3RCOA

Crystal structure of a conserved motif in human tdrd7
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
76
structure length
76
Chain Sequence
MLEGDLVSKMLRAVLQSHKNGVALPRLQGEYRSLTGDWIPFKQLGFPTLEAYLRSVPAVVRIETSRSGEITCYAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a conserved motif in human TDRD7
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Tudor domain-containing protein 7
total genus 19
structure length 76
sequence length 76
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12872 OST-HTH OST-HTH/LOTUS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1880 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3rcoA00
2LH9A 2KZVA 2KPMA 2LY2A 2LY1A 3S93A 3RCOA
chains in the Genus database with same CATH superfamily
3IP4B 4E7JA 3FXUA 3I54A 2DYRH 2RGVA 2ZXJA 3ZN0A 1IXRC 1HC8A 3BZCA 3WODF 1D5VA 3N05A 5F1JA 1MKMA 1K79A 2OZ6A 2GLOA 3TDUC 1BJAA 2ELJA 2KMUA 3Q0VA 3CCLI 1XGMA 3V8KA 3G4SI 2M30A 3V7CA 1G3SA 5C4JJ 1I6HJ 2Y31A 3CLQA 1WJ5A 2L0KA 3CCYA 5J1YA 3MVPA 4B09A 1R1TA 4JBAA 4X6AJ 2K9NA 3K0LA 3PNTA 2P81A 4E7SA 1FWZA 2Y0SN 4OAYA 2IGKA 1P4WA 3BROA 3MZ8A 4IQ4A 5E3LA 4OIOF 3ABTA 1CGPA 1UAAA 1HQCA 1MMAA 3MWMA 4XICA 3S3MA 4L0ZB 1W7PB 2ZMEB 2A69F 2E5NA 1W5SA 2BV6A 2CWEA 3DKYA 2M2EA 3AAFA 4HNUA 2JUGA 1OQYA 4TV7A 2NOGA 5BQTA 1IN5A 1ITYA 1ZTRA 2A5WA 3OIPA 3FX3A 1YW8A 2BOLA 2R7FA 2PFBA 4IVNA 4XLAA 5JR3A 3G71I 5JVGF 3WTVC 2VKDA 4XLHA 4CYCB 4Q47A 1LUJB 1Y1VJ 3DTEA 2PI0A 4C30A 4BBRJ 4CHUA 1O3TA 4YG2F 3L2VA 1R71A 1NK3P 1YLFA 1ON2A 2QEXI 2XRNA 3A0BC 3SEQA 4A5NA 3VDXA 2P5VA 4JYKA 5B1BH 3OYFA 2FA5A 3BZ6A 4UUTA 5D4SA 3QPLA 5TGTA 2DPDA 3BCAA 1ETWA 2KIUA 1J2XA 4D5CA 5F0HA 1MMSA 1X1DA 4KJZA 5HOOA 3H3VK 1APLC 2FOWA 2L3DA 3F8BA 2Y69H 5FB2A 3OL4A 3WU0A 5D5UB 1Z6TA 3RPUA 2CQXA 2NVTJ 2D1VA 3E7LA 1X58A 3HDDA 4IOCF 1PUFA 2QKLB 5DM6F 3W6VA 2IA0A 5DYMA 2VPLA 1OJLA 2VBYA 3TO6A 3VPRA 4HF2A 4PJJA 1ERDA 3CZ6A 4E7HA 4XKVA 2LK2A 2H8RA 1JXSA 2EV5A 4HSRA 2E60A 2EPFA 2EIJH 2G9WA 2NNYA 1QVUA 2HWVA 3WU2C 2KLOA 1ZRDA 2DT5A 1A6QA 4I7HA 1G8XA 2Q1ZB 4UV9A 5KNLA 4EEFG 3HOUJ 2M34A 2CGPA 5JFRA 1WI9A 2L9RA 2AS5F 1TC3C 2G7HA 1ZG5A 2FMYA 3PUBA 2VODA 1FOKA 2CH0A 1DU6A 2RQQA 5ICFA 5CVIA 4ENJA 1OYIA 2LDUA 4E4HA 1BW5A 2K27A 2KFDA 3GFJA 4DZJA 1MSFC 2ZSHB 4XKBA 1EH6A 2HYGD 2DO7A 3HBLA 3HGGA 1HOMA 3GYHX 3U9GA 4B4CA 5KAFC 3KEYA 2XPUA 2Z99A 2R7DA 3ZOBA 3MD2A 3VWBA 2DFEA 2QLZA 2PJRB 4A3BJ 3NAUA 1LPQA 3D5SC 2HTJA 3O2PE 4BDYA 1T38A 1TWFJ 4RM3A 1OMIA 3PO3J 1I39A 5HDNA 5FGMA 2GIZA 3KX2A 4O5VA 3DLLF 2UWMA 2LOOA 4XOPA 2KRCA 5CVUA 2JVHA 3G3ZA 4I98B 5DCFA 2LBFB 2FXAA 2W84A 4MEYF 5JI6A 1F5TA 2IA1A 2K3PA 4FE4A 1ETKA 4A69C 5ICEA 2R0QC 4R8HA 2A6EF 1A36A 3OYMA 4HEA2 1IUFA 1I3AA 4G7HF 4L18B 5DS9A 3TL4X 1PUFB 4AIJA 3F6OA 2WTEA 2UXNA 3A1YA 2X0LA 2L5QA 1ZN2A 3HUGA 1IJWC 3BQZA 1QZZA 2LP0A 1S9HA 2DA2A 1Z1DA 3CCJI 5GPCA 4D7MA 1P7JA 3H3UA 2Z9OA 1KU9A 3K4KA 1O57A 4I99C 3AG3H 2VPRA 1U78A 4BQAA 3DBHB 4IRGA 1SVOA 2AHQA 2VC0A 3E6MA 4Q5SF 1QHGA 3QPTA 4XLNF 3DWLE 1XCBA 3L2UA 2R5ZB 2BHYA 2CQ7A 2X51A 3GW2A 5B66C 4Q48A 3FK6A 3K4NA 2V1NA 1B8IA 5CVJA 2CU7A 4X0GA 4IL6C 3VYRB 4V2GA 2HTSA 2COBA 1EKEA 4L5JA 2QZ8A 2CW0F 2UUZA 2WC2A 3C2GA 4A0YA 4PJ0C 1R23A 5FRNA 4ZYGA 1P7IA 3V8JA 2FU4A 2R92J 4DZPA 4DIQA 3CDHA 1E2XA 4M6XA 2E1NA 5DD4A 1WJDA 5HLTA 3GFIA 1GUUA 3IKTA 2JWTA 3HRMA 3H0GJ 1TW2A 2V7FA 4BXFA 2TRTA 1VI0A 2TDXA 5TRDA 1I50J 2R93J 1FYKA 4ZYHA 1VQ7I 1DP7P 2PMZA 1G3YA 5FROA 1GT0C 3CJTB 3VYUB 5IOYA 1TNSA 2CO5A 3K4BA 4I02A 1U3EM 1YJ9I 5F08A 3S1RJ 4A3CJ 1JTXA 2A05A 5L3EA 1QNTA 3ERED 2DMQA 2KRFA 2ADUA 3HZJA 1V3FA 4EATA 2R7XA 1IDYA 1IW7F 1BR4A 2HPIA 2WB1N 5F1RA 3GZ6A 1IV8A 5ICCA 1ETXA 3BOQA 1EF4A 2H8WA 2JTVA 1JHHA 3FXJA 2BHZA 2ZMEC 2LD5A 3LSTA 3HTSB 1MBJA 3ZMSA 1VQ6I 1FBSA 3ZQ7A 1G59A 3KZYA 3G1MA 2WV0A 3M1CA 2OPTA 3ZN1A 3S14J 5FKLA 2QWWA 2FX0A 3NRVA 4XRSA 3LQQA 1S29A 2HQRA 1YTYA 3GTMJ 2F4IA 1QZYA 3JW4A 2E1MB 2E71A 2AXLA 2ZJQF 1QQIA 1R4NB 4AIHA 1T0FA 2M3AA 1U5TB 4NHJA 4M3BA 4A3EJ 3QOEA 4XORA 4KMUX 5HODA 2V26A 2DA5A 3I71A 4LLGF 1OYYA 4FTHA 3EUHC 4XONA 1XGSA 1FTZA 2P4WA 2K85A 2O5RA 1N75A 2Y0SA 4O3MA 5FKNA 1NG6A 1OCZH 4ZYEA 5FRMA 4XM3A 2OTJI 1EH7A 2JA6J 5F04A 4BEHA 3DKXA 1X1CA 2E7XA 2WWYA 4LD5A 2DJNA 4U0YA 4BNCA 4BXUA 3ZMDA 2DAOA 3H92A 1G3TA 1OKRA 2CUZA 1JI8A 4P96A 2VKVA 4FISA 2CQKA 3SZPA 1JUMA 5IT3A 2A07F 2ECBA 3HRSA 1OCTC 3A01A 3IL2A 1JT6A 4E7IA 5FKMA 1ZELA 2PQ8A 2LTPA 3FXOA 5IY5H 1RC9A 1IAWA 3I58A 5FLXK 1DU0A 4CZCA 4ZYDA 3BTLA 4ZTFA 2CMPA 3M8JA 3N97A 2NOJB 3H35A 4BHCA 2KL4A 3Q9SA 2FE3A 1T33A 1XGOA 1QRYA 2Z5UA 3CCEI 1Z6RA 3BTIA 3GLLA 4XLFA 1QU3A 4E6KG 2G0EA 2M45A 1DUXC 4XLCA 4IKFA 1UELB 4BBSJ 1UMQA 2L7KA 3WG7H 3D1NI 2CFOA 1D1CA 1F4KA 3S2DJ 4KITB 3ZQIA 1IRZA 2WA0A 1UHSA 1UCRA 4M9ZA 1DGWY 2RAEA 3GVAA 4FHTA 3E5QA 5FJ8J 1VZ0A 1HLVA 2XDVA 2V9PA 2XASA 3V7RA 1RR7A 1FBQA 4CYCA 1KQ8A 4L5IA 1S7EA 2BGCA 1K6OA 2EINH 3C3WA 3Q5FA 1YITI 1ZREA 3S1NJ 4KYWA 2JJ7A 1H9GA 3DBLB 5LHGA 3UNGC 4RGSA 1G2HA 1IRGA 2CV1A 4M3EA 2CRGA 3GLXA 3DTKA 3FK7A 2FQ3A 1YOVB 3I53A 1E3OC 1GV2A 2ZSIB 5GPAA 4AIDA 1X1BA 4RBOA 2R7ZJ 1FT9A 2H1LA 4B47A 2QENA 3J81Z 4X1EA 3F23A 4MNUA 2OAZA 2RREA 1R58A 2HDWA 4YFKF 1B1BA 4OMYA 1BI1A 5JLWA 1IN8A 3DQVC 2VQGA 5LHHA 5F0FA 3OYHA 5BOXA 5LFAA 2M5WA 3LFKA 5LGTA 3SXYA 4RB1A 4IRIA 4A3GJ 1BOAA 4GYIA 1X4OA 4L5EA 1D5YA 1XMXA 3RDIA 1REPC 1LE8B 2ETHA 1P2FA 1USSA 2EH3A 4GXOA 3NWTA 4MFDA 4ANJA 5HNFA 1KA8A 2HEOA 2FNPA 2DDBA 4IO9F 2YX4A 4G9YA 1AKHA 1KZHA 4IEJA 4S0HB 3GWZA 5B3SH 1X4PA 4FX0A 2BW3A 1BBYA 2YX7A 2KPMA 1J7KA 1W7PA 3X2QH 1XGNA 4XLPF 3GTQJ 1LEBA 3LSGA 1J75A 3R4KA 4G7OF 2K9QA 3RKQA 4DJAA 3CUQA 4XKWA 2OQGA 4E7LA 2YR2A 4IHXA 3CJQB 1MJAA 4CCMA 1U5TC 1R5HA 2UXXA 4UUSA 5EZGA 5DDGA 2BY3A 3BR5A 5FLXZ 3TP0A 1Q1VA 4I09A 2VKEA 1B9MA 3M8FA 3I59B 2P6TA 2WB1A 2VL8A 1IN6A 3GTKJ 3VEPA 3L2QA 2VE9A 4J01A 3VOEA 2AXTC 2O8XA 3OYNA 3GTLJ 2VJ5A 3FKJA 1UZCA 4Y4RA 1VTNC 4HRIA 5CVVA 2R7SA 5AIPA 3KP2A 4WXCA 4UNOA 1SD7A 4ETSA 2PMZN 4ASNA 1HKSA 2XAHA 3VODA 2LR8A 5GAEJ 2M9HA 3BJAA 4XQFA 2OBPA 1JUPA 3S2WA 5HS7A 2IBDA 1U2WA 5E3OA 1VNDA 1ODDA 4DNCA 4BJTA 5DM7F 4LMYA 2OTLI 3HIFA 1WJCA 3L2WA 5L3GA 1WSUA 3VYTB 1P4XA 3QPHA 2Z33A 3MCZA 1NG7A 1MBHA 1PJRA 4A12A 5C4XJ 1T08B 4HPQA 3CP2A 4RAYA 2JA8J 4BHPA 3BPVA 2LREA 3WTWC 3A01B 2Z3YA 2E1CA 2K02A 3GTOJ 1T56A 5EZHA 3I56I 4KT5C 1PP8F 2NS8A 2L01A 4IRHA 3FM3A 1IUYA 2ZXWH 5CKTA 4N9IA 3RI4A 1J9IA 1LFPA 4HV6A 4XMYA 4CA0A 2MBFA 4EM2A 5E1WA 3F8MA 3KP5A 4EGZA 5DUIA 3PJRA 2Y9ZA 4HZFA 3DEUA 4LB5A 5CVRA 1BIAA 3DV8A 4NDLA 4KNYA 4EM0B 3S15J 1S72I 3MQ0A 4DGWB 9ANTA 3COAC 5AIQA 4NC8A 3W6KB 4KT6A 3FXKA 3OYCA 5HS8A 5IT9K 4F7ZA 4ABZA 4LGWA 1IG7A 3ZR8X 3B6AA 1FMWA 4M6YA 2X6XA 3EYIA 2IS4A 2PN6A 3HSRA 5GAGJ 1MMNA 2O6GE 3J80K 3ASOH 5K5QA 3PM1A 3R6SA 1OR7C 1L3LA 3TO7A 4AYBA 4LG0A 2ACJA 1SFEA 1TWCJ 4ZDLA 5IP9J 2MC3A 4ESFA 1BR1A 3CLOA 4DQ2A 2XIGA 1UFMA 1Z3YA 2EFNA 3HYIA 4PFOA 2PEXA 3SYTA 4G6TB 1MJBA 1FOWA 1JE8A 1IN7A 4ZJZA 2X6OA 3KEQA 1FJLA 3CC7I 2O9LA 1Y39A 3IHUA 1K78B 1VQOI 2XPWA 3F0CA 5LEKA 3IV5A 5KHDA 4XSXF 1ULYA 1XSVA 3IRRA 1FP1D 3PSFA 2JN6A 5EG0B 4CO8A 5E8IA 2WAEA 2FD5A 3JR9A 2EK5A 3IUOA 3JRGA 3D0SA 1CQTA 2IS1A 2DA1A 3GMEA 2D45A 3S1QJ 3SJMA 2H6CA 2LC2A 2VXZA 3PQKA 2XGDA 4BKXA 1FYMA 1HA8A 4XN0A 5KAIC 1SFXA 3TKYA 4QWQA 1HSTA 3MKLA 3BG7A 4YIFA 2O8KA 2J5OA 1XMKA 2EJRA 1J0RA 1TQIA 2KKOA 5ILUA 5L3FA 1DP3A 3BQYA 4B48A 1WPKA 2FF4A 4P5OA 1UJ8A 3BC8A 3D5RC 3GZNB 1MJ9A 4M74A 2M4KA 1USTA 2VKHA 2M8EA 1W7PD 4BU2A 4XRSG 2XB5A 2CUFA 1IF1A 4P9FA 