4ENJA

Crystal structure of s. pombe atl1 in complex with damaged dna containing o6-hydroxyethylguanine
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
MRMDEFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHPETHVPWHRVINSRGTISKRDISAGEQRQKDRLEEEGVEIYQTSLGEYKLNLPEYMWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Alkyltransferase-like protein 1
publication title Atl1 Regulates Choice between Global Genome and Transcription-Coupled Repair of O(6)-Alkylguanines.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 24
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2012-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4enjA00
2G7HA 2KJCA 1QQIA 4TV7A 1TW2A 1ZHFA 2Z33A 2CYYA 3WTYC 3IWFA 2RDPA 1TBXA 1U6GA 2HTJA 4IVNA 4MTEA 4O5VA 3M1EA 2O03A 2G9WA 6PAXA 3HOTA 5CVRA 4ZH4F 5ICEA 1W5SA 4A5MA 5LGUA 3L9FA 2RC4A 4OIOF 5E17F 3CUQB 5E8GA 4A6EA 1MJAA 4AD9A 3E6CC 2OZ6A 3E5UA 2A07F 4ZZDA 4IJAA 1R1UA 2E7XA 3E5QA 1KA8A 1FSEA 4KIBA 3ZQ7A 1FPQA 1GXQA 2FXAA 2RNJA 5ICCA 2RV8A 3VFZA 3ELKA 4S04A 4HV6A 2EFNA 2HYGD 1U78A 5D6EA 4L5IA 4Q5SF 1IRGA 3RKXA 2MD5A 1BN5A 1T2KA 3Q5FA 4GCVA 4UVCA 2L4AA 1ZAOA 4HQEA 2ZJ2A 3EQLF 2TDXA 2AXLA 1F9NA 3CTAA 2J5OA 1BIBA 1KGSA 2K7LA 2CWEA 4M72A 4WK8F 1B9MA 3B02A 3LA3A 2GAUA 1XN7A 2LSOA 4KNYA 2OQRA 1BJAA 4ETSA 2V1XA 1G6NA 2IP2A 3CJNA 3E6MA 4EV0A 5DD8A 1R58A 1W4MA 4G7ZF 4HX8A 2B0LA 2KIUA 3SFZA 4B8XA 3GFJA 4OMYA 3HTUA 3L09A 5LRSA 5K5OA 5LEKA 1ZYRF 4EM0B 1D3YA 2VE9A 4HZFA 1O3SA 1MJBA 1R5HA 3BPXA 2RQPA 2HWVA 3MWMA 1YYVA 5ILUA 1YO5C 4A0YA 5DUIA 3R0JA 2MLGA 1HBXG 5JFRA 4ENNA 1BC8C 3MAJA 4P9UA 2RN7A 4M74A 4N0BA 3FF5A 4RB3C 1UFMA 3RYRA 1H9GA 5CVJA 3DF8A 4YIIA 2HFHA 3HUGA 3M9AA 2YPRA 4CGZA 4R1HA 1QZZA 3F23A 2QBYB 2A61A 2W57A 2EFQA 2H94A 2VBZA 2ZCWA 4RGRA 1DPRA 3V7SA 4LK1F 5LRRA 3P9IA 3IL2A 2JZYA 1IUYA 5E1XA 3HTSB 2UXNA 5BS6A 3BZ6A 5IT3A 4M9ZA 2P5VA 3R6SA 3F6OA 3SZPA 3GO5A 1MDMA 5HS8A 4LFUA 2O3FA 2YX7A 1HQCA 1T38A 1ZH5A 5CVIA 4EM2A 4EGZA 4EM1A 3J81K 3KP6A 2UZKA 1H9TA 1KU9A 3KP7A 1TTYA 2VONA 5F6FA 1BBYA 4ZYEA 2K4BA 4ESJA 2STWA 2Q8KA 2C6YA 2ZMEB 2K4JA 1K7AA 2FQ3A 1HKQA 3R0AA 4A12A 1SFEA 2NRAC 3JW4A 4MNUA 1HSJA 1PP8F 2V1DA 4G7OF 2FBKA 2LF8A 3GVAA 3LQRA 1SD6A 4XLNF 5DCFA 5LGTA 1FYLA 3TO9A 1JHFA 1FYMA 3T8TA 4XSXF 1ZRDA 4UHTA 1NHAA 4OU0A 1I6XA 2YX4A 4L9TA 3ZMVA 4S05A 4PZJA 4BHPA 4PCQA 3TOAA 1ZGJA 1LEBA 4U88A 3LA2A 5HDGA 4IPAA 1FYKA 1YW7A 5ED4A 4BHBA 5CYVA 3FXQA 3QPTA 2XGXA 3F21A 1R22A 1UB9A 4D0PA 4EJWA 3QU6A 3VEPA 1DUXC 4A5NA 3TOBA 4G6DA 4I09A 2VBWA 5J8FA 2R3SA 2VXZA 2EB7A 4CZZA 2OD5A 1CGPA 2XAFA 4IRHA 3I4PA 3KP3A 4XSZF 3KZYA 4ASNA 2XAHA 1OYWA 4CXFA 1ZRFA 3HSFA 2O61A 3ML6A 3TKYA 2QYOA 4CICA 3GZ6A 3GW2A 4EJUA 1KU7A 2A6HF 2JPCA 4LJZF 2K27A 3CUQC 5L3FA 3MQ0A 1KQ0A 1G3WA 4KDPA 5FD6A 2GA1A 2PQ8A 3HOSA 5DDGA 3O6BB 1PP7U 1T6SA 2RGVA 5D5WB 2BV6A 5K5QA 3LA7A 4LLLA 3G73A 4WXDA 1QGPA 1OMIA 3M7GA 2O8XA 2F5EA 2EV0A 3GYHX 2FBIA 2E1NA 2Z5UA 3SXYA 2EJRA 4UUVA 2IW5A 5CJ9A 4OMZA 4QLCU 2JPBA 1ZG1A 3KP4A 2MH9A 3OV8A 4JQFA 5HLIA 4ENKA 3CO7C 1EH8A 2NNYA 2H6CA 5ILSA 5FB2A 5J6XA 4OIRF 3FMSA 5JR3A 4MQ9F 4OIPF 1IZ1A 4KICA 1Z05A 3F8CA 1TQIA 4ENMA 2QBYA 3REOA 3LFKA 3ZN1A 2RKHA 1FBSA 1HW5A 3LAPA 1IXCA 3T1BA 1LJ9A 1WKMA 1MZBA 5D8LB 4FX0A 2PBIA 1L0OC 4BH9A 1FP2A 4HLYA 2P5LC 3ERED 3RPUA 5E18F 1K79A 4U0WA 5ILVA 3HHGA 3BJAA 3I5UA 4EJOA 3QP6A 3WTWC 3IRQA 1D8JA 5JHUA 1HW1A 3FM3A 2ZBKA 3O2PE 3P7NA 1R1TA 1SFXA 4OINF 3QOPA 3F8FA 4EMSA 2FMYA 2GXBA 1WSUA 2L01A 3K1PA 1PUEE 1HSTA 2GA2A 4MGRA 2GQQA 4P55A 4HF1A 1FSHA 1W5TA 2Z99A 1D5VA 2BYVE 4GYGA 4I0AA 4HYEA 5L3BA 4RGUA 4WX9A 2QENA 2FA5A 4KMUX 4U0VA 2HYFA 4L0ZB 4I2OA 2XUBA 1R1VA 3ZMSA 1G3TA 2HDCA 4PGGA 4DQ2A 5LBQA 3QAHA 4FT8A 2P7CB 1LDJA 2MH2A 1WRJA 3M8FA 1USTA 2FMLA 3S2WA 4UXNA 1FX7A 3MFKA 1OYIA 3WTUC 3MZYA 1CF7B 4A2UA 2L3DA 1F5TA 2OQGA 1IRFA 3F6VA 1LDDA 2WTEA 3V4GA 1I1GA 4RGSA 2PFBA 4Y13A 1QPMA 2DBBA 2FNPA 4GXOA 3V8LA 1FBQA 5K1YA 1V4RA 1HXDA 1MJ9A 4O6JA 1ZGAA 3I58A 3FMRA 3QP5A 3FX3A 2D45A 4WXHA 3DXJF 2P8TA 2Q2EA 4G7HF 4OOIA 1YW8A 2ZXJA 4A0ZA 2VOOA 4BYYA 2CSOA 4G8XA 1YTYA 1KYZA 2ELHA 1SD4A 4CYDA 2VT3A 4XLPF 3V8KA 1ZARA 5HS7A 2MC3A 4NB5A 2W25A 3E6BA 3NQOA 1JGSA 1STZA 2PLYA 2M87A 2PEXA 4DNCA 3N97A 1S7AA 4I98B 1AWCA 1REPC 1ZG3A 3I53A 2K02A 4RB0A 1O57A 3I71A 4YFXF 1Z7UA 2XVCA 2QQBA 1OPCA 4G94A 2J5PA 2MA3A 3F8BA 3ZPLA 2WV0A 2F5CA 1W7PB 1LDKB 2FRHA 3IRRA 1Z6TA 2UWMA 2HR3A 1OR7A 2BE5F 2NAZA 1FZPB 4JK1X 4HV5A 2Y48A 3TQNA 2MBFA 1AOYA 3KLNA 3DKWA 4Q4ZF 3I0TA 1RNLA 5FO5A 4M9XA 5H6QA 4XRFA 2VODA 3TGNA 3LSTA 4IHTA 1RUNA 1D8KA 1XMKA 3EYIA 4KFCA 1E17A 1R7JA 4ESBA 1J9IA 3K2ZA 2DPUA 2HOEA 2L02A 2IT0A 3P9KA 2CG4A 1S6LA 1XDSA 1IXRC 2E7WA 1KQ9A 2X4HA 5HVQC 3W6JB 1ON2A 1OYYA 2F2EA 1ZRCA 2HTSA 1EH6A 2LKPA 5J8CA 3GZ5A 2XIGA 4IRGA 4ON0A 4MHGA 1TQMA 2DLLA 3VOEA 3LWFA 5D5VB 2DAOA 4I01A 2DFIA 1BOAA 3VODA 4H0EA 1TQPA 2XROA 3PQJA 4UVBA 1J5YA 2XKOA 3GEZA 1BM9A 4L0YB 1XGSA 1B9NA 2M45A 4QWQA 5KVRA 3ZMUA 3W6KB 2OBPA 1GVJA 1ODDA 1MD0A 2EV6A 3J80Z 3BP8A 1PDNC 2EK5A 2Y0MA 2DQRA 4HAMA 4UV8A 3JAMZ 1E2XA 2R7DA 1YLFA 5DD4A 3U2RA 2ZKZA 3RI4A 3K69A 2DK5A 5JVTA 4GO1A 4EGYA 4KT5C 3BJOA 1ONVA 5L3CA 2PMUA 5BPIA 5LHHA 1P4AA 1Z6RA 1CF7A 3E5XA 2ZO4A 2ISYA 3MCZA 2Z3YA 1YG2A 3JTHA 3CUQA 1QNTA 1XDUA 4IRIA 2H09A 2NYXA 1SD7A 3WGGA 3SZTA 1FT9A 1P6RA 3IHUA 1ULYA 4HQMA 4LMYA 5D4SA 4BXUA 4EJTA 1XGNA 2FOKA 4CO8A 4FHTA 2KIMA 3WTXC 1YW9A 2EFPA 5ICGA 3L7WA 1YQAA 3I59B 1LVAA 4M6XA 1K6OA 2DTRA 5LHIA 2OU2A 3ZMDA 2BEOA 4LLGF 3ISPA 3DP7A 3FWEA 3RDIA 4ZYGA 3WU0A 2GZWA 2A5YB 1XCVA 1RI7A 1XGMA 1IN6A 2ISZA 2V9VA 1ZLKA 5LHGA 2K86A 1O7FA 4KIFA 3ZMTA 2KIFA 3QU3A 1W7PA 2KJBA 4I02A 1BC7C 3ZN0A 2ZFWA 2X0LA 4ESFA 4IHSA 2M30A 2VN2A 3BJ6A 1SFUA 1A04A 3KFWX 3ROUA 2QLZA 3WG9A 4ENJA 2IJLA 1RIOH 2XHKA 3RIRA 4WCGA 4MEYF 3F72A 3BDDA 3PQKA 3KZZA 5BOXA 4HW0A 5HLGA 4CDGA 2P7VB 2QWWA 3MZHA 1UHWA 1J7KA 1IF1A 3GX4X 1G3YA 3BWGA 4WXCA 2M8EA 4LG0B 1XGOA 1QZYA 2EV5A 1J0RA 4HA8A 3O3KA 2OZUA 1LQ1A 1O3QA 5D5UB 1V3FA 4N9IA 2W24A 4KA4A 2GWRA 1G4DA 1R00A 3LQQA 3GWZA 1WQ2A 2DU9A 4MQVA 4HDVA 4AIKA 2A69F 2ESNA 1FNNA 4BNCA 1KQ8A 1SMTA 3SQNA 2DW4A 1I27A 2L54A 3TO7A 5D8KB 2OA4A 5D4RA 2QQAA 4ZZLA 3EUHA 3R61A 5BMZA 1RUOA 3EYYA 3WODF 3V8JA 3RPQA 3HRMA 1R36A 3WTSC 2D2WA 4M6YA 5FFXA 2L4MA 3DPLC 2YSRA 1XSVA 2IPQX 1U2WA 3KEOA 4RGXA 5KK1A 1OKRA 2CGPA 4UVAA 5A2QZ 3FMQA 2COMA 3K0LA 1LNWA 1Z91A 5HS9A 3EDPA 1KU2A 1C0WA 1X3UA 5IT9Z 3L00A 2E1CA 2GIVA 3GXOA 5DCMB 3KEQA 2IVMA 2R7FA 2EFOA 2FU4A 4LB5A 4UNOA 2HQRA 2ZMEA 4KN7X 4Y15A 5E8IA 2EA4A 1R5GA 2BBYA 2QVOA 3GUDA 3E6DA 3C3WA 3DQVC 1U8RA 3K1NA 3L2CA 2ESHA 2V6CA 1MDMB 4Q48A 1B4AA 1GXPA 4KN4X 5K5RA 3KETA 5H6RA 3LAJA 4HF2A 4HF0A 1XB4A 3WE2A 1T0FA 3CLOA 3JSPA 3P9CA 3D5LA 3FM5A 3V7RA 1J2XA 2Q0OA 5FLXZ 1U5TB 3HSEA 2P4WA 5CVVA 4AWXB 3H3UA 2D1VA 3KCCA 3RTRA 2MLKA 2JTVA 2A6EF 1FWZA 1ON1A 3ZP5A 2VE8A 4YFKF 3C1DA 3I59A 4MEXF 3SHFA 1YIOA 2PN6A 4BQAA 3RKWA 1RZ4A 1K78B 4EJVA 1BI2A 1FY7A 1O3TA 1L3LA 5ERIA 3CDHA 1W7PD 3WTTC 1KU3A 5LGNA 3FXUA 5JI6A 3H92A 2A68F 2YU3A 4I7HA 1DP7P 5FGMA 4Z2YA 2LNBA 4LD5A 2XKPA 4IXAA 1Q1HA 3BPVA 1FOKA 2FF4A 2WC2A 3EETA 3G3ZA 4OIQF 4L5JA 2LF7A 4B09A 3T8RA 4YIFA 5TJJA 2O6GE 1F4KA 1TW3A 5BPDA 4KMFA 3MEXA 3WGIA 3VB2A 3R60A 2VBXA 1KYWA 1FC3A 5H20A 2YR2A 2W85A 2DT5A 4YG2F 2QM3A 1TLHB 4RB1A 1IN5A 4P9FA 4LG0A 3Q9VA 1SD5A 2W84A 2P6TA 1O3RA 1B1BA 5CLSA 5DEQA 3ECOA 1ZLJA 5EEGA 2M5WA 2XAQA 4WF2A 1S7OA 1FLIA 3ABTA 5AIQA 3BY6A 2DO7A 3DEUA 1U3EM 2BGCA 3HRTA 1HW2A 1I5ZA 4BAYA 5E1WA 2HEOA 2CW0F 3GFMA 1O7LA 1EH7A 3RJPA 3U1DA 3GF2A 2WWYA 3WE3A 3WU1B 4AIJA 2VC0A 2PI0A 2EFWA 4M71A 1P4XA 3KP2A 2IA0A 2HGCA 1LB2A 1VTNC 1TNTA 3HYIA 3KP5A 2V79A 4M73A 1IW7F 2KKOA 2EA2A 3J80K 3KE2A 1SAXA 1LEAA 3E3VA 3WGHA 3JAMK 3V7CA 3T0YA 3R4KA 4K2EA 5HOOA 2PJPA 1UCRA 5DCMA 3F3XA 2O0YA 3GFLA 3BOQA 4YFNF 1WI9A 5E20A 1H0MA 3DFGA 4CHUA 1ZG5A 2JRTA 2JT1A 5E1ZB 2CO5A 5HLHA 3RKYA 2P5KA 2VOPA 5DYMA 4RAZA 4FX4A 1IAWA 2Z9OA 1S29A 1ZN2A 3CO6C 2HQNA 3T5XA 1SMYF 2D1HA 5FD5A 1BIAA 1GHCA 4LK0F 2CQKA 5EEHA 1HKTA 3NEUA 1T39A 4IF4A 5FFZA 3WTZA 3F22A 3KLOA 3F8MA 2ETHA 3HRUA 1U5TA 2DQLA 2VC1A 5BQTA 1I1SA 1ZREA 4L9NA 4N9HA 4LGWA 3IKTA 4ZYDA 2ADUA 3C7JA 1IN7A 4P96A 1B59A 2KRFA 4L9JA 2FSWA 4PGHA 2QZ8A 2A3SA 1K78A 3HHHA 3J81Z 1B6AA 1JHHA 2H6BA 4ZYHA 2QUFA 4NQWA 1Y0UA 1HKSA 4M9SA 4A0XA 1MKMA 5AIPA 5LEJA 4LB6B 3CUOA 5D5XB 2IA1A 1EV7A 3FXRA 1XMAA 2HKXA 4G9YA 1TNSA 3N4MA 2QQ9A 3F8NA 4EQQA 4MTDA 1BI3A 3E97A 2RVCA 5HDKA 3DV8A 5CVUA 2STTA 2PMHA 2HZTA 2IA2A 5F64A 3B73A 2OAZA 3I64A 2H27A 1DPUA 3PFIA 1QO0D 3K1MA 4JBAA 2HS5A 2UXXA 1U5TC 3JTGA 1USSA 1MGTA 4Y17A 1P2FA 3NRVA 5F1RA 1UHMA 2VT2A 1R23A 2ZNYA 3ULQB 5DV5A 3WTVC 4U7DA 4RS8A 2LDUA 4NHJA 2FE3A 2F5FA 4HBLA 3OOPA 4KIGA 3IKVA 3C18A 4KYWA 3GLXA 2XRNA 2CFXA 1YS6A 1XSDA 1T98A 3H3ZA 4HLXA 4HX4A 5DUKA 4LLNA 4AVPA 4A6DA 1BI1A 3COAC 4Q47A 4F7ZA 1Z1DA 3HRSA 3RYPA 1XD7A 2DPDA 4RAYA 5L3GA 2XAJA 3I54A 4E70A 3FZVA 5HDNA 4R8HA 4EVIA 3ECHA 2V1UA 1JE8A 1XCBA 3FHZA 1P92A 3JSOA 3GFIA 2VBYA 4P5OA 3Q9SA 3AAFA 1Z9CA 3D0SA 4KUMA 2Y75A 5A2QK 3K9TA 3M8EA 2NS0A 4PDKA 2GXGA 4HDUA 1J75A 1P4WA 2JSCA 2M1BA 5IT9K 3ABUA 3TDZC 5AONA 1J59A 3IWZA 1YS7A 1BI0A 2F5DA 2EWNA 4HX7A 4I0BA 1F1ZA 4AIHA 4L9VA 3HSRA 1XSXA 2XAGA 1QBJA 5ICFA 2NNNA 4WWCA 5LLQA 5L3EA 3TO6A 2XV4S 2HKOA 4R79A 4HOBA 3QRFF 1S8NA 2ACJA 3QPHA 1YFHA 2IRFG 3HIFA 1FBUA 4L18B 2P6SA 2G7UA 4U0YA 5TRDA 2FEZA 1G3SA 3DPTA 4BHCA 3J7AO 5FLXK 3IC7A 2FNAA 4O3MA 2FBHA 3TDUC 1FP1D 1IXSB 1WWXA 4UV9A 4G6QA 2DK8A 5D6FA 4GYIA 1JXSA 1DDNA 1IN4A 3ZMZA 2XASA 5L3DA 1IN8A 1S3JA 2ZNZA 4GGGA 3U9GA 4XBFA 2AS5F 3BROA 2PG4A 4RB2C 4U7BA 2DI3A
chains in the Genus database with same CATH superfamily
2XGCA 4PUSA 1WH5A 2G7HA 2KJCA 5GAEJ 2DN0A 5CKTA 3CD6I 1QQIA 4TV7A 1TW2A 1ZHFA 2W1OA 2Z33A 4Y52J 2CYYA 3WTYC 1ITYA 3IWFA 2PJRB 2WADA 3NWSA 2RDPA 1LFBA 3IH3A 3QOEA 1TBXA 1U6GA 2F48A 3FXOA 2HTJA 3BG7A 2Q1ZB 4IVNA 4MTEA 3KEYA 4O5VA 4E7LA 3M1EA 1MBHA 2O03A 3S2HJ 4A3FJ 3ZQGA 4C2TA 1VQ6I 5EGOA 2IEKA 2G9WA 2FQ4A 6PAXA 4G12A 1QPIA 3HOTA 1WZ2A 5CVRA 1T33A 1MSEC 4ZH4F 5ICEA 5JLWA 2NVUB 1W5SA 1W36D 1Y6IA 1XX5A 4HSRA 4A5MA 5LGUA 1X1PA 1Y0NA 2DFFA 2RC4A 3L9FA 4OIOF 3HOWJ 5E17F 3CUQB 5E8GA 4Y7NJ 1F36A 4Y4RA 4A6EA 5GPCA 5JVGF 1NH3A 1MJAA 4AD9A 3E6CC 3W3CA 2OZ6A 3AL0C 4B4CA 3E5UA 2A07F 2EZLA 4ZZDA 4IJAA 1R1UA 4EEFG 2VQCA 2E7XA 2BY3A 4AYBN 3HDDA 3E5QA 2R7SA 1KA8A 3K4JA 1DGWY 1FSEA 4KIBA 1SFOJ 3ZQ7A 5HLTA 1FPQA 1X2MA 2PMZN 5LD2C 3ZQCA 1GXQA 2FXAA 2KMUA 2ZJRF 1X2NA 4EATA 2BOLA 2M4GA 2RNJA 5ICCA 1N75A 2RV8A 3VFZA 1S5LC 3ELKA 3AFHA 2MGQA 4Z6YA 4S04A 4HV6A 2EFNA 2HYGD 5EF6A 1U78A 5D6EA 2PMZA 2LP0A 4RAFA 4L5IA 4Q5SF 1IRGA 3RKXA 3RCOA 2DA4A 2EBIA 4MO7A 2MD5A 1BN5A 1T2KA 2L7FP 3Q5FA 3S3NA 4GCVA 4UVCA 2L4AA 2Z1DA 1ZAOA 4HQEA 3S8PA 2ZJ2A 3EQLF 1ETXA 3B6AA 3GTQJ 2TRTA 3LL7A 2TDXA 4RDUA 2AXLA 5GADJ 2CQXA 1F9NA 3VYRB 3CTAA 2J5OA 3DPUA 1BIBA 1KGSA 4BKXA 3GTPJ 2K7LA 2CWEA 4M72A 4WK8F 1B9MA 1O4XA 1HDPA 2M9HA 3CCRI 2VJ4A 4II3A 3B02A 3LA3A 4ABZA 3PSIA 2GAUA 2EIMH 4XLEA 3TL4X 1XN7A 2K9SA 2LSOA 1I50J 2EILH 3I56I 4KNYA 2OQRA 1BJAA 4ETSA 2V1XA 1G6NA 1WJFA 2X6WA 2IP2A 3CJNA 4B43A 1BOBA 3E6MA 4NC8A 5B66C 4EV0A 2A05A 3HOXJ 5DD8A 3HG9A 1R58A 2OF7A 1A31A 1W4MA 4G7ZF 2OJED 3ABMH 4IEJA 4HX8A 2B0LA 2KIUA 3DTKA 5IYCJ 3SFZA 4B8XA 3ASOH 4I76A 3GFJA 3FKJA 3OYDA 2DA3A 4OMYA 2COBA 1J09A 2LH9A 3HTUA 3L09A 5LRSA 2NXNB 5K5OA 5LEKA 2MABA 1ZYRF 3G4SI 4EM0B 3C2BA 3M8JA 2WY7Q 1D3YA 1U8BA 3KX2A 4HZFA 4F52A 2VE9A 1O3SA 1I3AA 1MJBA 4XKCA 1R5HA 2X48A 3I9V2 4QIWN 3BPXA 1NK3P 2RQPA 2HWVA 2QSGX 1Z7LA 3MWMA 1YYVA 5ILUA 2BVLA 2FUG2 5J1UA 1YO5C 2QKLB 2XGEA 3UR3C 4V2FA 4A0YA 5DUIA 1D0YA 1RRJA 5B3SH 3R0JA 2MLGA 1OQYA 1HBXG 1TWFJ 3ONQA 5JFRA 4ENNA 