3RCOA

Crystal structure of a conserved motif in human tdrd7
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
76
structure length
76
Chain Sequence
MLEGDLVSKMLRAVLQSHKNGVALPRLQGEYRSLTGDWIPFKQLGFPTLEAYLRSVPAVVRIETSRSGEITCYAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tudor domain-containing protein 7
publication title Crystal structure of a conserved motif in human TDRD7
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 19
structure length 76
sequence length 76
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12872 OST-HTH OST-HTH/LOTUS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1880 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3rcoA00
3S93A 2KZVA 2LY2A 2LH9A 2LY1A 2KPMA 3RCOA
chains in the Genus database with same CATH superfamily
1WJBA 1FMVA 1FX7A 4DGWB 4JBAA 4EJOA 2RN7A 4CZCA 3GTLJ 1D0ZA 2VBYA 3KX2A 4ZC3A 4XICA 2Y69H 4JQFA 1VQPI 3GTPJ 1R23A 3EUKL 5H20A 4WF2A 2XVCA 3GZNB 2Y0SA 1QZYA 3E5UA 2JUCA 4FHTA 2VC1A 4MNUA 3K6GA 5FB2A 3J80K 4Z6YA 1O3SA 4WWCA 4BE1A 2HQRA 5JHFA 1JI8A 1Z91A 2MC4A 5DD8A 1MNMC 4M71A 5FLMJ 3ABUA 1QA6A 1I3AA 1JXSA 1AKHB 4EJUA 1OYWA 1W36C 2MA3A 2KMUA 4F91B 4ZDPA 2JVHA 1FSEA 1LB2A 3SEQA 1UG0A 1Y6IA 2CUZA 3P7NA 4HNUA 2QQAA 2FRHA 3F21A 4UY8I 1BJAA 5F6FA 1FOXA 4ZYHA 1ZAOA 2CGPA 5CVIA 1FLIA 2O03A 2X6OA 4RAFA 3ASOH 4ENMA 1R00A 1J0RA 1K7AA 5LLQA 4GYIA 1WJFA 3D5SC 3SJMA 3ZQIA 1WH5A 3TKYA 3BZKA 2F5VA 2VJJA 3JAMZ 3CCMI 2CRGA 1P4AA 4Y15A 1FNNA 4BE0A 2QYOA 3ASNH 1G59A 2WADA 4IOAF 2LG4A 2K86A 4Y17A 3CJRB 3G3ZA 4B1RA 4C2TA 4NB5A 1XGMA 4I02A 2DO7A 5LGNA 3OY9A 2FD5A 5EDNA 1VQ8I 3FK7A 3UNGC 3FXMA 3CUQB 2M8EA 1ZR2A 1SFUA 1VQ9I 1JT6A 1T08B 3W2VA 3AKZA 3OIPA 1P7JA 2WBMA 3ABLH 3CLOA 1OMIA 1TW2A 4HLXA 4CCMA 5EG0A 4BQNA 1PP8F 1A6IA 3HIFA 3OYGA 2DT7B 4RB3C 2K02A 3I59B 4AU7A 2ICWG 2QQ8A 3R60A 1BW5A 3OYLA 1N25A 4BJ6C 2OV7A 2IS2A 3BC8A 5LHHA 1BIAA 2IRFG 3H5AA 3QODA 3LA2A 5JI6A 4PGGA 1ZELA 2H6BA 4YIRX 1HW5A 3CJTB 1BR1A 3D0SA 1B6AA 4EJWA 1F9NA 1OYIA 1Z6TA 1HKQA 2WY8Q 3GLXA 3V7RA 1B72A 3R0AA 4M73A 4NUBA 5ICCA 1IN8A 3B6CA 3IAM2 4MTDA 3K2AA 3VYUB 3H35A 3Q0WA 3SHFA 4JYKA 3BQYA 3LAJA 2BEOA 2KHMA 1J5YA 2Y48A 4BH9A 2JK3A 2L01A 1SAXA 4D5CA 1FP1D 1K83J 3O8GA 2EPFA 4UB8C 3J81Z 4IO9F 5AIQA 5FD6A 4OWRB 4OINF 2DFIA 1FEXA 1OCPA 2LDUA 4ASNA 5FLXK 3K1PA 4S05A 2HQNA 1GLNA 1GHCA 1ZR4A 2BXYA 3F8MA 3PM1A 5E3MA 4J19A 2HYJA 2PG4A 4IXAA 2VKDA 4JP0A 3BPXA 1VQ7I 4RA2A 4RGRA 4CCLA 1H89C 1J2XA 4XKCA 1V5GA 3B73A 4EEFG 4C30A 1G3TA 2GM4A 3OMYA 3SYTA 2OQGA 3RDIA 1BC8C 2K5CA 2VQLA 4MGRA 3W3CA 1EH8A 1ETVA 1Y0NA 4ITVA 2EIMH 1MMAA 4ZH4F 2FOWA 4MFEA 2ZMEB 3BJOA 2P4WA 2Z5UA 1WFXA 2XB5A 1DP7P 5IT3A 3I58A 1T95A 1KYZA 3CMMA 3VYRB 3DP7A 1WQ2A 2ME0A 3GMEA 4RS8A 5E1ZB 4P96A 1FSHA 4LFUA 4DNCA 2AXLA 3T8RA 2JA6J 3MZYA 9ANTA 2IXSA 4RM2A 1ZRCA 1DDNA 5FD5A 3LL7A 4KA4A 2F6CA 1Z1DA 3BTCA 3LSPA 3LNQA 4HDUA 1X1AA 4N9HA 3ZRGA 5B3SH 1WHUA 2L7MP 2K85A 3BR3A 3EDPA 4JOMA 4UUSA 1SD7A 3WTZA 1FT9A 3BTLA 3HOXJ 5KAFC 1D0YA 3ZP5A 2JPBA 1AA7A 1KQ0A 3S3MA 4RLFA 5GPCA 3K70C 2DXIA 4N0BA 1IV8A 5EGOA 3QYFA 4IL6C 3HUGB 1FOYA 5ILVA 4XLEA 3LSJA 1CF7A 3S2DJ 4IPAA 4XRFA 1IRXA 1NK3P 3OV8A 2CUEA 1XPXA 2BGCA 3GTGJ 4DIQA 2R7TA 4RB2C 3S32A 4LITA 1X3ZB 3A4CA 3ROUA 2CO5A 2K4BA 4A2UA 1P7IA 2L54A 5J1RA 1YJWI 2WV0A 1RESA 4I2OA 2V79A 1KQ9A 3VYTB 3I71A 1HDPA 2KIFA 2CS3A 2EZKA 4X6AJ 2XC7A 4KNYA 4XORA 4ENKA 1Z3YA 2IGOA 1QVTA 2W85A 5LHIA 4I0BA 2XDVA 4QPOA 3BTJA 1T0FC 4BJTA 1TWCJ 3V7SA 3ZQCA 3P9CA 4XLNF 1R9TJ 2F5CA 3TO9A 3CMEI 3NAUA 3JRIA 2LD5A 1P9QC 4HQMA 2BY3A 2ETHA 3NRVA 4XLAA 3UKGA 2UXNA 1WI9A 2QKMB 2XRNA 1PUFA 1K78A 2BV6A 1YS6A 2X48A 3U1DA 1YJ9I 2KLOA 4DW6A 2IVMA 5M5XJ 2HVRA 2COBA 5E3OA 2Q1ZB 5L3CA 3IKTA 2VQGA 2R3SA 4XKVA 3O3KA 2PEXA 1OQYA 2KL4A 3P5JA 3LSKA 4KITB 1USTA 3VODA 3ZXSA 1W1WE 4P9FA 3KEYA 2PBIA 4UV9A 2BHZA 1XX5A 3I53A 2E34A 1U6GA 4EM0B 1R5HA 1NG6A 2CQXA 3PQKA 5L3BA 1MDMA 4XLFA 1R5GA 4G94A 2A61A 1JUMA 4YIFA 1LFPA 4DBRA 4ZDOA 2IGKA 2XSJC 2DTRA 2ACJA 3NWSA 2P81A 3GWZA 4Q4ZF 1U5TC 2I10A 4CCJA 3Q5FA 3AL0B 2UXXA 4XRSA 2BY1A 3DEEA 2G0EA 4E7HA 1LVKA 2M4KA 2NAZA 3FZVA 1U8BA 1SMTA 2IPQX 3ZMUA 4P1WA 4EVIA 3VEPA 4CYCA 2PN6A 4ZYEA 3PFIA 2DJNA 5EJCA 2JUGA 5ERIA 2HVQA 3WG7H 3OS2A 3BR1A 2EQRA 3G4SI 2NVQJ 1JGSA 1SFKA 3V7CA 3E7LA 5H2FC 2Q2EB 4ENNA 4AIDA 2LBFA 3HC7A 2YX7A 5J6XA 2XGEA 2ZFUA 5ILUA 1IZ1A 4E7ZA 2RDPA 5D6EA 1O4XA 2KJCA 5IYBJ 1ZKGA 3FMQA 5D8LB 4NQWA 4A3FJ 2VB6A 2AXTC 2LP0A 4RAZA 5M3MJ 1YG2A 1KU2A 1YI2I 4A3GJ 4F7ZA 3FXOA 2FBKA 1IAWA 3TP0A 4EJVA 5TRDA 4BAYA 2LKSA 4Y13A 1I39A 2HQAA 3CCQI 1EH7A 2QZ8A 3PIPF 2QSGX 3C2HA 4I0AA 3FHZA 1W0TA 2LK2A 2CJJA 2CYYA 2EV6A 3RQIA 3CC7I 3L2WA 4KIGA 5DTDA 4CCOA 4PJJA 2DTZA 2GOMA 5DCFA 1RRJA 2E1OA 4RAYA 1XMAA 1SVLA 4XLCA 2R7FA 3X2QH 3SZTA 4KN7X 2Y9ZA 3ZCOA 1X1CA 1UJ8A 2J5OA 2H09A 1WVRA 2E2IJ 2ZCWA 3IHUA 3RYRA 2Y75A 3BDDA 1X2MA 3M7GA 2L9SA 3PSFA 4FE4A 2O6GE 3LA7A 1IN7A 4C9YA 2A5YB 4AVPA 2VPRA 4NHJA 2JA2A 1W7PD 1Z77A 5LBQA 1R6RA 3H5RA 2FQ4A 1J7KA 4YRVA 4IZZA 1IXRC 2X6XA 1DU6A 5KCMA 4KICA 3E3VA 1V5EA 2RC4A 2X9DA 3K4MA 3VSLA 1B59A 2F5DA 1Z05A 2ZJPF 3OWTA 1GVJA 1SFEA 3UR3C 4IKFA 1O7FA 2MC3A 3TP3A 2EWNA 1RKWA 4B8XA 3AAFA 3W6VA 1O3QA 1HA8A 1IUYA 2K9NA 5K7ZA 1RI7A 3CO7C 3HOUJ 1FYKA 5J3LA 1KONA 3HDDA 4UVAA 1DPUA 3RKYA 1MZBA 4HG2A 2KZVA 3KLOA 3HTSB 4ESFA 1S7OA 2VBZA 3ZMTA 4E7LA 2XHKA 2NOJB 4BHCA 1YITI 5IP7J 1G4DA 3HEFA 1MBHA 3DLAA 2MSYA 4UXNA 1SEUA 2HU9A 2F4OB 3BR0A 1NTCA 3OYAA 1B8IB 3CQZJ 3DEUA 1CGPA 2L0KA 5GPAA 3FKIJ 1JUPA 4EM1A 4IJAA 4IHXA 1HOMA 3J81K 3RZOJ 2HOSA 2XSDC 2HFHA 1G3YA 2FBIA 3CF2A 2W7NA 4KYWA 3BQZA 4F93B 5C3EJ 1LVAA 2TRTA 4BGDA 5IOZA 3W6KB 1FTZA 2E7WA 1LEBA 2XPUA 3K4CA 5FKKA 4QTRA 1LKXA 1FYLA 4M3DA 3S1QJ 2KT0A 3HXLA 3BG5A 2TCTA 2E5NA 2ESHA 5E3LA 3DCFA 4G9YA 5KVRA 4PJ0C 2R7RA 5DDGA 1HKTA 2O5RA 3H36A 2QF7A 5F27A 2HPMA 3I4NJ 4U0WA 2JPCA 1S29A 1TWAJ 2J5PA 1T39A 3W6JB 2FSWA 2VC0A 4WXHA 2DMPA 2VLAA 3QYBA 2CH0A 3EETA 1S72I 5LEKA 4BXFA 4UV8A 4E6KG 3DXJF 3FBIB 1MBKA 2XAGA 1I5ZA 4AM3A 1IRFA 1Y56A 5DUIA 1RUNA 2ZC2A 2L3DA 2DT6A 2IS1A 3JW4A 4LJZF 4HX8A 4M6VA 4G6QA 2PMHA 2Y2ZA 3F0CA 4ESJA 5M5YJ 2M0MA 2KP6A 4XOTA 1W7PA 2XF6A 4DBQA 3OYHA 2EJRA 1LDKB 4Y52J 3ABKH 1O3RA 1POGA 3EPZA 4DQ2A 2H27A 4KDPA 1WJAA 3TOBA 3HL2A 4XMYA 1X3UA 1H9GA 3A03A 3VOEA 4AIHA 3OIQA 1WGXA 3KCCA 3F9KA 2B0LA 3QQAA 4BXUA 1ON1A 1Y8QB 5E17F 4K2EA 3HGYA 3FBNB 3K9TA 2P5KA 5J1YA 2M34A 3ABTA 1NG7A 2R7VA 3OYNA 3C1DA 1TZLA 4L9TA 2V9VA 3NQOA 5FROA 3CDHA 1HW1A 1MBEA 1H9TA 1HSJA 3AG1H 2O3FA 1MJAA 3E97A 1MKMA 1MNDA 1OCZH 2YS9A 4RLQA 2A6EF 3PNYA 2WWYA 3A02A 4R1HA 3WTWC 1FMWA 2NYXA 1I6HJ 3S1MJ 3K4KA 5GADJ 2GLOA 5DS9A 3JRCA 1LDJA 4XM3A 2HXOA 4CXFA 2R4GA 5CPRB 4ZTFA 3F72A 2MGQA 4OIPF 2OZUA 3DBRB 4HF1A 2H1LA 1RIOH 4BHPA 1OR7A 2JSCA 3JTGA 2ME6A 1YRNB 2GIZA 3CD6I 3GO5A 3HZJA 3L2VA 4IQJA 3FMSA 3T1BA 2LF8A 3BP8A 3S3NA 3JTHA 5CJ9A 2P8TA 4KFCA 3O8HA 3OS0A 4IHSA 2WC2A 4HX4A 2NRAC 4C3HJ 3S1RJ 2E35A 2IBDA 2MW8A 2P6SA 3QP6A 4OOIA 1BI0A 1MGTA 2LF7A 5JR3A 3SZPA 2XROA 2RREA 1G3WA 1XTAA 3JSOA 3F8CA 4EGZA 2NNNA 4HNTA 2Y31A 4L9VA 2L5QA 4A6DA 2XB0X 3FF5A 1T33A 5E20A 3R61A 5EEAA 5D5WB 4E4HA 2CFXA 3HRTA 1YS7A 2Z33A 3AL0C 2STWA 2OTLI 2K3FA 2NVXJ 2GXBA 3HSEA 1A04A 5D6FA 3PIOF 2H8RA 2C6YA 1R58A 5F04A 1BI2A 2BW3A 5HLHA 1LE8B 2YPRA 3HTUA 2DDAA 2ZO4A 5DYMA 4AIKA 4LOCA 1TNTA 4FETA 3U2RA 2Q8KA 2QA4I 4JX5A 4XKWA 3FX3A 1JGGA 3GTQJ 2VXZA 1U5TB 1X4PA 3T5XA 3T8TA 5FO5A 1EJ9A 5M3FJ 2NS8A 4M72A 1Z21A 3WHCA 1FJLA 2VQCA 3DTIA 5B5EC 4FQGA 4I99C 