4ENJA

Crystal structure of s. pombe atl1 in complex with damaged dna containing o6-hydroxyethylguanine
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
MRMDEFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHPETHVPWHRVINSRGTISKRDISAGEQRQKDRLEEEGVEIYQTSLGEYKLNLPEYMWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alkyltransferase-like protein 1
publication title Atl1 Regulates Choice between Global Genome and Transcription-Coupled Repair of O(6)-Alkylguanines.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein/dna
total genus 24
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2012-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4enjA00
1LDDA 2PQ8A 4FHTA 5DYMA 2DQRA 1OPCA 4ASNA 1OYIA 1R5GA 1REPC 4M6XA 3N97A 5CYVA 4EJWA 5E1WA 2HFHA 1Z91A 5F1RA 1JXSA 2VONA 5ILSA 2L4MA 5ILUA 1BC8C 1R58A 3C3WA 1W7PD 3MQ0A 2L54A 3QPTA 3EQLF 5LGTA 1XD7A 3TDZC 4I0AA 4M73A 4EV0A 3V7RA 1F1ZA 1ZRCA 2VE9A 1QQIA 2ELHA 3QP5A 4IXAA 2VC1A 2COMA 4U0YA 3ULQB 5BPIA 2FSWA 3O6BB 2YSRA 3FF5A 1Z05A 1WI9A 3IKVA 5BMZA 5DUKA 4UHTA 4G8XA 3LFKA 2OU2A 2X4HA 4KIGA 4YIFA 4JBAA 2LF8A 4RB1A 5LBQA 3W6KB 5LRRA 1SMYF 3T0YA 2A69F 4O5VA 4WWCA 2ZJ2A 4LMYA 1K7AA 4I09A 5FB2A 1D8JA 3DPTA 1Z9CA 1U8RA 4O6JA 3J80K 4PGHA 5L3DA 3BY6A 1KYZA 2V1DA 4RGXA 2EV5A 1XMAA 1S6LA 4IHSA 2OQGA 2IA1A 3ABTA 3I53A 2XAQA 2NS0A 2VE8A 3I4PA 4G6QA 2EFNA 4U88A 2HZTA 3FXRA 5HDNA 3K1NA 4I2OA 2VBZA 3SXYA 3SHFA 5JHUA 2ZBKA 1U5TB 2EB7A 3EYIA 4LB5A 1T0FA 3KZZA 5L3BA 3AAFA 2Q8KA 5E17F 2JTVA 4HV5A 4NHJA 1BI3A 4GO1A 1J0RA 1K78B 2FMLA 2VT3A 3LQQA 3BJAA 3F22A 2D1VA 2EA4A 2VOPA 1YW8A 2G7HA 5K5QA 2XKOA 3WTXC 3GZ6A 1O3RA 2Y75A 4HYEA 2YX4A 4RGUA 3VODA 1UHWA 4XLNF 3E6BA 4HQMA 3HOTA 1FPQA 2F5DA 1BBYA 1FSEA 2VXZA 1MGTA 3VEPA 5ERIA 2OD5A 3KE2A 1T39A 1TBXA 4G7HF 2F2EA 4RB0A 4ZYHA 1ZRFA 2NYXA 2PG4A 2J5PA 2ZNYA 1XMKA 1SD6A 3GW2A 2RKHA 2HTSA 1QO0D 2G7UA 5DEQA 1MJBA 3Q9SA 4OIPF 3K2ZA 4EGYA 4BHPA 4ZYDA 1SFXA 4DNCA 4Y17A 5F6FA 2EFPA 2QQ9A 2D1HA 2VT2A 1A04A 2AXLA 1YFHA 4A5MA 4LK1F 2STTA 4A2UA 2RNJA 1F4KA 3H3ZA 2DBBA 4CDGA 2MH9A 2YR2A 1I1GA 3FHZA 1QZZA 4KN7X 1SD4A 3E5XA 3BROA 3SZTA 3TGNA 1KGSA 3ERED 3VOEA 4UXNA 4KUMA 5TRDA 1FC3A 2UWMA 3PFIA 3P9KA 1IW7F 3BDDA 3I64A 2VBWA 1LQ1A 2FBKA 4UVCA 3FXUA 5BS6A 3IRRA 1LNWA 3CO6C 4AD9A 1R1VA 1FP2A 2C6YA 3JSOA 1ULYA 1X3UA 3V8JA 4CZZA 3HTUA 1P92A 4QLCU 3SQNA 1HKQA 1FWZA 4Z2YA 2PLYA 2O8XA 1R1UA 3I58A 1B6AA 5D5UB 5J6XA 1HSJA 2P7CB 1J75A 4L9NA 1ZGAA 3IL2A 2JPBA 2ADUA 2VBYA 2A5YB 2L01A 4LJZF 1XDSA 2BBYA 4U0VA 5FLXZ 2IA0A 4Y15A 3PQJA 1BJAA 5HVQC 3ZN1A 2CSOA 1W4MA 1QPMA 2H09A 2M87A 2ESHA 3DPLC 1XN7A 5AONA 3ZPLA 3FMQA 5FD6A 4JQFA 3GFJA 1LB2A 3J81Z 2ZCWA 2FOKA 2NRAC 4Q48A 4UUVA 3K1PA 1ZRDA 1RI7A 4HX7A 2GA2A 3JAMZ 5DCFA 5K5OA 5CVVA 3F6OA 3HSRA 1KA8A 2JSCA 1R36A 4ESJA 1YG2A 1H9TA 1YIOA 1S7AA 3M9AA 2VOOA 1KQ9A 1MZBA 2MD5A 3ISPA 4Q5SF 5DCMA 2CGPA 5J8FA 4RB3C 4KIBA 4BNCA 1FNNA 2K4BA 5CJ9A 5TJJA 1HW5A 2VN2A 4DQ2A 3HUGA 1G6NA 3KP2A 1WQ2A 1HQCA 1OYWA 3NRVA 4IVNA 4IHTA 1LEAA 4OU0A 4HZFA 3WTUC 4RAYA 5BOXA 2GXBA 2RQPA 2PJPA 4LGWA 1NHAA 2RGVA 2P8TA 1BI2A 3HOSA 1BOAA 1BI1A 2MH2A 3MAJA 4ZZDA 5E8GA 2XUBA 4RAZA 4WK8F 1O3QA 2KIFA 2RVCA 4IF4A 4IRHA 4PZJA 1FP1D 3QU6A 3FWEA 2F5EA 2XAGA 1TNSA 1JHFA 3L2CA 3CUOA 3I0TA 2R7DA 6PAXA 4L5IA 1EH8A 3B73A 3DQVC 4M72A 1Z1DA 1JE8A 1WWXA 4GGGA 1O7FA 2IT0A 2HDCA 2EJRA 1FY7A 2P5KA 3OV8A 2B0LA 1ZN2A 5FLXK 1YTYA 5HDKA 1JHHA 2DK5A 3C7JA 5FD5A 1V3FA 3HRSA 5FFZA 1AWCA 4GXOA 5F64A 2RV8A 3N4MA 3E5QA 1P6RA 3L7WA 1I1SA 2QQBA 4ESBA 4CYDA 2NNNA 5EEHA 3JSPA 4M6YA 3JAMK 2OBPA 3L9FA 1XSXA 3CUQC 3GX4X 3K9TA 2QBYA 4JK1X 1G3YA 4UVAA 5JVTA 2HR3A 2WV0A 1Z7UA 3GUDA 4HV6A 2EK5A 1ZG1A 4XRFA 2JZYA 2ETHA 2CYYA 1ZG5A 1YLFA 1S8NA 4LG0B 1MKMA 4A0XA 3ZMSA 2ZFWA 1HXDA 5HLIA 2FBIA 2DLLA 2LDUA 1H0MA 3VB2A 3LAPA 2Y48A 1LDJA 4MGRA 3H92A 3RIRA 4MEXF 3U9GA 3KP5A 4ESFA 3WGIA 3BZ6A 5ED4A 3TOBA 2K02A 1ON2A 3CO7C 5LHGA 4MNUA 3HYIA 2IA2A 2E7XA 1AOYA 5E20A 1DPUA 2M30A 3CLOA 4H0EA 4HAMA 2BYVE 1PUEE 4LLNA 3F8FA 4Q4ZF 5D6FA 1YO5C 5BPDA 3WTTC 4L0ZB 3DV8A 1DUXC 1QBJA 3F8NA 3Q9VA 4IPAA 2J5OA 5DCMB 2H6CA 3WTZA 2Q2EA 2ZMEA 5CVIA 3IWFA 1KYWA 2VC0A 3MZYA 2A68F 2QLZA 3RJPA 2WTEA 3KEOA 3F8MA 2CWEA 1FT9A 4IRIA 1S7OA 4KDPA 1ZH5A 3F6VA 1SFEA 2H6BA 2IVMA 3F8CA 2W24A 3KP7A 4P96A 4EM0B 4WF2A 5DUIA 3B02A 4CHUA 1ZHFA 1PP7U 4LLLA 3ZMTA 1KQ8A 1OR7A 2IP2A 2KKOA 2Z99A 4MTEA 4KFCA 2HS5A 3LA3A 4ZYGA 2YX7A 3GZ5A 3F72A 2P7VB 1OYYA 2PEXA 5IT9Z 2DI3A 1P2FA 2QWWA 1T98A 2OZUA 3HRUA 4R79A 2ACJA 2HTJA 5AIPA 1MDMA 1KU3A 1FZPB 2LSOA 4UV9A 2O6GE 2AS5F 1CF7A 5JR3A 3CDHA 1Y0UA 5H6RA 3GFMA 2MLGA 1U5TC 4EM1A 3WTVC 4EGZA 4M9ZA 4TV7A 2M1BA 4RS8A 3TDUC 3V7CA 4ZYEA 4I01A 1TNTA 1YW9A 2HKXA 4AIKA 3KP3A 1ZG3A 1LVAA 1IN7A 3HHGA 5D8KB 1UHMA 1GHCA 5HLHA 3ZMDA 3L00A 3FM3A 2F5CA 1CGPA 3GF2A 3C1DA 3ZQ7A 5A2QZ 5BQTA 1FBUA 1RZ4A 2FF4A 4G7ZF 4P55A 4K2EA 3TO7A 4HW0A 2P4WA 2IRFG 4WXHA 2W85A 2UZKA 5D6EA 1IAWA 3TO9A 4LB6B 3O3KA 4EJVA 3K0LA 2MC3A 2QYOA 1HBXG 4EMSA 2EFWA 1D8KA 2P6SA 1IRGA 2LNBA 2QBYB 2FA5A 2FNPA 2DU9A 4U0WA 2K7LA 3H3UA 3HTSB 2WWYA 3R6SA 1I6XA 2XHKA 1KU9A 2IPQX 1PP8F 1RIOH 3P9IA 1GXQA 4AVPA 3GYHX 3G73A 2O03A 5E1ZB 2XASA 3IC7A 3RYRA 4GCVA 4RB2C 1IN5A 2QM3A 5ILVA 2GXGA 2IW5A 3E97A 3QP6A 3RKYA 4UV8A 4EVIA 1W5TA 2K86A 4BHCA 3MFKA 4IJAA 2ZO4A 2PMUA 4M71A 1DDNA 3T8TA 1K6OA 3EETA 5E1XA 3U1DA 3QU3A 5IT9K 1V4RA 3MWMA 1TQMA 3REOA 5JI6A 2W84A 2ZMEB 4A6DA 2DO7A 1QGPA 3I59A 3LAJA 4Y13A 3KP6A 3MZHA 4RGSA 1GXPA 1FYMA 1LJ9A 2P6TA 4KN4X 1J7KA 3JW4A 1G3SA 2JPCA 1HKTA 3S2WA 4HBLA 1USTA 2DAOA 1HW2A 4WX9A 1BN5A 1Z6RA 3E6DA 3R0JA 1L0OC 3E5UA 2GA1A 4N9IA 3PQKA 3F21A 4AIHA 4HF1A 5L3GA 1XCBA 5KVRA 5A2QK 4I02A 1KU7A 3MEXA 3KEQA 1JGSA 3V7SA 3RPUA 1IN6A 4A6EA 2CO5A 5J8CA 4YFKF 2XAHA 1Z6TA 2DW4A 3ZMZA 1CF7B 2Y0MA 2A61A 2P5LC 3GO5A 4U7DA 3ZN0A 3GXOA 4L0YB 2V79A 3HHHA 4CO8A 4ENNA 1IXSB 2P5VA 5LGNA 3BP8A 4LK0F 2FNAA 2EA2A 1LDKB 2HWVA 3JTGA 4AWXB 4FT8A 5DD8A 3VFZA 2HQNA 2XKPA 4OIQF 3WU1B 2V6CA 4BAYA 4HLXA 3V8KA 4BQAA 3WODF 4BXUA 3QRFF 5HS9A 2GIVA 2M8EA 3DEUA 4E70A 4ZH4F 3Q5FA 1ON1A 2DFIA 1EV7A 2R3SA 2ZKZA 1G3WA 4MQVA 3K1MA 2XRNA 4P5OA 1DPRA 4M9XA 1W5SA 3R4KA 1USSA 1E17A 3WGGA 4R8HA 4L9VA 3E3VA 3KLNA 1J2XA 4A0YA 2XROA 2XAJA 1U5TA 3C18A 1T2KA 2L02A 3GLXA 4LFUA 2W25A 4KA4A 3CJNA 4PGGA 2DQLA 3KFWX 3OOPA 1C0WA 2QVOA 5DDGA 4FX4A 4KICA 5H20A 5LLQA 3QOPA 3QAHA 3HIFA 1B9MA 2DK8A 3WTYC 4YFNF 5L3FA 3F3XA 1B59A 3RDIA 4ENJA 3WE2A 4G94A 4G6DA 3FX3A 3FXQA 4NQWA 4L5JA 2BV6A 1U2WA 2KIMA 5LHIA 5LEJA 2RN7A 1FYLA 3L09A 3KP4A 3M7GA 3BWGA 2OQRA 1R1TA 3J81K 1SD7A 2HGCA 5ICGA 2A3SA 1BM9A 3ECHA 5HDGA 3I59B 2ESNA 2D45A 4HOBA 3ROUA 5IT3A 2DT5A 1YS6A 2FMYA 3HSFA 4YIIA 2LF7A 5CVJA 2HYGD 5ICCA 1G3TA 4D0PA 5HS7A 1J9IA 3HRTA 1P4XA 2CQKA 3SZPA 1YQAA 3FM5A 2CG4A 3FMRA 3T5XA 1T38A 3LA2A 2FBHA 1H9GA 1R5HA 1UFMA 2DTRA 1IN4A 2O0YA 4OIOF 4HF2A 1D5VA 3LSTA 1TQIA 4KMUX 3CTAA 3QPHA 2ISYA 3M8FA 2GWRA 2PMHA 3M8EA 1D3YA 1U6GA 4WCGA 2NAZA 4S04A 5ICEA 2V9VA 4R1HA 5D8LB 1XGNA 2RDPA 1XDUA 5L3CA 4EJUA 2FE3A 1XSDA 1RUNA 1UB9A 2BGCA 4IRGA 4EJOA 3RKWA 2JRTA 3BPXA 1FBQA 2HKOA 3LWFA 2VODA 4MHGA 2XVCA 1Q1HA 3ZMUA 4LD5A 5E8IA 1SAXA 1FSHA 3ZMVA 3RPQA 5DV5A 4EJTA 3I54A 4HQEA 4CGZA 2HQRA 4QWQA 1BIBA 4ZZLA 1U78A 5D4SA 4MEYF 5D5VB 5FO5A 1W7PA 1B1BA 5HS8A 4HA8A 4ETSA 4G9YA 3R60A 2HEOA 3GFLA 2O61A 2XV4S 3F23A 2FQ3A 1XGMA 2EV6A 3RTRA 2L3DA 2OA4A 1IN8A 3IWZA 2K27A 4OOIA 3ML6A 4WXCA 5CLSA 1E2XA 4WXDA 1K79A 3T1BA 3V4GA 1XGOA 1ZYRF 1XB4A 2X0LA 5ICFA 1ZGJA 3KETA 4EQQA 1LEBA 2A6HF 1IUYA 4BH9A 4G7OF 4B8XA 1G4DA 2PI0A 5LEKA 4KT5C 3DF8A 1QZYA 3LQRA 3R61A 4UVBA 1YYVA 3MCZA 4CXFA 1R00A 2HYFA 2FXAA 4L9TA 3IRQA 4UNOA 3FMSA 2QENA 4N9HA 4XLPF 2XAFA 5HLGA 2L4AA 3E6MA 1ONVA 3U2RA 2K4JA 5K1YA 1R23A 4L18B 1BIAA 1TW2A 1STZA 4M74A 1PDNC 3D0SA 4PCQA 1KU2A 2GQQA 2IJLA 5LHHA 5D5WB 2NNYA 2LKPA 4CICA 1EH6A 4KNYA 1B9NA 2MBFA 2R7FA 5JFRA 3SFZA 1R22A 3RYPA 1WKMA 3P9CA 1J5YA 1MJAA 3DKWA 5FFXA 4KIFA 3P7NA 1RNLA 1J59A 3NQOA 3FZVA 3WU0A 3IKTA 4HDUA 2RC4A 4MTDA 4XSZF 2YU3A 1F5TA 4EM2A 4HDVA 4PDKA 3WTWC 5DD4A 1WRJA 2WC2A 4A0ZA 3TKYA 1I27A 2EFOA 1KQ0A 2W57A 3O2PE 2EV0A 3W6JB 4A12A 4KYWA 2E7WA 2QUFA 3ZP5A 4OMYA 2JT1A 3F8BA 3EYYA 2PN6A 2BEOA 1BC7C 3WGHA 1ZARA 1QNTA 2UXXA 3IHUA 4YG2F 1P4WA 4I98B 1FOKA 4Q47A 3V8LA 2E1NA 1FX7A 1TLHB 2F5FA 3BJOA 3BJ6A 2DPDA 5LGUA 3TQNA 4ENMA 5CVUA 5EEGA 2MLKA 2M5WA 4I7HA 3WTSC 2ISZA 1S29A 2ZXJA 1ZAOA 3CUQA 4F7ZA 2A07F 3HRMA 3ELKA 1HSTA 3K69A 2MA3A 3JTHA 1FLIA 1U3EM 2M45A 3HSEA 4N0BA 2KJBA 2STWA 3ECOA 1UCRA 2YPRA 1IXRC 2EFQA 1I5ZA 2A6EF 1VTNC 2CW0F 3GEZA 1WSUA 4O3MA 4A5NA 5L3EA 5LRSA 1W7PB 2FU4A 2GAUA 1FBSA 2Z9OA 3LA7A 2PBIA 1O57A 1O7LA 1GVJA 3GWZA 2XIGA 2O3FA 2FRHA 2GZWA 3KLOA 5KK1A 2HOEA 2FEZA 2H94A 3GVAA 4XSXF 4LG0A 4BHBA 4U7BA 2CFXA 1F9NA 4M9SA 3RKXA 2UXNA 2V1UA 1IZ1A 4HLYA 4KMFA 3TOAA 1RUOA 2QZ8A 1XSVA 5CVRA 1B4AA 3KCCA 1HW1A 1MDMB 1DP7P 3I71A 2V1XA 2XGXA 2G9WA 2Z3YA 1L3LA 2KJCA 4LLGF 4S05A 1OMIA 1ODDA 2QQAA 1IRFA 4YFXF 4FX0A 4L9JA 5HOOA 2OZ6A 2H27A 5FGMA 1TTYA 3I5UA 5E18F 3DFGA 1ZLJA 2TDXA 1SMTA 5D5XB 4I0BA 4ON0A 3WG9A 1O3TA 2BE5F 1ZREA 3J7AO 1TQPA 3NEUA 1O3SA 2VBXA 1XCVA 1T6SA 3KZYA 3BPVA 2EWNA 1S3JA 3EUHA 4B09A 1SD5A 3R0AA 2D2WA 4GYGA 4ENKA 1IXCA 2KIUA 1ZLKA 1YW7A 4MQ9F 1TW3A 3T8RA 2PFBA 1MD0A 1XGSA 2OAZA 2Z33A 3WE3A 3DXJF 1K78A 3M1EA 3EDPA 1EH7A 1P4AA 3D5LA 4OMZA 3J80Z 5D4RA 1OKRA 4XBFA 1YS7A 3E6CC 2ZNZA 5K5RA 2DPUA 4HF0A 3GFIA 3DP7A 1R7JA 3ABUA 4P9UA 3G3ZA 4HX8A 3RI4A 1FYKA 1SFUA 4OIRF 4NB5A 3TO6A 1IF1A 1HKSA 4GYIA 5AIQA 5H6QA 1BI0A 4HX4A 4RGRA 1MJ9A 2KRFA 4P9FA 3BOQA 3CUQB 4OINF 3COAC 4BYYA 2Q0OA 2E1CA 4AIJA 2Z5UA
chains in the Genus database with same CATH superfamily
1LDDA 2PX9A 2PQ8A 1HF0A 1QVTA 4FHTA 1G59A 4BEHA 1D1CA 5DYMA 2DQRA 1OPCA 4ASNA 3H9QA 1OYIA 1BOBA 4BQNA 2MD0A 1R5GA 1REPC 2OCCH 2VASA 4M6XA 3N97A 1O4XA 5CYVA 4EJWA 4IEJA 5E1WA 2HFHA 1Z91A 4BXFA 1YRNA 5F1RA 1JXSA 2OTLI 4XIDA 2VONA 3I4MJ 2UUZA 5ILSA 3MKZA 2L4MA 3F9KA 4NUBA 1A35A 5ILUA 1BC8C 1R58A 2WB1N 3C3WA 1W7PD 4MIMA 4UB6C 3MQ0A 3BTIA 5DTDA 4BE2A 4AYBN 2L54A 3QPTA 4QSHA 2AHQA 2E36A 3EQLF 5IYCJ 5LGTA 1OISA 1XD7A 4IHVA 3TDZC 2HU9A 3Q0VA 4I0AA 1POGA 4M73A 4EV0A 1WJ5A 2HOAA 3V7RA 3AL0B 2B63J 1F1ZA 3CCJI 1OJLA 1QVUA 5LFAA 1VQPI 1ZRCA 2VE9A 4V19K 1QQIA 2ELHA 3QP5A 4CYCB 4IXAA 2VC1A 2COMA 4U0YA 3ULQB 5BPIA 3JRAA 2FSWA 1DQUA 4ZJZA 5TISC 2OJED 1MBKA 3O6BB 3OS1A 1YX5A 2YSRA 3FF5A 2DODA 2E34A 1OCRH 1Z05A 2LD5A 1FTTA 1WI9A 4MFDA 1ETOA 3IKVA 2TCTA 5BMZA 5DUKA 4UHTA 4G8XA 3H9JA 2KFDA 3LFKA 4XLCA 2OU2A 2X4HA 4KIGA 4YIFA 4JBAA 4A3CJ 4KJZA 2NVQJ 2LF8A 4RB1A 5LBQA 3W6KB 5LRRA 2W7NA 2IGOA 1SMYF 4XLEA 3P5JA 3T0YA 2A69F 4O5VA 4FE7A 5EJCA 4WWCA 3AG2H 4PJ0C 4C3HJ 2ZJ2A 2DMUA 2ZJPF 2EILH 1TWHJ 4LMYA 1K7AA 1WFXA 4I09A 5FB2A 1D8JA 1I3QJ 3DPTA 4A3EJ 3FISA 1Y0NA 1Z9CA 1WGXA 1R49A 1U8RA 1Z3YA 3DKYA 4O6JA 5GAHJ 3J80K 4PGHA 5L3DA 3BY6A 1JKPC 1KYZA 2A05A 2V1DA 1QPIA 4RGXA 3JRFA 2CQNA 2EV5A 2FD5A 2AQEA 1XMAA 2VKDA 4YELA 1WH5A 1S6LA 4HNVA 3HJEA 1AHDP 1FIAA 2IA1A 2OQGA 3ABTA 4IHSA 2Y30A 3I53A 1QRYA 2XAQA 3K4JA 4IOAF 3JRBA 2XSDC 2NS0A 2VE8A 4XL9A 2GM4A 1MBGA 4XMYA 5FROA 3I4PA 4AIDA 3CDIA 4G6QA 2EFNA 4U88A 3VPRA 2HZTA 2LY1A 3FXRA 1MIJA 2BY2A 5HDNA 2K9MA 3K1NA 4I2OA 1HC8A 1SFOJ 5EGOB 2VBZA 1EA3A 3SXYA 3SYTA 2Q1ZB 3MKLA 3MVPA 3SHFA 4BKXA 1J09A 2VKHA 5JHUA 2ZBKA 4M3GA 3SZGA 3AFHA 4II2A 3WHCA 1U5TB 2L7ZA 3GTQJ 2DMPA 1ACIA 1TWGJ 2EB7A 3EYIA 4LB5A 1WJCA 3QYEA 1T0FA 3GBGA 3KZZA 5L3BA 3AAFA 3K2AA 1WVRA 2Q8KA 2E2HJ 1IV8A 5E17F 2JTVA 5JLXA 4E7ZA 4HV5A 1JKRC 4NHJA 2FUG2 1BI3A 4GO1A 4U87A 1ZGWA 4E7HA 1J0RA 1K78B 4XRSA 3S1RJ 2FMLA 2DMTA 1Z7LA 2VT3A 3LQQA 4IHXA 4CCJA 1HA8A 3BJAA 4F91B 3F22A 2D1VA 4FCYA 2EA4A 