3G6EI

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
b'GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3g6eI00
3I55I 5GAGJ 2ZJQF 1VQ8I 1VQOI 3CCRI 3CC2I 2H8WA 3CCUI 1VQ6I 2E34A 1MMSA 1VQ4I 1VQLI 4V19K 3PIOF 3J7ZI 3G4SI 1YITI 1ACIA 3G71I 3I56I 1S72I 1VQPI 1FOXA 2JQ7A 3CJTB 3CC7I 1VQ5I 1VQ7I 1YJWI 3CC4I 1FOWA 2OTLI 1FOYA 2ZJPF 5GAEJ 1HC8A 5GAHJ 1YJ9I 3CCVI 2E35A 3CCQI 4IOCF 2FOWA 4IO9F 1YI2I 4IOAF 1VQKI 1YJNI 1VQNI 1QA6A 5JVGF 3CCLI 5DM7F 3CCJI 2OTJI 4UY8I 2ZJRF 3CCMI 5GADJ 3CD6I 3DLLF 2K3FA 1YHQI 5DM6F 3CF5F 1Y39A 1YIJI 1VQMI 2QEXI 3CCSI 3G6EI 3CCEI 3CMEI 1VQ9I 3PIPF 3J7YJ 2NXNB 3CMAI 2QA4I 2E36A
chains in the Genus database with same CATH superfamily
3LAJA 3V7SA 1MH4A 1YLFA 2E2HJ 1Z3XA 1OCCH 1VQOI 4XN3A 2KISA 5LBQA 2DFIA 3HSEA 2EFOA 1LDDA 5EF6A 2P0WA 4UB6C 5LHGA 2TRTA 1SD6A 2L0KA 3VPRA 4ZC3A 3T5XA 3S2HJ 1X1CA 2BEOA 1AHDP 3CCUI 2ELKA 4L18B 4UUTA 3FISA 5M3MJ 4W97A 1XN7A 1I39A 1VF9A 2HFHA 2X48A 3SQNA 2WTEA 4P5OA 1MMDA 1UHSA 3GFLA 4XSZF 4BAYA 1FBSA 1QPIA 1Z3YA 1F36A 1IO2A 1HBXG 3DTIA 2K4BA 2QLZA 3CLOA 1TNTA 2NOJB 3H9JA 2KLOA 3WTSC 3BR5A 2IS1A 1QVUA 3SFZA 4EQQA 4YELA 3PNVA 1T0FC 2XB5A 5FKKA 2RNGA 5ED4A 5FKNA 3WTZA 2XRLA 1H8AC 1ON1A 4H0EA 1KU9A 5BOXA 2CH0A 4B8XA 3COAC 4IRGA 3CCQI 1R4NB 3OYDA 1WKMA 2KJCA 2L7ZA 3S16J 2QSGX 2EV5A 2WY7Q 5ICGA 3P9IA 2XIGA 4KITB 1ORKA 3GZNB 2F4MB 2F5CA 4M3GA 1YFHA 2R92J 1NH3A 5A2QZ 3P9CA 3GTPJ 4IOAF 3NQOA 2OAZA 3BWGA 2PJPA 2DA1A 3HL2A 1WJBA 5FJ8J 3MWMA 3V42A 3EUHA 1DU6A 3MKYB 4TV7A 2ZFUA 4HOBA 3R4KA 3BPXA 4KUMA 3GZ5A 2VLAA 4MTEA 2HNHA 4IQJA 1WJ5A 3M3YJ 3ZQQA 4OIRF 1R49A 5HS9A 2MLGA 3RJPA 2WB1N 2O61A 1BOBA 2DDBA 1RRJA 3H9GA 3E5XA 2HQAA 3LSJA 1AOYA 1RZ4A 1W36D 4J19A 1G8XA 2HQ5A 4M9XA 3BG9A 3R0AA 2KRFA 1WJCA 2STTA 4BE1A 1ZGAA 2NNNA 3M1CA 1LJ9A 4F55A 1B6AA 2GM4A 1W4MA 2FXAA 2LK2A 2MYSA 3LAPA 3AL0C 2I5UA 3JAMK 3H5RA 2M2EA 1MNEA 1JKRC 3E5UA 4XLEA 3F6VA 5GAGJ 3DWLE 4M74A 3IAS2 1FYLA 3ZQIA 4MQ9F 4MQVA 5ERIA 3ABMH 3CC2I 2CUFA 1SC7A 2GZWA 4LLLA 5JI6A 1OMIA 4IRHA 3VOEA 5GPCA 3B73A 5HNFA 2KDZA 1WJFA 2HYFA 5DD8A 4HLXA 3KP5A 5F0FA 3JTHA 3HOSA 2NNYA 1MJAA 5FKOA 1ZYRF 4FE7A 1RR7A 4ZYHA 2X6XA 3G71I 2HVQA 2IA2A 1N25A 2GOXB 4BXUA 4XMYA 3RZOJ 2K9LA 3KCCA 5CKTA 5FO5A 2CUZA 2PMZN 2ZJ2A 5C44J 1FSHA 4E70A 5TJJA 2EFNA 2L01A 4YRVA 2BHZA 4LFUA 2DOAA 1TWCJ 4L5IA 4RB2C 4XKBA 4LG0B 1ZG3A 3K2ZA 4XLAA 2EZHA 2H09A 3DBRB 3DBLB 2FMYA 1WVRA 1RPWA 4IOCF 1P9QC 4FQGA 2KP6A 1T08B 3M9AA 5JLWA 2EV0A 2QQ9A 5DUIA 3BR3A 2ZXWH 4BHCA 2O8XA 3H5NA 2HOSA 1HCRA 3FBNB 3OYIA 2K5CA 3QU6A 1RNLA 4N9HA 1MBFA 5C4JJ 5FKLA 1JUMA 4PCQA 3S93A 2LBFA 3QPHA 1XGSA 3VYRB 1GLNA 4ZH4F 1DUXC 3K4CA 3P7NA 1QA6A 2VXDA 3KFWX 5CJ9A 1T33A 1IN8A 2QENA 3ASNH 4Y17A 3TW6A 2CQ7A 2VKEA 5J47A 4PUSA 2M0MA 1LB2A 5DM7F 3KE2A 2VUMJ 4MNUA 4XQFA 3ZMVA 4WXCA 3DF8A 4P1WA 3I5UA 4KN4X 4EJWA 4AC0A 3AG2H 2HGCA 1D8JA 2Y9YA 3G1MA 2ZKZA 4HV6A 2B9SA 1V5EA 2KHMA 4AWXB 2XAFA 3FMRA 2K4JA 2LH9A 3LQRA 1YG2A 1Y56A 3GX4X 2DPUA 2BBYA 2ISZA 3F21A 2L02A 1YRNB 2YSRA 3CMAI 1IG7A 3VSLA 3RKQA 3SJMA 2V4JC 4C3IJ 1LFPA 3TBIA 1XGMA 2OD5A 3OIPA 1Y6IA 2J5OA 2M1BA 3VYTB 2XV4S 3OIQA 3AL0B 4A3LJ 2HQRA 3BZCA 1LVKA 3BG6A 3SEQA 2IGNA 1WPKA 1ZR4A 3ULQB 1O7LA 2LG4A 2NYXA 4BE0A 1S6LA 2JT1A 5KAIC 3BR2A 4BBSJ 4CCMA 2X9DA 4U0YA 4E7LA 2UZKA 1WZ2A 2ZXIA 2Z99A 1S3JA 2ELHA 1FX7A 4S04A 1J0RA 3BY6A 4RM2A 1G3TA 3KZIC 1ZK8A 4A69C 1J9IA 2FBHA 1ETQA 4QPOA 1JUPA 5HDGA 3WGIA 1J59A 3JCUC 4HW0A 3JTGA 2HI3A 1U0JA 3BG3A 1BIBA 3CJRB 4RAYA 2XAHA 3G1LA 4UXNA 3NWSA 2M0CA 4RMNA 3I58A 2R3SA 5E17F 2VT3A 5H20A 3DXJF 2X51A 5DCMB 3K4MA 1R5GA 2QBYB 3KP7A 1Y1WJ 3BROA 1FP2A 4DOZA 4G9YA 5FLVA 1STZA 1XX5A 2V79A 3N05A 2CGPA 3IH3A 2MC3A 2OUMA 3BZ6A 1DU0A 1YOVB 1TWAJ 3WE3A 5ILUA 4EJOA 3OYHA 3P5JA 4V2GA 3M07A 5KNLA 1YS6A 3FX3A 1LFBA 2DT5A 2JSCA 3JRHA 2GXAA 4E7ZA 4NC8A 2A6EF 4RBOA 3B6AA 2V9PA 3S1QJ 2L7KA 4MGRA 4CCKA 3OR2C 2A3SA 3DKWA 2HZDA 2CJJA 3I64A 2LKSA 4G8XA 3MKZA 4EV0A 3FMQA 2AS5F 1U5TC 1Z6TA 3G6EI 4KDPA 5BNGA 1ZARA 3I4MJ 1A36A 1ZGWA 4MTDA 1J09A 3GVAA 4Y3OA 5IOYA 2LY1A 4LK1F 2QA4I 4OIOF 3IV5A 1TWHJ 4F93B 1IZ1A 5DD4A 4E7SA 3KP4A 1OCRH 2C6YA 1BW6A 3HTSB 2BGCA 4C2MJ 1I50J 2M3AA 2XAUA 4ETSA 1ONVA 1QHHD 1VNDA 4UUSA 1R4MB 3WU2C 2M87A 4CUGA 1SFEA 2X1EA 4XLFA 2ISYA 2EH3A 3J7ZI 5TRDA 3FDYA 2CV0A 1DQUA 3X2QH 1TQMA 1U6GA 2XDVA 4OIPF 2H6CA 2VL8A 5HODA 4E7HA 2R5ZB 4LG0A 2X6YA 3O6BB 5L3EA 4M3EA 3R61A 3FXUA 5EEHA 2JZYA 4EM0B 1LE8B 1T0FA 1MMNA 3EDPA 3CQZJ 1BBYA 2RNJA 5D4RA 4UUVA 2QQAA 1UG2A 1HC8A 3WGGA 1XB4A 1W0UA 4XRMA 3V8LA 3OWTA 4KIFA 4A6EA 4KIGA 1IV6A 4I2OA 1Z9CA 4CICA 3HC7A 2Z2SB 1P4WA 1SAUA 2GA2A 2KZVA 2XPUA 3KPHA 4EJTA 1B1BA 3CUQC 1WHUA 1JHFA 1KU2A 2L9VA 3PL8A 3I0TA 1APLC 3I4NJ 1IXSB 4CZZA 3W3CA 2ZBKA 3K4JA 3U9GA 2FX0A 3HEFA 1R58A 1Z6RA 3ZR8X 5LEJA 3BR1A 4XICA 2WA0A 3V7CA 3NEUA 1IAWA 2IGKA 3RYPA 3MAJA 3GTGJ 2CUEA 2HDWA 5EEAA 4II2A 3MVPA 4XONA 4KA4A 5M5YJ 4WK8F 3K2AA 1E0EA 2VJ5A 3OS1A 1O3QA 1YS7A 5F08A 2X6OA 1YRNA 4A5NA 3PM1A 2FMLA 2CW0F 3C2BA 3RKWA 4C3JJ 2DO7A 2L9SA 2XAJA 2D5VA 3GLLA 1TZLA 1R1UA 4MLOA 3L00A 3J7YJ 1MDMA 3FXQA 4B47A 2RKHA 2EIKH 3LSTA 2OZ6A 5FD6A 1IRXA 2R7SA 3CDLA 1U5TB 4UVAA 2ZJQF 1W0TA 4EJVA 3M4OJ 3VDXA 3UR3C 5JFRA 1DGWY 1LEBA 2GAUA 1OCZH 5DYMA 2Z33A 2JWTA 1ETKA 4X1EA 1WQ2A 3VODA 3SZPA 2X4HA 3QQAA 2DBBA 2E34A 2F48A 3BG5A 2VQHA 3DKYA 1OCTC 1MMSA 3O2PE 2GWRA 2XPWA 1A35A 4BH9A 3SEZA 5L3DA 4QWQA 5K7ZA 1ZELA 4P9FA 3DPTA 2DYRH 4GRIA 2M5WA 3TQNA 2JUCA 1QZEA 2L9RA 1HDPA 1IDYA 1SFKA 1FOXA 4G6QA 1PUEE 2V6CA 3TO9A 4FX4A 1R71A 2VIXA 2IXSA 3N97A 1HSTA 4MIMA 2QVOA 3F23A 4DYRA 3CC4I 4Y4RA 2I10A 2Z9OA 4Q4ZF 5AIQA 2DMUA 2E1MC 3BR6A 4IZZA 5DCMA 4OOIA 1P92A 3KZYA 2Q1ZB 3G2BA 4U7DA 3LOCA 3I9V2 1X19A 4XN0A 1ZRDA 2QKMB 1B4AA 3BCBA 4BS9A 3K70C 2H1KA 1YI2I 3K10A 5E8GA 3JRGA 3GTJJ 2CS3A 3SYTA 2MC4A 2OPTA 3IKVA 3OL3A 5KVRA 3C2HA 1SMTA 1A6QA 2FQ4A 5J1YA 2TDXA 4LK0F 1TBXA 2P7VB 2A5YB 5FB2A 1VQNI 2YR2A 1FYMA 2Y30A 2M7AA 4P55A 5F0CA 4I01A 2ZXJA 1T6SA 1BW5A 3CUQB 3HG9A 4LLGF 1FTZA 3GCMA 2BVMA 4PSWA 1FYKA 2P8TA 3S17J 5D8LB 2K7LA 2BY3A 1XSXA 1WWXA 1IDZA 4EM2A 3IL2A 3E1SA 4A3JJ 1D1AA 4IHSA 2FOKA 1D0YA 2Y0MA 5B1BH 1TTYA 1Z05A 3EUAA 4ZYEA 4ESFA 3TOAA 1UELB 3GLXA 5CLSA 4KYWA 2XF5A 1DPUA 5B3SH 3CCSI 1XCBA 5E3MA 4MHGA 5BQTA 1X1DA 3FWEA 2B0LA 4W1UA 1QHGA 3LSGA 2IT0A 3FM5A 3W6JB 1D5YA 1FIPA 1ERDA 2NS0A 3WTXC 1LDKB 2DA6A 1YIOA 1OYWA 1R22A 2V9VA 1FP1D 