1VQ4I

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 14
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vq4I00
1S72I 4UY8I 3I56I 1VQ8I 3CC4I 3J7YJ 4V19K 3CMAI 3CCUI 2QA4I 1VQKI 1FOXA 3J7ZI 3PIPF 3CCSI 1YJ9I 1VQ9I 2QEXI 1VQMI 5JVGF 1YHQI 1VQ7I 2JQ7A 5GAHJ 5GAGJ 1YI2I 3G6EI 3CJTB 3CF5F 2OTLI 2E36A 1VQOI 2FOWA 2NXNB 1HC8A 3CCVI 3CD6I 3I55I 1MMSA 3CCQI 3CC7I 3CCMI 3CCLI 1VQLI 2ZJRF 2E35A 3DLLF 1VQNI 1YJNI 1YJWI 1FOYA 4IO9F 2ZJPF 1VQ5I 1YIJI 3CCRI 3CMEI 2H8WA 5GADJ 5DM7F 1Y39A 3PIOF 2ZJQF 4IOAF 3G4SI 4IOCF 3G71I 1YITI 1VQPI 3CC2I 1FOWA 1ACIA 2OTJI 5DM6F 3CCEI 1QA6A 2K3FA 1VQ6I 3CCJI 5GAEJ 2E34A 1VQ4I
chains in the Genus database with same CATH superfamily
3H9QA 3RI4A 1RR7A 1NG7A 3A0BC 1JJ6C 1E2XA 4J01A 3D5RC 3RPUD 3WTTC 1DPRA 2DOFA 5CJ9A 3TKYA 3LFKA 5L3CA 3L1PA 3K10A 2EWNA 2IVMA 4O6JA 1GHCA 1Q1HA 4I01A 3F3XA 3CUQB 4KFCA 3LAPA 4BQAA 4EQQA 3ROUA 1W4MA 1GV5A 2Z16A 4IHSA 3OYHA 2Y9YA 2DFIA 1HDPA 5JR3A 3E1SA 4HG2A 1I3QJ 5LHHA 3LSIA 4UVCA 2KP6A 1VQ7I 5LHIA 3VYRB 2FMLA 4EJUA 3AAFA 1MDMB 1Z9CA 3AG4H 3S3OA 1R23A 2E19A 1N25A 3CJTB 1PUEE 2D1VA 4JQFA 1HKTA 2CG4A 4I0BA 4M72A 4UXNA 2E36A 1JTYA 1U8RA 2JA7J 2HKOA 1B4AA 1GLNA 1T39A 5M5WJ 2OD5A 4FT8A 1VNDA 3H0DA 3HPHA 1VTNC 4ENKA 3FBIB 1IXCA 2M3AA 3BP8A 1R4NB 4RDUA 2XPWA 3MZYA 4EM0B 3OSGA 1Z77A 2LFBA 1MKMA 1SEUA 4XKCA 3G73A 4CYCB 1XB4A 1T33A 3HM5A 1FBUA 2BZTA 3PO3J 2E2JJ 2R7UA 2NRAC 3DXJF 1TWHJ 4IO9F 3BJOA 5DV5A 4HRIA 1U2WA 2ISZA 5IP7J 3E6DA 2IGKA 2BEOA 3ZXSA 1LQ1A 2H27A 5E8GA 1B9NA 1XMKA 2Y0SA 2YS9A 2DCEA 2ZJQF 2R7XA 2R7WA 5JHUA 4RAGA 5D4RA 1G6NA 1FJLA 2HVQA 3OOUA 1HOMA 5BS6A 3IKTA 3TQNA 2E5NA 4Q47A 3OYCA 3KFWX 3JSOA 5HS7A 4A0ZA 1H0MA 2KDOA 3TGNA 1R00A 4AIKA 4FX0A 4E4HA 4E70A 3HGGA 4EM2A 4XKVA 5LRRA 2EZLA 2ID6A 1HW2A 2F2EA 4BBRJ 2M5WA 1S72I 5E8IA 3PSFA 3LQRA 3CO7C 3AG2H 2M4KA 1GXQA 2VL8A 2B63J 2P7VB 3UKGA 2WADA 4WXDA 3HRMA 4M3EA 2GXBA 1TL8A 1IJWC 3FISA 2XKPA 5KAFC 3D1NI 2L4AA 3KP6A 4CO8A 1PYVA 1TQMA 3E6CC 3PIPF 3DBLB 1SMYF 2H94A 2W82A 3L2RA 4UV8A 2CQXA 1QVTA 1HF0A 1LB2A 3VOEA 3IRRA 3GLXA 4BQQA 5D5WB 4CYDA 1WI3A 3LSRA 3L2UA 1XSVA 2X85A 3L7WA 3P9IA 5EEAA 1BL0A 4P9FA 1K61A 2HQ5A 4YELA 1AOYA 1TWAJ 4CCNA 2EIKH 2VIXA 1V5FA 2IGNA 3PM1A 2K02A 3DU6A 2R0QC 1MJAA 3ZN1A 3HOUJ 1YW9A 1IF1A 3DTEA 3BPVA 4XQFA 4UB6C 3BR2A 2X6XA 2ZSIB 3H9GA 5K7ZA 3CCLI 4XSXF 1I39A 1VQLI 1S5LC 3DKXA 5ICGA 4ZDPA 5L3BA 1VFCA 1BM9A 2EPFA 3ML6A 4F91B 3K1PA 3KPHA 2M2EA 2V4JC 3VB2A 2IGOA 1FPQA 2MLGA 3T5XA 2WAEA 1GV2A 2L5QA 2TRTA 3GCMA 1ZREA 2JUCA 2CQKA 2XAQA 3JTHA 4E7SA 1DU6A 2M87A 2O5RA 3GFLA 3WTYC 5E1ZB 4DYCA 3ERED 3CMEI 2WAFA 1BR2A 4Y4RA 4ZYAA 1KZHA 4EV0A 2PMZA 3QWLA 2KJBA 4WWCA 2EINH 1FYKA 3KEOA 3O8GA 3WODF 3T0YA 1DP3A 4II2A 2MH2A 4ON0A 2DA7A 1A04A 1WGXA 1Y1VJ 2VXDA 3JRHA 1KGSA 1X1PA 1XG1A 1TQIA 2LG4A 2RC4A 2MG4A 2O3FA 4IHTA 2QCOA 5L3EA 2JK3A 3FK6A 4PJMA 2E5ZA 2YPRA 3VPRA 2ESNA 4IQJA 1FP1D 2HOTA 2VE8A 3PL8A 2R93J 2R7OA 2XPUA 2DXIA 1LVKA 1YG2A 3B02A 3ABLH 1U8BA 3E5XA 2L0KA 2I10A 4XLHA 4D5CA 3GTLJ 1R5HA 1X3UA 2MA3A 4M3FA 2HZDA 2WAQA 5E3LA 2O8XA 2STWA 1YS7A 1V5GA 1OMIA 2JSCA 4YFNF 2ZC2A 1I50J 5JLXA 4XBFA 2L01A 3F23A 3IRQA 3ZQFA 3RDIA 2R7RA 2CV1A 3TW7A 1OCCH 4ZTFA 1DGRM 4U0VA 3HOWJ 4BBSJ 4LLGF 2EV6A 3GFMA 3R0AA 3RSNA 3S14J 2VJ4A 3KZZA 4Z2YA 4CHUA 2XRLA 1J0RA 2E7WA 3TEDA 3U1KA 3AFHA 3E3VA 3IWFA 1QHGA 3HRSA 4PJNA 4Q4ZF 4CGZA 3CLOA 2VT3A 1XDSA 1W1WE 2COMA 5KNLA 1R5ID 2VQLA 5E3OA 3G6EI 3C2BA 4G6QA 3R4KA 4PCQA 2DMQA 3CLQA 2Q8KA 3HL2A 4Y17A 3BG5A 1BN5A 1IUYA 4BQOA 3ZMVA 5K5OA 1DUXC 2FNPA 2Y75A 3OOPA 1TWCJ 4DZJA 4EJTA 4IX7A 2BYVE 4OMYA 4HZFA 2WC2A 4XKWA 1RR8C 2CW7A 3F8MA 1B8IB 2H1LA 5EGOB 4OIOF 1QVUA 3V8JA 3MZ8A 1IV8A 5FLMJ 5K5QA 1Z05A 2R4GA 2XHKA 2EV0A 1WJ5A 1I1GA 4F55A 2O8KA 3WGHA 4L5IA 1UZCA 3SHFA 2X9DA 1VQ5I 2E1OA 2CQQA 3IAM2 4CH7A 3LA3A 1FMVA 5FGMA 1V55H 3LQQA 4DNCA 5LFAA 5FRMA 1G3WA 2B0LA 1K6YA 1WVRA 3L9FA 2IS4A 4BS9A 4HPQA 1LDKB 2Y0SN 2JA2A 1F43A 3UNGC 2X6WA 1SC7A 4O5VA 1BI0A 2A5YB 3PFYA 1J2XA 1O3QA 4C3IJ 2CRGA 3WTZA 1FSHA 2JMWA 3IHUA 1KQ0A 4BYYA 2KKOA 2VXZA 2KIUA 2QENA 1Z7UA 3ZR8X 1X1DA 2V6CA 2LDUA 4ZTJA 1IUFA 1QPMA 3F8FA 2RVCA 3JRGA 1YS6A 3RTRA 4BEHA 1IRXA 4IQ4A 5FKNA 1K4SA 5FLXK 3GUDA 3WU0A 1U5TA 1J5YA 4XSZF 3MD2A 1DGWY 5DDGA 1TT5B 2FBIA 5IT9K 5B1BH 2HS5A 5EG0A 5C4JJ 4A6EA 2X1DA 1JE8A 2PJRA 4CCKA 3KYDB 4NNJA 5BPIA 3E7LA 4UB8C 1OCRH 2QKMB 2ACJA 3KP4A 3HOYJ 2E60A 4N9IA 3N05A 2BOLA 4RGXA 4E7ZA 1H89C 3HOZJ 2FOKA 5LRSA 2F5DA 2F4MB 3QAHA 3K4BA 2ETHA 4NC6A 3IL2A 3FX3A 2AXTC 2QUFA 4ZZDA 1ZGWA 5D5VB 2LBFA 1VQ9I 3ASNH 4XRFA 3MMYB 5FROA 2K3PA 5JVGF 3FZVA 5ILSA 4DJAA 1YHQI 1F5TA 2HKXA 4MHGA 2GAUA 5K1YA 3WTSC 3WTXC 3TL4X 4WK8F 3SZPA 4BHBA 5D8KB 3OYGA 3CO6C 2X1EA 4XRMA 2HQRA 1QRYA 4IXAA 5K5RA 1VQOI 5F04A 1BIAA 1SFUA 5CYVA 5E17F 5FKLA 3JR9A 2MYSA 4KN7X 2LMDA 3E0JB 1SMTA 2L9VA 4HQEA 2ISYA 1P7JA 2GZWA 3GYHX 2ADUA 3EUHA 3A0HC 3SEZA 1D1BA 2GBYA 2DO7A 3U9GA 2DJIA 4IKFA 2GLOA 2V1DA 1TNSA 2FJ1A 5BMZA 4Y3OA 4FETA 1I1SA 3G1MA 4OU0A 3QYBA 4DBQA 3QYFA 1SFOJ 4NHJA 3LSHA 1MGTA 3S17J 2XAGA 1E3HA 3E6MA 1A31A 1X3ZB 1X1AA 1O7FA 4B48A 1OR7A 3W3CA 3L2CA 3ELKA 4QPOA 4RAFA 3DPUA 3CDHA 1XMXA 3I5UA 1DU0A 1B9MA 2R5ZA 2LKPA 1FTZA 1SFKA 2E1MC 2PMZN 1YFHA 3SQNA 2LNBA 5F64A 2ZMEA 4YRVA 1FOKA 3BJ6A 4RB3C 2DT6A 3HB9A 4OIQF 1WJCA 4L9VA 2XRNA 5D5XB 1NG6A 3JTGA 3S1QJ 2HPIA 1ZG1A 5TRDA 3I9V2 4RS8A 4KA4A 1FIAA 1E3OC 1Z6TA 3HOXJ 1HCRA 4AIHA 2JRMA 1YW8A 3WE2A 1YYVA 3CCJI 1TBXA 3HOSA 2OPTA 1ETXA 3GVAA 5H6QA 2VC1A 3PNTA 4X1EA 2K9LA 4B47A 2L9NA 3ZMUA 2LF8A 4L0YB 2JA6J 5IPAA 3K70C 1WCMJ 4PGHA 3OYAA 1SD4A 4ESBA 2ECCA 3DWLE 3MEXA 4G7OF 2E7XA 1MBEA 2JRTA 1ZQ3P 5FFXA 2OV7A 1M1EB 2M0CA 4HV6A 2R5YB 3HIFA 4KIBA 4OIPF 2Q2EB 2HQAA 4IJAA 3BOQA 2BVLA 4G8XA 1ZGJA 4D5FA 1QNTA 2UXNA 4LJZF 2Q1ZB 4E7LA 4A3JJ 3IP4B 5HS9A 2ME0A 3VDXA 1ETVA 2X0LA 5GPCA 3FXRA 4BQNA 4XLNF 2BHZA 2LH9A 5DD4A 4YFXF 2CUJA 1QZYA 4ZYDA 4E7KA 1FP2A 1JKPC 2VJJA 1SFEA 4FE7A 2LC2A 2QVOA 3HBLA 2OTLI 2IP2A 4XKBA 4R8HA 1K78A 2CO5A 2AQFA 3H35A 1G59A 2XAJA 5CVVA 2IW5A 3PQJA 2P6TA 3CCVI 3CD6I 3I59A 1MMSA 2DK5A 1B72B 3ISPA 2RGVA 1D0ZA 4LOCA 5E3NA 4E7JA 1O3RA 2EZKA 4EEFG 4WF2A 3WHBA 1F36A 3C1DA 2V9PA 1YX3A 1J09A 2L7FP 4Q5SF 3A1YA 1G3SA 1XGOA 5J6XA 1FOYA 5TGTA 1SVMA 1TT0A 3HTSB 2Z1DA 3CF2A 5GTHC 2P81A 2W25A 1W36D 3BT9A 4I09A 3LMMA 1OISA 2HVRA 1N78A 1UG0A 2JN6A 2I5UA 3MQ0A 4JYKA 3SZGA 1HDDC 1ZG5A 2BE5F 