3CMYA

Structure of a homeodomain in complex with dna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
60
structure length
60
Chain Sequence
GQRRSRTTFTAEQLEELERAFERTHYPDIYTREELAQRAKLTEARVQVWFSNRRARWRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Paired box protein Pax-3
publication title Structural Basis for DNA Recognition by the Human PAX3 Homeodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator/dna
total genus 22
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2008-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3cmyA00
2LY9A 3ZQGA 1QVUA 3HOYJ 1OCTC 3S1QJ 2G0EA 4IHWA 3BR3A 5F04A 1ETXA 2JA5J 4JX4A 2NVTJ 4A3MJ 4CYCA 1ZQ3P 1BL0A 1JT6A 1MBEA 4BBRJ 1ETKA 4DZPA 1Y1WJ 1ETQA 3IH4A 2DJNA 4I6ZA 1OJLA 1POGA 1DU0A 4M3EA 1BW5A 2KDZA 5J1RA 3FIWA 1LE8B 2XB0X 3S1MJ 1VNDA 3RZDJ 2JA8J 1H8AC 4XRSG 1WPKA 5FKNA 1VI0A 1XS9A 3OIOA 5C4XJ 3H0GJ 4C3IJ 4LOCA 1IC8A 3W6VA 2Y9ZA 1FTTA 1JTXA 1GV5A 1RKWA 2H8RA 1JGGA 4L5EA 3JRCA 3GTJJ 1MSFC 4A69C 3L1PA 3OSFA 4DYCA 1FIAA 2R7ZJ 1MH4A 4V2FA 4XRMA 3HEFA 4W1UA 1WGXA 4B4CA 3RZOJ 1MBGA 2Y9YA 3LOCA 1VFCA 1G2HA 2X9DA 5M3MJ 3JRHA 2YUSA 1PUFB 2DMQA 2JMWA 3TP3A 1JKOC 2R5YA 1AU7A 3TW6A 3CDLA 1HF0A 3IH2A 4D7MA 4FTHA 1AKHB 2L9RA 1LFUP 1ETWA 4Y7NJ 1K83J 2ME6A 2K9QA 1YRNA 2NVXJ 3ZOBA 4A3LJ 1BJZA 2XB5A 1P7IA 1IUFA 3WHCA 5DS9A 5K7ZA 4IEJA 4W97A 3BG5A 3B6AA 1S7EA 3I4MJ 2ECCA 2L7MP 3A03A 3BTLA 1ZTRA 2DMUA 1UMQA 3D1NI 1FJLA 4M3DA 4S0HB 3S15J 2W48A 3RQIA 3HOWJ 3UKGA 2E2IJ 2EZLA 1QRYA 4BKXA 1W0UA 2DA6A 4C3HJ 4QIWN 1GUUA 4AUXA 2EQRA 3BG9A 5F27A 1OCPA 5GP9A 1IJWC 1LE8A 2JN6A 3A02A 2HDDA 5M5YJ 1JTYA 2XGCA 1I50J 5GPAA 3BR0A 3MVPA 1B72B 5FKMA 2QCOA 4X1EA 1U9NA 1NTCA 2MGQA 5HODA 1ZK8A 2NOGA 3HOXJ 4BY1J 3S17J 3JRBA 1JKPC 2ZB9A 4B3AA 1ZKGA 2OPTA 1P7JA 1SANA 2P81A 3VPRA 3JRDA 3S2DJ 3JRIA 3PO3J 2VUMJ 2CQQA 2EH3A 5IP7J 2DA1A 2VKEA 5BNGA 5IOZA 4A93J 2LR8A 4FE4A 3GTLJ 4HNVA 1WI3A 2M9HA 5JLXA 5EDNA 1MBHA 1X2MA 1PUFA 3JREA 1UG2A 3BR6A 2LVSA 1IGNA 2K40A 1ZGWA 4XIDA 2Y0SN 1TWFJ 1NK3P 3ZQIA 2DMTA 5K7FA 4MIMA 3DEWA 3HB9A 2NS8A 1GT0C 2N8GA 2AO9A 5J1YA 5EG0A 4M3BA 2M0CA 3A01B 4JX5A 5F08A 4BY7J 5EEAA 4FCYA 2GBYA 4DYQA 2O8KA 1IDZA 4JX6A 3F0CA 2E2JJ 2CJJA 1QVTA 1ORKA 3BTCA 2JJ7A 5F0HA 2LLKA 1JJ8C 2PMZN 5FKKA 3GTQJ 3CCYA 2DMPA 1NK2P 1GV2A 3B6CA 5E3NA 4QTRA 1AHDP 4D7NA 5K7HA 5FLMJ 1MBKA 3HGYA 3SFIA 2K9NA 1ETVA 5FJ8J 1IDYA 2EZIA 5IPAA 3PM1A 4UUSA 2DMNA 4A3KJ 3C2BA 2HQ5A 1WCMJ 4A3FJ 3BR1A 2R5ZA 1JT0A 2GM4A 2HYJA 1MH3A 3GTMJ 2CUEA 2M2EA 5IYBJ 1B8IB 1I6HJ 2O9LA 3GTOJ 1LFBA 4DW6A 1JKQC 2RAEA 4IHYA 4D5FA 3ZQHA 3LSRA 1VF9A 5C3EJ 3I4NJ 3HOUJ 1X58A 2M34A 1RR7A 2FX0A 5E3LA 3HKZN 2M8GX 3TEDA 1X2NA 2L0KA 3FISA 4Y52J 4FISA 2JWTA 1ZR2A 5E3OA 4CYCB 2R92J 4C2MJ 5C4JJ 5IOYA 3LNQA 2XPWA 4A3GJ 3BTJA 2EZKA 2FJ1A 3JRGA 1IV6A 2FD5A 2LFBA 2OF7A 3Q0UA 9ANTA 2ME0A 2D5VA 2AHQA 4XRSA 4BBSJ 3ZQFA 1BW6A 3O8GA 1HDDC 1TWCJ 1MBJA 2DA4A 2VI6A 4QSHA 1ITYA 3JR9A 1T56A 1DU6A 2DTZA 4DYRA 3LSPA 1I3QJ 2LKXA 2B63J 2R93J 1HDPA 2TCTA 1JJ6C 4ABZA 2X6OA 3QQAA 3BG3A 1OFCX 2HI3A 1U8BA 3JRFA 4DZJA 4IHXA 1E3OC 3G1OA 2GLOA 4UUTA 5IP9J 1ETYA 2DA2A 2E1OA 3ZQCA 2I10A 2LTPA 1ZR4A 2WB1N 4AYBN 3DCFA 5FLVA 2MW8A 3MKLA 1WH7A 1TWHJ 5GPCA 5M5XJ 1FIPA 3G1LA 2CU7A 3S2HJ 1BA5A 5M3FJ 1APLC 5EGOB 3HOZJ 2DA5A 2ELKA 2Y30A 1D5YA 2HOAA 4G12A 1R9TJ 4I76A 1W0TA 2JA6J 1WH5A 2Y2ZA 3GBGA 1AKHA 2CRGA 3S16J 4NDLA 1HCRA 1HOMA 3S1RJ 4MLOA 1YRNB 3GTKJ 2E2HJ 3G1MA 1JUMA 1T33A 2IBDA 2WV1A 4B1RA 3H3VK 2TRTA 3BTIA 3HOVJ 2EBIA 1TWAJ 3NAUA 5F1JA 2XGEA 2DA7A 1RPWA 2JK3A 1Y1VJ 2XPUA 4A3CJ 2HXIA 1Z0XA 2ID3A 4M3GA 2CUFA 1TC3C 4FE7A 2LP0A 3K7AJ 3BR5A 5EZHA 3IH3A 4IHVA 2E19A 3MN2A 2ID6A 1A6IA 3E7LA 4MFEA 2NVQJ 3RKQA 3S1NJ 2L7FP 3FK7A 5J1UA 3PO2J 3LSJA 4A3DJ 1JKRC 2Y31A 5IYCJ 1F36A 2ECBA 5EYRA 2XGDA 1B72A 3NARA 3QPSA 1Z77A 1CQTA 1RKTA 1RETA 3CQZJ 5F0CA 1U9OA 5IP6A 3CMYA 3BT9A 3M3YJ 2DA3A 4XICA 3K2AA 3HBLA 5IYDJ 3GTGJ 2QF7A 1TWGJ 3Q3SA 3ZQLA 1RESA 3LSGA 5FKLA 4M6VA 2JA7J 3WHBA 5EGOA 2IAIA 1Q1VA 4X6AJ 2COBA 2R0QC 4D5CA 1K61A 3IV5A 4RBOA 4A3IJ 2CQXA 5JLWA 5M5WJ 2EZHA 3TP0A 3SDGA 1HLVA 3HDDA 3S14J 4A3BJ 4GFBA 1FTZA 2MG4A 4M3FA 1IG7A 4RDUA 4V2GA 1H89C 2X48A 5EZGA 4EEFG 1IRZA 4AC0A 5EG0B 1JUPA 4JYKA 3A01A 2VPRA 2K9SA 3Q0WA 5J3LA 4A3JJ 3QPLA 4BXXJ 2KT0A 2L7ZA 3FKIJ 5EF6A 1JUSA 2LK2A 1GVDA 5E3MA 3Q0VA 4MFDA 1ENHA 2XPVA 1H88C 2HOTA 2LD5A 1SFOJ 3GTPJ 1QPIA 2WAQN 3SJMA 3M4OJ 1FEXA 4JP0A 3FK6A 1XC5A 1GDTA 2YU9J 3HGGA 4UUSB 2YS9A 2XRLA 2XSDC 5DTDA 1EF4A 4XK4A 2O7OA 2R5ZB 5FKOA 3TW7A 1UHSA 2MSYA 5C44J 4C3JJ 3BQYA 3OSGA 1U78A 2HOSA 3BQZA 1MBFA 3OOUA 1B8IA 2IEKA 1MNMC 2DN0A 1A5JA 2R5YB 2H1KA 1F43A 4J19A 1MSEC 5F0FA 2NVYJ 3O8HA 3HM5A 3JRAA 4A3EJ 1ETOA 2FQ4A 2VKVA 3BR2A 1XG1A 1O4XA 4MO7A 2HXOA 2NS7A
chains in the Genus database with same CATH superfamily
3RCOA 1OCTC 2JSPA 3S3NA 2HDWA 1K6OA 3CMEI 4NBQA 1ETXA 1R22A 2XASA 4PDKA 3HSFA 4XLFA 1WSUA 1ZQ3P 1JT6A 2AXTC 4L5JA 3FXLA 4BBRJ 5FGMA 3E6CC 1ETKA 4DZPA 3IH4A 4I6ZA 4AVPA 3F8NA 3CCQI 1ZG1A 1DU0A 1ZRFA 3R0AA 2KDZA 4LIUA 4HRIA 4DBRA 1TW3A 2ELHA 2XB0X 4I0BA 1VNDA 3RZDJ 1G3SA 4K2EA 3R0JA 4IVNA 5HLTA 3PFIA 2WAFA 1VI0A 1OCCH 4NHJA 2ZKZA 2RREA 3H0GJ 4BU2A 3LAPA 3W6VA 4QPQA 5D4SA 3OOPA 3O2PE 4LIVA 4UXNA 2KJBA 2DQRA 2IA2A 1JTXA 3PUBA 1TQPA 4RAGA 1JGGA 4OAYA 2DOEA 4XLCA 3F22A 2Z9OA 2EV6A 3OSFA 3AG3H 3S3OA 4BJ5C 3TQNA 3ZP5A 2QBYB 2R7SA 1ZG5A 1ON1A 2W57A 2WBMA 2MC3A 3GF2A 3OR1C 1XDUA 2XSJC 2LMDA 3EUAA 5E18F 1MH4A 1XGOA 1VTNC 2CMPA 4W1UA 4B4CA 2GOXB 4N4OB 1MBGA 3LOCA 2ZXWH 4D9JA 3DTKA 2EB7A 1PUFB 3O3KA 3C7JA 5DUIA 1JKOC 2G7UA 2QYOA 2ESNA 2MLKA 3CDLA 3GCMA 3SFZA 3GXOA 2F5EA 2PG4A 1MDMA 2XF7A 1P4AA 2J5PA 4BJ6C 2K9QA 4IXAA 1E3PA 2M3AA 4IF4A 4A3LJ 2JZYA 4IRHA 2NOJB 1LUJB 3ROUA 4BQOA 2VPLA 2R7QA 2XB5A 2L4MA 1PJRA 5K7ZA 2DK5A 4Q48A 2ESHA 3B6AA 1S7EA 4I09A 3I4MJ 4CA0A 2ECCA 3A03A 4GO1A 1H9TA 3VFZA 2MABA 2PMHA 1FJLA 3FMQA 3CCJI 4M3DA 1LDKB 3RQIA 3LSIA 4ON0A 3CO7C 2E2IJ 4MTEA 3OYEA 1W0UA 1IW7F 1A35A 2Q0OA 1I1GA 4PSWA 2BEOA 3LSMA 2E5ZA 2UXNA 2W84A 1ACIA 2JN6A 2CW8A 3T1BA 1I50J 1YW7A 5GPAA 2GZWA 4QPOA 2W1OA 2KDOA 1B72B 2VOOA 3RTRA 5GTHC 1NTCA 4EV0A 4M9SA 1OISA 5HODA 1ZK8A 2HR3A 5L3EA 4OIQF 2BY1A 4UV9A 3S17J 4G7OF 1Y6IA 2HZTA 3HUGA 4G6QA 5HLHA 4KISA 1HC8A 2CQ7A 4PUSA 2Z2SB 4BL0B 1T39A 2VUMJ 2EH3A 1A31A 1Y8QB 4EGYA 3BZCA 3CCRI 1FP1D 2LR8A 4FASD 1O57A 1WWXA 1V55H 5JLXA 4EVIA 1R49A 2B7EA 3BR6A 4AIHA 2LVSA 3J7ZI 2XKPA 3GZ5A 5K1YA 2M8EA 3FXUA 2KPMA 4M73A 5ED4A 3D5RC 2VT2A 4ZC3A 1FYLA 3V7SA 1G59A 1BOAA 3O6BB 4G6TB 3TKYA 1B6AA 3I9V2 4MIMA 3WTSC 3K4CA 1SVOA 1R36A 2WTEA 1D5VA 5ICCA 1Y0UA 2NS8A 3DU6A 1R1VA 5BPDA 5J1YA 2DDBA 1ZLKA 1D0ZA 1H9GA 1UHWA 4M3BA 4A2UA 2M0CA 2M1BA 3A01B 3OYAA 5KAIC 1XN7A 5F08A 1KU7A 5EEHA 3KZYA 2DJIA 4DYQA 1X4OA 2O8KA 3MFKA 4ZH4F 3CMAI 2E36A 4BE0A 1DP3A 1QVTA 2HFHA 2LLKA 4LB6B 3CCYA 1NK2P 4QTRA 4BS9A 4O5VA 4Q5SF 3ERED 4L9JA 4A6DA 3DPTA 1DUXC 3H92A 2K9NA 3FM3A 4YIIA 2CWEA 5FJ8J 1ZELA 1XDSA 3CP2A 5E1WA 1IDYA 4CCLA 3I0TA 2DMNA 2L9VA 3C2BA 3FXQA 3BR1A 2R5ZA 2HYJA 3E5UA 4BJTA 4JBAA 3PFYA 3QU3A 2M2EA 5IYBJ 1DGRM 2O9LA 4ZYAA 3X2QH 4MQVA 3GTOJ 1JI8A 4XORA 1JKQC 5L3GA 5HS8A 2NS0A 4U0YA 3H9QA 1VF9A 1EH6A 4IZZA 1X58A 2COMA 2KHMA 2FOKA 4E7JA 3DU5A 1QNTA 3TGNA 3AL0C 3TEDA 3VSLA 1ULYA 1X2NA 1YJNI 2VKDA 2D1HA 2VC1A 2KQRA 5CVJA 3BJOA 4KMFA 3I3LA 5DM7F 3J81K 3BTJA 2DODA 4PGGA 2FD5A 1TNTA 1P2FA 2FBIA 2VIXA 4RM3A 3CC4I 3CF5F 2LFBA 3Q0UA 4LLLA 1GXPA 4DQ2A 3LAJA 1PP8F 1SVLA 3OYIA 2DBBA 3K69A 5B3SH 4QWQA 3NEUA 1BJAA 5DV5A 4HAMA 1T56A 2QUFA 1CF7B 4E7SA 1VQOI 3E0JB 2QSGX 1XGMA 4DYRA 1I3QJ 1N75A 2PMUA 2LKXA 2CFXA 2R93J 5CKTA 5CJ9A 3QQAA 4WXCA 4RB1A 1OFCX 3COAC 1W7PD 2P8TA 4FHTA 2VQHA 3JRFA 4L9VA 1E3OC 2HZDA 2JPBA 4OINF 3V8JA 1ETYA 3I5UA 5LEKA 2GLOA 4UNOA 2XC7A 2LTPA 1X1BA 3PQKA 4XKVA 2QBYA 3F9KA 2WB1N 2LKPA 1WH7A 4XNFA 4HF2A 4HX7A 1TQIA 3TL4X 1APLC 3OMYA 5TRDA 2A68F 2ELKA 2K85A 3IRQA 4KDPA 3ABKH 4G12A 1W0TA 1O3RA 3V8LA 3ZRGA 3I71A 4BQAA 1Y8RB 1TBXA 2XF6A 4NDLA 3MQ0A 1S8NA 4MLOA 1YRNB 2H27A 5AIPA 2E2HJ 1T33A 3MEXA 3NWSA 4B1RA 1WJ5A 5LD2C 1SD7A 1TWAJ 5GTIC 3WE2A 1LPQA 1V5FA 3K10A 2XGEA 3RJPA 1BI1A 2DA7A 1GXQA 1Y1VJ 1G8XA 2GAUA 4A3CJ 2RDPA 1N25A 1WJDA 4M3GA 4E7IA 4N0BA 3VOEA 2X1CA 4MHGA 3BR5A 2UV1A 3FM5A 3IH3A 1VQ8I 4HQMA 1Z9CA 3CCSI 4ENMA 3KX2A 4RB3C 2AS5F 4B8XA 2NVQJ 2E1NA 5A2QK 2VKHA 3FK7A 1UHMA 3FX3A 5J1UA 2ZNZA 2MA3A 3PO2J 4BNCA 1JKRC 1SEUA 3FXRA 2ECBA 1IRGA 4CH7A 2XGDA 1B72A 2XVCA 1BIBA 2MC4A 3NARA 2M5WA 1Z77A 1YO5C 4ITVA 3CQZJ 1U9OA 1VQMI 3KFWX 3BT9A 1DGWY 1S29A 2EFPA 4KITB 5FD5A 3KETA 3RI4A 2F5VA 3QWLA 3RKXA 4PZJA 5JHUA 4MNUA 3CZ6A 3W2VA 2Y0SA 3GTGJ 2OZUA 2QF7A 2ELJA 2Y75A 3IHUA 3OR2C 4JQFA 4KA4A 3ZQLA 3RYPA 2UWMA 3QP6A 1HW2A 2JA7J 2OTJI 