4B8XA

Near atomic resolution crystal structure of sco5413, a marr family transcriptional regulator from streptomyces coelicolor
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
144
structure length
139
Chain Sequence
b'GVPSMAAITSIMRAQQILLGEVDAVVKPYGLTFARYEALVLLTFSKSGELPMSKIGERLMVHPTSVTNTVDRLVRSGLVAKRPNPGTLATITDKGREVVEAATRDLMAMDFGLGAYDAEEGEIFAMLRPLRVAAGDFDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POSSIBLE MARR-TRANSCRIPTIONAL REGULATOR
publication title High Resolution Crystal Structure of Sco5413, a Widespread Actinomycete Marr Family Transcriptional Regulator of Unknown Function.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 52
structure length 139
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4b8xA00
2GA2A 3ECOA 2OAZA 1R23A 3I64A 1MDMA 1UHMA 4RB0A 2FRHA 1S29A 2EWNA 2KIMA 1U2WA 3E3VA 3OOPA 4Q4ZF 1Y0UA 2FQ3A 1FBUA 5BS6A 4BH9A 4MEXF 2HZTA 1R22A 3QU3A 2DPDA 2W57A 4HAMA 3P9CA 3SFZA 5LHHA 3H3UA 4DNCA 1XSDA 4A12A 3JW4A 2CGPA 3RJPA 2O3FA 2YR2A 2LF7A 2D1VA 3CJNA 1RUOA 2OZ6A 4EQQA 3EQLF 3RTRA 4G6DA 4A5NA 1YFHA 5K5OA 4OIOF 5L3FA 4GCVA 3K0LA 3M7GA 3VB2A 4IHTA 4PGGA 3B73A 2QYOA 1ZG5A 1BI3A 3Q9SA 3L09A 1IW7F 1KYZA 1EV7A 4HA8A 4O3MA 4RS8A 2HKOA 3RKYA 1YQAA 2Z3YA 5E8GA 4CYDA 5TRDA 2ZKZA 3I71A 1PUEE 4HQEA 1QZYA 5HDKA 1SD5A 4ZYHA 1I1GA 3J80Z 1I1SA 1IUYA 1VTNC 1FBQA 2VN2A 5IT3A 4YIIA 5HDNA 2CYYA 2CSOA 3TGNA 2P5KA 5FFXA 1IZ1A 3FZVA 3HIFA 4HF2A 3FF5A 4A2UA 2FMYA 4BQAA 3GZ6A 2XAGA 2K02A 3V7CA 3IL2A 5LRSA 4EJVA 3MZHA 4KA4A 3EUHA 2RC4A 3R6SA 3ABUA 3IKVA 4Y15A 3L00A 3E5QA 4RB1A 1JE8A 1FC3A 1KU7A 5DUKA 5HLGA 2NNNA 1KU2A 2IPQX 1LDKB 3RKXA 2Z33A 2XIGA 3G3ZA 1LDJA 1B6AA 2OBPA 3F3XA 1IN7A 1GXQA 3WU0A 4F7ZA 1O57A 3RKWA 3I58A 5FLXK 1REPC 4Y13A 4BHPA 3TKYA 3LSTA 3F6VA 4OIPF 3TQNA 1K6OA 3KCCA 1U8RA 2E1CA 2VODA 3BJOA 2CW0F 4CO8A 4FX0A 1FLIA 4BAYA 3IKTA 1ON2A 2K27A 5D5VB 3V8KA 3EDPA 2VOOA 2K86A 2WC2A 1DUXC 2X4HA 5IT9Z 3GFIA 2DI3A 3ML6A 2Q8KA 2V9VA 2RNJA 3E6CC 1XCVA 2W24A 4IRIA 5D5WB 5K1YA 1F9NA 1P6RA 4HQMA 3BDDA 3Q9VA 2FU4A 4KICA 2CFXA 2P7VB 3RYPA 1FWZA 1W7PB 1FPQA 2MH9A 2E7XA 3CUQC 2Z99A 3F6OA 1R7JA 3VOEA 2H6CA 1ZARA 4N9IA 4EJUA 5BOXA 1U5TA 2OQGA 4LK0F 1Z7UA 2VBWA 3O3KA 2PLYA 3WTWC 2ZO4A 5DCMA 1WI9A 4A6EA 4KNYA 3LAJA 1R5GA 3GXOA 5LRRA 4EJOA 3QPHA 3K1NA 2H09A 2FNAA 3GVAA 3W6KB 4UV9A 1YTYA 3G73A 3KZYA 4ENKA 3HHGA 2FNPA 3T1BA 4A6DA 2GXBA 4LD5A 2V1XA 2XAHA 3IWZA 1TNTA 5AIPA 2X0LA 3HRUA 4UUVA 4L0ZB 2L4MA 2O61A 2OQRA 2PI0A 1GHCA 5ILSA 5CVRA 3T0YA 1WKMA 3ZN1A 2HS5A 5CYVA 4N0BA 1J59A 4FX4A 1MDMB 2HQRA 3FMSA 3HOSA 3WU1B 4MQVA 2A6HF 4MNUA 3WGGA 5K5RA 3O6BB 2FEZA 3ZMZA 3MZYA 4ESJA 5A2QK 4YG2F 1RNLA 1FP2A 5ICFA 2HTSA 2CQKA 1UHWA 5BMZA 1R5HA 3TDUC 3ROUA 4YFXF 2M87A 3GZ5A 4L18B 2YX4A 3QAHA 4OMZA 4PZJA 4M9SA 3D0SA 3LQQA 3U9GA 3MFKA 4OMYA 4CHUA 3EETA 1Z91A 3FM3A 1SMTA 1ZGAA 1SAXA 1R00A 4AVPA 2XAQA 2LDUA 3H3ZA 3ZMVA 2PEXA 4EVIA 4ZZLA 4ZYEA 3WTZA 2C6YA 2JT1A 4LLNA 2XAJA 1B9NA 3REOA 3GEZA 4MEYF 4P9UA 1UFMA 5HVQC 1BI1A 4ZYGA 5F6FA 1DDNA 1BN5A 5DEQA 1LVAA 5CVIA 4U88A 3ZQ7A 1ZRDA 3DFGA 3COAC 2O6GE 4GO1A 4OINF 1Q1HA 4HX8A 1TTYA 3R4KA 3I59A 4KIBA 2DO7A 5J8CA 1K78A 2D2WA 4OOIA 3R60A 2P8TA 3C7JA 1EH8A 2R3SA 4B8XA 1TNSA 4MGRA 5DV5A 2VE9A 3ZN0A 2HYGD 2VC0A 4LLGF 2YPRA 1USSA 1S8NA 1GVJA 1LEAA 2P5LC 2PN6A 3M8EA 4A0YA 3H92A 4O6JA 1YYVA 2HKXA 5BPDA 4RAYA 3BJAA 2IT0A 2V6CA 3U2RA 3FXQA 3QOPA 2EFPA 2LNBA 2EB7A 2HYFA 1U6GA 4PCQA 2P4WA 4HV5A 4XSXF 5D8LB 1W7PD 2FBKA 4Q47A 2MD5A 3HSRA 3E5XA 1AWCA 1YIOA 3L7WA 2IA2A 5FD6A 1BOAA 4K2EA 2WV0A 3LWFA 2XHKA 3HRMA 4LK1F 2KJBA 2D45A 1FX7A 2ELHA 5KK1A 2EFQA 1IRFA 1ODDA 2ESHA 3MQ0A 4IRHA 1YW7A 2F2EA 5E1ZB 3CUQA 2EFOA 1IN4A 3PQJA 2VBXA 1R36A 1HSTA 5IT9K 4CXFA 4I98B 2VBYA 1BIBA 2OZUA 2QLZA 4ASNA 2LKPA 1XMKA 3QPTA 4L9JA 2OA4A 4AWXB 1G4DA 2EA4A 2G7HA 3V4GA 4LJZF 3RYRA 3GFMA 2EFWA 5D8KB 3QP6A 4HF1A 4HYEA 4P96A 4WCGA 5D4SA 1B1BA 4UVCA 2DW4A 3KEOA 4BHBA 1MJBA 2EV0A 1ZG1A 3CUOA 1U5TB 4NB5A 3BZ6A 5K5QA 3K1MA 3ZMDA 1PDNC 5DCMB 3RDIA 2K4JA 2EFNA 1O7FA 2YX7A 1XGOA 1HQCA 2ZBKA 3E6DA 3IRQA 1ZRFA 2DLLA 3E6BA 2L3DA 5F1RA 3F21A 3TOBA 1YG2A 4U7DA 5L3DA 3BP8A 5FD5A 1G3WA 4L9NA 3K69A 1R1VA 1KGSA 3FHZA 1I6XA 3HSFA 2L02A 1MD0A 3ZMUA 5AIQA 1OYIA 2IA0A 3V8LA 5CVVA 5LEJA 5HOOA 4IRGA 1EH7A 4PGHA 1ZHFA 3HHHA 4RGRA 5L3GA 3CLOA 1XGNA 3DXJF 3I53A 3GWZA 1CF7A 4ENMA 1ZG3A 3HTUA 4LB6B 2JSCA 3K1PA 1JXSA 1J5YA 3FMQA 1P92A 5ICEA 3HTSB 3CO6C 4OIQF 3WE3A 4KT5C 3WTUC 1FOKA 2NRAC 3T8TA 4M6XA 1LQ1A 1FYMA 4S04A 5FO5A 5AONA 3GUDA 3GX4X 1LEBA 2MH2A 4TV7A 3C3WA 1Z6TA 3PFIA 3J81Z 2VT2A 5HLHA 2PQ8A 3B02A 4Z2YA 1W5TA 3ZMTA 2ZMEA 3R0AA 2QVOA 3JAMZ 1BC7C 4G6QA 1J2XA 1RIOH 4ESBA 4KMFA 4JBAA 4EGYA 3J7AO 2GXGA 2FA5A 2QUFA 3F8BA 3N4MA 1XD7A 2COMA 5D6FA 3RPUA 5DD4A 5E1WA 3JTHA 1E17A 2LF8A 3I59B 1R1UA 4FHTA 1G6NA 1K78B 2DK8A 1FYLA 4I0AA 2EV5A 2YSRA 2P6TA 1IXCA 4PDKA 2QQ9A 3JSPA 1UCRA 2BV6A 1ZH5A 4RAZA 4L9TA 1T98A 1IXSB 5J8FA 4JK1X 4KN7X 3TO9A 5D5UB 4LGWA 4HX4A 1XGMA 3DPLC 3WTTC 2E1NA 1L3LA 3NRVA 4A0XA 1K7AA 4GYIA 3F8CA 3I0TA 4UNOA 1OYYA 2Y75A 1W5SA 2IP2A 4EM0B 1XDUA 2GWRA 4YFKF 2M30A 2L01A 4U0YA 3P7NA 4ENNA 1E2XA 2FBIA 1S7AA 4R8HA 4HDVA 1XMAA 1CGPA 1QBJA 4P55A 2HR3A 1LDDA 5BPIA 4B09A 5ILUA 5DYMA 1GXPA 3PQKA 2MA3A 2Q0OA 3WE2A 4UVBA 3BOQA 3FM5A 2NYXA 1R58A 5HLIA 3FXRA 1OYWA 4XRFA 3JSOA 4U0VA 3M9AA 4GXOA 2ZXJA 1T0FA 3IRRA 1HXDA 4O5VA 2IVMA 2NS0A 1XN7A 1JHFA 2DAOA 3L2CA 5HS8A 2Q2EA 3ABTA 1L0OC 3TO7A 3I5UA 3SQNA 2FBHA 3CDHA 1J0RA 5LGUA 5ICCA 4LB5A 4H0EA 2L54A 2B0LA 3MCZA 4IPAA 2DQLA 1WRJA 2XGXA 3BPXA 4Y17A 2E7WA 2BYVE 1LNWA 3U1DA 1RI7A 4L5IA 3LAPA 4IJAA 3I54A 2UZKA 1DPRA 4L5JA 4KIFA 1G3SA 4IVNA 3VFZA 1SFEA 2STTA 1H9TA 1USTA 2RVCA 3V8JA 4P5OA 4AIKA 1HW5A 1HKQA 5J6XA 1V4RA 1SD4A 4G7HF 1XDSA 4EM2A 2NAZA 4EJWA 4L0YB 2EK5A 2Y48A 5H6QA 2GQQA 4M73A 2ZCWA 3EYYA 2FOKA 3KLOA 3LA2A 5TJJA 2FE3A 1ON1A 3FWEA 4KIGA 2WTEA 4MHGA 3HYIA 2W25A 1P4XA 2W85A 1D8JA 2MLGA 4G8XA 3KP4A 4ZH4F 3DQVC 1RUNA 2JTVA 4BHCA 3F72A 3J80K 1Z6RA 3ULQB 1CF7B 5KVRA 4A5MA 1OMIA 4GGGA 4I0BA 5FB2A 2ZFWA 1P2FA 2RDPA 2XROA 2PG4A 2ZJ2A 1JGSA 2JZYA 1TQMA 2XRNA 2JPCA 5LHGA 1S6LA 1YO5C 3ZPLA 2VT3A 2A5YB 4I09A 2Z9OA 1DPUA 1IRGA 4EM1A 4R79A 3RI4A 2A69F 4ETSA 2QZ8A 3L9FA 4LMYA 1QZZA 4M9ZA 1BBYA 2XKPA 3CO7C 3M1EA 1HW2A 4P9FA 1FBSA 3F8FA 2OU2A 3V7SA 1XB4A 5LEKA 3KFWX 2ZMEB 1Z1DA 2DBBA 4LG0A 3ECHA 1X3UA 1BI0A 2HGCA 3JAMK 3LQRA 1ZLJA 2WWYA 1IXRC 4ESFA 1OPCA 1D8KA 1STZA 4L9VA 3E6MA 4RGUA 4E70A 1Z9CA 3CTAA 3SZPA 5HDGA 3WODF 1T38A 2L4AA 1T6SA 2PBIA 1KQ9A 1MKMA 4DQ2A 1T39A 1KQ0A 3TO6A 1F4KA 2KIUA 5JI6A 2M1BA 2VONA 3KZZA 4BNCA 1TLHB 2JPBA 4RB2C 3T5XA 2XAFA 2XV4S 1KQ8A 3WGHA 1DP7P 2PMHA 1SFXA 4HX7A 2KIFA 1F5TA 1U5TC 1OR7A 2FSWA 2J5PA 3WG9A 3GW2A 4I2OA 4XSZF 3MWMA 2G9WA 5A2QZ 1MZBA 4WXHA 5HS9A 2AS5F 4M9XA 2FMLA 4G9YA 4YFNF 1BIAA 4M72A 1O3TA 4IXAA 2ADUA 4GYGA 3BY6A 4JQFA 2BE5F 2P6SA 3DV8A 1IF1A 4BYYA 1LJ9A 2QBYA 1BJAA 3QU6A 1F1ZA 4R1HA 2ZNYA 3GYHX 2ISYA 4UHTA 1FY7A 4XLNF 4IHSA 4RGSA 3HRTA 3P9KA 3NEUA 1ZN2A 2GZWA 1O3QA 1RZ4A 3C18A 3WGIA 5LHIA 3HRSA 2D1HA 1BI2A 2IA1A 1P4WA 2KKOA 1G3YA 2RQPA 3GFJA 1O3SA 1YW9A 4G94A 2UXXA 2DT5A 3O2PE 4KDPA 2MC3A 4HW0A 4HLXA 2KJCA 2KRFA 5LBQA 4LFUA 2VXZA 1ZGJA 1XGSA 2BGCA 2MBFA 3NQOA 4I7HA 4XLPF 2F5DA 2EA2A 1PP7U 2XASA 2PMUA 2A68F 4S05A 4KN4X 5L3CA 3P9IA 4EMSA 2R7DA 4CICA 4LLLA 5LGNA 3SZTA 4RB3C 3BROA 1PP8F 2VBZA 2K4BA 1ONVA 5E17F 5DDGA 1XSXA 3BWGA 3DP7A 2PFBA 1U78A 3KP6A 4KMUX 4WXCA 2ACJA 2CWEA 2STWA 3QRFF 5CVJA 2K7LA 4CZZA 2H94A 2M5WA 1B4AA 3D5LA 3F8MA 2GAUA 4M74A 2VC1A 2O8XA 1FZPB 4N9HA 3HUGA 1S7OA 5CVUA 5BQTA 4CGZA 2FXAA 3RPQA 2ZNZA 4I02A 1FYKA 3ERED 4CDGA 1FSEA 1IN5A 3KE2A 3TDZC 1B9MA 4AIJA 3GLXA 3JTGA 1TQIA 3KP3A 2A6EF 3K9TA 1YW8A 1J7KA 1MJAA 2UXNA 4A0ZA 3EYIA 5L3EA 4WX9A 5E20A 5E8IA 4KUMA 3R0JA 3VEPA 1U3EM 4WF2A 3K2ZA 2Z5UA 5JHUA 1EH6A 4UV8A 2DTRA 1ZREA 2ETHA 2ESNA 3Q5FA 3FXUA 4WWCA 4WXDA 2VOPA 2RGVA 1P4AA 3ISPA 1WWXA 2VE8A 2V79A 4XBFA 1MGTA 2HDCA 1K79A 1H0MA 4G7OF 3ZP5A 1HKSA 4M6YA 1FT9A 1ZRCA 5ICGA 4LG0B 1KU3A 4IF4A 1ZAOA 1D3YA 4Q48A 1WSUA 1XSVA 2V1UA 1V3FA 2EV6A 2P7CB 1FSHA 2A61A 4ENJA 5HS7A 2DFIA 1SD7A 3KEQA 4RGXA 3HSEA 1G3TA 1FNNA 1HSJA 2QQAA 1HBXG 1W4MA 2W84A 2HFHA 2A07F 3I4PA 3T8RA 2BBYA 2QWWA 1QGPA 2UWMA 3S2WA 1TQPA 5ED4A 3CUQB 2GIVA 3FX3A 1J9IA 1ULYA 3GO5A 1JHHA 4MTDA 1C0WA 5EEGA 4UXNA 1MJ9A 1HKTA 1TBXA 2ISZA 1T2KA 1QQIA 2NNYA 3F8NA 2RV8A 5JFRA 4AD9A 1J75A 1FP1D 4I01A 3ELKA 4KYWA 3KETA 5E1XA 5ERIA 1H9GA 4WK8F 3OV8A 1WQ2A 2QQBA 5CLSA 3LA3A 3QP5A 3IWFA 4HF0A 4KFCA 3FMRA 2RN7A 2H27A 1AOYA 4MTEA 5CJ9A 3KP2A 5H6RA 1QO0D 3W6JB 4HOBA 4G7ZF 3WTSC 3M8FA 4UVAA 1S3JA 4QLCU 1BC8C 1QPMA 1ZLKA 1UB9A 2FF4A 1IN8A 1SD6A 5JR3A 3F23A 4U7BA 2YU3A 4EGZA 1SMYF 3SXYA 3BJ6A 3IHUA 5ILVA 1KU9A 3KP7A 2A3SA 2QBYB 3TOAA 5EEHA 1QNTA 2RKHA 4NHJA 4EJTA 1R1TA 1YS7A 3ZMSA 5L3BA 3KP5A 1KA8A 1XCBA 4OU0A 4QWQA 1ZYRF 4HV6A 2Y0MA 2HWVA 3SHFA 2DQRA 4MQ9F 2XVCA 2PJPA 5DCFA 6PAXA 5H20A 3R61A 5JVTA 5FLXZ 1I5ZA 2CG4A 2P5VA 1LB2A 4NQWA 5LGTA 4FT8A 4HDUA 3WTYC 3DKWA 2HQNA 2EJRA 2V1DA 1OKRA 2DPUA 3WTXC 2M8EA 5DUIA 1BM9A 2O03A 3V7RA 5LLQA 2LSOA 3DPTA 4YIFA 1I27A 3F22A 2DK5A 2JRTA 2F5CA 1IAWA 3DEUA 3KLNA 5FFZA 2XKOA 5D6EA 4ZYDA 1TW2A 5D5XB 4U0WA 2BEOA 1SFUA 4D0PA 2QENA 2MLKA 3C1DA 2OD5A 4Q5SF 3IC7A 1Z05A 4HZFA 3RIRA 2DU9A 3DF8A 1NHAA 3LA7A 3GF2A 3LFKA 1KYWA 3J81K 2IW5A 1B59A 1IN6A 1W7PA 4AIHA 3HOTA 2QM3A 2XUBA 3GFLA 3WTVC 2F5EA 2J5OA 2M45A 2CO5A 2AXLA 4ON0A 4EV0A 2G7UA 4OIRF 4ZZDA 1D5VA 5E18F 5DD8A 1HW1A 2GA1A 3N97A 1YLFA 4M71A 3BPVA 1YS6A 2TDXA 5D4RA 5F64A 4HLYA 1O7LA 2IJLA 1O3RA 3MAJA 3MEXA 2H6BA 3AAFA 2HEOA 3VODA 2R7FA 2IRFG 2HOEA 3E97A 3E5UA 4HBLA 5FGMA 2O0YA 4BXUA 1TW3A 2HTJA 2F5FA 1A04A
chains in the Genus database with same CATH superfamily
2ZJRF 3K4CA 1A6QA 1IRXA 2GA2A 2OAZA 2CJJA 3ECOA 1R23A 2VQHA 3I64A 1MDMA 1UHMA 4RB0A 1TWAJ 5IP9J 1Z3YA 2FRHA 4BQNA 1S29A 2GM4A 2EWNA 2R5ZB 5F0CA 3CCRI 1X4PA 2KIMA 3VDXA 4MLOA 1U2WA 4D5FA 3E3VA 3OOPA 4Q4ZF 1X19A 2EH3A 2KIQA 1Y0UA 4XQFA 2FQ3A 2FX0A 1FBUA 5BS6A 4BH9A 4XKBA 4MEXF 5M3MJ 2HZTA 2RREA 3QPSA 1WGXA 4DZJA 1R22A 3QU3A 2DPDA 2W57A 3PUBA 3MN2A 4HAMA 1E3OC 3P9CA 3KPHA 3SFZA 5LHHA 2XB5A 3H3UA 4DNCA 5GTIC 1XSDA 3LSRA 3A0HC 4A12A 3HB9A 3JW4A 2FJ1A 2CGPA 1DQUA 4E7JA 3RJPA 4CZCA 2O3FA 4N4OB 2LY1A 2IS6A 2YR2A 1PUFA 2LF7A 2D1VA 1WZ2A 3CJNA 1RUOA 2OZ6A 4EQQA 3EQLF 1MBFA 3WG7H 2VQCA 3RTRA 4G6DA 4A5NA 3UR3C 1YFHA 5K5OA 1YX5A 4NC7A 4OIOF 4XOTA 5L3FA 3OYLA 1TWHJ 1K4TA 3C2HA 4GCVA 2CW7A 2M7BA 4NNJA 1JT6A 3K0LA 3M7GA 3K4JA 5J1UA 2CW8A 3VB2A 1SVLA 3OYKA 1D5YA 4IHTA 3JRFA 4PGGA 3B73A 2QYOA 1ZG5A 2KP6A 1BI3A 3KYDB 3BZKA 3Q9SA 1X2NA 4D5CA 3WHCA 3L09A 1IW7F 1IJWC 4EEFG 3ASOH 3H9JA 2RNGA 3PO2J 1KYZA 4NUBA 1EA3A 1R4NB 1EV7A 4HA8A 4O3MA 1I50J 2R7VA 4RS8A 2HKOA 4A3FJ 3RKYA 1YQAA 2Z3YA 5EG0B 2VL8A 1A35A 5E8GA 3G1OA 4CYDA 5TRDA 3QQAA 1JJ6C 2ZKZA 2QKLB 3I71A 1AHDP 1PUEE 4HQEA 1QZYA 5HDKA 1SD5A 3HC7A 5B66C 4ZYHA 1IDYA 2R7WA 2H1KA 1CQTA 3E1SA 1ENHA 2LKSA 1I1GA 3J80Z 1I1SA 1IUYA 1VTNC 1KZHA 5EJCA 1YE9A 4BY7J 3S1RJ 1FBQA 2VN2A 3CESA 2L0KA 2XF7A 3CCLI 3HDDA 2EBIA 5IT3A 4YIIA 5HDNA 2V4JC 2CYYA 2CSOA 3TGNA 3S15J 2P5KA 5FFXA 2Y9YA 1D1CA 1IZ1A 3FZVA 3H5AA 3HIFA 4HF2A 3FF5A 4FQGA 4A2UA 2FMYA 5J4VA 4BQAA 4II3A 3GZ6A 2XAGA 2B7EA 2K02A 1Y56A 3V7CA 1TP4A 3IL2A 2R7ZJ 3MKLA 5FRNA 4A69C 4F52A 3CP2A 4LITA 5LRSA 4LIVA 2MW8A 2LD5A 4EJVA 3MZHA 4W97A 4KA4A 1SAUA 1FOWA 3EUHA 2RC4A 3R6SA 1F43A 3ABUA 4PJNA 2KZVA 3HKZN 3IKVA 1MSEC 4Y15A 2HOAA 2DFEA 3HZJA 3ZQQA 3L00A 3E5QA 4U87A 4RB1A 1JE8A 3L1PA 2IGKA 1FC3A 4Y3OA 2XPWA 5DUKA 1KU7A 2DJIA 5HLGA 2NNNA 3TMOA 1KU2A 2JVGA 3I55I 2IPQX 3GTLJ 1LDKB 3RKXA 3ESWB 2Z33A 2XIGA 2Z1DA 1LDJA 1B6AA 3G3ZA 2OBPA 2O7OA 