3CMYA

Structure of a homeodomain in complex with dna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
60
structure length
60
Chain Sequence
GQRRSRTTFTAEQLEELERAFERTHYPDIYTREELAQRAKLTEARVQVWFSNRRARWRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator/dna
molecule keywords Paired box protein Pax-3
publication title Structural Basis for DNA Recognition by the Human PAX3 Homeodomain.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2008-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3cmyA00
2GLOA 1A6IA 1MBFA 1I3QJ 4CYCA 3OIOA 5IP6A 2X6OA 4AYBN 5C4XJ 3LSJA 5EGOA 1ETOA 4B4CA 4XK4A 1MSFC 5F0CA 2CUEA 1TWGJ 2NVYJ 3GBGA 3MKLA 3WHCA 1OJLA 1ZKGA 4IEJA 1JUMA 1HCRA 1RR7A 2JA8J 4ABZA 1BW5A 3TW7A 3E7LA 2O9LA 1NK3P 9ANTA 3HB9A 1FIAA 1WH5A 2MGQA 2JN6A 1MSEC 2CJJA 2R7ZJ 5FKMA 2HXIA 5FKOA 2X48A 5F0FA 1FTTA 1IC8A 3S1NJ 3M4OJ 1U9NA 2MSYA 1ZGWA 2Y30A 2DA7A 2LP0A 2DMQA 5IYBJ 5IYCJ 1U78A 1K61A 3ZQHA 2QCOA 2DTZA 3HGGA 4JX6A 3ZQFA 1EF4A 3GTKJ 3TP0A 2E2HJ 1MH3A 2DA6A 1ETKA 5IPAA 5FLVA 2GM4A 2O7OA 5DS9A 1P7IA 1DU6A 2LTPA 3GTMJ 2EH3A 2JA5J 1RKWA 2VKVA 2DA1A 3JRIA 3LSGA 3PO2J 5EYRA 2TCTA 2YUSA 3C2BA 4FTHA 3BR6A 4LOCA 1NK2P 2AO9A 1RETA 3B6AA 5K7HA 1FIPA 1JT0A 4IHXA 5M5XJ 2MG4A 5E3LA 2FD5A 3F0CA 3HKZN 2X9DA 1E3OC 3M3YJ 3S2DJ 2L7MP 4JP0A 4RBOA 1B8IB 2EBIA 2JJ7A 5EG0B 2R5YB 5IP7J 3HOXJ 2EZKA 3G1MA 1B72A 4FCYA 4MIMA 2HDDA 2K40A 2Y31A 2R0QC 1UHSA 4UUSB 2K9QA 1VFCA 2W48A 3A01A 3IH2A 4AC0A 1VF9A 5K7ZA 1IG7A 5GPCA 3NAUA 1JJ8C 3BT9A 4QIWN 1X2MA 2M0CA 3W6VA 2Y0SN 1MBKA 1FEXA 3DEWA 1A5JA 5E3MA 3BR3A 5FLMJ 2Y9YA 2OF7A 5C44J 1PUFA 3GTLJ 1IDYA 2JA6J 1IDZA 1QRYA 2DMUA 5IP9J 4A3EJ 3ZQIA 3CCYA 4DW6A 4GFBA 5M3MJ 2LFBA 5E3NA 3GTJJ 2AHQA 2Y2ZA 1AKHB 5GP9A 5JLXA 5IOYA 1IJWC 3L1PA 2LD5A 5JLWA 2R5ZB 2JK3A 4FISA 5HODA 3HOZJ 4M3EA 2HYJA 1UG2A 2DA2A 4M6VA 1WPKA 1ITYA 3S1RJ 4BXXJ 2RAEA 3QPLA 3HOVJ 1XS9A 5K7FA 1ETYA 5EZGA 2HQ5A 4A3KJ 4A3BJ 3HDDA 2HOAA 1FJLA 1WGXA 1QVTA 1QPIA 4W1UA 2XGCA 5FKNA 4A3JJ 3TP3A 4RDUA 3BG5A 1WI3A 2DA5A 2OPTA 3Q0VA 4L5EA 3PM1A 1O4XA 4JX4A 1GDTA 2K9SA 4JX5A 2XGDA 5J1YA 2I10A 1TWHJ 2YS9A 1JKRC 2IEKA 1RESA 1TWFJ 2M34A 3BR5A 1TWAJ 2HOTA 3JREA 5F1JA 3IH3A 5J1UA 2M8GX 1ETXA 1MH4A 2KT0A 2EZIA 1Q1VA 4CYCB 3S2HJ 4C2MJ 4M3BA 3BTLA 4MFEA 5EGOB 1F36A 1D5YA 2HOSA 2VKEA 1Z0XA 1P7JA 2EZHA 5J1RA 1MBHA 3BR1A 3HBLA 3FISA 4A69C 1XC5A 3G1OA 4MLOA 2FJ1A 2ME0A 1JKQC 1JKPC 1LE8A 1VNDA 1X58A 3Q0WA 2ID6A 4DZPA 3RKQA 1DU0A 4C3IJ 1JUPA 1F43A 3SFIA 4IHVA 4BY7J 2LLKA 1OCTC 5EG0A 2EZLA 1ENHA 2IBDA 4MFDA 2DA3A 1G2HA 1TWCJ 2P81A 3BG9A 1HOMA 4X1EA 5M3FJ 5DTDA 2R92J 2CQXA 5IOZA 2KDZA 2L7ZA 1JT6A 2D5VA 3S1MJ 2L7FP 5FKLA 4XRSA 3CMYA 1BW6A 2XPUA 3MN2A 1IGNA 4A3GJ 2G0EA 3OOUA 3IH4A 1MBEA 5IYDJ 4A3MJ 1BJZA 1BL0A 5F08A 5EF6A 1QVUA 3ZQCA 3VPRA 1JJ6C 3S15J 5C3EJ 3HEFA 3FK7A 1MBGA 3TEDA 3BG3A 2NVXJ 4V2FA 1ETVA 2NVTJ 4JYKA 3JRBA 1TC3C 5J3LA 1OCPA 1T56A 1ORKA 1ZTRA 4C3HJ 1IRZA 3JRAA 5BNGA 3CQZJ 3I4MJ 3D1NI 4BBSJ 3BTCA 3S1QJ 5EEAA 3BQZA 1R9TJ 4A93J 2ELKA 4A3CJ 3K7AJ 4XRSG 1SANA 1Y1VJ 2ZB9A 1X2NA 4M3DA 2M2EA 1JKOC 3O8HA 1ZK8A 2WV1A 4DYCA 2XSDC 3LNQA 2CUFA 1XG1A 2NS7A 4XIDA 4I6ZA 1H88C 2NOGA 2E2IJ 4A3IJ 1CQTA 4G12A 4BBRJ 2XPWA 3MVPA 1U9OA 3K2AA 3A02A 1JTXA 1AHDP 4BY1J 4QSHA 3QPSA 1FTZA 1JUSA 3ZQLA 2TRTA 3RZDJ 2WAQN 5F0HA 1LFBA 4DZJA 3S16J 2EQRA 3GTGJ 1BA5A 2VPRA 1PUFB 2DA4A 4M3GA 2M9HA 5C4JJ 2DMPA 2JA7J 1Y1WJ 3TW6A 2YU9J 2XGEA 3UKGA 1VI0A 2ID3A 3HM5A 2O8KA 3WHBA 1OFCX 4HNVA 2R93J 3H0GJ 5EZHA 3GTOJ 1MNMC 2H8RA 1RKTA 1YRNB 3BR0A 5F27A 3BR2A 3BTIA 1WH7A 1T33A 2LVSA 1H8AC 1I6HJ 4FE7A 1HDPA 4J19A 1GT0C 3OSGA 3S14J 2B63J 2CU7A 2XB5A 1UMQA 2MW8A 3LSRA 4V2GA 3JRDA 2GBYA 2FQ4A 3HOUJ 4I76A 3A03A 3DCFA 2JMWA 2DMTA 3HGYA 2PMZN 2DJNA 1GVDA 3CDLA 4FE4A 1SFOJ 5FJ8J 2ME6A 4EEFG 4DYRA 1APLC 5GPAA 2XPVA 2LKXA 2ECBA 3IV5A 1B8IA 3JRFA 2R5YA 3QQAA 1NTCA 1HF0A 2NS8A 2Y9ZA 4D7MA 5M5YJ 3Q0UA 1S7EA 4C3JJ 1H89C 2QF7A 4AUXA 4IHWA 1POGA 4UUSA 4NDLA 3JRHA 1IV6A 3OSFA 2LY9A 2CRGA 2ECCA 3FIWA 1K83J 3RQIA 3ZOBA 1ETQA 1Z77A 2N8GA 1I50J 1ZR2A 2H1KA 1WCMJ 4DYQA 3I4NJ 3Q3SA 3BTJA 1LE8B 3HOWJ 4BKXA 4A3DJ 2E1OA 4B1RA 3RZOJ 5M5WJ 2JWTA 3FKIJ 4Y7NJ 3NARA 4A3FJ 5EDNA 3JRCA 5FKKA 1U8BA 1GV2A 2L9RA 2WB1N 1AKHA 1AU7A 4IHYA 3JRGA 1W0TA 2R5ZA 4MO7A 3O8GA 3BQYA 4QTRA 4UUTA 4W97A 2LK2A 4A3LJ 1ZQ3P 3SDGA 3JR9A 4M3FA 1B72B 1MBJA 1RPWA 2HI3A 4XICA 2LR8A 1ETWA 2VUMJ 3HOYJ 2IAIA 2DN0A 2K9NA 2COBA 4B3AA 1HLVA 2HXOA 3PO3J 3GTQJ 1IUFA 4Y52J 3A01B 2XRLA 1HDDC 4D7NA 2L0KA 2E2JJ 2NVQJ 2E19A 4S0HB 3ZQGA 1LFUP 1JGGA 5E3OA 3H3VK 5F04A 2FX0A 3FK6A 1W0UA 3S17J 3GTPJ 1GUUA 3B6CA 3SJMA 2DMNA 4X6AJ 1JTYA 4D5CA 3G1LA 1ZR4A 3LSPA 1YRNA 2CQQA 2XB0X 2VI6A 4XRMA 4D5FA 3LOCA 1GV5A
chains in the Genus database with same CATH superfamily
5ED4A 1A6IA 4CYCA 1R36A 4RLFA 4BS9A 1YG2A 4AYBN 3CCLI 3VYRB 5HLIA 2VONA 4G7ZF 2IW5A 3S8PA 3JTGA 1HSTA 4E4HA 4ZYEA 1FC3A 2CUEA 1RNLA 3MKLA 3PSFA 2MBFA 4WXHA 2P6SA 1HCRA 3CUQB 4IEJA 3AL0B 5CVJA 4ABZA 4D1QA 4PFOA 2UWMA 3IL2A 1YIOA 2O9LA 1EJ9A 3KP4A 4RGXA 1NK3P 1ZHFA 3E6BA 4DBRA 2EA2A 1WH5A 2MGQA 2XAGA 1MSEC 3L2UA 2R7ZJ 3OR2C 2WV0A 3PFYA 2E1CA 1HXDA 1SVOA 5KVRA 4CICA 3AL0C 1GHCA 2HVQA 5L3BA 2EFPA 5IYBJ 3KLOA 1K61A 2MH9A 3T8RA 2QCOA 4XKCA 3HGGA 3CLOA 2ESNA 3DQVC 4YIIA 3TP0A 2F4IA 2E2HJ 3BG7A 1ETKA 2OTJI 1YW9A 4Y13A 3IRQA 1WWXA 3KFWX 2R7XA 3VWBA 4FX0A 1DU6A 4IHTA 1ERDA 2BYVE 1GLNA 2GIZA 2JA5J 3BP8A 1S5LC 2VKVA 3BWGA 3M8EA 2DLLA 1S72I 3PO2J 1YS7A 5HDGA 3C2BA 4FTHA 1NK2P 5BPDA 2FA5A 1RETA 5K7HA 2EFOA 2XAJA 1FIPA 3CCUI 1KZHA 4IHXA 3LA2A 3J7AO 1J09A 1IXCA 3J80K 2VPLA 2V79A 3J7ZI 4R1HA 5ILVA 3KZZA 4RLQA 2HEOA 5AIPA 3ISPA 4KN7X 4HDUA 3K69A 1XDSA 4JP0A 3S3MA 5DCMA 2JVHA 2YU3A 1S29A 2L4AA 2OCEA 5HDKA 3ERED 2K85A 1D1BA 3QP5A 1ODDA 3SQNA 2VJIA 1TTYA 4AIHA 1HKSA 1F1ZA 4MIMA 1B72A 5HLGA 3PIPF 2Y31A 2YX4A 4JQFA 1UHSA 4B8XA 1E0EA 1Z21A 1K6OA 2EFWA 2EV6A 5KCMA 2CV1A 4L5JA 5FB2A 3IH2A 1R6RA 3OYDA 5IT9K 5CQGA 4XN3A 5K7ZA 5GPCA 2CMPA 1X2MA 2K3PA 1UAAA 3W6VA 1FP1D 2Y0SN 1STZA 4GDFA 1A5JA 5FLMJ 2F4OB 1WJBA 2X0LA 2Y9YA 3S3OA 3HC7A 2OF7A 4ENNA 3AG4H 1I5ZA 3ECHA 2DMUA 2E5NA 5FO5A 3CMAI 4A3EJ 2K7LA 3TQNA 1EH6A 1XGOA 1R23A 2VN2A 4DNCA 4GFBA 1QNTA 4LJZF 5M3MJ 3ZRGA 4BHPA 1KQ8A 3CDHA 3F72A 3V7RA 2W84A 5IOYA 1IJWC 1XMAA 1FSEA 1JE8A 3HRUA 3HOZJ 3K10A 2NOJB 5L3DA 1BI2A 1UG2A 4P1WA 4BJ6C 1WPKA 1A04A 1UZCA 2DI3A 3EUKL 1VQ5I 2HPIA 4BXXJ 2RAEA 2XRNA 3HOVJ 1W5TA 1QBJA 3EETA 1GXPA 1LQ1A 3VEPA 5GADJ 5AONA 3GFLA 3OWTA 1R49A 2ZFUA 5BPIA 1QVTA 3FX3A 3LFUA 4W1UA 1IN8A 1RR8C 4HF1A 4WXDA 3BG5A 4L5IA 1W4MA 1T95A 4ZZLA 1KU3A 1O7FA 3L7WA 2VIXA 2BVLA 2XGDA 5J1YA 2JSPA 2DT7B 2I5UA 4HA8A 1FYLA 3S2WA 2YS9A 4BXUA 2LKSA 1OKRA 3A2KA 2HVRA 1JKRC 4GYIA 1TWFJ 1LPQA 3BR5A 3HIFA 1O3RA 3M8JA 1QZEA 2HOTA 3DV8A 3VFZA 3IH3A 1U5TC 2ZJRF 1ETXA 1MH4A 2KT0A 3RJPA 4I98B 3UNGC 1B1BA 3H1CA 1V5FA 4LD5A 3ZMSA 4UY8I 1BOBA 2HGCA 1SD6A 4A2UA 1D5YA 5TJJA 3BZ6A 1XSXA 4PZJA 4NHJA 4HOBA 2VKEA 3V8KA 3BDDA 4BAYA 4EMSA 2XC7A 5D5VB 4ENMA 2ACJA 1XN7A 3I9V2 2FJ1A 2L5QA 1JKQC 3HYIA 2ID6A 4DZPA 3ZGKA 4U0YA 3BJAA 4UHTA 1DU0A 1JUPA 1OCTC 4S04A 1TQMA 2EZLA 1VQMI 2VJJA 1G2HA 1RUOA 1TWCJ 4GYGA 2R7QA 5A2QK 1HKTA 1OR7C 2IGKA 2D5VA 3FXLA 4LB5A 3WG9A 2M1BA 1MNEA 4LG0B 3PFIA 1BW6A 4ZTFA 1VQKI 4A3GJ 3I58A 2W82A 1D8JA 2G0EA 3HKZA 3OYNA 3IH4A 5ERIA 2W7NA 1R71A 5E79C 3CTAA 5C3EJ 3OYIA 3S15J 1O57A 3BG3A 2K86A 3GEZA 4ANJA 4V2FA 5HOOA 1IUYA 2F5FA 2NVTJ 3JRBA 1ZRCA 4Q5SF 1I39A 1OCPA 1MW7A 1ORKA 4EQQA 2XASA 4BE1A 2VQCA 3KP7A 5BNGA 2DPDA 1R5ID 5E1ZB 4HEA2 3LA3A 2Q0OA 2GIVA 3D1NI 4KYWA 3BTCA 3K4LA 4RAGA 2E1MB 1R9TJ 2Z99A 3OS1A 1X1DA 2COMA 4A93J 3J81Z 1OCRH 1SANA 4LLNA 2EB7A 3RI4A 2ZMEA 1LUJB 4AVPA 2M2EA 4WCGA 4BXFA 5LGNA 3BG6A 1HBXG 1F5TA 2X1CA 3L2WA 1ZH5A 3H35A 2DFIA 2FF4A 5ICGA 2ZJPF 2NS7A 2NOGA 2EFNA 1I1GA 4HX8A 2JRTA 4PSXA 2JPCA 2E1MC 3FMRA 5FRNA 3JSPA 2XPWA 1XGSA 3GLXA 4HAMA 1OYWA 2ADUA 5DYMA 5FFZA 3X2QH 1D1AA 1LEAA 3QPSA 4QSHA 4BY1J 3K0LA 3V8JA 2AS5F 2TRTA 5LEJA 2WAQN 4IRGA 2EQRA 4KIFA 2BXYA 1RC9A 1FOKA 4RGUA 2VPRA 2Q2EB 2DA4A 1BIAA 5C4JJ 2KFDA 1WKMA 2DMPA 3V7CA 2ICWG 3WU2C 1Y1WJ 4HPQA 4HSRA 4S05A 3UKGA 2ID3A 3OOPA 3H92A 2M4GA 3NWSA 4HNVA 2R93J 4XLPF 2IS4A 2VJ5A 3H0GJ 2M45A 3G6EI 2E1NA 3FF5A 3F8BA 2BOLA 3D0SA 1UCRA 3H9GA 1T33A 1HDPA 1TNSA 3ERMA 1XMXA 3TDZC 2CU7A 1SAUA 2GA2A 3BCBA 4IOAF 3KP6A 3LSRA 2HNHA 4V2GA 1T0FC 3GMEA 4IHSA 4M9ZA 2Y75A 4FQGA 1EV7A 2LMDA 3DCFA 2MA3A 2NS0A 3GO5A 3I53A 4Y3OA 1GVDA 3TMOA 2HWVA 4ZYGA 2LBFA 5FJ8J 3OS0A 1TL8A 3LA7A 3R4KA 4Q4ZF 3PQKA 4HZFA 4CZCA 3AKZA 1FYMA 3IV5A 4XONA 1KGSA 3ZN1A 5FLXK 2QYOA 4XNFA 2OZUA 1SMYF 5H2FC 5M5YJ 3Q0UA 3C3WA 2FE3A 1S7EA 3F6VA 1H89C 1YW8A 2VC0A 1P9QC 2E35A 3KYLA 2ZNZA 1YS6A 1DGWY 3ABKH 3E97A 