMZA 2EV5A 2NAZA 3Q9SA 1Z9CA 4HW0A 2UXXA 5LBQA 1G3TA 5HS7A 4Y13A 1MJBA 2CGPA 2OU2A 4DQ2A 3JSPA 5KVRA 3W6JB 4A2UA 3HOTA 3BJ6A 3KP4A 2LDUA 2Q0OA 3ECOA 3KETA 3FHZA 2L02A 2L4AA 1IN4A 2RGVA 2EV0A 3G73A 1YW7A 1WSUA 1S7AA 1O7FA 2LKPA 4BQAA 2ZCWA 2DU9A 2Z99A 3CO6C 4EM2A 3F8FA 1MGTA 3H3ZA 1WWXA 3K1NA 2MC3A 3LAJA 1H9TA 4BHCA 2P7VB 3GW2A 1LDJA 1GXQA 3SZTA 3DF8A 3I64A 3KZZA 3R61A 3TO7A 3F8MA 5LEKA 2H27A 1USTA 2GWRA 3M8FA 1EH6A 4EJVA 2FF4A 3V8KA 4EJWA 3MAJA 3FF5A 5L3EA 5K5OA 3R4KA 3ZMVA 2XROA 4M71A 5BS6A 2MLKA 3IKVA 1X3UA 2NNYA 3P9KA 1KYWA 3WGGA 3DPTA 2DPDA 3RTRA 2XGXA 5DCMB 2STTA 2YR2A 2H94A 5KK1A 3GUDA 1BI1A 1IW7F 2PEXA 3LAPA 3JAMK 5ILUA 3QU3A 1Z1DA 4BXUA 2F5DA 1WKMA 3BJOA 1IAWA 2IA1A 5LGUA 1D8JA 3HRTA 2K7LA 4IJAA 4M74A 4PGHA 3F3XA 4QWQA 1WRJA 2IA2A 1SD5A 3I0TA 1LB2A 4ZYGA 1EH8A 1KQ0A 2DI3A 3DQVC 2A3SA 4ENNA 2QWWA 2P7CB 2ESHA 1BC7C 4HLXA 1KA8A 1OMIA 4GO1A 2ISYA 5D4SA 4P5OA 3JW4A 2YU3A 4YIFA 5D4RA 2PN6A 5LRRA 3LSTA 3CDHA 1XDSA 4FHTA 2G9WA 5E1XA 4XLNF 3IL2A 1O3SA 2M45A 3HSFA 2XAJA 3T0YA 1XCVA 3I54A 1S3JA 2M8EA 1OYIA 1ZRDA 3HIFA 2MA3A 3T5XA 5DV5A 1LEAA 2R7FA 5LHIA 1QGPA 1QNTA 4DNCA 2ZMEB 3HTUA 5L3DA 2JPCA 3I59B 1UCRA 2M30A 2Y48A 3DPLC 2HZTA 3M1EA 3RDIA 5DD4A 3IWZA 4U0WA 3GFMA 3ZN0A 1USSA 3ISPA 3EDPA 2QQAA 5LEJA 3AAFA 2Z3YA 4HQEA 3RKXA 3DV8A 2V79A 3DKWA 4WWCA 1B4AA 4HF2A 1H9GA 5JI6A 5L3FA 4A6DA 4G6DA 3V4GA 2EFQA 4L18B 2GZWA 2AXLA 2V1DA 3PQKA 4LK1F 4G7HF 3KP6A 5BPIA 4ON0A 4ENKA 3HTSB 2E7XA 3K1MA 4G94A 1R58A 4D0PA 4A0YA 1MJAA 2ESNA 2COMA 1K7AA 3WODF 5L3BA 4AIJA 4LG0B 4P55A 1MZBA 1XMAA 1KGSA 4CHUA 1XN7A 3VFZA 3Q5FA 1YLFA 4B09A 3HSRA 2OAZA 3JSOA 3V7SA 2W57A 5ERIA 5TJJA 4LLLA 2QBYB 4P9FA 2DBBA 3TQNA 3TOAA 3RPUA 2CW0F 4RB3C 4L5JA 1YW8A 2HQRA 4ENJA 1FC3A 1P4WA 4LLNA 4KIGA 2FXAA 4RAZA 1HQCA 2PI0A 3SFZA 3NRVA 2HR3A 1KYZA 2MD5A 4GYGA 3IHUA 5LGTA 1IUYA 2XIGA 2CFXA 1W5TA 1ZGJA 2DLLA 1PUEE 1Z05A 1TNSA 2JRTA 4S04A 4ESJA 3DXJF 3G3ZA 5CJ9A 2YX7A 5L3CA 2IT0A 5A2QZ 2V1XA 2VN2A 1C0WA 1FLIA 3E97A 3HUGA 3RYPA 3HSEA 2Y75A 2DK8A 4BHPA 4LMYA 2KJBA 3D0SA 2D1VA 1LEBA 4R8HA 3MQ0A 1BI0A 3MZYA 5HDNA 4YFKF 2IW5A 4ZZLA 2W85A 5E8IA 3F8BA 3KP3A 5CLSA 1ZAOA 5DCMA 1HKQA 3HYIA 3KZYA 2EFOA 5LLQA 3KP2A 3QAHA 3L09A 4I09A 3IKTA 1STZA 1NHAA 2GIVA 3ECHA 3I58A 4RGXA 3O6BB 4FX0A 4N9HA 4LD5A 3M9AA 4CYDA 5JVTA 1L3LA 5DYMA 1I1SA 5DCFA 3TO6A 1BM9A 4IVNA 5AIQA 5J8CA 2O0YA 5D6EA 3KCCA 4EQQA 4L9NA 2G7HA 2XAGA 1DUXC 2FNPA 4IRIA 5AIPA 3F8CA 3TDUC 1JHHA 4G7ZF 2KIMA 3RKYA 2E7WA 5JFRA 1SD4A 2GQQA 4XBFA 2XAQA 1REPC 5FD5A 2EFNA 3V8JA 3U9GA 3WTWC 1UFMA 2VT2A 3BOQA 4KDPA 2NYXA 3WGHA 3O3KA 1L0OC 2FE3A 3P7NA 2ACJA 1S6LA 1TNTA 4GGGA 4JK1X 4KN7X 2WWYA 4S05A 3F6VA 2NNNA 3NQOA 4U0VA 1OKRA 1J75A 4HZFA 2PMUA 4ZH4F 2MH9A 2ZMEA 4KICA 4AIHA 2CSOA 2V6CA 3I59A 4TV7A 2EJRA 4RGUA 4CDGA 1OR7A 4LK0F 2DFIA 4OIOF 3J81Z 2QUFA 1WI9A 1Y0UA 4IHTA 3JAMZ 1R23A 2P5KA 1P92A 4IHSA 2QZ8A 1K78A 1J2XA 4EMSA 2XVCA 4Q4ZF 3BROA 1ODDA 4LG0A 2H6BA 4U7BA 3MCZA 1G6NA 2VONA 4EJUA 3GF2A 5JHUA 3F21A 1XD7A 5CVUA 1FZPB 1BN5A 3EETA 2WTEA 1KU9A 2Z33A 3H92A 3QOPA 3WTTC 2QBYA 2A07F 1GXPA 2IVMA 2O61A 1QO0D 1FSEA 3HOSA 2L01A 1FWZA 3T8RA 5K1YA 1H0MA 1OYYA 2FRHA 3OOPA 3E6CC 3GEZA 4OU0A 3ZN1A 3L7WA 1FT9A 3WTXC 2K86A 1O3TA 1ZGAA 1HSJA 1U2WA 4YFXF 3J81K 1J9IA 1MDMA 1SFUA 3WE2A 4OINF 2BE5F 4ESFA 2OA4A 2E1NA 2ZO4A 1K79A 1QQIA 1KU3A 2IPQX 5HS9A 4MNUA 1IXSB 1RUOA 2BBYA 2EWNA 2H09A 1TTYA 2HGCA 1F5TA 1T39A 2VT3A 2DT5A 2HFHA 1QZYA 2JT1A 2ZJ2A 4HQMA 1W7PA 3QU6A 5J8FA 5ILVA 2F5CA 1U6GA 1IRGA 3M7GA 2DW4A 3REOA 4PCQA 3SZPA 4RB1A 3T1BA 5ICCA 2JSCA 1T0FA 2WV0A 5D5UB 2LF8A 4KT5C 1V4RA 1BBYA 5HVQC 1TW2A 4KIBA 4UNOA 2PMHA 3CLOA 1QZZA 2IRFG 1T38A 3E6BA 4RB0A 1FBUA 3FX3A 2JZYA 1E2XA 4NB5A 5IT9K 3O2PE 2PQ8A 1J59A 2BGCA 2ADUA 5ICGA 2FU4A 2VE9A 3GZ5A 2HYGD 2VC1A 3ERED 3BP8A 3K1PA 3GWZA 2ELHA 1OPCA 3C7JA 1I27A 4WX9A 1KU7A 4I01A 4O6JA 1RUNA 1J7KA 1SMYF 4MQ9F 3P9CA 1SD6A 2P5LC 1F9NA 4WXCA 1ONVA 3GO5A 2P6TA 2VXZA 5DUKA 2UWMA 2G7UA 3MEXA 1QBJA 1MKMA 4WXHA 3TDZC 1PP7U 1E17A 2BV6A 1LDDA 3HHGA 2JPBA 1KQ9A 2W25A 3GVAA 4BHBA 3MFKA 1YG2A 2UZKA 1HW5A 3RJPA 3WG9A 1YS6A 2MBFA 2ZFWA 3K69A 2E1CA 2RV8A 4OIRF 6PAXA 3U1DA 4GXOA 4H0EA 2XUBA 3TO9A 4MQVA 5HDKA 4UVAA 1FY7A 4KMFA 2ZNYA 3KP5A 1XMKA 2DQRA 4NHJA 2HTJA 5HLIA 4BYYA 4KN4X 1ZG5A 4BAYA 1ZREA 1Z7UA 4HF0A 5CYVA 2KJCA 2D1HA 2RNJA 3WTZA 2TDXA 2YSRA 2P5VA 2P8TA 1SD7A 1R1UA 4QLCU 2L54A 2RKHA 3GLXA 4OMYA 2GXBA 2A6HF 5BPDA 5IT3A 5D8KB 4XSZF 1OYWA 3DEUA 2A6EF 1P6RA 2EFWA 1YO5C 3EYIA 5FO5A 1DPUA 4NQWA 3WE3A 5D8LB 4UV9A 5FLXK 3GFLA 1B9MA 1MD0A 1W4MA 2CQKA 4A0XA 1W5SA 4CXFA 2FMLA 3HRUA 2BYVE 2O3FA 2RVCA 3E6DA 3KP7A 5K5QA 5LGNA 1PDNC 4AD9A 5CVRA 1TQPA 1IN5A 1ON1A 2WC2A 2DAOA 1K6OA 1B59A 3PQJA 1ZRFA 1R1TA 1YYVA 1O57A 1F1ZA 4FX4A 2FBHA 4EV0A 2LSOA 3V8LA 2M87A 1RI7A 4HAMA 3TKYA 1FYLA 4OIQF 2GAUA 3ZMTA 4CICA 3BDDA 3ML6A 2M1BA 3SQNA 2YPRA 1HBXG 5H6QA 2HOEA 2QENA 4ETSA 4KMUX 3KE2A 3SHFA 1FNNA 1FBSA 4M9XA 3F23A 4IF4A 3E6MA 1U8RA 3RYRA 1IN6A 1MJ9A 1D3YA 4PDKA 4A5NA 5DDGA 2LNBA 2CWEA 1YQAA 3WTVC 3CJNA 1SFXA 1EH7A 2HDCA 3L2CA 1HW1A 2XV4S 2PFBA 2FA5A 1D8KA 3J80K 3ABUA 1AOYA 2JTVA 2PG4A 4I98B 4E70A 4XRFA 2VBZA 3LQRA 1A04A 2DQLA 4AIKA 1YTYA 1UHMA 4L5IA 1V3FA 2QM3A 1GVJA 2Q8KA 1YFHA 1BI2A 1AWCA 2EA4A 5DUIA 2W84A 4UV8A 1T2KA 5BOXA 2STWA 3K2ZA 1R5HA 1R1VA 1BOAA 4M6YA 1IXRC 3WTUC 3ELKA 1TQMA 2OBPA 4GYIA 3QP5A 1BIAA 2AS5F 2QQ9A 3ZMUA 1DP7P 2O03A 4A12A 4IRHA 4HF1A 2HKOA 4R79A 3LWFA 4U0YA 4A0ZA 1UHWA 5FFZA 3WGIA 1IXCA 2KRFA 4U88A 4I0BA 1LJ9A 4L0ZB 4LB5A 3C3WA 4KA4A 5H20A 5J6XA 5ED4A 4CGZA 2QLZA 3RPQA 1XSDA 2LF7A 2XKPA 2D45A 1J0RA 4Z2YA 4JQFA 1RZ4A 3WTYC 4Q48A 4HDVA 3GFIA 3MZHA 5ICEA 2UXNA 2RDPA 3V7RA 3LQQA 4HA8A 3K9TA 5H6RA 2GXGA 1HXDA 2DO7A 1KQ8A 1XCBA 3HRMA 4JBAA 4EGYA 2DTRA 1SAXA 4UXNA 1U5TC 1HKTA 1FSHA 4Y15A 3CUQC 3PFIA 3D5LA 3FMQA 1XB4A 4BH9A 1D5VA 1Z6TA 3CUOA 3LA3A 4HOBA 4MHGA 4MEXF 5D5XB 2VBXA 2ETHA 1RIOH 1G3SA 1R7JA 4YIIA 1LQ1A 3KLNA 4HX7A 4UHTA 3ZPLA 2PJPA 2FBIA 1R36A 4LJZF 2EFPA 1ZARA 2H6CA 5HOOA 3QP6A 1ZG1A 4GCVA 2QVOA 3U2RA 3ABTA 3FMRA 5CVIA 5EEHA 4HV5A 3F72A 1YIOA 2OQRA 3N4MA 5LHHA 1WQ2A 5EEGA 4MGRA 1TW3A 3F8NA 2NRAC 1U3EM 2ZKZA 3KEOA 4HV6A 3N97A 2Y0MA 1I5ZA 4KNYA 4Q5SF 2VE8A 2F5FA 4EGZA 1KU2A 4N0BA 2OZ6A 5HDGA 5HS8A 2K4JA 5ICFA 5F1RA 1CF7B 1ZLJA 2ISZA 5IT9Z 2K02A
chains in the Genus database with same CATH superfamily
2WAQN 5DEQA 2A68F 4XIDA 3ZP5A 5LD2C 3DFGA 1NH3A 4FTHA 2XRNA 2WADA 3GYHX 1V54H 4AU7A 3OV8A 5HLHA 3ZCOA 2WY8Q 3SYTA 4IL6C 3RKWA 5M5XJ 4MEYF 2R3SA 1O3QA 3PSIA 4L5EA 3SXYA 4HYEA 2RN7A 3BY6A 5IY5H 3DBLB 1ETWA 4BQNA 2K27A 4BDYA 4XKBA 3QWLA 3VODA 1S72I 2Y30A 2FEZA 3C1DA 1ZQ3P 4CCLA 1HLVA 1OCOH 3MKYB 1R4NB 1IN8A 1U78A 3R0AA 1EJ9A 3I4PA 1AA7A 3DWLE 3EQLF 3I4NJ 1MMSA 1XGNA 1Y39A 3I55I 1YS7A 3VYUB 3CD6I 1IO2A 2IP2A 3FMSA 3S2DJ 5H2FC 2L7MP 3HXLA 3FM3A 3JRGA 4QTRA 2E5NA 1Z91A 1FOKA 1VQKI 3AG4H 4L9VA 3E5UA 4EJTA 2IXSA 3KIOA 3FM5A 3ZMSA 2V7FA 1FPQA 3ONQA 4UUVA 1R00A 3COAC 1XSXA 3BG9A 4M6VA 2XRLA 4FE4A 1PUFA 4D5FA 1P4AA 2DJIA 3JTGA 2HS5A 3S2WA 2JSPA 2OCEA 2OQGA 4CO8A 1XGSA 2X0LA 4I2OA 1I1GA 2PBIA 3L2QA 2R7QA 1QHHD 4GFBA 1XX5A 1R9TJ 4PJJA 1TT5B 4F92B 2CH0A 4L9TA 3GZ6A 3QOEA 4NBQA 5K5RA 3W3CA 3H5NA 4A5MA 1P2FA 4G6QA 2KIUA 2VQGA 3DEWA 2WA0A 1GHCA 4G7OF 2V9VA 4PJMA 2VL8A 2NXNB 3BR2A 4HX8A 2EV6A 3F6OA 1CGPA 3FXRA 3H1CA 1G4DA 5IYBJ 4L0YB 1UB9A 2HDDA 5DM6F 2IA0A 4EM0B 2H8RA 2HWVA 4AWXB 1E3OC 4UVBA 3TGNA 1DDNA 2EK5A 1LVAA 3QRFF 3IH3A 1YRNB 2LKXA 2D5VA 2XC7A 4XLPF 3KEQA 1WFXA 2ECBA 3P9IA 3Q0UA 4ENMA 1MMNA 3VSKA 4IRGA 2F2EA 2K4BA 3ROUA 4M9SA 1JGSA 4A69C 5FRNA 2EPFA 2DTZA 1AKHB 4ZYDA 2BW3B 2XHKA 2ZXWH 1S8NA 4FT8A 1U5TB 1DU0A 2CW7A 1SFOJ 2Q2EB 1S29A 1BC8C 2HNHA 4YEJA 3PUBA 4CZCA 1ZHFA 3ASNH 4I0AA 5FGMA 5FROA 2VJ4A 4YELA 3WHBA 4B8XA 5FLXZ 3LA2A 4EM1A 3GXOA 3LSKA 3TBIA 1O3RA 1MSEC 3CUQB 4XRSA 2FQ3A 4K2EA 3W6KB 2NVUB 1TBXA 1WJEA 2J5OA 3MWMA 4A3DJ 4E7JA 5D5VB 1YX5A 1W7PD 4Y3OA 3W2VA 5F64A 3MD2A 5CKTA 1WVRA 3C18A 2HXOA 1RETA 2Y31A 3R6SA 2DFFA 5AONA 3JRHA 1JE8A 2HEOA 4DBRA 1IRFA 3GTJJ 2D2WA 3CMMA 5DD8A 2HTSA 1SEUA 1IRZA 4XSXF 3QYEA 2NVTJ 1RNLA 1B9NA 5C4JJ 1BJAA 4BY1J 2X4HA 1UMQA 4EJOA 1WCMJ 1U0JA 2VXDA 1TLHB 1DPRA 1IDYA 3EUHA 3Q0WA 1XGOA 4O5VA 4MTDA 5EGOB 3BJAA 3DP7A 3MKZA 2MG4A 2CUZA 3FXQA 4M6XA 2KP6A 1IN7A 4KUMA 2VODA 4HDUA 5E17F 2K9SA 4AM3A 3Q9VA 4ESBA 2FOKA 1S7OA 3VB2A 1VI0A 2M9HA 3VYTB 2QQ8A 3OR1C 4XOTA 2KIQA 2QYOA 3CF5F 2HYFA 3F9KA 2B0LA 2Y2ZA 1ZR2A 2M0CA 4BJ6C 1BR4A 3HHHA 3B6AA 3PM1A 5EZGA 3KFWX 1O7LA 4PGGA 2FSWA 3SJMA 2YUSA 5J1UA 4GRIA 4WF2A 2EZLA 1ON2A 3R0JA 3CTAA 3E3VA 5B3SH 1K78B 5CQGA 1I39A 2Q1ZB 5B1BH 3UNGC 1TL8A 2QSHX 3OYBA 5CVVA 4G9YA 3LSPA 2DA3A 2FUG2 2K40A 1LNWA 4A3CJ 1Y8RB 4EVIA 3KLOA 3GCMA 5FD6A 2YX4A 4Y17A 2F4OB 2BOLA 3LA7A 3IRRA 2V9PA 1A31A 4I76A 2BHZA 2Z9OA 1XC5A 4B47A 4RBOA 1T56A 4DYCA 4A3IJ 1VTNC 2VOPA 1XDUA 5C44J 2UV1A 1W1WE 3RI4A 3TL4X 3FZVA 2E5ZA 4MO7A 3NEUA 3OS1A 2XKOA 1AU7A 1BI3A 3S3OA 1N78A 2DPUA 2R7DA 2VBYA 3J80Z 5D5WB 5K7HA 1FP2A 3I9V2 2OZUA 1VFCA 4WXDA 1R4MB 3A2KA 5B66C 3BT9A 3OS2A 2OD5A 5E3OA 1X58A 2J5PA 4NUBA 3WHCA 1VQ8I 3WTSC 3M8EA 3FXUA 3ZQCA 3G1OA 2FNAA 2PLYA 1ZG3A 1Z6RA 2EZKA 2HQNA 3S32A 1G3YA 4N9IA 2M4KA 4D7MA 5E1WA 2PJRA 5JR3A 4M73A 4KIFA 5J1YA 2VBWA 3T8TA 1XGMA 1OCRH 4IHWA 5L3GA 4QSHA 1HW2A 4UVCA 4MTEA 3AG1H 1JGGA 4RB2C 1FYMA 2LFBA 2MH2A 1IZ1A 2XAHA 4J19A 2GXAA 3I56I 3ZQGA 4KISA 4P9UA 4N4OB 2DDBA 1LDKB 3CDLA 3OMYA 4D1QA 1ULYA 3NARA 4Y4RA 2CG4A 2LR8A 1N25A 4F91B 3CMYA 4LLGF 3J7AO 1IF1A 3EYYA 3L2RA 3BG7A 3CC7I 5TRDA 2HPMA 3ZQ7A 2DK5A 5M5WJ 1ACIA 2VIXA 1XPXA 2ZJRF 1DGWY 2IJLA 1IJWC 1U9NA 2A5YB 2OCCH 2FMYA 2P4WA 4G8XA 3ZQHA 1MDMB 4PJLA 2KDOA 1EV7A 3S3MA 2KKOA 2W24A 3CF2A 4HX4A 1J5YA 2QF7A 1SFEA 3CJTB 3HGGA 4H4KC 2DJNA 2XB5A 1ZH5A 1XSVA 1DP3A 3K4LA 1WJCA 2DFHA 3CLQA 1HKSA 3OYGA 2ZXIA 4CA0A 2GOXB 4HLYA 5IYCJ 4IHYA 2R7TA 2KLOA 3IRQA 2QQBA 2MW8A 2Y0SA 4P96A 5FKKA 4BEHA 5E20A 2KMUA 3I5UA 4WK8F 4RM3A 1ETVA 5KAIC 1CF7A 1BW6A 4LITA 5F6FA 3HC7A 2DMQA 4NNJA 4Q47A 5KHDA 3HRSA 3IH2A 1ZLKA 5HLTA 1I6XA 4WCGA 4BNCA 2EIJH 4ZZDA 2F5EA 3OIQA 1W7PB 2X9DA 1ZK8A 2VC0A 3HZJA 4HPQA 2P6SA 3FXMA 2NOJB 4AVPA 1RESA 1SC7A 2A5WA 5E3MA 2ZXJA 1QPMA 4OIPF 3V7CA 3UR3C 4KFCA 1Y6IA 4HSTA 5D6FA 2DDAA 5E1ZB 4ANJA 2O8XA 3JTHA 1R5GA 3QPHA 5FB2A 1TP4A 1TQIA 2JK3A 4M9ZA 2Y0SN 5EG0B 2E34A 1WJAA 4F52A 3ULQB 3B02A 2DA2A 2X48A 1UHSA 2GA2A 4X1EA 5FFXA 3HOZJ 2CO5A 4B48A 3AG2H 3L9FA 4HNTA 3F22A 2VOOA 1JTXA 4B3XA 1TC3C 2GM4A 3BQZA 4RGSA 4ZYHA 5IOZA 4XNFA 2ZBKA 2JRMA 1ZN2A 2RREA 3QPTA 3OIPA 3FK7A 3IC7A 2JUCA 3IWFA 3R60A 4CYCA 2EB7A 4ZTFA 1YW9A 3H3UA 4I02A 2O7OA 2M5WA 1JHFA 3DKXA 3GTLJ 2KIFA 4IO9F 2CU7A 4L9JA 3K10A 1JXSA 2K5CA 3K4KA 4YG2F 4BY7J 3RIRA 1HSTA 3BZ6A 4M72A 5LRSA 3J7ZI 3GX4X 5CVJA 2BXZA 3BPXA 5HLGA 3E5QA 2GLOA 2JWTA 3BPVA 2RQPA 5BQTA 1T98A 2IS2A 4A3EJ 3AFHA 4O3MA 1FX7A 3FWEA 1HOMA 1Q1HA 1WHUA 2L3DA 2A69F 4I7HA 5KCMA 2HVSA 3U1KA 1T6SA 4ASNA 4FCYA 2C6YA 2K9NA 3E0JB 1R22A 5E8GA 3OYIA 1VQ9I 4LFUA 1FBQA 2ZSIB 2HKXA 2O6GE 3MZ8A 2M0MA 3H0DA 4J01A 3LSHA 5E18F 4D9JA 3K6GA 4KITB 5A2QK 4R1HA 2E2JJ 4ZYEA 2NS0A 2R7SA 4XN0A 2LC2A 3I71A 3ZQIA 1YJWI 5BMZA 4YFNF 5EF6A 3WU1B 1BR2A 1TWGJ 4NC7A 2BY2A 1DQUA 3CO7C 1ZRCA 3FXJA 1LUJB 1FYKA 4XOPA 2GA1A 2XAFA 2DYRH 2DMTA 1FOWA 2ZNZA 3I53A 3LFKA 