1XS9A

A model of the ternary complex formed between mara, the alpha-ctd of rna polymerase and dna
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
129
structure length
129
Chain Sequence
MTMSRRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAERYGFESQQTLTRTFKNYFDVPPHKYRMTNMQGESRFLHPLNHYNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*GP*AP*TP*TP*TP*AP*GP*CP*AP*AP*AP*AP*CP*GP*TP*GP*GP*CP
publication title Versatility of the carboxy-terminal domain of the alpha subunit of RNA polymerase in transcriptional activation: use of the DNA contact site as a protein contact site for MarA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 39
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2004-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12833 HTH_18 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1xs9A02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1xs9A01
2CUFA 3A03A 5K7HA 4BBRJ 1FJLA 1X2NA 3TW6A 2GBYA 1HOMA 2FD5A 1FEXA 2I10A 1TC3C 2GLOA 2H1KA 2QCOA 1LFBA 4DW6A 2EH3A 2DA7A 4JP0A 1JT6A 3ZQCA 1FIAA 1HDDC 1ZGWA 2D5VA 4B3AA 2FQ4A 4RBOA 5HODA 4A3MJ 1P7JA 1I6HJ 1IRZA 2XGDA 1FTTA 2QF7A 1RKWA 4A69C 2MG4A 1XC5A 3IH4A 1Q1VA 4FE7A 1B72A 4UUTA 4DYCA 2YS9A 4QIWN 4C2MJ 3JRIA 1DU6A 2COBA 3LNQA 2DMPA 5F0HA 1PUFB 5C3EJ 2EBIA 1EF4A 1XS9A 4XICA 2DA5A 1S7EA 4BY1J 2VUMJ 1G2HA 2LLKA 5EG0B 3OSGA 3LSRA 3S2DJ 3G1OA 3HKZN 4AUXA 1APLC 2XGEA 2M9HA 3H3VK 3GTJJ 1VFCA 1WPKA 3M3YJ 3HOYJ 2NVXJ 2E19A 2AHQA 1ZQ3P 3UKGA 3CQZJ 4MFDA 2M8GX 4G12A 2KT0A 5IYBJ 2R0QC 4BXXJ 2DMTA 2ID3A 1VNDA 9ANTA 4EEFG 2Y9YA 2Y31A 3GBGA 1T33A 1NTCA 1UMQA 2LR8A 5FLVA 2XB0X 3BT9A 3HOWJ 2OF7A 2HOAA 1X2MA 1JTXA 1WH5A 3ZQGA 3GTGJ 3WHCA 1MNMC 4XRSG 4C3HJ 2K9QA 3HBLA 1JT0A 1LFUP 3JRHA 3O8GA 5EDNA 3FK6A 1MBEA 2DMUA 2EZIA 5BNGA 2ME0A 1ORKA 1W0UA 3BR3A 2JA7J 3A02A 5J1RA 4M6VA 3FKIJ 1ZK8A 1ETYA 2B63J 3BTIA 1IUFA 3O8HA 3HOXJ 2CQQA 4XRSA 3JRAA 1I50J 3OSFA 5DS9A 1FTZA 2MW8A 2H8RA 5EG0A 2E2JJ 3RZDJ 4J19A 1U9NA 1FIPA 4Y52J 2VPRA 4UUSA 5IYDJ 4LOCA 1W0TA 3IH3A 4Y7NJ 3RZOJ 1BJZA 3HB9A 1BW5A 4A3DJ 3GTPJ 4L5EA 1SANA 1RETA 5F08A 4XRMA 1NK3P 1WGXA 4XK4A 4M3DA 2NVTJ 3HOUJ 2IAIA 1HCRA 3DCFA 2K9SA 3MKLA 1WH7A 5IP9J 3PM1A 2R5ZA 1ZTRA 3M4OJ 1H88C 2LY9A 3LOCA 1Z77A 1GV2A 2ECCA 1UHSA 5FJ8J 1XG1A 3QPLA 5IOZA 3W6VA 3H0GJ 1E3OC 2VKVA 3FISA 1IDZA 4V2GA 4A3GJ 3JREA 1U78A 1WCMJ 2FJ1A 1JKPC 3JRFA 2WAQN 3I4MJ 3BR6A 4DZJA 5IP6A 4X1EA 2XPVA 4I6ZA 5FKNA 1GVDA 2NS8A 2ECBA 1OFCX 1CQTA 1OCPA 4BBSJ 2PMZN 3PO2J 2CQXA 5EGOA 4A3IJ 2HOTA 2R92J 5GPCA 2TCTA 2HXOA 1K83J 5E3OA 1A5JA 5C4XJ 2E2HJ 2N8GA 2JA6J 4A3LJ 2R93J 2VI6A 2NVYJ 2XSDC 3HGGA 2L7ZA 1MBJA 4FISA 1K61A 1ENHA 2EQRA 2XB5A 5GPAA 3TW7A 2R5YB 4UUSB 2DA6A 2HXIA 3HGYA 1TWCJ 3GTQJ 4GFBA 1LE8A 3QQAA 2CUEA 3HOZJ 3IV5A 1YRNB 2EZKA 3G1LA 4C3IJ 1ETXA 1RESA 2TRTA 2JN6A 2R5ZB 5IPAA 2KDZA 2G0EA 4A3KJ 2O7OA 1JKQC 1HF0A 4XIDA 1UG2A 5EZHA 2L9RA 2DJNA 5E3LA 1H8AC 1QRYA 4ABZA 4MO7A 2LD5A 4HNVA 2JA5J 3K7AJ 1IG7A 3NAUA 5M5XJ 3Q0VA 2K40A 4M3BA 3JRBA 4FTHA 3S14J 1Z0XA 5IOYA 2LFBA 5EYRA 3IH2A 4BY7J 3LSJA 3GTLJ 5FKMA 2Y9ZA 4DZPA 2HYJA 4I76A 4MFEA 3JRCA 2XRLA 3SDGA 1GT0C 1MSEC 2M2EA 1DU0A 1IGNA 3F0CA 2M34A 5EGOB 3GTKJ 2L7MP 3ZQHA 1SFOJ 4QTRA 2R5YA 5M5YJ 1BL0A 2E2IJ 3I4NJ 2NOGA 4S0HB 1Y1VJ 3K2AA 3BG3A 2LK2A 1X58A 2MSYA 1ZR2A 3SFIA 1YRNA 3WHBA 3D1NI 4D5FA 1TWFJ 1P7IA 3G1MA 1ETKA 2CRGA 2CU7A 3A01B 1R9TJ 3GTMJ 3S2HJ 4CYCB 2HDDA 3Q0UA 2IEKA 1JJ8C 3BTCA 1IV6A 1LE8B 1JKRC 4B1RA 2WB1N 2LVSA 2YU9J 1A6IA 1POGA 2AO9A 2DA3A 4C3JJ 1AKHB 5K7FA 1F36A 2ELKA 4IEJA 2JK3A 3S17J 2LP0A 2VKEA 3BG9A 1ZR4A 4W1UA 2HOSA 3RQIA 5JLXA 4JX5A 4DYRA 1TWHJ 3TP0A 1IJWC 5FKOA 5EZGA 3OOUA 2DMQA 2NVQJ 3HEFA 1HDPA 1NK2P 2DA2A 4QSHA 2GM4A 1OJLA 3MVPA 5IYCJ 2Y30A 3JRGA 2IBDA 1IDYA 3BR2A 5IP7J 1TWGJ 1JUMA 4AYBN 3C2BA 4BKXA 1MBFA 5EEAA 1Y1WJ 3HOVJ 3RKQA 2O9LA 5M3FJ 3CDLA 1BW6A 1JUSA 1ETWA 4FCYA 4W97A 3QPSA 2XGCA 1WI3A 4IHYA 2DN0A 3ZQFA 5F1JA 3B6AA 2EZHA 3HM5A 3BTJA 5JLWA 4A3FJ 1QPIA 1RR7A 2JJ7A 2Y2ZA 4D7MA 3A01A 1AHDP 2DTZA 1T56A 4CYCA 2P81A 4A3JJ 3NARA 1ETVA 5F0CA 4X6AJ 3MN2A 1JGGA 1RKTA 1MH3A 3ZQLA 1AKHA 4FE4A 5GP9A 2CJJA 3BG5A 3BQZA 2YUSA 3LSGA 1B8IA 1JJ6C 4MIMA 4JYKA 1RPWA 5E3NA 2JA8J 1AU7A 5DTDA 3BR0A 4JX4A 4IHXA 1ITYA 3FIWA 3SJMA 3BR1A 1HLVA 5M5WJ 2K9NA 3S16J 1MBHA 1MSFC 1U8BA 1MBGA 1F43A 2XPWA 4NDLA 3Q0WA 5EF6A 2LTPA 3LSPA 2JMWA 1VF9A 2LKXA 2DA4A 2DA1A 4M3GA 1D5YA 1TWAJ 2W48A 2O8KA 2OPTA 4D5CA 2NS7A 4A3CJ 4DYQA 4JX6A 4V2FA 1GDTA 1ETOA 2M0CA 1JKOC 4RDUA 5F04A 2ID6A 3ZQIA 3TP3A 5C44J 1BA5A 5E3MA 1IC8A 4A3EJ 2R7ZJ 3B6CA 3S1MJ 4B4CA 3GTOJ 2WV1A 1ZKGA 3CCYA 3TEDA 3S1NJ 1U9OA 2MGQA 2X48A 5FKKA 1JUPA 2E1OA 3L1PA 1PUFA 5F0FA 3ZOBA 2FX0A 3JRDA 1H89C 4AC0A 4A3BJ 2RAEA 3S1QJ 5F27A 2JWTA 3VPRA 3BTLA 1GUUA 3PO3J 3FK7A 1MH4A 1B72B 3HDDA 4M3EA 1QVUA 4A93J 3Q3SA 3CMYA 1JTYA 4D7NA 3JR9A 1B8IB 3BR5A 1VI0A 4MLOA 5J3LA 2HQ5A 2XPUA 3S1RJ 1OCTC 2L7FP 1O4XA 3E7LA 5K7ZA 4IHWA 2ME6A 3DEWA 5J1UA 2L0KA 1MBKA 5M3MJ 3S15J 2ZB9A 2EZLA 2Y0SN 1I3QJ 5C4JJ 4IHVA 2HI3A 5FLMJ 1QVTA 1GV5A 2X6OA 3OIOA 1ETQA 5J1YA 2DMNA 4M3FA 5FKLA 2X9DA 3BQYA
chains in the Genus database with same CATH superfamily
4BEHA 1Y8RB 4KYWA 2JZYA 3TW6A 5LRSA 5FRNA 1JI8A 1HOMA 2I10A 4HV5A 2E5NA 2RKHA 1LFBA 4DW6A 2K27A 1FYLA 1SMYF 5LRRA 5HLHA 5JR3A 4IJAA 3ZQCA 3LWFA 2OC6A 1O57A 4P96A 5HODA 1I6HJ 1VQOI 1FTTA 4E7HA 2QF7A 1UELB 1SEUA 3WTVC 1A04A 3LA3A 3U21A 2A3SA 1QU3A 3VYSB 4ON0A 4CSWA 1SVLA 4UUTA 4DYCA 2BW3A 1DGRM 3JRIA 2Z5UA 3P5JA 2DMPA 4PSWA 3OYJA 2X6XA 2E71A 3S32A 1K6OA 2Y48A 1EF4A 1XS9A 3FHZA 1KU2A 1P4XA 1S7EA 2DA5A 3IKVA 2LLKA 4WK8F 2FBHA 2XGEA 5GTHC 3H3VK 3GTJJ 3I58A 3AKZA 4NC7A 5E1WA 3OYGA 4XLHA 2OU2A 4G6DA 1TQMA 2L4AA 3CUQC 3C1DA 4MFDA 4F55A 3OL3A 4QPOA 1TT5B 2UV1A 2EA2A 4HX4A 4TV7A 2Y9YA 3H5AA 3KP4A 4C9YA 2XHKA 1PP7U 1T33A 1D0ZA 4LK1F 4AU7A 3AG3H 1DP7P 5FLVA 2BY1A 1AA7A 4XSZF 4IX7A 2OF7A 4M6YA 3ZQGA 2DAOA 2HKXA 5HNHA 2LRDA 2MLGA 1ZLJA 2K9QA 5H6RA 3CF2A 5DD8A 3KP2A 4XL9A 3K1PA 1MBEA 5BNGA 2K5CA 4B43A 2ME0A 1SFEA 2EV6A 2F5DA 1MGTA 4CCNA 2L54A 1W0UA 1P2FA 3C18A 3K4BA 3LMMA 2WC2A 3A02A 4M6VA 3BG6A 1ETYA 2B63J 2OTJI 1EKEA 3E3VA 1R1UA 4R79A 4I0AA 2MW8A 2QWWA 3T8TA 2R7XA 1LNWA 3QYFA 5ILVA 3RZDJ 1HA8A 2AXTC 1Z21A 2VPRA 2L02A 2Q2EA 1Z91A 4LOCA 1LFPA 4Y7NJ 1BW5A 4G7HF 1XN7A 4LITA 1KU7A 1RETA 4XOTA 3M9AA 3TL4X 4XRMA 1F5TA 2O8XA 5TJJA 5B66C 2QKMB 2IAIA 1XPXA 3QRFF 1HCRA 2VBWA 4A0YA 3M4OJ 4QWQA 3CMMA 1USSA 1H88C 1FX7A 2LY9A 3K4LA 4Q47A 2XVCA 2FNAA 2WA0A 3SZPA 3WODF 3QPLA 5IOZA 2QM3A 2LSOA 4XONA 3HKZA 4N0BA 2K85A 1W5CC 4HW0A 4V2GA 4I0BA 2V6CA 2R7TA 3ABTA 2AS5F 4HSTA 1WJDA 5CKTA 3VOEA 1BC8C 5JFRA 5CLSA 2H1LA 2F5CA 2WAQN 3I4MJ 1QHGA 1EH6A 1TNTA 2RGVA 4WXDA 4DZJA 4PJLA 2IGKA 4DOZA 4KMFA 2VQCA 2P7CB 2GXBA 2NAZA 1X1CA 3OYIA 2ECBA 2ZSIB 3FXOA 4L18B 3K10A 4BBSJ 1VZ0A 2PMZN 2HZDA 3PO2J 1OYIA 2XAFA 2TCTA 2HXOA 3U2RA 2V1DA 4PZJA 5DYMA 1FC3A 2P7VB 2E2HJ 2JA6J 1MMNA 3ZQQA 1A36A 3BG7A 5HLTA 2L9NA 3HGGA 3ABUA 3M8JA 3TOBA 4FISA 5DEQA 3QP6A 4A0XA 1KU9A 4FQGA 1MMDA 3GFJA 2JVGA 2LBFA 4AIDA 1DPUA 3RKXA 1VQKI 4BXFA 2HXIA 2V79A 5LGNA 1R71A 3E5XA 2KJCA 5D6FA 4XQFA 4BUPA 2LDUA 4D9JA 1LE8A 1FBSA 3HOZJ 2O03A 1U6GA 3L2QA 1XTAA 1YRNB 3R0JA 2EZKA 1WJFA 4C3IJ 2IA2A 5FO5A 1K78A 1R7JA 5E17F 1RESA 4E7KA 3L2RA 5IT3A 2G0EA 2O7OA 3G4SI 3ASOH 1JKQC 1HF0A 1V5GA 5EZHA 1D0YA 4LK0F 4PJJA 2DJNA 3FXQA 1HSJA 1QRYA 4MO7A 3P9CA 2ESHA 4BE2A 4ZDLA 3NAUA 4F3QA 5GTIC 4DBRA 2K40A 2FQ3A 4M3BA 3S14J 1Z0XA 2X85A 2QVOA 3WU1B 1QZZA 2JUCA 1X3UA 4RB1A 5E1ZB 1OPCA 3P9IA 4RAZA 4LJZF 2XRLA 3S3OA 4Q5SF 5FLXK 3JSOA 3HRTA 1IGNA 3F0CA 4WX9A 1BM9A 3PL8A 3M07A 5KCMA 2PLYA 4YIIA 2CUJA 2QQAA 4OIQF 4CDGA 1QA6A 3ZMSA 4QTRA 4C2TA 1BL0A 5FD6A 1KA8A 4MNUA 1OCZH 2DPDA 1Y1VJ 1LUJB 2LF8A 3IKTA 1X58A 3RKWA 1XMKA 3AG2H 2W4SA 3SFIA 4L9TA 5FGMA 3H9GA 1FY7A 4HQMA 1YRNA 5B1BH 3D1NI 3CLQA 1P7IA 4KICA 2CRGA 4M9XA 3CJRB 1O3SA 1D0XA 1RNLA 3HTUA 4N9HA 3TDUC 2OA4A 1LJ9A 1RC9A 3S2HJ 1TNSA 3GXOA 3HPGA 3Q0UA 5CVUA 3PSIA 5CYVA 4RB3C 4B1RA 3GZNB 4EJOA 3K6GA 3OYCA 4C3JJ 3OYEA 1F36A 4Y4RA 3H5RA 2UXNA 3AL0C 3S17J 3DBRB 2LP0A 4XLPF 2BZTA 3BG9A 2DT5A 1UB9A 3J81Z 3O3KA 2HOSA 3ERMA 3RPQA 3TO9A 3ZMDA 5FFXA 1D8JA 4I99C 3RSNA 2XSJC 3LSIA 1R58A 2RVCA 4EGYA 5EZGA 4DQ2A 5H2FC 1HKQA 1X4PA 2DMQA 3OOUA 4RB2C 3HEFA 1HDPA 1HSTA 2ZSHB 2NVQJ 4QPQA 4I2OA 1OJLA 1SD5A 2JT1A 1JHFA 3K2ZA 4XLFA 3LQQA 4EM1A 4AVZA 3OS2A 1XDUA 4UNOA 2ZXWH 1X1BA 1MBFA 5EEAA 4ZYGA 1JUSA 4XNFA 4NB5A 4W97A 3QPSA 1Q1HA 2KLOA 3R61A 4C30A 2DN0A 1IZ1A 1TQPA 2L2OA 3ZR8X 3ZQFA 1JE8A 3LFKA 3TO7A 1Z3YA 3HM5A 3CUQA 1ZGJA 4A3FJ 2GOXB 5BPDA 1VTNC 1CF7B 2JJ7A 2QZ8A 5HS7A 1T8IA 2OZ6A 2ADUA 3HPHA 3L09A 2P81A 2XF7A 2ZFWA 3DPTA 4CXFA 1LQ1A 2B9SA 2VODA 1I39A 3SZTA 2V7FA 2P0WA 5K5RA 1JGGA 