2VOPA 1YW8A 1ETVA 1TWAJ 2G7HA 3MKYB 1MMGA 5K5QA 2XKOA 2K40A 1ZR4A 1D1AA 3WTXC 3GZ6A 1O3RA 5C44J 2Y75A 4HYEA 1LKXA 4DBRA 3ZGKA 2YX4A 4C2UA 1T08B 4RGUA 3VODA 1UHWA 3MZ8A 3JRIA 2DA3A 4KT6A 4C2TA 2ELKA 3FXJA 4XLNF 3E6BA 4D5CA 3W6VA 4HQMA 2F5DA 1FPQA 4V2FA 3HOTA 1BBYA 5GAEJ 5JLWA 3OYFA 1FSEA 2VXZA 3HOWJ 1MGTA 3VEPA 3S3OA 3BG3A 2OD5A 3KE2A 5ERIA 1TBXA 4IQ4A 1T39A 1R9TJ 4G7HF 5GTHC 5J4VA 2F2EA 4RB0A 4ZYHA 4PJMA 4HG2A 1ZRFA 4KISA 2NYXA 2PG4A 2EPFA 2J5PA 2ZNYA 1XMKA 4ZTJA 1SD6A 3KZIC 1B72B 3GW2A 2R7WA 2RKHA 2H1KA 4BBSJ 2HTSA 1QO0D 2UV1A 3OYAA 2VPLA 4BGDA 3IH2A 3L2UA 2G7UA 5DEQA 3ESWB 4BEHB 2NVXJ 2KZVA 2F5VA 1MJBA 3Q9SA 3WU2C 4OIPF 2YS9A 3I4NJ 3K2ZA 3CC7I 4EGYA 3QOEA 4BHPA 4ZYDA 1SFXA 3X2QH 4DNCA 4Y17A 3VSKA 5F6FA 2HQ5A 2EFPA 1YRNB 2E2JJ 2QQ9A 2D1HA 2DJIA 2NVUB 2CU7A 4RLQA 2VT2A 1A04A 2AXLA 2WY8Q 3H35A 1HLVA 4ZDOA 1YFHA 4A5MA 2Y9YA 3PSIA 3ABMH 1ETYA 2OV7A 2JVHA 4LK1F 2HOSA 2STTA 3BR3A 4A2UA 2RNJA 4C9YA 1F4KA 2VIXA 3H3ZA 1X1AA 1GT0C 2DBBA 1H88C 1FOYA 4CDGA 2MH9A 2YR2A 1YJNI 2DDBA 1I1GA 3FHZA 1ETKA 3GCMA 1QZZA 3OYGA 4KN7X 1SD4A 5K7ZA 1VNDA 3CMMA 3E5XA 3BROA 3SZTA 1VQKI 3TGNA 4BJTA 1KGSA 1D0YA 2B9SA 3A0HC 1JKOC 3ERED 2M3AA 3VOEA 3S1QJ 5M5XJ 3BZCA 4UXNA 3CDLA 2Y69H 3B6AA 4KUMA 2E5NA 1IDZA 4L5EA 1FC3A 2GOMA 5TRDA 3PFIA 3GTPJ 2UWMA 3P9KA 1GUUA 1QHHD 4RAFA 2K85A 4B4CA 2VXDA 4BL0B 4BQQA 2IAIA 3OYJA 1NK2P 1IW7F 2COBA 3BDDA 1P9QC 3ZR8X 3I64A 1VQ6I 5BNGA 2VBWA 1LQ1A 2FBKA 3QPSA 4UVCA 4BQOA 3FXUA 2K5CA 2KDOA 5BS6A 2VL8A 3IRRA 5J1YA 1LNWA 3E1SA 2ECCA 3CO6C 1XPXA 2KMUA 4AD9A 3WHBA 4MO7A 3BC8A 1R1VA 3S15J 3JRHA 1FP2A 2C6YA 2GIZA 1BR4A 5FLVA 5C4JJ 5B3SH 1ULYA 5HNHA 3JSOA 1RKTA 3FXMA 1MNMC 1X3UA 2HNHA 1BA5A 3V8JA 1VQOI 2JMWA 1TP4A 4CZZA 3HTUA 3OL3A 2CV2A 3W2AA 4HRIA 3ZCOA 1P92A 4QLCU 3BR1A 1IG7A 3SQNA 1RC9A 3S1NJ 1HKQA 1FEXA 1E3PA 1FWZA 4Z2YA 1Y1VJ 2PLYA 3DTEA 2O8XA 1R1UA 3I58A 1B6AA 5D5UB 3HB9A 2M4KA 3BLYA 5J6XA 1HSJA 3CMYA 2LRDA 4RBOA 2P7CB 2HVSA 2Y2ZA 2JUGA 1J75A 4L9NA 1R71A 1XMXA 1ZGAA 2R7RA 2OPTA 1Y6IA 4PSWA 5F0FA 3IL2A 1K6YA 1S9HA 2KIQA 3K4BA 2JPBA 3CCLI 2ADUA 3MD2A 2EZLA 1FIPA 2VBYA 1VQNI 2WBMA 2A5YB 4IQJA 4A3MJ 2L01A 4LJZF 4EATA 1XDSA 2ZMEC 2BBYA 1IGNA 4U0VA 3QYFA 5FLXZ 1ETXA 2IA0A 2M9HA 4Y15A 3PQJA 3JRGA 2KHMA 1BJAA 3BG6A 5HVQC 5JHFA 3ZN1A 3OY9A 2CSOA 1I50J 3JCUC 1W4MA 1QPMA 2DA6A 2EIKH 3CCSI 2H09A 2A5WA 1DGRM 2M87A 4A3FJ 2HXIA 2ESHA 3DPLC 1XN7A 5AONA 4KITB 3ZPLA 3FMQA 2NS7A 5FD6A 4JQFA 3EPZA 3GFJA 4OAZA 1LB2A 3ZXSA 3J81Z 2XRLA 3CCMI 2ZCWA 2FOKA 2NRAC 4Q48A 3HM5A 2BY3A 3FBNB 2L9NA 4LITA 3FDYA 3K1PA 1ZRDA 4UUVA 3ASOH 4D7NA 3BCBA 3ZRGA 1RI7A 4HX7A 3S8PA 2GA2A 3JAMZ 5DCFA 5K5OA 3J7AY 4XRMA 4BDZA 4JYKA 5IOZA 2MW8A 4HSRA 4W1UA 3S3NA 2O9LA 3F6OA 5CVVA 3BR5A 3HSRA 1KA8A 2JSCA 3DCFA 3DTKA 1R36A 4ESJA 1YG2A 1FMVA 1H9TA 1YIOA 1S7AA 2XGEA 3M9AA 2VOOA 1KQ9A 1MZBA 1NG6A 5IY5H 2M7AA 4UUSA 2V9PA 2MD5A 3HGYA 5J3LA 3ISPA 5DM6F 2LH9A 3RSNA 3PL8A 4Q5SF 4XR6A 1N25A 2CRGA 5DCMA 1K61A 2R5ZB 2CGPA 5J8FA 1TZLA 4RB3C 4KIBA 4BNCA 2MABA 1FNNA 2K4BA 5CJ9A 3VYSB 1FOXA 1U9NA 3HOVJ 5TJJA 4B44A 4I99C 2W1OA 4XOPA 1HW5A 1X3ZB 2VN2A 1LFUP 4DQ2A 2X6WA 2OCEA 2LY2A 3HUGA 1G6NA 4AYBA 5J1UA 3KP2A 2VQLA 1WQ2A 1BR1A 1HQCA 4BDYA 3TW6A 2LK2A 2E1MB 1OYWA 3NRVA 4DGWB 3H0DA 4QTRA 3HEFA 1X4OA 4IVNA 2MGQA 4IHTA 1LEAA 3OS2A 2LR8A 4OU0A 4HZFA 3WTUC 2DMNA 3HKZN 2XDVA 2Z16A 2VJJA 4NC6A 2QKLB 4RAYA 5GPAA 2DDAA 5BOXA 2GXBA 2RQPA 2XF5A 5KAFC 4CCNA 3BG5A 4NC8A 3TMOA 2PJPA 4LGWA 1NTCA 1NHAA 3S1MJ 2JA7J 3I56I 2R5YA 3PO2J 4D5FA 3VYTB 1DP3A 2RGVA 2P8TA 1Y1WJ 3PNYA 2ELJA 1BI2A 3HOSA 1FJLA 3BR6A 1BOAA 1DGWY 3GTJJ 1BI1A 2ZC2A 1B8IA 2DXIA 4XM3A 2XF7A 3PNTA 4I6ZA 2X1CA 1X2NA 2MH2A 3MAJA 4ZZDA 2DJNA 4JX6A 3S3MA 2M8GX 3OR1C 1MH4A 5E8GA 2XUBA 4RAZA 4WK8F 1O3QA 1SFKA 3E0JB 2KIFA 2RVCA 2XB5A 3DTIA 4DYQA 4IF4A 4IRHA 4PZJA 1FP1D 1T95A 3QU6A 1TC3C 1EJ9A 5M3MJ 3OS0A 3FWEA 2F5EA 3SEZA 5HODA 3M4OJ 2XAGA 1TNSA 1JHFA 4AC0A 3CUOA 3I0TA 3L2CA 2R7DA 3IAS2 6PAXA 4L5IA 1EH8A 5F1JA 3B73A 3DQVC 2ME6A 1YJ9I 4M72A 5M3FJ 1X1PA 1Z1DA 3TP3A 3EUAA 1JE8A 1WWXA 4GGGA 4YEJA 5IP7J 1X2MA 4XRSG 1O7FA 2IT0A 2HDCA 2EJRA 1FY7A 2P5KA 3OV8A 1GVDA 2B0LA 5EF6A 1DU0A 1ZN2A 5FLXK 1YTYA 5HDKA 1JHHA 1SVMA 4BU2A 1MSEC 2DK5A 2ZFUA 3BQZA 3C7JA 3M1CA 5FD5A 4J00A 3BT9A 3DU6A 1V3FA 2N8GA 3HRSA 5FFZA 3FKIJ 5HNFA 2O5RA 1AWCA 4CH7A 4C3IJ 1TL8A 4GXOA 1IO2A 5F64A 2RV8A 3N4MA 3E5QA 1P6RA 3L7WA 1I1SA 3HOYJ 3PIPF 3LMMA 4B48A 5FKOA 3HDDA 2QQBA 3ZQLA 4ESBA 4CYDA 4C30A 1VF9A 2NNNA 5EEHA 3JSPA 4M6YA 3JAMK 2OBPA 3L9FA 1XSXA 2MSYA 5JVGF 3CUQC 3L2WA 3K9TA 3GX4X 2QBYA 3PO3J 3MMYB 4JK1X 2QA4I 1G3YA 4M3DA 3K7AJ 2QEXI 1JJ8C 4UVAA 5JVTA 2HR3A 2WV0A 1Z7UA 3GUDA 4HV6A 2H1LA 2EK5A 2LVSA 1ZG1A 2KDZA 3KYDB 1SC7A 1SEUA 4XRFA 2JZYA 2ETHA 2CYYA 1ZG5A 1YLFA 1S8NA 5F04A 2V9KA 4LG0B 1MKMA 2JN6A 4A0XA 3OSFA 3ZMSA 3OYEA 2ZFWA 3CP2A 1HXDA 5HLIA 2FBIA 2DLLA 2FQ4A 2LDUA 3HXLA 1H0MA 3VYUB 2P81A 2LP0A 3VB2A 1G8XA 3LL7A 2F48A 3LAPA 2Y48A 1LDJA 4PJNA 4MGRA 3H92A 2MC4A 2KPMA 3JRCA 3RIRA 4MEXF 3U9GA 2LBFA 1VQ5I 3GTKJ 2Y9ZA 1IRXA 3KP5A 4ESFA 3WGIA 3BZ6A 4LOCA 5ED4A 1UJ8A 4XOTA 3TOBA 2DYSH 4GRIA 2K02A 1ON2A 3CO7C 5LHGA 4MNUA 3HYIA 2IA2A 2E7XA 2BZTA 1AOYA 5E20A 2WV1A 2DYRH 2EIMH 4DZPA 3LSHA 2M30A 1DPUA 2BOLA 3CLOA 3OYCA 4H0EA 3TL4X 2XPWA 4HAMA 1E0EA 3HOZJ 1YI2I 3U21A 2BYVE 4E7KA 4DYRA 1PUEE 4LLNA 3AL0C 1ZTRA 3F8FA 4Q4ZF 1H8AC 2NS8A 5D6FA 1YO5C 5BPDA 1VQ7I 1UMQA 2R7VA 2ID6A 3WTTC 3DV8A 3KX2A 4L0ZB 4AM3A 4F3QA 4UUSB 1DUXC 3ABKH 4FETA 4HPQA 4E4HA 1QBJA 1D1BA 4EEFG 3F8NA 2HXOA 3Q9VA 4IPAA 2Y0SA 3OR2C 4J01A 2J5OA 1P7IA 2X51A 5DCMB 1XC5A 2CV0A 2H6CA 3WTZA 2Q2EA 4BY1J 2ZMEA 3RZDJ 4FISA 2LKXA 5B5EC 5CVIA 2I5UA 1KYWA 3HC7A 3IWFA 1I6HJ 3BG9A 4S0HB 4ZYAA 4CCOA 2VC0A 3QPLA 3MZYA 2A68F 2L9SA 2QLZA 3RJPA 4A3IJ 2WTEA 2AO9A 3KEOA 3FK7A 2X1EA 3F8MA 3BTCA 3HUGB 1V5FA 3A03A 1QZEA 5K7HA 2CWEA 2VJ4A 1WPKA 2M0MA 1FT9A 2CW8A 2R7SA 4IRIA 2E60A 1S7OA 4KDPA 1ZH5A 2Z2SB 3F6VA 1SFEA 2H6BA 2IBDA 2IVMA 4E7JA 2MFZA 2CS3A 3F8CA 2W24A 3KP7A 3OYKA 1WJFA 4P96A 3CCQI 4EM0B 4WF2A 5DUIA 3B02A 1RETA 3PM1A 4CHUA 1ZHFA 1PP7U 4LLLA 2X48A 3ZMTA 1KQ8A 2LYCA 5KHDA 1OR7A 5IYBJ 3KIOA 1K4TA 2IP2A 2KKOA 2Z99A 4MTEA 4KFCA 2HS5A 3LA3A 5J47A 4IOCF 4ZYGA 2YX7A 2CJJA 2LFBA 4XICA 3GZ5A 3F72A 2P7VB 1YE9A 1OYYA 2PEXA 5IT9Z 1LE8A 2DI3A 1P2FA 3J7YJ 5K7FA 1B8IB 2QWWA 5B1AH 1T98A 2OZUA 3HRUA 4R79A 2ACJA 1VQ8I 2HTJA 2IGMA 5AIPA 1MDMA 1KU3A 5EEAA 3PNVA 1FZPB 2DA1A 3BR0A 2LSOA 4UV9A 4DBQA 1JI8A 2O6GE 1VQ9I 1BR2A 3FXLA 2AS5F 1CF7A 5JR3A 1PUFA 3CDHA 3JREA 1JGGA 3G1MA 2LTPA 1Y0UA 5H6RA 2R92J 5C3EJ 5B66C 3GFMA 2MLGA 1U5TC 3A02A 4EM1A 3WTVC 4EGZA 5CQGA 4M9ZA 2DOEA 2ME0A 4TV7A 3K70C 1VQLI 4M3BA 2M1BA 4RS8A 3TDUC 2IS4A 3V7CA 4ZYEA 4I01A 1TNTA 1YW9A 2HKXA 2DFHA 2K9SA 4AIKA 3Q0UA 2JVGA 3KP3A 1ZG3A 5E3NA 1LVAA 3ZQQA 1IN7A 3HHGA 5D8KB 2IEKA 1AA7A 5DS9A 1T56A 1UHMA 1GHCA 5HLHA 3ZMDA 1SVLA 5KAIC 3CCVI 3L00A 3FM3A 4A69C 2ZXWH 4ABZA 2F5CA 3OYMA 1M1EB 3PFYA 1CGPA 3TEDA 3GF2A 3C1DA 3ZQ7A 5A2QZ 5BQTA 5GPCA 1FBUA 1RZ4A 2FF4A 3H36A 1XX5A 4G7ZF 2HVRA 5KCMA 4P55A 4K2EA 2QSGX 3TO7A 4HW0A 3IH4A 4MLOA 2L9VA 1ZK8A 2Y0SN 2P4WA 1Q1VA 2IRFG 2WY7Q 4WXHA 5EDNA 1WCMJ 1YX3A 1UG0A 2W85A 1ZELA 2UZKA 5D6EA 3RQIA 5FKMA 1H89C 1IAWA 4HSTA 3TO9A 4LB6B 1K83J 3O3KA 1OQYA 4EJVA 2EIJH 3K0LA 2EBIA 2MC3A 2QYOA 1HBXG 4EMSA 2EFWA 1D8KA 2P6SA 1Y8QB 1IRGA 2XC7A 4A3DJ 2LNBA 3CJQB 4MFEA 2QBYB 2P0WA 2FA5A 2FNPA 2DU9A 4U0WA 3CCEI 1JTXA 3GLLA 2K7LA 3H3UA 3HTSB 2WWYA 3R6SA 3CMEI 3RCOA 1I6XA 2XHKA 1KU9A 2IPQX 1RRJA 3KPHA 1PP8F 1APLC 1RIOH 2KP6A 3NWTA 2QF7A 4XN0A 1VFCA 1ERDA 5CQEA 2M34A 3LSJA 3P9IA 1GXQA 2RAEA 2DMQA 3K4CA 3WG7H 4AVPA 3GYHX 3G73A 1UAAA 1LUJB 2O03A 1Y39A 2ZSIB 3G1OA 5E1ZB 2XASA 2IS6A 3H9GA 2KISA 3IC7A 2LBFB 1PVEA 3RYRA 4GCVA 2E5ZA 3PSFA 3O8GA 4RB2C 1IN5A 2QM3A 5ILVA 1Z77A 3S32A 2GXGA 2IW5A 5IYDJ 3E97A 3QP6A 3BQYA 3RKYA 4C2MJ 2B7EA 1OCTC 3NAUA 3W3CA 2QSFX 3J7ZI 4UV8A 4EVIA 1W5TA 3LNQA 2R93J 4F93B 2K86A 1TT5B 4BHCA 3MFKA 4IJAA 3BR2A 2ZO4A 1MBEA 3FXOA 2PMUA 3Q3SA 1X1CA 5C4XJ 4M71A 1DDNA 3T8TA 3CF5F 4X6AJ 3HKZA 1K6OA 2JA2A 3EETA 2I10A 5E1XA 1NK3P 3U1DA 3QU3A 2DFEA 5IT9K 1V4RA 3MWMA 1TQMA 3REOA 5JI6A 2Q2EB 2W84A 2ZMEB 4A6DA 2DO7A 1QGPA 2KLOA 3GMEA 3I59A 3LAJA 4Y13A 3KP6A 3MZHA 4RGSA 3DU5A 1GXPA 2CW7A 2JRMA 1GV2A 1LJ9A 3HGGA 1FYMA 2P6TA 4KN4X 5TGTA 1JT6A 2AQFA 2E35A 3G1LA 1J7KA 3JW4A 1G3SA 2EZKA 4W97A 2FOWA 4Y52J 2ZXIA 1SANA 2JPCA 1HKTA 3S2WA 4HBLA 1USTA 4XKBA 2DAOA 3ZQGA 1HW2A 1OFCX 4DW6A 3HZJA 3ABLH 4WX9A 1BN5A 1Z6RA 2W48A 3E6DA 1IDYA 3OYHA 3CCYA 4BJ6C 3R0JA 2FJ1A 1L0OC 3E5UA 2R4GA 2GA1A 4N9IA 3PQKA 2X6OA 1WJDA 3M8JA 4AIHA 2FX0A 3F21A 5L3GA 4HF1A 1XCBA 3K4NA 4CYCA 3HG9A 2XAUA 1VI0A 5GP9A 5KVRA 4A3GJ 1ZKGA 5A2QK 3S16J 4I02A 2I8DA 1KU7A 3IAM2 2DA5A 3MEXA 3KEQA 2JQ7A 3A4CA 3FIWA 1FOWA 1JGSA 3V7SA 3RPUA 1LE8B 1IN6A 4A6EA 2K3PA 3DBHB 2CO5A 1KONA 5F0HA 5J8CA 3CCRI 2VQCA 4YFKF 3O8HA 2XGCA 4A3JJ 2XAHA 3OIQA 1PYVA 3AG1H 1Z6TA 1F36A 3VYRB 1CQTA 4X1EA 2DW4A 3ZMZA 1CF7B 4Z6YA 1PUFB 2Y0MA 4PFPA 2A61A 1OCCH 1S72I 1JUPA 1MNEA 2P5LC 3K4MA 2G0EA 2MYSA 3GO5A 4C3JJ 4U7DA 4BBRJ 1K4SA 3ZN0A 2OC6A 3GXOA 4II3A 4L0YB 2V79A 4NBQA 2E2IJ 4G12A 3HHHA 4CO8A 2KRCA 2VPRA 4ENNA 1IXSB 2VB6A 1YJWI 2P5VA 5LGNA 3BP8A 4LK0F 2VUMJ 4BE1A 3W2VA 3IH3A 2FNAA 1V54H 2HYJA 2EA2A 1LDKB 4FTHA 2HWVA 2IXSA 1MMDA 2KL4A 4D1QA 3JTGA 4AWXB 1GLNA 4FT8A 5DD8A 3VFZA 4J19A 2HQNA 2XKPA 4OIQF 2EZIA 3WU1B 4GFBA 2V6CA 4BAYA 4HLXA 3V8KA 5KNLA 1R4MB 4BJ5C 4Y3OA 4BQAA 3WODF 3H5AA 4BXUA 2VI6A 5HS9A 2GIVA 3QRFF 1R6RA 2M8EA 3DEUA 4E70A 4ZH4F 3QQAA 3Q5FA 1ON1A 2DFIA 3JR9A 1EV7A 3CLQA 3CP8A 4N4OB 1N75A 1BL0A 1W0TA 2R3SA 2HPMA 3OWTA 4NNJA 2ZKZA 4E7SA 1G3WA 4MQVA 3K1MA 4IX7A 2XRNA 4P5OA 1DPRA 4M9XA 1W5SA 1A6IA 3R4KA 2V1NA 4B3XA 1USSA 2V26A 1E17A 3WGGA 4R8HA 4L9VA 3LSRA 3E3VA 3KLNA 5EGOA 1J2XA 1ORKA 3OMYA 4A0YA 4QIWN 2XROA 4CA0A 2DOAA 2XAJA 4G6TB 3PIOF 2IS1A 1U5TA 2HVQA 3C18A 2HQAA 2L02A 3GLXA 4LFUA 1T2KA 5FKNA 1Y56A 2W25A 4XKWA 3SDGA 4KA4A 1YITI 2BW3A 1NH3A 2JJ7A 2HI3A 3CJNA 1MBFA 4PGGA 3LOCA 2DQLA 2WAFA 3CESA 3KFWX 3OOPA 1C0WA 2QVOA 3SDBA 1X1BA 2E1MC 3H3VK 3K10A 3OL4A 1ENHA 3UR3C 2ICWG 5IPAA 3KEYA 5DDGA 4FX4A 4KICA 2KZGA 4LIUA 2Y31A 5H20A 2CMPA 2YU9J 1ETQA 4IKFA 5LLQA 3QOPA 3QAHA 4CZCA 1PJRA 1U8BA 4FE4A 3G4SI 4B1RA 3HIFA 1B9MA 3OYBA 2BY1A 2DK8A 3DWLE 3C2GA 3SEQA 1R4NB 3WTYC 4YFNF 5L3FA 4BY7J 3DBLB 3F3XA 4GDFA 1B59A 3RDIA 3HL2A 2R0QC 4ENJA 2F4IA 5CPRB 3WE2A 4G94A 1TWFJ 2OUMA 3K4LA 3GTMJ 4G6DA 4HNTA 3FX3A 2CH0A 3FXQA 4NQWA 2VLAA 1R5ID 3HPGA 5H2FC 1E3OC 5M5YJ 1W5CC 2RQQA 4XONA 3VWBA 3BG7A 4L5JA 5FRNA 2BV6A 1U2WA 2R7OA 2KIMA 1I39A 4XLHA 5LHIA 3A01A 4RM2A 5LEJA 2RN7A 1FYLA 1S5LC 3I9V2 3L09A 3EUKL 3KP4A 3M7GA 3BWGA 2OQRA 1R1TA 4B47A 2DA7A 3J81K 4OWRB 5J4YA 1SD7A 3PUBA 2LOOA 2HGCA 4DIQA 4ZDPA 1OCPA 1RR7A 4XQFA 5GADJ 3HPHA 5ICGA 2A3SA 3UKGA 1TWCJ 2WAQA 1BM9A 3ECHA 4PJJA 5HDGA 2X6XA 2R7ZJ 1SAUA 2ECBA 4UB8C 4BS9A 3I59B 2ESNA 2D45A 4HOBA 3ROUA 5IT3A 4E7IA 2D5VA 3A1YA 2DT5A 3I3LA 4F52A 2NOGA 2L9RA 1YS6A 1IRZA 2L7FP 4NC7A 2FMYA 3RZOJ 3HSFA 4YIIA 2LF7A 2NVTJ 5CVJA 2HYGD 5ICCA 1G3TA 4D0PA 1XTAA 5HS7A 1J9IA 2F6CA 2M2EA 3HRTA 3QYBA 1N78A 1P4XA 2ZJRF 2CQKA 4AU7A 1XS9A 3SZPA 1YQAA 3FM5A 3RKQA 1WJBA 3S2HJ 2CG4A 2X1DA 3FMRA 1X58A 3T5XA 1T38A 2LG4A 2XPUA 2FBHA 3LA2A 1H9GA 2R7TA 1R5HA 1MBJA 1UFMA 2DTRA 1IN4A 2O0YA 4YRVA 3LSKA 4OIOF 5IOYA 4RLFA 4HF2A 2EZHA 1D5VA 3LSTA 1TQIA 5B1BH 3H0GJ 4KMUX 3CTAA 3AG4H 3QPHA 2ISYA 3M8FA 9ANTA 2DA4A 2PJRA 1WHUA 2GWRA 2PMHA 4RA2A 4F55A 2F4MB 5FLMJ 3CJRB 3M8EA 4LIVA 1D3YA 1U6GA 4WCGA 2NAZA 4S04A 5F08A 1DU6A 5ICEA 2V9VA 4RM3A 4R1HA 5D8LB 1XGNA 2RDPA 1XDUA 5L3CA 4EJUA 2FE3A 3L2RA 1XSDA 1RUNA 1UB9A 2BGCA 4IRGA 3U1KA 4EJOA 3ZQCA 3RKWA 2JRTA 3BPXA 