1VQ4I

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 14
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vq4I00
3CC4I 4IOAF 1HC8A 4UY8I 3I55I 5GADJ 3G4SI 2NXNB 2ZJQF 2ZJRF 3J7ZI 2E36A 1VQNI 1YIJI 3CC2I 2OTJI 3CMEI 1YI2I 5DM6F 1YJ9I 2ZJPF 1FOWA 3CCEI 3CCUI 1VQLI 2E34A 2QA4I 2E35A 3CCVI 4IOCF 1VQOI 1VQ4I 1VQMI 5GAEJ 3CMAI 2OTLI 1VQ6I 1VQ5I 1FOXA 3CCRI 3PIOF 1VQ7I 3CCQI 3CC7I 2FOWA 1MMSA 3CCSI 3DLLF 3CJTB 3I56I 3CCLI 1VQPI 1S72I 1YHQI 2QEXI 1FOYA 3G6EI 3PIPF 3CCJI 1YJWI 1QA6A 1VQ9I 2H8WA 4V19K 3CD6I 5DM7F 2JQ7A 5GAGJ 4IO9F 3J7YJ 5GAHJ 5JVGF 1YITI 3G71I 3CF5F 3CCMI 1Y39A 1VQ8I 1ACIA 2K3FA 1VQKI 1YJNI
chains in the Genus database with same CATH superfamily
1O7LA 1VZ0A 2TCTA 1HKTA 4XMYA 4ZZLA 1K79A 4XRSG 4XSZF 3EQLF 1OLTA 5A2QZ 1VNDA 6PAXA 2XRLA 1VQ4I 2DCEA 1IC8A 3IWZA 2HR3A 3JRHA 1OYYA 2MYSA 5E8GA 3PIOF 3CC7I 3PL8A 2OQRA 4ZDLA 3FF5A 3LWFA 3K70C 2M7BA 3FKIJ 3BY6A 4L5JA 2MLGA 3K6GA 1WPKA 4R8HA 2ME0A 4A3MJ 4J00A 1J9IA 2JPBA 4MFDA 5GADJ 3QP6A 2XASA 4C3JJ 4L5IA 3QPTA 4A3CJ 3W6KB 2GQQA 5HLIA 2K9MA 2GAUA 2JRTA 2E2IJ 4RAZA 3VPRA 5DV5A 3IC7A 2DT6A 1U9OA 2F4OB 4IZZA 2A61A 3HG9A 4GO1A 1NK3P 4HX8A 2R7RA 1R1TA 2XB0X 4NDLA 2K7LA 1ETKA 4AC0A 4AIDA 5IP9J 3F8CA 1G3TA 3PSFA 2IJLA 4JX4A 2Y31A 4U0WA 3OYFA 4PFPA 2QSGX 2CUFA 1T33A 4BKXA 2AO9A 2LRDA 1E3OC 1DQUA 1V3FA 2KMUA 2ZBKA 4G7ZF 1XDUA 4LGWA 4FE4A 4E6KG 1WJ5A 3PFYA 4RM2A 3F8MA 3IH2A 1S5LC 2DDBA 4L9TA 5D8KB 3JRIA 1VQOI 2LC2A 1Z77A 2L2OA 4C2MJ 3IUOA 2NS8A 3CESA 4FX4A 2K9SA 3FMRA 1KU7A 2RKHA 3TO9A 2WV1A 3V8KA 3L2RA 2CV1A 5JVGF 1GDTA 4X0GA 1R36A 2JA5J 5L3EA 3S8PA 4BE2A 5D5UB 3TMOA 1K4SA 3S17J 1BI1A 4XLNF 1R22A 1IN8A 3KLNA 2HVRA 1D0YA 4CCKA 4ZTFA 3GYHX 2DW4A 5JFRA 2ISZA 5JR3A 3JAMK 1SAXA 2EJRA 4A6DA 1IV8A 2HNHA 2OAZA 1MSEC 2L9NA 2B0LA 2VQHA 3MKLA 1YO5C 2VBXA 1W0UA 4EJOA 5E3OA 4NQWA 2COBA 2PLYA 2XAJA 1ZARA 4NB5A 4UVCA 4RB0A 1DUXC 1YJNI 2JJ7A 2KHMA 3GZNB 4RB3C 1P9QC 1P4XA 2I10A 1GVDA 1UJ8A 4ESBA 4OOIA 2OBPA 5KCMA 3T8RA 1MKMA 4B43A 1A5JA 2EBIA 4F52A 3K70D 4L9VA 5K1YA 2RGVA 4IJAA 2ICWG 2VXDA 3JAMZ 4XKWA 4HDUA 1K78B 3GLLA 5BOXA 4XL9A 3VFZA 3W2AA 2LBFA 3LMMA 3PNVA 4LITA 4BNCA 4KMFA 1U78A 3LSHA 4PFOA 3ABKH 3KP2A 3OS2A 5EEAA 5F64A 5EG0A 4YIIA 1TW3A 3WHCA 3OYKA 4BL0B 3GFLA 1USSA 1VQKI 1JTXA 1FIPA 4OWRB 1XC5A 1IN7A 5F6FA 3WHBA 2EIJH 1SVOA 2K4JA 2LYCA 3OV8A 5C44J 3HDDA 3QWLA 1AU7A 2UZKA 1BW6A 3ZXSA 4BEHA 4A0ZA 3F3XA 1YG2A 1TT5B 4BY1J 3GO5A 3W2WA 5CVUA 2OF7A 1G4DA 2JWTA 1X1CA 1W5TA 3M3YJ 2E7WA 1TWFJ 3SZPA 4MO7A 1ON1A 2X1DA 3SZTA 3WG7H 2K3PA 1EJ9A 3HRUA 5KNLA 1FBQA 2ZCWA 3JTHA 3WGHA 5GTIC 4HRIA 4LMYA 1GLNA 2CUEA 4FX0A 2XUBA 3E5XA 2HDWA 4MGRA 1OQYA 2W00A 3VODA 3VB2A 2WB1N 2EZKA 2KISA 3NWTA 3IKVA 4EJVA 4J19A 3KP3A 1MJ9A 4B3AA 5K5RA 2A6EF 2VB6A 5FJ8J 1LFPA 2ESNA 2PFBA 3WODF 2HDCA 2OV7A 2CMPA 4ENKA 1TNSA 1FC3A 1JKRC 1D5VA 5FKKA 4YFXF 4M71A 2NNYA 2B9SA 1CQTA 4B1RA 3I55I 3CP2A 3BP8A 2BGCA 3LL7A 4A3FJ 3H0DA 3D5RC 3LSGA 2LH9A 5CVVA 5IOYA 2E1NA 4JQFA 4A0XA 3FX3A 2A6TA 3EUKL 3CMAI 3SFZA 2OTLI 2LNBA 2R5YB 3F6VA 1VQ7I 3DLLF 3R0AA 1D8KA 1WQ2A 3OIPA 4A2UA 4XSXF 4EQQA 3H1CA 2MFZA 1EH8A 2VJ4A 1LE8B 3EYYA 4V2FA 3V7CA 5C4JJ 4RDUA 2W24A 2QSHX 4I0AA 3LSKA 1MIJA 4HX7A 3DV8A 2XSJC 2EFPA 1TWCJ 2DPDA 5L3CA 2D5VA 3F72A 3FXUA 3HXLA 2CYYA 4DZPA 1YOVB 1GV5A 1FBSA 4AIKA 1ETVA 2KIMA 1PP8F 2WBMA 2MA3A 5HNHA 3BR2A 3BJ6A 1LDJA 3WTTC 2IGMA 4KA4A 2W84A 4RGUA 4FT8A 2X6XA 2M0CA 5JVTA 1E3PA 1RETA 4O3MA 4BXXJ 3ELKA 3G4SI 1XX5A 2HZTA 3H5AA 2AHQA 3KZYA 2DA5A 2P0WA 1ETXA 3QRFF 3CCEI 1NTCA 2VE9A 2L4AA 2Z9OA 2V6EA 1YQAA 4B8XA 4H0EA 2NVQJ 2R7SA 2WC2A 1RR8C 5HS7A 4K2EA 2EFNA 4BACA 2K27A 3EUHC 4XKVA 4M9XA 5B66C 2DU9A 3DQVC 4L18B 3Q9SA 1XN7A 3VSKA 3BR1A 1TC3C 4IRHA 4CCJA 1J09A 2P5VA 3C2HA 1R71A 1MJBA 2HEOA 3HOVJ 5LBQA 2V9VA 1F9NA 2H1LA 2XRNA 4AUXA 5J47A 4MEXF 4I6ZA 4F93B 4MQ9F 3D5LA 1Q1VA 1G3SA 1PDNC 2HTSA 2WA0A 2P5KA 1LVKA 1P4WA 4U88A 3K69A 1BR4A 4RLQA 4DNCA 1V55H 4OMYA 2D2WA 2HVSA 3PO2J 4ABZA 2DOAA 1QVUA 4Y7NJ 3H36A 4NBQA 4XIDA 2H8RA 4GGGA 1RKWA 3DKWA 3LQQA 4IRGA 1R1UA 3GTGJ 2DOFA 2LDUA 3E97A 2RREA 3OS1A 3I54A 2F5CA 2DPUA 1U2WA 3ZQQA 2ECBA 3R61A 1OPCA 1S6LA 2Y0SA 2PJPA 2V26A 4XRMA 4EV0A 3QYEA 3V7SA 2XC7A 1YX5A 2KLOA 2QENA 4JBAA 1JHFA 5GP9A 1MJAA 4P1WA 1YE9A 3FK7A 4HLXA 4A3BJ 3LSRA 5HDGA 2O3FA 1QHGA 2VBWA 4F3QA 3ISPA 2XDVA 5FO5A 1VTNC 1WH7A 2RNGA 1AKHA 1YHQI 5K7FA 1Y8QB 4Y52J 4E7SA 4M3FA 2UWMA 4IHSA 2DA2A 4EMSA 2HOSA 3GEZA 3ZQCA 1B8IA 1FSEA 4LB6B 4B09A 2IA2A 4RLFA 3SDGA 1HC8A 1WCMJ 3VDXA 1V5EA 2VONA 1SEUA 3BT9A 1RI7A 2V1UA 5F04A 2BY1A 1FSHA 3VEPA 3ZQFA 2VASA 4LK0F 3AL0C 3T8TA 3I4PA 1KZHA 1MDMB 2IAIA 3AKZA 3SJMA 3WTWC 2IT0A 3HOXJ 3MKZA 3CJQB 3HKZN 3I9V2 2OPTA 5D4SA 3GLXA 2HPIA 4JX5A 2D1VA 3DKYA 2RNJA 4R1HA 4RA2A 1SD6A 2R7QA 3V7RA 1I6HJ 3IHUA 1FLIA 5D8LB 2VKHA 3KZIC 1X1BA 1Y6IA 4XICA 5FRMA 1RPWA 3BCAA 3E0JB 1JT6A 1OYWA 4U0YA 1XGNA 3BG9A 4BQQA 3IRQA 3GUDA 2WADA 2AQFA 1F4KA 4NNJA 2Y30A 5DCMB 3NAUA 4QIWN 2A5YB 3E6CC 1HKQA 1K83J 3CUQB 4UHTA 3IAS2 2E71A 2O5RA 5EEHA 1QBJA 2XF6A 2ZO4A 4A5MA 1LPQA 2PMZA 4IQJA 4YIFA 5ICGA 1VQ9I 5D6FA 4L0ZB 3OOPA 4A5NA 3CD6I 4C2TA 1ZG1A 2EINH 3KP6A 2X48A 3G1MA 3J80K 2MSYA 1Y0NA 1RRJA 1W36C 5L3FA 2FNAA 2FSWA 5TJJA 3OYJA 1QZZA 2HYFA 1TLHB 5FKOA 2PEXA 3K1MA 4A3GJ 4FE7A 2VPRA 2OCCH 3J7AY 3LSJA 4XLAA 3HTUA 2XROA 2KFDA 2X1EA 1CF7B 2O9LA 5TGTA 3S2DJ 4NC7A 2IPQX 1KYWA 3KYCB 2X6OA 3JRCA 2FA5A 2XGCA 3HPGA 3FHZA 2KDZA 4DYCA 4HV6A 4ZH4F 1OCCH 2ETHA 2L9VA 4XLFA 4ZYEA 3D1NI 1JKPC 1XDSA 5FD6A 3GTQJ 3ASOH 4QTRA 2LFBA 5E3NA 4LOCA 2Q2EA 3ZPLA 4XORA 5B3SH 5B5EC 2Z33A 1P7IA 2DFIA 4CSWA 3BZ6A 2E35A 2PMZN 2QA4I 1O3TA 2ZNZA 1ON2A 2F5VA 1BR2A 5DTDA 2EIKH 3S3NA 2L5QA 3SFIA 4YFKF 1UB9A 2LKSA 3J81Z 5EYRA 4MTEA 5H2FC 3BZKA 1MBHA 1O7FA 4CZCA 3DLAA 2WY8Q 3QP5A 2VKDA 3WU1B 2VLAA 2DT5A 1K4TA 4BQAA 1OR7C 1DGRM 2W57A 1MBKA 2CW8A 2LMDA 2ZSHB 2EZLA 3IH3A 2CUZA 1FYMA 2GIVA 4LLLA 5M3FJ 3I4NJ 4BAYA 1UFMA 3CO7C 2CV2A 2G7HA 5CJ9A 4BH9A 2RQQA 3TDZC 3CP8A 1Z7LA 2OA4A 1X3UA 2E1MB 2FOWA 2ZJ2A 2FMYA 4GYIA 1HW5A 4BHCA 3RZDJ 2QUFA 4P9FA 3F21A 4IHXA 3OYEA 3OSFA 2VT2A 1DU6A 1FEXA 3J81K 4PJJA 4HV5A 2IS1A 2DMTA 2LF8A 2XGEA 3J7YJ 2HXOA 1J0RA 3O8GA 2FQ4A 3DU6A 2ZFUA 1UHWA 1AA7A 1KQ9A 1B4AA 1ZGJA 3TO7A 3RKQA 1R49A 4C2UA 2G9WA 3HZJA 2WAEA 3MMYB 1OKRA 4MTDA 4A3JJ 2EH3A 2RV8A 1FP2A 3CF2A 5BPDA 3KYDB 3GTLJ 3E6MA 4XKBA 2BW3B 3HGYA 3SEQA 4EGZA 2QQBA 5FD5A 