1D8JA 1HW2A 1QHHD 1K4SA 1LPQA 3MWMA 3K70D 3LSGA 1ODDA 2VKHA 4Z2YA 1QU3A 2DA7A 3WTUC 2QCOA 4U7BA 1L3LA 1RPWA 2R92J 1BI3A 2HGCA 2XKOA 1Y8RB 3DEWA 4HDVA 3GEZA 5K5OA 2HYFA 4A3MJ 1OKRA 3FXKA 5JFRA 3IL2A 5BPIA 1RR8C 3K0LA 4M3FA 2F4IA 3S2HJ 1YX5A 2DFHA 1D0XA 1Z3XA 4QSHA 2E7XA 2GWRA 3LA3A 1IF1A 5KNLA 2EZHA 5CYVA 1RR7A 1XDSA 1ZGAA 1WPKA 3E5XA 5C4JJ 3WU1B 3H5NA 2OPTA 2UWMA 3CUOA 1R1TA 1ON2A 2GXAA 2NVYJ 4HSTA 2OUMA 2DN0A 2QGUA 2WB1A 1K6OA 2MBFA 1BJZA 4U88A 5D8KB 3DKYA 5JHUA 1ZRFA 1FZPB 2BYVE 2MFZA 2JT1A 2DOAA 4F3QA 3WTYC 4N9IA 3LSTA 3ECOA 1V4RA 1VQMI 2XAQA 2FOKA 2HOAA 2TDXA 2WB1N 3E6MA 3GYHX 3PJRA 2O7OA 3P9KA 1P4XA 2DMUA 3VYSB 3KLNA 3CCEI 1REPC 3DPTA 2FBHA 4XN0A 1YYVA 4ON0A 1IXCA 3EUHA 3J7AO 2V1NA 2DMTA 3FXJA 2BY0A 5GAGJ 1GVDA 1V3FA 4PFOA 4W1UA 3D1NI 3W2WA 3KP7A 3FXRA 1DGWY 3MKWB 2HWVA 1TP4A 2AS5F 2V7FA 3L9FA 5FKNA 2QQBA 2DOEA 1RC9A 2G7UA 4YELA 5HVQC 1U8RA 4PK4A 4HZFA 1F4KA 4LLNA 4MFDA 2VJ5A 4H0EA 4XRMA 4RBOA 1G3SA 1KU3A 1SFXA 2VKVA 2XAUA 4M6XA 1FOWA 1LDDA 3HOTA 2OA4A 1QPMA 2OC6A 5IPAA 2MH2A 1YW8A 1D5VA 1D1AA 2PMUA 2YU3A 3GFJA 3EUAA 4M3GA 4MIMA 3AFHA 1QHGA 2HOEA 3ULQB 1UG2A 2AO9A 4A3IJ 2XAHA 2LY9A 1I6XA 1ZTRA 3H9JA 3K10A 4CYDA 4IHYA 2XIGA 1E0EA 2PJRB 1ZARA 1ZLJA 1A5JA 5FJ8J 5LGUA 1PDNC 2E36A 1S8NA 3REOA 1C0WA 5EEHA 3HRUA 1PYVA 2CWEA 2PX9A 3F8NA 1ONVA 4C2MJ 1XS9A 2QBYA 3H1CA 5DM7F 4A3DJ 1S3JA 1T0FA 3KZYA 3R4KA 4CUGA 4PZJA 1WI3A 3N05A 2K27A 4LIVA 4KT6A 1DUXC 4LIUA 5B1AH 4HYEA 1YE9A 2VKEA 4CCNA 2R5ZB 1LUJB 2RKHA 3I54A 2E60A 3HRMA 5HLIA 3A01B 2P0WA 4HAMA 3L2RA 3M9AA 4A0ZA 3LSIA 5HODA 1FPQA 2JSPA 3RZDJ 2R5YA 2IW5A 1LEAA 2HS5A 5HNHA 1VFCA 2P5VA 2DYRH 3WU0A 1X4OA 4YG2F 2Z16A 2CQ7A 2AQFA 3QU3A 4KT5C 5IP9J 2IGNA 2KDZA 2V9KA 2W1OA 1OYYA 1XG1A 2X0LA 3L7WA 4FE7A 2W00A 4U87A 1XSVA 2D1VA 3ZQHA 5LGTA 3COAC 3RPQA 2BHYA 3E6BA 1K4TA 2QLZA 3PSIA 4G8XA 2OCCH 2LR8A 3ZOBA 6PAXA 1YJNI 3N97A 1SVMA 5IOYA 3SXYA 3PNVA 3S1NJ 2OF7A 2YUSA 3CCYA 4B47A 2BY2A 4A69C 4L5JA 1Y0UA 4OAYA 3OSGA 2VN2A 5TJJA 3F6OA 2MYSA 3R0JA 2M30A 1FBUA 5CLSA 4RAGA 5FKOA 3F3XA 5BS6A 2VASA 5E8GA 5E1XA 3C7JA 4F52A 3QU6A 5HOOA 5KHDA 4NC6A 1AKHA 4L0YB 3QPLA 2HTSA 2COMA 2DODA 3RCOA 3IH2A 2EZLA 3E5QA 2LKXA 1JE8A 2CUFA 2VE8A 4ETSA 4FTHA 4CA0A 4YFXF 2LMDA 4NBQA 4AVZA 4GYGA 2BE5F 3A0BC 1U78A 5FRNA 3OOUA 1STZA 3E0JB 3MMYB 1JTXA 3CDLA 5LHGA 1X58A 1A36A 2L9RA 4Y4RA 3LAPA 4D1QA 5J1UA 2B9SA 2JA7J 2CQNA 4I76A 4RGSA 5BOXA 3BWGA 3QOEA 4LG0B 2VQHA 3Q3SA 3SZGA 1TWHJ 2K9MA 4B44A 3CZ6A 3W2AA 5DEQA 3CC2I 1I27A 5ILSA 4P9UA 1T38A 2KRHA 2B63J 2W84A 1R1VA 2ZXHA 3ML6A 3BG3A 3U9GA 2ELJA 4PGHA 3L2UA 3CUQA 2VL8A 2DK5A 3RJPA 3HHGA 1VQNI 4BNCA 1ZN2A 5GTHC 3S8PA 1ETWA 5ICEA 2ELHA 2EV5A 4AYBN 3ZQLA 2ZBKA 1A35A 2KDOA 3RI4A 2PQ8A 1VZ0A 3I59A 3OYCA 2VPLA 4P5OA 3WE3A 4LLGF 3CCSI 2WAEA 4II3A 2FXAA 4A5MA 3F23A 5L3FA 4E7KA 5F1RA 2XGCA 4M3BA 4MO7A 4GDFA 3VB2A 2M5WA 1W4MA 5FKMA 3E6CC 3LQQA 3BR5A 3DU5A 1SC7A 3BY6A 1IDZA 1SFOJ 3JCUC 2CQKA 2ZXJA 3OYMA 4CH7A 1HKSA 1GUUA 1XMKA 3S93A 4B4CA 3KYLA 4XLHA 4XN3A 3JRFA 3WTXC 2YR2A 3DKWA 3F22A 1Y1WJ 2W4SA 3BG7A 2FUG2 4DZJA 4A3KJ 4BACA 3Q9VA 2P7VB 2XAJA 1UFMA 4KIFA 2O9LA 4V2FA 1VQ4I 2F48A 2NXNB 1LQ1A 4C2UA 1TWFJ 2HNHA 2R7WA 2EK5A 5M5WJ 1ZG3A 5TGTA 3OYFA 2PLYA 3CCRI 2LY2A 5ICGA 4J01A 2EZIA 1UZCA 1HBXG 2P7CB 3M8JA 1E3HA 2OQRA 3JREA 1FBSA 3GZ5A 3O6BB 1D5YA 2D5VA 4EM2A 2EA2A 1R1UA 5IYCJ 2HDCA 4NNJA 4BBRJ 1L0OC 2N8GA 3FXLA 4V2GA 3DBLB 4GRIA 3SEZA 3OS1A 3E1SA 2VONA 1PUEE 1SD6A 3BPVA 1U3EM 4L18B 5CKTA 3ZR8X 1Y39A 3IWZA 3K1NA 4LD5A 2G9WA 1T56A 3ZGKA 4BEHB 5DCMB 2PI0A 4H4KC 2ZMEA 4ABZA 3V42A 3HSFA 1QBJA 3KP6A 4CGZA 4Q48A 1A31A 2DLLA 5LRRA 4GFBA 4HX7A 2L7ZA 1VNDA 2EILH 3TO7A 3EYYA 2KRCA 3AG4H 2YX4A 4D5FA 1IG7A 4YEJA 2HZDA 3RTRA 3CMAI 2D1HA 1X1DA 5LD2C 2EB7A 3KPHA 1X3WB 5F0CA 3RIRA 4D7MA 3GX4X 2K40A 4LK1F 2DYSH 3HOVJ 1QGPA 2JN6A 4AWXB 3M1CA 1D1CA 2CW8A 2LRDA 3KP3A 3KYCB 2ESNA 3OIOA 5K5RA 2GQQA 2XRLA 5C4XJ 4XONA 1QZEA 2M9HA 5F64A 2NVUB 2I5UA 4DJAA 3I4MJ 3GUDA 2KQRA 4HLYA 4OU0A 2HQ5A 1WSUA 2Z9OA 4XK4A 3HUGA 5E8IA 1ETQA 1VQOI 4KMFA 2XV4S 3MKLA 4OIRF 1R4MB 3PO3J 3TMOA 3DPLC 2DA2A 3FDYA 1USSA 3ISPA 2A69F 4F92B 3OR2C 2WAFA 2E1MC 3J7YJ 2O8KA 2KZGA 1Z67A 5B1BH 4JX6A 3GTMJ 1MNEA 4I09A 3DLLF 1W36D 3WGIA 1HCRA 2DA3A 3K1MA 3HM5A 4IHTA 1PJRA 2V9PA 5D4RA 1ENHA 3ZQQA 1ZRDA 1DP3A 3BTIA 4WCGA 3HOWJ 2CG4A 3BT9A 2V1DA 3TQNA 2HKOA 2EFQA 2XGDA 2RNGA 5EF6A 3D5RC 1S7AA 1ORKA 3LSMA 3TDZC 2KJBA 1UB9A 1WRJA 1ZK8A 3I9V2 5LEJA 1PVEA 4ANJA 2E19A 3KZZA 2R7OA 2STTA 4YFNF 1IGNA 2EFOA 1J09A 2IS6A 1BC7C 3WGHA 4ZDLA 4LLLA 1U9NA 2A6HF 3LOCA 2LC2A 1HF0A 3S2WA 2HDDA 1SD4A 4JX4A 2ID6A 1JHHA 1KU9A 2XKPA 3MKZA 2V6CA 4E7JA 4A93J 3HKZN 4BKXA 3IKVA 2IP2A 2JQ7A 4XKBA 2A3SA 2ECCA 3C2GA 1YX3A 5D5XB 1R5ID 1V54H 4BU2A 2OJED 4HF2A 4E70A 5EG0B 2Z99A 4LGWA 4MEYF 3F6VA 3B02A 3CP2A 3M4OJ 1QO0D 1K79A 3HOZJ 2K9QA 4S04A 1MMSA 1MMGA 4IRGA 1GV2A 3WTVC 2K9SA 2M3AA 4C3JJ 3GTKJ 2DBBA 2W25A 3I4PA 2X85A 4M74A 2R7XA 3TGNA 3H3UA 5IP6A 2O0YA 4A5NA 1BBYA 1B72B 2BBYA 2L9VA 1E2XA 3SFIA 3GFLA 1XCVA 1QRYA 1NHAA 4RB1A 2M2EA 3QPHA 3OYKA 1WH7A 2DK8A 3U1KA 5JLXA 3CJQB 1B9NA 1IUFA 5BMZA 3K4BA 5HLGA 3QOPA 2P6TA 2M4GA 3P9IA 4IRHA 5E1WA 5A2QK 1IO2A 4GCVA 2VJ4A 1KYWA 3DWLE 2F4MB 1KGSA 4M9ZA 3GW2A 2DJIA 2ZSIB 1OCOH 3L1PA 3VPRA 1DU0A 3B6AA 3ERED 1HDDC 4G7OF 4ZZLA 4B3XA 4RMNA 2EBIA 1U2WA 5JVGF 2Q2EA 5CVVA 1EF4A 1F1ZA 3C2BA 2PJPA 3ABMH 3CF5F 3GCMA 4O6JA 3BZCA 2ZNZA 1G8XA 3SDGA 3GTOJ 2O61A 3GBGA 1XMXA 1XN7A 3CC4I 3BOQA 3JSPA 4CZZA 1BN5A 1YW7A 3V8JA 5F1JA 5GTIC 4E7IA 3H0DA 1HXDA 2XUBA 4L5IA 1G2HA 3HB9A 3KP4A 2F5EA 1D3YA 2EFWA 1OPCA 4EGYA 2LLKA 1E3OC 4CO8A 4FX0A 2DT5A 1TW3A 1W0UA 3S15J 5CVUA 3RKXA 2K4JA 2HZTA 2MLGA 2WTEA 4UVCA 2FU4A 3OSFA 4A3LJ 2DCEA 3OL4A 4N4OB 5BQTA 3CCVI 4HV5A 3K4NA 2F5FA 2HKXA 3DPUA 5BPDA 2ELKA 1R49A 4PSXA 3BCBA 3LSRA 4Q47A 2IEKA 3H9GA 3HPGA 1FYMA 2CQQA 3HBLA 1AU7A 3TW6A 2OCEA 3WGGA 4UUSB 3PFYA 5K1YA 2D45A 1V5FA 1BOBA 2M7AA 3ZMVA 3FXUA 3TDUC 1IJWC 3G71I 1UHMA 1ZREA 3PO2J 1DPRA 3MZHA 5EGOB 4M6YA 2ECBA 2LTPA 2VOOA 2LSOA 4A3JJ 2DPUA 3ONQA 3H92A 1EH6A 4QWQA 4OIOF 2FJ1A 4A12A 1FBQA 2FMYA 1T98A 1CF7B 3TOAA 2E1NA 1JJ6C 1KA8A 1EV7A 2H94A 3DV8A 4BQOA 2KISA 3VWBA 3IP4B 3HRSA 4HSRA 1S9HA 4S0HB 2IT0A 2ZSHB 3CCUI 2RQQA 3I56I 3V4GA 4B09A 3C18A 1YIJI 2V26A 4U7DA 1D8KA 4LB6B 2D2WA 3WU2C 4KIBA 5GAEJ 2Y0SN 3DKXA 1IC8A 1B8IA 1FY7A 3G6EI 4KISA 1GXQA 4RGUA 4XSXF 1JJ8C 1ZHFA 2XGXA 1SMYF 3G1MA 4MLOA 4MQ9F 2L7FP 2P5LC 1OR7C 4UHTA 4DYQA 2X1DA 2KIMA 3GFMA 2E71A 4WXDA 4NDLA 2R7SA 2BVLA 3RYPA 1U9OA 1ETKA 1P6RA 5K7HA 3M8EA 3GZ6A 4FX4A 4BDZA 2DA1A 5D4SA 3WTTC 1BR2A 1MJBA 5CVJA 1APLC 2HXIA 1H88C 2OBPA 3CLQA 1IXSB 4R79A 4XIDA 1PUFB 3WTSC 1K78B 1FOKA 1J75A 1IN5A 2RQPA 2VOPA 1M1EB 3KZIC 5C44J 1ETXA 2V1XA 3LSHA 4IVNA 1JKQC 4CSWA 3J7ZI 2ZNYA 1PP7U 5EEGA 1K6YA 3ZMDA 2IS4A 4B43A 2ZJRF 4KJZA 1P4WA 2GAUA 3S3OA 4HBLA 3MEXA 3KFWX 2X6WA 2B7EA 1LNWA 2DMNA 1SAUA 3GXOA 4XR6A 2VJIA 3IC7A 1MIJA 1ZH5A 2MD5A 2E2HJ 4BY1J 1VI0A 1MDMB 3HGGA 4I01A 2K7LA 2LFBA 4BQAA 1JT0A 3H3VK 4A6EA 2R7UA 5HS9A 1ZGJA 4IF4A 2DAOA 2OZ6A 4BDYA 4AUXA 5FGMA 1W5CC 1JUSA 1MW7A 4L0ZB 5AONA 2OTJI 2EINH 4KN4X 4ENJA 1K61A 1F5TA 2FQ3A 3KEQA 1N77A 1YW9A 3IV5A 4BUPA 3J7AY 5K7FA 4TV7A 3HYIA 4XBFA 3BJ6A 1WJEA 2A05A 2A68F 2LOOA 3A0HC 1F36A 2M0CA 5J4YA 4CYCB 1OCTC 3JRDA 1OJLA 2DMQA 2LKPA 3BG9A 3JR9A 2KKOA 2XPVA 4BHBA 1AWCA 4L9JA 3JRAA 1IRGA 1WKMA 2M7BA 2M87A 2NOGA 2ZFWA 4BS9A 5HS7A 3F8FA 4WX9A 1T6SA 4M9XA 2L7KA 4ZZDA 3G1OA 1UELB 2E1MB 2R7DA 2LBFB 2VE9A 1QQIA 