1VQ4I

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
b'GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vq4I00
3CF5F 1VQNI 3PIOF 4V19K 5GAEJ 1FOXA 2E36A 1YJ9I 2ZJPF 3CC2I 3CJTB 1VQ7I 2JQ7A 1VQKI 1VQLI 3CC4I 1VQOI 2OTLI 1HC8A 1VQ5I 3CMAI 3CCJI 2ZJRF 2K3FA 3J7YJ 2FOWA 1VQ8I 2NXNB 2E34A 3PIPF 2OTJI 1VQ4I 3CCEI 1VQ6I 3CCRI 3CCUI 4IOCF 1MMSA 3CMEI 1YJWI 1VQ9I 2QA4I 5JVGF 1YJNI 3CCSI 3G4SI 3CD6I 2ZJQF 3DLLF 5GAGJ 1FOYA 5DM6F 3G6EI 1FOWA 3CC7I 3CCMI 1QA6A 1ACIA 3I56I 1Y39A 3I55I 5DM7F 5GADJ 1VQMI 1YI2I 3G71I 4IO9F 3CCLI 2QEXI 4UY8I 2H8WA 3CCVI 1VQPI 2E35A 4IOAF 1YITI 1YHQI 3CCQI 5GAHJ 1S72I 1YIJI 3J7ZI
chains in the Genus database with same CATH superfamily
3HSEA 4RMNA 4CDGA 2X1CA 1FYKA 2M30A 3RI4A 3CLOA 1JTYA 1D1AA 4EJTA 4RAGA 2RC4A 1X3ZB 3J80Z 4A3KJ 3MVPA 3RQIA 2LKXA 3GYHX 2ZSHB 2V1XA 2DTRA 2HQRA 1MJAA 2XPWA 4Y13A 3LA7A 3LOCA 3K1NA 4XBFA 1ZG3A 5FKOA 1H88C 1ZARA 1HDPA 2X1DA 1LPQA 3M9AA 2A07F 4AD9A 3HIFA 5GPCA 3MFKA 3KFWX 1R71A 2CWEA 3HKZN 2PX9A 5EF6A 3GTOJ 1ERDA 1YX3A 2VL8A 5KK1A 5EG0B 3GLXA 1B9NA 3RQ4A 1IO2A 1MMNA 3BWGA 1GT0C 2CH0A 2R5YB 3QOEA 4OWRB 1SFUA 3FWEA 4EATA 3UR3C 3KEYA 1CF7A 2F4MB 3LMMA 1IRZA 2BEOA 1Y1WJ 4U87A 4M3EA 3O8HA 3B73A 1YQAA 1R1UA 1I1SA 3RDIA 5IYDJ 1XN7A 2HPMA 2W7NA 5HLIA 1AWCA 1R23A 1UFMA 3CCEI 1Z3YA 2ACJA 1NG6A 4ZZLA 2Z3YA 2QWWA 3WTWC 1Z7LA 2AS5F 5FFXA 3H5RA 2QLZA 3VPRA 3LSRA 4OAZA 4FISA 3FXUA 1JJ6C 4UXNA 3FKJA 3T5XA 3H1CA 4JOMA 3PO3J 2ZMEC 5FD6A 1YFHA 3DKYA 2VPLA 5C4XJ 4HDVA 3H35A 2LG4A 3I71A 4MEYF 1B8IB 1T0FA 2ESNA 2X6YA 5F64A 4XRSG 1JUMA 5GAGJ 3CC7I 2DT7B 4AM3A 1IRXA 3S1MJ 2IW5A 3X2QH 1FYLA 1DDNA 1OMIA 1RI7A 4LB5A 2P7VB 2N8GA 3ZR8X 5DS9A 4WF2A 5C4JJ 4IO9F 1UJ8A 2IXSA 3ZP5A 4I0BA 2V4JC 2DDBA 1FMWA 5FKLA 4PJJA 3P5JA 3WODF 2E2JJ 2HQ5A 2MYSA 1JGSA 1YRNA 4IOAF 3D5LA 3ELKA 2BY1A 2M1BA 1J7KA 1OCZH 2P7CB 2HTSA 3BQYA 1EH6A 1W5SA 2L2OA 2L9NA 2R7WA 1FEXA 1HKQA 2VT2A 4PFPA 1A5JA 3PO2J 4E70A 4PGGA 1XC5A 4KMUX 2RV8A 1MGTA 3GX4X 4A5MA 5K7ZA 4M3DA 2VJ4A 1VFCA 2QQ8A 3Q9SA 2ISYA 4BEHB 2X48A 4I98B 4RS8A 5D6FA 2L4MA 1K4TA 2OU2A 3FF5A 3Q3SA 2LTPA 3QYEA 2MC3A 3GFLA 4Y17A 2VUMJ 3TL4X 2E7WA 4U0WA 3V42A 5FB2A 1VQKI 2CQXA 4AU7A 4YIFA 1KU9A 2XF5A 1WRJA 3JW4A 4PGHA 4PSWA 3K4LA 1GV2A 2FXAA 4UVBA 5J1YA 2OAZA 4Y4RA 2MSYA 2A68F 3RKXA 2HVRA 3JSPA 3QYBA 3K0LA 3L2WA 5KNLA 3GUDA 2GLOA 2DU9A 4PFOA 1K4SA 1X4OA 4LFUA 1BW6A 4JQFA 3JR9A 4DYRA 3CMYA 4L9NA 2MBFA 4C30A 3V4GA 4PSXA 1G8XA 1V55H 2XAHA 2RREA 3K6GA 4CGZA 1MH4A 5FKNA 1AOYA 4HG2A 2W48A 4MIMA 2H27A 5F0FA 3OR2C 4IOCF 2EA2A 2M4GA 4HSTA 3LSPA 4IHWA 1B9MA 1DQUA 2M8GX 1D1CA 4GGGA 4O5VA 2KDOA 4IEJA 2M34A 2IRFG 1W5CC 4EJVA 4A0XA 4BQAA 1HKTA 3G4SI 1MSEC 2NVTJ 3IRRA 3ZCOA 2LBFB 2LOOA 2VIXA 4EJWA 4B43A 2XB5A 1WZ2A 5DM6F 3EDPA 3E7LA 3N05A 1RR8C 2R7VA 4U7BA 4HZFA 4DZPA 1LVKA 2LFBA 1QPIA 5BPDA 3KLOA 1VQMI 3M7GA 2R7XA 2D1HA 4QTRA 3TO6A 3CCLI 1U78A 3PFYA 3GF2A 2ZMEB 3M8JA 3TOBA 3JAMZ 4EVIA 3S93A 4PJLA 4XLAA 4KIGA 1WWXA 2OJED 3GMEA 1BBYA 2FUG2 3W6JB 3F3XA 1D8KA 2DAOA 1E0EA 1OQYA 4WXDA 3MKLA 5IOYA 4HA8A 4AYBN 1TQMA 2VKHA 5CQEA 1BIBA 1SMTA 1YX5A 2Z99A 1ETKA 5F0CA 2GXBA 1UHMA 2QVOA 3D5RC 1F1ZA 3ZQGA 2ECBA 5GAEJ 1G3SA 1HW2A 4C2MJ 2DT5A 1JKOC 1MBKA 1VNDA 2E36A 3UKGA 1E3OC 5EJCA 2A3SA 2RNJA 4CYCA 2FBIA 1BR4A 3CLQA 2VN2A 3U21A 3JSOA 4I99C 4CYDA 1REPC 2DPDA 2KLOA 1LB2A 4UV8A 1YW8A 4LG3A 1ZYRF 2LSOA 4NC8A 1SD7A 1JT0A 1WJBA 1HSTA 2EWNA 2R7ZJ 1ZGAA 4P1WA 4YFXF 4M74A 2LD5A 2O61A 1DP7P 1K78B 3ERMA 1OCTC 3IRQA 2K3FA 1NG7A 4LLLA 5D5XB 2X6XA 1VQ8I 1P4WA 4IZZA 4YELA 2NXNB 3AL0C 4MO7A 5DD8A 4V2FA 1Z67A 1XGNA 2JRTA 2STWA 4O3MA 3FDYA 2FQ4A 2F4IA 3DP7A 1S29A 2ELHA 2NS0A 4W97A 4XKCA 4WXHA 3C7JA 1R5GA 5JFRA 3GFJA 5HNHA 4AIDA 1O3TA 4HV6A 4Y7NJ 3BR0A 4ABZA 3OYLA 3DBHB 3PQJA 2VQLA 4A3EJ 5FROA 2VJIA 4AWXB 2YR2A 2X1EA 4MTEA 4FT8A 4RAFA 3ML6A 1TQIA 3IWZA 3DLAA 5HVQC 5IP9J 1I6XA 4EGYA 4CCKA 2EH3A 4BBSJ 4RGUA 3JRFA 4ENMA 3H92A 4H0EA 4A3IJ 1AU7A 1T6SA 1W36D 3K1MA 5FLXK 4EM0B 2CUFA 3ZQCA 3BTCA 2AXLA 3OYFA 1B1BA 3TOAA 3CUQC 1VF9A 2NNYA 4ENNA 4UUVA 5IT9Z 1VQPI 2QGUA 3M3YJ 4KITB 2YS9A 1IDZA 2Z2SB 3TO7A 2LF8A 3GO5A 2W85A 3K2ZA 2KIQA 3C2BA 4ZYGA 1WH7A 3MEXA 4P5OA 3HZJA 4OMYA 3GVAA 3H3UA 4EGZA 1U8RA 1O7LA 3S1NJ 4BNCA 1MNDA 2ZNZA 4A3FJ 3RCOA 1UCRA 1U9NA 2LKSA 2YU3A 3HOXJ 5E18F 1B4AA 2NAZA 3QRFF 2HYJA 2QSGX 3DEUA 2QQAA 4JP0A 3IV5A 1OR7A 4FE7A 4RLFA 2GWRA 3HUGA 3DFGA 2R7DA 3GXOA 4DYCA 5F04A 2ZSIB 4D9JA 1SEUA 2DI3A 1LJ9A 1T08B 5CJ9A 2EFPA 4UB6C 4D5FA 2TCTA 4L5EA 3TP3A 5A2QZ 1O3RA 2DTZA 1N77A 5M3MJ 3I0TA 3RPUA 1RPWA 1ON2A 2OCEA 3S8PA 1FY7A 5DV5A 5LGUA 4ZDOA 2VPRA 3CDLA 3KIOA 2KT0A 2QCOA 4DQ2A 1TL8A 1QBJA 1UAAA 4HPQA 5FGMA 4XL9A 3WTTC 1D1BA 2HZDA 4HX7A 4BHPA 1ENHA 5KAFC 3VYSB 3FIWA 2HVQA 2NVQJ 1EKEA 3F8CA 4YFNF 5B5EC 3CCUI 2DOAA 2EIKH 5IOZA 4IHVA 2MABA 2MH9A 1ZLKA 2ID6A 3PUFA 2GXAA 2ZXWH 2VJ5A 2D2WA 1V3FA 4HDUA 4KYWA 2Y0SN 2A5WA 2P4WA 2XPUA 2VLAA 2MD5A 1LDJA 1DP3A 1I1GA 2MLGA 3DLLF 2BE5F 2QQ9A 5D4SA 3MMYB 3OMYA 4EEFG 2D5VA 3AL0B 1ACIA 2ESHA 3IC7A 1G2HA 1ONVA 3OOPA 1V4RA 3HC7A 3TO9A 4EM2A 5H6RA 5JHUA 4I09A 5IYCJ 1CQTA 4MGRA 2G0EA 2BBYA 2M8EA 3I4PA 3JTGA 1X2NA 2FOKA 1DGRM 3BR1A 4LLNA 4ZH4F 4KIBA 1A31A 3TQNA 4BE1A 3OYMA 3G2BA 2EV6A 3KZIC 3BR2A 2DBBA 3CCQI 2OZ6A 1IN4A 4XKBA 5J8FA 4F55A 3B6CA 3OYGA 5E79C 2BVMA 3CJNA 2NVYJ 3GZ6A 1WFXA 4S05A 3CDIA 3LSTA 3ZXSA 3Q9VA 5J1RA 1JGGA 5J47A 3HOWJ 3CF5F 3HG9A 2H94A 3IKVA 2BVLA 1RR7A 2DK8A 5EG0A 4A3JJ 2WAEA 1RESA 4BQNA 2R5YA 1MMDA 4U0VA 3NAUA 3EUHA 1SC7A 3U2RA 2K9NA 2KQRA 3L1PA 4HYEA 3R61A 1JUSA 2V9PA 1JKQC 1HBXG 4O6JA 5GPAA 1P9QC 2GIZA 1IJWC 2Q2EB 2XAJA 2EFQA 3K7AJ 2ZFWA 4D1QA 3M07A 2HYFA 4NUBA 4DIQA 4IHYA 3LSIA 1U5TB 2HDCA 3MZYA 2V9KA 1STZA 2HKXA 3NARA 3QWLA 5DCMB 2R93J 3NEUA 2VKEA 1Q1VA 3BQZA 4BJTA 1FBUA 1OISA 1D5YA 2WTEA 5KHDA 1T56A 1WHUA 4CZCA 5BMZA 1B8IA 4XMYA 2PMUA 4LIUA 4E7HA 3DWLE 2BY3A 2F4OB 4M9ZA 3J7YJ 1T95A 2HVSA 1LFBA 5HS7A 5D5UB 2CQ7A 1D0XA 3E1SA 3DPLC 3MKWB 2ADUA 4G9YA 4A6DA 4ESJA 4G7OF 1R9TJ 1DPRA 2LNBA 4BQQA 3D0SA 2KPMA 3OYIA 3J81Z 4HNTA 4QIWN 1FTTA 2Z33A 5GP9A 3HPHA 2WA0A 1B72B 4XR6A 1GHCA 4P96A 4AIJA 1W4MA 5E3OA 3NRVA 3QYFA 2Y9ZA 2JA5J 4I6ZA 3KYCB 4JBAA 3M4OJ 2DYSH 2FRHA 1J9IA 3JRHA 2IT0A 3T8RA 1OCPA 4MFEA 1TWAJ 4MHGA 4MQ9F 3ZMZA 2DODA 1Z91A 2WAFA 1D5VA 3RZOJ 1UG2A 2X0LA 5H2FC 2EZHA 1M1EB 1NH3A 1IGNA 5DM7F 1G4DA 1KA8A 3DKXA 1X1BA 4F92B 4XIDA 5ICEA 1DUXC 