4B8XA

Near atomic resolution crystal structure of sco5413, a marr family transcriptional regulator from streptomyces coelicolor
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
144
structure length
139
Chain Sequence
GVPSMAAITSIMRAQQILLGEVDAVVKPYGLTFARYEALVLLTFSKSGELPMSKIGERLMVHPTSVTNTVDRLVRSGLVAKRPNPGTLATITDKGREVVEAATRDLMAMDFGLGAYDAEEGEIFAMLRPLRVAAGDFDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POSSIBLE MARR-TRANSCRIPTIONAL REGULATOR
publication title High Resolution Crystal Structure of Sco5413, a Widespread Actinomycete Marr Family Transcriptional Regulator of Unknown Function.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 52
structure length 139
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4b8xA00
2Z99A 5JI6A 1LDKB 2K4BA 2NNYA 5DCMB 1TBXA 1HW2A 3W6KB 3DP7A 3M7GA 2K4JA 2FMYA 2K02A 4O6JA 2A6HF 4OIOF 4KIGA 1RIOH 1JGSA 3OV8A 4UXNA 3BP8A 4XLNF 4HV6A 4A6EA 3BROA 5D8KB 1T2KA 4HDVA 2XV4S 1Q1HA 3SZPA 2W25A 4A5NA 4G6QA 1NHAA 3CJNA 5FLXZ 2FA5A 2FRHA 3SXYA 2Y48A 1EH8A 1ON2A 1HSJA 4Q4ZF 4RB1A 2LF7A 5CVVA 2J5PA 1VTNC 4UVCA 3RPQA 1SMYF 4LB5A 3JSOA 1LNWA 3H3ZA 3IC7A 1K78A 2H6CA 1YW8A 3G3ZA 5AIQA 2E7XA 1WKMA 1J59A 4GXOA 2A3SA 2UZKA 1MJAA 2IJLA 3ZP5A 2VE9A 3EDPA 2FF4A 1JXSA 1KGSA 2JPCA 2MLGA 1FBQA 2CW0F 1D8KA 1LQ1A 3O2PE 1MDMA 4CGZA 1V4RA 2HDCA 1TTYA 2H6BA 2WWYA 1UCRA 3JTGA 1FC3A 2OQGA 3E5QA 3HYIA 2QUFA 2VBYA 3WTYC 3EQLF 1ZLJA 2Z5UA 4Z2YA 2WV0A 5L3DA 5L3BA 2QZ8A 1AOYA 2BE5F 2RVCA 1K7AA 1S3JA 4U7DA 3LA3A 1OYYA 2M1BA 4RGXA 1USTA 4CDGA 3I4PA 1R23A 3FMQA 2EFQA 4DQ2A 3BDDA 2EV5A 1TNSA 2LSOA 5DDGA 1DPRA 4G7HF 3CDHA 3M9AA 3F23A 5L3FA 3E97A 4KMFA 5J8FA 2F5DA 2RV8A 4LLLA 4HLYA 3N97A 1MJBA 2ISZA 2DQLA 4G7OF 3R4KA 3HTSB 4ESBA 4OIQF 4RAZA 4QLCU 2DBBA 1S8NA 1YFHA 4CXFA 2EA4A 4KNYA 4FX0A 2Y75A 5IT3A 4ENMA 1XGOA 3F8BA 1HKSA 4M74A 3KP3A 1I27A 2LNBA 3C7JA 3JTHA 1YG2A 3I5UA 3MCZA 4G7ZF 1U6GA 3LA2A 1UFMA 3K1NA 3C18A 2YSRA 3KEQA 4HDUA 5FFZA 2EFNA 5DYMA 1DDNA 2O61A 2PJPA 2GQQA 1ZGJA 2LDUA 4FX4A 1YLFA 2XAHA 3BZ6A 3P7NA 3VOEA 1OYWA 3ZMZA 4EM0B 2PFBA 2NAZA 1R58A 3WTTC 2W57A 1P2FA 4GO1A 3WU1B 2QM3A 4ENKA 3GVAA 3QRFF 3GWZA 4HF2A 2O3FA 2ZNZA 3KE2A 2KIFA 2PLYA 3HHGA 2FQ3A 1B4AA 2Q8KA 3DXJF 2OQRA 1LEAA 1E2XA 4JK1X 2VBZA 4AIKA 1R36A 3KLOA 2LKPA 3J7AO 2DAOA 2XASA 1XSDA 4OINF 5CVUA 3SFZA 4YFXF 1IXCA 1PP8F 3TDUC 2GIVA 3M8FA 3JW4A 1WRJA 2QVOA 4L9NA 1USSA 1O3QA 2DTRA 5JVTA 4NB5A 3Q5FA 4JQFA 1ZN2A 3R60A 4GGGA 1GVJA 1QPMA 1MGTA 1FY7A 1IRFA 2L3DA 1V3FA 3E6BA 2L01A 3DKWA 1F4KA 1W7PD 4EGYA 2W84A 2F5CA 4XRFA 4EJVA 5A2QZ 4EJTA 4LG0A 2O03A 4E70A 4KN4X 4OU0A 4OIRF 2DK5A 3V8JA 3L2CA 3EUHA 4CO8A 4LMYA 5HLGA 3GX4X 5DCMA 3BOQA 3MQ0A 2V79A 5ILUA 2VC0A 1SD5A 4EJOA 2P5LC 3QPTA 2M87A 4P55A 2JZYA 1ZH5A 3E6MA 1B59A 2QQBA 3P9IA 1UHMA 1XDUA 2PG4A 4I02A 3K1MA 2F5EA 3E5XA 1B6AA 3L9FA 2COMA 2QBYB 1LEBA 3FXUA 5D6EA 3RKXA 1T38A 4G94A 5DD8A 4IRIA 2M45A 2NRAC 2FBIA 2FU4A 2Q2EA 1OPCA 3CLOA 4Y15A 3BJOA 5IT9Z 3C3WA 3REOA 2WTEA 4KA4A 3F72A 2V6CA 1BI3A 3O6BB 4ETSA 3O3KA 3ZN0A 1IN8A 4LD5A 4N0BA 3J81K 1G6NA 2CSOA 2D2WA 2H94A 1KU3A 4IXAA 2IA1A 2FOKA 4AVPA 4L0ZB 3HTUA 3H3UA 2ZNYA 1ZLKA 2R7FA 2NNNA 2PQ8A 2FNPA 5E1WA 4HA8A 2B0LA 1C0WA 1QGPA 3JAMK 1WQ2A 2A68F 1Z91A 2ZXJA 2QENA 1IUYA 1O57A 4AIJA 4HX7A 2HGCA 2KJCA 2MLKA 1SD6A 3FM5A 2HS5A 5E18F 2XAJA 2HEOA 2DFIA 6PAXA 2GXBA 3QU3A 3MZYA 4PZJA 4L0YB 1R1UA 1STZA 2XROA 1ON1A 3QPHA 5ILSA 3J80K 4I0AA 5CYVA 3TOBA 1JHHA 1CF7B 1O3TA 2KRFA 2Y0MA 3QOPA 3HOTA 2D1VA 4B8XA 1F5TA 4HX8A 3U1DA 3F8MA 4HZFA 5LGUA 4EMSA 4QWQA 5DUKA 3TO9A 2EFPA 3BY6A 3MEXA 4RB2C 2UWMA 4U88A 2QQAA 1OYIA 3K1PA 5E1XA 2MA3A 4IF4A 3FZVA 3LQRA 5L3EA 4HOBA 2CG4A 5HLIA 4I0BA 1R22A 3CTAA 1QNTA 4I09A 1XSVA 2FSWA 1YYVA 2VT3A 5HS8A 2OU2A 1LDDA 3U9GA 1F1ZA 4XSZF 3V7CA 4ZYHA 3HHHA 3ZN1A 1ZRDA 5FD6A 3QU6A 1D8JA 3KZZA 5K5RA 4UNOA 3M8EA 1W5SA 1R5HA 1IZ1A 1LVAA 5BQTA 3F21A 3B73A 3ZMDA 1XCBA 3GO5A 1J5YA 1ZARA 1ZG3A 1YO5C 4EM1A 2VOPA 4PGGA 2YU3A 3CO6C 2GA1A 2H27A 4A5MA 5CVIA 1I6XA 2RC4A 1QBJA 4LJZF 2V1UA 2X0LA 5E1ZB 5E8GA 3GFJA 4U0YA 1I1SA 3HUGA 2X4HA 3QP6A 4HX4A 1MD0A 4P5OA 4MEXF 5BS6A 2WC2A 1OKRA 3TGNA 3Q9SA 2LF8A 4P9FA 2D1HA 4BHCA 2EK5A 2A5YB 3DFGA 4LK1F 4ENNA 4UHTA 2UXNA 3HIFA 3KFWX 3TQNA 4HQMA 1GXPA 1O3SA 2IRFG 2P6SA 4EVIA 3MWMA 2ZJ2A 2A69F 1XD7A 3JSPA 1TW3A 2VBXA 2BYVE 3F6OA 1SFUA 2DLLA 1FPQA 1REPC 2XVCA 3K2ZA 3I53A 1S6LA 4GCVA 3T0YA 3WODF 1O7FA 1S7AA 3HRUA 1DUXC 4I98B 2XIGA 5LBQA 4ENJA 2DPDA 2ZKZA 2HYGD 2DK8A 3V8KA 4M71A 5DD4A 2ELHA 2O0YA 3KP4A 1MZBA 2XAGA 1YS6A 3ECOA 4L9JA 4KYWA 4WXHA 2ESNA 2VOOA 5E17F 4LLGF 2QBYA 4KN7X 1QZYA 1R1TA 3ML6A 2ZMEA 3RKWA 1WI9A 3I0TA 3NQOA 5E20A 1U3EM 3HSRA 4ZYGA 1IN6A 4LGWA 2MH2A 5L3GA 1BI2A 4A12A 4ESFA 3KZYA 1WWXA 2Z3YA 3D0SA 1Y0UA 2W85A 1Z1DA 1YS7A 3GLXA 3SHFA 5KVRA 3RTRA 3BPXA 3LAJA 4MQVA 1U8RA 3ABUA 2F2EA 3WTXC 3IRQA 1LJ9A 3KCCA 3HRSA 5DEQA 3NEUA 1G4DA 2M30A 2P7VB 2PEXA 2RQPA 2EV6A 2JT1A 1P4WA 3J80Z 1ZAOA 2KIMA 2ACJA 2CYYA 3V8LA 2M5WA 5H6RA 3WGIA 4M6YA 3LQQA 3I71A 4U7BA 2GXGA 1J75A 5TJJA 4EJWA 4HBLA 4IJAA 4WK8F 3KP7A 1IXRC 2HQRA 3L7WA 4HW0A 5JHUA 5DUIA 1QO0D 4WXCA 1FNNA 1K78B 2L4AA 1K79A 5HDGA 2ZO4A 3T8TA 3KEOA 1RZ4A 1IXSB 2VE8A 3NRVA 2EV0A 1QZZA 2EFWA 5JR3A 1RI7A 3ZMTA 1B9NA 1HKQA 2J5OA 1G3TA 4FHTA 2FE3A 4HAMA 2P5VA 5DV5A 2HTSA 2RNJA 2KJBA 2UXXA 1BI1A 2CQKA 1MDMB 3LFKA 2EJRA 1HKTA 2PMHA 4WCGA 1P92A 1K6OA 4EM2A 4WXDA 5FLXK 2MBFA 1ZG5A 5ICEA 1YQAA 2E7WA 1HW1A 5CJ9A 2DPUA 4M72A 3PQKA 2VBWA 1FSHA 2VN2A 5FB2A 1TW2A 1YIOA 2BEOA 3WTVC 2VT2A 4BQAA 5D8LB 2NS0A 3AAFA 1O7LA 1R7JA 4ZH4F 4L5IA 3DV8A 4R8HA 1Z05A 1KQ8A 1RNLA 4YG2F 4UV8A 3N4MA 5L3CA 2RKHA 3I54A 2XGXA 4LFUA 4ZYEA 2HZTA 3G73A 3GUDA 2BBYA 3B02A 4M9SA 1J2XA 2IPQX 1Z9CA 1S29A 1BN5A 3IKTA 4LLNA 4A2UA 3LWFA 2OBPA 3I58A 3E3VA 1XGSA 2P5KA 2PI0A 2P6TA 1IN7A 4OMZA 4HF0A 3RI4A 5ED4A 2GA2A 4PDKA 3ZPLA 4RS8A 1AWCA 3IL2A 5BMZA 4MQ9F 2Z33A 3V4GA 1FP1D 3GZ6A 1IW7F 3CUQB 1TQMA 2HFHA 4RGSA 1W5TA 1RUOA 3F22A 4R79A 2OD5A 1CGPA 1EV7A 4KICA 5D4RA 4XBFA 1S7OA 1H0MA 3HRTA 4M6XA 5EEHA 2TDXA 2QLZA 1QQIA 3FM3A 3VFZA 3ZMVA 2IP2A 1HQCA 2HTJA 5CVRA 1BBYA 5FO5A 3FHZA 1SFXA 4KFCA 1SMTA 3FMRA 1XCVA 3ROUA 1FP2A 2CO5A 4HF1A 2BV6A 3E5UA 4Y13A 1HXDA 2RGVA 1W7PB 3DEUA 5FFXA 1W4MA 3EYYA 1FYKA 5J8CA 4LK0F 4MGRA 1B9MA 1FZPB 1Z7UA 1YW9A 1WSUA 1GXQA 4U0WA 2L54A 3TOAA 2Q0OA 3I59B 4K2EA 2YX7A 2ESHA 1XN7A 2KKOA 4MTDA 5D5VB 4ASNA 2K7LA 1ZGAA 4DNCA 1BC8C 4N9IA 1HSTA 1F9NA 4XSXF 3PFIA 4S05A 5TRDA 4KT5C 1RUNA 5HOOA 5K5QA 1ODDA 2GWRA 4KMUX 4KIBA 2VC1A 3IKVA 5J6XA 2K86A 3P9KA 4LG0B 1HW5A 1SAXA 2HKOA 2IVMA 1XMKA 1JE8A 5EEGA 2HWVA 1PUEE 4IHSA 2CFXA 4HYEA 3DQVC 1BIAA 2V9VA 4L9VA 2EB7A 3SZTA 4ZZDA 4R1HA 4U0VA 2STWA 1FBUA 1FYLA 4L5JA 3ABTA 5BOXA 4BHBA 2YX4A 2A61A 2E1NA 5HDNA 4GYIA 4ESJA 3DPTA 5ICCA 3IWFA 4I2OA 5HVQC 1FOKA 1ZRCA 1T98A 5ICGA 5H20A 3FWEA 4A0ZA 1KU9A 4BH9A 5HS7A 4MTEA 2PMUA 3LAPA 4XLPF 1KU7A 4BYYA 2NYXA 1YW7A 1TNTA 2ETHA 2EA2A 1J0RA 4S04A 5JFRA 3ELKA 4YIIA 4UUVA 3QAHA 5A2QK 4IRHA 3RPUA 1T39A 3F8CA 1SD7A 5LEJA 2JTVA 2GZWA 1U78A 2Z9OA 4OIPF 3V7SA 2XAQA 2VONA 1OR7A 3HRMA 5HDKA 2FEZA 4JBAA 4O5VA 3WE2A 5K5OA 2BGCA 3KP6A 3MFKA 2FMLA 1MJ9A 1P4XA 4AD9A 3CUQC 3F6VA 5AIPA 3MZHA 3R6SA 5LRSA 4IPAA 2EWNA 5BPDA 4GYGA 5D5WB 1XMAA 3K69A 3RJPA 5LGTA 1U5TB 3GZ5A 4CZZA 5DCFA 2CGPA 4IRGA 1PP7U 2R7DA 3U2RA 1X3UA 4G9YA 2O6GE 4Q47A 3GEZA 1ONVA 2IA2A 3IRRA 4B09A 2IW5A 2VXZA 4PCQA 1PDNC 1B1BA 3QP5A 5IT9K 2V1XA 4UV9A 3TDZC 1GHCA 5ICFA 3J81Z 2HQNA 5D5XB 2QYOA 2HYFA 2ZCWA 4ZZLA 3E6CC 1SFEA 3WTUC 3GYHX 2JPBA 3DF8A 4OMYA 2PBIA 3FMSA 1G3YA 4UVBA 2DO7A 3MAJA 3H92A 2HOEA 2OZUA 5FD5A 2O8XA 1BM9A 4RGUA 3T5XA 5F64A 3FXQA 3JAMZ 3WTWC 1BIBA 2G7UA 1FBSA 3WGHA 4L9TA 4KIFA 1DPUA 5ILVA 1P6RA 3M1EA 5BPIA 1FT9A 3S2WA 1FX7A 3L09A 1I1GA 2ZBKA 3WG9A 4RGRA 4RB3C 1BI0A 2H09A 3WGGA 3CUQA 1ZG1A 2AS5F 4EV0A 2MH9A 1H9GA 2DI3A 1HBXG 3FX3A 1R1VA 2GAUA 3HOSA 2XUBA 2OAZA 1H9TA 3IWZA 3GW2A 4A0XA 3ECHA 1KYWA 4MHGA 4RAYA 2MD5A 1L3LA 3VODA 2L02A 3RIRA 2A6EF 3LSTA 2JSCA 3ZMUA 2MC3A 2XKPA 3Q9VA 5KK1A 2HR3A 5LLQA 3C1DA 3T1BA 5F6FA 2L4MA 2P7CB 1T0FA 1W7PA 1LB2A 3RDIA 3GFLA 2K27A 3TKYA 3CO7C 2W24A 1SD4A 3KP5A 3WU0A 2XAFA 4F7ZA 1FLIA 2E1CA 3R0JA 1EH6A 1DP7P 3IHUA 3GF2A 2IT0A 2R3SA 3TO6A 5LHHA 4LB6B 4NHJA 3I59A 1XGMA 3L00A 4TV7A 1BOAA 1FWZA 2P4WA 2PN6A 2XHKA 3TO7A 4M73A 4BXUA 4CICA 4BAYA 3VEPA 3KP2A 3ISPA 4BHPA 4P9UA 2A07F 2FNAA 1KQ0A 1XSXA 4Q5SF 3EYIA 4I01A 3EETA 1XGNA 1CF7A 1KQ9A 3RYPA 1XDSA 1KYZA 4H0EA 1IN5A 2EFOA 1T6SA 3CUOA 5E8IA 1R5GA 3ZMSA 5LRRA 4YFKF 2HKXA 2DW4A 3ULQB 2FBHA 5D4SA 3COAC 3FF5A 3GFMA 4HLXA 1ZHFA 3BJAA 4I7HA 1A04A 1XB4A 2DT5A 3T8RA 3F8NA 3HSFA 2D45A 4EGZA 1IRGA 4WX9A 4IVNA 1U5TC 1Z6TA 4P96A 2G9WA 3F8FA 3ZQ7A 2V1DA 3HSEA 3DPLC 1L0OC 4MEYF 5LEKA 1E17A 1ZYRF 5AONA 2XRNA 3E6DA 5LHGA 1ZRFA 4ZYDA 5D6FA 4A6DA 4KUMA 5FGMA 5CVJA 4UVAA 1KA8A 3WE3A 4WF2A 3R61A 2ZFWA 5HS9A 4AWXB 2OA4A 1R00A 4Y17A 3WTZA 2IA0A 2ZMEB 3BPVA 3KETA 2DQRA 5ERIA 2DU9A 2RDPA 5F1RA 2F5FA 4FT8A 1IAWA 1UB9A 1I5ZA 1P4AA 4M9ZA 2KIUA 3W6JB 4WWCA 1ZREA 3OOPA 1FYMA 4O3MA 3R0AA 5K1YA 3KLNA 1U2WA 1IF1A 4NQWA 2YR2A 3GXOA 3ERED 1BC7C 4CYDA 1G3WA 2FBKA 4HV5A 1D3YA 4A0YA 4Q48A 3WTSC 3RYRA 4D0PA 4L18B 2CWEA 4EQQA 3PQJA 4CHUA 3BJ6A 3BWGA 4MNUA 1TQIA 1J7KA 1G3SA 1OMIA 3VB2A 1U5TA 3D5LA 5D5UB 2QQ9A 5CLSA 4IHTA 5LHIA 4YIFA 1TQPA 5HLHA 1KU2A 3K9TA 5LGNA 1JHFA 2G7HA 2ISYA 1J9IA 4G6DA 1O3RA 4ON0A 1BJAA 1IN4A 1EH7A 4RB0A 3K0LA 1LDJA 3SQNA 4M9XA 2C6YA 1D5VA 1Z6RA 3FXRA 3RKYA 2ADUA 4OOIA 4BNCA 3V7RA 4KDPA 3LA7A 3F3XA 4PGHA 2P8TA 2STTA 5H6QA 3GFIA 2QWWA 4G8XA 1UHWA 4N9HA 2FXAA 2VODA 3I64A 4AIHA 1ULYA 2RN7A 2YPRA 1FSEA 2OZ6A 1TLHB 2AXLA 4HQEA 4EJUA 1YTYA 2M8EA 4YFNF 2JRTA 3P9CA 1MKMA 2XKOA
chains in the Genus database with same CATH superfamily
2Z99A 2UV1A 4DZPA 2CUJA 4PFOA 5JI6A 1LDKB 2K4BA 1KONA 2F48A 1W1WE 2IXSA 2V9KA 2NNYA 5DCMB 1TBXA 3FBIB 4E7SA 1HW2A 3S1RJ 2XF5A 3CJRB 2EQRA 3W6KB 3DP7A 5DM6F 3M7GA 1FIPA 1I6HJ 2K4JA 1Q1VA 2FMYA 2K02A 4O6JA 2ME6A 1EJ9A 2A6HF 4OIOF 4KIGA 3MZ8A 2V6EA 1RIOH 3C2HA 4II2A 2EZLA 1JGSA 4FISA 4V2FA 3B6AA 3OV8A 4ABZA 4IKFA 1Y56A 4UXNA 3BP8A 4XLNF 4A3CJ 1OFCX 4HV6A 4A6EA 3QYBA 1Z21A 3BROA 5D8KB 1T2KA 4HDVA 2XV4S 1Q1HA 3SZPA 1EKEA 2W25A 2M2EA 4A5NA 4G6QA 3JRAA 1RR8C 1NHAA 3CJNA 2NVUB 5FLXZ 2ZXIA 3SFIA 1TZLA 2KFDA 2FA5A 2FRHA 3SXYA 1ZTRA 3SZGA 4ZJZA 2Y2ZA 3HOZJ 4XM3A 4HSRA 2Y48A 1EH8A 4IX7A 4XLCA 1ON2A 3A4CA 1HSJA 4Q4ZF 4RB1A 4BBSJ 2LF7A 3A03A 5CVVA 3OSGA 4DOZA 2J5PA 1VTNC 5E3MA 4UVCA 3RPQA 1SMYF 1YX3A 2I8DA 3IAS2 3OYJA 4LB5A 3KYCB 4KJZA 3JSOA 3L1PA 1LNWA 3H3ZA 1AA7A 5KHDA 4A93J 4I99C 3OS2A 2IGKA 3IC7A 3VYSB 3QPLA 2NOGA 1K78A 2JMWA 2H6CA 3QOEA 1ZQ3P 1PVEA 1YW8A 2BY2A 2DA2A 3G3ZA 1N78A 5AIQA 2ZSIB 5EG0A 2E7XA 1WKMA 3I4NJ 1J59A 4B3AA 1W36D 4EATA 4GXOA 1S9HA 3HOUJ 2JA6J 2A3SA 1NH3A 3NWSA 2CUEA 2UZKA 1MJAA 1WJAA 4YEJA 3PM1A 4JOMA 3EUAA 1UG0A 3K4NA 2IJLA 2DFFA 4YIRX 2VE9A 3ZP5A 3EDPA 3RZOJ 2FF4A 3OIQA 1SVLA 1JXSA 2ZMEC 1TT5B 4ITVA 4NBQA 4DIQA 1A6IA 1KGSA 2JPCA 2MLGA 3MN2A 3OL3A 1FBQA 2CW0F 5M5XJ 1D8KA 1S5LC 3AG1H 3O2PE 1LQ1A 3L2QA 2FD5A 1MDMA 3ABLH 1H8AC 4CGZA 3KYLA 1V4RA 3ABMH 3H36A 2HDCA 1MMSA 1TTYA 1MNEA 2H6BA 4RAFA 4CYCA 2LH9A 2M7AA 2WWYA 5C4XJ 1UCRA 2NS7A 3JTGA 3TW6A 1SVOA 1ACIA 1FC3A 1X4OA 3HPHA 3P5JA 2OQGA 4XONA 3E5QA 3QYEA 3E7LA 2KHMA 1LPQA 3HYIA 2QUFA 2VBYA 3WTYC 3F9KA 3EQLF 2MSYA 1ZLJA 2WB1A 2Z5UA 4PJMA 2XPUA 4Z2YA 1Y39A 3CMEI 2WV0A 3L2UA 1YI2I 5L3DA 3GTLJ 5IP9J 2ECCA 3OIPA 5L3BA 2QZ8A 5FRNA 1AOYA 2DA7A 2BE5F 2RVCA 1K7AA 4S0HB 4LITA 4PJNA 1MMGA 1S3JA 4CCJA 3GTJJ 4U7DA 1XPXA 3B6CA 3X2QH 3LA3A 1OYYA 2M1BA 3NAUA 4RGXA 4N4OB 1USTA 4CDGA 3OYCA 3VWBA 2QA4I 3I4PA 1R23A 2GOMA 4D9JA 3FMQA 2XF7A 1YHQI 1SFKA 3IH3A 2MFZA 