3G6EI

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3g6eI00
2K3FA 2JQ7A 2E34A 1YI2I 3CCVI 3CMAI 3CD6I 1VQNI 3I56I 1YJWI 3CCJI 1Y39A 3CCMI 5GADJ 1VQMI 1S72I 4IOCF 1YJ9I 5DM6F 2OTLI 3J7ZI 3G71I 3CMEI 1VQOI 2ZJRF 3CJTB 1VQ6I 1YIJI 1HC8A 2QEXI 5GAHJ 3G6EI 1VQPI 1ACIA 2OTJI 3DLLF 1FOWA 3CCUI 1VQ8I 1VQ5I 1VQLI 1VQ4I 3CCQI 3CC7I 1YJNI 1FOYA 1MMSA 1YITI 1FOXA 3CF5F 3CCEI 3CCRI 2ZJPF 2QA4I 3CC2I 4UY8I 1YHQI 3G4SI 3I55I 3CCLI 2ZJQF 5DM7F 3CC4I 3CCSI 2NXNB 2E35A 5GAGJ 4IOAF 1VQ9I 2H8WA 1QA6A 1VQKI 4V19K 5GAEJ 3PIPF 5JVGF 3J7YJ 2E36A 2FOWA 3PIOF 4IO9F 1VQ7I
chains in the Genus database with same CATH superfamily
4JX4A 1UB9A 3I9V2 3QYFA 5D4RA 4KYWA 5EEHA 1DQUA 4EVIA 4XRSG 1BW6A 3MFKA 3OSGA 2DOEA 3CD6I 4I01A 3L2WA 5E20A 3CUQB 2E1MB 1XS9A 1G2HA 4A3LJ 2VONA 3R61A 4A3FJ 2XDVA 4M9SA 2GXGA 4FTHA 1APLC 3CCJI 4EM2A 2O9LA 1HDDC 4BNCA 2QSFX 1SAUA 3ECHA 3HJEA 1E3HA 2EJRA 5JVTA 1VQMI 3OR2C 3BTIA 1RIOH 3GTPJ 4RBOA 1OR7A 3MZYA 2ELHA 2KIMA 2NOGA 4HG2A 2K7LA 3JRFA 5C44J 3IKTA 5H6QA 2V4JC 3GBGA 3K4LA 2YS9A 2L9RA 5J1UA 3K7AJ 1RI7A 1Y8RB 2E1CA 4BUPA 5C3EJ 3I5UA 3WTXC 2EFPA 3PQKA 1UJ8A 2VASA 2ELKA 4U0WA 2DYRH 2DPDA 3BPVA 3I4MJ 3PNVA 3HZJA 4LMYA 1SD4A 2EFNA 4NNJA 4LK0F 2EIMH 3KYDB 1U78A 2YSRA 1ZG1A 3S2WA 4A12A 4QWQA 1MNMC 1NHAA 1I27A 1YOVB 1O7FA 2OZUA 4BDZA 1IZ1A 1NG7A 5DS9A 3NWTA 3M8JA 5D6EA 3CZ6A 2PEXA 3S3MA 3F8FA 4XOPA 3CC7I 4ETSA 5E17F 2R3SA 3CESA 1G8XA 4PJLA 1TW2A 2LF7A 3L9FA 5DUKA 2WB1A 3RPUA 3JSPA 4CH7A 5F64A 2V1NA 3MQ0A 2D45A 2Y0SA 4NBQA 2NVQJ 1TP4A 2BY0A 4CZCA 1VTNC 2HQNA 5HLHA 4G12A 3LSGA 1LVKA 2VKHA 4IOAF 4DNCA 2E60A 1JI8A 1S7OA 2IGOA 3K1MA 5HLGA 4UV8A 3LSPA 3BR0A 3R4KA 1EH7A 4FISA 3RKQA 4B43A 4ANJA 2FOWA 2Y9ZA 3T5XA 1R71A 4AVZA 2E34A 3VOEA 2X6YA 1RETA 2LFBA 2VPRA 4WXHA 5IT3A 2R7TA 1YI2I 2XSDC 2JSCA 5KHDA 2KDOA 2DQRA 3OYNA 1U2WA 4G6DA 1XG1A 3DEEA 1BOBA 4BBRJ 3H9QA 3KP4A 3J81Z 2HPIA 4ZDPA 4BGDA 2LSOA 3CLOA 3IWFA 4A3CJ 1TZLA 1T0FA 1B72B 2EPFA 5IYCJ 4BS9A 1S72I 4I2OA 2RQPA 3WU2C 1QRYA 4G94A 4JYKA 4Q48A 4KITB 1W0UA 1RR8C 3G71I 4OIOF 4B8XA 2JRMA 3BY6A 5BOXA 2ZMEA 5GTHC 1FMWA 1QU3A 4I0BA 4RAYA 3E6DA 2F4OB 3FXJA 2M2EA 5DD8A 4LG3A 3A01B 1UG0A 4CCNA 3U1DA 2RDPA 2VODA 2CFXA 2NYXA 2KT0A 2JVGA 4OOIA 2OAZA 4L9VA 4HV6A 5IT9K 3K6GA 5K7HA 4UXNA 1Z77A 4GRIA 1B8IA 1ZLJA 1FBUA 3NEUA 3V7SA 1Z67A 1DPUA 2L4MA 5L3BA 3G3ZA 3K10A 2XB0X 1IAWA 3M8FA 2VBWA 4BQQA 5LHIA 2K9NA 1I3QJ 4CCOA 2LY1A 3F3XA 2PLYA 3FHNA 5CVJA 2M4GA 4JOMA 5C4XJ 1SMYF 3BR3A 4BH9A 5FRNA 4L9JA 1VZ0A 4KIGA 5IP6A 2DT6A 1K79A 1BJAA 1G3SA 1Z1DA 4UY8I 4NQWA 4LK1F 4P1WA 3MWMA 3KCCA 2JMWA 1AHDP 1LEBA 5ICFA 5HS7A 2MW8A 2FE3A 4ASNA 4KISA 1D1CA 1OCPA 4EQQA 4H4KC 4JX5A 1MBKA 1MBGA 2LR8A 4QIWN 4JK1X 3Q5FA 3FXMA 3PNYA 3GFIA 3VDXA 3FBNB 4I0AA 3ZQQA 1F9NA 2DYSH 2JUGA 4RB1A 5H6RA 1ZH5A 1DUXC 1P7JA 4MFDA 4CDGA 2RQQA 2BHYA 2YPRA 4CCKA 3PIOF 2R0QC 1MMGA 3WTZA 4RLQA 1Q1VA 2ESNA 4ZJZA 1P4WA 3L2RA 4A0ZA 2L7ZA 3E6CC 4M74A 4YIFA 3CCYA 4YFXF 4XL9A 5J3LA 3IL2A 1O3SA 1KGSA 4KA4A 2E7XA 3D5LA 1HKTA 1SMTA 1YJWI 4N4OB 2P0WA 5FKNA 3V7CA 1JXSA 3BLYA 2VT2A 1K83J 3B02A 1WGXA 3O8HA 1A31A 2JA8J 1TBXA 1JE8A 5LHHA 2QQAA 2W24A 4IOCF 1JT6A 1UHWA 3MKLA 1WKMA 3A02A 5JI6A 3BTJA 2V1UA 2L5QA 2O3FA 1WSUA 1MDMA 2RN7A 2CQ7A 4RS8A 3EYYA 2DT5A 3BTLA 4XMYA 2CQQA 1RKTA 4AM3A 1OMIA 1SD6A 5EZHA 4D9JA 4C9YA 1SD5A 2M3AA 3DU5A 5DCFA 3M1EA 2CW7A 4Y3OA 2LK2A 1B59A 3G6EI 2HS5A 4Q4ZF 5LRRA 4MLOA 3JTGA 4XIDA 4UHTA 3LMMA 3V42A 4KMFA 4DYQA 2G0EA 1OCCH 3PM1A 4RMNA 2HGCA 4R79A 3UR3C 2QSGX 4M3GA 1WFXA 1VQ4I 3HKZN 1HOMA 1FP2A 2IGKA 2F2EA 4LG0B 3DEWA 5EF6A 3QU6A 1YITI 2Z3YA 4U7DA 1A5JA 1D1BA 2FA5A 1GLNA 2ZXIA 4YEJA 3FF5A 4KJZA 3WTWC 4AUXA 3CF5F 3MN2A 5C4JJ 3CCEI 1PP7U 3M4OJ 1USTA 2OQGA 5IPAA 3K2AA 3VYRB 2W25A 1RZ4A 1V5GA 1Y0NA 4RAFA 3LFKA 2XKOA 1YG2A 3Q9SA 3KLNA 4CICA 1JJ6C 4L0YB 5F04A 4LLGF 1R1UA 1LJ9A 2NXNB 2CMPA 4D1QA 3T0YA 1LFPA 5BQTA 1JT0A 2LTPA 2EFOA 5E8GA 4QTRA 3A4CA 1XD7A 1VQ9I 3BJAA 2R93J 3J7AO 2K9SA 3KIOA 3R60A 5J1RA 1X1CA 2MH2A 1H89C 2PBIA 2VC0A 2HYGD 4KN4X 4QLCU 1YO5C 2XGDA 2E2HJ 5HLTA 2R5ZB 1HF0A 1WWXA 3LWFA 3JAMK 2IP2A 3V4GA 1I1GA 3ML6A 2Q2EB 2JQ7A 4CGZA 3HUGA 4I6ZA 1XMKA 3RI4A 4IHWA 3K4CA 5JLWA 2WV1A 3OYHA 3L1PA 3FXOA 3JTHA 5DTDA 2FXAA 2F5EA 1OCRH 1U0JA 3I56I 2ZFUA 3D0SA 3RYRA 1IUFA 4BBSJ 4A5NA 2DK8A 2TDXA 3QWLA 2VQCA 4UUTA 2ACJA 3OIPA 2LKPA 4MO7A 3ZQLA 2IW5A 4PJJA 2QSHX 1YRNA 2FBHA 2FQ3A 2ZJ2A 4KIFA 4DIQA 5L3CA 3S17J 1T33A 2DI3A 2QLZA 2W82A 1U8RA 2LF8A 2DAOA 3M07A 2ZJRF 3T1BA 1YIJI 3IRQA 4RGRA 5HOOA 1EA3A 2DA6A 1BN5A 2HWVA 3HEFA 3OYLA 3PO2J 1DPRA 2K27A 2NRAC 4BJ6C 5A2QZ 2F5CA 3L00A 2CUFA 4E7LA 2BHZA 5FLMJ 2CH0A 5CVRA 2FMLA 3VYUB 4BAYA 3EYIA 1ETVA 2R4GA 2IA1A 1O3TA 2OU2A 3TL4X 1BC8C 2BXYA 5EJCA 1B9NA 4XN0A 3PO3J 2CS3A 4NB5A 2HZDA 3RKWA 1K78B 3ZPLA 3LQQA 4XLEA 2X85A 4DGWB 3L09A 1JTXA 3S1NJ 1KU2A 4XRFA 3E6MA 2DA1A 2R7VA 5GPAA 1YHQI 3ZQGA 4HNTA 2QKMB 5K5OA 4BHCA 3LL7A 4MQ9F 3CCLI 4BL0B 1XGNA 3IKVA 1A36A 1FPQA 2E35A 3GUDA 2R5YB 5EGOB 2DFFA 3C18A 3KFWX 5BS6A 2ZFWA 3OYDA 3DBHB 2LC2A 1S6LA 4MQVA 2ETHA 3V7RA 1U5TC 1Z3XA 4FX4A 2XPWA 1ZRDA 1KQ9A 2X9DA 3IC7A 5GAEJ 4A3JJ 3I59A 3PIPF 4BY7J 2XRLA 2MC3A 1W1WE 3VEPA 5J4VA 3OYIA 2XROA 4A3DJ 3LSMA 1J9IA 1JKQC 3C2BA 1IDYA 4WK8F 1J2XA 3B73A 2JZYA 1D8JA 1WPKA 4GCVA 2BOLA 4IRHA 1IRZA 2FF4A 5L3FA 3FMSA 4BYYA 1STZA 4Y33A 4FCYA 4UUVA 4C30A 4I7HA 1P9QC 4X6AJ 3EPZA 3D1NI 3PQJA 4E7KA 1OCTC 1FZPB 2VLAA 3HOTA 1Y56A 3FXKA 2Z1DA 2RGVA 4QPOA 5F27A 5J8CA 4BEHA 3KYLA 1ETWA 1J0RA 4AYBN 5DUIA 2BY3A 3MKWB 1ZAOA 4XLNF 2DK5A 5E79C 4S0HB 5FLVA 2GXAA 2M0CA 3AAFA 3SEQA 3HSFA 4BQOA 4DYCA 3ZQHA 1R5GA 2HYJA 5KNLA 4EGYA 3GF2A 1VQ6I 2XF6A 4XONA 3F22A 2G7UA 3W2VA 3F9KA 5GAHJ 1H0MA 3RPUD 4A3MJ 1OJLA 3FMQA 1BM9A 4B1RA 2V6EA 2XVCA 2LMDA 2VJ4A 2NVTJ 2JVHA 2DPUA 2NVXJ 2KZVA 3BT9A 5ED4A 2K02A 3WODF 4OWRB 2YUSA 2WAQN 1X3WB 2EV0A 4PSWA 2R7UA 2HEOA 4E6KG 4N9HA 3D5RC 1HA8A 4QPQA 2LVSA 3KP6A 3TW6A 2H09A 1E3PA 3MMYB 1IW7F 5D5UB 3WTYC 2MABA 1V55H 4M3DA 5EEGA 2I5UA 2HOSA 4JBAA 1LQ1A 1ULYA 4EJUA 2P7VB 5B1AH 3I64A 4NC6A 2LBFB 3DWLE 1MGTA 2ISZA 5IOYA 4EV0A 3SZGA 2DW4A 3BQZA 2H1LA 2FSWA 2IGMA 1W7PD 1Z7UA 3SEZA 5DM7F 1HXDA 2X4HA 2XUBA 3GEZA 2KIQA 3P5JA 4AD9A 2A5YB 2F4MB 2IPQX 4G7HF 1WJFA 1QBJA 3U1KA 1MMNA 3ASNH 3OV8A 2GQQA 3EDPA 1P4XA 4XSXF 3QPSA 2NVUB 1FP1D 3COAC 1WI9A 4A6EA 1RRJA 2F4IA 1D0YA 2KRFA 2X1EA 2V9KA 4MGRA 4BJTA 4IO9F 