3A03A 1IN7A 1GXQA 3F3XA 3FXMA 1M1EB 5FKMA 3WU0A 2LY9A 1VI0A 5DM6F 4F7ZA 1BR1A 1O57A 2NOJB 3RKWA 3I58A 3CC4I 1OCPA 5FLXK 2R7QA 1REPC 4NQWB 4Y13A 4BHPA 3TKYA 3V42A 3LSJA 2VPLA 2VJ5A 5F04A 4NC8A 5B3SH 1Z77A 3LSTA 3F6VA 4OIPF 3TQNA 1K6OA 3KCCA 1Z3XA 3KEYA 1U8RA 2E1CA 2VODA 3BJOA 2W1OA 4N4NB 2CW0F 4CO8A 2L9NA 4FX0A 1FLIA 4BAYA 3IAM2 3IKTA 2CQXA 1ON2A 4PFOA 3IP4B 1UJ8A 3I3LA 2K27A 2XGCA 2DA7A 3MMYB 3JRCA 5D5VB 3V8KA 3EDPA 2HYJA 4XRMA 2VOOA 2K86A 2WC2A 3RQIA 1AU7A 2ZC2A 2X4HA 1DUXC 3GFIA 2NVXJ 5IT9Z 2DI3A 4A3KJ 3N05A 1MH4A 3ML6A 2Q8KA 2VXDA 2V9VA 3BR1A 2RNJA 1XS9A 3RSNA 4XONA 5FKOA 2DYRH 3E6CC 1XCVA 2W24A 4IRIA 2WAQA 3I4NJ 3CCYA 5D5WB 5E3NA 5K1YA 1F9NA 1P6RA 2F48A 3OSGA 2M7AA 3B6AA 2QKMB 3Q9VA 2LVSA 3BDDA 2DOFA 4HQMA 2DA2A 4BGDA 2FU4A 1DU0A 4KICA 1HF0A 2CU7A 5GADJ 4C2TA 2CV2A 1IV8A 4Y7NJ 3L2RA 1TC3C 2CFXA 2P7VB 3MVPA 3RYPA 4W1UA 2IXSA 1YJNI 1FWZA 1R6RA 1JKQC 4J00A 1K4SA 4BACA 4G12A 1U9NA 1W7PB 2Y69H 1VQ8I 1FPQA 2HDWA 2E7XA 2MH9A 3CUQC 1ETVA 2VUMJ 2Z99A 2WBMA 3F6OA 3Q0VA 1R7JA 3VOEA 2L7ZA 2H6CA 1ZARA 4N9IA 4OAZA 3G4SI 4EJUA 3OOUA 1U5TA 3JRBA 5BOXA 2OQGA 5EZHA 4LK0F 4XK4A 1Z7UA 2VBWA 5GTHC 3K6GA 1VQMI 3O3KA 2PLYA 1IGNA 2ZJPF 3I9V2 1TZLA 3WTWC 2ZO4A 5DCMA 1WI9A 2K9SA 4A6EA 4KNYA 3GXOA 1R5GA 2QGUA 3LAJA 1GV5A 5LRRA 4EJOA 2Y0SN 3QPHA 1U0JA 2EILH 3K1NA 4B48A 1UZCA 2DMUA 2H09A 2FNAA 1S72I 3X2QH 5IYDJ 1LFPA 1OR7C 3GVAA 3W6KB 3BTLA 4UV9A 1YTYA 3G73A 3KZYA 2BW3A 4ENKA 3HHGA 1IUFA 2FNPA 2KDZA 4JX6A 3T1BA 4A6DA 2K9QA 2GXBA 4LD5A 2V1XA 2XAHA 3IWZA 1TNTA 3ZQHA 2B9SA 2WY8Q 1OISA 5AIPA 2GBYA 4GRIA 4XM3A 2X0LA 4QIWN 2V6EA 3HRUA 4UUVA 2G0EA 4L0ZB 2L4MA 2O61A 4QPQA 2OQRA 2PI0A 2E71A 3OYDA 4GFBA 3M3YJ 1GHCA 3K4LA 5ILSA 5CVRA 3T0YA 1WKMA 2V7FA 3ZN1A 4E7IA 2HS5A 5CYVA 4N0BA 1J59A 4FX4A 1MDMB 3OL4A 1I39A 3HOZJ 2HQRA 2IEKA 3FMSA 3HOSA 4MQVA 3WU1B 2A6HF 2EIMH 4MNUA 3WGGA 5K5RA 2XF6A 3O6BB 2FEZA 2KPMA 3ZMZA 3DEEA 3MZYA 4ESJA 4XORA 5A2QK 4YG2F 1TT5B 2XC7A 2LRDA 1RNLA 1BL0A 1FP2A 2PX9A 2HTSA 4Y4RA 5CPRB 5ICFA 2CQKA 1S9HA 1UAAA 3A1YA 1MBJA 1UHWA 5BMZA 1R5HA 4XN0A 3TDUC 3W3CA 3ROUA 4V19K 4I76A 4YFXF 3TW7A 2M87A 3FHNA 3DLAA 4J19A 3GZ5A 5F27A 4L18B 4XLEA 2DT7B 2YX4A 3QAHA 4OMZA 4PZJA 4M9SA 3D0SA 4BUPA 1G59A 2JJ7A 3LQQA 1E3PA 2HQ5A 3U9GA 2LKXA 3MFKA 3FDYA 1BOBA 4OMYA 3S16J 2K85A 1ZR2A 1FMWA 2TRTA 4XLAA 3EETA 3OS1A 5LD2C 1UMQA 4D1QA 1FOYA 4CHUA 1Z91A 5C3EJ 2W48A 3H9GA 1PUFB 3FM3A 1SMTA 2Y2ZA 2V9PA 2E34A 1ZGAA 2VJ4A 4F93B 2K3PA 1SAXA 1R00A 2XPVA 4AVPA 2HOSA 2XAQA 2LDUA 3H3ZA 3ZMVA 3AG2H 2PEXA 4EVIA 4RM3A 3K70C 5FJ8J 4ZZLA 4ZYEA 3HGGA 2D5VA 3WTZA 4F91B 1WFXA 2C6YA 4IHWA 2JT1A 4LLNA 2XAJA 3KYLA 4HNUA 1PVEA 1B9NA 3REOA 3GEZA 4MEYF 4P9UA 5DTDA 1UFMA 5HVQC 3PO3J 3ZR8X 1BI1A 3K4MA 2MGQA 4ZYGA 5IY5H 3DBLB 4I99C 5F6FA 1MH3A 1DDNA 3CJTB 2COBA 1SANA 3ZQFA 1BN5A 3W2AA 2MD0A 1DGWY 4JX5A 5DEQA 1LVAA 5CVIA 1DP3A 2XB0X 4U88A 3ZQ7A 5IYCJ 5CKTA 1LFUP 3CCSI 1ZRDA 4XMYA 1VZ0A 2HVQA 4PJ0C 2HI3A 3DFGA 1JI8A 5EYRA 3COAC 3S8PA 4A3MJ 2O6GE 4GO1A 4OINF 2ZXIA 3HJEA 3LSHA 4RAFA 3S2HJ 1Q1HA 4HX8A 5EF6A 1TTYA 1YI2I 3R4KA 3I59A 4KIBA 3OWTA 1ITYA 2DO7A 4CCMA 3ZQIA 5J8CA 4E7LA 2XSJC 4CCJA 1K78A 2D2WA 3MKYB 4OOIA 1S5LC 3R60A 2P8TA 3C7JA 4UUTA 1EH8A 2R3SA 4B8XA 1TNSA 4PK4A 4AVZA 3JR9A 4MGRA 5DV5A 2VE9A 2X6OA 3ZN0A 3ABKH 2HYGD 5EZGA 1H89C 1V5GA 3IH2A 5KCMA 2VC0A 4H4KC 4LLGF 2M4GA 5M3FJ 3RZDJ 1EKEA 2YPRA 1TWCJ 1K6YA 1Y6IA 2DXIA 5JHFA 1USSA 1S8NA 1GVJA 1LEAA 2P5LC 2PN6A 3M8EA 2ELJA 3JRHA 1WJAA 4A0YA 3H92A 4O6JA 1YYVA 2HKXA 3AFHA 5BPDA 4RAYA 3BJAA 3JREA 5JLXA 2PJRA 4A3EJ 2IT0A 1BW5A 2V6CA 3U2RA 3FXQA 3QOPA 2EFPA 3CC7I 1P7JA 2LNBA 2EB7A 2HYFA 1U6GA 4PCQA 2LMDA 3K7AJ 2HVSA 4MFDA 4B44A 2M9HA 2P4WA 4HV5A 3L2VA 4XSXF 2HDDA 2CH0A 5D8LB 1W7PD 2FBKA 4Q47A 3BZCA 2JK3A 2MD5A 3CC2I 5FLMJ 4KT6A 3H0DA 3HSRA 3VSKA 3E5XA 1AWCA 4BXXJ 1YIOA 3NARA 2MABA 3AKZA 3L7WA 3H3VK 1QHGA 1Z7LA 2I8DA 2NVQJ 2IA2A 3CJQB 1MBKA 5FD6A 1Y1WJ 1BOAA 2M2EA 3HPHA 3G1LA 1WJ5A 2VI6A 2E2HJ 3EUKL 3FIWA 4K2EA 4CCNA 2WV0A 3LWFA 2XHKA 3HRMA 4LK1F 2KJBA 3GBGA 4F55A 1WJBA 2D45A 1X3ZB 3OSFA 2DTZA 1A5JA 1FX7A 2ELHA 5KK1A 2EFQA 4BE1A 5IP7J 1IRFA 1ODDA 1MMSA 2ESHA 4BJ6C 4FCYA 1MMGA 3MQ0A 2HOTA 4IRHA 1YW7A 2F2EA 5E1ZB 4PUSA 4C2MJ 1TWGJ 3CUQA 3RCOA 2EFOA 4BKXA 1IN4A 4UUSB 2VB6A 3PQJA 4QSHA 4XLFA 5M5YJ 2VBXA 1R36A 2JA7J 1ETYA 1HSTA 2WV1A 5IT9K 4KJZA 4CXFA 4I98B 2VBYA 5GAGJ 1BIBA 5GAEJ 3S32A 2OZUA 2QLZA 4ASNA 3OYHA 2LKPA 1XMKA 4FTHA 2JN6A 4DYCA 4X6AJ 2DFFA 3QPTA 3HOWJ 1UG2A 5IOZA 4L5EA 1AKHA 5B1BH 3PIOF 4L9JA 2OA4A 1VQ7I 2NXNB 2JA2A 3IH4A 3A02A 4AWXB 2XRLA 1G4DA 2DJNA 2EA4A 2G7HA 1TWFJ 4M6VA 4LJZF 1X3WB 3RYRA 3V4GA 2JA5J 3GFMA 3OYJA 2EFWA 5D8KB 3QP6A 3K4BA 3H5RA 2WAQN 1RRJA 4HF1A 4HYEA 4P96A 4WCGA 2DMTA 4LG3A 1V54H 5D4SA 3AL0B 2JA8J 1X4OA 1B1BA 1R49A 4RMNA 4UVCA 4EATA 2DW4A 3KEOA 4B4CA 4GDFA 1WHUA 4BHBA 1MJBA 1R71A 2EV0A 4F92B 1K83J 1ZG1A 3CUOA 1U5TB 1OLTA 4NB5A 3BZ6A 5F1JA 1WVRA 3ZRGA 5J1RA 5K5QA 3GTPJ 3HOVJ 3K1MA 1XTAA 3SZGA 3ZMDA 2HXIA 4E4HA 3DLLF 1T0FC 1YJWI 1B8IA 1PDNC 4AM3A 1D0YA 1V5FA 5DCMB 3KZIC 5M5XJ 3CCQI 3RDIA 2K4JA 2EFNA 1O7FA 2AO9A 2YX7A 3AG4H 1XGOA 1HQCA 4BEHA 3W2VA 2ZBKA 4XOPA 3E6DA 1W36D 3GTQJ 3OYIA 4ZDLA 3IRQA 1ZRFA 2DLLA 3E6BA 2XGEA 2L3DA 3VYUB 5F1RA 4LOCA 3F21A 2KDOA 3TOBA 3FKIJ 4RLQA 1YG2A 3L2UA 4U7DA 4FE4A 5L3DA 3A4CA 1GV2A 3BP8A 4BDZA 3BLYA 5FD5A 1G3WA 4L9NA 3K69A 1R1VA 1KGSA 1ZK8A 3FHZA 1I6XA 3HSFA 2L02A 4XKVA 4E7ZA 1MD0A 4XIDA 1XX5A 1VFCA 1YRNA 3PSIA 3ZMUA 4C3HJ 5J4YA 1G2HA 5AIQA 1XPXA 1OYIA 2IA0A 3V8LA 3K2AA 5FKLA 5J1YA 3PFYA 5CVVA 5LEJA 2JUGA 5HOOA 3BG7A 4IRGA 1EH7A 4PGHA 3L2WA 3OYGA 2NVYJ 5C4XJ 3ASNH 3E0JB 3ZOBA 1ZHFA 4IHXA 3S3MA 2QA4I 3HHHA 4RGRA 5L3GA 4XRSG 1VQPI 3CLOA 4BS9A 3SEQA 3CMMA 5EEAA 2K3FA 2KZGA 1XGNA 3DXJF 3BG5A 2DMNA 3GWZA 3I53A 1OCZH 4F3QA 1CF7A 5E79C 4ENMA 1ZG3A 3FISA 4DYRA 1VNDA 3HTUA 4LB6B 2JSCA 3K1PA 1JXSA 3HGYA 1J5YA 1Z0XA 3FMQA 3W2WA 3CCMI 3WU2C 2CUJA 2KL4A 1P92A 3MD2A 3OYEA 3D5SC 3OYNA 5ICEA 3HTSB 1GDTA 3BCAA 3CO6C 4OIQF 3HPGA 3WE3A 5HLTA 4KT5C 3WTUC 4E6KG 3KIOA 3BG9A 1FOKA 4NC6A 2NRAC 3T8TA 2R7SA 3HG9A 4HNTA 4M6XA 3A0BC 2O8KA 1LQ1A 1FYMA 1FTTA 2W82A 4S04A 1X2MA 5FO5A 4A3GJ 2IS4A 2EINH 5AONA 5GP9A 3GUDA 3GX4X 1I3QJ 1LEBA 2MH2A 4HRIA 2LH9A 4TV7A 3K10A 1SFKA 3C3WA 1Z6TA 3PFIA 3J81Z 2VT2A 3H36A 5HLHA 2PQ8A 3B02A 3NAUA 4Z2YA 2ICWG 2CUZA 2E36A 2CQQA 1W5TA 3HXLA 2V9KA 4RAGA 4S0HB 1TL8A 1SC7A 2CV0A 3E7LA 3ZMTA 2ZMEA 3R0AA 1H8AC 2QVOA 3OIOA 4AC0A 1GVDA 3JAMZ 1QVUA 5K7FA 1BC7C 1XG1A 4OAYA 4G6QA 1TT0A 1J2XA 1QU3A 1RIOH 3G71I 4ESBA 4IO9F 4JBAA 4KMFA 4EGYA 3FBNB 3J7AO 1R5ID 2GXGA 2FA5A 1JUPA 2QUFA 1B72A 1JUMA 3F8BA 3VWBA 3N4MA 1OCTC 1JKPC 1XD7A 1P7IA 4XL9A 2COMA 3GTKJ 5D6FA 2K9MA 4UB8C 3WHBA 3RPUA 1ZELA 5DD4A 3SJMA 5E1WA 3JTHA 4DJAA 1E17A 2X85A 4C9YA 2LF8A 3I59B 1R1UA 2NS8A 4FHTA 2QSFX 3SDBA 1G6NA 4BBRJ 1K78B 5LFAA 2LTPA 3BTIA 2DK8A 4ABZA 1YIJI 3OS2A 1VQNI 1FYLA 1RKTA 3LOCA 4I0AA 3TW6A 4ANJA 2EV5A 3ZQLA 4AIDA 2YSRA 2P6TA 2X9DA 1ETXA 1IXCA 4RDUA 3SYTA 2E1MB 4CYCA 2JA6J 3CCEI 5FRMA 3FKJA 1MBGA 4PDKA 4ITVA 2ECBA 2QQ9A 5JVGF 3JSPA 1WJCA 4JX4A 2TCTA 2EZIA 3BQYA 1UCRA 2BV6A 1JKOC 4RAZA 1ZH5A 2L5QA 4L9TA 1T98A 3DBHB 4IHVA 1IXSB 5J8FA 4KISA 4IQJA 1PYVA 4JK1X 1D1BA 4KN7X 4IX7A 3TO9A 5D5UB 4LGWA 2VIXA 4HX4A 1XGMA 2HXOA 4XICA 4M3BA 2EZHA 3DPLC 3WTTC 2PJRB 2E1NA 1L3LA 3NRVA 4A0XA 1Y1VJ 3OIQA 3BQZA 2GOXB 1K7AA 1UHSA 4XKWA 2WADA 1FEXA 2Q1ZB 5FKKA 1ACIA 4GYIA 5IOYA 3F8CA 3I0TA 4UNOA 4C3JJ 1OYYA 2Y75A 1W5SA 3TL4X 2IP2A 2R7TA 5F08A 4EM0B 1XDUA 2GWRA 2BHYA 2ID6A 5M5WJ 1HDDC 4Y52J 4YFKF 2M30A 3J7AY 2MC4A 2L01A 4PJMA 1MW7A 4U0YA 2M34A 3P7NA 1MBHA 3OR1C 4ENNA 1E2XA 2FBIA 1WJEA 4UY8I 1S7AA 1MNMC 4R8HA 4D7NA 2BXZA 4HDVA 4KITB 3RKQA 1XMAA 1CGPA 2IGOA 4HSTA 1QBJA 2LFBA 2X51A 4P55A 5GPAA 2HR3A 1LDDA 2WAEA 5BPIA 4B09A 5ILUA 5DYMA 1GXPA 1W0TA 3PQKA 4JYKA 4DOZA 2MA3A 2Q0OA 3OYBA 3CDIA 3CJRB 3WE2A 4UVBA 1D0ZA 3BOQA 3FM5A 2NYXA 2JMWA 1WCMJ 2EPFA 1R58A 3DKYA 5FROA 5HLIA 3PIPF 3GTMJ 3FXRA 1OYWA 4RM2A 3H5NA 4IEJA 4G6TB 2CMPA 4XRFA 3JSOA 3GTGJ 2CRGA 4U0VA 3S1MJ 3M9AA 4GXOA 5CQEA 2B63J 2ZXJA 1N25A 4BE0A 3KYCB 1T0FA 3IRRA 1HXDA 4FISA 4O5VA 4CH7A 2IVMA 2XF5A 2DA1A 2NS0A 1IV6A 1X1CA 3HL2A 1XN7A 1JHFA 2DAOA 3PM1A 3MKWB 4DBQA 1QPIA 5HS8A 3L2CA 2Q2EA 3ABTA 1L0OC 3TO7A 2X1CA 1AKHB 3H35A 1W36C 3I5UA 3SQNA 2FBHA 4A3LJ 3CDHA 2BOLA 2OPTA 1J0RA 2E35A 2JWTA 2OJED 5ICCA 5LGUA 3OYFA 4LB5A 2E2JJ 4H0EA 2LBFA 1POGA 2L54A 3GMEA 2B0LA 3MCZA 4RLFA 4IPAA 3Q3SA 2DQLA 1WRJA 2Y30A 2VKHA 2XGXA 1ZKGA 3BPXA 2JSPA 4Y17A 1OCOH 2E7WA 2BYVE 3JCUC 1LNWA 3U1DA 1OCCH 2E1OA 1JTXA 5C4JJ 1RI7A 3GZNB 4L5IA 1WJFA 3LAPA 1EJ9A 1HA8A 4MFEA 3TBIA 3DU5A 3I54A 4IJAA 2AQFA 2ZJQF 1WH7A 3CCJI 3P5JA 4V2GA 2UZKA 1DPRA 4BJ5C 4L5JA 4KIFA 3OR2C 1G3SA 3FK6A 1B8IB 3QYBA 4IVNA 3VFZA 1SFEA 3ZXSA 5CQGA 4A3IJ 2R7OA 2STTA 3GLLA 2CQ7A 4BEHB 3HOUJ 2IS2A 1H9TA 1USTA 2RVCA 4UB6C 3V8JA 4P5OA 4M3EA 4AIKA 2CS3A 2L9RA 1ZGWA 1HW5A 2DMQA 1HKQA 3J7ZI 5J6XA 3CCUI 1V4RA 1SD4A 4G7HF 1XDSA 4EM2A 2NAZA 4EJWA 4L0YB 2EK5A 1OCRH 3DTKA 4MIMA 2Y48A 5H6QA 2GQQA 4M73A 2ZCWA 1N78A 4IZZA 3EYYA 2FOKA 2MFZA 3H0GJ 2E5ZA 4ZJZA 3NWTA 2AQEA 1YHQI 2R7RA 3CD6I 2DA6A 3KLOA 1YRNB 4LIUA 1X1AA 3LA2A 5TJJA 2OTLI 2FE3A 2BVLA 1ON1A 3FWEA 4KIGA 2WTEA 3DKXA 4MHGA 3HYIA 3IAS2 4M3DA 2W25A 1PJRA 1P4XA 2W85A 4XKCA 2VASA 1D8JA 2MLGA 4G8XA 3PNYA 3KP4A 4PJJA 4ZH4F 3DQVC 4HG2A 2CQNA 1RUNA 2LG4A 2JTVA 4IQ4A 2VPRA 4BHCA 3F72A 1K61A 3MZ8A 3ONQA 1Z6RA 3J80K 1ETOA 3ULQB 4IOCF 1CF7B 2CV1A 5KVRA 4A5MA 3LNQA 1N77A 2AXTC 1OMIA 4GGGA 4I0BA 5FB2A 2X6XA 2ZFWA 1P2FA 3GCMA 2X48A 2RDPA 2XROA 2PG4A 2ZJ2A 3OYMA 3LFUA 1JGSA 2JZYA 1TQMA 2XRNA 2JPCA 3QPLA 5LHGA 3AG1H 1S6LA 1T33A 3B6CA 1YO5C 3ZPLA 5JLWA 1H88C 2VT3A 2A5YB 4I09A 2Z9OA 1DPUA 3OIPA 1IRGA 1JGGA 3ZQCA 4B3XA 1J09A 3C2GA 4EM1A 4R79A 3RI4A 2A69F 4ETSA 2QZ8A 3L9FA 3O8HA 4LMYA 1QZZA 3Q0WA 4M9ZA 1BBYA 2XKPA 3CP8A 1D0XA 3A01A 4XLCA 3HOXJ 2BZTA 3CO7C 4PJLA 2DOAA 3M1EA 1HW2A 2WB1A 1ETQA 4P9FA 1E0EA 2X6WA 1LE8A 1FBSA 3F8FA 2OU2A 3V7SA 1XB4A 5LEKA 2N8GA 3KFWX 2ZMEB 1Z1DA 2DBBA 4LG0A 3ECHA 1X3UA 3LSMA 2BHZA 1BI0A 5E3LA 2HGCA 2Y31A 3JAMK 3LQRA 1RPWA 1ZLJA 5GAHJ 2WWYA 1IXRC 4C30A 3RZOJ 5EGOA 3VYSB 4ESFA 2K9LA 1OPCA 1D8KA 1STZA 4L9VA 3CLQA 1ERDA 2ZFUA 2QSHX 3E6MA 2L9VA 4RGUA 2OCEA 4E70A 1B72B 2EIKH 5IYBJ 1Z9CA 3CTAA 4BL0B 2LK2A 4QPOA 2EZKA 3SZPA 5HDGA 1Y39A 1NTCA 3CDLA 3WODF 2M4KA 1T38A 2L4AA 4ZYAA 1MSFC 3BCBA 3SDGA 1RC9A 2ZB9A 2PBIA 1T6SA 1KQ9A 1MKMA 2W4SA 3DTEA 4DQ2A 1VF9A 1T39A 2I5UA 1KQ0A 3S2DJ 4PSWA 3TO6A 3LSGA 4BU2A 1F4KA 3K4NA 2KIUA 5JI6A 2M1BA 1SFOJ 3PNTA 2VONA 2H8WA 2GOMA 3BR2A 3KZZA 2BY3A 4BNCA 1TLHB 2JPBA 4RB2C 1FTZA 1ETKA 3T5XA 3AL0C 5HNFA 3FXOA 2MG4A 2XAFA 2XV4S 1KQ8A 3WGHA 1FIPA 2Y9ZA 1V5EA 3JRIA 4CYCB 1QZEA 1DP7P 2PMHA 1SFXA 4HX7A 2KIFA 2R5YA 1F5TA 1MMAA 1U5TC 2O5RA 4IKFA 1OR7A 2FSWA 2V26A 3M1CA 4BJTA 2R7UA 2KMUA 3D5RC 2J5PA 2V1NA 2VKVA 3WG9A 3GW2A 3OYCA 4I2OA 5FLVA 1ETWA 2VJIA 1MMDA 2E60A 1Z21A 4XSZF 1W0UA 3MWMA 2G9WA 4DW6A 5A2QZ 1MZBA 2CUFA 2R7XA 4WXHA 5HS9A 4IOAF 3BR6A 2AS5F 4M9XA 2FMLA 2H1LA 2VKEA 1WPKA 4CSWA 4G9YA 2HPMA 3JRGA 4YFNF 1BIAA 4M72A 1O3TA 4IXAA 1U8BA 1N75A 1QHHD 3LL7A 5EDNA 2JRMA 3S3OA 2ADUA 1AA7A 4GYGA 2DODA 3BY6A 4JQFA 2QQ8A 2BE5F 2P6SA 3BR0A 1OQYA 3DWLE 2NS7A 2ZXHA 3DV8A 4YIRX 4V2FA 1IF1A 1QA6A 4BYYA 3LMMA 2X1DA 1LJ9A 2JVHA 2DCEA 3IUOA 2QBYA 1BJAA 3HM5A 3QU6A 1A36A 1F1ZA 1S7EA 2M0MA 4R1HA 2ZNYA 3DU6A 3GYHX 2ISYA 4UHTA 2BW3B 1FY7A 4XLNF 4FETA 4IHSA 4RGSA 3HRTA 2XAUA 1BJZA 2O9LA 1FOXA 3F9KA 3HOYJ 2EIJH 3P9KA 2MYSA 3NEUA 1ZN2A 2GZWA 1O3QA 1RZ4A 2MSYA 3C18A 4PFPA 3WGIA 2W7NA 5LHIA 3M07A 3HRSA 2ECCA 2D1HA 2FQ4A 5B5EC 1BI2A 1Z67A 2IA1A 1P4WA 1EF4A 4IL6C 1OJLA 2KKOA 2KISA 1G3YA 2RQPA 4E7SA 3VYTB 