3RCOA

Crystal structure of a conserved motif in human tdrd7
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
76
structure length
76
Chain Sequence
MLEGDLVSKMLRAVLQSHKNGVALPRLQGEYRSLTGDWIPFKQLGFPTLEAYLRSVPAVVRIETSRSGEITCYAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Tudor domain-containing protein 7
publication title Crystal structure of a conserved motif in human TDRD7
rcsb
source organism Homo sapiens
total genus 19
structure length 76
sequence length 76
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12872 OST-HTH OST-HTH/LOTUS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1880 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3rcoA00
2KPMA 2KZVA 2LH9A 3RCOA 2LY1A 3S93A 2LY2A
chains in the Genus database with same CATH superfamily
5GPCA 2P4WA 5J3LA 1JKPC 2DW4A 5F0HA 4BE0A 1VQ4I 5M3FJ 4HLYA 4RB1A 4I0BA 2MD0A 5IP6A 2J5OA 5J6XA 2LOOA 1GXPA 1CF7B 3G1OA 2R7WA 4RLQA 4RBOA 4ZYDA 4I7HA 3JREA 4UUSB 3S8PA 3NQOA 4DYCA 4KNYA 2JA5J 3EDPA 2FBHA 2XRLA 4B47A 1ZKGA 2O7OA 3A01B 3AG4H 4ENMA 3LA7A 2H8WA 4U88A 2F2EA 2ICWG 2HOEA 2MG4A 2IGNA 5H20A 3GLXA 3VSLA 1YTYA 3OYLA 2MH2A 2QSHX 2W1OA 5J1RA 5E3MA 2LMDA 2V26A 3LSPA 4XLPF 2TRTA 4GYGA 1U3EM 2BGCA 4HDUA 1SVLA 1VF9A 2KZVA 4CZCA 3BQYA 2DPDA 1R6RA 3I59A 4KN4X 3FM3A 3OYIA 1W7PA 1MJAA 5AIPA 1JGGA 3RSNA 3QWLA 3CLOA 5EGOA 3SFZA 4E7KA 1TBXA 1P7JA 1P9QC 3GXOA 2H6BA 3CDLA 2LH9A 3F6OA 3EPZA 2R0QC 3E5QA 2JT1A 3DEUA 2DA1A 1ZGJA 5L3DA 2MYSA 4HV6A 1PDNC 1IRXA 3K2AA 4AIHA 4RAFA 5L3GA 1Y1WJ 1FLIA 3L09A 3JTHA 1PYVA 3HKZN 4A6DA 3DPUA 4RLFA 5HLTA 3FX3A 5F6FA 3ZRGA 2ELHA 3FHNA 3IP4B 2CRGA 4GCVA 3CC2I 4NC6A 2HDCA 1MMDA 1HSTA 2E71A 2JZYA 2EV5A 3IV5A 2L54A 5E3LA 3HSFA 4V2GA 5JVGF 3A2KA 3NWSA 1V5GA 2HR3A 2XPWA 1U78A 1HW1A 3UKGA 3CJTB 3DTKA 2ISZA 4JBAA 2Z16A 3FXMA 1NG6A 4XRSA 3GTMJ 1MJBA 1ZTRA 1GV5A 4LB5A 3F8MA 5JLWA 2FOWA 4PGGA 1XPXA 4U87A 3RCOA 3KP3A 2IBDA 5M5YJ 2HXOA 1HW2A 1F36A 4MIMA 2DFHA 1MIJA 2LTPA 1MBFA 1LUJB 1XDSA 1B72A 1O57A 3HEFA 2PFBA 1FIPA 2R7DA 5HLGA 1S8NA 2IA2A 1QRYA 3E6BA 3HPGA 3BTJA 2XGDA 2JVHA 5FRMA 4FETA 2HFHA 5DS9A 3LA3A 1MBGA 4MEXF 2CQKA 3FZVA 4PUSA 4XLEA 3RZDJ 3QU3A 1LDJA 1QBJA 3C7JA 2NVQJ 4JX5A 3T8TA 3GZ6A 2RAEA 1SEUA 3HM5A 2K40A 2J5PA 1OYYA 3J7AY 3OYFA 1RIOH 3MAJA 1IV8A 2JA7J 4NNJA 2ZFWA 2VXDA 2VB6A 2ELJA 2EWNA 2Z33A 4I6ZA 1D3YA 4OINF 5FLMJ 1V55H 1WKMA 1B9NA 4L0ZB 3BTLA 3N97A 1UFMA 1WI3A 1FPQA 1TW3A 1T56A 3C2GA 1YG2A 1RR7A 1B8IA 1UG0A 3LMMA 3QRFF 4LITA 3F6VA 3GTGJ 4L9JA 2EIJH 4ESJA 1VQ8I 2LY1A 1KZHA 3HGYA 2LREA 3DXJF 4DYQA 5K7FA 3TEDA 1W36C 2IJLA 3M8EA 1UJ8A 1ZK8A 1HCRA 2L3DA 4I01A 1YJWI 3BP8A 2OD5A 2M2EA 3IWZA 3HRSA 3GYHX 3ZQCA 1WQ2A 4L18B 2H94A 1SFXA 5KAFC 3GW2A 3TMOA 4M3DA 1YW9A 4BL0B 1U5TA 4BEHB 1LE8B 2CUJA 5HOOA 5IY5H 3R60A 3VYSB 2MLKA 5DDGA 3CF2A 3MZYA 3WTUC 3ZQFA 3GLLA 1FSEA 1F1ZA 3T8RA 1K79A 3IHUA 1APLC 3WTWC 2JJ7A 1R1VA 5F04A 2W24A 4IZZA 3ZN0A 4DGWB 3DQVC 2BYVE 2NYXA 4NHJA 1I3QJ 2DT5A 4XN3A 1O3TA 1HKTA 2PG4A 1TTYA 2EILH 1XGOA 1RI7A 5L3EA 3GBGA 1XG1A 2LY9A 4ENJA 1JHFA 1D8JA 1IN7A 3J7YJ 3WU1B 2ECCA 1WSUA 1F9NA 1IW7F 3Q5FA 5D4SA 4B09A 1B59A 1J59A 2DYSH 3RYRA 3ZQ7A 2VBYA 4CH7A 4RB3C 2VUMJ 3CUQB 1ZR4A 3E6CC 3P9KA 4ENKA 3H35A 4U7BA 4Y17A 4DBQA 2OQGA 4HF2A 1Z6RA 2WAQN 1FEXA 4HQMA 1U8RA 2EIMH 3H0GJ 1QZEA 2HKOA 3AL0C 2HPIA 3CF5F 3CP8A 1FC3A 3CP2A 3M07A 2VPRA 3CCVI 2IW5A 2ZO4A 4B1RA 2QEXI 1BJZA 1LEAA 5J1UA 3SEZA 2F5DA 3KIOA 3J80K 2ZCWA 5HS7A 4RB0A 2Q2EA 5A2QZ 2X6WA 1X3UA 5K5RA 3HG9A 2M34A 2V79A 3L7WA 4JX6A 4QIWN 1W5CC 2O8KA 2FQ4A 1BBYA 1FY7A 4QPOA 2ZNZA 1Y1VJ 2UUZA 3BR6A 2F4MB 1R1UA 4ITVA 3QOPA 1JT6A 1GT0C 2JTVA 1ENHA 2QSFX 4IPAA 2E1CA 4GDFA 1BA5A 4A3JJ 1YS7A 2XKPA 2AXLA 2VE8A 3W2AA 1QU3A 3CESA 3H5NA 2HVSA 1OMIA 2Z99A 5L3BA 2EZHA 4BXUA 3C3WA 4KJZA 3JW4A 2OUMA 4BQOA 4ZYHA 2UXNA 3JSOA 1Y0UA 2E2JJ 1VZ0A 1BJAA 3KEYA 4EATA 1ZH5A 3SDBA 2EK5A 3M8JA 2M4KA 4ESFA 3QU6A 3S2WA 3V4GA 5M5XJ 3WGIA 1RUOA 4I99C 3HOYJ 1YW8A 2HGCA 1A31A 5IT3A 1XMKA 2ZJ2A 1GV2A 1JHHA 5IYDJ 3JRAA 5E3NA 3FMRA 3TO7A 1G59A 2FJ1A 4XKVA 4Y3OA 1ETVA 5BOXA 3JAMZ 1RKTA 5IYBJ 3I3LA 3IH2A 4G6DA 3K4NA 1ZARA 3ZQIA 1YE9A 1MH4A 1U0JA 2L7ZA 5EEGA 5F1RA 1MNEA 3WU0A 2CWEA 4NB5A 3LSMA 3ZMUA 3AG1H 2HOAA 1WI9A 3OYCA 1KQ8A 1LDKB 4OMYA 2NVTJ 3G71I 4M3EA 2AHQA 2PX9A 4LK1F 2QKLB 3CO6C 3E6DA 2NS0A 3VDXA 1K78B 1O7FA 3MVPA 4J19A 4A3KJ 1S29A 1EA3A 3CO7C 4IO9F 4ON0A 2E1NA 4YG2F 1UB9A 2JRTA 3SZGA 5D8KB 2V1UA 1F43A 3G2BA 1SFEA 3PL8A 5J8FA 3GZ5A 3ZQHA 2OCEA 4ANJA 2P5KA 2R5YB 2ACJA 1W0UA 3G73A 1ITYA 2WADA 3OWTA 4O5VA 4KMUX 1FWZA 2K7LA 4IHVA 3BOQA 3E1SA 4IOCF 4I09A 4C3JJ 1I5ZA 4A0ZA 4BAYA 2CQXA 2BY1A 1MDMB 2NS8A 4MQVA 5IT9Z 1SAXA 2W25A 2ESNA 2LBFA 3IKTA 3W6VA 2X51A 1J7KA 1W4MA 1U5TC 3HOTA 2K86A 3QP6A 1YITI 2F5EA 2JK3A 2KZGA 3I9V2 3HIFA 4EJTA 1DGWY 1GHCA 1IN5A 4CICA 1S7AA 3SJMA 4XLFA 3L9FA 3FBNB 3JRCA 3Q9SA 1XSDA 2BW3B 5IPAA 1MBKA 1WRJA 2HI3A 1BOAA 1X3WB 3RJPA 3VYUB 2DK5A 2ZC2A 3OL3A 5CVRA 4JX4A 3K69A 4NQWB 2VL8A 3FXUA 5GPAA 4Y15A 2R7FA 2XF6A 4IEJA 1I3AA 1BR1A 1HKQA 1R7JA 2D45A 3HUGB 1FBSA 3DTEA 2G7HA 2IGOA 3N4MA 2Q0OA 1EJ9A 3HTUA 2VKEA 1IN8A 2AQFA 2WTEA 1BN5A 4E7HA 2VN2A 4C3HJ 2RDPA 1IXRC 1I39A 5EZGA 3C18A 5F0FA 2CFXA 3BR3A 5H6QA 1FOYA 1HA8A 1MBJA 5DCMB 2OF7A 3D5SC 2XAFA 3MWMA 3OR2C 3A1YA 3DV8A 5TISC 3L00A 1SMYF 1K61A 3M3YJ 5FKLA 2A3SA 1FX7A 2NNNA 3OYEA 4PZJA 3ZN1A 2DFEA 1I27A 2FBKA 4RGRA 3GWZA 5E1XA 4N9IA 2YS9A 3RZOJ 3OYBA 2KFDA 2FE3A 2Y69H 2CQQA 5JVTA 3VYTB 3FXRA 1UZCA 5HVQC 2DLLA 2IGMA 1X1DA 2XSDC 4LIVA 3PQKA 4A3LJ 2DOAA 4L5EA 3E5UA 2E1MB 5EF6A 2HDWA 3H9GA 4KN7X 4FX4A 1UAAA 2X1EA 4BBRJ 3PJRA 1J9IA 4G6TB 2HQAA 1ETKA 1GLNA 2LNBA 3MMYB 2BV6A 2WV1A 1ZRDA 2ZNYA 3PNTA 2K9NA 4U0WA 2FUG2 3E7LA 5GAGJ 1WJCA 4QSHA 1SANA 3H3UA 1T8IA 2ISYA 5FKKA 5H6RA 2QGUA 2XAUA 4CCNA 3U1KA 1KU3A 4PSWA 5J4YA 3PSFA 5ED4A 3K0LA 2EA4A 3IWFA 1PVEA 2RVCA 2Z5UA 4U7DA 2HOSA 2X6YA 4CO8A 2BVLA 5K7HA 3KYCB 4M73A 4J00A 4B48A 4AIJA 3FM5A 3KZYA 1MKMA 3LSJA 4RAGA 4G7HF 2IXSA 3BR1A 5TRDA 2VC0A 3FMQA 3GCMA 5B1AH 5HLHA 2LKXA 4FQGA 2YR2A 1U6GA 2R5ZA 5E79C 2F48A 4KIGA 2KT0A 4A0XA 3OYGA 4Q5SF 1FOXA 4W1UA 1IO2A 2DYRH 2BZTA 4NBQA 4DQ2A 1VFCA 2XHKA 3CLQA 1BI3A 3F8NA 3EQLF 1VNDA 3FXOA 3ABKH 2Q1ZB 3OOUA 2BBYA 5D5XB 2X6OA 2F4IA 4BNCA 3BZCA 2R7VA 5L3FA 2M87A 1SVOA 1QZYA 2DCEA 5LGTA 4OIPF 4P55A 3SDGA 1CF7A 2MD5A 2P5LC 2NOGA 4RM3A 4UUSA 1T6SA 3CTAA 2HNHA 2O03A 4D9JA 2CFOA 3DCFA 5TJJA 1Y0NA 3D5LA 2Y9ZA 3A01A 5FD5A 3GTPJ 1D8KA 1K4SA 1USSA 4ZH4F 2Z2SB 3I58A 5DUKA 3JRGA 1JTXA 2X6XA 5LGUA 5HDNA 1A04A 4PCQA 5C44J 4ZTFA 1PUFA 2MBFA 1TWFJ 1B9MA 3QP5A 2PJRA 1YHQI 1V4RA 1HOMA 1TP4A 3R6SA 2E35A 4W97A 3I54A 5EYRA 1ETXA 2DODA 2DA5A 5E1ZB 3WTYC 3I71A 3ECHA 3J81Z 2DJIA 2Y2ZA 3C1DA 4U0VA 4S0HB 2VLAA 1VQPI 2DPUA 2PLYA 2RC4A 2EH3A 5EZHA 4XLCA 1E3OC 4CGZA 4A3IJ 1P4AA 1OCZH 1R58A 1JKOC 2CV0A 4MHGA 4L9TA 4HNVA 2JWTA 4YIRX 2L9SA 4A3DJ 5FKMA 2EV0A 1KU7A 2FMLA 2P5VA 2WB1A 5GADJ 4RMNA 4WK8F 9ANTA 1BOBA 2FSWA 3K1MA 1QA6A 5CKTA 1SD5A 2ME0A 5DM7F 1U9NA 3RKWA 5DYMA 1BR4A 2VONA 2BHYA 2ZXJA 2ZMEC 1UHMA 3HSRA 3ABLH 5FJ8J 1TLHB 2VODA 5DEQA 5FD6A 1UELB 5JHUA 1IDZA 1UG2A 3DBRB 1LVAA 1X2NA 2E5ZA 3GFLA 1ZG3A 4BHPA 2DMPA 3SEQA 1XSVA 1BIAA 1RPWA 4Y33A 3BLYA 3ROUA 4JYKA 4AUXA 4C2UA 4M9SA 2JA8J 3CDHA 1WJFA 4HDVA 5GTIC 3RIRA 2LDUA 2DA2A 4H0EA 4ASNA 2O61A 1T38A 1OFCX 2OZUA 4OIOF 3BR2A 4HSTA 3QYEA 4MLOA 5J8CA 4WXCA 3PO3J 1X19A 3VEPA 2AQEA 1I1GA 4LLLA 5ERIA 4V19K 2QKMB 1POGA 3CCJI 1FIAA 4ETSA 3UR3C 4M6VA 4AU7A 1GXQA 3CQZJ 2OU2A 5EEAA 