2EIJH 3FM3A 3QYEA 2XPWA 4NQWB 2FE3A 1XSDA 4IRIA 3I55I 4HNVA 1KQ8A 5FFXA 5FLVA 1MJ9A 1HLVA 3PUFA 3V8KA 3FIWA 1RUOA 1BL0A 2DA5A 5FFZA 3ZQFA 1GXPA 1X1BA 2L9NA 1XSXA 1JKPC 2NVTJ 5GAHJ 1YRNA 3SQNA 2H1KA 1X2NA 3S16J 4CDGA 3LQRA 3BR2A 3FMRA 1MSFC 1RETA 5DV5A 3LWFA 3MKYB 3IWFA 2ZXIA 3FM5A 2LREA 1BIBA 2HDWA 1BA5A 1YTYA 4MEXF 2WA0A 1MSEC 1I50J 4HQEA 5DM6F 2JZYA 3BZ6A 2QVOA 3CCJI 3EUHC 1ZYRF 3VFZA 5KAIC 3JRBA 4BXXJ 2R7QA 1YHQI 2OU2A 2FA5A 4EJTA 1W5TA 3IAS2 2H6CA 1TNSA 4HEA2 4G7ZF 2BOLA 1R71A 2YU9J 4FISA 5K5QA 1NK2P 1Z9CA 1ZLKA 3FWEA 1ETOA 4XQFA 3MFKA 1X19A 4Y33A 1ZQ3P 4BY7J 1J9IA 4KMUX 3OYIA 2W82A 5J47A 4UUTA 3MAJA 4LK0F 5GP9A 2IJLA 1LE8A 1Q1HA 4PDKA 4BQQA 2JMWA 1UHWA 2UUZA 3ZN0A 4IHWA 3GLLA 5A2QZ 2Y0MA 2WV1A 1LJ9A 2CV1A 4CHUA 3VSKA 3G73A 3DTKA 1Y1VJ 1U5TA 5HDNA 4Q5SF 4RM3A 1MD0A 2EV0A 2WAQA 2JA5J 4AD9A 3CP8A 2MG4A 2DU9A 3DU6A 4OAZA 3AG2H 3DF8A 3I3LA 1FTTA 3S14J 3ECHA 1G6NA 1BR4A 3FISA 1EKEA 2K9LA 3LFKA 3RQ4A 1N75A 1ZG1A 1S7EA 2LH9A 4PSWA 3OYDA 1GT0C 2W48A 3GVAA 2WAQN 3G1LA 4PFPA 2LYCA 1XB4A 1FP2A 4J00A 2GIVA 3G2BA 3RKWA 2IAIA 3S17J 1JHFA 2ADUA 3FKJA 3WODF 1VTNC 5E3NA 1ERDA 2KFDA 2HOTA 5FRMA 2GA1A 5FKLA 3ZMSA 5HDKA 4X1EA 5IT9K 3ZQ7A 2MH9A 2CW7A 1KZHA 2LNBA 2CMPA 1VQLI 4UNOA 3LMMA 3QAHA 5D5UB 3OYJA 1OLTA 2FNAA 2LY1A 4OIQF 1VQ6I 2UV1A 3RPUD 1EA3A 4AYBA 4BBSJ 2Y9YA 1SANA 2JTVA 2EA4A 1UAAA 2YSRA 4RB0A 3NWTA 1MBJA 3HPHA 3JRGA 3BG6A 1I3QJ 5J40A 2GXGA 4FCYA 2CW0F 1BOAA 2CV0A 3DTEA 1YIOA 3DQVC 3ZPLA 2A5WA 5DUKA 3R6SA 1ACIA 1BI1A 4MQVA 2X1CA 3K7AJ 3MN2A 5JLWA 2CFOA 2I8DA 2L02A 2HPIA 3N4MA 2DFEA 2BXZA 5HNFA 2KPMA 2FF4A 2L4MA 2V6EA 4Y3OA 1W7PB 5EYRA 4DZPA 2GOXB 1FIPA 2R93J 3Q0UA 2MLKA 1IV6A 3OYBA 3M8FA 1TWGJ 4BYYA 1TTYA 3CESA 3J80Z 1OISA 3H0GJ 5CVRA 1VQ5I 5F08A 2DQRA 3C3WA 2AQEA 1B1BA 1UCRA 3L2QA 1ULYA 1B4AA 2DDBA 2W24A 3PUBA 2EFPA 1MH4A 2X1EA 3SDBA 1XGOA 4M9SA 2E2JJ 2GBYA 1IRZA 2CU7A 4I98B 1YQAA 5L3GA 2V1UA 3ZN1A 5CQEA 4O3MA 4G6DA 1I1GA 4L9NA 1CQTA 2RNJA 3FXQA 2KIUA 1XDUA 3IRQA 2JVGA 4IHVA 1Z0XA 2VT3A 1MBGA 1E3PA 2ZB9A 1ITYA 3CTAA 4NC7A 1I1SA 1RNLA 3HOSA 2DQLA 4AC0A 3ERMA 3JRHA 1A6QA 3I5UA 3DBHB 2NNYA 5H6QA 1DGRM 4D0PA 1YOVB 4ZTJA 3MZ8A 4EV0A 3KP2A 4U0VA 1JKOC 4HV6A 3IUOA 2PJRA 1TBXA 2DW4A 2X51A 1FC3A 3QPSA 1OFCX 1TQIA 1WJ5A 3TBIA 2FNPA 4HRIA 4I6ZA 2DI3A 1RKTA 3L2CA 1TQPA 2DA4A 3OL3A 4F55A 5IY5H 4FASD 4XOPA 5AIPA 1Z7LA 3KE2A 1Z7UA 3KYDB 5TISC 4HW0A 1TLHB 5B66C 2Z3YA 1AHDP 3D5LA 4GGGA 3LFUA 3RPUA 4D7NA 5HDGA 2QSFX 3ELKA 2VUMJ 2PFBA 3FHNA 4A3CJ 3MVPA 4PJLA 4IX7A 1MMNA 4MTEA 2R5ZA 3I64A 4ESBA 3A01A 1IN6A 4A3BJ 3CUQC 4L5EA 2A07F 1O7LA 4MHGA 3QRFF 1R22A 2EIKH 1KU7A 5KK1A 5LRSA 3JAMK 5ICFA 2ZJ2A 2V4JC 3WHBA 2ZKZA 1Q1VA 2VI6A 3GF2A 4HF0A 4UUVA 2A6TA 1MH3A 3A1YA 3GTJJ 1W5SA 1ZGWA 4XL9A 2UZKA 1FWZA 1HQCA 4P55A 3ZQGA 5J8CA 1RZ4A 3QWLA 4V19K 1H0MA 4ZYGA 2BW3B 4W97A 3PNTA 2O8XA 3HG9A 3SFZA 2DOFA 2QENA 4N4NB 3VDXA 2OD5A 1VF9A 1SVOA 1N78A 3RSNA 4G7HF 4HPQA 1AOYA 2IGMA 3MD2A 1E17A 3IRRA 4A0YA 1LFUP 2IA0A 3IH3A 3H3ZA 4M3EA 2EH3A 2M8GX 1JKRC 3K2ZA 4E7SA 2QEXI 4X0GA 1SD5A 1UMQA 4YFKF 4XSZF 4UVBA 1TT0A 5LFAA 1IDYA 1VQKI 3NEUA 2GZWA 4A0XA 1QVUA 3I0TA 3EQLF 2IA2A 2RVCA 3ZMZA 5FLXZ 4QPQA 3A2KA 2EFNA 3K4JA 3E6DA 4DYCA 2HYGD 2X6YA 2Y30A 3HOYJ 4BJ5C 1NH3A 2M1BA 2BVMA 1D1BA 4RDUA 2QSHX 1TC3C 4CCKA 2VXDA 1S5LC 1QPIA 3HHHA 5J4VA 1H8AC 1WWXA 3PQJA 2R7ZJ 2VIXA 2JA8J 3BCAA 1XGSA 2Z2SB 2MABA 4HOBA 3TL4X 1XD7A 4BE2A 3K4LA 1HSTA 5J8FA 1V55H 4G12A 3L00A 3TEDA 4QLCU 3HKZA 2K3PA 4BL0B 4PUSA 4RGXA 4LG0A 3OR1C 2H8WA 3ESWB 2ZMEC 4DOZA 2HR3A 3F8BA 3IH4A 5EZHA 2OAZA 3AG3H 1F43A 1OCRH 4OMYA 2IA1A 1B9MA 1XCBA 4KUMA 4PJNA 1LFBA 2XAFA 2CV2A 2QKLB 2ZJQF 3CJNA 3QPTA 2HTJA 3PL8A 4NC8A 2Q0OA 4A3EJ 2F2EA 1YLFA 3M3YJ 2PMZA 2QWWA 5DD4A 2X4HA 3U21A 5L3EA 3KETA 2KRFA 4U0YA 2KIQA 2WY7Q 4IEJA 4GXOA 4G6TB 5EZGA 3TO6A 1O57A 3H9QA 3OOPA 2ISYA 1T2KA 3BROA 2JRMA 2PMZN 2JRTA 1TT5B 4O5VA 5L3DA 2ID3A 4DYRA 3WG9A 1HC8A 2FMLA 1MMDA 4IQ4A 1MBFA 4LB5A 1XGNA 2M45A 1JTYA 3QP5A 3T0YA 3K69A 3TW7A 2GA2A 5HLTA 1S6LA 3M1EA 1TL8A 2RGVA 1WJDA 4CICA 1BW6A 5JVTA 3CMYA 3CDIA 1XC5A 3KIOA 4LMYA 5D5VB 4GO1A 1IN4A 2QQ9A 4ZJZA 1WJCA 3HSRA 2W57A 1OCCH 2CUJA 4WK8F 2CSOA 1GV5A 2XF5A 1BM9A 3MQ0A 1QNTA 4B48A 1R4NB 3BJAA 2QM3A 4XRSG 1WCMJ 2DFFA 3DFGA 1O3TA 1P92A 3EYIA 4OMZA 5IT9Z 1UHSA 2FEZA 1FIAA 4C3IJ 4HA8A 5BNGA 2ISZA 3CO6C 4QIWN 1U0JA 2LVSA 4ZYAA 1ETYA 4YIIA 2R0QC 4FT8A 4JK1X 3OYEA 3KP5A 3Q9SA 1WZ2A 3WE2A 4ZYDA 1P2FA 2E5ZA 2DPDA 4EMSA 2G7HA 3BR6A 3MCZA 2HVSA 2RV8A 3V8LA 4EATA 1DQUA 5HS8A 3CCLI 2QBYB 1IW7F 1Z6RA 2RAEA 3KEOA 4D9JA 4AIJA 2XASA 2JJ7A 1ZG5A 4UB6C 1TQMA 1YO5C 3O2PE 4R8HA 1QZZA 3FK6A 5ED4A 4LG3A 2Z1DA 5E18F 2VBXA 3M07A 2FX0A 2JWTA 5CQGA 2HEOA 4IOCF 4BEHA 5DCMA 4Y7NJ 3HJEA 3RKQA 2ZXWH 5E79C 1GDTA 2VODA 2MD0A 2E1CA 2BZTA 2NS0A 2R5YB 1R7JA 4B3AA 5IYDJ 2DA6A 3BLYA 2VBWA 3Q0VA 4XNFA 1YFHA 1R36A 3NARA 1J59A 1X1PA 2QUFA 4WXCA 2XF7A 3GFIA 2NS7A 2HI3A 2AHQA 4I7HA 4PJMA 5F0FA 4PCQA 3L09A 4II2A 2L4AA 4XLPF 1T8IA 5F0HA 4EQQA 2VT2A 2L2OA 5H6RA
chains in the Genus database with same CATH topology
1WJBA 4BGDA 2KDOA 1FMVA 1VZ0A 4NQWB 4DGWB 3OYCA 2VPLA 4P5OA 4CZCA 3K4CA 2WAEA 4II3A 1D0ZA 3KX2A 1LKXA 4ZC3A 4JQFA 3HXLA 4E7KA 2E5NA 1X1BA 2L9NA 2R7RA 3EUKL 2O5RA 2Y0SA 3DU5A 3K6GA 2HPMA 4BE1A 3OYMA 4CH7A 3S93A 5JHFA 3KYLA 4XLHA 4XN3A 1JI8A 2MC4A 3MKYB 2ZXIA 2LREA 2W4SA 2HDWA 3BG7A 2FUG2 2WA0A 4BACA 3QYBA 2CH0A 1W36C 4BXFA 2KMUA 4E6KG 3EUHC 4F91B 4ZDPA 2JVHA 3FBIB 2R7QA 4C2UA 3SEQA 1Y56A 1UG0A 3IAS2 1Y6IA 2CUZA 2HNHA 2R7WA 4HNUA 2DT6A 5TGTA 4HEA2 3OYFA 2IS1A 2BOLA 2LY2A 4J01A 2M0MA 2KP6A 4XOTA 3M8JA 1X19A 4Y33A 2XF6A 4DBQA 3OYHA 1LDKB 3OYIA 2W82A 4NNJA 3EPZA 4BQQA 1WJAA 1WJFA 3D5SC 3HL2A 4XMYA 2UUZA 4GRIA 3SEZA 3OS1A 3E1SA 2CV1A 2F5VA 2VJJA 3OIQA 3VSKA 3DTKA 3F9KA 4BE0A 5CKTA 3ZR8X 1G59A 4RM3A 2WADA 3FBNB 2LG4A 3ZGKA 4BEHB 4H4KC 2WAQA 3V42A 3CJRB 4C2TA 1NG7A 3CP8A 3DU6A 4OAZA 3I3LA 3OYNA 2R7VA 1TZLA 3OY9A 5FROA 1BR4A 3UNGC 2K9LA 3RQ4A 1N75A 1MNDA 2LH9A 4PSWA 4RLQA 3W2VA 3AKZA 3OYDA 2KRCA 3OIPA 4PFPA 2LYCA 2WBMA 3PNYA 4J00A 4YEJA 1FMWA 2HZDA 3G2BA 3RTRA 4CCMA 4BQNA 1X1DA 3FKJA 3K4KA 5LD2C 3OYGA 2DT7B 4XM3A 4AU7A 2R4GA 5CPRB 4ZTFA 5FRMA 3OYLA 4BJ6C 2OV7A 2IS2A 3BC8A 3M1CA 1D1CA 2CW8A 2CW7A 2LRDA 3H5AA 3QODA 1ZELA 2CMPA 1BR1A 4XONA 3L2VA 3LMMA 4IQJA 2WY8Q 4DJAA 3OYJA 1OLTA 2LY1A 2KQRA 2UV1A 3RPUD 4NUBA 3S3NA 1EA3A 3IAM2 3OS0A 3VYUB 4AYBA 3H35A 2KHMA 1UAAA 3NWTA 3TMOA 3HPHA 3DPLC 2RREA 3BG6A 3FDYA 2CV0A 3DTEA 3DQVC 4OWRB 2A5WA 3OR2C 2WAFA 4HNTA 2E1MC 4F92B 2L5QA 2X1CA 2CFOA 2I8DA 1MNEA 2HPIA 1W36D 1GLNA 4E4HA 5HNFA 1PJRA 2KPMA 3AL0C 2V6EA 4Y3OA 3ZQQA 1DP3A 2GOXB 2VKDA 2BW3A 3OYBA 2RNGA 4CCLA 3D5RC 4XKCA 1V5GA 3CESA 4C30A 3LSMA 3OMYA 4FETA 2AQEA 3SYTA 3L2QA 2K5CA 2VQLA 3I9V2 3W3CA 3PUBA 4XKWA 4ANJA 2X1EA 3SDBA 2VXZA 1X4PA 2R7OA 4ITVA 1MMAA 1J09A 2IS6A 1Z21A 5CQEA 4ZDLA 2VQCA 3DTIA 1WFXA 2LC2A 2JVGA 1QHHD 3MKZA 3K70D 1T95A 3LSGA 4E7JA 4NC7A 2VKHA 1QU3A 3HOSA 3CMMA 3VYRB 4XKBA 4U7BA 3C2GA 1YX3A 1DGRM 2IXSA 4RM2A 4BU2A 4ZTJA 3LL7A 2F6CA 2F4IA 1YX5A 1X1AA 3IUOA 2PJRA 3CP2A 1D0XA 2X51A 3ZRGA 1Z3XA 1MMGA 1WJ5A 4JOMA 3TBIA 4HRIA 5KNLA 2M3AA 3H5NA 3OL3A 4F55A 2UWMA 1D0YA 2X85A 4XOPA 4FASD 1Z7LA 2R7XA 1AA7A 3S3MA 4RLFA 4HSTA 3K70C 2DXIA 2OUMA 2WB1A 3QYFA 3D5LA 3LFUA 3DKYA 3HUGB 2MFZA 4XLEA 3FHNA 3OYKA 2DOAA 1IRXA 4PJLA 1MMNA 4F3QA 4IX7A 3CJQB 2R7TA 4DIQA 3K4BA 3S32A 4LITA 3A4CA 2M4GA 3PJRA 2VJ4A 3DWLE 3VYTB 2CS3A 2DJIA 2ZSIB 2V4JC 2XC7A 3VYSB 3DPTA 4XORA 