1XS9A

A model of the ternary complex formed between mara, the alpha-ctd of rna polymerase and dna
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
129
structure length
129
Chain Sequence
b'MTMSRRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAERYGFESQQTLTRTFKNYFDVPPHKYRMTNMQGESRFLHPLNHYNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*GP*AP*TP*TP*TP*AP*GP*CP*AP*AP*AP*AP*CP*GP*TP*GP*GP*CP
publication title Versatility of the carboxy-terminal domain of the alpha subunit of RNA polymerase in transcriptional activation: use of the DNA contact site as a protein contact site for MarA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 39
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2004-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12833 HTH_18 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1xs9A02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1xs9A01
4RDUA 4A3MJ 2ME0A 2Y31A 1WI3A 2YS9A 3VPRA 1GV2A 1X2MA 5EF6A 2NVYJ 2EZIA 1POGA 3ZQFA 4X6AJ 5F27A 1JKQC 3JRCA 2FQ4A 1IC8A 1NK3P 4V2FA 1MBFA 1RETA 1XG1A 1XC5A 4S0HB 2D5VA 5HODA 2R7ZJ 3I4NJ 2JA5J 2FX0A 4FTHA 2VKVA 2R93J 5FKOA 4D5FA 2RAEA 2ECCA 2QF7A 5E3MA 5DTDA 5F0HA 4FE7A 3FK7A 3TW7A 2XPWA 3BR2A 2EZLA 1RKTA 4A3DJ 3G1MA 2HXIA 3GTPJ 2IEKA 4M3GA 2R0QC 4XIDA 1H8AC 4AYBN 2DMNA 3PO3J 1H88C 2GBYA 3O8HA 1GV5A 2R5YB 2CRGA 2DMUA 2ELKA 4A3LJ 5FJ8J 1FTZA 1WCMJ 2XPUA 3ZOBA 4QTRA 1U8BA 5C3EJ 4M3FA 3LOCA 2LR8A 2LTPA 5IOZA 5E3OA 5BNGA 1P7JA 1VNDA 3S15J 2E2JJ 2JK3A 1ETWA 4XRSG 3HM5A 5J1UA 2CJJA 2X9DA 4B3AA 1ITYA 1ETOA 4CYCA 3OSGA 2L0KA 1FTTA 1MBGA 3TEDA 1VF9A 1GVDA 4BXXJ 3H3VK 4W97A 2LVSA 4XK4A 1VFCA 5IP7J 2H1KA 3M3YJ 5EZGA 2HDDA 2LLKA 1IRZA 5EDNA 1I6HJ 1JUPA 2JMWA 2HXOA 4JYKA 2LP0A 5EGOA 3LNQA 2GLOA 1MBEA 4QIWN 1XS9A 1HF0A 2NVQJ 2HOSA 1MH4A 5IYBJ 1LFUP 3HDDA 3K2AA 2L7MP 2Y0SN 2X6OA 4A3BJ 2DMQA 5FKNA 4EEFG 2MSYA 2E1OA 1HDPA 5J3LA 4JX6A 5E3LA 1F43A 5GPAA 1BJZA 5JLWA 3HOVJ 1B8IB 3QPSA 5F0FA 1TWGJ 2PMZN 3LSRA 4MFEA 1IJWC 2ECBA 3SJMA 2CUFA 4BBSJ 4D5CA 5J1RA 1IUFA 1ETQA 4A3CJ 3IH3A 2XSDC 1Z77A 1IDYA 1F36A 5EEAA 4Y7NJ 1MSFC 4FISA 2R5ZB 1ETYA 4FE4A 2CU7A 1FIAA 2MGQA 3JRHA 3GTJJ 5FLMJ 1IDZA 3HGYA 4A3FJ 3CQZJ 9ANTA 1O4XA 3BQYA 2Y9YA 1IG7A 2DA6A 5FKMA 3BQZA 5F08A 3S1QJ 3ZQLA 1YRNB 4M6VA 1ZQ3P 1S7EA 3BTIA 2HOAA 1OCTC 2HI3A 2DA7A 2K9QA 3UKGA 3BTJA 2JA6J 1X58A 1SANA 1JKPC 4IHVA 1U9OA 4GFBA 3I4MJ 4UUSA 2VPRA 3MN2A 3LSJA 2EZHA 2VI6A 1SFOJ 1TC3C 4BBRJ 5EG0B 2N8GA 1RR7A 3JRBA 2AO9A 3B6AA 3WHCA 3ZQGA 3ZQIA 3HBLA 1WH5A 2G0EA 2H8RA 2LD5A 3HGGA 4LOCA 4C3HJ 2E2HJ 1ETKA 3A01B 2M8GX 1B72B 1GDTA 1PUFB 3HEFA 4IHXA 5FLVA 4I76A 3HOUJ 2OPTA 1TWAJ 3CDLA 3S1MJ 3DEWA 5EZHA 2IBDA 4XRMA 1QVUA 5F04A 3W6VA 2NVXJ 2XB0X 2B63J 4IHYA 1WPKA 3B6CA 3S16J 4C3JJ 3CCYA 1LFBA 1RESA 1MNMC 1R9TJ 4DYQA 3E7LA 1Q1VA 3HOYJ 4DW6A 1ETXA 1X2NA 1AKHB 2EBIA 2ID6A 3S1NJ 1TWFJ 4HNVA 1ZK8A 2AHQA 2Y9ZA 1OCPA 3LSGA 4A69C 4A3EJ 4ABZA 2K9NA 2R92J 3S14J 5GP9A 2DA5A 4V2GA 4J19A 4BY1J 4MIMA 4DYCA 1MBKA 3RQIA 5JLXA 1TWCJ 4A3KJ 3OIOA 3CMYA 2W48A 5F0CA 4DZPA 3HKZN 1ZTRA 2COBA 3MVPA 2ID3A 4JX5A 3IV5A 2DJNA 1NK2P 5M5YJ 3IH2A 2DMPA 4AUXA 1ETVA 3RZOJ 4D7MA 4I6ZA 1GT0C 3BTLA 5IPAA 2L7FP 4W1UA 5M5WJ 4C2MJ 3JRGA 2KDZA 2CQXA 3QQAA 3JRAA 2EQRA 4C3IJ 5IYDJ 5C44J 1RKWA 1NTCA 2O7OA 1LE8A 2NVTJ 3BG5A 3Q3SA 4M3EA 2X48A 5J1YA 2HOTA 4G12A 2JJ7A 1JJ8C 1GUUA 3TW6A 2Y30A 2EZKA 2TRTA 1UMQA 3Q0WA 1BA5A 2M9HA 2XGEA 3DCFA 4BKXA 3OSFA 3FK6A 4IHWA 5M5XJ 2E19A 1JKOC 5M3MJ 1D5YA 2MG4A 5M3FJ 2K9SA 4A93J 3C2BA 2ME6A 3QPLA 3PO2J 5C4XJ 3JRFA 1I3QJ 2XB5A 4L5EA 5K7HA 1JJ6C 5E3NA 1P7IA 3ZQCA 1ZKGA 1U78A 2DA1A 3S2DJ 4CYCB 1Y1WJ 1RPWA 2JN6A 3L1PA 4B4CA 3OOUA 3HB9A 1Y1VJ 3FISA 2P81A 3G1LA 2XPVA 3NAUA 2DA4A 3BT9A 4FCYA 3JRDA 1ZR4A 3A03A 2R5YA 1BW5A 3K7AJ 2OF7A 4DZJA 4AC0A 3GTGJ 3A02A 2IAIA 3LSPA 1ZR2A 5EGOB 4XICA 1JT0A 2JA7J 4JP0A 1JTXA 5FKLA 3BR3A 1FIPA 2YUSA 1K61A 3S17J 4XRSA 1WGXA 2QCOA 2E2IJ 1QVTA 3FIWA 5FKKA 2WB1N 3Q0VA 5K7ZA 1ORKA 5IP6A 1QRYA 1IGNA 1BW6A 3NARA 2LY9A 3TP3A 2GM4A 3GTKJ 1A6IA 2VUMJ 4MLOA 2NS7A 4QSHA 2XGDA 3JR9A 3H0GJ 3JRIA 1FEXA 2YU9J 3MKLA 3HOZJ 4BY7J 1OJLA 5GPCA 1AHDP 1MSEC 2TCTA 2M0CA 2XRLA 5IOYA 3IH4A 3S2HJ 5DS9A 3GTOJ 3Q0UA 2VKEA 5F1JA 2FD5A 2NOGA 1HDDC 1B8IA 4UUTA 1WH7A 4M3BA 1U9NA 2HQ5A 5EYRA 1MBJA 4IEJA 3GTLJ 1HLVA 4D7NA 1JGGA 4UUSB 1MBHA 2XGCA 3BR5A 4A3IJ 1I50J 1T33A 2CUEA 1T56A 2R5ZA 3RKQA 4RBOA 2DA3A 1ZGWA 1H89C 3FKIJ 1DU6A 2CQQA 1W0UA 5IP9J 2I10A 1TWHJ 2JWTA 3HOXJ 1HCRA 2M34A 1YRNA 3BR6A 2DA2A 5C4JJ 1UHSA 3BR0A 1DU0A 2HYJA 4JX4A 4B1RA 3WHBA 1A5JA 4A3GJ 2DN0A 3S1RJ 2LKXA 5EG0A 3D1NI 3G1OA 1IV6A 1FJLA 1JT6A 2JA8J 3BTCA 1JKRC 1ENHA 2Y2ZA 4A3JJ 2WV1A 4M3DA 2MW8A 3BG3A 2L9RA 2DMTA 3PM1A 1E3OC 1Z0XA 3TP0A 1VI0A 1W0TA 1EF4A 4NDLA 3SDGA 2O8KA 2WAQN 3ZQHA 2L7ZA 2LFBA 3GTMJ 3A01A 3O8GA 1B72A 1QPIA 1PUFA 2K40A 2M2EA 3M4OJ 4Y52J 3HOWJ 2ZB9A 3GTQJ 4DYRA 5IYCJ 1OFCX 1HOMA 3RZDJ 1BL0A 2FJ1A 1JUSA 2LK2A 1G2HA 1UG2A 1AU7A 3JREA 2NS8A 3BG9A 2KT0A 4MFDA 2DTZA 1MH3A 2EH3A 1AKHA 3GBGA 1JTYA 1K83J 3F0CA 3SFIA 1JUMA 5K7FA 4MO7A 3BR1A 2O9LA 1CQTA 1APLC 1LE8B 4X1EA
chains in the Genus database with same CATH superfamily
4A3MJ 4KIGA 5CVJA 2DT7B 1FC3A 2HNHA 2ME0A 2Y31A 2DDBA 3ULQB 3KEQA 1WI3A 3L2RA 1P2FA 3CUQB 3DBLB 4H0EA 3NRVA 3OYAA 4YFKF 3COAC 1K78A 3R0JA 3FM3A 4B09A 2PLYA 1V3FA 2EIKH 3NEUA 5F27A 3BZKA 1LJ9A 3ZR8X 2V1XA 1GLNA 4V2FA 1M1EB 1QQIA 2L5QA 1GXPA 3M8FA 5HODA 2ZMEB 4CCMA 2WTEA 4OIQF 4IX7A 4C9YA 2L4AA 2RAEA 2QF7A 4FE7A 3FK7A 3TW7A 2XPWA 5F1RA 2E7WA 4RAGA 2EZLA 1YE9A 1RKTA 2LMDA 3S93A 5ICCA 2M45A 3SHFA 3O6BB 4IHTA 2IEKA 2A6TA 2R0QC 2AQFA 1IF1A 5BS6A 3PO3J 2CQKA 4KIFA 4BHCA 1HBXG 2M4KA 1GV5A 1KU3A 3CLOA 2F6CA 4A3LJ 1XSDA 3CTAA 3HRSA 1DGWY 2AQEA 1FTZA 2CS3A 2XAFA 2Y75A 2XASA 1Y39A 4ZDLA 2R7XA 1HW1A 3LOCA 1BOAA 5E3OA 5BNGA 2XAJA 1F1ZA 3MKZA 1VNDA 5LHGA 3S15J 1D1AA 1EJ9A 2JK3A 1ETWA 3HM5A 1ODDA 4AD9A 1YTYA 2X9DA 2IGOA 4B3AA 4KUMA 1FBQA 1IN8A 1OCOH 4X0GA 1MBGA 3SEQA 1BC8C 4CZCA 5J40A 3FWEA 3DKYA 4YRVA 4BXXJ 3QPHA 2KJCA 2H1KA 2Z3YA 3U21A 1BI0A 3OYNA 1IRZA 3OOPA 5EDNA 2NS0A 2L3DA 1Z7UA 2E36A 1IXCA 1JUPA 1KONA 4PUSA 2WWYA 4JYKA 5EGOA 3KZIC 1MBEA 4QIWN 4G6DA 4KITB 3VYTB 1SFUA 4MTDA 2BOLA 2NVQJ 2XF6A 1MH4A 1OCZH 5IYBJ 2BE5F 2KIUA 1LFUP 3HDDA 3K2AA 2JZYA 3OL3A 2L7MP 2X6OA 5FKNA 5LBQA 4XKWA 2E1OA 1YJNI 1XDSA 2FOKA 2KLOA 5JLWA 1ZELA 4BYYA 1BBYA 1B8IB 4IOAF 3LSRA 1U6GA 5J1RA 6PAXA 3DFGA 1Z67A 5H20A 3ZMDA 1ETQA 3IH3A 3LA3A 5D4RA 4BU2A 1IDYA 4CA0A 4DJAA 1MSFC 4BHBA 4BJTA 3CP8A 1ETYA 5H6RA 2XROA 3GTJJ 1LPQA 4KFCA 3GFMA 2EFQA 5FLMJ 3HGYA 4EV0A 2NRAC 1YW9A 3TKYA 2Y9YA 4KN7X 3V7CA 5DUIA 2KMUA 5FKMA 3BQZA 5F08A 3S1QJ 1K4TA 1N75A 4M6VA 1S7EA 1EV7A 3ABLH 5GTIC 2HI3A 2OJED 2WV0A 1XMAA 2XAHA 2XKOA 1X58A 2D45A 2HVSA 3R60A 1R1VA 4OIRF 2ACJA 3VSLA 1B6AA 1U9OA 3PFYA 3LSJA 2VI6A 5HDGA 5E79C 3TO6A 5EG0B 2V1UA 4UB8C 4II3A 5DCMB 1ZAOA 1IAWA 2WB1A 2YR2A 1MKMA 1OPCA 2AO9A 2ETHA 2KDOA 1D1CA 1OCRH 2A05A 2VXDA 1WH5A 3HBLA 3V7RA 3WGIA 2WC2A 1RIOH 3ROUA 2W85A 1WJAA 4R8HA 4A2UA 2B0LA 3AAFA 1MJ9A 1ETKA 1MMDA 2ZFUA 3BDDA 1E17A 4Z6YA 1KU2A 2BV6A 1GDTA 1K79A 3RCOA 1YFHA 2JQ7A 4OU0A 2Q2EB 1TL8A 4PJ0C 2XV4S 1TW2A 5B3SH 3DQVC 1FBUA 4DNCA 2NVXJ 1WPKA 2X51A 4F55A 3FBNB 3OYDA 3V7SA 4C3JJ 1R22A 1RESA 1MNMC 1W7PB 3A0BC 4RM3A 4A5MA 3K9TA 1IRGA 3DKXA 2RDPA 1Z21A 1MJBA 3F8MA 2BY0A 1S7OA 3E7LA 3ECHA 4P9UA 1Q1VA 2O3FA 3RIRA 4DW6A 5GAEJ 1AKHB 2RV8A 5FRNA 1YQAA 2M7BA 3S1NJ 1FT9A 1KGSA 2QYOA 3OS0A 1ZK8A 2L54A 2Q8KA 3X2QH 4ABZA 3BZ6A 2ICWG 4GGGA 3T0YA 3HG9A 3CF2A 4J19A 4JK1X 1PUEE 2XAGA 3ONQA 3SDBA 4IL6C 2IRFG 4BS9A 1TWCJ 3HTSB 1ZYRF 5F0CA 2F2EA 1D1BA 3I55I 2X6XA 1ZHFA 5DM7F 1LEAA 2COBA 4D0PA 2FRHA 2KRCA 4JX5A 3IV5A 1IRFA 3DWLE 5E1ZB 2PJRB 2MC3A 2QZ8A 4AUXA 2DLLA 3CJQB 1KU9A 3RPUA 1DUXC 3CP2A 3WG7H 1TNSA 1SD5A 2IGKA 2HQNA 1GT0C 3PNYA 1LDKB 2L7FP 5HS9A 2EQRA 2P0WA 3QP5A 5C44J 3LMMA 3VOEA 3KYCB 1LE8A 2NVTJ 3TGNA 4AWXB 2NAZA 4G12A 1GUUA 3SYTA 3TW6A 1FBSA 2OC6A 2TRTA 4E7IA 3MKWB 3Q0WA 3HTUA 1VTNC 5DM6F 1YO5C 1NG7A 2ELHA 2P6TA 2GXBA 3DCFA 4XSZF 3ZQQA 3PL8A 1X1DA 3HRMA 4HLXA 4UXNA 2P4WA 1LB2A 2AS5F 3FDYA 3TO9A 4EM0B 2PX9A 3H5RA 1D5YA 3WE2A 2JSCA 2MG4A 5BQTA 1P4XA 1R6RA 2FOWA 2KL4A 4A93J 1K6YA 1FMVA 4HV5A 1QGPA 1WVRA 2DXIA 4XOPA 1V54H 3GX4X 1Q1HA 1KZHA 1P7IA 4FX0A 1ZKGA 3ZQCA 1KA8A 1U78A 3K4LA 4IOCF 2X6YA 4CYCB 3U2RA 3L1PA 4Q5SF 3OOUA 5FLXZ 4HPQA 3FXMA 3G1LA 5E18F 2XPVA 3NAUA 2DFFA 1MZBA 1ZR4A 2CGPA 2LRDA 3OYEA 4UVBA 4DZJA 3QWLA 1MNEA 3WTYC 1W5TA 1IXSB 3TL4X 1QZZA 2K86A 2IAIA 5LRSA 2FXAA 2VB6A 1G3SA 2VKDA 3GFLA 3ZRGA 4XICA 2PFBA 3C7JA 4Y4RA 5FRMA 1DP3A 3IAM2 2DFHA 3CCEI 5HDNA 2E2IJ 1O3SA 1R71A 2QQAA 3FIWA 3DXJF 2F4OB 4D1QA 1QNTA 1QBJA 3Q0VA 4KT6A 2V9PA 2MBFA 2B7EA 3ZMTA 4HQMA 5HVQC 