5KAFC 3K4MA 3A2KA 1DPRA 1OMIA 4KITB 5J8FA 3CCQI 1DDNA 2DA6A 3WU2C 3Q0WA 1QA6A 2A68F 3C7JA 1VI0A 3T5XA 3RDIA 1W1WE 2KZGA 4LFUA 2EILH 3G71I 3QPHA 3ONQA 4OU0A 3K2AA 1MNDA 1I27A 5IT9Z 4UV9A 4S04A 4WXDA 2IVMA 4JK1X 4DGWB 3RI4A 2ECCA 3EDPA 3BDDA 2CUJA 4E7LA 2HYJA 1R4MB 2LLKA 4CCMA 2LTPA 2DQLA 2WV0A 5D5XB 3M8JA 4DYRA 1HW1A 4AVPA 1FBUA 2XSDC 4XNFA 2JVGA 3P5JA 3SYTA 1E17A 3KP5A 4PJNA 3GBGA 2V6CA 3RKYA 3T1BA 4U0VA 2HQAA 2W25A 1AOYA 4PUSA 2P81A 5B1BH 3CDHA 3P9KA 5E79C 3S15J 1IZ1A 3I0TA 3EYIA 1KQ8A 5HDNA 1BIAA 4A3LJ 2RQPA 1A36A 3CQZJ 4BJ6C 3HKZA 1GUUA 5DUKA 3CCRI 2JA8J 2N8GA 2CQKA 1MH4A 2LKPA 2LBFB 1APLC 2IS6A 4MEYF 2QWWA 5FGMA 3E5UA 3I59A 4AYBN 1Y39A 3CCMI 1ITYA 3I59B 4IHTA 2Y69H 2F2EA 1HDDC 4II2A 2GLOA 2VL8A 2TDXA 1G8XA 4W97A 4AYBA 1TQMA 1MD0A 5J6XA 3Q3SA 3S1NJ 3R60A 4C30A 2P7VB 2R5ZA 1ETOA 4HW0A 2ZC2A 4M6YA 2R5ZB 1VQLI 2MC3A 2ISYA 2GXGA 4XBFA 1X1AA 5M5YJ 1S7EA 2FXAA 2Q8KA 1HBXG 2O61A 2RDPA 2H6CA 1I50J 2CG4A 3H5RA 1R5GA 2HFHA 2KL4A 4M72A 4FASD 2Y75A 4XLPF 2QBYB 1ORKA 2HDDA 3GTPJ 5K5QA 2IW5A 1AWCA 2ZJQF 1H9TA 3L9FA 1GHCA 3HJEA 3OYLA 1SAUA 2MH9A 2QQ8A 3HIFA 4A6EA 3VOEA 3DBRB 1VFCA 1EF4A 3BZCA 2D45A 2XGXA 5LFAA 4WCGA 4ON0A 2GBYA 4WXCA 2CRGA 2KIQA 3ZCOA 1TTYA 3ZQIA 2HTJA 1ZREA 1JKOC 1BR1A 4HF2A 4D7MA 2EV6A 2R7OA 1DP7P 1Z05A 1RKTA 4RBOA 5BPIA 2F48A 1MNEA 5LGTA 2VOPA 1G59A 3OYHA 1MDMA 1G3YA 3IL2A 1X2MA 2FU4A 3HRMA 2XKOA 1Y1WJ 1L3LA 4RAYA 1EA3A 4A3EJ 4XONA 4Q4ZF 3E3VA 2ACJA 2I5UA 1YIOA 3BPXA 4CGZA 2M1BA 5M3MJ 1RIOH 4B48A 1BI3A 1UMQA 4V19K 3ZRGA 4B47A 2A3SA 3S3OA 2L4MA 3TKYA 1X4PA 2NNNA 2HZDA 3O3KA 2DODA 2FD5A 2JVHA 2QYOA 4ITVA 4PZJA 3ZQGA 5EEGA 1SFXA 2LKXA 1FPQA 5LEJA 2NVTJ 1POGA 1QNTA 2LVSA 3CCUI 1IGNA 3RIRA 1BOAA 4UUTA 4RAFA 1R4NB 3W6JB 3F9KA 2QZ8A 3EETA 5DD8A 2KRHA 3VWBA 1ZGAA 4IRIA 3B6CA 3M1CA 3SHFA 2QCOA 3LNQA 2LSOA 3LA2A 2DJIA 3BR3A 3GF2A 4HPQA 3RTRA 1JKQC 2VE8A 2DMNA 2IGOA 4HEA2 2HKOA 5CVRA 5IP6A 1XSDA 4UNOA 1LB2A 4LJZF 4IOAF 3S1RJ 4P9UA 3BTCA 3Q0UA 2NS0A 5J4VA 2CW0F 3RQIA 1FOWA 1ODDA 3A01A 4UVAA 2E34A 2HI3A 2LF7A 1D5YA 3KFWX 5CKTA 1F36A 5GPAA 1SFKA 2BEOA 1RNLA 2K40A 1S72I 4HOBA 2XV4S 2NS7A 3UKGA 1J7KA 3WTSC 3M7GA 1MGTA 1J75A 1B59A 2R7DA 4BQOA 3RYPA 3JRDA 1LDDA 2OU2A 3ZR8X 3H0GJ 2R5YA 4Q48A 2V9PA 2DYSH 1WI3A 5D6EA 5ED4A 3PNYA 2L3DA 3WTVC 2QKMB 3PQJA 1YFHA 2VQGA 1LE8A 4IHYA 2FBIA 4A69C 3JRBA 3G1OA 3PFIA 2K9QA 5FLXZ 1QU3A 2G7UA 5FLVA 4B44A 2BV6A 5E1XA 1ZK8A 4XRSA 3KETA 2EFOA 1VQ8I 4BE0A 2QSFX 1RUOA 1SFEA 3AG3H 5CLSA 5CQEA 2IS2A 1HDPA 1YIJI 1YI2I 3L09A 4XRFA 3F22A 1FT9A 1CGPA 5F08A 1JE8A 4UV8A 2NOJB 1Z91A 2Y9ZA 3RPQA 1T39A 2F5EA 1IW7F 1I1GA 3KP7A 4PJMA 4RGRA 2WB1A 1N77A 2H27A 1UAAA 4UB8C 2NVUB 4RAGA 3GW2A 3OYGA 3N05A 1EH6A 3ZQLA 2K9NA 3OYIA 4ANJA 3W6VA 2IS4A 1T2KA 2EFWA 3ECHA 2PMUA 4LG0B 1K61A 4LG0A 3FBNB 4ZYHA 5J4YA 1ULYA 4HG2A 3U1KA 4ZZDA 4CXFA 2YPRA 4CH7A 1W7PB 1W36D 1W7PA 1QGPA 1XS9A 2BXZA 2J5PA 2KPMA 1H9GA 4WWCA 1LUJB 4ENMA 1JJ6C 1JUMA 3F0CA 2EK5A 5EF6A 1L0OC 1IRFA 2A5WA 1Z21A 2ID6A 4D1QA 2VXZA 3DBHB 5HOOA 1B8IB 2JQ7A 4H4KC 3S3MA 2VPLA 1ACIA 2R4GA 3S32A 5HLHA 4KT5C 1SANA 4I99C 2DYRH 1I3AA 2M4GA 1X4OA 2W7NA 1T98A 4HA8A 4F55A 4ESFA 3O6BB 2DAOA 2G0EA 2RC4A 4N4OB 4LLNA 4KJZA 2V1DA 1D1BA 3DEWA 3OYMA 3S2WA 1YJWI 3ESWB 1QHHD 4IO9F 5HVQC 1Z67A 5CVJA 1OCTC 1A35A 3NEUA 3MZ8A 5FROA 1U3EM 4EJWA 4OAZA 5EDNA 3HL2A 5TRDA 1MMNA 3E5QA 2DA1A 1GV2A 1OFCX 3FXOA 1D0ZA 1D3YA 1Z3YA 1Z3XA 1WVRA 1YS6A 2LR8A 4GCVA 1BC8C 2AXTC 4ZYGA 1V5FA 4BS9A 3B02A 1GVJA 5F1JA 4OINF 1QRYA 2YX7A 1WKMA 3HUGA 4L9NA 2A69F 4HF0A 1OYIA 3I71A 3S14J 1H88C 4EM1A 4MNUA 2BYVE 3Q0VA 3PQKA 1YITI 4ESJA 1Y8RB 4HX4A 4NUBA 3ZOBA 2P6SA 3JSOA 3L2WA 3I64A 2QVOA 4AWXB 5L3BA 3TO6A 1LNWA 1B6AA 2CFXA 3OIQA 4M9SA 1KA8A 5DM6F 3TP0A 4IX7A 1JGSA 1XGOA 1SVMA 3ROUA 1ZR2A 3H5NA 3HOYJ 1UHSA 5E3MA 3DWLE 5CPRB 2W48A 3ERED 2M45A 2YS9A 4P96A 5JHUA 4BHBA 2ID3A 1OJLA 1RUNA 1JT0A 2STTA 3U9GA 2Z99A 3RKXA 3AG4H 1YTYA 1NHAA 5D5WB 1Z0XA 4XLEA 3A02A 2DDAA 1ZKGA 2DJNA 4JX6A 3FM3A 5FFXA 1SD4A 1IG7A 3HOTA 4I7HA 4M74A 5DDGA 2CU7A 4IPAA 4M3BA 2D1HA 4XN0A 4HQMA 1UZCA 2IEKA 4E7KA 1OCPA 3REOA 2UUZA 3RYRA 4E70A 3Q9VA 4E7HA 1FIAA 2ZMEA 3JW4A 5DUIA 5HS8A 3HRSA 3GMEA 1FY7A 3PUBA 1O4XA 4X1EA 2O0YA 1WJDA 2HKXA 3U2RA 1R7JA 3GXOA 3P7NA 2EIMH 3DTIA 3WTZA 5E8IA 4U87A 2JA7J 3DP7A 1UHMA 2AQEA 5BS6A 1TL8A 4CCOA 2DK8A 2DFHA 2HOEA 4PGHA 1TBXA 5E3LA 4DJAA 3TQNA 3EUAA 1ZR4A 1BW5A 4XM3A 3IWFA 3GCMA 3SDBA 3DEEA 4XR6A 5DD4A 4HYEA 2EZHA 2PMHA 5GAEJ 5TISC 1I6XA 2V1XA 1SD5A 4GYGA 4HSRA 2PQ8A 4G7HF 4KMUX 2Y9YA 4KNYA 3OWTA 5E17F 2JUGA 5D5VB 2YSRA 3QU3A 5GPCA 1TQPA 3OL3A 4CYCA 1PUFB 1J59A 1G2HA 3CCYA 1YS7A 2VOOA 1IN4A 2DLLA 3ERMA 4AVZA 4FCYA 3ZQ7A 4NHJA 3FKJA 1B1BA 2L7ZA 2VBYA 3KEOA 2BY3A 1D1CA 3DFGA 4GFBA 2NYXA 2A07F 3S1QJ 3RZOJ 4AD9A 4YIRX 4E7JA 4KN7X 5IYBJ 3HTSB 2ZFWA 3M9AA 3CCLI 3WTUC 4KISA 3S1MJ 2EB7A 5LHHA 1R23A 2Y0SN 4PJ0C 1D0XA 3K2ZA 1LVAA 2VIXA 5IT3A 5JI6A 4Y4RA 1BI2A 1RZ4A 4C3IJ 4X6AJ 5J1YA 3W3CA 2W82A 1Z6TA 4EATA 2X9DA 2V1NA 2Z3YA 1DPUA 3CO6C 3A01B 1TWAJ 2ELJA 2XAFA 1TNTA 1D1AA 4G12A 1O3QA 2FBKA 1XCVA 3IH4A 4BU2A 3ECOA 3GFIA 4KUMA 2M34A 4UVBA 2F5DA 2WAFA 2M4KA 4A93J 4EJUA 4HBLA 5GAHJ 4IXAA 3GWZA 4DIQA 1FX7A 1MW7A 2KQRA 2ZMEC 4JYKA 5HS9A 4E7IA 4ZDOA 2LK2A 3MKYB 3ZQHA 3V4GA 2LY9A 1UG0A 3LA7A 4KIGA 1FZPB 1YRNB 4FTHA 5E18F 3MZHA 3JR9A 4CHUA 2X51A 1BJZA 3N4MA 1LEAA 2L7MP 1MMDA 1O3SA 1MSFC 5J8CA 2YR2A 1ZG3A 1WZ2A 3LQRA 4I2OA 4N4NB 1T8IA 1OISA 3L2QA 1NH3A 1QZEA 3FXJA 1OCOH 3OIOA 2VJIA 1IXSB 3FBIB 2NXNB 1S29A 2FMLA 2MG4A 3K4KA 3PJRA 1VF9A 1ETWA 4ENNA 1YW9A 4HDVA 1ZRDA 2HU9A 1X58A 2VC0A 1D8JA 5LEKA 2QKLB 1TWGJ 2E60A 3FWEA 3MVPA 4YFNF 2VI6A 1QO0D 1NG7A 1U5TB 1SFUA 4D5FA 4BUPA 3LOCA 1ZHFA 2XF7A 2FEZA 4U7BA 1F43A 3AG1H 2AXLA 1X3WB 3BQYA 5EGOB 3LFUA 3GX4X 1SFOJ 1NG6A 4GXOA 3NWSA 4EJTA 2M30A 1KU2A 3QYBA 1REPC 5BMZA 5EZGA 3F8NA 1E0EA 4I01A 4WX9A 1WRJA 1WI9A 4HAMA 4KIBA 2H94A 1VQPI 2O7OA 2E2HJ 5KVRA 3OYAA 5FLXK 1RR7A 5EJCA 3TW6A 1Y1VJ 1A6IA 1XMAA 3WE2A 1OCRH 4M6VA 3WE3A 1WH5A 3HC7A 1AHDP 2Y48A 4RM3A 2JZYA 3HPHA 5FRNA 1N75A 4W1UA 3AAFA 3HM5A 3HSEA 2F5FA 2BOLA 1VQ6I 2Q1ZB 4I76A 2VQCA 3VYSB 3HOSA 3C1DA 2V7FA 3E6DA 4M6XA 3OYDA 1XMXA 5JHFA 3FDYA 4S05A 1KYZA 4N9IA 4PJLA 1FTZA 1TQIA 2L0KA 1XPXA 1T56A 1MBEA 5CVIA 2EV0A 1FYLA 1T0FA 3H9GA 3ASNH 2RVCA 5F1RA 1X2NA 3HHHA 5IOZA 2R92J 2L7FP 2PG4A 4EVIA 5E1WA 2JSCA 2R7VA 2P7CB 3QPSA 2K9LA 