3JR9A 4ZTJA 1D1BA 1YJNI 1BC8C 2XSDC 4IHWA 1MMDA 3MAJA 5GAHJ 2ZJQF 4P9UA 2RN7A 2HVSA 4M74A 4N0BA 3E0JB 1DU0A 4XN0A 3FF5A 4RB3C 1UFMA 3VYTB 3FXJA 3RYRA 5GTIC 1H9GA 5CVJA 2ZFUA 2XPUA 3DF8A 4YIIA 3UKGA 1Y56A 2HFHA 3DTIA 3HUGA 3M9AA 2YPRA 3S15J 3QQAA 4CGZA 4R1HA 1MBGA 1QZZA 3HBLA 3F23A 5H2FC 3O8GA 4BXFA 3C2GA 1UG2A 2QBYB 2A61A 4DIQA 2VXDA 2W57A 3A03A 2EFQA 4FETA 2H94A 2VBZA 2K3PA 2ZCWA 4RGRA 4CUGA 3JRCA 3FIWA 3K6GA 1DPRA 2CUEA 1JUMA 3WU2C 3V7SA 3LSJA 1N25A 1JUPA 4LK1F 1M1EB 4XOPA 4JP0A 5LRRA 3P9IA 1ACIA 3IL2A 2JZYA 3KPHA 1IUYA 5E1XA 2L9SA 3IH2A 2CFOA 3HTSB 2UXNA 5EJCA 3BZ6A 5BS6A 2KDOA 2CUJA 1YOVB 4E7HA 1N77A 4BL0B 2MD0A 3CCMI 3K4CA 4M9ZA 5IT3A 2R7RA 1YJ9I 2P5VA 3R6SA 5TISC 2MSYA 3F6OA 1OCCH 3SZPA 3MKWB 1A6QA 3GO5A 3CJQB 4J01A 2KFDA 1MDMA 3DBRB 1V5FA 3GZNB 2W82A 3LSKA 5HS8A 4ANJA 2X1EA 2R4GA 4LFUA 1VQKI 2O3FA 2YX7A 5EDNA 1HQCA 3NWTA 1T38A 1ZH5A 5CVIA 4XM3A 4EM2A 4EGZA 4EM1A 5C3EJ 4CZCA 3J81K 2VASA 3KP6A 2OTLI 2JVHA 2JA2A 2UZKA 2R92J 2DTZA 4UUSA 3I4NJ 2AQEA 1MBEA 2LFBA 1H9TA 4BE0A 1KU9A 3KP7A 4C3IJ 1TTYA 2VONA 1MBJA 5F6FA 1BBYA 4ZYEA 2K4BA 4ESJA 3ESWB 1B72B 1I6HJ 2A6TA 2STWA 1MH3A 2Q8KA 4IHYA 2C6YA 1ZTRA 2CW7A 1JKRC 4XICA 2PJRA 2QEXI 2ZMEB 2K4JA 3PSFA 5M3MJ 2FQ3A 1K7AA 4HRIA 1HKQA 3U21A 3R0AA 4CSWA 4A12A 1SFEA 2M4KA 2ME6A 2NRAC 3G1MA 3JW4A 4MNUA 4XKVA 1HLVA 2EIKH 2O8KA 1HSJA 1PP8F 2V1DA 4G7OF 2FBKA 2LF8A 3GVAA 3LQRA 2VPLA 1H89C 1SD6A 3IH4A 2DMPA 5M5YJ 2XF6A 4XLNF 1TC3C 3DKYA 5DCFA 5LGTA 3JREA 3OIQA 3K4BA 1FYLA 3TO9A 2CRGA 3K4NA 1JHFA 1FYMA 3T8TA 4XSXF 3HKZN 4UHTA 4YRVA 1ZRDA 3F0CA 1NHAA 3M1CA 4OU0A 1I6XA 2Y9YA 4IL6C 4XIDA 5IYDJ 2YX4A 4AUXA 1IRXA 2RREA 4L9TA 4XK4A 3PO3J 2BZTA 1S9HA 3ZMVA 4S05A 5M3FJ 4PZJA 4BHPA 4PCQA 1IDYA 1FIAA 1Y1VJ 4E7IA 3TOAA 1ZGJA 1OCZH 1OISA 1LEBA 2KQRA 4U88A 3LA2A 5HDGA 4IPAA 1FYKA 2Z16A 1YW7A 3H5NA 5ED4A 2LG4A 5CYVA 1MH4A 3FXQA 4BHBA 1YI2I 3OOUA 2FX0A 4ZC3A 3ERMA 3QPTA 3PIOF 2XGXA 3F21A 1VQNI 1R22A 2R7QA 1UB9A 4D0PA 2E2HJ 4EJWA 3QU6A 3VEPA 1DUXC 4A5NA 3DU6A 5IOZA 3TOBA 1JI8A 4G6DA 2LMDA 4I09A 2VBWA 2IS4A 5J8FA 2R3SA 2VXZA 2EB7A 2X6YA 3A0BC 4CZZA 4BE2A 2KT0A 2OD5A 2HZDA 1CGPA 2XAFA 4IRHA 5FKOA 3I4PA 1UELB 3KP3A 2D5VA 4XSZF 2Q2EB 3KZYA 4ASNA 1A36A 1Q1VA 2XAHA 1OYWA 4CXFA 1ZRFA 3HSFA 2O61A 3ML6A 3TKYA 4M3DA 3OMYA 2QYOA 2VB6A 4CICA 3GZ6A 3GW2A 4EJUA 1KU7A 2A6HF 2KL4A 2L9RA 3UNGC 2JPCA 2LY1A 4LJZF 2K27A 3A01B 4V19K 2QGUA 3CUQC 5L3FA 3HEFA 3RQIA 3MQ0A 1KQ0A 1G3WA 5CQEA 5C44J 4KDPA 1IG7A 5FD6A 2GA1A 2PQ8A 3HOSA 5DDGA 5IP7J 3O6BB 2Z2SB 4D5FA 1PP7U 1T6SA 2RGVA 4RMNA 3KYLA 2V4JC 5D5WB 2CV2A 1WI3A 2BV6A 3SDBA 5K5QA 1MSFC 3LA7A 4LLLA 1X1CA 2JJ7A 3G73A 4WXDA 1QGPA 1OMIA 2BXZA 3M7GA 2O8XA 2F5EA 1GDTA 4E7ZA 4YELA 1WJ5A 4M3EA 3OYIA 4KT6A 1E3HA 4A69C 4C30A 1R4NB 2BHYA 2EV0A 4PSWA 3FK7A 1NG7A 3GYHX 2VKEA 2FBIA 2E1NA 2Z5UA 2RQQA 3SXYA 3CCEI 2EJRA 4UUVA 2IW5A 1TL8A 5CJ9A 4OMZA 4QLCU 2JPBA 3JRIA 2OCEA 1ZG1A 1P7IA 3M3YJ 4XLFA 3ZQQA 1T56A 1JJ8C 3KP4A 2MH9A 3OV8A 4JQFA 5HLIA 2F5VA 4HEA2 2HPMA 3A2KA 4ENKA 3CO7C 1EH8A 2NNYA 2H6CA 5ILSA 5FB2A 4BQOA 3NARA 3OSFA 5J6XA 4OIRF 2Y9ZA 3FMSA 5JR3A 4MQ9F 2IGKA 4BXXJ 3LSGA 3LSPA 2DMQA 2DFHA 4OIPF 1IZ1A 4KICA 4PJJA 1Z05A 1POGA 3F8CA 1TQIA 2NS8A 4BQNA 4B44A 3BG6A 2K5CA 4ENMA 2QBYA 4LIVA 5C4JJ 3P5JA 3L1PA 3REOA 3LFKA 3V42A 3ZN1A 3GBGA 2RKHA 4U87A 1FBSA 4IZZA 1HW5A 3LAPA 1IXCA 3T1BA 1LJ9A 1P9QC 1WKMA 4MFDA 1JJ6C 1MZBA 4DBRA 9ANTA 5D8LB 1RPWA 4FX0A 2PBIA 1L0OC 4BH9A 4NBQA 2EZIA 1Y39A 1FP2A 4HLYA 4ZYAA 3QYEA 2P5LC 3ERED 1WVRA 3PJRA 4CCOA 4QTRA 2R5ZB 5IOYA 3RPUA 5E18F 2K9MA 1K79A 4U0WA 3MKLA 4HG2A 1IDZA 1K61A 1Z0XA 3GTJJ 5ILVA 4GDFA 3HHGA 3BJAA 3I5UA 3S32A 4EJOA 2GBYA 3QP6A 3WTWC 3S93A 1EKEA 1R4MB 2BY2A 3IRQA 4ITVA 1D8JA 2EIJH 4E4HA 5JHUA 1CQTA 4A3IJ 1HW1A 2LTPA 3H35A 1ZR2A 1SC7A 3FM3A 2ZBKA 3BTIA 3O2PE 4FE4A 2F4IA 3P7NA 4BY1J 3WHBA 3L2VA 1R1TA 1SFXA 4OINF 2QCOA 3QOPA 4DYQA 4JX4A 3F8FA 4EMSA 2FMYA 2GXBA 1WSUA 2L01A 1Y8RB 5E3MA 3K1PA 2LKXA 1MW7A 1PUEE 3K10A 1HSTA 2GA2A 2XC7A 4MGRA 3OYFA 2GQQA 4P55A 4HF1A 1FSHA 2K85A 1W5TA 2Z99A 1D5VA 2Y69H 2BYVE 1VQPI 1G59A 2W00A 4GYGA 4I0AA 4HYEA 5L3BA 3H5RA 1ORKA 1WJEA 4RGUA 2X1CA 4WX9A 2QENA 1WCMJ 3JRBA 2FA5A 4KMUX 4PK4A 1G8XA 2HYFA 4U0VA 2IS2A 4A3MJ 4L0ZB 4I2OA 2XUBA 3VSLA 1WJCA 2V6EA 1FIPA 2DMUA 1VI0A 2NOJB 2M8GX 3M07A 1R1VA 2IBDA 3ZMSA 2BW3B 2YUSA 2VKHA 2P81A 3JRHA 3ASNH 1G3TA 2HDCA 2H1LA 5FLMJ 4PGGA 3AKZA 4DQ2A 1OCRH 4JOMA 5LBQA 3QAHA 2DOAA 1JTYA 4FT8A 2HU9A 2P7CB 1ZQ3P 3CJRB 1A6IA 1LDJA 2MH2A 1WRJA 2JA6J 2K40A 3M8FA 1USTA 5IY5H 2FMLA 3S2WA 2MYSA 4UXNA 3CZ6A 2H8RA 1FX7A 1Z21A 3MFKA 1OYIA 4CCJA 2XRLA 3WTUC 3MZYA 3HPHA 1CF7B 4A2UA 2L3DA 1F5TA 4G6TB 2IS6A 3S1RJ 3GTMJ 2OQGA 1IRFA 2M2EA 3PL8A 2LR8A 3DU5A 3F6VA 1LDDA 1MNMC 1LPQA 2WTEA 5B5EC 3V4GA 4IKFA 1I1GA 2XPWA 4IHXA 2R5YB 4RGSA 2JUCA 2PFBA 3MMYB 4Y13A 1BR1A 4BDZA 4JX6A 1QPMA 1ETYA 2DBBA 3OY9A 2FNPA 1YHQI 4GXOA 3V8LA 1FBQA 5K1YA 2K3FA 1V4RA 4XOTA 2XAUA 5F0HA 2GOMA 2GM4A 1HXDA 1MJ9A 2DA6A 3DKXA 1KZHA 3B6CA 1UAAA 1WJBA 1D1AA 4O6JA 2LBFB 1ZGAA 2O5RA 5KCMA 1HC8A 1VQ8I 3I58A 3FMRA 3QP5A 2ZMEC 3FX3A 2HOSA 2D45A 1MNEA 4WXHA 3DXJF 4AYBA 1PYVA 2P8TA 2Q2EA 4G7HF 1X3WB 4OOIA 1YW8A 1B8IB 2ZXJA 3TW7A 1OFCX 4A0ZA 3BR0A 1DQUA 3HPGA 2VPRA 5GAGJ 1GT0C 1WFXA 2VOOA 3CMAI 4BYYA 2ME0A 2CSOA 1YJWI 3A01A 4G8XA 1YTYA 3L2WA 2EINH 5K7HA 2ELHA 1KYZA 1QRYA 1SD4A 3H9JA 3FISA 4CYDA 3S3MA 3BG9A 2VT3A 4XLPF 3V8KA 2R0QC 4A3GJ 1SVLA 1ZARA 5HS7A 2MC3A 4NB5A 1WPKA 2W25A 3E6BA 3NQOA 2ELKA 1JGSA 3AG3H 1YRNB 3JCUC 1STZA 2PLYA 2M87A 2PEXA 1JTXA 4DNCA 3N97A 1S7AA 4I98B 3OYKA 1AWCA 1D1CA 1REPC 1ZG3A 5F0FA 3I53A 2L2OA 5CQGA 3IAM2 3CCUI 2K02A 4RB0A 1O57A 3I71A 4YFXF 3ZCOA 1Z7UA 4C3HJ 1YITI 2XVCA 2QKMB 1JUSA 3QYBA 3GTKJ 2QQBA 1BW6A 1OPCA 4G94A 2J5PA 2MA3A 3F8BA 1S72I 3ZPLA 2WV0A 2K9QA 2F5CA 1W7PB 1LDKB 2FRHA 4CCMA 3IRRA 1Z6TA 1OCTC 1QHGA 3D5RC 2UWMA 4KISA 2HR3A 1OR7A 3QODA 4E7JA 2BE5F 2NAZA 3OYEA 1FZPB 4ZDPA 4JK1X 3BR5A 3K7AJ 1U0JA 4HV5A 2Y48A 4XRSA 3TQNA 5GTHC 2VJ5A 2MBFA 4A3CJ 1AOYA 4LOCA 3KLNA 3DKWA 4Q4ZF 3I0TA 1RNLA 3JRFA 1JKOC 5FO5A 2XB0X 5KAIC 1E3OC 4M9XA 2UV1A 5H6QA 3HB9A 2DDBA 4XRFA 1ETQA 2VODA 1MBKA 3G6EI 3RPUD 3TGNA 4CA0A 2HI3A 3LSTA 1IV8A 4IHTA 1FMWA 1VQ9I 3HOVJ 1RUNA 1D8KA 4PJMA 1XMKA 3EYIA 2CUZA 2H8WA 1X3ZB 4KFCA 1EJ9A 1E17A 1R7JA 2FOWA 3DLLF 3D5SC 3CDIA 5HNHA 4XL9A 3GLLA 4ESBA 1J9IA 2MG4A 3K2ZA 4FQGA 2DPUA 2HOEA 2L02A 2EH3A 3A4CA 5KNLA 2IT0A 3P9KA 4XR6A 1HCRA 2R5ZA 3K4KA 4NUBA 2CG4A 1S6LA 2ID3A 1XDSA 3ZQLA 1YX5A 1IXRC 2E7WA 2A5WA 1KQ9A 1DP3A 2X4HA 5HVQC 4BBSJ 3LOCA 3W6JB 3ABKH 4B47A 1WJDA 3SZGA 1ON2A 2KHMA 1VQ5I 1OYYA 2F2EA 1ZRCA 2HTSA 4XKBA 1EH6A 2LKPA 2DOEA 4Y33A 5J8CA 3GZ5A 5FRMA 2XIGA 5BNGA 3E1SA 1FTZA 4IRGA 4ON0A 2X6XA 4MHGA 4HNUA 1TQMA 2DLLA 3VOEA 3K4LA 3LWFA 5D5VB 5B1BH 1OR7C 3SFIA 3TMOA 3BZCA 4RA2A 4PJNA 1X1BA 2DAOA 2X85A 4I01A 4QPOA 2DFIA 1BOAA 3VODA 2ZXWH 4H0EA 1TQPA 2XROA 3PQJA 4UVBA 3S14J 1J5YA 2CQ7A 4DBQA 2CV0A 2XKOA 3GEZA 1HOMA 1BM9A 4L0YB 2CW8A 3CP2A 1XGSA 1B9NA 2M45A 4QWQA 4BEHA 5KVRA 5F27A 3ZMUA 2LOOA 3W6KB 2OBPA 1GVJA 1ODDA 1MNDA 2LYCA 2VQGA 4J19A 1MD0A 2EV6A 3J80Z 3Q0UA 1D0XA 2ID6A 3BCBA 3BP8A 3TW6A 1PDNC 3U1KA 2EK5A 2Y0MA 2DQRA 1X1AA 4HAMA 4UV8A 3JAMZ 4UUTA 2BW3A 3H36A 1E2XA 2R7DA 4J00A 1YLFA 4XNFA 5DD4A 3U2RA 2V9KA 3LFUA 4YEJA 2X9DA 1X19A 4F92B 1QVTA 4CYCB 3SJMA 2ZKZA 5EG0B 3RI4A 1AKHB 3CCJI 3K69A 3M4OJ 2DK5A 5JVTA 2OTJI 2JA7J 4X6AJ 3CF5F 4GO1A 3VSKA 4EGYA 4ZJZA 1VQ7I 4KT5C 1KONA 2E1MB 1FOXA 3BJOA 3DEEA 1ONVA 2R7OA 3ZOBA 2DA1A 5L3CA 2QSFX 2VKDA 2PMUA 4AC0A 2ECBA 2GLOA 4BBRJ 5BPIA 5LHHA 1P4AA 1Z6RA 1RESA 1CF7A 1OCOH 3E5XA 2ZO4A 2ISYA 3H0DA 1QZEA 3HXLA 1X1DA 1K4SA 4OAZA 3MCZA 3S17J 2QF7A 1R6RA 1YG2A 2Z3YA 3JTHA 2R5YA 3CUQA 4BJ5C 3MKZA 3J7AY 1QNTA 1XDUA 4W97A 2ZJPF 2KRCA 1H8AC 4IRIA 2LD5A 2H09A 1Y8QB 2JVGA 2NYXA 1SD7A 5K7ZA 1U9NA 3Q0VA 3WGGA 2R93J 2MFZA 3G71I 3BR1A 1TT0A 5LFAA 3SZTA 4IX7A 3E7LA 1FT9A 2B9SA 3CMYA 1D5YA 1P6RA 3PNYA 3IHUA 1ULYA 4HQMA 2LBFA 4LMYA 4C9YA 2RNGA 5D4SA 4F55A 3OYAA 3HKZA 1JGGA 4BXUA 4EJTA 1XGNA 2FOKA 4CO8A 4FHTA 4CH7A 2VL8A 2WA0A 2NVQJ 3EPZA 3Q0WA 2KIMA 2E2JJ 4B48A 4C2UA 3W2WA 1B8IA 3DBLB 3WTXC 1YW9A 2WAFA 2EFPA 3FXKA 2E2IJ 5ICGA 4A93J 3L7WA 1MMNA 2F4OB 1YQAA 2JA5J 1SAUA 5EGOB 3I59B 1LVAA 2UUZA 4M6XA 1K6OA 2R7UA 2DTRA 5F08A 5LHIA 2OU2A 3ZMDA 2JUGA 1F43A 1LFUP 4NC6A 1ETKA 1MMGA 2BEOA 2WBMA 4LLGF 3ISPA 4ZDLA 3DP7A 1YRNA 5KHDA 2I8DA 1ZKGA 3FWEA 3RDIA 2HDDA 3DTEA 4ZYGA 1V54H 2EQRA 1VZ0A 3WU0A 1JKQC 2DYRH 2GZWA 2A5YB 1XCVA 1RI7A 1XGMA 1JT6A 2IAIA 3HZJA 1IN6A 2ISZA 4HSTA 4BQQA 4M3GA 2V9VA 1ZLKA 2VIXA 3OYHA 4IOCF 5LHGA 2K86A 4NC7A 1FMVA 1O7FA 1BR2A 4AU7A 1BA5A 4KIFA 3TP0A 3ZMTA 2KIFA 2I5UA 3QU3A 2DMTA 1W7PA 2KJBA 4I02A 1BC7C 3ZN0A 2ZFWA 2X0LA 3SYTA 4ESFA 3CC7I 4IHSA 3JRAA 2M30A 2VN2A 1E3PA 3HOYJ 3BJ6A 1SFUA 1A04A 3KFWX 3HGGA 2QLZA 3ROUA 3WG9A 3WG7H 3CCLI 4XORA 3K70C 3G1OA 4ENJA 2IJLA 1RIOH 2XHKA 2BY0A 3PFYA 3FK6A 3RIRA 2X1DA 4WCGA 4NNJA 3VWBA 4MEYF 1NG6A 1WGXA 3F72A 2NOGA 3MVPA 1X4OA 3CESA 5FLVA 5J3LA 1T95A 3BDDA 3KIOA 4LITA 2K9NA 3PQKA 4PSXA 1HDDC 1ETWA 3KZZA 1XMXA 5BOXA 4HW0A 3MD2A 1RC9A 5E3NA 5HLGA 4CDGA 2P7VB 2QWWA 3MZHA 1UHWA 1J7KA 1TP4A 1IF1A 2CV1A 1IJWC 3GX4X 1G3YA 3BWGA 1GVDA 3BR6A 4WXCA 2M8EA 4LG0B 2CQNA 2V1NA 1XGOA 1QZYA 1SVMA 3CMEI 2EV5A 2JRMA 2LC2A 1RETA 1J0RA 2AHQA 2VKVA 1SEUA 4HA8A 3O8HA 1R49A 2Y2ZA 3O3KA 1OLTA 5DM6F 2YU9J 3CC2I 2OZUA 1LQ1A 2JQ7A 1O3QA 2KPMA 4UY8I 1FOYA 5D5UB 3EUKL 2GIZA 2LK2A 1TWAJ 1V3FA 4A3DJ 4HPQA 1WJAA 2DJNA 4N9IA 2W24A 4KA4A 2GWRA 1G4DA 1R00A 1R5ID 3ABLH 3QWLA 3LQQA 3GWZA 1TWHJ 1UG0A 1H88C 1WQ2A 4XLCA 2DU9A 3CF2A 4MQVA 1IC8A 2DT7B 4HDVA 4F3QA 4AIKA 2A69F 2ESNA 3N05A 3RZDJ 1FNNA 4BNCA 1KQ8A 1SMTA 1WHUA 2DW4A 4LG3A 3SQNA 1I27A 2L54A 4L5EA 2HNHA 3TO7A 5D8KB 2OA4A 5D4RA 3BG3A 3JRGA 4DW6A 1UJ8A 4CCLA 1ZR4A 2QQAA 1W0UA 4ZZLA 3EUHA 2DCEA 3R61A 1T8IA 3A02A 3MZ8A 5BMZA 1RUOA 1I3QJ 3S2DJ 3EYYA 3AG2H 4DOZA 3WODF 2JWTA 3ZR8X 2YS9A 3V8JA 4FCYA 3RPQA 3HRMA 4M6VA 1R36A 3WTSC 3I4MJ 2D2WA 1P7JA 4W1UA 4M6YA 5FFXA 5K7FA 2L4MA 3DPLC 2YSRA 3IAS2 2E71A 3OYJA 2XPVA 1XSVA 5E79C 2IPQX 2QQ8A 1HF0A 1U2WA 4JX5A 3KEOA 4RGXA 3GTGJ 3OSGA 5KK1A 2R7TA 3X2QH 1OKRA 2CGPA 4UVAA 1TWCJ 1LVKA 5A2QZ 3FMQA 2COMA 1AA7A 1SANA 3K0LA 1GLNA 3J7YJ 1LNWA 2VJJA 2VUMJ 1Z91A 5HS9A 3EDPA 4A3BJ 1KU2A 3OIOA 2GOXB 4D5CA 1C0WA 1X3UA 3HM5A 5IT9Z 3L00A 3OL3A 2LREA 2GIVA 1B72A 2E1CA 3FKIJ 3GXOA 3LSHA 5DCMB 3DBHB 1AKHA 5EG0A 3KEQA 2IVMA 4AVZA 2R7FA 2KDZA 3VYUB 1JT0A 2EFOA 2FU4A 3OYLA 2IS1A 4LB5A 4BGDA 4UNOA 2HQRA 2ZMEA 4KN7X 4Y15A 1VQOI 3QPLA 5E8IA 4FTHA 2EA4A 1RKWA 1R5GA 2BBYA 2R7ZJ 2QVOA 1K83J 3GUDA 3LMMA 4PJ0C 3I55I 3E6DA 3TBIA 3C3WA 3K70D 3DQVC 4KITB 1U8RA 3K1NA 3L2CA 2ESHA 2V6CA 1MDMB 4QSHA 1LKXA 1Z3XA 1B4AA 4Q48A 2DT6A 1YIJI 1GXPA 4KN4X 5K5RA 2Y0SN 4BU2A 1GV5A 5F1JA 3PM1A 5FRNA 5FJ8J 3KETA 2HYJA 5H6RA 3LAJA 4HF2A 2DODA 2L9NA 3EUHC 4HF0A 1XB4A 3WE2A 4X0GA 5IYBJ 2E60A 2E35A 1T0FA 2F4MB 3CLOA 4DJAA 1TT5B 4XONA 3S3OA 3JSPA 3P9CA 5M5WJ 3D5LA 2Y0SA 3FM5A 3BZKA 3BCAA 3V7RA 1J2XA 2Q0OA 4H4KC 4CCNA 5FLXZ 1U5TB 3HSEA 2M0CA 2P4WA 3BG5A 4AIDA 4BDYA 4RAGA 2IGOA 5CVVA 4AWXB 3H3UA 1YE9A 2D1VA 3KCCA 4HNTA 2HDWA 2DA7A 1TWGJ 3RTRA 2MLKA 2XB5A 3AG4H 2JTVA 2A6EF 1MMAA 1FWZA 1ON1A 3ZP5A 5M5XJ 2VE8A 4YFKF 3C1DA 3I59A 3RQ4A 4MEXF 3ZQHA 3SHFA 1N78A 3OYCA 1YIOA 2PN6A 4BQAA 2LLKA 3RKWA 1RZ4A 1K78B 4EJVA 4IHVA 1D0ZA 1BI2A 1FY7A 1O3TA 1L3LA 4NQWB 5ERIA 3CDHA 2E1MC 2ZSIB 5J4VA 3K4MA 1W7PD 1R71A 3WTTC 2JK3A 1KU3A 3H3VK 5LGNA 3FXUA 4IOAF 2BVMA 5JI6A 3H92A 1XC5A 2A68F 3PUFA 2YU3A 3TEDA 4OWRB 4I7HA 4C3JJ 3ZGKA 1DP7P 5FGMA 4A3EJ 4Z2YA 2LNBA 4DYCA 4LD5A 2XKPA 4XRSG 4IXAA 2DDAA 2KP6A 2VQLA 4OAYA 1Q1HA 4A3JJ 2HOTA 4M3FA 1NK2P 3BPVA 1FOKA 