1HXDA 1RKTA 3WTSC 3FM5A 4DGWB 5GP9A 2CJJA 2KPMA 3ABKH 5LEKA 4IQ4A 2JQ7A 1XCVA 1B8IA 1FNNA 2MBFA 2DYSH 3ELKA 1RPWA 1YOVB 1R4MB 1NG6A 4U87A 1O7LA 4XRFA 3JAMK 2HPMA 3MZ8A 2HYFA 4F7ZA 2EFWA 4LFUA 3KE2A 2QSHX 3BR1A 1HLVA 1UZCA 4M71A 3CUOA 3ECHA 5HDGA 4CCLA 1E3PA 1J59A 2FU4A 2MC3A 1MBHA 3KFWX 1MSFC 2R4GA 1J2XA 6PAXA 3SXYA 2GXGA 3Q0WA 4L9NA 1M1EB 4U0YA 2LTPA 5LHGA 2HTSA 4IKFA 1EJ9A 2DA4A 3ABMH 2DK8A 4CCKA 1TWAJ 4S04A 4LD5A 2F5VA 4JK1X 3RKYA 4D5CA 3HJEA 4KMUX 4L0YB 4NQWB 3M7GA 5AONA 3IL2A 1LB2A 2GQQA 3DPLC 4V2FA 2A68F 3HC7A 1IW7F 3OYAA 3PNYA 1HKTA 5AIQA 5C44J 1IC8A 4LG0A 3QODA 3Q5FA 4BHBA 1T6SA 3SQNA 4B4CA 3ROUA 3GTOJ 3S2WA 1U9OA 1Y0UA 1GVJA 3VODA 2WTEA 2H6BA 4UHTA 5H20A 1PUFA 2FSWA 4P9UA 3OYNA 3B02A 2Z33A 3V8JA 3JRDA 2F4MB 1BR1A 2OTLI 4XN3A 2VN2A 2XAUA 5F27A 3I3LA 4UVAA 2JWTA 2YX7A 3QOEA 3ZQ7A 2XKOA 1TT0A 2O61A 2PG4A 2XC7A 4BDZA 1BOAA 3I4PA 3HDDA 2PMHA 3F3XA 2BY3A 2IW5A 3KP5A 5HLGA 1Z6RA 1JTYA 3PFIA 4FX0A 1IN4A 4D7NA 3JR9A 4GXOA 4P5OA 1VQMI 1X3WB 1IXSB 3BR5A 4MLOA 2HQ5A 1Y56A 2IGOA 2CMPA 1UG0A 4EGZA 4O6JA 2OD5A 3WTXC 2ME6A 3DEWA 2HR3A 4AIHA 1S8NA 5TRDA 1XGSA 3OIPA 5BS6A 1S9HA 2PBIA 5DD4A 2PI0A 3S15J 2P5LC 5HS8A 4NQWA 2EZLA 1Z1DA 2CW7A 1L3LA 1IXRC 5C4JJ 3LAJA 2HI3A 2OBPA 5BPIA 2NYXA 1JHHA 1QVTA 2JUGA 3OIOA 4M3FA 2G7HA 3PIOF 1P4WA 5ILSA 3DKYA 2CYYA 3DKWA 4BBRJ 3TO6A 2YR2A 3KX2A 1EH8A 3BZCA 1IN7A 1YW7A 3TKYA 1TC3C 1MMSA 4BACA 2QCOA 2HQNA 5LLQA 3I9V2 5HDNA 3EYYA 1K7AA 2DA7A 3F8FA 3QU6A 2HQRA 2P5VA 1FIAA 2PEXA 4B3AA 2E60A 4D0PA 1IRZA 1P7JA 2QBYB 1U0JA 2W57A 2MG4A 2ZMEC 1ZRFA 4E70A 1XC5A 2FMYA 1Q1VA 2QENA 2KIFA 1Z3XA 2COBA 2P6TA 3OV8A 2EBIA 3IAM2 1G2HA 2M45A 3OSGA 3S2DJ 3LSRA 3AL0B 1ON2A 1U8RA 3CCUI 4AUXA 2MFZA 4A6DA 1VQLI 2DI3A 4OWRB 2NVXJ 5E1XA 1BI1A 3HXLA 2AHQA 2EV5A 4BQNA 3ZN1A 3CDIA 1WFXA 3DXJF 3CQZJ 4Y15A 4G12A 3G3ZA 1FOXA 2KT0A 4IZZA 2ID3A 3WG7H 1RIOH 2ICWG 2PQ8A 4ZTJA 2Y31A 3GBGA 2AQFA 4E4HA 1FZPB 1MJ9A 1NTCA 3KZYA 3W6KB 4EV0A 5D5UB 4U7DA 3WG9A 2XB0X 2GIVA 1TTYA 1MMAA 1T0FC 3HOWJ 2GIZA 4EJUA 5D8LB 1G3YA 1JTXA 3B73A 3WHCA 2EFPA 4XRSG 1S72I 4IPAA 4HRIA 2Y0SA 4ENNA 1JT0A 1LFUP 4ZYAA 3JCUC 3FK6A 4I01A 2QBYA 2DMUA 2EZIA 1MZBA 2A6HF 5LFAA 1ORKA 4BL0B 3BR3A 2MABA 1PDNC 4C2UA 3KYLA 4LMYA 4O5VA 3BTIA 3PFYA 4JQFA 3BJOA 4HBLA 3SEZA 1FTZA 2MYSA 2E2JJ 5DDGA 4J19A 3KYDB 5F1RA 1FIPA 4ESJA 5IYDJ 4RGSA 3RZOJ 3HOTA 3GTPJ 2O6GE 1SANA 4IVNA 2MD0A 2KZGA 4M3DA 2VC1A 4RB0A 5FD5A 2NVTJ 2CFOA 2DOFA 5JHFA 1RRJA 2K9SA 4G6QA 5IP9J 3A1YA 3PM1A 4ZZLA 2FF4A 3ZXSA 2DFFA 1Z77A 3S3NA 2VASA 1UHSA 1FOYA 3GO5A 4I02A 1WZ2A 1TZLA 4UB8C 4OINF 4EM0B 4PFOA 4YFKF 5KAFC 2DT6A 1T08B 1E3OC 3ZMVA 2HS5A 2VKVA 2E34A 3FISA 2DYRH 3ONQA 4ZJZA 4HZFA 3CCMI 1YFHA 4A3GJ 4A2UA 2GZWA 5E8IA 2FE3A 5FLXZ 1ZG5A 2JRTA 4PK4A 3VDXA 3IAS2 4IRIA 2JPCA 3V4GA 1S7AA 4M74A 4KITB 1BJAA 3M1EA 4ETSA 3BR6A 1YO5C 5DCMA 4S05A 2L5QA 4RLFA 3U9GA 3BDDA 1FT9A 5LHIA 1R00A 3TDZC 1OCPA 5L3CA 2BVMA 2NS0A 4CO8A 4M9ZA 2Q0OA 5EGOA 4A3IJ 3CD6I 2IA1A 2R92J 2LH9A 5GPCA 3WTWC 3EUHA 1TL8A 1IUYA 4KISA 5E3OA 2LKPA 1JGSA 4OAYA 4HYEA 2RQQA 4A3LJ 2W24A 2R7QA 2IGMA 2NVYJ 1ONVA 3R0AA 4R1HA 1FLIA 4HAMA 1YJ9I 4UVBA 3BOQA 2LREA 5ERIA 4EJTA 1YTYA 4RS8A 5KNLA 2YX4A 3IRRA 1ZREA 2XB5A 5GPAA 3TW7A 3E5QA 1YITI 3KCCA 4L9VA 2Q2EB 3W6JB 1WQ2A 3CMAI 1R22A 2F2EA 2CUEA 2RNJA 4Y17A 3CF5F 3L2VA 3OYMA 3E6MA 2V1NA 1GXPA 3G1LA 1WRJA 4HG2A 1X19A 4XMYA 3F8BA 3K4MA 4RA2A 1Z05A 3REOA 4ZH4F 4MQ9F 1UG2A 4HA8A 4XSXF 4OIPF 1YX5A 5E3LA 1HW5A 1X1DA 1X1PA 1YG2A 3DEUA 2ACJA 4ABZA 4JBAA 3Q9VA 3ZP5A 5HS9A 5FFZA 5CQGA 3NWTA 4HNVA 2Z16A 3M8EA 3M1CA 5B3SH 2DOEA 5KHDA 3BLYA 2BVLA 2VL8A 4CGZA 2F4IA 1YX3A 3Q0VA 2PFBA 1OISA 4BQQA 4FTHA 2QQBA 3K4CA 2A5YB 1VQ7I 5IOYA 2P8TA 5DUKA 5CJ9A 2Y9ZA 4DZPA 1T98A 4I76A 3JRCA 2RNGA 4CCJA 2Y0MA 1GT0C 1UFMA 1I1GA 2WAQA 2EA4A 3FXRA 3F8CA 3OYHA 1ERDA 2VT2A 4IRHA 1WJBA 1O3TA 2QQ9A 1SFOJ 1LVKA 4KA4A 3LA7A 5M5YJ 1IAWA 5LHHA 2E2IJ 2PMZA 1PUEE 1FSEA 2A5WA 2DXIA 4S0HB 3K2AA 3FF5A 3BG3A 1S7OA 2HOEA 2X6WA 3JAMZ 5IT9Z 2B0LA 4XKWA 2BHYA 4XORA 1SMTA 4D5FA 1TWFJ 2COMA 2DLLA 5BOXA 3HSEA 4FHTA 5F64A 2LBFB 4HSRA 4EVIA 3K0LA 1SFKA 3A01B 4IXAA 1BR4A 3I53A 3GYHX 3RJPA 1JJ8C 1ZELA 1LE8B 2FBIA 1BBYA 1E3HA 1I27A 3CJQB 3DLAA 2WB1N 2YU9J 3MD2A 2DA3A 1F9NA 2BV6A 3LQRA 3K70C 3V7SA 1VQ8I 2ELKA 1Y39A 3WTUC 1K78B 1BC7C 4PJNA 1VQPI 3GZ5A 2O0YA 4JX5A 1KQ9A 4HX7A 5L3BA 1R1VA 1Y0NA 2ZC2A 5FKOA 3BCAA 4OMZA 2BGCA 2EIJH 2ZMEA 2DOAA 4P9FA 3MVPA 1YW9A 4HF1A 4N4NB 3SEQA 3T1BA 2CV1A 1J0RA 3RTRA 3BZ6A 3FDYA 4Q4ZF 1I6XA 1S5LC 1TWGJ 3CC4I 1JUMA 4ESFA 3H5NA 4AYBN 3OS0A 3HSRA 1IXCA 5D5WB 2HDWA 2DFIA 3J80K 3DBHB 4GDFA 2QSGX 1ETWA 3I5UA 4FCYA 4ENJA 5HLIA 1WI3A 4IHYA 2PMUA 2AQEA 2CS3A 1ODDA 4B8XA 2E35A 3FMSA 3B6AA 1LEBA 1N75A 4PSXA 4IRGA 3QU3A 2UZKA 4ZDPA 5IY5H 4BQOA 4I98B 3ZMUA 5J8FA 2VJIA 3A01A 3S93A 1R5GA 2ESNA 2M1BA 1PJRA 4HPQA 1FOKA 4A3JJ 3NARA 3PNVA 1PP8F 3ZPLA 1BN5A 2OJED 5F0CA 4X6AJ 3A0HC 4PFPA 3IHUA 1OYYA 2K3FA 2R7UA 2E1NA 4RGRA 2C6YA 1T0FA 3BQZA 1U5TC 3OR1C 5A2QK 4BU2A 4U0VA 5E3NA 4UXNA 1AU7A 4EATA 3QWLA 2VJ5A 4LGWA 4Y3OA 2Z9OA 2DQRA 1MD0A 1ITYA 4A0ZA 2P4WA 1ZG1A 5M5WJ 4GYIA 3HHGA 2K9NA 2LYCA 4M9SA 3S16J 2V9VA 3WE2A 2DCEA 3ZGKA 2K9MA 1F43A 4NDLA 2JTVA 2QQ8A 3LSPA 1T38A 3MEXA 1Z67A 1V5FA 3FXLA 5GAEJ 2DA1A 1D5YA 1IF1A 4UB6C 2OPTA 2DQLA 2FA5A 5L3GA 1VQ4I 4A3CJ 1IRGA 1BR2A 4DYQA 3BPXA 1YIOA 3CDHA 1Y6IA 3OIQA 1JKOC 4RDUA 2UUZA 5F04A 1A31A 1QHHD 1USTA 3DU6A 4IL6C 1B9MA 3CC7I 2R7ZJ 4BE0A 3F72A 1IN5A 2OZUA 4FASD 4ZYEA 2H6CA 2FMLA 3S1NJ 3O6BB 2MGQA 2DPUA 2RREA 2FOKA 4MTEA 1YLFA 1WVRA 3COAC 3E0JB 1G6NA 2BYVE 3CUQB 2FEZA 3KEOA 3JTGA 2FX0A 2PN6A 2VB6A 1H89C 4AC0A 2RAEA 4BHPA 1TLHB 3PQKA 4RGXA 2Q8KA 1SFUA 5E8GA 2GWRA 2R7RA 3BJAA 2A05A 2GA2A 2ZO4A 3K4JA 3MFKA 1YI2I 4MHGA 2FXAA 2EK5A 4AWXB 4DNCA 1MH4A 1B72B 5EJCA 4M3EA 4EJVA 1QVUA 3GFIA 4H0EA 3GEZA 2VQGA 3CMYA 4CZZA 4EQQA 2CH0A 1B8IB 3FXKA 1OCTC 3NWSA 3F6OA 2L7FP 1O4XA 1KZHA 1QZYA 2V6EA 5K7ZA 2IS2A 3L2WA 2EIKH 5KAIC 2Q1ZB 2DTRA 4BDYA 1TQIA 5J40A 5M3MJ 2ZB9A 2D1VA 2KKOA 1WWXA 4IHVA 2WADA 3CLOA 5FLMJ 1I1SA 2LNBA 2X6OA 3KEYA 1ETQA 1WJAA 2DMNA 5FKLA 4G94A 4PCQA 2X9DA 2QKLB 3BQYA 1Z9CA 1UHWA 5K7HA 3IUOA 1P9QC 1X2NA 4I7HA 2GBYA 3FX3A 1VQ5I 3D5RC 1FEXA 1BIAA 2GLOA 2H1KA 4NHJA 4GRIA 1CGPA 1QQIA 2MH2A 3IRQA 4L9JA 4JP0A 3N97A 3CP2A 2XDVA 1HDDC 1ZGWA 4RBOA 2FQ4A 3H35A 4A3MJ 1A35A 2IJLA 4LG0B 2XGDA 2LC2A 5B5EC 2GOMA 3FHNA 4A69C 2EJRA 3DEEA 2L9VA 2OV7A 3NRVA 4FE7A 1I3AA 1B72A 4BE1A 2YS9A 2IPQX 3E6DA 4C2MJ 4CYDA 4QIWN 2Y69H 3LNQA 3HRSA 5F0HA 2I5UA 1PUFB 3EUHC 1R23A 3LSKA 3EDPA 4XICA 2DDBA 1KYZA 3OYBA 3GMEA 4L5JA 5EG0B 3OYFA 2M9HA 4XLEA 3KPHA 1VFCA 2XROA 3RQ4A 1H9TA 3M3YJ 3EUKL 1SAUA 3QPHA 2JRMA 3QP5A 2E5ZA 4RM2A 4NC6A 1SD6A 3HTSB 2KRFA 2M8GX 2XF6A 2R0QC 3GZ6A 4BXXJ 2EB7A 9ANTA 3FMQA 4KT5C 1OR7A 2L01A 4KT6A 4R8HA 1FBQA 3RYPA 2LR8A 5BQTA 3FM3A 3DLLF 1K6YA 5EEHA 3MKZA 1MNDA 3E5UA 1B4AA 1P92A 1WH5A 2D1HA 3ISPA 4C3HJ 2QSFX 4RMNA 4CHUA 2XRNA 3O8GA 2KDOA 5GAHJ 4MTDA 1XSDA 1QO0D 5D5XB 1G3SA 2VONA 3E97A 3P7NA 2FUG2 4XKVA 4B09A 3FKIJ 3O8HA 4UY8I 4HLYA 2CQQA 3VWBA 2LG4A 2PJPA 3BROA 5DS9A 3WGIA 5EG0A 1U9NA 3WTYC 1U5TB 4Y52J 1XX5A 4UUSA 3DQVC 1W0TA 2BXZA 1XDSA 1J5YA 3IH3A 1W36C 2E7XA 1BJZA 1P4AA 4BJ5C 1P6RA 3BP8A 4A3DJ 3CCRI 1Y8QB 2K86A 2EFNA 1K4TA 2A61A 3F8NA 1WGXA 5FB2A 3H1CA 3JTHA 3HOUJ 2Z1DA 3DCFA 2R5ZA 4EM2A 1ZTRA 2PJRB 2VQHA 2ZJRF 1SVOA 2OAZA 2MLKA 1GV2A 2ZKZA 1N25A 1X1AA 1XMXA 1V54H 3ABLH 1GXQA 4A5MA 5DV5A 3HRUA 3CP8A 2QLZA 3ZRGA 1IRFA 1EV7A 1W1WE 1WCMJ 2FJ1A 3LL7A 2VJ4A 1RI7A 1U2WA 3KLOA 2XAQA 5IP6A 2R7OA 2XPVA 2HEOA 5FKNA 1GVDA 1ZAOA 2NS8A 2M8EA 2K4BA 4MEXF 2VIXA 3CCEI 3F8MA 2E7WA 5D5VB 2BY2A 5BMZA 1RUNA 4ZZDA 3R6SA 2L3DA 5K5QA 2R7FA 1K83J 1U5TA 2GXAA 5C4XJ 3HL2A 2KZVA 2R93J 2KFDA 3C2GA 3DV8A 1BI2A 2L7ZA 2JA2A 1MBJA 5J6XA 3FBIB 2JSCA 1REPC 1K79A 3S3MA 1K61A 3AAFA 3U1DA 2EQRA 3W2WA 4II3A 5B1AH 2UWMA 4BH9A 2PJRA 2J5OA 3VYRB 4A5NA 2R5YB 1SVMA 1R1TA 2V1XA 4I09A 2DA6A 2AXLA 1G3WA 3FXMA 3K9TA 3K4KA 1TWCJ 1R49A 1O3QA 3GTQJ 2IS6A 3FZVA 3HHHA 1GLNA 3OY9A 4U0WA 3TOAA 3BCBA 1KYWA 2MA3A 2A6EF 2TRTA 3GFLA 2JN6A 5ICFA 5LBQA 3GVAA 3HZJA 2KDZA 2CQNA 1YYVA 4A3KJ 1KGSA 1BIBA 1Z7LA 4MGRA 2ZNYA 1WSUA 4KFCA 2L9RA 4ZYHA 1H8AC 3BY6A 4CUGA 3J80Z 3D5LA 2W7NA 2LD5A 4IF4A 3R4KA 4DJAA 1VQ9I 4CZCA 2JA5J 1XSVA 2YU3A 4Q48A 3K7AJ 1G3TA 3CCQI 3JRBA 3DP7A 1DGWY 3WGHA 2BXYA 2LFBA 3E6BA 5EYRA 3AG1H 1FOWA 3IH2A 4BY7J 4XR6A 5DCMB 1MMGA 1H9GA 4MFEA 2X0LA 5FRMA 3ERED 3FKJA 2ZBKA 3SDGA 2M7BA 1KONA 2M2EA 2W82A 1X3ZB 4OIOF 5EGOB 2KL4A 3E6CC 2R5YA 2FBKA 2DK5A 4EJWA 4FX4A 2EFQA 5DUIA 1FSHA 1S3JA 2MD5A 5A2QZ 3ML6A 3I4NJ 4GO1A 2DU9A 2FRHA 1ZARA 1X4OA 3GLLA 4PGHA 1SD7A 2HGCA 2LK2A 2MSYA 1ZR2A 5K1YA 1DDNA 2VJJA 1B9NA 4GYGA 4KNYA 1J9IA 3G1MA 1ETKA 3DTEA 3LFUA 4BHCA 