3OSGA 2EPFA 4B3XA 1ETYA 3BC8A 1Z9CA 1JGGA 4F7ZA 4BYYA 2XIGA 4R79A 2QEXI 2X1CA 4BBRJ 2XHKA 1HXDA 3DEUA 3PSIA 3DTEA 2RAEA 1O3RA 2VJ5A 3V8LA 4ENJA 3BPVA 1ENHA 4D7NA 3TOAA 2P6TA 3VYUB 2QF7A 3CMMA 3GTKJ 3LSIA 2COMA 5LHIA 4OMZA 3HGGA 1MH3A 2O03A 1GXQA 4HZFA 3OR2C 2FUG2 1BJAA 2W85A 1LFUP 4WF2A 1NK2P 3LSMA 2JMWA 1W4MA 4KICA 3BQZA 3UNGC 2VKEA 3RPUA 3DBLB 4EEFG 4G8XA 3S16J 4XLCA 5E20A 3H9QA 3L2CA 1KU9A 3DTKA 3CC4I 1SVLA 4C9YA 2VUMJ 2Q2EB 5IP7J 3SZGA 3WTYC 3SQNA 2F6CA 2H6BA 1GT0C 2R7ZJ 3KZZA 1U8RA 1KQ0A 2GM4A 1ETQA 2EWNA 1FWZA 3M8EA 2L9RA 5J1UA 5ILUA 2M8EA 2WAQN 4G6TB 1YYVA 2ZKZA 4Y33A 1X1PA 5CYVA 2ME6A 2XVCA 2GXBA 2E2JJ 5F0HA 5DM7F 3J80Z 2DA4A 3MWMA 3WG9A 2DFFA 1QZYA 5EG0B 4N0BA 3TEDA 3RCOA 2KZVA 2OQGA 1PYVA 2IRFG 1FJLA 2KT0A 2JUCA 1YW8A 1WHUA 2M87A 3CUOA 1QPIA 3MAJA 2CSOA 5IYDJ 2EA2A 1QVTA 5E1ZB 3ABUA 3CDLA 5LGNA 1R1VA 2DO7A 3A1YA 3I3LA 3ULQB 5LRSA 3ZMZA 4LD5A 4TV7A 2X6YA 2XF5A 2I8DA 3HBLA 1ZG5A 3R0JA 3FXLA 4I0BA 4Z2YA 1IRXA 3HB9A 1B72B 4BQNA 4DYQA 2UXXA 3LA3A 1E3HA 2W1OA 2M9HA 3DF8A 3L7WA 3B6AA 2CW7A 3PUFA 4P55A 1T38A 1VQNI 3H9JA 1ZQ3P 1MBFA 2DN0A 2OZ6A 4AIJA 4BDZA 3CJRB 4PK4A 1LFBA 1P2FA 1Q1HA 3TDUC 1W5CC 5FFZA 3PIPF 2OJED 5K7ZA 3D0SA 3EUHA 2E7XA 2FX0A 1A6QA 2ZXJA 5ILVA 1I3QJ 3B73A 3CLOA 2GA1A 2IGKA 3E1SA 4BXUA 3BG6A 3QQAA 4S0HB 3L1PA 5AONA 3Q5FA 1IJWC 4XOTA 2L7KA 4A3DJ 2YU3A 3D5SC 1Z1DA 3J7ZI 1ZRFA 2JA2A 1FTTA 4IQ4A 2Y0MA 1BC7C 5F27A 5DEQA 4BE1A 2UXNA 1X1DA 4I98B 1R9TJ 1A04A 2O6GE 2XPUA 3H3ZA 5ICFA 1IO2A 1B9MA 2HWVA 4MIMA 2Z2SB 5ERIA 1S9HA 3IRRA 3OS0A 5J1RA 4ETSA 1S3JA 2MH2A 3F6OA 4Q47A 2BHZA 3GZ5A 4LLGF 2V4JC 3GTJJ 2LD5A 1WGXA 1I39A 1WWXA 3VYRB 1WJFA 3JRGA 1X3ZB 3JSPA 4KN4X 3LSPA 2PJRB 1IRGA 2PJRA 1MZBA 2V9KA 1P7JA 3AL0B 3HRTA 2NAZA 4Q5SF 1UG2A 2ZB9A 5CQGA 1F1ZA 2HQRA 2QM3A 3H35A 3CCJI 5J3LA 4CCNA 2CQXA 1ZELA 5D4RA 2OZUA 4II3A 5HNFA 5GAGJ 1QPMA 2X4HA 2VN2A 2IBDA 1JHHA 2MC4A 2PBIA 3RKWA 5ILSA 5BNGA 4B4CA 1HOMA 3A0HC 2EQRA 2DMQA 1ZAOA 1XMKA 2GXAA 3C2BA 4M3GA 1TT0A 4HQEA 2JTVA 2XKPA 1JUSA 2GZWA 2GOXB 3QU6A 1YLFA 2QGUA 1XGSA 3HYIA 1JTYA 5EZHA 1H89C 1U5TC 4G6QA 4I02A 2XB5A 4O6JA 4QPQA 2EA4A 2X0LA 1HW2A 2BY2A 2R93J 2QQ9A 1HSJA 2K5CA 3BG5A 1E2XA 2DQRA 1FYKA 2A6HF 2LY2A 3ZN1A 2WTEA 2CJJA 3QOEA 4BY7J 3VYTB 1HF0A 1JI8A 3JRAA 2FJ1A 5AIPA 3H3VK 4M9ZA 1STZA 1IXRC 1MNMC 4I09A 4IL6C 3KYLA 3I58A 3I53A 1SMTA 5J40A 2KDOA 5HLGA 3F23A 3V8JA 1VQ5I 2BZTA 2GA2A 5H6RA 3P9IA 3TGNA 1V54H 2ELHA 3E7LA 3I56I 3HSFA 2QLZA 4L0YB 3LAJA 1HLVA 2XPVA 4LIUA 2K86A 5DCMA 1R00A 3LFKA 2FE3A 1WJBA 4XLHA 1SC7A 3BLYA 2L01A 2DOEA 3J7AO 1FOXA 2BE5F 4KT6A 3O8HA 2E1OA 3KP4A 1TW2A 4M3DA 3S2HJ 3K0LA 1MMAA 1EKEA 4NQWB 1HCRA 3KX2A 1XG1A 3DKXA 4RGSA 4XN3A 5IYCJ 2C6YA 2K4BA 1K7AA 2BXYA 1BM9A 2FOKA 3BR0A 1PJRA 2RN7A 3TOBA 2KIUA 3P9CA 2YX4A 1UELB 2CQNA 2LP0A 1C0WA 3HOZJ 4ZDPA 2B7EA 3H92A 1U0JA 3K4NA 1K78A 1ZTRA 1PP7U 1IXCA 3FMQA 4RGXA 3R6SA 5IY5H 3MEXA 1IDYA 4RS8A 2ZJRF 4PCQA 2M3AA 3K1PA 3CTAA 4Z6YA 4YEJA 3CJNA 1X19A 2YU9J 3K4LA 4LIVA 3FMSA 2FQ3A 3CCVI 1TZLA 2IA0A 2YUSA 2H09A 1MMSA 3GZ6A 4CZZA 1BI0A 2HPMA 1M1EB 2M7AA 4GRIA 1AKHB 1QQIA 4D5CA 4BGDA 4FHTA 4BEHB 4C3HJ 2A05A 1LDKB 2J5OA 2DBBA 1BBYA 2MGQA 1GXPA 4KFCA 3K4JA 4CYDA 2KJCA 2DI3A 1BL0A 2DTRA 3O2PE 1XB4A 4V2GA 3FXKA 3CUQC 3FXRA 4UUSB 1P4AA 5H20A 2BHYA 5LHGA 5HLTA 1R6RA 1VQMI 2GWRA 5JLWA 5HODA 1DGWY 3CCSI 1W5SA 2X85A 4G6DA 1IV6A 4XKCA 1WJAA 1WJEA 3QPLA 3FIWA 3BR5A 3BJOA 3DCFA 4D9JA 2HOAA 3MQ0A 1XTAA 1G6NA 2HXIA 4UY8I 2M0MA 4A3IJ 4PSXA 1W0TA 1P92A 2PN6A 3CMEI 2AS5F 3E6BA 1XSXA 3BR6A 3MKWB 2LG4A 4RB1A 3AFHA 3BTIA 1WJCA 4CYCB 3HHGA 2VJJA 3C18A 2MD5A 2L02A 3ABTA 4HNUA 4BDYA 1W7PD 3CJTB 4ZYDA 5LRRA 2HS5A 3CZ6A 3L00A 4CA0A 5IPAA 1K6OA 1IF1A 1LQ1A 4CUGA 4UB6C 4A12A 5ICEA 1HQCA 9ANTA 2DXIA 2IXSA 4J01A 3G2BA 2BW3A 2EFQA 1U9NA 2CQQA 2VKVA 3GVAA 2P5LC 1S7AA 3MCZA 2X6WA 1SD7A 2QQAA 4DZJA 1XSVA 2VBZA 2R7XA 4BXFA 1S7OA 1B9NA 1BIBA 4CCLA 3CC2I 1LEBA 4OIPF 2CS3A 1BOBA 2M5WA 3U1DA 1EH7A 2L54A 3NQOA 2JPCA 3COAC 5JLXA 5BQTA 2R0QC 2F4IA 2KRCA 4FETA 1ZRCA 4MFEA 2CQ7A 4Y17A 5DCFA 3OYBA 4NC6A 2BBYA 1B72A 1U5TA 4QSHA 4BJ5C 4CO8A 4KYWA 3K1NA 2GIZA 2LOOA 2JN6A 1FP1D 3KCCA 2CFOA 4QPOA 3FZVA 3G3ZA 3HEFA 2E5NA 3GTMJ 2DA7A 2JT1A 3OR1C 3AG2H 3OOUA 4AM3A 1XCBA 3M1EA 2B63J 2LY1A 4AU7A 4RMNA 5ICCA 2MW8A 3TP3A 1BN5A 3CLQA 2E1MC 3SXYA 3F8BA 3JTGA 4CICA 2WY7Q 3A0BC 1FOYA 1RESA 5LLQA 4DOZA 2F4MB 4DBQA 5L3DA 5KK1A 1V4RA 4IF4A 4RB2C 3DXJF 2IP2A 3M8FA 1T95A 3WTXC 1S8NA 1XGMA 3EPZA 1YW7A 2W4SA 3ML6A 4JOMA 4EM0B 4BJTA 2KP6A 3WGIA 4HSTA 2CV0A 2E19A 1ZN2A 3GFJA 2WWYA 1R5ID 4HNVA 1JJ8C 2R7WA 1JXSA 1V5GA 3OL4A 3ZMSA 3QODA 4ZJZA 2KIFA 1IAWA 3DU5A 3K10A 2OUMA 3W2VA 3H3UA 3OYCA 1P6RA 3A03A 4PDKA 5FKMA 1DU0A 5C4XJ 1MBGA 3RQ4A 3CF5F 5AIQA 1R58A 3ABLH 5F0CA 1IDZA 4G7OF 4UUVA 1BA5A 2ESHA 5DYMA 1HSTA 1JUPA 1I5ZA 3FM5A 1YRNA 5L3GA 3V42A 2HVQA 1ONVA 2M2EA 2HQ5A 2JSPA 3BTJA 2DT7B 2P4WA 2OTJI 4O5VA 4MLOA 3KPHA 3C2GA 2ZXHA 2QBYA 3G1LA 1K6YA 4DBRA 3I5UA 1KONA 2EV5A 4U7DA 5EGOA 4CDGA 3OY9A 1N25A 3DPUA 1Y0UA 4XOPA 3FXQA 1FMVA 2Q0OA 1IUFA 4EM2A 2MD0A 2MLKA 3MZYA 3BWGA 2KRFA 2BVMA 4IHVA 3FXMA 3N97A 2XAQA 4HLYA 3KLOA 3RSNA 2KJBA 3DPLC 3X2QH 1N78A 4PGGA 3K9TA 2JK3A 1XD7A 2HGCA 4E7ZA 2P8TA 2VODA 1OCZH 1ZGWA 4ZYAA 4HNTA 3TW7A 4MQVA 3GTOJ 3G6EI 4IVNA 3RPUD 1KU3A 3U21A 4ASNA 2STWA 3BG7A 1SMYF 1FOKA 2MBFA 2ADUA 3KE2A 2R7TA 2E5ZA 1A31A 2GOMA 1J5YA 5FKLA 3PM1A 3ZMUA 5K5OA 3IV5A 4Y15A 1IN6A 3TL4X 3RJPA 2V79A 5KAIC 2MABA 4YELA 1HKSA 2PI0A 4LB5A 2DMPA 4DQ2A 3QYFA 3L2VA 2DFEA 2VQLA 5FB2A 1USTA 5HDKA 2H8WA 1UCRA 1TP4A 2OCEA 4FQGA 1T6SA 2L9SA 2DK5A 4BBSJ 4UXNA 2XAUA 4JP0A 5FLMJ 4XK4A 4ZC3A 1R5HA 3LSTA 4E4HA 2ZNYA 2Y2ZA 4OIQF 2R3SA 3OMYA 5C3EJ 3IKTA 4IOCF 2CGPA 4KDPA 3PO3J 3QOPA 3ZMVA 1FNNA 4YRVA 2IGNA 4PSWA 2VC1A 4HF1A 4F92B 1DP3A 1ZLKA 3M4OJ 3QAHA 4Y13A 4L5EA 1TWHJ 2M8GX 2E1CA 1IRZA 3KIOA 3CUQA 2HYGD 2K3FA 3OYNA 4IEJA 2XAGA 4OIRF 3MN2A 3L2UA 1ZLJA 2NVXJ 3HUGB 4G94A 1MMGA 2HOTA 2E36A 2ZXWH 4IHWA 1U8BA 3DPTA 2ZJPF 3BTLA 1H8AC 1ZYRF 4IKFA 2TRTA 4G9YA 1IUYA 2PX9A 3LAPA 3GFMA 3WGGA 3BCBA 1O57A 1Z7UA 4D0PA 3KEYA 2O8XA 4A3KJ 1Z6RA 1HA8A 3ZMDA 2XPWA 2FRHA 3ZGKA 1PVEA 3FISA 2R7UA 1IN5A 1FMWA 2ZMEB 3BJAA 4DW6A 5FKNA 3CMYA 3FHNA 5IT9K 2FF4A 4QLCU 4MHGA 3TBIA 4UUSA 3IP4B 1T0FC 1G3WA 1I1SA 4F91B 2K85A 1ZH5A 3S93A 2XGDA 1OR7A 1T08B 1U6GA 3ZP5A 3WU0A 3KEQA 3NRVA 5M5XJ 3NARA 2UV1A 1Y56A 2DMUA 2ZSIB 2JA6J 2XAHA 4GDFA 3IAM2 3R4KA 5B1AH 3BG3A 5LD2C 3M07A 4Y3OA 4A0YA 2HQNA 2OD5A 3C3WA 4M73A 3T0YA 4EGYA 4OIOF 2K02A 4P5OA 1KGSA 2ELKA 4WXHA 1PUFA 2BY0A 2KKOA 2DA3A 2NOGA 1YJ9I 2LREA 3A4CA 2IA1A 2NVYJ 3K7AJ 3ZN0A 2FBHA 1MBJA 1ERDA 2NRAC 3F8FA 4KIFA 2VT3A 3HOWJ 2CH0A 2DTZA 3VSLA 2CO5A 3BROA 3ZMTA 2Z1DA 1RC9A 5GTHC 4LG3A 4WK8F 4L9JA 4M3EA 2EZIA 1H0MA 1YX3A 2CWEA 2FNPA 2H1KA 2Z5UA 3ABMH 4YG2F 5DS9A 5F0FA 3CDIA 3JCUC 2BVLA 2OC6A 1J2XA 1LJ9A 3JREA 2O8KA 3I4MJ 3PNTA 5M5WJ 5K7HA 2WAQA 2R7FA 3HSRA 3MD2A 4QWQA 1CF7A 4NC8A 1F5TA 5A2QK 3BOQA 3JRFA 3SEZA 4FISA 3UR3C 5LGUA 4OAYA 3K4CA 4LK1F 5H6QA 3G73A 1LKXA 4AIHA 3FK6A 1WSUA 4XQFA 1WFXA 2Z16A 4BHPA 4N9HA 3MFKA 1EV7A 2JRMA 2ZXIA 3HOUJ 5KHDA 1PUEE 3K4BA 4ZTJA