1TZLA 3M1CA 1W36D 1P9QC 5AIQA 5JVTA 2LY9A 3W2VA 4BL0B 1U0JA 3IUOA 4I02A 3GTKJ 3H9GA 2VUMJ 4MLOA 1R1TA 3L2UA 4XKVA 4ZJZA 3JR9A 2XGDA 1WI9A 3HOTA 3J7AO 3V8LA 3JRIA 5CQEA 4I01A 4CSWA 4E7KA 2ZSHB 5GPCA 1AHDP 4HNTA 2X1EA 1WJ5A 2K85A 2TCTA 3E5QA 2M0CA 4CO8A 3GTOJ 3AL0C 5FB2A 3Q0UA 3A2KA 5F1JA 4G7OF 3F21A 2BVMA 3HPHA 4UUTA 2HQ5A 1AA7A 2CUJA 1HKSA 3F8NA 2CFOA 5CPRB 4UNOA 3K6GA 4CCLA 4UUSB 2L4MA 2IS1A 1FNNA 4Y3OA 3BJOA 5D6FA 1OKRA 3QYEA 1I50J 1T33A 2CUEA 2LF8A 2A07F 3PFIA 4U7DA 2R5ZA 4HF2A 4BH9A 4U88A 3M8EA 1FOXA 1OYIA 2JUCA 2OCCH 3GFJA 2R7RA 1H89C 2KQRA 2UZKA 4YELA 2ELJA 1RC9A 2HQAA 2VQCA 2AXLA 3SQNA 2I10A 1T39A 1I1GA 2JWTA 2IS2A 5IY5H 1HCRA 4IRGA 1YRNA 5C4JJ 4Y13A 3D5SC 1DU0A 2DOFA 2HYJA 3ZMZA 3WTTC 5ILUA 1XSVA 4YG2F 1A5JA 2HPIA 2BW3A 3AFHA 2DN0A 4HYEA 3H0DA 2HEOA 2YSRA 3HXLA 2HTJA 2JA8J 1TW3A 2CYYA 2BXYA 3G1OA 4GCVA 1JKRC 4HAMA 5D4SA 1MMAA 2JRMA 1R4NB 2ZBKA 3QAHA 3DPTA 4KMUX 2MW8A 4EATA 1X3WB 3PM1A 3MAJA 1EF4A 4BUPA 3OY9A 3GUDA 3E5UA 4A0ZA 2E5ZA 3MKYB 2L7ZA 3F8FA 3GWZA 1B72A 1QPIA 3R4KA 1PUFA 3KX2A 4HRIA 4NC6A 2MFZA 2W84A 4Y52J 3SFZA 1VQ9I 2ZB9A 2R7SA 2K5CA 4DYRA 5LD2C 4UV9A 1HOMA 1X3ZB 3L7WA 2BBYA 2LK2A 3V8KA 1X1PA 2YX7A 4HF0A 5EEHA 2HWVA 3PJRA 2YX4A 1EKEA 4PSWA 1TT0A 4PFPA 3JREA 4GO1A 2KPMA 4NC8A 5DD4A 1BN5A 3FF5A 4KA4A 2HGCA 2DTZA 4MFDA 3MZ8A 3KP2A 3R0AA 2X0LA 2W7NA 5BPIA 1YHQI 5HNFA 2V1NA 3F0CA 1WKMA 1JUMA 2LH9A 5K7FA 5FD5A 2GOMA 1XGSA 1YIOA 2O9LA 4S04A 2HQRA 1N78A 5K5OA 4D9JA 3A4CA 3EUKL 2IS6A 3K4CA 3KP5A 3P5JA 2YS9A 3VPRA 1X2MA 1FLIA 3PSFA 1OLTA 5GAHJ 3GFIA 1HW2A 4CHUA 1FOWA 4U87A 1SFEA 2QBYA 3OYBA 1POGA 1DPUA 4X6AJ 1JKQC 5BMZA 3W6KB 1VQNI 2RKHA 3V42A 2GAUA 2V9VA 3O2PE 1ZG5A 2IP2A 3SZGA 4Q48A 3ZN0A 2UWMA 1T2KA 2Y48A 3M7GA 1H9TA 2D5VA 4ZDPA 2JA5J 3K1PA 1J0RA 2FX0A 3DPLC 3VYUB 2CV1A 1MMGA 2VKVA 5FKOA 2VQLA 4NQWB 1ZGJA 2KP6A 3LSKA 2Z1DA 3BY6A 3IAS2 3CJRB 1J5YA 5DTDA 5F0HA 3J80K 4E7ZA 1GXQA 1P6RA 2JRTA 1MW7A 4B43A 1GHCA 3G1MA 2HXIA 2OZ6A 4WX9A 4UUVA 1E2XA 4AYBN 2DMNA 4P96A 2GBYA 2QA4I 2L2OA 2ZNZA 1D0XA 1ZREA 1W1WE 1Z1DA 3M8JA 1JI8A 2CRGA 2VE9A 2RQPA 3N4MA 5FJ8J 3GO5A 1WCMJ 2XPUA 4LG3A 4BXUA 3R61A 4BGDA 5C3EJ 2ZMEC 1U8BA 4DBRA 1G3TA 4B3XA 3RQ4A 2LR8A 2LTPA 1P7JA 2ZJQF 3P9CA 2E2JJ 1PVEA 2FSWA 2K4BA 1MDMA 2CJJA 4RB3C 3JCUC 3CO7C 4ESBA 4LFUA 4WF2A 2LREA 3KEOA 3HSEA 2EV5A 2L0KA 1FTTA 3TEDA 1VF9A 1I5ZA 3HL2A 1B59A 4XLEA 1FYKA 4W97A 2GXGA 5LGUA 2LVSA 5DUKA 2HPMA 2K4JA 3M3YJ 4HZFA 3FBIB 5EZGA 2K3FA 2HDDA 3GCMA 4ZC3A 1I6HJ 2JMWA 2KIMA 4F3QA 2VC0A 4GYIA 3H92A 2Z99A 3W3CA 1XS9A 1HF0A 3VYSB 5FD6A 5CKTA 2HOSA 2LBFA 4UY8I 3HYIA 4A3BJ 4EEFG 3WU0A 1N25A 5GPAA 1HKTA 4OAYA 5EJCA 1RRJA 4AIDA 3ZMSA 4P55A 1TBXA 3WE3A 2F4IA 5F0FA 4I0AA 2PMZN 4MFEA 4CCOA 4BBSJ 4IZZA 3C2GA 3J7AY 2DT6A 3GLXA 1R49A 1S9HA 3G4SI 3FM5A 4CCKA 1BR1A 2HVQA 2IA2A 2HS5A 3LA7A 1D3YA 1IUFA 1D0ZA 4CUGA 3JAMK 1S6LA 2XSDC 5GAGJ 1Z77A 3TO7A 3ZXSA 1WQ2A 1CF7A 2CH0A 4Y7NJ 3K10A 1A31A 1KQ8A 3F9KA 1B9NA 4BE2A 1G6NA 3F6OA 3WGHA 2CU7A 3DPUA 4LG0A 1XDUA 3E6DA 2ZJRF 3ZMVA 2OQGA 3TDUC 4O6JA 4A3FJ 4KJZA 1IG7A 3CDHA 1OR7A 1R1UA 1VQ4I 1GVJA 3IL2A 1ZQ3P 3BTIA 1OQYA 2HOAA 1UG0A 2DA7A 4CXFA 2JA6J 4RAZA 5BPDA 1JKPC 5DEQA 1UAAA 4IHVA 2HZTA 3KYLA 4Y17A 3I4MJ 3I53A 3MN2A 3V4GA 3KP7A 1W5SA 2VIXA 3F6VA 1R5GA 2N8GA 4HNUA 3TBIA 1RR7A 2H6BA 3JRBA 5J6XA 3B6AA 1T0FC 4FT8A 4N0BA 2VLAA 5GTHC 3A0HC 1XN7A 4EMSA 4EJOA 2H8RA 3T5XA 3HGGA 1Y6IA 2E2HJ 3I59B 4ETSA 3BC8A 2EA2A 3PNTA 2Z2SB 2E1NA 2MD0A 1X3UA 3OYHA 5FROA 3W2AA 2OCEA 5CQGA 1TWAJ 4RGXA 4RLFA 2EK5A 1LDDA 1QVUA 1QU3A 4GYGA 2XB0X 4IHYA 4F92B 3B6CA 4BQQA 3S16J 5HLIA 2VN2A 3BCAA 3CCYA 5LHIA 2E34A 4BNCA 3FXLA 4IXAA 1ONVA 2KRFA 3HC7A 1LKXA 2XDVA 4DYQA 2Y0MA 2A61A 2ID6A 2OTJI 4KIBA 1KQ0A 4AYBA 4BHPA 3KFWX 5LGNA 2Y9ZA 4CICA 1A35A 1RNLA 1SVOA 2K9NA 2FU4A 4F7ZA 2E7XA 3S14J 2DA5A 2O5RA 4PGGA 4V2GA 1UFMA 2RVCA 4LB6B 3HUGA 4Z2YA 4RMNA 3KZYA 4BY1J 4LLNA 1LUJB 2JTVA 3E97A 3MQ0A 4A3KJ 1I1SA 2FE3A 4NBQA 3HRTA 2W48A 1TQPA 4F52A 3RDIA 1WZ2A 2P5KA 5FO5A 4BEHB 2ID3A 5CVUA 3OR2C 2J5OA 3T1BA 4YFXF 5M5YJ 1NK2P 2FNAA 3RZOJ 2DO7A 2EPFA 1YLFA 3UR3C 1TT5B 2BGCA 3IWZA 2XIGA 4MTEA 3BTLA 2ZNYA 4HF1A 2RNJA 3LQRA 4W1UA 5M5WJ 4C2MJ 3JRGA 5A2QZ 5IYDJ 4C3IJ 1ZRDA 1EH8A 4KICA 3BG5A 3Q3SA 1BI3A 2X48A 4AU7A 4ESFA 4XLPF 4U7BA 3G71I 2HOTA 2ZXHA 3WTUC 5B1BH 3GYHX 2V7FA 5IT9Z 1Z91A 4ZYGA 2Y30A 3CUQA 1SAUA 4KN4X 2O03A 3W2WA 3J81Z 2M9HA 3F22A 3IRQA 5CVIA 1FZPB 2QSGX 2D1VA 4U0YA 3FK6A 4BQOA 4AVZA 1W5CC 4IHWA 3ZQ7A 3CF5F 1JKOC 4GXOA 5D8KB 1I6XA 2G7HA 3E6MA 2ISZA 2HU9A 2ZMEA 4O5VA 2MH9A 1JGSA 1K6OA 4EM1A 3C2BA 2ME6A 2RQQA 2XB5A 4L5EA 3RYPA 1YJ9I 4LK0F 1BC7C 3OYJA 5JR3A 3S2DJ 3OV8A 2VPLA 4II2A 2E1MB 2XF7A 3I0TA 1TNTA 3HB9A 2QLZA 5F6FA 2E60A 3KEYA 1O3TA 1YS6A 3BT9A 2EWNA 4HA8A 4EGYA 3ML6A 3AG1H 4A6DA 1Z3XA 1MJAA 4I2OA 1UCRA 1FP2A 3FXKA 3LSPA 2DOEA 1ZR2A 5CJ9A 5J4VA 3CCRI 2DU9A 1JTXA 3N05A 4JP0A 3S17J 4XRSA 1O7LA 1WGXA 3WTXC 2CV0A 1QVTA 2L02A 4B44A 2GIVA 5L3FA 3K70D 5FKKA 2BHZA 1B4AA 3QP6A 4CZZA 2P6SA 1G8XA 2W57A 3GMEA 3H9QA 4PGHA 5K7ZA 1ORKA 1YW8A 5IP6A 4HDUA 4HV6A 1YITI 2G9WA 2CQNA 5ILSA 3OYLA 1TLHB 2OTLI 5JI6A 4F93B 1ZRFA 3FXOA 3G2BA 4S05A 3F8CA 1O7FA 3MEXA 3ZMUA 5E1WA 5HLHA 2QUFA 2MA3A 3ABMH 2DYRH 1JE8A 2OD5A 3H0GJ 2OQRA 2XAUA 2YU9J 1W4MA 3GZNB 1OCCH 2WAEA 1OJLA 3P9KA 1RZ4A 3LFUA 1MSEC 4QLCU 4G7HF 5HNHA 4ZZDA 4JBAA 5DS9A 3KP6A 1FYLA 1G59A 4O3MA 4E7JA 1B8IA 1X1AA 4G94A 3OIPA 4M3BA 5EYRA 1MBJA 4L5JA 4IEJA 1R5ID 3GTLJ 1HLVA 1Y56A 4UB6C 2X6WA 1LEBA 1MBHA 2DI3A 4N9IA 2XGCA 5DYMA 4G7ZF 2DCEA 4A3IJ 3CC7I 1NG6A 3CCMI 1T56A 2FQ3A 4OAZA 1T0FA 4XLAA 3UNGC 2DA3A 4BQNA 2H8WA 2QSFX 1D0YA 1UB9A 1LFPA 2DOAA 5E17F 2VJJA 1LNWA 1V5GA 4IF4A 4EJVA 1W0UA 5IP9J 4L9NA 1TWHJ 4ANJA 2GWRA 2HKOA 3HOXJ 4NUBA 3VSKA 3QRFF 3BR6A 1YI2I 3IRRA 2LC2A 1UHSA 1V55H 3BR0A 3H35A 3CCSI 4JX4A 2PN6A 4B1RA 5DD8A 1ACIA 2V4JC 1XX5A 2QSHX 4A3GJ 4HG2A 4LJZF 2H1LA 2LKXA 5EG0A 5FFXA 3HIFA 4PK4A 5DCMA 1A6QA 1ENHA 3LL7A 2STWA 4A3JJ 4RB2C 3S3OA 2O6GE 1Y8QB 1P4WA 3I3LA 1W0TA 2O8KA 4CDGA 4HX8A 3ZQHA 3OYFA 2LFBA 1U8RA 3GTMJ 1SD4A 2EFWA 3C2HA 3ECOA 2EFOA 2IS4A 1YJWI 3GTQJ 2Q2EA 3WTWC 5IYCJ 3H36A 5E1XA 5GADJ 3L00A 1G2HA 1UG2A 3P7NA 3LAJA 3HPGA 3FMQA 3DTKA 1W7PA 2H94A 2WY7Q 2V1DA 2QKLB 3BG9A 3NWTA 5ICGA 2Y69H 2OBPA 1AKHA 1FSEA 2QM3A 2IGNA 3S2WA 1LDJA 4ZH4F 1K83J 2LF7A 3SFIA 4IO9F 4BDYA 1AWCA 2GQQA 3CC4I 1WFXA 2K27A 4ITVA 1J9IA 1USSA 3BLYA 3K4JA 4RDUA 3DP7A 4CYDA 1HXDA 2M8EA 1XTAA 2TDXA 3BCBA 3ASNH 1GV2A 1WRJA 5EF6A 2IPQX 4HLYA 2V79A 3ZQFA 1PDNC 2IW5A 2BY1A 1IC8A 2XGXA 2XKPA 3FKJA 2PJRA 3EDPA 2PJPA 1MBFA 1RETA 5LLQA 3AG4H 4BJ6C 4NC7A 1NHAA 1XC5A 4ENNA 3JTGA 2R7ZJ 3I4NJ 2W24A 4J01A 5ICEA 2HTSA 4F91B 1IW7F 3IKTA 2VOOA 1ZG3A 1S7AA 4I7HA 4BDZA 4MNUA 2HFHA 2OV7A 3D5LA 5DDGA 4XR6A 4XKCA 3LSHA 2BY3A 3EPZA 3LFKA 3J7YJ 5H2FC 3G6EI 1G3YA 4EJUA 2VJ5A 4PJMA 2R5YB 2IA0A 1EA3A 3K0LA 2DMUA 2QGUA 2EFPA 3R6SA 2VQHA 1H9GA 1J59A 4QTRA 1ON2A 4M3FA 2DT5A 1S3JA 1IV8A 1KU7A 3SZTA 2XHKA 5IOZA 3REOA 1ZLKA 2XRNA 4L0YB 1ZGAA 4HX7A 4XRSG 5J1UA 1YYVA 4AIKA 4CYCA 2HYGD 1OR7C 2PQ8A 2DFIA 2LKPA 1BR4A 3LAPA 2MABA 5JHUA 1N77A 3RKWA 3EYIA 1FMWA 4L9TA 4UVAA 1OYYA 1VFCA 2V26A 1T95A 4YIIA 4WXHA 2LLKA 4E7SA 3BWGA 2JSPA 4AVPA 5JVGF 3CCVI 1P92A 2XSJC 2HXOA 2OZUA 5D5UB 3LNQA 2A6EF 3EETA 2YU3A 3ABKH 2DBBA 1S29A 4ZTFA 4U0VA 4XORA 4NB5A 3CZ6A 3L9FA 3A1YA 1IRXA 2A5YB 2DMQA 3H1CA 2CMPA 3VWBA 3IC7A 2ZXIA 5E3LA 3SZPA 1F43A 2UXXA 1BJZA 4FETA 5D8LB 2Z9OA 2Z16A 2Q1ZB 4PJJA 2ESHA 4LGWA 3HOVJ 3DU5A 2O8XA 1MD0A 3QPSA 4CCNA 1TWGJ 1IJWC 4MEXF 1V4RA 1X4OA 3SJMA 2K7LA 4KYWA 2CUFA 3BOQA 2X1DA 1SMTA 1U5TB 5K5QA 1IZ1A 3KP3A 4A3CJ 2CSOA 5JHFA 2B9SA 3FXQA 2PMHA 1F36A 5EEAA 4NHJA 3P9IA 2PI0A 3DTIA 3NWSA 1FIAA 1XGOA 1VQLI 4TV7A 4PDKA 2R4GA 2LNBA 1IDZA 3S3MA 2G7UA 3HSFA 5DCFA 3BQYA 4NNJA 3ZPLA 2DA6A 2EB7A 2M1BA 3OYIA 3H5AA 2JPBA 3KZZA 1Y0UA 2K9QA 3UKGA 4LD5A 5D5XB 2HR3A 1XCVA 1U3EM 1R00A 1X1BA 2VE8A 4UUSA 1YX5A 2VPRA 5HLTA 4OWRB 2EZHA 1SFOJ 3T8TA 2M4GA 3CCUI 4AM3A 1D5VA 1WJFA 2CFXA 1REPC 1SD7A 1Z9CA 3MFKA 2DQLA 2FBHA 4JOMA 4IKFA 4R79A 1JHHA 3F72A 1S8NA 3FHNA 3WHCA 3BJ6A 4LITA 2MH2A 4ZDOA 1FOKA 2G0EA 1MIJA 1IN7A 5AIPA 2R3SA 4CH7A 2LD5A 4KMFA 4LOCA 4G6TB 4B8XA 1T08B 2NYXA 3MWMA 3A01B 2M8GX 2FF4A 3HEFA 2DQRA 3HOUJ 1UHWA 3CDLA 3DEWA 5EZHA 2IBDA 4XRMA 5F04A 4I99C 1T6SA 1XGNA 3W6VA 4XL9A 3DBRB 3CUQC 1Y0NA 2ZJPF 3OYCA 3JSPA 2ZO4A 1VQMI 3D5RC 1XMKA 5LGTA 4ZYDA 2IGMA 3I5UA 5L3EA 4DGWB 1OISA 3OR1C 1ZG1A 3HOYJ 1ETXA 1X2NA 1DPRA 4IQJA 3L2WA 3Q9VA 4HNVA 3GZ5A 1SVLA 2AHQA 1OCPA 3LSGA 3K70C 4A3EJ 2BYVE 3DLLF 4FASD 1XCBA 2IA1A 2DJIA 3PIOF 4HX4A 3IP4B 3KPHA 2NNYA 1ULYA 3CMYA 4WK8F 4E4HA 3IHUA 2JVHA 2KFDA 1K78B 3BPXA 3HKZN 3CCQI 3VEPA 4RLQA 1MNDA 2DJNA 2GA1A 4ZYHA 3L2CA 3KLOA 4G9YA 4XQFA 4UHTA 1HQCA 3RYRA 3K1NA 