4XNFA 4D9JA 3S3NA 3GFJA 2KLOA 1DGRM 1O3SA 3FBIB 2F5VA 2LC2A 1YW9A 4B3AA 4CCLA 4G94A 2LP0A 2DT5A 2UXXA 3O2PE 4DBRA 1JJ8C 4KDPA 1JTYA 2MC3A 2YS9A 4HW0A 4HLXA 2Q2EB 4C2UA 2LREA 2KJCA 2KRFA 5LBQA 4LFUA 3UKGA 2R0QC 3CQZJ 4CCKA 2VXZA 3W6VA 1XMXA 1ZGJA 2VKDA 4XRSA 1XGSA 2BGCA 2MBFA 1UG0A 2FUG2 3K70D 4A3DJ 2ZSHB 3TEDA 2LBFB 5H2FC 1V55H 3NQOA 1NG6A 1ORKA 1FMVA 2KT0A 4I7HA 2K5CA 3TP3A 3IH3A 4XLPF 2L7FP 3D1NI 1GLNA 2R4GA 5J3LA 4CA0A 2F5DA 2EA2A 1PP7U 1OFCX 2XASA 3BG6A 2PMUA 2L9SA 2A68F 4S05A 4KN4X 1NG7A 4NBQA 5L3CA 2K40A 2EZLA 4ZTFA 1NH3A 2DN0A 3P9IA 4EMSA 2R7DA 4CICA 4LLLA 1X1DA 5LGNA 1BR4A 3SZTA 4RB3C 3BROA 3QWLA 1RR8C 1PP8F 2L7MP 1LKXA 1SEUA 1VQKI 9ANTA 2VBZA 2K4BA 1ONVA 5E17F 5DDGA 1XSXA 2RAEA 5IPAA 2A05A 3BWGA 3DP7A 2LY2A 2PFBA 1U78A 3KP6A 1D1AA 4KMUX 1F36A 4WXCA 2ACJA 4DIQA 2OTJI 2CWEA 2ME0A 2STWA 2M0CA 4BQQA 5KHDA 3QRFF 2BY0A 1HLVA 5CVJA 1Y8RB 2K7LA 4CZZA 4BXFA 1A31A 4E7KA 2H94A 4JP0A 2M5WA 1B4AA 3D5LA 3F8MA 1WH5A 2W00A 2GAUA 2OC6A 4M74A 1RKWA 5HODA 2E2IJ 2E1MC 2VC1A 2O8XA 2I10A 1FZPB 4N9HA 2LYCA 3HUGA 3VSLA 1S7OA 5CVUA 5BQTA 4DGWB 4CGZA 2FXAA 1O4XA 5B1AH 2ELKA 2IGNA 3RPQA 2ZNZA 4I02A 1FYKA 3ERED 4CDGA 1FSEA 1IN5A 3KE2A 2DOEA 3VPRA 2F4IA 3TDZC 3J7YJ 2PMZA 1B9MA 2XSDC 4RA2A 4BE2A 3RPUD 1IO2A 4AIJA 3GLXA 3JTGA 3AG3H 1IDZA 1TQIA 3CCVI 3QOEA 3I56I 3KP3A 2A6EF 3K9TA 4DYQA 2X1EA 1YW8A 2DA5A 1J7KA 1MJAA 3JRDA 1RETA 2BY1A 2UXNA 2GXAA 3G1MA 1IRZA 4A0ZA 3EYIA 5L3EA 4WX9A 3A2KA 2CFOA 5E20A 5E8IA 4KUMA 3R0JA 4UUSA 3OS0A 3VEPA 1U3EM 4WF2A 2NOGA 4YRVA 3K2ZA 2Z5UA 1HC8A 5JHUA 1EH6A 4UV8A 1UELB 2DTRA 5TISC 3G6EI 1ZREA 2ETHA 3Q0UA 2ESNA 1GT0C 3Q5FA 4QTRA 3FXUA 3M8JA 4WWCA 2R92J 3BR5A 2ZSIB 2VQGA 3SEZA 4WXDA 2VOPA 2RGVA 2R5ZA 1P4AA 3ISPA 1WWXA 2VJJA 1I3AA 2VE8A 2E5NA 2HQAA 2V79A 4XBFA 1MGTA 3A01B 2HDCA 1K79A 1X58A 2BY2A 1H0MA 4G7OF 5F0FA 1MNDA 3ZP5A 1RESA 3CZ6A 5HNHA 1MBEA 1HKSA 4M6YA 1LE8B 1T8IA 1FT9A 1G8XA 1ZRCA 5ICGA 2JQ7A 1SVMA 4LG0B 1KU3A 4IF4A 1ZAOA 2R93J 1JT0A 2K9NA 1D3YA 4M3GA 4Q48A 2WB1N 3G2BA 1WSUA 1JUSA 1XSVA 2M8GX 1HCRA 2V1UA 2HU9A 5EGOB 1V3FA 2EV6A 4C3IJ 3ZQGA 1WJDA 3FXKA 2P7CB 3PL8A 2A61A 1FSHA 4BQOA 4ENJA 5HS7A 2DFIA 1SD7A 3KEQA 4RGXA 3S93A 4BBSJ 3HSEA 1G3TA 1FNNA 3CMAI 1HSJA 2QQAA 1HBXG 1W4MA 2W84A 2HFHA 2A07F 3QYEA 1NK2P 1T95A 2XPUA 4HSRA 3I4PA 3T8RA 3LSPA 2BBYA 3CMYA 2QWWA 1QGPA 3KX2A 4Z6YA 1HDPA 3FXLA 1LPQA 2BVMA 2UWMA 3S2WA 1TQPA 5ED4A 2OV7A 2NVTJ 3CUQB 2GIVA 3S1NJ 1VQ6I 2KHMA 3OMYA 1Y0NA 2WY7Q 3FX3A 4NDLA 1VQ5I 1J9IA 1ULYA 3GO5A 3LSIA 1JHHA 4MTDA 1C0WA 5EEGA 3L2QA 2VQLA 2YU9J 4UXNA 3S14J 4MO7A 1MNEA 1MJ9A 5TGTA 1HKTA 1TBXA 2ISZA 4A3CJ 1T2KA 1FJLA 3TP0A 1IG7A 4CCOA 1QQIA 2NNYA 3F8NA 2RV8A 2GIZA 1W5CC 5JFRA 1QVTA 4AD9A 1J75A 1FP1D 2CUEA 2WA0A 4IHYA 4I01A 1MIJA 3BTJA 3ELKA 2R5YB 1IC8A 2KRCA 3BR3A 1Q1VA 5EG0A 4KYWA 4CUGA 1SVOA 1A6IA 1XC5A 3KETA 5E1XA 5ERIA 1H9GA 3VYRB 4WK8F 2BXYA 3OV8A 1W1WE 3RQ4A 1WQ2A 2QQBA 1GUUA 4JOMA 5CLSA 3LA3A 4ZTJA 3QP5A 2DFHA 3IWFA 2L7KA 2DA3A 4HF0A 3FMRA 4KFCA 1YOVB 2RN7A 2F6CA 2H27A 5DM7F 1Y8QB 1AOYA 2NVUB 1R9TJ 3NWSA 4MTEA 2KQRA 4A3BJ 1YJ9I 5CJ9A 3KP2A 3DTIA 2VLAA 2Z16A 5H6RA 1QO0D 1JKRC 2IBDA 3HEFA 3BTCA 4HOBA 3W6JB 4G7ZF 3CF2A 4P1WA 4AYBN 1VQ4I 1VQ9I 4I6ZA 3DCFA 3M8FA 3WTSC 3O8GA 4UVAA 3PJRA 1P9QC 2IGMA 1S3JA 4A3JJ 4QLCU 1BC8C 1QPMA 1ZLKA 1UB9A 2FF4A 3OYAA 1U9OA 1IN8A 2HPIA 1SD6A 3HKZA 5JR3A 3F23A 4XN3A 4U7BA 3CF5F 2YU3A 4EGZA 1SMYF 2LOOA 2E19A 5C44J 2IS1A 3SXYA 5K7HA 5F0HA 4YEJA 3BJ6A 3IHUA 4AUXA 5ILVA 5IP6A 2A6TA 1KU9A 2DDBA 3KP7A 2A3SA 2QBYB 4X0GA 4BDYA 2ZXWH 2P0WA 3BT9A 3TOAA 3OY9A 3PNVA 1YX3A 2DMPA 5EEHA 1QNTA 2QCOA 1VQOI 2RKHA 4NHJA 4EJTA 4HPQA 1R1TA 2OCCH 2ID3A 2HNHA 1ZTRA 3HBLA 2DA4A 4ZDPA 1YS7A 1LFBA 3ZMSA 2X6YA 3EPZA 5L3BA 3KP5A 1KA8A 1XCBA 4OU0A 3CMEI 4QWQA 1ZYRF 4HV6A 2Y0MA 2HWVA 2UV1A 2DT6A 3SHFA 3DBRB 2DQRA 1APLC 1X1PA 3DEWA 2XVCA 4MQ9F 4Y33A 2ME6A 2PJPA 5DCFA 1ZR4A 3BC8A 6PAXA 5H20A 3SFIA 2UUZA 3R61A 5JVTA 5FLXZ 1BA5A 1I5ZA 3MKZA 4YELA 2CG4A 2P5VA 4A93J 1LB2A 1ZQ3P 4NQWA 5LGTA 3EUAA 1LUJB 4FT8A 2HVRA 3ZCOA 4E7HA 3ABMH 2A5WA 3WTYC 3DKWA 2HQNA 2EJRA 4OWRB 2V1DA 4HDUA 1OKRA 1RR7A 2RQQA 2DPUA 5KAFC 3WTXC 3EUHC 2IAIA 2M8EA 5DUIA 2F4OB 1BM9A 2O03A 3V7RA 4B47A 2LSOA 3DPTA 3PSFA 5LLQA 3M4OJ 4YIFA 1I27A 1T08B 2XDVA 3F22A 2DK5A 2JRTA 4D7MA 2F5CA 1IAWA 3DEUA 3KLNA 1HOMA 5FFZA 2XKOA 5D6EA 1I6HJ 2KFDA 5DS9A 4ZYDA 2M3AA 3ZGKA 3OL3A 1TW2A 2ZMEC 5D5XB 4U0WA 2BEOA 5BNGA 1SFUA 4D0PA 2L2OA 2QENA 2MLKA 3S17J 3C1DA 1X1BA 2OD5A 4B1RA 4Q5SF 2GLOA 3IC7A 3C2BA 4XR6A 3U21A 3GTJJ 1Z05A 4HZFA 5KAIC 3RIRA 1FIAA 3JRAA 2DU9A 3DF8A 4AU7A 1NHAA 3GTOJ 3LA7A 2F4MB 1WI3A 3GF2A 4XLHA 3LFKA 1KYWA 2OF7A 4BY1J 4ZDOA 3J81K 4FE7A 3F0CA 2IW5A 1B59A 5E3MA 1IN6A 2H8RA 1W7PA 4AIHA 4DZPA 3HOTA 2FOWA 4II2A 2QM3A 2XUBA 3GFLA 3WTVC 3FXJA 2F5EA 2J5OA 2M45A 3PUFA 4HEA2 2LLKA 2CO5A 4RBOA 1DU6A 3K4KA 3LSKA 2AXLA 2LR8A 2Y0SA 1BR2A 5K7ZA 3QYFA 2OUMA 3QODA 4ON0A 1YITI 4EV0A 3S1QJ 2G7UA 4OIRF 4B43A 4ZZDA 1D5VA 5E18F 2DDAA 1KONA 2P81A 5DD8A 1HW1A 2Z2SB 3HUGB 2GA1A 3DPUA 2HZDA 3UNGC 3I4MJ 2AHQA 4FASD 1T56A 1BW6A 2QSGX 2EQRA 5GPCA 3N97A 1YLFA 3BG3A 3ABLH 4M71A 2JUCA 3BPVA 1YS6A 3H1CA 2YUSA 2TDXA 5D4RA 4X1EA 3IV5A 5F64A 2FD5A 4ZC3A 4HLYA 1O7LA 2IJLA 2QF7A 1O3RA 3MAJA 1R4MB 2XGDA 3MEXA 2QEXI 2H6BA 5E3OA 3AAFA 1QRYA 4J01A 2HEOA 1MMNA 2PMZN 3VODA 2KRHA 1NK3P 1E3HA 3ERMA 2R7FA 2IRFG 2DYSH 1LVKA 3U1KA 2HOEA 3E97A 4HNVA 1VQLI 2WAFA 3E5UA 3FK7A 4PSXA 4HBLA 3H9QA 5FGMA 2O0YA 5FKNA 4BXUA 5J47A 1TW3A 2HTJA 2F5FA 5KNLA 1A04A 4M3FA 4AYBA 5J40A
chains in the Genus database with same CATH topology
2GA2A 3ECOA 2OAZA 1R23A 3I64A 1MDMA 1UHMA 4RB0A 2FRHA 1S29A 2EWNA 2KIMA 1U2WA 3E3VA 3OOPA 4Q4ZF 1Y0UA 2FQ3A 1FBUA 5BS6A 4BH9A 4MEXF 2HZTA 1R22A 3QU3A 2DPDA 2W57A 4HAMA 3P9CA 3SFZA 5LHHA 3H3UA 4DNCA 1XSDA 4A12A 3JW4A 2CGPA 3RJPA 2O3FA 2YR2A 2LF7A 2D1VA 3CJNA 1RUOA 2OZ6A 4EQQA 3EQLF 3RTRA 4G6DA 4A5NA 1YFHA 5K5OA 4OIOF 5L3FA 4GCVA 3K0LA 3M7GA 3VB2A 4IHTA 4PGGA 3B73A 2QYOA 1ZG5A 1BI3A 3Q9SA 3L09A 1IW7F 1KYZA 1EV7A 4HA8A 4O3MA 4RS8A 2HKOA 3RKYA 1YQAA 2Z3YA 5E8GA 4CYDA 5TRDA 2ZKZA 3I71A 1PUEE 4HQEA 1QZYA 5HDKA 1SD5A 4ZYHA 1I1GA 3J80Z 1I1SA 1IUYA 1VTNC 1FBQA 2VN2A 5IT3A 4YIIA 5HDNA 2CYYA 2CSOA 3TGNA 2P5KA 5FFXA 1IZ1A 3FZVA 3HIFA 4HF2A 3FF5A 4A2UA 2FMYA 4BQAA 3GZ6A 2XAGA 2K02A 3V7CA 3IL2A 5LRSA 4EJVA 3MZHA 4KA4A 3EUHA 2RC4A 3R6SA 3ABUA 3IKVA 4Y15A 3L00A 3E5QA 4RB1A 1JE8A 1FC3A 1KU7A 5DUKA 5HLGA 2NNNA 1KU2A 2IPQX 1LDKB 3RKXA 2Z33A 2XIGA 3G3ZA 1LDJA 1B6AA 2OBPA 3F3XA 1IN7A 1GXQA 3WU0A 4F7ZA 1O57A 3RKWA 3I58A 5FLXK 1REPC 4Y13A 4BHPA 3TKYA 3LSTA 3F6VA 4OIPF 3TQNA 1K6OA 3KCCA 1U8RA 2E1CA 2VODA 3BJOA 2CW0F 4CO8A 4FX0A 1FLIA 4BAYA 3IKTA 1ON2A 2K27A 5D5VB 3V8KA 3EDPA 2VOOA 2K86A 2WC2A 1DUXC 2X4HA 5IT9Z 3GFIA 2DI3A 3ML6A 2Q8KA 2V9VA 2RNJA 3E6CC 1XCVA 2W24A 4IRIA 5D5WB 5K1YA 1F9NA 1P6RA 4HQMA 3BDDA 3Q9VA 2FU4A 4KICA 2CFXA 2P7VB 3RYPA 1FWZA 1W7PB 1FPQA 2MH9A 2E7XA 3CUQC 2Z99A 3F6OA 1R7JA 3VOEA 2H6CA 1ZARA 4N9IA 4EJUA 5BOXA 1U5TA 2OQGA 4LK0F 1Z7UA 2VBWA 3O3KA 2PLYA 3WTWC 2ZO4A 5DCMA 1WI9A 4A6EA 4KNYA 3LAJA 1R5GA 3GXOA 5LRRA 4EJOA 3QPHA 3K1NA 2H09A 2FNAA 3GVAA 3W6KB 4UV9A 1YTYA 3G73A 3KZYA 4ENKA 3HHGA 2FNPA 3T1BA 4A6DA 2GXBA 4LD5A 2V1XA 2XAHA 3IWZA 1TNTA 5AIPA 2X0LA 3HRUA 4UUVA 4L0ZB 2L4MA 2O61A 2OQRA 2PI0A 1GHCA 5ILSA 5CVRA 3T0YA 1WKMA 3ZN1A 2HS5A 5CYVA 4N0BA 1J59A 4FX4A 1MDMB 2HQRA 3FMSA 3HOSA 3WU1B 4MQVA 2A6HF 4MNUA 3WGGA 5K5RA 3O6BB 2FEZA 3ZMZA 3MZYA 4ESJA 5A2QK 4YG2F 1RNLA 1FP2A 5ICFA 2HTSA 2CQKA 1UHWA 5BMZA 1R5HA 3TDUC 3ROUA 4YFXF 2M87A 3GZ5A 4L18B 2YX4A 3QAHA 4OMZA 4PZJA 4M9SA 3D0SA 3LQQA 3U9GA 3MFKA 4OMYA 4CHUA 3EETA 1Z91A 3FM3A 1SMTA 1ZGAA 1SAXA 1R00A 4AVPA 2XAQA 2LDUA 3H3ZA 3ZMVA 2PEXA 4EVIA 4ZZLA 4ZYEA 3WTZA 2C6YA 2JT1A 4LLNA 2XAJA 1B9NA 3REOA 3GEZA 4MEYF 4P9UA 1UFMA 5HVQC 1BI1A 4ZYGA 5F6FA 1DDNA 1BN5A 5DEQA 1LVAA 5CVIA 4U88A 3ZQ7A 1ZRDA 3DFGA 3COAC 2O6GE 4GO1A 4OINF 1Q1HA 4HX8A 1TTYA 3R4KA 3I59A 4KIBA 2DO7A 5J8CA 1K78A 2D2WA 4OOIA 3R60A 2P8TA 3C7JA 1EH8A 2R3SA 4B8XA 1TNSA 4MGRA 5DV5A 2VE9A 3ZN0A 2HYGD 2VC0A 4LLGF 2YPRA 1USSA 1S8NA 1GVJA 1LEAA 2P5LC 2PN6A 3M8EA 4A0YA 3H92A 4O6JA 1YYVA 2HKXA 5BPDA 4RAYA 3BJAA 2IT0A 2V6CA 3U2RA 3FXQA 3QOPA 2EFPA 2LNBA 2EB7A 2HYFA 1U6GA 4PCQA 2P4WA 4HV5A 4XSXF 5D8LB 1W7PD 2FBKA 4Q47A 2MD5A 3HSRA 3E5XA 1AWCA 1YIOA 3L7WA 2IA2A 5FD6A 1BOAA 4K2EA 2WV0A 3LWFA 2XHKA 3HRMA 4LK1F 2KJBA 2D45A 1FX7A 2ELHA 5KK1A 2EFQA 1IRFA 1ODDA 2ESHA 3MQ0A 4IRHA 1YW7A 2F2EA 5E1ZB 3CUQA 2EFOA 1IN4A 3PQJA 2VBXA 1R36A 1HSTA 5IT9K 4CXFA 4I98B 2VBYA 1BIBA 2OZUA 2QLZA 4ASNA 2LKPA 1XMKA 3QPTA 4L9JA 2OA4A 4AWXB 1G4DA 2EA4A 2G7HA 3V4GA 4LJZF 3RYRA 3GFMA 2EFWA 5D8KB 3QP6A 4HF1A 4HYEA 4P96A 4WCGA 5D4SA 1B1BA 4UVCA 2DW4A 3KEOA 4BHBA 1MJBA 2EV0A 1ZG1A 3CUOA 1U5TB 4NB5A 3BZ6A 5K5QA 3K1MA 3ZMDA 1PDNC 5DCMB 3RDIA 2K4JA 2EFNA 1O7FA 2YX7A 1XGOA 1HQCA 2ZBKA 3E6DA 3IRQA 1ZRFA 2DLLA 3E6BA 2L3DA 5F1RA 3F21A 3TOBA 1YG2A 4U7DA 5L3DA 3BP8A 5FD5A 1G3WA 4L9NA 3K69A 1R1VA 1KGSA 3FHZA 1I6XA 3HSFA 2L02A 1MD0A 3ZMUA 5AIQA 1OYIA 2IA0A 3V8LA 5CVVA 5LEJA 5HOOA 4IRGA 1EH7A 4PGHA 1ZHFA 3HHHA 4RGRA 5L3GA 3CLOA 1XGNA 3DXJF 3I53A 3GWZA 1CF7A 4ENMA 1ZG3A 3HTUA 4LB6B 2JSCA 3K1PA 1JXSA 1J5YA 3FMQA 1P92A 5ICEA 3HTSB 3CO6C 4OIQF 3WE3A 4KT5C 3WTUC 1FOKA 2NRAC 3T8TA 4M6XA 1LQ1A 1FYMA 4S04A 5FO5A 5AONA 3GUDA 3GX4X 1LEBA 2MH2A 4TV7A 3C3WA 1Z6TA 3PFIA 3J81Z 2VT2A 5HLHA 2PQ8A 3B02A 4Z2YA 1W5TA 3ZMTA 2ZMEA 3R0AA 2QVOA 3JAMZ 1BC7C 4G6QA 1J2XA 1RIOH 4ESBA 4KMFA 4JBAA 4EGYA 3J7AO 2GXGA 2FA5A 2QUFA 3F8BA 3N4MA 1XD7A 2COMA 5D6FA 3RPUA 5DD4A 5E1WA 3JTHA 1E17A 2LF8A 3I59B 1R1UA 4FHTA 1G6NA 1K78B 2DK8A 1FYLA 4I0AA 2EV5A 2YSRA 2P6TA 1IXCA 4PDKA 2QQ9A 3JSPA 1UCRA 2BV6A 1ZH5A 4RAZA 4L9TA 1T98A 1IXSB 5J8FA 4JK1X 4KN7X 3TO9A 5D5UB 4LGWA 4HX4A 1XGMA 3DPLC 3WTTC 2E1NA 1L3LA 3NRVA 4A0XA 1K7AA 4GYIA 3F8CA 3I0TA 4UNOA 1OYYA 2Y75A 1W5SA 2IP2A 4EM0B 1XDUA 2GWRA 4YFKF 2M30A 2L01A 4U0YA 3P7NA 4ENNA 1E2XA 2FBIA 1S7AA 4R8HA 4HDVA 1XMAA 1CGPA 1QBJA 4P55A 2HR3A 1LDDA 5BPIA 4B09A 5ILUA 5DYMA 1GXPA 3PQKA 2MA3A 2Q0OA 3WE2A 4UVBA 3BOQA 3FM5A 2NYXA 1R58A 5HLIA 3FXRA 1OYWA 4XRFA 3JSOA 4U0VA 3M9AA 4GXOA 2ZXJA 1T0FA 3IRRA 1HXDA 4O5VA 2IVMA 2NS0A 1XN7A 1JHFA 2DAOA 3L2CA 5HS8A 2Q2EA 3ABTA 1L0OC 3TO7A 3I5UA 3SQNA 2FBHA 3CDHA 1J0RA 5LGUA 5ICCA 4LB5A 4H0EA 2L54A 2B0LA 3MCZA 4IPAA 2DQLA 1WRJA 2XGXA 3BPXA 4Y17A 2E7WA 2BYVE 1LNWA 3U1DA 1RI7A 4L5IA 3LAPA 4IJAA 3I54A 2UZKA 1DPRA 4L5JA 4KIFA 1G3SA 4IVNA 3VFZA 1SFEA 2STTA 1H9TA 1USTA 2RVCA 3V8JA 4P5OA 4AIKA 1HW5A 1HKQA 5J6XA 1V4RA 1SD4A 4G7HF 1XDSA 4EM2A 2NAZA 4EJWA 4L0YB 2EK5A 2Y48A 5H6QA 2GQQA 4M73A 2ZCWA 3EYYA 2FOKA 3KLOA 3LA2A 5TJJA 2FE3A 1ON1A 3FWEA 4KIGA 2WTEA 4MHGA 3HYIA 2W25A 1P4XA 2W85A 1D8JA 2MLGA 4G8XA 3KP4A 4ZH4F 3DQVC 1RUNA 2JTVA 4BHCA 3F72A 3J80K 1Z6RA 3ULQB 1CF7B 5KVRA 4A5MA 1OMIA 4GGGA 4I0BA 5FB2A 2ZFWA 1P2FA 2RDPA 2XROA 2PG4A 2ZJ2A 1JGSA 2JZYA 1TQMA 2XRNA 2JPCA 5LHGA 1S6LA 1YO5C 3ZPLA 2VT3A 2A5YB 4I09A 2Z9OA 1DPUA 1IRGA 4EM1A 4R79A 3RI4A 2A69F 4ETSA 2QZ8A 3L9FA 4LMYA 1QZZA 4M9ZA 1BBYA 2XKPA 3CO7C 3M1EA 1HW2A 4P9FA 1FBSA 3F8FA 2OU2A 3V7SA 1XB4A 5LEKA 3KFWX 2ZMEB 1Z1DA 2DBBA 4LG0A 3ECHA 1X3UA 1BI0A 2HGCA 3JAMK 3LQRA 1ZLJA 2WWYA 1IXRC 4ESFA 1OPCA 1D8KA 1STZA 4L9VA 3E6MA 4RGUA 4E70A 1Z9CA 3CTAA 3SZPA 5HDGA 3WODF 1T38A 2L4AA 1T6SA 2PBIA 1KQ9A 1MKMA 4DQ2A 1T39A 1KQ0A 3TO6A 1F4KA 2KIUA 5JI6A 2M1BA 2VONA 3KZZA 4BNCA 1TLHB 2JPBA 4RB2C 3T5XA 2XAFA 2XV4S 1KQ8A 3WGHA 1DP7P 2PMHA 1SFXA 4HX7A 2KIFA 1F5TA 1U5TC 1OR7A 2FSWA 2J5PA 3WG9A 3GW2A 4I2OA 4XSZF 3MWMA 2G9WA 5A2QZ 1MZBA 4WXHA 5HS9A 2AS5F 4M9XA 2FMLA 4G9YA 4YFNF 1BIAA 4M72A 1O3TA 4IXAA 2ADUA 4GYGA 3BY6A 4JQFA 2BE5F 2P6SA 3DV8A 1IF1A 4BYYA 1LJ9A 