4UUTA 3DBRB 3IH2A 3GTJJ 3DU5A 1SFOJ 1UMQA 1Z7UA 2BY2A 3PSIA 4HLXA 2UZKA 2G9WA 3O6BB 4GO1A 5LRRA 1ZELA 2R7UA 1QZZA 1XPXA 1DU0A 3TBIA 4CCLA 2B9SA 4Z6YA 1N78A 3CP8A 1ETOA 2BOLA 1Y1VJ 2VKVA 3MN2A 4M6YA 3CJQB 3I53A 2ZXHA 4KFCA 4A0YA 2HU9A 3IL2A 2FSWA 4M6VA 5JLXA 4I0AA 1SD6A 1TW2A 3FXRA 3WTZA 3DKWA 3A0HC 5ILVA 3WTUC 1G6NA 3HRTA 2I8DA 5HDNA 3S14J 2O5RA 5JHFA 4A2UA 4E7IA 2PJRB 2YX4A 1H8AC 3QPLA 1MDMB 4L9TA 2WY7Q 1V5EA 2VBYA 2FNPA 3KX2A 3WHCA 3C18A 5E8IA 5ICCA 5E3MA 3UNGC 4Y52J 1W7PD 2ZJPF 2V7FA 4P55A 2IAIA 3WG9A 4XKVA 4RGRA 2BZTA 3S1RJ 3VDXA 2X6WA 3HOYJ 4YFKF 3JRBA 1FTZA 3GTKJ 2KIUA 2O8XA 1YW9A 2IGMA 3RKYA 3LL7A 1BI0A 3A01B 2NVXJ 5FLXZ 1FNNA 1Y8QB 2HGCA 3KP4A 2CUZA 3FXQA 5EEGA 4XLPF 1JJ8C 1F4KA 4XM3A 4G8XA 5B1AH 1JTXA 3OOUA 2V6EA 4NC7A 2LBFA 2F5FA 3ABMH 4XSXF 4G7HF 3OSFA 3IAS2 1JHHA 4LLGF 3IP4B 5M5WJ 3I59B 1WSUA 1VQ6I 2E1MB 1YG2A 3RPQA 3VSLA 3QODA 2Q0OA 3HSRA 2XGCA 4BXFA 3CMEI 3GTPJ 4B3AA 2CQQA 3WGHA 3CUOA 5IT9K 2ZMEA 5FO5A 4CSWA 3AKZA 3IKTA 4CCOA 1HKSA 4XN0A 1H9GA 3L9FA 5F27A 3QP6A 1HA8A 3S1QJ 5H20A 3Q0UA 3WTSC 1APLC 1RUNA 1IV6A 2DA6A 4BQOA 3BT9A 2CGPA 2CU7A 3IHUA 3U1KA 4E7ZA 2IA0A 4R79A 1IN7A 2F5VA 2O6GE 4JX4A 2CSOA 1OCOH 2FMLA 2B63J 1SFXA 1UG0A 3GW2A 4MFDA 3K4KA 4C9YA 3GFIA 1DU6A 3M1EA 4LJZF 1R49A 5DUIA 2R0QC 4UVCA 3DEWA 3RKWA 5FRNA 2HOSA 4GRIA 1PP8F 1UHWA 4G6DA 3OR1C 5KCMA 2LLKA 4ZTFA 2EV0A 2M45A 3SZPA 1YITI 2IS1A 3TDUC 3SDGA 1R22A 2Z1DA 4ETSA 4I01A 2XF6A 4ZYAA 3DPUA 3SFZA 1G3YA 1TWFJ 2R3SA 2ME0A 1RC9A 3T8TA 4KMFA 5ILUA 5A2QK 1RNLA 1LVAA 2HR3A 1QHHD 4G7ZF 2K40A 5ICFA 1LEBA 3QAHA 3FXKA 3MCZA 5LEKA 2DFHA 2PFBA 4FQGA 2LKPA 3KZYA 1PVEA 2LY2A 2ZKZA 1A35A 1TC3C 1K78A 3JCUC 2ZXIA 1YJ9I 1MJ9A 1BM9A 5K5QA 4UVAA 1UELB 5JVTA 4XOTA 4HF0A 4D0PA 2RVCA 4ZZDA 1V5GA 4F91B 5TISC 1R4NB 2FD5A 2NOGA 3BR3A 3TEDA 4CCMA 5IT3A 2F6CA 3JREA 4F7ZA 3F22A 5FKMA 2L3DA 1QHGA 2WC2A 2P5LC 3HPGA 1U0JA 1X2MA 3KP3A 4HNVA 3MQ0A 2XGDA 1ETVA 2M0CA 1OYIA 1T0FC 1TTYA 3FK7A 1ETQA 3L00A 2Z16A 3S3MA 4YIRX 1W1WE 1ZTRA 3WG7H 3OYCA 1PDNC 4XORA 2DMQA 5EEAA 2XAQA 1ZK8A 2DN0A 5FJ8J 2HFHA 3CO7C 3QU6A 4GFBA 2Y0MA 1IXSB 3K70C 1O3SA 2IEKA 2K4BA 2L54A 2K85A 3I9V2 3ASNH 1XX5A 4BJ5C 3SYTA 3T0YA 5TGTA 2OCCH 2MC4A 3IH4A 1WJAA 1ITYA 1O57A 4J00A 3GLLA 3ZN0A 4FCYA 5CVJA 3F9KA 1SAUA 1R58A 4HX8A 3G6EI 4OINF 4HLYA 2NS7A 2UWMA 4BYYA 1IXRC 1JT6A 3TW7A 4L0ZB 1S3JA 1IZ1A 2HYGD 3BDDA 2VXDA 1K6OA 2LDUA 2HDWA 3I54A 2VONA 2KIFA 2Y31A 1WI9A 3O2PE 2BY0A 3VYTB 3G71I 4GDFA 4X0GA 1D8JA 2M7BA 1QVTA 1TT0A 3BTJA 3EQLF 3T1BA 5HLGA 3CCVI 1X1DA 3E6CC 3F8FA 1K6YA 1SD4A 1HCRA 3CDHA 1MBEA 1EH7A 2L7FP 4MLOA 1UB9A 3FBIB 1IUYA 5C44J 1FBQA 1HDDC 1N25A 4IRIA 3HJEA 2XC7A 3MKZA 5K7FA 2RNGA 3CCYA 4B48A 3SJMA 2RN7A 3E3VA 4DNCA 4EQQA 2EZIA 3J7ZI 3ZMDA 5J4VA 3EUKL 4MTDA 1YS6A 3S32A 5IPAA 1S7OA 3PIOF 3ABKH 4DZJA 1FBSA 3FISA 3BZCA 1OKRA 5GTHC 4FTHA 3TW6A 1KQ8A 1FPQA 3I3LA 3W3CA 5M5YJ 2M4KA 3EPZA 4BDZA 2VT3A 1YO5C 4FE4A 2H1LA 3G1LA 2LVSA 4IJAA 1VQ7I 4J01A 2XSJC 1IF1A 5F6FA 4N9IA 2K02A 2L0KA 1ZQ3P 2FU4A 3J81K 4OIPF 1YS7A 3HRSA 3NQOA 4DOZA 4GYIA 3BCBA 2ZB9A 3JTHA 4IXAA 1P7JA 5ERIA 2K9LA 3VSKA 2A6EF 3L09A 3E6DA 4OOIA 2GOXB 3W2AA 3S16J 1AKHB 5BS6A 1KQ9A 4RB0A 2JPBA 1W7PB 4FETA 5E1ZB 4YRVA 1U8BA 2K3PA 3CCJI 3SXYA 2DMUA 2VE8A 4FX0A 3JRDA 1G3WA 1QNTA 1P2FA 5E20A 5TJJA 3OL4A 2UUZA 3PIPF 1FT9A 4N0BA 2DW4A 2NNNA 2EA4A 4CHUA 2EK5A 2CS3A 1YTYA 2PQ8A 1X3WB 2E60A 4UUSB 1VTNC 1E3HA 2LY9A 3BR5A 4FX4A 4NB5A 3HXLA 1X3UA 3QOPA 3H5NA 3Q0WA 1DPUA 1X58A 1WJ5A 1GUUA 2JA8J 2ETHA 1BOBA 2D45A 4IQJA 4PK4A 4A0ZA 5HODA 2L9RA 4CUGA 4BL0B 2JN6A 2W82A 3DQVC 3O3KA 2P8TA 1ETXA 1LQ1A 4WWCA 1BN5A 2ZNYA 4ZJZA 1PJRA 3GEZA 2KRCA 2PMZN 4D5CA 4E6KG 1JI8A 3FX3A 2V6CA 1BR2A 2BXYA 2HDDA 4N4OB 4CCNA 3MZ8A 1S7AA 5AIPA 1P92A 4R8HA 4PCQA 3CF2A 3WU1B 3HGYA 1R5HA 5E1WA 4BH9A 2IJLA 4L18B 4S0HB 2K9QA 3SQNA 4DBQA 3JRGA 2VB6A 1F5TA 5EZGA 3HTUA 2XAUA 3OY9A 3FKIJ 5HDKA 3ECHA 4II2A 1IG7A 3F6OA 1GV5A 2E5NA 2Q2EA 2HOTA 2DOEA 2PG4A 2MGQA 3FXJA 2XB0X 4B44A 1KYWA 1T38A 2MD0A 2GAUA 2JMWA 3LSKA 1U5TA 4A3MJ 1Z6RA 5DCMA 3ZGKA 5EGOB 2IVMA 2IPQX 2KJBA 2EB7A 1IC8A 2P0WA 2VODA 1J5YA 1WH5A 3RTRA 2WBMA 3KP6A 3A0BC 1DGWY 2R7QA 2BW3B 1ZLJA 1KONA 2OF7A 3E6BA 3V7SA 5LGNA 2DA4A 2E1CA 1LDDA 2KHMA 3SZTA 4L9JA 1FLIA 1ZKGA 5LGTA 3KCCA 3L2CA 2FMYA 2EBIA 5DTDA 4ON0A 1Y6IA 4LG0B 3JRCA 1ZREA 4LMYA 4KN7X 1QRYA 1B72A 2E1NA 3CMAI 1WPKA 2P5VA 3LQRA 4YEJA 1ZR2A 4IKFA 1J2XA 1YW7A 2RDPA 2BHYA 3E6MA 1OYWA 5JLWA 1Z05A 4XOPA 2ZJRF 2NRAC 2K27A 4RM2A 2CO5A 2E34A 2MW8A 3R6SA 3OL3A 2K4JA 2X6OA 3B6AA 5E3NA 1N75A 1X1AA 2W24A 1J75A 4KISA 2YX7A 3F72A 2DA1A 2JJ7A 1XSDA 2VBXA 2BXZA 3S15J 3OIOA 1RUOA 5DDGA 4I02A 2K9MA 4A12A 1I3QJ 2OD5A 3HSFA 2ELJA 2R7SA 1HLVA 4LB6B 3H9JA 1KU3A 2XV4S 6PAXA 2CW0F 1SMYF 1HOMA 3I64A 3LA2A 2C6YA 1HQCA 3IUOA 2PI0A 2VBZA 3DTKA 4EJUA 1RRJA 2EQRA 1E3PA 2JK3A 2PJRA 1LNWA 2VI6A 3VFZA 2LP0A 2V1NA 3GZNB 1MDMA 3SDBA 3ZPLA 2EIMH 1QVUA 4AC0A 2RQPA 5D6EA 2E1OA 1KZHA 1TWHJ 2F5CA 2DA7A 4OU0A 1XCBA 1AA7A 1KQ0A 2QM3A 2XAFA 3PNYA 4CICA 3BJAA 3H36A 4KT5C 3ZQFA 4U88A 1QU3A 1FP1D 4XLFA 1V5FA 5B3SH 3ZQ7A 1ORKA 4CZZA 4RM3A 3ISPA 3A01A 2X9DA 2X51A 1G59A 3RIRA 5AIQA 3PFIA 5FRMA 1XDUA 1T8IA 1OPCA 2L7KA 1XG1A 3DTEA 1Z6TA 2DJIA 2HZTA 1XMXA 4UHTA 4WK8F 2W00A 4HX4A 2GA2A 4GXOA 4QPOA 2DA5A 2PN6A 3I59A 4YG2F 1VQLI 3LAPA 3E5UA 2V1DA 1HSJA 3BP8A 4L9VA 4N9HA 1W0TA 3GTQJ 4UNOA 2JUCA 2OTLI 1F43A 1QO0D 3GTMJ 4ZYEA 1XDSA 3CP2A 2BHZA 3HB9A 1TP4A 4X1EA 5K5RA 1BJZA 4FASD 1FIPA 2IGKA 1OLTA 2ZXJA 4J19A 3DF8A 3BG6A 3CUQB 2Y48A 4DJAA 2O9LA 4GYGA 3PSFA 2F5EA 2ZO4A 1GVJA 1HW5A 2QSHX 3CTAA 2IGOA 1MBJA 2JSCA 2UXNA 4PJNA 4L0YB 3OYKA 1TWGJ 3PQKA 3KP2A 5LHIA 2EFWA 3REOA 4CXFA 3S2HJ 1E2XA 3ABUA 2LF7A 1PUFB 4HAMA 1YYVA 3TP0A 3RYRA 3LFKA 3K9TA 2UV1A 2XASA 4KUMA 4A6EA 4A3DJ 1OFCX 5ILSA 1AHDP 4E7KA 2HS5A 4M9XA 3KLNA 3OIPA 1T39A 1WJEA 2XRNA 3C2HA 3CJRB 1S7EA 3KP5A 2VOPA 2PEXA 2CFOA 3CZ6A 3RZDJ 5EYRA 3BOQA 3O8GA 4EJOA 1GDTA 4LK0F 4ANJA 3ERED 2L01A 2OPTA 1ZGWA 1I27A 2KDZA 2K5CA 3QQAA 3WE2A 1Q1HA 1MD0A 3E97A 3GWZA 3F6VA 5HLTA 4R1HA 5FLVA 3WGGA 1EA3A 1F36A 2I5UA 3HRUA 2E2HJ 2QBYB 3EETA 3BJOA 1HF0A 2HXOA 5GADJ 2D1VA 2R7FA 5CVIA 2L7MP 4BXUA 3KE2A 2CW7A 2DPUA 3AG3H 3EUHC 4UY8I 5F1JA 3K4NA 5D5WB 2HEOA 1U6GA 3COAC 4Q5SF 2DDAA 4RBOA 2KZGA 3SEZA 3V8KA 1GLNA 2J5PA 3FMQA 3FHZA 5CKTA 4ITVA 2KISA 2RGVA 4Q4ZF 1TZLA 2CUEA 1Z0XA 3ZN1A 4ASNA 2IS6A 