2FF4A 2L0KA 5J47A 5J1YA 4DYRA 2WC2A 2CH0A 3EETA 4BY7J 3G3ZA 4OIQF 4L5JA 3FXMA 2LF7A 1MIJA 3S1NJ 4B09A 3T8RA 4YIFA 5TJJA 3EUAA 3IUOA 3L2QA 5DTDA 1F4KA 1TW3A 5BPDA 2H1KA 5FKLA 2O6GE 1IO2A 1T0FC 5DM7F 4B3AA 3MEXA 4KMFA 3WGIA 3VB2A 2XGDA 5GPAA 3R60A 1UMQA 3CP8A 2VBXA 2ICWG 5FKNA 2DJIA 4P1WA 1KYWA 1XS9A 1FC3A 1A35A 5H20A 4Y3OA 1LUJB 2YR2A 1HA8A 2DA5A 2V7FA 2W85A 2DT5A 2DOFA 4YG2F 2QM3A 5FKMA 4UB8C 1TLHB 2KZVA 4RB1A 1JKPC 1IN5A 4P9FA 4LG0A 1BW5A 3QPSA 3A1YA 3I3LA 3S1QJ 1V55H 1ETVA 3S1MJ 3HC7A 5FKKA 3Q9VA 1IV6A 1SD5A 2W84A 1APLC 2P6TA 3VDXA 3BTCA 1K6YA 1O3RA 3CLQA 3IV5A 1B1BA 5CLSA 5DEQA 1U9OA 3ECOA 4PJLA 3HOUJ 1ZLJA 1LE8B 1IGNA 3OR1C 3BR3A 4CCKA 3K2AA 5EEGA 3J7ZI 2M5WA 2XAQA 4WF2A 1S7OA 2JA8J 1FLIA 3ABTA 5AIQA 1PVEA 3BY6A 1OCPA 2DO7A 2CQQA 3DEUA 1PUFB 3CMMA 1SVOA 1U3EM 4BE1A 1SFKA 2BGCA 3HRTA 1VQMI 1HW2A 1I5ZA 4BAYA 3G1LA 1DU6A 2GXAA 1RKTA 2HXIA 2JMWA 5E1WA 5JLXA 2HEOA 2CW0F 3GFMA 1O7LA 3ZXSA 3L2RA 1EH7A 2IXSA 3CCVI 4S0HB 2IGMA 3RJPA 3U1DA 3Q3SA 2KIQA 3GF2A 3CCSI 2WWYA 3WE3A 3WU1B 1X58A 4V2GA 3PIPF 1W1WE 4AIJA 2VC0A 4BS9A 5J4YA 2PI0A 2EFWA 4M71A 1VFCA 2NVTJ 3OIPA 2F6CA 1P4XA 3KP2A 3L2UA 2IA0A 2HGCA 3VPRA 5J1RA 1BL0A 3OS0A 2HXOA 4DZPA 1LB2A 2E19A 3S16J 1VTNC 2K9LA 3GTLJ 1TNTA 3HYIA 3KP5A 2V79A 2M34A 4M73A 1IW7F 2KKOA 2EA2A 2VI6A 3J80K 3KE2A 1SAXA 1LEAA 2KZGA 3E3VA 1EA3A 2EZKA 3WGHA 4I6ZA 3H1CA 4BUPA 3JAMK 3V7CA 4N4OB 3T0YA 3R4KA 4K2EA 5HOOA 2E34A 2E5ZA 2PJPA 4LIUA 1UCRA 3OYNA 5DCMA 2M3AA 2L9VA 2Y31A 2XF7A 3F3XA 2LVSA 2O0YA 1YX3A 3GFLA 3BOQA 4YFNF 1WI9A 3CCQI 2MW8A 1FOWA 5E20A 5HNFA 4GRIA 1H0MA 3DFGA 4CHUA 2WY8Q 1ZG5A 4QPQA 3C2HA 2AQFA 2JRTA 2JT1A 4MIMA 5E1ZB 2CO5A 2FJ1A 1OJLA 3FDYA 5HLHA 3RKYA 2P5KA 3SEZA 2VOPA 2L7KA 5DYMA 4RAZA 3JRDA 4FX4A 1IAWA 5EZHA 2Z9OA 4IQJA 1S29A 5IP9J 1ZN2A 3CO6C 2HQNA 2CJJA 3T5XA 1SMYF 2D1HA 5FD5A 4I99C 2WV1A 3H9GA 1BIAA 2AO9A 1GHCA 3D1NI 4LK0F 4RM3A 4JYKA 2CQKA 5EEHA 3RSNA 1HKTA 3NEUA 1T39A 4IF4A 3AL0B 5FFZA 2CS3A 3WTZA 3PNTA 2WAQN 3F22A 3AG1H 3KLOA 2OUMA 3F8MA 2ETHA 3TP3A 3HRUA 1U5TA 2DQLA 3KYCB 3MN2A 2VC1A 5BQTA 1I1SA 1IUFA 2PX9A 3QYFA 4L9NA 4N9HA 1ZREA 4XLHA 2OCCH 4LGWA 2WAQA 4D7MA 3OYBA 2DXIA 2X51A 2DMNA 3IKTA 4ZYDA 2ADUA 2L5QA 3W2VA 3W2AA 3C7JA 2WB1N 2NVYJ 1IN7A 4P96A 1B59A 3CQZJ 4FISA 4A3KJ 1QHHD 2E36A 1VQLI 1WH7A 4KJZA 2VQHA 2KRFA 2OC6A 4L9JA 2P0WA 1Z3YA 2FSWA 1GUUA 2QZ8A 2A3SA 4PGHA 1K78A 3HHHA 3J81Z 4XKWA 1B6AA 1JHHA 4A3LJ 2H6BA 5C4XJ 4ZYHA 1ZGWA 4XMYA 2QUFA 3OWTA 4PFOA 4NQWA 3ZRGA 1Y0UA 2WB1A 1HKSA 4BJ6C 3DEWA 4M9SA 2LY9A 5EZGA 3HL2A 2WAEA 1MKMA 4A0XA 2Y30A 5AIPA 1ERDA 3SEQA 5LEJA 1ZELA 4LB6B 3CUOA 5D5XB 3LSRA 2IA1A 1EV7A 3FXRA 2E1OA 1Z77A 2LKSA 1XMAA 2HKXA 4E7SA 2O7OA 4RBOA 4G9YA 1FTTA 2OPTA 3HGYA 1TNSA 3N4MA 2QQ9A 3F8NA 4FASD 3OYGA 4EQQA 1TZLA 3PO2J 4MTDA 3DLAA 1BI3A 3E97A 2RVCA 5HDKA 1FEXA 3CJTB 4N4NB 3DV8A 3KZIC 2JN6A 2W48A 2ELJA 3GTOJ 5CVUA 2STTA 4XRMA 4RM2A 4F91B 2PMHA 4B3XA 2QA4I 2VJIA 2HZTA 2IA2A 1V5GA 4RLQA 5F64A 3B73A 2OAZA 5IP6A 1BJZA 3CDLA 3I64A 2H27A 2NS7A 1DPUA 3OR2C 3PFIA 1QO0D 4D9JA 3K1MA 4JBAA 2HQAA 2HS5A 1ETOA 2UXXA 2G0EA 4MFEA 1U5TC 3JTGA 2JSPA 1S7EA 1USSA 1MGTA 3NRVA 1P2FA 4Y17A 5F1RA 1UHMA 3LSMA 2NVXJ 3HOZJ 2N8GA 2VT2A 3BT9A 1R23A 2ZNYA 3ULQB 5KAFC 3IP4B 5DV5A 3WTVC 4U7DA 4RS8A 2LDUA 1AU7A 4NHJA 2FE3A 4YIRX 2CUFA 3LSIA 2F5FA 4HBLA 3OOPA 4KIGA 4IO9F 5HODA 3IKVA 2LY2A 3C18A 1AHDP 2E5NA 2O9LA 4KYWA 3GLXA 2XRNA 1Z67A 5E3OA 2CFXA 3W6VA 1YS6A 1XSDA 1T98A 3H3ZA 4HLXA 4HX4A 2BHZA 5DUKA 4DGWB 3LNQA 2VLAA 4LLNA 1EF4A 1BR4A 4AM3A 4C2MJ 3FHNA 4AVPA 1Y1WJ 4A6DA 4XN3A 1BI1A 1LFPA 3COAC 1DGRM 4Q47A 2R7XA 4D7NA 1K4TA 1LE8A 4F7ZA 5CPRB 1Z1DA 3NAUA 3HRSA 3PUBA 3RYPA 2M0MA 1GV2A 1XD7A 1PJRA 4NDLA 3HJEA 4XLAA 2DPDA 4RAYA 1UHSA 1PUFA 4F93B 5L3GA 3SDGA 1G2HA 1VNDA 2XAJA 3PNVA 3I54A 2FD5A 1W5CC 4E70A 4HNVA 4RLFA 5J40A 3FZVA 5HDNA 3BC8A 4R8HA 4EVIA 1E0EA 2ECCA 3ECHA 1V5EA 2V1UA 1JE8A 2AXTC 3H0GJ 2V9PA 3FBNB 4ZDOA 2M7BA 2ZXIA 1XCBA 3FHZA 1P92A 3JSOA 2W7NA 3BR2A 2HVRA 3DWLE 3GFIA 2VBYA 4P5OA 3Q9SA 3AAFA 1Z9CA 3BTJA 3D0SA 4KUMA 2Y75A 1W36C 2HPIA 2ZSHB 2OV7A 3K9TA 2DFEA 2NS0A 3M8EA 4XQFA 4PDKA 5A2QK 5GP9A 5EEAA 1QU3A 2GXGA 2LRDA 3BLYA 4HDUA 2TCTA 2ZXHA 5F04A 2HVQA 5F0CA 3WHCA 2X6OA 4II2A 4DZJA 1J75A 3OYMA 1P4WA 2BXYA 2JSCA 2M1BA 5IT9K 3ABUA 1QA6A 2HOAA 5E3LA 3TDZC 5AONA 3OS1A 5B1AH 1W0TA 5IPAA 2DYSH 1A5JA 3OL4A 1J59A 4BACA 1ENHA 3IWZA 3H5AA 5FROA 2R7WA 4D1QA 1YS7A 2R7VA 1BI0A 2EPFA 3BQYA 1R9TJ 2MC4A 5JHFA 3H9QA 2F5DA 2EWNA 2I10A 2KRHA 4HX7A 2KLOA 1UZCA 2M7AA 3ZQIA 4I0BA 2XF5A 2ZC2A 1F1ZA 4AIHA 4L9VA 3HSRA 1T08B 1XSXA 2XAGA 3KYDB 4GFBA 1MMSA 1QBJA 2B7EA 4M3BA 5ICFA 2NNNA 4WWCA 4E6KG 5LLQA 3RKQA 5L3EA 3GCMA 3TO6A 5DS9A 2XV4S 4B1RA 2XDVA 1I39A 3DCFA 1FJLA 4IQ4A 2HKOA 3BTLA 3HUGB 4R79A 4HOBA 4MLOA 3QRFF 1S8NA 3G2BA 2L7ZA 2V26A 1VF9A 3QPHA 2ACJA 1YFHA 4ZTFA 2QSHX 5TGTA 1XG1A 1XTAA 2DA2A 4CYCA 2IRFG 1QVUA 3HIFA 1FBUA 4PFPA 3RZOJ 1RR7A 2L7MP 4L18B 2P6SA 1XPXA 2CU7A 2G7UA 3VYSB 3ZQFA 4U0YA 2BY1A 1IRZA 1MBFA 2CMPA 5TRDA 2FEZA 1VQ4I 1G3SA 4FE7A 3DPTA 5EYRA 3CCYA 4X1EA 4BHCA 3J7AO 1RR8C 5FLXK 3IC7A 3OS2A 2FNAA 3GMEA 4O3MA 2FBHA 3TDUC 1FP1D 3MKYB 4UB6C 1IXSB 2HQ5A 3FBIB 1WWXA 4UV9A 3F9KA 3A0HC 4G6QA 1X4PA 3CC4I 1NTCA 2B63J 2DK8A 5D6FA 2IGNA 3BQZA 3FXLA 4GYIA 1JXSA 2XSJC 1DDNA 1IN4A 2ZB9A 3ZMZA 2EZHA 2XASA 4BEHB 5L3DA 1IN8A 2KISA 4E7KA 1S3JA 2ZNZA 4GGGA 3U9GA 4XBFA 2AS5F 3BROA 2PG4A 4UUSB 4RB2C 2W4SA 4U7BA 1ZK8A 2RAEA 4BJTA 2DI3A
chains in the Genus database with same CATH topology
2G7HA 2KJCA 1QQIA 4TV7A 1TW2A 1ZHFA 2Z33A 2CYYA 3WTYC 3IWFA 2RDPA 1TBXA 1U6GA 2HTJA 4IVNA 4MTEA 4O5VA 3M1EA 2O03A 2G9WA 6PAXA 3HOTA 5CVRA 4ZH4F 5ICEA 1W5SA 4A5MA 5LGUA 3L9FA 2RC4A 4OIOF 5E17F 3CUQB 5E8GA 4A6EA 1MJAA 4AD9A 3E6CC 2OZ6A 3E5UA 2A07F 4ZZDA 4IJAA 1R1UA 2E7XA 3E5QA 1KA8A 1FSEA 4KIBA 3ZQ7A 1FPQA 1GXQA 2FXAA 2RNJA 5ICCA 2RV8A 3VFZA 3ELKA 4S04A 4HV6A 2EFNA 2HYGD 1U78A 5D6EA 4L5IA 4Q5SF 1IRGA 3RKXA 2MD5A 1BN5A 1T2KA 3Q5FA 4GCVA 4UVCA 2L4AA 1ZAOA 4HQEA 2ZJ2A 3EQLF 2TDXA 2AXLA 1F9NA 3CTAA 2J5OA 1BIBA 1KGSA 2K7LA 2CWEA 4M72A 4WK8F 1B9MA 3B02A 3LA3A 2GAUA 1XN7A 2LSOA 4KNYA 2OQRA 1BJAA 4ETSA 2V1XA 1G6NA 2IP2A 3CJNA 3E6MA 4EV0A 5DD8A 1R58A 1W4MA 4G7ZF 4HX8A 2B0LA 2KIUA 3SFZA 4B8XA 3GFJA 4OMYA 3HTUA 3L09A 5LRSA 5K5OA 5LEKA 1ZYRF 4EM0B 1D3YA 2VE9A 4HZFA 1O3SA 1MJBA 1R5HA 3BPXA 2RQPA 2HWVA 3MWMA 1YYVA 5ILUA 1YO5C 4A0YA 5DUIA 3R0JA 2MLGA 1HBXG 5JFRA 4ENNA 1BC8C 3MAJA 4P9UA 2RN7A 4M74A 4N0BA 3FF5A 4RB3C 1UFMA 3RYRA 1H9GA 5CVJA 3DF8A 4YIIA 2HFHA 3HUGA 3M9AA 2YPRA 4CGZA 4R1HA 1QZZA 3F23A 2QBYB 2A61A 2W57A 2EFQA 2H94A 2VBZA 2ZCWA 4RGRA 1DPRA 3V7SA 4LK1F 5LRRA 3P9IA 3IL2A 2JZYA 1IUYA 5E1XA 3HTSB 2UXNA 5BS6A 3BZ6A 5IT3A 4M9ZA 2P5VA 3R6SA 3F6OA 3SZPA 3GO5A 1MDMA 5HS8A 4LFUA 2O3FA 2YX7A 1HQCA 1T38A 1ZH5A 5CVIA 4EM2A 4EGZA 4EM1A 3J81K 3KP6A 2UZKA 1H9TA 1KU9A 3KP7A 1TTYA 2VONA 5F6FA 1BBYA 4ZYEA 2K4BA 4ESJA 2STWA 2Q8KA 2C6YA 2ZMEB 2K4JA 1K7AA 2FQ3A 1HKQA 3R0AA 4A12A 1SFEA 2NRAC 3JW4A 4MNUA 1HSJA 1PP8F 2V1DA 4G7OF 2FBKA 2LF8A 3GVAA 3LQRA 1SD6A 4XLNF 5DCFA 5LGTA 1FYLA 3TO9A 1JHFA 1FYMA 3T8TA 4XSXF 1ZRDA 4UHTA 1NHAA 4OU0A 1I6XA 2YX4A 4L9TA 3ZMVA 4S05A 4PZJA 4BHPA 4PCQA 3TOAA 1ZGJA 1LEBA 4U88A 3LA2A 5HDGA 4IPAA 1FYKA 1YW7A 5ED4A 4BHBA 5CYVA 3FXQA 3QPTA 2XGXA 3F21A 1R22A 1UB9A 4D0PA 4EJWA 3QU6A 3VEPA 1DUXC 4A5NA 3TOBA 4G6DA 4I09A 2VBWA 5J8FA 2R3SA 2VXZA 2EB7A 4CZZA 2OD5A 1CGPA 2XAFA 4IRHA 3I4PA 3KP3A 4XSZF 3KZYA 4ASNA 2XAHA 1OYWA 4CXFA 1ZRFA 3HSFA 2O61A 3ML6A 3TKYA 2QYOA 4CICA 3GZ6A 3GW2A 4EJUA 1KU7A 2A6HF 2JPCA 4LJZF 2K27A 3CUQC 5L3FA 3MQ0A 1KQ0A 1G3WA 4KDPA 5FD6A 2GA1A 2PQ8A 3HOSA 5DDGA 3O6BB 1PP7U 1T6SA 2RGVA 5D5WB 2BV6A 5K5QA 3LA7A 4LLLA 3G73A 4WXDA 1QGPA 1OMIA 3M7GA 2O8XA 2F5EA 2EV0A 3GYHX 2FBIA 2E1NA 2Z5UA 3SXYA 2EJRA 4UUVA 2IW5A 5CJ9A 4OMZA 4QLCU 2JPBA 1ZG1A 3KP4A 2MH9A 3OV8A 4JQFA 5HLIA 4ENKA 3CO7C 1EH8A 2NNYA 2H6CA 5ILSA 5FB2A 5J6XA 4OIRF 3FMSA 5JR3A 4MQ9F 4OIPF 1IZ1A 4KICA 1Z05A 3F8CA 1TQIA 4ENMA 2QBYA 3REOA 3LFKA 3ZN1A 2RKHA 1FBSA 1HW5A 3LAPA 1IXCA 3T1BA 1LJ9A 1WKMA 1MZBA 5D8LB 4FX0A 2PBIA 1L0OC 4BH9A 1FP2A 4HLYA 2P5LC 3ERED 3RPUA 5E18F 1K79A 4U0WA 5ILVA 3HHGA 3BJAA 3I5UA 4EJOA 3QP6A 3WTWC 3IRQA 1D8JA 5JHUA 1HW1A 3FM3A 2ZBKA 3O2PE 3P7NA 1R1TA 1SFXA 4OINF 3QOPA 3F8FA 4EMSA 2FMYA 2GXBA 1WSUA 2L01A 3K1PA 1PUEE 1HSTA 2GA2A 4MGRA 2GQQA 4P55A 4HF1A 1FSHA 1W5TA 2Z99A 1D5VA 2BYVE 4GYGA 4I0AA 4HYEA 5L3BA 4RGUA 4WX9A 2QENA 2FA5A 4KMUX 4U0VA 2HYFA 4L0ZB 4I2OA 2XUBA 1R1VA 3ZMSA 1G3TA 2HDCA 4PGGA 4DQ2A 5LBQA 3QAHA 4FT8A 2P7CB 1LDJA 2MH2A 1WRJA 3M8FA 1USTA 2FMLA 3S2WA 4UXNA 1FX7A 3MFKA 1OYIA 3WTUC 3MZYA 1CF7B 4A2UA 2L3DA 1F5TA 2OQGA 1IRFA 3F6VA 1LDDA 2WTEA 3V4GA 1I1GA 4RGSA 2PFBA 4Y13A 1QPMA 2DBBA 2FNPA 4GXOA 3V8LA 1FBQA 5K1YA 1V4RA 1HXDA 1MJ9A 4O6JA 1ZGAA 3I58A 3FMRA 3QP5A 3FX3A 2D45A 4WXHA 3DXJF 2P8TA 2Q2EA 4G7HF 4OOIA 1YW8A 2ZXJA 4A0ZA 2VOOA 4BYYA 2CSOA 4G8XA 1YTYA 1KYZA 2ELHA 1SD4A 4CYDA 2VT3A 4XLPF 3V8KA 1ZARA 5HS7A 2MC3A 4NB5A 2W25A 3E6BA 3NQOA 1JGSA 1STZA 2PLYA 2M87A 2PEXA 4DNCA 3N97A 1S7AA 4I98B 1AWCA 1REPC 1ZG3A 3I53A 2K02A 4RB0A 1O57A 3I71A 4YFXF 1Z7UA 2XVCA 2QQBA 1OPCA 4G94A 2J5PA 2MA3A 3F8BA 3ZPLA 2WV0A 2F5CA 1W7PB 1LDKB 2FRHA 3IRRA 1Z6TA 2UWMA 2HR3A 1OR7A 2BE5F 2NAZA 1FZPB 4JK1X 4HV5A 2Y48A 3TQNA 2MBFA 1AOYA 3KLNA 3DKWA 4Q4ZF 3I0TA 1RNLA 5FO5A 4M9XA 5H6QA 4XRFA 2VODA 3TGNA 3LSTA 4IHTA 1RUNA 1D8KA 1XMKA 3EYIA 4KFCA 1E17A 1R7JA 4ESBA 1J9IA 3K2ZA 2DPUA 2HOEA 2L02A 2IT0A 3P9KA 2CG4A 1S6LA 1XDSA 1IXRC 2E7WA 1KQ9A 2X4HA 5HVQC 3W6JB 1ON2A 1OYYA 2F2EA 1ZRCA 2HTSA 1EH6A 2LKPA 5J8CA 3GZ5A 2XIGA 4IRGA 4ON0A 4MHGA 1TQMA 2DLLA 3VOEA 3LWFA 5D5VB 2DAOA 4I01A 2DFIA 1BOAA 3VODA 4H0EA 1TQPA 2XROA 3PQJA 4UVBA 1J5YA 2XKOA 3GEZA 1BM9A 4L0YB 1XGSA 1B9NA 2M45A 4QWQA 5KVRA 3ZMUA 3W6KB 2OBPA 1GVJA 1ODDA 1MD0A 2EV6A 3J80Z 3BP8A 1PDNC 2EK5A 2Y0MA 2DQRA 4HAMA 4UV8A 3JAMZ 1E2XA 2R7DA 1YLFA 5DD4A 3U2RA 2ZKZA 3RI4A 3K69A 2DK5A 5JVTA 4GO1A 4EGYA 4KT5C 3BJOA 1ONVA 5L3CA 2PMUA 5BPIA 5LHHA 1P4AA 1Z6RA 1CF7A 3E5XA 2ZO4A 2ISYA 3MCZA 2Z3YA 1YG2A 3JTHA 3CUQA 1QNTA 1XDUA 4IRIA 2H09A 2NYXA 1SD7A 3WGGA 3SZTA 1FT9A 1P6RA 3IHUA 1ULYA 4HQMA 4LMYA 5D4SA 4BXUA 4EJTA 1XGNA 2FOKA 4CO8A 4FHTA 2KIMA 3WTXC 1YW9A 2EFPA 5ICGA 3L7WA 1YQAA 3I59B 1LVAA 4M6XA 1K6OA 2DTRA 5LHIA 2OU2A 3ZMDA 2BEOA 4LLGF 3ISPA 3DP7A 3FWEA 3RDIA 4ZYGA 3WU0A 2GZWA 2A5YB 1XCVA 1RI7A 1XGMA 1IN6A 2ISZA 2V9VA 1ZLKA 5LHGA 2K86A 1O7FA 4KIFA 3ZMTA 2KIFA 3QU3A 1W7PA 2KJBA 4I02A 1BC7C 3ZN0A 2ZFWA 2X0LA 4ESFA 4IHSA 2M30A 2VN2A 3BJ6A 1SFUA 1A04A 3KFWX 3ROUA 2QLZA 3WG9A 4ENJA 2IJLA 1RIOH 2XHKA 3RIRA 4WCGA 4MEYF 3F72A 3BDDA 3PQKA 3KZZA 5BOXA 4HW0A 5HLGA 4CDGA 2P7VB 2QWWA 3MZHA 1UHWA 1J7KA 1IF1A 3GX4X 1G3YA 3BWGA 4WXCA 2M8EA 4LG0B 1XGOA 1QZYA 2EV5A 1J0RA 4HA8A 3O3KA 2OZUA 1LQ1A 1O3QA 5D5UB 1V3FA 4N9IA 2W24A 4KA4A 2GWRA 1G4DA 1R00A 3LQQA 3GWZA 1WQ2A 2DU9A 4MQVA 4HDVA 4AIKA 2A69F 2ESNA 1FNNA 4BNCA 1KQ8A 1SMTA 3SQNA 2DW4A 1I27A 2L54A 3TO7A 5D8KB 2OA4A 5D4RA 2QQAA 4ZZLA 3EUHA 3R61A 5BMZA 1RUOA 3EYYA 3WODF 3V8JA 3RPQA 3HRMA 1R36A 3WTSC 2D2WA 4M6YA 5FFXA 2L4MA 3DPLC 2YSRA 1XSVA 2IPQX 1U2WA 3KEOA 4RGXA 5KK1A 1OKRA 2CGPA 4UVAA 5A2QZ 3FMQA 2COMA 3K0LA 1LNWA 1Z91A 5HS9A 3EDPA 1KU2A 1C0WA 1X3UA 5IT9Z 3L00A 2E1CA 2GIVA 3GXOA 5DCMB 3KEQA 2IVMA 2R7FA 2EFOA 2FU4A 4LB5A 4UNOA 2HQRA 2ZMEA 4KN7X 4Y15A 5E8IA 2EA4A 1R5GA 2BBYA 2QVOA 3GUDA 3E6DA 3C3WA 3DQVC 1U8RA 3K1NA 3L2CA 2ESHA 2V6CA 1MDMB 4Q48A 1B4AA 1GXPA 4KN4X 5K5RA 3KETA 5H6RA 3LAJA 4HF2A 4HF0A 1XB4A 3WE2A 1T0FA 3CLOA 3JSPA 3P9CA 3D5LA 3FM5A 3V7RA 1J2XA 2Q0OA 5FLXZ 1U5TB 3HSEA 2P4WA 5CVVA 4AWXB 3H3UA 2D1VA 3KCCA 3RTRA 2MLKA 2JTVA 2A6EF 1FWZA 1ON1A 3ZP5A 2VE8A 4YFKF 3C1DA 3I59A 