3CCRI 4S05A 3PJRA 1A6IA 2YU9J 4ZDPA 4EVIA 3N4MA 4LITA 1KONA 1I6XA 2JA2A 1WGXA 2IGMA 2MFZA 2EZKA 3F8CA 5FRMA 3TO7A 4PFOA 2QSHX 4LB5A 3HOWJ 3D5RC 2LY9A 3ASOH 2LREA 2A6TA 2DAOA 1RETA 1K78B 5E18F 1HF0A 1I5ZA 2ZO4A 2BOLA 5J6XA 1YITI 2R5ZA 4I0AA 4XKWA 2M45A 4HYEA 2P4WA 1LE8A 3JRIA 3HRSA 2ETHA 5JVTA 1X58A 3RPUA 3QP5A 2I8DA 2IS2A 4L5EA 3H3UA 4E7IA 3NAUA 3CC7I 3EYIA 4PFPA 2NRAC 3LNQA 2JMWA 5HS8A 1SMYF 1FOWA 2OJED 2E5ZA 3S2DJ 4LMYA 1MNDA 4M71A 5GAEJ 3DEEA 1SVMA 2XGEA 4N9IA 2W7NA 4O6JA 5GAHJ 3ZMZA 4IEJA 3CMMA 4DYCA 2E35A 3M7GA 1KGSA 1TP4A 3FHNA 3KP3A 3O8GA 1HA8A 2XAGA 1HW1A 4MFEA 2E1MB 2V9KA 5DDGA 3OYKA 1U2WA 3OY9A 3ESWB 3E0JB 4J00A 3HKZA 1S9HA 2FUG2 3TP3A 1SVOA 1FJLA 1XGOA 3I3LA 4I98B 3W2VA 2FNAA 1JTYA 4G7HF 4HEA2 1EH8A 1XCVA 2CYYA 3FXJA 1W7PD 2UXXA 3TEDA 4B1RA 1ZQ3P 5JVGF 5KAFC 2HDDA 3ECHA 3JW4A 4N4NB 2G7HA 5TISC 3RKXA 1O3SA 2LYCA 2XSDC 3HOYJ 2MD5A 2RVCA 5KHDA 1KA8A 3L2RA 5CQEA 4A5MA 1BI3A 1USTA 1ZR2A 3TL4X 2HZTA 4Y13A 1MMAA 2P5LC 4IHTA 1JUSA 1U5TA 1JGGA 3VYSB 4YIRX 1KU7A 2ZNYA 4X0GA 1J2XA 3DQVC 3S1RJ 1JGSA 2DK5A 1OYYA 2CU7A 2OZUA 3K1MA 1WFXA 3BZKA 4L5JA 4I99C 2ADUA 4CCOA 3GTQJ 3BT9A 3F8BA 3GO5A 2M4GA 4PJLA 4CCJA 2BHYA 3KLNA 2LRDA 5J40A 4ON0A 5FLXZ 1S29A 1PP8F 1U8BA 2CUJA 4I0BA 3DV8A 2PMHA 4BQAA 2ZMEC 3S32A 5CVUA 1QU3A 3KYDB 3OYGA 2MLKA 1LVAA 2AO9A 1UHWA 1T56A 2J5PA 5CQGA 3KZZA 2MH2A 2IA0A 4A12A 4KN7X 2DI3A 3PIOF 4G7ZF 1UMQA 2VASA 2QQ8A 3RCOA 1ACIA 2ME0A 4IHXA 3U1KA 3HB9A 3PNYA 4ITVA 2Y9ZA 2XKPA 2L4MA 2LSOA 1S72I 2HYGD 2A68F 3NRVA 1R7JA 1VQPI 2O03A 4LD5A 3NARA 1FEXA 3W2AA 4RA2A 4PJJA 3R6SA 3AG1H 5LGTA 4BDYA 3ZXSA 2N8GA 1F4KA 1C0WA 4ASNA 3CCYA 3CP8A 3E6MA 1N78A 2DA3A 2O7OA 4M3FA 4B4CA 1XMXA 2QF7A 1JKOC 1EJ9A 1G59A 2DT7B 1YO5C 3A0HC 3JR9A 2FSWA 4LG3A 4XKCA 3ELKA 1DPRA 4XR6A 3OYMA 4IX7A 1D5VA 4M73A 2O0YA 4YIIA 3GFJA 2QQBA 3CUQA 4BYYA 3CO7C 2EFPA 4DNCA 1SD5A 2HVRA 4AIJA 2PJRB 4CGZA 2K86A 4D5CA 2PEXA 3KYLA 4F3QA 1QRYA 4I6ZA 2IA1A 5GTHC 4LOCA 1FPQA 4CA0A 2JA8J 5J4YA 4LB6B 1MMGA 2Q8KA 1XSDA 2UV1A 3WTVC 4ZTFA 2DA4A 5F04A 2JJ7A 2E5NA 5HOOA 4A3FJ 3KEYA 5FFXA 2Z16A 3CUOA 3FHZA 1HQCA 4BL0B 4DZJA 3EYYA 3CDIA 1BL0A 3OIOA 4GFBA 5EZGA 4Q5SF 2YX4A 2LNBA 1W36C 2JN6A 3A0BC 4DBRA 5EG0B 1SFOJ 2LF7A 2BY1A 1D8KA 9ANTA 2MGQA 5LD2C 3OS2A 2K9MA 1IRZA 2DMQA 4AIDA 1Y0UA 3SZGA 5LHHA 2EINH 2PI0A 1IC8A 3FM3A 5E1XA 4M72A 1N75A 2IS4A 2Q2EB 2ECBA 4L9JA 3TP0A 5FGMA 1FLIA 1YW7A 4PJNA 2DJIA 1K78A 3AG3H 2R7QA 3GTKJ 2PQ8A 1OCOH 1MBHA 2HTSA 2BXYA 2QZ8A 4KMUX 4FTHA 1JT0A 4Q48A 2DTRA 4IKFA 3DU6A 3KP2A 1Z1DA 5HNHA 3K4KA 1CF7B 3ML6A 2ZMEB 1JKQC 1RUNA 1GUUA 2EA2A 1SAXA 1T39A 1PP7U 3J7AY 3M8FA 3W6VA 2IPQX 3WTYC 2FRHA 1KQ9A 3MD2A 3IKTA 2KIFA 3RI4A 1H89C 1GV2A 1TL8A 5K1YA 2H8RA 1G3SA 1UFMA 2WV1A 3GFIA 1WH7A 1SVLA 5H2FC 2ID3A 1K4TA 1JHHA 4CYDA 3MZ8A 4RM3A 2OTLI 4M3DA 4D7NA 2DXIA 2RDPA 1V4RA 3K0LA 2YUSA 2R0QC 2JPCA 3MMYB 2EZLA 1J75A 2A07F 1UG0A 2PMZA 3ZMTA 4HSRA 4EJUA 2MW8A 3OR1C 2LTPA 1XD7A 3LA3A 4AVZA 3WODF 4HQMA 2HXOA 1TNSA 2MD0A 3CO6C 3Q9VA 2VE9A 2KRCA 2ICWG 4BY7J 3ZOBA 2KMUA 3IWFA 1ZLKA 2PX9A 1T38A 1BOAA 3ZMSA 2NVTJ 2XASA 3ERMA 3QODA 3J81K 4PJMA 4UB8C 3L2VA 1MW7A 2M4KA 3VFZA 2VONA 4ZTJA 4XK4A 1OYIA 3T8RA 4JYKA 2MG4A 5EYRA 3J80Z 2D1VA 4F7ZA 2JA7J 3D5SC 4C9YA 4PSXA 1WJEA 4KIBA 2DT6A 2Y75A 4DQ2A 2JVGA 4CDGA 4IQ4A 4E7KA 3AFHA 2FBIA 1ITYA 3LSPA 1FBUA 5DEQA 2HEOA 3OS0A 3UNGC 1IRFA 1J5YA 3O8HA 4C30A 3OYLA 2LVSA 4Y33A 2QEXI 3WGHA 2F5FA 5CVJA 3JAMZ 1XG1A 3E97A 4RDUA 1IJWC 3IUOA 1JKPC 2Z3YA 1BJAA 2XUBA 1XSVA 1P6RA 3A1YA 2PBIA 5EEGA 3OOUA 3EETA 1BR1A 1Q1HA 1VQ8I 2VODA 3TGNA 1B72B 5K7FA 2EILH 5FD5A 3BCAA 2R5YB 5F27A 3OOPA 1IGNA 5IT9Z 4EGYA 2HOTA 1OJLA 4B3AA 1S7OA 1WH5A 1MGTA 4CH7A 1ETVA 3PQJA 2OV7A 2Q0OA 5LGUA 3BLYA 3EPZA 1GV5A 2ZXHA 4PGGA 4D1QA 5LRSA 2R7VA 3PSIA 2IBDA 2VKHA 3JREA 3K1NA 3GXOA 2LMDA 3U21A 5KK1A 2O3FA 3OYAA 2FBKA 1YX3A 3C2GA 2LC2A 5EDNA 3HRUA 4BGDA 2NVQJ 2E2IJ 4AYBN 1USSA 1AA7A 2GBYA 2X6WA 4Y15A 3GUDA 2MA3A 3SHFA 3HIFA 2FD5A 4PDKA 4U0VA 1R1VA 3RKYA 1G4DA 1B9MA 5E3LA 2DLLA 2DFHA 2M8EA 3WG9A 1PUFB 5IPAA 3CESA 3S3OA 5J1RA 3DLAA 2FOWA 1H88C 5B5EC 4A2UA 4RGRA 3TDZC 3PQKA 4XORA 4IO9F 3K7AJ 3DTEA 4NNJA 3Q0UA 5ICFA 5J8FA 4U7BA 1FOKA 3F3XA 3HSRA 2W85A 1X2NA 4XSXF 3OV8A 4YIFA 2E7WA 4WF2A 1K79A 1U9OA 5TGTA 4LJZF 1IW7F 4ZYGA 4HF0A 4XM3A 3SXYA 3WTUC 4XLHA 2YX7A 2L54A 4XLCA 5D5XB 5E1WA 2PFBA 1PVEA 4OAYA 1J7KA 5BPDA 2W57A 2Y0SN 1R00A 2IVMA 4AU7A 4YFNF 5EG0A 3RZDJ 3LFKA 2IS6A 2F4IA 1REPC 4BXFA 1JTXA 3RPQA 2XRNA 2F5EA 3OYCA 3ZN0A 2P6SA 3SFIA 4V2FA 1MZBA 2EZIA 1MKMA 3F6OA 3RYRA 2COMA 3ABUA 3BQYA 2F5DA 2Q2EA 1IUYA 3FXLA 2CQQA 1YQAA 2ID6A 1E17A 3DFGA 1G3YA 2YS9A 4E7JA 2G0EA 2JUGA 2ELJA 3CZ6A 4NQWB 1ULYA 1WJAA 2BY0A 4XRFA 1HXDA 4IRIA 5IYDJ 3PO3J 4QLCU 1FZPB 2ACJA 3OL4A 3S15J 1CF7A 2COBA 2ZMEA 1AU7A 1S5LC 4JX4A 3JSPA 1QVTA 4I76A 4OIQF 3IHUA 2W24A 2EWNA 2OU2A 3JSOA 1W1WE 3MEXA 1NG6A 1KQ8A 2DOEA 2DU9A 3ISPA 1F5TA 1IXRC 2L7FP 3R60A 4S0HB 4BHPA 4AUXA 3QOEA 5JHFA 4O3MA 1QZZA 5C3EJ 4GO1A 3J7AO 3HBLA 2VPLA 2HS5A 3H35A 3EUKL 1FBQA 2PN6A 1PDNC 2XB0X 3F72A 2K3PA 4KNYA 3K1PA 2XF6A 2VKVA 4Y52J 1X2MA 1TC3C 3QAHA 1FOYA 2RGVA 3ZN1A 1TT5B 4JQFA 2HOAA 1ZRFA 5HDKA 4OWRB 1WRJA 1OLTA 2NVXJ 4BY1J 1AWCA 1SD7A 2A05A 5B1AH 5IP9J 2L4AA 4NBQA 3T0YA 1D0ZA 3K4NA 3V7RA 5LFAA 1D1CA 1SFXA 3DPUA 4RB3C 1B8IB 1TWGJ 3MKWB 1MNMC 2KQRA 3TMOA 2XHKA 4BQNA 3ZQGA 4IPAA 3TW7A 2VE8A 3FF5A 3NWTA 5H6RA 2XC7A 3CJQB 1YJNI 1ZN2A 4U87A 4RB1A 5A2QK 2TCTA 2QKLB 3MN2A 2V1UA 5F6FA 2OA4A 1LUJB 4D0PA 2E2JJ 4QPQA 4U88A 5DUKA 2QBYA 4L0YB 1IUFA 4XRSG 3HOZJ 1EV7A 1ZHFA 2E1CA 1ETOA 2H1LA 1NTCA 3S14J 3CCJI 1F43A 2AXLA 2JK3A 3PO2J 2W4SA 1L3LA 5ILSA 2V7FA 3CD6I 2QUFA 4HG2A 2LR8A 4WXDA 2W84A 2VXZA 4HNTA 5DM6F 4L0ZB 1TQPA 2NVUB 2HXIA 4K2EA 2LOOA 2H94A 5D5WB 3GYHX 2DPDA 3HGYA 5IP7J 2V1NA 3L2CA 5GP9A 3EQLF 5KCMA 3QYBA 3CCEI 3HOUJ 1B72A 5K7HA 4WCGA 2Z1DA 4MFDA 1XDUA 2OBPA 3H1CA 2EPFA 2R5YA 4I02A 1E3PA 5CPRB 2BZTA 1YX5A 2RN7A 3DEWA 2A61A 3MCZA 2VQLA 2CW8A 3QYFA 1OCPA 5J3LA 4CO8A 3GZ6A 1K7AA 3KEQA 4ABZA 1K4SA 2IJLA 3BTJA 2H8WA 1I27A 1MD0A 1N77A 3LA2A 4A3CJ 4L9NA 5BS6A 4A3DJ 2O5RA 3REOA 3HXLA 4LIUA 5D6FA 2WAFA 2VQGA 3C18A 2O6GE 2KJBA 1YTYA 1FSEA 1I3AA 2HYJA 2R7XA 5D8KB 2VKDA 1P7IA 4XIDA 4KISA 1MBKA 3K6GA 3OMYA 3LSRA 3JRDA 2M9HA 1K83J 2ESHA 4EGZA 3OYBA 1QBJA 3FXRA 4JK1X 2VC0A 3ZMUA 4HDVA 4UVCA 2KIQA 3RQ4A 2GLOA 1K61A 1PUFA 4BUPA 