3BZKA 4M6XA 5HODA 4Z6YA 3MKWB 4C9YA 3A01A 3VYTB 2HOSA 5E79C 2HYFA 2IAIA 2K9MA 1BI3A 1VZ0A 2PLYA 2M45A 4OOIA 3I53A 3G71I 3ESWB 4DYRA 1SFXA 2BY0A 2M9HA 5JVTA 4XIDA 1YITI 3CC2I 1LUJB 4XNFA 4KYWA 2F5FA 1IN4A 1XPXA 4JP0A 3E6BA 1QZZA 3QU6A 3F0CA 2ECBA 2A3SA 5HLTA 4U7DA 2A61A 1HKQA 3BROA 3BPXA 2Z33A 1ZR4A 3SJMA 5B66C 2GXGA 3BLYA 1YRNA 1TP4A 4ENMA 2R7VA 3ASOH 1DPUA 4V19K 2P8TA 2CH0A 2WY7Q 1JXSA 2HTJA 4K2EA 3ZMSA 3T8RA 3MKLA 3K4MA 1OYWA 4A2UA 3OWTA 9ANTA 3JRIA 1D1AA 5ICFA 2K27A 5J8FA 2NS8A 4LK0F 4P55A 2PJPA 3IV5A 1QZEA 3FXKA 3LNQA 1GXPA 1IV6A 2O6GE 2OAZA 1LFPA 1MJBA 1X19A 2DU9A 2KIMA 2BV6A 1YLFA 3FF5A 2LSOA 2XSJC 1BC8C 2QSGX 4U87A 4EJVA 1VQMI 1ZHFA 2KMUA 4XORA 2IRFG 2YU3A 2K4JA 2ZXHA 2R7ZJ 4MNUA 1S7EA 1Y0NA 2BBYA 3TW6A 4YIFA 2JA5J 2OC6A 1X1BA 2HYGD 2F48A 3BJAA 3FKIJ 5EEGA 5HLHA 4GDFA 5EYRA 4G6TB 1MNEA 2MH9A 1MSEC 3P5JA 2QSHX 4BDYA 2DA2A 4KDPA 3OR2C 1IRZA 4LITA 1RUOA 5IP9J 1HKSA 2VJ5A 2MD5A 2OUMA 4C30A 1ETYA 2X1CA 3IWZA 3P9KA 4U7BA 4HDUA 2DLLA 3MN2A 3GFJA 2AXLA 2MD0A 3B6CA 1QBJA 2FMYA 4W97A 4IRIA 2CV0A 3OIOA 1FC3A 3HJEA 1K83J 4BXUA 1KA8A 2W24A 4UUSB 3CESA 5EZHA 4EM1A 4ZC3A 1OKRA 1UFMA 2RNJA 3CCYA 3RJPA 2K40A 3JRFA 1P9QC 1TQPA 1BOBA 2JVHA 1IN6A 2DT7B 1MH3A 2R7DA 3R60A 4L18B 3HOVJ 3H36A 1AHDP 1ZGAA 3E5UA 1LVAA 4BDZA 2DJNA 2TDXA 3S1MJ 1S6LA 4HNVA 5FLXZ 1S29A 3FKJA 3S1RJ 1VF9A 4BAYA 2GM4A 1LFBA 1ZRFA 2HU9A 5F27A 4RA2A 5ERIA 2P5KA 2E2HJ 1FTTA 1OCPA 1R22A 4M3GA 2H6BA 4BJ6C 1BOAA 3DEEA 1IO2A 1U5TB 5DD8A 2ELKA 3PNVA 5KCMA 4C3JJ 2HDDA 3S3MA 2OU2A 5EG0B 3M7GA 1Y1WJ 4XR6A 3M9AA 3F9KA 2OCCH 4KIGA 3G1OA 2XF6A 4XRSA 1CF7A 2HVSA 2ZKZA 3EYIA 1YQAA 3ZP5A 2KHMA 3TOBA 2VPRA 3VSKA 2YR2A 1NH3A 2BVMA 4BHPA 4RB1A 1T95A 2CSOA 2PG4A 1G3TA 2M1BA 4M74A 5ILUA 2VBYA 2O61A 2QLZA 4ZYHA 3BR6A 2JTVA 2DA6A 1B6AA 4A3EJ 1VI0A 3GX4X 2LF7A 2DTZA 1ZYRF 2NS0A 4IRHA 3EUKL 3BCBA 3M07A 4DW6A 1WJFA 4LG0A 4U0WA 3ZGKA 1AKHB 2OQGA 4E7HA 3GWZA 3OYKA 4EVIA 3R61A 3CUQC 5ILVA 2M34A 1XGNA 2ZXWH 2BY3A 2QM3A 4AD9A 2M8EA 1HSTA 4G7ZF 2B9SA 1N77A 1ORKA 1JJ8C 1HLVA 4DYQA 1T6SA 1AWCA 1I6HJ 1T0FC 4AIDA 3K0LA 1ULYA 3GW2A 4CZCA 3C18A 5JFRA 3K2AA 4AYBA 3VSLA 3D0SA 5H2FC 5H20A 2H1KA 5CVUA 3F6OA 2NNYA 2VBWA 3DEWA 3TBIA 2IS1A 2K86A 5AIPA 3DPTA 3K2ZA 3ZMTA 2K85A 1HBXG 3ZPLA 1XS9A 1TZLA 1UJ8A 4JOMA 3TO7A 1GVDA 1QGPA 1APLC 4LG3A 3A2KA 4RGRA 4YEJA 3Q5FA 4AVZA 2ZBKA 3EYYA 3KLNA 3WG9A 1YJWI 1KU7A 3RCOA 3WTWC 2BW3B 2ZMEB 5HOOA 1RC9A 2DN0A 4QPQA 1KU2A 5IT3A 2OQRA 1K79A 4BACA 1REPC 3ULQB 2FNAA 4NBQA 3OL4A 3U2RA 2JWTA 4KMFA 1XCVA 2LREA 3RPUA 2CUEA 1MBFA 2D1HA 3AG3H 3DBRB 3TP3A 4AVPA 4B1RA 1CGPA 3ZCOA 1MW7A 4J19A 4MQVA 4D1QA 2RREA 2CWEA 3I64A 4FHTA 2CFXA 2LKSA 3G3ZA 1P7IA 3HC7A 4DIQA 3S2WA 3J80K 3HGYA 3EUAA 1QA6A 2K3FA 4BE2A 3S3NA 4MQ9F 5BQTA 4FCYA 2K9QA 3LAJA 4HF1A 2AHQA 2A5WA 5D4SA 4HX4A 1OCOH 4PFPA 3S15J 1MIJA 2OA4A 2XV4S 1LDJA 1UB9A 1Y8RB 1QO0D 3MFKA 2L7ZA 2D5VA 2KIQA 1V4RA 4Y33A 5DEQA 2VOPA 4A3DJ 1Y56A 3CMAI 2F5VA 3BQYA 2RV8A 4B8XA 1JKRC 3GLLA 1VQKI 2G7UA 4LB5A 3VFZA 5CKTA 3PSIA 3FHZA 4F93B 2FEZA 4B3AA 4OMZA 2X6OA 3DKYA 1XN7A 2XKOA 5HDKA 2IS2A 4U88A 4JX6A 4UVBA 2VQGA 2L7KA 2HXIA 5M5YJ 1NK3P 2KRCA 1K78B 2KFDA 3FMRA 1K7AA 5J40A 2JQ7A 5DUIA 1LEBA 1WI9A 2YX7A 3GTKJ 3I59B 3DCFA 1XC5A 2V79A 3FBNB 4NUBA 3M3YJ 3RZOJ 3M4OJ 1IXRC 1XSXA 5F0FA 2EFQA 2QZ8A 3FDYA 4XK4A 2VODA 3JAMK 3V7CA 1T08B 4GCVA 3SEQA 2EFPA 4XN3A 1RIOH 2FF4A 1YIOA 1DP7P 4MO7A 3S93A 2QQ9A 1XMAA 4A3GJ 4EGYA 2QWWA 2CGPA 2ZFWA 3KEYA 4RAZA 2FRHA 1I27A 1MBGA 3W6KB 1R6RA 2CFOA 1SD7A 4C3HJ 5M5XJ 1H8AC 3ZMZA 2XGEA 1S8NA 3KE2A 2E35A 2NYXA 4PSXA 3DLLF 1YJNI 2FQ3A 1S7AA 2M7AA 3OS0A 1L0OC 1W7PB 4ESFA 3E97A 1ZRDA 1TW3A 1IRGA 3A01B 1V54H 5KK1A 1R1TA 4G7HF 1P2FA 2LKXA 3CDLA 3OMYA 4FE4A 4HDVA 3DV8A 3CDIA 3GZ6A 1Y39A 1ZTRA 5GP9A 1OFCX 2OZUA 3V4GA 5HDNA 3PUFA 1EH6A 2P5VA 3S32A 2Y0MA 5ED4A 4BL0B 3EETA 1SD5A 3WGIA 4M9ZA 3D5SC 4KT6A 1B59A 3LSGA 1T98A 2RN7A 1T2KA 5DCFA 1XGSA 4UVAA 4CXFA 2FU4A 2VQHA 4ZZLA 2W57A 1G8XA 3JRAA 1OCZH 2XAFA 2OBPA 2CJJA 1R1VA 2QSFX 4HBLA 2PX9A 1MMNA 3FM3A 1A36A 3A03A 4BUPA 5FJ8J 2LR8A 4F3QA 2JUGA 3MVPA 2Q0OA 4RGSA 1W5TA 2L3DA 2KZVA 4ABZA 1BJAA 5J47A 3JREA 4I99C 4OWRB 4GYGA 3QP6A 3CCUI 4M73A 3SDBA 4H0EA 3J7ZI 1FYMA 3NWTA 2WY8Q 1KU3A 2V1NA 1PDNC 2CMPA 4A3MJ 3FMQA 3KETA 1POGA 5FLVA 1V5EA 2ICWG 2HR3A 4ZH4F 3ZQQA 3BC8A 2C6YA 1MDMA 1ETKA 2HOAA 2XGCA 3DF8A 3NEUA 3K69A 2VOOA 4IHWA 3GTQJ 4LD5A 3GEZA 2XROA 4CSWA 4HNTA 3V8KA 2KRFA 4GGGA 2IS6A 4BU2A 4G9YA 3ZQHA 3VYSB 5GAGJ 4X6AJ 3K6GA 2QBYA 3H3VK 1F9NA 2MC4A 2NVXJ 3RIRA 1D3YA 4ZDOA 3VEPA 2YSRA 4AYBN 2FOWA 1JHFA 2A68F 1D0XA 5HVQC 1TWFJ 2BXZA 1BI2A 3Q9SA 2WV0A 5F0CA 3QPTA 3Q0UA 1RPWA 2CU7A 4Q48A 3CCQI 3CC7I 2DMUA 5L3GA 1S7OA 4YIRX 2HDCA 2ZJRF 2NVYJ 2JA8J 2F4IA 5KAIC 1Z7LA 2DFHA 2KISA 1KYWA 2F4OB 5CVRA 3BCAA 3CP2A 5K7FA 3RPQA 1MBKA 5F1JA 4DGWB 3S16J 3AKZA 1BI1A 5FKOA 2GOXB 5GADJ 3GBGA 3HRUA 2LYCA 3IH4A 2BY1A 2RKHA 2L9RA 1JUMA 2RNGA 3F72A 1JGSA 3RQIA 3V7RA 3HUGA 4HV5A 1JT0A 3GTGJ 3QRFF 5J4VA 4B3XA 3K4JA 1FOWA 1BBYA 2IT0A 5IYDJ 3HSFA 1F4KA 4IRGA 4S05A 2DW4A 5DM6F 3J7AO 1D0YA 3COAC 1O7LA 4ASNA 1JKQC 2A69F 1WJDA 1ZLJA 3IKVA 5FRNA 5CPRB 3HEFA 3QOEA 1J75A 3OYNA 1EA3A 3HG9A 2XPVA 4HYEA 2DDAA 2EA4A 1GDTA 1WH7A 4KUMA 3ZQLA 3GTJJ 1P4WA 1YX5A 4CCLA 4WX9A 4GFBA 3C3WA 1I5ZA 1SAUA 3KCCA 4LG0B 3L09A 3TDUC 1SVLA 2ZXJA 3AL0B 3G1LA 2DDBA 1TC3C 4II3A 3UR3C 1YJ9I 4LB6B 3QPLA 4KITB 3H5NA 2D2WA 1G3YA 2LOOA 4DZPA 2E2IJ 2XB0X 3RYPA 4P96A 3VWBA 3KP7A 4FISA 4N4NB 1W0TA 1RUNA 3PFIA 2VASA 1LEAA 4ESJA 3FXOA 1Z91A 5IOZA 2NAZA 2IA2A 3L00A 3U21A 4NC8A 4YG2F 5DCMA 2QQ8A 1EJ9A 4HX8A 4Y13A 3BZ6A 3H0GJ 3MWMA 2MABA 3JSPA 3SZTA 3DU5A 4EJOA 2E1NA 3K9TA 3QU3A 2G7HA 1TW2A 5DS9A 1R4MB 2KRHA 2ZB9A 3TO6A 3NQOA 5IYBJ 4C2UA 2KT0A 2W84A 2WTEA 3VYUB 1ZLKA 1ZH5A 3LSJA 2EFNA 1GUUA 1R58A 2FA5A 1U3EM 1I3AA 1EF4A 3CP8A 4M9SA 1FEXA 2MC3A 4IHYA 4PDKA 1VQNI 3RKQA 4B4CA 3NARA 3KP3A 1HA8A 2Y30A 1UHMA 2RQQA 5HNFA 1W36C 3G2BA 2EV5A 1S9HA 4ENJA 2L54A 5IY5H 2MLKA 4NC7A 3V42A 5JI6A 2L7MP 3M8FA 3KIOA 3QPHA 2KPMA 4KIFA 4JX4A 4L9NA 1MMDA 1FZPB 2H8WA 4JK1X 3BTIA 4R79A 2W1OA 2GIZA 4A0XA 2COBA 2VLAA 3H92A 1T56A 3J81K 2XAUA 3ONQA 1D5YA 2VB6A 5FB2A 3OYLA 5LGTA 5FD5A 3WU2C 1U9NA 1OLTA 4XOTA 1JI8A 2VN2A 4JX5A 3O8HA 4YFKF 5LEKA 1HW5A 3DFGA 4P9UA 2P6SA 3Q0VA 2EZHA 2XVCA 1BJZA 3C7JA 1IXSB 2DODA 2K5CA 2Y31A 2FQ4A 1GT0C 1MNDA 3BG9A 2Y9ZA 3DQVC 3ABUA 3ZQGA 