1BIBA 4LB6B 3S8PA 1CQTA 3SDBA 4IXAA 1BL0A 3TOBA 1SVOA 3L00A 1F4KA 2GBYA 3HGYA 2FBKA 2XGCA 2CFOA 4A6EA 2R7XA 4RGRA 4U7DA 5J40A 4J00A 2V6EA 3ZMDA 1PP8F 2BW3A 3M8JA 2RC4A 3ZQQA 2R7UA 3VSLA 2CYYA 1U5TA 4OMZA 4KYWA 2BEOA 4OOIA 2Q2EA 2FX0A 1G3WA 3VEPA 2EA2A 5LHGA 2L4MA 3AKZA 1OCCH 2MD0A 2YS9A 4PZJA 3VOEA 4RLQA 4CZZA 3BWGA 1B6AA 2OUMA 3PO2J 2A61A 2KZVA 3CUQA 4Y7NJ 4A3KJ 1W36C 4M3FA 4F7ZA 5ILSA 1FIPA 1SMTA 2XASA 3IUOA 1ETOA 3E5XA 2V1UA 1P4XA 3K0LA 4HBLA 4RAYA 1B1BA 3B73A 3DBHB 3BR3A 1FP1D 3MN2A 2X1CA 1GVDA 4XL9A 3ZQFA 1ORKA 1ZYRF 4LGWA 4RS8A 3WU0A 2MLGA 2F4MB 4C2TA 4IPAA 2V26A 2JMWA 4CCKA 3GFJA 2Z5UA 3FIWA 4BU2A 3OWTA 1MIJA 3ZMZA 2RNGA 4F93B 2EV5A 2NAZA 3Q9SA 1Z9CA 5C4XJ 4HW0A 2UXXA 5LBQA 4HSRA 1HDDC 3ZRGA 1G3TA 2OC6A 1RR8C 5HS7A 2Y69H 4Y13A 1MJBA 2CGPA 1D5YA 2OU2A 2E60A 2ZMEC 4XRSG 5EGOA 4DQ2A 3JSPA 1QVUA 4DIQA 2VI6A 5KVRA 3W6JB 3A4CA 3G1MA 4A2UA 2IAIA 1X3ZB 3HOTA 3BJ6A 3KP4A 3KZIC 3CCVI 4CCNA 2LDUA 2Q0OA 2M4GA 3ECOA 2O8KA 3KETA 3FHZA 2L02A 2L4AA 1IN4A 2RGVA 2E36A 2V1NA 1OR7C 2EV0A 1YW7A 3G73A 1WSUA 3HOVJ 2LMDA 3H5AA 4LIVA 4LG3A 1S7AA 5EEAA 3DKYA 3H36A 1Y8QB 1O7FA 3S17J 2LKPA 4AYBA 3SDGA 5B1AH 1W0UA 4BQAA 2ZCWA 1WPKA 2DU9A 5TISC 2Z99A 4BJTA 1SVLA 3MKLA 3CO6C 4EM2A 2M7BA 3F8FA 1MMAA 2VJ5A 2LKSA 5M3MJ 4XKWA 5DS9A 1MGTA 3H3ZA 1V55H 1WWXA 3K1NA 2MC3A 3LAJA 1H9TA 4BHCA 2WAQA 3FISA 2P7VB 2HOSA 3BG3A 1LDJA 3GW2A 1D0XA 3D1NI 1B8IB 1ETYA 1GV2A 1GXQA 3HOUJ 3SZTA 2LREA 3DF8A 4D5CA 4XK4A 1U9OA 3I64A 2ZFUA 3KZZA 3R61A 1OCPA 3TO7A 2YU9J 3OL3A 2ME6A 3F8MA 1GLNA 5LEKA 4AYBN 4DYQA 2H27A 1USTA 2GWRA 5FLVA 1RRJA 4FQGA 2X6YA 3AL0C 2COBA 3M8FA 3HUGB 1BR1A 4X0GA 1EH6A 3C2HA 4ZTJA 1YITI 4EJVA 3MKWB 1XTAA 2FF4A 1YX3A 3V8KA 3D5SC 2IGMA 4EJWA 3MAJA 1NTCA 3FF5A 5L3EA 3WG7H 5K5OA 1P9QC 3R4KA 3ZMVA 2XROA 4M71A 4C2UA 2LG4A 5BS6A 2MLKA 2JA2A 3IKVA 1X3UA 2NNYA 2OF7A 3P9KA 1KYWA 2R7WA 1UAAA 3WGGA 3DPTA 3GTMJ 2DPDA 3RTRA 1YOVB 4B3AA 3H35A 2XGXA 1F43A 2ZC2A 5DCMB 2STTA 3KYCB 2YR2A 2H94A 3DU6A 3HKZA 5KK1A 2ZB9A 3BTLA 3GUDA 3DTKA 1BI1A 1IW7F 5K7ZA 5J8CA 4I99C 2EBIA 4EATA 3W2AA 5FLMJ 2PEXA 1OISA 3LAPA 1SVMA 1UZCA 3JAMK 5ILUA 3QU3A 3PFYA 4G6TB 1Z1DA 4N4NB 1UELB 2M7AA 1XS9A 1AHDP 4BXUA 1JJ6C 2F5DA 3OYLA 1WKMA 3A1YA 3BJOA 5C3EJ 1VQ4I 3BR1A 2KQRA 2LY1A 5IPAA 1IAWA 1U8BA 2RQQA 3HKZN 2CUJA 2IA1A 5LGUA 1D8JA 3PNTA 3HRTA 3PIPF 2K7LA 4IJAA 3ZXSA 4AIDA 1H8AC 3G1LA 3LSMA 4E7ZA 1YIJI 2FOWA 4M74A 5GPAA 4CH7A 4PGHA 3L2UA 3F3XA 2MC4A 3DPUA 1QVTA 4FETA 4QWQA 5CPRB 1WRJA 1S5LC 2BY0A 2IA2A 3B6CA 1SD5A 3I0TA 1LB2A 1DGRM 4ZYGA 2JA7J 1MBGA 1WI3A 2CV1A 3UKGA 2EQRA 1VZ0A 1EH8A 3VYSB 1KQ0A 4CUGA 2L7KA 2DI3A 2ELJA 3A03A 3DQVC 2A3SA 4ENNA 1EKEA 2E1OA 2QWWA 2P7CB 1JKRC 3FK6A 5EG0A 2ESHA 1G2HA 1BC7C 1D1BA 4HLXA 1KA8A 1OMIA 1D0ZA 4GO1A 2ISYA 3PJRA 5D4SA 1OCTC 2H1KA 1JTYA 1UG0A 2IS6A 1KONA 2P81A 4P5OA 3S14J 3JW4A 1T0FC 4FASD 1A6IA 2YU3A 5E3LA 3OYMA 1ETQA 1POGA 4YIFA 3J7YJ 4JOMA 1WZ2A 5D4RA 3BQYA 2PN6A 5LRRA 1I6HJ 3LSTA 3S3NA 1HCRA 3CDHA 1Y0NA 1MNDA 2OTJI 2VQHA 1TWHJ 1XDSA 2X6WA 4FHTA 1VQ7I 2B7EA 1GT0C 1FTZA 2W00A 2G9WA 5E1XA 4XLNF 1MMGA 3IL2A 4C9YA 3KYLA 1O3SA 2M45A 2R7VA 3HSFA 2L9VA 2HVQA 2BHYA 2XAJA 3T0YA 1XCVA 3RZDJ 4RM2A 1B72B 2WV1A 4OAYA 3I54A 3KPHA 3DBRB 1S3JA 2R5ZA 2M8EA 3LOCA 1OYIA 1ZRDA 3ZQLA 1MNEA 3HIFA 2MA3A 4XRMA 3T5XA 5DV5A 1LEAA 2XPVA 2K9MA 3O8HA 2R7FA 5LHIA 1QGPA 1QNTA 3ASOH 3VDXA 4DNCA 2ZMEB 1DU6A 3HTUA 5GADJ 2Z1DA 5L3DA 2IEKA 2JPCA 4PK4A 3D5RC 3I59B 3JRDA 2JQ7A 2VUMJ 2M34A 1UCRA 2M30A 2W4SA 4RLFA 1VQPI 2EILH 2Y48A 3DPLC 1WJBA 2DN0A 2HZTA 3M1EA 2HQ5A 4XMYA 3RDIA 3SFIA 3HPGA 1QA6A 5DD4A 3OIOA 3IWZA 1K83J 3ABKH 4U0WA 2DT6A 3GFMA 3PO3J 2CQQA 2VJJA 2KRHA 2XB0X 3ZN0A 1USSA 3ISPA 4YRVA 3JRFA 3EDPA 2QQAA 5LEJA 1P7JA 3AAFA 2LOOA 1YJ9I 2Z3YA 2MABA 4C3IJ 4HQEA 3RKXA 3DV8A 2V79A 3QYFA 2K3FA 3DKWA 4V2GA 4WWCA 3H9JA 2QKMB 1B4AA 4HF2A 1H9GA 5JI6A 3S93A 5L3FA 4A6DA 4G6DA 3G71I 3V4GA 2EFQA 4L18B 2GZWA 2AXLA 2V1DA 5FJ8J 3U21A 4KT6A 3KX2A 2QCOA 3PQKA 4LK1F 4G7HF 1RKTA 3KP6A 5BPIA 4ON0A 4ENKA 3HTSB 3M07A 1X4PA 3PNYA 2E7XA 4V2FA 3ZGKA 3K1MA 4G94A 1R58A 2JA8J 4D0PA 1GV5A 1MJAA 2ESNA 2COMA 4A0YA 1K7AA 3H5RA 1LFPA 3WODF 5L3BA 4AIJA 4LG0B 2K85A 3CJRB 2MFZA 4HEA2 1MZBA 2LVSA 2VKDA 4P55A 3AL0B 1XMAA 1KGSA 4CHUA 1XN7A 3VFZA 2KZGA 3Q5FA 2R0QC 3C2GA 2CRGA 3GTGJ 3CCSI 2XGDA 2VLAA 1YLFA 3A02A 4X6AJ 4CCOA 2WAFA 3Q0VA 2A05A 2XDVA 3LFUA 4B09A 2AXTC 3A01A 3HSRA 2XSJC 2OAZA 3JSOA 5M3FJ 2LD5A 3V7SA 2M8GX 2JVHA 2W57A 2CQXA 5ERIA 5TJJA 4LLLA 2DFEA 2QBYB 1TWAJ 4P9FA 2DBBA 4AUXA 3TQNA 3DTIA 3TOAA 3RPUA 2CW0F 2M2EA 4RB3C 3OYCA 4L5JA 1YW8A 2HQRA 4ENJA 5F27A 1FC3A 4IKFA 1P4WA 1MBJA 3EPZA 4LLNA 4JYKA 2B9SA 4KIGA 2FXAA 2X6XA 3S1QJ 4RAZA 1K4TA 3HG9A 1HQCA 4B4CA 3HB9A 3GTQJ 2PI0A 1V5FA 3SFZA 3NRVA 3TP0A 3CCMI 2HR3A 2V4JC 4XLHA 9ANTA 1KYZA 2MD5A 2ICWG 3SEQA 4GYGA 3IHUA 5LGTA 4XKCA 1RR7A 2M3AA 3QYBA 3BZKA 4UUSB 1IUYA 2F4IA 2XIGA 2DMUA 2CFXA 1W5TA 1ZGJA 1Z21A 3OL4A 2DLLA 1PUEE 1ETKA 1Z05A 1TNSA 2JRTA 4S04A 4AC0A 3FXKA 2A6TA 1B8IA 2WB1N 4ESJA 3DXJF 3G3ZA 5CJ9A 2YX7A 3MMYB 5L3CA 2IT0A 5A2QZ 2V1XA 5FKLA 5KNLA 2VN2A 1C0WA 1FLIA 3E97A 3HUGA 3RYPA 3V42A 3HSEA 2ID3A 2Y75A 3DU5A 2DK8A 4BHPA 1A6QA 1PJRA 2HDWA 4LMYA 2NVXJ 3OYNA 4OWRB 2KJBA 1ENHA 1QU3A 3D0SA 2DOFA 2D1VA 1LEBA 1IV8A 2FJ1A 1P7IA 4R8HA 3MQ0A 2Z16A 1BI0A 4PJ0C 3MZYA 5HDNA 4YFKF 2IW5A 5IP6A 4ZZLA 3PL8A 2W85A 5E8IA 3F8BA 1UG2A 3KP3A 1N77A 2OJED 3BR6A 5CLSA 1ZAOA 5DCMA 1HKQA 5FKNA 1X1BA 3HYIA 1O4XA 3KZYA 2EFOA 5LLQA 1QZEA 1X2NA 3CESA 3KP2A 3QAHA 3L09A 1JJ8C 3HOYJ 4I09A 1FJLA 2EIKH 3S2HJ 1ZTRA 3S15J 2JJ7A 3IKTA 3JRBA 1QHGA 5DTDA 3HPHA 1STZA 1APLC 2MSYA 1NHAA 2LH9A 2VQLA 4CCMA 2E71A 2GIVA 3ECHA 3I58A 4RGXA 3O6BB 4FX0A 4N9HA 4LD5A 4ABZA 3CCRI 2L5QA 5EZHA 3M9AA 4CYDA 5JVTA 1L3LA 5DYMA 2ZXHA 1J09A 4ZC3A 5GAEJ 3VPRA 4A3MJ 1I1SA 3PSFA 5DCFA 4UB8C 4BUPA 3HJEA 1JUSA 3TO6A 1BM9A 4IVNA 5AIQA 4CCJA 1XMXA 2O0YA 3GZNB 3KYDB 5D6EA 5GTIC 1WJ5A 4E4HA 5JLXA 1X2MA 2QSFX 3KCCA 4EQQA 1HF0A 3K2AA 4L9NA 2G7HA 2XAGA 1W0TA 1DUXC 1SANA 3MVPA 4JX5A 2FNPA 4IRIA 1F36A 5AIPA 3H9GA 4RDUA 3F8CA 3TDUC 4ITVA 4E7HA 2JVGA 3HOWJ 3GLLA 1JHHA 2ME0A 2EH3A 4G7ZF 2KIMA 1LFUP 3CCJI 2L7FP 3RKYA 2E7WA 5JFRA 1WH7A 1TWCJ 1SD4A 1YRNA 2GQQA 2P0WA 4XBFA 2XAQA 2NVYJ 1REPC 3CCLI 2VQCA 1X3WB 1D1AA 5FD5A 4B43A 2EFNA 2HXIA 1IDZA 3V8JA 3U9GA 1A36A 5HNFA 1AKHA 3WTWC 1UFMA 2CQ7A 5K7FA 3OYAA 2VT2A 3BOQA 4KDPA 2NYXA 3WGHA 3JR9A 3O3KA 1L0OC 2FE3A 3P7NA 3S1NJ 3K7AJ 4KJZA 2KFDA 5IP9J 1MSFC 1ITYA 3BTCA 2KL4A 2ACJA 2DOEA 4DJAA 2H1LA 1S6LA 1B72A 1TNTA 4GGGA 3BLYA 2HOTA 4JK1X 4XLCA 3ZOBA 4KN7X 1FOXA 3GTPJ 4BE2A 2IGOA 2WWYA 4S05A 5B5EC 3F6VA 4BE0A 3TW6A 2NNNA 3NQOA 4U0VA 1OKRA 4PSXA 2W48A 1J75A 2CMPA 2L9RA 4HZFA 2PMUA 4ZH4F 2CV2A 4UUTA 2MH9A 2ZMEA 2E2IJ 4BXXJ 4KICA 3K70D 4AIHA 2CSOA 2V6CA 3I59A 1ZKGA 4TV7A 2EJRA 4RGUA 4GDFA 5F08A 2VPLA 2ECCA 1JI8A 4BE1A 2E1MB 4CDGA 1OR7A 4NC6A 5F04A 4LK0F 1JKQC 3CCUI 1Z0XA 2DFIA 3LSRA 5GPCA 4NQWB 2OPTA 3ABLH 4OIOF 2DA4A 1FOYA 3J81Z 1MBEA 1RC9A 3K4MA 1MNMC 2QUFA 1A5JA 1WI9A 1Y0UA 4BKXA 4IHTA 3H9QA 3JAMZ 2WAEA 2MGQA 1R71A 1R23A 1OQYA 4F3QA 5J47A 3OR2C 2P5KA 1P92A 1JT0A 2OTLI 4IHSA 4IHVA 1Y1WJ 2QZ8A 1FIAA 1K78A 3LSIA 3K4JA 1T95A 3J7AY 4AVZA 1J2XA 4YIRX 4IQJA 4OAZA 4EMSA 2XVCA 2BY3A 4Q4ZF 4E6KG 3BROA 5EYRA 2QGUA 3BG5A 1ODDA 3LSGA 4A93J 4LG0A 4ZDPA 1IG7A 1RPWA 2H6BA 1JKOC 4U7BA 3MCZA 1G6NA 4U87A 2VONA 2F6CA 5J3LA 4EJUA 2DOAA 3GF2A 3BTJA 5JHUA 3OSFA 3F21A 1XD7A 1GDTA 2L9SA 5CVUA 1E3PA 2DYSH 1FZPB 2KRCA 1BN5A 2VKHA 3EETA 1ZELA 2K9LA 3M3YJ 2WTEA 4W1UA 4DYRA 2HZDA 1KU9A 5F1JA 2Z33A 3H92A 4PSWA 3QOPA 4UY8I 2CW8A 3WTTC 2A07F 2QBYA 3DLAA 3OSGA 1GXPA 2IVMA 2O61A 1QO0D 1FSEA 2VKVA 2DXIA 2BY1A 2VPRA 3HOSA 3EUKL 4C3HJ 2L01A 2EINH 5GTHC 2KT0A 4A3JJ 1FWZA 4MFEA 3SZGA 3T8RA 5K1YA 1Y1VJ 1H0MA 1OYYA 2FRHA 3OOPA 3E6CC 2CV0A 4B1RA 3GEZA 1JKPC 4OU0A 3ZN1A 1V5GA 3L7WA 1FT9A 1LVKA 3WTXC 5IYDJ 2E35A 2K86A 4II3A 1O3TA 1VF9A 1ZGAA 2X1EA 3KEYA 1HSJA 1U2WA 4YFXF 1Z3YA 3P5JA 3J81K 4RAFA 3W2WA 4S0HB 4UUSA 2I8DA 1J9IA 1MDMA 1SFUA 3WE2A 2GIZA 4OINF 2BE5F 4ESFA 2OA4A 2E1NA 2ZO4A 1WJFA 1K79A 1QQIA 3OYKA 4UB6C 3A0HC 1KU3A 2IPQX 5HS9A 4DZPA 1LE8B 2VKEA 4MNUA 4M3EA 4BS9A 1IXSB 4ZYAA 2X51A 2R5YB 1RUOA 1SFKA 5IOYA 2BBYA 2EWNA 2H09A 2LP0A 1G8XA 3L2VA 1TTYA 2HGCA 1K61A 1F5TA 1T39A 2VT3A 4CYCB 3M4OJ 2DT5A 2HFHA 2HU9A 1QZYA 2JT1A 2WY7Q 2ZJ2A 4HQMA 1W7PA 3QU6A 5J8FA 5ILVA 2F5CA 5CQEA 2JN6A 4XLAA 1U6GA 1IRGA 3CP8A 3M7GA 2BVLA 2DW4A 3REOA 4PCQA 3S1MJ 2I10A 1S9HA 2XGEA 3SZPA 4RB1A 1Z77A 5F0HA 3E7LA 1E3HA 2I5UA 3T1BA 2JSCA 5ICCA 1T0FA 2WV0A 2L2OA 3L2WA 5D5UB 2LF8A 1YJNI 4KT5C 1V4RA 1BBYA 3H0GJ 3FKJA 4DGWB 5HVQC 1TW2A 4KIBA 2L7ZA 3K4CA 2L0KA 4UNOA 2PMHA 3CLOA 1QZZA 2IRFG 1TWFJ 2JUGA 1T38A 1XG1A 1X1PA 3E6BA 1HDPA 1FBUA 3FX3A 4RB0A 2IS1A 2JZYA 1E2XA 1VQNI 1PYVA 4NB5A 5IT9K 4XLEA 1OLTA 2LBFB 3I3LA 2PQ8A 3O2PE 3RSNA 3TEDA 3IV5A 1J59A 2BGCA 4A3LJ 2ADUA 3IAS2 5ICGA 5JLWA 1BW5A 2AQEA 2FU4A 2BXYA 4JP0A 5FRMA 2VE9A 3CCQI 3GZ5A 1QRYA 5TGTA 4A3GJ 1Z7LA 2HYGD 2VC1A 3ERED 4BACA 5GAHJ 3BP8A 5E3NA 4QPQA 4HNUA 3K1PA 5E79C 3GBGA 3GWZA 2ELHA 4CSWA 1OPCA 3C7JA 1IV6A 1I27A 4WX9A 1KU7A 2DT7B 1I3AA 4I01A 4O6JA 1RUNA 1J7KA 1SMYF 4MQ9F 3P9CA 1SD6A 1EA3A 3FDYA 3IAM2 2P5LC 1F9NA 2NVQJ 4WXCA 5FKMA 1ONVA 3GO5A 2FD5A 2CQNA 1MBKA 2P6TA 2VXZA 3PUFA 5DUKA 2UWMA 2EZHA 1YHQI 1M1EB 2G7UA 3MEXA 3NWSA 4PFOA 1QBJA 1MKMA 4WXHA 3TDZC 1PP7U 2R92J 1E17A 2BV6A 1LDDA 3HHGA 4II2A 1IRXA 3G6EI 2JPBA 2DA5A 2MYSA 3BZCA 1KQ9A 3BC8A 2CUFA 2W25A 1GUUA 3GVAA 2UUZA 4BHBA 3MFKA 1YG2A 2UZKA 1HW5A 2OV7A 3RJPA 3WG9A 1YS6A 2MBFA 2ZFWA 3K69A 3I4MJ 2E1CA 2RV8A 4OIRF 6PAXA 2NS7A 3SEZA 3QPLA 3U1DA 4GXOA 4H0EA 2XUBA 3TO9A 4MQVA 5HDKA 1Z67A 4P1WA 4UVAA 3A0BC 2WBMA 1Z3XA 1FY7A 3DCFA 5J4VA 4KMFA 2ZNYA 3KP5A 4DOZA 2HYJA 1XMKA 2B63J 3JRAA 3EUHC 2F48A 2HPIA 3ESWB 2DQRA 2R7ZJ 2LY2A 4NHJA 2HTJA 3O8GA 5HLIA 3S1RJ 3VWBA 4BL0B 3QPSA 2BZTA 4BYYA 4KN4X 1ZG5A 2KISA 1I50J 4BAYA 1S7EA 1ZREA 1Z7UA 1PVEA 4HF0A 5CYVA 2KJCA 5F0FA 5M5YJ 3FBIB 2D1HA 2RNJA 3WTZA 2TDXA 2YSRA 1V5EA 2P5VA 4DW6A 2X85A 2P8TA 1SD7A 1R1UA 1R6RA 4Z6YA 4QLCU 2L54A 3OYEA 3OYDA 2RKHA 1BJZA 3JRCA 3GLXA 4OMYA 4A3BJ 3QQAA 4D7NA 2GXBA 2ZJQF 3HDDA 2A6HF 5BPDA 2LTPA 5IT3A 1FTTA 5D8KB 3OYFA 4XSZF 1OYWA 3DEUA 2A6EF 1P6RA 2EFWA 5EJCA 1YO5C 3EYIA 1WH5A 5FO5A 4NQWA 3WE3A 1DPUA 5D8LB 4UV9A 3CC4I 5LFAA 5FLXK 4Y33A 4BXFA 3GFLA 3CC2I 4BBRJ 3K4NA 1B9MA 1R5ID 1MD0A 1W4MA 3NAUA 2CQKA 2E1MC 4A0XA 1X4OA 4JX6A 2KHMA 3HBLA 1W5SA 4CXFA 3FXOA 3E1SA 4FE7A 2FMLA 3HRUA 4IEJA 2WB1A 2BYVE 2O3FA 2RVCA 3E6DA 2V9KA 4E7SA 3KP7A 5K5QA 5LGNA 1PDNC 4AD9A 2VASA 1MBHA 1HC8A 5CVRA 1TQPA 1MBFA 2DMPA 2E2HJ 4MIMA 1T33A 1IN5A 4MLOA 3RZOJ 1ON1A 2WC2A 3DEEA 3HEFA 2DAOA 1K6OA 2W1OA 4B44A 1B59A 3DTEA 3PQJA 1ZRFA 1R1TA 4RA2A 4M3GA 1YYVA 4F55A 4IQ4A 1O57A 1D0YA 1YI2I 1F1ZA 4FX4A 2FBHA 4EV0A 1NK3P 2LSOA 3V8LA 2M87A 1RI7A 4V19K 4HAMA 3TMOA 2FQ4A 2DCEA 2XPWA 3TKYA 1FYLA 2PX9A 3JRIA 1LPQA 1MMDA 4OIQF 2R4GA 3G2BA 2GAUA 3ZMTA 4IHXA 4CICA 3BDDA 3ML6A 2M1BA 2NOGA 3FKIJ 1RKWA 3SQNA 1K6YA 1W5CC 2YPRA 3EUAA 1HBXG 2N8GA 2TCTA 4XQFA 5H6QA 1VQ6I 2HOEA 1LFBA 2QENA 2X1DA 5DM7F 3C2BA 3X2QH 4ETSA 1HA8A 4KMUX 4HNVA 3N05A 3KE2A 3SHFA 3OS0A 1FNNA 1FBSA 2LK2A 2BVMA 4M9XA 3VYRB 4E7IA 1X1CA 3F23A 3RQ4A 4NC8A 4IF4A 3E6MA 2KDZA 1U8RA 3RYRA 1IN6A 2LLKA 