1Y0NA 3HPGA 1T8IA 2DA2A 2R7WA 4MEXF 1DDNA 2OC6A 2R7FA 2MABA 4BE2A 2E1OA 2VBYA 2WAQA 2NAZA 1LDJA 2EB7A 4IVNA 3AKZA 3G3ZA 1ZH5A 1IN7A 2JTVA 4BEHB 4IHVA 1W5TA 4HSTA 2Y48A 1L0OC 3CMYA 2IP2A 4GXOA 1R36A 2CW7A 3GWZA 2LDUA 3WHCA 1ZREA 1IN5A 4AIHA 1Y8QB 2GQQA 2FE3A 2Y2ZA 1BJZA 3BG7A 2FNPA 1WSUA 3H0GJ 3D5LA 2DODA 3I53A 5IOZA 1YYVA 1MBJA 3F9KA 1POGA 4H4KC 4M6VA 1B9NA 2LD5A 2VC1A 2IGOA 2UUZA 3IH2A 1RKTA 5DTDA 1H0MA 2P5VA 1OR7C 5DCFA 2VJIA 1KYZA 4XNFA 2EQRA 5J4VA 2L2OA 3U2RA 3CCMI 1HKQA 2AHQA 1RC9A 5J1UA 1TT0A 5D4SA 2DFEA 4BJ5C 2WC2A 3OYJA 5K5QA 3ZPLA 5K5RA 1ZG5A 1HKSA 3H3ZA 3V8KA 3WG7H 1HOMA 1VQMI 4WWCA 1O3TA 2NS7A 4NQWA 4DZPA 4E4HA 3LQQA 3G73A 1BI0A 4U0WA 5JHUA 2V6EA 1ZTRA 4UHTA 2HOEA 3H9QA 1E3HA 1R6RA 4FT8A 1O3RA 1VQ9I 4GYGA 3G1OA 2W25A 2NXNB 2EIMH 4O5VA 5EZHA 3JRCA 2JVHA 3OYNA 1MSFC 3KYCB 1P2FA 1Y1VJ 1TQIA 2E36A 1OISA 4EM1A 1BR2A 2E71A 1FWZA 3ZCOA 1EF4A 1GDTA 2LY2A 3GF2A 1GT0C 1GVDA 1RESA 3HYIA 5FRNA 2DMNA 3TO6A 1BM9A 4AD9A 2DMTA 2OCEA 5F0HA 3LSKA 1BC7C 2W82A 4BDZA 2X85A 4HDUA 2O8KA 2XAQA 3PUBA 1X3ZB 3TKYA 2G9WA 2X0LA 4DW6A 4A3EJ 2EV6A 4V19K 3E3VA 4ESJA 4B3XA 5LEKA 3IRRA 4LGWA 2M7BA 3CDHA 3ROUA 3FXOA 4YEJA 4XRSA 5M3FJ 1UCRA 1RUOA 4IXAA 4KFCA 3BTIA 3FKJA 2G7UA 1G6NA 3FMSA 2M34A 2R93J 1S7AA 2DQLA 1UAAA 1NK3P 4BXXJ 4LIVA 4DGWB 1YJWI 4UVBA 3BC8A 4FHTA 2WV0A 4RGSA 3C3WA 5L3GA 3ABKH 2IEKA 1B8IA 1EA3A 1ZAOA 3QWLA 4ZZLA 5HLHA 1S8NA 2FEZA 3HRMA 3S2WA 2OF7A 3J80K 4IHYA 3S8PA 2CSOA 1FMWA 2DTZA 1SANA 1HKTA 3RSNA 1FMVA 1LEAA 1XDSA 5F1JA 2XPVA 4YG2F 3ZP5A 3K4BA 3WU0A 1OPCA 5HDNA 2BYVE 3VB2A 1K6OA 1HW5A 1QZYA 1E2XA 3WU1B 5CYVA 4GDFA 5D6EA 2Y31A 3KIOA 1QNTA 2NVYJ 3PSFA 4ANJA 2W1OA 2JRTA 1LNWA 3VSKA 4F91B 3H92A 5ICCA 5D5VB 3WTWC 2JA6J 1H9TA 4XOTA 4N0BA 2EJRA 4JBAA 1RIOH 1NHAA 3KEOA 4F52A 4A3BJ 3A4CA 2KFDA 1KQ0A 5CVRA 3B6CA 3C1DA 3A02A 3PFYA 2OQGA 1BN5A 4KICA 1DP3A 5FROA 2XGDA 1FT9A 1WI3A 2XSJC 1YIJI 1TWFJ 3RIRA 2DJNA 5E79C 2R7DA 4B43A 4DJAA 2JRMA 3QPTA 4A6DA 1MBGA 4NUBA 1GXQA 5DV5A 5BMZA 4G94A 2DYSH 2PG4A 2LLKA 2AQEA 5IT9K 4HNVA 3BP8A 3I59B 5D5UB 4QTRA 3A01B 4UUSB 5L3FA 2QWWA 3HHHA 3R0JA 4RGUA 1LPQA 2UWMA 3M8JA 2HWVA 3JRFA 5IY5H 2VBXA 3I55I 1R1TA 2CFXA 3ABLH 3OSGA 3ZMDA 4BBRJ 1D1BA 2CO5A 2MBFA 3RTRA 2ZFWA 4HX7A 2DDAA 1P4XA 3K9TA 5EJCA 5IYBJ 5HLGA 4NC7A 2P81A 2A69F 4HAMA 3GW2A 2FJ1A 3IRQA 1IF1A 5GTIC 5B66C 2VT2A 2KL4A 3RDIA 4Z6YA 1VFCA 2MSYA 2FA5A 3H36A 5M5WJ 4C2UA 1U78A 2LF8A 3HUGB 1IN6A 1AKHB 4HA8A 2QGUA 3BQZA 2ZSIB 4GGGA 1V55H 4N4OB 2JA5J 1G2HA 1P4AA 2WB1A 3RPUD 1Y8RB 2AQFA 5HLTA 2ESNA 1B59A 3A03A 1F9NA 4CCNA 4BNCA 6PAXA 4CCLA 2JQ7A 3CLQA 2E19A 2ZCWA 4PK4A 3L2WA 1D0XA 2CMPA 4LLNA 2H6BA 3V4GA 4EATA 4Q47A 3ZQCA 3M8EA 3P9KA 3D0SA 4BEHA 2P7CB 2PMUA 2BV6A 4FCYA 2BXZA 1QGPA 1UZCA 2GOMA 4RLFA 2H27A 5EGOB 3FK6A 2DOFA 2VN2A 3ABTA 3L2UA 4GCVA 3W6KB 1MSEC 3V8JA 1YE9A 3SDBA 1CQTA 1XC5A 2VBWA 3BDDA 1HW2A 1BI2A 3W2WA 1DGRM 2XKOA 2OCCH 3OYEA 4BHBA 2RQQA 1Z0XA 3WHBA 1IXCA 1FC3A 3A2KA 2DA7A 5C4XJ 2HTJA 3HPHA 2M8GX 4R79A 1SEUA 1K6YA 2XROA 4HF1A 5FKMA 2V26A 1GHCA 3VYUB 2OQRA 1HDDC 4ENJA 4HZFA 3GTLJ 3Q5FA 2HU9A 3HRTA 2OTJI 4HX4A 2DN0A 1FIAA 4UY8I 4CXFA 5E8IA 1E3OC 2ZJRF 5GADJ 5AONA 1MDMB 3H3VK 3QPLA 1W7PB 3I71A 1G3WA 2KDOA 3CF5F 1TW2A 4BJ6C 1JE8A 2HVSA 1X1AA 4PZJA 1W5SA 2D2WA 1XTAA 2MH9A 2BE5F 1EH6A 2M30A 3S1MJ 2IAIA 4IJAA 2E60A 3FXKA 1MH3A 1P7JA 4RS8A 4M9ZA 3HOXJ 1TW3A 4A3KJ 4IF4A 1Z91A 1ZRCA 4NHJA 2QSFX 2BVLA 1UJ8A 1T2KA 2VQCA 4ENMA 4UNOA 1QO0D 1O4XA 5BPIA 1V5GA 3HOVJ 2ZNZA 2PLYA 3ECOA 3SDGA 2L7MP 1Z7UA 3E6DA 2L5QA 2KT0A 2WBMA 3QOPA 2RV8A 4BU2A 2GA1A 2K02A 4YFXF 2WWYA 2CWEA 1VQLI 2F2EA 2CQKA 2F6CA 1Z7LA 2QCOA 1YW8A 5ICEA 1LKXA 3DPLC 4AM3A 2K40A 4KT5C 4ZYDA 1BA5A 4CYCB 3LFUA 4QIWN 2Z5UA 3LSHA 3GTOJ 4UV8A 1OKRA 1PYVA 3ZQ7A 4B44A 4OMZA 4ZDLA 2P6TA 4ENKA 2EK5A 2LFBA 5H6QA 4FETA 3KLOA 1I6HJ 1MBEA 3IWZA 5AIPA 3LSMA 3GFMA 4EMSA 3S3MA 1GXPA 5L3CA 2UXNA 4B48A 3OSFA 2WY8Q 2ZSHB 1A5JA 2ECCA 2EFWA 2R7ZJ 5LHIA 1FTTA 1MJBA 4OAZA 5L3BA 2EFQA 3ONQA 2HPMA 4M6YA 4BACA 3VWBA 2KZGA 4A3IJ 3WE2A 4A0YA 1IN4A 1X3UA 2E1NA 3HJEA 1ENHA 1I1GA 1RI7A 1V3FA 1GVJA 2HPIA 3GTMJ 4M3BA 1VQKI 2XGXA 1BI1A 5FLMJ 1R23A 4HV5A 3EUHC 2JPBA 3OYFA 3L09A 1QQIA 1W5CC 2E7XA 3GMEA 1MIJA 3Q9SA 1NK2P 4WXHA 2R7UA 3MZYA 2DCEA 3HHGA 1XMAA 2D1HA 2EIJH 3Q0WA 1PJRA 4CHUA 1CGPA 4ZZDA 2VBZA 1OQYA 2PJRA 2LKXA 1OR7A 3CF2A 4A3MJ 4A0ZA 4RAGA 2KIUA 2GXGA 4NB5A 3MKLA 1YHQI 1R9TJ 3I4PA 2VI6A 3A01A 1H9GA 3I59A 2YPRA 1XS9A 1Y39A 4HBLA 3HZJA 4JX5A 4EEFG 4G6DA 1ETWA 2B63J 2BW3B 2DFFA 3BJOA 4C3HJ 3CMEI 1DP7P 1JT6A 3IC7A 1ETXA 2NOGA 3QYEA 2QYOA 4RAZA 1O57A 5LGNA 3UKGA 3IP4B 1VTNC 1V5FA 4A0XA 3L1PA 4BQOA 3KETA 3GEZA 4G7OF 2YU3A 1F1ZA 3HUGA 4R1HA 2BY2A 2WADA 4XKVA 1AKHA 3AG4H 3F8FA 2NS8A 2DK8A 2HKOA 4II3A 2R7RA 1U3EM 3F8MA 3F22A 3C7JA 3F8NA 5M5XJ 3ZQFA 5HVQC 4P96A 3HTUA 4L9TA 3LA7A 3FIWA 2GXBA 4JOMA 2ZB9A 2EA4A 3G4SI 4FISA 1HSJA 3VEPA 2DQRA 2CRGA 3S1NJ 3I56I 2XGCA 1SD4A 4AIKA 4RB0A 3WTTC 3L2QA 3T8TA 4NC6A 1FNNA 1WI9A 3JRAA 1ZG1A 4C2TA 5EGOA 3CJTB 4CZCA 1KZHA 2QM3A 2R4GA 1VQ5I 4A3GJ 5IP6A 3QP6A 4F92B 4KT6A 5FFZA 3QRFF 2ZJPF 3E6CC 2Y69H 4UV9A 1UHMA 1JXSA 1ZLJA 1MJ9A 5K5OA 1U9NA 3PUFA 2HKXA 3CCVI 4P9UA 4JX6A 2RREA 4AYBA 1IV8A 2VJJA 1WJDA 3FZVA 3K70D 4G6TB 4PGHA 3PFIA 3S3NA 3J81Z 4OU0A 1XPXA 2FU4A 4HQEA 1JJ6C 4D9JA 3DTKA 4DYQA 5DS9A 2B7EA 1X3WB 1KU3A 2LP0A 2L3DA 3HGGA 4RAFA 4OINF 4DIQA 3FKIJ 3HDDA 4HNUA 4DBQA 1X1BA 1U8RA 3Q3SA 3HM5A 2RAEA 4HLYA 3ZRGA 1LQ1A 1JJ8C 3FK7A 4QSHA 2R7OA 4BJTA 1VZ0A 3QPSA 1JI8A 1X1PA 4PJ0C 2EBIA 1TLHB 1W7PA 1ZGJA 4J01A 1S7EA 3CCLI 2CV1A 2HQNA 2XF7A 5JLXA 4FE4A 4ZJZA 3BTLA 4XBFA 5ILVA 1I1SA 5LRRA 3H5AA 1ETYA 2VPRA 3DLLF 2K3FA 4I09A 3TOBA 2KPMA 4ENNA 2CV2A 3L9FA 1Z21A 2A6HF 1UB9A 1XGNA 3DP7A 2P5KA 3I54A 4XL9A 4HPQA 4D5FA 4XLNF 5IT3A 1WCMJ 3D1NI 2K9NA 2K9QA 2Y0SA 4RLQA 2VJ4A 5J8CA 3ZQLA 2VOOA 3L7WA 2GIZA 3LMMA 3O3KA 4L9VA 4GYIA 2KKOA 1A04A 3Q0VA 2STWA 4X6AJ 4IL6C 2FF4A 3E6BA 4BQQA 5IYCJ 2HDCA 4KMFA 4FX0A 4KJZA 1ZKGA 3LL7A 2FQ3A 3K4LA 2WAQN 5GPAA 1T95A 1EH7A 2R7TA 1YW9A 5HS7A 1SFUA 1NG7A 1RR8C 1ODDA 2DA5A 4BKXA 2GIVA 5FLXK 2F5VA 5E3OA 1VQ6I 2LKPA 3E7LA 4CYCA 3BPVA 1BC8C 1OFCX 1VQ4I 1V54H 3LSIA 1I3QJ 4FASD 3T1BA 2O9LA 4M6XA 1LFUP 2WAEA 2V1DA 4ZYAA 3TDUC 4Y7NJ 3F0CA 2CG4A 3BJ6A 3E5QA 3M1EA 3IAM2 3FXMA 3PNTA 3BR0A 3KX2A 1Q1VA 5LLQA 2IW5A 3JRBA 3BOQA 4I7HA 3AAFA 1HLVA 1VQ7I 3ZQHA 2VOPA 1XMKA 3ZGKA 3H0DA 3CP2A 2DMPA 1FY7A 4XOPA 3RQIA 3BTCA 1O7FA 1Z77A 3HKZN 4R8HA 1RKWA 2A5WA 1YJ9I 1QPMA 4WX9A 3IH4A 3DBHB 1EKEA 3DEUA 3GBGA 3CTAA 2K9SA 4ESBA 2F4OB 2KIMA 1BR4A 4RGXA 4IHWA 2D45A 3LWFA 5E1ZB 3CJNA 2IRFG 2AXTC 4E6KG 3HSFA 4ZDOA 4D7MA 3BJAA 4JP0A 2XVCA 3MFKA 2DW4A 4MO7A 2K27A 5F64A 1VI0A 5CVVA 2V1XA 4OMYA 1X4OA 3ERED 4XLPF 2W00A 1IRGA 2HR3A 2ZC2A 1D3YA 1A31A 5HLIA 3MZHA 4B09A 2CQXA 2LBFB 3K69A 4CSWA 5JR3A 2ME6A 2JSPA 2RC4A 3B02A 1M1EB 4YFKF 1X4PA 2BW3A 4Z2YA 1Z67A 2X1DA 1ON2A 1KYWA 1R5HA 2VB6A 4M9SA 1BIAA 3U1DA 5E3NA 4HX8A 5F1RA 3DKXA 1R5ID 4MEYF 2KRHA 2X1CA 4NDLA 3SZTA 4HF2A 5CVIA 2L9NA 4HRIA 3HOTA 3DCFA 3PIPF 1T98A 2CQNA 4G12A 2CFOA 2K85A 5E20A 2W48A 4A93J 3QU3A 3KP6A 3FBIB 2RQPA 4AVPA 3MQ0A 3DU5A
