1XS9A

A model of the ternary complex formed between mara, the alpha-ctd of rna polymerase and dna
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
129
structure length
129
Chain Sequence
MTMSRRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAERYGFESQQTLTRTFKNYFDVPPHKYRMTNMQGESRFLHPLNHYNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 5'-D(P*GP*AP*TP*TP*TP*AP*GP*CP*AP*AP*AP*AP*CP*GP*TP*GP*GP*CP
publication title Versatility of the carboxy-terminal domain of the alpha subunit of RNA polymerase in transcriptional activation: use of the DNA contact site as a protein contact site for MarA.
pubmed doi rcsb
source organism Escherichia coli
total genus 39
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2004-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12833 HTH_18 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1xs9A02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1xs9A01
2WB1N 2LTPA 1DU0A 3CQZJ 4XRSA 1H88C 4MLOA 1OCPA 2DMNA 1IJWC 1I50J 1IRZA 2XSDC 2FX0A 2E1OA 2HXOA 5F1JA 3JRCA 5C3EJ 3B6AA 2M2EA 3CCYA 3MKLA 1Z77A 1H8AC 1X58A 2HDDA 2X9DA 4M6VA 3HOXJ 4BBSJ 2IBDA 1OCTC 5IP7J 5DTDA 2DMPA 2WAQN 2NS8A 1YRNA 3HOVJ 2HQ5A 4LOCA 4MIMA 5M5WJ 4IEJA 2EZKA 5FKNA 1FTZA 2HYJA 3BR2A 5EZHA 4M3EA 5IYBJ 3BR6A 3LNQA 1F36A 1HF0A 4ABZA 2EZIA 2CU7A 1P7JA 1XS9A 1K61A 3IH4A 2VKEA 3JRHA 1LFUP 4JX6A 4FE4A 5K7HA 5M5XJ 2L9RA 3GBGA 3I4MJ 1JKOC 3S15J 4W1UA 3HOYJ 1JKRC 5IOYA 1UMQA 2DMQA 2X48A 3ZQCA 3HBLA 2XGEA 3BR5A 2E2IJ 3GTJJ 5BNGA 2G0EA 3HDDA 2JA6J 3GTPJ 2VUMJ 1TC3C 1RESA 2DJNA 1ETKA 1BW6A 1LE8B 2CUFA 5F27A 3S1MJ 1I6HJ 3DEWA 4NDLA 4B4CA 2LKXA 4A3JJ 3HOUJ 1FIPA 2ME0A 4M3FA 2D5VA 5DS9A 2XPUA 3JRBA 1U8BA 5F0CA 1WH7A 1X2MA 1WCMJ 3S1NJ 4A3CJ 2DMTA 4FISA 2M8GX 4AYBN 2XGCA 1T33A 2O9LA 3Q0VA 3F0CA 1MBKA 1W0TA 2M9HA 1ZK8A 2LY9A 3HGYA 2JA7J 4DYRA 1O4XA 5IPAA 1XG1A 3TW6A 4A3KJ 1U78A 3ZQIA 3OSFA 2IEKA 1GDTA 2EZHA 1Q1VA 2CQQA 2XGDA 1AKHB 1NK2P 5IP6A 3NARA 5GP9A 1D5YA 2DA7A 2HXIA 4CYCB 1MNMC 4G12A 5M3FJ 3JR9A 2E2JJ 2Y30A 2VPRA 5IP9J 4FTHA 1MBGA 1ETQA 1RETA 3LSGA 3OIOA 4A3MJ 4C2MJ 3S17J 5E3MA 3HOWJ 2MSYA 2LFBA 2NVYJ 4XRMA 1AU7A 5E3NA 2NS7A 4BKXA 3TP0A 2JA5J 3A01B 2Y9YA 3HM5A 2PMZN 1RR7A 2NVQJ 1GV5A 4DYQA 1IDZA 1S7EA 1NTCA 1FEXA 1FIAA 1QVUA 3C2BA 5J1UA 3HOZJ 1GV2A 1RKWA 2Y0SN 5J1RA 2H1KA 3S1QJ 2IAIA 2MG4A 2P81A 4Y7NJ 1B72B 1AHDP 3OSGA 2DA1A 3W6VA 2XB5A 1TWGJ 1HDDC 2DA2A 2E19A 3JREA 1MBHA 2LP0A 3WHBA 3ZQHA 3DCFA 3RZDJ 3IH3A 1BW5A 5IYCJ 4A3BJ 1ETYA 2DMUA 4XK4A 2EH3A 3ZOBA 1P7IA 3BTIA 3E7LA 3S14J 1MH3A 2Y2ZA 3OOUA 5C4JJ 2XRLA 4MO7A 5EG0B 2K9NA 1JGGA 4C3HJ 5C4XJ 1LFBA 5IYDJ 4V2FA 5EEAA 5J3LA 1ORKA 5EDNA 3GTOJ 5EGOA 3G1OA 3GTGJ 2O8KA 1ITYA 4J19A 2M0CA 2HOTA 2GLOA 5JLWA 1VNDA 1WI3A 1H89C 3BG3A 1HOMA 2JN6A 5E3OA 3VPRA 5EGOB 3GTLJ 2ZB9A 1UHSA 5C44J 1QRYA 4B1RA 4C3IJ 5M3MJ 1BJZA 1EF4A 2ID6A 4IHWA 4UUSB 1Y1VJ 2I10A 5JLXA 1ZR2A 5GPCA 1LE8A 1ETVA 2L7ZA 3QPLA 5K7FA 4FCYA 3FIWA 1XC5A 2TRTA 2EZLA 3BTCA 2K40A 2E2HJ 4A93J 1CQTA 2R5ZA 1JTYA 4BY1J 2M34A 1T56A 1E3OC 2DTZA 2QF7A 3MVPA 3FISA 1JT6A 2MGQA 3RKQA 3L1PA 2R5ZB 3D1NI 1IG7A 2JA8J 1AKHA 1ENHA 5EZGA 2ECCA 2TCTA 4D5FA 4MFDA 2LK2A 1W0UA 4B3AA 2VKVA 4CYCA 2R5YB 2JWTA 2R7ZJ 5FKLA 2R93J 2LLKA 2Y9ZA 1QPIA 3CDLA 4A3IJ 4A3DJ 4RDUA 4XIDA 2KDZA 1U9OA 4XRSG 3CMYA 2DA3A 2JMWA 4A3EJ 5FLMJ 1ZR4A 4X1EA 1HCRA 4AUXA 5FKKA 1F43A 3NAUA 5FKOA 5GPAA 1I3QJ 5F0HA 2ID3A 3A01A 5E3LA 2DA5A 3H0GJ 3M3YJ 2QCOA 1R9TJ 3HGGA 3SJMA 3GTMJ 1TWCJ 3A03A 5F08A 1WH5A 2AHQA 1B72A 1ZQ3P 3RZOJ 1RKTA 2GBYA 3WHCA 1OJLA 1TWAJ 1HLVA 2FQ4A 1GT0C 1IV6A 2FD5A 1FTTA 4BY7J 2GM4A 2B63J 3IV5A 3S16J 3ZQLA 4FE7A 4W97A 4D7NA 3JRDA 3BQZA 1ETXA 3LSRA 5FLVA 2COBA 2WV1A 3UKGA 5EG0A 4Y52J 2FJ1A 3TEDA 1DU6A 2ME6A 1A5JA 4X6AJ 2HOAA 4M3GA 4C3JJ 2CUEA 3TW7A 3FK7A 5FKMA 4I6ZA 4V2GA 2ECBA 3BR3A 1K83J 4IHYA 1BA5A 1WGXA 3ZQFA 1PUFB 2EBIA 2Y31A 3B6CA 4UUTA 2JJ7A 3Q3SA 1QVTA 3S2DJ 3I4NJ 4QIWN 2XB0X 2RAEA 3RQIA 4JX5A 1JJ6C 3LOCA 1JKPC 1BL0A 3BR1A 1MSEC 3H3VK 4A3FJ 1JJ8C 3Q0WA 4DZJA 2X6OA 2XPVA 3HKZN 3MN2A 2CQXA 1JKQC 5EYRA 3M4OJ 1RPWA 4UUSA 4A69C 3PO3J 1Z0XA 3BR0A 2R92J 2L0KA 4HNVA 1A6IA 2LD5A 4D5CA 1ZTRA 3BTLA 1SFOJ 4BXXJ 3QQAA 1WPKA 2W48A 4BBRJ 3QPSA 3BT9A 1YRNB 4L5EA 1VF9A 3IH2A 3SDGA 3G1LA 4EEFG 1G2HA 3O8HA 2LR8A 4I76A 3G1MA 5F04A 1VI0A 3JRAA 1JUSA 2CRGA 4QSHA 1VFCA 1JUMA 3K7AJ 1JUPA 1MBEA 3Q0UA 4S0HB 2AO9A 4DYCA 2NVXJ 1MSFC 3BG9A 1GUUA 4JX4A 3LSPA 3GTKJ 1Y1WJ 3FK6A 2R5YA 1ETWA 1FJLA 2MW8A 1U9NA 4RBOA 2LVSA 3SFIA 3K2AA 3FKIJ 2YU9J 2R0QC 4JYKA 4XICA 2NVTJ 3S2HJ 1TWHJ 3BG5A 2OF7A 4QTRA 2YUSA 2O7OA 1MBJA 3LSJA 4IHXA 2JK3A 2OPTA 3PM1A 2CJJA 5HODA 1APLC 1IC8A 3HEFA 5K7ZA 1B8IA 1JTXA 2K9QA 5J1YA 3ZQGA 2H8RA 3JRIA 5M5YJ 1GVDA 2NOGA 1TWFJ 2DA6A 4D7MA 3BQYA 5F0FA 9ANTA 1NK3P 3O8GA 2EQRA 1ZKGA 2N8GA 2VI6A 1UG2A 4M3BA 2L7FP 1B8IB 5EF6A 1SANA 1ETOA 4M3DA 4MFEA 4AC0A 3JRGA 3S1RJ 1ZGWA 2XPWA 3PO2J 4A3GJ 1OFCX 3JRFA 1JT0A 2HI3A 2DA4A 2HOSA 2DN0A 1IDYA 3HB9A 1HDPA 2YS9A 3BTJA 4GFBA 1PUFA 3TP3A 5IOZA 1X2NA 2ELKA 2K9SA 4A3LJ 2KT0A 5FJ8J 4DZPA 1IGNA 4IHVA 1IUFA 1MBFA 1POGA 2L7MP 3A02A 3GTQJ 4JP0A 1MH4A 4DW6A
chains in the Genus database with same CATH superfamily
3L2VA 1ZGJA 1FNNA 4XRSA 2H94A 4UV9A 2JTVA 4BAYA 1H88C 2XF6A 1I6XA 3FWEA 2Y48A 1G3SA 1OCPA 2M4GA 1IRZA 3MZHA 2W24A 3BWGA 1RC9A 2E1OA 2HXOA 5F1JA 3A0HC 4HX8A 5C3EJ 2MBFA 3CMMA 2KISA 1U0JA 2LOOA 3KYDB 4HV5A 3MKLA 3RCOA 2A07F 2H09A 3RIRA 1ODDA 1OMIA 4N9IA 2UUZA 3DTKA 3HOXJ 1O3TA 2DMPA 3E5QA 2NS8A 2CWEA 1Y56A 1R5ID 3F23A 4MIMA 4EM0B 2OZ6A 2MFZA 2HYJA 2K3PA 4OIRF 5IYBJ 3BR6A 3LNQA 4ZH4F 1LEAA 2HZTA 4A5NA 2WC2A 1P7JA 1YS7A 1XS9A 4F52A 3MQ0A 1J59A 3IH4A 3HRTA 3R60A 3MWMA 4YELA 4JX6A 4QPQA 1LFUP 5K7HA 3I55I 1BN5A 4N4OB 1V5GA 4J00A 2FA5A 2OCCH 3GBGA 4PSWA 3JTGA 1BC7C 2X6WA 3VYUB 3H35A 2V9VA 5LGUA 2DFEA 3BR5A 4HDVA 1IXSB 3C2HA 2G0EA 4LLGF 2JA6J 5CQEA 1LDDA 4L5JA 4BJ6C 2XAFA 1RESA 1HKQA 2CFOA 2PI0A 2D45A 4XBFA 2ISZA 2ZFWA 2CUFA 3K4BA 2HFHA 3OV8A 3DEWA 4NDLA 2GA2A 2LKSA 3OYGA 2ME0A 3ZPLA 5DS9A 3JRBA 2PMZA 4Q47A 4A3CJ 5D5WB 3W3CA 2XGCA 4IF4A 1X4OA 3F0CA 4UXNA 5K5RA 4B8XA 1K78A 3COAC 2JA7J 2XASA 4D0PA 1WJBA 1RRJA 3ZQQA 4A3KJ 1GXQA 4QWQA 1FP2A 1O3SA 1AA7A 1PDNC 2V1DA 1Q1VA 2LNBA 3CESA 2VJ5A 2CFXA 4L9TA 4CCJA 4P9FA 2FBIA 5HLIA 1JI8A 3I9V2 2CW0F 4U7DA 4IOAF 2Y75A 2LDUA 2BXZA 3H92A 5M3FJ 4PJJA 4ASNA 2PQ8A 1EH7A 2Y30A 3FHNA 1LKXA 4NNJA 4HX4A 2Y69H 2VQLA 2ZSHB 4A3MJ 1EJ9A 1W5SA 2JSPA 3NWSA 3S17J 1O57A 1SFEA 2STTA 2MLGA 5B5EC 3ZN1A 2LFBA 2NVYJ 2XF5A 2BZTA 1K79A 2QKMB 3A01B 2JSCA 3H1CA 3ZMSA 2M5WA 4KICA 4CCNA 2NVQJ 2X85A 3DXJF 1S7EA 3MMYB 3NWTA 3HOZJ 4UHTA 2XSJC 1RKWA 5L3BA 1JHFA 1G3TA 2HKXA 3HSEA 4ZZLA 1O3QA 2Z16A 1HSJA 3GFLA 2O3FA 2DA2A 2E19A 1VQ5I 4YG2F 1R1VA 1MW7A 1MBHA 3WHBA 5F64A 1OCOH 2P7CB 2HTJA 2R7RA 1EKEA 1P7IA 4BYYA 3E7LA 3S14J 4PJ0C 2WWYA 2XRLA 1WJFA 2OC6A 5J4YA 5EG0B 3ESWB 1QZYA 2VC0A 2L3DA 2Q2EA 2IJLA 3PNYA 3FBNB 3L2WA 4C3HJ 2FMYA 1XDSA 1BM9A 1OYWA 5EEAA 3ERED 3AG3H 3K2ZA 3LAJA 3H3UA 4WWCA 5EDNA 1IF1A 2CW7A 3IKTA 1W36C 3HTSB 2O8KA 4OU0A 4CYDA 1PP8F 1ZLKA 4J19A 5ILSA 5J8CA 4Y4RA 1Z1DA 1J7KA 5JLWA 1VNDA 1X1DA 1WI3A 2QQAA 1ZRDA 2HEOA 2GQQA 4L9VA 2OBPA 4EGYA 3FXQA 3V4GA 4U88A 5EGOB 2OCEA 4PGHA 4OIPF 2A61A 3FM5A 1K6OA 5C44J 1QRYA 4B1RA 3K4NA 2IGNA 2Z1DA 2PLYA 2ID6A 4HQEA 2BY2A 2EV6A 3FM3A 1MMDA 4UUSB 1ZRCA 3VSLA 1TBXA 2M7BA 4BE1A 1ETVA 5KAIC 3TO6A 3ZMVA 4NC7A 2CUZA 3GCMA 3CLQA 4XLCA 3ZGKA 2VQCA 3FIWA 3KLOA 2DOAA 2UXNA 2VN2A 3BTCA 2R4GA 3PNTA 5BMZA 1FLIA 3EPZA 3N97A 3F6VA 3ZQ7A 3IUOA 1W5CC 4HBLA 4BY1J 2M34A 2VASA 3S3OA 3NRVA 1A04A 3MVPA 4G6TB 1HBXG 2NNNA 2MGQA 3RKQA 3KIOA 2VL8A 1IG7A 5A2QZ 4HNUA 5EZGA 2DT5A 2TCTA 4MFDA 3GUDA 2LK2A 2K86A 3S8PA 1PJRA 4XL9A 4CYCA 3D5SC 2LREA 1V5EA 3E6BA 2JWTA 5HDNA 1BOBA 3CDLA 4PUSA 4IRHA 2CUJA 4M72A 4BS9A 3CMYA 4A3EJ 4XSZF 4BL0B 2GXBA 2DK5A 5KK1A 1XX5A 1HW2A 1QA6A 4I09A 5FKKA 1YHQI 4CSWA 1Z9CA 3IP4B 1N78A 4EJTA 3F21A 3OYIA 2DA5A 3M3YJ 5FD5A 3ZRGA 3HGGA 4BACA 2F6CA 1J0RA 3VOEA 3I56I 4IHTA 3A03A 5DEQA 2W00A 3SEZA 1E17A 2KKOA 1OISA 3VB2A 4ZTFA 5K1YA 4C2UA 2MABA 3CUQA 2FRHA 2XAUA 3RZOJ 3QP5A 1X1AA 1RKTA 4YIIA 3WHCA 3KPHA 4C30A 2W7NA 3CCLI 2NAZA 1HLVA 2FD5A 1V55H 3KCCA 2F4IA 5DCMA 2B63J 1SVMA 2V6CA 1WFXA 3ZQLA 4BJ5C 4W97A 1TT5B 3K1NA 2VLAA 1IW7F 1R58A 2BXYA 2COBA 2WV1A 2F5DA 3I71A 4ZZDA 1K4TA 3TO9A 3MD2A 3OR1C 1KQ9A 3BOQA 2EPFA 4HA8A 3GFMA 1HKSA 2K9LA 2FJ1A 2VKDA 4BHBA 3OS1A 2Y0MA 5L3CA 2V6EA 1A5JA 2JRMA 4R8HA 2ZMEB 5EEGA 3EUHA 2CW8A 2CUEA 2OZUA 1D0YA 1YG2A 4V2GA 4KT5C 4IHYA 3I59B 1G3WA 2PMHA 5FFXA 2DPDA 2XF7A 3Q3SA 5DYMA 4QIWN 2XB0X 1YOVB 1JJ6C 1MDMA 4IX7A 1XSVA 4BDZA 3L00A 2IPQX 3ECHA 1D3YA 3ABLH 4A3FJ 1JJ8C 2AQEA 2X6OA 2XPVA 3HKZN 3MN2A 4BDYA 3EYIA 1WWXA 1VQ8I 5EYRA 3DTEA 3SDBA 