5ILSA 1R9TJ 2VN2A 1TT5B 5D4RA 5FD6A 2FRHA 2O0YA 1V5EA 1WJEA 2COMA 3ECOA 2XHKA 2E1MC 2AO9A 3IH2A 3SEZA 5IPAA 5A2QZ 4UV8A 3ZQHA 2BVMA 3HEFA 1W0TA 2UV1A 3J7AO 3TDZC 2Y75A 3OSGA 2EILH 1FSEA 2DOEA 2NXNB 4BUPA 3B6CA 4KN4X 3ZQFA 1OLTA 2V9VA 4PJLA 1U9OA 3SDBA 4Q4ZF 1MDMB 1W0UA 2HQAA 1WJFA 2W57A 3GTGJ 1D0YA 4GCVA 2W48A 3KFWX 1WKMA 4HX4A 3OYBA 2MH9A 2V6EA 3AKZA 3I9V2 1VQKI 1QBJA 1SMTA 3HUGB 4BY1J 3HB9A 1PVEA 4WWCA 4CZZA 1FYLA 2L9SA 1WFXA 5TJJA 2WADA 3BT9A 3C18A 1LKXA 3MKZA 3F22A 2X48A 4EQQA 2R5ZA 1VQ4I 1SFUA 2KZGA 4FQGA 4FCYA 2VJJA 2R7OA 4OOIA 2LY1A 1HW5A 2V4JC 3IAS2 3HRUA 2DJIA 3JAMZ 4NQWB 1ZLJA 1SD4A 5J6XA 3WU1B 1B72B 2CS3A 4B3AA 2CUJA 2HFHA 2BY2A 4AVPA 3J80Z 5LD2C 3RKXA 4IOAF 2QVOA 3DFGA 2A6HF 4LIVA 2JA5J 3K4LA 5D5WB 2KJBA 1WH5A 5D6EA 4BGDA 3B73A 2XAFA 3MEXA 3VSKA 3OSFA 1LQ1A 3TBIA 1OCPA 2Y30A 4BEHB 3GTJJ 1SANA 3MZYA 3P9IA 4A3FJ 2PX9A 1YRNA 1HXDA 3QYBA 4QTRA 5EDNA 5E18F 5BMZA 4PFPA 5D6FA 3RTRA 1OFCX 1W4MA 3I3LA 3LOCA 2DODA 3AG1H 1A31A 1P9QC 4LFUA 1P4AA 2VB6A 3F8CA 4MQ9F 3REOA 3ASNH 3R60A 3U21A 4CDGA 3H9JA 1RNLA 2Y9YA 4HDVA 1KYZA 3ONQA 3LSRA 4L0YB 1R1UA 2X1EA 3K70C 1TWGJ 4G12A 2X4HA 5F0CA 3ZP5A 2VQHA 2MABA 3CCVI 1RKWA 2VQLA 2BVLA 2M4GA 3BZKA 1R00A 4ZDPA 4M71A 4YRVA 3CMYA 1R36A 3BR0A 3OY9A 3EUHA 3PQJA 3HTUA 1KQ9A 1KYWA 3C1DA 1VQNI 1NHAA 5BPDA 2ESNA 5H6QA 5EEGA 2LKXA 4M3FA 2QQBA 5D5VB 1OCOH 3JRBA 1T98A 2DDAA 2K9SA 5E79C 3AL0C 3G1LA 2PLYA 2DA3A 2VXDA 4M9XA 3L1PA 4MLOA 2M8GX 2BY1A 5A2QK 2JPCA 3E3VA 3FXMA 2IAIA 1SEUA 1H8AC 1JGSA 1ZARA 3OYLA 2HXIA 3E0JB 1H0MA 4IZZA 3FBNB 1R6RA 4MQVA 3SQNA 1Y1WJ 2XROA 2X1CA 2HOEA 3KE2A 3ZQQA 4KDPA 2LY2A 5LHIA 3RKWA 4AD9A 2JSPA 4HV5A 4BJ5C 3HL2A 1GHCA 1BI3A 5CQGA 4ENMA 2L7ZA 4WX9A 2DI3A 4LG0B 3EUKL 4PGHA 4CCJA 4CCLA 4CCOA 4Y13A 1STZA 1R5GA 1E3HA 1H89C 3L9FA 1VQ5I 3FXRA 5FFZA 2DTRA 2KT0A 3K70D 2M0CA 5KVRA 3L00A 3QU3A 5GTHC 4N4NB 1LVKA 4KMFA 3GX4X 2FNAA 1I5ZA 4Y3OA 2RV8A 3F6VA 4F92B 4HLXA 2K9MA 1QGPA 2JPBA 1MSEC 2FMLA 2HVSA 1FEXA 3F3XA 1LB2A 3M07A 1RPWA 3ZRGA 4F52A 1J5YA 4F93B 2JMWA 4J19A 3O6BB 4S05A 4RS8A 1MIJA 1ZK8A 4PSXA 4BACA 3HOWJ 1RR8C 4BQNA 3CUQC 3ZQCA 3C7JA 3FZVA 3KZZA 5EF6A 3G6EI 2K3FA 3O8HA 2JRMA 3M9AA 4IJAA 2W24A 2F4OB 5D8LB 2HI3A 3I59A 4NNJA 2DFHA 1ZGWA 1MH4A 2OA4A 3OWTA 3CC4I 3ABKH 1B8IB 4UUVA 1T95A 1BA5A 3LSPA 3HSEA 3O3KA 2OQRA 4UB6C 2V9KA 3JTHA 2DA4A 1ZLKA 2A61A 4MEXF 4AYBN 5LBQA 4KA4A 1AHDP 1U8RA 1E3PA 2GAUA 1XDUA 3KYCB 3C2BA 3KYLA 3WHBA 2R7UA 3TMOA 1FLIA 2XV4S 2NVUB 4LG3A 4BE0A 4A93J 2HOSA 1RESA 3HHGA 2R5YA 4BY7J 1IC8A 3MN2A 2CFXA 2E5ZA 1JJ6C 1AA7A 4DBRA 2XPVA 1S5LC 1V54H 2ZBKA 3HC7A 3JRIA 2HDCA 3CESA 5AONA 3CDLA 4XRMA 4A3IJ 1FP2A 4A3JJ 3A0HC 3KZIC 1YX5A 2ZMEA 4YELA 3NARA 4ZDOA 2V6CA 3NWSA 2QSGX 2EZHA 4HW0A 4EV0A 1TQMA 2YUSA 2Y48A 1JKPC 2XGCA 2RVCA 3SDGA 2EV6A 3NQOA 1H9TA 5CYVA 3HM5A 3R61A 4A5MA 5EYRA 1FPQA 3JRDA 2NVQJ 2MD0A 3K4MA 1W36C 3BPXA 3RYRA 3V8LA 2LMDA 3R0JA 4MTDA 5IP6A 4IHYA 3L7WA 4NC7A 1Z7UA 3HJEA 2E36A 3ABLH 2VIXA 1YHQI 2IXSA 5D8KB 1C0WA 3HKZN 5E1ZB 2CSOA 2H6BA 3E5XA 1MGTA 3TOAA 2IT0A 2WAFA 2ISYA 3P9KA 3CJRB 4M72A 3RJPA 2E2JJ 3V4GA 4OIRF 2LH9A 2XF7A 3CCUI 1QPMA 2ID6A 2LF7A 1ZGJA 2Z2SB 4HNVA 2Q2EA 2W4SA 1B4AA 2BYVE 1ACIA 5FKOA 2O3FA 4KN7X 2OC6A 4AC0A 1P92A 2GA1A 3A02A 3TO9A 3M3YJ 4WCGA 3G2BA 1ONVA 2JVGA 2BBYA 1HW1A 1XB4A 4UB8C 4L9JA 2HYJA 2HVQA 3K69A 1UHWA 4N9HA 2DOAA 1KU2A 1TP4A 2Q8KA 1YFHA 1ORKA 2HR3A 4H4KC 2JK3A 2HQ5A 1DPUA 2GXAA 1ETVA 4W97A 1YW7A 4BH9A 3A2KA 2KISA 3KP6A 3L2CA 2XC7A 1LDDA 2STWA 5DCMB 1O3QA 2DXIA 4P1WA 4NB5A 3ZMZA 1OR7A 2XGEA 2FUG2 2JRTA 1X1AA 4EM1A 3DF8A 4F3QA 3KP3A 2QA4I 3Q0UA 2VT2A 1WRJA 2L54A 3QYEA 3IC7A 3SFZA 2NS0A 4BYYA 3MZHA 1HBXG 2WY7Q 3PSIA 4IHSA 3FMQA 2EZLA 3C2HA 3HSFA 4G8XA 2ZNYA 3QU6A 4KISA 2QSHX 3M4OJ 2MD5A 3PNVA 3DP7A 2GIVA 3OYAA 2WBMA 3K6GA 4XNFA 5ILVA 3DPTA 3OL3A 2XRLA 3WG9A 1LEAA 2NVXJ 2DCEA 1HF0A 3RQ4A 3UKGA 3HOZJ 1VQ8I 1ZRCA 1BM9A 1MNEA 3VFZA 2L9NA 2V79A 2V1XA 1R5ID 4MO7A 3BG6A 4BS9A 3WTYC 4ENNA 1XCVA 2B63J 2KP6A 1YIOA 2IS6A 1A35A 2H27A 4EJWA 1X2NA 1Y8QB 2K4JA 3ELKA 2DK5A 5K7HA 3JTGA 3EUAA 1W1WE 5ED4A 3WTTC 3HOXJ 3GUDA 4DBQA 1IXCA 5GP9A 2CW8A 3U1DA 3RSNA 1SMYF 4YFNF 1YYVA 1WQ2A 1QA6A 2F4MB 1POGA 2N8GA 1ZG1A 2YSRA 2HOTA 4LITA 4A6EA 2EIMH 1MH3A 1OCRH 1VQ9I 2NNNA 2QBYB 1YI2I 4U0WA 5J4YA 3GXOA 3KEOA 4EGYA 2LBFA 1T0FC 4BHBA 2BXZA 4HQMA 2R7RA 2A3SA 1JT0A 2HU9A 1KQ0A 2EIKH 3HOVJ 1NTCA 1Y6IA 2FBHA 2Y2ZA 3BR2A 4ESJA 1ZR4A 4BQOA 1FNNA 2DQLA 3K10A 3M1EA 4II2A 4P9UA 2ZXHA 4IF4A 4CH7A 1ZAOA 2O7OA 2NYXA 3T8RA 1D3YA 2EV0A 1D1AA 1KU7A 1QO0D 4JX6A 2KQRA 4HLYA 3KYDB 2LG4A 4A3DJ 4GYGA 4WK8F 3HGYA 3SZGA 2HYFA 1F9NA 3VYSB 1JTYA 2KDOA 1EA3A 3FM5A 3NEUA 1OPCA 2LKPA 4P55A 4BQQA 4IHTA 3DU5A 5ICGA 1HDPA 4QLCU 3FISA 2JA2A 3B02A 3PFYA 1RETA 2IRFG 2TCTA 3ML6A 2OV7A 4L9VA 3DBRB 2O03A 5H2FC 2XSDC 4CGZA 4PK4A 4O6JA 3S17J 2CV2A 1K78A 4D0PA 1CF7B 4HQEA 4AUXA 1Z9CA 5J47A 4ZC3A 1FC3A 3OV8A 3H9QA 1O7FA 1J09A 2MH2A 2QM3A 1Z05A 1B6AA 1MMDA 1TW3A 4I2OA 1L0OC 1A5JA 3HPHA 2E19A 5FO5A 2M0MA 3DCFA 5GAHJ 3GZ5A 1DQUA 3F8NA 5BS6A 4B8XA 3W2VA 2MC4A 2QKMB 2CJJA 2I8DA 3PNYA 4LLLA 4GFBA 3F8FA 2VUMJ 1BW6A 3RCOA 4BJ6C 1X3ZB 3K2AA 1LDKB 4XKCA 2IVMA 2R7QA 2VQCA 1K6YA 4HA8A 2D5VA 3IH4A 3QWLA 2IP2A 3K4JA 4BE2A 2XF5A 3CF5F 2LFBA 1U6GA 2WV1A 3HOYJ 4UXNA 1I27A 1YS6A 2L4AA 2VI6A 2E2HJ 4PGGA 1MW7A 1BOBA 2F48A 3G1OA 4UVAA 3WGHA 1ZRFA 2R7TA 3OYEA 3DU6A 3WTZA 3BR1A 5BNGA 3U1KA 1QPIA 3FDYA 4K2EA 4KIGA 4JOMA 1NK2P 2O61A 5FFXA 4L9TA 2KDZA 2CYYA 2DA6A 3KP7A 4ITVA 4LOCA 3IWFA 4V2FA 1LVAA 1RI7A 4D5FA 2ZO4A 3GTPJ 1WJAA 3M7GA 1VQLI 3BWGA 4RGUA 2KIMA 3P9CA 1XS9A 4NQWA 3PFIA 1FX7A 1WH7A 3CP8A 3QOPA 5C44J 4B1RA 3BR6A 5HDGA 2DYSH 2AQEA 2HKOA 2DMTA 3QRFF 3UR3C 1JHFA 3U2RA 3PIOF 2XAUA 1WHUA 2HNHA 3RKYA 2PMUA 2WY8Q 1R49A 3S16J 1P6RA 3ABUA 3H5AA 1I1GA 3H3ZA 3J7ZI 3L2RA 2HKXA 2X9DA 1KONA 5K1YA 2EZIA 2ZB9A 2NVYJ 4A2UA 5J4VA 4OIPF 3CMMA 4B3XA 2DU9A 2HXOA 2EA4A 2MSYA 5K7ZA 2NRAC 2R5YB 2ME6A 2MG4A 1GXQA 1ON1A 2ECCA 2F5DA 3A03A 3I55I 3TP3A 3H0DA 4H0EA 4I0BA 1SVMA 2XGXA 3M8EA 1U9NA 1YRNB 5EJCA 1JKQC 5JHFA 4FE7A 3ESWB 1UB9A 5E8GA 3H5NA 2K86A 2DMNA 2W82A 4LLNA 1LFUP 3LSMA 3LFUA 3ZMTA 1Z77A 3CCSI 2NAZA 2ZJPF 2CV0A 3AG2H 3TOBA 1KU3A 5E3NA 1WJBA 1QZEA 5HLIA 4B43A 1MD0A 3BLYA 4M73A 4KFCA 1SAXA 5J1UA 2NS7A 3EYYA 3FXQA 2FBIA 3QAHA 5L3BA 5LGUA 4RB0A 4CXFA 3F9KA 1SC7A 4CCKA 4RAZA 3RQIA 1DDNA 5GADJ 5JVTA 1IO2A 4U7DA 2Q0OA 4NBQA 4XBFA 2IA2A 4OIQF 2QQ9A 4XK4A 2R7VA 2L7MP 3OYGA 1GVJA 3SFIA 1WI3A 3OS0A 2FJ1A 3PUFA 2F5CA 1BJZA 5IYCJ 5KCMA 1FSHA 1IRFA 4IXAA 1B59A 3S3NA 3CO6C 3LSIA 4E7KA 2HPMA 6PAXA 2W1OA 4U87A 4AWXB 2ZC2A 5DV5A 3TGNA 5M5XJ 1K7AA 2JA7J 5DUKA 4RGRA 2MGQA 1HKTA 1Y0UA 3CTAA 4OAZA 4WXDA 1R4MB 2LY9A 1NH3A 1ETOA 2X1DA 1VF9A 2VBZA 4U88A 1ZKGA 5HLHA 4LIUA 2JT1A 3ECHA 1I3QJ 3LQRA 2LKSA 3ISPA 1ETQA 1AKHB 1UG0A 5LGNA 3FIWA 3OYDA 5LRRA 3CC2I 3KCCA 1JKOC 2L9VA 1R1VA 2IPQX 3J7AY 2XVCA 4FASD 3T5XA 3E6BA 2LVSA 4KICA 3RZDJ 3SHFA 1SFOJ 3LA2A 5M5YJ 2ZCWA 4GDFA 1N25A 2VE8A 5K5RA 3IRQA 3LA3A 1FIAA 2KJCA 2ICWG 4KUMA 2XSJC 1XDSA 2HVRA 1Z67A 1YO5C 4G7ZF 1ETYA 2K40A 4QPOA 2V1UA 2YS9A 2OF7A 1RUOA 1O3RA 4II3A 2OCCH 2R7WA 1Z3XA 3QODA 3RPQA 3T8TA 3ZGKA 1YJWI 4CSWA 2XUBA 2QQAA 5CLSA 4ZZDA 1N78A 5IP7J 3LAPA 4ZH4F 3ZXSA 3DPUA 4FETA 3MFKA 3E5UA 1UG2A 2F6CA 1XD7A 3W6JB 3K1PA 3JREA 2DPUA 2EBIA 1VQPI 1I1SA 3CQZJ 2QGUA 2ID3A 3LMMA 4HAMA 1XTAA 2K4BA 2XAQA 1OYWA 4Y33A 1W5TA 2H1KA 3CO7C 2DTZA 3JCUC 5E1XA 2L4MA 4DYRA 1VFCA 2H94A 4XL9A 3K9TA 4Z6YA 3E6CC 2YU3A 4A3MJ 