2QBYA 1BJAA 3QU6A 1F1ZA 4R1HA 2ZNYA 3GYHX 2ISYA 4UHTA 1FY7A 4XLNF 4IHSA 4RGSA 3HRTA 3P9KA 3NEUA 1ZN2A 2GZWA 1O3QA 1RZ4A 3C18A 3WGIA 5LHIA 3HRSA 2D1HA 1BI2A 2IA1A 1P4WA 2KKOA 1G3YA 2RQPA 3GFJA 1O3SA 1YW9A 4G94A 2UXXA 2DT5A 3O2PE 4KDPA 2MC3A 4HW0A 4HLXA 2KJCA 2KRFA 5LBQA 4LFUA 2VXZA 1ZGJA 1XGSA 2BGCA 2MBFA 3NQOA 4I7HA 4XLPF 2F5DA 2EA2A 1PP7U 2XASA 2PMUA 2A68F 4S05A 4KN4X 5L3CA 3P9IA 4EMSA 2R7DA 4CICA 4LLLA 5LGNA 3SZTA 4RB3C 3BROA 1PP8F 2VBZA 2K4BA 1ONVA 5E17F 5DDGA 1XSXA 3BWGA 3DP7A 2PFBA 1U78A 3KP6A 4KMUX 4WXCA 2ACJA 2CWEA 2STWA 3QRFF 5CVJA 2K7LA 4CZZA 2H94A 2M5WA 1B4AA 3D5LA 3F8MA 2GAUA 4M74A 2VC1A 2O8XA 1FZPB 4N9HA 3HUGA 1S7OA 5CVUA 5BQTA 4CGZA 2FXAA 3RPQA 2ZNZA 4I02A 1FYKA 3ERED 4CDGA 1FSEA 1IN5A 3KE2A 3TDZC 1B9MA 4AIJA 3GLXA 3JTGA 1TQIA 3KP3A 2A6EF 3K9TA 1YW8A 1J7KA 1MJAA 2UXNA 4A0ZA 3EYIA 5L3EA 4WX9A 5E20A 5E8IA 4KUMA 3R0JA 3VEPA 1U3EM 4WF2A 3K2ZA 2Z5UA 5JHUA 1EH6A 4UV8A 2DTRA 1ZREA 2ETHA 2ESNA 3Q5FA 3FXUA 4WWCA 4WXDA 2VOPA 2RGVA 1P4AA 3ISPA 1WWXA 2VE8A 2V79A 4XBFA 1MGTA 2HDCA 1K79A 1H0MA 4G7OF 3ZP5A 1HKSA 4M6YA 1FT9A 1ZRCA 5ICGA 4LG0B 1KU3A 4IF4A 1ZAOA 1D3YA 4Q48A 1WSUA 1XSVA 2V1UA 1V3FA 2EV6A 2P7CB 1FSHA 2A61A 4ENJA 5HS7A 2DFIA 1SD7A 3KEQA 4RGXA 3HSEA 1G3TA 1FNNA 1HSJA 2QQAA 1HBXG 1W4MA 2W84A 2HFHA 2A07F 3I4PA 3T8RA 2BBYA 2QWWA 1QGPA 2UWMA 3S2WA 1TQPA 5ED4A 3CUQB 2GIVA 3FX3A 1J9IA 1ULYA 3GO5A 1JHHA 4MTDA 1C0WA 5EEGA 4UXNA 1MJ9A 1HKTA 1TBXA 2ISZA 1T2KA 1QQIA 2NNYA 3F8NA 2RV8A 5JFRA 4AD9A 1J75A 1FP1D 4I01A 3ELKA 4KYWA 3KETA 5E1XA 5ERIA 1H9GA 4WK8F 3OV8A 1WQ2A 2QQBA 5CLSA 3LA3A 3QP5A 3IWFA 4HF0A 4KFCA 3FMRA 2RN7A 2H27A 1AOYA 4MTEA 5CJ9A 3KP2A 5H6RA 1QO0D 3W6JB 4HOBA 4G7ZF 3WTSC 3M8FA 4UVAA 1S3JA 4QLCU 1BC8C 1QPMA 1ZLKA 1UB9A 2FF4A 1IN8A 1SD6A 5JR3A 3F23A 4U7BA 2YU3A 4EGZA 1SMYF 3SXYA 3BJ6A 3IHUA 5ILVA 1KU9A 3KP7A 2A3SA 2QBYB 3TOAA 5EEHA 1QNTA 2RKHA 4NHJA 4EJTA 1R1TA 1YS7A 3ZMSA 5L3BA 3KP5A 1KA8A 1XCBA 4OU0A 4QWQA 1ZYRF 4HV6A 2Y0MA 2HWVA 3SHFA 2DQRA 4MQ9F 2XVCA 2PJPA 5DCFA 6PAXA 5H20A 3R61A 5JVTA 5FLXZ 1I5ZA 2CG4A 2P5VA 1LB2A 4NQWA 5LGTA 4FT8A 4HDUA 3WTYC 3DKWA 2HQNA 2EJRA 2V1DA 1OKRA 2DPUA 3WTXC 2M8EA 5DUIA 1BM9A 2O03A 3V7RA 5LLQA 2LSOA 3DPTA 4YIFA 1I27A 3F22A 2DK5A 2JRTA 2F5CA 1IAWA 3DEUA 3KLNA 5FFZA 2XKOA 5D6EA 4ZYDA 1TW2A 5D5XB 4U0WA 2BEOA 1SFUA 4D0PA 2QENA 2MLKA 3C1DA 2OD5A 4Q5SF 3IC7A 1Z05A 4HZFA 3RIRA 2DU9A 3DF8A 1NHAA 3LA7A 3GF2A 3LFKA 1KYWA 3J81K 2IW5A 1B59A 1IN6A 1W7PA 4AIHA 3HOTA 2QM3A 2XUBA 3GFLA 3WTVC 2F5EA 2J5OA 2M45A 2CO5A 2AXLA 4ON0A 4EV0A 2G7UA 4OIRF 4ZZDA 1D5VA 5E18F 5DD8A 1HW1A 2GA1A 3N97A 1YLFA 4M71A 3BPVA 1YS6A 2TDXA 5D4RA 5F64A 4HLYA 1O7LA 2IJLA 1O3RA 3MAJA 3MEXA 2H6BA 3AAFA 2HEOA 3VODA 2R7FA 2IRFG 2HOEA 3E97A 3E5UA 4HBLA 5FGMA 2O0YA 4BXUA 1TW3A 2HTJA 2F5FA 1A04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GA2 A;  3ECO A;  2OAZ A;  1R23 A;  3I64 A;  1MDM A;  1UHM A;  4RB0 A;  2FRH A;  1S29 A;  2EWN A;  2KIM A;  1U2W A;  3E3V A;  3OOP A;  4Q4Z F;  1Y0U A;  2FQ3 A;  1FBU A;  5BS6 A;  4BH9 A;  4MEX F;  2HZT A;  1R22 A;  3QU3 A;  2DPD A;  2W57 A;  4HAM A;  3P9C A;  3SFZ A;  5LHH A;  3H3U A;  4DNC A;  1XSD A;  4A12 A;  3JW4 A;  2CGP A;  3RJP A;  2O3F A;  2YR2 A;  2LF7 A;  2D1V A;  3CJN A;  1RUO A;  2OZ6 A;  4EQQ A;  3EQL F;  3RTR A;  4G6D A;  4A5N A;  1YFH A;  5K5O A;  4OIO F;  5L3F A;  4GCV A;  3K0L A;  3M7G A;  3VB2 A;  4IHT A;  4PGG A;  3B73 A;  2QYO A;  1ZG5 A;  1BI3 A;  3Q9S A;  3L09 A;  1IW7 F;  1KYZ A;  1EV7 A;  4HA8 A;  4O3M A;  4RS8 A;  2HKO A;  3RKY A;  1YQA A;  2Z3Y A;  5E8G A;  4CYD A;  5TRD A;  2ZKZ A;  3I71 A;  1PUE E;  4HQE A;  1QZY A;  5HDK A;  1SD5 A;  4ZYH A;  1I1G A;  3J80 Z;  1I1S A;  1IUY A;  1VTN C;  1FBQ A;  2VN2 A;  5IT3 A;  4YII A;  5HDN A;  2CYY A;  2CSO A;  3TGN A;  2P5K A;  5FFX A;  1IZ1 A;  3FZV A;  3HIF A;  4HF2 A;  3FF5 A;  4A2U A;  2FMY A;  4BQA A;  3GZ6 A;  2XAG A;  2K02 A;  3V7C A;  3IL2 A;  5LRS A;  4EJV A;  3MZH A;  4KA4 A;  3EUH A;  2RC4 A;  3R6S A;  3ABU A;  3IKV A;  4Y15 A;  3L00 A;  3E5Q A;  4RB1 A;  1JE8 A;  1FC3 A;  1KU7 A;  5DUK A;  5HLG A;  2NNN A;  1KU2 A;  2IPQ X;  1LDK B;  3RKX A;  2Z33 A;  2XIG A;  3G3Z A;  1LDJ A;  1B6A A;  2OBP A;  3F3X A;  1IN7 A;  1GXQ A;  3WU0 A;  4F7Z A;  1O57 A;  3RKW A;  3I58 A;  5FLX K;  1REP C;  4Y13 A;  4BHP A;  3TKY A;  3LST A;  3F6V A;  4OIP F;  3TQN A;  1K6O A;  3KCC A;  1U8R A;  2E1C A;  2VOD A;  3BJO A;  2CW0 F;  4CO8 A;  4FX0 A;  1FLI A;  4BAY A;  3IKT A;  1ON2 A;  2K27 A;  5D5V B;  3V8K A;  3EDP A;  2VOO A;  2K86 A;  2WC2 A;  1DUX C;  2X4H A;  5IT9 Z;  3GFI A;  2DI3 A;  3ML6 A;  2Q8K A;  2V9V A;  2RNJ A;  3E6C C;  1XCV A;  2W24 A;  4IRI A;  5D5W B;  5K1Y A;  1F9N A;  1P6R A;  4HQM A;  3BDD A;  3Q9V A;  2FU4 A;  4KIC A;  2CFX A;  2P7V B;  3RYP A;  1FWZ A;  1W7P B;  1FPQ A;  2MH9 A;  2E7X A;  3CUQ C;  2Z99 A;  3F6O A;  1R7J A;  3VOE A;  2H6C A;  1ZAR A;  4N9I A;  4EJU A;  5BOX A;  1U5T A;  2OQG A;  4LK0 F;  1Z7U A;  2VBW A;  3O3K A;  2PLY A;  3WTW C;  2ZO4 A;  5DCM A;  1WI9 A;  4A6E A;  4KNY A;  3LAJ A;  1R5G A;  3GXO A;  5LRR A;  4EJO A;  3QPH A;  3K1N A;  2H09 A;  2FNA A;  3GVA A;  3W6K B;  4UV9 A;  1YTY A;  3G73 A;  3KZY A;  4ENK A;  3HHG A;  2FNP A;  3T1B A;  4A6D A;  2GXB A;  4LD5 A;  2V1X A;  2XAH A;  3IWZ A;  1TNT A;  5AIP A;  2X0L A;  3HRU A;  4UUV A;  4L0Z B;  2L4M A;  2O61 A;  2OQR A;  2PI0 A;  1GHC A;  5ILS A;  5CVR A;  3T0Y A;  1WKM A;  3ZN1 A;  2HS5 A;  5CYV A;  4N0B A;  1J59 A;  4FX4 A;  1MDM B;  2HQR A;  3FMS A;  3HOS A;  3WU1 B;  4MQV A;  2A6H F;  4MNU A;  3WGG A;  5K5R A;  3O6B B;  2FEZ A;  3ZMZ A;  3MZY A;  4ESJ A;  5A2Q K;  4YG2 F;  1RNL A;  1FP2 A;  5ICF A;  2HTS A;  2CQK A;  1UHW A;  5BMZ A;  1R5H A;  3TDU C;  3ROU A;  4YFX F;  2M87 A;  3GZ5 A;  4L18 B;  2YX4 A;  3QAH A;  4OMZ A;  4PZJ A;  4M9S A;  3D0S A;  3LQQ A;  3U9G A;  3MFK A;  4OMY A;  4CHU A;  3EET A;  1Z91 A;  3FM3 A;  1SMT A;  1ZGA A;  1SAX A;  1R00 A;  4AVP A;  2XAQ A;  2LDU A;  3H3Z A;  3ZMV A;  2PEX A;  4EVI A;  4ZZL A;  4ZYE A;  3WTZ A;  2C6Y A;  2JT1 A;  4LLN A;  2XAJ A;  1B9N A;  3REO A;  3GEZ A;  4MEY F;  4P9U A;  1UFM A;  5HVQ C;  1BI1 A;  4ZYG A;  5F6F A;  1DDN A;  1BN5 A;  5DEQ A;  1LVA A;  5CVI A;  4U88 A;  3ZQ7 A;  1ZRD A;  3DFG A;  3COA C;  2O6G E;  4GO1 A;  4OIN F;  1Q1H A;  4HX8 A;  1TTY A;  3R4K A;  3I59 A;  4KIB A;  2DO7 A;  5J8C A;  1K78 A;  2D2W A;  4OOI A;  3R60 A;  2P8T A;  3C7J A;  1EH8 A;  2R3S A;  4B8X A;  1TNS A;  4MGR A;  5DV5 A;  2VE9 A;  3ZN0 A;  2HYG D;  2VC0 A;  4LLG F;  2YPR A;  1USS A;  1S8N A;  1GVJ A;  1LEA A;  2P5L C;  2PN6 A;  3M8E A;  4A0Y A;  3H92 A;  4O6J A;  1YYV A;  2HKX A;  5BPD A;  4RAY A;  3BJA A;  2IT0 A;  2V6C A;  3U2R A;  3FXQ A;  3QOP A;  2EFP A;  2LNB A;  2EB7 A;  2HYF A;  1U6G A;  4PCQ A;  2P4W A;  4HV5 A;  4XSX F;  5D8L B;  1W7P D;  2FBK A;  4Q47 A;  2MD5 A;  3HSR A;  3E5X A;  1AWC A;  1YIO A;  3L7W A;  2IA2 A;  5FD6 A;  1BOA A;  4K2E A;  2WV0 A;  3LWF A;  2XHK A;  3HRM A;  4LK1 F;  2KJB A;  2D45 A;  1FX7 A;  2ELH A;  5KK1 A;  2EFQ A;  1IRF A;  1ODD A;  2ESH A;  3MQ0 A;  4IRH A;  1YW7 A;  2F2E A;  5E1Z B;  3CUQ A;  2EFO A;  1IN4 A;  3PQJ A;  2VBX A;  1R36 A;  1HST A;  5IT9 K;  4CXF A;  4I98 B;  2VBY A;  1BIB A;  2OZU A;  2QLZ A;  4ASN A;  2LKP A;  1XMK A;  3QPT A;  4L9J A;  2OA4 A;  4AWX B;  1G4D A;  2EA4 A;  2G7H A;  3V4G A;  4LJZ F;  3RYR A;  3GFM A;  2EFW A;  5D8K B;  3QP6 A;  4HF1 A;  4HYE A;  4P96 A;  4WCG A;  5D4S A;  1B1B A;  4UVC A;  2DW4 A;  3KEO A;  4BHB A;  1MJB A;  2EV0 A;  1ZG1 A;  3CUO A;  1U5T B;  4NB5 A;  3BZ6 A;  5K5Q A;  3K1M A;  3ZMD A;  1PDN C;  5DCM B;  3RDI A;  2K4J A;  2EFN A;  1O7F A;  2YX7 A;  1XGO A;  1HQC A;  2ZBK A;  3E6D A;  3IRQ A;  1ZRF A;  2DLL A;  3E6B A;  2L3D A;  5F1R A;  3F21 A;  3TOB A;  1YG2 A;  4U7D A;  5L3D A;  3BP8 A;  5FD5 A;  1G3W A;  4L9N A;  3K69 A;  1R1V A;  1KGS A;  3FHZ A;  1I6X A;  3HSF A;  2L02 A;  1MD0 A;  3ZMU A;  5AIQ A;  1OYI A;  2IA0 A;  3V8L A;  5CVV A;  5LEJ A;  5HOO A;  4IRG A;  1EH7 A;  4PGH A;  1ZHF A;  3HHH A;  4RGR A;  5L3G A;  3CLO A;  1XGN A;  3DXJ F;  3I53 A;  3GWZ A;  1CF7 A;  4ENM A;  1ZG3 A;  3HTU A;  4LB6 B;  2JSC A;  3K1P A;  1JXS A;  1J5Y A;  3FMQ A;  1P92 A;  5ICE A;  3HTS B;  3CO6 C;  4OIQ F;  3WE3 A;  4KT5 C;  3WTU C;  1FOK A;  2NRA C;  3T8T A;  4M6X A;  1LQ1 A;  1FYM A;  4S04 A;  5FO5 A;  5AON A;  3GUD A;  3GX4 X;  1LEB A;  2MH2 A;  4TV7 A;  3C3W A;  1Z6T A;  3PFI A;  3J81 Z;  2VT2 A;  5HLH A;  2PQ8 A;  3B02 A;  4Z2Y A;  1W5T A;  3ZMT A;  2ZME A;  3R0A A;  2QVO A;  3JAM Z;  1BC7 C;  4G6Q A;  1J2X A;  1RIO H;  4ESB A;  4KMF A;  4JBA A;  4EGY A;  3J7A O;  2GXG A;  2FA5 A;  2QUF A;  3F8B A;  3N4M A;  1XD7 A;  2COM A;  5D6F A;  3RPU A;  5DD4 A;  5E1W A;  3JTH A;  1E17 A;  2LF8 A;  3I59 B;  1R1U A;  4FHT A;  1G6N A;  1K78 B;  2DK8 A;  1FYL A;  4I0A A;  2EV5 A;  2YSR A;  2P6T A;  1IXC A;  4PDK A;  2QQ9 A;  3JSP A;  1UCR A;  2BV6 A;  1ZH5 A;  4RAZ A;  4L9T A;  1T98 A;  1IXS B;  5J8F A;  4JK1 X;  4KN7 X;  3TO9 A;  5D5U B;  4LGW A;  4HX4 A;  1XGM A;  3DPL C;  3WTT C;  2E1N A;  1L3L A;  3NRV A;  4A0X A;  1K7A A;  4GYI A;  3F8C A;  3I0T A;  4UNO A;  1OYY A;  2Y75 A;  1W5S A;  2IP2 A;  4EM0 B;  1XDU A;  2GWR A;  4YFK F;  2M30 A;  2L01 A;  4U0Y A;  3P7N A;  4ENN A;  1E2X A;  2FBI A;  1S7A A;  4R8H A;  4HDV A;  1XMA A;  1CGP A;  1QBJ A;  4P55 A;  2HR3 A;  1LDD A;  5BPI A;  4B09 A;  5ILU A;  5DYM A;  1GXP A;  3PQK A;  2MA3 A;  2Q0O A;  3WE2 A;  4UVB A;  3BOQ A;  3FM5 A;  2NYX A;  1R58 A;  5HLI A;  3FXR A;  1OYW A;  4XRF A;  3JSO A;  4U0V A;  3M9A A;  4GXO A;  2ZXJ A;  1T0F A;  3IRR A;  1HXD A;  4O5V A;  2IVM A;  2NS0 A;  1XN7 A;  1JHF A;  2DAO A;  3L2C A;  5HS8 A;  2Q2E A;  3ABT A;  1L0O C;  3TO7 A;  3I5U A;  3SQN A;  2FBH A;  3CDH A;  1J0R A;  5LGU A;  5ICC A;  4LB5 A;  4H0E A;  2L54 A;  2B0L A;  3MCZ A;  4IPA A;  2DQL A;  1WRJ A;  2XGX A;  3BPX A;  4Y17 A;  2E7W A;  2BYV E;  1LNW A;  3U1D A;  1RI7 A;  4L5I A;  3LAP A;  4IJA A;  3I54 A;  2UZK A;  1DPR A;  4L5J A;  4KIF A;  1G3S A;  4IVN A;  3VFZ A;  1SFE A;  2STT A;  1H9T A;  1UST A;  2RVC A;  3V8J A;  4P5O A;  4AIK A;  1HW5 A;  1HKQ A;  5J6X A;  1V4R A;  1SD4 A;  4G7H F;  1XDS A;  4EM2 A;  2NAZ A;  4EJW A;  4L0Y B;  2EK5 A;  2Y48 A;  5H6Q A;  2GQQ A;  4M73 A;  2ZCW A;  3EYY A;  2FOK A;  3KLO A;  3LA2 A;  5TJJ A;  2FE3 A;  1ON1 A;  3FWE A;  4KIG A;  2WTE A;  4MHG A;  3HYI A;  2W25 A;  1P4X A;  2W85 A;  1D8J A;  2MLG A;  4G8X A;  3KP4 A;  4ZH4 F;  3DQV C;  1RUN A;  2JTV A;  4BHC A;  3F72 A;  3J80 K;  1Z6R A;  3ULQ B;  1CF7 B;  5KVR A;  4A5M A;  1OMI A;  4GGG A;  4I0B A;  5FB2 A;  2ZFW A;  1P2F A;  2RDP A;  2XRO A;  2PG4 A;  2ZJ2 A;  1JGS A;  2JZY A;  1TQM A;  2XRN A;  2JPC A;  5LHG A;  1S6L A;  1YO5 C;  3ZPL A;  2VT3 A;  2A5Y B;  4I09 A;  2Z9O A;  1DPU A;  1IRG A;  4EM1 A;  4R79 A;  3RI4 A;  2A69 F;  4ETS A;  2QZ8 A;  3L9F A;  4LMY A;  1QZZ A;  4M9Z A;  1BBY A;  2XKP A;  3CO7 C;  3M1E A;  1HW2 A;  4P9F A;  1FBS A;  3F8F A;  2OU2 A;  3V7S A;  1XB4 A;  5LEK A;  3KFW X;  2ZME B;  1Z1D A;  2DBB A;  4LG0 A;  3ECH A;  1X3U A;  1BI0 A;  2HGC A;  3JAM K;  3LQR A;  1ZLJ A;  2WWY A;  1IXR C;  4ESF A;  1OPC A;  1D8K A;  1STZ A;  4L9V A;  3E6M A;  4RGU A;  4E70 A;  1Z9C A;  3CTA A;  3SZP A;  5HDG A;  3WOD F;  1T38 A;  2L4A A;  1T6S A;  2PBI A;  1KQ9 A;  1MKM A;  4DQ2 A;  1T39 A;  1KQ0 A;  3TO6 A;  1F4K A;  2KIU A;  5JI6 A;  2M1B A;  2VON A;  3KZZ A;  4BNC A;  1TLH B;  2JPB A;  4RB2 C;  3T5X A;  2XAF A;  2XV4 S;  1KQ8 A;  3WGH A;  1DP7 P;  2PMH A;  1SFX A;  4HX7 A;  2KIF A;  1F5T