3M9AA 3K4MA 2QM3A 1LJ9A 2M7BA 4CXFA 2COBA 3HPGA 4LG0B 1I39A 2L7KA 4G7HF 2R7OA 5LHGA 3IV5A 1FWZA 2V79A 1BOBA 1IXRC 1KU3A 2K9LA 2M4KA 5L3CA 3TP0A 1PUEE 4MGRA 2QQ8A 4RA2A 3HDDA 4M6YA 1R4MB 4M3FA 1H89C 1UG0A 1XGSA 2X48A 4ETSA 4EEFG 4IHTA 3J80Z 3ZMTA 4UUVA 3K4KA 4HSTA 4JYKA 3J81Z 3A01A 2V9KA 1XCVA 2O3FA 3Q0WA 2DQLA 4L0ZB 3HSEA 3OV8A 4L9NA 5IT3A 1TQMA 4OOIA 2X0LA 2BW3B 2CW0F 3DV8A 1BR2A 3OYLA 2LK2A 2V1UA 3RPUA 3MZ8A 2IGOA 4AVZA 4MEYF 1E0EA 2OBPA 1KYWA 1WKMA 4D0PA 1XB4A 4MFDA 3F8MA 4CSWA 3ZN1A 2KZVA 2LRDA 2QWWA 1RI7A 1USTA 3R4KA 2CGPA 3E6DA 2LD5A 2LY2A 1QPIA 2WAQN 3TMOA 1SD6A 3C3WA 4RAFA 3WU0A 4HX8A 2A05A 4UUSB 3ABTA 4MTDA 2JQ7A 2M87A 5DTDA 4XK4A 1QZYA 1EH8A 2EFQA 2E35A 3TW7A 4C3JJ 1Z7LA 2JPCA 4ZDLA 2CYYA 4CCOA 2HOSA 2LDUA 4EJOA 1BR4A 2VONA 1IRFA 3CTAA 3UNGC 2XUBA 3V42A 1MSEC 2KRHA 1WHUA 2H6BA 1XX5A 3O8HA 1X4PA 5ILSA 3JRAA 3DBRB 2ZJQF 1ETOA 2FQ4A 2VKVA 2A6TA 3BR2A 1O4XA 1T98A 2ZCWA 2NS7A 1R1UA 2DT7B 1QVUA 4EM1A 3S1QJ 4IHWA 2RV8A 1O7FA 5FO5A 4C9YA 4WCGA 2FQ3A 1XGNA 2KKOA 2KMUA 2NVTJ 3MKWB 2MH9A 1YLFA 2O61A 1F4KA 1Y1WJ 1ETQA 1OYYA 2OZ6A 2STWA 1VZ0A 2WADA 4GYGA 1CGPA 1PVEA 1IN7A 4OWRB 1BW5A 4EJWA 1WJEA 2CV1A 2HKOA 4IJAA 2OQRA 3HRUA 5K5RA 2JA8J 4YFXF 4LK1F 3CD6I 5C4XJ 1UZCA 1T0FA 1CF7A 1YS6A 3CP8A 3HHGA 1IC8A 2DFIA 3D0SA 2ZNYA 2F6CA 4R1HA 5A2QZ 2Y9ZA 2FE3A 4HG2A 1GV5A 2RNJA 3ZMSA 4AIKA 1SMYF 4L5EA 3JRCA 1MSFC 3IKVA 3HC7A 4OIOF 4E70A 2E1MB 3HUGB 4DIQA 2FUG2 3J7YJ 1BI2A 1FIAA 4BHPA 2R7ZJ 3CLQA 5FB2A 1O3QA 2EFNA 2M4GA 1IN8A 3AKZA 1TLHB 4V2FA 4KT5C 5EEGA 3RZOJ 4HPQA 2Y9YA 4PGHA 4KFCA 5M3MJ 4D1QA 3JRHA 3IWFA 1RR8C 1YI2I 3TP3A 3CCEI 4CCJA 1P4WA 1T95A 1FMVA 1KU9A 4ESJA 3TW6A 1AU7A 1HF0A 4M9ZA 4FTHA 1AKHB 2L9RA 1VQ7I 4G6DA 1LFUP 1FNNA 1R71A 2HDCA 1D8KA 2P5VA 2EV5A 2ETHA 4G9YA 1YRNA 4KUMA 4WWCA 4RB2C 2VODA 1BJZA 1YITI 3EYYA 2HWVA 2CSOA 3G2BA 3SEQA 2F2EA 4L18B 3K1PA 1BM9A 3LL7A 2I5UA 3BTLA 3TO7A 2DMUA 4Z2YA 4NNJA 2TDXA 4XLAA 4S0HB 4Q47A 2HOEA 4F91B 3Q5FA 2W48A 3S15J 3K9TA 3UKGA 4WK8F 2DLLA 1Z7UA 2NXNB 3J7AY 1UB9A 1OQYA 1P9QC 2X6YA 3M1EA 4MQ9F 2XIGA 1XMXA 4HNTA 1LE8A 1D1AA 2A5WA 2X4HA 5F27A 5GP9A 1IUYA 4BQNA 2NNNA 2VXZA 5D8KB 4WXHA 3B73A 2LOOA 4RAZA 3RIRA 5KAFC 5HOOA 4E6KG 2VE8A 2MLGA 5B66C 5ICGA 1RRJA 2QCOA 4X1EA 2XAGA 1U9NA 5ILVA 1LDDA 2A6EF 3CESA 3CF2A 5H6QA 2MGQA 1YE9A 4OAZA 5J8CA 3KLNA 5LEJA 5J4VA 2NOGA 4BY1J 4EM0B 3ECHA 3PIOF 2JT1A 4XLHA 4XOTA 3ONQA 4B3AA 3GMEA 1ZKGA 1VQ4I 4YFKF 4C2TA 1P7JA 3VPRA 3K70C 4HDVA 3MAJA 1FYKA 3JRDA 2BE5F 2K9MA 2VC0A 3AG4H 5DD4A 3JRIA 3PO3J 1MMSA 4II3A 2DXIA 1HSJA 3S93A 1HW1A 2EPFA 3GTLJ 1WI3A 4B09A 1C0WA 2X1DA 2IP2A 2L54A 2K27A 1MBHA 1X2MA 2YX7A 4LG0A 1UG2A 2HQAA 4PJ0C 2WV0A 1ZGWA 5H20A 1W5SA 1YIJI 2VBYA 2A5YB 1TWFJ 1OYIA 4ZDPA 1NK3P 5CVIA 2DMTA 3DPUA 2K3PA 3AG1H 3G6EI 2DFEA 3ERMA 3T8RA 2W00A 2VOPA 1GT0C 2N8GA 2AXLA 2HGCA 3OYGA 2W25A 3GZNB 1XPXA 4HLXA 4ZYHA 4A6EA 4HF0A 2GIZA 4R8HA 1XMAA 3E3VA 3WTWC 4DBQA 5E17F 1IZ1A 1W5TA 2OUMA 4PSXA 4BY7J 5B1AH 3BJ6A 3ECOA 1LKXA 4EM2A 2BW3A 2FBKA 3DWLE 4ENNA 3OIQA 3BZKA 2CJJA 1ORKA 1STZA 4S04A 2E71A 1GLNA 3NQOA 2QQAA 2PMZN 2ZFUA 3M8FA 4EATA 3GYHX 3GTQJ 3OL4A 3B6CA 5E3NA 1M1EB 4CYDA 3QRFF 5DCMA 3KP7A 2H6CA 3SFIA 3ZMUA 2PJPA 2DO7A 1TT5B 2ZJ2A 2LYCA 3ZR8X 3CCUI 4I2OA 4XOPA 2EZIA 5IPAA 3P9IA 2A6HF 4ZYEA 4UB6C 4UUSA 1X3UA 2BOLA 4A3FJ 4BUPA 2LF8A 1JT0A 2GM4A 3EYIA 1MIJA 2ZSHB 1ZHFA 5H2FC 1MH3A 1SAUA 4B43A 3GTMJ 2VJ4A 1S3JA 4KIGA 2BXZA 3OYNA 4DW6A 4Y15A 2HPMA 2X1EA 2RAEA 3SYTA 3SEZA 5LLQA 1SFXA 3I4NJ 2BY3A 3HOUJ 1PDNC 2DYRH 1LEAA 1KU2A 2M34A 5DCFA 3MKYB 5IT9K 1RR7A 2FX0A 1BIAA 3HKZN 1QQIA 2M8GX 5D6EA 2HVSA 1HSTA 1V5EA 1IN5A 2L0KA 3FISA 1IRXA 4PJJA 4FISA 1YJWI 4Y52J 1WRJA 2WC2A 1ODDA 2JWTA 1ZR2A 3I59B 4LLNA 3ULQB 3WTYC 1Z91A 3MZHA 5E1XA 1TP4A 2R92J 4C2MJ 5IOYA 1D1BA 4IX7A 4ASNA 5CVUA 3TOBA 1IV6A 4NC6A 4BACA 3CUQC 4F3QA 3E1SA 2IA0A 4N9IA 4ZYGA 4UVAA 2OF7A 3W3CA 2V1DA 2FRHA 3OS1A 3SHFA 3WODF 4FT8A 4E4HA 2D5VA 2AHQA 2A07F 3OYDA 4XLNF 1KYZA 3WTTC 1BW6A 1JHFA 3LSKA 1TWCJ 3L2UA 4XBFA 2DA4A 1DQUA 1OCOH 4P9FA 4QSHA 3P5JA 3ABLH 2PJRB 5K5OA 1OKRA 1FX7A 3S32A 1YYVA 1HDPA 2Z33A 3OS0A 1E2XA 1FY7A 1U8BA 3LFUA 2GA1A 4DZJA 2LNBA 1BC8C 4IHXA 3I54A 4UUTA 2OD5A 3ZQCA 3H5RA 1W4MA 4AYBN 1MMNA 4IOCF 2G7HA 2MW8A 4WXDA 5L3FA 2IA1A 3DTIA 1TWHJ 4FX0A 1P4XA 3G1LA 3S2HJ 2F4OB 1GHCA 5M3FJ 2JRMA 4GGGA 2YSRA 4BHBA 2P7CB 1QO0D 3GEZA 2H1LA 2Q1ZB 2YX4A 4ZDOA 5DM6F 2DDAA 2Y2ZA 2LG4A 1W5CC 2HPIA 2PLYA 1ZRDA 3BY6A 3LFKA 1AKHA 3SQNA 3S16J 5GAGJ 4UVBA 1LNWA 3K70D 4U7DA 3HOSA 4LK0F 2YU3A 3G1MA 4WX9A 3KEQA 3H3VK 3BTIA 1ZRCA 2JA2A 2EBIA 2EJRA 2KZGA 2X85A 1B9MA 3V7CA 3I53A 4CCKA 2OA4A 4Y4RA 3CCVI 3JSPA 2XPUA 1KA8A 2FF4A 3WU2C 3IKTA 2F5DA 2VT3A 3KP3A 1P92A 2JVHA 2LP0A 2HS5A 1S6LA 2PFBA 4IQJA 5K5QA 3TO9A 2E34A 2VBWA 3MN2A 4Q4ZF 2ID6A 1A6IA 3E7LA 1B1BA 2CQNA 4MFEA 2VQGA 2E60A 1J75A 1AWCA 4KICA 3CCMI 1FOXA 1ZLJA 1J0RA 4Y17A 5IYCJ 1F36A 3A2KA 4XKCA 1U6GA 1YQAA 2ZMEC 1OPCA 2CV0A 1DPRA 2W24A 3HYIA 2E1CA 3CMYA 2GA2A 3M3YJ 1RZ4A 3JTHA 1WJAA 2DA3A 3H1CA 1KQ0A 4U88A 3ABMH 3A0HC 5E8GA 3HXLA 2LKSA 2QZ8A 4M71A 4CGZA 3DFGA 1RUOA 3Q3SA 5KVRA 1MJAA 1RESA 3LSGA 5FKLA 1AOYA 2VJJA 4P55A 4BGDA 5GAEJ 3BOQA 3ASNH 2IAIA 3JW4A 4M6XA 4DJAA 3CDIA 2R0QC 1MNEA 1IV8A 2GWRA 2P6TA 3MD2A 3QPTA 4A3IJ 3WG9A 1J59A 3S8PA 2EZHA 2A69F 1X1AA 3SDGA 4PJMA 5DYMA 4P96A 1AA7A 3OL3A 1W36C 4GFBA 3HPHA 5ERIA 1FTZA 2Y48A 1EH7A 5J47A 2F5FA 1XD7A 4HA8A 4PCQA 1HQCA 1Z3YA 1IRZA 5EZGA 1USSA 3G71I 4AC0A 2CG4A 5EG0B 4BAYA 2F48A 1JUPA 6PAXA 2K9SA 2OCEA 1WJCA 1OCZH 1NG7A 2MYSA 2QLZA 2L7ZA 3RDIA 2BVLA 2V9PA 3I4PA 2KJCA 5L3DA 3LA7A 3KP6A 2JRTA 1UELB 2ADUA 2H09A 4I98B 1V5GA 1A6QA 3FBIB 1A36A 4OMZA 5D6FA 4ZZDA 5L3BA 1UCRA 1XC5A 1MJ9A 3Q9VA 2BYVE 3JTGA 2YU9J 1FYMA 3GFLA 3E5QA 4XSXF 1RC9A 1HXDA 3MWMA 4NUBA 3LSTA 1SC7A 3BCBA 4RMNA 1R58A 3A4CA 2OQGA 2MSYA 1Z6RA 3BJAA 3K4NA 1MNMC 1SFUA 2DN0A 2PN6A 4F92B 2J5OA 3ABUA 3R6SA 1F43A 4J19A 5F0FA 3VODA 1ZGAA 4KN4X 3H3UA 2E7WA 2UZKA 2PBIA 3SZPA 4A3EJ 4XONA 4AU7A 3ZQGA 3HOYJ 3JCUC 2OCCH 2G0EA 4N9HA 3BR3A 5F04A 4HSRA 2XAJA 3I59A 4JX4A 4U7BA 4C2UA 4G8XA 3DP7A 3VDXA 3MMYB 2KRFA 1BL0A 3F6VA 3ISPA 5JI6A 1IO2A 2DJNA 4RLQA 1ZGJA 1YX3A 4C30A 2HTSA 3U1KA 1FZPB 2Y69H 4CZZA 2RN7A 2WY7Q 3AG2H 3FIWA 4M9XA 4KIBA 1LE8B 3TDZC 1MJBA 1XSVA 1H8AC 2BVMA 2PX9A 1KZHA 4XRSG 1WPKA 1MGTA 2CO5A 5FKNA 2CV2A 1U5TC 3BWGA 3OIOA 2CFOA 1SFEA 4I99C 5J8FA 2PJRA 4HBLA 4C3IJ 3CDHA 2G9WA 3GFJA 4I01A 3C2GA 5KCMA 3H35A 1FTTA 2EFWA 4LG3A 1RKWA 4XR6A 4X0GA 2WY8Q 3DEEA 5GADJ 1TL8A 2I8DA 4OIPF 4A69C 2KISA 3L1PA 4UV8A 2V6CA 2VXDA 3CJQB 3T8TA 5JVTA 4IHSA 3LMMA 4HNUA 1JHHA 1VQ6I 3VYUB 4XRMA 3HEFA 1TW2A 2EWNA 3HRSA 3F8CA 1FPQA 1Z67A 1T2KA 3BG6A 1MKMA 3ZPLA 2Z99A 2YUSA 1W7PA 5TJJA 2ZJPF 3PNYA 3G3ZA 1YOVB 2DOAA 4AIDA 1U8RA 2VL8A 2XF5A 1MMGA 2VQCA 1ETWA 2ME6A 2X51A 1SFKA 1LEBA 1G3YA 4OIRF 3WTZA 3OIPA 1IUFA 3EUHA 1L3LA 4A5MA 4W97A 3IC7A 5B1BH 3FKJA 4OU0A 2EIKH 3K4BA 2L7MP 4BXUA 1ZTRA 3WTUC 3FWEA 2FMLA 1N78A 1PYVA 1ZARA 2QENA 4BKXA 3EUKL 3IWZA 3JAMK 5J6XA 1W36D 2DA6A 4QIWN 1GUUA 2R7WA 1SVMA 3MZYA 3BG9A 3EETA 3QYFA 1OCPA 1IJWC 4RGXA 5DCMB 4ESBA 3A02A 2HDDA 3ML6A 1R7JA 1X3ZB 2NYXA 2GXBA 2HVQA 5M5YJ 1JTYA 2XGCA 2XROA 3L2QA 4YEJA 3MVPA 3IRRA 5FKMA 4KYWA 1R1TA 3H36A 4A12A 1NHAA 2GXAA 1BI3A 2B9SA 4LMYA 2DTRA 2IPQX 5D5WB 2MFZA 2DPUA 4F93B 2X6XA 3JRBA 4XL9A 3G4SI 2QEXI 3L2WA 1XSDA 2P81A 1QA6A 2E7XA 3S2DJ 3DEUA 1OYWA 1I6XA 1RUNA 3BDDA 5FROA 4Y3OA 1K79A 5IP7J 2DA1A 2VKEA 3KLOA 1ZYRF 5EJCA 4CCNA 5IOZA 4A93J 3CC7I 4HNVA 5EDNA 1T8IA 3JREA 2W85A 2IRFG 2K40A 3KP2A 2Y0SN 2VJ5A 2FA5A 2B0LA 2FU4A 2VJIA 3P7NA 2NNYA 3ZQIA 3HSRA 3WTVC 2QA4I 2BY0A 3DEWA 3HB9A 3D5LA 3H5AA 1FOYA 2Z3YA 2AO9A 1K78B 5EG0A 2O5RA 2LSOA 4XMYA 1I5ZA 3FF5A 2VLAA 2DAOA 3LQQA 3F21A 2AQEA 3GLXA 2JTVA 4JX5A 1EV7A 4O6JA 2W7NA 2A61A 2CW7A 2MD5A 4FCYA 4L0YB 3K4JA 1WJFA 3F0CA 4LITA 2E2JJ 1VQLI 4L5IA 2R7DA 3DTEA 4XM3A 4II2A 2EV0A 4BEHB 5B5EC 1JJ8C 2XRNA 5FKKA 2EK5A 3M07A 1JGSA 3WU1B 2FBHA 5FFZA 1AHDP 4ZYDA 4PFOA 5FLMJ 3L2CA 2R7RA 1ETVA 2LC2A 2W82A 3DKXA 3KE2A 2QGUA 4IPAA 4PJLA 4CZCA 3RSNA 5HDKA 3PM1A 5D5UB 4XN3A 5LGNA 4A3KJ 2K3FA 4I7HA 4HZFA 1GVJA 2FNPA 2OC6A 3FHNA 3HHHA 4DNCA 4EQQA 3K2ZA 5F6FA 5BS6A 1B8IB 1LFBA 3CLOA 2L02A 4IHYA 3C2HA 2P7VB 4BE2A 5C3EJ 4BXFA 4G94A 2HYFA 2M30A 3FXKA 2P0WA 1FOKA 2IW5A 4XKBA 4BE1A 1WFXA 1HW5A 1R5GA 2Z16A 5DUKA 4A0ZA 2Q2EB 2K02A 2DPDA 2XGXA 4HV6A 4LGWA 5E3OA 1N77A 4CYCB 2CS3A 2BGCA 5C4JJ 2XPWA 2V7FA 2FJ1A 3JRGA 3LQRA 5CVVA 5ICFA 3SZGA 1T08B 3A0BC 3FBNB 1NG6A 2ISYA 3E97A 3MKZA 2R7UA 1MD0A 1U0JA 1TZLA 1MZBA 1OR7A 2R7FA 4XRSA 4BBSJ 3ZQFA 3O8GA 1MBJA 2R3SA 3HG9A 4HDUA 1DP7P 3E6BA 2EINH 3JR9A 3K4LA 2DTZA 4CO8A 1I3AA 2DYSH 5BMZA 2DW4A 3BG7A 3C18A 4EJVA 