4DBQA 1VQOI 1VQLI 1PUFB 1MJ9A 4JX4A 1LKXA 4XN3A 4I6ZA 1D3YA 4PDKA 3RQIA 4RAGA 2R7RA 2Y9ZA 4A5NA 3HL2A 5DDGA 3JCUC 2LNBA 1NG7A 2CWEA 4XLFA 1YQAA 1ETXA 3WTVC 3CJNA 3IH4A 1SFXA 1KZHA 1SAUA 1EH7A 2HDCA 3L2CA 3W6VA 1HW1A 4RMNA 3FBNB 2XV4S 3WU2C 3RPUD 2PFBA 2XAUA 3OOUA 5JVGF 2XF5A 2FA5A 4XORA 2IBDA 1JUPA 1D8KA 2XSDC 4IOAF 3J80K 4IOCF 3CCEI 3ABUA 1AOYA 4EEFG 2JTVA 1MH3A 2PG4A 2HVRA 3GTKJ 4I98B 4E70A 1T08B 4XRFA 1K4SA 2VBZA 3LQRA 1A04A 2DQLA 2GOMA 3TW7A 1QPIA 1LE8A 3LMMA 1FEXA 3CMAI 4AIKA 2LRDA 1YTYA 1UHMA 4ZDOA 4L5IA 1V3FA 2Z2SB 2R5YA 2QM3A 2K9QA 2XF7A 1GVJA 1FMVA 2Q8KA 1YFHA 1D1CA 1YE9A 1BI2A 5EDNA 3CJQB 2X6OA 1Y56A 3LSJA 2EA4A 5DUIA 2ZJPF 1AWCA 2W84A 4UV8A 4XONA 1T2KA 5BOXA 2HQAA 2STWA 2W82A 3K2ZA 3DLLF 3PNVA 3GTOJ 4BDZA 2AHQA 2TRTA 2JA5J 1R5HA 1R1VA 1BOBA 1BOAA 4M6YA 1IXRC 3WTUC 2XF6A 4XR6A 3ELKA 1TQMA 1X1DA 2OBPA 4GYIA 1UJ8A 3QP5A 3HOXJ 1BIAA 3BR5A 2AS5F 1WGXA 2QQ9A 3ZMUA 1DP7P 2QA4I 3OYJA 2QSGX 2O03A 2DA1A 3AG3H 4A12A 4IRHA 4A3FJ 4HF1A 3QODA 2HKOA 2DA7A 2HOAA 4R79A 3LWFA 4U0YA 2W7NA 3CMEI 2R5ZB 5BNGA 4A0ZA 3BG6A 1UHWA 4HG2A 3S16J 3K70C 5FFZA 4C30A 1X1AA 2K3PA 3WGIA 1A35A 1FMWA 1IXCA 2ZSHB 3M1CA 4BGDA 2KRFA 2CJJA 4U88A 4I0BA 1LJ9A 4L0ZB 4LB5A 2PMZA 2EIMH 1JUMA 3BR0A 3CDIA 2O5RA 3C3WA 3G4SI 2CS3A 5H20A 5J6XA 4KA4A 3F0CA 5ED4A 5HODA 4CGZA 5F0CA 1IC8A 2LBFA 4DZJA 4Y52J 2JA6J 4XICA 1NK2P 2QLZA 1OCZH 2O9LA 2AO9A 3RPQA 1XSDA 4FISA 2G0EA 2LF7A 3CP2A 5KAFC 2XKPA 2D45A 1J0RA 2VJIA 1T8IA 5JHFA 4Z2YA 2LYCA 4JQFA 1RZ4A 1MH4A 3WTYC 4Q48A 4HDVA 3OY9A 3GFIA 3MZHA 4XM3A 5FKOA 2PMZN 5ICEA 4IZZA 2UXNA 1VQ5I 4QIWN 2RDPA 3V7RA 3GMEA 3LQQA 4HA8A 3K9TA 1VQMI 4M3BA 2EZIA 5HNHA 3CQZJ 2HI3A 2IGKA 5H6RA 2GXGA 5IP7J 1HXDA 2DO7A 1KQ8A 1WJDA 1XCBA 3HRMA 2E19A 4JBAA 2ELKA 2XPUA 4EGYA 2DTRA 1SAXA 4UXNA 1U5TC 3ABMH 2DMNA 1G59A 1HKTA 1FSHA 4BQOA 2VB6A 3LNQA 2KPMA 4BBSJ 4Y15A 1R49A 1OJLA 3CUQC 2L9NA 1X19A 2CUEA 3LL7A 4LOCA 5J1RA 3PIOF 1JT6A 5GAGJ 3RKQA 4M3DA 4G12A 3PFIA 3D5LA 3FMQA 4PJNA 1XB4A 1I3QJ 4W97A 4BH9A 3L1PA 1D5VA 2F5VA 1E0EA 2Y9YA 3A01B 4BQQA 3BCAA 1H88C 4LIUA 1Z6TA 3CUOA 3LA3A 1ZGWA 4HOBA 3RCOA 4MHGA 1TT0A 4MEXF 1MW7A 1ERDA 4E7KA 1TZLA 3H3VK 2ID6A 3BTIA 2VBXA 1NG6A 5D5XB 3TP3A 2ETHA 2LY9A 4C2MJ 1RIOH 1G3SA 3FXLA 1R7JA 1N75A 1EF4A 5GP9A 2QKLB 4YIIA 1LQ1A 3KLNA 4HX7A 4UHTA 4PFPA 2PJRB 3ZPLA 2PJPA 3CZ6A 4HRIA 2FBIA 1R36A 3CCYA 4LJZF 2EFPA 1ZARA 4ZJZA 1W36D 2H6CA 5HOOA 3QP6A 1ZG1A 4GCVA 2QVOA 3U2RA 2QEXI 3ABTA 1IGNA 2RAEA 3FMRA 3Q3SA 5CVIA 5EEHA 4HV5A 3F72A 1H89C 3JREA 1YIOA 3BCBA 1BA5A 1Q1VA 2OQRA 3N4MA 5LHHA 1WQ2A 5EEGA 2R7OA 4MGRA 1TW3A 3ERMA 3F8NA 3OYHA 1VNDA 4E7LA 2NRAC 1U3EM 3IP4B 2ZKZA 3KEOA 2DA6A 4HV6A 2H8WA 3HM5A 3ZR8X 2IGNA 2NS8A 1IUFA 3N97A 1OFCX 2Y0MA 1I5ZA 5J4YA 4KNYA 4Q5SF 2DODA 2VE8A 2F5FA 3K4BA 4EGZA 1KU2A 3FHNA 4C3JJ 4BEHB 4N0BA 4PUSA 4QPOA 4BJ5C 4MFDA 2OZ6A 4XKVA 5HDGA 1ZR4A 5HS8A 2K4JA 5ICFA 5F1RA 1CF7B 2R93J 1ZLJA 2AQFA 3NWTA 2ISZA 5IT9Z 4IX7A 4NDLA 4ZDLA 2K02A 2IS4A
chains in the Genus database with same CATH topology
5DEQA 2A68F 3ZP5A 3DFGA 2XRNA 3GYHX 3OV8A 5HLHA 3RKWA 4MEYF 2R3SA 1O3QA 3SXYA 4HYEA 2RN7A 3BY6A 2K27A 3VODA 2FEZA 3C1DA 1U78A 1IN8A 3R0AA 3I4PA 3EQLF 1XGNA 1YS7A 2IP2A 3FMSA 3FM3A 1Z91A 1FOKA 4L9VA 3E5UA 4EJTA 3FM5A 3ZMSA 1FPQA 4UUVA 1R00A 3COAC 1XSXA 1P4AA 3JTGA 2HS5A 3S2WA 2OQGA 4CO8A 1XGSA 2X0LA 4I2OA 1I1GA 2PBIA 4L9TA 3GZ6A 5K5RA 4A5MA 1P2FA 4G6QA 2KIUA 1GHCA 4G7OF 2V9VA 4HX8A 2EV6A 3F6OA 1CGPA 3FXRA 1G4DA 4L0YB 1UB9A 2IA0A 4EM0B 2HWVA 4AWXB 4UVBA 3TGNA 1DDNA 2EK5A 1LVAA 3QRFF 4XLPF 3KEQA 3P9IA 4ENMA 4IRGA 2F2EA 2K4BA 3ROUA 4M9SA 1JGSA 4ZYDA 2XHKA 1S8NA 4FT8A 1U5TB 1S29A 1BC8C 1ZHFA 5FGMA 4I0AA 4B8XA 5FLXZ 3LA2A 4EM1A 3GXOA 1O3RA 3CUQB 2FQ3A 4K2EA 3W6KB 1TBXA 2J5OA 3MWMA 5D5VB 1W7PD 5F64A 3C18A 3R6SA 5AONA 1JE8A 2HEOA 1IRFA 2D2WA 5DD8A 2HTSA 4XSXF 1RNLA 1B9NA 1BJAA 2X4HA 4EJOA 1TLHB 1DPRA 3EUHA 1XGOA 4O5VA 4MTDA 3BJAA 3DP7A 3FXQA 4M6XA 1IN7A 4KUMA 2VODA 4HDUA 5E17F 3Q9VA 4ESBA 2FOKA 1S7OA 3VB2A 2QYOA 2HYFA 2B0LA 3HHHA 3KFWX 1O7LA 4PGGA 2FSWA 4WF2A 1ON2A 3R0JA 3CTAA 3E3VA 1K78B 5CVVA 4G9YA 1LNWA 4EVIA 3KLOA 5FD6A 2YX4A 4Y17A 3LA7A 3IRRA 2Z9OA 1VTNC 2VOPA 1XDUA 3RI4A 3FZVA 3NEUA 2XKOA 1BI3A 2DPUA 2R7DA 2VBYA 3J80Z 5D5WB 1FP2A 2OZUA 4WXDA 2OD5A 2J5PA 3WTSC 3M8EA 3FXUA 2FNAA 2PLYA 1ZG3A 1Z6RA 2HQNA 1G3YA 4N9IA 5E1WA 5JR3A 4M73A 4KIFA 2VBWA 3T8TA 1XGMA 5L3GA 1HW2A 4UVCA 4MTEA 4RB2C 1FYMA 2MH2A 1IZ1A 2XAHA 4P9UA 1LDKB 1ULYA 2CG4A 4LLGF 3J7AO 1IF1A 3EYYA 5TRDA 3ZQ7A 2DK5A 2IJLA 2P4WA 2A5YB 2FMYA 4G8XA 1MDMB 1EV7A 2KKOA 2W24A 4HX4A 1J5YA 1SFEA 1ZH5A 1XSVA 1HKSA 4HLYA 3IRQA 2QQBA 4P96A 5E20A 3I5UA 4WK8F 1CF7A 5F6FA 4Q47A 3HRSA 1ZLKA 1I6XA 4WCGA 4BNCA 4ZZDA 2F5EA 1W7PB 2VC0A 2P6SA 4AVPA 2ZXJA 1QPMA 4OIPF 3V7CA 4KFCA 5D6FA 5E1ZB 2O8XA 5FB2A 3JTHA 1R5GA 3QPHA 1TQIA 4M9ZA 3ULQB 3B02A 2GA2A 5FFXA 2CO5A 3L9FA 3F22A 2VOOA 4RGSA 4ZYHA 2ZBKA 1ZN2A 3QPTA 3IC7A 3IWFA 3R60A 2EB7A 1YW9A 3H3UA 4I02A 2M5WA 1JHFA 2KIFA 4L9JA 1JXSA 4YG2F 3RIRA 1HSTA 3BZ6A 4M72A 5LRSA 3GX4X 5CVJA 3BPXA 5HLGA 3E5QA 3BPVA 2RQPA 5BQTA 1T98A 4O3MA 1FX7A 3FWEA 1Q1HA 2L3DA 2A69F 4I7HA 1T6SA 4ASNA 2C6YA 1R22A 5E8GA 4LFUA 1FBQA 2HKXA 2O6GE 5E18F 5A2QK 4R1HA 4ZYEA 2NS0A 3I71A 5BMZA 4YFNF 3WU1B 3CO7C 1ZRCA 1FYKA 2GA1A 2XAFA 2ZNZA 3I53A 3LFKA 1BIBA 4LB6B 4IXAA 3TOBA 3L00A 1F4KA 2FBKA 4A6EA 4RGRA 4U7DA 3ZMDA 1PP8F 2RC4A 2CYYA 1U5TA 4OMZA 4KYWA 2BEOA 4OOIA 2Q2EA 1G3WA 3VEPA 2EA2A 5LHGA 2L4MA 4PZJA 3VOEA 4CZZA 3BWGA 1B6AA 2A61A 3CUQA 4F7ZA 5ILSA 1SMTA 2XASA 3E5XA 2V1UA 1P4XA 3K0LA 4HBLA 4RAYA 1B1BA 3B73A 1FP1D 1ZYRF 4LGWA 4RS8A 3WU0A 2MLGA 4IPAA 3GFJA 2Z5UA 3ZMZA 2EV5A 2NAZA 3Q9SA 1Z9CA 4HW0A 2UXXA 5LBQA 1G3TA 5HS7A 4Y13A 1MJBA 2CGPA 2OU2A 4DQ2A 3JSPA 5KVRA 3W6JB 4A2UA 3HOTA 3BJ6A 3KP4A 2LDUA 2Q0OA 3ECOA 3KETA 3FHZA 2L02A 2L4AA 1IN4A 2RGVA 2EV0A 3G73A 1YW7A 1WSUA 1S7AA 1O7FA 2LKPA 4BQAA 2ZCWA 2DU9A 2Z99A 3CO6C 4EM2A 3F8FA 1MGTA 3H3ZA 1WWXA 3K1NA 2MC3A 3LAJA 1H9TA 4BHCA 2P7VB 3GW2A 1LDJA 1GXQA 3SZTA 3DF8A 3I64A 3KZZA 3R61A 3TO7A 3F8MA 5LEKA 2H27A 1USTA 2GWRA 3M8FA 1EH6A 4EJVA 2FF4A 3V8KA 4EJWA 3MAJA 3FF5A 5L3EA 5K5OA 3R4KA 3ZMVA 2XROA 4M71A 5BS6A 2MLKA 3IKVA 1X3UA 2NNYA 3P9KA 1KYWA 3WGGA 3DPTA 2DPDA 3RTRA 2XGXA 5DCMB 2STTA 2YR2A 2H94A 5KK1A 3GUDA 1BI1A 1IW7F 2PEXA 3LAPA 3JAMK 5ILUA 3QU3A 1Z1DA 4BXUA 2F5DA 1WKMA 3BJOA 1IAWA 2IA1A 5LGUA 1D8JA 3HRTA 2K7LA 4IJAA 4M74A 4PGHA 3F3XA 4QWQA 1WRJA 2IA2A 1SD5A 3I0TA 1LB2A 4ZYGA 1EH8A 1KQ0A 2DI3A 3DQVC 2A3SA 4ENNA 2QWWA 2P7CB 2ESHA 1BC7C 4HLXA 1KA8A 1OMIA 4GO1A 2ISYA 5D4SA 4P5OA 3JW4A 2YU3A 4YIFA 5D4RA 2PN6A 5LRRA 3LSTA 3CDHA 1XDSA 4FHTA 2G9WA 5E1XA 4XLNF 3IL2A 1O3SA 2M45A 3HSFA 2XAJA 3T0YA 1XCVA 3I54A 1S3JA 2M8EA 1OYIA 1ZRDA 3HIFA 2MA3A 3T5XA 5DV5A 1LEAA 2R7FA 5LHIA 1QGPA 1QNTA 4DNCA 2ZMEB 3HTUA 5L3DA 2JPCA 3I59B 1UCRA 2M30A 2Y48A 3DPLC 2HZTA 3M1EA 3RDIA 5DD4A 3IWZA 4U0WA 3GFMA 3ZN0A 1USSA 3ISPA 3EDPA 2QQAA 5LEJA 3AAFA 2Z3YA 4HQEA 3RKXA 3DV8A 2V79A 3DKWA 4WWCA 1B4AA 4HF2A 1H9GA 5JI6A 5L3FA 4A6DA 4G6DA 3V4GA 2EFQA 4L18B 2GZWA 2AXLA 2V1DA 3PQKA 4LK1F 4G7HF 3KP6A 5BPIA 4ON0A 4ENKA 3HTSB 2E7XA 3K1MA 4G94A 1R58A 4D0PA 4A0YA 1MJAA 2ESNA 2COMA 1K7AA 3WODF 5L3BA 4AIJA 4LG0B 4P55A 1MZBA 1XMAA 1KGSA 4CHUA 1XN7A 3VFZA 3Q5FA 1YLFA 4B09A 3HSRA 2OAZA 3JSOA 3V7SA 2W57A 5ERIA 5TJJA 4LLLA 2QBYB 4P9FA 2DBBA 3TQNA 3TOAA 3RPUA 2CW0F 4RB3C 4L5JA 1YW8A 2HQRA 4ENJA 1FC3A 1P4WA 4LLNA 4KIGA 2FXAA 4RAZA 1HQCA 2PI0A 3SFZA 3NRVA 2HR3A 1KYZA 2MD5A 4GYGA 3IHUA 5LGTA 1IUYA 2XIGA 2CFXA 1W5TA 1ZGJA 2DLLA 1PUEE 1Z05A 1TNSA 2JRTA 4S04A 4ESJA 3DXJF 3G3ZA 5CJ9A 2YX7A 5L3CA 2IT0A 5A2QZ 2V1XA 2VN2A 1C0WA 1FLIA 3E97A 3HUGA 3RYPA 3HSEA 2Y75A 2DK8A 4BHPA 4LMYA 2KJBA 3D0SA 2D1VA 1LEBA 4R8HA 3MQ0A 1BI0A 3MZYA 5HDNA 4YFKF 2IW5A 4ZZLA 2W85A 5E8IA 3F8BA 3KP3A 5CLSA 1ZAOA 5DCMA 1HKQA 3HYIA 3KZYA 2EFOA 5LLQA 3KP2A 3QAHA 3L09A 4I09A 3IKTA 1STZA 1NHAA 2GIVA 3ECHA 3I58A 4RGXA 3O6BB 4FX0A 4N9HA 4LD5A 3M9AA 4CYDA 5JVTA 1L3LA 5DYMA 1I1SA 5DCFA 3TO6A 1BM9A 4IVNA 5AIQA 5J8CA 2O0YA 5D6EA 3KCCA 4EQQA 4L9NA 2G7HA 2XAGA 1DUXC 2FNPA 4IRIA 5AIPA 3F8CA 3TDUC 1JHHA 4G7ZF 2KIMA 3RKYA 2E7WA 5JFRA 1SD4A 2GQQA 4XBFA 2XAQA 1REPC 5FD5A 2EFNA 3V8JA 3U9GA 3WTWC 1UFMA 2VT2A 3BOQA 4KDPA 2NYXA 3WGHA 3O3KA 1L0OC 2FE3A 3P7NA 2ACJA 1S6LA 1TNTA 4GGGA 4JK1X 4KN7X 2WWYA 4S05A 3F6VA 2NNNA 3NQOA 4U0VA 1OKRA 1J75A 4HZFA 2PMUA 4ZH4F 2MH9A 2ZMEA 4KICA 4AIHA 2CSOA 2V6CA 3I59A 4TV7A 2EJRA 4RGUA 4CDGA 1OR7A 4LK0F 2DFIA 4OIOF 3J81Z 2QUFA 1WI9A 1Y0UA 4IHTA 3JAMZ 1R23A 2P5KA 1P92A 4IHSA 2QZ8A 1K78A 1J2XA 4EMSA 2XVCA 4Q4ZF 3BROA 1ODDA 4LG0A 2H6BA 4U7BA 3MCZA 1G6NA 2VONA 4EJUA 3GF2A 5JHUA 3F21A 1XD7A 5CVUA 1FZPB 1BN5A 3EETA 2WTEA 1KU9A 2Z33A 3H92A 3QOPA 3WTTC 2QBYA 2A07F 1GXPA 2IVMA 2O61A 1QO0D 1FSEA 3HOSA 2L01A 1FWZA 3T8RA 5K1YA 1H0MA 1OYYA 2FRHA 3OOPA 3E6CC 3GEZA 4OU0A 3ZN1A 3L7WA 1FT9A 3WTXC 2K86A 1O3TA 1ZGAA 1HSJA 1U2WA 4YFXF 3J81K 1J9IA 1MDMA 1SFUA 3WE2A 4OINF 2BE5F 4ESFA 2OA4A 2E1NA 2ZO4A 1K79A 1QQIA 1KU3A 2IPQX 5HS9A 4MNUA 1IXSB 1RUOA 2BBYA 2EWNA 2H09A 1TTYA 2HGCA 1F5TA 1T39A 2VT3A 2DT5A 2HFHA 1QZYA 2JT1A 2ZJ2A 4HQMA 1W7PA 3QU6A 5J8FA 5ILVA 2F5CA 1U6GA 1IRGA 3M7GA 2DW4A 3REOA 4PCQA 3SZPA 4RB1A 3T1BA 5ICCA 2JSCA 1T0FA 2WV0A 5D5UB 2LF8A 4KT5C 1V4RA 1BBYA 5HVQC 1TW2A 4KIBA 4UNOA 2PMHA 3CLOA 1QZZA 2IRFG 1T38A 3E6BA 4RB0A 1FBUA 3FX3A 2JZYA 1E2XA 4NB5A 5IT9K 3O2PE 2PQ8A 1J59A 2BGCA 2ADUA 5ICGA 2FU4A 2VE9A 3GZ5A 2HYGD 2VC1A 3ERED 3BP8A 3K1PA 3GWZA 2ELHA 1OPCA 3C7JA 1I27A 4WX9A 1KU7A 4I01A 4O6JA 1RUNA 1J7KA 1SMYF 4MQ9F 3P9CA 1SD6A 2P5LC 1F9NA 4WXCA 1ONVA 3GO5A 2P6TA 2VXZA 5DUKA 2UWMA 2G7UA 3MEXA 1QBJA 1MKMA 4WXHA 3TDZC 1PP7U 1E17A 2BV6A 1LDDA 3HHGA 2JPBA 1KQ9A 2W25A 3GVAA 4BHBA 3MFKA 1YG2A 2UZKA 1HW5A 3RJPA 3WG9A 1YS6A 2MBFA 2ZFWA 3K69A 2E1CA 2RV8A 4OIRF 6PAXA 3U1DA 4GXOA 4H0EA 2XUBA 3TO9A 4MQVA 5HDKA 4UVAA 1FY7A 4KMFA 2ZNYA 3KP5A 1XMKA 2DQRA 4NHJA 2HTJA 5HLIA 4BYYA 4KN4X 1ZG5A 4BAYA 1ZREA 1Z7UA 4HF0A 5CYVA 2KJCA 2D1HA 2RNJA 3WTZA 2TDXA 2YSRA 2P5VA 2P8TA 1SD7A 1R1UA 4QLCU 2L54A 2RKHA 3GLXA 4OMYA 2GXBA 2A6HF 5BPDA 5IT3A 5D8KB 4XSZF 1OYWA 3DEUA 2A6EF 1P6RA 2EFWA 1YO5C 3EYIA 5FO5A 1DPUA 4NQWA 3WE3A 5D8LB 4UV9A 5FLXK 3GFLA 1B9MA 1MD0A 1W4MA 2CQKA 4A0XA 1W5SA 4CXFA 2FMLA 3HRUA 2BYVE 2O3FA 2RVCA 3E6DA 3KP7A 5K5QA 5LGNA 1PDNC 4AD9A 5CVRA 1TQPA 1IN5A 1ON1A 2WC2A 2DAOA 1K6OA 1B59A 3PQJA 1ZRFA 1R1TA 1YYVA 1O57A 1F1ZA 4FX4A 2FBHA 4EV0A 2LSOA 3V8LA 2M87A 1RI7A 4HAMA 3TKYA 1FYLA 4OIQF 2GAUA 3ZMTA 4CICA 3BDDA 3ML6A 2M1BA 3SQNA 2YPRA 1HBXG 5H6QA 2HOEA 2QENA 4ETSA 4KMUX 3KE2A 3SHFA 1FNNA 1FBSA 4M9XA 3F23A 4IF4A 3E6MA 1U8RA 3RYRA 1IN6A 1MJ9A 1D3YA 4PDKA 4A5NA 5DDGA 2LNBA 2CWEA 1YQAA 3WTVC 3CJNA 1SFXA 1EH7A 2HDCA 3L2CA 1HW1A 2XV4S 2PFBA 2FA5A 1D8KA 3J80K 3ABUA 1AOYA 2JTVA 2PG4A 4I98B 4E70A 4XRFA 2VBZA 3LQRA 1A04A 2DQLA 4AIKA 1YTYA 1UHMA 4L5IA 1V3FA 2QM3A 1GVJA 2Q8KA 1YFHA 1BI2A 1AWCA 2EA4A 5DUIA 2W84A 4UV8A 1T2KA 5BOXA 2STWA 3K2ZA 1R5HA 1R1VA 1BOAA 4M6YA 1IXRC 3WTUC 3ELKA 1TQMA 2OBPA 4GYIA 3QP5A 1BIAA 2AS5F 2QQ9A 3ZMUA 1DP7P 2O03A 4A12A 4IRHA 4HF1A 2HKOA 4R79A 3LWFA 4U0YA 4A0ZA 1UHWA 5FFZA 3WGIA 1IXCA 2KRFA 4U88A 4I0BA 1LJ9A 4L0ZB 4LB5A 3C3WA 4KA4A 5H20A 5J6XA 5ED4A 4CGZA 2QLZA 3RPQA 1XSDA 2LF7A 2XKPA 2D45A 1J0RA 4Z2YA 4JQFA 1RZ4A 3WTYC 