3HPGA 3C1DA 2Z5UA 2PMUA 1ZG3A 1K83J 3F9KA 1R22A 3RQIA 3VB2A 1Z77A 2N8GA 4C2UA 1WCMJ 4DYQA 2UV1A 3BPXA 3BTJA 2UUZA 3RYPA 3OYFA 3ZCOA 2AXTC 1F4KA 3ZMVA 3QODA 3RZOJ 5M5WJ 2BW3A 3T1BA 3IP4B 3NARA 3LFKA 1PDNC 4A3FJ 5EDNA 2E60A 3R6SA 2M7BA 2YR2A 2LY2A 3TO7A 4E7JA 2L9RA 4XSZF 3RIRA 1WI9A 1AU7A 4IHYA 1KQ0A 2V1UA 3EDPA 4RAZA 1ZLKA 1OCZH 3LQRA 3K4CA 3VSLA 2IP2A 4W97A 2QQ8A 5DCMB 4AIJA 1R4NB 3V4GA 3JR9A 1B72B 1W1WE 1RPWA 2HI3A 3V42A 3ABTA 1HKQA 2LR8A 4ZC3A 2VUMJ 2IGOA 2YPRA 2DCEA 3SFZA 2H27A 4AD9A 4II2A 4UUVA 4HNTA 1YE9A 2STWA 1MMDA 2LG4A 2CO5A 1U5TA 1DDNA 1HLVA 3PO3J 4Y17A 1D1CA 4Y52J 1HDDC 1KA8A 2L0KA 4Q48A 2E19A 3JW4A 4OAZA 3MKYB 2PQ8A 2PX9A 5F04A 2F4MB 3OV8A 3FMQA 4ZDLA 3T0YA 1UHWA 2Z9OA 1GUUA 2R3SA 3SJMA 4PSWA 4X6AJ 1TT0A 2XHKA 1ZR4A 2M87A 3REOA 4AU7A 2A3SA 1CF7B 3AFHA 4XRMA 4EM1A 3ZMZA 1I3QJ 2MD0A 3L9FA 5C4XJ 4F55A 1ETOA 2QSGX 2MC3A 4BACA 2RVCA 1OR7A 4AYBA 4EJUA 2GOXB 4A0ZA 2ZJQF 3K70C 2VC1A 1NG6A 1LDJA 1A31A 1RR7A 3PUBA 1BW5A 3CCSI 5BMZA 2H8WA 3PQJA 3KLNA 3HB9A 4UVBA 4NC8A 1V4RA 4MQ9F 2O03A 2E34A 2JN6A 3DTIA 2NVUB 2CJJA 2H6BA 5FKOA 2X6YA 2EV0A 3MAJA 2WAFA 2XAUA 5F0FA 3M07A 4Z2YA 2XF5A 2AQFA 5L3GA 3IAM2 1H0MA 4HF2A 3DTKA 4XKWA 1IC8A 1IV8A 5DM7F 2PMZA 4P96A 2DA7A 2LP0A 1U78A 1XCBA 2XGXA 3ZQHA 3CD6I 4L9TA 2QLZA 1EF4A 3GTKJ 4KMUX 2CW0F 4LFUA 3BROA 2DXIA 3CP8A 2O7OA 1DPRA 1QA6A 2K9MA 2WWYA 2DYRH 5CLSA 3WGHA 2HR3A 3GTMJ 5GAEJ 2EH3A 2KKOA 4LLLA 1HC8A 1J59A 2P8TA 1B9MA 2JUGA 4R8HA 3WTTC 3BPVA 3HZJA 2TCTA 2TDXA 5D5XB 5JVGF 1R5GA 3DBRB 5IT9Z 4ETSA 1N78A 3B6AA 3PUFA 1DQUA 5HLTA 2B9SA 1JT0A 2A6TA 1TZLA 2R7DA 2X4HA 2MG4A 5E3LA 1XSDA 4BNCA 2Z2SB 5K1YA 4H4KC 3DF8A 3M3YJ 3S2DJ 3TOAA 3M1CA 1FX7A 1ULYA 2NAZA 3KEYA 4FT8A 2Q8KA 1A35A 2VQLA 5D6EA 4OIRF 2R5YB 2CV0A 4Z6YA 3PNTA 3JSOA 2HDDA 2Z16A 1YO5C 1WJDA 5BQTA 2R0QC 1ZELA 1QPMA 2LKPA 2V1NA 3HHHA 3GVAA 1HW5A 1BOAA 3AAFA 2HU9A 2KISA 3HUGB 4TV7A 4KNYA 3C18A 3VDXA 3NAUA 3BLYA 4QIWN 3EYIA 4F93B 1AOYA 1S7AA 1MKMA 3DEEA 3DEWA 4M74A 4HSTA 3BC8A 1BJAA 3BR3A 5ILSA 1VQ7I 2ZXIA 2BEOA 3GTLJ 2Q2EA 1IDYA 2JA6J 2CUZA 4M6YA 4IVNA 1V3FA 1Q1HA 3CCYA 4BHCA 5GTIC 1T0FA 3KP3A 3SEZA 4ZZDA 2LFBA 2KZVA 3G2BA 3HPHA 4BQAA 1BR2A 3MEXA 3WTSC 4BL0B 1AKHB 1XMKA 5JLXA 3L1PA 2LD5A 4FISA 2DFHA 2PMHA 4KIBA 2HYJA 4OMZA 1R4MB 4ESFA 4BYYA 1X4PA 2A6HF 1NH3A 2ZMEB 4QWQA 5TGTA 2M7AA 4BHBA 2F5VA 3OMYA 5DV5A 3BY6A 3RKWA 3ZMTA 2OBPA 1ETYA 3CCJI 2M4KA 5EZGA 2JPBA 3HDDA 1FJLA 2L3DA 2FXAA 4U87A 3K70D 4FETA 2HQNA 2XGCA 2MABA 2KRCA 4XQFA 2HDWA 5FKNA 3TP3A 3FM5A 2JUCA 2DA5A 3I64A 3Q0VA 3UR3C 1Y8RB 1BI0A 1O4XA 1GDTA 2M0MA 3F8FA 2ZMEC 4MEXF 4CCMA 3ECOA 3WODF 5TISC 4XRFA 2K9SA 4JX5A 4BUPA 5LGTA 3IWZA 3KPHA 3DTEA 1TWHJ 2KDOA 2DYSH 3RSNA 1FBQA 3VODA 5D5UB 4HX4A 2LF7A 2GOMA 3NEUA 4OIOF 2M34A 3KYCB 2BE5F 4KFCA 3F8CA 5J1UA 2PJRB 1IN4A 2DFFA 1YFHA 4LLGF 4A6EA 3OY9A 2WBMA 4M3BA 2HDCA 4P9UA 1TQPA 2G9WA 1WZ2A 2OJED 1F36A 3D5SC 2KHMA 1Z7UA 2L02A 2OQRA 5CJ9A 3WG7H 1BI1A 3W2WA 3K1PA 1Z0XA 1P7JA 3COAC 3BR1A 5H6QA 3HBLA 3H9JA 2K4JA 1A36A 3G1OA 2F5DA 3D5RC 2Q1ZB 4OINF 4HQEA 5KAIC 3LWFA 5HS8A 3E6MA 5H20A 2DK5A 5E1WA 1N77A 3KYDB 4QPOA 4C3IJ 1TW3A 1MIJA 1DUXC 2ZSIB 3QOEA 4BY7J 4IHVA 1O3QA 1LVKA 4XOPA 1FOYA 2IBDA 4MFDA 5EG0A 5EEHA 4GRIA 2JVGA 2P81A 4X1EA 5M3FJ 2DDBA 2LBFB 5D4RA 1JT6A 4CO8A 4A0XA 3CMYA 1V5GA 1KU2A 1JHHA 1UELB 3MN2A 2IA1A 4ZYDA 1T39A 3T5XA 4IPAA 1IXRC 4GO1A 3OOUA 4Y33A 4A12A 2W25A 1MBEA 4HRIA 2ZSHB 3IC7A 4CZZA 2FNAA 4LIUA 1BL0A 4RM2A 5F08A 1QVUA 3GZ5A 4IZZA 4FHTA 4RB1A 3HEFA 1MBGA 2A69F 2R7FA 4Y15A 5LD2C 1ETVA 2B0LA 2HOEA 1TC3C 1FYKA 1T56A 4C3HJ 5DUKA 3I54A 5TRDA 3CF2A 3A0BC 5J8FA 3CQZJ 1G8XA 3I4MJ 3TKYA 4KMFA 1G3YA 1Y39A 4B09A 3S1QJ 4L18B 1J9IA 1XD7A 2QQAA 1Y0NA 1JHFA 4HG2A 1QHHD 5F6FA 2FBIA 4XRSG 1Y1VJ 2ZB9A 1X2NA 2LRDA 3TO6A 2BW3B 4JK1X 1CF7A 2MD5A 1ZAOA 2O0YA 3C2GA 1K7AA 1JKOC 1ZK8A 5FGMA 3VYSB 4DYCA 5J8CA 3WU1B 2KRFA 2BVMA 1SFXA 2F5EA 5CQEA 1LB2A 1SFUA 3HRMA 1XG1A 4I6ZA 1XTAA 1Z6RA 4XM3A 1FNNA 4I01A 2E2IJ 3DFGA 4YEJA 3U21A 1P2FA 2V9KA 3MVPA 1U9OA 3HSRA 3W6JB 2UZKA 3A02A 1B9NA 1JTXA 4C9YA 1MMNA 1JXSA 1YQAA 1JUSA 3ZQLA 1QZZA 4M73A 2VKHA 2JQ7A 5ICCA 5F0HA 4NBQA 5E1XA 4G94A 3GTGJ 1U5TB 4PJJA 1XCVA 1UFMA 3WTXC 1PUFB 1BA5A 5LGUA 2XVCA 2M9HA 4CHUA 2JA7J 2LNBA 3TW6A 2ESHA 4KIGA 4XLEA 4X0GA 4MQVA 5D4SA 1MMSA 4ZDPA 3L2CA 2H8RA 1FZPB 3LAJA 1Y0UA 3QAHA 2O5RA 3MFKA 3L00A 1SVMA 3M7GA 1Z1DA 3S3NA 2IS6A 2FUG2 2VBXA 4MTDA 4E7HA 5HS9A 2P6TA 2B63J 1UMQA 4PJNA 2OC6A 4G6TB 1QZYA 1QO0D 2FQ4A 2EFQA 3A03A 1D8KA 4WWCA 1FOXA 3HSFA 2JMWA 4DJAA 3ZXSA 2DMTA 3HGYA 3ABMH 2Y48A 2D1HA 4I99C 2ME6A 4EEFG 1TP4A 2P0WA 2MLGA 4NC6A 4U0VA 3OYHA 1IF1A 1NHAA 2Y0MA 3ZN0A 1APLC 5FFXA 3HTSB 1U0JA 2LKXA 2F2EA 2XPVA 4N4OB 4IQJA 2BBYA 3JRFA 2R5YA 1E3HA 1NTCA 3QQAA 1SAXA 4B48A 3IHUA 4PGHA 3TOBA 4EJWA 2HKOA 1Z3XA 4E70A 1UG0A 2QF7A 3RKYA 4IHWA 3E0JB 3OYEA 5LHHA 4XBFA 4NDLA 3KP5A 3LQQA 3MD2A 3JTHA 4IRIA 2ECCA 2IRFG 2ZKZA 3FIWA 3HUGA 5HVQC 2BHYA 2ZJ2A 3OS2A 2DOFA 2ZBKA 1ZG1A 3P9IA 5HLHA 4IO9F 1I50J 2XSJC 3QWLA 4P9FA 3DKXA 2W85A 3AG2H 1LE8B 2R7TA 4BKXA 1HQCA 2E1OA 2OD5A 5J47A 2V7FA 2QKMB 3FKIJ 3LSHA 5JHUA 3J7AY 4BDYA 3MKZA 4WF2A 4HBLA 4RAYA 2JTVA 4LK0F 2VOPA 1IRFA 3FHNA 1AKHA 2FBKA 2VLAA 2P5KA 3O8GA 4NQWB 1Y56A 3BZKA 1LNWA 3O3KA 2L7KA 4DBQA 2RGVA 1YX3A 3SZPA 1V55H 2L9NA 3H36A 1MBJA 2EA4A 3QYFA 1ETWA 1H9TA 4U7DA 2IAIA 2LSOA 3GFMA 3FXUA 4IQ4A 1ON1A 1LFPA 2K9NA 1LEBA 3ZMUA 2XKOA 3A4CA 3QYBA 4CSWA 1BN5A 4YFNF 4EVIA 4YFKF 3GTQJ 1IUFA 4RS8A 5DDGA 5DEQA 1IN7A 4KICA 5J4VA 2K27A 1LFUP 1GXQA 5E3OA 4CH7A 2FX0A 3F6OA 3FK6A 2KPMA 3ZMDA 3K9TA 1MJAA 1FOWA 2DMNA 1B6AA 2VQHA 4DGWB 4D5CA 1D3YA 4IX7A 2IGMA 3FMSA 1YRNA 1VQNI 2H94A 4G6QA 2KJCA 2NRAC 2PJRA 5K5OA 5B1AH 4IOCF 1I27A 1MBFA 2VL8A 2VXZA 3B02A 3P9KA 1ZLJA 3OIOA 3GFIA 2X6OA 3R0JA 1LDKB 1WHUA 2ZFWA 5J40A 4V19K 2IPQX 4B4CA 4RM3A 4XK4A 3CO7C 1JGSA 1TBXA 2ZC2A 1MNDA 1N75A 1R1UA 1TWGJ 5K5RA 2NVYJ 3GFJA 3OIPA 3GBGA 1OJLA 4E7LA 1T08B 2GXAA 1ZKGA 3C7JA 1JUMA 3KEOA 2FMLA 2X1EA 4E7SA 1HW2A 3TW7A 4IRHA 2L01A 3WTUC 1SFEA 2DT6A 2C6YA 2L9VA 1FIAA 3ROUA 3DU6A 2QQ9A 2RKHA 5FKMA 1G3TA 2W4SA 3FDYA 2KMUA 3R61A 1UHMA 1MJ9A 4ASNA 4PK4A 5E18F 1U9NA 5CYVA 1ZGWA 1P92A 3VOEA 4B3XA 2Y30A 2DMQA 5IYCJ 2DTZA 2KLOA 3AG3H 3ZQFA 3KP2A 1XDUA 4KDPA 4EGZA 3QOPA 5IPAA 4AIDA 1YIJI 5FLVA 2HZTA 1R1VA 2CFOA 3FBIB 2GM4A 4OIPF 4CCLA 1B4AA 1SVLA 5DS9A 4WX9A 1P7IA 2RN7A 3Q5FA 2GXGA 1RKWA 2E71A 5KHDA 4L9VA 3JRIA 5ILUA 2PG4A 2DK8A 4NB5A 5EYRA 4R79A 2CG4A 1FWZA 3ZQQA 2YUSA 3BCAA 3BR6A 1D0XA 2AO9A 3U1KA 3IKVA 1A6QA 2PFBA 2CW8A 2BZTA 5M5XJ 2DBBA 2DDAA 3TL4X 2FD5A 3F0CA 2DODA 5D5WB 2GA1A 4LMYA 3HKZN 2X9DA 1E3OC 1EKEA 1ON2A 3CJTB 5HDNA 3CC2I 2L7MP 4XKBA 2CS3A 1SC7A 1B8IB 2V6EA 2EBIA 2JJ7A 5EG0B 1Z3YA 3DBHB 4AIKA 4FCYA 3RQ4A 3CF5F 1HSJA 3ZP5A 1HA8A 1Z91A 2R7OA 3JAMZ 4M72A 3KZYA 3GWZA 4HQMA 4MEYF 1MJBA 2K9QA 2WB1A 3EUHC 3FHZA 3OL4A 2RQPA 4N0BA 1XGMA 4PGGA 4QLCU 3OYAA 3OYMA 3E5XA 1VQLI 4CA0A 1KQ9A 3SHFA 1Z9CA 4HYEA 3NRVA 4UV9A 3BT9A 3GZNB 3KIOA 2M0CA 1FEXA 1MBKA 2BY0A 4G7HF 4EJOA 5E3MA 2KL4A 2P7VB 3GX4X 2VB6A 1PUFA 3IKTA 1AWCA 4ZDOA 2A07F 4EM0B 5IP9J 5KAFC 4RB3C 3ZQIA 2LYCA 2XF7A 4CCJA 2ISZA 2O3FA 3G3ZA 3GTJJ 1BI3A 4EGYA 3IUOA 1SD7A 2NXNB 4ZH4F 1U8RA 1EA3A 5GP9A 3QU6A 5JLWA 2R5ZB 4M3EA 3CCVI 4H0EA 1FBSA 4PUSA 1K4TA 4M6VA 3ABLH 2A05A 3GZ6A 2R7SA 1ITYA 3FWEA 3QPLA 2PEXA 3QYEA 2STTA 1E17A 4HLXA 5K7FA 4A3KJ 2HQ5A 2B7EA 4A3BJ 3CZ6A 2HOAA 2MFZA 3IWFA 1MMAA 1ZN2A 4ZTJA 3OL3A 4L9NA 4F92B 2IS2A 1L0OC 4B43A 1QPIA 3CCQI 2OTLI 3KEQA 4A3JJ 2FMYA 2V1XA 1WI3A 2OPTA 1BC7C 4P5OA 3WTVC 1XB4A 2M8EA 2VBZA 4JX4A 3ABUA 1QQIA 4O6JA 1JI8A 2CQNA 1SFKA 1VTNC 4I2OA 1PP8F 3DP7A 1U6GA 3W6KB 2RV8A 3FM3A 3GW2A 1KYWA 2M30A 2WTEA 2WY7Q 3LAPA 1RESA 1YTYA 1TWAJ 4YIFA 1R5HA 5F1JA 1B59A 4OAYA 4HDVA 4F91B 3J80Z 2EZIA 2FQ3A 1MD0A 1Q1VA 4HF0A 4IF4A 3K4KA 4DQ2A 3BTLA 1TW2A 2P4WA 1IO2A 5LFAA 5EGOB 3WE2A 1N25A 2HOSA 3IAS2 4G9YA 4LG3A 5LHIA 3U9GA 3NWTA 2JA2A 3FISA 3F8NA 4A0YA 2FOWA 4MLOA 3PJRA 4CCKA 2GQQA 1WJ5A 3TBIA 1JKPC 1LE8A 1VNDA 3Q0WA 5B66C 1SD4A 3RKQA 4EJVA 4RB0A 2HQAA 3EQLF 3CO6C 1OCOH 1ENHA 2DA3A 3O2PE 2Z3YA 3BG9A 4BH9A 2XAFA 2GAUA 2X51A 5F1RA 2KIFA 2R92J 1HOMA 2CQXA 1RI7A 5IOZA 4XOTA 2L7ZA 4M9SA 3CMMA 3GXOA 3WGGA 4MHGA 2BY3A 2E7XA 3S1MJ 1S7OA 2EV5A 2L7FP 3LSIA 1E2XA 4NQWA 3WTZA 1K78A 2H09A 2NYXA 3CLQA 2XPUA 4UNOA 1PJRA 1J7KA 2ZCWA 2JT1A 4YG2F 5D8KB 1MDMB 4KUMA 4A3MJ 4BE2A 1BJZA 2ETHA 4PFPA 3ZQCA 3VPRA 1QGPA 3FK7A 4BJTA 1CGPA 2WY8Q 1P4WA 1R00A 2JRMA 3HG9A 5E8GA 1FP2A 4JYKA 4BQQA 1YJNI 5J3LA 1IRZA 1ZTRA 2L9SA 1L3LA 1VZ0A 1ZREA 1PUEE 6PAXA 4PJLA 1WSUA 1OISA 4BBSJ 3DLLF 1X3WB 2VKDA 1LDDA 4YRVA 2DJIA 2K4BA 3Q9VA 5GTHC 4PDKA 1O7LA 1OLTA 3K7AJ 2Y0SA 3E1SA 4EATA 3F22A 1BC8C 