4MEXF 3SHFA 1YIOA 2PN6A 4BQAA 3RKWA 1RZ4A 1K78B 4EJVA 1BI2A 1FY7A 1O3TA 1L3LA 5ERIA 3CDHA 1W7PD 3WTTC 1KU3A 5LGNA 3FXUA 5JI6A 3H92A 2A68F 2YU3A 4I7HA 1DP7P 5FGMA 4Z2YA 2LNBA 4LD5A 2XKPA 4IXAA 1Q1HA 3BPVA 1FOKA 2FF4A 2WC2A 3EETA 3G3ZA 4OIQF 4L5JA 2LF7A 4B09A 3T8RA 4YIFA 5TJJA 2O6GE 1F4KA 1TW3A 5BPDA 4KMFA 3MEXA 3WGIA 3VB2A 3R60A 2VBXA 1KYWA 1FC3A 5H20A 2YR2A 2W85A 2DT5A 4YG2F 2QM3A 1TLHB 4RB1A 1IN5A 4P9FA 4LG0A 3Q9VA 1SD5A 2W84A 2P6TA 1O3RA 1B1BA 5CLSA 5DEQA 3ECOA 1ZLJA 5EEGA 2M5WA 2XAQA 4WF2A 1S7OA 1FLIA 3ABTA 5AIQA 3BY6A 2DO7A 3DEUA 1U3EM 2BGCA 3HRTA 1HW2A 1I5ZA 4BAYA 5E1WA 2HEOA 2CW0F 3GFMA 1O7LA 1EH7A 3RJPA 3U1DA 3GF2A 2WWYA 3WE3A 3WU1B 4AIJA 2VC0A 2PI0A 2EFWA 4M71A 1P4XA 3KP2A 2IA0A 2HGCA 1LB2A 1VTNC 1TNTA 3HYIA 3KP5A 2V79A 4M73A 1IW7F 2KKOA 2EA2A 3J80K 3KE2A 1SAXA 1LEAA 3E3VA 3WGHA 3JAMK 3V7CA 3T0YA 3R4KA 4K2EA 5HOOA 2PJPA 1UCRA 5DCMA 3F3XA 2O0YA 3GFLA 3BOQA 4YFNF 1WI9A 5E20A 1H0MA 3DFGA 4CHUA 1ZG5A 2JRTA 2JT1A 5E1ZB 2CO5A 5HLHA 3RKYA 2P5KA 2VOPA 5DYMA 4RAZA 4FX4A 1IAWA 2Z9OA 1S29A 1ZN2A 3CO6C 2HQNA 3T5XA 1SMYF 2D1HA 5FD5A 1BIAA 1GHCA 4LK0F 2CQKA 5EEHA 1HKTA 3NEUA 1T39A 4IF4A 5FFZA 3WTZA 3F22A 3KLOA 3F8MA 2ETHA 3HRUA 1U5TA 2DQLA 2VC1A 5BQTA 1I1SA 1ZREA 4L9NA 4N9HA 4LGWA 3IKTA 4ZYDA 2ADUA 3C7JA 1IN7A 4P96A 1B59A 2KRFA 4L9JA 2FSWA 4PGHA 2QZ8A 2A3SA 1K78A 3HHHA 3J81Z 1B6AA 1JHHA 2H6BA 4ZYHA 2QUFA 4NQWA 1Y0UA 1HKSA 4M9SA 4A0XA 1MKMA 5AIPA 5LEJA 4LB6B 3CUOA 5D5XB 2IA1A 1EV7A 3FXRA 1XMAA 2HKXA 4G9YA 1TNSA 3N4MA 2QQ9A 3F8NA 4EQQA 4MTDA 1BI3A 3E97A 2RVCA 5HDKA 3DV8A 5CVUA 2STTA 2PMHA 2HZTA 2IA2A 5F64A 3B73A 2OAZA 3I64A 2H27A 1DPUA 3PFIA 1QO0D 3K1MA 4JBAA 2HS5A 2UXXA 1U5TC 3JTGA 1USSA 1MGTA 4Y17A 1P2FA 3NRVA 5F1RA 1UHMA 2VT2A 1R23A 2ZNYA 3ULQB 5DV5A 3WTVC 4U7DA 4RS8A 2LDUA 4NHJA 2FE3A 2F5FA 4HBLA 3OOPA 4KIGA 3IKVA 3C18A 4KYWA 3GLXA 2XRNA 2CFXA 1YS6A 1XSDA 1T98A 3H3ZA 4HLXA 4HX4A 5DUKA 4LLNA 4AVPA 4A6DA 1BI1A 3COAC 4Q47A 4F7ZA 1Z1DA 3HRSA 3RYPA 1XD7A 2DPDA 4RAYA 5L3GA 2XAJA 3I54A 4E70A 3FZVA 5HDNA 4R8HA 4EVIA 3ECHA 2V1UA 1JE8A 1XCBA 3FHZA 1P92A 3JSOA 3GFIA 2VBYA 4P5OA 3Q9SA 3AAFA 1Z9CA 3D0SA 4KUMA 2Y75A 5A2QK 3K9TA 3M8EA 2NS0A 4PDKA 2GXGA 4HDUA 1J75A 1P4WA 2JSCA 2M1BA 5IT9K 3ABUA 3TDZC 5AONA 1J59A 3IWZA 1YS7A 1BI0A 2F5DA 2EWNA 4HX7A 4I0BA 1F1ZA 4AIHA 4L9VA 3HSRA 1XSXA 2XAGA 1QBJA 5ICFA 2NNNA 4WWCA 5LLQA 5L3EA 3TO6A 2XV4S 2HKOA 4R79A 4HOBA 3QRFF 1S8NA 2ACJA 3QPHA 1YFHA 2IRFG 3HIFA 1FBUA 4L18B 2P6SA 2G7UA 4U0YA 5TRDA 2FEZA 1G3SA 3DPTA 4BHCA 3J7AO 5FLXK 3IC7A 2FNAA 4O3MA 2FBHA 3TDUC 1FP1D 1IXSB 1WWXA 4UV9A 4G6QA 2DK8A 5D6FA 4GYIA 1JXSA 1DDNA 1IN4A 3ZMZA 2XASA 5L3DA 1IN8A 1S3JA 2ZNZA 4GGGA 3U9GA 4XBFA 2AS5F 3BROA 2PG4A 4RB2C 4U7BA 2DI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G7H A;  2KJC A;  1QQI A;  4TV7 A;  1TW2 A;  1ZHF A;  2Z33 A;  2CYY A;  3WTY C;  3IWF A;  2RDP A;  1TBX A;  1U6G A;  2HTJ A;  4IVN A;  4MTE A;  4O5V A;  3M1E A;  2O03 A;  2G9W A;  6PAX A;  3HOT A;  5CVR A;  4ZH4 F;  5ICE A;  1W5S A;  4A5M A;  5LGU A;  3L9F A;  2RC4 A;  4OIO F;  5E17 F;  3CUQ B;  5E8G A;  4A6E A;  1MJA A;  4AD9 A;  3E6C C;  2OZ6 A;  3E5U A;  2A07 F;  4ZZD A;  4IJA A;  1R1U A;  2E7X A;  3E5Q A;  1KA8 A;  1FSE A;  4KIB A;  3ZQ7 A;  1FPQ A;  1GXQ A;  2FXA A;  2RNJ A;  5ICC A;  2RV8 A;  3VFZ A;  3ELK A;  4S04 A;  4HV6 A;  2EFN A;  2HYG D;  1U78 A;  5D6E A;  4L5I A;  4Q5S F;  1IRG A;  3RKX A;  2MD5 A;  1BN5 A;  1T2K A;  3Q5F A;  4GCV A;  4UVC A;  2L4A A;  1ZAO A;  4HQE A;  2ZJ2 A;  3EQL F;  2TDX A;  2AXL A;  1F9N A;  3CTA A;  2J5O A;  1BIB A;  1KGS A;  2K7L A;  2CWE A;  4M72 A;  4WK8 F;  1B9M A;  3B02 A;  3LA3 A;  2GAU A;  1XN7 A;  2LSO A;  4KNY A;  2OQR A;  1BJA A;  4ETS A;  2V1X A;  1G6N A;  2IP2 A;  3CJN A;  3E6M A;  4EV0 A;  5DD8 A;  1R58 A;  1W4M A;  4G7Z F;  4HX8 A;  2B0L A;  2KIU A;  3SFZ A;  4B8X A;  3GFJ A;  4OMY A;  3HTU A;  3L09 A;  5LRS A;  5K5O A;  5LEK A;  1ZYR F;  4EM0 B;  1D3Y A;  2VE9 A;  4HZF A;  1O3S A;  1MJB A;  1R5H A;  3BPX A;  2RQP A;  2HWV A;  3MWM A;  1YYV A;  5ILU A;  1YO5 C;  4A0Y A;  5DUI A;  3R0J A;  2MLG A;  1HBX G;  5JFR A;  4ENN A;  1BC8 C;  3MAJ A;  4P9U A;  2RN7 A;  4M74 A;  4N0B A;  3FF5 A;  4RB3 C;  1UFM A;  3RYR A;  1H9G A;  5CVJ A;  3DF8 A;  4YII A;  2HFH A;  3HUG A;  3M9A A;  2YPR A;  4CGZ A;  4R1H A;  1QZZ A;  3F23 A;  2QBY B;  2A61 A;  2W57 A;  2EFQ A;  2H94 A;  2VBZ A;  2ZCW A;  4RGR A;  1DPR A;  3V7S A;  4LK1 F;  5LRR A;  3P9I A;  3IL2 A;  2JZY A;  1IUY A;  5E1X A;  3HTS B;  2UXN A;  5BS6 A;  3BZ6 A;  5IT3 A;  4M9Z A;  2P5V A;  3R6S A;  3F6O A;  3SZP A;  3GO5 A;  1MDM A;  5HS8 A;  4LFU A;  2O3F A;  2YX7 A;  1HQC A;  1T38 A;  1ZH5 A;  5CVI A;  4EM2 A;  4EGZ A;  4EM1 A;  3J81 K;  3KP6 A;  2UZK A;  1H9T A;  1KU9 A;  3KP7 A;  1TTY A;  2VON A;  5F6F A;  1BBY A;  4ZYE A;  2K4B A;  4ESJ A;  2STW A;  2Q8K A;  2C6Y A;  2ZME B;  2K4J A;  1K7A A;  2FQ3 A;  1HKQ A;  3R0A A;  4A12 A;  1SFE A;  2NRA C;  3JW4 A;  4MNU A;  1HSJ A;  1PP8 F;  2V1D A;  4G7O F;  2FBK A;  2LF8 A;  3GVA A;  3LQR A;  1SD6 A;  4XLN F;  5DCF A;  5LGT A;  1FYL A;  3TO9 A;  1JHF A;  1FYM A;  3T8T A;  4XSX F;  1ZRD A;  4UHT A;  1NHA A;  4OU0 A;  1I6X A;  2YX4 A;  4L9T A;  3ZMV A;  4S05 A;  4PZJ A;  4BHP A;  4PCQ A;  3TOA A;  1ZGJ A;  1LEB A;  4U88 A;  3LA2 A;  5HDG A;  4IPA A;  1FYK A;  1YW7 A;  5ED4 A;  4BHB A;  5CYV A;  3FXQ A;  3QPT A;  2XGX A;  3F21 A;  1R22 A;  1UB9 A;  4D0P A;  4EJW A;  3QU6 A;  3VEP A;  1DUX C;  4A5N A;  3TOB A;  4G6D A;  4I09 A;  2VBW A;  5J8F A;  2R3S A;  2VXZ A;  2EB7 A;  4CZZ A;  2OD5 A;  1CGP A;  2XAF A;  4IRH A;  3I4P A;  3KP3 A;  4XSZ F;  3KZY A;  4ASN A;  2XAH A;  1OYW A;  4CXF A;  1ZRF A;  3HSF A;  2O61 A;  3ML6 A;  3TKY A;  2QYO A;  4CIC A;  3GZ6 A;  3GW2 A;  4EJU A;  1KU7 A;  2A6H F;  2JPC A;  4LJZ F;  2K27 A;  3CUQ C;  5L3F A;  3MQ0 A;  1KQ0 A;  1G3W A;  4KDP A;  5FD6 A;  2GA1 A;  2PQ8 A;  3HOS A;  5DDG A;  3O6B B;  1PP7 U;  1T6S A;  2RGV A;  5D5W B;  2BV6 A;  5K5Q A;  3LA7 A;  4LLL A;  3G73 A;  4WXD A;  1QGP A;  1OMI A;  3M7G A;  2O8X A;  2F5E A;  2EV0 A;  3GYH X;  2FBI A;  2E1N A;  2Z5U A;  3SXY A;  2EJR A;  4UUV A;  2IW5 A;  5CJ9 A;  4OMZ A;  4QLC U;  2JPB A;  1ZG1 A;  3KP4 A;  2MH9 A;  3OV8 A;  4JQF A;  5HLI A;  4ENK A;  3CO7 C;  1EH8 A;  2NNY A;  2H6C A;  5ILS A;  5FB2 A;  5J6X A;  4OIR F;  3FMS A;  5JR3 A;  4MQ9 F;  4OIP F;  1IZ1 A;  4KIC A;  1Z05 A;  3F8C A;  1TQI A;  4ENM A;  2QBY A;  3REO A;  3LFK A;  3ZN1 A;  2RKH A;  1FBS A;  1HW5 A;  3LAP A;  1IXC A;  3T1B A;  1LJ9 A;  1WKM A;  1MZB A;  5D8L B;  4FX0 A;  2PBI A;  1L0O C;  4BH9 A;  1FP2 A;  4HLY A;  2P5L C;  3ERE D;  3RPU A;  5E18 F;  1K79 A;  4U0W A;  5ILV A;  3HHG A;  3BJA A;  3I5U A;  4EJO A;  3QP6 A;  3WTW C;  3IRQ A;  1D8J A;  5JHU A;  1HW1 A;  3FM3 A;  2ZBK A;  3O2P E;  3P7N A;  1R1T A;  1SFX A;  4OIN F;  3QOP A;  3F8F A;  4EMS A;  2FMY A;  2GXB A;  1WSU A;  2L01 A;  3K1P A;  1PUE E;  1HST A;  2GA2 A;  4MGR A;  2GQQ A;  4P55 A;  4HF1 A;  1FSH A;  1W5T A;  2Z99 A;  1D5V A;  2BYV E;  4GYG A;  4I0A A;  4HYE A;  5L3B A;  4RGU A;  4WX9 A;  2QEN A;  2FA5 A;  4KMU X;  4U0V A;  2HYF A;  4L0Z B;  4I2O A;  2XUB A;  1R1V A;  3ZMS A;  1G3T A;  2HDC A;  4PGG A;  4DQ2 A;  5LBQ A;  3QAH A;  4FT8 A;  2P7C B;  1LDJ A;  2MH2 A;  1WRJ A;  3M8F A;  1UST A;  2FML A;  3S2W A;  4UXN A;  1FX7 A;  3MFK A;  1OYI A;  3WTU C;  3MZY A;  1CF7 B;  4A2U A;  2L3D A;  1F5T A;  2OQG A;  1IRF A;  3F6V A;  1LDD A;  2WTE A;  3V4G A;  1I1G A;  4RGS A;  2PFB A;  4Y13 A;  1QPM A;  2DBB A;  2FNP A;  4GXO A;  3V8L A;  1FBQ A;  5K1Y A;  1V4R A;  1HXD A;  1MJ9 A;  4O6J A;  1ZGA A;  3I58 A;  3FMR A;  3QP5 A;  3FX3 A;  2D45 A;  4WXH A;  3DXJ F;  2P8T A;  2Q2E A;  4G7H F;  4OOI A;  1YW8 A;  2ZXJ A;  4A0Z A;  2VOO A;  4BYY A;  2CSO A;  4G8X A;  1YTY A;  1KYZ A;  2ELH A;  1SD4 A;  4CYD A;  2VT3 A;  4XLP F;  3V8K A;  1ZAR A;  5HS7 A;  2MC3 A;  4NB5 A;  2W25 A;  3E6B A;  3NQO A;  1JGS A;  1STZ A;  2PLY A;  2M87 A;  2PEX A;  4DNC A;  3N97 A;  1S7A A;  4I98 B;  1AWC A;  1REP C;  1ZG3 A;  3I53 A;  2K02 A;  4RB0 A;  1O57 A;  3I71 A;  4YFX F;  1Z7U A;  2XVC A;  2QQB A;  1OPC A;  4G94 A;  2J5P A;  2MA3 A;  3F8B A;  3ZPL A;  2WV0 A;  2F5C A;  1W7P B;  1LDK B;  2FRH A;  3IRR A;  1Z6T A;  2UWM A;  2HR3 A;  1OR7 A;  2BE5 F;  2NAZ A;  1FZP B;  4JK1 X;  4HV5 A;  2Y48 A;  3TQN A;  2MBF A;  1AOY A;  3KLN A;  3DKW A;  4Q4Z F;  3I0T A;  1RNL A;  5FO5 A;  4M9X A;  5H6Q A;  4XRF A;  2VOD A;  3TGN A;  3LST A;  4IHT A;  1RUN A;  1D8K A;  1XMK A;  3EYI A;  4KFC A;  1E17 A;  1R7J A;  4ESB A;  1J9I A;  3K2Z A;  2DPU A;  2HOE A;  2L02 A;  2IT0 A;  3P9K A;  2CG4 A;  1S6L A;  1XDS A;  1IXR C;  2E7W A;  1KQ9 A;  2X4H A;  5HVQ C;  3W6J B;  1ON2 A;  1OYY A;  2F2E A;  1ZRC A;  2HTS A;  1EH6 A;  2LKP A;  5J8C A;  3GZ5 A;  2XIG A;  4IRG A;  4ON0 A;  4MHG A;  1TQM A;  2DLL A;  3VOE A;  3LWF A;  5D5V B;  2DAO A;  4I01 A;  2DFI A;  1BOA A;  3VOD A;  4H0E A;  1TQP A;  2XRO A;  3PQJ A;  4UVB A;  1J5Y A;  2XKO A;  3GEZ A;  1BM9 A;  4L0Y B;  1XGS A;  1B9N A;  2M45 A;  4QWQ A;  5KVR A;  3ZMU A;  3W6K B;  2OBP A;  1GVJ A;  1ODD A;  1MD0 A;  2EV6 A;  3J80 Z;  3BP8 A;  1PDN C;  2EK5 A;  2Y0M A;  2DQR A;  4HAM A;  4UV8 A;  3JAM Z;  1E2X A;  2R7D A;  1YLF A;  5DD4 A;  3U2R A;  2ZKZ A;  3RI4 A;  3K69 A;  2DK5 A;  5JVT A;  4GO1 A;  4EGY A;  4KT5 C;  3BJO A;  1ONV A;  5L3C A;  2PMU A;  5BPI A;  5LHH A;  1P4A A;  1Z6R A;  1CF7 A;  3E5X A;  2ZO4 A;  2ISY A;  3MCZ A;  2Z3Y A;  1YG2 A;  3JTH A;  3CUQ A;  1QNT A;  1XDU A;  4IRI A;  2H09 A;  2NYX A;  1SD7 A;  3WGG A;  3SZT A;  1FT9 A;  1P6R A;  3IHU A;  1ULY A;  4HQM A;  4LMY A;  5D4S A;  4BXU A;  4EJT A;  1XGN A;  2FOK A;  4CO8 A;  4FHT A;  2KIM A;  3WTX C;  1YW9 A;  2EFP A;  5ICG A;  3L7W A;  1YQA A;  3I59 B;  1LVA A;  4M6X A;  1K6O A;  2DTR A;  5LHI A;  2OU2 A;  3ZMD A;  2BEO A;  4LLG F;  3ISP A;  3DP7 A;  3FWE A;  3RDI A;  4ZYG A;  3WU0 A;  2GZW A;  2A5Y B;  1XCV A;  1RI7 A;  1XGM A;  1IN6 A;  2ISZ A;  2V9V A;  1ZLK A;  5LHG A;  2K86 A;  1O7F A;  4KIF A;  3ZMT A;  2KIF A;  3QU3 A;  1W7P A;  2KJB A;  4I02 A;  1BC7 C;  3ZN0 A;  2ZFW A;  2X0L A;  4ESF A;  4IHS A;  2M30 A;  2VN2 A;  3BJ6 A;  1SFU A;  1A04 A;  3KFW X;  3ROU A;  2QLZ A;  3WG9 A;  4ENJ A;  2IJL A;  1RIO H;  2XHK A;  3RIR A;  4WCG A;  4MEY F;  3F72 A;  3BDD A;  3PQK A;  3KZZ A;  5BOX A;  4HW0 A;  5HLG A;  4CDG A;  2P7V B;  2QWW A;  3MZH A;  1UHW A;  1J7K A;  1IF1 A;  3GX4 X;  1G3Y A;  3BWG A;  4WXC A;  2M8E A;  4LG0 B;  1XGO A;  1QZY A;  2EV5 A;  1J0R A;  4HA8 A;  3O3K A;  2OZU A;  1LQ1 A;  1O3Q A;  5D5U B;  1V3F A;  4N9I A;  2W24 A;  4KA4 A;  2GWR A;  1G4D A;  1R00 A;  3LQQ A;  3GWZ A;  1WQ2 A;  2DU9 A;  4MQV A;  4HDV A;  4AIK A;  2A69 F;  2ESN A;  1FNN A;  4BNC A;  1KQ8 A;  1SMT A;  3SQN A;  2DW4 A;  1I27 A;  2L54 A;  3TO7 A;  5D8K B;  2OA4 A;  5D4R A;  2QQA A;  4ZZL A;  3EUH A;  3R61 A;  5BMZ A;  1RUO A;  3EYY A;  3WOD F;  3V8J A;  3RPQ A;  3HRM A;  1R36 A;  3WTS C;  2D2W A;  4M6Y A;  5FFX A;  2L4M A;  3DPL C;  2YSR A;  1XSV A;  2IPQ X;  1U2W A;  3KEO A;  4RGX A;  5KK1 A;  1OKR A;  2CGP A;  4UVA A;  5A2Q Z;  3FMQ A;  2COM A;  3K0L A;  1LNW A;  1Z91 A;  5HS9 A;  3EDP A;  1KU2 A;  1C0W A;  1X3U A;  5IT9 Z;  3L00 A;  2E1C A;  2GIV A;  3GXO A;  5DCM B;  3KEQ A;  2IVM A;  2R7F A;  2EFO A;  2FU4 A;  4LB5 A;  4UNO A;  2HQR A;  2ZME A;  4KN7 X;  4Y15 A;  5E8I A;  2EA4 A;  1R5G A;  2BBY A;  2QVO A;  3GUD A;  3E6D A;  3C3W A;  3DQV C;  1U8R A;  3K1N A;  3L2C A;  2ESH A;  2V6C A;  1MDM B;  4Q48 A;  1B4A A;  1GXP