2JQ7A 2QQBA 3PO3J 1B6AA 3BR0A 4HQMA 4JQFA 1FMVA 2L54A 2VKHA 3G73A 3J7AO 1A6IA 5HOOA 2XC7A 2B0LA 4AYBA 2E71A 4OIQF 2L9NA 2VC1A 1IN8A 1ERDA 2FQ3A 3GZNB 3G1LA 4EEFG 4LG3A 4KDPA 2OAZA 1F9NA 1J09A 1WJ5A 3JRAA 1JUSA 3K4KA 3KEQA 2R7WA 3QP6A 3ERMA 2LBFB 1TQMA 3FXUA 1MBEA 2E1NA 4II3A 4KUMA 3LA3A 3PQKA 1I1SA 4ZDOA 4S0HB 3LSHA 4DYCA 5KAFC 3LFUA 3F8FA 3SQNA 2VOPA 1IXCA 1KU7A 1Y1WJ 1T0FC 1WRJA 1YE9A 3FK6A 5CLSA 3RPQA 4OMZA 2MW8A 1U9NA 2E7WA 3ABKH 2BEOA 4S05A 3LAPA 3FXLA 2F4OB 1XSDA 4E4HA 2R0QC 1EH6A 2E34A 4IQJA 4ZYEA 3CO6C 3OYFA 1MBJA 4OMYA 2D2WA 4HPQA 4YFKF 5FFZA 4EVIA 5HODA 1QHHD 2H1LA 2XGXA 3M7GA 4NHJA 2QEXI 3HEFA 4I7HA 3RDIA 2PG4A 3CC4I 4KIFA 5M5YJ 2HGCA 4XOPA 1Y0NA 2KLOA 3T5XA 5LEJA 2LF8A 2JPBA 2DA6A 3E6DA 4D7MA 3FBIB 5IT3A 1NK3P 3DPUA 2EQRA 1ZKGA 1VQPI 1U5TB 3H9QA 1D8KA 1SD5A 2IS6A 3BJOA 4RGXA 1UAAA 1REPC 5EEHA 2GWRA 2Q8KA 2V1UA 1ZGWA 3PO2J 3BP8A 4A3GJ 1XTAA 2MLKA 1JT0A 4PFOA 3DLLF 1WKMA 2DA4A 4BEHA 1XCVA 1WHUA 2HOSA 2M7AA 2OV7A 3U2RA 1MNDA 3QPTA 2OD5A 3C1DA 1YI2I 4GFBA 1Y6IA 2DT6A 4L0ZB 5LHHA 2KIMA 4G9YA 3DFGA 4E7HA 2ELKA 3H5AA 1J75A 3GFIA 2KHMA 3FMQA 3LSTA 2L7MP 1JHHA 1LQ1A 3G3ZA 1ZELA 4DW6A 2NYXA 1DU0A 1U8RA 4DQ2A 3DPLC 4FASD 5EJCA 4MLOA 1RI7A 2DMNA 4ZYGA 3GLXA 2ESNA 2K5CA 5CVIA 3RKWA 3B6AA 5BPIA 4Y33A 1Z77A 1X58A 3CO7C 3KP3A 4M6VA 3VEPA 4ENJA 2IBDA 1OCTC 2JT1A 5IP7J 2HDWA 3KP6A 2CV1A 2ISYA 2HS5A 3WTZA 4AM3A 4LOCA 4FQGA 1Y39A 5FRNA 4RGRA 2ZNYA 5EZHA 2V4JC 3AG4H 4ABZA 2EZIA 2X6YA 2KRFA 5HNFA 2LY2A 2OQRA 1K61A 4IQ4A 3TKYA 4CO8A 5HVQC 4A5MA 4BU2A 4IO9F 4CCOA 1KONA 4G94A 1DGWY 4A6EA 5M5XJ 2HKOA 6PAXA 3WTXC 4M9XA 5ILUA 2RDPA 4RAFA 1DUXC 2BVLA 1R1TA 3HOYJ 4UY8I 1DGRM 1JKRC 1XGNA 1KYWA 1UMQA 2HR3A 2X48A 4IHSA 3A0BC 2XGEA 4LG0A 2E2IJ 1W7PD 3HDDA 1OYYA 1G3YA 2EFWA 3GTPJ 4MGRA 5LEKA 1TC3C 4RGUA 4DOZA 4KMFA 3MEXA 1XMKA 2PN6A 2ZNZA 2F48A 1VQ4I 1LE8B 4XMYA 1I6HJ 1A31A 2L9SA 3DEEA 3FDYA 2R3SA 4RB2C 4FHTA 4CCKA 2KRHA 1L0OC 4IOCF 1KA8A 4AU7A 3A2KA 4ZC3A 2GA1A 2XUBA 4NUBA 2BBYA 3OYHA 4BXUA 3Q0VA 1WSUA 3OIPA 4N0BA 4B47A 2M9HA 1ZK8A 2LY9A 4DYRA 1O4XA 1XG1A 1TZLA 1GLNA 1OQYA 3TW6A 3DBRB 1U78A 4OAYA 1BI2A 2A3SA 3F8BA 4HEA2 2M1BA 5HLHA 3OSFA 2Z9OA 2MC4A 3OYDA 1A35A 1AKHB 1UB9A 4NBQA 1BIBA 1GHCA 1S8NA 3QYFA 2DLLA 1D1BA 1SD4A 3TBIA 5GP9A 3QYEA 2DOEA 4N4NB 1D5YA 2DFHA 4RLQA 2HVRA 1WJDA 3JR9A 1J2XA 3HRMA 3M9AA 2E2JJ 3HL2A 3CCMI 3G2BA 3CLOA 3DU6A 1UELB 1OR7A 1ETQA 4FTHA 1A36A 1MGTA 1RETA 4K2EA 3OIOA 1FWZA 2V26A 2EA2A 3RSNA 5GADJ 3HXLA 4P9UA 5CVUA 3Q9SA 3NQOA 1YO5C 4XRMA 5E3NA 3KYCB 2DW4A 2HOEA 4XR6A 3B73A 2PMZN 1RR7A 2YX7A 1GV5A 4P5OA 2X1CA 1PVEA 1BOAA 1MMNA 1TNTA 2K7LA 2M8EA 1QVUA 4EJUA 1FEXA 3L2CA 1GV2A 2Y0SN 2IAIA 2HVQA 2P81A 3F6OA 2BVMA 4Y7NJ 5DDGA 5BPDA 1B72B 3LA7A 3W6VA 2XB5A 1TWGJ 1HSTA 1VQLI 4CZZA 1Y0UA 2LP0A 3OS2A 3ZQHA 5LRRA 1BW5A 1F1ZA 3R0JA 1OCRH 1UHMA 2R7SA 4GYGA 1ETYA 3O3KA 5D6FA 2IGOA 3UNGC 2EH3A 3DKWA 5D4SA 3BPVA 4XLPF 1MH3A 3V42A 4JK1X 2Y2ZA 4FX4A 2X1EA 5E1ZB 3TL4X 2VBZA 4A0YA 3FXRA 2FU4A 1NG6A 5L3GA 1JGGA 2IS4A 5D5XB 2XVCA 2XKOA 2ZKZA 3E3VA 1G8XA 4UVAA 3RYPA 4DJAA 5BQTA 1XSXA 2KL4A 2E5NA 3K70D 3PFYA 2HTSA 2P4WA 5J3LA 1X1PA 1KYZA 3GTOJ 5EGOA 1P2FA 3GYHX 1USSA 4PGGA 1D8JA 1TQIA 4ESBA 1ITYA 1YFHA 2M0CA 2HOTA 5ICEA 1O7LA 5J4VA 1IXRC 3BG3A 3F8CA 3HYIA 1YW9A 5ICCA 4WX9A 2EIKH 3ELKA 1ZG3A 3F22A 4HOBA 4C3IJ 1XCBA 3BZ6A 3AL0B 5HS8A 3V7RA 2W4SA 3BY6A 4IHWA 1Y1VJ 1ZHFA 1R22A 1G59A 3OYAA 2PFBA 2L7ZA 3QPLA 3KLNA 1T38A 4LK0F 3ZXSA 1B4AA 4A6DA 2A05A 4FCYA 1XC5A 1X4PA 2TRTA 3V7SA 2FNAA 4XLFA 4KNYA 5J6XA 1CF7A 2E2HJ 2DTRA 3SXYA 2R7OA 3IWFA 3CZ6A 1OCZH 1X3WB 2CS3A 3I54A 4XLNF 4E7IA 2QSHX 4IKFA 4UUVA 2X51A 1FSEA 3I58A 3OYKA 3EETA 3ROUA 3RYRA 1ULYA 3VODA 2DTZA 4ZTJA 2FMLA 2DPUA 1JT6A 1N75A 4I98B 4X0GA 4RMNA 3L1PA 1HC8A 2OJED 3KX2A 4FX0A 4GXOA 1FYLA 2PJRB 2A6TA 3BCBA 4KT6A 2HDCA 4D5FA 2F5CA 2DFIA 1V3FA 5AONA 3T8TA 2QSFX 3KP7A 2JRTA 2VKVA 2HNHA 4ENKA 5E17F 2R5YB 4YIRX 2VB6A 1IN5A 3E5XA 3VDXA 4XIDA 2ZO4A 1YX5A 3I4PA 3CCUI 1YYVA 2L4AA 3ASNH 4XRSG 3LL7A 2DA3A 2JMWA 5LD2C 2L4MA 3MZYA 2MH2A 4KITB 1OCCH 3CJQB 3AKZA 4M71A 2WADA 1LUJB 1F5TA 3WU0A 5GPAA 5F0HA 2ID3A 1W4MA 4OWRB 3HOSA 1MZBA 2CH0A 4BQQA 5FROA 4XSXF 3GZ5A 3WE3A 1FOWA 3SJMA 3GTMJ 1FBSA 2W82A 1TWCJ 3DF8A 2UWMA 1S5LC 1D5VA 2AHQA 4B43A 1YITI 1VQMI 2DK8A 4HLXA 2BW3B 3EQLF 4DIQA 3CCRI 2GBYA 1OJLA 1FBUA 4BHCA 3QU3A 1LPQA 4IPAA 2PEXA 2GIVA 2YSRA 3QWLA 2JPCA 3TGNA 4EM1A 5GTIC 3L09A 1WVRA 2ZMEC 1O7FA 3QOPA 3IV5A 2XAGA 4FE7A 2HQRA 2YPRA 1R1UA 3BQZA 4D7NA 3JRDA 3LSRA 2QQ8A 2ZMEA 2IA2A 5FLVA 1ONVA 4D9JA 3UKGA 2CQNA 2DI3A 2XROA 3FXJA 2NS0A 1W1WE 1YW7A 1MNEA 3TEDA 1DU6A 1T08B 1MMSA 2UXXA 3W6KB 2E35A 3L2UA 1JE8A 3KE2A 3LA2A 4I6ZA 2ECBA 1LEBA 2XIGA 1BA5A 3K0LA 3ZQFA 1AOYA 2A5WA 2EBIA 2FNPA 4UUTA 2JJ7A 1LVKA 1QVTA 3S2DJ 5GAHJ 3I4NJ 4JX5A 4BHPA 3K1PA 3GX4X 1BL0A 3BR1A 5A2QK 4RM2A 3WU1B 3S3MA 1VQ6I 3L9FA 2STWA 1BJAA 4CA0A 2EV0A 2RV8A 4DZJA 4CXFA 2KZGA 2CQXA 1I1GA 3PUFA 1G6NA 3M4OJ 4GRIA 1SFXA 2R92J 2L02A 1DQUA 4HNVA 4QLCU 1S7AA 3T1BA 1KQ8A 1Z3YA 2H6BA 1ZTRA 2LD5A 2DU9A 1SVLA 1T98A 5DUIA 2Z5UA 2K4BA 4BXXJ 3QQAA 1WPKA 3CUOA 1IRFA 2W48A 3E97A 2HQNA 3BT9A 5E79C 4L5EA 3RKXA 2F2EA 4O6JA 4M74A 3SDGA 4M6YA 1XMXA 2RN7A 1VI0A 1LDKB 4BE2A 3OS0A 1VFCA 1JUMA 4MQ9F 3EDPA 1JUPA 1FC3A 1P4AA 2K02A 3FZVA 3GMEA 2Q1ZB 4I02A 2BV6A 1KU3A 2VBYA 3V7CA 1MSFC 4JX4A 3GTKJ 3OWTA 2IVMA 4OIOF 3LSMA 1CGPA 1XGMA 2HQAA 4XORA 4WXCA 3CCVI 2K9MA 4G7HF 4GCVA 2O61A 3CMEI 2ZJQF 2O03A 4IVNA 4RBOA 3PJRA 1S6LA 3FKIJ 3P9IA 2YU9J 4JYKA 4ON0A 3E6CC 1R49A 1YQAA 5AIPA 1QBJA 1IN6A 4GYIA 1N77A 2YUSA 2HYGD 2I5UA 1DPUA 5D5VB 4XN0A 2RREA 4HSTA 5LFAA 3RQ4A 1U5TC 4U87A 4CUGA 3ZP5A 3FX3A 4I01A 5GAGJ 3BG6A 1K4SA 2VBWA 2K9QA 2DYSH 2H8RA 3BROA 2DODA 2K3FA 3G4SI 1GVDA 5CYVA 5D6EA 1TWFJ 2QQ9A 3FHZA 3BQYA 5F0FA 2RQPA 3KP5A 3QPHA 2N8GA 3U21A 3ZMTA 1K78B 1R7JA 1FPQA 1SANA 3I64A 5E1XA 4AC0A 3JRGA 3S3NA 2PX9A 2BYVE 1P9QC 2HI3A 1ON1A 2NRAC 2K85A 2WAQA 4EQQA 2OQGA 2M3AA 4MHGA 1QGPA 4LD5A 1QQIA 2O5RA 5E8GA 2P0WA 3W2WA 4O3MA 3HB9A 1HDPA 3OOPA 4H4KC 2Z33A 2YS9A 2DYRH 4LLLA 2FSWA 5L3DA 1PUFA 2P6SA 3TP3A 1X2NA 1I27A 3DBLB 1BR1A 3EUAA 3TO7A 5HLTA 3IKVA 3IAS2 3QAHA 4PJNA 4Y17A 1POGA 3GTQJ 2BE5F 1MH4A 4A3IJ 2ZSIB 1T8IA 1I5ZA 1X19A 4G6QA 2WB1N 3WTSC 5LHGA 4IJAA 2GXGA 3HSFA 3CQZJ 1FZPB 2XV4S 1ZG1A 2G7UA 1IJWC 1I50J 2L9VA 3DP7A 2XSDC 4U0VA 2H8WA 3A1YA 1FMWA 3DTIA 3K6GA 4ZDPA 3N4MA 1Z7UA 1MJBA 1Z05A 3CCYA 4NQWA 2KFDA 1Z21A 2X9DA 3E6MA 3SZPA 3O6BB 2F5FA 2W57A 3OYLA 3BLYA 5HNHA 4ZYDA 2E5ZA 5IY5H 1YRNA 2QBYA 4R79A 5IT9K 3HOVJ 1WJEA 2HQ5A 5M5WJ 1EV7A 2EZKA 5FKNA 3CCEI 5FB2A 3BR2A 4RLFA 1VQ7I 2FF4A 2Q2EB 5FO5A 1HF0A 2CU7A 3KZZA 4Z2YA 4L0YB 4Y13A 3AG1H 4IZZA 2COMA 4LITA 1JXSA 1XMAA 2VKEA 3GW2A 4FE4A 2DJIA 3LQRA 3E0JB 1W36D 5HDKA 2VIXA 1M1EB 2AXTC 4F93B 2L9RA 1E2XA 2XAJA 2EJRA 4L9JA 1JKOC 3I4MJ 1V4RA 4CGZA 2ZCWA 1FX7A 3ZQCA 3HBLA 2QLZA 1TW2A 4RS8A 3TMOA 3OYBA 1T0FA 2EWNA 3L2QA 2MC3A 4F3QA 4V19K 2VUMJ 2CQ7A 2CO5A 3CJNA 4KN7X 3WTWC 1ZARA 5LBQA 1SC7A 3R4KA 4DBRA 3KEYA 3VSKA 1YJNI 3S1MJ 3CP2A 2LKXA 1B9NA 4G7ZF 4M3FA 2D5VA 1Z6RA 2XPUA 3MAJA 2TDXA 2WTEA 5IT9Z 4ETSA 5F0CA 1WH7A 2DBBA 1WCMJ 2OTJI 2DMTA 3OR2C 4FISA 3ABTA 3DPTA 2O9LA 4M9SA 1MBKA 3GLLA 2IRFG 1W0TA 4MTEA 3HHHA 4H0EA 3REOA 2V7FA 2ZJ2A 1T95A 3WGGA 2XAHA 4AIDA 4MQVA 3SEQA 4FT8A 2IEKA 2EZHA 2FBHA 3GF2A 2CQQA 2XGDA 2EIMH 3H5NA 5K5QA 1FY7A 4RAZA 4LB6B 2R7VA 2FOWA 5L3FA 2Q0OA 4PDKA 5H6QA 4CYCB 3LMMA 4G12A 3BZCA 4CDGA 3B02A 4HRIA 3OYEA 5IP9J 1ON2A 2QWWA 3ASOH 4LK1F 3CD6I 1I3AA 1U3EM 4XNFA 4C2MJ 1LNWA 1TTYA 2RKHA 3WG7H 5JVTA 3HPHA 1KU9A 4RB0A 4MTDA 2ZXHA 4ZYAA 5H2FC 5JVGF 4LIUA 2NS7A 3TP0A 2L7KA 2Y9YA 2EV5A 4CZCA 2P6TA 4OAZA 3PSFA 1IDZA 1USTA 4KIBA 1ZREA 1IO2A 2H1KA 2QENA 2R7UA 4XKVA 1O3RA 1AHDP 2B9SA 3OSGA 3CUQB 2DCEA 3I53A 4B44A 3P7NA 1FP1D 4HYEA 1P6RA 3OYNA 3K1MA 3RZDJ 1LB2A 2LSOA 3DCFA 3IH3A 3S2WA 1SMTA 4B48A 4WXDA 4L5IA 3WTVC 1DDNA 5DCMB 4HSRA 4BUPA 2A68F 1MD0A 3ZOBA 3BTIA 3TDZC 1XB4A 2DQRA 5C4JJ 3CDHA 4AIKA 4MO7A 2MA3A 2X1DA 3TOBA 4J01A 1YTYA 1S29A 2QGUA 1OKRA 2Z3YA 4U0WA 5BOXA 3KEOA 1IN7A 2ZC2A 3IAM2 4ESJA 3AG2H 3PIOF 1SD6A 3C7JA 1RIOH 2P5LC 2C6YA 4UV8A 3QODA 3SFZA 2IP2A 1BC8C 3G1OA 2ZXIA 3CCSI 1MDMB 4KFCA 2M45A 2GLOA 5B66C 5JI6A 1H89C 1HOMA 2JN6A 5E3OA 1G4DA 2JZYA 3LSIA 2O6GE 2ZB9A 4ZDLA 2IW5A 3FMSA 1BJZA 1XDUA 3W2AA 4OOIA 3HTUA 4HDUA 2P7VB 1KU2A 3BPXA 3JW4A 3FMRA 3Q5FA 2NVUB 3ZMDA 3FF5A 4F91B 2UZKA 4GO1A 2EZLA 4I99C 1Z3XA 1K7AA 1S9HA 2QM3A 1W7PB 3DU5A 4A93J 1CQTA 1JTYA 1UZCA 2PJRA 3LQQA 2EINH 1Y8QB 1R5GA 3H9JA 4YEJA 1T56A 2HYFA 2VJIA 2HZDA 3PSIA 1E3OC 3BC8A 5D4RA 2V9KA 4EV0A 5B1AH 3ML6A 3CCQI 2R7QA 2BHYA 1NH3A 2X6XA 2R5ZB 4A2UA 3D1NI 3OYCA 1YW8A 1WJAA 2WA0A 5E8IA 5KHDA 1UCRA 2K27A 2ECCA 2VOOA 3U1KA 3RPUA 3BDDA 1W0UA 