3CMYA

Structure of a homeodomain in complex with dna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
60
structure length
60
Chain Sequence
GQRRSRTTFTAEQLEELERAFERTHYPDIYTREELAQRAKLTEARVQVWFSNRRARWRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Paired box protein Pax-3
publication title Structural Basis for DNA Recognition by the Human PAX3 Homeodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator/dna
total genus 22
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2008-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3cmyA00
1GT0C 3OSGA 2CRGA 4XRSG 4UUTA 4UUSB 5F08A 3BQZA 2DA5A 3O8HA 3S15J 4A3LJ 2CQQA 4IEJA 3GTOJ 1OJLA 2DA1A 3HEFA 1BJZA 3FK7A 1TWAJ 3HOZJ 1QRYA 3HBLA 2R92J 2JMWA 1POGA 4DYRA 4JX5A 2E2HJ 2X9DA 4XIDA 5FLVA 1I50J 3OOUA 2YU9J 4DZJA 2R5YB 4CYCA 4BBRJ 1OCTC 2I10A 4V2GA 1ETWA 1FIPA 1JJ6C 1ETXA 2AO9A 3MVPA 3BTIA 1H88C 2VKVA 2D5VA 3HGYA 5E3NA 4M3FA 1T56A 1APLC 5J1UA 3S14J 2HOTA 2DMPA 2NVYJ 1U9OA 3S2HJ 3I4NJ 1Z77A 2CQXA 4GFBA 1QVTA 4A3DJ 3WHBA 1H8AC 3BQYA 3CQZJ 1DU0A 2GM4A 1ITYA 1VNDA 3W6VA 1IUFA 2M8GX 1ETOA 3LOCA 4XICA 4X1EA 1JT6A 2ME6A 3BR3A 4L5EA 1RR7A 1ZR2A 1ZR4A 5IYCJ 2LD5A 1PUFA 3IH3A 4C3JJ 1Z0XA 3JRHA 2JN6A 4DZPA 1IDZA 5JLWA 2FX0A 1MH3A 2R5ZB 3ZQHA 5DS9A 2MGQA 2QCOA 1VI0A 3BG5A 3HOYJ 1JGGA 2M2EA 1HDDC 3PO2J 1IRZA 4MIMA 5FKLA 1H89C 3OSFA 2LY9A 4MFDA 1IG7A 1SANA 2E2IJ 1HLVA 3RQIA 3TP0A 1B8IB 3BR0A 1HDPA 3C2BA 3HDDA 3K7AJ 4RDUA 4S0HB 1JKRC 5IP9J 1TC3C 1G2HA 2Y9YA 1GV2A 2COBA 1X58A 5K7ZA 3HKZN 1GUUA 5F04A 2LLKA 4D7MA 5F0FA 2MSYA 3BR5A 3S1NJ 5J1RA 1MSFC 2HYJA 3I4MJ 2X6OA 1UHSA 1ZGWA 2XB5A 4I76A 4B3AA 1OCPA 2R7ZJ 2B63J 2HOAA 2VKEA 3HGGA 2Y2ZA 3H0GJ 4X6AJ 1U78A 3GTMJ 1YRNB 4I6ZA 1JKOC 2NVTJ 3PM1A 3FKIJ 2HDDA 1R9TJ 3NAUA 2DMUA 1IDYA 1FTZA 1Q1VA 2NS8A 2JA7J 2M34A 5J3LA 4V2FA 4A3JJ 4RBOA 2GLOA 1ETVA 2LTPA 1MSEC 5K7FA 3H3VK 3L1PA 3BTCA 3A01B 1TWGJ 4JP0A 5FKOA 2LVSA 3BG3A 2E1OA 1BL0A 3ZQFA 2L7ZA 1JUMA 2KDZA 3GTPJ 3QPSA 2IAIA 3PO3J 3JRGA 1XS9A 5M5XJ 5C4XJ 4Y7NJ 1D5YA 3GTQJ 3G1OA 3IV5A 2XGCA 2EZHA 1X2MA 5IYBJ 5JLXA 4LOCA 2CU7A 4MO7A 1ORKA 4DYCA 4A3BJ 1WGXA 2NVQJ 2N8GA 3JRIA 2P81A 4C3IJ 2NS7A 5EGOB 2H8RA 2DA2A 2ELKA 1RESA 3S17J 3RKQA 2K9SA 3DCFA 2X48A 2MW8A 2O9LA 3HOWJ 4QSHA 3MKLA 3B6CA 1JKQC 3HOXJ 1GDTA 2EZLA 5E3MA 1Y1WJ 1B72B 4B4CA 4Y52J 2JA6J 1LE8A 3S1MJ 4A3CJ 1JT0A 5EG0B 2R0QC 1A5JA 1TWCJ 1P7IA 5EYRA 1O4XA 1HF0A 1IV6A 1ZQ3P 2EBIA 2Y9ZA 2JA8J 3HOUJ 1GVDA 4FE4A 2FQ4A 4XRMA 3D1NI 2H1KA 1AU7A 4IHVA 1AKHB 5EZGA 4C2MJ 1JKPC 1VFCA 2CUFA 2DMNA 3LSJA 1WCMJ 4UUSA 5J1YA 3TEDA 2LR8A 1W0UA 1QVUA 3HB9A 3K2AA 5M3MJ 4DW6A 3CDLA 1WI3A 2Y31A 4B1RA 1ETYA 3CMYA 1MBFA 3LSRA 4A93J 2K40A 2YS9A 5GPAA 5F0CA 4MFEA 3S1QJ 2EZIA 3ZQCA 3BR2A 1WPKA 1RPWA 4BBSJ 1Y1VJ 5GP9A 2DN0A 3BG9A 5EEAA 4IHYA 1MH4A 4A3EJ 3MN2A 2R5YA 5FLMJ 3RZOJ 1T33A 3QQAA 2NVXJ 4BY1J 4FISA 1BW6A 3VPRA 4BKXA 4A3FJ 3JR9A 5FKKA 2DMTA 1MBEA 2XSDC 3B6AA 3BTLA 5F27A 2XGDA 4A3MJ 2ME0A 4AYBN 1BA5A 1SFOJ 1XG1A 3GBGA 4JYKA 4M3EA 1RKWA 1XC5A 2XB0X 4QIWN 2DA6A 3E7LA 3ZOBA 1AHDP 3GTGJ 1FIAA 1F36A 4M3GA 4CYCB 1U9NA 1WH7A 4J19A 4A3GJ 4M6VA 1K83J 9ANTA 2EQRA 2R93J 3ZQIA 5EF6A 2WAQN 3JRDA 2ECBA 2NOGA 1W0TA 5M3FJ 1UMQA 2IEKA 2E2JJ 3O8GA 1ZTRA 1LFBA 2KT0A 4M3BA 4XK4A 3JRAA 1JTYA 3Q3SA 1ENHA 2QF7A 2PMZN 2L7FP 2JA5J 2ID3A 1ZK8A 3JRCA 2L7MP 3G1MA 1B8IA 3DEWA 5M5YJ 4A69C 1PUFB 4EEFG 1FJLA 2EH3A 4XRSA 2FD5A 1MNMC 1NTCA 2K9QA 1MBHA 4QTRA 5C44J 3A03A 3Q0UA 4MLOA 5GPCA 1DU6A 4DYQA 1U8BA 1CQTA 3IH2A 3A02A 3QPLA 2TRTA 2VPRA 1LFUP 5DTDA 5IP6A 2L9RA 3F0CA 3FISA 2DA4A 5F1JA 2XPWA 2IBDA 4D5CA 2JWTA 1A6IA 2DA3A 3OIOA 4D7NA 2CUEA 3SFIA 4C3HJ 1YRNA 1HCRA 2Y30A 3TW7A 2HI3A 3G1LA 3FK6A 3GTLJ 1TWFJ 3M3YJ 5IP7J 1I6HJ 1WH5A 3GTKJ 3ZQLA 3S1RJ 2HOSA 4ABZA 2XRLA 2XPUA 1ZKGA 4AUXA 2HQ5A 2LK2A 2FJ1A 2LP0A 3BR1A 1F43A 2CJJA 4HNVA 4FE7A 2JJ7A 3JRBA 3S16J 3JREA 3JRFA 3Q0WA 3M4OJ 5IOYA 1K61A 2W48A 3A01A 1IC8A 1X2NA 4IHWA 5M5WJ 4FTHA 4A3IJ 4W1UA 5FKMA 1BW5A 4A3KJ 5IYDJ 2G0EA 3FIWA 3LNQA 3HOVJ 5HODA 1UG2A 3CCYA 2DMQA 5FJ8J 2XPVA 1JUPA 2MG4A 3UKGA 1NK3P 2ECCA 5EGOA 1RETA 2LFBA 2K9NA 3IH4A 3SJMA 2TCTA 1IJWC 5EZHA 1EF4A 4JX6A 5C4JJ 1ETKA 2L0KA 3HM5A 5E3OA 1B72A 1JUSA 3WHCA 3TW6A 5EG0A 2HXIA 5FKNA 2AHQA 3LSGA 4G12A 1S7EA 2LKXA 3SDGA 3BTJA 3S2DJ 5K7HA 2O7OA 5E3LA 2WB1N 4FCYA 4AC0A 1IGNA 4W97A 4M3DA 5F0HA 5BNGA 2O8KA 1HOMA 1VF9A 2DA7A 2HXOA 1I3QJ 2M9HA 2WV1A 3ZQGA 3GTJJ 3TP3A 4IHXA 2DTZA 2XGEA 1JJ8C 2DJNA 2JK3A 2YUSA 1AKHA 2Y0SN 1MBKA 4NDLA 4BXXJ 1GV5A 4D5FA 2R5ZA 3NARA 1OFCX 1E3OC 5C3EJ 1LE8B 2EZKA 2M0CA 1TWHJ 5EDNA 3Q0VA 1MBGA 3LSPA 1ETQA 5IPAA 1NK2P 4JX4A 3BT9A 2GBYA 1QPIA 1JTXA 2E19A 2VI6A 2RAEA 2ZB9A 2VUMJ 1MBJA 3RZDJ 4BY7J 1FTTA 5IOZA 2OF7A 1FEXA 3BR6A 1P7JA 2OPTA 1RKTA 2ID6A
chains in the Genus database with same CATH superfamily
3SZPA 2ZKZA 3MWMA 4HF2A 2LYCA 1ZARA 2QA4I 3OWTA 1W36C 2NAZA 5F08A 5K1YA 1QGPA 4ZDOA 2DA5A 1LJ9A 3F72A 5HLTA 2CQQA 1TQPA 3HOZJ 4JBAA 1UFMA 2CWEA 5EEGA 2JMWA 5HDGA 1QZEA 4DYRA 4ZTJA 1WJBA 4II3A 1FT9A 2KISA 4XIDA 5FB2A 5FLVA 4BJ6C 2YU9J 5DYMA 4HQMA 2R5YB 4CYCA 2I10A 4V2GA 1ETXA 3FX3A 3SZTA 3W6JB 3MVPA 3BC8A 5LEJA 5FFXA 4XLNF 3WTTC 1H88C 3HGYA 2DU9A 5JVGF 4XOTA 1PUEE 2QZ8A 3ZRGA 2RDPA 3S14J 3KEQA 3FXRA 3PQKA 1QVTA 3IWFA 5LGTA 1H8AC 1X4OA 3BZKA 1VNDA 4II2A 3LOCA 5EJCA 3VB2A 3V4GA 4M72A 2M45A 2ME6A 3BR3A 1I1GA 1ZR4A 1TQIA 2K9LA 5IYCJ 5TRDA 3IH3A 1OCOH 2HZDA 3DP7A 1EJ9A 4RAGA 2LBFB 4OAYA 2IP2A 4BDYA 4GCVA 4DZPA 3CCQI 1IDZA 1G4DA 2ZSHB 5JHUA 1WJDA 2FX0A 5KK1A 2E34A 2O3FA 1YW9A 4HSRA 2XF5A 2QCOA 1YYVA 3BG5A 1STZA 4MTEA 3OY9A 1MKMA 2VN2A 4LJZF 2RKHA 3M07A 2BHZA 1V5GA 1P2FA 1IZ1A 3OIQA 3F22A 2HYFA 2JPBA 4MTDA 5IT9K 4IQ4A 3GUDA 4BHPA 4BHBA 2E2IJ 2M5WA 1HSJA 1HLVA 4Y33A 3EQLF 2DI3A 2GA2A 1B8IB 3DKYA 3T1BA 3VODA 3N05A 4RLQA 5HS7A 3HDDA 1USSA 3DTIA 1FX7A 4B09A 1FP1D 5CQEA 2KFDA 1A35A 1RUOA 3HC7A 1A36A 5JI6A 2COBA 2HU9A 2VJ5A 5K7ZA 4FX4A 2Y48A 4L9TA 4WXHA 4ASNA 1GUUA 1FLIA 2MABA 3H3UA 4D7MA 5F0FA 1W36D 1YJNI 4A2UA 1KU3A 5JR3A 3BOQA 2XB5A 4NQWA 4B3AA 2E5NA 3C2GA 2DAOA 3HOTA 2O8XA 3OS1A 5CVVA 3S8PA 4X6AJ 2VC1A 3I56I 3G6EI 1K7AA 1YRNB 1JKOC 4ZYHA 2ISYA 3WG9A 1R9TJ 1P4XA 4OIOF 1PJRA 5E8IA 4ZTFA 2LDUA 4XKCA 3QP5A 1Z9CA 3WU2C 4V2FA 1F1ZA 4E4HA 3J7ZI 2IA0A 3CMMA 2EJRA 3B73A 2WTEA 1QA6A 1ZRFA 2A6HF 2NYXA 3L1PA 4U0WA 4HPQA 1VTNC 1ZRDA 4GDFA 3V8LA 4HG2A 1ERDA 3COAC 1SVLA 4ESFA 3E6DA 5FD6A 3DBRB 3FM5A 2XV4S 1YI2I 3ZQ7A 5M5XJ 5C4XJ 4Y7NJ 1K78A 2DJIA 5H6RA 3IV5A 3WTZA 3GFLA 1Z91A 4RGXA 1HBXG 4P5OA 2CU7A 1KGSA 4G8XA 1BI1A 5E18F 3CD6I 3JRIA 3N4MA 2HR3A 2W00A 1AOYA 2ELKA 2F5CA 4S05A 1T0FC 2K9SA 3DCFA 2MBFA 1S72I 1T8IA 5D8LB 3JAMK 2O9LA 2O6GE 4QSHA 5BOXA 2XVCA 4ZYEA 2M8EA 1IUYA 1Y1WJ 1HA8A 5HLGA 4B4CA 3FBNB 3O2PE 3KLOA 4A3CJ 1Z7LA 1E0EA 1LFPA 1P7IA 1W7PD 1HF0A 1P4WA 5IT3A 3FF5A 3VSKA 2DXIA 2ADUA 3SEQA 1VZ0A 3KE2A 2H94A 3Q9SA 5B66C 2QENA 2CW0F 4L9VA 3ZP5A 2FQ4A 1G59A 3WTSC 1ZAOA 3RYPA 1YX3A 2V1NA 3HKZA 1AKHB 3RI4A 5FRNA 5EZGA 3PIPF 2DMNA 1ON2A 3FBIB 3RJPA 2KZVA 2ZCWA 3FXJA 5BPIA 4UUSA 2XKPA 4BQNA 1W0UA 1X1BA 1QVUA 1GLNA 5AIPA 4PJ0C 1ZG3A 3K2AA 5CVUA 4GYIA 2KHMA 3ASNH 2CQKA 2PFBA 3LSRA 2W24A 2YS9A 4UVCA 4M71A 5CQGA 4UNOA 4CCKA 4OU0A 2DO7A 2WAFA 3ZQCA 1SEUA 1D0YA 1RPWA 4B48A 3E97A 2LOOA 5TJJA 4CCLA 2DN0A 1JE8A 1MH4A 3IC7A 2K85A 2A68F 3E3VA 3RZOJ 2AQEA 2GXAA 4IKFA 4FISA 3F23A 2HTSA 2ZXJA 5IY5H 3JR9A 1VQ7I 2DMTA 3FMQA 1FP2A 4AVZA 4LB5A 3ASOH 3I58A 5J40A 2GIZA 4OINF 1FOXA 2X6XA 4YEJA 2QSFX 1LKXA 4PK4A 1IN4A 2CFXA 1T6SA 2BVLA 2ESHA 2KRFA 2ETHA 2FSWA 4Z2YA 3C18A 2DQRA 2XB0X 2DA6A 2F48A 1B1BA 4RB1A 1XGMA 3E7LA 1AHDP 3PJRA 4UHTA 4L9NA 1HW5A 5ICCA 4I02A 4Y15A 4J19A 4L0ZB 4A3GJ 2LRDA 3REOA 4ZH4F 2F4IA 3OV8A 3ZQIA 2ZMEB 1W4MA 1O57A 4A6DA 1N25A 2EB7A 4RGRA 3RDIA 5M3FJ 1R6RA 3O8GA 1FNNA 4UUVA 1LFBA 2A61A 1DPUA 4DNCA 4M3BA 3QYFA 3JRAA 1OR7A 2LKSA 3LSHA 3ML6A 1MMDA 4XOPA 2G9WA 3AG4H 3CCLI 4HW0A 1SD5A 3JRCA 2L7MP 3G1MA 2ESNA 2LMDA 1PUFB 4EEFG 2EH3A 3K4NA 2VBWA 2ELJA 3JW4A 4XRSA 1LDDA 2JSPA 3CF2A 3DPUA 2LY2A 1MBHA 4A5NA 3Q0UA 2FNPA 3H0DA 3HPHA 3IP4B 4OAZA 1U8BA 1CQTA 1R1TA 2DCEA 4PSXA 3VFZA 3CP8A 5IP6A 3EDPA 3CZ6A 1Y8RB 2LNBA 3F0CA 3LFKA 4EM1A 3S93A 4L9JA 4J00A 5F1JA 2IBDA 5CPRB 5E1WA 4BYYA 4D5CA 1C0WA 1Q1HA 2EV5A 5L3FA 2Z33A 3RKXA 2AQFA 1BOBA 3DEUA 3WTUC 3OYEA 4H4KC 2CQ7A 3QYBA 3IKVA 3ZMDA 4FETA 1I6HJ 1JHHA 4HZFA 2G7UA 4IPAA 1XGOA 2CS3A 2XRLA 3TL4X 3TO9A 4AUXA 2HQ5A 3BR1A 4EM0B 2JJ7A 2KIFA 4ENMA 3PFYA 2E1NA 1P92A 2RQQA 4P9FA 3M4OJ 1K61A 1FOYA 1YS6A 3OYHA 3GWZA 1X2NA 5LFAA 4A3IJ 3F8MA 1JXSA 4LLNA 4W1UA 2DTRA 1SMTA 3OMYA 3VOEA 3FHZA 3I0TA 5FKMA 5E1ZB 2VQLA 2K02A 4YFNF 3J80Z 3LNQA 2K9MA 3H1CA 2E7WA 2F5FA 3U9GA 1OQYA 3CCYA 1O3QA 1BC7C 1YHQI 3DEEA 2PBIA 3ULQB 