3KP7A 3BROA 4AIJA 1LE8B 3OOUA 3LSKA 4YFNF 2F6CA 2XF5A 4PUSA 3RTRA 1FMVA 3MCZA 4I09A 3CCVI 3LFUA 5BNGA 1XCVA 3KETA 1VQNI 1FTZA 1ON2A 1SFEA 1O4XA 2ZKZA 3OYCA 3CTAA 4BXXJ 1Y6IA 3QAHA 3WHBA 1BOAA 1F4KA 2QUFA 1IGNA 2OCCH 1MJAA 2W4SA 5GADJ 4BE0A 2PQ8A 3FX3A 3FXQA 2W00A 1D0ZA 1N78A 1JUPA 1RC9A 2AQFA 1IV6A 1ZTRA 3WTSC 3NARA 1Z6TA 4G7ZF 2KMUA 2L3DA 2J5PA 5FKMA 1GVDA 2VC1A 3T8TA 5F1RA 1BA5A 1BR4A 3E7LA 4CCMA 1FWZA 1R4NB 2LKSA 3K0LA 1MSFC 4ENJA 5FKKA 3E5XA 2X6OA 2XPVA 2DTZA 1QGPA 2A6TA 2CG4A 5CKTA 2ELJA 3PUFA 1I3AA 3QU3A 3GXOA 6PAXA 3T8RA 2IA2A 2PG4A 3GWZA 4CYCB 1R00A 4XKBA 4IF4A 2IT0A 4U87A 5D5VB 2F5DA 3B6AA 3R6SA 4O3MA 4U88A 3QPLA 3DU6A 1E3OC 2ZNZA 3S1QJ 1S7EA 3M9AA 4Y15A 1BW5A 4RAGA 1XSDA 2Y30A 4CYDA 1W5CC 4HF2A 3MVPA 1P2FA 4JX6A 3GTMJ 5K5RA 2Y31A 3DKYA 3RPQA 2W1OA 2KIUA 1WH7A 2DMQA 5FGMA 2BE5F 4G8XA 4BQAA 1JHHA 5ILVA 3M7GA 4EJTA 1OR7C 3SJMA 2JA5J 2LLKA 3HRMA 3E0JB 5FLXK 1SFOJ 2WADA 2P5KA 3AG2H 5E3LA 1J09A 1WJCA 2OC6A 2HTJA 3BR6A 3IH2A 4W1UA 4LGWA 2MLKA 3LAJA 2V1DA 4E7HA 3KE2A 1KYZA 5E3NA 1HSTA 1WJAA 2D1HA 4Y13A 2KDZA 2FOKA 2EZHA 3GTGJ 5EEAA 4HQEA 4M6XA 1WCMJ 3J7YJ 2CV1A 3AG4H 4ZZLA 1IXCA 2M8EA 2VPLA 5FD5A 2HI3A 3BPXA 3ZQFA 3DBRB 4YELA 4BHBA 3DFGA 1DU0A 4RGUA 1IXSB 5D4SA 2L2OA 3ESWB 3L2CA 1TL8A 4RAZA 4EGZA 3DEUA 3BCAA 2VBXA 4RB0A 1DP7P 1IO2A 4LIUA 5EG0B 3PJRA 2YU9J 4IJAA 3W3CA 5HVQC 3SFIA 2TRTA 3LNQA 1J7KA 5B5EC 3FXUA 3JRCA 3QYEA 3A0HC 2K5CA 2ZBKA 1ZN2A 2FNPA 3EUAA 2KL4A 3BZKA 4PCQA 1MNDA 4PJNA 2YX4A 3CCMI 1ZRCA 2L7FP 1IN7A 1MBHA 4O5VA 4S05A 1OKRA 5E1WA 5D6FA 4A3KJ 1FX7A 1WZ2A 3J7AY 4ITVA 3MEXA 3U2RA 4LLLA 1XDSA 4X0GA 1W7PA 4ZYHA 1HSJA 1EJ9A 4M72A 1XMAA 3LA2A 5K7ZA 2M45A 5DCMA 1ZGAA 2O7OA 4AWXB 1PVEA 2LG4A 1T6SA 3GZNB 2Y69H 3EUKL 2DOAA 3BG7A 1OQYA 4G6TB 1HC8A 2JRTA 4B09A 1KU3A 3A1YA 4ENKA 3ULQB 2COBA 2R7OA 1BR1A 1Z05A 2EH3A 2VJIA 1VQPI 1S8NA 3NWSA 1GV5A 4A0XA 4M3EA 1EH6A 4BXUA 4PFOA 1T98A 1UZCA 5HNFA 1U6GA 3GTJJ 3RKYA 2IXSA 4PJMA 3BG3A 4PGHA 2DCEA 5HDKA 2GA2A 3TW7A 1FLIA 2DMUA 1OYYA 4P55A 4BU2A 1RPWA 3OYKA 1VQLI 3C7JA 5EYRA 1SC7A 3QPHA 4GGGA 3D5SC 5F0FA 1YJNI 4MIMA 4IQJA 2VL8A 3C2GA 5E8IA 1WQ2A 4FASD 3ZR8X 4BDYA 4XLHA 2OJED 4LB6B 1T0FC 2KHMA 1OFCX 2BV6A 1MBEA 2GOXB 3BG5A 2Z33A 2ZXJA 4FQGA 5IY5H 2DFHA 2RKHA 1WI3A 3JR9A 2HVRA 3QP6A 1AWCA 1BIBA 3I55I 3DPTA 2MSYA 2ZMEC 4BXFA 1IDZA 1RNLA 3H36A 2XAGA 4ZYAA 4IHYA 4UUSA 3Q9VA 4HOBA 2DMPA 1GVJA 4YFKF 2ZC2A 4XOTA 4WX9A 2BZTA 4KUMA 2DA2A 4RDUA 1FSHA 1SVLA 2EQRA 4B48A 2P6TA 1ZRFA 2CJJA 2KIFA 5LD2C 2O6GE 2GZWA 1FYKA 1POGA 2VQGA 4HAMA 4LJZF 2EILH 2NOJB 2V7FA 3ABKH 3IHUA 3EUHA 2Q8KA 1BI3A 5FROA 3ZGKA 2QZ8A 4CCJA 2RREA 1G3TA 3VYTB 3RCOA 4XLAA 1LB2A 2PJRA 3TOAA 1YX5A 2KJBA 2XAJA 2HZTA 3LSIA 4KNYA 2Q1ZB 3BJ6A 2LNBA 2M34A 3TGNA 1KU9A 5KAIC 3G2BA 4RM3A 4U7BA 2Z16A 2L9SA 3I71A 1ON1A 4PJ0C 1U5TB 1LNWA 1AA7A 3EUHC 1A35A 3HRUA 1YX3A 3J7ZI 2HTSA 2IEKA 2LRDA 4EJOA 1ITYA 5B66C 3N05A 2E5ZA 3DCFA 4IRGA 4BKXA 4ESJA 4Z2YA 4XLFA 1LFUP 1IF1A 1D1AA 3KX2A 3GYHX 2ZSIB 1IJWC 1KQ0A 1B4AA 1YYVA 3TP3A 4KN7X 4KICA 3TDUC 2EIKH 3TBIA 3GZ6A 4H0EA 3FZVA 5HDGA 2R7ZJ 2QEXI 1XGSA 3BCBA 4ZYEA 4EJWA 1ZGJA 4HX7A 3BG9A 3B6CA 3I59B 1I50J 2Y0SN 3KP5A 4ZDLA 2W85A 4OAYA 3MKZA 3E97A 4DZPA 3HYIA 3Q0VA 2A3SA 5KCMA 4F52A 2W84A 5FFXA 5E1ZB 2DTRA 2IA0A 3P9CA 3L2QA 4A0YA 2MD5A 5JHFA 2L7MP 2O0YA 1FSEA 2FBIA 3HG9A 4LD5A 4LLNA 1QVTA 2M4KA 4AU7A 3ERED 2ME0A 2VQHA 2LY2A 3VSKA 5EDNA 1ZKGA 3H3UA 2GLOA 3E1SA 1OPCA 3CCRI 4A6DA 1VF9A 1GXPA 4Q5SF 1E17A 3QOEA 1AKHB 1G3YA 3CC2I 1SVOA 2JPCA 2Y9YA 3I0TA 5FO5A 3CCSI 4XKCA 3HRTA 5AIQA 4IX7A 1GXQA 1X1PA 1EF4A 3G1OA 2IS1A 2LH9A 2QQ8A 3J80K 5ILUA 4EJVA 1MMAA 2HQAA 2H8WA 2M1BA 4XICA 4R1HA 3F21A 4KIBA 2UXXA 2YX7A 3HGYA 4B3XA 3K70D 1S5LC 2M5WA 1PUFA 3IUOA 5KK1A 4IRIA 3F8BA 5JLXA 2DO7A 2HKOA 3EQLF 3QQAA 4CA0A 4FHTA 3Q3SA 2EBIA 1JTYA 1R1TA 2LDUA 2PMHA 2DBBA 3BOQA 4M3FA 4D7MA 3OYAA 2TCTA 4F7ZA 3HOSA 1G4DA 2R92J 3CMAI 2DMNA 4E4HA 2DFIA 1KZHA 2XKPA 4QSHA 2E5NA 2E2IJ 3DLAA 3QODA 2RC4A 4M6VA 2WY8Q 2OF7A 2OV7A 1QPIA 1TLHB 4IL6C 2BBYA 1I5ZA 2XASA 3S3NA 4D5CA 4HF1A 5IT9Z 4LFUA 4IZZA 2QKLB 3DTKA 1YJ9I 3OY9A 2NAZA 4ZZDA 1XGMA 2VXZA 5D8KB 2CYYA 1S29A 2QYOA 3G1LA 3H9GA 1HW2A 4NDLA 5LEJA 3CMEI 4HA8A 2CQXA 3DF8A 1SFKA 5LGNA 3ZOBA 3CO7C 2DA3A 2MD0A 5TISC 4HX4A 4CXFA 1X19A 1TWHJ 2HOEA 4PZJA 2OCEA 2L54A 1B72A 3AL0C 3Q0WA 1SFXA 3CQZJ 4N9IA 3IV5A 3JREA 4HZFA 1TWCJ 1E2XA 1EV7A 2KQRA 4UV9A 3OIQA 2M7AA 1FT9A 5AONA 4M6YA 3DLLF 2ISYA 1VQ8I 4UVCA 1R49A 4NUBA 3TQNA 2EINH 2HYFA 1VQ5I 1EH8A 2VXDA 3K2ZA 3FDYA 1XSVA 2B63J 3CP2A 5J6XA 1ETQA 4DJAA 2PX9A 2LY9A 3FXLA 1X2NA 4ZTFA 4B4CA 2HQRA 4HDVA 2XAQA 3REOA 2AO9A 4D7NA 2L02A 4XORA 1QZEA 3S2DJ 4OINF 2FX0A 2RNJA 3LSTA 4U0VA 1IN4A 4IEJA 2DU9A 3M3YJ 4JP0A 1B6AA 2ZXWH 3MD2A 1Y1VJ 2Z5UA 3LA7A 2IJLA 2ID6A 5LHGA 2G9WA 3OS0A 2R7QA 2XAFA 3H5AA 3RYPA 3I53A 5CPRB 1UG2A 5E18F 4MNUA 1ETYA 2PFBA 3WGIA 4F93B 3S16J 4HNVA 2EIJH 1SD7A 3ASOH 3CUOA 4GXOA 3SYTA 5HS8A 3ZN0A 2WTEA 1WRJA 2A5WA 2M30A 4L5EA 2UWMA 3QPTA 2H6BA 5ILSA 3S32A 3GZ5A 3OYBA 3CJNA 3HHHA 1A6IA 4ZC3A 2OUMA 1USSA 4ZDOA 1J59A 2DLLA 3ZQCA 2DQLA 4C2UA 1JKPC 5E3MA 3UKGA 4OU0A 2MA3A 3GFJA 5CVUA 9ANTA 4FT8A 3VYSB 3W6VA 1YW9A 3DQVC 3ELKA 1WJEA 2LKXA 2XGXA 3OYEA 3PUBA 1YTYA 3MZ8A 4N0BA 5ICEA 4L9TA 2IVMA 2ZCWA 1DGRM 3TEDA 4E7SA 1HKQA 2JWTA 1P7IA 5FD6A 3ERMA 2IBDA 3ZRGA 1I1SA 1K6OA 5J40A 3U9GA 5BPIA 3HOVJ 3ZMSA 1FBQA 2MH9A 2R7WA 4ENNA 1WJ5A 1N77A 3IH4A 3HIFA 3KEOA 3HXLA 3I4NJ 4J01A 1HBXG 4I99C 3LSHA 4WXDA 2HNHA 4B44A 3GTLJ 3HOWJ 5LEKA 4XNFA 4Y17A 3CJTB 1JKRC 2Q0OA 4J19A 3H0DA 2H27A 2FUG2 2HFHA 2NS8A 3WHCA 4HDUA 4F92B 2A69F 4MFEA 3A0BC 1GUUA 4P9FA 1NK3P 2QQ9A 3GFMA 3HSEA 2UV1A 4A2UA 4XRMA 3IP4B 1W5TA 3WE3A 4D0PA 1BI1A 3DXJF 2WAFA 1CF7A 5CVIA 2AXTC 5IOZA 3CLQA 3OYFA 2FU4A 4FX0A 3E5UA 1ERDA 3DTEA 1ZG5A 3ISPA 3HB9A 4IHVA 4EM0B 3K70C 3BQYA 3E5QA 3K4KA 1FOXA 3CF2A 3HGGA 5EZGA 2GXBA 3OYJA 5D5XB 4AVPA 3K4BA 2Z2SB 4XLCA 2ME6A 3RZOJ 1ZR2A 2BXZA 2DA4A 3ZMTA 1FYMA 2W57A 1O7LA 1WH5A 2VJ5A 2ZSHB 3QYBA 3HM5A 4RB2C 3WU0A 2VE8A 1MH3A 2EFWA 5FKOA 1W36D 3JW4A 2HVSA 4HNUA 2XV4S 1RESA 5GAGJ 5JFRA 1W7PB 3PNTA 2QBYA 3ABUA 4XR6A 2H8RA 2LREA 3VFZA 4CZZA 3V8KA 2GA1A 1XCBA 3EETA 4LITA 3CP8A 5K1YA 1UFMA 4YG2F 3QOPA 2BW3A 2XSJC 3S15J 4X1EA 2BEOA 2QWWA 3WU1B 3OWTA 1PJRA 5H2FC 4HX8A 4RGXA 1T56A 2K3FA 3RZDJ 2K86A 2CO5A 1GDTA 3HPGA 3BJOA 3NQOA 2JA2A 3JRAA 1BR2A 