3S14J 2MG4A 3VSLA 1FBQA 2HKOA 3LWFA 2VODA 4MHGA 4DZJA 2XVCA 1Q1HA 3ZMUA 4LD5A 5E8IA 1SAXA 1Z21A 5EZHA 1VQ4I 3B6CA 1FSHA 3ZMVA 3RPQA 4XN3A 3OOUA 5DV5A 4EJTA 3I54A 1W36D 2KT0A 4HQEA 4CGZA 2HQRA 2WA0A 2NXNB 1Z3XA 3G71I 4QWQA 2IS2A 3ZQIA 1BIBA 4ZZLA 2CUJA 5E3LA 1U78A 2IGKA 5D4SA 4MEYF 5D5VB 1ITYA 5FO5A 4F92B 1W7PA 3S93A 1B1BA 2QCOA 5HS8A 4HA8A 4ETSA 4G9YA 2WADA 3HOXJ 1IV6A 2L5QA 3R60A 4XLFA 3IUOA 2CQXA 1LVKA 2HEOA 3V42A 3GFLA 5F27A 1UG2A 2QKMB 4DOZA 2VJIA 2O61A 2XV4S 3F23A 1VQMI 2FQ3A 1ETWA 1XGMA 2EV6A 3RTRA 2L3DA 3ZOBA 1VZ0A 2OA4A 2WAQN 1IN8A 3IWZA 2K27A 4OOIA 3CC2I 3ML6A 2XPVA 4WXCA 5CLSA 2R5YB 1E2XA 4WXDA 4IHWA 1HDDC 1K79A 3T1BA 3V4GA 2IGNA 1XGOA 2GBYA 1ZYRF 2JA6J 2A6TA 3DLAA 1XB4A 2X0LA 2XF6A 5ICFA 1ZGJA 3KETA 4EQQA 3KYLA 3C2BA 1LEBA 2A6HF 2BW3B 1IUYA 4BH9A 4G7OF 4B8XA 3VDXA 3L1PA 1G4DA 5LEKA 2PI0A 1RKWA 4KT5C 4JP0A 5F0CA 2F4OB 3DF8A 5EYRA 2JA5J 1QZYA 5J1RA 1U0JA 3LQRA 3EUHC 3R61A 4UVBA 3G2BA 2JUCA 1YYVA 3CQZJ 3MCZA 3BCAA 4CXFA 3S2DJ 4A93J 2JWTA 3FXKA 2E1OA 1R00A 2HYFA 2R7UA 2FXAA 4L9TA 4BACA 3QWLA 2H8WA 3ZQFA 3MN2A 3IRQA 3OYDA 2LMDA 4XLAA 4UNOA 3FMSA 4PUSA 2DTZA 2X6YA 4HEA2 3D5SC 2QENA 4N9HA 4XLPF 2XAFA 5HLGA 2L4AA 1X1DA 2DT6A 4M3EA 3E6MA 3GTGJ 1ONVA 3U2RA 1MMSA 2K4JA 5K1YA 1R23A 3DBRB 4L18B 1BIAA 3SFIA 1TW2A 1STZA 2E19A 4M74A 2EINH 3TW7A 3HBLA 4XKCA 1PDNC 3D0SA 3OYNA 3PJRA 4PCQA 1KU2A 2GQQA 2IJLA 2CQ7A 4JX4A 5LHHA 5D5WB 2NNYA 2LKPA 4CICA 4NQWB 2R5ZA 1KZHA 1EH6A 4KNYA 4HNUA 1B9NA 4DYCA 2GOXB 2MBFA 2YUSA 2R7FA 4XNFA 5IP6A 2ZJQF 1MMNA 2VQHA 5JFRA 3SFZA 1JJ6C 1R22A 3RYPA 1WKMA 3P9CA 1J5YA 1MJAA 3DKWA 4JOMA 5FFXA 3D1NI 4A3BJ 5FKKA 3A01B 3JRDA 4KIFA 3P7NA 1RNLA 1J59A 3NQOA 3FZVA 1EKEA 4FQGA 3WU0A 3IKTA 4HDUA 2RC4A 2W4SA 4MTDA 4XSZF 2YU3A 1I3AA 3KYCB 2DFFA 4EM2A 3LSGA 5E3OA 1F5TA 3F0CA 4HDVA 2DT7B 2O7OA 4PDKA 1NG7A 5GTIC 1JTYA 3IV5A 1IC8A 3WTWC 5DD4A 1WRJA 2WC2A 4I76A 4A0ZA 3TKYA 1I27A 4B43A 1OLTA 2EFOA 1KQ0A 2W57A 3L2QA 3O2PE 1OCOH 2EV0A 1RPWA 1JUSA 2VQGA 2ZXHA 4Y4RA 3W6JB 2M4GA 4A12A 3K6GA 1BJZA 1JT0A 2ZB9A 4KYWA 2E7WA 3CCUI 2QUFA 1LFBA 3ZP5A 4OMYA 2JT1A 1YOVB 3LSIA 3F8BA 2EQRA 1ZQ3P 3EYYA 2PN6A 2BEOA 5EG0A 1BC7C 3WGHA 3NARA 4PFOA 1ZARA 1QNTA 2L2OA 2PMZA 2UXXA 3CMAI 2VJ5A 2M0CA 3IHUA 2KQRA 4P1WA 4YG2F 5DM7F 1ZR2A 2ID3A 1UZCA 1P4WA 2RREA 4I98B 3W2WA 1FOKA 4Q47A 3V8LA 3DPUA 2E1NA 4IZZA 3G6EI 4Y7NJ 2OF7A 1FX7A 2L7MP 1TLHB 2DOFA 2QSHX 2GXAA 2F5FA 3BJOA 1FTZA 3BJ6A 2DPDA 5LGUA 3OIOA 3TQNA 4ENMA 5CVUA 2XSJC 2QGUA 4D9JA 5EEGA 1OCZH 1HCRA 2PJRB 5HLTA 2MLKA 4XK4A 4JX5A 2M5WA 4I7HA 5GAGJ 3BTJA 4NDLA 2HDWA 2NOJB 2K9NA 5M5WJ 3WTSC 2ISZA 1S29A 2ZXJA 3DEEA 3RPUD 1AKHA 4B3AA 1N77A 1ZAOA 3CUQA 2DN0A 4F7ZA 2O8KA 3L2VA 1RR8C 2A07F 1JUMA 3HRMA 3CC4I 3ELKA 1HSTA 1YHQI 3K69A 2MA3A 3JTHA 5EZGA 1FLIA 1U3EM 2M45A 3HSEA 4N0BA 1W1WE 4AVZA 4ITVA 4DJAA 4Y33A 2KJBA 2STWA 2X85A 2Z1DA 3ECOA 1UCRA 3CF2A 2YPRA 1IXRC 2EFQA 4CUGA 1RESA 5FJ8J 1I5ZA 2A6EF 4PSXA 1MNDA 2VKEA 2CW0F 2WAEA 1VTNC 1JKQC 1A36A 4AUXA 3GEZA 1EF4A 5J40A 3DKXA 1WSUA 4O3MA 1BW6A 4LG3A 2LREA 4A5NA 5L3EA 5LRSA 1W7PB 2HZDA 1MSFC 2HDDA 2FU4A 1UHSA 5LD2C 2LKSA 2GAUA 4ZC3A 2OTJI 4QPOA 2KRHA 1FBSA 1FMWA 2Z9OA 3LA7A 2PBIA 3S17J 4BXXJ 2LLKA 1S7EA 1O57A 1GVJA 1O7LA 3K4KA 2CFOA 3GWZA 2XIGA 3A0BC 4CCLA 4YIRX 2O3FA 3LSMA 2CUZA 2FRHA 2GZWA 3KLOA 5KK1A 3FK6A 4FASD 1IJWC 2HOEA 3HOUJ 2FEZA 3GTLJ 2H94A 3GVAA 4XSXF 1LPQA 4LG0A 4BHBA 4BUPA 4U7BA 2CFXA 1F9NA 4M9SA 4UY8I 3RKXA 2UXNA 2V1UA 1IZ1A 4HLYA 4KMFA 3TOAA 1RUOA 3OYLA 3I55I 2V4JC 1WI3A 2BVLA 4XKVA 3SJMA 2DA2A 1QU3A 3CZ6A 3GTOJ 4XORA 2QZ8A 1XSVA 5CVRA 3CJTB 3LSPA 5FKLA 3K70D 1B4AA 3KCCA 1F43A 3PUFA 2W82A 2VKVA 3ASNH 1HW1A 1MDMB 2PMZN 1MW7A 1DP7P 3I71A 2V1XA 2XGXA 4D7MA 4H4KC 2G9WA 1A31A 2Z3YA 1T8IA 1L3LA 2KJCA 1P7JA 3UNGC 4N4NB 4IO9F 4LLGF 4S05A 1OMIA 1Z67A 1ODDA 1WH7A 1IRFA 2QQAA 4YFXF 2QQ8A 2LY9A 3DEWA 5CKTA 1T0FC 3IP4B 4FX0A 3C2HA 1D5YA 1Z0XA 4L9JA 2K9QA 2K3FA 5HOOA 2HOTA 2BXZA 2OZ6A 4M6VA 3MKWB 2H27A 5FGMA 2DCEA 1OR7C 1TTYA 2EH3A 2HPIA 3I5UA 2JSPA 2L0KA 5E18F 3DFGA 3E7LA 2RNGA 1SVOA 1V5EA 1ZLJA 4M3FA 1U9OA 2TDXA 1SMTA 5D5XB 1GV5A 3BZKA 4I0BA 4A3LJ 4ON0A 1V5GA 3RQ4A 3WG9A 3TP0A 3H5RA 2CUFA 4BE0A 3OIPA 1O3TA 2BE5F 4ZTFA 1HOMA 1ZREA 1G2HA 2BXYA 2R7QA 1Y8RB 3OSGA 3J7AO 1TQPA 3FKJA 3NEUA 1O3SA 1E3HA 2VBXA 1XCVA 2WB1A 1T6SA 3KZYA 2K9LA 1QHGA 3BPVA 2EWNA 3FBIB 1A5JA 4CCKA 4A3KJ 1S3JA 1T33A 3EUHA 1TT0A 2V6EA 1IUFA 1UELB 4B09A 1W36C 2CV1A 3TBIA 4UUTA 3AG3H 1SD5A 1QA6A 2ZSHB 3R0AA 2BHZA 2D2WA 2GLOA 1XG1A 3N05A 3NWSA 1BW5A 1D0ZA 2AXTC 4GYGA 2XB0X 3CD6I 3M3YJ 1LFPA 4RMNA 1IXCA 2KIUA 5IP9J 4ENKA 3H1CA 2W00A 1ZLKA 5E79C 3AKZA 1YW7A 2JK3A 2M7BA 3D5RC 4MQ9F 3M07A 4QPQA 1TW3A 3T8RA 3A2KA 2PFBA 1MD0A 1XGSA 2OAZA 2Z33A 1X3WB 2E71A 2LC2A 3WE3A 2NVYJ 2CUEA 3DXJF 1K78A 2V7FA 3LFUA 5EG0B 1MH3A 4X0GA 3M1EA 1AU7A 3EDPA 4PK4A 1EH7A 2BY0A 1P4AA 2L7KA 3D5LA 3Q0WA 4OMZA 1WZ2A 3J80Z 5D4RA 2BHYA 1OKRA 4XBFA 1YS7A 4CCMA 4RDUA 3E6CC 4OAYA 3BTLA 2ZNZA 1V55H 1X19A 4RAGA 5K5RA 4HF0A 3ONQA 3GFIA 1GDTA 3DP7A 2DPUA 4ZDLA 1R7JA 3ABUA 4E7LA 4P9UA 3G3ZA 4HX8A 2CQQA 3H5NA 3DLLF 3RI4A 1FYKA 1SFUA 2TRTA 4OIRF 1WJEA 4NB5A 3TO6A 2JA8J 1IF1A 4CSWA 1HKSA 4GYIA 4IHYA 5AIQA 5H6QA 1BI0A 4PJLA 3OYIA 2X9DA 1MMAA 1WJAA 4HX4A 4RGRA 1A6QA 1MJ9A 4ANJA 2KRFA 4P9FA 3BOQA 3QODA 2H8RA 1MBHA 1W0UA 1AKHB 5FRMA 3CUQB 4OINF 3COAC 4BYYA 3ZQHA 4E6KG 2R7XA 2Q0OA 3ERMA 1X4PA 3FHNA 3GZNB 2E1CA 2XGDA 4IL6C 2BVMA 4AIJA 5E3MA 1B72A 1HDPA 2Z5UA 1YIJI 4V2GA 1D0XA
chains in the Genus database with same CATH topology
1LDDA 2PQ8A 4FHTA 5DYMA 2DQRA 1OPCA 4ASNA 1OYIA 1R5GA 1REPC 4M6XA 3N97A 5CYVA 4EJWA 5E1WA 2HFHA 1Z91A 5F1RA 1JXSA 2VONA 5ILSA 2L4MA 5ILUA 1BC8C 1R58A 3C3WA 1W7PD 3MQ0A 2L54A 3QPTA 3EQLF 5LGTA 1XD7A 3TDZC 4I0AA 4M73A 4EV0A 3V7RA 1F1ZA 1ZRCA 2VE9A 1QQIA 2ELHA 3QP5A 4IXAA 2VC1A 2COMA 4U0YA 3ULQB 5BPIA 2FSWA 3O6BB 2YSRA 3FF5A 1Z05A 1WI9A 3IKVA 5BMZA 5DUKA 4UHTA 4G8XA 3LFKA 2OU2A 2X4HA 4KIGA 4YIFA 4JBAA 2LF8A 4RB1A 5LBQA 3W6KB 5LRRA 1SMYF 3T0YA 2A69F 4O5VA 4WWCA 2ZJ2A 4LMYA 1K7AA 4I09A 5FB2A 1D8JA 3DPTA 1Z9CA 1U8RA 4O6JA 3J80K 4PGHA 5L3DA 3BY6A 1KYZA 2V1DA 4RGXA 2EV5A 1XMAA 1S6LA 4IHSA 2OQGA 2IA1A 3ABTA 3I53A 2XAQA 2NS0A 2VE8A 3I4PA 4G6QA 2EFNA 4U88A 2HZTA 3FXRA 5HDNA 3K1NA 4I2OA 2VBZA 3SXYA 3SHFA 5JHUA 2ZBKA 1U5TB 2EB7A 3EYIA 4LB5A 1T0FA 3KZZA 5L3BA 3AAFA 2Q8KA 5E17F 2JTVA 4HV5A 4NHJA 1BI3A 4GO1A 1J0RA 1K78B 2FMLA 2VT3A 3LQQA 3BJAA 3F22A 2D1VA 2EA4A 2VOPA 1YW8A 2G7HA 5K5QA 2XKOA 3WTXC 3GZ6A 1O3RA 2Y75A 4HYEA 2YX4A 4RGUA 3VODA 1UHWA 4XLNF 3E6BA 4HQMA 3HOTA 1FPQA 2F5DA 1BBYA 1FSEA 2VXZA 1MGTA 3VEPA 5ERIA 2OD5A 3KE2A 1T39A 1TBXA 4G7HF 2F2EA 4RB0A 4ZYHA 1ZRFA 2NYXA 2PG4A 2J5PA 2ZNYA 1XMKA 1SD6A 3GW2A 2RKHA 2HTSA 1QO0D 2G7UA 5DEQA 1MJBA 3Q9SA 4OIPF 3K2ZA 4EGYA 4BHPA 4ZYDA 1SFXA 4DNCA 4Y17A 5F6FA 2EFPA 2QQ9A 2D1HA 2VT2A 1A04A 2AXLA 1YFHA 4A5MA 4LK1F 2STTA 4A2UA 2RNJA 1F4KA 3H3ZA 2DBBA 4CDGA 2MH9A 2YR2A 1I1GA 3FHZA 1QZZA 4KN7X 1SD4A 3E5XA 3BROA 3SZTA 3TGNA 1KGSA 3ERED 3VOEA 4UXNA 4KUMA 5TRDA 1FC3A 2UWMA 3PFIA 3P9KA 1IW7F 3BDDA 3I64A 2VBWA 1LQ1A 2FBKA 4UVCA 3FXUA 5BS6A 3IRRA 1LNWA 3CO6C 4AD9A 1R1VA 1FP2A 2C6YA 3JSOA 1ULYA 1X3UA 3V8JA 4CZZA 3HTUA 1P92A 4QLCU 3SQNA 1HKQA 1FWZA 4Z2YA 2PLYA 2O8XA 1R1UA 3I58A 1B6AA 5D5UB 5J6XA 1HSJA 2P7CB 1J75A 4L9NA 1ZGAA 3IL2A 2JPBA 2ADUA 2VBYA 2A5YB 2L01A 4LJZF 1XDSA 2BBYA 4U0VA 5FLXZ 2IA0A 4Y15A 3PQJA 1BJAA 5HVQC 3ZN1A 2CSOA 1W4MA 1QPMA 2H09A 2M87A 2ESHA 3DPLC 1XN7A 5AONA 3ZPLA 3FMQA 5FD6A 4JQFA 3GFJA 1LB2A 3J81Z 2ZCWA 2FOKA 2NRAC 4Q48A 4UUVA 3K1PA 1ZRDA 1RI7A 4HX7A 2GA2A 3JAMZ 5DCFA 5K5OA 5CVVA 3F6OA 3HSRA 1KA8A 2JSCA 1R36A 4ESJA 1YG2A 1H9TA 1YIOA 1S7AA 3M9AA 2VOOA 1KQ9A 1MZBA 2MD5A 3ISPA 4Q5SF 5DCMA 2CGPA 5J8FA 4RB3C 4KIBA 4BNCA 1FNNA 2K4BA 5CJ9A 5TJJA 1HW5A 2VN2A 4DQ2A 3HUGA 1G6NA 3KP2A 1WQ2A 1HQCA 1OYWA 3NRVA 4IVNA 4IHTA 1LEAA 4OU0A 4HZFA 3WTUC 4RAYA 5BOXA 2GXBA 2RQPA 2PJPA 4LGWA 1NHAA 2RGVA 2P8TA 1BI2A 3HOSA 1BOAA 1BI1A 2MH2A 3MAJA 4ZZDA 5E8GA 2XUBA 4RAZA 4WK8F 1O3QA 2KIFA 2RVCA 4IF4A 4IRHA 4PZJA 1FP1D 3QU6A 3FWEA 2F5EA 2XAGA 1TNSA 1JHFA 3L2CA 3CUOA 3I0TA 2R7DA 6PAXA 4L5IA 1EH8A 3B73A 3DQVC 4M72A 1Z1DA 1JE8A 1WWXA 4GGGA 1O7FA 2IT0A 2HDCA 2EJRA 1FY7A 2P5KA 3OV8A 2B0LA 1ZN2A 5FLXK 1YTYA 5HDKA 1JHHA 2DK5A 3C7JA 5FD5A 1V3FA 3HRSA 5FFZA 1AWCA 4GXOA 5F64A 2RV8A 3N4MA 3E5QA 1P6RA 3L7WA 1I1SA 2QQBA 4ESBA 4CYDA 2NNNA 5EEHA 3JSPA 4M6YA 3JAMK 2OBPA 3L9FA 1XSXA 3CUQC 3GX4X 3K9TA 2QBYA 4JK1X 1G3YA 4UVAA 5JVTA 2HR3A 2WV0A 1Z7UA 3GUDA 4HV6A 2EK5A 1ZG1A 4XRFA 2JZYA 2ETHA 2CYYA 1ZG5A 1YLFA 1S8NA 4LG0B 1MKMA 4A0XA 3ZMSA 2ZFWA 1HXDA 5HLIA 2FBIA 2DLLA 2LDUA 1H0MA 3VB2A 3LAPA 2Y48A 1LDJA 4MGRA 3H92A 3RIRA 4MEXF 3U9GA 3KP5A 4ESFA 3WGIA 3BZ6A 5ED4A 3TOBA 2K02A 1ON2A 3CO7C 5LHGA 4MNUA 3HYIA 2IA2A 2E7XA 1AOYA 5E20A 1DPUA 2M30A 3CLOA 4H0EA 4HAMA 2BYVE 1PUEE 4LLNA 3F8FA 4Q4ZF 5D6FA 1YO5C 5BPDA 3WTTC 4L0ZB 3DV8A 1DUXC 1QBJA 3F8NA 3Q9VA 4IPAA 2J5OA 5DCMB 2H6CA 3WTZA 2Q2EA 2ZMEA 5CVIA 3IWFA 1KYWA 2VC0A 3MZYA 2A68F 2QLZA 3RJPA 2WTEA 3KEOA 3F8MA 2CWEA 1FT9A 4IRIA 1S7OA 4KDPA 1ZH5A 3F6VA 1SFEA 2H6BA 2IVMA 3F8CA 2W24A 3KP7A 4P96A 4EM0B 4WF2A 5DUIA 3B02A 4CHUA 1ZHFA 1PP7U 4LLLA 3ZMTA 1KQ8A 1OR7A 2IP2A 2KKOA 2Z99A 4MTEA 4KFCA 2HS5A 3LA3A 4ZYGA 2YX7A 3GZ5A 3F72A 2P7VB 1OYYA 2PEXA 5IT9Z 2DI3A 1P2FA 2QWWA 1T98A 2OZUA 3HRUA 4R79A 2ACJA 2HTJA 5AIPA 1MDMA 1KU3A 1FZPB 2LSOA 4UV9A 2O6GE 2AS5F 1CF7A 5JR3A 3CDHA 1Y0UA 5H6RA 3GFMA 2MLGA 1U5TC 4EM1A 3WTVC 4EGZA 4M9ZA 4TV7A 2M1BA 4RS8A 3TDUC 3V7CA 4ZYEA 4I01A 1TNTA 1YW9A 2HKXA 4AIKA 3KP3A 1ZG3A 1LVAA 1IN7A 3HHGA 5D8KB 1UHMA 1GHCA 5HLHA 3ZMDA 3L00A 3FM3A 2F5CA 1CGPA 3GF2A 3C1DA 3ZQ7A 5A2QZ 5BQTA 1FBUA 1RZ4A 2FF4A 4G7ZF 4P55A 4K2EA 3TO7A 4HW0A 2P4WA 2IRFG 4WXHA 2W85A 2UZKA 5D6EA 1IAWA 3TO9A 4LB6B 3O3KA 4EJVA 3K0LA 2MC3A 2QYOA 1HBXG 4EMSA 2EFWA 1D8KA 2P6SA 1IRGA 2LNBA 2QBYB 2FA5A 2FNPA 2DU9A 4U0WA 2K7LA 3H3UA 3HTSB 2WWYA 3R6SA 1I6XA 2XHKA 1KU9A 2IPQX 1PP8F 1RIOH 3P9IA 1GXQA 4AVPA 3GYHX 3G73A 2O03A 5E1ZB 2XASA 3IC7A 3RYRA 4GCVA 4RB2C 1IN5A 2QM3A 5ILVA 2GXGA 2IW5A 3E97A 3QP6A 3RKYA 4UV8A 4EVIA 1W5TA 2K86A 4BHCA 3MFKA 4IJAA 2ZO4A 2PMUA 4M71A 1DDNA 3T8TA 1K6OA 3EETA 5E1XA 3U1DA 3QU3A 5IT9K 1V4RA 3MWMA 1TQMA 3REOA 5JI6A 2W84A 2ZMEB 4A6DA 2DO7A 1QGPA 3I59A 3LAJA 4Y13A 3KP6A 3MZHA 4RGSA 1GXPA 1FYMA 1LJ9A 2P6TA 4KN4X 1J7KA 3JW4A 1G3SA 2JPCA 1HKTA 3S2WA 4HBLA 1USTA 2DAOA 1HW2A 4WX9A 1BN5A 1Z6RA 3E6DA 3R0JA 1L0OC 3E5UA 2GA1A 4N9IA 3PQKA 3F21A 4AIHA 4HF1A 5L3GA 1XCBA 5KVRA 5A2QK 4I02A 1KU7A 3MEXA 3KEQA 1JGSA 3V7SA 3RPUA 1IN6A 4A6EA 2CO5A 5J8CA 4YFKF 2XAHA 1Z6TA 2DW4A 3ZMZA 1CF7B 2Y0MA 2A61A 2P5LC 3GO5A 4U7DA 3ZN0A 3GXOA 4L0YB 2V79A 3HHHA 4CO8A 4ENNA 1IXSB 2P5VA 5LGNA 3BP8A 4LK0F 2FNAA 2EA2A 1LDKB 2HWVA 3JTGA 4AWXB 4FT8A 5DD8A 3VFZA 2HQNA 2XKPA 4OIQF 3WU1B 2V6CA 4BAYA 4HLXA 3V8KA 4BQAA 3WODF 4BXUA 3QRFF 5HS9A 2GIVA 2M8EA 3DEUA 4E70A 4ZH4F 3Q5FA 1ON1A 2DFIA 1EV7A 2R3SA 2ZKZA 1G3WA 4MQVA 3K1MA 2XRNA 4P5OA 1DPRA 4M9XA 1W5SA 3R4KA 1USSA 1E17A 3WGGA 4R8HA 4L9VA 3E3VA 3KLNA 1J2XA 4A0YA 2XROA 2XAJA 1U5TA 3C18A 1T2KA 2L02A 3GLXA 4LFUA 2W25A 4KA4A 3CJNA 4PGGA 2DQLA 3KFWX 3OOPA 1C0WA 2QVOA 5DDGA 4FX4A 4KICA 5H20A 5LLQA 3QOPA 3QAHA 3HIFA 1B9MA 2DK8A 3WTYC 4YFNF 5L3FA 3F3XA 1B59A 3RDIA 4ENJA 3WE2A 4G94A 4G6DA 3FX3A 3FXQA 4NQWA 4L5JA 2BV6A 1U2WA 2KIMA 5LHIA 5LEJA 2RN7A 1FYLA 3L09A 3KP4A 3M7GA 3BWGA 2OQRA 1R1TA 3J81K 1SD7A 2HGCA 5ICGA 2A3SA 1BM9A 3ECHA 5HDGA 3I59B 2ESNA 2D45A 4HOBA 3ROUA 5IT3A 2DT5A 1YS6A 2FMYA 3HSFA 4YIIA 2LF7A 5CVJA 2HYGD 5ICCA 1G3TA 4D0PA 5HS7A 1J9IA 3HRTA 1P4XA 2CQKA 3SZPA 1YQAA 3FM5A 2CG4A 3FMRA 3T5XA 1T38A 3LA2A 2FBHA 1H9GA 1R5HA 1UFMA 2DTRA 1IN4A 2O0YA 4OIOF 4HF2A 1D5VA 3LSTA 