4Q48A 4HDVA 3GFIA 3MZHA 5ICEA 2UXNA 2RDPA 3V7RA 3LQQA 4HA8A 3K9TA 5H6RA 2GXGA 1HXDA 2DO7A 1KQ8A 1XCBA 3HRMA 4JBAA 4EGYA 2DTRA 1SAXA 4UXNA 1U5TC 1HKTA 1FSHA 4Y15A 3CUQC 3PFIA 3D5LA 3FMQA 1XB4A 4BH9A 1D5VA 1Z6TA 3CUOA 3LA3A 4HOBA 4MHGA 4MEXF 5D5XB 2VBXA 2ETHA 1RIOH 1G3SA 1R7JA 4YIIA 1LQ1A 3KLNA 4HX7A 4UHTA 3ZPLA 2PJPA 2FBIA 1R36A 4LJZF 2EFPA 1ZARA 2H6CA 5HOOA 3QP6A 1ZG1A 4GCVA 2QVOA 3U2RA 3ABTA 3FMRA 5CVIA 5EEHA 4HV5A 3F72A 1YIOA 2OQRA 3N4MA 5LHHA 1WQ2A 5EEGA 4MGRA 1TW3A 3F8NA 2NRAC 1U3EM 2ZKZA 3KEOA 4HV6A 3N97A 2Y0MA 1I5ZA 4KNYA 4Q5SF 2VE8A 2F5FA 4EGZA 1KU2A 4N0BA 2OZ6A 5HDGA 5HS8A 2K4JA 5ICFA 5F1RA 1CF7B 1ZLJA 2ISZA 5IT9Z 2K02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DEQ A;  2A68 F;  3ZP5 A;  3DFG A;  2XRN A;  3GYH X;  3OV8 A;  5HLH A;  3RKW A;  4MEY F;  2R3S A;  1O3Q A;  3SXY A;  4HYE A;  2RN7 A;  3BY6 A;  2K27 A;  3VOD A;  2FEZ A;  3C1D A;  1U78 A;  1IN8 A;  3R0A A;  3I4P A;  3EQL F;  1XGN A;  1YS7 A;  2IP2 A;  3FMS A;  3FM3 A;  1Z91 A;  1FOK A;  4L9V A;  3E5U A;  4EJT A;  3FM5 A;  3ZMS A;  1FPQ A;  4UUV A;  1R00 A;  3COA C;  1XSX A;  1P4A A;  3JTG A;  2HS5 A;  3S2W A;  2OQG A;  4CO8 A;  1XGS A;  2X0L A;  4I2O A;  1I1G A;  2PBI A;  4L9T A;  3GZ6 A;  5K5R A;  4A5M A;  1P2F A;  4G6Q A;  2KIU A;  1GHC A;  4G7O F;  2V9V A;  4HX8 A;  2EV6 A;  3F6O A;  1CGP A;  3FXR A;  1G4D A;  4L0Y B;  1UB9 A;  2IA0 A;  4EM0 B;  2HWV A;  4AWX B;  4UVB A;  3TGN A;  1DDN A;  2EK5 A;  1LVA A;  3QRF F;  4XLP F;  3KEQ A;  3P9I A;  4ENM A;  4IRG A;  2F2E A;  2K4B A;  3ROU A;  4M9S A;  1JGS A;  4ZYD A;  2XHK A;  1S8N A;  4FT8 A;  1U5T B;  1S29 A;  1BC8 C;  1ZHF A;  5FGM A;  4I0A A;  4B8X A;  5FLX Z;  3LA2 A;  4EM1 A;  3GXO A;  1O3R A;  3CUQ B;  2FQ3 A;  4K2E A;  3W6K B;  1TBX A;  2J5O A;  3MWM A;  5D5V B;  1W7P D;  5F64 A;  3C18 A;  3R6S A;  5AON A;  1JE8 A;  2HEO A;  1IRF A;  2D2W A;  5DD8 A;  2HTS A;  4XSX F;  1RNL A;  1B9N A;  1BJA A;  2X4H A;  4EJO A;  1TLH B;  1DPR A;  3EUH A;  1XGO A;  4O5V A;  4MTD A;  3BJA A;  3DP7 A;  3FXQ A;  4M6X A;  1IN7 A;  4KUM A;  2VOD A;  4HDU A;  5E17 F;  3Q9V A;  4ESB A;  2FOK A;  1S7O A;  3VB2 A;  2QYO A;  2HYF A;  2B0L A;  3HHH A;  3KFW X;  1O7L A;  4PGG A;  2FSW A;  4WF2 A;  1ON2 A;  3R0J A;  3CTA A;  3E3V A;  1K78 B;  5CVV A;  4G9Y A;  1LNW A;  4EVI A;  3KLO A;  5FD6 A;  2YX4 A;  4Y17 A;  3LA7 A;  3IRR A;  2Z9O A;  1VTN C;  2VOP A;  1XDU A;  3RI4 A;  3FZV A;  3NEU A;  2XKO A;  1BI3 A;  2DPU A;  2R7D A;  2VBY A;  3J80 Z;  5D5W B;  1FP2 A;  2OZU A;  4WXD A;  2OD5 A;  2J5P A;  3WTS C;  3M8E A;  3FXU A;  2FNA A;  2PLY A;  1ZG3 A;  1Z6R A;  2HQN A;  1G3Y A;  4N9I A;  5E1W A;  5JR3 A;  4M73 A;  4KIF A;  2VBW A;  3T8T A;  1XGM A;  5L3G A;  1HW2 A;  4UVC A;  4MTE A;  4RB2 C;  1FYM A;  2MH2 A;  1IZ1 A;  2XAH A;  4P9U A;  1LDK B;  1ULY A;  2CG4 A;  4LLG F;  3J7A O;  1IF1 A;  3EYY A;  5TRD A;  3ZQ7 A;  2DK5 A;  2IJL A;  2P4W A;  2A5Y B;  2FMY A;  4G8X A;  1MDM B;  1EV7 A;  2KKO A;  2W24 A;  4HX4 A;  1J5Y A;  1SFE A;  1ZH5 A;  1XSV A;  1HKS A;  4HLY A;  3IRQ A;  2QQB A;  4P96 A;  5E20 A;  3I5U A;  4WK8 F;  1CF7 A;  5F6F A;  4Q47 A;  3HRS A;  1ZLK A;  1I6X A;  4WCG A;  4BNC A;  4ZZD A;  2F5E A;  1W7P B;  2VC0 A;  2P6S A;  4AVP A;  2ZXJ A;  1QPM A;  4OIP F;  3V7C A;  4KFC A;  5D6F A;  5E1Z B;  2O8X A;  5FB2 A;  3JTH A;  1R5G A;  3QPH A;  1TQI A;  4M9Z A;  3ULQ B;  3B02 A;  2GA2 A;  5FFX A;  2CO5 A;  3L9F A;  3F22 A;  2VOO A;  4RGS A;  4ZYH A;  2ZBK A;  1ZN2 A;  3QPT A;  3IC7 A;  3IWF A;  3R60 A;  2EB7 A;  1YW9 A;  3H3U A;  4I02 A;  2M5W A;  1JHF A;  2KIF A;  4L9J A;  1JXS A;  4YG2 F;  3RIR A;  1HST A;  3BZ6 A;  4M72 A;  5LRS A;  3GX4 X;  5CVJ A;  3BPX A;  5HLG A;  3E5Q A;  3BPV A;  2RQP A;  5BQT A;  1T98 A;  4O3M A;  1FX7 A;  3FWE A;  1Q1H A;  2L3D A;  2A69 F;  4I7H A;  1T6S A;  4ASN A;  2C6Y A;  1R22 A;  5E8G A;  4LFU A;  1FBQ A;  2HKX A;  2O6G E;  5E18 F;  5A2Q K;  4R1H A;  4ZYE A;  2NS0 A;  3I71 A;  5BMZ A;  4YFN F;  3WU1 B;  3CO7 C;  1ZRC A;  1FYK A;  2GA1 A;  2XAF A;  2ZNZ A;  3I53 A;  3LFK A;  1BIB A;  4LB6 B;  4IXA A;  3TOB A;  3L00 A;  1F4K A;  2FBK A;  4A6E A;  4RGR A;  4U7D A;  3ZMD A;  1PP8 F;  2RC4 A;  2CYY A;  1U5T A;  4OMZ A;  4KYW A;  2BEO A;  4OOI A;  2Q2E A;  1G3W A;  3VEP A;  2EA2 A;  5LHG A;  2L4M A;  4PZJ A;  3VOE A;  4CZZ A;  3BWG A;  1B6A A;  2A61 A;  3CUQ A;  4F7Z A;  5ILS A;  1SMT A;  2XAS A;  3E5X A;  2V1U A;  1P4X A;  3K0L A;  4HBL A;  4RAY A;  1B1B A;  3B73 A;  1FP1 D;  1ZYR F;  4LGW A;  4RS8 A;  3WU0 A;  2MLG A;  4IPA A;  3GFJ A;  2Z5U A;  3ZMZ A;  2EV5 A;  2NAZ A;  3Q9S A;  1Z9C A;  4HW0 A;  2UXX A;  5LBQ A;  1G3T A;  5HS7 A;  4Y13 A;  1MJB A;  2CGP A;  2OU2 A;  4DQ2 A;  3JSP A;  5KVR A;  3W6J B;  4A2U A;  3HOT A;  3BJ6 A;  3KP4 A;  2LDU A;  2Q0O A;  3ECO A;  3KET A;  3FHZ A;  2L02 A;  2L4A A;  1IN4 A;  2RGV A;  2EV0 A;  3G73 A;  1YW7 A;  1WSU A;  1S7A A;  1O7F A;  2LKP A;  4BQA A;  2ZCW A;  2DU9 A;  2Z99 A;  3CO6 C;  4EM2 A;  3F8F A;  1MGT A;  3H3Z A;  1WWX A;  3K1N A;  2MC3 A;  3LAJ A;  1H9T A;  4BHC A;  2P7V B;  3GW2 A;  1LDJ A;  1GXQ A;  3SZT A;  3DF8 A;  3I64 A;  3KZZ A;  3R61 A;  3TO7 A;  3F8M A;  5LEK A;  2H27 A;  1UST A;  2GWR A;  3M8F A;  1EH6 A;  4EJV A;  2FF4 A;  3V8K A;  4EJW A;  3MAJ A;  3FF5 A;  5L3E A;  5K5O A;  3R4K A;  3ZMV A;  2XRO A;  4M71 A;  5BS6 A;  2MLK A;  3IKV A;  1X3U A;  2NNY A;  3P9K A;  1KYW A;  3WGG A;  3DPT A;  2DPD A;  3RTR A;  2XGX A;  5DCM B;  2STT A;  2YR2 A;  2H94 A;  5KK1 A;  3GUD A;  1BI1 A;  1IW7 F;  2PEX A;  3LAP A;  3JAM K;  5ILU A;  3QU3 A;  1Z1D A;  4BXU A;  2F5D A;  1WKM A;  3BJO A;  1IAW A;  2IA1 A;  5LGU A;  1D8J A;  3HRT A;  2K7L A;  4IJA A;  4M74 A;  4PGH A;  3F3X A;  4QWQ A;  1WRJ A;  2IA2 A;  1SD5 A;  3I0T A;  1LB2 A;  4ZYG A;  1EH8 A;  1KQ0 A;  2DI3 A;  3DQV C;  2A3S A;  4ENN A;  2QWW A;  2P7C B;  2ESH A;  1BC7 C;  4HLX A;  1KA8 A;  1OMI A;  4GO1 A;  2ISY A;  5D4S A;  4P5O A;  3JW4 A;  2YU3 A;  4YIF A;  5D4R A;  2PN6 A;  5LRR A;  3LST A;  3CDH A;  1XDS A;  4FHT A;  2G9W A;  5E1X A;  4XLN F;  3IL2 A;  1O3S A;  2M45 A;  3HSF A;  2XAJ A;  3T0Y A;  1XCV A;  3I54 A;  1S3J A;  2M8E A;  1OYI A;  1ZRD A;  3HIF A;  2MA3 A;  3T5X A;  5DV5 A;  1LEA A;  2R7F A;  5LHI A;  1QGP A;  1QNT A;  4DNC A;  2ZME B;  3HTU A;  5L3D A;  2JPC A;  3I59 B;  1UCR A;  2M30 A;  2Y48 A;  3DPL C;  2HZT A;  3M1E A;  3RDI A;  5DD4 A;  3IWZ A;  4U0W A;  3GFM A;  3ZN0 A;  1USS A;  3ISP A;  3EDP A;  2QQA A;  5LEJ A;  3AAF A;  2Z3Y A;  4HQE A;  3RKX A;  3DV8 A;  2V79 A;  3DKW A;  4WWC A;  1B4A A;  4HF2 A;  1H9G A;  5JI6 A;  5L3F A;  4A6D A;  4G6D A;  3V4G A;  2EFQ A;  4L18 B;  2GZW A;  2AXL A;  2V1D A;  3PQK A;  4LK1 F;  4G7H F;  3KP6 A;  5BPI A;  4ON0 A;  4ENK A;  3HTS B;  2E7X A;  3K1M A;  4G94 A;  1R58 A;  4D0P A;  4A0Y A;  1MJA A;  2ESN A;  2COM A;  1K7A A;  3WOD F;  5L3B A;  4AIJ A;  4LG0 B;  4P55 A;  1MZB A;  1XMA A;  1KGS A;  4CHU A;  1XN7 A;  3VFZ A;  3Q5F A;  1YLF A;  4B09 A;  3HSR A;  2OAZ A;  3JSO A;  3V7S A;  2W57 A;  5ERI A;  5TJJ A;  4LLL A;  2QBY B;  4P9F A;  2DBB A;  3TQN A;  3TOA A;  3RPU A;  2CW0 F;  4RB3 C;  4L5J A;  1YW8 A;  2HQR A;  4ENJ A;  1FC3 A;  1P4W A;  4LLN A;  4KIG A;  2FXA A;  4RAZ A;  1HQC A;  2PI0 A;  3SFZ A;  3NRV A;  2HR3 A;  1KYZ A;  2MD5 A;  4GYG A;  3IHU A;  5LGT A;  1IUY A;  2XIG A;  2CFX A;  1W5T A;  1ZGJ A;  2DLL A;  1PUE E;  1Z05 A;  1TNS A;  2JRT A;  4S04 A;  4ESJ A;  3DXJ F;  3G3Z A;  5CJ9 A;  2YX7 A;  5L3C A;  2IT0 A;  5A2Q Z;  2V1X A;  2VN2 A;  1C0W A;  1FLI A;  3E97 A;  3HUG A;  3RYP A;  3HSE A;  2Y75 A;  2DK8 A;  4BHP A;  4LMY A;  2KJB A;  3D0S A;  2D1V A;  1LEB A;  4R8H A;  3MQ0 A;  1BI0 A;  3MZY A;  5HDN A;  4YFK F;  2IW5 A;  4ZZL A;  2W85 A;  5E8I A;  3F8B A;  3KP3 A;  5CLS A;  1ZAO A;  5DCM A;  1HKQ A;  3HYI A;  3KZY A;  2EFO A;  5LLQ A;  3KP2 A;  3QAH A;  3L09 A;  4I09 A;  3IKT A;  1STZ A;  1NHA A;  2GIV A;  3ECH A;  3I58 A;  4RGX A;  3O6B B;  4FX0 A;  4N9H A;  4LD5 A;  3M9A A;  4CYD A;  5JVT A;  1L3L A;  5DYM A;  1I1S A;  5DCF A;  3TO6 A;  1BM9 A;  4IVN A;  5AIQ A;  5J8C A;  2O0Y A;  5D6E A;  3KCC A;  4EQQ A;  4L9N A;  2G7H A;  2XAG A;  1DUX C;  2FNP A;  4IRI A;  5AIP A;  3F8C A;  3TDU C;  1JHH A;  4G7Z F;  2KIM A;  3RKY A;  2E7W A;  5JFR A;  1SD4 A;  2GQQ A;  4XBF A;  2XAQ A;  1REP C;  5FD5 A;  2EFN A;  3V8J A;  3U9G A;  3WTW C;  1UFM A;  2VT2 A;  3BOQ A;  4KDP A;  2NYX A;  3WGH A;  3O3K A;  1L0O C;  2FE3 A;  3P7N A;  2ACJ A;  1S6L A;  1TNT A;  4GGG A;  4JK1 X;  4KN7 X;  2WWY A;  4S05 A;  3F6V A;  2NNN A;  3NQO A;  4U0V A;  1OKR A;  1J75 A;  4HZF A;  2PMU A;  4ZH4 F;  2MH9 A;  2ZME A;  4KIC A;  4AIH A;  2CSO A;  2V6C A;  3I59 A;  4TV7 A;  2EJR A;  4RGU A;  4CDG A;  1OR7 A;  4LK0 F;  2DFI A;  4OIO F;  3J81 Z;  2QUF A;  1WI9 A;  1Y0U A;  4IHT A;  3JAM Z;  1R23 A;  2P5K A;  1P92 A;  4IHS A;  2QZ8 A;  1K78 A;  1J2X A;  4EMS A;  2XVC A;  4Q4Z F;  3BRO A;  1ODD A;  4LG0 A;  2H6B A;  4U7B A;  3MCZ A;  1G6N A;  2VON A;  4EJU A;  3GF2 A;  5JHU A;  3F21 A;  1XD7 A;  5CVU A;  1FZP B;  1BN5 A;  3EET A;  2WTE A;  1KU9 A;  2Z33 A;  3H92 A;  3QOP A;  3WTT C;  2QBY A;  2A07 F;  1GXP A;  2IVM A;  2O61 A;  1QO0 D;  1FSE A;  3HOS A;  2L01 A;  1FWZ A;  3T8R A;  5K1Y A;  1H0M A;  1OYY A;  2FRH A;  3OOP A;  3E6C C;  3GEZ A;  4OU0 A;  3ZN1 A;  3L7W A;  1FT9 A;  3WTX C;  2K86 A;  1O3T A;  1ZGA A;  1HSJ A;  1U2W A;  4YFX F;  3J81 K;  1J9I A;  1MDM A;  1SFU A;  3WE2 A;  4OIN F;  2BE5 F;  4ESF A;  2OA4 A;  2E1N A;  2ZO4 A;  1K79 A;  1QQI A;  1KU3 A;  2IPQ X;  5HS9 A;  4MNU A;  1IXS B;  1RUO A;  2BBY A;  2EWN A;  2H09 A;  1TTY A;  2HGC A;  1F5T A;  1T39 A;  2VT3 A;  2DT5 A;  2HFH A;  1QZY A;  2JT1 A;  2ZJ2 A;  4HQM A;  1W7P A;  3QU6 A;  5J8F A;  5ILV A;  2F5C A;  1U6G A;  1IRG A;  3M7G A;  2DW4 A;  3REO A;  4PCQ A;  3SZP A;  4RB1 A;  3T1B A;  5ICC A;  2JSC A;  1T0F A;  2WV0 A;  5D5U B;  2LF8 A;  4KT5 C;  1V4R A;  1BBY A;  5HVQ C;  1TW2 A;  4KIB A;  4UNO A;  2PMH A;  3CLO A;  1QZZ A;  2IRF G;  1T38 A;  3E6B A;  4RB0 A;  1FBU A;  3FX3 A;  2JZY A;  1E2X A;  4NB5 A;  5IT9 K;  3O2P E;  2PQ8 A;  1J59 A;  2BGC A;  2ADU A;  5ICG A;  2FU4 A;  2VE9 A;  3GZ5 A;  2HYG D;  2VC1 A;  3ERE D;  3BP8 A;  3K1P A;  3GWZ A;  2ELH A;  1OPC A;  3C7J A;  1I27 A;  4WX9 A;  1KU7 A;  4I01 A;  4O6J A;  1RUN A;  1J7K A;  1SMY F;  4MQ9 F;  3P9C A;  1SD6 A;  2P5L C;  1F9N A;  4WXC A;  1ONV A;  3GO5 A;  2P6T A;  2VXZ A;  5DUK A;  2UWM A;  2G7U A;  3MEX A;  1QBJ A;  1MKM A;  4WXH A;  3TDZ C;  1PP7 U;  1E17 A;  2BV6 A;  1LDD A;  3HHG A;  2JPB A;  1KQ9 A;  2W25 A;  3GVA A;  4BHB A;  3MFK A;  1YG2 A;  2UZK A;  1HW5 A;  3RJP A;  3WG9 A;  1YS6 A;  2MBF A;  2ZFW A;  3K69 A;  2E1C A;  2RV8 A;  4OIR F;  6PAX A;  3U1D A;  4GXO A;  4H0E A;  2XUB A;  3TO9 A;  4MQV A;  5HDK A;  4UVA A;  1FY7 A;  4KMF A;  2ZNY A;  3KP5 A;  1XMK A;  2DQR A;  4NHJ A;  2HTJ A;  5HLI A;  4BYY A;  4KN4 X;  1ZG5 A;  4BAY A;  1ZRE A;  1Z7U A;  4HF0 A;  5CYV A;  2KJC A;  2D1H A;  2RNJ A;  3WTZ A;  2TDX A;  2YSR A;  2P5V A;  2P8T A;  1SD7 A;  1R1U A;  4QLC U;  2L54 A;  2RKH A;  3GLX A;  4OMY A;  2GXB A;  2A6H F;  