5FLXK 3FHZA 2WY7Q 3REOA 3IRRA 3A4CA 3QPSA 2X9DA 3CCMI 2RV8A 1U2WA 4G7OF 3CUOA 2R7TA 1ZYRF 3Q0WA 1XN7A 3KX2A 4C2TA 4A5NA 2R7SA 1X3ZB 2R7ZJ 2K27A 3DWLE 1WPKA 1FJLA 1SD4A 1VQ6I 4RM2A 4XRFA 2A05A 1Z9CA 4QTRA 1FMVA 2H1LA 2BY2A 2LK2A 1OCCH 2GXAA 2HXIA 2D5VA 1J0RA 1S6LA 4HV5A 2Z1DA 3BG5A 2V1XA 2XKOA 2QBYB 2K3PA 4XKBA 2XV4S 1OYWA 3TDUC 5D5VB 2KIUA 1ON1A 1IUFA 1XS9A 4XBFA 2FXAA 1B6AA 2X48A 3SFIA 3JRDA 1ZELA 4RA2A 2HWVA 2E2IJ 2M1BA 3I4PA 4HYEA 4XOPA 5LRSA 2PQ8A 1BI2A 3KP5A 3M1EA 3G3ZA 2AS5F 3TP3A 1TWGJ 2RGVA 1U9OA 1M1EB 2HYFA 1Z21A 3KP4A 1E0EA 1LE8A 3K4MA 4CUGA 2V6EA 4ZDOA 1TWHJ 4JK1X 1DGRM 5KVRA 3FDYA 1YOVB 4M9XA 4GRIA 3C2HA 4UV8A 1IRZA 2LR8A 3W2VA 1HSJA 4C3IJ 2BY3A 3K7AJ 5E3OA 2A69F 2DFIA 1MW7A 2ID3A 2K9SA 3E97A 2VOPA 1L3LA 3A0BC 4NDLA 1C0WA 1I6XA 5ICGA 1T08B 4HSRA 5HDKA 4B3XA 3GFMA 1STZA 3M9AA 2QWWA 2VOOA 3LSHA 1BC8C 3IH4A 3R0AA 4FT8A 4AM3A 1G6NA 3F23A 2D1VA 4Q4ZF 4GO1A 2EQRA 3W6JB 2CW0F 4A93J 2Q8KA 3S16J 1D1AA 2WBMA 4P5OA 1Y6IA 1BW6A 1Y8QB 3M8FA 4E7LA 4BDZA 2CUFA 3LQQA 4ZTJA 3OYNA 1JKQC 4YELA 3HOXJ 4LGWA 3HOWJ 2ECBA 1FBQA 2DI3A 3HRUA 1OCRH 4HNUA 4S05A 3BPVA 3TDZC 2H6CA 3I59B 2DAOA 1W7PB 2R7UA 4HZFA 2QQ9A 2RNJA 5GAEJ 1HF0A 2LC2A 2XAGA 4WXHA 1K7AA 1RETA 2V7FA 2XAQA 3PIOF 4CSWA 3B73A 3HOUJ 1LVKA 3WHCA 4CYCA 1QPIA 4HX7A 1F4KA 1G3WA 2WAFA 2F6CA 2EFNA 2HQRA 2K02A 1R1TA 2Y0MA 5ICFA 1I50J 3A03A 3WTXC 3KZIC 4EGZA 1E2XA 2PJPA 1HBXG 2IGKA 1YX5A 4HG2A 5M5WJ 5KAIC 2MABA 5LRRA 2F5VA 1WVRA 3O6BB 2P7VB 2BXZA 2XGEA 2A5WA 2Y0SN 2JSCA 1R49A 2BEOA 3OR1C 4IQ4A 3OY9A 4E7IA 2CG4A 2HPMA 5EEHA 4C30A 5EG0A 2KQRA 3RQIA 5D4RA 4KYWA 2VQHA 3V42A 3R61A 2YU3A 2W84A 1IN4A 4IRIA 4XN0A 1W0TA 1SC7A 3BG3A 2M0CA 2XGXA 3KEQA 2EFQA 1LEBA 5BS6A 4A6EA 1S5LC 2JPCA 2QF7A 2AXTC 2CO5A 1V5FA 3B6CA 3S32A 4IQJA 1BM9A 1VQ5I 1MSEC 1GUUA 4DZJA 2EJRA 3FKIJ 4BQQA 3HC7A 4ENNA 2VKDA 4DNCA 4EM0B 2CQNA 2V9VA 3WGGA 3Q0UA 4FTHA 2C6YA 3FWEA 3VFZA 3GTOJ 1QVTA 4EM2A 2MC3A 2LF8A 2QENA 4A12A 3IL2A 3LWFA 3LAPA 5B66C 2DN0A 3DEWA 3FBIB 5C4JJ 1TW2A 2DQRA 3RI4A 3N05A 4BXFA 3S14J 3ZQQA 3J80Z 1DP7P 3BWGA 2DTRA 2XB5A 2IPQX 2KIQA 1IDYA 3B6AA 4F92B 1SFOJ 2IS1A 1K78A 3PFYA 4LK0F 3BR5A 4JOMA 3VB2A 2FMYA 3TGNA 3BJAA 4UB8C 4EQQA 2ZSIB 3EUKL 2LY2A 1ETYA 1O3SA 4LMYA 2OZ6A 3O8HA 5D8LB 1XCVA 2VQGA 4CXFA 2JQ7A 3MN2A 3OYAA 1JI8A 1I6HJ 1B8IB 1EH7A 4B4CA 4M74A 3DU6A 5FKOA 1E17A 3TOBA 3CC4I 2CW7A 2L7KA 3MZ8A 4QWQA 3TO9A 2DQLA 4UB6C 4PJ0C 1LPQA 2QYOA 2Y75A 2FNAA 5ICEA 4MQ9F 4L9NA 1QO0D 2XF5A 1K83J 3V8JA 1WJEA 2WB1N 4R8HA 3I53A 4DYRA 1EF4A 1XGMA 2NS7A 1MNMC 4CCKA 3OS2A 1R71A 2V9KA 4CCMA 4I2OA 5GAHJ 3V8LA 5FFXA 4ZYEA 4KDPA 4XLAA 2VPLA 5HS9A 2WV0A 3S3NA 3L2VA 4YFNF 2LKSA 1XGNA 5M3MJ 3H3VK 2BW3A 2DMNA 4IOAF 4Y4RA 1GDTA 2G0EA 1XDUA 4LIUA 3D1NI 1ZN2A 2X85A 2V1NA 5FB2A 2LD5A 4BGDA 5KNLA 3BR0A 3AFHA 4N4OB 5D6EA 3ONQA 3I4NJ 1ERDA 2K5CA 1EV7A 4V2FA 3LNQA 2LKPA 2KJBA 4BHCA 3G4SI 5DV5A 1DUXC 3BT9A 1BI1A 1YS6A 2GM4A 4HEA2 4S04A 4YIFA 3KPHA 3ULQB 4ZYAA 3CUQC 1OISA 3GZNB 2FQ3A 4M6YA 2CS3A 2HVQA 4HBLA 1VQ7I 2LLKA 3AAFA 4M71A 2EPFA 2YX4A 4ZZDA 1IF1A 2V1DA 1VQOI 2OTLI 3K4BA 4BACA 2R4GA 2WY8Q 4XQFA 4WF2A 3K6GA 3BZKA 4DOZA 1OYIA 1YRNA 2K3FA 5IYCJ 4ABZA 2ELKA 1WJDA 1KQ9A 4M3GA 1SFUA 3JRBA 1KQ0A 4IRHA 1R5ID 4FASD 4UHTA 1O4XA 3JCUC 2XGCA 4G94A 1S3JA 1R9TJ 3S1NJ 3OS0A 2KRHA 2TDXA 2FBIA 3IKVA 4PSXA 3C2BA 5CQEA 3PO2J 1D0ZA 3CZ6A 2XB0X 1V5EA 1H9GA 2OBPA 3T5XA 1ZGAA 3HJEA 4XKWA 5LD2C 3LQRA 1CGPA 1J5YA 2LRDA 4UVBA 3DF8A 2X4HA 3Q9VA 1XB4A 2NOJB 4E7SA 1NHAA 4RGUA 1Q1HA 2NAZA 2STTA 3ZPLA 4AIKA 4XONA 2K9MA 4GXOA 2Z9OA 4LG0A 4XRSG 4JQFA 1AU7A 3QODA 3TQNA 4LG3A 4IRGA 3WG9A 3BCBA 3L2WA 1MMNA 4P9FA 3K4KA 4OAYA 2IT0A 2PMHA 3BG9A 2K9LA 4BUPA 3CC7I 4A3CJ 1IJWC 2IVMA 2HYGD 1ZR2A 5H2FC 3K4CA 2ZMEA 2F5CA 1YFHA 1ETWA 4XLNF 3VYRB 4EJOA 4FHTA 1R23A 2RN7A 2UWMA 1X2MA 2XC7A 1AHDP 2EV6A 1ON2A 1TQMA 2RREA 1XMXA 3HXLA 5TGTA 2BHZA 2KLOA 2B9SA 2VKHA 3A02A 1H8AC 4F91B 3E5XA 2M8GX 1LKXA 3ELKA 3K1NA 4WX9A 3E6MA 5DUIA 5D5WB 3FIWA 2QQAA 1SFKA 4UY8I 4A3EJ 3EYIA 1YIJI 2HYJA 1A6IA 2V6CA 3ZR8X 2CGPA 3H0DA 2KRCA 2K4BA 2EFWA 1V54H 1BL0A 2W85A 2W4SA 4IXAA 5HS8A 1T39A 4F52A 4DIQA 5HODA 2MH9A 4RS8A 3IC7A 5F08A 2JN6A 2O0YA 3DU5A 3QAHA 3CJQB 1USTA 4PJLA 4HA8A 1P6RA 4J01A 3CCRI 4KISA 3RQ4A 3LAJA 2ZXHA 2W7NA 4LD5A 5K5QA 1XX5A 2KP6A 3QPLA 3EUHA 4I76A 4CCJA 1OPCA 1TT0A 3K4LA 3RKXA 2Y9YA 2ZFUA 2R7OA 5KK1A 1H88C 4A69C 3HPHA 1E3HA 1ZG5A 2XUBA 4OU0A 1VQMI 3BJOA 3QYFA 3SHFA 2DA3A 2E60A 3EETA 3R4KA 3ZMVA 4EV0A 3PQJA 1TZLA 3MD2A 1A35A 2KMUA 1R00A 1Z91A 1P2FA 1T0FA 2CUEA 2L7FP 2YU9J 2EZIA 1VTNC 1SAUA 4OAZA 3SZPA 1HDDC 2OAZA 1J09A 1OLTA 4BJ5C 4Y13A 2CU7A 2Y0SA 3ZMSA 1LDDA 4BS9A 3E3VA 2DU9A 1MZBA 2CH0A 3ZOBA 5FLVA 3IAS2 4KUMA 3FXJA 2MFZA 1RESA 1JT0A 1T98A 4MEYF 2KL4A 3DKWA 3VPRA 5EJCA 2HQ5A 2XDVA 3HRMA 1MMGA 2OJED 2LSOA 5CJ9A 3BDDA 1D0XA 5BQTA 3E0JB 4IHXA 2R92J 5ILSA 2E19A 3J7AO 3KYDB 2VJ4A 4UXNA 3U9GA 2XVCA 2MA3A 2ZKZA 1H89C 4DJAA 1FNNA 4PJJA 3BROA 1RNLA 3MFKA 2Y30A 3NEUA 3JTGA 1IG7A 1WFXA 3WODF 3PM1A 3HRTA 5E8IA 2GA1A 2LYCA 2KHMA 1NK2P 4OMZA 4BQNA 2A6TA 4M3FA 4D0PA 4KA4A 2D2WA 2M30A 1RC9A 3LL7A 4LJZF 2Y31A 3VODA 1K4TA 3ZMDA 1Z7LA 2DT6A 2O8XA 2IS6A 2GAUA 1R5GA 1X1BA 4BXXJ 1LQ1A 4Z2YA 3IUOA 2XASA 4LFUA 1IAWA 3DBHB 5GTHC 1YIOA 4RAZA 3CCLI 1ZAOA 2HEOA 4C2MJ 1FTZA 3IRQA 3PFIA 4ESBA 1W1WE 3S17J 2M5WA 2CQ7A 3CCEI 4OWRB 1MD0A 1X4OA 3CDIA 3DEEA 2VBWA 3F8BA 3KP7A 4I0AA 2BXYA 3WTVC 2OPTA 4N9HA 2GXGA 1NG7A 1MSFC 1BW5A 2XRNA 5L3CA 4U0YA 2DA4A 3M1CA 2ZJRF 2VT3A 1MNDA 1PUEE 1BR2A 3F0CA 1Z77A 1ULYA 4ZJZA 4G6QA 4BY7J 3OYDA 1P92A 2ZJQF 3ZGKA 3KZZA 3CMMA 3LOCA 2DFFA 2EFPA 2QUFA 2COBA 4ZDPA 4Z6YA 2RNGA 3T1BA 4HX8A 3P5JA 4IHSA 2YSRA 2XF7A 1ACIA 3F22A 2VJJA 1O3RA 3NARA 2P6TA 1YJNI 2B7EA 2B63J 3BG6A 4FE4A 2QA4I 4PK4A 1SD7A 3G6EI 1AOYA 4GGGA 1XSXA 2EINH 1HW5A 5F27A 2X1DA 2KKOA 2E7XA 4OIQF 4PDKA 3OV8A 4KICA 4P96A 1WCMJ 3MZHA 3F21A 4B44A 1JXSA 1JUPA 5IOZA 3S1MJ 1IXCA 1N75A 1PJRA 5DD4A 3OSFA 2A6EF 3V8KA 5IP9J 4O3MA 3I4MJ 1I1SA 1Z0XA 4E70A 5K5OA 1HLVA 1XTAA 3IH3A 4HF1A 2NVYJ 5LEJA 3FISA 4PJNA 3W2WA 3OOPA 5F64A 5ICCA 2VJ5A 1Z6TA 3PIPF 1EH6A 2MLGA 5CPRB 3GMEA 2YUSA 4WCGA 4JP0A 2JSPA 1AKHB 2HVRA 1WHUA 1ETOA 2DMQA 2H27A 4F3QA 5LHGA 5BMZA 5FLXZ 3VWBA 3L1PA 2LFBA 1X1PA 4KIBA 4BJ6C 5ILUA 2BOLA 5HNFA 4BU2A 3KYLA 1J2XA 4X6AJ 3SXYA 5B3SH 2E2HJ 2PBIA 3GEZA 3EUHC 1S9HA 4MGRA 5J1YA 4KFCA 3G1MA 3ABMH 4AIDA 3MCZA 2PMZN 2QLZA 1PUFB 3BY6A 1QHGA 4QLCU 3JRFA 3BG7A 2PJRB 3ZMTA 2GLOA 1SD6A 2M3AA 4HLXA 2JMWA 5DM6F 1H9TA 3L2UA 2F4OB 3ZP5A 2KISA 3OSGA 2HKXA 4FX0A 1FMWA 2RKHA 3L2RA 1T0FC 5ILVA 2L5QA 3KE2A 4B3AA 3K70C 3BTCA 4CHUA 3DP7A 5K7ZA 2KPMA 1D1CA 3RDIA 1IRGA 4MNUA 1A5JA 2JRMA 1QVUA 3L2QA 2OA4A 4M3BA 4IVNA 2QSGX 3OMYA 2DJNA 5CVVA 1N78A 3P7NA 3HHHA 3S3MA 2GA2A 1F5TA 1WZ2A 3KCCA 3WG7H 3MKZA 3S3OA 3U1DA 4TV7A 2A6HF 3FK6A 3ZMZA 5B5EC 1AWCA 1D1BA 4F7ZA 4A3FJ 1MBHA 1IC8A 3KLOA 5HNHA 1YYVA 4HF0A 1ZRCA 4I02A 1DDNA 4PJMA 3S2DJ 2LF7A 4BEHA 2WC2A 2QQ8A 4Y7NJ 3J7ZI 2DA6A 3WTSC 1TT5B 1YLFA 3I55I 4IHWA 2FRHA 4AVZA 3CMAI 1G3YA 3M7GA 4UV9A 2EA2A 4QPQA 3M4OJ 1OJLA 2DT7B 1FBUA 4BYYA 4DZPA 4RAYA 2A68F 1FP2A 1S7EA 1B1BA 2WAEA 4X0GA 3GTQJ 4PFOA 2CMPA 4BHBA 3F8FA 4M9ZA 4NC7A 3KFWX 2Z3YA 2E5NA 3ABUA 5EDNA 5LGNA 4AD9A 4XL9A 5GP9A 3MKLA 5J47A 2DO7A 1NK3P 3D0SA 1X1CA 3RKYA 1OKRA 4G7ZF 2XAJA 1JUMA 1VI0A 2M0MA 1R36A 4A3MJ 3V7SA 3S1QJ 2I5UA 2K9QA 4G9YA 5IOYA 3TP0A 1OCOH 4HAMA 2DDBA 1JTYA 4FCYA 1X58A 1FYLA 2DMUA 2RQPA 4BDYA 5C3EJ 1Z1DA 3B02A 3CUQA 1QHHD 2ZXWH 4HW0A 4XSZF 