5EEHA 3A4CA 3RZOJ 3I4NJ 1AOYA 2L2OA 4RLFA 2ISZA 1TT0A 2H09A 2P5LC 3FMSA 2DW4A 4JK1X 1F36A 4ZTJA 4RDUA 5CQEA 2QCOA 2P0WA 2F2EA 1G3WA 2LNBA 4A6DA 3V7SA 3BDDA 1HKQA 5CJ9A 2KRHA 2R4GA 2K9LA 4PJNA 4RGXA 3ZMVA 1ZH5A 3WHCA 2B7EA 5DEQA 2VC1A 3TEDA 1Y56A 2EFPA 4C3HJ 1W5CC 1XSDA 4RB3C 1T8IA 4CICA 2RN7A 4IHWA 3ERMA 3WTUC 2FOKA 2KHMA 1BIBA 3LA7A 2XKPA 1G6NA 2W25A 4Z2YA 3I4PA 5M5WJ 1TWHJ 3RYPA 4EJVA 4LB6B 4D1QA 3I64A 5J8CA 2E2IJ 1W36D 1T6SA 3FBIB 1Q1HA 1TLHB 3QQAA 3S32A 1H88C 2P7CB 1D0ZA 2DFIA 1LNWA 1YQAA 4M9SA 1K4TA 1MBFA 5F64A 4G94A 4I76A 3T0YA 2IEKA 2M7BA 1GXPA 4V19K 2P7VB 4XIDA 2KIFA 1JJ8C 1SD6A 2EFOA 2VONA 2HZTA 1R22A 1VQMI 1MBGA 2P8TA 1MMGA 4YIIA 4M3DA 3L09A 2RNGA 3OYIA 2QUFA 1WCMJ 1WVRA 4GGGA 4F91B 4UUSB 1ENHA 1PYVA 4JX5A 1MDMA 2R3SA 2VBXA 5FD5A 5HNHA 4EJOA 4BAYA 1XX5A 1MZBA 1GV5A 1Y8RB 5L3CA 3EDPA 3Q3SA 4GO1A 2ESHA 4B44A 2GXBA 2FBKA 2GWRA 3K7AJ 1V4RA 4XSZF 1M1EB 3E1SA 2RKHA 3GCMA 3PIPF 4PJMA 5H6RA 3FF5A 3AG4H 3JRAA 3DPLC 2VJIA 5CPRB 2DMPA 1WWXA 4EJUA 5J8FA 2OZUA 2LLKA 1SAUA 4PCQA 2GBYA 2XKOA 5B1AH 2PBIA 2F5FA 2BZTA 4IX7A 2OD5A 5HVQC 4LJZF 4HF1A 5DCMA 1WGXA 4E70A 3CUQB 5HDKA 4RA2A 5L3DA 1X19A 1ZHFA 3CUOA 1BC7C 2E35A 1XSXA 1Z91A 5EGOA 1D0XA 3AFHA 2IW5A 3ZQGA 3QP6A 3CCRI 4JP0A 4KIBA 5HS9A 1ZYRF 2QYOA 5EG0A 1O4XA 2EFQA 3PL8A 4Y15A 3BJOA 1RKTA 1JGGA 2VOOA 4PSWA 2OJED 4C2UA 4HOBA 3JRFA 4ON0A 1B9NA 1S7AA 2JQ7A 4NC6A 2CG4A 1K4SA 2M87A 4U7BA 1J59A 1PUEE 2MYSA 1JKRC 1S6LA 1FMVA 2ZJRF 4NUBA 4BL0B 5E17F 4ENKA 2YU9J 1FTTA 2MLGA 2DK8A 3EETA 4HX7A 1TZLA 4MHGA 3LL7A 3LAJA 3QPSA 3VSLA 2XAJA 3WTSC 1PDNC 4A3LJ 4PZJA 2X6YA 1YE9A 2ELKA 5LEJA 5J3LA 4OMZA 4UHTA 2DA7A 1O7LA 3PO2J 1FZPB 3JSPA 1YIJI 1V5GA 2HQNA 1A6IA 1BI0A 3QYFA 1Y0NA 1LE8A 1PP7U 2UZKA 2DBBA 2EWNA 2PMHA 5E3MA 1ZQ3P 1HSJA 2BXYA 1LDJA 1U8BA 4MFEA 2QBYA 3BY6A 2WAQA 2OU2A 3KLOA 2ZXIA 2ME0A 3CMAI 5M3FJ 2A6TA 4DYCA 3JRCA 2XB0X 2RC4A 1DPRA 2GQQA 4DYQA 3V42A 5JLXA 1I6XA 3KP4A 3OIOA 4MGRA 3Q9VA 4R1HA 4RLQA 1E17A 4IHVA 3BTJA 2L02A 3WGIA 4RAFA 2OUMA 2GM4A 3TW7A 5J40A 3LSKA 2B0LA 5JHUA 1YX3A 1XMAA 3OOUA 3FXLA 1G4DA 2CQQA 4XOTA 4EVIA 3OS2A 1MBKA 4Y52J 2EQRA 3O8GA 4LK1F 3ZMUA 1GDTA 2HOAA 2DN0A 4IPAA 4FX4A 1X2MA 2Q2EB 1E0EA 4XR6A 1D1BA 4XN3A 4I0AA 4DW6A 1FOYA 1ZGAA 4JQFA 3MKYB 2J5PA 2K7LA 2IGMA 2VJ4A 2VLAA 3CMEI 3I0TA 4G6DA 2LSOA 2L7FP 1AWCA 2LF8A 2M1BA 2ZNZA 3GFMA 4HSTA 2ELHA 4MTEA 3OMYA 3MMYB 4CUGA 4ZZLA 4Y7NJ 2EFWA 1D8JA 1UHMA 2M7AA 4HG2A 3I4MJ 4BE1A 2E7WA 5TISC 5HLGA 4WF2A 1D8KA 2JSCA 4C2MJ 3CJNA 4A3KJ 4HX8A 3BTCA 3H36A 4I6ZA 2ZJ2A 4CCNA 4S04A 4C3JJ 3OOPA 1ZG3A 1HCRA 2W00A 2PG4A 1B72A 3W2AA 5B5EC 1HW2A 2EA2A 4QSHA 1XC5A 1SFKA 2IGOA 1K61A 4HNTA 3LNQA 1YG2A 2C6YA 1MNMC 2FSWA 2DLLA 2IS2A 2GZWA 4C9YA 4UVBA 3H9GA 2VT3A 1DGRM 5F6FA 1RRJA 1BR2A 2OCEA 4HF0A 3JSOA 3ROUA 2DQRA 5IOZA 2BW3B 5E20A 5KK1A 2PJPA 4AU7A 3KLNA 1GLNA 3K2ZA 4L9NA 2MW8A 1U5TA 3P5JA 2I10A 3F21A 4KIFA 3BP8A 1BC8C 1IV6A 4Y17A 2JUCA 3S3OA 2Y0MA 3DTIA 1XN7A 3W3CA 1FIPA 1X1PA 2FQ4A 3GO5A 4JX4A 3S8PA 4YFXF 2PJRA 3TW6A 2GA2A 1N77A 2RQPA 3WTXC 4AIKA 4XLEA 3ZQLA 3TQNA 4R79A 3OR1C 2VASA 1F1ZA 3CDIA 2A5YB 1RUNA 3RPUD 3J81K 4J00A 5M3MJ 4IQJA 5IYDJ 3OIQA 3HRTA 2JZYA 4GRIA 3GBGA 1WZ2A 1QHHD 3OR2C 5IYBJ 2VOPA 3GFLA 1T39A 2ZFWA 2W7NA 1TTYA 4OU0A 1IXSB 1FY7A 5FLVA 1FOXA 1OISA 4PDKA 2BY0A 5C3EJ 4G6QA 1SD5A 2D2WA 4OWRB 1TBXA 2HZDA 1EH8A 3WGGA 4MIMA 2Z1DA 4A0XA 4D9JA 2STTA 2WAQN 1LFBA 2AQFA 2KZVA 3HKZA 1U0JA 3LSJA 5D5XB 4EMSA 4FT8A 4YEJA 3H1CA 4AVZA 1XG1A 1BN5A 2ZKZA 3IH3A 4QIWN 5EEAA 2RNJA 4QPQA 1QVTA 3T1BA 1K83J 3BJ6A 3I5UA 5DD8A 1IGNA 2RDPA 3HPGA 2BE5F 3J7YJ 5K7FA 5F27A 2XAGA 2I5UA 2GOMA 5H20A 3GF2A 4M6VA 1FBUA 2X6WA 1AU7A 3QP5A 3D5LA 1RZ4A 4W1UA 3KETA 3DEEA 4A0ZA 4D7NA 4UY8I 3LWFA 1A04A 4RAGA 1S7OA 3RIRA 5EGOB 2A68F 3EQLF 3OYJA 2QQ8A 1XPXA 3BG5A 1TWAJ 5DTDA 3BG9A 3VB2A 2DMUA 3AL0B 3K4CA 2QF7A 3DXJF 3ZCOA 3HHHA 3WE3A 1R7JA 1SVLA 3E97A 5LRSA 1TNTA 2CQNA 3HOSA 4RMNA 1KGSA 4OINF 4EJTA 2F5VA 4HDUA 3DKWA 3OS1A 2MA3A 1BL0A 2HS5A 3JRHA 5ERIA 3JAMK 3MAJA 2IJLA 2DOFA 3IAM2 3EPZA 1LJ9A 4YIRX 2B9SA 3CCQI 4C3IJ 1Z7LA 3BCBA 2QSFX 3WE2A 4RB2C 4DOZA 3KPHA 2D1HA 4LK0F 4WXHA 1S3JA 3G73A 1CF7A 4C2TA 2XF6A 2E1OA 3HOTA 2VBWA 1YJNI 2DFFA 3K1NA 4N4OB 4PUSA 3E6DA 1Z0XA 1O3SA 3GEZA 4M3GA 1EJ9A 2FEZA 3K1MA 3FHNA 3ABMH 3DEWA 4CYDA 1F43A 5LLQA 2E34A 3CCMI 2HGCA 1YS7A 5FKKA 1JUSA 2V1DA 5BPIA 2DT7B 2CUEA 1BI2A 1X3UA 4HYEA 3HXLA 3S1MJ 5FLMJ 3KIOA 2CW7A 1HDDC 3HG9A 3BG3A 2KIQA 3H5RA 5K5OA 1IN4A 2G7UA 2Z16A 4HBLA 3S2HJ 1EV7A 1GVDA 3W2WA 1Z21A 2BEOA 1OCCH 2YPRA 3Q0WA 1T2KA 2IGNA 2X85A 1S8NA 1TL8A 3N4MA 1MNDA 4ESBA 4BXXJ 2EZKA 2P5KA 3BR3A 3IWZA 3MKWB 3IKVA 2LRDA 1ZR2A 2GXGA 1X3WB 5J1RA 3ULQB 1YW9A 4ZYAA 3S93A 1IRXA 4BDZA 3CF2A 2K5CA 3P7NA 4UVCA 3OYKA 2HDDA 2LYCA 2EB7A 1RIOH 3FMRA 2P6SA 2W85A 4F55A 3FHZA 5GTIC 4E7ZA 3CD6I 4AM3A 3FWEA 2F5EA 1V5FA 2DT6A 4I01A 5IT9Z 1MBEA 3DLAA 2MLKA 3FKIJ 3ZPLA 3SZTA 4RM2A 3LSHA 2GOXB 3F72A 1V55H 4N0BA 4U0VA 1IZ1A 4XRFA 1IDZA 2ZFUA 2MFZA 1TQPA 3R0AA
chains in the Genus database with same CATH topology
3IP4B 4E7JA 2KRHA 2R4GA 4NC7A 2K9LA 4PJNA 3N05A 2VIXA 1Y56A 2WB1A 2VL8A 2IXSA 2ELJA 2KMUA 3L2QA 2KHMA 1WJ5A 2WAFA 4J01A 3CJRB 3OYNA 4D1QA 2VJ5A 2LH9A 3FKJA 2XF7A 4Y4RA 1W36D 4HRIA 2R7SA 3PNTA 4E7SA 3FBIB 3S32A 2Z2SB 2W4SA 4OAYA 2IGKA 1D0ZA 4IQ4A 1UAAA 1MMAA 3S3MA 2OC6A 2E5NA 4XQFA 2M7BA 3G2BA 3DKYA 2JVGA 4HNUA 2JUGA 2A5WA 2HVQA 3OIPA 2BOLA 1MMGA 2DOAA 4XLAA 4BJTA 3OYIA 2RNGA 2VKDA 1WJCA 4XLHA 4F91B 3L2WA 3DTEA 4H4KC 1PYVA 4C30A 3L2VA 5HNHA 3VYTB 3A2KA 2XC7A 4B44A 1NG7A 2DXIA 3SEQA 4P1WA 1PJRA 3VDXA 2FUG2 4HPQA 3OYFA 3CP2A 3E1SA 1X1AA 4F3QA 4PJMA 2LREA 3DPLC 5TGTA 3BCAA 3QYEA 2VJIA 5CPRB 2WY7Q 3PSIA 1SAUA 3C2HA 1X1DA 4KJZA 5HOOA 4IX7A 5HVQC 4KISA 5CKTA 3PNVA 3OL4A 1LFPA 4XMYA 3OYAA 2WBMA 3K6GA 2QKLB 1X19A 4XNFA 3DPTA 4CA0A 3OL3A 2VPLA 1ERDA 4PJJA 3PJRA 1D0XA 2DCEA 3AFHA 3CZ6A 4XKVA 3RQ4A 4E7HA 4HSRA 1MNEA 2E60A 2L9NA 3BG6A 4BS9A 2KLOA 1G8XA 2Q1ZB 3PL8A 4DGWB 2KP6A 5KNLA 4PSWA 4C2UA 2IS6A 4NC8A 4KT6A 3OYCA 3EUAA 4U7BA 3ZR8X 1FMWA 4DBQA 2MYSA 3PUBA 2CW8A 2X6XA 1FMVA 3RSNA 2IS4A 2CH0A 4NUBA 1MMNA 2RQQA 4BL0B 4E4HA 1TZLA 4LITA 3LL7A 2ZSHB 1OR7C 3VSLA 4XKBA 2X6YA 4AYBA 1YE9A 4ZDLA 2LBFA 1T0FC 3KEYA 1BR1A 2R7RA 2HU9A 3MD2A 3VWBA 2PJRB 1Y6IA 1V5GA 1Z3YA 4BQOA 3QYFA 4PFOA 3SYTA 4G6TB 3D5SC 3K10A 4BDYA 4ZJZA 4II2A 4RM3A 2ZXHA 3KX2A 4CH7A 2UWMA 5KHDA 2LOOA 4XOPA 2KRCA 2JVHA 2P0WA 2LBFB 1D1AA 3PSFA 2WAQA 2ZXIA 2KQRA 2WAEA 3IUOA 2A6TA 2IS1A 2K3PA 2LG4A 2LC2A 2VXZA 3V42A 1HA8A 3OYMA 4HEA2 3SZGA 4XN0A 3VYSB 2KDOA 1EA3A 3TL4X 4RLQA 3BG7A 3A1YA 2L5QA 4BQQA 3DU5A 2OUMA 2JA2A 1S9HA 3PFYA 3LSKA 1DP3A 1YX3A 4B48A 3OOUA 2OV7A 4P5OA 3BC8A 3D5RC 4XOTA 3OS2A 3K4KA 2M4KA 2VKHA 4PK4A 2CV2A 4BU2A 4ZC3A 1QHGA 2Q2EB 3H9QA 1J09A 1E0EA 4XR6A 1D1BA 1MMDA 1V5EA 4XN3A 1WJEA 3DWLE 3HPHA 4JQFA 3MKYB 3L2UA 2M0MA 2E1MC 2IGMA 3SEZA 2VJ4A 2X51A 2BVMA 1DQUA 2VLAA 2UV1A 3K4NA 4BUPA 2V1NA 3W2VA 1OLTA 4PJLA 3SDBA 2MC4A 2QKMB 4X0GA 4HSTA 2I8DA 1WJFA 2HQAA 4CUGA 3OMYA 3MMYB 1D0YA 2M7AA 3PNYA 4HG2A 3VYRB 3OYBA 4BE1A 2V6EA 3AKZA 3RCOA 4BJ6C 3I9V2 2UUZA 3C2GA 5FRNA 1LDKB 4CCNA 4XKCA 4DIQA 3HUGB 2R7QA 1WJDA 2VQCA 2W00A 1K6YA 5HLTA 2L9SA 1WFXA 3W2AA 2WADA 2IGOA 1SFKA 1LKXA 4HNTA 3MKZA 3K4JA 4BE2A 2XF5A 2IS2A 2V7FA 4BXFA 4C9YA 3H9GA 1DGRM 2VJJA 2R7OA 1BR2A 2PMZA 5FROA 3VYUB 2LY1A 3IAS2 2V4JC 3K4BA 2DJIA 2BW3B 4NQWB 1MW7A 1BOBA 4AU7A 2R7TA 1GLNA 2CS3A 3OYEA 3DU6A 2CUJA 5LD2C 3FDYA 4JOMA 4LIVA 3K4LA 4BGDA 3VSKA 