chains in the Genus database with same CATH topology
3I55I 5GAGJ 2ZJQF 1VQ8I 1VQOI 3CCRI 3CC2I 2H8WA 3CCUI 1VQ6I 2E34A 1MMSA 1VQ4I 1VQLI 4V19K 3PIOF 3J7ZI 3G4SI 1YITI 1ACIA 3G71I 3I56I 1S72I 1VQPI 1FOXA 2JQ7A 3CJTB 3CC7I 1VQ5I 1VQ7I 1YJWI 3CC4I 1FOWA 2OTLI 1FOYA 2ZJPF 5GAEJ 1HC8A 5GAHJ 1YJ9I 3CCVI 2E35A 3CCQI 4IOCF 2FOWA 4IO9F 1YI2I 4IOAF 1VQKI 1YJNI 1VQNI 1QA6A 5JVGF 3CCLI 5DM7F 3CCJI 2OTJI 4UY8I 2ZJRF 3CCMI 5GADJ 3CD6I 3DLLF 2K3FA 1YHQI 5DM6F 3CF5F 1Y39A 1YIJI 1VQMI 2QEXI 3CCSI 3G6EI 3CCEI 3CMEI 1VQ9I 3PIPF 3J7YJ 2NXNB 3CMAI 2QA4I 2E36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 I;  5GAG J;  2ZJQ F;  1VQ8 I;  1VQO I;  3CCR I;  3CC2 I;  2H8W A;  3CCU I;  1VQ6 I;  2E34 A;  1MMS A;  1VQ4 I;  1VQL I;  4V19 K;  3PIO F;  3J7Z I;  3G4S I;  1YIT I;  1ACI A;  3G71 I;  3I56 I;  1S72 I;  1VQP I;  1FOX A;  2JQ7 A;  3CJT B;  3CC7 I;  1VQ5 I;  1VQ7 I;  1YJW I;  3CC4 I;  1FOW A;  2OTL I;  1FOY A;  2ZJP F;  5GAE J;  1HC8 A;  5GAH J;  1YJ9 I;  3CCV I;  2E35 A;  3CCQ I;  4IOC F;  2FOW A;  4IO9 F;  1YI2 I;  4IOA F;  1VQK I;  1YJN I;  1VQN I;  1QA6 A;  5JVG F;  3CCL I;  5DM7 F;  3CCJ I;  2OTJ I;  4UY8 I;  2ZJR F;  3CCM I;  5GAD J;  3CD6 I;  3DLL F;  2K3F A;  1YHQ I;  5DM6 F;  3CF5 F;  1Y39 A;  1YIJ I;  1VQM I;  2QEX I;  3CCS I;  3G6E I;  3CCE I;  3CME I;  1VQ9 I;  3PIP F;  3J7Y J;  2NXN B;  3CMA I;  2QA4 I;  2E36 A; 
#chains in the Genus database with same CATH topology
 3LAJ A;  3V7S A;  1MH4 A;  1YLF A;  2E2H J;  1Z3X A;  1OCC H;  1VQO I;  4XN3 A;  2KIS A;  5LBQ A;  2DFI A;  3HSE A;  2EFO A;  1LDD A;  5EF6 A;  2P0W A;  4UB6 C;  5LHG A;  2TRT A;  1SD6 A;  2L0K A;  3VPR A;  4ZC3 A;  3T5X A;  3S2H J;  1X1C A;  2BEO A;  1AHD P;  3CCU I;  2ELK A;  4L18 B;  4UUT A;  3FIS A;  5M3M J;  4W97 A;  1XN7 A;  1I39 A;  1VF9 A;  2HFH A;  2X48 A;  3SQN A;  2WTE A;  4P5O A;  1MMD A;  1UHS A;  3GFL A;  4XSZ F;  4BAY A;  1FBS A;  1QPI A;  1Z3Y A;  1F36 A;  1IO2 A;  1HBX G;  3DTI A;  2K4B A;  2QLZ A;  3CLO A;  1TNT A;  2NOJ B;  3H9J A;  2KLO A;  3WTS C;  3BR5 A;  2IS1 A;  1QVU A;  3SFZ A;  4EQQ A;  4YEL A;  3PNV A;  1T0F C;  2XB5 A;  5FKK A;  2RNG A;  5ED4 A;  5FKN A;  3WTZ A;  2XRL A;  1H8A C;  1ON1 A;  4H0E A;  1KU9 A;  5BOX A;  2CH0 A;  4B8X A;  3COA C;  4IRG A;  3CCQ I;  1R4N B;  3OYD A;  1WKM A;  2KJC A;  2L7Z A;  3S16 J;  2QSG X;  2EV5 A;  2WY7 Q;  5ICG A;  3P9I A;  2XIG A;  4KIT B;  1ORK A;  3GZN B;  2F4M B;  2F5C A;  4M3G A;  1YFH A;  2R92 J;  1NH3 A;  5A2Q Z;  3P9C A;  3GTP J;  4IOA F;  3NQO A;  2OAZ A;  3BWG A;  2PJP A;  2DA1 A;  3HL2 A;  1WJB A;  5FJ8 J;  3MWM A;  3V42 A;  3EUH A;  1DU6 A;  3MKY B;  4TV7 A;  2ZFU A;  4HOB A;  3R4K A;  3BPX A;  4KUM A;  3GZ5 A;  2VLA A;  4MTE A;  2HNH A;  4IQJ A;  1WJ5 A;  3M3Y J;  3ZQQ A;  4OIR F;  1R49 A;  5HS9 A;  2MLG A;  3RJP A;  2WB1 N;  2O61 A;  1BOB A;  2DDB A;  1RRJ A;  3H9G A;  3E5X A;  2HQA A;  3LSJ A;  1AOY A;  1RZ4 A;  1W36 D;  4J19 A;  1G8X A;  2HQ5 A;  4M9X A;  3BG9 A;  3R0A A;  2KRF A;  1WJC A;  2STT A;  4BE1 A;  1ZGA A;  2NNN A;  3M1C A;  1LJ9 A;  4F55 A;  1B6A A;  2GM4 A;  1W4M A;  2FXA A;  2LK2 A;  2MYS A;  3LAP A;  3AL0 C;  2I5U A;  3JAM K;  3H5R A;  2M2E A;  1MNE A;  1JKR C;  3E5U A;  4XLE A;  3F6V A;  5GAG J;  3DWL E;  4M74 A;  3IAS 2;  1FYL A;  3ZQI A;  4MQ9 F;  4MQV A;  5ERI A;  3ABM H;  3CC2 I;  2CUF A;  1SC7 A;  2GZW A;  4LLL A;  5JI6 A;  1OMI A;  4IRH A;  3VOE A;  5GPC A;  3B73 A;  5HNF A;  2KDZ A;  1WJF A;  2HYF A;  5DD8 A;  4HLX A;  3KP5 A;  5F0F A;  3JTH A;  3HOS A;  2NNY A;  1MJA A;  5FKO A;  1ZYR F;  4FE7 A;  1RR7 A;  4ZYH A;  2X6X A;  3G71 I;  2HVQ A;  2IA2 A;  1N25 A;  2GOX B;  4BXU A;  4XMY A;  3RZO J;  2K9L A;  3KCC A;  5CKT A;  5FO5 A;  2CUZ A;  2PMZ N;  2ZJ2 A;  5C44 J;  1FSH A;  4E70 A;  5TJJ A;  2EFN A;  2L01 A;  4YRV A;  2BHZ A;  4LFU A;  2DOA A;  1TWC J;  4L5I A;  4RB2 C;  4XKB A;  4LG0 B;  1ZG3 A;  3K2Z A;  4XLA A;  2EZH A;  2H09 A;  3DBR B;  3DBL B;  2FMY A;  1WVR A;  1RPW A;  4IOC F;  1P9Q C;  4FQG A;  2KP6 A;  1T08 B;  3M9A A;  5JLW A;  2EV0 A;  2QQ9 A;  5DUI A;  3BR3 A;  2ZXW H;  4BHC A;  2O8X A;  3H5N A;  2HOS A;  1HCR A;  3FBN B;  3OYI A;  2K5C A;  3QU6 A;  1RNL A;  4N9H A;  1MBF A;  5C4J J;  5FKL A;  1JUM A;  4PCQ A;  3S93 A;  2LBF A;  3QPH A;  1XGS A;  3VYR B;  1GLN A;  4ZH4 F;  1DUX C;  3K4C A;  3P7N A;  1QA6 A;  2VXD A;  3KFW X;  5CJ9 A;  1T33 A;  1IN8 A;  2QEN A;  3ASN H;  4Y17 A;  3TW6 A;  2CQ7 A;  2VKE A;  5J47 A;  4PUS A;  2M0M A;  1LB2 A;  5DM7 F;  3KE2 A;  2VUM J;  4MNU A;  4XQF A;  3ZMV A;  4WXC A;  3DF8 A;  4P1W A;  3I5U A;  4KN4 X;  4EJW A;  4AC0 A;  3AG2 H;  2HGC A;  1D8J A;  2Y9Y A;  3G1M A;  2ZKZ A;  4HV6 A;  2B9S A;  1V5E A;  2KHM A;  4AWX B;  2XAF A;  3FMR A;  2K4J A;  2LH9 A;  3LQR A;  1YG2 A;  1Y56 A;  3GX4 X;  2DPU A;  2BBY A;  2ISZ A;  3F21 A;  2L02 A;  1YRN B;  2YSR A;  3CMA I;  1IG7 A;  3VSL A;  3RKQ A;  3SJM A;  2V4J C;  4C3I J;  1LFP A;  3TBI A;  1XGM A;  2OD5 A;  3OIP A;  1Y6I A;  2J5O A;  2M1B A;  3VYT B;  2XV4 S;  3OIQ A;  3AL0 B;  4A3L J;  2HQR A;  3BZC A;  1LVK A;  3BG6 A;  3SEQ A;  2IGN A;  1WPK A;  1ZR4 A;  3ULQ B;  1O7L A;  2LG4 A;  2NYX A;  4BE0 A;  1S6L A;  2JT1 A;  5KAI C;  3BR2 A;  4BBS J;  4CCM A;  2X9D A;  4U0Y A;  4E7L A;  2UZK A;  1WZ2 A;  2ZXI A;  2Z99 A;  1S3J A;  2ELH A;  1FX7 A;  4S04 A;  1J0R A;  3BY6 A;  4RM2 A;  1G3T A;  3KZI C;  1ZK8 A;  4A69 C;  1J9I A;  2FBH A;  1ETQ A;  4QPO A;  1JUP A;  5HDG A;  3WGI A;  1J59 A;  3JCU C;  4HW0 A;  3JTG A;  2HI3 A;  1U0J A;  3BG3 A;  1BIB A;  