2K7LA 1VQNI 1JUPA 4BEHA 4KA4A 4V19K 2UXXA 2HOAA 2R4GA 5H6QA 3HOSA 2EFOA 2HQAA 2R5ZB 1NTCA 1YE9A 1MBHA 2FBHA 1JKRC 3P9IA 4Y15A 1LE8B 4BY1J 4Q47A 1ZGJA 3U9GA 4OIQF 5L3DA 3S2WA 5L3GA 3I4NJ 1BR1A 2QKLB 2CUJA 4XONA 2VJJA 5CQGA 1FSHA 3MKYB 2DFIA 1CGPA 1U9OA 4XQFA 4A3LJ 1JE8A 4YIIA 3I5UA 5M5XJ 1R4MB 2Z9OA 1FX7A 1LDKB 2EV5A 3GCMA 4Q48A 1IN5A 1IAWA 2OUMA 1BIAA 1TW3A 2WV1A 2JT1A 3DBLB 1H89C 3HRMA 3G1OA 1D3YA 3QP5A 4DW6A 2EILH 1JKPC 4ZTJA 1LKXA 4IVNA 3A02A 3R0JA 4M9SA 5J4YA 1WCMJ 5BNGA 1SFKA 3OS2A 1S9HA 1VQ4I 3A4CA 5JI6A 5D8LB 4M3FA 2PLYA 4K2EA 1PP7U 2X85A 2DMNA 1A04A 2F48A 3K4JA 3FXLA 1RKTA 5EEHA 2NS8A 2JA6J 3LSMA 2P5KA 4XNFA 1MNEA 2E71A 3VOEA 4CO8A 3HL2A 1SVLA 5J40A 3KYLA 3CQZJ 5HLHA 2GQQA 4UB8C 4OAYA 4M71A 3I55I 1XCVA 1A36A 1FOKA 4XLEA 1BOAA 4IRHA 2A61A 2ID3A 2DCEA 3ASOH 1EV7A 1WJCA 4IL6C 4II3A 1TQPA 3W6KB 1I50J 3A2KA 3I4MJ 1SVMA 3AFHA 2QEXI 4XLHA 3K70D 3BTIA 5EDNA 1H9TA 5TRDA 4NQWB 1BI1A 2L9VA 1S8NA 2QZ8A 2XGXA 5E3LA 3L2QA 3LWFA 4E4HA 5HOOA 4RAZA 5J3LA 4BJ6C 2DXIA 2IA1A 2VOOA 3A1YA 2AQFA 3I58A 4KNYA 3F8MA 3JRIA 1JHFA 2JTVA 3HOVJ 4MEXF 2VBWA 4P9FA 2ISZA 4RGSA 2KL4A 2A5YB 3IAM2 1BI2A 1ZG1A 1R36A 1ZAOA 5L3BA 1AKHA 4RA2A 4ENJA 1P7IA 1W7PA 4DGWB 2EINH 2ZFUA 1FOXA 1QPMA 4BS9A 2XUBA 3QPTA 2K9SA 2KJCA 3K2AA 3F8BA 3NWSA 1HW1A 3E0JB 1EH8A 2VC1A 2IS4A 4E7JA 1B6AA 1R6RA 4JYKA 2HWVA 2VKDA 2V9VA 1QZEA 2CJJA 3OIQA 1BL0A 3S3NA 1I3AA 1V54H 3GBGA 4UUSA 4WXCA 2VC0A 1FYMA 4G6TB 4RB1A 2ZBKA 2OBPA 1FSEA 2FF4A 3U1DA 2QQBA 3H5AA 4B3XA 3BROA 1R00A 5LBQA 1K79A 2L5QA 4C3IJ 4XRFA 1Y0NA 4N4NB 4PJ0C 4E7SA 3OYNA 4B4CA 5CLSA 3VYUB 2FE3A 1LFUP 1OCCH 3V7CA 2YPRA 1R5ID 1FC3A 4F52A 5CVRA 4IRGA 3KYDB 5K1YA 3J7AY 1IN8A 2KKOA 3H0DA 2VQHA 3TKYA 2W1OA 1YJWI 1X4PA 1ZR4A 1TLHB 2DLLA 3MAJA 4V2GA 1PYVA 2CYYA 2QKMB 3WU0A 2DFFA 2Y75A 1EJ9A 2CV2A 2Q1ZB 4L5IA 4BDYA 4BUPA 3Q0VA 2WAQA 2Y0SA 3DPTA 4ZDPA 5ICGA 4ENKA 5E17F 4HV5A 4JX6A 2YUSA 2XRLA 3WTYC 4OIRF 1USTA 3I56I 1J0RA 2O03A 3H3ZA 4MQVA 4OMZA 3TGNA 4BGDA 5HS8A 2GBYA 1LFPA 5HDGA 5B66C 5LHHA 2H6CA 4KN4X 5DYMA 5EGOA 4HNUA 1QQIA 2DMTA 1K83J 2NYXA 4KICA 2JSPA 2OZUA 3AAFA 5IY5H 2JVHA 1O4XA 1X19A 1XGSA 1YLFA 1WKMA 1ZRFA 1MIJA 1P4XA 2BW3A 2QYOA 3J7AO 3QPHA 4A5NA 2L02A 3GZ5A 1ZRDA 1VZ0A 3ECOA 1IV8A 2DQLA 3MZHA 2YU9J 3ZOBA 2HNHA 3E5QA 1SVOA 2VQCA 1TWCJ 3Q5FA 4F93B 1USSA 1YIJI 4L5JA 2EJRA 1R1VA 3VODA 5F0HA 4HF1A 2CMPA 4LG0A 1Y56A 2M2EA 2E5ZA 2JZYA 4XN3A 3OYBA 2E19A 3EYYA 4B09A 3SEQA 5LHGA 3V7RA 2FA5A 1KU7A 4U0YA 3NWTA 4BACA 3L2VA 2K86A 3DEEA 1PUEE 3PNTA 2IGNA 3AG4H 3L2RA 2BV6A 4FHTA 3CC2I 2X4HA 3K4BA 3KP7A 3WTXC 4Y3OA 4BU2A 4BAYA 4WCGA 5LEJA 1WQ2A 4HSRA 2EIJH 2GXGA 1T98A 4TV7A 4A3CJ 3OS1A 1O7FA 2HQNA 2DT6A 2R7OA 3H9QA 2ME6A 3C3WA 4BHCA 1WVRA 4A3BJ 3HTSB 3TMOA 5K7HA 3BZ6A 2WWYA 3KETA 4G12A 4IHSA 3SHFA 2FOWA 5DEQA 4UV9A 2CFXA 2L7ZA 3FK6A 1ZRCA 5D5VB 2Y69H 3ZMSA 3OYEA 2XSDC 4XRSA 3RKQA 1B59A 2MLKA 1MSFC 1TNSA 4D7MA 1KGSA 1MMSA 4HBLA 4HW0A 3G73A 2M5WA 4CH7A 1MMGA 2WV0A 2E2IJ 1R1TA 4KIFA 1RKWA 1F9NA 4S04A 5F08A 1YJNI 3FBNB 2XIGA 1CF7B 2RKHA 3GTGJ 2JPCA 1ULYA 1R7JA 2WY8Q 3E5XA 1K61A 3LNQA 1J09A 5LRSA 2LR8A 3CD6I 5HS9A 3WE3A 1FJLA 4AIHA 3KEOA 3N97A 4QLCU 1FOYA 2VASA 2XVCA 1FOWA 3D5SC 3BC8A 1C0WA 2COBA 1G3TA 1TT5B 2KMUA 4G6QA 5C3EJ 3F23A 3HHHA 3OWTA 2KRHA 1NHAA 1FIAA 3G3ZA 3DTIA 1WJFA 4F3QA 4M3BA 2BYVE 1QGPA 1UZCA 4NNJA 2QF7A 1BW5A 3AG1H 2HKOA 4XKWA 4QPQA 1X1PA 4ZC3A 2OQRA 5CYVA 3ONQA 2DOFA 2XROA 2XPVA 5GTIC 2DJNA 2V79A 4MNUA 3WTVC 5LFAA 2LK2A 3K4MA 2LREA 5D4RA 2GIVA 2P81A 1ON1A 2RQQA 2IA2A 3PUBA 4BKXA 4I7HA 5KVRA 3OYAA 1A6IA 3LAJA 3ABLH 3EUAA 2W4SA 3RSNA 1TNTA 3VB2A 4CA0A 2WADA 3IWFA 2A05A 2WB1A 3CUQA 3SZGA 1YRNB 2CV1A 2R92J 1IRGA 3CESA 1QZYA 1OJLA 1FMVA 3CJTB 3IH3A 1U3EM 2O0YA 2G7HA 4XRMA 4M3GA 4W1UA 3LSGA 3BG9A 3V8LA 4CCJA 1HXDA 2MH2A 1MJBA 4M72A 4PDKA 3H3VK 1E17A 2LRDA 3OSGA 1PUFA 3CC4I 1EF4A 2GA1A 3W6VA 5BQTA 1VQOI 4BE2A 2TRTA 2FX0A 2VE9A 4PZJA 5D8KB 4GCVA 3ZQHA 3ZQLA 4LIVA 4DYQA 3GTLJ 3M1CA 1SD5A 2XHKA 4HEA2 5DCFA 9ANTA 3ZRGA 4M73A 3RPUD 2XKPA 2M9HA 4E7LA 2PJPA 4C2TA 2Y2ZA 2MA3A 3KEQA 3C1DA 1Z1DA 3W2WA 2IBDA 5CPRB 1XSXA 3MD2A 3ULQB 3DU6A 2QBYA 4HF2A 1BA5A 1BC7C 1U2WA 5L3EA 2CW8A 2DK5A 2XAGA 3PM1A 2F2EA 5L3FA 4AVZA 2LY1A 2P6TA 2DA2A 4C2UA 3J80K 3EYIA 4XLNF 3P7NA 1VQ9I 4NHJA 4RGXA 4HQMA 5JVGF 2XGEA 1IXCA 1MZBA 3HKZA 3SFIA 1MBGA 1IRFA 2GZWA 2H09A 2CQNA 2A6TA 2ELKA 1MMAA 2DYRH 4WX9A 2EZLA 4IPAA 3W2VA 1YIOA 3R0AA 2ICWG 1J59A 3LSHA 1Y0UA 2Z5UA 3K69A 2FQ3A 1Y39A 3LQQA 4B8XA 4RB3C 3WGIA 1U5TC 4KDPA 2G7UA 1FZPB 2STTA 3H0GJ 1YI2I 2LYCA 4RB2C 3BCAA 1Z77A 2R5ZA 2HI3A 2CG4A 5E8GA 3HOZJ 3R4KA 3N4MA 2O3FA 3HGGA 3G1MA 5FLMJ 2H1KA 3S2DJ 5IP6A 1S6LA 4BBRJ 3K10A 1H0MA 1LE8A 2O8KA 2AHQA 2Q8KA 3HDDA 1I6HJ 3M8FA 3K1PA 2QUFA 1MH3A 1XS9A 1KU2A 1L0OC 1S72I 1O3QA 4LD5A 2YSRA 1MNMC 3HOUJ 2ZJ2A 1SFEA 1X1CA 1IUFA 3HYIA 2OC6A 3L7WA 3BTLA 3GFMA 4I76A 2Y9YA 1OR7C 5IP7J 3DCFA 5FFZA 3WU2C 2CQKA 2E7XA 2OQGA 3KPHA 1WI3A 3OYDA 2XF7A 2R7RA 2DQRA 2LC2A 3DV8A 1XTAA 4IQ4A 3AG2H 4BY7J 3HEFA 2GOMA 3JRAA 1XGMA 2AO9A 3F8NA 2DMPA 4DBRA 3LA3A 4NBQA 2WAQN 5IYBJ 5CVVA 2EZKA 3FMSA 1ZN2A 2R7TA 4ZDLA 2DA3A 4PUSA 2MFZA 2V26A 4CYCB 1T2KA 2H8RA 3LSJA 1NK3P 2JA2A 2NOJB 2OTJI 3OV8A 3BG5A 1W36C 2JA7J 2JRMA 2OA4A 3CCRI 3BZKA 3ZMTA 2A69F 1BC8C 3V8JA 3OYHA 1SANA 3F21A 2M7AA 1ZH5A 2NVUB 5B1BH 3FZVA 4C3HJ 3B02A 4KJZA 2VQGA 2W57A 2QA4I 3WHBA 4JK1X 1ETYA 1D0YA 1L3LA 2KFDA 2FNAA 2H6BA 3CCSI 4I2OA 4NQWA 2W84A 4D7NA 3ZQQA 2ZJQF 1XB4A 2ECCA 2IP2A 4OIOF 2AQEA 3HOTA 5LLQA 3ROUA 3CCMI 1I5ZA 2L9SA 4BXXJ 3H9GA 1BI3A 4ESFA 5J6XA 2XDVA 4NC6A 2KRFA 2PMHA 2CRGA 4A93J 2KP6A 4EM1A 3L2UA 1XSVA 2W25A 1VI0A 1OYYA 3RJPA 1BJAA 1XD7A 2H8WA 5AONA 3HM5A 4B1RA 2QENA 3BPXA 1NK2P 2IS2A 2JVGA 1YHQI 1KYZA 4X6AJ 1P4AA 3P9CA 1IDYA 4EV0A 4P9UA 5L3CA 2F5DA 2EFNA 2HPIA 2L4AA 3P9KA 1WGXA 2E1MC 1RIOH 5KAIC 4LITA 4AIKA 3VEPA 4Y33A 4U7DA 5EZHA 2ZC2A 2KZVA 4M6XA 3ESWB 2DFEA 4JX5A 1ETWA 1IW7F 2A6HF 5BOXA 2JUGA 3KZZA 1FP2A 4XSZF 5M3FJ 3BG3A 3ZQIA 2LH9A 4AUXA 1UHSA 2BGCA 3FHNA 1D0ZA 3A03A 3HBLA 3RYPA 3MWMA 5J8CA 1W5TA 3K4CA 3LFUA 1T33A 2EPFA 4AVPA 1W0UA 1MKMA 2RAEA 4XICA 2JQ7A 5ED4A 4ZYDA 5K5OA 3BR6A 4LK1F 3TDZC 3DXJF 2B0LA 4XK4A 4IX7A 1XGOA 3VYRB 4EMSA 1Z9CA 2HOEA 1TBXA 3CMMA 1HC8A 2LMDA 3BG7A 3BY6A 4Z2YA 3BPVA 4BE0A 1I39A 2JWTA 2OV7A 2GM4A 4AYBA 1VQ5I 3JAMK 5LD2C 3VWBA 1JXSA 3BLYA 3PL8A 4RLQA 1LUJB 5E1XA 2CV0A 4A69C 1GXPA 2PBIA 4B47A 1MW7A 3OYJA 3CO6C 3HUGB 4IHXA 2COMA 2P6SA 1A6QA 2XKOA 1OCRH 4LGWA 1GVDA 3FM3A 2HTJA 2KIMA 3F0CA 5HNFA 1ZHFA 4HOBA 2MG4A 1ZG5A 1MBFA 4H4KC 4ESBA 2AXTC 1LEAA 4IF4A 3ABTA 2ZCWA 3PNVA 4C3JJ 3QPSA 5FD5A 2FEZA 3FXOA 4RDUA 5BPIA 1XMKA 2VXZA 3ZMUA 3HHGA 2O7OA 5DUKA 2FJ1A 5F1RA 3OS0A 3R60A 5J1UA 1FWZA 2I10A 1Z21A 1IN6A 2M87A 5CVUA 1ODDA 1YOVB 2M3AA 3FXMA 4QSHA 1QA6A 1WJDA 2FBKA 3C2GA 2DO7A 4PJMA 4XLCA 5JR3A 4LOCA 2WB1N 1Y8RB 1S5LC 2PMZA 3PJRA 3FMRA 2QSFX 5DD4A 3S17J 3S3OA 4G94A 5FKKA 3ZMVA 1Z3XA 1K7AA 4IHTA 2HXIA 1RZ4A 2E35A 4HRIA 3D1NI 2J5OA 4NDLA 2M0MA 1SAXA 2TDXA 4RAYA 3BJ6A 4A3GJ 2Y30A 1POGA 4QWQA 5GAHJ 1P6RA 3QU3A 3M8EA 4ZYHA 1RETA 3FM5A 1GXQA 4HQEA 1XMAA 2V1UA 2B7EA 4KT6A 4BHBA