4AC0A 2HTJA 2AO9A 2F5FA 1RRJA 2FX0A 4NC8A 4KT6A 4Q48A 1DU6A 4BE2A 1HKSA 3TBIA 5LBQA 2H1KA 3P9CA 4YEJA 2HQNA 3AL0B 3ERMA 4A3BJ 5KCMA 1JJ6C 2YX7A 4PGHA 4II3A 5AIQA 1KU9A 3RKQA 2JPBA 2XPUA 3ZXSA 3P9IA 5HLIA 1GVJA 1ZG1A 3JR9A 4IX7A 5EGOB 2CV2A 4UVAA 3ZQLA 4UUTA 3FXQA 2CUZA 3ERED 4GFBA 3K9TA 3SYTA 1N25A 2JA6J 3HOZJ 3CMYA 5FROA 2IA0A 2IA1A 2ZBKA 2QCOA 3WTZA 2FU4A 2ID6A 4MFEA 3DKYA 2DOEA 1IRFA 1R4NB 3DLAA 3MQ0A 1OQYA 2O5RA 2GZWA 1LB2A 1REPC 1OR7C 2CJJA 4Q47A 2H09A 3K10A 1RUNA 3OYKA 2O9LA 1MBEA 5E20A 5F1JA 3K70D 3ZQGA 3HYIA 3FF5A 3ASNH 4UUVA 3BCAA 1UHWA 2L9VA 2M8EA 4E6KG 3GFIA 2E1OA 3K2ZA 2QQBA 3H3ZA 4L5IA 2ZXIA 2VIXA 4R79A 4RB2C 3R0JA 1FYKA 2X1CA 5J40A 5JLXA 2XIGA 2IEKA 2A61A 2IAIA 2KIMA 3T0YA 2N8GA 3I64A 1JE8A 3CCUI 1KGSA 3WE3A 5K1YA 1G3SA 3HSEA 1MGTA 3FXLA 3VSKA 3KEOA 3GTKJ 2VBZA 2L9RA 1QQIA 1B72B 1T95A 1B4AA 3QYBA 4KT5C 2XROA 1RR8C 1D0YA 2GIVA 3BTIA 2MC4A 2EFOA 4XR6A 3V7CA 5CYVA 4NUBA 4ZC3A 3DLLF 1T2KA 1H0MA 1J75A 3ABTA 3RPUD 2UZKA 3O3KA 1Z3YA 3AKZA 1ZLKA 3LFKA 2R7RA 3DPLC 2PN6A 3MEXA 4MTDA 2VQLA 2V9PA 2VASA 3NWTA 3V7RA 2ZSHB 1GVDA 3L2CA 2PI0A 4EJUA 3RYPA 2UV1A 3VOEA 2W48A 4HRIA 4N4NB 3H92A 1ORKA 1TWAJ 2RQQA 3AG2H 2ETHA 2BE5F 3K4JA 1FOKA 3H5AA 3CMEI 1YW7A 1QNTA 3HZJA 2P6SA 1UMQA 4CA0A 1YJ9I 1YQAA 3H1CA 3S1RJ 3COAC 4D7NA 2GOMA 3CCYA 4EJWA 1L0OC 1E3PA 1O7LA 2CSOA 3SZTA 4F93B 3PNYA 3Q3SA 2KJCA 2IP2A 3ESWB 5J4VA 3LSTA 2EBIA 1OCPA 5A2QK 1VQKI 2DMTA 1Y8RB 2CW8A 3TOAA 4D7MA 1IN6A 1S72I 2R5YA 1WH7A 1IGNA 3H9QA 4CCOA 3GTJJ 1G3TA 3SQNA 3CCQI 5KHDA 4HPQA 4ZDLA 1KYWA 2KDOA 4DW6A 2R7QA 3OYHA 4CYCB 4HQEA 1MDMA 1DU0A 3WTTC 1FOWA 1BC7C 2JVGA 1U5TB 3DBLB 2W57A 3LA2A 4RGSA 5FGMA 2NRAC 1QGPA 4AYBA 3WE2A 5CVJA 4P9UA 4WXDA 3GFJA 3W3CA 1LNWA 4XNFA 5LEKA 1WWXA 1XCBA 3UNGC 2OC6A 4XRMA 5EG0B 1W36D 4D1QA 2M45A 4A2UA 4HX4A 3O2PE 1JKRC 1WGXA 2M4GA 1ZRFA 2L02A 5B1BH 2K4JA 4NQWA 1W5TA 2E34A 2G7UA 1IXSB 4N0BA 4B8XA 5CVIA 1YI2I 3HUGA 5BNGA 3GF2A 3NRVA 3ECOA 2BY0A 2OCCH 3RTRA 2GBYA 2CV1A 2JUGA 1A6QA 2IRFG 3JAMK 2OTJI 4OIRF 5DTDA 2NXNB 2O6GE 3FKJA 1KU2A 3OYMA 4LB6B 2LG4A 1AA7A 1K6YA 1R22A 2CYYA 3HBLA 1DQUA 2VQCA 5DCMA 4IHYA 1LFBA 4YRVA 4MO7A 2DDAA 1OCTC 4XKCA 3GTLJ 2STWA 4BKXA 1KONA 4C9YA 2VC1A 1TQPA 3IAM2 3K1PA 1WJ5A 3OIOA 2PMZA 2L4AA 3BC8A 4E7ZA 2Q2EB 3DKXA 1WH5A 5LHHA 4BBSJ 2D1HA 4A3GJ 4HNTA 4AVPA 2M7AA 3OL4A 3HOSA 2FEZA 1SMTA 3JRHA 3F3XA 1JJ8C 5CQGA 1Z7UA 2A5YB 2ADUA 3HGGA 3CJNA 4A0YA 4WWCA 3CJRB 3KETA 3HDDA 4FISA 3QPHA 4E7JA 2OV7A 2GIZA 4II2A 5E1WA 3KP2A 2FD5A 3OIPA 1P4WA 5FRNA 1W7PD 1KA8A 4AWXB 1LJ9A 2HS5A 4L5JA 5JI6A 2VKVA 2DTZA 4LLNA 2FOKA 2QM3A 2I10A 2NVXJ 3U2RA 2EZKA 1D5VA 4IJAA 3HKZA 1P7IA 2JUCA 2XAHA 3FXKA 1R4MB 5DD8A 4YFXF 5IT9K 4IL6C 1T33A 2COMA 5LHIA 3KLNA 2MGQA 3S93A 4EVIA 2P8TA 1LFPA 3WU2C 2HZDA 4KIFA 3LSKA 5E17F 1UCRA 3WHBA 4BH9A 4L9VA 1G2HA 2L0KA 2HU9A 3BJ6A 1Z67A 3BQZA 5LLQA 1VQ9I 4P1WA 3TW7A 5HDGA 3EUAA 4BE1A 4XSXF 3QOEA 1LFUP 1FSHA 1FYMA 5IP7J 2HTSA 5FFZA 1Q1VA 1TL8A 3GVAA 4UVCA 3H9JA 3U21A 2HDDA 4CYDA 4R1HA 2NNYA 4M72A 2M9HA 3TO6A 4IKFA 3D5RC 5FKNA 2ME6A 2EZLA 2GOXB 4KITB 4EM1A 2PEXA 4MFDA 3EYYA 1YX3A 3ISPA 1SVMA 3TW6A 1ZHFA 1G8XA 3PNVA 4FE7A 3F8CA 1D5YA 1QZZA 2QZ8A 4XORA 2O3FA 2VT2A 3TKYA 5D5UB 2KDZA 2R3SA 3RPQA 5LFAA 1V3FA 3DFGA 2DXIA 1NH3A 1DP3A 2IS2A 3BPXA 4ZYGA 2LP0A 4O6JA 3I5UA 4EGYA 3PSIA 1PP8F 4Y52J 4L0YB 2W00A 1ZGWA 1YRNB 4UNOA 1DPUA 3DTIA 1ZLJA 4D5CA 3F9KA 3HHGA 1PP7U 5DCFA 4ZZLA 5F0CA 4M6XA 4PFPA 4DBRA 2LVSA 5JFRA 2B0LA 2P7CB 4XK4A 1ZREA 2GQQA 3NAUA 2VJIA 2L7MP 3H36A 3MKYB 2L01A 3FK7A 3HB9A 3PUBA 1VQLI 3DPTA 2WWYA 3GO5A 6PAXA 4IHTA 5FO5A 2VI6A 1ZQ3P 4BQAA 1XC5A 3AG3H 2L2OA 5AONA 2LBFB 5JR3A 1WJAA 1IUYA 4I98B 3CCSI 2GWRA 4XLHA 4CZZA 1G4DA 1BIBA 1A36A 1MH3A 1TWCJ 2A07F 1FP1D 4CCLA 1S7OA 1XMAA 5JHFA 2VBXA 4LG0B 2DA7A 2UXXA 2JA2A 2PMUA 1CQTA 1RKWA 3ZCOA 3H5RA 4K2EA 1K6OA 2E36A 2MW8A 1U8BA 1KYZA 3G1LA 1YO5C 1TNTA 1ONVA 1TQIA 2HZTA 4H4KC 4OOIA 2FF4A 4RDUA 1TNSA 2DBBA 2ZJPF 3OYJA 2OQRA 2ZMEB 3HL2A 4A5MA 2XSJC 3BZ6A 5BPDA 1Z3XA 3Q0VA 2MSYA 2KIFA 3RPUA 3GX4X 2V4JC 3CD6I 4X1EA 5D6FA 2KRFA 2H8RA 5BPIA 1MJ9A 3KP6A 2NVUB 1DPRA 1MMSA 4IF4A 2IS4A 2FA5A 3HTSB 3I56I 4B43A 2HOTA 2K85A 1JUSA 3S2HJ 2R7XA 3W6KB 2DOFA 1VQNI 2EB7A 3LFUA 1IV6A 3S15J 3ML6A 1X4PA 4G8XA 3LSGA 1P4XA 1EH8A 1RZ4A 2E7WA 2Y48A 4RGXA 3X2QH 2VE9A 4G12A 2WAQA 2YPRA 1AKHA 2G9WA 2M7BA 1HDPA 1Z05A 3ASOH 2ZB9A 2E1MC 2XPVA 4D5FA 1JGSA 2R93J 2BVMA 4BY1J 1R5HA 4YIIA 2L4MA 2I8DA 1ODDA 2P81A 4YFKF 1Y39A 1O3QA 3HOVJ 1HC8A 5CVUA 4E4HA 1EKEA 1MMAA 1Y56A 3PUFA 1FT9A 4LLGF 1N77A 4KMFA 4XOTA 3I0TA 5C4XJ 1OR7A 2QBYA 1BI0A 2FNPA 2QVOA 4HOBA 1QPMA 2WA0A 3WGHA 3J81K 4BJTA 1IZ1A 1ETQA 3A0HC 3QPTA 4XMYA 1X1AA 4XM3A 1HQCA 5E8GA 3OS1A 1WJBA 1W5SA 4GYIA 4XIDA 2P0WA 2L9NA 3QQAA 3MKWB 1TC3C 4MTEA 3JRIA 4EEFG 3TL4X 1FZPB 4AYBN 1FTTA 5CLSA 3JSPA 1HXDA 3F72A 2W82A 1XD7A 2R5ZB 2TCTA 4CDGA 2EIKH 2GXBA 4EMSA 4F55A 3FMSA 5E18F 3LSRA 3OIQA 2X0LA 4EJVA 3LSIA 2DK8A 2VXZA 3O8GA 3GUDA 4LOCA 1UHSA 1XGSA 1NTCA 2ESHA 4XICA
chains in the Genus database with same CATH topology
2E1MB 3L2VA 2CV2A 2BW3A 2HDWA 2CUZA 3H9GA 4Y4RA 3SYTA 4BE0A 4LIUA 1UAAA 2X85A 2X1EA 2V1NA 3PJRA 4BGDA 5KNLA 5FROA 4G6TB 2MD0A 2HQAA 3AFHA 4N4OB 1GLNA 2LOOA 3MMYB 3DKYA 3ONQA 1ERDA 2K5CA 3DLAA 4RLQA 2R7WA 3PNTA 2O5RA 2FUG2 1WJCA 3S8PA 1OR7C 3K10A 3OYKA 2XAUA 4CCNA 4PSWA 3PSFA 4B47A 4HEA2 3K70D 4ZYAA 2X6YA 2BVLA 3BCAA 4E6KG 2IGNA 3VSLA 2CS3A 4J00A 2HVQA 4B48A 3OYLA 2ZXIA 2VIXA 2W1OA 2IXSA 4R79A 3K4BA 4BACA 2R4GA 2WY8Q 4XQFA 3K6GA 4DOZA 2V26A 2X1CA 1WJDA 3OYGA 2KZVA 4CZCA 4FASD 1R6RA 3OYIA 3OS0A 2KRHA 3RSNA 3VSKA 2Q1ZB 3OOUA 4PSXA 4E7KA 2F4IA 5CQEA 1T95A 1D0ZA 3CZ6A 1P9QC 1V5EA 3QYBA 1D0YA 2LH9A 2R7VA 2MC4A 4XR6A 3EPZA 4XKWA 4NUBA 2DCEA 4ZC3A 5LD2C 2LRDA 3RPUD 1Z3YA 3AKZA 2NOJB 2MYSA 2R7RA 3DPLC 4E7SA 4RM3A 2VQLA 1IRXA 2VASA 3NWTA 2ZSHB 2HNHA 1PYVA 4D9JA 2CFOA 4XONA 3DPUA 2UV1A 4HRIA 4RLFA 4N4NB 5HLTA 2K9MA 3D5LA 3ZRGA 3FHNA 3IP4B 4JQFA 3QODA 2RQQA 4LG3A 3K4JA 3BCBA 3H5AA 1MMNA 3L2WA 2Z2SB 1MMDA 3K4KA 4OAYA 2K9LA 4BUPA 2X6XA 3A2KA 4CA0A 3NWSA 1V5GA 2GOMA 3DTKA 4ZTFA 3K4CA 2Z16A 1NG6A 4F93B 3PNYA 2PJRA 3VYRB 4U87A 3RCOA 2UWMA 2CW8A 2XC7A 2RREA 3HXLA 3H9QA 5TGTA 4CCOA 2KLOA 5KHDA 4HPQA 2VKHA 4ZDLA 2DJIA 2KDOA 4F91B 2VLAA 2R7QA 3OYHA 1LKXA 4XLCA 3HPGA 1SFKA 2CV0A 3ZR8X 3H0DA 2JVHA 2KRCA 5FRMA 2JVGA 4FETA 2L9SA 4AYBA 2W4SA 4PUSA 4XLEA 2WB1A 4DIQA 4F52A 3W3CA 4RMNA 1BOBA 3DU5A 4XNFA 3UNGC 3CJQB 2OC6A 4PJLA 1W36D 5CKTA 4D1QA 4J01A 4KISA 3RQ4A 1BR4A 2ZXHA 3OYFA 2W7NA 3J7AY 2KP6A 2M4GA 4CCJA 4NNJA 2VXDA 2VB6A 2ELJA 1TT0A 3K4LA 1UELB 2ZFUA 2R7OA 3HPHA 2E5ZA 3RTRA 3QYFA 3SEQA 2E60A 3C2GA 2CV1A 4Y33A 3BLYA 2JUGA 4C2UA 1TZLA 3MD2A 1UG0A 1WJFA 2KMUA 3LMMA 4LITA 3FKJA 2LY1A 3OYMA 2LG4A 2LREA 1AA7A 1W36C 1K6YA 1DQUA 2VQCA 1SAUA 4OAZA 4YRVA 1J09A 1OLTA 4HSTA 4BJ5C 3QYEA 4MLOA 2Y0SA 1X19A 4BS9A 4XKCA 2AQEA 2CH0A 2QKMB 1KONA 4C9YA 3IAS2 3TMOA 3UR3C 3IAM2 4AU7A 4BL0B 1WJ5A 4BEHB 2CUJA 5HOOA 2WY7Q 2MFZA 2PMZA 3A4CA 3BC8A 2Q2EB 3DKXA 4E7ZA 3VYSB 2KL4A 3CF2A 4HNTA 2R7TA 2XDVA 3HOSA 2M7AA 3OL4A 3KX2A 4C2TA 2R7SA 1MMGA 5CQGA 1D0XA 3E0JB 3DWLE 4RM2A 3CJRB 1FMVA 4IZZA 4DGWB 2VJ4A 3DQVC 4E7JA 2OV7A 4II2A 4DJAA 4PJJA 4XN3A 3OIPA 2Z1DA 5FRNA 1WFXA 3GBGA 2K3PA 4XKBA 2LYCA 2KHMA 4BQNA 2A6TA 4CH7A 3LL7A 3HKZA 1ZELA 3H35A 4XOPA 1Z7LA 2DT6A 4U7BA 4DBQA 2IS6A 1X1BA 3S93A 3IUOA 1LFPA 3AL0C 2HZDA 2HPIA 3CP8A 3CP2A 3LSKA 3SEZA 1Z21A 1E0EA 3K4MA 2HU9A 4CUGA 4P1WA 2V6EA 4ZDOA 1DGRM 3EUAA 