4B8XA

Near atomic resolution crystal structure of sco5413, a marr family transcriptional regulator from streptomyces coelicolor
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
144
structure length
139
Chain Sequence
GVPSMAAITSIMRAQQILLGEVDAVVKPYGLTFARYEALVLLTFSKSGELPMSKIGERLMVHPTSVTNTVDRLVRSGLVAKRPNPGTLATITDKGREVVEAATRDLMAMDFGLGAYDAEEGEIFAMLRPLRVAAGDFDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords POSSIBLE MARR-TRANSCRIPTIONAL REGULATOR
publication title High Resolution Crystal Structure of Sco5413, a Widespread Actinomycete Marr Family Transcriptional Regulator of Unknown Function.
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 52
structure length 139
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4b8xA00
3HSFA 3C3WA 2AS5F 2V1DA 4NB5A 2P7CB 3JAMK 3B73A 1ZRCA 4ZH4F 5J8CA 1LNWA 2L02A 2PG4A 4N0BA 1IN5A 4A6DA 3O6BB 1ZG5A 1XGOA 1T0FA 1Y0UA 4RGSA 1DDNA 1REPC 3RIRA 2ADUA 4U0WA 2PEXA 4KUMA 2JPBA 3FZVA 2R7DA 4B09A 1HBXG 1JE8A 3E5XA 4LK0F 3GFLA 4PGGA 2Z3YA 2BEOA 4S04A 2BV6A 3TOAA 2UXNA 5CVRA 2NAZA 1S6LA 5BQTA 3SFZA 1XSXA 1O57A 1BI1A 4WXDA 4S05A 4Y13A 3JSOA 1W4MA 2QM3A 2JRTA 3IC7A 3ROUA 4HX4A 4IHSA 1KQ8A 1KYWA 1YQAA 4KN4X 2QZ8A 3C18A 5CYVA 3LSTA 3REOA 1TLHB 4UNOA 2G9WA 2ZCWA 2Y48A 3H92A 3RPQA 3HOSA 2IA0A 1E2XA 4M6XA 3SZPA 2MLKA 4EM0B 1ZG1A 2DQLA 3PFIA 3WGGA 2DK5A 3RYRA 1BN5A 3KCCA 1R1UA 3OOPA 3FHZA 2K4JA 2EA2A 2HOEA 3O2PE 2HZTA 5HOOA 3BPXA 1K7AA 3HSEA 3EYYA 2H94A 1J0RA 2K02A 2M1BA 2OBPA 3EUHA 1XN7A 2LDUA 2KIMA 5AIQA 3FWEA 4I2OA 3C7JA 4Y15A 4RAYA 4UXNA 3CUOA 4ON0A 1ZRFA 4MEXF 4R1HA 4EV0A 3I58A 2DI3A 3LFKA 1SFEA 2W24A 3N97A 1BIBA 4I0AA 5DYMA 2COMA 5E1WA 3LAJA 3ABUA 4ESBA 3P9KA 1Z91A 2K4BA 4HDVA 4P5OA 3LQQA 4LG0B 4KYWA 3Q9SA 3MZYA 1HW1A 2CQKA 4IPAA 5JVTA 1B1BA 4UVCA 3RDIA 2F2EA 2HEOA 3F22A 1OYYA 2IP2A 3F3XA 2JZYA 4CICA 2M30A 3CUQA 2E7XA 1IUYA 3GLXA 3WE2A 2HFHA 3P7NA 4EJWA 2YX4A 1H0MA 1SD4A 5D5WB 2IRFG 3ULQB 1G3SA 1TQMA 3R4KA 2LF7A 1Z05A 2QBYA 3CDHA 5FGMA 1IAWA 4L5IA 4UUVA 1FSHA 3HRTA 2W57A 1S3JA 5ILUA 3KFWX 5LEJA 2WV0A 4L18B 1WWXA 2XAJA 2UZKA 2NS0A 2P5VA 3SQNA 3FMRA 1G3TA 3O3KA 3QOPA 4RGUA 3CUQC 2FNAA 4XLPF 1QO0D 2E1NA 2CFXA 2P7VB 5BMZA 2XRNA 3WU0A 4MQVA 4RGXA 5DEQA 3LWFA 3MEXA 5DV5A 3WE3A 4HV5A 3LA2A 3L09A 4IJAA 2CO5A 1FC3A 2L01A 2ZJ2A 5D4SA 1XB4A 2F5FA 2NNNA 4XSXF 2VC1A 2XKPA 2K86A 1HKQA 3P9IA 3Q5FA 3ABTA 1YIOA 2YU3A 1R00A 2A61A 2MD5A 1LB2A 1FY7A 2ACJA 4OIQF 4AWXB 1TW3A 1LEBA 4RB3C 3WTXC 3WU1B 3R0JA 2V9VA 3BP8A 4NQWA 3GXOA 3I53A 1HW2A 4RB0A 5K5QA 1FYMA 2Q2EA 2HWVA 1BOAA 3TGNA 1UHMA 2TDXA 1R5GA 1K6OA 5HVQC 3L00A 2P8TA 4YIFA 1SFXA 4I7HA 4R79A 2D45A 2LNBA 2EJRA 5CVUA 4M6YA 1U5TB 5KK1A 5DCMA 3ECOA 5A2QZ 1Z1DA 2FOKA 5DD8A 3V7SA 5FD6A 1RIOH 2RGVA 1ZREA 2EV6A 2A69F 5BPDA 4BNCA 2YSRA 3ZMZA 3ZPLA 1KGSA 5HLIA 4BHCA 4KICA 1J75A 3FXRA 4A5NA 1J9IA 1RNLA 3QRFF 1BI2A 3TO7A 1FZPB 4BQAA 4L9JA 2PJPA 2KIFA 1SMYF 2W84A 3GUDA 1TW2A 3Q9VA 2R3SA 2CGPA 1XCBA 3DP7A 4M74A 1SD7A 1STZA 2M87A 5ED4A 2OU2A 2PLYA 2OZ6A 2KKOA 5D8LB 1R5HA 3RI4A 2K27A 3E5UA 2H6BA 3E3VA 1O7LA 3GYHX 1LDDA 1HXDA 3K0LA 4EM2A 3J7AO 4XRFA 1WI9A 3COAC 3FXQA 3SZTA 1XSVA 2E7WA 1RZ4A 1CF7A 4G94A 2HYFA 3RPUA 2ZXJA 4MNUA 3C1DA 1I5ZA 4KFCA 3FMSA 4AIKA 4UVAA 3GX4X 2F5DA 3V8LA 4KA4A 1JHHA 4YFNF 3RYPA 5JFRA 1UHWA 2M8EA 1XGNA 1IF1A 3ZQ7A 4HDUA 4KMFA 4KIBA 1OMIA 1B6AA 1UB9A 3KP2A 2GWRA 4I0BA 2F5CA 2IA2A 2WC2A 2FRHA 4H0EA 1QZYA 2VC0A 1XMAA 2GAUA 3DKWA 1XMKA 1ZHFA 1FSEA 5E1ZB 3D5LA 3RJPA 3JSPA 5L3CA 2DK8A 2JTVA 2ZMEB 4Y17A 2L4MA 2LF8A 2QVOA 2HDCA 2A3SA 2CWEA 1ZN2A 4IHTA 3WTWC 4RB2C 5A2QK 3I59A 3KEOA 1I6XA 3R0AA 6PAXA 5E8IA 1BIAA 4LLNA 2QYOA 2GA2A 3G3ZA 1P2FA 1QBJA 2O3FA 1F1ZA 2NNYA 1KA8A 1IZ1A 1TNSA 1I1SA 5CJ9A 3ZMUA 1RI7A 3VODA 4YIIA 4HYEA 5ICEA 5AONA 1KU9A 4HF1A 1FYKA 5FB2A 4U7DA 4A12A 4XLNF 2Y0MA 1FBQA 1EH7A 2FBKA 2HTSA 2FMYA 3K69A 4FT8A 1FWZA 4M73A 3GF2A 5D4RA 4MEYF 4R8HA 2XAGA 1HKSA 3VFZA 1P4AA 3KE2A 4LFUA 1G4DA 1DPUA 1EH8A 1FYLA 4L9NA 3RTRA 4LK1F 3W6JB 3NRVA 1K78B 3IHUA 3FX3A 2YX7A 2BYVE 2VOPA 3H3UA 3IKVA 5IT3A 1YW8A 3GFMA 5FD5A 2VBXA 5K5RA 1XCVA 4KN7X 5HLGA 3DPLC 2STWA 3PQKA 3GZ6A 5LBQA 1YFHA 1O3QA 4HW0A 3GFIA 4DQ2A 3VB2A 3EYIA 2ELHA 2RC4A 3CO7C 2LKPA 3RKYA 1OPCA 4Z2YA 2RNJA 1Z6TA 3MCZA 2MLGA 4G9YA 2QQAA 3F8MA 3K1NA 2STTA 2UWMA 3ML6A 3U1DA 1IN4A 4NHJA 1FPQA 2ESNA 1B59A 4MTDA 2QWWA 4EGYA 1R1VA 1LDJA 5TJJA 4DNCA 5LHHA 2P6TA 1V4RA 3RKXA 2O8XA 4BAYA 3M1EA 1FBUA 3L2CA 3V8KA 3GZ5A 4EGZA 4ENJA 3E6MA 5LHIA 1R58A 2Q8KA 1HQCA 1YS6A 2VBZA 3ZMSA 4WXCA 1QZZA 3QAHA 1XD7A 2P4WA 1V3FA 4RGRA 5BS6A 1BJAA 4HX7A 1Z6RA 2XKOA 5H20A 3F8NA 3QPTA 2IVMA 3V4GA 1Z7UA 3NQOA 4IVNA 2XV4S 3IWFA 3F8FA 5D8KB 4HZFA 1SFUA 2EV0A 1U6GA 3WTUC 2HQNA 1ON2A 4AVPA 3E6DA 4KDPA 1BI3A 3FXUA 2IT0A 4KIFA 3J80Z 1L0OC 3P9CA 2KIUA 4GGGA 2RV8A 4AIHA 1D8JA 4FX4A 1UCRA 2BE5F 2YR2A 2LSOA 4CDGA 1PP7U 2PN6A 3PQJA 3WODF 4BHPA 3BJAA 1W7PD 1W7PB 4O3MA 3CLOA 2OQGA 5TRDA 2QQBA 1T39A 1IN8A 2W85A 3TOBA 2DW4A 1R7JA 3BZ6A 4WXHA 3KP3A 3HHHA 4P96A 4IRHA 1B9MA 2GXGA 1TNTA 4KMUX 4GYIA 3T0YA 2H6CA 4WF2A 1DUXC 2QLZA 4IXAA 1U5TA 2HGCA 3GFJA 1ZGAA 4EVIA 2D1VA 4U0VA 2ZNZA 1YW7A 5EEGA 1LJ9A 2H09A 4EMSA 4BH9A 3GW2A 4MHGA 1JGSA 5E18F 5DDGA 2K7LA 2A6HF 3M8EA 2HS5A 5LRSA 4OIPF 2XHKA 1Q1HA 2MBFA 5DUKA 2W25A 1I1GA 1KU3A 3FF5A 3ECHA 1BM9A 4IRIA 1FT9A 4HV6A 1R1TA 4M9SA 1O3SA 2EFOA 2EFPA 5ILSA 2V6CA 1ONVA 3WTTC 4G7HF 4ZYGA 2CYYA 2GIVA 2DT5A 1I27A 4U7BA 2A5YB 2XAHA 2O6GE 4A0XA 3BROA 1SAXA 3CUQB 4LB5A 1ZH5A 1TQIA 1HKTA 5H6QA 4HBLA 3CJNA 1MDMB 1D8KA 1EH6A 3MZHA 4ASNA 3E97A 4U88A 3SHFA 4LLGF 3H3ZA 2L3DA 3S2WA 5EEHA 1J59A 4E70A 1G3WA 1U5TC 1SD5A 4K2EA 1USTA 2BGCA 2HQRA 3L7WA 4ENNA 1MJAA 1P92A 5D5UB 2QBYB 2XIGA 3KLNA 3FM3A 5ICGA 3CTAA 1MGTA 1T2KA 2HTJA 1GHCA 2D2WA 4HOBA 4OIRF 4G6DA 4A0YA 1F5TA 1ODDA 4A5MA 2HKOA 2UXXA 2A07F 2Z33A 2J5OA 5LGUA 2VOOA 5HDNA 3K1PA 3J80K 2DU9A 3K1MA 4KT5C 1WKMA 2PBIA 3WG9A 2RQPA 5L3EA 3HOTA 1FNNA 2IPQX 3E5QA 3HTSB 4Q5SF 3QU3A 4BXUA 1JXSA 2FE3A 1GVJA 2VT3A 4M9XA 2FBHA 2GXBA 2ESHA 2CSOA 3WTYC 4U0YA 2E1CA 3KLOA 1USSA 4G8XA 4EJUA 5HLHA 1B4AA 1IXRC 4YG2F 5ILVA 4KNYA 2PMUA 5LRRA 4ENKA 2XAFA 3HRMA 3MAJA 4CO8A 2FU4A 5F64A 4Q47A 4G7OF 1IRFA 1JHFA 1DPRA 4D0PA 4LMYA 1ZGJA 3F21A 1CGPA 5D6FA 1MZBA 2FMLA 4EJOA 2R7FA 2HKXA 2O0YA 1ZLJA 2VN2A 2ISZA 3ZN0A 2P5LC 2XROA 3HTUA 1GXQA 4AIJA 4L5JA 4JK1X 2RN7A 4OMZA 1FX7A 2XASA 4G7ZF 4M9ZA 1G3YA 2ZNYA 5LEKA 3MFKA 5F6FA 1IN7A 3HIFA 2NYXA 3LQRA 3KZZA 3QP6A 1WRJA 3GEZA 1YTYA 2M45A 3F6VA 2EV5A 3I4PA 1OKRA 4RAZA 4OU0A 5E1XA 3V7RA 5AIPA 4UV8A 4GO1A 1P4WA 4RB1A 1D3YA 3W6KB 2MH9A 3M9AA 3IKTA 5J8FA 1QQIA 5BOXA 4O5VA 1HSJA 1QPMA 3VEPA 1K78A 2RDPA 1H9TA 4WK8F 1E17A 1O7FA 1OYIA 2FBIA 1BC8C 3F72A 4PZJA 3TQNA 4M71A 5JI6A 3V7CA 5E17F 4ZZLA 5HDGA 3M7GA 4M72A 3TKYA 3ZMTA 5E20A 1XDSA 2OZUA 1ON1A 2X4HA 2Q0OA 1T6SA 4L0YB 1YLFA 1PDNC 2VE8A 5LLQA 4LB6B 3G73A 1FP1D 5K5OA 3IL2A 2H27A 5E8GA 3JTGA 4HAMA 3ZMVA 2NRAC 2WTEA 4ZYDA 4ESJA 2CW0F 3JTHA 1QNTA 3BWGA 1KU7A 3NEUA 1J5YA 1CF7B 2M5WA 2Z5UA 1FOKA 2O03A 1O3TA 2Y75A 1S8NA 1YG2A 3B02A 2DQRA 5H6RA 5D6EA 3IWZA 2FXAA 5HS8A 3WTVC 3BJ6A 3R61A 4QWQA 3VOEA 3R60A 5CLSA 1SD6A 2DAOA 1L3LA 5FO5A 3T5XA 3DXJF 3WTZA 3KP7A 1IRGA 1RUOA 3E6BA 2XAQA 4OIOF 5L3GA 1U8RA 4HQMA 2C6YA 1HSTA 4MTEA 4LG0A 2V1XA 4Q48A 1BBYA 1T98A 2FF4A 3F23A 5CVIA 4UVBA 4XBFA 1OR7A 5L3DA 5ICFA 3K2ZA 3BY6A 4IRGA 3KETA 2VXZA 3RKWA 2FSWA 1R23A 3I59B 1ZARA 4WCGA 4N9IA 4FX0A 3JW4A 2KRFA 4L9TA 3QU6A 4EJTA 3LA7A 2OA4A 3J81Z 1MKMA 2Z9OA 2OQRA 4HQEA 3KZYA 1W7PA 4P9FA 4ETSA 1U78A 1XDUA 1YYVA 4GCVA 4GXOA 5FFXA 5LGNA 3N4MA 1G6NA 3AAFA 1P6RA 3HSRA 3BDDA 3BOQA 1S29A 4CGZA 1KYZA 5K1YA 5DD4A 1U3EM 2EFNA 2DPDA 4YFKF 1MJBA 4PGHA 1R22A 5J6XA 1F4KA 3TO9A 2V79A 1ZLKA 3HUGA 1U2WA 1NHAA 2IW5A 4UV9A 1DP7P 4LGWA 5FFZA 3ZN1A 3KEQA 3F6OA 3QPHA 2B0LA 4B8XA 2O61A 1ZRDA 4A0ZA 5HS9A 4MGRA 2XGXA 1LQ1A 4HF0A 3KP5A 3WTSC 3BPVA 2DFIA 1S7AA 1VTNC 1F9NA 3ERED 2J5PA 3KP4A 3DPTA 2Z99A 3ELKA 3MWMA 2PI0A 2CG4A 2VONA 2DO7A 3TDZC 4BYYA 2MH2A 1KQ0A 2PMHA 1MDMA 2A68F 3L9FA 2DLLA 1S7OA 1IW7F 2ISYA 4LD5A 4OOIA 3ZMDA 3KP6A 5D5VB 3MQ0A 1GXPA 2EWNA 2VE9A 1TQPA 1J2XA 2OD5A 4WX9A 3FMQA 2VT2A 3M8FA 2F5EA 3HHGA 3LAPA 3DF8A 3I54A 2G7HA 1WQ2A 3IRQA 1OYWA 2EK5A 4GYGA 3EQLF 2VBYA 3I5UA 2DTRA 4HA8A 3BJOA 5JHUA 2ETHA 1ZYRF 5FLXZ 3HRUA 1LEAA 1X3UA 3DEUA 5JR3A 2QENA 3WGIA 1C0WA 2ZO4A 4ENMA 4I01A 3DQVC 2KJCA 4CHUA 3LA3A 2FA5A 2PFBA 5F1RA 4L9VA 2EFWA 4WWCA 2MC3A 5KVRA 3D0SA 3J81K 2JPCA 3T1BA 2OAZA 4PDKA 2D1HA 2P5KA 2L54A 4P9UA 1QGPA 1FLIA 2PQ8A 4OMYA 4CXFA 1EV7A 4N9HA 4F7ZA 3IRRA 2YPRA 4HF2A 2GQQA 4CYDA 3I64A 4ZYHA 1XGMA 4MQ9F 4I09A 4EM1A 3DFGA 1XSDA 1J7KA 4ZYEA 3HRSA 5ERIA 4KIGA 5CVJA 5DUIA 5IT9Z 2RVCA 2VBWA 2IA1A 3K9TA 2DBBA 2KJBA 3F8CA 4HX8A 2VODA 4G6QA 2ZBKA 3GWZA 5DCFA 1AWCA 4PCQA 2A6EF 4I98B 1R36A 3TO6A 2EB7A 2DPUA 4JQFA 3R6SA 1IN6A 1KU2A 2FQ3A 3E6CC 1FBSA 4P55A 1P4XA 2GA1A 3JAMZ 3F8BA 3U2RA 1IXCA 5BPIA 4HLXA 4EQQA 5L3BA 4EJVA 4QLCU 5ICCA 2HR3A 2AXLA 1ULYA 1BI0A 1ZAOA 4TV7A 5D5XB 3I71A 1IXSB 2FEZA 3QP5A 1W5SA 3TDUC 2ZMEA 4LLLA 1SMTA 4HLYA 2ZFWA 1PP8F 1YW9A 4XSZF 1MJ9A 2FNPA 5FLXK 1AOYA 4LJZF 4O6JA 3GO5A 4A6EA 2JT1A 5HDKA 1YO5C 2XUBA 2V1UA 3FM5A 4OINF 2BBYA 3T8RA 5L3FA 3HYIA 1T38A 4JBAA 4L0ZB 4AD9A 2P6SA 3OV8A 1YS7A 4Q4ZF 2EFQA 4YFXF 2G7UA 2QQ9A 1ZG3A 4FHTA 2HYGD 4BHBA 5DCMB 3EETA 2RKHA 2EA4A 3EDPA 1PUEE 3CO6C 1UFMA 5HS7A 2WWYA 3ZP5A 4RS8A 1HW5A 2L4AA 1KQ9A 3T8TA 3DV8A 3SXYA 1TBXA 1RUNA 3V8JA 3WGHA 4I02A 1A04A 1MD0A 1O3RA 4UHTA 1WSUA 3U9GA 2ZKZA 2GZWA 2X0LA 1FP2A 1W5TA 4A2UA 4ESFA 1Z9CA 3I0TA 4CZZA 1D5VA 5IT9K 1XGSA 2JSCA 2MA3A 1K79A 1H9GA 2XVCA 1LDKB 1LVAA 1TTYA 1B9NA 4ZZDA 3ISPA 5LHGA 4IF4A 3GVAA 1BC7C 2IJLA 5LGTA 5CVVA 2QUFA
chains in the Genus database with same CATH superfamily
1MBEA 3HSFA 2GXAA 3C3WA 1UHSA 3ERMA 1W36C 2Z1DA 2AS5F 1WVRA 2V1DA 1SAUA 2JA8J 4NB5A 2P7CB 3JAMK 3B73A 4XORA 1ZRCA 4ZH4F 5J8CA 4LITA 1UZCA 1SVMA 2DOEA 4EATA 1RR8C 1LNWA 2L02A 2PG4A 4N0BA 4Y4RA 2HOAA 1IN5A 5E3MA 2O7OA 1XG1A 3O8HA 2VJIA 5HNFA 2VQGA 4A6DA 3O6BB 1ZG5A 1XGOA 1AU7A 1T0FA 1GVDA 1Y0UA 4RGSA 2DA1A 3N05A 5GPAA 1DDNA 3W2AA 1REPC 3RIRA 2R4GA 2ADUA 4U0WA 2PEXA 4KUMA 2LBFA 4E7ZA 1E0EA 2KL4A 2CV0A 2R93J 1ERDA 2JPBA 3FZVA 3O8GA 3RPUD 2R7DA 5F0FA 4B09A 3TW6A 4A3FJ 1MNEA 2K85A 1HBXG 1F43A 1JE8A 3E5XA 2L7FP 4LK0F 3J7AY 1MH3A 3G2BA 2COBA 3A03A 3A01A 3IUOA 3GFLA 4PGGA 3H5RA 2Z3YA 2O9LA 2LC2A 3AKZA 2BEOA 4S04A 3DTIA 3GTQJ 2BV6A 3TOAA 3HB9A 2UXNA 2KISA 1MMDA 2HU9A 2LY1A 2NAZA 1S6LA 4PJNA 5CVRA 5BQTA 3SFZA 1XSXA 1O57A 1BI1A 4WXDA 4S0HB 2WAFA 4B4CA 4A3CJ 5F1JA 3OSGA 4S05A 4Y13A 1AKHA 3JSOA 4HNTA 1W4MA 2K9SA 2QM3A 3JREA 1PYVA 2DN0A 3H35A 2JRTA 3DCFA 4XR6A 1A36A 3BLYA 3IC7A 3PNTA 4C2UA 2L9SA 2JVGA 3ROUA 4HX4A 3RKQA 4IHSA 5C4XJ 1KQ8A 1KYWA 3OYEA 4RA2A 1YQAA 3HL2A 4KN4X 2QZ8A 2XPUA 3C18A 3BZCA 2M0CA 2DDBA 2VQHA 1RC9A 1T0FC 1VQLI 3OYIA 5CYVA 4DZPA 3LSTA 3REOA 1TLHB 1Q1VA 3ABMH 4UNOA 2G9WA 2ZCWA 3RZOJ 2Y48A 3H92A 3RPQA 2H1LA 4DJAA 4IO9F 3HOSA 2EILH 2XC7A 2IA0A 2OC6A 1E2XA 4M6XA 3SZPA 1V5EA 2MLKA 1LE8A 3K6GA 4EM0B 5JLXA 1ZG1A 4V19K 1RETA 4B1RA 3A1YA 2DQLA 3W2WA 3OS2A 3PFIA 4IEJA 3VWBA 3WGGA 1BR2A 3DWLE 3S3MA 2DK5A 4PSXA 3RYRA 2ZJRF 1BN5A 2CV2A 2LR8A 3KCCA 1R1UA 3OOPA 4CUGA 3FHZA 4D1QA 2K4JA 1RKWA 2EA2A 2HOEA 3O2PE 1WH7A 4DGWB 4GDFA 2W00A 2HZTA 3CMMA 1EA3A 1RESA 5HOOA 5GTIC 3OIPA 5C44J 2EZLA 5M5YJ 3BPXA 1Y1VJ 1K7AA 3S1NJ 2NVQJ 1YE9A 2E34A 3HSEA 2KZVA 3EYYA 2H94A 1J0RA 2K02A 3FDYA 2M1BA 3QODA 2RAEA 3OYDA 2OBPA 3KPHA 2VUMJ 3S16J 4D5CA 3EUHA 1XN7A 2BY3A 2LDUA 1FTTA 1WJCA 2D5VA 1MMSA 2KIMA 3GTKJ 4NDLA 5AIQA 2Y30A 2VKDA 2K9QA 3FWEA 4I2OA 3C7JA 4Y15A 4RAYA 5F0CA 3M8JA 4UXNA 3PM1A 3CUOA 1JUSA 4J00A 2HYJA 1IJWC 3CP2A 