3DQVC 4ABZA 1JJ6C 2X6OA 1FOWA 1JXSA 3HL2A 3HRTA 3M8EA 2DA2A 2XAHA 2I10A 5J4YA 3F23A 3ZCOA 2UUZA 3MKLA 5M5XJ 1Y56A 1YHQI 1U3EM 3WTXC 2VBXA 4CUGA 1BA5A 3T0YA 5F1RA 1KQ9A 3C1DA 2RVCA 3ASOH 2IT0A 1WZ2A 1I1SA 1R5ID 3HIFA 2Y30A 2O8XA 2HOAA 1R9TJ 4I76A 2JA6J 5CVRA 1WH5A 1OCRH 2CRGA 3QP5A 2CUZA 3V7RA 1HCRA 1HOMA 2FSWA 3WGGA 1YS7A 5LRRA 5JFRA 1JUMA 2IBDA 4E7LA 4IKFA 3P9KA 3E6MA 3WGIA 5GAHJ 4ZTJA 2CQKA 2RQQA 3ESWB 3GW2A 5F1JA 2XDVA 3V4GA 2JK3A 1XSXA 4LD5A 4R79A 2YPRA 1S7OA 2HXIA 1D1CA 1Z0XA 2ID3A 2CUFA 4FE7A 3K7AJ 3L7WA 3KCCA 5EZHA 3PNVA 3R60A 1Z6TA 3IL2A 5HLIA 2R4GA 3DPLC 3TDUC 2L7FP 2L5QA 4A3DJ 3LSJA 3CJTB 4AYBA 2Y31A 5LFAA 3DBHB 4IRIA 5EYRA 3NRVA 1FBUA 3QPSA 5HDNA 4LLGF 4YG2F 1CQTA 1RKTA 4XQFA 5F0CA 1LDJA 1QHGA 1NH3A 5KNLA 2EIJH 4NQWA 5FRNA 4Y13A 1TT0A 3QAHA 1R00A 5FLXK 5IYDJ 1LQ1A 2AQFA 1TWGJ 1V4RA 1ZN2A 4J00A 1QHHD 3DF8A 2KRCA 4NC8A 2IS6A 3REOA 2DOFA 3RKYA 2X6WA 1X3WB 1F5TA 5EGOA 3W6JB 4X6AJ 2L4AA 3N05A 3GVAA 4IL6C 3ZMZA 3CCLI 4D5CA 1K61A 2OAZA 4AD9A 4RBOA 3K0LA 3WE3A 2CQXA 3AFHA 3FXJA 2QKMB 5KK1A 3KPHA 3ZMVA 3IAM2 3GFMA 3S14J 4A3BJ 5ILUA 3ZN0A 2F5CA 3KYLA 3KEOA 4RDUA 2EA4A 2XV4S 1K78A 1WI9A 1HBXG 1MNDA 2QSFX 1XMKA 4OMYA 4A5NA 5LGUA 5D4RA 2M7AA 2LH9A 2VPRA 3N4MA 5J3LA 1J9IA 4A3JJ 3S2WA 1PP7U 3ZQ7A 4XRFA 5EF6A 1G3TA 1YTYA 1GVDA 3KZZA 4P1WA 1IN4A 4BEHA 5E3MA 1DPUA 3F72A 2IS2A 3Q0VA 1QZEA 4ZZLA 4BYYA 2XPVA 5D5VB 4FETA 2E5NA 3IUOA 3M4OJ 1J2XA 1QGPA 3FK6A 3PIPF 1GDTA 2BHYA 1VQNI 3HGGA 2QKLB 1FSEA 4IQ4A 2YS9A 3OS2A 2XSDC 4A0XA 3EUHC 3PQJA 3OY9A 1UHSA 5C44J 1MMDA 1K6YA 3OSGA 1U78A 2RNGA 1T38A 1MBFA 1DDNA 1W7PB 1B8IA 2IEKA 3CUQB 2O03A 2Q8KA 4F55A 3K1MA 4BH9A 2H1KA 2PI0A 1QBJA 1IF1A 1Y39A 3HTSB 4CHUA 3QYBA 2NVYJ 1R5HA 2HU9A 3HM5A 2ICWG 2C6YA 1BC7C 1XG1A 2ZSIB 3QPHA 4MO7A 5FKOA 2LY9A 3HJEA 2DU9A 2OV7A 1FBSA 5HDGA 2Q2EA 4HQEA 1S72I 2MBFA 5KHDA 2JA5J 2KLOA 5IY5H 4CYCA 3VB2A 3VEPA 4EMSA 4A3MJ 2ZFWA 1MBEA 2WA0A 5CQEA 1HKTA 1OJLA 1POGA 1EJ9A 3S3MA 4M3EA 2OJED 2KFDA 5E8IA 2LY1A 5J1RA 1O7LA 1J7KA 1FP2A 2HQRA 5D5XB 3S1MJ 2O6GE 4V19K 1SD5A 4TV7A 2WB1A 4H0EA 1D8JA 1XTAA 1LVAA 3FMSA 2L2OA 4E7KA 2K7LA 4IO9F 3V8KA 1XS9A 1U2WA 4PFPA 3GZ6A 4LOCA 1X19A 5FRMA 3IAS2 1YX5A 4YELA 3ZGKA 3I56I 4YFNF 3EDPA 4Y33A 4IRGA 3K1NA 2P5LC 1IXSB 2H8RA 1T6SA 3GTJJ 2R7XA 5CYVA 3DXJF 3KYCB 1FMWA 2ZJRF 4I0AA 2D45A 4F7ZA 4DYCA 1A04A 2KIFA 3JSOA 4HV5A 1Y0NA 2HEOA 4YIFA 4S05A 4YIRX 2H94A 5HVQC 3HOTA 1G3WA 3BP8A 4NC7A 1WGXA 5FLXZ 1VFCA 4RM2A 1LVKA 4U0VA 3WGHA 3OYMA 2X9DA 1G2HA 3QOPA 2M0MA 4FQGA 4LB5A 2DMQA 2JMWA 4AIJA 3ZXSA 1T0FC 2K4JA 2KIUA 4LJZF 4RGRA 1D0YA 2QVOA 2R5YA 5IT9Z 3IH2A 4D7MA 3H9JA 3G73A 1HA8A 1YW9A 3CJRB 3KEYA 4CICA 4Y7NJ 1K83J 3QOEA 3VYRB 4UB8C 4J01A 3ZOBA 2NVXJ 1LB2A 2JUCA 1P7IA 1R23A 2ZMEB 3CUOA 3WHCA 5DS9A 4IEJA 3BG5A 4HOBA 1UMQA 1OLTA 1W1WE 3J80K 3D1NI 3KZIC 4EJUA 2R7VA 3FXMA 3OYBA 3HOWJ 2XAUA 2EZLA 1KQ8A 4M74A 4BDYA 1QRYA 1KONA 3F3XA 3E5XA 4UVCA 5H6RA 2LBFB 4B3XA 4C3HJ 4AUXA 2EQRA 4L9TA 3TBIA 4AWXB 2F4MB 3AL0B 1X1DA 1K4TA 4DGWB 2WAEA 3IP4B 2Y0MA 3BR0A 1O3SA 4IOAF 2KL4A 5BPIA 1ZREA 1J5YA 5CPRB 4B47A 2JUGA 1X1PA 4RGUA 2IGMA 2RC4A 4KT6A 3KP4A 3HOXJ 1BBYA 1JKPC 2ZB9A 3FHZA 2GQQA 2OPTA 1ZG3A 1SANA 2RKHA 3TO6A 1ZH5A 3OWTA 1HKSA 5AONA 2DT5A 1G4DA 5DDGA 5FD6A 4BQQA 3BROA 2CQQA 3W2WA 5DEQA 4PJNA 2PEXA 2ISZA 1Z3XA 5BNGA 1TNSA 2QQBA 3HRMA 4FE4A 2L01A 2XKOA 4NB5A 2HTJA 4QLCU 1OR7C 2M9HA 1PUFA 2FNAA 3DKWA 1IGNA 1ON2A 3CO6C 4XIDA 2L3DA 1X1CA 1EKEA 2VB6A 2KP6A 3FMRA 3K6GA 1R4NB 1MW7A 2HYGD 2DI3A 4HF1A 4E7HA 3RPUD 4HLYA 2EFOA 5K7FA 1L0OC 2V4JC 1UFMA 1YIOA 1K4SA 4GCVA 1B4AA 3KP5A 2P6SA 4ZJZA 3I58A 2WAQA 3WG7H 4F52A 2DK8A 2Z1DA 3QODA 2ZXJA 2XHKA 1Q1HA 2XAQA 3BLYA 4RS8A 3MCZA 5EEAA 5LHIA 2GBYA 1IDZA 2PQ8A 4JX6A 3RPQA 2ZXHA 3OYKA 2A3SA 1Z1DA 2JSCA 2V9VA 3BTCA 2JJ7A 2L9NA 2D2WA 3SDBA 5F0HA 1FC3A 2DMPA 1GV2A 5DD8A 1J09A 4RGSA 4D7NA 4HX4A 2IGKA 5K7HA 1SMTA 1MBKA 2HQNA 3HGYA 1MMAA 2F4IA 4XLPF 3GLLA 2YR2A 5J40A 4EJTA 2UXXA 1Z05A 4GYIA 1S7AA 2HQ5A 4FX4A 1FLIA 2LF7A 1WCMJ 3H9GA 4WF2A 4G7ZF 4ENJA 4I02A 4HYEA 4U87A 2V1XA 3L09A 2CUEA 2FMYA 2MH2A 3CUQA 4KIFA 1I6HJ 3PSFA 1FBQA 3DLLF 5HLGA 3RKWA 4D5FA 5BOXA 1QU3A 3ZQHA 3OYFA 4H4KC 2D1VA 2KIMA 2VASA 3LSRA 4BDZA 3UR3C 3FDYA 5LBQA 4KJZA 3GO5A 1U5TB 2RQPA 5LHHA 3L2RA 1E17A 2EILH 4RLFA 5E3LA 4ZTFA 1UAAA 3F6OA 3QYEA 3Q9SA 4U0WA 2GXGA 1S5LC 5D8LB 1S9HA 2DCEA 1RNLA 1P6RA 3LNQA 2BV6A 2RGVA 4O3MA 3QU6A 2QQ9A 4A3GJ 2EZKA 3F8BA 1B59A 4GXOA 3VYTB 3ELKA 5HNFA 1IN6A 2ZBKA 9ANTA 2R7TA 2ME0A 5LRSA 2DFFA 4ENKA 2JVGA 1IXCA 1I27A 3KIOA 1HDDC 2VI6A 5HNHA 2NAZA 2QSHX 2BHZA 1ITYA 4CCMA 4BHCA 3RQ4A 1DU6A 2VBZA 2V26A 3NWTA 4JOMA 2EIMH 3PUFA 2XAFA 3LSPA 4EGZA 2B63J 2IGNA 2TCTA 1KGSA 2CUJA 1K7AA 3BG3A 1H0MA 2HI3A 4NQWB 4ANJA 4XLEA 3FZVA 3R61A 3G1OA 5IP9J 2CH0A 2E1OA 1ERDA 3U21A 4M72A 1ZR4A 3U9GA 3DCFA 3GX4X 2ZXIA 2BXYA 2HVRA 4PK4A 3CC2I 4P5OA 3U1DA 5FLVA 5GPCA 2STTA 1FIPA 2CU7A 4Z6YA 2WWYA 2K86A 5EGOB 3VWBA 3HOZJ 2DA5A 5FFXA 1WVRA 2VE9A 3BPXA 1D5YA 2FOWA 3PSIA 5BQTA 3GBGA 3L00A 3BC8A 2GOMA 1YW8A 1MDMB 3CJNA 3PL8A 1O3TA 4UHTA 1LFPA 3LA3A 1G6NA 3S1RJ 2O0YA 3GTKJ 3LA2A 5CQGA 2WV1A 1R6RA 2ZMEA 5JR3A 1RIOH 2E1MC 3HOVJ 1WJBA 2TRTA 3HZJA 5CLSA 1FSHA 3A1YA 1WQ2A 3T5XA 3NAUA 2ACJA 3H0DA 2MD0A 2VQLA 1OMIA 3DKYA 1FT9A 1RPWA 3OYHA 1D3YA 2IS4A 4XN0A 3AAFA 1REPC 1QPMA 1TC3C 3EPZA 5ICEA 2ZC2A 2FEZA 1SD4A 5HS7A 4IHVA 1V3FA 4HEA2 2E19A 3J7AO 2LBFA 2LREA 4XKWA 3RKQA 1TTYA 3S1NJ 2IS1A 3GUDA 2EA2A 3L9FA 3M7GA 2BZTA 3I64A 2P5KA 4A0YA 1ZAOA 3L2VA 2GIVA 1SAXA 2KIQA 2ZO4A 1RETA 1UJ8A 5IP6A 4N4NB 2IJLA 4XICA 3K2AA 3HBLA 2K5CA 1YG2A 2DFHA 2P4WA 3RYRA 3U2RA 5HS9A 4KNYA 2OTLI 3DBLB 5JHFA 4YRVA 4MEXF 4CDGA 4M6VA 3LWFA 1QZZA 2OU2A 3GWZA 2NVUB 1BI0A 3HTUA 3SXYA 3WHBA 5LGTA 1VQKI 1Q1VA 3H5NA 2IVMA 3KYDB 5E1ZB 3VSKA 4B44A 2V1NA 1VQPI 3M8JA 4P9UA 3CMMA 5JLWA 4B48A 5M5WJ 4RAYA 1YJ9I 4E7ZA 3LSHA 1HLVA 2MG4A 4XSZF 3SZTA 3W6KB 3BPVA 3BCAA 3H3ZA 2PMZA 1IG7A 1EA3A 4V2GA 2M45A 5JVGF 2IXSA 3DLAA 3ZQQA 1B9NA 3VYSB 3W2AA 3M1CA 2DT6A 4LFUA 2W4SA 1XCBA 1HKQA 3TOAA 1F1ZA 5E79C 2NRAC 3QPLA 4BXXJ 3JAMZ 3N97A 2BY2A 4KMUX 2Z5UA 2HNHA 2KT0A 1BN5A 1ONVA 3FKIJ 5TISC 3P9CA 1IAWA 2L9SA 1JUSA 2V6EA 1BR1A 3PJRA 5F64A 3EQLF 4AM3A 5E20A 3PNTA 3ZMDA 3OYCA 1ENHA 4DOZA 1H88C 2HOTA 3GTPJ 1SFOJ 1E3HA 3SJMA 1FEXA 4JP0A 3F8FA 1V54H 4UY8I 1YFHA 4GRIA 2XRLA 3OYJA 1EF4A 1D0XA 2O7OA 2VN2A 2R5ZB 3HKZA 4RB0A 3BQYA 2FXAA 1JE8A 4ESFA 3BQZA 3OOUA 1F9NA 3FXOA 1VQ5I 1VQ9I 3B02A 4HW0A 2BBYA 1A5JA 2K4BA 2HKXA 3BZ6A 5AIQA 2R5YB 4KN7X 3D5SC 1Z21A 4JK1X 5TGTA 3I55I 1U5TA 4GDFA 2HXOA 3GFIA 2H8WA
chains in the Genus database with same CATH topology
2LY9A 3ZQGA 1QVUA 3HOYJ 1OCTC 3S1QJ 2G0EA 4IHWA 3BR3A 5F04A 1ETXA 2JA5J 4JX4A 2NVTJ 4A3MJ 4CYCA 1ZQ3P 1BL0A 1JT6A 1MBEA 4BBRJ 1ETKA 4DZPA 1Y1WJ 1ETQA 3IH4A 2DJNA 4I6ZA 1OJLA 1POGA 1DU0A 4M3EA 1BW5A 2KDZA 5J1RA 3FIWA 1LE8B 2XB0X 3S1MJ 1VNDA 3RZDJ 2JA8J 1H8AC 4XRSG 1WPKA 5FKNA 1VI0A 1XS9A 3OIOA 5C4XJ 3H0GJ 4C3IJ 4LOCA 1IC8A 3W6VA 2Y9ZA 1FTTA 1JTXA 1GV5A 1RKWA 2H8RA 1JGGA 4L5EA 3JRCA 3GTJJ 1MSFC 4A69C 3L1PA 3OSFA 4DYCA 1FIAA 2R7ZJ 1MH4A 4V2FA 4XRMA 3HEFA 4W1UA 1WGXA 4B4CA 3RZOJ 1MBGA 2Y9YA 3LOCA 1VFCA 1G2HA 2X9DA 5M3MJ 3JRHA 2YUSA 1PUFB 2DMQA 2JMWA 3TP3A 1JKOC 2R5YA 1AU7A 3TW6A 3CDLA 1HF0A 3IH2A 4D7MA 4FTHA 1AKHB 2L9RA 1LFUP 1ETWA 4Y7NJ 1K83J 2ME6A 2K9QA 1YRNA 2NVXJ 3ZOBA 4A3LJ 1BJZA 2XB5A 1P7IA 1IUFA 3WHCA 5DS9A 5K7ZA 4IEJA 4W97A 3BG5A 3B6AA 1S7EA 3I4MJ 2ECCA 2L7MP 3A03A 3BTLA 1ZTRA 2DMUA 1UMQA 3D1NI 1FJLA 4M3DA 4S0HB 3S15J 2W48A 3RQIA 3HOWJ 3UKGA 2E2IJ 2EZLA 1QRYA 4BKXA 1W0UA 2DA6A 4C3HJ 4QIWN 1GUUA 4AUXA 2EQRA 3BG9A 5F27A 1OCPA 5GP9A 1IJWC 1LE8A 2JN6A 3A02A 2HDDA 5M5YJ 1JTYA 2XGCA 1I50J 5GPAA 3BR0A 3MVPA 1B72B 5FKMA 2QCOA 4X1EA 1U9NA 1NTCA 2MGQA 5HODA 1ZK8A 2NOGA 3HOXJ 4BY1J 3S17J 3JRBA 1JKPC 2ZB9A 4B3AA 1ZKGA 2OPTA 1P7JA 1SANA 2P81A 3VPRA 3JRDA 3S2DJ 3JRIA 3PO3J 2VUMJ 2CQQA 2EH3A 5IP7J 2DA1A 2VKEA 5BNGA 5IOZA 4A93J 2LR8A 4FE4A 3GTLJ 4HNVA 1WI3A 2M9HA 5JLXA 5EDNA 1MBHA 1X2MA 1PUFA 3JREA 1UG2A 3BR6A 2LVSA 1IGNA 2K40A 1ZGWA 4XIDA 2Y0SN 1TWFJ 1NK3P 3ZQIA 2DMTA 5K7FA 4MIMA 3DEWA 3HB9A 2NS8A 1GT0C 2N8GA 2AO9A 5J1YA 5EG0A 4M3BA 2M0CA 3A01B 4JX5A 5F08A 4BY7J 5EEAA 4FCYA 2GBYA 4DYQA 2O8KA 1IDZA 4JX6A 3F0CA 2E2JJ 2CJJA 1QVTA 1ORKA 3BTCA 2JJ7A 5F0HA 2LLKA 1JJ8C 2PMZN 5FKKA 3GTQJ 3CCYA 2DMPA 1NK2P 1GV2A 3B6CA 5E3NA 4QTRA 1AHDP 4D7NA 5K7HA 5FLMJ 1MBKA 3HGYA 3SFIA 2K9NA 1ETVA 5FJ8J 1IDYA 2EZIA 5IPAA 3PM1A 4UUSA 2DMNA 4A3KJ 3C2BA 2HQ5A 1WCMJ 4A3FJ 3BR1A 2R5ZA 1JT0A 2GM4A 2HYJA 1MH3A 3GTMJ 2CUEA 2M2EA 5IYBJ 1B8IB 1I6HJ 2O9LA 3GTOJ 1LFBA 4DW6A 1JKQC 2RAEA 4IHYA 4D5FA 3ZQHA 3LSRA 1VF9A 5C3EJ 3I4NJ 3HOUJ 1X58A 2M34A 1RR7A 2FX0A 5E3LA 3HKZN 2M8GX 