1B1BA 2ZMEB 3S14J 3H3ZA 5L3EA 2P5LC 1LFBA 1XC5A 1R22A 3E3VA 4J00A 1L0OC 3MAJA 5B1BH 1PYVA 3GCMA 2COMA 3IH3A 2QQBA 1J75A 1RUOA 3OR1C 4DW6A 1EKEA 2JN6A 4DQ2A 2NS7A 4PDKA 2OTLI 1S7AA 2D5VA 4WWCA 1SANA 3ECOA 4M9XA 4M71A 4OMZA 1JGGA 3TO7A 2Y0MA 1XN7A 1W4MA 1LDKB 3C2HA 3DPLC 1B8IB 2WC2A 2K4BA 2P4WA 1WVRA 2OPTA 1HKSA 4BQNA 4IPAA 5J4YA 4UUSB 2FMYA 1ZARA 3J81K 1TTYA 5F0CA 2NNYA 1N75A 2E19A 1ENHA 3ABLH 1SVMA 2KP6A 1F36A 1X3UA 2VKVA 2ECBA 1ACIA 2BVLA 1XB4A 1OCOH 1X2MA 2KRCA 1LDJA 4JQFA 2XAUA 1D3YA 4II2A 3OS1A 1IN6A 4NQWB 3SZTA 4LIVA 3RIRA 2FQ4A 2B9SA 1LEAA 3OL3A 2PJRB 2IRFG 2N8GA 2Z9OA 2HDWA 4A5MA 1FOYA 3HTUA 5CJ9A 2JK3A 3H5NA 4WXCA 3HOUJ 5J47A 1DU6A 1YS6A 1XTAA 3CO6C 4C3IJ 3FKIJ 4Y4RA 1E0EA 4XBFA 1MJ9A 4F91B 4DZJA 5ICGA 2ZJPF 1L3LA 2X48A 3JSOA 2L7KA 4HLYA 3G4SI 2P5VA 5DDGA 1TNTA 4NC8A 1HW1A 3C3WA 1PDNC 1X3ZB 4OMYA 2L0KA 2A6EF 4IHSA 4KMUX 1R5ID 3L7WA 4F3QA 4A3IJ 2R7RA 2UXNA 1K78A 4PSXA 5F08A 5K7FA 1MJBA 1Z21A 3KP2A 4HLXA 3P9IA 3SDGA 2VUMJ 1OLTA 1MNEA 2EK5A 1Y8QB 2R7DA 1U9OA 2M0MA 2LP0A 1WHUA 2E36A 4UB8C 1ZELA 1V4RA 5GTIC 4DBQA 2WA0A 2GIVA 1IUYA 1X1DA 5IYDJ 2R5YA 3N97A 1QQIA 3H9JA 3KYCB 2K3PA 4HF0A 5EGOA 1FNNA 4I98B 4PK4A 2PI0A 3P9KA 3GFLA 2E1NA 4BJ5C 3ZQ7A 1O3QA 1MDMB 1XGOA 1OYWA 3LQRA 4HPQA 2GM4A 1R5HA 2AHQA 5CLSA 5F6FA 5L3GA 2OBPA 1DDNA 4G7OF 1I6HJ 2FNAA 2QGUA 1QZYA 2CQKA 2PJPA 2M7BA 2CFOA 5M5WJ 1O3RA 2D2WA 1CQTA 2P81A 2R7XA 5HDNA 1IRFA 2STWA 1W0TA 1YQAA 3GW2A 2VB6A 1ZGWA 2O5RA 3I4PA 3LSJA 4HEA2 1T38A 2PMZN 2K9QA 2RVCA 1RKWA 3KLOA 3V8JA 2Y2ZA 2MBFA 2BY1A 3ZMZA 3RKXA 5HODA 3HBLA 5TJJA 4B3AA 3BP8A 1RR7A 2OQRA 3JRGA 1FEXA 3M1CA 2GAUA 1H88C 3GLXA 2X1DA 3GTQJ 2BGCA 4P9UA 1QNTA 3S2HJ 1PUFB 1IN5A 1TC3C 2CSOA 2ECCA 3K1PA 4M9ZA 1W36C 1Y0UA 5DYMA 4YIIA 4IHXA 1QZZA 3K69A 1YFHA 1KONA 5DD4A 1O57A 2F5VA 1Q1HA 3FM3A 3X2QH 3M8EA 2RV8A 1FC3A 4E7JA 2NVYJ 1REPC 1FIAA 2O8XA 4A69C 1DP3A 1UELB 3K4JA 3F6VA 4KT5C 3AL0B 5TRDA 2ZXHA 5K5QA 2AXLA 2K9LA 2KKOA 2VBYA 2Y75A 4AIKA 4OIQF 3OYGA 3RDIA 5HNHA 2LD5A 1FOKA 5GP9A 1BIAA 4ENMA 1TT0A 3CDHA 1Z9CA 1V5EA 4NHJA 3HRSA 4UVBA 2ICWG 1S3JA 3HUGB 2BY2A 2A07F 3BR1A 5CYVA 3HKZA 1MH4A 3WGHA 4V19K 1HLVA 2DXIA 3TMOA 3F23A 5JVGF 1H8AC 2LBFA 2VQLA 3E6BA 5D8LB 2O8KA 2A68F 3NAUA 1QHHD 1JGSA 4XSZF 4OIRF 4HW0A 3LSRA 1K7AA 3WTVC 1HDPA 2IS4A 3LAPA 4EMSA 3ROUA 4E70A 2V26A 3BG6A 3DKWA 2CV0A 3CJQB 1RUNA 3AKZA 1YRNB 2XGEA 3A2KA 2MC4A 3F8NA 1BI0A 1V3FA 4K2EA 1XSXA 1QVUA 3R0AA 2K9MA 2W48A 3HHGA 1ONVA 2CGPA 1J5YA 1LE8A 2CUJA 1K4TA 5DM6F 4ON0A 4OAZA 5E3OA 2WWYA 5FRMA 2VN2A 3O3KA 3DBLB 3ZCOA 2CQNA 3O6BB 1V5FA 1JUSA 3BR2A 2WBMA 1D8KA 3I58A 2V9PA 1P6RA 3FKJA 4PGGA 1T2KA 5F0HA 5J1YA 2NNNA 2OZ6A 1TQMA 2DA7A 2DT7B 1Z3YA 2K40A 2K4JA 5DV5A 2RNGA 4E7IA 4A93J 5JR3A 2UZKA 4AC0A 1HW5A 1GT0C 3DP7A 1ZG3A 5FLXZ 3VODA 1R7JA 2H94A 5M5XJ 1ODDA 2ZNYA 3JRDA 1ETKA 2KLOA 5ICCA 3HL2A 4ZH4F 2B7EA 3CUQA 3HTSB 4WCGA 3W6KB 3H3VK 4MTDA 2DDAA 3GVAA 3OMYA 4IVNA 2EZKA 3HOZJ 3FMRA 3SXYA 1XMXA 2IS2A 2F5FA 2Z99A 3JRBA 2DMTA 3W2WA 4CYCA 2WB1N 2V1XA 1FJLA 4MHGA 4BE2A 3TKYA 2M9HA 3ZMUA 5A2QK 3BWGA 4XKVA 1TWGJ 3FWEA 4HSRA 1YS7A 3JCUC 1MBFA 2VIXA 2HKXA 3CUQC 2A6HF 2E1MC 1M1EB 1X4OA 3RJPA 3CC4I 1TT5B 1X4PA 1IXRC 4NC7A 2M8GX 3ABTA 1FY7A 1ORKA 1Z6RA 4L18B 5IP7J 1PP8F 3FIWA 1K4SA 2MFZA 4OIPF 4TV7A 1XX5A 1MD0A 3CDIA 3P7NA 2CWEA 4XK4A 4UVAA 2XC7A 1HQCA 3S3OA 3VPRA 5M3MJ 2G7HA 4M73A 2Y48A 2WAEA 3F0CA 4UB6C 2RAEA 2W7NA 1QO0D 3MZHA 4BEHB 2MGQA 3W2AA 3Q0UA 1U9NA 1TWFJ 4ZTJA 4D5FA 3LOCA 3U21A 4Y7NJ 1NTCA 1VNDA 1CF7B 4W97A 3KP3A 4GDFA 3FM5A 4E7ZA 4CO8A 2JA6J 4BHPA 4C2MJ 4KFCA 2M87A 3L2VA 2X51A 5FFZA 5LRSA 2HQ5A 2MLGA 1Y39A 2HOAA 5FB2A 1BBYA 5KAFC 4BACA 1SEUA 4RLFA 1H9TA 5ERIA 4PFPA 1QPMA 1ETXA 5L3DA 3HOXJ 1UAAA 1LDDA 1T95A 4B47A 4LB5A 5EG0A 3GX4X 1N25A 3WTUC 2P6SA 2OA4A 4MEYF 3N4MA 4ABZA 4FE4A 4XN3A 3OYMA 2IGNA 5IYBJ 2HXIA 4F55A 4L0ZB 2X1CA 3JRIA 4IQ4A 2QBYB 1YE9A 2VE9A 2DDBA 2EWNA 5BPDA 2GOMA 4FE7A 4A3GJ 2EV5A 1DGWY 4CSWA 1A6QA 2QENA 3H35A 4I76A 3GO5A 5AIPA 5M5YJ 2BW3B 3CMYA 2OTJI 2HXOA 1S9HA 2A05A 4AYBA 2D1VA 3CCUI 2A61A 1FTTA 3A03A 1AU7A 1IN8A 1A04A 2VJJA 1TQPA 1R1VA 2QF7A 3F72A 4U0YA 3F8CA 1SFUA 1LKXA 2O03A 3ZMDA 1MSEC 2J5OA 4O6JA 4BE1A 1NH3A 2CU7A 2R7FA 2YU3A 5LGTA 4FETA 1FIPA 3SHFA 2XIGA 1ZK8A 2EZIA 2HU9A 1ZR4A 2KZGA 4GYIA 1H9GA 2KISA 2CUZA 3BZ6A 3ZN1A 1U8BA 2PN6A 5CVVA 2B0LA 2DFEA 3MKYB 1TQIA 2KFDA 1ZYRF 2CRGA 2UUZA 4MEXF 4II3A 1D5YA 3TDZC 1OISA 1JKOC 1P92A 4L5IA 3V8LA 3FK7A 1GHCA 2WAQA 2V9VA 3RQ4A 2HDCA 2JT1A 1FYLA 3GMEA 3A01A 1UCRA 1QA6A 5J8FA 1HCRA 1FBSA 1G59A 3S8PA 1D0XA 1I39A 4XLPF 2FD5A 2VT3A 5M3FJ 2OD5A 3HDDA 2C6YA 4HV5A 5TGTA 1MZBA 1LPQA 4P96A 1BJZA 2GIZA 2O61A 3WGGA 1MMDA 3R0JA 1NG6A 4ESFA 1KQ8A 3HPHA 5D5WB 4IKFA 1K61A 2JSPA 3FK6A 5LBQA 5BMZA 1NK2P 1GV2A 2EA2A 4L5JA 4BY1J 4C3HJ 1YIOA 2XPUA 3AG3H 4RGSA 3CJRB 2BYVE 2FRHA 1T8IA 1F5TA 2EB7A 1VFCA 3FXRA 3DPUA 5LLQA 2V79A 1Z7LA 2GWRA 1BL0A 2P8TA 3IAS2 2CV2A 3S1MJ 5HLIA 2IS6A 2I10A 3DTIA 1YLFA 1BC7C 2XB5A 3K4MA 1MKMA 1ZREA 1C0WA 4C2TA 2I8DA 3ZQIA 2HVQA 3UNGC 2JUCA 2QCOA 3F6OA 3H5RA 5KVRA 2DOFA 1IRXA 4V2GA 3W6JB 3OIOA 1JUMA 2ZB9A 2AS5F 3CDLA 2XHKA 1ETOA 1U5TA 2HR3A 3OL4A 3FISA 1F43A 1Z0XA 2QM3A 3HC7A 1YW7A 3RSNA 4ZYGA 3GTKJ 3AFHA 4P5OA 2EFQA 4DYRA 4HRIA 3CMMA 1R36A 3FHZA 3S1RJ 2CW8A 1MBJA 1D5VA 1LVAA 1V54H 2L9VA 5GPCA 3KPHA 5FKLA 3PFYA 4EM1A 3QRFF 2XAHA 1BI2A 3H0GJ 3I54A 2P7CB 1P4AA 4V2FA 2XRNA 3J80Z 4XRSA 2YR2A 3DV8A 3F8MA 4DOZA 3WG7H 2STTA 1G3WA 2X0LA 3SDBA 1T39A 1ZHFA 2KJCA 3BZCA 4G6QA 3ZMVA 4XKWA 2HOTA 2VBZA 4LOCA 2DA5A 4RB3C 4A3BJ 2WY7Q 4RM2A 3HOYJ 4IHTA 1K6YA 3G73A 4YIRX 2HDDA 2ID3A 4AIHA 1G6NA 2XGCA 3DKXA 3KZZA 4EATA 3H92A 2KPMA 4XM3A 4G9YA 5HS9A 4S04A 4M3BA 1UHMA 4AIDA 2LOOA 4ESBA 1X1AA 2DN0A 3IAM2 3K9TA 1R4MB 2PMUA 4XQFA 3QP5A 4EEFG 2VKEA 3SZPA 4GYGA 5CQEA 2X6XA 2EV6A 3TO9A 1AKHA 3S93A 1R9TJ 2MYSA 3VSLA 4ZYDA 3PSIA 3ZP5A 3JAMZ 4Y52J 4MTEA 1I6XA 2VKDA 5DEQA 3RQIA 1VQ7I 2FBKA 1ZQ3P 4CCLA 3KEQA 3ABMH 3KEYA 2E1OA 4DBRA 4YRVA 3BTCA 4LG0A 2JA7J 1MIJA 2H1KA 1VI0A 2ADUA 4Z6YA 5DCMB 3TOBA 1XPXA 1SAXA 2FEZA 4CUGA 1IC8A 3PSFA 4C3JJ 2IAIA 3H1CA 2DJIA 3IRRA 2FJ1A 3AG1H 1IG7A 4WF2A 3WTTC 2NS0A 3SQNA 1TW3A 2JPBA 1YW8A 3TP0A 2L4AA 2X6WA 2EZLA 1UMQA 1WJDA 1KA8A 3IWZA 3LA3A 3KZIC 3NRVA 2CW0F 2E2JJ 2PMZA 1LUJB 3G1MA 1QHGA 4A3EJ 2JJ7A 3K1NA 1R58A 1VQOI 1OYIA 1R23A 3OS2A 3KZYA 5H20A 2V6CA 3C1DA 4HSTA 2R5ZA 1F1ZA 2WV0A 3L2UA 5F1JA 5IP9J 2E7WA 2EA4A 3OSFA 3OOPA 3I3LA 4RA2A 3WG9A 2Q2EA 3BR5A 3TO6A 5LGUA 1FOWA 3ONQA 3BC8A 3K4NA 1Y1WJ 3O2PE 2DJNA 4I02A 3JRHA 4KT6A 4HYEA 3GTOJ 3HSRA 1X58A 3VWBA 1OCZH 3CCQI 3O8GA 4HBLA 1X1BA 2GBYA 2DODA 2LYCA 5E1XA 3VB2A 1TWAJ 1PUEE 1MMSA 2JTVA 2HPMA 1R6RA 1ZLKA 2ESHA 5FJ8J 4GFBA 1KYWA 2L01A 2VI6A 1U3EM 2VOPA 5B3SH 1CGPA 2QVOA 1B9MA 3ZXSA 4N4NB 1T08B 5CQGA 2R7SA 1WJBA 2QA4I 1JJ8C 2BVMA 2H6CA 2E71A 3FBIB 4UNOA 4KDPA 2L9NA 1MW7A 4CHUA 2VOOA 1IV8A 2F48A 5LFAA 2ZJQF 1IRGA 1JHFA 4Q47A 2K85A 1AOYA 4IXAA 1TNSA 3PFIA 3WE2A 2ZO4A 1Z91A 1VQKI 2MG4A 3SFZA 5JHUA 1KU7A 2KRHA 4HQMA 2AQEA 4L9NA 1W5SA 4R8HA 1XDUA 3GLLA 3PL8A 2XF7A 4GO1A 2CUEA 1UHSA 3BDDA