1ACIA 2J5PA 4BEHB 3L2QA 4U0WA 2WV1A 3DKYA 3RKXA 3N05A 2CV2A 3LNQA 1T38A 2HKXA 2L2OA 2CUFA 1J0RA 3I5UA 4E6KG 3E5UA 4XIDA 1H88C 4I02A 2QVOA 5JFRA 1G6NA 2ZXWH 1HW1A 1NG7A 3I59A 3SXYA 4A3IJ 4CXFA 1CQTA 2AQEA 2P5LC 5LBQA 3HL2A 4LITA 3K2AA 5CVUA 2QGUA 1OQYA 2MC4A 5HS7A 3ZPLA 4KN4X 4D9JA 1AHDP 3ESWB 1J5YA 5EJCA 4PJ0C 4L0YB 4YIRX 3RZDJ 1YITI 3S16J 3LMMA 3MKWB 2EPFA 2Z1DA 5DCFA 5HNHA 2IJLA 4KA4A 4M3GA 3U1DA 3K6GA 5FD5A 1LJ9A 3L2VA 2ZXHA 1T98A 2YU9J 4XSXF 2H6CA 5KK1A 1KONA 1ZARA 1VI0A 4MNUA 4WXCA 1E3PA 2DPUA 3HM5A 2O8KA 3CJNA 4M6XA 5L3CA 3O6BB 1ZYRF 3KCCA 1RRJA 3GTOJ 5EZHA 2QQBA 1MNMC 2FOKA 2KIMA 2ZXJA 1YRNB 3H3ZA 2VT2A 4B47A 3RTRA 5A2QZ 3CJRB 1OPCA 4RGSA 1VQ8I 1I6HJ 2O6GE 2HS5A 2V9VA 4FE7A 4ITVA 4J19A 3OSGA 1GT0C 3S14J 2E7WA 1P4AA 2MW8A 4XR6A 3DWLE 1X3UA 3FXMA 4RB2C 3JRDA 3LL7A 3SEQA 3I4PA 4I76A 3RPUA 1XGNA 2KZGA 2FBHA 2VBWA 4IXAA 1T2KA 3H3UA 2PMZN 2DJNA 3VYUB 1WQ2A 2V6CA 3DPLC 4JBAA 1SFOJ 3EUHA 3J7YJ 2VBYA 2QKLB 4DYRA 3CUQC 1D5VA 2BY1A 4G7OF 5GPAA 5JR3A 3WE3A 2ECBA 3GLLA 4BJ5C 3RYRA 2QEXI 1B8IA 2CH0A 3OYGA 1IW7F 1GVJA 1HF0A 2CWEA 2X85A 2DTRA 4ZYHA 3EYYA 3G71I 2NS8A 4EV0A 4D7MA 1TNTA 2P5VA 2RNGA 3FXKA 3ONQA 4C30A 4C3JJ 4AUXA 4ZJZA 1BR4A 4GXOA 3F23A 5D8LB 3JRHA 1IV6A 2W24A 2LY9A 2CRGA 4HLYA 3HHGA 1BBYA 2R7VA 1XSVA 2V9PA 2DOEA 1ETQA 1USTA 3CMEI 1ZR2A 4OOIA 1YHQI 3ELKA 1I6XA 1V5EA 1VQ9I 4OWRB 3HOWJ 4K2EA 3EUAA 3I3LA 4A3DJ 5DUIA 1REPC 5B1BH 1R7JA 3RCOA 2JWTA 1BIBA 1FMVA 2LOOA 3QP6A 4NNJA 1W36C 4FX4A 3K4BA 5FKKA 1U8BA 1GV2A 3VSKA 2F5CA 3JRGA 3G4SI 2R5ZA 4MO7A 5E8IA 3MZ8A 5EEGA 3BQYA 4QTRA 4UUTA 1R1TA 2LK2A 3FZVA 1ZQ3P 3SDGA 4HNUA 3MQ0A 1F9NA 2WAEA 4M3FA 2XDVA 3MMYB 3HRSA 1FSHA 3AG1H 4KT5C 3E3VA 2EIMH 2W1OA 1PP7U 2COBA 3Q9SA 1WVRA 4B3AA 2HXOA 5AIQA 3GF2A 2XRLA 5FROA 1USSA 2LY1A 4D7NA 5JHFA 2E2JJ 4S0HB 3ZQGA 4GCVA 3H3VK 2VASA 2OAZA 1YOVB 1YLFA 3CCRI 3S17J 4KT6A 3GTPJ 2DAOA 3ZR8X 2OZ6A 1JTYA 3N4MA 1DGRM 5FRMA 1PYVA 2XB0X 4IL6C 2UXXA 2WAQA 2QWWA 2VI6A 5LHGA 4UVAA 1GV5A 4OMYA 2GLOA 1IRGA 5IP6A 3G73A 2F48A 2LDUA 3LSJA 4MGRA 5E20A 1W5CC 2P7CB 5EGOA 1YJ9I 2EWNA 5FLXZ 2WC2A 5F0CA 4LB6B 4L9JA 1MSFC 4L0ZB 1I3AA 1DP7P 2VXDA 1TT5B 3FXJA 3WHCA 5BOXA 1D0YA 1YX5A 4NUBA 3BJOA 2JA8J 2ISYA 1WJCA 4U7BA 3P7NA 1K6YA 2XKPA 3WTWC 3E7LA 5LRSA 3EPZA 9ANTA 1EH8A 4DOZA 2DW4A 4BE0A 3U2RA 2IVMA 3GUDA 2LH9A 3DU5A 1S8NA 3DXJF 3DBLB 2HXIA 3BOQA 2X48A 2R4GA 1FTTA 1VQPI 3S1NJ 3M4OJ 4I09A 4O3MA 2MSYA 2KP6A 2QZ8A 4A5NA 2XV4S 3WGIA 4JX6A 2HTJA 3W3CA 1U2WA 2RNJA 2V4JC 5E17F 1MH3A 1H9GA 2DA6A 1MDMA 2HFHA 3M1EA 2PI0A 2K3FA 1LVAA 2E5ZA 1X19A 3BZCA 2LTPA 2CSOA 3CJQB 2DQRA 2DA1A 1OYIA 2UXNA 3CDIA 3LSGA 4I0BA 3V8LA 4XMYA 3N97A 2LREA 4EM2A 1RIOH 4LOCA 2CQ7A 2CFXA 2MLKA 1X3ZB 3HRTA 2WA0A 3H5NA 3H5RA 2IGNA 5LLQA 2BXZA 3PL8A 4CCOA 3QPHA 4HV6A 1W36D 2M5WA 2KJBA 2A5YB 1YYVA 1P6RA 2L4MA 4RBOA 3OYKA 4BEHA 4LIVA 1Z6TA 5IP7J 3DEUA 2EZKA 3HOXJ 3G1MA 3MZYA 3P5JA 2K40A 4E7IA 3HXLA 2MYSA 4XN0A 1K78B 1IXSB 5HNFA 4UUSB 2J5OA 1VFCA 3LSTA 2W48A 5IT3A 3K4JA 3L09A 3A01A 4AC0A 3K1MA 1W7PB 2EK5A 1VF9A 4GGGA 2FNPA 2PLYA 1IG7A 1JJ8C 1EH7A 2X1DA 4AVZA 1WFXA 2XUBA 5B3SH 4MTEA 2K9LA 2OV7A 3F21A 2QBYB 1TLHB 2IA0A 3S32A 2OUMA 5C44J 5DD8A 3R60A 1V54H 1IDZA 5DM6F 1QRYA 2OU2A 2VT3A 2KIQA 3E6CC 3B73A 4DW6A 4ESBA 3CCEI 2HTSA 5E3NA 2VODA 2AHQA 1VQOI 4N4NB 2Y2ZA 3LSKA 1OYYA 3SYTA 4IKFA 2BY2A 2JK3A 5LEKA 5HODA 3PNVA 2FRHA 4LK1F 2DA2A 2DOAA 3LSMA 4P55A 2D2WA 3QRFF 4UXNA 4CCNA 4BDZA 5J4YA 3S1RJ 3CUQA 3KZIC 3W2VA 4N9IA 1G3SA 4JOMA 1XS9A 3QPTA 2KQRA 1SD5A 2CQKA 4BGDA 4KITB 3I59B 1WGXA 2VQGA 4RGRA 4EJTA 1T8IA 1QHGA 3WU0A 4CYDA 2XROA 4RDUA 2EINH 4II3A 4G8XA 4L5EA 3RPQA 2BHZA 3PM1A 3I56I 3MZHA 2IA2A 2FSWA 4J01A 2PBIA 3I55I 3OIQA 1DP3A 3F3XA 2HZDA 2I10A 2OA4A 2YX7A 2OCCH 5IY5H 4ENKA 3PNYA 1IAWA 2IEKA 4BQNA 1O3TA 5CKTA 4ZYAA 3JREA 2G7HA 3E5QA 2M8GX 1ZGJA 1IN6A 4YELA 4CYCB 2WADA 3S2HJ 3DPTA 4XLHA 4M71A 4C2MJ 4MFEA 2HVSA 1WJAA 2R7RA 1UJ8A 1QU3A 4XKVA 1VQ6I 3TDUC 3H0DA 3S93A 2EZHA 5J1RA 1FMWA 1MBHA 1Z67A 2ZNYA 1Z7LA 1IRXA 4A69C 1XC5A 2EJRA 3FXQA 1WRJA 2DU9A 4RAFA 2ELHA 2ME0A 2FEZA 2G7UA 4HX7A 3FKJA 2HYGD 1X58A 4XLNF 5FD6A 1TQIA 1F43A 2DO7A 3SFIA 2LLKA 2R7WA 4XLFA 4CDGA 3I71A 2GWRA 1IN5A 5DTDA 1Z05A 2KDZA 5GAHJ 2VE8A 3HTUA 2Z33A 3CC4I 1UB9A 3A1YA 3M8FA 3DKWA 5FKLA 3TGNA 4XRSA 3E6DA 2QA4I 4IJAA 2V1DA 4KISA 3IRRA 1U3EM 3PSIA 1IGNA 5JI6A 1BM9A 3D5LA 4UV8A 2M3AA 3SDBA 3ASOH 5IYDJ 2KRHA 3NQOA 2H1LA 2EIKH 4HW0A 5EF6A 3OYLA 1JJ6C 1ONVA 4BQOA 3TEDA 2HPMA 3H9QA 5KNLA 2NVXJ 1WJEA 1FLIA 1VQ4I 4G6DA 1FY7A 3DPUA 1W5SA 5BS6A 2XAHA 2VE9A 3JRAA 2QENA 3KE2A 1K79A 4OIQF 1D0ZA 5CPRB 2CW7A 1MMGA 5EEAA 3BQZA 5LRRA 2X6WA 2ELKA 4A3CJ 5D6FA 4YFXF 4RA2A 4XL9A 3BJ6A 5L3EA 4HV5A 5J6XA 4M3DA 1W7PD 3KETA 3O8HA 1X1BA 3HOTA 2D1VA 4NC7A 4FASD 2XSDC 3VYTB 2D45A 4I0AA 5ICFA 1J75A 4OU0A 3HSEA 2PN6A 1X4OA 3L2RA 2W57A 2OQGA 3DLAA 1S3JA 4QPQA 3P9CA 4G12A 2A6EF 4BBRJ 4KJZA 2CYYA 3CP2A 1G4DA 3WTYC 1C0WA 3CESA 2AXLA 2HQRA 2HYFA 1FTZA 2NNYA 3GYHX 3ZQ7A 3FXRA 1PVEA 1FBUA 1LFBA 4DZJA 2JZYA 3J81K 1MGTA 2XGEA 1YW7A 3TO9A 4N9HA 2L54A 3WHBA 1OFCX 2EILH 3FBNB 3SZTA 1Y6IA 3F8MA 3K4MA 1RKTA 3BR0A 5F27A 3BR2A 3KX2A 3OR1C 3BTIA 3M9AA 1YI2I 1G59A 1WH7A 1G3WA 5CVVA 2I8DA 2LVSA 1H8AC 4C2TA 2XB5A 1X1CA 2XIGA 3C2HA 1RZ4A 3PIOF 4RMNA 2GBYA 4UVCA 2A5WA 3HOUJ 1OMIA 2KIUA 4CUGA 1S9HA 5DD4A 4BU2A 1O3SA 1FT9A 1ZRDA 2IT0A 3K2ZA 1Y8QB 4F3QA 1XX5A 2X6XA 3CDLA 4FE4A 3K1NA 3ML6A 4UB8C 2CUJA 3SZGA 5B5EC 2K5CA 2MH2A 2V26A 2O61A 3A0HC 4LG0A 2BGCA 2QM3A 2ELJA 1X1AA 4XLAA 2Y69H 2PJPA 5K5QA 4A5MA 4UB6C 3QU3A 2RQQA 1KU9A 5CVRA 2Y9ZA 4F7ZA 4A6DA 2IS1A 1SEUA 4J00A 1POGA 2XAQA 3T8TA 4UUSA 2K02A 1KU7A 2DFEA 4ON0A 3RPUD 3OSFA 3OYJA 2GZWA 2LC2A 3HOSA 1ZG5A 3I0TA 3CUOA 1W7PA 4B44A 2RC4A 2QUFA 3ZOBA 5H6RA 4ESJA 2LF8A 4Q47A 4E7KA 1LKXA 3K4NA 2W00A 3ASNH 2H1KA 4Y4RA 3I4NJ 2CGPA 1X1PA 2QSFX 3Q3SA 4PJMA 1YJWI 2QBYA 5GAGJ 2QSHX 2GXBA 1FPQA 4WK8F 4B1RA 3H5AA 2A61A 1DPUA 4Y7NJ 2IXSA 4F52A 2NNNA 3HJEA 2XF6A 3JRCA 1S6LA 4D0PA 3V7SA 2WB1N 4PCQA 3MWMA 3W2AA 2VOOA 2O8XA 2ZO4A 5CVIA 3GCMA 1W0TA 4LGWA 3MCZA 3RDIA 2RREA 3JCUC 2VJ4A 3CC7I 4ENJA 4CGZA 1OCCH 1XPXA 1T6SA 4U88A 3R0AA 5F64A 5ICEA 1AA7A 4A3LJ 3FXOA 3CCMI 1M1EB 1ZGAA 3OYCA 4AM3A 1KYZA 4XICA 2A68F 3OYBA 4AWXB 2JSCA 3HOYJ 1BR1A 1SMTA 1WJFA 2BV6A 2DN0A 2RDPA 2YSRA 2F6CA 1I1SA 3A01B 4XORA 1P4XA 4E7ZA 1ZRFA 5L3FA 4DIQA 1IZ1A 1K4SA 2FU4A 4XLCA 2NVQJ 2DT5A 1JGGA 5JVTA 4I7HA 2DQLA 1W0UA 3ULQB 2EIJH 2E36A 3B6CA 1RUNA 3JAMK 1R58A 3G1LA 3LSPA 2CQQA 1J2XA 2R7UA 1MZBA 4M9XA 4O5VA 3LOCA 4D5FA
chains in the Genus database with same CATH topology
2GLOA 1A6IA 1MBFA 1I3QJ 4CYCA 3OIOA 5IP6A 2X6OA 4AYBN 5C4XJ 3LSJA 5EGOA 1ETOA 4B4CA 4XK4A 1MSFC 5F0CA 2CUEA 1TWGJ 2NVYJ 3GBGA 3MKLA 3WHCA 1OJLA 1ZKGA 4IEJA 1JUMA 1HCRA 1RR7A 2JA8J 4ABZA 1BW5A 3TW7A 3E7LA 2O9LA 1NK3P 9ANTA 3HB9A 1FIAA 1WH5A 2MGQA 2JN6A 1MSEC 2CJJA 2R7ZJ 5FKMA 2HXIA 5FKOA 2X48A 5F0FA 1FTTA 1IC8A 3S1NJ 3M4OJ 1U9NA 2MSYA 1ZGWA 2Y30A 2DA7A 2LP0A 2DMQA 5IYBJ 5IYCJ 1U78A 1K61A 3ZQHA 2QCOA 2DTZA 3HGGA 4JX6A 3ZQFA 1EF4A 3GTKJ 3TP0A 2E2HJ 1MH3A 2DA6A 1ETKA 5IPAA 5FLVA 2GM4A 2O7OA 5DS9A 1P7IA 1DU6A 2LTPA 3GTMJ 2EH3A 2JA5J 1RKWA 2VKVA 2DA1A 3JRIA 3LSGA 3PO2J 5EYRA 2TCTA 2YUSA 3C2BA 4FTHA 3BR6A 4LOCA 1NK2P 2AO9A 1RETA 3B6AA 5K7HA 1FIPA 1JT0A 4IHXA 5M5XJ 2MG4A 5E3LA 2FD5A 3F0CA 3HKZN 2X9DA 1E3OC 3M3YJ 3S2DJ 2L7MP 4JP0A 4RBOA 1B8IB 2EBIA 2JJ7A 5EG0B 2R5YB 5IP7J 3HOXJ 2EZKA 3G1MA 1B72A 4FCYA 4MIMA 2HDDA 2K40A 2Y31A 2R0QC 1UHSA 4UUSB 2K9QA 1VFCA 2W48A 3A01A 3IH2A 4AC0A 1VF9A 5K7ZA 1IG7A 5GPCA 3NAUA 1JJ8C 3BT9A 4QIWN 1X2MA 2M0CA 3W6VA 2Y0SN 1MBKA 1FEXA 3DEWA 1A5JA 5E3MA 3BR3A 5FLMJ 2Y9YA 2OF7A 5C44J 1PUFA 3GTLJ 1IDYA 2JA6J 1IDZA 1QRYA 2DMUA 5IP9J 4A3EJ 3ZQIA 3CCYA 4DW6A 4GFBA 5M3MJ 2LFBA 5E3NA 3GTJJ 2AHQA 2Y2ZA 1AKHB 5GP9A 5JLXA 5IOYA 1IJWC 3L1PA 2LD5A 5JLWA 2R5ZB 2JK3A 4FISA 5HODA 3HOZJ 4M3EA 2HYJA 1UG2A 2DA2A 4M6VA 1WPKA 1ITYA 3S1RJ 4BXXJ 2RAEA 3QPLA 3HOVJ 1XS9A 5K7FA 1ETYA 5EZGA 2HQ5A 4A3KJ 4A3BJ 3HDDA 2HOAA 1FJLA 1WGXA 1QVTA 1QPIA 4W1UA 2XGCA 5FKNA 4A3JJ 3TP3A 4RDUA 3BG5A 1WI3A 2DA5A 2OPTA 3Q0VA 4L5EA 3PM1A 1O4XA 4JX4A 1GDTA 2K9SA 4JX5A 2XGDA 5J1YA 2I10A 1TWHJ 2YS9A 1JKRC 2IEKA 1RESA 1TWFJ 2M34A 3BR5A 1TWAJ 2HOTA 3JREA 5F1JA 3IH3A 5J1UA 2M8GX 1ETXA 1MH4A 2KT0A 2EZIA 1Q1VA 4CYCB 3S2HJ 4C2MJ 4M3BA 3BTLA 4MFEA 5EGOB 1F36A 1D5YA 2HOSA 2VKEA 1Z0XA 1P7JA 2EZHA 5J1RA 1MBHA 3BR1A 3HBLA 3FISA 4A69C 1XC5A 3G1OA 4MLOA 2FJ1A 2ME0A 1JKQC 1JKPC 1LE8A 1VNDA 1X58A 3Q0WA 2ID6A 4DZPA 3RKQA 1DU0A 4C3IJ 1JUPA 1F43A 3SFIA 4IHVA 4BY7J 2LLKA 1OCTC 5EG0A 2EZLA 1ENHA 2IBDA 4MFDA 2DA3A 1G2HA 1TWCJ 2P81A 3BG9A 1HOMA 4X1EA 5M3FJ 5DTDA 2R92J 2CQXA 5IOZA 2KDZA 2L7ZA 1JT6A 2D5VA 3S1MJ 