4XR6A 3JCUC 2CUJA 1JUPA 5D8KB 3UKGA 1LEAA 1QPMA 2Z1DA 1RETA 1IN8A 2HKOA 4XRFA 1KU9A 3K4JA 1MDMA 2BXZA 3GXOA 4M6XA 5FLXK 3KFWX 5C4JJ 4E7HA 2L0KA 3T8RA 4XLAA 1B72A 1NH3A 4GGGA 1JUSA 3TW6A 5E79C 1PDNC 2L9SA 3I4PA 5FKNA 4IOCF 5E8GA 2MC4A 4RGUA 2R7OA 2JRMA 3IWZA 2HVSA 3AFHA 2O7OA 5E3LA 4FCYA 4AC0A 2L01A 4W97A 5BNGA 4B43A 1W7PB 4LK1F 1D5VA 2XF6A 4PFOA 4BXFA 1VF9A 2DA7A 2HXOA 1IW7F 4X0GA 1PYVA 4PCQA 2Y69H 2EK5A 4NC7A 3OYGA 3CDIA 1O7FA 4ZZDA 2YUSA 3QPTA 5LRSA 4RS8A 2M4GA 4BAYA 1U8RA 1E3HA 3ROUA 1AA7A 1O7LA 3VYSB 3NARA 1QU3A 3DXJF 2JVGA 3GFJA 4UXNA 4KJZA 3CP2A 3BJAA 4I99C 1KYZA 2V9PA 4D0PA 4MHGA 3LSPA 1ETQA 3TKYA 1S3JA 3BPVA 2W7NA 2XF7A 1QNTA 2VUMJ 2OF7A 2HVRA 1P7JA 2OPTA 5JHFA 2DOFA 4I2OA 2HFHA 2QQAA 1B9MA 2GXGA 1OKRA 5FD5A 3OYCA 4DIQA 4XRSG 2ZNZA 2P7VB 4I0BA 3LA2A 3H9GA 3AL0B 2XAQA 3O8HA 3L2CA 3QU6A 3V7CA 5F1RA 3S15J 1OJLA 5FROA 2DA1A 3HEFA 3PSFA 3HHGA 4G6TB 2HYGD 2IS4A 3FK7A 4RM2A 3HBLA 2OUMA 1IO2A 2I5UA 1T98A 3DQVC 4D9JA 5ICGA 1WJCA 2E2HJ 4BE0A 2LKPA 2MLGA 4O5VA 1I50J 5EEHA 3L9FA 1S9HA 1ZLJA 2IXSA 2FU4A 4ANJA 1Z3YA 2A69F 1BR1A 1JJ6C 1FIPA 4G7HF 1U5TA 2AO9A 2Z16A 1T38A 3BTIA 3PFIA 2VKVA 2D5VA 3HSRA 5E3NA 1T56A 2DK8A 1TLHB 5J1UA 1ZGAA 1CF7B 3ABTA 1FOKA 4XLHA 2HOTA 2DMPA 3FM3A 1U9OA 3S2HJ 3A4CA 2CQXA 2EINH 4GFBA 1F4KA 3BQYA 3CQZJ 1ITYA 5AONA 2UXXA 1IUFA 2M8GX 1XX5A 2DK5A 3G2BA 4PGHA 1TBXA 1EH8A 1V5EA 1WHUA 4IHTA 4XICA 2GZWA 2HQAA 2RC4A 4X1EA 4EATA 2X1EA 4F7ZA 4L5EA 1X19A 2NNYA 1XPXA 1DDNA 2JN6A 1R7JA 3A2KA 1MMAA 2XASA 5JLWA 3L09A 4LG0A 4LK0F 2MGQA 5GAHJ 1VI0A 3VWBA 4UY8I 2M1BA 1ZREA 1JGGA 4ENNA 2W1OA 3F21A 2P6TA 2FBKA 1IAWA 1IRZA 5FKLA 3JTGA 3CMAI 2J5PA 2LY9A 4ETSA 2PJPA 1JI8A 2RNGA 2PMZA 1IG7A 4A0ZA 1B6AA 3I54A 3FXMA 3TP0A 3L2UA 2BY3A 1IN6A 1MMNA 2P5KA 3DTKA 4WX9A 4YFXF 5KAFC 3K7AJ 1TQMA 2DBBA 1XGNA 4S0HB 1G2HA 5IP9J 4ZYDA 4HDUA 2VBZA 2AXTC 2QSGX 2WAEA 3M8FA 4RAYA 3DF8A 4YIFA 2F4MB 3ZN1A 3F8NA 3LA3A 2R7RA 3NRVA 2QBYB 4WXCA 2DFEA 3GFMA 3S1NJ 2KMUA 1MSFC 2HTJA 2HYJA 3N97A 1ULYA 5D5VB 2RGVA 1WWXA 1FY7A 1ZH5A 4IJAA 4Y4RA 1ZGWA 3QOEA 5JFRA 2R7ZJ 3HGGA 4UV8A 4LG3A 3I59B 4XLEA 4BGDA 5D4RA 3PM1A 1KU2A 2UWMA 2W25A 3R61A 2BW3B 4DGWB 1K6YA 4YFKF 3P9CA 5L3GA 3TDZC 3G71I 2IGOA 3IUOA 4OIRF 2ACJA 3LSTA 3T5XA 1UHWA 2ELHA 1SFEA 4XKBA 2IGMA 3DPLC 3HUGB 5HDNA 2DFFA 2LTPA 3OYNA 3CJQB 3H3VK 2GA1A 3WGGA 4N4NB 2MA3A 5FKOA 2LVSA 3BG3A 3Q9VA 3P7NA 2Q0OA 5DUIA 4P96A 3OYKA 3PO3J 4Q4ZF 3IRQA 1XS9A 2FOWA 1DPRA 4FX0A 1A6QA 1NG7A 2XGCA 3DBLB 4KISA 3MZHA 2V1XA 5IYBJ 4EQQA 3ERED 1H0MA 1VQ6I 5ED4A 5HLIA 2PLYA 4O3MA 1NG6A 3F9KA 1D3YA 1ORKA 3TOBA 4A3BJ 2DT7B 2N8GA 4F93B 1R4NB 3R4KA 2NS7A 5D6EA 2DA2A 3S17J 1VQ8I 5H20A 3RKQA 3K4KA 3CJRB 2PJRB 5ERIA 3ZQQA 2QSHX 2MW8A 3GEZA 2Q8KA 2HWVA 4BH9A 3B6CA 2O61A 2XIGA 2IRFG 1WSUA 3I3LA 5E1XA 2H6BA 3K4LA 3R0AA 1LE8A 1JT0A 2JVHA 5A2QK 3PUFA 3LFUA 4HAMA 3EYIA 3KETA 4G7OF 1A5JA 2KIQA 5EYRA 2WA0A 1O4XA 2VONA 3E6MA 1UZCA 3H9QA 2EFOA 2WB1A 3GMEA 1O3TA 2CO5A 1OCCH 1LNWA 2H1KA 3CCMI 2VOOA 3CESA 4JK1X 1X3ZB 1CGPA 3ABUA 2EPFA 1ZGJA 4LGWA 2CUFA 1R00A 3LSJA 1WCMJ 3I5UA 2V26A 4GRIA 3CDLA 1WI3A 2FA5A 4B44A 2Y31A 2PEXA 1ETYA 2EA4A 2IS2A 3VYRB 4HF0A 1MBFA 2KL4A 2CW8A 1J9IA 1Z21A 2YPRA 2VLAA 3IRRA 2EZIA 1R71A 2XAGA 4IHYA 2QEXI 3HPGA 2R5YA 1V5FA 3QQAA 1UAAA 2LG4A 4BY1J 3VPRA 3FMRA 3F8FA 4BKXA 2JPCA 3TOAA 1FC3A 5LGUA 2V9VA 4KMFA 3ABMH 3B6AA 3M9AA 1R49A 3HSEA 2XGDA 3MZ8A 4IRGA 1FBUA 5ILVA 2ME0A 1JGSA 2BY2A 1G3SA 4HA8A 5B1AH 1BA5A 4YIIA 1XG1A 1U5TC 3K1MA 4HEA2 2X1DA 3RKYA 3GBGA 4JYKA 1LUJB 1YS7A 4HF1A 1RKWA 4FT8A 3KYDB 4GYGA 1LB2A 3GZ6A 2BEOA 4HYEA 3LA7A 1FIAA 4KICA 3LAJA 2STWA 1U9NA 2V79A 4CCNA 1U2WA 3BP8A 4M6VA 2LBFA 9ANTA 3C3WA 2ZJ2A 2EQRA 1FYKA 2C6YA 3VSLA 1P6RA 5GAEJ 3KPHA 2PQ8A 1D0ZA 3S3NA 1V4RA 1UMQA 2VBXA 3L00A 4Q47A 4R79A 4XK4A 2HGCA 1A04A 1X3WB 2X6YA 2VE8A 3EETA 5CVIA 2WWYA 3VYTB 2RVCA 1J0RA 2QF7A 2PMZN 2L7FP 3FMSA 4XKWA 4CCJA 1UELB 1ZK8A 3ZGKA 3QODA 1VQPI 2F5EA 1B8IA 1MIJA 4IL6C 2V9KA 3PIOF 2VQCA 3JSPA 5FRMA 1VQOI 1BR2A 3J7AO 3HJEA 3I53A 2FD5A 1MNMC 4QTRA 5C44J 1EV7A 3A03A 4CXFA 1XSDA 1EH7A 2BYVE 3TBIA 3A02A 2IA2A 4N9IA 3MKYB 3OYAA 5H2FC 3FISA 2XAUA 1ON1A 5TGTA 4QLCU 1J59A 3BROA 2CSOA 3ESWB 2XPWA 5B3SH 3S3MA 2F5VA 4DJAA 2WBMA 4UV9A 1SVMA 1ZELA 3WODF 3OIOA 3ZCOA 4D7NA 1H9TA 4BS9A 1IXCA 3EPZA 3C7JA 1YRNA 1HCRA 4MEXF 3WU1B 2HI3A 3FK6A 4KDPA 4A5MA 1XCVA 3I71A 3M3YJ 5IT9Z 1WH5A 3GTKJ 4P9UA 3OYJA 2X4HA 2DOAA 4IF4A 3U1DA 3S1RJ 3WU0A 3OYMA 2IGKA 2HOSA 3M8EA 3WE2A 2LK2A 2FJ1A 3QP6A 1F43A 2CJJA 1ZHFA 3JRFA 5KHDA 3FXQA 3Q0WA 3SDBA 2W48A 2OAZA 1IC8A 3IAS2 2V1DA 2GOMA 4UB8C 3TO7A 4FTHA 1YJWI 5D5UB 3BJ6A 1G6NA 1D1AA 2OQRA 3KP2A 3F3XA 4KFCA 3U21A 3PSIA 1BJAA 2G0EA 2F4OB 3FIWA 1S8NA 1ACIA 4HX8A 1B9NA 3A0HC 2Z5UA 1K4TA 2E35A 2L54A 2HZTA 2XPVA 2XHKA 2MH2A 2MG4A 2K4BA 2OD5A 2LFBA 3IH4A 4S04A 1FWZA 1FYMA 1TNSA 4D1QA 2VXZA 3O3KA 4CDGA 1HQCA 4JX6A 2MD0A 3HM5A 2QM3A 3MD2A 3HRSA 3OR1C 3GYHX 3J7AY 3WHCA 4F52A 2B9SA 2MYSA 3NQOA 3RPUD 4RM3A 2F6CA 2UXNA 1MW7A 2AHQA 1ONVA 1S7EA 4NC6A 3SDGA 1KU7A 2CGPA 5K7HA 3SYTA 1MD0A 1WVRA 3HG9A 3ZMZA 1R1VA 2WB1N 2O8KA 5F0HA 1Z7UA 1HOMA 2VKDA 4ENKA 1I3QJ 1G3WA 5B5EC 3GX4X 3W2AA 2ICWG 1T95A 1T39A 1I3AA 4OIQF 2HDWA 2DTZA 4ZDLA 4BHCA 2DYSH 2JK3A 1AKHA 2DPUA 1YO5C 1BIAA 1X4PA 1TNTA 4AVPA 2K4JA 3ABKH 4PZJA 2R5ZA 1OFCX 2B0LA 2RNJA 2M30A 5C3EJ 1ZN2A 2EZKA 4WCGA 2R7UA 4Z6YA 5DD4A 4E7KA 4IO9F 4WK8F 5IPAA 4U7DA 3JAMZ 5HOOA 4Y13A 3AG1H 3CMEI 2ZFUA 4K2EA 1JTXA 2E19A 2VI6A 2RAEA 3U2RA 2XUBA 1MBJA 4CICA 3RZDJ 2W4SA 2BXYA 1XMKA 3V7SA 1FEXA 3BR6A 1RKTA 4N0BA 3E6CC 2V4JC 2EIMH 2DQLA 2A3SA 2EIJH 2E36A 3OSGA 4ESBA 3BZ6A 3CO6C 3V8JA 5HDKA 2VOPA 4TV7A 3WGHA 3GTOJ 3QPHA 3K9TA 1B4AA 1NHAA 4E7IA 1TWAJ 1EA3A 3K70C 3HL2A 3H5AA 2R92J 4FHTA 4DBRA 1POGA 4JX5A 2X9DA 2XC7A 2F2EA 1Z3XA 2QQBA 3AAFA 1BR4A 2X85A 2KJBA 3EUHA 4BBRJ 2E60A 3LL7A 1D1BA 1OCTC 5D6FA 1XDUA 1O3SA 3KYLA 4R8HA 4KIFA 1IV8A 1MMGA 2A5YB 2VKHA 2ZMEA 3KYCB 4M3FA 3M1EA 3QAHA 2EA2A 1EH6A 2K3PA 4KUMA 3CTAA 4XMYA 2R7DA 4KIBA 4BQQA 3BLYA 3I4NJ 1Z77A 3EUAA 1SD6A 2QLZA 2DT5A 4HLXA 4AYBA 3BCBA 3DKWA 4XBFA 1F5TA 2GM4A 2Q2EA 4RAZA 4HX7A 1KQ8A 5DM6F 1JT6A 1FYLA 2VIXA 2H27A 1PUFA 1RZ4A 2G7HA 3JRHA 4E6KG 4F92B 1X1CA 3C1DA 2Y0SA 4F91B 4YELA 2E7XA 1MH3A 4P55A 1FSHA 3ZQHA 1J7KA 1FOWA 4XN3A 1IXRC 2BE5F 5DD8A 2KLOA 2CV1A 3PO2J 4XKVA 1QZYA 1TP4A 3K1NA 5ICEA 3OSFA 3R6SA 2DYRH 4Y17A 1REPC 3NEUA 3E0JB 4CSWA 3BY6A 3M1CA 4PJJA 3RQIA 2FRHA 3BR0A 1HDPA 5FO5A 3C2BA 4J01A 1YJ9I 3SZGA 3OS2A 4RDUA 1G3TA 2Z99A 2PN6A 1V55H 2GAUA 1GV2A 3LQRA 1X58A 3J7YJ 3JSOA 3GCMA 2JRTA 3HKZN 1Y6IA 1O3RA 4KT5C 4MGRA 2FE3A 1W5TA 2LLKA 2EFWA 2VQHA 1G8XA 3QYEA 4QWQA 3I4MJ 1U0JA 1HC8A 1UHSA 2DW4A 1HW1A 2FXAA 2BY0A 3DU6A 2B63J 1GXQA 1I6XA 4C30A 2Y2ZA 4I98B 2BBYA 2Z9OA 3GTMJ 3ELKA 2NVTJ 3FKIJ 2FBIA 3K10A 1VQLI 3ZR8X 5DCMA 3CC7I 1SFXA 1U5TB 5CYVA 1FTZA 3NWSA 1TT5B 2JSCA 1Y0UA 2NS8A 2M34A 3BG6A 3PNVA 3T8TA 1TW3A 4A0XA 4A3JJ 1PP8F 1YQAA 2HKXA 4IQJA 1TZLA 1RUNA 3RQ4A 1MSEC 2PMHA 5K7FA 4EGZA 3QRFF 1J09A 4BE1A 2CQNA 3A01B 2E1OA 1R58A 1WJ5A 2OCCH 5GTIC 2KDZA 3QPSA 3A0BC 3X2QH 2NVUB 2XSJC 3OYFA 1BIBA 3MKWB 3CUOA 4HX4A 4XSXF 4IXAA 2V7FA 3T0YA 2CMPA 1X2MA 4RB2C 3J81K 4U0YA 5JLXA 4LOCA 4Y3OA 4XLPF 1W7PA 3KP7A 5CVRA 4DYCA 1WGXA 2EFNA 2P81A 1JHFA 4C3IJ 1FSEA 2CG4A 2GWRA 5EGOB 2H8RA 1RESA 3FXOA 2ZSIB 4EJTA 2X48A 2VC0A 4M9XA 3HOWJ 5LHGA 3K4BA 3W3CA 2CFOA 4KMUX 5E3MA 3D0SA 3DTEA 5FGMA 4Y52J 2JA6J 1ZG5A 3S1MJ 4BEHB 5J8FA 3CLQA 5EG0B 3F6OA 3HZJA 3KZIC 2TDXA 2R0QC 1IRGA 1TWCJ 1W1WE 5BMZA 4QPQA 4AIKA 3CC4I 4ZZLA 4HRIA 5FLXZ 2FMLA 2K27A 1IV6A 3KZYA 3K4MA 1XDSA 2Y9ZA 4FASD 3KX2A 2JA8J 4OWRB 3L2QA 1QBJA 1GVDA 1IN5A 1LVKA 2BY1A 4FE4A 3ERMA 4FQGA 4AD9A 4XRMA 2MLKA 4ZYAA 4H0EA 1QZZA 2KKOA 2L5QA 5LHIA 3KCCA 4IHVA 3ZMTA 1OR7C 4N9HA 2Q1ZB 4C2MJ 3OIPA 6PAXA 5KAIC 1VFCA 3BG7A 2VJIA 4HSTA 4KITB 5J1YA 3GO5A 3TEDA 3B02A 3WTVC 4BDZA 2R7TA 3FXKA 2OV7A 4LLGF 1XN7A 5M3MJ 3VDXA 4DW6A 5TISC 2O5RA 4PDKA 1Z05A 2QVOA 2MD5A 5LEKA 3ZN0A 4A12A 4KYWA 2ZC2A 1Y56A 3CMYA 4A93J 1N78A 2K40A 5GPAA 2OTJI 3M7GA 1OISA 2M87A 5BS6A 2KIMA 1QHHD 1P4AA 1WPKA 3MKZA 4WF2A 3LQQA 4C2UA 2AS5F 2LH9A 2M4KA 2X0LA 4BBSJ 5GP9A 1OYYA 1QO0D 4RLFA 2HPIA 3BG9A 5EEAA 1LQ1A 4KIGA 4A3EJ 3MN2A 5FLMJ 2W84A 2P4WA 2NVXJ 2XKOA 3CUQA 4AIHA 2OQGA 2L3DA 5FKKA 4ZYGA 1HW2A 1L0OC 5DDGA 3CCJI 2XSDC 4F3QA 4CHUA 1D8KA 1CF7A 1WZ2A 3BTLA 1UCRA 1DP7P 4OMYA 3EUHC 2R7QA 3MMYB 4AYBN 2YX4A 3DFGA 1V54H 1S7OA 3HRUA 4M3EA 4LLLA 4ZDPA 3PL8A 4QIWN 4E70A 2ZMEC 1OCRH 3W2WA 3ZOBA 3KP3A 2XAFA 2D1HA 4M3GA 4CYCB 2V1UA 1YITI 4G94A 3HRMA 4ITVA 3ISPA 1K83J 4LFUA 2R93J 2PMUA 5EF6A 3DLLF 4WXDA 2YSRA 3JRDA 3QU3A 2NOGA 1W0TA 2F5DA 2IEKA 1K6OA 1ZTRA 2KT0A 2B7EA 3O6BB 1IRXA 4WWCA 2FBHA 