chains in the Genus database with same CATH topology
3CC4I 4IOAF 1HC8A 4UY8I 3I55I 5GADJ 3G4SI 2NXNB 2ZJQF 2ZJRF 3J7ZI 2E36A 1VQNI 1YIJI 3CC2I 2OTJI 3CMEI 1YI2I 5DM6F 1YJ9I 2ZJPF 1FOWA 3CCEI 3CCUI 1VQLI 2E34A 2QA4I 2E35A 3CCVI 4IOCF 1VQOI 1VQ4I 1VQMI 5GAEJ 3CMAI 2OTLI 1VQ6I 1VQ5I 1FOXA 3CCRI 3PIOF 1VQ7I 3CCQI 3CC7I 2FOWA 1MMSA 3CCSI 3DLLF 3CJTB 3I56I 3CCLI 1VQPI 1S72I 1YHQI 2QEXI 1FOYA 3G6EI 3PIPF 3CCJI 1YJWI 1QA6A 1VQ9I 2H8WA 4V19K 3CD6I 5DM7F 2JQ7A 5GAGJ 4IO9F 3J7YJ 5GAHJ 5JVGF 1YITI 3G71I 3CF5F 3CCMI 1Y39A 1VQ8I 1ACIA 2K3FA 1VQKI 1YJNI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 I;  4IOA F;  1HC8 A;  4UY8 I;  3I55 I;  5GAD J;  3G4S I;  2NXN B;  2ZJQ F;  2ZJR F;  3J7Z I;  2E36 A;  1VQN I;  1YIJ I;  3CC2 I;  2OTJ I;  3CME I;  1YI2 I;  5DM6 F;  1YJ9 I;  2ZJP F;  1FOW A;  3CCE I;  3CCU I;  1VQL I;  2E34 A;  2QA4 I;  2E35 A;  3CCV I;  4IOC F;  1VQO I;  1VQ4 I;  1VQM I;  5GAE J;  3CMA I;  2OTL I;  1VQ6 I;  1VQ5 I;  1FOX A;  3CCR I;  3PIO F;  1VQ7 I;  3CCQ I;  3CC7 I;  2FOW A;  1MMS A;  3CCS I;  3DLL F;  3CJT B;  3I56 I;  3CCL I;  1VQP I;  1S72 I;  1YHQ I;  2QEX I;  1FOY A;  3G6E I;  3PIP F;  3CCJ I;  1YJW I;  1QA6 A;  1VQ9 I;  2H8W A;  4V19 K;  3CD6 I;  5DM7 F;  2JQ7 A;  5GAG J;  4IO9 F;  3J7Y J;  5GAH J;  5JVG F;  1YIT I;  3G71 I;  3CF5 F;  3CCM I;  1Y39 A;  1VQ8 I;  1ACI A;  2K3F A;  1VQK I;  1YJN I; 
#chains in the Genus database with same CATH topology
 1O7L A;  1VZ0 A;  2TCT A;  1HKT A;  4XMY A;  4ZZL A;  1K79 A;  4XRS G;  4XSZ F;  3EQL F;  1OLT A;  5A2Q Z;  1VND A;  6PAX A;  2XRL A;  1VQ4 I;  2DCE A;  1IC8 A;  3IWZ A;  2HR3 A;  3JRH A;  1OYY A;  2MYS A;  5E8G A;  3PIO F;  3CC7 I;  3PL8 A;  2OQR A;  4ZDL A;  3FF5 A;  3LWF A;  3K70 C;  2M7B A;  3FKI J;  3BY6 A;  4L5J A;  2MLG A;  3K6G A;  1WPK A;  4R8H A;  2ME0 A;  4A3M J;  4J00 A;  1J9I A;  2JPB A;  4MFD A;  5GAD J;  3QP6 A;  2XAS A;  4C3J J;  4L5I A;  3QPT A;  4A3C J;  3W6K B;  2GQQ A;  5HLI A;  2K9M A;  2GAU A;  2JRT A;  2E2I J;  4RAZ A;  3VPR A;  5DV5 A;  3IC7 A;  2DT6 A;  1U9O A;  2F4O B;  4IZZ A;  2A61 A;  3HG9 A;  4GO1 A;  1NK3 P;  4HX8 A;  2R7R A;  1R1T A;  2XB0 X;  4NDL A;  2K7L A;  1ETK A;  4AC0 A;  4AID A;  5IP9 J;  3F8C A;  1G3T A;  3PSF A;  2IJL A;  4JX4 A;  2Y31 A;  4U0W A;  3OYF A;  4PFP A;  2QSG X;  2CUF A;  1T33 A;  4BKX A;  2AO9 A;  2LRD A;  1E3O C;  1DQU A;  1V3F A;  2KMU A;  2ZBK A;  4G7Z F;  1XDU A;  4LGW A;  4FE4 A;  4E6K G;  1WJ5 A;  3PFY A;  4RM2 A;  3F8M A;  3IH2 A;  1S5L C;  2DDB A;  4L9T A;  5D8K B;  3JRI A;  1VQO I;  2LC2 A;  1Z77 A;  2L2O A;  4C2M J;  3IUO A;  2NS8 A;  3CES A;  4FX4 A;  2K9S A;  3FMR A;  1KU7 A;  2RKH A;  3TO9 A;  2WV1 A;  3V8K A;  3L2R A;  2CV1 A;  5JVG F;  1GDT A;  4X0G A;  1R36 A;  2JA5 J;  5L3E A;  3S8P A;  4BE2 A;  5D5U B;  3TMO A;  1K4S A;  3S17 J;  1BI1 A;  4XLN F;  1R22 A;  1IN8 A;  3KLN A;  2HVR A;  1D0Y A;  4CCK A;  4ZTF A;  3GYH X;  2DW4 A;  5JFR A;  2ISZ A;  5JR3 A;  3JAM K;  1SAX A;  2EJR A;  4A6D A;  1IV8 A;  2HNH A;  2OAZ A;  1MSE C;  2L9N A;  2B0L A;  2VQH A;  3MKL A;  1YO5 C;  2VBX A;  1W0U A;  4EJO A;  5E3O A;  4NQW A;  2COB A;  2PLY A;  2XAJ A;  1ZAR A;  4NB5 A;  4UVC A;  4RB0 A;  1DUX C;  1YJN I;  2JJ7 A;  2KHM A;  3GZN B;  4RB3 C;  1P9Q C;  1P4X A;  2I10 A;  1GVD A;  1UJ8 A;  4ESB A;  4OOI A;  2OBP A;  5KCM A;  3T8R A;  1MKM A;  4B43 A;  1A5J A;  2EBI A;  4F52 A;  3K70 D;  4L9V A;  5K1Y A;  2RGV A;  4IJA A;  2ICW G;  2VXD A;  3JAM Z;  4XKW A;  4HDU A;  1K78 B;  3GLL A;  5BOX A;  4XL9 A;  3VFZ A;  3W2A A;  2LBF A;  3LMM A;  3PNV A;  4LIT A;  4BNC A;  4KMF A;  1U78 A;  3LSH A;  4PFO A;  3ABK H;  3KP2 A;  3OS2 A;  5EEA A;  5F64 A;  5EG0 A;  4YII A;  1TW3 A;  3WHC A;  3OYK A;  4BL0 B;  3GFL A;  1USS A;  1VQK I;  1JTX A;  1FIP A;  4OWR B;  1XC5 A;  1IN7 A;  5F6F A;  3WHB A;  2EIJ H;  1SVO A;  2K4J A;  2LYC A;  3OV8 A;  5C44 J;  3HDD A;  3QWL A;  1AU7 A;  2UZK A;  1BW6 A;  3ZXS A;  4BEH A;  4A0Z A;  3F3X A;  1YG2 A;  1TT5 B;  4BY1 J;  3GO5 A;  3W2W A;  5CVU A;  2OF7 A;  1G4D A;  2JWT A;  1X1C A;  1W5T A;  3M3Y J;  2E7W A;  1TWF J;  3SZP A;  4MO7 A;  1ON1 A;  2X1D A;  3SZT A;  3WG7 H;  2K3P A;  1EJ9 A;  3HRU A;  5KNL A;  1FBQ A;  2ZCW A;  3JTH A;  3WGH A;  5GTI C;  4HRI A;  4LMY A;  1GLN A;  2CUE A;  4FX0 A;  2XUB A;  3E5X A;  2HDW A;  4MGR A;  1OQY A;  2W00 A;  3VOD A;  3VB2 A;  2WB1 N;  2EZK A;  2KIS A;  3NWT A;  3IKV A;  4EJV A;  4J19 A;  3KP3 A;  1MJ9 A;  4B3A A;  5K5R A;  2A6E F;  2VB6 A;  5FJ8 J;  1LFP A;  2ESN A;  2PFB A;  3WOD F;  2HDC A;  2OV7 A;  2CMP A;  4ENK A;  1TNS A;  1FC3 A;  1JKR C;  1D5V A;  5FKK A;  4YFX F;  4M71 A;  2NNY A;  2B9S A;  1CQT A;  4B1R A;  3I55 I;  3CP2 A;  3BP8 A;  2BGC A;  3LL7 A;  4A3F J;  3H0D A;  3D5R C;  3LSG A;  2LH9 A;  5CVV A;  5IOY A;  2E1N A;  4JQF A;  4A0X A;  3FX3 A;  2A6T A;  3EUK L;  3CMA I;  3SFZ A;  2OTL I;  2LNB A;  2R5Y B;  3F6V A;  1VQ7 I;  3DLL F;  3R0A A;  1D8K A;  1WQ2 A;  3OIP A;  4A2U A;  4XSX F;  4EQQ A;  3H1C A;  2MFZ A;  1EH8 A;  2VJ4 A;  1LE8 B;  3EYY A;  4V2F A;  3V7C A;  5C4J J;  4RDU A;  2W24 A;  2QSH X;  4I0A A;  3LSK A;  1MIJ A;  4HX7 A;  3DV8 A;  2XSJ C;  2EFP A;  1TWC J;  2DPD A;  5L3C A;  2D5V A;  3F72 A;  3FXU A;  3HXL A;  2CYY A;  4DZP A;  1YOV B;  1GV5 A;  1FBS A;  4AIK A;  1ETV A;  2KIM A;  1PP8 F;  2WBM A;  2MA3 A;  5HNH A;  3BR2 A;  3BJ6 A;  1LDJ A;  3WTT C;  2IGM A;  4KA4 A;  2W84 A;  4RGU A;  4FT8 A;  2X6X A;  2M0C A;  5JVT A;  1E3P A;  1RET A;  4O3M A;  4BXX J;  3ELK A;  3G4S I;  1XX5 A;  2HZT A;  