3TOBA 4ZYEA 5FGMA 5IPAA 5E8IA 2V6EA 3JRAA 3D0SA 4XN3A 4GDFA 2PMUA 3B73A 4XLFA 3HOSA 1WJEA 3PQJA 2Z33A 5J1YA 5LEJA 1D8KA 4XONA 2VBWA 3I56I 2M5WA 4HQEA 1JJ8C 2CW8A 2EZKA 1R7JA 2KZGA 3BG7A 3K4BA 1JXSA 2QQBA 5L3CA 3I54A 2KZVA 1XMXA 3NQOA 1T8IA 2ZXJA 2CV2A 4LB5A 4G8XA 5M5XJ 1O3QA 2BXZA 4ZYAA 2QEXI 2RGVA 1ZH5A 3N97A 2K9SA 3I58A 1PJRA 3ZP5A 3RKYA 1BOBA 2GOXB 4NQWA 4R1HA 3PO2J 5C4XJ 1I3QJ 1EH6A 1OYWA 2J5PA 2R7QA 5E3NA 1FPQA 1DQUA 1HSJA 2KRHA 3EYYA 2NNNA 3S3NA 3GLLA 4L5IA 2VQGA 1ERDA 2DA1A 1Z7LA 1F4KA 3SEZA 4EM2A 1RPWA 4XRFA 5LFAA 1VQ8I 4B4CA 3KCCA 1LQ1A 1Y1VJ 1R36A 4YFNF 4EJWA 4IHSA 1QPMA 2FMYA 4XLCA 2P81A 2DA4A 3BPVA 4FCYA 3JRDA 4ENKA 5JFRA 2CW0F 1BW5A 2OF7A 3F3XA 2DAOA 3GXOA 3GTGJ 1VQ7I 2NOJB 3A02A 3H5NA 4QPOA 4OINF 5EGOB 1JT0A 1I27A 1VQPI 5FKLA 2JA7J 3BR3A 1WJCA 2CUZA 3HHGA 1FIPA 1FP1D 2VBYA 2YUSA 2VASA 3VFZA 2QCOA 1IN6A 4C30A 3CMMA 2A6HF 2WB1N 2X4HA 1PP7U 2VJ4A 1NH3A 2E1MC 1BIBA 1STZA 1HSTA 1B1BA 1BW6A 5J4YA 2K9LA 3L09A 4CGZA 1VQ5I 3TP3A 2GM4A 3MD2A 1WJDA 4I09A 3G3ZA 1A6IA 4AIHA 2Q0OA 3RSNA 4RGUA 2NS7A 1V5EA 2X1CA 2HOEA 3QODA 1L0OC 1VQOI 4HDVA 3HOZJ 2F5CA 4IQ4A 2FNPA 5J47A 2NXNB 1BM9A 2LOOA 3KE2A 3S2HJ 2XRLA 3FZVA 3F23A 3DKWA 3ERED 3OS1A 2DK5A 2KJBA 2RREA 5L3DA 2NOGA 3OIQA 1HDDC 1U9NA 2K02A 4MQ9F 1W36C 3JW4A 2EV0A 1XSXA 2I8DA 2UUZA 2A69F 4U0WA 3CDIA 4G6QA 5DV5A 3AKZA 5CYVA 2W25A 3J80Z 4QPQA 3RKQA 1IN5A 3MCZA 3GVAA 1S72I 2M87A 4RBOA 1MMNA 2ZJ2A 2MLKA 4IVNA 4KISA 4RB0A 3EUHC 2R7UA 3PNVA 5HDKA 2W00A 3FKIJ 3KYDB 3HKZA 3TMOA 2QENA 2R7DA 2ZSIB 1WJBA 5TJJA 2DA2A 4MEYF 1G3WA 5LHHA 2GXAA 3E1SA 2NVUB 2QWWA 3WHBA 2IXSA 2MYSA 3S1RJ 3D1NI 2JA2A 1FJLA 1JT6A 3GW2A 2EV6A 3I9V2 4WCGA 2OAZA 2F48A 5IT3A 3WTSC 2F5DA 3BG3A 2L9RA 2DMTA 2OU2A 5HOOA 1E3OC 2FEZA 3DEUA 4XOTA 3M1EA 1VI0A 5FLXK 2PMZA 4NDLA 2UV1A 2UXNA 4C2UA 3I59A 3PSIA 2WAQN 2P5LC 1SFXA 4ENMA 2K9MA 3O8GA 4BQAA 5B66C 1SD6A 3CLQA 1FOYA 1RUNA 3M4OJ 5ICFA 1KQ9A 3H3ZA 1J75A 3I64A 1P4AA 3Q9SA 3RZDJ 1Z6TA 5K1YA 3TQNA 2FJ1A 3RPQA 1JUSA 3TOAA 1YOVB 3H9JA 2M7AA 2R7OA 3RTRA 2WA0A 2NS8A 4RA2A 1QA6A 1D8JA 2KT0A 4HBLA 1MH3A 5J8CA 2BZTA 2CWEA 1KYZA 4MQVA 1C0WA 2MLGA 2EINH 3GBGA 3E6CC 5LEKA 3M07A 3KIOA 4YIFA 3RKXA 3T8RA 4MGRA 5H6QA 4MO7A 3BR1A 2HDWA 5HS8A 2CQ7A 1A36A 1CQTA 2BVLA 1H0MA 1LE8B 2RNGA 5F64A 2WAFA 3JAMZ 2LKSA 1ZARA 2E35A 3HZJA 1HA8A 1BR2A 2VJIA 3EUAA 1I3AA 2NVYJ 4GRIA 4P1WA 2EZIA 1TQIA 4BEHA 1X19A 3VYRB 3JRCA 2FQ4A 3ZGKA 4JQFA 1TP4A 4Q4ZF 1NK3P 1IUYA 5TGTA 2VT2A 3LSMA 1XG1A 1Z6RA 4HOBA 4UV8A 2FBKA 3FMRA 4S0HB 4P9FA 2ADUA 3RI4A 4IJAA 1YIJI 4FTHA 2A5WA 4IRHA 2R93J 2DTRA 4D5FA 1IXRC 2M0MA 4LIVA 2ECCA 5E3MA 5TRDA 3OWTA 3PQKA 3U1KA 1MGTA 1V5FA 2V6CA 3BR2A 1J2XA 3MZYA 4A3DJ 3QOEA 2XUBA 2PBIA 3GTPJ 2CO5A 4M3GA 3ABTA 1BJAA 4XIDA 1H8AC 4M73A 5KK1A 3DU6A 1H88C 2DODA 3CC2I 1E3HA 2QVOA 3O8HA 5AONA 3FMSA 2CW7A 3GF2A 4A5NA 2ELKA 4B48A 1QHGA 4EGZA 2JVGA 2VBZA 3ZOBA 3W6JB 4M71A 1QZEA 2VXZA 3K4KA 2MC4A 3S8PA 4OOIA 1QHHD 4FX4A 1VQ6I 3K69A 3EQLF 1VQKI 1PP8F 4OIPF 1ITYA 1ETOA 3OSGA 2CG4A 4XNFA 4J00A 2P7VB 1GVDA 3U1DA 1TQMA 2R7VA 3H3VK 4Y15A 1USTA 4XK4A 1ZN2A 5IP7J 3ZN1A 2F4MB 2L7KA 2ZC2A 3K4NA 5EEGA 2FUG2 3DBHB 3CESA 1K4SA 2FA5A 2GA2A 5HS7A 2LP0A 2KKOA 2GIZA 2ZKZA 5E8GA 2GLOA 1HC8A 2HDCA 4LIUA 1S5LC 5CVRA 4E7LA 2Y0SN 2VKHA 4RAFA 4A0XA 1J7KA 2MSYA 1HDPA 5J3LA 4JX6A 2E71A 3BROA 1IO2A 2VC1A 3LWFA 1R23A 4P5OA 1EH7A 2ECBA 3VB2A 4LLLA 2WAQA 3QU6A 1SAXA 3KLNA 4RGSA 3ERMA 4D5CA 4I98B 1UHMA 2LY1A 3AG3H 3OS2A 2HZDA 1QZYA 1R58A 4WWCA 2LG4A 4FISA 2R5ZB 1UZCA 2JUGA 2D2WA 5D5VB 4AIJA 4FE4A 3JRHA 2MGQA 4E70A 3EUHA 3RPUD 3TDZC 3CQZJ 9ANTA 1O4XA 1WWXA 2XVCA 4RGRA 2AXTC 1XPXA 1F5TA 4BXFA 2F5FA 4BE1A 4ON0A 3ZQLA 1YRNB 1X1CA 1KYWA 4PJLA 4IRIA 3BG6A 1OCTC 4M72A 3LQQA 3BTJA 4A6EA 1UELB 1SANA 2LY2A 2DPUA 5KVRA 4HW0A 2BW3B 4GFBA 1U5TC 3WGGA 2O0YA 1TC3C 4BBRJ 1OMIA 4Y33A 2EJRA 2A68F 3ASOH 4M9XA 4RS8A 4XKBA 4ENJA 3ZQGA 3ZQIA 4M74A 5B5EC 4PFOA 1R4MB 4C3HJ 3ESWB 3OMYA 3H3UA 2M30A 1B72B 1PUFB 5FLVA 4IHXA 4I76A 1RR8C 2ZXWH 2OPTA 3S1MJ 3K4MA 3QPTA 4MHGA 3JTHA 3M9AA 3F8BA 2B63J 4E7HA 3E0JB 1YG2A 4XLHA 1FWZA 1W7PD 4BE0A 1MMSA 1LFBA 1WSUA 3K1MA 2ZCWA 4XSXF 1K7AA 1R9TJ 1UJ8A 3B02A 3KETA 2XC7A 3CJNA 1B9MA 4LMYA 2EBIA 4N4OB 2W1OA 2BY2A 2QQ9A 1TWFJ 5ERIA 1DDNA 3WTVC 4EJTA 3LSTA 3QU3A 1BI2A 1L3LA 5FFZA 4PCQA 4A69C 2R92J 4DQ2A 2A3SA 1FYMA 3IKVA 5GP9A 4HSTA 2EIMH 4C2TA 1QO0D 3ISPA 3U9GA 4MIMA 4DYCA 4FHTA 1MBKA 3RQIA 5JLXA 2R7TA 4N4NB 3PUBA 2QQ8A 2RN7A 3OIOA 2PEXA 3PUFA 1Z3YA 3CJTB 3PIPF 2QBYB 4RM2A 4DZPA 1ZTRA 2BEOA 4WXDA 3MVPA 4M6XA 3WU1B 4LLGF 2QKMB 3CUOA 3SXYA 2D1HA 2VT3A 3IH2A 2DMPA 4RAYA 1ETVA 4D7MA 3CD6I 1YX3A 1FY7A 4L9VA 3FXRA 3E6BA 2KIQA 4I6ZA 2HVRA 1SFKA 2F5VA 2DK8A 4B47A 4M9ZA 3C18A 2KDZA 2CQXA 3QQAA 2V9KA 5CVVA 1RKWA 1X4PA 1NTCA 2HKXA 2KISA 2O7OA 3BP8A 4PJNA 4M3EA 1BI1A 3WU2C 3VODA 2JJ7A 1R5HA 3HSRA 3FX3A 2FMLA 3DTEA 3OYKA 1LVAA 5K5RA 1UMQA 1BA5A 1SC7A 2JT1A 4XMYA 3E5XA 2XGEA 3E3VA 4ZTJA 2H27A 5KCMA 3C1DA 2DYSH 2Y0SA 3DV8A 4BKXA 4BAYA 3OSFA 2STTA 5L3GA 2R7WA 4QWQA 2E19A 1Z05A 4YIRX 5M3MJ 2KHMA 2OUMA 2XAQA 5ILVA 3LSIA 5M3FJ 2IJLA 3FHZA 5BOXA 4FQGA 1G4DA 3QPLA 2K3PA 3DEEA 3JRFA 5K7HA 1JJ6C 4XM3A 2L9NA 3QYFA 3CCLI 2R7FA 1MDMB 3HHHA 1SVMA 3HJEA 1FSHA 1Y1WJ 4L18B 2JN6A 3I71A 5L3BA 2EILH 2BHYA 2RC4A 1HKQA 3FISA 4L0ZB 3Q5FA 2L9SA 2VBXA 3A03A 2R5YA 3K7AJ 3G73A 4PZJA 2YPRA 4AC0A 3BJAA 2Z5UA 1DGRM 3DF8A 3O3KA 2ISYA 3V8JA 3L2VA 1Y8RB 4RB1A 2VOPA 2PG4A 2LBFB 1K61A 1YW7A 3CCJI 3ZCOA 1AOYA 3ABUA 4HEA2 4ESJA 2GZWA 4XLNF 2COMA 3AL0B 3HRUA 1WHUA 5J8FA 2HYFA 4E6KG 3DLAA 2FBIA 2DDAA 4I0BA 2KIFA 4UVCA 1QRYA 2MD5A 2LDUA 3OYGA 4KNYA 3AG2H 1IGNA 5E20A 1J09A 3NARA 3KP4A 2VONA 4L9JA 4IPAA 2WY8Q 1DP7P 1FX7A 1CF7B 1O57A 3FXJA 4Q47A 4ASNA 5KHDA 4LK1F 4QSHA 3JSOA 1FEXA 4DBQA 4LG0B 2F5EA 3MKLA 1ZLJA 4BY7J 1O3RA 5HLGA 1HW5A 2DW4A 2OA4A 5IOYA 3IH4A 2WBMA 2IT0A 2L01A 1T98A 1XB4A 5CLSA 2VKEA 2FD5A 1WH7A 3I4PA 4ZZLA 5LRRA 1U2WA 5KNLA 5A2QK 4D7NA 3QOPA 1JGGA 1U5TA 3C3WA 3K2ZA 1LVKA 3BR5A 3OL4A 3WG9A 4OMZA 5IT9K 4OIOF 5D5WB 3J81K 5B1AH 1ZGWA 3BZCA 1F9NA 4YEJA 3MZHA 4KDPA 1SMYF 1E0EA 4XN0A 4DOZA 2E5NA 2H6CA 1DU6A 1JHFA 5ED4A 2CQQA 4V19K 2P8TA 4EVIA 2E1CA 2M34A 2VODA 1A04A 4H4KC 2IVMA 1XGMA 2P5VA 4M9SA 2O61A 3IWFA 2ZFWA 3WODF 2W82A 4M6YA 3CO6C 1IV6A 4PSXA 1IN4A 3BTCA 1T38A 2ESNA 2Y2ZA 1RUOA 2WV1A 4M3DA 3VDXA 2W4SA 4BACA 2DPDA 1CGPA 1VZ0A 1Z0XA 2EA4A 3TP0A 4BJ5C 1YS7A 3SDGA 2VL8A 3WTZA 4WXCA 5KAIC 3A01A 2M3AA 1TTYA 2C6YA 3OYMA 2LYCA 2LSOA 2K40A 2X85A 2M2EA 5TISC 4DIQA 3HOWJ 3L2QA 3CMEI 2EFNA 3HUGB 1OFCX 4OMYA 1BL0A 1BIAA 4K2EA 3MMYB 1I39A 5D6EA 3GEZA 1XD7A 2JPCA 3CMAI 4XBFA 1AU7A 3S32A 2EIJH 2H09A 2DFEA 2P7CB 3FXUA 4CCJA 3J7ZI 4EQQA 1ZRCA 2I5UA 2EH3A 2L9VA 2XF5A 3RJPA 4HSRA 3ELKA 1ON1A 4KT5C 1RI7A 1JTYA 1SEUA 1E3PA 4N9HA 1PYVA 5KAFC 4A0YA 2WADA 3GZ6A 3QYBA 3LA2A 4A12A 1APLC 4X1EA
chains in the Genus database with same CATH topology
4RDUA 4A3MJ 2ME0A 2Y31A 1WI3A 2YS9A 3VPRA 1GV2A 1X2MA 5EF6A 2NVYJ 2EZIA 1POGA 3ZQFA 4X6AJ 5F27A 1JKQC 3JRCA 2FQ4A 1IC8A 1NK3P 4V2FA 1MBFA 1RETA 1XG1A 1XC5A 4S0HB 2D5VA 5HODA 2R7ZJ 3I4NJ 2JA5J 2FX0A 4FTHA 2VKVA 2R93J 5FKOA 4D5FA 2RAEA 2ECCA 2QF7A 5E3MA 5DTDA 5F0HA 4FE7A 3FK7A 3TW7A 2XPWA 3BR2A 2EZLA 1RKTA 4A3DJ 3G1MA 2HXIA 3GTPJ 2IEKA 4M3GA 2R0QC 4XIDA 1H8AC 4AYBN 2DMNA 3PO3J 1H88C 2GBYA 3O8HA 1GV5A 2R5YB 2CRGA 2DMUA 2ELKA 4A3LJ 5FJ8J 1FTZA 1WCMJ 2XPUA 3ZOBA 4QTRA 1U8BA 5C3EJ 4M3FA 3LOCA 2LR8A 2LTPA 5IOZA 5E3OA 5BNGA 1P7JA 1VNDA 3S15J 2E2JJ 2JK3A 1ETWA 4XRSG 3HM5A 5J1UA 2CJJA 2X9DA 4B3AA 1ITYA 1ETOA 4CYCA 3OSGA 2L0KA 1FTTA 1MBGA 3TEDA 1VF9A 1GVDA 4BXXJ 3H3VK 4W97A 2LVSA 4XK4A 1VFCA 5IP7J 2H1KA 3M3YJ 5EZGA 2HDDA 2LLKA 1IRZA 5EDNA 1I6HJ 1JUPA 2JMWA 2HXOA 4JYKA 2LP0A 5EGOA 3LNQA 2GLOA 1MBEA 4QIWN 1XS9A 1HF0A 2NVQJ 2HOSA 1MH4A 5IYBJ 1LFUP 3HDDA 3K2AA 2L7MP 2Y0SN 2X6OA 4A3BJ 2DMQA 5FKNA 4EEFG 2MSYA 2E1OA 1HDPA 5J3LA 4JX6A 5E3LA 1F43A 5GPAA 1BJZA 5JLWA 3HOVJ 1B8IB 3QPSA 5F0FA 1TWGJ 2PMZN 3LSRA 4MFEA 1IJWC 2ECBA 3SJMA 2CUFA 4BBSJ 4D5CA 5J1RA 1IUFA 1ETQA 4A3CJ 3IH3A 2XSDC 1Z77A 1IDYA 1F36A 5EEAA 4Y7NJ 1MSFC 4FISA 2R5ZB 1ETYA 4FE4A 2CU7A 1FIAA 2MGQA 3JRHA 3GTJJ 5FLMJ 1IDZA 3HGYA 4A3FJ 3CQZJ 9ANTA 1O4XA 3BQYA 2Y9YA 1IG7A 2DA6A 5FKMA 3BQZA 5F08A 3S1QJ 3ZQLA 1YRNB 4M6VA 1ZQ3P 1S7EA 3BTIA 2HOAA 1OCTC 2HI3A 2DA7A 2K9QA 3UKGA 3BTJA 2JA6J 1X58A 1SANA 1JKPC 4IHVA 1U9OA 4GFBA 3I4MJ 4UUSA 2VPRA 3MN2A 3LSJA 2EZHA 2VI6A 1SFOJ 1TC3C 4BBRJ 5EG0B 2N8GA 1RR7A 3JRBA 2AO9A 3B6AA 3WHCA 3ZQGA 3ZQIA 3HBLA 1WH5A 2G0EA 2H8RA 2LD5A 3HGGA 4LOCA 4C3HJ 2E2HJ 1ETKA 3A01B 2M8GX 1B72B 1GDTA 1PUFB 3HEFA 4IHXA 5FLVA 4I76A 3HOUJ 2OPTA 1TWAJ 3CDLA 3S1MJ 3DEWA 5EZHA 2IBDA 4XRMA 1QVUA 5F04A 3W6VA 2NVXJ 2XB0X 2B63J 4IHYA 1WPKA 3B6CA 3S16J 4C3JJ 3CCYA 1LFBA 1RESA 