4ON0A 1ZRFA 4MEXF 2GM4A 5BNGA 4R1HA 4EV0A 3I58A 2DI3A 3LFKA 1SFEA 4C3IJ 3HOWJ 2W24A 3ZQCA 3N97A 1BIBA 3Q0UA 4I0AA 5DYMA 1ZK8A 2VJ5A 1DU0A 1E3HA 3OIOA 2COMA 5E1WA 3LAJA 4B47A 2IGOA 2WAQA 1JTYA 3ABUA 2ZXHA 4ESBA 2AO9A 4J01A 3P9KA 3X2QH 1POGA 1Z91A 2K4BA 4HDVA 4P5OA 4ZDPA 3LQQA 4NC8A 4LG0B 4KYWA 3Q9SA 2VKVA 3MZYA 3I55I 1HW1A 4HNVA 5F0HA 2CQKA 3ZOBA 2CW7A 1T08B 4IPAA 5JVTA 1B1BA 3HZJA 2VB6A 4UVCA 3RDIA 1MBHA 2F2EA 1HA8A 2HEOA 4XM3A 1OYYA 3F22A 2IP2A 3CCUI 1ITYA 3F3XA 2JZYA 4CICA 1YRNB 2M30A 3CUQA 2QSHX 3SJMA 3EUHC 4CCJA 1JKOC 2E7XA 4ITVA 4BXFA 3GLXA 2DXIA 1IUYA 3B6CA 3WE2A 3I4NJ 2GIZA 2HFHA 3P7NA 1ZTRA 4EJWA 2YX4A 1SEUA 4C3JJ 4E7HA 4PFOA 3IP4B 3M4OJ 1H0MA 2R5YA 5E3OA 1SD4A 4PK4A 1S72I 1JKPC 5D5WB 4BE2A 2FD5A 2EZKA 4LIVA 1TL8A 2IRFG 4V2GA 4FQGA 1G59A 3ULQB 3I9V2 1G3SA 1TQMA 3R4KA 4BACA 2LF7A 2VIXA 1Z05A 4XN0A 2QBYA 3CDHA 4XLAA 5FGMA 3AG2H 2YS9A 1IAWA 4L5IA 4UUVA 1FSHA 3K10A 3HRTA 2PX9A 2W57A 1S3JA 5ILUA 2IS1A 2ZB9A 3KFWX 5LEJA 2WV0A 5B3SH 3L2RA 4L18B 3HOUJ 1WWXA 4AVZA 3W3CA 2LVSA 2XAJA 2UZKA 2NS0A 1R4MB 2P5VA 5LD2C 4DYQA 3RCOA 4BJ5C 3SQNA 1X4OA 3BR2A 3FMRA 1G3TA 3O3KA 3LSGA 3QOPA 3VYTB 1K83J 3KZIC 4RGUA 4U87A 3CUQC 2FNAA 3HUGB 4XLPF 1QO0D 1KONA 2PJRB 2KLOA 4FASD 3FHNA 4W1UA 3TP0A 3I56I 2E1NA 2OUMA 2CFXA 2HQ5A 2P7VB 1R9TJ 3L2WA 5BMZA 3AL0C 2XRNA 2N8GA 4MQVA 2ZXIA 4RGXA 5DEQA 3LWFA 5KAIC 2L2OA 3WU0A 3FXLA 4LOCA 3MEXA 3HGGA 5DV5A 4B3AA 3WE3A 4JOMA 3OYJA 4HV5A 3LA2A 1ZKGA 3L09A 4AC0A 1VF9A 1JGGA 3A02A 3OWTA 4IJAA 2CO5A 1FC3A 2HXIA 2L01A 2ZJ2A 5D4SA 1I6HJ 5EF6A 5FLVA 1XB4A 2A05A 2F5FA 4XLEA 2NNNA 4XSXF 2VC1A 2M8GX 2XKPA 2K86A 1HKQA 3E0JB 3P9IA 2HOTA 3Q5FA 3ABTA 3CCLI 1W0TA 1YIOA 2YU3A 2BXYA 1R00A 3FXOA 1JKQC 1A6IA 5FJ8J 2DA2A 1Z77A 2A61A 2MD5A 1LB2A 1FY7A 2ACJA 4OIQF 4AWXB 1TW3A 3OYHA 1LEBA 2RQQA 4RB3C 3WTXC 3WU1B 3R0JA 2V9VA 1X1DA 3OYBA 3LSMA 3TW7A 3BP8A 4IKFA 1PUFB 4NQWA 4E7KA 3GXOA 3I53A 4Y7NJ 1HW2A 4RDUA 4RB0A 4A3BJ 5K5QA 4X0GA 3I3LA 4ZJZA 2CQNA 2E2HJ 1FYMA 5IYBJ 1YJNI 2Q2EA 1GT0C 2MYSA 2CV1A 2HWVA 1BOAA 2EINH 3TGNA 1UHMA 2TDXA 2VQLA 2HI3A 1R5GA 5KCMA 5J4VA 1K6OA 5HVQC 1DGRM 3L00A 2VKEA 1ETVA 2P8TA 3BG5A 4XKBA 4CSWA 1R49A 4M6VA 2IS6A 2IXSA 3CCSI 2H8WA 3LOCA 4X1EA 4YIFA 1SFXA 4I7HA 2CQXA 4R79A 2D45A 2LNBA 1NK2P 1A5JA 2EJRA 2GOXB 5FROA 5CVUA 4M6YA 3PL8A 1U5TB 3OMYA 5DCMA 5KK1A 4A3JJ 3ECOA 3A0HC 5A2QZ 1Z1DA 2CUEA 2FOKA 3K4JA 4UUTA 5DD8A 4ZYAA 3PUBA 5JVGF 3V7SA 5FD6A 1QVTA 1RIOH 3EUAA 2RGVA 5GAGJ 4M3FA 1ZREA 2EV6A 1N25A 2A69F 2PMZA 3ZQQA 3PIOF 5BPDA 2O8KA 2YU9J 2V4JC 2R7SA 4BNCA 2OJED 2V9KA 1SANA 2YSRA 1K6YA 3ZMZA 4GRIA 3ZPLA 2ID3A 3QYEA 1KGSA 5J1UA 4IOCF 5HLIA 4BHCA 4F3QA 3ZRGA 5EEAA 2F48A 4KICA 3RSNA 1J75A 2XPVA 3FXRA 4A5NA 4A3EJ 3S1QJ 4BQQA 3G4SI 1J9IA 1RNLA 3OS0A 3QRFF 1BI2A 4F52A 3TO7A 1FZPB 3BR3A 4BQAA 3UNGC 1W5CC 4HNUA 1IC8A 4YIRX 4L9JA 1P7IA 3E1SA 2PJPA 4BDYA 1WZ2A 2KIFA 2GOMA 1SMYF 3CC2I 2K9LA 2W84A 1JUMA 3GUDA 2IEKA 5B1BH 2XGCA 3A4CA 1TW2A 1P9QC 3Q9VA 5EG0A 4D7MA 1I50J 2DOAA 2R3SA 3CESA 2CGPA 3OS1A 4I76A 1XCBA 3DP7A 1G2HA 4M74A 1SD7A 1STZA 2M87A 4CCOA 5ED4A 3JRCA 1BW6A 2OU2A 3AG3H 4EEFG 2PLYA 2XF6A 1ETYA 2OZ6A 2KKOA 5D8LB 2DA5A 1R5HA 3RI4A 2K27A 3E5UA 5H2FC 1DP3A 2H6BA 2IGNA 1F36A 2E5NA 2NOJB 3E3VA 1O7LA 3HDDA 3GYHX 1D5YA 1Z67A 2QCOA 1LDDA 1HXDA 4FTHA 3K0LA 2OPTA 2KRCA 1DQUA 2IBDA 4EM2A 2OTLI 3D5RC 3J7AO 4XRFA 1N75A 1WI9A 3COAC 3FXQA 5HLTA 3SZTA 1LFPA 1OQYA 1XSVA 1RZ4A 2E7WA 1X4PA 1CF7A 4G6TB 3NWSA 2P81A 4JYKA 3OYFA 4G94A 3GTLJ 2HYFA 3FXMA 3RPUA 2ZXJA 4MNUA 1BOBA 3NARA 3WHCA 3C1DA 1MNDA 4DBQA 1I5ZA 4KFCA 3FMSA 4ZDOA 4AIKA 4UVAA 4FCYA 2ECBA 3GX4X 2F5DA 3V8LA 4KA4A 1JHHA 4YFNF 4RLFA 3RYPA 2XDVA 5JFRA 3H0GJ 2M4KA 2F5VA 1EF4A 1HLVA 3BG6A 1UHWA 2M8EA 3JCUC 1XGNA 2CQQA 3OOUA 3ZQLA 3ZQ7A 1IF1A 2I8DA 4HDUA 4KMFA 2Z2SB 4KIBA 1OMIA 1VQKI 1B6AA 1UB9A 3K4MA 1XPXA 4QTRA 3KP2A 2GWRA 4I0BA 2F5CA 3Q0VA 2IA2A 1G8XA 3ASNH 2WC2A 2FRHA 4H0EA 1M1EB 4ANJA 1QZYA 3KEYA 2LY9A 2VC0A 1IRZA 1XMAA 2GAUA 3DKWA 1MMNA 4C30A 1XMKA 5JLWA 1ZHFA 2VJ4A 4BEHB 2WV1A 5J3LA 5J1YA 1FSEA 5E1ZB 5J4YA 3D5LA 4XKWA 3RJPA 3JSPA 5L3CA 2DK8A 2JTVA 4YEJA 2ZMEB 3K4BA 4Y17A 2X1DA 2L4MA 3PJRA 2LF8A 2MC4A 2QVOA 2HDCA 2LTPA 1D1CA 2A3SA 4QIWN 4NUBA 3BTIA 3MZ8A 2CWEA 3J7YJ 1ZN2A 3FXJA 4Z6YA 3CJTB 4IHTA 2HZDA 3WTWC 2CMPA 2UV1A 4E7SA 1TC3C 3IH2A 2HXOA 4RB2C 3HEFA 5A2QK 3C2HA 3I59A 3HM5A 3KEOA 1JT0A 1I6XA 5FKMA 4ZC3A 3R0AA 4A3DJ 6PAXA 1Y8RB 5E8IA 1BIAA 1O4XA 4LLNA 3W2VA 2QYOA 1JT6A 2R7RA 3U1KA 2GA2A 3G3ZA 1P2FA 1QBJA 2O3FA 2X51A 4F93B 2DCEA 3S8PA 1F1ZA 1SVLA 1KA8A 4C3HJ 2NNYA 3FK6A 2KIQA 3B6AA 1IZ1A 1TNSA 1TWGJ 2NXNB 1I1SA 4UUSB 5CJ9A 2KFDA 1RI7A 3ZMUA 3VODA 1W36D 1A6QA 3CJQB 2B63J 4YIIA 4HYEA 5ICEA 5AONA 2VQCA 4OAZA 2HVSA 1KU9A 2HDDA 4LG3A 4HF1A 1FYKA 3S1MJ 1WJ5A 1FOWA 5FB2A 4U7DA 4A12A 4XLNF 3JRDA 1YOVB 1WH5A 2CJJA 2Y0MA 4XLFA 2QA4I 1FBQA 1B72A 1EH7A 1ENHA 1YX5A 2FBKA 2VLAA 2R5ZB 2HTSA 2FMYA 3K69A 4FT8A 4N4OB 3BG9A 1FWZA 5KAFC 4M73A 3GF2A 5D4RA 4MEYF 4RAGA 2LYCA 4AU7A 4R8HA 3S3NA 1WPKA 2XAGA 1HKSA 3BQYA 3K4NA 2JA5J 5JHFA 2B9SA 1R4NB 2F6CA 1UG2A 3VFZA 1P4AA 2ZJQF 4FE4A 3EPZA 3KE2A 4LFUA 1G4DA 2M7BA 2W1OA 4YRVA 1DPUA 3V42A 1OJLA 1LFUP 3DKXA 1EH8A 2CW8A 4BE0A 1FYLA 4L9NA 4XNFA 3RTRA 4LK1F 3W6JB 3NRVA 1K78B 3IHUA 3FX3A 4N4NB 2YX7A 3QQAA 2BYVE 2VOPA 3H3UA 2X48A 3IKVA 3FISA 5IP9J 5IT3A 1YW8A 3GFMA 5FD5A 2VBXA 5K5RA 3M3YJ 1XCVA 4D5FA 3OYNA 4KN7X 3JR9A 5HLGA 3DPLC 5CPRB 2STWA 4A3KJ 4M3BA 4RM2A 3IV5A 3PQKA 3L2VA 2LG4A 3GZ6A 5LBQA 1D0XA 1YFHA 1O3QA 1JI8A 4HW0A 5GAHJ 3PUFA 3DPUA 3GFIA 1V54H 2LLKA 3VB2A 4DQ2A 2OCCH 3EYIA 2V1NA 2ELHA 3DBRB 1OCPA 1J09A 2RC4A 3CO7C 1MSFC 2LKPA 3RKYA 3BQZA 1OPCA 4Z2YA 2RNJA 1Z6TA 2Y31A 4UB8C 3MCZA 2L9VA 4HRIA 2MLGA 2V26A 2WBMA 4G9YA 2QQAA 2HVQA 3F8MA 3K1NA 1I3AA 1WJAA 2WAEA 3I4MJ 2STTA 3H9JA 1WJEA 4KITB 2UWMA 4IOAF 2H8RA 3ML6A 4XN3A 3U1DA 1WI3A 1IN4A 4NHJA 4G12A 1FPQA 2I5UA 2ESNA 1T33A 1YJ9I 2XF7A 3PSIA 2JA7J 1B59A 3JRIA 1A31A 3KX2A 1LKXA 1IG7A 4MTDA 2L0KA 2LBFB 2M3AA 2QWWA 4EGYA 1R1VA 1LDJA 5CQEA 5TJJA 3S2HJ 4DNCA 2W82A 5LHHA 3G1MA 1Y6IA 2P6TA 1V4RA 3RKXA 2O8XA 2XSDC 4BAYA 3M1EA 1FBUA 3L2CA 3BR5A 4C9YA 3V8KA 3GZ5A 4EGZA 3MN2A 2CRGA 4ENJA 1LPQA 3E6MA 5LHIA 1R58A 1U9OA 3OY9A 3CCMI 2Q8KA 1HQCA 1X2MA 2IS4A 1UMQA 1YS6A 2VBZA 3ZMSA 3IAS2 2NOGA 4WXCA 1QZZA 2X85A 3QAHA 1WFXA 1XD7A 4C2MJ 2P4WA 1Y8QB 1D1BA 1V3FA 2EZHA 2K40A 2WB1A 3HJEA 4RGRA 4A3MJ 3OL4A 1TP4A 5BS6A 1BJAA 4HX7A 2IAIA 1Z6RA 2XKOA 5H20A 3F8NA 3QPTA 3VSLA 4XRSG 2IVMA 2ME6A 3V4GA 1Z7UA 3NQOA 4IVNA 3CZ6A 2XV4S 3IWFA 3F8FA 3OYLA 5D8KB 4CCMA 3H3VK 3IH4A 4HZFA 3K70D 1SFUA 1Y56A 2EV0A 2JUGA 3WU2C 1BJZA 2KRHA 3GTJJ 1U6GA 3WTUC 2HQNA 4RAFA 1ON2A 5GAEJ 5KHDA 4AVPA 3E6DA 4KDPA 2CUJA 1BI3A 3FXUA 5IY5H 3J7ZI 2IT0A 4KIFA 2RREA 1L0OC 3J80Z 3CC4I 3P9CA 2KIUA 3MKWB 4GGGA 1YJWI 1FOYA 1IDYA 2RV8A 3LSIA 4AIHA 3OYMA 1D8JA 2JJ7A 4FX4A 3SFIA 1UCRA 1QHHD 2MSYA 2BE5F 2YR2A 2LSOA 1JJ8C 4CDGA 3W6VA 5IOYA 1WGXA 2PN6A 5B1AH 1PP7U 3CCRI 3FKIJ 3PQJA 1FIPA 2LP0A 4XONA 1MH4A 3WODF 4A93J 3HOYJ 4BHPA 2KT0A 3BJAA 3SEQA 1W7PD 2EQRA 1W7PB 4IQJA 3LL7A 3C2BA 3TP3A 4O3MA 2I10A 5F27A 3CLOA 2OQGA 5B5EC 5TRDA 4PJLA 1D0ZA 2LRDA 4PJMA 2QQBA 3MKYB 1T39A 1IN8A 5E3NA 2OF7A 4GFBA 2JN6A 2W85A 2JSPA 2MABA 3TOBA 1JTXA 3SZGA 2DW4A 4B48A 1R7JA 3BZ6A 1T56A 4E6KG 3DBHB 3HKZA 2ZJPF 4WXHA 2OV7A 3KP3A 3HHHA 4P96A 2DMNA 4IRHA 1B9MA 1JUPA 2GXGA 4JX6A 1TNTA 3E7LA 4KMUX 4GYIA 2HOSA 5DS9A 3T0YA 2H6CA 4WF2A 1DUXC 2QLZA 3DBLB 4IXAA 2R7TA 2F4IA 1U5TA 3K4LA 2HGCA 3GFJA 1ZGAA 1A35A 1R71A 2D1VA 4EVIA 2WAQN 3DKYA 3ZQGA 4U0VA 2ZNZA 1YW7A 5EEGA 1LJ9A 2H09A 5HODA 2VXDA 3FIWA 3LFUA 2MD0A 3OL3A 4EMSA 2WB1N 3GW2A 4MHGA 3WHBA 4BH9A 1Z0XA 1JGSA 2DMUA 4IHXA 2JWTA 3GTOJ 1AA7A 5E18F 5DDGA 2K7LA 3CD6I 2A6HF 3M8EA 3PNVA 2HS5A 5LRSA 4OIPF 4BY1J 4XKVA 2QKMB 2XHKA 5EGOB 1Q1HA 1GDTA 1V5FA 2B7EA 2MBFA 5DUKA 2W25A 1I1GA 1KU3A 1TZLA 3CMEI 3FF5A 3ECHA 1V55H 1BM9A 4IRIA 1Z21A 2L7ZA 1VQNI 1ZELA 2BY0A 4D9JA 1FT9A 3M1CA 4HV6A 2H1KA 1R1TA 4M9SA 1O3SA 3F9KA 2EFOA 2EFPA 4RMNA 1ZR2A 5ILSA 2V6CA 1ONVA 3WTTC 4M3DA 3DLAA 4G7HF 4ZYGA 2CYYA 2V7FA 2GIVA 2XAUA 2DT5A 1I27A 4U7BA 2A5YB 2XAHA 2O6GE 4A0XA 3BROA 1E3PA 4NBQA 1SAXA 3CUQB 4LB5A 1ZH5A 1TQIA 3CMAI 4AM3A 3S2DJ 1HKTA 5H6QA 4HBLA 3CJNA 2HDWA 1MDMB 1D8KA 1EH6A 3MZHA 4ASNA 3E97A 2CUFA 3G1OA 1BR1A 2XPWA 4CYCA 4U88A 1IRXA 3SHFA 2E2JJ 2R5YB 4LLGF 2LREA 3H3ZA 2L3DA 2WY7Q 3S2WA 1I3QJ 4PJJA 5EEHA 2R92J 1BR4A 1J59A 3HGYA 2BW3A 4E70A 3AL0B 2M2EA 1G3WA 1U5TC 1OCTC 2EPFA 1SD5A 4K2EA 1USTA 5LFAA 4BUPA 4BQNA 2BGCA 1N77A 2HQRA 3L7WA 4ENNA 2R7UA 2NS7A 4BS9A 1MJAA 1P92A 5D5UB 4XKCA 2QBYB 2XIGA 1FMWA 5FRMA 3KLNA 3G6EI 3FM3A 5ICGA 3CCYA 2DT6A 3CTAA 1MGTA 1T2KA 2HTJA 4DW6A 1GHCA 2D2WA 4I99C 3BTJA 4HOBA 4OIRF 1Z7LA 4G6DA 3ZQFA 2E36A 4A0YA 2XGDA 1F5TA 1IGNA 2NVXJ 1QZEA 1ODDA 1WHUA 4KT6A 4A5MA 2HKOA 2UXXA 2BY1A 1W0UA 2A07F 2Z33A 2BXZA 2J5OA 3BC8A 5LGUA 2VOOA 5HDNA 5KNLA 3K1PA 3J80K 3VSKA 3P5JA 2DU9A 1OCCH 3K1MA 2XSJC 4KT5C 1QHGA 1WKMA 4MLOA 2PBIA 3WG9A 3M07A 3TBIA 2RQPA 5L3EA 3HOTA 1F4KA 4OWRB 2DA7A 1MIJA 1FNNA 2R7QA 2A5WA 2KDZA 1OCRH 2IPQX 1DU6A 3E5QA 2X1CA 2K3PA 3HTSB 1VQ7I 4Q5SF 3QU3A 4BXUA 1JXSA 3H36A 1RR7A 3CP8A 2TRTA 2FE3A 1GV5A 1GVJA 3GMEA 2VT3A 4M9XA 2FBHA 2GXBA 3G71I 2ESHA 2CSOA 3WTYC 3LSHA 4U0YA 2E1CA 3KLOA 1H88C 2K3FA 1USSA 2EIJH 4G8XA 4EJUA 5HLHA 3BR1A 1B4AA 1IXRC 4YG2F 5ILVA 4KNYA 3NAUA 2PMUA 1OFCX 5LRRA 4ENKA 2XAFA 3HRMA 3OYAA 5GADJ 3MAJA 4CO8A 2FU4A 3ONQA 5F64A 4BE1A 4Q47A 4G7OF 1IRFA 2E5ZA 1JHFA 5IOZA 1DPRA 3CF5F 4D0PA 2WA0A 1RRJA 4LMYA 1ZGJA 3CJRB 3F21A 4IHWA 1CGPA 1OISA 3BT9A 2X6YA 5D6FA 1MZBA 3ZCOA 3VPRA 2L9RA 4JP0A 4D7NA 3JRFA 4H4KC 2FMLA 1VZ0A 3ESWB 3UR3C 4B44A 3ABKH 3JRGA 4EJOA 2R7FA 3HOXJ 4XQFA 2HKXA 2K5CA 2ID6A 2O0YA 3OYKA 1ZLJA 2VN2A 3BR0A 5DTDA 2ISZA 3ZN0A 2P5LC 3S1RJ 2XROA 1CQTA 3HTUA 1GXQA 4AIJA 4L5JA 4JK1X 1FIAA 2CH0A 5FKNA 2RN7A 2JA2A 4OMZA 4QSHA 1FX7A 4MFDA 5EYRA 2M4GA 1GLNA 2E1MC 2Q2EB 2XASA 4G7ZF 5K7FA 4M9ZA 1ETWA 3VYRB 5M3FJ 2NS8A 1G3YA 4XK4A 1SVOA 5TISC 2Y0SA 1D1AA 4UUSA 2ZNYA 5LEKA 3MFKA 5F6FA 4PJ0C 1IV6A 1IN7A 3ASOH 3WG7H 3HIFA 2NYXA 2WY8Q 1MSEC 2CS3A 3ZQIA 3LQRA 3CMYA 3KZZA 2AHQA 3QP6A 2LKXA 4E7JA 2E60A 1WRJA 3Q0WA 1YITI 3GEZA 1YTYA 2Y9YA 3TMOA 1IO2A 3LSJA 4F55A 2M45A 4CZCA 3F6VA 2O5RA 2EV5A 5K7ZA 2R5ZA 3CC7I 2X1EA 2JUCA 3I4PA 2PMZN 4KJZA 5DM7F 3KIOA 1OKRA 2VASA 3S32A 4RAZA 4OU0A 3FBNB 3SYTA 2DYSH 5J47A 3CCVI 5E1XA 3V7RA 5AIPA 4XRMA 4UV8A 4GO1A 2Z16A 3S3OA 1P4WA 3QYFA 1D3YA 4RB1A 3W6KB 2MH9A 3HPHA 3M9AA 3PFYA 5GP9A 1ZQ3P 3CDLA 3IKTA 3H9GA 5J8FA 4JX5A 1S7EA 1QQIA 2ECCA 5BOXA 4ZTJA 1TWCJ 1WCMJ 1XMXA 4O5VA 5IP7J 4I6ZA 1Y1WJ 1HSJA 1QPMA 2G0EA 3VEPA 3UKGA 1K78A 2RDPA 2KZGA 1PVEA 1U0JA 4IZZA 4RM3A 5K7HA 3CCEI 5J40A 4QPOA 1VQMI 1H9TA 4WK8F 1NG7A 1O7FA 1OYIA 2FBIA 3JRBA 3F72A 2MGQA 1MBGA 1BC8C 1E17A 4PZJA 2DMPA 3TQNA 4M71A 5JI6A 3V7CA 5E17F 4A69C 4ZZLA 2RNGA 3M7GA 4M72A 5HDGA 3TKYA 1ETKA 2IGKA 2JMWA 2M0MA 2XB0X 5E20A 4DYRA 1YIJI 1XDSA 4M3GA 2DA6A 1B8IB 2BOLA 5EG0B 2OZUA 3S14J 1ON1A 2DA3A 2X4HA 2Q0OA 2R7XA 1T6SA 4L0YB 1YLFA 3FK7A 1UG0A 4IHYA 1PDNC 2VE8A 2P0WA 4PUSA 5LLQA 2EIKH 2DFEA 4BJ6C 3VYSB 2BHZA 1E3OC 4LB6B 3S93A 3G73A 1FP1D 4NNJA 5K5OA 3IL2A 2H27A 1X3ZB 5E8GA 2AXTC 3JTGA 1NG6A 4HAMA 2R7WA 3ZMVA 2NRAC 2WTEA 4ZYDA 1MMGA 4ESJA 2X6OA 2Y0SN 2CQ7A 4A3GJ 2CW0F 2E19A 3JTHA 1QNTA 3K7AJ 4II3A 4FETA 3BWGA 1HCRA 1KU7A 3NEUA 1J5YA 1CF7B 1MBKA 2M5WA 2Z5UA 1FOKA 1ORKA 5HNHA 2O03A 2QF7A 1O3TA 4A3LJ 1LUJB 1S8NA 2Y75A 1UAAA 1YG2A 1BA5A 4P1WA 3B02A 2DQRA 3OYGA 5GPCA 5H6RA 5D6EA 2VI6A 1HDPA 3QOEA 3IWZA 2FXAA 5HS8A 1X1CA 3ZGKA 1OLTA 3WTVC 3BJ6A 3R61A 4QWQA 3VOEA 3K4CA 3R60A 5B66C 1MW7A 3RQIA 5CLSA 1SD6A 2DAOA 1L3LA 1W1WE 3HOVJ 2DA4A 1X2NA 5FO5A 4IX7A 5C3EJ 