chains in the Genus database with same CATH topology
2K3FA 2JQ7A 2E34A 1YI2I 3CCVI 3CMAI 3CD6I 1VQNI 3I56I 1YJWI 3CCJI 1Y39A 3CCMI 5GADJ 1VQMI 1S72I 4IOCF 1YJ9I 5DM6F 2OTLI 3J7ZI 3G71I 3CMEI 1VQOI 2ZJRF 3CJTB 1VQ6I 1YIJI 1HC8A 2QEXI 5GAHJ 3G6EI 1VQPI 1ACIA 2OTJI 3DLLF 1FOWA 3CCUI 1VQ8I 1VQ5I 1VQLI 1VQ4I 3CCQI 3CC7I 1YJNI 1FOYA 1MMSA 1YITI 1FOXA 3CF5F 3CCEI 3CCRI 2ZJPF 2QA4I 3CC2I 4UY8I 1YHQI 3G4SI 3I55I 3CCLI 2ZJQF 5DM7F 3CC4I 3CCSI 2NXNB 2E35A 5GAGJ 4IOAF 1VQ9I 2H8WA 1QA6A 1VQKI 4V19K 5GAEJ 3PIPF 5JVGF 3J7YJ 2E36A 2FOWA 3PIOF 4IO9F 1VQ7I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3F A;  2JQ7 A;  2E34 A;  1YI2 I;  3CCV I;  3CMA I;  3CD6 I;  1VQN I;  3I56 I;  1YJW I;  3CCJ I;  1Y39 A;  3CCM I;  5GAD J;  1VQM I;  1S72 I;  4IOC F;  1YJ9 I;  5DM6 F;  2OTL I;  3J7Z I;  3G71 I;  3CME I;  1VQO I;  2ZJR F;  3CJT B;  1VQ6 I;  1YIJ I;  1HC8 A;  2QEX I;  5GAH J;  3G6E I;  1VQP I;  1ACI A;  2OTJ I;  3DLL F;  1FOW A;  3CCU I;  1VQ8 I;  1VQ5 I;  1VQL I;  1VQ4 I;  3CCQ I;  3CC7 I;  1YJN I;  1FOY A;  1MMS A;  1YIT I;  1FOX A;  3CF5 F;  3CCE I;  3CCR I;  2ZJP F;  2QA4 I;  3CC2 I;  4UY8 I;  1YHQ I;  3G4S I;  3I55 I;  3CCL I;  2ZJQ F;  5DM7 F;  3CC4 I;  3CCS I;  2NXN B;  2E35 A;  5GAG J;  4IOA F;  1VQ9 I;  2H8W A;  1QA6 A;  1VQK I;  4V19 K;  5GAE J;  3PIP F;  5JVG F;  3J7Y J;  2E36 A;  2FOW A;  3PIO F;  4IO9 F;  1VQ7 I; 
#chains in the Genus database with same CATH topology
 4JX4 A;  1UB9 A;  3I9V 2;  3QYF A;  5D4R A;  4KYW A;  5EEH A;  1DQU A;  4EVI A;  4XRS G;  1BW6 A;  3MFK A;  3OSG A;  2DOE A;  3CD6 I;  4I01 A;  3L2W A;  5E20 A;  3CUQ B;  2E1M B;  1XS9 A;  1G2H A;  4A3L J;  2VON A;  3R61 A;  4A3F J;  2XDV A;  4M9S A;  2GXG A;  4FTH A;  1APL C;  3CCJ I;  4EM2 A;  2O9L A;  1HDD C;  4BNC A;  2QSF X;  1SAU A;  3ECH A;  3HJE A;  1E3H A;  2EJR A;  5JVT A;  1VQM I;  3OR2 C;  3BTI A;  1RIO H;  3GTP J;  4RBO A;  1OR7 A;  3MZY A;  2ELH A;  2KIM A;  2NOG A;  4HG2 A;  2K7L A;  3JRF A;  5C44 J;  3IKT A;  5H6Q A;  2V4J C;  3GBG A;  3K4L A;  2YS9 A;  2L9R A;  5J1U A;  3K7A J;  1RI7 A;  1Y8R B;  2E1C A;  4BUP A;  5C3E J;  3I5U A;  3WTX C;  2EFP A;  3PQK A;  1UJ8 A;  2VAS A;  2ELK A;  4U0W A;  2DYR H;  2DPD A;  3BPV A;  3I4M J;  3PNV A;  3HZJ A;  4LMY A;  1SD4 A;  2EFN A;  4NNJ A;  4LK0 F;  2EIM H;  3KYD B;  1U78 A;  2YSR A;  1ZG1 A;  3S2W A;  4A12 A;  4QWQ A;  1MNM C;  1NHA A;  1I27 A;  1YOV B;  1O7F A;  2OZU A;  4BDZ A;  1IZ1 A;  1NG7 A;  5DS9 A;  3NWT A;  3M8J A;  5D6E A;  3CZ6 A;  2PEX A;  3S3M A;  3F8F A;  4XOP A;  3CC7 I;  4ETS A;  5E17 F;  2R3S A;  3CES A;  1G8X A;  4PJL A;  1TW2 A;  2LF7 A;  3L9F A;  5DUK A;  2WB1 A;  3RPU A;  3JSP A;  4CH7 A;  5F64 A;  2V1N A;  3MQ0 A;  2D45 A;  2Y0S A;  4NBQ A;  2NVQ J;  1TP4 A;  2BY0 A;  4CZC A;  1VTN C;  2HQN A;  5HLH A;  4G12 A;  3LSG A;  1LVK A;  2VKH A;  4IOA F;  4DNC A;  2E60 A;  1JI8 A;  1S7O A;  2IGO A;  3K1M A;  5HLG A;  4UV8 A;  3LSP A;  3BR0 A;  3R4K A;  1EH7 A;  4FIS A;  3RKQ A;  4B43 A;  4ANJ A;  2FOW A;  2Y9Z A;  3T5X A;  1R71 A;  4AVZ A;  2E34 A;  3VOE A;  2X6Y A;  1RET A;  2LFB A;  2VPR A;  4WXH A;  5IT3 A;  2R7T A;  1YI2 I;  2XSD C;  2JSC A;  5KHD A;  2KDO A;  2DQR A;  3OYN A;  1U2W A;  4G6D A;  1XG1 A;  3DEE A;  1BOB A;  4BBR J;  3H9Q A;  3KP4 A;  3J81 Z;  2HPI A;  4ZDP A;  4BGD A;  2LSO A;  3CLO A;  3IWF A;  4A3C J;  1TZL A;  1T0F A;  1B72 B;  2EPF A;  5IYC J;  4BS9 A;  1S72 I;  4I2O A;  2RQP A;  3WU2 C;  1QRY A;  4G94 A;  4JYK A;  4Q48 A;  4KIT B;  1W0U A;  1RR8 C;  3G71 I;  4OIO F;  4B8X A;  2JRM A;  3BY6 A;  5BOX A;  2ZME A;  5GTH C;  1FMW A;  1QU3 A;  4I0B A;  4RAY A;  3E6D A;  2F4O B;  3FXJ A;  2M2E A;  5DD8 A;  4LG3 A;  3A01 B;  1UG0 A;  4CCN A;  3U1D A;  2RDP A;  2VOD A;  2CFX A;  2NYX A;  2KT0 A;  2JVG A;  4OOI A;  2OAZ A;  4L9V A;  4HV6 A;  5IT9 K;  3K6G A;  5K7H A;  4UXN A;  1Z77 A;  4GRI A;  1B8I A;  1ZLJ A;  1FBU A;  3NEU A;  3V7S A;  1Z67 A;  1DPU A;  2L4M A;  5L3B A;  3G3Z A;  3K10 A;  2XB0 X;  1IAW A;  3M8F A;  2VBW A;  4BQQ A;  5LHI A;  2K9N A;  1I3Q J;  4CCO A;  2LY1 A;  3F3X A;  2PLY A;  3FHN A;  5CVJ A;  2M4G A;  4JOM A;  5C4X J;  1SMY F;  3BR3 A;  4BH9 A;  5FRN A;  4L9J A;  1VZ0 A;  4KIG A;  5IP6 A;  2DT6 A;  1K79 A;  1BJA A;  1G3S A;  1Z1D A;  4UY8 I;  4NQW A;  4LK1 F;  4P1W A;  3MWM A;  3KCC A;  2JMW A;  1AHD P;  1LEB A;  5ICF A;  5HS7 A;  2MW8 A;  2FE3 A;  4ASN A;  4KIS A;  1D1C A;  1OCP A;  4EQQ A;  4H4K C;  4JX5 A;  1MBK A;  1MBG A;  2LR8 A;  4QIW N;  4JK1 X;  3Q5F A;  3FXM A;  3PNY A;  3GFI A;  3VDX A;  3FBN B;  4I0A A;  3ZQQ A;  1F9N A;  2DYS H;  2JUG A;  4RB1 A;  5H6R A;  1ZH5 A;  1DUX C;  1P7J A;  4MFD A;  4CDG A;  2RQQ A;  2BHY A;  2YPR A;  4CCK A;  3PIO F;  2R0Q C;  1MMG A;  3WTZ A;  4RLQ A;  1Q1V A;  2ESN A;  4ZJZ A;  1P4W A;  3L2R A;  4A0Z A;  2L7Z A;  3E6C C;  4M74 A;  4YIF A;  3CCY A;  4YFX F;  4XL9 A;  5J3L A;  3IL2 A;  1O3S A;  1KGS A;  4KA4 A;  2E7X A;  3D5L A;  1HKT A;  1SMT A;  1YJW I;  4N4O B;  2P0W A;  5FKN A;  3V7C A;  1JXS A;  3BLY A;  2VT2 A;  1K83 J;  3B02 A;  1WGX A;  3O8H A;  1A31 A;  2JA8 J;  1TBX A;  1JE8 A;  5LHH A;  2QQA A;  2W24 A;  4IOC F;  1JT6 A;  1UHW A;  3MKL A;  1WKM A;  3A02 A;  5JI6 A;  3BTJ A;  2V1U A;  2L5Q A;  2O3F A;  1WSU A;  1MDM A;  2RN7 A;  2CQ7 A;  4RS8 A;  3EYY A;  2DT5 A;  3BTL A;  4XMY A;  2CQQ A;  1RKT A;  4AM3 A;  1OMI A;  1SD6 A;  5EZH A;  4D9J A;  4C9Y A;  1SD5 A;  2M3A A;  3DU5 A;  5DCF A;  3M1E A;  2CW7 A;  4Y3O A;  2LK2 A;  1B59 A;  3G6E I;  2HS5 A;  4Q4Z F;  5LRR A;  4MLO A;  3JTG A;  4XID A;  4UHT A;  