2CYYA 1RUOA 4HX7A 3M8EA 2NNYA 4B3AA 1KGSA 4G6DA 4CCLA 1P92A 2R7ZJ 5FKLA 2R93J 3H0DA 1QPIA 4A3DJ 1YJ9I 3OL4A 4RDUA 1U9OA 1XGOA 3F3XA 5F6FA 5TRDA 5FLMJ 5LHIA 4X1EA 5ILVA 3HUGB 4MEYF 3J80Z 1EA3A 3J7ZI 1HCRA 1F43A 1TLHB 3NAUA 2F4MB 5FKOA 2FE3A 3BJ6A 4F7ZA 2KQRA 5FLXK 2D1HA 4BH9A 4KN4X 3R61A 2X0LA 1X3ZB 2M4KA 2BHZA 3A01A 1PP7U 1L3LA 2QCOA 4Z6YA 4PJLA 2RGVA 3OY9A 2KIUA 2I8DA 4ENNA 2HPIA 4LLNA 2F5EA 3JAMK 5F08A 2H6CA 3DEUA 2E36A 2R7FA 2KRCA 4AIHA 1B9MA 3N05A 5JHFA 4XKBA 1GT0C 1FTTA 2VQGA 2DDBA 3A4CA 3PFIA 1F4KA 2AQFA 1HKTA 4IXAA 4DGWB 1B1BA 2EIJH 2EFNA 1QPMA 1HQCA 5EG0A 3JSPA 3E1SA 4BEHB 3BCAA 3D5LA 2K4JA 1RZ4A 5E20A 1SAXA 4GGGA 1ZN2A 4Y15A 4EJOA 3DQVC 5FKMA 4S04A 2MD0A 3BR3A 4PCQA 5TGTA 4CHUA 3JSOA 3CTAA 2ZJPF 4UVBA 3RTRA 1LVAA 1IRXA 3CP8A 5FLXZ 2M0MA 2OU2A 2P8TA 2RAEA 3RQIA 4RB1A 3LOCA 1E3PA 1U6GA 1JKPC 2XHKA 3MCZA 4M6XA 1KZHA 1MSEC 4BNCA 1S72I 2CG4A 2BY1A 3FXKA 4JBAA 3JAMZ 2QKLB 1ZRFA 3M8JA 1JKQC 2KP6A 2ZBKA 4WCGA 4HAMA 1Q1HA 2R7XA 5FD6A 4UUSA 4E7ZA 1Z0XA 2L0KA 2VE8A 2E7XA 3Q9VA 4XLAA 3AAFA 1W5TA 2FXAA 4PFPA 4P1WA 1SFOJ 5E1WA 2A5YB 2DAOA 4BBRJ 5ICGA 1SFUA 2JA2A 2E1MB 1G2HA 2LR8A 1PUEE 2X4HA 2KJBA 1ZYRF 3J81Z 1RUNA 2CV2A 3K7AJ 1D0ZA 3HG9A 3ONQA 3Q0UA 2GIZA 2AO9A 2EILH 1GUUA 2RVCA 5B1BH 3WGHA 4E7SA 1VQOI 3IL2A 5DCFA 1SEUA 2VONA 1V54H 4Q4ZF 2XKPA 2AXLA 3PNVA 1YJWI 1ETWA 1HW5A 1FJLA 4R1HA 3HOTA 3KP2A 4Q5SF 3WTUC 3SFIA 3K2AA 1IV8A 2VE9A 5AIQA 1D0XA 4DBQA 4KISA 5J47A 1XGSA 4LG0B 4XICA 2RNJA 1MJAA 2WY7Q 3IC7A 2HVSA 4M9ZA 1TWHJ 2GZWA 2GOXB 3BG5A 3NEUA 5E18F 4QTRA 2L2OA 4UVCA 3QU6A 1VZ0A 4E7LA 1STZA 2Z99A 5HS9A 2HWVA 2MYSA 3LSJA 2KIFA 1YLFA 1R23A 3M1CA 5TJJA 4LJZF 1APLC 2Y0SA 2BY3A 4RA2A 4LMYA 4KIGA 2EK5A 1JTXA 3ZQGA 1WI9A 1RR8C 3JRIA 2A69F 4PJMA 3K69A 3OL3A 3RPUD 3HZJA 2O0YA 3HPGA 3HC7A 5JHUA 3MKZA 9ANTA 1Z7LA 2VI6A 5CVRA 4KMUX 2L7FP 1B8IB 2LH9A 5DM6F 3QYBA 1TT0A 4XLEA 3K4MA 5EF6A 1E0EA 1ETOA 3S1RJ 1ZH5A 2PBIA 2DQLA 4XLHA 3V8LA 3CF5F 4B09A 2EFPA 4M73A 2DN0A 4I0AA 2ESHA 1IDYA 2W1OA 1GXPA 4GDFA 5LLQA 4XKCA 2WV0A 4AWXB 1X1BA 2CGPA 5B3SH 2ZXWH 1WQ2A 2YU3A 1K6YA 1FOXA 1YIOA 3L2RA 3PIPF 3CF2A 3I59A 2LF7A 1LJ9A 3FXOA 4IL6C 5J40A 3KZYA 1R6RA 2K9SA 4A3LJ 2KT0A 5FJ8J 3IRRA 5H6RA 1IUFA 1MBFA 1QHGA 1ZAOA 2FEZA 3A02A 3RJPA 4BQOA 5J8FA 4JP0A 1IZ1A 3CC7I 1OYIA 4LB5A 4AIJA 2LTPA 4EJWA 4BXFA 3KZIC 1QO0D 2VJJA 4HW0A 1JGSA 2FX0A 2XAQA 1MMAA 3HSRA 4XKWA 2A6EF 3JRCA 2M87A 5LGTA 5HDGA 3JTHA 4PZJA 2LRDA 3DV8A 2M2EA 1HA8A 3CJTB 2D1VA 1N25A 2DDAA 3SZGA 1H8AC 1BI1A 3I3LA 3IWZA 5DV5A 2HDDA 1U2WA 4XQFA 1DP7P 4G7OF 4NC6A 3GXOA 4BBSJ 1ACIA 3HRSA 3VYTB 5DTDA 2WAQN 3OMYA 4UB6C 2WBMA 5DD8A 3G71I 4IEJA 2DT7B 1FTZA 5L3EA 2M30A 3D5RC 4M3EA 3OIQA 2E1CA 4IRGA 5FGMA 1F36A 3MZ8A 4C2TA 2LBFA 3F8NA 2QZ8A 3D0SA 3DBHB 1IAWA 4C9YA 4BGDA 1BR2A 4IRIA 5ICFA 1I39A 3JRHA 1Y8RB 2L01A 4ENMA 3X2QH 5DM7F 3C18A 4L9NA 2KPMA 4E7KA 4E70A 1H0MA 3S15J 4RM3A 4W1UA 4HF1A 4ITVA 5IOYA 4F55A 4EGZA 2DMQA 2AS5F 5ED4A 1TNSA 2LY1A 3GTJJ 2VQHA 2VXZA 5DUKA 5BNGA 2BY0A 4N9HA 1IRGA 3EYYA 3FXMA 2DJNA 1ETKA 2FUG2 1BW6A 5CVJA 3S32A 5F27A 2CSOA 2JVHA 4F92B 1DP3A 4B4CA 2BGCA 4RAYA 4A3JJ 3HOUJ 5KNLA 1FIPA 5KCMA 1U8BA 1SAUA 2XRNA 1CF7B 1X2MA 3S1NJ 3U9GA 2M8GX 1TW3A 4AYBN 3PL8A 1T33A 3K4CA 3OYJA 4WF2A 1U5TA 3HGYA 1VQKI 5IPAA 2RC4A 1UHWA 2VJ4A 1SD7A 1TQPA 1SVOA 4LFUA 3ZQIA 3M1EA 4KA4A 1GDTA 1LFPA 2QYOA 1NK2P 2J5OA 5IP6A 3NARA 1R4MB 2DA7A 2HXIA 2ZXJA 1MNMC 1VQNI 3HRUA 4I2OA 5TISC 1AWCA 3U1DA 2VPRA 5CKTA 3K9TA 4EMSA 1MBGA 4YFNF 3LSGA 4HV6A 1BI3A 1R71A 3WE2A 3F72A 1Z6TA 3P9KA 4RAGA 2VT2A 2H27A 5E3MA 2ICWG 3HOWJ 1DPRA 2MSYA 3G6EI 3CUQC 3ULQB 4AVZA 3H9GA 1AU7A 3WTTC 2KZVA 4BKXA 2JA5J 1TP4A 3HM5A 3F9KA 2DO7A 2OUMA 3I0TA 4A0ZA 4DYQA 3BG7A 4MEXF 1NTCA 1FIAA 3C2BA 5J1UA 1MKMA 4E7JA 5J1RA 2Z2SB 3GO5A 3S1QJ 4P96A 2L5QA 2MG4A 2V9PA 1XN7A 2DA1A 1FBQA 2EB7A 2ETHA 3M8FA 1HDDC 1P4WA 3MKWB 3JREA 2QSGX 3ABUA 3CJRB 1P4XA 2XDVA 3V8JA 5IYCJ 4A3BJ 3EUHC 2DMUA 4XK4A 3JCUC 3PUBA 4Y3OA 5ERIA 1BBYA 3LSKA 3OOUA 3R6SA 3I5UA 4XM3A 2V1NA 2IXSA 3RI4A 1R00A 3ISPA 4CICA 3W2VA 2K9NA 4A0XA 5JR3A 5C4XJ 1NHAA 4HG2A 1LFBA 5IYDJ 4V2FA 4JOMA 2OTLI 4WXHA 3UR3C 2IS2A 5CVVA 1ORKA 1X3UA 2KJCA 1UG0A 3GTGJ 5H20A 2ACJA 3CMAI 2PMUA 2WY8Q 3K10A 1B59A 3T8RA 3TOAA 2RQQA 1QZEA 3VFZA 4II2A 3VPRA 2VPLA 3GTLJ 2IT0A 3GZ6A 1UHSA 4B3XA 2JUCA 5M3MJ 3ZMUA 1EF4A 3FKJA 2I10A 2DXIA 5JLXA 1ZR2A 5LGNA 5GPCA 1W7PA 1LE8A 2YR2A 4CH7A 5K7FA 1BI0A 2CMPA 2HU9A 5KVRA 2MD5A 3SYTA 2DOFA 4KJZA 3SHFA 5JFRA 2K40A 1QNTA 2R5ZA 3MKYB 4OINF 5GTHC 2EFQA 2A6HF 2E60A 1T39A 1FSHA 1FYMA 2R7DA 2QF7A 3FISA 4HLYA 5FRMA 4ANJA 3H5RA 2JA8J 1AKHA 1ENHA 2ELHA 4YIFA 1E3HA 1YS6A 4PSXA 2B7EA 4XOTA 1XPXA 3HUGA 5CJ9A 3V8KA 4LGWA 2LLKA 2Y9ZA 3DKYA 3J7YJ 2KDZA 3H36A 4PK4A 5DD4A 5BS6A 3E5UA 5K5OA 1ZR4A 4I0BA 2UV1A 2WB1A 2W25A 2IS1A 2LC2A 1ZG5A 3IHUA 4AUXA 5HLGA 1SFKA 1X1CA 5CPRB 2CQKA 1I3QJ 2P5VA 1ZLJA 1YX3A 5E3LA 1R36A 4P55A 3H0GJ 3WGIA 3VWBA 3TQNA 1R9TJ 2ELJA 1C0WA 3CCJI 2LYCA 2W84A 1RNLA 1WH5A 3HKZA 1B72A 2KDOA 1ZQ3P 4XN3A 3VYSB 5F1RA 3IRQA 1TWAJ 2FBKA 2FQ4A 3ABMH 1IV6A 1NG7A 4NB5A 4BY7J 5D8KB 1YIJI 1GVJA 4YFXF 1FYKA 2GM4A 1J9IA 5D8LB 3S16J 2G9WA 3DKXA 1ETXA 2ADUA 3HJEA 3EUKL 1FOYA 4LIVA 4HF2A 1WZ2A 2LMDA 2QUFA 4Y52J 1OPCA 3TDUC 3QOEA 4XRFA 2VT3A 2ME6A 1VQ9I 2KMUA 4X6AJ 2HOAA 4M3GA 3S93A 4C3JJ 3R0AA 3C2GA 3PQJA 3FK7A 3TW7A 4O5VA 1WJCA 1K83J 5HS7A 3W6JB 4D1QA 1WGXA 1PUFB 1R4NB 3K70C 3P5JA 4ZJZA 2Y31A 3B6CA 3KYLA 2GXAA 2ZFUA 2VODA 3QRFF 3HIFA 2JUGA 1PYVA 2F5VA 2GOMA 1T2KA 2VBXA 2OA4A 4NC8A 4TV7A 3BJAA 3P9CA 3H3VK 1SMYF 3DLAA 3Q0WA 2VXDA 4UNOA 3AL0C 3GWZA 2V1XA 2IGMA 3LFKA 4BJTA 1IUYA 4EM2A 3K4LA 3MFKA 1RPWA 2V79A 3SZTA 3AFHA 4A69C 2JVGA 2E1MC 3T0YA 4BQAA 3J7AY 1S3JA 3O2PE 3GFJA 4HNTA 4HF0A 4NQWB 4D5CA 3BTLA 1MJ9A 4ESFA 4YRVA 3KP4A 3J80K 4KYWA 1HW1A 3HHGA 4AVPA 3QPSA 2WAFA 2HPMA 3K4JA 1YRNB 1VF9A 3IH2A 4ZYHA 2LKPA 2QBYB 3KFWX 1QU3A 3O8HA 1BIAA 4I76A 3G1MA 5F04A 2EA4A 3WG9A 1A6QA 2PJPA 2CRGA 4QSHA 5CQGA 2R7TA 3ZMZA 3C3WA 2G7HA 4U0YA 2RNGA 1EH8A 3WU2C 2IA0A 1R5HA 1QZZA 2NVXJ 3BG9A 4G8XA 3LSPA 2W85A 3OYMA 2DFFA 3ZR8X 1H9TA 2FOKA 2R5YA 4Q48A 2NXNB 4DNCA 1OLTA 4QPOA 1S7OA 2LVSA 4RB3C 4FETA 3VYRB 3KETA 4BQNA 2LG4A 1FT9A 1T6SA 4RGSA 3ECOA 2NVTJ 2MH9A 4A12A 1FOKA 1ZGAA 3WODF 3S2HJ 1Z67A 3ZN0A 2OF7A 3L7WA 4HZFA 3DWLE 2GAUA 2O7OA 1MIJA 1D1AA 2NOJB 3BZKA 1H9GA 2YX4A 5D5UB 1TL8A 4IHXA 2WAEA 2QA4I 2JK3A 2OPTA 3PM1A 2CJJA 3GVAA 1V5FA 1IC8A 1J5YA 1MMGA 5K7ZA 2IA1A 1B8IA 2KIQA 5J1YA 2NOGA 2BW3A 1UFMA 3F8MA 4WK8F 4MNUA 1KQ0A 1HXDA 3O8GA 1UG2A 4M3BA 2EFOA 2O8XA 4L18B 4EJVA 4CCMA 1XD7A 4M3DA 2J5PA 4MFEA 4U7BA 3WTYC 2XPWA 5GAEJ 1OFCX 4AD9A 3JRFA 1Z91A 4UB8C 1VTNC 1BR4A 1OR7C 2CV0A 3ZCOA 2BOLA 4XONA 4BE0A 2QVOA 2P5KA 3CC2I 1UJ8A 1D1CA 4EATA 3GEZA 2ZJRF 3BTJA 4E6KG 3LWFA 1LDJA 5LRSA 5IOZA 2IGKA 3CDIA 3J81K 4DZPA 1IGNA 4IHVA 3H3ZA 3RKYA 3M07A 1IN4A
chains in the Genus database with same CATH topology
2WB1N 2LTPA 1DU0A 3CQZJ 4XRSA 1H88C 4MLOA 1OCPA 2DMNA 1IJWC 1I50J 1IRZA 2XSDC 2FX0A 2E1OA 2HXOA 5F1JA 3JRCA 5C3EJ 3B6AA 2M2EA 3CCYA 3MKLA 1Z77A 1H8AC 1X58A 2HDDA 2X9DA 4M6VA 3HOXJ 4BBSJ 2IBDA 1OCTC 5IP7J 5DTDA 2DMPA 2WAQN 2NS8A 1YRNA 3HOVJ 2HQ5A 4LOCA 4MIMA 5M5WJ 4IEJA 2EZKA 5FKNA 1FTZA 2HYJA 3BR2A 5EZHA 4M3EA 5IYBJ 3BR6A 3LNQA 1F36A 1HF0A 4ABZA 2EZIA 2CU7A 1P7JA 1XS9A 1K61A 3IH4A 2VKEA 3JRHA 1LFUP 4JX6A 4FE4A 5K7HA 5M5XJ 2L9RA 3GBGA 3I4MJ 1JKOC 3S15J 4W1UA 3HOYJ 1JKRC 5IOYA 1UMQA 2DMQA 2X48A 3ZQCA 3HBLA 2XGEA 3BR5A 2E2IJ 3GTJJ 5BNGA 2G0EA 3HDDA 2JA6J 3GTPJ 2VUMJ 1TC3C 1RESA 2DJNA 1ETKA 1BW6A 1LE8B 2CUFA 5F27A 3S1MJ 1I6HJ 3DEWA 4NDLA 4B4CA 2LKXA 4A3JJ 3HOUJ 1FIPA 2ME0A 4M3FA 2D5VA 5DS9A 2XPUA 3JRBA 1U8BA 5F0CA 1WH7A 1X2MA 1WCMJ 3S1NJ 4A3CJ 2DMTA 4FISA 2M8GX 4AYBN 2XGCA 1T33A 2O9LA 3Q0VA 3F0CA 1MBKA 1W0TA 2M9HA 1ZK8A 2LY9A 3HGYA 2JA7J 4DYRA 1O4XA 5IPAA 1XG1A 3TW6A 4A3KJ 1U78A 3ZQIA 3OSFA 2IEKA 1GDTA 2EZHA 1Q1VA 2CQQA 2XGDA 1AKHB 1NK2P 5IP6A 3NARA 5GP9A 1D5YA 2DA7A 2HXIA 4CYCB 1MNMC 4G12A 5M3FJ 3JR9A 2E2JJ 2Y30A 2VPRA 5IP9J 4FTHA 1MBGA 1ETQA 1RETA 3LSGA 3OIOA 4A3MJ 4C2MJ 3S17J 5E3MA 3HOWJ 2MSYA 2LFBA 2NVYJ 4XRMA 1AU7A 5E3NA 2NS7A 4BKXA 3TP0A 2JA5J 3A01B 2Y9YA 3HM5A 2PMZN 1RR7A 2NVQJ 1GV5A 4DYQA 1IDZA 1S7EA 1NTCA 1FEXA 1FIAA 1QVUA 3C2BA 5J1UA 3HOZJ 1GV2A 1RKWA 2Y0SN 5J1RA 2H1KA 3S1QJ 2IAIA 2MG4A 2P81A 4Y7NJ 1B72B 1AHDP 3OSGA 2DA1A 3W6VA 2XB5A 1TWGJ 1HDDC 2DA2A 2E19A 3JREA 1MBHA 2LP0A 3WHBA 3ZQHA 3DCFA 3RZDJ 3IH3A 1BW5A 5IYCJ 4A3BJ 1ETYA 2DMUA 4XK4A 2EH3A 3ZOBA 1P7IA 3BTIA 3E7LA 3S14J 1MH3A 2Y2ZA 3OOUA 5C4JJ 2XRLA 4MO7A 5EG0B 2K9NA 1JGGA 4C3HJ 5C4XJ 1LFBA 5IYDJ 4V2FA 5EEAA 5J3LA 1ORKA 5EDNA 3GTOJ 5EGOA 3G1OA 3GTGJ 2O8KA 1ITYA 4J19A 2M0CA 2HOTA 2GLOA 5JLWA 1VNDA 1WI3A 1H89C 3BG3A 1HOMA 2JN6A 5E3OA 3VPRA 5EGOB 