3CJR B;  4RAY A;  2XAH A;  3G1L A;  4UXN A;  3NWS A;  2M0C A;  4RMN A;  3I58 A;  2R3S A;  5E17 F;  2VT3 A;  5H20 A;  3DXJ F;  2X51 A;  5DCM B;  3K4M A;  1R5G A;  2QBY B;  3KP7 A;  1Y1W J;  3BRO A;  1FP2 A;  4DOZ A;  4G9Y A;  5FLV A;  1STZ A;  1XX5 A;  2V79 A;  3N05 A;  2CGP A;  3IH3 A;  2MC3 A;  2OUM A;  3BZ6 A;  1DU0 A;  1YOV B;  1TWA J;  3WE3 A;  5ILU A;  4EJO A;  3OYH A;  3P5J A;  4V2G A;  3M07 A;  5KNL A;  1YS6 A;  3FX3 A;  1LFB A;  2DT5 A;  2JSC A;  3JRH A;  2GXA A;  4E7Z A;  4NC8 A;  2A6E F;  4RBO A;  3B6A A;  2V9P A;  3S1Q J;  2L7K A;  4MGR A;  4CCK A;  3OR2 C;  2A3S A;  3DKW A;  2HZD A;  2CJJ A;  3I64 A;  2LKS A;  4G8X A;  3MKZ A;  4EV0 A;  3FMQ A;  2AS5 F;  1U5T C;  1Z6T A;  3G6E I;  4KDP A;  5BNG A;  1ZAR A;  3I4M J;  1A36 A;  1ZGW A;  4MTD A;  1J09 A;  3GVA A;  4Y3O A;  5IOY A;  2LY1 A;  4LK1 F;  2QA4 I;  4OIO F;  3IV5 A;  1TWH J;  4F93 B;  1IZ1 A;  5DD4 A;  4E7S A;  3KP4 A;  1OCR H;  2C6Y A;  1BW6 A;  3HTS B;  2BGC A;  4C2M J;  1I50 J;  2M3A A;  2XAU A;  4ETS A;  1ONV A;  1QHH D;  1VND A;  4UUS A;  1R4M B;  3WU2 C;  2M87 A;  4CUG A;  1SFE A;  2X1E A;  4XLF A;  2ISY A;  2EH3 A;  3J7Z I;  5TRD A;  3FDY A;  2CV0 A;  1DQU A;  3X2Q H;  1TQM A;  1U6G A;  2XDV A;  4OIP F;  2H6C A;  2VL8 A;  5HOD A;  4E7H A;  2R5Z B;  4LG0 A;  2X6Y A;  3O6B B;  5L3E A;  4M3E A;  3R61 A;  3FXU A;  5EEH A;  2JZY A;  4EM0 B;  1LE8 B;  1T0F A;  1MMN A;  3EDP A;  3CQZ J;  1BBY A;  2RNJ A;  5D4R A;  4UUV A;  2QQA A;  1UG2 A;  1HC8 A;  3WGG A;  1XB4 A;  1W0U A;  4XRM A;  3V8L A;  3OWT A;  4KIF A;  4A6E A;  4KIG A;  1IV6 A;  4I2O A;  1Z9C A;  4CIC A;  3HC7 A;  2Z2S B;  1P4W A;  1SAU A;  2GA2 A;  2KZV A;  2XPU A;  3KPH A;  4EJT A;  1B1B A;  3CUQ C;  1WHU A;  1JHF A;  1KU2 A;  2L9V A;  3PL8 A;  3I0T A;  1APL C;  3I4N J;  1IXS B;  4CZZ A;  3W3C A;  2ZBK A;  3K4J A;  3U9G A;  2FX0 A;  3HEF A;  1R58 A;  1Z6R A;  3ZR8 X;  5LEJ A;  3BR1 A;  4XIC A;  2WA0 A;  3V7C A;  3NEU A;  1IAW A;  2IGK A;  3RYP A;  3MAJ A;  3GTG J;  2CUE A;  2HDW A;  5EEA A;  4II2 A;  3MVP A;  4XON A;  4KA4 A;  5M5Y J;  4WK8 F;  3K2A A;  1E0E A;  2VJ5 A;  3OS1 A;  1O3Q A;  1YS7 A;  5F08 A;  2X6O A;  1YRN A;  4A5N A;  3PM1 A;  2FML A;  2CW0 F;  3C2B A;  3RKW A;  4C3J J;  2DO7 A;  2L9S A;  2XAJ A;  2D5V A;  3GLL A;  1TZL A;  1R1U A;  4MLO A;  3L00 A;  3J7Y J;  1MDM A;  3FXQ A;  4B47 A;  2RKH A;  2EIK H;  3LST A;  2OZ6 A;  5FD6 A;  1IRX A;  2R7S A;  3CDL A;  1U5T B;  4UVA A;  2ZJQ F;  1W0T A;  4EJV A;  3M4O J;  3VDX A;  3UR3 C;  5JFR A;  1DGW Y;  1LEB A;  2GAU A;  1OCZ H;  5DYM A;  2Z33 A;  2JWT A;  1ETK A;  4X1E A;  1WQ2 A;  3VOD A;  3SZP A;  2X4H A;  3QQA A;  2DBB A;  2E34 A;  2F48 A;  3BG5 A;  2VQH A;  3DKY A;  1OCT C;  1MMS A;  3O2P E;  2GWR A;  2XPW A;  1A35 A;  4BH9 A;  3SEZ A;  5L3D A;  4QWQ A;  5K7Z A;  1ZEL A;  4P9F A;  3DPT A;  2DYR H;  4GRI A;  2M5W A;  3TQN A;  2JUC A;  1QZE A;  2L9R A;  1HDP A;  1IDY A;  1SFK A;  1FOX A;  4G6Q A;  1PUE E;  2V6C A;  3TO9 A;  4FX4 A;  1R71 A;  2VIX A;  2IXS A;  3N97 A;  1HST A;  4MIM A;  2QVO A;  3F23 A;  4DYR A;  3CC4 I;  4Y4R A;  2I10 A;  2Z9O A;  4Q4Z F;  5AIQ A;  2DMU A;  2E1M C;  3BR6 A;  4IZZ A;  5DCM A;  4OOI A;  1P92 A;  3KZY A;  2Q1Z B;  3G2B A;  4U7D A;  3LOC A;  3I9V 2;  1X19 A;  4XN0 A;  1ZRD A;  2QKM B;  1B4A A;  3BCB A;  4BS9 A;  3K70 C;  2H1K A;  1YI2 I;  3K10 A;  5E8G A;  3JRG A;  3GTJ J;  2CS3 A;  3SYT A;  2MC4 A;  2OPT A;  3IKV A;  3OL3 A;  5KVR A;  3C2H A;  1SMT A;  1A6Q A;  2FQ4 A;  5J1Y A;  2TDX A;  4LK0 F;  1TBX A;  2P7V B;  2A5Y B;  5FB2 A;  1VQN I;  2YR2 A;  1FYM A;  2Y30 A;  2M7A A;  4P55 A;  5F0C A;  4I01 A;  2ZXJ A;  1T6S A;  1BW5 A;  3CUQ B;  3HG9 A;  4LLG F;  1FTZ A;  3GCM A;  2BVM A;  4PSW A;  1FYK A;  2P8T A;  3S17 J;  5D8L B;  2K7L A;  2BY3 A;  1XSX A;  1WWX A;  1IDZ A;  4EM2 A;  3IL2 A;  3E1S A;  4A3J J;  1D1A A;  4IHS A;  2FOK A;  1D0Y A;  2Y0M A;  5B1B H;  1TTY A;  1Z05 A;  3EUA A;  4ZYE A;  4ESF A;  3TOA A;  1UEL B;  3GLX A;  5CLS A;  4KYW A;  2XF5 A;  1DPU A;  5B3S H;  3CCS I;  1XCB A;  5E3M A;  4MHG A;  5BQT A;  1X1D A;  3FWE A;  2B0L A;  4W1U A;  1QHG A;  3LSG A;  2IT0 A;  3FM5 A;  3W6J B;  1D5Y A;  1FIP A;  1ERD A;  2NS0 A;  3WTX C;  1LDK B;  2DA6 A;  1YIO A;  1OYW A;  1R22 A;  2V9V A;  1FP1 D;  3CCR I;  4S05 A;  3PJR A;  1A6I A;  2YU9 J;  4ZDP A;  4EVI A;  3N4M A;  4LIT A;  1KON A;  1I6X A;  2JA2 A;  1WGX A;  2IGM A;  2MFZ A;  2EZK A;  3F8C A;  5FRM A;  3TO7 A;  4PFO A;  2QSH X;  4LB5 A;  3HOW J;  3D5R C;  2LY9 A;  3ASO H;  2LRE A;  2A6T A;  2DAO A;  1RET A;  1K78 B;  5E18 F;  1HF0 A;  1I5Z A;  2ZO4 A;  2BOL A;  5J6X A;  1YIT I;  2R5Z A;  4I0A A;  4XKW A;  2M45 A;  4HYE A;  2P4W A;  1LE8 A;  3JRI A;  3HRS A;  2ETH A;  5JVT A;  1X58 A;  3RPU A;  3QP5 A;  2I8D A;  2IS2 A;  4L5E A;  3H3U A;  4E7I A;  3NAU A;  3CC7 I;  3EYI A;  4PFP A;  2NRA C;  3LNQ A;  2JMW A;  5HS8 A;  1SMY F;  1FOW A;  2OJE D;  2E5Z A;  3S2D J;  4LMY A;  1MND A;  4M71 A;  5GAE J;  3DEE A;  1SVM A;  2XGE A;  4N9I A;  2W7N A;  4O6J A;  5GAH J;  3ZMZ A;  4IEJ A;  3CMM A;  4DYC A;  2E35 A;  3M7G A;  1KGS A;  1TP4 A;  3FHN A;  3KP3 A;  3O8G A;  1HA8 A;  2XAG A;  1HW1 A;  4MFE A;  2E1M B;  2V9K A;  5DDG A;  3OYK A;  1U2W A;  3OY9 A;  3ESW B;  3E0J B;  4J00 A;  3HKZ A;  1S9H A;  2FUG 2;  3TP3 A;  1SVO A;  1FJL A;  1XGO A;  3I3L A;  4I98 B;  3W2V A;  2FNA A;  1JTY A;  4G7H F;  4HEA 2;  1EH8 A;  1XCV A;  2CYY A;  3FXJ A;  1W7P D;  2UXX A;  3TED A;  4B1R A;  1ZQ3 P;  5JVG F;  5KAF C;  2HDD A;  3ECH A;  3JW4 A;  4N4N B;  2G7H A;  5TIS C;  3RKX A;  1O3S A;  2LYC A;  2XSD C;  3HOY J;  2MD5 A;  2RVC A;  5KHD A;  1KA8 A;  3L2R A;  5CQE A;  4A5M A;  1BI3 A;  1UST A;  1ZR2 A;  3TL4 X;  2HZT A;  4Y13 A;  1MMA A;  2P5L C;  4IHT A;  1JUS A;  1U5T A;  1JGG A;  3VYS B;  4YIR X;  1KU7 A;  2ZNY A;  4X0G A;  1J2X A;  3DQV C;  3S1R J;  1JGS A;  2DK5 A;  1OYY A;  2CU7 A;  2OZU A;  3K1M A;  1WFX A;  3BZK A;  4L5J A;  4I99 C;  2ADU A;  4CCO A;  3GTQ J;  3BT9 A;  3F8B A;  3GO5 A;  2M4G A;  4PJL A;  4CCJ A;  2BHY A;  3KLN A;  2LRD A;  5J40 A;  4ON0 A;  5FLX Z;  1S29 A;  1PP8 F;  1U8B A;  2CUJ A;  4I0B A;  3DV8 A;  2PMH A;  4BQA A;  2ZME C;  3S32 A;  5CVU A;  1QU3 A;  3KYD B;  3OYG A;  2MLK A;  1LVA A;  2AO9 A;  1UHW A;  1T56 A;  