3DLLF 3T5XA 2HVRA 2KP6A 1S9HA 3DXJF 3WTZA 1XX5A 3KP7A 4BL0B 1IRGA 1RUOA 1FMVA 2K9MA 2XAQA 3E6BA 2NVYJ 3VDXA 3HOZJ 4OIOF 3CCJI 2EZIA 5L3GA 1U8RA 2HPMA 3CLQA 2L5QA 3LSPA 4HQMA 1H8AC 4BDZA 2C6YA 2LD5A 4RLQA 1HSTA 4MTEA 4LG0A 4DBRA 4E7LA 2V1XA 4IL6C 4FE7A 4XLCA 5J1RA 4Q48A 1OCOH 1T98A 1BBYA 1MNMC 3GTMJ 3ABLH 4Y33A 1XS9A 2FF4A 3F23A 4BGDA 4Y3OA 3SDGA 5CVIA 4UVBA 4XBFA 1Z3XA 1OR7A 1X1PA 2DODA 5FRNA 3LMMA 5L3DA 1YRNA 1T8IA 5ICFA 1XC5A 4XL9A 1BL0A 3K2ZA 4DYCA 3BY6A 4IRGA 1UJ8A 3KETA 2E35A 2VXZA 4E4HA 3SEZA 2CFOA 2FSWA 3A0BC 3HBLA 3RKWA 1WJBA 1R23A 1FJLA 3I59B 1AHDP 1ZARA 3D5SC 1LVKA 4WCGA 3AG4H 3BCBA 4N9IA 4FX0A 2KPMA 3FXKA 3CF2A 2L9NA 3LNQA 1V5GA 3JW4A 3KYDB 1X1BA 2KRFA 4L9TA 4RBOA 3QU6A 4EJTA 3LA7A 4DZJA 2OA4A 3J81Z 1VQ8I 3G1LA 1MKMA 1YI2I 2Z9OA 2L7KA 3GLLA 2OQRA 4HQEA 3BZKA 1P7JA 1W7PA 3KZYA 2OTJI 4P9FA 4ETSA 3DEWA 4MIMA 2MFZA 2YUSA 1U78A 1XDUA 3GCMA 1GV2A 1YYVA 4GCVA 4B3XA 2NVTJ 3A2KA 4GXOA 5FFXA 1EJ9A 1QVUA 5LGNA 5E79C 4LIUA 3N4MA 2A6TA 1G6NA 3AAFA 1B72B 2DFFA 1P6RA 3HSRA 3BDDA 4XOPA 4YELA 3TEDA 3BOQA 1S29A 3A01B 4CGZA 3K70C 1KYZA 2L7MP 5K1YA 5DD4A 1U3EM 2EFNA 5IYCJ 2DPDA 1TWFJ 1Y0NA 4YFKF 1MJBA 4HSTA 1OR7C 4PGHA 1R22A 2LMDA 1DGWY 3DTEA 3TO9A 2V79A 1ETXA 5J6XA 2R0QC 1R6RA 1U2WA 3HUGA 2W7NA 1ZGWA 1ZLKA 2R7VA 2PJRA 1NHAA 2IW5A 4UV9A 1DP7P 2Q1ZB 4LGWA 2JA6J 3MD2A 5FFZA 3U21A 2ELKA 1X3WB 2W48A 5FKOA 1LFBA 3KEQA 3ZN1A 5IP6A 3F6OA 3QPHA 1MBFA 1AKHB 2DOFA 1I39A 2B0LA 1N78A 4B8XA 3S17J 4V2FA 2O61A 1ZRDA 4A0ZA 5HS9A 2IGMA 4MGRA 2KMUA 2XGXA 1LQ1A 4FISA 4ABZA 4HF0A 2QSGX 3OR1C 2EBIA 3KP5A 3WTSC 3BPVA 2DFIA 5EGOA 3PO2J 1PJRA 1S7AA 1VTNC 4KISA 4J19A 3JRHA 1K4SA 2CUZA 3RQ4A 1F9NA 3ERED 3IAM2 2FOWA 2J5PA 3KP4A 4IQ4A 3H1CA 3S15J 3DPTA 2Z99A 3ELKA 4HEA2 2BZTA 2X6XA 3MKLA 3MWMA 3L1PA 2PI0A 4BBRJ 1LE8B 2CG4A 1IUFA 2VONA 2DO7A 3TDZC 4BYYA 3OYCA 2MH2A 5EDNA 2DTZA 4NC7A 1KQ0A 1FTZA 2PMHA 3K2AA 1MDMA 2A68F 4Y52J 3L9FA 2DLLA 1S7OA 3F0CA 2ZSIB 2ZSHB 1RKTA 1HOMA 1IW7F 2ISYA 1PUFA 4LD5A 4CCKA 1VNDA 2WADA 4OOIA 3ZMDA 3KP6A 5D5VB 1SC7A 3MQ0A 1GXPA 2EWNA 2QKLB 5IYDJ 2VE9A 1TQPA 1J2XA 3L2UA 3DTKA 2FJ1A 2OD5A 5IPAA 1VQ4I 4WX9A 3FMQA 2VT2A 3C2GA 3M8FA 2F5EA 2DYRH 2OCEA 3HHGA 3DF8A 3LAPA 4ZTFA 5TGTA 1EKEA 2G7HA 3I54A 1U8BA 1WQ2A 3MMYB 3EUKL 3IRQA 1D0YA 3H0DA 2TCTA 1OYWA 2EK5A 2LKSA 3MVPA 4GYGA 2F4OB 3EQLF 3AFHA 2VBYA 3LSRA 3I5UA 2NVUB 2FUG2 4A3IJ 2DTRA 1YX3A 4C2TA 1BW5A 4HA8A 3OSFA 3BJOA 5JHUA 2ETHA 3HPGA 2HNHA 1MMAA 4UY8I 3GTGJ 3FKJA 1ZYRF 5FLXZ 1NH3A 3HRUA 2IS2A 1APLC 1LEAA 1X3UA 1FEXA 3DEUA 2BVLA 3ZR8X 5JR3A 2QENA 3WGIA 4BXXJ 1VQPI 1C0WA 2ZO4A 2AQEA 5FLMJ 2VKHA 3OR2C 5GTHC 4ENMA 3TL4X 2LY2A 4I01A 4MO7A 2X6WA 3DQVC 4BY7J 3AG1H 2DDAA 1OCZH 2KJCA 4CHUA 2CU7A 3HXLA 1QU3A 3VYUB 3LA3A 2FA5A 5EZHA 2PFBA 2M7AA 5F1RA 2BVMA 3BTCA 4QPQA 4L9VA 1X1AA 2Y69H 2EFWA 4WWCA 4B43A 1FOXA 2MC3A 5KVRA 5FKKA 2JRMA 3D0SA 3J81K 2JPCA 1IDZA 1VFCA 4XRSA 1TT5B 3T1BA 2OAZA 4PDKA 4PFPA 3BCAA 4XLHA 3Q3SA 2D1HA 5CQGA 2P5KA 2VL8A 1WJFA 2L54A 4P9UA 1QGPA 5M5WJ 1FLIA 1ACIA 4F92B 2V6EA 2PQ8A 2KHMA 5EZGA 4PSWA 4OMYA 2M9HA 2JK3A 4CXFA 2V9PA 1EV7A 2ZC2A 4N9HA 4AYBA 4F7ZA 3IRRA 2K9NA 1JKRC 2YPRA 4XICA 4HF2A 2VPLA 2GQQA 4CYDA 3I64A 1R5ID 1NK3P 4HSRA 3QPLA 4ZYHA 1XGMA 1QA6A 3LSKA 3BG7A 2XB5A 4MQ9F 5CKTA 5M3MJ 4I09A 2ZXWH 4EM1A 1X19A 1ETQA 3DFGA 1XSDA 1S5LC 2DMQA 1J7KA 1XTAA 1ZR4A 3PIPF 4ZYEA 3HRSA 2ELJA 3HC7A 5ERIA 4KIGA 5CVJA 5DUIA 5IT9Z 2RVCA 3HKZN 3SDBA 2VBWA 2IA1A 2XF5A 3K9TA 3PO3J 2DBBA 3BG3A 2R7OA 2KJBA 5FKLA 3F8CA 2DJIA 3DEEA 4HX8A 2VODA 4G6QA 1T95A 2ZBKA 3GWZA 5DCFA 1AWCA 4PCQA 2ZFUA 4F91B 1H89C 2A6EF 4I98B 1R36A 2JVHA 2EB7A 3TO6A 2DPUA 2QGUA 5C4JJ 2DFHA 4JQFA 4BQOA 3R6SA 1IN6A 2BY2A 4CCNA 1KU2A 3GZNB 4M3EA 2FQ3A 2GBYA 3E6CC 1FBSA 3NWTA 1K4TA 4P55A 1NTCA 3JRAA 2R7ZJ 2EH3A 4BU2A 1P4XA 2GA1A 3JAMZ 3F8BA 3U2RA 2FQ4A 1IXCA 5BPIA 2E1OA 4HLXA 1MBJA 9ANTA 4EQQA 3CCQI 3KYLA 5L3BA 2MW8A 4EJVA 3ZQHA 4AIDA 4QLCU 5ICCA 1VQ9I 3PSFA 2HR3A 2AXLA 1ULYA 2M34A 2UUZA 3H9QA 1BI0A 1X58A 3CQZJ 1ZAOA 3BR6A 2DMTA 4TV7A 2HQAA 4II2A 2DJNA 3FBIB 5D5XB 2QEXI 4CH7A 4NC6A 5F04A 3I71A 1IXSB 2FEZA 4BKXA 3QP5A 3CDIA 4BEHA 4XIDA 3QYBA 1W5SA 3QPSA 3H5NA 3TDUC 2ZMEA 4LLLA 1SMTA 4HLYA 3GTPJ 2ZFWA 1PP8F 1JJ6C 1YW9A 4BBSJ 2VJJA 2ICWG 4HPQA 4XSZF 1ETOA 1HC8A 1MJ9A 4AYBN 2FNPA 3BTLA 5FLXK 2EIMH 1AOYA 4LJZF 1IV8A 4NQWB 1U9NA 4O6JA 4CYCB 1HDDC 1B8IA 4X6AJ 3GO5A 4A6EA 4E7IA 1WJDA 3H5AA 2JT1A 5HDKA 2BW3B 1YO5C 4DOZA 1SFOJ 3QWLA 1K61A 2XUBA 2V1UA 3FM5A 3K4KA 4OINF 5E3LA 2BBYA 2JQ7A 2GLOA 3IH3A 3T8RA 5L3FA 1UELB 3HYIA 3DU6A 4OAYA 4ZDLA 1T38A 1TWHJ 4JBAA 2XGEA 4CA0A 1VQOI 1Z3YA 4L0ZB 4AD9A 2P6SA 1QPIA 4DIQA 2MG4A 2Y9ZA 3OV8A 1YS7A 4L5EA 5DM6F 2EFQA 4Q4ZF 4YFXF 2G7UA 2QQ9A 1KZHA 4IHVA 1ZG3A 4BJTA 2XRLA 4FHTA 2HYGD 4BHBA 2QQ8A 2KDOA 5DCMB 3EETA 4MFEA 2Y2ZA 2LK2A 2RKHA 2EA4A 3EDPA 3ZXSA 2BHYA 3RZDJ 1VI0A 1UFMA 5HS7A 3CO6C 1PUEE 2WWYA 4W97A 3ZP5A 4RS8A 2ZMEC 2F4MB 1HW5A 2L4AA 1KQ9A 3T8TA 3DV8A 3SXYA 1TBXA 1RUNA 3V8JA 2AQFA 3WGHA 4I02A 1A04A 2ME0A 1MD0A 1O3RA 1VQ6I 4UHTA 4XOTA 2LOOA 3ZMTA 1TWAJ 1WSUA 2E1MB 3OIQA 1RPWA 3U9GA 2KQRA 3PNYA 2ZKZA 2GZWA 1TT0A 2X0LA 1YHQI 2W4SA 4XMYA 3L2QA 1FP2A 2FX0A 2HPIA 1Y39A 2VPRA 5F08A 1W5TA 2QSFX 4A2UA 4CCLA 4ESFA 3D1NI 3KYCB 1Z9CA 3I0TA 4CZZA 1D5VA 5IT9K 2LH9A 2DT7B 4HG2A 1XGSA 2JSCA 2LFBA 3GBGA 2MA3A 3DU5A 1H9GA 2XVCA 1K79A 1LDKB 1LVAA 2E71A 5M5XJ 1SFKA 3MKZA 1HF0A 1TTYA 1B9NA 4ZZDA 3ISPA 5LHGA 4JX4A 4AUXA 5EJCA 1QRYA 4IF4A 2X9DA 3GVAA 1GUUA 1BC7C 3HG9A 1VQ5I 2IJLA 4UB6C 5LGTA 5CVVA 2E2IJ 2QUFA
chains in the Genus database with same CATH topology
3HSFA 3C3WA 2AS5F 2V1DA 4NB5A 2P7CB 3JAMK 3B73A 1ZRCA 4ZH4F 5J8CA 1LNWA 2L02A 2PG4A 4N0BA 1IN5A 4A6DA 3O6BB 1ZG5A 1XGOA 1T0FA 1Y0UA 4RGSA 1DDNA 1REPC 3RIRA 2ADUA 4U0WA 2PEXA 4KUMA 2JPBA 3FZVA 2R7DA 4B09A 1HBXG 1JE8A 3E5XA 4LK0F 3GFLA 4PGGA 2Z3YA 2BEOA 4S04A 2BV6A 3TOAA 2UXNA 5CVRA 2NAZA 1S6LA 5BQTA 3SFZA 1XSXA 1O57A 1BI1A 4WXDA 4S05A 4Y13A 3JSOA 1W4MA 2QM3A 2JRTA 3IC7A 3ROUA 4HX4A 4IHSA 1KQ8A 1KYWA 1YQAA 4KN4X 2QZ8A 3C18A 5CYVA 3LSTA 3REOA 1TLHB 4UNOA 2G9WA 2ZCWA 2Y48A 3H92A 3RPQA 3HOSA 2IA0A 1E2XA 4M6XA 3SZPA 2MLKA 4EM0B 1ZG1A 2DQLA 3PFIA 3WGGA 2DK5A 3RYRA 1BN5A 3KCCA 1R1UA 3OOPA 3FHZA 2K4JA 2EA2A 2HOEA 3O2PE 2HZTA 5HOOA 3BPXA 1K7AA 3HSEA 3EYYA 2H94A 1J0RA 2K02A 2M1BA 2OBPA 3EUHA 1XN7A 2LDUA 2KIMA 5AIQA 3FWEA 4I2OA 3C7JA 4Y15A 4RAYA 4UXNA 3CUOA 4ON0A 1ZRFA 4MEXF 4R1HA 4EV0A 3I58A 2DI3A 3LFKA 1SFEA 2W24A 3N97A 1BIBA 4I0AA 5DYMA 2COMA 5E1WA 3LAJA 3ABUA 4ESBA 3P9KA 1Z91A 2K4BA 4HDVA 4P5OA 3LQQA 4LG0B 4KYWA 3Q9SA 3MZYA 1HW1A 2CQKA 4IPAA 5JVTA 1B1BA 4UVCA 3RDIA 2F2EA 2HEOA 3F22A 1OYYA 2IP2A 3F3XA 2JZYA 4CICA 2M30A 3CUQA 2E7XA 1IUYA 3GLXA 3WE2A 2HFHA 3P7NA 4EJWA 2YX4A 1H0MA 1SD4A 5D5WB 2IRFG 3ULQB 1G3SA 1TQMA 3R4KA 2LF7A 1Z05A 2QBYA 3CDHA 5FGMA 1IAWA 4L5IA 4UUVA 1FSHA 3HRTA 2W57A 1S3JA 5ILUA 3KFWX 5LEJA 2WV0A 4L18B 1WWXA 2XAJA 2UZKA 2NS0A 2P5VA 3SQNA 3FMRA 1G3TA 3O3KA 3QOPA 4RGUA 3CUQC 2FNAA 4XLPF 1QO0D 2E1NA 2CFXA 2P7VB 5BMZA 2XRNA 3WU0A 4MQVA 4RGXA 5DEQA 3LWFA 3MEXA 5DV5A 3WE3A 4HV5A 3LA2A 3L09A 4IJAA 2CO5A 1FC3A 2L01A 2ZJ2A 5D4SA 1XB4A 2F5FA 2NNNA 4XSXF 2VC1A 2XKPA 2K86A 1HKQA 3P9IA 3Q5FA 3ABTA 1YIOA 2YU3A 1R00A 2A61A 2MD5A 1LB2A 1FY7A 2ACJA 4OIQF 4AWXB 1TW3A 1LEBA 4RB3C 3WTXC 3WU1B 3R0JA 2V9VA 3BP8A 4NQWA 3GXOA 3I53A 1HW2A 4RB0A 5K5QA 1FYMA 2Q2EA 2HWVA 1BOAA 3TGNA 1UHMA 2TDXA 1R5GA 1K6OA 5HVQC 3L00A 2P8TA 4YIFA 1SFXA 4I7HA 4R79A 2D45A 2LNBA 2EJRA 5CVUA 4M6YA 1U5TB 5KK1A 5DCMA 3ECOA 5A2QZ 1Z1DA 2FOKA 5DD8A 3V7SA 5FD6A 1RIOH 2RGVA 1ZREA 2EV6A 2A69F 5BPDA 4BNCA 2YSRA 3ZMZA 3ZPLA 1KGSA 5HLIA 4BHCA 4KICA 1J75A 3FXRA 4A5NA 1J9IA 1RNLA 3QRFF 1BI2A 3TO7A 1FZPB 4BQAA 4L9JA 2PJPA 2KIFA 1SMYF 2W84A 3GUDA 1TW2A 3Q9VA 2R3SA 2CGPA 1XCBA 3DP7A 4M74A 1SD7A 1STZA 2M87A 5ED4A 2OU2A 2PLYA 2OZ6A 2KKOA 5D8LB 1R5HA 3RI4A 2K27A 3E5UA 2H6BA 3E3VA 1O7LA 3GYHX 1LDDA 1HXDA 3K0LA 4EM2A 3J7AO 4XRFA 1WI9A 3COAC 3FXQA 3SZTA 1XSVA 2E7WA 1RZ4A 1CF7A 4G94A 2HYFA 3RPUA 2ZXJA 4MNUA 3C1DA 1I5ZA 4KFCA 3FMSA 4AIKA 4UVAA 3GX4X 2F5DA 3V8LA 4KA4A 1JHHA 4YFNF 3RYPA 5JFRA 1UHWA 2M8EA 1XGNA 1IF1A 3ZQ7A 4HDUA 4KMFA 4KIBA 1OMIA 1B6AA 1UB9A 3KP2A 2GWRA 4I0BA 2F5CA 2IA2A 2WC2A 2FRHA 4H0EA 1QZYA 2VC0A 1XMAA 2GAUA 3DKWA 1XMKA 1ZHFA 1FSEA 5E1ZB 3D5LA 3RJPA 3JSPA 5L3CA 2DK8A 2JTVA 2ZMEB 4Y17A 2L4MA 2LF8A 2QVOA 2HDCA 2A3SA 2CWEA 1ZN2A 4IHTA 3WTWC 4RB2C 5A2QK 3I59A 3KEOA 1I6XA 3R0AA 6PAXA 5E8IA 1BIAA 4LLNA 2QYOA 2GA2A 3G3ZA 1P2FA 1QBJA 2O3FA 1F1ZA 2NNYA 1KA8A 1IZ1A 1TNSA 1I1SA 5CJ9A 3ZMUA 1RI7A 3VODA 4YIIA 4HYEA 5ICEA 5AONA 1KU9A 4HF1A 1FYKA 5FB2A 4U7DA 4A12A 4XLNF 2Y0MA 1FBQA 1EH7A 2FBKA 2HTSA 2FMYA 3K69A 4FT8A 1FWZA 4M73A 3GF2A 5D4RA 4MEYF 4R8HA 2XAGA 1HKSA 3VFZA 1P4AA 3KE2A 4LFUA 1G4DA 1DPUA 1EH8A 1FYLA 4L9NA 3RTRA 4LK1F 3W6JB 3NRVA 1K78B 3IHUA 3FX3A 2YX7A 2BYVE 2VOPA 3H3UA 3IKVA 5IT3A 1YW8A 3GFMA 5FD5A 2VBXA 5K5RA 1XCVA 4KN7X 5HLGA 3DPLC 2STWA 3PQKA 3GZ6A 5LBQA 1YFHA 1O3QA 4HW0A 3GFIA 4DQ2A 3VB2A 3EYIA 2ELHA 2RC4A 3CO7C 2LKPA 3RKYA 1OPCA 4Z2YA 2RNJA 1Z6TA 3MCZA 2MLGA 4G9YA 2QQAA 3F8MA 3K1NA 2STTA 2UWMA 3ML6A 3U1DA 1IN4A 4NHJA 1FPQA 2ESNA 1B59A 4MTDA 2QWWA 4EGYA 1R1VA 1LDJA 5TJJA 4DNCA 5LHHA 2P6TA 1V4RA 3RKXA 2O8XA 4BAYA 3M1EA 1FBUA 3L2CA 3V8KA 3GZ5A 4EGZA 4ENJA 3E6MA 5LHIA 1R58A 2Q8KA 1HQCA 1YS6A 2VBZA 3ZMSA 4WXCA 1QZZA 3QAHA 1XD7A 2P4WA 1V3FA 4RGRA 5BS6A 1BJAA 4HX7A 1Z6RA 2XKOA 5H20A 3F8NA 3QPTA 2IVMA 3V4GA 1Z7UA 3NQOA 4IVNA 2XV4S 3IWFA 3F8FA 5D8KB 4HZFA 1SFUA 2EV0A 1U6GA 3WTUC 2HQNA 1ON2A 4AVPA 3E6DA 4KDPA 1BI3A 3FXUA 2IT0A 4KIFA 3J80Z 1L0OC 3P9CA 2KIUA 4GGGA 2RV8A 4AIHA 1D8JA 4FX4A 1UCRA 2BE5F 2YR2A 2LSOA 4CDGA 1PP7U 2PN6A 3PQJA 3WODF 4BHPA 3BJAA 1W7PD 1W7PB 4O3MA 3CLOA 2OQGA 5TRDA 2QQBA 1T39A 1IN8A 2W85A 3TOBA 2DW4A 1R7JA 3BZ6A 4WXHA 3KP3A 3HHHA 4P96A 4IRHA 1B9MA 2GXGA 1TNTA 4KMUX 4GYIA 3T0YA 2H6CA 4WF2A 1DUXC 2QLZA 4IXAA 1U5TA 2HGCA 3GFJA 1ZGAA 4EVIA 2D1VA 4U0VA 2ZNZA 1YW7A 5EEGA 1LJ9A 2H09A 4EMSA 4BH9A 3GW2A 4MHGA 1JGSA 5E18F 5DDGA 2K7LA 2A6HF 3M8EA 2HS5A 5LRSA 4OIPF 2XHKA 1Q1HA 2MBFA 5DUKA 2W25A 1I1GA 1KU3A 3FF5A 3ECHA 1BM9A 4IRIA 1FT9A 4HV6A 1R1TA 4M9SA 1O3SA 2EFOA 2EFPA 5ILSA 2V6CA 1ONVA 3WTTC 4G7HF 4ZYGA 2CYYA 2GIVA 2DT5A 1I27A 4U7BA 2A5YB 2XAHA 2O6GE 4A0XA 3BROA 1SAXA 3CUQB 4LB5A 1ZH5A 1TQIA 1HKTA 5H6QA 4HBLA 3CJNA 1MDMB 1D8KA 1EH6A 3MZHA 4ASNA 3E97A 4U88A 3SHFA 4LLGF 3H3ZA 2L3DA 3S2WA 5EEHA 1J59A 4E70A 1G3WA 1U5TC 1SD5A 4K2EA 1USTA 2BGCA 2HQRA 3L7WA 4ENNA 1MJAA 1P92A 5D5UB 2QBYB 2XIGA 3KLNA 3FM3A 5ICGA 3CTAA 1MGTA 1T2KA 2HTJA 1GHCA 2D2WA 4HOBA 4OIRF 4G6DA 4A0YA 1F5TA 1ODDA 4A5MA 2HKOA 2UXXA 2A07F 2Z33A 2J5OA 5LGUA 2VOOA 5HDNA 3K1PA 3J80K 2DU9A 3K1MA 4KT5C 1WKMA 2PBIA 3WG9A 2RQPA 5L3EA 3HOTA 1FNNA 2IPQX 3E5QA 3HTSB 4Q5SF 3QU3A 4BXUA 1JXSA 2FE3A 1GVJA 2VT3A 4M9XA 2FBHA 2GXBA 2ESHA 2CSOA 3WTYC 4U0YA 2E1CA 3KLOA 1USSA 4G8XA 4EJUA 5HLHA 1B4AA 1IXRC 4YG2F 5ILVA 4KNYA 2PMUA 5LRRA 4ENKA 2XAFA 3HRMA 3MAJA 4CO8A 2FU4A 5F64A 4Q47A 4G7OF 1IRFA 1JHFA 1DPRA 4D0PA 4LMYA 1ZGJA 3F21A 1CGPA 5D6FA 1MZBA 2FMLA 4EJOA 2R7FA 2HKXA 2O0YA 1ZLJA 2VN2A 2ISZA 3ZN0A 2P5LC 2XROA 3HTUA 1GXQA 4AIJA 4L5JA 4JK1X 2RN7A 4OMZA 1FX7A 2XASA 4G7ZF 4M9ZA 1G3YA 2ZNYA 5LEKA 3MFKA 5F6FA 1IN7A 3HIFA 2NYXA 3LQRA 3KZZA 3QP6A 1WRJA 3GEZA 1YTYA 2M45A 3F6VA 2EV5A 3I4PA 1OKRA 4RAZA 4OU0A 5E1XA 3V7RA 5AIPA 4UV8A 4GO1A 1P4WA 4RB1A 1D3YA 3W6KB 2MH9A 3M9AA 3IKTA 5J8FA 1QQIA 5BOXA 4O5VA 1HSJA 1QPMA 3VEPA 1K78A 2RDPA 1H9TA 4WK8F 1E17A 1O7FA 1OYIA 2FBIA 1BC8C 3F72A 4PZJA 3TQNA 4M71A 5JI6A 3V7CA 5E17F 4ZZLA 5HDGA 3M7GA 4M72A 3TKYA 3ZMTA 5E20A 1XDSA 2OZUA 1ON1A 2X4HA 2Q0OA 1T6SA 4L0YB 1YLFA 1PDNC 2VE8A 5LLQA 4LB6B 3G73A 1FP1D 5K5OA 3IL2A 2H27A 5E8GA 