3TEDA 1X2NA 2L0KA 3FISA 4Y52J 4FISA 2JWTA 1ZR2A 5E3OA 4CYCB 2R92J 4C2MJ 5C4JJ 5IOYA 3LNQA 2XPWA 4A3GJ 3BTJA 2EZKA 2FJ1A 3JRGA 1IV6A 2FD5A 2LFBA 2OF7A 3Q0UA 9ANTA 2ME0A 2D5VA 2AHQA 4XRSA 4BBSJ 3ZQFA 1BW6A 3O8GA 1HDDC 1TWCJ 1MBJA 2DA4A 2VI6A 4QSHA 1ITYA 3JR9A 1T56A 1DU6A 2DTZA 4DYRA 3LSPA 1I3QJ 2LKXA 2B63J 2R93J 1HDPA 2TCTA 1JJ6C 4ABZA 2X6OA 3QQAA 3BG3A 1OFCX 2HI3A 1U8BA 3JRFA 4DZJA 4IHXA 1E3OC 3G1OA 2GLOA 4UUTA 5IP9J 1ETYA 2DA2A 2E1OA 3ZQCA 2I10A 2LTPA 1ZR4A 2WB1N 4AYBN 3DCFA 5FLVA 2MW8A 3MKLA 1WH7A 1TWHJ 5GPCA 5M5XJ 1FIPA 3G1LA 2CU7A 3S2HJ 1BA5A 5M3FJ 1APLC 5EGOB 3HOZJ 2DA5A 2ELKA 2Y30A 1D5YA 2HOAA 4G12A 1R9TJ 4I76A 1W0TA 2JA6J 1WH5A 2Y2ZA 3GBGA 1AKHA 2CRGA 3S16J 4NDLA 1HCRA 1HOMA 3S1RJ 4MLOA 1YRNB 3GTKJ 2E2HJ 3G1MA 1JUMA 1T33A 2IBDA 2WV1A 4B1RA 3H3VK 2TRTA 3BTIA 3HOVJ 2EBIA 1TWAJ 3NAUA 5F1JA 2XGEA 2DA7A 1RPWA 2JK3A 1Y1VJ 2XPUA 4A3CJ 2HXIA 1Z0XA 2ID3A 4M3GA 2CUFA 1TC3C 4FE7A 2LP0A 3K7AJ 3BR5A 5EZHA 3IH3A 4IHVA 2E19A 3MN2A 2ID6A 1A6IA 3E7LA 4MFEA 2NVQJ 3RKQA 3S1NJ 2L7FP 3FK7A 5J1UA 3PO2J 3LSJA 4A3DJ 1JKRC 2Y31A 5IYCJ 1F36A 2ECBA 5EYRA 2XGDA 1B72A 3NARA 3QPSA 1Z77A 1CQTA 1RKTA 1RETA 3CQZJ 5F0CA 1U9OA 5IP6A 3CMYA 3BT9A 3M3YJ 2DA3A 4XICA 3K2AA 3HBLA 5IYDJ 3GTGJ 2QF7A 1TWGJ 3Q3SA 3ZQLA 1RESA 3LSGA 5FKLA 4M6VA 2JA7J 3WHBA 5EGOA 2IAIA 1Q1VA 4X6AJ 2COBA 2R0QC 4D5CA 1K61A 3IV5A 4RBOA 4A3IJ 2CQXA 5JLWA 5M5WJ 2EZHA 3TP0A 3SDGA 1HLVA 3HDDA 3S14J 4A3BJ 4GFBA 1FTZA 2MG4A 4M3FA 1IG7A 4RDUA 4V2GA 1H89C 2X48A 5EZGA 4EEFG 1IRZA 4AC0A 5EG0B 1JUPA 4JYKA 3A01A 2VPRA 2K9SA 3Q0WA 5J3LA 4A3JJ 3QPLA 4BXXJ 2KT0A 2L7ZA 3FKIJ 5EF6A 1JUSA 2LK2A 1GVDA 5E3MA 3Q0VA 4MFDA 1ENHA 2XPVA 1H88C 2HOTA 2LD5A 1SFOJ 3GTPJ 1QPIA 2WAQN 3SJMA 3M4OJ 1FEXA 4JP0A 3FK6A 1XC5A 1GDTA 2YU9J 3HGGA 4UUSB 2YS9A 2XRLA 2XSDC 5DTDA 1EF4A 4XK4A 2O7OA 2R5ZB 5FKOA 3TW7A 1UHSA 2MSYA 5C44J 4C3JJ 3BQYA 3OSGA 1U78A 2HOSA 3BQZA 1MBFA 3OOUA 1B8IA 2IEKA 1MNMC 2DN0A 1A5JA 2R5YB 2H1KA 1F43A 4J19A 1MSEC 5F0FA 2NVYJ 3O8HA 3HM5A 3JRAA 4A3EJ 1ETOA 2FQ4A 2VKVA 3BR2A 1XG1A 1O4XA 4MO7A 2HXOA 2NS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LY9 A;  3ZQG A;  1QVU A;  3HOY J;  1OCT C;  3S1Q J;  2G0E A;  4IHW A;  3BR3 A;  5F04 A;  1ETX A;  2JA5 J;  4JX4 A;  2NVT J;  4A3M J;  4CYC A;  1ZQ3 P;  1BL0 A;  1JT6 A;  1MBE A;  4BBR J;  1ETK A;  4DZP A;  1Y1W J;  1ETQ A;  3IH4 A;  2DJN A;  4I6Z A;  1OJL A;  1POG A;  1DU0 A;  4M3E A;  1BW5 A;  2KDZ A;  5J1R A;  3FIW A;  1LE8 B;  2XB0 X;  3S1M J;  1VND A;  3RZD J;  2JA8 J;  1H8A C;  4XRS G;  1WPK A;  5FKN A;  1VI0 A;  1XS9 A;  3OIO A;  5C4X J;  3H0G J;  4C3I J;  4LOC A;  1IC8 A;  3W6V A;  2Y9Z A;  1FTT A;  1JTX A;  1GV5 A;  1RKW A;  2H8R A;  1JGG A;  4L5E A;  3JRC A;  3GTJ J;  1MSF C;  4A69 C;  3L1P A;  3OSF A;  4DYC A;  1FIA A;  2R7Z J;  1MH4 A;  4V2F A;  4XRM A;  3HEF A;  4W1U A;  1WGX A;  4B4C A;  3RZO J;  1MBG A;  2Y9Y A;  3LOC A;  1VFC A;  1G2H A;  2X9D A;  5M3M J;  3JRH A;  2YUS A;  1PUF B;  2DMQ A;  2JMW A;  3TP3 A;  1JKO C;  2R5Y A;  1AU7 A;  3TW6 A;  3CDL A;  1HF0 A;  3IH2 A;  4D7M A;  4FTH A;  1AKH B;  2L9R A;  1LFU P;  1ETW A;  4Y7N J;  1K83 J;  2ME6 A;  2K9Q A;  1YRN A;  2NVX J;  3ZOB A;  4A3L J;  1BJZ A;  2XB5 A;  1P7I A;  1IUF A;  3WHC A;  5DS9 A;  5K7Z A;  4IEJ A;  4W97 A;  3BG5 A;  3B6A A;  1S7E A;  3I4M J;  2ECC A;  2L7M P;  3A03 A;  3BTL A;  1ZTR A;  2DMU A;  1UMQ A;  3D1N I;  1FJL A;  4M3D A;  4S0H B;  3S15 J;  2W48 A;  3RQI A;  3HOW J;  3UKG A;  2E2I J;  2EZL A;  1QRY A;  4BKX A;  1W0U A;  2DA6 A;  4C3H J;  4QIW N;  1GUU A;  4AUX A;  2EQR A;  3BG9 A;  5F27 A;  1OCP A;  5GP9 A;  1IJW C;  1LE8 A;  2JN6 A;  3A02 A;  2HDD A;  5M5Y J;  1JTY A;  2XGC A;  1I50 J;  5GPA A;  3BR0 A;  3MVP A;  1B72 B;  5FKM A;  2QCO A;  4X1E A;  1U9N A;  1NTC A;  2MGQ A;  5HOD A;  1ZK8 A;  2NOG A;  3HOX J;  4BY1 J;  3S17 J;  3JRB A;  1JKP C;  2ZB9 A;  4B3A A;  1ZKG A;  2OPT A;  1P7J A;  1SAN A;  2P81 A;  3VPR A;  3JRD A;  3S2D J;  3JRI A;  3PO3 J;  2VUM J;  2CQQ A;  2EH3 A;  5IP7 J;  2DA1 A;  2VKE A;  5BNG A;  5IOZ A;  4A93 J;  2LR8 A;  4FE4 A;  3GTL J;  4HNV A;  1WI3 A;  2M9H A;  5JLX A;  5EDN A;  1MBH A;  1X2M A;  1PUF A;  3JRE A;  1UG2 A;  3BR6 A;  2LVS A;  1IGN A;  2K40 A;  1ZGW A;  4XID A;  2Y0S N;  1TWF J;  1NK3 P;  3ZQI A;  2DMT A;  5K7F A;  4MIM A;  3DEW A;  3HB9 A;  2NS8 A;  1GT0 C;  2N8G A;  2AO9 A;  5J1Y A;  5EG0 A;  4M3B A;  2M0C A;  3A01 B;  4JX5 A;  5F08 A;  4BY7 J;  5EEA A;  4FCY A;  2GBY A;  4DYQ A;  2O8K A;  1IDZ A;  4JX6 A;  3F0C A;  2E2J J;  2CJJ A;  1QVT A;  1ORK A;  3BTC A;  2JJ7 A;  5F0H A;  2LLK A;  1JJ8 C;  2PMZ N;  5FKK A;  3GTQ J;  3CCY A;  2DMP A;  1NK2 P;  1GV2 A;  3B6C A;  5E3N A;  4QTR A;  1AHD P;  4D7N A;  5K7H A;  5FLM J;  1MBK A;  3HGY A;  3SFI A;  2K9N A;  1ETV A;  5FJ8 J;  1IDY A;  2EZI A;  5IPA A;  3PM1 A;  4UUS A;  2DMN A;  4A3K J;  3C2B A;  2HQ5 A;  1WCM J;  4A3F J;  3BR1 A;  2R5Z A;  1JT0 A;  2GM4 A;  2HYJ A;  1MH3 A;  3GTM J;  2CUE A;  2M2E A;  5IYB J;  1B8I B;  1I6H J;  2O9L A;  3GTO J;  1LFB A;  4DW6 A;  1JKQ C;  2RAE A;  4IHY A;  4D5F A;  3ZQH A;  3LSR A;  1VF9 A;  5C3E J;  3I4N J;  3HOU J;  1X58 A;  2M34 A;  1RR7 A;  2FX0 A;  5E3L A;  3HKZ N;  2M8G X;  3TED A;  1X2N A;  2L0K A;  3FIS A;  4Y52 J;  4FIS A;  2JWT A;  1ZR2 A;  5E3O A;  4CYC B;  2R92 J;  4C2M J;  5C4J J;  5IOY A;  3LNQ A;  2XPW A;  4A3G J;  3BTJ A;  2EZK A;  2FJ1 A;  3JRG A;  1IV6 A;  2FD5 A;  2LFB A;  2OF7 A;  3Q0U A;  9ANT A;  2ME0 A;  2D5V A;  2AHQ A;  4XRS A;  4BBS J;  3ZQF A;  1BW6 A;  3O8G A;  1HDD C;  1TWC J;  1MBJ A;  2DA4 A;  2VI6 A;  4QSH A;  1ITY A;  3JR9 A;  1T56 A;  1DU6 A;  2DTZ A;  4DYR A;  3LSP A;  1I3Q J;  2LKX A;  2B63 J;  2R93 J;  1HDP A;  2TCT A;  1JJ6 C;  4ABZ A;  2X6O A;  3QQA A;  3BG3 A;  1OFC X;  2HI3 A;  1U8B A;  3JRF A;  4DZJ A;  4IHX A;  1E3O C;  3G1O A;  2GLO A;  4UUT A;  5IP9 J;  1ETY A;  2DA2 A;  2E1O A;  3ZQC A;  2I10 A;  2LTP A;  1ZR4 A;  2WB1 N;  4AYB N;  3DCF A;  5FLV A;  2MW8 A;  3MKL A;  1WH7 A;  1TWH J;  5GPC A;  5M5X J;  1FIP A;  3G1L A;  2CU7 A;  3S2H J;  1BA5 A;  5M3F J;  1APL C;  5EGO B;  3HOZ J;  2DA5 A;  2ELK A;  2Y30 A;  1D5Y A;  2HOA A;  4G12 A;  1R9T J;  4I76 A;  1W0T A;  2JA6 J;  1WH5 A;  2Y2Z A;  3GBG A;  1AKH A;  2CRG A;  3S16 J;  4NDL A;  1HCR A;  1HOM A;  3S1R J;  4MLO A;  1YRN B;  3GTK J;  2E2H J;  3G1M A;  1JUM A;  1T33 A;  2IBD A;  2WV1 A;  4B1R A;  3H3V K;  2TRT A;  3BTI A;  3HOV J;  2EBI A;  1TWA J;  3NAU A;  5F1J A;  2XGE A;  2DA7 A;  1RPW A;  2JK3 A;  1Y1V J;  2XPU A;  4A3C J;  2HXI A;  1Z0X A;  2ID3 A;  4M3G A;  2CUF A;  1TC3 C;  4FE7 A;  2LP0 A;  3K7A J;  3BR5 A;  5EZH A;  3IH3 A;  4IHV A;  2E19 A;  3MN2 A;  2ID6 A;  1A6I A;  3E7L A;  4MFE A;  2NVQ J;  3RKQ A;  3S1N J;  2L7F P;  3FK7 A;  5J1U A;  3PO2 J;  3LSJ A;  4A3D J;  1JKR C;  2Y31 A;  5IYC J;  1F36 A;  2ECB A;  5EYR A;  2XGD A;  1B72 A;  3NAR A;  3QPS A;  1Z77 A;  1CQT A;  1RKT A;  1RET A;  3CQZ J;  5F0C A;  1U9O A;  5IP6 A;  3CMY A;  3BT9 A;  3M3Y J;  2DA3 A;  4XIC A;  3K2A A;  3HBL A;  5IYD J;  3GTG J;  2QF7 A;  1TWG J;  3Q3S A;  3ZQL A;  1RES A;  3LSG A;  5FKL A;  4M6V A;  2JA7 J;  3WHB A;  5EGO A;  2IAI A;  1Q1V A;  4X6A J;  2COB A;  2R0Q C;  4D5C A;  1K61 A;  3IV5 A;  4RBO A;  4A3I J;  2CQX A;  5JLW A;  5M5W J;  2EZH A;  3TP0 A;  3SDG A;  1HLV A;  3HDD A;  3S14 J;  4A3B J;  4GFB A;  1FTZ A;  2MG4 A;  4M3F A;  1IG7 A;  4RDU A;  4V2G A;  1H89 C;  2X48 A;  5EZG A;  4EEF G;  1IRZ A;  4AC0 A;  5EG0 B;  1JUP A;  4JYK A;  3A01 A;  2VPR A;  2K9S A;  3Q0W A;  5J3L A;  4A3J J;  3QPL A;  4BXX J;  2KT0 A;  2L7Z A;  3FKI J;  5EF6 A;  1JUS A;  2LK2 A;  1GVD A;  5E3M A;  3Q0V A;  4MFD A;  1ENH A;  2XPV A;  1H88 C;  2HOT A;  2LD5 A;  1SFO J;  3GTP J;  1QPI A;  2WAQ N;  3SJM A;  3M4O J;  1FEX A;  4JP0 A;  3FK6 A;  1XC5 A;  1GDT A;  2YU9 J;  3HGG A;  4UUS B;  2YS9 A;  2XRL A;  2XSD C;  5DTD A;  1EF4 A;  4XK4 A;  2O7O A;  2R5Z B;  5FKO A;  3TW7 A;  1UHS A;  2MSY A;  5C44 J;  4C3J J;  3BQY A;  3OSG A;  1U78 A;  2HOS A;  3BQZ A;  1MBF A;  3OOU A;  1B8I A;  2IEK A;  1MNM C;  2DN0 A;  1A5J A;  2R5Y B;  2H1K A;  1F43 A;  4J19 A;  1MSE C;  5F0F A;  2NVY J;  3O8H A;  3HM5 A;  3JRA A;  4A3E J;  1ETO A;  2FQ4 A;  2VKV A;  3BR2 A;  1XG1 A;  1O4X A;  4MO7 A;  2HXO A;  2NS7 A; 
#chains in the Genus database with same CATH topology