A;  1U5T C;  1OR7 A;  2FSW A;  2J5P A;  3WG9 A;  3GW2 A;  4I2O A;  4XSZ F;  3MWM A;  2G9W A;  5A2Q Z;  1MZB A;  4WXH A;  5HS9 A;  2AS5 F;  4M9X A;  2FML A;  4G9Y A;  4YFN F;  1BIA A;  4M72 A;  1O3T A;  4IXA A;  2ADU A;  4GYG A;  3BY6 A;  4JQF A;  2BE5 F;  2P6S A;  3DV8 A;  1IF1 A;  4BYY A;  1LJ9 A;  2QBY A;  1BJA A;  3QU6 A;  1F1Z A;  4R1H A;  2ZNY A;  3GYH X;  2ISY A;  4UHT A;  1FY7 A;  4XLN F;  4IHS A;  4RGS A;  3HRT A;  3P9K A;  3NEU A;  1ZN2 A;  2GZW A;  1O3Q A;  1RZ4 A;  3C18 A;  3WGI A;  5LHI A;  3HRS A;  2D1H A;  1BI2 A;  2IA1 A;  1P4W A;  2KKO A;  1G3Y A;  2RQP A;  3GFJ A;  1O3S A;  1YW9 A;  4G94 A;  2UXX A;  2DT5 A;  3O2P E;  4KDP A;  2MC3 A;  4HW0 A;  4HLX A;  2KJC A;  2KRF A;  5LBQ A;  4LFU A;  2VXZ A;  1ZGJ A;  1XGS A;  2BGC A;  2MBF A;  3NQO A;  4I7H A;  4XLP F;  2F5D A;  2EA2 A;  1PP7 U;  2XAS A;  2PMU A;  2A68 F;  4S05 A;  4KN4 X;  5L3C A;  3P9I A;  4EMS A;  2R7D A;  4CIC A;  4LLL A;  5LGN A;  3SZT A;  4RB3 C;  3BRO A;  1PP8 F;  2VBZ A;  2K4B A;  1ONV A;  5E17 F;  5DDG A;  1XSX A;  3BWG A;  3DP7 A;  2PFB A;  1U78 A;  3KP6 A;  4KMU X;  4WXC A;  2ACJ A;  2CWE A;  2STW A;  3QRF F;  5CVJ A;  2K7L A;  4CZZ A;  2H94 A;  2M5W A;  1B4A A;  3D5L A;  3F8M A;  2GAU A;  4M74 A;  2VC1 A;  2O8X A;  1FZP B;  4N9H A;  3HUG A;  1S7O A;  5CVU A;  5BQT A;  4CGZ A;  2FXA A;  3RPQ A;  2ZNZ A;  4I02 A;  1FYK A;  3ERE D;  4CDG A;  1FSE A;  1IN5 A;  3KE2 A;  3TDZ C;  1B9M A;  4AIJ A;  3GLX A;  3JTG A;  1TQI A;  3KP3 A;  2A6E F;  3K9T A;  1YW8 A;  1J7K A;  1MJA A;  2UXN A;  4A0Z A;  3EYI A;  5L3E A;  4WX9 A;  5E20 A;  5E8I A;  4KUM A;  3R0J A;  3VEP A;  1U3E M;  4WF2 A;  3K2Z A;  2Z5U A;  5JHU A;  1EH6 A;  4UV8 A;  2DTR A;  1ZRE A;  2ETH A;  2ESN A;  3Q5F A;  3FXU A;  4WWC A;  4WXD A;  2VOP A;  2RGV A;  1P4A A;  3ISP A;  1WWX A;  2VE8 A;  2V79 A;  4XBF A;  1MGT A;  2HDC A;  1K79 A;  1H0M A;  4G7O F;  3ZP5 A;  1HKS A;  4M6Y A;  1FT9 A;  1ZRC A;  5ICG A;  4LG0 B;  1KU3 A;  4IF4 A;  1ZAO A;  1D3Y A;  4Q48 A;  1WSU A;  1XSV A;  2V1U A;  1V3F A;  2EV6 A;  2P7C B;  1FSH A;  2A61 A;  4ENJ A;  5HS7 A;  2DFI A;  1SD7 A;  3KEQ A;  4RGX A;  3HSE A;  1G3T A;  1FNN A;  1HSJ A;  2QQA A;  1HBX G;  1W4M A;  2W84 A;  2HFH A;  2A07 F;  3I4P A;  3T8R A;  2BBY A;  2QWW A;  1QGP A;  2UWM A;  3S2W A;  1TQP A;  5ED4 A;  3CUQ B;  2GIV A;  3FX3 A;  1J9I A;  1ULY A;  3GO5 A;  1JHH A;  4MTD A;  1C0W A;  5EEG A;  4UXN A;  1MJ9 A;  1HKT A;  1TBX A;  2ISZ A;  1T2K A;  1QQI A;  2NNY A;  3F8N A;  2RV8 A;  5JFR A;  4AD9 A;  1J75 A;  1FP1 D;  4I01 A;  3ELK A;  4KYW A;  3KET A;  5E1X A;  5ERI A;  1H9G A;  4WK8 F;  3OV8 A;  1WQ2 A;  2QQB A;  5CLS A;  3LA3 A;  3QP5 A;  3IWF A;  4HF0 A;  4KFC A;  3FMR A;  2RN7 A;  2H27 A;  1AOY A;  4MTE A;  5CJ9 A;  3KP2 A;  5H6R A;  1QO0 D;  3W6J B;  4HOB A;  4G7Z F;  3WTS C;  3M8F A;  4UVA A;  1S3J A;  4QLC U;  1BC8 C;  1QPM A;  1ZLK A;  1UB9 A;  2FF4 A;  1IN8 A;  1SD6 A;  5JR3 A;  3F23 A;  4U7B A;  2YU3 A;  4EGZ A;  1SMY F;  3SXY A;  3BJ6 A;  3IHU A;  5ILV A;  1KU9 A;  3KP7 A;  2A3S A;  2QBY B;  3TOA A;  5EEH A;  1QNT A;  2RKH A;  4NHJ A;  4EJT A;  1R1T A;  1YS7 A;  3ZMS A;  5L3B A;  3KP5 A;  1KA8 A;  1XCB A;  4OU0 A;  4QWQ A;  1ZYR F;  4HV6 A;  2Y0M A;  2HWV A;  3SHF A;  2DQR A;  4MQ9 F;  2XVC A;  2PJP A;  5DCF A;  6PAX A;  5H20 A;  3R61 A;  5JVT A;  5FLX Z;  1I5Z A;  2CG4 A;  2P5V A;  1LB2 A;  4NQW A;  5LGT A;  4FT8 A;  4HDU A;  3WTY C;  3DKW A;  2HQN A;  2EJR A;  2V1D A;  1OKR A;  2DPU A;  3WTX C;  2M8E A;  5DUI A;  1BM9 A;  2O03 A;  3V7R A;  5LLQ A;  2LSO A;  3DPT A;  4YIF A;  1I27 A;  3F22 A;  2DK5 A;  2JRT A;  2F5C A;  1IAW A;  3DEU A;  3KLN A;  5FFZ A;  2XKO A;  5D6E A;  4ZYD A;  1TW2 A;  5D5X B;  4U0W A;  2BEO A;  1SFU A;  4D0P A;  2QEN A;  2MLK A;  3C1D A;  2OD5 A;  4Q5S F;  3IC7 A;  1Z05 A;  4HZF A;  3RIR A;  2DU9 A;  3DF8 A;  1NHA A;  3LA7 A;  3GF2 A;  3LFK A;  1KYW A;  3J81 K;  2IW5 A;  1B59 A;  1IN6 A;  1W7P A;  4AIH A;  3HOT A;  2QM3 A;  2XUB A;  3GFL A;  3WTV C;  2F5E A;  2J5O A;  2M45 A;  2CO5 A;  2AXL A;  4ON0 A;  4EV0 A;  2G7U A;  4OIR F;  4ZZD A;  1D5V A;  5E18 F;  5DD8 A;  1HW1 A;  2GA1 A;  3N97 A;  1YLF A;  4M71 A;  3BPV A;  1YS6 A;  2TDX A;  5D4R A;  5F64 A;  4HLY A;  1O7L A;  2IJL A;  1O3R A;  3MAJ A;  3MEX A;  2H6B A;  3AAF A;  2HEO A;  3VOD A;  2R7F A;  2IRF G;  2HOE A;  3E97 A;  3E5U A;  4HBL A;  5FGM A;  2O0Y A;  4BXU A;  1TW3 A;  2HTJ A;  2F5F A;  1A04 A; 
#chains in the Genus database with same CATH topology
 2ZJR F;  3K4C A;  1A6Q A;  1IRX A;  2GA2 A;  2OAZ A;  2CJJ A;  3ECO A;  1R23 A;  2VQH A;  3I64 A;  1MDM A;  1UHM A;  4RB0 A;  1TWA J;  5IP9 J;  1Z3Y A;  2FRH A;  4BQN A;  1S29 A;  2GM4 A;  2EWN A;  2R5Z B;  5F0C A;  3CCR I;  1X4P A;  2KIM A;  3VDX A;  4MLO A;  1U2W A;  4D5F A;  3E3V A;  3OOP A;  4Q4Z F;  1X19 A;  2EH3 A;  2KIQ A;  1Y0U A;  4XQF A;  2FQ3 A;  2FX0 A;  1FBU A;  5BS6 A;  4BH9 A;  4XKB A;  4MEX F;  5M3M J;  2HZT A;  2RRE A;  3QPS A;  1WGX A;  4DZJ A;  1R22 A;  3QU3 A;  2DPD A;  2W57 A;  3PUB A;  3MN2 A;  4HAM A;  1E3O C;  3P9C A;  3KPH A;  3SFZ A;  5LHH A;  2XB5 A;  3H3U A;  4DNC A;  5GTI C;  1XSD A;  3LSR A;  3A0H C;  4A12 A;  3HB9 A;  3JW4 A;  2FJ1 A;  2CGP A;  1DQU A;  4E7J A;  3RJP A;  4CZC A;  2O3F A;  4N4O B;  2LY1 A;  2IS6 A;  2YR2 A;  1PUF A;  2LF7 A;  2D1V A;  1WZ2 A;  3CJN A;  1RUO A;  2OZ6 A;  4EQQ A;  3EQL F;  1MBF A;  3WG7 H;  2VQC A;  3RTR A;  4G6D A;  4A5N A;  3UR3 C;  1YFH A;  5K5O A;  1YX5 A;  4NC7 A;  4OIO F;  4XOT A;  5L3F A;  3OYL A;  1TWH J;  1K4T A;  3C2H A;  4GCV A;  2CW7 A;  2M7B A;  4NNJ A;  1JT6 A;  3K0L A;  3M7G A;  3K4J A;  5J1U A;  2CW8 A;  3VB2 A;  1SVL A;  3OYK A;  1D5Y A;  4IHT A;  3JRF A;  4PGG A;  3B73 A;  2QYO A;  1ZG5 A;  2KP6 A;  1BI3 A;  3KYD B;  3BZK A;  3Q9S A;  1X2N A;  4D5C A;  3WHC A;  3L09 A;  1IW7 F;  1IJW C;  4EEF G;  3ASO H;  3H9J A;  2RNG A;  3PO2 J;  1KYZ A;  4NUB A;  1EA3 A;  1R4N B;  1EV7 A;  4HA8 A;  4O3M A;  1I50 J;  2R7V A;  4RS8 A;  2HKO A;  4A3F J;  3RKY A;  1YQA A;  2Z3Y A;  5EG0 B;  2VL8 A;  1A35 A;  5E8G A;  3G1O A;  4CYD A;  5TRD A;  3QQA A;  1JJ6 C;  2ZKZ A;  2QKL B;  3I71 A;  1AHD P;  1PUE E;  4HQE A;  1QZY A;  5HDK A;  1SD5 A;  3HC7 A;  5B66 C;  4ZYH A;  1IDY A;  2R7W A;  2H1K A;  1CQT A;  3E1S A;  1ENH A;  2LKS A;  1I1G A;  3J80 Z;  1I1S A;  1IUY A;  1VTN C;  1KZH A;  5EJC A;  1YE9 A;  4BY7 J;  3S1R J;  1FBQ A;  2VN2 A;  3CES A;  2L0K A;  2XF7 A;  3CCL I;  3HDD A;  2EBI A;  5IT3 A;  4YII A;  5HDN A;  2V4J C;  2CYY A;  2CSO A;  3TGN A;  3S15 J;  2P5K A;  5FFX A;  2Y9Y A;  1D1C A;  1IZ1 A;  3FZV A;  3H5A A;  3HIF A;  4HF2 A;  3FF5 A;  4FQG A;  4A2U A;  2FMY A;  5J4V A;  4BQA A;  4II3 A;  3GZ6 A;  2XAG A;  2B7E A;  2K02 A;  1Y56 A;  3V7C A;  1TP4 A;  3IL2 A;  2R7Z J;  3MKL A;  5FRN A;  4A69 C;  4F52 A;  3CP2 A;  4LIT A;  5LRS A;  4LIV A;  2MW8 A;  2LD5 A;  4EJV A;  3MZH A;  4W97 A;  4KA4 A;  1SAU A;  1FOW A;  3EUH A;  2RC4 A;  3R6S A;  1F43 A;  3ABU A;  4PJN A;  2KZV A;  3HKZ N;  3IKV A;  1MSE C;  4Y15 A;  2HOA A;  2DFE A;  3HZJ A;  3ZQQ A;  3L00 A;  3E5Q A;  4U87 A;  4RB1 A;  1JE8 A;  3L1P A;  2IGK A;  1FC3 A;  4Y3O A;  2XPW A;  5DUK A;  1KU7 A;  2DJI A;  5HLG A;  2NNN A;  3TMO A;  1KU2 A;  2JVG A;  3I55 I;  2IPQ X;  3GTL J;  1LDK B;  3RKX A;  3ESW B;  2Z33 A;  2XIG A;  2Z1D A;  1LDJ A;  1B6A A;  3G3Z A;  2OBP A;  2O7O A;  3A03 A;  1IN7 A;  1GXQ A;  3F3X A;  3FXM A;  1M1E B;  5FKM A;  3WU0 A;  2LY9 A;  1VI0 A;  5DM6 F;  4F7Z A;  1BR1 A;  1O57 A;  2NOJ B;  3RKW A;  3I58 A;  3CC4 I;  1OCP A;  5FLX K;  2R7Q A;  1REP C;  4NQW B;  4Y13 A;  4BHP A;  3TKY A;  3V42 A;  3LSJ A;  2VPL A;  2VJ5 A;  5F04 A;  4NC8 A;  5B3S H;  1Z77 A;  3LST A;  3F6V A;  4OIP F;  3TQN A;  1K6O A;  3KCC A;  1Z3X A;  3KEY A;  1U8R A;  2E1C A;  2VOD A;  3BJO A;  2W1O A;  4N4N B;  2CW0 F;  4CO8 A;  2L9N A;  4FX0 A;  1FLI A;  4BAY A;  3IAM 2;  3IKT A;  2CQX A;  1ON2 A;  4PFO A;  3IP4 B;  1UJ8 A;  3I3L A;  2K27 A;  2XGC A;  2DA7 A;  3MMY B;  3JRC A;  5D5V B;  3V8K A;  3EDP A;  2HYJ A;  4XRM A;  2VOO A;  2K86 A;  2WC2 A;  3RQI A;  1AU7 A;  2ZC2 A;  2X4H A;  1DUX C;  3GFI A;  2NVX J;  5IT9 Z;  2DI3 A;  4A3K J;  3N05 A;  1MH4 A;  3ML6 A;  2Q8K A;  2VXD A;  2V9V A;  3BR1 A;  2RNJ A;  1XS9 A;  3RSN A;  4XON A;  5FKO A;  2DYR H;  3E6C C;  1XCV A;  2W24 A;  4IRI A;  2WAQ A;  3I4N J;  3CCY A;  5D5W B;  5E3N A;  5K1Y A;  1F9N A;  1P6R A;  2F48 A;  3OSG A;  2M7A A;  3B6A A;  2QKM B;  3Q9V A;  2LVS A;  3BDD A;  2DOF A;  4HQM A;  2DA2 A;  4BGD A;  2FU4 A;  1DU0 A;  4KIC A;  1HF0 A;  2CU7 A;  5GAD J;  4C2T A;  2CV2 A;  1IV8 A;  4Y7N J;  3L2R A;  1TC3 C;  2CFX A;  2P7V B;  3MVP A;  3RYP A;  4W1U A;  2IXS A;  1YJN I;  1FWZ A;  1R6R A;  1JKQ C;  4J00 A;  1K4S A;  4BAC A;  4G12 A;  1U9N A;  1W7P B;  2Y69 H;  1VQ8 I;  1FPQ A;  2HDW A;  2E7X A;  2MH9 A;  3CUQ C;  1ETV A;  2VUM J;  2Z99 A;  2WBM A;  3F6O A;  3Q0V A;  1R7J A;  3VOE A;  2L7Z A;  2H6C A;  1ZAR A;  4N9I A;  4OAZ A;  3G4S I;  4EJU A;  3OOU A;  1U5T A;  3JRB A;  5BOX A;  2OQG A;  5EZH A;  4LK0 F;  4XK4 A;  1Z7U A;  2VBW A;  5GTH C;  3K6G A;  1VQM I;  3O3K A;  2PLY A;  1IGN A;  2ZJP F;  3I9V 2;  1TZL A;  3WTW C;  2ZO4 A;  5DCM A;  1WI9 A;  2K9S A;  4A6E A;  4KNY A;  3GXO A;  1R5G A;  2QGU A;  3LAJ A;  1GV5 A;  5LRR A;  4EJO A;  2Y0S N;  3QPH A;  1U0J A;  2EIL H;  3K1N A;  4B48 A;  1UZC A;  2DMU A;  2H09 A;  2FNA A;  1S72 I;  3X2Q H;  5IYD J;  1LFP A;  1OR7 C;  3GVA A;  3W6K B;  3BTL A;  4UV9 A;  1YTY A;  3G73 A;  3KZY A;  2BW3 A;  4ENK A;  3HHG A;  1IUF A;  2FNP A;  2KDZ A;  4JX6 A;  3T1B A;  4A6D A;  2K9Q A;  2GXB A;  4LD5 A;  2V1X A;  2XAH A;  3IWZ A;  1TNT A;  3ZQH A;  2B9S A;  2WY8 Q;  1OIS A;  5AIP A;  2GBY A;  4GRI A;  4XM3 A;  2X0L A;  4QIW N;  2V6E A;  3HRU A;  4UUV A;  2G0E A;  4L0Z B;  2L4M A;  2O61 A;  4QPQ A;  2OQR A;  2PI0 A;  2E71 A;  3OYD A;  4GFB A;  3M3Y J;  1GHC A;  3K4L A;  5ILS A;  5CVR A;  3T0Y A;  1WKM A;  2V7F A;  3ZN1 A;  4E7I A;  2HS5 A;  5CYV A;  4N0B A;  1J59 A;  4FX4 A;  1MDM B;  3OL4 A;  1I39 A;  3HOZ J;  2HQR A;  2IEK A;  3FMS A;  3HOS A;  4MQV A;  3WU1 B;  2A6H F;  2EIM H;  4MNU A;  3WGG A;  5K5R A;  2XF6 A;  3O6B B;  2FEZ A;  2KPM A;  3ZMZ A;  3DEE A;  3MZY A;  4ESJ A;  4XOR A;  5A2Q K;  4YG2 F;  1TT5 B;  2XC7 A;  2LRD A;  1RNL A;  1BL0 A;  1FP2 A;  2PX9 A;  2HTS A;  4Y4R A;  5CPR B;  5ICF A;  2CQK A;  1S9H A;  1UAA A;  3A1Y A;  1MBJ A;  1UHW A;  5BMZ A;  1R5H A;  4XN0 A;  3TDU C;  3W3C A;  3ROU A;  4V19 K;  4I76 A;  4YFX F;  3TW7 A;  2M87 A;  3FHN A;  3DLA A;  4J19 A;  3GZ5 A;  5F27 A;  4L18 B;  4XLE A;  2DT7 B;  2YX4 A;  3QAH A;  4OMZ A;  4PZJ A;  4M9S A;  3D0S A;  4BUP A;  1G59 A;  2JJ7 A;  3LQQ A;  1E3P A;  2HQ5 A;  3U9G A;  2LKX A;  3MFK A;  3FDY A;  1BOB A;  4OMY A;  3S16 J;  2K85 A;  1ZR2 A;  1FMW A;  2TRT A;  4XLA A;  3EET A;  3OS1 A;  5LD2 C;  1UMQ A;  4D1Q A;  1FOY A;  4CHU A;  1Z91 A;  5C3E J;  2W48 A;  3H9G A;  1PUF B;  3FM3 A;  1SMT A;  2Y2Z A;  2V9P A;  2E34 A;  1ZGA A;  2VJ4 A;  4F93 B;  2K3P A;  1SAX A;  1R00 A;  2XPV A;  4AVP A;  2HOS A;  2XAQ A;  2LDU A;  3H3Z A;  3ZMV A;  3AG2 H;  2PEX A;  4EVI A;  4RM3 A;  3K70 C;  5FJ8 J;  4ZZL A;  4ZYE A;  3HGG A;  2D5V A;  3WTZ A;  4F91 B;  1WFX A;  2C6Y A;  4IHW A;  2JT1 A;  4LLN A;  2XAJ A;  3KYL A;  4HNU A;  1PVE A;  1B9N A;  3REO A;  3GEZ A;  4MEY F;  4P9U A;  5DTD A;  1UFM A;  5HVQ C;  3PO3 J;  3ZR8 X;  1BI1 A;  3K4M A;  2MGQ A;  4ZYG A;  5IY5 H;  3DBL B;  4I99 C;  5F6F A;  1MH3 A;  1DDN A;  3CJT B;  2COB A;  1SAN A;  