1MNMC 1R9TJ 4DYQA 3E7LA 1Q1VA 3HOYJ 4DW6A 1ETXA 1X2NA 1AKHB 2EBIA 2ID6A 3S1NJ 1TWFJ 4HNVA 1ZK8A 2AHQA 2Y9ZA 1OCPA 3LSGA 4A69C 4A3EJ 4ABZA 2K9NA 2R92J 3S14J 5GP9A 2DA5A 4V2GA 4J19A 4BY1J 4MIMA 4DYCA 1MBKA 3RQIA 5JLXA 1TWCJ 4A3KJ 3OIOA 3CMYA 2W48A 5F0CA 4DZPA 3HKZN 1ZTRA 2COBA 3MVPA 2ID3A 4JX5A 3IV5A 2DJNA 1NK2P 5M5YJ 3IH2A 2DMPA 4AUXA 1ETVA 3RZOJ 4D7MA 4I6ZA 1GT0C 3BTLA 5IPAA 2L7FP 4W1UA 5M5WJ 4C2MJ 3JRGA 2KDZA 2CQXA 3QQAA 3JRAA 2EQRA 4C3IJ 5IYDJ 5C44J 1RKWA 1NTCA 2O7OA 1LE8A 2NVTJ 3BG5A 3Q3SA 4M3EA 2X48A 5J1YA 2HOTA 4G12A 2JJ7A 1JJ8C 1GUUA 3TW6A 2Y30A 2EZKA 2TRTA 1UMQA 3Q0WA 1BA5A 2M9HA 2XGEA 3DCFA 4BKXA 3OSFA 3FK6A 4IHWA 5M5XJ 2E19A 1JKOC 5M3MJ 1D5YA 2MG4A 5M3FJ 2K9SA 4A93J 3C2BA 2ME6A 3QPLA 3PO2J 5C4XJ 3JRFA 1I3QJ 2XB5A 4L5EA 5K7HA 1JJ6C 5E3NA 1P7IA 3ZQCA 1ZKGA 1U78A 2DA1A 3S2DJ 4CYCB 1Y1WJ 1RPWA 2JN6A 3L1PA 4B4CA 3OOUA 3HB9A 1Y1VJ 3FISA 2P81A 3G1LA 2XPVA 3NAUA 2DA4A 3BT9A 4FCYA 3JRDA 1ZR4A 3A03A 2R5YA 1BW5A 3K7AJ 2OF7A 4DZJA 4AC0A 3GTGJ 3A02A 2IAIA 3LSPA 1ZR2A 5EGOB 4XICA 1JT0A 2JA7J 4JP0A 1JTXA 5FKLA 3BR3A 1FIPA 2YUSA 1K61A 3S17J 4XRSA 1WGXA 2QCOA 2E2IJ 1QVTA 3FIWA 5FKKA 2WB1N 3Q0VA 5K7ZA 1ORKA 5IP6A 1QRYA 1IGNA 1BW6A 3NARA 2LY9A 3TP3A 2GM4A 3GTKJ 1A6IA 2VUMJ 4MLOA 2NS7A 4QSHA 2XGDA 3JR9A 3H0GJ 3JRIA 1FEXA 2YU9J 3MKLA 3HOZJ 4BY7J 1OJLA 5GPCA 1AHDP 1MSEC 2TCTA 2M0CA 2XRLA 5IOYA 3IH4A 3S2HJ 5DS9A 3GTOJ 3Q0UA 2VKEA 5F1JA 2FD5A 2NOGA 1HDDC 1B8IA 4UUTA 1WH7A 4M3BA 1U9NA 2HQ5A 5EYRA 1MBJA 4IEJA 3GTLJ 1HLVA 4D7NA 1JGGA 4UUSB 1MBHA 2XGCA 3BR5A 4A3IJ 1I50J 1T33A 2CUEA 1T56A 2R5ZA 3RKQA 4RBOA 2DA3A 1ZGWA 1H89C 3FKIJ 1DU6A 2CQQA 1W0UA 5IP9J 2I10A 1TWHJ 2JWTA 3HOXJ 1HCRA 2M34A 1YRNA 3BR6A 2DA2A 5C4JJ 1UHSA 3BR0A 1DU0A 2HYJA 4JX4A 4B1RA 3WHBA 1A5JA 4A3GJ 2DN0A 3S1RJ 2LKXA 5EG0A 3D1NI 3G1OA 1IV6A 1FJLA 1JT6A 2JA8J 3BTCA 1JKRC 1ENHA 2Y2ZA 4A3JJ 2WV1A 4M3DA 2MW8A 3BG3A 2L9RA 2DMTA 3PM1A 1E3OC 1Z0XA 3TP0A 1VI0A 1W0TA 1EF4A 4NDLA 3SDGA 2O8KA 2WAQN 3ZQHA 2L7ZA 2LFBA 3GTMJ 3A01A 3O8GA 1B72A 1QPIA 1PUFA 2K40A 2M2EA 3M4OJ 4Y52J 3HOWJ 2ZB9A 3GTQJ 4DYRA 5IYCJ 1OFCX 1HOMA 3RZDJ 1BL0A 2FJ1A 1JUSA 2LK2A 1G2HA 1UG2A 1AU7A 3JREA 2NS8A 3BG9A 2KT0A 4MFDA 2DTZA 1MH3A 2EH3A 1AKHA 3GBGA 1JTYA 1K83J 3F0CA 3SFIA 1JUMA 5K7FA 4MO7A 3BR1A 2O9LA 1CQTA 1APLC 1LE8B 4X1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RDU A;  4A3M J;  2ME0 A;  2Y31 A;  1WI3 A;  2YS9 A;  3VPR A;  1GV2 A;  1X2M A;  5EF6 A;  2NVY J;  2EZI A;  1POG A;  3ZQF A;  4X6A J;  5F27 A;  1JKQ C;  3JRC A;  2FQ4 A;  1IC8 A;  1NK3 P;  4V2F A;  1MBF A;  1RET A;  1XG1 A;  1XC5 A;  4S0H B;  2D5V A;  5HOD A;  2R7Z J;  3I4N J;  2JA5 J;  2FX0 A;  4FTH A;  2VKV A;  2R93 J;  5FKO A;  4D5F A;  2RAE A;  2ECC A;  2QF7 A;  5E3M A;  5DTD A;  5F0H A;  4FE7 A;  3FK7 A;  3TW7 A;  2XPW A;  3BR2 A;  2EZL A;  1RKT A;  4A3D J;  3G1M A;  2HXI A;  3GTP J;  2IEK A;  4M3G A;  2R0Q C;  4XID A;  1H8A C;  4AYB N;  2DMN A;  3PO3 J;  1H88 C;  2GBY A;  3O8H A;  1GV5 A;  2R5Y B;  2CRG A;  2DMU A;  2ELK A;  4A3L J;  5FJ8 J;  1FTZ A;  1WCM J;  2XPU A;  3ZOB A;  4QTR A;  1U8B A;  5C3E J;  4M3F A;  3LOC A;  2LR8 A;  2LTP A;  5IOZ A;  5E3O A;  5BNG A;  1P7J A;  1VND A;  3S15 J;  2E2J J;  2JK3 A;  1ETW A;  4XRS G;  3HM5 A;  5J1U A;  2CJJ A;  2X9D A;  4B3A A;  1ITY A;  1ETO A;  4CYC A;  3OSG A;  2L0K A;  1FTT A;  1MBG A;  3TED A;  1VF9 A;  1GVD A;  4BXX J;  3H3V K;  4W97 A;  2LVS A;  4XK4 A;  1VFC A;  5IP7 J;  2H1K A;  3M3Y J;  5EZG A;  2HDD A;  2LLK A;  1IRZ A;  5EDN A;  1I6H J;  1JUP A;  2JMW A;  2HXO A;  4JYK A;  2LP0 A;  5EGO A;  3LNQ A;  2GLO A;  1MBE A;  4QIW N;  1XS9 A;  1HF0 A;  2NVQ J;  2HOS A;  1MH4 A;  5IYB J;  1LFU P;  3HDD A;  3K2A A;  2L7M P;  2Y0S N;  2X6O A;  4A3B J;  2DMQ A;  5FKN A;  4EEF G;  2MSY A;  2E1O A;  1HDP A;  5J3L A;  4JX6 A;  5E3L A;  1F43 A;  5GPA A;  1BJZ A;  5JLW A;  3HOV J;  1B8I B;  3QPS A;  5F0F A;  1TWG J;  2PMZ N;  3LSR A;  4MFE A;  1IJW C;  2ECB A;  3SJM A;  2CUF A;  4BBS J;  4D5C A;  5J1R A;  1IUF A;  1ETQ A;  4A3C J;  3IH3 A;  2XSD C;  1Z77 A;  1IDY A;  1F36 A;  5EEA A;  4Y7N J;  1MSF C;  4FIS A;  2R5Z B;  1ETY A;  4FE4 A;  2CU7 A;  1FIA A;  2MGQ A;  3JRH A;  3GTJ J;  5FLM J;  1IDZ A;  3HGY A;  4A3F J;  3CQZ J;  9ANT A;  1O4X A;  3BQY A;  2Y9Y A;  1IG7 A;  2DA6 A;  5FKM A;  3BQZ A;  5F08 A;  3S1Q J;  3ZQL A;  1YRN B;  4M6V A;  1ZQ3 P;  1S7E A;  3BTI A;  2HOA A;  1OCT C;  2HI3 A;  2DA7 A;  2K9Q A;  3UKG A;  3BTJ A;  2JA6 J;  1X58 A;  1SAN A;  1JKP C;  4IHV A;  1U9O A;  4GFB A;  3I4M J;  4UUS A;  2VPR A;  3MN2 A;  3LSJ A;  2EZH A;  2VI6 A;  1SFO J;  1TC3 C;  4BBR J;  5EG0 B;  2N8G A;  1RR7 A;  3JRB A;  2AO9 A;  3B6A A;  3WHC A;  3ZQG A;  3ZQI A;  3HBL A;  1WH5 A;  2G0E A;  2H8R A;  2LD5 A;  3HGG A;  4LOC A;  4C3H J;  2E2H J;  1ETK A;  3A01 B;  2M8G X;  1B72 B;  1GDT A;  1PUF B;  3HEF A;  4IHX A;  5FLV A;  4I76 A;  3HOU J;  2OPT A;  1TWA J;  3CDL A;  3S1M J;  3DEW A;  5EZH A;  2IBD A;  4XRM A;  1QVU A;  5F04 A;  3W6V A;  2NVX J;  2XB0 X;  2B63 J;  4IHY A;  1WPK A;  3B6C A;  3S16 J;  4C3J J;  3CCY A;  1LFB A;  1RES A;  1MNM C;  1R9T J;  4DYQ A;  3E7L A;  1Q1V A;  3HOY J;  4DW6 A;  1ETX A;  1X2N A;  1AKH B;  2EBI A;  2ID6 A;  3S1N J;  1TWF J;  4HNV A;  1ZK8 A;  2AHQ A;  2Y9Z A;  1OCP A;  3LSG A;  4A69 C;  4A3E J;  4ABZ A;  2K9N A;  2R92 J;  3S14 J;  5GP9 A;  2DA5 A;  4V2G A;  4J19 A;  4BY1 J;  4MIM A;  4DYC A;  1MBK A;  3RQI A;  5JLX A;  1TWC J;  4A3K J;  3OIO A;  3CMY A;  2W48 A;  5F0C A;  4DZP A;  3HKZ N;  1ZTR A;  2COB A;  3MVP A;  2ID3 A;  4JX5 A;  3IV5 A;  2DJN A;  1NK2 P;  5M5Y J;  3IH2 A;  2DMP A;  4AUX A;  1ETV A;  3RZO J;  4D7M A;  4I6Z A;  1GT0 C;  3BTL A;  5IPA A;  2L7F P;  4W1U A;  5M5W J;  4C2M J;  3JRG A;  2KDZ A;  2CQX A;  3QQA A;  3JRA A;  2EQR A;  4C3I J;  5IYD J;  5C44 J;  1RKW A;  1NTC A;  2O7O A;  1LE8 A;  2NVT J;  3BG5 A;  3Q3S A;  4M3E A;  2X48 A;  5J1Y A;  2HOT A;  4G12 A;  2JJ7 A;  1JJ8 C;  1GUU A;  3TW6 A;  2Y30 A;  2EZK A;  2TRT A;  1UMQ A;  3Q0W A;  1BA5 A;  2M9H A;  2XGE A;  3DCF A;  4BKX A;  3OSF A;  3FK6 A;  4IHW A;  5M5X J;  2E19 A;  1JKO C;  5M3M J;  1D5Y A;  2MG4 A;  5M3F J;  2K9S A;  4A93 J;  3C2B A;  2ME6 A;  3QPL A;  3PO2 J;  5C4X J;  3JRF A;  1I3Q J;  2XB5 A;  4L5E A;  5K7H A;  1JJ6 C;  5E3N A;  1P7I A;  3ZQC A;  1ZKG A;  1U78 A;  2DA1 A;  3S2D J;  4CYC B;  1Y1W J;  1RPW A;  2JN6 A;  3L1P A;  4B4C A;  3OOU A;  3HB9 A;  1Y1V J;  3FIS A;  2P81 A;  3G1L A;  2XPV A;  3NAU A;  2DA4 A;  3BT9 A;  4FCY A;  3JRD A;  1ZR4 A;  3A03 A;  2R5Y A;  1BW5 A;  3K7A J;  2OF7 A;  4DZJ A;  4AC0 A;  3GTG J;  3A02 A;  2IAI A;  3LSP A;  1ZR2 A;  5EGO B;  4XIC A;  1JT0 A;  2JA7 J;  4JP0 A;  1JTX A;  5FKL A;  3BR3 A;  1FIP A;  2YUS A;  1K61 A;  3S17 J;  4XRS A;  1WGX A;  2QCO A;  2E2I J;  1QVT A;  3FIW A;  5FKK A;  2WB1 N;  3Q0V A;  5K7Z A;  1ORK A;  5IP6 A;  1QRY A;  1IGN A;  1BW6 A;  3NAR A;  2LY9 A;  3TP3 A;  2GM4 A;  3GTK J;  1A6I A;  2VUM J;  4MLO A;  2NS7 A;  4QSH A;  2XGD A;  3JR9 A;  3H0G J;  3JRI A;  1FEX A;  2YU9 J;  3MKL A;  3HOZ J;  4BY7 J;  1OJL A;  5GPC A;  1AHD P;  1MSE C;  2TCT A;  2M0C A;  2XRL A;  5IOY A;  3IH4 A;  3S2H J;  5DS9 A;  3GTO J;  3Q0U A;  2VKE A;  5F1J A;  2FD5 A;  2NOG A;  1HDD C;  1B8I A;  4UUT A;  1WH7 A;  4M3B A;  1U9N A;  2HQ5 A;  5EYR A;  1MBJ A;  4IEJ A;  3GTL J;  1HLV A;  4D7N A;  1JGG A;  4UUS B;  1MBH A;  2XGC A;  3BR5 A;  4A3I J;  1I50 J;  1T33 A;  2CUE A;  1T56 A;  2R5Z A;  3RKQ A;  4RBO A;  2DA3 A;  1ZGW A;  1H89 C;  3FKI J;  1DU6 A;  2CQQ A;  1W0U A;  5IP9 J;  2I10 A;  1TWH J;  2JWT A;  3HOX J;  1HCR A;  2M34 A;  1YRN A;  3BR6 A;  2DA2 A;  5C4J J;  1UHS A;  3BR0 A;  1DU0 A;  2HYJ A;  4JX4 A;  4B1R A;  3WHB A;  1A5J A;  4A3G J;  2DN0 A;  3S1R J;  2LKX A;  5EG0 A;  3D1N I;  3G1O A;  1IV6 A;  1FJL A;  1JT6 A;  2JA8 J;  3BTC A;  1JKR C;  1ENH A;  2Y2Z A;  4A3J J;  2WV1 A;  4M3D A;  2MW8 A;  3BG3 A;  2L9R A;  2DMT A;  3PM1 A;  1E3O C;  1Z0X A;  3TP0 A;  1VI0 A;  1W0T A;  1EF4 A;  4NDL A;  3SDG A;  2O8K A;  2WAQ N;  3ZQH A;  2L7Z A;  2LFB A;  3GTM J;  3A01 A;  3O8G A;  1B72 A;  1QPI A;  1PUF A;  2K40 A;  2M2E A;  3M4O J;  4Y52 J;  3HOW J;  2ZB9 A;  3GTQ J;  4DYR A;  5IYC J;  1OFC X;  1HOM A;  3RZD J;  1BL0 A;  2FJ1 A;  1JUS A;  2LK2 A;  1G2H A;  1UG2 A;  1AU7 A;  3JRE A;  2NS8 A;  3BG9 A;  2KT0 A;  4MFD A;  2DTZ A;  1MH3 A;  2EH3 A;  1AKH A;  3GBG A;  1JTY A;  1K83 J;  3F0C A;  3SFI A;  1JUM A;  5K7F A;  4MO7 A;  3BR1 A;  2O9L A;  1CQT A;  1APL C;  1LE8 B;  4X1E A; 
#chains in the Genus database with same CATH topology