chains in the Genus database with same CATH topology
3CF5F 1VQNI 3PIOF 4V19K 5GAEJ 1FOXA 2E36A 1YJ9I 2ZJPF 3CC2I 3CJTB 1VQ7I 2JQ7A 1VQKI 1VQLI 3CC4I 1VQOI 2OTLI 1HC8A 1VQ5I 3CMAI 3CCJI 2ZJRF 2K3FA 3J7YJ 2FOWA 1VQ8I 2NXNB 2E34A 3PIPF 2OTJI 1VQ4I 3CCEI 1VQ6I 3CCRI 3CCUI 4IOCF 1MMSA 3CMEI 1YJWI 1VQ9I 2QA4I 5JVGF 1YJNI 3CCSI 3G4SI 3CD6I 2ZJQF 3DLLF 5GAGJ 1FOYA 5DM6F 3G6EI 1FOWA 3CC7I 3CCMI 1QA6A 1ACIA 3I56I 1Y39A 3I55I 5DM7F 5GADJ 1VQMI 1YI2I 3G71I 4IO9F 3CCLI 2QEXI 4UY8I 2H8WA 3CCVI 1VQPI 2E35A 4IOAF 1YITI 1YHQI 3CCQI 5GAHJ 1S72I 1YIJI 3J7ZI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CF5 F;  1VQN I;  3PIO F;  4V19 K;  5GAE J;  1FOX A;  2E36 A;  1YJ9 I;  2ZJP F;  3CC2 I;  3CJT B;  1VQ7 I;  2JQ7 A;  1VQK I;  1VQL I;  3CC4 I;  1VQO I;  2OTL I;  1HC8 A;  1VQ5 I;  3CMA I;  3CCJ I;  2ZJR F;  2K3F A;  3J7Y J;  2FOW A;  1VQ8 I;  2NXN B;  2E34 A;  3PIP F;  2OTJ I;  1VQ4 I;  3CCE I;  1VQ6 I;  3CCR I;  3CCU I;  4IOC F;  1MMS A;  3CME I;  1YJW I;  1VQ9 I;  2QA4 I;  5JVG F;  1YJN I;  3CCS I;  3G4S I;  3CD6 I;  2ZJQ F;  3DLL F;  5GAG J;  1FOY A;  5DM6 F;  3G6E I;  1FOW A;  3CC7 I;  3CCM I;  1QA6 A;  1ACI A;  3I56 I;  1Y39 A;  3I55 I;  5DM7 F;  5GAD J;  1VQM I;  1YI2 I;  3G71 I;  4IO9 F;  3CCL I;  2QEX I;  4UY8 I;  2H8W A;  3CCV I;  1VQP I;  2E35 A;  4IOA F;  1YIT I;  1YHQ I;  3CCQ I;  5GAH J;  1S72 I;  1YIJ I;  3J7Z I; 
#chains in the Genus database with same CATH topology
 3HSE A;  4RMN A;  4CDG A;  2X1C A;  1FYK A;  2M30 A;  3RI4 A;  3CLO A;  1JTY A;  1D1A A;  4EJT A;  4RAG A;  2RC4 A;  1X3Z B;  3J80 Z;  4A3K J;  3MVP A;  3RQI A;  2LKX A;  3GYH X;  2ZSH B;  2V1X A;  2DTR A;  2HQR A;  1MJA A;  2XPW A;  4Y13 A;  3LA7 A;  3LOC A;  3K1N A;  4XBF A;  1ZG3 A;  5FKO A;  1H88 C;  1ZAR A;  1HDP A;  2X1D A;  1LPQ A;  3M9A A;  2A07 F;  4AD9 A;  3HIF A;  5GPC A;  3MFK A;  3KFW X;  1R71 A;  2CWE A;  3HKZ N;  2PX9 A;  5EF6 A;  3GTO J;  1ERD A;  1YX3 A;  2VL8 A;  5KK1 A;  5EG0 B;  3GLX A;  1B9N A;  3RQ4 A;  1IO2 A;  1MMN A;  3BWG A;  1GT0 C;  2CH0 A;  2R5Y B;  3QOE A;  4OWR B;  1SFU A;  3FWE A;  4EAT A;  3UR3 C;  3KEY A;  1CF7 A;  2F4M B;  3LMM A;  1IRZ A;  2BEO A;  1Y1W J;  4U87 A;  4M3E A;  3O8H A;  3B73 A;  1YQA A;  1R1U A;  1I1S A;  3RDI A;  5IYD J;  1XN7 A;  2HPM A;  2W7N A;  5HLI A;  1AWC A;  1R23 A;  1UFM A;  3CCE I;  1Z3Y A;  2ACJ A;  1NG6 A;  4ZZL A;  2Z3Y A;  2QWW A;  3WTW C;  1Z7L A;  2AS5 F;  5FFX A;  3H5R A;  2QLZ A;  3VPR A;  3LSR A;  4OAZ A;  4FIS A;  3FXU A;  1JJ6 C;  4UXN A;  3FKJ A;  3T5X A;  3H1C A;  4JOM A;  3PO3 J;  2ZME C;  5FD6 A;  1YFH A;  3DKY A;  2VPL A;  5C4X J;  4HDV A;  3H35 A;  2LG4 A;  3I71 A;  4MEY F;  1B8I B;  1T0F A;  2ESN A;  2X6Y A;  5F64 A;  4XRS G;  1JUM A;  5GAG J;  3CC7 I;  2DT7 B;  4AM3 A;  1IRX A;  3S1M J;  2IW5 A;  3X2Q H;  1FYL A;  1DDN A;  1OMI A;  1RI7 A;  4LB5 A;  2P7V B;  2N8G A;  3ZR8 X;  5DS9 A;  4WF2 A;  5C4J J;  4IO9 F;  1UJ8 A;  2IXS A;  3ZP5 A;  4I0B A;  2V4J C;  2DDB A;  1FMW A;  5FKL A;  4PJJ A;  3P5J A;  3WOD F;  2E2J J;  2HQ5 A;  2MYS A;  1JGS A;  1YRN A;  4IOA F;  3D5L A;  3ELK A;  2BY1 A;  2M1B A;  1J7K A;  1OCZ H;  2P7C B;  2HTS A;  3BQY A;  1EH6 A;  1W5S A;  2L2O A;  2L9N A;  2R7W A;  1FEX A;  1HKQ A;  2VT2 A;  4PFP A;  1A5J A;  3PO2 J;  4E70 A;  4PGG A;  1XC5 A;  4KMU X;  2RV8 A;  1MGT A;  3GX4 X;  4A5M A;  5K7Z A;  4M3D A;  2VJ4 A;  1VFC A;  2QQ8 A;  3Q9S A;  2ISY A;  4BEH B;  2X48 A;  4I98 B;  4RS8 A;  5D6F A;  2L4M A;  1K4T A;  2OU2 A;  3FF5 A;  3Q3S A;  2LTP A;  3QYE A;  2MC3 A;  3GFL A;  4Y17 A;  2VUM J;  3TL4 X;  2E7W A;  4U0W A;  3V42 A;  5FB2 A;  1VQK I;  2CQX A;  4AU7 A;  4YIF A;  1KU9 A;  2XF5 A;  1WRJ A;  3JW4 A;  4PGH A;  4PSW A;  3K4L A;  1GV2 A;  2FXA A;  4UVB A;  5J1Y A;  2OAZ A;  4Y4R A;  2MSY A;  2A68 F;  3RKX A;  2HVR A;  3JSP A;  3QYB A;  3K0L A;  3L2W A;  5KNL A;  3GUD A;  2GLO A;  2DU9 A;  4PFO A;  1K4S A;  1X4O A;  4LFU A;  1BW6 A;  4JQF A;  3JR9 A;  4DYR A;  3CMY A;  4L9N A;  2MBF A;  4C30 A;  3V4G A;  4PSX A;  1G8X A;  1V55 H;  2XAH A;  2RRE A;  3K6G A;  4CGZ A;  1MH4 A;  5FKN A;  1AOY A;  4HG2 A;  2W48 A;  4MIM A;  2H27 A;  5F0F A;  3OR2 C;  4IOC F;  2EA2 A;  2M4G A;  4HST A;  3LSP A;  4IHW A;  1B9M A;  1DQU A;  2M8G X;  1D1C A;  4GGG A;  4O5V A;  2KDO A;  4IEJ A;  2M34 A;  2IRF G;  1W5C C;  4EJV A;  4A0X A;  4BQA A;  1HKT A;  3G4S I;  1MSE C;  2NVT J;  3IRR A;  3ZCO A;  2LBF B;  2LOO A;  2VIX A;  4EJW A;  4B43 A;  2XB5 A;  1WZ2 A;  5DM6 F;  3EDP A;  3E7L A;  3N05 A;  1RR8 C;  2R7V A;  4U7B A;  4HZF A;  4DZP A;  1LVK A;  2LFB A;  1QPI A;  5BPD A;  3KLO A;  1VQM I;  3M7G A;  2R7X A;  2D1H A;  4QTR A;  3TO6 A;  3CCL I;  1U78 A;  3PFY A;  3GF2 A;  2ZME B;  3M8J A;  3TOB A;  3JAM Z;  4EVI A;  3S93 A;  4PJL A;  4XLA A;  4KIG A;  1WWX A;  2OJE D;  3GME A;  1BBY A;  2FUG 2;  3W6J B;  3F3X A;  1D8K A;  2DAO A;  1E0E A;  1OQY A;  4WXD A;  3MKL A;  5IOY A;  4HA8 A;  4AYB N;  1TQM A;  2VKH A;  5CQE A;  1BIB A;  1SMT A;  1YX5 A;  2Z99 A;  1ETK A;  5F0C A;  2GXB A;  1UHM A;  2QVO A;  3D5R C;  1F1Z A;  3ZQG A;  2ECB A;  5GAE J;  1G3S A;  1HW2 A;  4C2M J;  2DT5 A;  1JKO C;  1MBK A;  1VND A;  2E36 A;  3UKG A;  1E3O C;  5EJC A;  2A3S A;  2RNJ A;  4CYC A;  2FBI A;  1BR4 A;  3CLQ A;  2VN2 A;  3U21 A;  3JSO A;  4I99 C;  4CYD A;  1REP C;  2DPD A;  2KLO A;  1LB2 A;  4UV8 A;  1YW8 A;  4LG3 A;  1ZYR F;  2LSO A;  4NC8 A;  1SD7 A;  1JT0 A;  1WJB A;  1HST A;  2EWN A;  2R7Z J;  1ZGA A;  4P1W A;  4YFX F;  4M74 A;  2LD5 A;  2O61 A;  1DP7 P;  1K78 B;  3ERM A;  