1TQIA 4KMUX 3CTAA 3QPHA 2ISYA 3M8FA 2GWRA 2PMHA 3M8EA 1D3YA 1U6GA 4WCGA 2NAZA 4S04A 5ICEA 2V9VA 4R1HA 5D8LB 1XGNA 2RDPA 1XDUA 5L3CA 4EJUA 2FE3A 1XSDA 1RUNA 1UB9A 2BGCA 4IRGA 4EJOA 3RKWA 2JRTA 3BPXA 1FBQA 2HKOA 3LWFA 2VODA 4MHGA 2XVCA 1Q1HA 3ZMUA 4LD5A 5E8IA 1SAXA 1FSHA 3ZMVA 3RPQA 5DV5A 4EJTA 3I54A 4HQEA 4CGZA 2HQRA 4QWQA 1BIBA 4ZZLA 1U78A 5D4SA 4MEYF 5D5VB 5FO5A 1W7PA 1B1BA 5HS8A 4HA8A 4ETSA 4G9YA 3R60A 2HEOA 3GFLA 2O61A 2XV4S 3F23A 2FQ3A 1XGMA 2EV6A 3RTRA 2L3DA 2OA4A 1IN8A 3IWZA 2K27A 4OOIA 3ML6A 4WXCA 5CLSA 1E2XA 4WXDA 1K79A 3T1BA 3V4GA 1XGOA 1ZYRF 1XB4A 2X0LA 5ICFA 1ZGJA 3KETA 4EQQA 1LEBA 2A6HF 1IUYA 4BH9A 4G7OF 4B8XA 1G4DA 2PI0A 5LEKA 4KT5C 3DF8A 1QZYA 3LQRA 3R61A 4UVBA 1YYVA 3MCZA 4CXFA 1R00A 2HYFA 2FXAA 4L9TA 3IRQA 4UNOA 3FMSA 2QENA 4N9HA 4XLPF 2XAFA 5HLGA 2L4AA 3E6MA 1ONVA 3U2RA 2K4JA 5K1YA 1R23A 4L18B 1BIAA 1TW2A 1STZA 4M74A 1PDNC 3D0SA 4PCQA 1KU2A 2GQQA 2IJLA 5LHHA 5D5WB 2NNYA 2LKPA 4CICA 1EH6A 4KNYA 1B9NA 2MBFA 2R7FA 5JFRA 3SFZA 1R22A 3RYPA 1WKMA 3P9CA 1J5YA 1MJAA 3DKWA 5FFXA 4KIFA 3P7NA 1RNLA 1J59A 3NQOA 3FZVA 3WU0A 3IKTA 4HDUA 2RC4A 4MTDA 4XSZF 2YU3A 1F5TA 4EM2A 4HDVA 4PDKA 3WTWC 5DD4A 1WRJA 2WC2A 4A0ZA 3TKYA 1I27A 2EFOA 1KQ0A 2W57A 3O2PE 2EV0A 3W6JB 4A12A 4KYWA 2E7WA 2QUFA 3ZP5A 4OMYA 2JT1A 3F8BA 3EYYA 2PN6A 2BEOA 1BC7C 3WGHA 1ZARA 1QNTA 2UXXA 3IHUA 4YG2F 1P4WA 4I98B 1FOKA 4Q47A 3V8LA 2E1NA 1FX7A 1TLHB 2F5FA 3BJOA 3BJ6A 2DPDA 5LGUA 3TQNA 4ENMA 5CVUA 5EEGA 2MLKA 2M5WA 4I7HA 3WTSC 2ISZA 1S29A 2ZXJA 1ZAOA 3CUQA 4F7ZA 2A07F 3HRMA 3ELKA 1HSTA 3K69A 2MA3A 3JTHA 1FLIA 1U3EM 2M45A 3HSEA 4N0BA 2KJBA 2STWA 3ECOA 1UCRA 2YPRA 1IXRC 2EFQA 1I5ZA 2A6EF 1VTNC 2CW0F 3GEZA 1WSUA 4O3MA 4A5NA 5L3EA 5LRSA 1W7PB 2FU4A 2GAUA 1FBSA 2Z9OA 3LA7A 2PBIA 1O57A 1O7LA 1GVJA 3GWZA 2XIGA 2O3FA 2FRHA 2GZWA 3KLOA 5KK1A 2HOEA 2FEZA 2H94A 3GVAA 4XSXF 4LG0A 4BHBA 4U7BA 2CFXA 1F9NA 4M9SA 3RKXA 2UXNA 2V1UA 1IZ1A 4HLYA 4KMFA 3TOAA 1RUOA 2QZ8A 1XSVA 5CVRA 1B4AA 3KCCA 1HW1A 1MDMB 1DP7P 3I71A 2V1XA 2XGXA 2G9WA 2Z3YA 1L3LA 2KJCA 4LLGF 4S05A 1OMIA 1ODDA 2QQAA 1IRFA 4YFXF 4FX0A 4L9JA 5HOOA 2OZ6A 2H27A 5FGMA 1TTYA 3I5UA 5E18F 3DFGA 1ZLJA 2TDXA 1SMTA 5D5XB 4I0BA 4ON0A 3WG9A 1O3TA 2BE5F 1ZREA 3J7AO 1TQPA 3NEUA 1O3SA 2VBXA 1XCVA 1T6SA 3KZYA 3BPVA 2EWNA 1S3JA 3EUHA 4B09A 1SD5A 3R0AA 2D2WA 4GYGA 4ENKA 1IXCA 2KIUA 1ZLKA 1YW7A 4MQ9F 1TW3A 3T8RA 2PFBA 1MD0A 1XGSA 2OAZA 2Z33A 3WE3A 3DXJF 1K78A 3M1EA 3EDPA 1EH7A 1P4AA 3D5LA 4OMZA 3J80Z 5D4RA 1OKRA 4XBFA 1YS7A 3E6CC 2ZNZA 5K5RA 2DPUA 4HF0A 3GFIA 3DP7A 1R7JA 3ABUA 4P9UA 3G3ZA 4HX8A 3RI4A 1FYKA 1SFUA 4OIRF 4NB5A 3TO6A 1IF1A 1HKSA 4GYIA 5AIQA 5H6QA 1BI0A 4HX4A 4RGRA 1MJ9A 2KRFA 4P9FA 3BOQA 3CUQB 4OINF 3COAC 4BYYA 2Q0OA 2E1CA 4AIJA 2Z5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LDD A;  2PQ8 A;  4FHT A;  5DYM A;  2DQR A;  1OPC A;  4ASN A;  1OYI A;  1R5G A;  1REP C;  4M6X A;  3N97 A;  5CYV A;  4EJW A;  5E1W A;  2HFH A;  1Z91 A;  5F1R A;  1JXS A;  2VON A;  5ILS A;  2L4M A;  5ILU A;  1BC8 C;  1R58 A;  3C3W A;  1W7P D;  3MQ0 A;  2L54 A;  3QPT A;  3EQL F;  5LGT A;  1XD7 A;  3TDZ C;  4I0A A;  4M73 A;  4EV0 A;  3V7R A;  1F1Z A;  1ZRC A;  2VE9 A;  1QQI A;  2ELH A;  3QP5 A;  4IXA A;  2VC1 A;  2COM A;  4U0Y A;  3ULQ B;  5BPI A;  2FSW A;  3O6B B;  2YSR A;  3FF5 A;  1Z05 A;  1WI9 A;  3IKV A;  5BMZ A;  5DUK A;  4UHT A;  4G8X A;  3LFK A;  2OU2 A;  2X4H A;  4KIG A;  4YIF A;  4JBA A;  2LF8 A;  4RB1 A;  5LBQ A;  3W6K B;  5LRR A;  1SMY F;  3T0Y A;  2A69 F;  4O5V A;  4WWC A;  2ZJ2 A;  4LMY A;  1K7A A;  4I09 A;  5FB2 A;  1D8J A;  3DPT A;  1Z9C A;  1U8R A;  4O6J A;  3J80 K;  4PGH A;  5L3D A;  3BY6 A;  1KYZ A;  2V1D A;  4RGX A;  2EV5 A;  1XMA A;  1S6L A;  4IHS A;  2OQG A;  2IA1 A;  3ABT A;  3I53 A;  2XAQ A;  2NS0 A;  2VE8 A;  3I4P A;  4G6Q A;  2EFN A;  4U88 A;  2HZT A;  3FXR A;  5HDN A;  3K1N A;  4I2O A;  2VBZ A;  3SXY A;  3SHF A;  5JHU A;  2ZBK A;  1U5T B;  2EB7 A;  3EYI A;  4LB5 A;  1T0F A;  3KZZ A;  5L3B A;  3AAF A;  2Q8K A;  5E17 F;  2JTV A;  4HV5 A;  4NHJ A;  1BI3 A;  4GO1 A;  1J0R A;  1K78 B;  2FML A;  2VT3 A;  3LQQ A;  3BJA A;  3F22 A;  2D1V A;  2EA4 A;  2VOP A;  1YW8 A;  2G7H A;  5K5Q A;  2XKO A;  3WTX C;  3GZ6 A;  1O3R A;  2Y75 A;  4HYE A;  2YX4 A;  4RGU A;  3VOD A;  1UHW A;  4XLN F;  3E6B A;  4HQM A;  3HOT A;  1FPQ A;  2F5D A;  1BBY A;  1FSE A;  2VXZ A;  1MGT A;  3VEP A;  5ERI A;  2OD5 A;  3KE2 A;  1T39 A;  1TBX A;  4G7H F;  2F2E A;  4RB0 A;  4ZYH A;  1ZRF A;  2NYX A;  2PG4 A;  2J5P A;  2ZNY A;  1XMK A;  1SD6 A;  3GW2 A;  2RKH A;  2HTS A;  1QO0 D;  2G7U A;  5DEQ A;  1MJB A;  3Q9S A;  4OIP F;  3K2Z A;  4EGY A;  4BHP A;  4ZYD A;  1SFX A;  4DNC A;  4Y17 A;  5F6F A;  2EFP A;  2QQ9 A;  2D1H A;  2VT2 A;  1A04 A;  2AXL A;  1YFH A;  4A5M A;  4LK1 F;  2STT A;  4A2U A;  2RNJ A;  1F4K A;  3H3Z A;  2DBB A;  4CDG A;  2MH9 A;  2YR2 A;  1I1G A;  3FHZ A;  1QZZ A;  4KN7 X;  1SD4 A;  3E5X A;  3BRO A;  3SZT A;  3TGN A;  1KGS A;  3ERE D;  3VOE A;  4UXN A;  4KUM A;  5TRD A;  1FC3 A;  2UWM A;  3PFI A;  3P9K A;  1IW7 F;  3BDD A;  3I64 A;  2VBW A;  1LQ1 A;  2FBK A;  4UVC A;  3FXU A;  5BS6 A;  3IRR A;  1LNW A;  3CO6 C;  4AD9 A;  1R1V A;  1FP2 A;  2C6Y A;  3JSO A;  1ULY A;  1X3U A;  3V8J A;  4CZZ A;  3HTU A;  1P92 A;  4QLC U;  3SQN A;  1HKQ A;  1FWZ A;  4Z2Y A;  2PLY A;  2O8X A;  1R1U A;  3I58 A;  1B6A A;  5D5U B;  5J6X A;  1HSJ A;  2P7C B;  1J75 A;  4L9N A;  1ZGA A;  3IL2 A;  2JPB A;  2ADU A;  2VBY A;  2A5Y B;  2L01 A;  4LJZ F;  1XDS A;  2BBY A;  4U0V A;  5FLX Z;  2IA0 A;  4Y15 A;  3PQJ A;  1BJA A;  5HVQ C;  3ZN1 A;  2CSO A;  1W4M A;  1QPM A;  2H09 A;  2M87 A;  2ESH A;  3DPL C;  1XN7 A;  5AON A;  3ZPL A;  3FMQ A;  5FD6 A;  4JQF A;  3GFJ A;  1LB2 A;  3J81 Z;  2ZCW A;  2FOK A;  2NRA C;  4Q48 A;  4UUV A;  3K1P A;  1ZRD A;  1RI7 A;  4HX7 A;  2GA2 A;  3JAM Z;  5DCF A;  5K5O A;  5CVV A;  3F6O A;  3HSR A;  1KA8 A;  2JSC A;  1R36 A;  4ESJ A;  1YG2 A;  1H9T A;  1YIO A;  1S7A A;  3M9A A;  2VOO A;  1KQ9 A;  1MZB A;  2MD5 A;  3ISP A;  4Q5S F;  5DCM A;  2CGP A;  5J8F A;  4RB3 C;  4KIB A;  4BNC A;  1FNN A;  2K4B A;  5CJ9 A;  5TJJ A;  1HW5 A;  2VN2 A;  4DQ2 A;  3HUG A;  1G6N A;  3KP2 A;  1WQ2 A;  1HQC A;  1OYW A;  3NRV A;  4IVN A;  4IHT A;  1LEA A;  4OU0 A;  4HZF A;  3WTU C;  4RAY A;  5BOX A;  2GXB A;  2RQP A;  2PJP A;  4LGW A;  1NHA A;  2RGV A;  2P8T A;  1BI2 A;  3HOS A;  1BOA A;  1BI1 A;  2MH2 A;  3MAJ A;  4ZZD A;  5E8G A;  2XUB A;  4RAZ A;  4WK8 F;  1O3Q A;  2KIF A;  2RVC A;  4IF4 A;  4IRH A;  4PZJ A;  1FP1 D;  3QU6 A;  3FWE A;  2F5E A;  2XAG A;  1TNS A;  1JHF A;  3L2C A;  3CUO A;  3I0T A;  2R7D A;  6PAX A;  4L5I A;  1EH8 A;  3B73 A;  3DQV C;  4M72 A;  1Z1D A;  1JE8 A;  1WWX A;  4GGG A;  1O7F A;  2IT0 A;  2HDC A;  2EJR A;  1FY7 A;  2P5K A;  3OV8 A;  2B0L A;  1ZN2 A;  5FLX K;  1YTY A;  5HDK A;  1JHH A;  2DK5 A;  3C7J A;  5FD5 A;  1V3F A;  3HRS A;  5FFZ A;  1AWC A;  4GXO A;  5F64 A;  2RV8 A;  3N4M A;  3E5Q A;  1P6R A;  3L7W A;  1I1S A;  2QQB A;  4ESB A;  4CYD A;  2NNN A;  5EEH A;  3JSP A;  4M6Y A;  3JAM K;  2OBP A;  3L9F A;  1XSX A;  3CUQ C;  3GX4 X;  3K9T A;  2QBY A;  4JK1 X;  1G3Y A;  4UVA A;  5JVT A;  2HR3 A;  2WV0 A;  1Z7U A;  3GUD A;  4HV6 A;  2EK5 A;  1ZG1 A;  4XRF A;  2JZY A;  2ETH A;  2CYY A;  1ZG5 A;  1YLF A;  1S8N A;  4LG0 B;  1MKM A;  4A0X A;  3ZMS A;  2ZFW A;  1HXD A;  5HLI A;  2FBI A;  2DLL A;  2LDU A;  1H0M A;  3VB2 A;  3LAP A;  2Y48 A;  1LDJ A;  4MGR A;  3H92 A;  3RIR A;  4MEX F;  3U9G A;  3KP5 A;  4ESF A;  3WGI A;  3BZ6 A;  5ED4 A;  3TOB A;  2K02 A;  1ON2 A;  3CO7 C;  5LHG A;  4MNU A;  3HYI A;  2IA2 A;  2E7X A;  1AOY A;  5E20 A;  1DPU A;  2M30 A;  3CLO A;  4H0E A;  4HAM A;  2BYV E;  1PUE E;  4LLN A;  3F8F A;  4Q4Z F;  5D6F A;  1YO5 C;  5BPD A;  3WTT C;  4L0Z B;  3DV8 A;  1DUX C;  1QBJ A;  3F8N A;  3Q9V A;  4IPA A;  2J5O A;  5DCM B;  2H6C A;  3WTZ A;  2Q2E A;  2ZME A;  5CVI A;  3IWF A;  1KYW A;  2VC0 A;  3MZY A;  2A68 F;  2QLZ A;  3RJP A;  2WTE A;  3KEO A;  3F8M A;  2CWE A;  1FT9 A;  4IRI A;  1S7O A;  4KDP A;  1ZH5 A;  3F6V A;  1SFE A;  2H6B A;  2IVM A;  3F8C A;  2W24 A;  3KP7 A;  4P96 A;  4EM0 B;  4WF2 A;  5DUI A;  3B02 A;  4CHU A;  1ZHF A;  1PP7 U;  4LLL A;  3ZMT A;  1KQ8 A;  1OR7 A;  2IP2 A;  2KKO A;  2Z99 A;  4MTE A;  4KFC A;  2HS5 A;  3LA3 A;  4ZYG A;  2YX7 A;  3GZ5 A;  3F72 A;  2P7V B;  1OYY A;  2PEX A;  5IT9 Z;  2DI3 A;  1P2F A;  2QWW A;  1T98 A;  2OZU A;  3HRU A;  4R79 A;  2ACJ A;  2HTJ A;  5AIP A;  1MDM A;  1KU3 A;  1FZP B;  2LSO A;  4UV9 A;  2O6G E;  2AS5 F;  1CF7 A;  5JR3 A;  3CDH A;  1Y0U A;  5H6R A;  3GFM A;  2MLG A;  1U5T C;  4EM1 A;  3WTV C;  4EGZ A;  4M9Z A;  4TV7 A;  2M1B A;  4RS8 A;  3TDU C;  3V7C A;  4ZYE A;  4I01 A;  1TNT A;  1YW9 A;  2HKX A;  4AIK A;  3KP3 A;  1ZG3 A;  1LVA A;  1IN7 A;  3HHG A;  5D8K B;  1UHM A;  1GHC A;  5HLH A;  3ZMD A;  3L00 A;  3FM3 A;  2F5C A;  1CGP A;  3GF2 A;  3C1D A;  3ZQ7 A;  5A2Q Z;  5BQT A;  1FBU A;  1RZ4 A;  2FF4 A;  4G7Z F;  4P55 A;  4K2E A;  3TO7 A;  4HW0 A;  2P4W A;  2IRF G;  4WXH A;  2W85 A;  2UZK A;  5D6E A;  1IAW A;  3TO9 A;  4LB6 B;  3O3K A;  4EJV A;  3K0L A;  2MC3 A;  2QYO A;  1HBX G;  4EMS A;  2EFW A;  1D8K A;  2P6S A;  1IRG A;  2LNB A;  2QBY B;  2FA5 A;  2FNP A;  2DU9 A;  4U0W A;  2K7L A;  3H3U A;  3HTS B;  2WWY A;  3R6S A;  1I6X A;  2XHK A;  1KU9 A;  2IPQ X;  1PP8 F;  1RIO H;  3P9I A;  1GXQ A;  4AVP A;  3GYH X;  3G73 A;  2O03 A;  5E1Z B;  2XAS A;  3IC7 A;  3RYR A;  4GCV A;  4RB2 C;  1IN5 A;  2QM3 A;  5ILV A;  2GXG A;  2IW5 A;  3E97 A;  3QP6 A;  3RKY A;  4UV8 A;  4EVI A;  1W5T A;  2K86 A;  4BHC A;  3MFK A;  4IJA A;  2ZO4 A;  2PMU A;  4M71 A;  1DDN A;  3T8T A;  1K6O A;  3EET A;  5E1X A;  3U1D A;  3QU3 A;  5IT9 K;  1V4R A;  3MWM A;  1TQM A;  3REO A;  5JI6 A;  2W84 A;  2ZME B;  4A6D A;  2DO7 A;  1QGP A;  3I59 A;  3LAJ A;  4Y13 A;  3KP6 A;  3MZH A;  4RGS A;  1GXP A;  1FYM A;  1LJ9 A;  2P6T A;  4KN4 X;  1J7K A;  3JW4 A;  1G3S A;  2JPC A;  1HKT A;  3S2W A;  4HBL A;  1UST A;  2DAO A;  1HW2 A;  4WX9 A;  1BN5 A;  1Z6R A;  3E6D A;  3R0J A;  1L0O C;  3E5U A;  2GA1 A;  4N9I A;  3PQK A;  3F21 A;  4AIH A;  4HF1 A;  5L3G A;  1XCB A;  5KVR A;  5A2Q K;  4I02 A;  1KU7 A;  3MEX A;  3KEQ A;  1JGS A;  3V7S A;  3RPU A;  1IN6 A;  4A6E A;  2CO5 A;  5J8C A;  4YFK F;  2XAH A;  1Z6T A;  2DW4 A;  3ZMZ A;  1CF7 B;  2Y0M A;  2A61 A;  2P5L C;  3GO5 A;  4U7D A;  3ZN0 A;  3GXO A;  4L0Y B;  2V79 A;  3HHH A;  4CO8 A;  4ENN A;  1IXS B;  2P5V A;  5LGN A;  3BP8 A;  4LK0 F;  2FNA A;  2EA2 A;  1LDK B;  2HWV A;  3JTG A;  4AWX B;  4FT8 A;  5DD8 A;  3VFZ A;  2HQN A;  2XKP A;  4OIQ F;  3WU1 B;  2V6C A;  4BAY A;  4HLX A;  3V8K A;  4BQA A;  3WOD F;  4BXU A;  3QRF F;  5HS9 A;  2GIV A;  2M8E A;  3DEU A;  4E70 A;  4ZH4 F;  3Q5F A;  1ON1 A;  2DFI A;  1EV7 A;  2R3S A;  2ZKZ A;  1G3W A;  4MQV A;  3K1M A;  2XRN A;  4P5O A;  1DPR A;  4M9X A;  1W5S A;  3R4K A;  1USS A;  1E17 A;  3WGG A;  4R8H A;  4L9V A;  3E3V A;  3KLN A;  1J2X A;  4A0Y A;  2XRO A;  2XAJ A;  1U5T A;  3C18 A;  1T2K A;  2L02 A;  3GLX A;  4LFU A;  2W25 A;  4KA4 A;  3CJN A;  4PGG A;  2DQL A;  3KFW X;  3OOP A;  1C0W A;  2QVO A;  5DDG A;  4FX4 A;  4KIC A;  5H20 A;  5LLQ A;  3QOP A;  3QAH A;  3HIF A;  1B9M A;  2DK8 A;  3WTY C;  4YFN F;  5L3F A;  3F3X A;  1B59 A;  3RDI A;  4ENJ A;  3WE2 A;  4G94 A;  4G6D A;  3FX3 A;  3FXQ A;  4NQW A;  4L5J A;  2BV6 A;  1U2W A;  2KIM A;  5LHI A;  5LEJ A;  2RN7 A;  1FYL A;  3L09 A;  3KP4 A;  3M7G A;  3BWG A;  2OQR A;  1R1T A;  3J81 K;  1SD7 A;  2HGC A;  5ICG A;  2A3S A;  1BM9 A;  3ECH A;  5HDG A;  3I59 B;  2ESN A;  2D45 A;  4HOB