3H5A A;  2AHQ A;  3KZY A;  2DA5 A;  2P0W A;  1ETX A;  3QRF F;  3CCE I;  1NTC A;  2VE9 A;  2L4A A;  2Z9O A;  2V6E A;  1YQA A;  4B8X A;  4H0E A;  2NVQ J;  2R7S A;  2WC2 A;  1RR8 C;  5HS7 A;  4K2E A;  2EFN A;  4BAC A;  2K27 A;  3EUH C;  4XKV A;  4M9X A;  5B66 C;  2DU9 A;  3DQV C;  4L18 B;  3Q9S A;  1XN7 A;  3VSK A;  3BR1 A;  1TC3 C;  4IRH A;  4CCJ A;  1J09 A;  2P5V A;  3C2H A;  1R71 A;  1MJB A;  2HEO A;  3HOV J;  5LBQ A;  2V9V A;  1F9N A;  2H1L A;  2XRN A;  4AUX A;  5J47 A;  4MEX F;  4I6Z A;  4F93 B;  4MQ9 F;  3D5L A;  1Q1V A;  1G3S A;  1PDN C;  2HTS A;  2WA0 A;  2P5K A;  1LVK A;  1P4W A;  4U88 A;  3K69 A;  1BR4 A;  4RLQ A;  4DNC A;  1V55 H;  4OMY A;  2D2W A;  2HVS A;  3PO2 J;  4ABZ A;  2DOA A;  1QVU A;  4Y7N J;  3H36 A;  4NBQ A;  4XID A;  2H8R A;  4GGG A;  1RKW A;  3DKW A;  3LQQ A;  4IRG A;  1R1U A;  3GTG J;  2DOF A;  2LDU A;  3E97 A;  2RRE A;  3OS1 A;  3I54 A;  2F5C A;  2DPU A;  1U2W A;  3ZQQ A;  2ECB A;  3R61 A;  1OPC A;  1S6L A;  2Y0S A;  2PJP A;  2V26 A;  4XRM A;  4EV0 A;  3QYE A;  3V7S A;  2XC7 A;  1YX5 A;  2KLO A;  2QEN A;  4JBA A;  1JHF A;  5GP9 A;  1MJA A;  4P1W A;  1YE9 A;  3FK7 A;  4HLX A;  4A3B J;  3LSR A;  5HDG A;  2O3F A;  1QHG A;  2VBW A;  4F3Q A;  3ISP A;  2XDV A;  5FO5 A;  1VTN C;  1WH7 A;  2RNG A;  1AKH A;  1YHQ I;  5K7F A;  1Y8Q B;  4Y52 J;  4E7S A;  4M3F A;  2UWM A;  4IHS A;  2DA2 A;  4EMS A;  2HOS A;  3GEZ A;  3ZQC A;  1B8I A;  1FSE A;  4LB6 B;  4B09 A;  2IA2 A;  4RLF A;  3SDG A;  1HC8 A;  1WCM J;  3VDX A;  1V5E A;  2VON A;  1SEU A;  3BT9 A;  1RI7 A;  2V1U A;  5F04 A;  2BY1 A;  1FSH A;  3VEP A;  3ZQF A;  2VAS A;  4LK0 F;  3AL0 C;  3T8T A;  3I4P A;  1KZH A;  1MDM B;  2IAI A;  3AKZ A;  3SJM A;  3WTW C;  2IT0 A;  3HOX J;  3MKZ A;  3CJQ B;  3HKZ N;  3I9V 2;  2OPT A;  5D4S A;  3GLX A;  2HPI A;  4JX5 A;  2D1V A;  3DKY A;  2RNJ A;  4R1H A;  4RA2 A;  1SD6 A;  2R7Q A;  3V7R A;  1I6H J;  3IHU A;  1FLI A;  5D8L B;  2VKH A;  3KZI C;  1X1B A;  1Y6I A;  4XIC A;  5FRM A;  1RPW A;  3BCA A;  3E0J B;  1JT6 A;  1OYW A;  4U0Y A;  1XGN A;  3BG9 A;  4BQQ A;  3IRQ A;  3GUD A;  2WAD A;  2AQF A;  1F4K A;  4NNJ A;  2Y30 A;  5DCM B;  3NAU A;  4QIW N;  2A5Y B;  3E6C C;  1HKQ A;  1K83 J;  3CUQ B;  4UHT A;  3IAS 2;  2E71 A;  2O5R A;  5EEH A;  1QBJ A;  2XF6 A;  2ZO4 A;  4A5M A;  1LPQ A;  2PMZ A;  4IQJ A;  4YIF A;  5ICG A;  1VQ9 I;  5D6F A;  4L0Z B;  3OOP A;  4A5N A;  3CD6 I;  4C2T A;  1ZG1 A;  2EIN H;  3KP6 A;  2X48 A;  3G1M A;  3J80 K;  2MSY A;  1Y0N A;  1RRJ A;  1W36 C;  5L3F A;  2FNA A;  2FSW A;  5TJJ A;  3OYJ A;  1QZZ A;  2HYF A;  1TLH B;  5FKO A;  2PEX A;  3K1M A;  4A3G J;  4FE7 A;  2VPR A;  2OCC H;  3J7A Y;  3LSJ A;  4XLA A;  3HTU A;  2XRO A;  2KFD A;  2X1E A;  1CF7 B;  2O9L A;  5TGT A;  3S2D J;  4NC7 A;  2IPQ X;  1KYW A;  3KYC B;  2X6O A;  3JRC A;  2FA5 A;  2XGC A;  3HPG A;  3FHZ A;  2KDZ A;  4DYC A;  4HV6 A;  4ZH4 F;  1OCC H;  2ETH A;  2L9V A;  4XLF A;  4ZYE A;  3D1N I;  1JKP C;  1XDS A;  5FD6 A;  3GTQ J;  3ASO H;  4QTR A;  2LFB A;  5E3N A;  4LOC A;  2Q2E A;  3ZPL A;  4XOR A;  5B3S H;  5B5E C;  2Z33 A;  1P7I A;  2DFI A;  4CSW A;  3BZ6 A;  2E35 A;  2PMZ N;  2QA4 I;  1O3T A;  2ZNZ A;  1ON2 A;  2F5V A;  1BR2 A;  5DTD A;  2EIK H;  3S3N A;  2L5Q A;  3SFI A;  4YFK F;  1UB9 A;  2LKS A;  3J81 Z;  5EYR A;  4MTE A;  5H2F C;  3BZK A;  1MBH A;  1O7F A;  4CZC A;  3DLA A;  2WY8 Q;  3QP5 A;  2VKD A;  3WU1 B;  2VLA A;  2DT5 A;  1K4T A;  4BQA A;  1OR7 C;  1DGR M;  2W57 A;  1MBK A;  2CW8 A;  2LMD A;  2ZSH B;  2EZL A;  3IH3 A;  2CUZ A;  1FYM A;  2GIV A;  4LLL A;  5M3F J;  3I4N J;  4BAY A;  1UFM A;  3CO7 C;  2CV2 A;  2G7H A;  5CJ9 A;  4BH9 A;  2RQQ A;  3TDZ C;  3CP8 A;  1Z7L A;  2OA4 A;  1X3U A;  2E1M B;  2FOW A;  2ZJ2 A;  2FMY A;  4GYI A;  1HW5 A;  4BHC A;  3RZD J;  2QUF A;  4P9F A;  3F21 A;  4IHX A;  3OYE A;  3OSF A;  2VT2 A;  1DU6 A;  1FEX A;  3J81 K;  4PJJ A;  4HV5 A;  2IS1 A;  2DMT A;  2LF8 A;  2XGE A;  3J7Y J;  2HXO A;  1J0R A;  3O8G A;  2FQ4 A;  3DU6 A;  2ZFU A;  1UHW A;  1AA7 A;  1KQ9 A;  1B4A A;  1ZGJ A;  3TO7 A;  3RKQ A;  1R49 A;  4C2U A;  2G9W A;  3HZJ A;  2WAE A;  3MMY B;  1OKR A;  4MTD A;  4A3J J;  2EH3 A;  2RV8 A;  1FP2 A;  3CF2 A;  5BPD A;  3KYD B;  3GTL J;  3E6M A;  4XKB A;  2BW3 B;  3HGY A;  3SEQ A;  4EGZ A;  2QQB A;  5FD5 A;  5KAF C;  3K4M A;  3A2K A;  1DPR A;  1OMI A;  4KIT B;  5J8F A;  3CCQ I;  1DDN A;  2DA6 A;  3WU2 C;  3Q0W A;  1QA6 A;  2A68 F;  3C7J A;  1VI0 A;  3T5X A;  3RDI A;  1W1W E;  2KZG A;  4LFU A;  2EIL H;  3G71 I;  3QPH A;  3ONQ A;  4OU0 A;  3K2A A;  1MND A;  1I27 A;  5IT9 Z;  4UV9 A;  4S04 A;  4WXD A;  2IVM A;  4JK1 X;  4DGW B;  3RI4 A;  2ECC A;  3EDP A;  3BDD A;  2CUJ A;  4E7L A;  2HYJ A;  1R4M B;  2LLK A;  4CCM A;  2LTP A;  2DQL A;  2WV0 A;  5D5X B;  3M8J A;  4DYR A;  1HW1 A;  4AVP A;  1FBU A;  2XSD C;  4XNF A;  2JVG A;  3P5J A;  3SYT A;  1E17 A;  3KP5 A;  4PJN A;  3GBG A;  2V6C A;  3RKY A;  3T1B A;  4U0V A;  2HQA A;  2W25 A;  1AOY A;  4PUS A;  2P81 A;  5B1B H;  3CDH A;  3P9K A;  5E79 C;  3S15 J;  1IZ1 A;  3I0T A;  3EYI A;  1KQ8 A;  5HDN A;  1BIA A;  4A3L J;  2RQP A;  1A36 A;  3CQZ J;  4BJ6 C;  3HKZ A;  1GUU A;  5DUK A;  3CCR I;  2JA8 J;  2N8G A;  2CQK A;  1MH4 A;  2LKP A;  2LBF B;  1APL C;  2IS6 A;  4MEY F;  2QWW A;  5FGM A;  3E5U A;  3I59 A;  4AYB N;  1Y39 A;  3CCM I;  1ITY A;  3I59 B;  4IHT A;  2Y69 H;  2F2E A;  1HDD C;  4II2 A;  2GLO A;  2VL8 A;  2TDX A;  1G8X A;  4W97 A;  4AYB A;  1TQM A;  1MD0 A;  5J6X A;  3Q3S A;  3S1N J;  3R60 A;  4C30 A;  2P7V B;  2R5Z A;  1ETO A;  4HW0 A;  2ZC2 A;  4M6Y A;  2R5Z B;  1VQL I;  2MC3 A;  2ISY A;  2GXG A;  4XBF A;  1X1A A;  5M5Y J;  1S7E A;  2FXA A;  2Q8K A;  1HBX G;  2O61 A;  2RDP A;  2H6C A;  1I50 J;  2CG4 A;  3H5R A;  1R5G A;  2HFH A;  2KL4 A;  4M72 A;  4FAS D;  2Y75 A;  4XLP F;  2QBY B;  1ORK A;  2HDD A;  3GTP J;  5K5Q A;  2IW5 A;  1AWC A;  2ZJQ F;  1H9T A;  3L9F A;  1GHC A;  3HJE A;  3OYL A;  1SAU A;  2MH9 A;  2QQ8 A;  3HIF A;  4A6E A;  3VOE A;  3DBR B;  1VFC A;  1EF4 A;  3BZC A;  2D45 A;  2XGX A;  5LFA A;  4WCG A;  4ON0 A;  2GBY A;  4WXC A;  2CRG A;  2KIQ A;  3ZCO A;  1TTY A;  3ZQI A;  2HTJ A;  1ZRE A;  1JKO C;  1BR1 A;  4HF2 A;  4D7M A;  2EV6 A;  2R7O A;  1DP7 P;  1Z05 A;  1RKT A;  4RBO A;  5BPI A;  2F48 A;  1MNE A;  5LGT A;  2VOP A;  1G59 