1OCT C;  3IRQ A;  2K3F A;  1NG7 A;  4LLL A;  5D5X B;  2X6X A;  1VQ8 I;  1P4W A;  4IZZ A;  4YEL A;  2NXN B;  3AL0 C;  4MO7 A;  5DD8 A;  4V2F A;  1Z67 A;  1XGN A;  2JRT A;  2STW A;  4O3M A;  3FDY A;  2FQ4 A;  2F4I A;  3DP7 A;  1S29 A;  2ELH A;  2NS0 A;  4W97 A;  4XKC A;  4WXH A;  3C7J A;  1R5G A;  5JFR A;  3GFJ A;  5HNH A;  4AID A;  1O3T A;  4HV6 A;  4Y7N J;  3BR0 A;  4ABZ A;  3OYL A;  3DBH B;  3PQJ A;  2VQL A;  4A3E J;  5FRO A;  2VJI A;  4AWX B;  2YR2 A;  2X1E A;  4MTE A;  4FT8 A;  4RAF A;  3ML6 A;  1TQI A;  3IWZ A;  3DLA A;  5HVQ C;  5IP9 J;  1I6X A;  4EGY A;  4CCK A;  2EH3 A;  4BBS J;  4RGU A;  3JRF A;  4ENM A;  3H92 A;  4H0E A;  4A3I J;  1AU7 A;  1T6S A;  1W36 D;  3K1M A;  5FLX K;  4EM0 B;  2CUF A;  3ZQC A;  3BTC A;  2AXL A;  3OYF A;  1B1B A;  3TOA A;  3CUQ C;  1VF9 A;  2NNY A;  4ENN A;  4UUV A;  5IT9 Z;  1VQP I;  2QGU A;  3M3Y J;  4KIT B;  2YS9 A;  1IDZ A;  2Z2S B;  3TO7 A;  2LF8 A;  3GO5 A;  2W85 A;  3K2Z A;  2KIQ A;  3C2B A;  4ZYG A;  1WH7 A;  3MEX A;  4P5O A;  3HZJ A;  4OMY A;  3GVA A;  3H3U A;  4EGZ A;  1U8R A;  1O7L A;  3S1N J;  4BNC A;  1MND A;  2ZNZ A;  4A3F J;  3RCO A;  1UCR A;  1U9N A;  2LKS A;  2YU3 A;  3HOX J;  5E18 F;  1B4A A;  2NAZ A;  3QRF F;  2HYJ A;  2QSG X;  3DEU A;  2QQA A;  4JP0 A;  3IV5 A;  1OR7 A;  4FE7 A;  4RLF A;  2GWR A;  3HUG A;  3DFG A;  2R7D A;  3GXO A;  4DYC A;  5F04 A;  2ZSI B;  4D9J A;  1SEU A;  2DI3 A;  1LJ9 A;  1T08 B;  5CJ9 A;  2EFP A;  4UB6 C;  4D5F A;  2TCT A;  4L5E A;  3TP3 A;  5A2Q Z;  1O3R A;  2DTZ A;  1N77 A;  5M3M J;  3I0T A;  3RPU A;  1RPW A;  1ON2 A;  2OCE A;  3S8P A;  1FY7 A;  5DV5 A;  5LGU A;  4ZDO A;  2VPR A;  3CDL A;  3KIO A;  2KT0 A;  2QCO A;  4DQ2 A;  1TL8 A;  1QBJ A;  1UAA A;  4HPQ A;  5FGM A;  4XL9 A;  3WTT C;  1D1B A;  2HZD A;  4HX7 A;  4BHP A;  1ENH A;  5KAF C;  3VYS B;  3FIW A;  2HVQ A;  2NVQ J;  1EKE A;  3F8C A;  4YFN F;  5B5E C;  3CCU I;  2DOA A;  2EIK H;  5IOZ A;  4IHV A;  2MAB A;  2MH9 A;  1ZLK A;  2ID6 A;  3PUF A;  2GXA A;  2ZXW H;  2VJ5 A;  2D2W A;  1V3F A;  4HDU A;  4KYW A;  2Y0S N;  2A5W A;  2P4W A;  2XPU A;  2VLA A;  2MD5 A;  1LDJ A;  1DP3 A;  1I1G A;  2MLG A;  3DLL F;  2BE5 F;  2QQ9 A;  5D4S A;  3MMY B;  3OMY A;  4EEF G;  2D5V A;  3AL0 B;  1ACI A;  2ESH A;  3IC7 A;  1G2H A;  1ONV A;  3OOP A;  1V4R A;  3HC7 A;  3TO9 A;  4EM2 A;  5H6R A;  5JHU A;  4I09 A;  5IYC J;  1CQT A;  4MGR A;  2G0E A;  2BBY A;  2M8E A;  3I4P A;  3JTG A;  1X2N A;  2FOK A;  1DGR M;  3BR1 A;  4LLN A;  4ZH4 F;  4KIB A;  1A31 A;  3TQN A;  4BE1 A;  3OYM A;  3G2B A;  2EV6 A;  3KZI C;  3BR2 A;  2DBB A;  3CCQ I;  2OZ6 A;  1IN4 A;  4XKB A;  5J8F A;  4F55 A;  3B6C A;  3OYG A;  5E79 C;  2BVM A;  3CJN A;  2NVY J;  3GZ6 A;  1WFX A;  4S05 A;  3CDI A;  3LST A;  3ZXS A;  3Q9V A;  5J1R A;  1JGG A;  5J47 A;  3HOW J;  3CF5 F;  3HG9 A;  2H94 A;  3IKV A;  2BVL A;  1RR7 A;  2DK8 A;  5EG0 A;  4A3J J;  2WAE A;  1RES A;  4BQN A;  2R5Y A;  1MMD A;  4U0V A;  3NAU A;  3EUH A;  1SC7 A;  3U2R A;  2K9N A;  2KQR A;  3L1P A;  4HYE A;  3R61 A;  1JUS A;  2V9P A;  1JKQ C;  1HBX G;  4O6J A;  5GPA A;  1P9Q C;  2GIZ A;  1IJW C;  2Q2E B;  2XAJ A;  2EFQ A;  3K7A J;  2ZFW A;  4D1Q A;  3M07 A;  2HYF A;  4NUB A;  4DIQ A;  4IHY A;  3LSI A;  1U5T B;  2HDC A;  3MZY A;  2V9K A;  1STZ A;  2HKX A;  3NAR A;  3QWL A;  5DCM B;  2R93 J;  3NEU A;  2VKE A;  1Q1V A;  3BQZ A;  4BJT A;  1FBU A;  1OIS A;  1D5Y A;  2WTE A;  5KHD A;  1T56 A;  1WHU A;  4CZC A;  5BMZ A;  1B8I A;  4XMY A;  2PMU A;  4LIU A;  4E7H A;  3DWL E;  2BY3 A;  2F4O B;  4M9Z A;  3J7Y J;  1T95 A;  2HVS A;  1LFB A;  5HS7 A;  5D5U B;  2CQ7 A;  1D0X A;  3E1S A;  3DPL C;  3MKW B;  2ADU A;  4G9Y A;  4A6D A;  4ESJ A;  4G7O F;  1R9T J;  1DPR A;  2LNB A;  4BQQ A;  3D0S A;  2KPM A;  3OYI A;  3J81 Z;  4HNT A;  4QIW N;  1FTT A;  2Z33 A;  5GP9 A;  3HPH A;  2WA0 A;  1B72 B;  4XR6 A;  1GHC A;  4P96 A;  4AIJ A;  1W4M A;  5E3O A;  3NRV A;  3QYF A;  2Y9Z A;  2JA5 J;  4I6Z A;  3KYC B;  4JBA A;  3M4O J;  2DYS H;  2FRH A;  1J9I A;  3JRH A;  2IT0 A;  3T8R A;  1OCP A;  4MFE A;  1TWA J;  4MHG A;  4MQ9 F;  3ZMZ A;  2DOD A;  1Z91 A;  2WAF A;  1D5V A;  3RZO J;  1UG2 A;  2X0L A;  5H2F C;  2EZH A;  1M1E B;  1NH3 A;  1IGN A;  5DM7 F;  1G4D A;  1KA8 A;  3DKX A;  1X1B A;  4F92 B;  4XID A;  5ICE A;  1DUX C;  4UUT A;  3DBR B;  3IH2 A;  3GTJ J;  3DU5 A;  1SFO J;  1UMQ A;  1Z7U A;  2BY2 A;  3PSI A;  4HLX A;  2UZK A;  2G9W A;  3O6B B;  4GO1 A;  5LRR A;  1ZEL A;  2R7U A;  1QZZ A;  1XPX A;  1DU0 A;  3TBI A;  4CCL A;  2B9S A;  4Z6Y A;  1N78 A;  3CP8 A;  1ETO A;  2BOL A;  1Y1V J;  2VKV A;  3MN2 A;  4M6Y A;  3CJQ B;  3I53 A;  2ZXH A;  4KFC A;  4A0Y A;  2HU9 A;  3IL2 A;  2FSW A;  4M6V A;  5JLX A;  4I0A A;  1SD6 A;  1TW2 A;  3FXR A;  3WTZ A;  3DKW A;  3A0H C;  5ILV A;  3WTU C;  1G6N A;  3HRT A;  2I8D A;  5HDN A;  3S14 J;  2O5R A;  5JHF A;  4A2U A;  4E7I A;  2PJR B;  2YX4 A;  1H8A C;  3QPL A;  1MDM B;  4L9T A;  2WY7 Q;  1V5E A;  2VBY A;  2FNP A;  3KX2 A;  3WHC A;  3C18 A;  5E8I A;  5ICC A;  5E3M A;  3UNG C;  4Y52 J;  1W7P D;  2ZJP F;  2V7F A;  4P55 A;  2IAI A;  3WG9 A;  4XKV A;  4RGR A;  2BZT A;  3S1R J;  3VDX A;  2X6W A;  3HOY J;  4YFK F;  3JRB A;  1FTZ A;  3GTK J;  2KIU A;  2O8X A;  1YW9 A;  2IGM A;  3RKY A;  3LL7 A;  1BI0 A;  3A01 B;  2NVX J;  5FLX Z;  1FNN A;  1Y8Q B;  2HGC A;  3KP4 A;  2CUZ A;  3FXQ A;  5EEG A;  4XLP F;  1JJ8 C;  1F4K A;  4XM3 A;  4G8X A;  5B1A H;  1JTX A;  3OOU A;  2V6E A;  4NC7 A;  2LBF A;  2F5F A;  3ABM H;  4XSX F;  4G7H F;  3OSF A;  3IAS 2;  1JHH A;  4LLG F;  3IP4 B;  5M5W J;  3I59 B;  1WSU A;  1VQ6 I;  2E1M B;  1YG2 A;  3RPQ A;  3VSL A;  3QOD A;  2Q0O A;  3HSR A;  2XGC A;  4BXF A;  3CME I;  3GTP J;  4B3A A;  2CQQ A;  3WGH A;  3CUO A;  5IT9 K;  2ZME A;  5FO5 A;  4CSW A;  3AKZ A;  3IKT A;  4CCO A;  1HKS A;  4XN0 A;  1H9G A;  3L9F A;  5F27 A;  3QP6 A;  1HA8 A;  3S1Q J;  5H20 A;  3Q0U A;  3WTS C;  1APL C;  1RUN A;  1IV6 A;  2DA6 A;  4BQO A;  3BT9 A;  2CGP A;  2CU7 A;  3IHU A;  3U1K A;  4E7Z A;  2IA0 A;  4R79 A;  1IN7 A;  2F5V A;  2O6G E;  4JX4 A;  2CSO A;  1OCO H;  2FML A;  2B63 J;  1SFX A;  1UG0 A;  3GW2 A;  4MFD A;  3K4K A;  4C9Y A;  3GFI A;  1DU6 A;  3M1E A;  4LJZ F;  1R49 A;  5DUI A;  2R0Q C;  4UVC A;  3DEW A;  3RKW A;  5FRN A;  2HOS A;  4GRI A;  1PP8 F;  1UHW A;  