5BPD A;  5IT3 A;  5D8K B;  4XSZ F;  1OYW A;  3DEU A;  2A6E F;  1P6R A;  2EFW A;  1YO5 C;  3EYI A;  5FO5 A;  1DPU A;  4NQW A;  3WE3 A;  5D8L B;  4UV9 A;  5FLX K;  3GFL A;  1B9M A;  1MD0 A;  1W4M A;  2CQK A;  4A0X A;  1W5S A;  4CXF A;  2FML A;  3HRU A;  2BYV E;  2O3F A;  2RVC A;  3E6D A;  3KP7 A;  5K5Q A;  5LGN A;  1PDN C;  4AD9 A;  5CVR A;  1TQP A;  1IN5 A;  1ON1 A;  2WC2 A;  2DAO A;  1K6O A;  1B59 A;  3PQJ A;  1ZRF A;  1R1T A;  1YYV A;  1O57 A;  1F1Z A;  4FX4 A;  2FBH A;  4EV0 A;  2LSO A;  3V8L A;  2M87 A;  1RI7 A;  4HAM A;  3TKY A;  1FYL A;  4OIQ F;  2GAU A;  3ZMT A;  4CIC A;  3BDD A;  3ML6 A;  2M1B A;  3SQN A;  2YPR A;  1HBX G;  5H6Q A;  2HOE A;  2QEN A;  4ETS A;  4KMU X;  3KE2 A;  3SHF A;  1FNN A;  1FBS A;  4M9X A;  3F23 A;  4IF4 A;  3E6M A;  1U8R A;  3RYR A;  1IN6 A;  1MJ9 A;  1D3Y A;  4PDK A;  4A5N A;  5DDG A;  2LNB A;  2CWE A;  1YQA A;  3WTV C;  3CJN A;  1SFX A;  1EH7 A;  2HDC A;  3L2C A;  1HW1 A;  2XV4 S;  2PFB A;  2FA5 A;  1D8K A;  3J80 K;  3ABU A;  1AOY A;  2JTV A;  2PG4 A;  4I98 B;  4E70 A;  4XRF A;  2VBZ A;  3LQR A;  1A04 A;  2DQL A;  4AIK A;  1YTY A;  1UHM A;  4L5I A;  1V3F A;  2QM3 A;  1GVJ A;  2Q8K A;  1YFH A;  1BI2 A;  1AWC A;  2EA4 A;  5DUI A;  2W84 A;  4UV8 A;  1T2K A;  5BOX A;  2STW A;  3K2Z A;  1R5H A;  1R1V A;  1BOA A;  4M6Y A;  1IXR C;  3WTU C;  3ELK A;  1TQM A;  2OBP A;  4GYI A;  3QP5 A;  1BIA A;  2AS5 F;  2QQ9 A;  3ZMU A;  1DP7 P;  2O03 A;  4A12 A;  4IRH A;  4HF1 A;  2HKO A;  4R79 A;  3LWF A;  4U0Y A;  4A0Z A;  1UHW A;  5FFZ A;  3WGI A;  1IXC A;  2KRF A;  4U88 A;  4I0B A;  1LJ9 A;  4L0Z B;  4LB5 A;  3C3W A;  4KA4 A;  5H20 A;  5J6X A;  5ED4 A;  4CGZ A;  2QLZ A;  3RPQ A;  1XSD A;  2LF7 A;  2XKP A;  2D45 A;  1J0R A;  4Z2Y A;  4JQF A;  1RZ4 A;  3WTY C;  4Q48 A;  4HDV A;  3GFI A;  3MZH A;  5ICE A;  2UXN A;  2RDP A;  3V7R A;  3LQQ A;  4HA8 A;  3K9T A;  5H6R A;  2GXG A;  1HXD A;  2DO7 A;  1KQ8 A;  1XCB A;  3HRM A;  4JBA A;  4EGY A;  2DTR A;  1SAX A;  4UXN A;  1U5T C;  1HKT A;  1FSH A;  4Y15 A;  3CUQ C;  3PFI A;  3D5L A;  3FMQ A;  1XB4 A;  4BH9 A;  1D5V A;  1Z6T A;  3CUO A;  3LA3 A;  4HOB A;  4MHG A;  4MEX F;  5D5X B;  2VBX A;  2ETH A;  1RIO H;  1G3S A;  1R7J A;  4YII A;  1LQ1 A;  3KLN A;  4HX7 A;  4UHT A;  3ZPL A;  2PJP A;  2FBI A;  1R36 A;  4LJZ F;  2EFP A;  1ZAR A;  2H6C A;  5HOO A;  3QP6 A;  1ZG1 A;  4GCV A;  2QVO A;  3U2R A;  3ABT A;  3FMR A;  5CVI A;  5EEH A;  4HV5 A;  3F72 A;  1YIO A;  2OQR A;  3N4M A;  5LHH A;  1WQ2 A;  5EEG A;  4MGR A;  1TW3 A;  3F8N A;  2NRA C;  1U3E M;  2ZKZ A;  3KEO A;  4HV6 A;  3N97 A;  2Y0M A;  1I5Z A;  4KNY A;  4Q5S F;  2VE8 A;  2F5F A;  4EGZ A;  1KU2 A;  4N0B A;  2OZ6 A;  5HDG A;  5HS8 A;  2K4J A;  5ICF A;  5F1R A;  1CF7 B;  1ZLJ A;  2ISZ A;  5IT9 Z;  2K02 A; 
#chains in the Genus database with same CATH topology
 2WAQ N;  5DEQ A;  2A68 F;  4XID A;  3ZP5 A;  5LD2 C;  3DFG A;  1NH3 A;  4FTH A;  2XRN A;  2WAD A;  3GYH X;  1V54 H;  4AU7 A;  3OV8 A;  5HLH A;  3ZCO A;  2WY8 Q;  3SYT A;  4IL6 C;  3RKW A;  5M5X J;  4MEY F;  2R3S A;  1O3Q A;  3PSI A;  4L5E A;  3SXY A;  4HYE A;  2RN7 A;  3BY6 A;  5IY5 H;  3DBL B;  1ETW A;  4BQN A;  2K27 A;  4BDY A;  4XKB A;  3QWL A;  3VOD A;  1S72 I;  2Y30 A;  2FEZ A;  3C1D A;  1ZQ3 P;  4CCL A;  1HLV A;  1OCO H;  3MKY B;  1R4N B;  1IN8 A;  1U78 A;  3R0A A;  1EJ9 A;  3I4P A;  1AA7 A;  3DWL E;  3EQL F;  3I4N J;  1MMS A;  1XGN A;  1Y39 A;  3I55 I;  1YS7 A;  3VYU B;  3CD6 I;  1IO2 A;  2IP2 A;  3FMS A;  3S2D J;  5H2F C;  2L7M P;  3HXL A;  3FM3 A;  3JRG A;  4QTR A;  2E5N A;  1Z91 A;  1FOK A;  1VQK I;  3AG4 H;  4L9V A;  3E5U A;  4EJT A;  2IXS A;  3KIO A;  3FM5 A;  3ZMS A;  2V7F A;  1FPQ A;  3ONQ A;  4UUV A;  1R00 A;  3COA C;  1XSX A;  3BG9 A;  4M6V A;  2XRL A;  4FE4 A;  1PUF A;  4D5F A;  1P4A A;  2DJI A;  3JTG A;  2HS5 A;  3S2W A;  2JSP A;  2OCE A;  2OQG A;  4CO8 A;  1XGS A;  2X0L A;  4I2O A;  1I1G A;  2PBI A;  3L2Q A;  2R7Q A;  1QHH D;  4GFB A;  1XX5 A;  1R9T J;  4PJJ A;  1TT5 B;  4F92 B;  2CH0 A;  4L9T A;  3GZ6 A;  3QOE A;  4NBQ A;  5K5R A;  3W3C A;  3H5N A;  4A5M A;  1P2F A;  4G6Q A;  2KIU A;  2VQG A;  3DEW A;  2WA0 A;  1GHC A;  4G7O F;  2V9V A;  4PJM A;  2VL8 A;  2NXN B;  3BR2 A;  4HX8 A;  2EV6 A;  3F6O A;  1CGP A;  3FXR A;  3H1C A;  1G4D A;  5IYB J;  4L0Y B;  1UB9 A;  2HDD A;  5DM6 F;  2IA0 A;  4EM0 B;  2H8R A;  2HWV A;  4AWX B;  1E3O C;  4UVB A;  3TGN A;  1DDN A;  2EK5 A;  1LVA A;  3QRF F;  3IH3 A;  1YRN B;  2LKX A;  2D5V A;  2XC7 A;  4XLP F;  3KEQ A;  1WFX A;  2ECB A;  3P9I A;  3Q0U A;  4ENM A;  1MMN A;  3VSK A;  4IRG A;  2F2E A;  2K4B A;  3ROU A;  4M9S A;  1JGS A;  4A69 C;  5FRN A;  2EPF A;  2DTZ A;  1AKH B;  4ZYD A;  2BW3 B;  2XHK A;  2ZXW H;  1S8N A;  4FT8 A;  1U5T B;  1DU0 A;  2CW7 A;  1SFO J;  2Q2E B;  1S29 A;  1BC8 C;  2HNH A;  4YEJ A;  3PUB A;  4CZC A;  1ZHF A;  3ASN H;  4I0A A;  5FGM A;  5FRO A;  2VJ4 A;  4YEL A;  3WHB A;  4B8X A;  5FLX Z;  3LA2 A;  4EM1 A;  3GXO A;  3LSK A;  3TBI A;  1O3R A;  1MSE C;  3CUQ B;  4XRS A;  2FQ3 A;  4K2E A;  3W6K B;  2NVU B;  1TBX A;  1WJE A;  2J5O A;  3MWM A;  4A3D J;  4E7J A;  5D5V B;  1YX5 A;  1W7P D;  4Y3O A;  3W2V A;  5F64 A;  3MD2 A;  5CKT A;  1WVR A;  3C18 A;  2HXO A;  1RET A;  2Y31 A;  3R6S A;  2DFF A;  5AON A;  3JRH A;  1JE8 A;  2HEO A;  4DBR A;  1IRF A;  3GTJ J;  2D2W A;  3CMM A;  5DD8 A;  2HTS A;  1SEU A;  1IRZ A;  4XSX F;  3QYE A;  2NVT J;  1RNL A;  1B9N A;  5C4J J;  1BJA A;  4BY1 J;  2X4H A;  1UMQ A;  4EJO A;  1WCM J;  1U0J A;  2VXD A;  1TLH B;  1DPR A;  1IDY A;  3EUH A;  3Q0W A;  1XGO A;  4O5V A;  4MTD A;  5EGO B;  3BJA A;  3DP7 A;  3MKZ A;  2MG4 A;  2CUZ A;  3FXQ A;  4M6X A;  2KP6 A;  1IN7 A;  4KUM A;  2VOD A;  4HDU A;  5E17 F;  2K9S A;  4AM3 A;  3Q9V A;  4ESB A;  2FOK A;  1S7O A;  3VB2 A;  1VI0 A;  2M9H A;  3VYT B;  2QQ8 A;  3OR1 C;  4XOT A;  2KIQ A;  2QYO A;  3CF5 F;  2HYF A;  3F9K A;  2B0L A;  2Y2Z A;  1ZR2 A;  2M0C A;  4BJ6 C;  1BR4 A;  3HHH A;  3B6A A;  3PM1 A;  5EZG A;  3KFW X;  1O7L A;  4PGG A;  2FSW A;  3SJM A;  2YUS A;  5J1U A;  4GRI A;  4WF2 A;  2EZL A;  1ON2 A;  3R0J A;  3CTA A;  3E3V A;  5B3S H;  1K78 B;  5CQG A;  1I39 A;  2Q1Z B;  5B1B H;  3UNG C;  1TL8 A;  2QSH X;  3OYB A;  5CVV A;  4G9Y A;  3LSP A;  2DA3 A;  2FUG 2;  2K40 A;  1LNW A;  4A3C J;  1Y8R B;  4EVI A;  3KLO A;  3GCM A;  5FD6 A;  2YX4 A;  4Y17 A;  2F4O B;  2BOL A;  3LA7 A;  3IRR A;  2V9P A;  1A31 A;  4I76 A;  2BHZ A;  2Z9O A;  1XC5 A;  4B47 A;  4RBO A;  1T56 A;  4DYC A;  4A3I J;  1VTN C;  2VOP A;  1XDU A;  5C44 J;  2UV1 A;  1W1W E;  3RI4 A;  3TL4 X;  3FZV A;  2E5Z A;  4MO7 A;  3NEU A;  3OS1 A;  2XKO A;  1AU7 A;  1BI3 A;  3S3O A;  1N78 A;  2DPU A;  2R7D A;  2VBY A;  3J80 Z;  5D5W B;  5K7H A;  1FP2 A;  3I9V 2;  2OZU A;  1VFC A;  4WXD A;  1R4M B;  3A2K A;  5B66 C;  3BT9 A;  3OS2 A;  2OD5 A;  5E3O A;  1X58 A;  2J5P A;  4NUB A;  3WHC A;  1VQ8 I;  3WTS C;  3M8E A;  3FXU A;  3ZQC A;  3G1O A;  2FNA A;  2PLY A;  1ZG3 A;  1Z6R A;  2EZK A;  2HQN A;  3S32 A;  1G3Y A;  4N9I A;  2M4K A;  4D7M A;  5E1W A;  2PJR A;  5JR3 A;  4M73 A;  4KIF A;  5J1Y A;  2VBW A;  3T8T A;  1XGM A;  1OCR H;  4IHW A;  5L3G A;  4QSH A;  1HW2 A;  4UVC A;  4MTE A;  3AG1 H;  1JGG A;  4RB2 C;  1FYM A;  2LFB A;  2MH2 A;  1IZ1 A;  2XAH A;  4J19 A;  2GXA A;  3I56 I;  3ZQG A;  4KIS A;  4P9U A;  4N4O B;  2DDB A;  1LDK B;  3CDL A;  3OMY A;  4D1Q A;  1ULY A;  3NAR A;  4Y4R A;  2CG4 A;  2LR8 A;  1N25 A;  4F91 B;  3CMY A;  4LLG F;  3J7A O;  1IF1 A;  3EYY A;  3L2R A;  3BG7 A;  3CC7 I;  5TRD A;  2HPM A;  3ZQ7 A;  2DK5 A;  5M5W J;  1ACI A;  2VIX A;  1XPX A;  2ZJR F;  1DGW Y;  2IJL A;  1IJW C;  1U9N A;  2A5Y B;  2OCC H;  2FMY A;  2P4W A;  4G8X A;  3ZQH A;  1MDM B;  4PJL A;  2KDO A;  1EV7 A;  3S3M A;  2KKO A;  2W24 A;  3CF2 A;  4HX4 A;  1J5Y A;  2QF7 A;  1SFE A;  3CJT B;  3HGG A;  4H4K C;  2DJN A;  2XB5 A;  1ZH5 A;  1XSV A;  1DP3 A;  3K4L A;  1WJC A;  2DFH A;  3CLQ A;  1HKS A;  3OYG A;  2ZXI A;  4CA0 A;  2GOX B;  4HLY A;  5IYC J;  4IHY A;  2R7T A;  2KLO A;  3IRQ A;  2QQB A;  2MW8 A;  2Y0S A;  4P96 A;  5FKK A;  4BEH A;  5E20 A;  2KMU A;  3I5U A;  4WK8 F;  4RM3 A;  1ETV A;  5KAI C;  1CF7 A;  1BW6 A;  4LIT A;  5F6F A;  3HC7 A;  2DMQ A;  4NNJ A;  4Q47 A;  5KHD A;  3HRS A;  3IH2 A;  1ZLK A;  5HLT A;  1I6X A;  4WCG A;  4BNC A;  2EIJ H;  4ZZD A;  2F5E A;  3OIQ A;  1W7P B;  2X9D A;  1ZK8 A;  2VC0 A;  3HZJ A;  4HPQ A;  2P6S A;  3FXM A;  2NOJ B;  4AVP A;  1RES A;  1SC7 A;  2A5W A;  5E3M A;  2ZXJ A;  1QPM A;  4OIP F;  3V7C A;  3UR3 C;  4KFC A;  1Y6I A;  4HST A;  5D6F A;  2DDA A;  5E1Z B;  4ANJ A;  2O8X A;  3JTH A;  1R5G A;  3QPH A;  5FB2 A;  1TP4 A;  1TQI A;  2JK3 A;  4M9Z A;  2Y0S N;  5EG0 B;  2E34 A;  1WJA A;  4F52 A;  3ULQ B;  3B02 A;  2DA2 A;  2X48 A;  1UHS A;  2GA2 A;  4X1E A;  5FFX A;  3HOZ J;  2CO5 A;  4B48 A;  3AG2 H;  3L9F A;  4HNT A;  3F22 A;  2VOO A;  1JTX A;  4B3X A;  1TC3 C;  2GM4 A;  3BQZ A;  4RGS A;  4ZYH A;  5IOZ A;  4XNF A;  2ZBK A;  2JRM A;  1ZN2 A;  2RRE A;  3QPT A;  3OIP A;  3FK7 A;  3IC7 A;  2JUC A;  3IWF A;  3R60 A;  4CYC A;  2EB7 A;  4ZTF A;  1YW9 A;  3H3U A;  4I02 A;  2O7O A;  2M5W A;  1JHF A;  3DKX A;  3GTL J;  2KIF A;  4IO9 F;  2CU7 A;  4L9J A;  3K10 A;  1JXS A;  2K5C A;  3K4K A;  4YG2 F;  4BY7 J;  3RIR A;  1HST A;  3BZ6 A;  4M72 A;  5LRS A;  3J7Z I;  3GX4 X;  5CVJ A;  2BXZ A;  3BPX A;  5HLG A;  3E5Q A;  2GLO A;  2JWT A;  3BPV A;  2RQP A;  5BQT A;  1T98 A;  2IS2 A;  4A3E J;  3AFH A;  4O3M A;  1FX7 A;  3FWE A;  1HOM A;  1Q1H A;  1WHU A;  2L3D A;  2A69 F;  4I7H A;  5KCM A;  2HVS A;  3U1K A;  1T6S A;  4ASN A;  4FCY A;  2C6Y A;  2K9N A;  3E0J B;  1R22 A;  5E8G A;  3OYI A;  1VQ9 I;  4LFU A;  1FBQ A;  2ZSI B;  2HKX A;  2O6G E;  3MZ8 A;  2M0M A;  3H0D A;  4J01 A;  3LSH A;  5E18 F;  4D9J A;  3K6G A;  4KIT B;  5A2Q K;  4R1H A;  2E2J J;  4ZYE A;  2NS0 A;  2R7S A;  4XN0 A;  2LC2 A;  3I71 A;  3ZQI A;  1YJW I;  5BMZ A;  4YFN F;  5EF6 A;  3WU1 B;  1BR2 A;  1TWG J;  4NC7 A;  2BY2 A;  1DQU A;  3CO7 C;  1ZRC A;  3FXJ A;  1LUJ B;  1FYK A;  4XOP A;  2GA1 A;  2XAF A;  2DYR H;  2DMT A;  1FOW A;  2ZNZ A;  3I53 A;  3LFK A;  1BIB A;  4LB6 B;  3S8P A;  1CQT A;  3SDB A;  4IXA A;  1BL0 A;  3TOB A;  1SVO A;  3L00 A;  1F4K A;  2GBY A;  3HGY A;  2FBK A;  2XGC A;  2CFO A;  4A6E A;  2R7X A;  4RGR A;  4U7D A;  5J40 A;  4J00 A;  2V6E A;  3ZMD A;  1PP8 F;  2BW3 A;  3M8J A;  2RC4 A;  3ZQQ A;  2R7U A;  3VSL A;  2CYY A;  1U5T A;  4OMZ A;  4KYW A;  2BEO A;  4OOI A;  2Q2E A;  2FX0 A;  1G3W A;  3VEP A;  2EA2 A;  5LHG A;  2L4M A;  3AKZ A;  1OCC H;  2MD0 A;  2YS9 A;  4PZJ A;  3VOE A;  4RLQ A;  4CZZ A;  3BWG A;  1B6A A;  2OUM A;  3PO2 J;  2A61 A;  2KZV A;  3CUQ A;  4Y7N J;  4A3K J;  1W36 C;  4M3F A;  4F7Z A;  5ILS A;  1FIP A;  1SMT A;  2XAS A;  3IUO A;  1ETO A;  3E5X A;  2V1U A;  1P4X A;  3K0L A;  4HBL A;  4RAY A;  1B1B A;  3B73 A;  3DBH B;  3BR3 A;  1FP1 D;  3MN2 A;  2X1C A;  1GVD A;  4XL9 A;  3ZQF A;  1ORK A;  1ZYR F;  4LGW A;  4RS8 A;  3WU0 A;  2MLG A;  2F4M B;  4C2T A;  4IPA A;  2V26 A;  2JMW A;  4CCK A;  3GFJ A;  2Z5U A;  3FIW A;  4BU2 A;  3OWT A;  1MIJ A;  3ZMZ A;  2RNG A;  4F93 B;  2EV5 A;  2NAZ A;  