3JTGA 4HAMA 3ZMVA 2NRAC 2WTEA 4ZYDA 4ESJA 2CW0F 3JTHA 1QNTA 3BWGA 1KU7A 3NEUA 1J5YA 1CF7B 2M5WA 2Z5UA 1FOKA 2O03A 1O3TA 2Y75A 1S8NA 1YG2A 3B02A 2DQRA 5H6RA 5D6EA 3IWZA 2FXAA 5HS8A 3WTVC 3BJ6A 3R61A 4QWQA 3VOEA 3R60A 5CLSA 1SD6A 2DAOA 1L3LA 5FO5A 3T5XA 3DXJF 3WTZA 3KP7A 1IRGA 1RUOA 3E6BA 2XAQA 4OIOF 5L3GA 1U8RA 4HQMA 2C6YA 1HSTA 4MTEA 4LG0A 2V1XA 4Q48A 1BBYA 1T98A 2FF4A 3F23A 5CVIA 4UVBA 4XBFA 1OR7A 5L3DA 5ICFA 3K2ZA 3BY6A 4IRGA 3KETA 2VXZA 3RKWA 2FSWA 1R23A 3I59B 1ZARA 4WCGA 4N9IA 4FX0A 3JW4A 2KRFA 4L9TA 3QU6A 4EJTA 3LA7A 2OA4A 3J81Z 1MKMA 2Z9OA 2OQRA 4HQEA 3KZYA 1W7PA 4P9FA 4ETSA 1U78A 1XDUA 1YYVA 4GCVA 4GXOA 5FFXA 5LGNA 3N4MA 1G6NA 3AAFA 1P6RA 3HSRA 3BDDA 3BOQA 1S29A 4CGZA 1KYZA 5K1YA 5DD4A 1U3EM 2EFNA 2DPDA 4YFKF 1MJBA 4PGHA 1R22A 5J6XA 1F4KA 3TO9A 2V79A 1ZLKA 3HUGA 1U2WA 1NHAA 2IW5A 4UV9A 1DP7P 4LGWA 5FFZA 3ZN1A 3KEQA 3F6OA 3QPHA 2B0LA 4B8XA 2O61A 1ZRDA 4A0ZA 5HS9A 4MGRA 2XGXA 1LQ1A 4HF0A 3KP5A 3WTSC 3BPVA 2DFIA 1S7AA 1VTNC 1F9NA 3ERED 2J5PA 3KP4A 3DPTA 2Z99A 3ELKA 3MWMA 2PI0A 2CG4A 2VONA 2DO7A 3TDZC 4BYYA 2MH2A 1KQ0A 2PMHA 1MDMA 2A68F 3L9FA 2DLLA 1S7OA 1IW7F 2ISYA 4LD5A 4OOIA 3ZMDA 3KP6A 5D5VB 3MQ0A 1GXPA 2EWNA 2VE9A 1TQPA 1J2XA 2OD5A 4WX9A 3FMQA 2VT2A 3M8FA 2F5EA 3HHGA 3LAPA 3DF8A 3I54A 2G7HA 1WQ2A 3IRQA 1OYWA 2EK5A 4GYGA 3EQLF 2VBYA 3I5UA 2DTRA 4HA8A 3BJOA 5JHUA 2ETHA 1ZYRF 5FLXZ 3HRUA 1LEAA 1X3UA 3DEUA 5JR3A 2QENA 3WGIA 1C0WA 2ZO4A 4ENMA 4I01A 3DQVC 2KJCA 4CHUA 3LA3A 2FA5A 2PFBA 5F1RA 4L9VA 2EFWA 4WWCA 2MC3A 5KVRA 3D0SA 3J81K 2JPCA 3T1BA 2OAZA 4PDKA 2D1HA 2P5KA 2L54A 4P9UA 1QGPA 1FLIA 2PQ8A 4OMYA 4CXFA 1EV7A 4N9HA 4F7ZA 3IRRA 2YPRA 4HF2A 2GQQA 4CYDA 3I64A 4ZYHA 1XGMA 4MQ9F 4I09A 4EM1A 3DFGA 1XSDA 1J7KA 4ZYEA 3HRSA 5ERIA 4KIGA 5CVJA 5DUIA 5IT9Z 2RVCA 2VBWA 2IA1A 3K9TA 2DBBA 2KJBA 3F8CA 4HX8A 2VODA 4G6QA 2ZBKA 3GWZA 5DCFA 1AWCA 4PCQA 2A6EF 4I98B 1R36A 3TO6A 2EB7A 2DPUA 4JQFA 3R6SA 1IN6A 1KU2A 2FQ3A 3E6CC 1FBSA 4P55A 1P4XA 2GA1A 3JAMZ 3F8BA 3U2RA 1IXCA 5BPIA 4HLXA 4EQQA 5L3BA 4EJVA 4QLCU 5ICCA 2HR3A 2AXLA 1ULYA 1BI0A 1ZAOA 4TV7A 5D5XB 3I71A 1IXSB 2FEZA 3QP5A 1W5SA 3TDUC 2ZMEA 4LLLA 1SMTA 4HLYA 2ZFWA 1PP8F 1YW9A 4XSZF 1MJ9A 2FNPA 5FLXK 1AOYA 4LJZF 4O6JA 3GO5A 4A6EA 2JT1A 5HDKA 1YO5C 2XUBA 2V1UA 3FM5A 4OINF 2BBYA 3T8RA 5L3FA 3HYIA 1T38A 4JBAA 4L0ZB 4AD9A 2P6SA 3OV8A 1YS7A 4Q4ZF 2EFQA 4YFXF 2G7UA 2QQ9A 1ZG3A 4FHTA 2HYGD 4BHBA 5DCMB 3EETA 2RKHA 2EA4A 3EDPA 1PUEE 3CO6C 1UFMA 5HS7A 2WWYA 3ZP5A 4RS8A 1HW5A 2L4AA 1KQ9A 3T8TA 3DV8A 3SXYA 1TBXA 1RUNA 3V8JA 3WGHA 4I02A 1A04A 1MD0A 1O3RA 4UHTA 1WSUA 3U9GA 2ZKZA 2GZWA 2X0LA 1FP2A 1W5TA 4A2UA 4ESFA 1Z9CA 3I0TA 4CZZA 1D5VA 5IT9K 1XGSA 2JSCA 2MA3A 1K79A 1H9GA 2XVCA 1LDKB 1LVAA 1TTYA 1B9NA 4ZZDA 3ISPA 5LHGA 4IF4A 3GVAA 1BC7C 2IJLA 5LGTA 5CVVA 2QUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HSF A;  3C3W A;  2AS5 F;  2V1D A;  4NB5 A;  2P7C B;  3JAM K;  3B73 A;  1ZRC A;  4ZH4 F;  5J8C A;  1LNW A;  2L02 A;  2PG4 A;  4N0B A;  1IN5 A;  4A6D A;  3O6B B;  1ZG5 A;  1XGO A;  1T0F A;  1Y0U A;  4RGS A;  1DDN A;  1REP C;  3RIR A;  2ADU A;  4U0W A;  2PEX A;  4KUM A;  2JPB A;  3FZV A;  2R7D A;  4B09 A;  1HBX G;  1JE8 A;  3E5X A;  4LK0 F;  3GFL A;  4PGG A;  2Z3Y A;  2BEO A;  4S04 A;  2BV6 A;  3TOA A;  2UXN A;  5CVR A;  2NAZ A;  1S6L A;  5BQT A;  3SFZ A;  1XSX A;  1O57 A;  1BI1 A;  4WXD A;  4S05 A;  4Y13 A;  3JSO A;  1W4M A;  2QM3 A;  2JRT A;  3IC7 A;  3ROU A;  4HX4 A;  4IHS A;  1KQ8 A;  1KYW A;  1YQA A;  4KN4 X;  2QZ8 A;  3C18 A;  5CYV A;  3LST A;  3REO A;  1TLH B;  4UNO A;  2G9W A;  2ZCW A;  2Y48 A;  3H92 A;  3RPQ A;  3HOS A;  2IA0 A;  1E2X A;  4M6X A;  3SZP A;  2MLK A;  4EM0 B;  1ZG1 A;  2DQL A;  3PFI A;  3WGG A;  2DK5 A;  3RYR A;  1BN5 A;  3KCC A;  1R1U A;  3OOP A;  3FHZ A;  2K4J A;  2EA2 A;  2HOE A;  3O2P E;  2HZT A;  5HOO A;  3BPX A;  1K7A A;  3HSE A;  3EYY A;  2H94 A;  1J0R A;  2K02 A;  2M1B A;  2OBP A;  3EUH A;  1XN7 A;  2LDU A;  2KIM A;  5AIQ A;  3FWE A;  4I2O A;  3C7J A;  4Y15 A;  4RAY A;  4UXN A;  3CUO A;  4ON0 A;  1ZRF A;  4MEX F;  4R1H A;  4EV0 A;  3I58 A;  2DI3 A;  3LFK A;  1SFE A;  2W24 A;  3N97 A;  1BIB A;  4I0A A;  5DYM A;  2COM A;  5E1W A;  3LAJ A;  3ABU A;  4ESB A;  3P9K A;  1Z91 A;  2K4B A;  4HDV A;  4P5O A;  3LQQ A;  4LG0 B;  4KYW A;  3Q9S A;  3MZY A;  1HW1 A;  2CQK A;  4IPA A;  5JVT A;  1B1B A;  4UVC A;  3RDI A;  2F2E A;  2HEO A;  3F22 A;  1OYY A;  2IP2 A;  3F3X A;  2JZY A;  4CIC A;  2M30 A;  3CUQ A;  2E7X A;  1IUY A;  3GLX A;  3WE2 A;  2HFH A;  3P7N A;  4EJW A;  2YX4 A;  1H0M A;  1SD4 A;  5D5W B;  2IRF G;  3ULQ B;  1G3S A;  1TQM A;  3R4K A;  2LF7 A;  1Z05 A;  2QBY A;  3CDH A;  5FGM A;  1IAW A;  4L5I A;  4UUV A;  1FSH A;  3HRT A;  2W57 A;  1S3J A;  5ILU A;  3KFW X;  5LEJ A;  2WV0 A;  4L18 B;  1WWX A;  2XAJ A;  2UZK A;  2NS0 A;  2P5V A;  3SQN A;  3FMR A;  1G3T A;  3O3K A;  3QOP A;  4RGU A;  3CUQ C;  2FNA A;  4XLP F;  1QO0 D;  2E1N A;  2CFX A;  2P7V B;  5BMZ A;  2XRN A;  3WU0 A;  4MQV A;  4RGX A;  5DEQ A;  3LWF A;  3MEX A;  5DV5 A;  3WE3 A;  4HV5 A;  3LA2 A;  3L09 A;  4IJA A;  2CO5 A;  1FC3 A;  2L01 A;  2ZJ2 A;  5D4S A;  1XB4 A;  2F5F A;  2NNN A;  4XSX F;  2VC1 A;  2XKP A;  2K86 A;  1HKQ A;  3P9I A;  3Q5F A;  3ABT A;  1YIO A;  2YU3 A;  1R00 A;  2A61 A;  2MD5 A;  1LB2 A;  1FY7 A;  2ACJ A;  4OIQ F;  4AWX B;  1TW3 A;  1LEB A;  4RB3 C;  3WTX C;  3WU1 B;  3R0J A;  2V9V A;  3BP8 A;  4NQW A;  3GXO A;  3I53 A;  1HW2 A;  4RB0 A;  5K5Q A;  1FYM A;  2Q2E A;  2HWV A;  1BOA A;  3TGN A;  1UHM A;  2TDX A;  1R5G A;  1K6O A;  5HVQ C;  3L00 A;  2P8T A;  4YIF A;  1SFX A;  4I7H A;  4R79 A;  2D45 A;  2LNB A;  2EJR A;  5CVU A;  4M6Y A;  1U5T B;  5KK1 A;  5DCM A;  3ECO A;  5A2Q Z;  1Z1D A;  2FOK A;  5DD8 A;  3V7S A;  5FD6 A;  1RIO H;  2RGV A;  1ZRE A;  2EV6 A;  2A69 F;  5BPD A;  4BNC A;  2YSR A;  3ZMZ A;  3ZPL A;  1KGS A;  5HLI A;  4BHC A;  4KIC A;  1J75 A;  3FXR A;  4A5N A;  1J9I A;  1RNL A;  3QRF F;  1BI2 A;  3TO7 A;  1FZP B;  4BQA A;  4L9J A;  2PJP A;  2KIF A;  1SMY F;  2W84 A;  3GUD A;  1TW2 A;  3Q9V A;  2R3S A;  2CGP A;  1XCB A;  3DP7 A;  4M74 A;  1SD7 A;  1STZ A;  2M87 A;  5ED4 A;  2OU2 A;  2PLY A;  2OZ6 A;  2KKO A;  5D8L B;  1R5H A;  3RI4 A;  2K27 A;  3E5U A;  2H6B A;  3E3V A;  1O7L A;  3GYH X;  1LDD A;  1HXD A;  3K0L A;  4EM2 A;  3J7A O;  4XRF A;  1WI9 A;  3COA C;  3FXQ A;  3SZT A;  1XSV A;  2E7W A;  1RZ4 A;  1CF7 A;  4G94 A;  2HYF A;  3RPU A;  2ZXJ A;  4MNU A;  3C1D A;  1I5Z A;  4KFC A;  3FMS A;  4AIK A;  4UVA A;  3GX4 X;  2F5D A;  3V8L A;  4KA4 A;  1JHH A;  4YFN F;  3RYP A;  5JFR A;  1UHW A;  2M8E A;  1XGN A;  1IF1 A;  3ZQ7 A;  4HDU A;  4KMF A;  4KIB A;  1OMI A;  1B6A A;  1UB9 A;  3KP2 A;  2GWR A;  4I0B A;  2F5C A;  2IA2 A;  2WC2 A;  2FRH A;  4H0E A;  1QZY A;  2VC0 A;  1XMA A;  2GAU A;  3DKW A;  1XMK A;  1ZHF A;  1FSE A;  5E1Z B;  3D5L A;  3RJP A;  3JSP A;  5L3C A;  2DK8 A;  2JTV A;  2ZME B;  4Y17 A;  2L4M A;  2LF8 A;  2QVO A;  2HDC A;  2A3S A;  2CWE A;  1ZN2 A;  4IHT A;  3WTW C;  4RB2 C;  5A2Q K;  3I59 A;  3KEO A;  1I6X A;  3R0A A;  6PAX A;  5E8I A;  1BIA A;  4LLN A;  2QYO A;  2GA2 A;  3G3Z A;  1P2F A;  1QBJ A;  2O3F A;  1F1Z A;  2NNY A;  1KA8 A;  1IZ1 A;  1TNS A;  1I1S A;  5CJ9 A;  3ZMU A;  1RI7 A;  3VOD A;  4YII A;  4HYE A;  5ICE A;  5AON A;  1KU9 A;  4HF1 A;  1FYK A;  5FB2 A;  4U7D A;  4A12 A;  4XLN F;  2Y0M A;  1FBQ A;  1EH7 A;  2FBK A;  2HTS A;  2FMY A;  3K69 A;  4FT8 A;  1FWZ A;  4M73 A;  3GF2 A;  5D4R A;  4MEY F;  4R8H A;  2XAG A;  1HKS A;  3VFZ A;  1P4A A;  3KE2 A;  4LFU A;  1G4D A;  1DPU A;  1EH8 A;  1FYL A;  4L9N A;  3RTR A;  4LK1 F;  3W6J B;  3NRV A;  1K78 B;  3IHU A;  3FX3 A;  2YX7 A;  2BYV E;  2VOP A;  3H3U A;  3IKV A;  5IT3 A;  1YW8 A;  3GFM A;  5FD5 A;  2VBX A;  5K5R A;  1XCV A;  4KN7 X;  5HLG A;  3DPL C;  2STW A;  3PQK A;  3GZ6 A;  5LBQ A;  1YFH A;  1O3Q A;  4HW0 A;  3GFI A;  4DQ2 A;  3VB2 A;  3EYI A;  2ELH A;  2RC4 A;  3CO7 C;  2LKP A;  3RKY A;  1OPC A;  4Z2Y A;  2RNJ A;  1Z6T A;  3MCZ A;  2MLG A;  4G9Y A;  2QQA A;  3F8M A;  3K1N A;  2STT A;  2UWM A;  3ML6 A;  3U1D A;  1IN4 A;  4NHJ A;  1FPQ A;  2ESN A;  1B59 A;  4MTD A;  2QWW A;  4EGY A;  1R1V A;  1LDJ A;  5TJJ A;  4DNC A;  5LHH A;  2P6T A;  1V4R A;  3RKX A;  2O8X A;  4BAY A;  3M1E A;  1FBU A;  3L2C A;  3V8K A;  3GZ5 A;  4EGZ A;  4ENJ A;  3E6M A;  5LHI A;  1R58 A;  2Q8K A;  1HQC A;  1YS6 A;  2VBZ A;  3ZMS A;  4WXC A;  1QZZ A;  3QAH A;  1XD7 A;  2P4W A;  1V3F A;  4RGR A;  5BS6 A;  1BJA A;  4HX7 A;  1Z6R A;  2XKO A;  5H20 A;  3F8N A;  3QPT A;  2IVM A;  3V4G A;  1Z7U A;  3NQO A;  4IVN A;  2XV4 S;  3IWF A;  3F8F A;  5D8K B;  4HZF A;  1SFU A;  2EV0 A;  1U6G A;  3WTU C;  2HQN A;  1ON2 A;  4AVP A;  3E6D A;  4KDP A;  1BI3 A;  3FXU A;  2IT0 A;  4KIF A;  3J80 Z;  1L0O C;  3P9C A;  2KIU A;  4GGG A;  2RV8 A;  4AIH A;  1D8J A;  4FX4 A;  1UCR A;  2BE5 F;  2YR2 A;  2LSO A;  4CDG A;  1PP7 U;  2PN6 A;  3PQJ A;  3WOD F;  4BHP A;  3BJA A;  1W7P D;  1W7P B;  4O3M A;  3CLO A;  2OQG A;  5TRD A;  2QQB A;  1T39 A;  1IN8 A;  2W85 A;  3TOB A;  2DW4 A;  1R7J A;  3BZ6 A;  4WXH A;  3KP3 A;  3HHH A;  4P96 A;  4IRH A;  1B9M A;  2GXG A;  1TNT A;  4KMU X;  4GYI A;  3T0Y A;  2H6C A;  4WF2 A;  1DUX C;  2QLZ A;  4IXA A;  1U5T A;  2HGC A;  3GFJ A;  1ZGA A;  4EVI A;  2D1V A;  4U0V A;  2ZNZ A;  1YW7 A;  5EEG A;  1LJ9 A;  2H09 A;  4EMS A;  4BH9 A;  3GW2 A;  4MHG A;  1JGS A;  5E18 F;  5DDG A;  2K7L A;  2A6H F;  3M8E A;  2HS5 A;  5LRS A;  4OIP F;  2XHK A;  1Q1H A;  2MBF A;  5DUK A;  2W25 A;  1I1G A;  1KU3 A;  3FF5 A;  3ECH A;  1BM9 A;  4IRI A;  1FT9 A;  4HV6 A;  1R1T A;  4M9S A;  1O3S A;  2EFO A;  2EFP A;  5ILS A;  2V6C A;  1ONV A;  3WTT C;  4G7H F;  4ZYG A;  2CYY A;  2GIV A;  2DT5 A;  1I27 A;  4U7B A;  2A5Y B;  2XAH A;  2O6G E;  4A0X A;  3BRO A;  1SAX A;  3CUQ B;  4LB5 A;  1ZH5 A;  1TQI A;  1HKT A;  5H6Q A;  4HBL A;  3CJN A;  1MDM B;  1D8K A;  1EH6 A;  3MZH A;  4ASN A;  3E97 A;  4U88 A;  3SHF A;  4LLG F;  3H3Z A;  2L3D A;  3S2W A;  5EEH A;  1J59 A;  4E70 A;  1G3W A;  1U5T C;  1SD5 A;  4K2E A;  1UST A;  2BGC A;  2HQR A;  3L7W A;  4ENN A;  1MJA A;  1P92 A;  5D5U B;  2QBY B;  2XIG A;  3KLN A;  3FM3 A;  5ICG A;  3CTA A;  1MGT A;  1T2K A;  2HTJ A;  1GHC A;  2D2W A;  4HOB A;  4OIR F;  4G6D A;  4A0Y A;  1F5T A;  1ODD A;  4A5M A;  2HKO A;  2UXX A;  2A07 F;  2Z33 A;  2J5O A;  5LGU A;  2VOO A;  5HDN A;  3K1P A;  3J80 K;  2DU9 A;  3K1M A;  4KT5 C;  1WKM A;  2PBI A;  3WG9 A;  2RQP A;  5L3E A;  3HOT A;  1FNN A;  2IPQ X;  3E5Q A;  3HTS B;  4Q5S F;  3QU3 A;  4BXU A;  1JXS A;  2FE3 A;  1GVJ A;  2VT3 A;  4M9X A;  2FBH A;  2GXB A;  2ESH A;  2CSO A;  3WTY C;  4U0Y A;  2E1C A;  3KLO A;  1USS A;  4G8X A;  4EJU A;  5HLH A;  1B4A A;  1IXR C;  4YG2 F;  5ILV A;  4KNY A;  2PMU A;  5LRR A;  4ENK A;  2XAF A;  3HRM A;  3MAJ A;  4CO8 A;  2FU4 A;  5F64 A;  4Q47 A;  4G7O F;  1IRF A;  1JHF A;  1DPR A;  4D0P A;  4LMY A;  1ZGJ A;  3F21 A;  1CGP A;  5D6F A;  1MZB A;  2FML A;  4EJO A;  2R7F A;  2HKX A;  2O0Y A;  1ZLJ A;  2VN2 A;  2ISZ A;  3ZN0 A;  2P5L C;  2XRO A;  3HTU A;  1GXQ A;  4AIJ A;  4L5J A;  4JK1 X;  2RN7 A;  4OMZ A;  1FX7 A;  2XAS A;  4G7Z F;  4M9Z A;  1G3Y A;  2ZNY A;  5LEK A;  3MFK A;  5F6F A;  1IN7 A;  3HIF A;  2NYX A;  3LQR A;  3KZZ A;  3QP6 A;  1WRJ A;  3GEZ A;  1YTY A;  2M45 A;  3F6V A;  2EV5 A;  3I4P A;  1OKR A;  4RAZ A;  4OU0 A;  5E1X A;  3V7R A;  5AIP A;  4UV8 A;  4GO1 A;  1P4W A;  4RB1 A;  1D3Y A;  3W6K B;  2MH9 A;  3M9A A;  3IKT A;  5J8F A;  1QQI A;  5BOX A;  4O5V A;  1HSJ A;  1QPM A;  3VEP A;  1K78 A;  2RDP A;  1H9T A;  4WK8 F;  1E17 A;  1O7F A;  1OYI A;  2FBI