2EFQA 5E3LA 3PNYA 4DQ2A 1ETKA 3BDDA 5DM7F 5KAIC 1G8XA 1JKQC 2EV5A 4CCMA 2EZHA 1TNSA 3ERMA 2LSOA 5DDGA 1DPRA 2I5UA 2M4KA 3CDHA 3M9AA 3F23A 5L3FA 4G7HF 3E97A 2KDZA 1V5EA 4KMFA 5J8FA 2F5DA 3BCAA 2AO9A 3FIWA 2RV8A 3FKJA 4LLLA 4HLYA 3HEFA 3EPZA 3N97A 1MJBA 2VI6A 2ISZA 3CJQB 2DQLA 2IS4A 1FJLA 3AG3H 4G7OF 1YX5A 1TT0A 2K5CA 3R4KA 3HTSB 2JN6A 1ZK8A 4ESBA 2WAFA 4OIQF 1WI3A 4RAZA 2BW3B 4QLCU 1JKRC 2DBBA 5J4YA 2DFHA 1S8NA 1YFHA 4CXFA 2DOEA 3DKYA 1NG6A 2EA4A 4KNYA 4FX0A 2Y75A 4RDUA 5IT3A 2R5YA 4ENMA 1XGOA 2VKHA 3F8BA 1DQUA 1HKSA 3H5RA 4A69C 4BXFA 4M74A 1MNMC 3KP3A 1I27A 2LNBA 3C7JA 3JTHA 2H8RA 5GAEJ 1YG2A 3I5UA 3MCZA 2ZJRF 4G7ZF 1RKTA 1U6GA 3LA2A 2JA5J 5HNFA 1UFMA 2L7KA 4X1EA 3JR9A 2DOFA 2LC2A 3K1NA 3C18A 2DA5A 2KP6A 3ZQFA 2YSRA 3KEQA 4HDUA 5FFZA 4AVZA 4CCKA 4Y52J 2M0MA 3H9QA 4BS9A 1UJ8A 2EFNA 5DYMA 1DDNA 2O61A 2OUMA 2PJPA 1WJEA 2GQQA 2Y31A 1ZGJA 4BEHB 2LDUA 4FX4A 1YLFA 2XAHA 3BZ6A 3QQAA 4ZDOA 3P7NA 3VOEA 1OYWA 3ZMZA 4EM0B 2PFBA 4BDZA 2NAZA 1R58A 2A6TA 3M1CA 3WTTC 2R93J 3DLAA 4X6AJ 1MBEA 2W57A 5CQEA 1P2FA 4GO1A 3WU1B 2QM3A 4ENKA 4IHXA 3GVAA 2QSGX 4E7LA 5M3MJ 3QRFF 3GWZA 3OWTA 4HNTA 2O3FA 5M5WJ 2ZNZA 4HF2A 3KE2A 2K40A 2EINH 2LVSA 3UKGA 2DXIA 2KIFA 4JX4A 3VSLA 1OCPA 4M6VA 2PLYA 3H35A 3HHGA 2FQ3A 1B4AA 5F0FA 2Q8KA 2A5WA 3DXJF 2OQRA 3U1KA 1P7JA 1LEAA 2KMUA 5F0CA 1B8IA 1E2XA 1HA8A 4JK1X 2VBZA 4AIKA 1R36A 3KLOA 2BY1A 2LKPA 3CCRI 1BOBA 3J7AO 2DAOA 2XASA 3VYTB 4AYBN 4I6ZA 1XSDA 1GT0C 2E1OA 4OINF 5CVUA 2JVHA 1MMDA 2L9NA 4D7NA 3SFZA 4YFXF 1HCRA 3CCMI 1IXCA 1PP8F 3S32A 3TDUC 1V5GA 2GIVA 3M8FA 3NWTA 4IO9F 4A3MJ 3IAM2 3JW4A 1OCOH 2O7OA 3S8PA 2M3AA 1WRJA 1RRJA 2QVOA 4B47A 4L9NA 4NUBA 1USSA 2LK2A 1VQ8I 1O3QA 3E0JB 2DTRA 3GZNB 3H0GJ 2R7UA 5JVTA 1TC3C 2XB0X 2WY7Q 4NB5A 3Q5FA 3OYMA 4JQFA 1ZN2A 3R60A 3S2HJ 4AM3A 4ANJA 2ZXHA 1GVJA 1QPMA 4GGGA 4F93B 3DU5A 1MGTA 1FY7A 2X9DA 1IRFA 2L3DA 1V3FA 4BY7J 3E6BA 2L01A 1UELB 3ASOH 1SAUA 1OCTC 3DKWA 4UUTA 4JX6A 4Y7NJ 1F4KA 1W7PD 4EGYA 2W84A 2F5CA 4RM3A 4XRFA 3GTOJ 4IOAF 4EJVA 5A2QZ 4EJTA 1FOWA 4LG0A 2O03A 4E70A 1PUFB 4KN4X 4OU0A 4OIRF 2X6WA 4NC7A 2DK5A 3V8JA 3L2CA 5GAHJ 3EUHA 2NVXJ 4CO8A 4LMYA 5HLGA 2R7TA 3GX4X 5DCMA 3BOQA 3MQ0A 5HNHA 3HDDA 2V79A 5ILUA 2VC0A 2XSJC 4BE1A 1SD5A 2BY3A 1MW7A 4EJOA 2P5LC 2VKEA 5GPAA 5K7FA 3M3YJ 1VQLI 2ME0A 3QPTA 2M87A 4P55A 2JZYA 1ZH5A 1D1BA 3E6MA 1B59A 2QQBA 1MMAA 3P9IA 1UHMA 2L7ZA 2D5VA 1X3WB 1XDUA 5TISC 2PG4A 4I02A 3EUKL 3K1MA 1X19A 2F5EA 2LOOA 2VQCA 3LSPA 3TP3A 3E5XA 1B6AA 3L9FA 2VIXA 3SJMA 1Z77A 2COMA 1OLTA 2QBYB 4BJ6C 1LEBA 4YELA 3FXUA 4AUXA 5D6EA 3RKXA 1T38A 3LOCA 2IGMA 2E2JJ 4BGDA 4G94A 5DD8A 4IRIA 2M45A 2NRAC 2FBIA 1A6QA 2DMQA 2FU4A 2Q2EA 4M3FA 3JRBA 5KNLA 4QSHA 3OYNA 1OPCA 2CQQA 3CLOA 1I50J 4Y15A 4H4KC 3BJOA 4C30A 3C3WA 1RKWA 3REOA 5IT9Z 2OF7A 3A0BC 1DU6A 1P9QC 2P81A 3BR5A 2I10A 2WTEA 4KA4A 3F72A 2V6CA 1LE8B 4NNJA 3HOYJ 1BI3A 3O6BB 4ETSA 3O3KA 1U9OA 3ZN0A 1IN8A 3OSFA 4LD5A 4N0BA 4AU7A 4HNUA 1JT6A 3J81K 1ETQA 1G6NA 4C3JJ 2CSOA 3OYFA 2D2WA 1IG7A 2H94A 3ZQQA 1KU3A 4IXAA 3MMYB 9ANTA 2IA1A 3OL4A 2FOKA 4AVPA 1QPIA 4L0ZB 1MBGA 1OJLA 1R4NB 4LG3A 3HTUA 3H3UA 2ZNYA 3JRHA 4Y3OA 1VQ4I 2R7XA 3OY9A 1VQNI 4EEFG 1ZLKA 1RR7A 2R7FA 2NNNA 4FTHA 1IO2A 2PQ8A 4HNVA 1K61A 2DFEA 2FNPA 5E1WA 3QODA 4N4NB 1FMVA 3HPGA 4HA8A 2B0LA 3LSIA 4A3EJ 1C0WA 1JJ8C 1QGPA 1B72B 1D0XA 1W36C 2DYSH 4FCYA 2EZKA 2HQ5A 3JAMK 2NXNB 1UAAA 3JRCA 1WQ2A 1NG7A 2A68F 2L5QA 2IGOA 1LFBA 1Z91A 3DWLE 2ZXJA 2HVRA 2VKVA 3H9JA 3VYRB 3PNVA 2KRHA 2QENA 3E1SA 1U8BA 1IUYA 3GTQJ 1O57A 1X58A 4LIVA 4AIJA 4HX7A 3BZCA 1I39A 1JKPC 2M9HA 4IZZA 1T8IA 1R9TJ 1YOVB 1TWGJ 2LY2A 1BW6A 3VYUB 2HGCA 2KJCA 2XDVA 2MLKA 1SD6A 1QVTA 3FM5A 4ZC3A 4M3BA 3OYAA 2HS5A 5E18F 3CCSI 4C2TA 2K9LA 1R49A 2XAJA 2HEOA 1A31A 5FKOA 2DFIA 4CH7A 6PAXA 2GXBA 3QU3A 2R7SA 3MZYA 4PZJA 4L0YB 2R7RA 1R1UA 1STZA 2Y9ZA 4V19K 1WH5A 2XROA 3PO2J 2YUSA 4DZJA 2V9PA 1ON1A 3K7AJ 1Z3XA 1YITI 3QPHA 2QF7A 5ILSA 3J80K 2JA8J 2XC7A 3OYGA 4XIDA 4I0AA 2JRMA 5CYVA 2QEXI 3QPSA 1K6YA 2X1CA 3M8JA 3TOBA 1KZHA 3L2RA 1JHHA 1CF7B 2VQLA 4Y33A 5CPRB 2KRFA 2Y0MA 3MVPA 1O3TA 3QOPA 2HXOA 3HOTA 3MKYB 2D1VA 4B8XA 1F5TA 2M34A 2KL4A 4HX8A 3U1DA 2ZFUA 3F8MA 4QIWN 5EGOA 4HZFA 4PSWA 5LGUA 4EMSA 4QWQA 2W4SA 2LG4A 5DUKA 2MC4A 3TO9A 2ZXWH 4IHYA 2EFPA 3BY6A 1OR7C 2H8WA 2O9LA 1QHHD 3JRFA 4XK4A 3MEXA 2E19A 4RB2C 1V5FA 2UWMA 4U88A 3BR6A 2QQAA 1OYIA 2VPRA 3K1PA 3OYBA 3LSRA 5E1XA 2MA3A 4IF4A 1X1BA 3FZVA 3LQRA 3A01B 3GTMJ 4XOPA 5B3SH 2AQFA 5L3EA 4HOBA 2X6XA 2CG4A 1VQ5I 2E5NA 4B43A 5HLIA 3HOXJ 2NVTJ 3VSKA 1Y8QB 1HDPA 3FXJA 4I0BA 1R22A 3CTAA 3GTPJ 1QNTA 2AQEA 2HDDA 4I09A 1XSVA 2FSWA 1YYVA 2CU7A 2VT3A 5HS8A 2OU2A 1YRNA 1LDDA 1SANA 3U9GA 1F1ZA 4XSZF 2BVLA 3V7CA 3BQYA 4ZYHA 2QGUA 3HHHA 3ZN1A 1ZRDA 3W3CA 3TMOA 4BEHA 5FD6A 4MFDA 3QU6A 1D8JA 3KZZA 3ONQA 3OOUA 5K5RA 5GTIC 4BBRJ 4UNOA 1R5ID 3M8EA 2CW8A 4A3IJ 3I56I 1X4PA 2DT7B 4CCLA 1T08B 1W5SA 1R5HA 1J09A 3RKQA 4BY1J 1IZ1A 1LVAA 5BQTA 5GPCA 3F21A 2BY0A 3CQZJ 3B73A 3ZMDA 1XCBA 3GO5A 3SEQA 2VQGA 1J5YA 4CUGA 2HI3A 1ZARA 1ZG3A 1YO5C 4EM1A 2VOPA 3BG9A 4PGGA 2YU3A 3CO6C 1R4MB 2GA1A 2VJJA 2Y0SA 2H27A 2RQQA 4A5MA 5CVIA 1I6XA 4CZCA 2EILH 4HG2A 5EDNA 2RC4A 2KISA 3CMMA 5IY5H 1QBJA 4IHVA 4DJAA 1D1AA 1HF0A 2E2IJ 1S72I 4HPQA 4LJZF 3ZOBA 2X0LA 3V42A 3UNGC 5HODA 2V1UA 3ZGKA 4KT6A 5E1ZB 5E8GA 2W1OA 3GFJA 3DEWA 3ZR8X 4U0YA 1I1SA 3HUGA 2X4HA 1G2HA 3QP6A 4HX4A 1MD0A 4P5OA 4MEXF 1W0TA 3BTCA 5BS6A 2L9SA 5IYDJ 5EZHA 4NQWB 3S14J 3HOWJ 4OAZA 2WC2A 1OKRA 5J3LA 3TGNA 3Q9SA 3I4MJ 1XMXA 3FXOA 3G71I 3IV5A 2M8GX 2LF8A 4D1QA 4P9FA 4E7ZA 2D1HA 4BHCA 2EK5A 2A5YB 3DFGA 1POGA 3ABKH 2P0WA 4LK1F 4HEA2 4OAYA 4C9YA 4A3KJ 4ENNA 4U87A 4UHTA 2UXNA 3HIFA 3KFWX 1Z3YA 2GOXB 3TQNA 1IRZA 2VJIA 4HQMA 2E2HJ 1GXPA 2VXDA 2LBFA 1O3SA 2IRFG 2P6SA 2JQ7A 4EVIA 3MWMA 3AL0C 2ZJ2A 2A69F 2E5ZA 1MBJA 1XD7A 2ID6A 3JSPA 3IUOA 2VBXA 1TW3A 2BYVE 3F6OA 2OCCH 1SFUA 2FX0A 1ETYA 2DLLA 1Y6IA 1FOXA 1FPQA 1REPC 2O8KA 2XVCA 3K2ZA 4J01A 3I53A 1S6LA 4GCVA 2PMZA 3GCMA 3BQZA 3T0YA 3BTLA 3AKZA 3WODF 1O7FA 4LOCA 2KZGA 3BC8A 1JT0A 5J1UA 2ZC2A 2HDWA 1S7AA 3HRUA 4E7KA 3PUBA 1DUXC 4BQOA 4I98B 2VPLA 2XIGA 3ZQGA 5LBQA 4ENJA 3VPRA 3G1LA 2DPDA 2ZKZA 4B44A 1ETWA 2HYGD 2DK8A 4DYRA 3V8KA 2IGNA 5HLTA 3J7AY 4M71A 1SFOJ 2X1EA 1YIJI 5DD4A 1FTTA 2DJIA 2COBA 2ELHA 2GBYA 2O0YA 4BJ5C 1ERDA 2Y69H 4XKBA 2IBDA 3KP4A 5EJCA 2A05A 1MZBA 2XAGA 1YS6A 1AKHB 3ECOA 4D7MA 3OYKA 1U9NA 3ZQLA 4L9JA 4KYWA 2Z2SB 4WXHA 2ESNA 2PX9A 2VOOA 2NOJB 3DBHB 5E17F 2LY1A 4LLGF 2QBYA 4KN7X 3K4CA 1QZYA 1R1TA 3A1YA 2EPFA 3S2DJ 3ML6A 2ZMEA 4BL0B 4RMNA 3RKWA 1TWHJ 1WI9A 3I0TA 3NQOA 5E20A 3RQIA 5IP7J 1U3EM 3S3MA 3HSRA 2MG4A 4ZYGA 1IN6A 4LGWA 4A3DJ 4QPQA 2MH2A 1JTXA 2OJED 4XRSG 5L3GA 1BI2A 5GAGJ 4A12A 4XL9A 4ESFA 2LREA 3KZYA 1X2MA 1VQ9I 1WWXA 2DA4A 2Z3YA 2KDOA 5M5YJ 3D0SA 1Y0UA 2W85A 4PJJA 4J19A 3I55I 1Z1DA 1GV2A 1YS7A 3GLXA 3SHFA 5KVRA 3RTRA 3BPXA 3LAJA 1LE8A 4MQVA 1U8RA 2HOSA 3FDYA 2JSPA 3ABUA 2F2EA 1N77A 3WTXC 5K7ZA 3IRQA 2XPVA 2GLOA 1UMQA 1LJ9A 3KCCA 3HRSA 5DEQA 3ZQCA 3BTIA 2WB1N 1FEXA 1VQOI 4E7IA 3NEUA 1JTYA 1G4DA 3G1MA 2M30A 2P7VB 3FK6A 2BOLA 1NTCA 2PEXA 2RQPA 2DOAA 3ESWB 3K4LA 2EV6A 1ETXA 1P4WA 2JT1A 4F3QA 3J80Z 4XNFA 1ZAOA 2KIMA 1EF4A 4XN0A 1E3HA 1MSEC 2YS9A 2ACJA 2CYYA 3V8LA 1WGXA 2M5WA 2PMZN 4XORA 2IEKA 4RLQA 3FXLA 3PNTA 5H6RA 3WGIA 3BCBA 3JRDA 4M6YA 3TEDA 3LQQA 4BU2A 2BHZA 3L2VA 3I71A 2QSHX 4U7BA 2GXGA 1J75A 2PJRB 2JWTA 3HZJA 5TJJA 4PK4A 4EJWA 4XKCA 3HGYA 4IQ4A 4HBLA 2DDBA 4IJAA 3C2BA 3DBLB 1ZR4A 4WK8F 1B72A 2ZSHB 3KP7A 5FRMA 1IXRC 2HQRA 3L7WA 4HW0A 2CJJA 5JHUA 5DUIA 1QO0D 4WXCA 3HBLA 1FNNA 4HSTA 2E71A 4DYQA 1K78B 2L4AA 1K79A 1FTZA 3OYHA 5HDGA 2ZO4A 3T8TA 5H2FC 3KEOA 3BG6A 1RZ4A 1T56A 2H1LA 2KT0A 5EG0B 1IXSB 2VE8A 3NRVA 4YRVA 4M3GA 3WU2C 2EV0A 3CESA 2CRGA 2QSFX 1QZZA 2EFWA 5JR3A 4XKWA 1RI7A 3ZMTA 3DCFA 1B9NA 1LKXA 1HKQA 2J5OA 4UY8I 4DBRA 4E7JA 1SC7A 1G3TA 4FHTA 2FE3A 3K2AA 4HAMA 2P5VA 2IS6A 5DV5A 4B48A 2HTSA 3BG7A 1S7EA 2AHQA 2RNJA 2DMPA 5B5EC 3K70C 2KJBA 2UXXA 1GV5A 2WAQA 1BI1A 2CQKA 1MDMB 3LFKA 1TWFJ 2F4IA 5F27A 4B1RA 2EJRA 4GDFA 1HKTA 2PMHA 4WCGA 3CCUI 5IOZA 2DYRH 5EZGA 3KZIC 1P92A 1K6OA 3HKZA 4CYCB 4EM2A 4WXDA 5FLXK 2MBFA 1ZG5A 5ICEA 2LKXA 1YQAA 4F52A 2E7WA 4ZDPA 1HW1A 5CJ9A 2DPUA 2LR8A 4M72A 3PQKA 5C4JJ 2VBWA 1FSHA 2B9SA 3A2KA 2DMUA 1IRXA 3Q0VA 2VN2A 1MH4A 4UUSB 1X1PA 1BL0A 5FB2A 1TW2A 1V55H 2WV1A 4E4HA 1YIOA 2BEOA 3WTVC 5FKNA 2VT2A 4BQAA 3CP2A 4BQQA 5D8LB 2NS0A 4C2UA 3JREA 3AAFA 1YJWI 1O7LA 1R7JA 4ZH4F 4L5IA 3DV8A 4R8HA 1Z05A 1KQ8A 4C3HJ 1RNLA 4YG2F 5GADJ 3A01A 4UV8A 2GXAA 3N4MA 5L3CA 1WH7A 2RKHA 3I54A 3OIOA 3G2BA 4RM2A 1W0UA 2XGXA 1DP3A 3DEEA 2HVQA 4LFUA 4ZYEA 2HZTA 3G73A 3GUDA 2BBYA 3BT9A 2Y30A 5KCMA 1X1CA 4BACA 3B02A 3DTIA 3DLLF 4M9SA 1J2XA 2OC6A 2IPQX 1S29A 1BN5A 2ECBA 1Z9CA 3IKTA 4LLNA 4A2UA 2E36A 1ITYA 3LWFA 2OBPA 3C2GA 3I58A 3E3VA 3S3NA 1XGSA 2P5KA 4XR6A 4Z6YA 2PI0A 3A0HC 3LL7A 2P6TA 1GVDA 3DKXA 4OWRB 2CQNA 1IN7A 4OMZA 4HF0A 5CKTA 3RI4A 5ED4A 1IDZA 1BR1A 2GA2A 1VNDA 4PDKA 3ZPLA 1FOYA 3JRIA 1LUJB 4ZYAA 3M07A 3CZ6A 2E60A 4RS8A 1AWCA 3IL2A 5BMZA 4QTRA 4MQ9F 2Z33A 3V4GA 1FP1D 3GMEA 5FLMJ 2VJ5A 4XN3A 3GZ6A 3S1NJ 2BHYA 1IW7F 1D0ZA 4D5FA 2XPWA 3CUQB 1TWAJ 3H0DA 1IV6A 1HOMA 1TQMA 2HFHA 2WAQN 1W5TA 2JJ7A 3O8HA 4RGSA 1RUOA 3F22A 4R79A 1WVRA 2NS8A 1APLC 3Q3SA 4W1UA 2OD5A 3AG4H 3AL0B 2GIZA 1W5CC 1EV7A 4KICA 1CGPA 1JUMA 1X1DA 5M3FJ 2YU9J 5D4RA 3WHCA 3HKZN 4XBFA 1S7OA 4C2MJ 1H0MA 2CV1A 3HRTA 5F08A 1MSFC 3PSFA 5LD2C 1N75A 4M6XA 5EEHA 3WHBA 2TDXA 2QLZA 1QQIA 3K6GA 5KAFC 2M4GA 2MGQA 2DCEA 3BZKA 3O8GA 3FM3A 5FKMA 1Y0NA 3OYDA 3VFZA 3OYIA 3ZMVA 2IP2A 1IUFA 3CF5F 1VF9A 2NVYJ 1HQCA 1A5JA 2HTJA 2L9RA 1BBYA 5CVRA 5FO5A 3FHZA 3HG9A 1SFXA 4KFCA 1SMTA 1UG2A 3FMRA 2R7ZJ 1XCVA 3ROUA 1XC5A 1FP2A 2CO5A 4AIDA 3S17J 5J1YA 3CD6I 4HF1A 2BV6A 3E5UA 2BVMA 3FXKA 3HM5A 4Y13A 1HXDA 2RGVA 1E3OC 1W7PB 3DEUA 5FFXA 1JKOC 3FK7A 1NK2P 1W4MA 2FOWA 2JA2A 3EYYA 1FYKA 5J8CA 2K85A 4LK0F 1GDTA 4MGRA 1B9MA 1FZPB 1Z7UA 2KLOA 4FASD 1B8IB 1MBFA 1YW9A 4IEJA 3CCEI 4XKVA 1WSUA 1GXQA 3W2AA 2VASA 3K4BA 4U0WA 4XQFA 1GUUA 2L54A 3TOAA 2Q0OA 3I59B 3K4MA 4K2EA 4XICA 3SEZA 3DBRB 2YX7A 2ESHA 2LLKA 5FKLA 1XN7A 2KKOA 2KZVA 3HB9A 3VDXA 2ELKA 1FMWA 4PJLA 4MTDA 2LKSA 5D5VB 4ASNA 3NARA 2K7LA 1R71A 4MFEA 1PJRA 1ZGAA 4DNCA 2DODA 2DA3A 1BC8C 1UHSA 3MKLA 4M3EA 1WHUA 1OCCH 4G12A 2V7FA 5EEAA 4N9IA 1HSTA 3A02A 1F9NA 1ZGWA 2F4MB 4PJ0C 4XSXF 1I3AA 1AKHA 3PFIA 3WG7H 4S05A 4KT5C 5TRDA 1RUNA 1K4SA 1I3QJ 5HOOA 5K5QA 1JGGA 3RSNA 2V26A 1IDYA 3UR3C 1ODDA 2CMPA 1ORKA 2GWRA 4KMUX 2E1MB 1Z0XA 2BW3A 4KIBA 2VC1A 4PUSA 4FETA 1VQMI 1SEUA 2CV2A 4A3JJ 2NVQJ 3IKVA 2Z1DA 2IS1A 5J6XA 2K86A 1QZEA 1G59A 1XX5A 2RNGA 3CDIA 3N05A 4BE0A 3LSJA 1IGNA 3P9KA 4LG0B 1HW5A 1SAXA 2HKOA 2K3PA 1A36A 1WFXA 2IVMA 1XMKA 1JE8A 2R7VA 1QVUA 1RC9A 3CLQA 5EEGA 2HWVA 5IYCJ 4D5CA 3ZRGA 1PUEE 1ZELA 3HC7A 4PFPA 2QCOA 3FXMA 4IHSA 4DW6A 2CFXA 2VB6A 4HYEA 3DQVC 1BIAA 2V9VA 3H5AA 4L9VA 2EB7A 3SZTA 4ZZDA 4R1HA 3RZDJ 3I9V2 4U0VA 2STWA 3S93A 1FBUA 1FYLA 2LRDA 4L5JA 3ABTA 1VZ0A 5BOXA 4MO7A 4BHBA 1ZR2A 2YX4A 1Y1WJ 2A61A 5B1AH 2E1NA 5HDNA 4GYIA 1R6RA 4E6KG 4ESJA 3HXLA 3DPTA 5F1JA 2CV0A 5ICCA 3IWFA 4I2OA 2Z16A 5HVQC 1FOKA 1ZRCA 2ICWG 1ETVA 1T95A 1T98A 2VLAA 3ZXSA 5ICGA 4GRIA 5H20A 4IQJA 1WCMJ 3FWEA 3CCYA 4A0ZA 1KU9A 4BH9A 5HS7A 2XAUA 1Y8RB 3DPUA 3F0CA 4MTEA 4CA0A 2PMUA 4BJTA 4B4CA 3LAPA 3OYLA 4XLPF 2Q2EB 1KU7A 2PJRA 1HC8A 2MW8A 1Z7LA 4BYYA 2NYXA 1YW7A 3BG5A 4W97A 1TNTA 2ETHA 2R5ZB 2EA2A 1J0RA 3PO3J 2KPMA 4S04A 5JFRA 3TBIA 2O5RA 2E34A 2JUGA 3ELKA 4YIIA 1A35A 4UUVA 2LD5A 4IHWA 3QAHA 5A2QK 4IRHA 3RPUA 3W6VA 5DTDA 1IC8A 5JLXA 5FJ8J 1T39A 2V4JC 1SD7A 3F8CA 2CW7A 5LEJA 1O4XA 2QKLB 2JTVA 4BE2A 2GZWA 1U78A 2Z9OA 4KISA 4OIPF 3V7SA 3LSHA 