A;  3OYH A;  1MDM A;  1G3Y A;  3IL2 A;  1X2M A;  2FU4 A;  3HRM A;  2XKO A;  1Y1W J;  1L3L A;  4RAY A;  1EA3 A;  4A3E J;  4XON A;  4Q4Z F;  3E3V A;  2ACJ A;  2I5U A;  1YIO A;  3BPX A;  4CGZ A;  2M1B A;  5M3M J;  1RIO H;  4B48 A;  1BI3 A;  1UMQ A;  4V19 K;  3ZRG A;  4B47 A;  2A3S A;  3S3O A;  2L4M A;  3TKY A;  1X4P A;  2NNN A;  2HZD A;  3O3K A;  2DOD A;  2FD5 A;  2JVH A;  2QYO A;  4ITV A;  4PZJ A;  3ZQG A;  5EEG A;  1SFX A;  2LKX A;  1FPQ A;  5LEJ A;  2NVT J;  1POG A;  1QNT A;  2LVS A;  3CCU I;  1IGN A;  3RIR A;  1BOA A;  4UUT A;  4RAF A;  1R4N B;  3W6J B;  3F9K A;  2QZ8 A;  3EET A;  5DD8 A;  2KRH A;  3VWB A;  1ZGA A;  4IRI A;  3B6C A;  3M1C A;  3SHF A;  2QCO A;  3LNQ A;  2LSO A;  3LA2 A;  2DJI A;  3BR3 A;  3GF2 A;  4HPQ A;  3RTR A;  1JKQ C;  2VE8 A;  2DMN A;  2IGO A;  4HEA 2;  2HKO A;  5CVR A;  5IP6 A;  1XSD A;  4UNO A;  1LB2 A;  4LJZ F;  4IOA F;  3S1R J;  4P9U A;  3BTC A;  3Q0U A;  2NS0 A;  5J4V A;  2CW0 F;  3RQI A;  1FOW A;  1ODD A;  3A01 A;  4UVA A;  2E34 A;  2HI3 A;  2LF7 A;  1D5Y A;  3KFW X;  5CKT A;  1F36 A;  5GPA A;  1SFK A;  2BEO A;  1RNL A;  2K40 A;  1S72 I;  4HOB A;  2XV4 S;  2NS7 A;  3UKG A;  1J7K A;  3WTS C;  3M7G A;  1MGT A;  1J75 A;  1B59 A;  2R7D A;  4BQO A;  3RYP A;  3JRD A;  1LDD A;  2OU2 A;  3ZR8 X;  3H0G J;  2R5Y A;  4Q48 A;  2V9P A;  2DYS H;  1WI3 A;  5D6E A;  5ED4 A;  3PNY A;  2L3D A;  3WTV C;  2QKM B;  3PQJ A;  1YFH A;  2VQG A;  1LE8 A;  4IHY A;  2FBI A;  4A69 C;  3JRB A;  3G1O A;  3PFI A;  2K9Q A;  5FLX Z;  1QU3 A;  2G7U A;  5FLV A;  4B44 A;  2BV6 A;  5E1X A;  1ZK8 A;  4XRS A;  3KET A;  2EFO A;  1VQ8 I;  4BE0 A;  2QSF X;  1RUO A;  1SFE A;  3AG3 H;  5CLS A;  5CQE A;  2IS2 A;  1HDP A;  1YIJ I;  1YI2 I;  3L09 A;  4XRF A;  3F22 A;  1FT9 A;  1CGP A;  5F08 A;  1JE8 A;  4UV8 A;  2NOJ B;  1Z91 A;  2Y9Z A;  3RPQ A;  1T39 A;  2F5E A;  1IW7 F;  1I1G A;  3KP7 A;  4PJM A;  4RGR A;  2WB1 A;  1N77 A;  2H27 A;  1UAA A;  4UB8 C;  2NVU B;  4RAG A;  3GW2 A;  3OYG A;  3N05 A;  1EH6 A;  3ZQL A;  2K9N A;  3OYI A;  4ANJ A;  3W6V A;  2IS4 A;  1T2K A;  2EFW A;  3ECH A;  2PMU A;  4LG0 B;  1K61 A;  4LG0 A;  3FBN B;  4ZYH A;  5J4Y A;  1ULY A;  4HG2 A;  3U1K A;  4ZZD A;  4CXF A;  2YPR A;  4CH7 A;  1W7P B;  1W36 D;  1W7P A;  1QGP A;  1XS9 A;  2BXZ A;  2J5P A;  2KPM A;  1H9G A;  4WWC A;  1LUJ B;  4ENM A;  1JJ6 C;  1JUM A;  3F0C A;  2EK5 A;  5EF6 A;  1L0O C;  1IRF A;  2A5W A;  1Z21 A;  2ID6 A;  4D1Q A;  2VXZ A;  3DBH B;  5HOO A;  1B8I B;  2JQ7 A;  4H4K C;  3S3M A;  2VPL A;  1ACI A;  2R4G A;  3S32 A;  5HLH A;  4KT5 C;  1SAN A;  4I99 C;  2DYR H;  1I3A A;  2M4G A;  1X4O A;  2W7N A;  1T98 A;  4HA8 A;  4F55 A;  4ESF A;  3O6B B;  2DAO A;  2G0E A;  2RC4 A;  4N4O B;  4LLN A;  4KJZ A;  2V1D A;  1D1B A;  3DEW A;  3OYM A;  3S2W A;  1YJW I;  3ESW B;  1QHH D;  4IO9 F;  5HVQ C;  1Z67 A;  5CVJ A;  1OCT C;  1A35 A;  3NEU A;  3MZ8 A;  5FRO A;  1U3E M;  4EJW A;  4OAZ A;  5EDN A;  3HL2 A;  5TRD A;  1MMN A;  3E5Q A;  2DA1 A;  1GV2 A;  1OFC X;  3FXO A;  1D0Z A;  1D3Y A;  1Z3Y A;  1Z3X A;  1WVR A;  1YS6 A;  2LR8 A;  4GCV A;  1BC8 C;  2AXT C;  4ZYG A;  1V5F A;  4BS9 A;  3B02 A;  1GVJ A;  5F1J A;  4OIN F;  1QRY A;  2YX7 A;  1WKM A;  3HUG A;  4L9N A;  2A69 F;  4HF0 A;  1OYI A;  3I71 A;  3S14 J;  1H88 C;  4EM1 A;  4MNU A;  2BYV E;  3Q0V A;  3PQK A;  1YIT I;  4ESJ A;  1Y8R B;  4HX4 A;  4NUB A;  3ZOB A;  2P6S A;  3JSO A;  3L2W A;  3I64 A;  2QVO A;  4AWX B;  5L3B A;  3TO6 A;  1LNW A;  1B6A A;  2CFX A;  3OIQ A;  4M9S A;  1KA8 A;  5DM6 F;  3TP0 A;  4IX7 A;  1JGS A;  1XGO A;  1SVM A;  3ROU A;  1ZR2 A;  3H5N A;  3HOY J;  1UHS A;  5E3M A;  3DWL E;  5CPR B;  2W48 A;  3ERE D;  2M45 A;  2YS9 A;  4P96 A;  5JHU A;  4BHB A;  2ID3 A;  1OJL A;  1RUN A;  1JT0 A;  2STT A;  3U9G A;  2Z99 A;  3RKX A;  3AG4 H;  1YTY A;  1NHA A;  5D5W B;  1Z0X A;  4XLE A;  3A02 A;  2DDA A;  1ZKG A;  2DJN A;  4JX6 A;  3FM3 A;  5FFX A;  1SD4 A;  1IG7 A;  3HOT A;  4I7H A;  4M74 A;  5DDG A;  2CU7 A;  4IPA A;  4M3B A;  2D1H A;  4XN0 A;  4HQM A;  1UZC A;  2IEK A;  4E7K A;  1OCP A;  3REO A;  2UUZ A;  3RYR A;  4E70 A;  3Q9V A;  4E7H A;  1FIA A;  2ZME A;  3JW4 A;  5DUI A;  5HS8 A;  3HRS A;  3GME A;  1FY7 A;  3PUB A;  1O4X A;  4X1E A;  2O0Y A;  1WJD A;  2HKX A;  3U2R A;  1R7J A;  3GXO A;  3P7N A;  2EIM H;  3DTI A;  3WTZ A;  5E8I A;  4U87 A;  2JA7 J;  3DP7 A;  1UHM A;  2AQE A;  5BS6 A;  1TL8 A;  4CCO A;  2DK8 A;  2DFH A;  2HOE A;  4PGH A;  1TBX A;  5E3L A;  4DJA A;  3TQN A;  3EUA A;  1ZR4 A;  1BW5 A;  4XM3 A;  3IWF A;  3GCM A;  3SDB A;  3DEE A;  4XR6 A;  5DD4 A;  4HYE A;  2EZH A;  2PMH A;  5GAE J;  5TIS C;  1I6X A;  2V1X A;  1SD5 A;  4GYG A;  4HSR A;  2PQ8 A;  4G7H F;  4KMU X;  2Y9Y A;  4KNY A;  3OWT A;  5E17 F;  2JUG A;  5D5V B;  2YSR A;  3QU3 A;  5GPC A;  1TQP A;  3OL3 A;  4CYC A;  1PUF B;  1J59 A;  1G2H A;  3CCY A;  1YS7 A;  2VOO A;  1IN4 A;  2DLL A;  3ERM A;  4AVZ A;  4FCY A;  3ZQ7 A;  4NHJ A;  3FKJ A;  1B1B A;  2L7Z A;  2VBY A;  3KEO A;  2BY3 A;  1D1C A;  3DFG A;  4GFB A;  2NYX A;  2A07 F;  3S1Q J;  3RZO J;  4AD9 A;  4YIR X;  4E7J A;  4KN7 X;  5IYB J;  3HTS B;  2ZFW A;  3M9A A;  3CCL I;  3WTU C;  4KIS A;  3S1M J;  2EB7 A;  5LHH A;  1R23 A;  2Y0S N;  4PJ0 C;  1D0X A;  3K2Z A;  1LVA A;  2VIX A;  5IT3 A;  5JI6 A;  4Y4R A;  1BI2 A;  1RZ4 A;  4C3I J;  4X6A J;  5J1Y A;  3W3C A;  2W82 A;  1Z6T A;  4EAT A;  2X9D A;  2V1N A;  2Z3Y A;  1DPU A;  3CO6 C;  3A01 B;  1TWA J;  2ELJ A;  2XAF A;  1TNT A;  1D1A A;  4G12 A;  1O3Q A;  2FBK A;  1XCV A;  3IH4 A;  4BU2 A;  3ECO A;  3GFI A;  4KUM A;  2M34 A;  4UVB A;  2F5D A;  2WAF A;  2M4K A;  4A93 J;  4EJU A;  4HBL A;  5GAH J;  4IXA A;  3GWZ A;  4DIQ A;  1FX7 A;  1MW7 A;  2KQR A;  2ZME C;  4JYK A;  5HS9 A;  4E7I A;  4ZDO A;  2LK2 A;  3MKY B;  3ZQH A;  3V4G A;  2LY9 A;  1UG0 A;  3LA7 A;  4KIG A;  1FZP B;  1YRN B;  4FTH A;  5E18 F;  3MZH A;  3JR9 A;  4CHU A;  2X51 A;  1BJZ A;  3N4M A;  1LEA A;  2L7M P;  1MMD A;  1O3S A;  1MSF C;  5J8C A;  2YR2 A;  1ZG3 A;  1WZ2 A;  3LQR A;  4I2O A;  4N4N B;  1T8I A;  1OIS A;  3L2Q A;  1NH3 A;  1QZE A;  3FXJ A;  1OCO H;  3OIO A;  2VJI A;  1IXS B;  3FBI B;  2NXN B;  1S29 A;  2FML A;  2MG4 A;  3K4K A;  3PJR A;  1VF9 A;  1ETW A;  4ENN A;  1YW9 A;  4HDV A;  1ZRD A;  2HU9 A;  1X58 A;  2VC0 A;  1D8J A;  5LEK A;  2QKL