3GTLJ 2ZB9A 1UHSA 5C44J 1QRYA 4B1RA 4C3IJ 5M3MJ 1BJZA 1EF4A 2ID6A 4IHWA 4UUSB 1Y1VJ 2I10A 5JLXA 1ZR2A 5GPCA 1LE8A 1ETVA 2L7ZA 3QPLA 5K7FA 4FCYA 3FIWA 1XC5A 2TRTA 2EZLA 3BTCA 2K40A 2E2HJ 4A93J 1CQTA 2R5ZA 1JTYA 4BY1J 2M34A 1T56A 1E3OC 2DTZA 2QF7A 3MVPA 3FISA 1JT6A 2MGQA 3RKQA 3L1PA 2R5ZB 3D1NI 1IG7A 2JA8J 1AKHA 1ENHA 5EZGA 2ECCA 2TCTA 4D5FA 4MFDA 2LK2A 1W0UA 4B3AA 2VKVA 4CYCA 2R5YB 2JWTA 2R7ZJ 5FKLA 2R93J 2LLKA 2Y9ZA 1QPIA 3CDLA 4A3IJ 4A3DJ 4RDUA 4XIDA 2KDZA 1U9OA 4XRSG 3CMYA 2DA3A 2JMWA 4A3EJ 5FLMJ 1ZR4A 4X1EA 1HCRA 4AUXA 5FKKA 1F43A 3NAUA 5FKOA 5GPAA 1I3QJ 5F0HA 2ID3A 3A01A 5E3LA 2DA5A 3H0GJ 3M3YJ 2QCOA 1R9TJ 3HGGA 3SJMA 3GTMJ 1TWCJ 3A03A 5F08A 1WH5A 2AHQA 1B72A 1ZQ3P 3RZOJ 1RKTA 2GBYA 3WHCA 1OJLA 1TWAJ 1HLVA 2FQ4A 1GT0C 1IV6A 2FD5A 1FTTA 4BY7J 2GM4A 2B63J 3IV5A 3S16J 3ZQLA 4FE7A 4W97A 4D7NA 3JRDA 3BQZA 1ETXA 3LSRA 5FLVA 2COBA 2WV1A 3UKGA 5EG0A 4Y52J 2FJ1A 3TEDA 1DU6A 2ME6A 1A5JA 4X6AJ 2HOAA 4M3GA 4C3JJ 2CUEA 3TW7A 3FK7A 5FKMA 4I6ZA 4V2GA 2ECBA 3BR3A 1K83J 4IHYA 1BA5A 1WGXA 3ZQFA 1PUFB 2EBIA 2Y31A 3B6CA 4UUTA 2JJ7A 3Q3SA 1QVTA 3S2DJ 3I4NJ 4QIWN 2XB0X 2RAEA 3RQIA 4JX5A 1JJ6C 3LOCA 1JKPC 1BL0A 3BR1A 1MSEC 3H3VK 4A3FJ 1JJ8C 3Q0WA 4DZJA 2X6OA 2XPVA 3HKZN 3MN2A 2CQXA 1JKQC 5EYRA 3M4OJ 1RPWA 4UUSA 4A69C 3PO3J 1Z0XA 3BR0A 2R92J 2L0KA 4HNVA 1A6IA 2LD5A 4D5CA 1ZTRA 3BTLA 1SFOJ 4BXXJ 3QQAA 1WPKA 2W48A 4BBRJ 3QPSA 3BT9A 1YRNB 4L5EA 1VF9A 3IH2A 3SDGA 3G1LA 4EEFG 1G2HA 3O8HA 2LR8A 4I76A 3G1MA 5F04A 1VI0A 3JRAA 1JUSA 2CRGA 4QSHA 1VFCA 1JUMA 3K7AJ 1JUPA 1MBEA 3Q0UA 4S0HB 2AO9A 4DYCA 2NVXJ 1MSFC 3BG9A 1GUUA 4JX4A 3LSPA 3GTKJ 1Y1WJ 3FK6A 2R5YA 1ETWA 1FJLA 2MW8A 1U9NA 4RBOA 2LVSA 3SFIA 3K2AA 3FKIJ 2YU9J 2R0QC 4JYKA 4XICA 2NVTJ 3S2HJ 1TWHJ 3BG5A 2OF7A 4QTRA 2YUSA 2O7OA 1MBJA 3LSJA 4IHXA 2JK3A 2OPTA 3PM1A 2CJJA 5HODA 1APLC 1IC8A 3HEFA 5K7ZA 1B8IA 1JTXA 2K9QA 5J1YA 3ZQGA 2H8RA 3JRIA 5M5YJ 1GVDA 2NOGA 1TWFJ 2DA6A 4D7MA 3BQYA 5F0FA 9ANTA 1NK3P 3O8GA 2EQRA 1ZKGA 2N8GA 2VI6A 1UG2A 4M3BA 2L7FP 1B8IB 5EF6A 1SANA 1ETOA 4M3DA 4MFEA 4AC0A 3JRGA 3S1RJ 1ZGWA 2XPWA 3PO2J 4A3GJ 1OFCX 3JRFA 1JT0A 2HI3A 2DA4A 2HOSA 2DN0A 1IDYA 3HB9A 1HDPA 2YS9A 3BTJA 4GFBA 1PUFA 3TP3A 5IOZA 1X2NA 2ELKA 2K9SA 4A3LJ 2KT0A 5FJ8J 4DZPA 1IGNA 4IHVA 1IUFA 1MBFA 1POGA 2L7MP 3A02A 3GTQJ 4JP0A 1MH4A 4DW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WB1 N;  2LTP A;  1DU0 A;  3CQZ J;  4XRS A;  1H88 C;  4MLO A;  1OCP A;  2DMN A;  1IJW C;  1I50 J;  1IRZ A;  2XSD C;  2FX0 A;  2E1O A;  2HXO A;  5F1J A;  3JRC A;  5C3E J;  3B6A A;  2M2E A;  3CCY A;  3MKL A;  1Z77 A;  1H8A C;  1X58 A;  2HDD A;  2X9D A;  4M6V A;  3HOX J;  4BBS J;  2IBD A;  1OCT C;  5IP7 J;  5DTD A;  2DMP A;  2WAQ N;  2NS8 A;  1YRN A;  3HOV J;  2HQ5 A;  4LOC A;  4MIM A;  5M5W J;  4IEJ A;  2EZK A;  5FKN A;  1FTZ A;  2HYJ A;  3BR2 A;  5EZH A;  4M3E A;  5IYB J;  3BR6 A;  3LNQ A;  1F36 A;  1HF0 A;  4ABZ A;  2EZI A;  2CU7 A;  1P7J A;  1XS9 A;  1K61 A;  3IH4 A;  2VKE A;  3JRH A;  1LFU P;  4JX6 A;  4FE4 A;  5K7H A;  5M5X J;  2L9R A;  3GBG A;  3I4M J;  1JKO C;  3S15 J;  4W1U A;  3HOY J;  1JKR C;  5IOY A;  1UMQ A;  2DMQ A;  2X48 A;  3ZQC A;  3HBL A;  2XGE A;  3BR5 A;  2E2I J;  3GTJ J;  5BNG A;  2G0E A;  3HDD A;  2JA6 J;  3GTP J;  2VUM J;  1TC3 C;  1RES A;  2DJN A;  1ETK A;  1BW6 A;  1LE8 B;  2CUF A;  5F27 A;  3S1M J;  1I6H J;  3DEW A;  4NDL A;  4B4C A;  2LKX A;  4A3J J;  3HOU J;  1FIP A;  2ME0 A;  4M3F A;  2D5V A;  5DS9 A;  2XPU A;  3JRB A;  1U8B A;  5F0C A;  1WH7 A;  1X2M A;  1WCM J;  3S1N J;  4A3C J;  2DMT A;  4FIS A;  2M8G X;  4AYB N;  2XGC A;  1T33 A;  2O9L A;  3Q0V A;  3F0C A;  1MBK A;  1W0T A;  2M9H A;  1ZK8 A;  2LY9 A;  3HGY A;  2JA7 J;  4DYR A;  1O4X A;  5IPA A;  1XG1 A;  3TW6 A;  4A3K J;  1U78 A;  3ZQI A;  3OSF A;  2IEK A;  1GDT A;  2EZH A;  1Q1V A;  2CQQ A;  2XGD A;  1AKH B;  1NK2 P;  5IP6 A;  3NAR A;  5GP9 A;  1D5Y A;  2DA7 A;  2HXI A;  4CYC B;  1MNM C;  4G12 A;  5M3F J;  3JR9 A;  2E2J J;  2Y30 A;  2VPR A;  5IP9 J;  4FTH A;  1MBG A;  1ETQ A;  1RET A;  3LSG A;  3OIO A;  4A3M J;  4C2M J;  3S17 J;  5E3M A;  3HOW J;  2MSY A;  2LFB A;  2NVY J;  4XRM A;  1AU7 A;  5E3N A;  2NS7 A;  4BKX A;  3TP0 A;  2JA5 J;  3A01 B;  2Y9Y A;  3HM5 A;  2PMZ N;  1RR7 A;  2NVQ J;  1GV5 A;  4DYQ A;  1IDZ A;  1S7E A;  1NTC A;  1FEX A;  1FIA A;  1QVU A;  3C2B A;  5J1U A;  3HOZ J;  1GV2 A;  1RKW A;  2Y0S N;  5J1R A;  2H1K A;  3S1Q J;  2IAI A;  2MG4 A;  2P81 A;  4Y7N J;  1B72 B;  1AHD P;  3OSG A;  2DA1 A;  3W6V A;  2XB5 A;  1TWG J;  1HDD C;  2DA2 A;  2E19 A;  3JRE A;  1MBH A;  2LP0 A;  3WHB A;  3ZQH A;  3DCF A;  3RZD J;  3IH3 A;  1BW5 A;  5IYC J;  4A3B J;  1ETY A;  2DMU A;  4XK4 A;  2EH3 A;  3ZOB A;  1P7I A;  3BTI A;  3E7L A;  3S14 J;  1MH3 A;  2Y2Z A;  3OOU A;  5C4J J;  2XRL A;  4MO7 A;  5EG0 B;  2K9N A;  1JGG A;  4C3H J;  5C4X J;  1LFB A;  5IYD J;  4V2F A;  5EEA A;  5J3L A;  1ORK A;  5EDN A;  3GTO J;  5EGO A;  3G1O A;  3GTG J;  2O8K A;  1ITY A;  4J19 A;  2M0C A;  2HOT A;  2GLO A;  5JLW A;  1VND A;  1WI3 A;  1H89 C;  3BG3 A;  1HOM A;  2JN6 A;  5E3O A;  3VPR A;  5EGO B;  3GTL J;  2ZB9 A;  1UHS A;  5C44 J;  1QRY A;  4B1R A;  4C3I J;  5M3M J;  1BJZ A;  1EF4 A;  2ID6 A;  4IHW A;  4UUS B;  1Y1V J;  2I10 A;  5JLX A;  1ZR2 A;  5GPC A;  1LE8 A;  1ETV A;  2L7Z A;  3QPL A;  5K7F A;  4FCY A;  3FIW A;  1XC5 A;  2TRT A;  2EZL A;  3BTC A;  2K40 A;  2E2H J;  4A93 J;  1CQT A;  2R5Z A;  1JTY A;  4BY1 J;  2M34 A;  1T56 A;  1E3O C;  2DTZ A;  2QF7 A;  3MVP A;  3FIS A;  1JT6 A;  2MGQ A;  3RKQ A;  3L1P A;  2R5Z B;  3D1N I;  1IG7 A;  2JA8 J;  1AKH A;  1ENH A;  5EZG A;  2ECC A;  2TCT A;  4D5F A;  4MFD A;  2LK2 A;  1W0U A;  4B3A A;  2VKV A;  4CYC A;  2R5Y B;  2JWT A;  2R7Z J;  5FKL A;  2R93 J;  2LLK A;  2Y9Z A;  1QPI A;  3CDL A;  4A3I J;  4A3D J;  4RDU A;  4XID A;  2KDZ A;  1U9O A;  4XRS G;  3CMY A;  2DA3 A;  2JMW A;  4A3E J;  5FLM J;  1ZR4 A;  4X1E A;  1HCR A;  4AUX A;  5FKK A;  1F43 A;  3NAU A;  5FKO A;  5GPA A;  1I3Q J;  5F0H A;  2ID3 A;  3A01 A;  5E3L A;  2DA5 A;  3H0G J;  3M3Y J;  2QCO A;  1R9T J;  3HGG A;  3SJM A;  3GTM J;  1TWC J;  3A03 A;  5F08 A;  1WH5 A;  2AHQ A;  1B72 A;  1ZQ3 P;  3RZO J;  1RKT A;  2GBY A;  3WHC A;  1OJL A;  1TWA J;  1HLV A;  2FQ4 A;  1GT0 C;  1IV6 A;  2FD5 A;  1FTT A;  4BY7 J;  2GM4 A;  2B63 J;  3IV5 A;  3S16 J;  3ZQL A;  4FE7 A;  4W97 A;  4D7N A;  3JRD A;  3BQZ A;  1ETX A;  3LSR A;  5FLV A;  2COB A;  2WV1 A;  3UKG A;  5EG0 A;  4Y52 J;  2FJ1 A;  3TED A;  1DU6 A;  2ME6 A;  1A5J A;  4X6A J;  2HOA A;  4M3G A;  4C3J J;  2CUE A;  3TW7 A;  3FK7 A;  5FKM A;  4I6Z A;  4V2G A;  2ECB A;  3BR3 A;  1K83 J;  4IHY A;  1BA5 A;  1WGX A;  3ZQF A;  1PUF B;  2EBI A;  2Y31 A;  3B6C A;  4UUT A;  2JJ7 A;  3Q3S A;  1QVT A;  3S2D J;  3I4N J;  4QIW N;  2XB0 X;  2RAE A;  3RQI A;  4JX5 A;  1JJ6 C;  3LOC A;  1JKP C;  1BL0 A;  3BR1 A;  1MSE C;  3H3V K;  4A3F J;  1JJ8 C;  3Q0W A;  4DZJ A;  2X6O A;  2XPV A;  3HKZ N;  3MN2 A;  2CQX A;  1JKQ C;  5EYR A;  3M4O J;  1RPW A;  4UUS A;  4A69 C;  3PO3 J;  1Z0X A;  3BR0 A;  2R92 J;  2L0K A;  4HNV A;  1A6I A;  2LD5 A;  4D5C A;  1ZTR A;  3BTL A;  1SFO J;  4BXX J;  3QQA A;  1WPK A;  2W48 A;  4BBR J;  3QPS A;  3BT9 A;  1YRN B;  4L5E A;  1VF9 A;  3IH2 A;  3SDG A;  3G1L A;  4EEF G;  1G2H A;  3O8H A;  2LR8 A;  4I76 A;  3G1M A;  5F04 A;  1VI0 A;  3JRA A;  1JUS A;  2CRG A;  4QSH A;  1VFC A;  1JUM A;  3K7A J;  1JUP A;  1MBE A;  3Q0U A;  4S0H B;  2AO9 A;  4DYC A;  2NVX J;  1MSF C;  3BG9 A;  1GUU A;  4JX4 A;  3LSP A;  3GTK J;  1Y1W J;  3FK6 A;  2R5Y A;  1ETW A;  1FJL A;  2MW8 A;  1U9N A;  4RBO A;  2LVS A;  3SFI A;  3K2A A;  3FKI J;  2YU9 J;  2R0Q C;  4JYK A;  4XIC A;  2NVT J;  3S2H J;  1TWH J;  3BG5 A;  2OF7 A;  4QTR A;  2YUS A;  2O7O A;  1MBJ A;  3LSJ A;  4IHX A;  2JK3 A;  2OPT A;  3PM1 A;  2CJJ A;  5HOD A;  1APL C;  1IC8 A;  3HEF A;  5K7Z A;  1B8I A;  1JTX A;  2K9Q A;  5J1Y A;  3ZQG A;  2H8R A;  3JRI A;  5M5Y J;  1GVD A;  2NOG A;  1TWF J;  2DA6 A;  4D7M A;  3BQY A;  5F0F A;  9ANT A;  1NK3 P;  3O8G A;  2EQR A;  1ZKG A;  2N8G A;  2VI6 A;  1UG2 A;  4M3B A;  2L7F P;  1B8I B;  5EF6 A;  1SAN A;  1ETO A;  4M3D A;  4MFE A;  4AC0 A;  3JRG A;  3S1R J;  1ZGW A;  2XPW A;  3PO2 J;  4A3G J;  1OFC X;  3JRF A;  1JT0 A;  2HI3 A;  2DA4 A;  2HOS A;  2DN0 A;  1IDY A;  3HB9 A;  1HDP A;  2YS9 A;  3BTJ A;  4GFB A;  1PUF A;  3TP3 A;  5IOZ A;  1X2N A;  2ELK A;  2K9S A;  4A3L J;  2KT0 A;  5FJ8 J;  4DZP A;  1IGN A;  4IHV A;  1IUF A;  1MBF A;  1POG A;  2L7M P;  3A02 A;  3GTQ J;  4JP0 A;  1MH4 A;  4DW6 A; 
#chains in the Genus database with same CATH topology