2X6WA 3FDYA 4OWRB 3QOEA 4BE1A 3DEEA 1X4OA 4GRIA 3C2HA 3HG9A 3W2VA 1NG7A 4QPOA 2UUZA 3H9JA 3U21A 3M1CA 4ITVA 1MNDA 4IKFA 1BR2A 1MW7A 4ZJZA 3OYDA 3ZGKA 3D5RC 2GOXB 4KITB 3CMMA 3W2AA 1YX3A 1QU3A 3CESA 3H5NA 4HSRA 4B3XA 2HVSA 4ZDPA 1G8XA 3LSHA 2RNGA 3PNVA 4KJZA 2OUMA 4BQOA 2XF7A 4XORA 2VJJA 1VZ0A 3KEYA 4EATA 5LFAA 1D1AA 2WBMA 3BG6A 1Y6IA 4P5OA 3SDBA 3M8JA 4PK4A 4E7LA 2M4KA 2DXIA 1DP3A 2IS2A 4BDZA 2X1DA 4ZTJA 3OYNA 4YELA 3PSIA 2W00A 4B44A 3DTIA 3F9KA 4HNUA 1N75A 1PJRA 2R7UA 4PFPA 4DBRA 1G59A 4XKVA 2LC2A 2VJIA 4Y3OA 3MKYB 3PUBA 2V7FA 3I3LA 4CSWA 3W2WA 3DPTA 4PJNA 3K4NA 1YE9A 1LVKA 1U0JA 2VJ5A 2L2OA 2LBFB 1WJAA 1MNEA 2WAFA 5CPRB 2F6CA 4XLHA 3LSMA 3OYCA 2JSPA 1LDKB 2HVRA 2IGKA 1YX5A 4HG2A 4CCLA 4F3QA 2MABA 5JHFA 2F5VA 3VWBA 2QKLB 4BJ6C 2JA2A 2A5WA 2BOLA 5HNFA 4BU2A 3OR1C 3ZCOA 3H5RA 4IQ4A 3OY9A 3KYLA 4E7IA 2HPMA 3VDXA 4C30A 2KQRA 3EUHC 1S9HA 2VQHA 3V42A 1EA3A 4XN0A 4H4KC 3OYJA 3HL2A 1QHGA 2XSJC 3SZGA 1Z3XA 3BG7A 2PJRB 2M3AA 3G2BA 3PL8A 3L2UA 1V5FA 3S32A 2V4JC 4ANJA 1FMWA 4IQJA 3L2RA 1T0FC 2L5QA 2WADA 3K70C 3OWTA 4BQQA 2KPMA 1D1CA 3E1SA 3HC7A 2VKDA 3L2QA 2IS4A 3OMYA 1N78A 4B43A 3S3MA 2R7XA 3MKZA 3S3OA 2LBFA 3LFUA 1D1BA 2X51A 1X4PA 3HOTA 3LSGA 5HNHA 3FBIB 2WAQA 4PJMA 3I9V2 2M7BA 1DGWY 3N05A 4BEHA 4BXFA 3ZQQA 4XLFA 2E1MC 3FBNB 2BVMA 2BW3B 4F92B 2IS1A 4AVZA 3PFYA 3VYUB 4QPQA 4JOMA 3OL3A 2DT7B 4NQWB 2VL8A 2I8DA 2WAEA 4X0GA 2XF6A 2ZSIB 3EUKL 1BR1A 2CMPA 4PFOA 2LY2A 3HUGB 4NC7A 3DTEA 4E4HA 2IGOA 1MMAA 2E5NA 1Y56A 2VQGA 4XL9A 3OYAA 2AQFA 1N77A 4XOTA 1JI8A 4E7HA 1X1CA 2WA0A 2M0MA 4BJTA 3DU6A 4XMYA 1X1AA 4XM3A 2CW7A 1HA8A 2L7KA 3OS1A 1WJBA 4BDYA 2P0WA 2L9NA 3D5SC 3MKWB 1QHHD 3OR2C 3A1YA 3TL4X 3OYEA 2XF5A 4KT6A 4NC8A 4BE2A 2W82A 1WJEA 3TBIA 4YEJA 3AL0B 5KCMA 4F55A 3OYBA 4II3A 4CCKA 3OIQA 3VYTB 3OS2A 2V9KA 3LSIA 4CCMA 2VXZA 5HVQC 3ZXSA 2IGMA 1X1DA 4LIVA 4XLAA 2VPLA 2DOAA 4IX7A 3S3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KPM A;  2KZV A;  2LH9 A;  3RCO A;  2LY1 A;  3S93 A;  2LY2 A; 
#chains in the Genus database with same CATH topology
 5GPC A;  2P4W A;  5J3L A;  1JKP C;  2DW4 A;  5F0H A;  4BE0 A;  1VQ4 I;  5M3F J;  4HLY A;  4RB1 A;  4I0B A;  2MD0 A;  5IP6 A;  2J5O A;  5J6X A;  2LOO A;  1GXP A;  1CF7 B;  3G1O A;  2R7W A;  4RLQ A;  4RBO A;  4ZYD A;  4I7H A;  3JRE A;  4UUS B;  3S8P A;  3NQO A;  4DYC A;  4KNY A;  2JA5 J;  3EDP A;  2FBH A;  2XRL A;  4B47 A;  1ZKG A;  2O7O A;  3A01 B;  3AG4 H;  4ENM A;  3LA7 A;  2H8W A;  4U88 A;  2F2E A;  2ICW G;  2HOE A;  2MG4 A;  2IGN A;  5H20 A;  3GLX A;  3VSL A;  1YTY A;  3OYL A;  2MH2 A;  2QSH X;  2W1O A;  5J1R A;  5E3M A;  2LMD A;  2V26 A;  3LSP A;  4XLP F;  2TRT A;  4GYG A;  1U3E M;  2BGC A;  4HDU A;  1SVL A;  1VF9 A;  2KZV A;  4CZC A;  3BQY A;  2DPD A;  1R6R A;  3I59 A;  4KN4 X;  3FM3 A;  3OYI A;  1W7P A;  1MJA A;  5AIP A;  1JGG A;  3RSN A;  3QWL A;  3CLO A;  5EGO A;  3SFZ A;  4E7K A;  1TBX A;  1P7J A;  1P9Q C;  3GXO A;  2H6B A;  3CDL A;  2LH9 A;  3F6O A;  3EPZ A;  2R0Q C;  3E5Q A;  2JT1 A;  3DEU A;  2DA1 A;  1ZGJ A;  5L3D A;  2MYS A;  4HV6 A;  1PDN C;  1IRX A;  3K2A A;  4AIH A;  4RAF A;  5L3G A;  1Y1W J;  1FLI A;  3L09 A;  3JTH A;  1PYV A;  3HKZ N;  4A6D A;  3DPU A;  4RLF A;  5HLT A;  3FX3 A;  5F6F A;  3ZRG A;  2ELH A;  3FHN A;  3IP4 B;  2CRG A;  4GCV A;  3CC2 I;  4NC6 A;  2HDC A;  1MMD A;  1HST A;  2E71 A;  2JZY A;  2EV5 A;  3IV5 A;  2L54 A;  5E3L A;  3HSF A;  4V2G A;  5JVG F;  3A2K A;  3NWS A;  1V5G A;  2HR3 A;  2XPW A;  1U78 A;  1HW1 A;  3UKG A;  3CJT B;  3DTK A;  2ISZ A;  4JBA A;  2Z16 A;  3FXM A;  1NG6 A;  4XRS A;  3GTM J;  1MJB A;  1ZTR A;  1GV5 A;  4LB5 A;  3F8M A;  5JLW A;  2FOW A;  4PGG A;  1XPX A;  4U87 A;  3RCO A;  3KP3 A;  2IBD A;  5M5Y J;  2HXO A;  1HW2 A;  1F36 A;  4MIM A;  2DFH A;  1MIJ A;  2LTP A;  1MBF A;  1LUJ B;  1XDS A;  1B72 A;  1O57 A;  3HEF A;  2PFB A;  1FIP A;  2R7D A;  5HLG A;  1S8N A;  2IA2 A;  1QRY A;  3E6B A;  3HPG A;  3BTJ A;  2XGD A;  2JVH A;  5FRM A;  4FET A;  2HFH A;  5DS9 A;  3LA3 A;  1MBG A;  4MEX F;  2CQK A;  3FZV A;  4PUS A;  4XLE A;  3RZD J;  3QU3 A;  1LDJ A;  1QBJ A;  3C7J A;  2NVQ J;  4JX5 A;  3T8T A;  3GZ6 A;  2RAE A;  1SEU A;  3HM5 A;  2K40 A;  2J5P A;  1OYY A;  3J7A Y;  3OYF A;  1RIO H;  3MAJ A;  1IV8 A;  2JA7 J;  4NNJ A;  2ZFW A;  2VXD A;  2VB6 A;  2ELJ A;  2EWN A;  2Z33 A;  4I6Z A;  1D3Y A;  4OIN F;  5FLM J;  1V55 H;  1WKM A;  1B9N A;  4L0Z B;  3BTL A;  3N97 A;  1UFM A;  1WI3 A;  1FPQ A;  1TW3 A;  1T56 A;  3C2G A;  1YG2 A;  1RR7 A;  1B8I A;  1UG0 A;  3LMM A;  3QRF F;  4LIT A;  3F6V A;  3GTG J;  4L9J A;  2EIJ H;  4ESJ A;  1VQ8 I;  2LY1 A;  1KZH A;  3HGY A;  2LRE A;  3DXJ F;  4DYQ A;  5K7F A;  3TED A;  1W36 C;  2IJL A;  3M8E A;  1UJ8 A;  1ZK8 A;  1HCR A;  2L3D A;  4I01 A;  1YJW I;  3BP8 A;  2OD5 A;  2M2E A;  3IWZ A;  3HRS A;  3GYH X;  3ZQC A;  1WQ2 A;  4L18 B;  2H94 A;  1SFX A;  5KAF C;  3GW2 A;  3TMO A;  4M3D A;  1YW9 A;  4BL0 B;  1U5T A;  4BEH B;  1LE8 B;  2CUJ A;  5HOO A;  5IY5 H;  3R60 A;  3VYS B;  2MLK A;  5DDG A;  3CF2 A;  3MZY A;  3WTU C;  3ZQF A;  3GLL A;  1FSE A;  1F1Z A;  3T8R A;  1K79 A;  3IHU A;  1APL C;  3WTW C;  2JJ7 A;  1R1V A;  5F04 A;  2W24 A;  4IZZ A;  3ZN0 A;  4DGW B;  3DQV C;  2BYV E;  2NYX A;  4NHJ A;  1I3Q J;  2DT5 A;  4XN3 A;  1O3T A;  1HKT A;  2PG4 A;  1TTY A;  2EIL H;  1XGO A;  1RI7 A;  5L3E A;  3GBG A;  1XG1 A;  2LY9 A;  4ENJ A;  1JHF A;  1D8J A;  1IN7 A;  3J7Y J;  3WU1 B;  2ECC A;  1WSU A;  1F9N A;  1IW7 F;  3Q5F A;  5D4S A;  4B09 A;  1B59 A;  1J59 A;  2DYS H;  3RYR A;  3ZQ7 A;  2VBY A;  4CH7 A;  4RB3 C;  2VUM J;  3CUQ B;  1ZR4 A;  3E6C C;  3P9K A;  4ENK A;  3H35 A;  4U7B A;  4Y17 A;  4DBQ A;  2OQG A;  4HF2 A;  1Z6R A;  2WAQ N;  1FEX A;  4HQM A;  1U8R A;  2EIM H;  3H0G J;  1QZE A;  2HKO A;  3AL0 C;  2HPI A;  3CF5 F;  3CP8 A;  1FC3 A;  3CP2 A;  3M07 A;  2VPR A;  3CCV I;  2IW5 A;  2ZO4 A;  4B1R A;  2QEX I;  1BJZ A;  1LEA A;  5J1U A;  3SEZ A;  2F5D A;  3KIO A;  3J80 K;  2ZCW A;  5HS7 A;  4RB0 A;  2Q2E A;  5A2Q Z;  2X6W A;  1X3U A;  5K5R A;  3HG9 A;  2M34 A;  2V79 A;  3L7W A;  4JX6 A;  4QIW N;  1W5C C;  2O8K A;  2FQ4 A;  1BBY A;  1FY7 A;  4QPO A;  2ZNZ A;  1Y1V J;  2UUZ A;  3BR6 A;  2F4M B;  1R1U A;  4ITV A;  3QOP A;  1JT6 A;  1GT0 C;  2JTV A;  1ENH A;  2QSF X;  4IPA A;  2E1C A;  4GDF A;  1BA5 A;  4A3J J;  1YS7 A;  2XKP A;  2AXL A;  2VE8 A;  3W2A A;  1QU3 A;  3CES A;  3H5N A;  2HVS A;  1OMI A;  2Z99 A;  5L3B A;  2EZH A;  4BXU A;  3C3W A;  4KJZ A;  3JW4 A;  2OUM A;  4BQO A;  4ZYH A;  2UXN A;  3JSO A;  1Y0U A;  2E2J J;  1VZ0 A;  1BJA A;  3KEY A;  4EAT A;  1ZH5 A;  3SDB A;  2EK5 A;  3M8J A;  2M4K A;  4ESF A;  3QU6 A;  3S2W A;  3V4G A;  5M5X J;  3WGI A;  1RUO A;  4I99 C;  3HOY J;  1YW8 A;  2HGC A;  1A31 A;  5IT3 A;  1XMK A;  2ZJ2 A;  1GV2 A;  1JHH A;  5IYD J;  3JRA A;  5E3N A;  3FMR A;  3TO7 A;  1G59 A;  2FJ1 A;  4XKV A;  4Y3O A;  1ETV A;  5BOX A;  3JAM Z;  1RKT A;  5IYB J;  3I3L A;  3IH2 A;  4G6D A;  3K4N A;  1ZAR A;  3ZQI A;  1YE9 A;  1MH4 A;  1U0J A;  2L7Z A;  5EEG A;  5F1R A;  1MNE A;  3WU0 A;  2CWE A;  4NB5 A;  3LSM A;  3ZMU A;  3AG1 H;  2HOA A;  1WI9 A;  3OYC A;  1KQ8 A;  1LDK B;  4OMY A;  2NVT J;  3G71 I;  4M3E A;  2AHQ A;  2PX9 A;  4LK1 F;  2QKL B;  3CO6 C;  3E6D A;  2NS0 A;  3VDX A;  1K78 B;  1O7F A;  3MVP A;  4J19 A;  4A3K J;  1S29 A;  1EA3 A;  3CO7 C;  4IO9 F;  4ON0 A;  2E1N A;  4YG2 F;  1UB9 A;  2JRT A;  3SZG A;  5D8K