A;  3ROU A;  5IT3 A;  2DT5 A;  1YS6 A;  2FMY A;  3HSF A;  4YII A;  2LF7 A;  5CVJ A;  2HYG D;  5ICC A;  1G3T A;  4D0P A;  5HS7 A;  1J9I A;  3HRT A;  1P4X A;  2CQK A;  3SZP A;  1YQA A;  3FM5 A;  2CG4 A;  3FMR A;  3T5X A;  1T38 A;  3LA2 A;  2FBH A;  1H9G A;  1R5H A;  1UFM A;  2DTR A;  1IN4 A;  2O0Y A;  4OIO F;  4HF2 A;  1D5V A;  3LST A;  1TQI A;  4KMU X;  3CTA A;  3QPH A;  2ISY A;  3M8F A;  2GWR A;  2PMH A;  3M8E A;  1D3Y A;  1U6G A;  4WCG A;  2NAZ A;  4S04 A;  5ICE A;  2V9V A;  4R1H A;  5D8L B;  1XGN A;  2RDP A;  1XDU A;  5L3C A;  4EJU A;  2FE3 A;  1XSD A;  1RUN A;  1UB9 A;  2BGC A;  4IRG A;  4EJO A;  3RKW A;  2JRT A;  3BPX A;  1FBQ A;  2HKO A;  3LWF A;  2VOD A;  4MHG A;  2XVC A;  1Q1H A;  3ZMU A;  4LD5 A;  5E8I A;  1SAX A;  1FSH A;  3ZMV A;  3RPQ A;  5DV5 A;  4EJT A;  3I54 A;  4HQE A;  4CGZ A;  2HQR A;  4QWQ A;  1BIB A;  4ZZL A;  1U78 A;  5D4S A;  4MEY F;  5D5V B;  5FO5 A;  1W7P A;  1B1B A;  5HS8 A;  4HA8 A;  4ETS A;  4G9Y A;  3R60 A;  2HEO A;  3GFL A;  2O61 A;  2XV4 S;  3F23 A;  2FQ3 A;  1XGM A;  2EV6 A;  3RTR A;  2L3D A;  2OA4 A;  1IN8 A;  3IWZ A;  2K27 A;  4OOI A;  3ML6 A;  4WXC A;  5CLS A;  1E2X A;  4WXD A;  1K79 A;  3T1B A;  3V4G A;  1XGO A;  1ZYR F;  1XB4 A;  2X0L A;  5ICF A;  1ZGJ A;  3KET A;  4EQQ A;  1LEB A;  2A6H F;  1IUY A;  4BH9 A;  4G7O F;  4B8X A;  1G4D A;  2PI0 A;  5LEK A;  4KT5 C;  3DF8 A;  1QZY A;  3LQR A;  3R61 A;  4UVB A;  1YYV A;  3MCZ A;  4CXF A;  1R00 A;  2HYF A;  2FXA A;  4L9T A;  3IRQ A;  4UNO A;  3FMS A;  2QEN A;  4N9H A;  4XLP F;  2XAF A;  5HLG A;  2L4A A;  3E6M A;  1ONV A;  3U2R A;  2K4J A;  5K1Y A;  1R23 A;  4L18 B;  1BIA A;  1TW2 A;  1STZ A;  4M74 A;  1PDN C;  3D0S A;  4PCQ A;  1KU2 A;  2GQQ A;  2IJL A;  5LHH A;  5D5W B;  2NNY A;  2LKP A;  4CIC A;  1EH6 A;  4KNY A;  1B9N A;  2MBF A;  2R7F A;  5JFR A;  3SFZ A;  1R22 A;  3RYP A;  1WKM A;  3P9C A;  1J5Y A;  1MJA A;  3DKW A;  5FFX A;  4KIF A;  3P7N A;  1RNL A;  1J59 A;  3NQO A;  3FZV A;  3WU0 A;  3IKT A;  4HDU A;  2RC4 A;  4MTD A;  4XSZ F;  2YU3 A;  1F5T A;  4EM2 A;  4HDV A;  4PDK A;  3WTW C;  5DD4 A;  1WRJ A;  2WC2 A;  4A0Z A;  3TKY A;  1I27 A;  2EFO A;  1KQ0 A;  2W57 A;  3O2P E;  2EV0 A;  3W6J B;  4A12 A;  4KYW A;  2E7W A;  2QUF A;  3ZP5 A;  4OMY A;  2JT1 A;  3F8B A;  3EYY A;  2PN6 A;  2BEO A;  1BC7 C;  3WGH A;  1ZAR A;  1QNT A;  2UXX A;  3IHU A;  4YG2 F;  1P4W A;  4I98 B;  1FOK A;  4Q47 A;  3V8L A;  2E1N A;  1FX7 A;  1TLH B;  2F5F A;  3BJO A;  3BJ6 A;  2DPD A;  5LGU A;  3TQN A;  4ENM A;  5CVU A;  5EEG A;  2MLK A;  2M5W A;  4I7H A;  3WTS C;  2ISZ A;  1S29 A;  2ZXJ A;  1ZAO A;  3CUQ A;  4F7Z A;  2A07 F;  3HRM A;  3ELK A;  1HST A;  3K69 A;  2MA3 A;  3JTH A;  1FLI A;  1U3E M;  2M45 A;  3HSE A;  4N0B A;  2KJB A;  2STW A;  3ECO A;  1UCR A;  2YPR A;  1IXR C;  2EFQ A;  1I5Z A;  2A6E F;  1VTN C;  2CW0 F;  3GEZ A;  1WSU A;  4O3M A;  4A5N A;  5L3E A;  5LRS A;  1W7P B;  2FU4 A;  2GAU A;  1FBS A;  2Z9O A;  3LA7 A;  2PBI A;  1O57 A;  1O7L A;  1GVJ A;  3GWZ A;  2XIG A;  2O3F A;  2FRH A;  2GZW A;  3KLO A;  5KK1 A;  2HOE A;  2FEZ A;  2H94 A;  3GVA A;  4XSX F;  4LG0 A;  4BHB A;  4U7B A;  2CFX A;  1F9N A;  4M9S A;  3RKX A;  2UXN A;  2V1U A;  1IZ1 A;  4HLY A;  4KMF A;  3TOA A;  1RUO A;  2QZ8 A;  1XSV A;  5CVR A;  1B4A A;  3KCC A;  1HW1 A;  1MDM B;  1DP7 P;  3I71 A;  2V1X A;  2XGX A;  2G9W A;  2Z3Y A;  1L3L A;  2KJC A;  4LLG F;  4S05 A;  1OMI A;  1ODD A;  2QQA A;  1IRF A;  4YFX F;  4FX0 A;  4L9J A;  5HOO A;  2OZ6 A;  2H27 A;  5FGM A;  1TTY A;  3I5U A;  5E18 F;  3DFG A;  1ZLJ A;  2TDX A;  1SMT A;  5D5X B;  4I0B A;  4ON0 A;  3WG9 A;  1O3T A;  2BE5 F;  1ZRE A;  3J7A O;  1TQP A;  3NEU A;  1O3S A;  2VBX A;  1XCV A;  1T6S A;  3KZY A;  3BPV A;  2EWN A;  1S3J A;  3EUH A;  4B09 A;  1SD5 A;  3R0A A;  2D2W A;  4GYG A;  4ENK A;  1IXC A;  2KIU A;  1ZLK A;  1YW7 A;  4MQ9 F;  1TW3 A;  3T8R A;  2PFB A;  1MD0 A;  1XGS A;  2OAZ A;  2Z33 A;  3WE3 A;  3DXJ F;  1K78 A;  3M1E A;  3EDP A;  1EH7 A;  1P4A A;  3D5L A;  4OMZ A;  3J80 Z;  5D4R A;  1OKR A;  4XBF A;  1YS7 A;  3E6C C;  2ZNZ A;  5K5R A;  2DPU A;  4HF0 A;  3GFI A;  3DP7 A;  1R7J A;  3ABU A;  4P9U A;  3G3Z A;  4HX8 A;  3RI4 A;  1FYK A;  1SFU A;  4OIR F;  4NB5 A;  3TO6 A;  1IF1 A;  1HKS A;  4GYI A;  5AIQ A;  5H6Q A;  1BI0 A;  4HX4 A;  4RGR A;  1MJ9 A;  2KRF A;  4P9F A;  3BOQ A;  3CUQ B;  4OIN F;  3COA C;  4BYY A;  2Q0O A;  2E1C A;  4AIJ A;  2Z5U A; 
#chains in the Genus database with same CATH topology
 1LDD A;  2PX9 A;  2PQ8 A;  1HF0 A;  1QVT A;  4FHT A;  1G59 A;  4BEH A;  1D1C A;  5DYM A;  2DQR A;  1OPC A;  4ASN A;  3H9Q A;  1OYI A;  1BOB A;  4BQN A;  2MD0 A;  1R5G A;  1REP C;  2OCC H;  2VAS A;  4M6X A;  3N97 A;  1O4X A;  5CYV A;  4EJW A;  4IEJ A;  5E1W A;  2HFH A;  1Z91 A;  4BXF A;  1YRN A;  5F1R A;  1JXS A;  2OTL I;  4XID A;  2VON A;  3I4M J;  2UUZ A;  5ILS A;  3MKZ A;  2L4M A;  3F9K A;  4NUB A;  1A35 A;  5ILU A;  1BC8 C;  1R58 A;  2WB1 N;  3C3W A;  1W7P D;  4MIM A;  4UB6 C;  3MQ0 A;  3BTI A;  5DTD A;  4BE2 A;  4AYB N;  2L54 A;  3QPT A;  4QSH A;  2AHQ A;  2E36 A;  3EQL F;  5IYC J;  5LGT A;  1OIS A;  1XD7 A;  4IHV A;  3TDZ C;  2HU9 A;  3Q0V A;  4I0A A;  1POG A;  4M73 A;  4EV0 A;  1WJ5 A;  2HOA A;  3V7R A;  3AL0 B;  2B63 J;  1F1Z A;  3CCJ I;  1OJL A;  1QVU A;  5LFA A;  1VQP I;  1ZRC A;  2VE9 A;  4V19 K;  1QQI A;  2ELH A;  3QP5 A;  4CYC B;  4IXA A;  2VC1 A;  2COM A;  4U0Y A;  3ULQ B;  5BPI A;  3JRA A;  2FSW A;  1DQU A;  4ZJZ A;  5TIS C;  2OJE D;  1MBK A;  3O6B B;  3OS1 A;  1YX5 A;  2YSR A;  3FF5 A;  2DOD A;  2E34 A;  1OCR H;  1Z05 A;  2LD5 A;  1FTT A;  1WI9 A;  4MFD A;  1ETO A;  3IKV A;  2TCT A;  5BMZ A;  5DUK A;  4UHT A;  4G8X A;  3H9J A;  2KFD A;  3LFK A;  4XLC A;  2OU2 A;  2X4H A;  4KIG A;  4YIF A;  4JBA A;  4A3C J;  4KJZ A;  2NVQ J;  2LF8 A;  4RB1 A;  5LBQ A;  3W6K B;  5LRR A;  2W7N A;  2IGO A;  1SMY F;  4XLE A;  3P5J A;  3T0Y A;  2A69 F;  4O5V A;  4FE7 A;  5EJC A;  4WWC A;  3AG2 H;  4PJ0 C;  4C3H J;  2ZJ2 A;  2DMU A;  2ZJP F;  2EIL H;  1TWH J;  4LMY A;  1K7A A;  1WFX A;  4I09 A;  5FB2 A;  1D8J A;  1I3Q J;  3DPT A;  4A3E J;  3FIS A;  1Y0N A;  1Z9C A;  1WGX A;  1R49 A;  1U8R A;  1Z3Y A;  3DKY A;  4O6J A;  5GAH J;  3J80 K;  4PGH A;  5L3D A;  3BY6 A;  1JKP C;  1KYZ A;  2A05 A;  2V1D A;  1QPI A;  4RGX A;  3JRF A;  2CQN A;  2EV5 A;  2FD5 A;  2AQE A;  1XMA A;  2VKD A;  4YEL A;  1WH5 A;  1S6L A;  4HNV A;  3HJE A;  1AHD P;  1FIA A;  2IA1 A;  2OQG A;  3ABT A;  4IHS A;  2Y30 A;  3I53 A;  1QRY A;  2XAQ A;  3K4J A;  4IOA F;  3JRB A;  2XSD C;  2NS0 A;  2VE8 A;  4XL9 A;  2GM4 A;  1MBG A;  4XMY A;  5FRO A;  3I4P A;  4AID A;  3CDI A;  4G6Q A;  2EFN A;  4U88 A;  3VPR A;  2HZT A;  2LY1 A;  3FXR A;  1MIJ A;  2BY2 A;  5HDN A;  2K9M A;  3K1N A;  4I2O A;  1HC8 A;  1SFO J;  5EGO B;  2VBZ A;  1EA3 A;  3SXY A;  3SYT A;  2Q1Z B;  3MKL A;  3MVP A;  3SHF A;  4BKX A;  1J09 A;  2VKH A;  5JHU A;  2ZBK A;  4M3G A;  3SZG A;  3AFH A;  4II2 A;  3WHC A;  1U5T B;  2L7Z A;  3GTQ J;  2DMP A;  1ACI A;  1TWG J;  2EB7 A;  3EYI A;  4LB5 A;  1WJC A;  3QYE A;  1T0F A;  3GBG A;  3KZZ A;  5L3B A;  3AAF A;  3K2A A;  1WVR A;  2Q8K A;  2E2H J;  1IV8 A;  5E17 F;  2JTV A;  5JLX A;  4E7Z A;  4HV5 A;  1JKR C;  4NHJ A;  2FUG 2;  1BI3 A;  4GO1 A;  4U87 A;  1ZGW A;  4E7H A;  1J0R A;  1K78 B;  4XRS A;  3S1R J;  2FML A;  2DMT A;  1Z7L A;  2VT3 A;  3LQQ A;  4IHX A;  4CCJ A;  1HA8 A;  3BJA A;  4F91 B;  3F22 A;  2D1V A;  4FCY A;  2EA4 A;  2VOP A;  1YW8 A;  1ETV A;  1TWA J;  2G7H A;  3MKY B;  1MMG A;  5K5Q A;  2XKO A;  2K40 A;  1ZR4 A;  1D1A A;  3WTX C;  3GZ6 A;  1O3R A;  5C44 J;  2Y75 A;  4HYE A;  1LKX A;  4DBR A;  3ZGK A;  2YX4 A;  4C2U A;  1T08 B;  4RGU A;  3VOD A;  1UHW A;  3MZ8 A;  3JRI A;  2DA3 A;  4KT6 A;  4C2T A;  2ELK A;  3FXJ A;  4XLN F;  3E6B A;  4D5C A;  3W6V A;  4HQM A;  2F5D A;  1FPQ A;  4V2F A;  3HOT A;  1BBY A;  5GAE J;  5JLW A;  3OYF A;  1FSE A;  2VXZ A;  3HOW J;  1MGT A;  3VEP A;  3S3O A;  3BG3 A;  2OD5 A;  3KE2 A;  5ERI A;  1TBX A;  4IQ4 A;  1T39 A;  1R9T J;  4G7H F;  5GTH C;  5J4V A;  2F2E A;  4RB0 A;  4ZYH A;  4PJM A;  4HG2 A;  1ZRF A;  4KIS A;  2NYX A;  2PG4 A;  2EPF A;  2J5P A;  2ZNY A;  1XMK A;  4ZTJ A;  1SD6 A;  3KZI C;  1B72 B;  3GW2 A;  2R7W A;  2RKH A;  2H1K A;  4BBS J;  2HTS A;  1QO0 D;  2UV1 A;  3OYA A;  2VPL A;  4BGD A;  3IH2 A;  3L2U A;  2G7U A;  5DEQ A;  3ESW B;  4BEH B;  2NVX J;  2KZV A;  2F5V A;  1MJB A;  3Q9S A;  3WU2 C;  4OIP F;  2YS9 A;  3I4N J;  3K2Z A;  3CC7 I;  4EGY A;  3QOE A;  4BHP A;  4ZYD A;  1SFX A;  3X2Q H;  4DNC A;  4Y17 A;  3VSK A;  5F6F A;  2HQ5 A;  2EFP A;  1YRN B;  2E2J J;  2QQ9 A;  2D1H A;  2DJI A;  2NVU B;  2CU7 A;  4RLQ A;  2VT2 A;  1A04 A;  2AXL A;  2WY8 Q;  3H35 A;  1HLV A;  4ZDO A;  1YFH A;  4A5M A;  2Y9Y A;  3PSI A;  3ABM H;  1ETY A;  2OV7 A;  2JVH A;  4LK1 F;  2HOS A;  2STT A;  3BR3 A;  4A2U A;  2RNJ A;  4C9Y A;  1F4K A;  2VIX A;  3H3Z A;  1X1A A;  1GT0 C;  2DBB A;  1H88 C;  1FOY A;  4CDG A;  2MH9 A;  2YR2 A;  1YJN I;  2DDB A;  1I1G A;  3FHZ A;  1ETK A;  3GCM A;  1QZZ A;  3OYG A;  4KN7 X;  1SD4 A;  5K7Z A;  1VND A;  3CMM A;  3E5X A;  3BRO A;  3SZT A;  1VQK I;  3TGN A;  4BJT A;  1KGS A;  1D0Y A;  2B9S A;  3A0H C;  1JKO C;  3ERE D;  2M3A A;  3VOE A;  3S1Q J;  5M5X J;  3BZC A;  4UXN A;  3CDL A;  2Y69 H;  3B6A A;  4KUM A;  2E5N A;  1IDZ A;  4L5E A;  1FC3 A;  2GOM A;  5TRD A;  3PFI A;  3GTP J;  2UWM A;  3P9K A;  1GUU A;  1QHH D;  4RAF A;  2K85 A;  4B4C A;  2VXD A;  4BL0 B;  4BQQ A;  2IAI A;  3OYJ A;  1NK2 P;  1IW7 F;  2COB A;  3BDD A;  1P9Q C;  3ZR8 X;  3I64 A;  1VQ6 I;  5BNG A;  2VBW A;  1LQ1 A;  2FBK A;  3QPS A;  4UVC A;  4BQO A;  3FXU A;  2K5C A;  2KDO A;  5BS6 A;  2VL8 A;  3IRR A;  5J1Y A;  1LNW A;  3E1S A;  2ECC A;  3CO6 C;  1XPX A;  2KMU A;  4AD9 A;  3WHB A;  4MO7 A;  3BC8 A;  1R1V A;  3S15 J;  3JRH A;  1FP2 A;  2C6Y A;  2GIZ A;  1BR4 A;  5FLV A;  5C4J J;  5B3S H;  1ULY A;  5HNH A;  3JSO A;  1RKT A;  3FXM A;  1MNM C;  1X3U A;  2HNH A;  1BA5 A;  3V8J A;  1VQO I;  2JMW A;  1TP4 A;  4CZZ A;  3HTU A;  3OL3 A;  2CV2 A;  3W2A A;  4HRI A;  3ZCO A;  1P92 A;  4QLC U;  3BR1 A;  1IG7 A;  3SQN A;  1RC9 A;  3S1N J;  1HKQ A;  1FEX A;  1E3P A;  1FWZ A;  4Z2Y A;  1Y1V J;  2PLY A;  3DTE A;  2O8X A;  1R1U A;  3I58 A;  1B6A A;  5D5U B;  3HB9 A;  2M4K A;  3BLY A;  5J6X A;  1HSJ A;  3CMY A;  2LRD A;  4RBO A;  2P7C B;  2HVS A;  2Y2Z A;  2JUG A;  1J75 A;  4L9N A;  1R71 A;  1XMX A;  1ZGA A;  2R7R A;  2OPT A;  1Y6I A;  4PSW A;  5F0F A;  3IL2 A;  1K6Y A;  1S9H A;  2KIQ A;  3K4B A;  2JPB A;  3CCL I;  2ADU A;  3MD2 A;  2EZL A;  1FIP A;  2VBY A;  1VQN I;  2WBM A;  2A5Y B;  4IQJ A;  4A3M J;  2L01 A;  4LJZ F;  4EAT A;  1XDS A;  2ZME C;  2BBY A;  1IGN A;  4U0V A;  3QYF A;  5FLX Z;  1ETX A;  2IA0 A;  2M9H A;  4Y15 A;  3PQJ A;  3JRG A;  2KHM A;  1BJA A;  3BG6 A;  5HVQ C;  5JHF A;  3ZN1 A;  3OY9 A;  2CSO A;  1I50 J;  3JCU C;  1W4M A;  1QPM A;  2DA6 A;  2EIK H;  3CCS I;  2H09 A;  2A5W A;  1DGR M;  2M87 A;  4A3F J;  2HXI A;  2ESH A;  3DPL C;  1XN7 A;  5AON A;  4KIT B;  3ZPL A;  3FMQ A;  2NS7 A;  5FD6 A;  4JQF A;  3EPZ A;  3GFJ A;  4OAZ A;  1LB2 A;  3ZXS A;  3J81 Z;  2XRL A;  3CCM I;  2ZCW A;  2FOK A;  2NRA C;  4Q48 A;  3HM5 A;  2BY3 A;  3FBN B;  2L9N A;  4LIT A;  3FDY A;  3K1P A;  1ZRD A;  4UUV A;  3ASO H;  4D7N A;  3BCB A;  3ZRG A;  1RI7 A;  4HX7 A;  3S8P A;  2GA2 A;  3JAM Z;  5DCF A;  5K5O A;  3J7A Y;  4XRM A;  4BDZ A;  4JYK A;  5IOZ A;  2MW8 A;  4HSR A;  4W1U A;  3S3N A;  2O9L A;  3F6O A;  5CVV A;  3BR5 A;  3HSR A;  1KA8 A;  2JSC A;  3DCF A;  