2RQPA 3Q3SA 1ENHA 1U3EM 1RI7A 3RTRA 1SC7A 4ON0A 5F6FA 1R5ID 3HIFA 2ID3A 3H3ZA 1WI9A 3JTHA 4LB6B 4A69C 2D1VA 3D5LA 4QPOA 4CCOA 5M5YJ 3OYLA 3G73A 3ZXSA 2XAHA 1I39A 1WQ2A 1Y0NA 4L0YB 4MNUA 1NTCA 4RB3C 2Y0MA 3L2WA 4HV6A 5DEQA 2JUCA 1Z6RA 1V3FA 2H6CA 2H8WA 4YRVA 5KNLA 4MLOA 2MC3A 4GXOA 5GPCA 2IT0A 4DYQA 1R5HA 2L7KA 3IH2A 3QPLA 4MEYF 2TRTA 2QBYA 4BQAA 1LFUP 5DTDA 4EMSA 3DU5A 2L9RA 3GLXA 4C9YA 2ZJQF 1XMAA 4KN7X 2VT2A 3KIOA 3TQNA 3LSMA 1U6GA 1LVAA 3KZZA 2FUG2 1VQMI 2CUEA 3SFIA 1QHGA 2X51A 1IRFA 2BVMA 3I59A 4AIDA 3BPXA 1S29A 3TW7A 3G1LA 3GTLJ 3AG2H 1HKTA 4XLCA 2BW3A 2DOEA 3TO6A 4OMZA 4PSWA 2LF7A 3KEOA 3RKWA 3F8CA 1I5ZA 2VJJA 2XPUA 1ZKGA 4P1WA 3HUGA 3RSNA 2YX7A 1TTYA 3ECHA 4FE7A 4HNVA 1BOAA 3L2VA 2OJED 3HTSB 3H36A 3I9V2 4BJ5C 1VQNI 2GQQA 4NQWB 1R5GA 4IHWA 5M5WJ 1DUXC 4EGYA 3CCSI 1OYWA 2L4MA 2VQGA 2X1CA 3DLAA 1VQ5I 2IGNA 3MAJA 1BW5A 5LBQA 1BI3A 4A3KJ 2P7CB 1MMSA 5LLQA 1KQ9A 4V19K 5HVQC 2KRCA 2BGCA 2FNAA 2IA1A 5HODA 1UG2A 2DMQA 1D8JA 5FJ8J 5LHHA 4BJTA 1NK3P 1XCBA 2EV6A 2K9NA 5LGNA 3SJMA 4EVIA 4KN4X 1W5SA 2DODA 2TCTA 1HSTA 3DWLE 4YIRX 2PJRA 1DGWY 2H1LA 3DKXA 3FHNA 4XLFA 4DBQA 1ETKA 2KP6A 5E3OA 4UB6C 5E17F 1R1UA 3GW2A 1T2KA 2QKLB 2QQ9A 4BE2A 1K78B 2LSOA 2M3AA 4G12A 2P0WA 4PUSA 2LKXA 3I55I 3BTJA 4HBLA 3HTUA 2KDOA 2K3FA 1WRJA 3PNTA 3GTJJ 2WV1A 3MZYA 2ZO4A 5CJ9A 1ZYRF 3AKZA 3TP3A 4IHXA 4IOAF 5K5QA 1JJ8C 4CGZA 2DJNA 1RR8C 1BM9A 3IKTA 4E7LA 1KONA 1E2XA 1MBKA 4CO8A 4NDLA 1PP7U 4BXXJ 1Z67A 1GV5A 4D5FA 2GOXB 1AWCA 3IHUA 1RNLA 2ZXWH 1P9QC 1XD7A 4KA4A 2PX9A 3V8KA 4HNUA 3SFZA 4XONA 2KZGA 2Y75A 2M0CA 4CUGA 2K7LA 1TWHJ 1W5CC 1WJFA 3Q0VA 1MBGA 1MNDA 2FMYA 4IVNA 2EIKH 3HSFA 4JX4A 3OR2C 3BT9A 1OLTA 5E20A 2GBYA 3K6GA 3SXYA 5HNFA 1SMYF 3VYUB 4LITA 1SFKA 4E7ZA 3CCEI 1YX5A 4RGSA 5A2QZ 3WTYC 1Y8QB 2O03A 3W2VA 3AL0C 1WJEA 4RMNA 4PGGA 3FZVA 3NWTA 3HOSA 1GT0C 3ZPLA 2KQRA 4XM3A 3CJNA 4G7ZF 5D5XB 1XSXA 5HS9A 1ZG1A 2A6TA 4DOZA 1HKQA 1YLFA 3ZMVA 4G6QA 2CRGA 4UUTA 2DDAA 4AU7A 4UUSB 3BQZA 3LMMA 2YR2A 4A3LJ 4IEJA 3DBHB 2CH0A 2W57A 2P6SA 3FKJA 3MEXA 1BJZA 1SD4A 2I8DA 4U0VA 2CUZA 1HXDA 1QRYA 3V7RA 2VE9A 3CUQC 2HPMA 1J2XA 4EV0A 3CLOA 2Z2SB 5HS8A 4OIPF 2COMA 2HNHA 4DQ2A 3KP6A 3OOUA 4DZJA 3BCAA 4EJWA 5LD2C 1ETWA 4RB0A 1TL8A 1E17A 1S5LC 2OZUA 2VASA 4AIJA 1APLC 1FMVA 2ZFWA 2ZJRF 2JTVA 3R60A 4IX7A 5J6XA 2NVYJ 4EJOA 1R36A 2JUGA 2MH9A 2XAJA 4A3DJ 3WHBA 2ZXIA 1DU0A 3E5UA 3F8BA 3W6VA 1YTYA 1ETOA 1GHCA 4HQEA 4ZC3A 4LIVA 4UVAA 1S6LA 2XROA 1RR7A 1ZR2A 5BPDA 3OYIA 2LD5A 3Q5FA 2HVQA 4C3JJ 1Z0XA 1Z1DA 2OBPA 3K4CA 2A05A 1ODDA 3RYRA 4I0AA 5DM7F 4I01A 3D5SC 1VQ9I 3GLLA 2VT3A 1BI2A 1X1AA 2R5ZB 2K86A 3FXLA 2WAQA 3R0JA 3FWEA 5DS9A 2WY7Q 2LREA 4CH7A 1SFUA 4JQFA 3HOYJ 3OL3A 2M2EA 1HDDC 4MIMA 1XSVA 4PJMA 4A6EA 1MJBA 2L9NA 2XDVA 1H89C 2OZ6A 3IAM2 2L4AA 1R4MB 4MFDA 5DCFA 4NB5A 1SANA 1FPQA 4B8XA 2E1MC 3EYYA 1XGSA 3MQ0A 2XRNA 2IVMA 1TC3C 1JKRC 3FXUA 3V42A 2NNNA 2V6CA 1E3PA 2OA4A 2Y9YA 3WG7H 5GAGJ 3OYBA 4XNFA 2QQ8A 1BBYA 4PJLA 2NOJB 2QWWA 3WE3A 3P9KA 5HLHA 2M7AA 2BV6A 1B59A 3MCZA 5F04A 3K0LA 2MSYA 3BR5A 3G4SI 3J80K 5J1RA 3CC2I 4CCMA 2X6OA 1FMWA 5GADJ 3SHFA 4I76A 1OCPA 2HOAA 2VKEA 2XGXA 3K1PA 3H0GJ 2P5LC 3GVAA 1U78A 4I6ZA 1FBQA 2M7BA 2R7VA 3C2HA 2NS0A 1N77A 4AM3A 4L5JA 2HDDA 1YIOA 3NAUA 2DMUA 3PNYA 1IDYA 5LRRA 1Y39A 1Q1VA 2JA7J 2O0YA 5J3LA 4B3XA 2E71A 3ZMUA 4U88A 1XB4A 5L3EA 4RBOA 3H92A 2GLOA 1ETVA 4NHJA 1I1SA 3K69A 1SAXA 3H5RA 1H9GA 2OTLI 4XSZF 3BTCA 5DUKA 1TWGJ 3OL4A 3QOPA 4JP0A 2DFIA 2OU2A 2W82A 2Q2EB 1BL0A 2AXLA 3ZQFA 2L7ZA 1JUMA 3GTPJ 1DGRM 2IAIA 1MZBA 3JRGA 3K2ZA 2IW5A 2W85A 4PJNA 1D5YA 4ENJA 3GTQJ 3G1OA 4OOIA 2EZHA 2UUZA 4EJUA 3LAPA 2DLLA 4BQOA 4U87A 2CV0A 4MO7A 3D5RC 1OPCA 3U1KA 2ZNYA 3GFIA 1XMXA 4NBQA 5K5RA 2NVQJ 2E5ZA 3GF2A 2KPMA 2ZJPF 1J5YA 2VJ4A 3HHHA 3LSKA 4IRHA 1MDMB 1WKMA 1VQKI 1D0XA 2QYOA 1WFXA 1M1EB 2P5VA 2Z3YA 3MKLA 1JKQC 1LDKB 3HOXJ 1GDTA 2EZLA 4O6JA 2P8TA 4C2TA 3BWGA 1B72B 1A31A 4LMYA 1KQ0A 4NNJA 1LDJA 3RPQA 1DP3A 3SQNA 3EUKL 1OMIA 2X6WA 1GXPA 1HKSA 1ZQ3P 2EBIA 5J8CA 3HOUJ 3CCVI 4G9YA 1TW2A 2YU3A 3D1NI 2MFZA 1AU7A 3SEZA 1TT0A 1XTAA 5DV5A 1N75A 4KNYA 2D45A 3I64A 5L3DA 1JKPC 2CV2A 2VBYA 4Q48A 2R4GA 2A07F 2HEOA 2LR8A 1K79A 1LEBA 3HB9A 4M73A 2R7SA 4E7JA 4MQ9F 5L3CA 1YFHA 1MJ9A 2QKMB 4B1RA 2DT6A 1X3UA 5DCMB 2VL8A 5F0CA 2CYYA 2EILH 2OC6A 1X1DA 2WY8Q 3ONQA 5F64A 1DQUA 2UZKA 4MFEA 3S1QJ 4A0YA 4RAFA 5H6QA 1ZRCA 3BR2A 1BN5A 3CCRI 4U7BA 1Y1VJ 4F55A 1KYWA 3F6VA 4I09A 1RRJA 1T33A 5KCMA 4GO1A 1BW6A 2FF4A 2JQ7A 4A3FJ 2M0MA 3H35A 1MBEA 2HOEA 3G3ZA 1SAUA 2EFQA 1YW8A 5B1BH 4BUPA 3M8JA 4M74A 5F27A 2WC2A 3WGIA 4A3MJ 2BOLA 2KRHA 4L18B 1J75A 1R22A 3PQJA 3OS0A 1SFOJ 4BXUA 2NRAC 2VODA 1XC5A 3TMOA 4AWXB 3QWLA 2K5CA 5CVJA 1FBSA 3HYIA 3LSIA 3K70D 2OCEA 3GTGJ 3FDYA 1F36A 3ECOA 1WH7A 1YE9A 2PG4A 4IZZA 2WV0A 2RN7A 1UG0A 1OCZH 2L02A 2WAQN 1MJAA 2VXDA 3GZ5A 2ECBA 5ILUA 2E2JJ 1YIJI 1MNEA 1G3YA 1D1CA 1QQIA 1JTYA 1SD7A 3CF5F 2HQRA 3DV8A 1PVEA 2JA5J 1IN7A 1BI0A 4M9ZA 4LD5A 2IJLA 3DEWA 3BJOA 1BC8C 1FJLA 2R7XA 4CZCA 5J47A 4MQVA 3KP4A 1VQ4I 4HDVA 1YG2A 4UVBA 5D5WB 1GVJA 3P5JA 4ZJZA 2K9QA 5GTHC 3OYDA 5KVRA 3KP5A 4LG0B 2H09A 2R7FA 2QGUA 3PUBA 2HQNA 3RCOA 2J5OA 1DU6A 4Q5SF 2ZXHA 2VPRA 2D2WA 5ICFA 2JZYA 3H5NA 5FFZA 2NXNB 3HRTA 3H9JA 3W6KB 2DA4A 2FOKA 1YW7A 1EKEA 2JWTA 3ABLH 1I27A 1A6IA 4E7SA 2DA3A 2VPLA 4R1HA 4EJVA 5BQTA 2RREA 3ZMSA 2R7WA 2CW7A 3KEYA 4I7HA 1KA8A 2L9VA 2BHYA 4BL0B 5CLSA 4C3HJ 4JOMA 2Y30A 3WTWC 2GIVA 1TWFJ 5IP7J 3BDDA 2V6EA 3CUQB 3HXLA 3ZQLA 1RC9A 3DPTA 4ABZA 1FZPB 2DPDA 3E1SA 2LF8A 2JA2A 2LP0A 2L2OA 1KZHA 2A5WA 1USTA 4XORA 2PI0A 3JRBA 3S16J 4YG2F 1IF1A 3JREA 5IOYA 1YOVB 3A01A 1SVOA 2FEZA 2HS5A 5K5OA 3S32A 2HDCA 1X1PA 2E1CA 1F9NA 3L7WA 3CCUI 1S7AA 1RIOH 1LPQA 5IYDJ 5J4YA 1UB9A 3RPUA 1K4SA 5J4VA 3HOVJ 4PFPA 3S3OA 3LWFA 3L2RA 4N4OB 1Z6TA 2IPQX 2WADA 5CKTA 1MGTA 3CDHA 3GZNB 4LIUA 2ISZA 5HNHA 4XN0A 1L3LA 2ECCA 5EGOA 4HV5A 2LC2A 2DDBA 3E6BA 1IJWC 1WJAA 5EZHA 5L3BA 2FQ3A 1UJ8A 2EWNA 3MFKA 1EF4A 5ILSA 4CZZA 3OOPA 2BZTA 4L5IA 3S2WA 3E5QA 1OYIA 3TGNA 5AIQA 4KT6A 2IS1A 4BACA 5JVTA 4BEHA 5EG0A 2HXIA 3A1YA 1T0FA 3UR3C 4HNTA 3LSGA 2R3SA 4CA0A 3BZCA 2RV8A 3S2DJ 4NC8A 4EM2A 3WTXC 1IGNA 4M3DA 4ESJA 1R23A 3RIRA 3ZQGA 2M9HA 2ZBKA 3AG3H 4NUBA 4IRIA 2QUFA 2E1MB 4IHSA 2XGEA 4XL9A 2LY1A 3CO7C 2VB6A 3P9IA 3UNGC 1ZLKA 4HOBA 2Y0SN 2GXBA 3J81Z 4M9SA 2EFPA 4HLYA 4BNCA 1IXSB 1E3OC 2A6EF 1LE8B 2EV0A 2UV1A 2IS6A 1UHMA 5EDNA 1T08B 4BU2A 1NK2P 3IL2A 2KJCA 3CJTB 3VEPA 3E5XA 1QPIA 2DFHA 2ZB9A 4M6YA 4G6DA 3KLNA 4BY7J 3TDUC 1FTTA 5IOZA 4B47A 4XQFA 5D4SA 2STTA 2JT1A 4CYDA 2KIUA 4RA2A 2ID6A
chains in the Genus database with same CATH topology
1GT0C 3OSGA 2CRGA 4XRSG 4UUTA 4UUSB 5F08A 3BQZA 2DA5A 3O8HA 3S15J 4A3LJ 2CQQA 4IEJA 3GTOJ 1OJLA 2DA1A 3HEFA 1BJZA 3FK7A 1TWAJ 3HOZJ 1QRYA 3HBLA 2R92J 2JMWA 1POGA 4DYRA 4JX5A 2E2HJ 2X9DA 4XIDA 5FLVA 1I50J 3OOUA 2YU9J 4DZJA 2R5YB 4CYCA 4BBRJ 1OCTC 2I10A 4V2GA 1ETWA 1FIPA 1JJ6C 1ETXA 2AO9A 3MVPA 3BTIA 1H88C 2VKVA 2D5VA 3HGYA 5E3NA 4M3FA 1T56A 1APLC 5J1UA 3S14J 2HOTA 2DMPA 2NVYJ 1U9OA 3S2HJ 3I4NJ 1Z77A 2CQXA 4GFBA 1QVTA 4A3DJ 3WHBA 1H8AC 3BQYA 3CQZJ 1DU0A 2GM4A 1ITYA 1VNDA 3W6VA 1IUFA 2M8GX 1ETOA 3LOCA 4XICA 4X1EA 1JT6A 2ME6A 3BR3A 4L5EA 1RR7A 1ZR2A 1ZR4A 5IYCJ 2LD5A 1PUFA 3IH3A 4C3JJ 1Z0XA 3JRHA 2JN6A 4DZPA 1IDZA 5JLWA 2FX0A 1MH3A 2R5ZB 3ZQHA 5DS9A 2MGQA 2QCOA 1VI0A 3BG5A 3HOYJ 1JGGA 2M2EA 1HDDC 3PO2J 1IRZA 4MIMA 5FKLA 1H89C 3OSFA 2LY9A 4MFDA 1IG7A 1SANA 2E2IJ 1HLVA 3RQIA 3TP0A 1B8IB 3BR0A 1HDPA 3C2BA 3HDDA 3K7AJ 4RDUA 4S0HB 1JKRC 5IP9J 1TC3C 1G2HA 2Y9YA 1GV2A 2COBA 1X58A 5K7ZA 3HKZN 1GUUA 5F04A 2LLKA 4D7MA 5F0FA 2MSYA 3BR5A 3S1NJ 5J1RA 1MSFC 2HYJA 3I4MJ 2X6OA 1UHSA 1ZGWA 2XB5A 4I76A 4B3AA 1OCPA 2R7ZJ 2B63J 2HOAA 2VKEA 3HGGA 2Y2ZA 3H0GJ 4X6AJ 1U78A 3GTMJ 1YRNB 4I6ZA 1JKOC 2NVTJ 3PM1A 3FKIJ 2HDDA 1R9TJ 3NAUA 2DMUA 1IDYA 1FTZA 1Q1VA 2NS8A 2JA7J 2M34A 5J3LA 4V2FA 4A3JJ 4RBOA 2GLOA 1ETVA 2LTPA 1MSEC 5K7FA 3H3VK 3L1PA 3BTCA 3A01B 1TWGJ 4JP0A 5FKOA 2LVSA 3BG3A 2E1OA 1BL0A 3ZQFA 2L7ZA 1JUMA 2KDZA 3GTPJ 3QPSA 2IAIA 3PO3J 3JRGA 1XS9A 5M5XJ 5C4XJ 4Y7NJ 1D5YA 3GTQJ 3G1OA 3IV5A 2XGCA 2EZHA 1X2MA 5IYBJ 5JLXA 4LOCA 2CU7A 4MO7A 1ORKA 4DYCA 4A3BJ 1WGXA 2NVQJ 2N8GA 3JRIA 2P81A 4C3IJ 2NS7A 5EGOB 2H8RA 2DA2A 2ELKA 1RESA 3S17J 3RKQA 2K9SA 3DCFA 2X48A 2MW8A 2O9LA 3HOWJ 4QSHA 3MKLA 3B6CA 1JKQC 3HOXJ 1GDTA 2EZLA 5E3MA 1Y1WJ 1B72B 4B4CA 4Y52J 2JA6J 1LE8A 3S1MJ 4A3CJ 1JT0A 5EG0B 2R0QC 1A5JA 1TWCJ 1P7IA 5EYRA 1O4XA 1HF0A 1IV6A 1ZQ3P 2EBIA 2Y9ZA 2JA8J 3HOUJ 1GVDA 4FE4A 2FQ4A 4XRMA 3D1NI 2H1KA 1AU7A 4IHVA 1AKHB 5EZGA 4C2MJ 1JKPC 1VFCA 2CUFA 2DMNA 3LSJA 1WCMJ 4UUSA 5J1YA 3TEDA 2LR8A 1W0UA 1QVUA 3HB9A 3K2AA 5M3MJ 4DW6A 3CDLA 1WI3A 2Y31A 4B1RA 1ETYA 3CMYA 1MBFA 