3KYCB 2XUBA 3CTAA 4MLOA 3ZQCA 2A05A 2DA3A 4PSWA 2VQCA 1FOXA 4XLEA 4A0YA 2NNNA 4S0HB 2QKLB 5F1RA 4MIMA 4OAYA 5E1XA 3MAJA 3JAMZ 3RKYA 3W2WA 2O03A 1RKTA 4X0GA 5L3FA 4NB5A 2IBDA 4I7HA 2MFZA 5CVIA 2D45A 1JKOC 2A6EF 5J3LA 1ERDA 3F8CA 2DTRA 4E6KG 2LP0A 1UCRA 3ZMDA 4LMYA 2QF7A 3LL7A 3LSKA 2Y48A 1KYZA 3P7NA 4BHCA 4PZJA 4IL6C 1ETWA 3W2VA 2X51A 4CCMA 3OIQA 1HQCA 3CF5F 4M9XA 1IGNA 5IYCJ 1U78A 1R36A 1B8IA 4L0ZB 3JRCA 1WQ2A 2IEKA 3OYEA 3BTJA 3DKWA 4UHTA 3HHGA 3W6VA 3OYMA 2LRDA 4IF4A 1OYIA 3MKYB 3CCMI 2VKEA 3ZOBA 3LSMA 5D5UB 1UMQA 4QWQA 4KT5C 2DA1A 2DAOA 4JBAA 3V7SA 4NQWA 4A69C 2VBXA 5BOXA 4L9TA 1XX5A 4KJZA 3LWFA 2HQNA 4U0YA 4GO1A 4ZJZA 4A3CJ 1WZ2A 1O4XA 3FIWA 2FXAA 3M1EA 1HW1A 1BIBA 1EV7A 2EJRA 3I54A 4LFUA 3WU1B 3OS2A 1O57A 2WWYA 3F6VA 2ZNZA 1YTYA 2M30A 2V9KA 2XGDA 2EQRA 2Z3YA 4LK1F 5CQEA 5B1AH 4BE1A 1PP7U 3HDDA 5DM7F 2JPBA 3JCUC 1J7KA 1X2MA 5F08A 4G12A 1FNNA 4BY7J 2F6CA 3CJNA 1N75A 4PFOA 3PNYA 1G4DA 1XCBA 5L3DA 2HTSA 1ON1A 1LE8A 5EDNA 4IEJA 1YO5C 2LK2A 2P0WA 4IHXA 5DTDA 3DPLC 4IPAA 5A2QK 2VT2A 3HRTA 2EILH 2X48A 4GRIA 1D8KA 1R7JA 2BY2A 2HGCA 4FX4A 3CC4I 1TTYA 4M6VA 5CLSA 5K7HA 5IT9Z 3ABTA 1WJEA 1R9TJ 4HA8A 1KQ9A 4LLNA 4FTHA 3BG6A 2R7SA 2HI3A 1STZA 4I76A 1WRJA 1ODDA 3ERMA 4BEHB 1MMAA 3GO5A 5EEHA 2DFEA 4WCGA 2QQBA 2VE9A 1ZAOA 3GTPJ 1FX7A 2PFBA 3F8NA 2NOGA 3LA2A 3FXLA 3GZ5A 3FXMA 5D6EA 5EF6A 2R7QA 2E1CA 2PJRB 2QBYB 1W5CC 2X4HA 5LGUA 4C2MJ 5D8LB 1QU3A 3BDDA 4RAYA 2QEXI 2DMTA 4RM3A 4AC0A 5KVRA 2UUZA 4F7ZA 3L2QA 2DMNA 2M7BA 2UWMA 1DDNA 3MKZA 2ZO4A 1YI2I 1CQTA 1ON2A 4AM3A 1E0EA 1ZKGA 5J4YA 2OJED 2QQAA 2LBFB 1LNWA 4CDGA 4MGRA 5E18F 4B43A 1ETQA 1KQ8A 1OJLA 4D7NA 1SVOA 1OQYA 3BR3A 3FHNA 3KEQA 3LFUA 1X2NA 5M3FJ 4ITVA 4HF0A 3H3ZA 2GIVA 4V2GA 2KZGA 2XF7A 4HNUA 5LLQA 1R49A 1MNMC 4A5NA 3CJQB 1Q1VA 4A93J 3S1NJ 1ENHA 5GPAA 1TWGJ 2HXOA 1TNTA 4Y7NJ 3K4CA 1BW6A 2FSWA 1Z21A 1Y6IA 1YW7A 3BWGA 3HOTA 3OYBA 2LY1A 1PUFA 4LGWA 1NK2P 3LOCA 2GOMA 2KDZA 4ANJA 3O6BB 1AU7A 2YUSA 1QPIA 4I0AA 3I3LA 1FBQA 4N9HA 2R7TA 2HPMA 3HUGB 3TDZC 4PJLA 4L5JA 2OF7A 3RKWA 2P4WA 3BY6A 3PIOF 5F0HA 2NS7A 2JZYA 1LJ9A 4G94A 4P1WA 4UUVA 3G4SI 4HEA2 5AONA 3L2VA 1JGGA 2DA4A 2UV1A 3FXJA 3OY9A 4A12A 5J1UA 2R5ZB 1VQPI 3GF2A 3GTMJ 1ACIA 4DBRA 4XLPF 3QQAA 1RRJA 2OTJI 5FKMA 3TMOA 1K6OA 2XF5A 2HDWA 5ICEA 5F6FA 3T1BA 3WHCA 2IGMA 2Y2ZA 3RZDJ 2UXXA 3BZCA 1PVEA 4BKXA 2ZJ2A 3TP0A 3E5QA 1SAXA 4M6YA 2H09A 3I56I 2MBFA 2NOJB 1BC7C 3S2DJ 4CUGA 1OYYA 2YU9J 1U5TC 2R5YA 3FXUA 2Q2EA 2NVQJ 2DYRH 1ZRCA 3HSEA 3I58A 1I6XA 2I8DA 3H5AA 3DBHB 5TJJA 3KYLA 5C44J 2ESHA 3KLOA 1MSFC 3W6JB 2ZFUA 4M3BA 4XLCA 3HTUA 1H9GA 2VUMJ 3BR5A 2JSPA 3TO9A 3RYRA 4PK4A 5DCMB 2FUG2 1IC8A 3ZQIA 2H6CA 4D7MA 2O9LA 2ME6A 3F22A 1MD0A 4XICA 4EMSA 1UHSA 3DEUA 5EZGA 2G0EA 2PN6A 3M1CA 3SDGA 5IOYA 1RETA 4HSRA 2WB1A 1B72A 4DQ2A 5FFZA 3DP7A 2DK8A 4YIIA 4RLQA 4F92B 3K1MA 3NRVA 1PP8F 3REOA 2DBBA 2ELJA 3CJRB 4AUXA 1IN7A 2Z9OA 2NXNB 4WXCA 1T8IA 4FASD 1ZR2A 1WJAA 4AU7A 2KQRA 4CZZA 4RB0A 2Y69H 3OYIA 3EUHC 2AQEA 3J81Z 1H88C 3BQZA 2IPQX 2V26A 1D1CA 2JVGA 4KISA 4IZZA 4A3KJ 1QQIA 5J8CA 2QGUA 4UUTA 1ZK8A 1E3PA 2AS5F 5H6RA 2A6HF 3V8LA 1YIJI 2HFHA 3CCRI 1W5SA 3MZHA 2NVUB 4G6DA 2W7NA 3NWSA 3IUOA 2W4SA 3EQLF 4CICA 3LA7A 1IDYA 1OR7C 1FBSA 2RQPA 3ECHA 3IAS2 2ELHA 2PMHA 2VKDA 3A4CA 2VJIA 1QHHD 3SYTA 4MEXF 3H9JA 2ZMEC 3X2QH 3A02A 1P6RA 1R71A 4BY1J 1USTA 3TOAA 3N97A 3F8BA 2VI6A 1UHWA 2ZCWA 1XTAA 3M8EA 5FKKA 3JRDA 3C2GA 2J5OA 3RQ4A 2A07F 4PUSA 4XRSG 4OINF 4HW0A 2VPLA 1X4PA 3HKZA 3PO2J 1PJRA 4AWXB 5GAEJ 3IC7A 2V7FA 2DFFA 1HXDA 1E17A 3KP5A 3CZ6A 3BTLA 1ZG3A 2CQ7A 5BPDA 4UY8I 4QIWN 4A3LJ 3BR0A 1Y0UA 3ZQ7A 2V1XA 3QODA 4HLYA 3J7YJ 2V6EA 4P5OA 1IN5A 2K7LA 2DQLA 5EJCA 5LGNA 5FD6A 3JW4A 1EH8A 4ZDLA 4A5MA 2XAHA 1USSA 3OYJA 4XMYA 1MBJA 1RKWA 3KP2A 2PBIA 3GZNB 3SFIA 3CQZJ 4H4KC 4PGGA 1FLIA 2DT5A 1FMWA 5J1YA 1YRNB 2A6TA 3CCSI 1Z67A 4QLCU 2LVSA 1R1UA 3I4NJ 1SANA 4NDLA 1EKEA 1X3WB 3Q9VA 2BGCA 2V1UA 4QTRA 3FK7A 2OZ6A 1XD7A 3CUQA 3GXOA 3K4LA 2HOEA 1WKMA 4HQMA 2L4MA 3OR1C 2GA1A 4E7IA 1T0FA 2L2OA 3KZIC 3Q0WA 4PJ0C 4W1UA 2NVTJ 2WBMA 1J9IA 2F5EA 1FIPA 5CVJA 5GTIC 4QSHA 1P92A 5CQGA 2KJCA 4UUSA 4NQWB 1LKXA 1O3TA 5LBQA 4L5EA 2W85A 3P9CA 4LIUA 3NAUA 2N8GA 1BW5A 3H1CA 5ICCA 3RKXA 2IXSA 2PMUA 1B1BA 5JHFA 2DMPA 4I6ZA 5D6FA 3ZN0A 4EATA 3PJRA 4Y52J 1R5GA 2RDPA 3EPZA 2DOEA 2E1MB 5HLIA 3K7AJ 2WA0A 2EK5A 1A6QA 2DI3A 1P4XA 2R92J 3FWEA 1IG7A 2MSYA 4MFEA 2CW8A 1F1ZA 4UNOA 4FQGA 1NHAA 1D8JA 1KU9A 1WPKA 5A2QZ 4CYCA 4RBOA 4BE0A 1O3SA 3LSPA 1BA5A 2XDVA 1C0WA 2V9VA 3Q3SA 2IJLA 1LE8B 2VBZA 2XSDC 1V3FA 1WFXA 5TISC 4A3BJ 2CW0F 5C4XJ 3GFIA 2DQRA 4ZYEA 3JRBA 2MGQA 4KNYA 1A35A 4A6DA 1RZ4A 4CCJA 1JUSA 5FO5A 4A3FJ 3OL3A 1RI7A 1RNLA 1FT9A 4RLFA 5DUKA 5IP6A 1K4TA 1IDZA 2E34A 2LLKA 4D0PA 3SFZA 2EBIA 3S8PA 3N4MA 2H8RA 2P7CB 3GMEA 1L3LA 2XGXA 4GXOA 4ENNA 3I4PA 3HSRA 2K9SA 4UV9A 1MBHA 3ZRGA 1W7PD 2GA2A 4HSTA 2XIGA 3H5RA 4RB2C 2OCEA 3ABMH 3WE3A 2XASA 3GTOJ 2RAEA 1XDUA 3SXYA 5BNGA 4IHVA 3BTCA 1AKHA 2FD5A 5E1WA 1GVJA 3QYEA 1JT6A 2TCTA 3WGGA 1CF7B 2EB7A 5HDGA 1HSJA 4Y15A 2EZIA 2ZXIA 4EGZA 4BXFA 1UG2A 2JJ7A 2EH3A 2HWVA 5E3MA 2MW8A 4RGUA 3IH3A 1WHUA 1DQUA 4LLLA 4XONA 2M8GX 3IH2A 1YE9A 2R3SA 4ZYGA 1MH4A 1Z3YA 1WWXA 4PJJA 1WJBA 4S04A 1FSEA 1ZN2A 3KX2A 3QOPA 3HXLA 2O0YA 1H9TA 2WB1N 4BH9A 4BXXJ 1WH5A 2HNHA 3M8JA 2CQNA 4BJ5C 4HOBA 4KMUX 4R1HA 4XLAA 5E20A 2PEXA 4V2FA 1KONA 1MJ9A 1U0JA 2DPUA 1NTCA 4DOZA 2AO9A 2F5CA 1HC8A 1D5VA 2LY2A 2VC0A 3T8TA 1RESA 1PUFB 3WTUC 4IVNA 3I4MJ 1FWZA 4BJTA 2BW3A 5LHGA 1LPQA 3I0TA 1U9OA 3PQKA 2DPDA 2W48A 3DTKA 2FBHA 3FMSA 2WV1A 2Z5UA 2ID3A 2XC7A 3OSFA 2LD5A 4GYIA 1JHHA 1FY7A 4MEYF 2Z2SB 4HAMA 5HLGA 1ETOA 1BR4A 2VKHA 1X4OA 2M4GA 1IZ1A 4HLXA 4XL9A 4EJWA 1XSDA 2STTA 4BGDA 1YOVB 2GXAA 3S2HJ 1ZARA 3ECOA 2DYSH 2L9SA 3D5LA 4XN0A 3WTVC 1J59A 1G2HA 3CUOA 1JUPA 2FE3A 3OIPA 1IW7F 5HNHA 4WXHA 1XGMA 4N0BA 1SD6A 3K1NA 3H3UA 4B44A 4IOCF 2WAQN 3BR1A 1BR1A 2DOAA 4BNCA 3DLAA 2KIFA 2IA0A 3QPSA 5DYMA 1Z3XA 3J80Z 3HYIA 4I2OA 3HKZN 1VQ6I 4KN4X 5C3EJ 3J7AY 3KZYA 3K4KA 3MCZA 1LFUP 4CA0A 2HZTA 5B3SH 2O7OA 4O3MA 3ABKH 3W2AA 2EIMH 1VQ8I 2CV2A 2PQ8A 1T38A 2CS3A 2Z99A 4AIJA 3HHHA 4D9JA 3B73A 1OPCA 3K70D 4CCOA 2R7FA 4XLFA 2HEOA 3BG3A 1UELB 4I98B 2EIJH 1OCTC 4L9JA 2QA4I 2VONA 3OS1A 5B5EC 1LDDA 4MTDA 3QP5A 4MTEA 3PUBA 4OAZA 2IA1A 2XB5A 2ZSHB 3FXQA 5M3MJ 1TLHB 1X58A 3DTIA 4M3DA 2KLOA 5JLWA 4ETSA 3FM5A 2E71A 5HS8A 1IRFA 2K4BA 3U1DA 1A6IA 1Z0XA 2CUFA 1FYLA 1MZBA 5AIQA 1Z1DA 1W0UA 3AL0C 4XM3A 3BG7A 2EFWA 1S3JA 4XOPA 2PI0A 5GAHJ 1IN8A 3HPGA 1JTXA 5J1RA 2CUZA 1IAWA 5LEJA 2J5PA 5LD2C 1P4AA 2GQQA 1Y8QB 2LTPA 3CMYA 4A3IJ 4HF2A 4C2TA 3I55I 3CMMA 1W7PA 2JPCA 2QYOA 3AG1H 2JT1A 1Z6RA 3OYDA 1AA7A 2FBKA 2BHYA 2KL4A 4F52A 2HYJA 4HX7A 2FX0A 3WG7H 3F21A 2ZNYA 2EFOA 1WSUA 3EDPA 5KHDA 2UZKA 2K9NA 2L02A 2ZJPF 3OYFA 4J00A 4N4OB 4RMNA 1ONVA 3O3KA 4M71A 2GWRA 1X1CA 1EH7A 4RM2A 5EGOA 2B7EA 6PAXA 2CYYA 1MMGA 4LIVA 4B09A 2VKVA 2LY9A 3K4NA 2G9WA 2P5LC 4IOAF 3R0JA 4OIRF 3L2WA 1U6GA 2M0MA 3LSTA 2DA5A 3I71A 3B6AA 4TV7A 3O2PE 3R6SA 2W00A 4I02A 2EA2A 1ZELA 1UAAA 4MFDA 3VODA 4KICA 2YX4A 3CCEI 3C2HA 2BXYA 2X6YA 1A5JA 3OV8A 3HZJA 1VQ4I 1ITYA