2XAQA 2VONA 3S16J 1E0EA 3TW7A 2DMNA 1OR7A 3HRMA 4FQGA 4A3GJ 5HDKA 3FISA 2FEZA 4JBAA 4O5VA 3PL8A 3WE2A 3Q0WA 5K5OA 4BKXA 3KIOA 2BGCA 2CUZA 3KP6A 2R0QC 4XLFA 3MFKA 3LSMA 5JVGF 3BR0A 4ZTFA 1QU3A 3D5SC 3K10A 1JI8A 3W2WA 5E79C 1SVMA 1BA5A 2FMLA 1MJ9A 1YJNI 1P4XA 4AD9A 1D5YA 2LYCA 3CUQC 2X1DA 3F6VA 5AIPA 3MZHA 2L7FP 3R6SA 5LRSA 4IPAA 3K4JA 2EWNA 2CQXA 5BPDA 4GYGA 5D5WB 1XMAA 5EYRA 3K69A 3RJPA 5LGTA 5J4VA 3MKZA 2LFBA 1U5TB 3CJTB 3GZ5A 4CZZA 5DCFA 2CGPA 4IRGA 2KRCA 4A3FJ 1PP7U 2R7DA 5FROA 2WA0A 3U2RA 3K4KA 1X3UA 3PIPF 1TWCJ 4G9YA 2O6GE 3JRGA 2VKDA 4Q47A 1DU0A 2VQHA 3DTKA 3GEZA 1YJ9I 5FLVA 4XLEA 4UUSA 3HJEA 1WJCA 1ONVA 3KYDB 3QWLA 2IA2A 3IRRA 4F55A 1OQYA 4B09A 1FIAA 1PUFA 2IW5A 2VXZA 4B3XA 4PCQA 4GFBA 1PDNC 2LMDA 4PSXA 1B1BA 3G6EI 3BG3A 2ID3A 3LSKA 3QP5A 3JCUC 5F04A 5IT9K 2N8GA 1VQPI 1MMNA 2V1XA 4UV9A 1RETA 3TDZC 1GHCA 5ICFA 3J81Z 3RPUD 2DTZA 3CCVI 3OMYA 2QKMB 1Y1VJ 2FUG2 4NDLA 3LMMA 2HQNA 5JHFA 2HNHA 3SDGA 5D5XB 4C3IJ 4II3A 4XRMA 2OTLI 3S1MJ 2QYOA 3LNQA 2HYFA 4LIUA 3FKIJ 2LY9A 2ZCWA 4ZZLA 3E6CC 1SFEA 1T0FC 3WTUC 3GYHX 2JPBA 4IL6C 2GM4A 2WBMA 2Y0SN 5B1BH 2WY8Q 3FHNA 1NK3P 3DF8A 3AFHA 1AU7A 4OMYA 1ENHA 2R92J 4QPOA 2PBIA 5IPAA 2VUMJ 3CDLA 3FMSA 1G3YA 2F5VA 4UVBA 3CCQI 2X85A 1BR2A 2DO7A 3MAJA 3H92A 2HOEA 1QA6A 2OZUA 5FD5A 2O8XA 1BM9A 4RGUA 5TGTA 3T5XA 5F64A 1Z67A 1MBHA 3FXQA 4AYBA 3H3VK 3LFUA 3KEYA 3JAMZ 2IS2A 1XS9A 5EGOB 3WTWC 1BIBA 2G7UA 4BQNA 3CC4I 1TP4A 2XF6A 1FBSA 3WGHA 4L9TA 4KIFA 1DPUA 5ILVA 1P6RA 2FJ1A 3M1EA 5BPIA 1FT9A 3CF2A 3S2WA 1FX7A 2EIKH 1I1GA 2ZBKA 3L09A 4RGRA 2OV7A 3WG9A 3CC2I 3MD2A 4RB3C 5JLWA 1BI0A 2H09A 3WGGA 3CUQA 2OPTA 1ZG1A 2AS5F 1HDDC 4EV0A 2MH9A 3S3OA 3H5NA 1H9GA 2K9SA 2DI3A 3I3LA 1T33A 2DN0A 1K4TA 1HBXG 3FX3A 2W82A 1R1VA 2W48A 2GAUA 4CCNA 4JX5A 3HOSA 3L2WA 1V54H 2XUBA 1YRNB 2OAZA 4CSWA 2EBIA 1H9TA 2VJ4A 4FE7A 3IWZA 3GW2A 1BJZA 1QRYA 2E1MC 4A0XA 3ECHA 1F43A 1KYWA 4MHGA 2W00A 2MD5A 4RAYA 2ZJPF 2G0EA 2TCTA 3BLYA 3H1CA 1L3LA 3VODA 2L02A 3RIRA 2A6EF 3LSTA 2JSCA 3ZMUA 2MC3A 2XKPA 3Q9VA 5KK1A 1LFPA 2HR3A 3M4OJ 3EUHC 4F91B 1JUPA 2V1NA 3ZCOA 3C1DA 5LLQA 1YE9A 1F36A 3SDBA 5K7HA 2M7BA 3T1BA 3ZQHA 4JP0A 5F6FA 2ELJA 4RAGA 2L4MA 5BNGA 2P7CB 4F92B 1T0FA 3IH4A 2XGDA 1W7PA 2UUZA 2XGEA 1LB2A 3RDIA 4P1WA 3GFLA 2K27A 1M1EB 3TKYA 2KQRA 3CO7C 1QHGA 2JUCA 2W24A 3IH2A 3H9GA 2LP0A 1SD4A 3KP5A 2BZTA 3WU0A 4UB6C 2XAFA 4F7ZA 3G4SI 1FLIA 2E1CA 3R0JA 5IYBJ 1EH6A 4DYCA 3TL4X 1DP7P 3IHUA 2XRLA 3GF2A 2IT0A 1VI0A 2R3SA 2X51A 3TO6A 5LHHA 4LB6B 4NHJA 2E35A 3I59A 1XGMA 3L00A 4TV7A 3HUGB 1BOAA 1FWZA 2P4WA 2PN6A 2XHKA 3QYFA 3TO7A 4M73A 2K3FA 4BXUA 3SYTA 4BAYA 4CICA 2HU9A 3OS0A 2RREA 3VEPA 3KP2A 3MKWB 3HGGA 3ISPA 4BHPA 5E3NA 4P9UA 2X6YA 2A07F 1X3ZB 2FNAA 2K9QA 1KQ0A 1XSXA 3AG2H 3G1OA 4Q5SF 3EYIA 4I01A 3EETA 2F4OB 4X0GA 1XGNA 3PFYA 3KX2A 1WJFA 1KQ9A 3RYPA 1CF7A 2H1KA 1XDSA 2L2OA 1KYZA 5C3EJ 3LSGA 2EIMH 5CQGA 4H0EA 1IN5A 2HYJA 2HQAA 3CP8A 2EFOA 1T6SA 3D1NI 3CUOA 5E8IA 1R5GA 3ZMSA 5LRRA 2LBFB 4XMYA 2DT6A 3ZQIA 4YFKF 2HKXA 5C44J 4BDYA 1OISA 2R7QA 1AHDP 3DTEA 2F6CA 2DW4A 3ULQB 3KPHA 2OCEA 1GLNA 2FBHA 5D4SA 3COAC 1WJDA 3FF5A 3GFMA 2DDAA 2TRTA 4HLXA 1ZHFA 1OCZH 2K9MA 3ASNH 3BJAA 4I7HA 4A3LJ 1A04A 2CUFA 1XB4A 1MNDA 2DT5A 2KIQA 1JUSA 3T8RA 3F8NA 5J1RA 3HSFA 2D45A 4EGZA 3PIOF 1IRGA 4WX9A 1IV8A 4IVNA 1H89C 1XTAA 2JVGA 1U5TC 1Z6TA 1VQKI 3PJRA 4P96A 2DA1A 2G9WA 3F8FA 3ZQ7A 5B66C 2V1DA 1VFCA 2XSDC 3HSEA 2WADA 3DPLC 1L0OC 4M3DA 3BTJA 5FKKA 2JK3A 4XLHA 2CQ7A 4MEYF 5LEKA 1E17A 1WJBA 1ZYRF 2CH0A 2XRNA 3BR1A 3E6DA 5AONA 5LHGA 1ZRFA 4NC8A 3W2VA 4ZYDA 3S1QJ 2X48A 5D6FA 2QQ8A 4A6DA 4KUMA 3HL2A 2L9VA 1D1CA 5CVJA 1ETOA 1RESA 5FGMA 3CCLI 3DU6A 2R7WA 4UVAA 1KA8A 4RA2A 5J40A 4WF2A 3WE3A 2CFOA 3R61A 1P7IA 2ZFWA 4ZTJA 2XGCA 2EH3A 5HS9A 2ZB9A 4AWXB 1LFUP 2OA4A 1R00A 4Y17A 3WTZA 2IA0A 2ZMEB 4BXXJ 3BPVA 3KETA 1WZ2A 2DMTA 2DQRA 5ERIA 3GLLA 2DU9A 4IOCF 2OTJI 4XRSA 2RDPA 4MLOA 2R5YB 1MIJA 1DGWY 3CC7I 5F1RA 1BW5A 3PUFA 3BR3A 2Q1ZB 5LFAA 2R5ZA 5GTHC 1BR4A 5E3OA 1K83J 3PSIA 2F5FA 2HZDA 4FT8A 1IAWA 1UB9A 1I5ZA 1P4AA 2W7NA 1ZKGA 2HPIA 4DGWB 2VL8A 1OCRH 4M9ZA 1DGRM 3U21A 2KIUA 1IJWC 1D0YA 3W6JB 4WWCA 4BUPA 1ZREA 3OOPA 2ZJQF 1FYMA 4O3MA 3R0AA 1XG1A 3KLNA 5K1YA 1U2WA 4G6TB 3OS1A 2DJNA 4NQWA 3IP4B 1IF1A 1VQ7I 1LVKA 3BR2A 2YR2A 2EIJH 3GXOA 3ERED 2CS3A 3FBNB 1PYVA 3RQ4A 1BC7C 4CYDA 2HPMA 1G3WA 2FBKA 4HV5A 2WAEA 4J00A 1UZCA 1D3YA 4A0YA 2B7EA 4Q48A 2HXIA 3WTSC 3RYRA 4DBQA 4D0PA 2L7MP 4E7HA 4A3BJ 4L18B 2AXTC 2CWEA 3S15J 2BXZA 4EQQA 3PQJA 4CHUA 3BJ6A 3BWGA 4MNUA 1TQIA 5IP6A 1MBKA 2MD0A 3CMAI 4HRIA 3OR1C 3HOVJ 4RLFA 1J7KA 1G3SA 4UB8C 1OMIA 3VB2A 1U5TA 3D5LA 4FE4A 5D5UB 2QQ9A 5CLSA 4IHTA 1N25A 5LHIA 5DS9A 4KITB 2RAEA 1TQPA 4YIFA 2L0KA 5HLHA 1KU2A 3K70D 3K9TA 2IAIA 4AC0A 5IOYA 4JYKA 5LGNA 2LTPA 1JHFA 3CCJI 2G7HA 2ISYA 1X2NA 2BXYA 5EF6A 1J9IA 4G6DA 2Y9YA 4CCOA 1O3RA 4ON0A 2HOTA 1WPKA 4I76A 4ZDLA 1BJAA 1IN4A 1EH7A 1HLVA 3J7ZI 2HOAA 4RB0A 3K0LA 2M0CA 3Q0UA 1H88C 4RBOA 1MH3A 1LDJA 3SQNA 5F0HA 1X1AA 4M9XA 2C6YA 1D5VA 1U0JA 1Z6RA 3FXRA 3RKYA 2ADUA 2EZIA 3D5RC 4MIMA 4OOIA 4BNCA 4XLAA 3V7RA 1JJ6C 4KDPA 3LA7A 1WJ5A 3F3XA 4PGHA 3OYEA 3J7YJ 2K9NA 1TL8A 2P8TA 2STTA 5H6QA 3GFIA 2QWWA 3GBGA 2HVSA 4NC6A 3GTKJ 2X6OA 1RPWA 2R7OA 4G8XA 2MABA 1UHWA 4N9HA 2R4GA 1EA3A 2FXAA 2B63J 2VODA 1E3PA 1VQ6I 3CMYA 1CQTA 3I64A 4AIHA 4L5EA 5J47A 1ULYA 2RN7A 2YPRA 2XB5A 3GTGJ 1FSEA 2OZ6A 1TLHB 2AXLA 3OR2C 5GP9A 4EJUA 4HQEA 1YTYA 3RCOA 2M8EA 4XOTA 3TP0A 4YFNF 2FQ4A 2JRTA 3P9CA 2DA6A 2MYSA 2JA7J 4V2GA 4Y4RA 1MKMA 2XKOA
chains in the Genus database with same CATH topology
2Z99A 5JI6A 1LDKB 2K4BA 2NNYA 5DCMB 1TBXA 1HW2A 3W6KB 3DP7A 3M7GA 2K4JA 2FMYA 2K02A 4O6JA 2A6HF 4OIOF 4KIGA 1RIOH 1JGSA 3OV8A 4UXNA 3BP8A 4XLNF 4HV6A 4A6EA 3BROA 5D8KB 1T2KA 4HDVA 2XV4S 1Q1HA 3SZPA 2W25A 4A5NA 4G6QA 1NHAA 3CJNA 5FLXZ 2FA5A 2FRHA 3SXYA 2Y48A 1EH8A 1ON2A 1HSJA 4Q4ZF 4RB1A 2LF7A 5CVVA 2J5PA 1VTNC 4UVCA 3RPQA 1SMYF 4LB5A 3JSOA 1LNWA 3H3ZA 3IC7A 1K78A 2H6CA 1YW8A 3G3ZA 5AIQA 2E7XA 1WKMA 1J59A 4GXOA 2A3SA 2UZKA 1MJAA 2IJLA 3ZP5A 2VE9A 3EDPA 2FF4A 1JXSA 1KGSA 2JPCA 2MLGA 1FBQA 2CW0F 1D8KA 1LQ1A 3O2PE 1MDMA 4CGZA 1V4RA 2HDCA 1TTYA 2H6BA 2WWYA 1UCRA 3JTGA 1FC3A 2OQGA 3E5QA 3HYIA 2QUFA 2VBYA 3WTYC 3EQLF 1ZLJA 2Z5UA 4Z2YA 2WV0A 5L3DA 5L3BA 2QZ8A 1AOYA 2BE5F 2RVCA 1K7AA 1S3JA 4U7DA 3LA3A 1OYYA 2M1BA 4RGXA 1USTA 4CDGA 3I4PA 1R23A 3FMQA 2EFQA 4DQ2A 3BDDA 2EV5A 1TNSA 2LSOA 5DDGA 1DPRA 4G7HF 3CDHA 3M9AA 3F23A 5L3FA 3E97A 4KMFA 5J8FA 2F5DA 2RV8A 4LLLA 4HLYA 3N97A 1MJBA 2ISZA 2DQLA 4G7OF 3R4KA 3HTSB 4ESBA 4OIQF 4RAZA 4QLCU 2DBBA 1S8NA 1YFHA 4CXFA 2EA4A 4KNYA 4FX0A 2Y75A 5IT3A 4ENMA 1XGOA 3F8BA 1HKSA 4M74A 3KP3A 1I27A 2LNBA 3C7JA 3JTHA 1YG2A 3I5UA 3MCZA 4G7ZF 1U6GA 3LA2A 1UFMA 3K1NA 3C18A 2YSRA 3KEQA 4HDUA 5FFZA 2EFNA 5DYMA 1DDNA 2O61A 2PJPA 2GQQA 1ZGJA 2LDUA 4FX4A 1YLFA 2XAHA 3BZ6A 3P7NA 3VOEA 1OYWA 3ZMZA 4EM0B 2PFBA 2NAZA 1R58A 3WTTC 2W57A 1P2FA 4GO1A 3WU1B 2QM3A 4ENKA 3GVAA 3QRFF 3GWZA 4HF2A 2O3FA 2ZNZA 3KE2A 2KIFA 2PLYA 3HHGA 2FQ3A 1B4AA 2Q8KA 3DXJF 2OQRA 1LEAA 1E2XA 4JK1X 2VBZA 4AIKA 1R36A 3KLOA 2LKPA 3J7AO 2DAOA 2XASA 1XSDA 4OINF 5CVUA 3SFZA 4YFXF 1IXCA 1PP8F 3TDUC 2GIVA 3M8FA 3JW4A 1WRJA 2QVOA 4L9NA 1USSA 1O3QA 2DTRA 5JVTA 4NB5A 3Q5FA 4JQFA 1ZN2A 3R60A 4GGGA 1GVJA 1QPMA 1MGTA 1FY7A 1IRFA 2L3DA 1V3FA 3E6BA 2L01A 3DKWA 1F4KA 1W7PD 4EGYA 2W84A 2F5CA 4XRFA 4EJVA 5A2QZ 4EJTA 4LG0A 2O03A 4E70A 4KN4X 4OU0A 4OIRF 2DK5A 3V8JA 3L2CA 3EUHA 4CO8A 4LMYA 5HLGA 3GX4X 5DCMA 3BOQA 3MQ0A 2V79A 5ILUA 2VC0A 1SD5A 4EJOA 2P5LC 3QPTA 2M87A 4P55A 2JZYA 1ZH5A 3E6MA 1B59A 2QQBA 3P9IA 1UHMA 1XDUA 2PG4A 4I02A 3K1MA 2F5EA 3E5XA 1B6AA 3L9FA 2COMA 2QBYB 1LEBA 3FXUA 5D6EA 3RKXA 1T38A 4G94A 5DD8A 4IRIA 2M45A 2NRAC 2FBIA 2FU4A 2Q2EA 1OPCA 3CLOA 4Y15A 3BJOA 5IT9Z 3C3WA 3REOA 2WTEA 4KA4A 3F72A 2V6CA 1BI3A 3O6BB 4ETSA 3O3KA 3ZN0A 1IN8A 4LD5A 4N0BA 3J81K 1G6NA 2CSOA 2D2WA 2H94A 1KU3A 4IXAA 2IA1A 2FOKA 4AVPA 4L0ZB 3HTUA 3H3UA 2ZNYA 1ZLKA 2R7FA 2NNNA 2PQ8A 2FNPA 5E1WA 4HA8A 2B0LA 1C0WA 1QGPA 3JAMK 1WQ2A 2A68F 1Z91A 2ZXJA 2QENA 1IUYA 1O57A 4AIJA 4HX7A 2HGCA 2KJCA 2MLKA 1SD6A 3FM5A 2HS5A 5E18F 2XAJA 2HEOA 2DFIA 6PAXA 2GXBA 3QU3A 3MZYA 4PZJA 4L0YB 1R1UA 1STZA 2XROA 1ON1A 3QPHA 5ILSA 3J80K 4I0AA 5CYVA 3TOBA 1JHHA 1CF7B 1O3TA 2KRFA 2Y0MA 3QOPA 3HOTA 2D1VA 4B8XA 1F5TA 4HX8A 3U1DA 3F8MA 4HZFA 5LGUA 4EMSA 4QWQA 5DUKA 3TO9A 2EFPA 3BY6A 3MEXA 4RB2C 2UWMA 4U88A 2QQAA 1OYIA 3K1PA 5E1XA 2MA3A 4IF4A 3FZVA 3LQRA 5L3EA 4HOBA 2CG4A 5HLIA 4I0BA 1R22A 3CTAA 1QNTA 4I09A 1XSVA 2FSWA 1YYVA 2VT3A 5HS8A 2OU2A 1LDDA 3U9GA 1F1ZA 4XSZF 3V7CA 4ZYHA 3HHHA 3ZN1A 1ZRDA 5FD6A 3QU6A 1D8JA 3KZZA 5K5RA 4UNOA 3M8EA 1W5SA 1R5HA 1IZ1A 1LVAA 5BQTA 3F21A 3B73A 3ZMDA 1XCBA 3GO5A 1J5YA 1ZARA 1ZG3A 1YO5C 4EM1A 2VOPA 4PGGA 2YU3A 3CO6C 2GA1A 2H27A 4A5MA 5CVIA 1I6XA 2RC4A 1QBJA 4LJZF 2V1UA 2X0LA 5E1ZB 5E8GA 3GFJA 4U0YA 1I1SA 3HUGA 2X4HA 3QP6A 4HX4A 1MD0A 4P5OA 4MEXF 5BS6A 2WC2A 1OKRA 3TGNA 3Q9SA 2LF8A 4P9FA 2D1HA 4BHCA 2EK5A 2A5YB 3DFGA 4LK1F 4ENNA 4UHTA 2UXNA 3HIFA 3KFWX 3TQNA 4HQMA 1GXPA 1O3SA 2IRFG 2P6SA 4EVIA 3MWMA 2ZJ2A 2A69F 1XD7A 3JSPA 1TW3A 2VBXA 2BYVE 3F6OA 1SFUA 2DLLA 1FPQA 1REPC 2XVCA 3K2ZA 3I53A 1S6LA 4GCVA 3T0YA 3WODF 1O7FA 1S7AA 3HRUA 1DUXC 4I98B 2XIGA 5LBQA 4ENJA 2DPDA 2ZKZA 2HYGD 2DK8A 3V8KA 4M71A 5DD4A 2ELHA 2O0YA 3KP4A 1MZBA 2XAGA 1YS6A 3ECOA 4L9JA 4KYWA 4WXHA 2ESNA 2VOOA 5E17F 4LLGF 2QBYA 4KN7X 1QZYA 1R1TA 3ML6A 2ZMEA 3RKWA 1WI9A 3I0TA 3NQOA 5E20A 1U3EM 3HSRA 4ZYGA 1IN6A 4LGWA 2MH2A 5L3GA 1BI2A 4A12A 4ESFA 3KZYA 1WWXA 2Z3YA 3D0SA 1Y0UA 2W85A 1Z1DA 1YS7A 3GLXA 3SHFA 5KVRA 3RTRA 3BPXA 3LAJA 4MQVA 1U8RA 3ABUA 2F2EA 3WTXC 3IRQA 1LJ9A 3KCCA 3HRSA 5DEQA 3NEUA 1G4DA 2M30A 2P7VB 2PEXA 2RQPA 2EV6A 2JT1A 1P4WA 3J80Z 1ZAOA 2KIMA 2ACJA 2CYYA 3V8LA 2M5WA 5H6RA 3WGIA 4M6YA 3LQQA 3I71A 4U7BA 2GXGA 1J75A 5TJJA 4EJWA 4HBLA 4IJAA 4WK8F 3KP7A 1IXRC 2HQRA 3L7WA 4HW0A 5JHUA 5DUIA 1QO0D 4WXCA 1FNNA 1K78B 2L4AA 1K79A 5HDGA 2ZO4A 3T8TA 3KEOA 1RZ4A 1IXSB 2VE8A 3NRVA 2EV0A 1QZZA 2EFWA 5JR3A 1RI7A 3ZMTA 1B9NA 1HKQA 2J5OA 1G3TA 4FHTA 2FE3A 4HAMA 2P5VA 5DV5A 2HTSA 2RNJA 2KJBA 2UXXA 1BI1A 2CQKA 1MDMB 3LFKA 2EJRA 1HKTA 2PMHA 4WCGA 1P92A 1K6OA 4EM2A 4WXDA 5FLXK 2MBFA 1ZG5A 5ICEA 1YQAA 2E7WA 1HW1A 5CJ9A 2DPUA 4M72A 3PQKA 2VBWA 1FSHA 2VN2A 5FB2A 1TW2A 1YIOA 2BEOA 3WTVC 2VT2A 4BQAA 5D8LB 2NS0A 3AAFA 1O7LA 1R7JA 4ZH4F 4L5IA 3DV8A 4R8HA 1Z05A 1KQ8A 1RNLA 4YG2F 4UV8A 3N4MA 5L3CA 2RKHA 3I54A 2XGXA 4LFUA 4ZYEA 2HZTA 3G73A 3GUDA 2BBYA 3B02A 4M9SA 1J2XA 2IPQX 1Z9CA 1S29A 1BN5A 3IKTA 4LLNA 4A2UA 3LWFA 2OBPA 3I58A 3E3VA 1XGSA 2P5KA 2PI0A 2P6TA 1IN7A 4OMZA 4HF0A 3RI4A 5ED4A 2GA2A 4PDKA 3ZPLA 4RS8A 1AWCA 3IL2A 5BMZA 4MQ9F 2Z33A 3V4GA 1FP1D 3GZ6A 1IW7F 3CUQB 1TQMA 2HFHA 4RGSA 1W5TA 1RUOA 3F22A 4R79A 2OD5A 1CGPA 1EV7A 4KICA 5D4RA 4XBFA 1S7OA 1H0MA 3HRTA 4M6XA 5EEHA 2TDXA 2QLZA 1QQIA 3FM3A 3VFZA 3ZMVA 2IP2A 1HQCA 2HTJA 5CVRA 1BBYA 5FO5A 3FHZA 1SFXA 4KFCA 1SMTA 3FMRA 1XCVA 3ROUA 1FP2A 2CO5A 4HF1A 2BV6A 3E5UA 4Y13A 1HXDA 2RGVA 1W7PB 3DEUA 5FFXA 1W4MA 3EYYA 1FYKA 5J8CA 4LK0F 4MGRA 1B9MA 1FZPB 1Z7UA 1YW9A 1WSUA 1GXQA 4U0WA 2L54A 3TOAA 2Q0OA 3I59B 4K2EA 2YX7A 2ESHA 1XN7A 2KKOA 4MTDA 5D5VB 4ASNA 2K7LA 1ZGAA 4DNCA 1BC8C 4N9IA 1HSTA 1F9NA 4XSXF 3PFIA 4S05A 5TRDA 4KT5C 1RUNA 5HOOA 5K5QA 1ODDA 2GWRA 4KMUX 4KIBA 2VC1A 3IKVA 5J6XA 2K86A 3P9KA 4LG0B 1HW5A 1SAXA 2HKOA 2IVMA 1XMKA 1JE8A 5EEGA 2HWVA 1PUEE 4IHSA 2CFXA 4HYEA 3DQVC 1BIAA 2V9VA 4L9VA 2EB7A 3SZTA 4ZZDA 4R1HA 4U0VA 2STWA 1FBUA 1FYLA 4L5JA 3ABTA 5BOXA 4BHBA 2YX4A 2A61A 2E1NA 5HDNA 4GYIA 4ESJA 3DPTA 5ICCA 3IWFA 4I2OA 5HVQC 1FOKA 1ZRCA 1T98A 5ICGA 5H20A 3FWEA 4A0ZA 1KU9A 4BH9A 5HS7A 4MTEA 2PMUA 3LAPA 4XLPF 1KU7A 4BYYA 2NYXA 