3LSRA 4A93J 2K40A 2YS9A 5GPAA 5F0CA 4MFEA 3S1QJ 2EZIA 3ZQCA 3BR2A 1WPKA 1RPWA 4BBSJ 1Y1VJ 5GP9A 2DN0A 3BG9A 5EEAA 4IHYA 1MH4A 4A3EJ 3MN2A 2R5YA 5FLMJ 3RZOJ 1T33A 3QQAA 2NVXJ 4BY1J 4FISA 1BW6A 3VPRA 4BKXA 4A3FJ 3JR9A 5FKKA 2DMTA 1MBEA 2XSDC 3B6AA 3BTLA 5F27A 2XGDA 4A3MJ 2ME0A 4AYBN 1BA5A 1SFOJ 1XG1A 3GBGA 4JYKA 4M3EA 1RKWA 1XC5A 2XB0X 4QIWN 2DA6A 3E7LA 3ZOBA 1AHDP 3GTGJ 1FIAA 1F36A 4M3GA 4CYCB 1U9NA 1WH7A 4J19A 4A3GJ 4M6VA 1K83J 9ANTA 2EQRA 2R93J 3ZQIA 5EF6A 2WAQN 3JRDA 2ECBA 2NOGA 1W0TA 5M3FJ 1UMQA 2IEKA 2E2JJ 3O8GA 1ZTRA 1LFBA 2KT0A 4M3BA 4XK4A 3JRAA 1JTYA 3Q3SA 1ENHA 2QF7A 2PMZN 2L7FP 2JA5J 2ID3A 1ZK8A 3JRCA 2L7MP 3G1MA 1B8IA 3DEWA 5M5YJ 4A69C 1PUFB 4EEFG 1FJLA 2EH3A 4XRSA 2FD5A 1MNMC 1NTCA 2K9QA 1MBHA 4QTRA 5C44J 3A03A 3Q0UA 4MLOA 5GPCA 1DU6A 4DYQA 1U8BA 1CQTA 3IH2A 3A02A 3QPLA 2TRTA 2VPRA 1LFUP 5DTDA 5IP6A 2L9RA 3F0CA 3FISA 2DA4A 5F1JA 2XPWA 2IBDA 4D5CA 2JWTA 1A6IA 2DA3A 3OIOA 4D7NA 2CUEA 3SFIA 4C3HJ 1YRNA 1HCRA 2Y30A 3TW7A 2HI3A 3G1LA 3FK6A 3GTLJ 1TWFJ 3M3YJ 5IP7J 1I6HJ 1WH5A 3GTKJ 3ZQLA 3S1RJ 2HOSA 4ABZA 2XRLA 2XPUA 1ZKGA 4AUXA 2HQ5A 2LK2A 2FJ1A 2LP0A 3BR1A 1F43A 2CJJA 4HNVA 4FE7A 2JJ7A 3JRBA 3S16J 3JREA 3JRFA 3Q0WA 3M4OJ 5IOYA 1K61A 2W48A 3A01A 1IC8A 1X2NA 4IHWA 5M5WJ 4FTHA 4A3IJ 4W1UA 5FKMA 1BW5A 4A3KJ 5IYDJ 2G0EA 3FIWA 3LNQA 3HOVJ 5HODA 1UG2A 3CCYA 2DMQA 5FJ8J 2XPVA 1JUPA 2MG4A 3UKGA 1NK3P 2ECCA 5EGOA 1RETA 2LFBA 2K9NA 3IH4A 3SJMA 2TCTA 1IJWC 5EZHA 1EF4A 4JX6A 5C4JJ 1ETKA 2L0KA 3HM5A 5E3OA 1B72A 1JUSA 3WHCA 3TW6A 5EG0A 2HXIA 5FKNA 2AHQA 3LSGA 4G12A 1S7EA 2LKXA 3SDGA 3BTJA 3S2DJ 5K7HA 2O7OA 5E3LA 2WB1N 4FCYA 4AC0A 1IGNA 4W97A 4M3DA 5F0HA 5BNGA 2O8KA 1HOMA 1VF9A 2DA7A 2HXOA 1I3QJ 2M9HA 2WV1A 3ZQGA 3GTJJ 3TP3A 4IHXA 2DTZA 2XGEA 1JJ8C 2DJNA 2JK3A 2YUSA 1AKHA 2Y0SN 1MBKA 4NDLA 4BXXJ 1GV5A 4D5FA 2R5ZA 3NARA 1OFCX 1E3OC 5C3EJ 1LE8B 2EZKA 2M0CA 1TWHJ 5EDNA 3Q0VA 1MBGA 3LSPA 1ETQA 5IPAA 1NK2P 4JX4A 3BT9A 2GBYA 1QPIA 1JTXA 2E19A 2VI6A 2RAEA 2ZB9A 2VUMJ 1MBJA 3RZDJ 4BY7J 1FTTA 5IOZA 2OF7A 1FEXA 3BR6A 1P7JA 2OPTA 1RKTA 2ID6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GT0 C;  3OSG A;  2CRG A;  4XRS G;  4UUT A;  4UUS B;  5F08 A;  3BQZ A;  2DA5 A;  3O8H A;  3S15 J;  4A3L J;  2CQQ A;  4IEJ A;  3GTO J;  1OJL A;  2DA1 A;  3HEF A;  1BJZ A;  3FK7 A;  1TWA J;  3HOZ J;  1QRY A;  3HBL A;  2R92 J;  2JMW A;  1POG A;  4DYR A;  4JX5 A;  2E2H J;  2X9D A;  4XID A;  5FLV A;  1I50 J;  3OOU A;  2YU9 J;  4DZJ A;  2R5Y B;  4CYC A;  4BBR J;  1OCT C;  2I10 A;  4V2G A;  1ETW A;  1FIP A;  1JJ6 C;  1ETX A;  2AO9 A;  3MVP A;  3BTI A;  1H88 C;  2VKV A;  2D5V A;  3HGY A;  5E3N A;  4M3F A;  1T56 A;  1APL C;  5J1U A;  3S14 J;  2HOT A;  2DMP A;  2NVY J;  1U9O A;  3S2H J;  3I4N J;  1Z77 A;  2CQX A;  4GFB A;  1QVT A;  4A3D J;  3WHB A;  1H8A C;  3BQY A;  3CQZ J;  1DU0 A;  2GM4 A;  1ITY A;  1VND A;  3W6V A;  1IUF A;  2M8G X;  1ETO A;  3LOC A;  4XIC A;  4X1E A;  1JT6 A;  2ME6 A;  3BR3 A;  4L5E A;  1RR7 A;  1ZR2 A;  1ZR4 A;  5IYC J;  2LD5 A;  1PUF A;  3IH3 A;  4C3J J;  1Z0X A;  3JRH A;  2JN6 A;  4DZP A;  1IDZ A;  5JLW A;  2FX0 A;  1MH3 A;  2R5Z B;  3ZQH A;  5DS9 A;  2MGQ A;  2QCO A;  1VI0 A;  3BG5 A;  3HOY J;  1JGG A;  2M2E A;  1HDD C;  3PO2 J;  1IRZ A;  4MIM A;  5FKL A;  1H89 C;  3OSF A;  2LY9 A;  4MFD A;  1IG7 A;  1SAN A;  2E2I J;  1HLV A;  3RQI A;  3TP0 A;  1B8I B;  3BR0 A;  1HDP A;  3C2B A;  3HDD A;  3K7A J;  4RDU A;  4S0H B;  1JKR C;  5IP9 J;  1TC3 C;  1G2H A;  2Y9Y A;  1GV2 A;  2COB A;  1X58 A;  5K7Z A;  3HKZ N;  1GUU A;  5F04 A;  2LLK A;  4D7M A;  5F0F A;  2MSY A;  3BR5 A;  3S1N J;  5J1R A;  1MSF C;  2HYJ A;  3I4M J;  2X6O A;  1UHS A;  1ZGW A;  2XB5 A;  4I76 A;  4B3A A;  1OCP A;  2R7Z J;  2B63 J;  2HOA A;  2VKE A;  3HGG A;  2Y2Z A;  3H0G J;  4X6A J;  1U78 A;  3GTM J;  1YRN B;  4I6Z A;  1JKO C;  2NVT J;  3PM1 A;  3FKI J;  2HDD A;  1R9T J;  3NAU A;  2DMU A;  1IDY A;  1FTZ A;  1Q1V A;  2NS8 A;  2JA7 J;  2M34 A;  5J3L A;  4V2F A;  4A3J J;  4RBO A;  2GLO A;  1ETV A;  2LTP A;  1MSE C;  5K7F A;  3H3V K;  3L1P A;  3BTC A;  3A01 B;  1TWG J;  4JP0 A;  5FKO A;  2LVS A;  3BG3 A;  2E1O A;  1BL0 A;  3ZQF A;  2L7Z A;  1JUM A;  2KDZ A;  3GTP J;  3QPS A;  2IAI A;  3PO3 J;  3JRG A;  1XS9 A;  5M5X J;  5C4X J;  4Y7N J;  1D5Y A;  3GTQ J;  3G1O A;  3IV5 A;  2XGC A;  2EZH A;  1X2M A;  5IYB J;  5JLX A;  4LOC A;  2CU7 A;  4MO7 A;  1ORK A;  4DYC A;  4A3B J;  1WGX A;  2NVQ J;  2N8G A;  3JRI A;  2P81 A;  4C3I J;  2NS7 A;  5EGO B;  2H8R A;  2DA2 A;  2ELK A;  1RES A;  3S17 J;  3RKQ A;  2K9S A;  3DCF A;  2X48 A;  2MW8 A;  2O9L A;  3HOW J;  4QSH A;  3MKL A;  3B6C A;  1JKQ C;  3HOX J;  1GDT A;  2EZL A;  5E3M A;  1Y1W J;  1B72 B;  4B4C A;  4Y52 J;  2JA6 J;  1LE8 A;  3S1M J;  4A3C J;  1JT0 A;  5EG0 B;  2R0Q C;  1A5J A;  1TWC J;  1P7I A;  5EYR A;  1O4X A;  1HF0 A;  1IV6 A;  1ZQ3 P;  2EBI A;  2Y9Z A;  2JA8 J;  3HOU J;  1GVD A;  4FE4 A;  2FQ4 A;  4XRM A;  3D1N I;  2H1K A;  1AU7 A;  4IHV A;  1AKH B;  5EZG A;  4C2M J;  1JKP C;  1VFC A;  2CUF A;  2DMN A;  3LSJ A;  1WCM J;  4UUS A;  5J1Y A;  3TED A;  2LR8 A;  1W0U A;  1QVU A;  3HB9 A;  3K2A A;  5M3M J;  4DW6 A;  3CDL A;  1WI3 A;  2Y31 A;  4B1R A;  1ETY A;  3CMY A;  1MBF A;  3LSR A;  4A93 J;  2K40 A;  2YS9 A;  5GPA A;  5F0C A;  4MFE A;  3S1Q J;  2EZI A;  3ZQC A;  3BR2 A;  1WPK A;  1RPW A;  4BBS J;  1Y1V J;  5GP9 A;  2DN0 A;  3BG9 A;  5EEA A;  4IHY A;  1MH4 A;  4A3E J;  3MN2 A;  2R5Y A;  5FLM J;  3RZO J;  1T33 A;  3QQA A;  2NVX J;  4BY1 J;  4FIS A;  1BW6 A;  3VPR A;  4BKX A;  4A3F J;  3JR9 A;  5FKK A;  2DMT A;  1MBE A;  2XSD C;  3B6A A;  3BTL A;  5F27 A;  2XGD A;  4A3M J;  2ME0 A;  4AYB N;  1BA5 A;  1SFO J;  1XG1 A;  3GBG A;  4JYK A;  4M3E A;  1RKW A;  1XC5 A;  2XB0 X;  4QIW N;  2DA6 A;  3E7L A;  3ZOB A;  1AHD P;  3GTG J;  1FIA A;  1F36 A;  4M3G A;  4CYC B;  1U9N A;  1WH7 A;  4J19 A;  4A3G J;  4M6V A;  1K83 J;  9ANT A;  2EQR A;  2R93 J;  3ZQI A;  5EF6 A;  2WAQ N;  3JRD A;  2ECB A;  2NOG A;  1W0T A;  5M3F J;  1UMQ A;  2IEK A;  2E2J J;  3O8G A;  1ZTR A;  1LFB A;  2KT0 A;  4M3B A;  4XK4 A;  3JRA A;  1JTY A;  3Q3S A;  1ENH A;  2QF7 A;  2PMZ N;  2L7F P;  2JA5 J;  2ID3 A;  1ZK8 A;  3JRC A;  2L7M P;  3G1M A;  1B8I A;  3DEW A;  5M5Y J;  4A69 C;  1PUF B;  4EEF G;  1FJL A;  2EH3 A;  4XRS A;  2FD5 A;  1MNM C;  1NTC A;  2K9Q A;  1MBH A;  4QTR A;  5C44 J;  3A03 A;  3Q0U A;  4MLO A;  5GPC A;  1DU6 A;  4DYQ A;  1U8B A;  1CQT A;  3IH2 A;  3A02 A;  3QPL A;  2TRT A;  2VPR A;  1LFU P;  5DTD A;  5IP6 A;  2L9R A;  3F0C A;  3FIS A;  2DA4 A;  5F1J A;  2XPW A;  2IBD A;  4D5C A;  2JWT A;  1A6I A;  2DA3 A;  3OIO A;  4D7N A;  2CUE A;  3SFI A;  4C3H J;  1YRN A;  1HCR A;  2Y30 A;  3TW7 A;  2HI3 A;  3G1L A;  3FK6 A;  3GTL J;  1TWF J;  3M3Y J;  5IP7 J;  1I6H J;  1WH5 A;  3GTK J;  3ZQL A;  3S1R J;  2HOS A;  4ABZ A;  2XRL A;  2XPU A;  1ZKG A;  4AUX A;  2HQ5 A;  2LK2 A;  2FJ1 A;  2LP0 A;  3BR1 A;  1F43 A;  2CJJ A;  4HNV A;  4FE7 A;  2JJ7 A;  3JRB A;  3S16 J;  3JRE A;  3JRF A;  3Q0W A;  3M4O J;  5IOY A;  1K61 A;  2W48 A;  3A01 A;  1IC8 A;  1X2N A;  4IHW A;  5M5W J;  4FTH A;  4A3I J;  4W1U A;  5FKM A;  1BW5 A;  4A3K J;  5IYD J;  2G0E A;  3FIW A;  3LNQ A;  3HOV J;  5HOD A;  1UG2 A;  3CCY A;  2DMQ A;  5FJ8 J;  2XPV A;  1JUP A;  2MG4 A;  3UKG A;  1NK3 P;  2ECC A;  5EGO A;  1RET A;  2LFB A;  2K9N A;  3IH4 A;  3SJM A;  2TCT A;  1IJW C;  5EZH A;  1EF4 A;  4JX6 A;  5C4J J;  1ETK A;  2L0K A;  3HM5 A;  5E3O A;  1B72 A;  1JUS A;  3WHC A;  3TW6 A;  5EG0 A;  2HXI A;  5FKN A;  2AHQ A;  3LSG A;  4G12 A;  1S7E A;  2LKX A;  3SDG A;  3BTJ A;  3S2D J;  5K7H A;  2O7O A;  5E3L A;  2WB1 N;  4FCY A;  4AC0 A;  1IGN A;  4W97 A;  4M3D A;  5F0H A;  5BNG A;  2O8K A;  1HOM A;  1VF9 A;  2DA7 A;  2HXO A;  1I3Q J;  2M9H A;  2WV1 A;  3ZQG A;  3GTJ J;  3TP3 A;  4IHX A;  2DTZ A;  2XGE A;  1JJ8 C;  2DJN A;  2JK3 A;  2YUS A;  1AKH A;  2Y0S N;  1MBK A;  4NDL A;  4BXX J;  1GV5 A;  4D5F A;  2R5Z A;  3NAR A;  1OFC X;  1E3O C;  5C3E J;  1LE8 B;  2EZK A;  2M0C A;  1TWH J;  5EDN A;  3Q0V A;  1MBG A;  3LSP A;  1ETQ A;  5IPA A;  1NK2 P;  4JX4 A;  3BT9 A;  2GBY A;  1QPI A;  1JTX A;  2E19 A;  2VI6 A;  2RAE A;  2ZB9 A;  2VUM J;  1MBJ A;  3RZD J;  4BY7 J;  1FTT A;  5IOZ A;  2OF7 A;  1FEX A;  3BR6 A;  1P7J A;  2OPT A;  1RKT A;  2ID6 A; 
#chains in the Genus database with same CATH topology