chains in the Genus database with same CATH topology
1S72I 4UY8I 3I56I 1VQ8I 3CC4I 3J7YJ 4V19K 3CMAI 3CCUI 2QA4I 1VQKI 1FOXA 3J7ZI 3PIPF 3CCSI 1YJ9I 1VQ9I 2QEXI 1VQMI 5JVGF 1YHQI 1VQ7I 2JQ7A 5GAHJ 5GAGJ 1YI2I 3G6EI 3CJTB 3CF5F 2OTLI 2E36A 1VQOI 2FOWA 2NXNB 1HC8A 3CCVI 3CD6I 3I55I 1MMSA 3CCQI 3CC7I 3CCMI 3CCLI 1VQLI 2ZJRF 2E35A 3DLLF 1VQNI 1YJNI 1YJWI 1FOYA 4IO9F 2ZJPF 1VQ5I 1YIJI 3CCRI 3CMEI 2H8WA 5GADJ 5DM7F 1Y39A 3PIOF 2ZJQF 4IOAF 3G4SI 4IOCF 3G71I 1YITI 1VQPI 3CC2I 1FOWA 1ACIA 2OTJI 5DM6F 3CCEI 1QA6A 2K3FA 1VQ6I 3CCJI 5GAEJ 2E34A 1VQ4I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 I;  4UY8 I;  3I56 I;  1VQ8 I;  3CC4 I;  3J7Y J;  4V19 K;  3CMA I;  3CCU I;  2QA4 I;  1VQK I;  1FOX A;  3J7Z I;  3PIP F;  3CCS I;  1YJ9 I;  1VQ9 I;  2QEX I;  1VQM I;  5JVG F;  1YHQ I;  1VQ7 I;  2JQ7 A;  5GAH J;  5GAG J;  1YI2 I;  3G6E I;  3CJT B;  3CF5 F;  2OTL I;  2E36 A;  1VQO I;  2FOW A;  2NXN B;  1HC8 A;  3CCV I;  3CD6 I;  3I55 I;  1MMS A;  3CCQ I;  3CC7 I;  3CCM I;  3CCL I;  1VQL I;  2ZJR F;  2E35 A;  3DLL F;  1VQN I;  1YJN I;  1YJW I;  1FOY A;  4IO9 F;  2ZJP F;  1VQ5 I;  1YIJ I;  3CCR I;  3CME I;  2H8W A;  5GAD J;  5DM7 F;  1Y39 A;  3PIO F;  2ZJQ F;  4IOA F;  3G4S I;  4IOC F;  3G71 I;  1YIT I;  1VQP I;  3CC2 I;  1FOW A;  1ACI A;  2OTJ I;  5DM6 F;  3CCE I;  1QA6 A;  2K3F A;  1VQ6 I;  3CCJ I;  5GAE J;  2E34 A;  1VQ4 I; 
#chains in the Genus database with same CATH topology
 3H9Q A;  3RI4 A;  1RR7 A;  1NG7 A;  3A0B C;  1JJ6 C;  1E2X A;  4J01 A;  3D5R C;  3RPU D;  3WTT C;  1DPR A;  2DOF A;  5CJ9 A;  3TKY A;  3LFK A;  5L3C A;  3L1P A;  3K10 A;  2EWN A;  2IVM A;  4O6J A;  1GHC A;  1Q1H A;  4I01 A;  3F3X A;  3CUQ B;  4KFC A;  3LAP A;  4BQA A;  4EQQ A;  3ROU A;  1W4M A;  1GV5 A;  2Z16 A;  4IHS A;  3OYH A;  2Y9Y A;  2DFI A;  1HDP A;  5JR3 A;  3E1S A;  4HG2 A;  1I3Q J;  5LHH A;  3LSI A;  4UVC A;  2KP6 A;  1VQ7 I;  5LHI A;  3VYR B;  2FML A;  4EJU A;  3AAF A;  1MDM B;  1Z9C A;  3AG4 H;  3S3O A;  1R23 A;  2E19 A;  1N25 A;  3CJT B;  1PUE E;  2D1V A;  4JQF A;  1HKT A;  2CG4 A;  4I0B A;  4M72 A;  4UXN A;  2E36 A;  1JTY A;  1U8R A;  2JA7 J;  2HKO A;  1B4A A;  1GLN A;  1T39 A;  5M5W J;  2OD5 A;  4FT8 A;  1VND A;  3H0D A;  3HPH A;  1VTN C;  4ENK A;  3FBI B;  1IXC A;  2M3A A;  3BP8 A;  1R4N B;  4RDU A;  2XPW A;  3MZY A;  4EM0 B;  3OSG A;  1Z77 A;  2LFB A;  1MKM A;  1SEU A;  4XKC A;  3G73 A;  4CYC B;  1XB4 A;  1T33 A;  3HM5 A;  1FBU A;  2BZT A;  3PO3 J;  2E2J J;  2R7U A;  2NRA C;  3DXJ F;  1TWH J;  4IO9 F;  3BJO A;  5DV5 A;  4HRI A;  1U2W A;  2ISZ A;  5IP7 J;  3E6D A;  2IGK A;  2BEO A;  3ZXS A;  1LQ1 A;  2H27 A;  5E8G A;  1B9N A;  1XMK A;  2Y0S A;  2YS9 A;  2DCE A;  2ZJQ F;  2R7X A;  2R7W A;  5JHU A;  4RAG A;  5D4R A;  1G6N A;  1FJL A;  2HVQ A;  3OOU A;  1HOM A;  5BS6 A;  3IKT A;  3TQN A;  2E5N A;  4Q47 A;  3OYC A;  3KFW X;  3JSO A;  5HS7 A;  4A0Z A;  1H0M A;  2KDO A;  3TGN A;  1R00 A;  4AIK A;  4FX0 A;  4E4H A;  4E70 A;  3HGG A;  4EM2 A;  4XKV A;  5LRR A;  2EZL A;  2ID6 A;  1HW2 A;  2F2E A;  4BBR J;  2M5W A;  1S72 I;  5E8I A;  3PSF A;  3LQR A;  3CO7 C;  3AG2 H;  2M4K A;  1GXQ A;  2VL8 A;  2B63 J;  2P7V B;  3UKG A;  2WAD A;  4WXD A;  3HRM A;  4M3E A;  2GXB A;  1TL8 A;  1IJW C;  3FIS A;  2XKP A;  5KAF C;  3D1N I;  2L4A A;  3KP6 A;  4CO8 A;  1PYV A;  1TQM A;  3E6C C;  3PIP F;  3DBL B;  1SMY F;  2H94 A;  2W82 A;  3L2R A;  4UV8 A;  2CQX A;  1QVT A;  1HF0 A;  1LB2 A;  3VOE A;  3IRR A;  3GLX A;  4BQQ A;  5D5W B;  4CYD A;  1WI3 A;  3LSR A;  3L2U A;  1XSV A;  2X85 A;  3L7W A;  3P9I A;  5EEA A;  1BL0 A;  4P9F A;  1K61 A;  2HQ5 A;  4YEL A;  1AOY A;  1TWA J;  4CCN A;  2EIK H;  2VIX A;  1V5F A;  2IGN A;  3PM1 A;  2K02 A;  3DU6 A;  2R0Q C;  1MJA A;  3ZN1 A;  3HOU J;  1YW9 A;  1IF1 A;  3DTE A;  3BPV A;  4XQF A;  4UB6 C;  3BR2 A;  2X6X A;  2ZSI B;  3H9G A;  5K7Z A;  3CCL I;  4XSX F;  1I39 A;  1VQL I;  1S5L C;  3DKX A;  5ICG A;  4ZDP A;  5L3B A;  1VFC A;  1BM9 A;  2EPF A;  3ML6 A;  4F91 B;  3K1P A;  3KPH A;  2M2E A;  2V4J C;  3VB2 A;  2IGO A;  1FPQ A;  2MLG A;  3T5X A;  2WAE A;  1GV2 A;  2L5Q A;  2TRT A;  3GCM A;  1ZRE A;  2JUC A;  2CQK A;  2XAQ A;  3JTH A;  4E7S A;  1DU6 A;  2M87 A;  2O5R A;  3GFL A;  3WTY C;  5E1Z B;  4DYC A;  3ERE D;  3CME I;  2WAF A;  1BR2 A;  4Y4R A;  4ZYA A;  1KZH A;  4EV0 A;  2PMZ A;  3QWL A;  2KJB A;  4WWC A;  2EIN H;  1FYK A;  3KEO A;  3O8G A;  3WOD F;  3T0Y A;  1DP3 A;  4II2 A;  2MH2 A;  4ON0 A;  2DA7 A;  1A04 A;  1WGX A;  1Y1V J;  2VXD A;  3JRH A;  1KGS A;  1X1P A;  1XG1 A;  1TQI A;  2LG4 A;  2RC4 A;  2MG4 A;  2O3F A;  4IHT A;  2QCO A;  5L3E A;  2JK3 A;  3FK6 A;  4PJM A;  2E5Z A;  2YPR A;  3VPR A;  2ESN A;  4IQJ A;  1FP1 D;  2HOT A;  2VE8 A;  3PL8 A;  2R93 J;  2R7O A;  2XPU A;  2DXI A;  1LVK A;  1YG2 A;  3B02 A;  3ABL H;  1U8B A;  3E5X A;  2L0K A;  2I10 A;  4XLH A;  4D5C A;  3GTL J;  1R5H A;  1X3U A;  2MA3 A;  4M3F A;  2HZD A;  2WAQ A;  5E3L A;  2O8X A;  2STW A;  1YS7 A;  1V5G A;  1OMI A;  2JSC A;  4YFN F;  2ZC2 A;  1I50 J;  5JLX A;  4XBF A;  2L01 A;  3F23 A;  3IRQ A;  3ZQF A;  3RDI A;  2R7R A;  2CV1 A;  3TW7 A;  1OCC H;  4ZTF A;  1DGR M;  4U0V A;  3HOW J;  4BBS J;  4LLG F;  2EV6 A;  3GFM A;  3R0A A;  3RSN A;  3S14 J;  2VJ4 A;  3KZZ A;  4Z2Y A;  4CHU A;  2XRL A;  1J0R A;  2E7W A;  3TED A;  3U1K A;  3AFH A;  3E3V A;  3IWF A;  1QHG A;  3HRS A;  4PJN A;  4Q4Z F;  4CGZ A;  3CLO A;  2VT3 A;  1XDS A;  1W1W E;  2COM A;  5KNL A;  1R5I D;  2VQL A;  5E3O A;  3G6E I;  3C2B A;  4G6Q A;  3R4K A;  4PCQ A;  2DMQ A;  3CLQ A;  