1YW7A 1TNTA 2ETHA 2EA2A 1J0RA 4S04A 5JFRA 3ELKA 4YIIA 4UUVA 3QAHA 5A2QK 4IRHA 3RPUA 1T39A 3F8CA 1SD7A 5LEJA 2JTVA 2GZWA 1U78A 2Z9OA 4OIPF 3V7SA 2XAQA 2VONA 1OR7A 3HRMA 5HDKA 2FEZA 4JBAA 4O5VA 3WE2A 5K5OA 2BGCA 3KP6A 3MFKA 2FMLA 1MJ9A 1P4XA 4AD9A 3CUQC 3F6VA 5AIPA 3MZHA 3R6SA 5LRSA 4IPAA 2EWNA 5BPDA 4GYGA 5D5WB 1XMAA 3K69A 3RJPA 5LGTA 1U5TB 3GZ5A 4CZZA 5DCFA 2CGPA 4IRGA 1PP7U 2R7DA 3U2RA 1X3UA 4G9YA 2O6GE 4Q47A 3GEZA 1ONVA 2IA2A 3IRRA 4B09A 2IW5A 2VXZA 4PCQA 1PDNC 1B1BA 3QP5A 5IT9K 2V1XA 4UV9A 3TDZC 1GHCA 5ICFA 3J81Z 2HQNA 5D5XB 2QYOA 2HYFA 2ZCWA 4ZZLA 3E6CC 1SFEA 3WTUC 3GYHX 2JPBA 3DF8A 4OMYA 2PBIA 3FMSA 1G3YA 4UVBA 2DO7A 3MAJA 3H92A 2HOEA 2OZUA 5FD5A 2O8XA 1BM9A 4RGUA 3T5XA 5F64A 3FXQA 3JAMZ 3WTWC 1BIBA 2G7UA 1FBSA 3WGHA 4L9TA 4KIFA 1DPUA 5ILVA 1P6RA 3M1EA 5BPIA 1FT9A 3S2WA 1FX7A 3L09A 1I1GA 2ZBKA 3WG9A 4RGRA 4RB3C 1BI0A 2H09A 3WGGA 3CUQA 1ZG1A 2AS5F 4EV0A 2MH9A 1H9GA 2DI3A 1HBXG 3FX3A 1R1VA 2GAUA 3HOSA 2XUBA 2OAZA 1H9TA 3IWZA 3GW2A 4A0XA 3ECHA 1KYWA 4MHGA 4RAYA 2MD5A 1L3LA 3VODA 2L02A 3RIRA 2A6EF 3LSTA 2JSCA 3ZMUA 2MC3A 2XKPA 3Q9VA 5KK1A 2HR3A 5LLQA 3C1DA 3T1BA 5F6FA 2L4MA 2P7CB 1T0FA 1W7PA 1LB2A 3RDIA 3GFLA 2K27A 3TKYA 3CO7C 2W24A 1SD4A 3KP5A 3WU0A 2XAFA 4F7ZA 1FLIA 2E1CA 3R0JA 1EH6A 1DP7P 3IHUA 3GF2A 2IT0A 2R3SA 3TO6A 5LHHA 4LB6B 4NHJA 3I59A 1XGMA 3L00A 4TV7A 1BOAA 1FWZA 2P4WA 2PN6A 2XHKA 3TO7A 4M73A 4BXUA 4CICA 4BAYA 3VEPA 3KP2A 3ISPA 4BHPA 4P9UA 2A07F 2FNAA 1KQ0A 1XSXA 4Q5SF 3EYIA 4I01A 3EETA 1XGNA 1CF7A 1KQ9A 3RYPA 1XDSA 1KYZA 4H0EA 1IN5A 2EFOA 1T6SA 3CUOA 5E8IA 1R5GA 3ZMSA 5LRRA 4YFKF 2HKXA 2DW4A 3ULQB 2FBHA 5D4SA 3COAC 3FF5A 3GFMA 4HLXA 1ZHFA 3BJAA 4I7HA 1A04A 1XB4A 2DT5A 3T8RA 3F8NA 3HSFA 2D45A 4EGZA 1IRGA 4WX9A 4IVNA 1U5TC 1Z6TA 4P96A 2G9WA 3F8FA 3ZQ7A 2V1DA 3HSEA 3DPLC 1L0OC 4MEYF 5LEKA 1E17A 1ZYRF 5AONA 2XRNA 3E6DA 5LHGA 1ZRFA 4ZYDA 5D6FA 4A6DA 4KUMA 5FGMA 5CVJA 4UVAA 1KA8A 3WE3A 4WF2A 3R61A 2ZFWA 5HS9A 4AWXB 2OA4A 1R00A 4Y17A 3WTZA 2IA0A 2ZMEB 3BPVA 3KETA 2DQRA 5ERIA 2DU9A 2RDPA 5F1RA 2F5FA 4FT8A 1IAWA 1UB9A 1I5ZA 1P4AA 4M9ZA 2KIUA 3W6JB 4WWCA 1ZREA 3OOPA 1FYMA 4O3MA 3R0AA 5K1YA 3KLNA 1U2WA 1IF1A 4NQWA 2YR2A 3GXOA 3ERED 1BC7C 4CYDA 1G3WA 2FBKA 4HV5A 1D3YA 4A0YA 4Q48A 3WTSC 3RYRA 4D0PA 4L18B 2CWEA 4EQQA 3PQJA 4CHUA 3BJ6A 3BWGA 4MNUA 1TQIA 1J7KA 1G3SA 1OMIA 3VB2A 1U5TA 3D5LA 5D5UB 2QQ9A 5CLSA 4IHTA 5LHIA 4YIFA 1TQPA 5HLHA 1KU2A 3K9TA 5LGNA 1JHFA 2G7HA 2ISYA 1J9IA 4G6DA 1O3RA 4ON0A 1BJAA 1IN4A 1EH7A 4RB0A 3K0LA 1LDJA 3SQNA 4M9XA 2C6YA 1D5VA 1Z6RA 3FXRA 3RKYA 2ADUA 4OOIA 4BNCA 3V7RA 4KDPA 3LA7A 3F3XA 4PGHA 2P8TA 2STTA 5H6QA 3GFIA 2QWWA 4G8XA 1UHWA 4N9HA 2FXAA 2VODA 3I64A 4AIHA 1ULYA 2RN7A 2YPRA 1FSEA 2OZ6A 1TLHB 2AXLA 4HQEA 4EJUA 1YTYA 2M8EA 4YFNF 2JRTA 3P9CA 1MKMA 2XKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z99 A;  5JI6 A;  1LDK B;  2K4B A;  2NNY A;  5DCM B;  1TBX A;  1HW2 A;  3W6K B;  3DP7 A;  3M7G A;  2K4J A;  2FMY A;  2K02 A;  4O6J A;  2A6H F;  4OIO F;  4KIG A;  1RIO H;  1JGS A;  3OV8 A;  4UXN A;  3BP8 A;  4XLN F;  4HV6 A;  4A6E A;  3BRO A;  5D8K B;  1T2K A;  4HDV A;  2XV4 S;  1Q1H A;  3SZP A;  2W25 A;  4A5N A;  4G6Q A;  1NHA A;  3CJN A;  5FLX Z;  2FA5 A;  2FRH A;  3SXY A;  2Y48 A;  1EH8 A;  1ON2 A;  1HSJ A;  4Q4Z F;  4RB1 A;  2LF7 A;  5CVV A;  2J5P A;  1VTN C;  4UVC A;  3RPQ A;  1SMY F;  4LB5 A;  3JSO A;  1LNW A;  3H3Z A;  3IC7 A;  1K78 A;  2H6C A;  1YW8 A;  3G3Z A;  5AIQ A;  2E7X A;  1WKM A;  1J59 A;  4GXO A;  2A3S A;  2UZK A;  1MJA A;  2IJL A;  3ZP5 A;  2VE9 A;  3EDP A;  2FF4 A;  1JXS A;  1KGS A;  2JPC A;  2MLG A;  1FBQ A;  2CW0 F;  1D8K A;  1LQ1 A;  3O2P E;  1MDM A;  4CGZ A;  1V4R A;  2HDC A;  1TTY A;  2H6B A;  2WWY A;  1UCR A;  3JTG A;  1FC3 A;  2OQG A;  3E5Q A;  3HYI A;  2QUF A;  2VBY A;  3WTY C;  3EQL F;  1ZLJ A;  2Z5U A;  4Z2Y A;  2WV0 A;  5L3D A;  5L3B A;  2QZ8 A;  1AOY A;  2BE5 F;  2RVC A;  1K7A A;  1S3J A;  4U7D A;  3LA3 A;  1OYY A;  2M1B A;  4RGX A;  1UST A;  4CDG A;  3I4P A;  1R23 A;  3FMQ A;  2EFQ A;  4DQ2 A;  3BDD A;  2EV5 A;  1TNS A;  2LSO A;  5DDG A;  1DPR A;  4G7H F;  3CDH A;  3M9A A;  3F23 A;  5L3F A;  3E97 A;  4KMF A;  5J8F A;  2F5D A;  2RV8 A;  4LLL A;  4HLY A;  3N97 A;  1MJB A;  2ISZ A;  2DQL A;  4G7O F;  3R4K A;  3HTS B;  4ESB A;  4OIQ F;  4RAZ A;  4QLC U;  2DBB A;  1S8N A;  1YFH A;  4CXF A;  2EA4 A;  4KNY A;  4FX0 A;  2Y75 A;  5IT3 A;  4ENM A;  1XGO A;  3F8B A;  1HKS A;  4M74 A;  3KP3 A;  1I27 A;  2LNB A;  3C7J A;  3JTH A;  1YG2 A;  3I5U A;  3MCZ A;  4G7Z F;  1U6G A;  3LA2 A;  1UFM A;  3K1N A;  3C18 A;  2YSR A;  3KEQ A;  4HDU A;  5FFZ A;  2EFN A;  5DYM A;  1DDN A;  2O61 A;  2PJP A;  2GQQ A;  1ZGJ A;  2LDU A;  4FX4 A;  1YLF A;  2XAH A;  3BZ6 A;  3P7N A;  3VOE A;  1OYW A;  3ZMZ A;  4EM0 B;  2PFB A;  2NAZ A;  1R58 A;  3WTT C;  2W57 A;  1P2F A;  4GO1 A;  3WU1 B;  2QM3 A;  4ENK A;  3GVA A;  3QRF F;  3GWZ A;  4HF2 A;  2O3F A;  2ZNZ A;  3KE2 A;  2KIF A;  2PLY A;  3HHG A;  2FQ3 A;  1B4A A;  2Q8K A;  3DXJ F;  2OQR A;  1LEA A;  1E2X A;  4JK1 X;  2VBZ A;  4AIK A;  1R36 A;  3KLO A;  2LKP A;  3J7A O;  2DAO A;  2XAS A;  1XSD A;  4OIN F;  5CVU A;  3SFZ A;  4YFX F;  1IXC A;  1PP8 F;  3TDU C;  2GIV A;  3M8F A;  3JW4 A;  1WRJ A;  2QVO A;  4L9N A;  1USS A;  1O3Q A;  2DTR A;  5JVT A;  4NB5 A;  3Q5F A;  4JQF A;  1ZN2 A;  3R60 A;  4GGG A;  1GVJ A;  1QPM A;  1MGT A;  1FY7 A;  1IRF A;  2L3D A;  1V3F A;  3E6B A;  2L01 A;  3DKW A;  1F4K A;  1W7P D;  4EGY A;  2W84 A;  2F5C A;  4XRF A;  4EJV A;  5A2Q Z;  4EJT A;  4LG0 A;  2O03 A;  4E70 A;  4KN4 X;  4OU0 A;  4OIR F;  2DK5 A;  3V8J A;  3L2C A;  3EUH A;  4CO8 A;  4LMY A;  5HLG A;  3GX4 X;  5DCM A;  3BOQ A;  3MQ0 A;  2V79 A;  5ILU A;  2VC0 A;  1SD5 A;  4EJO A;  2P5L C;  3QPT A;  2M87 A;  4P55 A;  2JZY A;  1ZH5 A;  3E6M A;  1B59 A;  2QQB A;  3P9I A;  1UHM A;  1XDU A;  2PG4 A;  4I02 A;  3K1M A;  2F5E A;  3E5X A;  1B6A A;  3L9F A;  2COM A;  2QBY B;  1LEB A;  3FXU A;  5D6E A;  3RKX A;  1T38 A;  4G94 A;  5DD8 A;  4IRI A;  2M45 A;  2NRA C;  2FBI A;  2FU4 A;  2Q2E A;  1OPC A;  3CLO A;  4Y15 A;  3BJO A;  5IT9 Z;  3C3W A;  3REO A;  2WTE A;  4KA4 A;  3F72 A;  2V6C A;  1BI3 A;  3O6B B;  4ETS A;  3O3K A;  3ZN0 A;  1IN8 A;  4LD5 A;  4N0B A;  3J81 K;  1G6N A;  2CSO A;  2D2W A;  2H94 A;  1KU3 A;  4IXA A;  2IA1 A;  2FOK A;  4AVP A;  4L0Z B;  3HTU A;  3H3U A;  2ZNY A;  1ZLK A;  2R7F A;  2NNN A;  2PQ8 A;  2FNP A;  5E1W A;  4HA8 A;  2B0L A;  1C0W A;  1QGP A;  3JAM K;  1WQ2 A;  2A68 F;  1Z91 A;  2ZXJ A;  2QEN A;  1IUY A;  1O57 A;  4AIJ A;  4HX7 A;  2HGC A;  2KJC A;  2MLK A;  1SD6 A;  3FM5 A;  2HS5 A;  5E18 F;  2XAJ A;  2HEO A;  2DFI A;  6PAX A;  2GXB A;  3QU3 A;  3MZY A;  4PZJ A;  4L0Y B;  1R1U A;  1STZ A;  2XRO A;  1ON1 A;  3QPH A;  5ILS A;  3J80 K;  4I0A A;  5CYV A;  3TOB A;  1JHH A;  1CF7 B;  1O3T A;  2KRF A;  2Y0M A;  3QOP A;  3HOT A;  2D1V A;  4B8X A;  1F5T A;  4HX8 A;  3U1D A;  3F8M A;  4HZF A;  5LGU A;  4EMS A;  4QWQ A;  5DUK A;  3TO9 A;  2EFP A;  3BY6 A;  3MEX A;  4RB2 C;  2UWM A;  4U88 A;  2QQA A;  1OYI A;  3K1P A;  5E1X A;  2MA3 A;  4IF4 A;  3FZV A;  3LQR A;  5L3E A;  4HOB A;  2CG4 A;  5HLI A;  4I0B A;  1R22 A;  3CTA A;  1QNT A;  4I09 A;  1XSV A;  2FSW A;  1YYV A;  2VT3 A;  5HS8 A;  2OU2 A;  1LDD A;  3U9G A;  1F1Z A;  4XSZ F;  3V7C A;  4ZYH A;  3HHH A;  3ZN1 A;  1ZRD A;  5FD6 A;  3QU6 A;  1D8J A;  3KZZ A;  5K5R A;  4UNO A;  3M8E A;  1W5S A;  1R5H A;  1IZ1 A;  1LVA A;  5BQT A;  3F21 A;  3B73 A;  3ZMD A;  1XCB A;  3GO5 A;  1J5Y A;  1ZAR A;  1ZG3 A;  1YO5 C;  4EM1 A;  2VOP A;  4PGG A;  2YU3 A;  3CO6 C;  2GA1 A;  2H27 A;  4A5M A;  5CVI A;  1I6X A;  2RC4 A;  1QBJ A;  4LJZ F;  2V1U A;  2X0L A;  5E1Z B;  5E8G A;  3GFJ A;  4U0Y A;  1I1S A;  3HUG A;  2X4H A;  3QP6 A;  4HX4 A;  1MD0 A;  4P5O A;  4MEX F;  5BS6 A;  2WC2 A;  1OKR A;  3TGN A;  3Q9S A;  2LF8 A;  4P9F A;  2D1H A;  4BHC A;  2EK5 A;  2A5Y B;  3DFG A;  4LK1 F;  4ENN A;  4UHT A;  2UXN A;  3HIF A;  3KFW X;  3TQN A;  4HQM A;  1GXP A;  1O3S A;  2IRF G;  2P6S A;  4EVI A;  3MWM A;  2ZJ2 A;  2A69 F;  1XD7 A;  3JSP A;  1TW3 A;  2VBX A;  2BYV E;  3F6O A;  1SFU A;  2DLL A;  1FPQ A;  1REP C;  2XVC A;  3K2Z A;  3I53 A;  1S6L A;  4GCV A;  3T0Y A;  3WOD F;  1O7F A;  1S7A A;  3HRU A;  1DUX C;  4I98 B;  2XIG A;  5LBQ A;  4ENJ A;  2DPD A;  2ZKZ A;  2HYG D;  2DK8 A;  3V8K A;  4M71 A;  5DD4 A;  2ELH A;  2O0Y A;  3KP4 A;  1MZB A;  2XAG A;  1YS6 A;  3ECO A;  4L9J A;  4KYW A;  4WXH A;  2ESN A;  2VOO A;  5E17 F;  4LLG F;  2QBY A;  4KN7 X;  1QZY A;  1R1T A;  3ML6 A;  2ZME A;  3RKW A;  1WI9 A;  3I0T A;  3NQO A;  5E20 A;  1U3E M;  3HSR A;  4ZYG A;  1IN6 A;  4LGW A;  2MH2 A;  5L3G A;  1BI2 A;  4A12 A;  4ESF A;  3KZY A;  1WWX A;  2Z3Y A;  3D0S A;  1Y0U A;  2W85 A;  1Z1D A;  1YS7 A;  3GLX A;  3SHF A;  5KVR A;  3RTR A;  3BPX A;  3LAJ A;  4MQV A;  1U8R A;  3ABU A;  2F2E A;  3WTX C;  3IRQ A;  1LJ9 A;  3KCC A;  3HRS A;  5DEQ A;  3NEU A;  1G4D A;  2M30 A;  2P7V B;  2PEX A;  2RQP A;  2EV6 A;  2JT1 A;  1P4W A;  3J80 Z;  1ZAO A;  2KIM A;  2ACJ A;  2CYY A;  3V8L A;  2M5W A;  5H6R A;  3WGI A;  4M6Y A;  3LQQ A;  3I71 A;  4U7B A;  2GXG A;  1J75 A;  5TJJ A;  4EJW A;  4HBL A;  4IJA A;  4WK8 F;  3KP7 A;  1IXR C;  2HQR A;  3L7W A;  4HW0 A;  5JHU A;  5DUI A;  1QO0 D;  4WXC A;  1FNN A;  1K78 B;  2L4A A;  1K79 A;  5HDG A;  2ZO4 A;  3T8T A;  3KEO A;  1RZ4 A;  1IXS B;  2VE8 A;  3NRV A;  2EV0 A;  1QZZ A;  2EFW A;  5JR3 A;  1RI7 A;  3ZMT A;  1B9N A;  1HKQ A;  2J5O A;  1G3T A;  4FHT A;  2FE3 A;  4HAM A;  2P5V A;  5DV5 A;  2HTS A;  2RNJ A;  2KJB A;  2UXX A;  1BI1 A;  2CQK A;  1MDM B;  3LFK A;  2EJR A;  1HKT A;  2PMH A;  4WCG A;  1P92 A;  1K6O A;  4EM2 A;  4WXD A;  5FLX K;  2MBF A;  1ZG5 A;  5ICE A;  1YQA A;  2E7W A;  1HW1 A;  5CJ9 A;  2DPU A;  4M72 A;  3PQK A;  2VBW A;  1FSH A;  2VN2 A;  5FB2 A;  1TW2 A;  1YIO A;  2BEO A;  3WTV C;  2VT2 A;  4BQA A;  5D8L B;  2NS0 A;  3AAF A;  1O7L A;  1R7J A;  4ZH4 F;  4L5I A;  3DV8 A;  4R8H A;  1Z05 A;  1KQ8 A;  1RNL A;  4YG2 F;  4UV8 A;  3N4M A;  5L3C A;  2RKH A;  3I54 A;  2XGX A;  4LFU A;  4ZYE A;  2HZT A;  3G73 A;  3GUD A;  2BBY A;  3B02 A;  4M9S A;  1J2X A;  2IPQ X;  1Z9C A;  1S29 A;  1BN5 A;  3IKT A;  4LLN A;  4A2U A;  3LWF A;  2OBP A;  3I58 A;  3E3V A;  1XGS A;  2P5K A;  2PI0 A;  2P6T A;  1IN7 A;  4OMZ A;  4HF0 A;  3RI4 A;  5ED4 A;  2GA2 A;  4PDK A;  3ZPL A;  4RS8 A;  1AWC A;  3IL2 A;  5BMZ A;  4MQ9 F;  2Z33 A;  3V4G A;  1FP1 D;  3GZ6 A;  1IW7 F;  3CUQ B;  1TQM A;  2HFH A;  4RGS A;  1W5T A;  1RUO A;  3F22 A;  4R79 A;  2OD5 A;  1CGP A;  1EV7 A;  4KIC A;  5D4R A;  4XBF A;  1S7O A;  1H0M A;  3HRT A;  4M6X A;  5EEH A;  2TDX A;  2QLZ A;  1QQI A;  3FM3 A;  3VFZ A;  3ZMV A;  2IP2 A;  1HQC A;  2HTJ A;  5CVR A;  1BBY A;  5FO5 A;  3FHZ A;  1SFX A;  4KFC A;  1SMT A;  3FMR A;  1XCV A;  3ROU A;  1FP2 A;  2CO5 A;  4HF1 A;  2BV6 A;  3E5U A;  4Y13 A;  1HXD A;  2RGV A;  1W7P B;  3DEU A;  5FFX A;  1W4M A;  3EYY A;  1FYK A;  5J8C A;  4LK0 F;  4MGR A;  1B9M A;  1FZP B;  1Z7U A;  1YW9 A;  1WSU A;  1GXQ A;  4U0W A;  2L54 A;  3TOA A;  2Q0O A;  3I59 B;  4K2E A;  2YX7 A;  2ESH A;  1XN7 A;  2KKO A;  4MTD A;  5D5V B;  4ASN A;  2K7L A;  1ZGA A;  4DNC A;  1BC8 C;  4N9I A;  1HST A;  1F9N A;  4XSX F;  3PFI A;  4S05 A;  5TRD A;  4KT5 C;  1RUN A;  5HOO A;  5K5Q A;  1ODD A;  2GWR A;  4KMU X;  4KIB A;  2VC1 A;  3IKV A;  5J6X A;  2K86 A;  3P9K A;  4LG0 B;  1HW5 A;  1SAX A;  2HKO A;  2IVM A;  1XMK A;  1JE8 A;  5EEG A;  2HWV A;  1PUE E;  4IHS A;  2CFX A;  4HYE A;  3DQV C;  1BIA A;  2V9V A;  4L9V A;  2EB7 A;  3SZT A;  4ZZD A;  4R1H A;  4U0V A;  2STW