2L7FP 5FKLA 4XRSA 3CMYA 1BW6A 2XPUA 3MN2A 1IGNA 4A3GJ 2G0EA 3OOUA 3IH4A 1MBEA 5IYDJ 4A3MJ 1BJZA 1BL0A 5F08A 5EF6A 1QVUA 3ZQCA 3VPRA 1JJ6C 3S15J 5C3EJ 3HEFA 3FK7A 1MBGA 3TEDA 3BG3A 2NVXJ 4V2FA 1ETVA 2NVTJ 4JYKA 3JRBA 1TC3C 5J3LA 1OCPA 1T56A 1ORKA 1ZTRA 4C3HJ 1IRZA 3JRAA 5BNGA 3CQZJ 3I4MJ 3D1NI 4BBSJ 3BTCA 3S1QJ 5EEAA 3BQZA 1R9TJ 4A93J 2ELKA 4A3CJ 3K7AJ 4XRSG 1SANA 1Y1VJ 2ZB9A 1X2NA 4M3DA 2M2EA 1JKOC 3O8HA 1ZK8A 2WV1A 4DYCA 2XSDC 3LNQA 2CUFA 1XG1A 2NS7A 4XIDA 4I6ZA 1H88C 2NOGA 2E2IJ 4A3IJ 1CQTA 4G12A 4BBRJ 2XPWA 3MVPA 1U9OA 3K2AA 3A02A 1JTXA 1AHDP 4BY1J 4QSHA 3QPSA 1FTZA 1JUSA 3ZQLA 2TRTA 3RZDJ 2WAQN 5F0HA 1LFBA 4DZJA 3S16J 2EQRA 3GTGJ 1BA5A 2VPRA 1PUFB 2DA4A 4M3GA 2M9HA 5C4JJ 2DMPA 2JA7J 1Y1WJ 3TW6A 2YU9J 2XGEA 3UKGA 1VI0A 2ID3A 3HM5A 2O8KA 3WHBA 1OFCX 4HNVA 2R93J 3H0GJ 5EZHA 3GTOJ 1MNMC 2H8RA 1RKTA 1YRNB 3BR0A 5F27A 3BR2A 3BTIA 1WH7A 1T33A 2LVSA 1H8AC 1I6HJ 4FE7A 1HDPA 4J19A 1GT0C 3OSGA 3S14J 2B63J 2CU7A 2XB5A 1UMQA 2MW8A 3LSRA 4V2GA 3JRDA 2GBYA 2FQ4A 3HOUJ 4I76A 3A03A 3DCFA 2JMWA 2DMTA 3HGYA 2PMZN 2DJNA 1GVDA 3CDLA 4FE4A 1SFOJ 5FJ8J 2ME6A 4EEFG 4DYRA 1APLC 5GPAA 2XPVA 2LKXA 2ECBA 3IV5A 1B8IA 3JRFA 2R5YA 3QQAA 1NTCA 1HF0A 2NS8A 2Y9ZA 4D7MA 5M5YJ 3Q0UA 1S7EA 4C3JJ 1H89C 2QF7A 4AUXA 4IHWA 1POGA 4UUSA 4NDLA 3JRHA 1IV6A 3OSFA 2LY9A 2CRGA 2ECCA 3FIWA 1K83J 3RQIA 3ZOBA 1ETQA 1Z77A 2N8GA 1I50J 1ZR2A 2H1KA 1WCMJ 4DYQA 3I4NJ 3Q3SA 3BTJA 1LE8B 3HOWJ 4BKXA 4A3DJ 2E1OA 4B1RA 3RZOJ 5M5WJ 2JWTA 3FKIJ 4Y7NJ 3NARA 4A3FJ 5EDNA 3JRCA 5FKKA 1U8BA 1GV2A 2L9RA 2WB1N 1AKHA 1AU7A 4IHYA 3JRGA 1W0TA 2R5ZA 4MO7A 3O8GA 3BQYA 4QTRA 4UUTA 4W97A 2LK2A 4A3LJ 1ZQ3P 3SDGA 3JR9A 4M3FA 1B72B 1MBJA 1RPWA 2HI3A 4XICA 2LR8A 1ETWA 2VUMJ 3HOYJ 2IAIA 2DN0A 2K9NA 2COBA 4B3AA 1HLVA 2HXOA 3PO3J 3GTQJ 1IUFA 4Y52J 3A01B 2XRLA 1HDDC 4D7NA 2L0KA 2E2JJ 2NVQJ 2E19A 4S0HB 3ZQGA 1LFUP 1JGGA 5E3OA 3H3VK 5F04A 2FX0A 3FK6A 1W0UA 3S17J 3GTPJ 1GUUA 3B6CA 3SJMA 2DMNA 4X6AJ 1JTYA 4D5CA 3G1LA 1ZR4A 3LSPA 1YRNA 2CQQA 2XB0X 2VI6A 4XRMA 4D5FA 3LOCA 1GV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GLO A;  1A6I A;  1MBF A;  1I3Q J;  4CYC A;  3OIO A;  5IP6 A;  2X6O A;  4AYB N;  5C4X J;  3LSJ A;  5EGO A;  1ETO A;  4B4C A;  4XK4 A;  1MSF C;  5F0C A;  2CUE A;  1TWG J;  2NVY J;  3GBG A;  3MKL A;  3WHC A;  1OJL A;  1ZKG A;  4IEJ A;  1JUM A;  1HCR A;  1RR7 A;  2JA8 J;  4ABZ A;  1BW5 A;  3TW7 A;  3E7L A;  2O9L A;  1NK3 P;  9ANT A;  3HB9 A;  1FIA A;  1WH5 A;  2MGQ A;  2JN6 A;  1MSE C;  2CJJ A;  2R7Z J;  5FKM A;  2HXI A;  5FKO A;  2X48 A;  5F0F A;  1FTT A;  1IC8 A;  3S1N J;  3M4O J;  1U9N A;  2MSY A;  1ZGW A;  2Y30 A;  2DA7 A;  2LP0 A;  2DMQ A;  5IYB J;  5IYC J;  1U78 A;  1K61 A;  3ZQH A;  2QCO A;  2DTZ A;  3HGG A;  4JX6 A;  3ZQF A;  1EF4 A;  3GTK J;  3TP0 A;  2E2H J;  1MH3 A;  2DA6 A;  1ETK A;  5IPA A;  5FLV A;  2GM4 A;  2O7O A;  5DS9 A;  1P7I A;  1DU6 A;  2LTP A;  3GTM J;  2EH3 A;  2JA5 J;  1RKW A;  2VKV A;  2DA1 A;  3JRI A;  3LSG A;  3PO2 J;  5EYR A;  2TCT A;  2YUS A;  3C2B A;  4FTH A;  3BR6 A;  4LOC A;  1NK2 P;  2AO9 A;  1RET A;  3B6A A;  5K7H A;  1FIP A;  1JT0 A;  4IHX A;  5M5X J;  2MG4 A;  5E3L A;  2FD5 A;  3F0C A;  3HKZ N;  2X9D A;  1E3O C;  3M3Y J;  3S2D J;  2L7M P;  4JP0 A;  4RBO A;  1B8I B;  2EBI A;  2JJ7 A;  5EG0 B;  2R5Y B;  5IP7 J;  3HOX J;  2EZK A;  3G1M A;  1B72 A;  4FCY A;  4MIM A;  2HDD A;  2K40 A;  2Y31 A;  2R0Q C;  1UHS A;  4UUS B;  2K9Q A;  1VFC A;  2W48 A;  3A01 A;  3IH2 A;  4AC0 A;  1VF9 A;  5K7Z A;  1IG7 A;  5GPC A;  3NAU A;  1JJ8 C;  3BT9 A;  4QIW N;  1X2M A;  2M0C A;  3W6V A;  2Y0S N;  1MBK A;  1FEX A;  3DEW A;  1A5J A;  5E3M A;  3BR3 A;  5FLM J;  2Y9Y A;  2OF7 A;  5C44 J;  1PUF A;  3GTL J;  1IDY A;  2JA6 J;  1IDZ A;  1QRY A;  2DMU A;  5IP9 J;  4A3E J;  3ZQI A;  3CCY A;  4DW6 A;  4GFB A;  5M3M J;  2LFB A;  5E3N A;  3GTJ J;  2AHQ A;  2Y2Z A;  1AKH B;  5GP9 A;  5JLX A;  5IOY A;  1IJW C;  3L1P A;  2LD5 A;  5JLW A;  2R5Z B;  2JK3 A;  4FIS A;  5HOD A;  3HOZ J;  4M3E A;  2HYJ A;  1UG2 A;  2DA2 A;  4M6V A;  1WPK A;  1ITY A;  3S1R J;  4BXX J;  2RAE A;  3QPL A;  3HOV J;  1XS9 A;  5K7F A;  1ETY A;  5EZG A;  2HQ5 A;  4A3K J;  4A3B J;  3HDD A;  2HOA A;  1FJL A;  1WGX A;  1QVT A;  1QPI A;  4W1U A;  2XGC A;  5FKN A;  4A3J J;  3TP3 A;  4RDU A;  3BG5 A;  1WI3 A;  2DA5 A;  2OPT A;  3Q0V A;  4L5E A;  3PM1 A;  1O4X A;  4JX4 A;  1GDT A;  2K9S A;  4JX5 A;  2XGD A;  5J1Y A;  2I10 A;  1TWH J;  2YS9 A;  1JKR C;  2IEK A;  1RES A;  1TWF J;  2M34 A;  3BR5 A;  1TWA J;  2HOT A;  3JRE A;  5F1J A;  3IH3 A;  5J1U A;  2M8G X;  1ETX A;  1MH4 A;  2KT0 A;  2EZI A;  1Q1V A;  4CYC B;  3S2H J;  4C2M J;  4M3B A;  3BTL A;  4MFE A;  5EGO B;  1F36 A;  1D5Y A;  2HOS A;  2VKE A;  1Z0X A;  1P7J A;  2EZH A;  5J1R A;  1MBH A;  3BR1 A;  3HBL A;  3FIS A;  4A69 C;  1XC5 A;  3G1O A;  4MLO A;  2FJ1 A;  2ME0 A;  1JKQ C;  1JKP C;  1LE8 A;  1VND A;  1X58 A;  3Q0W A;  2ID6 A;  4DZP A;  3RKQ A;  1DU0 A;  4C3I J;  1JUP A;  1F43 A;  3SFI A;  4IHV A;  4BY7 J;  2LLK A;  1OCT C;  5EG0 A;  2EZL A;  1ENH A;  2IBD A;  4MFD A;  2DA3 A;  1G2H A;  1TWC J;  2P81 A;  3BG9 A;  1HOM A;  4X1E A;  5M3F J;  5DTD A;  2R92 J;  2CQX A;  5IOZ A;  2KDZ A;  2L7Z A;  1JT6 A;  2D5V A;  3S1M J;  2L7F P;  5FKL A;  4XRS A;  3CMY A;  1BW6 A;  2XPU A;  3MN2 A;  1IGN A;  4A3G J;  2G0E A;  3OOU A;  3IH4 A;  1MBE A;  5IYD J;  4A3M J;  1BJZ A;  1BL0 A;  5F08 A;  5EF6 A;  1QVU A;  3ZQC A;  3VPR A;  1JJ6 C;  3S15 J;  5C3E J;  3HEF A;  3FK7 A;  1MBG A;  3TED A;  3BG3 A;  2NVX J;  4V2F A;  1ETV A;  2NVT J;  4JYK A;  3JRB A;  1TC3 C;  5J3L A;  1OCP A;  1T56 A;  1ORK A;  1ZTR A;  4C3H J;  1IRZ A;  3JRA A;  5BNG A;  3CQZ J;  3I4M J;  3D1N I;  4BBS J;  3BTC A;  3S1Q J;  5EEA A;  3BQZ A;  1R9T J;  4A93 J;  2ELK A;  4A3C J;  3K7A J;  4XRS G;  1SAN A;  1Y1V J;  2ZB9 A;  1X2N A;  4M3D A;  2M2E A;  1JKO C;  3O8H A;  1ZK8 A;  2WV1 A;  4DYC A;  2XSD C;  3LNQ A;  2CUF A;  1XG1 A;  2NS7 A;  4XID A;  4I6Z A;  1H88 C;  2NOG A;  2E2I J;  4A3I J;  1CQT A;  4G12 A;  4BBR J;  2XPW A;  3MVP A;  1U9O A;  3K2A A;  3A02 A;  1JTX A;  1AHD P;  4BY1 J;  4QSH A;  3QPS A;  1FTZ A;  1JUS A;  3ZQL A;  2TRT A;  3RZD J;  2WAQ N;  5F0H A;  1LFB A;  4DZJ A;  3S16 J;  2EQR A;  3GTG J;  1BA5 A;  2VPR A;  1PUF B;  2DA4 A;  4M3G A;  2M9H A;  5C4J J;  2DMP A;  2JA7 J;  1Y1W J;  3TW6 A;  2YU9 J;  2XGE A;  3UKG A;  1VI0 A;  2ID3 A;  3HM5 A;  2O8K A;  3WHB A;  1OFC X;  4HNV A;  2R93 J;  3H0G J;  5EZH A;  3GTO J;  1MNM C;  2H8R A;  1RKT A;  1YRN B;  3BR0 A;  5F27 A;  3BR2 A;  3BTI A;  1WH7 A;  1T33 A;  2LVS A;  1H8A C;  1I6H J;  4FE7 A;  1HDP A;  4J19 A;  1GT0 C;  3OSG A;  3S14 J;  2B63 J;  2CU7 A;  2XB5 A;  1UMQ A;  2MW8 A;  3LSR A;  4V2G A;  3JRD A;  2GBY A;  2FQ4 A;  3HOU J;  4I76 A;  3A03 A;  3DCF A;  2JMW A;  2DMT A;  3HGY A;  2PMZ N;  2DJN A;  1GVD A;  3CDL A;  4FE4 A;  1SFO J;  5FJ8 J;  2ME6 A;  4EEF G;  4DYR A;  1APL C;  5GPA A;  2XPV A;  2LKX A;  2ECB A;  3IV5 A;  1B8I A;  3JRF A;  2R5Y A;  3QQA A;  1NTC A;  1HF0 A;  2NS8 A;  2Y9Z A;  4D7M A;  5M5Y J;  3Q0U A;  1S7E A;  4C3J J;  1H89 C;  2QF7 A;  4AUX A;  4IHW A;  1POG A;  4UUS A;  4NDL A;  3JRH A;  1IV6 A;  3OSF A;  2LY9 A;  2CRG A;  2ECC A;  3FIW A;  1K83 J;  3RQI A;  3ZOB A;  1ETQ A;  1Z77 A;  2N8G A;  1I50 J;  1ZR2 A;  2H1K A;  1WCM J;  4DYQ A;  3I4N J;  3Q3S A;  3BTJ A;  1LE8 B;  3HOW J;  4BKX A;  4A3D J;  2E1O A;  4B1R A;  3RZO J;  5M5W J;  2JWT A;  3FKI J;  4Y7N J;  3NAR A;  4A3F J;  5EDN A;  3JRC A;  5FKK A;  1U8B A;  1GV2 A;  2L9R A;  2WB1 N;  1AKH A;  1AU7 A;  4IHY A;  3JRG A;  1W0T A;  2R5Z A;  4MO7 A;  3O8G A;  3BQY A;  4QTR A;  4UUT A;  4W97 A;  2LK2 A;  4A3L J;  1ZQ3 P;  3SDG A;  3JR9 A;  4M3F A;  1B72 B;  1MBJ A;  1RPW A;  2HI3 A;  4XIC A;  2LR8 A;  1ETW A;  2VUM J;  3HOY J;  2IAI A;  2DN0 A;  2K9N A;  2COB A;  4B3A A;  1HLV A;  2HXO A;  3PO3 J;  3GTQ J;  1IUF A;  4Y52 J;  3A01 B;  2XRL A;  1HDD C;  4D7N A;  2L0K A;  2E2J J;  2NVQ J;  2E19 A;  4S0H B;  3ZQG A;  1LFU P;  1JGG A;  5E3O A;  3H3V K;  5F04 A;  2FX0 A;  3FK6 A;  1W0U A;  3S17 J;  3GTP J;  1GUU A;  3B6C A;  3SJM A;  2DMN A;  4X6A J;  1JTY A;  4D5C A;  3G1L A;  1ZR4 A;  3LSP A;  1YRN A;  2CQQ A;  2XB0 X;  2VI6 A;  4XRM A;  4D5F A;  3LOC A;  1GV5 A; 
#chains in the Genus database with same CATH topology