2Q8K A;  3HL2 A;  4Y17 A;  3BG5 A;  1BN5 A;  1IUY A;  4BQO A;  3ZMV A;  5K5O A;  1DUX C;  2FNP A;  2Y75 A;  3OOP A;  1TWC J;  4DZJ A;  4EJT A;  4IX7 A;  2BYV E;  4OMY A;  4HZF A;  2WC2 A;  4XKW A;  1RR8 C;  2CW7 A;  3F8M A;  1B8I B;  2H1L A;  5EGO B;  4OIO F;  1QVU A;  3V8J A;  3MZ8 A;  1IV8 A;  5FLM J;  5K5Q A;  1Z05 A;  2R4G A;  2XHK A;  2EV0 A;  1WJ5 A;  1I1G A;  4F55 A;  2O8K A;  3WGH A;  4L5I A;  1UZC A;  3SHF A;  2X9D A;  1VQ5 I;  2E1O A;  2CQQ A;  3IAM 2;  4CH7 A;  3LA3 A;  1FMV A;  5FGM A;  1V55 H;  3LQQ A;  4DNC A;  5LFA A;  5FRM A;  1G3W A;  2B0L A;  1K6Y A;  1WVR A;  3L9F A;  2IS4 A;  4BS9 A;  4HPQ A;  1LDK B;  2Y0S N;  2JA2 A;  1F43 A;  3UNG C;  2X6W A;  1SC7 A;  4O5V A;  1BI0 A;  2A5Y B;  3PFY A;  1J2X A;  1O3Q A;  4C3I J;  2CRG A;  3WTZ A;  1FSH A;  2JMW A;  3IHU A;  1KQ0 A;  4BYY A;  2KKO A;  2VXZ A;  2KIU A;  2QEN A;  1Z7U A;  3ZR8 X;  1X1D A;  2V6C A;  2LDU A;  4ZTJ A;  1IUF A;  1QPM A;  3F8F A;  2RVC A;  3JRG A;  1YS6 A;  3RTR A;  4BEH A;  1IRX A;  4IQ4 A;  5FKN A;  1K4S A;  5FLX K;  3GUD A;  3WU0 A;  1U5T A;  1J5Y A;  4XSZ F;  3MD2 A;  1DGW Y;  5DDG A;  1TT5 B;  2FBI A;  5IT9 K;  5B1B H;  2HS5 A;  5EG0 A;  5C4J J;  4A6E A;  2X1D A;  1JE8 A;  2PJR A;  4CCK A;  3KYD B;  4NNJ A;  5BPI A;  3E7L A;  4UB8 C;  1OCR H;  2QKM B;  2ACJ A;  3KP4 A;  3HOY J;  2E60 A;  4N9I A;  3N05 A;  2BOL A;  4RGX A;  4E7Z A;  1H89 C;  3HOZ J;  2FOK A;  5LRS A;  2F5D A;  2F4M B;  3QAH A;  3K4B A;  2ETH A;  4NC6 A;  3IL2 A;  3FX3 A;  2AXT C;  2QUF A;  4ZZD A;  1ZGW A;  5D5V B;  2LBF A;  1VQ9 I;  3ASN H;  4XRF A;  3MMY B;  5FRO A;  2K3P A;  5JVG F;  3FZV A;  5ILS A;  4DJA A;  1YHQ I;  1F5T A;  2HKX A;  4MHG A;  2GAU A;  5K1Y A;  3WTS C;  3WTX C;  3TL4 X;  4WK8 F;  3SZP A;  4BHB A;  5D8K B;  3OYG A;  3CO6 C;  2X1E A;  4XRM A;  2HQR A;  1QRY A;  4IXA A;  5K5R A;  1VQO I;  5F04 A;  1BIA A;  1SFU A;  5CYV A;  5E17 F;  5FKL A;  3JR9 A;  2MYS A;  4KN7 X;  2LMD A;  3E0J B;  1SMT A;  2L9V A;  4HQE A;  2ISY A;  1P7J A;  2GZW A;  3GYH X;  2ADU A;  3EUH A;  3A0H C;  3SEZ A;  1D1B A;  2GBY A;  2DO7 A;  3U9G A;  2DJI A;  4IKF A;  2GLO A;  2V1D A;  1TNS A;  2FJ1 A;  5BMZ A;  4Y3O A;  4FET A;  1I1S A;  3G1M A;  4OU0 A;  3QYB A;  4DBQ A;  3QYF A;  1SFO J;  4NHJ A;  3LSH A;  1MGT A;  3S17 J;  2XAG A;  1E3H A;  3E6M A;  1A31 A;  1X3Z B;  1X1A A;  1O7F A;  4B48 A;  1OR7 A;  3W3C A;  3L2C A;  3ELK A;  4QPO A;  4RAF A;  3DPU A;  3CDH A;  1XMX A;  3I5U A;  1DU0 A;  1B9M A;  2R5Z A;  2LKP A;  1FTZ A;  1SFK A;  2E1M C;  2PMZ N;  1YFH A;  3SQN A;  2LNB A;  5F64 A;  2ZME A;  4YRV A;  1FOK A;  3BJ6 A;  4RB3 C;  2DT6 A;  3HB9 A;  4OIQ F;  1WJC A;  4L9V A;  2XRN A;  5D5X B;  1NG6 A;  3JTG A;  3S1Q J;  2HPI A;  1ZG1 A;  5TRD A;  3I9V 2;  4RS8 A;  4KA4 A;  1FIA A;  1E3O C;  1Z6T A;  3HOX J;  1HCR A;  4AIH A;  2JRM A;  1YW8 A;  3WE2 A;  1YYV A;  3CCJ I;  1TBX A;  3HOS A;  2OPT A;  1ETX A;  3GVA A;  5H6Q A;  2VC1 A;  3PNT A;  4X1E A;  2K9L A;  4B47 A;  2L9N A;  3ZMU A;  2LF8 A;  4L0Y B;  2JA6 J;  5IPA A;  3K70 C;  1WCM J;  4PGH A;  3OYA A;  1SD4 A;  4ESB A;  2ECC A;  3DWL E;  3MEX A;  4G7O F;  2E7X A;  1MBE A;  2JRT A;  1ZQ3 P;  5FFX A;  2OV7 A;  1M1E B;  2M0C A;  4HV6 A;  2R5Y B;  3HIF A;  4KIB A;  4OIP F;  2Q2E B;  2HQA A;  4IJA A;  3BOQ A;  2BVL A;  4G8X A;  1ZGJ A;  4D5F A;  1QNT A;  2UXN A;  4LJZ F;  2Q1Z B;  4E7L A;  4A3J J;  3IP4 B;  5HS9 A;  2ME0 A;  3VDX A;  1ETV A;  2X0L A;  5GPC A;  3FXR A;  4BQN A;  4XLN F;  2BHZ A;  2LH9 A;  5DD4 A;  4YFX F;  2CUJ A;  1QZY A;  4ZYD A;  4E7K A;  1FP2 A;  1JKP C;  2VJJ A;  1SFE A;  4FE7 A;  2LC2 A;  2QVO A;  3HBL A;  2OTL I;  2IP2 A;  4XKB A;  4R8H A;  1K78 A;  2CO5 A;  2AQF A;  3H35 A;  1G59 A;  2XAJ A;  5CVV A;  2IW5 A;  3PQJ A;  2P6T A;  3CCV I;  3CD6 I;  3I59 A;  1MMS A;  2DK5 A;  1B72 B;  3ISP A;  2RGV A;  1D0Z A;  4LOC A;  5E3N A;  4E7J A;  1O3R A;  2EZK A;  4EEF G;  4WF2 A;  3WHB A;  1F36 A;  3C1D A;  2V9P A;  1YX3 A;  1J09 A;  2L7F P;  4Q5S F;  3A1Y A;  1G3S A;  1XGO A;  5J6X A;  1FOY A;  5TGT A;  1SVM A;  1TT0 A;  3HTS B;  2Z1D A;  3CF2 A;  5GTH C;  2P81 A;  2W25 A;  1W36 D;  3BT9 A;  4I09 A;  3LMM A;  1OIS A;  2HVR A;  1N78 A;  1UG0 A;  2JN6 A;  2I5U A;  3MQ0 A;  4JYK A;  3SZG A;  1HDD C;  1ZG5 A;  2BE5 F;  3BZK A;  4M6X A;  5HOD A;  4Z6Y A;  3MKW B;  4C9Y A;  3A01 A;  3VYT B;  2HOS A;  5E79 C;  2HYF A;  2IAI A;  2K9M A;  1BI3 A;  1VZ0 A;  2PLY A;  2M45 A;  4OOI A;  3I53 A;  3G71 I;  3ESW B;  4DYR A;  1SFX A;  2BY0 A;  2M9H A;  5JVT A;  4XID A;  1YIT I;  3CC2 I;  1LUJ B;  4XNF A;  4KYW A;  2F5F A;  1IN4 A;  1XPX A;  4JP0 A;  3E6B A;  1QZZ A;  3QU6 A;  3F0C A;  2ECB A;  2A3S A;  5HLT A;  4U7D A;  2A61 A;  1HKQ A;  3BRO A;  3BPX A;  2Z33 A;  1ZR4 A;  3SJM A;  5B66 C;  2GXG A;  3BLY A;  1YRN A;  1TP4 A;  4ENM A;  2R7V A;  3ASO H;  1DPU A;  4V19 K;  2P8T A;  2CH0 A;  2WY7 Q;  1JXS A;  2HTJ A;  4K2E A;  3ZMS A;  3T8R A;  3MKL A;  3K4M A;  1OYW A;  4A2U A;  3OWT A;  9ANT A;  3JRI A;  1D1A A;  5ICF A;  2K27 A;  5J8F A;  2NS8 A;  4LK0 F;  4P55 A;  2PJP A;  3IV5 A;  1QZE A;  3FXK A;  3LNQ A;  1GXP A;  1IV6 A;  2O6G E;  2OAZ A;  1LFP A;  1MJB A;  1X19 A;  2DU9 A;  2KIM A;  2BV6 A;  1YLF A;  3FF5 A;  2LSO A;  2XSJ C;  1BC8 C;  2QSG X;  4U87 A;  4EJV A;  1VQM I;  1ZHF A;  2KMU A;  4XOR A;  2IRF G;  2YU3 A;  2K4J A;  2ZXH A;  2R7Z J;  4MNU A;  1S7E A;  1Y0N A;  2BBY A;  3TW6 A;  4YIF A;  2JA5 J;  2OC6 A;  1X1B A;  2HYG D;  2F48 A;  3BJA A;  3FKI J;  5EEG A;  5HLH A;  4GDF A;  5EYR A;  4G6T B;  1MNE A;  2MH9 A;  1MSE C;  3P5J A;  2QSH X;  4BDY A;  2DA2 A;  4KDP A;  3OR2 C;  1IRZ A;  4LIT A;  1RUO A;  5IP9 J;  1HKS A;  2VJ5 A;  2MD5 A;  2OUM A;  4C30 A;  1ETY A;  2X1C A;  3IWZ A;  3P9K A;  4U7B A;  4HDU A;  2DLL A;  3MN2 A;  3GFJ A;  2AXL A;  2MD0 A;  3B6C A;  1QBJ A;  2FMY A;  4W97 A;  4IRI A;  2CV0 A;  3OIO A;  1FC3 A;  3HJE A;  1K83 J;  4BXU A;  1KA8 A;  2W24 A;  4UUS B;  3CES A;  5EZH A;  4EM1 A;  4ZC3 A;  1OKR A;  1UFM A;  2RNJ A;  3CCY A;  3RJP A;  2K40 A;  3JRF A;  1P9Q C;  1TQP A;  1BOB A;  2JVH A;  1IN6 A;  2DT7 B;  1MH3 A;  2R7D A;  3R60 A;  4L18 B;  3HOV J;  3H36 A;  1AHD P;  1ZGA A;  3E5U A;  1LVA A;  4BDZ A;  2DJN A;  2TDX A;  3S1M J;  1S6L A;  4HNV A;  5FLX Z;  1S29 A;  3FKJ A;  3S1R