4G6D A;  3OR1 C;  5KCM A;  2LLK A;  4ZTF A;  2EV0 A;  2M45 A;  3SZP A;  1YIT I;  2IS1 A;  3TDU C;  3SDG A;  1R22 A;  2Z1D A;  4ETS A;  4I01 A;  2XF6 A;  4ZYA A;  3DPU A;  3SFZ A;  1G3Y A;  1TWF J;  2R3S A;  2ME0 A;  1RC9 A;  3T8T A;  4KMF A;  5ILU A;  5A2Q K;  1RNL A;  1LVA A;  2HR3 A;  1QHH D;  4G7Z F;  2K40 A;  5ICF A;  1LEB A;  3QAH A;  3FXK A;  3MCZ A;  5LEK A;  2DFH A;  2PFB A;  4FQG A;  2LKP A;  3KZY A;  1PVE A;  2LY2 A;  2ZKZ A;  1A35 A;  1TC3 C;  1K78 A;  3JCU C;  2ZXI A;  1YJ9 I;  1MJ9 A;  1BM9 A;  5K5Q A;  4UVA A;  1UEL B;  5JVT A;  4XOT A;  4HF0 A;  4D0P A;  2RVC A;  4ZZD A;  1V5G A;  4F91 B;  5TIS C;  1R4N B;  2FD5 A;  2NOG A;  3BR3 A;  3TED A;  4CCM A;  5IT3 A;  2F6C A;  3JRE A;  4F7Z A;  3F22 A;  5FKM A;  2L3D A;  1QHG A;  2WC2 A;  2P5L C;  3HPG A;  1U0J A;  1X2M A;  3KP3 A;  4HNV A;  3MQ0 A;  2XGD A;  1ETV A;  2M0C A;  1OYI A;  1T0F C;  1TTY A;  3FK7 A;  1ETQ A;  3L00 A;  2Z16 A;  3S3M A;  4YIR X;  1W1W E;  1ZTR A;  3WG7 H;  3OYC A;  1PDN C;  4XOR A;  2DMQ A;  5EEA A;  2XAQ A;  1ZK8 A;  2DN0 A;  5FJ8 J;  2HFH A;  3CO7 C;  3QU6 A;  4GFB A;  2Y0M A;  1IXS B;  3K70 C;  1O3S A;  2IEK A;  2K4B A;  2L54 A;  2K85 A;  3I9V 2;  3ASN H;  1XX5 A;  4BJ5 C;  3SYT A;  3T0Y A;  5TGT A;  2OCC H;  2MC4 A;  3IH4 A;  1WJA A;  1ITY A;  1O57 A;  4J00 A;  3GLL A;  3ZN0 A;  4FCY A;  5CVJ A;  3F9K A;  1SAU A;  1R58 A;  4HX8 A;  3G6E I;  4OIN F;  4HLY A;  2NS7 A;  2UWM A;  4BYY A;  1IXR C;  1JT6 A;  3TW7 A;  4L0Z B;  1S3J A;  1IZ1 A;  2HYG D;  3BDD A;  2VXD A;  1K6O A;  2LDU A;  2HDW A;  3I54 A;  2VON A;  2KIF A;  2Y31 A;  1WI9 A;  3O2P E;  2BY0 A;  3VYT B;  3G71 I;  4GDF A;  4X0G A;  1D8J A;  2M7B A;  1QVT A;  1TT0 A;  3BTJ A;  3EQL F;  3T1B A;  5HLG A;  3CCV I;  1X1D A;  3E6C C;  3F8F A;  1K6Y A;  1SD4 A;  1HCR A;  3CDH A;  1MBE A;  1EH7 A;  2L7F P;  4MLO A;  1UB9 A;  3FBI B;  1IUY A;  5C44 J;  1FBQ A;  1HDD C;  1N25 A;  4IRI A;  3HJE A;  2XC7 A;  3MKZ A;  5K7F A;  2RNG A;  3CCY A;  4B48 A;  3SJM A;  2RN7 A;  3E3V A;  4DNC A;  4EQQ A;  2EZI A;  3J7Z I;  3ZMD A;  5J4V A;  3EUK L;  4MTD A;  1YS6 A;  3S32 A;  5IPA A;  1S7O A;  3PIO F;  3ABK H;  4DZJ A;  1FBS A;  3FIS A;  3BZC A;  1OKR A;  5GTH C;  4FTH A;  3TW6 A;  1KQ8 A;  1FPQ A;  3I3L A;  3W3C A;  5M5Y J;  2M4K A;  3EPZ A;  4BDZ A;  2VT3 A;  1YO5 C;  4FE4 A;  2H1L A;  3G1L A;  2LVS A;  4IJA A;  1VQ7 I;  4J01 A;  2XSJ C;  1IF1 A;  5F6F A;  4N9I A;  2K02 A;  2L0K A;  1ZQ3 P;  2FU4 A;  3J81 K;  4OIP F;  1YS7 A;  3HRS A;  3NQO A;  4DOZ A;  4GYI A;  3BCB A;  2ZB9 A;  3JTH A;  4IXA A;  1P7J A;  5ERI A;  2K9L A;  3VSK A;  2A6E F;  3L09 A;  3E6D A;  4OOI A;  2GOX B;  3W2A A;  3S16 J;  1AKH B;  5BS6 A;  1KQ9 A;  4RB0 A;  2JPB A;  1W7P B;  4FET A;  5E1Z B;  4YRV A;  1U8B A;  2K3P A;  3CCJ I;  3SXY A;  2DMU A;  2VE8 A;  4FX0 A;  3JRD A;  1G3W A;  1QNT A;  1P2F A;  5E20 A;  5TJJ A;  3OL4 A;  2UUZ A;  3PIP F;  1FT9 A;  4N0B A;  2DW4 A;  2NNN A;  2EA4 A;  4CHU A;  2EK5 A;  2CS3 A;  1YTY A;  2PQ8 A;  1X3W B;  2E60 A;  4UUS B;  1VTN C;  1E3H A;  2LY9 A;  3BR5 A;  4FX4 A;  4NB5 A;  3HXL A;  1X3U A;  3QOP A;  3H5N A;  3Q0W A;  1DPU A;  1X58 A;  1WJ5 A;  1GUU A;  2JA8 J;  2ETH A;  1BOB A;  2D45 A;  4IQJ A;  4PK4 A;  4A0Z A;  5HOD A;  2L9R A;  4CUG A;  4BL0 B;  2JN6 A;  2W82 A;  3DQV C;  3O3K A;  2P8T A;  1ETX A;  1LQ1 A;  4WWC A;  1BN5 A;  2ZNY A;  4ZJZ A;  1PJR A;  3GEZ A;  2KRC A;  2PMZ N;  4D5C A;  4E6K G;  1JI8 A;  3FX3 A;  2V6C A;  1BR2 A;  2BXY A;  2HDD A;  4N4O B;  4CCN A;  3MZ8 A;  1S7A A;  5AIP A;  1P92 A;  4R8H A;  4PCQ A;  3CF2 A;  3WU1 B;  3HGY A;  1R5H A;  5E1W A;  4BH9 A;  2IJL A;  4L18 B;  4S0H B;  2K9Q A;  3SQN A;  4DBQ A;  3JRG A;  2VB6 A;  1F5T A;  5EZG A;  3HTU A;  2XAU A;  3OY9 A;  3FKI J;  5HDK A;  3ECH A;  4II2 A;  1IG7 A;  3F6O A;  1GV5 A;  2E5N A;  2Q2E A;  2HOT A;  2DOE A;  2PG4 A;  2MGQ A;  3FXJ A;  2XB0 X;  4B44 A;  1KYW A;  1T38 A;  2MD0 A;  2GAU A;  2JMW A;  3LSK A;  1U5T A;  4A3M J;  1Z6R A;  5DCM A;  3ZGK A;  5EGO B;  2IVM A;  2IPQ X;  2KJB A;  2EB7 A;  1IC8 A;  2P0W A;  2VOD A;  1J5Y A;  1WH5 A;  3RTR A;  2WBM A;  3KP6 A;  3A0B C;  1DGW Y;  2R7Q A;  2BW3 B;  1ZLJ A;  1KON A;  2OF7 A;  3E6B A;  3V7S A;  5LGN A;  2DA4 A;  2E1C A;  1LDD A;  2KHM A;  3SZT A;  4L9J A;  1FLI A;  1ZKG A;  5LGT A;  3KCC A;  3L2C A;  2FMY A;  2EBI A;  5DTD A;  4ON0 A;  1Y6I A;  4LG0 B;  3JRC A;  1ZRE A;  4LMY A;  4KN7 X;  1QRY A;  1B72 A;  2E1N A;  3CMA I;  1WPK A;  2P5V A;  3LQR A;  4YEJ A;  1ZR2 A;  4IKF A;  1J2X A;  1YW7 A;  2RDP A;  2BHY A;  3E6M A;  1OYW A;  5JLW A;  1Z05 A;  4XOP A;  2ZJR F;  2NRA C;  2K27 A;  4RM2 A;  2CO5 A;  2E34 A;  2MW8 A;  3R6S A;  3OL3 A;  2K4J A;  2X6O A;  3B6A A;  5E3N A;  1N75 A;  1X1A A;  2W24 A;  1J75 A;  4KIS A;  2YX7 A;  3F72 A;  2DA1 A;  2JJ7 A;  1XSD A;  2VBX A;  2BXZ A;  3S15 J;  3OIO A;  1RUO A;  5DDG A;  4I02 A;  2K9M A;  4A12 A;  1I3Q J;  2OD5 A;  3HSF A;  2ELJ A;  2R7S A;  1HLV A;  4LB6 B;  3H9J A;  1KU3 A;  2XV4 S;  6PAX A;  2CW0 F;  1SMY F;  1HOM A;  3I64 A;  3LA2 A;  2C6Y A;  1HQC A;  3IUO A;  2PI0 A;  2VBZ A;  3DTK A;  4EJU A;  1RRJ A;  2EQR A;  1E3P A;  2JK3 A;  2PJR A;  1LNW A;  2VI6 A;  3VFZ A;  2LP0 A;  2V1N A;  3GZN B;  1MDM A;  3SDB A;  3ZPL A;  2EIM H;  1QVU A;  4AC0 A;  2RQP A;  5D6E A;  2E1O A;  1KZH A;  1TWH J;  2F5C A;  2DA7 A;  4OU0 A;  1XCB A;  1AA7 A;  1KQ0 A;  2QM3 A;  2XAF A;  3PNY A;  4CIC A;  3BJA A;  3H36 A;  4KT5 C;  3ZQF A;  4U88 A;  1QU3 A;  1FP1 D;  4XLF A;  1V5F A;  5B3S H;  3ZQ7 A;  1ORK A;  4CZZ A;  4RM3 A;  3ISP A;  3A01 A;  2X9D A;  2X51 A;  1G59 A;  3RIR A;  5AIQ A;  3PFI A;  5FRM A;  1XDU A;  1T8I A;  1OPC A;  2L7K A;  1XG1 A;  3DTE A;  1Z6T A;  2DJI A;  2HZT A;  1XMX A;  4UHT A;  4WK8 F;  2W00 A;  4HX4 A;  2GA2 A;  4GXO A;  4QPO A;  2DA5 A;  2PN6 A;  3I59 A;  4YG2 F;  1VQL I;  3LAP A;  3E5U A;  2V1D A;  1HSJ A;  3BP8 A;  4L9V A;  4N9H A;  1W0T A;  3GTQ J;  4UNO A;  2JUC A;  2OTL I;  1F43 A;  1QO0 D;  3GTM J;  4ZYE A;  1XDS A;  3CP2 A;  2BHZ A;  3HB9 A;  1TP4 A;  4X1E A;  5K5R A;  1BJZ A;  4FAS D;  1FIP A;  2IGK A;  1OLT A;  2ZXJ A;  4J19 A;  3DF8 A;  3BG6 A;  3CUQ B;  2Y48 A;  4DJA A;  2O9L A;  4GYG A;  3PSF A;  2F5E A;  2ZO4 A;  1GVJ A;  1HW5 A;  2QSH X;  3CTA A;  2IGO A;  1MBJ A;  2JSC