2F4OB 4CCMA 4WXHA 2EV0A 3V7CA 1OQYA 1R9TJ 3GTMJ 2HDDA 4U88A 3HSFA 2R7DA 5D8KB 3KIOA 1MDMB 3DFGA 1JKRC 3SFZA 3HYIA 2LVSA 1POGA 2AO9A 2XKPA 1AKHB 4F92B 4Y13A 3ZMTA 1RR8C 2RV8A 4IEJA 2JK3A 5ICCA 2WY8Q 1FBUA 1QGPA 3A2KA 2VKEA 4W1UA 1YJWI 3RQIA 4KN7X 5DM6F 5JLXA 4DYRA 1ZRCA 2CWEA 2DDAA 1MNEA 2Z2SB 2EILH 3ESWB 4II2A 1OCOH 3N4MA 5JHUA 2ZXIA 3OMYA 3MKWB 3I56I 3PUBA 3H3ZA 2HVQA 1WKMA 5LGTA 4N4OB 2KISA 1UJ8A 2M3AA 3JRGA 3CZ6A 4XLNF 1IRXA 4Y33A 2WAEA 3FWEA 1NHAA 2IBDA 1IDYA 2K7LA 3CTAA 4YFNF 5IP7J 4RAYA 3DU5A 2RDPA 4BKXA 1WJCA 2X1EA 1Y1WJ 3HOVJ 4LB5A 1YHQI 1BW6A 2KRCA 3I59B 2IS1A 2XGCA 3C7JA 3WU2C 2DODA 2QYOA 3KP6A 4BNCA 1B1BA 2ZCWA 4XKBA 4DBQA 3H92A 5F1JA 1DUXC 1K4SA 2P5KA 4HX8A 4RLQA 2EZHA 5JLWA 3BTJA 1E2XA 1RR7A 2LMDA 4KJZA 4AVPA 4E7ZA 3WTTC 2V4JC 2BHZA 3OOPA 3KP7A 4Z6YA 1MDMA 1SFXA 1G8XA 2ISZA 3TGNA 2W1OA 1T39A 5CVJA 4BS9A 1L0OC 4X0GA 1E17A 3N05A 3FBNB 3QYBA 3ZQLA 1AKHA 1UCRA 4FE4A 4E7SA 5H6QA 3H36A 3LSGA 3G73A 3BZKA 1BI3A 4MIMA 5J8CA 3LA2A 4JYKA 4OAZA 2JA8J 1D1CA 1IN6A 3KETA 5JI6A 3DBLB 5D4RA 4DIQA 4KIBA 3EUAA 3SJMA 4BJTA 3GLXA 2XAHA 3EYIA 4F52A 5HOOA 2CV0A 1GHCA 3KP3A 4RGUA 1U8BA 1R5ID 2A07F 2WB1A 5EF6A 2E36A 1J7KA 1LDKB 2IGNA 1VF9A 3VSKA 4IOAF 4G7OF 4HOBA 2IT0A 3I71A 3I55I 2O8KA 3I59A 2ISYA 4MQVA 3C3WA 2ZMEB 4XOPA 4PJ0C 3DTIA 1OR7C 2JPBA 2A6TA 3IP4B 2ID6A 4FT8A 3ZQIA 2OUMA 2LOOA 2W84A 3TP3A 4E6KG 3V8KA 3I0TA 2XAJA 2D2WA 2MH9A 1XGNA 1V5EA 2F6CA 3S1MJ 3CCYA 3TEDA 1NH3A 2EPFA 2IXSA 5E79C 4AIJA 2STTA 4AYBA 2KHMA 2E1CA 2E1OA 3UNGC 1LPQA 3CESA 1ZHFA 4F91B 5F0FA 1R4NB 2KJBA 4LB6B 3KZIC 1RZ4A 5D4SA 2R7WA 1KQ0A 1OMIA 2JVHA 3S1QJ 4A3BJ 2HDCA 4JOMA 2CFXA 3CO6C 4HNTA 1HW2A 3VPRA 1W7PB 4LLGF 2LY1A 2K9LA 3FK7A 5JVTA 4ZYDA 3J7AO 4FETA 4ENMA 3LSHA 1AOYA 2W85A 1ULYA 4A93J 3ULQB 3TBIA 2OQRA 3CCJI 5J3LA 2ZJQF 2KMUA 1FP2A 4LIUA 1YW8A 5TGTA 2CQ7A 2YSRA 3FXUA 1YE9A 2L0KA 2G7UA 5J1UA 2XAGA 2XF5A 4RM3A 3RYRA 4WCGA 3CJNA 2R7SA 1MBKA 1QZEA 2VBXA 2RQPA 2ELJA 5J4YA 3JW4A 2CGPA 3A0BC 3L7WA 1D8KA 4WF2A 2X1DA 1V3FA 5J1YA 2L9SA 1BI0A 2DFEA 4AIKA 3VYUB 2HFHA 2NOJB 4GCVA 4CH7A 1D1BA 2VE8A 3DTKA 2QA4I 1JXSA 2CUFA 3A03A 3T8RA 3K70D 4OU0A 1FJLA 2HVSA 1LEAA 1QNTA 2XUBA 1S6LA 1OKRA 3ZMZA 1ZH5A 2X4HA 3DPUA 2FD5A 2CW8A 3IC7A 1XGOA 1MJBA 3MCZA 1Z7UA 3GX4X 2HTJA 3S8PA 2EH3A 2HKOA 4M73A 2BEOA 1JT6A 2KIUA 2CO5A 1WHUA 2D5VA 4BXUA 3RPUA 1T2KA 1S29A 3SYTA 3EQLF 1RKWA 1V4RA 3RI4A 4IHTA 4ZDOA 5ICEA 1W7PA 3C2HA 2NRAC 3IH4A 3L2CA 2EFOA 2M5WA 3K1MA 2OCCH 1DU6A 3ZCOA 2A69F 2M30A 4HLXA 3A4CA 5C3EJ 4BY1J 2F5EA 2VUMJ 3KYCB 3L9FA 5HDKA 3HUGB 3I64A 3G1OA 3HKZN 3F21A 4XM3A 1APLC 2O5RA 4A12A 2E1MC 1W5TA 1IO2A 1WPKA 4J00A 2KIQA 4V19K 3HOYJ 1DP3A 2E19A 2WY7Q 4P55A 1STZA 3F9KA 4AD9A 4HNUA 1O3RA 1ZQ3P 3UKGA 2CUZA 2VLAA 3MZHA 5IYBJ 1RUOA 2DMTA 3NQOA 4IQJA 1VNDA 5L3DA 4EEFG 2X1CA 4Z2YA 2WV0A 1FPQA 1OCRH 4XKCA 4EMSA 5TISC 2W25A 3K1NA 3JSPA 5GAGJ 2NNYA 2CV2A 1UMQA 4L5IA 3KZZA 2ZJPF 1WJ5A 5J47A 2H27A 2VBYA 1V55H 5AIPA 3BT9A 2Y75A 2DJIA 2HOAA 1X2MA 1SC7A 2BE5F 2H94A 2W00A 1MNMC 3GTGJ 1O7FA 4IO9F 3HBLA 4ANJA 3G2BA 3F6VA 1B59A 3JRHA 5EDNA 1TW2A 2UXXA 2ZXHA 2V26A 1D1AA 4YIRX 4HQEA 3G6EI 2HPIA 1IN8A 4G8XA 2JA7J 4HF2A 4KIGA 3U1KA 5J1RA 1ZK8A 3HOXJ 1IUFA 1ZG3A 4XRSA 3JRAA 1I50J 1KU3A 3OSFA 3D0SA 3W2AA 2H8RA 1EA3A 4KIFA 1W4MA 3H3UA 3VFZA 3HUGA 3AG4H 2K4JA 4HEA2 3HB9A 5F6FA 3PJRA 4NBQA 5L3FA 2XGXA 5DM7F 3EPZA 4L5EA 5F08A 1XMAA 1NK3P 1MIJA 1E0EA 4XK4A 3BWGA 5HNFA 3MKLA 1WH7A 3HG9A 2OCEA 3PNTA 3CO7C 3LOCA 4RAGA 2ECCA 2J5PA 2HVRA 5FJ8J 2KQRA 4OMYA 4UV8A 1XG1A 2H8WA 2KRHA 2OQGA 2WWYA 3GCMA 4UV9A 2VOOA 2QUFA 3W6VA 3H0GJ 1TBXA 4YG2F 4PDKA 3V7RA 3SDBA 3PIPF 1IDZA 1HC8A 3LSMA 2JSPA 5E20A 4G6TB 2IS4A 4LIVA 3GF2A 3JREA 3ASNH 1U78A 1R5HA 5DCFA 2IA0A 4LG3A 3JRFA 1JKPC 3F23A 4AM3A 2LKSA 4F93B 3IWFA 4X1EA 2L4MA 2V9KA 2CW0F 3J7ZI 4I6ZA 3QYEA 2Z99A 4D1QA 3OYLA 1OFCX 1CQTA 3OS1A 1J09A 3AFHA 3PQJA 1DPRA 4A6EA 2CQXA 2Z3YA 3TMOA 2DO7A 2HOTA 1PYVA 2X6YA 4QLCU 4UVCA 2BBYA 1A5JA 2M0MA 2N8GA 3W2VA 1TP4A 2VI6A 2XSDC 2HYGD 2XASA 1HKSA 3KEQA 3VEPA 1LDDA 2I8DA 1ENHA 1Z6TA 5ILUA 2FOWA 3LSTA 4OOIA 3K4NA 3CCVI 2VT3A 4PGGA 1A6QA 1HQCA 4UUSB 5L3EA 3ZN0A 2XV4S 2VKDA 3HGYA 4GFBA 4IOCF 3QQAA 2RN7A 5ICGA 3WTZA 4B47A 3IV5A 1AWCA 4UUVA 2LF7A 2QGUA 4ZTFA 1ETXA 4BJ6C 1XSXA 1XGMA 1FMVA 2R5ZB 4J01A 5IPAA 2DT7B 4GGGA 2GA1A 2VOPA 4XIDA 2EIMH 5IT9K 4XN0A 5CVIA 1LDJA 3HRMA 5KVRA 2BY0A 2VE9A 5CPRB 3FXJA 4LLLA 5D6EA 4E7JA 2GAUA 2KP6A 4N9IA 4HDUA 1IG7A 2WAFA 2B7EA 2L7KA 5M5XJ 4BQAA 1YS6A 3OWTA 2NNNA 2X51A 1W5SA 3PSFA 3SHFA 4M72A 1YS7A 3LSJA 4ZC3A 2K02A 3GTLJ 2RC4A 5FKMA 2HYJA 4NUBA 3BC8A 4CA0A 3GWZA 3H9QA 3O2PE 4YEJA 4NNJA 1MSEC 2M4GA 1DU0A 1ZLKA 2XIGA 3MMYB 2IVMA 4B3XA 2M34A 2TDXA 2R3SA 3GTKJ 2L7MP 3ZQHA 1HBXG 2VPLA 3IWZA 3T0YA 1CF7A 4L0ZB 5CQEA 1FYKA 4PUSA 3J7YJ 2NOGA 2V9PA 3LAPA 4HF0A 4ITVA 2ETHA 2E1MB 2VXZA 2H09A 5LEJA 5J4VA 4BYYA 2HWVA 3WHBA 1D3YA 4XLAA 3VSLA 2CU7A 1C0WA 2G9WA 1MJAA 5ED4A 3TQNA 1MKMA 4CYCB 2IEKA 1LKXA 3H9JA 4KUMA 4U7BA 3BTCA 1IV6A 2VQLA 3I54A 2K3PA 1A6IA 3EETA 2CG4A 3D5SC 5K7FA 1G4DA 4YIFA 2VKHA 1ZYRF 1NG7A 3BJ6A 1W36D 1T95A 1ZR4A 3G71I 1B6AA 2DBBA 4PJMA 1TWHJ 3CCLI 5HVQC 3TP0A 2HU9A 2ZNZA 3SZGA 1IJWC 1FYMA 2F5FA 5GADJ 1NK2P 4HDVA 2DA2A 4QSHA 2LY2A 2GM4A 5IYCJ 2Y30A 1J75A 1OCCH 3PUFA 4BAYA 3BR2A 1H0MA 3DF8A 4CICA 1WI9A 3C2BA 2CSOA 2FNPA 5E18F 1IV8A 4E7IA 3RKQA 2O9LA 4IHSA 5M3FJ 3CDLA 2O3FA 2WBMA 4O3MA 3OR2C 5LD2C 4WXCA 1ZN2A 3HIFA 4M6XA 3VYTB 3J7AY 2P6SA 3NEUA 3DWLE 3CJTB 1OYWA 3OL4A 1QPIA 2M87A 2Y2ZA 3GFMA 3DKXA 3Q9SA 4D7MA 3K69A 1AHDP 2DTZA 3MKYB 1T56A 4CYCA 1N77A 1ACIA 2IP2A 5KK1A 1R6RA 3L2UA 4YFXF 5LGUA 1DQUA 2DFHA 1WJEA 2KIMA 4XBFA 1D5VA 1ETVA 3MN2A 3W3CA 1MH3A 1XCBA 3KLNA 3MQ0A 3QAHA 3GUDA 1QPMA 3E1SA 3BG5A 2YUSA 2F48A 4HV6A 4KN4X 4MEYF 1UAAA 4ENKA 1JJ6C 1OLTA 4G7ZF 5K5OA 5DTDA 3WGGA 3CC2I 1KQ8A 3BR0A 2CQKA 5CVRA 4JX4A 2BOLA 2HZTA 3P9KA 4IHXA 3FIWA 2ZXJA 1SAXA 4H4KC 2M4KA 1N78A 4P1WA 2YPRA 2ZJ2A 1FMWA 1MBGA 2XPWA 3F22A 2PX9A 1PVEA 1ZGAA 1HW1A 2JMWA 3WE3A 4B44A 4BGDA 3UR3C 2LKXA 4M3GA 3M8FA 4XLCA 3RPUD 2W48A 4ASNA 3R60A 3CCSI 2VXDA 3BPVA 2NS7A 1W7PD 3V8LA 4JX6A 3MAJA 5EEGA 1R36A 3J81K 3FMRA 1ETOA 2M0CA 1UHMA 1GDTA 3V42A 2MC4A 4B48A 4RAFA 4YELA 1BA5A 5E3MA 2R7VA 1U3EM 4A3EJ 2NVUB 3GW2A 2VBZA 3OYKA 1XD7A 1BOBA 4BEHB 2IRFG 3B6CA 2STWA 4LLNA 2WV1A 1ZKGA 3H0DA 2X48A 5FKKA 1MW7A 4E7LA 3OYDA 1JUPA 3L1PA 3VB2A 1YJNI 3RCOA 3MWMA 3ZOBA 3L00A 1F1ZA 2ELHA 1FWZA 1LVAA 1FP1D 1F4KA 1YQAA 2V1UA 2ZFUA 3BTLA 3MZYA 2EINH 1GUUA 3PO3J 4NC8A 2BW3B 4YRVA 1ON1A 3Q3SA 1VQ6I 1EH7A 3WU0A 1G59A 5FROA 2NXNB 1VI0A 1SD4A 2XPUA 3S1RJ 3QPTA 2M7AA 5JVGF 3E7LA 4IHWA 2VC0A 2EWNA 1QBJA 2D45A 1XB4A 4K2EA 4WWCA 4KDPA 3T5XA 1I5ZA 2Y0SN 3QOPA 1I3QJ 2HQAA 1VQNI 3HOSA 4CCOA 2DW4A 2QEXI 1GV5A 3ECOA 5CVVA 1ZRDA 4ESBA 3CMEI 1YIJI 1TW3A 4OIRF 2HNHA 3RDIA 3X2QH 3RIRA 4G9YA
chains in the Genus database with same CATH topology
2CUFA 3A03A 5K7HA 4BBRJ 1FJLA 1X2NA 3TW6A 2GBYA 1HOMA 2FD5A 1FEXA 2I10A 1TC3C 2GLOA 2H1KA 2QCOA 1LFBA 4DW6A 2EH3A 2DA7A 4JP0A 1JT6A 3ZQCA 1FIAA 1HDDC 1ZGWA 2D5VA 4B3AA 2FQ4A 4RBOA 5HODA 4A3MJ 1P7JA 1I6HJ 1IRZA 2XGDA 1FTTA 2QF7A 1RKWA 4A69C 2MG4A 1XC5A 3IH4A 1Q1VA 4FE7A 1B72A 4UUTA 4DYCA 2YS9A 4QIWN 4C2MJ 3JRIA 1DU6A 2COBA 3LNQA 2DMPA 5F0HA 1PUFB 5C3EJ 2EBIA 1EF4A 1XS9A 4XICA 2DA5A 1S7EA 4BY1J 2VUMJ 1G2HA 2LLKA 5EG0B 3OSGA 3LSRA 3S2DJ 3G1OA 3HKZN 4AUXA 1APLC 2XGEA 2M9HA 3H3VK 3GTJJ 1VFCA 1WPKA 3M3YJ 3HOYJ 2NVXJ 2E19A 2AHQA 1ZQ3P 3UKGA 3CQZJ 4MFDA 2M8GX 4G12A 2KT0A 5IYBJ 2R0QC 4BXXJ 2DMTA 2ID3A 1VNDA 9ANTA 4EEFG 2Y9YA 2Y31A 3GBGA 1T33A 1NTCA 1UMQA 2LR8A 5FLVA 2XB0X 3BT9A 3HOWJ 2OF7A 2HOAA 1X2MA 1JTXA 1WH5A 3ZQGA 3GTGJ 3WHCA 1MNMC 4XRSG 4C3HJ 2K9QA 3HBLA 1JT0A 1LFUP 3JRHA 3O8GA 5EDNA 3FK6A 1MBEA 2DMUA 2EZIA 5BNGA 2ME0A 1ORKA 1W0UA 3BR3A 2JA7J 3A02A 5J1RA 4M6VA 3FKIJ 1ZK8A 1ETYA 2B63J 3BTIA 1IUFA 3O8HA 3HOXJ 2CQQA 4XRSA 3JRAA 1I50J 3OSFA 5DS9A 1FTZA 2MW8A 2H8RA 5EG0A 2E2JJ 3RZDJ 4J19A 1U9NA 1FIPA 4Y52J 2VPRA 4UUSA 5IYDJ 4LOCA 1W0TA 3IH3A 4Y7NJ 3RZOJ 1BJZA 3HB9A 1BW5A 4A3DJ 3GTPJ 4L5EA 1SANA 1RETA 5F08A 4XRMA 1NK3P 1WGXA 4XK4A 4M3DA 2NVTJ 3HOUJ 2IAIA 1HCRA 3DCFA 2K9SA 3MKLA 1WH7A 5IP9J 3PM1A 2R5ZA 1ZTRA 3M4OJ 1H88C 2LY9A 3LOCA 1Z77A 1GV2A 2ECCA 1UHSA 5FJ8J 1XG1A 3QPLA 5IOZA 3W6VA 3H0GJ 1E3OC 2VKVA 3FISA 1IDZA 4V2GA 4A3GJ 3JREA 1U78A 1WCMJ 2FJ1A 1JKPC 3JRFA 2WAQN 3I4MJ 3BR6A 4DZJA 5IP6A 4X1EA 2XPVA 4I6ZA 5FKNA 1GVDA 2NS8A 2ECBA 1OFCX 1CQTA 1OCPA 4BBSJ 2PMZN 3PO2J 2CQXA 5EGOA 4A3IJ 2HOTA 2R92J 5GPCA 2TCTA 2HXOA 1K83J 5E3OA 1A5JA 5C4XJ 2E2HJ 2N8GA 2JA6J 4A3LJ 2R93J 2VI6A 2NVYJ 2XSDC 3HGGA 2L7ZA 1MBJA 4FISA 1K61A 1ENHA 2EQRA 2XB5A 5GPAA 3TW7A 2R5YB 4UUSB 2DA6A 2HXIA 3HGYA 1TWCJ 3GTQJ 4GFBA 1LE8A 3QQAA 2CUEA 3HOZJ 3IV5A 1YRNB 