A;  1BC8 C;  3F72 A;  4PZJ A;  3TQN A;  4M71 A;  5JI6 A;  3V7C A;  5E17 F;  4ZZL A;  5HDG A;  3M7G A;  4M72 A;  3TKY A;  3ZMT A;  5E20 A;  1XDS A;  2OZU A;  1ON1 A;  2X4H A;  2Q0O A;  1T6S A;  4L0Y B;  1YLF A;  1PDN C;  2VE8 A;  5LLQ A;  4LB6 B;  3G73 A;  1FP1 D;  5K5O A;  3IL2 A;  2H27 A;  5E8G A;  3JTG A;  4HAM A;  3ZMV A;  2NRA C;  2WTE A;  4ZYD A;  4ESJ A;  2CW0 F;  3JTH A;  1QNT A;  3BWG A;  1KU7 A;  3NEU A;  1J5Y A;  1CF7 B;  2M5W A;  2Z5U A;  1FOK A;  2O03 A;  1O3T A;  2Y75 A;  1S8N A;  1YG2 A;  3B02 A;  2DQR A;  5H6R A;  5D6E A;  3IWZ A;  2FXA A;  5HS8 A;  3WTV C;  3BJ6 A;  3R61 A;  4QWQ A;  3VOE A;  3R60 A;  5CLS A;  1SD6 A;  2DAO A;  1L3L A;  5FO5 A;  3T5X A;  3DXJ F;  3WTZ A;  3KP7 A;  1IRG A;  1RUO A;  3E6B A;  2XAQ A;  4OIO F;  5L3G A;  1U8R A;  4HQM A;  2C6Y A;  1HST A;  4MTE A;  4LG0 A;  2V1X A;  4Q48 A;  1BBY A;  1T98 A;  2FF4 A;  3F23 A;  5CVI A;  4UVB A;  4XBF A;  1OR7 A;  5L3D A;  5ICF A;  3K2Z A;  3BY6 A;  4IRG A;  3KET A;  2VXZ A;  3RKW A;  2FSW A;  1R23 A;  3I59 B;  1ZAR A;  4WCG A;  4N9I A;  4FX0 A;  3JW4 A;  2KRF A;  4L9T A;  3QU6 A;  4EJT A;  3LA7 A;  2OA4 A;  3J81 Z;  1MKM A;  2Z9O A;  2OQR A;  4HQE A;  3KZY A;  1W7P A;  4P9F A;  4ETS A;  1U78 A;  1XDU A;  1YYV A;  4GCV A;  4GXO A;  5FFX A;  5LGN A;  3N4M A;  1G6N A;  3AAF A;  1P6R A;  3HSR A;  3BDD A;  3BOQ A;  1S29 A;  4CGZ A;  1KYZ A;  5K1Y A;  5DD4 A;  1U3E M;  2EFN A;  2DPD A;  4YFK F;  1MJB A;  4PGH A;  1R22 A;  5J6X A;  1F4K A;  3TO9 A;  2V79 A;  1ZLK A;  3HUG A;  1U2W A;  1NHA A;  2IW5 A;  4UV9 A;  1DP7 P;  4LGW A;  5FFZ A;  3ZN1 A;  3KEQ A;  3F6O A;  3QPH A;  2B0L A;  4B8X A;  2O61 A;  1ZRD A;  4A0Z A;  5HS9 A;  4MGR A;  2XGX A;  1LQ1 A;  4HF0 A;  3KP5 A;  3WTS C;  3BPV A;  2DFI A;  1S7A A;  1VTN C;  1F9N A;  3ERE D;  2J5P A;  3KP4 A;  3DPT A;  2Z99 A;  3ELK A;  3MWM A;  2PI0 A;  2CG4 A;  2VON A;  2DO7 A;  3TDZ C;  4BYY A;  2MH2 A;  1KQ0 A;  2PMH A;  1MDM A;  2A68 F;  3L9F A;  2DLL A;  1S7O A;  1IW7 F;  2ISY A;  4LD5 A;  4OOI A;  3ZMD A;  3KP6 A;  5D5V B;  3MQ0 A;  1GXP A;  2EWN A;  2VE9 A;  1TQP A;  1J2X A;  2OD5 A;  4WX9 A;  3FMQ A;  2VT2 A;  3M8F A;  2F5E A;  3HHG A;  3LAP A;  3DF8 A;  3I54 A;  2G7H A;  1WQ2 A;  3IRQ A;  1OYW A;  2EK5 A;  4GYG A;  3EQL F;  2VBY A;  3I5U A;  2DTR A;  4HA8 A;  3BJO A;  5JHU A;  2ETH A;  1ZYR F;  5FLX Z;  3HRU A;  1LEA A;  1X3U A;  3DEU A;  5JR3 A;  2QEN A;  3WGI A;  1C0W A;  2ZO4 A;  4ENM A;  4I01 A;  3DQV C;  2KJC A;  4CHU A;  3LA3 A;  2FA5 A;  2PFB A;  5F1R A;  4L9V A;  2EFW A;  4WWC A;  2MC3 A;  5KVR A;  3D0S A;  3J81 K;  2JPC A;  3T1B A;  2OAZ A;  4PDK A;  2D1H A;  2P5K A;  2L54 A;  4P9U A;  1QGP A;  1FLI A;  2PQ8 A;  4OMY A;  4CXF A;  1EV7 A;  4N9H A;  4F7Z A;  3IRR A;  2YPR A;  4HF2 A;  2GQQ A;  4CYD A;  3I64 A;  4ZYH A;  1XGM A;  4MQ9 F;  4I09 A;  4EM1 A;  3DFG A;  1XSD A;  1J7K A;  4ZYE A;  3HRS A;  5ERI A;  4KIG A;  5CVJ A;  5DUI A;  5IT9 Z;  2RVC A;  2VBW A;  2IA1 A;  3K9T A;  2DBB A;  2KJB A;  3F8C A;  4HX8 A;  2VOD A;  4G6Q A;  2ZBK A;  3GWZ A;  5DCF A;  1AWC A;  4PCQ A;  2A6E F;  4I98 B;  1R36 A;  3TO6 A;  2EB7 A;  2DPU A;  4JQF A;  3R6S A;  1IN6 A;  1KU2 A;  2FQ3 A;  3E6C C;  1FBS A;  4P55 A;  1P4X A;  2GA1 A;  3JAM Z;  3F8B A;  3U2R A;  1IXC A;  5BPI A;  4HLX A;  4EQQ A;  5L3B A;  4EJV A;  4QLC U;  5ICC A;  2HR3 A;  2AXL A;  1ULY A;  1BI0 A;  1ZAO A;  4TV7 A;  5D5X B;  3I71 A;  1IXS B;  2FEZ A;  3QP5 A;  1W5S A;  3TDU C;  2ZME A;  4LLL A;  1SMT A;  4HLY A;  2ZFW A;  1PP8 F;  1YW9 A;  4XSZ F;  1MJ9 A;  2FNP A;  5FLX K;  1AOY A;  4LJZ F;  4O6J A;  3GO5 A;  4A6E A;  2JT1 A;  5HDK A;  1YO5 C;  2XUB A;  2V1U A;  3FM5 A;  4OIN F;  2BBY A;  3T8R A;  5L3F A;  3HYI A;  1T38 A;  4JBA A;  4L0Z B;  4AD9 A;  2P6S A;  3OV8 A;  1YS7 A;  4Q4Z F;  2EFQ A;  4YFX F;  2G7U A;  2QQ9 A;  1ZG3 A;  4FHT A;  2HYG D;  4BHB A;  5DCM B;  3EET A;  2RKH A;  2EA4 A;  3EDP A;  1PUE E;  3CO6 C;  1UFM A;  5HS7 A;  2WWY A;  3ZP5 A;  4RS8 A;  1HW5 A;  2L4A A;  1KQ9 A;  3T8T A;  3DV8 A;  3SXY A;  1TBX A;  1RUN A;  3V8J A;  3WGH A;  4I02 A;  1A04 A;  1MD0 A;  1O3R A;  4UHT A;  1WSU A;  3U9G A;  2ZKZ A;  2GZW A;  2X0L A;  1FP2 A;  1W5T A;  4A2U A;  4ESF A;  1Z9C A;  3I0T A;  4CZZ A;  1D5V A;  5IT9 K;  1XGS A;  2JSC A;  2MA3 A;  1K79 A;  1H9G A;  2XVC A;  1LDK B;  1LVA A;  1TTY A;  1B9N A;  4ZZD A;  3ISP A;  5LHG A;  4IF4 A;  3GVA A;  1BC7 C;  2IJL A;  5LGT A;  5CVV A;  2QUF A; 
#chains in the Genus database with same CATH topology
 1MBE A;  3HSF A;  2GXA A;  3C3W A;  1UHS A;  3ERM A;  1W36 C;  2Z1D A;  2AS5 F;  1WVR A;  2V1D A;  1SAU A;  2JA8 J;  4NB5 A;  2P7C B;  3JAM K;  3B73 A;  4XOR A;  1ZRC A;  4ZH4 F;  5J8C A;  4LIT A;  1UZC A;  1SVM A;  2DOE A;  4EAT A;  1RR8 C;  1LNW A;  2L02 A;  2PG4 A;  4N0B A;  4Y4R A;  2HOA A;  1IN5 A;  5E3M A;  2O7O A;  1XG1 A;  3O8H A;  2VJI A;  5HNF A;  2VQG A;  4A6D A;  3O6B B;  1ZG5 A;  1XGO A;  1AU7 A;  1T0F A;  1GVD A;  1Y0U A;  4RGS A;  2DA1 A;  3N05 A;  5GPA A;  1DDN A;  3W2A A;  1REP C;  3RIR A;  2R4G A;  2ADU A;  4U0W A;  2PEX A;  4KUM A;  2LBF A;  4E7Z A;  1E0E A;  2KL4 A;  2CV0 A;  2R93 J;  1ERD A;  2JPB A;  3FZV A;  3O8G A;  3RPU D;  2R7D A;  5F0F A;  4B09 A;  3TW6 A;  4A3F J;  1MNE A;  2K85 A;  1HBX G;  1F43 A;  1JE8 A;  3E5X A;  2L7F P;  4LK0 F;  3J7A Y;  1MH3 A;  3G2B A;  2COB A;  3A03 A;  3A01 A;  3IUO A;  3GFL A;  4PGG A;  3H5R A;  2Z3Y A;  2O9L A;  2LC2 A;  3AKZ A;  2BEO A;  4S04 A;  3DTI A;  3GTQ J;  2BV6 A;  3TOA A;  3HB9 A;  2UXN A;  2KIS A;  1MMD A;  2HU9 A;  2LY1 A;  2NAZ A;  1S6L A;  4PJN A;  5CVR A;  5BQT A;  3SFZ A;  1XSX A;  1O57 A;  1BI1 A;  4WXD A;  4S0H B;  2WAF A;  4B4C A;  4A3C J;  5F1J A;  3OSG A;  4S05 A;  4Y13 A;  1AKH A;  3JSO A;  4HNT A;  1W4M A;  2K9S A;  2QM3 A;  3JRE A;  1PYV A;  2DN0 A;  3H35 A;  2JRT A;  3DCF A;  4XR6 A;  1A36 A;  3BLY A;  3IC7 A;  3PNT A;  4C2U A;  2L9S A;  2JVG A;  3ROU A;  4HX4 A;  3RKQ A;  4IHS A;  5C4X J;  1KQ8 A;  1KYW A;  3OYE A;  4RA2 A;  1YQA A;  3HL2 A;  4KN4 X;  2QZ8 A;  2XPU A;  3C18 A;  3BZC A;  2M0C A;  2DDB A;  2VQH A;  1RC9 A;  1T0F C;  1VQL I;  3OYI A;  5CYV A;  4DZP A;  3LST A;  3REO A;  1TLH B;  1Q1V A;  3ABM H;  4UNO A;  2G9W A;  2ZCW A;  3RZO J;  2Y48 A;  3H92 A;  3RPQ A;  2H1L A;  4DJA A;  4IO9 F;  3HOS A;  2EIL H;  2XC7 A;  2IA0 A;  2OC6 A;  1E2X A;  4M6X A;  3SZP A;  1V5E A;  2MLK A;  1LE8 A;  3K6G A;  4EM0 B;  5JLX A;  1ZG1 A;  4V19 K;  1RET A;  4B1R A;  3A1Y A;  2DQL A;  3W2W A;  3OS2 A;  3PFI A;  4IEJ A;  3VWB A;  3WGG A;  1BR2 A;  3DWL E;  3S3M A;  2DK5 A;  4PSX A;  3RYR A;  2ZJR F;  1BN5 A;  2CV2 A;  2LR8 A;  3KCC A;  1R1U A;  3OOP A;  4CUG A;  3FHZ A;  4D1Q A;  2K4J A;  1RKW A;  2EA2 A;  2HOE A;  3O2P E;  1WH7 A;  4DGW B;  4GDF A;  2W00 A;  2HZT A;  3CMM A;  1EA3 A;  1RES A;  5HOO A;  5GTI C;  3OIP A;  5C44 J;  2EZL A;  5M5Y J;  3BPX A;  1Y1V J;  1K7A A;  3S1N J;  2NVQ J;  1YE9 A;  2E34 A;  3HSE A;  2KZV A;  3EYY A;  2H94 A;  1J0R A;  2K02 A;  3FDY A;  2M1B A;  3QOD A;  2RAE A;  3OYD A;  2OBP A;  3KPH A;  2VUM J;  3S16 J;  4D5C A;  3EUH A;  1XN7 A;  2BY3 A;  2LDU A;  1FTT A;  1WJC A;  2D5V A;  1MMS A;  2KIM A;  3GTK J;  4NDL A;  5AIQ A;  2Y30 A;  2VKD A;  2K9Q A;  3FWE A;  4I2O A;  3C7J A;  4Y15 A;  4RAY A;  5F0C A;  3M8J A;  4UXN A;  3PM1 A;  3CUO A;  1JUS A;  4J00 A;  2HYJ A;  1IJW C;  3CP2 A;  4ON0 A;  1ZRF A;  4MEX F;  2GM4 A;  5BNG A;  4R1H A;  4EV0 A;  3I58 A;  2DI3 A;  3LFK A;  1SFE A;  4C3I J;  3HOW J;  2W24 A;  3ZQC A;  3N97 A;  1BIB A;  3Q0U A;  4I0A A;  5DYM A;  1ZK8 A;  2VJ5 A;  1DU0 A;  1E3H A;  3OIO A;  2COM A;  5E1W A;  3LAJ A;  4B47 A;  2IGO A;  2WAQ A;  1JTY A;  3ABU A;  2ZXH A;  4ESB A;  2AO9 A;  4J01 A;  3P9K A;  3X2Q H;  1POG A;  1Z91 A;  2K4B A;  4HDV A;  4P5O A;  4ZDP A;  3LQQ A;  4NC8 A;  4LG0 B;  4KYW A;  3Q9S A;  2VKV A;  3MZY A;  3I55 I;  1HW1 A;  4HNV A;  5F0H A;  2CQK A;  3ZOB A;  2CW7 A;  1T08 B;  4IPA A;  5JVT A;  1B1B A;  3HZJ A;  2VB6 A;  4UVC A;  3RDI A;  1MBH A;  2F2E A;  1HA8 A;  2HEO A;  4XM3 A;  1OYY A;  3F22 A;  2IP2 A;  3CCU I;  1ITY A;  3F3X A;  2JZY A;  4CIC A;  1YRN B;  2M30 A;  3CUQ A;  2QSH X;  3SJM A;  3EUH C;  4CCJ A;  1JKO C;  2E7X A;  4ITV A;  4BXF A;  3GLX A;  2DXI A;  1IUY A;  3B6C A;  3WE2 A;  3I4N J;  2GIZ A;  2HFH A;  3P7N A;  1ZTR A;  4EJW A;  2YX4 A;  1SEU A;  4C3J J;  4E7H A;  4PFO A;  3IP4 B;  3M4O J;  1H0M A;  2R5Y A;  5E3O A;  1SD4 A;  4PK4 A;  1S72 I;  1JKP C;  5D5W B;  4BE2 A;  2FD5 A;  2EZK A;  4LIV A;  1TL8 A;  2IRF G;  4V2G A;  4FQG A;  1G59 A;  3ULQ B;  3I9V 2;  1G3S A;  1TQM A;  3R4K A;  4BAC A;  2LF7 A;  2VIX A;  1Z05 A;  4XN0 A;  2QBY A;  3CDH A;  4XLA A;  5FGM A;  3AG2 H;  2YS9 A;  1IAW A;  4L5I A;  4UUV A;  1FSH A;  3K10 A;  3HRT A;  2PX9 A;  2W57 A;  1S3J A;  5ILU A;  2IS1 A;  2ZB9 A;  3KFW X;  5LEJ A;  2WV0 A;  5B3S H;  3L2R A;  4L18 B;  3HOU J;  1WWX A;  4AVZ A;  3W3C A;  2LVS A;  2XAJ A;  2UZK A;  2NS0 A;  1R4M B;  2P5V A;  5LD2 C;  4DYQ A;  3RCO A;  4BJ5 C;  3SQN A;  1X4O A;  3BR2 A;  3FMR A;  1G3T A;  3O3K A;  3LSG A;  3QOP A;  3VYT B;  1K83 J;  3KZI C;  4RGU A;  4U87 A;  3CUQ C;  2FNA A;  3HUG B;  4XLP F;  1QO0 D;  1KON A;  2PJR B;  2KLO A;  4FAS D;  3FHN A;  4W1U A;  3TP0 A;  3I56 I;  2E1N A;  2OUM A;  2CFX A;  2HQ5 A;  2P7V B;  1R9T J;  3L2W A;  5BMZ A;  3AL0 C;  2XRN A;  2N8G A;  4MQV A;  2ZXI A;  4RGX A;  5DEQ A;  3LWF A;  5KAI C;  2L2O A;  3WU0 A;  3FXL A;  4LOC A;  3MEX A;  3HGG A;  5DV5 A;  4B3A A;  3WE3 A;  4JOM A;  3OYJ A;  4HV5 A;  3LA2 A;  1ZKG A;  3L09 A;  4AC0 A;  1VF9 A;  1JGG A;  3A02 A;  3OWT A;  4IJA A;  2CO5 A;  1FC3 A;  2HXI A;  2L01 A;  2ZJ2 A;  5D4S A;  1I6H J;  5EF6 A;  5FLV A;  1XB4 A;  2A05 A;  2F5F A;  4XLE A;  2NNN A;  4XSX F;  2VC1 A;  2M8G X;  2XKP A;  2K86 A;  1HKQ A;  3E0J B;  3P9I A;  2HOT A;  3Q5F A;  3ABT A;  3CCL I;  1W0T A;  1YIO A;  2YU3 A;  2BXY A;  1R00 A;  3FXO A;  1JKQ C;  1A6I A;  5FJ8 J;  2DA2 A;  1Z77 A;  2A61 A;  2MD5 A;  1LB2 A;  1FY7 A;  2ACJ A;  4OIQ F;  4AWX B;  1TW3 A;  3OYH A;  1LEB A;  2RQQ A;  4RB3 C;  3WTX C;  3WU1 B;  3R0J A;  2V9V A;  1X1D A;  3OYB A;  3LSM A;  3TW7 A;  3BP8 A;  4IKF A;  1PUF B;  4NQW A;  4E7K A;  3GXO A;  3I53 A;  4Y7N J;  1HW2 A;  4RDU A;  4RB0 A;  4A3B J;  5K5Q A;  4X0G A;  3I3L A;  4ZJZ A;  2CQN A;  2E2H J;  1FYM A;  5IYB J;  1YJN I;  2Q2E A;  1GT0 C;  2MYS A;  2CV1 A;  2HWV A;  1BOA A;  2EIN H;  3TGN A;  1UHM A;  2TDX A;  2VQL A;  2HI3 A;  1R5G A;  5KCM A;  5J4V A;  1K6O A;  5HVQ C;  1DGR M;  3L00 A;  2VKE A;  1ETV A;  2P8T A;  3BG5 A;  4XKB A;  4CSW A;  1R49 A;  4M6V A;  2IS6 A;  2IXS A;  3CCS I;  2H8W A;  3LOC A;  4X1E A;  4YIF A;  1SFX A;  4I7H A;  2CQX A;  4R79 A;  2D45 A;  2LNB A;  1NK2 P;  1A5J A;  2EJR A;  2GOX B;  5FRO A;  5CVU A;  4M6Y A;  3PL8 A;  1U5T B;  3OMY A;  5DCM A;  5KK1 A;  4A3J J;  3ECO A;  3A0H C;  5A2Q Z;  1Z1D A;  2CUE A;  2FOK A;  3K4J A;  4UUT A;  5DD8 A;  4ZYA A;  3PUB A;  5JVG F;  3V7S A;  5FD6 A;  1QVT A;  1RIO H;  3EUA A;  2RGV A;  5GAG J;  4M3F A;  1ZRE A;  2EV6 A;  1N25 A;  2A69 F;  2PMZ A;  3ZQQ A;  3PIO F;  5BPD A;  2O8K A;  2YU9 J;  2V4J C;  2R7S A;  4BNC A;  2OJE D;  2V9K A;  1SAN A;  2YSR A;  1K6Y A;  3ZMZ A;  4GRI A;  3ZPL A;  2ID3 A;  3QYE A;  1KGS A;  5J1U A;  4IOC F;  5HLI A;  4BHC A;  4F3Q A;  3ZRG A;  5EEA A;  2F48 A;  4KIC A;  3RSN A;  1J75 A;  2XPV A;  3FXR A;  4A5N A;  4A3E J;  3S1Q J;  4BQQ A;  3G4S I;  1J9I A;  1RNL A;  3OS0 A;  3QRF F;  1BI2 A;  4F52 A;  3TO7 A;  1FZP B;  3BR3 A;  4BQA A;  3UNG C;  