 5ED4 A;  1A6I A;  4CYC A;  1R36 A;  4RLF A;  4BS9 A;  1YG2 A;  4AYB N;  3CCL I;  3VYR B;  5HLI A;  2VON A;  4G7Z F;  2IW5 A;  3S8P A;  3JTG A;  1HST A;  4E4H A;  4ZYE A;  1FC3 A;  2CUE A;  1RNL A;  3MKL A;  3PSF A;  2MBF A;  4WXH A;  2P6S A;  1HCR A;  3CUQ B;  4IEJ A;  3AL0 B;  5CVJ A;  4ABZ A;  4D1Q A;  4PFO A;  2UWM A;  3IL2 A;  1YIO A;  2O9L A;  1EJ9 A;  3KP4 A;  4RGX A;  1NK3 P;  1ZHF A;  3E6B A;  4DBR A;  2EA2 A;  1WH5 A;  2MGQ A;  2XAG A;  1MSE C;  3L2U A;  2R7Z J;  3OR2 C;  2WV0 A;  3PFY A;  2E1C A;  1HXD A;  1SVO A;  5KVR A;  4CIC A;  3AL0 C;  1GHC A;  2HVQ A;  5L3B A;  2EFP A;  5IYB J;  3KLO A;  1K61 A;  2MH9 A;  3T8R A;  2QCO A;  4XKC A;  3HGG A;  3CLO A;  2ESN A;  3DQV C;  4YII A;  3TP0 A;  2F4I A;  2E2H J;  3BG7 A;  1ETK A;  2OTJ I;  1YW9 A;  4Y13 A;  3IRQ A;  1WWX A;  3KFW X;  2R7X A;  3VWB A;  4FX0 A;  1DU6 A;  4IHT A;  1ERD A;  2BYV E;  1GLN A;  2GIZ A;  2JA5 J;  3BP8 A;  1S5L C;  2VKV A;  3BWG A;  3M8E A;  2DLL A;  1S72 I;  3PO2 J;  1YS7 A;  5HDG A;  3C2B A;  4FTH A;  1NK2 P;  5BPD A;  2FA5 A;  1RET A;  5K7H A;  2EFO A;  2XAJ A;  1FIP A;  3CCU I;  1KZH A;  4IHX A;  3LA2 A;  3J7A O;  1J09 A;  1IXC A;  3J80 K;  2VPL A;  2V79 A;  3J7Z I;  4R1H A;  5ILV A;  3KZZ A;  4RLQ A;  2HEO A;  5AIP A;  3ISP A;  4KN7 X;  4HDU A;  3K69 A;  1XDS A;  4JP0 A;  3S3M A;  5DCM A;  2JVH A;  2YU3 A;  1S29 A;  2L4A A;  2OCE A;  5HDK A;  3ERE D;  2K85 A;  1D1B A;  3QP5 A;  1ODD A;  3SQN A;  2VJI A;  1TTY A;  4AIH A;  1HKS A;  1F1Z A;  4MIM A;  1B72 A;  5HLG A;  3PIP F;  2Y31 A;  2YX4 A;  4JQF A;  1UHS A;  4B8X A;  1E0E A;  1Z21 A;  1K6O A;  2EFW A;  2EV6 A;  5KCM A;  2CV1 A;  4L5J A;  5FB2 A;  3IH2 A;  1R6R A;  3OYD A;  5IT9 K;  5CQG A;  4XN3 A;  5K7Z A;  5GPC A;  2CMP A;  1X2M A;  2K3P A;  1UAA A;  3W6V A;  1FP1 D;  2Y0S N;  1STZ A;  4GDF A;  1A5J A;  5FLM J;  2F4O B;  1WJB A;  2X0L A;  2Y9Y A;  3S3O A;  3HC7 A;  2OF7 A;  4ENN A;  3AG4 H;  1I5Z A;  3ECH A;  2DMU A;  2E5N A;  5FO5 A;  3CMA I;  4A3E J;  2K7L A;  3TQN A;  1EH6 A;  1XGO A;  1R23 A;  2VN2 A;  4DNC A;  4GFB A;  1QNT A;  4LJZ F;  5M3M J;  3ZRG A;  4BHP A;  1KQ8 A;  3CDH A;  3F72 A;  3V7R A;  2W84 A;  5IOY A;  1IJW C;  1XMA A;  1FSE A;  1JE8 A;  3HRU A;  3HOZ J;  3K10 A;  2NOJ B;  5L3D A;  1BI2 A;  1UG2 A;  4P1W A;  4BJ6 C;  1WPK A;  1A04 A;  1UZC A;  2DI3 A;  3EUK L;  1VQ5 I;  2HPI A;  4BXX J;  2RAE A;  2XRN A;  3HOV J;  1W5T A;  1QBJ A;  3EET A;  1GXP A;  1LQ1 A;  3VEP A;  5GAD J;  5AON A;  3GFL A;  3OWT A;  1R49 A;  2ZFU A;  5BPI A;  1QVT A;  3FX3 A;  3LFU A;  4W1U A;  1IN8 A;  1RR8 C;  4HF1 A;  4WXD A;  3BG5 A;  4L5I A;  1W4M A;  1T95 A;  4ZZL A;  1KU3 A;  1O7F A;  3L7W A;  2VIX A;  2BVL A;  2XGD A;  5J1Y A;  2JSP A;  2DT7 B;  2I5U A;  4HA8 A;  1FYL A;  3S2W A;  2YS9 A;  4BXU A;  2LKS A;  1OKR A;  3A2K A;  2HVR A;  1JKR C;  4GYI A;  1TWF J;  1LPQ A;  3BR5 A;  3HIF A;  1O3R A;  3M8J A;  1QZE A;  2HOT A;  3DV8 A;  3VFZ A;  3IH3 A;  1U5T C;  2ZJR F;  1ETX A;  1MH4 A;  2KT0 A;  3RJP A;  4I98 B;  3UNG C;  1B1B A;  3H1C A;  1V5F A;  4LD5 A;  3ZMS A;  4UY8 I;  1BOB A;  2HGC A;  1SD6 A;  4A2U A;  1D5Y A;  5TJJ A;  3BZ6 A;  1XSX A;  4PZJ A;  4NHJ A;  4HOB A;  2VKE A;  3V8K A;  3BDD A;  4BAY A;  4EMS A;  2XC7 A;  5D5V B;  4ENM A;  2ACJ A;  1XN7 A;  3I9V 2;  2FJ1 A;  2L5Q A;  1JKQ C;  3HYI A;  2ID6 A;  4DZP A;  3ZGK A;  4U0Y A;  3BJA A;  4UHT A;  1DU0 A;  1JUP A;  1OCT C;  4S04 A;  1TQM A;  2EZL A;  1VQM I;  2VJJ A;  1G2H A;  1RUO A;  1TWC J;  4GYG A;  2R7Q A;  5A2Q K;  1HKT A;  1OR7 C;  2IGK A;  2D5V A;  3FXL A;  4LB5 A;  3WG9 A;  2M1B A;  1MNE A;  4LG0 B;  3PFI A;  1BW6 A;  4ZTF A;  1VQK I;  4A3G J;  3I58 A;  2W82 A;  1D8J A;  2G0E A;  3HKZ A;  3OYN A;  3IH4 A;  5ERI A;  2W7N A;  1R71 A;  5E79 C;  3CTA A;  5C3E J;  3OYI A;  3S15 J;  1O57 A;  3BG3 A;  2K86 A;  3GEZ A;  4ANJ A;  4V2F A;  5HOO A;  1IUY A;  2F5F A;  2NVT J;  3JRB A;  1ZRC A;  4Q5S F;  1I39 A;  1OCP A;  1MW7 A;  1ORK A;  4EQQ A;  2XAS A;  4BE1 A;  2VQC A;  3KP7 A;  5BNG A;  2DPD A;  1R5I D;  5E1Z B;  4HEA 2;  3LA3 A;  2Q0O A;  2GIV A;  3D1N I;  4KYW A;  3BTC A;  3K4L A;  4RAG A;  2E1M B;  1R9T J;  2Z99 A;  3OS1 A;  1X1D A;  2COM A;  4A93 J;  3J81 Z;  1OCR H;  1SAN A;  4LLN A;  2EB7 A;  3RI4 A;  2ZME A;  1LUJ B;  4AVP A;  2M2E A;  4WCG A;  4BXF A;  5LGN A;  3BG6 A;  1HBX G;  1F5T A;  2X1C A;  3L2W A;  1ZH5 A;  3H35 A;  2DFI A;  2FF4 A;  5ICG A;  2ZJP F;  2NS7 A;  2NOG A;  2EFN A;  1I1G A;  4HX8 A;  2JRT A;  4PSX A;  2JPC A;  2E1M C;  3FMR A;  5FRN A;  3JSP A;  2XPW A;  1XGS A;  3GLX A;  4HAM A;  1OYW A;  2ADU A;  5DYM A;  5FFZ A;  3X2Q H;  1D1A A;  1LEA A;  3QPS A;  4QSH A;  4BY1 J;  3K0L A;  3V8J A;  2AS5 F;  2TRT A;  5LEJ A;  2WAQ N;  4IRG A;  2EQR A;  4KIF A;  2BXY A;  1RC9 A;  1FOK A;  4RGU A;  2VPR A;  2Q2E B;  2DA4 A;  1BIA A;  5C4J J;  2KFD A;  1WKM A;  2DMP A;  3V7C A;  2ICW G;  3WU2 C;  1Y1W J;  4HPQ A;  4HSR A;  4S05 A;  3UKG A;  2ID3 A;  3OOP A;  3H92 A;  2M4G A;  3NWS A;  4HNV A;  2R93 J;  4XLP F;  2IS4 A;  2VJ5 A;  3H0G J;  2M45 A;  3G6E I;  2E1N A;  3FF5 A;  3F8B A;  2BOL A;  3D0S A;  1UCR A;  3H9G A;  1T33 A;  1HDP A;  1TNS A;  3ERM A;  1XMX A;  3TDZ C;  2CU7 A;  1SAU A;  2GA2 A;  3BCB A;  4IOA F;  3KP6 A;  3LSR A;  2HNH A;  4V2G A;  1T0F C;  3GME A;  4IHS A;  4M9Z A;  2Y75 A;  4FQG A;  1EV7 A;  2LMD A;  3DCF A;  2MA3 A;  2NS0 A;  3GO5 A;  3I53 A;  4Y3O A;  1GVD A;  3TMO A;  2HWV A;  4ZYG A;  2LBF A;  5FJ8 J;  3OS0 A;  1TL8 A;  3LA7 A;  3R4K A;  4Q4Z F;  3PQK A;  4HZF A;  4CZC A;  3AKZ A;  1FYM A;  3IV5 A;  4XON A;  1KGS A;  3ZN1 A;  5FLX K;  2QYO A;  4XNF A;  2OZU A;  1SMY F;  5H2F C;  5M5Y J;  3Q0U A;  3C3W A;  2FE3 A;  1S7E A;  3F6V A;  1H89 C;  1YW8 A;  2VC0 A;  1P9Q C;  2E35 A;  3KYL A;  2ZNZ A;  1YS6 A;  1DGW Y;  3ABK H;  3E97 A;  3HPG A;  3C1D A;  2Z5U A;  2PMU A;  1ZG3 A;  1K83 J;  3F9K A;  1R22 A;  3RQI A;  3VB2 A;  1Z77 A;  2N8G A;  4C2U A;  1WCM J;  4DYQ A;  2UV1 A;  3BPX A;  3BTJ A;  2UUZ A;  3RYP A;  3OYF A;  3ZCO A;  2AXT C;  1F4K A;  3ZMV A;  3QOD A;  3RZO J;  5M5W J;  2BW3 A;  3T1B A;  3IP4 B;  3NAR A;  3LFK A;  1PDN C;  4A3F J;  5EDN A;  2E60 A;  3R6S A;  2M7B A;  2YR2 A;  2LY2 A;  3TO7 A;  4E7J A;  2L9R A;  4XSZ F;  3RIR A;  1WI9 A;  1AU7 A;  4IHY A;  1KQ0 A;  2V1U A;  3EDP A;  4RAZ A;  1ZLK A;  1OCZ H;  3LQR A;  3K4C A;  3VSL A;  2IP2 A;  4W97 A;  2QQ8 A;  5DCM B;  4AIJ A;  1R4N B;  3V4G A;  3JR9 A;  1B72 B;  1W1W E;  1RPW A;  2HI3 A;  3V42 A;  3ABT A;  1HKQ A;  2LR8 A;  4ZC3 A;  2VUM J;  2IGO A;  2YPR A;  2DCE A;  3SFZ A;  2H27 A;  4AD9 A;  4II2 A;  4UUV A;  4HNT A;  1YE9 A;  2STW A;  1MMD A;  2LG4 A;  2CO5 A;  1U5T A;  1DDN A;  1HLV A;  3PO3 J;  4Y17 A;  1D1C A;  4Y52 J;  1HDD C;  1KA8 A;  2L0K A;  4Q48 A;  2E19 A;  3JW4 A;  4OAZ A;  3MKY B;  2PQ8 A;  2PX9 A;  5F04 A;  2F4M B;  3OV8 A;  3FMQ A;  4ZDL A;  3T0Y A;  1UHW A;  2Z9O A;  1GUU A;  2R3S A;  3SJM A;  4PSW A;  4X6A J;  1TT0 A;  2XHK A;  1ZR4 A;  2M87 A;  3REO A;  4AU7 A;  2A3S A;  1CF7 B;  3AFH A;  4XRM A;  4EM1 A;  3ZMZ A;  1I3Q J;  2MD0 A;  3L9F A;  5C4X J;  4F55 A;  1ETO A;  2QSG X;  2MC3 A;  4BAC A;  2RVC A;  1OR7 A;  4AYB A;  4EJU A;  2GOX B;  4A0Z A;  2ZJQ F;  3K70 C;  2VC1 A;  1NG6 A;  1LDJ A;  1A31 A;  1RR7 A;  3PUB A;  1BW5 A;  3CCS I;  5BMZ A;  2H8W A;  3PQJ A;  3KLN A;  3HB9 A;  4UVB A;  4NC8 A;  1V4R A;  4MQ9 F;  2O03 A;  2E34 A;  2JN6 A;  3DTI A;  2NVU B;  2CJJ A;  2H6B A;  5FKO A;  2X6Y A;  2EV0 A;  3MAJ A;  2WAF A;  2XAU A;  5F0F A;  3M07 A;  4Z2Y A;  2XF5 A;  2AQF A;  5L3G A;  3IAM 2;  1H0M A;  4HF2 A;  3DTK A;  4XKW A;  1IC8 A;  1IV8 A;  5DM7 F;  2PMZ A;  4P96 A;  2DA7 A;  2LP0 A;  1U78 A;  1XCB A;  2XGX A;  3ZQH A;  3CD6 I;  4L9T A;  2QLZ A;  1EF4 A;  3GTK J;  4KMU X;  2CW0 F;  4LFU A;  3BRO A;  2DXI A;  3CP8 A;  2O7O A;  1DPR A;  1QA6 A;  2K9M A;  2WWY A;  2DYR H;  5CLS A;  3WGH A;  2HR3 A;  3GTM J;  5GAE J;  2EH3 A;  2KKO A;  4LLL A;  1HC8 A;  1J59 A;  2P8T A;  1B9M A;  2JUG A;  4R8H A;  3WTT C;  3BPV A;  3HZJ A;  2TCT A;  2TDX A;  5D5X B;  5JVG F;  1R5G A;  3DBR B;  5IT9 Z;  4ETS A;  1N78 A;  3B6A A;  3PUF A;  1DQU A;  5HLT A;  2B9S A;  1JT0 A;  2A6T A;  1TZL A;  2R7D A;  2X4H A;  2MG4 A;  5E3L A;  1XSD A;  4BNC A;  2Z2S B;  5K1Y A;  4H4K C;  3DF8 A;  3M3Y J;  3S2D J;  3TOA A;  3M1C A;  1FX7 A;  1ULY A;  2NAZ A;  3KEY A;  4FT8 A;  2Q8K A;  1A35 A;  2VQL A;  5D6E A;  4OIR F;  2R5Y B;  2CV0 A;  4Z6Y A;  3PNT A;  3JSO A;  2HDD A;  2Z16 A;  1YO5 C;  1WJD A;  5BQT A;  2R0Q C;  1ZEL A;  1QPM A;  2LKP A;  2V1N A;  3HHH A;  3GVA A;  1HW5 A;  1BOA A;  3AAF A;  2HU9 A;  2KIS A;  3HUG B;  4TV7 A;  4KNY A;  3C18 A;  3VDX A;  3NAU A;  3BLY A;  4QIW N;  3EYI A;  4F93 B;  1AOY A;  1S7A A;  1MKM A;  3DEE A;  3DEW A;  4M74 A;  4HST A;  3BC8 A;  1BJA A;  3BR3 A;  5ILS A;  1VQ7 I;  2ZXI A;  2BEO A;  3GTL J;  2Q2E A;  