4B8XA

Near atomic resolution crystal structure of sco5413, a marr family transcriptional regulator from streptomyces coelicolor
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
144
structure length
139
Chain Sequence
GVPSMAAITSIMRAQQILLGEVDAVVKPYGLTFARYEALVLLTFSKSGELPMSKIGERLMVHPTSVTNTVDRLVRSGLVAKRPNPGTLATITDKGREVVEAATRDLMAMDFGLGAYDAEEGEIFAMLRPLRVAAGDFDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Crystal Structure of Sco5413, a Widespread Actinomycete Marr Family Transcriptional Regulator of Unknown Function.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
molecule keywords POSSIBLE MARR-TRANSCRIPTIONAL REGULATOR
total genus 52
structure length 139
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4b8xA00
4MQ9F 1TBXA 1HSTA 5DEQA 3BJ6A 3CLOA 5K5OA 1R00A 4TV7A 2F5FA 2E7XA 2W25A 2CFXA 4MQVA 2VXZA 1REPC 4EV0A 1IN7A 3F72A 4F7ZA 2HWVA 2QQAA 2OAZA 2QVOA 1UHWA 1HKSA 3ZMZA 1ZG5A 4FX4A 3RYRA 1O3RA 3ROUA 1YW8A 2Z3YA 3LA3A 5ERIA 5DD8A 5D5UB 3EDPA 2RC4A 1QZZA 2CG4A 3C7JA 2ISZA 5EEGA 2QQBA 3C1DA 3JW4A 3RI4A 3PFIA 3V8JA 1LJ9A 4KIBA 4OIRF 1P6RA 2HYGD 4KT5C 1FBUA 4FHTA 2J5OA 1FSHA 3WGIA 4A12A 2QENA 3PQKA 4A0XA 4XRFA 2FU4A 4KIGA 2V1XA 4B09A 3KETA 1USSA 2F2EA 5LRRA 1W4MA 1F1ZA 4CYDA 1BI1A 4HQMA 2VE9A 1LDJA 2P7CB 2JRTA 2DT5A 2EFNA 4BYYA 2R3SA 1P4WA 1DP7P 2GXBA 2VOOA 2FXAA 3QAHA 2HEOA 2HTJA 1T38A 4I01A 3GF2A 5D6FA 3OOPA 2DI3A 3N97A 3I59A 3CO6C 3IL2A 1U5TA 3WE3A 4HLYA 1Z91A 4A6DA 4CGZA 1T2KA 2ESHA 2YPRA 4I0BA 2LDUA 4S05A 5BOXA 2YSRA 2XIGA 5L3CA 1D5VA 1LEAA 1LVAA 4Y17A 3M7GA 3V8KA 1U6GA 4MTDA 2E1NA 2DQLA 2A3SA 2V1DA 2DLLA 2HGCA 1J5YA 3LAPA 4B8XA 1I1GA 4EJWA 2ZJ2A 2VT3A 2IA0A 3GVAA 2IA1A 1GXQA 1FYLA 1ZHFA 4HF1A 3NQOA 5J8FA 4PZJA 3FM5A 4OOIA 5IT9K 1TNSA 5DYMA 1FYKA 4M74A 5JVTA 1BIBA 4ENKA 5HDGA 4BNCA 2FE3A 3JSPA 1XDUA 4KMUX 3F21A 5LGUA 4OIPF 3ZQ7A 2Q2EA 2ZO4A 4MEXF 2O0YA 4IJAA 3QPHA 2CO5A 1HBXG 3FF5A 2GAUA 3M9AA 1G3SA 3O2PE 1P2FA 2DAOA 4LJZF 2OZ6A 1P4XA 