3ZQF A;  1BN5 A;  3W2A A;  2MD0 A;  1DGW Y;  4JX5 A;  5DEQ A;  1LVA A;  5CVI A;  1DP3 A;  2XB0 X;  4U88 A;  3ZQ7 A;  5IYC J;  5CKT A;  1LFU P;  3CCS I;  1ZRD A;  4XMY A;  1VZ0 A;  2HVQ A;  4PJ0 C;  2HI3 A;  3DFG A;  1JI8 A;  5EYR A;  3COA C;  3S8P A;  4A3M J;  2O6G E;  4GO1 A;  4OIN F;  2ZXI A;  3HJE A;  3LSH A;  4RAF A;  3S2H J;  1Q1H A;  4HX8 A;  5EF6 A;  1TTY A;  1YI2 I;  3R4K A;  3I59 A;  4KIB A;  3OWT A;  1ITY A;  2DO7 A;  4CCM A;  3ZQI A;  5J8C A;  4E7L A;  2XSJ C;  4CCJ A;  1K78 A;  2D2W A;  3MKY B;  4OOI A;  1S5L C;  3R60 A;  2P8T A;  3C7J A;  4UUT A;  1EH8 A;  2R3S A;  4B8X A;  1TNS A;  4PK4 A;  4AVZ A;  3JR9 A;  4MGR A;  5DV5 A;  2VE9 A;  2X6O A;  3ZN0 A;  3ABK H;  2HYG D;  5EZG A;  1H89 C;  1V5G A;  3IH2 A;  5KCM A;  2VC0 A;  4H4K C;  4LLG F;  2M4G A;  5M3F J;  3RZD J;  1EKE A;  2YPR A;  1TWC J;  1K6Y A;  1Y6I A;  2DXI A;  5JHF A;  1USS A;  1S8N A;  1GVJ A;  1LEA A;  2P5L C;  2PN6 A;  3M8E A;  2ELJ A;  3JRH A;  1WJA A;  4A0Y A;  3H92 A;  4O6J A;  1YYV A;  2HKX A;  3AFH A;  5BPD A;  4RAY A;  3BJA A;  3JRE A;  5JLX A;  2PJR A;  4A3E J;  2IT0 A;  1BW5 A;  2V6C A;  3U2R A;  3FXQ A;  3QOP A;  2EFP A;  3CC7 I;  1P7J A;  2LNB A;  2EB7 A;  2HYF A;  1U6G A;  4PCQ A;  2LMD A;  3K7A J;  2HVS A;  4MFD A;  4B44 A;  2M9H A;  2P4W A;  4HV5 A;  3L2V A;  4XSX F;  2HDD A;  2CH0 A;  5D8L B;  1W7P D;  2FBK A;  4Q47 A;  3BZC A;  2JK3 A;  2MD5 A;  3CC2 I;  5FLM J;  4KT6 A;  3H0D A;  3HSR A;  3VSK A;  3E5X A;  1AWC A;  4BXX J;  1YIO A;  3NAR A;  2MAB A;  3AKZ A;  3L7W A;  3H3V K;  1QHG A;  1Z7L A;  2I8D A;  2NVQ J;  2IA2 A;  3CJQ B;  1MBK A;  5FD6 A;  1Y1W J;  1BOA A;  2M2E A;  3HPH A;  3G1L A;  1WJ5 A;  2VI6 A;  2E2H J;  3EUK L;  3FIW A;  4K2E A;  4CCN A;  2WV0 A;  3LWF A;  2XHK A;  3HRM A;  4LK1 F;  2KJB A;  3GBG A;  4F55 A;  1WJB A;  2D45 A;  1X3Z B;  3OSF A;  2DTZ A;  1A5J A;  1FX7 A;  2ELH A;  5KK1 A;  2EFQ A;  4BE1 A;  5IP7 J;  1IRF A;  1ODD A;  1MMS A;  2ESH A;  4BJ6 C;  4FCY A;  1MMG A;  3MQ0 A;  2HOT A;  4IRH A;  1YW7 A;  2F2E A;  5E1Z B;  4PUS A;  4C2M J;  1TWG J;  3CUQ A;  3RCO A;  2EFO A;  4BKX A;  1IN4 A;  4UUS B;  2VB6 A;  3PQJ A;  4QSH A;  4XLF A;  5M5Y J;  2VBX A;  1R36 A;  2JA7 J;  1ETY A;  1HST A;  2WV1 A;  5IT9 K;  4KJZ A;  4CXF A;  4I98 B;  2VBY A;  5GAG J;  1BIB A;  5GAE J;  3S32 A;  2OZU A;  2QLZ A;  4ASN A;  3OYH A;  2LKP A;  1XMK A;  4FTH A;  2JN6 A;  4DYC A;  4X6A J;  2DFF A;  3QPT A;  3HOW J;  1UG2 A;  5IOZ A;  4L5E A;  1AKH A;  5B1B H;  3PIO F;  4L9J A;  2OA4 A;  1VQ7 I;  2NXN B;  2JA2 A;  3IH4 A;  3A02 A;  4AWX B;  2XRL A;  1G4D A;  2DJN A;  2EA4 A;  2G7H A;  1TWF J;  4M6V A;  4LJZ F;  1X3W B;  3RYR A;  3V4G A;  2JA5 J;  3GFM A;  3OYJ A;  2EFW A;  5D8K B;  3QP6 A;  3K4B A;  3H5R A;  2WAQ N;  1RRJ A;  4HF1 A;  4HYE A;  4P96 A;  4WCG A;  2DMT A;  4LG3 A;  1V54 H;  5D4S A;  3AL0 B;  2JA8 J;  1X4O A;  1B1B A;  1R49 A;  4RMN A;  4UVC A;  4EAT A;  2DW4 A;  3KEO A;  4B4C A;  4GDF A;  1WHU A;  4BHB A;  1MJB A;  1R71 A;  2EV0 A;  4F92 B;  1K83 J;  1ZG1 A;  3CUO A;  1U5T B;  1OLT A;  4NB5 A;  3BZ6 A;  5F1J A;  1WVR A;  3ZRG A;  5J1R A;  5K5Q A;  3GTP J;  3HOV J;  3K1M A;  1XTA A;  3SZG A;  3ZMD A;  2HXI A;  4E4H A;  3DLL F;  1T0F C;  1YJW I;  1B8I A;  1PDN C;  4AM3 A;  1D0Y A;  1V5F A;  5DCM B;  3KZI C;  5M5X J;  3CCQ I;  3RDI A;  2K4J A;  2EFN A;  1O7F A;  2AO9 A;  2YX7 A;  3AG4 H;  1XGO A;  1HQC A;  4BEH A;  3W2V A;  2ZBK A;  4XOP A;  3E6D A;  1W36 D;  3GTQ J;  3OYI A;  4ZDL A;  3IRQ A;  1ZRF A;  2DLL A;  3E6B A;  2XGE A;  2L3D A;  3VYU B;  5F1R A;  4LOC A;  3F21 A;  2KDO A;  3TOB A;  3FKI J;  4RLQ A;  1YG2 A;  3L2U A;  4U7D A;  4FE4 A;  5L3D A;  3A4C A;  1GV2 A;  3BP8 A;  4BDZ A;  3BLY A;  5FD5 A;  1G3W A;  4L9N A;  3K69 A;  1R1V A;  1KGS A;  1ZK8 A;  3FHZ A;  1I6X A;  3HSF A;  2L02 A;  4XKV A;  4E7Z A;  1MD0 A;  4XID A;  1XX5 A;  1VFC A;  1YRN A;  3PSI A;  3ZMU A;  4C3H J;  5J4Y A;  1G2H A;  5AIQ A;  1XPX A;  1OYI A;  2IA0 A;  3V8L A;  3K2A A;  5FKL A;  5J1Y A;  3PFY A;  5CVV A;  5LEJ A;  2JUG A;  5HOO A;  3BG7 A;  4IRG A;  1EH7 A;  4PGH A;  3L2W A;  3OYG A;  2NVY J;  5C4X J;  3ASN H;  3E0J B;  3ZOB A;  1ZHF A;  4IHX A;  3S3M A;  2QA4 I;  3HHH A;  4RGR A;  5L3G A;  4XRS G;  1VQP I;  3CLO A;  4BS9 A;  3SEQ A;  3CMM A;  5EEA A;  2K3F A;  2KZG A;  1XGN A;  3DXJ F;  3BG5 A;  2DMN A;  3GWZ A;  3I53 A;  1OCZ H;  4F3Q A;  1CF7 A;  5E79 C;  4ENM A;  1ZG3 A;  3FIS A;  4DYR A;  1VND A;  3HTU A;  4LB6 B;  2JSC A;  3K1P A;  1JXS A;  3HGY A;  1J5Y A;  1Z0X A;  3FMQ A;  3W2W A;  3CCM I;  3WU2 C;  2CUJ A;  2KL4 A;  1P92 A;  3MD2 A;  3OYE A;  3D5S C;  3OYN A;  5ICE A;  3HTS B;  1GDT A;  3BCA A;  3CO6 C;  4OIQ F;  3HPG A;  3WE3 A;  5HLT A;  4KT5 C;  3WTU C;  4E6K G;  3KIO A;  3BG9 A;  1FOK A;  4NC6 A;  2NRA C;  3T8T A;  2R7S A;  3HG9 A;  4HNT A;  4M6X A;  3A0B C;  2O8K A;  1LQ1 A;  1FYM A;  1FTT A;  2W82 A;  4S04 A;  1X2M A;  5FO5 A;  4A3G J;  2IS4 A;  2EIN H;  5AON A;  5GP9 A;  3GUD A;  3GX4 X;  1I3Q J;  1LEB A;  2MH2 A;  4HRI A;  2LH9 A;  4TV7 A;  3K10 A;  1SFK A;  3C3W A;  1Z6T A;  3PFI A;  3J81 Z;  2VT2 A;  3H36 A;  5HLH A;  2PQ8 A;  3B02 A;  3NAU A;  4Z2Y A;  2ICW G;  2CUZ A;  2E36 A;  2CQQ A;  1W5T A;  3HXL A;  2V9K A;  4RAG A;  4S0H B;  1TL8 A;  1SC7 A;  2CV0 A;  3E7L A;  3ZMT A;  2ZME A;  3R0A A;  1H8A C;  2QVO A;  3OIO A;  4AC0 A;  1GVD A;  3JAM Z;  1QVU A;  5K7F A;  1BC7 C;  1XG1 A;  4OAY A;  4G6Q A;  1TT0 A;  1J2X A;  1QU3 A;  1RIO H;  3G71 I;  4ESB A;  4IO9 F;  4JBA A;  4KMF A;  4EGY A;  3FBN B;  3J7A O;  1R5I D;  2GXG A;  2FA5 A;  1JUP A;  2QUF A;  1B72 A;  1JUM A;  3F8B A;  3VWB A;  3N4M A;  1OCT C;  1JKP C;  1XD7 A;  1P7I A;  4XL9 A;  2COM A;  3GTK J;  5D6F A;  2K9M A;  4UB8 C;  3WHB A;  3RPU A;  1ZEL A;  5DD4 A;  3SJM A;  5E1W A;  3JTH A;  4DJA A;  1E17 A;  2X85 A;  4C9Y A;  2LF8 A;  3I59 B;  1R1U A;  2NS8 A;  4FHT A;  2QSF X;  3SDB A;  1G6N A;  4BBR J;  1K78 B;  5LFA A;  2LTP A;  3BTI A;  2DK8 A;  4ABZ A;  1YIJ I;  3OS2 A;  1VQN I;  1FYL A;  1RKT A;  3LOC A;  4I0A A;  3TW6 A;  4ANJ A;  2EV5 A;  3ZQL A;  4AID A;  2YSR A;  2P6T A;  2X9D A;  1ETX A;  1IXC A;  4RDU A;  3SYT A;  2E1M B;  4CYC A;  2JA6 J;  3CCE I;  5FRM A;  3FKJ A;  1MBG A;  4PDK A;  4ITV A;  2ECB A;  2QQ9 A;  5JVG F;  3JSP A;  1WJC A;  4JX4 A;  2TCT A;  2EZI A;  3BQY A;  1UCR A;  2BV6 A;  1JKO C;  4RAZ A;  1ZH5 A;  2L5Q A;  4L9T A;  1T98 A;  3DBH B;  4IHV A;  1IXS B;  5J8F A;  4KIS A;  4IQJ A;  1PYV A;  4JK1 X;  1D1B A;  4KN7 X;  4IX7 A;  3TO9 A;  5D5U B;  4LGW A;  2VIX A;  4HX4 A;  1XGM A;  2HXO A;  4XIC A;  4M3B A;  2EZH A;  3DPL C;  3WTT C;  2PJR B;  2E1N A;  1L3L A;  3NRV A;  4A0X A;  1Y1V J;  3OIQ A;  3BQZ A;  2GOX B;  1K7A A;  1UHS A;  4XKW A;  2WAD A;  1FEX A;  2Q1Z B;  5FKK A;  1ACI A;  4GYI A;  5IOY A;  3F8C A;  3I0T A;  4UNO A;  4C3J J;  1OYY A;  2Y75 A;  1W5S A;  3TL4 X;  2IP2 A;  2R7T A;  5F08 A;  4EM0 B;  1XDU A;  2GWR A;  2BHY A;  2ID6 A;  5M5W J;  1HDD C;  4Y52 J;  4YFK F;  2M30 A;  3J7A Y;  2MC4 A;  2L01 A;  4PJM A;  1MW7 A;  4U0Y A;  2M34 A;  3P7N A;  1MBH A;  3OR1 C;  4ENN A;  1E2X A;  2FBI A;  1WJE A;  4UY8 I;  1S7A A;  1MNM C;  4R8H A;  4D7N A;  2BXZ A;  4HDV A;  4KIT B;  3RKQ A;  1XMA A;  1CGP A;  2IGO A;  4HST A;  1QBJ A;  2LFB A;  2X51 A;  4P55 A;  5GPA A;  2HR3 A;  1LDD A;  2WAE A;  5BPI A;  4B09 A;  5ILU A;  5DYM A;  1GXP A;  1W0T A;  3PQK A;  4JYK A;  4DOZ A;  2MA3 A;  2Q0O A;  3OYB A;  3CDI A;  3CJR B;  3WE2 A;  4UVB A;  1D0Z A;  3BOQ A;  3FM5 A;  2NYX A;  2JMW A;  1WCM J;  2EPF A;  1R58 A;  3DKY A;  5FRO A;  5HLI A;  3PIP F;  3GTM J;  3FXR A;  1OYW A;  4RM2 A;  3H5N A;  4IEJ A;  4G6T B;  2CMP A;  4XRF A;  3JSO A;  3GTG J;  2CRG A;  4U0V A;  3S1M J;  3M9A A;  4GXO A;  5CQE A;  2B63 J;  2ZXJ A;  1N25 A;  4BE0 A;  3KYC B;  1T0F A;  3IRR A;  1HXD A;  4FIS A;  4O5V A;  4CH7 A;  2IVM A;  2XF5 A;  2DA1 A;  2NS0 A;  1IV6 A;  1X1C A;  3HL2 A;  1XN7 A;  1JHF A;  2DAO A;  3PM1 A;  3MKW B;  4DBQ A;  1QPI A;  5HS8 A;  3L2C A;  2Q2E A;  3ABT A;  1L0O C;  3TO7 A;  2X1C A;  1AKH B;  3H35 A;  1W36 C;  3I5U A;  3SQN A;  2FBH A;  4A3L J;  3CDH A;  2BOL A;  2OPT A;  1J0R A;  2E35 A;  2JWT A;  2OJE D;  5ICC A;  5LGU A;  3OYF A;  4LB5 A;  2E2J J;  4H0E A;  2LBF A;  1POG A;  2L54 A;  3GME A;  2B0L A;  3MCZ A;  4RLF A;  4IPA A;  3Q3S A;  2DQL A;  1WRJ A;  2Y30 A;  2VKH A;  2XGX A;  1ZKG A;  3BPX A;  2JSP A;  4Y17 A;  1OCO H;  2E7W A;  2BYV E;  3JCU C;  1LNW A;  3U1D A;  1OCC H;  2E1O A;  1JTX A;  5C4J J;  1RI7 A;  3GZN B;  4L5I A;  1WJF A;  3LAP A;  1EJ9 A;  1HA8 A;  4MFE A;  3TBI A;  3DU5 A;  3I54 A;  4IJA A;  2AQF A;  2ZJQ F;  1WH7 A;  3CCJ I;  3P5J A;  4V2G A;  2UZK A;  1DPR A;  4BJ5 C;  4L5J A;  4KIF A;  3OR2 C;  1G3S A;  3FK6 A;  1B8I B;  3QYB A;  4IVN A;  3VFZ A;  1SFE A;  3ZXS A;  5CQG A;  4A3I J;  2R7O A;  2STT A;  3GLL A;  2CQ7 A;  4BEH B;  3HOU J;  2IS2 A;  1H9T A;  1UST A;  2RVC A;  4UB6 C;  3V8J A;  4P5O A;  4M3E A;  4AIK A;  2CS3 A;  2L9R A;  1ZGW A;  1HW5 A;  2DMQ A;  1HKQ A;  3J7Z I;  5J6X A;  3CCU I;  1V4R A;  1SD4 A;  4G7H F;  1XDS A;  4EM2 A;  2NAZ A;  4EJW A;  4L0Y B;  2EK5 A;  1OCR H;  3DTK A;  4MIM A;  2Y48 A;  5H6Q A;  2GQQ A;  4M73 A;  2ZCW A;  1N78 A;  4IZZ A;  3EYY A;  2FOK A;  2MFZ A;  3H0G J;  2E5Z A;  4ZJZ A;  3NWT A;  2AQE A;  1YHQ I;  2R7R A;  3CD6 I;  2DA6 A;  3KLO A;  1YRN B;  4LIU A;  1X1A A;  3LA2 A;  5TJJ A;  2OTL I;  2FE3 A;  2BVL A;  1ON1 A;  3FWE A;  4KIG A;  2WTE A;  3DKX A;  4MHG A;  3HYI A;  3IAS 2;  4M3D A;  2W25 A;  1PJR A;  1P4X A;  2W85 A;  4XKC A;  2VAS A;  1D8J A;  2MLG A;  4G8X A;  3PNY A;  3KP4 A;  4PJJ A;  4ZH4 F;  3DQV C;  4HG2 A;  2CQN A;  1RUN A;  2LG4 A;  2JTV A;  4IQ4 A;  2VPR A;  4BHC A;  3F72 A;  1K61 A;  3MZ8 A;  3ONQ A;  1Z6R A;  3J80 K;  1ETO A;  3ULQ B;  4IOC F;  1CF7 B;  2CV1 A;  5KVR A;  4A5M A;  3LNQ A;  1N77 A;  2AXT C;  1OMI A;  4GGG A;  4I0B A;  5FB2 A;  2X6X A;  2ZFW A;  1P2F A;  3GCM A;  2X48 A;  2RDP A;  2XRO A;  2PG4 A;  2ZJ2 A;  3OYM A;  3LFU A;  1JGS A;  2JZY A;  1TQM A;  2XRN A;  2JPC A;  3QPL A;  5LHG A;  3AG1 H;  1S6L A;  1T33 A;  3B6C A;  1YO5 C;  3ZPL A;  5JLW A;  1H88 C;  2VT3 A;  2A5Y B;  4I09 A;  2Z9O A;  1DPU A;  3OIP A;  1IRG A;  1JGG A;  3ZQC A;  4B3X A;  1J09 A;  3C2G A;  4EM1 A;  4R79 A;  3RI4 A;  2A69 F;  4ETS A;  2QZ8 A;  3L9F A;  3O8H A;  4LMY A;  1QZZ A;  3Q0W A;  4M9Z A;  1BBY A;  2XKP A;  3CP8 A;  1D0X A;  3A01 A;  4XLC A;  3HOX J;  2BZT A;  3CO7 C;  4PJL A;  2DOA A;  3M1E A;  1HW2 A;  2WB1 A;  1ETQ A;  4P9F A;  1E0E A;  2X6W A;  1LE8 A;  1FBS A;  3F8F A;  2OU2 A;  3V7S A;  1XB4 A;  5LEK A;  2N8G A;  3KFW X;  2ZME B;  1Z1D A;  2DBB A;  4LG0 A;  3ECH A;  1X3U A;  3LSM A;  2BHZ A;  1BI0 A;  5E3L A;  2HGC A;  2Y31 A;  3JAM K;  3LQR A;  1RPW A;  1ZLJ A;  5GAH J;  2WWY A;  1IXR C;  4C30 A;  3RZO J;  5EGO A;  3VYS B;  4ESF A;  2K9L A;  1OPC A;  1D8K A;  1STZ A;  4L9V A;  3CLQ A;  1ERD A;  2ZFU A;  2QSH X;  3E6M A;  2L9V A;  4RGU A;  2OCE A;  4E70 A;  1B72 B;  2EIK H;  5IYB J;  1Z9C A;  3CTA A;  4BL0 B;  2LK2 A;  4QPO A;  2EZK A;  3SZP A;  5HDG A;  1Y39 A;  1NTC A;  3CDL A;  3WOD F;  2M4K A;  1T38 A;  2L4A A;  4ZYA A;  1MSF C;  3BCB A;  3SDG A;  1RC9 A;  2ZB9 A;  2PBI A;  1T6S A;  1KQ9 A;  1MKM A;  2W4S A;  3DTE A;  4DQ2 A;  1VF9 A;  1T39 A;  2I5U A;  1KQ0 A;  3S2D J;  4PSW A;  3TO6 A;  3LSG A;  4BU2 A;  1F4K A;  3K4N A;  2KIU A;  5JI6 A;  2M1B A;  1SFO J;  3PNT A;  2VON A;  2H8W A;  2GOM A;  3BR2 A;  3KZZ A;  2BY3 A;  4BNC A;  1TLH B;  2JPB A;  4RB2 