A;  2UXN A;  4PJN A;  4L0Y B;  3OYK A;  1TWG J;  3PQK A;  3KP2 A;  5LHI A;  2EFW A;  3REO A;  4CXF A;  3S2H J;  1E2X A;  3ABU A;  2LF7 A;  1PUF B;  4HAM A;  1YYV A;  3TP0 A;  3RYR A;  3LFK A;  3K9T A;  2UV1 A;  2XAS A;  4KUM A;  4A6E A;  4A3D J;  1OFC X;  5ILS A;  1AHD P;  4E7K A;  2HS5 A;  4M9X A;  3KLN A;  3OIP A;  1T39 A;  1WJE A;  2XRN A;  3C2H A;  3CJR B;  1S7E A;  3KP5 A;  2VOP A;  2PEX A;  2CFO A;  3CZ6 A;  3RZD J;  5EYR A;  3BOQ A;  3O8G A;  4EJO A;  1GDT A;  4LK0 F;  4ANJ A;  3ERE D;  2L01 A;  2OPT A;  1ZGW A;  1I27 A;  2KDZ A;  2K5C A;  3QQA A;  3WE2 A;  1Q1H A;  1MD0 A;  3E97 A;  3GWZ A;  3F6V A;  5HLT A;  4R1H A;  5FLV A;  3WGG A;  1EA3 A;  1F36 A;  2I5U A;  3HRU A;  2E2H J;  2QBY B;  3EET A;  3BJO A;  1HF0 A;  2HXO A;  5GAD J;  2D1V A;  2R7F A;  5CVI A;  2L7M P;  4BXU A;  3KE2 A;  2CW7 A;  2DPU A;  3AG3 H;  3EUH C;  4UY8 I;  5F1J A;  3K4N A;  5D5W B;  2HEO A;  1U6G A;  3COA C;  4Q5S F;  2DDA A;  4RBO A;  2KZG A;  3SEZ A;  3V8K A;  1GLN A;  2J5P A;  3FMQ A;  3FHZ A;  5CKT A;  4ITV A;  2KIS A;  2RGV A;  4Q4Z F;  1TZL A;  2CUE A;  1Z0X A;  3ZN1 A;  4ASN A;  2IS6 A;  2K7L A;  1VQN I;  1JUP A;  4BEH A;  4KA4 A;  4V19 K;  2UXX A;  2HOA A;  2R4G A;  5H6Q A;  3HOS A;  2EFO A;  2HQA A;  2R5Z B;  1NTC A;  1YE9 A;  1MBH A;  2FBH A;  1JKR C;  3P9I A;  4Y15 A;  1LE8 B;  4BY1 J;  4Q47 A;  1ZGJ A;  3U9G A;  4OIQ F;  5L3D A;  3S2W A;  5L3G A;  3I4N J;  1BR1 A;  2QKL B;  2CUJ A;  4XON A;  2VJJ A;  5CQG A;  1FSH A;  3MKY B;  2DFI A;  1CGP A;  1U9O A;  4XQF A;  4A3L J;  1JE8 A;  4YII A;  3I5U A;  5M5X J;  1R4M B;  2Z9O A;  1FX7 A;  1LDK B;  2EV5 A;  3GCM A;  4Q48 A;  1IN5 A;  1IAW A;  2OUM A;  1BIA A;  1TW3 A;  2WV1 A;  2JT1 A;  3DBL B;  1H89 C;  3HRM A;  3G1O A;  1D3Y A;  3QP5 A;  4DW6 A;  2EIL H;  1JKP C;  4ZTJ A;  1LKX A;  4IVN A;  3A02 A;  3R0J A;  4M9S A;  5J4Y A;  1WCM J;  5BNG A;  1SFK A;  3OS2 A;  1S9H A;  1VQ4 I;  3A4C A;  5JI6 A;  5D8L B;  4M3F A;  2PLY A;  4K2E A;  1PP7 U;  2X85 A;  2DMN A;  1A04 A;  2F48 A;  3K4J A;  3FXL A;  1RKT A;  5EEH A;  2NS8 A;  2JA6 J;  3LSM A;  2P5K A;  4XNF A;  1MNE A;  2E71 A;  3VOE A;  4CO8 A;  3HL2 A;  1SVL A;  5J40 A;  3KYL A;  3CQZ J;  5HLH A;  2GQQ A;  4UB8 C;  4OAY A;  4M71 A;  3I55 I;  1XCV A;  1A36 A;  1FOK A;  4XLE A;  1BOA A;  4IRH A;  2A61 A;  2ID3 A;  2DCE A;  3ASO H;  1EV7 A;  1WJC A;  4IL6 C;  4II3 A;  1TQP A;  3W6K B;  1I50 J;  3A2K A;  3I4M J;  1SVM A;  3AFH A;  2QEX I;  4XLH A;  3K70 D;  3BTI A;  5EDN A;  1H9T A;  5TRD A;  4NQW B;  1BI1 A;  2L9V A;  1S8N A;  2QZ8 A;  2XGX A;  5E3L A;  3L2Q A;  3LWF A;  4E4H A;  5HOO A;  4RAZ A;  5J3L A;  4BJ6 C;  2DXI A;  2IA1 A;  2VOO A;  3A1Y A;  2AQF A;  3I58 A;  4KNY A;  3F8M A;  3JRI A;  1JHF A;  2JTV A;  3HOV J;  4MEX F;  2VBW A;  4P9F A;  2ISZ A;  4RGS A;  2KL4 A;  2A5Y B;  3IAM 2;  1BI2 A;  1ZG1 A;  1R36 A;  1ZAO A;  5L3B A;  1AKH A;  4RA2 A;  4ENJ A;  1P7I A;  1W7P A;  4DGW B;  2EIN H;  2ZFU A;  1FOX A;  1QPM A;  4BS9 A;  2XUB A;  3QPT A;  2K9S A;  2KJC A;  3K2A A;  3F8B A;  3NWS A;  1HW1 A;  3E0J B;  1EH8 A;  2VC1 A;  2IS4 A;  4E7J A;  1B6A A;  1R6R A;  4JYK A;  2HWV A;  2VKD A;  2V9V A;  1QZE A;  2CJJ A;  3OIQ A;  1BL0 A;  3S3N A;  1I3A A;  1V54 H;  3GBG A;  4UUS A;  4WXC A;  2VC0 A;  1FYM A;  4G6T B;  4RB1 A;  2ZBK A;  2OBP A;  1FSE A;  2FF4 A;  3U1D A;  2QQB A;  3H5A A;  4B3X A;  3BRO A;  1R00 A;  5LBQ A;  1K79 A;  2L5Q A;  4C3I J;  4XRF A;  1Y0N A;  4N4N B;  4PJ0 C;  4E7S A;  3OYN A;  4B4C A;  5CLS A;  3VYU B;  2FE3 A;  1LFU P;  1OCC H;  3V7C A;  2YPR A;  1R5I D;  1FC3 A;  4F52 A;  5CVR A;  4IRG A;  3KYD B;  5K1Y A;  3J7A Y;  1IN8 A;  2KKO A;  3H0D A;  2VQH A;  3TKY A;  2W1O A;  1YJW I;  1X4P A;  1ZR4 A;  1TLH B;  2DLL A;  3MAJ A;  4V2G A;  1PYV A;  2CYY A;  2QKM B;  3WU0 A;  2DFF A;  2Y75 A;  1EJ9 A;  2CV2 A;  2Q1Z B;  4L5I A;  4BDY A;  4BUP A;  3Q0V A;  2WAQ A;  2Y0S A;  3DPT A;  4ZDP A;  5ICG A;  4ENK A;  5E17 F;  4HV5 A;  4JX6 A;  2YUS A;  2XRL A;  3WTY C;  4OIR F;  1UST A;  3I56 I;  1J0R A;  2O03 A;  3H3Z A;  4MQV A;  4OMZ A;  3TGN A;  4BGD A;  5HS8 A;  2GBY A;  1LFP A;  5HDG A;  5B66 C;  5LHH A;  2H6C A;  4KN4 X;  5DYM A;  5EGO A;  4HNU A;  1QQI A;  2DMT A;  1K83 J;  2NYX A;  4KIC A;  2JSP A;  2OZU A;  3AAF A;  5IY5 H;  2JVH A;  1O4X A;  1X19 A;  1XGS A;  1YLF A;  1WKM A;  1ZRF A;  1MIJ A;  1P4X A;  2BW3 A;  2QYO A;  3J7A O;  3QPH A;  4A5N A;  2L02 A;  3GZ5 A;  1ZRD A;  1VZ0 A;  3ECO A;  1IV8 A;  2DQL A;  3MZH A;  2YU9 J;  3ZOB A;  2HNH A;  3E5Q A;  1SVO A;  2VQC A;  1TWC J;  3Q5F A;  4F93 B;  1USS A;  1YIJ I;  4L5J A;  2EJR A;  1R1V A;  3VOD A;  5F0H A;  4HF1 A;  2CMP A;  4LG0 A;  1Y56 A;  2M2E A;  2E5Z A;  2JZY A;  4XN3 A;  3OYB A;  2E19 A;  3EYY A;  4B09 A;  3SEQ A;  5LHG A;  3V7R A;  2FA5 A;  1KU7 A;  4U0Y A;  3NWT A;  4BAC A;  3L2V A;  2K86 A;  3DEE A;  1PUE E;  3PNT A;  2IGN A;  3AG4 H;  3L2R A;  2BV6 A;  4FHT A;  3CC2 I;  2X4H A;  3K4B A;  3KP7 A;  3WTX C;  4Y3O A;  4BU2 A;  4BAY A;  4WCG A;  5LEJ A;  1WQ2 A;  4HSR A;  2EIJ H;  2GXG A;  1T98 A;  4TV7 A;  4A3C J;  3OS1 A;  1O7F A;  2HQN A;  2DT6 A;  2R7O A;  3H9Q A;  2ME6 A;  3C3W A;  4BHC A;  1WVR A;  4A3B J;  3HTS B;  3TMO A;  5K7H A;  3BZ6 A;  2WWY A;  3KET A;  4G12 A;  4IHS A;  3SHF A;  2FOW A;  5DEQ A;  4UV9 A;  2CFX A;  2L7Z A;  3FK6 A;  1ZRC A;  5D5V B;  2Y69 H;  3ZMS A;  3OYE A;  2XSD C;  4XRS A;  3RKQ A;  1B59 A;  2MLK A;  1MSF C;  1TNS A;  4D7M A;  1KGS A;  1MMS A;  4HBL A;  4HW0 A;  3G73 A;  2M5W A;  4CH7 A;  1MMG A;  2WV0 A;  2E2I J;  1R1T A;  4KIF A;  1RKW A;  1F9N A;  4S04 A;  5F08 A;  1YJN I;  3FBN B;  2XIG A;  1CF7 B;  2RKH A;  3GTG J;  2JPC A;  1ULY A;  1R7J A;  2WY8 Q;  3E5X A;  1K61 A;  3LNQ A;  1J09 A;  5LRS A;  2LR8 A;  3CD6 I;  5HS9 A;  3WE3 A;  1FJL A;  4AIH A;  3KEO A;  3N97 A;  4QLC U;  1FOY A;  2VAS A;  2XVC A;  1FOW A;  3D5S C;  3BC8 A;  1C0W A;  2COB A;  1G3T A;  1TT5 B;  2KMU A;  4G6Q A;  5C3E J;  3F23 A;  3HHH A;  3OWT A;  2KRH A;  1NHA A;  1FIA A;  3G3Z A;  3DTI A;  1WJF A;  4F3Q A;  4M3B A;  2BYV E;  1QGP A;  1UZC A;  4NNJ A;  2QF7 A;  1BW5 A;  3AG1 H;  2HKO A;  4XKW A;  4QPQ A;  1X1P A;  4ZC3 A;  2OQR A;  5CYV A;  3ONQ A;  2DOF A;  2XRO A;  2XPV A;  5GTI C;  2DJN A;  2V79 A;  4MNU A;  3WTV C;  5LFA