2EZKA 3G1LA 4C3IJ 1ETXA 1RESA 2TRTA 2JN6A 2R5ZB 5IPAA 2KDZA 2G0EA 4A3KJ 2O7OA 1JKQC 1HF0A 4XIDA 1UG2A 5EZHA 2L9RA 2DJNA 5E3LA 1H8AC 1QRYA 4ABZA 4MO7A 2LD5A 4HNVA 2JA5J 3K7AJ 1IG7A 3NAUA 5M5XJ 3Q0VA 2K40A 4M3BA 3JRBA 4FTHA 3S14J 1Z0XA 5IOYA 2LFBA 5EYRA 3IH2A 4BY7J 3LSJA 3GTLJ 5FKMA 2Y9ZA 4DZPA 2HYJA 4I76A 4MFEA 3JRCA 2XRLA 3SDGA 1GT0C 1MSEC 2M2EA 1DU0A 1IGNA 3F0CA 2M34A 5EGOB 3GTKJ 2L7MP 3ZQHA 1SFOJ 4QTRA 2R5YA 5M5YJ 1BL0A 2E2IJ 3I4NJ 2NOGA 4S0HB 1Y1VJ 3K2AA 3BG3A 2LK2A 1X58A 2MSYA 1ZR2A 3SFIA 1YRNA 3WHBA 3D1NI 4D5FA 1TWFJ 1P7IA 3G1MA 1ETKA 2CRGA 2CU7A 3A01B 1R9TJ 3GTMJ 3S2HJ 4CYCB 2HDDA 3Q0UA 2IEKA 1JJ8C 3BTCA 1IV6A 1LE8B 1JKRC 4B1RA 2WB1N 2LVSA 2YU9J 1A6IA 1POGA 2AO9A 2DA3A 4C3JJ 1AKHB 5K7FA 1F36A 2ELKA 4IEJA 2JK3A 3S17J 2LP0A 2VKEA 3BG9A 1ZR4A 4W1UA 2HOSA 3RQIA 5JLXA 4JX5A 4DYRA 1TWHJ 3TP0A 1IJWC 5FKOA 5EZGA 3OOUA 2DMQA 2NVQJ 3HEFA 1HDPA 1NK2P 2DA2A 4QSHA 2GM4A 1OJLA 3MVPA 5IYCJ 2Y30A 3JRGA 2IBDA 1IDYA 3BR2A 5IP7J 1TWGJ 1JUMA 4AYBN 3C2BA 4BKXA 1MBFA 5EEAA 1Y1WJ 3HOVJ 3RKQA 2O9LA 5M3FJ 3CDLA 1BW6A 1JUSA 1ETWA 4FCYA 4W97A 3QPSA 2XGCA 1WI3A 4IHYA 2DN0A 3ZQFA 5F1JA 3B6AA 2EZHA 3HM5A 3BTJA 5JLWA 4A3FJ 1QPIA 1RR7A 2JJ7A 2Y2ZA 4D7MA 3A01A 1AHDP 2DTZA 1T56A 4CYCA 2P81A 4A3JJ 3NARA 1ETVA 5F0CA 4X6AJ 3MN2A 1JGGA 1RKTA 1MH3A 3ZQLA 1AKHA 4FE4A 5GP9A 2CJJA 3BG5A 3BQZA 2YUSA 3LSGA 1B8IA 1JJ6C 4MIMA 4JYKA 1RPWA 5E3NA 2JA8J 1AU7A 5DTDA 3BR0A 4JX4A 4IHXA 1ITYA 3FIWA 3SJMA 3BR1A 1HLVA 5M5WJ 2K9NA 3S16J 1MBHA 1MSFC 1U8BA 1MBGA 1F43A 2XPWA 4NDLA 3Q0WA 5EF6A 2LTPA 3LSPA 2JMWA 1VF9A 2LKXA 2DA4A 2DA1A 4M3GA 1D5YA 1TWAJ 2W48A 2O8KA 2OPTA 4D5CA 2NS7A 4A3CJ 4DYQA 4JX6A 4V2FA 1GDTA 1ETOA 2M0CA 1JKOC 4RDUA 5F04A 2ID6A 3ZQIA 3TP3A 5C44J 1BA5A 5E3MA 1IC8A 4A3EJ 2R7ZJ 3B6CA 3S1MJ 4B4CA 3GTOJ 2WV1A 1ZKGA 3CCYA 3TEDA 3S1NJ 1U9OA 2MGQA 2X48A 5FKKA 1JUPA 2E1OA 3L1PA 1PUFA 5F0FA 3ZOBA 2FX0A 3JRDA 1H89C 4AC0A 4A3BJ 2RAEA 3S1QJ 5F27A 2JWTA 3VPRA 3BTLA 1GUUA 3PO3J 3FK7A 1MH4A 1B72B 3HDDA 4M3EA 1QVUA 4A93J 3Q3SA 3CMYA 1JTYA 4D7NA 3JR9A 1B8IB 3BR5A 1VI0A 4MLOA 5J3LA 2HQ5A 2XPUA 3S1RJ 1OCTC 2L7FP 1O4XA 3E7LA 5K7ZA 4IHWA 2ME6A 3DEWA 5J1UA 2L0KA 1MBKA 5M3MJ 3S15J 2ZB9A 2EZLA 2Y0SN 1I3QJ 5C4JJ 4IHVA 2HI3A 5FLMJ 1QVTA 1GV5A 2X6OA 3OIOA 1ETQA 5J1YA 2DMNA 4M3FA 5FKLA 2X9DA 3BQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CUF A;  3A03 A;  5K7H A;  4BBR J;  1FJL A;  1X2N A;  3TW6 A;  2GBY A;  1HOM A;  2FD5 A;  1FEX A;  2I10 A;  1TC3 C;  2GLO A;  2H1K A;  2QCO A;  1LFB A;  4DW6 A;  2EH3 A;  2DA7 A;  4JP0 A;  1JT6 A;  3ZQC A;  1FIA A;  1HDD C;  1ZGW A;  2D5V A;  4B3A A;  2FQ4 A;  4RBO A;  5HOD A;  4A3M J;  1P7J A;  1I6H J;  1IRZ A;  2XGD A;  1FTT A;  2QF7 A;  1RKW A;  4A69 C;  2MG4 A;  1XC5 A;  3IH4 A;  1Q1V A;  4FE7 A;  1B72 A;  4UUT A;  4DYC A;  2YS9 A;  4QIW N;  4C2M J;  3JRI A;  1DU6 A;  2COB A;  3LNQ A;  2DMP A;  5F0H A;  1PUF B;  5C3E J;  2EBI A;  1EF4 A;  1XS9 A;  4XIC A;  2DA5 A;  1S7E A;  4BY1 J;  2VUM J;  1G2H A;  2LLK A;  5EG0 B;  3OSG A;  3LSR A;  3S2D J;  3G1O A;  3HKZ N;  4AUX A;  1APL C;  2XGE A;  2M9H A;  3H3V K;  3GTJ J;  1VFC A;  1WPK A;  3M3Y J;  3HOY J;  2NVX J;  2E19 A;  2AHQ A;  1ZQ3 P;  3UKG A;  3CQZ J;  4MFD A;  2M8G X;  4G12 A;  2KT0 A;  5IYB J;  2R0Q C;  4BXX J;  2DMT A;  2ID3 A;  1VND A;  9ANT A;  4EEF G;  2Y9Y A;  2Y31 A;  3GBG A;  1T33 A;  1NTC A;  1UMQ A;  2LR8 A;  5FLV A;  2XB0 X;  3BT9 A;  3HOW J;  2OF7 A;  2HOA A;  1X2M A;  1JTX A;  1WH5 A;  3ZQG A;  3GTG J;  3WHC A;  1MNM C;  4XRS G;  4C3H J;  2K9Q A;  3HBL A;  1JT0 A;  1LFU P;  3JRH A;  3O8G A;  5EDN A;  3FK6 A;  1MBE A;  2DMU A;  2EZI A;  5BNG A;  2ME0 A;  1ORK A;  1W0U A;  3BR3 A;  2JA7 J;  3A02 A;  5J1R A;  4M6V A;  3FKI J;  1ZK8 A;  1ETY A;  2B63 J;  3BTI A;  1IUF A;  3O8H A;  3HOX J;  2CQQ A;  4XRS A;  3JRA A;  1I50 J;  3OSF A;  5DS9 A;  1FTZ A;  2MW8 A;  2H8R A;  5EG0 A;  2E2J J;  3RZD J;  4J19 A;  1U9N A;  1FIP A;  4Y52 J;  2VPR A;  4UUS A;  5IYD J;  4LOC A;  1W0T A;  3IH3 A;  4Y7N J;  3RZO J;  1BJZ A;  3HB9 A;  1BW5 A;  4A3D J;  3GTP J;  4L5E A;  1SAN A;  1RET A;  5F08 A;  4XRM A;  1NK3 P;  1WGX A;  4XK4 A;  4M3D A;  2NVT J;  3HOU J;  2IAI A;  1HCR A;  3DCF A;  2K9S A;  3MKL A;  1WH7 A;  5IP9 J;  3PM1 A;  2R5Z A;  1ZTR A;  3M4O J;  1H88 C;  2LY9 A;  3LOC A;  1Z77 A;  1GV2 A;  2ECC A;  1UHS A;  5FJ8 J;  1XG1 A;  3QPL A;  5IOZ A;  3W6V A;  3H0G J;  1E3O C;  2VKV A;  3FIS A;  1IDZ A;  4V2G A;  4A3G J;  3JRE A;  1U78 A;  1WCM J;  2FJ1 A;  1JKP C;  3JRF A;  2WAQ N;  3I4M J;  3BR6 A;  4DZJ A;  5IP6 A;  4X1E A;  2XPV A;  4I6Z A;  5FKN A;  1GVD A;  2NS8 A;  2ECB A;  1OFC X;  1CQT A;  1OCP A;  4BBS J;  2PMZ N;  3PO2 J;  2CQX A;  5EGO A;  4A3I J;  2HOT A;  2R92 J;  5GPC A;  2TCT A;  2HXO A;  1K83 J;  5E3O A;  1A5J A;  5C4X J;  2E2H J;  2N8G A;  2JA6 J;  4A3L J;  2R93 J;  2VI6 A;  2NVY J;  2XSD C;  3HGG A;  2L7Z A;  1MBJ A;  4FIS A;  1K61 A;  1ENH A;  2EQR A;  2XB5 A;  5GPA A;  3TW7 A;  2R5Y B;  4UUS B;  2DA6 A;  2HXI A;  3HGY A;  1TWC J;  3GTQ J;  4GFB A;  1LE8 A;  3QQA A;  2CUE A;  3HOZ J;  3IV5 A;  1YRN B;  2EZK A;  3G1L A;  4C3I J;  1ETX A;  1RES A;  2TRT A;  2JN6 A;  2R5Z B;  5IPA A;  2KDZ A;  2G0E A;  4A3K J;  2O7O A;  1JKQ C;  1HF0 A;  4XID A;  1UG2 A;  5EZH A;  2L9R A;  2DJN A;  5E3L A;  1H8A C;  1QRY A;  4ABZ A;  4MO7 A;  2LD5 A;  4HNV A;  2JA5 J;  3K7A J;  1IG7 A;  3NAU A;  5M5X J;  3Q0V A;  2K40 A;  4M3B A;  3JRB A;  4FTH A;  3S14 J;  1Z0X A;  5IOY A;  2LFB A;  5EYR A;  3IH2 A;  4BY7 J;  3LSJ A;  3GTL J;  5FKM A;  2Y9Z A;  4DZP A;  2HYJ A;  4I76 A;  4MFE A;  3JRC A;  2XRL A;  3SDG A;  1GT0 C;  1MSE C;  2M2E A;  1DU0 A;  1IGN A;  3F0C A;  2M34 A;  5EGO B;  3GTK J;  2L7M P;  3ZQH A;  1SFO J;  4QTR A;  2R5Y A;  5M5Y J;  1BL0 A;  2E2I J;  3I4N J;  2NOG A;  4S0H B;  1Y1V J;  3K2A A;  3BG3 A;  2LK2 A;  1X58 A;  2MSY A;  1ZR2 A;  3SFI A;  1YRN A;  3WHB A;  3D1N I;  4D5F A;  1TWF J;  1P7I A;  3G1M A;  1ETK A;  2CRG A;  2CU7 A;  3A01 B;  1R9T J;  3GTM J;  3S2H J;  4CYC B;  2HDD A;  3Q0U A;  2IEK A;  1JJ8 C;  3BTC A;  1IV6 A;  1LE8 B;  1JKR C;  4B1R A;  2WB1 N;  2LVS A;  2YU9 J;  1A6I A;  1POG A;  2AO9 A;  2DA3 A;  4C3J J;  1AKH B;  5K7F A;  1F36 A;  2ELK A;  4IEJ A;  2JK3 A;  3S17 J;  2LP0 A;  2VKE A;  3BG9 A;  1ZR4 A;  4W1U A;  2HOS A;  3RQI A;  5JLX A;  4JX5 A;  4DYR A;  1TWH J;  3TP0 A;  1IJW C;  5FKO A;  5EZG A;  3OOU A;  2DMQ A;  2NVQ J;  3HEF A;  1HDP A;  1NK2 P;  2DA2 A;  4QSH A;  2GM4 A;  1OJL A;  3MVP A;  5IYC J;  2Y30 A;  3JRG A;  2IBD A;  1IDY A;  3BR2 A;  5IP7 J;  1TWG J;  1JUM A;  4AYB N;  3C2B A;  4BKX A;  1MBF A;  5EEA A;  1Y1W J;  3HOV J;  3RKQ A;  2O9L A;  5M3F J;  3CDL A;  1BW6 A;  1JUS A;  1ETW A;  4FCY A;  4W97 A;  3QPS A;  2XGC A;  1WI3 A;  4IHY A;  2DN0 A;  3ZQF A;  5F1J A;  3B6A A;  2EZH A;  3HM5 A;  3BTJ A;  5JLW A;  4A3F J;  1QPI A;  1RR7 A;  2JJ7 A;  2Y2Z A;  4D7M A;  3A01 A;  1AHD P;  2DTZ A;  1T56 A;  4CYC A;  2P81 A;  4A3J J;  3NAR A;  1ETV A;  5F0C A;  4X6A J;  3MN2 A;  1JGG A;  1RKT A;  1MH3 A;  3ZQL A;  1AKH A;  4FE4 A;  5GP9 A;  2CJJ A;  3BG5 A;  3BQZ A;  2YUS A;  3LSG A;  1B8I A;  1JJ6 C;  4MIM A;  4JYK A;  1RPW A;  5E3N A;  2JA8 J;  1AU7 A;  5DTD A;  3BR0 A;  4JX4 A;  4IHX A;  1ITY A;  3FIW A;  3SJM A;  3BR1 A;  1HLV A;  5M5W J;  2K9N A;  3S16 J;  1MBH A;  1MSF C;  1U8B A;  1MBG A;  1F43 A;  2XPW A;  4NDL A;  3Q0W A;  5EF6 A;  2LTP A;  3LSP A;  2JMW A;  1VF9 A;  2LKX A;  2DA4 A;  2DA1 A;  4M3G A;  1D5Y A;  1TWA J;  2W48 A;  2O8K A;  2OPT A;  4D5C A;  2NS7 A;  4A3C J;  4DYQ A;  4JX6 A;  4V2F A;  1GDT A;  1ETO A;  2M0C A;  1JKO C;  4RDU A;  5F04 A;  2ID6 A;  3ZQI A;  3TP3 A;  5C44 J;  1BA5 A;  5E3M A;  1IC8 A;  4A3E J;  2R7Z J;  3B6C A;  3S1M J;  4B4C A;  3GTO J;  2WV1 A;  1ZKG A;  3CCY A;  3TED A;  3S1N J;  1U9O A;  2MGQ A;  2X48 A;  5FKK A;  1JUP A;  2E1O A;  3L1P A;  1PUF A;  5F0F A;  3ZOB A;  2FX0 A;  3JRD A;  1H89 C;  4AC0 A;  4A3B J;  2RAE A;  3S1Q J;  5F27 A;  2JWT A;  3VPR A;  3BTL A;  1GUU A;  3PO3 J;  3FK7 A;  1MH4 A;  1B72 B;  3HDD A;  4M3E A;  1QVU A;  4A93 J;  3Q3S A;  3CMY A;  1JTY A;  4D7N A;  3JR9 A;  1B8I B;  3BR5 A;  1VI0 A;  4MLO A;  5J3L A;  2HQ5 A;  2XPU A;  3S1R J;  1OCT C;  2L7F P;  1O4X A;  3E7L A;  5K7Z A;  4IHW A;  2ME6 A;  3DEW A;  5J1U A;  2L0K A;  1MBK A;  5M3M J;  3S15 J;  2ZB9 A;  2EZL A;  2Y0S N;  1I3Q J;  5C4J J;  4IHV A;  2HI3 A;  5FLM J;  1QVT A;  1GV5 A;  2X6O A;  3OIO A;  1ETQ A;  5J1Y A;  2DMN A;  4M3F A;  5FKL A;  2X9D A;  3BQY A; 
#chains in the Genus database with same CATH topology