A;  1FBU A;  1FYL A;  4L5J A;  3ABT A;  5BOX A;  4BHB A;  2YX4 A;  2A61 A;  2E1N A;  5HDN A;  4GYI A;  4ESJ A;  3DPT A;  5ICC A;  3IWF A;  4I2O A;  5HVQ C;  1FOK A;  1ZRC A;  1T98 A;  5ICG A;  5H20 A;  3FWE A;  4A0Z A;  1KU9 A;  4BH9 A;  5HS7 A;  4MTE A;  2PMU A;  3LAP A;  4XLP F;  1KU7 A;  4BYY A;  2NYX A;  1YW7 A;  1TNT A;  2ETH A;  2EA2 A;  1J0R A;  4S04 A;  5JFR A;  3ELK A;  4YII A;  4UUV A;  3QAH A;  5A2Q K;  4IRH A;  3RPU A;  1T39 A;  3F8C A;  1SD7 A;  5LEJ A;  2JTV A;  2GZW A;  1U78 A;  2Z9O A;  4OIP F;  3V7S A;  2XAQ A;  2VON A;  1OR7 A;  3HRM A;  5HDK A;  2FEZ A;  4JBA A;  4O5V A;  3WE2 A;  5K5O A;  2BGC A;  3KP6 A;  3MFK A;  2FML A;  1MJ9 A;  1P4X A;  4AD9 A;  3CUQ C;  3F6V A;  5AIP A;  3MZH A;  3R6S A;  5LRS A;  4IPA A;  2EWN A;  5BPD A;  4GYG A;  5D5W B;  1XMA A;  3K69 A;  3RJP A;  5LGT A;  1U5T B;  3GZ5 A;  4CZZ A;  5DCF A;  2CGP A;  4IRG A;  1PP7 U;  2R7D A;  3U2R A;  1X3U A;  4G9Y A;  2O6G E;  4Q47 A;  3GEZ A;  1ONV A;  2IA2 A;  3IRR A;  4B09 A;  2IW5 A;  2VXZ A;  4PCQ A;  1PDN C;  1B1B A;  3QP5 A;  5IT9 K;  2V1X A;  4UV9 A;  3TDZ C;  1GHC A;  5ICF A;  3J81 Z;  2HQN A;  5D5X B;  2QYO A;  2HYF A;  2ZCW A;  4ZZL A;  3E6C C;  1SFE A;  3WTU C;  3GYH X;  2JPB A;  3DF8 A;  4OMY A;  2PBI A;  3FMS A;  1G3Y A;  4UVB A;  2DO7 A;  3MAJ A;  3H92 A;  2HOE A;  2OZU A;  5FD5 A;  2O8X A;  1BM9 A;  4RGU A;  3T5X A;  5F64 A;  3FXQ A;  3JAM Z;  3WTW C;  1BIB A;  2G7U A;  1FBS A;  3WGH A;  4L9T A;  4KIF A;  1DPU A;  5ILV A;  1P6R A;  3M1E A;  5BPI A;  1FT9 A;  3S2W A;  1FX7 A;  3L09 A;  1I1G A;  2ZBK A;  3WG9 A;  4RGR A;  4RB3 C;  1BI0 A;  2H09 A;  3WGG A;  3CUQ A;  1ZG1 A;  2AS5 F;  4EV0 A;  2MH9 A;  1H9G A;  2DI3 A;  1HBX G;  3FX3 A;  1R1V A;  2GAU A;  3HOS A;  2XUB A;  2OAZ A;  1H9T A;  3IWZ A;  3GW2 A;  4A0X A;  3ECH A;  1KYW A;  4MHG A;  4RAY A;  2MD5 A;  1L3L A;  3VOD A;  2L02 A;  3RIR A;  2A6E F;  3LST A;  2JSC A;  3ZMU A;  2MC3 A;  2XKP A;  3Q9V A;  5KK1 A;  2HR3 A;  5LLQ A;  3C1D A;  3T1B A;  5F6F A;  2L4M A;  2P7C B;  1T0F A;  1W7P A;  1LB2 A;  3RDI A;  3GFL A;  2K27 A;  3TKY A;  3CO7 C;  2W24 A;  1SD4 A;  3KP5 A;  3WU0 A;  2XAF A;  4F7Z A;  1FLI A;  2E1C A;  3R0J A;  1EH6 A;  1DP7 P;  3IHU A;  3GF2 A;  2IT0 A;  2R3S A;  3TO6 A;  5LHH A;  4LB6 B;  4NHJ A;  3I59 A;  1XGM A;  3L00 A;  4TV7 A;  1BOA A;  1FWZ A;  2P4W A;  2PN6 A;  2XHK A;  3TO7 A;  4M73 A;  4BXU A;  4CIC A;  4BAY A;  3VEP A;  3KP2 A;  3ISP A;  4BHP A;  4P9U A;  2A07 F;  2FNA A;  1KQ0 A;  1XSX A;  4Q5S F;  3EYI A;  4I01 A;  3EET A;  1XGN A;  1CF7 A;  1KQ9 A;  3RYP A;  1XDS A;  1KYZ A;  4H0E A;  1IN5 A;  2EFO A;  1T6S A;  3CUO A;  5E8I A;  1R5G A;  3ZMS A;  5LRR A;  4YFK F;  2HKX A;  2DW4 A;  3ULQ B;  2FBH A;  5D4S A;  3COA C;  3FF5 A;  3GFM A;  4HLX A;  1ZHF A;  3BJA A;  4I7H A;  1A04 A;  1XB4 A;  2DT5 A;  3T8R A;  3F8N A;  3HSF A;  2D45 A;  4EGZ A;  1IRG A;  4WX9 A;  4IVN A;  1U5T C;  1Z6T A;  4P96 A;  2G9W A;  3F8F A;  3ZQ7 A;  2V1D A;  3HSE A;  3DPL C;  1L0O C;  4MEY F;  5LEK A;  1E17 A;  1ZYR F;  5AON A;  2XRN A;  3E6D A;  5LHG A;  1ZRF A;  4ZYD A;  5D6F A;  4A6D A;  4KUM A;  5FGM A;  5CVJ A;  4UVA A;  1KA8 A;  3WE3 A;  4WF2 A;  3R61 A;  2ZFW A;  5HS9 A;  4AWX B;  2OA4 A;  1R00 A;  4Y17 A;  3WTZ A;  2IA0 A;  2ZME B;  3BPV A;  3KET A;  2DQR A;  5ERI A;  2DU9 A;  2RDP A;  5F1R A;  2F5F A;  4FT8 A;  1IAW A;  1UB9 A;  1I5Z A;  1P4A A;  4M9Z A;  2KIU A;  3W6J B;  4WWC A;  1ZRE A;  3OOP A;  1FYM A;  4O3M A;  3R0A A;  5K1Y A;  3KLN A;  1U2W A;  1IF1 A;  4NQW A;  2YR2 A;  3GXO A;  3ERE D;  1BC7 C;  4CYD A;  1G3W A;  2FBK A;  4HV5 A;  1D3Y A;  4A0Y A;  4Q48 A;  3WTS C;  3RYR A;  4D0P A;  4L18 B;  2CWE A;  4EQQ A;  3PQJ A;  4CHU A;  3BJ6 A;  3BWG A;  4MNU A;  1TQI A;  1J7K A;  1G3S A;  1OMI A;  3VB2 A;  1U5T A;  3D5L A;  5D5U B;  2QQ9 A;  5CLS A;  4IHT A;  5LHI A;  4YIF A;  1TQP A;  5HLH A;  1KU2 A;  3K9T A;  5LGN A;  1JHF A;  2G7H A;  2ISY A;  1J9I A;  4G6D A;  1O3R A;  4ON0 A;  1BJA A;  1IN4 A;  1EH7 A;  4RB0 A;  3K0L A;  1LDJ A;  3SQN A;  4M9X A;  2C6Y A;  1D5V A;  1Z6R A;  3FXR A;  3RKY A;  2ADU A;  4OOI A;  4BNC A;  3V7R A;  4KDP A;  3LA7 A;  3F3X A;  4PGH A;  2P8T A;  2STT A;  5H6Q A;  3GFI A;  2QWW A;  4G8X A;  1UHW A;  4N9H A;  2FXA A;  2VOD A;  3I64 A;  4AIH A;  1ULY A;  2RN7 A;  2YPR A;  1FSE A;  2OZ6 A;  1TLH B;  2AXL A;  4HQE A;  4EJU A;  1YTY A;  2M8E A;  4YFN F;  2JRT A;  3P9C A;  1MKM A;  2XKO A; 
#chains in the Genus database with same CATH topology
 2Z99 A;  2UV1 A;  4DZP A;  2CUJ A;  4PFO A;  5JI6 A;  1LDK B;  2K4B A;  1KON A;  2F48 A;  1W1W E;  2IXS A;  2V9K A;  2NNY A;  5DCM B;  1TBX A;  3FBI B;  4E7S A;  1HW2 A;  3S1R J;  2XF5 A;  3CJR B;  2EQR A;  3W6K B;  3DP7 A;  5DM6 F;  3M7G A;  1FIP A;  1I6H J;  2K4J A;  1Q1V A;  2FMY A;  2K02 A;  4O6J A;  2ME6 A;  1EJ9 A;  2A6H F;  4OIO F;  4KIG A;  3MZ8 A;  2V6E A;  1RIO H;  3C2H A;  4II2 A;  2EZL A;  1JGS A;  4FIS A;  4V2F A;  3B6A A;  3OV8 A;  4ABZ A;  4IKF A;  1Y56 A;  4UXN A;  3BP8 A;  4XLN F;  4A3C J;  1OFC X;  4HV6 A;  4A6E A;  3QYB A;  1Z21 A;  3BRO A;  5D8K B;  1T2K A;  4HDV A;  2XV4 S;  1Q1H A;  3SZP A;  1EKE A;  2W25 A;  2M2E A;  4A5N A;  4G6Q A;  3JRA A;  1RR8 C;  1NHA A;  3CJN A;  2NVU B;  5FLX Z;  2ZXI A;  3SFI A;  1TZL A;  2KFD A;  2FA5 A;  2FRH A;  3SXY A;  1ZTR A;  3SZG A;  4ZJZ A;  2Y2Z A;  3HOZ J;  4XM3 A;  4HSR A;  2Y48 A;  1EH8 A;  4IX7 A;  4XLC A;  1ON2 A;  3A4C A;  1HSJ A;  4Q4Z F;  4RB1 A;  4BBS J;  2LF7 A;  3A03 A;  5CVV A;  3OSG A;  4DOZ A;  2J5P A;  1VTN C;  5E3M A;  4UVC A;  3RPQ A;  1SMY F;  1YX3 A;  2I8D A;  3IAS 2;  3OYJ A;  4LB5 A;  3KYC B;  4KJZ A;  3JSO A;  3L1P A;  1LNW A;  3H3Z A;  1AA7 A;  5KHD A;  4A93 J;  4I99 C;  3OS2 A;  2IGK A;  3IC7 A;  3VYS B;  3QPL A;  2NOG A;  1K78 A;  2JMW A;  2H6C A;  3QOE A;  1ZQ3 P;  1PVE A;  1YW8 A;  2BY2 A;  2DA2 A;  3G3Z A;  1N78 A;  5AIQ A;  2ZSI B;  5EG0 A;  2E7X A;  1WKM A;  3I4N J;  1J59 A;  4B3A A;  1W36 D;  4EAT A;  4GXO A;  1S9H A;  3HOU J;  2JA6 J;  2A3S A;  1NH3 A;  3NWS A;  2CUE A;  2UZK A;  1MJA A;  1WJA A;  4YEJ A;  3PM1 A;  4JOM A;  3EUA A;  1UG0 A;  3K4N A;  2IJL A;  2DFF A;  4YIR X;  2VE9 A;  3ZP5 A;  3EDP A;  3RZO J;  2FF4 A;  3OIQ A;  1SVL A;  1JXS A;  2ZME C;  1TT5 B;  4ITV A;  4NBQ A;  4DIQ A;  1A6I A;  1KGS A;  2JPC A;  2MLG A;  3MN2 A;  3OL3 A;  1FBQ A;  2CW0 F;  5M5X J;  1D8K A;  1S5L C;  3AG1 H;  3O2P E;  1LQ1 A;  3L2Q A;  2FD5 A;  1MDM A;  3ABL H;  1H8A C;  4CGZ A;  3KYL A;  1V4R A;  3ABM H;  3H36 A;  2HDC A;  1MMS A;  1TTY A;  1MNE A;  2H6B A;  4RAF A;  4CYC A;  2LH9 A;  2M7A A;  2WWY A;  5C4X J;  1UCR A;  2NS7 A;  3JTG A;  3TW6 A;  1SVO A;  1ACI A;  1FC3 A;  1X4O A;  3HPH A;  3P5J A;  2OQG A;  4XON A;  3E5Q A;  3QYE A;  3E7L A;  2KHM A;  1LPQ A;  3HYI A;  2QUF A;  2VBY A;  3WTY C;  3F9K A;  3EQL F;  2MSY A;  1ZLJ A;  2WB1 A;  2Z5U A;  4PJM A;  2XPU A;  4Z2Y A;  1Y39 A;  3CME I;  2WV0 A;  3L2U A;  1YI2 I;  5L3D A;  3GTL J;  5IP9 J;  2ECC A;  3OIP A;  5L3B A;  2QZ8 A;  5FRN A;  1AOY A;  2DA7 A;  2BE5 F;  2RVC A;  1K7A A;  4S0H B;  4LIT A;  4PJN A;  1MMG A;  1S3J A;  4CCJ A;  3GTJ J;  4U7D A;  1XPX A;  3B6C A;  3X2Q H;  3LA3 A;  1OYY A;  2M1B A;  3NAU A;  4RGX A;  4N4O B;  1UST A;  4CDG A;  3OYC A;  3VWB A;  2QA4 I;  3I4P A;  1R23 A;  2GOM A;  4D9J A;  3FMQ A;  2XF7 A;  1YHQ I;  1SFK A;  3IH3 A;  2MFZ A;  2EFQ A;  5E3L A;  3PNY A;  4DQ2 A;  1ETK A;  3BDD A;  5DM7 F;  5KAI C;  1G8X A;  1JKQ C;  2EV5 A;  4CCM A;  2EZH A;  1TNS A;  3ERM A;  2LSO A;  5DDG A;  1DPR A;  2I5U A;  2M4K A;  3CDH A;  3M9A A;  3F23 A;  5L3F A;  4G7H F;  3E97 A;  2KDZ A;  1V5E A;  4KMF A;  5J8F A;  2F5D A;  3BCA A;  2AO9 A;  3FIW A;  2RV8 A;  3FKJ A;  4LLL A;  4HLY A;  3HEF A;  3EPZ A;  3N97 A;  1MJB A;  2VI6 A;  2ISZ A;  3CJQ B;  2DQL A;  2IS4 A;  1FJL A;  3AG3 H;  4G7O F;  1YX5 A;  1TT0 A;  2K5C A;  3R4K A;  3HTS B;  2JN6 A;  1ZK8 A;  4ESB A;  2WAF A;  4OIQ F;  1WI3 A;  4RAZ A;  2BW3 B;  4QLC U;  1JKR C;  2DBB A;  5J4Y A;  2DFH A;  1S8N A;  1YFH A;  4CXF A;  2DOE A;  3DKY A;  1NG6 A;  2EA4 A;  4KNY A;  4FX0 A;  2Y75 A;  4RDU A;  5IT3 A;  2R5Y A;  4ENM A;  1XGO A;  2VKH A;  3F8B A;  1DQU A;  1HKS A;  3H5R A;  4A69 C;  4BXF A;  4M74 A;  1MNM C;  3KP3 A;  1I27 A;  2LNB A;  3C7J A;  3JTH A;  2H8R A;  5GAE J;  1YG2 A;  3I5U A;  3MCZ A;  2ZJR F;  4G7Z F;  1RKT A;  1U6G A;  3LA2 A;  2JA5 J;  5HNF A;  1UFM A;  2L7K A;  4X1E A;  3JR9 A;  2DOF A;  2LC2 A;  3K1N A;  3C18 A;  2DA5 A;  2KP6 A;  3ZQF A;  2YSR A;  3KEQ A;  4HDU A;  5FFZ A;  4AVZ A;  4CCK A;  4Y52 J;  2M0M A;  3H9Q A;  4BS9 A;  1UJ8 A;  2EFN A;  5DYM A;  1DDN A;  2O61 A;  2OUM A;  2PJP A;  1WJE A;  2GQQ A;  2Y31 A;  1ZGJ A;  4BEH B;  2LDU A;  4FX4 A;  1YLF A;  2XAH A;  3BZ6 A;  3QQA A;  4ZDO A;  3P7N A;  3VOE A;  1OYW A;  3ZMZ A;  4EM0 B;  2PFB A;  4BDZ A;  2NAZ A;  1R58 A;  2A6T A;  3M1C A;  3WTT C;  2R93 J;  3DLA A;  4X6A J;  1MBE A;  2W57 A;  5CQE A;  1P2F A;  4GO1 A;  3WU1 B;  2QM3 A;  4ENK A;  4IHX A;  3GVA A;  2QSG X;  4E7L A;  5M3M J;  3QRF F;  3GWZ A;  3OWT A;  4HNT A;  2O3F A;  5M5W J;  2ZNZ A;  4HF2 A;  3KE2 A;  2K40 A;  2EIN H;  2LVS A;  3UKG A;  2DXI A;  2KIF A;  4JX4 A;  3VSL A;  1OCP A;  4M6V A;  2PLY A;  3H35 A;  3HHG A;  2FQ3 A;  1B4A A;  5F0F A;  2Q8K A;  2A5W A;  3DXJ F;  2OQR A;  3U1K A;  1P7J A;  1LEA A;  2KMU A;  5F0C A;  1B8I A;  1E2X A;  1HA8 A;  4JK1 X;  2VBZ A;  4AIK A;  1R36 A;  3KLO A;  2BY1 A;  2LKP A;  3CCR I;  1BOB A;  3J7A O;  2DAO A;  2XAS A;  3VYT B;  4AYB N;  4I6Z A;  1XSD A;  1GT0 C;  2E1O A;  4OIN F;  5CVU A;  2JVH A;  1MMD A;  2L9N A;  4D7N A;  3SFZ A;  4YFX F;  1HCR A;  3CCM I;  1IXC A;  1PP8 F;  3S32 A;  3TDU C;  1V5G A;  2GIV A;  3M8F A;  3NWT A;  4IO9 F;  4A3M J;  3IAM 2;  3JW4 A;  1OCO H;  2O7O A;  3S8P A;  2M3A A;  1WRJ A;  1RRJ A;  2QVO A;  4B47 A;  4L9N A;  4NUB A;  1USS A;  2LK2 A;  1VQ8 I;  1O3Q A;  3E0J B;  2DTR A;  3GZN B;  3H0G J;  2R7U A;  5JVT A;  1TC3 C;  2XB0 X;  2WY7 Q;  4NB5 A;  3Q5F A;  3OYM A;  4JQF A;  1ZN2 A;  3R60 A;  3S2H J;  4AM3 A;  4ANJ A;  2ZXH A;  1GVJ A;  1QPM A;  4GGG A;  4F93 B;  3DU5 A;  1MGT A;  1FY7 A;  2X9D A;  1IRF A;  2L3D A;  1V3F A;  4BY7 J;  3E6B A;  2L01 A;  1UEL B;  3ASO H;  1SAU A;  1OCT C;  3DKW A;  4UUT A;  4JX6 A;  4Y7N J;  1F4K A;  1W7P D;  4EGY A;  2W84 A;  2F5C A;  4RM3 A;  4XRF A;  3GTO J;  4IOA F;  4EJV A;  5A2Q Z;  4EJT A;  1FOW A;  4LG0 A;  2O03 A;  4E70 A;  1PUF B;  4KN4 X;  4OU0 A;  4OIR F;  2X6W A;  4NC7 A;  2DK5 A;  3V8J A;  3L2C A;  5GAH J;  3EUH A;  2NVX J;  4CO8 A;  4LMY A;  5HLG A;  2R7T A;  3GX4 X;  5DCM A;  3BOQ A;  3MQ0 A;  5HNH A;  3HDD A;  2V79 A;  5ILU A;  2VC0 A;  2XSJ C;  4BE1 A;  1SD5 A;  2BY3 A;  1MW7 A;  4EJO A;  2P5L C;  2VKE A;  5GPA A;  5K7F A;  3M3Y J;  1VQL I;  2ME0 A;  3QPT A;  2M87 A;  4P55 A;  2JZY A;  1ZH5 A;  1D1B A;  3E6M A;  1B59 A;  2QQB A;  1MMA A;  3P9I A;  1UHM A;  2L7Z A;  2D5V A;  1X3W B;  1XDU A;  5TIS C;  2PG4 A;  4I02 A;  3EUK L;  3K1M A;  1X19 A;  2F5E A;  2LOO A;  2VQC A;  3LSP A;  3TP3 A;  3E5X A;  1B6A A;  3L9F A;  2VIX A;  3SJM A;  1Z77 A;  2COM A;  1OLT A;  2QBY B;  4BJ6 C;  1LEB A;  4YEL A;  3FXU A;  4AUX A;  5D6E A;  3RKX A;  1T38 A;  3LOC A;  2IGM A;  2E2J J;  4BGD A;  4G94 A;  5DD8 A;  4IRI A;  2M45 A;  2NRA C;  2FBI A;  1A6Q A;  2DMQ A;  2FU4 A;  2Q2E A;  4M3F A;  3JRB A;  5KNL A;  4QSH A;  3OYN A;  1OPC A;  2CQQ A;  3CLO A;  1I50 J;  4Y15 A;  4H4K C;  3BJO A;  4C30 A;  3C3W A;  1RKW A;  3REO A;  5IT9 Z;  2OF7 A;  3A0B C;  1DU6 A;  