1W5C C;  4HNU A;  1IC8 A;  4YIR X;  4L9J A;  1P7I A;  3E1S A;  2PJP A;  4BDY A;  1WZ2 A;  2KIF A;  2GOM A;  1SMY F;  3CC2 I;  2K9L A;  2W84 A;  1JUM A;  3GUD A;  2IEK A;  5B1B H;  2XGC A;  3A4C A;  1TW2 A;  1P9Q C;  3Q9V A;  5EG0 A;  4D7M A;  1I50 J;  2DOA A;  2R3S A;  3CES A;  2CGP A;  3OS1 A;  4I76 A;  1XCB A;  3DP7 A;  1G2H A;  4M74 A;  1SD7 A;  1STZ A;  2M87 A;  4CCO A;  5ED4 A;  3JRC A;  1BW6 A;  2OU2 A;  3AG3 H;  4EEF G;  2PLY A;  2XF6 A;  1ETY A;  2OZ6 A;  2KKO A;  5D8L B;  2DA5 A;  1R5H A;  3RI4 A;  2K27 A;  3E5U A;  5H2F C;  1DP3 A;  2H6B A;  2IGN A;  1F36 A;  2E5N A;  2NOJ B;  3E3V A;  1O7L A;  3HDD A;  3GYH X;  1D5Y A;  1Z67 A;  2QCO A;  1LDD A;  1HXD A;  4FTH A;  3K0L A;  2OPT A;  2KRC A;  1DQU A;  2IBD A;  4EM2 A;  2OTL I;  3D5R C;  3J7A O;  4XRF A;  1N75 A;  1WI9 A;  3COA C;  3FXQ A;  5HLT A;  3SZT A;  1LFP A;  1OQY A;  1XSV A;  1RZ4 A;  2E7W A;  1X4P A;  1CF7 A;  4G6T B;  3NWS A;  2P81 A;  4JYK A;  3OYF A;  4G94 A;  3GTL J;  2HYF A;  3FXM A;  3RPU A;  2ZXJ A;  4MNU A;  1BOB A;  3NAR A;  3WHC A;  3C1D A;  1MND A;  4DBQ A;  1I5Z A;  4KFC A;  3FMS A;  4ZDO A;  4AIK A;  4UVA A;  4FCY A;  2ECB A;  3GX4 X;  2F5D A;  3V8L A;  4KA4 A;  1JHH A;  4YFN F;  4RLF A;  3RYP A;  2XDV A;  5JFR A;  3H0G J;  2M4K A;  2F5V A;  1EF4 A;  1HLV A;  3BG6 A;  1UHW A;  2M8E A;  3JCU C;  1XGN A;  2CQQ A;  3OOU A;  3ZQL A;  3ZQ7 A;  1IF1 A;  2I8D A;  4HDU A;  4KMF A;  2Z2S B;  4KIB A;  1OMI A;  1VQK I;  1B6A A;  1UB9 A;  3K4M A;  1XPX A;  4QTR A;  3KP2 A;  2GWR A;  4I0B A;  2F5C A;  3Q0V A;  2IA2 A;  1G8X A;  3ASN H;  2WC2 A;  2FRH A;  4H0E A;  1M1E B;  4ANJ A;  1QZY A;  3KEY A;  2LY9 A;  2VC0 A;  1IRZ A;  1XMA A;  2GAU A;  3DKW A;  1MMN A;  4C30 A;  1XMK A;  5JLW A;  1ZHF A;  2VJ4 A;  4BEH B;  2WV1 A;  5J3L A;  5J1Y A;  1FSE A;  5E1Z B;  5J4Y A;  3D5L A;  4XKW A;  3RJP A;  3JSP A;  5L3C A;  2DK8 A;  2JTV A;  4YEJ A;  2ZME B;  3K4B A;  4Y17 A;  2X1D A;  2L4M A;  3PJR A;  2LF8 A;  2MC4 A;  2QVO A;  2HDC A;  2LTP A;  1D1C A;  2A3S A;  4QIW N;  4NUB A;  3BTI A;  3MZ8 A;  2CWE A;  3J7Y J;  1ZN2 A;  3FXJ A;  4Z6Y A;  3CJT B;  4IHT A;  2HZD A;  3WTW C;  2CMP A;  2UV1 A;  4E7S A;  1TC3 C;  3IH2 A;  2HXO A;  4RB2 C;  3HEF A;  5A2Q K;  3C2H A;  3I59 A;  3HM5 A;  3KEO A;  1JT0 A;  1I6X A;  5FKM A;  4ZC3 A;  3R0A A;  4A3D J;  6PAX A;  1Y8R B;  5E8I A;  1BIA A;  1O4X A;  4LLN A;  3W2V A;  2QYO A;  1JT6 A;  2R7R A;  3U1K A;  2GA2 A;  3G3Z A;  1P2F A;  1QBJ A;  2O3F A;  2X51 A;  4F93 B;  2DCE A;  3S8P A;  1F1Z A;  1SVL A;  1KA8 A;  4C3H J;  2NNY A;  3FK6 A;  2KIQ A;  3B6A A;  1IZ1 A;  1TNS A;  1TWG J;  2NXN B;  1I1S A;  4UUS B;  5CJ9 A;  2KFD A;  1RI7 A;  3ZMU A;  3VOD A;  1W36 D;  1A6Q A;  3CJQ B;  2B63 J;  4YII A;  4HYE A;  5ICE A;  5AON A;  2VQC A;  4OAZ A;  2HVS A;  1KU9 A;  2HDD A;  4LG3 A;  4HF1 A;  1FYK A;  3S1M J;  1WJ5 A;  1FOW A;  5FB2 A;  4U7D A;  4A12 A;  4XLN F;  3JRD A;  1YOV B;  1WH5 A;  2CJJ A;  2Y0M A;  4XLF A;  2QA4 I;  1FBQ A;  1B72 A;  1EH7 A;  1ENH A;  1YX5 A;  2FBK A;  2VLA A;  2R5Z B;  2HTS A;  2FMY A;  3K69 A;  4FT8 A;  4N4O B;  3BG9 A;  1FWZ A;  5KAF C;  4M73 A;  3GF2 A;  5D4R A;  4MEY F;  4RAG A;  2LYC A;  4AU7 A;  4R8H A;  3S3N A;  1WPK A;  2XAG A;  1HKS A;  3BQY A;  3K4N A;  2JA5 J;  5JHF A;  2B9S A;  1R4N B;  2F6C A;  1UG2 A;  3VFZ A;  1P4A A;  2ZJQ F;  4FE4 A;  3EPZ A;  3KE2 A;  4LFU A;  1G4D A;  2M7B A;  2W1O A;  4YRV A;  1DPU A;  3V42 A;  1OJL A;  1LFU P;  3DKX A;  1EH8 A;  2CW8 A;  4BE0 A;  1FYL A;  4L9N A;  4XNF A;  3RTR A;  4LK1 F;  3W6J B;  3NRV A;  1K78 B;  3IHU A;  3FX3 A;  4N4N B;  2YX7 A;  3QQA A;  2BYV E;  2VOP A;  3H3U A;  2X48 A;  3IKV A;  3FIS A;  5IP9 J;  5IT3 A;  1YW8 A;  3GFM A;  5FD5 A;  2VBX A;  5K5R A;  3M3Y J;  1XCV A;  4D5F A;  3OYN A;  4KN7 X;  3JR9 A;  5HLG A;  3DPL C;  5CPR B;  2STW A;  4A3K J;  4M3B A;  4RM2 A;  3IV5 A;  3PQK A;  3L2V A;  2LG4 A;  3GZ6 A;  5LBQ A;  1D0X A;  1YFH A;  1O3Q A;  1JI8 A;  4HW0 A;  5GAH J;  3PUF A;  3DPU A;  3GFI A;  1V54 H;  2LLK A;  3VB2 A;  4DQ2 A;  2OCC H;  3EYI A;  2V1N A;  2ELH A;  3DBR B;  1OCP A;  1J09 A;  2RC4 A;  3CO7 C;  1MSF C;  2LKP A;  3RKY A;  3BQZ A;  1OPC A;  4Z2Y A;  2RNJ A;  1Z6T A;  2Y31 A;  4UB8 C;  3MCZ A;  2L9V A;  4HRI A;  2MLG A;  2V26 A;  2WBM A;  4G9Y A;  2QQA A;  2HVQ A;  3F8M A;  3K1N A;  1I3A A;  1WJA A;  2WAE A;  3I4M J;  2STT A;  3H9J A;  1WJE A;  4KIT B;  2UWM A;  4IOA F;  2H8R A;  3ML6 A;  4XN3 A;  3U1D A;  1WI3 A;  1IN4 A;  4NHJ A;  4G12 A;  1FPQ A;  2I5U A;  2ESN A;  1T33 A;  1YJ9 I;  2XF7 A;  3PSI A;  2JA7 J;  1B59 A;  3JRI A;  1A31 A;  3KX2 A;  1LKX A;  1IG7 A;  4MTD A;  2L0K A;  2LBF B;  2M3A A;  2QWW A;  4EGY A;  1R1V A;  1LDJ A;  5CQE A;  5TJJ A;  3S2H J;  4DNC A;  2W82 A;  5LHH A;  3G1M A;  1Y6I A;  2P6T A;  1V4R A;  3RKX A;  2O8X A;  2XSD C;  4BAY A;  3M1E A;  1FBU A;  3L2C A;  3BR5 A;  4C9Y A;  3V8K A;  3GZ5 A;  4EGZ A;  3MN2 A;  2CRG A;  4ENJ A;  1LPQ A;  3E6M A;  5LHI A;  1R58 A;  1U9O A;  3OY9 A;  3CCM I;  2Q8K A;  1HQC A;  1X2M A;  2IS4 A;  1UMQ A;  1YS6 A;  2VBZ A;  3ZMS A;  3IAS 2;  2NOG A;  4WXC A;  1QZZ A;  2X85 A;  3QAH A;  1WFX A;  1XD7 A;  4C2M J;  2P4W A;  1Y8Q B;  1D1B A;  1V3F A;  2EZH A;  2K40 A;  2WB1 A;  3HJE A;  4RGR A;  4A3M J;  3OL4 A;  1TP4 A;  5BS6 A;  1BJA A;  4HX7 A;  2IAI A;  1Z6R A;  2XKO A;  5H20 A;  3F8N A;  3QPT A;  3VSL A;  4XRS G;  2IVM A;  2ME6 A;  3V4G A;  1Z7U A;  3NQO A;  4IVN A;  3CZ6 A;  2XV4 S;  3IWF A;  3F8F A;  3OYL A;  5D8K B;  4CCM A;  3H3V K;  3IH4 A;  4HZF A;  3K70 D;  1SFU A;  1Y56 A;  2EV0 A;  2JUG A;  3WU2 C;  1BJZ A;  2KRH A;  3GTJ J;  1U6G A;  3WTU C;  2HQN A;  4RAF A;  1ON2 A;  5GAE J;  5KHD A;  4AVP A;  3E6D A;  4KDP A;  2CUJ A;  1BI3 A;  3FXU A;  5IY5 H;  3J7Z I;  2IT0 A;  4KIF A;  2RRE A;  1L0O C;  3J80 Z;  3CC4 I;  3P9C A;  2KIU A;  3MKW B;  4GGG A;  1YJW I;  1FOY A;  1IDY A;  2RV8 A;  3LSI A;  4AIH A;  3OYM A;  1D8J A;  2JJ7 A;  4FX4 A;  3SFI A;  1UCR A;  1QHH D;  2MSY A;  2BE5 F;  2YR2 A;  2LSO A;  1JJ8 C;  4CDG A;  3W6V A;  5IOY A;  1WGX A;  2PN6 A;  5B1A H;  1PP7 U;  3CCR I;  3FKI J;  3PQJ A;  1FIP A;  2LP0 A;  4XON A;  1MH4 A;  3WOD F;  4A93 J;  3HOY J;  4BHP A;  2KT0 A;  3BJA A;  3SEQ A;  1W7P D;  2EQR A;  1W7P B;  4IQJ A;  3LL7 A;  3C2B A;  3TP3 A;  4O3M A;  2I10 A;  5F27 A;  3CLO A;  2OQG A;  5B5E C;  5TRD A;  4PJL A;  1D0Z A;  2LRD A;  4PJM A;  2QQB A;  3MKY B;  1T39 A;  1IN8 A;  5E3N A;  2OF7 A;  4GFB A;  2JN6 A;  2W85 A;  2JSP A;  2MAB A;  3TOB A;  1JTX A;  3SZG A;  2DW4 A;  4B48 A;  1R7J A;  3BZ6 A;  1T56 A;  4E6K G;  3DBH B;  3HKZ A;  2ZJP F;  4WXH A;  2OV7 A;  3KP3 A;  3HHH A;  4P96 A;  2DMN A;  4IRH A;  1B9M A;  1JUP A;  2GXG A;  4JX6 A;  1TNT A;  3E7L A;  4KMU X;  4GYI A;  2HOS A;  5DS9 A;  3T0Y A;  2H6C A;  4WF2 A;  1DUX C;  2QLZ A;  3DBL B;  4IXA A;  2R7T A;  2F4I A;  1U5T A;  3K4L A;  2HGC A;  3GFJ A;  1ZGA A;  1A35 A;  1R71 A;  2D1V A;  4EVI A;  2WAQ N;  3DKY A;  3ZQG A;  4U0V A;  2ZNZ A;  1YW7 A;  5EEG A;  1LJ9 A;  2H09 A;  5HOD A;  2VXD A;  3FIW A;  3LFU A;  2MD0 A;  3OL3 A;  4EMS A;  2WB1 N;  3GW2 A;  4MHG A;  3WHB A;  4BH9 A;  1Z0X A;  1JGS A;  2DMU A;  4IHX A;  2JWT A;  3GTO J;  1AA7 A;  5E18 F;  5DDG A;  2K7L A;  3CD6 I;  2A6H F;  3M8E A;  3PNV A;  2HS5 A;  5LRS A;  4OIP F;  4BY1 J;  4XKV A;  2QKM B;  2XHK A;  5EGO B;  1Q1H A;  1GDT A;  1V5F A;  2B7E A;  2MBF A;  5DUK A;  2W25 A;  1I1G A;  1KU3 A;  1TZL A;  3CME I;  3FF5 A;  3ECH A;  1V55 H;  1BM9 A;  4IRI A;  1Z21 A;  2L7Z A;  1VQN I;  1ZEL A;  2BY0 A;  4D9J A;  1FT9 A;  3M1C A;  4HV6 A;  2H1K A;  1R1T A;  4M9S A;  1O3S A;  3F9K A;  2EFO A;  2EFP A;  4RMN A;  1ZR2 A;  5ILS A;  2V6C A;  1ONV A;  3WTT C;  4M3D A;  3DLA A;  4G7H F;  4ZYG A;  2CYY A;  2V7F A;  2GIV A;  2XAU A;  2DT5 A;  1I27 A;  4U7B A;  2A5Y B;  2XAH A;  2O6G E;  4A0X A;  3BRO A;  1E3P A;  4NBQ A;  1SAX A;  3CUQ B;  4LB5 A;  1ZH5 A;  1TQI A;  3CMA I;  4AM3 A;  3S2D J;  1HKT A;  5H6Q A;  4HBL A;  3CJN A;  2HDW A;  1MDM B;  1D8K A;  1EH6 A;  3MZH A;  4ASN A;  3E97 A;  2CUF A;  3G1O A;  1BR1 A;  2XPW A;  4CYC A;  4U88 A;  1IRX A;  3SHF A;  2E2J J;  2R5Y B;  4LLG F;  2LRE A;  3H3Z A;  2L3D A;  2WY7 Q;  3S2W A;  1I3Q J;  4PJJ A;  5EEH A;  2R92 J;  1BR4 A;  1J59 A;  3HGY A;  2BW3 A;  4E70 A;  3AL0 B;  2M2E A;  1G3W A;  1U5T C;  1OCT C;  2EPF A;  1SD5 A;  4K2E A;  1UST A;  5LFA A;  4BUP A;  4BQN A;  2BGC A;  1N77 A;  2HQR A;  3L7W A;  4ENN A;  2R7U A;  2NS7 A;  4BS9 A;  1MJA A;  1P92 A;  5D5U B;  4XKC A;  2QBY B;  2XIG A;  1FMW A;  5FRM A;  3KLN A;  3G6E I;  3FM3 A;  5ICG A;  3CCY A;  2DT6 A;  3CTA A;  1MGT A;  1T2K A;  2HTJ A;  4DW6 A;  1GHC A;  2D2W A;  4I99 C;  3BTJ A;  4HOB A;  4OIR F;  1Z7L A;  4G6D A;  3ZQF A;  2E36 A;  4A0Y A;  2XGD A;  1F5T A;  1IGN A;  2NVX J;  1QZE A;  1ODD A;  1WHU A;  4KT6 A;  4A5M A;  2HKO A;  2UXX A;  2BY1 A;  1W0U A;  2A07 F;  2Z33 A;  2BXZ A;  2J5O A;  3BC8 A;  5LGU A;  2VOO A;  5HDN A;  5KNL A;  3K1P A;  3J80 K;  3VSK A;  3P5J A;  2DU9 A;  1OCC H;  3K1M A;  2XSJ C;  4KT5 C;  1QHG A;  1WKM A;  4MLO A;  2PBI A;  3WG9 A;  3M07 A;  3TBI A;  2RQP A;  5L3E A;  3HOT A;  1F4K A;  4OWR B;  2DA7 A;  1MIJ A;  1FNN A;  2R7Q A;  2A5W A;  2KDZ A;  1OCR H;  2IPQ X;  1DU6 A;  3E5Q A;  2X1C A;  2K3P A;  3HTS B;  1VQ7 I;  4Q5S F;  3QU3 A;  4BXU A;  1JXS A;  3H36 A;  1RR7 A;  3CP8 A;  2TRT A;  2FE3 A;  1GV5 A;  1GVJ A;  3GME A;  2VT3 A;  4M9X A;  2FBH A;  2GXB A;  3G71 I;  2ESH A;  2CSO A;  3WTY C;  3LSH A;  4U0Y A;  2E1C A;  3KLO A;  1H88 C;  2K3F A;  1USS A;  2EIJ H;  4G8X A;  4EJU A;  5HLH A;  3BR1 A;  1B4A A;  1IXR C;  4YG2 F;  5ILV A;  4KNY A;  3NAU A;  2PMU A;  1OFC X;  5LRR A;  4ENK A;  2XAF A;  3HRM A;  3OYA A;  5GAD J;  3MAJ A;  4CO8 A;  2FU4 A;  3ONQ A;  5F64 A;  4BE1 A;  4Q47 A;  4G7O F;  1IRF A;  2E5Z A;  1JHF A;  5IOZ A;  1DPR A;  3CF5 F;  4D0P A;  2WA0 A;  1RRJ A;  4LMY A;  1ZGJ A;  3CJR B;  3F21 A;  4IHW A;  1CGP A;  1OIS A;  3BT9 A;  2X6Y A;  5D6F A;  1MZB A;  3ZCO A;  3VPR A;  2L9R A;  4JP0 A;  4D7N A;  3JRF A;  4H4K C;  2FML A;  1VZ0 A;  3ESW B;  3UR3 C;  4B44 A;  3ABK H;  3JRG A;  4EJO A;  2R7F A;  3HOX J;  4XQF A;  2HKX A;  2K5C A;  2ID6 A;  2O0Y A;  3OYK A;  1ZLJ A;  2VN2 A;  3BR0 A;  5DTD A;  2ISZ A;  3ZN0 A;  2P5L C;  3S1R J;  2XRO A;  1CQT A;  3HTU A;  1GXQ A;  4AIJ A;  4L5J A;  4JK1 X;  1FIA A;  2CH0 A;  5FKN A;  2RN7 A;  2JA2 A;  4OMZ A;  4QSH A;  1FX7 A;  4MFD A;  5EYR A;  2M4G A;  1GLN A;  2E1M C;  2Q2E B;  2XAS A;  4G7Z F;  5K7F A;  4M9Z A;  1ETW A;  3VYR B;  5M3F J;  2NS8 A;  1G3Y A;  4XK4 A;  1SVO A;  5TIS C;  2Y0S A;  1D1A A;  4UUS A;  2ZNY A;  5LEK A;  3MFK A;  5F6F A;  4PJ0 C;  1IV6 A;  1IN7 A;  3ASO H;  3WG7 H;  3HIF A;  2NYX A;  2WY8 Q;  1MSE C;  2CS3 A;  3ZQI A;  3LQR A;  3CMY A;  3KZZ A;  2AHQ A;  3QP6 A;  2LKX A;  4E7J A;  2E60 A;  1WRJ A;  3Q0W A;  1YIT I;  3GEZ A;  1YTY A;  2Y9Y A;  3TMO A;  1IO2 A;  3LSJ A;  4F55 A;  2M45 A;  4CZC A;  3F6V A;  2O5R A;  2EV5 A;  5K7Z A;  2R5Z A;  3CC7 I;  2X1E A;  2JUC A;  3I4P A;  2PMZ N;  4KJZ A;  5DM7 F;  3KIO A;  1OKR A;  2VAS A;  3S32 A;  4RAZ A;  4OU0 A;  3FBN B;  3SYT A;  2DYS H;  5J47 A;  3CCV I;  5E1X A;  3V7R A;  5AIP A;  4XRM A;  4UV8 A;  4GO1 A;  2Z16 A;  3S3O A;  1P4W A;  3QYF A;  1D3Y A;  4RB1 A;  3W6K B;  2MH9 A;  3HPH A;  3M9A A;  3PFY A;  5GP9 A;  1ZQ3 P;  3CDL A;  3IKT A;  3H9G A;  5J8F A;  4JX5 A;  1S7E A;  1QQI A;  2ECC A;  5BOX A;  4ZTJ A;  1TWC J;  1WCM J;  1XMX A;  4O5V A;  5IP7 J;  4I6Z A;  1Y1W J;  1HSJ A;  1QPM