 4BEH A;  1Y8R B;  4KYW A;  2JZY A;  3TW6 A;  5LRS A;  5FRN A;  1JI8 A;  1HOM A;  2I10 A;  4HV5 A;  2E5N A;  2RKH A;  1LFB A;  4DW6 A;  2K27 A;  1FYL A;  1SMY F;  5LRR A;  5HLH A;  5JR3 A;  4IJA A;  3ZQC A;  3LWF A;  2OC6 A;  1O57 A;  4P96 A;  5HOD A;  1I6H J;  1VQO I;  1FTT A;  4E7H A;  2QF7 A;  1UEL B;  1SEU A;  3WTV C;  1A04 A;  3LA3 A;  3U21 A;  2A3S A;  1QU3 A;  3VYS B;  4ON0 A;  4CSW A;  1SVL A;  4UUT A;  4DYC A;  2BW3 A;  1DGR M;  3JRI A;  2Z5U A;  3P5J A;  2DMP A;  4PSW A;  3OYJ A;  2X6X A;  2E71 A;  3S32 A;  1K6O A;  2Y48 A;  1EF4 A;  1XS9 A;  3FHZ A;  1KU2 A;  1P4X A;  1S7E A;  2DA5 A;  3IKV A;  2LLK A;  4WK8 F;  2FBH A;  2XGE A;  5GTH C;  3H3V K;  3GTJ J;  3I58 A;  3AKZ A;  4NC7 A;  5E1W A;  3OYG A;  4XLH A;  2OU2 A;  4G6D A;  1TQM A;  2L4A A;  3CUQ C;  3C1D A;  4MFD A;  4F55 A;  3OL3 A;  4QPO A;  1TT5 B;  2UV1 A;  2EA2 A;  4HX4 A;  4TV7 A;  2Y9Y A;  3H5A A;  3KP4 A;  4C9Y A;  2XHK A;  1PP7 U;  1T33 A;  1D0Z A;  4LK1 F;  4AU7 A;  3AG3 H;  1DP7 P;  5FLV A;  2BY1 A;  1AA7 A;  4XSZ F;  4IX7 A;  2OF7 A;  4M6Y A;  3ZQG A;  2DAO A;  2HKX A;  5HNH A;  2LRD A;  2MLG A;  1ZLJ A;  2K9Q A;  5H6R A;  3CF2 A;  5DD8 A;  3KP2 A;  4XL9 A;  3K1P A;  1MBE A;  5BNG A;  2K5C A;  4B43 A;  2ME0 A;  1SFE A;  2EV6 A;  2F5D A;  1MGT A;  4CCN A;  2L54 A;  1W0U A;  1P2F A;  3C18 A;  3K4B A;  3LMM A;  2WC2 A;  3A02 A;  4M6V A;  3BG6 A;  1ETY A;  2B63 J;  2OTJ I;  1EKE A;  3E3V A;  1R1U A;  4R79 A;  4I0A A;  2MW8 A;  2QWW A;  3T8T A;  2R7X A;  1LNW A;  3QYF A;  5ILV A;  3RZD J;  1HA8 A;  2AXT C;  1Z21 A;  2VPR A;  2L02 A;  2Q2E A;  1Z91 A;  4LOC A;  1LFP A;  4Y7N J;  1BW5 A;  4G7H F;  1XN7 A;  4LIT A;  1KU7 A;  1RET A;  4XOT A;  3M9A A;  3TL4 X;  4XRM A;  1F5T A;  2O8X A;  5TJJ A;  5B66 C;  2QKM B;  2IAI A;  1XPX A;  3QRF F;  1HCR A;  2VBW A;  4A0Y A;  3M4O J;  4QWQ A;  3CMM A;  1USS A;  1H88 C;  1FX7 A;  2LY9 A;  3K4L A;  4Q47 A;  2XVC A;  2FNA A;  2WA0 A;  3SZP A;  3WOD F;  3QPL A;  5IOZ A;  2QM3 A;  2LSO A;  4XON A;  3HKZ A;  4N0B A;  2K85 A;  1W5C C;  4HW0 A;  4V2G A;  4I0B A;  2V6C A;  2R7T A;  3ABT A;  2AS5 F;  4HST A;  1WJD A;  5CKT A;  3VOE A;  1BC8 C;  5JFR A;  5CLS A;  2H1L A;  2F5C A;  2WAQ N;  3I4M J;  1QHG A;  1EH6 A;  1TNT A;  2RGV A;  4WXD A;  4DZJ A;  4PJL A;  2IGK A;  4DOZ A;  4KMF A;  2VQC A;  2P7C B;  2GXB A;  2NAZ A;  1X1C A;  3OYI A;  2ECB A;  2ZSI B;  3FXO A;  4L18 B;  3K10 A;  4BBS J;  1VZ0 A;  2PMZ N;  2HZD A;  3PO2 J;  1OYI A;  2XAF A;  2TCT A;  2HXO A;  3U2R A;  2V1D A;  4PZJ A;  5DYM A;  1FC3 A;  2P7V B;  2E2H J;  2JA6 J;  1MMN A;  3ZQQ A;  1A36 A;  3BG7 A;  5HLT A;  2L9N A;  3HGG A;  3ABU A;  3M8J A;  3TOB A;  4FIS A;  5DEQ A;  3QP6 A;  4A0X A;  1KU9 A;  4FQG A;  1MMD A;  3GFJ A;  2JVG A;  2LBF A;  4AID A;  1DPU A;  3RKX A;  1VQK I;  4BXF A;  2HXI A;  2V79 A;  5LGN A;  1R71 A;  3E5X A;  2KJC A;  5D6F A;  4XQF A;  4BUP A;  2LDU A;  4D9J A;  1LE8 A;  1FBS A;  3HOZ J;  2O03 A;  1U6G A;  3L2Q A;  1XTA A;  1YRN B;  3R0J A;  2EZK A;  1WJF A;  4C3I J;  2IA2 A;  5FO5 A;  1K78 A;  1R7J A;  5E17 F;  1RES A;  4E7K A;  3L2R A;  5IT3 A;  2G0E A;  2O7O A;  3G4S I;  3ASO H;  1JKQ C;  1HF0 A;  1V5G A;  5EZH A;  1D0Y A;  4LK0 F;  4PJJ A;  2DJN A;  3FXQ A;  1HSJ A;  1QRY A;  4MO7 A;  3P9C A;  2ESH A;  4BE2 A;  4ZDL A;  3NAU A;  4F3Q A;  5GTI C;  4DBR A;  2K40 A;  2FQ3 A;  4M3B A;  3S14 J;  1Z0X A;  2X85 A;  2QVO A;  3WU1 B;  1QZZ A;  2JUC A;  1X3U A;  4RB1 A;  5E1Z B;  1OPC A;  3P9I A;  4RAZ A;  4LJZ F;  2XRL A;  3S3O A;  4Q5S F;  5FLX K;  3JSO A;  3HRT A;  1IGN A;  3F0C A;  4WX9 A;  1BM9 A;  3PL8 A;  3M07 A;  5KCM A;  2PLY A;  4YII A;  2CUJ A;  2QQA A;  4OIQ F;  4CDG A;  1QA6 A;  3ZMS A;  4QTR A;  4C2T A;  1BL0 A;  5FD6 A;  1KA8 A;  4MNU A;  1OCZ H;  2DPD A;  1Y1V J;  1LUJ B;  2LF8 A;  3IKT A;  1X58 A;  3RKW A;  1XMK A;  3AG2 H;  2W4S A;  3SFI A;  4L9T A;  5FGM A;  3H9G A;  1FY7 A;  4HQM A;  1YRN A;  5B1B H;  3D1N I;  3CLQ A;  1P7I A;  4KIC A;  2CRG A;  4M9X A;  3CJR B;  1O3S A;  1D0X A;  1RNL A;  3HTU A;  4N9H A;  3TDU C;  2OA4 A;  1LJ9 A;  1RC9 A;  3S2H J;  1TNS A;  3GXO A;  3HPG A;  3Q0U A;  5CVU A;  3PSI A;  5CYV A;  4RB3 C;  4B1R A;  3GZN B;  4EJO A;  3K6G A;  3OYC A;  4C3J J;  3OYE A;  1F36 A;  4Y4R A;  3H5R A;  2UXN A;  3AL0 C;  3S17 J;  3DBR B;  2LP0 A;  4XLP F;  2BZT A;  3BG9 A;  2DT5 A;  1UB9 A;  3J81 Z;  3O3K A;  2HOS A;  3ERM A;  3RPQ A;  3TO9 A;  3ZMD A;  5FFX A;  1D8J A;  4I99 C;  3RSN A;  2XSJ C;  3LSI A;  1R58 A;  2RVC A;  4EGY A;  5EZG A;  4DQ2 A;  5H2F C;  1HKQ A;  1X4P A;  2DMQ A;  3OOU A;  4RB2 C;  3HEF A;  1HDP A;  1HST A;  2ZSH B;  2NVQ J;  4QPQ A;  4I2O A;  1OJL A;  1SD5 A;  2JT1 A;  1JHF A;  3K2Z A;  4XLF A;  3LQQ A;  4EM1 A;  4AVZ A;  3OS2 A;  1XDU A;  4UNO A;  2ZXW H;  1X1B A;  1MBF A;  5EEA A;  4ZYG A;  1JUS A;  4XNF A;  4NB5 A;  4W97 A;  3QPS A;  1Q1H A;  2KLO A;  3R61 A;  4C30 A;  2DN0 A;  1IZ1 A;  1TQP A;  2L2O A;  3ZR8 X;  3ZQF A;  1JE8 A;  3LFK A;  3TO7 A;  1Z3Y A;  3HM5 A;  3CUQ A;  1ZGJ A;  4A3F J;  2GOX B;  5BPD A;  1VTN C;  1CF7 B;  2JJ7 A;  2QZ8 A;  5HS7 A;  1T8I A;  2OZ6 A;  2ADU A;  3HPH A;  3L09 A;  2P81 A;  2XF7 A;  2ZFW A;  3DPT A;  4CXF A;  1LQ1 A;  2B9S A;  2VOD A;  1I39 A;  3SZT A;  2V7F A;  2P0W A;  5K5R A;  1JGG A;  1HXD A;  1RKT A;  3WTS C;  3FM5 A;  4DGW B;  5GP9 A;  2CJJ A;  2KPM A;  3ABK H;  5LEK A;  4IQ4 A;  2JQ7 A;  1XCV A;  1B8I A;  1FNN A;  2MBF A;  2DYS H;  3ELK A;  1RPW A;  1YOV B;  1R4M B;  1NG6 A;  4U87 A;  1O7L A;  4XRF A;  3JAM K;  2HPM A;  3MZ8 A;  2HYF A;  4F7Z A;  2EFW A;  4LFU A;  3KE2 A;  2QSH X;  3BR1 A;  1HLV A;  1UZC A;  4M71 A;  3CUO A;  3ECH A;  5HDG A;  4CCL A;  1E3P A;  1J59 A;  2FU4 A;  2MC3 A;  1MBH A;  3KFW X;  1MSF C;  2R4G A;  1J2X A;  6PAX A;  3SXY A;  2GXG A;  3Q0W A;  4L9N A;  1M1E B;  4U0Y A;  2LTP A;  5LHG A;  2HTS A;  4IKF A;  1EJ9 A;  2DA4 A;  3ABM H;  2DK8 A;  4CCK A;  1TWA J;  4S04 A;  4LD5 A;  2F5V A;  4JK1 X;  3RKY A;  4D5C A;  3HJE A;  4KMU X;  4L0Y B;  4NQW B;  3M7G A;  5AON A;  3IL2 A;  1LB2 A;  2GQQ A;  3DPL C;  4V2F A;  2A68 F;  3HC7 A;  1IW7 F;  3OYA A;  3PNY A;  1HKT A;  5AIQ A;  5C44 J;  1IC8 A;  4LG0 A;  3QOD A;  3Q5F A;  4BHB A;  1T6S A;  3SQN A;  4B4C A;  3ROU A;  3GTO J;  3S2W A;  1U9O A;  1Y0U A;  1GVJ A;  3VOD A;  2WTE A;  2H6B A;  4UHT A;  5H20 A;  1PUF A;  2FSW A;  4P9U A;  3OYN A;  3B02 A;  2Z33 A;  3V8J A;  3JRD A;  2F4M B;  1BR1 A;  2OTL I;  4XN3 A;  2VN2 A;  2XAU A;  5F27 A;  3I3L A;  4UVA A;  2JWT A;  2YX7 A;  3QOE A;  3ZQ7 A;  2XKO A;  1TT0 A;  2O61 A;  2PG4 A;  2XC7 A;  4BDZ A;  1BOA A;  3I4P A;  3HDD A;  2PMH A;  3F3X A;  2BY3 A;  2IW5 A;  3KP5 A;  5HLG A;  1Z6R A;  1JTY A;  3PFI A;  4FX0 A;  1IN4 A;  4D7N A;  3JR9 A;  4GXO A;  4P5O A;  1VQM I;  1X3W B;  1IXS B;  3BR5 A;  4MLO A;  2HQ5 A;  1Y56 A;  2IGO A;  2CMP A;  1UG0 A;  4EGZ A;  4O6J A;  2OD5 A;  3WTX C;  2ME6 A;  3DEW A;  2HR3 A;  4AIH A;  1S8N A;  5TRD A;  1XGS A;  3OIP A;  5BS6 A;  1S9H A;  2PBI A;  5DD4 A;  2PI0 A;  3S15 J;  2P5L C;  5HS8 A;  4NQW A;  2EZL A;  1Z1D A;  2CW7 A;  1L3L A;  1IXR C;  5C4J J;  3LAJ A;  2HI3 A;  2OBP A;  5BPI A;  2NYX A;  1JHH A;  1QVT A;  2JUG A;  3OIO A;  4M3F A;  2G7H A;  3PIO F;  1P4W A;  5ILS A;  3DKY A;  2CYY A;  3DKW A;  4BBR J;  3TO6 A;  2YR2 A;  3KX2 A;  1EH8 A;  3BZC A;  1IN7 A;  1YW7 A;  3TKY A;  1TC3 C;  1MMS A;  4BAC A;  2QCO A;  2HQN A;  5LLQ A;  3I9V 2;  5HDN A;  3EYY A;  1K7A A;  2DA7 A;  3F8F A;  3QU6 A;  2HQR A;  2P5V A;  1FIA A;  2PEX A;  4B3A A;  2E60 A;  4D0P A;  1IRZ A;  1P7J A;  2QBY B;  1U0J A;  2W57 A;  2MG4 A;  2ZME C;  1ZRF A;  4E70 A;  1XC5 A;  2FMY A;  1Q1V A;  2QEN A;  2KIF A;  1Z3X A;  2COB A;  2P6T A;  3OV8 A;  2EBI A;  3IAM 2;  1G2H A;  2M45 A;  3OSG A;  3S2D J;  3LSR A;  3AL0 B;  1ON2 A;  1U8R A;  3CCU I;  4AUX A;  2MFZ A;  4A6D A;  1VQL I;  2DI3 A;  4OWR B;  2NVX J;  5E1X A;  1BI1 A;  3HXL A;  2AHQ A;  2EV5 A;  4BQN A;  3ZN1 A;  3CDI A;  1WFX A;  3DXJ F;  3CQZ J;  4Y15 A;  4G12 A;  3G3Z A;  1FOX A;  2KT0 A;  4IZZ A;  2ID3 A;  3WG7 H;  1RIO H;  2ICW G;  2PQ8 A;  4ZTJ A;  2Y31 A;  3GBG A;  2AQF A;  4E4H A;  1FZP B;  1MJ9 A;  1NTC A;  3KZY A;  3W6K B;  4EV0 A;  5D5U B;  4U7D A;  3WG9 A;  2XB0 X;  2GIV A;  1TTY A;  1MMA A;  1T0F C;  3HOW J;  2GIZ A;  4EJU A;  5D8L B;  1G3Y A;  1JTX A;  3B73 A;  3WHC A;  2EFP A;  4XRS G;  1S72 I;  4IPA A;  4HRI A;  2Y0S A;  4ENN A;  1JT0 A;  1LFU P;  4ZYA A;  3JCU C;  3FK6 A;  4I01 A;  2QBY A;  2DMU A;  2EZI A;  1MZB A;  2A6H F;  5LFA A;  1ORK A;  4BL0 B;  3BR3 A;  2MAB A;  1PDN C;  4C2U A;  3KYL A;  4LMY A;  4O5V A;  3BTI A;  3PFY A;  4JQF A;  3BJO A;  4HBL A;  3SEZ A;  1FTZ A;  2MYS A;  2E2J J;  5DDG A;  4J19 A;  3KYD B;  