C;  1FTZ A;  1ETK A;  3T5X A;  3AL0 C;  5HNF A;  3FXO A;  2MG4 A;  2XAF A;  2XV4 S;  1KQ8 A;  3WGH A;  1FIP A;  2Y9Z A;  1V5E A;  3JRI A;  4CYC B;  1QZE A;  1DP7 P;  2PMH A;  1SFX A;  4HX7 A;  2KIF A;  2R5Y A;  1F5T A;  1MMA A;  1U5T C;  2O5R A;  4IKF A;  1OR7 A;  2FSW A;  2V26 A;  3M1C A;  4BJT A;  2R7U A;  2KMU A;  3D5R C;  2J5P A;  2V1N A;  2VKV A;  3WG9 A;  3GW2 A;  3OYC A;  4I2O A;  5FLV A;  1ETW A;  2VJI A;  1MMD A;  2E60 A;  1Z21 A;  4XSZ F;  1W0U A;  3MWM A;  2G9W A;  4DW6 A;  5A2Q Z;  1MZB A;  2CUF A;  2R7X A;  4WXH A;  5HS9 A;  4IOA F;  3BR6 A;  2AS5 F;  4M9X A;  2FML A;  2H1L A;  2VKE A;  1WPK A;  4CSW A;  4G9Y A;  2HPM A;  3JRG A;  4YFN F;  1BIA A;  4M72 A;  1O3T A;  4IXA A;  1U8B A;  1N75 A;  1QHH D;  3LL7 A;  5EDN A;  2JRM A;  3S3O A;  2ADU A;  1AA7 A;  4GYG A;  2DOD A;  3BY6 A;  4JQF A;  2QQ8 A;  2BE5 F;  2P6S A;  3BR0 A;  1OQY A;  3DWL E;  2NS7 A;  2ZXH A;  3DV8 A;  4YIR X;  4V2F A;  1IF1 A;  1QA6 A;  4BYY A;  3LMM A;  2X1D A;  1LJ9 A;  2JVH A;  2DCE A;  3IUO A;  2QBY A;  1BJA A;  3HM5 A;  3QU6 A;  1A36 A;  1F1Z A;  1S7E A;  2M0M A;  4R1H A;  2ZNY A;  3DU6 A;  3GYH X;  2ISY A;  4UHT A;  2BW3 B;  1FY7 A;  4XLN F;  4FET A;  4IHS A;  4RGS A;  3HRT A;  2XAU A;  1BJZ A;  2O9L A;  1FOX A;  3F9K A;  3HOY J;  2EIJ H;  3P9K A;  2MYS A;  3NEU A;  1ZN2 A;  2GZW A;  1O3Q A;  1RZ4 A;  2MSY A;  3C18 A;  4PFP A;  3WGI A;  2W7N A;  5LHI A;  3M07 A;  3HRS A;  2ECC A;  2D1H A;  2FQ4 A;  5B5E C;  1BI2 A;  1Z67 A;  2IA1 A;  1P4W A;  1EF4 A;  4IL6 C;  1OJL A;  2KKO A;  2KIS A;  1G3Y A;  2RQP A;  4E7S A;  3VYT B;  4XNF A;  4D9J A;  3S3N A;  3GFJ A;  2KLO A;  1DGR M;  1O3S A;  3FBI B;  2F5V A;  2LC2 A;  1YW9 A;  4B3A A;  4CCL A;  4G94 A;  2LP0 A;  2DT5 A;  2UXX A;  3O2P E;  4DBR A;  1JJ8 C;  4KDP A;  1JTY A;  2MC3 A;  2YS9 A;  4HW0 A;  4HLX A;  2Q2E B;  4C2U A;  2LRE A;  2KJC A;  2KRF A;  5LBQ A;  4LFU A;  3UKG A;  2R0Q C;  3CQZ J;  4CCK A;  2VXZ A;  3W6V A;  1XMX A;  1ZGJ A;  2VKD A;  4XRS A;  1XGS A;  2BGC A;  2MBF A;  1UG0 A;  2FUG 2;  3K70 D;  4A3D J;  2ZSH B;  3TED A;  2LBF B;  5H2F C;  1V55 H;  3NQO A;  1NG6 A;  1ORK A;  1FMV A;  2KT0 A;  4I7H A;  2K5C A;  3TP3 A;  3IH3 A;  4XLP F;  2L7F P;  3D1N I;  1GLN A;  2R4G A;  5J3L A;  4CA0 A;  2F5D A;  2EA2 A;  1PP7 U;  1OFC X;  2XAS A;  3BG6 A;  2PMU A;  2L9S A;  2A68 F;  4S05 A;  4KN4 X;  1NG7 A;  4NBQ A;  5L3C A;  2K40 A;  2EZL A;  4ZTF A;  1NH3 A;  2DN0 A;  3P9I A;  4EMS A;  2R7D A;  4CIC A;  4LLL A;  1X1D A;  5LGN A;  1BR4 A;  3SZT A;  4RB3 C;  3BRO A;  3QWL A;  1RR8 C;  1PP8 F;  2L7M P;  1LKX A;  1SEU A;  1VQK I;  9ANT A;  2VBZ A;  2K4B A;  1ONV A;  5E17 F;  5DDG A;  1XSX A;  2RAE A;  5IPA A;  2A05 A;  3BWG A;  3DP7 A;  2LY2 A;  2PFB A;  1U78 A;  3KP6 A;  1D1A A;  4KMU X;  1F36 A;  4WXC A;  2ACJ A;  4DIQ A;  2OTJ I;  2CWE A;  2ME0 A;  2STW A;  2M0C A;  4BQQ A;  5KHD A;  3QRF F;  2BY0 A;  1HLV A;  5CVJ A;  1Y8R B;  2K7L A;  4CZZ A;  4BXF A;  1A31 A;  4E7K A;  2H94 A;  4JP0 A;  2M5W A;  1B4A A;  3D5L A;  3F8M A;  1WH5 A;  2W00 A;  2GAU A;  2OC6 A;  4M74 A;  1RKW A;  5HOD A;  2E2I J;  2E1M C;  2VC1 A;  2O8X A;  2I10 A;  1FZP B;  4N9H A;  2LYC A;  3HUG A;  3VSL A;  1S7O A;  5CVU A;  5BQT A;  4DGW B;  4CGZ A;  2FXA A;  1O4X A;  5B1A H;  2ELK A;  2IGN A;  3RPQ A;  2ZNZ A;  4I02 A;  1FYK A;  3ERE D;  4CDG A;  1FSE A;  1IN5 A;  3KE2 A;  2DOE A;  3VPR A;  2F4I A;  3TDZ C;  3J7Y J;  2PMZ A;  1B9M A;  2XSD C;  4RA2 A;  4BE2 A;  3RPU D;  1IO2 A;  4AIJ A;  3GLX A;  3JTG A;  3AG3 H;  1IDZ A;  1TQI A;  3CCV I;  3QOE A;  3I56 I;  3KP3 A;  2A6E F;  3K9T A;  4DYQ A;  2X1E A;  1YW8 A;  2DA5 A;  1J7K A;  1MJA A;  3JRD A;  1RET A;  2BY1 A;  2UXN A;  2GXA A;  3G1M A;  1IRZ A;  4A0Z A;  3EYI A;  5L3E A;  4WX9 A;  3A2K A;  2CFO A;  5E20 A;  5E8I A;  4KUM A;  3R0J A;  4UUS A;  3OS0 A;  3VEP A;  1U3E M;  4WF2 A;  2NOG A;  4YRV A;  3K2Z A;  2Z5U A;  1HC8 A;  5JHU A;  1EH6 A;  4UV8 A;  1UEL B;  2DTR A;  5TIS C;  3G6E I;  1ZRE A;  2ETH A;  3Q0U A;  2ESN A;  1GT0 C;  3Q5F A;  4QTR A;  3FXU A;  3M8J A;  4WWC A;  2R92 J;  3BR5 A;  2ZSI B;  2VQG A;  3SEZ A;  4WXD A;  2VOP A;  2RGV A;  2R5Z A;  1P4A A;  3ISP A;  1WWX A;  2VJJ A;  1I3A A;  2VE8 A;  2E5N A;  2HQA A;  2V79 A;  4XBF A;  1MGT A;  3A01 B;  2HDC A;  1K79 A;  1X58 A;  2BY2 A;  1H0M A;  4G7O F;  5F0F A;  1MND A;  3ZP5 A;  1RES A;  3CZ6 A;  5HNH A;  1MBE A;  1HKS A;  4M6Y A;  1LE8 B;  1T8I A;  1FT9 A;  1G8X A;  1ZRC A;  5ICG A;  2JQ7 A;  1SVM A;  4LG0 B;  1KU3 A;  4IF4 A;  1ZAO A;  2R93 J;  1JT0 A;  2K9N A;  1D3Y A;  4M3G A;  4Q48 A;  2WB1 N;  3G2B A;  1WSU A;  1JUS A;  1XSV A;  2M8G X;  1HCR A;  2V1U A;  2HU9 A;  5EGO B;  1V3F A;  2EV6 A;  4C3I J;  3ZQG A;  1WJD A;  3FXK A;  2P7C B;  3PL8 A;  2A61 A;  1FSH A;  4BQO A;  4ENJ A;  5HS7 A;  2DFI A;  1SD7 A;  3KEQ A;  4RGX A;  3S93 A;  4BBS J;  3HSE A;  1G3T A;  1FNN A;  3CMA I;  1HSJ A;  2QQA A;  1HBX G;  1W4M A;  2W84 A;  2HFH A;  2A07 F;  3QYE A;  1NK2 P;  1T95 A;  2XPU A;  4HSR A;  3I4P A;  3T8R A;  3LSP A;  2BBY A;  3CMY A;  2QWW A;  1QGP A;  3KX2 A;  4Z6Y A;  1HDP A;  3FXL A;  1LPQ A;  2BVM A;  2UWM A;  3S2W A;  1TQP A;  5ED4 A;  2OV7 A;  2NVT J;  3CUQ B;  2GIV A;  3S1N J;  1VQ6 I;  2KHM A;  3OMY A;  1Y0N A;  2WY7 Q;  3FX3 A;  4NDL A;  1VQ5 I;  1J9I A;  1ULY A;  3GO5 A;  3LSI A;  1JHH A;  4MTD A;  1C0W A;  5EEG A;  3L2Q A;  2VQL A;  2YU9 J;  4UXN A;  3S14 J;  4MO7 A;  1MNE A;  1MJ9 A;  5TGT A;  1HKT A;  1TBX A;  2ISZ A;  4A3C J;  1T2K A;  1FJL A;  3TP0 A;  1IG7 A;  4CCO A;  1QQI A;  2NNY A;  3F8N A;  2RV8 A;  2GIZ A;  1W5C C;  5JFR A;  1QVT A;  4AD9 A;  1J75 A;  1FP1 D;  2CUE A;  2WA0 A;  4IHY A;  4I01 A;  1MIJ A;  3BTJ A;  3ELK A;  2R5Y B;  1IC8 A;  2KRC A;  3BR3 A;  1Q1V A;  5EG0 A;  4KYW A;  4CUG A;  1SVO A;  1A6I A;  1XC5 A;  3KET A;  5E1X A;  5ERI A;  1H9G A;  3VYR B;  4WK8 F;  2BXY A;  3OV8 A;  1W1W E;  3RQ4 A;  1WQ2 A;  2QQB A;  1GUU A;  4JOM A;  5CLS A;  3LA3 A;  4ZTJ A;  3QP5 A;  2DFH A;  3IWF A;  2L7K A;  2DA3 A;  4HF0 A;  3FMR A;  4KFC A;  1YOV B;  2RN7 A;  2F6C A;  2H27 A;  5DM7 F;  1Y8Q B;  1AOY A;  2NVU B;  1R9T J;  3NWS A;  4MTE A;  2KQR A;  4A3B J;  1YJ9 I;  5CJ9 A;  3KP2 A;  3DTI A;  2VLA A;  2Z16 A;  5H6R A;  1QO0 D;  1JKR C;  2IBD A;  3HEF A;  3BTC A;  4HOB A;  3W6J B;  4G7Z F;  3CF2 A;  4P1W A;  4AYB N;  1VQ4 I;  1VQ9 I;  4I6Z A;  3DCF A;  3M8F A;  3WTS C;  3O8G A;  4UVA A;  3PJR A;  1P9Q C;  2IGM A;  1S3J A;  4A3J J;  4QLC U;  1BC8 C;  1QPM A;  1ZLK A;  1UB9 A;  2FF4 A;  3OYA A;  1U9O A;  1IN8 A;  2HPI A;  1SD6 A;  3HKZ A;  5JR3 A;  3F23 A;  4XN3 A;  4U7B A;  3CF5 F;  2YU3 A;  4EGZ A;  1SMY F;  2LOO A;  2E19 A;  5C44 J;  2IS1 A;  3SXY A;  5K7H A;  5F0H A;  4YEJ A;  3BJ6 A;  3IHU A;  4AUX A;  5ILV A;  5IP6 A;  2A6T A;  1KU9 A;  2DDB A;  3KP7 A;  2A3S A;  2QBY B;  4X0G A;  4BDY A;  2ZXW H;  2P0W A;  3BT9 A;  3TOA A;  3OY9 A;  3PNV A;  1YX3 A;  2DMP A;  5EEH A;  1QNT A;  2QCO A;  1VQO I;  2RKH A;  4NHJ A;  4EJT A;  4HPQ A;  1R1T A;  2OCC H;  2ID3 A;  2HNH A;  1ZTR A;  3HBL A;  2DA4 A;  4ZDP A;  1YS7 A;  1LFB A;  3ZMS A;  2X6Y A;  3EPZ A;  5L3B A;  3KP5 A;  1KA8 A;  1XCB A;  4OU0 A;  3CME I;  4QWQ A;  1ZYR F;  4HV6 A;  2Y0M A;  2HWV A;  2UV1 A;  2DT6 A;  3SHF A;  3DBR B;  2DQR A;  1APL C;  1X1P A;  3DEW A;  2XVC A;  4MQ9 F;  4Y33 A;  2ME6 A;  2PJP A;  5DCF A;  1ZR4 A;  3BC8 A;  6PAX A;  5H20 A;  3SFI A;  2UUZ A;  3R61 A;  5JVT A;  5FLX Z;  1BA5 A;  1I5Z A;  3MKZ A;  4YEL A;  2CG4 A;  2P5V A;  4A93 J;  1LB2 A;  1ZQ3 P;  4NQW A;  5LGT A;  3EUA A;  1LUJ B;  4FT8 A;  2HVR A;  3ZCO A;  4E7H A;  3ABM H;  2A5W A;  3WTY C;  3DKW A;  2HQN A;  2EJR A;  4OWR B;  2V1D A;  4HDU A;  1OKR A;  1RR7 A;  2RQQ A;  2DPU A;  5KAF C;  3WTX C;  3EUH C;  2IAI A;  2M8E A;  5DUI A;  2F4O B;  1BM9 A;  2O03 A;  3V7R A;  4B47 A;  2LSO A;  3DPT A;  3PSF A;  5LLQ A;  3M4O J;  4YIF A;  1I27 A;  1T08 B;  2XDV A;  3F22 A;  2DK5 A;  2JRT A;  4D7M A;  2F5C A;  1IAW A;  3DEU A;  3KLN A;  1HOM A;  5FFZ A;  2XKO A;  5D6E A;  1I6H J;  2KFD A;  5DS9 A;  4ZYD A;  2M3A A;  3ZGK A;  3OL3 A;  1TW2 A;  2ZME C;  5D5X B;  4U0W A;  2BEO A;  5BNG A;  1SFU A;  4D0P A;  2L2O A;  2QEN A;  2MLK A;  3S17 J;  3C1D A;  1X1B A;  2OD5 A;  4B1R A;  4Q5S F;  2GLO A;  3IC7 A;  3C2B A;  4XR6 A;  3U21 A;  3GTJ J;  1Z05 A;  4HZF A;  5KAI C;  3RIR A;  1FIA A;  3JRA A;  2DU9 A;  3DF8 A;  4AU7 A;  1NHA A;  3GTO J;  3LA7 A;  2F4M B;  1WI3 A;  3GF2 A;  4XLH A;  3LFK A;  1KYW A;  2OF7 A;  4BY1 J;  4ZDO A;  3J81 K;  4FE7 A;  3F0C A;  2IW5 A;  1B59 A;  5E3M A;  1IN6 A;  2H8R A;  1W7P A;  4AIH A;  4DZP A;  3HOT A;  2FOW A;  4II2 A;  2QM3 A;  2XUB A;  3GFL A;  3WTV C;  3FXJ A;  2F5E A;  2J5O A;  2M45 A;  3PUF A;  4HEA 2;  2LLK A;  2CO5 A;  4RBO A;  1DU6 A;  3K4K A;  3LSK A;  2AXL A;  2LR8 A;  2Y0S A;  1BR2 A;  5K7Z A;  3QYF A;  2OUM A;  3QOD A;  4ON0 A;  1YIT I;  4EV0 A;  3S1Q J;  2G7U A;  4OIR F;  4B43 A;  4ZZD A;  1D5V A;  5E18 F;  2DDA A;  1KON A;  2P81 A;  5DD8 A;  1HW1 A;  2Z2S B;  3HUG B;  2GA1 A;  3DPU A;  2HZD A;  3UNG C;  3I4M J;  2AHQ A;  4FAS D;  1T56 A;  1BW6 A;  2QSG X;  2EQR A;  5GPC A;  3N97 A;  1YLF A;  3BG3 A;  3ABL H;  4M71 A;  2JUC A;  3BPV A;  1YS6 A;  3H1C A;  2YUS A;  2TDX A;  5D4R A;  4X1E A;  3IV5 A;  5F64 A;  2FD5 A;  4ZC3 A;  4HLY A;  1O7L A;  2IJL A;  2QF7 A;  1O3R A;  3MAJ A;  1R4M B;  2XGD A;  3MEX A;  2QEX I;  2H6B A;  5E3O A;  3AAF A;  1QRY A;  4J01 A;  2HEO A;  1MMN A;  2PMZ N;  3VOD A;  2KRH A;  1NK3 P;  1E3H A;  3ERM A;  2R7F A;  2IRF G;  2DYS H;  1LVK A;  3U1K A;  2HOE A;  3E97 A;  4HNV A;  1VQL I;  2WAF A;  3E5U A;  3FK7 A;  4PSX A;  4HBL A;  3H9Q A;  5FGM A;  2O0Y A;  5FKN A;  4BXU A;  5J47 A;  1TW3 A;  2HTJ A;  2F5F A;  5KNL A;  1A04 A;  4M3F A;  4AYB A;  5J40 A; 
#chains in the Genus database with same CATH homology