1Z3YA 2IGOA 4XN0A 2A6TA 4B3XA 4RMNA 3A1YA 2V1NA 2XDVA 4XL9A 4QPOA 1T0FC 4BJTA 4PFOA 2BW3B 3PNTA 3W2WA 3HG9A 1DGWY 3MKWB 4N4NB 3VDXA 1G8XA 1N78A 2V7FA 3RSNA 4HPQA 2IGMA 3GBGA 3MD2A 1P9QC 4YELA 5HVQC 4XLAA 4PK4A 4E7IA 3H0DA 4E7SA 4X0GA 2VJ5A 2QKMB 1TT0A 2XAUA 5LFAA 3HOTA 2OC6A 2KLOA 2HVRA 4QPQA 3A2KA 2Q1ZB 1D1AA 3K4JA 2DCEA 2VQGA 3EUAA 3OL4A 4XKVA 3AFHA 1QHGA 2X6YA 4N4OB 4BJ5C 2BVMA 1D1BA 2KL4A 3K4NA 3DPUA 4CCKA 2VXDA 3H9JA 3K10A 3LSKA 4PSXA 4KITB 3ZXSA 3BCBA 1E0EA 2PJRB 3KEYA 3HPGA 3H9GA 1ERDA 1NG6A 2VIXA 4XLFA 3BCAA 2Z2SB 2MABA 1LFPA 3PFYA 3TL4X 1V5FA 4BE2A 4DBRA 4ZDOA 1BOBA 2IGKA 2M7AA 2XSJC 3K4LA 3NWSA 1PYVA 4CCJA 3HKZA 3AL0B 2K3PA 3DEEA 4BL0B 4PUSA 4E7HA 3OR1C 1LVKA 3ONQA 4CUGA 4DOZA 3N05A 2M4KA 4LIVA 4P1WA 3VWBA 4BQOA 4KT6A 4LIUA 3IP4B 1YE9A 4CCNA 4HSRA 1S9HA 2E60A 2P0WA 2ZSHB 4PJNA 3L2RA 2CV2A 2RQQA 2QKLB 3LSIA 3PL8A 4NC8A 2JUGA 2JSPA 5HNHA 2PMZA 2HVQA 3OS2A 3U21A 2V26A 1SFKA 1X4OA 2Z16A 3DKXA 2WY7Q 2AQFA 2Q2EB 4KISA 4G6TB 2LBFA 3HC7A 2IGNA 3H9QA 2V9KA 2W1OA 4MLOA 2ZFUA 4U87A 2VLAA 4E7ZA 2W00A 1OR7C 2X1DA 1MMDA 4IQ4A 3PSIA 2VB6A 2R7SA 2BVLA 5HLTA 3PNVA 4B47A 4BDZA 1WJDA 1BR2A 4OAYA 2HQAA 3C2HA 2MYSA 4R79A 3L2WA 4ZJZA 4CCOA 4PJJA 1WJCA 2VASA 2GOMA 3LSHA 4XLCA 4F52A 2CUJA 4CSWA 5HOOA 2XF5A 5KHDA 4B48A 1K6YA 2IS4A 4B43A 3ZCOA 4KJZA 1X1CA 3RCOA 3S3OA 2X6WA 1SAUA 4XR6A 1U0JA 2VJIA 4CA0A 4ZYAA 2L9SA 4AVZA 3PSFA 3OYEA 5FRNA 4C9YA 3OOUA 3E0JB 3MMYB 2JA2A 2R7UA 2E5ZA 1R6RA 3H5RA 4IZZA 4YRVA 4Y4RA 4BDYA 2HVSA 1MW7A 2X6XA 4EATA 4D1QA 1DQUA 5KCMA 3VSLA 1V5EA 3K4MA 3QOEA 4D9JA 1N77A 2VQHA 3SZGA 4BUPA 3OWTA 3J7AY 3UR3C 4IKFA 2K9MA 4B44A 3CZ6A 1WJEA 4LG3A 2LOOA 2Z1DA 1HA8A 3W2AA 5CQGA 4BEHA 2KRHA 1KONA 2MD0A 2M7BA 2ZXHA 4HG2A 2KZVA 4BS9A 3BLYA 4E7LA 4XNFA 2ELJA 2NOJB 3DLAA 3L2UA 2XF7A 2VL8A 2HU9A 2L7KA 3OYAA 4PJMA 1UELB 2E1MB 2LBFB 4II2A 3S8PA 2W7NA 3CF2A 4F93B 4XQFA 3QYEA 2L2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S93 A;  2KZV A;  2LY2 A;  2LH9 A;  2LY1 A;  2KPM A;  3RCO A; 
#chains in the Genus database with same CATH topology
 1WJB A;  1FMV A;  1FX7 A;  4DGW B;  4JBA A;  4EJO A;  2RN7 A;  4CZC A;  3GTL J;  1D0Z A;  2VBY A;  3KX2 A;  4ZC3 A;  4XIC A;  2Y69 H;  4JQF A;  1VQP I;  3GTP J;  1R23 A;  3EUK L;  5H20 A;  4WF2 A;  2XVC A;  3GZN B;  2Y0S A;  1QZY A;  3E5U A;  2JUC A;  4FHT A;  2VC1 A;  4MNU A;  3K6G A;  5FB2 A;  3J80 K;  4Z6Y A;  1O3S A;  4WWC A;  4BE1 A;  2HQR A;  5JHF A;  1JI8 A;  1Z91 A;  2MC4 A;  5DD8 A;  1MNM C;  4M71 A;  5FLM J;  3ABU A;  1QA6 A;  1I3A A;  1JXS A;  1AKH B;  4EJU A;  1OYW A;  1W36 C;  2MA3 A;  2KMU A;  4F91 B;  4ZDP A;  2JVH A;  1FSE A;  1LB2 A;  3SEQ A;  1UG0 A;  1Y6I A;  2CUZ A;  3P7N A;  4HNU A;  2QQA A;  2FRH A;  3F21 A;  4UY8 I;  1BJA A;  5F6F A;  1FOX A;  4ZYH A;  1ZAO A;  2CGP A;  5CVI A;  1FLI A;  2O03 A;  2X6O A;  4RAF A;  3ASO H;  4ENM A;  1R00 A;  1J0R A;  1K7A A;  5LLQ A;  4GYI A;  1WJF A;  3D5S C;  3SJM A;  3ZQI A;  1WH5 A;  3TKY A;  3BZK A;  2F5V A;  2VJJ A;  3JAM Z;  3CCM I;  2CRG A;  1P4A A;  4Y15 A;  1FNN A;  4BE0 A;  2QYO A;  3ASN H;  1G59 A;  2WAD A;  4IOA F;  2LG4 A;  2K86 A;  4Y17 A;  3CJR B;  3G3Z A;  4B1R A;  4C2T A;  4NB5 A;  1XGM A;  4I02 A;  2DO7 A;  5LGN A;  3OY9 A;  2FD5 A;  5EDN A;  1VQ8 I;  3FK7 A;  3UNG C;  3FXM A;  3CUQ B;  2M8E A;  1ZR2 A;  1SFU A;  1VQ9 I;  1JT6 A;  1T08 B;  3W2V A;  3AKZ A;  3OIP A;  1P7J A;  2WBM A;  3ABL H;  3CLO A;  1OMI A;  1TW2 A;  4HLX A;  4CCM A;  5EG0 A;  4BQN A;  1PP8 F;  1A6I A;  3HIF A;  3OYG A;  2DT7 B;  4RB3 C;  2K02 A;  3I59 B;  4AU7 A;  2ICW G;  2QQ8 A;  3R60 A;  1BW5 A;  3OYL A;  1N25 A;  4BJ6 C;  2OV7 A;  2IS2 A;  3BC8 A;  5LHH A;  1BIA A;  2IRF G;  3H5A A;  3QOD A;  3LA2 A;  5JI6 A;  4PGG A;  1ZEL A;  2H6B A;  4YIR X;  1HW5 A;  3CJT B;  1BR1 A;  3D0S A;  1B6A A;  4EJW A;  1F9N A;  1OYI A;  1Z6T A;  1HKQ A;  2WY8 Q;  3GLX A;  3V7R A;  1B72 A;  3R0A A;  4M73 A;  4NUB A;  5ICC A;  1IN8 A;  3B6C A;  3IAM 2;  4MTD A;  3K2A A;  3VYU B;  3H35 A;  3Q0W A;  3SHF A;  4JYK A;  3BQY A;  3LAJ A;  2BEO A;  2KHM A;  1J5Y A;  2Y48 A;  4BH9 A;  2JK3 A;  2L01 A;  1SAX A;  4D5C A;  1FP1 D;  1K83 J;  3O8G A;  2EPF A;  4UB8 C;  3J81 Z;  4IO9 F;  5AIQ A;  5FD6 A;  4OWR B;  4OIN F;  2DFI A;  1FEX A;  1OCP A;  2LDU A;  4ASN A;  5FLX K;  3K1P A;  4S05 A;  2HQN A;  1GLN A;  1GHC A;  1ZR4 A;  2BXY A;  3F8M A;  3PM1 A;  5E3M A;  4J19 A;  2HYJ A;  2PG4 A;  4IXA A;  2VKD A;  4JP0 A;  3BPX A;  1VQ7 I;  4RA2 A;  4RGR A;  4CCL A;  1H89 C;  1J2X A;  4XKC A;  1V5G A;  3B73 A;  4EEF G;  4C30 A;  1G3T A;  2GM4 A;  3OMY A;  3SYT A;  2OQG A;  3RDI A;  1BC8 C;  2K5C A;  2VQL A;  4MGR A;  3W3C A;  1EH8 A;  1ETV A;  1Y0N A;  4ITV A;  2EIM H;  1MMA A;  4ZH4 F;  2FOW A;  4MFE A;  2ZME B;  3BJO A;  2P4W A;  2Z5U A;  1WFX A;  2XB5 A;  1DP7 P;  5IT3 A;  3I58 A;  1T95 A;  1KYZ A;  3CMM A;  3VYR B;  3DP7 A;  1WQ2 A;  2ME0 A;  3GME A;  4RS8 A;  5E1Z B;  4P96 A;  1FSH A;  4LFU A;  4DNC A;  2AXL A;  3T8R A;  2JA6 J;  3MZY A;  9ANT A;  2IXS A;  4RM2 A;  1ZRC A;  1DDN A;  5FD5 A;  3LL7 A;  4KA4 A;  2F6C A;  1Z1D A;  3BTC A;  3LSP A;  3LNQ A;  4HDU A;  1X1A A;  4N9H A;  3ZRG A;  5B3S H;  1WHU A;  2L7M P;  2K85 A;  3BR3 A;  3EDP A;  4JOM A;  4UUS A;  1SD7 A;  3WTZ A;  1FT9 A;  3BTL A;  3HOX J;  5KAF C;  1D0Y A;  3ZP5 A;  2JPB A;  1AA7 A;  1KQ0 A;  3S3M A;  4RLF A;  5GPC A;  3K70 C;  2DXI A;  4N0B A;  1IV8 A;  5EGO A;  3QYF A;  4IL6 C;  3HUG B;  1FOY A;  5ILV A;  4XLE A;  3LSJ A;  1CF7 A;  3S2D J;  4IPA A;  4XRF A;  1IRX A;  1NK3 P;  3OV8 A;  2CUE A;  1XPX A;  2BGC A;  3GTG J;  4DIQ A;  2R7T A;  4RB2 C;  3S32 A;  4LIT A;  1X3Z B;  3A4C A;  3ROU A;  2CO5 A;  2K4B A;  4A2U A;  1P7I A;  2L54 A;  5J1R A;  1YJW I;  2WV0 A;  1RES A;  4I2O A;  2V79 A;  1KQ9 A;  3VYT B;  3I71 A;  1HDP A;  2KIF A;  2CS3 A;  2EZK A;  4X6A J;  2XC7 A;  4KNY A;  4XOR A;  4ENK A;  1Z3Y A;  2IGO A;  1QVT A;  2W85 A;  5LHI A;  4I0B A;  2XDV A;  4QPO A;  3BTJ A;  1T0F C;  4BJT A;  1TWC J;  3V7S A;  3ZQC A;  3P9C A;  4XLN F;  1R9T J;  2F5C A;  3TO9 A;  3CME I;  3NAU A;  3JRI A;  2LD5 A;  1P9Q C;  4HQM A;  2BY3 A;  2ETH A;  3NRV A;  4XLA A;  3UKG A;  2UXN A;  1WI9 A;  2QKM B;  2XRN A;  1PUF A;  1K78 A;  2BV6 A;  1YS6 A;  2X48 A;  3U1D A;  1YJ9 I;  2KLO A;  4DW6 A;  2IVM A;  5M5X J;  2HVR A;  2COB A;  5E3O A;  2Q1Z B;  5L3C A;  3IKT A;  2VQG A;  2R3S A;  4XKV A;  3O3K A;  2PEX A;  1OQY A;  2KL4 A;  3P5J A;  3LSK A;  4KIT B;  1UST A;  3VOD A;  3ZXS A;  1W1W E;  4P9F A;  3KEY A;  2PBI A;  4UV9 A;  2BHZ A;  1XX5 A;  3I53 A;  2E34 A;  1U6G A;  4EM0 B;  1R5H A;  1NG6 A;  2CQX A;  3PQK A;  5L3B A;  1MDM A;  4XLF A;  1R5G A;  4G94 A;  2A61 A;  1JUM A;  4YIF A;  1LFP A;  4DBR A;  4ZDO A;  2IGK A;  2XSJ C;  2DTR A;  2ACJ A;  3NWS A;  2P81 A;  3GWZ A;  4Q4Z F;  1U5T C;  2I10 A;  4CCJ A;  3Q5F A;  3AL0 B;  2UXX A;  4XRS A;  2BY1 A;  3DEE A;  2G0E A;  4E7H A;  1LVK A;  2M4K A;  2NAZ A;  3FZV A;  1U8B A;  1SMT A;  2IPQ X;  3ZMU A;  4P1W A;  4EVI A;  3VEP A;  4CYC A;  2PN6 A;  4ZYE A;  3PFI A;  2DJN A;  5EJC A;  2JUG A;  5ERI A;  2HVQ A;  3WG7 H;  3OS2 A;  3BR1 A;  2EQR A;  3G4S I;  2NVQ J;  1JGS A;  1SFK A;  3V7C A;  3E7L A;  5H2F C;  2Q2E B;  4ENN A;  4AID A;  2LBF A;  3HC7 A;  2YX7 A;  5J6X A;  2XGE A;  2ZFU A;  5ILU A;  1IZ1 A;  4E7Z A;  2RDP A;  5D6E A;  1O4X A;  2KJC A;  5IYB J;  1ZKG A;  3FMQ A;  5D8L B;  4NQW A;  