J;  1VF9 A;  4BAY A;  2GM4 A;  1LFB A;  1ZRF A;  2HU9 A;  5F27 A;  4RA2 A;  5ERI A;  2P5K A;  2E2H J;  1FTT A;  1OCP A;  1R22 A;  4M3G A;  2H6B A;  4BJ6 C;  1BOA A;  3DEE A;  1IO2 A;  1U5T B;  5DD8 A;  2ELK A;  3PNV A;  5KCM A;  4C3J J;  2HDD A;  3S3M A;  2OU2 A;  5EG0 B;  3M7G A;  1Y1W J;  4XR6 A;  3M9A A;  3F9K A;  2OCC H;  4KIG A;  3G1O A;  2XF6 A;  4XRS A;  1CF7 A;  2HVS A;  2ZKZ A;  3EYI A;  1YQA A;  3ZP5 A;  2KHM A;  3TOB A;  2VPR A;  3VSK A;  2YR2 A;  1NH3 A;  2BVM A;  4BHP A;  4RB1 A;  1T95 A;  2CSO A;  2PG4 A;  1G3T A;  2M1B A;  4M74 A;  5ILU A;  2VBY A;  2O61 A;  2QLZ A;  4ZYH A;  3BR6 A;  2JTV A;  2DA6 A;  1B6A A;  4A3E J;  1VI0 A;  3GX4 X;  2LF7 A;  2DTZ A;  1ZYR F;  2NS0 A;  4IRH A;  3EUK L;  3BCB A;  3M07 A;  4DW6 A;  1WJF A;  4LG0 A;  4U0W A;  3ZGK A;  1AKH B;  2OQG A;  4E7H A;  3GWZ A;  3OYK A;  4EVI A;  3R61 A;  3CUQ C;  5ILV A;  2M34 A;  1XGN A;  2ZXW H;  2BY3 A;  2QM3 A;  4AD9 A;  2M8E A;  1HST A;  4G7Z F;  2B9S A;  1N77 A;  1ORK A;  1JJ8 C;  1HLV A;  4DYQ A;  1T6S A;  1AWC A;  1I6H J;  1T0F C;  4AID A;  3K0L A;  1ULY A;  3GW2 A;  4CZC A;  3C18 A;  5JFR A;  3K2A A;  4AYB A;  3VSL A;  3D0S A;  5H2F C;  5H20 A;  2H1K A;  5CVU A;  3F6O A;  2NNY A;  2VBW A;  3DEW A;  3TBI A;  2IS1 A;  2K86 A;  5AIP A;  3DPT A;  3K2Z A;  3ZMT A;  2K85 A;  1HBX G;  3ZPL A;  1XS9 A;  1TZL A;  1UJ8 A;  4JOM A;  3TO7 A;  1GVD A;  1QGP A;  1APL C;  4LG3 A;  3A2K A;  4RGR A;  4YEJ A;  3Q5F A;  4AVZ A;  2ZBK A;  3EYY A;  3KLN A;  3WG9 A;  1YJW I;  1KU7 A;  3RCO A;  3WTW C;  2BW3 B;  2ZME B;  5HOO A;  1RC9 A;  2DN0 A;  4QPQ A;  1KU2 A;  5IT3 A;  2OQR A;  1K79 A;  4BAC A;  1REP C;  3ULQ B;  2FNA A;  4NBQ A;  3OL4 A;  3U2R A;  2JWT A;  4KMF A;  1XCV A;  2LRE A;  3RPU A;  2CUE A;  1MBF A;  2D1H A;  3AG3 H;  3DBR B;  3TP3 A;  4AVP A;  4B1R A;  1CGP A;  3ZCO A;  1MW7 A;  4J19 A;  4MQV A;  4D1Q A;  2RRE A;  2CWE A;  3I64 A;  4FHT A;  2CFX A;  2LKS A;  3G3Z A;  1P7I A;  3HC7 A;  4DIQ A;  3S2W A;  3J80 K;  3HGY A;  3EUA A;  1QA6 A;  2K3F A;  4BE2 A;  3S3N A;  4MQ9 F;  5BQT A;  4FCY A;  2K9Q A;  3LAJ A;  4HF1 A;  2AHQ A;  2A5W A;  5D4S A;  4HX4 A;  1OCO H;  4PFP A;  3S15 J;  1MIJ A;  2OA4 A;  2XV4 S;  1LDJ A;  1UB9 A;  1Y8R B;  1QO0 D;  3MFK A;  2L7Z A;  2D5V A;  2KIQ A;  1V4R A;  4Y33 A;  5DEQ A;  2VOP A;  4A3D J;  1Y56 A;  3CMA I;  2F5V A;  3BQY A;  2RV8 A;  4B8X A;  1JKR C;  3GLL A;  1VQK I;  2G7U A;  4LB5 A;  3VFZ A;  5CKT A;  3PSI A;  3FHZ A;  4F93 B;  2FEZ A;  4B3A A;  4OMZ A;  2X6O A;  3DKY A;  1XN7 A;  2XKO A;  5HDK A;  2IS2 A;  4U88 A;  4JX6 A;  4UVB A;  2VQG A;  2L7K A;  2HXI A;  5M5Y J;  1NK3 P;  2KRC A;  1K78 B;  2KFD A;  3FMR A;  1K7A A;  5J40 A;  2JQ7 A;  5DUI A;  1LEB A;  1WI9 A;  2YX7 A;  3GTK J;  3I59 B;  3DCF A;  1XC5 A;  2V79 A;  3FBN B;  4NUB A;  3M3Y J;  3RZO J;  3M4O J;  1IXR C;  1XSX A;  5F0F A;  2EFQ A;  2QZ8 A;  3FDY A;  4XK4 A;  2VOD A;  3JAM K;  3V7C A;  1T08 B;  4GCV A;  3SEQ A;  2EFP A;  4XN3 A;  1RIO H;  2FF4 A;  1YIO A;  1DP7 P;  4MO7 A;  3S93 A;  2QQ9 A;  1XMA A;  4A3G J;  4EGY A;  2QWW A;  2CGP A;  2ZFW A;  3KEY A;  4RAZ A;  2FRH A;  1I27 A;  1MBG A;  3W6K B;  1R6R A;  2CFO A;  1SD7 A;  4C3H J;  5M5X J;  1H8A C;  3ZMZ A;  2XGE A;  1S8N A;  3KE2 A;  2E35 A;  2NYX A;  4PSX A;  3DLL F;  1YJN I;  2FQ3 A;  1S7A A;  2M7A A;  3OS0 A;  1L0O C;  1W7P B;  4ESF A;  3E97 A;  1ZRD A;  1TW3 A;  1IRG A;  3A01 B;  1V54 H;  5KK1 A;  1R1T A;  4G7H F;  1P2F A;  2LKX A;  3CDL A;  3OMY A;  4FE4 A;  4HDV A;  3DV8 A;  3CDI A;  3GZ6 A;  1Y39 A;  1ZTR A;  5GP9 A;  1OFC X;  2OZU A;  3V4G A;  5HDN A;  3PUF A;  1EH6 A;  2P5V A;  3S32 A;  2Y0M A;  5ED4 A;  4BL0 B;  3EET A;  1SD5 A;  3WGI A;  4M9Z A;  3D5S C;  4KT6 A;  1B59 A;  3LSG A;  1T98 A;  2RN7 A;  1T2K A;  5DCF A;  1XGS A;  4UVA A;  4CXF A;  2FU4 A;  2VQH A;  4ZZL A;  2W57 A;  1G8X A;  3JRA A;  1OCZ H;  2XAF A;  2OBP A;  2CJJ A;  1R1V A;  2QSF X;  4HBL A;  2PX9 A;  1MMN A;  3FM3 A;  1A36 A;  3A03 A;  4BUP A;  5FJ8 J;  2LR8 A;  4F3Q A;  2JUG A;  3MVP A;  2Q0O A;  4RGS A;  1W5T A;  2L3D A;  2KZV A;  4ABZ A;  1BJA A;  5J47 A;  3JRE A;  4I99 C;  4OWR B;  4GYG A;  3QP6 A;  3CCU I;  4M73 A;  3SDB A;  4H0E A;  3J7Z I;  1FYM A;  3NWT A;  2WY8 Q;  1KU3 A;  2V1N A;  1PDN C;  2CMP A;  4A3M J;  3FMQ A;  3KET A;  1POG A;  5FLV A;  1V5E A;  2ICW G;  2HR3 A;  4ZH4 F;  3ZQQ A;  3BC8 A;  2C6Y A;  1MDM A;  1ETK A;  2HOA A;  2XGC A;  3DF8 A;  3NEU A;  3K69 A;  2VOO A;  4IHW A;  3GTQ J;  4LD5 A;  3GEZ A;  2XRO A;  4CSW A;  4HNT A;  3V8K A;  2KRF A;  4GGG A;  2IS6 A;  4BU2 A;  4G9Y A;  3ZQH A;  3VYS B;  5GAG J;  4X6A J;  3K6G A;  2QBY A;  3H3V K;  1F9N A;  2MC4 A;  2NVX J;  3RIR A;  1D3Y A;  4ZDO A;  3VEP A;  2YSR A;  4AYB N;  2FOW A;  1JHF A;  2A68 F;  1D0X A;  5HVQ C;  1TWF J;  2BXZ A;  1BI2 A;  3Q9S A;  2WV0 A;  5F0C A;  3QPT A;  3Q0U A;  1RPW A;  2CU7 A;  4Q48 A;  3CCQ I;  3CC7 I;  2DMU A;  5L3G A;  1S7O A;  4YIR X;  2HDC A;  2ZJR F;  2NVY J;  2JA8 J;  2F4I A;  5KAI C;  1Z7L A;  2DFH A;  2KIS A;  1KYW A;  2F4O B;  5CVR A;  3BCA A;  3CP2 A;  5K7F A;  3RPQ A;  1MBK A;  5F1J A;  4DGW B;  3S16 J;  3AKZ A;  1BI1 A;  5FKO A;  2GOX B;  5GAD J;  3GBG A;  3HRU A;  2LYC A;  3IH4 A;  2BY1 A;  2RKH A;  2L9R A;  1JUM A;  2RNG A;  3F72 A;  1JGS A;  3RQI A;  3V7R A;  3HUG A;  4HV5 A;  1JT0 A;  3GTG J;  3QRF F;  5J4V A;  4B3X A;  3K4J A;  1FOW A;  1BBY A;  2IT0 A;  5IYD J;  3HSF A;  1F4K A;  4IRG A;  4S05 A;  2DW4 A;  5DM6 F;  3J7A O;  1D0Y A;  3COA C;  1O7L A;  4ASN A;  1JKQ C;  2A69 F;  1WJD A;  1ZLJ A;  3IKV A;  5FRN A;  5CPR B;  3HEF A;  3QOE A;  1J75 A;  3OYN A;  1EA3 A;  3HG9 A;  2XPV A;  4HYE A;  2DDA A;  2EA4 A;  1GDT A;  1WH7 A;  4KUM A;  3ZQL A;  3GTJ J;  1P4W A;  1YX5 A;  4CCL A;  4WX9 A;  4GFB A;  3C3W A;  1I5Z A;  1SAU A;  3KCC A;  4LG0 B;  3L09 A;  3TDU C;  1SVL A;  2ZXJ A;  3AL0 B;  3G1L A;  2DDB A;  1TC3 C;  4II3 A;  3UR3 C;  1YJ9 I;  4LB6 B;  3QPL A;  4KIT B;  3H5N A;  2D2W A;  1G3Y A;  2LOO A;  4DZP A;  2E2I J;  2XB0 X;  3RYP A;  4P96 A;  3VWB A;  3KP7 A;  4FIS A;  4N4N B;  1W0T A;  1RUN A;  3PFI A;  2VAS A;  1LEA A;  4ESJ A;  3FXO A;  1Z91 A;  5IOZ A;  2NAZ A;  2IA2 A;  3L00 A;  3U21 A;  4NC8 A;  4YG2 F;  5DCM A;  2QQ8 A;  1EJ9 A;  4HX8 A;  4Y13 A;  3BZ6 A;  3H0G