B;  1TWG J;  2E60 A;  3FWE A;  3MVP A;  4YFN F;  2VI6 A;  1QO0 D;  1NG7 A;  1U5T B;  1SFU A;  4D5F A;  4BUP A;  3LOC A;  1ZHF A;  2XF7 A;  2FEZ A;  4U7B A;  1F43 A;  3AG1 H;  2AXL A;  1X3W B;  3BQY A;  5EGO B;  3LFU A;  3GX4 X;  1SFO J;  1NG6 A;  4GXO A;  3NWS A;  4EJT A;  2M30 A;  1KU2 A;  3QYB A;  1REP C;  5BMZ A;  5EZG A;  3F8N A;  1E0E A;  4I01 A;  4WX9 A;  1WRJ A;  1WI9 A;  4HAM A;  4KIB A;  2H94 A;  1VQP I;  2O7O A;  2E2H J;  5KVR A;  3OYA A;  5FLX K;  1RR7 A;  5EJC A;  3TW6 A;  1Y1V J;  1A6I A;  1XMA A;  3WE2 A;  1OCR H;  4M6V A;  3WE3 A;  1WH5 A;  3HC7 A;  1AHD P;  2Y48 A;  4RM3 A;  2JZY A;  3HPH A;  5FRN A;  1N75 A;  4W1U A;  3AAF A;  3HM5 A;  3HSE A;  2F5F A;  2BOL A;  1VQ6 I;  2Q1Z B;  4I76 A;  2VQC A;  3VYS B;  3HOS A;  3C1D A;  2V7F A;  3E6D A;  4M6X A;  3OYD A;  1XMX A;  5JHF A;  3FDY A;  4S05 A;  1KYZ A;  4N9I A;  4PJL A;  1FTZ A;  1TQI A;  2L0K A;  1XPX A;  1T56 A;  1MBE A;  5CVI A;  2EV0 A;  1FYL A;  1T0F A;  3H9G A;  3ASN H;  2RVC A;  5F1R A;  1X2N A;  3HHH A;  5IOZ A;  2R92 J;  2L7F P;  2PG4 A;  4EVI A;  5E1W A;  2JSC A;  2R7V A;  2P7C B;  3QPS A;  2K9L A;  3OSG A;  2EPF A;  4B3X A;  1ETY A;  3BC8 A;  1Z9C A;  1JGG A;  4F7Z A;  4BYY A;  2XIG A;  4R79 A;  2QEX I;  2X1C A;  4BBR J;  2XHK A;  1HXD A;  3DEU A;  3PSI A;  3DTE A;  2RAE A;  1O3R A;  2VJ5 A;  3V8L A;  4ENJ A;  3BPV A;  1ENH A;  4D7N A;  3TOA A;  2P6T A;  3VYU B;  2QF7 A;  3CMM A;  3GTK J;  3LSI A;  2COM A;  5LHI A;  4OMZ A;  3HGG A;  1MH3 A;  2O03 A;  1GXQ A;  4HZF A;  3OR2 C;  2FUG 2;  1BJA A;  2W85 A;  1LFU P;  4WF2 A;  1NK2 P;  3LSM A;  2JMW A;  1W4M A;  4KIC A;  3BQZ A;  3UNG C;  2VKE A;  3RPU A;  3DBL B;  4EEF G;  4G8X A;  3S16 J;  4XLC A;  5E20 A;  3H9Q A;  3L2C A;  1KU9 A;  3DTK A;  3CC4 I;  1SVL A;  4C9Y A;  2VUM J;  2Q2E B;  5IP7 J;  3SZG A;  3WTY C;  3SQN A;  2F6C A;  2H6B A;  1GT0 C;  2R7Z J;  3KZZ A;  1U8R A;  1KQ0 A;  2GM4 A;  1ETQ A;  2EWN A;  1FWZ A;  3M8E A;  2L9R A;  5J1U A;  5ILU A;  2M8E A;  2WAQ N;  4G6T B;  1YYV A;  2ZKZ A;  4Y33 A;  1X1P A;  5CYV A;  2ME6 A;  2XVC A;  2GXB A;  2E2J J;  5F0H A;  5DM7 F;  3J80 Z;  2DA4 A;  3MWM A;  3WG9 A;  2DFF A;  1QZY A;  5EG0 B;  4N0B A;  3TED A;  3RCO A;  2KZV A;  2OQG A;  1PYV A;  2IRF G;  1FJL A;  2KT0 A;  2JUC A;  1YW8 A;  1WHU A;  2M87 A;  3CUO A;  1QPI A;  3MAJ A;  2CSO A;  5IYD J;  2EA2 A;  1QVT A;  5E1Z B;  3ABU A;  3CDL A;  5LGN A;  1R1V A;  2DO7 A;  3A1Y A;  3I3L A;  3ULQ B;  5LRS A;  3ZMZ A;  4LD5 A;  4TV7 A;  2X6Y A;  2XF5 A;  2I8D A;  3HBL A;  1ZG5 A;  3R0J A;  3FXL A;  4I0B A;  4Z2Y A;  1IRX A;  3HB9 A;  1B72 B;  4BQN A;  4DYQ A;  2UXX A;  3LA3 A;  1E3H A;  2W1O A;  2M9H A;  3DF8 A;  3L7W A;  3B6A A;  2CW7 A;  3PUF A;  4P55 A;  1T38 A;  1VQN I;  3H9J A;  1ZQ3 P;  1MBF A;  2DN0 A;  2OZ6 A;  4AIJ A;  4BDZ A;  3CJR B;  4PK4 A;  1LFB A;  1P2F A;  1Q1H A;  3TDU C;  1W5C C;  5FFZ A;  3PIP F;  2OJE D;  5K7Z A;  3D0S A;  3EUH A;  2E7X A;  2FX0 A;  1A6Q A;  2ZXJ A;  5ILV A;  1I3Q J;  3B73 A;  3CLO A;  2GA1 A;  2IGK A;  3E1S A;  4BXU A;  3BG6 A;  3QQA A;  4S0H B;  3L1P A;  5AON A;  3Q5F A;  1IJW C;  4XOT A;  2L7K A;  4A3D J;  2YU3 A;  3D5S C;  1Z1D A;  3J7Z I;  1ZRF A;  2JA2 A;  1FTT A;  4IQ4 A;  2Y0M A;  1BC7 C;  5F27 A;  5DEQ A;  4BE1 A;  2UXN A;  1X1D A;  4I98 B;  1R9T J;  1A04 A;  2O6G E;  2XPU A;  3H3Z A;  5ICF A;  1IO2 A;  1B9M A;  2HWV A;  4MIM A;  2Z2S B;  5ERI A;  1S9H A;  3IRR A;  3OS0 A;  5J1R A;  4ETS A;  1S3J A;  2MH2 A;  3F6O A;  4Q47 A;  2BHZ A;  3GZ5 A;  4LLG F;  2V4J C;  3GTJ J;  2LD5 A;  1WGX A;  1I39 A;  1WWX A;  3VYR B;  1WJF A;  3JRG A;  1X3Z B;  3JSP A;  4KN4 X;  3LSP A;  2PJR B;  1IRG A;  2PJR A;  1MZB A;  2V9K A;  1P7J A;  3AL0 B;  3HRT A;  2NAZ A;  4Q5S F;  1UG2 A;  2ZB9 A;  5CQG A;  1F1Z A;  2HQR A;  2QM3 A;  3H35 A;  3CCJ I;  5J3L A;  4CCN A;  2CQX A;  1ZEL A;  5D4R A;  2OZU A;  4II3 A;  5HNF A;  5GAG J;  1QPM A;  2X4H A;  2VN2 A;  2IBD A;  1JHH A;  2MC4 A;  2PBI A;  3RKW A;  5ILS A;  5BNG A;  4B4C A;  1HOM A;  3A0H C;  2EQR A;  2DMQ A;  1ZAO A;  1XMK A;  2GXA A;  3C2B A;  4M3G A;  1TT0 A;  4HQE A;  2JTV A;  2XKP A;  1JUS A;  2GZW A;  2GOX B;  3QU6 A;  1YLF A;  2QGU A;  1XGS A;  3HYI A;  1JTY A;  5EZH A;  1H89 C;  1U5T C;  4G6Q A;  4I02 A;  2XB5 A;  4O6J A;  4QPQ A;  2EA4 A;  2X0L A;  1HW2 A;  2BY2 A;  2R93 J;  2QQ9 A;  1HSJ A;  2K5C A;  3BG5 A;  1E2X A;  2DQR A;  1FYK A;  2A6H F;  2LY2 A;  3ZN1 A;  2WTE A;  2CJJ A;  3QOE A;  4BY7 J;  3VYT B;  1HF0 A;  1JI8 A;  3JRA A;  2FJ1 A;  5AIP A;  3H3V K;  4M9Z A;  1STZ A;  1IXR C;  1MNM C;  4I09 A;  4IL6 C;  3KYL A;  3I58 A;  3I53 A;  1SMT A;  5J40 A;  2KDO A;  5HLG A;  3F23 A;  3V8J A;  1VQ5 I;  2BZT A;  2GA2 A;  5H6R A;  3P9I A;  3TGN A;  1V54 H;  2ELH A;  3E7L A;  3I56 I;  3HSF A;  2QLZ A;  4L0Y B;  3LAJ A;  1HLV A;  2XPV A;  4LIU A;  2K86 A;  5DCM A;  1R00 A;  3LFK A;  2FE3 A;  1WJB A;  4XLH A;  1SC7 A;  3BLY A;  2L01 A;  2DOE A;  3J7A O;  1FOX A;  2BE5 F;  4KT6 A;  3O8H A;  2E1O A;  3KP4 A;  1TW2 A;  4M3D A;  3S2H J;  3K0L A;  1MMA A;  1EKE A;  4NQW B;  1HCR A;  3KX2 A;  1XG1 A;  3DKX A;  4RGS A;  4XN3 A;  5IYC J;  2C6Y A;  2K4B A;  1K7A A;  2BXY A;  1BM9 A;  2FOK A;  3BR0 A;  1PJR A;  2RN7 A;  3TOB A;  2KIU A;  3P9C A;  2YX4 A;  1UEL B;  2CQN A;  2LP0 A;  1C0W A;  3HOZ J;  4ZDP A;  2B7E A;  3H92 A;  1U0J A;  3K4N A;  1K78 A;  1ZTR A;  1PP7 U;  1IXC A;  3FMQ A;  4RGX A;  3R6S A;  5IY5 H;  3MEX A;  1IDY A;  4RS8 A;  2ZJR F;  4PCQ A;  2M3A A;  3K1P A;  3CTA A;  4Z6Y A;  4YEJ A;  3CJN A;  1X19 A;  2YU9 J;  3K4L A;  4LIV A;  3FMS A;  2FQ3 A;  3CCV I;  1TZL A;  2IA0 A;  2YUS A;  2H09 A;  1MMS A;  3GZ6 A;  4CZZ A;  1BI0 A;  2HPM A;  1M1E B;  2M7A A;  4GRI A;  1AKH B;  1QQI A;  4D5C A;  4BGD A;  4FHT A;  4BEH B;  4C3H J;  2A05 A;  1LDK B;  2J5O A;  2DBB A;  1BBY A;  2MGQ A;  1GXP A;  4KFC A;  3K4J A;  4CYD A;  2KJC A;  2DI3 A;  1BL0 A;  2DTR A;  3O2P E;  1XB4 A;  4V2G A;  3FXK A;  3CUQ C;  3FXR A;  4UUS B;  1P4A A;  5H20 A;  2BHY A;  5LHG A;  5HLT A;  1R6R A;  1VQM I;  2GWR A;  5JLW A;  5HOD A;  1DGW Y;  3CCS I;  1W5S A;  2X85 A;  4G6D A;  1IV6 A;  4XKC A;  1WJA A;  1WJE A;  3QPL A;  3FIW A;  3BR5 A;  3BJO A;  3DCF A;  4D9J A;  2HOA A;  3MQ0 A;  1XTA A;  1G6N A;  2HXI A;  4UY8 I;  2M0M A;  