3Q9S A;  1Z9C A;  5C4X J;  4HW0 A;  2UXX A;  5LBQ A;  4HSR A;  1HDD C;  3ZRG A;  1G3T A;  2OC6 A;  1RR8 C;  5HS7 A;  2Y69 H;  4Y13 A;  1MJB A;  2CGP A;  1D5Y A;  2OU2 A;  2E60 A;  2ZME C;  4XRS G;  5EGO A;  4DQ2 A;  3JSP A;  1QVU A;  4DIQ A;  2VI6 A;  5KVR A;  3W6J B;  3A4C A;  3G1M A;  4A2U A;  2IAI A;  1X3Z B;  3HOT A;  3BJ6 A;  3KP4 A;  3KZI C;  3CCV I;  4CCN A;  2LDU A;  2Q0O A;  2M4G A;  3ECO A;  2O8K A;  3KET A;  3FHZ A;  2L02 A;  2L4A A;  1IN4 A;  2RGV A;  2E36 A;  2V1N A;  1OR7 C;  2EV0 A;  1YW7 A;  3G73 A;  1WSU A;  3HOV J;  2LMD A;  3H5A A;  4LIV A;  4LG3 A;  1S7A A;  5EEA A;  3DKY A;  3H36 A;  1Y8Q B;  1O7F A;  3S17 J;  2LKP A;  4AYB A;  3SDG A;  5B1A H;  1W0U A;  4BQA A;  2ZCW A;  1WPK A;  2DU9 A;  5TIS C;  2Z99 A;  4BJT A;  1SVL A;  3MKL A;  3CO6 C;  4EM2 A;  2M7B A;  3F8F A;  1MMA A;  2VJ5 A;  2LKS A;  5M3M J;  4XKW A;  5DS9 A;  1MGT A;  3H3Z A;  1V55 H;  1WWX A;  3K1N A;  2MC3 A;  3LAJ A;  1H9T A;  4BHC A;  2WAQ A;  3FIS A;  2P7V B;  2HOS A;  3BG3 A;  1LDJ A;  3GW2 A;  1D0X A;  3D1N I;  1B8I B;  1ETY A;  1GV2 A;  1GXQ A;  3HOU J;  3SZT A;  2LRE A;  3DF8 A;  4D5C A;  4XK4 A;  1U9O A;  3I64 A;  2ZFU A;  3KZZ A;  3R61 A;  1OCP A;  3TO7 A;  2YU9 J;  3OL3 A;  2ME6 A;  3F8M A;  1GLN A;  5LEK A;  4AYB N;  4DYQ A;  2H27 A;  1UST A;  2GWR A;  5FLV A;  1RRJ A;  4FQG A;  2X6Y A;  3AL0 C;  2COB A;  3M8F A;  3HUG B;  1BR1 A;  4X0G A;  1EH6 A;  3C2H A;  4ZTJ A;  1YIT I;  4EJV A;  3MKW B;  1XTA A;  2FF4 A;  1YX3 A;  3V8K A;  3D5S C;  2IGM A;  4EJW A;  3MAJ A;  1NTC A;  3FF5 A;  5L3E A;  3WG7 H;  5K5O A;  1P9Q C;  3R4K A;  3ZMV A;  2XRO A;  4M71 A;  4C2U A;  2LG4 A;  5BS6 A;  2MLK A;  2JA2 A;  3IKV A;  1X3U A;  2NNY A;  2OF7 A;  3P9K A;  1KYW A;  2R7W A;  1UAA A;  3WGG A;  3DPT A;  3GTM J;  2DPD A;  3RTR A;  1YOV B;  4B3A A;  3H35 A;  2XGX A;  1F43 A;  2ZC2 A;  5DCM B;  2STT A;  3KYC B;  2YR2 A;  2H94 A;  3DU6 A;  3HKZ A;  5KK1 A;  2ZB9 A;  3BTL A;  3GUD A;  3DTK A;  1BI1 A;  1IW7 F;  5K7Z A;  5J8C A;  4I99 C;  2EBI A;  4EAT A;  3W2A A;  5FLM J;  2PEX A;  1OIS A;  3LAP A;  1SVM A;  1UZC A;  3JAM K;  5ILU A;  3QU3 A;  3PFY A;  4G6T B;  1Z1D A;  4N4N B;  1UEL B;  2M7A A;  1XS9 A;  1AHD P;  4BXU A;  1JJ6 C;  2F5D A;  3OYL A;  1WKM A;  3A1Y A;  3BJO A;  5C3E J;  1VQ4 I;  3BR1 A;  2KQR A;  2LY1 A;  5IPA A;  1IAW A;  1U8B A;  2RQQ A;  3HKZ N;  2CUJ A;  2IA1 A;  5LGU A;  1D8J A;  3PNT A;  3HRT A;  3PIP F;  2K7L A;  4IJA A;  3ZXS A;  4AID A;  1H8A C;  3G1L A;  3LSM A;  4E7Z A;  1YIJ I;  2FOW A;  4M74 A;  5GPA A;  4CH7 A;  4PGH A;  3L2U A;  3F3X A;  2MC4 A;  3DPU A;  1QVT A;  4FET A;  4QWQ A;  5CPR B;  1WRJ A;  1S5L C;  2BY0 A;  2IA2 A;  3B6C A;  1SD5 A;  3I0T A;  1LB2 A;  1DGR M;  4ZYG A;  2JA7 J;  1MBG A;  1WI3 A;  2CV1 A;  3UKG A;  2EQR A;  1VZ0 A;  1EH8 A;  3VYS B;  1KQ0 A;  4CUG A;  2L7K A;  2DI3 A;  2ELJ A;  3A03 A;  3DQV C;  2A3S A;  4ENN A;  1EKE A;  2E1O A;  2QWW A;  2P7C B;  1JKR C;  3FK6 A;  5EG0 A;  2ESH A;  1G2H A;  1BC7 C;  1D1B A;  4HLX A;  1KA8 A;  1OMI A;  1D0Z A;  4GO1 A;  2ISY A;  3PJR A;  5D4S A;  1OCT C;  2H1K A;  1JTY A;  1UG0 A;  2IS6 A;  1KON A;  2P81 A;  4P5O A;  3S14 J;  3JW4 A;  1T0F C;  4FAS D;  1A6I A;  2YU3 A;  5E3L A;  3OYM A;  1ETQ A;  1POG A;  4YIF A;  3J7Y J;  4JOM A;  1WZ2 A;  5D4R A;  3BQY A;  2PN6 A;  5LRR A;  1I6H J;  3LST A;  3S3N A;  1HCR A;  3CDH A;  1Y0N A;  1MND A;  2OTJ I;  2VQH A;  1TWH J;  1XDS A;  2X6W A;  4FHT A;  1VQ7 I;  2B7E A;  1GT0 C;  1FTZ A;  2W00 A;  2G9W A;  5E1X A;  4XLN F;  1MMG A;  3IL2 A;  4C9Y A;  3KYL A;  1O3S A;  2M45 A;  2R7V A;  3HSF A;  2L9V A;  2HVQ A;  2BHY A;  2XAJ A;  3T0Y A;  1XCV A;  3RZD J;  4RM2 A;  1B72 B;  2WV1 A;  4OAY A;  3I54 A;  3KPH A;  3DBR B;  1S3J A;  2R5Z A;  2M8E A;  3LOC A;  1OYI A;  1ZRD A;  3ZQL A;  1MNE A;  3HIF A;  2MA3 A;  4XRM A;  3T5X A;  5DV5 A;  1LEA A;  2XPV A;  2K9M A;  3O8H A;  2R7F A;  5LHI A;  1QGP A;  1QNT A;  3ASO H;  3VDX A;  4DNC A;  2ZME B;  1DU6 A;  3HTU A;  5GAD J;  2Z1D A;  5L3D A;  2IEK A;  2JPC A;  4PK4 A;  3D5R C;  3I59 B;  3JRD A;  2JQ7 A;  2VUM J;  2M34 A;  1UCR A;  2M30 A;  2W4S A;  4RLF A;  1VQP I;  2EIL H;  2Y48 A;  3DPL C;  1WJB A;  2DN0 A;  2HZT A;  3M1E A;  2HQ5 A;  4XMY A;  3RDI A;  3SFI A;  3HPG A;  1QA6 A;  5DD4 A;  3OIO A;  3IWZ A;  1K83 J;  3ABK H;  4U0W A;  2DT6 A;  3GFM A;  3PO3 J;  2CQQ A;  2VJJ A;  2KRH A;  2XB0 X;  3ZN0 A;  1USS A;  3ISP A;  4YRV A;  3JRF A;  3EDP A;  2QQA A;  5LEJ A;  1P7J A;  3AAF A;  2LOO A;  1YJ9 I;  2Z3Y A;  2MAB A;  4C3I J;  4HQE A;  3RKX A;  3DV8 A;  2V79 A;  3QYF A;  2K3F A;  3DKW A;  4V2G A;  4WWC A;  3H9J A;  2QKM B;  1B4A A;  4HF2 A;  1H9G A;  5JI6 A;  3S93 A;  5L3F A;  4A6D A;  4G6D A;  3G71 I;  3V4G A;  2EFQ A;  4L18 B;  2GZW A;  2AXL A;  2V1D A;  5FJ8 J;  3U21 A;  4KT6 A;  3KX2 A;  2QCO A;  3PQK A;  4LK1 F;  4G7H F;  1RKT A;  3KP6 A;  5BPI A;  4ON0 A;  4ENK A;  3HTS B;  3M07 A;  1X4P A;  3PNY A;  2E7X A;  4V2F A;  3ZGK A;  3K1M A;  4G94 A;  1R58 A;  2JA8 J;  4D0P A;  1GV5 A;  1MJA A;  2ESN A;  2COM A;  4A0Y A;  1K7A A;  3H5R A;  1LFP A;  3WOD F;  5L3B A;  4AIJ A;  4LG0 B;  2K85 A;  3CJR B;  2MFZ A;  4HEA 2;  1MZB A;  2LVS A;  2VKD A;  4P55 A;  3AL0 B;  1XMA A;  1KGS A;  4CHU A;  1XN7 A;  3VFZ A;  2KZG A;  3Q5F A;  2R0Q C;  3C2G A;  2CRG A;  3GTG J;  3CCS I;  2XGD A;  2VLA A;  1YLF A;  3A02 A;  4X6A J;  4CCO A;  2WAF A;  3Q0V A;  2A05 A;  2XDV A;  3LFU A;  4B09 A;  2AXT C;  3A01 A;  3HSR A;  2XSJ C;  2OAZ A;  3JSO A;  5M3F J;  2LD5 A;  3V7S A;  2M8G X;  2JVH A;  2W57 A;  2CQX A;  5ERI A;  5TJJ A;  4LLL A;  2DFE A;  2QBY B;  1TWA J;  4P9F A;  2DBB A;  4AUX A;  3TQN A;  3DTI A;  3TOA A;  3RPU A;  2CW0 F;  2M2E A;  4RB3 C;  3OYC A;  4L5J A;  1YW8 A;  2HQR A;  4ENJ A;  5F27 A;  1FC3 A;  4IKF A;  1P4W A;  1MBJ A;  3EPZ A;  4LLN A;  4JYK A;  2B9S A;  4KIG A;  2FXA A;  2X6X A;  3S1Q J;  4RAZ A;  1K4T A;  3HG9 A;  1HQC A;  4B4C A;  3HB9 A;  3GTQ J;  2PI0 A;  1V5F A;  3SFZ A;  3NRV A;  3TP0 A;  3CCM I;  2HR3 A;  2V4J C;  4XLH A;  9ANT A;  1KYZ A;  2MD5 A;  2ICW G;  3SEQ A;  4GYG A;  3IHU A;  5LGT A;  4XKC A;  1RR7 A;  2M3A A;  3QYB A;  3BZK A;  4UUS B;  1IUY A;  2F4I A;  2XIG A;  2DMU A;  2CFX A;  1W5T A;  1ZGJ A;  1Z21 A;  3OL4 A;  2DLL A;  1PUE E;  1ETK A;  1Z05 A;  1TNS A;  2JRT A;  4S04 A;  4AC0 A;  3FXK A;  2A6T A;  1B8I A;  2WB1 N;  4ESJ A;  3DXJ F;  3G3Z A;  5CJ9 A;  2YX7 A;  3MMY B;  5L3C A;  2IT0 A;  5A2Q Z;  2V1X A;  5FKL A;  5KNL A;  2VN2 A;  1C0W A;  1FLI A;  3E97 A;  3HUG A;  3RYP A;  3V42 A;  3HSE A;  2ID3 A;  2Y75 A;  3DU5 A;  2DK8 A;  4BHP A;  1A6Q A;  1PJR A;  2HDW A;  4LMY A;  2NVX J;  3OYN A;  4OWR B;  2KJB A;  1ENH A;  1QU3 A;  3D0S A;  2DOF A;  2D1V A;  1LEB A;  1IV8 A;  2FJ1 A;  1P7I A;  4R8H A;  3MQ0 A;  2Z16 A;  1BI0 A;  4PJ0 C;  3MZY A;  5HDN A;  4YFK F;  2IW5 A;  5IP6 A;  4ZZL A;  3PL8 A;  2W85 A;  5E8I A;  3F8B A;  1UG2 A;  3KP3 A;  1N77 A;  2OJE D;  3BR6 A;  5CLS A;  1ZAO A;  5DCM A;  1HKQ A;  5FKN A;  1X1B A;  3HYI A;  1O4X A;  3KZY A;  2EFO A;  5LLQ A;  1QZE A;  1X2N A;  3CES A;  3KP2 A;  3QAH A;  3L09 A;  1JJ8 C;  3HOY J;  4I09 A;  1FJL A;  2EIK H;  3S2H J;  1ZTR A;  3S15 J;  2JJ7 A;  3IKT A;  3JRB A;  1QHG A;  5DTD A;  3HPH A;  1STZ A;  1APL C;  2MSY A;  1NHA A;  2LH9 A;  2VQL A;  4CCM A;  2E71 A;  2GIV A;  3ECH A;  3I58 A;  4RGX A;  3O6B B;  4FX0 A;  4N9H A;  4LD5 A;  4ABZ A;  3CCR I;  2L5Q A;  5EZH A;  3M9A A;  4CYD A;  5JVT A;  1L3L A;  5DYM A;  2ZXH A;  1J09 A;  4ZC3 A;  5GAE J;  3VPR A;  4A3M J;  1I1S A;  3PSF A;  5DCF A;  4UB8 C;  4BUP A;  3HJE A;  1JUS A;  3TO6 A;  1BM9 A;  4IVN A;  5AIQ A;  4CCJ A;  1XMX A;  2O0Y A;  3GZN B;  3KYD B;  5D6E A;  5GTI C;  1WJ5 A;  4E4H A;  5JLX A;  1X2M A;  2QSF X;  3KCC A;  4EQQ A;  1HF0 A;  3K2A A;  4L9N A;  2G7H A;  2XAG A;  1W0T A;  1DUX C;  1SAN A;  3MVP A;  4JX5 A;  2FNP A;  4IRI A;  1F36 A;  5AIP A;  3H9G A;  4RDU A;  3F8C A;  3TDU C;  4ITV A;  4E7H A;  2JVG A;  3HOW J;  3GLL A;  1JHH A;  2ME0 A;  2EH3 A;  4G7Z F;  2KIM A;  1LFU P;  3CCJ I;  2L7F P;  3RKY A;  2E7W A;  5JFR A;  1WH7 A;  1TWC J;  1SD4 A;  1YRN A;  2GQQ A;  2P0W A;  4XBF A;  2XAQ A;  2NVY J;  1REP C;  3CCL I;  2VQC A;  1X3W B;  1D1A A;  5FD5 A;  4B43 A;  2EFN A;  2HXI A;  1IDZ A;  3V8J A;  3U9G A;  1A36 A;  5HNF A;  1AKH A;  3WTW C;  1UFM A;  2CQ7 A;  5K7F A;  3OYA A;  2VT2 A;  3BOQ A;  4KDP A;  2NYX A;  3WGH A;  3JR9 A;  3O3K A;  1L0O C;  2FE3 A;  3P7N A;  3S1N J;  3K7A J;  4KJZ A;  2KFD A;  5IP9 J;  1MSF C;  1ITY A;  3BTC A;  2KL4 A;  2ACJ A;  2DOE A;  4DJA A;  2H1L A;  1S6L A;  1B72 A;  1TNT A;  4GGG A;  3BLY A;  2HOT A;  4JK1 X;  4XLC A;  3ZOB A;  4KN7 X;  1FOX A;  3GTP J;  4BE2 A;  2IGO A;  2WWY A;  4S05 A;  5B5E C;  3F6V A;  4BE0 A;  3TW6 A;  2NNN A;  3NQO A;  4U0V A;  1OKR A;  4PSX A;  2W48 A;  1J75 A;  2CMP A;  2L9R A;  4HZF A;  2PMU A;  4ZH4 F;  2CV2 A;  4UUT A;  2MH9 A;  2ZME A;  2E2I J;  4BXX J;  4KIC A;  3K70 D;  4AIH A;  2CSO A;  2V6C A;  3I59 A;  1ZKG A;  4TV7 A;  2EJR A;  4RGU A;  4GDF A;  5F08 A;  2VPL A;  2ECC A;  1JI8 A;  4BE1 A;  2E1M B;  4CDG A;  1OR7 A;  4NC6 A;  5F04 A;  4LK0 F;  1JKQ C;  3CCU I;  1Z0X A;  2DFI A;  3LSR A;  5GPC A;  4NQW B;  2OPT A;  3ABL H;  4OIO F;  2DA4 A;  1FOY A;  3J81 Z;  1MBE A;  1RC9 A;  3K4M A;  1MNM C;  2QUF A;  1A5J A;  1WI9 A;  1Y0U A;  4BKX A;  4IHT A;  3H9Q A;  3JAM Z;  2WAE A;  2MGQ A;  1R71 A;  1R23 A;  1OQY A;  4F3Q A;  5J47 A;  3OR2 C;  2P5K A;  1P92 A;  1JT0 A;  2OTL I;  4IHS A;  4IHV A;  1Y1W J;  2QZ8 A;  1FIA A;  1K78 A;  3LSI A;  3K4J A;  1T95 A;  3J7A Y;  4AVZ A;  1J2X A;  4YIR X;  4IQJ A;  4OAZ A;  4EMS A;  2XVC A;  2BY3 A;  4Q4Z F;  4E6K G;  3BRO A;  5EYR A;  2QGU A;  3BG5 A;  1ODD A;  3LSG A;  4A93 J;  4LG0 A;  4ZDP A;  1IG7 A;  1RPW A;  2H6B A;  1JKO C;  4U7B A;  3MCZ A;  1G6N A;  4U87 A;  2VON A;  2F6C A;  5J3L A;  4EJU A;  2DOA A;  3GF2 A;  3BTJ A;  5JHU A;  3OSF A;  3F21 A;  1XD7 A;  1GDT A;  2L9S A;  5CVU A;  1E3P A;  2DYS H;  1FZP B;  2KRC A;  1BN5 A;  2VKH A;  3EET A;  1ZEL A;  2K9L A;  3M3Y J;  2WTE A;  4W1U A;  4DYR A;  2HZD A;  1KU9 A;  5F1J A;  2Z33 A;  3H92 A;  4PSW A;  3QOP A;  4UY8 I;  2CW8 A;  3WTT C;  2A07 F;  2QBY A;  3DLA A;  3OSG A;  1GXP A;  2IVM A;  2O61 A;  1QO0 D;  1FSE A;  2VKV A;  2DXI A;  2BY1 A;  2VPR A;  3HOS A;  3EUK L;  4C3H J;  2L01 A;  2EIN H;  5GTH C;  2KT0 A;  4A3J J;  1FWZ A;  4MFE A;  3SZG A;  3T8R A;  5K1Y A;  1Y1V J;  1H0M A;  1OYY A;  2FRH A;  3OOP A;  3E6C C;  2CV0 A;  4B1R A;  3GEZ A;  1JKP C;  4OU0 A;  3ZN1 A;  1V5G A;  3L7W A;  1FT9 A;  1LVK A;  3WTX C;  5IYD J;  2E35 A;  2K86 A;  4II3 A;  1O3T A;  1VF9 A;  1ZGA A;  2X1E A;  3KEY A;  1HSJ A;  1U2W A;  4YFX F;  1Z3Y A;  3P5J A;  3J81 K;  4RAF A;  3W2W A;  4S0H B;  4UUS A;  2I8D A;  1J9I A;  1MDM A;  1SFU A;  3WE2 A;  2GIZ A;  4OIN F;  2BE5 F;  4ESF A;  2OA4 A;  2E1N A;  2ZO4 A;  1WJF A;  1K79 A;  1QQI A;  3OYK A;  4UB6 C;  3A0H C;  1KU3 A;  2IPQ X;  5HS9 A;  4DZP A;  1LE8 B;  2VKE A;  4MNU A;  4M3E A;  4BS9 A;  1IXS B;  4ZYA A;  2X51 A;  2R5Y B;  1RUO A;  1SFK A;  5IOY A;  2BBY A;  2EWN