 2GA2 A;  3ECO A;  2OAZ A;  1R23 A;  3I64 A;  1MDM A;  1UHM A;  4RB0 A;  2FRH A;  1S29 A;  2EWN A;  2KIM A;  1U2W A;  3E3V A;  3OOP A;  4Q4Z F;  1Y0U A;  2FQ3 A;  1FBU A;  5BS6 A;  4BH9 A;  4MEX F;  2HZT A;  1R22 A;  3QU3 A;  2DPD A;  2W57 A;  4HAM A;  3P9C A;  3SFZ A;  5LHH A;  3H3U A;  4DNC A;  1XSD A;  4A12 A;  3JW4 A;  2CGP A;  3RJP A;  2O3F A;  2YR2 A;  2LF7 A;  2D1V A;  3CJN A;  1RUO A;  2OZ6 A;  4EQQ A;  3EQL F;  3RTR A;  4G6D A;  4A5N A;  1YFH A;  5K5O A;  4OIO F;  5L3F A;  4GCV A;  3K0L A;  3M7G A;  3VB2 A;  4IHT A;  4PGG A;  3B73 A;  2QYO A;  1ZG5 A;  1BI3 A;  3Q9S A;  3L09 A;  1IW7 F;  1KYZ A;  1EV7 A;  4HA8 A;  4O3M A;  4RS8 A;  2HKO A;  3RKY A;  1YQA A;  2Z3Y A;  5E8G A;  4CYD A;  5TRD A;  2ZKZ A;  3I71 A;  1PUE E;  4HQE A;  1QZY A;  5HDK A;  1SD5 A;  4ZYH A;  1I1G A;  3J80 Z;  1I1S A;  1IUY A;  1VTN C;  1FBQ A;  2VN2 A;  5IT3 A;  4YII A;  5HDN A;  2CYY A;  2CSO A;  3TGN A;  2P5K A;  5FFX A;  1IZ1 A;  3FZV A;  3HIF A;  4HF2 A;  3FF5 A;  4A2U A;  2FMY A;  4BQA A;  3GZ6 A;  2XAG A;  2K02 A;  3V7C A;  3IL2 A;  5LRS A;  4EJV A;  3MZH A;  4KA4 A;  3EUH A;  2RC4 A;  3R6S A;  3ABU A;  3IKV A;  4Y15 A;  3L00 A;  3E5Q A;  4RB1 A;  1JE8 A;  1FC3 A;  1KU7 A;  5DUK A;  5HLG A;  2NNN A;  1KU2 A;  2IPQ X;  1LDK B;  3RKX A;  2Z33 A;  2XIG A;  3G3Z A;  1LDJ A;  1B6A A;  2OBP A;  3F3X A;  1IN7 A;  1GXQ A;  3WU0 A;  4F7Z A;  1O57 A;  3RKW A;  3I58 A;  5FLX K;  1REP C;  4Y13 A;  4BHP A;  3TKY A;  3LST A;  3F6V A;  4OIP F;  3TQN A;  1K6O A;  3KCC A;  1U8R A;  2E1C A;  2VOD A;  3BJO A;  2CW0 F;  4CO8 A;  4FX0 A;  1FLI A;  4BAY A;  3IKT A;  1ON2 A;  2K27 A;  5D5V B;  3V8K A;  3EDP A;  2VOO A;  2K86 A;  2WC2 A;  1DUX C;  2X4H A;  5IT9 Z;  3GFI A;  2DI3 A;  3ML6 A;  2Q8K A;  2V9V A;  2RNJ A;  3E6C C;  1XCV A;  2W24 A;  4IRI A;  5D5W B;  5K1Y A;  1F9N A;  1P6R A;  4HQM A;  3BDD A;  3Q9V A;  2FU4 A;  4KIC A;  2CFX A;  2P7V B;  3RYP A;  1FWZ A;  1W7P B;  1FPQ A;  2MH9 A;  2E7X A;  3CUQ C;  2Z99 A;  3F6O A;  1R7J A;  3VOE A;  2H6C A;  1ZAR A;  4N9I A;  4EJU A;  5BOX A;  1U5T A;  2OQG A;  4LK0 F;  1Z7U A;  2VBW A;  3O3K A;  2PLY A;  3WTW C;  2ZO4 A;  5DCM A;  1WI9 A;  4A6E A;  4KNY A;  3LAJ A;  1R5G A;  3GXO A;  5LRR A;  4EJO A;  3QPH A;  3K1N A;  2H09 A;  2FNA A;  3GVA A;  3W6K B;  4UV9 A;  1YTY A;  3G73 A;  3KZY A;  4ENK A;  3HHG A;  2FNP A;  3T1B A;  4A6D A;  2GXB A;  4LD5 A;  2V1X A;  2XAH A;  3IWZ A;  1TNT A;  5AIP A;  2X0L A;  3HRU A;  4UUV A;  4L0Z B;  2L4M A;  2O61 A;  2OQR A;  2PI0 A;  1GHC A;  5ILS A;  5CVR A;  3T0Y A;  1WKM A;  3ZN1 A;  2HS5 A;  5CYV A;  4N0B A;  1J59 A;  4FX4 A;  1MDM B;  2HQR A;  3FMS A;  3HOS A;  3WU1 B;  4MQV A;  2A6H F;  4MNU A;  3WGG A;  5K5R A;  3O6B B;  2FEZ A;  3ZMZ A;  3MZY A;  4ESJ A;  5A2Q K;  4YG2 F;  1RNL A;  1FP2 A;  5ICF A;  2HTS A;  2CQK A;  1UHW A;  5BMZ A;  1R5H A;  3TDU C;  3ROU A;  4YFX F;  2M87 A;  3GZ5 A;  4L18 B;  2YX4 A;  3QAH A;  4OMZ A;  4PZJ A;  4M9S A;  3D0S A;  3LQQ A;  3U9G A;  3MFK A;  4OMY A;  4CHU A;  3EET A;  1Z91 A;  3FM3 A;  1SMT A;  1ZGA A;  1SAX A;  1R00 A;  4AVP A;  2XAQ A;  2LDU A;  3H3Z A;  3ZMV A;  2PEX A;  4EVI A;  4ZZL A;  4ZYE A;  3WTZ A;  2C6Y A;  2JT1 A;  4LLN A;  2XAJ A;  1B9N A;  3REO A;  3GEZ A;  4MEY F;  4P9U A;  1UFM A;  5HVQ C;  1BI1 A;  4ZYG A;  5F6F A;  1DDN A;  1BN5 A;  5DEQ A;  1LVA A;  5CVI A;  4U88 A;  3ZQ7 A;  1ZRD A;  3DFG A;  3COA C;  2O6G E;  4GO1 A;  4OIN F;  1Q1H A;  4HX8 A;  1TTY A;  3R4K A;  3I59 A;  4KIB A;  2DO7 A;  5J8C A;  1K78 A;  2D2W A;  4OOI A;  3R60 A;  2P8T A;  3C7J A;  1EH8 A;  2R3S A;  4B8X A;  1TNS A;  4MGR A;  5DV5 A;  2VE9 A;  3ZN0 A;  2HYG D;  2VC0 A;  4LLG F;  2YPR A;  1USS A;  1S8N A;  1GVJ A;  1LEA A;  2P5L C;  2PN6 A;  3M8E A;  4A0Y A;  3H92 A;  4O6J A;  1YYV A;  2HKX A;  5BPD A;  4RAY A;  3BJA A;  2IT0 A;  2V6C A;  3U2R A;  3FXQ A;  3QOP A;  2EFP A;  2LNB A;  2EB7 A;  2HYF A;  1U6G A;  4PCQ A;  2P4W A;  4HV5 A;  4XSX F;  5D8L B;  1W7P D;  2FBK A;  4Q47 A;  2MD5 A;  3HSR A;  3E5X A;  1AWC A;  1YIO A;  3L7W A;  2IA2 A;  5FD6 A;  1BOA A;  4K2E A;  2WV0 A;  3LWF A;  2XHK A;  3HRM A;  4LK1 F;  2KJB A;  2D45 A;  1FX7 A;  2ELH A;  5KK1 A;  2EFQ A;  1IRF A;  1ODD A;  2ESH A;  3MQ0 A;  4IRH A;  1YW7 A;  2F2E A;  5E1Z B;  3CUQ A;  2EFO A;  1IN4 A;  3PQJ A;  2VBX A;  1R36 A;  1HST A;  5IT9 K;  4CXF A;  4I98 B;  2VBY A;  1BIB A;  2OZU A;  2QLZ A;  4ASN A;  2LKP A;  1XMK A;  3QPT A;  4L9J A;  2OA4 A;  4AWX B;  1G4D A;  2EA4 A;  2G7H A;  3V4G A;  4LJZ F;  3RYR A;  3GFM A;  2EFW A;  5D8K B;  3QP6 A;  4HF1 A;  4HYE A;  4P96 A;  4WCG A;  5D4S A;  1B1B A;  4UVC A;  2DW4 A;  3KEO A;  4BHB A;  1MJB A;  2EV0 A;  1ZG1 A;  3CUO A;  1U5T B;  4NB5 A;  3BZ6 A;  5K5Q A;  3K1M A;  3ZMD A;  1PDN C;  5DCM B;  3RDI A;  2K4J A;  2EFN A;  1O7F A;  2YX7 A;  1XGO A;  1HQC A;  2ZBK A;  3E6D A;  3IRQ A;  1ZRF A;  2DLL A;  3E6B A;  2L3D A;  5F1R A;  3F21 A;  3TOB A;  1YG2 A;  4U7D A;  5L3D A;  3BP8 A;  5FD5 A;  1G3W A;  4L9N A;  3K69 A;  1R1V A;  1KGS A;  3FHZ A;  1I6X A;  3HSF A;  2L02 A;  1MD0 A;  3ZMU A;  5AIQ A;  1OYI A;  2IA0 A;  3V8L A;  5CVV A;  5LEJ A;  5HOO A;  4IRG A;  1EH7 A;  4PGH A;  1ZHF A;  3HHH A;  4RGR A;  5L3G A;  3CLO A;  1XGN A;  3DXJ F;  3I53 A;  3GWZ A;  1CF7 A;  4ENM A;  1ZG3 A;  3HTU A;  4LB6 B;  2JSC A;  3K1P A;  1JXS A;  1J5Y A;  3FMQ A;  1P92 A;  5ICE A;  3HTS B;  3CO6 C;  4OIQ F;  3WE3 A;  4KT5 C;  3WTU C;  1FOK A;  2NRA C;  3T8T A;  4M6X A;  1LQ1 A;  1FYM A;  4S04 A;  5FO5 A;  5AON A;  3GUD A;  3GX4 X;  1LEB A;  2MH2 A;  4TV7 A;  3C3W A;  1Z6T A;  3PFI A;  3J81 Z;  2VT2 A;  5HLH A;  2PQ8 A;  3B02 A;  4Z2Y A;  1W5T A;  3ZMT A;  2ZME A;  3R0A A;  2QVO A;  3JAM Z;  1BC7 C;  4G6Q A;  1J2X A;  1RIO H;  4ESB A;  4KMF A;  4JBA A;  4EGY A;  3J7A O;  2GXG A;  2FA5 A;  2QUF A;  3F8B A;  3N4M A;  1XD7 A;  2COM A;  5D6F A;  3RPU A;  5DD4 A;  5E1W A;  3JTH A;  1E17 A;  2LF8 A;  3I59 B;  1R1U A;  4FHT A;  1G6N A;  1K78 B;  2DK8 A;  1FYL A;  4I0A A;  2EV5 A;  2YSR A;  2P6T A;  1IXC A;  4PDK A;  2QQ9 A;  3JSP A;  1UCR A;  2BV6 A;  1ZH5 A;  4RAZ A;  4L9T A;  1T98 A;  1IXS B;  5J8F A;  4JK1 X;  4KN7 X;  3TO9 A;  5D5U B;  4LGW A;  4HX4 A;  1XGM A;  3DPL C;  3WTT C;  2E1N A;  1L3L A;  3NRV A;  4A0X A;  1K7A A;  4GYI A;  3F8C A;  3I0T A;  4UNO A;  1OYY A;  2Y75 A;  1W5S A;  2IP2 A;  4EM0 B;  1XDU A;  2GWR A;  4YFK F;  2M30 A;  2L01 A;  4U0Y A;  3P7N A;  4ENN A;  1E2X A;  2FBI A;  1S7A A;  4R8H A;  4HDV A;  1XMA A;  1CGP A;  1QBJ A;  4P55 A;  2HR3 A;  1LDD A;  5BPI A;  4B09 A;  5ILU A;  5DYM A;  1GXP A;  3PQK A;  2MA3 A;  2Q0O A;  3WE2 A;  4UVB A;  3BOQ A;  3FM5 A;  2NYX A;  1R58 A;  5HLI A;  3FXR A;  1OYW A;  4XRF A;  3JSO A;  4U0V A;  3M9A A;  4GXO A;  2ZXJ A;  1T0F A;  3IRR A;  1HXD A;  4O5V A;  2IVM A;  2NS0 A;  1XN7 A;  1JHF A;  2DAO A;  3L2C A;  5HS8 A;  2Q2E A;  3ABT A;  1L0O C;  3TO7 A;  3I5U A;  3SQN A;  2FBH A;  3CDH A;  1J0R A;  5LGU A;  5ICC A;  4LB5 A;  4H0E A;  2L54 A;  2B0L A;  3MCZ A;  4IPA A;  2DQL A;  1WRJ A;  2XGX A;  3BPX A;  4Y17 A;  2E7W A;  2BYV E;  1LNW A;  3U1D A;  1RI7 A;  4L5I A;  3LAP A;  4IJA A;  3I54 A;  2UZK A;  1DPR A;  4L5J A;  4KIF A;  1G3S A;  4IVN A;  3VFZ A;  1SFE A;  2STT A;  1H9T A;  1UST A;  2RVC A;  3V8J A;  4P5O A;  4AIK A;  1HW5 A;  1HKQ A;  5J6X A;  1V4R A;  1SD4 A;  4G7H F;  1XDS A;  4EM2 A;  2NAZ A;  4EJW A;  4L0Y B;  2EK5 A;  2Y48 A;  5H6Q A;  2GQQ A;  4M73 A;  2ZCW A;  3EYY A;  2FOK A;  3KLO A;  3LA2 A;  5TJJ A;  2FE3 A;  1ON1 A;  3FWE A;  4KIG A;  2WTE A;  4MHG A;  3HYI A;  2W25 A;  1P4X A;  2W85 A;  1D8J A;  2MLG A;  4G8X A;  3KP4 A;  4ZH4 F;  3DQV C;  1RUN A;  2JTV A;  4BHC A;  3F72 A;  3J80 K;  1Z6R A;  3ULQ B;  1CF7 B;  5KVR A;  4A5M A;  1OMI A;  4GGG A;  4I0B A;  5FB2 A;  2ZFW A;  1P2F A;  2RDP A;  2XRO A;  2PG4 A;  2ZJ2 A;  1JGS A;  2JZY A;  1TQM A;  2XRN A;  2JPC A;  5LHG A;  1S6L A;  1YO5 C;  3ZPL A;  2VT3 A;  2A5Y B;  4I09 A;  2Z9O A;  1DPU A;  1IRG A;  4EM1 A;  4R79 A;  3RI4 A;  2A69 F;  4ETS A;  2QZ8 A;  3L9F A;  4LMY A;  1QZZ A;  4M9Z A;  1BBY A;  2XKP A;  3CO7 C;  3M1E A;  1HW2 A;  4P9F A;  1FBS A;  3F8F A;  2OU2 A;  3V7S A;  1XB4 A;  5LEK A;  3KFW X;  2ZME B;  1Z1D A;  2DBB A;  4LG0 A;  3ECH A;  1X3U A;  1BI0 A;  2HGC A;  3JAM K;  3LQR A;  1ZLJ A;  2WWY A;  1IXR C;  4ESF A;  1OPC A;  1D8K A;  1STZ A;  4L9V A;  3E6M A;  4RGU A;  4E70 A;  1Z9C A;  3CTA A;  3SZP A;  5HDG A;  3WOD F;  1T38 A;  2L4A A;  1T6S A;  2PBI A;  1KQ9 A;  1MKM A;  4DQ2 A;  1T39 A;  1KQ0 A;  3TO6 A;  1F4K A;  2KIU A;  5JI6 A;  2M1B A;  2VON A;  3KZZ A;  4BNC A;  1TLH B;  2JPB A;  4RB2 C;  3T5X A;  2XAF A;  2XV4 S;  1KQ8 A;  3WGH A;  1DP7 P;  2PMH A;  1SFX A;  4HX7 A;  2KIF A;  1F5T A;  1U5T C;  1OR7 A;  2FSW A;  2J5P A;  3WG9 A;  3GW2 A;  4I2O A;  4XSZ F;  3MWM A;  2G9W A;  5A2Q Z;  1MZB A;  4WXH A;  5HS9 A;  2AS5 F;  4M9X A;  2FML A;  4G9Y A;  4YFN F;  1BIA A;  4M72 A;  1O3T A;  4IXA A;  2ADU A;  4GYG A;  3BY6 A;  4JQF A;  2BE5 F;  2P6S A;  3DV8 A;  1IF1 A;  4BYY A;  1LJ9 A;  2QBY A;  1BJA A;  3QU6 A;  1F1Z A;  4R1H A;  2ZNY A;  3GYH X;  2ISY A;  4UHT A;  1FY7 A;  4XLN F;  4IHS A;  4RGS A;  3HRT A;  3P9K A;  3NEU A;  1ZN2 A;  2GZW A;  1O3Q A;  1RZ4 A;  3C18 A;  3WGI A;  5LHI A;  3HRS A;  2D1H A;  1BI2 A;  2IA1 A;  1P4W A;  2KKO A;  1G3Y A;  2RQP A;  3GFJ A;  1O3S A;  1YW9 A;  4G94 A;  2UXX A;  2DT5 A;  3O2P E;  4KDP A;  2MC3 A;  4HW0 A;  4HLX A;  2KJC A;  2KRF A;  5LBQ A;  4LFU A;  2VXZ A;  1ZGJ A;  1XGS A;  2BGC A;  2MBF A;  3NQO A;  4I7H A;  4XLP F;  2F5D A;  2EA2 A;  1PP7 U;  2XAS A;  2PMU A;  2A68 F;  4S05 A;  4KN4 X;  5L3C A;  3P9I A;  4EMS A;  2R7D A;  4CIC A;  4LLL A;  5LGN A;  3SZT A;  4RB3 C;  3BRO A;  1PP8 F;  2VBZ A;  2K4B A;  1ONV A;  5E17 F;  5DDG A;  1XSX A;  3BWG A;  3DP7 A;  2PFB A;  1U78 A;  3KP6 A;  4KMU X;  4WXC A;  2ACJ A;  2CWE A;  2STW A;  3QRF F;  5CVJ A;  2K7L A;  4CZZ A;  2H94 A;  2M5W A;  1B4A A;  3D5L A;  3F8M A;  2GAU A;  4M74 A;  2VC1 A;  2O8X A;  1FZP B;  4N9H A;  3HUG A;  1S7O A;  5CVU A;  5BQT A;  4CGZ A;  2FXA A;  3RPQ A;  2ZNZ A;  4I02 A;  1FYK A;  3ERE D;  4CDG A;  1FSE A;  1IN5 A;  3KE2 A;  3TDZ C;  1B9M A;  4AIJ A;  3GLX A;  3JTG A;  1TQI A;  3KP3 A;  2A6E F;  3K9T A;  1YW8 A;  1J7K A;  1MJA A;  2UXN A;  4A0Z A;  3EYI A;  5L3E A;  4WX9 A;  5E20 A;  5E8I A;  4KUM A;  3R0J A;  3VEP A;  1U3E M;  4WF2 A;  3K2Z A;  2Z5U A;  5JHU A;  1EH6 A;  4UV8 A;  2DTR A;  1ZRE A;  2ETH A;  2ESN A;  3Q5F A;  3FXU A;  4WWC A;  4WXD A;  2VOP A;  2RGV A;  1P4A A;  3ISP A;  1WWX A;  2VE8 A;  2V79 A;  4XBF A;  1MGT A;  2HDC A;  1K79 A;  1H0M A;  4G7O F;  3ZP5 A;  1HKS A;  4M6Y A;  1FT9 A;  1ZRC A;  5ICG A;  4LG0 B;  1KU3 A;  4IF4 A;  1ZAO A;  1D3Y A;  4Q48 A;  1WSU A;  1XSV A;  2V1U A;  1V3F A;  2EV6 A;  2P7C B;  1FSH A;  2A61 A;  4ENJ A;  5HS7 A;  2DFI A;  1SD7 A;  3KEQ A;  4RGX A;  3HSE A;  1G3T A;  1FNN A;  1HSJ A;  2QQA A;  1HBX G;  1W4M A;  2W84 A;  2HFH A;  2A07 F;  3I4P A;  3T8R A;  2BBY A;  2QWW A;  1QGP A;  2UWM A;  3S2W A;  1TQP A;  5ED4 A;  3CUQ B;  2GIV A;  3FX3 A;  1J9I A;  1ULY A;  3GO5 A;  1JHH A;  4MTD A;  1C0W A;  5EEG A;  4UXN A;  1MJ9 A;  1HKT A;  1TBX A;  2ISZ A;  1T2K A;  1QQI A;  2NNY A;  3F8N A;  2RV8 A;  5JFR A;  4AD9 A;  1J75 A;  1FP1 D;  4I01 A;  3ELK A;  4KYW A;  3KET A;  5E1X A;  5ERI A;  1H9G A;  4WK8 F;  3OV8 A;  1WQ2 A;  2QQB A;  5CLS A;  3LA3 A;  3QP5 A;  3IWF A;  4HF0 A;  4KFC A;  3FMR A;  2RN7 A;  2H27 A;  1AOY A;  4MTE A;  5CJ9 A;  3KP2 A;  5H6R A;  1QO0 D;  3W6J B;  4HOB A;  4G7Z F;  3WTS C;  3M8F A;  4UVA A;  1S3J A;  4QLC U;  1BC8 C;  1QPM A;  1ZLK A;  1UB9 A;  2FF4 A;  1IN8 A;  1SD6 A;  5JR3 A;  3F23 A;  4U7B A;  2YU3 A;  4EGZ A;  1SMY F;  3SXY A;  3BJ6 A;  3IHU A;  5ILV A;  1KU9 A;  3KP7 A;  2A3S A;  2QBY B;  3TOA A;  5EEH A;  1QNT A;  2RKH A;  4NHJ A;  4EJT A;  1R1T A;  1YS7 A;  3ZMS A;  5L3B A;  3KP5 A;  1KA8 A;  1XCB A;  4OU0 A;  4QWQ A;  1ZYR F;  4HV6 A;  2Y0M A;  2HWV A;  3SHF A;  2DQR A;  4MQ9 F;  2XVC A;  2PJP A;  5DCF A;  6PAX A;  5H20 A;  3R61 A;  5JVT A;  5FLX Z;  1I5Z A;  2CG4 A;  2P5V A;  1LB2 A;  4NQW A;  5LGT A;  4FT8 A;  4HDU A;  3WTY C;  3DKW A;  2HQN A;  2EJR A;  2V1D A;  1OKR A;  2DPU A;  3WTX C;  2M8E A;  5DUI A;  1BM9 A;  2O03 A;  3V7R A;  5LLQ A;  2LSO A;  3DPT A;  4YIF A;  1I27 A;  3F22 A;  2DK5 A;  2JRT A;  2F5C A;  1IAW A;  3DEU A;  3KLN A;  5FFZ A;  2XKO A;  5D6E A;  4ZYD A;  1TW2 A;  5D5X B;  4U0W A;  2BEO A;  1SFU A;  4D0P A;  2QEN A;  2MLK A;  3C1D A;  2OD5 A;  4Q5S F;  3IC7 A;  1Z05 A;  4HZF A;  3RIR A;  2DU9 A;  3DF8 A;  1NHA A;  3LA7 A;  3GF2 A;  3LFK A;  1KYW A;  3J81 K;  2IW5 A;  1B59 A;  1IN6 A;  1W7P A;  4AIH A;  3HOT A;  2QM3 A;  2XUB A;  3GFL A;  3WTV C;  2F5E A;  2J5O A;  2M45 A;  2CO5 A;  2AXL A;  4ON0 A;  4EV0 A;  2G7U A;  4OIR F;  4ZZD A;  1D5V A;  5E18 F;  5DD8 A;  1HW1 A;  2GA1 A;  3N97 A;  1YLF A;  4M71 A;  3BPV A;  1YS6 A;  2TDX A;  5D4R A;  5F64 A;  4HLY A;  1O7L A;  2IJL A;  1O3R A;  3MAJ A;  3MEX A;  2H6B A;  3AAF A;  2HEO A;  3VOD A;  2R7F A;  2IRF G;  2HOE A;  3E97 A;  3E5U A;  4HBL A;  5FGM A;  2O0Y A;  4BXU A;  1TW3 A;  2HTJ A;  2F5F A;  1A04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...