B;  2V1U A;  1F43 A;  3G2B A;  1SFE A;  3PL8 A;  5J8F A;  3GZ5 A;  3ZQH A;  2OCE A;  4ANJ A;  2P5K A;  2R5Y B;  2ACJ A;  1W0U A;  3G73 A;  1ITY A;  2WAD A;  3OWT A;  4O5V A;  4KMU X;  1FWZ A;  2K7L A;  4IHV A;  3BOQ A;  3E1S A;  4IOC F;  4I09 A;  4C3J J;  1I5Z A;  4A0Z A;  4BAY A;  2CQX A;  2BY1 A;  1MDM B;  2NS8 A;  4MQV A;  5IT9 Z;  1SAX A;  2W25 A;  2ESN A;  2LBF A;  3IKT A;  3W6V A;  2X51 A;  1J7K A;  1W4M A;  1U5T C;  3HOT A;  2K86 A;  3QP6 A;  1YIT I;  2F5E A;  2JK3 A;  2KZG A;  3I9V 2;  3HIF A;  4EJT A;  1DGW Y;  1GHC A;  1IN5 A;  4CIC A;  1S7A A;  3SJM A;  4XLF A;  3L9F A;  3FBN B;  3JRC A;  3Q9S A;  1XSD A;  2BW3 B;  5IPA A;  1MBK A;  1WRJ A;  2HI3 A;  1BOA A;  1X3W B;  3RJP A;  3VYU B;  2DK5 A;  2ZC2 A;  3OL3 A;  5CVR A;  4JX4 A;  3K69 A;  4NQW B;  2VL8 A;  3FXU A;  5GPA A;  4Y15 A;  2R7F A;  2XF6 A;  4IEJ A;  1I3A A;  1BR1 A;  1HKQ A;  1R7J A;  2D45 A;  3HUG B;  1FBS A;  3DTE A;  2G7H A;  2IGO A;  3N4M A;  2Q0O A;  1EJ9 A;  3HTU A;  2VKE A;  1IN8 A;  2AQF A;  2WTE A;  1BN5 A;  4E7H A;  2VN2 A;  4C3H J;  2RDP A;  1IXR C;  1I39 A;  5EZG A;  3C18 A;  5F0F A;  2CFX A;  3BR3 A;  5H6Q A;  1FOY A;  1HA8 A;  1MBJ A;  5DCM B;  2OF7 A;  3D5S C;  2XAF A;  3MWM A;  3OR2 C;  3A1Y A;  3DV8 A;  5TIS C;  3L00 A;  1SMY F;  1K61 A;  3M3Y J;  5FKL A;  2A3S A;  1FX7 A;  2NNN A;  3OYE A;  4PZJ A;  3ZN1 A;  2DFE A;  1I27 A;  2FBK A;  4RGR A;  3GWZ A;  5E1X A;  4N9I A;  2YS9 A;  3RZO J;  3OYB A;  2KFD A;  2FE3 A;  2Y69 H;  2CQQ A;  5JVT A;  3VYT B;  3FXR A;  1UZC A;  5HVQ C;  2DLL A;  2IGM A;  1X1D A;  2XSD C;  4LIV A;  3PQK A;  4A3L J;  2DOA A;  4L5E A;  3E5U A;  2E1M B;  5EF6 A;  2HDW A;  3H9G A;  4KN7 X;  4FX4 A;  1UAA A;  2X1E A;  4BBR J;  3PJR A;  1J9I A;  4G6T B;  2HQA A;  1ETK A;  1GLN A;  2LNB A;  3MMY B;  2BV6 A;  2WV1 A;  1ZRD A;  2ZNY A;  3PNT A;  2K9N A;  4U0W A;  2FUG 2;  3E7L A;  5GAG J;  1WJC A;  4QSH A;  1SAN A;  3H3U A;  1T8I A;  2ISY A;  5FKK A;  5H6R A;  2QGU A;  2XAU A;  4CCN A;  3U1K A;  1KU3 A;  4PSW A;  5J4Y A;  3PSF A;  5ED4 A;  3K0L A;  2EA4 A;  3IWF A;  1PVE A;  2RVC A;  2Z5U A;  4U7D A;  2HOS A;  2X6Y A;  4CO8 A;  2BVL A;  5K7H A;  3KYC B;  4M73 A;  4J00 A;  4B48 A;  4AIJ A;  3FM5 A;  3KZY A;  1MKM A;  3LSJ A;  4RAG A;  4G7H F;  2IXS A;  3BR1 A;  5TRD A;  2VC0 A;  3FMQ A;  3GCM A;  5B1A H;  5HLH A;  2LKX A;  4FQG A;  2YR2 A;  1U6G A;  2R5Z A;  5E79 C;  2F48 A;  4KIG A;  2KT0 A;  4A0X A;  3OYG A;  4Q5S F;  1FOX A;  4W1U A;  1IO2 A;  2DYR H;  2BZT A;  4NBQ A;  4DQ2 A;  1VFC A;  2XHK A;  3CLQ A;  1BI3 A;  3F8N A;  3EQL F;  1VND A;  3FXO A;  3ABK H;  2Q1Z B;  3OOU A;  2BBY A;  5D5X B;  2X6O A;  2F4I A;  4BNC A;  3BZC A;  2R7V A;  5L3F A;  2M87 A;  1SVO A;  1QZY A;  2DCE A;  5LGT A;  4OIP F;  4P55 A;  3SDG A;  1CF7 A;  2MD5 A;  2P5L C;  2NOG A;  4RM3 A;  4UUS A;  1T6S A;  3CTA A;  2HNH A;  2O03 A;  4D9J A;  2CFO A;  3DCF A;  5TJJ A;  1Y0N A;  3D5L A;  2Y9Z A;  3A01 A;  5FD5 A;  3GTP J;  1D8K A;  1K4S A;  1USS A;  4ZH4 F;  2Z2S B;  3I58 A;  5DUK A;  3JRG A;  1JTX A;  2X6X A;  5LGU A;  5HDN A;  1A04 A;  4PCQ A;  5C44 J;  4ZTF A;  1PUF A;  2MBF A;  1TWF J;  1B9M A;  3QP5 A;  2PJR A;  1YHQ I;  1V4R A;  1HOM A;  1TP4 A;  3R6S A;  2E35 A;  4W97 A;  3I54 A;  5EYR A;  1ETX A;  2DOD A;  2DA5 A;  5E1Z B;  3WTY C;  3I71 A;  3ECH A;  3J81 Z;  2DJI A;  2Y2Z A;  3C1D A;  4U0V A;  4S0H B;  2VLA A;  1VQP I;  2DPU A;  2PLY A;  2RC4 A;  2EH3 A;  5EZH A;  4XLC A;  1E3O C;  4CGZ A;  4A3I J;  1P4A A;  1OCZ H;  1R58 A;  1JKO C;  2CV0 A;  4MHG A;  4L9T A;  4HNV A;  2JWT A;  4YIR X;  2L9S A;  4A3D J;  5FKM A;  2EV0 A;  1KU7 A;  2FML A;  2P5V A;  2WB1 A;  5GAD J;  4RMN A;  4WK8 F;  9ANT A;  1BOB A;  2FSW A;  3K1M A;  1QA6 A;  5CKT A;  1SD5 A;  2ME0 A;  5DM7 F;  1U9N A;  3RKW A;  5DYM A;  1BR4 A;  2VON A;  2BHY A;  2ZXJ A;  2ZME C;  1UHM A;  3HSR A;  3ABL H;  5FJ8 J;  1TLH B;  2VOD A;  5DEQ A;  5FD6 A;  1UEL B;  5JHU A;  1IDZ A;  1UG2 A;  3DBR B;  1LVA A;  1X2N A;  2E5Z A;  3GFL A;  1ZG3 A;  4BHP A;  2DMP A;  3SEQ A;  1XSV A;  1BIA A;  1RPW A;  4Y33 A;  3BLY A;  3ROU A;  4JYK A;  4AUX A;  4C2U A;  4M9S A;  2JA8 J;  3CDH A;  1WJF A;  4HDV A;  5GTI C;  3RIR A;  2LDU A;  2DA2 A;  4H0E A;  4ASN A;  2O61 A;  1T38 A;  1OFC X;  2OZU A;  4OIO F;  3BR2 A;  4HST A;  3QYE A;  4MLO A;  5J8C A;  4WXC A;  3PO3 J;  1X19 A;  3VEP A;  2AQE A;  1I1G A;  4LLL A;  5ERI A;  4V19 K;  2QKM B;  1POG A;  3CCJ I;  1FIA A;  4ETS A;  3UR3 C;  4M6V A;  4AU7 A;  1GXQ A;  3CQZ J;  2OU2 A;  5EEA A;  5FLX K;  3FHZ A;  2WY7 Q;  3REO A;  3IRR A;  3A4C A;  3QPS A;  2X9D A;  3CCM I;  2RV8 A;  1U2W A;  4G7O F;  3CUO A;  2R7T A;  1ZYR F;  3Q0W A;  1XN7 A;  3KX2 A;  4C2T A;  4A5N A;  2R7S A;  1X3Z B;  2R7Z J;  2K27 A;  3DWL E;  1WPK A;  1FJL A;  1SD4 A;  1VQ6 I;  4RM2 A;  4XRF A;  2A05 A;  1Z9C A;  4QTR A;  1FMV A;  2H1L A;  2BY2 A;  2LK2 A;  1OCC H;  2GXA A;  2HXI A;  2D5V A;  1J0R A;  1S6L A;  4HV5 A;  2Z1D A;  3BG5 A;  2V1X A;  2XKO A;  2QBY B;  2K3P A;  4XKB A;  2XV4 S;  1OYW A;  3TDU C;  5D5V B;  2KIU A;  1ON1 A;  1IUF A;  1XS9 A;  4XBF A;  2FXA A;  1B6A A;  2X48 A;  3SFI A;  3JRD A;  1ZEL A;  4RA2 A;  2HWV A;  2E2I J;  2M1B A;  3I4P A;  4HYE A;  4XOP A;  5LRS A;  2PQ8 A;  1BI2 A;  3KP5 A;  3M1E A;  3G3Z A;  2AS5 F;  3TP3 A;  1TWG J;  2RGV A;  1U9O A;  1M1E B;  2HYF A;  1Z21 A;  3KP4 A;  1E0E A;  1LE8 A;  3K4M A;  4CUG A;  2V6E A;  4ZDO A;  1TWH J;  4JK1 X;  1DGR M;  5KVR A;  3FDY A;  1YOV B;  4M9X A;  4GRI A;  3C2H A;  4UV8 A;  1IRZ A;  2LR8 A;  3W2V A;  1HSJ A;  4C3I J;  2BY3 A;  3K7A J;  5E3O A;  2A69 F;  2DFI A;  1MW7 A;  2ID3 A;  2K9S A;  3E97 A;  2VOP A;  1L3L A;  3A0B C;  4NDL A;  1C0W A;  1I6X A;  5ICG A;  1T08 B;  4HSR A;  5HDK A;  4B3X A;  3GFM A;  1STZ A;  3M9A A;  2QWW A;  2VOO A;  3LSH A;  1BC8 C;  3IH4 A;  3R0A A;  4FT8 A;  4AM3 A;  1G6N A;  3F23 A;  2D1V A;  4Q4Z F;  4GO1 A;  2EQR A;  3W6J B;  2CW0 F;  4A93 J;  2Q8K A;  3S16 J;  1D1A A;  2WBM A;  4P5O A;  1Y6I A;  1BW6 A;  1Y8Q B;  3M8F A;  4E7L A;  4BDZ A;  2CUF A;  3LQQ A;  4ZTJ A;  3OYN A;  1JKQ C;  4YEL A;  3HOX J;  4LGW A;  3HOW J;  2ECB A;  1FBQ A;  2DI3 A;  3HRU A;  1OCR H;  4HNU A;  4S05 A;  3BPV A;  3TDZ C;  2H6C A;  3I59 B;  2DAO A;  1W7P B;  2R7U A;  4HZF A;  2QQ9 A;  2RNJ A;  5GAE J;  1HF0 A;  2LC2 A;  2XAG A;  4WXH A;  1K7A A;  1RET A;  2V7F A;  2XAQ A;  3PIO F;  4CSW A;  3B73 A;  3HOU J;  1LVK A;  3WHC A;  4CYC A;  1QPI A;  4HX7 A;  1F4K A;  1G3W A;  2WAF A;  2F6C A;  2EFN A;  2HQR A;  2K02 A;  1R1T A;  2Y0M A;  5ICF A;  1I50 J;  3A03 A;  3WTX C;  3KZI C;  4EGZ A;  1E2X A;  2PJP A;  1HBX G;  2IGK A;  1YX5 A;  4HG2 A;  5M5W J;  5KAI C;  2MAB A;  5LRR A;  2F5V A;  1WVR A;  3O6B B;  2P7V B;  2BXZ A;  2XGE A;  2A5W A;  2Y0S N;  2JSC A;  1R49 A;  2BEO A;  3OR1 C;  4IQ4 A;  3OY9 A;  4E7I A;  2CG4 A;  2HPM A;  5EEH A;  4C30 A;  5EG0 A;  2KQR A;  3RQI A;  5D4R A;  4KYW A;  2VQH A;  3V42 A;  3R61 A;  2YU3 A;  2W84 A;  1IN4 A;  4IRI A;  4XN0 A;  1W0T A;  1SC7 A;  3BG3 A;  2M0C A;  2XGX A;  3KEQ A;  2EFQ A;  1LEB A;  5BS6 A;  4A6E A;  1S5L C;  2JPC A;  2QF7 A;  2AXT C;  2CO5 A;  1V5F A;  3B6C A;  3S32 A;  4IQJ A;  1BM9 A;  1VQ5 I;  1MSE C;  1GUU A;  4DZJ A;  2EJR A;  3FKI J;  4BQQ A;  3HC7 A;  4ENN A;  2VKD A;  4DNC A;  4EM0 B;  2CQN A;  2V9V A;  3WGG A;  3Q0U A;  4FTH A;  2C6Y A;  3FWE A;  3VFZ A;  3GTO