A;  2H09 A;  2LP0 A;  1G8X A;  3L2V A;  1TTY A;  2HGC A;  1K61 A;  1F5T A;  1T39 A;  2VT3 A;  4CYC B;  3M4O J;  2DT5 A;  2HFH A;  2HU9 A;  1QZY A;  2JT1 A;  2WY7 Q;  2ZJ2 A;  4HQM A;  1W7P A;  3QU6 A;  5J8F A;  5ILV A;  2F5C A;  5CQE A;  2JN6 A;  4XLA A;  1U6G A;  1IRG A;  3CP8 A;  3M7G A;  2BVL A;  2DW4 A;  3REO A;  4PCQ A;  3S1M J;  2I10 A;  1S9H A;  2XGE A;  3SZP A;  4RB1 A;  1Z77 A;  5F0H A;  3E7L A;  1E3H A;  2I5U A;  3T1B A;  2JSC A;  5ICC A;  1T0F A;  2WV0 A;  2L2O A;  3L2W A;  5D5U B;  2LF8 A;  1YJN I;  4KT5 C;  1V4R A;  1BBY A;  3H0G J;  3FKJ A;  4DGW B;  5HVQ C;  1TW2 A;  4KIB A;  2L7Z A;  3K4C A;  2L0K A;  4UNO A;  2PMH A;  3CLO A;  1QZZ A;  2IRF G;  1TWF J;  2JUG A;  1T38 A;  1XG1 A;  1X1P A;  3E6B A;  1HDP A;  1FBU A;  3FX3 A;  4RB0 A;  2IS1 A;  2JZY A;  1E2X A;  1VQN I;  1PYV A;  4NB5 A;  5IT9 K;  4XLE A;  1OLT A;  2LBF B;  3I3L A;  2PQ8 A;  3O2P E;  3RSN A;  3TED A;  3IV5 A;  1J59 A;  2BGC A;  4A3L J;  2ADU A;  3IAS 2;  5ICG A;  5JLW A;  1BW5 A;  2AQE A;  2FU4 A;  2BXY A;  4JP0 A;  5FRM A;  2VE9 A;  3CCQ I;  3GZ5 A;  1QRY A;  5TGT A;  4A3G J;  1Z7L A;  2HYG D;  2VC1 A;  3ERE D;  4BAC A;  5GAH J;  3BP8 A;  5E3N A;  4QPQ A;  4HNU A;  3K1P A;  5E79 C;  3GBG A;  3GWZ A;  2ELH A;  4CSW A;  1OPC A;  3C7J A;  1IV6 A;  1I27 A;  4WX9 A;  1KU7 A;  2DT7 B;  1I3A A;  4I01 A;  4O6J A;  1RUN A;  1J7K A;  1SMY F;  4MQ9 F;  3P9C A;  1SD6 A;  1EA3 A;  3FDY A;  3IAM 2;  2P5L C;  1F9N A;  2NVQ J;  4WXC A;  5FKM A;  1ONV A;  3GO5 A;  2FD5 A;  2CQN A;  1MBK A;  2P6T A;  2VXZ A;  3PUF A;  5DUK A;  2UWM A;  2EZH A;  1YHQ I;  1M1E B;  2G7U A;  3MEX A;  3NWS A;  4PFO A;  1QBJ A;  1MKM A;  4WXH A;  3TDZ C;  1PP7 U;  2R92 J;  1E17 A;  2BV6 A;  1LDD A;  3HHG A;  4II2 A;  1IRX A;  3G6E I;  2JPB A;  2DA5 A;  2MYS A;  3BZC A;  1KQ9 A;  3BC8 A;  2CUF A;  2W25 A;  1GUU A;  3GVA A;  2UUZ A;  4BHB A;  3MFK A;  1YG2 A;  2UZK A;  1HW5 A;  2OV7 A;  3RJP A;  3WG9 A;  1YS6 A;  2MBF A;  2ZFW A;  3K69 A;  3I4M J;  2E1C A;  2RV8 A;  4OIR F;  6PAX A;  2NS7 A;  3SEZ A;  3QPL A;  3U1D A;  4GXO A;  4H0E A;  2XUB A;  3TO9 A;  4MQV A;  5HDK A;  1Z67 A;  4P1W A;  4UVA A;  3A0B C;  2WBM A;  1Z3X A;  1FY7 A;  3DCF A;  5J4V A;  4KMF A;  2ZNY A;  3KP5 A;  4DOZ A;  2HYJ A;  1XMK A;  2B63 J;  3JRA A;  3EUH C;  2F48 A;  2HPI A;  3ESW B;  2DQR A;  2R7Z J;  2LY2 A;  4NHJ A;  2HTJ A;  3O8G A;  5HLI A;  3S1R J;  3VWB A;  4BL0 B;  3QPS A;  2BZT A;  4BYY A;  4KN4 X;  1ZG5 A;  2KIS A;  1I50 J;  4BAY A;  1S7E A;  1ZRE A;  1Z7U A;  1PVE A;  4HF0 A;  5CYV A;  2KJC A;  5F0F A;  5M5Y J;  3FBI B;  2D1H A;  2RNJ A;  3WTZ A;  2TDX A;  2YSR A;  1V5E A;  2P5V A;  4DW6 A;  2X85 A;  2P8T A;  1SD7 A;  1R1U A;  1R6R A;  4Z6Y A;  4QLC U;  2L54 A;  3OYE A;  3OYD A;  2RKH A;  1BJZ A;  3JRC A;  3GLX A;  4OMY A;  4A3B J;  3QQA A;  4D7N A;  2GXB A;  2ZJQ F;  3HDD A;  2A6H F;  5BPD A;  2LTP A;  5IT3 A;  1FTT A;  5D8K B;  3OYF A;  4XSZ F;  1OYW A;  3DEU A;  2A6E F;  1P6R A;  2EFW A;  5EJC A;  1YO5 C;  3EYI A;  1WH5 A;  5FO5 A;  4NQW A;  3WE3 A;  1DPU A;  5D8L B;  4UV9 A;  3CC4 I;  5LFA A;  5FLX K;  4Y33 A;  4BXF A;  3GFL A;  3CC2 I;  4BBR J;  3K4N A;  1B9M A;  1R5I D;  1MD0 A;  1W4M A;  3NAU A;  2CQK A;  2E1M C;  4A0X A;  1X4O A;  4JX6 A;  2KHM A;  3HBL A;  1W5S A;  4CXF A;  3FXO A;  3E1S A;  4FE7 A;  2FML A;  3HRU A;  4IEJ A;  2WB1 A;  2BYV E;  2O3F A;  2RVC A;  3E6D A;  2V9K A;  4E7S A;  3KP7 A;  5K5Q A;  5LGN A;  1PDN C;  4AD9 A;  2VAS A;  1MBH A;  1HC8 A;  5CVR A;  1TQP A;  1MBF A;  2DMP A;  2E2H J;  4MIM A;  1T33 A;  1IN5 A;  4MLO A;  3RZO J;  1ON1 A;  2WC2 A;  3DEE A;  3HEF A;  2DAO A;  1K6O A;  2W1O A;  4B44 A;  1B59 A;  3DTE A;  3PQJ A;  1ZRF A;  1R1T A;  4RA2 A;  4M3G A;  1YYV A;  4F55 A;  4IQ4 A;  1O57 A;  1D0Y A;  1YI2 I;  1F1Z A;  4FX4 A;  2FBH A;  4EV0 A;  1NK3 P;  2LSO A;  3V8L A;  2M87 A;  1RI7 A;  4V19 K;  4HAM A;  3TMO A;  2FQ4 A;  2DCE A;  2XPW A;  3TKY A;  1FYL A;  2PX9 A;  3JRI A;  1LPQ A;  1MMD A;  4OIQ F;  2R4G A;  3G2B A;  2GAU A;  3ZMT A;  4IHX A;  4CIC A;  3BDD A;  3ML6 A;  2M1B A;  2NOG A;  3FKI J;  1RKW A;  3SQN A;  1K6Y A;  1W5C C;  2YPR A;  3EUA A;  1HBX G;  2N8G A;  2TCT A;  4XQF A;  5H6Q A;  1VQ6 I;  2HOE A;  1LFB A;  2QEN A;  2X1D A;  5DM7 F;  3C2B A;  3X2Q H;  4ETS A;  1HA8 A;  4KMU X;  4HNV A;  3N05 A;  3KE2 A;  3SHF A;  3OS0 A;  1FNN A;  1FBS A;  2LK2 A;  2BVM A;  4M9X A;  3VYR B;  4E7I A;  1X1C A;  3F23 A;  3RQ4 A;  4NC8 A;  4IF4 A;  3E6M A;  2KDZ A;  1U8R A;  3RYR A;  1IN6 A;  2LLK A;  4DBQ A;  1VQO I;  1VQL I;  1PUF B;  1MJ9 A;  4JX4 A;  1LKX A;  4XN3 A;  4I6Z A;  1D3Y A;  4PDK A;  3RQI A;  4RAG A;  2R7R A;  2Y9Z A;  4A5N A;  3HL2 A;  5DDG A;  3JCU C;  2LNB A;  1NG7 A;  2CWE A;  4XLF A;  1YQA A;  1ETX A;  3WTV C;  3CJN A;  3IH4 A;  1SFX A;  1KZH A;  1SAU A;  1EH7 A;  2HDC A;  3L2C A;  3W6V A;  1HW1 A;  4RMN A;  3FBN B;  2XV4 S;  3WU2 C;  3RPU D;  2PFB A;  2XAU A;  3OOU A;  5JVG F;  2XF5 A;  2FA5 A;  4XOR A;  2IBD A;  1JUP A;  1D8K A;  2XSD C;  4IOA F;  3J80 K;  4IOC F;  3CCE I;  3ABU A;  1AOY A;  4EEF G;  2JTV A;  1MH3 A;  2PG4 A;  2HVR A;  3GTK J;  4I98 B;  4E70 A;  1T08 B;  4XRF A;  1K4S A;  2VBZ A;  3LQR A;  1A04 A;  2DQL A;  2GOM A;  3TW7 A;  1QPI A;  1LE8 A;  3LMM A;  1FEX A;  3CMA I;  4AIK A;  2LRD A;  1YTY A;  1UHM A;  4ZDO A;  4L5I A;  1V3F A;  2Z2S B;  2R5Y A;  2QM3 A;  2K9Q A;  2XF7 A;  1GVJ A;  1FMV A;  2Q8K A;  1YFH A;  1D1C A;  1YE9 A;  1BI2 A;  5EDN A;  3CJQ B;  2X6O A;  1Y56 A;  3LSJ A;  2EA4 A;  5DUI A;  2ZJP F;  1AWC A;  2W84 A;  4UV8 A;  4XON A;  1T2K A;  5BOX A;  2HQA A;  2STW A;  2W82 A;  3K2Z A;  3DLL F;  3PNV A;  3GTO J;  4BDZ A;  2AHQ A;  2TRT A;  2JA5 J;  1R5H A;  1R1V A;  1BOB A;  1BOA A;  4M6Y A;  1IXR C;  3WTU C;  2XF6 A;  4XR6 A;  3ELK A;  1TQM A;  1X1D A;  2OBP A;  4GYI A;  1UJ8 A;  3QP5 A;  3HOX J;  1BIA A;  3BR5 A;  2AS5 F;  1WGX A;  2QQ9 A;  3ZMU A;  1DP7 P;  2QA4 I;  3OYJ A;  2QSG X;  2O03 A;  2DA1 A;  3AG3 H;  4A12 A;  4IRH A;  4A3F J;  4HF1 A;  3QOD A;  2HKO A;  2DA7 A;  2HOA A;  4R79 A;  3LWF A;  4U0Y A;  2W7N A;  3CME I;  2R5Z B;  5BNG A;  4A0Z A;  3BG6 A;  1UHW A;  4HG2 A;  3S16 J;  3K70 C;  5FFZ A;  4C30 A;  1X1A A;  2K3P A;  3WGI A;  1A35 A;  1FMW A;  1IXC A;  2ZSH B;  3M1C A;  4BGD A;  2KRF A;  2CJJ A;  4U88 A;  4I0B A;  1LJ9 A;  4L0Z B;  4LB5 A;  2PMZ A;  2EIM H;  1JUM A;  3BR0 A;  3CDI A;  2O5R A;  3C3W A;  3G4S I;  2CS3 A;  5H20 A;  5J6X A;  4KA4 A;  3F0C A;  5ED4 A;  5HOD A;  4CGZ A;  5F0C A;  1IC8 A;  2LBF A;  4DZJ A;  4Y52 J;  2JA6 J;  4XIC A;  1NK2 P;  2QLZ A;  1OCZ H;  2O9L A;  2AO9 A;  3RPQ A;  1XSD A;  4FIS A;  2G0E A;  2LF7 A;  3CP2 A;  5KAF C;  2XKP A;  2D45 A;  1J0R A;  2VJI A;  1T8I A;  5JHF A;  4Z2Y A;  2LYC A;  4JQF A;  1RZ4 A;  1MH4 A;  3WTY C;  4Q48 A;  4HDV A;  3OY9 A;  3GFI A;  3MZH A;  4XM3 A;  5FKO A;  2PMZ N;  5ICE A;  4IZZ A;  2UXN A;  1VQ5 I;  4QIW N;  2RDP A;  3V7R A;  3GME A;  3LQQ A;  4HA8 A;  3K9T A;  1VQM I;  4M3B A;  2EZI A;  5HNH A;  3CQZ J;  2HI3 A;  2IGK A;  5H6R A;  2GXG A;  5IP7 J;  1HXD A;  2DO7 A;  1KQ8 A;  1WJD A;  1XCB A;  3HRM A;  2E19 A;  4JBA A;  2ELK A;  2XPU A;  4EGY A;  2DTR A;  1SAX A;  4UXN A;  1U5T C;  3ABM H;  2DMN A;  1G59 A;  1HKT A;  1FSH A;  4BQO A;  2VB6 A;  3LNQ A;  2KPM A;  4BBS J;  4Y15 A;  1R49 A;  1OJL A;  3CUQ C;  2L9N A;  1X19 A;  2CUE A;  3LL7 A;  4LOC A;  5J1R A;  3PIO F;  1JT6 A;  5GAG J;  3RKQ A;  4M3D A;  4G12 A;  3PFI A;  3D5L A;  3FMQ A;  4PJN A;  1XB4 A;  1I3Q J;  4W97 A;  4BH9 A;  3L1P A;  1D5V A;  2F5V A;  1E0E A;  2Y9Y A;  3A01 B;  4BQQ A;  3BCA A;  1H88 C;  4LIU A;  1Z6T A;  3CUO A;  3LA3 A;  1ZGW A;  4HOB A;  3RCO A;  4MHG A;  1TT0 A;  4MEX F;  1MW7 A;  1ERD A;  4E7K A;  1TZL A;  3H3V K;  2ID6 A;  3BTI A;  2VBX A;  1NG6 A;  5D5X B;  3TP3 A;  2ETH A;  2LY9 A;  4C2M J;  1RIO H;  1G3S A;  3FXL A;  1R7J A;  1N75 A;  1EF4 A;  5GP9 A;  2QKL B;  4YII A;  1LQ1 A;  3KLN A;  4HX7 A;  4UHT A;  4PFP A;  2PJR B;  3ZPL A;  2PJP A;  3CZ6 A;  4HRI A;  2FBI A;  1R36 A;  3CCY A;  4LJZ F;  2EFP A;  1ZAR A;  4ZJZ A;  1W36 D;  2H6C A;  5HOO A;  3QP6 A;  1ZG1 A;  4GCV A;  2QVO A;  3U2R A;  2QEX I;  3ABT A;  1IGN A;  2RAE A;  3FMR A;  3Q3S A;  5CVI A;  5EEH A;  4HV5 A;  3F72 A;  1H89 C;  3JRE A;  1YIO A;  3BCB A;  1BA5 A;  1Q1V A;  2OQR A;  3N4M A;  5LHH A;  1WQ2 A;  5EEG A;  2R7O A;  4MGR A;  1TW3 A;  3ERM A;  3F8N A;  3OYH A;  1VND A;  4E7L A;  2NRA C;  1U3E M;  3IP4 B;  2ZKZ A;  3KEO A;  2DA6 A;  4HV6 A;  2H8W A;  3HM5 A;  3ZR8 X;  2IGN A;  2NS8 A;  1IUF A;  3N97 A;  1OFC X;  2Y0M A;  1I5Z A;  5J4Y A;  4KNY A;  4Q5S F;  2DOD A;  2VE8 A;  2F5F A;  3K4B A;  4EGZ A;  1KU2 A;  3FHN A;  4C3J J;  4BEH B;  4N0B A;  4PUS A;  4QPO A;  4BJ5 C;  4MFD A;  2OZ6 A;  4XKV A;  5HDG A;  1ZR4 A;  5HS8 A;  2K4J A;  5ICF A;  5F1R A;  1CF7 B;  2R93 J;  1ZLJ A;  2AQF A;  3NWT A;  2ISZ A;  5IT9 Z;  4IX7 A;  4NDL A;  4ZDL A;  2K02 A;  2IS4 A; 
#chains in the Genus database with same CATH homology
 5DEQ A;  2A68 F;  3ZP5 A;  3DFG A;  2XRN A;  3GYH X;  3OV8 A;  5HLH A;  3RKW A;  4MEY F;  2R3S A;  1O3Q A;  3SXY A;  4HYE A;  2RN7 A;  3BY6 A;  2K27 A;  3VOD A;  2FEZ A;  3C1D A;  1U78 A;  1IN8 A;  3R0A A;  3I4P A;  3EQL F;  1XGN A;  1YS7 A;  2IP2 A;  3FMS A;  3FM3 A;  1Z91 A;  1FOK A;  4L9V A;  3E5U A;  4EJT A;  3FM5 A;  3ZMS A;  1FPQ A;  4UUV A;  1R00 A;  3COA C;  1XSX A;  1P4A A;  3JTG A;  2HS5 A;  3S2W A;  2OQG A;  4CO8 A;  1XGS A;  2X0L A;  4I2O A;  1I1G A;  2PBI A;  4L9T A;  3GZ6 A;  5K5R A;  4A5M A;  1P2F A;  4G6Q A;  2KIU A;  1GHC A;  4G7O F;  2V9V A;  4HX8 A;  2EV6 A;  3F6O A;  1CGP A;  3FXR A;  1G4D A;  4L0Y B;  1UB9 A;  2IA0 A;  4EM0 B;  2HWV A;  4AWX B;  4UVB A;  3TGN A;  1DDN A;  2EK5 A;  1LVA A;  3QRF F;  4XLP F;  3KEQ A;  3P9I A;  4ENM A;  4IRG A;  2F2E A;  2K4B A;  3ROU A;  4M9S A;  1JGS A;  4ZYD A;  2XHK A;  1S8N A;  4FT8 A;  1U5T B;  1S29 A;  1BC8 C;  1ZHF A;  5FGM A;  4I0A A;  4B8X A;  5FLX Z;  3LA2 A;  4EM1 A;  3GXO A;  1O3R A;  3CUQ B;  2FQ3 A;  4K2E A;  3W6K B;  1TBX A;  2J5O A;  3MWM A;  5D5V B;  1W7P D;  5F64 A;  3C18 A;  3R6S A;  5AON A;  1JE8 A;  2HEO A;  1IRF A;  2D2W A;  5DD8 A;  2HTS A;  4XSX F;  1RNL A;  1B9N A;  1BJA A;  2X4H A;  4EJO A;  1TLH B;  1DPR A;  3EUH A;  1XGO A;  4O5V A;  4MTD A;  3BJA A;  3DP7 A;  3FXQ A;  4M6X A;  1IN7 A;  4KUM A;  2VOD A;  4HDU A;  5E17 F;  3Q9V A;  4ESB A;  2FOK A;  1S7O A;  3VB2 A;  2QYO A;  2HYF A;  2B0L A;  3HHH A;  3KFW X;  1O7L A;  4PGG A;  2FSW A;  4WF2 A;  1ON2 A;  3R0J A;  3CTA A;  3E3V A;  1K78 B;  5CVV A;  4G9Y A;  1LNW A;  4EVI A;  3KLO A;  5FD6 A;  2YX4 A;  4Y17 A;  3LA7 A;  3IRR A;  2Z9O A;  1VTN C;  2VOP A;  1XDU A;  3RI4 A;  3FZV A;  3NEU A;  2XKO A;  1BI3 A;  2DPU A;  2R7D A;  2VBY A;  3J80 Z;  5D5W B;  1FP2 A;  2OZU A;  4WXD A;  2OD5 A;  2J5P A;  3WTS C;  3M8E A;  3FXU A;  2FNA A;  2PLY A;  1ZG3 A;  1Z6R A;  2HQN A;  1G3Y A;  4N9I A;  5E1W A;  5JR3 A;  4M73 A;  4KIF A;  2VBW A;  3T8T A;  1XGM A;  5L3G A;  1HW2 A;  4UVC A;  4MTE A;  4RB2 C;  1FYM A;  2MH2 A;  1IZ1 A;  2XAH A;  4P9U A;  1LDK B;  1ULY A;  2CG4 