 3RCO A;  1OCT C;  2JSP A;  3S3N A;  2HDW A;  1K6O A;  3CME I;  4NBQ A;  1ETX A;  1R22 A;  2XAS A;  4PDK A;  3HSF A;  4XLF A;  1WSU A;  1ZQ3 P;  1JT6 A;  2AXT C;  4L5J A;  3FXL A;  4BBR J;  5FGM A;  3E6C C;  1ETK A;  4DZP A;  3IH4 A;  4I6Z A;  4AVP A;  3F8N A;  3CCQ I;  1ZG1 A;  1DU0 A;  1ZRF A;  3R0A A;  2KDZ A;  4LIU A;  4HRI A;  4DBR A;  1TW3 A;  2ELH A;  2XB0 X;  4I0B A;  1VND A;  3RZD J;  1G3S A;  4K2E A;  3R0J A;  4IVN A;  5HLT A;  3PFI A;  2WAF A;  1VI0 A;  1OCC H;  4NHJ A;  2ZKZ A;  2RRE A;  3H0G J;  4BU2 A;  3LAP A;  3W6V A;  4QPQ A;  5D4S A;  3OOP A;  3O2P E;  4LIV A;  4UXN A;  2KJB A;  2DQR A;  2IA2 A;  1JTX A;  3PUB A;  1TQP A;  4RAG A;  1JGG A;  4OAY A;  2DOE A;  4XLC A;  3F22 A;  2Z9O A;  2EV6 A;  3OSF A;  3AG3 H;  3S3O A;  4BJ5 C;  3TQN A;  3ZP5 A;  2QBY B;  2R7S A;  1ZG5 A;  1ON1 A;  2W57 A;  2WBM A;  2MC3 A;  3GF2 A;  3OR1 C;  1XDU A;  2XSJ C;  2LMD A;  3EUA A;  5E18 F;  1MH4 A;  1XGO A;  1VTN C;  2CMP A;  4W1U A;  4B4C A;  2GOX B;  4N4O B;  1MBG A;  3LOC A;  2ZXW H;  4D9J A;  3DTK A;  2EB7 A;  1PUF B;  3O3K A;  3C7J A;  5DUI A;  1JKO C;  2G7U A;  2QYO A;  2ESN A;  2MLK A;  3CDL A;  3GCM A;  3SFZ A;  3GXO A;  2F5E A;  2PG4 A;  1MDM A;  2XF7 A;  1P4A A;  2J5P A;  4BJ6 C;  2K9Q A;  4IXA A;  1E3P A;  2M3A A;  4IF4 A;  4A3L J;  2JZY A;  4IRH A;  2NOJ B;  1LUJ B;  3ROU A;  4BQO A;  2VPL A;  2R7Q A;  2XB5 A;  2L4M A;  1PJR A;  5K7Z A;  2DK5 A;  4Q48 A;  2ESH A;  3B6A A;  1S7E A;  4I09 A;  3I4M J;  4CA0 A;  2ECC A;  3A03 A;  4GO1 A;  1H9T A;  3VFZ A;  2MAB A;  2PMH A;  1FJL A;  3FMQ A;  3CCJ I;  4M3D A;  1LDK B;  3RQI A;  3LSI A;  4ON0 A;  3CO7 C;  2E2I J;  4MTE A;  3OYE A;  1W0U A;  1IW7 F;  1A35 A;  2Q0O A;  1I1G A;  4PSW A;  2BEO A;  3LSM A;  2E5Z A;  2UXN A;  2W84 A;  1ACI A;  2JN6 A;  2CW8 A;  3T1B A;  1I50 J;  1YW7 A;  5GPA A;  2GZW A;  4QPO A;  2W1O A;  2KDO A;  1B72 B;  2VOO A;  3RTR A;  5GTH C;  1NTC A;  4EV0 A;  4M9S A;  1OIS A;  5HOD A;  1ZK8 A;  2HR3 A;  5L3E A;  4OIQ F;  2BY1 A;  4UV9 A;  3S17 J;  4G7O F;  1Y6I A;  2HZT A;  3HUG A;  4G6Q A;  5HLH A;  4KIS A;  1HC8 A;  2CQ7 A;  4PUS A;  2Z2S B;  4BL0 B;  1T39 A;  2VUM J;  2EH3 A;  1A31 A;  1Y8Q B;  4EGY A;  3BZC A;  3CCR I;  1FP1 D;  2LR8 A;  4FAS D;  1O57 A;  1WWX A;  1V55 H;  5JLX A;  4EVI A;  1R49 A;  2B7E A;  3BR6 A;  4AIH A;  2LVS A;  3J7Z I;  2XKP A;  3GZ5 A;  5K1Y A;  2M8E A;  3FXU A;  2KPM A;  4M73 A;  5ED4 A;  3D5R C;  2VT2 A;  4ZC3 A;  1FYL A;  3V7S A;  1G59 A;  1BOA A;  3O6B B;  4G6T B;  3TKY A;  1B6A A;  3I9V 2;  4MIM A;  3WTS C;  3K4C A;  1SVO A;  1R36 A;  2WTE A;  1D5V A;  5ICC A;  1Y0U A;  2NS8 A;  3DU6 A;  1R1V A;  5BPD A;  5J1Y A;  2DDB A;  1ZLK A;  1D0Z A;  1H9G A;  1UHW A;  4M3B A;  4A2U A;  2M0C A;  2M1B A;  3A01 B;  3OYA A;  5KAI C;  1XN7 A;  5F08 A;  1KU7 A;  5EEH A;  3KZY A;  2DJI A;  4DYQ A;  1X4O A;  2O8K A;  3MFK A;  4ZH4 F;  3CMA I;  2E36 A;  4BE0 A;  1DP3 A;  1QVT A;  2HFH A;  2LLK A;  4LB6 B;  3CCY A;  1NK2 P;  4QTR A;  4BS9 A;  4O5V A;  4Q5S F;  3ERE D;  4L9J A;  4A6D A;  3DPT A;  1DUX C;  3H92 A;  2K9N A;  3FM3 A;  4YII A;  2CWE A;  5FJ8 J;  1ZEL A;  1XDS A;  3CP2 A;  5E1W A;  1IDY A;  4CCL A;  3I0T A;  2DMN A;  2L9V A;  3C2B A;  3FXQ A;  3BR1 A;  2R5Z A;  2HYJ A;  3E5U A;  4BJT A;  4JBA A;  3PFY A;  3QU3 A;  2M2E A;  5IYB J;  1DGR M;  2O9L A;  4ZYA A;  3X2Q H;  4MQV A;  3GTO J;  1JI8 A;  4XOR A;  1JKQ C;  5L3G A;  5HS8 A;  2NS0 A;  4U0Y A;  3H9Q A;  1VF9 A;  1EH6 A;  4IZZ A;  1X58 A;  2COM A;  2KHM A;  2FOK A;  4E7J A;  3DU5 A;  1QNT A;  3TGN A;  3AL0 C;  3TED A;  3VSL A;  1ULY A;  1X2N A;  1YJN I;  2VKD A;  2D1H A;  2VC1 A;  2KQR A;  5CVJ A;  3BJO A;  4KMF A;  3I3L A;  5DM7 F;  3J81 K;  3BTJ A;  2DOD A;  4PGG A;  2FD5 A;  1TNT A;  1P2F A;  2FBI A;  2VIX A;  4RM3 A;  3CC4 I;  3CF5 F;  2LFB A;  3Q0U A;  4LLL A;  1GXP A;  4DQ2 A;  3LAJ A;  1PP8 F;  1SVL A;  3OYI A;  2DBB A;  3K69 A;  5B3S H;  4QWQ A;  3NEU A;  1BJA A;  5DV5 A;  4HAM A;  1T56 A;  2QUF A;  1CF7 B;  4E7S A;  1VQO I;  3E0J B;  2QSG X;  1XGM A;  4DYR A;  1I3Q J;  1N75 A;  2PMU A;  2LKX A;  2CFX A;  2R93 J;  5CKT A;  5CJ9 A;  3QQA A;  4WXC A;  4RB1 A;  1OFC X;  3COA C;  1W7P D;  2P8T A;  4FHT A;  2VQH A;  3JRF A;  4L9V A;  1E3O C;  2HZD A;  2JPB A;  4OIN F;  3V8J A;  1ETY A;  3I5U A;  5LEK A;  2GLO A;  4UNO A;  2XC7 A;  2LTP A;  1X1B A;  3PQK A;  4XKV A;  2QBY A;  3F9K A;  2WB1 N;  2LKP A;  1WH7 A;  4XNF A;  4HF2 A;  4HX7 A;  1TQI A;  3TL4 X;  1APL C;  3OMY A;  5TRD A;  2A68 F;  2ELK A;  2K85 A;  3IRQ A;  4KDP A;  3ABK H;  4G12 A;  1W0T A;  1O3R A;  3V8L A;  3ZRG A;  3I71 A;  4BQA A;  1Y8R B;  1TBX A;  2XF6 A;  4NDL A;  3MQ0 A;  1S8N A;  4MLO A;  1YRN B;  2H27 A;  5AIP A;  2E2H J;  1T33 A;  3MEX A;  3NWS A;  4B1R A;  1WJ5 A;  5LD2 C;  1SD7 A;  1TWA J;  5GTI C;  3WE2 A;  1LPQ A;  1V5F A;  3K10 A;  2XGE A;  3RJP A;  1BI1 A;  2DA7 A;  1GXQ A;  1Y1V J;  1G8X A;  2GAU A;  4A3C J;  2RDP A;  1N25 A;  1WJD A;  4M3G A;  4E7I A;  4N0B A;  3VOE A;  2X1C A;  4MHG A;  3BR5 A;  2UV1 A;  3FM5 A;  3IH3 A;  1VQ8 I;  4HQM A;  1Z9C A;  3CCS I;  4ENM A;  3KX2 A;  4RB3 C;  2AS5 F;  4B8X A;  2NVQ J;  2E1N A;  5A2Q K;  2VKH A;  3FK7 A;  1UHM A;  3FX3 A;  5J1U A;  2ZNZ A;  2MA3 A;  3PO2 J;  4BNC A;  1JKR C;  1SEU A;  3FXR A;  2ECB A;  1IRG A;  4CH7 A;  2XGD A;  1B72 A;  2XVC A;  1BIB A;  2MC4 A;  3NAR A;  2M5W A;  1Z77 A;  1YO5 C;  4ITV A;  3CQZ J;  1U9O A;  1VQM I;  3KFW X;  3BT9 A;  1DGW Y;  1S29 A;  2EFP A;  4KIT B;  5FD5 A;  3KET A;  3RI4 A;  2F5V A;  3QWL A;  3RKX A;  4PZJ A;  5JHU A;  4MNU A;  3CZ6 A;  3W2V A;  2Y0S A;  3GTG J;  2OZU A;  2QF7 A;  2ELJ A;  2Y75 A;  3IHU A;  3OR2 C;  4JQF A;  4KA4 A;  3ZQL A;  3RYP A;  2UWM A;  3QP6 A;  1HW2 A;  2JA7 J;  2OTJ I;  3M9A A;  3K4M A;  2QM3 A;  1LJ9 A;  2M7B A;  4CXF A;  2COB A;  3HPG A;  4LG0 B;  1I39 A;  2L7K A;  4G7H F;  2R7O A;  5LHG A;  3IV5 A;  1FWZ A;  2V79 A;  1BOB A;  1IXR C;  1KU3 A;  2K9L A;  2M4K A;  5L3C A;  3TP0 A;  1PUE E;  4MGR A;  2QQ8 A;  4RA2 A;  3HDD A;  4M6Y A;  1R4M B;  4M3F A;  1H89 C;  1UG0 A;  1XGS A;  2X48 A;  4ETS A;  4EEF G;  4IHT A;  3J80 Z;  3ZMT A;  4UUV A;  3K4K A;  4HST A;  4JYK A;  3J81 Z;  3A01 A;  2V9K A;  1XCV A;  2O3F A;  3Q0W A;  2DQL A;  4L0Z B;  3HSE A;  3OV8 A;  4L9N A;  5IT3 A;  1TQM A;  4OOI A;  2X0L A;  2BW3 B;  2CW0 F;  3DV8 A;  1BR2 A;  3OYL A;  2LK2 A;  2V1U A;  3RPU A;  3MZ8 A;  2IGO A;  4AVZ A;  4MEY F;  1E0E A;  2OBP A;  1KYW A;  1WKM A;  4D0P A;  1XB4 A;  4MFD A;  3F8M A;  4CSW A;  3ZN1 A;  2KZV A;  2LRD A;  2QWW A;  1RI7 A;  1UST A;  3R4K A;  2CGP A;  3E6D A;  2LD5 A;  2LY2 A;  1QPI A;  2WAQ N;  3TMO A;  1SD6 A;  3C3W A;  4RAF A;  3WU0 A;  4HX8 A;  2A05 A;  4UUS B;  3ABT A;  4MTD A;  2JQ7 A;  2M87 A;  5DTD A;  4XK4 A;  1QZY A;  1EH8 A;  2EFQ A;  2E35 A;  3TW7 A;  4C3J J;  1Z7L A;  2JPC A;  4ZDL A;  2CYY A;  4CCO A;  2HOS A;  2LDU A;  4EJO A;  1BR4 A;  2VON A;  1IRF A;  3CTA A;  3UNG C;  2XUB A;  3V42 A;  1MSE C;  2KRH A;  1WHU A;  2H6B A;  1XX5 A;  3O8H A;  1X4P A;  5ILS A;  3JRA A;  3DBR B;  2ZJQ F;  1ETO A;  2FQ4 A;  2VKV A;  2A6T A;  3BR2 A;  1O4X A;  1T98 A;  2ZCW A;  2NS7 A;  1R1U A;  2DT7 B;  1QVU A;  4EM1 A;  3S1Q J;  4IHW A;  2RV8 A;  1O7F A;  5FO5 A;  4C9Y A;  4WCG A;  2FQ3 A;  1XGN A;  2KKO A;  2KMU A;  2NVT J;  3MKW B;  2MH9 A;  1YLF A;  2O61 A;  1F4K A;  1Y1W J;  1ETQ A;  1OYY A;  2OZ6 A;  2STW A;  1VZ0 A;  2WAD A;  4GYG A;  1CGP A;  1PVE A;  1IN7 A;  4OWR B;  1BW5 A;  4EJW A;  1WJE A;  2CV1 A;  2HKO A;  4IJA A;  2OQR A;  3HRU A;  5K5R A;  2JA8 J;  4YFX F;  4LK1 F;  3CD6 I;  5C4X J;  1UZC A;  1T0F A;  1CF7 A;  1YS6 A;  3CP8 A;  3HHG A;  1IC8 A;  2DFI A;  3D0S A;  2ZNY A;  2F6C A;  4R1H A;  5A2Q Z;  2Y9Z A;  2FE3 A;  4HG2 A;  1GV5 A;  2RNJ A;  3ZMS A;  4AIK A;  1SMY F;  4L5E A;  3JRC A;  1MSF C;  3IKV A;  3HC7 A;  4OIO F;  4E70 A;  2E1M B;  3HUG B;  4DIQ A;  2FUG 2;  3J7Y J;  1BI2 A;  1FIA A;  4BHP A;  2R7Z J;  3CLQ A;  5FB2 A;  1O3Q A;  2EFN A;  2M4G A;  1IN8 A;  3AKZ A;  1TLH B;  4V2F A;  4KT5 C;  5EEG A;  3RZO J;  4HPQ A;  2Y9Y A;  4PGH A;  4KFC A;  5M3M J;  4D1Q A;  3JRH A;  3IWF A;  1RR8 C;  1YI2 I;  3TP3 A;  3CCE I;  4CCJ A;  1P4W A;  1T95 A;  1FMV A;  1KU9 A;  4ESJ A;  3TW6 A;  1AU7 A;  1HF0 A;  4M9Z A;  4FTH A;  1AKH B;  2L9R A;  1VQ7 I;  4G6D A;  1LFU P;  1FNN A;  1R71 A;  2HDC A;  1D8K A;  2P5V A;  2EV5 A;  2ETH A;  4G9Y A;  1YRN A;  4KUM A;  4WWC A;  4RB2 C;  2VOD A;  1BJZ A;  1YIT I;  3EYY A;  2HWV A;  2CSO A;  3G2B A;  3SEQ A;  2F2E A;  4L18 B;  3K1P A;  1BM9 A;  3LL7 A;  2I5U A;  3BTL A;  3TO7 A;  2DMU A;  4Z2Y A;  4NNJ A;  2TDX A;  4XLA A;  4S0H B;  4Q47 A;  2HOE A;  4F91 B;  3Q5F A;  2W48 A;  3S15 J;  3K9T A;  3UKG A;  4WK8 F;  2DLL A;  1Z7U A;  2NXN B;  3J7A Y;  1UB9 A;  1OQY A;  1P9Q C;  2X6Y A;  3M1E A;  4MQ9 F;  2XIG A;  1XMX A;  4HNT