2ELHA 2QBYA 4L9TA 3CO7C 4PGGA 4LG0B 1DDNA 1FNNA 3FX3A 5ICEA 3ZMTA 1MD0A 1YIOA 2R7FA 5ICCA 4I0AA 3H92A 3DXJF 2ACJA 3DP7A 1X3UA 5A2QK 4WF2A 5E1WA 3TQNA 2EV0A 2P8TA 1IXSB 1U3EM 3MCZA 1LEBA 1Z05A 4Q5SF 1YTYA 1OYIA 1XMKA 1JHFA 2L02A 1ON2A 1R7JA 3T8RA 4OIQF 4HX8A 4WWCA 1O3SA 1FT9A 3TO9A 1S3JA 3SQNA 3COAC 4ESFA 2M8EA 4Q48A 4EJTA 2ZXJA 4HV5A 1HXDA 4GCVA 1XB4A 4E70A 3HRUA 2PJPA 1BM9A 1SFXA 1J7KA 3RTRA 1K78B 5CJ9A 1B59A 5D8KB 2EFWA 3LWFA 5FFZA 3ABTA 1B4AA 2P7VB 2PEXA 3B73A 3GXOA 5HS9A 1LNWA 3TGNA 2G7UA 1ON1A 4M6XA 5L3EA 4EGYA 3FXUA 3FMRA 2Z99A 1D8JA 4UXNA 2M87A 3RPUA 4N9IA 3EYYA 5HLIA 4GYGA 3DEUA 3IKVA 4R1HA 2ZCWA 3EUHA 4MHGA 3ABUA 2PG4A 1HKTA 2HYFA 3TKYA 1KYZA 2QUFA 3E5QA 2UXNA 3IRQA 2P5LC 4BXUA 4IHSA 3Q9SA 4KICA 2A61A 2A5YB 4HF0A 3KCCA 1TW3A 2O3FA 3ECOA 3WTYC 3I4PA 1YS7A 3OV8A 3O3KA 1JHHA 2DTRA 1K78A 2ZBKA 4L9JA 2EFQA 2UWMA 1V4RA 3AAFA 2ZNYA 2V1UA 3TOBA 4HDVA 5AONA 2HDCA 2XASA 3I64A 5D5WB 2VN2A 1MDMA 2H27A 4LMYA 5FO5A 1Z6TA 3F8FA 3K1PA 1IAWA 2FOKA 3WTSC 2K02A 5TJJA 2IPQX 4L9NA 1XSVA 2PN6A 3IWFA 1IN6A 3SFZA 3CJNA 5KVRA 5LEJA 2H6CA 5DCFA 1IN5A 3HSRA 1U78A 1U5TB 1L0OC 1Q1HA 4LLLA 2M45A 1KA8A 3QU3A 4O5VA 2EB7A 2OA4A 2HZTA 1ZRFA 2DQRA 4MNUA 4LLNA 2AS5F 5BS6A 3CUQB 4NB5A 5LHGA 4KDPA 3ZP5A 1K6OA 2P4WA 3N4MA 1Y0UA 4BHCA 4IRHA 3GWZA 3E5UA 2PBIA 2HS5A 2Y0MA 1TNTA 1XSDA 1HW2A 1Z1DA 1Z7UA 2Q0OA 3GLXA 2EA2A 4IVNA 4O6JA 2ZKZA 3DV8A 3FWEA 4EJUA 2A6EF 2XV4S 3F22A 5D8LB 2MH9A 1FYMA 4HLXA 3ISPA 5LGNA 1DPRA 4EGZA 5FB2A 5F6FA 2IA2A 2FF4A 3GFLA 4OMYA 2A6HF 2L01A 3J80K 1J59A 1F4KA 3CUQA 5H20A 2CGPA 1G6NA 5D5XB 4UVBA 4UNOA 1KU3A 1XDSA 2PI0A 4Q47A 4ZZLA 2FA5A 3G73A 5F1RA 1R5GA 2HFHA 2Z5UA 2STTA 2EV5A 3QRFF 1A04A 2XAFA 2Y48A 2X0LA 1U2WA 3BOQA 3E6DA 1IXCA 1LDDA 4ON0A 1FBQA 1CF7B 1C0WA 2DO7A 2HTSA 2WV0A 4OINF 2V9VA 1VTNC 4M72A 4AD9A 3J81Z 2RN7A 2XAHA 3HHGA 3HSEA 3QP5A 2LKPA 1XD7A 2JZYA 4MTEA 2L3DA 2RKHA 1TW2A 3WU1B 4QWQA 2QLZA 2UZKA 1HSJA 1GVJA 1FLIA 2IJLA 1OYWA 2XVCA 3U1DA 1LDKB 4CICA 