1P9Q C;  2P81 A;  3BR5 A;  2I10 A;  2WTE A;  4KA4 A;  3F72 A;  2V6C A;  1LE8 B;  4NNJ A;  3HOY J;  1BI3 A;  3O6B B;  4ETS A;  3O3K A;  1U9O A;  3ZN0 A;  1IN8 A;  3OSF A;  4LD5 A;  4N0B A;  4AU7 A;  4HNU A;  1JT6 A;  3J81 K;  1ETQ A;  1G6N A;  4C3J J;  2CSO A;  3OYF A;  2D2W A;  1IG7 A;  2H94 A;  3ZQQ A;  1KU3 A;  4IXA A;  3MMY B;  9ANT A;  2IA1 A;  3OL4 A;  2FOK A;  4AVP A;  1QPI A;  4L0Z B;  1MBG A;  1OJL A;  1R4N B;  4LG3 A;  3HTU A;  3H3U A;  2ZNY A;  3JRH A;  4Y3O A;  1VQ4 I;  2R7X A;  3OY9 A;  1VQN I;  4EEF G;  1ZLK A;  1RR7 A;  2R7F A;  2NNN A;  4FTH A;  1IO2 A;  2PQ8 A;  4HNV A;  1K61 A;  2DFE A;  2FNP A;  5E1W A;  3QOD A;  4N4N B;  1FMV A;  3HPG A;  4HA8 A;  2B0L A;  3LSI A;  4A3E J;  1C0W A;  1JJ8 C;  1QGP A;  1B72 B;  1D0X A;  1W36 C;  2DYS H;  4FCY A;  2EZK A;  2HQ5 A;  3JAM K;  2NXN B;  1UAA A;  3JRC A;  1WQ2 A;  1NG7 A;  2A68 F;  2L5Q A;  2IGO A;  1LFB A;  1Z91 A;  3DWL E;  2ZXJ A;  2HVR A;  2VKV A;  3H9J A;  3VYR B;  3PNV A;  2KRH A;  2QEN A;  3E1S A;  1U8B A;  1IUY A;  3GTQ J;  1O57 A;  1X58 A;  4LIV A;  4AIJ A;  4HX7 A;  3BZC A;  1I39 A;  1JKP C;  2M9H A;  4IZZ A;  1T8I A;  1R9T J;  1YOV B;  1TWG J;  2LY2 A;  1BW6 A;  3VYU B;  2HGC A;  2KJC A;  2XDV A;  2MLK A;  1SD6 A;  1QVT A;  3FM5 A;  4ZC3 A;  4M3B A;  3OYA A;  2HS5 A;  5E18 F;  3CCS I;  4C2T A;  2K9L A;  1R49 A;  2XAJ A;  2HEO A;  1A31 A;  5FKO A;  2DFI A;  4CH7 A;  6PAX A;  2GXB A;  3QU3 A;  2R7S A;  3MZY A;  4PZJ A;  4L0Y B;  2R7R A;  1R1U A;  1STZ A;  2Y9Z A;  4V19 K;  1WH5 A;  2XRO A;  3PO2 J;  2YUS A;  4DZJ A;  2V9P A;  1ON1 A;  3K7A J;  1Z3X A;  1YIT I;  3QPH A;  2QF7 A;  5ILS A;  3J80 K;  2JA8 J;  2XC7 A;  3OYG A;  4XID A;  4I0A A;  2JRM A;  5CYV A;  2QEX I;  3QPS A;  1K6Y A;  2X1C A;  3M8J A;  3TOB A;  1KZH A;  3L2R A;  1JHH A;  1CF7 B;  2VQL A;  4Y33 A;  5CPR B;  2KRF A;  2Y0M A;  3MVP A;  1O3T A;  3QOP A;  2HXO A;  3HOT A;  3MKY B;  2D1V A;  4B8X A;  1F5T A;  2M34 A;  2KL4 A;  4HX8 A;  3U1D A;  2ZFU A;  3F8M A;  4QIW N;  5EGO A;  4HZF A;  4PSW A;  5LGU A;  4EMS A;  4QWQ A;  2W4S A;  2LG4 A;  5DUK A;  2MC4 A;  3TO9 A;  2ZXW H;  4IHY A;  2EFP A;  3BY6 A;  1OR7 C;  2H8W A;  2O9L A;  1QHH D;  3JRF A;  4XK4 A;  3MEX A;  2E19 A;  4RB2 C;  1V5F A;  2UWM A;  4U88 A;  3BR6 A;  2QQA A;  1OYI A;  2VPR A;  3K1P A;  3OYB A;  3LSR A;  5E1X A;  2MA3 A;  4IF4 A;  1X1B A;  3FZV A;  3LQR A;  3A01 B;  3GTM J;  4XOP A;  5B3S H;  2AQF A;  5L3E A;  4HOB A;  2X6X A;  2CG4 A;  1VQ5 I;  2E5N A;  4B43 A;  5HLI A;  3HOX J;  2NVT J;  3VSK A;  1Y8Q B;  1HDP A;  3FXJ A;  4I0B A;  1R22 A;  3CTA A;  3GTP J;  1QNT A;  2AQE A;  2HDD A;  4I09 A;  1XSV A;  2FSW A;  1YYV A;  2CU7 A;  2VT3 A;  5HS8 A;  2OU2 A;  1YRN A;  1LDD A;  1SAN A;  3U9G A;  1F1Z A;  4XSZ F;  2BVL A;  3V7C A;  3BQY A;  4ZYH A;  2QGU A;  3HHH A;  3ZN1 A;  1ZRD A;  3W3C A;  3TMO A;  4BEH A;  5FD6 A;  4MFD A;  3QU6 A;  1D8J A;  3KZZ A;  3ONQ A;  3OOU A;  5K5R A;  5GTI C;  4BBR J;  4UNO A;  1R5I D;  3M8E A;  2CW8 A;  4A3I J;  3I56 I;  1X4P A;  2DT7 B;  4CCL A;  1T08 B;  1W5S A;  1R5H A;  1J09 A;  3RKQ A;  4BY1 J;  1IZ1 A;  1LVA A;  5BQT A;  5GPC A;  3F21 A;  2BY0 A;  3CQZ J;  3B73 A;  3ZMD A;  1XCB A;  3GO5 A;  3SEQ A;  2VQG A;  1J5Y A;  4CUG A;  2HI3 A;  1ZAR A;  1ZG3 A;  1YO5 C;  4EM1 A;  2VOP A;  3BG9 A;  4PGG A;  2YU3 A;  3CO6 C;  1R4M B;  2GA1 A;  2VJJ A;  2Y0S A;  2H27 A;  2RQQ A;  4A5M A;  5CVI A;  1I6X A;  4CZC A;  2EIL H;  4HG2 A;  5EDN A;  2RC4 A;  2KIS A;  3CMM A;  5IY5 H;  1QBJ A;  4IHV A;  4DJA A;  1D1A A;  1HF0 A;  2E2I J;  1S72 I;  4HPQ A;  4LJZ F;  3ZOB A;  2X0L A;  3V42 A;  3UNG C;  5HOD A;  2V1U A;  3ZGK A;  4KT6 A;  5E1Z B;  5E8G A;  2W1O A;  3GFJ A;  3DEW A;  3ZR8 X;  4U0Y A;  1I1S A;  3HUG A;  2X4H A;  1G2H A;  3QP6 A;  4HX4 A;  1MD0 A;  4P5O A;  4MEX F;  1W0T A;  3BTC A;  5BS6 A;  2L9S A;  5IYD J;  5EZH A;  4NQW B;  3S14 J;  3HOW J;  4OAZ A;  2WC2 A;  1OKR A;  5J3L A;  3TGN A;  3Q9S A;  3I4M J;  1XMX A;  3FXO A;  3G71 I;  3IV5 A;  2M8G X;  2LF8 A;  4D1Q A;  4P9F A;  4E7Z A;  2D1H A;  4BHC A;  2EK5 A;  2A5Y B;  3DFG A;  1POG A;  3ABK H;  2P0W A;  4LK1 F;  4HEA 2;  4OAY A;  4C9Y A;  4A3K J;  4ENN A;  4U87 A;  4UHT A;  2UXN A;  3HIF A;  3KFW X;  1Z3Y A;  2GOX B;  3TQN A;  1IRZ A;  2VJI A;  4HQM A;  2E2H J;  1GXP A;  2VXD A;  2LBF A;  1O3S A;  2IRF G;  2P6S A;  2JQ7 A;  4EVI A;  3MWM A;  3AL0 C;  2ZJ2 A;  2A69 F;  2E5Z A;  1MBJ A;  1XD7 A;  2ID6 A;  3JSP A;  3IUO A;  2VBX A;  1TW3 A;  2BYV E;  3F6O A;  2OCC H;  1SFU A;  2FX0 A;  1ETY A;  2DLL A;  1Y6I A;  1FOX A;  1FPQ A;  1REP C;  2O8K A;  2XVC A;  3K2Z A;  4J01 A;  3I53 A;  1S6L A;  4GCV A;  2PMZ A;  3GCM A;  3BQZ A;  3T0Y A;  3BTL A;  3AKZ A;  3WOD F;  1O7F A;  4LOC A;  2KZG A;  3BC8 A;  1JT0 A;  5J1U A;  2ZC2 A;  2HDW A;  1S7A A;  3HRU A;  4E7K A;  3PUB A;  1DUX C;  4BQO A;  4I98 B;  2VPL A;  2XIG A;  3ZQG A;  5LBQ A;  4ENJ A;  3VPR A;  3G1L A;  2DPD A;  2ZKZ A;  4B44 A;  1ETW A;  2HYG D;  2DK8 A;  4DYR A;  3V8K A;  2IGN A;  5HLT A;  3J7A Y;  4M71 A;  1SFO J;  2X1E A;  1YIJ I;  5DD4 A;  1FTT A;  2DJI A;  2COB A;  2ELH A;  2GBY A;  2O0Y A;  4BJ5 C;  1ERD A;  2Y69 H;  4XKB A;  2IBD A;  3KP4 A;  5EJC A;  2A05 A;  1MZB A;  2XAG A;  1YS6 A;  1AKH B;  3ECO A;  4D7M A;  3OYK A;  1U9N A;  3ZQL A;  4L9J A;  4KYW A;  2Z2S B;  4WXH A;  2ESN A;  2PX9 A;  2VOO A;  2NOJ B;  3DBH B;  5E17 F;  2LY1 A;  4LLG F;  2QBY A;  4KN7 X;  3K4C A;  1QZY A;  1R1T A;  3A1Y A;  2EPF A;  3S2D J;  3ML6 A;  2ZME A;  4BL0 B;  4RMN A;  3RKW A;  1TWH J;  1WI9 A;  3I0T A;  3NQO A;  5E20 A;  3RQI A;  5IP7 J;  1U3E M;  3S3M A;  3HSR A;  2MG4 A;  4ZYG A;  1IN6 A;  4LGW A;  4A3D J;  4QPQ A;  2MH2 A;  1JTX A;  2OJE D;  4XRS G;  5L3G A;  1BI2 A;  5GAG J;  4A12 A;  4XL9 A;  4ESF A;  2LRE A;  3KZY A;  1X2M A;  1VQ9 I;  1WWX A;  2DA4 A;  2Z3Y A;  2KDO A;  5M5Y J;  3D0S A;  1Y0U A;  2W85 A;  4PJJ A;  4J19 A;  3I55 I;  1Z1D A;  1GV2 A;  1YS7 A;  3GLX A;  3SHF A;  5KVR A;  3RTR A;  3BPX A;  3LAJ A;  1LE8 A;  4MQV A;  1U8R A;  2HOS A;  3FDY A;  2JSP A;  3ABU A;  2F2E A;  1N77 A;  3WTX C;  5K7Z A;  3IRQ A;  2XPV A;  2GLO A;  1UMQ A;  1LJ9 A;  3KCC A;  3HRS A;  5DEQ A;  3ZQC A;  3BTI A;  2WB1 N;  1FEX A;  1VQO I;  4E7I A;  3NEU A;  1JTY A;  1G4D A;  3G1M A;  2M30 A;  2P7V B;  3FK6 A;  2BOL A;  1NTC A;  2PEX A;  2RQP A;  2DOA A;  3ESW B;  3K4L A;  2EV6 A;  1ETX A;  1P4W A;  2JT1 A;  4F3Q A;  3J80 Z;  4XNF A;  1ZAO A;  2KIM A;  1EF4 A;  4XN0 A;  1E3H A;  1MSE C;  2YS9 A;  2ACJ A;  2CYY A;  3V8L A;  1WGX A;  2M5W A;  2PMZ N;  4XOR A;  2IEK A;  4RLQ A;  3FXL A;  3PNT A;  5H6R A;  3WGI A;  3BCB A;  3JRD A;  4M6Y A;  3TED A;  3LQQ A;  4BU2 A;  2BHZ A;  3L2V A;  3I71 A;  2QSH X;  4U7B A;  2GXG A;  1J75 A;  2PJR B;  2JWT A;  3HZJ A;  5TJJ A;  4PK4 A;  4EJW A;  4XKC A;  3HGY A;  4IQ4 A;  4HBL A;  2DDB A;  4IJA A;  3C2B A;  3DBL B;  1ZR4 A;  4WK8 F;  1B72 A;  2ZSH B;  3KP7 A;  5FRM A;  1IXR C;  2HQR A;  3L7W A;  4HW0 A;  2CJJ A;  5JHU A;  5DUI A;  1QO0 D;  4WXC A;  3HBL A;  1FNN A;  4HST A;  2E71 A;  4DYQ A;  1K78 B;  2L4A A;  1K79 A;  1FTZ A;  3OYH A;  5HDG A;  2ZO4 A;  3T8T A;  5H2F C;  3KEO A;  3BG6 A;  1RZ4 A;  1T56 A;  2H1L A;  2KT0 A;  5EG0 B;  1IXS B;  2VE8 A;  3NRV A;  4YRV A;  4M3G A;  3WU2 C;  2EV0 A;  3CES A;  2CRG A;  2QSF X;  1QZZ A;  2EFW A;  5JR3 A;  4XKW A;  1RI7 A;  3ZMT A;  3DCF A;  1B9N A;  1LKX A;  1HKQ A;  2J5O A;  4UY8 I;  4DBR A;  4E7J A;  1SC7 A;  1G3T A;  4FHT A;  2FE3 A;  3K2A A;  4HAM A;  2P5V A;  2IS6 A;  5DV5 A;  4B48 A;  2HTS A;  3BG7 A;  1S7E A;  2AHQ A;  2RNJ A;  2DMP A;  5B5E C;  3K70 C;  2KJB A;  2UXX A;  1GV5 A;  2WAQ A;  1BI1 A;  2CQK A;  1MDM B;  3LFK A;  1TWF J;  2F4I A;  5F27 A;  4B1R A;  2EJR A;  4GDF A;  1HKT A;  2PMH A;  4WCG A;  3CCU I;  5IOZ A;  2DYR H;  5EZG A;  3KZI C;  1P92 A;  1K6O A;  3HKZ A;  4CYC B;  4EM2 A;  4WXD A;  5FLX K;  2MBF A;  1ZG5 A;  5ICE A;  2LKX A;  1YQA A;  4F52 A;  2E7W A;  4ZDP A;  1HW1 A;  5CJ9 A;  2DPU A;  2LR8 A;  4M72 A;  3PQK A;  5C4J J;  2VBW A;  1FSH A;  2B9S A;  3A2K A;  2DMU A;  1IRX A;  3Q0V A;  2VN2 A;  1MH4 A;  4UUS B;  1X1P A;  1BL0 A;  5FB2 A;  1TW2 A;  1V55 H;  2WV1 A;  4E4H A;  1YIO A;  2BEO A;  3WTV C;  5FKN A;  2VT2 A;  4BQA A;  3CP2 A;  4BQQ A;  5D8L B;  2NS0 A;  4C2U A;  3JRE A;  3AAF A;  1YJW I;  1O7L A;  1R7J A;  4ZH4 F;  4L5I A;  3DV8 A;  4R8H A;  1Z05 A;  1KQ8 A;  4C3H J;  1RNL A;  4YG2 F;  5GAD J;  3A01 A;  4UV8 A;  2GXA A;  3N4M A;  5L3C A;  1WH7 A;  2RKH A;  3I54 A;  3OIO A;  3G2B A;  4RM2 A;  1W0U A;  2XGX A;  1DP3 A;  3DEE A;  2HVQ A;  4LFU A;  4ZYE A;  2HZT A;  3G73 A;  3GUD A;  2BBY A;  3BT9 A;  2Y30 A;  5KCM A;  1X1C A;  4BAC A;  3B02 A;  3DTI A;  3DLL F;  4M9S A;  1J2X A;  2OC6 A;  2IPQ X;  1S29 A;  1BN5 A;  2ECB A;  1Z9C A;  3IKT A;  4LLN A;  4A2U A;  2E36 A;  1ITY A;  3LWF A;  2OBP A;  3C2G A;  3I58 A;  3E3V A;  3S3N A;  1XGS A;  2P5K A;  4XR6 A;  4Z6Y A;  2PI0 A;  3A0H C;  3LL7 A;  2P6T A;  1GVD A;  3DKX A;  4OWR B;  2CQN A;  1IN7 A;  4OMZ A;  4HF0 A;  5CKT A;  3RI4 A;  5ED4 A;  1IDZ A;  1BR1 A;  2GA2 A;  1VND A;  4PDK A;  3ZPL A;  1FOY A;  3JRI A;  1LUJ B;  4ZYA A;  3M07 A;  3CZ6 A;  2E60 A;  4RS8 A;  1AWC A;  3IL2 A;  5BMZ A;  4QTR A;  4MQ9 F;  2Z33 A;  3V4G A;  1FP1 D;  3GME A;  5FLM J;  2VJ5 A;  4XN3 A;  3GZ6 A;  3S1N J;  2BHY A;  1IW7 F;  1D0Z A;  4D5F A;  2XPW A;  3CUQ B;  1TWA J;  3H0D A;  1IV6 A;  1HOM A;  1TQM A;  2HFH A;  2WAQ N;  1W5T A;  2JJ7 A;  3O8H A;  4RGS A;  1RUO A;  3F22 A;  4R79 A;  1WVR A;  2NS8 A;  1APL C;  3Q3S A;  4W1U A;  2OD5 A;  3AG4 H;  3AL0 B;  2GIZ A;  1W5C C;  1EV7 A;  4KIC A;  1CGP A;  1JUM A;  1X1D A;  5M3F J;  2YU9 J;  5D4R A;  3WHC A;  3HKZ N;  4XBF A;  1S7O A;  4C2M J;  1H0M A;  2CV1 A;  3HRT A;  5F08 A;  1MSF C;  3PSF A;  5LD2 C;  1N75 A;  4M6X A;  5EEH A;  3WHB A;  2TDX A;  2QLZ A;  1QQI A;  3K6G A;  5KAF C;  2M4G A;  2MGQ A;  2DCE A;  3BZK A;  3O8G A;  3FM3 A;  5FKM A;  1Y0N A;  3OYD A;  3VFZ A;  3OYI A;  3ZMV A;  2IP2 A;  1IUF A;  3CF5 F;  1VF9 A;  2NVY J;  1HQC A;  1A5J A;  2HTJ A;  2L9R A;  1BBY A;  5CVR A;  5FO5 A;  3FHZ A;  3HG9 A;  1SFX A;  4KFC A;  1SMT A;  1UG2 A;  3FMR A;  2R7Z J;  1XCV A;  3ROU A;  1XC5 A;  1FP2 A;  2CO5 A;  4AID A;  3S17 J;  5J1Y A;  3CD6 I;  4HF1 A;  2BV6 A;  3E5U A;  2BVM A;  3FXK A;  3HM5 A;  4Y13 A;  1HXD A;  2RGV A;  1E3O C;  1W7P B;  3DEU A;  5FFX A;  1JKO C;  3FK7 A;  1NK2 P;  1W4M A;  2FOW A;  2JA2 A;  3EYY A;  1FYK A;  5J8C A;  2K85 A;  4LK0 F;  1GDT A;  4MGR A;  1B9M A;  1FZP B;  1Z7U A;  2KLO A;  4FAS D;  1B8I B;  1MBF A;  1YW9 A;  4IEJ A;  3CCE I;  4XKV A;  1WSU A;  1GXQ A;  3W2A A;  2VAS A;  3K4B A;  4U0W A;  4XQF A;  1GUU A;  2L54 A;  3TOA A;  2Q0O A;  3I59 B;  3K4M A;  4K2E A;  4XIC A;  3SEZ A;  3DBR B;  2YX7 A;  2ESH A;  2LLK A;  5FKL A;  1XN7 A;  2KKO A;  2KZV A;  3HB9 A;  3VDX A;  2ELK A;  1FMW A;  4PJL A;  4MTD A;  2LKS A;  5D5V B;  4ASN A;  3NAR A;  2K7L A;  1R71 A;  4MFE A;  1PJR A;  1ZGA A;  4DNC A;  2DOD A;  2DA3 A;  1BC8 C;  1UHS A;  3MKL A;  4M3E A;  1WHU A;  1OCC H;  4G12 A;  2V7F A;  5EEA A;  4N9I A;  1HST A;  3A02 A;  1F9N A;  1ZGW A;  2F4M B;  4PJ0 C;  4XSX F;  1I3A A;  1AKH A;  3PFI A;  3WG7 H;  4S05 A;  4KT5 C;  5TRD A;  1RUN A;  1K4S A;  1I3Q J;  5HOO A;  5K5Q A;  1JGG A;  3RSN A;  2V26 A;  1IDY A;  3UR3 C;  1ODD A;  2CMP A;  1ORK A;  2GWR A;  4KMU X;  2E1M B;  1Z0X A;  2BW3 A;  4KIB A;  2VC1 A;  4PUS A;  4FET A;  1VQM I;  1SEU A;  2CV2 A;  4A3J J;  2NVQ J;  3IKV A;  2Z1D A;  2IS1 A;  5J6X