A;  4KN4 X;  5K5R A;  3KET A;  5H6R A;  3LAJ A;  4HF2 A;  4HF0 A;  1XB4 A;  3WE2 A;  1T0F A;  3CLO A;  3JSP A;  3P9C A;  3D5L A;  3FM5 A;  3V7R A;  1J2X A;  2Q0O A;  5FLX Z;  1U5T B;  3HSE A;  2P4W A;  5CVV A;  4AWX B;  3H3U A;  2D1V A;  3KCC A;  3RTR A;  2MLK A;  2JTV A;  2A6E F;  1FWZ A;  1ON1 A;  3ZP5 A;  2VE8 A;  4YFK F;  3C1D A;  3I59 A;  4MEX F;  3SHF A;  1YIO A;  2PN6 A;  4BQA A;  3RKW A;  1RZ4 A;  1K78 B;  4EJV A;  1BI2 A;  1FY7 A;  1O3T A;  1L3L A;  5ERI A;  3CDH A;  1W7P D;  3WTT C;  1KU3 A;  5LGN A;  3FXU A;  5JI6 A;  3H92 A;  2A68 F;  2YU3 A;  4I7H A;  1DP7 P;  5FGM A;  4Z2Y A;  2LNB A;  4LD5 A;  2XKP A;  4IXA A;  1Q1H A;  3BPV A;  1FOK A;  2FF4 A;  2WC2 A;  3EET A;  3G3Z A;  4OIQ F;  4L5J A;  2LF7 A;  4B09 A;  3T8R A;  4YIF A;  5TJJ A;  2O6G E;  1F4K A;  1TW3 A;  5BPD A;  4KMF A;  3MEX A;  3WGI A;  3VB2 A;  3R60 A;  2VBX A;  1KYW A;  1FC3 A;  5H20 A;  2YR2 A;  2W85 A;  2DT5 A;  4YG2 F;  2QM3 A;  1TLH B;  4RB1 A;  1IN5 A;  4P9F A;  4LG0 A;  3Q9V A;  1SD5 A;  2W84 A;  2P6T A;  1O3R A;  1B1B A;  5CLS A;  5DEQ A;  3ECO A;  1ZLJ A;  5EEG A;  2M5W A;  2XAQ A;  4WF2 A;  1S7O A;  1FLI A;  3ABT A;  5AIQ A;  3BY6 A;  2DO7 A;  3DEU A;  1U3E M;  2BGC A;  3HRT A;  1HW2 A;  1I5Z A;  4BAY A;  5E1W A;  2HEO A;  2CW0 F;  3GFM A;  1O7L A;  1EH7 A;  3RJP A;  3U1D A;  3GF2 A;  2WWY A;  3WE3 A;  3WU1 B;  4AIJ A;  2VC0 A;  2PI0 A;  2EFW A;  4M71 A;  1P4X A;  3KP2 A;  2IA0 A;  2HGC A;  1LB2 A;  1VTN C;  1TNT A;  3HYI A;  3KP5 A;  2V79 A;  4M73 A;  1IW7 F;  2KKO A;  2EA2 A;  3J80 K;  3KE2 A;  1SAX A;  1LEA A;  3E3V A;  3WGH A;  3JAM K;  3V7C A;  3T0Y A;  3R4K A;  4K2E A;  5HOO A;  2PJP A;  1UCR A;  5DCM A;  3F3X A;  2O0Y A;  3GFL A;  3BOQ A;  4YFN F;  1WI9 A;  5E20 A;  1H0M A;  3DFG A;  4CHU A;  1ZG5 A;  2JRT A;  2JT1 A;  5E1Z B;  2CO5 A;  5HLH A;  3RKY A;  2P5K A;  2VOP A;  5DYM A;  4RAZ A;  4FX4 A;  1IAW A;  2Z9O A;  1S29 A;  1ZN2 A;  3CO6 C;  2HQN A;  3T5X A;  1SMY F;  2D1H A;  5FD5 A;  1BIA A;  1GHC A;  4LK0 F;  2CQK A;  5EEH A;  1HKT A;  3NEU A;  1T39 A;  4IF4 A;  5FFZ A;  3WTZ A;  3F22 A;  3KLO A;  3F8M A;  2ETH A;  3HRU A;  1U5T A;  2DQL A;  2VC1 A;  5BQT A;  1I1S A;  1ZRE A;  4L9N A;  4N9H A;  4LGW A;  3IKT A;  4ZYD A;  2ADU A;  3C7J A;  1IN7 A;  4P96 A;  1B59 A;  2KRF A;  4L9J A;  2FSW A;  4PGH A;  2QZ8 A;  2A3S A;  1K78 A;  3HHH A;  3J81 Z;  1B6A A;  1JHH A;  2H6B A;  4ZYH A;  2QUF A;  4NQW A;  1Y0U A;  1HKS A;  4M9S A;  4A0X A;  1MKM A;  5AIP A;  5LEJ A;  4LB6 B;  3CUO A;  5D5X B;  2IA1 A;  1EV7 A;  3FXR A;  1XMA A;  2HKX A;  4G9Y A;  1TNS A;  3N4M A;  2QQ9 A;  3F8N A;  4EQQ A;  4MTD A;  1BI3 A;  3E97 A;  2RVC A;  5HDK A;  3DV8 A;  5CVU A;  2STT A;  2PMH A;  2HZT A;  2IA2 A;  5F64 A;  3B73 A;  2OAZ A;  3I64 A;  2H27 A;  1DPU A;  3PFI A;  1QO0 D;  3K1M A;  4JBA A;  2HS5 A;  2UXX A;  1U5T C;  3JTG A;  1USS A;  1MGT A;  4Y17 A;  1P2F A;  3NRV A;  5F1R A;  1UHM A;  2VT2 A;  1R23 A;  2ZNY A;  3ULQ B;  5DV5 A;  3WTV C;  4U7D A;  4RS8 A;  2LDU A;  4NHJ A;  2FE3 A;  2F5F A;  4HBL A;  3OOP A;  4KIG A;  3IKV A;  3C18 A;  4KYW A;  3GLX A;  2XRN A;  2CFX A;  1YS6 A;  1XSD A;  1T98 A;  3H3Z A;  4HLX A;  4HX4 A;  5DUK A;  4LLN A;  4AVP A;  4A6D A;  1BI1 A;  3COA C;  4Q47 A;  4F7Z A;  1Z1D A;  3HRS A;  3RYP A;  1XD7 A;  2DPD A;  4RAY A;  5L3G A;  2XAJ A;  3I54 A;  4E70 A;  3FZV A;  5HDN A;  4R8H A;  4EVI A;  3ECH A;  2V1U A;  1JE8 A;  1XCB A;  3FHZ A;  1P92 A;  3JSO A;  3GFI A;  2VBY A;  4P5O A;  3Q9S A;  3AAF A;  1Z9C A;  3D0S A;  4KUM A;  2Y75 A;  5A2Q K;  3K9T A;  3M8E A;  2NS0 A;  4PDK A;  2GXG A;  4HDU A;  1J75 A;  1P4W A;  2JSC A;  2M1B A;  5IT9 K;  3ABU A;  3TDZ C;  5AON A;  1J59 A;  3IWZ A;  1YS7 A;  1BI0 A;  2F5D A;  2EWN A;  4HX7 A;  4I0B A;  1F1Z A;  4AIH A;  4L9V A;  3HSR A;  1XSX A;  2XAG A;  1QBJ A;  5ICF A;  2NNN A;  4WWC A;  5LLQ A;  5L3E A;  3TO6 A;  2XV4 S;  2HKO A;  4R79 A;  4HOB A;  3QRF F;  1S8N A;  2ACJ A;  3QPH A;  1YFH A;  2IRF G;  3HIF A;  1FBU A;  4L18 B;  2P6S A;  2G7U A;  4U0Y A;  5TRD A;  2FEZ A;  1G3S A;  3DPT A;  4BHC A;  3J7A O;  5FLX K;  3IC7 A;  2FNA A;  4O3M A;  2FBH A;  3TDU C;  1FP1 D;  1IXS B;  1WWX A;  4UV9 A;  4G6Q A;  2DK8 A;  5D6F A;  4GYI A;  1JXS A;  1DDN A;  1IN4 A;  3ZMZ A;  2XAS A;  5L3D A;  1IN8 A;  1S3J A;  2ZNZ A;  4GGG A;  3U9G A;  4XBF A;  2AS5 F;  3BRO A;  2PG4 A;  4RB2 C;  4U7B A;  2DI3 A; 
#chains in the Genus database with same CATH topology
 2XGC A;  4PUS A;  1WH5 A;  2G7H A;  2KJC A;  5GAE J;  2DN0 A;  5CKT A;  3CD6 I;  1QQI A;  4TV7 A;  1TW2 A;  1ZHF A;  2W1O A;  2Z33 A;  4Y52 J;  2CYY A;  3WTY C;  1ITY A;  3IWF A;  2PJR B;  2WAD A;  3NWS A;  2RDP A;  1LFB A;  3IH3 A;  3QOE A;  1TBX A;  1U6G A;  2F48 A;  3FXO A;  2HTJ A;  3BG7 A;  2Q1Z B;  4IVN A;  4MTE A;  3KEY A;  4O5V A;  4E7L A;  3M1E A;  1MBH A;  2O03 A;  3S2H J;  4A3F J;  3ZQG A;  4C2T A;  1VQ6 I;  5EGO A;  2IEK A;  2G9W A;  2FQ4 A;  6PAX A;  4G12 A;  1QPI A;  3HOT A;  1WZ2 A;  5CVR A;  1T33 A;  1MSE C;  4ZH4 F;  5ICE A;  5JLW A;  2NVU B;  1W5S A;  1W36 D;  1Y6I A;  1XX5 A;  4HSR A;  4A5M A;  5LGU A;  1X1P A;  1Y0N A;  2DFF A;  2RC4 A;  3L9F A;  4OIO F;  3HOW J;  5E17 F;  3CUQ B;  5E8G A;  4Y7N J;  1F36 A;  4Y4R A;  4A6E A;  5GPC A;  5JVG F;  1NH3 A;  1MJA A;  4AD9 A;  3E6C C;  3W3C A;  2OZ6 A;  3AL0 C;  4B4C A;  3E5U A;  2A07 F;  2EZL A;  4ZZD A;  4IJA A;  1R1U A;  4EEF G;  2VQC A;  2E7X A;  2BY3 A;  4AYB N;  3HDD A;  3E5Q A;  2R7S A;  1KA8 A;  3K4J A;  1DGW Y;  1FSE A;  4KIB A;  1SFO J;  3ZQ7 A;  5HLT A;  1FPQ A;  1X2M A;  2PMZ N;  5LD2 C;  3ZQC A;  1GXQ A;  2FXA A;  2KMU A;  2ZJR F;  1X2N A;  4EAT A;  2BOL A;  2M4G A;  2RNJ A;  5ICC A;  1N75 A;  2RV8 A;  3VFZ A;  1S5L C;  3ELK A;  3AFH A;  2MGQ A;  4Z6Y A;  4S04 A;  4HV6 A;  2EFN A;  2HYG D;  5EF6 A;  1U78 A;  5D6E A;  2PMZ A;  2LP0 A;  4RAF A;  4L5I A;  4Q5S F;  1IRG A;  3RKX A;  3RCO A;  2DA4 A;  2EBI A;  4MO7 A;  2MD5 A;  1BN5 A;  1T2K A;  2L7F P;  3Q5F A;  3S3N A;  4GCV A;  4UVC A;  2L4A A;  2Z1D A;  1ZAO A;  4HQE A;  3S8P A;  2ZJ2 A;  3EQL F;  1ETX A;  3B6A A;  3GTQ J;  2TRT A;  3LL7 A;  2TDX A;  4RDU A;  2AXL A;  5GAD J;  2CQX A;  1F9N A;  3VYR B;  3CTA A;  2J5O A;  3DPU A;  1BIB A;  1KGS A;  4BKX A;  3GTP J;  2K7L A;  2CWE A;  4M72 A;  4WK8 F;  1B9M A;  1O4X A;  1HDP A;  2M9H A;  3CCR I;  2VJ4 A;  4II3 A;  3B02 A;  3LA3 A;  4ABZ A;  3PSI A;  2GAU A;  2EIM H;  4XLE A;  3TL4 X;  1XN7 A;  2K9S A;  2LSO A;  1I50 J;  2EIL H;  3I56 I;  4KNY A;  2OQR A;  1BJA A;  4ETS A;  2V1X A;  1G6N A;  1WJF A;  2X6W A;  2IP2 A;  3CJN A;  4B43 A;  1BOB A;  3E6M A;  4NC8 A;  5B66 C;  4EV0 A;  2A05 A;  3HOX J;  5DD8 A;  3HG9 A;  1R58 A;  2OF7 A;  1A31 A;  1W4M A;  4G7Z F;  2OJE D;  3ABM H;  4IEJ A;  4HX8 A;  2B0L A;  2KIU A;  3DTK A;  5IYC J;  3SFZ A;  4B8X A;  3ASO H;  4I76 A;  3GFJ A;  3FKJ A;  3OYD A;  2DA3 A;  4OMY A;  2COB A;  1J09 A;  2LH9 A;  3HTU A;  3L09 A;  5LRS A;  2NXN B;  5K5O A;  5LEK A;  2MAB A;  1ZYR F;  3G4S I;  4EM0 B;  3C2B A;  3M8J A;  2WY7 Q;  1D3Y A;  1U8B A;  3KX2 A;  4HZF A;  4F52 A;  2VE9 A;  1O3S A;  1I3A A;  1MJB A;  4XKC A;  1R5H A;  2X48 A;  3I9V 2;  4QIW N;  3BPX A;  1NK3 P;  2RQP A;  2HWV A;  2QSG X;  1Z7L A;  3MWM A;  1YYV A;  5ILU A;  2BVL A;  2FUG 2;  5J1U A;  1YO5 C;  2QKL B;  2XGE A;  3UR3 C;  4V2F A;  4A0Y A;  5DUI A;  1D0Y A;  1RRJ A;  5B3S H;  3R0J A;  2MLG A;  1OQY A;  1HBX G;  1TWF J;  3ONQ A;  5JFR A;  4ENN A;  3JR9 A;  4ZTJ A;  1D1B A;  1YJN I;  1BC8 C;  2XSD C;  4IHW A;  1MMD A;  3MAJ A;  5GAH J;  2ZJQ F;  4P9U A;  2RN7 A;  2HVS A;  4M74 A;  4N0B A;  3E0J B;  1DU0 A;  4XN0 A;  3FF5 A;  4RB3 C;  1UFM A;  3VYT B;  3FXJ A;  3RYR A;  5GTI C;  1H9G A;  5CVJ A;  2ZFU A;  2XPU A;  3DF8 A;  4YII A;  3UKG A;  1Y56 A;  2HFH A;  3DTI A;  3HUG A;  3M9A A;  2YPR A;  3S15 J;  3QQA A;  4CGZ A;  4R1H A;  1MBG A;  1QZZ A;  3HBL A;  3F23 A;  5H2F C;  3O8G A;  4BXF A;  3C2G A;  1UG2 A;  2QBY B;  2A61 A;  4DIQ A;  2VXD A;  2W57 A;  3A03 A;  2EFQ A;  4FET A;  2H94 A;  2VBZ A;  2K3P A;  2ZCW A;  4RGR A;  4CUG A;  3JRC A;  3FIW A;  3K6G A;  1DPR A;  2CUE A;  1JUM A;  3WU2 C;  3V7S A;  3LSJ A;  1N25 A;  1JUP A;  4LK1 F;  1M1E B;  4XOP A;  4JP0 A;  5LRR A;  3P9I A;  1ACI A;  3IL2 A;  2JZY A;  3KPH A;  1IUY A;  5E1X A;  2L9S A;  3IH2 A;  2CFO A;  3HTS B;  2UXN A;  5EJC A;  3BZ6 A;  5BS6 A;  2KDO A;  2CUJ A;  1YOV B;  4E7H A;  1N77 A;  4BL0 B;  2MD0 A;  3CCM I;  3K4C A;  4M9Z A;  5IT3 A;  2R7R A;  1YJ9 I;  2P5V A;  3R6S A;  5TIS C;  2MSY A;  3F6O A;  1OCC H;  3SZP A;  3MKW B;  1A6Q A;  3GO5 A;  3CJQ B;  4J01 A;  2KFD A;  1MDM A;  3DBR B;  1V5F A;  3GZN B;  2W82 A;  3LSK A;  5HS8 A;  4ANJ A;  2X1E A;  2R4G A;  4LFU A;  1VQK I;  2O3F A;  2YX7 A;  5EDN A;  1HQC A;  3NWT A;  1T38 A;  1ZH5 A;  5CVI A;  4XM3 A;  4EM2 A;  4EGZ A;  4EM1 A;  5C3E J;  4CZC A;  3J81 K;  2VAS A;  3KP6 A;  2OTL I;  2JVH A;  2JA2 A;  2UZK A;  2R92 J;  2DTZ A;  4UUS A;  3I4N J;  2AQE A;  1MBE A;  2LFB A;  1H9T A;  4BE0 A;  1KU9 A;  3KP7 A;  4C3I J;  1TTY A;  2VON A;  1MBJ A;  5F6F A;  1BBY A;  4ZYE A;  2K4B A;  4ESJ A;  3ESW B;  1B72 B;  1I6H J;  2A6T A;  2STW A;  1MH3 A;  2Q8K A;  4IHY A;  2C6Y A;  1ZTR A;  2CW7 A;  1JKR C;  4XIC A;  2PJR A;  2QEX I;  2ZME B;  2K4J A;  3PSF A;  5M3M J;  2FQ3 A;  1K7A A;  4HRI A;  1HKQ A;  3U21 A;  3R0A A;  4CSW A;  4A12 A;  1SFE A;  2M4K A;  2ME6 A;  2NRA C;  3G1M A;  3JW4 A;  4MNU A;  4XKV A;  1HLV A;  2EIK H;  2O8K A;  1HSJ A;  1PP8 F;  2V1D A;  4G7O F;  2FBK A;  2LF8 A;  3GVA A;  3LQR A;  2VPL A;  1H89 C;  1SD6 A;  3IH4 A;  2DMP A;  5M5Y J;  2XF6 A;  4XLN F;  1TC3 C;  3DKY A;  5DCF A;  5LGT A;  3JRE A;  3OIQ A;  3K4B A;  1FYL A;  3TO9 A;  2CRG A;  3K4N A;  1JHF A;  1FYM A;  3T8T A;  4XSX F;  3HKZ N;  4UHT A;  4YRV A;  1ZRD A;  3F0C A;  1NHA A;  3M1C A;  4OU0 A;  1I6X A;  2Y9Y A;  4IL6 C;  4XID A;  5IYD J;  2YX4 A;  4AUX A;  1IRX A;  2RRE A;  4L9T A;  4XK4 A;  3PO3 J;  2BZT A;  1S9H A;  3ZMV A;  4S05 A;  5M3F J;  4PZJ A;  4BHP A;  4PCQ A;  1IDY A;  1FIA A;  1Y1V J;  4E7I A;  3TOA A;  1ZGJ A;  1OCZ H;  1OIS A;  1LEB A;  2KQR A;  4U88 A;  3LA2 A;  5HDG A;  4IPA A;  1FYK A;  2Z16 A;  1YW7 A;  3H5N A;  5ED4 A;  2LG4 A;  5CYV A;  1MH4 A;  3FXQ A;  4BHB A;  1YI2 I;  3OOU A;  2FX0 A;  4ZC3 A;  3ERM A;  3QPT A;  3PIO F;  2XGX A;  3F21 A;  1VQN I;  1R22 A;  2R7Q A;  1UB9 A;  4D0P A;  2E2H J;  4EJW A;  3QU6 A;  3VEP A;  1DUX C;  4A5N A;  3DU6 A;  5IOZ A;  3TOB A;  1JI8 A;  4G6D A;  2LMD A;  4I09 A;  2VBW A;  2IS4 A;  5J8F A;  2R3S A;  2VXZ A;  2EB7 A;  2X6Y A;  3A0B C;  4CZZ A;  4BE2 A;  2KT0 A;  2OD5 A;  2HZD A;  1CGP A;  2XAF A;  4IRH A;  5FKO A;  3I4P A;  1UEL B;  3KP3 A;  2D5V A;  4XSZ F;  2Q2E B;  3KZY A;  4ASN A;  1A36 A;  1Q1V A;  2XAH A;  1OYW A;  4CXF A;  1ZRF A;  3HSF A;  2O61 A;  3ML6 A;  3TKY A;  4M3D A;  3OMY A;  2QYO A;  2VB6 A;  4CIC A;  3GZ6 A;  3GW2 A;  4EJU A;  1KU7 A;  2A6H F;  2KL4 A;  2L9R A;  3UNG C;  2JPC A;  2LY1 A;  4LJZ F;  2K27 A;  3A01 B;  4V19 K;  2QGU A;  3CUQ C;  5L3F A;  3HEF A;  3RQI A;  3MQ0 A;  1KQ0 A;  1G3W A;  5CQE A;  5C44 J;  4KDP A;  1IG7 A;  5FD6 A;  2GA1 A;  2PQ8 A;  3HOS A;  5DDG A;  5IP7 J;  3O6B B;  2Z2S B;  4D5F A;  1PP7 U;  1T6S A;  2RGV A;  4RMN A;  3KYL A;  2V4J C;  5D5W B;  2CV2 A;  1WI3 A;  2BV6 A;  3SDB A;  5K5Q A;  1MSF C;  3LA7 A;  4LLL A;  1X1C A;  2JJ7 A;  3G73 A;  4WXD A;  1QGP A;  1OMI A;  2BXZ A;  3M7G A;  2O8X A;  2F5E A;  1GDT A;  4E7Z A;  4YEL A;  1WJ5 A;  4M3E A;  3OYI A;  4KT6 A;  1E3H A;  