3LMM A;  3V42 A;  4KMF A;  4DYQ A;  2G0E A;  1OCC H;  3PM1 A;  4RMN A;  2HGC A;  4R79 A;  3UR3 C;  2QSG X;  4M3G A;  1WFX A;  1VQ4 I;  3HKZ N;  1HOM A;  1FP2 A;  2IGK A;  2F2E A;  4LG0 B;  3DEW A;  5EF6 A;  3QU6 A;  1YIT I;  2Z3Y A;  4U7D A;  1A5J A;  1D1B A;  2FA5 A;  1GLN A;  2ZXI A;  4YEJ A;  3FF5 A;  4KJZ A;  3WTW C;  4AUX A;  3CF5 F;  3MN2 A;  5C4J J;  3CCE I;  1PP7 U;  3M4O J;  1UST A;  2OQG A;  5IPA A;  3K2A A;  3VYR B;  2W25 A;  1RZ4 A;  1V5G A;  1Y0N A;  4RAF A;  3LFK A;  2XKO A;  1YG2 A;  3Q9S A;  3KLN A;  4CIC A;  1JJ6 C;  4L0Y B;  5F04 A;  4LLG F;  1R1U A;  1LJ9 A;  2NXN B;  2CMP A;  4D1Q A;  3T0Y A;  1LFP A;  5BQT A;  1JT0 A;  2LTP A;  2EFO A;  5E8G A;  4QTR A;  3A4C A;  1XD7 A;  1VQ9 I;  3BJA A;  2R93 J;  3J7A O;  2K9S A;  3KIO A;  3R60 A;  5J1R A;  1X1C A;  2MH2 A;  1H89 C;  2PBI A;  2VC0 A;  2HYG D;  4KN4 X;  4QLC U;  1YO5 C;  2XGD A;  2E2H J;  5HLT A;  2R5Z B;  1HF0 A;  1WWX A;  3LWF A;  3JAM K;  2IP2 A;  3V4G A;  1I1G A;  3ML6 A;  2Q2E B;  2JQ7 A;  4CGZ A;  3HUG A;  4I6Z A;  1XMK A;  3RI4 A;  4IHW A;  3K4C A;  5JLW A;  2WV1 A;  3OYH A;  3L1P A;  3FXO A;  3JTH A;  5DTD A;  2FXA A;  2F5E A;  1OCR H;  1U0J A;  3I56 I;  2ZFU A;  3D0S A;  3RYR A;  1IUF A;  4BBS J;  4A5N A;  2DK8 A;  2TDX A;  3QWL A;  2VQC A;  4UUT A;  2ACJ A;  3OIP A;  2LKP A;  4MO7 A;  3ZQL A;  2IW5 A;  4PJJ A;  2QSH X;  1YRN A;  2FBH A;  2FQ3 A;  2ZJ2 A;  4KIF A;  4DIQ A;  5L3C A;  3S17 J;  1T33 A;  2DI3 A;  2QLZ A;  2W82 A;  1U8R A;  2LF8 A;  2DAO A;  3M07 A;  2ZJR F;  3T1B A;  1YIJ I;  3IRQ A;  4RGR A;  5HOO A;  1EA3 A;  2DA6 A;  1BN5 A;  2HWV A;  3HEF A;  3OYL A;  3PO2 J;  1DPR A;  2K27 A;  2NRA C;  4BJ6 C;  5A2Q Z;  2F5C A;  3L00 A;  2CUF A;  4E7L A;  2BHZ A;  5FLM J;  2CH0 A;  5CVR A;  2FML A;  3VYU B;  4BAY A;  3EYI A;  1ETV A;  2R4G A;  2IA1 A;  1O3T A;  2OU2 A;  3TL4 X;  1BC8 C;  2BXY A;  5EJC A;  1B9N A;  4XN0 A;  3PO3 J;  2CS3 A;  4NB5 A;  2HZD A;  3RKW A;  1K78 B;  3ZPL A;  3LQQ A;  4XLE A;  2X85 A;  4DGW B;  3L09 A;  1JTX A;  3S1N J;  1KU2 A;  4XRF A;  3E6M A;  2DA1 A;  2R7V A;  5GPA A;  1YHQ I;  3ZQG A;  4HNT A;  2QKM B;  5K5O A;  4BHC A;  3LL7 A;  4MQ9 F;  3CCL I;  4BL0 B;  1XGN A;  3IKV A;  1A36 A;  1FPQ A;  2E35 A;  3GUD A;  2R5Y B;  5EGO B;  2DFF A;  3C18 A;  3KFW X;  5BS6 A;  2ZFW A;  3OYD A;  3DBH B;  2LC2 A;  1S6L A;  4MQV A;  2ETH A;  3V7R A;  1U5T C;  1Z3X A;  4FX4 A;  2XPW A;  1ZRD A;  1KQ9 A;  2X9D A;  3IC7 A;  5GAE J;  4A3J J;  3I59 A;  3PIP F;  4BY7 J;  2XRL A;  2MC3 A;  1W1W E;  3VEP A;  5J4V A;  3OYI A;  2XRO A;  4A3D J;  3LSM A;  1J9I A;  1JKQ C;  3C2B A;  1IDY A;  4WK8 F;  1J2X A;  3B73 A;  2JZY A;  1D8J A;  1WPK A;  4GCV A;  2BOL A;  4IRH A;  1IRZ A;  2FF4 A;  5L3F A;  3FMS A;  4BYY A;  1STZ A;  4Y33 A;  4FCY A;  4UUV A;  4C30 A;  4I7H A;  1P9Q C;  4X6A J;  3EPZ A;  3D1N I;  3PQJ A;  4E7K A;  1OCT C;  1FZP B;  2VLA A;  3HOT A;  1Y56 A;  3FXK A;  2Z1D A;  2RGV A;  4QPO A;  5F27 A;  5J8C A;  4BEH A;  3KYL A;  1ETW A;  1J0R A;  4AYB N;  5DUI A;  2BY3 A;  3MKW B;  1ZAO A;  4XLN F;  2DK5 A;  5E79 C;  4S0H B;  5FLV A;  2GXA A;  2M0C A;  3AAF A;  3SEQ A;  3HSF A;  4BQO A;  4DYC A;  3ZQH A;  1R5G A;  2HYJ A;  5KNL A;  4EGY A;  3GF2 A;  1VQ6 I;  2XF6 A;  4XON A;  3F22 A;  2G7U A;  3W2V A;  3F9K A;  5GAH J;  1H0M A;  3RPU D;  4A3M J;  1OJL A;  3FMQ A;  1BM9 A;  4B1R A;  2V6E A;  2XVC A;  2LMD A;  2VJ4 A;  2NVT J;  2JVH A;  2DPU A;  2NVX J;  2KZV A;  3BT9 A;  5ED4 A;  2K02 A;  3WOD F;  4OWR B;  2YUS A;  2WAQ N;  1X3W B;  2EV0 A;  4PSW A;  2R7U A;  2HEO A;  4E6K G;  4N9H A;  3D5R C;  1HA8 A;  4QPQ A;  2LVS A;  3KP6 A;  3TW6 A;  2H09 A;  1E3P A;  3MMY B;  1IW7 F;  5D5U B;  3WTY C;  2MAB A;  1V55 H;  4M3D A;  5EEG A;  2I5U A;  2HOS A;  4JBA A;  1LQ1 A;  1ULY A;  4EJU A;  2P7V B;  5B1A H;  3I64 A;  4NC6 A;  2LBF B;  3DWL E;  1MGT A;  2ISZ A;  5IOY A;  4EV0 A;  3SZG A;  2DW4 A;  3BQZ A;  2H1L A;  2FSW A;  2IGM A;  1W7P D;  1Z7U A;  3SEZ A;  5DM7 F;  1HXD A;  2X4H A;  2XUB A;  3GEZ A;  2KIQ A;  3P5J A;  4AD9 A;  2A5Y B;  2F4M B;  2IPQ X;  4G7H F;  1WJF A;  1QBJ A;  3U1K A;  1MMN A;  3ASN H;  3OV8 A;  2GQQ A;  3EDP A;  1P4X A;  4XSX F;  3QPS A;  2NVU B;  1FP1 D;  3COA C;  1WI9 A;  4A6E A;  1RRJ A;  2F4I A;  1D0Y A;  2KRF A;  2X1E A;  2V9K A;  4MGR A;  4BJT A;  4IO9 F;  3KP7 A;  3BRO A;  4AIJ A;  1LE8 B;  3OOU A;  3LSK A;  4YFN F;  2F6C A;  2XF5 A;  4PUS A;  3RTR A;  1FMV A;  3MCZ A;  4I09 A;  3CCV I;  3LFU A;  5BNG A;  1XCV A;  3KET A;  1VQN I;  1FTZ A;  1ON2 A;  1SFE A;  1O4X A;  2ZKZ A;  3OYC A;  3CTA A;  4BXX J;  1Y6I A;  3QAH A;  3WHB A;  1BOA A;  1F4K A;  2QUF A;  1IGN A;  2OCC H;  1MJA A;  2W4S A;  5GAD J;  4BE0 A;  2PQ8 A;  3FX3 A;  3FXQ A;  2W00 A;  1D0Z A;  1N78 A;  1JUP A;  1RC9 A;  2AQF A;  1IV6 A;  1ZTR A;  3WTS C;  3NAR A;  1Z6T A;  4G7Z F;  2KMU A;  2L3D A;  2J5P A;  5FKM A;  1GVD A;  2VC1 A;  3T8T A;  5F1R A;  1BA5 A;  1BR4 A;  3E7L A;  4CCM A;  1FWZ A;  1R4N B;  2LKS A;  3K0L A;  1MSF C;  4ENJ A;  5FKK A;  3E5X A;  2X6O A;  2XPV A;  2DTZ A;  1QGP A;  2A6T A;  2CG4 A;  5CKT A;  2ELJ A;  3PUF A;  1I3A A;  3QU3 A;  3GXO A;  6PAX A;  3T8R A;  2IA2 A;  2PG4 A;  3GWZ A;  4CYC B;  1R00 A;  4XKB A;  4IF4 A;  2IT0 A;  4U87 A;  5D5V B;  2F5D A;  3B6A A;  3R6S A;  4O3M A;  4U88 A;  3QPL A;  3DU6 A;  1E3O C;  2ZNZ A;  3S1Q J;  1S7E A;  3M9A A;  4Y15 A;  1BW5 A;  4RAG A;  1XSD A;  2Y30 A;  4CYD A;  1W5C C;  4HF2 A;  3MVP A;  1P2F A;  4JX6 A;  3GTM J;  5K5R A;  2Y31 A;  3DKY A;  3RPQ A;  2W1O A;  2KIU A;  1WH7 A;  2DMQ A;  5FGM A;  2BE5 F;  4G8X A;  4BQA A;  1JHH A;  5ILV A;  3M7G A;  4EJT A;  1OR7 C;  3SJM A;  2JA5 J;  2LLK A;  3HRM A;  3E0J B;  5FLX K;  1SFO J;  2WAD A;  2P5K A;  3AG2 H;  5E3L A;  1J09 A;  1WJC A;  2OC6 A;  2HTJ A;  3BR6 A;  3IH2 A;  4W1U A;  4LGW A;  2MLK A;  3LAJ A;  2V1D A;  4E7H A;  3KE2 A;  1KYZ A;  5E3N A;  1HST A;  1WJA A;  2D1H A;  4Y13 A;  2KDZ A;  2FOK A;  2EZH A;  3GTG J;  5EEA A;  4HQE A;  4M6X A;  1WCM J;  3J7Y J;  2CV1 A;  3AG4 H;  4ZZL A;  1IXC A;  2M8E A;  2VPL A;  5FD5 A;  2HI3 A;  3BPX A;  3ZQF A;  3DBR B;  4YEL A;  4BHB A;  3DFG A;  1DU0 A;  4RGU A;  1IXS B;  5D4S A;  2L2O A;  3ESW B;  3L2C A;  1TL8 A;  4RAZ A;  4EGZ A;  3DEU A;  3BCA A;  2VBX A;  4RB0 