A;  1LE8 A;  1D1A A;  2A5W A;  2X4H A;  5F27 A;  5GP9 A;  1IUY A;  4BQN A;  2NNN A;  2VXZ A;  5D8K B;  4WXH A;  3B73 A;  2LOO A;  4RAZ A;  3RIR A;  5KAF C;  5HOO A;  4E6K G;  2VE8 A;  2MLG A;  5B66 C;  5ICG A;  1RRJ A;  2QCO A;  4X1E A;  2XAG A;  1U9N A;  5ILV A;  1LDD A;  2A6E F;  3CES A;  3CF2 A;  5H6Q A;  2MGQ A;  1YE9 A;  4OAZ A;  5J8C A;  3KLN A;  5LEJ A;  5J4V A;  2NOG A;  4BY1 J;  4EM0 B;  3ECH A;  3PIO F;  2JT1 A;  4XLH A;  4XOT A;  3ONQ A;  4B3A A;  3GME A;  1ZKG A;  1VQ4 I;  4YFK F;  4C2T A;  1P7J A;  3VPR A;  3K70 C;  4HDV A;  3MAJ A;  1FYK A;  3JRD A;  2BE5 F;  2K9M A;  2VC0 A;  3AG4 H;  5DD4 A;  3JRI A;  3PO3 J;  1MMS A;  4II3 A;  2DXI A;  1HSJ A;  3S93 A;  1HW1 A;  2EPF A;  3GTL J;  1WI3 A;  4B09 A;  1C0W A;  2X1D A;  2IP2 A;  2L54 A;  2K27 A;  1MBH A;  1X2M A;  2YX7 A;  4LG0 A;  1UG2 A;  2HQA A;  4PJ0 C;  2WV0 A;  1ZGW A;  5H20 A;  1W5S A;  1YIJ I;  2VBY A;  2A5Y B;  1TWF J;  1OYI A;  4ZDP A;  1NK3 P;  5CVI A;  2DMT A;  3DPU A;  2K3P A;  3AG1 H;  3G6E I;  2DFE A;  3ERM A;  3T8R A;  2W00 A;  2VOP A;  1GT0 C;  2N8G A;  2AXL A;  2HGC A;  3OYG A;  2W25 A;  3GZN B;  1XPX A;  4HLX A;  4ZYH A;  4A6E A;  4HF0 A;  2GIZ A;  4R8H A;  1XMA A;  3E3V A;  3WTW C;  4DBQ A;  5E17 F;  1IZ1 A;  1W5T A;  2OUM A;  4PSX A;  4BY7 J;  5B1A H;  3BJ6 A;  3ECO A;  1LKX A;  4EM2 A;  2BW3 A;  2FBK A;  3DWL E;  4ENN A;  3OIQ A;  3BZK A;  2CJJ A;  1ORK A;  1STZ A;  4S04 A;  2E71 A;  1GLN A;  3NQO A;  2QQA A;  2PMZ N;  2ZFU A;  3M8F A;  4EAT A;  3GYH X;  3GTQ J;  3OL4 A;  3B6C A;  5E3N A;  1M1E B;  4CYD A;  3QRF F;  5DCM A;  3KP7 A;  2H6C A;  3SFI A;  3ZMU A;  2PJP A;  2DO7 A;  1TT5 B;  2ZJ2 A;  2LYC A;  3ZR8 X;  3CCU I;  4I2O A;  4XOP A;  2EZI A;  5IPA A;  3P9I A;  2A6H F;  4ZYE A;  4UB6 C;  4UUS A;  1X3U A;  2BOL A;  4A3F J;  4BUP A;  2LF8 A;  1JT0 A;  2GM4 A;  3EYI A;  1MIJ A;  2ZSH B;  1ZHF A;  5H2F C;  1MH3 A;  1SAU A;  4B43 A;  3GTM J;  2VJ4 A;  1S3J A;  4KIG A;  2BXZ A;  3OYN A;  4DW6 A;  4Y15 A;  2HPM A;  2X1E A;  2RAE A;  3SYT A;  3SEZ A;  5LLQ A;  1SFX A;  3I4N J;  2BY3 A;  3HOU J;  1PDN C;  2DYR H;  1LEA A;  1KU2 A;  2M34 A;  5DCF A;  3MKY B;  5IT9 K;  1RR7 A;  2FX0 A;  1BIA A;  3HKZ N;  1QQI A;  2M8G X;  5D6E A;  2HVS A;  1HST A;  1V5E A;  1IN5 A;  2L0K A;  3FIS A;  1IRX A;  4PJJ A;  4FIS A;  1YJW I;  4Y52 J;  1WRJ A;  2WC2 A;  1ODD A;  2JWT A;  1ZR2 A;  3I59 B;  4LLN A;  3ULQ B;  3WTY C;  1Z91 A;  3MZH A;  5E1X A;  1TP4 A;  2R92 J;  4C2M J;  5IOY A;  1D1B A;  4IX7 A;  4ASN A;  5CVU A;  3TOB A;  1IV6 A;  4NC6 A;  4BAC A;  3CUQ C;  4F3Q A;  3E1S A;  2IA0 A;  4N9I A;  4ZYG A;  4UVA A;  2OF7 A;  3W3C A;  2V1D A;  2FRH A;  3OS1 A;  3SHF A;  3WOD F;  4FT8 A;  4E4H A;  2D5V A;  2AHQ A;  2A07 F;  3OYD A;  4XLN F;  1KYZ A;  3WTT C;  1BW6 A;  1JHF A;  3LSK A;  1TWC J;  3L2U A;  4XBF A;  2DA4 A;  1DQU A;  1OCO H;  4P9F A;  4QSH A;  3P5J A;  3ABL H;  2PJR B;  5K5O A;  1OKR A;  1FX7 A;  3S32 A;  1YYV A;  1HDP A;  2Z33 A;  3OS0 A;  1E2X A;  1FY7 A;  1U8B A;  3LFU A;  2GA1 A;  4DZJ A;  2LNB A;  1BC8 C;  4IHX A;  3I54 A;  4UUT A;  2OD5 A;  3ZQC A;  3H5R A;  1W4M A;  4AYB N;  1MMN A;  4IOC F;  2G7H A;  2MW8 A;  4WXD A;  5L3F A;  2IA1 A;  3DTI A;  1TWH J;  4FX0 A;  1P4X A;  3G1L A;  3S2H J;  2F4O B;  1GHC A;  5M3F J;  2JRM A;  4GGG A;  2YSR A;  4BHB A;  2P7C B;  1QO0 D;  3GEZ A;  2H1L A;  2Q1Z B;  2YX4 A;  4ZDO A;  5DM6 F;  2DDA A;  2Y2Z A;  2LG4 A;  1W5C C;  2HPI A;  2PLY A;  1ZRD A;  3BY6 A;  3LFK A;  1AKH A;  3SQN A;  3S16 J;  5GAG J;  4UVB A;  1LNW A;  3K70 D;  4U7D A;  3HOS A;  4LK0 F;  2YU3 A;  3G1M A;  4WX9 A;  3KEQ A;  3H3V K;  3BTI A;  1ZRC A;  2JA2 A;  2EBI A;  2EJR A;  2KZG A;  2X85 A;  1B9M A;  3V7C A;  3I53 A;  4CCK A;  2OA4 A;  4Y4R A;  3CCV I;  3JSP A;  2XPU A;  1KA8 A;  2FF4 A;  3WU2 C;  3IKT A;  2F5D A;  2VT3 A;  3KP3 A;  1P92 A;  2JVH A;  2LP0 A;  2HS5 A;  1S6L A;  2PFB A;  4IQJ A;  5K5Q A;  3TO9 A;  2E34 A;  2VBW A;  3MN2 A;  4Q4Z F;  2ID6 A;  1A6I A;  3E7L A;  1B1B A;  2CQN A;  4MFE A;  2VQG A;  2E60 A;  1J75 A;  1AWC A;  4KIC A;  3CCM I;  1FOX A;  1ZLJ A;  1J0R A;  4Y17 A;  5IYC J;  1F36 A;  3A2K A;  4XKC A;  1U6G A;  1YQA A;  2ZME C;  1OPC A;  2CV0 A;  1DPR A;  2W24 A;  3HYI A;  2E1C A;  3CMY A;  2GA2 A;  3M3Y J;  1RZ4 A;  3JTH A;  1WJA A;  2DA3 A;  3H1C A;  1KQ0 A;  4U88 A;  3ABM H;  3A0H C;  5E8G A;  3HXL A;  2LKS A;  2QZ8 A;  4M71 A;  4CGZ A;  3DFG A;  1RUO A;  3Q3S A;  5KVR A;  1MJA A;  1RES A;  3LSG A;  5FKL A;  1AOY A;  2VJJ A;  4P55 A;  4BGD A;  5GAE J;  3BOQ A;  3ASN H;  2IAI A;  3JW4 A;  4M6X A;  4DJA A;  3CDI A;  2R0Q C;  1MNE A;  1IV8 A;  2GWR A;  2P6T A;  3MD2 A;  3QPT A;  4A3I J;  3WG9 A;  1J59 A;  3S8P A;  2EZH A;  2A69 F;  1X1A A;  3SDG A;  4PJM A;  5DYM A;  4P96 A;  1AA7 A;  3OL3 A;  1W36 C;  4GFB A;  3HPH A;  5ERI A;  1FTZ A;  2Y48 A;  1EH7 A;  5J47 A;  2F5F A;  1XD7 A;  4HA8 A;  4PCQ A;  1HQC A;  1Z3Y A;  1IRZ A;  5EZG A;  1USS A;  3G71 I;  4AC0 A;  2CG4 A;  5EG0 B;  4BAY A;  2F48 A;  1JUP A;  6PAX A;  2K9S A;  2OCE A;  1WJC A;  1OCZ H;  1NG7 A;  2MYS A;  2QLZ A;  2L7Z A;  3RDI A;  2BVL A;  2V9P A;  3I4P A;  2KJC A;  5L3D A;  3LA7 A;  3KP6 A;  2JRT A;  1UEL B;  2ADU A;  2H09 A;  4I98 B;  1V5G A;  1A6Q A;  3FBI B;  1A36 A;  4OMZ A;  5D6F A;  4ZZD A;  5L3B A;  1UCR A;  1XC5 A;  1MJ9 A;  3Q9V A;  2BYV E;  3JTG A;  2YU9 J;  1FYM A;  3GFL A;  3E5Q A;  4XSX F;  1RC9 A;  1HXD A;  3MWM A;  4NUB A;  3LST A;  1SC7 A;  3BCB A;  4RMN A;  1R58 A;  3A4C A;  2OQG A;  2MSY A;  1Z6R A;  3BJA A;  3K4N A;  1MNM C;  1SFU A;  2DN0 A;  2PN6 A;  4F92 B;  2J5O A;  3ABU A;  3R6S A;  1F43 A;  4J19 A;  5F0F A;  3VOD A;  1ZGA A;  4KN4 X;  3H3U A;  2E7W A;  2UZK A;  2PBI A;  3SZP A;  4A3E J;  4XON A;  4AU7 A;  3ZQG A;  3HOY J;  3JCU C;  2OCC H;  2G0E A;  4N9H A;  3BR3 A;  5F04 A;  4HSR A;  2XAJ A;  3I59 A;  4JX4 A;  4U7B A;  4C2U A;  4G8X A;  3DP7 A;  3VDX A;  3MMY B;  2KRF A;  1BL0 A;  3F6V A;  3ISP A;  5JI6 A;  1IO2 A;  2DJN A;  4RLQ A;  1ZGJ A;  1YX3 A;  4C30 A;  2HTS A;  3U1K A;  1FZP B;  2Y69 H;  4CZZ A;  2RN7 A;  2WY7 Q;  3AG2 H;  3FIW A;  4M9X A;  4KIB A;  1LE8 B;  3TDZ C;  1MJB A;  1XSV A;  1H8A C;  2BVM A;  2PX9 A;  1KZH A;  4XRS G;  1WPK A;  1MGT A;  2CO5 A;  5FKN A;  2CV2 A;  1U5T C;  3BWG A;  3OIO A;  2CFO A;  1SFE A;  4I99 C;  5J8F A;  2PJR A;  4HBL A;  4C3I J;  3CDH A;  2G9W A;  3GFJ A;  4I01 A;  3C2G A;  5KCM A;  3H35 A;  1FTT A;  2EFW A;  4LG3 A;  1RKW A;  4XR6 A;  4X0G A;  2WY8 Q;  3DEE A;  5GAD J;  1TL8 A;  2I8D A;  4OIP F;  4A69 C;  2KIS A;  3L1P A;  4UV8 A;  2V6C A;  2VXD A;  3CJQ B;  3T8T A;  5JVT A;  4IHS A;  3LMM A;  4HNU A;  1JHH A;  1VQ6 I;  3VYU B;  4XRM A;  3HEF A;  1TW2 A;  2EWN A;  3HRS A;  3F8C A;  1FPQ A;  1Z67 A;  1T2K A;  3BG6 A;  1MKM A;  3ZPL A;  2Z99 A;  2YUS A;  1W7P A;  5TJJ A;  2ZJP F;  3PNY A;  3G3Z A;  1YOV B;  2DOA A;  4AID A;  1U8R A;  2VL8 A;  2XF5 A;  1MMG A;  2VQC A;  1ETW A;  2ME6 A;  2X51 A;  1SFK A;  1LEB A;  1G3Y A;  4OIR F;  3WTZ A;  3OIP A;  1IUF A;  3EUH A;  1L3L A;  4A5M A;  4W97 A;  3IC7 A;  5B1B H;  3FKJ A;  4OU0 A;  2EIK H;  3K4B A;  2L7M P;  4BXU A;  1ZTR A;  3WTU C;  3FWE A;  2FML A;  1N78 A;  1PYV A;  1ZAR A;  2QEN A;  4BKX A;  3EUK L;  3IWZ A;  3JAM K;  5J6X A;  1W36 D;  2DA6 A;  4QIW N;  1GUU A;  2R7W A;  1SVM A;  3MZY A;  3BG9 A;  3EET A;  3QYF A;  1OCP A;  1IJW C;  4RGX A;  5DCM B;  4ESB A;  3A02 A;  2HDD A;  3ML6 A;  1R7J A;  1X3Z B;  2NYX A;  2GXB A;  2HVQ A;  5M5Y J;  1JTY A;  2XGC A;  2XRO A;  3L2Q A;  4YEJ A;  3MVP A;  3IRR A;  5FKM A;  4KYW A;  1R1T A;  3H36 A;  4A12 A;  1NHA A;  2GXA A;  1BI3 A;  2B9S A;  4LMY A;  2DTR A;  2IPQ X;  5D5W B;  2MFZ A;  2DPU A;  4F93 B;  2X6X A;  3JRB A;  4XL9 A;  3G4S I;  2QEX I;  3L2W A;  1XSD A;  2P81 A;  1QA6 A;  2E7X A;  3S2D J;  3DEU A;  1OYW A;  1I6X A;  1RUN A;  3BDD A;  5FRO A;  4Y3O A;  1K79 A;  5IP7 J;  2DA1 A;  2VKE A;  3KLO A;  1ZYR F;  5EJC A;  4CCN A;  5IOZ A;  4A93 J;  3CC7 I;  4HNV A;  5EDN A;  1T8I A;  3JRE A;  2W85 A;  2IRF G;  2K40 A;  3KP2 A;  2Y0S N;  2VJ5 A;  2FA5 A;  2B0L A;  2FU4 A;  2VJI A;  3P7N A;  2NNY A;  3ZQI A;  3HSR A;  3WTV C;  2QA4 I;  2BY0 A;  3DEW A;  3HB9 A;  3D5L A;  3H5A A;  1FOY A;  2Z3Y A;  2AO9 A;  1K78 B;  5EG0 A;  2O5R A;  2LSO A;  4XMY A;  1I5Z A;  3FF5 A;  2VLA A;  2DAO A;  3LQQ A;  3F21 A;  2AQE A;  3GLX A;  2JTV A;  4JX5 A;  1EV7 A;  4O6J A;  2W7N A;  2A61 A;  2CW7 A;  2MD5 A;  4FCY A;  4L0Y B;  3K4J A;  1WJF A;  3F0C A;  4LIT A;  2E2J J;  1VQL I;  4L5I A;  2R7D A;  3DTE A;  4XM3 A;  4II2 A;  2EV0 A;  4BEH