4EATA 2R7XA 4ITVA 3TBIA 4BEHB 3S3OA 1BR4A 2HPIA 3DTIA 3W3CA 1WJAA 3QYBA 3S8PA 2PJRA 4PFPA 3RTRA 1N77A 3I3LA 4XLEA 4R79A 3OR1C 2VASA 3CP8A 1P9QC 3RPUD 4J00A 1G59A 2AQEA 3UR3C 3M1CA 2VB6A 3U21A 4IQJA 2XAUA 2HNHA 3H9JA 2WY8Q 3OIQA 4GRIA 3GBGA 1QHHD 3OR2C 2F4IA 2E1MB 3ONQA 3H5AA 2W7NA 3L2RA 2X1EA 3K70C 2M3AA 1KONA 2VQHA 3QOEA 2MABA 4OWRB 2VQLA 4XORA 2HZDA 2BVLA 2V26A 2Z1DA 2M4GA 3CMMA 4ZDPA 4B3XA 4D9JA 2KZVA 2AQFA 3HKZA 4YRVA 1U0JA 3EUHC 4XONA 4YEJA 4AVZA 2O5RA 3OY9A 1N75A 2Y0SA 3H0DA 1NG6A 5FRMA 4XM3A 4QPQA 4BEHA 3DKXA 1X1CA 3HPGA 5JHFA 3AL0C 3H5NA 2VXDA 2W82A 3LSMA 3LFUA 2CUZA 1JI8A 4MLOA 2GOMA 2CV0A 2X6WA 1WJBA 3D5LA 3OYLA 4E7IA 3E0JB 4B43A 3DEEA 3FBNB 4IZZA 1ZELA 1R6RA 3BLYA 2X1CA 3ZQQA 2LY2A 3F9KA 3OYJA 2JSPA 4BJ5C 4CCKA 3HL2A 5CQGA 4CZCA 4ZTFA 2CMPA 3M8JA 3EUKL 4CCJA 3AL0B 4CCLA 3K4CA 4CCOA 2NOJB 3H35A 2KL4A 3ZCOA 2R7VA 3OYGA 1QU3A 4XLFA 3OS0A 4E6KG 3HOSA 3K70D 4XLCA 4IKFA 5KCMA 1UELB 4RMNA 2L7KA 4N4NB 2F5VA 1LVKA 2CFOA 1D1CA 3OS1A 3S3NA 4KITB 4Y3OA 4F92B 2WA0A 3LSIA 4E7KA 2HPMA 1DGWY 2W1OA 4U87A 2K9MA 2HVSA 1VZ0A 3IAM2 3EPZA 4OAZA 3ZRGA 2XDVA 4F52A 4F93B 2X1DA 1Z7LA 3BCBA 4PSXA 4BACA 4BQNA 4DOZA 4LIUA 4C2TA 1UG0A 2XF6A 3OYDA 3UNGC 3HOTA 2CV1A 4N4OB 3DTKA 4PUSA 3J7AY 4FASD 4NNJA 2ZSIB 3FHNA 1X1BA 3OWTA 4B47A 1T95A 2DT7B 2XSJC 2HVRA 2V9KA 4QPOA 2RREA 3HXLA 2HDWA 4II3A 2CW7A 3HG9A 2R7WA 1Z3XA 3DQVC 2VQGA 3H5RA 3QODA 3ZGKA 4CSWA 2Z16A 3KYLA 3OYHA 2R7UA 1N78A 3TMOA 5LFAA 3W2WA 1Z21A 3ZXSA 3DPUA 2IGNA 4FETA 4LG3A 4BE0A 2X85A 1X4OA 2F6CA 2E5ZA 1MNDA 1AA7A 4DBRA 3NWTA 4ANJA 3MKWB 2LRDA 5HNFA 3HC7A 4ZYAA 3S93A 1IRXA 4BDZA 3CF2A 3CESA 2K5CA 3LMMA 3OYKA 2LYCA 1X4PA 4Y33A 2BW3A 4F55A 1YX5A 2KPMA 4YELA 4E7ZA 4ZDOA 4XL9A 3NWSA 1V5FA 2DT6A 3LSGA 3A4CA 2L2OA 3DLAA 4RLFA 1TT0A 4DJAA 4RM2A 3LSHA 4XKWA 2GOXB 4E7LA 3CJQB 4ZTJA 4CCMA 5CQEA 2MD0A 2ZFUA 2MFZA 3K4MA 1W36C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LH9 A;  2KZV A;  2KPM A;  2LY2 A;  2LY1 A;  3S93 A;  3RCO A; 
#chains in the Genus database with same CATH topology
 3IP4 B;  4E7J A;  3FXU A;  3I54 A;  2DYR H;  2RGV A;  2ZXJ A;  3ZN0 A;  1IXR C;  1HC8 A;  3BZC A;  3WOD F;  1D5V A;  3N05 A;  5F1J A;  1MKM A;  1K79 A;  2OZ6 A;  2GLO A;  3TDU C;  1BJA A;  2ELJ A;  2KMU A;  3Q0V A;  3CCL I;  1XGM A;  3V8K A;  3G4S I;  2M30 A;  3V7C A;  1G3S A;  5C4J J;  1I6H J;  2Y31 A;  3CLQ A;  1WJ5 A;  2L0K A;  3CCY A;  5J1Y A;  3MVP A;  4B09 A;  1R1T A;  4JBA A;  4X6A J;  2K9N A;  3K0L A;  3PNT A;  2P81 A;  4E7S A;  1FWZ A;  2Y0S N;  4OAY A;  2IGK A;  1P4W A;  3BRO A;  3MZ8 A;  4IQ4 A;  5E3L A;  4OIO F;  3ABT A;  1CGP A;  1UAA A;  1HQC A;  1MMA A;  3MWM A;  4XIC A;  3S3M A;  4L0Z B;  1W7P B;  2ZME B;  2A69 F;  2E5N A;  1W5S A;  2BV6 A;  2CWE A;  3DKY A;  2M2E A;  3AAF A;  4HNU A;  2JUG A;  1OQY A;  4TV7 A;  2NOG A;  5BQT A;  1IN5 A;  1ITY A;  1ZTR A;  2A5W A;  3OIP A;  3FX3 A;  1YW8 A;  2BOL A;  2R7F A;  2PFB A;  4IVN A;  4XLA A;  5JR3 A;  3G71 I;  5JVG F;  3WTV C;  2VKD A;  4XLH A;  4CYC B;  4Q47 A;  1LUJ B;  1Y1V J;  3DTE A;  2PI0 A;  4C30 A;  4BBR J;  4CHU A;  1O3T A;  4YG2 F;  3L2V A;  1R71 A;  1NK3 P;  1YLF A;  1ON2 A;  2QEX I;  2XRN A;  3A0B C;  3SEQ A;  4A5N A;  3VDX A;  2P5V A;  4JYK A;  5B1B H;  3OYF A;  2FA5 A;  3BZ6 A;  4UUT A;  5D4S A;  3QPL A;  5TGT A;  2DPD A;  3BCA A;  1ETW A;  2KIU A;  1J2X A;  4D5C A;  5F0H A;  1MMS A;  1X1D A;  4KJZ A;  5HOO A;  3H3V K;  1APL C;  2FOW A;  2L3D A;  3F8B A;  2Y69 H;  5FB2 A;  3OL4 A;  3WU0 A;  5D5U B;  1Z6T A;  3RPU A;  2CQX A;  2NVT J;  2D1V A;  3E7L A;  1X58 A;  3HDD A;  4IOC F;  1PUF A;  2QKL B;  5DM6 F;  3W6V A;  2IA0 A;  5DYM A;  2VPL A;  1OJL A;  2VBY A;  3TO6 A;  3VPR A;  4HF2 A;  4PJJ A;  1ERD A;  3CZ6 A;  4E7H A;  4XKV A;  2LK2 A;  2H8R A;  1JXS A;  2EV5 A;  4HSR A;  2E60 A;  2EPF A;  2EIJ H;  2G9W A;  2NNY A;  1QVU A;  2HWV A;  3WU2 C;  2KLO A;  1ZRD A;  2DT5 A;  1A6Q A;  4I7H A;  1G8X A;  2Q1Z B;  4UV9 A;  5KNL A;  4EEF G;  3HOU J;  2M34 A;  2CGP A;  5JFR A;  1WI9 A;  2L9R A;  2AS5 F;  1TC3 C;  2G7H A;  1ZG5 A;  2FMY A;  3PUB A;  2VOD A;  1FOK A;  2CH0 A;  1DU6 A;  2RQQ A;  5ICF A;  5CVI A;  4ENJ A;  1OYI A;  2LDU A;  4E4H A;  1BW5 A;  2K27 A;  2KFD A;  3GFJ A;  4DZJ A;  1MSF C;  2ZSH B;  4XKB A;  1EH6 A;  2HYG D;  2DO7 A;  3HBL A;  3HGG A;  1HOM A;  3GYH X;  3U9G A;  4B4C A;  5KAF C;  3KEY A;  2XPU A;  2Z99 A;  2R7D A;  3ZOB A;  3MD2 A;  3VWB A;  2DFE A;  2QLZ A;  2PJR B;  4A3B J;  3NAU A;  1LPQ A;  3D5S C;  2HTJ A;  3O2P E;  4BDY A;  1T38 A;  1TWF J;  4RM3 A;  1OMI A;  3PO3 J;  1I39 A;  5HDN A;  5FGM A;  2GIZ A;  3KX2 A;  4O5V A;  3DLL F;  2UWM A;  2LOO A;  4XOP A;  2KRC A;  5CVU A;  2JVH A;  3G3Z A;  4I98 B;  5DCF A;  2LBF B;  2FXA A;  2W84 A;  4MEY F;  5JI6 A;  1F5T A;  2IA1 A;  2K3P A;  4FE4 A;  1ETK A;  4A69 C;  5ICE A;  2R0Q C;  4R8H A;  2A6E F;  1A36 A;  3OYM A;  4HEA 2;  1IUF A;  1I3A A;  4G7H F;  4L18 B;  5DS9 A;  3TL4 X;  1PUF B;  4AIJ A;  3F6O A;  2WTE A;  2UXN A;  3A1Y A;  2X0L A;  2L5Q A;  1ZN2 A;  3HUG A;  1IJW C;  3BQZ A;  1QZZ A;  2LP0 A;  1S9H A;  2DA2 A;  1Z1D A;  3CCJ I;  5GPC A;  4D7M A;  1P7J A;  3H3U A;  2Z9O A;  1KU9 A;  3K4K A;  1O57 A;  4I99 C;  3AG3 H;  2VPR A;  1U78 A;  4BQA A;  3DBH B;  4IRG A;  1SVO A;  2AHQ A;  2VC0 A;  3E6M A;  4Q5S F;  1QHG A;  3QPT A;  4XLN F;  3DWL E;  1XCB A;  3L2U A;  2R5Z B;  2BHY A;  2CQ7 A;  2X51 A;  3GW2 A;  5B66 C;  4Q48 A;  3FK6 A;  3K4N A;  2V1N A;  1B8I A;  5CVJ A;  2CU7 A;  4X0G A;  4IL6 C;  3VYR B;  4V2G A;  2HTS A;  2COB A;  1EKE A;  4L5J A;  2QZ8 A;  2CW0 F;  2UUZ A;  2WC2 A;  3C2G A;  4A0Y A;  4PJ0 C;  1R23 A;  5FRN A;  4ZYG A;  1P7I A;  3V8J A;  2FU4 A;  2R92 J;  4DZP A;  4DIQ A;  3CDH A;  1E2X A;  4M6X A;  2E1N A;  5DD4 A;  1WJD A;  5HLT A;  3GFI A;  1GUU A;  3IKT A;  2JWT A;  3HRM A;  3H0G J;  1TW2 A;  2V7F A;  4BXF A;  2TRT A;  1VI0 A;  2TDX A;  5TRD A;  1I50 J;  2R93 J;  1FYK A;  4ZYH A;  1VQ7 I;  1DP7 P;  2PMZ A;  1G3Y A;  5FRO A;  1GT0 C;  3CJT B;  3VYU B;  5IOY A;  1TNS A;  2CO5 A;  3K4B A;  4I02 A;  1U3E M;  1YJ9 I;  5F08 A;  3S1R J;  4A3C J;  1JTX A;  2A05 A;  5L3E A;  1QNT A;  3ERE D;  2DMQ A;  2KRF A;  2ADU A;  3HZJ A;  1V3F A;  4EAT A;  2R7X A;  1IDY A;  1IW7 F;  1BR4 A;  2HPI A;  2WB1 N;  5F1R A;  3GZ6 A;  1IV8 A;  5ICC A;  1ETX A;  3BOQ A;  1EF4 A;  2H8W A;  2JTV A;  1JHH A;  3FXJ A;  2BHZ A;  2ZME C;  2LD5 A;  3LST A;  3HTS B;  1MBJ A;  3ZMS A;  1VQ6 I;  1FBS A;  3ZQ7 A;  1G59 A;  3KZY A;  3G1M A;  2WV0 A;  3M1C A;  2OPT A;  3ZN1 A;  3S14 J;  5FKL A;  2QWW A;  2FX0 A;  3NRV A;  4XRS A;  3LQQ A;  1S29 A;  2HQR A;  1YTY A;  3GTM J;  2F4I A;  1QZY A;  3JW4 A;  2E1M B;  2E71 A;  2AXL A;  2ZJQ F;  1QQI A;  1R4N B;  4AIH A;  1T0F A;  2M3A A;  1U5T B;  4NHJ A;  4M3B A;  4A3E J;  3QOE A;  4XOR A;  4KMU X;  5HOD A;  2V26 A;  2DA5 A;  3I71 A;  4LLG F;  1OYY A;  4FTH A;  3EUH C;  4XON A;  1XGS A;  1FTZ A;  2P4W A;  2K85 A;  2O5R A;  1N75 A;  2Y0S A;  4O3M A;  5FKN A;  1NG6 A;  1OCZ H;  4ZYE A;  5FRM A;  4XM3 A;  2OTJ I;  1EH7 A;  2JA6 J;  5F04 A;  4BEH A;  3DKX A;  1X1C A;  2E7X A;  2WWY A;  4LD5 A;  2DJN A;  4U0Y A;  4BNC A;  4BXU A;  3ZMD A;  2DAO A;  3H92 A;  1G3T A;  1OKR A;  2CUZ A;  1JI8 A;  4P96 A;  2VKV A;  4FIS A;  2CQK A;  3SZP A;  1JUM A;  5IT3 A;  2A07 F;  2ECB A;  3HRS A;  1OCT C;  3A01 A;  3IL2 A;  1JT6 A;  4E7I A;  5FKM A;  1ZEL A;  2PQ8 