J;  1QVT A;  4EM2 A;  2MC3 A;  2LF8 A;  2QEN A;  4A12 A;  3IL2 A;  3LWF A;  3LAP A;  5B66 C;  2DN0 A;  3DEW A;  3FBI B;  5C4J J;  1TW2 A;  2DQR A;  3RI4 A;  3N05 A;  4BXF A;  3S14 J;  3ZQQ A;  3J80 Z;  1DP7 P;  3BWG A;  2DTR A;  2XB5 A;  2IPQ X;  2KIQ A;  1IDY A;  3B6A A;  4F92 B;  1SFO J;  2IS1 A;  1K78 A;  3PFY A;  4LK0 F;  3BR5 A;  4JOM A;  3VB2 A;  2FMY A;  3TGN A;  3BJA A;  4UB8 C;  4EQQ A;  2ZSI B;  3EUK L;  2LY2 A;  1ETY A;  1O3S A;  4LMY A;  2OZ6 A;  3O8H A;  5D8L B;  1XCV A;  2VQG A;  4CXF A;  2JQ7 A;  3MN2 A;  3OYA A;  1JI8 A;  1I6H J;  1B8I B;  1EH7 A;  4B4C A;  4M74 A;  3DU6 A;  5FKO A;  1E17 A;  3TOB A;  3CC4 I;  2CW7 A;  2L7K A;  3MZ8 A;  4QWQ A;  3TO9 A;  2DQL A;  4UB6 C;  4PJ0 C;  1LPQ A;  2QYO A;  2Y75 A;  2FNA A;  5ICE A;  4MQ9 F;  4L9N A;  1QO0 D;  2XF5 A;  1K83 J;  3V8J A;  1WJE A;  2WB1 N;  4R8H A;  3I53 A;  4DYR A;  1EF4 A;  1XGM A;  2NS7 A;  1MNM C;  4CCK A;  3OS2 A;  1R71 A;  2V9K A;  4CCM A;  4I2O A;  5GAH J;  3V8L A;  5FFX A;  4ZYE A;  4KDP A;  4XLA A;  2VPL A;  5HS9 A;  2WV0 A;  3S3N A;  3L2V A;  4YFN F;  2LKS A;  1XGN A;  5M3M J;  3H3V K;  2BW3 A;  2DMN A;  4IOA F;  4Y4R A;  1GDT A;  2G0E A;  1XDU A;  4LIU A;  3D1N I;  1ZN2 A;  2X85 A;  2V1N A;  5FB2 A;  2LD5 A;  4BGD A;  5KNL A;  3BR0 A;  3AFH A;  4N4O B;  5D6E A;  3ONQ A;  3I4N J;  1ERD A;  2K5C A;  1EV7 A;  4V2F A;  3LNQ A;  2LKP A;  2KJB A;  4BHC A;  3G4S I;  5DV5 A;  1DUX C;  3BT9 A;  1BI1 A;  1YS6 A;  2GM4 A;  4HEA 2;  4S04 A;  4YIF A;  3KPH A;  3ULQ B;  4ZYA A;  3CUQ C;  1OIS A;  3GZN B;  2FQ3 A;  4M6Y A;  2CS3 A;  2HVQ A;  4HBL A;  1VQ7 I;  2LLK A;  3AAF A;  4M71 A;  2EPF A;  2YX4 A;  4ZZD A;  1IF1 A;  2V1D A;  1VQO I;  2OTL I;  3K4B A;  4BAC A;  2R4G A;  2WY8 Q;  4XQF A;  4WF2 A;  3K6G A;  3BZK A;  4DOZ A;  1OYI A;  1YRN A;  2K3F A;  5IYC J;  4ABZ A;  2ELK A;  1WJD A;  1KQ9 A;  4M3G A;  1SFU A;  3JRB A;  1KQ0 A;  4IRH A;  1R5I D;  4FAS D;  4UHT A;  1O4X A;  3JCU C;  2XGC A;  4G94 A;  1S3J A;  1R9T J;  3S1N J;  3OS0 A;  2KRH A;  2TDX A;  2FBI A;  3IKV A;  4PSX A;  3C2B A;  5CQE A;  3PO2 J;  1D0Z A;  3CZ6 A;  2XB0 X;  1V5E A;  1H9G A;  2OBP A;  3T5X A;  1ZGA A;  3HJE A;  4XKW A;  5LD2 C;  3LQR A;  1CGP A;  1J5Y A;  2LRD A;  4UVB A;  3DF8 A;  2X4H A;  3Q9V A;  1XB4 A;  2NOJ B;  4E7S A;  1NHA A;  4RGU A;  1Q1H A;  2NAZ A;  2STT A;  3ZPL A;  4AIK A;  4XON A;  2K9M A;  4GXO A;  2Z9O A;  4LG0 A;  4XRS G;  4JQF A;  1AU7 A;  3QOD A;  3TQN A;  4LG3 A;  4IRG A;  3WG9 A;  3BCB A;  3L2W A;  1MMN A;  4P9F A;  3K4K A;  4OAY A;  2IT0 A;  2PMH A;  3BG9 A;  2K9L A;  4BUP A;  3CC7 I;  4A3C J;  1IJW C;  2IVM A;  2HYG D;  1ZR2 A;  5H2F C;  3K4C A;  2ZME A;  2F5C A;  1YFH A;  1ETW A;  4XLN F;  3VYR B;  4EJO A;  4FHT A;  1R23 A;  2RN7 A;  2UWM A;  1X2M A;  2XC7 A;  1AHD P;  2EV6 A;  1ON2 A;  1TQM A;  2RRE A;  1XMX A;  3HXL A;  5TGT A;  2BHZ A;  2KLO A;  2B9S A;  2VKH A;  3A02 A;  1H8A C;  4F91 B;  3E5X A;  2M8G X;  1LKX A;  3ELK A;  3K1N A;  4WX9 A;  3E6M A;  5DUI A;  5D5W B;  3FIW A;  2QQA A;  1SFK A;  4UY8 I;  4A3E J;  3EYI A;  1YIJ I;  2HYJ A;  1A6I A;  2V6C A;  3ZR8 X;  2CGP A;  3H0D A;  2KRC A;  2K4B A;  2EFW A;  1V54 H;  1BL0 A;  2W85 A;  2W4S A;  4IXA A;  5HS8 A;  1T39 A;  4F52 A;  4DIQ A;  5HOD A;  2MH9 A;  4RS8 A;  3IC7 A;  5F08 A;  2JN6 A;  2O0Y A;  3DU5 A;  3QAH A;  3CJQ B;  1UST A;  4PJL A;  4HA8 A;  1P6R A;  4J01 A;  3CCR I;  4KIS A;  3RQ4 A;  3LAJ A;  2ZXH A;  2W7N A;  4LD5 A;  5K5Q A;  1XX5 A;  2KP6 A;  3QPL A;  3EUH A;  4I76 A;  4CCJ A;  1OPC A;  1TT0 A;  3K4L A;  3RKX A;  2Y9Y A;  2ZFU A;  2R7O A;  5KK1 A;  1H88 C;  4A69 C;  3HPH A;  1E3H A;  1ZG5 A;  2XUB A;  4OU0 A;  1VQM I;  3BJO A;  3QYF A;  3SHF A;  2DA3 A;  2E60 A;  3EET A;  3R4K A;  3ZMV A;  4EV0 A;  3PQJ A;  1TZL A;  3MD2 A;  1A35 A;  2KMU A;  1R00 A;  1Z91 A;  1P2F A;  1T0F A;  2CUE A;  2L7F P;  2YU9 J;  2EZI A;  1VTN C;  1SAU A;  4OAZ A;  3SZP A;  1HDD C;  2OAZ A;  1J09 A;  1OLT A;  4BJ5 C;  4Y13 A;  2CU7 A;  2Y0S A;  3ZMS A;  1LDD A;  4BS9 A;  3E3V A;  2DU9 A;  1MZB A;  2CH0 A;  3ZOB A;  5FLV A;  3IAS 2;  4KUM A;  3FXJ A;  2MFZ A;  1RES A;  1JT0 A;  1T98 A;  4MEY F;  2KL4 A;  3DKW A;  3VPR A;  5EJC A;  2HQ5 A;  2XDV A;  3HRM A;  1MMG A;  2OJE D;  2LSO A;  5CJ9 A;  3BDD A;  1D0X A;  5BQT A;  3E0J B;  4IHX A;  2R92 J;  5ILS A;  2E19 A;  3J7A O;  3KYD B;  2VJ4 A;  4UXN A;  3U9G A;  2XVC A;  2MA3 A;  2ZKZ A;  1H89 C;  4DJA A;  1FNN A;  4PJJ A;  3BRO A;  1RNL A;  3MFK A;  2Y30 A;  3NEU A;  3JTG A;  1IG7 A;  1WFX A;  3WOD F;  3PM1 A;  3HRT A;  5E8I A;  2GA1 A;  2LYC A;  2KHM A;  1NK2 P;  4OMZ A;  4BQN A;  2A6T A;  4M3F A;  4D0P A;  4KA4 A;  2D2W A;  2M30 A;  1RC9 A;  3LL7 A;  4LJZ F;  2Y31 A;  3VOD A;  1K4T A;  3ZMD A;  1Z7L A;  2DT6 A;  2O8X A;  2IS6 A;  2GAU A;  1R5G A;  1X1B A;  4BXX J;  1LQ1 A;  4Z2Y A;  3IUO A;  2XAS A;  4LFU A;  1IAW A;  3DBH B;  5GTH C;  1YIO A;  4RAZ A;  3CCL I;  1ZAO A;  2HEO A;  4C2M J;  1FTZ A;  3IRQ A;  3PFI A;  4ESB A;  1W1W E;  3S17 J;  2M5W A;  2CQ7 A;  3CCE I;  4OWR B;  1MD0 A;  1X4O A;  3CDI A;  3DEE A;  2VBW A;  3F8B A;  3KP7 A;  4I0A A;  2BXY A;  3WTV C;  2OPT A;  4N9H A;  2GXG A;  1NG7 A;  1MSF C;  1BW5 A;  2XRN A;  5L3C A;  4U0Y A;  2DA4 A;  3M1C A;  2ZJR F;  2VT3 A;  1MND A;  1PUE E;  1BR2 A;  3F0C A;  1Z77 A;  1ULY A;  4ZJZ A;  4G6Q A;  4BY7 J;  3OYD A;  1P92 A;  2ZJQ F;  3ZGK A;  3KZZ A;  3CMM A;  3LOC A;  2DFF A;  2EFP A;  2QUF A;  2COB A;  4ZDP A;  4Z6Y A;  2RNG A;  3T1B A;  4HX8 A;  3P5J A;  4IHS A;  2YSR A;  2XF7 A;  1ACI A;  3F22 A;  2VJJ A;  1O3R A;  3NAR A;  2P6T A;  1YJN I;  2B7E A;  2B63 J;  3BG6 A;  4FE4 A;  2QA4 I;  4PK4 A;  1SD7 A;  3G6E I;  1AOY A;  4GGG A;  1XSX A;  2EIN H;  1HW5 A;  5F27 A;  2X1D A;  2KKO A;  2E7X A;  4OIQ F;  4PDK A;  3OV8 A;  4KIC A;  4P96 A;  1WCM J;  3MZH A;  3F21 A;  4B44 A;  1JXS A;  1JUP A;  5IOZ A;  3S1M J;  1IXC A;  1N75 A;  1PJR A;  5DD4 A;  3OSF A;  2A6E F;  3V8K A;  5IP9 J;  4O3M A;  3I4M J;  1I1S A;  1Z0X A;  4E70 A;  5K5O A;  1HLV A;  1XTA A;  3IH3 A;  4HF1 A;  2NVY J;  5LEJ A;  3FIS A;  4PJN A;  3W2W A;  3OOP A;  5F64 A;  5ICC A;  2VJ5 A;  1Z6T A;  3PIP F;  1EH6 A;  2MLG A;  5CPR B;  3GME A;  2YUS A;  4WCG A;  4JP0 A;  2JSP A;  1AKH B;  2HVR A;  1WHU A;  1ETO A;  2DMQ A;  2H27 A;  4F3Q A;  5LHG A;  5BMZ A;  5FLX Z;  3VWB A;  3L1P A;  2LFB A;  1X1P A;  4KIB A;  4BJ6 C;  5ILU A;  2BOL A;  5HNF A;  4BU2 A;  3KYL A;  1J2X A;  4X6A J;  3SXY A;  5B3S H;  2E2H J;  2PBI A;  3GEZ A;  3EUH C;  1S9H A;  4MGR A;  5J1Y A;  4KFC A;  3G1M A;  3ABM H;  4AID A;  3MCZ A;  2PMZ N;  2QLZ A;  1PUF B;  3BY6 A;  1QHG A;  4QLC U;  3JRF A;  3BG7 A;  2PJR B;  3ZMT A;  2GLO A;  1SD6 A;  2M3A A;  4HLX A;  2JMW A;  5DM6 F;  1H9T A;  3L2U A;  2F4O B;  3ZP5 A;  2KIS A;  3OSG A;  2HKX A;  4FX0 A;  1FMW A;  2RKH A;  3L2R A;  1T0F C;  5ILV A;  2L5Q A;  3KE2 A;  4B3A A;  3K70 C;  3BTC A;  4CHU A;  3DP7 A;  5K7Z A;  2KPM A;  1D1C A;  3RDI A;  1IRG A;  4MNU A;  1A5J A;  2JRM A;  1QVU A;  3L2Q A;  2OA4 A;  4M3B A;  4IVN A;  2QSG X;  3OMY A;  2DJN A;  5CVV A;  1N78 A;  3P7N A;  3HHH A;  3S3M A;  2GA2 A;  1F5T A;  1WZ2 A;  3KCC A;  3WG7 H;  3MKZ A;  3S3O A;  3U1D A;  4TV7 A;  2A6H F;  3FK6 A;  3ZMZ A;  5B5E C;  1AWC A;  1D1B A;  4F7Z A;  4A3F J;  1MBH A;  1IC8 A;  3KLO A;  5HNH A;  1YYV A;  4HF0 A;  1ZRC A;  4I02 A;  1DDN A;  4PJM A;  