J;  3MWM A;  2MAB A;  3JSP A;  3SZT A;  3DU5 A;  4EJO A;  2E1N A;  3K9T A;  3QU3 A;  2G7H A;  1TW2 A;  5DS9 A;  1R4M B;  2KRH A;  2ZB9 A;  3TO6 A;  3NQO A;  5IYB J;  4C2U A;  2KT0 A;  2W84 A;  2WTE A;  3VYU B;  1ZLK A;  1ZH5 A;  3LSJ A;  2EFN A;  1GUU A;  1R58 A;  2FA5 A;  1U3E M;  1I3A A;  1EF4 A;  3CP8 A;  4M9S A;  1FEX A;  2MC3 A;  4IHY A;  4PDK A;  1VQN I;  3RKQ A;  4B4C A;  3NAR A;  3KP3 A;  1HA8 A;  2Y30 A;  1UHM A;  2RQQ A;  5HNF A;  1W36 C;  3G2B A;  2EV5 A;  1S9H A;  4ENJ A;  2L54 A;  5IY5 H;  2MLK A;  4NC7 A;  3V42 A;  5JI6 A;  2L7M P;  3M8F A;  3KIO A;  3QPH A;  2KPM A;  4KIF A;  4JX4 A;  4L9N A;  1MMD A;  1FZP B;  2H8W A;  4JK1 X;  3BTI A;  4R79 A;  2W1O A;  2GIZ A;  4A0X A;  2COB A;  2VLA A;  3H92 A;  1T56 A;  3J81 K;  2XAU A;  3ONQ A;  1D5Y A;  2VB6 A;  5FB2 A;  3OYL A;  5LGT A;  5FD5 A;  3WU2 C;  1U9N A;  1OLT A;  4XOT A;  1JI8 A;  2VN2 A;  4JX5 A;  3O8H A;  4YFK F;  5LEK A;  1HW5 A;  3DFG A;  4P9U A;  2P6S A;  3Q0V A;  2EZH A;  2XVC A;  1BJZ A;  3C7J A;  1IXS B;  2DOD A;  2K5C A;  2Y31 A;  2FQ4 A;  1GT0 C;  1MND A;  3BG9 A;  2Y9Z A;  3DQV C;  3ABU A;  3ZQG A;  3KYC B;  2XUB A;  3CTA A;  4MLO A;  3ZQC A;  2A05 A;  2DA3 A;  4PSW A;  2VQC A;  1FOX A;  4XLE A;  4A0Y A;  2NNN A;  4S0H B;  2QKL B;  5F1R A;  4MIM A;  4OAY A;  5E1X A;  3MAJ A;  3JAM Z;  3RKY A;  3W2W A;  2O03 A;  1RKT A;  4X0G A;  5L3F A;  4NB5 A;  2IBD A;  4I7H A;  2MFZ A;  5CVI A;  2D45 A;  1JKO C;  2A6E F;  5J3L A;  1ERD A;  3F8C A;  2DTR A;  4E6K G;  2LP0 A;  1UCR A;  3ZMD A;  4LMY A;  2QF7 A;  3LL7 A;  3LSK A;  2Y48 A;  1KYZ A;  3P7N A;  4BHC A;  4PZJ A;  4IL6 C;  1ETW A;  3W2V A;  2X51 A;  4CCM A;  3OIQ A;  1HQC A;  3CF5 F;  4M9X A;  1IGN A;  5IYC J;  1U78 A;  1R36 A;  1B8I A;  4L0Z B;  3JRC A;  1WQ2 A;  2IEK A;  3OYE A;  3BTJ A;  3DKW A;  4UHT A;  3HHG A;  3W6V A;  3OYM A;  2LRD A;  4IF4 A;  1OYI A;  3MKY B;  3CCM I;  2VKE A;  3ZOB A;  3LSM A;  5D5U B;  1UMQ A;  4QWQ A;  4KT5 C;  2DA1 A;  2DAO A;  4JBA A;  3V7S A;  4NQW A;  4A69 C;  2VBX A;  5BOX A;  4L9T A;  1XX5 A;  4KJZ A;  3LWF A;  2HQN A;  4U0Y A;  4GO1 A;  4ZJZ A;  4A3C J;  1WZ2 A;  1O4X A;  3FIW A;  2FXA A;  3M1E A;  1HW1 A;  1BIB A;  1EV7 A;  2EJR A;  3I54 A;  4LFU A;  3WU1 B;  3OS2 A;  1O57 A;  2WWY A;  3F6V A;  2ZNZ A;  1YTY A;  2M30 A;  2V9K A;  2XGD A;  2EQR A;  2Z3Y A;  4LK1 F;  5CQE A;  5B1A H;  4BE1 A;  1PP7 U;  3HDD A;  5DM7 F;  2JPB A;  3JCU C;  1J7K A;  1X2M A;  5F08 A;  4G12 A;  1FNN A;  4BY7 J;  2F6C A;  3CJN A;  1N75 A;  4PFO A;  3PNY A;  1G4D A;  1XCB A;  5L3D A;  2HTS A;  1ON1 A;  1LE8 A;  5EDN A;  4IEJ A;  1YO5 C;  2LK2 A;  2P0W A;  4IHX A;  5DTD A;  3DPL C;  4IPA A;  5A2Q K;  2VT2 A;  3HRT A;  2EIL H;  2X48 A;  4GRI A;  1D8K A;  1R7J A;  2BY2 A;  2HGC A;  4FX4 A;  3CC4 I;  1TTY A;  4M6V A;  5CLS A;  5K7H A;  5IT9 Z;  3ABT A;  1WJE A;  1R9T J;  4HA8 A;  1KQ9 A;  4LLN A;  4FTH A;  3BG6 A;  2R7S A;  2HI3 A;  1STZ A;  4I76 A;  1WRJ A;  1ODD A;  3ERM A;  4BEH B;  1MMA A;  3GO5 A;  5EEH A;  2DFE A;  4WCG A;  2QQB A;  2VE9 A;  1ZAO A;  3GTP J;  1FX7 A;  2PFB A;  3F8N A;  2NOG A;  3LA2 A;  3FXL A;  3GZ5 A;  3FXM A;  5D6E A;  5EF6 A;  2R7Q A;  2E1C A;  2PJR B;  2QBY B;  1W5C C;  2X4H A;  5LGU A;  4C2M J;  5D8L B;  1QU3 A;  3BDD A;  4RAY A;  2QEX I;  2DMT A;  4RM3 A;  4AC0 A;  5KVR A;  2UUZ A;  4F7Z A;  3L2Q A;  2DMN A;  2M7B A;  2UWM A;  1DDN A;  3MKZ A;  2ZO4 A;  1YI2 I;  1CQT A;  1ON2 A;  4AM3 A;  1E0E A;  1ZKG A;  5J4Y A;  2OJE D;  2QQA A;  2LBF B;  1LNW A;  4CDG A;  4MGR A;  5E18 F;  4B43 A;  1ETQ A;  1KQ8 A;  1OJL A;  4D7N A;  1SVO A;  1OQY A;  3BR3 A;  3FHN A;  3KEQ A;  3LFU A;  1X2N A;  5M3F J;  4ITV A;  4HF0 A;  3H3Z A;  2GIV A;  4V2G A;  2KZG A;  2XF7 A;  4HNU A;  5LLQ A;  1R49 A;  1MNM C;  4A5N A;  3CJQ B;  1Q1V A;  4A93 J;  3S1N J;  1ENH A;  5GPA A;  1TWG J;  2HXO A;  1TNT A;  4Y7N J;  3K4C A;  1BW6 A;  2FSW A;  1Z21 A;  1Y6I A;  1YW7 A;  3BWG A;  3HOT A;  3OYB A;  2LY1 A;  1PUF A;  4LGW A;  1NK2 P;  3LOC A;  2GOM A;  2KDZ A;  4ANJ A;  3O6B B;  1AU7 A;  2YUS A;  1QPI A;  4I0A A;  3I3L A;  1FBQ A;  4N9H A;  2R7T A;  2HPM A;  3HUG B;  3TDZ C;  4PJL A;  4L5J A;  2OF7 A;  3RKW A;  2P4W A;  3BY6 A;  3PIO F;  5F0H A;  2NS7 A;  2JZY A;  1LJ9 A;  4G94 A;  4P1W A;  4UUV A;  3G4S I;  4HEA 2;  5AON A;  3L2V A;  1JGG A;  2DA4 A;  2UV1 A;  3FXJ A;  3OY9 A;  4A12 A;  5J1U A;  2R5Z B;  1VQP I;  3GF2 A;  3GTM J;  1ACI A;  4DBR A;  4XLP F;  3QQA A;  1RRJ A;  2OTJ I;  5FKM A;  3TMO A;  1K6O A;  2XF5 A;  2HDW A;  5ICE A;  5F6F A;  3T1B A;  3WHC A;  2IGM A;  2Y2Z A;  3RZD J;  2UXX A;  3BZC A;  1PVE A;  4BKX A;  2ZJ2 A;  3TP0 A;  3E5Q A;  1SAX A;  4M6Y A;  2H09 A;  3I56 I;  2MBF A;  2NOJ B;  1BC7 C;  3S2D J;  4CUG A;  1OYY A;  2YU9 J;  1U5T C;  2R5Y A;  3FXU A;  2Q2E A;  2NVQ J;  2DYR H;  1ZRC A;  3HSE A;  3I58 A;  1I6X A;  2I8D A;  3H5A A;  3DBH B;  5TJJ A;  3KYL A;  5C44 J;  2ESH A;  3KLO A;  1MSF C;  3W6J B;  2ZFU A;  4M3B A;  4XLC A;  3HTU A;  1H9G A;  2VUM J;  3BR5 A;  2JSP A;  3TO9 A;  3RYR A;  4PK4 A;  5DCM B;  2FUG 2;  1IC8 A;  3ZQI A;  2H6C A;  4D7M A;  2O9L A;  2ME6 A;  3F22 A;  1MD0 A;  4XIC A;  4EMS A;  1UHS A;  3DEU A;  5EZG A;  2G0E A;  2PN6 A;  3M1C A;  3SDG A;  5IOY A;  1RET A;  4HSR A;  2WB1 A;  1B72 A;  4DQ2 A;  5FFZ A;  3DP7 A;  2DK8 A;  4YII A;  4RLQ A;  4F92 B;  3K1M A;  3NRV A;  1PP8 F;  3REO A;  2DBB A;  2ELJ A;  3CJR B;  4AUX A;  1IN7 A;  2Z9O A;  2NXN B;  4WXC A;  1T8I A;  4FAS D;  1ZR2 A;  1WJA A;  4AU7 A;  2KQR A;  4CZZ A;  4RB0 A;  2Y69 H;  3OYI A;  3EUH C;  2AQE A;  3J81 Z;  1H88 C;  3BQZ A;  2IPQ X;  2V26 A;  1D1C A;  2JVG A;  4KIS A;  4IZZ A;  4A3K J;  1QQI A;  5J8C A;  2QGU A;  4UUT A;  1ZK8 A;  1E3P A;  2AS5 F;  5H6R A;  2A6H F;  3V8L A;  1YIJ I;  2HFH A;  3CCR I;  1W5S A;  3MZH A;  2NVU B;  4G6D A;  2W7N A;  3NWS A;  3IUO A;  2W4S A;  3EQL F;  4CIC A;  3LA7 A;  1IDY A;  1OR7 C;  1FBS A;  2RQP A;  3ECH A;  3IAS 2;  2ELH A;  2PMH A;  2VKD A;  3A4C A;  2VJI A;  1QHH D;  3SYT A;  4MEX F;  3H9J A;  2ZME C;  3X2Q H;  3A02 A;  1P6R A;  1R71 A;  4BY1 J;  1UST A;  3TOA A;  3N97 A;  3F8B A;  2VI6 A;  1UHW A;  2ZCW A;  1XTA A;  3M8E A;  5FKK A;  3JRD A;  3C2G A;  2J5O A;  3RQ4 A;  2A07 F;  4PUS A;  4XRS G;  4OIN F;  4HW0 A;  2VPL