A;  2LTP A;  3FXO A;  5IY5 H;  1RC9 A;  1IAW A;  3I58 A;  5FLX K;  1DU0 A;  4CZC A;  4ZYD A;  3BTL A;  4ZTF A;  2CMP A;  3M8J A;  3N97 A;  2NOJ B;  3H35 A;  4BHC A;  2KL4 A;  3Q9S A;  2FE3 A;  1T33 A;  1XGO A;  1QRY A;  2Z5U A;  3CCE I;  1Z6R A;  3BTI A;  3GLL A;  4XLF A;  1QU3 A;  4E6K G;  2G0E A;  2M45 A;  1DUX C;  4XLC A;  4IKF A;  1UEL B;  4BBS J;  1UMQ A;  2L7K A;  3WG7 H;  3D1N I;  2CFO A;  1D1C A;  1F4K A;  3S2D J;  4KIT B;  3ZQI A;  1IRZ A;  2WA0 A;  1UHS A;  1UCR A;  4M9Z A;  1DGW Y;  2RAE A;  3GVA A;  4FHT A;  3E5Q A;  5FJ8 J;  1VZ0 A;  1HLV A;  2XDV A;  2V9P A;  2XAS A;  3V7R A;  1RR7 A;  1FBQ A;  4CYC A;  1KQ8 A;  4L5I A;  1S7E A;  2BGC A;  1K6O A;  2EIN H;  3C3W A;  3Q5F A;  1YIT I;  1ZRE A;  3S1N J;  4KYW A;  2JJ7 A;  1H9G A;  3DBL B;  5LHG A;  3UNG C;  4RGS A;  1G2H A;  1IRG A;  2CV1 A;  4M3E A;  2CRG A;  3GLX A;  3DTK A;  3FK7 A;  2FQ3 A;  1YOV B;  3I53 A;  1E3O C;  1GV2 A;  2ZSI B;  5GPA A;  4AID A;  1X1B A;  4RBO A;  2R7Z J;  1FT9 A;  2H1L A;  4B47 A;  2QEN A;  3J81 Z;  4X1E A;  3F23 A;  4MNU A;  2OAZ A;  2RRE A;  1R58 A;  2HDW A;  4YFK F;  1B1B A;  4OMY A;  1BI1 A;  5JLW A;  1IN8 A;  3DQV C;  2VQG A;  5LHH A;  5F0F A;  3OYH A;  5BOX A;  5LFA A;  2M5W A;  3LFK A;  5LGT A;  3SXY A;  4RB1 A;  4IRI A;  4A3G J;  1BOA A;  4GYI A;  1X4O A;  4L5E A;  1D5Y A;  1XMX A;  3RDI A;  1REP C;  1LE8 B;  2ETH A;  1P2F A;  1USS A;  2EH3 A;  4GXO A;  3NWT A;  4MFD A;  4ANJ A;  5HNF A;  1KA8 A;  2HEO A;  2FNP A;  2DDB A;  4IO9 F;  2YX4 A;  4G9Y A;  1AKH A;  1KZH A;  4IEJ A;  4S0H B;  3GWZ A;  5B3S H;  1X4P A;  4FX0 A;  2BW3 A;  1BBY A;  2YX7 A;  2KPM A;  1J7K A;  1W7P A;  3X2Q H;  1XGN A;  4XLP F;  3GTQ J;  1LEB A;  3LSG A;  1J75 A;  3R4K A;  4G7O F;  2K9Q A;  3RKQ A;  4DJA A;  3CUQ A;  4XKW A;  2OQG A;  4E7L A;  2YR2 A;  4IHX A;  3CJQ B;  1MJA A;  4CCM A;  1U5T C;  1R5H A;  2UXX A;  4UUS A;  5EZG A;  5DDG A;  2BY3 A;  3BR5 A;  5FLX Z;  3TP0 A;  1Q1V A;  4I09 A;  2VKE A;  1B9M A;  3M8F A;  3I59 B;  2P6T A;  2WB1 A;  2VL8 A;  1IN6 A;  3GTK J;  3VEP A;  3L2Q A;  2VE9 A;  4J01 A;  3VOE A;  2AXT C;  2O8X A;  3OYN A;  3GTL J;  2VJ5 A;  3FKJ A;  1UZC A;  4Y4R A;  1VTN C;  4HRI A;  5CVV A;  2R7S A;  5AIP A;  3KP2 A;  4WXC A;  4UNO A;  1SD7 A;  4ETS A;  2PMZ N;  4ASN A;  1HKS A;  2XAH A;  3VOD A;  2LR8 A;  5GAE J;  2M9H A;  3BJA A;  4XQF A;  2OBP A;  1JUP A;  3S2W A;  5HS7 A;  2IBD A;  1U2W A;  5E3O A;  1VND A;  1ODD A;  4DNC A;  4BJT A;  5DM7 F;  4LMY A;  2OTL I;  3HIF A;  1WJC A;  3L2W A;  5L3G A;  1WSU A;  3VYT B;  1P4X A;  3QPH A;  2Z33 A;  3MCZ A;  1NG7 A;  1MBH A;  1PJR A;  4A12 A;  5C4X J;  1T08 B;  4HPQ A;  3CP2 A;  4RAY A;  2JA8 J;  4BHP A;  3BPV A;  2LRE A;  3WTW C;  3A01 B;  2Z3Y A;  2E1C A;  2K02 A;  3GTO J;  1T56 A;  5EZH A;  3I56 I;  4KT5 C;  1PP8 F;  2NS8 A;  2L01 A;  4IRH A;  3FM3 A;  1IUY A;  2ZXW H;  5CKT A;  4N9I A;  3RI4 A;  1J9I A;  1LFP A;  4HV6 A;  4XMY A;  4CA0 A;  2MBF A;  4EM2 A;  5E1W A;  3F8M A;  3KP5 A;  4EGZ A;  5DUI A;  3PJR A;  2Y9Z A;  4HZF A;  3DEU A;  4LB5 A;  5CVR A;  1BIA A;  3DV8 A;  4NDL A;  4KNY A;  4EM0 B;  3S15 J;  1S72 I;  3MQ0 A;  4DGW B;  9ANT A;  3COA C;  5AIQ A;  4NC8 A;  3W6K B;  4KT6 A;  3FXK A;  3OYC A;  5HS8 A;  5IT9 K;  4F7Z A;  4ABZ A;  4LGW A;  1IG7 A;  3ZR8 X;  3B6A A;  1FMW A;  4M6Y A;  2X6X A;  3EYI A;  2IS4 A;  2PN6 A;  3HSR A;  5GAG J;  1MMN A;  2O6G E;  3J80 K;  3ASO H;  5K5Q A;  3PM1 A;  3R6S A;  1OR7 C;  1L3L A;  3TO7 A;  4AYB A;  4LG0 A;  2ACJ A;  1SFE A;  1TWC J;  4ZDL A;  5IP9 J;  2MC3 A;  4ESF A;  1BR1 A;  3CLO A;  4DQ2 A;  2XIG A;  1UFM A;  1Z3Y A;  2EFN A;  3HYI A;  4PFO A;  2PEX A;  3SYT A;  4G6T B;  1MJB A;  1FOW A;  1JE8 A;  1IN7 A;  4ZJZ A;  2X6O A;  3KEQ A;  1FJL A;  3CC7 I;  2O9L A;  1Y39 A;  3IHU A;  1K78 B;  1VQO I;  2XPW A;  3F0C A;  5LEK A;  3IV5 A;  5KHD A;  4XSX F;  1ULY A;  1XSV A;  3IRR A;  1FP1 D;  3PSF A;  2JN6 A;  5EG0 B;  4CO8 A;  5E8I A;  2WAE A;  2FD5 A;  3JR9 A;  2EK5 A;  3IUO A;  3JRG A;  3D0S A;  1CQT A;  2IS1 A;  2DA1 A;  3GME A;  2D45 A;  3S1Q J;  3SJM A;  2H6C A;  2LC2 A;  2VXZ A;  3PQK A;  2XGD A;  4BKX A;  1FYM A;  1HA8 A;  4XN0 A;  5KAI C;  1SFX A;  3TKY A;  4QWQ A;  1HST A;  3MKL A;  3BG7 A;  4YIF A;  2O8K A;  2J5O A;  1XMK A;  2EJR A;  1J0R A;  1TQI A;  2KKO A;  5ILU A;  5L3F A;  1DP3 A;  3BQY A;  4B48 A;  1WPK A;  2FF4 A;  4P5O A;  1UJ8 A;  3BC8 A;  3D5R C;  3GZN B;  1MJ9 A;  4M74 A;  2M4K A;  1UST A;  2VKH A;  2M8E A;  1W7P D;  4BU2 A;  4XRS G;  2XB5 A;  2CUF A;  1IF1 A;  4P9F A;  5ILS A;  1R9T J;  2VN2 A;  1TT5 B;  5D4R A;  5FD6 A;  2FRH A;  2O0Y A;  1V5E A;  1WJE A;  2COM A;  3ECO A;  2XHK A;  2E1M C;  2AO9 A;  3IH2 A;  3SEZ A;  5IPA A;  5A2Q Z;  4UV8 A;  3ZQH A;  2BVM A;  3HEF A;  1W0T A;  2UV1 A;  3J7A O;  3TDZ C;  2Y75 A;  3OSG A;  2EIL H;  1FSE A;  2DOE A;  2NXN B;  4BUP A;  3B6C A;  4KN4 X;  3ZQF A;  1OLT A;  2V9V A;  4PJL A;  1U9O A;  3SDB A;  4Q4Z F;  1MDM B;  1W0U A;  2HQA A;  1WJF A;  2W57 A;  3GTG J;  1D0Y A;  4GCV A;  2W48 A;  3KFW X;  1WKM A;  4HX4 A;  3OYB A;  2MH9 A;  2V6E A;  3AKZ A;  3I9V 2;  1VQK I;  1QBJ A;  1SMT A;  3HUG B;  4BY1 J;  3HB9 A;  1PVE A;  4WWC A;  4CZZ A;  1FYL A;  2L9S A;  1WFX A;  5TJJ A;  2WAD A;  3BT9 A;  3C18 A;  1LKX A;  3MKZ A;  3F22 A;  2X48 A;  4EQQ A;  2R5Z A;  1VQ4 I;  1SFU A;  2KZG A;  4FQG A;  4FCY A;  2VJJ A;  2R7O A;  4OOI A;  2LY1 A;  1HW5 A;  2V4J C;  3IAS 2;  3HRU A;  2DJI A;  3JAM Z;  4NQW B;  1ZLJ A;  1SD4 A;  5J6X A;  3WU1 B;  1B72 B;  2CS3 A;  4B3A A;  2CUJ A;  2HFH A;  2BY2 A;  4AVP A;  3J80 Z;  5LD2 C;  3RKX A;  4IOA F;  2QVO A;  3DFG A;  2A6H F;  4LIV A;  2JA5 J;  3K4L A;  5D5W B;  2KJB A;  1WH5 A;  5D6E A;  4BGD A;  3B73 A;  2XAF A;  3MEX A;  3VSK A;  3OSF A;  1LQ1 A;  3TBI A;  1OCP A;  2Y30 A;  4BEH B;  3GTJ J;  1SAN A;  3MZY A;  3P9I A;  4A3F J;  2PX9 A;  1YRN A;  1HXD A;  3QYB A;  4QTR A;  5EDN A;  5E18 F;  5BMZ A;  4PFP A;  5D6F A;  3RTR A;  1OFC X;  1W4M A;  3I3L A;  3LOC A;  2DOD A;  3AG1 H;  1A31 A;  1P9Q C;  4LFU A;  1P4A A;  2VB6 A;  3F8C A;  4MQ9 F;  3REO A;  3ASN H;  3R60 A;  3U21 A;  4CDG A;  3H9J A;  1RNL A;  2Y9Y A;  4HDV A;  1KYZ A;  3ONQ A;  3LSR A;  4L0Y B;  1R1U A;  2X1E A;  3K70 C;  1TWG J;  4G12 A;  2X4H A;  5F0C A;  3ZP5 A;  2VQH A;  2MAB A;  3CCV I;  1RKW A;  2VQL A;  2BVL A;  2M4G A;  3BZK A;  1R00 A;  4ZDP A;  4M71 A;  4YRV A;  3CMY A;  1R36 A;  3BR0 A;  3OY9 A;  3EUH A;  3PQJ A;  3HTU A;  1KQ9 A;  1KYW A;  3C1D A;  1VQN I;  1NHA A;  5BPD A;  2ESN A;  5H6Q A;  5EEG A;  2LKX A;  4M3F A;  2QQB A;  5D5V B;  1OCO H;  3JRB A;  1T98 A;  2DDA A;  2K9S A;  5E79 C;  3AL0 C;  3G1L A;  2PLY A;  2DA3 A;  2VXD A;  4M9X A;  3L1P A;  4MLO A;  2M8G X;  2BY1 A;  5A2Q K;  2JPC A;  3E3V A;  3FXM A;  2IAI A;  1SEU A;  1H8A C;  1JGS A;  1ZAR A;  3OYL A;  2HXI A;  3E0J B;  1H0M A;  4IZZ A;  3FBN B;  1R6R A;  4MQV A;  3SQN A;  1Y1W J;  2XRO A;  2X1C A;  2HOE A;  3KE2 A;  3ZQQ A;  4KDP A;  2LY2 A;  5LHI A;  3RKW A;  4AD9 A;  2JSP A;  4HV5 A;  4BJ5 C;  3HL2 A;  1GHC A;  1BI3 A;  5CQG A;  4ENM A;  2L7Z A;  4WX9 A;  2DI3 A;  4LG0 B;  3EUK L;  4PGH A;  4CCJ A;  4CCL A;  4CCO A;  4Y13 A;  1STZ A;  1R5G A;  1E3H A;  1H89 C;  3L9F A;  1VQ5 I;  3FXR A;  5FFZ A;  2DTR A;  2KT0 A;  3K70 D;  2M0C A;  5KVR A;  3L00 A;  3QU3 A;  5GTH C;  4N4N B;  1LVK A;  4KMF A;  3GX4 X;  2FNA A;  