5F1R A;  1FIP A;  4ESJ A;  5IYD J;  4RGS A;  3RZO J;  3HOT A;  3GTP J;  2O6G E;  1SAN A;  4IVN A;  2MD0 A;  2KZG A;  4M3D A;  2VC1 A;  4RB0 A;  5FD5 A;  2NVT J;  2CFO A;  2DOF A;  5JHF A;  1RRJ A;  2K9S A;  4G6Q A;  5IP9 J;  3A1Y A;  3PM1 A;  4ZZL A;  2FF4 A;  3ZXS A;  2DFF A;  1Z77 A;  3S3N A;  2VAS A;  1UHS A;  1FOY A;  3GO5 A;  4I02 A;  1WZ2 A;  1TZL A;  4UB8 C;  4OIN F;  4EM0 B;  4PFO A;  4YFK F;  5KAF C;  2DT6 A;  1T08 B;  1E3O C;  3ZMV A;  2HS5 A;  2VKV A;  2E34 A;  3FIS A;  2DYR H;  3ONQ A;  4ZJZ A;  4HZF A;  3CCM I;  1YFH A;  4A3G J;  4A2U A;  2GZW A;  5E8I A;  2FE3 A;  5FLX Z;  1ZG5 A;  2JRT A;  4PK4 A;  3VDX A;  3IAS 2;  4IRI A;  2JPC A;  3V4G A;  1S7A A;  4M74 A;  4KIT B;  1BJA A;  3M1E A;  4ETS A;  3BR6 A;  1YO5 C;  5DCM A;  4S05 A;  2L5Q A;  4RLF A;  3U9G A;  3BDD A;  1FT9 A;  5LHI A;  1R00 A;  3TDZ C;  1OCP A;  5L3C A;  2BVM A;  2NS0 A;  4CO8 A;  4M9Z A;  2Q0O A;  5EGO A;  4A3I J;  3CD6 I;  2IA1 A;  2R92 J;  2LH9 A;  5GPC A;  3WTW C;  3EUH A;  1TL8 A;  1IUY A;  4KIS A;  5E3O A;  2LKP A;  1JGS A;  4OAY A;  4HYE A;  2RQQ A;  4A3L J;  2W24 A;  2R7Q A;  2IGM A;  2NVY J;  1ONV A;  3R0A A;  4R1H A;  1FLI A;  4HAM A;  1YJ9 I;  4UVB A;  3BOQ A;  2LRE A;  5ERI A;  4EJT A;  1YTY A;  4RS8 A;  5KNL A;  2YX4 A;  3IRR A;  1ZRE A;  2XB5 A;  5GPA A;  3TW7 A;  3E5Q A;  1YIT I;  3KCC A;  4L9V A;  2Q2E B;  3W6J B;  1WQ2 A;  3CMA I;  1R22 A;  2F2E A;  2CUE A;  2RNJ A;  4Y17 A;  3CF5 F;  3L2V A;  3OYM A;  3E6M A;  2V1N A;  1GXP A;  3G1L A;  1WRJ A;  4HG2 A;  1X19 A;  4XMY A;  3F8B A;  3K4M A;  4RA2 A;  1Z05 A;  3REO A;  4ZH4 F;  4MQ9 F;  1UG2 A;  4HA8 A;  4XSX F;  4OIP F;  1YX5 A;  5E3L A;  1HW5 A;  1X1D A;  1X1P A;  1YG2 A;  3DEU A;  2ACJ A;  4ABZ A;  4JBA A;  3Q9V A;  3ZP5 A;  5HS9 A;  5FFZ A;  5CQG A;  3NWT A;  4HNV A;  2Z16 A;  3M8E A;  3M1C A;  5B3S H;  2DOE A;  5KHD A;  3BLY A;  2BVL A;  2VL8 A;  4CGZ A;  2F4I A;  1YX3 A;  3Q0V A;  2PFB A;  1OIS A;  4BQQ A;  4FTH A;  2QQB A;  3K4C A;  2A5Y B;  1VQ7 I;  5IOY A;  2P8T A;  5DUK A;  5CJ9 A;  2Y9Z A;  4DZP A;  1T98 A;  4I76 A;  3JRC A;  2RNG A;  4CCJ A;  2Y0M A;  1GT0 C;  1UFM A;  1I1G A;  2WAQ A;  2EA4 A;  3FXR A;  3F8C A;  3OYH A;  1ERD A;  2VT2 A;  4IRH A;  1WJB A;  1O3T A;  2QQ9 A;  1SFO J;  1LVK A;  4KA4 A;  3LA7 A;  5M5Y J;  1IAW A;  5LHH A;  2E2I J;  2PMZ A;  1PUE E;  1FSE A;  2A5W A;  2DXI A;  4S0H B;  3K2A A;  3FF5 A;  3BG3 A;  1S7O A;  2HOE A;  2X6W A;  3JAM Z;  5IT9 Z;  2B0L A;  4XKW A;  2BHY A;  4XOR A;  1SMT A;  4D5F A;  1TWF J;  2COM A;  2DLL A;  5BOX A;  3HSE A;  4FHT A;  5F64 A;  2LBF B;  4HSR A;  4EVI A;  3K0L A;  1SFK A;  3A01 B;  4IXA A;  1BR4 A;  3I53 A;  3GYH X;  3RJP A;  1JJ8 C;  1ZEL A;  1LE8 B;  2FBI A;  1BBY A;  1E3H A;  1I27 A;  3CJQ B;  3DLA A;  2WB1 N;  2YU9 J;  3MD2 A;  2DA3 A;  1F9N A;  2BV6 A;  3LQR A;  3K70 C;  3V7S A;  1VQ8 I;  2ELK A;  1Y39 A;  3WTU C;  1K78 B;  1BC7 C;  4PJN A;  1VQP I;  3GZ5 A;  2O0Y A;  4JX5 A;  1KQ9 A;  4HX7 A;  5L3B A;  1R1V A;  1Y0N A;  2ZC2 A;  5FKO A;  3BCA A;  4OMZ A;  2BGC A;  2EIJ H;  2ZME A;  2DOA A;  4P9F A;  3MVP A;  1YW9 A;  4HF1 A;  4N4N B;  3SEQ A;  3T1B A;  2CV1 A;  1J0R A;  3RTR A;  3BZ6 A;  3FDY A;  4Q4Z F;  1I6X A;  1S5L C;  1TWG J;  3CC4 I;  1JUM A;  4ESF A;  3H5N A;  4AYB N;  3OS0 A;  3HSR A;  1IXC A;  5D5W B;  2HDW A;  2DFI A;  3J80 K;  3DBH B;  4GDF A;  2QSG X;  1ETW A;  3I5U A;  4FCY A;  4ENJ A;  5HLI A;  1WI3 A;  4IHY A;  2PMU A;  2AQE A;  2CS3 A;  1ODD A;  4B8X A;  2E35 A;  3FMS A;  3B6A A;  1LEB A;  1N75 A;  4PSX A;  4IRG A;  3QU3 A;  2UZK A;  4ZDP A;  5IY5 H;  4BQO A;  4I98 B;  3ZMU A;  5J8F A;  2VJI A;  3A01 A;  3S93 A;  1R5G A;  2ESN A;  2M1B A;  1PJR A;  4HPQ A;  1FOK A;  4A3J J;  3NAR A;  3PNV A;  1PP8 F;  3ZPL A;  1BN5 A;  2OJE D;  5F0C A;  4X6A J;  3A0H C;  4PFP A;  3IHU A;  1OYY A;  2K3F A;  2R7U A;  2E1N A;  4RGR A;  2C6Y A;  1T0F A;  3BQZ A;  1U5T C;  3OR1 C;  5A2Q K;  4BU2 A;  4U0V A;  5E3N A;  4UXN A;  1AU7 A;  4EAT A;  3QWL A;  2VJ5 A;  4LGW A;  4Y3O A;  2Z9O A;  2DQR A;  1MD0 A;  1ITY A;  4A0Z A;  2P4W A;  1ZG1 A;  5M5W J;  4GYI A;  3HHG A;  2K9N A;  2LYC A;  4M9S A;  3S16 J;  2V9V A;  3WE2 A;  2DCE A;  3ZGK A;  2K9M A;  1F43 A;  4NDL A;  2JTV A;  2QQ8 A;  3LSP A;  1T38 A;  3MEX A;  1Z67 A;  1V5F A;  3FXL A;  5GAE J;  2DA1 A;  1D5Y A;  1IF1 A;  4UB6 C;  2OPT A;  2DQL A;  2FA5 A;  5L3G A;  1VQ4 I;  4A3C J;  1IRG A;  1BR2 A;  4DYQ A;  3BPX A;  1YIO A;  3CDH A;  1Y6I A;  3OIQ A;  1JKO C;  4RDU A;  2UUZ A;  5F04 A;  1A31 A;  1QHH D;  1UST A;  3DU6 A;  4IL6 C;  1B9M A;  3CC7 I;  2R7Z J;  4BE0 A;  3F72 A;  1IN5 A;  2OZU A;  4FAS D;  4ZYE A;  2H6C A;  2FML A;  3S1N J;  3O6B B;  2MGQ A;  2DPU A;  2RRE A;  2FOK A;  4MTE A;  1YLF A;  1WVR A;  3COA C;  3E0J B;  1G6N A;  2BYV E;  3CUQ B;  2FEZ A;  3KEO A;  3JTG A;  2FX0 A;  2PN6 A;  2VB6 A;  1H89 C;  4AC0 A;  2RAE A;  4BHP A;  1TLH B;  3PQK A;  4RGX A;  2Q8K A;  1SFU A;  5E8G A;  2GWR A;  2R7R A;  3BJA A;  2A05 A;  2GA2 A;  2ZO4 A;  3K4J A;  3MFK A;  1YI2 I;  4MHG A;  2FXA A;  2EK5 A;  4AWX B;  4DNC A;  1MH4 A;  1B72 B;  5EJC A;  4M3E A;  4EJV A;  1QVU A;  3GFI A;  4H0E A;  3GEZ A;  2VQG A;  3CMY A;  4CZZ A;  4EQQ A;  2CH0 A;  1B8I B;  3FXK A;  1OCT C;  3NWS A;  3F6O A;  2L7F P;  1O4X A;  1KZH A;  1QZY A;  2V6E A;  5K7Z A;  2IS2 A;  3L2W A;  2EIK H;  5KAI C;  2Q1Z B;  2DTR A;  4BDY A;  1TQI A;  5J40 A;  5M3M J;  2ZB9 A;  2D1V A;  2KKO A;  1WWX A;  4IHV A;  2WAD A;  3CLO A;  5FLM J;  1I1S A;  2LNB A;  2X6O A;  3KEY A;  1ETQ A;  1WJA A;  2DMN A;  5FKL A;  4G94 A;  4PCQ A;  2X9D A;  2QKL B;  3BQY A;  1Z9C A;  1UHW A;  5K7H A;  3IUO A;  1P9Q C;  1X2N A;  4I7H A;  2GBY A;  3FX3 A;  1VQ5 I;  3D5R C;  1FEX A;  1BIA A;  2GLO A;  2H1K A;  4NHJ A;  4GRI A;  1CGP A;  1QQI A;  2MH2 A;  3IRQ A;  4L9J A;  4JP0 A;  3N97 A;  3CP2 A;  2XDV A;  1HDD C;  1ZGW A;  4RBO A;  2FQ4 A;  3H35 A;  4A3M J;  1A35 A;  2IJL A;  4LG0 B;  2XGD A;  2LC2 A;  5B5E C;  2GOM A;  3FHN A;  4A69 C;  2EJR A;  3DEE A;  2L9V A;  2OV7 A;  3NRV A;  4FE7 A;  1I3A A;  1B72 A;  4BE1 A;  2YS9 A;  2IPQ X;  3E6D A;  4C2M J;  4CYD A;  4QIW N;  2Y69 H;  3LNQ A;  3HRS A;  5F0H A;  2I5U A;  1PUF B;  3EUH C;  1R23 A;  3LSK A;  3EDP A;  4XIC A;  2DDB A;  1KYZ A;  3OYB A;  3GME A;  4L5J A;  5EG0 B;  3OYF A;  2M9H A;  4XLE A;  3KPH A;  1VFC A;  2XRO A;  3RQ4 A;  1H9T A;  3M3Y J;  3EUK L;  1SAU A;  3QPH A;  2JRM A;  3QP5 A;  2E5Z A;  4RM2 A;  4NC6 A;  1SD6 A;  3HTS B;  2KRF A;  2M8G X;  2XF6 A;  2R0Q C;  3GZ6 A;  4BXX J;  2EB7 A;  9ANT A;  3FMQ A;  4KT5 C;  1OR7 A;  2L01 A;  4KT6 A;  4R8H A;  1FBQ A;  3RYP A;  2LR8 A;  5BQT A;  3FM3 A;  3DLL F;  1K6Y A;  5EEH A;  3MKZ A;  1MND A;  3E5U A;  1B4A A;  1P92 A;  1WH5 A;  2D1H A;  3ISP A;  4C3H J;  2QSF X;  4RMN A;  4CHU A;  2XRN A;  3O8G A;  2KDO A;  5GAH J;  4MTD A;  1XSD A;  1QO0 D;  5D5X B;  1G3S A;  2VON A;  3E97 A;  3P7N A;  2FUG 2;  4XKV A;  4B09 A;  3FKI J;  3O8H A;  4UY8 I;  4HLY A;  2CQQ A;  3VWB A;  2LG4 A;  2PJP A;  3BRO A;  5DS9 A;  3WGI A;  5EG0 A;  1U9N A;  3WTY C;  1U5T B;  4Y52 J;  1XX5 A;  4UUS A;  3DQV C;  1W0T A;  2BXZ A;  1XDS A;  1J5Y A;  3IH3 A;  1W36 C;  2E7X A;  1BJZ A;  1P4A A;  4BJ5 C;  1P6R A;  3BP8 A;  4A3D J;  3CCR I;  1Y8Q B;  2K86 A;  2EFN A;  1K4T A;  2A61 A;  3F8N A;  1WGX A;  5FB2 A;  3H1C A;  3JTH A;  3HOU J;  2Z1D A;  3DCF A;  2R5Z A;  4EM2 A;  1ZTR A;  2PJR B;  2VQH A;  2ZJR F;  1SVO A;  2OAZ A;  2MLK A;  1GV2 A;  2ZKZ A;  1N25 A;  1X1A A;  1XMX A;  1V54 H;  3ABL H;  1GXQ A;  4A5M A;  5DV5 A;  3HRU A;  3CP8 A;  2QLZ A;  3ZRG A;  1IRF A;  1EV7 A;  1W1W E;  1WCM J;  2FJ1 A;  3LL7 A;  2VJ4 A;  1RI7 A;  1U2W A;  3KLO A;  2XAQ A;  5IP6 A;  2R7O A;  2XPV A;  2HEO A;  5FKN A;  1GVD A;  1ZAO A;  2NS8 A;  2M8E A;  2K4B A;  4MEX F;  2VIX A;  3CCE I;  3F8M A;  2E7W A;  5D5V B;  2BY2 A;  5BMZ A;  1RUN A;  4ZZD A;  3R6S A;  2L3D A;  5K5Q A;  2R7F A;  1K83 J;  1U5T A;  2GXA A;  5C4X J;  3HL2 A;  2KZV A;  2R93 J;  2KFD A;  3C2G A;  3DV8 A;  1BI2 A;  2L7Z A;  2JA2 A;  1MBJ A;  5J6X A;  3FBI B;  2JSC A;  1REP C;  1K79 A;  3S3M A;  1K61 A;  3AAF A;  3U1D A;  2EQR A;  3W2W A;  4II3 A;  5B1A H;  2UWM A;  4BH9 A;  2PJR A;  2J5O A;  3VYR B;  4A5N A;  2R5Y B;  1SVM A;  1R1T A;  2V1X A;  4I09 A;  2DA6 A;  2AXL A;  1G3W A;  3FXM A;  3K9T A;  3K4K A;  1TWC J;  1R49 A;  1O3Q A;  3GTQ J;  2IS6 A;  3FZV A;  3HHH A;  1GLN A;  3OY9 A;  4U0W A;  3TOA A;  3BCB A;  1KYW A;  2MA3 A;  2A6E F;  2TRT A;  3GFL A;  2JN6 A;  5ICF A;  5LBQ A;  3GVA A;  3HZJ A;  2KDZ A;  2CQN A;  1YYV A;  4A3K J;  1KGS A;  1BIB A;  1Z7L A;  4MGR A;  