A;  1DP7 P;  1IO2 A;  4LIU A;  5EG0 B;  3PJR A;  2YU9 J;  4IJA A;  3W3C A;  5HVQ C;  3SFI A;  2TRT A;  3LNQ A;  1J7K A;  5B5E C;  3FXU A;  3JRC A;  3QYE A;  3A0H C;  2K5C A;  2ZBK A;  1ZN2 A;  2FNP A;  3EUA A;  2KL4 A;  3BZK A;  4PCQ A;  1MND A;  4PJN A;  2YX4 A;  3CCM I;  1ZRC A;  2L7F P;  1IN7 A;  1MBH A;  4O5V A;  4S05 A;  1OKR A;  5E1W A;  5D6F A;  4A3K J;  1FX7 A;  1WZ2 A;  3J7A Y;  4ITV A;  3MEX A;  3U2R A;  4LLL A;  1XDS A;  4X0G A;  1W7P A;  4ZYH A;  1HSJ A;  1EJ9 A;  4M72 A;  1XMA A;  3LA2 A;  5K7Z A;  2M45 A;  5DCM A;  1ZGA A;  2O7O A;  4AWX B;  1PVE A;  2LG4 A;  1T6S A;  3GZN B;  2Y69 H;  3EUK L;  2DOA A;  3BG7 A;  1OQY A;  4G6T B;  1HC8 A;  2JRT A;  4B09 A;  1KU3 A;  3A1Y A;  4ENK A;  3ULQ B;  2COB A;  2R7O A;  1BR1 A;  1Z05 A;  2EH3 A;  2VJI A;  1VQP I;  1S8N A;  3NWS A;  1GV5 A;  4A0X A;  4M3E A;  1EH6 A;  4BXU A;  4PFO A;  1T98 A;  1UZC A;  5HNF A;  1U6G A;  3GTJ J;  3RKY A;  2IXS A;  4PJM A;  3BG3 A;  4PGH A;  2DCE A;  5HDK A;  2GA2 A;  3TW7 A;  1FLI A;  2DMU A;  1OYY A;  4P55 A;  4BU2 A;  1RPW A;  3OYK A;  1VQL I;  3C7J A;  5EYR A;  1SC7 A;  3QPH A;  4GGG A;  3D5S C;  5F0F A;  1YJN I;  4MIM A;  4IQJ A;  2VL8 A;  3C2G A;  5E8I A;  1WQ2 A;  4FAS D;  3ZR8 X;  4BDY A;  4XLH A;  2OJE D;  4LB6 B;  1T0F C;  2KHM A;  1OFC X;  2BV6 A;  1MBE A;  2GOX B;  3BG5 A;  2Z33 A;  2ZXJ A;  4FQG A;  5IY5 H;  2DFH A;  2RKH A;  1WI3 A;  3JR9 A;  2HVR A;  3QP6 A;  1AWC A;  1BIB A;  3I55 I;  3DPT A;  2MSY A;  2ZME C;  4BXF A;  1IDZ A;  1RNL A;  3H36 A;  2XAG A;  4ZYA A;  4IHY A;  4UUS A;  3Q9V A;  4HOB A;  2DMP A;  1GVJ A;  4YFK F;  2ZC2 A;  4XOT A;  4WX9 A;  2BZT A;  4KUM A;  2DA2 A;  4RDU A;  1FSH A;  1SVL A;  2EQR A;  4B48 A;  2P6T A;  1ZRF A;  2CJJ A;  2KIF A;  5LD2 C;  2O6G E;  2GZW A;  1FYK A;  1POG A;  2VQG A;  4HAM A;  4LJZ F;  2EIL H;  2NOJ B;  2V7F A;  3ABK H;  3IHU A;  3EUH A;  2Q8K A;  1BI3 A;  5FRO A;  3ZGK A;  2QZ8 A;  4CCJ A;  2RRE A;  1G3T A;  3VYT B;  3RCO A;  4XLA A;  1LB2 A;  2PJR A;  3TOA A;  1YX5 A;  2KJB A;  2XAJ A;  2HZT A;  3LSI A;  4KNY A;  2Q1Z B;  3BJ6 A;  2LNB A;  2M34 A;  3TGN A;  1KU9 A;  5KAI C;  3G2B A;  4RM3 A;  4U7B A;  2Z16 A;  2L9S A;  3I71 A;  1ON1 A;  4PJ0 C;  1U5T B;  1LNW A;  1AA7 A;  3EUH C;  1A35 A;  3HRU A;  1YX3 A;  3J7Z I;  2HTS A;  2IEK A;  2LRD A;  4EJO A;  1ITY A;  5B66 C;  3N05 A;  2E5Z A;  3DCF A;  4IRG A;  4BKX A;  4ESJ A;  4Z2Y A;  4XLF A;  1LFU P;  1IF1 A;  1D1A A;  3KX2 A;  3GYH X;  2ZSI B;  1IJW C;  1KQ0 A;  1B4A A;  1YYV A;  3TP3 A;  4KN7 X;  4KIC A;  3TDU C;  2EIK H;  3TBI A;  3GZ6 A;  4H0E A;  3FZV A;  5HDG A;  2R7Z J;  2QEX I;  1XGS A;  3BCB A;  4ZYE A;  4EJW A;  1ZGJ A;  4HX7 A;  3BG9 A;  3B6C A;  3I59 B;  1I50 J;  2Y0S N;  3KP5 A;  4ZDL A;  2W85 A;  4OAY A;  3MKZ A;  3E97 A;  4DZP A;  3HYI A;  3Q0V A;  2A3S A;  5KCM A;  4F52 A;  2W84 A;  5FFX A;  5E1Z B;  2DTR A;  2IA0 A;  3P9C A;  3L2Q A;  4A0Y A;  2MD5 A;  5JHF A;  2L7M P;  2O0Y A;  1FSE A;  2FBI A;  3HG9 A;  4LD5 A;  4LLN A;  1QVT A;  2M4K A;  4AU7 A;  3ERE D;  2ME0 A;  2VQH A;  2LY2 A;  3VSK A;  5EDN A;  1ZKG A;  3H3U A;  2GLO A;  3E1S A;  1OPC A;  3CCR I;  4A6D A;  1VF9 A;  1GXP A;  4Q5S F;  1E17 A;  3QOE A;  1AKH B;  1G3Y A;  3CC2 I;  1SVO A;  2JPC A;  2Y9Y A;  3I0T A;  5FO5 A;  3CCS I;  4XKC A;  3HRT A;  5AIQ A;  4IX7 A;  1GXQ A;  1X1P A;  1EF4 A;  3G1O A;  2IS1 A;  2LH9 A;  2QQ8 A;  3J80 K;  5ILU A;  4EJV A;  1MMA A;  2HQA A;  2H8W A;  2M1B A;  4XIC A;  4R1H A;  3F21 A;  4KIB A;  2UXX A;  2YX7 A;  3HGY A;  4B3X A;  3K70 D;  1S5L C;  2M5W A;  1PUF A;  3IUO A;  5KK1 A;  4IRI A;  3F8B A;  5JLX A;  2DO7 A;  2HKO A;  3EQL F;  3QQA A;  4CA0 A;  4FHT A;  3Q3S A;  2EBI A;  1JTY A;  1R1T A;  2LDU A;  2PMH A;  2DBB A;  3BOQ A;  4M3F A;  4D7M A;  3OYA A;  2TCT A;  4F7Z A;  3HOS A;  1G4D A;  2R92 J;  3CMA I;  2DMN A;  4E4H A;  2DFI A;  1KZH A;  2XKP A;  4QSH A;  2E5N A;  2E2I J;  3DLA A;  3QOD A;  2RC4 A;  4M6V A;  2WY8 Q;  2OF7 A;  2OV7 A;  1QPI A;  1TLH B;  4IL6 C;  2BBY A;  1I5Z A;  2XAS A;  3S3N A;  4D5C A;  4HF1 A;  5IT9 Z;  4LFU A;  4IZZ A;  2QKL B;  3DTK A;  1YJ9 I;  3OY9 A;  2NAZ A;  4ZZD A;  1XGM A;  2VXZ A;  5D8K B;  2CYY A;  1S29 A;  2QYO A;  3G1L A;  3H9G A;  1HW2 A;  4NDL A;  5LEJ A;  3CME I;  4HA8 A;  2CQX A;  3DF8 A;  1SFK A;  5LGN A;  3ZOB A;  3CO7 C;  2DA3 A;  2MD0 A;  5TIS C;  4HX4 A;  4CXF A;  1X19 A;  1TWH J;  2HOE A;  4PZJ A;  2OCE A;  2L54 A;  1B72 A;  3AL0 C;  3Q0W A;  1SFX A;  3CQZ J;  4N9I A;  3IV5 A;  3JRE A;  4HZF A;  1TWC J;  1E2X A;  1EV7 A;  2KQR A;  4UV9 A;  3OIQ A;  2M7A A;  1FT9 A;  5AON A;  4M6Y A;  3DLL F;  2ISY A;  1VQ8 I;  4UVC A;  1R49 A;  4NUB A;  3TQN A;  2EIN H;  2HYF A;  1VQ5 I;  1EH8 A;  2VXD A;  3K2Z A;  3FDY A;  1XSV A;  2B63 J;  3CP2 A;  5J6X A;  1ETQ A;  4DJA A;  2PX9 A;  2LY9 A;  3FXL A;  1X2N A;  4ZTF A;  4B4C A;  2HQR A;  4HDV A;  2XAQ A;  3REO A;  2AO9 A;  4D7N A;  2L02 A;  4XOR A;  1QZE A;  3S2D J;  4OIN F;  2FX0 A;  2RNJ A;  3LST A;  4U0V A;  1IN4 A;  4IEJ A;  2DU9 A;  3M3Y J;  4JP0 A;  1B6A A;  2ZXW H;  3MD2 A;  1Y1V J;  2Z5U A;  3LA7 A;  2IJL A;  2ID6 A;  5LHG A;  2G9W A;  3OS0 A;  2R7Q A;  2XAF A;  3H5A A;  3RYP A;  3I53 A;  5CPR B;  1UG2 A;  5E18 F;  4MNU A;  1ETY A;  2PFB A;  3WGI A;  4F93 B;  3S16 J;  4HNV A;  2EIJ H;  1SD7 A;  3ASO H;  3CUO A;  4GXO A;  3SYT A;  5HS8 A;  3ZN0 A;  2WTE A;  1WRJ A;  2A5W A;  2M30 A;  4L5E A;  2UWM A;  3QPT A;  2H6B A;  5ILS A;  3S32 A;  3GZ5 A;  3OYB A;  3CJN A;  3HHH A;  1A6I A;  4ZC3 A;  2OUM A;  1USS A;  4ZDO A;  1J59 A;  2DLL A;  3ZQC A;  2DQL A;  4C2U A;  1JKP C;  5E3M A;  3UKG A;  4OU0 A;  2MA3 A;  3GFJ A;  5CVU A;  9ANT A;  4FT8 A;  3VYS B;  3W6V A;  1YW9 A;  3DQV C;  3ELK A;  1WJE A;  2LKX A;  2XGX A;  3OYE A;  3PUB A;  1YTY A;  3MZ8 A;  4N0B A;  5ICE A;  4L9T A;  2IVM A;  2ZCW A;  1DGR M;  3TED A;  4E7S A;  1HKQ A;  2JWT A;  1P7I A;  5FD6 A;  3ERM A;  2IBD A;  3ZRG A;  1I1S A;  1K6O A;  5J40 A;  3U9G A;  5BPI A;  3HOV J;  3ZMS A;  1FBQ A;  2MH9 A;  2R7W A;  4ENN A;  1WJ5 A;  1N77 A;  3IH4 A;  3HIF A;  3KEO A;  3HXL A;  3I4N J;  4J01 A;  1HBX G;  4I99 C;  3LSH A;  4WXD A;  2HNH A;  4B44 A;  3GTL J;  3HOW J;  5LEK A;  4XNF A;  4Y17 A;  3CJT B;  1JKR C;  2Q0O A;  4J19 A;  3H0D A;  2H27 A;  