4A69 C;  4C30 A;  1R4N B;  2BHY A;  2EV0 A;  4PSW A;  3FK7 A;  1NG7 A;  3GYH X;  2VKE A;  2FBI A;  2E1N A;  2Z5U A;  2RQQ A;  3SXY A;  3CCE I;  2EJR A;  4UUV A;  2IW5 A;  1TL8 A;  5CJ9 A;  4OMZ A;  4QLC U;  2JPB A;  3JRI A;  2OCE A;  1ZG1 A;  1P7I A;  3M3Y J;  4XLF A;  3ZQQ A;  1T56 A;  1JJ8 C;  3KP4 A;  2MH9 A;  3OV8 A;  4JQF A;  5HLI A;  2F5V A;  4HEA 2;  2HPM A;  3A2K A;  4ENK A;  3CO7 C;  1EH8 A;  2NNY A;  2H6C A;  5ILS A;  5FB2 A;  4BQO A;  3NAR A;  3OSF A;  5J6X A;  4OIR F;  2Y9Z A;  3FMS A;  5JR3 A;  4MQ9 F;  2IGK A;  4BXX J;  3LSG A;  3LSP A;  2DMQ A;  2DFH A;  4OIP F;  1IZ1 A;  4KIC A;  4PJJ A;  1Z05 A;  1POG A;  3F8C A;  1TQI A;  2NS8 A;  4BQN A;  4B44 A;  3BG6 A;  2K5C A;  4ENM A;  2QBY A;  4LIV A;  5C4J J;  3P5J A;  3L1P A;  3REO A;  3LFK A;  3V42 A;  3ZN1 A;  3GBG A;  2RKH A;  4U87 A;  1FBS A;  4IZZ A;  1HW5 A;  3LAP A;  1IXC A;  3T1B A;  1LJ9 A;  1P9Q C;  1WKM A;  4MFD A;  1JJ6 C;  1MZB A;  4DBR A;  9ANT A;  5D8L B;  1RPW A;  4FX0 A;  2PBI A;  1L0O C;  4BH9 A;  4NBQ A;  2EZI A;  1Y39 A;  1FP2 A;  4HLY A;  4ZYA A;  3QYE A;  2P5L C;  3ERE D;  1WVR A;  3PJR A;  4CCO A;  4QTR A;  2R5Z B;  5IOY A;  3RPU A;  5E18 F;  2K9M A;  1K79 A;  4U0W A;  3MKL A;  4HG2 A;  1IDZ A;  1K61 A;  1Z0X A;  3GTJ J;  5ILV A;  4GDF A;  3HHG A;  3BJA A;  3I5U A;  3S32 A;  4EJO A;  2GBY A;  3QP6 A;  3WTW C;  3S93 A;  1EKE A;  1R4M B;  2BY2 A;  3IRQ A;  4ITV A;  1D8J A;  2EIJ H;  4E4H A;  5JHU A;  1CQT A;  4A3I J;  1HW1 A;  2LTP A;  3H35 A;  1ZR2 A;  1SC7 A;  3FM3 A;  2ZBK A;  3BTI A;  3O2P E;  4FE4 A;  2F4I A;  3P7N A;  4BY1 J;  3WHB A;  3L2V A;  1R1T A;  1SFX A;  4OIN F;  2QCO A;  3QOP A;  4DYQ A;  4JX4 A;  3F8F A;  4EMS A;  2FMY A;  2GXB A;  1WSU A;  2L01 A;  1Y8R B;  5E3M A;  3K1P A;  2LKX A;  1MW7 A;  1PUE E;  3K10 A;  1HST A;  2GA2 A;  2XC7 A;  4MGR A;  3OYF A;  2GQQ A;  4P55 A;  4HF1 A;  1FSH A;  2K85 A;  1W5T A;  2Z99 A;  1D5V A;  2Y69 H;  2BYV E;  1VQP I;  1G59 A;  2W00 A;  4GYG A;  4I0A A;  4HYE A;  5L3B A;  3H5R A;  1ORK A;  1WJE A;  4RGU A;  2X1C A;  4WX9 A;  2QEN A;  1WCM J;  3JRB A;  2FA5 A;  4KMU X;  4PK4 A;  1G8X A;  2HYF A;  4U0V A;  2IS2 A;  4A3M J;  4L0Z B;  4I2O A;  2XUB A;  3VSL A;  1WJC A;  2V6E A;  1FIP A;  2DMU A;  1VI0 A;  2NOJ B;  2M8G X;  3M07 A;  1R1V A;  2IBD A;  3ZMS A;  2BW3 B;  2YUS A;  2VKH A;  2P81 A;  3JRH A;  3ASN H;  1G3T A;  2HDC A;  2H1L A;  5FLM J;  4PGG A;  3AKZ A;  4DQ2 A;  1OCR H;  4JOM A;  5LBQ A;  3QAH A;  2DOA A;  1JTY A;  4FT8 A;  2HU9 A;  2P7C B;  1ZQ3 P;  3CJR B;  1A6I A;  1LDJ A;  2MH2 A;  1WRJ A;  2JA6 J;  2K40 A;  3M8F A;  1UST A;  5IY5 H;  2FML A;  3S2W A;  2MYS A;  4UXN A;  3CZ6 A;  2H8R A;  1FX7 A;  1Z21 A;  3MFK A;  1OYI A;  4CCJ A;  2XRL A;  3WTU C;  3MZY A;  3HPH A;  1CF7 B;  4A2U A;  2L3D A;  1F5T A;  4G6T B;  2IS6 A;  3S1R J;  3GTM J;  2OQG A;  1IRF A;  2M2E A;  3PL8 A;  2LR8 A;  3DU5 A;  3F6V A;  1LDD A;  1MNM C;  1LPQ A;  2WTE A;  5B5E C;  3V4G A;  4IKF A;  1I1G A;  2XPW A;  4IHX A;  2R5Y B;  4RGS A;  2JUC A;  2PFB A;  3MMY B;  4Y13 A;  1BR1 A;  4BDZ A;  4JX6 A;  1QPM A;  1ETY A;  2DBB A;  3OY9 A;  2FNP A;  1YHQ I;  4GXO A;  3V8L A;  1FBQ A;  5K1Y A;  2K3F A;  1V4R A;  4XOT A;  2XAU A;  5F0H A;  2GOM A;  2GM4 A;  1HXD A;  1MJ9 A;  2DA6 A;  3DKX A;  1KZH A;  3B6C A;  1UAA A;  1WJB A;  1D1A A;  4O6J A;  2LBF B;  1ZGA A;  2O5R A;  5KCM A;  1HC8 A;  1VQ8 I;  3I58 A;  3FMR A;  3QP5 A;  2ZME C;  3FX3 A;  2HOS A;  2D45 A;  1MNE A;  4WXH A;  3DXJ F;  4AYB A;  1PYV A;  2P8T A;  2Q2E A;  4G7H F;  1X3W B;  4OOI A;  1YW8 A;  1B8I B;  2ZXJ A;  3TW7 A;  1OFC X;  4A0Z A;  3BR0 A;  1DQU A;  3HPG A;  2VPR A;  5GAG J;  1GT0 C;  1WFX A;  2VOO A;  3CMA I;  4BYY A;  2ME0 A;  2CSO A;  1YJW I;  3A01 A;  4G8X A;  1YTY A;  3L2W A;  2EIN H;  5K7H A;  2ELH A;  1KYZ A;  1QRY A;  1SD4 A;  3H9J A;  3FIS A;  4CYD A;  3S3M A;  3BG9 A;  2VT3 A;  4XLP F;  3V8K A;  2R0Q C;  4A3G J;  1SVL A;  1ZAR A;  5HS7 A;  2MC3 A;  4NB5 A;  1WPK A;  2W25 A;  3E6B A;  3NQO A;  2ELK A;  1JGS A;  3AG3 H;  1YRN B;  3JCU C;  1STZ A;  2PLY A;  2M87 A;  2PEX A;  1JTX A;  4DNC A;  3N97 A;  1S7A A;  4I98 B;  3OYK A;  1AWC A;  1D1C A;  1REP C;  1ZG3 A;  5F0F A;  3I53 A;  2L2O A;  5CQG A;  3IAM 2;  3CCU I;  2K02 A;  4RB0 A;  1O57 A;  3I71 A;  4YFX F;  3ZCO A;  1Z7U A;  4C3H J;  1YIT I;  2XVC A;  2QKM B;  1JUS A;  3QYB A;  3GTK J;  2QQB A;  1BW6 A;  1OPC A;  4G94 A;  2J5P A;  2MA3 A;  3F8B A;  1S72 I;  3ZPL A;  2WV0 A;  2K9Q A;  2F5C A;  1W7P B;  1LDK B;  2FRH A;  4CCM A;  3IRR A;  1Z6T A;  1OCT C;  1QHG A;  3D5R C;  2UWM A;  4KIS A;  2HR3 A;  1OR7 A;  3QOD A;  4E7J A;  2BE5 F;  2NAZ A;  3OYE A;  1FZP B;  4ZDP A;  4JK1 X;  3BR5 A;  3K7A J;  1U0J A;  4HV5 A;  2Y48 A;  4XRS A;  3TQN A;  5GTH C;  2VJ5 A;  2MBF A;  4A3C J;  1AOY A;  4LOC A;  3KLN A;  3DKW A;  4Q4Z F;  3I0T A;  1RNL A;  3JRF A;  1JKO C;  5FO5 A;  2XB0 X;  5KAI C;  1E3O C;  4M9X A;  2UV1 A;  5H6Q A;  3HB9 A;  2DDB A;  4XRF A;  1ETQ A;  2VOD A;  1MBK A;  3G6E I;  3RPU D;  3TGN A;  4CA0 A;  2HI3 A;  3LST A;  1IV8 A;  4IHT A;  1FMW A;  1VQ9 I;  3HOV J;  1RUN A;  1D8K A;  4PJM A;  1XMK A;  3EYI A;  2CUZ A;  2H8W A;  1X3Z B;  4KFC A;  1EJ9 A;  1E17 A;  1R7J A;  2FOW A;  3DLL F;  3D5S C;  3CDI A;  5HNH A;  4XL9 A;  3GLL A;  4ESB A;  1J9I A;  2MG4 A;  3K2Z A;  4FQG A;  2DPU A;  2HOE A;  2L02 A;  2EH3 A;  3A4C A;  5KNL A;  2IT0 A;  3P9K A;  4XR6 A;  1HCR A;  2R5Z A;  3K4K A;  4NUB A;  2CG4 A;  1S6L A;  2ID3 A;  1XDS A;  3ZQL A;  1YX5 A;  1IXR C;  2E7W A;  2A5W A;  1KQ9 A;  1DP3 A;  2X4H A;  5HVQ C;  4BBS J;  3LOC A;  3W6J B;  3ABK H;  4B47 A;  1WJD A;  3SZG A;  1ON2 A;  2KHM A;  1VQ5 I;  1OYY A;  2F2E A;  1ZRC A;  2HTS A;  4XKB A;  1EH6 A;  2LKP A;  2DOE A;  4Y33 A;  5J8C A;  3GZ5 A;  5FRM A;  2XIG A;  5BNG A;  3E1S A;  1FTZ A;  4IRG A;  4ON0 A;  2X6X A;  4MHG A;  4HNU A;  1TQM A;  2DLL A;  3VOE A;  3K4L A;  3LWF A;  5D5V B;  5B1B H;  1OR7 C;  3SFI A;  3TMO A;  3BZC A;  4RA2 A;  4PJN A;  1X1B A;  2DAO A;  2X85 A;  4I01 A;  4QPO A;  2DFI A;  1BOA A;  3VOD A;  2ZXW H;  4H0E A;  1TQP A;  2XRO A;  3PQJ A;  4UVB A;  3S14 J;  1J5Y A;  2CQ7 A;  4DBQ A;  2CV0 A;  2XKO A;  3GEZ A;  1HOM A;  1BM9 A;  4L0Y B;  2CW8 A;  3CP2 A;  1XGS A;  1B9N A;  2M45 A;  4QWQ A;  4BEH A;  5KVR A;  5F27 A;  3ZMU A;  2LOO A;  3W6K B;  2OBP A;  1GVJ A;  1ODD A;  1MND A;  2LYC A;  2VQG A;  4J19 A;  1MD0 A;  2EV6 A;  3J80 Z;  3Q0U A;  1D0X A;  2ID6 A;  3BCB A;  3BP8 A;  3TW6 A;  1PDN C;  3U1K A;  2EK5 A;  2Y0M A;  2DQR A;  1X1A A;  4HAM A;  4UV8 A;  3JAM Z;  4UUT A;  2BW3 A;  3H36 A;  1E2X A;  2R7D A;  4J00 A;  1YLF A;  4XNF A;  5DD4 A;  3U2R A;  2V9K A;  3LFU A;  4YEJ A;  2X9D A;  1X19 A;  4F92 B;  1QVT A;  4CYC B;  3SJM A;  2ZKZ A;  5EG0 B;  3RI4 A;  1AKH B;  3CCJ I;  3K69 A;  3M4O J;  2DK5 A;  5JVT A;  2OTJ I;  2JA7 J;  4X6A J;  3CF5 F;  4GO1 A;  3VSK A;  4EGY A;  4ZJZ A;  1VQ7 I;  4KT5 C;  1KON A;  2E1M B;  1FOX A;  3BJO A;  3DEE A;  1ONV A;  2R7O A;  3ZOB A;  2DA1 A;  5L3C A;  2QSF X;  2VKD A;  2PMU A;  4AC0 A;  2ECB A;  2GLO A;  4BBR J;  5BPI A;  5LHH A;  1P4A A;  1Z6R A;  1RES A;  1CF7 A;  1OCO H;  3E5X A;  2ZO4 A;  2ISY A;  3H0D A;  1QZE A;  3HXL A;  1X1D A;  1K4S A;  4OAZ A;  3MCZ A;  3S17 J;  2QF7 A;  1R6R A;  1YG2 A;  2Z3Y A;  3JTH A;  2R5Y A;  3CUQ A;  4BJ5 C;  3MKZ A;  3J7A Y;  1QNT A;  1XDU A;  4W97 A;  2ZJP F;  2KRC A;  1H8A C;  4IRI A;  2LD5 A;  2H09 A;  1Y8Q B;  2JVG A;  2NYX A;  1SD7 A;  5K7Z A;  1U9N A;  3Q0V A;  3WGG A;  2R93 J;  2MFZ A;  3G71 I;  3BR1 A;  1TT0 A;  5LFA A;  3SZT A;  4IX7 A;  3E7L A;  1FT9 A;  2B9S A;  3CMY A;  1D5Y A;  1P6R A;  3PNY A;  3IHU A;  1ULY A;  4HQM A;  2LBF A;  4LMY A;  4C9Y A;  2RNG A;  5D4S A;  4F55 A;  3OYA A;  3HKZ A;  1JGG A;  4BXU A;  4EJT A;  1XGN A;  2FOK A;  4CO8 A;  4FHT A;  4CH7 A;  2VL8 A;  2WA0 A;  2NVQ J;  3EPZ A;  3Q0W A;  2KIM A;  2E2J J;  4B48 A;  4C2U A;  3W2W A;  1B8I A;  3DBL B;  3WTX C;  1YW9 A;  2WAF A;  2EFP A;  3FXK A;  2E2I J;  5ICG A;  4A93 J;  3L7W A;  1MMN A;  2F4O B;  1YQA A;  2JA5 J;  1SAU A;  5EGO B;  3I59 B;  1LVA A;  2UUZ A;  4M6X A;  1K6O A;  2R7U A;  2DTR A;  5F08 A;  5LHI A;  2OU2 A;  3ZMD A;  2JUG A;  1F43 A;  1LFU P;  4NC6 A;  1ETK A;  1MMG A;  2BEO A;  2WBM A;  4LLG F;  3ISP A;  4ZDL A;  3DP7 A;  1YRN A;  5KHD A;  2I8D A;  1ZKG A;  3FWE A;  3RDI A;  2HDD A;  3DTE A;  4ZYG A;  1V54 H;  2EQR A;  1VZ0 A;  3WU0 A;  1JKQ C;  2DYR H;  2GZW A;  2A5Y B;  1XCV A;  1RI7 A;  1XGM A;  1JT6 A;  2IAI A;  3HZJ A;  1IN6 A;  2ISZ A;  4HST A;  4BQQ A;  4M3G A;  2V9V A;  1ZLK A;  2VIX A;  3OYH A;  4IOC F;  5LHG A;  2K86 A;  4NC7 A;  1FMV A;  1O7F A;  1BR2 A;  4AU7 A;  1BA5 A;  4KIF A;  3TP0 A;  3ZMT A;  2KIF A;  2I5U A;  3QU3 A;  2DMT A;  1W7P A;  2KJB A;  4I02 A;  1BC7 C;  3ZN0 A;  2ZFW A;  2X0L A;  3SYT A;  4ESF A;  3CC7 I;  4IHS A;  3JRA A;  2M30 A;  2VN2 A;  1E3P A;  3HOY J;  3BJ6 A;  1SFU A;  1A04 A;  3KFW X;  3HGG A;  2QLZ A;  3ROU A;  3WG9 A;  3WG7 H;  3CCL I;  4XOR A;  3K70 C;  3G1O A;  4ENJ A;  2IJL A;  1RIO H;  2XHK A;  2BY0 A;  3PFY A;  3FK6 A;  3RIR A;  2X1D A;  4WCG A;  4NNJ A;  3VWB A;  4MEY F;  1NG6 A;  1WGX A;  3F72 A;  2NOG A;  3MVP A;  1X4O A;  3CES A;  5FLV A;  5J3L A;  1T95 A;  3BDD A;  3KIO A;  4LIT A;  2K9N A;  3PQK A;  4PSX A;  1HDD C;  1ETW A;  3KZZ A;  1XMX A;  5BOX A;  4HW0 A;  3MD2 A;  1RC9 A;  5E3N A;  5HLG A;  4CDG A;  2P7V B;  2QWW A;  3MZH A;  1UHW A;  1J7K A;  1TP4 A;  1IF1 A;  2CV1 A;  1IJW C;  3GX4 X;  1G3Y A;  3BWG A;  1GVD A;  3BR6 A;  4WXC A;  2M8E A;  4LG0 B;  2CQN A;  2V1N A;  1XGO A;  1QZY A;  1SVM A;  3CME I;  2EV5 A;  2JRM A;  2LC2 A;  1RET A;  1J0R A;  2AHQ A;  2VKV A;  1SEU A;  4HA8 A;  3O8H A;  1R49 A;  2Y2Z A;  3O3K A;  1OLT A;  5DM6 F;  2YU9 J;  3CC2 I;  2OZU A;  1LQ1 A;  2JQ7 A;  1O3Q A;  2KPM A;  4UY8 I;  1FOY A;  5D5U B;  3EUK L;  2GIZ A;  2LK2 A;  1TWA J;  1V3F A;  4A3D J;  4HPQ A;  1WJA A;  2DJN A;  4N9I A;  2W24 A;  4KA4 A;  2GWR A;  1G4D A;  1R00 A;  1R5I D;  3ABL H;  3QWL A;  3LQQ A;  3GWZ A;  1TWH J;  1UG0 A;  1H88 C;  1WQ2 A;  4XLC A;  2DU9 A;  3CF2 A;  4MQV A;  1IC8 A;  2DT7 B;  4HDV A;  4F3Q A;  4AIK A;  2A69 F;  2ESN A;  3N05 A;  3RZD J;  1FNN A;  4BNC A;  1KQ8 A;  1SMT A;  1WHU A;  2DW4 A;  4LG3 A;  3SQN A;  1I27 A;  2L54 A;  4L5E A;  2HNH A;  3TO7 A;  5D8K B;  2OA4 A;  5D4R A;  3BG3 A;  3JRG A;  4DW6 A;  1UJ8 A;  4CCL A;  1ZR4 A;  2QQA A;  1W0U A;  4ZZL A;  3EUH A;  2DCE A;  3R61 A;  1T8I A;  3A02 A;  3MZ8 A;  5BMZ A;  1RUO A;  1I3Q J;  3S2D J;  3EYY A;  3AG2 H;  4DOZ A;  3WOD F;  2JWT A;  3ZR8 X;  2YS9 A;  3V8J A;  4FCY A;  3RPQ A;  3HRM A;  4M6V A;  1R36 A;  3WTS C;  3I4M J;  2D2W A;  1P7J A;  4W1U A;  4M6Y A;  5FFX A;  5K7F A;  2L4M A;  3DPL C;  2YSR A;  3IAS 2;  2E71 A;  3OYJ A;  2XPV A;  1XSV A;  5E79 C;  2IPQ X;  2QQ8 A;  1HF0 A;  1U2W A;  4JX5 A;  3KEO A;  4RGX A;  3GTG J;  3OSG A;  5KK1 A;  2R7T A;  3X2Q H;  1OKR A;  2CGP A;  4UVA A;  1TWC J;  1LVK A;  5A2Q Z;  3FMQ A;  2COM A;  1AA7 A;  1SAN A;  3K0L A;  1GLN A;  3J7Y J;  1LNW A;  2VJJ A;  2VUM J;  1Z91 A;  5HS9 A;  3EDP A;  4A3B J;  1KU2 A;  3OIO A;  2GOX B;  4D5C A;  1C0W A;  1X3U A;  3HM5 A;  5IT9 Z;  3L00 A;  3OL3 A;  2LRE A;  2GIV A;  1B72 A;  2E1C A;  3FKI J;  3GXO A;  3LSH A;  5DCM B;  3DBH B;  1AKH A;  5EG0 A;  3KEQ A;  2IVM A;  4AVZ A;  2R7F A;  2KDZ A;  3VYU B;  1JT0 A;  2EFO A;  2FU4 A;  3OYL A;  2IS1 A;  4LB5 A;  4BGD A;  4UNO A;  2HQR A;  2ZME A;  4KN7 X;  4Y15 A;  1VQO I;  3QPL A;  5E8I A;  4FTH A;  2EA4 A;  1RKW A;  1R5G A;  2BBY A;  2R7Z J;  2QVO A;  1K83 J;  3GUD A;  3LMM A;  4PJ0 C;  3I55 I;  3E6D A;  3TBI A;  3C3W A;  3K70 D;  3DQV C;  4KIT B;  1U8R A;  3K1N A;  3L2C A;  2ESH A;  2V6C A;  1MDM B;  4QSH A;  1LKX A;  1Z3X A;  1B4A A;  4Q48 A;  2DT6 A;  1YIJ I;  1GXP A;  4KN4 X;  5K5R A;  2Y0S N;  4BU2 A;  1GV5 A;  5F1J A;  3PM1 A;  5FRN A;  5FJ8 J;  3KET A;  2HYJ A;  5H6R A;  3LAJ A;  4HF2 A;  2DOD A;  2L9N A;  3EUH C;  4HF0 A;  1XB4 A;  3WE2 A;  4X0G A;  5IYB J;  2E60 A;  2E35 A;  1T0F A;  2F4M B;  3CLO A;  4DJA A;  1TT5 B;  4XON A;  3S3O A;  3JSP A;  3P9C A;  5M5W J;  3D5L A;  2Y0S A;  3FM5 A;  3BZK A;  3BCA A;  3V7R A;  1J2X A;  2Q0O A;  4H4K C;  4CCN A;  5FLX Z;  1U5T B;  3HSE A;  2M0C A;  2P4W A;  3BG5 A;  4AID A;  4BDY A;  4RAG A;  2IGO A;  5CVV A;  4AWX B;  3H3U A;  1YE9 A;  2D1V A;  3KCC A;  4HNT A;  2HDW A;  2DA7 A;  1TWG J;  3RTR A;  2MLK A;  2XB5 A;  3AG4 H;  2JTV A;  2A6E F;  1MMA A;  1FWZ A;  1ON1 A;  3ZP5 A;  5M5X J;  2VE8 A;  4YFK F;  3C1D A;  3I59 A;  3RQ4 A;  4MEX F;  3ZQH A;  3SHF A;  1N78 A;  3OYC A;  1YIO A;  2PN6 A;  4BQA A;  2LLK A;  3RKW A;  1RZ4 A;  1K78 B;  4EJV A;  4IHV A;  1D0Z A;  1BI2 A;  1FY7 A;  1O3T A;  1L3L A;  4NQW B;  5ERI A;  3CDH A;  2E1M C;  2ZSI B;  5J4V A;  3K4M A;  1W7P D;  1R71 A;  3WTT C;  2JK3 A;  1KU3 A;  3H3V K;  5LGN A;  3FXU A;  4IOA F;  2BVM A;  5JI6 A;  3H92 A;  1XC5 A;  2A68 F;  3PUF A;  2YU3 A;  3TED A;  4OWR B;  4I7H A;  4C3J J;  3ZGK A;  1DP7 P;  5FGM A;  4A3E J;  4Z2Y A;  2LNB A;  4DYC A;  4LD5 A;  2XKP A;  4XRS G;  4IXA A;  2DDA A;  2KP6 A;  2VQL A;  4OAY A;  1Q1H A;  4A3J J;  2HOT A;  4M3F A;  1NK2 P;  3BPV A;  1FOK A;  2FF4 A;  2L0K A;  5J47 A;  5J1Y A;  4DYR A;  2WC2 A;  2CH0 A;  3EET A;  4BY7 J;  3G3Z A;  4OIQ F;  4L5J A;  3FXM A;  2LF7 A;  1MIJ A;  3S1N J;  4B09 A;  3T8R A;  4YIF A;  5TJJ A;  3EUA A;  3IUO A;  3L2Q A;  5DTD A;  1F4K A;  1TW3 A;  5BPD A;  2H1K A;  5FKL A;  2O6G E;  1IO2 A;  1T0F C;  5DM7 F;  4B3A A;  3MEX A;  4KMF A;  3WGI A;  3VB2 A;  2XGD A;  5GPA A;  3R60 A;  1UMQ A;  3CP8 A;  2VBX A;  2ICW G;  5FKN A;  2DJI A;  4P1W A;  1KYW A;  1XS9 A;  1FC3 A;  1A35 A;  5H20 A;  4Y3O A;  1LUJ B;  2YR2 A;  1HA8 A;  2DA5 A;  2V7F A;  2W85 A;  2DT5 A;  2DOF A;  4YG2 F;  2QM3 A;  5FKM A;  4UB8 C;  1TLH B;  2KZV A;  4RB1 A;  1JKP C;  1IN5 A;  4P9F A;  4LG0 A;  1BW5 A;  3QPS A;  3A1Y A;  3I3L A;  3S1Q J;  1V55 H;  1ETV A;  3S1M J;  3HC7 A;  5FKK A;  3Q9V A;  1IV6 A;  1SD5 A;  2W84 A;  1APL C;  2P6T A;  3VDX A;  3BTC A;  1K6Y A;  1O3R A;  3CLQ A;  3IV5 A;  1B1B A;  5CLS A;  5DEQ A;  1U9O A;  3ECO A;  4PJL A;  3HOU J;  1ZLJ A;  1LE8 B;  1IGN A;  3OR1 C;  3BR3 A;  4CCK A;  3K2A A;  5EEG A;  3J7Z I;  2M5W A;  2XAQ A;  4WF2 A;  1S7O A;  2JA8 J;  1FLI A;  3ABT A;  5AIQ A;  1PVE A;  3BY6 A;  1OCP A;  2DO7 A;  2CQQ A;  3DEU A;  1PUF B;  3CMM A;  1SVO A;  1U3E M;  4BE1 A;  1SFK A;  2BGC A;  3HRT A;  1VQM I;  1HW2 A;  1I5Z A;  4BAY A;  3G1L A;  1DU6 A;  2GXA A;  1RKT A;  2HXI A;  2JMW A;  5E1W A;  5JLX A;  2HEO A;  2CW0 F;  3GFM A;  1O7L A;  3ZXS A;  3L2R A;  1EH7 A;  2IXS A;  3CCV I;  4S0H B;  2IGM A;  3RJP A;  3U1D A;  3Q3S A;  2KIQ A;  3GF2 A;  3CCS I;  2WWY A;  3WE3 A;  3WU1 B;  1X58 A;  4V2G A;  3PIP F;  1W1W E;  4AIJ A;  2VC0 A;  4BS9 A;  5J4Y A;  2PI0 A;  2EFW A;  4M71 A;  1VFC A;  2NVT J;  3OIP A;  2F6C A;  1P4X A;  3KP2 A;  3L2U A;  2IA0 A;  2HGC A;  3VPR A;  5J1R A;  1BL0 A;  3OS0 A;  2HXO A;  4DZP A;  1LB2 A;  2E19 A;  3S16 J;  1VTN C;  2K9L A;  3GTL J;  1TNT A;  3HYI A;  3KP5 A;  2V79 A;  2M34 A;  4M73 A;  1IW7 F;  2KKO A;  2EA2 A;  2VI6 A;  3J80 K;  3KE2 A;  1SAX A;  1LEA A;  2KZG A;  3E3V A;  1EA3 A;  2EZK A;  3WGH A;  4I6Z A;  3H1C A;  4BUP A;  3JAM K;  3V7C A;  4N4O B;  3T0Y A;  3R4K A;  4K2E A;  5HOO A;  2E34 A;  2E5Z A;  2PJP A;  4LIU A;  1UCR A;  3OYN A;  5DCM A;  2M3A A;  2L9V A;  2Y31 A;  2XF7 A;  3F3X A;  2LVS A;  2O0Y A;  1YX3 A;  3GFL A;  3BOQ A;  4YFN F;  1WI9 A;  3CCQ I;  2MW8 A;  1FOW A;  5E20 A;  5HNF A;  4GRI A;  1H0M A;  3DFG A;  4CHU A;  2WY8 Q;  1ZG5 A;  4QPQ A;  3C2H A;  2AQF A;  2JRT A;  2JT1 A;  4MIM A;  5E1Z B;  2CO5 A;  2FJ1 A;  1OJL A;  3FDY A;  5HLH A;  3RKY A;  2P5K A;  3SEZ A;  2VOP A;  2L7K A;  5DYM A;  4RAZ A;  3JRD A;  4FX4 A;  1IAW A;  5EZH A;  2Z9O A;  4IQJ A;  1S29 A;  5IP9 J;  1ZN2 A;  3CO6 C;  2HQN A;  2CJJ A;  3T5X A;  1SMY F;  2D1H A;  5FD5 A;  4I99 C;  2WV1 A;  3H9G A;  1BIA A;  2AO9 A;  1GHC A;  3D1N I;  4LK0 F;  4RM3 A;  4JYK A;  2CQK A;  5EEH A;  3RSN A;  1HKT A;  3NEU A;  1T39 A;  4IF4 A;  3AL0 B;  5FFZ A;  2CS3 A;  3WTZ A;  3PNT A;  2WAQ N;  3F22 A;  3AG1 H;  3KLO A;  2OUM A;  3F8M A;  2ETH A;  3TP3 A;  3HRU A;  1U5T A;  2DQL A;  3KYC B;  3MN2 A;  2VC1 A;  5BQT A;  1I1S A;  1IUF A;  2PX9 A;  3QYF A;  4L9N A;  4N9H A;  1ZRE A;  4XLH A;  2OCC H;  4LGW A;  2WAQ A;  4D7M A;  3OYB A;  2DXI A;  2X51 A;  2DMN A;  3IKT A;  4ZYD A;  2ADU A;  2L5Q A;  3W2V A;  3W2A A;  3C7J A;  2WB1 N;  2NVY J;  1IN7 A;  4P96 A;  1B59 A;  3CQZ J;  4FIS A;  4A3K J;  1QHH D;  2E36 A;  1VQL I;  1WH7 A;  4KJZ A;  2VQH A;  2KRF A;  2OC6 A;  4L9J A;  2P0W A;  1Z3Y A;  2FSW A;  1GUU A;  2QZ8 A;  2A3S A;  4PGH A;  1K78 A;  3HHH A;  3J81 Z;  4XKW A;  1B6A A;  1JHH A;  4A3L J;  2H6B A;  5C4X J;  4ZYH A;  1ZGW A;  4XMY A;  2QUF A;  3OWT A;  4PFO A;  4NQW A;  3ZRG A;  1Y0U A;  2WB1 A;  1HKS A;  4BJ6 C;  3DEW A;  4M9S A;  2LY9 A;  5EZG A;  3HL2 A;  2WAE A;  1MKM A;  4A0X A;  2Y30 A;  5AIP A;  1ERD A;  3SEQ A;  5LEJ A;  1ZEL A;  4LB6 B;  3CUO A;  5D5X B;  3LSR A;  2IA1 A;  1EV7 A;  3FXR A;  2E1O A;  1Z77 A;  2LKS A;  1XMA A;  2HKX A;  4E7S A;  2O7O A;  4RBO A;  4G9Y A;  1FTT A;  2OPT A;  3HGY A;  1TNS A;  3N4M A;  2QQ9 A;  3F8N A;  4FAS D;  3OYG A;  4EQQ A;  1TZL A;  3PO2 J;  4MTD A;  3DLA A;  1BI3 A;  3E97 A;  2RVC A;  5HDK A;  1FEX A;  3CJT B;  4N4N B;  3DV8 A;  3KZI C;  2JN6 A;  2W48 A;  2ELJ A;  3GTO J;  5CVU A;  2STT A;  4XRM A;  4RM2 A;  4F91 B;  2PMH A;  4B3X A;  2QA4 I;  2VJI A;  2HZT A;  2IA2 A;  1V5G A;  4RLQ A;  5F64 A;  3B73 A;  2OAZ A;  5IP6 A;  1BJZ A;  3CDL A;  3I64 A;  2H27 A;  2NS7 A;  1DPU A;  3OR2 C;  3PFI A;  1QO0 D;  4D9J A;  3K1M A;  4JBA A;  2HQA A;  2HS5 A;  1ETO A;  2UXX A;  2G0E A;  4MFE A;  1U5T C;  3JTG A;  2JSP A;  1S7E A;  1USS A;  1MGT A;  3NRV A;  1P2F A;  4Y17 A;  5F1R A;  1UHM A;  3LSM A;  2NVX J;  3HOZ J;  2N8G A;  2VT2 A;  3BT9 A;  1R23 A;  2ZNY A;  3ULQ B;  5KAF C;  3IP4 B;  5DV5 A;  3WTV C;  4U7D A;  4RS8 A;  2LDU A;  1AU7 A;  4NHJ A;  2FE3 A;  4YIR X;  2CUF A;  3LSI A;  2F5F A;  4HBL A;  3OOP A;  4KIG A;  4IO9 F;  5HOD A;  3IKV A;  2LY2 A;  3C18 A;  1AHD P;  2E5N A;  2O9L A;  4KYW A;  3GLX A;  2XRN A;  1Z67 A;  5E3O A;  2CFX A;  3W6V A;  1YS6 A;  1XSD A;  1T98 A;  3H3Z A;  4HLX A;  4HX4 A;  2BHZ A;  5DUK A;  4DGW B;  3LNQ A;  2VLA A;  4LLN A;  1EF4 A;  1BR4 A;  4AM3 A;  4C2M J;  3FHN A;  4AVP A;  1Y1W J;  4A6D A;  4XN3 A;  1BI1 A;  1LFP A;  3COA C;  1DGR M;  4Q47 A;  2R7X A;  4D7N A;  1K4T A;  1LE8 A;  4F7Z A;  5CPR B;  1Z1D A;  3NAU A;  3HRS A;  3PUB A;  3RYP A;  2M0M A;  1GV2 A;  1XD7 A;  1PJR A;  4NDL A;  3HJE A;  4XLA A;  2DPD A;  4RAY A;  1UHS A;  1PUF A;  4F93 B;  5L3G A;  3SDG A;  1G2H A;  1VND A;  2XAJ A;  3PNV A;  3I54 A;  2FD5 A;  1W5C C;  4E70 A;  4HNV A;  4RLF A;  5J40 A;  3FZV A;  5HDN A;  3BC8 A;  4R8H A;  4EVI A;  1E0E A;  2ECC A;  3ECH A;  1V5E A;  2V1U A;  1JE8 A;  2AXT C;  3H0G J;  2V9P A;  3FBN B;  4ZDO A;  2M7B A;  2ZXI A;  1XCB A;  3FHZ A;  1P92 A;  3JSO A;  2W7N A;  3BR2 A;  2HVR A;  3DWL E;  3GFI A;  2VBY A;  4P5O A;  3Q9S A;  3AAF A;  1Z9C A;  3BTJ A;  3D0S A;  4KUM A;  2Y75 A;  1W36 C;  2HPI A;  2ZSH B;  2OV7 A;  3K9T A;  2DFE A;  2NS0 A;  3M8E A;  4XQF A;  4PDK A;  5A2Q K;  5GP9 A;  5EEA A;  1QU3 A;  2GXG A;  2LRD A;  3BLY A;  4HDU A;  2TCT A;  2ZXH A;  5F04 A;  2HVQ A;  5F0C A;  3WHC A;  2X6O A;  4II2 A;  4DZJ A;  1J75 A;  3OYM A;  1P4W A;  2BXY A;  2JSC A;  2M1B A;  5IT9 K;  3ABU A;  1QA6 A;  2HOA A;  5E3L A;  3TDZ C;  5AON A;  3OS1 A;  5B1A H;  1W0T A;  5IPA A;  2DYS H;  1A5J A;  3OL4 A;  1J59 A;  4BAC A;  1ENH A;  3IWZ A;  3H5A A;  5FRO A;  2R7W A;  4D1Q A;  1YS7 A;  2R7V A;  1BI0 A;  2EPF A;  3BQY A;  1R9T J;  2MC4 A;  5JHF A;  3H9Q A;  2F5D A;  2EWN A;  2I10 A;  2KRH A;  4HX7 A;  2KLO A;  1UZC A;  2M7A A;  3ZQI A;  4I0B A;  2XF5 A;  2ZC2 A;  1F1Z A;  4AIH A;  4L9V A;  3HSR A;  1T08 B;  1XSX A;  2XAG A;  3KYD B;  4GFB A;  1MMS A;  1QBJ A;  2B7E A;  4M3B A;  5ICF A;  2NNN A;  4WWC A;  4E6K G;  5LLQ A;  3RKQ A;  5L3E A;  3GCM A;  3TO6 A;  5DS9 A;  2XV4 S;  4B1R A;  2XDV A;  1I39 A;  3DCF A;  1FJL A;  4IQ4 A;  2HKO A;  3BTL A;  3HUG B;  4R79 A;  4HOB A;  4MLO A;  3QRF F;  1S8N A;  3G2B A;  2L7Z A;  2V26 A;  1VF9 A;  3QPH A;  2ACJ A;  1YFH A;  4ZTF A;  2QSH X;  5TGT A;  1XG1 A;  1XTA A;  2DA2 A;  4CYC A;  2IRF G;  1QVU A;  3HIF A;  1FBU A;  4PFP A;  3RZO J;  1RR7 A;  2L7M P;  4L18 B;  2P6S A;  1XPX A;  2CU7 A;  2G7U A;  3VYS B;  3ZQF A;  4U0Y A;  2BY1 A;  1IRZ A;  1MBF A;  2CMP A;  5TRD A;  2FEZ A;  1VQ4 I;  1G3S A;  4FE7 A;  3DPT A;  5EYR A;  3CCY A;  4X1E A;  4BHC A;  3J7A O;  1RR8 C;  5FLX K;  3IC7 A;  3OS2 A;  2FNA A;  3GME A;  4O3M A;  2FBH A;  3TDU C;  1FP1 D;  3MKY B;  4UB6 C;  1IXS B;  2HQ5 A;  3FBI B;  1WWX A;  4UV9 A;  3F9K A;  3A0H C;  4G6Q A;  1X4P A;  3CC4 I;  1NTC A;  2B63 J;  2DK8 A;  5D6F A;  2IGN A;  3BQZ A;  3FXL A;  4GYI A;  1JXS A;  2XSJ C;  1DDN A;  1IN4 A;  2ZB9 A;  3ZMZ A;  2EZH A;  2XAS A;  4BEH B;  5L3D A;  1IN8 A;  2KIS A;  4E7K A;  1S3J A;  2ZNZ A;  4GGG A;  3U9G A;  4XBF A;  2AS5 F;  3BRO A;  2PG4 A;  4UUS B;  4RB2 C;  2W4S A;  4U7B A;  1ZK8 A;  2RAE A;  4BJT A;  2DI3 A; 
#chains in the Genus database with same CATH homology