4A3F J;  2VB6 A;  2AXT C;  2LP0 A;  4RAZ A;  5M3M J;  1YG2 A;  1KU2 A;  1YI2 I;  4A3G J;  4F7Z A;  3FXO A;  2FBK A;  1IAW A;  3TP0 A;  4EJV A;  5TRD A;  4BAY A;  2LKS A;  4Y13 A;  1I39 A;  2HQA A;  3CCQ I;  1EH7 A;  2QZ8 A;  3PIP F;  2QSG X;  3C2H A;  4I0A A;  3FHZ A;  1W0T A;  2LK2 A;  2CJJ A;  2CYY A;  2EV6 A;  3RQI A;  3CC7 I;  3L2W A;  4KIG A;  5DTD A;  4CCO A;  4PJJ A;  2DTZ A;  2GOM A;  5DCF A;  1RRJ A;  2E1O A;  4RAY A;  1XMA A;  1SVL A;  4XLC A;  2R7F A;  3X2Q H;  3SZT A;  4KN7 X;  2Y9Z A;  3ZCO A;  1X1C A;  1UJ8 A;  2J5O A;  2H09 A;  1WVR A;  2E2I J;  2ZCW A;  3IHU A;  3RYR A;  2Y75 A;  3BDD A;  1X2M A;  3M7G A;  2L9S A;  3PSF A;  4FE4 A;  2O6G E;  3LA7 A;  1IN7 A;  4C9Y A;  2A5Y B;  4AVP A;  2VPR A;  4NHJ A;  2JA2 A;  1W7P D;  1Z77 A;  5LBQ A;  1R6R A;  3H5R A;  2FQ4 A;  1J7K A;  4YRV A;  4IZZ A;  1IXR C;  2X6X A;  1DU6 A;  5KCM A;  4KIC A;  3E3V A;  1V5E A;  2RC4 A;  2X9D A;  3K4M A;  3VSL A;  1B59 A;  2F5D A;  1Z05 A;  2ZJP F;  3OWT A;  1GVJ A;  1SFE A;  3UR3 C;  4IKF A;  1O7F A;  2MC3 A;  3TP3 A;  2EWN A;  1RKW A;  4B8X A;  3AAF A;  3W6V A;  1O3Q A;  1HA8 A;  1IUY A;  2K9N A;  5K7Z A;  1RI7 A;  3CO7 C;  3HOU J;  1FYK A;  5J3L A;  1KON A;  3HDD A;  4UVA A;  1DPU A;  3RKY A;  1MZB A;  4HG2 A;  2KZV A;  3KLO A;  3HTS B;  4ESF A;  1S7O A;  2VBZ A;  3ZMT A;  4E7L A;  2XHK A;  2NOJ B;  4BHC A;  1YIT I;  5IP7 J;  1G4D A;  3HEF A;  1MBH A;  3DLA A;  2MSY A;  4UXN A;  1SEU A;  2HU9 A;  2F4O B;  3BR0 A;  1NTC A;  3OYA A;  1B8I B;  3CQZ J;  3DEU A;  1CGP A;  2L0K A;  5GPA A;  3FKI J;  1JUP A;  4EM1 A;  4IJA A;  4IHX A;  1HOM A;  3J81 K;  3RZO J;  2HOS A;  2XSD C;  2HFH A;  1G3Y A;  2FBI A;  3CF2 A;  2W7N A;  4KYW A;  3BQZ A;  4F93 B;  5C3E J;  1LVA A;  2TRT A;  4BGD A;  5IOZ A;  3W6K B;  1FTZ A;  2E7W A;  1LEB A;  2XPU A;  3K4C A;  5FKK A;  4QTR A;  1LKX A;  1FYL A;  4M3D A;  3S1Q J;  2KT0 A;  3HXL A;  3BG5 A;  2TCT A;  2E5N A;  2ESH A;  5E3L A;  3DCF A;  4G9Y A;  5KVR A;  4PJ0 C;  2R7R A;  5DDG A;  1HKT A;  2O5R A;  3H36 A;  2QF7 A;  5F27 A;  2HPM A;  3I4N J;  4U0W A;  2JPC A;  1S29 A;  1TWA J;  2J5P A;  1T39 A;  3W6J B;  2FSW A;  2VC0 A;  4WXH A;  2DMP A;  2VLA A;  3QYB A;  2CH0 A;  3EET A;  1S72 I;  5LEK A;  4BXF A;  4UV8 A;  4E6K G;  3DXJ F;  3FBI B;  1MBK A;  2XAG A;  1I5Z A;  4AM3 A;  1IRF A;  1Y56 A;  5DUI A;  1RUN A;  2ZC2 A;  2L3D A;  2DT6 A;  2IS1 A;  3JW4 A;  4LJZ F;  4HX8 A;  4M6V A;  4G6Q A;  2PMH A;  2Y2Z A;  3F0C A;  4ESJ A;  5M5Y J;  2M0M A;  2KP6 A;  4XOT A;  1W7P A;  2XF6 A;  4DBQ A;  3OYH A;  2EJR A;  1LDK B;  4Y52 J;  3ABK H;  1O3R A;  1POG A;  3EPZ A;  4DQ2 A;  2H27 A;  4KDP A;  1WJA A;  3TOB A;  3HL2 A;  4XMY A;  1X3U A;  1H9G A;  3A03 A;  3VOE A;  4AIH A;  3OIQ A;  1WGX A;  3KCC A;  3F9K A;  2B0L A;  3QQA A;  4BXU A;  1ON1 A;  1Y8Q B;  5E17 F;  4K2E A;  3HGY A;  3FBN B;  3K9T A;  2P5K A;  5J1Y A;  2M34 A;  3ABT A;  1NG7 A;  2R7V A;  3OYN A;  3C1D A;  1TZL A;  4L9T A;  2V9V A;  3NQO A;  5FRO A;  3CDH A;  1HW1 A;  1MBE A;  1H9T A;  1HSJ A;  3AG1 H;  2O3F A;  1MJA A;  3E97 A;  1MKM A;  1MND A;  1OCZ H;  2YS9 A;  4RLQ A;  2A6E F;  3PNY A;  2WWY A;  3A02 A;  4R1H A;  3WTW C;  1FMW A;  2NYX A;  1I6H J;  3S1M J;  3K4K A;  5GAD J;  2GLO A;  5DS9 A;  3JRC A;  1LDJ A;  4XM3 A;  2HXO A;  4CXF A;  2R4G A;  5CPR B;  4ZTF A;  3F72 A;  2MGQ A;  4OIP F;  2OZU A;  3DBR B;  4HF1 A;  2H1L A;  1RIO H;  4BHP A;  1OR7 A;  2JSC A;  3JTG A;  2ME6 A;  1YRN B;  2GIZ A;  3CD6 I;  3GO5 A;  3HZJ A;  3L2V A;  4IQJ A;  3FMS A;  3T1B A;  2LF8 A;  3BP8 A;  3S3N A;  3JTH A;  5CJ9 A;  2P8T A;  4KFC A;  3O8H A;  3OS0 A;  4IHS A;  2WC2 A;  4HX4 A;  2NRA C;  4C3H J;  3S1R J;  2E35 A;  2IBD A;  2MW8 A;  2P6S A;  3QP6 A;  4OOI A;  1BI0 A;  1MGT A;  2LF7 A;  5JR3 A;  3SZP A;  2XRO A;  2RRE A;  1G3W A;  1XTA A;  3JSO A;  3F8C A;  4EGZ A;  2NNN A;  4HNT A;  2Y31 A;  4L9V A;  2L5Q A;  4A6D A;  2XB0 X;  3FF5 A;  1T33 A;  5E20 A;  3R61 A;  5EEA A;  5D5W B;  4E4H A;  2CFX A;  3HRT A;  1YS7 A;  2Z33 A;  3AL0 C;  2STW A;  2OTL I;  2K3F A;  2NVX J;  2GXB A;  3HSE A;  1A04 A;  5D6F A;  3PIO F;  2H8R A;  2C6Y A;  1R58 A;  5F04 A;  1BI2 A;  2BW3 A;  5HLH A;  1LE8 B;  2YPR A;  3HTU A;  2DDA A;  2ZO4 A;  5DYM A;  4AIK A;  4LOC A;  1TNT A;  4FET A;  3U2R A;  2Q8K A;  2QA4 I;  4JX5 A;  4XKW A;  3FX3 A;  1JGG A;  3GTQ J;  2VXZ A;  1U5T B;  1X4P A;  3T5X A;  3T8T A;  5FO5 A;  1EJ9 A;  5M3F J;  2NS8 A;  4M72 A;  1Z21 A;  3WHC A;  1FJL A;  2VQC A;  3DTI A;  5B5E C;  4FQG A;  4I99 C;  1D8J A;  1HW2 A;  1QHH D;  1K4S A;  1LPQ A;  3MWM A;  3K70 D;  3LSG A;  1ODD A;  2VKH A;  4Z2Y A;  1QU3 A;  2DA7 A;  3WTU C;  2QCO A;  4U7B A;  1L3L A;  1RPW A;  2R92 J;  1BI3 A;  2HGC A;  2XKO A;  1Y8R B;  3DEW A;  4HDV A;  3GEZ A;  5K5O A;  2HYF A;  4A3M J;  1OKR A;  3FXK A;  5JFR A;  3IL2 A;  5BPI A;  1RR8 C;  3K0L A;  4M3F A;  2F4I A;  3S2H J;  1YX5 A;  2DFH A;  1D0X A;  1Z3X A;  4QSH A;  2E7X A;  2GWR A;  3LA3 A;  1IF1 A;  5KNL A;  2EZH A;  5CYV A;  1RR7 A;  1XDS A;  1ZGA A;  1WPK A;  3E5X A;  5C4J J;  3WU1 B;  3H5N A;  2OPT A;  2UWM A;  3CUO A;  1R1T A;  1ON2 A;  2GXA A;  2NVY J;  4HST A;  2OUM A;  2DN0 A;  2QGU A;  2WB1 A;  1K6O A;  2MBF A;  1BJZ A;  4U88 A;  5D8K B;  3DKY A;  5JHU A;  1ZRF A;  1FZP B;  2BYV E;  2MFZ A;  2JT1 A;  2DOA A;  4F3Q A;  3WTY C;  4N9I A;  3LST A;  3ECO A;  1V4R A;  1VQM I;  2XAQ A;  2FOK A;  2HOA A;  2TDX A;  2WB1 N;  3E6M A;  3GYH X;  3PJR A;  2O7O A;  3P9K A;  1P4X A;  2DMU A;  3VYS B;  3KLN A;  3CCE I;  1REP C;  3DPT A;  2FBH A;  4XN0 A;  1YYV A;  4ON0 A;  1IXC A;  3EUH A;  3J7A O;  2V1N A;  2DMT A;  3FXJ A;  2BY0 A;  5GAG J;  1GVD A;  1V3F A;  4PFO A;  4W1U A;  3D1N I;  3W2W A;  3KP7 A;  3FXR A;  1DGW Y;  3MKW B;  2HWV A;  1TP4 A;  2AS5 F;  2V7F A;  3L9F A;  5FKN A;  2QQB A;  2DOE A;  1RC9 A;  2G7U A;  4YEL A;  5HVQ C;  1U8R A;  4PK4 A;  4HZF A;  1F4K A;  4LLN A;  4MFD A;  2VJ5 A;  4H0E A;  4XRM A;  4RBO A;  1G3S A;  1KU3 A;  1SFX A;  2VKV A;  2XAU A;  4M6X A;  1FOW A;  1LDD A;  3HOT A;  2OA4 A;  1QPM A;  2OC6 A;  5IPA A;  2MH2 A;  1YW8 A;  1D5V A;  1D1A A;  2PMU A;  2YU3 A;  3GFJ A;  3EUA A;  4M3G A;  4MIM A;  3AFH A;  1QHG A;  2HOE A;  3ULQ B;  1UG2 A;  2AO9 A;  4A3I J;  2XAH A;  2LY9 A;  1I6X A;  1ZTR A;  3H9J A;  3K10 A;  4CYD A;  4IHY A;  2XIG A;  1E0E A;  2PJR B;  1ZAR A;  1ZLJ A;  1A5J A;  5FJ8 J;  5LGU A;  1PDN C;  2E36 A;  1S8N A;  3REO A;  1C0W A;  5EEH A;  3HRU A;  1PYV A;  2CWE A;  2PX9 A;  3F8N A;  1ONV A;  4C2M J;  1XS9 A;  2QBY A;  3H1C A;  5DM7 F;  4A3D J;  1S3J A;  1T0F A;  3KZY A;  3R4K A;  4CUG A;  4PZJ A;  1WI3 A;  3N05 A;  2K27 A;  4LIV A;  4KT6 A;  1DUX C;  4LIU A;  5B1A H;  4HYE A;  1YE9 A;  2VKE A;  4CCN A;  2R5Z B;  1LUJ B;  2RKH A;  3I54 A;  2E60 A;  3HRM A;  5HLI A;  3A01 B;  2P0W A;  4HAM A;  3L2R A;  3M9A A;  4A0Z A;  3LSI A;  5HOD A;  1FPQ A;  2JSP A;  3RZD J;  2R5Y A;  2IW5 A;  1LEA A;  2HS5 A;  5HNH A;  1VFC A;  2P5V A;  2DYR H;  3WU0 A;  1X4O A;  4YG2 F;  2Z16 A;  2CQ7 A;  2AQF A;  3QU3 A;  4KT5 C;  5IP9 J;  2IGN A;  2KDZ A;  2V9K A;  2W1O A;  1OYY A;  1XG1 A;  2X0L A;  3L7W A;  4FE7 A;  2W00 A;  4U87 A;  1XSV A;  2D1V A;  3ZQH A;  5LGT A;  3COA C;  3RPQ A;  2BHY A;  3E6B A;  1K4T A;  2QLZ A;  3PSI A;  4G8X A;  2OCC H;  2LR8 A;  3ZOB A;  6PAX A;  1YJN I;  3N97 A;  1SVM A;  5IOY A;  3SXY A;  3PNV A;  3S1N J;  