 4A3M J;  4KIG A;  5CVJ A;  2DT7 B;  1FC3 A;  2HNH A;  2ME0 A;  2Y31 A;  2DDB A;  3ULQ B;  3KEQ A;  1WI3 A;  3L2R A;  1P2F A;  3CUQ B;  3DBL B;  4H0E A;  3NRV A;  3OYA A;  4YFK F;  3COA C;  1K78 A;  3R0J A;  3FM3 A;  4B09 A;  2PLY A;  1V3F A;  2EIK H;  3NEU A;  5F27 A;  3BZK A;  1LJ9 A;  3ZR8 X;  2V1X A;  1GLN A;  4V2F A;  1M1E B;  1QQI A;  2L5Q A;  1GXP A;  3M8F A;  5HOD A;  2ZME B;  4CCM A;  2WTE A;  4OIQ F;  4IX7 A;  4C9Y A;  2L4A A;  2RAE A;  2QF7 A;  4FE7 A;  3FK7 A;  3TW7 A;  2XPW A;  5F1R A;  2E7W A;  4RAG A;  2EZL A;  1YE9 A;  1RKT A;  2LMD A;  3S93 A;  5ICC A;  2M45 A;  3SHF A;  3O6B B;  4IHT A;  2IEK A;  2A6T A;  2R0Q C;  2AQF A;  1IF1 A;  5BS6 A;  3PO3 J;  2CQK A;  4KIF A;  4BHC A;  1HBX G;  2M4K A;  1GV5 A;  1KU3 A;  3CLO A;  2F6C A;  4A3L J;  1XSD A;  3CTA A;  3HRS A;  1DGW Y;  2AQE A;  1FTZ A;  2CS3 A;  2XAF A;  2Y75 A;  2XAS A;  1Y39 A;  4ZDL A;  2R7X A;  1HW1 A;  3LOC A;  1BOA A;  5E3O A;  5BNG A;  2XAJ A;  1F1Z A;  3MKZ A;  1VND A;  5LHG A;  3S15 J;  1D1A A;  1EJ9 A;  2JK3 A;  1ETW A;  3HM5 A;  1ODD A;  4AD9 A;  1YTY A;  2X9D A;  2IGO A;  4B3A A;  4KUM A;  1FBQ A;  1IN8 A;  1OCO H;  4X0G A;  1MBG A;  3SEQ A;  1BC8 C;  4CZC A;  5J40 A;  3FWE A;  3DKY A;  4YRV A;  4BXX J;  3QPH A;  2KJC A;  2H1K A;  2Z3Y A;  3U21 A;  1BI0 A;  3OYN A;  1IRZ A;  3OOP A;  5EDN A;  2NS0 A;  2L3D A;  1Z7U A;  2E36 A;  1IXC A;  1JUP A;  1KON A;  4PUS A;  2WWY A;  4JYK A;  5EGO A;  3KZI C;  1MBE A;  4QIW N;  4G6D A;  4KIT B;  3VYT B;  1SFU A;  4MTD A;  2BOL A;  2NVQ J;  2XF6 A;  1MH4 A;  1OCZ H;  5IYB J;  2BE5 F;  2KIU A;  1LFU P;  3HDD A;  3K2A A;  2JZY A;  3OL3 A;  2L7M P;  2X6O A;  5FKN A;  5LBQ A;  4XKW A;  2E1O A;  1YJN I;  1XDS A;  2FOK A;  2KLO A;  5JLW A;  1ZEL A;  4BYY A;  1BBY A;  1B8I B;  4IOA F;  3LSR A;  1U6G A;  5J1R A;  6PAX A;  3DFG A;  1Z67 A;  5H20 A;  3ZMD A;  1ETQ A;  3IH3 A;  3LA3 A;  5D4R A;  4BU2 A;  1IDY A;  4CA0 A;  4DJA A;  1MSF C;  4BHB A;  4BJT A;  3CP8 A;  1ETY A;  5H6R A;  2XRO A;  3GTJ J;  1LPQ A;  4KFC A;  3GFM A;  2EFQ A;  5FLM J;  3HGY A;  4EV0 A;  2NRA C;  1YW9 A;  3TKY A;  2Y9Y A;  4KN7 X;  3V7C A;  5DUI A;  2KMU A;  5FKM A;  3BQZ A;  5F08 A;  3S1Q J;  1K4T A;  1N75 A;  4M6V A;  1S7E A;  1EV7 A;  3ABL H;  5GTI C;  2HI3 A;  2OJE D;  2WV0 A;  1XMA A;  2XAH A;  2XKO A;  1X58 A;  2D45 A;  2HVS A;  3R60 A;  1R1V A;  4OIR F;  2ACJ A;  3VSL A;  1B6A A;  1U9O A;  3PFY A;  3LSJ A;  2VI6 A;  5HDG A;  5E79 C;  3TO6 A;  5EG0 B;  2V1U A;  4UB8 C;  4II3 A;  5DCM B;  1ZAO A;  1IAW A;  2WB1 A;  2YR2 A;  1MKM A;  1OPC A;  2AO9 A;  2ETH A;  2KDO A;  1D1C A;  1OCR H;  2A05 A;  2VXD A;  1WH5 A;  3HBL A;  3V7R A;  3WGI A;  2WC2 A;  1RIO H;  3ROU A;  2W85 A;  1WJA A;  4R8H A;  4A2U A;  2B0L A;  3AAF A;  1MJ9 A;  1ETK A;  1MMD A;  2ZFU A;  3BDD A;  1E17 A;  4Z6Y A;  1KU2 A;  2BV6 A;  1GDT A;  1K79 A;  3RCO A;  1YFH A;  2JQ7 A;  4OU0 A;  2Q2E B;  1TL8 A;  4PJ0 C;  2XV4 S;  1TW2 A;  5B3S H;  3DQV C;  1FBU A;  4DNC A;  2NVX J;  1WPK A;  2X51 A;  4F55 A;  3FBN B;  3OYD A;  3V7S A;  4C3J J;  1R22 A;  1RES A;  1MNM C;  1W7P B;  3A0B C;  4RM3 A;  4A5M A;  3K9T A;  1IRG A;  3DKX A;  2RDP A;  1Z21 A;  1MJB A;  3F8M A;  2BY0 A;  1S7O A;  3E7L A;  3ECH A;  4P9U A;  1Q1V A;  2O3F A;  3RIR A;  4DW6 A;  5GAE J;  1AKH B;  2RV8 A;  5FRN A;  1YQA A;  2M7B A;  3S1N J;  1FT9 A;  1KGS A;  2QYO A;  3OS0 A;  1ZK8 A;  2L54 A;  2Q8K A;  3X2Q H;  4ABZ A;  3BZ6 A;  2ICW G;  4GGG A;  3T0Y A;  3HG9 A;  3CF2 A;  4J19 A;  4JK1 X;  1PUE E;  2XAG A;  3ONQ A;  3SDB A;  4IL6 C;  2IRF G;  4BS9 A;  1TWC J;  3HTS B;  1ZYR F;  5F0C A;  2F2E A;  1D1B A;  3I55 I;  2X6X A;  1ZHF A;  5DM7 F;  1LEA A;  2COB A;  4D0P A;  2FRH A;  2KRC A;  4JX5 A;  3IV5 A;  1IRF A;  3DWL E;  5E1Z B;  2PJR B;  2MC3 A;  2QZ8 A;  4AUX A;  2DLL A;  3CJQ B;  1KU9 A;  3RPU A;  1DUX C;  3CP2 A;  3WG7 H;  1TNS A;  1SD5 A;  2IGK A;  2HQN A;  1GT0 C;  3PNY A;  1LDK B;  2L7F P;  5HS9 A;  2EQR A;  2P0W A;  3QP5 A;  5C44 J;  3LMM A;  3VOE A;  3KYC B;  1LE8 A;  2NVT J;  3TGN A;  4AWX B;  2NAZ A;  4G12 A;  1GUU A;  3SYT A;  3TW6 A;  1FBS A;  2OC6 A;  2TRT A;  4E7I A;  3MKW B;  3Q0W A;  3HTU A;  1VTN C;  5DM6 F;  1YO5 C;  1NG7 A;  2ELH A;  2P6T A;  2GXB A;  3DCF A;  4XSZ F;  3ZQQ A;  3PL8 A;  1X1D A;  3HRM A;  4HLX A;  4UXN A;  2P4W A;  1LB2 A;  2AS5 F;  3FDY A;  3TO9 A;  4EM0 B;  2PX9 A;  3H5R A;  1D5Y A;  3WE2 A;  2JSC A;  2MG4 A;  5BQT A;  1P4X A;  1R6R A;  2FOW A;  2KL4 A;  4A93 J;  1K6Y A;  1FMV A;  4HV5 A;  1QGP A;  1WVR A;  2DXI A;  4XOP A;  1V54 H;  3GX4 X;  1Q1H A;  1KZH A;  1P7I A;  4FX0 A;  1ZKG A;  3ZQC A;  1KA8 A;  1U78 A;  3K4L A;  4IOC F;  2X6Y A;  4CYC B;  3U2R A;  3L1P A;  4Q5S F;  3OOU A;  5FLX Z;  4HPQ A;  3FXM A;  3G1L A;  5E18 F;  2XPV A;  3NAU A;  2DFF A;  1MZB A;  1ZR4 A;  2CGP A;  2LRD A;  3OYE A;  4UVB A;  4DZJ A;  3QWL A;  1MNE A;  3WTY C;  1W5T A;  1IXS B;  3TL4 X;  1QZZ A;  2K86 A;  2IAI A;  5LRS A;  2FXA A;  2VB6 A;  1G3S A;  2VKD A;  3GFL A;  3ZRG A;  4XIC A;  2PFB A;  3C7J A;  4Y4R A;  5FRM A;  1DP3 A;  3IAM 2;  2DFH A;  3CCE I;  5HDN A;  2E2I J;  1O3S A;  1R71 A;  2QQA A;  3FIW A;  3DXJ F;  2F4O B;  4D1Q A;  1QNT A;  1QBJ A;  3Q0V A;  4KT6 A;  2V9P A;  2MBF A;  2B7E A;  3ZMT A;  4HQM A;  5HVQ C;  1TZL A;  3M1C A;  1W36 D;  1P9Q C;  5AIQ A;  5JVT A;  2LY9 A;  3W2V A;  4BL0 B;  1U0J A;  3IUO A;  4I02 A;  3GTK J;  3H9G A;  2VUM J;  4MLO A;  1R1T A;  3L2U A;  4XKV A;  4ZJZ A;  3JR9 A;  2XGD A;  1WI9 A;  3HOT A;  3J7A O;  3V8L A;  3JRI A;  5CQE A;  4I01 A;  4CSW A;  4E7K A;  2ZSH B;  5GPC A;  1AHD P;  4HNT A;  2X1E A;  1WJ5 A;  2K85 A;  2TCT A;  3E5Q A;  2M0C A;  4CO8 A;  3GTO J;  3AL0 C;  5FB2 A;  3Q0U A;  3A2K A;  5F1J A;  4G7O F;  3F21 A;  2BVM A;  3HPH A;  4UUT A;  2HQ5 A;  1AA7 A;  2CUJ A;  1HKS A;  3F8N A;  2CFO A;  5CPR B;  4UNO A;  3K6G A;  4CCL A;  4UUS B;  2L4M A;  2IS1 A;  1FNN A;  4Y3O A;  3BJO A;  5D6F A;  1OKR A;  3QYE A;  1I50 J;  1T33 A;  2CUE A;  2LF8 A;  2A07 F;  3PFI A;  4U7D A;  2R5Z A;  4HF2 A;  4BH9 A;  4U88 A;  3M8E A;  1FOX A;  1OYI A;  2JUC A;  2OCC H;  3GFJ A;  2R7R A;  1H89 C;  2KQR A;  2UZK A;  4YEL A;  2ELJ A;  1RC9 A;  2HQA A;  2VQC A;  2AXL A;  3SQN A;  2I10 A;  1T39 A;  1I1G A;  2JWT A;  2IS2 A;  5IY5 H;  1HCR A;  4IRG A;  1YRN A;  5C4J J;  4Y13 A;  3D5S C;  1DU0 A;  2DOF A;  2HYJ A;  3ZMZ A;  3WTT C;  5ILU A;  1XSV A;  4YG2 F;  1A5J A;  2HPI A;  2BW3 A;  3AFH A;  2DN0 A;  4HYE A;  3H0D A;  2HEO A;  2YSR A;  3HXL A;  2HTJ A;  2JA8 J;  1TW3 A;  2CYY A;  2BXY A;  3G1O A;  4GCV A;  1JKR C;  4HAM A;  5D4S A;  1MMA A;  2JRM A;  1R4N B;  2ZBK A;  3QAH A;  3DPT A;  4KMU X;  2MW8 A;  4EAT A;  1X3W B;  3PM1 A;  3MAJ A;  1EF4 A;  4BUP A;  3OY9 A;  3GUD A;  3E5U A;  4A0Z A;  2E5Z A;  3MKY B;  2L7Z A;  3F8F A;  3GWZ A;  1B72 A;  1QPI A;  3R4K A;  1PUF A;  3KX2 A;  4HRI A;  4NC6 A;  2MFZ A;  2W84 A;  4Y52 J;  3SFZ A;  1VQ9 I;  2ZB9 A;  2R7S A;  2K5C A;  4DYR A;  5LD2 C;  4UV9 A;  1HOM A;  1X3Z B;  3L7W A;  2BBY A;  2LK2 A;  3V8K A;  1X1P A;  2YX7 A;  4HF0 A;  5EEH A;  2HWV A;  3PJR A;  2YX4 A;  1EKE A;  4PSW A;  1TT0 A;  4PFP A;  3JRE A;  4GO1 A;  2KPM A;  4NC8 A;  5DD4 A;  1BN5 A;  3FF5 A;  4KA4 A;  2HGC A;  2DTZ A;  4MFD A;  3MZ8 A;  3KP2 A;  3R0A A;  2X0L A;  2W7N A;  5BPI A;  1YHQ I;  5HNF A;  2V1N A;  3F0C A;  1WKM A;  1JUM A;  2LH9 A;  5K7F A;  5FD5 A;  2GOM A;  1XGS A;  1YIO A;  2O9L A;  4S04 A;  2HQR A;  1N78 A;  5K5O A;  4D9J A;  3A4C A;  3EUK L;  2IS6 A;  3K4C A;  3KP5 A;  3P5J A;  2YS9 A;  3VPR A;  1X2M A;  1FLI A;  3PSF A;  1OLT A;  5GAH J;  3GFI A;  1HW2 A;  4CHU A;  1FOW A;  4U87 A;  1SFE A;  2QBY A;  3OYB A;  1POG A;  1DPU A;  4X6A J;  1JKQ C;  5BMZ A;  3W6K B;  1VQN I;  2RKH A;  3V42 A;  2GAU A;  2V9V A;  3O2P E;  1ZG5 A;  2IP2 A;  3SZG A;  4Q48 A;  3ZN0 A;  2UWM A;  1T2K A;  2Y48 A;  3M7G A;  1H9T A;  2D5V A;  4ZDP A;  2JA5 J;  3K1P A;  1J0R A;  2FX0 A;  3DPL C;  3VYU B;  2CV1 A;  1MMG A;  2VKV A;  5FKO A;  2VQL A;  4NQW B;  1ZGJ A;  2KP6 A;  3LSK A;  2Z1D A;  3BY6 A;  3IAS 2;  3CJR B;  1J5Y A;  5DTD A;  5F0H A;  3J80 K;  4E7Z A;  1GXQ A;  1P6R A;  2JRT A;  1MW7 A;  4B43 A;  1GHC A;  3G1M A;  2HXI A;  2OZ6 A;  4WX9 A;  4UUV A;  1E2X A;  4AYB N;  2DMN A;  4P96 A;  2GBY A;  2QA4 I;  2L2O A;  2ZNZ A;  1D0X A;  1ZRE A;  1W1W E;  1Z1D A;  3M8J A;  1JI8 A;  2CRG A;  2VE9 A;  2RQP A;  3N4M A;  5FJ8 J;  3GO5 A;  1WCM J;  2XPU A;  4LG3 A;  4BXU A;  3R61 A;  4BGD A;  5C3E J;  2ZME C;  1U8B A;  4DBR A;  1G3T A;  4B3X A;  3RQ4 A;  2LR8 A;  2LTP A;  1P7J A;  2ZJQ F;  3P9C A;  2E2J J;  1PVE A;  2FSW A;  2K4B A;  1MDM A;  2CJJ A;  4RB3 C;  3JCU C;  3CO7 C;  4ESB A;  4LFU A;  4WF2 A;  2LRE A;  3KEO A;  