 2G7H A;  2KJC A;  1QQI A;  4TV7 A;  1TW2 A;  1ZHF A;  2Z33 A;  2CYY A;  3WTY C;  3IWF A;  2RDP A;  1TBX A;  1U6G A;  2HTJ A;  4IVN A;  4MTE A;  4O5V A;  3M1E A;  2O03 A;  2G9W A;  6PAX A;  3HOT A;  5CVR A;  4ZH4 F;  5ICE A;  1W5S A;  4A5M A;  5LGU A;  3L9F A;  2RC4 A;  4OIO F;  5E17 F;  3CUQ B;  5E8G A;  4A6E A;  1MJA A;  4AD9 A;  3E6C C;  2OZ6 A;  3E5U A;  2A07 F;  4ZZD A;  4IJA A;  1R1U A;  2E7X A;  3E5Q A;  1KA8 A;  1FSE A;  4KIB A;  3ZQ7 A;  1FPQ A;  1GXQ A;  2FXA A;  2RNJ A;  5ICC A;  2RV8 A;  3VFZ A;  3ELK A;  4S04 A;  4HV6 A;  2EFN A;  2HYG D;  1U78 A;  5D6E A;  4L5I A;  4Q5S F;  1IRG A;  3RKX A;  2MD5 A;  1BN5 A;  1T2K A;  3Q5F A;  4GCV A;  4UVC A;  2L4A A;  1ZAO A;  4HQE A;  2ZJ2 A;  3EQL F;  2TDX A;  2AXL A;  1F9N A;  3CTA A;  2J5O A;  1BIB A;  1KGS A;  2K7L A;  2CWE A;  4M72 A;  4WK8 F;  1B9M A;  3B02 A;  3LA3 A;  2GAU A;  1XN7 A;  2LSO A;  4KNY A;  2OQR A;  1BJA A;  4ETS A;  2V1X A;  1G6N A;  2IP2 A;  3CJN A;  3E6M A;  4EV0 A;  5DD8 A;  1R58 A;  1W4M A;  4G7Z F;  4HX8 A;  2B0L A;  2KIU A;  3SFZ A;  4B8X A;  3GFJ A;  4OMY A;  3HTU A;  3L09 A;  5LRS A;  5K5O A;  5LEK A;  1ZYR F;  4EM0 B;  1D3Y A;  2VE9 A;  4HZF A;  1O3S A;  1MJB A;  1R5H A;  3BPX A;  2RQP A;  2HWV A;  3MWM A;  1YYV A;  5ILU A;  1YO5 C;  4A0Y A;  5DUI A;  3R0J A;  2MLG A;  1HBX G;  5JFR A;  4ENN A;  1BC8 C;  3MAJ A;  4P9U A;  2RN7 A;  4M74 A;  4N0B A;  3FF5 A;  4RB3 C;  1UFM A;  3RYR A;  1H9G A;  5CVJ A;  3DF8 A;  4YII A;  2HFH A;  3HUG A;  3M9A A;  2YPR A;  4CGZ A;  4R1H A;  1QZZ A;  3F23 A;  2QBY B;  2A61 A;  2W57 A;  2EFQ A;  2H94 A;  2VBZ A;  2ZCW A;  4RGR A;  1DPR A;  3V7S A;  4LK1 F;  5LRR A;  3P9I A;  3IL2 A;  2JZY A;  1IUY A;  5E1X A;  3HTS B;  2UXN A;  5BS6 A;  3BZ6 A;  5IT3 A;  4M9Z A;  2P5V A;  3R6S A;  3F6O A;  3SZP A;  3GO5 A;  1MDM A;  5HS8 A;  4LFU A;  2O3F A;  2YX7 A;  1HQC A;  1T38 A;  1ZH5 A;  5CVI A;  4EM2 A;  4EGZ A;  4EM1 A;  3J81 K;  3KP6 A;  2UZK A;  1H9T A;  1KU9 A;  3KP7 A;  1TTY A;  2VON A;  5F6F A;  1BBY A;  4ZYE A;  2K4B A;  4ESJ A;  2STW A;  2Q8K A;  2C6Y A;  2ZME B;  2K4J A;  1K7A A;  2FQ3 A;  1HKQ A;  3R0A A;  4A12 A;  1SFE A;  2NRA C;  3JW4 A;  4MNU A;  1HSJ A;  1PP8 F;  2V1D A;  4G7O F;  2FBK A;  2LF8 A;  3GVA A;  3LQR A;  1SD6 A;  4XLN F;  5DCF A;  5LGT A;  1FYL A;  3TO9 A;  1JHF A;  1FYM A;  3T8T A;  4XSX F;  1ZRD A;  4UHT A;  1NHA A;  4OU0 A;  1I6X A;  2YX4 A;  4L9T A;  3ZMV A;  4S05 A;  4PZJ A;  4BHP A;  4PCQ A;  3TOA A;  1ZGJ A;  1LEB A;  4U88 A;  3LA2 A;  5HDG A;  4IPA A;  1FYK A;  1YW7 A;  5ED4 A;  4BHB A;  5CYV A;  3FXQ A;  3QPT A;  2XGX A;  3F21 A;  1R22 A;  1UB9 A;  4D0P A;  4EJW A;  3QU6 A;  3VEP A;  1DUX C;  4A5N A;  3TOB A;  4G6D A;  4I09 A;  2VBW A;  5J8F A;  2R3S A;  2VXZ A;  2EB7 A;  4CZZ A;  2OD5 A;  1CGP A;  2XAF A;  4IRH A;  3I4P A;  3KP3 A;  4XSZ F;  3KZY A;  4ASN A;  2XAH A;  1OYW A;  4CXF A;  1ZRF A;  3HSF A;  2O61 A;  3ML6 A;  3TKY A;  2QYO A;  4CIC A;  3GZ6 A;  3GW2 A;  4EJU A;  1KU7 A;  2A6H F;  2JPC A;  4LJZ F;  2K27 A;  3CUQ C;  5L3F A;  3MQ0 A;  1KQ0 A;  1G3W A;  4KDP A;  5FD6 A;  2GA1 A;  2PQ8 A;  3HOS A;  5DDG A;  3O6B B;  1PP7 U;  1T6S A;  2RGV A;  5D5W B;  2BV6 A;  5K5Q A;  3LA7 A;  4LLL A;  3G73 A;  4WXD A;  1QGP A;  1OMI A;  3M7G A;  2O8X A;  2F5E A;  2EV0 A;  3GYH X;  2FBI A;  2E1N A;  2Z5U A;  3SXY A;  2EJR A;  4UUV A;  2IW5 A;  5CJ9 A;  4OMZ A;  4QLC U;  2JPB A;  1ZG1 A;  3KP4 A;  2MH9 A;  3OV8 A;  4JQF A;  5HLI A;  4ENK A;  3CO7 C;  1EH8 A;  2NNY A;  2H6C A;  5ILS A;  5FB2 A;  5J6X A;  4OIR F;  3FMS A;  5JR3 A;  4MQ9 F;  4OIP F;  1IZ1 A;  4KIC A;  1Z05 A;  3F8C A;  1TQI A;  4ENM A;  2QBY A;  3REO A;  3LFK A;  3ZN1 A;  2RKH A;  1FBS A;  1HW5 A;  3LAP A;  1IXC A;  3T1B A;  1LJ9 A;  1WKM A;  1MZB A;  5D8L B;  4FX0 A;  2PBI A;  1L0O C;  4BH9 A;  1FP2 A;  4HLY A;  2P5L C;  3ERE D;  3RPU A;  5E18 F;  1K79 A;  4U0W A;  5ILV A;  3HHG A;  3BJA A;  3I5U A;  4EJO A;  3QP6 A;  3WTW C;  3IRQ A;  1D8J A;  5JHU A;  1HW1 A;  3FM3 A;  2ZBK A;  3O2P E;  3P7N A;  1R1T A;  1SFX A;  4OIN F;  3QOP A;  3F8F A;  4EMS A;  2FMY A;  2GXB A;  1WSU A;  2L01 A;  3K1P A;  1PUE E;  1HST A;  2GA2 A;  4MGR A;  2GQQ A;  4P55 A;  4HF1 A;  1FSH A;  1W5T A;  2Z99 A;  1D5V A;  2BYV E;  4GYG A;  4I0A A;  4HYE A;  5L3B A;  4RGU A;  4WX9 A;  2QEN A;  2FA5 A;  4KMU X;  4U0V A;  2HYF A;  4L0Z B;  4I2O A;  2XUB A;  1R1V A;  3ZMS A;  1G3T A;  2HDC A;  4PGG A;  4DQ2 A;  5LBQ A;  3QAH A;  4FT8 A;  2P7C B;  1LDJ A;  2MH2 A;  1WRJ A;  3M8F A;  1UST A;  2FML A;  3S2W A;  4UXN A;  1FX7 A;  3MFK A;  1OYI A;  3WTU C;  3MZY A;  1CF7 B;  4A2U A;  2L3D A;  1F5T A;  2OQG A;  1IRF A;  3F6V A;  1LDD A;  2WTE A;  3V4G A;  1I1G A;  4RGS A;  2PFB A;  4Y13 A;  1QPM A;  2DBB A;  2FNP A;  4GXO A;  3V8L A;  1FBQ A;  5K1Y A;  1V4R A;  1HXD A;  1MJ9 A;  4O6J A;  1ZGA A;  3I58 A;  3FMR A;  3QP5 A;  3FX3 A;  2D45 A;  4WXH A;  3DXJ F;  2P8T A;  2Q2E A;  4G7H F;  4OOI A;  1YW8 A;  2ZXJ A;  4A0Z A;  2VOO A;  4BYY A;  2CSO A;  4G8X A;  1YTY A;  1KYZ A;  2ELH A;  1SD4 A;  4CYD A;  2VT3 A;  4XLP F;  3V8K A;  1ZAR A;  5HS7 A;  2MC3 A;  4NB5 A;  2W25 A;  3E6B A;  3NQO A;  1JGS A;  1STZ A;  2PLY A;  2M87 A;  2PEX A;  4DNC A;  3N97 A;  1S7A A;  4I98 B;  1AWC A;  1REP C;  1ZG3 A;  3I53 A;  2K02 A;  4RB0 A;  1O57 A;  3I71 A;  4YFX F;  1Z7U A;  2XVC A;  2QQB A;  1OPC A;  4G94 A;  2J5P A;  2MA3 A;  3F8B A;  3ZPL A;  2WV0 A;  2F5C A;  1W7P B;  1LDK B;  2FRH A;  3IRR A;  1Z6T A;  2UWM A;  2HR3 A;  1OR7 A;  2BE5 F;  2NAZ A;  1FZP B;  4JK1 X;  4HV5 A;  2Y48 A;  3TQN A;  2MBF A;  1AOY A;  3KLN A;  3DKW A;  4Q4Z F;  3I0T A;  1RNL A;  5FO5 A;  4M9X A;  5H6Q A;  4XRF A;  2VOD A;  3TGN A;  3LST A;  4IHT A;  1RUN A;  1D8K A;  1XMK A;  3EYI A;  4KFC A;  1E17 A;  1R7J A;  4ESB A;  1J9I A;  3K2Z A;  2DPU A;  2HOE A;  2L02 A;  2IT0 A;  3P9K A;  2CG4 A;  1S6L A;  1XDS A;  1IXR C;  2E7W A;  1KQ9 A;  2X4H A;  5HVQ C;  3W6J B;  1ON2 A;  1OYY A;  2F2E A;  1ZRC A;  2HTS A;  1EH6 A;  2LKP A;  5J8C A;  3GZ5 A;  2XIG A;  4IRG A;  4ON0 A;  4MHG A;  1TQM A;  2DLL A;  3VOE A;  3LWF A;  5D5V B;  2DAO A;  4I01 A;  2DFI A;  1BOA A;  3VOD A;  4H0E A;  1TQP A;  2XRO A;  3PQJ A;  4UVB A;  1J5Y A;  2XKO A;  3GEZ A;  1BM9 A;  4L0Y B;  1XGS A;  1B9N A;  2M45 A;  4QWQ A;  5KVR A;  3ZMU A;  3W6K B;  2OBP A;  1GVJ A;  1ODD A;  1MD0 A;  2EV6 A;  3J80 Z;  3BP8 A;  1PDN C;  2EK5 A;  2Y0M A;  2DQR A;  4HAM A;  4UV8 A;  3JAM Z;  1E2X A;  2R7D A;  1YLF A;  5DD4 A;  3U2R A;  2ZKZ A;  3RI4 A;  3K69 A;  2DK5 A;  5JVT A;  4GO1 A;  4EGY A;  4KT5 C;  3BJO A;  1ONV A;  5L3C A;  2PMU A;  5BPI A;  5LHH A;  1P4A A;  1Z6R A;  1CF7 A;  3E5X A;  2ZO4 A;  2ISY A;  3MCZ A;  2Z3Y A;  1YG2 A;  3JTH A;  3CUQ A;  1QNT A;  1XDU A;  4IRI A;  2H09 A;  2NYX A;  1SD7 A;  3WGG A;  3SZT A;  1FT9 A;  1P6R A;  3IHU A;  1ULY A;  4HQM A;  4LMY A;  5D4S A;  4BXU A;  4EJT A;  1XGN A;  2FOK A;  4CO8 A;  4FHT A;  2KIM A;  3WTX C;  1YW9 A;  2EFP A;  5ICG A;  3L7W A;  1YQA A;  3I59 B;  1LVA A;  4M6X A;  1K6O A;  2DTR A;  5LHI A;  2OU2 A;  3ZMD A;  2BEO A;  4LLG F;  3ISP A;  3DP7 A;  3FWE A;  3RDI A;  4ZYG A;  3WU0 A;  2GZW A;  2A5Y B;  1XCV A;  1RI7 A;  1XGM A;  1IN6 A;  2ISZ A;  2V9V A;  1ZLK A;  5LHG A;  2K86 A;  1O7F A;  4KIF A;  3ZMT A;  2KIF A;  3QU3 A;  1W7P A;  2KJB A;  4I02 A;  1BC7 C;  3ZN0 A;  2ZFW A;  2X0L A;  4ESF A;  4IHS A;  2M30 A;  2VN2 A;  3BJ6 A;  1SFU A;  1A04 A;  3KFW X;  3ROU A;  2QLZ A;  3WG9 A;  4ENJ A;  2IJL A;  1RIO H;  2XHK A;  3RIR A;  4WCG A;  4MEY F;  3F72 A;  3BDD A;  3PQK A;  3KZZ A;  5BOX A;  4HW0 A;  5HLG A;  4CDG A;  2P7V B;  2QWW A;  3MZH A;  1UHW A;  1J7K A;  1IF1 A;  3GX4 X;  1G3Y A;  3BWG A;  4WXC A;  2M8E A;  4LG0 B;  1XGO A;  1QZY A;  2EV5 A;  1J0R A;  4HA8 A;  3O3K A;  2OZU A;  1LQ1 A;  1O3Q A;  5D5U B;  1V3F A;  4N9I A;  2W24 A;  4KA4 A;  2GWR A;  1G4D A;  1R00 A;  3LQQ A;  3GWZ A;  1WQ2 A;  2DU9 A;  4MQV A;  4HDV A;  4AIK A;  2A69 F;  2ESN A;  1FNN A;  4BNC A;  1KQ8 A;  1SMT A;  3SQN A;  2DW4 A;  1I27 A;  2L54 A;  3TO7 A;  5D8K B;  2OA4 A;  5D4R A;  2QQA A;  4ZZL A;  3EUH A;  3R61 A;  5BMZ A;  1RUO A;  3EYY A;  3WOD F;  3V8J A;  3RPQ A;  3HRM A;  1R36 A;  3WTS C;  2D2W A;  4M6Y A;  5FFX A;  2L4M A;  3DPL C;  2YSR A;  1XSV A;  2IPQ X;  1U2W A;  3KEO A;  4RGX A;  5KK1 A;  1OKR A;  2CGP A;  4UVA A;  5A2Q Z;  3FMQ A;  2COM A;  3K0L A;  1LNW A;  1Z91 A;  5HS9 A;  3EDP A;  1KU2 A;  1C0W A;  1X3U A;  5IT9 Z;  3L00 A;  2E1C A;  2GIV A;  3GXO A;  5DCM B;  3KEQ A;  2IVM A;  2R7F A;  2EFO A;  2FU4 A;  4LB5 A;  4UNO A;  2HQR A;  2ZME A;  4KN7 X;  4Y15 A;  5E8I A;  2EA4 A;  1R5G A;  2BBY A;  2QVO A;  3GUD A;  3E6D A;  3C3W A;  3DQV C;  1U8R A;  3K1N A;  3L2C A;  2ESH A;  2V6C A;  1MDM B;  4Q48 A;  1B4A A;  1GXP A;  4KN4 X;  5K5R A;  3KET A;  5H6R A;  3LAJ A;  4HF2 A;  4HF0 A;  1XB4 A;  3WE2 A;  1T0F A;  3CLO A;  3JSP A;  3P9C A;  3D5L A;  3FM5 A;  3V7R A;  1J2X A;  2Q0O A;  5FLX Z;  1U5T B;  3HSE A;  2P4W A;  5CVV A;  4AWX B;  3H3U A;  2D1V A;  3KCC A;  3RTR A;  2MLK A;  2JTV A;  2A6E F;  1FWZ A;  1ON1 A;  3ZP5 A;  2VE8 A;  4YFK F;  3C1D A;  3I59 A;  4MEX F;  3SHF A;  1YIO A;  2PN6 A;  4BQA A;  3RKW A;  1RZ4 A;  1K78 B;  4EJV A;  1BI2 A;  1FY7 A;  1O3T A;  1L3L A;  5ERI A;  3CDH A;  1W7P D;  3WTT C;  1KU3 A;  5LGN A;  3FXU A;  5JI6 A;  3H92 A;  2A68 F;  2YU3 A;  4I7H A;  1DP7 P;  5FGM A;  4Z2Y A;  2LNB A;  4LD5 A;  2XKP A;  4IXA A;  1Q1H A;  3BPV A;  1FOK A;  2FF4 A;  2WC2 A;  3EET A;  3G3Z A;  4OIQ F;  4L5J A;  2LF7 A;  4B09 A;  3T8R A;  4YIF A;  5TJJ A;  2O6G E;  1F4K A;  1TW3 A;  5BPD A;  4KMF A;  3MEX A;  3WGI A;  3VB2 A;  3R60 A;  2VBX A;  1KYW A;  1FC3 A;  5H20 A;  2YR2 A;  2W85 A;  2DT5 A;  4YG2 F;  2QM3 A;  1TLH B;  4RB1 A;  1IN5 A;  4P9F A;  4LG0 A;  3Q9V A;  1SD5 A;  2W84 A;  2P6T A;  1O3R A;  1B1B A;  5CLS A;  5DEQ A;  3ECO A;  1ZLJ A;  5EEG A;  2M5W A;  2XAQ A;  4WF2 A;  1S7O A;  1FLI A;  3ABT A;  5AIQ A;  3BY6 A;  2DO7 A;  3DEU A;  1U3E M;  2BGC A;  3HRT A;  1HW2 A;  1I5Z A;  4BAY A;  5E1W A;  2HEO A;  2CW0 F;  3GFM A;  1O7L A;  1EH7 A;  3RJP A;  3U1D A;  3GF2 A;  2WWY A;  3WE3 A;  3WU1 B;  4AIJ A;  2VC0 A;  2PI0 A;  2EFW A;  4M71 A;  1P4X A;  3KP2 A;  2IA0 A;  2HGC A;  1LB2 A;  1VTN C;  1TNT A;  3HYI A;  3KP5 A;  2V79 A;  4M73 A;  1IW7 F;  2KKO A;  2EA2 A;  3J80 K;  3KE2 A;  1SAX A;  1LEA A;  3E3V A;  3WGH A;  3JAM K;  3V7C A;  3T0Y A;  3R4K A;  4K2E A;  5HOO A;  2PJP A;  1UCR A;  5DCM A;  3F3X A;  2O0Y A;  3GFL A;  3BOQ A;  4YFN F;  1WI9 A;  5E20 A;  1H0M A;  3DFG A;  4CHU A;  1ZG5 A;  2JRT A;  2JT1 A;  5E1Z B;  2CO5 A;  5HLH A;  3RKY A;  2P5K A;  2VOP A;  5DYM A;  4RAZ A;  4FX4 A;  1IAW A;  2Z9O A;  1S29 A;  1ZN2 A;  3CO6 C;  2HQN A;  3T5X A;  1SMY F;  2D1H A;  5FD5 A;  1BIA A;  1GHC A;  4LK0 F;  2CQK A;  5EEH A;  1HKT A;  3NEU A;  1T39 A;  4IF4 A;  5FFZ A;  3WTZ A;  3F22 A;  3KLO A;  3F8M A;  2ETH A;  3HRU A;  1U5T A;  2DQL A;  2VC1 A;  5BQT A;  1I1S A;  1ZRE A;  4L9N A;  4N9H A;  4LGW A;  3IKT A;  4ZYD A;  2ADU A;  3C7J A;  1IN7 A;  4P96 A;  1B59 A;  2KRF A;  4L9J A;  2FSW A;  4PGH A;  2QZ8 A;  2A3S A;  1K78 A;  3HHH A;  3J81 Z;  1B6A A;  1JHH A;  2H6B A;  4ZYH A;  2QUF A;  4NQW A;  1Y0U A;  1HKS A;  4M9S A;  4A0X A;  1MKM A;  5AIP A;  5LEJ A;  4LB6 B;  3CUO A;  5D5X B;  2IA1 A;  1EV7 A;  3FXR A;  1XMA A;  2HKX A;  4G9Y A;  1TNS A;  3N4M A;  2QQ9 A;  3F8N A;  4EQQ A;  4MTD A;  1BI3 A;  3E97 A;  2RVC A;  5HDK A;  3DV8 A;  5CVU A;  2STT A;  2PMH A;  2HZT A;  2IA2 A;  5F64 A;  3B73 A;  2OAZ A;  3I64 A;  2H27 A;  1DPU A;  3PFI A;  1QO0 D;  3K1M A;  4JBA A;  2HS5 A;  2UXX A;  1U5T C;  3JTG A;  1USS A;  1MGT A;  4Y17 A;  1P2F A;  3NRV A;  5F1R A;  1UHM A;  2VT2 A;  1R23 A;  2ZNY A;  3ULQ B;  5DV5 A;  3WTV C;  4U7D A;  4RS8 A;  2LDU A;  4NHJ A;  2FE3 A;  2F5F A;  4HBL A;  3OOP A;  4KIG A;  3IKV A;  3C18 A;  4KYW A;  3GLX A;  2XRN A;  2CFX A;  1YS6 A;  1XSD A;  1T98 A;  3H3Z A;  4HLX A;  4HX4 A;  5DUK A;  4LLN A;  4AVP A;  4A6D A;  1BI1 A;  3COA C;  4Q47 A;  4F7Z A;  1Z1D A;  3HRS A;  3RYP A;  1XD7 A;  2DPD A;  4RAY A;  5L3G A;  2XAJ A;  3I54 A;  4E70 A;  3FZV A;  5HDN A;  4R8H A;  4EVI A;  3ECH A;  2V1U A;  1JE8 A;  1XCB A;  3FHZ A;  1P92 A;  3JSO A;  3GFI A;  2VBY A;  4P5O A;  3Q9S A;  3AAF A;  1Z9C A;  3D0S A;  4KUM A;  2Y75 A;  5A2Q K;  3K9T A;  3M8E A;  2NS0 A;  4PDK A;  2GXG A;  4HDU A;  1J75 A;  1P4W A;  2JSC A;  2M1B A;  5IT9 K;  3ABU A;  3TDZ C;  5AON A;  1J59 A;  3IWZ A;  1YS7 A;  1BI0 A;  2F5D A;  2EWN A;  4HX7 A;  4I0B A;  1F1Z A;  4AIH A;  4L9V A;  3HSR A;  1XSX A;  2XAG A;  1QBJ A;  5ICF A;  2NNN A;  4WWC A;  5LLQ A;  5L3E A;  3TO6 A;  2XV4 S;  2HKO A;  4R79 A;  4HOB A;  3QRF F;  1S8N A;  2ACJ A;  3QPH A;  1YFH A;  2IRF G;  3HIF A;  1FBU A;  4L18 B;  2P6S A;  2G7U A;  4U0Y A;  5TRD A;  2FEZ A;  1G3S A;  3DPT A;  4BHC A;  3J7A O;  5FLX K;  3IC7 A;  2FNA A;  4O3M A;  2FBH A;  3TDU C;  1FP1 D;  1IXS B;  1WWX A;  4UV9 A;  4G6Q A;  2DK8 A;  5D6F A;  4GYI A;  1JXS A;  1DDN A;  1IN4 A;  3ZMZ A;  2XAS A;  5L3D A;  1IN8 A;  1S3J A;  2ZNZ A;  4GGG A;  3U9G A;  4XBF A;  2AS5 F;  3BRO A;  2PG4 A;  4RB2 C;  4U7B A;  2DI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...