4A3I J;  4PSX A;  1W0T A;  1P92 A;  2PN6 A;  3CME I;  2AS5 F;  3E6B A;  1XSX A;  3BR6 A;  3MKW B;  2LG4 A;  4RB1 A;  3AFH A;  3BTI A;  1WJC A;  4CYC B;  3HHG A;  2VJJ A;  3C18 A;  2MD5 A;  2L02 A;  3ABT A;  4HNU A;  4BDY A;  1W7P D;  3CJT B;  4ZYD A;  5LRR A;  2HS5 A;  3CZ6 A;  3L00 A;  4CA0 A;  5IPA A;  1K6O A;  1IF1 A;  1LQ1 A;  4CUG A;  4UB6 C;  4A12 A;  5ICE A;  1HQC A;  9ANT A;  2DXI A;  2IXS A;  4J01 A;  3G2B A;  2BW3 A;  2EFQ A;  1U9N A;  2CQQ A;  2VKV A;  3GVA A;  2P5L C;  1S7A A;  3MCZ A;  2X6W A;  1SD7 A;  2QQA A;  4DZJ A;  1XSV A;  2VBZ A;  2R7X A;  4BXF A;  1S7O A;  1B9N A;  1BIB A;  4CCL A;  3CC2 I;  1LEB A;  4OIP F;  2CS3 A;  1BOB A;  2M5W A;  3U1D A;  1EH7 A;  2L54 A;  3NQO A;  2JPC A;  3COA C;  5JLX A;  5BQT A;  2R0Q C;  2F4I A;  2KRC A;  4FET A;  1ZRC A;  4MFE A;  2CQ7 A;  4Y17 A;  5DCF A;  3OYB A;  4NC6 A;  2BBY A;  1B72 A;  1U5T A;  4QSH A;  4BJ5 C;  4CO8 A;  4KYW A;  3K1N A;  2GIZ A;  2LOO A;  2JN6 A;  1FP1 D;  3KCC A;  2CFO A;  4QPO A;  3FZV A;  3G3Z A;  3HEF A;  2E5N A;  3GTM J;  2DA7 A;  2JT1 A;  3OR1 C;  3AG2 H;  3OOU A;  4AM3 A;  1XCB A;  3M1E A;  2B63 J;  2LY1 A;  4AU7 A;  4RMN A;  5ICC A;  2MW8 A;  3TP3 A;  1BN5 A;  3CLQ A;  2E1M C;  3SXY A;  3F8B A;  3JTG A;  4CIC A;  2WY7 Q;  3A0B C;  1FOY A;  1RES A;  5LLQ A;  4DOZ A;  2F4M B;  4DBQ A;  5L3D A;  5KK1 A;  1V4R A;  4IF4 A;  4RB2 C;  3DXJ F;  2IP2 A;  3M8F A;  1T95 A;  3WTX C;  1S8N A;  1XGM A;  3EPZ A;  1YW7 A;  2W4S A;  3ML6 A;  4JOM A;  4EM0 B;  4BJT A;  2KP6 A;  3WGI A;  4HST A;  2CV0 A;  2E19 A;  1ZN2 A;  3GFJ A;  2WWY A;  1R5I D;  4HNV A;  1JJ8 C;  2R7W A;  1JXS A;  1V5G A;  3OL4 A;  3ZMS A;  3QOD A;  4ZJZ A;  2KIF A;  1IAW A;  3DU5 A;  3K10 A;  2OUM A;  3W2V A;  3H3U A;  3OYC A;  1P6R A;  3A03 A;  4PDK A;  5FKM A;  1DU0 A;  5C4X J;  1MBG A;  3RQ4 A;  3CF5 F;  5AIQ A;  1R58 A;  3ABL H;  5F0C A;  1IDZ A;  4G7O F;  4UUV A;  1BA5 A;  2ESH A;  5DYM A;  1HST A;  1JUP A;  1I5Z A;  3FM5 A;  1YRN A;  5L3G A;  3V42 A;  2HVQ A;  1ONV A;  2M2E A;  2HQ5 A;  2JSP A;  3BTJ A;  2DT7 B;  2P4W A;  2OTJ I;  4O5V A;  4MLO A;  3KPH A;  3C2G A;  2ZXH A;  2QBY A;  3G1L A;  1K6Y A;  4DBR A;  3I5U A;  1KON A;  2EV5 A;  4U7D A;  5EGO A;  4CDG A;  3OY9 A;  1N25 A;  3DPU A;  1Y0U A;  4XOP A;  3FXQ A;  1FMV A;  2Q0O A;  1IUF A;  4EM2 A;  2MD0 A;  2MLK A;  3MZY A;  3BWG A;  2KRF A;  2BVM A;  4IHV A;  3FXM A;  3N97 A;  2XAQ A;  4HLY A;  3KLO A;  3RSN A;  2KJB A;  3DPL C;  3X2Q H;  1N78 A;  4PGG A;  3K9T A;  2JK3 A;  1XD7 A;  2HGC A;  4E7Z A;  2P8T A;  2VOD A;  1OCZ H;  1ZGW A;  4ZYA A;  4HNT A;  3TW7 A;  4MQV A;  3GTO J;  3G6E I;  4IVN A;  3RPU D;  1KU3 A;  3U21 A;  4ASN A;  2STW A;  3BG7 A;  1SMY F;  1FOK A;  2MBF A;  2ADU A;  3KE2 A;  2R7T A;  2E5Z A;  1A31 A;  2GOM A;  1J5Y A;  5FKL A;  3PM1 A;  3ZMU A;  5K5O A;  3IV5 A;  4Y15 A;  1IN6 A;  3TL4 X;  3RJP A;  2V79 A;  5KAI C;  2MAB A;  4YEL A;  1HKS A;  2PI0 A;  4LB5 A;  2DMP A;  4DQ2 A;  3QYF A;  3L2V A;  2DFE A;  2VQL A;  5FB2 A;  1UST A;  5HDK A;  2H8W A;  1UCR A;  1TP4 A;  2OCE A;  4FQG A;  1T6S A;  2L9S A;  2DK5 A;  4BBS J;  4UXN A;  2XAU A;  4JP0 A;  5FLM J;  4XK4 A;  4ZC3 A;  1R5H A;  3LST A;  4E4H A;  2ZNY A;  2Y2Z A;  4OIQ F;  2R3S A;  3OMY A;  5C3E J;  3IKT A;  4IOC F;  2CGP A;  4KDP A;  3PO3 J;  3QOP A;  3ZMV A;  1FNN A;  4YRV A;  2IGN A;  4PSW A;  2VC1 A;  4HF1 A;  4F92 B;  1DP3 A;  1ZLK A;  3M4O J;  3QAH A;  4Y13 A;  4L5E A;  1TWH J;  2M8G X;  2E1C A;  1IRZ A;  3KIO A;  3CUQ A;  2HYG D;  2K3F A;  3OYN A;  4IEJ A;  2XAG A;  4OIR F;  3MN2 A;  3L2U A;  1ZLJ A;  2NVX J;  3HUG B;  4G94 A;  1MMG A;  2HOT A;  2E36 A;  2ZXW H;  4IHW A;  1U8B A;  3DPT A;  2ZJP F;  3BTL A;  1H8A C;  1ZYR F;  4IKF A;  2TRT A;  4G9Y A;  1IUY A;  2PX9 A;  3LAP A;  3GFM A;  3WGG A;  3BCB A;  1O57 A;  1Z7U A;  4D0P A;  3KEY A;  2O8X A;  4A3K J;  1Z6R A;  1HA8 A;  3ZMD A;  2XPW A;  2FRH A;  3ZGK A;  1PVE A;  3FIS A;  2R7U A;  1IN5 A;  1FMW A;  2ZME B;  3BJA A;  4DW6 A;  5FKN A;  3CMY A;  3FHN A;  5IT9 K;  2FF4 A;  4QLC U;  4MHG A;  3TBI A;  4UUS A;  3IP4 B;  1T0F C;  1G3W A;  1I1S A;  4F91 B;  2K85 A;  1ZH5 A;  3S93 A;  2XGD A;  1OR7 A;  1T08 B;  1U6G A;  3ZP5 A;  3WU0 A;  3KEQ A;  3NRV A;  5M5X J;  3NAR A;  2UV1 A;  1Y56 A;  2DMU A;  2ZSI B;  2JA6 J;  2XAH A;  4GDF A;  3IAM 2;  3R4K A;  5B1A H;  3BG3 A;  5LD2 C;  3M07 A;  4Y3O A;  4A0Y A;  2HQN A;  2OD5 A;  3C3W A;  4M73 A;  3T0Y A;  4EGY A;  4OIO F;  2K02 A;  4P5O A;  1KGS A;  2ELK A;  4WXH A;  1PUF A;  2BY0 A;  2KKO A;  2DA3 A;  2NOG A;  1YJ9 I;  2LRE A;  3A4C A;  2IA1 A;  2NVY J;  3K7A J;  3ZN0 A;  2FBH A;  1MBJ A;  1ERD A;  2NRA C;  3F8F A;  4KIF A;  2VT3 A;  3HOW J;  2CH0 A;  2DTZ A;  3VSL A;  2CO5 A;  3BRO A;  3ZMT A;  2Z1D A;  1RC9 A;  5GTH C;  4LG3 A;  4WK8 F;  4L9J A;  4M3E A;  2EZI A;  1H0M A;  1YX3 A;  2CWE A;  2FNP A;  2H1K A;  2Z5U A;  3ABM H;  4YG2 F;  5DS9 A;  5F0F A;  3CDI A;  3JCU C;  2BVL A;  2OC6 A;  1J2X A;  1LJ9 A;  3JRE A;  2O8K A;  3I4M J;  3PNT A;  5M5W J;  5K7H A;  2WAQ A;  2R7F A;  3HSR A;  3MD2 A;  4QWQ A;  1CF7 A;  4NC8 A;  1F5T A;  5A2Q K;  3BOQ A;  3JRF A;  3SEZ A;  4FIS A;  3UR3 C;  5LGU A;  4OAY A;  3K4C A;  4LK1 F;  5H6Q A;  3G73 A;  1LKX A;  4AIH A;  3FK6 A;  1WSU A;  4XQF A;  1WFX A;  2Z16 A;  4BHP A;  4N9H A;  3MFK A;  1EV7 A;  2JRM A;  2ZXI A;  3HOU J;  5KHD A;  1PUE E;  3K4B A;  4ZTJ A; 
#chains in the Genus database with same CATH homology
 3CC4 I;  4IOA F;  1HC8 A;  4UY8 I;  3I55 I;  5GAD J;  3G4S I;  2NXN B;  2ZJQ F;  2ZJR F;  3J7Z I;  2E36 A;  1VQN I;  1YIJ I;  3CC2 I;  2OTJ I;  3CME I;  1YI2 I;  5DM6 F;  1YJ9 I;  2ZJP F;  1FOW A;  3CCE I;  3CCU I;  1VQL I;  2E34 A;  2QA4 I;  2E35 A;  3CCV I;  4IOC F;  1VQO I;  1VQ4 I;  1VQM I;  5GAE J;  3CMA I;  2OTL I;  1VQ6 I;  1VQ5 I;  1FOX A;  3CCR I;  3PIO F;  1VQ7 I;  3CCQ I;  3CC7 I;  2FOW A;  1MMS A;  3CCS I;  3DLL F;  3CJT B;  3I56 I;  3CCL I;  1VQP I;  1S72 I;  1YHQ I;  2QEX I;  1FOY A;  3G6E I;  3PIP F;  3CCJ I;  1YJW I;  1QA6 A;  1VQ9 I;  2H8W A;  4V19 K;  3CD6 I;  5DM7 F;  2JQ7 A;  5GAG J;  4IO9 F;  3J7Y J;  5GAH J;  5JVG F;  1YIT I;  3G71 I;  3CF5 F;  3CCM I;  1Y39 A;  1VQ8 I;  1ACI A;  2K3F A;  1VQK I;  1YJN I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...