1I5Z A;  4Y3O A;  2RV8 A;  3F6V A;  4F92 B;  4HLX A;  2K9M A;  1QGP A;  2JPB A;  1MSE C;  2FML A;  2HVS A;  1FEX A;  3F3X A;  1LB2 A;  3M07 A;  1RPW A;  3ZRG A;  4F52 A;  1J5Y A;  4F93 B;  2JMW A;  4J19 A;  3O6B B;  4S05 A;  4RS8 A;  1MIJ A;  1ZK8 A;  4PSX A;  4BAC A;  3HOW J;  1RR8 C;  4BQN A;  3CUQ C;  3ZQC A;  3C7J A;  3FZV A;  3KZZ A;  5EF6 A;  3G6E I;  2K3F A;  3O8H A;  2JRM A;  3M9A A;  4IJA A;  2W24 A;  2F4O B;  5D8L B;  2HI3 A;  3I59 A;  4NNJ A;  2DFH A;  1ZGW A;  1MH4 A;  2OA4 A;  3OWT A;  3CC4 I;  3ABK H;  1B8I B;  4UUV A;  1T95 A;  1BA5 A;  3LSP A;  3HSE A;  3O3K A;  2OQR A;  4UB6 C;  2V9K A;  3JTH A;  2DA4 A;  1ZLK A;  2A61 A;  4MEX F;  4AYB N;  5LBQ A;  4KA4 A;  1AHD P;  1U8R A;  1E3P A;  2GAU A;  1XDU A;  3KYC B;  3C2B A;  3KYL A;  3WHB A;  2R7U A;  3TMO A;  1FLI A;  2XV4 S;  2NVU B;  4LG3 A;  4BE0 A;  4A93 J;  2HOS A;  1RES A;  3HHG A;  2R5Y A;  4BY7 J;  1IC8 A;  3MN2 A;  2CFX A;  2E5Z A;  1JJ6 C;  1AA7 A;  4DBR A;  2XPV A;  1S5L C;  1V54 H;  2ZBK A;  3HC7 A;  3JRI A;  2HDC A;  3CES A;  5AON A;  3CDL A;  4XRM A;  4A3I J;  1FP2 A;  4A3J J;  3A0H C;  3KZI C;  1YX5 A;  2ZME A;  4YEL A;  3NAR A;  4ZDO A;  2V6C A;  3NWS A;  2QSG X;  2EZH A;  4HW0 A;  4EV0 A;  1TQM A;  2YUS A;  2Y48 A;  1JKP C;  2XGC A;  2RVC A;  3SDG A;  2EV6 A;  3NQO A;  1H9T A;  5CYV A;  3HM5 A;  3R61 A;  4A5M A;  5EYR A;  1FPQ A;  3JRD A;  2NVQ J;  2MD0 A;  3K4M A;  1W36 C;  3BPX A;  3RYR A;  3V8L A;  2LMD A;  3R0J A;  4MTD A;  5IP6 A;  4IHY A;  3L7W A;  4NC7 A;  1Z7U A;  3HJE A;  2E36 A;  3ABL H;  2VIX A;  1YHQ I;  2IXS A;  5D8K B;  1C0W A;  3HKZ N;  5E1Z B;  2CSO A;  2H6B A;  3E5X A;  1MGT A;  3TOA A;  2IT0 A;  2WAF A;  2ISY A;  3P9K A;  3CJR B;  4M72 A;  3RJP A;  2E2J J;  3V4G A;  4OIR F;  2LH9 A;  2XF7 A;  3CCU I;  1QPM A;  2ID6 A;  2LF7 A;  1ZGJ A;  2Z2S B;  4HNV A;  2Q2E A;  2W4S A;  1B4A A;  2BYV E;  1ACI A;  5FKO A;  2O3F A;  4KN7 X;  2OC6 A;  4AC0 A;  1P92 A;  2GA1 A;  3A02 A;  3TO9 A;  3M3Y J;  4WCG A;  3G2B A;  1ONV A;  2JVG A;  2BBY A;  1HW1 A;  1XB4 A;  4UB8 C;  4L9J A;  2HYJ A;  2HVQ A;  3K69 A;  1UHW A;  4N9H A;  2DOA A;  1KU2 A;  1TP4 A;  2Q8K A;  1YFH A;  1ORK A;  2HR3 A;  4H4K C;  2JK3 A;  2HQ5 A;  1DPU A;  2GXA A;  1ETV A;  4W97 A;  1YW7 A;  4BH9 A;  3A2K A;  2KIS A;  3KP6 A;  3L2C A;  2XC7 A;  1LDD A;  2STW A;  5DCM B;  1O3Q A;  2DXI A;  4P1W A;  4NB5 A;  3ZMZ A;  1OR7 A;  2XGE A;  2FUG 2;  2JRT A;  1X1A A;  4EM1 A;  3DF8 A;  4F3Q A;  3KP3 A;  2QA4 I;  3Q0U A;  2VT2 A;  1WRJ A;  2L54 A;  3QYE A;  3IC7 A;  3SFZ A;  2NS0 A;  4BYY A;  3MZH A;  1HBX G;  2WY7 Q;  3PSI A;  4IHS A;  3FMQ A;  2EZL A;  3C2H A;  3HSF A;  4G8X A;  2ZNY A;  3QU6 A;  4KIS A;  2QSH X;  3M4O J;  2MD5 A;  3PNV A;  3DP7 A;  2GIV A;  3OYA A;  2WBM A;  3K6G A;  4XNF A;  5ILV A;  3DPT A;  3OL3 A;  2XRL A;  3WG9 A;  1LEA A;  2NVX J;  2DCE A;  1HF0 A;  3RQ4 A;  3UKG A;  3HOZ J;  1VQ8 I;  1ZRC A;  1BM9 A;  1MNE A;  3VFZ A;  2L9N A;  2V79 A;  2V1X A;  1R5I D;  4MO7 A;  3BG6 A;  4BS9 A;  3WTY C;  4ENN A;  1XCV A;  2B63 J;  2KP6 A;  1YIO A;  2IS6 A;  1A35 A;  2H27 A;  4EJW A;  1X2N A;  1Y8Q B;  2K4J A;  3ELK A;  2DK5 A;  5K7H A;  3JTG A;  3EUA A;  1W1W E;  5ED4 A;  3WTT C;  3HOX J;  3GUD A;  4DBQ A;  1IXC A;  5GP9 A;  2CW8 A;  3U1D A;  3RSN A;  1SMY F;  4YFN F;  1YYV A;  1WQ2 A;  1QA6 A;  2F4M B;  1POG A;  2N8G A;  1ZG1 A;  2YSR A;  2HOT A;  4LIT A;  4A6E A;  2EIM H;  1MH3 A;  1OCR H;  1VQ9 I;  2NNN A;  2QBY B;  1YI2 I;  4U0W A;  5J4Y A;  3GXO A;  3KEO A;  4EGY A;  2LBF A;  1T0F C;  4BHB A;  2BXZ A;  4HQM A;  2R7R A;  2A3S A;  1JT0 A;  2HU9 A;  1KQ0 A;  2EIK H;  3HOV J;  1NTC A;  1Y6I A;  2FBH A;  2Y2Z A;  3BR2 A;  4ESJ A;  1ZR4 A;  4BQO A;  1FNN A;  2DQL A;  3K10 A;  3M1E A;  4II2 A;  4P9U A;  2ZXH A;  4IF4 A;  4CH7 A;  1ZAO A;  2O7O A;  2NYX A;  3T8R A;  1D3Y A;  2EV0 A;  1D1A A;  1KU7 A;  1QO0 D;  4JX6 A;  2KQR A;  4HLY A;  3KYD B;  2LG4 A;  4A3D J;  4GYG A;  4WK8 F;  3HGY A;  3SZG A;  2HYF A;  1F9N A;  3VYS B;  1JTY A;  2KDO A;  1EA3 A;  3FM5 A;  3NEU A;  1OPC A;  2LKP A;  4P55 A;  4BQQ A;  4IHT A;  3DU5 A;  5ICG A;  1HDP A;  4QLC U;  3FIS A;  2JA2 A;  3B02 A;  3PFY A;  1RET A;  2IRF G;  2TCT A;  3ML6 A;  2OV7 A;  4L9V A;  3DBR B;  2O03 A;  5H2F C;  2XSD C;  4CGZ A;  4PK4 A;  4O6J A;  3S17 J;  2CV2 A;  1K78 A;  4D0P A;  1CF7 B;  4HQE A;  4AUX A;  1Z9C A;  5J47 A;  4ZC3 A;  1FC3 A;  3OV8 A;  3H9Q A;  1O7F A;  1J09 A;  2MH2 A;  2QM3 A;  1Z05 A;  1B6A A;  1MMD A;  1TW3 A;  4I2O A;  1L0O C;  1A5J A;  3HPH A;  2E19 A;  5FO5 A;  2M0M A;  3DCF A;  5GAH J;  3GZ5 A;  1DQU A;  3F8N A;  5BS6 A;  4B8X A;  3W2V A;  2MC4 A;  2QKM B;  2CJJ A;  2I8D A;  3PNY A;  4LLL A;  4GFB A;  3F8F A;  2VUM J;  1BW6 A;  3RCO A;  4BJ6 C;  1X3Z B;  3K2A A;  1LDK B;  4XKC A;  2IVM A;  2R7Q A;  2VQC A;  1K6Y A;  4HA8 A;  2D5V A;  3IH4 A;  3QWL A;  2IP2 A;  3K4J A;  4BE2 A;  2XF5 A;  3CF5 F;  2LFB A;  1U6G A;  2WV1 A;  3HOY J;  4UXN A;  1I27 A;  1YS6 A;  2L4A A;  2VI6 A;  2E2H J;  4PGG A;  1MW7 A;  1BOB A;  2F48 A;  3G1O A;  4UVA A;  3WGH A;  1ZRF A;  2R7T A;  3OYE A;  3DU6 A;  3WTZ A;  3BR1 A;  5BNG A;  3U1K A;  1QPI A;  3FDY A;  4K2E A;  4KIG A;  4JOM A;  1NK2 P;  2O61 A;  5FFX A;  4L9T A;  2KDZ A;  2CYY A;  2DA6 A;  3KP7 A;  4ITV A;  4LOC A;  3IWF A;  4V2F A;  1LVA A;  1RI7 A;  4D5F A;  2ZO4 A;  3GTP J;  1WJA A;  3M7G A;  1VQL I;  3BWG A;  4RGU A;  2KIM A;  3P9C A;  1XS9 A;  4NQW A;  3PFI A;  1FX7 A;  1WH7 A;  3CP8 A;  3QOP A;  5C44 J;  4B1R A;  3BR6 A;  5HDG A;  2DYS H;  2AQE A;  2HKO A;  2DMT A;  3QRF F;  3UR3 C;  1JHF A;  3U2R A;  3PIO F;  2XAU A;  1WHU A;  2HNH A;  3RKY A;  2PMU A;  2WY8 Q;  1R49 A;  3S16 J;  1P6R A;  3ABU A;  3H5A A;  1I1G A;  3H3Z A;  3J7Z I;  3L2R A;  2HKX A;  2X9D A;  1KON A;  5K1Y A;  2EZI A;  2ZB9 A;  2NVY J;  4A2U A;  5J4V A;  4OIP F;  3CMM A;  4B3X A;  2DU9 A;  2HXO A;  2EA4 A;  2MSY A;  5K7Z A;  2NRA C;  2R5Y B;  2ME6 A;  2MG4 A;  1GXQ A;  1ON1 A;  2ECC A;  2F5D A;  3A03 A;  3I55 I;  3TP3 A;  3H0D A;  4H0E A;  4I0B A;  1SVM A;  2XGX A;  3M8E A;  1U9N A;  1YRN B;  5EJC A;  1JKQ C;  5JHF A;  4FE7 A;  3ESW B;  1UB9 A;  5E8G A;  3H5N A;  2K86 A;  2DMN A;  2W82 A;  4LLN A;  1LFU P;  3LSM A;  3LFU A;  3ZMT A;  1Z77 A;  3CCS I;  2NAZ A;  2ZJP F;  2CV0 A;  3AG2 H;  3TOB A;  1KU3 A;  5E3N A;  1WJB A;  1QZE A;  5HLI A;  4B43 A;  1MD0 A;  3BLY A;  4M73 A;  4KFC A;  1SAX A;  5J1U A;  2NS7 A;  3EYY A;  3FXQ A;  2FBI A;  3QAH A;  5L3B A;  5LGU A;  4RB0 A;  4CXF A;  3F9K A;  1SC7 A;  4CCK A;  4RAZ A;  3RQI A;  1DDN A;  5GAD J;  5JVT A;  1IO2 A;  4U7D A;  2Q0O A;  4NBQ A;  4XBF A;  2IA2 A;  4OIQ F;  2QQ9 A;  4XK4 A;  2R7V A;  2L7M P;  3OYG A;  1GVJ A;  3SFI A;  1WI3 A;  3OS0 A;  2FJ1 A;  3PUF A;  2F5C A;  1BJZ A;  5IYC J;  5KCM A;  1FSH A;  1IRF A;  4IXA A;  1B59 A;  3S3N A;  3CO6 C;  3LSI A;  4E7K A;  2HPM A;  6PAX A;  2W1O A;  4U87 A;  4AWX B;  2ZC2 A;  5DV5 A;  3TGN A;  5M5X J;  1K7A A;  2JA7 J;  5DUK A;  4RGR A;  2MGQ A;  1HKT A;  1Y0U A;  3CTA A;  4OAZ A;  4WXD A;  1R4M B;  2LY9 A;  1NH3 A;  1ETO A;  2X1D A;  1VF9 A;  2VBZ A;  4U88 A;  1ZKG A;  5HLH A;  4LIU A;  2JT1 A;  3ECH A;  1I3Q J;  3LQR A;  2LKS A;  3ISP A;  1ETQ A;  1AKH B;  1UG0 A;  5LGN A;  3FIW A;  3OYD A;  5LRR A;  3CC2 I;  3KCC A;  1JKO C;  2L9V A;  1R1V A;  2IPQ X;  3J7A Y;  2XVC A;  4FAS D;  3T5X A;  3E6B A;  