2OF7 A;  2YUS A;  3CCY A;  4B47 A;  2BY2 A;  4A69 C;  4L5J A;  1Y0U A;  4OAY A;  3OSG A;  2VN2 A;  5TJJ A;  3F6O A;  2MYS A;  3R0J A;  2M30 A;  1FBU A;  5CLS A;  4RAG A;  5FKO A;  3F3X A;  5BS6 A;  2VAS A;  5E8G A;  5E1X A;  3C7J A;  4F52 A;  3QU6 A;  5HOO A;  5KHD A;  4NC6 A;  1AKH A;  4L0Y B;  3QPL A;  2HTS A;  2COM A;  2DOD A;  3RCO A;  3IH2 A;  2EZL A;  3E5Q A;  2LKX A;  1JE8 A;  2CUF A;  2VE8 A;  4ETS A;  4FTH A;  4CA0 A;  4YFX F;  2LMD A;  4NBQ A;  4AVZ A;  4GYG A;  2BE5 F;  3A0B C;  1U78 A;  5FRN A;  3OOU A;  1STZ A;  3E0J B;  3MMY B;  1JTX A;  3CDL A;  5LHG A;  1X58 A;  1A36 A;  2L9R A;  4Y4R A;  3LAP A;  4D1Q A;  5J1U A;  2B9S A;  2JA7 J;  2CQN A;  4I76 A;  4RGS A;  5BOX A;  3BWG A;  3QOE A;  4LG0 B;  2VQH A;  3Q3S A;  3SZG A;  1TWH J;  2K9M A;  4B44 A;  3CZ6 A;  3W2A A;  5DEQ A;  3CC2 I;  1I27 A;  5ILS A;  4P9U A;  1T38 A;  2KRH A;  2B63 J;  2W84 A;  1R1V A;  2ZXH A;  3ML6 A;  3BG3 A;  3U9G A;  2ELJ A;  4PGH A;  3L2U A;  3CUQ A;  2VL8 A;  2DK5 A;  3RJP A;  3HHG A;  1VQN I;  4BNC A;  1ZN2 A;  5GTH C;  3S8P A;  1ETW A;  5ICE A;  2ELH A;  2EV5 A;  4AYB N;  3ZQL A;  2ZBK A;  1A35 A;  2KDO A;  3RI4 A;  2PQ8 A;  1VZ0 A;  3I59 A;  3OYC A;  2VPL A;  4P5O A;  3WE3 A;  4LLG F;  3CCS I;  2WAE A;  4II3 A;  2FXA A;  4A5M A;  3F23 A;  5L3F A;  4E7K A;  5F1R A;  2XGC A;  4M3B A;  4MO7 A;  4GDF A;  3VB2 A;  2M5W A;  1W4M A;  5FKM A;  3E6C C;  3LQQ A;  3BR5 A;  3DU5 A;  1SC7 A;  3BY6 A;  1IDZ A;  1SFO J;  3JCU C;  2CQK A;  2ZXJ A;  3OYM A;  4CH7 A;  1HKS A;  1GUU A;  1XMK A;  3S93 A;  4B4C A;  3KYL A;  4XLH A;  4XN3 A;  3JRF A;  3WTX C;  2YR2 A;  3DKW A;  3F22 A;  1Y1W J;  2W4S A;  3BG7 A;  2FUG 2;  4DZJ A;  4A3K J;  4BAC A;  3Q9V A;  2P7V B;  2XAJ A;  1UFM A;  4KIF A;  2O9L A;  4V2F A;  1VQ4 I;  2F48 A;  2NXN B;  1LQ1 A;  4C2U A;  1TWF J;  2HNH A;  2R7W A;  2EK5 A;  5M5W J;  1ZG3 A;  5TGT A;  3OYF A;  2PLY A;  3CCR I;  2LY2 A;  5ICG A;  4J01 A;  2EZI A;  1UZC A;  1HBX G;  2P7C B;  3M8J A;  1E3H A;  2OQR A;  3JRE A;  1FBS A;  3GZ5 A;  3O6B B;  1D5Y A;  2D5V A;  4EM2 A;  2EA2 A;  1R1U A;  5IYC J;  2HDC A;  4NNJ A;  4BBR J;  1L0O C;  2N8G A;  3FXL A;  4V2G A;  3DBL B;  4GRI A;  3SEZ A;  3OS1 A;  3E1S A;  2VON A;  1PUE E;  1SD6 A;  3BPV A;  1U3E M;  4L18 B;  5CKT A;  3ZR8 X;  1Y39 A;  3IWZ A;  3K1N A;  4LD5 A;  2G9W A;  1T56 A;  3ZGK A;  4BEH B;  5DCM B;  2PI0 A;  4H4K C;  2ZME A;  4ABZ A;  3V42 A;  3HSF A;  1QBJ A;  3KP6 A;  4CGZ A;  4Q48 A;  1A31 A;  2DLL A;  5LRR A;  4GFB A;  4HX7 A;  2L7Z A;  1VND A;  2EIL H;  3TO7 A;  3EYY A;  2KRC A;  3AG4 H;  2YX4 A;  4D5F A;  1IG7 A;  4YEJ A;  2HZD A;  3RTR A;  3CMA I;  2D1H A;  1X1D A;  5LD2 C;  2EB7 A;  3KPH A;  1X3W B;  5F0C A;  3RIR A;  4D7M A;  3GX4 X;  2K40 A;  4LK1 F;  2DYS H;  3HOV J;  1QGP A;  2JN6 A;  4AWX B;  3M1C A;  1D1C A;  2CW8 A;  2LRD A;  3KP3 A;  3KYC B;  2ESN A;  3OIO A;  5K5R A;  2GQQ A;  2XRL A;  5C4X J;  4XON A;  1QZE A;  2M9H A;  5F64 A;  2NVU B;  2I5U A;  4DJA A;  3I4M J;  3GUD A;  2KQR A;  4HLY A;  4OU0 A;  2HQ5 A;  1WSU A;  2Z9O A;  4XK4 A;  3HUG A;  5E8I A;  1ETQ A;  1VQO I;  4KMF A;  2XV4 S;  3MKL A;  4OIR F;  1R4M B;  3PO3 J;  3TMO A;  3DPL C;  2DA2 A;  3FDY A;  1USS A;  3ISP A;  2A69 F;  4F92 B;  3OR2 C;  2WAF A;  2E1M C;  3J7Y J;  2O8K A;  2KZG A;  1Z67 A;  5B1B H;  4JX6 A;  3GTM J;  1MNE A;  4I09 A;  3DLL F;  1W36 D;  3WGI A;  1HCR A;  2DA3 A;  3K1M A;  3HM5 A;  4IHT A;  1PJR A;  2V9P A;  5D4R A;  1ENH A;  3ZQQ A;  1ZRD A;  1DP3 A;  3BTI A;  4WCG A;  3HOW J;  2CG4 A;  3BT9 A;  2V1D A;  3TQN A;  2HKO A;  2EFQ A;  2XGD A;  2RNG A;  5EF6 A;  3D5R C;  1S7A A;  1ORK A;  3LSM A;  3TDZ C;  2KJB A;  1UB9 A;  1WRJ A;  1ZK8 A;  3I9V 2;  5LEJ A;  1PVE A;  4ANJ A;  2E19 A;  3KZZ A;  2R7O A;  2STT A;  4YFN F;  1IGN A;  2EFO A;  1J09 A;  2IS6 A;  1BC7 C;  3WGH A;  4ZDL A;  4LLL A;  1U9N A;  2A6H F;  3LOC A;  2LC2 A;  1HF0 A;  3S2W A;  2HDD A;  1SD4 A;  4JX4 A;  2ID6 A;  1JHH A;  1KU9 A;  2XKP A;  3MKZ A;  2V6C A;  4E7J A;  4A93 J;  3HKZ N;  4BKX A;  3IKV A;  2IP2 A;  2JQ7 A;  4XKB A;  2A3S A;  2ECC A;  3C2G A;  1YX3 A;  5D5X B;  1R5I D;  1V54 H;  4BU2 A;  2OJE D;  4HF2 A;  4E70 A;  5EG0 B;  2Z99 A;  4LGW A;  4MEY F;  3F6V A;  3B02 A;  3CP2 A;  3M4O J;  1QO0 D;  1K79 A;  3HOZ J;  2K9Q A;  4S04 A;  1MMS A;  1MMG A;  4IRG A;  1GV2 A;  3WTV C;  2K9S A;  2M3A A;  4C3J J;  3GTK J;  2DBB A;  2W25 A;  3I4P A;  2X85 A;  4M74 A;  2R7X A;  3TGN A;  3H3U A;  5IP6 A;  2O0Y A;  4A5N A;  1BBY A;  1B72 B;  2BBY A;  2L9V A;  1E2X A;  3SFI A;  3GFL A;  1XCV A;  1QRY A;  1NHA A;  4RB1 A;  2M2E A;  3QPH A;  3OYK A;  1WH7 A;  2DK8 A;  3U1K A;  5JLX A;  3CJQ B;  1B9N A;  1IUF A;  5BMZ A;  3K4B A;  5HLG A;  3QOP A;  2P6T A;  2M4G A;  3P9I A;  4IRH A;  5E1W A;  5A2Q K;  1IO2 A;  4GCV A;  2VJ4 A;  1KYW A;  3DWL E;  2F4M B;  1KGS A;  4M9Z A;  3GW2 A;  2DJI A;  2ZSI B;  1OCO H;  3L1P A;  3VPR A;  1DU0 A;  3B6A A;  3ERE D;  1HDD C;  4G7O F;  4ZZL A;  4B3X A;  4RMN A;  2EBI A;  1U2W A;  5JVG F;  2Q2E A;  5CVV A;  1EF4 A;  1F1Z A;  3C2B A;  2PJP A;  3ABM H;  3CF5 F;  3GCM A;  4O6J A;  3BZC A;  2ZNZ A;  1G8X A;  3SDG A;  3GTO J;  2O61 A;  3GBG A;  1XMX A;  1XN7 A;  3CC4 I;  3BOQ A;  3JSP A;  4CZZ A;  1BN5 A;  1YW7 A;  3V8J A;  5F1J A;  5GTI C;  4E7I A;  3H0D A;  1HXD A;  2XUB A;  4L5I A;  1G2H A;  3HB9 A;  3KP4 A;  2F5E A;  1D3Y A;  2EFW A;  1OPC A;  4EGY A;  2LLK A;  1E3O C;  4CO8 A;  4FX0 A;  2DT5 A;  1TW3 A;  1W0U A;  3S15 J;  5CVU A;  3RKX A;  2K4J A;  2HZT A;  2MLG A;  2WTE A;  4UVC A;  2FU4 A;  3OSF A;  4A3L J;  2DCE A;  3OL4 A;  4N4O B;  5BQT A;  3CCV I;  4HV5 A;  3K4N A;  2F5F A;  2HKX A;  3DPU A;  5BPD A;  2ELK A;  1R49 A;  4PSX A;  3BCB A;  3LSR A;  4Q47 A;  2IEK A;  3H9G A;  3HPG A;  1FYM A;  2CQQ A;  3HBL A;  1AU7 A;  3TW6 A;  2OCE A;  3WGG A;  4UUS B;  3PFY A;  5K1Y A;  2D45 A;  1V5F A;  1BOB A;  2M7A A;  3ZMV A;  3FXU A;  3TDU C;  1IJW C;  3G71 I;  1UHM A;  1ZRE A;  3PO2 J;  1DPR A;  3MZH A;  5EGO B;  4M6Y A;  2ECB A;  2LTP A;  2VOO A;  2LSO A;  4A3J J;  2DPU A;  3ONQ A;  3H92 A;  1EH6 A;  4QWQ A;  4OIO F;  2FJ1 A;  4A12 A;  1FBQ A;  2FMY A;  1T98 A;  1CF7 B;  3TOA A;  2E1N A;  1JJ6 C;  1KA8 A;  1EV7 A;  2H94 A;  3DV8 A;  4BQO A;  2KIS A;  3VWB A;  3IP4 B;  3HRS A;  4HSR A;  1S9H A;  4S0H B;  2IT0 A;  2ZSH B;  3CCU I;  2RQQ A;  3I56 I;  3V4G A;  4B09 A;  3C18 A;  1YIJ I;  2V26 A;  4U7D A;  1D8K A;  4LB6 B;  2D2W A;  3WU2 C;  4KIB A;  5GAE J;  2Y0S N;  3DKX A;  1IC8 A;  1B8I A;  1FY7 A;  3G6E I;  4KIS A;  1GXQ A;  4RGU A;  4XSX F;  1JJ8 C;  1ZHF A;  2XGX A;  1SMY F;  3G1M A;  4MLO A;  4MQ9 F;  2L7F P;  2P5L C;  1OR7 C;  4UHT A;  4DYQ A;  2X1D A;  2KIM A;  3GFM A;  2E71 A;  4WXD A;  4NDL A;  2R7S A;  2BVL A;  3RYP A;  1U9O A;  1ETK A;  1P6R A;  5K7H A;  3M8E A;  3GZ6 A;  4FX4 A;  4BDZ A;  2DA1 A;  5D4S A;  3WTT C;  1BR2 A;  1MJB A;  5CVJ A;  1APL C;  2HXI A;  1H88 C;  2OBP A;  3CLQ A;  1IXS B;  4R79 A;  4XID A;  1PUF B;  3WTS C;  1K78 B;  1FOK A;  1J75 A;  1IN5 A;  2RQP A;  2VOP A;  1M1E B;  3KZI C;  5C44 J;  1ETX A;  2V1X A;  3LSH A;  4IVN A;  1JKQ C;  4CSW A;  3J7Z I;  2ZNY A;  1PP7 U;  5EEG A;  1K6Y A;  3ZMD A;  2IS4 A;  4B43 A;  2ZJR F;  4KJZ A;  1P4W A;  2GAU A;  3S3O A;  4HBL A;  3MEX A;  3KFW X;  2X6W A;  2B7E A;  1LNW A;  2DMN A;  1SAU A;  3GXO A;  4XR6 A;  2VJI A;  3IC7 A;  1MIJ A;  