2J5P A;  5CQG A;  3KZZ A;  2MH2 A;  2IA0 A;  4A12 A;  4KN7 X;  2DI3 A;  3PIO F;  4G7Z F;  1UMQ A;  2VAS A;  2QQ8 A;  3RCO A;  1ACI A;  2ME0 A;  4IHX A;  3U1K A;  3HB9 A;  3PNY A;  4ITV A;  2Y9Z A;  2XKP A;  2L4M A;  2LSO A;  1S72 I;  2HYG D;  2A68 F;  3NRV A;  1R7J A;  1VQP I;  2O03 A;  4LD5 A;  3NAR A;  1FEX A;  3W2A A;  4RA2 A;  4PJJ A;  3R6S A;  3AG1 H;  5LGT A;  4BDY A;  3ZXS A;  2N8G A;  1F4K A;  1C0W A;  4ASN A;  3CCY A;  3CP8 A;  3E6M A;  1N78 A;  2DA3 A;  2O7O A;  4M3F A;  4B4C A;  1XMX A;  2QF7 A;  1JKO C;  1EJ9 A;  1G59 A;  2DT7 B;  1YO5 C;  3A0H C;  3JR9 A;  2FSW A;  4LG3 A;  4XKC A;  3ELK A;  1DPR A;  4XR6 A;  3OYM A;  4IX7 A;  1D5V A;  4M73 A;  2O0Y A;  4YII A;  3GFJ A;  2QQB A;  3CUQ A;  4BYY A;  3CO7 C;  2EFP A;  4DNC A;  1SD5 A;  2HVR A;  4AIJ A;  2PJR B;  4CGZ A;  2K86 A;  4D5C A;  2PEX A;  3KYL A;  4F3Q A;  1QRY A;  4I6Z A;  2IA1 A;  5GTH C;  4LOC A;  1FPQ A;  4CA0 A;  2JA8 J;  5J4Y A;  4LB6 B;  1MMG A;  2Q8K A;  1XSD A;  2UV1 A;  3WTV C;  4ZTF A;  2DA4 A;  5F04 A;  2JJ7 A;  2E5N A;  5HOO A;  4A3F J;  3KEY A;  5FFX A;  2Z16 A;  3CUO A;  3FHZ A;  1HQC A;  4BL0 B;  4DZJ A;  3EYY A;  3CDI A;  1BL0 A;  3OIO A;  4GFB A;  5EZG A;  4Q5S F;  2YX4 A;  2LNB A;  1W36 C;  2JN6 A;  3A0B C;  4DBR A;  5EG0 B;  1SFO J;  2LF7 A;  2BY1 A;  1D8K A;  9ANT A;  2MGQ A;  5LD2 C;  3OS2 A;  2K9M A;  1IRZ A;  2DMQ A;  4AID A;  1Y0U A;  3SZG A;  5LHH A;  2EIN H;  2PI0 A;  1IC8 A;  3FM3 A;  5E1X A;  4M72 A;  1N75 A;  2IS4 A;  2Q2E B;  2ECB A;  4L9J A;  3TP0 A;  5FGM A;  1FLI A;  1YW7 A;  4PJN A;  2DJI A;  1K78 A;  3AG3 H;  2R7Q A;  3GTK J;  2PQ8 A;  1OCO H;  1MBH A;  2HTS A;  2BXY A;  2QZ8 A;  4KMU X;  4FTH A;  1JT0 A;  4Q48 A;  2DTR A;  4IKF A;  3DU6 A;  3KP2 A;  1Z1D A;  5HNH A;  3K4K A;  1CF7 B;  3ML6 A;  2ZME B;  1JKQ C;  1RUN A;  1GUU A;  2EA2 A;  1SAX A;  1T39 A;  1PP7 U;  3J7A Y;  3M8F A;  3W6V A;  2IPQ X;  3WTY C;  2FRH A;  1KQ9 A;  3MD2 A;  3IKT A;  2KIF A;  3RI4 A;  1H89 C;  1GV2 A;  1TL8 A;  5K1Y A;  2H8R A;  1G3S A;  1UFM A;  2WV1 A;  3GFI A;  1WH7 A;  1SVL A;  5H2F C;  2ID3 A;  1K4T A;  1JHH A;  4CYD A;  3MZ8 A;  4RM3 A;  2OTL I;  4M3D A;  4D7N A;  2DXI A;  2RDP A;  1V4R A;  3K0L A;  2YUS A;  2R0Q C;  2JPC A;  3MMY B;  2EZL A;  1J75 A;  2A07 F;  1UG0 A;  2PMZ A;  3ZMT A;  4HSR A;  4EJU A;  2MW8 A;  3OR1 C;  2LTP A;  1XD7 A;  3LA3 A;  4AVZ A;  3WOD F;  4HQM A;  2HXO A;  1TNS A;  2MD0 A;  3CO6 C;  3Q9V A;  2VE9 A;  2KRC A;  2ICW G;  4BY7 J;  3ZOB A;  2KMU A;  3IWF A;  1ZLK A;  2PX9 A;  1T38 A;  1BOA A;  3ZMS A;  2NVT J;  2XAS A;  3ERM A;  3QOD A;  3J81 K;  4PJM A;  4UB8 C;  3L2V A;  1MW7 A;  2M4K A;  3VFZ A;  2VON A;  4ZTJ A;  4XK4 A;  1OYI A;  3T8R A;  4JYK A;  2MG4 A;  5EYR A;  3J80 Z;  2D1V A;  4F7Z A;  2JA7 J;  3D5S C;  4C9Y A;  4PSX A;  1WJE A;  4KIB A;  2DT6 A;  2Y75 A;  4DQ2 A;  2JVG A;  4CDG A;  4IQ4 A;  4E7K A;  3AFH A;  2FBI A;  1ITY A;  3LSP A;  1FBU A;  5DEQ A;  2HEO A;  3OS0 A;  3UNG C;  1IRF A;  1J5Y A;  3O8H A;  4C30 A;  3OYL A;  2LVS A;  4Y33 A;  2QEX I;  3WGH A;  2F5F A;  5CVJ A;  3JAM Z;  1XG1 A;  3E97 A;  4RDU A;  1IJW C;  3IUO A;  1JKP C;  2Z3Y A;  1BJA A;  2XUB A;  1XSV A;  1P6R A;  3A1Y A;  2PBI A;  5EEG A;  3OOU A;  3EET A;  1BR1 A;  1Q1H A;  1VQ8 I;  2VOD A;  3TGN A;  1B72 B;  5K7F A;  2EIL H;  5FD5 A;  3BCA A;  2R5Y B;  5F27 A;  3OOP A;  1IGN A;  5IT9 Z;  4EGY A;  2HOT A;  1OJL A;  4B3A A;  1S7O A;  1WH5 A;  1MGT A;  4CH7 A;  1ETV A;  3PQJ A;  2OV7 A;  2Q0O A;  5LGU A;  3BLY A;  3EPZ A;  1GV5 A;  2ZXH A;  4PGG A;  4D1Q A;  5LRS A;  2R7V A;  3PSI A;  2IBD A;  2VKH A;  3JRE A;  3K1N A;  3GXO A;  2LMD A;  3U21 A;  5KK1 A;  2O3F A;  3OYA A;  2FBK A;  1YX3 A;  3C2G A;  2LC2 A;  5EDN A;  3HRU A;  4BGD A;  2NVQ J;  2E2I J;  4AYB N;  1USS A;  1AA7 A;  2GBY A;  2X6W A;  4Y15 A;  3GUD A;  2MA3 A;  3SHF A;  3HIF A;  2FD5 A;  4PDK A;  4U0V A;  1R1V A;  3RKY A;  1G4D A;  1B9M A;  5E3L A;  2DLL A;  2DFH A;  2M8E A;  3WG9 A;  1PUF B;  5IPA A;  3CES A;  3S3O A;  5J1R A;  3DLA A;  2FOW A;  1H88 C;  5B5E C;  4A2U A;  4RGR A;  3TDZ C;  3PQK A;  4XOR A;  4IO9 F;  3K7A J;  3DTE A;  4NNJ A;  3Q0U A;  5ICF A;  5J8F A;  4U7B A;  1FOK A;  3F3X A;  3HSR A;  2W85 A;  1X2N A;  4XSX F;  3OV8 A;  4YIF A;  2E7W A;  4WF2 A;  1K79 A;  1U9O A;  5TGT A;  4LJZ F;  1IW7 F;  4ZYG A;  4HF0 A;  4XM3 A;  3SXY A;  3WTU C;  4XLH A;  2YX7 A;  2L54 A;  4XLC A;  5D5X B;  5E1W A;  2PFB A;  1PVE A;  4OAY A;  1J7K A;  5BPD A;  2W57 A;  2Y0S N;  1R00 A;  2IVM A;  4AU7 A;  4YFN F;  5EG0 A;  3RZD J;  3LFK A;  2IS6 A;  2F4I A;  1REP C;  4BXF A;  1JTX A;  3RPQ A;  2XRN A;  2F5E A;  3OYC A;  3ZN0 A;  2P6S A;  3SFI A;  4V2F A;  1MZB A;  2EZI A;  1MKM A;  3F6O A;  3RYR A;  2COM A;  3ABU A;  3BQY A;  2F5D A;  2Q2E A;  1IUY A;  3FXL A;  2CQQ A;  1YQA A;  2ID6 A;  1E17 A;  3DFG A;  1G3Y A;  2YS9 A;  4E7J A;  2G0E A;  2JUG A;  2ELJ A;  3CZ6 A;  4NQW B;  1ULY A;  1WJA A;  2BY0 A;  4XRF A;  1HXD A;  4IRI A;  5IYD J;  3PO3 J;  4QLC U;  1FZP B;  2ACJ A;  3OL4 A;  3S15 J;  1CF7 A;  2COB A;  2ZME A;  1AU7 A;  1S5L C;  4JX4 A;  3JSP A;  1QVT A;  4I76 A;  4OIQ F;  3IHU A;  2W24 A;  2EWN A;  2OU2 A;  3JSO A;  1W1W E;  3MEX A;  1NG6 A;  1KQ8 A;  2DOE A;  2DU9 A;  3ISP A;  1F5T A;  1IXR C;  2L7F P;  3R60 A;  4S0H B;  4BHP A;  4AUX A;  3QOE A;  5JHF A;  4O3M A;  1QZZ A;  5C3E J;  4GO1 A;  3J7A O;  3HBL A;  2VPL A;  2HS5 A;  3H35 A;  3EUK L;  1FBQ A;  2PN6 A;  1PDN C;  2XB0 X;  3F72 A;  2K3P A;  4KNY A;  3K1P A;  2XF6 A;  2VKV A;  4Y52 J;  1X2M A;  1TC3 C;  3QAH A;  1FOY A;  2RGV A;  3ZN1 A;  1TT5 B;  4JQF A;  2HOA A;  1ZRF A;  5HDK A;  4OWR B;  1WRJ A;  1OLT A;  2NVX J;  4BY1 J;  1AWC A;  1SD7 A;  2A05 A;  5B1A H;  5IP9 J;  2L4A A;  4NBQ A;  3T0Y A;  1D0Z A;  3K4N A;  3V7R A;  5LFA A;  1D1C A;  1SFX A;  3DPU A;  4RB3 C;  1B8I B;  1TWG J;  3MKW B;  1MNM C;  2KQR A;  3TMO A;  2XHK A;  4BQN A;  3ZQG A;  4IPA A;  3TW7 A;  2VE8 A;  3FF5 A;  3NWT A;  5H6R A;  2XC7 A;  3CJQ B;  1YJN I;  1ZN2 A;  4U87 A;  4RB1 A;  5A2Q K;  2TCT A;  2QKL B;  3MN2 A;  2V1U A;  5F6F A;  2OA4 A;  1LUJ B;  4D0P A;  2E2J J;  4QPQ A;  4U88 A;  5DUK A;  2QBY A;  4L0Y B;  1IUF A;  4XRS G;  3HOZ J;  1EV7 A;  1ZHF A;  2E1C A;  1ETO A;  2H1L A;  1NTC A;  3S14 J;  3CCJ I;  1F43 