2ZNY A;  1WSU A;  4KFC A;  2L9R A;  4ZYH A;  1H8A C;  3BY6 A;  4CUG A;  3J80 Z;  3D5L A;  2W7N A;  2LD5 A;  4IF4 A;  3R4K A;  4DJA A;  1VQ9 I;  4CZC A;  2JA5 J;  1XSV A;  2YU3 A;  4Q48 A;  3K7A J;  1G3T A;  3CCQ I;  3JRB A;  3DP7 A;  1DGW Y;  3WGH A;  2BXY A;  2LFB A;  3E6B A;  5EYR A;  3AG1 H;  1FOW A;  3IH2 A;  4BY7 J;  4XR6 A;  5DCM B;  1MMG A;  1H9G A;  4MFE A;  2X0L A;  5FRM A;  3ERE D;  3FKJ A;  2ZBK A;  3SDG A;  2M7B A;  1KON A;  2M2E A;  2W82 A;  1X3Z B;  4OIO F;  5EGO B;  2KL4 A;  3E6C C;  2R5Y A;  2FBK A;  2DK5 A;  4EJW A;  4FX4 A;  2EFQ A;  5DUI A;  1FSH A;  1S3J A;  2MD5 A;  5A2Q Z;  3ML6 A;  3I4N J;  4GO1 A;  2DU9 A;  2FRH A;  1ZAR A;  1X4O A;  3GLL A;  4PGH A;  1SD7 A;  2HGC A;  2LK2 A;  2MSY A;  1ZR2 A;  5K1Y A;  1DDN A;  2VJJ A;  1B9N A;  4GYG A;  4KNY A;  1J9I A;  3G1M A;  1ETK A;  3DTE A;  3LFU A;  4BHC A;  2F4O B;  4CCM A;  4WXH A;  2EV0 A;  3V7C A;  1OQY A;  1R9T J;  3GTM J;  2HDD A;  4U88 A;  3HSF A;  2R7D A;  5D8K B;  3KIO A;  1MDM B;  3DFG A;  1JKR C;  3SFZ A;  3HYI A;  2LVS A;  1POG A;  2AO9 A;  2XKP A;  1AKH B;  4F92 B;  4Y13 A;  3ZMT A;  1RR8 C;  2RV8 A;  4IEJ A;  2JK3 A;  5ICC A;  2WY8 Q;  1FBU A;  1QGP A;  3A2K A;  2VKE A;  4W1U A;  1YJW I;  3RQI A;  4KN7 X;  5DM6 F;  5JLX A;  4DYR A;  1ZRC A;  2CWE A;  2DDA A;  1MNE A;  2Z2S B;  2EIL H;  3ESW B;  4II2 A;  1OCO H;  3N4M A;  5JHU A;  2ZXI A;  3OMY A;  3MKW B;  3I56 I;  3PUB A;  3H3Z A;  2HVQ A;  1WKM A;  5LGT A;  4N4O B;  2KIS A;  1UJ8 A;  2M3A A;  3JRG A;  3CZ6 A;  4XLN F;  1IRX A;  4Y33 A;  2WAE A;  3FWE A;  1NHA A;  2IBD A;  1IDY A;  2K7L A;  3CTA A;  4YFN F;  5IP7 J;  4RAY A;  3DU5 A;  2RDP A;  4BKX A;  1WJC A;  2X1E A;  1Y1W J;  3HOV J;  4LB5 A;  1YHQ I;  1BW6 A;  2KRC A;  3I59 B;  2IS1 A;  2XGC A;  3C7J A;  3WU2 C;  2DOD A;  2QYO A;  3KP6 A;  4BNC A;  1B1B A;  2ZCW A;  4XKB A;  4DBQ A;  3H92 A;  5F1J A;  1DUX C;  1K4S A;  2P5K A;  4HX8 A;  4RLQ A;  2EZH A;  5JLW A;  3BTJ A;  1E2X A;  1RR7 A;  2LMD A;  4KJZ A;  4AVP A;  4E7Z A;  3WTT C;  2V4J C;  2BHZ A;  3OOP A;  3KP7 A;  4Z6Y A;  1MDM A;  1SFX A;  1G8X A;  2ISZ A;  3TGN A;  2W1O A;  1T39 A;  5CVJ A;  4BS9 A;  1L0O C;  4X0G A;  1E17 A;  3N05 A;  3FBN B;  3QYB A;  3ZQL A;  1AKH A;  1UCR A;  4FE4 A;  4E7S A;  5H6Q A;  3H36 A;  3LSG A;  3G73 A;  3BZK A;  1BI3 A;  4MIM A;  5J8C A;  3LA2 A;  4JYK A;  4OAZ A;  2JA8 J;  1D1C A;  1IN6 A;  3KET A;  5JI6 A;  3DBL B;  5D4R A;  4DIQ A;  4KIB A;  3EUA A;  3SJM A;  4BJT A;  3GLX A;  2XAH A;  3EYI A;  4F52 A;  5HOO A;  2CV0 A;  1GHC A;  3KP3 A;  4RGU A;  1U8B A;  1R5I D;  2A07 F;  2WB1 A;  5EF6 A;  2E36 A;  1J7K A;  1LDK B;  2IGN A;  1VF9 A;  3VSK A;  4IOA F;  4G7O F;  4HOB A;  2IT0 A;  3I71 A;  3I55 I;  2O8K A;  3I59 A;  2ISY A;  4MQV A;  3C3W A;  2ZME B;  4XOP A;  4PJ0 C;  3DTI A;  1OR7 C;  2JPB A;  2A6T A;  3IP4 B;  2ID6 A;  4FT8 A;  3ZQI A;  2OUM A;  2LOO A;  2W84 A;  3TP3 A;  4E6K G;  3V8K A;  3I0T A;  2XAJ A;  2D2W A;  2MH9 A;  1XGN A;  1V5E A;  2F6C A;  3S1M J;  3CCY A;  3TED A;  1NH3 A;  2EPF A;  2IXS A;  5E79 C;  4AIJ A;  2STT A;  4AYB A;  2KHM A;  2E1C A;  2E1O A;  3UNG C;  1LPQ A;  3CES A;  1ZHF A;  4F91 B;  5F0F A;  1R4N B;  2KJB A;  4LB6 B;  3KZI C;  1RZ4 A;  5D4S A;  2R7W A;  1KQ0 A;  1OMI A;  2JVH A;  3S1Q J;  4A3B J;  2HDC A;  4JOM A;  2CFX A;  3CO6 C;  4HNT A;  1HW2 A;  3VPR A;  1W7P B;  4LLG F;  2LY1 A;  2K9L A;  3FK7 A;  5JVT A;  4ZYD A;  3J7A O;  4FET A;  4ENM A;  3LSH A;  1AOY A;  2W85 A;  1ULY A;  4A93 J;  3ULQ B;  3TBI A;  2OQR A;  3CCJ I;  5J3L A;  2ZJQ F;  2KMU A;  1FP2 A;  4LIU A;  1YW8 A;  5TGT A;  2CQ7 A;  2YSR A;  3FXU A;  1YE9 A;  2L0K A;  2G7U A;  5J1U A;  2XAG A;  2XF5 A;  4RM3 A;  3RYR A;  4WCG A;  3CJN A;  2R7S A;  1MBK A;  1QZE A;  2VBX A;  2RQP A;  2ELJ A;  5J4Y A;  3JW4 A;  2CGP A;  3A0B C;  3L7W A;  1D8K A;  4WF2 A;  2X1D A;  1V3F A;  5J1Y A;  2L9S A;  1BI0 A;  2DFE A;  4AIK A;  3VYU B;  2HFH A;  2NOJ B;  4GCV A;  4CH7 A;  1D1B A;  2VE8 A;  3DTK A;  2QA4 I;  1JXS A;  2CUF A;  3A03 A;  3T8R A;  3K70 D;  4OU0 A;  1FJL A;  2HVS A;  1LEA A;  1QNT A;  2XUB A;  1S6L A;  1OKR A;  3ZMZ A;  1ZH5 A;  2X4H A;  3DPU A;  2FD5 A;  2CW8 A;  3IC7 A;  1XGO A;  1MJB A;  3MCZ A;  1Z7U A;  3GX4 X;  2HTJ A;  3S8P A;  2EH3 A;  2HKO A;  4M73 A;  2BEO A;  1JT6 A;  2KIU A;  2CO5 A;  1WHU A;  2D5V A;  4BXU A;  3RPU A;  1T2K A;  1S29 A;  3SYT A;  3EQL F;  1RKW A;  1V4R A;  3RI4 A;  4IHT A;  4ZDO A;  5ICE A;  1W7P A;  3C2H A;  2NRA C;  3IH4 A;  3L2C A;  2EFO A;  2M5W A;  3K1M A;  2OCC H;  1DU6 A;  3ZCO A;  2A69 F;  2M30 A;  4HLX A;  3A4C A;  5C3E J;  4BY1 J;  2F5E A;  2VUM J;  3KYC B;  3L9F A;  5HDK A;  3HUG B;  3I64 A;  3G1O A;  3HKZ N;  3F21 A;  4XM3 A;  1APL C;  2O5R A;  4A12 A;  2E1M C;  1W5T A;  1IO2 A;  1WPK A;  4J00 A;  2KIQ A;  4V19 K;  3HOY J;  1DP3 A;  2E19 A;  2WY7 Q;  4P55 A;  1STZ A;  3F9K A;  4AD9 A;  4HNU A;  1O3R A;  1ZQ3 P;  3UKG A;  2CUZ A;  2VLA A;  3MZH A;  5IYB J;  1RUO A;  2DMT A;  3NQO A;  4IQJ A;  1VND A;  5L3D A;  4EEF G;  2X1C A;  4Z2Y A;  2WV0 A;  1FPQ A;  1OCR H;  4XKC A;  4EMS A;  5TIS C;  2W25 A;  3K1N A;  3JSP A;  5GAG J;  2NNY A;  2CV2 A;  1UMQ A;  4L5I A;  3KZZ A;  2ZJP F;  1WJ5 A;  5J47 A;  2H27 A;  2VBY A;  1V55 H;  5AIP A;  3BT9 A;  2Y75 A;  2DJI A;  2HOA A;  1X2M A;  1SC7 A;  2BE5 F;  2H94 A;  2W00 A;  1MNM C;  3GTG J;  1O7F A;  4IO9 F;  3HBL A;  4ANJ A;  3G2B A;  3F6V A;  1B59 A;  3JRH A;  5EDN A;  1TW2 A;  2UXX A;  2ZXH A;  2V26 A;  1D1A A;  4YIR X;  4HQE A;  3G6E I;  2HPI A;  1IN8 A;  4G8X A;  2JA7 J;  4HF2 A;  4KIG A;  3U1K A;  5J1R A;  1ZK8 A;  3HOX J;  1IUF A;  1ZG3 A;  4XRS A;  3JRA A;  1I50 J;  1KU3 A;  3OSF A;  3D0S A;  3W2A A;  2H8R A;  1EA3 A;  4KIF A;  1W4M A;  3H3U A;  3VFZ A;  3HUG A;  3AG4 H;  2K4J A;  4HEA 2;  3HB9 A;  5F6F A;  3PJR A;  4NBQ A;  5L3F A;  2XGX A;  5DM7 F;  3EPZ A;  4L5E A;  5F08 A;  1XMA A;  1NK3 P;  1MIJ A;  1E0E A;  4XK4 A;  3BWG A;  5HNF A;  3MKL A;  1WH7 A;  3HG9 A;  2OCE A;  3PNT A;  3CO7 C;  3LOC A;  4RAG A;  2ECC A;  2J5P A;  2HVR A;  5FJ8 J;  2KQR A;  4OMY A;  4UV8 A;  1XG1 A;  2H8W A;  2KRH A;  2OQG A;  2WWY A;  3GCM A;  4UV9 A;  2VOO A;  2QUF A;  3W6V A;  3H0G J;  1TBX A;  4YG2 F;  4PDK A;  3V7R A;  3SDB A;  3PIP F;  1IDZ A;  1HC8 A;  3LSM A;  2JSP A;  5E20 A;  4G6T B;  2IS4 A;  4LIV A;  3GF2 A;  3JRE A;  3ASN H;  1U78 A;  1R5H A;  5DCF A;  2IA0 A;  4LG3 A;  3JRF A;  1JKP C;  3F23 A;  4AM3 A;  2LKS A;  4F93 B;  3IWF A;  4X1E A;  2L4M A;  2V9K A;  2CW0 F;  3J7Z I;  4I6Z A;  3QYE A;  2Z99 A;  4D1Q A;  3OYL A;  1OFC X;  1CQT A;  3OS1 A;  1J09 A;  3AFH A;  3PQJ A;  1DPR A;  4A6E A;  2CQX A;  2Z3Y A;  3TMO A;  2DO7 A;  2HOT A;  1PYV A;  2X6Y A;  4QLC U;  4UVC A;  2BBY A;  1A5J A;  2M0M A;  2N8G A;  3W2V A;  1TP4 A;  2VI6 A;  2XSD C;  2HYG D;  2XAS A;  1HKS A;  3KEQ A;  3VEP A;  1LDD A;  2I8D A;  1ENH A;  1Z6T A;  5ILU A;  2FOW A;  3LST A;  4OOI A;  3K4N A;  3CCV I;  2VT3 A;  4PGG A;  1A6Q A;  1HQC A;  4UUS B;  5L3E A;  3ZN0 A;  2XV4 S;  2VKD A;  3HGY A;  4GFB A;  4IOC F;  3QQA A;  2RN7 A;  5ICG A;  3WTZ A;  4B47 A;  3IV5 A;  1AWC A;  4UUV A;  2LF7 A;  2QGU A;  4ZTF A;  1ETX A;  4BJ6 C;  1XSX A;  1XGM A;  1FMV A;  2R5Z B;  4J01 A;  5IPA A;  2DT7 B;  4GGG A;  2GA1 A;  2VOP A;  4XID A;  2EIM H;  5IT9 K;  4XN0 A;  5CVI A;  1LDJ A;  3HRM A;  5KVR A;  2BY0 A;  2VE9 A;  5CPR B;  3FXJ A;  4LLL A;  5D6E A;  4E7J A;  2GAU A;  2KP6 A;  4N9I A;  4HDU A;  1IG7 A;  2WAF A;  2B7E A;  2L7K A;  5M5X J;  4BQA A;  1YS6 A;  3OWT A;  2NNN A;  2X51 A;  1W5S A;  3PSF A;  3SHF A;  4M72 A;  1YS7 A;  3LSJ A;  4ZC3 A;  2K02 A;  3GTL J;  2RC4 A;  5FKM A;  2HYJ A;  4NUB A;  3BC8 A;  4CA0 A;  3GWZ A;  3H9Q A;  3O2P E;  4YEJ A;  4NNJ A;  1MSE C;  2M4G A;  1DU0 A;  1ZLK A;  2XIG A;  3MMY B;  2IVM A;  4B3X A;  2M34 A;  2TDX A;  2R3S A;  3GTK J;  2L7M P;  3ZQH A;  1HBX G;  2VPL A;  3IWZ A;  3T0Y A;  1CF7 A;  4L0Z B;  5CQE A;  1FYK A;  4PUS A;  3J7Y J;  2NOG A;  2V9P A;  3LAP A;  4HF0 A;  4ITV A;  2ETH A;  2E1M B;  2VXZ A;  2H09 A;  5LEJ A;  5J4V A;  4BYY A;  2HWV A;  3WHB A;  1D3Y A;  4XLA A;  3VSL A;  2CU7 A;  1C0W A;  2G9W A;  1MJA A;  5ED4 A;  3TQN A;  1MKM A;  4CYC B;  2IEK A;  1LKX A;  3H9J A;  4KUM A;  4U7B A;  3BTC A;  1IV6 A;  2VQL A;  3I54 A;  2K3P A;  1A6I A;  3EET A;  2CG4 A;  3D5S C;  5K7F A;  1G4D A;  4YIF A;  2VKH A;  1ZYR F;  1NG7 A;  3BJ6 A;  1W36 D;  1T95 A;  1ZR4 A;  3G71 I;  1B6A A;  2DBB A;  4PJM A;  1TWH J;  3CCL I;  5HVQ C;  3TP0 A;  2HU9 A;  2ZNZ A;  3SZG A;  1IJW C;  1FYM A;  2F5F A;  5GAD J;  1NK2 P;  4HDV A;  2DA2 A;  4QSH A;  2LY2 A;  2GM4 