3DTK A;  1R36 A;  4ESJ A;  1YG2 A;  1FMV A;  1H9T A;  1YIO A;  1S7A A;  2XGE A;  3M9A A;  2VOO A;  1KQ9 A;  1MZB A;  1NG6 A;  5IY5 H;  2M7A A;  4UUS A;  2V9P A;  2MD5 A;  3HGY A;  5J3L A;  3ISP A;  5DM6 F;  2LH9 A;  3RSN A;  3PL8 A;  4Q5S F;  4XR6 A;  1N25 A;  2CRG A;  5DCM A;  1K61 A;  2R5Z B;  2CGP A;  5J8F A;  1TZL A;  4RB3 C;  4KIB A;  4BNC A;  2MAB A;  1FNN A;  2K4B A;  5CJ9 A;  3VYS B;  1FOX A;  1U9N A;  3HOV J;  5TJJ A;  4B44 A;  4I99 C;  2W1O A;  4XOP A;  1HW5 A;  1X3Z B;  2VN2 A;  1LFU P;  4DQ2 A;  2X6W A;  2OCE A;  2LY2 A;  3HUG A;  1G6N A;  4AYB A;  5J1U A;  3KP2 A;  2VQL A;  1WQ2 A;  1BR1 A;  1HQC A;  4BDY A;  3TW6 A;  2LK2 A;  2E1M B;  1OYW A;  3NRV A;  4DGW B;  3H0D A;  4QTR A;  3HEF A;  1X4O A;  4IVN A;  2MGQ A;  4IHT A;  1LEA A;  3OS2 A;  2LR8 A;  4OU0 A;  4HZF A;  3WTU C;  2DMN A;  3HKZ N;  2XDV A;  2Z16 A;  2VJJ A;  4NC6 A;  2QKL B;  4RAY A;  5GPA A;  2DDA A;  5BOX A;  2GXB A;  2RQP A;  2XF5 A;  5KAF C;  4CCN A;  3BG5 A;  4NC8 A;  3TMO A;  2PJP A;  4LGW A;  1NTC A;  1NHA A;  3S1M J;  2JA7 J;  3I56 I;  2R5Y A;  3PO2 J;  4D5F A;  3VYT B;  1DP3 A;  2RGV A;  2P8T A;  1Y1W J;  3PNY A;  2ELJ A;  1BI2 A;  3HOS A;  1FJL A;  3BR6 A;  1BOA A;  1DGW Y;  3GTJ J;  1BI1 A;  2ZC2 A;  1B8I A;  2DXI A;  4XM3 A;  2XF7 A;  3PNT A;  4I6Z A;  2X1C A;  1X2N A;  2MH2 A;  3MAJ A;  4ZZD A;  2DJN A;  4JX6 A;  3S3M A;  2M8G X;  3OR1 C;  1MH4 A;  5E8G A;  2XUB A;  4RAZ A;  4WK8 F;  1O3Q A;  1SFK A;  3E0J B;  2KIF A;  2RVC A;  2XB5 A;  3DTI A;  4DYQ A;  4IF4 A;  4IRH A;  4PZJ A;  1FP1 D;  1T95 A;  3QU6 A;  1TC3 C;  1EJ9 A;  5M3M J;  3OS0 A;  3FWE A;  2F5E A;  3SEZ A;  5HOD A;  3M4O J;  2XAG A;  1TNS A;  1JHF A;  4AC0 A;  3CUO A;  3I0T A;  3L2C A;  2R7D A;  3IAS 2;  6PAX A;  4L5I A;  1EH8 A;  5F1J A;  3B73 A;  3DQV C;  2ME6 A;  1YJ9 I;  4M72 A;  5M3F J;  1X1P A;  1Z1D A;  3TP3 A;  3EUA A;  1JE8 A;  1WWX A;  4GGG A;  4YEJ A;  5IP7 J;  1X2M A;  4XRS G;  1O7F A;  2IT0 A;  2HDC A;  2EJR A;  1FY7 A;  2P5K A;  3OV8 A;  1GVD A;  2B0L A;  5EF6 A;  1DU0 A;  1ZN2 A;  5FLX K;  1YTY A;  5HDK A;  1JHH A;  1SVM A;  4BU2 A;  1MSE C;  2DK5 A;  2ZFU A;  3BQZ A;  3C7J A;  3M1C A;  5FD5 A;  4J00 A;  3BT9 A;  3DU6 A;  1V3F A;  2N8G A;  3HRS A;  5FFZ A;  3FKI J;  5HNF A;  2O5R A;  1AWC A;  4CH7 A;  4C3I J;  1TL8 A;  4GXO A;  1IO2 A;  5F64 A;  2RV8 A;  3N4M A;  3E5Q A;  1P6R A;  3L7W A;  1I1S A;  3HOY J;  3PIP F;  3LMM A;  4B48 A;  5FKO A;  3HDD A;  2QQB A;  3ZQL A;  4ESB A;  4CYD A;  4C30 A;  1VF9 A;  2NNN A;  5EEH A;  3JSP A;  4M6Y A;  3JAM K;  2OBP A;  3L9F A;  1XSX A;  2MSY A;  5JVG F;  3CUQ C;  3L2W A;  3K9T A;  3GX4 X;  2QBY A;  3PO3 J;  3MMY B;  4JK1 X;  2QA4 I;  1G3Y A;  4M3D A;  3K7A J;  2QEX I;  1JJ8 C;  4UVA A;  5JVT A;  2HR3 A;  2WV0 A;  1Z7U A;  3GUD A;  4HV6 A;  2H1L A;  2EK5 A;  2LVS A;  1ZG1 A;  2KDZ A;  3KYD B;  1SC7 A;  1SEU A;  4XRF A;  2JZY A;  2ETH A;  2CYY A;  1ZG5 A;  1YLF A;  1S8N A;  5F04 A;  2V9K A;  4LG0 B;  1MKM A;  2JN6 A;  4A0X A;  3OSF A;  3ZMS A;  3OYE A;  2ZFW A;  3CP2 A;  1HXD A;  5HLI A;  2FBI A;  2DLL A;  2FQ4 A;  2LDU A;  3HXL A;  1H0M A;  3VYU B;  2P81 A;  2LP0 A;  3VB2 A;  1G8X A;  3LL7 A;  2F48 A;  3LAP A;  2Y48 A;  1LDJ A;  4PJN A;  4MGR A;  3H92 A;  2MC4 A;  2KPM A;  3JRC A;  3RIR A;  4MEX F;  3U9G A;  2LBF A;  1VQ5 I;  3GTK J;  2Y9Z A;  1IRX A;  3KP5 A;  4ESF A;  3WGI A;  3BZ6 A;  4LOC A;  5ED4 A;  1UJ8 A;  4XOT A;  3TOB A;  2DYS H;  4GRI A;  2K02 A;  1ON2 A;  3CO7 C;  5LHG A;  4MNU A;  3HYI A;  2IA2 A;  2E7X A;  2BZT A;  1AOY A;  5E20 A;  2WV1 A;  2DYR H;  2EIM H;  4DZP A;  3LSH A;  2M30 A;  1DPU A;  2BOL A;  3CLO A;  3OYC A;  4H0E A;  3TL4 X;  2XPW A;  4HAM A;  1E0E A;  3HOZ J;  1YI2 I;  3U21 A;  2BYV E;  4E7K A;  4DYR A;  1PUE E;  4LLN A;  3AL0 C;  1ZTR A;  3F8F A;  4Q4Z F;  1H8A C;  2NS8 A;  5D6F A;  1YO5 C;  5BPD A;  1VQ7 I;  1UMQ A;  2R7V A;  2ID6 A;  3WTT C;  3DV8 A;  3KX2 A;  4L0Z B;  4AM3 A;  4F3Q A;  4UUS B;  1DUX C;  3ABK H;  4FET A;  4HPQ A;  4E4H A;  1QBJ A;  1D1B A;  4EEF G;  3F8N A;  2HXO A;  3Q9V A;  4IPA A;  2Y0S A;  3OR2 C;  4J01 A;  2J5O A;  1P7I A;  2X51 A;  5DCM B;  1XC5 A;  2CV0 A;  2H6C A;  3WTZ A;  2Q2E A;  4BY1 J;  2ZME A;  3RZD J;  4FIS A;  2LKX A;  5B5E C;  5CVI A;  2I5U A;  1KYW A;  3HC7 A;  3IWF A;  1I6H J;  3BG9 A;  4S0H B;  4ZYA A;  4CCO A;  2VC0 A;  3QPL A;  3MZY A;  2A68 F;  2L9S A;  2QLZ A;  3RJP A;  4A3I J;  2WTE A;  2AO9 A;  3KEO A;  3FK7 A;  2X1E A;  3F8M A;  3BTC A;  3HUG B;  1V5F A;  3A03 A;  1QZE A;  5K7H A;  2CWE A;  2VJ4 A;  1WPK A;  2M0M A;  1FT9 A;  2CW8 A;  2R7S A;  4IRI A;  2E60 A;  1S7O A;  4KDP A;  1ZH5 A;  2Z2S B;  3F6V A;  1SFE A;  2H6B A;  2IBD A;  2IVM A;  4E7J A;  2MFZ A;  2CS3 A;  3F8C A;  2W24 A;  3KP7 A;  3OYK A;  1WJF A;  4P96 A;  3CCQ I;  4EM0 B;  4WF2 A;  5DUI A;  3B02 A;  1RET A;  3PM1 A;  4CHU A;  1ZHF A;  1PP7 U;  4LLL A;  2X48 A;  3ZMT A;  1KQ8 A;  2LYC A;  5KHD A;  1OR7 A;  5IYB J;  3KIO A;  1K4T A;  2IP2 A;  2KKO A;  2Z99 A;  4MTE A;  4KFC A;  2HS5 A;  3LA3 A;  5J47 A;  4IOC F;  4ZYG A;  2YX7 A;  2CJJ A;  2LFB A;  4XIC A;  3GZ5 A;  3F72 A;  2P7V B;  1YE9 A;  1OYY A;  2PEX A;  5IT9 Z;  1LE8 A;  2DI3 A;  1P2F A;  3J7Y J;  5K7F A;  1B8I B;  2QWW A;  5B1A H;  1T98 A;  2OZU A;  3HRU A;  4R79 A;  2ACJ A;  1VQ8 I;  2HTJ A;  2IGM A;  5AIP A;  1MDM A;  1KU3 A;  5EEA A;  3PNV A;  1FZP B;  2DA1 A;  3BR0 A;  2LSO A;  4UV9 A;  4DBQ A;  1JI8 A;  2O6G E;  1VQ9 I;  1BR2 A;  3FXL A;  2AS5 F;  1CF7 A;  5JR3 A;  1PUF A;  3CDH A;  3JRE A;  1JGG A;  3G1M A;  2LTP A;  1Y0U A;  5H6R A;  2R92 J;  5C3E J;  5B66 C;  3GFM A;  2MLG A;  1U5T C;  3A02 A;  4EM1 A;  3WTV C;  4EGZ A;  5CQG A;  4M9Z A;  2DOE A;  2ME0 A;  4TV7 A;  3K70 C;  1VQL I;  4M3B A;  2M1B A;  4RS8 A;  3TDU C;  2IS4 A;  3V7C A;  4ZYE A;  4I01 A;  1TNT A;  1YW9 A;  2HKX A;  2DFH A;  2K9S A;  4AIK A;  3Q0U A;  2JVG A;  3KP3 A;  1ZG3 A;  5E3N A;  1LVA A;  3ZQQ A;  1IN7 A;  3HHG A;  5D8K B;  2IEK A;  1AA7 A;  5DS9 A;  1T56 A;  1UHM A;  1GHC A;  5HLH A;  3ZMD A;  1SVL A;  5KAI C;  3CCV I;  3L00 A;  3FM3 A;  4A69 C;  2ZXW H;  4ABZ A;  2F5C A;  3OYM A;  1M1E B;  3PFY A;  1CGP A;  3TED A;  3GF2 A;  3C1D A;  3ZQ7 A;  5A2Q Z;  5BQT A;  5GPC A;  1FBU A;  1RZ4 A;  2FF4 A;  3H36 A;  1XX5 A;  4G7Z F;  2HVR A;  5KCM A;  4P55 A;  4K2E A;  2QSG X;  3TO7 A;  4HW0 A;  3IH4 A;  4MLO A;  2L9V A;  1ZK8 A;  2Y0S N;  2P4W A;  1Q1V A;  2IRF G;  2WY7 Q;  4WXH A;  5EDN A;  1WCM J;  1YX3 A;  1UG0 A;  2W85 A;  1ZEL A;  2UZK A;  5D6E A;  3RQI A;  5FKM A;  1H89 C;  1IAW A;  4HST A;  3TO9 A;  4LB6 B;  1K83 J;  3O3K A;  1OQY A;  4EJV A;  2EIJ H;  3K0L A;  2EBI A;  2MC3 A;  2QYO A;  1HBX G;  4EMS A;  2EFW A;  1D8K A;  2P6S A;  1Y8Q B;  1IRG A;  2XC7 A;  4A3D J;  2LNB A;  3CJQ B;  4MFE A;  2QBY B;  2P0W A;  2FA5 A;  2FNP A;  2DU9 A;  4U0W A;  3CCE I;  1JTX A;  3GLL A;  2K7L A;  3H3U A;  3HTS B;  2WWY A;  3R6S A;  3CME I;  3RCO A;  1I6X A;  2XHK A;  1KU9 A;  2IPQ X;  1RRJ A;  3KPH A;  1PP8 F;  1APL C;  1RIO H;  2KP6 A;  3NWT A;  2QF7 A;  4XN0 A;  1VFC A;  1ERD A;  5CQE A;  2M34 A;  3LSJ A;  3P9I A;  1GXQ A;  2RAE A;  2DMQ A;  3K4C A;  3WG7 H;  4AVP A;  3GYH X;  3G73 A;  1UAA A;  1LUJ B;  2O03 A;  1Y39 A;  2ZSI B;  3G1O A;  5E1Z B;  2XAS A;  2IS6 A;  3H9G A;  2KIS A;  3IC7 A;  2LBF B;  1PVE A;  3RYR A;  4GCV A;  2E5Z A;  3PSF A;  3O8G A;  4RB2 C;  1IN5 A;  2QM3 A;  5ILV A;  1Z77 A;  3S32 A;  2GXG A;  2IW5 A;  5IYD J;  3E97 A;  3QP6 A;  3BQY A;  3RKY A;  4C2M J;  2B7E A;  1OCT C;  3NAU A;  3W3C A;  2QSF X;  3J7Z I;  4UV8 A;  4EVI A;  1W5T A;  3LNQ A;  2R93 J;  4F93 B;  2K86 A;  1TT5 B;  4BHC A;  3MFK A;  4IJA A;  3BR2 A;  2ZO4 A;  1MBE A;  3FXO A;  2PMU A;  3Q3S A;  1X1C A;  5C4X J;  4M71 A;  1DDN A;  3T8T A;  3CF5 F;  4X6A J;  3HKZ A;  1K6O A;  2JA2 A;  3EET A;  2I10 A;  5E1X A;  1NK3 P;  3U1D A;  3QU3 A;  2DFE A;  5IT9 K;  1V4R A;  3MWM A;  1TQM A;  3REO A;  5JI6 A;  2Q2E B;  2W84 A;  2ZME B;  4A6D A;  2DO7 A;  1QGP A;  2KLO A;  3GME A;  3I59 A;  3LAJ A;  4Y13 A;  3KP6 A;  3MZH A;  4RGS A;  3DU5 A;  1GXP A;  2CW7 A;  2JRM A;  1GV2 A;  1LJ9 A;  3HGG A;  1FYM A;  2P6T A;  4KN4 X;  5TGT A;  1JT6 A;  2AQF A;  2E35 A;  3G1L A;  1J7K A;  3JW4 A;  1G3S A;  2EZK A;  4W97 A;  2FOW A;  4Y52 J;  2ZXI A;  1SAN A;  2JPC A;  1HKT A;  3S2W A;  4HBL A;  1UST A;  4XKB A;  2DAO A;  3ZQG A;  1HW2 A;  1OFC X;  4DW6 A;  3HZJ A;  3ABL H;  4WX9 A;  1BN5 A;  1Z6R A;  2W48 A;  3E6D A;  1IDY A;  3OYH A;  3CCY A;  4BJ6 C;  3R0J A;  2FJ1 A;  1L0O C;  3E5U A;  2R4G A;  2GA1 A;  4N9I A;  3PQK A;  2X6O A;  1WJD A;  3M8J A;  4AIH A;  2FX0 A;  3F21 A;  5L3G A;  4HF1 A;  1XCB A;  3K4N A;  4CYC A;  3HG9 A;  2XAU A;  1VI0 A;  5GP9 A;  5KVR A;  4A3G J;  1ZKG A;  5A2Q K;  3S16 J;  4I02 A;  2I8D A;  1KU7 A;  3IAM 2;  2DA5 A;  3MEX A;  3KEQ A;  2JQ7 A;  3A4C A;  3FIW A;  1FOW A;  1JGS A;  3V7S A;  3RPU A;  1LE8 B;  1IN6 A;  4A6E A;  2K3P A;  3DBH B;  2CO5 A;  1KON A;  5F0H A;  5J8C A;  3CCR I;  2VQC A;  4YFK F;  3O8H A;  2XGC A;  4A3J J;  2XAH A;  3OIQ A;  1PYV A;  3AG1 H;  1Z6T A;  1F36 A;  3VYR B;  1CQT A;  4X1E A;  2DW4 A;  3ZMZ A;  1CF7 B;  4Z6Y A;  1PUF B;  2Y0M A;  4PFP A;  2A61 A;  1OCC H;  1S72 I;  1JUP A;  1MNE A;  2P5L C;  3K4M A;  2G0E A;  2MYS A;  3GO5 A;  4C3J J;  4U7D A;  4BBR J;  1K4S A;  3ZN0 A;  2OC6 A;  3GXO A;  4II3 A;  4L0Y B;  2V79 A;  4NBQ A;  2E2I J;  4G12 A;  3HHH A;  4CO8 A;  2KRC A;  2VPR A;  4ENN A;  1IXS B;  2VB6 A;  1YJW I;  2P5V A;  5LGN A;  3BP8 A;  4LK0 F;  2VUM J;  4BE1 A;  3W2V A;  3IH3 A;  2FNA A;  1V54 H;  2HYJ A;  2EA2 A;  1LDK B;  4FTH A;  2HWV A;  2IXS A;  1MMD A;  2KL4 A;  4D1Q A;  3JTG A;  4AWX B;  1GLN A;  4FT8 A;  5DD8 A;  3VFZ A;  4J19 A;  2HQN A;  2XKP A;  4OIQ F;  2EZI A;  3WU1 B;  4GFB A;  2V6C A;  4BAY A;  4HLX A;  3V8K A;  5KNL A;  1R4M B;  4BJ5 C;  4Y3O A;  4BQA A;  3WOD F;  3H5A A;  4BXU A;  2VI6 A;  5HS9 A;  2GIV A;  3QRF F;  1R6R A;  2M8E A;  3DEU A;  4E70 A;  4ZH4 F;  3QQA A;  3Q5F A;  1ON1 A;  2DFI A;  3JR9 A;  1EV7 A;  3CLQ A;  3CP8 A;  4N4O B;  1N75 A;  1BL0 A;  1W0T A;  2R3S A;  2HPM A;  3OWT A;  4NNJ A;  2ZKZ A;  4E7S A;  1G3W A;  4MQV A;  3K1M A;  4IX7 A;  2XRN A;  4P5O A;  1DPR A;  4M9X A;  1W5S A;  1A6I A;  3R4K A;  2V1N A;  4B3X A;  1USS A;  2V26 A;  1E17 A;  3WGG A;  4R8H A;  4L9V A;  3LSR A;  3E3V A;  3KLN A;  5EGO A;  1J2X A;  1ORK A;  3OMY A;  4A0Y A;  4QIW N;  2XRO A;  4CA0 A;  2DOA A;  2XAJ A;  4G6T B;  3PIO F;  2IS1 A;  1U5T A;  2HVQ A;  3C18 A;  2HQA A;  2L02 A;  3GLX A;  4LFU A;  1T2K A;  5FKN A;  1Y56 A;  2W25 A;  4XKW A;  3SDG A;  4KA4 A;  1YIT I;  2BW3 A;  1NH3 A;  2JJ7 A;  2HI3 A;  3CJN A;  1MBF A;  4PGG A;  3LOC A;  2DQL A;  2WAF A;  3CES A;  3KFW X;  3OOP A;  1C0W A;  2QVO A;  3SDB A;  1X1B A;  2E1M C;  3H3V K;  3K10 A;  3OL4 A;  1ENH A;  3UR3 C;  2ICW G;  5IPA A;  3KEY A;  5DDG A;  4FX4 A;  4KIC A;  2KZG A;  4LIU A;  2Y31 A;  5H20 A;  2CMP A;  2YU9 J;  1ETQ A;  4IKF A;  5LLQ A;  3QOP A;  3QAH A;  4CZC A;  1PJR A;  1U8B A;  4FE4 A;  3G4S I;  4B1R A;  3HIF A;  1B9M A;  3OYB A;  2BY1 A;  2DK8 A;  3DWL E;  3C2G A;  3SEQ A;  1R4N B;  3WTY C;  4YFN F;  5L3F A;  4BY7 J;  3DBL B;  3F3X A;  4GDF A;  1B59 A;  3RDI A;  3HL2 A;  2R0Q C;  4ENJ A;  2F4I A;  5CPR B;  3WE2 A;  4G94 A;  1TWF J;  2OUM A;  3K4L A;  3GTM J;  4G6D A;  4HNT A;  3FX3 A;  2CH0 A;  3FXQ A;  4NQW A;  2VLA A;  1R5I D;  3HPG A;  5H2F C;  1E3O C;  5M5Y J;  1W5C C;  2RQQ A;  4XON A;  3VWB A;  3BG7 A;  4L5J A;  5FRN A;  2BV6 A;  1U2W