A;  2AXL A;  2JK3 A;  3PO2 J;  2W4S A;  1L3L A;  5ILS A;  2V7F A;  3CD6 I;  2QUF A;  4HG2 A;  2LR8 A;  4WXD A;  2W84 A;  2VXZ A;  4HNT A;  5DM6 F;  4L0Z B;  1TQP A;  2NVU B;  2HXI A;  4K2E A;  2LOO A;  2H94 A;  5D5W B;  3GYH X;  2DPD A;  3HGY A;  5IP7 J;  2V1N A;  3L2C A;  5GP9 A;  3EQL F;  5KCM A;  3QYB A;  3CCE I;  3HOU J;  1B72 A;  5K7H A;  4WCG A;  2Z1D A;  4MFD A;  1XDU A;  2OBP A;  3H1C A;  2EPF A;  2R5Y A;  4I02 A;  1E3P A;  5CPR B;  2BZT A;  1YX5 A;  2RN7 A;  3DEW A;  2A61 A;  3MCZ A;  2VQL A;  2CW8 A;  3QYF A;  1OCP A;  5J3L A;  4CO8 A;  3GZ6 A;  1K7A A;  3KEQ A;  4ABZ A;  1K4S A;  2IJL A;  3BTJ A;  2H8W A;  1I27 A;  1MD0 A;  1N77 A;  3LA2 A;  4A3C J;  4L9N A;  5BS6 A;  4A3D J;  2O5R A;  3REO A;  3HXL A;  4LIU A;  5D6F A;  2WAF A;  2VQG A;  3C18 A;  2O6G E;  2KJB A;  1YTY A;  1FSE A;  1I3A A;  2HYJ A;  2R7X A;  5D8K B;  2VKD A;  1P7I A;  4XID A;  4KIS A;  1MBK A;  3K6G A;  3OMY A;  3LSR A;  3JRD A;  2M9H A;  1K83 J;  2ESH A;  4EGZ A;  3OYB A;  1QBJ A;  3FXR A;  4JK1 X;  2VC0 A;  3ZMU A;  4HDV A;  4UVC A;  2KIQ A;  3RQ4 A;  2GLO A;  1K61 A;  1PUF A;  4BUP A;  1Y0N A;  3HPG A;  1T8I A;  2DA2 A;  2R7W A;  4MEX F;  1DDN A;  2OC6 A;  2R7F A;  2MAB A;  4BE2 A;  2E1O A;  2VBY A;  2WAQ A;  2NAZ A;  1LDJ A;  2EB7 A;  4IVN A;  3AKZ A;  3G3Z A;  1ZH5 A;  1IN7 A;  2JTV A;  4BEH B;  4IHV A;  1W5T A;  4HST A;  2Y48 A;  1L0O C;  3CMY A;  2IP2 A;  4GXO A;  1R36 A;  2CW7 A;  3GWZ A;  2LDU A;  3WHC A;  1ZRE A;  1IN5 A;  4AIH A;  1Y8Q B;  2GQQ A;  2FE3 A;  2Y2Z A;  1BJZ A;  3BG7 A;  2FNP A;  1WSU A;  3H0G J;  3D5L A;  2DOD A;  3I53 A;  5IOZ A;  1YYV A;  1MBJ A;  3F9K A;  1POG A;  4H4K C;  4M6V A;  1B9N A;  2LD5 A;  2VC1 A;  2IGO A;  2UUZ A;  3IH2 A;  1RKT A;  5DTD A;  1H0M A;  2P5V A;  1OR7 C;  5DCF A;  2VJI A;  1KYZ A;  4XNF A;  2EQR A;  5J4V A;  2L2O A;  3U2R A;  3CCM I;  1HKQ A;  2AHQ A;  1RC9 A;  5J1U A;  1TT0 A;  5D4S A;  2DFE A;  4BJ5 C;  2WC2 A;  3OYJ A;  5K5Q A;  3ZPL A;  5K5R A;  1ZG5 A;  1HKS A;  3H3Z A;  3V8K A;  3WG7 H;  1HOM A;  1VQM I;  4WWC A;  1O3T A;  2NS7 A;  4NQW A;  4DZP A;  4E4H A;  3LQQ A;  3G73 A;  1BI0 A;  4U0W A;  5JHU A;  2V6E A;  1ZTR A;  4UHT A;  2HOE A;  3H9Q A;  1E3H A;  1R6R A;  4FT8 A;  1O3R A;  1VQ9 I;  4GYG A;  3G1O A;  2W25 A;  2NXN B;  2EIM H;  4O5V A;  5EZH A;  3JRC A;  2JVH A;  3OYN A;  1MSF C;  3KYC B;  1P2F A;  1Y1V J;  1TQI A;  2E36 A;  1OIS A;  4EM1 A;  1BR2 A;  2E71 A;  1FWZ A;  3ZCO A;  1EF4 A;  1GDT A;  2LY2 A;  3GF2 A;  1GT0 C;  1GVD A;  1RES A;  3HYI A;  5FRN A;  2DMN A;  3TO6 A;  1BM9 A;  4AD9 A;  2DMT A;  2OCE A;  5F0H A;  3LSK A;  1BC7 C;  2W82 A;  4BDZ A;  2X85 A;  4HDU A;  2O8K A;  2XAQ A;  3PUB A;  1X3Z B;  3TKY A;  2G9W A;  2X0L A;  4DW6 A;  4A3E J;  2EV6 A;  4V19 K;  3E3V A;  4ESJ A;  4B3X A;  5LEK A;  3IRR A;  4LGW A;  2M7B A;  3CDH A;  3ROU A;  3FXO A;  4YEJ A;  4XRS A;  5M3F J;  1UCR A;  1RUO A;  4IXA A;  4KFC A;  3BTI A;  3FKJ A;  2G7U A;  1G6N A;  3FMS A;  2M34 A;  2R93 J;  1S7A A;  2DQL A;  1UAA A;  1NK3 P;  4BXX J;  4LIV A;  4DGW B;  1YJW I;  4UVB A;  3BC8 A;  4FHT A;  2WV0 A;  4RGS A;  3C3W A;  5L3G A;  3ABK H;  2IEK A;  1B8I A;  1EA3 A;  1ZAO A;  3QWL A;  4ZZL A;  5HLH A;  1S8N A;  2FEZ A;  3HRM A;  3S2W A;  2OF7 A;  3J80 K;  4IHY A;  3S8P A;  2CSO A;  1FMW A;  2DTZ A;  1SAN A;  1HKT A;  3RSN A;  1FMV A;  1LEA A;  1XDS A;  5F1J A;  2XPV A;  4YG2 F;  3ZP5 A;  3K4B A;  3WU0 A;  1OPC A;  5HDN A;  2BYV E;  3VB2 A;  1K6O A;  1HW5 A;  1QZY A;  1E2X A;  3WU1 B;  5CYV A;  4GDF A;  5D6E A;  2Y31 A;  3KIO A;  1QNT A;  2NVY J;  3PSF A;  4ANJ A;  2W1O A;  2JRT A;  1LNW A;  3VSK A;  4F91 B;  3H92 A;  5ICC A;  5D5V B;  3WTW C;  2JA6 J;  1H9T A;  4XOT A;  4N0B A;  2EJR A;  4JBA A;  1RIO H;  1NHA A;  3KEO A;  4F52 A;  4A3B J;  3A4C A;  2KFD A;  1KQ0 A;  5CVR A;  3B6C A;  3C1D A;  3A02 A;  3PFY A;  2OQG A;  1BN5 A;  4KIC A;  1DP3 A;  5FRO A;  2XGD A;  1FT9 A;  1WI3 A;  2XSJ C;  1YIJ I;  1TWF J;  3RIR A;  2DJN A;  5E79 C;  2R7D A;  4B43 A;  4DJA A;  2JRM A;  3QPT A;  4A6D A;  1MBG A;  4NUB A;  1GXQ A;  5DV5 A;  5BMZ A;  4G94 A;  2DYS H;  2PG4 A;  2LLK A;  2AQE A;  5IT9 K;  4HNV A;  3BP8 A;  3I59 B;  5D5U B;  4QTR A;  3A01 B;  4UUS B;  5L3F A;  2QWW A;  3HHH A;  3R0J A;  4RGU A;  1LPQ A;  2UWM A;  3M8J A;  2HWV A;  3JRF A;  5IY5 H;  2VBX A;  3I55 I;  1R1T A;  2CFX A;  3ABL H;  3OSG A;  3ZMD A;  4BBR J;  1D1B A;  2CO5 A;  2MBF A;  3RTR A;  2ZFW A;  4HX7 A;  2DDA A;  1P4X A;  3K9T A;  5EJC A;  5IYB J;  5HLG A;  4NC7 A;  2P81 A;  2A69 F;  4HAM A;  3GW2 A;  2FJ1 A;  3IRQ A;  1IF1 A;  5GTI C;  5B66 C;  2VT2 A;  2KL4 A;  3RDI A;  4Z6Y A;  1VFC A;  2MSY A;  2FA5 A;  3H36 A;  5M5W J;  4C2U A;  1U78 A;  2LF8 A;  3HUG B;  1IN6 A;  1AKH B;  4HA8 A;  2QGU A;  3BQZ A;  2ZSI B;  4GGG A;  1V55 H;  4N4O B;  2JA5 J;  1G2H A;  1P4A A;  2WB1 A;  3RPU D;  1Y8R B;  2AQF A;  5HLT A;  2ESN A;  1B59 A;  3A03 A;  1F9N A;  4CCN A;  4BNC A;  6PAX A;  4CCL A;  2JQ7 A;  3CLQ A;  2E19 A;  2ZCW A;  4PK4 A;  3L2W A;  1D0X A;  2CMP A;  4LLN A;  2H6B A;  3V4G A;  4EAT A;  4Q47 A;  3ZQC A;  3M8E A;  3P9K A;  3D0S A;  4BEH A;  2P7C B;  2PMU A;  2BV6 A;  4FCY A;  2BXZ A;  1QGP A;  1UZC A;  2GOM A;  4RLF A;  2H27 A;  5EGO B;  3FK6 A;  2DOF A;  2VN2 A;  3ABT A;  3L2U A;  4GCV A;  3W6K B;  1MSE C;  3V8J A;  1YE9 A;  3SDB A;  1CQT A;  1XC5 A;  2VBW A;  3BDD A;  1HW2 A;  1BI2 A;  3W2W A;  1DGR M;  2XKO A;  2OCC H;  3OYE A;  4BHB A;  2RQQ A;  1Z0X A;  3WHB A;  1IXC A;  1FC3 A;  3A2K A;  2DA7 A;  5C4X J;  2HTJ A;  3HPH A;  2M8G X;  4R79 A;  1SEU A;  1K6Y A;  2XRO A;  4HF1 A;  5FKM A;  2V26 A;  1GHC A;  3VYU B;  2OQR A;  1HDD C;  4ENJ A;  4HZF A;  3GTL J;  3Q5F A;  2HU9 A;  3HRT A;  2OTJ I;  4HX4 A;  2DN0 A;  1FIA A;  4UY8 I;  4CXF A;  5E8I A;  1E3O C;  2ZJR F;  5GAD J;  5AON A;  1MDM B;  3H3V K;  3QPL A;  1W7P B;  3I71 A;  1G3W A;  2KDO A;  3CF5 F;  1TW2 A;  4BJ6 C;  1JE8 A;  2HVS A;  1X1A A;  4PZJ A;  1W5S A;  2D2W A;  1XTA A;  2MH9 A;  2BE5 F;  1EH6 A;  2M30 A;  3S1M J;  2IAI A;  4IJA A;  2E60 A;  3FXK A;  1MH3 A;  1P7J A;  4RS8 A;  4M9Z A;  3HOX J;  1TW3 A;  4A3K J;  4IF4 A;  1Z91 A;  1ZRC A;  4NHJ A;  2QSF X;  2BVL A;  1UJ8 A;  1T2K A;  2VQC A;  4ENM A;  4UNO A;  1QO0 D;  1O4X A;  5BPI A;  1V5G