A;  2LK2 A;  3K4M A;  2LRE A;  5D4R A;  2GIV A;  2P81 A;  1ON1 A;  2RQQ A;  2IA2 A;  3PUB A;  4BKX A;  4I7H A;  5KVR A;  3OYA A;  1A6I A;  3LAJ A;  3ABL H;  3EUA A;  2W4S A;  3RSN A;  1TNT A;  3VB2 A;  4CA0 A;  2WAD A;  3IWF A;  2A05 A;  2WB1 A;  3CUQ A;  3SZG A;  1YRN B;  2CV1 A;  2R92 J;  1IRG A;  3CES A;  1QZY A;  1OJL A;  1FMV A;  3CJT B;  3IH3 A;  1U3E M;  2O0Y A;  2G7H A;  4XRM A;  4M3G A;  4W1U A;  3LSG A;  3BG9 A;  3V8L A;  4CCJ A;  1HXD A;  2MH2 A;  1MJB A;  4M72 A;  4PDK A;  3H3V K;  1E17 A;  2LRD A;  3OSG A;  1PUF A;  3CC4 I;  1EF4 A;  2GA1 A;  3W6V A;  5BQT A;  1VQO I;  4BE2 A;  2TRT A;  2FX0 A;  2VE9 A;  4PZJ A;  5D8K B;  4GCV A;  3ZQH A;  3ZQL A;  4LIV A;  4DYQ A;  3GTL J;  3M1C A;  1SD5 A;  2XHK A;  4HEA 2;  5DCF A;  9ANT A;  3ZRG A;  4M73 A;  3RPU D;  2XKP A;  2M9H A;  4E7L A;  2PJP A;  4C2T A;  2Y2Z A;  2MA3 A;  3KEQ A;  3C1D A;  1Z1D A;  3W2W A;  2IBD A;  5CPR B;  1XSX A;  3MD2 A;  3ULQ B;  3DU6 A;  2QBY A;  4HF2 A;  1BA5 A;  1BC7 C;  1U2W A;  5L3E A;  2CW8 A;  2DK5 A;  2XAG A;  3PM1 A;  2F2E A;  5L3F A;  4AVZ A;  2LY1 A;  2P6T A;  2DA2 A;  4C2U A;  3J80 K;  3EYI A;  4XLN F;  3P7N A;  1VQ9 I;  4NHJ A;  4RGX A;  4HQM A;  5JVG F;  2XGE A;  1IXC A;  1MZB A;  3HKZ A;  3SFI A;  1MBG A;  1IRF A;  2GZW A;  2H09 A;  2CQN A;  2A6T A;  2ELK A;  1MMA A;  2DYR H;  4WX9 A;  2EZL A;  4IPA A;  3W2V A;  1YIO A;  3R0A A;  2ICW G;  1J59 A;  3LSH A;  1Y0U A;  2Z5U A;  3K69 A;  2FQ3 A;  1Y39 A;  3LQQ A;  4B8X A;  4RB3 C;  3WGI A;  1U5T C;  4KDP A;  2G7U A;  1FZP B;  2STT A;  3H0G J;  1YI2 I;  2LYC A;  4RB2 C;  3BCA A;  1Z77 A;  2R5Z A;  2HI3 A;  2CG4 A;  5E8G A;  3HOZ J;  3R4K A;  3N4M A;  2O3F A;  3HGG A;  3G1M A;  5FLM J;  2H1K A;  3S2D J;  5IP6 A;  1S6L A;  4BBR J;  3K10 A;  1H0M A;  1LE8 A;  2O8K A;  2AHQ A;  2Q8K A;  3HDD A;  1I6H J;  3M8F A;  3K1P A;  2QUF A;  1MH3 A;  1XS9 A;  1KU2 A;  1L0O C;  1S72 I;  1O3Q A;  4LD5 A;  2YSR A;  1MNM C;  3HOU J;  2ZJ2 A;  1SFE A;  1X1C A;  1IUF A;  3HYI A;  2OC6 A;  3L7W A;  3BTL A;  3GFM A;  4I76 A;  2Y9Y A;  1OR7 C;  5IP7 J;  3DCF A;  5FFZ A;  3WU2 C;  2CQK A;  2E7X A;  2OQG A;  3KPH A;  1WI3 A;  3OYD A;  2XF7 A;  2R7R A;  2DQR A;  2LC2 A;  3DV8 A;  1XTA A;  4IQ4 A;  3AG2 H;  4BY7 J;  3HEF A;  2GOM A;  3JRA A;  1XGM A;  2AO9 A;  3F8N A;  2DMP A;  4DBR A;  3LA3 A;  4NBQ A;  2WAQ N;  5IYB J;  5CVV A;  2EZK A;  3FMS A;  1ZN2 A;  2R7T A;  4ZDL A;  2DA3 A;  4PUS A;  2MFZ A;  2V26 A;  4CYC B;  1T2K A;  2H8R A;  3LSJ A;  1NK3 P;  2JA2 A;  2NOJ B;  2OTJ I;  3OV8 A;  3BG5 A;  1W36 C;  2JA7 J;  2JRM A;  2OA4 A;  3CCR I;  3BZK A;  3ZMT A;  2A69 F;  1BC8 C;  3V8J A;  3OYH A;  1SAN A;  3F21 A;  2M7A A;  1ZH5 A;  2NVU B;  5B1B H;  3FZV A;  4C3H J;  3B02 A;  4KJZ A;  2VQG A;  2W57 A;  2QA4 I;  3WHB A;  4JK1 X;  1ETY A;  1D0Y A;  1L3L A;  2KFD A;  2FNA A;  2H6B A;  3CCS I;  4I2O A;  4NQW A;  2W84 A;  4D7N A;  3ZQQ A;  2ZJQ F;  1XB4 A;  2ECC A;  2IP2 A;  4OIO F;  2AQE A;  3HOT A;  5LLQ A;  3ROU A;  3CCM I;  1I5Z A;  2L9S A;  4BXX J;  3H9G A;  1BI3 A;  4ESF A;  5J6X A;  2XDV A;  4NC6 A;  2KRF A;  2PMH A;  2CRG A;  4A93 J;  2KP6 A;  4EM1 A;  3L2U A;  1XSV A;  2W25 A;  1VI0 A;  1OYY A;  3RJP A;  1BJA A;  1XD7 A;  2H8W A;  5AON A;  3HM5 A;  4B1R A;  2QEN A;  3BPX A;  1NK2 P;  2IS2 A;  2JVG A;  1YHQ I;  1KYZ A;  4X6A J;  1P4A A;  3P9C A;  1IDY A;  4EV0 A;  4P9U A;  5L3C A;  2F5D A;  2EFN A;  2HPI A;  2L4A A;  3P9K A;  1WGX A;  2E1M C;  1RIO H;  5KAI C;  4LIT A;  4AIK A;  3VEP A;  4Y33 A;  4U7D A;  5EZH A;  2ZC2 A;  2KZV A;  4M6X A;  3ESW B;  2DFE A;  4JX5 A;  1ETW A;  1IW7 F;  2A6H F;  5BOX A;  2JUG A;  3KZZ A;  1FP2 A;  4XSZ F;  5M3F J;  3BG3 A;  3ZQI A;  2LH9 A;  4AUX A;  1UHS A;  2BGC A;  3FHN A;  1D0Z A;  3A03 A;  3HBL A;  3RYP A;  3MWM A;  5J8C A;  1W5T A;  3K4C A;  3LFU A;  1T33 A;  2EPF A;  4AVP A;  1W0U A;  1MKM A;  2RAE A;  4XIC A;  2JQ7 A;  5ED4 A;  4ZYD A;  5K5O A;  3BR6 A;  4LK1 F;  3TDZ C;  3DXJ F;  2B0L A;  4XK4 A;  4IX7 A;  1XGO A;  3VYR B;  4EMS A;  1Z9C A;  2HOE A;  1TBX A;  3CMM A;  1HC8 A;  2LMD A;  3BG7 A;  3BY6 A;  4Z2Y A;  3BPV A;  4BE0 A;  1I39 A;  2JWT A;  2OV7 A;  2GM4 A;  4AYB A;  1VQ5 I;  3JAM K;  5LD2 C;  3VWB A;  1JXS A;  3BLY A;  3PL8 A;  4RLQ A;  1LUJ B;  5E1X A;  2CV0 A;  4A69 C;  1GXP A;  2PBI A;  4B47 A;  1MW7 A;  3OYJ A;  3CO6 C;  3HUG B;  4IHX A;  2COM A;  2P6S A;  1A6Q A;  2XKO A;  1OCR H;  4LGW A;  1GVD A;  3FM3 A;  2HTJ A;  2KIM A;  3F0C A;  5HNF A;  1ZHF A;  4HOB A;  2MG4 A;  1ZG5 A;  1MBF A;  4H4K C;  4ESB A;  2AXT C;  1LEA A;  4IF4 A;  3ABT A;  2ZCW A;  3PNV A;  4C3J J;  3QPS A;  5FD5 A;  2FEZ A;  3FXO A;  4RDU A;  5BPI A;  1XMK A;  2VXZ A;  3ZMU A;  3HHG A;  2O7O A;  5DUK A;  2FJ1 A;  5F1R A;  3OS0 A;  3R60 A;  5J1U A;  1FWZ A;  2I10 A;  1Z21 A;  1IN6 A;  2M87 A;  5CVU A;  1ODD A;  1YOV B;  2M3A A;  3FXM A;  4QSH A;  1QA6 A;  1WJD A;  2FBK A;  3C2G A;  2DO7 A;  4PJM A;  4XLC A;  5JR3 A;  4LOC A;  2WB1 N;  1Y8R B;  1S5L C;  2PMZ A;  3PJR A;  3FMR A;  2QSF X;  5DD4 A;  3S17 J;  3S3O A;  4G94 A;  5FKK A;  3ZMV A;  1Z3X A;  1K7A A;  4IHT A;  2HXI A;  1RZ4 A;  2E35 A;  4HRI A;  3D1N I;  2J5O A;  4NDL A;  2M0M A;  1SAX A;  2TDX A;  4RAY A;  3BJ6 A;  4A3G J;  2Y30 A;  1POG A;  4QWQ A;  5GAH J;  1P6R A;  3QU3 A;  3M8E A;  4ZYH A;  1RET A;  3FM5 A;  1GXQ A;  4HQE A;  1XMA A;  2V1U A;  2B7E A;  4KT6 A;  4BHB A; 
#chains in the Genus database with same CATH homology
 3CF5 F;  1VQN I;  3PIO F;  4V19 K;  5GAE J;  1FOX A;  2E36 A;  1YJ9 I;  2ZJP F;  3CC2 I;  3CJT B;  1VQ7 I;  2JQ7 A;  1VQK I;  1VQL I;  3CC4 I;  1VQO I;  2OTL I;  1HC8 A;  1VQ5 I;  3CMA I;  3CCJ I;  2ZJR F;  2K3F A;  3J7Y J;  2FOW A;  1VQ8 I;  2NXN B;  2E34 A;  3PIP F;  2OTJ I;  1VQ4 I;  3CCE I;  1VQ6 I;  3CCR I;  3CCU I;  4IOC F;  1MMS A;  3CME I;  1YJW I;  1VQ9 I;  2QA4 I;  5JVG F;  1YJN I;  3CCS I;  3G4S I;  3CD6 I;  2ZJQ F;  3DLL F;  5GAG J;  1FOY A;  5DM6 F;  3G6E I;  1FOW A;  3CC7 I;  3CCM I;  1QA6 A;  1ACI A;  3I56 I;  1Y39 A;  3I55 I;  5DM7 F;  5GAD J;  1VQM I;  1YI2 I;  3G71 I;  4IO9 F;  3CCL I;  2QEX I;  4UY8 I;  2H8W A;  3CCV I;  1VQP I;  2E35 A;  4IOA F;  1YIT I;  1YHQ I;  3CCQ I;  5GAH J;  1S72 I;  1YIJ I;  3J7Z I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...