A;  2R7O A;  2KIM A;  1I39 A;  4XLH A;  5LHI A;  3A01 A;  4RM2 A;  5LEJ A;  2RN7 A;  1FYL A;  1S5L C;  3I9V 2;  3L09 A;  3EUK L;  3KP4 A;  3M7G A;  3BWG A;  2OQR A;  1R1T A;  4B47 A;  2DA7 A;  3J81 K;  4OWR B;  5J4Y A;  1SD7 A;  3PUB A;  2LOO A;  2HGC A;  4DIQ A;  4ZDP A;  1OCP A;  1RR7 A;  4XQF A;  5GAD J;  3HPH A;  5ICG A;  2A3S A;  3UKG A;  1TWC J;  2WAQ A;  1BM9 A;  3ECH A;  4PJJ A;  5HDG A;  2X6X A;  2R7Z J;  1SAU A;  2ECB A;  4UB8 C;  4BS9 A;  3I59 B;  2ESN A;  2D45 A;  4HOB A;  3ROU A;  5IT3 A;  4E7I A;  2D5V A;  3A1Y A;  2DT5 A;  3I3L A;  4F52 A;  2NOG A;  2L9R A;  1YS6 A;  1IRZ A;  2L7F P;  4NC7 A;  2FMY A;  3RZO J;  3HSF A;  4YII A;  2LF7 A;  2NVT J;  5CVJ A;  2HYG D;  5ICC A;  1G3T A;  4D0P A;  1XTA A;  5HS7 A;  1J9I A;  2F6C A;  2M2E A;  3HRT A;  3QYB A;  1N78 A;  1P4X A;  2ZJR F;  2CQK A;  4AU7 A;  1XS9 A;  3SZP A;  1YQA A;  3FM5 A;  3RKQ A;  1WJB A;  3S2H J;  2CG4 A;  2X1D A;  3FMR A;  1X58 A;  3T5X A;  1T38 A;  2LG4 A;  2XPU A;  2FBH A;  3LA2 A;  1H9G A;  2R7T A;  1R5H A;  1MBJ A;  1UFM A;  2DTR A;  1IN4 A;  2O0Y A;  4YRV A;  3LSK A;  4OIO F;  5IOY A;  4RLF A;  4HF2 A;  2EZH A;  1D5V A;  3LST A;  1TQI A;  5B1B H;  3H0G J;  4KMU X;  3CTA A;  3AG4 H;  3QPH A;  2ISY A;  3M8F A;  9ANT A;  2DA4 A;  2PJR A;  1WHU A;  2GWR A;  2PMH A;  4RA2 A;  4F55 A;  2F4M B;  5FLM J;  3CJR B;  3M8E A;  4LIV A;  1D3Y A;  1U6G A;  4WCG A;  2NAZ A;  4S04 A;  5F08 A;  1DU6 A;  5ICE A;  2V9V A;  4RM3 A;  4R1H A;  5D8L B;  1XGN A;  2RDP A;  1XDU A;  5L3C A;  4EJU A;  2FE3 A;  3L2R A;  1XSD A;  1RUN A;  1UB9 A;  2BGC A;  4IRG A;  3U1K A;  4EJO A;  3ZQC A;  3RKW A;  2JRT A;  3BPX A;  3S14 J;  2MG4 A;  3VSL A;  1FBQ A;  2HKO A;  3LWF A;  2VOD A;  4MHG A;  4DZJ A;  2XVC A;  1Q1H A;  3ZMU A;  4LD5 A;  5E8I A;  1SAX A;  1Z21 A;  5EZH A;  1VQ4 I;  3B6C A;  1FSH A;  3ZMV A;  3RPQ A;  4XN3 A;  3OOU A;  5DV5 A;  4EJT A;  3I54 A;  1W36 D;  2KT0 A;  4HQE A;  4CGZ A;  2HQR A;  2WA0 A;  2NXN B;  1Z3X A;  3G71 I;  4QWQ A;  2IS2 A;  3ZQI A;  1BIB A;  4ZZL A;  2CUJ A;  5E3L A;  1U78 A;  2IGK A;  5D4S A;  4MEY F;  5D5V B;  1ITY A;  5FO5 A;  4F92 B;  1W7P A;  3S93 A;  1B1B A;  2QCO A;  5HS8 A;  4HA8 A;  4ETS A;  4G9Y A;  2WAD A;  3HOX J;  1IV6 A;  2L5Q A;  3R60 A;  4XLF A;  3IUO A;  2CQX A;  1LVK A;  2HEO A;  3V42 A;  3GFL A;  5F27 A;  1UG2 A;  2QKM B;  4DOZ A;  2VJI A;  2O61 A;  2XV4 S;  3F23 A;  1VQM I;  2FQ3 A;  1ETW A;  1XGM A;  2EV6 A;  3RTR A;  2L3D A;  3ZOB A;  1VZ0 A;  2OA4 A;  2WAQ N;  1IN8 A;  3IWZ A;  2K27 A;  4OOI A;  3CC2 I;  3ML6 A;  2XPV A;  4WXC A;  5CLS A;  2R5Y B;  1E2X A;  4WXD A;  4IHW A;  1HDD C;  1K79 A;  3T1B A;  3V4G A;  2IGN A;  1XGO A;  2GBY A;  1ZYR F;  2JA6 J;  2A6T A;  3DLA A;  1XB4 A;  2X0L A;  2XF6 A;  5ICF A;  1ZGJ A;  3KET A;  4EQQ A;  3KYL A;  3C2B A;  1LEB A;  2A6H F;  2BW3 B;  1IUY A;  4BH9 A;  4G7O F;  4B8X A;  3VDX A;  3L1P A;  1G4D A;  5LEK A;  2PI0 A;  1RKW A;  4KT5 C;  4JP0 A;  5F0C A;  2F4O B;  3DF8 A;  5EYR A;  2JA5 J;  1QZY A;  5J1R A;  1U0J A;  3LQR A;  3EUH C;  3R61 A;  4UVB A;  3G2B A;  2JUC A;  1YYV A;  3CQZ J;  3MCZ A;  3BCA A;  4CXF A;  3S2D J;  4A93 J;  2JWT A;  3FXK A;  2E1O A;  1R00 A;  2HYF A;  2R7U A;  2FXA A;  4L9T A;  4BAC A;  3QWL A;  2H8W A;  3ZQF A;  3MN2 A;  3IRQ A;  3OYD A;  2LMD A;  4XLA A;  4UNO A;  3FMS A;  4PUS A;  2DTZ A;  2X6Y A;  4HEA 2;  3D5S C;  2QEN A;  4N9H A;  4XLP F;  2XAF A;  5HLG A;  2L4A A;  1X1D A;  2DT6 A;  4M3E A;  3E6M A;  3GTG J;  1ONV A;  3U2R A;  1MMS A;  2K4J A;  5K1Y A;  1R23 A;  3DBR B;  4L18 B;  1BIA A;  3SFI A;  1TW2 A;  1STZ A;  2E19 A;  4M74 A;  2EIN H;  3TW7 A;  3HBL A;  4XKC A;  1PDN C;  3D0S A;  3OYN A;  3PJR A;  4PCQ A;  1KU2 A;  2GQQ A;  2IJL A;  2CQ7 A;  4JX4 A;  5LHH A;  5D5W B;  2NNY A;  2LKP A;  4CIC A;  4NQW B;  2R5Z A;  1KZH A;  1EH6 A;  4KNY A;  4HNU A;  1B9N A;  4DYC A;  2GOX B;  2MBF A;  2YUS A;  2R7F A;  4XNF A;  5IP6 A;  2ZJQ F;  1MMN A;  2VQH A;  5JFR A;  3SFZ A;  1JJ6 C;  1R22 A;  3RYP A;  1WKM A;  3P9C A;  1J5Y A;  1MJA A;  3DKW A;  4JOM A;  5FFX A;  3D1N I;  4A3B J;  5FKK A;  3A01 B;  3JRD A;  4KIF A;  3P7N A;  1RNL A;  1J59 A;  3NQO A;  3FZV A;  1EKE A;  4FQG A;  3WU0 A;  3IKT A;  4HDU A;  2RC4 A;  2W4S A;  4MTD A;  4XSZ F;  2YU3 A;  1I3A A;  3KYC B;  2DFF A;  4EM2 A;  3LSG A;  5E3O A;  1F5T A;  3F0C A;  4HDV A;  2DT7 B;  2O7O A;  4PDK A;  1NG7 A;  5GTI C;  1JTY A;  3IV5 A;  1IC8 A;  3WTW C;  5DD4 A;  1WRJ A;  2WC2 A;  4I76 A;  4A0Z A;  3TKY A;  1I27 A;  4B43 A;  1OLT A;  2EFO A;  1KQ0 A;  2W57 A;  3L2Q A;  3O2P E;  1OCO H;  2EV0 A;  1RPW A;  1JUS A;  2VQG A;  2ZXH A;  4Y4R A;  3W6J B;  2M4G A;  4A12 A;  3K6G A;  1BJZ A;  1JT0 A;  2ZB9 A;  4KYW A;  2E7W A;  3CCU I;  2QUF A;  1LFB A;  3ZP5 A;  4OMY A;  2JT1 A;  1YOV B;  3LSI A;  3F8B A;  2EQR A;  1ZQ3 P;  3EYY A;  2PN6 A;  2BEO A;  5EG0 A;  1BC7 C;  3WGH A;  3NAR A;  4PFO A;  1ZAR A;  1QNT A;  2L2O A;  2PMZ A;  2UXX A;  3CMA I;  2VJ5 A;  2M0C A;  3IHU A;  2KQR A;  4P1W A;  4YG2 F;  5DM7 F;  1ZR2 A;  2ID3 A;  1UZC A;  1P4W A;  2RRE A;  4I98 B;  3W2W A;  1FOK A;  4Q47 A;  3V8L A;  3DPU A;  2E1N A;  4IZZ A;  3G6E I;  4Y7N J;  2OF7 A;  1FX7 A;  2L7M P;  1TLH B;  2DOF A;  2QSH X;  2GXA A;  2F5F A;  3BJO A;  1FTZ A;  3BJ6 A;  2DPD A;  5LGU A;  3OIO A;  3TQN A;  4ENM A;  5CVU A;  2XSJ C;  2QGU A;  4D9J A;  5EEG A;  1OCZ H;  1HCR A;  2PJR B;  5HLT A;  2MLK A;  4XK4 A;  4JX5 A;  2M5W A;  4I7H A;  5GAG J;  3BTJ A;  4NDL A;  2HDW A;  2NOJ B;  2K9N A;  5M5W J;  3WTS C;  2ISZ A;  1S29 A;  2ZXJ A;  3DEE A;  3RPU D;  1AKH A;  4B3A A;  1N77 A;  1ZAO A;  3CUQ A;  2DN0 A;  4F7Z A;  2O8K A;  3L2V A;  1RR8 C;  2A07 F;  1JUM A;  3HRM A;  3CC4 I;  3ELK A;  1HST A;  1YHQ I;  3K69 A;  2MA3 A;  3JTH A;  5EZG A;  1FLI A;  1U3E M;  2M45 A;  3HSE A;  4N0B A;  1W1W E;  4AVZ A;  4ITV A;  4DJA A;  4Y33 A;  2KJB A;  2STW A;  2X85 A;  2Z1D A;  3ECO A;  1UCR A;  3CF2 A;  2YPR A;  1IXR C;  2EFQ A;  4CUG A;  1RES A;  5FJ8 J;  1I5Z A;  2A6E F;  4PSX A;  1MND A;  2VKE A;  2CW0 F;  2WAE A;  1VTN C;  1JKQ C;  1A36 A;  4AUX A;  3GEZ A;  1EF4 A;  5J40 A;  3DKX A;  1WSU A;  4O3M A;  1BW6 A;  4LG3 A;  2LRE A;  4A5N A;  5L3E A;  5LRS A;  1W7P B;  2HZD A;  1MSF C;  2HDD A;  2FU4 A;  1UHS A;  5LD2 C;  2LKS A;  2GAU A;  4ZC3 A;  2OTJ I;  4QPO A;  2KRH A;  1FBS A;  1FMW A;  2Z9O A;  3LA7 A;  2PBI A;  3S17 J;  4BXX J;  2LLK A;  1S7E A;  1O57 A;  1GVJ A;  1O7L A;  3K4K A;  2CFO A;  3GWZ A;  2XIG A;  3A0B C;  4CCL A;  4YIR X;  2O3F A;  3LSM A;  2CUZ A;  2FRH A;  2GZW A;  3KLO A;  5KK1 A;  3FK6 A;  4FAS D;  1IJW C;  2HOE A;  3HOU J;  2FEZ A;  3GTL J;  2H94 A;  3GVA A;  4XSX F;  1LPQ A;  4LG0 A;  4BHB A;  4BUP A;  4U7B A;  2CFX A;  1F9N A;  4M9S A;  4UY8 I;  3RKX A;  2UXN A;  2V1U A;  1IZ1 A;  4HLY A;  4KMF A;  3TOA A;  1RUO A;  3OYL A;  3I55 I;  2V4J C;  1WI3 A;  2BVL A;  4XKV A;  3SJM A;  2DA2 A;  1QU3 A;  3CZ6 A;  3GTO J;  4XOR A;  2QZ8 A;  1XSV A;  5CVR A;  3CJT B;  3LSP A;  5FKL A;  3K70 D;  1B4A A;  3KCC A;  1F43 A;  3PUF A;  2W82 A;  2VKV A;  3ASN H;  1HW1 A;  1MDM B;  2PMZ N;  1MW7 A;  1DP7 P;  3I71 A;  2V1X A;  2XGX A;  4D7M A;  4H4K C;  2G9W A;  1A31 A;  2Z3Y A;  1T8I A;  1L3L A;  2KJC A;  1P7J A;  3UNG C;  4N4N B;  4IO9 F;  4LLG F;  4S05 A;  1OMI A;  1Z67 A;  1ODD A;  1WH7 A;  1IRF A;  2QQA A;  4YFX F;  2QQ8 A;  2LY9 A;  3DEW A;  5CKT A;  1T0F C;  3IP4 B;  4FX0 A;  3C2H A;  1D5Y A;  1Z0X A;  4L9J A;  2K9Q A;  2K3F A;  5HOO A;  2HOT A;  2BXZ A;  2OZ6 A;  4M6V A;  3MKW B;  2H27 A;  5FGM A;  2DCE A;  1OR7 C;  1TTY A;  2EH3 A;  2HPI A;  3I5U A;  2JSP A;  2L0K A;  5E18 F;  3DFG A;  3E7L A;  2RNG A;  1SVO A;  1V5E A;  1ZLJ A;  4M3F A;  1U9O A;  2TDX A;  1SMT A;  5D5X B;  1GV5 A;  3BZK A;  4I0B A;  4A3L J;  4ON0 A;  1V5G A;  3RQ4 A;  3WG9 A;  3TP0 A;  3H5R A;  2CUF A;  4BE0 A;  3OIP A;  1O3T A;  2BE5 F;  4ZTF A;  1HOM A;  1ZRE A;  1G2H A;  2BXY A;  2R7Q A;  1Y8R B;  3OSG A;  3J7A O;  1TQP A;  3FKJ A;  3NEU A;  1O3S A;  1E3H A;  2VBX A;  1XCV A;  2WB1 A;  1T6S A;  3KZY A;  2K9L A;  1QHG A;  3BPV A;  2EWN A;  3FBI B;  1A5J A;  4CCK A;  4A3K J;  1S3J A;  1T33 A;  3EUH A;  1TT0 A;  2V6E A;  1IUF A;  1UEL B;  4B09 A;  1W36 C;  2CV1 A;  3TBI A;  4UUT A;  3AG3 H;  1SD5 A;  1QA6 A;  2ZSH B;  3R0A A;  2BHZ A;  2D2W A;  2GLO A;  1XG1 A;  3N05 A;  3NWS A;  1BW5 A;  1D0Z A;  2AXT C;  4GYG A;  2XB0 X;  3CD6 I;  3M3Y J;  1LFP A;  4RMN A;  1IXC A;  2KIU A;  5IP9 J;  4ENK A;  3H1C A;  2W00 A;  1ZLK A;  5E79 C;  3AKZ A;  1YW7 A;  2JK3 A;  2M7B A;  3D5R C;  4MQ9 F;  3M07 A;  4QPQ A;  1TW3 A;  3T8R A;  3A2K A;  2PFB A;  1MD0 A;  1XGS A;  2OAZ A;  2Z33 A;  1X3W B;  2E71 A;  2LC2 A;  3WE3 A;  2NVY J;  2CUE A;  3DXJ F;  1K78 A;  2V7F A;  3LFU A;  5EG0 B;  1MH3 A;  4X0G A;  3M1E A;  1AU7 A;  3EDP A;  4PK4 A;  1EH7 A;  2BY0 A;  1P4A A;  2L7K A;  3D5L A;  3Q0W A;  4OMZ A;  1WZ2 A;  3J80 Z;  5D4R A;  2BHY A;  1OKR A;  4XBF A;  1YS7 A;  4CCM A;  4RDU A;  3E6C C;  4OAY A;  3BTL A;  2ZNZ A;  1V55 H;  1X19 A;  4RAG A;  5K5R A;  4HF0 A;  3ONQ A;  3GFI A;  1GDT A;  3DP7 A;  2DPU A;  4ZDL A;  1R7J A;  3ABU A;  4E7L A;  4P9U A;  3G3Z A;  4HX8 A;  2CQQ A;  3H5N A;  3DLL F;  3RI4 A;  1FYK A;  1SFU A;  2TRT A;  4OIR F;  1WJE A;  4NB5 A;  3TO6 A;  2JA8 J;  1IF1 A;  4CSW A;  1HKS A;  4GYI A;  4IHY A;  5AIQ A;  5H6Q A;  1BI0 A;  4PJL A;  3OYI A;  2X9D A;  1MMA A;  1WJA A;  4HX4 A;  4RGR A;  1A6Q A;  1MJ9 A;  4ANJ A;  2KRF A;  4P9F A;  3BOQ A;  3QOD A;  2H8R A;  1MBH A;  1W0U A;  1AKH B;  5FRM A;  3CUQ B;  4OIN F;  3COA C;  4BYY A;  3ZQH A;  4E6K G;  2R7X A;  2Q0O A;  3ERM A;  1X4P A;  3FHN A;  3GZN B;  2E1C A;  2XGD A;  4IL6 C;  2BVM A;  4AIJ A;  5E3M A;  1B72 A;  1HDP A;  2Z5U A;  1YIJ I;  4V2G A;  1D0X A; 
#chains in the Genus database with same CATH homology