3S2D J;  2LF7 A;  4BEH A;  2WC2 A;  2QQ8 A;  4Y7N J;  3J7Z I;  2DA6 A;  3WTS C;  1TT5 B;  1YLF A;  3I55 I;  4IHW A;  2FRH A;  4AVZ A;  3CMA I;  1G3Y A;  3M7G A;  4UV9 A;  2EA2 A;  4QPQ A;  3M4O J;  1OJL A;  2DT7 B;  1FBU A;  4BYY A;  4DZP A;  4RAY A;  2A68 F;  1FP2 A;  1S7E A;  1B1B A;  2WAE A;  4X0G A;  3GTQ J;  4PFO A;  2CMP A;  4BHB A;  3F8F A;  4M9Z A;  4NC7 A;  3KFW X;  2Z3Y A;  2E5N A;  3ABU A;  5EDN A;  5LGN A;  4AD9 A;  4XL9 A;  5GP9 A;  3MKL A;  5J47 A;  2DO7 A;  1NK3 P;  3D0S A;  1X1C A;  3RKY A;  1OKR A;  4G7Z F;  2XAJ A;  1JUM A;  1VI0 A;  2M0M A;  1R36 A;  4A3M J;  3V7S A;  3S1Q J;  2I5U A;  2K9Q A;  4G9Y A;  5IOY A;  3TP0 A;  1OCO H;  4HAM A;  2DDB A;  1JTY A;  4FCY A;  1X58 A;  1FYL A;  2DMU A;  2RQP A;  4BDY A;  5C3E J;  1Z1D A;  3B02 A;  3CUQ A;  1QHH D;  2ZXW H;  4HW0 A;  4XSZ F;  4AC0 A;  2HTJ A;  2AO9 A;  2F5F A;  1RRJ A;  2FX0 A;  4NC8 A;  4KT6 A;  4Q48 A;  1DU6 A;  4BE2 A;  1HKS A;  3TBI A;  5LBQ A;  2H1K A;  3P9C A;  4YEJ A;  2HQN A;  3AL0 B;  3ERM A;  4A3B J;  5KCM A;  1JJ6 C;  2YX7 A;  4PGH A;  4II3 A;  5AIQ A;  1KU9 A;  3RKQ A;  2JPB A;  2XPU A;  3ZXS A;  3P9I A;  5HLI A;  1GVJ A;  1ZG1 A;  3JR9 A;  4IX7 A;  5EGO B;  2CV2 A;  4UVA A;  3ZQL A;  4UUT A;  3FXQ A;  2CUZ A;  3ERE D;  4GFB A;  3K9T A;  3SYT A;  1N25 A;  2JA6 J;  3HOZ J;  3CMY A;  5FRO A;  2IA0 A;  2IA1 A;  2ZBK A;  2QCO A;  3WTZ A;  2FU4 A;  2ID6 A;  4MFE A;  3DKY A;  2DOE A;  1IRF A;  1R4N B;  3DLA A;  3MQ0 A;  1OQY A;  2O5R A;  2GZW A;  1LB2 A;  1REP C;  1OR7 C;  2CJJ A;  4Q47 A;  2H09 A;  3K10 A;  1RUN A;  3OYK A;  2O9L A;  1MBE A;  5E20 A;  5F1J A;  3K70 D;  3ZQG A;  3HYI A;  3FF5 A;  3ASN H;  4UUV A;  3BCA A;  1UHW A;  2L9V A;  2M8E A;  4E6K G;  3GFI A;  2E1O A;  3K2Z A;  2QQB A;  3H3Z A;  4L5I A;  2ZXI A;  2VIX A;  4R79 A;  4RB2 C;  3R0J A;  1FYK A;  2X1C A;  5J40 A;  5JLX A;  2XIG A;  2IEK A;  2A61 A;  2IAI A;  2KIM A;  3T0Y A;  2N8G A;  3I64 A;  1JE8 A;  3CCU I;  1KGS A;  3WE3 A;  5K1Y A;  1G3S A;  3HSE A;  1MGT A;  3FXL A;  3VSK A;  3KEO A;  3GTK J;  2VBZ A;  2L9R A;  1QQI A;  1B72 B;  1T95 A;  1B4A A;  3QYB A;  4KT5 C;  2XRO A;  1RR8 C;  1D0Y A;  2GIV A;  3BTI A;  2MC4 A;  2EFO A;  4XR6 A;  3V7C A;  5CYV A;  4NUB A;  4ZC3 A;  3DLL F;  1T2K A;  1H0M A;  1J75 A;  3ABT A;  3RPU D;  2UZK A;  3O3K A;  1Z3Y A;  3AKZ A;  1ZLK A;  3LFK A;  2R7R A;  3DPL C;  2PN6 A;  3MEX A;  4MTD A;  2VQL A;  2V9P A;  2VAS A;  3NWT A;  3V7R A;  2ZSH B;  1GVD A;  3L2C A;  2PI0 A;  4EJU A;  3RYP A;  2UV1 A;  3VOE A;  2W48 A;  4HRI A;  4N4N B;  3H92 A;  1ORK A;  1TWA J;  2RQQ A;  3AG2 H;  2ETH A;  2BE5 F;  3K4J A;  1FOK A;  3H5A A;  3CME I;  1YW7 A;  1QNT A;  3HZJ A;  2P6S A;  1UMQ A;  4CA0 A;  1YJ9 I;  1YQA A;  3H1C A;  3S1R J;  3COA C;  4D7N A;  2GOM A;  3CCY A;  4EJW A;  1L0O C;  1E3P A;  1O7L A;  2CSO A;  3SZT A;  4F93 B;  3PNY A;  3Q3S A;  2KJC A;  2IP2 A;  3ESW B;  5J4V A;  3LST A;  2EBI A;  1OCP A;  5A2Q K;  1VQK I;  2DMT A;  1Y8R B;  2CW8 A;  3TOA A;  4D7M A;  1IN6 A;  1S72 I;  2R5Y A;  1WH7 A;  1IGN A;  3H9Q A;  4CCO A;  3GTJ J;  1G3T A;  3SQN A;  3CCQ I;  5KHD A;  4HPQ A;  4ZDL A;  1KYW A;  2KDO A;  4DW6 A;  2R7Q A;  3OYH A;  4CYC B;  4HQE A;  1MDM A;  1DU0 A;  3WTT C;  1FOW A;  1BC7 C;  2JVG A;  1U5T B;  3DBL B;  2W57 A;  3LA2 A;  4RGS A;  5FGM A;  2NRA C;  1QGP A;  4AYB A;  3WE2 A;  5CVJ A;  4P9U A;  4WXD A;  3GFJ A;  3W3C A;  1LNW A;  4XNF A;  5LEK A;  1WWX A;  1XCB A;  3UNG C;  2OC6 A;  4XRM A;  5EG0 B;  1W36 D;  4D1Q A;  2M45 A;  4A2U A;  4HX4 A;  3O2P E;  1JKR C;  1WGX A;  2M4G A;  1ZRF A;  2L02 A;  5B1B H;  2K4J A;  4NQW A;  1W5T A;  2E34 A;  2G7U A;  1IXS B;  4N0B A;  4B8X A;  5CVI A;  1YI2 I;  3HUG A;  5BNG A;  3GF2 A;  3NRV A;  3ECO A;  2BY0 A;  2OCC H;  3RTR A;  2GBY A;  2CV1 A;  2JUG A;  1A6Q A;  2IRF G;  3JAM K;  2OTJ I;  4OIR F;  5DTD A;  2NXN B;  2O6G E;  3FKJ A;  1KU2 A;  3OYM A;  4LB6 B;  2LG4 A;  1AA7 A;  1K6Y A;  1R22 A;  2CYY A;  3HBL A;  1DQU A;  2VQC A;  5DCM A;  4IHY A;  1LFB A;  4YRV A;  4MO7 A;  2DDA A;  1OCT C;  4XKC A;  3GTL J;  2STW A;  4BKX A;  1KON A;  4C9Y A;  2VC1 A;  1TQP A;  3IAM 2;  3K1P A;  1WJ5 A;  3OIO A;  2PMZ A;  2L4A A;  3BC8 A;  4E7Z A;  2Q2E B;  3DKX A;  1WH5 A;  5LHH A;  4BBS J;  2D1H A;  4A3G J;  4HNT A;  4AVP A;  2M7A A;  3OL4 A;  3HOS A;  2FEZ A;  1SMT A;  3JRH A;  3F3X A;  1JJ8 C;  5CQG A;  1Z7U A;  2A5Y B;  2ADU A;  3HGG A;  3CJN A;  4A0Y A;  4WWC A;  3CJR B;  3KET A;  3HDD A;  4FIS A;  3QPH A;  4E7J A;  2OV7 A;  2GIZ A;  4II2 A;  5E1W A;  3KP2 A;  2FD5 A;  3OIP A;  1P4W A;  5FRN A;  1W7P D;  1KA8 A;  4AWX B;  1LJ9 A;  2HS5 A;  4L5J A;  5JI6 A;  2VKV A;  2DTZ A;  4LLN A;  2FOK A;  2QM3 A;  2I10 A;  2NVX J;  3U2R A;  2EZK A;  1D5V A;  4IJA A;  3HKZ A;  1P7I A;  2JUC A;  2XAH A;  3FXK A;  1R4M B;  5DD8 A;  4YFX F;  5IT9 K;  4IL6 C;  1T33 A;  2COM A;  5LHI A;  3KLN A;  2MGQ A;  3S93 A;  4EVI A;  2P8T A;  1LFP A;  3WU2 C;  2HZD A;  4KIF A;  3LSK A;  5E17 F;  1UCR A;  3WHB A;  4BH9 A;  4L9V A;  1G2H A;  2L0K A;  2HU9 A;  3BJ6 A;  1Z67 A;  3BQZ A;  5LLQ A;  1VQ9 I;  4P1W A;  3TW7 A;  5HDG A;  3EUA A;  4BE1 A;  4XSX F;  3QOE A;  1LFU P;  1FSH A;  1FYM A;  5IP7 J;  2HTS A;  5FFZ A;  1Q1V A;  1TL8 A;  3GVA A;  4UVC A;  3H9J A;  3U21 A;  2HDD A;  4CYD A;  4R1H A;  2NNY A;  4M72 A;  2M9H A;  3TO6 A;  4IKF A;  3D5R C;  5FKN A;  2ME6 A;  2EZL A;  2GOX B;  4KIT B;  4EM1 A;  2PEX A;  4MFD A;  3EYY A;  1YX3 A;  3ISP A;  1SVM A;  3TW6 A;  1ZHF A;  1G8X A;  3PNV A;  4FE7 A;  3F8C A;  1D5Y A;  1QZZ A;  2QZ8 A;  4XOR A;  2O3F A;  2VT2 A;  3TKY A;  5D5U B;  2KDZ A;  2R3S A;  3RPQ A;  5LFA A;  1V3F A;  3DFG A;  2DXI A;  1NH3 A;  1DP3 A;  2IS2 A;  3BPX A;  4ZYG A;  2LP0 A;  4O6J A;  3I5U A;  4EGY A;  3PSI A;  1PP8 F;  4Y52 J;  4L0Y B;  2W00 A;  1ZGW A;  1YRN B;  4UNO A;  1DPU A;  3DTI A;  1ZLJ A;  4D5C A;  3F9K A;  3HHG A;  1PP7 U;  5DCF A;  4ZZL A;  5F0C A;  4M6X A;  4PFP A;  4DBR A;  2LVS A;  5JFR A;  2B0L A;  2P7C B;  4XK4 A;  1ZRE A;  2GQQ A;  3NAU A;  2VJI A;  2L7M P;  3H36 A;  3MKY B;  2L01 A;  3FK7 A;  3HB9 A;  3PUB A;  1VQL I;  3DPT A;  2WWY A;  3GO5 A;  6PAX A;  4IHT A;  5FO5 A;  2VI6 A;  1ZQ3 P;  4BQA A;  1XC5 A;  3AG3 H;  2L2O A;  5AON A;  2LBF B;  5JR3 A;  1WJA A;  1IUY A;  4I98 B;  3CCS I;  2GWR A;  4XLH A;  4CZZ A;  1G4D A;  1BIB A;  1A36 A;  1MH3 A;  1TWC J;  2A07 F;  1FP1 D;  4CCL A;  1S7O A;  1XMA A;  5JHF A;  2VBX A;  4LG0 B;  2DA7 A;  2UXX A;  2JA2 A;  2PMU A;  1CQT A;  1RKW A;  3ZCO A;  3H5R A;  4K2E A;  1K6O A;  2E36 A;  2MW8 A;  1U8B A;  1KYZ A;  3G1L A;  1YO5 C;  1TNT A;  1ONV A;  1TQI A;  2HZT A;  4H4K C;  4OOI A;  2FF4 A;  4RDU A;  1TNS A;  2DBB A;  2ZJP F;  3OYJ A;  2OQR A;  2ZME B;  3HL2 A;  4A5M A;  2XSJ C;  3BZ6 A;  5BPD A;  1Z3X A;  3Q0V A;  2MSY A;  2KIF A;  3RPU A;  3GX4 X;  2V4J C;  3CD6 I;  4X1E A;  5D6F A;  2KRF A;  2H8R A;  5BPI A;  1MJ9 A;  3KP6 A;  2NVU B;  1DPR A;  1MMS A;  4IF4 A;  2IS4 A;  2FA5 A;  3HTS B;  3I56 I;  4B43 A;  2HOT A;  2K85 A;  1JUS A;  3S2H J;  2R7X A;  3W6K B;  2DOF A;  1VQN I;  2EB7 A;  3LFU A;  1IV6 A;  3S15 J;  3ML6 A;  1X4P A;  4G8X A;  3LSG A;  1P4X A;  1EH8 A;  1RZ4 A;  2E7W A;  2Y48 A;  4RGX A;  3X2Q H;  2VE9 A;  4G12 A;  2WAQ A;  2YPR A;  1AKH A;  2G9W A;  2M7B A;  1HDP A;  1Z05 A;  3ASO H;  2ZB9 A;  2E1M C;  2XPV A;  4D5F A;  1JGS A;  2R93 J;  2BVM A;  4BY1 J;  1R5H A;  4YII A;  2L4M A;  2I8D A;  1ODD A;  2P81 A;  4YFK F;  1Y39 A;  1O3Q A;  3HOV J;  1HC8 A;  5CVU A;  4E4H A;  1EKE A;  1MMA A;  1Y56 A;  3PUF A;  1FT9 A;  4LLG F;  1N77 A;  4KMF A;  4XOT A;  3I0T A;  5C4X J;  1OR7 A;  2QBY A;  1BI0 A;  2FNP A;  2QVO A;  4HOB A;  1QPM A;  2WA0 A;  3WGH A;  3J81 K;  4BJT A;  1IZ1 A;  1ETQ A;  3A0H C;  3QPT A;  4XMY A;  1X1A A;  4XM3 A;  1HQC A;  5E8G A;  3OS1 A;  1WJB A;  1W5S A;  4GYI A;  4XID A;  2P0W A;  2L9N A;  3QQA A;  3MKW B;  1TC3 C;  4MTE A;  3JRI A;  4EEF G;  3TL4 X;  1FZP B;  4AYB N;  1FTT A;  5CLS A;  3JSP A;  1HXD A;  3F72 A;  2W82 A;  1XD7 A;  2R5Z B;  2TCT A;  4CDG A;  2EIK H;  2GXB A;  4EMS A;  4F55 A;  3FMS A;  5E18 F;  3LSR A;  3OIQ A;  2X0L A;  4EJV A;  3LSI A;  2DK8 A;  2VXZ A;  3O8G A;  3GUD A;  4LOC A;  1UHS A;  1XGS A;  1NTC A;  2ESH A;  4XIC A; 