3HSE A;  2EV5 A;  2L0K A;  1FTT A;  3TED A;  1VF9 A;  1I5Z A;  3HL2 A;  1B59 A;  4XLE A;  1FYK A;  4W97 A;  2GXG A;  5LGU A;  2LVS A;  5DUK A;  2HPM A;  2K4J A;  3M3Y J;  4HZF A;  3FBI B;  5EZG A;  2K3F A;  2HDD A;  3GCM A;  4ZC3 A;  1I6H J;  2JMW A;  2KIM A;  4F3Q A;  2VC0 A;  4GYI A;  3H92 A;  2Z99 A;  3W3C A;  1XS9 A;  1HF0 A;  3VYS B;  5FD6 A;  5CKT A;  2HOS A;  2LBF A;  4UY8 I;  3HYI A;  4A3B J;  4EEF G;  3WU0 A;  1N25 A;  5GPA A;  1HKT A;  4OAY A;  5EJC A;  1RRJ A;  4AID A;  3ZMS A;  4P55 A;  1TBX A;  3WE3 A;  2F4I A;  5F0F A;  4I0A A;  2PMZ N;  4MFE A;  4CCO A;  4BBS J;  4IZZ A;  3C2G A;  3J7A Y;  2DT6 A;  3GLX A;  1R49 A;  1S9H A;  3G4S I;  3FM5 A;  4CCK A;  1BR1 A;  2HVQ A;  2IA2 A;  2HS5 A;  3LA7 A;  1D3Y A;  1IUF A;  1D0Z A;  4CUG A;  3JAM K;  1S6L A;  2XSD C;  5GAG J;  1Z77 A;  3TO7 A;  3ZXS A;  1WQ2 A;  1CF7 A;  2CH0 A;  4Y7N J;  3K10 A;  1A31 A;  1KQ8 A;  3F9K A;  1B9N A;  4BE2 A;  1G6N A;  3F6O A;  3WGH A;  2CU7 A;  3DPU A;  4LG0 A;  1XDU A;  3E6D A;  2ZJR F;  3ZMV A;  2OQG A;  3TDU C;  4O6J A;  4A3F J;  4KJZ A;  1IG7 A;  3CDH A;  1OR7 A;  1R1U A;  1VQ4 I;  1GVJ A;  3IL2 A;  1ZQ3 P;  3BTI A;  1OQY A;  2HOA A;  1UG0 A;  2DA7 A;  4CXF A;  2JA6 J;  4RAZ A;  5BPD A;  1JKP C;  5DEQ A;  1UAA A;  4IHV A;  2HZT A;  3KYL A;  4Y17 A;  3I4M J;  3I53 A;  3MN2 A;  3V4G A;  3KP7 A;  1W5S A;  2VIX A;  3F6V A;  1R5G A;  2N8G A;  4HNU A;  3TBI A;  1RR7 A;  2H6B A;  3JRB A;  5J6X A;  3B6A A;  1T0F C;  4FT8 A;  4N0B A;  2VLA A;  5GTH C;  3A0H C;  1XN7 A;  4EMS A;  4EJO A;  2H8R A;  3T5X A;  3HGG A;  1Y6I A;  2E2H J;  3I59 B;  4ETS A;  3BC8 A;  2EA2 A;  3PNT A;  2Z2S B;  2E1N A;  2MD0 A;  1X3U A;  3OYH A;  5FRO A;  3W2A A;  2OCE A;  5CQG A;  1TWA J;  4RGX A;  4RLF A;  2EK5 A;  1LDD A;  1QVU A;  1QU3 A;  4GYG A;  2XB0 X;  4IHY A;  4F92 B;  3B6C A;  4BQQ A;  3S16 J;  5HLI A;  2VN2 A;  3BCA A;  3CCY A;  5LHI A;  2E34 A;  4BNC A;  3FXL A;  4IXA A;  1ONV A;  2KRF A;  3HC7 A;  1LKX A;  2XDV A;  4DYQ A;  2Y0M A;  2A61 A;  2ID6 A;  2OTJ I;  4KIB A;  1KQ0 A;  4AYB A;  4BHP A;  3KFW X;  5LGN A;  2Y9Z A;  4CIC A;  1A35 A;  1RNL A;  1SVO A;  2K9N A;  2FU4 A;  4F7Z A;  2E7X A;  3S14 J;  2DA5 A;  2O5R A;  4PGG A;  4V2G A;  1UFM A;  2RVC A;  4LB6 B;  3HUG A;  4Z2Y A;  4RMN A;  3KZY A;  4BY1 J;  4LLN A;  1LUJ B;  2JTV A;  3E97 A;  3MQ0 A;  4A3K J;  1I1S A;  2FE3 A;  4NBQ A;  3HRT A;  2W48 A;  1TQP A;  4F52 A;  3RDI A;  1WZ2 A;  2P5K A;  5FO5 A;  4BEH B;  2ID3 A;  5CVU A;  3OR2 C;  2J5O A;  3T1B A;  4YFX F;  5M5Y J;  1NK2 P;  2FNA A;  3RZO J;  2DO7 A;  2EPF A;  1YLF A;  3UR3 C;  1TT5 B;  2BGC A;  3IWZ A;  2XIG A;  4MTE A;  3BTL A;  2ZNY A;  4HF1 A;  2RNJ A;  3LQR A;  4W1U A;  5M5W J;  4C2M J;  3JRG A;  5A2Q Z;  5IYD J;  4C3I J;  1ZRD A;  1EH8 A;  4KIC A;  3BG5 A;  3Q3S A;  1BI3 A;  2X48 A;  4AU7 A;  4ESF A;  4XLP F;  4U7B A;  3G71 I;  2HOT A;  2ZXH A;  3WTU C;  5B1B H;  3GYH X;  2V7F A;  5IT9 Z;  1Z91 A;  4ZYG A;  2Y30 A;  3CUQ A;  1SAU A;  4KN4 X;  2O03 A;  3W2W A;  3J81 Z;  2M9H A;  3F22 A;  3IRQ A;  5CVI A;  1FZP B;  2QSG X;  2D1V A;  4U0Y A;  3FK6 A;  4BQO A;  4AVZ A;  1W5C C;  4IHW A;  3ZQ7 A;  3CF5 F;  1JKO C;  4GXO A;  5D8K B;  1I6X A;  2G7H A;  3E6M A;  2ISZ A;  2HU9 A;  2ZME A;  4O5V A;  2MH9 A;  1JGS A;  1K6O A;  4EM1 A;  3C2B A;  2ME6 A;  2RQQ A;  2XB5 A;  4L5E A;  3RYP A;  1YJ9 I;  4LK0 F;  1BC7 C;  3OYJ A;  5JR3 A;  3S2D J;  3OV8 A;  2VPL A;  4II2 A;  2E1M B;  2XF7 A;  3I0T A;  1TNT A;  3HB9 A;  2QLZ A;  5F6F A;  2E60 A;  3KEY A;  1O3T A;  1YS6 A;  3BT9 A;  2EWN A;  4HA8 A;  4EGY A;  3ML6 A;  3AG1 H;  4A6D A;  1Z3X A;  1MJA A;  4I2O A;  1UCR A;  1FP2 A;  3FXK A;  3LSP A;  2DOE A;  1ZR2 A;  5CJ9 A;  5J4V A;  3CCR I;  2DU9 A;  1JTX A;  3N05 A;  4JP0 A;  3S17 J;  4XRS A;  1O7L A;  1WGX A;  3WTX C;  2CV0 A;  1QVT A;  2L02 A;  4B44 A;  2GIV A;  5L3F A;  3K70 D;  5FKK A;  2BHZ A;  1B4A A;  3QP6 A;  4CZZ A;  2P6S A;  1G8X A;  2W57 A;  3GME A;  3H9Q A;  4PGH A;  5K7Z A;  1ORK A;  1YW8 A;  5IP6 A;  4HDU A;  4HV6 A;  1YIT I;  2G9W A;  2CQN A;  5ILS A;  3OYL A;  1TLH B;  2OTL I;  5JI6 A;  4F93 B;  1ZRF A;  3FXO A;  3G2B A;  4S05 A;  3F8C A;  1O7F A;  3MEX A;  3ZMU A;  5E1W A;  5HLH A;  2QUF A;  2MA3 A;  3ABM H;  2DYR H;  1JE8 A;  2OD5 A;  3H0G J;  2OQR A;  2XAU A;  2YU9 J;  1W4M A;  3GZN B;  1OCC H;  2WAE A;  1OJL A;  3P9K A;  1RZ4 A;  3LFU A;  1MSE C;  4QLC U;  4G7H F;  5HNH A;  4ZZD A;  4JBA A;  5DS9 A;  3KP6 A;  1FYL A;  1G59 A;  4O3M A;  4E7J A;  1B8I A;  1X1A A;  4G94 A;  3OIP A;  4M3B A;  5EYR A;  1MBJ A;  4L5J A;  4IEJ A;  1R5I D;  3GTL J;  1HLV A;  1Y56 A;  4UB6 C;  2X6W A;  1LEB A;  1MBH A;  2DI3 A;  4N9I A;  2XGC A;  5DYM A;  4G7Z F;  2DCE A;  4A3I J;  3CC7 I;  1NG6 A;  3CCM I;  1T56 A;  2FQ3 A;  4OAZ A;  1T0F A;  4XLA A;  3UNG C;  2DA3 A;  4BQN A;  2H8W A;  2QSF X;  1D0Y A;  1UB9 A;  1LFP A;  2DOA A;  5E17 F;  2VJJ A;  1LNW A;  1V5G A;  4IF4 A;  4EJV A;  1W0U A;  5IP9 J;  4L9N A;  1TWH J;  4ANJ A;  2GWR A;  2HKO A;  3HOX J;  4NUB A;  3VSK A;  3QRF F;  3BR6 A;  1YI2 I;  3IRR A;  2LC2 A;  1UHS A;  1V55 H;  3BR0 A;  3H35 A;  3CCS I;  4JX4 A;  2PN6 A;  4B1R A;  5DD8 A;  1ACI A;  2V4J C;  1XX5 A;  2QSH X;  4A3G J;  4HG2 A;  4LJZ F;  2H1L A;  2LKX A;  5EG0 A;  5FFX A;  3HIF A;  4PK4 A;  5DCM A;  1A6Q A;  1ENH A;  3LL7 A;  2STW A;  4A3J J;  4RB2 C;  3S3O A;  2O6G E;  1Y8Q B;  1P4W A;  3I3L A;  1W0T A;  2O8K A;  4CDG A;  4HX8 A;  3ZQH A;  3OYF A;  2LFB A;  1U8R A;  3GTM J;  1SD4 A;  2EFW A;  3C2H A;  3ECO A;  2EFO A;  2IS4 A;  1YJW I;  3GTQ J;  2Q2E A;  3WTW C;  5IYC J;  3H36 A;  5E1X A;  5GAD J;  3L00 A;  1G2H A;  1UG2 A;  3P7N A;  3LAJ A;  3HPG A;  3FMQ A;  3DTK A;  1W7P A;  2H94 A;  2WY7 Q;  2V1D A;  2QKL B;  3BG9 A;  3NWT A;  5ICG A;  2Y69 H;  2OBP A;  1AKH A;  1FSE A;  2QM3 A;  2IGN A;  3S2W A;  1LDJ A;  4ZH4 F;  1K83 J;  2LF7 A;  3SFI A;  4IO9 F;  4BDY A;  1AWC A;  2GQQ A;  3CC4 I;  1WFX A;  2K27 A;  4ITV A;  1J9I A;  1USS A;  3BLY A;  3K4J A;  4RDU A;  3DP7 A;  4CYD A;  1HXD A;  2M8E A;  1XTA A;  2TDX A;  3BCB A;  3ASN H;  1GV2 A;  1WRJ A;  5EF6 A;  2IPQ X;  4HLY A;  2V79 A;  3ZQF A;  1PDN C;  2IW5 A;  2BY1 A;  1IC8 A;  2XGX A;  2XKP A;  3FKJ A;  2PJR A;  3EDP A;  2PJP A;  1MBF A;  1RET A;  5LLQ A;  3AG4 H;  4BJ6 C;  4NC7 A;  1NHA A;  1XC5 A;  4ENN A;  3JTG A;  2R7Z J;  3I4N J;  2W24 A;  4J01 A;  5ICE A;  2HTS A;  4F91 B;  1IW7 F;  3IKT A;  2VOO A;  1ZG3 A;  1S7A A;  4I7H A;  4BDZ A;  4MNU A;  2HFH A;  2OV7 A;  3D5L A;  5DDG A;  4XR6 A;  4XKC A;  3LSH A;  2BY3 A;  3EPZ A;  3LFK A;  3J7Y J;  5H2F C;  3G6E I;  1G3Y A;  4EJU A;  2VJ5 A;  4PJM A;  2R5Y B;  2IA0 A;  1EA3 A;  3K0L A;  2DMU A;  2QGU A;  2EFP A;  3R6S A;  2VQH A;  1H9G A;  1J59 A;  4QTR A;  1ON2 A;  4M3F A;  2DT5 A;  1S3J A;  1IV8 A;  1KU7 A;  3SZT A;  2XHK A;  5IOZ A;  3REO A;  1ZLK A;  2XRN A;  4L0Y B;  1ZGA A;  4HX7 A;  4XRS G;  5J1U A;  1YYV A;  4AIK A;  4CYC A;  2HYG D;  1OR7 C;  2PQ8 A;  2DFI A;  2LKP A;  1BR4 A;  3LAP A;  2MAB A;  5JHU A;  1N77 A;  3RKW A;  3EYI A;  1FMW A;  4L9T A;  4UVA A;  1OYY A;  1VFC A;  2V26 A;  1T95 A;  4YII A;  4WXH A;  2LLK A;  4E7S A;  3BWG A;  2JSP A;  4AVP A;  5JVG F;  3CCV I;  1P92 A;  2XSJ C;  2HXO A;  2OZU A;  5D5U B;  3LNQ A;  2A6E F;  3EET A;  2YU3 A;  3ABK H;  2DBB A;  1S29 A;  4ZTF A;  4U0V A;  4XOR A;  4NB5 A;  3CZ6 A;  3L9F A;  3A1Y A;  1IRX A;  2A5Y B;  2DMQ A;  3H1C A;  2CMP A;  3VWB A;  3IC7 A;  2ZXI A;  5E3L A;  3SZP A;  1F43 A;  2UXX A;  1BJZ A;  4FET A;  5D8L B;  2Z9O A;  2Z16 A;  2Q1Z B;  4PJJ A;  2ESH A;  4LGW A;  3HOV J;  3DU5 A;  2O8X A;  1MD0 A;  3QPS A;  4CCN A;  1TWG J;  1IJW C;  4MEX F;  1V4R A;  1X4O A;  3SJM A;  2K7L A;  4KYW A;  2CUF A;  3BOQ A;  2X1D A;  1SMT A;  1U5T B;  5K5Q A;  1IZ1 A;  3KP3 A;  4A3C J;  2CSO A;  5JHF A;  2B9S A;  3FXQ A;  2PMH A;  1F36 A;  5EEA A;  4NHJ A;  3P9I A;  2PI0 A;  3DTI A;  3NWS A;  1FIA A;  1XGO A;  1VQL I;  4TV7 A;  4PDK A;  2R4G A;  2LNB A;  1IDZ A;  3S3M A;  2G7U A;  3HSF A;  5DCF A;  3BQY A;  4NNJ A;  3ZPL A;  2DA6 A;  2EB7 A;  2M1B A;  3OYI A;  3H5A A;  2JPB A;  3KZZ A;  1Y0U A;  2K9Q A;  3UKG A;  4LD5 A;  5D5X B;  2HR3 A;  1XCV A;  1U3E M;  1R00 A;  1X1B A;  2VE8 A;  4UUS A;  1YX5 A;  2VPR A;  5HLT A;  4OWR B;  2EZH A;  1SFO J;  3T8T A;  2M4G A;  3CCU I;  4AM3 A;  1D5V A;  1WJF A;  2CFX A;  1REP C;  1SD7 A;  1Z9C A;  3MFK A;  2DQL A;  2FBH A;  4JOM A;  4IKF A;  4R79 A;  1JHH A;  3F72 A;  1S8N A;  3FHN A;  3WHC A;  3BJ6 A;  4LIT A;  2MH2 A;  4ZDO A;  1FOK A;  2G0E A;  1MIJ A;  1IN7 A;  5AIP A;  2R3S A;  4CH7 A;  2LD5 A;  4KMF A;  4LOC A;  