A;  2G0E A;  3VEP A;  3UKG A;  1K78 A;  2RDP A;  2KZG A;  1PVE A;  1U0J A;  4IZZ A;  4RM3 A;  5K7H A;  3CCE I;  5J40 A;  4QPO A;  1VQM I;  1H9T A;  4WK8 F;  1NG7 A;  1O7F A;  1OYI A;  2FBI A;  3JRB A;  3F72 A;  2MGQ A;  1MBG A;  1BC8 C;  1E17 A;  4PZJ A;  2DMP A;  3TQN A;  4M71 A;  5JI6 A;  3V7C A;  5E17 F;  4A69 C;  4ZZL A;  2RNG A;  3M7G A;  4M72 A;  5HDG A;  3TKY A;  1ETK A;  2IGK A;  2JMW A;  2M0M A;  2XB0 X;  5E20 A;  4DYR A;  1YIJ I;  1XDS A;  4M3G A;  2DA6 A;  1B8I B;  2BOL A;  5EG0 B;  2OZU A;  3S14 J;  1ON1 A;  2DA3 A;  2X4H A;  2Q0O A;  2R7X A;  1T6S A;  4L0Y B;  1YLF A;  3FK7 A;  1UG0 A;  4IHY A;  1PDN C;  2VE8 A;  2P0W A;  4PUS A;  5LLQ A;  2EIK H;  2DFE A;  4BJ6 C;  3VYS B;  2BHZ A;  1E3O C;  4LB6 B;  3S93 A;  3G73 A;  1FP1 D;  4NNJ A;  5K5O A;  3IL2 A;  2H27 A;  1X3Z B;  5E8G A;  2AXT C;  3JTG A;  1NG6 A;  4HAM A;  2R7W A;  3ZMV A;  2NRA C;  2WTE A;  4ZYD A;  1MMG A;  4ESJ A;  2X6O A;  2Y0S N;  2CQ7 A;  4A3G J;  2CW0 F;  2E19 A;  3JTH A;  1QNT A;  3K7A J;  4II3 A;  4FET A;  3BWG A;  1HCR A;  1KU7 A;  3NEU A;  1J5Y A;  1CF7 B;  1MBK A;  2M5W A;  2Z5U A;  1FOK A;  1ORK A;  5HNH A;  2O03 A;  2QF7 A;  1O3T A;  4A3L J;  1LUJ B;  1S8N A;  2Y75 A;  1UAA A;  1YG2 A;  1BA5 A;  4P1W A;  3B02 A;  2DQR A;  3OYG A;  5GPC A;  5H6R A;  5D6E A;  2VI6 A;  1HDP A;  3QOE A;  3IWZ A;  2FXA A;  5HS8 A;  1X1C A;  3ZGK A;  1OLT A;  3WTV C;  3BJ6 A;  3R61 A;  4QWQ A;  3VOE A;  3K4C A;  3R60 A;  5B66 C;  1MW7 A;  3RQI A;  5CLS A;  1SD6 A;  2DAO A;  1L3L A;  1W1W E;  3HOV J;  2DA4 A;  1X2N A;  5FO5 A;  4IX7 A;  5C3E J;  3DLL F;  3T5X A;  2HVR A;  2KP6 A;  1S9H A;  3DXJ F;  3WTZ A;  1XX5 A;  3KP7 A;  4BL0 B;  1IRG A;  1RUO A;  1FMV A;  2K9M A;  2XAQ A;  3E6B A;  2NVY J;  3VDX A;  3HOZ J;  4OIO F;  3CCJ I;  2EZI A;  5L3G A;  1U8R A;  2HPM A;  3CLQ A;  2L5Q A;  3LSP A;  4HQM A;  1H8A C;  4BDZ A;  2C6Y A;  2LD5 A;  4RLQ A;  1HST A;  4MTE A;  4LG0 A;  4DBR A;  4E7L A;  2V1X A;  4IL6 C;  4FE7 A;  4XLC A;  5J1R A;  4Q48 A;  1OCO H;  1T98 A;  1BBY A;  1MNM C;  3GTM J;  3ABL H;  4Y33 A;  1XS9 A;  2FF4 A;  3F23 A;  4BGD A;  4Y3O A;  3SDG A;  5CVI A;  4UVB A;  4XBF A;  1Z3X A;  1OR7 A;  1X1P A;  2DOD A;  5FRN A;  3LMM A;  5L3D A;  1YRN A;  1T8I A;  5ICF A;  1XC5 A;  4XL9 A;  1BL0 A;  3K2Z A;  4DYC A;  3BY6 A;  4IRG A;  1UJ8 A;  3KET A;  2E35 A;  2VXZ A;  4E4H A;  3SEZ A;  2CFO A;  2FSW A;  3A0B C;  3HBL A;  3RKW A;  1WJB A;  1R23 A;  1FJL A;  3I59 B;  1AHD P;  1ZAR A;  3D5S C;  1LVK A;  4WCG A;  3AG4 H;  3BCB A;  4N9I A;  4FX0 A;  2KPM A;  3FXK A;  3CF2 A;  2L9N A;  3LNQ A;  1V5G A;  3JW4 A;  3KYD B;  1X1B A;  2KRF A;  4L9T A;  4RBO A;  3QU6 A;  4EJT A;  3LA7 A;  4DZJ A;  2OA4 A;  3J81 Z;  1VQ8 I;  3G1L A;  1MKM A;  1YI2 I;  2Z9O A;  2L7K A;  3GLL A;  2OQR A;  4HQE A;  3BZK A;  1P7J A;  1W7P A;  3KZY A;  2OTJ I;  4P9F A;  4ETS A;  3DEW A;  4MIM A;  2MFZ A;  2YUS A;  1U78 A;  1XDU A;  3GCM A;  1GV2 A;  1YYV A;  4GCV A;  4B3X A;  2NVT J;  3A2K A;  4GXO A;  5FFX A;  1EJ9 A;  1QVU A;  5LGN A;  5E79 C;  4LIU A;  3N4M A;  2A6T A;  1G6N A;  3AAF A;  1B72 B;  2DFF A;  1P6R A;  3HSR A;  3BDD A;  4XOP A;  4YEL A;  3TED A;  3BOQ A;  1S29 A;  3A01 B;  4CGZ A;  3K70 C;  1KYZ A;  2L7M P;  5K1Y A;  5DD4 A;  1U3E M;  2EFN A;  5IYC J;  2DPD A;  1TWF J;  1Y0N A;  4YFK F;  1MJB A;  4HST A;  1OR7 C;  4PGH A;  1R22 A;  2LMD A;  1DGW Y;  3DTE A;  3TO9 A;  2V79 A;  1ETX A;  5J6X A;  2R0Q C;  1R6R A;  1U2W A;  3HUG A;  2W7N A;  1ZGW A;  1ZLK A;  2R7V A;  2PJR A;  1NHA A;  2IW5 A;  4UV9 A;  1DP7 P;  2Q1Z B;  4LGW A;  2JA6 J;  3MD2 A;  5FFZ A;  3U21 A;  2ELK A;  1X3W B;  2W48 A;  5FKO A;  1LFB A;  3KEQ A;  3ZN1 A;  5IP6 A;  3F6O A;  3QPH A;  1MBF A;  1AKH B;  2DOF A;  1I39 A;  2B0L A;  1N78 A;  4B8X A;  3S17 J;  4V2F A;  2O61 A;  1ZRD A;  4A0Z A;  5HS9 A;  2IGM A;  4MGR A;  2KMU A;  2XGX A;  1LQ1 A;  4FIS A;  4ABZ A;  4HF0 A;  2QSG X;  3OR1 C;  2EBI A;  3KP5 A;  3WTS C;  3BPV A;  2DFI A;  5EGO A;  3PO2 J;  1PJR A;  1S7A A;  1VTN C;  4KIS A;  4J19 A;  3JRH A;  1K4S A;  2CUZ A;  3RQ4 A;  1F9N A;  3ERE D;  3IAM 2;  2FOW A;  2J5P A;  3KP4 A;  4IQ4 A;  3H1C A;  3S15 J;  3DPT A;  2Z99 A;  3ELK A;  4HEA 2;  2BZT A;  2X6X A;  3MKL A;  3MWM A;  3L1P A;  2PI0 A;  4BBR J;  1LE8 B;  2CG4 A;  1IUF A;  2VON A;  2DO7 A;  3TDZ C;  4BYY A;  3OYC A;  2MH2 A;  5EDN A;  2DTZ A;  4NC7 A;  1KQ0 A;  1FTZ A;  2PMH A;  3K2A A;  1MDM A;  2A68 F;  4Y52 J;  3L9F A;  2DLL A;  1S7O A;  3F0C A;  2ZSI B;  2ZSH B;  1RKT A;  1HOM A;  1IW7 F;  2ISY A;  1PUF A;  4LD5 A;  4CCK A;  1VND A;  2WAD A;  4OOI A;  3ZMD A;  3KP6 A;  5D5V B;  1SC7 A;  3MQ0 A;  1GXP A;  2EWN A;  2QKL B;  5IYD J;  2VE9 A;  1TQP A;  1J2X A;  3L2U A;  3DTK A;  2FJ1 A;  2OD5 A;  5IPA A;  1VQ4 I;  4WX9 A;  3FMQ A;  2VT2 A;  3C2G A;  3M8F A;  2F5E A;  2DYR H;  2OCE A;  3HHG A;  3DF8 A;  3LAP A;  4ZTF A;  5TGT A;  1EKE A;  2G7H A;  3I54 A;  1U8B A;  1WQ2 A;  3MMY B;  3EUK L;  3IRQ A;  1D0Y A;  3H0D A;  2TCT A;  1OYW A;  2EK5 A;  2LKS A;  3MVP A;  4GYG A;  2F4O B;  3EQL F;  3AFH A;  2VBY A;  3LSR A;  3I5U A;  2NVU B;  2FUG 2;  4A3I J;  2DTR A;  1YX3 A;  4C2T A;  1BW5 A;  4HA8 A;  3OSF A;  3BJO A;  5JHU A;  2ETH A;  3HPG A;  2HNH A;  1MMA A;  4UY8 I;  3GTG J;  3FKJ A;  1ZYR F;  5FLX Z;  1NH3 A;  3HRU A;  2IS2 A;  1APL C;  1LEA A;  1X3U A;  1FEX A;  3DEU A;  2BVL A;  3ZR8 X;  5JR3 A;  2QEN A;  3WGI A;  4BXX J;  1VQP I;  1C0W A;  2ZO4 A;  2AQE A;  5FLM J;  2VKH A;  3OR2 C;  5GTH C;  4ENM A;  3TL4 X;  2LY2 A;  4I01 A;  4MO7 A;  2X6W A;  3DQV C;  4BY7 J;  3AG1 H;  2DDA A;  1OCZ H;  2KJC A;  4CHU A;  2CU7 A;  3HXL A;  1QU3 A;  3VYU B;  3LA3 A;  2FA5 A;  5EZH A;  2PFB A;  2M7A A;  5F1R A;  2BVM A;  3BTC A;  4QPQ A;  4L9V A;  1X1A A;  2Y69 H;  2EFW A;  4WWC A;  4B43 A;  1FOX A;  2MC3 A;  5KVR A;  5FKK A;  2JRM A;  3D0S A;  3J81 K;  2JPC A;  1IDZ A;  1VFC A;  4XRS A;  1TT5 B;  3T1B A;  2OAZ A;  4PDK A;  4PFP A;  3BCA A;  4XLH A;  3Q3S A;  2D1H A;  5CQG A;  2P5K A;  2VL8 A;  1WJF A;  2L54 A;  4P9U A;  1QGP A;  5M5W J;  1FLI A;  1ACI A;  4F92 B;  2V6E A;  2PQ8 A;  2KHM A;  5EZG A;  4PSW A;  4OMY A;  2M9H A;  2JK3 A;  4CXF A;  2V9P A;  1EV7 A;  2ZC2 A;  4N9H A;  4AYB A;  4F7Z A;  3IRR A;  2K9N A;  1JKR C;  2YPR A;  4XIC A;  4HF2 A;  2VPL A;  2GQQ A;  4CYD A;  3I64 A;  1R5I D;  1NK3 P;  4HSR A;  3QPL A;  4ZYH A;  1XGM A;  1QA6 A;  3LSK A;  3BG7 A;  2XB5 A;  4MQ9 F;  5CKT A;  5M3M J;  4I09 A;  2ZXW H;  4EM1 A;  1X19 A;  1ETQ A;  3DFG A;  1XSD A;  1S5L C;  2DMQ A;  1J7K A;  1XTA A;  1ZR4 A;  3PIP F;  4ZYE A;  3HRS A;  2ELJ A;  3HC7 A;  5ERI A;  4KIG A;  5CVJ A;  5DUI A;  5IT9 Z;  2RVC A;  3HKZ N;  3SDB A;  2VBW A;  2IA1 A;  2XF5 A;  3K9T A;  3PO3 J;  2DBB A;  3BG3 A;  2R7O A;  2KJB A;  5FKL A;  3F8C A;  2DJI A;  3DEE A;  4HX8 A;  2VOD A;  4G6Q A;  1T95 A;  2ZBK A;  3GWZ A;  5DCF A;  1AWC A;  4PCQ A;  2ZFU A;  4F91 B;  1H89 C;  2A6E F;  4I98 B;  1R36 A;  2JVH A;  2EB7 A;  3TO6 A;  2DPU A;  2QGU A;  5C4J J;  2DFH A;  4JQF A;  4BQO A;  3R6S A;  1IN6 A;  2BY2 A;  4CCN A;  1KU2 A;  3GZN B;  4M3E A;  2FQ3 A;  2GBY A;  3E6C C;  1FBS A;  3NWT A;  1K4T A;  4P55 A;  1NTC A;  3JRA A;  2R7Z J;  2EH3 A;  4BU2 A;  1P4X A;  2GA1 A;  3JAM Z;  3F8B A;  3U2R A;  2FQ4 A;  1IXC A;  5BPI A;  2E1O A;  4HLX A;  1MBJ A;  9ANT A;  4EQQ A;  3CCQ I;  3KYL A;  5L3B A;  2MW8 A;  4EJV A;  3ZQH A;  4AID A;  4QLC U;  5ICC A;  1VQ9 I;  3PSF A;  2HR3 A;  2AXL A;  1ULY A;  2M34 A;  2UUZ A;  3H9Q A;  1BI0 A;  1X58 A;  3CQZ J;  1ZAO A;  3BR6 A;  2DMT A;  4TV7 A;  2HQA A;  4II2 A;  2DJN A;  3FBI B;  5D5X B;  2QEX I;  4CH7 A;  4NC6 A;  5F04 A;  3I71 A;  1IXS B;  2FEZ A;  4BKX A;  3QP5 A;  3CDI A;  4BEH A;  4XID A;  3QYB A;  1W5S A;  3QPS A;  3H5N A;  3TDU C;  2ZME A;  4LLL A;  1SMT A;  4HLY A;  3GTP J;  2ZFW A;  1PP8 F;  1JJ6 C;  1YW9 A;  4BBS J;  2VJJ A;  2ICW G;  4HPQ A;  4XSZ F;  1ETO A;  1HC8 A;  1MJ9 A;  4AYB N;  2FNP A;  3BTL A;  5FLX K;  2EIM H;  1AOY A;  4LJZ F;  1IV8 A;  4NQW B;  1U9N A;  4O6J A;  4CYC B;  1HDD C;  1B8I A;  4X6A J;  3GO5 A;  4A6E A;  4E7I A;  1WJD A;  3H5A A;  2JT1 A;  5HDK A;  2BW3 B;  1YO5 C;  4DOZ A;  1SFO J;  3QWL A;  1K61 A;  2XUB A;  2V1U A;  3FM5 A;  3K4K A;  4OIN F;  5E3L A;  2BBY A;  2JQ7 A;  2GLO A;  3IH3 A;  3T8R A;  5L3F A;  1UEL B;  3HYI A;  3DU6 A;  4OAY A;  4ZDL A;  1T38 A;  1TWH J;  4JBA A;  2XGE A;  4CA0 A;  1VQO I;  1Z3Y A;  4L0Z B;  4AD9 A;  2P6S A;  1QPI A;  4DIQ A;  2MG4 A;  2Y9Z A;  3OV8 A;  1YS7 A;  4L5E A;  5DM6 F;  2EFQ A;  4Q4Z F;  4YFX F;  2G7U A;  2QQ9 A;  1KZH A;  4IHV A;  1ZG3 A;  4BJT A;  2XRL A;  4FHT A;  2HYG D;  4BHB A;  2QQ8 A;  2KDO A;  5DCM B;  3EET A;  4MFE A;  2Y2Z A;  2LK2 A;  2RKH A;  2EA4 A;  3EDP A;  3ZXS A;  2BHY A;  3RZD J;  1VI0 A;  1UFM A;  5HS7 A;  3CO6 C;  1PUE E;  2WWY A;  4W97 A;  3ZP5 A;  4RS8 A;  2ZME C;  2F4M B;  1HW5 A;  2L4A A;  1KQ9 A;  3T8T A;  3DV8 A;  3SXY A;  1TBX A;  1RUN A;  3V8J A;  2AQF A;  3WGH A;  4I02 A;  1A04 A;  2ME0 A;  1MD0 A;  1O3R A;  1VQ6 I;  4UHT A;  4XOT A;  2LOO A;  3ZMT A;  1TWA J;  1WSU A;  2E1M B;  3OIQ A;  1RPW A;  3U9G A;  2KQR A;  3PNY A;  2ZKZ A;  2GZW A;  1TT0 A;  2X0L A;  1YHQ I;  2W4S A;  4XMY A;  3L2Q A;  1FP2 A;  2FX0 A;  2HPI A;  1Y39 A;  2VPR A;  5F08 A;  1W5T A;  2QSF X;  4A2U A;  4CCL A;  4ESF A;  3D1N I;  3KYC B;  1Z9C A;  3I0T A;  4CZZ A;  1D5V A;  5IT9 K;  2LH9 A;  2DT7 B;  4HG2 A;  1XGS A;  2JSC A;  2LFB A;  3GBG A;  2MA3 A;  3DU5 A;  1H9G A;  2XVC A;  1K79 A;  1LDK B;  1LVA A;  2E71 A;  5M5X J;  1SFK A;  3MKZ A;  1HF0 A;  1TTY A;  1B9N A;  4ZZD A;  3ISP A;  5LHG A;  4JX4 A;  4AUX A;  5EJC A;  1QRY A;  4IF4 A;  2X9D A;  3GVA A;  1GUU A;  1BC7 C;  3HG9 A;  1VQ5 I;  2IJL A;  4UB6 C;  5LGT A;  5CVV A;  2E2I J;  2QUF A; 
#chains in the Genus database with same CATH homology