 3L2V A;  1ZGJ A;  1FNN A;  4XRS A;  2H94 A;  4UV9 A;  2JTV A;  4BAY A;  1H88 C;  2XF6 A;  1I6X A;  3FWE A;  2Y48 A;  1G3S A;  1OCP A;  2M4G A;  1IRZ A;  3MZH A;  2W24 A;  3BWG A;  1RC9 A;  2E1O A;  2HXO A;  5F1J A;  3A0H C;  4HX8 A;  5C3E J;  2MBF A;  3CMM A;  2KIS A;  1U0J A;  2LOO A;  3KYD B;  4HV5 A;  3MKL A;  3RCO A;  2A07 F;  2H09 A;  3RIR A;  1ODD A;  1OMI A;  4N9I A;  2UUZ A;  3DTK A;  3HOX J;  1O3T A;  2DMP A;  3E5Q A;  2NS8 A;  2CWE A;  1Y56 A;  1R5I D;  3F23 A;  4MIM A;  4EM0 B;  2OZ6 A;  2MFZ A;  2HYJ A;  2K3P A;  4OIR F;  5IYB J;  3BR6 A;  3LNQ A;  4ZH4 F;  1LEA A;  2HZT A;  4A5N A;  2WC2 A;  1P7J A;  1YS7 A;  1XS9 A;  4F52 A;  3MQ0 A;  1J59 A;  3IH4 A;  3HRT A;  3R60 A;  3MWM A;  4YEL A;  4JX6 A;  4QPQ A;  1LFU P;  5K7H A;  3I55 I;  1BN5 A;  4N4O B;  1V5G A;  4J00 A;  2FA5 A;  2OCC H;  3GBG A;  4PSW A;  3JTG A;  1BC7 C;  2X6W A;  3VYU B;  3H35 A;  2V9V A;  5LGU A;  2DFE A;  3BR5 A;  4HDV A;  1IXS B;  3C2H A;  2G0E A;  4LLG F;  2JA6 J;  5CQE A;  1LDD A;  4L5J A;  4BJ6 C;  2XAF A;  1RES A;  1HKQ A;  2CFO A;  2PI0 A;  2D45 A;  4XBF A;  2ISZ A;  2ZFW A;  2CUF A;  3K4B A;  2HFH A;  3OV8 A;  3DEW A;  4NDL A;  2GA2 A;  2LKS A;  3OYG A;  2ME0 A;  3ZPL A;  5DS9 A;  3JRB A;  2PMZ A;  4Q47 A;  4A3C J;  5D5W B;  3W3C A;  2XGC A;  4IF4 A;  1X4O A;  3F0C A;  4UXN A;  5K5R A;  4B8X A;  1K78 A;  3COA C;  2JA7 J;  2XAS A;  4D0P A;  1WJB A;  1RRJ A;  3ZQQ A;  4A3K J;  1GXQ A;  4QWQ A;  1FP2 A;  1O3S A;  1AA7 A;  1PDN C;  2V1D A;  1Q1V A;  2LNB A;  3CES A;  2VJ5 A;  2CFX A;  4L9T A;  4CCJ A;  4P9F A;  2FBI A;  5HLI A;  1JI8 A;  3I9V 2;  2CW0 F;  4U7D A;  4IOA F;  2Y75 A;  2LDU A;  2BXZ A;  3H92 A;  5M3F J;  4PJJ A;  4ASN A;  2PQ8 A;  1EH7 A;  2Y30 A;  3FHN A;  1LKX A;  4NNJ A;  4HX4 A;  2Y69 H;  2VQL A;  2ZSH B;  4A3M J;  1EJ9 A;  1W5S A;  2JSP A;  3NWS A;  3S17 J;  1O57 A;  1SFE A;  2STT A;  2MLG A;  5B5E C;  3ZN1 A;  2LFB A;  2NVY J;  2XF5 A;  2BZT A;  1K79 A;  2QKM B;  3A01 B;  2JSC A;  3H1C A;  3ZMS A;  2M5W A;  4KIC A;  4CCN A;  2NVQ J;  2X85 A;  3DXJ F;  1S7E A;  3MMY B;  3NWT A;  3HOZ J;  4UHT A;  2XSJ C;  1RKW A;  5L3B A;  1JHF A;  1G3T A;  2HKX A;  3HSE A;  4ZZL A;  1O3Q A;  2Z16 A;  1HSJ A;  3GFL A;  2O3F A;  2DA2 A;  2E19 A;  1VQ5 I;  4YG2 F;  1R1V A;  1MW7 A;  1MBH A;  3WHB A;  5F64 A;  1OCO H;  2P7C B;  2HTJ A;  2R7R A;  1EKE A;  1P7I A;  4BYY A;  3E7L A;  3S14 J;  4PJ0 C;  2WWY A;  2XRL A;  1WJF A;  2OC6 A;  5J4Y A;  5EG0 B;  3ESW B;  1QZY A;  2VC0 A;  2L3D A;  2Q2E A;  2IJL A;  3PNY A;  3FBN B;  3L2W A;  4C3H J;  2FMY A;  1XDS A;  1BM9 A;  1OYW A;  5EEA A;  3ERE D;  3AG3 H;  3K2Z A;  3LAJ A;  3H3U A;  4WWC A;  5EDN A;  1IF1 A;  2CW7 A;  3IKT A;  1W36 C;  3HTS B;  2O8K A;  4OU0 A;  4CYD A;  1PP8 F;  1ZLK A;  4J19 A;  5ILS A;  5J8C A;  4Y4R A;  1Z1D A;  1J7K A;  5JLW A;  1VND A;  1X1D A;  1WI3 A;  2QQA A;  1ZRD A;  2HEO A;  2GQQ A;  4L9V A;  2OBP A;  4EGY A;  3FXQ A;  3V4G A;  4U88 A;  5EGO B;  2OCE A;  4PGH A;  4OIP F;  2A61 A;  3FM5 A;  1K6O A;  5C44 J;  1QRY A;  4B1R A;  3K4N A;  2IGN A;  2Z1D A;  2PLY A;  2ID6 A;  4HQE A;  2BY2 A;  2EV6 A;  3FM3 A;  1MMD A;  4UUS B;  1ZRC A;  3VSL A;  1TBX A;  2M7B A;  4BE1 A;  1ETV A;  5KAI C;  3TO6 A;  3ZMV A;  4NC7 A;  2CUZ A;  3GCM A;  3CLQ A;  4XLC A;  3ZGK A;  2VQC A;  3FIW A;  3KLO A;  2DOA A;  2UXN A;  2VN2 A;  3BTC A;  2R4G A;  3PNT A;  5BMZ A;  1FLI A;  3EPZ A;  3N97 A;  3F6V A;  3ZQ7 A;  3IUO A;  1W5C C;  4HBL A;  4BY1 J;  2M34 A;  2VAS A;  3S3O A;  3NRV A;  1A04 A;  3MVP A;  4G6T B;  1HBX G;  2NNN A;  2MGQ A;  3RKQ A;  3KIO A;  2VL8 A;  1IG7 A;  5A2Q Z;  4HNU A;  5EZG A;  2DT5 A;  2TCT A;  4MFD A;  3GUD A;  2LK2 A;  2K86 A;  3S8P A;  1PJR A;  4XL9 A;  4CYC A;  3D5S C;  2LRE A;  1V5E A;  3E6B A;  2JWT A;  5HDN A;  1BOB A;  3CDL A;  4PUS A;  4IRH A;  2CUJ A;  4M72 A;  4BS9 A;  3CMY A;  4A3E J;  4XSZ F;  4BL0 B;  2GXB A;  2DK5 A;  5KK1 A;  1XX5 A;  1HW2 A;  1QA6 A;  4I09 A;  5FKK A;  1YHQ I;  4CSW A;  1Z9C A;  3IP4 B;  1N78 A;  4EJT A;  3F21 A;  3OYI A;  2DA5 A;  3M3Y J;  5FD5 A;  3ZRG A;  3HGG A;  4BAC A;  2F6C A;  1J0R A;  3VOE A;  3I56 I;  4IHT A;  3A03 A;  5DEQ A;  2W00 A;  3SEZ A;  1E17 A;  2KKO A;  1OIS A;  3VB2 A;  4ZTF A;  5K1Y A;  4C2U A;  2MAB A;  3CUQ A;  2FRH A;  2XAU A;  3RZO J;  3QP5 A;  1X1A A;  1RKT A;  4YII A;  3WHC A;  3KPH A;  4C30 A;  2W7N A;  3CCL I;  2NAZ A;  1HLV A;  2FD5 A;  1V55 H;  3KCC A;  2F4I A;  5DCM A;  2B63 J;  1SVM A;  2V6C A;  1WFX A;  3ZQL A;  4BJ5 C;  4W97 A;  1TT5 B;  3K1N A;  2VLA A;  1IW7 F;  1R58 A;  2BXY A;  2COB A;  2WV1 A;  2F5D A;  3I71 A;  4ZZD A;  1K4T A;  3TO9 A;  3MD2 A;  3OR1 C;  1KQ9 A;  3BOQ A;  2EPF A;  4HA8 A;  3GFM A;  1HKS A;  2K9L A;  2FJ1 A;  2VKD A;  4BHB A;  3OS1 A;  2Y0M A;  5L3C A;  2V6E A;  1A5J A;  2JRM A;  4R8H A;  2ZME B;  5EEG A;  3EUH A;  2CW8 A;  2CUE A;  2OZU A;  1D0Y A;  1YG2 A;  4V2G A;  4KT5 C;  4IHY A;  3I59 B;  1G3W A;  2PMH A;  5FFX A;  2DPD A;  2XF7 A;  3Q3S A;  5DYM A;  4QIW N;  2XB0 X;  1YOV B;  1JJ6 C;  1MDM A;  4IX7 A;  1XSV A;  4BDZ A;  3L00 A;  2IPQ X;  3ECH A;  1D3Y A;  3ABL H;  4A3F J;  1JJ8 C;  2AQE A;  2X6O A;  2XPV A;  3HKZ N;  3MN2 A;  4BDY A;  3EYI A;  1WWX A;  1VQ8 I;  5EYR A;  3DTE A;  3SDB A;  2JQ7 A;  2QQB A;  3PO3 J;  1B6A A;  3BR0 A;  4HQM A;  4JQF A;  1FMV A;  2L54 A;  2VKH A;  3G73 A;  3J7A O;  1A6I A;  5HOO A;  2XC7 A;  2B0L A;  4AYB A;  2E71 A;  4OIQ F;  2L9N A;  2VC1 A;  1IN8 A;  1ERD A;  2FQ3 A;  3GZN B;  3G1L A;  4EEF G;  4LG3 A;  4KDP A;  2OAZ A;  1F9N A;  1J09 A;  1WJ5 A;  3JRA A;  1JUS A;  3K4K A;  3KEQ A;  2R7W A;  3QP6 A;  3ERM A;  2LBF B;  1TQM A;  3FXU A;  1MBE A;  2E1N A;  4II3 A;  4KUM A;  3LA3 A;  3PQK A;  1I1S A;  4ZDO A;  4S0H B;  3LSH A;  4DYC A;  5KAF C;  3LFU A;  3F8F A;  3SQN A;  2VOP A;  1IXC A;  1KU7 A;  1Y1W J;  1T0F C;  1WRJ A;  1YE9 A;  3FK6 A;  5CLS A;  3RPQ A;  4OMZ A;  2MW8 A;  1U9N A;  2E7W A;  3ABK H;  2BEO A;  4S05 A;  3LAP A;  3FXL A;  2F4O B;  1XSD A;  4E4H A;  2R0Q C;  1EH6 A;  2E34 A;  4IQJ A;  4ZYE A;  3CO6 C;  3OYF A;  1MBJ A;  4OMY A;  2D2W A;  4HPQ A;  4YFK F;  5FFZ A;  4EVI A;  5HOD A;  1QHH D;  2H1L A;  2XGX A;  3M7G A;  4NHJ A;  2QEX I;  3HEF A;  4I7H A;  3RDI A;  2PG4 A;  3CC4 I;  4KIF A;  5M5Y J;  2HGC A;  4XOP A;  1Y0N A;  2KLO A;  3T5X A;  5LEJ A;  2LF8 A;  2JPB A;  2DA6 A;  3E6D A;  4D7M A;  3FBI B;  5IT3 A;  1NK3 P;  3DPU A;  2EQR A;  1ZKG A;  1VQP I;  1U5T B;  3H9Q A;  1D8K A;  1SD5 A;  2IS6 A;  3BJO A;  4RGX A;  1UAA A;  1REP C;  5EEH A;  2GWR A;  2Q8K A;  2V1U A;  1ZGW A;  3PO2 J;  3BP8 A;  4A3G J;  1XTA A;  2MLK A;  1JT0 A;  4PFO A;  3DLL F;  1WKM A;  2DA4 A;  4BEH A;  1XCV A;  1WHU A;  2HOS A;  2M7A A;  2OV7 A;  3U2R A;  1MND A;  3QPT A;  2OD5 A;  3C1D A;  1YI2 I;  4GFB A;  1Y6I A;  2DT6 A;  4L0Z B;  5LHH A;  2KIM A;  4G9Y A;  3DFG A;  4E7H A;  2ELK A;  3H5A A;  1J75 A;  3GFI A;  2KHM A;  3FMQ A;  3LST A;  2L7M P;  1JHH A;  1LQ1 A;  3G3Z A;  1ZEL A;  4DW6 A;  2NYX A;  1DU0 A;  1U8R A;  4DQ2 A;  3DPL C;  4FAS D;  5EJC A;  4MLO A;  1RI7 A;  2DMN A;  4ZYG A;  3GLX A;  2ESN A;  2K5C A;  5CVI A;  3RKW A;  3B6A A;  5BPI A;  4Y33 A;  1Z77 A;  1X58 A;  3CO7 C;  3KP3 A;  4M6V A;  3VEP A;  4ENJ A;  2IBD A;  1OCT C;  2JT1 A;  5IP7 J;  2HDW A;  3KP6 A;  2CV1 A;  2ISY A;  2HS5 A;  3WTZ A;  4AM3 A;  4LOC A;  4FQG A;  1Y39 A;  5FRN A;  4RGR A;  2ZNY A;  5EZH A;  2V4J C;  3AG4 H;  4ABZ A;  2EZI A;  2X6Y A;  2KRF A;  5HNF A;  2LY2 A;  2OQR A;  1K61 A;  4IQ4 A;  3TKY A;  4CO8 A;  5HVQ C;  4A5M A;  4BU2 A;  4IO9 F;  4CCO A;  1KON A;  4G94 A;  1DGW Y;  4A6E A;  5M5X J;  2HKO A;  6PAX A;  3WTX C;  4M9X A;  5ILU A;  2RDP A;  4RAF A;  1DUX C;  2BVL A;  1R1T A;  3HOY J;  4UY8 I;  1DGR M;  1JKR C;  1XGN A;  1KYW A;  1UMQ A;  2HR3 A;  2X48 A;  4IHS A;  3A0B C;  2XGE A;  4LG0 A;  2E2I J;  1W7P D;  3HDD A;  1OYY A;  1G3Y A;  2EFW A;  3GTP J;  4MGR A;  5LEK A;  1TC3 C;  4RGU A;  4DOZ A;  4KMF A;  3MEX A;  1XMK A;  2PN6 A;  2ZNZ A;  2F48 A;  1VQ4 I;  1LE8 B;  4XMY A;  1I6H J;  1A31 A;  2L9S A;  3DEE A;  3FDY A;  2R3S A;  4RB2 C;  4FHT A;  4CCK A;  2KRH A;  1L0O C;  4IOC F;  1KA8 A;  4AU7 A;  3A2K A;  4ZC3 A;  2GA1 A;  2XUB A;  4NUB A;  2BBY A;  3OYH A;  4BXU A;  3Q0V A;  1WSU A;  3OIP A;  4N0B A;  4B47 A;  2M9H A;  1ZK8 A;  2LY9 A;  4DYR A;  1O4X A;  1XG1 A;  1TZL A;  1GLN A;  1OQY A;  3TW6 A;  3DBR B;  1U78 A;  4OAY A;  1BI2 A;  2A3S A;  3F8B A;  4HEA 2;  2M1B A;  5HLH A;  3OSF A;  2Z9O A;  2MC4 A;  3OYD A;  1A35 A;  1AKH B;  1UB9 A;  4NBQ A;  1BIB A;  1GHC A;  1S8N A;  3QYF A;  2DLL A;  1D1B A;  1SD4 A;  3TBI A;  5GP9 A;  3QYE A;  2DOE A;  4N4N B;  1D5Y A;  2DFH A;  4RLQ A;  2HVR A;  1WJD A;  3JR9 