1IDY A;  2JA6 J;  2CUZ A;  4M6Y A;  4IVN A;  1V3F A;  1Q1H A;  3CCY A;  4BHC A;  5GTI C;  1T0F A;  3KP3 A;  3SEZ A;  4ZZD A;  2LFB A;  2KZV A;  3G2B A;  3HPH A;  4BQA A;  1BR2 A;  3MEX A;  3WTS C;  4BL0 B;  1AKH B;  1XMK A;  5JLX A;  3L1P A;  2LD5 A;  4FIS A;  2DFH A;  2PMH A;  4KIB A;  2HYJ A;  4OMZ A;  1R4M B;  4ESF A;  4BYY A;  1X4P A;  2A6H F;  1NH3 A;  2ZME B;  4QWQ A;  5TGT A;  2M7A A;  4BHB A;  2F5V A;  3OMY A;  5DV5 A;  3BY6 A;  3RKW A;  3ZMT A;  2OBP A;  1ETY A;  3CCJ I;  2M4K A;  5EZG A;  2JPB A;  3HDD A;  1FJL A;  2L3D A;  2FXA A;  4U87 A;  3K70 D;  4FET A;  2HQN A;  2XGC A;  2MAB A;  2KRC A;  4XQF A;  2HDW A;  5FKN A;  3TP3 A;  3FM5 A;  2JUC A;  2DA5 A;  3I64 A;  3Q0V A;  3UR3 C;  1Y8R B;  1BI0 A;  1O4X A;  1GDT A;  2M0M A;  3F8F A;  2ZME C;  4MEX F;  4CCM A;  3ECO A;  3WOD F;  5TIS C;  4XRF A;  2K9S A;  4JX5 A;  4BUP A;  5LGT A;  3IWZ A;  3KPH A;  3DTE A;  1TWH J;  2KDO A;  2DYS H;  3RSN A;  1FBQ A;  3VOD A;  5D5U B;  4HX4 A;  2LF7 A;  2GOM A;  3NEU A;  4OIO F;  2M34 A;  3KYC B;  2BE5 F;  4KFC A;  3F8C A;  5J1U A;  2PJR B;  1IN4 A;  2DFF A;  1YFH A;  4LLG F;  4A6E A;  3OY9 A;  2WBM A;  4M3B A;  2HDC A;  4P9U A;  1TQP A;  2G9W A;  1WZ2 A;  2OJE D;  1F36 A;  3D5S C;  2KHM A;  1Z7U A;  2L02 A;  2OQR A;  5CJ9 A;  3WG7 H;  1BI1 A;  3W2W A;  3K1P A;  1Z0X A;  1P7J A;  3COA C;  3BR1 A;  5H6Q A;  3HBL A;  3H9J A;  2K4J A;  1A36 A;  3G1O A;  2F5D A;  3D5R C;  2Q1Z B;  4OIN F;  4HQE A;  5KAI C;  3LWF A;  5HS8 A;  3E6M A;  5H20 A;  2DK5 A;  5E1W A;  1N77 A;  3KYD B;  4QPO A;  4C3I J;  1TW3 A;  1MIJ A;  1DUX C;  2ZSI B;  3QOE A;  4BY7 J;  4IHV A;  1O3Q A;  1LVK A;  4XOP A;  1FOY A;  2IBD A;  4MFD A;  5EG0 A;  5EEH A;  4GRI A;  2JVG A;  2P81 A;  4X1E A;  5M3F J;  2DDB A;  2LBF B;  5D4R A;  1JT6 A;  4CO8 A;  4A0X A;  3CMY A;  1V5G A;  1KU2 A;  1JHH A;  1UEL B;  3MN2 A;  2IA1 A;  4ZYD A;  1T39 A;  3T5X A;  4IPA A;  1IXR C;  4GO1 A;  3OOU A;  4Y33 A;  4A12 A;  2W25 A;  1MBE A;  4HRI A;  2ZSH B;  3IC7 A;  4CZZ A;  2FNA A;  4LIU A;  1BL0 A;  4RM2 A;  5F08 A;  1QVU A;  3GZ5 A;  4IZZ A;  4FHT A;  4RB1 A;  3HEF A;  1MBG A;  2A69 F;  2R7F A;  4Y15 A;  5LD2 C;  1ETV A;  2B0L A;  2HOE A;  1TC3 C;  1FYK A;  1T56 A;  4C3H J;  5DUK A;  3I54 A;  5TRD A;  3CF2 A;  3A0B C;  5J8F A;  3CQZ J;  1G8X A;  3I4M J;  3TKY A;  4KMF A;  1G3Y A;  1Y39 A;  4B09 A;  3S1Q J;  4L18 B;  1J9I A;  1XD7 A;  2QQA A;  1Y0N A;  1JHF A;  4HG2 A;  1QHH D;  5F6F A;  2FBI A;  4XRS G;  1Y1V J;  2ZB9 A;  1X2N A;  2LRD A;  3TO6 A;  2BW3 B;  4JK1 X;  1CF7 A;  2MD5 A;  1ZAO A;  2O0Y A;  3C2G A;  1K7A A;  1JKO C;  1ZK8 A;  5FGM A;  3VYS B;  4DYC A;  5J8C A;  3WU1 B;  2KRF A;  2BVM A;  1SFX A;  2F5E A;  5CQE A;  1LB2 A;  1SFU A;  3HRM A;  1XG1 A;  4I6Z A;  1XTA A;  1Z6R A;  4XM3 A;  1FNN A;  4I01 A;  2E2I J;  3DFG A;  4YEJ A;  3U21 A;  1P2F A;  2V9K A;  3MVP A;  1U9O A;  3HSR A;  3W6J B;  2UZK A;  3A02 A;  1B9N A;  1JTX A;  4C9Y A;  1MMN A;  1JXS A;  1YQA A;  1JUS A;  3ZQL A;  1QZZ A;  4M73 A;  2VKH A;  2JQ7 A;  5ICC A;  5F0H A;  4NBQ A;  5E1X A;  4G94 A;  3GTG J;  1U5T B;  4PJJ A;  1XCV A;  1UFM A;  3WTX C;  1PUF B;  1BA5 A;  5LGU A;  2XVC A;  2M9H A;  4CHU A;  2JA7 J;  2LNB A;  3TW6 A;  2ESH A;  4KIG A;  4XLE A;  4X0G A;  4MQV A;  5D4S A;  1MMS A;  4ZDP A;  3L2C A;  2H8R A;  1FZP B;  3LAJ A;  1Y0U A;  3QAH A;  2O5R A;  3MFK A;  3L00 A;  1SVM A;  3M7G A;  1Z1D A;  3S3N A;  2IS6 A;  2FUG 2;  2VBX A;  4MTD A;  4E7H A;  5HS9 A;  2P6T A;  2B63 J;  1UMQ A;  4PJN A;  2OC6 A;  4G6T B;  1QZY A;  1QO0 D;  2FQ4 A;  2EFQ A;  3A03 A;  1D8K A;  4WWC A;  1FOX A;  3HSF A;  2JMW A;  4DJA A;  3ZXS A;  2DMT A;  3HGY A;  3ABM H;  2Y48 A;  2D1H A;  4I99 C;  2ME6 A;  4EEF G;  1TP4 A;  2P0W A;  2MLG A;  4NC6 A;  4U0V A;  3OYH A;  1IF1 A;  1NHA A;  2Y0M A;  3ZN0 A;  1APL C;  5FFX A;  3HTS B;  1U0J A;  2LKX A;  2F2E A;  2XPV A;  4N4O B;  4IQJ A;  2BBY A;  3JRF A;  2R5Y A;  1E3H A;  1NTC A;  3QQA A;  1SAX A;  4B48 A;  3IHU A;  4PGH A;  3TOB A;  4EJW A;  2HKO A;  1Z3X A;  4E70 A;  1UG0 A;  2QF7 A;  3RKY A;  4IHW A;  3E0J B;  3OYE A;  5LHH A;  4XBF A;  4NDL A;  3KP5 A;  3LQQ A;  3MD2 A;  3JTH A;  4IRI A;  2ECC A;  2IRF G;  2ZKZ A;  3FIW A;  3HUG A;  5HVQ C;  2BHY A;  2ZJ2 A;  3OS2 A;  2DOF A;  2ZBK A;  1ZG1 A;  3P9I A;  5HLH A;  4IO9 F;  1I50 J;  2XSJ C;  3QWL A;  4P9F A;  3DKX A;  2W85 A;  3AG2 H;  1LE8 B;  2R7T A;  4BKX A;  1HQC A;  2E1O A;  2OD5 A;  5J47 A;  2V7F A;  2QKM B;  3FKI J;  3LSH A;  5JHU A;  3J7A Y;  4BDY A;  3MKZ A;  4WF2 A;  4HBL A;  4RAY A;  2JTV A;  4LK0 F;  2VOP A;  1IRF A;  3FHN A;  1AKH A;  2FBK A;  2VLA A;  2P5K A;  3O8G A;  4NQW B;  1Y56 A;  3BZK A;  1LNW A;  3O3K A;  2L7K A;  4DBQ A;  2RGV A;  1YX3 A;  3SZP A;  1V55 H;  2L9N A;  3H36 A;  1MBJ A;  2EA4 A;  3QYF A;  1ETW A;  1H9T A;  4U7D A;  2IAI A;  2LSO A;  3GFM A;  3FXU A;  4IQ4 A;  1ON1 A;  1LFP A;  2K9N A;  1LEB A;  3ZMU A;  2XKO A;  3A4C A;  3QYB A;  4CSW A;  1BN5 A;  4YFN F;  4EVI A;  4YFK F;  3GTQ J;  1IUF A;  4RS8 A;  5DDG A;  5DEQ A;  1IN7 A;  4KIC A;  5J4V A;  2K27 A;  1LFU P;  1GXQ A;  5E3O A;  4CH7 A;  2FX0 A;  3F6O A;  3FK6 A;  2KPM A;  3ZMD A;  3K9T A;  1MJA A;  1FOW A;  2DMN A;  1B6A A;  2VQH A;  4DGW B;  4D5C A;  1D3Y A;  4IX7 A;  2IGM A;  3FMS A;  1YRN A;  1VQN I;  2H94 A;  4G6Q A;  2KJC A;  2NRA C;  2PJR A;  5K5O A;  5B1A H;  4IOC F;  1I27 A;  1MBF A;  2VL8 A;  2VXZ A;  3B02 A;  3P9K A;  1ZLJ A;  3OIO A;  3GFI A;  2X6O A;  3R0J A;  1LDK B;  1WHU A;  2ZFW A;  5J40 A;  4V19 K;  2IPQ X;  4B4C A;  4RM3 A;  4XK4 A;  3CO7 C;  1JGS A;  1TBX A;  2ZC2 A;  1MND A;  1N75 A;  1R1U A;  1TWG J;  5K5R A;  2NVY J;  3GFJ A;  3OIP A;  3GBG A;  1OJL A;  4E7L A;  1T08 B;  2GXA A;  1ZKG A;  3C7J A;  1JUM A;  3KEO A;  2FML A;  2X1E A;  4E7S A;  1HW2 A;  3TW7 A;  4IRH A;  2L01 A;  3WTU C;  1SFE A;  2DT6 A;  2C6Y A;  2L9V A;  1FIA A;  3ROU A;  3DU6 A;  2QQ9 A;  2RKH A;  5FKM A;  1G3T A;  2W4S A;  3FDY A;  2KMU A;  3R61 A;  1UHM A;  1MJ9 A;  4ASN A;  4PK4 A;  5E18 F;  1U9N A;  5CYV A;  1ZGW A;  1P92 A;  3VOE A;  4B3X A;  2Y30 A;  2DMQ A;  5IYC J;  2DTZ A;  2KLO A;  3AG3 H;  3ZQF A;  3KP2 A;  1XDU A;  4KDP A;  4EGZ A;  3QOP A;  5IPA A;  4AID A;  1YIJ I;  5FLV A;  2HZT A;  1R1V A;  2CFO A;  3FBI B;  2GM4 A;  4OIP F;  4CCL A;  1B4A A;  1SVL A;  5DS9 A;  4WX9 A;  1P7I A;  2RN7 A;  3Q5F A;  2GXG A;  1RKW A;  2E71 A;  5KHD A;  4L9V A;  3JRI A;  5ILU A;  2PG4 A;  2DK8 A;  4NB5 A;  5EYR A;  4R79 A;  2CG4 A;  1FWZ A;  3ZQQ A;  2YUS A;  3BCA A;  3BR6 A;  1D0X A;  2AO9 A;  3U1K A;  3IKV A;  1A6Q A;  2PFB A;  2CW8 A;  2BZT A;  5M5X J;  2DBB A;  2DDA A;  3TL4 X;  2FD5 A;  3F0C A;  2DOD A;  5D5W B;  2GA1 A;  4LMY A;  3HKZ N;  2X9D A;  1E3O C;  1EKE A;  1ON2 A;  3CJT B;  5HDN A;  3CC2 I;  2L7M P;  4XKB A;  2CS3 A;  1SC7 A;  1B8I B;  2V6E A;  2EBI A;  2JJ7 A;  5EG0 B;  1Z3Y A;  3DBH B;  4AIK A;  4FCY A;  3RQ4 A;  3CF5 F;  1HSJ A;  3ZP5 A;  1HA8 A;  1Z91 A;  2R7O A;  3JAM Z;  4M72 A;  3KZY A;  3GWZ A;  4HQM A;  4MEY F;  1MJB A;  2K9Q A;  2WB1 A;  3EUH C;  3FHZ A;  3OL4 A;  2RQP A;  4N0B A;  1XGM A;  4PGG A;  4QLC U;  3OYA A;  3OYM A;  3E5X A;  1VQL I;  4CA0 A;  1KQ9 A;  3SHF A;  1Z9C A;  4HYE A;  3NRV A;  4UV9 A;  3BT9 A;  3GZN B;  3KIO A;  2M0C A;  1FEX A;  1MBK A;  2BY0 A;  4G7H F;  4EJO A;  5E3M A;  2KL4 A;  2P7V B;  3GX4 X;  2VB6 A;  1PUF A;  3IKT A;  1AWC A;  4ZDO A;  2A07 F;  4EM0 B;  5IP9 J;  5KAF C;  4RB3 C;  3ZQI A;  2LYC A;  2XF7 A;  4CCJ A;  2ISZ A;  2O3F A;  3G3Z A;  3GTJ J;  1BI3 A;  4EGY A;  3IUO A;  1SD7 A;  2NXN B;  4ZH4 F;  1U8R A;  1EA3 A;  5GP9 A;  3QU6 A;  5JLW A;  2R5Z B;  4M3E A;  3CCV I;  4H0E A;  1FBS A;  4PUS A;  1K4T A;  4M6V A;  3ABL H;  2A05 A;  3GZ6 A;  2R7S A;  1ITY A;  3FWE A;  3QPL A;  2PEX A;  3QYE A;  2STT A;  1E17 A;  4HLX A;  5K7F A;  4A3K J;  2HQ5 A;  2B7E A;  4A3B J;  3CZ6 A;  2HOA A;  2MFZ A;  3IWF A;  1MMA A;  1ZN2 A;  4ZTJ A;  3OL3 A;  4L9N A;  4F92 B;  2IS2 A;  1L0O C;  4B43 A;  1QPI A;  3CCQ I;  2OTL I;  3KEQ A;  4A3J J;  2FMY A;  2V1X A;  1WI3 A;  2OPT A;  1BC7 C;  4P5O A;  3WTV C;  1XB4 A;  2M8E A;  2VBZ A;  4JX4 A;  3ABU A;  1QQI A;  4O6J A;  1JI8 A;  2CQN A;  1SFK A;  1VTN C;  4I2O A;  1PP8 F;  3DP7 A;  1U6G A;  3W6K B;  2RV8 A;  3FM3 A;  3GW2 A;  1KYW A;  2M30 A;  2WTE A;  2WY7 Q;  3LAP A;  1RES A;  1YTY A;  1TWA J;  4YIF A;  1R5H A;  5F1J A;  1B59 A;  4OAY A;  4HDV A;  4F91 B;  3J80 Z;  2EZI A;  2FQ3 A;  1MD0 A;  1Q1V A;  4HF0 A;  4IF4 A;  3K4K A;  4DQ2 A;  3BTL A;  1TW2 A;  2P4W A;  1IO2 A;  5LFA A;  5EGO B;  3WE2 