2LVS A;  4KIC A;  3RZD J;  3SHF A;  1SFO J;  3LA2 A;  5M5Y J;  2ZCW A;  4GDF A;  1N25 A;  2VE8 A;  5K5R A;  3IRQ A;  3LA3 A;  1FIA A;  2KJC A;  2ICW G;  4KUM A;  2XSJ C;  1XDS A;  2HVR A;  1Z67 A;  1YO5 C;  4G7Z F;  1ETY A;  2K40 A;  4QPO A;  2V1U A;  2YS9 A;  2OF7 A;  1RUO A;  1O3R A;  4II3 A;  2OCC H;  2R7W A;  1Z3X A;  3QOD A;  3RPQ A;  3T8T A;  3ZGK A;  1YJW I;  4CSW A;  2XUB A;  2QQA A;  5CLS A;  4ZZD A;  1N78 A;  5IP7 J;  3LAP A;  4ZH4 F;  3ZXS A;  3DPU A;  4FET A;  3MFK A;  3E5U A;  1UG2 A;  2F6C A;  1XD7 A;  3W6J B;  3K1P A;  3JRE A;  2DPU A;  2EBI A;  1VQP I;  1I1S A;  3CQZ J;  2QGU A;  2ID3 A;  3LMM A;  4HAM A;  1XTA A;  2K4B A;  2XAQ A;  1OYW A;  4Y33 A;  1W5T A;  2H1K A;  3CO7 C;  2DTZ A;  3JCU C;  5E1X A;  2L4M A;  4DYR A;  1VFC A;  2H94 A;  4XL9 A;  3K9T A;  4Z6Y A;  3E6C C;  2YU3 A;  4A3M J;  5EEH A;  3A4C A;  3RZO J;  3I4N J;  1AOY A;  2L2O A;  4RLF A;  2ISZ A;  1TT0 A;  2H09 A;  2P5L C;  3FMS A;  2DW4 A;  4JK1 X;  1F36 A;  4ZTJ A;  4RDU A;  5CQE A;  2QCO A;  2P0W A;  2F2E A;  1G3W A;  2LNB A;  4A6D A;  3V7S A;  3BDD A;  1HKQ A;  5CJ9 A;  2KRH A;  2R4G A;  2K9L A;  4PJN A;  4RGX A;  3ZMV A;  1ZH5 A;  3WHC A;  2B7E A;  5DEQ A;  2VC1 A;  3TED A;  1Y56 A;  2EFP A;  4C3H J;  1W5C C;  1XSD A;  4RB3 C;  1T8I A;  4CIC A;  2RN7 A;  4IHW A;  3ERM A;  3WTU C;  2FOK A;  2KHM A;  1BIB A;  3LA7 A;  2XKP A;  1G6N A;  2W25 A;  4Z2Y A;  3I4P A;  5M5W J;  1TWH J;  3RYP A;  4EJV A;  4LB6 B;  4D1Q A;  3I64 A;  5J8C A;  2E2I J;  1W36 D;  1T6S A;  3FBI B;  1Q1H A;  1TLH B;  3QQA A;  3S32 A;  1H88 C;  2P7C B;  1D0Z A;  2DFI A;  1LNW A;  1YQA A;  4M9S A;  1K4T A;  1MBF A;  5F64 A;  4G94 A;  4I76 A;  3T0Y A;  2IEK A;  2M7B A;  1GXP A;  4V19 K;  2P7V B;  4XID A;  2KIF A;  1JJ8 C;  1SD6 A;  2EFO A;  2VON A;  2HZT A;  1R22 A;  1VQM I;  1MBG A;  2P8T A;  1MMG A;  4YII A;  4M3D A;  3L09 A;  2RNG A;  3OYI A;  2QUF A;  1WCM J;  1WVR A;  4GGG A;  4F91 B;  4UUS B;  1ENH A;  1PYV A;  4JX5 A;  1MDM A;  2R3S A;  2VBX A;  5FD5 A;  5HNH A;  4EJO A;  4BAY A;  1XX5 A;  1MZB A;  1GV5 A;  1Y8R B;  5L3C A;  3EDP A;  3Q3S A;  4GO1 A;  2ESH A;  4B44 A;  2GXB A;  2FBK A;  2GWR A;  3K7A J;  1V4R A;  4XSZ F;  1M1E B;  3E1S A;  2RKH A;  3GCM A;  3PIP F;  4PJM A;  5H6R A;  3FF5 A;  3AG4 H;  3JRA A;  3DPL C;  2VJI A;  5CPR B;  2DMP A;  1WWX A;  4EJU A;  5J8F A;  2OZU A;  2LLK A;  1SAU A;  4PCQ A;  2GBY A;  2XKO A;  5B1A H;  2PBI A;  2F5F A;  2BZT A;  4IX7 A;  2OD5 A;  5HVQ C;  4LJZ F;  4HF1 A;  5DCM A;  1WGX A;  4E70 A;  3CUQ B;  5HDK A;  4RA2 A;  5L3D A;  1X19 A;  1ZHF A;  3CUO A;  1BC7 C;  2E35 A;  1XSX A;  1Z91 A;  5EGO A;  1D0X A;  3AFH A;  2IW5 A;  3ZQG A;  3QP6 A;  3CCR I;  4JP0 A;  4KIB A;  5HS9 A;  1ZYR F;  2QYO A;  5EG0 A;  1O4X A;  2EFQ A;  3PL8 A;  4Y15 A;  3BJO A;  1RKT A;  1JGG A;  2VOO A;  4PSW A;  2OJE D;  4C2U A;  4HOB A;  3JRF A;  4ON0 A;  1B9N A;  1S7A A;  2JQ7 A;  4NC6 A;  2CG4 A;  1K4S A;  2M87 A;  4U7B A;  1J59 A;  1PUE E;  2MYS A;  1JKR C;  1S6L A;  1FMV A;  2ZJR F;  4NUB A;  4BL0 B;  5E17 F;  4ENK A;  2YU9 J;  1FTT A;  2MLG A;  2DK8 A;  3EET A;  4HX7 A;  1TZL A;  4MHG A;  3LL7 A;  3LAJ A;  3QPS A;  3VSL A;  2XAJ A;  3WTS C;  1PDN C;  4A3L J;  4PZJ A;  2X6Y A;  1YE9 A;  2ELK A;  5LEJ A;  5J3L A;  4OMZ A;  4UHT A;  2DA7 A;  1O7L A;  3PO2 J;  1FZP B;  3JSP A;  1YIJ I;  1V5G A;  2HQN A;  1A6I A;  1BI0 A;  3QYF A;  1Y0N A;  1LE8 A;  1PP7 U;  2UZK A;  2DBB A;  2EWN A;  2PMH A;  5E3M A;  1ZQ3 P;  1HSJ A;  2BXY A;  1LDJ A;  1U8B A;  4MFE A;  2QBY A;  3BY6 A;  2WAQ A;  2OU2 A;  3KLO A;  2ZXI A;  2ME0 A;  3CMA I;  5M3F J;  2A6T A;  4DYC A;  3JRC A;  2XB0 X;  2RC4 A;  1DPR A;  2GQQ A;  4DYQ A;  3V42 A;  5JLX A;  1I6X A;  3KP4 A;  3OIO A;  4MGR A;  3Q9V A;  4R1H A;  4RLQ A;  1E17 A;  4IHV A;  3BTJ A;  2L02 A;  3WGI A;  4RAF A;  2OUM A;  2GM4 A;  3TW7 A;  5J40 A;  3LSK A;  2B0L A;  5JHU A;  1YX3 A;  1XMA A;  3OOU A;  3FXL A;  1G4D A;  2CQQ A;  4XOT A;  4EVI A;  3OS2 A;  1MBK A;  4Y52 J;  2EQR A;  3O8G A;  4LK1 F;  3ZMU A;  1GDT A;  2HOA A;  2DN0 A;  4IPA A;  4FX4 A;  1X2M A;  2Q2E B;  1E0E A;  4XR6 A;  1D1B A;  4XN3 A;  4I0A A;  4DW6 A;  1FOY A;  1ZGA A;  4JQF A;  3MKY B;  2J5P A;  2K7L A;  2IGM A;  2VJ4 A;  2VLA A;  3CME I;  3I0T A;  4G6D A;  2LSO A;  2L7F P;  1AWC A;  2LF8 A;  2M1B A;  2ZNZ A;  3GFM A;  4HST A;  2ELH A;  4MTE A;  3OMY A;  3MMY B;  4CUG A;  4ZZL A;  4Y7N J;  2EFW A;  1D8J A;  1UHM A;  2M7A A;  4HG2 A;  3I4M J;  4BE1 A;  2E7W A;  5TIS C;  5HLG A;  4WF2 A;  1D8K A;  2JSC A;  4C2M J;  3CJN A;  4A3K J;  4HX8 A;  3BTC A;  3H36 A;  4I6Z A;  2ZJ2 A;  4CCN A;  4S04 A;  4C3J J;  3OOP A;  1ZG3 A;  1HCR A;  2W00 A;  2PG4 A;  1B72 A;  3W2A A;  5B5E C;  1HW2 A;  2EA2 A;  4QSH A;  1XC5 A;  1SFK A;  2IGO A;  1K61 A;  4HNT A;  3LNQ A;  1YG2 A;  2C6Y A;  1MNM C;  2FSW A;  2DLL A;  2IS2 A;  2GZW A;  4C9Y A;  4UVB A;  3H9G A;  2VT3 A;  1DGR M;  5F6F A;  1RRJ A;  1BR2 A;  2OCE A;  4HF0 A;  3JSO A;  3ROU A;  2DQR A;  5IOZ A;  2BW3 B;  5E20 A;  5KK1 A;  2PJP A;  4AU7 A;  3KLN A;  1GLN A;  3K2Z A;  4L9N A;  2MW8 A;  1U5T A;  3P5J A;  2I10 A;  3F21 A;  4KIF A;  3BP8 A;  1BC8 C;  1IV6 A;  4Y17 A;  2JUC A;  3S3O A;  2Y0M A;  3DTI A;  1XN7 A;  3W3C A;  1FIP A;  1X1P A;  2FQ4 A;  3GO5 A;  4JX4 A;  3S8P A;  4YFX F;  2PJR A;  3TW6 A;  2GA2 A;  1N77 A;  2RQP A;  3WTX C;  4AIK A;  4XLE A;  3ZQL A;  3TQN A;  4R79 A;  3OR1 C;  2VAS A;  1F1Z A;  3CDI A;  2A5Y B;  1RUN A;  3RPU D;  3J81 K;  4J00 A;  5M3M J;  4IQJ A;  5IYD J;  3OIQ A;  3HRT A;  2JZY A;  4GRI A;  3GBG A;  1WZ2 A;  1QHH D;  3OR2 C;  5IYB J;  2VOP A;  3GFL A;  1T39 A;  2ZFW A;  2W7N A;  1TTY A;  4OU0 A;  1IXS B;  1FY7 A;  5FLV A;  1FOX A;  1OIS A;  4PDK A;  2BY0 A;  5C3E J;  4G6Q A;  1SD5 A;  2D2W A;  4OWR B;  1TBX A;  2HZD A;  1EH8 A;  3WGG A;  4MIM A;  2Z1D A;  4A0X A;  4D9J A;  2STT A;  2WAQ N;  1LFB A;  2AQF A;  2KZV A;  3HKZ A;  1U0J A;  3LSJ A;  5D5X B;  4EMS A;  4FT8 A;  4YEJ A;  3H1C A;  4AVZ A;  1XG1 A;  1BN5 A;  2ZKZ A;  3IH3 A;  4QIW N;  5EEA A;  2RNJ A;  4QPQ A;  1QVT A;  3T1B A;  1K83 J;  3BJ6 A;  3I5U A;  5DD8 A;  1IGN A;  2RDP A;  3HPG A;  2BE5 F;  3J7Y J;  5K7F A;  5F27 A;  2XAG A;  2I5U A;  2GOM A;  5H20 A;  3GF2 A;  4M6V A;  1FBU A;  2X6W A;  1AU7 A;  3QP5 A;  3D5L A;  1RZ4 A;  4W1U A;  3KET A;  3DEE A;  4A0Z A;  4D7N A;  4UY8 I;  3LWF A;  1A04 A;  4RAG A;  1S7O A;  3RIR A;  5EGO B;  2A68 F;  3EQL F;  3OYJ A;  2QQ8 A;  1XPX A;  3BG5 A;  1TWA J;  5DTD A;  3BG9 A;  3VB2 A;  2DMU A;  3AL0 B;  3K4C A;  2QF7 A;  3DXJ F;  3ZCO A;  3HHH A;  3WE3 A;  1R7J A;  1SVL A;  3E97 A;  5LRS A;  1TNT A;  2CQN A;  3HOS A;  4RMN A;  1KGS A;  4OIN F;  4EJT A;  2F5V A;  4HDU A;  3DKW A;  3OS1 A;  2MA3 A;  1BL0 A;  2HS5 A;  3JRH A;  5ERI A;  3JAM K;  3MAJ A;  2IJL A;  2DOF A;  3IAM 2;  3EPZ A;  1LJ9 A;  4YIR X;  2B9S A;  3CCQ I;  4C3I J;  1Z7L A;  3BCB A;  2QSF X;  3WE2 A;  4RB2 C;  4DOZ A;  3KPH A;  2D1H A;  4LK0 F;  4WXH A;  1S3J A;  3G73 A;  1CF7 A;  4C2T A;  2XF6 A;  2E1O A;  3HOT A;  2VBW A;  1YJN I;  2DFF A;  3K1N A;  4N4O B;  4PUS A;  3E6D A;  1Z0X A;  1O3S A;  3GEZ A;  4M3G A;  1EJ9 A;  2FEZ A;  3K1M A;  3FHN A;  3ABM H;  3DEW A;  4CYD A;  1F43 A;  5LLQ A;  2E34 A;  3CCM I;  2HGC A;  1YS7 A;  5FKK A;  1JUS A;  2V1D A;  5BPI A;  2DT7 B;  2CUE A;  1BI2 A;  1X3U A;  4HYE A;  3HXL A;  3S1M J;  5FLM J;  3KIO A;  2CW7 A;  1HDD C;  3HG9 A;  3BG3 A;  2KIQ A;  3H5R A;  5K5O A;  1IN4 A;  2G7U A;  2Z16 A;  4HBL A;  3S2H J;  1EV7 A;  1GVD A;  3W2W A;  1Z21 A;  2BEO A;  1OCC H;  2YPR A;  3Q0W A;  1T2K A;  2IGN A;  2X85 A;  1S8N A;  1TL8 A;  3N4M A;  1MND A;  4ESB A;  4BXX J;  2EZK A;  2P5K A;  3BR3 A;  3IWZ A;  3MKW B;  3IKV A;  2LRD A;  1ZR2 A;  2GXG A;  1X3W B;  5J1R A;  3ULQ B;  1YW9 A;  4ZYA A;  3S93 A;  1IRX A;  4BDZ A;  3CF2 A;  2K5C A;  3P7N A;  4UVC A;  3OYK A;  2HDD A;  2LYC A;  2EB7 A;  1RIO H;  3FMR A;  2P6S A;  2W85 A;  4F55 A;  3FHZ A;  5GTI C;  4E7Z A;  3CD6 I;  4AM3 A;  3FWE A;  2F5E A;  1V5F A;  2DT6 A;  4I01 A;  5IT9 Z;  1MBE A;  3DLA A;  2MLK A;  3FKI J;  3ZPL A;  3SZT A;  4RM2 A;  3LSH A;  2GOX B;  3F72 A;  1V55 H;  4N0B A;  4U0V A;  1IZ1 A;  4XRF A;  1IDZ A;  2ZFU A;  2MFZ A;  1TQP A;  3R0A A; 