4G6T B;  4B8X A;  1T08 B;  2NYX A;  3MWM A;  3A01 B;  2M8G X;  2FF4 A;  3HEF A;  2DQR A;  3HOU J;  1UHW A;  3CDL A;  3DEW A;  5EZH A;  2IBD A;  4XRM A;  5F04 A;  4I99 C;  1T6S A;  1XGN A;  3W6V A;  4XL9 A;  3DBR B;  3CUQ C;  1Y0N A;  2ZJP F;  3OYC A;  3JSP A;  2ZO4 A;  1VQM I;  3D5R C;  1XMK A;  5LGT A;  4ZYD A;  2IGM A;  3I5U A;  5L3E A;  4DGW B;  1OIS A;  3OR1 C;  1ZG1 A;  3HOY J;  1ETX A;  1X2N A;  1DPR A;  4IQJ A;  3L2W A;  3Q9V A;  4HNV A;  3GZ5 A;  1SVL A;  2AHQ A;  1OCP A;  3LSG A;  3K70 C;  4A3E J;  2BYV E;  3DLL F;  4FAS D;  1XCB A;  2IA1 A;  2DJI A;  3PIO F;  4HX4 A;  3IP4 B;  3KPH A;  2NNY A;  1ULY A;  3CMY A;  4WK8 F;  4E4H A;  3IHU A;  2JVH A;  2KFD A;  1K78 B;  3BPX A;  3HKZ N;  3CCQ I;  3VEP A;  4RLQ A;  1MND A;  2DJN A;  2GA1 A;  4ZYH A;  3L2C A;  3KLO A;  4G9Y A;  4XQF A;  4UHT A;  1HQC A;  3RYR A;  3K1N A;  3TOB A;  4ZYE A;  5FGM A;  5IPA A;  5E8I A;  2V6E A;  3JRA A;  3D0S A;  4XN3 A;  4GDF A;  2PMU A;  3B73 A;  4XLF A;  3HOS A;  1WJE A;  3PQJ A;  2Z33 A;  5J1Y A;  5LEJ A;  1D8K A;  4XON A;  2VBW A;  3I56 I;  2M5W A;  4HQE A;  1JJ8 C;  2CW8 A;  2EZK A;  1R7J A;  2KZG A;  3BG7 A;  3K4B A;  1JXS A;  2QQB A;  5L3C A;  3I54 A;  2KZV A;  1XMX A;  3NQO A;  1T8I A;  2ZXJ A;  2CV2 A;  4LB5 A;  4G8X A;  5M5X J;  1O3Q A;  2BXZ A;  4ZYA A;  2QEX I;  2RGV A;  1ZH5 A;  3N97 A;  2K9S A;  3I58 A;  1PJR A;  3ZP5 A;  3RKY A;  1BOB A;  2GOX B;  4NQW A;  4R1H A;  3PO2 J;  5C4X J;  1I3Q J;  1EH6 A;  1OYW A;  2J5P A;  2R7Q A;  5E3N A;  1FPQ A;  1DQU A;  1HSJ A;  2KRH A;  3EYY A;  2NNN A;  3S3N A;  3GLL A;  4L5I A;  2VQG A;  1ERD A;  2DA1 A;  1Z7L A;  1F4K A;  3SEZ A;  4EM2 A;  1RPW A;  4XRF A;  5LFA A;  1VQ8 I;  4B4C A;  3KCC A;  1LQ1 A;  1Y1V J;  1R36 A;  4YFN F;  4EJW A;  4IHS A;  1QPM A;  2FMY A;  4XLC A;  2P81 A;  2DA4 A;  3BPV A;  4FCY A;  3JRD A;  4ENK A;  5JFR A;  2CW0 F;  1BW5 A;  2OF7 A;  3F3X A;  2DAO A;  3GXO A;  3GTG J;  1VQ7 I;  2NOJ B;  3A02 A;  3H5N A;  4QPO A;  4OIN F;  5EGO B;  1JT0 A;  1I27 A;  1VQP I;  5FKL A;  2JA7 J;  3BR3 A;  1WJC A;  2CUZ A;  3HHG A;  1FIP A;  1FP1 D;  2VBY A;  2YUS A;  2VAS A;  3VFZ A;  2QCO A;  1IN6 A;  4C30 A;  3CMM A;  2A6H F;  2WB1 N;  2X4H A;  1PP7 U;  2VJ4 A;  1NH3 A;  2E1M C;  1BIB A;  1STZ A;  1HST A;  1B1B A;  1BW6 A;  5J4Y A;  2K9L A;  3L09 A;  4CGZ A;  1VQ5 I;  3TP3 A;  2GM4 A;  3MD2 A;  1WJD A;  4I09 A;  3G3Z A;  1A6I A;  4AIH A;  2Q0O A;  3RSN A;  4RGU A;  2NS7 A;  1V5E A;  2X1C A;  2HOE A;  3QOD A;  1L0O C;  1VQO I;  4HDV A;  3HOZ J;  2F5C A;  4IQ4 A;  2FNP A;  5J47 A;  2NXN B;  1BM9 A;  2LOO A;  3KE2 A;  3S2H J;  2XRL A;  3FZV A;  3F23 A;  3DKW A;  3ERE D;  3OS1 A;  2DK5 A;  2KJB A;  2RRE A;  5L3D A;  2NOG A;  3OIQ A;  1HDD C;  1U9N A;  2K02 A;  4MQ9 F;  1W36 C;  3JW4 A;  2EV0 A;  1XSX A;  2I8D A;  2UUZ A;  2A69 F;  4U0W A;  3CDI A;  4G6Q A;  5DV5 A;  3AKZ A;  5CYV A;  2W25 A;  3J80 Z;  4QPQ A;  3RKQ A;  1IN5 A;  3MCZ A;  3GVA A;  1S72 I;  2M87 A;  4RBO A;  1MMN A;  2ZJ2 A;  2MLK A;  4IVN A;  4KIS A;  4RB0 A;  3EUH C;  2R7U A;  3PNV A;  5HDK A;  2W00 A;  3FKI J;  3KYD B;  3HKZ A;  3TMO A;  2QEN A;  2R7D A;  2ZSI B;  1WJB A;  5TJJ A;  2DA2 A;  4MEY F;  1G3W A;  5LHH A;  2GXA A;  3E1S A;  2NVU B;  2QWW A;  3WHB A;  2IXS A;  2MYS A;  3S1R J;  3D1N I;  2JA2 A;  1FJL A;  1JT6 A;  3GW2 A;  2EV6 A;  3I9V 2;  4WCG A;  2OAZ A;  2F48 A;  5IT3 A;  3WTS C;  2F5D A;  3BG3 A;  2L9R A;  2DMT A;  2OU2 A;  5HOO A;  1E3O C;  2FEZ A;  3DEU A;  4XOT A;  3M1E A;  1VI0 A;  5FLX K;  2PMZ A;  4NDL A;  2UV1 A;  2UXN A;  4C2U A;  3I59 A;  3PSI A;  2WAQ N;  2P5L C;  1SFX A;  4ENM A;  2K9M A;  3O8G A;  4BQA A;  5B66 C;  1SD6 A;  3CLQ A;  1FOY A;  1RUN A;  3M4O J;  5ICF A;  1KQ9 A;  3H3Z A;  1J75 A;  3I64 A;  1P4A A;  3Q9S A;  3RZD J;  1Z6T A;  5K1Y A;  3TQN A;  2FJ1 A;  3RPQ A;  1JUS A;  3TOA A;  1YOV B;  3H9J A;  2M7A A;  2R7O A;  3RTR A;  2WA0 A;  2NS8 A;  4RA2 A;  1QA6 A;  1D8J A;  2KT0 A;  4HBL A;  1MH3 A;  5J8C A;  2BZT A;  2CWE A;  1KYZ A;  4MQV A;  1C0W A;  2MLG A;  2EIN H;  3GBG A;  3E6C C;  5LEK A;  3M07 A;  3KIO A;  4YIF A;  3RKX A;  3T8R A;  4MGR A;  5H6Q A;  4MO7 A;  3BR1 A;  2HDW A;  5HS8 A;  2CQ7 A;  1A36 A;  1CQT A;  2BVL A;  1H0M A;  1LE8 B;  2RNG A;  5F64 A;  2WAF A;  3JAM Z;  2LKS A;  1ZAR A;  2E35 A;  3HZJ A;  1HA8 A;  1BR2 A;  2VJI A;  3EUA A;  1I3A A;  2NVY J;  4GRI A;  4P1W A;  2EZI A;  1TQI A;  4BEH A;  1X19 A;  3VYR B;  3JRC A;  2FQ4 A;  3ZGK A;  4JQF A;  1TP4 A;  4Q4Z F;  1NK3 P;  1IUY A;  5TGT A;  2VT2 A;  3LSM A;  1XG1 A;  1Z6R A;  4HOB A;  4UV8 A;  2FBK A;  3FMR A;  4S0H B;  4P9F A;  2ADU A;  3RI4 A;  4IJA A;  1YIJ I;  4FTH A;  2A5W A;  4IRH A;  2R93 J;  2DTR A;  4D5F A;  1IXR C;  2M0M A;  4LIV A;  2ECC A;  5E3M A;  5TRD A;  3OWT A;  3PQK A;  3U1K A;  1MGT A;  1V5F A;  2V6C A;  3BR2 A;  1J2X A;  3MZY A;  4A3D J;  3QOE A;  2XUB A;  2PBI A;  3GTP J;  2CO5 A;  4M3G A;  3ABT A;  1BJA A;  4XID A;  1H8A C;  4M73 A;  5KK1 A;  3DU6 A;  1H88 C;  2DOD A;  3CC2 I;  1E3H A;  2QVO A;  3O8H A;  5AON A;  3FMS A;  2CW7 A;  3GF2 A;  4A5N A;  2ELK A;  4B48 A;  1QHG A;  4EGZ A;  2JVG A;  2VBZ A;  3ZOB A;  3W6J B;  4M71 A;  1QZE A;  2VXZ A;  3K4K A;  2MC4 A;  3S8P A;  4OOI A;  1QHH D;  4FX4 A;  1VQ6 I;  3K69 A;  3EQL F;  1VQK I;  1PP8 F;  4OIP F;  1ITY A;  1ETO A;  3OSG A;  2CG4 A;  4XNF A;  4J00 A;  2P7V B;  1GVD A;  3U1D A;  1TQM A;  2R7V A;  3H3V K;  4Y15 A;  1UST A;  4XK4 A;  1ZN2 A;  5IP7 J;  3ZN1 A;  2F4M B;  2L7K A;  2ZC2 A;  3K4N A;  5EEG A;  2FUG 2;  3DBH B;  3CES A;  1K4S A;  2FA5 A;  2GA2 A;  5HS7 A;  2LP0 A;  2KKO A;  2GIZ A;  2ZKZ A;  5E8G A;  2GLO A;  1HC8 A;  2HDC A;  4LIU A;  1S5L C;  5CVR A;  4E7L A;  2Y0S N;  2VKH A;  4RAF A;  4A0X A;  1J7K A;  2MSY A;  1HDP A;  5J3L A;  4JX6 A;  2E71 A;  3BRO A;  1IO2 A;  2VC1 A;  3LWF A;  1R23 A;  4P5O A;  1EH7 A;  2ECB A;  3VB2 A;  4LLL A;  2WAQ A;  3QU6 A;  1SAX A;  3KLN A;  4RGS A;  3ERM A;  4D5C A;  4I98 B;  1UHM A;  2LY1 A;  3AG3 H;  3OS2 A;  2HZD A;  1QZY A;  1R58 A;  4WWC A;  2LG4 A;  4FIS A;  2R5Z B;  1UZC A;  2JUG A;  2D2W A;  5D5V B;  4AIJ A;  4FE4 A;  3JRH A;  2MGQ A;  4E70 A;  3EUH A;  3RPU D;  3TDZ C;  3CQZ J;  9ANT A;  1O4X A;  1WWX A;  2XVC A;  4RGR A;  2AXT C;  1XPX A;  1F5T A;  4BXF A;  2F5F A;  4BE1 A;  4ON0 A;  3ZQL A;  1YRN B;  1X1C A;  1KYW A;  4PJL A;  4IRI A;  3BG6 A;  1OCT C;  4M72 A;  3LQQ A;  3BTJ A;  4A6E A;  1UEL B;  1SAN A;  2LY2 A;  2DPU A;  5KVR A;  4HW0 A;  2BW3 B;  4GFB A;  1U5T C;  3WGG A;  2O0Y A;  1TC3 C;  4BBR J;  1OMI A;  4Y33 A;  2EJR A;  2A68 F;  3ASO H;  4M9X A;  4RS8 A;  4XKB A;  4ENJ A;  3ZQG A;  3ZQI A;  4M74 A;  5B5E C;  4PFO A;  1R4M B;  4C3H J;  3ESW B;  3OMY A;  3H3U A;  2M30 A;  1B72 B;  1PUF B;  5FLV A;  4IHX A;  4I76 A;  1RR8 C;  2ZXW H;  2OPT A;  3S1M J;  3K4M A;  3QPT A;  4MHG A;  3JTH A;  3M9A A;  3F8B A;  2B63 J;  4E7H A;  3E0J B;  1YG2 A;  4XLH A;  1FWZ A;  1W7P D;  4BE0 A;  1MMS A;  1LFB A;  1WSU A;  3K1M A;  2ZCW A;  4XSX F;  1K7A A;  1R9T J;  1UJ8 A;  3B02 A;  3KET A;  2XC7 A;  3CJN A;  1B9M A;  4LMY A;  2EBI A;  4N4O B;  2W1O A;  2BY2 A;  2QQ9 A;  1TWF J;  5ERI A;  1DDN A;  3WTV C;  4EJT A;  3LST A;  3QU3 A;  1BI2 A;  1L3L A;  5FFZ A;  4PCQ A;  4A69 C;  2R92 J;  4DQ2 A;  2A3S A;  1FYM A;  3IKV A;  5GP9 A;  4HST A;  2EIM H;  4C2T A;  1QO0 D;  3ISP A;  3U9G A;  4MIM A;  4DYC A;  4FHT A;  1MBK A;  3RQI A;  5JLX A;  2R7T A;  4N4N B;  3PUB A;  2QQ8 A;  2RN7 A;  3OIO A;  2PEX A;  3PUF A;  1Z3Y A;  3CJT B;  3PIP F;  2QBY B;  4RM2 A;  4DZP A;  1ZTR A;  2BEO A;  4WXD A;  3MVP A;  4M6X A;  3WU1 B;  4LLG F;  2QKM B;  3CUO A;  3SXY A;  2D1H A;  2VT3 A;  3IH2 A;  2DMP A;  4RAY A;  1ETV A;  4D7M A;  3CD6 I;  1YX3 A;  1FY7 A;  4L9V A;  3FXR A;  3E6B A;  2KIQ A;  4I6Z A;  2HVR A;  1SFK A;  2F5V A;  2DK8 A;  4B47 A;  4M9Z A;  3C18 A;  2KDZ A;  2CQX A;  3QQA A;  2V9K A;  5CVV A;  1RKW A;  1X4P A;  1NTC A;  2HKX A;  2KIS A;  2O7O A;  3BP8 A;  4PJN A;  4M3E A;  1BI1 A;  3WU2 C;  3VOD A;  2JJ7 A;  1R5H A;  3HSR A;  3FX3 A;  2FML A;  3DTE A;  3OYK A;  1LVA A;  5K5R A;  1UMQ A;  1BA5 A;  1SC7 A;  2JT1 A;  4XMY A;  3E5X A;  2XGE A;  3E3V A;  4ZTJ A;  2H27 A;  5KCM A;  3C1D A;  2DYS H;  2Y0S A;  3DV8 A;  4BKX A;  4BAY A;  3OSF A;  2STT A;  5L3G A;  2R7W A;  4QWQ A;  2E19 A;  1Z05 A;  4YIR X;  5M3M J;  2KHM A;  2OUM A;  2XAQ A;  5ILV A;  3LSI A;  5M3F J;  2IJL A;  3FHZ A;  5BOX A;  4FQG A;  1G4D A;  3QPL A;  2K3P A;  3DEE A;  3JRF A;  5K7H A;  1JJ6 C;  4XM3 A;  2L9N A;  3QYF A;  3CCL I;  2R7F A;  1MDM B;  3HHH A;  1SVM A;  3HJE A;  1FSH A;  1Y1W J;  4L18 B;  2JN6 