#chains in the Genus database with same CATH homology
 2E1M B;  3L2V A;  2CV2 A;  2BW3 A;  2HDW A;  2CUZ A;  3H9G A;  4Y4R A;  3SYT A;  4BE0 A;  4LIU A;  1UAA A;  2X85 A;  2X1E A;  2V1N A;  3PJR A;  4BGD A;  5KNL A;  5FRO A;  4G6T B;  2MD0 A;  2HQA A;  3AFH A;  4N4O B;  1GLN A;  2LOO A;  3MMY B;  3DKY A;  3ONQ A;  1ERD A;  2K5C A;  3DLA A;  4RLQ A;  2R7W A;  3PNT A;  2O5R A;  2FUG 2;  1WJC A;  3S8P A;  1OR7 C;  3K10 A;  3OYK A;  2XAU A;  4CCN A;  4PSW A;  3PSF A;  4B47 A;  4HEA 2;  3K70 D;  4ZYA A;  2X6Y A;  2BVL A;  3BCA A;  4E6K G;  2IGN A;  3VSL A;  2CS3 A;  4J00 A;  2HVQ A;  4B48 A;  3OYL A;  2ZXI A;  2VIX A;  2W1O A;  2IXS A;  4R79 A;  3K4B A;  4BAC A;  2R4G A;  2WY8 Q;  4XQF A;  3K6G A;  4DOZ A;  2V26 A;  2X1C A;  1WJD A;  3OYG A;  2KZV A;  4CZC A;  4FAS D;  1R6R A;  3OYI A;  3OS0 A;  2KRH A;  3RSN A;  3VSK A;  2Q1Z B;  3OOU A;  4PSX A;  4E7K A;  2F4I A;  5CQE A;  1T95 A;  1D0Z A;  3CZ6 A;  1P9Q C;  1V5E A;  3QYB A;  1D0Y A;  2LH9 A;  2R7V A;  2MC4 A;  4XR6 A;  3EPZ A;  4XKW A;  4NUB A;  2DCE A;  4ZC3 A;  5LD2 C;  2LRD A;  3RPU D;  1Z3Y A;  3AKZ A;  2NOJ B;  2MYS A;  2R7R A;  3DPL C;  4E7S A;  4RM3 A;  2VQL A;  1IRX A;  2VAS A;  3NWT A;  2ZSH B;  2HNH A;  1PYV A;  4D9J A;  2CFO A;  4XON A;  3DPU A;  2UV1 A;  4HRI A;  4RLF A;  4N4N B;  5HLT A;  2K9M A;  3D5L A;  3ZRG A;  3FHN A;  3IP4 B;  4JQF A;  3QOD A;  2RQQ A;  4LG3 A;  3K4J A;  3BCB A;  3H5A A;  1MMN A;  3L2W A;  2Z2S B;  1MMD A;  3K4K A;  4OAY A;  2K9L A;  4BUP A;  2X6X A;  3A2K A;  4CA0 A;  3NWS A;  1V5G A;  2GOM A;  3DTK A;  4ZTF A;  3K4C A;  2Z16 A;  1NG6 A;  4F93 B;  3PNY A;  2PJR A;  3VYR B;  4U87 A;  3RCO A;  2UWM A;  2CW8 A;  2XC7 A;  2RRE A;  3HXL A;  3H9Q A;  5TGT A;  4CCO A;  2KLO A;  5KHD A;  4HPQ A;  2VKH A;  4ZDL A;  2DJI A;  2KDO A;  4F91 B;  2VLA A;  2R7Q A;  3OYH A;  1LKX A;  4XLC A;  3HPG A;  1SFK A;  2CV0 A;  3ZR8 X;  3H0D A;  2JVH A;  2KRC A;  5FRM A;  2JVG A;  4FET A;  2L9S A;  4AYB A;  2W4S A;  4PUS A;  4XLE A;  2WB1 A;  4DIQ A;  4F52 A;  3W3C A;  4RMN A;  1BOB A;  3DU5 A;  4XNF A;  3UNG C;  3CJQ B;  2OC6 A;  4PJL A;  1W36 D;  5CKT A;  4D1Q A;  4J01 A;  4KIS A;  3RQ4 A;  1BR4 A;  2ZXH A;  3OYF A;  2W7N A;  3J7A Y;  2KP6 A;  2M4G A;  4CCJ A;  4NNJ A;  2VXD A;  2VB6 A;  2ELJ A;  1TT0 A;  3K4L A;  1UEL B;  2ZFU A;  2R7O A;  3HPH A;  2E5Z A;  3RTR A;  3QYF A;  3SEQ A;  2E60 A;  3C2G A;  2CV1 A;  4Y33 A;  3BLY A;  2JUG A;  4C2U A;  1TZL A;  3MD2 A;  1UG0 A;  1WJF A;  2KMU A;  3LMM A;  4LIT A;  3FKJ A;  2LY1 A;  3OYM A;  2LG4 A;  2LRE A;  1AA7 A;  1W36 C;  1K6Y A;  1DQU A;  2VQC A;  1SAU A;  4OAZ A;  4YRV A;  1J09 A;  1OLT A;  4HST A;  4BJ5 C;  3QYE A;  4MLO A;  2Y0S A;  1X19 A;  4BS9 A;  4XKC A;  2AQE A;  2CH0 A;  2QKM B;  1KON A;  4C9Y A;  3IAS 2;  3TMO A;  3UR3 C;  3IAM 2;  4AU7 A;  4BL0 B;  1WJ5 A;  4BEH B;  2CUJ A;  5HOO A;  2WY7 Q;  2MFZ A;  2PMZ A;  3A4C A;  3BC8 A;  2Q2E B;  3DKX A;  4E7Z A;  3VYS B;  2KL4 A;  3CF2 A;  4HNT A;  2R7T A;  2XDV A;  3HOS A;  2M7A A;  3OL4 A;  3KX2 A;  4C2T A;  2R7S A;  1MMG A;  5CQG A;  1D0X A;  3E0J B;  3DWL E;  4RM2 A;  3CJR B;  1FMV A;  4IZZ A;  4DGW B;  2VJ4 A;  3DQV C;  4E7J A;  2OV7 A;  4II2 A;  4DJA A;  4PJJ A;  4XN3 A;  3OIP A;  2Z1D A;  5FRN A;  1WFX A;  3GBG A;  2K3P A;  4XKB A;  2LYC A;  2KHM A;  4BQN A;  2A6T A;  4CH7 A;  3LL7 A;  3HKZ A;  1ZEL A;  3H35 A;  4XOP A;  1Z7L A;  2DT6 A;  4U7B A;  4DBQ A;  2IS6 A;  1X1B A;  3S93 A;  3IUO A;  1LFP A;  3AL0 C;  2HZD A;  2HPI A;  3CP8 A;  3CP2 A;  3LSK A;  3SEZ A;  1Z21 A;  1E0E A;  3K4M A;  2HU9 A;  4CUG A;  4P1W A;  2V6E A;  4ZDO A;  1DGR M;  3EUA A;  2X6W A;  3FDY A;  4OWR B;  3QOE A;  4BE1 A;  3DEE A;  1X4O A;  4GRI A;  3C2H A;  3HG9 A;  3W2V A;  1NG7 A;  4QPO A;  2UUZ A;  3H9J A;  3U21 A;  3M1C A;  4ITV A;  1MND A;  4IKF A;  1BR2 A;  1MW7 A;  4ZJZ A;  3OYD A;  3ZGK A;  3D5R C;  2GOX B;  4KIT B;  3CMM A;  3W2A A;  1YX3 A;  1QU3 A;  3CES A;  3H5N A;  4HSR A;  4B3X A;  2HVS A;  4ZDP A;  1G8X A;  3LSH A;  2RNG A;  3PNV A;  4KJZ A;  2OUM A;  4BQO A;  2XF7 A;  4XOR A;  2VJJ A;  1VZ0 A;  3KEY A;  4EAT A;  5LFA A;  1D1A A;  2WBM A;  3BG6 A;  1Y6I A;  4P5O A;  3SDB A;  3M8J A;  4PK4 A;  4E7L A;  2M4K A;  2DXI A;  1DP3 A;  2IS2 A;  4BDZ A;  2X1D A;  4ZTJ A;  3OYN A;  4YEL A;  3PSI A;  2W00 A;  4B44 A;  3DTI A;  3F9K A;  4HNU A;  1N75 A;  1PJR A;  2R7U A;  4PFP A;  4DBR A;  1G59 A;  4XKV A;  2LC2 A;  2VJI A;  4Y3O A;  3MKY B;  3PUB A;  2V7F A;  3I3L A;  4CSW A;  3W2W A;  3DPT A;  4PJN A;  3K4N A;  1YE9 A;  1LVK A;  1U0J A;  2VJ5 A;  2L2O A;  2LBF B;  1WJA A;  1MNE A;  2WAF A;  5CPR B;  2F6C A;  4XLH A;  3LSM A;  3OYC A;  2JSP A;  1LDK B;  2HVR A;  2IGK A;  1YX5 A;  4HG2 A;  4CCL A;  4F3Q A;  2MAB A;  5JHF A;  2F5V A;  3VWB A;  2QKL B;  4BJ6 C;  2JA2 A;  2A5W A;  2BOL A;  5HNF A;  4BU2 A;  3OR1 C;  3ZCO A;  3H5R A;  4IQ4 A;  3OY9 A;  3KYL A;  4E7I A;  2HPM A;  3VDX A;  4C30 A;  2KQR A;  3EUH C;  1S9H A;  2VQH A;  3V42 A;  1EA3 A;  4XN0 A;  4H4K C;  3OYJ A;  3HL2 A;  1QHG A;  2XSJ C;  3SZG A;  1Z3X A;  3BG7 A;  2PJR B;  2M3A A;  3G2B A;  3PL8 A;  3L2U A;  1V5F A;  3S32 A;  2V4J C;  4ANJ A;  1FMW A;  4IQJ A;  3L2R A;  1T0F C;  2L5Q A;  2WAD A;  3K70 C;  3OWT A;  4BQQ A;  2KPM A;  1D1C A;  3E1S A;  3HC7 A;  2VKD A;  3L2Q A;  2IS4 A;  3OMY A;  1N78 A;  4B43 A;  3S3M A;  2R7X A;  3MKZ A;  3S3O A;  2LBF A;  3LFU A;  1D1B A;  2X51 A;  1X4P A;  3HOT A;  3LSG A;  5HNH A;  3FBI B;  2WAQ A;  4PJM A;  3I9V 2;  2M7B A;  1DGW Y;  3N05 A;  4BEH A;  4BXF A;  3ZQQ A;  4XLF A;  2E1M C;  3FBN B;  2BVM A;  2BW3 B;  4F92 B;  2IS1 A;  4AVZ A;  3PFY A;  3VYU B;  4QPQ A;  4JOM A;  3OL3 A;  2DT7 B;  4NQW B;  2VL8 A;  2I8D A;  2WAE A;  4X0G A;  2XF6 A;  2ZSI B;  3EUK L;  1BR1 A;  2CMP A;  4PFO A;  2LY2 A;  3HUG B;  4NC7 A;  3DTE A;  4E4H A;  2IGO A;  1MMA A;  2E5N A;  1Y56 A;  2VQG A;  4XL9 A;  3OYA A;  2AQF A;  1N77 A;  4XOT A;  1JI8 A;  4E7H A;  1X1C A;  2WA0 A;  2M0M A;  4BJT A;  3DU6 A;  4XMY A;  1X1A A;  4XM3 A;  2CW7 A;  1HA8 A;  2L7K A;  3OS1 A;  1WJB A;  4BDY A;  2P0W A;  2L9N A;  3D5S C;  3MKW B;  1QHH D;  3OR2 C;  3A1Y A;  3TL4 X;  3OYE A;  2XF5 A;  4KT6 A;  4NC8 A;  4BE2 A;  2W82 A;  1WJE A;  3TBI A;  4YEJ A;  3AL0 B;  5KCM A;  4F55 A;  3OYB A;  4II3 A;  4CCK A;  3OIQ A;  3VYT B;  3OS2 A;  2V9K A;  3LSI A;  4CCM A;  2VXZ A;  5HVQ C;  3ZXS A;  2IGM A;  1X1D A;  4LIV A;  4XLA A;  2VPL A;  2DOA A;  4IX7 A;  3S3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...