 3HSF A;  3C3W A;  2AS5 F;  2V1D A;  4NB5 A;  2P7C B;  3JAM K;  3B73 A;  1ZRC A;  4ZH4 F;  5J8C A;  1LNW A;  2L02 A;  2PG4 A;  4N0B A;  1IN5 A;  4A6D A;  3O6B B;  1ZG5 A;  1XGO A;  1T0F A;  1Y0U A;  4RGS A;  1DDN A;  1REP C;  3RIR A;  2ADU A;  4U0W A;  2PEX A;  4KUM A;  2JPB A;  3FZV A;  2R7D A;  4B09 A;  1HBX G;  1JE8 A;  3E5X A;  4LK0 F;  3GFL A;  4PGG A;  2Z3Y A;  2BEO A;  4S04 A;  2BV6 A;  3TOA A;  2UXN A;  5CVR A;  2NAZ A;  1S6L A;  5BQT A;  3SFZ A;  1XSX A;  1O57 A;  1BI1 A;  4WXD A;  4S05 A;  4Y13 A;  3JSO A;  1W4M A;  2QM3 A;  2JRT A;  3IC7 A;  3ROU A;  4HX4 A;  4IHS A;  1KQ8 A;  1KYW A;  1YQA A;  4KN4 X;  2QZ8 A;  3C18 A;  5CYV A;  3LST A;  3REO A;  1TLH B;  4UNO A;  2G9W A;  2ZCW A;  2Y48 A;  3H92 A;  3RPQ A;  3HOS A;  2IA0 A;  1E2X A;  4M6X A;  3SZP A;  2MLK A;  4EM0 B;  1ZG1 A;  2DQL A;  3PFI A;  3WGG A;  2DK5 A;  3RYR A;  1BN5 A;  3KCC A;  1R1U A;  3OOP A;  3FHZ A;  2K4J A;  2EA2 A;  2HOE A;  3O2P E;  2HZT A;  5HOO A;  3BPX A;  1K7A A;  3HSE A;  3EYY A;  2H94 A;  1J0R A;  2K02 A;  2M1B A;  2OBP A;  3EUH A;  1XN7 A;  2LDU A;  2KIM A;  5AIQ A;  3FWE A;  4I2O A;  3C7J A;  4Y15 A;  4RAY A;  4UXN A;  3CUO A;  4ON0 A;  1ZRF A;  4MEX F;  4R1H A;  4EV0 A;  3I58 A;  2DI3 A;  3LFK A;  1SFE A;  2W24 A;  3N97 A;  1BIB A;  4I0A A;  5DYM A;  2COM A;  5E1W A;  3LAJ A;  3ABU A;  4ESB A;  3P9K A;  1Z91 A;  2K4B A;  4HDV A;  4P5O A;  3LQQ A;  4LG0 B;  4KYW A;  3Q9S A;  3MZY A;  1HW1 A;  2CQK A;  4IPA A;  5JVT A;  1B1B A;  4UVC A;  3RDI A;  2F2E A;  2HEO A;  3F22 A;  1OYY A;  2IP2 A;  3F3X A;  2JZY A;  4CIC A;  2M30 A;  3CUQ A;  2E7X A;  1IUY A;  3GLX A;  3WE2 A;  2HFH A;  3P7N A;  4EJW A;  2YX4 A;  1H0M A;  1SD4 A;  5D5W B;  2IRF G;  3ULQ B;  1G3S A;  1TQM A;  3R4K A;  2LF7 A;  1Z05 A;  2QBY A;  3CDH A;  5FGM A;  1IAW A;  4L5I A;  4UUV A;  1FSH A;  3HRT A;  2W57 A;  1S3J A;  5ILU A;  3KFW X;  5LEJ A;  2WV0 A;  4L18 B;  1WWX A;  2XAJ A;  2UZK A;  2NS0 A;  2P5V A;  3SQN A;  3FMR A;  1G3T A;  3O3K A;  3QOP A;  4RGU A;  3CUQ C;  2FNA A;  4XLP F;  1QO0 D;  2E1N A;  2CFX A;  2P7V B;  5BMZ A;  2XRN A;  3WU0 A;  4MQV A;  4RGX A;  5DEQ A;  3LWF A;  3MEX A;  5DV5 A;  3WE3 A;  4HV5 A;  3LA2 A;  3L09 A;  4IJA A;  2CO5 A;  1FC3 A;  2L01 A;  2ZJ2 A;  5D4S A;  1XB4 A;  2F5F A;  2NNN A;  4XSX F;  2VC1 A;  2XKP A;  2K86 A;  1HKQ A;  3P9I A;  3Q5F A;  3ABT A;  1YIO A;  2YU3 A;  1R00 A;  2A61 A;  2MD5 A;  1LB2 A;  1FY7 A;  2ACJ A;  4OIQ F;  4AWX B;  1TW3 A;  1LEB A;  4RB3 C;  3WTX C;  3WU1 B;  3R0J A;  2V9V A;  3BP8 A;  4NQW A;  3GXO A;  3I53 A;  1HW2 A;  4RB0 A;  5K5Q A;  1FYM A;  2Q2E A;  2HWV A;  1BOA A;  3TGN A;  1UHM A;  2TDX A;  1R5G A;  1K6O A;  5HVQ C;  3L00 A;  2P8T A;  4YIF A;  1SFX A;  4I7H A;  4R79 A;  2D45 A;  2LNB A;  2EJR A;  5CVU A;  4M6Y A;  1U5T B;  5KK1 A;  5DCM A;  3ECO A;  5A2Q Z;  1Z1D A;  2FOK A;  5DD8 A;  3V7S A;  5FD6 A;  1RIO H;  2RGV A;  1ZRE A;  2EV6 A;  2A69 F;  5BPD A;  4BNC A;  2YSR A;  3ZMZ A;  3ZPL A;  1KGS A;  5HLI A;  4BHC A;  4KIC A;  1J75 A;  3FXR A;  4A5N A;  1J9I A;  1RNL A;  3QRF F;  1BI2 A;  3TO7 A;  1FZP B;  4BQA A;  4L9J A;  2PJP A;  2KIF A;  1SMY F;  2W84 A;  3GUD A;  1TW2 A;  3Q9V A;  2R3S A;  2CGP A;  1XCB A;  3DP7 A;  4M74 A;  1SD7 A;  1STZ A;  2M87 A;  5ED4 A;  2OU2 A;  2PLY A;  2OZ6 A;  2KKO A;  5D8L B;  1R5H A;  3RI4 A;  2K27 A;  3E5U A;  2H6B A;  3E3V A;  1O7L A;  3GYH X;  1LDD A;  1HXD A;  3K0L A;  4EM2 A;  3J7A O;  4XRF A;  1WI9 A;  3COA C;  3FXQ A;  3SZT A;  1XSV A;  2E7W A;  1RZ4 A;  1CF7 A;  4G94 A;  2HYF A;  3RPU A;  2ZXJ A;  4MNU A;  3C1D A;  1I5Z A;  4KFC A;  3FMS A;  4AIK A;  4UVA A;  3GX4 X;  2F5D A;  3V8L A;  4KA4 A;  1JHH A;  4YFN F;  3RYP A;  5JFR A;  1UHW A;  2M8E A;  1XGN A;  1IF1 A;  3ZQ7 A;  4HDU A;  4KMF A;  4KIB A;  1OMI A;  1B6A A;  1UB9 A;  3KP2 A;  2GWR A;  4I0B A;  2F5C A;  2IA2 A;  2WC2 A;  2FRH A;  4H0E A;  1QZY A;  2VC0 A;  1XMA A;  2GAU A;  3DKW A;  1XMK A;  1ZHF A;  1FSE A;  5E1Z B;  3D5L A;  3RJP A;  3JSP A;  5L3C A;  2DK8 A;  2JTV A;  2ZME B;  4Y17 A;  2L4M A;  2LF8 A;  2QVO A;  2HDC A;  2A3S A;  2CWE A;  1ZN2 A;  4IHT A;  3WTW C;  4RB2 C;  5A2Q K;  3I59 A;  3KEO A;  1I6X A;  3R0A A;  6PAX A;  5E8I A;  1BIA A;  4LLN A;  2QYO A;  2GA2 A;  3G3Z A;  1P2F A;  1QBJ A;  2O3F A;  1F1Z A;  2NNY A;  1KA8 A;  1IZ1 A;  1TNS A;  1I1S A;  5CJ9 A;  3ZMU A;  1RI7 A;  3VOD A;  4YII A;  4HYE A;  5ICE A;  5AON A;  1KU9 A;  4HF1 A;  1FYK A;  5FB2 A;  4U7D A;  4A12 A;  4XLN F;  2Y0M A;  1FBQ A;  1EH7 A;  2FBK A;  2HTS A;  2FMY A;  3K69 A;  4FT8 A;  1FWZ A;  4M73 A;  3GF2 A;  5D4R A;  4MEY F;  4R8H A;  2XAG A;  1HKS A;  3VFZ A;  1P4A A;  3KE2 A;  4LFU A;  1G4D A;  1DPU A;  1EH8 A;  1FYL A;  4L9N A;  3RTR A;  4LK1 F;  3W6J B;  3NRV A;  1K78 B;  3IHU A;  3FX3 A;  2YX7 A;  2BYV E;  2VOP A;  3H3U A;  3IKV A;  5IT3 A;  1YW8 A;  3GFM A;  5FD5 A;  2VBX A;  5K5R A;  1XCV A;  4KN7 X;  5HLG A;  3DPL C;  2STW A;  3PQK A;  3GZ6 A;  5LBQ A;  1YFH A;  1O3Q A;  4HW0 A;  3GFI A;  4DQ2 A;  3VB2 A;  3EYI A;  2ELH A;  2RC4 A;  3CO7 C;  2LKP A;  3RKY A;  1OPC A;  4Z2Y A;  2RNJ A;  1Z6T A;  3MCZ A;  2MLG A;  4G9Y A;  2QQA A;  3F8M A;  3K1N A;  2STT A;  2UWM A;  3ML6 A;  3U1D A;  1IN4 A;  4NHJ A;  1FPQ A;  2ESN A;  1B59 A;  4MTD A;  2QWW A;  4EGY A;  1R1V A;  1LDJ A;  5TJJ A;  4DNC A;  5LHH A;  2P6T A;  1V4R A;  3RKX A;  2O8X A;  4BAY A;  3M1E A;  1FBU A;  3L2C A;  3V8K A;  3GZ5 A;  4EGZ A;  4ENJ A;  3E6M A;  5LHI A;  1R58 A;  2Q8K A;  1HQC A;  1YS6 A;  2VBZ A;  3ZMS A;  4WXC A;  1QZZ A;  3QAH A;  1XD7 A;  2P4W A;  1V3F A;  4RGR A;  5BS6 A;  1BJA A;  4HX7 A;  1Z6R A;  2XKO A;  5H20 A;  3F8N A;  3QPT A;  2IVM A;  3V4G A;  1Z7U A;  3NQO A;  4IVN A;  2XV4 S;  3IWF A;  3F8F A;  5D8K B;  4HZF A;  1SFU A;  2EV0 A;  1U6G A;  3WTU C;  2HQN A;  1ON2 A;  4AVP A;  3E6D A;  4KDP A;  1BI3 A;  3FXU A;  2IT0 A;  4KIF A;  3J80 Z;  1L0O C;  3P9C A;  2KIU A;  4GGG A;  2RV8 A;  4AIH A;  1D8J A;  4FX4 A;  1UCR A;  2BE5 F;  2YR2 A;  2LSO A;  4CDG A;  1PP7 U;  2PN6 A;  3PQJ A;  3WOD F;  4BHP A;  3BJA A;  1W7P D;  1W7P B;  4O3M A;  3CLO A;  2OQG A;  5TRD A;  2QQB A;  1T39 A;  1IN8 A;  2W85 A;  3TOB A;  2DW4 A;  1R7J A;  3BZ6 A;  4WXH A;  3KP3 A;  3HHH A;  4P96 A;  4IRH A;  1B9M A;  2GXG A;  1TNT A;  4KMU X;  4GYI A;  3T0Y A;  2H6C A;  4WF2 A;  1DUX C;  2QLZ A;  4IXA A;  1U5T A;  2HGC A;  3GFJ A;  1ZGA A;  4EVI A;  2D1V A;  4U0V A;  2ZNZ A;  1YW7 A;  5EEG A;  1LJ9 A;  2H09 A;  4EMS A;  4BH9 A;  3GW2 A;  4MHG A;  1JGS A;  5E18 F;  5DDG A;  2K7L A;  2A6H F;  3M8E A;  2HS5 A;  5LRS A;  4OIP F;  2XHK A;  1Q1H A;  2MBF A;  5DUK A;  2W25 A;  1I1G A;  1KU3 A;  3FF5 A;  3ECH A;  1BM9 A;  4IRI A;  1FT9 A;  4HV6 A;  1R1T A;  4M9S A;  1O3S A;  2EFO A;  2EFP A;  5ILS A;  2V6C A;  1ONV A;  3WTT C;  4G7H F;  4ZYG A;  2CYY A;  2GIV A;  2DT5 A;  1I27 A;  4U7B A;  2A5Y B;  2XAH A;  2O6G E;  4A0X A;  3BRO A;  1SAX A;  3CUQ B;  4LB5 A;  1ZH5 A;  1TQI A;  1HKT A;  5H6Q A;  4HBL A;  3CJN A;  1MDM B;  1D8K A;  1EH6 A;  3MZH A;  4ASN A;  3E97 A;  4U88 A;  3SHF A;  4LLG F;  3H3Z A;  2L3D A;  3S2W A;  5EEH A;  1J59 A;  4E70 A;  1G3W A;  1U5T C;  1SD5 A;  4K2E A;  1UST A;  2BGC A;  2HQR A;  3L7W A;  4ENN A;  1MJA A;  1P92 A;  5D5U B;  2QBY B;  2XIG A;  3KLN A;  3FM3 A;  5ICG A;  3CTA A;  1MGT A;  1T2K A;  2HTJ A;  1GHC A;  2D2W A;  4HOB A;  4OIR F;  4G6D A;  4A0Y A;  1F5T A;  1ODD A;  4A5M A;  2HKO A;  2UXX A;  2A07 F;  2Z33 A;  2J5O A;  5LGU A;  2VOO A;  5HDN A;  3K1P A;  3J80 K;  2DU9 A;  3K1M A;  4KT5 C;  1WKM A;  2PBI A;  3WG9 A;  2RQP A;  5L3E A;  3HOT A;  1FNN A;  2IPQ X;  3E5Q A;  3HTS B;  4Q5S F;  3QU3 A;  4BXU A;  1JXS A;  2FE3 A;  1GVJ A;  2VT3 A;  4M9X A;  2FBH A;  2GXB A;  2ESH A;  2CSO A;  3WTY C;  4U0Y A;  2E1C A;  3KLO A;  1USS A;  4G8X A;  4EJU A;  5HLH A;  1B4A A;  1IXR C;  4YG2 F;  5ILV A;  4KNY A;  2PMU A;  5LRR A;  4ENK A;  2XAF A;  3HRM A;  3MAJ A;  4CO8 A;  2FU4 A;  5F64 A;  4Q47 A;  4G7O F;  1IRF A;  1JHF A;  1DPR A;  4D0P A;  4LMY A;  1ZGJ A;  3F21 A;  1CGP A;  5D6F A;  1MZB A;  2FML A;  4EJO A;  2R7F A;  2HKX A;  2O0Y A;  1ZLJ A;  2VN2 A;  2ISZ A;  3ZN0 A;  2P5L C;  2XRO A;  3HTU A;  1GXQ A;  4AIJ A;  4L5J A;  4JK1 X;  2RN7 A;  4OMZ A;  1FX7 A;  2XAS A;  4G7Z F;  4M9Z A;  1G3Y A;  2ZNY A;  5LEK A;  3MFK A;  5F6F A;  1IN7 A;  3HIF A;  2NYX A;  3LQR A;  3KZZ A;  3QP6 A;  1WRJ A;  3GEZ A;  1YTY A;  2M45 A;  3F6V A;  2EV5 A;  3I4P A;  1OKR A;  4RAZ A;  4OU0 A;  5E1X A;  3V7R A;  5AIP A;  4UV8 A;  4GO1 A;  1P4W A;  4RB1 A;  1D3Y A;  3W6K B;  2MH9 A;  3M9A A;  3IKT A;  5J8F A;  1QQI A;  5BOX A;  4O5V A;  1HSJ A;  1QPM A;  3VEP A;  1K78 A;  2RDP A;  1H9T A;  4WK8 F;  1E17 A;  1O7F A;  1OYI A;  2FBI A;  1BC8 C;  3F72 A;  4PZJ A;  3TQN A;  4M71 A;  5JI6 A;  3V7C A;  5E17 F;  4ZZL A;  5HDG A;  3M7G A;  4M72 A;  3TKY A;  3ZMT A;  5E20 A;  1XDS A;  2OZU A;  1ON1 A;  2X4H A;  2Q0O A;  1T6S A;  4L0Y B;  1YLF A;  1PDN C;  2VE8 A;  5LLQ A;  4LB6 B;  3G73 A;  1FP1 D;  5K5O A;  3IL2 A;  2H27 A;  5E8G A;  3JTG A;  4HAM A;  3ZMV A;  2NRA C;  2WTE A;  4ZYD A;  4ESJ A;  2CW0 F;  3JTH A;  1QNT A;  3BWG A;  1KU7 A;  3NEU A;  1J5Y A;  1CF7 B;  2M5W A;  2Z5U A;  1FOK A;  2O03 A;  1O3T A;  2Y75 A;  1S8N A;  1YG2 A;  3B02 A;  2DQR A;  5H6R A;  5D6E A;  3IWZ A;  2FXA A;  5HS8 A;  3WTV C;  3BJ6 A;  3R61 A;  4QWQ A;  3VOE A;  3R60 A;  5CLS A;  1SD6 A;  2DAO A;  1L3L A;  5FO5 A;  3T5X A;  3DXJ F;  3WTZ A;  3KP7 A;  1IRG A;  1RUO A;  3E6B A;  2XAQ A;  4OIO F;  5L3G A;  1U8R A;  4HQM A;  2C6Y A;  1HST A;  4MTE A;  4LG0 A;  2V1X A;  4Q48 A;  1BBY A;  1T98 A;  2FF4 A;  3F23 A;  5CVI A;  4UVB A;  4XBF A;  1OR7 A;  5L3D A;  5ICF A;  3K2Z A;  3BY6 A;  4IRG A;  3KET A;  2VXZ A;  3RKW A;  2FSW A;  1R23 A;  3I59 B;  1ZAR A;  4WCG A;  4N9I A;  4FX0 A;  3JW4 A;  2KRF A;  4L9T A;  3QU6 A;  4EJT A;  3LA7 A;  2OA4 A;  3J81 Z;  1MKM A;  2Z9O A;  2OQR A;  4HQE A;  3KZY A;  1W7P A;  4P9F A;  4ETS A;  1U78 A;  1XDU A;  1YYV A;  4GCV A;  4GXO A;  5FFX A;  5LGN A;  3N4M A;  1G6N A;  3AAF A;  1P6R A;  3HSR A;  3BDD A;  3BOQ A;  1S29 A;  4CGZ A;  1KYZ A;  5K1Y A;  5DD4 A;  1U3E M;  2EFN A;  2DPD A;  4YFK F;  1MJB A;  4PGH A;  1R22 A;  5J6X A;  1F4K A;  3TO9 A;  2V79 A;  1ZLK A;  3HUG A;  1U2W A;  1NHA A;  2IW5 A;  4UV9 A;  1DP7 P;  4LGW A;  5FFZ A;  3ZN1 A;  3KEQ A;  3F6O A;  3QPH A;  2B0L A;  4B8X A;  2O61 A;  1ZRD A;  4A0Z A;  5HS9 A;  4MGR A;  2XGX A;  1LQ1 A;  4HF0 A;  3KP5 A;  3WTS C;  3BPV A;  2DFI A;  1S7A A;  1VTN C;  1F9N A;  3ERE D;  2J5P A;  3KP4 A;  3DPT A;  2Z99 A;  3ELK A;  3MWM A;  2PI0 A;  2CG4 A;  2VON A;  2DO7 A;  3TDZ C;  4BYY A;  2MH2 A;  1KQ0 A;  2PMH A;  1MDM A;  2A68 F;  3L9F A;  2DLL A;  1S7O A;  1IW7 F;  2ISY A;  4LD5 A;  4OOI A;  3ZMD A;  3KP6 A;  5D5V B;  3MQ0 A;  1GXP A;  2EWN A;  2VE9 A;  1TQP A;  1J2X A;  2OD5 A;  4WX9 A;  3FMQ A;  2VT2 A;  3M8F A;  2F5E A;  3HHG A;  3LAP A;  3DF8 A;  3I54 A;  2G7H A;  1WQ2 A;  3IRQ A;  1OYW A;  2EK5 A;  4GYG A;  3EQL F;  2VBY A;  3I5U A;  2DTR A;  4HA8 A;  3BJO A;  5JHU A;  2ETH A;  1ZYR F;  5FLX Z;  3HRU A;  1LEA A;  1X3U A;  3DEU A;  5JR3 A;  2QEN A;  3WGI A;  1C0W A;  2ZO4 A;  4ENM A;  4I01 A;  3DQV C;  2KJC A;  4CHU A;  3LA3 A;  2FA5 A;  2PFB A;  5F1R A;  4L9V A;  2EFW A;  4WWC A;  2MC3 A;  5KVR A;  3D0S A;  3J81 K;  2JPC A;  3T1B A;  2OAZ A;  4PDK A;  2D1H A;  2P5K A;  2L54 A;  4P9U A;  1QGP A;  1FLI A;  2PQ8 A;  4OMY A;  4CXF A;  1EV7 A;  4N9H A;  4F7Z A;  3IRR A;  2YPR A;  4HF2 A;  2GQQ A;  4CYD A;  3I64 A;  4ZYH A;  1XGM A;  4MQ9 F;  4I09 A;  4EM1 A;  3DFG A;  1XSD A;  1J7K A;  4ZYE A;  3HRS A;  5ERI A;  4KIG A;  5CVJ A;  5DUI A;  5IT9 Z;  2RVC A;  2VBW A;  2IA1 A;  3K9T A;  2DBB A;  2KJB A;  3F8C A;  4HX8 A;  2VOD A;  4G6Q A;  2ZBK A;  3GWZ A;  5DCF A;  1AWC A;  4PCQ A;  2A6E F;  4I98 B;  1R36 A;  3TO6 A;  2EB7 A;  2DPU A;  4JQF A;  3R6S A;  1IN6 A;  1KU2 A;  2FQ3 A;  3E6C C;  1FBS A;  4P55 A;  1P4X A;  2GA1 A;  3JAM Z;  3F8B A;  3U2R A;  1IXC A;  5BPI A;  4HLX A;  4EQQ A;  5L3B A;  4EJV A;  4QLC U;  5ICC A;  2HR3 A;  2AXL A;  1ULY A;  1BI0 A;  1ZAO A;  4TV7 A;  5D5X B;  3I71 A;  1IXS B;  2FEZ A;  3QP5 A;  1W5S A;  3TDU C;  2ZME A;  4LLL A;  1SMT A;  4HLY A;  2ZFW A;  1PP8 F;  1YW9 A;  4XSZ F;  1MJ9 A;  2FNP A;  5FLX K;  1AOY A;  4LJZ F;  4O6J A;  3GO5 A;  4A6E A;  2JT1 A;  5HDK A;  1YO5 C;  2XUB A;  2V1U A;  3FM5 A;  4OIN F;  2BBY A;  3T8R A;  5L3F A;  3HYI A;  1T38 A;  4JBA A;  4L0Z B;  4AD9 A;  2P6S A;  3OV8 A;  1YS7 A;  4Q4Z F;  2EFQ A;  4YFX F;  2G7U A;  2QQ9 A;  1ZG3 A;  4FHT A;  2HYG D;  4BHB A;  5DCM B;  3EET A;  2RKH A;  2EA4 A;  3EDP A;  1PUE E;  3CO6 C;  1UFM A;  5HS7 A;  2WWY A;  3ZP5 A;  4RS8 A;  1HW5 A;  2L4A A;  1KQ9 A;  3T8T A;  3DV8 A;  3SXY A;  1TBX A;  1RUN A;  3V8J A;  3WGH A;  4I02 A;  1A04 A;  1MD0 A;  1O3R A;  4UHT A;  1WSU A;  3U9G A;  2ZKZ A;  2GZW A;  2X0L A;  1FP2 A;  1W5T A;  4A2U A;  4ESF A;  1Z9C A;  3I0T A;  4CZZ A;  1D5V A;  5IT9 K;  1XGS A;  2JSC A;  2MA3 A;  1K79 A;  1H9G A;  2XVC A;  1LDK B;  1LVA A;  1TTY A;  1B9N A;  4ZZD A;  3ISP A;  5LHG A;  4IF4 A;  3GVA A;  1BC7 C;  2IJL A;  5LGT A;  5CVV A;  2QUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...