 3SZP A;  2ZKZ A;  3MWM A;  4HF2 A;  2LYC A;  1ZAR A;  2QA4 I;  3OWT A;  1W36 C;  2NAZ A;  5F08 A;  5K1Y A;  1QGP A;  4ZDO A;  2DA5 A;  1LJ9 A;  3F72 A;  5HLT A;  2CQQ A;  1TQP A;  3HOZ J;  4JBA A;  1UFM A;  2CWE A;  5EEG A;  2JMW A;  5HDG A;  1QZE A;  4DYR A;  4ZTJ A;  1WJB A;  4II3 A;  1FT9 A;  2KIS A;  4XID A;  5FB2 A;  5FLV A;  4BJ6 C;  2YU9 J;  5DYM A;  4HQM A;  2R5Y B;  4CYC A;  2I10 A;  4V2G A;  1ETX A;  3FX3 A;  3SZT A;  3W6J B;  3MVP A;  3BC8 A;  5LEJ A;  5FFX A;  4XLN F;  3WTT C;  1H88 C;  3HGY A;  2DU9 A;  5JVG F;  4XOT A;  1PUE E;  2QZ8 A;  3ZRG A;  2RDP A;  3S14 J;  3KEQ A;  3FXR A;  3PQK A;  1QVT A;  3IWF A;  5LGT A;  1H8A C;  1X4O A;  3BZK A;  1VND A;  4II2 A;  3LOC A;  5EJC A;  3VB2 A;  3V4G A;  4M72 A;  2M45 A;  2ME6 A;  3BR3 A;  1I1G A;  1ZR4 A;  1TQI A;  2K9L A;  5IYC J;  5TRD A;  3IH3 A;  1OCO H;  2HZD A;  3DP7 A;  1EJ9 A;  4RAG A;  2LBF B;  4OAY A;  2IP2 A;  4BDY A;  4GCV A;  4DZP A;  3CCQ I;  1IDZ A;  1G4D A;  2ZSH B;  5JHU A;  1WJD A;  2FX0 A;  5KK1 A;  2E34 A;  2O3F A;  1YW9 A;  4HSR A;  2XF5 A;  2QCO A;  1YYV A;  3BG5 A;  1STZ A;  4MTE A;  3OY9 A;  1MKM A;  2VN2 A;  4LJZ F;  2RKH A;  3M07 A;  2BHZ A;  1V5G A;  1P2F A;  1IZ1 A;  3OIQ A;  3F22 A;  2HYF A;  2JPB A;  4MTD A;  5IT9 K;  4IQ4 A;  3GUD A;  4BHP A;  4BHB A;  2E2I J;  2M5W A;  1HSJ A;  1HLV A;  4Y33 A;  3EQL F;  2DI3 A;  2GA2 A;  1B8I B;  3DKY A;  3T1B A;  3VOD A;  3N05 A;  4RLQ A;  5HS7 A;  3HDD A;  1USS A;  3DTI A;  1FX7 A;  4B09 A;  1FP1 D;  5CQE A;  2KFD A;  1A35 A;  1RUO A;  3HC7 A;  1A36 A;  5JI6 A;  2COB A;  2HU9 A;  2VJ5 A;  5K7Z A;  4FX4 A;  2Y48 A;  4L9T A;  4WXH A;  4ASN A;  1GUU A;  1FLI A;  2MAB A;  3H3U A;  4D7M A;  5F0F A;  1W36 D;  1YJN I;  4A2U A;  1KU3 A;  5JR3 A;  3BOQ A;  2XB5 A;  4NQW A;  4B3A A;  2E5N A;  3C2G A;  2DAO A;  3HOT A;  2O8X A;  3OS1 A;  5CVV A;  3S8P A;  4X6A J;  2VC1 A;  3I56 I;  3G6E I;  1K7A A;  1YRN B;  1JKO C;  4ZYH A;  2ISY A;  3WG9 A;  1R9T J;  1P4X A;  4OIO F;  1PJR A;  5E8I A;  4ZTF A;  2LDU A;  4XKC A;  3QP5 A;  1Z9C A;  3WU2 C;  4V2F A;  1F1Z A;  4E4H A;  3J7Z I;  2IA0 A;  3CMM A;  2EJR A;  3B73 A;  2WTE A;  1QA6 A;  1ZRF A;  2A6H F;  2NYX A;  3L1P A;  4U0W A;  4HPQ A;  1VTN C;  1ZRD A;  4GDF A;  3V8L A;  4HG2 A;  1ERD A;  3COA C;  1SVL A;  4ESF A;  3E6D A;  5FD6 A;  3DBR B;  3FM5 A;  2XV4 S;  1YI2 I;  3ZQ7 A;  5M5X J;  5C4X J;  4Y7N J;  1K78 A;  2DJI A;  5H6R A;  3IV5 A;  3WTZ A;  3GFL A;  1Z91 A;  4RGX A;  1HBX G;  4P5O A;  2CU7 A;  1KGS A;  4G8X A;  1BI1 A;  5E18 F;  3CD6 I;  3JRI A;  3N4M A;  2HR3 A;  2W00 A;  1AOY A;  2ELK A;  2F5C A;  4S05 A;  1T0F C;  2K9S A;  3DCF A;  2MBF A;  1S72 I;  1T8I A;  5D8L B;  3JAM K;  2O9L A;  2O6G E;  4QSH A;  5BOX A;  2XVC A;  4ZYE A;  2M8E A;  1IUY A;  1Y1W J;  1HA8 A;  5HLG A;  4B4C A;  3FBN B;  3O2P E;  3KLO A;  4A3C J;  1Z7L A;  1E0E A;  1LFP A;  1P7I A;  1W7P D;  1HF0 A;  1P4W A;  5IT3 A;  3FF5 A;  3VSK A;  2DXI A;  2ADU A;  3SEQ A;  1VZ0 A;  3KE2 A;  2H94 A;  3Q9S A;  5B66 C;  2QEN A;  2CW0 F;  4L9V A;  3ZP5 A;  2FQ4 A;  1G59 A;  3WTS C;  1ZAO A;  3RYP A;  1YX3 A;  2V1N A;  3HKZ A;  1AKH B;  3RI4 A;  5FRN A;  5EZG A;  3PIP F;  2DMN A;  1ON2 A;  3FBI B;  3RJP A;  2KZV A;  2ZCW A;  3FXJ A;  5BPI A;  4UUS A;  2XKP A;  4BQN A;  1W0U A;  1X1B A;  1QVU A;  1GLN A;  5AIP A;  4PJ0 C;  1ZG3 A;  3K2A A;  5CVU A;  4GYI A;  2KHM A;  3ASN H;  2CQK A;  2PFB A;  3LSR A;  2W24 A;  2YS9 A;  4UVC A;  4M71 A;  5CQG A;  4UNO A;  4CCK A;  4OU0 A;  2DO7 A;  2WAF A;  3ZQC A;  1SEU A;  1D0Y A;  1RPW A;  4B48 A;  3E97 A;  2LOO A;  5TJJ A;  4CCL A;  2DN0 A;  1JE8 A;  1MH4 A;  3IC7 A;  2K85 A;  2A68 F;  3E3V A;  3RZO J;  2AQE A;  2GXA A;  4IKF A;  4FIS A;  3F23 A;  2HTS A;  2ZXJ A;  5IY5 H;  3JR9 A;  1VQ7 I;  2DMT A;  3FMQ A;  1FP2 A;  4AVZ A;  4LB5 A;  3ASO H;  3I58 A;  5J40 A;  2GIZ A;  4OIN F;  1FOX A;  2X6X A;  4YEJ A;  2QSF X;  1LKX A;  4PK4 A;  1IN4 A;  2CFX A;  1T6S A;  2BVL A;  2ESH A;  2KRF A;  2ETH A;  2FSW A;  4Z2Y A;  3C18 A;  2DQR A;  2XB0 X;  2DA6 A;  2F48 A;  1B1B A;  4RB1 A;  1XGM A;  3E7L A;  1AHD P;  3PJR A;  4UHT A;  4L9N A;  1HW5 A;  5ICC A;  4I02 A;  4Y15 A;  4J19 A;  4L0Z B;  4A3G J;  2LRD A;  3REO A;  4ZH4 F;  2F4I A;  3OV8 A;  3ZQI A;  2ZME B;  1W4M A;  1O57 A;  4A6D A;  1N25 A;  2EB7 A;  4RGR A;  3RDI A;  5M3F J;  1R6R A;  3O8G A;  1FNN A;  4UUV A;  1LFB A;  2A61 A;  1DPU A;  4DNC A;  4M3B A;  3QYF A;  3JRA A;  1OR7 A;  2LKS A;  3LSH A;  3ML6 A;  1MMD A;  4XOP A;  2G9W A;  3AG4 H;  3CCL I;  4HW0 A;  1SD5 A;  3JRC A;  2L7M P;  3G1M A;  2ESN A;  2LMD A;  1PUF B;  4EEF G;  2EH3 A;  3K4N A;  2VBW A;  2ELJ A;  3JW4 A;  4XRS A;  1LDD A;  2JSP A;  3CF2 A;  3DPU A;  2LY2 A;  1MBH A;  4A5N A;  3Q0U A;  2FNP A;  3H0D A;  3HPH A;  3IP4 B;  4OAZ A;  1U8B A;  1CQT A;  1R1T A;  2DCE A;  4PSX A;  3VFZ A;  3CP8 A;  5IP6 A;  3EDP A;  3CZ6 A;  1Y8R B;  2LNB A;  3F0C A;  3LFK A;  4EM1 A;  3S93 A;  4L9J A;  4J00 A;  5F1J A;  2IBD A;  5CPR B;  5E1W A;  4BYY A;  4D5C A;  1C0W A;  1Q1H A;  2EV5 A;  5L3F A;  2Z33 A;  3RKX A;  2AQF A;  1BOB A;  3DEU A;  3WTU C;  3OYE A;  4H4K C;  2CQ7 A;  3QYB A;  3IKV A;  3ZMD A;  4FET A;  1I6H J;  1JHH A;  4HZF A;  2G7U A;  4IPA A;  1XGO A;  2CS3 A;  2XRL A;  3TL4 X;  3TO9 A;  4AUX A;  2HQ5 A;  3BR1 A;  4EM0 B;  2JJ7 A;  2KIF A;  4ENM A;  3PFY A;  2E1N A;  1P92 A;  2RQQ A;  4P9F A;  3M4O J;  1K61 A;  1FOY A;  1YS6 A;  3OYH A;  3GWZ A;  1X2N A;  5LFA A;  4A3I J;  3F8M A;  1JXS A;  4LLN A;  4W1U A;  2DTR A;  1SMT A;  3OMY A;  3VOE A;  3FHZ A;  3I0T A;  5FKM A;  5E1Z B;  2VQL A;  2K02 A;  4YFN F;  3J80 Z;  3LNQ A;  2K9M A;  3H1C A;  2E7W A;  2F5F A;  3U9G A;  1OQY A;  3CCY A;  1O3Q A;  1BC7 C;  1YHQ I;  3DEE A;  2PBI A;  3ULQ B;  4XR6 A;  3JCU C;  2CUJ A;  1JUP A;  5D8K B;  3UKG A;  1LEA A;  1QPM A;  2Z1D A;  1RET A;  1IN8 A;  2HKO A;  4XRF A;  1KU9 A;  3K4J A;  1MDM A;  2BXZ A;  3GXO A;  4M6X A;  5FLX K;  3KFW X;  5C4J J;  4E7H A;  2L0K A;  3T8R A;  4XLA A;  1B72 A;  1NH3 A;  4GGG A;  1JUS A;  3TW6 A;  5E79 C;  1PDN C;  2L9S A;  3I4P A;  5FKN A;  4IOC F;  5E8G A;  2MC4 A;  4RGU A;  2R7O A;  2JRM A;  3IWZ A;  2HVS A;  3AFH A;  2O7O A;  5E3L A;  4FCY A;  4AC0 A;  2L01 A;  4W97 A;  5BNG A;  4B43 A;  1W7P B;  4LK1 F;  1D5V A;  2XF6 A;  4PFO A;  4BXF A;  1VF9 A;  2DA7 A;  2HXO A;  1IW7 F;  4X0G A;  1PYV A;  4PCQ A;  2Y69 H;  2EK5 A;  4NC7 A;  3OYG A;  3CDI A;  1O7F A;  4ZZD A;  2YUS A;  3QPT A;  5LRS A;  4RS8 A;  2M4G A;  4BAY A;  1U8R A;  1E3H A;  3ROU A;  1AA7 A;  1O7L A;  3VYS B;  3NAR A;  1QU3 A;  3DXJ F;  2JVG A;  3GFJ A;  4UXN A;  4KJZ A;  3CP2 A;  3BJA A;  4I99 C;  1KYZ A;  2V9P A;  4D0P A;  4MHG A;  3LSP A;  1ETQ A;  3TKY A;  1S3J A;  3BPV A;  2W7N A;  2XF7 A;  1QNT A;  2VUM J;  2OF7 A;  2HVR A;  1P7J A;  2OPT A;  5JHF A;  2DOF A;  4I2O A;  2HFH A;  2QQA A;  1B9M A;  2GXG A;  1OKR A;  5FD5 A;  3OYC A;  4DIQ A;  4XRS G;  2ZNZ A;  2P7V B;  4I0B A;  3LA2 A;  3H9G A;  3AL0 B;  2XAQ A;  3O8H A;  3L2C A;  3QU6 A;  3V7C A;  5F1R A;  3S15 J;  1OJL A;  5FRO A;  2DA1 A;  3HEF A;  3PSF A;  3HHG A;  4G6T B;  2HYG D;  2IS4 A;  3FK7 A;  4RM2 A;  3HBL A;  2OUM A;  1IO2 A;  2I5U A;  1T98 A;  3DQV C;  4D9J A;  5ICG A;  1WJC A;  2E2H J;  4BE0 A;  2LKP A;  2MLG A;  4O5V A;  1I50 J;  5EEH A;  3L9F A;  1S9H A;  1ZLJ A;  2IXS A;  2FU4 A;  4ANJ A;  1Z3Y A;  2A69 F;  1BR1 A;  1JJ6 C;  1FIP A;  4G7H F;  1U5T A;  2AO9 A;  2Z16 A;  1T38 A;  3BTI A;  3PFI A;  2VKV A;  2D5V A;  3HSR A;  5E3N A;  1T56 A;  2DK8 A;  1TLH B;  5J1U A;  1ZGA A;  1CF7 B;  3ABT A;  1FOK A;  4XLH A;  2HOT A;  2DMP A;  3FM3 A;  1U9O A;  3S2H J;  3A4C A;  2CQX A;  2EIN H;  4GFB A;  1F4K A;  3BQY A;  3CQZ J;  1ITY A;  5AON A;  2UXX A;  1IUF A;  2M8G X;  1XX5 A;  2DK5 A;  3G2B A;  4PGH A;  1TBX A;  1EH8 A;  1V5E A;  1WHU A;  4IHT A;  4XIC A;  2GZW A;  2HQA A;  2RC4 A;  4X1E A;  4EAT A;  2X1E A;  4F7Z A;  4L5E A;  1X19 A;  2NNY A;  1XPX A;  1DDN A;  2JN6 A;  1R7J A;  3A2K A;  1MMA A;  2XAS A;  5JLW A;  3L09 A;  4LG0 A;  4LK0 F;  2MGQ A;  5GAH J;  1VI0 A;  3VWB A;  4UY8 I;  2M1B A;  1ZRE A;  1JGG A;  4ENN A;  2W1O A;  3F21 A;  2P6T A;  2FBK A;  1IAW A;  1IRZ A;  5FKL A;  3JTG A;  3CMA I;  2J5P A;  2LY9 A;  4ETS A;  2PJP A;  1JI8 A;  2RNG A;  2PMZ A;  1IG7 A;  4A0Z A;  1B6A A;  3I54 A;  3FXM A;  3TP0 A;  3L2U A;  2BY3 A;  1IN6 A;  1MMN A;  2P5K A;  3DTK A;  4WX9 A;  4YFX F;  5KAF C;  3K7A J;  1TQM A;  2DBB A;  1XGN A;  4S0H B;  1G2H A;  5IP9 J;  4ZYD A;  4HDU A;  2VBZ A;  2AXT C;  2QSG X;  2WAE A;  3M8F A;  4RAY A;  3DF8 A;  4YIF A;  2F4M B;  3ZN1 A;  3F8N A;  3LA3 A;  2R7R A;  3NRV A;  2QBY B;  4WXC A;  2DFE A;  3GFM A;  3S1N J;  2KMU A;  1MSF C;  2HTJ A;  2HYJ A;  3N97 A;  1ULY A;  5D5V B;  2RGV A;  1WWX A;  1FY7 A;  1ZH5 A;  4IJA A;  4Y4R A;  1ZGW A;  3QOE A;  5JFR A;  2R7Z J;  3HGG