2FUG 2;  2HFH A;  2NS8 A;  3WHC A;  4HDU A;  4F92 B;  2A69 F;  4MFE A;  3A0B C;  1GUU A;  4P9F A;  1NK3 P;  2QQ9 A;  3GFM A;  3HSE A;  2UV1 A;  4A2U A;  4XRM A;  3IP4 B;  1W5T A;  3WE3 A;  4D0P A;  1BI1 A;  3DXJ F;  2WAF A;  1CF7 A;  5CVI A;  2AXT C;  5IOZ A;  3CLQ A;  3OYF A;  2FU4 A;  4FX0 A;  3E5U A;  1ERD A;  3DTE A;  1ZG5 A;  3ISP A;  3HB9 A;  4IHV A;  4EM0 B;  3K70 C;  3BQY A;  3E5Q A;  3K4K A;  1FOX A;  3CF2 A;  3HGG A;  5EZG A;  2GXB A;  3OYJ A;  5D5X B;  4AVP A;  3K4B A;  2Z2S B;  4XLC A;  2ME6 A;  3RZO J;  1ZR2 A;  2BXZ A;  2DA4 A;  3ZMT A;  1FYM A;  2W57 A;  1O7L A;  1WH5 A;  2VJ5 A;  2ZSH B;  3QYB A;  3HM5 A;  4RB2 C;  3WU0 A;  2VE8 A;  1MH3 A;  2EFW A;  5FKO A;  1W36 D;  3JW4 A;  2HVS A;  4HNU A;  2XV4 S;  1RES A;  5GAG J;  5JFR A;  1W7P B;  3PNT A;  2QBY A;  3ABU A;  4XR6 A;  2H8R A;  2LRE A;  3VFZ A;  4CZZ A;  3V8K A;  2GA1 A;  1XCB A;  3EET A;  4LIT A;  3CP8 A;  5K1Y A;  1UFM A;  4YG2 F;  3QOP A;  2BW3 A;  2XSJ C;  3S15 J;  4X1E A;  2BEO A;  2QWW A;  3WU1 B;  3OWT A;  1PJR A;  5H2F C;  4HX8 A;  4RGX A;  1T56 A;  2K3F A;  3RZD J;  2K86 A;  2CO5 A;  1GDT A;  3HPG A;  3BJO A;  3NQO A;  2JA2 A;  3JRA A;  1BR2 A;  1B1B A;  2ZME B;  3S14 J;  3H3Z A;  5L3E A;  2P5L C;  1LFB A;  1XC5 A;  1R22 A;  3E3V A;  4J00 A;  1L0O C;  3MAJ A;  5B1B H;  1PYV A;  3GCM A;  2COM A;  3IH3 A;  2QQB A;  1J75 A;  1RUO A;  3OR1 C;  4DW6 A;  1EKE A;  2JN6 A;  4DQ2 A;  2NS7 A;  4PDK A;  2OTL I;  1S7A A;  2D5V A;  4WWC A;  1SAN A;  3ECO A;  4M9X A;  4M71 A;  4OMZ A;  1JGG A;  3TO7 A;  2Y0M A;  1XN7 A;  1W4M A;  1LDK B;  3C2H A;  3DPL C;  1B8I B;  2WC2 A;  2K4B A;  2P4W A;  1WVR A;  2OPT A;  1HKS A;  4BQN A;  4IPA A;  5J4Y A;  4UUS B;  2FMY A;  1ZAR A;  3J81 K;  1TTY A;  5F0C A;  2NNY A;  1N75 A;  2E19 A;  1ENH A;  3ABL H;  1SVM A;  2KP6 A;  1F36 A;  1X3U A;  2VKV A;  2ECB A;  1ACI A;  2BVL A;  1XB4 A;  1OCO H;  1X2M A;  2KRC A;  1LDJ A;  4JQF A;  2XAU A;  1D3Y A;  4II2 A;  3OS1 A;  1IN6 A;  4NQW B;  3SZT A;  4LIV A;  3RIR A;  2FQ4 A;  2B9S A;  1LEA A;  3OL3 A;  2PJR B;  2IRF G;  2N8G A;  2Z9O A;  2HDW A;  4A5M A;  1FOY A;  3HTU A;  5CJ9 A;  2JK3 A;  3H5N A;  4WXC A;  3HOU J;  5J47 A;  1DU6 A;  1YS6 A;  1XTA A;  3CO6 C;  4C3I J;  3FKI J;  4Y4R A;  1E0E A;  4XBF A;  1MJ9 A;  4F91 B;  4DZJ A;  5ICG A;  2ZJP F;  1L3L A;  2X48 A;  3JSO A;  2L7K A;  4HLY A;  3G4S I;  2P5V A;  5DDG A;  1TNT A;  4NC8 A;  1HW1 A;  3C3W A;  1PDN C;  1X3Z B;  4OMY A;  2L0K A;  2A6E F;  4IHS A;  4KMU X;  1R5I D;  3L7W A;  4F3Q A;  4A3I J;  2R7R A;  2UXN A;  1K78 A;  4PSX A;  5F08 A;  5K7F A;  1MJB A;  1Z21 A;  3KP2 A;  4HLX A;  3P9I A;  3SDG A;  2VUM J;  1OLT A;  1MNE A;  2EK5 A;  1Y8Q B;  2R7D A;  1U9O A;  2M0M A;  2LP0 A;  1WHU A;  2E36 A;  4UB8 C;  1ZEL A;  1V4R A;  5GTI C;  4DBQ A;  2WA0 A;  2GIV A;  1IUY A;  1X1D A;  5IYD J;  2R5Y A;  3N97 A;  1QQI A;  3H9J A;  3KYC B;  2K3P A;  4HF0 A;  5EGO A;  1FNN A;  4I98 B;  4PK4 A;  2PI0 A;  3P9K A;  3GFL A;  2E1N A;  4BJ5 C;  3ZQ7 A;  1O3Q A;  1MDM B;  1XGO A;  1OYW A;  3LQR A;  4HPQ A;  2GM4 A;  1R5H A;  2AHQ A;  5CLS A;  5F6F A;  5L3G A;  2OBP A;  1DDN A;  4G7O F;  1I6H J;  2FNA A;  2QGU A;  1QZY A;  2CQK A;  2PJP A;  2M7B A;  2CFO A;  5M5W J;  1O3R A;  2D2W A;  1CQT A;  2P81 A;  2R7X A;  5HDN A;  1IRF A;  2STW A;  1W0T A;  1YQA A;  3GW2 A;  2VB6 A;  1ZGW A;  2O5R A;  3I4P A;  3LSJ A;  4HEA 2;  1T38 A;  2PMZ N;  2K9Q A;  2RVC A;  1RKW A;  3KLO A;  3V8J A;  2Y2Z A;  2MBF A;  2BY1 A;  3ZMZ A;  3RKX A;  5HOD A;  3HBL A;  5TJJ A;  4B3A A;  3BP8 A;  1RR7 A;  2OQR A;  3JRG A;  1FEX A;  3M1C A;  2GAU A;  1H88 C;  3GLX A;  2X1D A;  3GTQ J;  2BGC A;  4P9U A;  1QNT A;  3S2H J;  1PUF B;  1IN5 A;  1TC3 C;  2CSO A;  2ECC A;  3K1P A;  4M9Z A;  1W36 C;  1Y0U A;  5DYM A;  4YII A;  4IHX A;  1QZZ A;  3K69 A;  1YFH A;  1KON A;  5DD4 A;  1O57 A;  2F5V A;  1Q1H A;  3FM3 A;  3X2Q H;  3M8E A;  2RV8 A;  1FC3 A;  4E7J A;  2NVY J;  1REP C;  1FIA A;  2O8X A;  4A69 C;  1DP3 A;  1UEL B;  3K4J A;  3F6V A;  4KT5 C;  3AL0 B;  5TRD A;  2ZXH A;  5K5Q A;  2AXL A;  2K9L A;  2KKO A;  2VBY A;  2Y75 A;  4AIK A;  4OIQ F;  3OYG A;  3RDI A;  5HNH A;  2LD5 A;  1FOK A;  5GP9 A;  1BIA A;  4ENM A;  1TT0 A;  3CDH A;  1Z9C A;  1V5E A;  4NHJ A;  3HRS A;  4UVB A;  2ICW G;  1S3J A;  3HUG B;  2BY2 A;  2A07 F;  3BR1 A;  5CYV A;  3HKZ A;  1MH4 A;  3WGH A;  4V19 K;  1HLV A;  2DXI A;  3TMO A;  3F23 A;  5JVG F;  1H8A C;  2LBF A;  2VQL A;  3E6B A;  5D8L B;  2O8K A;  2A68 F;  3NAU A;  1QHH D;  1JGS A;  4XSZ F;  4OIR F;  4HW0 A;  3LSR A;  1K7A A;  3WTV C;  1HDP A;  2IS4 A;  3LAP A;  4EMS A;  3ROU A;  4E70 A;  2V26 A;  3BG6 A;  3DKW A;  2CV0 A;  3CJQ B;  1RUN A;  3AKZ A;  1YRN B;  2XGE A;  3A2K A;  2MC4 A;  3F8N A;  1BI0 A;  1V3F A;  4K2E A;  1XSX A;  1QVU A;  3R0A A;  2K9M A;  2W48 A;  3HHG A;  1ONV A;  2CGP A;  1J5Y A;  1LE8 A;  2CUJ A;  1K4T A;  5DM6 F;  4ON0 A;  4OAZ A;  5E3O A;  2WWY A;  5FRM A;  2VN2 A;  3O3K A;  3DBL B;  3ZCO A;  2CQN A;  3O6B B;  1V5F A;  1JUS A;  3BR2 A;  2WBM A;  1D8K A;  3I58 A;  2V9P A;  1P6R A;  3FKJ A;  4PGG A;  1T2K A;  5F0H A;  5J1Y A;  2NNN A;  2OZ6 A;  1TQM A;  2DA7 A;  2DT7 B;  1Z3Y A;  2K40 A;  2K4J A;  5DV5 A;  2RNG A;  4E7I A;  4A93 J;  5JR3 A;  2UZK A;  4AC0 A;  1HW5 A;  1GT0 C;  3DP7 A;  1ZG3 A;  5FLX Z;  3VOD A;  1R7J A;  2H94 A;  5M5X J;  1ODD A;  2ZNY A;  3JRD A;  1ETK A;  2KLO A;  5ICC A;  3HL2 A;  4ZH4 F;  2B7E A;  3CUQ A;  3HTS B;  4WCG A;  3W6K B;  3H3V K;  4MTD A;  2DDA A;  3GVA A;  3OMY A;  4IVN A;  2EZK A;  3HOZ J;  3FMR A;  3SXY A;  1XMX A;  2IS2 A;  2F5F A;  2Z99 A;  3JRB A;  2DMT A;  3W2W A;  4CYC A;  2WB1 N;  2V1X A;  1FJL A;  4MHG A;  4BE2 A;  3TKY A;  2M9H A;  3ZMU A;  5A2Q K;  3BWG A;  4XKV A;  1TWG J;  3FWE A;  4HSR A;  1YS7 A;  3JCU C;  1MBF A;  2VIX A;  2HKX A;  3CUQ C;  2A6H F;  2E1M C;  1M1E B;  1X4O A;  3RJP A;  3CC4 I;  1TT5 B;  1X4P A;  1IXR C;  4NC7 A;  2M8G X;  3ABT A;  1FY7 A;  1ORK A;  1Z6R A;  4L18 B;  5IP7 J;  1PP8 F;  3FIW A;  1K4S A;  2MFZ A;  4OIP F;  4TV7 A;  1XX5 A;  1MD0 A;  3CDI A;  3P7N A;  2CWE A;  4XK4 A;  4UVA A;  2XC7 A;  1HQC A;  3S3O A;  3VPR A;  5M3M J;  2G7H A;  4M73 A;  2Y48 A;  2WAE A;  3F0C A;  4UB6 C;  2RAE A;  2W7N A;  1QO0 D;  3MZH A;  4BEH B;  2MGQ A;  3W2A A;  3Q0U A;  1U9N A;  1TWF J;  4ZTJ A;  4D5F A;  3LOC A;  3U21 A;  4Y7N J;  1NTC A;  1VND A;  1CF7 B;  4W97 A;  3KP3 A;  4GDF A;  3FM5 A;  4E7Z A;  4CO8 A;  2JA6 J;  4BHP A;  4C2M J;  4KFC A;  2M87 A;  3L2V A;  2X51 A;  5FFZ A;  5LRS A;  2HQ5 A;  2MLG A;  1Y39 A;  2HOA A;  5FB2 A;  1BBY A;  5KAF C;  4BAC A;  1SEU A;  4RLF A;  1H9T A;  5ERI A;  4PFP A;  1QPM A;  1ETX A;  5L3D A;  3HOX J;  1UAA A;  1LDD A;  1T95 A;  4B47 A;  4LB5 A;  5EG0 A;  3GX4 X;  1N25 A;  3WTU C;  2P6S A;  2OA4 A;  4MEY F;  3N4M A;  4ABZ A;  4FE4 A;  4XN3 A;  3OYM A;  2IGN A;  5IYB J;  2HXI A;  4F55 A;  4L0Z B;  2X1C A;  3JRI A;  4IQ4 A;  2QBY B;  1YE9 A;  2VE9 A;  2DDB A;  2EWN A;  5BPD A;  2GOM A;  4FE7 A;  4A3G J;  2EV5 A;  1DGW Y;  4CSW A;  1A6Q A;  2QEN A;  3H35 A;  4I76 A;  3GO5 A;  5AIP A;  5M5Y J;  2BW3 B;  3CMY A;  2OTJ I;  2HXO A;  1S9H A;  2A05 A;  4AYB A;  2D1V A;  3CCU I;  2A61 A;  1FTT A;  3A03 A;  1AU7 A;  1IN8 A;  1A04 A;  2VJJ A;  1TQP A;  1R1V A;  2QF7 A;  3F72 A;  4U0Y A;  3F8C A;  1SFU A;  1LKX A;  2O03 A;  3ZMD A;  1MSE C;  2J5O A;  4O6J A;  4BE1 A;  1NH3 A;  2CU7 A;  2R7F A;  2YU3 A;  5LGT A;  4FET A;  1FIP A;  3SHF A;  2XIG A;  1ZK8 A;  2EZI A;  2HU9 A;  1ZR4 A;  2KZG A;  4GYI A;  1H9G A;  2KIS A;  2CUZ A;  3BZ6 A;  3ZN1 A;  1U8B A;  2PN6 A;  5CVV A;  2B0L A;  2DFE A;  3MKY B;  1TQI A;  2KFD A;  1ZYR F;  2CRG A;  2UUZ A;  4MEX F;  4II3 A;  1D5Y A;  3TDZ C;  1OIS A;  1JKO C;  1P92 A;  4L5I A;  3V8L A;  3FK7 A;  1GHC A;  2WAQ A;  2V9V A;  3RQ4 A;  2HDC A;  2JT1 A;  1FYL A;  3GME A;  3A01 A;  1UCR A;  1QA6 A;  5J8F A;  1HCR A;  1FBS A;  1G59 A;  3S8P A;  1D0X A;  1I39 A;  4XLP F;  2FD5 A;  2VT3 A;  5M3F J;  2OD5 A;  3HDD A;  2C6Y A;  4HV5 A;  5TGT A;  1MZB A;  1LPQ A;  4P96 A;  1BJZ A;  2GIZ A;  2O61 A;  3WGG A;  1MMD A;  3R0J A;  1NG6 A;  4ESF A;  1KQ8 A;  3HPH A;  5D5W B;  4IKF A;  1K61 A;  2JSP A;  3FK6 A;  5LBQ A;  5BMZ A;  1NK2 P;  1GV2 A;  2EA2 A;  4L5J A;  4BY1 J;  4C3H J;  1YIO A;  2XPU A;  3AG3 H;  4RGS A;  3CJR B;  2BYV E;  2FRH A;  1T8I A;  1F5T A;  2EB7 A;  1VFC A;  3FXR A;  3DPU A;  5LLQ A;  2V79 A;  1Z7L A;  2GWR A;  1BL0 A;  2P8T A;  3IAS 2;  2CV2 A;  3S1M J;  5HLI A;  2IS6 A;  2I10 A;  3DTI A;  1YLF A;  1BC7 C;  2XB5 A;  3K4M A;  1MKM A;  1ZRE A;  1C0W A;  4C2T A;  2I8D A;  3ZQI A;  2HVQ A;  3UNG C;  2JUC A;  2QCO A;  3F6O A;  3H5R A;  5KVR A;  2DOF A;  1IRX A;  4V2G A;  3W6J B;  3OIO A;  1JUM A;  2ZB9 A;  2AS5 F;  3CDL A;  2XHK A;  1ETO A;  1U5T A;  2HR3 A;  3OL4 A;  3FIS A;  1F43 A;  1Z0X A;  2QM3 A;  3HC7 A;  1YW7 A;  3RSN A;  4ZYG A;  3GTK J;  3AFH A;  4P5O A;  2EFQ A;  4DYR A;  4HRI A;  3CMM A;  1R36 A;  3FHZ A;  3S1R J;  2CW8 A;  1MBJ A;  1D5V A;  1LVA A;  1V54 H;  2L9V A;  5GPC A;  3KPH A;  5FKL A;  3PFY A;  4EM1 A;  3QRF F;  2XAH A;  1BI2 A;  3H0G J;  3I54 A;  2P7C B;  1P4A A;  4V2F A;  2XRN A;  3J80 Z;  4XRS A;  2YR2 A;  3DV8 A;  3F8M A;  4DOZ A;  3WG7 H;  2STT A;  1G3W A;  2X0L A;  3SDB A;  1T39 A;  1ZHF A;  2KJC A;  3BZC A;  4G6Q A;  3ZMV A;  4XKW A;  2HOT A;  2VBZ A;  4LOC A;  2DA5 A;  4RB3 C;  4A3B J;  2WY7 Q;  4RM2 A;  3HOY J;  4IHT A;  1K6Y A;  3G73 A;  4YIR X;  2HDD A;  2ID3 A;  4AIH A;  1G6N A;  2XGC A;  3DKX A;  3KZZ A;  4EAT A;  3H92 A;  2KPM A;  4XM3 A;  4G9Y A;  5HS9 A;  4S04 A;  4M3B A;  1UHM A;  4AID A;  2LOO A;  4ESB A;  1X1A A;  2DN0 A;  3IAM 2;  3K9T A;  1R4M B;  2PMU A;  4XQF A;  3QP5 A;  4EEF G;  2VKE A;  3SZP A;  4GYG A;  5CQE A;  2X6X A;  2EV6 A;  3TO9 A;  1AKH A;  3S93 A;  1R9T J;  2MYS A;  3VSL A;  4ZYD A;  3PSI A;  3ZP5 A;  3JAM Z;  4Y52 J;  4MTE A;  1I6X A;  2VKD A;  5DEQ A;  3RQI A;  1VQ7 I;  2FBK A;  1ZQ3 P;  4CCL A;  3KEQ A;  3ABM H;  3KEY A;  2E1O A;  4DBR A;  4YRV A;  3BTC A;  4LG0 A;  2JA7 J;  1MIJ A;  2H1K A;  1VI0 A;  2ADU A;  4Z6Y A;  5DCM B;  3TOB A;  1XPX A;  1SAX A;  2FEZ A;  4CUG A;  1IC8 A;  3PSF A;  4C3J J;  2IAI A;  3H1C A;  2DJI A;  3IRR A;  2FJ1 A;  3AG1 H;  1IG7 A;  4WF2 A;  3WTT C;  2NS0 A;  3SQN A;  1TW3 A;  2JPB A;  1YW8 A;  3TP0 A;  2L4A A;  2X6W A;  2EZL A;  1UMQ A;  1WJD A;  1KA8 A;  3IWZ A;  3LA3 A;  3KZI C;  3NRV A;  2CW0 F;  2E2J J;  2PMZ A;  1LUJ B;  3G1M A;  1QHG A;  4A3E J;  2JJ7 A;  3K1N A;  1R58 A;  1VQO I;  1OYI A;  1R23 A;  3OS2 A;  3KZY A;  5H20 A;  2V6C A;  3C1D A;  4HST A;  2R5Z A;  1F1Z A;  2WV0 A;  3L2U A;  5F1J A;  5IP9 J;  2E7W A;  2EA4 A;  3OSF A;  3OOP A;  3I3L A;  4RA2 A;  3WG9 A;  2Q2E A;  3BR5 A;  3TO6 A;  5LGU A;  1FOW A;  3ONQ A;  3BC8 A;  3K4N A;  1Y1W J;  3O2P E;  2DJN A;  4I02 A;  3JRH A;  4KT6 A;  4HYE A;  3GTO J;  3HSR A;  1X58 A;  3VWB A;  1OCZ H;  3CCQ I;  3O8G A;  4HBL A;  1X1B A;  2GBY A;  2DOD A;  2LYC A;  5E1X A;  3VB2 A;  1TWA J;  1PUE E;  1MMS A;  2JTV A;  2HPM A;  1R6R A;  1ZLK A;  2ESH A;  5FJ8 J;  4GFB A;  1KYW A;  2L01 A;  2VI6 A;  1U3E M;  2VOP A;  5B3S H;  1CGP A;  2QVO A;  1B9M A;  3ZXS A;  4N4N B;  1T08 B;  5CQG A;  2R7S A;  1WJB A;  2QA4 I;  1JJ8 C;  2BVM A;  2H6C A;  2E71 A;  3FBI B;  4UNO A;  4KDP A;  2L9N A;  1MW7 A;  4CHU A;  2VOO A;  1IV8 A;  2F48 A;  5LFA A;  2ZJQ F;  1IRG A;  1JHF A;  4Q47 A;  2K85 A;  1AOY A;  4IXA A;  1TNS A;  3PFI A;  3WE2 A;  2ZO4 A;  1Z91 A;  1VQK I;  2MG4 A;  3SFZ A;  5JHU A;  1KU7 A;  2KRH A;  4HQM A;  2AQE A;  4L9N A;  1W5S A;  4R8H A;  1XDU A;  3GLL A;  3PL8 A;  2XF7 A;  4GO1 A;  2CUE A;  1UHS A;  3BDD A; 
#chains in the Genus database with same CATH homology
 2K3F A;  2JQ7 A;  2E34 A;  1YI2 I;  3CCV I;  3CMA I;  3CD6 I;  1VQN I;  3I56 I;  1YJW I;  3CCJ I;  1Y39 A;  3CCM I;  5GAD J;  1VQM I;  1S72 I;  4IOC F;  1YJ9 I;  5DM6 F;  2OTL I;  3J7Z I;  3G71 I;  3CME I;  1VQO I;  2ZJR F;  3CJT B;  1VQ6 I;  1YIJ I;  1HC8 A;  2QEX I;  5GAH J;  3G6E I;  1VQP I;  1ACI A;  2OTJ I;  3DLL F;  1FOW A;  3CCU I;  1VQ8 I;  1VQ5 I;  1VQL I;  1VQ4 I;  3CCQ I;  3CC7 I;  1YJN I;  1FOY A;  1MMS A;  1YIT I;  1FOX A;  3CF5 F;  3CCE I;  3CCR I;  2ZJP F;  2QA4 I;  3CC2 I;  4UY8 I;  1YHQ I;  3G4S I;  3I55 I;  3CCL I;  2ZJQ F;  5DM7 F;  3CC4 I;  3CCS I;  2NXN B;  2E35 A;  5GAG J;  4IOA F;  1VQ9 I;  2H8W A;  1QA6 A;  1VQK I;  4V19 K;  5GAE J;  3PIP F;  5JVG F;  3J7Y J;  2E36 A;  2FOW A;  3PIO F;  4IO9 F;  1VQ7 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...