A;  4LLG F;  3J7A O;  1IF1 A;  3EYY A;  5TRD A;  3ZQ7 A;  2DK5 A;  2IJL A;  2P4W A;  2A5Y B;  2FMY A;  4G8X A;  1MDM B;  1EV7 A;  2KKO A;  2W24 A;  4HX4 A;  1J5Y A;  1SFE A;  1ZH5 A;  1XSV A;  1HKS A;  4HLY A;  3IRQ A;  2QQB A;  4P96 A;  5E20 A;  3I5U A;  4WK8 F;  1CF7 A;  5F6F A;  4Q47 A;  3HRS A;  1ZLK A;  1I6X A;  4WCG A;  4BNC A;  4ZZD A;  2F5E A;  1W7P B;  2VC0 A;  2P6S A;  4AVP A;  2ZXJ A;  1QPM A;  4OIP F;  3V7C A;  4KFC A;  5D6F A;  5E1Z B;  2O8X A;  5FB2 A;  3JTH A;  1R5G A;  3QPH A;  1TQI A;  4M9Z A;  3ULQ B;  3B02 A;  2GA2 A;  5FFX A;  2CO5 A;  3L9F A;  3F22 A;  2VOO A;  4RGS A;  4ZYH A;  2ZBK A;  1ZN2 A;  3QPT A;  3IC7 A;  3IWF A;  3R60 A;  2EB7 A;  1YW9 A;  3H3U A;  4I02 A;  2M5W A;  1JHF A;  2KIF A;  4L9J A;  1JXS A;  4YG2 F;  3RIR A;  1HST A;  3BZ6 A;  4M72 A;  5LRS A;  3GX4 X;  5CVJ A;  3BPX A;  5HLG A;  3E5Q A;  3BPV A;  2RQP A;  5BQT A;  1T98 A;  4O3M A;  1FX7 A;  3FWE A;  1Q1H A;  2L3D A;  2A69 F;  4I7H A;  1T6S A;  4ASN A;  2C6Y A;  1R22 A;  5E8G A;  4LFU A;  1FBQ A;  2HKX A;  2O6G E;  5E18 F;  5A2Q K;  4R1H A;  4ZYE A;  2NS0 A;  3I71 A;  5BMZ A;  4YFN F;  3WU1 B;  3CO7 C;  1ZRC A;  1FYK A;  2GA1 A;  2XAF A;  2ZNZ A;  3I53 A;  3LFK A;  1BIB A;  4LB6 B;  4IXA A;  3TOB A;  3L00 A;  1F4K A;  2FBK A;  4A6E A;  4RGR A;  4U7D A;  3ZMD A;  1PP8 F;  2RC4 A;  2CYY A;  1U5T A;  4OMZ A;  4KYW A;  2BEO A;  4OOI A;  2Q2E A;  1G3W A;  3VEP A;  2EA2 A;  5LHG A;  2L4M A;  4PZJ A;  3VOE A;  4CZZ A;  3BWG A;  1B6A A;  2A61 A;  3CUQ A;  4F7Z A;  5ILS A;  1SMT A;  2XAS A;  3E5X A;  2V1U A;  1P4X A;  3K0L A;  4HBL A;  4RAY A;  1B1B A;  3B73 A;  1FP1 D;  1ZYR F;  4LGW A;  4RS8 A;  3WU0 A;  2MLG A;  4IPA A;  3GFJ A;  2Z5U A;  3ZMZ A;  2EV5 A;  2NAZ A;  3Q9S A;  1Z9C A;  4HW0 A;  2UXX A;  5LBQ A;  1G3T A;  5HS7 A;  4Y13 A;  1MJB A;  2CGP A;  2OU2 A;  4DQ2 A;  3JSP A;  5KVR A;  3W6J B;  4A2U A;  3HOT A;  3BJ6 A;  3KP4 A;  2LDU A;  2Q0O A;  3ECO A;  3KET A;  3FHZ A;  2L02 A;  2L4A A;  1IN4 A;  2RGV A;  2EV0 A;  3G73 A;  1YW7 A;  1WSU A;  1S7A A;  1O7F A;  2LKP A;  4BQA A;  2ZCW A;  2DU9 A;  2Z99 A;  3CO6 C;  4EM2 A;  3F8F A;  1MGT A;  3H3Z A;  1WWX A;  3K1N A;  2MC3 A;  3LAJ A;  1H9T A;  4BHC A;  2P7V B;  3GW2 A;  1LDJ A;  1GXQ A;  3SZT A;  3DF8 A;  3I64 A;  3KZZ A;  3R61 A;  3TO7 A;  3F8M A;  5LEK A;  2H27 A;  1UST A;  2GWR A;  3M8F A;  1EH6 A;  4EJV A;  2FF4 A;  3V8K A;  4EJW A;  3MAJ A;  3FF5 A;  5L3E A;  5K5O A;  3R4K A;  3ZMV A;  2XRO A;  4M71 A;  5BS6 A;  2MLK A;  3IKV A;  1X3U A;  2NNY A;  3P9K A;  1KYW A;  3WGG A;  3DPT A;  2DPD A;  3RTR A;  2XGX A;  5DCM B;  2STT A;  2YR2 A;  2H94 A;  5KK1 A;  3GUD A;  1BI1 A;  1IW7 F;  2PEX A;  3LAP A;  3JAM K;  5ILU A;  3QU3 A;  1Z1D A;  4BXU A;  2F5D A;  1WKM A;  3BJO A;  1IAW A;  2IA1 A;  5LGU A;  1D8J A;  3HRT A;  2K7L A;  4IJA A;  4M74 A;  4PGH A;  3F3X A;  4QWQ A;  1WRJ A;  2IA2 A;  1SD5 A;  3I0T A;  1LB2 A;  4ZYG A;  1EH8 A;  1KQ0 A;  2DI3 A;  3DQV C;  2A3S A;  4ENN A;  2QWW A;  2P7C B;  2ESH A;  1BC7 C;  4HLX A;  1KA8 A;  1OMI A;  4GO1 A;  2ISY A;  5D4S A;  4P5O A;  3JW4 A;  2YU3 A;  4YIF A;  5D4R A;  2PN6 A;  5LRR A;  3LST A;  3CDH A;  1XDS A;  4FHT A;  2G9W A;  5E1X A;  4XLN F;  3IL2 A;  1O3S A;  2M45 A;  3HSF A;  2XAJ A;  3T0Y A;  1XCV A;  3I54 A;  1S3J A;  2M8E A;  1OYI A;  1ZRD A;  3HIF A;  2MA3 A;  3T5X A;  5DV5 A;  1LEA A;  2R7F A;  5LHI A;  1QGP A;  1QNT A;  4DNC A;  2ZME B;  3HTU A;  5L3D A;  2JPC A;  3I59 B;  1UCR A;  2M30 A;  2Y48 A;  3DPL C;  2HZT A;  3M1E A;  3RDI A;  5DD4 A;  3IWZ A;  4U0W A;  3GFM A;  3ZN0 A;  1USS A;  3ISP A;  3EDP A;  2QQA A;  5LEJ A;  3AAF A;  2Z3Y A;  4HQE A;  3RKX A;  3DV8 A;  2V79 A;  3DKW A;  4WWC A;  1B4A A;  4HF2 A;  1H9G A;  5JI6 A;  5L3F A;  4A6D A;  4G6D A;  3V4G A;  2EFQ A;  4L18 B;  2GZW A;  2AXL A;  2V1D A;  3PQK A;  4LK1 F;  4G7H F;  3KP6 A;  5BPI A;  4ON0 A;  4ENK A;  3HTS B;  2E7X A;  3K1M A;  4G94 A;  1R58 A;  4D0P A;  4A0Y A;  1MJA A;  2ESN A;  2COM A;  1K7A A;  3WOD F;  5L3B A;  4AIJ A;  4LG0 B;  4P55 A;  1MZB A;  1XMA A;  1KGS A;  4CHU A;  1XN7 A;  3VFZ A;  3Q5F A;  1YLF A;  4B09 A;  3HSR A;  2OAZ A;  3JSO A;  3V7S A;  2W57 A;  5ERI A;  5TJJ A;  4LLL A;  2QBY B;  4P9F A;  2DBB A;  3TQN A;  3TOA A;  3RPU A;  2CW0 F;  4RB3 C;  4L5J A;  1YW8 A;  2HQR A;  4ENJ A;  1FC3 A;  1P4W A;  4LLN A;  4KIG A;  2FXA A;  4RAZ A;  1HQC A;  2PI0 A;  3SFZ A;  3NRV A;  2HR3 A;  1KYZ A;  2MD5 A;  4GYG A;  3IHU A;  5LGT A;  1IUY A;  2XIG A;  2CFX A;  1W5T A;  1ZGJ A;  2DLL A;  1PUE E;  1Z05 A;  1TNS A;  2JRT A;  4S04 A;  4ESJ A;  3DXJ F;  3G3Z A;  5CJ9 A;  2YX7 A;  5L3C A;  2IT0 A;  5A2Q Z;  2V1X A;  2VN2 A;  1C0W A;  1FLI A;  3E97 A;  3HUG A;  3RYP A;  3HSE A;  2Y75 A;  2DK8 A;  4BHP A;  4LMY A;  2KJB A;  3D0S A;  2D1V A;  1LEB A;  4R8H A;  3MQ0 A;  1BI0 A;  3MZY A;  5HDN A;  4YFK F;  2IW5 A;  4ZZL A;  2W85 A;  5E8I A;  3F8B A;  3KP3 A;  5CLS A;  1ZAO A;  5DCM A;  1HKQ A;  3HYI A;  3KZY A;  2EFO A;  5LLQ A;  3KP2 A;  3QAH A;  3L09 A;  4I09 A;  3IKT A;  1STZ A;  1NHA A;  2GIV A;  3ECH A;  3I58 A;  4RGX A;  3O6B B;  4FX0 A;  4N9H A;  4LD5 A;  3M9A A;  4CYD A;  5JVT A;  1L3L A;  5DYM A;  1I1S A;  5DCF A;  3TO6 A;  1BM9 A;  4IVN A;  5AIQ A;  5J8C A;  2O0Y A;  5D6E A;  3KCC A;  4EQQ A;  4L9N A;  2G7H A;  2XAG A;  1DUX C;  2FNP A;  4IRI A;  5AIP A;  3F8C A;  3TDU C;  1JHH A;  4G7Z F;  2KIM A;  3RKY A;  2E7W A;  5JFR A;  1SD4 A;  2GQQ A;  4XBF A;  2XAQ A;  1REP C;  5FD5 A;  2EFN A;  3V8J A;  3U9G A;  3WTW C;  1UFM A;  2VT2 A;  3BOQ A;  4KDP A;  2NYX A;  3WGH A;  3O3K A;  1L0O C;  2FE3 A;  3P7N A;  2ACJ A;  1S6L A;  1TNT A;  4GGG A;  4JK1 X;  4KN7 X;  2WWY A;  4S05 A;  3F6V A;  2NNN A;  3NQO A;  4U0V A;  1OKR A;  1J75 A;  4HZF A;  2PMU A;  4ZH4 F;  2MH9 A;  2ZME A;  4KIC A;  4AIH A;  2CSO A;  2V6C A;  3I59 A;  4TV7 A;  2EJR A;  4RGU A;  4CDG A;  1OR7 A;  4LK0 F;  2DFI A;  4OIO F;  3J81 Z;  2QUF A;  1WI9 A;  1Y0U A;  4IHT A;  3JAM Z;  1R23 A;  2P5K A;  1P92 A;  4IHS A;  2QZ8 A;  1K78 A;  1J2X A;  4EMS A;  2XVC A;  4Q4Z F;  3BRO A;  1ODD A;  4LG0 A;  2H6B A;  4U7B A;  3MCZ A;  1G6N A;  2VON A;  4EJU A;  3GF2 A;  5JHU A;  3F21 A;  1XD7 A;  5CVU A;  1FZP B;  1BN5 A;  3EET A;  2WTE A;  1KU9 A;  2Z33 A;  3H92 A;  3QOP A;  3WTT C;  2QBY A;  2A07 F;  1GXP A;  2IVM A;  2O61 A;  1QO0 D;  1FSE A;  3HOS A;  2L01 A;  1FWZ A;  3T8R A;  5K1Y A;  1H0M A;  1OYY A;  2FRH A;  3OOP A;  3E6C C;  3GEZ A;  4OU0 A;  3ZN1 A;  3L7W A;  1FT9 A;  3WTX C;  2K86 A;  1O3T A;  1ZGA A;  1HSJ A;  1U2W A;  4YFX F;  3J81 K;  1J9I A;  1MDM A;  1SFU A;  3WE2 A;  4OIN F;  2BE5 F;  4ESF A;  2OA4 A;  2E1N A;  2ZO4 A;  1K79 A;  1QQI A;  1KU3 A;  2IPQ X;  5HS9 A;  4MNU A;  1IXS B;  1RUO A;  2BBY A;  2EWN A;  2H09 A;  1TTY A;  2HGC A;  1F5T A;  1T39 A;  2VT3 A;  2DT5 A;  2HFH A;  1QZY A;  2JT1 A;  2ZJ2 A;  4HQM A;  1W7P A;  3QU6 A;  5J8F A;  5ILV A;  2F5C A;  1U6G A;  1IRG A;  3M7G A;  2DW4 A;  3REO A;  4PCQ A;  3SZP A;  4RB1 A;  3T1B A;  5ICC A;  2JSC A;  1T0F A;  2WV0 A;  5D5U B;  2LF8 A;  4KT5 C;  1V4R A;  1BBY A;  5HVQ C;  1TW2 A;  4KIB A;  4UNO A;  2PMH A;  3CLO A;  1QZZ A;  2IRF G;  1T38 A;  3E6B A;  4RB0 A;  1FBU A;  3FX3 A;  2JZY A;  1E2X A;  4NB5 A;  5IT9 K;  3O2P E;  2PQ8 A;  1J59 A;  2BGC A;  2ADU A;  5ICG A;  2FU4 A;  2VE9 A;  3GZ5 A;  2HYG D;  2VC1 A;  3ERE D;  3BP8 A;  3K1P A;  3GWZ A;  2ELH A;  1OPC A;  3C7J A;  1I27 A;  4WX9 A;  1KU7 A;  4I01 A;  4O6J A;  1RUN A;  1J7K A;  1SMY F;  4MQ9 F;  3P9C A;  1SD6 A;  2P5L C;  1F9N A;  4WXC A;  1ONV A;  3GO5 A;  2P6T A;  2VXZ A;  5DUK A;  2UWM A;  2G7U A;  3MEX A;  1QBJ A;  1MKM A;  4WXH A;  3TDZ C;  1PP7 U;  1E17 A;  2BV6 A;  1LDD A;  3HHG A;  2JPB A;  1KQ9 A;  2W25 A;  3GVA A;  4BHB A;  3MFK A;  1YG2 A;  2UZK A;  1HW5 A;  3RJP A;  3WG9 A;  1YS6 A;  2MBF A;  2ZFW A;  3K69 A;  2E1C A;  2RV8 A;  4OIR F;  6PAX A;  3U1D A;  4GXO A;  4H0E A;  2XUB A;  3TO9 A;  4MQV A;  5HDK A;  4UVA A;  1FY7 A;  4KMF A;  2ZNY A;  3KP5 A;  1XMK A;  2DQR A;  4NHJ A;  2HTJ A;  5HLI A;  4BYY A;  4KN4 X;  1ZG5 A;  4BAY A;  1ZRE A;  1Z7U A;  4HF0 A;  5CYV A;  2KJC A;  2D1H A;  2RNJ A;  3WTZ A;  2TDX A;  2YSR A;  2P5V A;  2P8T A;  1SD7 A;  1R1U A;  4QLC U;  2L54 A;  2RKH A;  3GLX A;  4OMY A;  2GXB A;  2A6H F;  5BPD A;  5IT3 A;  5D8K B;  4XSZ F;  1OYW A;  3DEU A;  2A6E F;  1P6R A;  2EFW A;  1YO5 C;  3EYI A;  5FO5 A;  1DPU A;  4NQW A;  3WE3 A;  5D8L B;  4UV9 A;  5FLX K;  3GFL A;  1B9M A;  1MD0 A;  1W4M A;  2CQK A;  4A0X A;  1W5S A;  4CXF A;  2FML A;  3HRU A;  2BYV E;  2O3F A;  2RVC A;  3E6D A;  3KP7 A;  5K5Q A;  5LGN A;  1PDN C;  4AD9 A;  5CVR A;  1TQP A;  1IN5 A;  1ON1 A;  2WC2 A;  2DAO A;  1K6O A;  1B59 A;  3PQJ A;  1ZRF A;  1R1T A;  1YYV A;  1O57 A;  1F1Z A;  4FX4 A;  2FBH A;  4EV0 A;  2LSO A;  3V8L A;  2M87 A;  1RI7 A;  4HAM A;  3TKY A;  1FYL A;  4OIQ F;  2GAU A;  3ZMT A;  4CIC A;  3BDD A;  3ML6 A;  2M1B A;  3SQN A;  2YPR A;  1HBX G;  5H6Q A;  2HOE A;  2QEN A;  4ETS A;  4KMU X;  3KE2 A;  3SHF A;  1FNN A;  1FBS A;  4M9X A;  3F23 A;  4IF4 A;  3E6M A;  1U8R A;  3RYR A;  1IN6 A;  1MJ9 A;  1D3Y A;  4PDK A;  4A5N A;  5DDG A;  2LNB A;  2CWE A;  1YQA A;  3WTV C;  3CJN A;  1SFX A;  1EH7 A;  2HDC A;  3L2C A;  1HW1 A;  2XV4 S;  2PFB A;  2FA5 A;  1D8K A;  3J80 K;  3ABU A;  1AOY A;  2JTV A;  2PG4 A;  4I98 B;  4E70 A;  4XRF A;  2VBZ A;  3LQR A;  1A04 A;  2DQL A;  4AIK A;  1YTY A;  1UHM A;  4L5I A;  1V3F A;  2QM3 A;  1GVJ A;  2Q8K A;  1YFH A;  1BI2 A;  1AWC A;  2EA4 A;  5DUI A;  2W84 A;  4UV8 A;  1T2K A;  5BOX A;  2STW A;  3K2Z A;  1R5H A;  1R1V A;  1BOA A;  4M6Y A;  1IXR C;  3WTU C;  3ELK A;  1TQM A;  2OBP A;  4GYI A;  3QP5 A;  1BIA A;  2AS5 F;  2QQ9 A;  3ZMU A;  1DP7 P;  2O03 A;  4A12 A;  4IRH A;  4HF1 A;  2HKO A;  4R79 A;  3LWF A;  4U0Y A;  4A0Z A;  1UHW A;  5FFZ A;  3WGI A;  1IXC A;  2KRF A;  4U88 A;  4I0B A;  1LJ9 A;  4L0Z B;  4LB5 A;  3C3W A;  4KA4 A;  5H20 A;  5J6X A;  5ED4 A;  4CGZ A;  2QLZ A;  3RPQ A;  1XSD A;  2LF7 A;  2XKP A;  2D45 A;  1J0R A;  4Z2Y A;  4JQF A;  1RZ4 A;  3WTY C;  4Q48 A;  4HDV A;  3GFI A;  3MZH A;  5ICE A;  2UXN A;  2RDP A;  3V7R A;  3LQQ A;  4HA8 A;  3K9T A;  5H6R A;  2GXG A;  1HXD A;  2DO7 A;  1KQ8 A;  1XCB A;  3HRM A;  4JBA A;  4EGY A;  2DTR A;  1SAX A;  4UXN A;  1U5T C;  1HKT A;  1FSH A;  4Y15 A;  3CUQ C;  3PFI A;  3D5L A;  3FMQ A;  1XB4 A;  4BH9 A;  1D5V A;  1Z6T A;  3CUO A;  3LA3 A;  4HOB A;  4MHG A;  4MEX F;  5D5X B;  2VBX A;  2ETH A;  1RIO H;  1G3S A;  1R7J A;  4YII A;  1LQ1 A;  3KLN A;  4HX7 A;  4UHT A;  3ZPL A;  2PJP A;  2FBI A;  1R36 A;  4LJZ F;  2EFP A;  1ZAR A;  2H6C A;  5HOO A;  3QP6 A;  1ZG1 A;  4GCV A;  2QVO A;  3U2R A;  3ABT A;  3FMR A;  5CVI A;  5EEH A;  4HV5 A;  3F72 A;  1YIO A;  2OQR A;  3N4M A;  5LHH A;  1WQ2 A;  5EEG A;  4MGR A;  1TW3 A;  3F8N A;  2NRA C;  1U3E M;  2ZKZ A;  3KEO A;  4HV6 A;  3N97 A;  2Y0M A;  1I5Z A;  4KNY A;  4Q5S F;  2VE8 A;  2F5F A;  4EGZ A;  1KU2 A;  4N0B A;  2OZ6 A;  5HDG A;  5HS8 A;  2K4J A;  5ICF A;  5F1R A;  1CF7 B;  1ZLJ A;  2ISZ A;  5IT9 Z;  2K02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...