A;  4UV8 A;  4LG3 A;  3I59 B;  4XLE A;  4BGD A;  5D4R A;  3PM1 A;  1KU2 A;  2UWM A;  2W25 A;  3R61 A;  2BW3 B;  4DGW B;  1K6Y A;  4YFK F;  3P9C A;  5L3G A;  3TDZ C;  3G71 I;  2IGO A;  3IUO A;  4OIR F;  2ACJ A;  3LST A;  3T5X A;  1UHW A;  2ELH A;  1SFE A;  4XKB A;  2IGM A;  3DPL C;  3HUG B;  5HDN A;  2DFF A;  2LTP A;  3OYN A;  3CJQ B;  3H3V K;  2GA1 A;  3WGG A;  4N4N B;  2MA3 A;  5FKO A;  2LVS A;  3BG3 A;  3Q9V A;  3P7N A;  2Q0O A;  5DUI A;  4P96 A;  3OYK A;  3PO3 J;  4Q4Z F;  3IRQ A;  1XS9 A;  2FOW A;  1DPR A;  4FX0 A;  1A6Q A;  1NG7 A;  2XGC A;  3DBL B;  4KIS A;  3MZH A;  2V1X A;  5IYB J;  4EQQ A;  3ERE D;  1H0M A;  1VQ6 I;  5ED4 A;  5HLI A;  2PLY A;  4O3M A;  1NG6 A;  3F9K A;  1D3Y A;  1ORK A;  3TOB A;  4A3B J;  2DT7 B;  2N8G A;  4F93 B;  1R4N B;  3R4K A;  2NS7 A;  5D6E A;  2DA2 A;  3S17 J;  1VQ8 I;  5H20 A;  3RKQ A;  3K4K A;  3CJR B;  2PJR B;  5ERI A;  3ZQQ A;  2QSH X;  2MW8 A;  3GEZ A;  2Q8K A;  2HWV A;  4BH9 A;  3B6C A;  2O61 A;  2XIG A;  2IRF G;  1WSU A;  3I3L A;  5E1X A;  2H6B A;  3K4L A;  3R0A A;  1LE8 A;  1JT0 A;  2JVH A;  5A2Q K;  3PUF A;  3LFU A;  4HAM A;  3EYI A;  3KET A;  4G7O F;  1A5J A;  2KIQ A;  5EYR A;  2WA0 A;  1O4X A;  2VON A;  3E6M A;  1UZC A;  3H9Q A;  2EFO A;  2WB1 A;  3GME A;  1O3T A;  2CO5 A;  1OCC H;  1LNW A;  2H1K A;  3CCM I;  2VOO A;  3CES A;  4JK1 X;  1X3Z B;  1CGP A;  3ABU A;  2EPF A;  1ZGJ A;  4LGW A;  2CUF A;  1R00 A;  3LSJ A;  1WCM J;  3I5U A;  2V26 A;  4GRI A;  3CDL A;  1WI3 A;  2FA5 A;  4B44 A;  2Y31 A;  2PEX A;  1ETY A;  2EA4 A;  2IS2 A;  3VYR B;  4HF0 A;  1MBF A;  2KL4 A;  2CW8 A;  1J9I A;  1Z21 A;  2YPR A;  2VLA A;  3IRR A;  2EZI A;  1R71 A;  2XAG A;  4IHY A;  2QEX I;  3HPG A;  2R5Y A;  1V5F A;  3QQA A;  1UAA A;  2LG4 A;  4BY1 J;  3VPR A;  3FMR A;  3F8F A;  4BKX A;  2JPC A;  3TOA A;  1FC3 A;  5LGU A;  2V9V A;  4KMF A;  3ABM H;  3B6A A;  3M9A A;  1R49 A;  3HSE A;  2XGD A;  3MZ8 A;  4IRG A;  1FBU A;  5ILV A;  2ME0 A;  1JGS A;  2BY2 A;  1G3S A;  4HA8 A;  5B1A H;  1BA5 A;  4YII A;  1XG1 A;  1U5T C;  3K1M A;  4HEA 2;  2X1D A;  3RKY A;  3GBG A;  4JYK A;  1LUJ B;  1YS7 A;  4HF1 A;  1RKW A;  4FT8 A;  3KYD B;  4GYG A;  1LB2 A;  3GZ6 A;  2BEO A;  4HYE A;  3LA7 A;  1FIA A;  4KIC A;  3LAJ A;  2STW A;  1U9N A;  2V79 A;  4CCN A;  1U2W A;  3BP8 A;  4M6V A;  2LBF A;  9ANT A;  3C3W A;  2ZJ2 A;  2EQR A;  1FYK A;  2C6Y A;  3VSL A;  1P6R A;  5GAE J;  3KPH A;  2PQ8 A;  1D0Z A;  3S3N A;  1V4R A;  1UMQ A;  2VBX A;  3L00 A;  4Q47 A;  4R79 A;  4XK4 A;  2HGC A;  1A04 A;  1X3W B;  2X6Y A;  2VE8 A;  3EET A;  5CVI A;  2WWY A;  3VYT B;  2RVC A;  1J0R A;  2QF7 A;  2PMZ N;  2L7F P;  3FMS A;  4XKW A;  4CCJ A;  1UEL B;  1ZK8 A;  3ZGK A;  3QOD A;  1VQP I;  2F5E A;  1B8I A;  1MIJ A;  4IL6 C;  2V9K A;  3PIO F;  2VQC A;  3JSP A;  5FRM A;  1VQO I;  1BR2 A;  3J7A O;  3HJE A;  3I53 A;  2FD5 A;  1MNM C;  4QTR A;  5C44 J;  1EV7 A;  3A03 A;  4CXF A;  1XSD A;  1EH7 A;  2BYV E;  3TBI A;  3A02 A;  2IA2 A;  4N9I A;  3MKY B;  3OYA A;  5H2F C;  3FIS A;  2XAU A;  1ON1 A;  5TGT A;  4QLC U;  1J59 A;  3BRO A;  2CSO A;  3ESW B;  2XPW A;  5B3S H;  3S3M A;  2F5V A;  4DJA A;  2WBM A;  4UV9 A;  1SVM A;  1ZEL A;  3WOD F;  3OIO A;  3ZCO A;  4D7N A;  1H9T A;  4BS9 A;  1IXC A;  3EPZ A;  3C7J A;  1YRN A;  1HCR A;  4MEX F;  3WU1 B;  2HI3 A;  3FK6 A;  4KDP A;  4A5M A;  1XCV A;  3I71 A;  3M3Y J;  5IT9 Z;  1WH5 A;  3GTK J;  4P9U A;  3OYJ A;  2X4H A;  2DOA A;  4IF4 A;  3U1D A;  3S1R J;  3WU0 A;  3OYM A;  2IGK A;  2HOS A;  3M8E A;  3WE2 A;  2LK2 A;  2FJ1 A;  3QP6 A;  1F43 A;  2CJJ A;  1ZHF A;  3JRF A;  5KHD A;  3FXQ A;  3Q0W A;  3SDB A;  2W48 A;  2OAZ A;  1IC8 A;  3IAS 2;  2V1D A;  2GOM A;  4UB8 C;  3TO7 A;  4FTH A;  1YJW I;  5D5U B;  3BJ6 A;  1G6N A;  1D1A A;  2OQR A;  3KP2 A;  3F3X A;  4KFC A;  3U21 A;  3PSI A;  1BJA A;  2G0E A;  2F4O B;  3FIW A;  1S8N A;  1ACI A;  4HX8 A;  1B9N A;  3A0H C;  2Z5U A;  1K4T A;  2E35 A;  2L54 A;  2HZT A;  2XPV A;  2XHK A;  2MH2 A;  2MG4 A;  2K4B A;  2OD5 A;  2LFB A;  3IH4 A;  4S04 A;  1FWZ A;  1FYM A;  1TNS A;  4D1Q A;  2VXZ A;  3O3K A;  4CDG A;  1HQC A;  4JX6 A;  2MD0 A;  3HM5 A;  2QM3 A;  3MD2 A;  3HRS A;  3OR1 C;  3GYH X;  3J7A Y;  3WHC A;  4F52 A;  2B9S A;  2MYS A;  3NQO A;  3RPU D;  4RM3 A;  2F6C A;  2UXN A;  1MW7 A;  2AHQ A;  1ONV A;  1S7E A;  4NC6 A;  3SDG A;  1KU7 A;  2CGP A;  5K7H A;  3SYT A;  1MD0 A;  1WVR A;  3HG9 A;  3ZMZ A;  1R1V A;  2WB1 N;  2O8K A;  5F0H A;  1Z7U A;  1HOM A;  2VKD A;  4ENK A;  1I3Q J;  1G3W A;  5B5E C;  3GX4 X;  3W2A A;  2ICW G;  1T95 A;  1T39 A;  1I3A A;  4OIQ F;  2HDW A;  2DTZ A;  4ZDL A;  4BHC A;  2DYS H;  2JK3 A;  1AKH A;  2DPU A;  1YO5 C;  1BIA A;  1X4P A;  1TNT A;  4AVP A;  2K4J A;  3ABK H;  4PZJ A;  2R5Z A;  1OFC X;  2B0L A;  2RNJ A;  2M30 A;  5C3E J;  1ZN2 A;  2EZK A;  4WCG A;  2R7U A;  4Z6Y A;  5DD4 A;  4E7K A;  4IO9 F;  4WK8 F;  5IPA A;  4U7D A;  3JAM Z;  5HOO A;  4Y13 A;  3AG1 H;  3CME I;  2ZFU A;  4K2E A;  1JTX A;  2E19 A;  2VI6 A;  2RAE A;  3U2R A;  2XUB A;  1MBJ A;  4CIC A;  3RZD J;  2W4S A;  2BXY A;  1XMK A;  3V7S A;  1FEX A;  3BR6 A;  1RKT A;  4N0B A;  3E6C C;  2V4J C;  2EIM H;  2DQL A;  2A3S A;  2EIJ H;  2E36 A;  3OSG A;  4ESB A;  3BZ6 A;  3CO6 C;  3V8J A;  5HDK A;  2VOP A;  4TV7 A;  3WGH A;  3GTO J;  3QPH A;  3K9T A;  1B4A A;  1NHA A;  4E7I A;  1TWA J;  1EA3 A;  3K70 C;  3HL2 A;  3H5A A;  2R92 J;  4FHT A;  4DBR A;  1POG A;  4JX5 A;  2X9D A;  2XC7 A;  2F2E A;  1Z3X A;  2QQB A;  3AAF A;  1BR4 A;  2X85 A;  2KJB A;  3EUH A;  4BBR J;  2E60 A;  3LL7 A;  1D1B A;  1OCT C;  5D6F A;  1XDU A;  1O3S A;  3KYL A;  4R8H A;  4KIF A;  1IV8 A;  1MMG A;  2A5Y B;  2VKH A;  2ZME A;  3KYC B;  4M3F A;  3M1E A;  3QAH A;  2EA2 A;  1EH6 A;  2K3P A;  4KUM A;  3CTA A;  4XMY A;  2R7D A;  4KIB A;  4BQQ A;  3BLY A;  3I4N J;  1Z77 A;  3EUA A;  1SD6 A;  2QLZ A;  2DT5 A;  4HLX A;  4AYB A;  3BCB A;  3DKW A;  4XBF A;  1F5T A;  2GM4 A;  2Q2E A;  4RAZ A;  4HX7 A;  1KQ8 A;  5DM6 F;  1JT6 A;  1FYL A;  2VIX A;  2H27 A;  1PUF A;  1RZ4 A;  2G7H A;  3JRH A;  4E6K G;  4F92 B;  1X1C A;  3C1D A;  2Y0S A;  4F91 B;  4YEL A;  2E7X A;  1MH3 A;  4P55 A;  1FSH A;  3ZQH A;  1J7K A;  1FOW A;  4XN3 A;  1IXR C;  2BE5 F;  5DD8 A;  2KLO A;  2CV1 A;  3PO2 J;  4XKV A;  1QZY A;  1TP4 A;  3K1N A;  5ICE A;  3OSF A;  3R6S A;  2DYR H;  4Y17 A;  1REP C;  3NEU A;  3E0J B;  4CSW A;  3BY6 A;  3M1C A;  4PJJ A;  3RQI A;  2FRH A;  3BR0 A;  1HDP A;  5FO5 A;  3C2B A;  4J01 A;  1YJ9 I;  3SZG A;  3OS2 A;  4RDU A;  1G3T A;  2Z99 A;  2PN6 A;  1V55 H;  2GAU A;  1GV2 A;  3LQR A;  1X58 A;  3J7Y J;  3JSO A;  3GCM A;  2JRT A;  3HKZ N;  1Y6I A;  1O3R A;  4KT5 C;  4MGR A;  2FE3 A;  1W5T A;  2LLK A;  2EFW A;  2VQH A;  1G8X A;  3QYE A;  4QWQ A;  3I4M J;  1U0J A;  1HC8 A;  1UHS A;  2DW4 A;  1HW1 A;  2FXA A;  2BY0 A;  3DU6 A;  2B63 J;  1GXQ A;  1I6X A;  4C30 A;  2Y2Z A;  4I98 B;  2BBY A;  2Z9O A;  3GTM J;  3ELK A;  2NVT J;  3FKI J;  2FBI A;  3K10 A;  1VQL I;  3ZR8 X;  5DCM A;  3CC7 I;  1SFX A;  1U5T B;  5CYV A;  1FTZ A;  3NWS A;  1TT5 B;  2JSC A;  1Y0U A;  2NS8 A;  2M34 A;  3BG6 A;  3PNV A;  3T8T A;  1TW3 A;  4A0X A;  4A3J J;  1PP8 F;  1YQA A;  2HKX A;  4IQJ A;  1TZL A;  1RUN A;  3RQ4 A;  1MSE C;  2PMH A;  5K7F A;  4EGZ A;  3QRF F;  1J09 A;  4BE1 A;  2CQN A;  3A01 B;  2E1O A;  1R58 A;  1WJ5 A;  2OCC H;  5GTI C;  2KDZ A;  3QPS A;  3A0B C;  3X2Q H;  2NVU B;  2XSJ C;  3OYF A;  1BIB A;  3MKW B;  3CUO A;  4HX4 A;  4XSX F;  4IXA A;  2V7F A;  3T0Y A;  2CMP A;  1X2M A;  4RB2 C;  3J81 K;  4U0Y A;  5JLX A;  4LOC A;  4Y3O A;  4XLP F;  1W7P A;  3KP7 A;  5CVR A;  4DYC A;  1WGX A;  2EFN A;  2P81 A;  1JHF A;  4C3I J;  1FSE A;  2CG4 A;  2GWR A;  5EGO B;  2H8R A;  1RES A;  3FXO A;  2ZSI B;  4EJT A;  2X48 A;  2VC0 A;  4M9X A;  3HOW J;  5LHG A;  3K4B A;  3W3C A;  2CFO A;  4KMU X;  5E3M A;  3D0S A;  3DTE A;  5FGM A;  4Y52 J;  2JA6 J;  1ZG5 A;  3S1M J;  4BEH B;  5J8F A;  3CLQ A;  5EG0 B;  3F6O A;  3HZJ A;  3KZI C;  2TDX A;  2R0Q C;  1IRG A;  1TWC J;  1W1W E;  5BMZ A;  4QPQ A;  4AIK A;  3CC4 I;  4ZZL A;  4HRI A;  5FLX Z;  2FML A;  2K27 A;  1IV6 A;  3KZY A;  3K4M A;  1XDS A;  2Y9Z A;  4FAS D;  3KX2 A;  2JA8 J;  4OWR B;  3L2Q A;  1QBJ A;  1GVD A;  1IN5 A;  1LVK A;  2BY1 A;  4FE4 A;  3ERM A;  4FQG A;  4AD9 A;  4XRM A;  2MLK A;  4ZYA A;  4H0E A;  1QZZ A;  2KKO A;  2L5Q A;  5LHI A;  3KCC A;  4IHV A;  3ZMT A;  1OR7 C;  4N9H A;  2Q1Z B;  4C2M J;  3OIP A;  6PAX A;  5KAI C;  1VFC A;  3BG7 A;  2VJI A;  4HST A;  4KIT B;  5J1Y A;  3GO5 A;  3TED A;  3B02 A;  3WTV C;  4BDZ A;  2R7T A;  3FXK A;  2OV7 A;  4LLG F;  1XN7 