 1LDD A;  2PQ8 A;  4FHT A;  5DYM A;  2DQR A;  1OPC A;  4ASN A;  1OYI A;  1R5G A;  1REP C;  4M6X A;  3N97 A;  5CYV A;  4EJW A;  5E1W A;  2HFH A;  1Z91 A;  5F1R A;  1JXS A;  2VON A;  5ILS A;  2L4M A;  5ILU A;  1BC8 C;  1R58 A;  3C3W A;  1W7P D;  3MQ0 A;  2L54 A;  3QPT A;  3EQL F;  5LGT A;  1XD7 A;  3TDZ C;  4I0A A;  4M73 A;  4EV0 A;  3V7R A;  1F1Z A;  1ZRC A;  2VE9 A;  1QQI A;  2ELH A;  3QP5 A;  4IXA A;  2VC1 A;  2COM A;  4U0Y A;  3ULQ B;  5BPI A;  2FSW A;  3O6B B;  2YSR A;  3FF5 A;  1Z05 A;  1WI9 A;  3IKV A;  5BMZ A;  5DUK A;  4UHT A;  4G8X A;  3LFK A;  2OU2 A;  2X4H A;  4KIG A;  4YIF A;  4JBA A;  2LF8 A;  4RB1 A;  5LBQ A;  3W6K B;  5LRR A;  1SMY F;  3T0Y A;  2A69 F;  4O5V A;  4WWC A;  2ZJ2 A;  4LMY A;  1K7A A;  4I09 A;  5FB2 A;  1D8J A;  3DPT A;  1Z9C A;  1U8R A;  4O6J A;  3J80 K;  4PGH A;  5L3D A;  3BY6 A;  1KYZ A;  2V1D A;  4RGX A;  2EV5 A;  1XMA A;  1S6L A;  4IHS A;  2OQG A;  2IA1 A;  3ABT A;  3I53 A;  2XAQ A;  2NS0 A;  2VE8 A;  3I4P A;  4G6Q A;  2EFN A;  4U88 A;  2HZT A;  3FXR A;  5HDN A;  3K1N A;  4I2O A;  2VBZ A;  3SXY A;  3SHF A;  5JHU A;  2ZBK A;  1U5T B;  2EB7 A;  3EYI A;  4LB5 A;  1T0F A;  3KZZ A;  5L3B A;  3AAF A;  2Q8K A;  5E17 F;  2JTV A;  4HV5 A;  4NHJ A;  1BI3 A;  4GO1 A;  1J0R A;  1K78 B;  2FML A;  2VT3 A;  3LQQ A;  3BJA A;  3F22 A;  2D1V A;  2EA4 A;  2VOP A;  1YW8 A;  2G7H A;  5K5Q A;  2XKO A;  3WTX C;  3GZ6 A;  1O3R A;  2Y75 A;  4HYE A;  2YX4 A;  4RGU A;  3VOD A;  1UHW A;  4XLN F;  3E6B A;  4HQM A;  3HOT A;  1FPQ A;  2F5D A;  1BBY A;  1FSE A;  2VXZ A;  1MGT A;  3VEP A;  5ERI A;  2OD5 A;  3KE2 A;  1T39 A;  1TBX A;  4G7H F;  2F2E A;  4RB0 A;  4ZYH A;  1ZRF A;  2NYX A;  2PG4 A;  2J5P A;  2ZNY A;  1XMK A;  1SD6 A;  3GW2 A;  2RKH A;  2HTS A;  1QO0 D;  2G7U A;  5DEQ A;  1MJB A;  3Q9S A;  4OIP F;  3K2Z A;  4EGY A;  4BHP A;  4ZYD A;  1SFX A;  4DNC A;  4Y17 A;  5F6F A;  2EFP A;  2QQ9 A;  2D1H A;  2VT2 A;  1A04 A;  2AXL A;  1YFH A;  4A5M A;  4LK1 F;  2STT A;  4A2U A;  2RNJ A;  1F4K A;  3H3Z A;  2DBB A;  4CDG A;  2MH9 A;  2YR2 A;  1I1G A;  3FHZ A;  1QZZ A;  4KN7 X;  1SD4 A;  3E5X A;  3BRO A;  3SZT A;  3TGN A;  1KGS A;  3ERE D;  3VOE A;  4UXN A;  4KUM A;  5TRD A;  1FC3 A;  2UWM A;  3PFI A;  3P9K A;  1IW7 F;  3BDD A;  3I64 A;  2VBW A;  1LQ1 A;  2FBK A;  4UVC A;  3FXU A;  5BS6 A;  3IRR A;  1LNW A;  3CO6 C;  4AD9 A;  1R1V A;  1FP2 A;  2C6Y A;  3JSO A;  1ULY A;  1X3U A;  3V8J A;  4CZZ A;  3HTU A;  1P92 A;  4QLC U;  3SQN A;  1HKQ A;  1FWZ A;  4Z2Y A;  2PLY A;  2O8X A;  1R1U A;  3I58 A;  1B6A A;  5D5U B;  5J6X A;  1HSJ A;  2P7C B;  1J75 A;  4L9N A;  1ZGA A;  3IL2 A;  2JPB A;  2ADU A;  2VBY A;  2A5Y B;  2L01 A;  4LJZ F;  1XDS A;  2BBY A;  4U0V A;  5FLX Z;  2IA0 A;  4Y15 A;  3PQJ A;  1BJA A;  5HVQ C;  3ZN1 A;  2CSO A;  1W4M A;  1QPM A;  2H09 A;  2M87 A;  2ESH A;  3DPL C;  1XN7 A;  5AON A;  3ZPL A;  3FMQ A;  5FD6 A;  4JQF A;  3GFJ A;  1LB2 A;  3J81 Z;  2ZCW A;  2FOK A;  2NRA C;  4Q48 A;  4UUV A;  3K1P A;  1ZRD A;  1RI7 A;  4HX7 A;  2GA2 A;  3JAM Z;  5DCF A;  5K5O A;  5CVV A;  3F6O A;  3HSR A;  1KA8 A;  2JSC A;  1R36 A;  4ESJ A;  1YG2 A;  1H9T A;  1YIO A;  1S7A A;  3M9A A;  2VOO A;  1KQ9 A;  1MZB A;  2MD5 A;  3ISP A;  4Q5S F;  5DCM A;  2CGP A;  5J8F A;  4RB3 C;  4KIB A;  4BNC A;  1FNN A;  2K4B A;  5CJ9 A;  5TJJ A;  1HW5 A;  2VN2 A;  4DQ2 A;  3HUG A;  1G6N A;  3KP2 A;  1WQ2 A;  1HQC A;  1OYW A;  3NRV A;  4IVN A;  4IHT A;  1LEA A;  4OU0 A;  4HZF A;  3WTU C;  4RAY A;  5BOX A;  2GXB A;  2RQP A;  2PJP A;  4LGW A;  1NHA A;  2RGV A;  2P8T A;  1BI2 A;  3HOS A;  1BOA A;  1BI1 A;  2MH2 A;  3MAJ A;  4ZZD A;  5E8G A;  2XUB A;  4RAZ A;  4WK8 F;  1O3Q A;  2KIF A;  2RVC A;  4IF4 A;  4IRH A;  4PZJ A;  1FP1 D;  3QU6 A;  3FWE A;  2F5E A;  2XAG A;  1TNS A;  1JHF A;  3L2C A;  3CUO A;  3I0T A;  2R7D A;  6PAX A;  4L5I A;  1EH8 A;  3B73 A;  3DQV C;  4M72 A;  1Z1D A;  1JE8 A;  1WWX A;  4GGG A;  1O7F A;  2IT0 A;  2HDC A;  2EJR A;  1FY7 A;  2P5K A;  3OV8 A;  2B0L A;  1ZN2 A;  5FLX K;  1YTY A;  5HDK A;  1JHH A;  2DK5 A;  3C7J A;  5FD5 A;  1V3F A;  3HRS A;  5FFZ A;  1AWC A;  4GXO A;  5F64 A;  2RV8 A;  3N4M A;  3E5Q A;  1P6R A;  3L7W A;  1I1S A;  2QQB A;  4ESB A;  4CYD A;  2NNN A;  5EEH A;  3JSP A;  4M6Y A;  3JAM K;  2OBP A;  3L9F A;  1XSX A;  3CUQ C;  3GX4 X;  3K9T A;  2QBY A;  4JK1 X;  1G3Y A;  4UVA A;  5JVT A;  2HR3 A;  2WV0 A;  1Z7U A;  3GUD A;  4HV6 A;  2EK5 A;  1ZG1 A;  4XRF A;  2JZY A;  2ETH A;  2CYY A;  1ZG5 A;  1YLF A;  1S8N A;  4LG0 B;  1MKM A;  4A0X A;  3ZMS A;  2ZFW A;  1HXD A;  5HLI A;  2FBI A;  2DLL A;  2LDU A;  1H0M A;  3VB2 A;  3LAP A;  2Y48 A;  1LDJ A;  4MGR A;  3H92 A;  3RIR A;  4MEX F;  3U9G A;  3KP5 A;  4ESF A;  3WGI A;  3BZ6 A;  5ED4 A;  3TOB A;  2K02 A;  1ON2 A;  3CO7 C;  5LHG A;  4MNU A;  3HYI A;  2IA2 A;  2E7X A;  1AOY A;  5E20 A;  1DPU A;  2M30 A;  3CLO A;  4H0E A;  4HAM A;  2BYV E;  1PUE E;  4LLN A;  3F8F A;  4Q4Z F;  5D6F A;  1YO5 C;  5BPD A;  3WTT C;  4L0Z B;  3DV8 A;  1DUX C;  1QBJ A;  3F8N A;  3Q9V A;  4IPA A;  2J5O A;  5DCM B;  2H6C A;  3WTZ A;  2Q2E A;  2ZME A;  5CVI A;  3IWF A;  1KYW A;  2VC0 A;  3MZY A;  2A68 F;  2QLZ A;  3RJP A;  2WTE A;  3KEO A;  3F8M A;  2CWE A;  1FT9 A;  4IRI A;  1S7O A;  4KDP A;  1ZH5 A;  3F6V A;  1SFE A;  2H6B A;  2IVM A;  3F8C A;  2W24 A;  3KP7 A;  4P96 A;  4EM0 B;  4WF2 A;  5DUI A;  3B02 A;  4CHU A;  1ZHF A;  1PP7 U;  4LLL A;  3ZMT A;  1KQ8 A;  1OR7 A;  2IP2 A;  2KKO A;  2Z99 A;  4MTE A;  4KFC A;  2HS5 A;  3LA3 A;  4ZYG A;  2YX7 A;  3GZ5 A;  3F72 A;  2P7V B;  1OYY A;  2PEX A;  5IT9 Z;  2DI3 A;  1P2F A;  2QWW A;  1T98 A;  2OZU A;  3HRU A;  4R79 A;  2ACJ A;  2HTJ A;  5AIP A;  1MDM A;  1KU3 A;  1FZP B;  2LSO A;  4UV9 A;  2O6G E;  2AS5 F;  1CF7 A;  5JR3 A;  3CDH A;  1Y0U A;  5H6R A;  3GFM A;  2MLG A;  1U5T C;  4EM1 A;  3WTV C;  4EGZ A;  4M9Z A;  4TV7 A;  2M1B A;  4RS8 A;  3TDU C;  3V7C A;  4ZYE A;  4I01 A;  1TNT A;  1YW9 A;  2HKX A;  4AIK A;  3KP3 A;  1ZG3 A;  1LVA A;  1IN7 A;  3HHG A;  5D8K B;  1UHM A;  1GHC A;  5HLH A;  3ZMD A;  3L00 A;  3FM3 A;  2F5C A;  1CGP A;  3GF2 A;  3C1D A;  3ZQ7 A;  5A2Q Z;  5BQT A;  1FBU A;  1RZ4 A;  2FF4 A;  4G7Z F;  4P55 A;  4K2E A;  3TO7 A;  4HW0 A;  2P4W A;  2IRF G;  4WXH A;  2W85 A;  2UZK A;  5D6E A;  1IAW A;  3TO9 A;  4LB6 B;  3O3K A;  4EJV A;  3K0L A;  2MC3 A;  2QYO A;  1HBX G;  4EMS A;  2EFW A;  1D8K A;  2P6S A;  1IRG A;  2LNB A;  2QBY B;  2FA5 A;  2FNP A;  2DU9 A;  4U0W A;  2K7L A;  3H3U A;  3HTS B;  2WWY A;  3R6S A;  1I6X A;  2XHK A;  1KU9 A;  2IPQ X;  1PP8 F;  1RIO H;  3P9I A;  1GXQ A;  4AVP A;  3GYH X;  3G73 A;  2O03 A;  5E1Z B;  2XAS A;  3IC7 A;  3RYR A;  4GCV A;  4RB2 C;  1IN5 A;  2QM3 A;  5ILV A;  2GXG A;  2IW5 A;  3E97 A;  3QP6 A;  3RKY A;  4UV8 A;  4EVI A;  1W5T A;  2K86 A;  4BHC A;  3MFK A;  4IJA A;  2ZO4 A;  2PMU A;  4M71 A;  1DDN A;  3T8T A;  1K6O A;  3EET A;  5E1X A;  3U1D A;  3QU3 A;  5IT9 K;  1V4R A;  3MWM A;  1TQM A;  3REO A;  5JI6 A;  2W84 A;  2ZME B;  4A6D A;  2DO7 A;  1QGP A;  3I59 A;  3LAJ A;  4Y13 A;  3KP6 A;  3MZH A;  4RGS A;  1GXP A;  1FYM A;  1LJ9 A;  2P6T A;  4KN4 X;  1J7K A;  3JW4 A;  1G3S A;  2JPC A;  1HKT A;  3S2W A;  4HBL A;  1UST A;  2DAO A;  1HW2 A;  4WX9 A;  1BN5 A;  1Z6R A;  3E6D A;  3R0J A;  1L0O C;  3E5U A;  2GA1 A;  4N9I A;  3PQK A;  3F21 A;  4AIH A;  4HF1 A;  5L3G A;  1XCB A;  5KVR A;  5A2Q K;  4I02 A;  1KU7 A;  3MEX A;  3KEQ A;  1JGS A;  3V7S A;  3RPU A;  1IN6 A;  4A6E A;  2CO5 A;  5J8C A;  4YFK F;  2XAH A;  1Z6T A;  2DW4 A;  3ZMZ A;  1CF7 B;  2Y0M A;  2A61 A;  2P5L C;  3GO5 A;  4U7D A;  3ZN0 A;  3GXO A;  4L0Y B;  2V79 A;  3HHH A;  4CO8 A;  4ENN A;  1IXS B;  2P5V A;  5LGN A;  3BP8 A;  4LK0 F;  2FNA A;  2EA2 A;  1LDK B;  2HWV A;  3JTG A;  4AWX B;  4FT8 A;  5DD8 A;  3VFZ A;  2HQN A;  2XKP A;  4OIQ F;  3WU1 B;  2V6C A;  4BAY A;  4HLX A;  3V8K A;  4BQA A;  3WOD F;  4BXU A;  3QRF F;  5HS9 A;  2GIV A;  2M8E A;  3DEU A;  4E70 A;  4ZH4 F;  3Q5F A;  1ON1 A;  2DFI A;  1EV7 A;  2R3S A;  2ZKZ A;  1G3W A;  4MQV A;  3K1M A;  2XRN A;  4P5O A;  1DPR A;  4M9X A;  1W5S A;  3R4K A;  1USS A;  1E17 A;  3WGG A;  4R8H A;  4L9V A;  3E3V A;  3KLN A;  1J2X A;  4A0Y A;  2XRO A;  2XAJ A;  1U5T A;  3C18 A;  1T2K A;  2L02 A;  3GLX A;  4LFU A;  2W25 A;  4KA4 A;  3CJN A;  4PGG A;  2DQL A;  3KFW X;  3OOP A;  1C0W A;  2QVO A;  5DDG A;  4FX4 A;  4KIC A;  5H20 A;  5LLQ A;  3QOP A;  3QAH A;  3HIF A;  1B9M A;  2DK8 A;  3WTY C;  4YFN F;  5L3F A;  3F3X A;  1B59 A;  3RDI A;  4ENJ A;  3WE2 A;  4G94 A;  4G6D A;  3FX3 A;  3FXQ A;  4NQW A;  4L5J A;  2BV6 A;  1U2W A;  2KIM A;  5LHI A;  5LEJ A;  2RN7 A;  1FYL A;  3L09 A;  3KP4 A;  3M7G A;  3BWG A;  2OQR A;  1R1T A;  3J81 K;  1SD7 A;  2HGC A;  5ICG A;  2A3S A;  1BM9 A;  3ECH A;  5HDG A;  3I59 B;  2ESN A;  2D45 A;  4HOB A;  3ROU A;  5IT3 A;  2DT5 A;  1YS6 A;  2FMY A;  3HSF A;  4YII A;  2LF7 A;  5CVJ A;  2HYG D;  5ICC A;  1G3T A;  4D0P A;  5HS7 A;  1J9I A;  3HRT A;  1P4X A;  2CQK A;  3SZP A;  1YQA A;  3FM5 A;  2CG4 A;  3FMR A;  3T5X A;  1T38 A;  3LA2 A;  2FBH A;  1H9G A;  1R5H A;  1UFM A;  2DTR A;  1IN4 A;  2O0Y A;  4OIO F;  4HF2 A;  1D5V A;  3LST A;  1TQI A;  4KMU X;  3CTA A;  3QPH A;  2ISY A;  3M8F A;  2GWR A;  2PMH A;  3M8E A;  1D3Y A;  1U6G A;  4WCG A;  2NAZ A;  4S04 A;  5ICE A;  2V9V A;  4R1H A;  5D8L B;  1XGN A;  2RDP A;  1XDU A;  5L3C A;  4EJU A;  2FE3 A;  1XSD A;  1RUN A;  1UB9 A;  2BGC A;  4IRG A;  4EJO A;  3RKW A;  2JRT A;  3BPX A;  1FBQ A;  2HKO A;  3LWF A;  2VOD A;  4MHG A;  2XVC A;  1Q1H A;  3ZMU A;  4LD5 A;  5E8I A;  1SAX A;  1FSH A;  3ZMV A;  3RPQ A;  5DV5 A;  4EJT A;  3I54 A;  4HQE A;  4CGZ A;  2HQR A;  4QWQ A;  1BIB A;  4ZZL A;  1U78 A;  5D4S A;  4MEY F;  5D5V B;  5FO5 A;  1W7P A;  1B1B A;  5HS8 A;  4HA8 A;  4ETS A;  4G9Y A;  3R60 A;  2HEO A;  3GFL A;  2O61 A;  2XV4 S;  3F23 A;  2FQ3 A;  1XGM A;  2EV6 A;  3RTR A;  2L3D A;  2OA4 A;  1IN8 A;  3IWZ A;  2K27 A;  4OOI A;  3ML6 A;  4WXC A;  5CLS A;  1E2X A;  4WXD A;  1K79 A;  3T1B A;  3V4G A;  1XGO A;  1ZYR F;  1XB4 A;  2X0L A;  5ICF A;  1ZGJ A;  3KET A;  4EQQ A;  1LEB A;  2A6H F;  1IUY A;  4BH9 A;  4G7O F;  4B8X A;  1G4D A;  2PI0 A;  5LEK A;  4KT5 C;  3DF8 A;  1QZY A;  3LQR A;  3R61 A;  4UVB A;  1YYV A;  3MCZ A;  4CXF A;  1R00 A;  2HYF A;  2FXA A;  4L9T A;  3IRQ A;  4UNO A;  3FMS A;  2QEN A;  4N9H A;  4XLP F;  2XAF A;  5HLG A;  2L4A A;  3E6M A;  1ONV A;  3U2R A;  2K4J A;  5K1Y A;  1R23 A;  4L18 B;  1BIA A;  1TW2 A;  1STZ A;  4M74 A;  1PDN C;  3D0S A;  4PCQ A;  1KU2 A;  2GQQ A;  2IJL A;  5LHH A;  5D5W B;  2NNY A;  2LKP A;  4CIC A;  1EH6 A;  4KNY A;  1B9N A;  2MBF A;  2R7F A;  5JFR A;  3SFZ A;  1R22 A;  3RYP A;  1WKM A;  3P9C A;  1J5Y A;  1MJA A;  3DKW A;  5FFX A;  4KIF A;  3P7N A;  1RNL A;  1J59 A;  3NQO A;  3FZV A;  3WU0 A;  3IKT A;  4HDU A;  2RC4 A;  4MTD A;  4XSZ F;  2YU3 A;  1F5T A;  4EM2 A;  4HDV A;  4PDK A;  3WTW C;  5DD4 A;  1WRJ A;  2WC2 A;  4A0Z A;  3TKY A;  1I27 A;  2EFO A;  1KQ0 A;  2W57 A;  3O2P E;  2EV0 A;  3W6J B;  4A12 A;  4KYW A;  2E7W A;  2QUF A;  3ZP5 A;  4OMY A;  2JT1 A;  3F8B A;  3EYY A;  2PN6 A;  2BEO A;  1BC7 C;  3WGH A;  1ZAR A;  1QNT A;  2UXX A;  3IHU A;  4YG2 F;  1P4W A;  4I98 B;  1FOK A;  4Q47 A;  3V8L A;  2E1N A;  1FX7 A;  1TLH B;  2F5F A;  3BJO A;  3BJ6 A;  2DPD A;  5LGU A;  3TQN A;  4ENM A;  5CVU A;  5EEG A;  2MLK A;  2M5W A;  4I7H A;  3WTS C;  2ISZ A;  1S29 A;  2ZXJ A;  1ZAO A;  3CUQ A;  4F7Z A;  2A07 F;  3HRM A;  3ELK A;  1HST A;  3K69 A;  2MA3 A;  3JTH A;  1FLI A;  1U3E M;  2M45 A;  3HSE A;  4N0B A;  2KJB A;  2STW A;  3ECO A;  1UCR A;  2YPR A;  1IXR C;  2EFQ A;  1I5Z A;  2A6E F;  1VTN C;  2CW0 F;  3GEZ A;  1WSU A;  4O3M A;  4A5N A;  5L3E A;  5LRS A;  1W7P B;  2FU4 A;  2GAU A;  1FBS A;  2Z9O A;  3LA7 A;  2PBI A;  1O57 A;  1O7L A;  1GVJ A;  3GWZ A;  2XIG A;  2O3F A;  2FRH A;  2GZW A;  3KLO A;  5KK1 A;  2HOE A;  2FEZ A;  2H94 A;  3GVA A;  4XSX F;  4LG0 A;  4BHB A;  4U7B A;  2CFX A;  1F9N A;  4M9S A;  3RKX A;  2UXN A;  2V1U A;  1IZ1 A;  4HLY A;  4KMF A;  3TOA A;  1RUO A;  2QZ8 A;  1XSV A;  5CVR A;  1B4A A;  3KCC A;  1HW1 A;  1MDM B;  1DP7 P;  3I71 A;  2V1X A;  2XGX A;  2G9W A;  2Z3Y A;  1L3L A;  2KJC A;  4LLG F;  4S05 A;  1OMI A;  1ODD A;  2QQA A;  1IRF A;  4YFX F;  4FX0 A;  4L9J A;  5HOO A;  2OZ6 A;  2H27 A;  5FGM A;  1TTY A;  3I5U A;  5E18 F;  3DFG A;  1ZLJ A;  2TDX A;  1SMT A;  5D5X B;  4I0B A;  4ON0 A;  3WG9 A;  1O3T A;  2BE5 F;  1ZRE A;  3J7A O;  1TQP A;  3NEU A;  1O3S A;  2VBX A;  1XCV A;  1T6S A;  3KZY A;  3BPV A;  2EWN A;  1S3J A;  3EUH A;  4B09 A;  1SD5 A;  3R0A A;  2D2W A;  4GYG A;  4ENK A;  1IXC A;  2KIU A;  1ZLK A;  1YW7 A;  4MQ9 F;  1TW3 A;  3T8R A;  2PFB A;  1MD0 A;  1XGS A;  2OAZ A;  2Z33 A;  3WE3 A;  3DXJ F;  1K78 A;  3M1E A;  3EDP A;  1EH7 A;  1P4A A;  3D5L A;  4OMZ A;  3J80 Z;  5D4R A;  1OKR A;  4XBF A;  1YS7 A;  3E6C C;  2ZNZ A;  5K5R A;  2DPU A;  4HF0 A;  3GFI A;  3DP7 A;  1R7J A;  3ABU A;  4P9U A;  3G3Z A;  4HX8 A;  3RI4 A;  1FYK A;  1SFU A;  4OIR F;  4NB5 A;  3TO6 A;  1IF1 A;  1HKS A;  4GYI A;  5AIQ A;  5H6Q A;  1BI0 A;  4HX4 A;  4RGR A;  1MJ9 A;  2KRF A;  4P9F A;  3BOQ A;  3CUQ B;  4OIN F;  3COA C;  4BYY A;  2Q0O A;  2E1C A;  4AIJ A;  2Z5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...