A;  1J2X A;  3HRM A;  3M9A A;  2E2J J;  3HL2 A;  3CCM I;  3G2B A;  3CLO A;  3DU6 A;  1UEL B;  1OR7 A;  1ETQ A;  4FTH A;  1A36 A;  1MGT A;  1RET A;  4K2E A;  3OIO A;  1FWZ A;  2V26 A;  2EA2 A;  3RSN A;  5GAD J;  3HXL A;  4P9U A;  5CVU A;  3Q9S A;  3NQO A;  1YO5 C;  4XRM A;  5E3N A;  3KYC B;  2DW4 A;  2HOE A;  4XR6 A;  3B73 A;  2PMZ N;  1RR7 A;  2YX7 A;  1GV5 A;  4P5O A;  2X1C A;  1PVE A;  1BOA A;  1MMN A;  1TNT A;  2K7L A;  2M8E A;  1QVU A;  4EJU A;  1FEX A;  3L2C A;  1GV2 A;  2Y0S N;  2IAI A;  2HVQ A;  2P81 A;  3F6O A;  2BVM A;  4Y7N J;  5DDG A;  5BPD A;  1B72 B;  3LA7 A;  3W6V A;  2XB5 A;  1TWG J;  1HST A;  1VQL I;  4CZZ A;  1Y0U A;  2LP0 A;  3OS2 A;  3ZQH A;  5LRR A;  1BW5 A;  1F1Z A;  3R0J A;  1OCR H;  1UHM A;  2R7S A;  4GYG A;  1ETY A;  3O3K A;  5D6F A;  2IGO A;  3UNG C;  2EH3 A;  3DKW A;  5D4S A;  3BPV A;  4XLP F;  1MH3 A;  3V42 A;  4JK1 X;  2Y2Z A;  4FX4 A;  2X1E A;  5E1Z B;  3TL4 X;  2VBZ A;  4A0Y A;  3FXR A;  2FU4 A;  1NG6 A;  5L3G A;  1JGG A;  2IS4 A;  5D5X B;  2XVC A;  2XKO A;  2ZKZ A;  3E3V A;  1G8X A;  4UVA A;  3RYP A;  4DJA A;  5BQT A;  1XSX A;  2KL4 A;  2E5N A;  3K70 D;  3PFY A;  2HTS A;  2P4W A;  5J3L A;  1X1P A;  1KYZ A;  3GTO J;  5EGO A;  1P2F A;  3GYH X;  1USS A;  4PGG A;  1D8J A;  1TQI A;  4ESB A;  1ITY A;  1YFH A;  2M0C A;  2HOT A;  5ICE A;  1O7L A;  5J4V A;  1IXR C;  3BG3 A;  3F8C A;  3HYI A;  1YW9 A;  5ICC A;  4WX9 A;  2EIK H;  3ELK A;  1ZG3 A;  3F22 A;  4HOB A;  4C3I J;  1XCB A;  3BZ6 A;  3AL0 B;  5HS8 A;  3V7R A;  2W4S A;  3BY6 A;  4IHW A;  1Y1V J;  1ZHF A;  1R22 A;  1G59 A;  3OYA A;  2PFB A;  2L7Z A;  3QPL A;  3KLN A;  1T38 A;  4LK0 F;  3ZXS A;  1B4A A;  4A6D A;  2A05 A;  4FCY A;  1XC5 A;  1X4P A;  2TRT A;  3V7S A;  2FNA A;  4XLF A;  4KNY A;  5J6X A;  1CF7 A;  2E2H J;  2DTR A;  3SXY A;  2R7O A;  3IWF A;  3CZ6 A;  1OCZ H;  1X3W B;  2CS3 A;  3I54 A;  4XLN F;  4E7I A;  2QSH X;  4IKF A;  4UUV A;  2X51 A;  1FSE A;  3I58 A;  3OYK A;  3EET A;  3ROU A;  3RYR A;  1ULY A;  3VOD A;  2DTZ A;  4ZTJ A;  2FML A;  2DPU A;  1JT6 A;  1N75 A;  4I98 B;  4X0G A;  4RMN A;  3L1P A;  1HC8 A;  2OJE D;  3KX2 A;  4FX0 A;  4GXO A;  1FYL A;  2PJR B;  2A6T A;  3BCB A;  4KT6 A;  2HDC A;  4D5F A;  2F5C A;  2DFI A;  1V3F A;  5AON A;  3T8T A;  2QSF X;  3KP7 A;  2JRT A;  2VKV A;  2HNH A;  4ENK A;  5E17 F;  2R5Y B;  4YIR X;  2VB6 A;  1IN5 A;  3E5X A;  3VDX A;  4XID A;  2ZO4 A;  1YX5 A;  3I4P A;  3CCU I;  1YYV A;  2L4A A;  3ASN H;  4XRS G;  3LL7 A;  2DA3 A;  2JMW A;  5LD2 C;  2L4M A;  3MZY A;  2MH2 A;  4KIT B;  1OCC H;  3CJQ B;  3AKZ A;  4M71 A;  2WAD A;  1LUJ B;  1F5T A;  3WU0 A;  5GPA A;  5F0H A;  2ID3 A;  1W4M A;  4OWR B;  3HOS A;  1MZB A;  2CH0 A;  4BQQ A;  5FRO A;  4XSX F;  3GZ5 A;  3WE3 A;  1FOW A;  3SJM A;  3GTM J;  1FBS A;  2W82 A;  1TWC J;  3DF8 A;  2UWM A;  1S5L C;  1D5V A;  2AHQ A;  4B43 A;  1YIT I;  1VQM I;  2DK8 A;  4HLX A;  2BW3 B;  3EQL F;  4DIQ A;  3CCR I;  2GBY A;  1OJL A;  1FBU A;  4BHC A;  3QU3 A;  1LPQ A;  4IPA A;  2PEX A;  2GIV A;  2YSR A;  3QWL A;  2JPC A;  3TGN A;  4EM1 A;  5GTI C;  3L09 A;  1WVR A;  2ZME C;  1O7F A;  3QOP A;  3IV5 A;  2XAG A;  4FE7 A;  2HQR A;  2YPR A;  1R1U A;  3BQZ A;  4D7N A;  3JRD A;  3LSR A;  2QQ8 A;  2ZME A;  2IA2 A;  5FLV A;  1ONV A;  4D9J A;  3UKG A;  2CQN A;  2DI3 A;  2XRO A;  3FXJ A;  2NS0 A;  1W1W E;  1YW7 A;  1MNE A;  3TED A;  1DU6 A;  1T08 B;  1MMS A;  2UXX A;  3W6K B;  2E35 A;  3L2U A;  1JE8 A;  3KE2 A;  3LA2 A;  4I6Z A;  2ECB A;  1LEB A;  2XIG A;  1BA5 A;  3K0L A;  3ZQF A;  1AOY A;  2A5W A;  2EBI A;  2FNP A;  4UUT A;  2JJ7 A;  1LVK A;  1QVT A;  3S2D J;  5GAH J;  3I4N J;  4JX5 A;  4BHP A;  3K1P A;  3GX4 X;  1BL0 A;  3BR1 A;  5A2Q K;  4RM2 A;  3WU1 B;  3S3M A;  1VQ6 I;  3L9F A;  2STW A;  1BJA A;  4CA0 A;  2EV0 A;  2RV8 A;  4DZJ A;  4CXF A;  2KZG A;  2CQX A;  1I1G A;  3PUF A;  1G6N A;  3M4O J;  4GRI A;  1SFX A;  2R92 J;  2L02 A;  1DQU A;  4HNV A;  4QLC U;  1S7A A;  3T1B A;  1KQ8 A;  1Z3Y A;  2H6B A;  1ZTR A;  2LD5 A;  2DU9 A;  1SVL A;  1T98 A;  5DUI A;  2Z5U A;  2K4B A;  4BXX J;  3QQA A;  1WPK A;  3CUO A;  1IRF A;  2W48 A;  3E97 A;  2HQN A;  3BT9 A;  5E79 C;  4L5E A;  3RKX A;  2F2E A;  4O6J A;  4M74 A;  3SDG A;  4M6Y A;  1XMX A;  2RN7 A;  1VI0 A;  1LDK B;  4BE2 A;  3OS0 A;  1VFC A;  1JUM A;  4MQ9 F;  3EDP A;  1JUP A;  1FC3 A;  1P4A A;  2K02 A;  3FZV A;  3GME A;  2Q1Z B;  4I02 A;  2BV6 A;  1KU3 A;  2VBY A;  3V7C A;  1MSF C;  4JX4 A;  3GTK J;  3OWT A;  2IVM A;  4OIO F;  3LSM A;  1CGP A;  1XGM A;  2HQA A;  4XOR A;  4WXC A;  3CCV I;  2K9M A;  4G7H F;  4GCV A;  2O61 A;  3CME I;  2ZJQ F;  2O03 A;  4IVN A;  4RBO A;  3PJR A;  1S6L A;  3FKI J;  3P9I A;  2YU9 J;  4JYK A;  4ON0 A;  3E6C C;  1R49 A;  1YQA A;  5AIP A;  1QBJ A;  1IN6 A;  4GYI A;  1N77 A;  2YUS A;  2HYG D;  2I5U A;  1DPU A;  5D5V B;  4XN0 A;  2RRE A;  4HST A;  5LFA A;  3RQ4 A;  1U5T C;  4U87 A;  4CUG A;  3ZP5 A;  3FX3 A;  4I01 A;  5GAG J;  3BG6 A;  1K4S A;  2VBW A;  2K9Q A;  2DYS H;  2H8R A;  3BRO A;  2DOD A;  2K3F A;  3G4S I;  1GVD A;  5CYV A;  5D6E A;  1TWF J;  2QQ9 A;  3FHZ A;  3BQY A;  5F0F A;  2RQP A;  3KP5 A;  3QPH A;  2N8G A;  3U21 A;  3ZMT A;  1K78 B;  1R7J A;  1FPQ A;  1SAN A;  3I64 A;  5E1X A;  4AC0 A;  3JRG A;  3S3N A;  2PX9 A;  2BYV E;  1P9Q C;  2HI3 A;  1ON1 A;  2NRA C;  2K85 A;  2WAQ A;  4EQQ A;  2OQG A;  2M3A A;  4MHG A;  1QGP A;  4LD5 A;  1QQI A;  2O5R A;  5E8G A;  2P0W A;  3W2W A;  4O3M A;  3HB9 A;  1HDP A;  3OOP A;  4H4K C;  2Z33 A;  2YS9 A;  2DYR H;  4LLL A;  2FSW A;  5L3D A;  1PUF A;  2P6S A;  3TP3 A;  1X2N A;  1I27 A;  3DBL B;  1BR1 A;  3EUA A;  3TO7 A;  5HLT A;  3IKV A;  3IAS 2;  3QAH A;  4PJN A;  4Y17 A;  1POG A;  3GTQ J;  2BE5 F;  1MH4 A;  4A3I J;  2ZSI B;  1T8I A;  1I5Z A;  1X19 A;  4G6Q A;  2WB1 N;  3WTS C;  5LHG A;  4IJA A;  2GXG A;  3HSF A;  3CQZ J;  1FZP B;  2XV4 S;  1ZG1 A;  2G7U A;  1IJW C;  1I50 J;  2L9V A;  3DP7 A;  2XSD C;  4U0V A;  2H8W A;  3A1Y A;  1FMW A;  3DTI A;  3K6G A;  4ZDP A;  3N4M A;  1Z7U A;  1MJB A;  1Z05 A;  3CCY A;  4NQW A;  2KFD A;  1Z21 A;  2X9D A;  3E6M A;  3SZP A;  3O6B B;  2F5F A;  2W57 A;  3OYL A;  3BLY A;  5HNH A;  4ZYD A;  2E5Z A;  5IY5 H;  1YRN A;  2QBY A;  4R79 A;  5IT9 K;  3HOV J;  1WJE A;  2HQ5 A;  5M5W J;  1EV7 A;  2EZK A;  5FKN A;  3CCE I;  5FB2 A;  3BR2 A;  4RLF A;  1VQ7 I;  2FF4 A;  2Q2E B;  5FO5 A;  1HF0 A;  2CU7 A;  3KZZ A;  4Z2Y A;  4L0Y B;  4Y13 A;  3AG1 H;  4IZZ A;  2COM A;  4LIT A;  1JXS A;  1XMA A;  2VKE A;  3GW2 A;  4FE4 A;  2DJI A;  3LQR A;  3E0J B;  1W36 D;  5HDK A;  2VIX A;  1M1E B;  2AXT C;  4F93 B;  2L9R A;  1E2X A;  2XAJ A;  2EJR A;  4L9J A;  1JKO C;  3I4M J;  1V4R A;  4CGZ A;  2ZCW A;  1FX7 A;  3ZQC A;  3HBL A;  2QLZ A;  1TW2 A;  4RS8 A;  3TMO A;  3OYB A;  1T0F A;  2EWN A;  3L2Q A;  2MC3 A;  4F3Q A;  4V19 K;  2VUM J;  2CQ7 A;  2CO5 A;  3CJN A;  4KN7 X;  3WTW C;  1ZAR A;  5LBQ A;  1SC7 A;  3R4K A;  4DBR A;  3KEY A;  3VSK A;  1YJN I;  3S1M J;  3CP2 A;  2LKX A;  1B9N A;  4G7Z F;  4M3F A;  2D5V A;  1Z6R A;  2XPU A;  3MAJ A;  2TDX A;  2WTE A;  5IT9 Z;  4ETS A;  5F0C A;  1WH7 A;  2DBB A;  1WCM J;  2OTJ I;  2DMT A;  3OR2 C;  4FIS A;  3ABT A;  3DPT A;  2O9L A;  4M9S A;  1MBK A;  3GLL A;  2IRF G;  1W0T A;  4MTE A;  3HHH A;  4H0E A;  3REO A;  2V7F A;  2ZJ2 A;  1T95 A;  3WGG A;  2XAH A;  4AID A;  4MQV A;  3SEQ A;  4FT8 A;  2IEK A;  2EZH A;  2FBH A;  3GF2 A;  2CQQ A;  2XGD A;  2EIM H;  3H5N A;  5K5Q A;  1FY7 A;  4RAZ A;  4LB6 B;  2R7V A;  2FOW A;  5L3F A;  2Q0O A;  4PDK A;  5H6Q A;  4CYC B;  3LMM A;  4G12 A;  3BZC A;  4CDG A;  3B02 A;  4HRI A;  3OYE A;  5IP9 J;  1ON2 A;  2QWW A;  3ASO H;  4LK1 F;  3CD6 I;  1I3A A;  1U3E M;  4XNF A;  4C2M J;  1LNW A;  1TTY A;  2RKH A;  3WG7 H;  5JVT A;  3HPH A;  1KU9 A;  4RB0 A;  4MTD A;  2ZXH A;  4ZYA A;  5H2F C;  5JVG F;  4LIU A;  2NS7 A;  3TP0 A;  2L7K A;  2Y9Y A;  2EV5 A;  4CZC A;  2P6T A;  4OAZ A;  3PSF A;  1IDZ A;  1UST A;  4KIB A;  1ZRE A;  1IO2 A;  2H1K A;  2QEN A;  2R7U A;  4XKV A;  1O3R A;  1AHD P;  2B9S A;  3OSG A;  3CUQ B;  2DCE A;  3I53 A;  4B44 A;  3P7N A;  1FP1 D;  4HYE A;  1P6R A;  3OYN A;  3K1M A;  3RZD J;  1LB2 A;  2LSO A;  3DCF A;  3IH3 A;  3S2W A;  1SMT A;  4B48 A;  4WXD A;  4L5I A;  3WTV C;  1DDN A;  5DCM B;  4HSR A;  4BUP A;  2A68 F;  1MD0 A;  3ZOB A;  3BTI A;  3TDZ C;  1XB4 A;  2DQR A;  5C4J J;  3CDH A;  4AIK A;  4MO7 A;  2MA3 A;  2X1D A;  3TOB A;  4J01 A;  1YTY A;  1S29 A;  2QGU A;  1OKR A;  2Z3Y A;  4U0W A;  5BOX A;  3KEO A;  1IN7 A;  2ZC2 A;  3IAM 2;  4ESJ A;  3AG2 H;  3PIO F;  1SD6 A;  3C7J A;  1RIO H;  2P5L C;  2C6Y A;  4UV8 A;  3QOD A;  3SFZ A;  2IP2 A;  1BC8 C;  3G1O