A;  5M3M J;  3VDX A;  4DW6 A;  5TIS C;  2O5R A;  4PDK A;  1Z05 A;  2QVO A;  2MD5 A;  5LEK A;  3ZN0 A;  4A12 A;  4KYW A;  2ZC2 A;  1Y56 A;  3CMY A;  4A93 J;  1N78 A;  2K40 A;  5GPA A;  2OTJ I;  3M7G A;  1OIS A;  2M87 A;  5BS6 A;  2KIM A;  1QHH D;  1P4A A;  1WPK A;  3MKZ A;  4WF2 A;  3LQQ A;  4C2U A;  2AS5 F;  2LH9 A;  2M4K A;  2X0L A;  4BBS J;  5GP9 A;  1OYY A;  1QO0 D;  4RLF A;  2HPI A;  3BG9 A;  5EEA A;  1LQ1 A;  4KIG A;  4A3E J;  3MN2 A;  5FLM J;  2W84 A;  2P4W A;  2NVX J;  2XKO A;  3CUQ A;  4AIH A;  2OQG A;  2L3D A;  5FKK A;  4ZYG A;  1HW2 A;  1L0O C;  5DDG A;  3CCJ I;  2XSD C;  4F3Q A;  4CHU A;  1D8K A;  1CF7 A;  1WZ2 A;  3BTL A;  1UCR A;  1DP7 P;  4OMY A;  3EUH C;  2R7Q A;  3MMY B;  4AYB N;  2YX4 A;  3DFG A;  1V54 H;  1S7O A;  3HRU A;  4M3E A;  4LLL A;  4ZDP A;  3PL8 A;  4QIW N;  4E70 A;  2ZME C;  1OCR H;  3W2W A;  3ZOB A;  3KP3 A;  2XAF A;  2D1H A;  4M3G A;  4CYC B;  2V1U A;  1YIT I;  4G94 A;  3HRM A;  4ITV A;  3ISP A;  1K83 J;  4LFU A;  2R93 J;  2PMU A;  5EF6 A;  3DLL F;  4WXD A;  2YSR A;  3JRD A;  3QU3 A;  2NOG A;  1W0T A;  2F5D A;  2IEK A;  1K6O A;  1ZTR A;  2KT0 A;  2B7E A;  3O6B B;  1IRX A;  4WWC A;  2FBH A;  2RQP A;  3Q3S A;  1ENH A;  1U3E M;  1RI7 A;  3RTR A;  1SC7 A;  4ON0 A;  5F6F A;  1R5I D;  3HIF A;  2ID3 A;  3H3Z A;  1WI9 A;  3JTH A;  4LB6 B;  4A69 C;  2D1V A;  3D5L A;  4QPO A;  4CCO A;  5M5Y J;  3OYL A;  3G73 A;  3ZXS A;  2XAH A;  1I39 A;  1WQ2 A;  1Y0N A;  4L0Y B;  4MNU A;  1NTC A;  4RB3 C;  2Y0M A;  3L2W A;  4HV6 A;  5DEQ A;  2JUC A;  1Z6R A;  1V3F A;  2H6C A;  2H8W A;  4YRV A;  5KNL A;  4MLO A;  2MC3 A;  4GXO A;  5GPC A;  2IT0 A;  4DYQ A;  1R5H A;  2L7K A;  3IH2 A;  3QPL A;  4MEY F;  2TRT A;  2QBY A;  4BQA A;  1LFU P;  5DTD A;  4EMS A;  3DU5 A;  2L9R A;  3GLX A;  4C9Y A;  2ZJQ F;  1XMA A;  4KN7 X;  2VT2 A;  3KIO A;  3TQN A;  3LSM A;  1U6G A;  1LVA A;  3KZZ A;  2FUG 2;  1VQM I;  2CUE A;  3SFI A;  1QHG A;  2X51 A;  1IRF A;  2BVM A;  3I59 A;  4AID A;  3BPX A;  1S29 A;  3TW7 A;  3G1L A;  3GTL J;  3AG2 H;  1HKT A;  4XLC A;  2BW3 A;  2DOE A;  3TO6 A;  4OMZ A;  4PSW A;  2LF7 A;  3KEO A;  3RKW A;  3F8C A;  1I5Z A;  2VJJ A;  2XPU A;  1ZKG A;  4P1W A;  3HUG A;  3RSN A;  2YX7 A;  1TTY A;  3ECH A;  4FE7 A;  4HNV A;  1BOA A;  3L2V A;  2OJE D;  3HTS B;  3H36 A;  3I9V 2;  4BJ5 C;  1VQN I;  2GQQ A;  4NQW B;  1R5G A;  4IHW A;  5M5W J;  1DUX C;  4EGY A;  3CCS I;  1OYW A;  2L4M A;  2VQG A;  2X1C A;  3DLA A;  1VQ5 I;  2IGN A;  3MAJ A;  1BW5 A;  5LBQ A;  1BI3 A;  4A3K J;  2P7C B;  1MMS A;  5LLQ A;  1KQ9 A;  4V19 K;  5HVQ C;  2KRC A;  2BGC A;  2FNA A;  2IA1 A;  5HOD A;  1UG2 A;  2DMQ A;  1D8J A;  5FJ8 J;  5LHH A;  4BJT A;  1NK3 P;  1XCB A;  2EV6 A;  2K9N A;  5LGN A;  3SJM A;  4EVI A;  4KN4 X;  1W5S A;  2DOD A;  2TCT A;  1HST A;  3DWL E;  4YIR X;  2PJR A;  1DGW Y;  2H1L A;  3DKX A;  3FHN A;  4XLF A;  4DBQ A;  1ETK A;  2KP6 A;  5E3O A;  4UB6 C;  5E17 F;  1R1U A;  3GW2 A;  1T2K A;  2QKL B;  2QQ9 A;  4BE2 A;  1K78 B;  2LSO A;  2M3A A;  4G12 A;  2P0W A;  4PUS A;  2LKX A;  3I55 I;  3BTJ A;  4HBL A;  3HTU A;  2KDO A;  2K3F A;  1WRJ A;  3PNT A;  3GTJ J;  2WV1 A;  3MZY A;  2ZO4 A;  5CJ9 A;  1ZYR F;  3AKZ A;  3TP3 A;  4IHX A;  4IOA F;  5K5Q A;  1JJ8 C;  4CGZ A;  2DJN A;  1RR8 C;  1BM9 A;  3IKT A;  4E7L A;  1KON A;  1E2X A;  1MBK A;  4CO8 A;  4NDL A;  1PP7 U;  4BXX J;  1Z67 A;  1GV5 A;  4D5F A;  2GOX B;  1AWC A;  3IHU A;  1RNL A;  2ZXW H;  1P9Q C;  1XD7 A;  4KA4 A;  2PX9 A;  3V8K A;  4HNU A;  3SFZ A;  4XON A;  2KZG A;  2Y75 A;  2M0C A;  4CUG A;  2K7L A;  1TWH J;  1W5C C;  1WJF A;  3Q0V A;  1MBG A;  1MND A;  2FMY A;  4IVN A;  2EIK H;  3HSF A;  4JX4 A;  3OR2 C;  3BT9 A;  1OLT A;  5E20 A;  2GBY A;  3K6G A;  3SXY A;  5HNF A;  1SMY F;  3VYU B;  4LIT A;  1SFK A;  4E7Z A;  3CCE I;  1YX5 A;  4RGS A;  5A2Q Z;  3WTY C;  1Y8Q B;  2O03 A;  3W2V A;  3AL0 C;  1WJE A;  4RMN A;  4PGG A;  3FZV A;  3NWT A;  3HOS A;  1GT0 C;  3ZPL A;  2KQR A;  4XM3 A;  3CJN A;  4G7Z F;  5D5X B;  1XSX A;  5HS9 A;  1ZG1 A;  2A6T A;  4DOZ A;  1HKQ A;  1YLF A;  3ZMV A;  4G6Q A;  2CRG A;  4UUT A;  2DDA A;  4AU7 A;  4UUS B;  3BQZ A;  3LMM A;  2YR2 A;  4A3L J;  4IEJ A;  3DBH B;  2CH0 A;  2W57 A;  2P6S A;  3FKJ A;  3MEX A;  1BJZ A;  1SD4 A;  2I8D A;  4U0V A;  2CUZ A;  1HXD A;  1QRY A;  3V7R A;  2VE9 A;  3CUQ C;  2HPM A;  1J2X A;  4EV0 A;  3CLO A;  2Z2S B;  5HS8 A;  4OIP F;  2COM A;  2HNH A;  4DQ2 A;  3KP6 A;  3OOU A;  4DZJ A;  3BCA A;  4EJW A;  5LD2 C;  1ETW A;  4RB0 A;  1TL8 A;  1E17 A;  1S5L C;  2OZU A;  2VAS A;  4AIJ A;  1APL C;  1FMV A;  2ZFW A;  2ZJR F;  2JTV A;  3R60 A;  4IX7 A;  5J6X A;  2NVY J;  4EJO A;  1R36 A;  2JUG A;  2MH9 A;  2XAJ A;  4A3D J;  3WHB A;  2ZXI A;  1DU0 A;  3E5U A;  3F8B A;  3W6V A;  1YTY A;  1ETO A;  1GHC A;  4HQE A;  4ZC3 A;  4LIV A;  4UVA A;  1S6L A;  2XRO A;  1RR7 A;  1ZR2 A;  5BPD A;  3OYI A;  2LD5 A;  3Q5F A;  2HVQ A;  4C3J J;  1Z0X A;  1Z1D A;  2OBP A;  3K4C A;  2A05 A;  1ODD A;  3RYR A;  4I0A A;  5DM7 F;  4I01 A;  3D5S C;  1VQ9 I;  3GLL A;  2VT3 A;  1BI2 A;  1X1A A;  2R5Z B;  2K86 A;  3FXL A;  2WAQ A;  3R0J A;  3FWE A;  5DS9 A;  2WY7 Q;  2LRE A;  4CH7 A;  1SFU A;  4JQF A;  3HOY J;  3OL3 A;  2M2E A;  1HDD C;  4MIM A;  1XSV A;  4PJM A;  4A6E A;  1MJB A;  2L9N A;  2XDV A;  1H89 C;  2OZ6 A;  3IAM 2;  2L4A A;  1R4M B;  4MFD A;  5DCF A;  4NB5 A;  1SAN A;  1FPQ A;  4B8X A;  2E1M C;  3EYY A;  1XGS A;  3MQ0 A;  2XRN A;  2IVM A;  1TC3 C;  1JKR C;  3FXU A;  3V42 A;  2NNN A;  2V6C A;  1E3P A;  2OA4 A;  2Y9Y A;  3WG7 H;  5GAG J;  3OYB A;  4XNF A;  2QQ8 A;  1BBY A;  4PJL A;  2NOJ B;  2QWW A;  3WE3 A;  3P9K A;  5HLH A;  2M7A A;  2BV6 A;  1B59 A;  3MCZ A;  5F04 A;  3K0L A;  2MSY A;  3BR5 A;  3G4S I;  3J80 K;  5J1R A;  3CC2 I;  4CCM A;  2X6O A;  1FMW A;  5GAD J;  3SHF A;  4I76 A;  1OCP A;  2HOA A;  2VKE A;  2XGX A;  3K1P A;  3H0G J;  2P5L C;  3GVA A;  1U78 A;  4I6Z A;  1FBQ A;  2M7B A;  2R7V A;  3C2H A;  2NS0 A;  1N77 A;  4AM3 A;  4L5J A;  2HDD A;  1YIO A;  3NAU A;  2DMU A;  3PNY A;  1IDY A;  5LRR A;  1Y39 A;  1Q1V A;  2JA7 J;  2O0Y A;  5J3L A;  4B3X A;  2E71 A;  3ZMU A;  4U88 A;  1XB4 A;  5L3E A;  4RBO A;  3H92 A;  2GLO A;  1ETV A;  4NHJ A;  1I1S A;  3K69 A;  1SAX A;  3H5R A;  1H9G A;  2OTL I;  4XSZ F;  3BTC A;  5DUK A;  1TWG J;  3OL4 A;  3QOP A;  4JP0 A;  2DFI A;  2OU2 A;  2W82 A;  2Q2E B;  1BL0 A;  2AXL A;  3ZQF A;  2L7Z A;  1JUM A;  3GTP J;  1DGR M;  2IAI A;  1MZB A;  3JRG A;  3K2Z A;  2IW5 A;  2W85 A;  4PJN A;  1D5Y A;  4ENJ A;  3GTQ J;  3G1O A;  4OOI A;  2EZH A;  2UUZ A;  4EJU A;  3LAP A;  2DLL A;  4BQO A;  4U87 A;  2CV0 A;  4MO7 A;  3D5R C;  1OPC A;  3U1K A;  2ZNY A;  3GFI A;  1XMX A;  4NBQ A;  5K5R A;  2NVQ J;  2E5Z A;  3GF2 A;  2KPM A;  2ZJP F;  1J5Y A;  2VJ4 A;  3HHH A;  3LSK A;  4IRH A;  1MDM B;  1WKM A;  1VQK I;  1D0X A;  2QYO A;  1WFX A;  1M1E B;  2P5V A;  2Z3Y A;  3MKL A;  1JKQ C;  1LDK B;  3HOX J;  1GDT A;  2EZL A;  4O6J A;  2P8T A;  4C2T A;  3BWG A;  1B72 B;  1A31 A;  4LMY A;  1KQ0 A;  4NNJ A;  1LDJ A;  3RPQ A;  1DP3 A;  3SQN A;  3EUK L;  1OMI A;  2X6W A;  1GXP A;  1HKS A;  1ZQ3 P;  2EBI A;  5J8C A;  3HOU J;  3CCV I;  4G9Y A;  1TW2 A;  2YU3 A;  3D1N I;  2MFZ A;  1AU7 A;  3SEZ A;  1TT0 A;  1XTA A;  5DV5 A;  1N75 A;  4KNY A;  2D45 A;  3I64 A;  5L3D A;  1JKP C;  2CV2 A;  2VBY A;  4Q48 A;  2R4G A;  2A07 F;  2HEO A;  2LR8 A;  1K79 A;  1LEB A;  3HB9 A;  4M73 A;  2R7S A;  4E7J A;  4MQ9 F;  5L3C A;  1YFH A;  1MJ9 A;  2QKM B;  4B1R A;  2DT6 A;  1X3U A;  5DCM B;  2VL8 A;  5F0C A;  2CYY A;  2EIL H;  2OC6 A;  1X1D A;  2WY8 Q;  3ONQ A;  5F64 A;  1DQU A;  2UZK A;  4MFE A;  3S1Q J;  4A0Y A;  4RAF A;  5H6Q A;  1ZRC A;  3BR2 A;  1BN5 A;  3CCR I;  4U7B A;  1Y1V J;  4F55 A;  1KYW A;  3F6V A;  4I09 A;  1RRJ A;  1T33 A;  5KCM A;  4GO1 A;  1BW6 A;  2FF4 A;  2JQ7 A;  4A3F J;  2M0M A;  3H35 A;  1MBE A;  2HOE A;  3G3Z A;  1SAU A;  2EFQ A;  1YW8 A;  5B1B H;  4BUP A;  3M8J A;  4M74 A;  5F27 A;  2WC2 A;  3WGI A;  4A3M J;  2BOL A;  2KRH A;  4L18 B;  1J75 A;  1R22 A;  3PQJ A;  3OS0 A;  1SFO J;  4BXU A;  2NRA C;  2VOD A;  1XC5 A;  3TMO A;  4AWX B;  3QWL A;  2K5C A;  5CVJ A;  1FBS A;  3HYI A;  3LSI A;  3K70 D;  2OCE A;  3GTG J;  3FDY A;  1F36 A;  3ECO A;  1WH7 A;  1YE9 A;  2PG4 A;  4IZZ A;  2WV0 A;  2RN7 A;  1UG0 A;  1OCZ H;  2L02 A;  2WAQ N;  1MJA A;  2VXD A;  3GZ5 A;  2ECB A;  5ILU A;  2E2J J;  1YIJ I;  1MNE A;  1G3Y A;  1D1C A;  1QQI A;  1JTY A;  1SD7 A;  3CF5 F;  2HQR A;  3DV8 A;  1PVE A;  2JA5 J;  1IN7 A;  1BI0 A;  4M9Z A;  4LD5 A;  2IJL A;  3DEW A;  3BJO A;  1BC8 C;  1FJL A;  2R7X A;  4CZC