A;  2K86 A;  1QZE A;  1G59 A;  1XX5 A;  2RNG A;  3CDI A;  3N05 A;  4BE0 A;  3LSJ A;  1IGN A;  3P9K A;  4LG0 B;  1HW5 A;  1SAX A;  2HKO A;  2K3P A;  1A36 A;  1WFX A;  2IVM A;  1XMK A;  1JE8 A;  2R7V A;  1QVU A;  1RC9 A;  3CLQ A;  5EEG A;  2HWV A;  5IYC J;  4D5C A;  3ZRG A;  1PUE E;  1ZEL A;  3HC7 A;  4PFP A;  2QCO A;  3FXM A;  4IHS A;  4DW6 A;  2CFX A;  2VB6 A;  4HYE A;  3DQV C;  1BIA A;  2V9V A;  3H5A A;  4L9V A;  2EB7 A;  3SZT A;  4ZZD A;  4R1H A;  3RZD J;  3I9V 2;  4U0V A;  2STW A;  3S93 A;  1FBU A;  1FYL A;  2LRD A;  4L5J A;  3ABT A;  1VZ0 A;  5BOX A;  4MO7 A;  4BHB A;  1ZR2 A;  2YX4 A;  1Y1W J;  2A61 A;  5B1A H;  2E1N A;  5HDN A;  4GYI A;  1R6R A;  4E6K G;  4ESJ A;  3HXL A;  3DPT A;  5F1J A;  2CV0 A;  5ICC A;  3IWF A;  4I2O A;  2Z16 A;  5HVQ C;  1FOK A;  1ZRC A;  2ICW G;  1ETV A;  1T95 A;  1T98 A;  2VLA A;  3ZXS A;  5ICG A;  4GRI A;  5H20 A;  4IQJ A;  1WCM J;  3FWE A;  3CCY A;  4A0Z A;  1KU9 A;  4BH9 A;  5HS7 A;  2XAU A;  1Y8R B;  3DPU A;  3F0C A;  4MTE A;  4CA0 A;  2PMU A;  4BJT A;  4B4C A;  3LAP A;  3OYL A;  4XLP F;  2Q2E B;  1KU7 A;  2PJR A;  1HC8 A;  2MW8 A;  1Z7L A;  4BYY A;  2NYX A;  1YW7 A;  3BG5 A;  4W97 A;  1TNT A;  2ETH A;  2R5Z B;  2EA2 A;  1J0R A;  3PO3 J;  2KPM A;  4S04 A;  5JFR A;  3TBI A;  2O5R A;  2E34 A;  2JUG A;  3ELK A;  4YII A;  1A35 A;  4UUV A;  2LD5 A;  4IHW A;  3QAH A;  5A2Q K;  4IRH A;  3RPU A;  3W6V A;  5DTD A;  1IC8 A;  5JLX A;  5FJ8 J;  1T39 A;  2V4J C;  1SD7 A;  3F8C A;  2CW7 A;  5LEJ A;  1O4X A;  2QKL B;  2JTV A;  4BE2 A;  2GZW A;  1U78 A;  2Z9O A;  4KIS A;  4OIP F;  3V7S A;  3LSH A;  2XAQ A;  2VON A;  3S16 J;  1E0E A;  3TW7 A;  2DMN A;  1OR7 A;  3HRM A;  4FQG A;  4A3G J;  5HDK A;  3FIS A;  2FEZ A;  4JBA A;  4O5V A;  3PL8 A;  3WE2 A;  3Q0W A;  5K5O A;  4BKX A;  3KIO A;  2BGC A;  2CUZ A;  3KP6 A;  2R0Q C;  4XLF A;  3MFK A;  3LSM A;  5JVG F;  3BR0 A;  4ZTF A;  1QU3 A;  3D5S C;  3K10 A;  1JI8 A;  3W2W A;  5E79 C;  1SVM A;  1BA5 A;  2FML A;  1MJ9 A;  1YJN I;  1P4X A;  4AD9 A;  1D5Y A;  2LYC A;  3CUQ C;  2X1D A;  3F6V A;  5AIP A;  3MZH A;  2L7F P;  3R6S A;  5LRS A;  4IPA A;  3K4J A;  2EWN A;  2CQX A;  5BPD A;  4GYG A;  5D5W B;  1XMA A;  5EYR A;  3K69 A;  3RJP A;  5LGT A;  5J4V A;  3MKZ A;  2LFB A;  1U5T B;  3CJT B;  3GZ5 A;  4CZZ A;  5DCF A;  2CGP A;  4IRG A;  2KRC A;  4A3F J;  1PP7 U;  2R7D A;  5FRO A;  2WA0 A;  3U2R A;  3K4K A;  1X3U A;  3PIP F;  1TWC J;  4G9Y A;  2O6G E;  3JRG A;  2VKD A;  4Q47 A;  1DU0 A;  2VQH A;  3DTK A;  3GEZ A;  1YJ9 I;  5FLV A;  4XLE A;  4UUS A;  3HJE A;  1WJC A;  1ONV A;  3KYD B;  3QWL A;  2IA2 A;  3IRR A;  4F55 A;  1OQY A;  4B09 A;  1FIA A;  1PUF A;  2IW5 A;  2VXZ A;  4B3X A;  4PCQ A;  4GFB A;  1PDN C;  2LMD A;  4PSX A;  1B1B A;  3G6E I;  3BG3 A;  2ID3 A;  3LSK A;  3QP5 A;  3JCU C;  5F04 A;  5IT9 K;  2N8G A;  1VQP I;  1MMN A;  2V1X A;  4UV9 A;  1RET A;  3TDZ C;  1GHC A;  5ICF A;  3J81 Z;  3RPU D;  2DTZ A;  3CCV I;  3OMY A;  2QKM B;  1Y1V J;  2FUG 2;  4NDL A;  3LMM A;  2HQN A;  5JHF A;  2HNH A;  3SDG A;  5D5X B;  4C3I J;  4II3 A;  4XRM A;  2OTL I;  3S1M J;  2QYO A;  3LNQ A;  2HYF A;  4LIU A;  3FKI J;  2LY9 A;  2ZCW A;  4ZZL A;  3E6C C;  1SFE A;  1T0F C;  3WTU C;  3GYH X;  2JPB A;  4IL6 C;  2GM4 A;  2WBM A;  2Y0S N;  5B1B H;  2WY8 Q;  3FHN A;  1NK3 P;  3DF8 A;  3AFH A;  1AU7 A;  4OMY A;  1ENH A;  2R92 J;  4QPO A;  2PBI A;  5IPA A;  2VUM J;  3CDL A;  3FMS A;  1G3Y A;  2F5V A;  4UVB A;  3CCQ I;  2X85 A;  1BR2 A;  2DO7 A;  3MAJ A;  3H92 A;  2HOE A;  1QA6 A;  2OZU A;  5FD5 A;  2O8X A;  1BM9 A;  4RGU A;  5TGT A;  3T5X A;  5F64 A;  1Z67 A;  1MBH A;  3FXQ A;  4AYB A;  3H3V K;  3LFU A;  3KEY A;  3JAM Z;  2IS2 A;  1XS9 A;  5EGO B;  3WTW C;  1BIB A;  2G7U A;  4BQN A;  3CC4 I;  1TP4 A;  2XF6 A;  1FBS A;  3WGH A;  4L9T A;  4KIF A;  1DPU A;  5ILV A;  1P6R A;  2FJ1 A;  3M1E A;  5BPI A;  1FT9 A;  3CF2 A;  3S2W A;  1FX7 A;  2EIK H;  1I1G A;  2ZBK A;  3L09 A;  4RGR A;  2OV7 A;  3WG9 A;  3CC2 I;  3MD2 A;  4RB3 C;  5JLW A;  1BI0 A;  2H09 A;  3WGG A;  3CUQ A;  2OPT A;  1ZG1 A;  2AS5 F;  1HDD C;  4EV0 A;  2MH9 A;  3S3O A;  3H5N A;  1H9G A;  2K9S A;  2DI3 A;  3I3L A;  1T33 A;  2DN0 A;  1K4T A;  1HBX G;  3FX3 A;  2W82 A;  1R1V A;  2W48 A;  2GAU A;  4CCN A;  4JX5 A;  3HOS A;  3L2W A;  1V54 H;  2XUB A;  1YRN B;  2OAZ A;  4CSW A;  2EBI A;  1H9T A;  2VJ4 A;  4FE7 A;  3IWZ A;  3GW2 A;  1BJZ A;  1QRY A;  2E1M C;  4A0X A;  3ECH A;  1F43 A;  1KYW A;  4MHG A;  2W00 A;  2MD5 A;  4RAY A;  2ZJP F;  2G0E A;  2TCT A;  3BLY A;  3H1C A;  1L3L A;  3VOD A;  2L02 A;  3RIR A;  2A6E F;  3LST A;  2JSC A;  3ZMU A;  2MC3 A;  2XKP A;  3Q9V A;  5KK1 A;  1LFP A;  2HR3 A;  3M4O J;  3EUH C;  4F91 B;  1JUP A;  2V1N A;  3ZCO A;  3C1D A;  5LLQ A;  1YE9 A;  1F36 A;  3SDB A;  5K7H A;  2M7B A;  3T1B A;  3ZQH A;  4JP0 A;  5F6F A;  2ELJ A;  4RAG A;  2L4M A;  5BNG A;  2P7C B;  4F92 B;  1T0F A;  3IH4 A;  2XGD A;  1W7P A;  2UUZ A;  2XGE A;  1LB2 A;  3RDI A;  4P1W A;  3GFL A;  2K27 A;  1M1E B;  3TKY A;  2KQR A;  3CO7 C;  1QHG A;  2JUC A;  2W24 A;  3IH2 A;  3H9G A;  2LP0 A;  1SD4 A;  3KP5 A;  2BZT A;  3WU0 A;  4UB6 C;  2XAF A;  4F7Z A;  3G4S I;  1FLI A;  2E1C A;  3R0J A;  5IYB J;  1EH6 A;  4DYC A;  3TL4 X;  1DP7 P;  3IHU A;  2XRL A;  3GF2 A;  2IT0 A;  1VI0 A;  2R3S A;  2X51 A;  3TO6 A;  5LHH A;  4LB6 B;  4NHJ A;  2E35 A;  3I59 A;  1XGM A;  3L00 A;  4TV7 A;  3HUG B;  1BOA A;  1FWZ A;  2P4W A;  2PN6 A;  2XHK A;  3QYF A;  3TO7 A;  4M73 A;  2K3F A;  4BXU A;  3SYT A;  4BAY A;  4CIC A;  2HU9 A;  3OS0 A;  2RRE A;  3VEP A;  3KP2 A;  3MKW B;  3HGG A;  3ISP A;  4BHP A;  5E3N A;  4P9U A;  2X6Y A;  2A07 F;  1X3Z B;  2FNA A;  2K9Q A;  1KQ0 A;  1XSX A;  3AG2 H;  3G1O A;  4Q5S F;  3EYI A;  4I01 A;  3EET A;  2F4O B;  4X0G A;  1XGN A;  3PFY A;  3KX2 A;  1WJF A;  1KQ9 A;  3RYP A;  1CF7 A;  2H1K A;  1XDS A;  2L2O A;  1KYZ A;  5C3E J;  3LSG A;  2EIM H;  5CQG A;  4H0E A;  1IN5 A;  2HYJ A;  2HQA A;  3CP8 A;  2EFO A;  1T6S A;  3D1N I;  3CUO A;  5E8I A;  1R5G A;  3ZMS A;  5LRR A;  2LBF B;  4XMY A;  2DT6 A;  3ZQI A;  4YFK F;  2HKX A;  5C44 J;  4BDY A;  1OIS A;  2R7Q A;  1AHD P;  3DTE A;  2F6C A;  2DW4 A;  3ULQ B;  3KPH A;  2OCE A;  1GLN A;  2FBH A;  5D4S A;  3COA C;  1WJD A;  3FF5 A;  3GFM A;  2DDA A;  2TRT A;  4HLX A;  1ZHF A;  1OCZ H;  2K9M A;  3ASN H;  3BJA A;  4I7H A;  4A3L J;  1A04 A;  2CUF A;  1XB4 A;  1MND A;  2DT5 A;  2KIQ A;  1JUS A;  3T8R A;  3F8N A;  5J1R A;  3HSF A;  2D45 A;  4EGZ A;  3PIO F;  1IRG A;  4WX9 A;  1IV8 A;  4IVN A;  1H89 C;  1XTA A;  2JVG A;  1U5T C;  1Z6T A;  1VQK I;  3PJR A;  4P96 A;  2DA1 A;  2G9W A;  3F8F A;  3ZQ7 A;  5B66 C;  2V1D A;  1VFC A;  2XSD C;  3HSE A;  2WAD A;  3DPL C;  1L0O C;  4M3D A;  3BTJ A;  5FKK A;  2JK3 A;  4XLH A;  2CQ7 A;  4MEY F;  5LEK A;  1E17 A;  1WJB A;  1ZYR F;  2CH0 A;  2XRN A;  3BR1 A;  3E6D A;  5AON A;  5LHG A;  1ZRF A;  4NC8 A;  3W2V A;  4ZYD A;  3S1Q J;  2X48 A;  5D6F A;  2QQ8 A;  4A6D A;  4KUM A;  3HL2 A;  2L9V A;  1D1C A;  5CVJ A;  1ETO A;  1RES A;  5FGM A;  3CCL I;  3DU6 A;  2R7W A;  4UVA A;  1KA8 A;  4RA2 A;  5J40 A;  4WF2 A;  3WE3 A;  2CFO A;  3R61 A;  1P7I A;  2ZFW A;  4ZTJ A;  2XGC A;  2EH3 A;  5HS9 A;  2ZB9 A;  4AWX B;  1LFU P;  2OA4 A;  1R00 A;  4Y17 A;  3WTZ A;  2IA0 A;  2ZME B;  4BXX J;  3BPV A;  3KET A;  1WZ2 A;  2DMT A;  2DQR A;  5ERI A;  3GLL A;  2DU9 A;  4IOC F;  2OTJ I;  4XRS A;  2RDP A;  4MLO A;  2R5Y B;  1MIJ A;  1DGW Y;  3CC7 I;  5F1R A;  1BW5 A;  3PUF A;  3BR3 A;  2Q1Z B;  5LFA A;  2R5Z A;  5GTH C;  1BR4 A;  5E3O A;  1K83 J;  3PSI A;  2F5F A;  2HZD A;  4FT8 A;  1IAW A;  1UB9 A;  1I5Z A;  1P4A A;  2W7N A;  1ZKG A;  2HPI A;  4DGW B;  2VL8 A;  1OCR H;  4M9Z A;  1DGR M;  3U21 A;  2KIU A;  1IJW C;  1D0Y A;  3W6J B;  4WWC A;  4BUP A;  1ZRE A;  3OOP A;  2ZJQ F;  1FYM A;  4O3M A;  3R0A A;  1XG1 A;  3KLN A;  5K1Y A;  1U2W A;  4G6T B;  3OS1 A;  2DJN A;  4NQW A;  3IP4 B;  1IF1 A;  1VQ7 I;  1LVK A;  3BR2 A;  2YR2 A;  2EIJ H;  3GXO A;  3ERE D;  2CS3 A;  3FBN B;  1PYV A;  3RQ4 A;  1BC7 C;  4CYD A;  2HPM A;  1G3W A;  2FBK A;  4HV5 A;  2WAE A;  4J00 A;  1UZC A;  1D3Y A;  4A0Y A;  2B7E A;  4Q48 A;  2HXI A;  3WTS C;  3RYR A;  4DBQ A;  4D0P A;  2L7M P;  4E7H A;  4A3B J;  4L18 B;  2AXT C;  2CWE A;  3S15 J;  2BXZ A;  4EQQ A;  3PQJ A;  4CHU A;  3BJ6 A;  3BWG A;  4MNU A;  1TQI A;  5IP6 A;  1MBK A;  2MD0 A;  3CMA I;  4HRI A;  3OR1 C;  3HOV J;  4RLF A;  1J7K A;  1G3S A;  4UB8 C;  1OMI A;  3VB2 A;  1U5T A;  3D5L A;  4FE4 A;  5D5U B;  2QQ9 A;  5CLS A;  4IHT A;  1N25 A;  5LHI A;  5DS9 A;  4KIT B;  2RAE A;  1TQP A;  4YIF A;  2L0K A;  5HLH A;  1KU2 A;  3K70 D;  3K9T A;  2IAI A;  4AC0 A;  5IOY A;  4JYK A;  5LGN A;  2LTP A;  1JHF A;  3CCJ I;  2G7H A;  2ISY A;  1X2N A;  2BXY A;  5EF6 A;  1J9I A;  4G6D A;  2Y9Y A;  4CCO A;  1O3R A;  4ON0 A;  2HOT A;  1WPK A;  4I76 A;  4ZDL A;  1BJA A;  1IN4 A;  1EH7 A;  1HLV A;  3J7Z I;  2HOA A;  4RB0 A;  3K0L A;  2M0C A;  3Q0U A;  1H88 C;  4RBO A;  1MH3 A;  1LDJ A;  3SQN A;  5F0H A;  1X1A A;  4M9X A;  2C6Y A;  1D5V A;  1U0J A;  1Z6R A;  3FXR A;  3RKY A;  2ADU A;  2EZI A;  3D5R C;  4MIM A;  4OOI A;  4BNC A;  4XLA A;  3V7R A;  1JJ6 C;  4KDP A;  3LA7 A;  1WJ5 A;  3F3X A;  4PGH A;  3OYE A;  3J7Y J;  2K9N A;  1TL8 A;  2P8T A;  2STT A;  5H6Q A;  3GFI A;  2QWW A;  3GBG A;  2HVS A;  4NC6 A;  3GTK J;  2X6O A;  1RPW A;  2R7O A;  4G8X A;  2MAB A;  1UHW A;  4N9H A;  2R4G A;  1EA3 A;  2FXA A;  2B63 J;  2VOD A;  1E3P A;  1VQ6 I;  3CMY A;  1CQT A;  3I64 A;  4AIH A;  4L5E A;  5J47 A;  1ULY A;  2RN7 A;  2YPR A;  2XB5 A;  3GTG J;  1FSE A;  2OZ6 A;  1TLH B;  2AXL A;  3OR2 C;  5GP9 A;  4EJU A;  4HQE A;  1YTY A;  3RCO A;  2M8E A;  4XOT A;  3TP0 A;  4YFN F;  2FQ4 A;  2JRT A;  3P9C A;  2DA6 A;  2MYS A;  2JA7 J;  4V2G A;  4Y4R A;  1MKM A;  2XKO A; 
#chains in the Genus database with same CATH homology