3I53A 4EJVA 3L09A 3V4GA 5D5VB 3F8CA 1STZA 3L00A 3WG9A 2XKOA 3HRTA 4HBLA 1TQPA 5FD6A 1I1SA 2EWNA 2CQKA 2HOEA 3FHZA 4ENNA 3IC7A 4HX7A 1SD4A 5J6XA 3VODA 4YFXF 2ZNZA 1FP2A 5ICGA 1SD5A 2DW4A 4RGXA 1SD6A 3QU6A 4HF2A 1TQIA 2K7LA 3I5UA 4EVIA 4Z2YA 4GO1A 3M8FA 4RGUA 2FBKA 2KIMA 3KP3A 3FXQA 1IXRC 3HYIA 4JBAA 4A0YA 5D4RA 2C6YA 1V3FA 3D0SA 4RAZA 1U5TC 1UCRA 3RKWA 1ZN2A 4U0YA 5LHIA 2O6GE 4IHTA 2JT1A 4ENMA 3E6MA 2D1VA 4U7BA 5CVJA 1WSUA 1OYYA 3HOTA 2VC0A 3ELKA 4R8HA 3K2ZA 1R1TA 5HLGA 2E7WA 4RGRA 2Q8KA 3W6JB 1KU7A 2LSOA 3FMSA 1P4AA 2F5DA 1D3YA 3JSOA 1J0RA 4A5NA 5HVQC 4L18B 2V79A 4M9SA 2J5PA 5AIQA 3FM3A 3GX4X 2FQ3A 2FNAA 3QOPA 1BC7C 1ZH5A 1WWXA 4HW0A 4ZYEA 1XGNA 2GQQA 3G3ZA 1OMIA 3E5XA 3MEXA 3E6CC 3VEPA 1CGPA 3GW2A 4YG2F 3TO6A 3DFGA 4G6QA 3KP6A 1HKQA 4G94A 2O8XA 5FLXZ 2B0LA 1USTA 2CW0F 3REOA 2WWYA 2COMA 3RPQA 3Q5FA 2NYXA 3F6VA 3K1MA 4GXOA 3CDHA 3LA7A 1IUYA 2K4JA 4OIOF 4LK1F 2CYYA 3HIFA 4OMZA 1YS6A 4L9VA 2K4BA 3WGHA 3JTGA 3R4KA 5K5RA 1ZYRF 3HHHA 4CHUA 4HAMA 5HLHA 1IN4A 2FSWA 4ZZDA 1RUNA 4UV8A 4ZYGA 2M30A 2O61A 4G8XA 5JHUA 1T6SA 3JAMZ 3WTTC 2MD5A 3QPTA 4KN7X 4L5JA 1SD7A 5TRDA 1LQ1A 3MAJA 1SMYF 1IZ1A 5ICFA 2FMLA 4AVPA 4FT8A 3E6BA 2K86A 2GIVA 2QQ9A 2O03A 4KIFA 1O3TA 4ZYHA 2YU3A 1DPUA 2QYOA 5D4SA 2GZWA 1Z9CA 3RKYA 4OU0A 5DV5A 1SAXA 1CF7A 4KNYA 2FEZA 4PGHA 1O7FA 1P92A 2VBYA 4LFUA 4CO8A 4YIIA 2ZMEB 1O3QA 4ZH4F 1H9TA 2DK5A 3NEUA 4N0BA 4WX9A 5FGMA 1ZREA 4NQWA 1KQ0A 4EM2A 4BHBA 3T0YA 2NNNA 1ZLKA 2MA3A 2IW5A 3GZ5A 2W57A 1XGMA 1KU2A 1K7AA 3FMQA 1B6AA 5EEHA 2WC2A 4P9FA 3GFJA 2MLKA 3C18A 3ZMDA 5A2QZ 4GYIA 2Z9OA 4FX0A 3IRRA 2ADUA 2MH2A 3Q9VA 5DUKA 5BPDA 3R0JA 2G9WA 1FBSA 3O6BB 2P6TA 2MC3A 1QQIA 1ZGAA 1MZBA 3C3WA 3H3UA 4XSXF 5KK1A 4WXDA 5CVVA 1W7PD 2TDXA 2DU9A 4G9YA 2JTVA 2PLYA 5E20A 1T0FA 4QLCU 1G3TA 4ZYDA 1W5TA 3GO5A 5HS8A 1OPCA 3RKXA 2HQNA 1YQAA 2L54A 3LA2A 4M9ZA 3RDIA 3JTHA 5HDNA 4RB2C 3SZPA 1IF1A 2NS0A 2W85A 1SFUA 2OQGA 3T8TA 4M71A 3NRVA 3R60A 4WK8F 5CVRA 1PP8F 3IHUA 3FXRA 2FBHA 2V6CA 