#chains in the Genus database with same CATH homology
 3IP4 B;  4E7J A;  2KRH A;  2R4G A;  4NC7 A;  2K9L A;  4PJN A;  3N05 A;  2VIX A;  1Y56 A;  2WB1 A;  2VL8 A;  2IXS A;  2ELJ A;  2KMU A;  3L2Q A;  2KHM A;  1WJ5 A;  2WAF A;  4J01 A;  3CJR B;  3OYN A;  4D1Q A;  2VJ5 A;  2LH9 A;  3FKJ A;  2XF7 A;  4Y4R A;  1W36 D;  4HRI A;  2R7S A;  3PNT A;  4E7S A;  3FBI B;  3S32 A;  2Z2S B;  2W4S A;  4OAY A;  2IGK A;  1D0Z A;  4IQ4 A;  1UAA A;  1MMA A;  3S3M A;  2OC6 A;  2E5N A;  4XQF A;  2M7B A;  3G2B A;  3DKY A;  2JVG A;  4HNU A;  2JUG A;  2A5W A;  2HVQ A;  3OIP A;  2BOL A;  1MMG A;  2DOA A;  4XLA A;  4BJT A;  3OYI A;  2RNG A;  2VKD A;  1WJC A;  4XLH A;  4F91 B;  3L2W A;  3DTE A;  4H4K C;  1PYV A;  4C30 A;  3L2V A;  5HNH A;  3VYT B;  3A2K A;  2XC7 A;  4B44 A;  1NG7 A;  2DXI A;  3SEQ A;  4P1W A;  1PJR A;  3VDX A;  2FUG 2;  4HPQ A;  3OYF A;  3CP2 A;  3E1S A;  1X1A A;  4F3Q A;  4PJM A;  2LRE A;  3DPL C;  5TGT A;  3BCA A;  3QYE A;  2VJI A;  5CPR B;  2WY7 Q;  3PSI A;  1SAU A;  3C2H A;  1X1D A;  4KJZ A;  5HOO A;  4IX7 A;  5HVQ C;  4KIS A;  5CKT A;  3PNV A;  3OL4 A;  1LFP A;  4XMY A;  3OYA A;  2WBM A;  3K6G A;  2QKL B;  1X19 A;  4XNF A;  3DPT A;  4CA0 A;  3OL3 A;  2VPL A;  1ERD A;  4PJJ A;  3PJR A;  1D0X A;  2DCE A;  3AFH A;  3CZ6 A;  4XKV A;  3RQ4 A;  4E7H A;  4HSR A;  1MNE A;  2E60 A;  2L9N A;  3BG6 A;  4BS9 A;  2KLO A;  1G8X A;  2Q1Z B;  3PL8 A;  4DGW B;  2KP6 A;  5KNL A;  4PSW A;  4C2U A;  2IS6 A;  4NC8 A;  4KT6 A;  3OYC A;  3EUA A;  4U7B A;  3ZR8 X;  1FMW A;  4DBQ A;  2MYS A;  3PUB A;  2CW8 A;  2X6X A;  1FMV A;  3RSN A;  2IS4 A;  2CH0 A;  4NUB A;  1MMN A;  2RQQ A;  4BL0 B;  4E4H A;  1TZL A;  4LIT A;  3LL7 A;  2ZSH B;  1OR7 C;  3VSL A;  4XKB A;  2X6Y A;  4AYB A;  1YE9 A;  4ZDL A;  2LBF A;  1T0F C;  3KEY A;  1BR1 A;  2R7R A;  2HU9 A;  3MD2 A;  3VWB A;  2PJR B;  1Y6I A;  1V5G A;  1Z3Y A;  4BQO A;  3QYF A;  4PFO A;  3SYT A;  4G6T B;  3D5S C;  3K10 A;  4BDY A;  4ZJZ A;  4II2 A;  4RM3 A;  2ZXH A;  3KX2 A;  4CH7 A;  2UWM A;  5KHD A;  2LOO A;  4XOP A;  2KRC A;  2JVH A;  2P0W A;  2LBF B;  1D1A A;  3PSF A;  2WAQ A;  2ZXI A;  2KQR A;  2WAE A;  3IUO A;  2A6T A;  2IS1 A;  2K3P A;  2LG4 A;  2LC2 A;  2VXZ A;  3V42 A;  1HA8 A;  3OYM A;  4HEA 2;  3SZG A;  4XN0 A;  3VYS B;  2KDO A;  1EA3 A;  3TL4 X;  4RLQ A;  3BG7 A;  3A1Y A;  2L5Q A;  4BQQ A;  3DU5 A;  2OUM A;  2JA2 A;  1S9H A;  3PFY A;  3LSK A;  1DP3 A;  1YX3 A;  4B48 A;  3OOU A;  2OV7 A;  4P5O A;  3BC8 A;  3D5R C;  4XOT A;  3OS2 A;  3K4K A;  2M4K A;  2VKH A;  4PK4 A;  2CV2 A;  4BU2 A;  4ZC3 A;  1QHG A;  2Q2E B;  3H9Q A;  1J09 A;  1E0E A;  4XR6 A;  1D1B A;  1MMD A;  1V5E A;  4XN3 A;  1WJE A;  3DWL E;  3HPH A;  4JQF A;  3MKY B;  3L2U A;  2M0M A;  2E1M C;  2IGM A;  3SEZ A;  2VJ4 A;  2X51 A;  2BVM A;  1DQU A;  2VLA A;  2UV1 A;  3K4N A;  4BUP A;  2V1N A;  3W2V A;  1OLT A;  4PJL A;  3SDB A;  2MC4 A;  2QKM B;  4X0G A;  4HST A;  2I8D A;  1WJF A;  2HQA A;  4CUG A;  3OMY A;  3MMY B;  1D0Y A;  2M7A A;  3PNY A;  4HG2 A;  3VYR B;  3OYB A;  4BE1 A;  2V6E A;  3AKZ A;  3RCO A;  4BJ6 C;  3I9V 2;  2UUZ A;  3C2G A;  5FRN A;  1LDK B;  4CCN A;  4XKC A;  4DIQ A;  3HUG B;  2R7Q A;  1WJD A;  2VQC A;  2W00 A;  1K6Y A;  5HLT A;  2L9S A;  1WFX A;  3W2A A;  2WAD A;  2IGO A;  1SFK A;  1LKX A;  4HNT A;  3MKZ A;  3K4J A;  4BE2 A;  2XF5 A;  2IS2 A;  2V7F A;  4BXF A;  4C9Y A;  3H9G A;  1DGR M;  2VJJ A;  2R7O A;  1BR2 A;  2PMZ A;  5FRO A;  3VYU B;  2LY1 A;  3IAS 2;  2V4J C;  3K4B A;  2DJI A;  2BW3 B;  4NQW B;  1MW7 A;  1BOB A;  4AU7 A;  2R7T A;  1GLN A;  2CS3 A;  3OYE A;  3DU6 A;  2CUJ A;  5LD2 C;  3FDY A;  4JOM A;  4LIV A;  3K4L A;  4BGD A;  3VSK A;  4EAT A;  2R7X A;  4ITV A;  3TBI A;  4BEH B;  3S3O A;  1BR4 A;  2HPI A;  3DTI A;  3W3C A;  1WJA A;  3QYB A;  3S8P A;  2PJR A;  4PFP A;  3RTR A;  1N77 A;  3I3L A;  4XLE A;  4R79 A;  3OR1 C;  2VAS A;  3CP8 A;  1P9Q C;  3RPU D;  4J00 A;  1G59 A;  2AQE A;  3UR3 C;  3M1C A;  2VB6 A;  3U21 A;  4IQJ A;  2XAU A;  2HNH A;  3H9J A;  2WY8 Q;  3OIQ A;  4GRI A;  3GBG A;  1QHH D;  3OR2 C;  2F4I A;  2E1M B;  3ONQ A;  3H5A A;  2W7N A;  3L2R A;  2X1E A;  3K70 C;  2M3A A;  1KON A;  2VQH A;  3QOE A;  2MAB A;  4OWR B;  2VQL A;  4XOR A;  2HZD A;  2BVL A;  2V26 A;  2Z1D A;  2M4G A;  3CMM A;  4ZDP A;  4B3X A;  4D9J A;  2KZV A;  2AQF A;  3HKZ A;  4YRV A;  1U0J A;  3EUH C;  4XON A;  4YEJ A;  4AVZ A;  2O5R A;  3OY9 A;  1N75 A;  2Y0S A;  3H0D A;  1NG6 A;  5FRM A;  4XM3 A;  4QPQ A;  4BEH A;  3DKX A;  1X1C A;  3HPG A;  5JHF A;  3AL0 C;  3H5N A;  2VXD A;  2W82 A;  3LSM A;  3LFU A;  2CUZ A;  1JI8 A;  4MLO A;  2GOM A;  2CV0 A;  2X6W A;  1WJB A;  3D5L A;  3OYL A;  4E7I A;  3E0J B;  4B43 A;  3DEE A;  3FBN B;  4IZZ A;  1ZEL A;  1R6R A;  3BLY A;  2X1C A;  3ZQQ A;  2LY2 A;  3F9K A;  3OYJ A;  2JSP A;  4BJ5 C;  4CCK A;  3HL2 A;  5CQG A;  4CZC A;  4ZTF A;  2CMP A;  3M8J A;  3EUK L;  4CCJ A;  3AL0 B;  4CCL A;  3K4C A;  4CCO A;  2NOJ B;  3H35 A;  2KL4 A;  3ZCO A;  2R7V A;  3OYG A;  1QU3 A;  4XLF A;  3OS0 A;  4E6K G;  3HOS A;  3K70 D;  4XLC A;  4IKF A;  5KCM A;  1UEL B;  4RMN A;  2L7K A;  4N4N B;  2F5V A;  1LVK A;  2CFO A;  1D1C A;  3OS1 A;  3S3N A;  4KIT B;  4Y3O A;  4F92 B;  2WA0 A;  3LSI A;  4E7K A;  2HPM A;  1DGW Y;  2W1O A;  4U87 A;  2K9M A;  2HVS A;  1VZ0 A;  3IAM 2;  3EPZ A;  4OAZ A;  3ZRG A;  2XDV A;  4F52 A;  4F93 B;  2X1D A;  1Z7L A;  3BCB A;  4PSX A;  4BAC A;  4BQN A;  4DOZ A;  4LIU A;  4C2T A;  1UG0 A;  2XF6 A;  3OYD A;  3UNG C;  3HOT A;  2CV1 A;  4N4O B;  3DTK A;  4PUS A;  3J7A Y;  4FAS D;  4NNJ A;  2ZSI B;  3FHN A;  1X1B A;  3OWT A;  4B47 A;  1T95 A;  2DT7 B;  2XSJ C;  2HVR A;  2V9K A;  4QPO A;  2RRE A;  3HXL A;  2HDW A;  4II3 A;  2CW7 A;  3HG9 A;  2R7W A;  1Z3X A;  3DQV C;  2VQG A;  3H5R A;  3QOD A;  3ZGK A;  4CSW A;  2Z16 A;  3KYL A;  3OYH A;  2R7U A;  1N78 A;  3TMO A;  5LFA A;  3W2W A;  1Z21 A;  3ZXS A;  3DPU A;  2IGN A;  4FET A;  4LG3 A;  4BE0 A;  2X85 A;  1X4O A;  2F6C A;  2E5Z A;  1MND A;  1AA7 A;  4DBR A;  3NWT A;  4ANJ A;  3MKW B;  2LRD A;  5HNF A;  3HC7 A;  4ZYA A;  3S93 A;  1IRX A;  4BDZ A;  3CF2 A;  3CES A;  2K5C A;  3LMM A;  3OYK A;  2LYC A;  1X4P A;  4Y33 A;  2BW3 A;  4F55 A;  1YX5 A;  2KPM A;  4YEL A;  4E7Z A;  4ZDO A;  4XL9 A;  3NWS A;  1V5F A;  2DT6 A;  3LSG A;  3A4C A;  2L2O A;  3DLA A;  4RLF A;  1TT0 A;  4DJA A;  4RM2 A;  3LSH A;  4XKW A;  2GOX B;  4E7L A;  3CJQ B;  4ZTJ A;  4CCM A;  5CQE A;  2MD0 A;  2ZFU A;  2MFZ A;  3K4M A;  1W36 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...