 2Z99 A;  5JI6 A;  1LDK B;  2K4B A;  2NNY A;  5DCM B;  1TBX A;  1HW2 A;  3W6K B;  3DP7 A;  3M7G A;  2K4J A;  2FMY A;  2K02 A;  4O6J A;  2A6H F;  4OIO F;  4KIG A;  1RIO H;  1JGS A;  3OV8 A;  4UXN A;  3BP8 A;  4XLN F;  4HV6 A;  4A6E A;  3BRO A;  5D8K B;  1T2K A;  4HDV A;  2XV4 S;  1Q1H A;  3SZP A;  2W25 A;  4A5N A;  4G6Q A;  1NHA A;  3CJN A;  5FLX Z;  2FA5 A;  2FRH A;  3SXY A;  2Y48 A;  1EH8 A;  1ON2 A;  1HSJ A;  4Q4Z F;  4RB1 A;  2LF7 A;  5CVV A;  2J5P A;  1VTN C;  4UVC A;  3RPQ A;  1SMY F;  4LB5 A;  3JSO A;  1LNW A;  3H3Z A;  3IC7 A;  1K78 A;  2H6C A;  1YW8 A;  3G3Z A;  5AIQ A;  2E7X A;  1WKM A;  1J59 A;  4GXO A;  2A3S A;  2UZK A;  1MJA A;  2IJL A;  3ZP5 A;  2VE9 A;  3EDP A;  2FF4 A;  1JXS A;  1KGS A;  2JPC A;  2MLG A;  1FBQ A;  2CW0 F;  1D8K A;  1LQ1 A;  3O2P E;  1MDM A;  4CGZ A;  1V4R A;  2HDC A;  1TTY A;  2H6B A;  2WWY A;  1UCR A;  3JTG A;  1FC3 A;  2OQG A;  3E5Q A;  3HYI A;  2QUF A;  2VBY A;  3WTY C;  3EQL F;  1ZLJ A;  2Z5U A;  4Z2Y A;  2WV0 A;  5L3D A;  5L3B A;  2QZ8 A;  1AOY A;  2BE5 F;  2RVC A;  1K7A A;  1S3J A;  4U7D A;  3LA3 A;  1OYY A;  2M1B A;  4RGX A;  1UST A;  4CDG A;  3I4P A;  1R23 A;  3FMQ A;  2EFQ A;  4DQ2 A;  3BDD A;  2EV5 A;  1TNS A;  2LSO A;  5DDG A;  1DPR A;  4G7H F;  3CDH A;  3M9A A;  3F23 A;  5L3F A;  3E97 A;  4KMF A;  5J8F A;  2F5D A;  2RV8 A;  4LLL A;  4HLY A;  3N97 A;  1MJB A;  2ISZ A;  2DQL A;  4G7O F;  3R4K A;  3HTS B;  4ESB A;  4OIQ F;  4RAZ A;  4QLC U;  2DBB A;  1S8N A;  1YFH A;  4CXF A;  2EA4 A;  4KNY A;  4FX0 A;  2Y75 A;  5IT3 A;  4ENM A;  1XGO A;  3F8B A;  1HKS A;  4M74 A;  3KP3 A;  1I27 A;  2LNB A;  3C7J A;  3JTH A;  1YG2 A;  3I5U A;  3MCZ A;  4G7Z F;  1U6G A;  3LA2 A;  1UFM A;  3K1N A;  3C18 A;  2YSR A;  3KEQ A;  4HDU A;  5FFZ A;  2EFN A;  5DYM A;  1DDN A;  2O61 A;  2PJP A;  2GQQ A;  1ZGJ A;  2LDU A;  4FX4 A;  1YLF A;  2XAH A;  3BZ6 A;  3P7N A;  3VOE A;  1OYW A;  3ZMZ A;  4EM0 B;  2PFB A;  2NAZ A;  1R58 A;  3WTT C;  2W57 A;  1P2F A;  4GO1 A;  3WU1 B;  2QM3 A;  4ENK A;  3GVA A;  3QRF F;  3GWZ A;  4HF2 A;  2O3F A;  2ZNZ A;  3KE2 A;  2KIF A;  2PLY A;  3HHG A;  2FQ3 A;  1B4A A;  2Q8K A;  3DXJ F;  2OQR A;  1LEA A;  1E2X A;  4JK1 X;  2VBZ A;  4AIK A;  1R36 A;  3KLO A;  2LKP A;  3J7A O;  2DAO A;  2XAS A;  1XSD A;  4OIN F;  5CVU A;  3SFZ A;  4YFX F;  1IXC A;  1PP8 F;  3TDU C;  2GIV A;  3M8F A;  3JW4 A;  1WRJ A;  2QVO A;  4L9N A;  1USS A;  1O3Q A;  2DTR A;  5JVT A;  4NB5 A;  3Q5F A;  4JQF A;  1ZN2 A;  3R60 A;  4GGG A;  1GVJ A;  1QPM A;  1MGT A;  1FY7 A;  1IRF A;  2L3D A;  1V3F A;  3E6B A;  2L01 A;  3DKW A;  1F4K A;  1W7P D;  4EGY A;  2W84 A;  2F5C A;  4XRF A;  4EJV A;  5A2Q Z;  4EJT A;  4LG0 A;  2O03 A;  4E70 A;  4KN4 X;  4OU0 A;  4OIR F;  2DK5 A;  3V8J A;  3L2C A;  3EUH A;  4CO8 A;  4LMY A;  5HLG A;  3GX4 X;  5DCM A;  3BOQ A;  3MQ0 A;  2V79 A;  5ILU A;  2VC0 A;  1SD5 A;  4EJO A;  2P5L C;  3QPT A;  2M87 A;  4P55 A;  2JZY A;  1ZH5 A;  3E6M A;  1B59 A;  2QQB A;  3P9I A;  1UHM A;  1XDU A;  2PG4 A;  4I02 A;  3K1M A;  2F5E A;  3E5X A;  1B6A A;  3L9F A;  2COM A;  2QBY B;  1LEB A;  3FXU A;  5D6E A;  3RKX A;  1T38 A;  4G94 A;  5DD8 A;  4IRI A;  2M45 A;  2NRA C;  2FBI A;  2FU4 A;  2Q2E A;  1OPC A;  3CLO A;  4Y15 A;  3BJO A;  5IT9 Z;  3C3W A;  3REO A;  2WTE A;  4KA4 A;  3F72 A;  2V6C A;  1BI3 A;  3O6B B;  4ETS A;  3O3K A;  3ZN0 A;  1IN8 A;  4LD5 A;  4N0B A;  3J81 K;  1G6N A;  2CSO A;  2D2W A;  2H94 A;  1KU3 A;  4IXA A;  2IA1 A;  2FOK A;  4AVP A;  4L0Z B;  3HTU A;  3H3U A;  2ZNY A;  1ZLK A;  2R7F A;  2NNN A;  2PQ8 A;  2FNP A;  5E1W A;  4HA8 A;  2B0L A;  1C0W A;  1QGP A;  3JAM K;  1WQ2 A;  2A68 F;  1Z91 A;  2ZXJ A;  2QEN A;  1IUY A;  1O57 A;  4AIJ A;  4HX7 A;  2HGC A;  2KJC A;  2MLK A;  1SD6 A;  3FM5 A;  2HS5 A;  5E18 F;  2XAJ A;  2HEO A;  2DFI A;  6PAX A;  2GXB A;  3QU3 A;  3MZY A;  4PZJ A;  4L0Y B;  1R1U A;  1STZ A;  2XRO A;  1ON1 A;  3QPH A;  5ILS A;  3J80 K;  4I0A A;  5CYV A;  3TOB A;  1JHH A;  1CF7 B;  1O3T A;  2KRF A;  2Y0M A;  3QOP A;  3HOT A;  2D1V A;  4B8X A;  1F5T A;  4HX8 A;  3U1D A;  3F8M A;  4HZF A;  5LGU A;  4EMS A;  4QWQ A;  5DUK A;  3TO9 A;  2EFP A;  3BY6 A;  3MEX A;  4RB2 C;  2UWM A;  4U88 A;  2QQA A;  1OYI A;  3K1P A;  5E1X A;  2MA3 A;  4IF4 A;  3FZV A;  3LQR A;  5L3E A;  4HOB A;  2CG4 A;  5HLI A;  4I0B A;  1R22 A;  3CTA A;  1QNT A;  4I09 A;  1XSV A;  2FSW A;  1YYV A;  2VT3 A;  5HS8 A;  2OU2 A;  1LDD A;  3U9G A;  1F1Z A;  4XSZ F;  3V7C A;  4ZYH A;  3HHH A;  3ZN1 A;  1ZRD A;  5FD6 A;  3QU6 A;  1D8J A;  3KZZ A;  5K5R A;  4UNO A;  3M8E A;  1W5S A;  1R5H A;  1IZ1 A;  1LVA A;  5BQT A;  3F21 A;  3B73 A;  3ZMD A;  1XCB A;  3GO5 A;  1J5Y A;  1ZAR A;  1ZG3 A;  1YO5 C;  4EM1 A;  2VOP A;  4PGG A;  2YU3 A;  3CO6 C;  2GA1 A;  2H27 A;  4A5M A;  5CVI A;  1I6X A;  2RC4 A;  1QBJ A;  4LJZ F;  2V1U A;  2X0L A;  5E1Z B;  5E8G A;  3GFJ A;  4U0Y A;  1I1S A;  3HUG A;  2X4H A;  3QP6 A;  4HX4 A;  1MD0 A;  4P5O A;  4MEX F;  5BS6 A;  2WC2 A;  1OKR A;  3TGN A;  3Q9S A;  2LF8 A;  4P9F A;  2D1H A;  4BHC A;  2EK5 A;  2A5Y B;  3DFG A;  4LK1 F;  4ENN A;  4UHT A;  2UXN A;  3HIF A;  3KFW X;  3TQN A;  4HQM A;  1GXP A;  1O3S A;  2IRF G;  2P6S A;  4EVI A;  3MWM A;  2ZJ2 A;  2A69 F;  1XD7 A;  3JSP A;  1TW3 A;  2VBX A;  2BYV E;  3F6O A;  1SFU A;  2DLL A;  1FPQ A;  1REP C;  2XVC A;  3K2Z A;  3I53 A;  1S6L A;  4GCV A;  3T0Y A;  3WOD F;  1O7F A;  1S7A A;  3HRU A;  1DUX C;  4I98 B;  2XIG A;  5LBQ A;  4ENJ A;  2DPD A;  2ZKZ A;  2HYG D;  2DK8 A;  3V8K A;  4M71 A;  5DD4 A;  2ELH A;  2O0Y A;  3KP4 A;  1MZB A;  2XAG A;  1YS6 A;  3ECO A;  4L9J A;  4KYW A;  4WXH A;  2ESN A;  2VOO A;  5E17 F;  4LLG F;  2QBY A;  4KN7 X;  1QZY A;  1R1T A;  3ML6 A;  2ZME A;  3RKW A;  1WI9 A;  3I0T A;  3NQO A;  5E20 A;  1U3E M;  3HSR A;  4ZYG A;  1IN6 A;  4LGW A;  2MH2 A;  5L3G A;  1BI2 A;  4A12 A;  4ESF A;  3KZY A;  1WWX A;  2Z3Y A;  3D0S A;  1Y0U A;  2W85 A;  1Z1D A;  1YS7 A;  3GLX A;  3SHF A;  5KVR A;  3RTR A;  3BPX A;  3LAJ A;  4MQV A;  1U8R A;  3ABU A;  2F2E A;  3WTX C;  3IRQ A;  1LJ9 A;  3KCC A;  3HRS A;  5DEQ A;  3NEU A;  1G4D A;  2M30 A;  2P7V B;  2PEX A;  2RQP A;  2EV6 A;  2JT1 A;  1P4W A;  3J80 Z;  1ZAO A;  2KIM A;  2ACJ A;  2CYY A;  3V8L A;  2M5W A;  5H6R A;  3WGI A;  4M6Y A;  3LQQ A;  3I71 A;  4U7B A;  2GXG A;  1J75 A;  5TJJ A;  4EJW A;  4HBL A;  4IJA A;  4WK8 F;  3KP7 A;  1IXR C;  2HQR A;  3L7W A;  4HW0 A;  5JHU A;  5DUI A;  1QO0 D;  4WXC A;  1FNN A;  1K78 B;  2L4A A;  1K79 A;  5HDG A;  2ZO4 A;  3T8T A;  3KEO A;  1RZ4 A;  1IXS B;  2VE8 A;  3NRV A;  2EV0 A;  1QZZ A;  2EFW A;  5JR3 A;  1RI7 A;  3ZMT A;  1B9N A;  1HKQ A;  2J5O A;  1G3T A;  4FHT A;  2FE3 A;  4HAM A;  2P5V A;  5DV5 A;  2HTS A;  2RNJ A;  2KJB A;  2UXX A;  1BI1 A;  2CQK A;  1MDM B;  3LFK A;  2EJR A;  1HKT A;  2PMH A;  4WCG A;  1P92 A;  1K6O A;  4EM2 A;  4WXD A;  5FLX K;  2MBF A;  1ZG5 A;  5ICE A;  1YQA A;  2E7W A;  1HW1 A;  5CJ9 A;  2DPU A;  4M72 A;  3PQK A;  2VBW A;  1FSH A;  2VN2 A;  5FB2 A;  1TW2 A;  1YIO A;  2BEO A;  3WTV C;  2VT2 A;  4BQA A;  5D8L B;  2NS0 A;  3AAF A;  1O7L A;  1R7J A;  4ZH4 F;  4L5I A;  3DV8 A;  4R8H A;  1Z05 A;  1KQ8 A;  1RNL A;  4YG2 F;  4UV8 A;  3N4M A;  5L3C A;  2RKH A;  3I54 A;  2XGX A;  4LFU A;  4ZYE A;  2HZT A;  3G73 A;  3GUD A;  2BBY A;  3B02 A;  4M9S A;  1J2X A;  2IPQ X;  1Z9C A;  1S29 A;  1BN5 A;  3IKT A;  4LLN A;  4A2U A;  3LWF A;  2OBP A;  3I58 A;  3E3V A;  1XGS A;  2P5K A;  2PI0 A;  2P6T A;  1IN7 A;  4OMZ A;  4HF0 A;  3RI4 A;  5ED4 A;  2GA2 A;  4PDK A;  3ZPL A;  4RS8 A;  1AWC A;  3IL2 A;  5BMZ A;  4MQ9 F;  2Z33 A;  3V4G A;  1FP1 D;  3GZ6 A;  1IW7 F;  3CUQ B;  1TQM A;  2HFH A;  4RGS A;  1W5T A;  1RUO A;  3F22 A;  4R79 A;  2OD5 A;  1CGP A;  1EV7 A;  4KIC A;  5D4R A;  4XBF A;  1S7O A;  1H0M A;  3HRT A;  4M6X A;  5EEH A;  2TDX A;  2QLZ A;  1QQI A;  3FM3 A;  3VFZ A;  3ZMV A;  2IP2 A;  1HQC A;  2HTJ A;  5CVR A;  1BBY A;  5FO5 A;  3FHZ A;  1SFX A;  4KFC A;  1SMT A;  3FMR A;  1XCV A;  3ROU A;  1FP2 A;  2CO5 A;  4HF1 A;  2BV6 A;  3E5U A;  4Y13 A;  1HXD A;  2RGV A;  1W7P B;  3DEU A;  5FFX A;  1W4M A;  3EYY A;  1FYK A;  5J8C A;  4LK0 F;  4MGR A;  1B9M A;  1FZP B;  1Z7U A;  1YW9 A;  1WSU A;  1GXQ A;  4U0W A;  2L54 A;  3TOA A;  2Q0O A;  3I59 B;  4K2E A;  2YX7 A;  2ESH A;  1XN7 A;  2KKO A;  4MTD A;  5D5V B;  4ASN A;  2K7L A;  1ZGA A;  4DNC A;  1BC8 C;  4N9I A;  1HST A;  1F9N A;  4XSX F;  3PFI A;  4S05 A;  5TRD A;  4KT5 C;  1RUN A;  5HOO A;  5K5Q A;  1ODD A;  2GWR A;  4KMU X;  4KIB A;  2VC1 A;  3IKV A;  5J6X A;  2K86 A;  3P9K A;  4LG0 B;  1HW5 A;  1SAX A;  2HKO A;  2IVM A;  1XMK A;  1JE8 A;  5EEG A;  2HWV A;  1PUE E;  4IHS A;  2CFX A;  4HYE A;  3DQV C;  1BIA A;  2V9V A;  4L9V A;  2EB7 A;  3SZT A;  4ZZD A;  4R1H A;  4U0V A;  2STW A;  1FBU A;  1FYL A;  4L5J A;  3ABT A;  5BOX A;  4BHB A;  2YX4 A;  2A61 A;  2E1N A;  5HDN A;  4GYI A;  4ESJ A;  3DPT A;  5ICC A;  3IWF A;  4I2O A;  5HVQ C;  1FOK A;  1ZRC A;  1T98 A;  5ICG A;  5H20 A;  3FWE A;  4A0Z A;  1KU9 A;  4BH9 A;  5HS7 A;  4MTE A;  2PMU A;  3LAP A;  4XLP F;  1KU7 A;  4BYY A;  2NYX A;  1YW7 A;  1TNT A;  2ETH A;  2EA2 A;  1J0R A;  4S04 A;  5JFR A;  3ELK A;  4YII A;  4UUV A;  3QAH A;  5A2Q K;  4IRH A;  3RPU A;  1T39 A;  3F8C A;  1SD7 A;  5LEJ A;  2JTV A;  2GZW A;  1U78 A;  2Z9O A;  4OIP F;  3V7S A;  2XAQ A;  2VON A;  1OR7 A;  3HRM A;  5HDK A;  2FEZ A;  4JBA A;  4O5V A;  3WE2 A;  5K5O A;  2BGC A;  3KP6 A;  3MFK A;  2FML A;  1MJ9 A;  1P4X A;  4AD9 A;  3CUQ C;  3F6V A;  5AIP A;  3MZH A;  3R6S A;  5LRS A;  4IPA A;  2EWN A;  5BPD A;  4GYG A;  5D5W B;  1XMA A;  3K69 A;  3RJP A;  5LGT A;  1U5T B;  3GZ5 A;  4CZZ A;  5DCF A;  2CGP A;  4IRG A;  1PP7 U;  2R7D A;  3U2R A;  1X3U A;  4G9Y A;  2O6G E;  4Q47 A;  3GEZ A;  1ONV A;  2IA2 A;  3IRR A;  4B09 A;  2IW5 A;  2VXZ A;  4PCQ A;  1PDN C;  1B1B A;  3QP5 A;  5IT9 K;  2V1X A;  4UV9 A;  3TDZ C;  1GHC A;  5ICF A;  3J81 Z;  2HQN A;  5D5X B;  2QYO A;  2HYF A;  2ZCW A;  4ZZL A;  3E6C C;  1SFE A;  3WTU C;  3GYH X;  2JPB A;  3DF8 A;  4OMY A;  2PBI A;  3FMS A;  1G3Y A;  4UVB A;  2DO7 A;  3MAJ A;  3H92 A;  2HOE A;  2OZU A;  5FD5 A;  2O8X A;  1BM9 A;  4RGU A;  3T5X A;  5F64 A;  3FXQ A;  3JAM Z;  3WTW C;  1BIB A;  2G7U A;  1FBS A;  3WGH A;  4L9T A;  4KIF A;  1DPU A;  5ILV A;  1P6R A;  3M1E A;  5BPI A;  1FT9 A;  3S2W A;  1FX7 A;  3L09 A;  1I1G A;  2ZBK A;  3WG9 A;  4RGR A;  4RB3 C;  1BI0 A;  2H09 A;  3WGG A;  3CUQ A;  1ZG1 A;  2AS5 F;  4EV0 A;  2MH9 A;  1H9G A;  2DI3 A;  1HBX G;  3FX3 A;  1R1V A;  2GAU A;  3HOS A;  2XUB A;  2OAZ A;  1H9T A;  3IWZ A;  3GW2 A;  4A0X A;  3ECH A;  1KYW A;  4MHG A;  4RAY A;  2MD5 A;  1L3L A;  3VOD A;  2L02 A;  3RIR A;  2A6E F;  3LST A;  2JSC A;  3ZMU A;  2MC3 A;  2XKP A;  3Q9V A;  5KK1 A;  2HR3 A;  5LLQ A;  3C1D A;  3T1B A;  5F6F A;  2L4M A;  2P7C B;  1T0F A;  1W7P A;  1LB2 A;  3RDI A;  3GFL A;  2K27 A;  3TKY A;  3CO7 C;  2W24 A;  1SD4 A;  3KP5 A;  3WU0 A;  2XAF A;  4F7Z A;  1FLI A;  2E1C A;  3R0J A;  1EH6 A;  1DP7 P;  3IHU A;  3GF2 A;  2IT0 A;  2R3S A;  3TO6 A;  5LHH A;  4LB6 B;  4NHJ A;  3I59 A;  1XGM A;  3L00 A;  4TV7 A;  1BOA A;  1FWZ A;  2P4W A;  2PN6 A;  2XHK A;  3TO7 A;  4M73 A;  4BXU A;  4CIC A;  4BAY A;  3VEP A;  3KP2 A;  3ISP A;  4BHP A;  4P9U A;  2A07 F;  2FNA A;  1KQ0 A;  1XSX A;  4Q5S F;  3EYI A;  4I01 A;  3EET A;  1XGN A;  1CF7 A;  1KQ9 A;  3RYP A;  1XDS A;  1KYZ A;  4H0E A;  1IN5 A;  2EFO A;  1T6S A;  3CUO A;  5E8I A;  1R5G A;  3ZMS A;  5LRR A;  4YFK F;  2HKX A;  2DW4 A;  3ULQ B;  2FBH A;  5D4S A;  3COA C;  3FF5 A;  3GFM A;  4HLX A;  1ZHF A;  3BJA A;  4I7H A;  1A04 A;  1XB4 A;  2DT5 A;  3T8R A;  3F8N A;  3HSF A;  2D45 A;  4EGZ A;  1IRG A;  4WX9 A;  4IVN A;  1U5T C;  1Z6T A;  4P96 A;  2G9W A;  3F8F A;  3ZQ7 A;  2V1D A;  3HSE A;  3DPL C;  1L0O C;  4MEY F;  5LEK A;  1E17 A;  1ZYR F;  5AON A;  2XRN A;  3E6D A;  5LHG A;  1ZRF A;  4ZYD A;  5D6F A;  4A6D A;  4KUM A;  5FGM A;  5CVJ A;  4UVA A;  1KA8 A;  3WE3 A;  4WF2 A;  3R61 A;  2ZFW A;  5HS9 A;  4AWX B;  2OA4 A;  1R00 A;  4Y17 A;  3WTZ A;  2IA0 A;  2ZME B;  3BPV A;  3KET A;  2DQR A;  5ERI A;  2DU9 A;  2RDP A;  5F1R A;  2F5F A;  4FT8 A;  1IAW A;  1UB9 A;  1I5Z A;  1P4A A;  4M9Z A;  2KIU A;  3W6J B;  4WWC A;  1ZRE A;  3OOP A;  1FYM A;  4O3M A;  3R0A A;  5K1Y A;  3KLN A;  1U2W A;  1IF1 A;  4NQW A;  2YR2 A;  3GXO A;  3ERE D;  1BC7 C;  4CYD A;  1G3W A;  2FBK A;  4HV5 A;  1D3Y A;  4A0Y A;  4Q48 A;  3WTS C;  3RYR A;  4D0P A;  4L18 B;  2CWE A;  4EQQ A;  3PQJ A;  4CHU A;  3BJ6 A;  3BWG A;  4MNU A;  1TQI A;  1J7K A;  1G3S A;  1OMI A;  3VB2 A;  1U5T A;  3D5L A;  5D5U B;  2QQ9 A;  5CLS A;  4IHT A;  5LHI A;  4YIF A;  1TQP A;  5HLH A;  1KU2 A;  3K9T A;  5LGN A;  1JHF A;  2G7H A;  2ISY A;  1J9I A;  4G6D A;  1O3R A;  4ON0 A;  1BJA A;  1IN4 A;  1EH7 A;  4RB0 A;  3K0L A;  1LDJ A;  3SQN A;  4M9X A;  2C6Y A;  1D5V A;  1Z6R A;  3FXR A;  3RKY A;  2ADU A;  4OOI A;  4BNC A;  3V7R A;  4KDP A;  3LA7 A;  3F3X A;  4PGH A;  2P8T A;  2STT A;  5H6Q A;  3GFI A;  2QWW A;  4G8X A;  1UHW A;  4N9H A;  2FXA A;  2VOD A;  3I64 A;  4AIH A;  1ULY A;  2RN7 A;  2YPR A;  1FSE A;  2OZ6 A;  1TLH B;  2AXL A;  4HQE A;  4EJU A;  1YTY A;  2M8E A;  4YFN F;  2JRT A;  3P9C A;  1MKM A;  2XKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...