A;  2ZXI A;  3CCS I;  1MDM B;  4KFC A;  2M45 A;  2GLO A;  5B66 C;  5JI6 A;  1H89 C;  1HOM A;  2JN6 A;  5E3O A;  1G4D A;  2JZY A;  3LSI A;  2O6G E;  2ZB9 A;  4ZDL A;  2IW5 A;  3FMS A;  1BJZ A;  1XDU A;  3W2A A;  4OOI A;  3HTU A;  4HDU A;  2P7V B;  1KU2 A;  3BPX A;  3JW4 A;  3FMR A;  3Q5F A;  2NVU B;  3ZMD A;  3FF5 A;  4F91 B;  2UZK A;  4GO1 A;  2EZL A;  4I99 C;  1Z3X A;  1K7A A;  1S9H A;  2QM3 A;  1W7P B;  3DU5 A;  4A93 J;  1CQT A;  1JTY A;  1UZC A;  2PJR A;  3LQQ A;  2EIN H;  1Y8Q B;  1R5G A;  3H9J A;  4YEJ A;  1T56 A;  2HYF A;  2VJI A;  2HZD A;  3PSI A;  1E3O C;  3BC8 A;  5D4R A;  2V9K A;  4EV0 A;  5B1A H;  3ML6 A;  3CCQ I;  2R7Q A;  2BHY A;  1NH3 A;  2X6X A;  2R5Z B;  4A2U A;  3D1N I;  3OYC A;  1YW8 A;  1WJA A;  2WA0 A;  5E8I A;  5KHD A;  1UCR A;  2K27 A;  2ECC A;  2VOO A;  3U1K A;  3RPU A;  3BDD A;  1W0U A;  2CYY A;  1RUO A;  4HX7 A;  3M8E A;  2NNY A;  4B3A A;  1KGS A;  4G6D A;  4CCL A;  1P92 A;  2R7Z J;  5FKL A;  2R93 J;  3H0D A;  1QPI A;  4A3D J;  1YJ9 I;  3OL4 A;  4RDU A;  1U9O A;  1XGO A;  3F3X A;  5F6F A;  5TRD A;  5FLM J;  5LHI A;  4X1E A;  5ILV A;  3HUG B;  4MEY F;  3J80 Z;  1EA3 A;  3J7Z I;  1HCR A;  1F43 A;  1TLH B;  3NAU A;  2F4M B;  5FKO A;  2FE3 A;  3BJ6 A;  4F7Z A;  2KQR A;  5FLX K;  2D1H A;  4BH9 A;  4KN4 X;  3R61 A;  2X0L A;  1X3Z B;  2M4K A;  2BHZ A;  3A01 A;  1PP7 U;  1L3L A;  2QCO A;  4Z6Y A;  4PJL A;  2RGV A;  3OY9 A;  2KIU A;  2I8D A;  4ENN A;  2HPI A;  4LLN A;  2F5E A;  3JAM K;  5F08 A;  2H6C A;  3DEU A;  2E36 A;  2R7F A;  2KRC A;  4AIH A;  1B9M A;  3N05 A;  5JHF A;  4XKB A;  1GT0 C;  1FTT A;  2VQG A;  2DDB A;  3A4C A;  3PFI A;  1F4K A;  2AQF A;  1HKT A;  4IXA A;  4DGW B;  1B1B A;  2EIJ H;  2EFN A;  1QPM A;  1HQC A;  5EG0 A;  3JSP A;  3E1S A;  4BEH B;  3BCA A;  3D5L A;  2K4J A;  1RZ4 A;  5E20 A;  1SAX A;  4GGG A;  1ZN2 A;  4Y15 A;  4EJO A;  3DQV C;  5FKM A;  4S04 A;  2MD0 A;  3BR3 A;  4PCQ A;  5TGT A;  4CHU A;  3JSO A;  3CTA A;  2ZJP F;  4UVB A;  3RTR A;  1LVA A;  1IRX A;  3CP8 A;  5FLX Z;  2M0M A;  2OU2 A;  2P8T A;  2RAE A;  3RQI A;  4RB1 A;  3LOC A;  1E3P A;  1U6G A;  1JKP C;  2XHK A;  3MCZ A;  4M6X A;  1KZH A;  1MSE C;  4BNC A;  1S72 I;  2CG4 A;  2BY1 A;  3FXK A;  4JBA A;  3JAM Z;  2QKL B;  1ZRF A;  3M8J A;  1JKQ C;  2KP6 A;  2ZBK A;  4WCG A;  4HAM A;  1Q1H A;  2R7X A;  5FD6 A;  4UUS A;  4E7Z A;  1Z0X A;  2L0K A;  2VE8 A;  2E7X A;  3Q9V A;  4XLA A;  3AAF A;  1W5T A;  2FXA A;  4PFP A;  4P1W A;  1SFO J;  5E1W A;  2A5Y B;  2DAO A;  4BBR J;  5ICG A;  1SFU A;  2JA2 A;  2E1M B;  1G2H A;  2LR8 A;  1PUE E;  2X4H A;  2KJB A;  1ZYR F;  3J81 Z;  1RUN A;  2CV2 A;  3K7A J;  1D0Z A;  3HG9 A;  3ONQ A;  3Q0U A;  2GIZ A;  2AO9 A;  2EIL H;  1GUU A;  2RVC A;  5B1B H;  3WGH A;  4E7S A;  1VQO I;  3IL2 A;  5DCF A;  1SEU A;  2VON A;  1V54 H;  4Q4Z F;  2XKP A;  2AXL A;  3PNV A;  1YJW I;  1ETW A;  1HW5 A;  1FJL A;  4R1H A;  3HOT A;  3KP2 A;  4Q5S F;  3WTU C;  3SFI A;  3K2A A;  1IV8 A;  2VE9 A;  5AIQ A;  1D0X A;  4DBQ A;  4KIS A;  5J47 A;  1XGS A;  4LG0 B;  4XIC A;  2RNJ A;  1MJA A;  2WY7 Q;  3IC7 A;  2HVS A;  4M9Z A;  1TWH J;  2GZW A;  2GOX B;  3BG5 A;  3NEU A;  5E18 F;  4QTR A;  2L2O A;  4UVC A;  3QU6 A;  1VZ0 A;  4E7L A;  1STZ A;  2Z99 A;  5HS9 A;  2HWV A;  2MYS A;  3LSJ A;  2KIF A;  1YLF A;  1R23 A;  3M1C A;  5TJJ A;  4LJZ F;  1APL C;  2Y0S A;  2BY3 A;  4RA2 A;  4LMY A;  4KIG A;  2EK5 A;  1JTX A;  3ZQG A;  1WI9 A;  1RR8 C;  3JRI A;  2A69 F;  4PJM A;  3K69 A;  3OL3 A;  3RPU D;  3HZJ A;  2O0Y A;  3HPG A;  3HC7 A;  5JHU A;  3MKZ A;  9ANT A;  1Z7L A;  2VI6 A;  5CVR A;  4KMU X;  2L7F P;  1B8I B;  2LH9 A;  5DM6 F;  3QYB A;  1TT0 A;  4XLE A;  3K4M A;  5EF6 A;  1E0E A;  1ETO A;  3S1R J;  1ZH5 A;  2PBI A;  2DQL A;  4XLH A;  3V8L A;  3CF5 F;  4B09 A;  2EFP A;  4M73 A;  2DN0 A;  4I0A A;  2ESH A;  1IDY A;  2W1O A;  1GXP A;  4GDF A;  5LLQ A;  4XKC A;  2WV0 A;  4AWX B;  1X1B A;  2CGP A;  5B3S H;  2ZXW H;  1WQ2 A;  2YU3 A;  1K6Y A;  1FOX A;  1YIO A;  3L2R A;  3PIP F;  3CF2 A;  3I59 A;  2LF7 A;  1LJ9 A;  3FXO A;  4IL6 C;  5J40 A;  3KZY A;  1R6R A;  2K9S A;  4A3L J;  2KT0 A;  5FJ8 J;  3IRR A;  5H6R A;  1IUF A;  1MBF A;  1QHG A;  1ZAO A;  2FEZ A;  3A02 A;  3RJP A;  4BQO A;  5J8F A;  4JP0 A;  1IZ1 A;  3CC7 I;  1OYI A;  4LB5 A;  4AIJ A;  2LTP A;  4EJW A;  4BXF A;  3KZI C;  1QO0 D;  2VJJ A;  4HW0 A;  1JGS A;  2FX0 A;  2XAQ A;  1MMA A;  3HSR A;  4XKW A;  2A6E F;  3JRC A;  2M87 A;  5LGT A;  5HDG A;  3JTH A;  4PZJ A;  2LRD A;  3DV8 A;  2M2E A;  1HA8 A;  3CJT B;  2D1V A;  1N25 A;  2DDA A;  3SZG A;  1H8A C;  1BI1 A;  3I3L A;  3IWZ A;  5DV5 A;  2HDD A;  1U2W A;  4XQF A;  1DP7 P;  4G7O F;  4NC6 A;  3GXO A;  4BBS J;  1ACI A;  3HRS A;  3VYT B;  5DTD A;  2WAQ N;  3OMY A;  4UB6 C;  2WBM A;  5DD8 A;  3G71 I;  4IEJ A;  2DT7 B;  1FTZ A;  5L3E A;  2M30 A;  3D5R C;  4M3E A;  3OIQ A;  2E1C A;  4IRG A;  5FGM A;  1F36 A;  3MZ8 A;  4C2T A;  2LBF A;  3F8N A;  2QZ8 A;  3D0S A;  3DBH B;  1IAW A;  4C9Y A;  4BGD A;  1BR2 A;  4IRI A;  5ICF A;  1I39 A;  3JRH A;  1Y8R B;  2L01 A;  4ENM A;  3X2Q H;  5DM7 F;  3C18 A;  4L9N A;  2KPM A;  4E7K A;  4E70 A;  1H0M A;  3S15 J;  4RM3 A;  4W1U A;  4HF1 A;  4ITV A;  5IOY A;  4F55 A;  4EGZ A;  2DMQ A;  2AS5 F;  5ED4 A;  1TNS A;  2LY1 A;  3GTJ J;  2VQH A;  2VXZ A;  5DUK A;  5BNG A;  2BY0 A;  4N9H A;  1IRG A;  3EYY A;  3FXM A;  2DJN A;  1ETK A;  2FUG 2;  1BW6 A;  5CVJ A;  3S32 A;  5F27 A;  2CSO A;  2JVH A;  4F92 B;  1DP3 A;  4B4C A;  2BGC A;  4RAY A;  4A3J J;  3HOU J;  5KNL A;  1FIP A;  5KCM A;  1U8B A;  1SAU A;  2XRN A;  1CF7 B;  1X2M A;  3S1N J;  3U9G A;  2M8G X;  1TW3 A;  4AYB N;  3PL8 A;  1T33 A;  3K4C A;  3OYJ A;  4WF2 A;  1U5T A;  3HGY A;  1VQK I;  5IPA A;  2RC4 A;  1UHW A;  2VJ4 A;  1SD7 A;  1TQP A;  1SVO A;  4LFU A;  3ZQI A;  3M1E A;  4KA4 A;  1GDT A;  1LFP A;  2QYO A;  1NK2 P;  2J5O A;  5IP6 A;  3NAR A;  1R4M B;  2DA7 A;  2HXI A;  2ZXJ A;  1MNM C;  1VQN I;  3HRU A;  4I2O A;  5TIS C;  1AWC A;  3U1D A;  2VPR A;  5CKT A;  3K9T A;  4EMS A;  1MBG A;  4YFN F;  3LSG A;  4HV6 A;  1BI3 A;  1R71 A;  3WE2 A;  3F72 A;  1Z6T A;  3P9K A;  4RAG A;  2VT2 A;  2H27 A;  5E3M A;  2ICW G;  3HOW J;  1DPR A;  2MSY A;  3G6E I;  3CUQ C;  3ULQ B;  4AVZ A;  3H9G A;  1AU7 A;  3WTT C;  2KZV A;  4BKX A;  2JA5 J;  1TP4 A;  3HM5 A;  3F9K A;  2DO7 A;  2OUM A;  3I0T A;  4A0Z A;  4DYQ A;  3BG7 A;  4MEX F;  1NTC A;  1FIA A;  3C2B A;  5J1U A;  1MKM A;  4E7J A;  5J1R A;  2Z2S B;  3GO5 A;  3S1Q J;  4P96 A;  2L5Q A;  2MG4 A;  2V9P A;  1XN7 A;  2DA1 A;  1FBQ A;  2EB7 A;  2ETH A;  3M8F A;  1HDD C;  1P4W A;  3MKW B;  3JRE A;  2QSG X;  3ABU A;  3CJR B;  1P4X A;  2XDV A;  3V8J A;  5IYC J;  4A3B J;  3EUH C;  2DMU A;  4XK4 A;  3JCU C;  3PUB A;  4Y3O A;  5ERI A;  1BBY A;  3LSK A;  3OOU A;  3R6S A;  3I5U A;  4XM3 A;  2V1N A;  2IXS A;  3RI4 A;  1R00 A;  3ISP A;  4CIC A;  3W2V A;  2K9N A;  4A0X A;  5JR3 A;  5C4X J;  1NHA A;  4HG2 A;  1LFB A;  5IYD J;  4V2F A;  4JOM A;  2OTL I;  4WXH A;  3UR3 C;  2IS2 A;  5CVV A;  1ORK A;  1X3U A;  2KJC A;  1UG0 A;  3GTG J;  5H20 A;  2ACJ A;  3CMA I;  2PMU A;  2WY8 Q;  3K10 A;  1B59 A;  3T8R A;  3TOA A;  2RQQ A;  1QZE A;  3VFZ A;  4II2 A;  3VPR A;  2VPL A;  3GTL J;  2IT0 A;  3GZ6 A;  1UHS A;  4B3X A;  2JUC A;  5M3M J;  3ZMU A;  1EF4 A;  3FKJ A;  2I10 A;  2DXI A;  5JLX A;  1ZR2 A;  5LGN A;  5GPC A;  1W7P A;  1LE8 A;  2YR2 A;  4CH7 A;  5K7F A;  1BI0 A;  2CMP A;  2HU9 A;  5KVR A;  2MD5 A;  3SYT A;  2DOF A;  4KJZ A;  3SHF A;  5JFR A;  2K40 A;  1QNT A;  2R5Z A;  3MKY B;  4OIN F;  5GTH C;  2EFQ A;  2A6H F;  2E60 A;  1T39 A;  1FSH A;  1FYM A;  2R7D A;  2QF7 A;  3FIS A;  4HLY A;  5FRM A;  4ANJ A;  3H5R A;  2JA8 J;  1AKH A;  1ENH A;  2ELH A;  4YIF A;  1E3H A;  1YS6 A;  4PSX A;  2B7E A;  4XOT A;  1XPX A;  3HUG A;  5CJ9 A;  3V8K A;  4LGW A;  2LLK A;  2Y9Z A;  3DKY A;  3J7Y J;  2KDZ A;  3H36 A;  4PK4 A;  5DD4 A;  5BS6 A;  3E5U A;  5K5O A;  1ZR4 A;  4I0B A;  2UV1 A;  2WB1 A;  2W25 A;  2IS1 A;  2LC2 A;  1ZG5 A;  3IHU A;  4AUX A;  5HLG A;  1SFK A;  1X1C A;  5CPR B;  2CQK A;  1I3Q J;  2P5V A;  1ZLJ A;  1YX3 A;  5E3L A;  1R36 A;  4P55 A;  3H0G J;  3WGI A;  3VWB A;  3TQN A;  1R9T J;  2ELJ A;  1C0W A;  3CCJ I;  2LYC A;  2W84 A;  1RNL A;  1WH5 A;  3HKZ A;  1B72 A;  2KDO A;  1ZQ3 P;  4XN3 A;  3VYS B;  5F1R A;  3IRQ A;  1TWA J;  2FBK A;  2FQ4 A;  3ABM H;  1IV6 A;  1NG7 A;  4NB5 A;  4BY7 J;  5D8K B;  1YIJ I;  1GVJ A;  4YFX F;  1FYK A;  2GM4 A;  1J9I A;  5D8L B;  3S16 J;  2G9W A;  3DKX A;  1ETX A;  2ADU A;  3HJE A;  3EUK L;  1FOY A;  4LIV A;  4HF2 A;  1WZ2 A;  2LMD A;  2QUF A;  4Y52 J;  1OPC A;  3TDU C;  3QOE A;  4XRF A;  2VT3 