4MEYF 4ESJA 4P5OA 5L3DA 5LRSA 1IW7F 2VT2A 2RDPA 1W7PA 4UVAA 4BQAA 4K2EA 4LD5A 3KLOA 1IRFA 4BAYA 5J8CA 4WXHA 1MJBA 2P6SA 4YFKF 5DCMA 3K9TA 1BN5A 3R0AA 2A68F 3SZTA 5CVIA 4IPAA 4HDUA 2FBIA 5H6QA 1FC3A 1OR7A 1W7PB 4CXFA 4BH9A 4U7DA 2D1HA 2JPCA 1QO0D 1WI9A 2CWEA 4HA8A 5LHHA 4I09A 1KQ9A 5LLQA 3GEZA 3K69A 3IWZA 1SMTA 3F8NA 2X4HA 5L3FA 4IRGA 3R6SA 3TO7A 3P9IA 1ZG1A 3ECHA 2KRFA 1BI2A 1ZARA 4EJOA 4LB5A 3K0LA 2DFIA 2F5CA 3S2WA 4L5IA 3U9GA 3WODF 1UFMA 1RI7A 2JSCA 3LFKA 2LF8A 2VE8A 2EFPA 5CLSA 5LEKA 3SHFA 2D2WA 1PP7U 2XROA 1MKMA 4EQQA 4G7OF 3CUQC 3F23A 3J81K 1S8NA 1FY7A 1R22A 4JQFA 2H94A 5HOOA 1XN7A 3TDUC 1QZYA 2NRAC 2BV6A 2IRFG 1XSXA 3BPVA 4WXCA 3DQVC 5ILSA 4I2OA 1HW1A 4M9XA 2OU2A 1K79A 5BQTA 2DK8A 1HQCA 2QBYB 5JFRA 1OKRA 4S04A 1H0MA 2XAGA 2KKOA 2YX7A 2BGCA 2GA2A 2XHKA 3ULQB 3WGGA 1YW7A 4U88A 4Y13A 4A5MA 4CZZA 1WKMA 3ZN1A 3BDDA 2IVMA 1FZPB 4DNCA 2BBYA 3J7AO 3WU0A 2A07F 5FD5A 1J9IA 2NNYA 3R61A 3VFZA 5AIPA 1ODDA 4ETSA 2UXXA 5ED4A 1FX7A 1BJAA 1EH6A 2Y75A 3SXYA 1RUOA 3WTUC 2XUBA 1UB9A 1EH7A 3ZMVA 4AIKA 2KJBA 3LAJA 2QZ8A 1XGOA 1QGPA 1KGSA 2VODA 5LBQA 4HX4A 1I6XA 3WTWC 1XMAA 1JGSA 3U2RA 3WTXC 1R23A 2FRHA 3KP5A 4G7ZF 2A69F 5HDKA 2NAZA 4ESBA 2RGVA 5K5QA 1BBYA 1WRJA 1PUEE 4L0YB 1RZ4A 3I54A 3HTSB 3JAMK 4P55A 3V8LA 1XCVA 4KYWA 3ZMUA 3RYPA 5E8GA 2L4AA 2P5VA 1KYWA 3T5XA 4AWXB 2XRNA 3P7NA 4AIHA 2H6BA 4RB0A 1YLFA 2ZFWA 2OZUA 1FP1D 1EH8A 2WTEA 3F8BA 4YFNF 4LLGF 3V7RA 3B02A 4LK0F 2OBPA 1D8KA 5E17F 2HKXA 3RJPA 1RNLA 2GXGA 3GYHX 3BZ6A 5IT3A 5FFXA 4N9HA 5DUIA 2VC1A 4IXAA 5IT9Z 1Z6RA 3GFIA 4MGRA 1J2XA 4A6EA 1B9NA 3DPLC 3ML6A 4UVCA 1ZRCA 2ESNA 3HOSA 5CYVA 2OD5A 5ILVA 2MBFA 1R5HA 5E1XA 2DPDA 2ETHA 1KQ8A 2IT0A 3VB2A 4RAYA 2FMYA 2GWRA 1F9NA 5LGTA 1QPMA 3ZN0A 5CVUA 1GHCA 4IRIA 1R58A 4PCQA 1MGTA 3KFWX 3KE2A 4U0VA 3F6OA 4P96A 3BP8A 1S29A 3DPTA 2YR2A 3I59B 4UHTA 1B9MA 3TOAA 1IN8A 4KFCA 1YW9A 4LB6B 1BIAA 3L7WA 2ISYA 3L9FA 5E8IA 4EMSA 1R1UA 2FNPA 3WTZA 1JXSA 2YX4A 4KN4X 2ZMEA 3WTVC 4G7HF 5BPIA 