1ZH5 A;  2MD5 A;  2E2H J;  4BY1 J;  1VI0 A;  1MDM B;  3HGG A;  4I01 A;  2K7L A;  2LFB A;  4BQA A;  1JT0 A;  3H3V K;  4A6E A;  2R7U A;  5HS9 A;  1ZGJ A;  4IF4 A;  2DAO A;  2OZ6 A;  4BDY A;  4AUX A;  5FGM A;  1W5C C;  1JUS A;  1MW7 A;  4L0Z B;  5AON A;  2OTJ I;  2EIN H;  4KN4 X;  4ENJ A;  1K61 A;  1F5T A;  2FQ3 A;  3KEQ A;  1N77 A;  1YW9 A;  3IV5 A;  4BUP A;  3J7A Y;  5K7F A;  4TV7 A;  3HYI A;  4XBF A;  3BJ6 A;  1WJE A;  2A05 A;  2A68 F;  2LOO A;  3A0H C;  1F36 A;  2M0C A;  5J4Y A;  4CYC B;  1OCT C;  3JRD A;  1OJL A;  2DMQ A;  2LKP A;  3BG9 A;  3JR9 A;  2KKO A;  2XPV A;  4BHB A;  1AWC A;  4L9J A;  3JRA A;  1IRG A;  1WKM A;  2M7B A;  2M87 A;  2NOG A;  2ZFW A;  4BS9 A;  5HS7 A;  3F8F A;  4WX9 A;  1T6S A;  4M9X A;  2L7K A;  4ZZD A;  3G1O A;  1UEL B;  2E1M B;  2R7D A;  2LBF B;  2VE9 A;  1QQI A;  2EIJ H;  3FM3 A;  3QYE A;  2XPW A;  4NQW B;  2FE3 A;  1XSD A;  4IRI A;  3I55 I;  4HNV A;  1KQ8 A;  5FFX A;  5FLV A;  1MJ9 A;  1HLV A;  3PUF A;  3V8K A;  3FIW A;  1RUO A;  1BL0 A;  2DA5 A;  5FFZ A;  3ZQF A;  1GXP A;  1X1B A;  2L9N A;  1XSX A;  1JKP C;  2NVT J;  5GAH J;  1YRN A;  3SQN A;  2H1K A;  1X2N A;  3S16 J;  4CDG A;  3LQR A;  3BR2 A;  3FMR A;  1MSF C;  1RET A;  5DV5 A;  3LWF A;  3MKY B;  3IWF A;  2ZXI A;  3FM5 A;  2LRE A;  1BIB A;  2HDW A;  1BA5 A;  1YTY A;  4MEX F;  2WA0 A;  1MSE C;  1I50 J;  4HQE A;  5DM6 F;  2JZY A;  3BZ6 A;  2QVO A;  3CCJ I;  3EUH C;  1ZYR F;  3VFZ A;  5KAI C;  3JRB A;  4BXX J;  2R7Q A;  1YHQ I;  2OU2 A;  2FA5 A;  4EJT A;  1W5T A;  3IAS 2;  2H6C A;  1TNS A;  4HEA 2;  4G7Z F;  2BOL A;  1R71 A;  2YU9 J;  4FIS A;  5K5Q A;  1NK2 P;  1Z9C A;  1ZLK A;  3FWE A;  1ETO A;  4XQF A;  3MFK A;  1X19 A;  4Y33 A;  1ZQ3 P;  4BY7 J;  1J9I A;  4KMU X;  3OYI A;  2W82 A;  5J47 A;  4UUT A;  3MAJ A;  4LK0 F;  5GP9 A;  2IJL A;  1LE8 A;  1Q1H A;  4PDK A;  4BQQ A;  2JMW A;  1UHW A;  2UUZ A;  3ZN0 A;  4IHW A;  3GLL A;  5A2Q Z;  2Y0M A;  2WV1 A;  1LJ9 A;  2CV1 A;  4CHU A;  3VSK A;  3G73 A;  3DTK A;  1Y1V J;  1U5T A;  5HDN A;  4Q5S F;  4RM3 A;  1MD0 A;  2EV0 A;  2WAQ A;  2JA5 J;  4AD9 A;  3CP8 A;  2MG4 A;  2DU9 A;  3DU6 A;  4OAZ A;  3AG2 H;  3DF8 A;  3I3L A;  1FTT A;  3S14 J;  3ECH A;  1G6N A;  1BR4 A;  3FIS A;  1EKE A;  2K9L A;  3LFK A;  3RQ4 A;  1N75 A;  1ZG1 A;  1S7E A;  2LH9 A;  4PSW A;  3OYD A;  1GT0 C;  2W48 A;  3GVA A;  2WAQ N;  3G1L A;  4PFP A;  2LYC A;  1XB4 A;  1FP2 A;  4J00 A;  2GIV A;  3G2B A;  3RKW A;  2IAI A;  3S17 J;  1JHF A;  2ADU A;  3FKJ A;  3WOD F;  1VTN C;  5E3N A;  1ERD A;  2KFD A;  2HOT A;  5FRM A;  2GA1 A;  5FKL A;  3ZMS A;  5HDK A;  4X1E A;  5IT9 K;  3ZQ7 A;  2MH9 A;  2CW7 A;  1KZH A;  2LNB A;  2CMP A;  1VQL I;  4UNO A;  3LMM A;  3QAH A;  5D5U B;  3OYJ A;  1OLT A;  2FNA A;  2LY1 A;  4OIQ F;  1VQ6 I;  2UV1 A;  3RPU D;  1EA3 A;  4AYB A;  4BBS J;  2Y9Y A;  1SAN A;  2JTV A;  2EA4 A;  1UAA A;  2YSR A;  4RB0 A;  3NWT A;  1MBJ A;  3HPH A;  3JRG A;  3BG6 A;  1I3Q J;  5J40 A;  2GXG A;  4FCY A;  2CW0 F;  1BOA A;  2CV0 A;  3DTE A;  1YIO A;  3DQV C;  3ZPL A;  2A5W A;  5DUK A;  3R6S A;  1ACI A;  1BI1 A;  4MQV A;  2X1C A;  3K7A J;  3MN2 A;  5JLW A;  2CFO A;  2I8D A;  2L02 A;  2HPI A;  3N4M A;  2DFE A;  2BXZ A;  5HNF A;  2KPM A;  2FF4 A;  2L4M A;  2V6E A;  4Y3O A;  1W7P B;  5EYR A;  4DZP A;  2GOX B;  1FIP A;  2R93 J;  3Q0U A;  2MLK A;  1IV6 A;  3OYB A;  3M8F A;  1TWG J;  4BYY A;  1TTY A;  3CES A;  3J80 Z;  1OIS A;  3H0G J;  5CVR A;  1VQ5 I;  5F08 A;  2DQR A;  3C3W A;  2AQE A;  1B1B A;  1UCR A;  3L2Q A;  1ULY A;  1B4A A;  2DDB A;  2W24 A;  3PUB A;  2EFP A;  1MH4 A;  2X1E A;  3SDB A;  1XGO A;  4M9S A;  2E2J J;  2GBY A;  1IRZ A;  2CU7 A;  4I98 B;  1YQA A;  5L3G A;  2V1U A;  3ZN1 A;  5CQE A;  4O3M A;  4G6D A;  1I1G A;  4L9N A;  1CQT A;  2RNJ A;  3FXQ A;  2KIU A;  1XDU A;  3IRQ A;  2JVG A;  4IHV A;  1Z0X A;  2VT3 A;  1MBG A;  1E3P A;  2ZB9 A;  1ITY A;  3CTA A;  4NC7 A;  1I1S A;  1RNL A;  3HOS A;  2DQL A;  4AC0 A;  3ERM A;  3JRH A;  1A6Q A;  3I5U A;  3DBH B;  2NNY A;  5H6Q A;  1DGR M;  4D0P A;  1YOV B;  4ZTJ A;  3MZ8 A;  4EV0 A;  3KP2 A;  4U0V A;  1JKO C;  4HV6 A;  3IUO A;  2PJR A;  1TBX A;  2DW4 A;  2X51 A;  1FC3 A;  3QPS A;  1OFC X;  1TQI A;  1WJ5 A;  3TBI A;  2FNP A;  4HRI A;  4I6Z A;  2DI3 A;  1RKT A;  3L2C A;  1TQP A;  2DA4 A;  3OL3 A;  4F55 A;  5IY5 H;  4FAS D;  4XOP A;  5AIP A;  1Z7L A;  3KE2 A;  1Z7U A;  3KYD B;  5TIS C;  4HW0 A;  1TLH B;  5B66 C;  2Z3Y A;  1AHD P;  3D5L A;  4GGG A;  3LFU A;  3RPU A;  4D7N A;  5HDG A;  2QSF X;  3ELK A;  2VUM J;  2PFB A;  3FHN A;  4A3C J;  3MVP A;  4PJL A;  4IX7 A;  1MMN A;  4MTE A;  2R5Z A;  3I64 A;  4ESB A;  3A01 A;  1IN6 A;  4A3B J;  3CUQ C;  4L5E A;  2A07 F;  1O7L A;  4MHG A;  3QRF F;  1R22 A;  2EIK H;  1KU7 A;  5KK1 A;  5LRS A;  3JAM K;  5ICF A;  2ZJ2 A;  2V4J C;  3WHB A;  2ZKZ A;  1Q1V A;  2VI6 A;  3GF2 A;  4HF0 A;  4UUV A;  2A6T A;  1MH3 A;  3A1Y A;  3GTJ J;  1W5S A;  1ZGW A;  4XL9 A;  2UZK A;  1FWZ A;  1HQC A;  4P55 A;  3ZQG A;  5J8C A;  1RZ4 A;  3QWL A;  4V19 K;  1H0M A;  4ZYG A;  2BW3 B;  4W97 A;  3PNT A;  2O8X A;  3HG9 A;  3SFZ A;  2DOF A;  2QEN A;  4N4N B;  3VDX A;  2OD5 A;  1VF9 A;  1SVO A;  1N78 A;  3RSN A;  4G7H F;  4HPQ A;  1AOY A;  2IGM A;  3MD2 A;  1E17 A;  3IRR A;  4A0Y A;  1LFU P;  2IA0 A;  3IH3 A;  3H3Z A;  4M3E A;  2EH3 A;  2M8G X;  1JKR C;  3K2Z A;  4E7S A;  2QEX I;  4X0G A;  1SD5 A;  1UMQ A;  4YFK F;  4XSZ F;  4UVB A;  1TT0 A;  5LFA A;  1IDY A;  1VQK I;  3NEU A;  2GZW A;  4A0X A;  1QVU A;  3I0T A;  3EQL F;  2IA2 A;  2RVC A;  3ZMZ A;  5FLX Z;  4QPQ A;  3A2K A;  2EFN A;  3K4J A;  3E6D A;  4DYC A;  2HYG D;  2X6Y A;  2Y30 A;  3HOY J;  4BJ5 C;  1NH3 A;  2M1B A;  2BVM A;  1D1B A;  4RDU A;  2QSH X;  1TC3 C;  4CCK A;  2VXD A;  1S5L C;  1QPI A;  3HHH A;  5J4V A;  1H8A C;  1WWX A;  3PQJ A;  2R7Z J;  2VIX A;  2JA8 J;  3BCA A;  1XGS A;  2Z2S B;  2MAB A;  4HOB A;  3TL4 X;  1XD7 A;  4BE2 A;  3K4L A;  1HST A;  5J8F A;  1V55 H;  4G12 A;  3L00 A;  3TED A;  4QLC U;  3HKZ A;  2K3P A;  4BL0 B;  4PUS A;  4RGX A;  4LG0 A;  3OR1 C;  2H8W A;  3ESW B;  2ZME C;  4DOZ A;  2HR3 A;  3F8B A;  3IH4 A;  5EZH A;  2OAZ A;  3AG3 H;  1F43 A;  1OCR H;  4OMY A;  2IA1 A;  1B9M A;  1XCB A;  4KUM A;  4PJN A;  1LFB A;  2XAF A;  2CV2 A;  2QKL B;  2ZJQ F;  3CJN A;  3QPT A;  2HTJ A;  3PL8 A;  4NC8 A;  2Q0O A;  4A3E J;  2F2E A;  1YLF A;  3M3Y J;  2PMZ A;  2QWW A;  5DD4 A;  2X4H A;  3U21 A;  5L3E A;  3KET A;  2KRF A;  4U0Y A;  2KIQ A;  2WY7 Q;  4IEJ A;  4GXO A;  4G6T B;  5EZG A;  3TO6 A;  1O57 A;  3H9Q A;  3OOP A;  2ISY A;  1T2K A;  3BRO A;  2JRM A;  2PMZ N;  2JRT A;  1TT5 B;  4O5V A;  5L3D A;  2ID3 A;  4DYR A;  3WG9 A;  1HC8 A;  2FML A;  1MMD A;  4IQ4 A;  1MBF A;  4LB5 A;  1XGN A;  2M45 A;  1JTY A;  3QP5 A;  3T0Y A;  3K69 A;  3TW7 A;  2GA2 A;  5HLT A;  1S6L A;  3M1E A;  1TL8 A;  2RGV A;  1WJD A;  4CIC A;  1BW6 A;  5JVT A;  3CMY A;  3CDI A;  1XC5 A;  3KIO A;  4LMY A;  5D5V B;  4GO1 A;  1IN4 A;  2QQ9 A;  4ZJZ A;  1WJC A;  3HSR A;  2W57 A;  1OCC H;  2CUJ A;  4WK8 F;  2CSO A;  1GV5 A;  2XF5 A;  1BM9 A;  3MQ0 A;  1QNT A;  4B48 A;  1R4N B;  3BJA A;  2QM3 A;  4XRS G;  1WCM J;  2DFF A;  3DFG A;  1O3T A;  1P92 A;  3EYI A;  4OMZ A;  5IT9 Z;  1UHS A;  2FEZ A;  1FIA A;  4C3I J;  4HA8 A;  5BNG A;  2ISZ A;  3CO6 C;  4QIW N;  1U0J A;  2LVS A;  4ZYA A;  1ETY A;  4YII A;  2R0Q C;  4FT8 A;  4JK1 X;  3OYE A;  3KP5 A;  3Q9S A;  1WZ2 A;  3WE2 A;  4ZYD A;  1P2F A;  2E5Z A;  2DPD A;  4EMS A;  2G7H A;  3BR6 A;  3MCZ A;  2HVS A;  2RV8 A;  3V8L A;  4EAT A;  1DQU A;  5HS8 A;  3CCL I;  2QBY B;  1IW7 F;  1Z6R A;  2RAE A;  3KEO A;  4D9J A;  4AIJ A;  2XAS A;  2JJ7 A;  1ZG5 A;  4UB6 C;  1TQM A;  1YO5 C;  3O2P E;  4R8H A;  1QZZ A;  3FK6 A;  5ED4 A;  4LG3 A;  2Z1D A;  5E18 F;  2VBX A;  3M07 A;  2FX0 A;  2JWT A;  5CQG A;  2HEO A;  4IOC F;  4BEH A;  5DCM A;  4Y7N J;  3HJE A;  3RKQ A;  2ZXW H;  5E79 C;  1GDT A;  2VOD A;  2MD0 A;  2E1C A;  2BZT A;  2NS0 A;  2R5Y B;  1R7J A;  4B3A A;  5IYD J;  2DA6 A;  3BLY A;  2VBW A;  3Q0V A;  4XNF A;  1YFH A;  1R36 A;  3NAR A;  1J59 A;  1X1P A;  2QUF A;  4WXC A;  2XF7 A;  3GFI A;  2NS7 A;  2HI3 A;  2AHQ A;  4I7H A;  4PJM A;  5F0F A;  4PCQ A;  3L09 A;  4II2 A;  2L4A A;  4XLP F;  1T8I A;  5F0H A;  4EQQ A;  2VT2 A;  2L2O A;  5H6R A; 