B;  5B5E C;  1JJ8 C;  2XRN A;  5FKK A;  2EK5 A;  3M07 A;  1JGS A;  3WU1 B;  2FBH A;  5FFZ A;  1AHD P;  4ZYD A;  4PFO A;  5FLM J;  3L2C A;  2R7R A;  1ETV A;  2LC2 A;  2W82 A;  3DKX A;  3KE2 A;  2QGU A;  4IPA A;  4PJL A;  4CZC A;  3RSN A;  5HDK A;  3PM1 A;  5D5U B;  4XN3 A;  5LGN A;  4A3K J;  2K3F A;  4I7H A;  4HZF A;  1GVJ A;  2FNP A;  2OC6 A;  3FHN A;  3HHH A;  4DNC A;  4EQQ A;  3K2Z A;  5F6F A;  5BS6 A;  1B8I B;  1LFB A;  3CLO A;  2L02 A;  4IHY A;  3C2H A;  2P7V B;  4BE2 A;  5C3E J;  4BXF A;  4G94 A;  2HYF A;  2M30 A;  3FXK A;  2P0W A;  1FOK A;  2IW5 A;  4XKB A;  4BE1 A;  1WFX A;  1HW5 A;  1R5G A;  2Z16 A;  5DUK A;  4A0Z A;  2Q2E B;  2K02 A;  2DPD A;  2XGX A;  4HV6 A;  4LGW A;  5E3O A;  1N77 A;  4CYC B;  2CS3 A;  2BGC A;  5C4J J;  2XPW A;  2V7F A;  2FJ1 A;  3JRG A;  3LQR A;  5CVV A;  5ICF A;  3SZG A;  1T08 B;  3A0B C;  3FBN B;  1NG6 A;  2ISY A;  3E97 A;  3MKZ A;  2R7U A;  1MD0 A;  1U0J A;  1TZL A;  1MZB A;  1OR7 A;  2R7F A;  4XRS A;  4BBS J;  3ZQF A;  3O8G A;  1MBJ A;  2R3S A;  3HG9 A;  4HDU A;  1DP7 P;  3E6B A;  2EIN H;  3JR9 A;  3K4L A;  2DTZ A;  4CO8 A;  1I3A A;  2DYS H;  5BMZ A;  2DW4 A;  3BG7 A;  3C18 A;  4EJV A;  3DQV C;  4ABZ A;  1JJ6 C;  2X6O A;  1FOW A;  1JXS A;  3HL2 A;  3HRT A;  3M8E A;  2DA2 A;  2XAH A;  2I10 A;  5J4Y A;  3F23 A;  3ZCO A;  2UUZ A;  3MKL A;  5M5X J;  1Y56 A;  1YHQ I;  1U3E M;  3WTX C;  2VBX A;  4CUG A;  1BA5 A;  3T0Y A;  5F1R A;  1KQ9 A;  3C1D A;  2RVC A;  3ASO H;  2IT0 A;  1WZ2 A;  1I1S A;  1R5I D;  3HIF A;  2Y30 A;  2O8X A;  2HOA A;  1R9T J;  4I76 A;  2JA6 J;  5CVR A;  1WH5 A;  1OCR H;  2CRG A;  3QP5 A;  2CUZ A;  3V7R A;  1HCR A;  1HOM A;  2FSW A;  3WGG A;  1YS7 A;  5LRR A;  5JFR A;  1JUM A;  2IBD A;  4E7L A;  4IKF A;  3P9K A;  3E6M A;  3WGI A;  5GAH J;  4ZTJ A;  2CQK A;  2RQQ A;  3ESW B;  3GW2 A;  5F1J A;  2XDV A;  3V4G A;  2JK3 A;  1XSX A;  4LD5 A;  4R79 A;  2YPR A;  1S7O A;  2HXI A;  1D1C A;  1Z0X A;  2ID3 A;  2CUF A;  4FE7 A;  3K7A J;  3L7W A;  3KCC A;  5EZH A;  3PNV A;  3R60 A;  1Z6T A;  3IL2 A;  5HLI A;  2R4G A;  3DPL C;  3TDU C;  2L7F P;  2L5Q A;  4A3D J;  3LSJ A;  3CJT B;  4AYB A;  2Y31 A;  5LFA A;  3DBH B;  4IRI A;  5EYR A;  3NRV A;  1FBU A;  3QPS A;  5HDN A;  4LLG F;  4YG2 F;  1CQT A;  1RKT A;  4XQF A;  5F0C A;  1LDJ A;  1QHG A;  1NH3 A;  5KNL A;  2EIJ H;  4NQW A;  5FRN A;  4Y13 A;  1TT0 A;  3QAH A;  1R00 A;  5FLX K;  5IYD J;  1LQ1 A;  2AQF A;  1TWG J;  1V4R A;  1ZN2 A;  4J00 A;  1QHH D;  3DF8 A;  2KRC A;  4NC8 A;  2IS6 A;  3REO A;  2DOF A;  3RKY A;  2X6W A;  1X3W B;  1F5T A;  5EGO A;  3W6J B;  4X6A J;  2L4A A;  3N05 A;  3GVA A;  4IL6 C;  3ZMZ A;  3CCL I;  4D5C A;  1K61 A;  2OAZ A;  4AD9 A;  4RBO A;  3K0L A;  3WE3 A;  2CQX A;  3AFH A;  3FXJ A;  2QKM B;  5KK1 A;  3KPH A;  3ZMV A;  3IAM 2;  3GFM A;  3S14 J;  4A3B J;  5ILU A;  3ZN0 A;  2F5C A;  3KYL A;  3KEO A;  4RDU A;  2EA4 A;  2XV4 S;  1K78 A;  1WI9 A;  1HBX G;  1MND A;  2QSF X;  1XMK A;  4OMY A;  4A5N A;  5LGU A;  5D4R A;  2M7A A;  2LH9 A;  2VPR A;  3N4M A;  5J3L A;  1J9I A;  4A3J J;  3S2W A;  1PP7 U;  3ZQ7 A;  4XRF A;  5EF6 A;  1G3T A;  1YTY A;  1GVD A;  3KZZ A;  4P1W A;  1IN4 A;  4BEH A;  5E3M A;  1DPU A;  3F72 A;  2IS2 A;  3Q0V A;  1QZE A;  4ZZL A;  4BYY A;  2XPV A;  5D5V B;  4FET A;  2E5N A;  3IUO A;  3M4O J;  1J2X A;  1QGP A;  3FK6 A;  3PIP F;  1GDT A;  2BHY A;  1VQN I;  3HGG A;  2QKL B;  1FSE A;  4IQ4 A;  2YS9 A;  3OS2 A;  2XSD C;  4A0X A;  3EUH C;  3PQJ A;  3OY9 A;  1UHS A;  5C44 J;  1MMD A;  1K6Y A;  3OSG A;  1U78 A;  2RNG A;  1T38 A;  1MBF A;  1DDN A;  1W7P B;  1B8I A;  2IEK A;  3CUQ B;  2O03 A;  2Q8K A;  4F55 A;  3K1M A;  4BH9 A;  2H1K A;  2PI0 A;  1QBJ A;  1IF1 A;  1Y39 A;  3HTS B;  4CHU A;  3QYB A;  2NVY J;  1R5H A;  2HU9 A;  3HM5 A;  2ICW G;  2C6Y A;  1BC7 C;  1XG1 A;  2ZSI B;  3QPH A;  4MO7 A;  5FKO A;  2LY9 A;  3HJE A;  2DU9 A;  2OV7 A;  1FBS A;  5HDG A;  2Q2E A;  4HQE A;  1S72 I;  2MBF A;  5KHD A;  2JA5 J;  2KLO A;  5IY5 H;  4CYC A;  3VB2 A;  3VEP A;  4EMS A;  4A3M J;  2ZFW A;  1MBE A;  2WA0 A;  5CQE A;  1HKT A;  1OJL A;  1POG A;  1EJ9 A;  3S3M A;  4M3E A;  2OJE D;  2KFD A;  5E8I A;  2LY1 A;  5J1R A;  1O7L A;  1J7K A;  1FP2 A;  2HQR A;  5D5X B;  3S1M J;  2O6G E;  4V19 K;  1SD5 A;  4TV7 A;  2WB1 A;  4H0E A;  1D8J A;  1XTA A;  1LVA A;  3FMS A;  2L2O A;  4E7K A;  2K7L A;  4IO9 F;  3V8K A;  1XS9 A;  1U2W A;  4PFP A;  3GZ6 A;  4LOC A;  1X19 A;  5FRM A;  3IAS 2;  1YX5 A;  4YEL A;  3ZGK A;  3I56 I;  4YFN F;  3EDP A;  4Y33 A;  4IRG A;  3K1N A;  2P5L C;  1IXS B;  2H8R A;  1T6S A;  3GTJ J;  2R7X A;  5CYV A;  3DXJ F;  3KYC B;  1FMW A;  2ZJR F;  4I0A A;  2D45 A;  4F7Z A;  4DYC A;  1A04 A;  2KIF A;  3JSO A;  4HV5 A;  1Y0N A;  2HEO A;  4YIF A;  4S05 A;  4YIR X;  2H94 A;  5HVQ C;  3HOT A;  1G3W A;  3BP8 A;  4NC7 A;  1WGX A;  5FLX Z;  1VFC A;  4RM2 A;  1LVK A;  4U0V A;  3WGH A;  3OYM A;  2X9D A;  1G2H A;  3QOP A;  2M0M A;  4FQG A;  4LB5 A;  2DMQ A;  2JMW A;  4AIJ A;  3ZXS A;  1T0F C;  2K4J A;  2KIU A;  4LJZ F;  4RGR A;  1D0Y A;  2QVO A;  2R5Y A;  5IT9 Z;  3IH2 A;  4D7M A;  3H9J A;  3G73 A;  1HA8 A;  1YW9 A;  3CJR B;  3KEY A;  4CIC A;  4Y7N J;  1K83 J;  3QOE A;  3VYR B;  4UB8 C;  4J01 A;  3ZOB A;  2NVX J;  1LB2 A;  2JUC A;  1P7I A;  1R23 A;  2ZME B;  3CUO A;  3WHC A;  5DS9 A;  4IEJ A;  3BG5 A;  4HOB A;  1UMQ A;  1OLT A;  1W1W E;  3J80 K;  3D1N I;  3KZI C;  4EJU A;  2R7V A;  3FXM A;  3OYB A;  3HOW J;  2XAU A;  2EZL A;  1KQ8 A;  4M74 A;  4BDY A;  1QRY A;  1KON A;  3F3X A;  3E5X A;  4UVC A;  5H6R A;  2LBF B;  4B3X A;  4C3H J;  4AUX A;  2EQR A;  4L9T A;  3TBI A;  4AWX B;  2F4M B;  3AL0 B;  1X1D A;  1K4T A;  4DGW B;  2WAE A;  3IP4 B;  2Y0M A;  3BR0 A;  1O3S A;  4IOA F;  2KL4 A;  5BPI A;  1ZRE A;  1J5Y A;  5CPR B;  4B47 A;  2JUG A;  1X1P A;  4RGU A;  2IGM A;  2RC4 A;  4KT6 A;  3KP4 A;  3HOX J;  1BBY A;  1JKP C;  2ZB9 A;  3FHZ A;  2GQQ A;  2OPT A;  1ZG3 A;  1SAN A;  2RKH A;  3TO6 A;  1ZH5 A;  3OWT A;  1HKS A;  5AON A;  2DT5 A;  1G4D A;  5DDG A;  5FD6 A;  4BQQ A;  3BRO A;  2CQQ A;  3W2W A;  5DEQ A;  4PJN A;  2PEX A;  2ISZ A;  1Z3X A;  5BNG A;  1TNS A;  2QQB A;  3HRM A;  4FE4 A;  2L01 A;  2XKO A;  4NB5 A;  2HTJ A;  4QLC U;  1OR7 C;  2M9H A;  1PUF A;  2FNA A;  3DKW A;  1IGN A;  1ON2 A;  3CO6 C;  4XID A;  2L3D A;  1X1C A;  1EKE A;  2VB6 A;  2KP6 A;  3FMR A;  3K6G A;  1R4N B;  1MW7 A;  2HYG D;  2DI3 A;  4HF1 A;  4E7H A;  3RPU D;  4HLY A;  2EFO A;  5K7F A;  1L0O C;  2V4J C;  1UFM A;  1YIO A;  1K4S A;  4GCV A;  1B4A A;  3KP5 A;  2P6S A;  4ZJZ A;  3I58 A;  2WAQ A;  3WG7 H;  4F52 A;  2DK8 A;  2Z1D A;  3QOD A;  2ZXJ A;  2XHK A;  1Q1H A;  2XAQ A;  3BLY A;  4RS8 A;  3MCZ A;  5EEA A;  5LHI A;  2GBY A;  1IDZ A;  2PQ8 A;  4JX6 A;  3RPQ A;  2ZXH A;  3OYK A;  2A3S A;  1Z1D A;  2JSC A;  2V9V A;  3BTC A;  2JJ7 A;  2L9N A;  2D2W A;  3SDB A;  5F0H A;  1FC3 A;  2DMP A;  1GV2 A;  5DD8 A;  1J09 A;  4RGS A;  4D7N A;  4HX4 A;  2IGK A;  5K7H A;  1SMT A;  1MBK A;  2HQN A;  3HGY A;  1MMA A;  2F4I A;  4XLP F;  3GLL A;  2YR2 A;  5J40 A;  4EJT A;  2UXX A;  1Z05 A;  4GYI A;  1S7A A;  2HQ5 A;  4FX4 A;  1FLI A;  2LF7 A;  1WCM J;  3H9G A;  4WF2 A;  4G7Z F;  4ENJ A;  4I02 A;  4HYE A;  4U87 A;  2V1X A;  3L09 A;  2CUE A;  2FMY A;  2MH2 A;  3CUQ A;  4KIF A;  1I6H J;  3PSF A;  1FBQ A;  3DLL F;  5HLG A;  3RKW A;  4D5F A;  5BOX A;  1QU3 A;  3ZQH A;  3OYF A;  4H4K C;  2D1V A;  2KIM A;  2VAS A;  3LSR A;  4BDZ A;  3UR3 C;  3FDY A;  5LBQ A;  4KJZ A;  3GO5 A;  1U5T B;  2RQP A;  5LHH A;  3L2R A;  1E17 A;  2EIL H;  4RLF A;  5E3L A;  4ZTF A;  1UAA A;  3F6O A;  3QYE A;  3Q9S A;  4U0W A;  2GXG A;  1S5L C;  5D8L B;  1S9H A;  2DCE A;  1RNL A;  1P6R A;  3LNQ A;  2BV6 A;  2RGV A;  4O3M A;  3QU6 A;  2QQ9 A;  4A3G J;  2EZK A;  3F8B A;  1B59 A;  4GXO A;  3VYT B;  3ELK A;  5HNF A;  1IN6 A;  2ZBK A;  9ANT A;  2R7T A;  2ME0 A;  5LRS A;  2DFF A;  4ENK A;  2JVG A;  1IXC A;  1I27 A;  3KIO A;  1HDD C;  2VI6 A;  5HNH A;  2NAZ A;  2QSH X;  2BHZ A;  1ITY A;  4CCM A;  4BHC A;  3RQ4 A;  1DU6 A;  2VBZ A;  2V26 A;  3NWT A;  4JOM A;  2EIM H;  3PUF A;  2XAF A;  3LSP A;  4EGZ A;  2B63 J;  2IGN A;  2TCT A;  1KGS A;  2CUJ A;  1K7A A;  3BG3 A;  1H0M A;  2HI3 A;  4NQW B;  4ANJ A;  4XLE A;  3FZV A;  3R61 A;  3G1O A;  5IP9 J;  2CH0 A;  2E1O A;  1ERD A;  3U21 A;  4M72 A;  1ZR4 A;  3U9G A;  3DCF A;  3GX4 X;  2ZXI A;  2BXY A;  2HVR A;  4PK4 A;  3CC2 I;  4P5O A;  3U1D A;  5FLV A;  5GPC A;  2STT A;  1FIP A;  2CU7 A;  4Z6Y A;  2WWY A;  2K86 A;  5EGO B;  3VWB A;  3HOZ J;  2DA5 A;  5FFX A;  1WVR A;  2VE9 A;  3BPX A;  1D5Y A;  2FOW A;  3PSI A;  5BQT