A;  2ME6 A;  1VQ9 I;  2KMU A;  4X6A J;  2HOA A;  4M3G A;  3S93 A;  4C3J J;  3R0A A;  3C2G A;  3PQJ A;  3FK7 A;  3TW7 A;  4O5V A;  1WJC A;  1K83 J;  5HS7 A;  3W6J B;  4D1Q A;  1WGX A;  1PUF B;  1R4N B;  3K70 C;  3P5J A;  4ZJZ A;  2Y31 A;  3B6C A;  3KYL A;  2GXA A;  2ZFU A;  2VOD A;  3QRF F;  3HIF A;  2JUG A;  1PYV A;  2F5V A;  2GOM A;  1T2K A;  2VBX A;  2OA4 A;  4NC8 A;  4TV7 A;  3BJA A;  3P9C A;  3H3V K;  1SMY F;  3DLA A;  3Q0W A;  2VXD A;  4UNO A;  3AL0 C;  3GWZ A;  2V1X A;  2IGM A;  3LFK A;  4BJT A;  1IUY A;  4EM2 A;  3K4L A;  3MFK A;  1RPW A;  2V79 A;  3SZT A;  3AFH A;  4A69 C;  2JVG A;  2E1M C;  3T0Y A;  4BQA A;  3J7A Y;  1S3J A;  3O2P E;  3GFJ A;  4HNT A;  4HF0 A;  4NQW B;  4D5C A;  3BTL A;  1MJ9 A;  4ESF A;  4YRV A;  3KP4 A;  3J80 K;  4KYW A;  1HW1 A;  3HHG A;  4AVP A;  3QPS A;  2WAF A;  2HPM A;  3K4J A;  1YRN B;  1VF9 A;  3IH2 A;  4ZYH A;  2LKP A;  2QBY B;  3KFW X;  1QU3 A;  3O8H A;  1BIA A;  4I76 A;  3G1M A;  5F04 A;  2EA4 A;  3WG9 A;  1A6Q A;  2PJP A;  2CRG A;  4QSH A;  5CQG A;  2R7T A;  3ZMZ A;  3C3W A;  2G7H A;  4U0Y A;  2RNG A;  1EH8 A;  3WU2 C;  2IA0 A;  1R5H A;  1QZZ A;  2NVX J;  3BG9 A;  4G8X A;  3LSP A;  2W85 A;  3OYM A;  2DFF A;  3ZR8 X;  1H9T A;  2FOK A;  2R5Y A;  4Q48 A;  2NXN B;  4DNC A;  1OLT A;  4QPO A;  1S7O A;  2LVS A;  4RB3 C;  4FET A;  3VYR B;  3KET A;  4BQN A;  2LG4 A;  1FT9 A;  1T6S A;  4RGS A;  3ECO A;  2NVT J;  2MH9 A;  4A12 A;  1FOK A;  1ZGA A;  3WOD F;  3S2H J;  1Z67 A;  3ZN0 A;  2OF7 A;  3L7W A;  4HZF A;  3DWL E;  2GAU A;  2O7O A;  1MIJ A;  1D1A A;  2NOJ B;  3BZK A;  1H9G A;  2YX4 A;  5D5U B;  1TL8 A;  4IHX A;  2WAE A;  2QA4 I;  2JK3 A;  2OPT A;  3PM1 A;  2CJJ A;  3GVA A;  1V5F A;  1IC8 A;  1J5Y A;  1MMG A;  5K7Z A;  2IA1 A;  1B8I A;  2KIQ A;  5J1Y A;  2NOG A;  2BW3 A;  1UFM A;  3F8M A;  4WK8 F;  4MNU A;  1KQ0 A;  1HXD A;  3O8G A;  1UG2 A;  4M3B A;  2EFO A;  2O8X A;  4L18 B;  4EJV A;  4CCM A;  1XD7 A;  4M3D A;  2J5P A;  4MFE A;  4U7B A;  3WTY C;  2XPW A;  5GAE J;  1OFC X;  4AD9 A;  3JRF A;  1Z91 A;  4UB8 C;  1VTN C;  1BR4 A;  1OR7 C;  2CV0 A;  3ZCO A;  2BOL A;  4XON A;  4BE0 A;  2QVO A;  2P5K A;  3CC2 I;  1UJ8 A;  1D1C A;  4EAT A;  3GEZ A;  2ZJR F;  3BTJ A;  4E6K G;  3LWF A;  1LDJ A;  5LRS A;  5IOZ A;  2IGK A;  3CDI A;  3J81 K;  4DZP A;  1IGN A;  4IHV A;  3H3Z A;  3RKY A;  3M07 A;  1IN4 A; 
#chains in the Genus database with same CATH homology
 2WB1 N;  2LTP A;  1DU0 A;  3CQZ J;  4XRS A;  1H88 C;  4MLO A;  1OCP A;  2DMN A;  1IJW C;  1I50 J;  1IRZ A;  2XSD C;  2FX0 A;  2E1O A;  2HXO A;  5F1J A;  3JRC A;  5C3E J;  3B6A A;  2M2E A;  3CCY A;  3MKL A;  1Z77 A;  1H8A C;  1X58 A;  2HDD A;  2X9D A;  4M6V A;  3HOX J;  4BBS J;  2IBD A;  1OCT C;  5IP7 J;  5DTD A;  2DMP A;  2WAQ N;  2NS8 A;  1YRN A;  3HOV J;  2HQ5 A;  4LOC A;  4MIM A;  5M5W J;  4IEJ A;  2EZK A;  5FKN A;  1FTZ A;  2HYJ A;  3BR2 A;  5EZH A;  4M3E A;  5IYB J;  3BR6 A;  3LNQ A;  1F36 A;  1HF0 A;  4ABZ A;  2EZI A;  2CU7 A;  1P7J A;  1XS9 A;  1K61 A;  3IH4 A;  2VKE A;  3JRH A;  1LFU P;  4JX6 A;  4FE4 A;  5K7H A;  5M5X J;  2L9R A;  3GBG A;  3I4M J;  1JKO C;  3S15 J;  4W1U A;  3HOY J;  1JKR C;  5IOY A;  1UMQ A;  2DMQ A;  2X48 A;  3ZQC A;  3HBL A;  2XGE A;  3BR5 A;  2E2I J;  3GTJ J;  5BNG A;  2G0E A;  3HDD A;  2JA6 J;  3GTP J;  2VUM J;  1TC3 C;  1RES A;  2DJN A;  1ETK A;  1BW6 A;  1LE8 B;  2CUF A;  5F27 A;  3S1M J;  1I6H J;  3DEW A;  4NDL A;  4B4C A;  2LKX A;  4A3J J;  3HOU J;  1FIP A;  2ME0 A;  4M3F A;  2D5V A;  5DS9 A;  2XPU A;  3JRB A;  1U8B A;  5F0C A;  1WH7 A;  1X2M A;  1WCM J;  3S1N J;  4A3C J;  2DMT A;  4FIS A;  2M8G X;  4AYB N;  2XGC A;  1T33 A;  2O9L A;  3Q0V A;  3F0C A;  1MBK A;  1W0T A;  2M9H A;  1ZK8 A;  2LY9 A;  3HGY A;  2JA7 J;  4DYR A;  1O4X A;  5IPA A;  1XG1 A;  3TW6 A;  4A3K J;  1U78 A;  3ZQI A;  3OSF A;  2IEK A;  1GDT A;  2EZH A;  1Q1V A;  2CQQ A;  2XGD A;  1AKH B;  1NK2 P;  5IP6 A;  3NAR A;  5GP9 A;  1D5Y A;  2DA7 A;  2HXI A;  4CYC B;  1MNM C;  4G12 A;  5M3F J;  3JR9 A;  2E2J J;  2Y30 A;  2VPR A;  5IP9 J;  4FTH A;  1MBG A;  1ETQ A;  1RET A;  3LSG A;  3OIO A;  4A3M J;  4C2M J;  3S17 J;  5E3M A;  3HOW J;  2MSY A;  2LFB A;  2NVY J;  4XRM A;  1AU7 A;  5E3N A;  2NS7 A;  4BKX A;  3TP0 A;  2JA5 J;  3A01 B;  2Y9Y A;  3HM5 A;  2PMZ N;  1RR7 A;  2NVQ J;  1GV5 A;  4DYQ A;  1IDZ A;  1S7E A;  1NTC A;  1FEX A;  1FIA A;  1QVU A;  3C2B A;  5J1U A;  3HOZ J;  1GV2 A;  1RKW A;  2Y0S N;  5J1R A;  2H1K A;  3S1Q J;  2IAI A;  2MG4 A;  2P81 A;  4Y7N J;  1B72 B;  1AHD P;  3OSG A;  2DA1 A;  3W6V A;  2XB5 A;  1TWG J;  1HDD C;  2DA2 A;  2E19 A;  3JRE A;  1MBH A;  2LP0 A;  3WHB A;  3ZQH A;  3DCF A;  3RZD J;  3IH3 A;  1BW5 A;  5IYC J;  4A3B J;  1ETY A;  2DMU A;  4XK4 A;  2EH3 A;  3ZOB A;  1P7I A;  3BTI A;  3E7L A;  3S14 J;  1MH3 A;  2Y2Z A;  3OOU A;  5C4J J;  2XRL A;  4MO7 A;  5EG0 B;  2K9N A;  1JGG A;  4C3H J;  5C4X J;  1LFB A;  5IYD J;  4V2F A;  5EEA A;  5J3L A;  1ORK A;  5EDN A;  3GTO J;  5EGO A;  3G1O A;  3GTG J;  2O8K A;  1ITY A;  4J19 A;  2M0C A;  2HOT A;  2GLO A;  5JLW A;  1VND A;  1WI3 A;  1H89 C;  3BG3 A;  1HOM A;  2JN6 A;  5E3O A;  3VPR A;  5EGO B;  3GTL J;  2ZB9 A;  1UHS A;  5C44 J;  1QRY A;  4B1R A;  4C3I J;  5M3M J;  1BJZ A;  1EF4 A;  2ID6 A;  4IHW A;  4UUS B;  1Y1V J;  2I10 A;  5JLX A;  1ZR2 A;  5GPC A;  1LE8 A;  1ETV A;  2L7Z A;  3QPL A;  5K7F A;  4FCY A;  3FIW A;  1XC5 A;  2TRT A;  2EZL A;  3BTC A;  2K40 A;  2E2H J;  4A93 J;  1CQT A;  2R5Z A;  1JTY A;  4BY1 J;  2M34 A;  1T56 A;  1E3O C;  2DTZ A;  2QF7 A;  3MVP A;  3FIS A;  1JT6 A;  2MGQ A;  3RKQ A;  3L1P A;  2R5Z B;  3D1N I;  1IG7 A;  2JA8 J;  1AKH A;  1ENH A;  5EZG A;  2ECC A;  2TCT A;  4D5F A;  4MFD A;  2LK2 A;  1W0U A;  4B3A A;  2VKV A;  4CYC A;  2R5Y B;  2JWT A;  2R7Z J;  5FKL A;  2R93 J;  2LLK A;  2Y9Z A;  1QPI A;  3CDL A;  4A3I J;  4A3D J;  4RDU A;  4XID A;  2KDZ A;  1U9O A;  4XRS G;  3CMY A;  2DA3 A;  2JMW A;  4A3E J;  5FLM J;  1ZR4 A;  4X1E A;  1HCR A;  4AUX A;  5FKK A;  1F43 A;  3NAU A;  5FKO A;  5GPA A;  1I3Q J;  5F0H A;  2ID3 A;  3A01 A;  5E3L A;  2DA5 A;  3H0G J;  3M3Y J;  2QCO A;  1R9T J;  3HGG A;  3SJM A;  3GTM J;  1TWC J;  3A03 A;  5F08 A;  1WH5 A;  2AHQ A;  1B72 A;  1ZQ3 P;  3RZO J;  1RKT A;  2GBY A;  3WHC A;  1OJL A;  1TWA J;  1HLV A;  2FQ4 A;  1GT0 C;  1IV6 A;  2FD5 A;  1FTT A;  4BY7 J;  2GM4 A;  2B63 J;  3IV5 A;  3S16 J;  3ZQL A;  4FE7 A;  4W97 A;  4D7N A;  3JRD A;  3BQZ A;  1ETX A;  3LSR A;  5FLV A;  2COB A;  2WV1 A;  3UKG A;  5EG0 A;  4Y52 J;  2FJ1 A;  3TED A;  1DU6 A;  2ME6 A;  1A5J A;  4X6A J;  2HOA A;  4M3G A;  4C3J J;  2CUE A;  3TW7 A;  3FK7 A;  5FKM A;  4I6Z A;  4V2G A;  2ECB A;  3BR3 A;  1K83 J;  4IHY A;  1BA5 A;  1WGX A;  3ZQF A;  1PUF B;  2EBI A;  2Y31 A;  3B6C A;  4UUT A;  2JJ7 A;  3Q3S A;  1QVT A;  3S2D J;  3I4N J;  4QIW N;  2XB0 X;  2RAE A;  3RQI A;  4JX5 A;  1JJ6 C;  3LOC A;  1JKP C;  1BL0 A;  3BR1 A;  1MSE C;  3H3V K;  4A3F J;  1JJ8 C;  3Q0W A;  4DZJ A;  2X6O A;  2XPV A;  3HKZ N;  3MN2 A;  2CQX A;  1JKQ C;  5EYR A;  3M4O J;  1RPW A;  4UUS A;  4A69 C;  3PO3 J;  1Z0X A;  3BR0 A;  2R92 J;  2L0K A;  4HNV A;  1A6I A;  2LD5 A;  4D5C A;  1ZTR A;  3BTL A;  1SFO J;  4BXX J;  3QQA A;  1WPK A;  2W48 A;  4BBR J;  3QPS A;  3BT9 A;  1YRN B;  4L5E A;  1VF9 A;  3IH2 A;  3SDG A;  3G1L A;  4EEF G;  1G2H A;  3O8H A;  2LR8 A;  4I76 A;  3G1M A;  5F04 A;  1VI0 A;  3JRA A;  1JUS A;  2CRG A;  4QSH A;  1VFC A;  1JUM A;  3K7A J;  1JUP A;  1MBE A;  3Q0U A;  4S0H B;  2AO9 A;  4DYC A;  2NVX J;  1MSF C;  3BG9 A;  1GUU A;  4JX4 A;  3LSP A;  3GTK J;  1Y1W J;  3FK6 A;  2R5Y A;  1ETW A;  1FJL A;  2MW8 A;  1U9N A;  4RBO A;  2LVS A;  3SFI A;  3K2A A;  3FKI J;  2YU9 J;  2R0Q C;  4JYK A;  4XIC A;  2NVT J;  3S2H J;  1TWH J;  3BG5 A;  2OF7 A;  4QTR A;  2YUS A;  2O7O A;  1MBJ A;  3LSJ A;  4IHX A;  2JK3 A;  2OPT A;  3PM1 A;  2CJJ A;  5HOD A;  1APL C;  1IC8 A;  3HEF A;  5K7Z A;  1B8I A;  1JTX A;  2K9Q A;  5J1Y A;  3ZQG A;  2H8R A;  3JRI A;  5M5Y J;  1GVD A;  2NOG A;  1TWF J;  2DA6 A;  4D7M A;  3BQY A;  5F0F A;  9ANT A;  1NK3 P;  3O8G A;  2EQR A;  1ZKG A;  2N8G A;  2VI6 A;  1UG2 A;  4M3B A;  2L7F P;  1B8I B;  5EF6 A;  1SAN A;  1ETO A;  4M3D A;  4MFE A;  4AC0 A;  3JRG A;  3S1R J;  1ZGW A;  2XPW A;  3PO2 J;  4A3G J;  1OFC X;  3JRF A;  1JT0 A;  2HI3 A;  2DA4 A;  2HOS A;  2DN0 A;  1IDY A;  3HB9 A;  1HDP A;  2YS9 A;  3BTJ A;  4GFB A;  1PUF A;  3TP3 A;  5IOZ A;  1X2N A;  2ELK A;  2K9S A;  4A3L J;  2KT0 A;  5FJ8 J;  4DZP A;  1IGN A;  4IHV A;  1IUF A;  1MBF A;  1POG A;  2L7M P;  3A02 A;  3GTQ J;  4JP0 A;  1MH4 A;  4DW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...