#chains in the Genus database with same CATH homology
 1WJB A;  4BGD A;  2KDO A;  1FMV A;  1VZ0 A;  4NQW B;  4DGW B;  3OYC A;  2VPL A;  4P5O A;  4CZC A;  3K4C A;  2WAE A;  4II3 A;  1D0Z A;  3KX2 A;  1LKX A;  4ZC3 A;  4JQF A;  3HXL A;  4E7K A;  2E5N A;  1X1B A;  2L9N A;  2R7R A;  3EUK L;  2O5R A;  2Y0S A;  3DU5 A;  3K6G A;  2HPM A;  4BE1 A;  3OYM A;  4CH7 A;  3S93 A;  5JHF A;  3KYL A;  4XLH A;  4XN3 A;  1JI8 A;  2MC4 A;  3MKY B;  2ZXI A;  2LRE A;  2W4S A;  2HDW A;  3BG7 A;  2FUG 2;  2WA0 A;  4BAC A;  3QYB A;  2CH0 A;  1W36 C;  4BXF A;  2KMU A;  4E6K G;  3EUH C;  4F91 B;  4ZDP A;  2JVH A;  3FBI B;  2R7Q A;  4C2U A;  3SEQ A;  1Y56 A;  1UG0 A;  3IAS 2;  1Y6I A;  2CUZ A;  2HNH A;  2R7W A;  4HNU A;  2DT6 A;  5TGT A;  4HEA 2;  3OYF A;  2IS1 A;  2BOL A;  2LY2 A;  4J01 A;  2M0M A;  2KP6 A;  4XOT A;  3M8J A;  1X19 A;  4Y33 A;  2XF6 A;  4DBQ A;  3OYH A;  1LDK B;  3OYI A;  2W82 A;  4NNJ A;  3EPZ A;  4BQQ A;  1WJA A;  1WJF A;  3D5S C;  3HL2 A;  4XMY A;  2UUZ A;  4GRI A;  3SEZ A;  3OS1 A;  3E1S A;  2CV1 A;  2F5V A;  2VJJ A;  3OIQ A;  3VSK A;  3DTK A;  3F9K A;  4BE0 A;  5CKT A;  3ZR8 X;  1G59 A;  4RM3 A;  2WAD A;  3FBN B;  2LG4 A;  3ZGK A;  4BEH B;  4H4K C;  2WAQ A;  3V42 A;  3CJR B;  4C2T A;  1NG7 A;  3CP8 A;  3DU6 A;  4OAZ A;  3I3L A;  3OYN A;  2R7V A;  1TZL A;  3OY9 A;  5FRO A;  1BR4 A;  3UNG C;  2K9L A;  3RQ4 A;  1N75 A;  1MND A;  2LH9 A;  4PSW A;  4RLQ A;  3W2V A;  3AKZ A;  3OYD A;  2KRC A;  3OIP A;  4PFP A;  2LYC A;  2WBM A;  3PNY A;  4J00 A;  4YEJ A;  1FMW A;  2HZD A;  3G2B A;  3RTR A;  4CCM A;  4BQN A;  1X1D A;  3FKJ A;  3K4K A;  5LD2 C;  3OYG A;  2DT7 B;  4XM3 A;  4AU7 A;  2R4G A;  5CPR B;  4ZTF A;  5FRM A;  3OYL A;  4BJ6 C;  2OV7 A;  2IS2 A;  3BC8 A;  3M1C A;  1D1C A;  2CW8 A;  2CW7 A;  2LRD A;  3H5A A;  3QOD A;  1ZEL A;  2CMP A;  1BR1 A;  4XON A;  3L2V A;  3LMM A;  4IQJ A;  2WY8 Q;  4DJA A;  3OYJ A;  1OLT A;  2LY1 A;  2KQR A;  2UV1 A;  3RPU D;  4NUB A;  3S3N A;  1EA3 A;  3IAM 2;  3OS0 A;  3VYU B;  4AYB A;  3H35 A;  2KHM A;  1UAA A;  3NWT A;  3TMO A;  3HPH A;  3DPL C;  2RRE A;  3BG6 A;  3FDY A;  2CV0 A;  3DTE A;  3DQV C;  4OWR B;  2A5W A;  3OR2 C;  2WAF A;  4HNT A;  2E1M C;  4F92 B;  2L5Q A;  2X1C A;  2CFO A;  2I8D A;  1MNE A;  2HPI A;  1W36 D;  1GLN A;  4E4H A;  5HNF A;  1PJR A;  2KPM A;  3AL0 C;  2V6E A;  4Y3O A;  3ZQQ A;  1DP3 A;  2GOX B;  2VKD A;  2BW3 A;  3OYB A;  2RNG A;  4CCL A;  3D5R C;  4XKC A;  1V5G A;  3CES A;  4C30 A;  3LSM A;  3OMY A;  4FET A;  2AQE A;  3SYT A;  3L2Q A;  2K5C A;  2VQL A;  3I9V 2;  3W3C A;  3PUB A;  4XKW A;  4ANJ A;  2X1E A;  3SDB A;  2VXZ A;  1X4P A;  2R7O A;  4ITV A;  1MMA A;  1J09 A;  2IS6 A;  1Z21 A;  5CQE A;  4ZDL A;  2VQC A;  3DTI A;  1WFX A;  2LC2 A;  2JVG A;  1QHH D;  3MKZ A;  3K70 D;  1T95 A;  3LSG A;  4E7J A;  4NC7 A;  2VKH A;  1QU3 A;  3HOS A;  3CMM A;  3VYR B;  4XKB A;  4U7B A;  3C2G A;  1YX3 A;  1DGR M;  2IXS A;  4RM2 A;  4BU2 A;  4ZTJ A;  3LL7 A;  2F6C A;  2F4I A;  1YX5 A;  1X1A A;  3IUO A;  2PJR A;  3CP2 A;  1D0X A;  2X51 A;  3ZRG A;  1Z3X A;  1MMG A;  1WJ5 A;  4JOM A;  3TBI A;  4HRI A;  5KNL A;  2M3A A;  3H5N A;  3OL3 A;  4F55 A;  2UWM A;  1D0Y A;  2X85 A;  4XOP A;  4FAS D;  1Z7L A;  2R7X A;  1AA7 A;  3S3M A;  4RLF A;  4HST A;  3K70 C;  2DXI A;  2OUM A;  2WB1 A;  3QYF A;  3D5L A;  3LFU A;  3DKY A;  3HUG B;  2MFZ A;  4XLE A;  3FHN A;  3OYK A;  2DOA A;  1IRX A;  4PJL A;  1MMN A;  4F3Q A;  4IX7 A;  3CJQ B;  2R7T A;  4DIQ A;  3K4B A;  3S32 A;  4LIT A;  3A4C A;  2M4G A;  3PJR A;  2VJ4 A;  3DWL E;  3VYT B;  2CS3 A;  2DJI A;  2ZSI B;  2V4J C;  2XC7 A;  3VYS B;  3DPT A;  4XOR A;  1Z3Y A;  2IGO A;  4XN0 A;  2A6T A;  4B3X A;  4RMN A;  3A1Y A;  2V1N A;  2XDV A;  4XL9 A;  4QPO A;  1T0F C;  4BJT A;  4PFO A;  2BW3 B;  3PNT A;  3W2W A;  3HG9 A;  1DGW Y;  3MKW B;  4N4N B;  3VDX A;  1G8X A;  1N78 A;  2V7F A;  3RSN A;  4HPQ A;  2IGM A;  3GBG A;  3MD2 A;  1P9Q C;  4YEL A;  5HVQ C;  4XLA A;  4PK4 A;  4E7I A;  3H0D A;  4E7S A;  4X0G A;  2VJ5 A;  2QKM B;  1TT0 A;  2XAU A;  5LFA A;  3HOT A;  2OC6 A;  2KLO A;  2HVR A;  4QPQ A;  3A2K A;  2Q1Z B;  1D1A A;  3K4J A;  2DCE A;  2VQG A;  3EUA A;  3OL4 A;  4XKV A;  3AFH A;  1QHG A;  2X6Y A;  4N4O B;  4BJ5 C;  2BVM A;  1D1B A;  2KL4 A;  3K4N A;  3DPU A;  4CCK A;  2VXD A;  3H9J A;  3K10 A;  3LSK A;  4PSX A;  4KIT B;  3ZXS A;  3BCB A;  1E0E A;  2PJR B;  3KEY A;  3HPG A;  3H9G A;  1ERD A;  1NG6 A;  2VIX A;  4XLF A;  3BCA A;  2Z2S B;  2MAB A;  1LFP A;  3PFY A;  3TL4 X;  1V5F A;  4BE2 A;  4DBR A;  4ZDO A;  1BOB A;  2IGK A;  2M7A A;  2XSJ C;  3K4L A;  3NWS A;  1PYV A;  4CCJ A;  3HKZ A;  3AL0 B;  2K3P A;  3DEE A;  4BL0 B;  4PUS A;  4E7H A;  3OR1 C;  1LVK A;  3ONQ A;  4CUG A;  4DOZ A;  3N05 A;  2M4K A;  4LIV A;  4P1W A;  3VWB A;  4BQO A;  4KT6 A;  4LIU A;  3IP4 B;  1YE9 A;  4CCN A;  4HSR A;  1S9H A;  2E60 A;  2P0W A;  2ZSH B;  4PJN A;  3L2R A;  2CV2 A;  2RQQ A;  2QKL B;  3LSI A;  3PL8 A;  4NC8 A;  2JUG A;  2JSP A;  5HNH A;  2PMZ A;  2HVQ A;  3OS2 A;  3U21 A;  2V26 A;  1SFK A;  1X4O A;  2Z16 A;  3DKX A;  2WY7 Q;  2AQF A;  2Q2E B;  4KIS A;  4G6T B;  2LBF A;  3HC7 A;  2IGN A;  3H9Q A;  2V9K A;  2W1O A;  4MLO A;  2ZFU A;  4U87 A;  2VLA A;  4E7Z A;  2W00 A;  1OR7 C;  2X1D A;  1MMD A;  4IQ4 A;  3PSI A;  2VB6 A;  2R7S A;  2BVL A;  5HLT A;  3PNV A;  4B47 A;  4BDZ A;  1WJD A;  1BR2 A;  4OAY A;  2HQA A;  3C2H A;  2MYS A;  4R79 A;  3L2W A;  4ZJZ A;  4CCO A;  4PJJ A;  1WJC A;  2VAS A;  2GOM A;  3LSH A;  4XLC A;  4F52 A;  2CUJ A;  4CSW A;  5HOO A;  2XF5 A;  5KHD A;  4B48 A;  1K6Y A;  2IS4 A;  4B43 A;  3ZCO A;  4KJZ A;  1X1C A;  3RCO A;  3S3O A;  2X6W A;  1SAU A;  4XR6 A;  1U0J A;  2VJI A;  4CA0 A;  4ZYA A;  2L9S A;  4AVZ A;  3PSF A;  3OYE A;  5FRN A;  4C9Y A;  3OOU A;  3E0J B;  3MMY B;  2JA2 A;  2R7U A;  2E5Z A;  1R6R A;  3H5R A;  4IZZ A;  4YRV A;  4Y4R A;  4BDY A;  2HVS A;  1MW7 A;  2X6X A;  4EAT A;  4D1Q A;  1DQU A;  5KCM A;  3VSL A;  1V5E A;  3K4M A;  3QOE A;  4D9J A;  1N77 A;  2VQH A;  3SZG A;  4BUP A;  3OWT A;  3J7A Y;  3UR3 C;  4IKF A;  2K9M A;  4B44 A;  3CZ6 A;  1WJE A;  4LG3 A;  2LOO A;  2Z1D A;  1HA8 A;  3W2A A;  5CQG A;  4BEH A;  2KRH A;  1KON A;  2MD0 A;  2M7B A;  2ZXH A;  4HG2 A;  2KZV A;  4BS9 A;  3BLY A;  4E7L A;  4XNF A;  2ELJ A;  2NOJ B;  3DLA A;  3L2U A;  2XF7 A;  2VL8 A;  2HU9 A;  2L7K A;  3OYA A;  4PJM A;  1UEL B;  2E1M B;  2LBF B;  4II2 A;  3S8P A;  2W7N A;  3CF2 A;  4F93 B;  4XQF A;  3QYE A;  2L2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...