A;  3GBG A;  3L00 A;  3BC8 A;  2GOM A;  1YW8 A;  1MDM B;  3CJN A;  3PL8 A;  1O3T A;  4UHT A;  1LFP A;  3LA3 A;  1G6N A;  3S1R J;  2O0Y A;  3GTK J;  3LA2 A;  5CQG A;  2WV1 A;  1R6R A;  2ZME A;  5JR3 A;  1RIO H;  2E1M C;  3HOV J;  1WJB A;  2TRT A;  3HZJ A;  5CLS A;  1FSH A;  3A1Y A;  1WQ2 A;  3T5X A;  3NAU A;  2ACJ A;  3H0D A;  2MD0 A;  2VQL A;  1OMI A;  3DKY A;  1FT9 A;  1RPW A;  3OYH A;  1D3Y A;  2IS4 A;  4XN0 A;  3AAF A;  1REP C;  1QPM A;  1TC3 C;  3EPZ A;  5ICE A;  2ZC2 A;  2FEZ A;  1SD4 A;  5HS7 A;  4IHV A;  1V3F A;  4HEA 2;  2E19 A;  3J7A O;  2LBF A;  2LRE A;  4XKW A;  3RKQ A;  1TTY A;  3S1N J;  2IS1 A;  3GUD A;  2EA2 A;  3L9F A;  3M7G A;  2BZT A;  3I64 A;  2P5K A;  4A0Y A;  1ZAO A;  3L2V A;  2GIV A;  1SAX A;  2KIQ A;  2ZO4 A;  1RET A;  1UJ8 A;  5IP6 A;  4N4N B;  2IJL A;  4XIC A;  3K2A A;  3HBL A;  2K5C A;  1YG2 A;  2DFH A;  2P4W A;  3RYR A;  3U2R A;  5HS9 A;  4KNY A;  2OTL I;  3DBL B;  5JHF A;  4YRV A;  4MEX F;  4CDG A;  4M6V A;  3LWF A;  1QZZ A;  2OU2 A;  3GWZ A;  2NVU B;  1BI0 A;  3HTU A;  3SXY A;  3WHB A;  5LGT A;  1VQK I;  1Q1V A;  3H5N A;  2IVM A;  3KYD B;  5E1Z B;  3VSK A;  4B44 A;  2V1N A;  1VQP I;  3M8J A;  4P9U A;  3CMM A;  5JLW A;  4B48 A;  5M5W J;  4RAY A;  1YJ9 I;  4E7Z A;  3LSH A;  1HLV A;  2MG4 A;  4XSZ F;  3SZT A;  3W6K B;  3BPV A;  3BCA A;  3H3Z A;  2PMZ A;  1IG7 A;  1EA3 A;  4V2G A;  2M45 A;  5JVG F;  2IXS A;  3DLA A;  3ZQQ A;  1B9N A;  3VYS B;  3W2A A;  3M1C A;  2DT6 A;  4LFU A;  2W4S A;  1XCB A;  1HKQ A;  3TOA A;  1F1Z A;  5E79 C;  2NRA C;  3QPL A;  4BXX J;  3JAM Z;  3N97 A;  2BY2 A;  4KMU X;  2Z5U A;  2HNH A;  2KT0 A;  1BN5 A;  1ONV A;  3FKI J;  5TIS C;  3P9C A;  1IAW A;  2L9S A;  1JUS A;  2V6E A;  1BR1 A;  3PJR A;  5F64 A;  3EQL F;  4AM3 A;  5E20 A;  3PNT A;  3ZMD A;  3OYC A;  1ENH A;  4DOZ A;  1H88 C;  2HOT A;  3GTP J;  1SFO J;  1E3H A;  3SJM A;  1FEX A;  4JP0 A;  3F8F A;  1V54 H;  4UY8 I;  1YFH A;  4GRI A;  2XRL A;  3OYJ A;  1EF4 A;  1D0X A;  2O7O A;  2VN2 A;  2R5Z B;  3HKZ A;  4RB0 A;  3BQY A;  2FXA A;  1JE8 A;  4ESF A;  3BQZ A;  3OOU A;  1F9N A;  3FXO A;  1VQ5 I;  1VQ9 I;  3B02 A;  4HW0 A;  2BBY A;  1A5J A;  2K4B A;  2HKX A;  3BZ6 A;  5AIQ A;  2R5Y B;  4KN7 X;  3D5S C;  1Z21 A;  4JK1 X;  5TGT A;  3I55 I;  1U5T A;  4GDF A;  2HXO A;  3GFI A;  2H8W A; 
#chains in the Genus database with same CATH homology
 2LY9 A;  3ZQG A;  1QVU A;  3HOY J;  1OCT C;  3S1Q J;  2G0E A;  4IHW A;  3BR3 A;  5F04 A;  1ETX A;  2JA5 J;  4JX4 A;  2NVT J;  4A3M J;  4CYC A;  1ZQ3 P;  1BL0 A;  1JT6 A;  1MBE A;  4BBR J;  1ETK A;  4DZP A;  1Y1W J;  1ETQ A;  3IH4 A;  2DJN A;  4I6Z A;  1OJL A;  1POG A;  1DU0 A;  4M3E A;  1BW5 A;  2KDZ A;  5J1R A;  3FIW A;  1LE8 B;  2XB0 X;  3S1M J;  1VND A;  3RZD J;  2JA8 J;  1H8A C;  4XRS G;  1WPK A;  5FKN A;  1VI0 A;  1XS9 A;  3OIO A;  5C4X J;  3H0G J;  4C3I J;  4LOC A;  1IC8 A;  3W6V A;  2Y9Z A;  1FTT A;  1JTX A;  1GV5 A;  1RKW A;  2H8R A;  1JGG A;  4L5E A;  3JRC A;  3GTJ J;  1MSF C;  4A69 C;  3L1P A;  3OSF A;  4DYC A;  1FIA A;  2R7Z J;  1MH4 A;  4V2F A;  4XRM A;  3HEF A;  4W1U A;  1WGX A;  4B4C A;  3RZO J;  1MBG A;  2Y9Y A;  3LOC A;  1VFC A;  1G2H A;  2X9D A;  5M3M J;  3JRH A;  2YUS A;  1PUF B;  2DMQ A;  2JMW A;  3TP3 A;  1JKO C;  2R5Y A;  1AU7 A;  3TW6 A;  3CDL A;  1HF0 A;  3IH2 A;  4D7M A;  4FTH A;  1AKH B;  2L9R A;  1LFU P;  1ETW A;  4Y7N J;  1K83 J;  2ME6 A;  2K9Q A;  1YRN A;  2NVX J;  3ZOB A;  4A3L J;  1BJZ A;  2XB5 A;  1P7I A;  1IUF A;  3WHC A;  5DS9 A;  5K7Z A;  4IEJ A;  4W97 A;  3BG5 A;  3B6A A;  1S7E A;  3I4M J;  2ECC A;  2L7M P;  3A03 A;  3BTL A;  1ZTR A;  2DMU A;  1UMQ A;  3D1N I;  1FJL A;  4M3D A;  4S0H B;  3S15 J;  2W48 A;  3RQI A;  3HOW J;  3UKG A;  2E2I J;  2EZL A;  1QRY A;  4BKX A;  1W0U A;  2DA6 A;  4C3H J;  4QIW N;  1GUU A;  4AUX A;  2EQR A;  3BG9 A;  5F27 A;  1OCP A;  5GP9 A;  1IJW C;  1LE8 A;  2JN6 A;  3A02 A;  2HDD A;  5M5Y J;  1JTY A;  2XGC A;  1I50 J;  5GPA A;  3BR0 A;  3MVP A;  1B72 B;  5FKM A;  2QCO A;  4X1E A;  1U9N A;  1NTC A;  2MGQ A;  5HOD A;  1ZK8 A;  2NOG A;  3HOX J;  4BY1 J;  3S17 J;  3JRB A;  1JKP C;  2ZB9 A;  4B3A A;  1ZKG A;  2OPT A;  1P7J A;  1SAN A;  2P81 A;  3VPR A;  3JRD A;  3S2D J;  3JRI A;  3PO3 J;  2VUM J;  2CQQ A;  2EH3 A;  5IP7 J;  2DA1 A;  2VKE A;  5BNG A;  5IOZ A;  4A93 J;  2LR8 A;  4FE4 A;  3GTL J;  4HNV A;  1WI3 A;  2M9H A;  5JLX A;  5EDN A;  1MBH A;  1X2M A;  1PUF A;  3JRE A;  1UG2 A;  3BR6 A;  2LVS A;  1IGN A;  2K40 A;  1ZGW A;  4XID A;  2Y0S N;  1TWF J;  1NK3 P;  3ZQI A;  2DMT A;  5K7F A;  4MIM A;  3DEW A;  3HB9 A;  2NS8 A;  1GT0 C;  2N8G A;  2AO9 A;  5J1Y A;  5EG0 A;  4M3B A;  2M0C A;  3A01 B;  4JX5 A;  5F08 A;  4BY7 J;  5EEA A;  4FCY A;  2GBY A;  4DYQ A;  2O8K A;  1IDZ A;  4JX6 A;  3F0C A;  2E2J J;  2CJJ A;  1QVT A;  1ORK A;  3BTC A;  2JJ7 A;  5F0H A;  2LLK A;  1JJ8 C;  2PMZ N;  5FKK A;  3GTQ J;  3CCY A;  2DMP A;  1NK2 P;  1GV2 A;  3B6C A;  5E3N A;  4QTR A;  1AHD P;  4D7N A;  5K7H A;  5FLM J;  1MBK A;  3HGY A;  3SFI A;  2K9N A;  1ETV A;  5FJ8 J;  1IDY A;  2EZI A;  5IPA A;  3PM1 A;  4UUS A;  2DMN A;  4A3K J;  3C2B A;  2HQ5 A;  1WCM J;  4A3F J;  3BR1 A;  2R5Z A;  1JT0 A;  2GM4 A;  2HYJ A;  1MH3 A;  3GTM J;  2CUE A;  2M2E A;  5IYB J;  1B8I B;  1I6H J;  2O9L A;  3GTO J;  1LFB A;  4DW6 A;  1JKQ C;  2RAE A;  4IHY A;  4D5F A;  3ZQH A;  3LSR A;  1VF9 A;  5C3E J;  3I4N J;  3HOU J;  1X58 A;  2M34 A;  1RR7 A;  2FX0 A;  5E3L A;  3HKZ N;  2M8G X;  3TED A;  1X2N A;  2L0K A;  3FIS A;  4Y52 J;  4FIS A;  2JWT A;  1ZR2 A;  5E3O A;  4CYC B;  2R92 J;  4C2M J;  5C4J J;  5IOY A;  3LNQ A;  2XPW A;  4A3G J;  3BTJ A;  2EZK A;  2FJ1 A;  3JRG A;  1IV6 A;  2FD5 A;  2LFB A;  2OF7 A;  3Q0U A;  9ANT A;  2ME0 A;  2D5V A;  2AHQ A;  4XRS A;  4BBS J;  3ZQF A;  1BW6 A;  3O8G A;  1HDD C;  1TWC J;  1MBJ A;  2DA4 A;  2VI6 A;  4QSH A;  1ITY A;  3JR9 A;  1T56 A;  1DU6 A;  2DTZ A;  4DYR A;  3LSP A;  1I3Q J;  2LKX A;  2B63 J;  2R93 J;  1HDP A;  2TCT A;  1JJ6 C;  4ABZ A;  2X6O A;  3QQA A;  3BG3 A;  1OFC X;  2HI3 A;  1U8B A;  3JRF A;  4DZJ A;  4IHX A;  1E3O C;  3G1O A;  2GLO A;  4UUT A;  5IP9 J;  1ETY A;  2DA2 A;  2E1O A;  3ZQC A;  2I10 A;  2LTP A;  1ZR4 A;  2WB1 N;  4AYB N;  3DCF A;  5FLV A;  2MW8 A;  3MKL A;  1WH7 A;  1TWH J;  5GPC A;  5M5X J;  1FIP A;  3G1L A;  2CU7 A;  3S2H J;  1BA5 A;  5M3F J;  1APL C;  5EGO B;  3HOZ J;  2DA5 A;  2ELK A;  2Y30 A;  1D5Y A;  2HOA A;  4G12 A;  1R9T J;  4I76 A;  1W0T A;  2JA6 J;  1WH5 A;  2Y2Z A;  3GBG A;  1AKH A;  2CRG A;  3S16 J;  4NDL A;  1HCR A;  1HOM A;  3S1R J;  4MLO A;  1YRN B;  3GTK J;  2E2H J;  3G1M A;  1JUM A;  1T33 A;  2IBD A;  2WV1 A;  4B1R A;  3H3V K;  2TRT A;  3BTI A;  3HOV J;  2EBI A;  1TWA J;  3NAU A;  5F1J A;  2XGE A;  2DA7 A;  1RPW A;  2JK3 A;  1Y1V J;  2XPU A;  4A3C J;  2HXI A;  1Z0X A;  2ID3 A;  4M3G A;  2CUF A;  1TC3 C;  4FE7 A;  2LP0 A;  3K7A J;  3BR5 A;  5EZH A;  3IH3 A;  4IHV A;  2E19 A;  3MN2 A;  2ID6 A;  1A6I A;  3E7L A;  4MFE A;  2NVQ J;  3RKQ A;  3S1N J;  2L7F P;  3FK7 A;  5J1U A;  3PO2 J;  3LSJ A;  4A3D J;  1JKR C;  2Y31 A;  5IYC J;  1F36 A;  2ECB A;  5EYR A;  2XGD A;  1B72 A;  3NAR A;  3QPS A;  1Z77 A;  1CQT A;  1RKT A;  1RET A;  3CQZ J;  5F0C A;  1U9O A;  5IP6 A;  3CMY A;  3BT9 A;  3M3Y J;  2DA3 A;  4XIC A;  3K2A A;  3HBL A;  5IYD J;  3GTG J;  2QF7 A;  1TWG J;  3Q3S A;  3ZQL A;  1RES A;  3LSG A;  5FKL A;  4M6V A;  2JA7 J;  3WHB A;  5EGO A;  2IAI A;  1Q1V A;  4X6A J;  2COB A;  2R0Q C;  4D5C A;  1K61 A;  3IV5 A;  4RBO A;  4A3I J;  2CQX A;  5JLW A;  5M5W J;  2EZH A;  3TP0 A;  3SDG A;  1HLV A;  3HDD A;  3S14 J;  4A3B J;  4GFB A;  1FTZ A;  2MG4 A;  4M3F A;  1IG7 A;  4RDU A;  4V2G A;  1H89 C;  2X48 A;  5EZG A;  4EEF G;  1IRZ A;  4AC0 A;  5EG0 B;  1JUP A;  4JYK A;  3A01 A;  2VPR A;  2K9S A;  3Q0W A;  5J3L A;  4A3J J;  3QPL A;  4BXX J;  2KT0 A;  2L7Z A;  3FKI J;  5EF6 A;  1JUS A;  2LK2 A;  1GVD A;  5E3M A;  3Q0V A;  4MFD A;  1ENH A;  2XPV A;  1H88 C;  2HOT A;  2LD5 A;  1SFO J;  3GTP J;  1QPI A;  2WAQ N;  3SJM A;  3M4O J;  1FEX A;  4JP0 A;  3FK6 A;  1XC5 A;  1GDT A;  2YU9 J;  3HGG A;  4UUS B;  2YS9 A;  2XRL A;  2XSD C;  5DTD A;  1EF4 A;  4XK4 A;  2O7O A;  2R5Z B;  5FKO A;  3TW7 A;  1UHS A;  2MSY A;  5C44 J;  4C3J J;  3BQY A;  3OSG A;  1U78 A;  2HOS A;  3BQZ A;  1MBF A;  3OOU A;  1B8I A;  2IEK A;  1MNM C;  2DN0 A;  1A5J A;  2R5Y B;  2H1K A;  1F43 A;  4J19 A;  1MSE C;  5F0F A;  2NVY J;  3O8H A;  3HM5 A;  3JRA A;  4A3E J;  1ETO A;  2FQ4 A;  2VKV A;  3BR2 A;  1XG1 A;  1O4X A;  4MO7 A;  2HXO A;  2NS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...