A;  1N25 A;  2HOS A;  3IAS 2;  4G9Y A;  4LG3 A;  5LHI A;  3U9G A;  3NWT A;  2JA2 A;  3FIS A;  3F8N A;  4A0Y A;  2FOW A;  4MLO A;  3PJR A;  4CCK A;  2GQQ A;  1WJ5 A;  3TBI A;  1JKP C;  1LE8 A;  1VND A;  3Q0W A;  5B66 C;  1SD4 A;  3RKQ A;  4EJV A;  4RB0 A;  2HQA A;  3EQL F;  3CO6 C;  1OCO H;  1ENH A;  2DA3 A;  3O2P E;  2Z3Y A;  3BG9 A;  4BH9 A;  2XAF A;  2GAU A;  2X51 A;  5F1R A;  2KIF A;  2R92 J;  1HOM A;  2CQX A;  1RI7 A;  5IOZ A;  4XOT A;  2L7Z A;  4M9S A;  3CMM A;  3GXO A;  3WGG A;  4MHG A;  2BY3 A;  2E7X A;  3S1M J;  1S7O A;  2EV5 A;  2L7F P;  3LSI A;  1E2X A;  4NQW A;  3WTZ A;  1K78 A;  2H09 A;  2NYX A;  3CLQ A;  2XPU A;  4UNO A;  1PJR A;  1J7K A;  2ZCW A;  2JT1 A;  4YG2 F;  5D8K B;  1MDM B;  4KUM A;  4A3M J;  4BE2 A;  1BJZ A;  2ETH A;  4PFP A;  3ZQC A;  3VPR A;  1QGP A;  3FK7 A;  4BJT A;  1CGP A;  2WY8 Q;  1P4W A;  1R00 A;  2JRM A;  3HG9 A;  5E8G A;  1FP2 A;  4JYK A;  4BQQ A;  1YJN I;  5J3L A;  1IRZ A;  1ZTR A;  2L9S A;  1L3L A;  1VZ0 A;  1ZRE A;  1PUE E;  6PAX A;  4PJL A;  1WSU A;  1OIS A;  4BBS J;  3DLL F;  1X3W B;  2VKD A;  1LDD A;  4YRV A;  2DJI A;  2K4B A;  3Q9V A;  5GTH C;  4PDK A;  1O7L A;  1OLT A;  3K7A J;  2Y0S A;  3E1S A;  4EAT A;  3F22 A;  1BC8 C;  1ACI A;  2J5P A;  4BEH B;  3L2Q A;  4U0W A;  2WV1 A;  3DKY A;  3RKX A;  3N05 A;  2CV2 A;  3LNQ A;  1T38 A;  2HKX A;  2L2O A;  2CUF A;  1J0R A;  3I5U A;  4E6K G;  3E5U A;  4XID A;  1H88 C;  4I02 A;  2QVO A;  5JFR A;  1G6N A;  2ZXW H;  1HW1 A;  1NG7 A;  3I59 A;  3SXY A;  4A3I J;  4CXF A;  1CQT A;  2AQE A;  2P5L C;  5LBQ A;  3HL2 A;  4LIT A;  3K2A A;  5CVU A;  2QGU A;  1OQY A;  2MC4 A;  5HS7 A;  3ZPL A;  4KN4 X;  4D9J A;  1AHD P;  3ESW B;  1J5Y A;  5EJC A;  4PJ0 C;  4L0Y B;  4YIR X;  3RZD J;  1YIT I;  3S16 J;  3LMM A;  3MKW B;  2EPF A;  2Z1D A;  5DCF A;  5HNH A;  2IJL A;  4KA4 A;  4M3G A;  3U1D A;  3K6G A;  5FD5 A;  1LJ9 A;  3L2V A;  2ZXH A;  1T98 A;  2YU9 J;  4XSX F;  2H6C A;  5KK1 A;  1KON A;  1ZAR A;  1VI0 A;  4MNU A;  4WXC A;  1E3P A;  2DPU A;  3HM5 A;  2O8K A;  3CJN A;  4M6X A;  5L3C A;  3O6B B;  1ZYR F;  3KCC A;  1RRJ A;  3GTO J;  5EZH A;  2QQB A;  1MNM C;  2FOK A;  2KIM A;  2ZXJ A;  1YRN B;  3H3Z A;  2VT2 A;  4B47 A;  3RTR A;  5A2Q Z;  3CJR B;  1OPC A;  4RGS A;  1VQ8 I;  1I6H J;  2O6G E;  2HS5 A;  2V9V A;  4FE7 A;  4ITV A;  4J19 A;  3OSG A;  1GT0 C;  3S14 J;  2E7W A;  1P4A A;  2MW8 A;  4XR6 A;  3DWL E;  1X3U A;  3FXM A;  4RB2 C;  3JRD A;  3LL7 A;  3SEQ A;  3I4P A;  4I76 A;  3RPU A;  1XGN A;  2KZG A;  2FBH A;  2VBW A;  4IXA A;  1T2K A;  3H3U A;  2PMZ N;  2DJN A;  3VYU B;  1WQ2 A;  2V6C A;  3DPL C;  4JBA A;  1SFO J;  3EUH A;  3J7Y J;  2VBY A;  2QKL B;  4DYR A;  3CUQ C;  1D5V A;  2BY1 A;  4G7O F;  5GPA A;  5JR3 A;  3WE3 A;  2ECB A;  3GLL A;  4BJ5 C;  3RYR A;  2QEX I;  1B8I A;  2CH0 A;  3OYG A;  1IW7 F;  1GVJ A;  1HF0 A;  2CWE A;  2X85 A;  2DTR A;  4ZYH A;  3EYY A;  3G71 I;  2NS8 A;  4EV0 A;  4D7M A;  1TNT A;  2P5V A;  2RNG A;  3FXK A;  3ONQ A;  4C30 A;  4C3J J;  4AUX A;  4ZJZ A;  1BR4 A;  4GXO A;  3F23 A;  5D8L B;  3JRH A;  1IV6 A;  2W24 A;  2LY9 A;  2CRG A;  4HLY A;  3HHG A;  1BBY A;  2R7V A;  1XSV A;  2V9P A;  2DOE A;  1ETQ A;  1UST A;  3CME I;  1ZR2 A;  4OOI A;  1YHQ I;  3ELK A;  1I6X A;  1V5E A;  1VQ9 I;  4OWR B;  3HOW J;  4K2E A;  3EUA A;  3I3L A;  4A3D J;  5DUI A;  1REP C;  5B1B H;  1R7J A;  3RCO A;  2JWT A;  1BIB A;  1FMV A;  2LOO A;  3QP6 A;  4NNJ A;  1W36 C;  4FX4 A;  3K4B A;  5FKK A;  1U8B A;  1GV2 A;  3VSK A;  2F5C A;  3JRG A;  3G4S I;  2R5Z A;  4MO7 A;  5E8I A;  3MZ8 A;  5EEG A;  3BQY A;  4QTR A;  4UUT A;  1R1T A;  2LK2 A;  3FZV A;  1ZQ3 P;  3SDG A;  4HNU A;  3MQ0 A;  1F9N A;  2WAE A;  4M3F A;  2XDV A;  3MMY B;  3HRS A;  1FSH A;  3AG1 H;  4KT5 C;  3E3V A;  2EIM H;  2W1O A;  1PP7 U;  2COB A;  3Q9S A;  1WVR A;  4B3A A;  2HXO A;  5AIQ A;  3GF2 A;  2XRL A;  5FRO A;  1USS A;  2LY1 A;  4D7N A;  5JHF A;  2E2J J;  4S0H B;  3ZQG A;  4GCV A;  3H3V K;  2VAS A;  2OAZ A;  1YOV B;  1YLF A;  3CCR I;  3S17 J;  4KT6 A;  3GTP J;  2DAO A;  3ZR8 X;  2OZ6 A;  1JTY A;  3N4M A;  1DGR M;  5FRM A;  1PYV A;  2XB0 X;  4IL6 C;  2UXX A;  2WAQ A;  2QWW A;  2VI6 A;  5LHG A;  4UVA A;  1GV5 A;  4OMY A;  2GLO A;  1IRG A;  5IP6 A;  3G73 A;  2F48 A;  2LDU A;  3LSJ A;  4MGR A;  5E20 A;  1W5C C;  2P7C B;  5EGO A;  1YJ9 I;  2EWN A;  5FLX Z;  2WC2 A;  5F0C A;  4LB6 B;  4L9J A;  1MSF C;  4L0Z B;  1I3A A;  1DP7 P;  2VXD A;  1TT5 B;  3FXJ A;  3WHC A;  5BOX A;  1D0Y A;  1YX5 A;  4NUB A;  3BJO A;  2JA8 J;  2ISY A;  1WJC A;  4U7B A;  3P7N A;  1K6Y A;  2XKP A;  3WTW C;  3E7L A;  5LRS A;  3EPZ A;  9ANT A;  1EH8 A;  4DOZ A;  2DW4 A;  4BE0 A;  3U2R A;  2IVM A;  3GUD A;  2LH9 A;  3DU5 A;  1S8N A;  3DXJ F;  3DBL B;  2HXI A;  3BOQ A;  2X48 A;  2R4G A;  1FTT A;  1VQP I;  3S1N J;  3M4O J;  4I09 A;  4O3M A;  2MSY A;  2KP6 A;  2QZ8 A;  4A5N A;  2XV4 S;  3WGI A;  4JX6 A;  2HTJ A;  3W3C A;  1U2W A;  2RNJ A;  2V4J C;  5E17 F;  1MH3 A;  1H9G A;  2DA6 A;  1MDM A;  2HFH A;  3M1E A;  2PI0 A;  2K3F A;  1LVA A;  2E5Z A;  1X19 A;  3BZC A;  2LTP A;  2CSO A;  3CJQ B;  2DQR A;  2DA1 A;  1OYI A;  2UXN A;  3CDI A;  3LSG A;  4I0B A;  3V8L A;  4XMY A;  3N97 A;  2LRE A;  4EM2 A;  1RIO H;  4LOC A;  2CQ7 A;  2CFX A;  2MLK A;  1X3Z B;  3HRT A;  2WA0 A;  3H5N A;  3H5R A;  2IGN A;  5LLQ A;  2BXZ A;  3PL8 A;  4CCO A;  3QPH A;  4HV6 A;  1W36 D;  2M5W A;  2KJB A;  2A5Y B;  1YYV A;  1P6R A;  2L4M A;  4RBO A;  3OYK A;  4BEH A;  4LIV A;  1Z6T A;  5IP7 J;  3DEU A;  2EZK A;  3HOX J;  3G1M A;  3MZY A;  3P5J A;  2K40 A;  4E7I A;  3HXL A;  2MYS A;  4XN0 A;  1K78 B;  1IXS B;  5HNF A;  4UUS B;  2J5O A;  1VFC A;  3LST A;  2W48 A;  5IT3 A;  3K4J A;  3L09 A;  3A01 A;  4AC0 A;  3K1M A;  1W7P B;  2EK5 A;  1VF9 A;  4GGG A;  2FNP A;  2PLY A;  1IG7 A;  1JJ8 C;  1EH7 A;  2X1D A;  4AVZ A;  1WFX A;  2XUB A;  5B3S H;  4MTE A;  2K9L A;  2OV7 A;  3F21 A;  2QBY B;  1TLH B;  2IA0 A;  3S32 A;  2OUM A;  5C44 J;  5DD8 A;  3R60 A;  1V54 H;  1IDZ A;  5DM6 F;  1QRY A;  2OU2 A;  2VT3 A;  2KIQ A;  3E6C C;  3B73 A;  4DW6 A;  4ESB A;  3CCE I;  2HTS A;  5E3N A;  2VOD A;  2AHQ A;  1VQO I;  4N4N B;  2Y2Z A;  3LSK A;  1OYY A;  3SYT A;  4IKF A;  2BY2 A;  2JK3 A;  5LEK A;  5HOD A;  3PNV A;  2FRH A;  4LK1 F;  2DA2 A;  2DOA A;  3LSM A;  4P55 A;  2D2W A;  3QRF F;  4UXN A;  4CCN A;  4BDZ A;  5J4Y A;  3S1R J;  3CUQ A;  3KZI C;  3W2V A;  4N9I A;  1G3S A;  4JOM A;  1XS9 A;  3QPT A;  2KQR A;  1SD5 A;  2CQK A;  4BGD A;  4KIT B;  3I59 B;  1WGX A;  2VQG A;  4RGR A;  4EJT A;  1T8I A;  1QHG A;  3WU0 A;  4CYD A;  2XRO A;  4RDU A;  2EIN H;  4II3 A;  4G8X A;  4L5E A;  3RPQ A;  2BHZ A;  3PM1 A;  3I56 I;  3MZH A;  2IA2 A;  2FSW A;  4J01 A;  2PBI A;  3I55 I;  3OIQ A;  1DP3 A;  3F3X A;  2HZD A;  2I10 A;  2OA4 A;  2YX7 A;  2OCC H;  5IY5 H;  4ENK A;  3PNY A;  1IAW A;  2IEK A;  4BQN A;  1O3T A;  5CKT A;  4ZYA A;  3JRE A;  2G7H A;  3E5Q A;  2M8G X;  1ZGJ A;  1IN6 A;  4YEL A;  4CYC B;  2WAD A;  3S2H J;  3DPT A;  4XLH A;  4M71 A;  4C2M J;  4MFE A;  2HVS A;  1WJA A;  2R7R A;  1UJ8 A;  1QU3 A;  4XKV A;  1VQ6 I;  3TDU C;  3H0D A;  3S93 A;  2EZH A;  5J1R A;  1FMW A;  1MBH A;  1Z67 A;  2ZNY A;  1Z7L A;  1IRX A;  4A69 C;  1XC5 A;  2EJR A;  3FXQ A;  1WRJ A;  2DU9 A;  4RAF A;  2ELH A;  2ME0 A;  2FEZ A;  2G7U A;  4HX7 A;  3FKJ A;  2HYG D;  1X58 A;  4XLN F;  5FD6 A;  1TQI A;  1F43 A;  2DO7 A;  3SFI A;  2LLK A;  2R7W A;  4XLF A;  4CDG A;  3I71 A;  2GWR A;  1IN5 A;  5DTD A;  1Z05 A;  2KDZ A;  5GAH J;  2VE8 A;  3HTU A;  2Z33 A;  3CC4 I;  1UB9 A;  3A1Y A;  3M8F A;  3DKW A;  5FKL A;  3TGN A;  4XRS A;  3E6D A;  2QA4 I;  4IJA A;  2V1D A;  4KIS A;  3IRR A;  1U3E M;  3PSI A;  1IGN A;  5JI6 A;  1BM9 A;  3D5L A;  4UV8 A;  2M3A A;  3SDB A;  3ASO H;  5IYD J;  2KRH A;  3NQO A;  2H1L A;  2EIK H;  4HW0 A;  5EF6 A;  3OYL A;  1JJ6 C;  1ONV A;  4BQO A;  3TED A;  2HPM A;  3H9Q A;  5KNL A;  2NVX J;  1WJE A;  1FLI A;  1VQ4 I;  4G6D A;  1FY7 A;  3DPU A;  1W5S A;  5BS6 A;  2XAH A;  2VE9 A;  3JRA A;  2QEN A;  3KE2 A;  1K79 A;  4OIQ F;  1D0Z A;  5CPR B;  2CW7 A;  1MMG A;  5EEA A;  3BQZ A;  5LRR A;  2X6W A;  2ELK A;  4A3C J;  5D6F A;  4YFX F;  4RA2 A;  4XL9 A;  3BJ6 A;  5L3E A;  4HV5 A;  5J6X A;  4M3D A;  1W7P D;  3KET A;  3O8H A;  1X1B A;  3HOT A;  2D1V A;  4NC7 A;  4FAS D;  2XSD C;  3VYT B;  2D45 A;  4I0A A;  5ICF A;  1J75 A;  4OU0 A;  3HSE A;  2PN6 A;  1X4O A;  3L2R A;  2W57 A;  2OQG A;  3DLA A;  1S3J A;  4QPQ A;  3P9C A;  4G12 A;  2A6E F;  4BBR J;  4KJZ A;  2CYY A;  3CP2 A;  1G4D A;  3WTY C;  1C0W A;  3CES A;  2AXL A;  2HQR A;  2HYF A;  1FTZ A;  