A;  3I71 A;  5L3B A;  2EIL H;  2BHY A;  2RC4 A;  1HKQ A;  3FIS A;  4L0Z B;  3Q5F A;  2L9S A;  2VBX A;  3A03 A;  2R5Y A;  3K7A J;  3G73 A;  4PZJ A;  2YPR A;  4AC0 A;  3BJA A;  2Z5U A;  1DGR M;  3DF8 A;  3O3K A;  2ISY A;  3V8J A;  3L2V A;  1Y8R B;  4RB1 A;  2VOP A;  2PG4 A;  2LBF B;  1K61 A;  1YW7 A;  3CCJ I;  3ZCO A;  1AOY A;  3ABU A;  4HEA 2;  4ESJ A;  2GZW A;  4XLN F;  2COM A;  3AL0 B;  3HRU A;  1WHU A;  5J8F A;  2HYF A;  4E6K G;  3DLA A;  2FBI A;  2DDA A;  4I0B A;  2KIF A;  4UVC A;  1QRY A;  2MD5 A;  2LDU A;  3OYG A;  4KNY A;  3AG2 H;  1IGN A;  5E20 A;  1J09 A;  3NAR A;  3KP4 A;  2VON A;  4L9J A;  4IPA A;  2WY8 Q;  1DP7 P;  1FX7 A;  1CF7 B;  1O57 A;  3FXJ A;  4Q47 A;  4ASN A;  5KHD A;  4LK1 F;  4QSH A;  3JSO A;  1FEX A;  4DBQ A;  4LG0 B;  2F5E A;  3MKL A;  1ZLJ A;  4BY7 J;  1O3R A;  5HLG A;  1HW5 A;  2DW4 A;  2OA4 A;  5IOY A;  3IH4 A;  2WBM A;  2IT0 A;  2L01 A;  1T98 A;  1XB4 A;  5CLS A;  2VKE A;  2FD5 A;  1WH7 A;  3I4P A;  4ZZL A;  5LRR A;  1U2W A;  5KNL A;  5A2Q K;  4D7N A;  3QOP A;  1JGG A;  1U5T A;  3C3W A;  3K2Z A;  1LVK A;  3BR5 A;  3OL4 A;  3WG9 A;  4OMZ A;  5IT9 K;  4OIO F;  5D5W B;  3J81 K;  5B1A H;  1ZGW A;  3BZC A;  1F9N A;  4YEJ A;  3MZH A;  4KDP A;  1SMY F;  1E0E A;  4XN0 A;  4DOZ A;  2E5N A;  2H6C A;  1DU6 A;  1JHF A;  5ED4 A;  2CQQ A;  4V19 K;  2P8T A;  4EVI A;  2E1C A;  2M34 A;  2VOD A;  1A04 A;  4H4K C;  2IVM A;  1XGM A;  2P5V A;  4M9S A;  2O61 A;  3IWF A;  2ZFW A;  3WOD F;  2W82 A;  4M6Y A;  3CO6 C;  1IV6 A;  4PSX A;  1IN4 A;  3BTC A;  1T38 A;  2ESN A;  2Y2Z A;  1RUO A;  2WV1 A;  4M3D A;  3VDX A;  2W4S A;  4BAC A;  2DPD A;  1CGP A;  1VZ0 A;  1Z0X A;  2EA4 A;  3TP0 A;  4BJ5 C;  1YS7 A;  3SDG A;  2VL8 A;  3WTZ A;  4WXC A;  5KAI C;  3A01 A;  2M3A A;  1TTY A;  2C6Y A;  3OYM A;  2LYC A;  2LSO A;  2K40 A;  2X85 A;  2M2E A;  5TIS C;  4DIQ A;  3HOW J;  3L2Q A;  3CME I;  2EFN A;  3HUG B;  1OFC X;  4OMY A;  1BL0 A;  1BIA A;  4K2E A;  3MMY B;  1I39 A;  5D6E A;  3GEZ A;  1XD7 A;  2JPC A;  3CMA I;  4XBF A;  1AU7 A;  3S32 A;  2EIJ H;  2H09 A;  2DFE A;  2P7C B;  3FXU A;  4CCJ A;  3J7Z I;  4EQQ A;  1ZRC A;  2I5U A;  2EH3 A;  2L9V A;  2XF5 A;  3RJP A;  4HSR A;  3ELK A;  1ON1 A;  4KT5 C;  1RI7 A;  1JTY A;  1SEU A;  1E3P A;  4N9H A;  1PYV A;  5KAF C;  4A0Y A;  2WAD A;  3GZ6 A;  3QYB A;  3LA2 A;  4A12 A;  1APL C;  4X1E A; 
#chains in the Genus database with same CATH homology
 4RDU A;  4A3M J;  2ME0 A;  2Y31 A;  1WI3 A;  2YS9 A;  3VPR A;  1GV2 A;  1X2M A;  5EF6 A;  2NVY J;  2EZI A;  1POG A;  3ZQF A;  4X6A J;  5F27 A;  1JKQ C;  3JRC A;  2FQ4 A;  1IC8 A;  1NK3 P;  4V2F A;  1MBF A;  1RET A;  1XG1 A;  1XC5 A;  4S0H B;  2D5V A;  5HOD A;  2R7Z J;  3I4N J;  2JA5 J;  2FX0 A;  4FTH A;  2VKV A;  2R93 J;  5FKO A;  4D5F A;  2RAE A;  2ECC A;  2QF7 A;  5E3M A;  5DTD A;  5F0H A;  4FE7 A;  3FK7 A;  3TW7 A;  2XPW A;  3BR2 A;  2EZL A;  1RKT A;  4A3D J;  3G1M A;  2HXI A;  3GTP J;  2IEK A;  4M3G A;  2R0Q C;  4XID A;  1H8A C;  4AYB N;  2DMN A;  3PO3 J;  1H88 C;  2GBY A;  3O8H A;  1GV5 A;  2R5Y B;  2CRG A;  2DMU A;  2ELK A;  4A3L J;  5FJ8 J;  1FTZ A;  1WCM J;  2XPU A;  3ZOB A;  4QTR A;  1U8B A;  5C3E J;  4M3F A;  3LOC A;  2LR8 A;  2LTP A;  5IOZ A;  5E3O A;  5BNG A;  1P7J A;  1VND A;  3S15 J;  2E2J J;  2JK3 A;  1ETW A;  4XRS G;  3HM5 A;  5J1U A;  2CJJ A;  2X9D A;  4B3A A;  1ITY A;  1ETO A;  4CYC A;  3OSG A;  2L0K A;  1FTT A;  1MBG A;  3TED A;  1VF9 A;  1GVD A;  4BXX J;  3H3V K;  4W97 A;  2LVS A;  4XK4 A;  1VFC A;  5IP7 J;  2H1K A;  3M3Y J;  5EZG A;  2HDD A;  2LLK A;  1IRZ A;  5EDN A;  1I6H J;  1JUP A;  2JMW A;  2HXO A;  4JYK A;  2LP0 A;  5EGO A;  3LNQ A;  2GLO A;  1MBE A;  4QIW N;  1XS9 A;  1HF0 A;  2NVQ J;  2HOS A;  1MH4 A;  5IYB J;  1LFU P;  3HDD A;  3K2A A;  2L7M P;  2Y0S N;  2X6O A;  4A3B J;  2DMQ A;  5FKN A;  4EEF G;  2MSY A;  2E1O A;  1HDP A;  5J3L A;  4JX6 A;  5E3L A;  1F43 A;  5GPA A;  1BJZ A;  5JLW A;  3HOV J;  1B8I B;  3QPS A;  5F0F A;  1TWG J;  2PMZ N;  3LSR A;  4MFE A;  1IJW C;  2ECB A;  3SJM A;  2CUF A;  4BBS J;  4D5C A;  5J1R A;  1IUF A;  1ETQ A;  4A3C J;  3IH3 A;  2XSD C;  1Z77 A;  1IDY A;  1F36 A;  5EEA A;  4Y7N J;  1MSF C;  4FIS A;  2R5Z B;  1ETY A;  4FE4 A;  2CU7 A;  1FIA A;  2MGQ A;  3JRH A;  3GTJ J;  5FLM J;  1IDZ A;  3HGY A;  4A3F J;  3CQZ J;  9ANT A;  1O4X A;  3BQY A;  2Y9Y A;  1IG7 A;  2DA6 A;  5FKM A;  3BQZ A;  5F08 A;  3S1Q J;  3ZQL A;  1YRN B;  4M6V A;  1ZQ3 P;  1S7E A;  3BTI A;  2HOA A;  1OCT C;  2HI3 A;  2DA7 A;  2K9Q A;  3UKG A;  3BTJ A;  2JA6 J;  1X58 A;  1SAN A;  1JKP C;  4IHV A;  1U9O A;  4GFB A;  3I4M J;  4UUS A;  2VPR A;  3MN2 A;  3LSJ A;  2EZH A;  2VI6 A;  1SFO J;  1TC3 C;  4BBR J;  5EG0 B;  2N8G A;  1RR7 A;  3JRB A;  2AO9 A;  3B6A A;  3WHC A;  3ZQG A;  3ZQI A;  3HBL A;  1WH5 A;  2G0E A;  2H8R A;  2LD5 A;  3HGG A;  4LOC A;  4C3H J;  2E2H J;  1ETK A;  3A01 B;  2M8G X;  1B72 B;  1GDT A;  1PUF B;  3HEF A;  4IHX A;  5FLV A;  4I76 A;  3HOU J;  2OPT A;  1TWA J;  3CDL A;  3S1M J;  3DEW A;  5EZH A;  2IBD A;  4XRM A;  1QVU A;  5F04 A;  3W6V A;  2NVX J;  2XB0 X;  2B63 J;  4IHY A;  1WPK A;  3B6C A;  3S16 J;  4C3J J;  3CCY A;  1LFB A;  1RES A;  1MNM C;  1R9T J;  4DYQ A;  3E7L A;  1Q1V A;  3HOY J;  4DW6 A;  1ETX A;  1X2N A;  1AKH B;  2EBI A;  2ID6 A;  3S1N J;  1TWF J;  4HNV A;  1ZK8 A;  2AHQ A;  2Y9Z A;  1OCP A;  3LSG A;  4A69 C;  4A3E J;  4ABZ A;  2K9N A;  2R92 J;  3S14 J;  5GP9 A;  2DA5 A;  4V2G A;  4J19 A;  4BY1 J;  4MIM A;  4DYC A;  1MBK A;  3RQI A;  5JLX A;  1TWC J;  4A3K J;  3OIO A;  3CMY A;  2W48 A;  5F0C A;  4DZP A;  3HKZ N;  1ZTR A;  2COB A;  3MVP A;  2ID3 A;  4JX5 A;  3IV5 A;  2DJN A;  1NK2 P;  5M5Y J;  3IH2 A;  2DMP A;  4AUX A;  1ETV A;  3RZO J;  4D7M A;  4I6Z A;  1GT0 C;  3BTL A;  5IPA A;  2L7F P;  4W1U A;  5M5W J;  4C2M J;  3JRG A;  2KDZ A;  2CQX A;  3QQA A;  3JRA A;  2EQR A;  4C3I J;  5IYD J;  5C44 J;  1RKW A;  1NTC A;  2O7O A;  1LE8 A;  2NVT J;  3BG5 A;  3Q3S A;  4M3E A;  2X48 A;  5J1Y A;  2HOT A;  4G12 A;  2JJ7 A;  1JJ8 C;  1GUU A;  3TW6 A;  2Y30 A;  2EZK A;  2TRT A;  1UMQ A;  3Q0W A;  1BA5 A;  2M9H A;  2XGE A;  3DCF A;  4BKX A;  3OSF A;  3FK6 A;  4IHW A;  5M5X J;  2E19 A;  1JKO C;  5M3M J;  1D5Y A;  2MG4 A;  5M3F J;  2K9S A;  4A93 J;  3C2B A;  2ME6 A;  3QPL A;  3PO2 J;  5C4X J;  3JRF A;  1I3Q J;  2XB5 A;  4L5E A;  5K7H A;  1JJ6 C;  5E3N A;  1P7I A;  3ZQC A;  1ZKG A;  1U78 A;  2DA1 A;  3S2D J;  4CYC B;  1Y1W J;  1RPW A;  2JN6 A;  3L1P A;  4B4C A;  3OOU A;  3HB9 A;  1Y1V J;  3FIS A;  2P81 A;  3G1L A;  2XPV A;  3NAU A;  2DA4 A;  3BT9 A;  4FCY A;  3JRD A;  1ZR4 A;  3A03 A;  2R5Y A;  1BW5 A;  3K7A J;  2OF7 A;  4DZJ A;  4AC0 A;  3GTG J;  3A02 A;  2IAI A;  3LSP A;  1ZR2 A;  5EGO B;  4XIC A;  1JT0 A;  2JA7 J;  4JP0 A;  1JTX A;  5FKL A;  3BR3 A;  1FIP A;  2YUS A;  1K61 A;  3S17 J;  4XRS A;  1WGX A;  2QCO A;  2E2I J;  1QVT A;  3FIW A;  5FKK A;  2WB1 N;  3Q0V A;  5K7Z A;  1ORK A;  5IP6 A;  1QRY A;  1IGN A;  1BW6 A;  3NAR A;  2LY9 A;  3TP3 A;  2GM4 A;  3GTK J;  1A6I A;  2VUM J;  4MLO A;  2NS7 A;  4QSH A;  2XGD A;  3JR9 A;  3H0G J;  3JRI A;  1FEX A;  2YU9 J;  3MKL A;  3HOZ J;  4BY7 J;  1OJL A;  5GPC A;  1AHD P;  1MSE C;  2TCT A;  2M0C A;  2XRL A;  5IOY A;  3IH4 A;  3S2H J;  5DS9 A;  3GTO J;  3Q0U A;  2VKE A;  5F1J A;  2FD5 A;  2NOG A;  1HDD C;  1B8I A;  4UUT A;  1WH7 A;  4M3B A;  1U9N A;  2HQ5 A;  5EYR A;  1MBJ A;  4IEJ A;  3GTL J;  1HLV A;  4D7N A;  1JGG A;  4UUS B;  1MBH A;  2XGC A;  3BR5 A;  4A3I J;  1I50 J;  1T33 A;  2CUE A;  1T56 A;  2R5Z A;  3RKQ A;  4RBO A;  2DA3 A;  1ZGW A;  1H89 C;  3FKI J;  1DU6 A;  2CQQ A;  1W0U A;  5IP9 J;  2I10 A;  1TWH J;  2JWT A;  3HOX J;  1HCR A;  2M34 A;  1YRN A;  3BR6 A;  2DA2 A;  5C4J J;  1UHS A;  3BR0 A;  1DU0 A;  2HYJ A;  4JX4 A;  4B1R A;  3WHB A;  1A5J A;  4A3G J;  2DN0 A;  3S1R J;  2LKX A;  5EG0 A;  3D1N I;  3G1O A;  1IV6 A;  1FJL A;  1JT6 A;  2JA8 J;  3BTC A;  1JKR C;  1ENH A;  2Y2Z A;  4A3J J;  2WV1 A;  4M3D A;  2MW8 A;  3BG3 A;  2L9R A;  2DMT A;  3PM1 A;  1E3O C;  1Z0X A;  3TP0 A;  1VI0 A;  1W0T A;  1EF4 A;  4NDL A;  3SDG A;  2O8K A;  2WAQ N;  3ZQH A;  2L7Z A;  2LFB A;  3GTM J;  3A01 A;  3O8G A;  1B72 A;  1QPI A;  1PUF A;  2K40 A;  2M2E A;  3M4O J;  4Y52 J;  3HOW J;  2ZB9 A;  3GTQ J;  4DYR A;  5IYC J;  1OFC X;  1HOM A;  3RZD J;  1BL0 A;  2FJ1 A;  1JUS A;  2LK2 A;  1G2H A;  1UG2 A;  1AU7 A;  3JRE A;  2NS8 A;  3BG9 A;  2KT0 A;  4MFD A;  2DTZ A;  1MH3 A;  2EH3 A;  1AKH A;  3GBG A;  1JTY A;  1K83 J;  3F0C A;  3SFI A;  1JUM A;  5K7F A;  4MO7 A;  3BR1 A;  2O9L A;  1CQT A;  1APL C;  1LE8 B;  4X1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...