A;  5J47 A;  4MQV A;  3KP4 A;  1VQ4 I;  4HDV A;  1YG2 A;  4UVB A;  5D5W B;  1GVJ A;  3P5J A;  4ZJZ A;  2K9Q A;  5GTH C;  3OYD A;  5KVR A;  3KP5 A;  4LG0 B;  2H09 A;  2R7F A;  2QGU A;  3PUB A;  2HQN A;  3RCO A;  2J5O A;  1DU6 A;  4Q5S F;  2ZXH A;  2VPR A;  2D2W A;  5ICF A;  2JZY A;  3H5N A;  5FFZ A;  2NXN B;  3HRT A;  3H9J A;  3W6K B;  2DA4 A;  2FOK A;  1YW7 A;  1EKE A;  2JWT A;  3ABL H;  1I27 A;  1A6I A;  4E7S A;  2DA3 A;  2VPL A;  4R1H A;  4EJV A;  5BQT A;  2RRE A;  3ZMS A;  2R7W A;  2CW7 A;  3KEY A;  4I7H A;  1KA8 A;  2L9V A;  2BHY A;  4BL0 B;  5CLS A;  4C3H J;  4JOM A;  2Y30 A;  3WTW C;  2GIV A;  1TWF J;  5IP7 J;  3BDD A;  2V6E A;  3CUQ B;  3HXL A;  3ZQL A;  1RC9 A;  3DPT A;  4ABZ A;  1FZP B;  2DPD A;  3E1S A;  2LF8 A;  2JA2 A;  2LP0 A;  2L2O A;  1KZH A;  2A5W A;  1UST A;  4XOR A;  2PI0 A;  3JRB A;  3S16 J;  4YG2 F;  1IF1 A;  3JRE A;  5IOY A;  1YOV B;  3A01 A;  1SVO A;  2FEZ A;  2HS5 A;  5K5O A;  3S32 A;  2HDC A;  1X1P A;  2E1C A;  1F9N A;  3L7W A;  3CCU I;  1S7A A;  1RIO H;  1LPQ A;  5IYD J;  5J4Y A;  1UB9 A;  3RPU A;  1K4S A;  5J4V A;  3HOV J;  4PFP A;  3S3O A;  3LWF A;  3L2R A;  4N4O B;  1Z6T A;  2IPQ X;  2WAD A;  5CKT A;  1MGT A;  3CDH A;  3GZN B;  4LIU A;  2ISZ A;  5HNH A;  4XN0 A;  1L3L A;  2ECC A;  5EGO A;  4HV5 A;  2LC2 A;  2DDB A;  3E6B A;  1IJW C;  1WJA A;  5EZH A;  5L3B A;  2FQ3 A;  1UJ8 A;  2EWN A;  3MFK A;  1EF4 A;  5ILS A;  4CZZ A;  3OOP A;  2BZT A;  4L5I A;  3S2W A;  3E5Q A;  1OYI A;  3TGN A;  5AIQ A;  4KT6 A;  2IS1 A;  4BAC A;  5JVT A;  4BEH A;  5EG0 A;  2HXI A;  3A1Y A;  1T0F A;  3UR3 C;  4HNT A;  3LSG A;  2R3S A;  4CA0 A;  3BZC A;  2RV8 A;  3S2D J;  4NC8 A;  4EM2 A;  3WTX C;  1IGN A;  4M3D A;  4ESJ A;  1R23 A;  3RIR A;  3ZQG A;  2M9H A;  2ZBK A;  3AG3 H;  4NUB A;  4IRI A;  2QUF A;  2E1M B;  4IHS A;  2XGE A;  4XL9 A;  2LY1 A;  3CO7 C;  2VB6 A;  3P9I A;  3UNG C;  1ZLK A;  4HOB A;  2Y0S N;  2GXB A;  3J81 Z;  4M9S A;  2EFP A;  4HLY A;  4BNC A;  1IXS B;  1E3O C;  2A6E F;  1LE8 B;  2EV0 A;  2UV1 A;  2IS6 A;  1UHM A;  5EDN A;  1T08 B;  4BU2 A;  1NK2 P;  3IL2 A;  2KJC A;  3CJT B;  3VEP A;  3E5X A;  1QPI A;  2DFH A;  2ZB9 A;  4M6Y A;  4G6D A;  3KLN A;  4BY7 J;  3TDU C;  1FTT A;  5IOZ A;  4B47 A;  4XQF A;  5D4S A;  2STT A;  2JT1 A;  4CYD A;  2KIU A;  4RA2 A;  2ID6 A; 
#chains in the Genus database with same CATH homology
 1GT0 C;  3OSG A;  2CRG A;  4XRS G;  4UUT A;  4UUS B;  5F08 A;  3BQZ A;  2DA5 A;  3O8H A;  3S15 J;  4A3L J;  2CQQ A;  4IEJ A;  3GTO J;  1OJL A;  2DA1 A;  3HEF A;  1BJZ A;  3FK7 A;  1TWA J;  3HOZ J;  1QRY A;  3HBL A;  2R92 J;  2JMW A;  1POG A;  4DYR A;  4JX5 A;  2E2H J;  2X9D A;  4XID A;  5FLV A;  1I50 J;  3OOU A;  2YU9 J;  4DZJ A;  2R5Y B;  4CYC A;  4BBR J;  1OCT C;  2I10 A;  4V2G A;  1ETW A;  1FIP A;  1JJ6 C;  1ETX A;  2AO9 A;  3MVP A;  3BTI A;  1H88 C;  2VKV A;  2D5V A;  3HGY A;  5E3N A;  4M3F A;  1T56 A;  1APL C;  5J1U A;  3S14 J;  2HOT A;  2DMP A;  2NVY J;  1U9O A;  3S2H J;  3I4N J;  1Z77 A;  2CQX A;  4GFB A;  1QVT A;  4A3D J;  3WHB A;  1H8A C;  3BQY A;  3CQZ J;  1DU0 A;  2GM4 A;  1ITY A;  1VND A;  3W6V A;  1IUF A;  2M8G X;  1ETO A;  3LOC A;  4XIC A;  4X1E A;  1JT6 A;  2ME6 A;  3BR3 A;  4L5E A;  1RR7 A;  1ZR2 A;  1ZR4 A;  5IYC J;  2LD5 A;  1PUF A;  3IH3 A;  4C3J J;  1Z0X A;  3JRH A;  2JN6 A;  4DZP A;  1IDZ A;  5JLW A;  2FX0 A;  1MH3 A;  2R5Z B;  3ZQH A;  5DS9 A;  2MGQ A;  2QCO A;  1VI0 A;  3BG5 A;  3HOY J;  1JGG A;  2M2E A;  1HDD C;  3PO2 J;  1IRZ A;  4MIM A;  5FKL A;  1H89 C;  3OSF A;  2LY9 A;  4MFD A;  1IG7 A;  1SAN A;  2E2I J;  1HLV A;  3RQI A;  3TP0 A;  1B8I B;  3BR0 A;  1HDP A;  3C2B A;  3HDD A;  3K7A J;  4RDU A;  4S0H B;  1JKR C;  5IP9 J;  1TC3 C;  1G2H A;  2Y9Y A;  1GV2 A;  2COB A;  1X58 A;  5K7Z A;  3HKZ N;  1GUU A;  5F04 A;  2LLK A;  4D7M A;  5F0F A;  2MSY A;  3BR5 A;  3S1N J;  5J1R A;  1MSF C;  2HYJ A;  3I4M J;  2X6O A;  1UHS A;  1ZGW A;  2XB5 A;  4I76 A;  4B3A A;  1OCP A;  2R7Z J;  2B63 J;  2HOA A;  2VKE A;  3HGG A;  2Y2Z A;  3H0G J;  4X6A J;  1U78 A;  3GTM J;  1YRN B;  4I6Z A;  1JKO C;  2NVT J;  3PM1 A;  3FKI J;  2HDD A;  1R9T J;  3NAU A;  2DMU A;  1IDY A;  1FTZ A;  1Q1V A;  2NS8 A;  2JA7 J;  2M34 A;  5J3L A;  4V2F A;  4A3J J;  4RBO A;  2GLO A;  1ETV A;  2LTP A;  1MSE C;  5K7F A;  3H3V K;  3L1P A;  3BTC A;  3A01 B;  1TWG J;  4JP0 A;  5FKO A;  2LVS A;  3BG3 A;  2E1O A;  1BL0 A;  3ZQF A;  2L7Z A;  1JUM A;  2KDZ A;  3GTP J;  3QPS A;  2IAI A;  3PO3 J;  3JRG A;  1XS9 A;  5M5X J;  5C4X J;  4Y7N J;  1D5Y A;  3GTQ J;  3G1O A;  3IV5 A;  2XGC A;  2EZH A;  1X2M A;  5IYB J;  5JLX A;  4LOC A;  2CU7 A;  4MO7 A;  1ORK A;  4DYC A;  4A3B J;  1WGX A;  2NVQ J;  2N8G A;  3JRI A;  2P81 A;  4C3I J;  2NS7 A;  5EGO B;  2H8R A;  2DA2 A;  2ELK A;  1RES A;  3S17 J;  3RKQ A;  2K9S A;  3DCF A;  2X48 A;  2MW8 A;  2O9L A;  3HOW J;  4QSH A;  3MKL A;  3B6C A;  1JKQ C;  3HOX J;  1GDT A;  2EZL A;  5E3M A;  1Y1W J;  1B72 B;  4B4C A;  4Y52 J;  2JA6 J;  1LE8 A;  3S1M J;  4A3C J;  1JT0 A;  5EG0 B;  2R0Q C;  1A5J A;  1TWC J;  1P7I A;  5EYR A;  1O4X A;  1HF0 A;  1IV6 A;  1ZQ3 P;  2EBI A;  2Y9Z A;  2JA8 J;  3HOU J;  1GVD A;  4FE4 A;  2FQ4 A;  4XRM A;  3D1N I;  2H1K A;  1AU7 A;  4IHV A;  1AKH B;  5EZG A;  4C2M J;  1JKP C;  1VFC A;  2CUF A;  2DMN A;  3LSJ A;  1WCM J;  4UUS A;  5J1Y A;  3TED A;  2LR8 A;  1W0U A;  1QVU A;  3HB9 A;  3K2A A;  5M3M J;  4DW6 A;  3CDL A;  1WI3 A;  2Y31 A;  4B1R A;  1ETY A;  3CMY A;  1MBF A;  3LSR A;  4A93 J;  2K40 A;  2YS9 A;  5GPA A;  5F0C A;  4MFE A;  3S1Q J;  2EZI A;  3ZQC A;  3BR2 A;  1WPK A;  1RPW A;  4BBS J;  1Y1V J;  5GP9 A;  2DN0 A;  3BG9 A;  5EEA A;  4IHY A;  1MH4 A;  4A3E J;  3MN2 A;  2R5Y A;  5FLM J;  3RZO J;  1T33 A;  3QQA A;  2NVX J;  4BY1 J;  4FIS A;  1BW6 A;  3VPR A;  4BKX A;  4A3F J;  3JR9 A;  5FKK A;  2DMT A;  1MBE A;  2XSD C;  3B6A A;  3BTL A;  5F27 A;  2XGD A;  4A3M J;  2ME0 A;  4AYB N;  1BA5 A;  1SFO J;  1XG1 A;  3GBG A;  4JYK A;  4M3E A;  1RKW A;  1XC5 A;  2XB0 X;  4QIW N;  2DA6 A;  3E7L A;  3ZOB A;  1AHD P;  3GTG J;  1FIA A;  1F36 A;  4M3G A;  4CYC B;  1U9N A;  1WH7 A;  4J19 A;  4A3G J;  4M6V A;  1K83 J;  9ANT A;  2EQR A;  2R93 J;  3ZQI A;  5EF6 A;  2WAQ N;  3JRD A;  2ECB A;  2NOG A;  1W0T A;  5M3F J;  1UMQ A;  2IEK A;  2E2J J;  3O8G A;  1ZTR A;  1LFB A;  2KT0 A;  4M3B A;  4XK4 A;  3JRA A;  1JTY A;  3Q3S A;  1ENH A;  2QF7 A;  2PMZ N;  2L7F P;  2JA5 J;  2ID3 A;  1ZK8 A;  3JRC A;  2L7M P;  3G1M A;  1B8I A;  3DEW A;  5M5Y J;  4A69 C;  1PUF B;  4EEF G;  1FJL A;  2EH3 A;  4XRS A;  2FD5 A;  1MNM C;  1NTC A;  2K9Q A;  1MBH A;  4QTR A;  5C44 J;  3A03 A;  3Q0U A;  4MLO A;  5GPC A;  1DU6 A;  4DYQ A;  1U8B A;  1CQT A;  3IH2 A;  3A02 A;  3QPL A;  2TRT A;  2VPR A;  1LFU P;  5DTD A;  5IP6 A;  2L9R A;  3F0C A;  3FIS A;  2DA4 A;  5F1J A;  2XPW A;  2IBD A;  4D5C A;  2JWT A;  1A6I A;  2DA3 A;  3OIO A;  4D7N A;  2CUE A;  3SFI A;  4C3H J;  1YRN A;  1HCR A;  2Y30 A;  3TW7 A;  2HI3 A;  3G1L A;  3FK6 A;  3GTL J;  1TWF J;  3M3Y J;  5IP7 J;  1I6H J;  1WH5 A;  3GTK J;  3ZQL A;  3S1R J;  2HOS A;  4ABZ A;  2XRL A;  2XPU A;  1ZKG A;  4AUX A;  2HQ5 A;  2LK2 A;  2FJ1 A;  2LP0 A;  3BR1 A;  1F43 A;  2CJJ A;  4HNV A;  4FE7 A;  2JJ7 A;  3JRB A;  3S16 J;  3JRE A;  3JRF A;  3Q0W A;  3M4O J;  5IOY A;  1K61 A;  2W48 A;  3A01 A;  1IC8 A;  1X2N A;  4IHW A;  5M5W J;  4FTH A;  4A3I J;  4W1U A;  5FKM A;  1BW5 A;  4A3K J;  5IYD J;  2G0E A;  3FIW A;  3LNQ A;  3HOV J;  5HOD A;  1UG2 A;  3CCY A;  2DMQ A;  5FJ8 J;  2XPV A;  1JUP A;  2MG4 A;  3UKG A;  1NK3 P;  2ECC A;  5EGO A;  1RET A;  2LFB A;  2K9N A;  3IH4 A;  3SJM A;  2TCT A;  1IJW C;  5EZH A;  1EF4 A;  4JX6 A;  5C4J J;  1ETK A;  2L0K A;  3HM5 A;  5E3O A;  1B72 A;  1JUS A;  3WHC A;  3TW6 A;  5EG0 A;  2HXI A;  5FKN A;  2AHQ A;  3LSG A;  4G12 A;  1S7E A;  2LKX A;  3SDG A;  3BTJ A;  3S2D J;  5K7H A;  2O7O A;  5E3L A;  2WB1 N;  4FCY A;  4AC0 A;  1IGN A;  4W97 A;  4M3D A;  5F0H A;  5BNG A;  2O8K A;  1HOM A;  1VF9 A;  2DA7 A;  2HXO A;  1I3Q J;  2M9H A;  2WV1 A;  3ZQG A;  3GTJ J;  3TP3 A;  4IHX A;  2DTZ A;  2XGE A;  1JJ8 C;  2DJN A;  2JK3 A;  2YUS A;  1AKH A;  2Y0S N;  1MBK A;  4NDL A;  4BXX J;  1GV5 A;  4D5F A;  2R5Z A;  3NAR A;  1OFC X;  1E3O C;  5C3E J;  1LE8 B;  2EZK A;  2M0C A;  1TWH J;  5EDN A;  3Q0V A;  1MBG A;  3LSP A;  1ETQ A;  5IPA A;  1NK2 P;  4JX4 A;  3BT9 A;  2GBY A;  1QPI A;  1JTX A;  2E19 A;  2VI6 A;  2RAE A;  2ZB9 A;  2VUM J;  1MBJ A;  3RZD J;  4BY7 J;  1FTT A;  5IOZ A;  2OF7 A;  1FEX A;  3BR6 A;  1P7J A;  2OPT A;  1RKT A;  2ID6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...