2NNY A;  3GYH X;  3ZQ7 A;  3FXR A;  1PVE A;  1FBU A;  1LFB A;  4DZJ A;  2JZY A;  3J81 K;  1MGT A;  2XGE A;  1YW7 A;  3TO9 A;  4N9H A;  2L54 A;  3WHB A;  1OFC X;  2EIL H;  3FBN B;  3SZT A;  1Y6I A;  3F8M A;  3K4M A;  1RKT A;  3BR0 A;  5F27 A;  3BR2 A;  3KX2 A;  3OR1 C;  3BTI A;  3M9A A;  1YI2 I;  1G59 A;  1WH7 A;  1G3W A;  5CVV A;  2I8D A;  2LVS A;  1H8A C;  4C2T A;  2XB5 A;  1X1C A;  2XIG A;  3C2H A;  1RZ4 A;  3PIO F;  4RMN A;  2GBY A;  4UVC A;  2A5W A;  3HOU J;  1OMI A;  2KIU A;  4CUG A;  1S9H A;  5DD4 A;  4BU2 A;  1O3S A;  1FT9 A;  1ZRD A;  2IT0 A;  3K2Z A;  1Y8Q B;  4F3Q A;  1XX5 A;  2X6X A;  3CDL A;  4FE4 A;  3K1N A;  3ML6 A;  4UB8 C;  2CUJ A;  3SZG A;  5B5E C;  2K5C A;  2MH2 A;  2V26 A;  2O61 A;  3A0H C;  4LG0 A;  2BGC A;  2QM3 A;  2ELJ A;  1X1A A;  4XLA A;  2Y69 H;  2PJP A;  5K5Q A;  4A5M A;  4UB6 C;  3QU3 A;  2RQQ A;  1KU9 A;  5CVR A;  2Y9Z A;  4F7Z A;  4A6D A;  2IS1 A;  1SEU A;  4J00 A;  1POG A;  2XAQ A;  3T8T A;  4UUS A;  2K02 A;  1KU7 A;  2DFE A;  4ON0 A;  3RPU D;  3OSF A;  3OYJ A;  2GZW A;  2LC2 A;  3HOS A;  1ZG5 A;  3I0T A;  3CUO A;  1W7P A;  4B44 A;  2RC4 A;  2QUF A;  3ZOB A;  5H6R A;  4ESJ A;  2LF8 A;  4Q47 A;  4E7K A;  1LKX A;  3K4N A;  2W00 A;  3ASN H;  2H1K A;  4Y4R A;  3I4N J;  2CGP A;  1X1P A;  2QSF X;  3Q3S A;  4PJM A;  1YJW I;  2QBY A;  5GAG J;  2QSH X;  2GXB A;  1FPQ A;  4WK8 F;  4B1R A;  3H5A A;  2A61 A;  1DPU A;  4Y7N J;  2IXS A;  4F52 A;  2NNN A;  3HJE A;  2XF6 A;  3JRC A;  1S6L A;  4D0P A;  3V7S A;  2WB1 N;  4PCQ A;  3MWM A;  3W2A A;  2VOO A;  2O8X A;  2ZO4 A;  5CVI A;  3GCM A;  1W0T A;  4LGW A;  3MCZ A;  3RDI A;  2RRE A;  3JCU C;  2VJ4 A;  3CC7 I;  4ENJ A;  4CGZ A;  1OCC H;  1XPX A;  1T6S A;  4U88 A;  3R0A A;  5F64 A;  5ICE A;  1AA7 A;  4A3L J;  3FXO A;  3CCM I;  1M1E B;  1ZGA A;  3OYC A;  4AM3 A;  1KYZ A;  4XIC A;  2A68 F;  3OYB A;  4AWX B;  2JSC A;  3HOY J;  1BR1 A;  1SMT A;  1WJF A;  2BV6 A;  2DN0 A;  2RDP A;  2YSR A;  2F6C A;  1I1S A;  3A01 B;  4XOR A;  1P4X A;  4E7Z A;  1ZRF A;  5L3F A;  4DIQ A;  1IZ1 A;  1K4S A;  2FU4 A;  4XLC A;  2NVQ J;  2DT5 A;  1JGG A;  5JVT A;  4I7H A;  2DQL A;  1W0U A;  3ULQ B;  2EIJ H;  2E36 A;  3B6C A;  1RUN A;  3JAM K;  1R58 A;  3G1L A;  3LSP A;  2CQQ A;  1J2X A;  2R7U A;  1MZB A;  4M9X A;  4O5V A;  3LOC A;  4D5F A; 
#chains in the Genus database with same CATH homology
 2GLO A;  1A6I A;  1MBF A;  1I3Q J;  4CYC A;  3OIO A;  5IP6 A;  2X6O A;  4AYB N;  5C4X J;  3LSJ A;  5EGO A;  1ETO A;  4B4C A;  4XK4 A;  1MSF C;  5F0C A;  2CUE A;  1TWG J;  2NVY J;  3GBG A;  3MKL A;  3WHC A;  1OJL A;  1ZKG A;  4IEJ A;  1JUM A;  1HCR A;  1RR7 A;  2JA8 J;  4ABZ A;  1BW5 A;  3TW7 A;  3E7L A;  2O9L A;  1NK3 P;  9ANT A;  3HB9 A;  1FIA A;  1WH5 A;  2MGQ A;  2JN6 A;  1MSE C;  2CJJ A;  2R7Z J;  5FKM A;  2HXI A;  5FKO A;  2X48 A;  5F0F A;  1FTT A;  1IC8 A;  3S1N J;  3M4O J;  1U9N A;  2MSY A;  1ZGW A;  2Y30 A;  2DA7 A;  2LP0 A;  2DMQ A;  5IYB J;  5IYC J;  1U78 A;  1K61 A;  3ZQH A;  2QCO A;  2DTZ A;  3HGG A;  4JX6 A;  3ZQF A;  1EF4 A;  3GTK J;  3TP0 A;  2E2H J;  1MH3 A;  2DA6 A;  1ETK A;  5IPA A;  5FLV A;  2GM4 A;  2O7O A;  5DS9 A;  1P7I A;  1DU6 A;  2LTP A;  3GTM J;  2EH3 A;  2JA5 J;  1RKW A;  2VKV A;  2DA1 A;  3JRI A;  3LSG A;  3PO2 J;  5EYR A;  2TCT A;  2YUS A;  3C2B A;  4FTH A;  3BR6 A;  4LOC A;  1NK2 P;  2AO9 A;  1RET A;  3B6A A;  5K7H A;  1FIP A;  1JT0 A;  4IHX A;  5M5X J;  2MG4 A;  5E3L A;  2FD5 A;  3F0C A;  3HKZ N;  2X9D A;  1E3O C;  3M3Y J;  3S2D J;  2L7M P;  4JP0 A;  4RBO A;  1B8I B;  2EBI A;  2JJ7 A;  5EG0 B;  2R5Y B;  5IP7 J;  3HOX J;  2EZK A;  3G1M A;  1B72 A;  4FCY A;  4MIM A;  2HDD A;  2K40 A;  2Y31 A;  2R0Q C;  1UHS A;  4UUS B;  2K9Q A;  1VFC A;  2W48 A;  3A01 A;  3IH2 A;  4AC0 A;  1VF9 A;  5K7Z A;  1IG7 A;  5GPC A;  3NAU A;  1JJ8 C;  3BT9 A;  4QIW N;  1X2M A;  2M0C A;  3W6V A;  2Y0S N;  1MBK A;  1FEX A;  3DEW A;  1A5J A;  5E3M A;  3BR3 A;  5FLM J;  2Y9Y A;  2OF7 A;  5C44 J;  1PUF A;  3GTL J;  1IDY A;  2JA6 J;  1IDZ A;  1QRY A;  2DMU A;  5IP9 J;  4A3E J;  3ZQI A;  3CCY A;  4DW6 A;  4GFB A;  5M3M J;  2LFB A;  5E3N A;  3GTJ J;  2AHQ A;  2Y2Z A;  1AKH B;  5GP9 A;  5JLX A;  5IOY A;  1IJW C;  3L1P A;  2LD5 A;  5JLW A;  2R5Z B;  2JK3 A;  4FIS A;  5HOD A;  3HOZ J;  4M3E A;  2HYJ A;  1UG2 A;  2DA2 A;  4M6V A;  1WPK A;  1ITY A;  3S1R J;  4BXX J;  2RAE A;  3QPL A;  3HOV J;  1XS9 A;  5K7F A;  1ETY A;  5EZG A;  2HQ5 A;  4A3K J;  4A3B J;  3HDD A;  2HOA A;  1FJL A;  1WGX A;  1QVT A;  1QPI A;  4W1U A;  2XGC A;  5FKN A;  4A3J J;  3TP3 A;  4RDU A;  3BG5 A;  1WI3 A;  2DA5 A;  2OPT A;  3Q0V A;  4L5E A;  3PM1 A;  1O4X A;  4JX4 A;  1GDT A;  2K9S A;  4JX5 A;  2XGD A;  5J1Y A;  2I10 A;  1TWH J;  2YS9 A;  1JKR C;  2IEK A;  1RES A;  1TWF J;  2M34 A;  3BR5 A;  1TWA J;  2HOT A;  3JRE A;  5F1J A;  3IH3 A;  5J1U A;  2M8G X;  1ETX A;  1MH4 A;  2KT0 A;  2EZI A;  1Q1V A;  4CYC B;  3S2H J;  4C2M J;  4M3B A;  3BTL A;  4MFE A;  5EGO B;  1F36 A;  1D5Y A;  2HOS A;  2VKE A;  1Z0X A;  1P7J A;  2EZH A;  5J1R A;  1MBH A;  3BR1 A;  3HBL A;  3FIS A;  4A69 C;  1XC5 A;  3G1O A;  4MLO A;  2FJ1 A;  2ME0 A;  1JKQ C;  1JKP C;  1LE8 A;  1VND A;  1X58 A;  3Q0W A;  2ID6 A;  4DZP A;  3RKQ A;  1DU0 A;  4C3I J;  1JUP A;  1F43 A;  3SFI A;  4IHV A;  4BY7 J;  2LLK A;  1OCT C;  5EG0 A;  2EZL A;  1ENH A;  2IBD A;  4MFD A;  2DA3 A;  1G2H A;  1TWC J;  2P81 A;  3BG9 A;  1HOM A;  4X1E A;  5M3F J;  5DTD A;  2R92 J;  2CQX A;  5IOZ A;  2KDZ A;  2L7Z A;  1JT6 A;  2D5V A;  3S1M J;  2L7F P;  5FKL A;  4XRS A;  3CMY A;  1BW6 A;  2XPU A;  3MN2 A;  1IGN A;  4A3G J;  2G0E A;  3OOU A;  3IH4 A;  1MBE A;  5IYD J;  4A3M J;  1BJZ A;  1BL0 A;  5F08 A;  5EF6 A;  1QVU A;  3ZQC A;  3VPR A;  1JJ6 C;  3S15 J;  5C3E J;  3HEF A;  3FK7 A;  1MBG A;  3TED A;  3BG3 A;  2NVX J;  4V2F A;  1ETV A;  2NVT J;  4JYK A;  3JRB A;  1TC3 C;  5J3L A;  1OCP A;  1T56 A;  1ORK A;  1ZTR A;  4C3H J;  1IRZ A;  3JRA A;  5BNG A;  3CQZ J;  3I4M J;  3D1N I;  4BBS J;  3BTC A;  3S1Q J;  5EEA A;  3BQZ A;  1R9T J;  4A93 J;  2ELK A;  4A3C J;  3K7A J;  4XRS G;  1SAN A;  1Y1V J;  2ZB9 A;  1X2N A;  4M3D A;  2M2E A;  1JKO C;  3O8H A;  1ZK8 A;  2WV1 A;  4DYC A;  2XSD C;  3LNQ A;  2CUF A;  1XG1 A;  2NS7 A;  4XID A;  4I6Z A;  1H88 C;  2NOG A;  2E2I J;  4A3I J;  1CQT A;  4G12 A;  4BBR J;  2XPW A;  3MVP A;  1U9O A;  3K2A A;  3A02 A;  1JTX A;  1AHD P;  4BY1 J;  4QSH A;  3QPS A;  1FTZ A;  1JUS A;  3ZQL A;  2TRT A;  3RZD J;  2WAQ N;  5F0H A;  1LFB A;  4DZJ A;  3S16 J;  2EQR A;  3GTG J;  1BA5 A;  2VPR A;  1PUF B;  2DA4 A;  4M3G A;  2M9H A;  5C4J J;  2DMP A;  2JA7 J;  1Y1W J;  3TW6 A;  2YU9 J;  2XGE A;  3UKG A;  1VI0 A;  2ID3 A;  3HM5 A;  2O8K A;  3WHB A;  1OFC X;  4HNV A;  2R93 J;  3H0G J;  5EZH A;  3GTO J;  1MNM C;  2H8R A;  1RKT A;  1YRN B;  3BR0 A;  5F27 A;  3BR2 A;  3BTI A;  1WH7 A;  1T33 A;  2LVS A;  1H8A C;  1I6H J;  4FE7 A;  1HDP A;  4J19 A;  1GT0 C;  3OSG A;  3S14 J;  2B63 J;  2CU7 A;  2XB5 A;  1UMQ A;  2MW8 A;  3LSR A;  4V2G A;  3JRD A;  2GBY A;  2FQ4 A;  3HOU J;  4I76 A;  3A03 A;  3DCF A;  2JMW A;  2DMT A;  3HGY A;  2PMZ N;  2DJN A;  1GVD A;  3CDL A;  4FE4 A;  1SFO J;  5FJ8 J;  2ME6 A;  4EEF G;  4DYR A;  1APL C;  5GPA A;  2XPV A;  2LKX A;  2ECB A;  3IV5 A;  1B8I A;  3JRF A;  2R5Y A;  3QQA A;  1NTC A;  1HF0 A;  2NS8 A;  2Y9Z A;  4D7M A;  5M5Y J;  3Q0U A;  1S7E A;  4C3J J;  1H89 C;  2QF7 A;  4AUX A;  4IHW A;  1POG A;  4UUS A;  4NDL A;  3JRH A;  1IV6 A;  3OSF A;  2LY9 A;  2CRG A;  2ECC A;  3FIW A;  1K83 J;  3RQI A;  3ZOB A;  1ETQ A;  1Z77 A;  2N8G A;  1I50 J;  1ZR2 A;  2H1K A;  1WCM J;  4DYQ A;  3I4N J;  3Q3S A;  3BTJ A;  1LE8 B;  3HOW J;  4BKX A;  4A3D J;  2E1O A;  4B1R A;  3RZO J;  5M5W J;  2JWT A;  3FKI J;  4Y7N J;  3NAR A;  4A3F J;  5EDN A;  3JRC A;  5FKK A;  1U8B A;  1GV2 A;  2L9R A;  2WB1 N;  1AKH A;  1AU7 A;  4IHY A;  3JRG A;  1W0T A;  2R5Z A;  4MO7 A;  3O8G A;  3BQY A;  4QTR A;  4UUT A;  4W97 A;  2LK2 A;  4A3L J;  1ZQ3 P;  3SDG A;  3JR9 A;  4M3F A;  1B72 B;  1MBJ A;  1RPW A;  2HI3 A;  4XIC A;  2LR8 A;  1ETW A;  2VUM J;  3HOY J;  2IAI A;  2DN0 A;  2K9N A;  2COB A;  4B3A A;  1HLV A;  2HXO A;  3PO3 J;  3GTQ J;  1IUF A;  4Y52 J;  3A01 B;  2XRL A;  1HDD C;  4D7N A;  2L0K A;  2E2J J;  2NVQ J;  2E19 A;  4S0H B;  3ZQG A;  1LFU P;  1JGG A;  5E3O A;  3H3V K;  5F04 A;  2FX0 A;  3FK6 A;  1W0U A;  3S17 J;  3GTP J;  1GUU A;  3B6C A;  3SJM A;  2DMN A;  4X6A J;  1JTY A;  4D5C A;  3G1L A;  1ZR4 A;  3LSP A;  1YRN A;  2CQQ A;  2XB0 X;  2VI6 A;  4XRM A;  4D5F A;  3LOC A;  1GV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...