A;  1X4P A;  3HKZ A;  3PO2 J;  1PJR A;  4AWX B;  5GAE J;  3IC7 A;  2V7F A;  2DFF A;  1HXD A;  1E17 A;  3KP5 A;  3CZ6 A;  3BTL A;  1ZG3 A;  2CQ7 A;  5BPD A;  4UY8 I;  4QIW N;  4A3L J;  3BR0 A;  1Y0U A;  3ZQ7 A;  2V1X A;  3QOD A;  4HLY A;  3J7Y J;  2V6E A;  4P5O A;  1IN5 A;  2K7L A;  2DQL A;  5EJC A;  5LGN A;  5FD6 A;  3JW4 A;  1EH8 A;  4ZDL A;  4A5M A;  2XAH A;  1USS A;  3OYJ A;  4XMY A;  1MBJ A;  1RKW A;  3KP2 A;  2PBI A;  3GZN B;  3SFI A;  3CQZ J;  4H4K C;  4PGG A;  1FLI A;  2DT5 A;  1FMW A;  5J1Y A;  1YRN B;  2A6T A;  3CCS I;  1Z67 A;  4QLC U;  2LVS A;  1R1U A;  3I4N J;  1SAN A;  4NDL A;  1EKE A;  1X3W B;  3Q9V A;  2BGC A;  2V1U A;  4QTR A;  3FK7 A;  2OZ6 A;  1XD7 A;  3CUQ A;  3GXO A;  3K4L A;  2HOE A;  1WKM A;  4HQM A;  2L4M A;  3OR1 C;  2GA1 A;  4E7I A;  1T0F A;  2L2O A;  3KZI C;  3Q0W A;  4PJ0 C;  4W1U A;  2NVT J;  2WBM A;  1J9I A;  2F5E A;  1FIP A;  5CVJ A;  5GTI C;  4QSH A;  1P92 A;  5CQG A;  2KJC A;  4UUS A;  4NQW B;  1LKX A;  1O3T A;  5LBQ A;  4L5E A;  2W85 A;  3P9C A;  4LIU A;  3NAU A;  2N8G A;  1BW5 A;  3H1C A;  5ICC A;  3RKX A;  2IXS A;  2PMU A;  1B1B A;  5JHF A;  2DMP A;  4I6Z A;  5D6F A;  3ZN0 A;  4EAT A;  3PJR A;  4Y52 J;  1R5G A;  2RDP A;  3EPZ A;  2DOE A;  2E1M B;  5HLI A;  3K7A J;  2WA0 A;  2EK5 A;  1A6Q A;  2DI3 A;  1P4X A;  2R92 J;  3FWE A;  1IG7 A;  2MSY A;  4MFE A;  2CW8 A;  1F1Z A;  4UNO A;  4FQG A;  1NHA A;  1D8J A;  1KU9 A;  1WPK A;  5A2Q Z;  4CYC A;  4RBO A;  4BE0 A;  1O3S A;  3LSP A;  1BA5 A;  2XDV A;  1C0W A;  2V9V A;  3Q3S A;  2IJL A;  1LE8 B;  2VBZ A;  2XSD C;  1V3F A;  1WFX A;  5TIS C;  4A3B J;  2CW0 F;  5C4X J;  3GFI A;  2DQR A;  4ZYE A;  3JRB A;  2MGQ A;  4KNY A;  1A35 A;  4A6D A;  1RZ4 A;  4CCJ A;  1JUS A;  5FO5 A;  4A3F J;  3OL3 A;  1RI7 A;  1RNL A;  1FT9 A;  4RLF A;  5DUK A;  5IP6 A;  1K4T A;  1IDZ A;  2E34 A;  2LLK A;  4D0P A;  3SFZ A;  2EBI A;  3S8P A;  3N4M A;  2H8R A;  2P7C B;  3GME A;  1L3L A;  2XGX A;  4GXO A;  4ENN A;  3I4P A;  3HSR A;  2K9S A;  4UV9 A;  1MBH A;  3ZRG A;  1W7P D;  2GA2 A;  4HST A;  2XIG A;  3H5R A;  4RB2 C;  2OCE A;  3ABM H;  3WE3 A;  2XAS A;  3GTO J;  2RAE A;  1XDU A;  3SXY A;  5BNG A;  4IHV A;  3BTC A;  1AKH A;  2FD5 A;  5E1W A;  1GVJ A;  3QYE A;  1JT6 A;  2TCT A;  3WGG A;  1CF7 B;  2EB7 A;  5HDG A;  1HSJ A;  4Y15 A;  2EZI A;  2ZXI A;  4EGZ A;  4BXF A;  1UG2 A;  2JJ7 A;  2EH3 A;  2HWV A;  5E3M A;  2MW8 A;  4RGU A;  3IH3 A;  1WHU A;  1DQU A;  4LLL A;  4XON A;  2M8G X;  3IH2 A;  1YE9 A;  2R3S A;  4ZYG A;  1MH4 A;  1Z3Y A;  1WWX A;  4PJJ A;  1WJB A;  4S04 A;  1FSE A;  1ZN2 A;  3KX2 A;  3QOP A;  3HXL A;  2O0Y A;  1H9T A;  2WB1 N;  4BH9 A;  4BXX J;  1WH5 A;  2HNH A;  3M8J A;  2CQN A;  4BJ5 C;  4HOB A;  4KMU X;  4R1H A;  4XLA A;  5E20 A;  2PEX A;  4V2F A;  1KON A;  1MJ9 A;  1U0J A;  2DPU A;  1NTC A;  4DOZ A;  2AO9 A;  2F5C A;  1HC8 A;  1D5V A;  2LY2 A;  2VC0 A;  3T8T A;  1RES A;  1PUF B;  3WTU C;  4IVN A;  3I4M J;  1FWZ A;  4BJT A;  2BW3 A;  5LHG A;  1LPQ A;  3I0T A;  1U9O A;  3PQK A;  2DPD A;  2W48 A;  3DTK A;  2FBH A;  3FMS A;  2WV1 A;  2Z5U A;  2ID3 A;  2XC7 A;  3OSF A;  2LD5 A;  4GYI A;  1JHH A;  1FY7 A;  4MEY F;  2Z2S B;  4HAM A;  5HLG A;  1ETO A;  1BR4 A;  2VKH A;  1X4O A;  2M4G A;  1IZ1 A;  4HLX A;  4XL9 A;  4EJW A;  1XSD A;  2STT A;  4BGD A;  1YOV B;  2GXA A;  3S2H J;  1ZAR A;  3ECO A;  2DYS H;  2L9S A;  3D5L A;  4XN0 A;  3WTV C;  1J59 A;  1G2H A;  3CUO A;  1JUP A;  2FE3 A;  3OIP A;  1IW7 F;  5HNH A;  4WXH A;  1XGM A;  4N0B A;  1SD6 A;  3K1N A;  3H3U A;  4B44 A;  4IOC F;  2WAQ N;  3BR1 A;  1BR1 A;  2DOA A;  4BNC A;  3DLA A;  2KIF A;  2IA0 A;  3QPS A;  5DYM A;  1Z3X A;  3J80 Z;  3HYI A;  4I2O A;  3HKZ N;  1VQ6 I;  4KN4 X;  5C3E J;  3J7A Y;  3KZY A;  3K4K A;  3MCZ A;  1LFU P;  4CA0 A;  2HZT A;  5B3S H;  2O7O A;  4O3M A;  3ABK H;  3W2A A;  2EIM H;  1VQ8 I;  2CV2 A;  2PQ8 A;  1T38 A;  2CS3 A;  2Z99 A;  4AIJ A;  3HHH A;  4D9J A;  3B73 A;  1OPC A;  3K70 D;  4CCO A;  2R7F A;  4XLF A;  2HEO A;  3BG3 A;  1UEL B;  4I98 B;  2EIJ H;  1OCT C;  4L9J A;  2QA4 I;  2VON A;  3OS1 A;  5B5E C;  1LDD A;  4MTD A;  3QP5 A;  4MTE A;  3PUB A;  4OAZ A;  2IA1 A;  2XB5 A;  2ZSH B;  3FXQ A;  5M3M J;  1TLH B;  1X58 A;  3DTI A;  4M3D A;  2KLO A;  5JLW A;  4ETS A;  3FM5 A;  2E71 A;  5HS8 A;  1IRF A;  2K4B A;  3U1D A;  1A6I A;  1Z0X A;  2CUF A;  1FYL A;  1MZB A;  5AIQ A;  1Z1D A;  1W0U A;  3AL0 C;  4XM3 A;  3BG7 A;  2EFW A;  1S3J A;  4XOP A;  2PI0 A;  5GAH J;  1IN8 A;  3HPG A;  1JTX A;  5J1R A;  2CUZ A;  1IAW A;  5LEJ A;  2J5P A;  5LD2 C;  1P4A A;  2GQQ A;  1Y8Q B;  2LTP A;  3CMY A;  4A3I J;  4HF2 A;  4C2T A;  3I55 I;  3CMM A;  1W7P A;  2JPC A;  2QYO A;  3AG1 H;  2JT1 A;  1Z6R A;  3OYD A;  1AA7 A;  2FBK A;  2BHY A;  2KL4 A;  4F52 A;  2HYJ A;  4HX7 A;  2FX0 A;  3WG7 H;  3F21 A;  2ZNY A;  2EFO A;  1WSU A;  3EDP A;  5KHD A;  2UZK A;  2K9N A;  2L02 A;  2ZJP F;  3OYF A;  4J00 A;  4N4O B;  4RMN A;  1ONV A;  3O3K A;  4M71 A;  2GWR A;  1X1C A;  1EH7 A;  4RM2 A;  5EGO A;  2B7E A;  6PAX A;  2CYY A;  1MMG A;  4LIV A;  4B09 A;  2VKV A;  2LY9 A;  3K4N A;  2G9W A;  2P5L C;  4IOA F;  3R0J A;  4OIR F;  3L2W A;  1U6G A;  2M0M A;  3LST A;  2DA5 A;  3I71 A;  3B6A A;  4TV7 A;  3O2P E;  3R6S A;  2W00 A;  4I02 A;  2EA2 A;  1ZEL A;  1UAA A;  4MFD A;  3VOD A;  4KIC A;  2YX4 A;  3CCE I;  3C2H A;  2BXY A;  2X6Y A;  1A5J A;  3OV8 A;  3HZJ A;  1VQ4 I;  1ITY A; 
#chains in the Genus database with same CATH homology
 1S72 I;  4UY8 I;  3I56 I;  1VQ8 I;  3CC4 I;  3J7Y J;  4V19 K;  3CMA I;  3CCU I;  2QA4 I;  1VQK I;  1FOX A;  3J7Z I;  3PIP F;  3CCS I;  1YJ9 I;  1VQ9 I;  2QEX I;  1VQM I;  5JVG F;  1YHQ I;  1VQ7 I;  2JQ7 A;  5GAH J;  5GAG J;  1YI2 I;  3G6E I;  3CJT B;  3CF5 F;  2OTL I;  2E36 A;  1VQO I;  2FOW A;  2NXN B;  1HC8 A;  3CCV I;  3CD6 I;  3I55 I;  1MMS A;  3CCQ I;  3CC7 I;  3CCM I;  3CCL I;  1VQL I;  2ZJR F;  2E35 A;  3DLL F;  1VQN I;  1YJN I;  1YJW I;  1FOY A;  4IO9 F;  2ZJP F;  1VQ5 I;  1YIJ I;  3CCR I;  3CME I;  2H8W A;  5GAD J;  5DM7 F;  1Y39 A;  3PIO F;  2ZJQ F;  4IOA F;  3G4S I;  4IOC F;  3G71 I;  1YIT I;  1VQP I;  3CC2 I;  1FOW A;  1ACI A;  2OTJ I;  5DM6 F;  3CCE I;  1QA6 A;  2K3F A;  1VQ6 I;  3CCJ I;  5GAE J;  2E34 A;  1VQ4 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...