A;  3HOV J;  2ZNZ A;  2PLY A;  3ECO A;  3SDG A;  2L7M P;  1Z7U A;  3E6D A;  2L5Q A;  2KT0 A;  2WBM A;  3QOP A;  2RV8 A;  4BU2 A;  2GA1 A;  2K02 A;  4YFX F;  2WWY A;  2CWE A;  1VQL I;  2F2E A;  2CQK A;  2F6C A;  1Z7L A;  2QCO A;  1YW8 A;  5ICE A;  1LKX A;  3DPL C;  4AM3 A;  2K40 A;  4KT5 C;  4ZYD A;  1BA5 A;  4CYC B;  3LFU A;  4QIW N;  2Z5U A;  3LSH A;  3GTO J;  4UV8 A;  1OKR A;  1PYV A;  3ZQ7 A;  4B44 A;  4OMZ A;  4ZDL A;  2P6T A;  4ENK A;  2EK5 A;  2LFB A;  5H6Q A;  4FET A;  3KLO A;  1I6H J;  1MBE A;  3IWZ A;  5AIP A;  3LSM A;  3GFM A;  4EMS A;  3S3M A;  1GXP A;  5L3C A;  2UXN A;  4B48 A;  3OSF A;  2WY8 Q;  2ZSH B;  1A5J A;  2ECC A;  2EFW A;  2R7Z J;  5LHI A;  1FTT A;  1MJB A;  4OAZ A;  5L3B A;  2EFQ A;  3ONQ A;  2HPM A;  4M6Y A;  4BAC A;  3VWB A;  2KZG A;  4A3I J;  3WE2 A;  4A0Y A;  1IN4 A;  1X3U A;  2E1N A;  3HJE A;  1ENH A;  1I1G A;  1RI7 A;  1V3F A;  1GVJ A;  2HPI A;  3GTM J;  4M3B A;  1VQK I;  2XGX A;  1BI1 A;  5FLM J;  1R23 A;  4HV5 A;  3EUH C;  2JPB A;  3OYF A;  3L09 A;  1QQI A;  1W5C C;  2E7X A;  3GME A;  1MIJ A;  3Q9S A;  1NK2 P;  4WXH A;  2R7U A;  3MZY A;  2DCE A;  3HHG A;  1XMA A;  2D1H A;  2EIJ H;  3Q0W A;  1PJR A;  4CHU A;  1CGP A;  4ZZD A;  2VBZ A;  1OQY A;  2PJR A;  2LKX A;  1OR7 A;  3CF2 A;  4A3M J;  4A0Z A;  4RAG A;  2KIU A;  2GXG A;  4NB5 A;  3MKL A;  1YHQ I;  1R9T J;  3I4P A;  2VI6 A;  3A01 A;  1H9G A;  3I59 A;  2YPR A;  1XS9 A;  1Y39 A;  4HBL A;  3HZJ A;  4JX5 A;  4EEF G;  4G6D A;  1ETW A;  2B63 J;  2BW3 B;  2DFF A;  3BJO A;  4C3H J;  3CME I;  1DP7 P;  1JT6 A;  3IC7 A;  1ETX A;  2NOG A;  3QYE A;  2QYO A;  4RAZ A;  1O57 A;  5LGN A;  3UKG A;  3IP4 B;  1VTN C;  1V5F A;  4A0X A;  3L1P A;  4BQO A;  3KET A;  3GEZ A;  4G7O F;  2YU3 A;  1F1Z A;  3HUG A;  4R1H A;  2BY2 A;  2WAD A;  4XKV A;  1AKH A;  3AG4 H;  3F8F A;  2NS8 A;  2DK8 A;  2HKO A;  4II3 A;  2R7R A;  1U3E M;  3F8M A;  3F22 A;  3C7J A;  3F8N A;  5M5X J;  3ZQF A;  5HVQ C;  4P96 A;  3HTU A;  4L9T A;  3LA7 A;  3FIW A;  2GXB A;  4JOM A;  2ZB9 A;  2EA4 A;  3G4S I;  4FIS A;  1HSJ A;  3VEP A;  2DQR A;  2CRG A;  3S1N J;  3I56 I;  2XGC A;  1SD4 A;  4AIK A;  4RB0 A;  3WTT C;  3L2Q A;  3T8T A;  4NC6 A;  1FNN A;  1WI9 A;  3JRA A;  1ZG1 A;  4C2T A;  5EGO A;  3CJT B;  4CZC A;  1KZH A;  2QM3 A;  2R4G A;  1VQ5 I;  4A3G J;  5IP6 A;  3QP6 A;  4F92 B;  4KT6 A;  5FFZ A;  3QRF F;  2ZJP F;  3E6C C;  2Y69 H;  4UV9 A;  1UHM A;  1JXS A;  1ZLJ A;  1MJ9 A;  5K5O A;  1U9N A;  3PUF A;  2HKX A;  3CCV I;  4P9U A;  4JX6 A;  2RRE A;  4AYB A;  1IV8 A;  2VJJ A;  1WJD A;  3FZV A;  3K70 D;  4G6T B;  4PGH A;  3PFI A;  3S3N A;  3J81 Z;  4OU0 A;  1XPX A;  2FU4 A;  4HQE A;  1JJ6 C;  4D9J A;  3DTK A;  4DYQ A;  5DS9 A;  2B7E A;  1X3W B;  1KU3 A;  2LP0 A;  2L3D A;  3HGG A;  4RAF A;  4OIN F;  4DIQ A;  3FKI J;  3HDD A;  4HNU A;  4DBQ A;  1X1B A;  1U8R A;  3Q3S A;  3HM5 A;  2RAE A;  4HLY A;  3ZRG A;  1LQ1 A;  1JJ8 C;  3FK7 A;  4QSH A;  2R7O A;  4BJT A;  1VZ0 A;  3QPS A;  1JI8 A;  1X1P A;  4PJ0 C;  2EBI A;  1TLH B;  1W7P A;  1ZGJ A;  4J01 A;  1S7E A;  3CCL I;  2CV1 A;  2HQN A;  2XF7 A;  5JLX A;  4FE4 A;  4ZJZ A;  3BTL A;  4XBF A;  5ILV A;  1I1S A;  5LRR A;  3H5A A;  1ETY A;  2VPR A;  3DLL F;  2K3F A;  4I09 A;  3TOB A;  2KPM A;  4ENN A;  2CV2 A;  3L9F A;  1Z21 A;  2A6H F;  1UB9 A;  1XGN A;  3DP7 A;  2P5K A;  3I54 A;  4XL9 A;  4HPQ A;  4D5F A;  4XLN F;  5IT3 A;  1WCM J;  3D1N I;  2K9N A;  2K9Q A;  2Y0S A;  4RLQ A;  2VJ4 A;  5J8C A;  3ZQL A;  2VOO A;  3L7W A;  2GIZ A;  3LMM A;  3O3K A;  4L9V A;  4GYI A;  2KKO A;  1A04 A;  3Q0V A;  2STW A;  4X6A J;  4IL6 C;  2FF4 A;  3E6B A;  4BQQ A;  5IYC J;  2HDC A;  4KMF A;  4FX0 A;  4KJZ A;  1ZKG A;  3LL7 A;  2FQ3 A;  3K4L A;  2WAQ N;  5GPA A;  1T95 A;  1EH7 A;  2R7T A;  1YW9 A;  5HS7 A;  1SFU A;  1NG7 A;  1RR8 C;  1ODD A;  2DA5 A;  4BKX A;  2GIV A;  5FLX K;  2F5V A;  5E3O A;  1VQ6 I;  2LKP A;  3E7L A;  4CYC A;  3BPV A;  1BC8 C;  1OFC X;  1VQ4 I;  1V54 H;  3LSI A;  1I3Q J;  4FAS D;  3T1B A;  2O9L A;  4M6X A;  1LFU P;  2WAE A;  2V1D A;  4ZYA A;  3TDU C;  4Y7N J;  3F0C A;  2CG4 A;  3BJ6 A;  3E5Q A;  3M1E A;  3IAM 2;  3FXM A;  3PNT A;  3BR0 A;  3KX2 A;  1Q1V A;  5LLQ A;  2IW5 A;  3JRB A;  3BOQ A;  4I7H A;  3AAF A;  1HLV A;  1VQ7 I;  3ZQH A;  2VOP A;  1XMK A;  3ZGK A;  3H0D A;  3CP2 A;  2DMP A;  1FY7 A;  4XOP A;  3RQI A;  3BTC A;  1O7F A;  1Z77 A;  3HKZ N;  4R8H A;  1RKW A;  2A5W A;  1YJ9 I;  1QPM A;  4WX9 A;  3IH4 A;  3DBH B;  1EKE A;  3DEU A;  3GBG A;  3CTA A;  2K9S A;  4ESB A;  2F4O B;  2KIM A;  1BR4 A;  4RGX A;  4IHW A;  2D45 A;  3LWF A;  5E1Z B;  3CJN A;  2IRF G;  2AXT C;  4E6K G;  3HSF A;  4ZDO A;  4D7M A;  3BJA A;  4JP0 A;  2XVC A;  3MFK A;  2DW4 A;  4MO7 A;  2K27 A;  5F64 A;  1VI0 A;  5CVV A;  2V1X A;  4OMY A;  1X4O A;  3ERE D;  4XLP F;  2W00 A;  1IRG A;  2HR3 A;  2ZC2 A;  1D3Y A;  1A31 A;  5HLI A;  3MZH A;  4B09 A;  2CQX A;  2LBF B;  3K69 A;  4CSW A;  5JR3 A;  2ME6 A;  2JSP A;  2RC4 A;  3B02 A;  1M1E B;  4YFK F;  1X4P A;  2BW3 A;  4Z2Y A;  1Z67 A;  2X1D A;  1ON2 A;  1KYW A;  1R5H A;  2VB6 A;  4M9S A;  1BIA A;  3U1D A;  5E3N A;  4HX8 A;  5F1R A;  3DKX A;  1R5I D;  4MEY F;  2KRH A;  2X1C A;  4NDL A;  3SZT A;  4HF2 A;  5CVI A;  2L9N A;  4HRI A;  3HOT A;  3DCF A;  3PIP F;  1T98 A;  2CQN A;  4G12 A;  2CFO A;  2K85 A;  5E20 A;  2W48 A;  4A93 J;  3QU3 A;  3KP6 A;  3FBI B;  2RQP A;  4AVP A;  3MQ0 A;  3DU5 A; 
#chains in the Genus database with same CATH homology
 3I55 I;  5GAG J;  2ZJQ F;  1VQ8 I;  1VQO I;  3CCR I;  3CC2 I;  2H8W A;  3CCU I;  1VQ6 I;  2E34 A;  1MMS A;  1VQ4 I;  1VQL I;  4V19 K;  3PIO F;  3J7Z I;  3G4S I;  1YIT I;  1ACI A;  3G71 I;  3I56 I;  1S72 I;  1VQP I;  1FOX A;  2JQ7 A;  3CJT B;  3CC7 I;  1VQ5 I;  1VQ7 I;  1YJW I;  3CC4 I;  1FOW A;  2OTL I;  1FOY A;  2ZJP F;  5GAE J;  1HC8 A;  5GAH J;  1YJ9 I;  3CCV I;  2E35 A;  3CCQ I;  4IOC F;  2FOW A;  4IO9 F;  1YI2 I;  4IOA F;  1VQK I;  1YJN I;  1VQN I;  1QA6 A;  5JVG F;  3CCL I;  5DM7 F;  3CCJ I;  2OTJ I;  4UY8 I;  2ZJR F;  3CCM I;  5GAD J;  3CD6 I;  3DLL F;  2K3F A;  1YHQ I;  5DM6 F;  3CF5 F;  1Y39 A;  1YIJ I;  1VQM I;  2QEX I;  3CCS I;  3G6E I;  3CCE I;  3CME I;  1VQ9 I;  3PIP F;  3J7Y J;  2NXN B;  3CMA I;  2QA4 I;  2E36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...