A;  5IYC J;  2Y30 A;  1J75 A;  1OCC H;  3PUF A;  4BAY A;  3BR2 A;  1H0M A;  3DF8 A;  4CIC A;  1WI9 A;  3C2B A;  2CSO A;  2FNP A;  5E18 F;  1IV8 A;  4E7I A;  3RKQ A;  2O9L A;  4IHS A;  5M3F J;  3CDL A;  2O3F A;  2WBM A;  4O3M A;  3OR2 C;  5LD2 C;  4WXC A;  1ZN2 A;  3HIF A;  4M6X A;  3VYT B;  3J7A Y;  2P6S A;  3NEU A;  3DWL E;  3CJT B;  1OYW A;  3OL4 A;  1QPI A;  2M87 A;  2Y2Z A;  3GFM A;  3DKX A;  3Q9S A;  4D7M A;  3K69 A;  1AHD P;  2DTZ A;  3MKY B;  1T56 A;  4CYC A;  1N77 A;  1ACI A;  2IP2 A;  5KK1 A;  1R6R A;  3L2U A;  4YFX F;  5LGU A;  1DQU A;  2DFH A;  1WJE A;  2KIM A;  4XBF A;  1D5V A;  1ETV A;  3MN2 A;  3W3C A;  1MH3 A;  1XCB A;  3KLN A;  3MQ0 A;  3QAH A;  3GUD A;  1QPM A;  3E1S A;  3BG5 A;  2YUS A;  2F48 A;  4HV6 A;  4KN4 X;  4MEY F;  1UAA A;  4ENK A;  1JJ6 C;  1OLT A;  4G7Z F;  5K5O A;  5DTD A;  3WGG A;  3CC2 I;  1KQ8 A;  3BR0 A;  2CQK A;  5CVR A;  4JX4 A;  2BOL A;  2HZT A;  3P9K A;  4IHX A;  3FIW A;  2ZXJ A;  1SAX A;  4H4K C;  2M4K A;  1N78 A;  4P1W A;  2YPR A;  2ZJ2 A;  1FMW A;  1MBG A;  2XPW A;  3F22 A;  2PX9 A;  1PVE A;  1ZGA A;  1HW1 A;  2JMW A;  3WE3 A;  4B44 A;  4BGD A;  3UR3 C;  2LKX A;  4M3G A;  3M8F A;  4XLC A;  3RPU D;  2W48 A;  4ASN A;  3R60 A;  3CCS I;  2VXD A;  3BPV A;  2NS7 A;  1W7P D;  3V8L A;  4JX6 A;  3MAJ A;  5EEG A;  1R36 A;  3J81 K;  3FMR A;  1ETO A;  2M0C A;  1UHM A;  1GDT A;  3V42 A;  2MC4 A;  4B48 A;  4RAF A;  4YEL A;  1BA5 A;  5E3M A;  2R7V A;  1U3E M;  4A3E J;  2NVU B;  3GW2 A;  2VBZ A;  3OYK A;  1XD7 A;  1BOB A;  4BEH B;  2IRF G;  3B6C A;  2STW A;  4LLN A;  2WV1 A;  1ZKG A;  3H0D A;  2X48 A;  5FKK A;  1MW7 A;  4E7L A;  3OYD A;  1JUP A;  3L1P A;  3VB2 A;  1YJN I;  3RCO A;  3MWM A;  3ZOB A;  3L00 A;  1F1Z A;  2ELH A;  1FWZ A;  1LVA A;  1FP1 D;  1F4K A;  1YQA A;  2V1U A;  2ZFU A;  3BTL A;  3MZY A;  2EIN H;  1GUU A;  3PO3 J;  4NC8 A;  2BW3 B;  4YRV A;  1ON1 A;  3Q3S A;  1VQ6 I;  1EH7 A;  3WU0 A;  1G59 A;  5FRO A;  2NXN B;  1VI0 A;  1SD4 A;  2XPU A;  3S1R J;  3QPT A;  2M7A A;  5JVG F;  3E7L A;  4IHW A;  2VC0 A;  2EWN A;  1QBJ A;  2D45 A;  1XB4 A;  4K2E A;  4WWC A;  4KDP A;  3T5X A;  1I5Z A;  2Y0S N;  3QOP A;  1I3Q J;  2HQA A;  1VQN I;  3HOS A;  4CCO A;  2DW4 A;  2QEX I;  1GV5 A;  3ECO A;  5CVV A;  1ZRD A;  4ESB A;  3CME I;  1YIJ I;  1TW3 A;  4OIR F;  2HNH A;  3RDI A;  3X2Q H;  3RIR A;  4G9Y A; 
#chains in the Genus database with same CATH homology
 2CUF A;  3A03 A;  5K7H A;  4BBR J;  1FJL A;  1X2N A;  3TW6 A;  2GBY A;  1HOM A;  2FD5 A;  1FEX A;  2I10 A;  1TC3 C;  2GLO A;  2H1K A;  2QCO A;  1LFB A;  4DW6 A;  2EH3 A;  2DA7 A;  4JP0 A;  1JT6 A;  3ZQC A;  1FIA A;  1HDD C;  1ZGW A;  2D5V A;  4B3A A;  2FQ4 A;  4RBO A;  5HOD A;  4A3M J;  1P7J A;  1I6H J;  1IRZ A;  2XGD A;  1FTT A;  2QF7 A;  1RKW A;  4A69 C;  2MG4 A;  1XC5 A;  3IH4 A;  1Q1V A;  4FE7 A;  1B72 A;  4UUT A;  4DYC A;  2YS9 A;  4QIW N;  4C2M J;  3JRI A;  1DU6 A;  2COB A;  3LNQ A;  2DMP A;  5F0H A;  1PUF B;  5C3E J;  2EBI A;  1EF4 A;  1XS9 A;  4XIC A;  2DA5 A;  1S7E A;  4BY1 J;  2VUM J;  1G2H A;  2LLK A;  5EG0 B;  3OSG A;  3LSR A;  3S2D J;  3G1O A;  3HKZ N;  4AUX A;  1APL C;  2XGE A;  2M9H A;  3H3V K;  3GTJ J;  1VFC A;  1WPK A;  3M3Y J;  3HOY J;  2NVX J;  2E19 A;  2AHQ A;  1ZQ3 P;  3UKG A;  3CQZ J;  4MFD A;  2M8G X;  4G12 A;  2KT0 A;  5IYB J;  2R0Q C;  4BXX J;  2DMT A;  2ID3 A;  1VND A;  9ANT A;  4EEF G;  2Y9Y A;  2Y31 A;  3GBG A;  1T33 A;  1NTC A;  1UMQ A;  2LR8 A;  5FLV A;  2XB0 X;  3BT9 A;  3HOW J;  2OF7 A;  2HOA A;  1X2M A;  1JTX A;  1WH5 A;  3ZQG A;  3GTG J;  3WHC A;  1MNM C;  4XRS G;  4C3H J;  2K9Q A;  3HBL A;  1JT0 A;  1LFU P;  3JRH A;  3O8G A;  5EDN A;  3FK6 A;  1MBE A;  2DMU A;  2EZI A;  5BNG A;  2ME0 A;  1ORK A;  1W0U A;  3BR3 A;  2JA7 J;  3A02 A;  5J1R A;  4M6V A;  3FKI J;  1ZK8 A;  1ETY A;  2B63 J;  3BTI A;  1IUF A;  3O8H A;  3HOX J;  2CQQ A;  4XRS A;  3JRA A;  1I50 J;  3OSF A;  5DS9 A;  1FTZ A;  2MW8 A;  2H8R A;  5EG0 A;  2E2J J;  3RZD J;  4J19 A;  1U9N A;  1FIP A;  4Y52 J;  2VPR A;  4UUS A;  5IYD J;  4LOC A;  1W0T A;  3IH3 A;  4Y7N J;  3RZO J;  1BJZ A;  3HB9 A;  1BW5 A;  4A3D J;  3GTP J;  4L5E A;  1SAN A;  1RET A;  5F08 A;  4XRM A;  1NK3 P;  1WGX A;  4XK4 A;  4M3D A;  2NVT J;  3HOU J;  2IAI A;  1HCR A;  3DCF A;  2K9S A;  3MKL A;  1WH7 A;  5IP9 J;  3PM1 A;  2R5Z A;  1ZTR A;  3M4O J;  1H88 C;  2LY9 A;  3LOC A;  1Z77 A;  1GV2 A;  2ECC A;  1UHS A;  5FJ8 J;  1XG1 A;  3QPL A;  5IOZ A;  3W6V A;  3H0G J;  1E3O C;  2VKV A;  3FIS A;  1IDZ A;  4V2G A;  4A3G J;  3JRE A;  1U78 A;  1WCM J;  2FJ1 A;  1JKP C;  3JRF A;  2WAQ N;  3I4M J;  3BR6 A;  4DZJ A;  5IP6 A;  4X1E A;  2XPV A;  4I6Z A;  5FKN A;  1GVD A;  2NS8 A;  2ECB A;  1OFC X;  1CQT A;  1OCP A;  4BBS J;  2PMZ N;  3PO2 J;  2CQX A;  5EGO A;  4A3I J;  2HOT A;  2R92 J;  5GPC A;  2TCT A;  2HXO A;  1K83 J;  5E3O A;  1A5J A;  5C4X J;  2E2H J;  2N8G A;  2JA6 J;  4A3L J;  2R93 J;  2VI6 A;  2NVY J;  2XSD C;  3HGG A;  2L7Z A;  1MBJ A;  4FIS A;  1K61 A;  1ENH A;  2EQR A;  2XB5 A;  5GPA A;  3TW7 A;  2R5Y B;  4UUS B;  2DA6 A;  2HXI A;  3HGY A;  1TWC J;  3GTQ J;  4GFB A;  1LE8 A;  3QQA A;  2CUE A;  3HOZ J;  3IV5 A;  1YRN B;  2EZK A;  3G1L A;  4C3I J;  1ETX A;  1RES A;  2TRT A;  2JN6 A;  2R5Z B;  5IPA A;  2KDZ A;  2G0E A;  4A3K J;  2O7O A;  1JKQ C;  1HF0 A;  4XID A;  1UG2 A;  5EZH A;  2L9R A;  2DJN A;  5E3L A;  1H8A C;  1QRY A;  4ABZ A;  4MO7 A;  2LD5 A;  4HNV A;  2JA5 J;  3K7A J;  1IG7 A;  3NAU A;  5M5X J;  3Q0V A;  2K40 A;  4M3B A;  3JRB A;  4FTH A;  3S14 J;  1Z0X A;  5IOY A;  2LFB A;  5EYR A;  3IH2 A;  4BY7 J;  3LSJ A;  3GTL J;  5FKM A;  2Y9Z A;  4DZP A;  2HYJ A;  4I76 A;  4MFE A;  3JRC A;  2XRL A;  3SDG A;  1GT0 C;  1MSE C;  2M2E A;  1DU0 A;  1IGN A;  3F0C A;  2M34 A;  5EGO B;  3GTK J;  2L7M P;  3ZQH A;  1SFO J;  4QTR A;  2R5Y A;  5M5Y J;  1BL0 A;  2E2I J;  3I4N J;  2NOG A;  4S0H B;  1Y1V J;  3K2A A;  3BG3 A;  2LK2 A;  1X58 A;  2MSY A;  1ZR2 A;  3SFI A;  1YRN A;  3WHB A;  3D1N I;  4D5F A;  1TWF J;  1P7I A;  3G1M A;  1ETK A;  2CRG A;  2CU7 A;  3A01 B;  1R9T J;  3GTM J;  3S2H J;  4CYC B;  2HDD A;  3Q0U A;  2IEK A;  1JJ8 C;  3BTC A;  1IV6 A;  1LE8 B;  1JKR C;  4B1R A;  2WB1 N;  2LVS A;  2YU9 J;  1A6I A;  1POG A;  2AO9 A;  2DA3 A;  4C3J J;  1AKH B;  5K7F A;  1F36 A;  2ELK A;  4IEJ A;  2JK3 A;  3S17 J;  2LP0 A;  2VKE A;  3BG9 A;  1ZR4 A;  4W1U A;  2HOS A;  3RQI A;  5JLX A;  4JX5 A;  4DYR A;  1TWH J;  3TP0 A;  1IJW C;  5FKO A;  5EZG A;  3OOU A;  2DMQ A;  2NVQ J;  3HEF A;  1HDP A;  1NK2 P;  2DA2 A;  4QSH A;  2GM4 A;  1OJL A;  3MVP A;  5IYC J;  2Y30 A;  3JRG A;  2IBD A;  1IDY A;  3BR2 A;  5IP7 J;  1TWG J;  1JUM A;  4AYB N;  3C2B A;  4BKX A;  1MBF A;  5EEA A;  1Y1W J;  3HOV J;  3RKQ A;  2O9L A;  5M3F J;  3CDL A;  1BW6 A;  1JUS A;  1ETW A;  4FCY A;  4W97 A;  3QPS A;  2XGC A;  1WI3 A;  4IHY A;  2DN0 A;  3ZQF A;  5F1J A;  3B6A A;  2EZH A;  3HM5 A;  3BTJ A;  5JLW A;  4A3F J;  1QPI A;  1RR7 A;  2JJ7 A;  2Y2Z A;  4D7M A;  3A01 A;  1AHD P;  2DTZ A;  1T56 A;  4CYC A;  2P81 A;  4A3J J;  3NAR A;  1ETV A;  5F0C A;  4X6A J;  3MN2 A;  1JGG A;  1RKT A;  1MH3 A;  3ZQL A;  1AKH A;  4FE4 A;  5GP9 A;  2CJJ A;  3BG5 A;  3BQZ A;  2YUS A;  3LSG A;  1B8I A;  1JJ6 C;  4MIM A;  4JYK A;  1RPW A;  5E3N A;  2JA8 J;  1AU7 A;  5DTD A;  3BR0 A;  4JX4 A;  4IHX A;  1ITY A;  3FIW A;  3SJM A;  3BR1 A;  1HLV A;  5M5W J;  2K9N A;  3S16 J;  1MBH A;  1MSF C;  1U8B A;  1MBG A;  1F43 A;  2XPW A;  4NDL A;  3Q0W A;  5EF6 A;  2LTP A;  3LSP A;  2JMW A;  1VF9 A;  2LKX A;  2DA4 A;  2DA1 A;  4M3G A;  1D5Y A;  1TWA J;  2W48 A;  2O8K A;  2OPT A;  4D5C A;  2NS7 A;  4A3C J;  4DYQ A;  4JX6 A;  4V2F A;  1GDT A;  1ETO A;  2M0C A;  1JKO C;  4RDU A;  5F04 A;  2ID6 A;  3ZQI A;  3TP3 A;  5C44 J;  1BA5 A;  5E3M A;  1IC8 A;  4A3E J;  2R7Z J;  3B6C A;  3S1M J;  4B4C A;  3GTO J;  2WV1 A;  1ZKG A;  3CCY A;  3TED A;  3S1N J;  1U9O A;  2MGQ A;  2X48 A;  5FKK A;  1JUP A;  2E1O A;  3L1P A;  1PUF A;  5F0F A;  3ZOB A;  2FX0 A;  3JRD A;  1H89 C;  4AC0 A;  4A3B J;  2RAE A;  3S1Q J;  5F27 A;  2JWT A;  3VPR A;  3BTL A;  1GUU A;  3PO3 J;  3FK7 A;  1MH4 A;  1B72 B;  3HDD A;  4M3E A;  1QVU A;  4A93 J;  3Q3S A;  3CMY A;  1JTY A;  4D7N A;  3JR9 A;  1B8I B;  3BR5 A;  1VI0 A;  4MLO A;  5J3L A;  2HQ5 A;  2XPU A;  3S1R J;  1OCT C;  2L7F P;  1O4X A;  3E7L A;  5K7Z A;  4IHW A;  2ME6 A;  3DEW A;  5J1U A;  2L0K A;  1MBK A;  5M3M J;  3S15 J;  2ZB9 A;  2EZL A;  2Y0S N;  1I3Q J;  5C4J J;  4IHV A;  2HI3 A;  5FLM J;  1QVT A;  1GV5 A;  2X6O A;  3OIO A;  1ETQ A;  5J1Y A;  2DMN A;  4M3F A;  5FKL A;  2X9D A;  3BQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...