4CDGA 3K1NA 1YYVA 2VBZA 2P5KA 5JI6A 4XLNF 3LQRA 2M1BA 3EQLF 3GUDA 4HQEA 2VBWA 1QNTA 1MDMB 1H9GA 2XGXA 5L3BA 2RV8A 4Q4ZF 3W6KB 1EV7A 2R7DA 3MWMA 1F5TA 4L0ZB 1AOYA 1RIOH 3KLNA 1GXPA 5BMZA 3KZZA 3BROA 2K27A 1LB2A 4Y15A 3M8EA 1AWCA 2M5WA 1FPQA 4RS8A 3MZHA 4GGGA 4HV6A 2JPBA 3V7CA 2VBXA 1ONVA 4UV9A 3LQQA 5HS7A 2E1CA 3HRSA 2XKPA 4XSZF 3P9KA 2W24A 1XGSA 1JE8A 3DF8A 1ZRDA 2VONA 3V7SA 5DD4A 2H09A 1E17A 3KP4A 4ENJA 3VOEA 1S7OA 4P9UA 3WE2A 1ZAOA 5DCMB 2L4MA 3I0TA 4M6YA 2F5EA 2DPUA 1MJAA 4JK1X 1HW5A 1T39A 3RIRA 2CSOA 3ZMSA 2RQPA 2HR3A 3ERED 2PQ8A 1S7AA 2EA4A 3KZYA 5FLXK 3MZYA 4EM1A 1NHAA 1DUXC 3D5LA 2AXLA 1YG2A 3HTUA 2LNBA 2LF7A 1G4DA 2KIFA 1TQMA 1FWZA 2BEOA 3L2CA 2HQRA 5H6RA 2EFOA 4KA4A 1I5ZA 4DQ2A 4XBFA 2QM3A 3CUOA 1I27A 3HSFA 4YIFA 4UUVA 3KP2A 3BJAA 3KEOA 2RVCA 3T1BA 3IKTA 3H3ZA 6PAXA 2KJCA 2D45A 1B1BA 4KUMA 4LG0A 1T98A 2BYVE 2PMUA 1U8RA 3CTAA 2KIUA 4XLPF 1XCBA 2HKOA 3GZ6A 4A0ZA 4O3MA 1ZGJA 3BPXA 3E3VA 1BOAA 1TLHB 3M1EA 1G3WA 1YFHA 1WQ2A 1QBJA 2G7HA 4EM0B 2OQRA 2W84A 3DKWA 4I7HA 1BI0A 4U0WA 1UHMA 4I02A 5E18F 3KP7A 1J75A 4AIJA 3BJOA 3P9CA 3E97A 3PQJA 1O7LA 3MFKA 3EYIA 4A2UA 4HYEA 4PDKA 2RNJA 3HRMA 4I98B 2BE5F 1ZLJA 5K1YA 1ZG3A 2STWA 3HUGA 3TDZC 1W5SA 3FZVA 1YO5C 3J80Z 3F3XA 4HZFA 4NHJA 2GA1A 3F8MA 4LGWA 3EETA 5ILUA 1O57A 3MQ0A 2DBBA 5E1ZB 2EK5A 1G3YA 1TTYA 2QWWA 3QP6A 1BC8C 1PDNC 3LSTA 2EV6A 1SFEA 4ASNA 4G6DA 1L3LA 1MJ9A 2PFBA 2MLGA 5L3GA 1IRGA 5JR3A 1E2XA 4H0EA 2EJRA 2XAQA 3GFMA 2XAJA 1S6LA 1R1VA 4RB1A 1BI3A 3I58A 2VOPA 5D6EA 4D0PA 2Z33A 4RGSA 4BHPA 1R36A 4HOBA 4RB3C 3BY6A 4IF4A 2IP2A 3I71A 3ZPLA 1ULYA 3KEQA 1KU9A 5F64A 5DDGA 4R79A 4WCGA 4KMFA 1FSEA 3BWGA 2PMHA 1FOKA 4M73A
chains in the Genus database with same CATH superfamily
4MQ9F 4MLOA 1ACIA 1TBXA 1HSTA 3BG5A 3OYLA 5DEQA 3GTOJ 1FOXA 3BJ6A 3OIQA 3CLOA 2VQHA 3I56I 1JJ6C 5K5OA 3GTPJ 1R00A 3DTKA 4TV7A 1D0ZA 4G12A 2F5FA 2JSPA 4BBRJ 2ZJRF 2E7XA 2XPVA 3OYJA 4RLFA 2W25A 4ZTFA 2KZVA 2CFXA 4MQVA 2VXZA 1REPC 1UG2A 4EV0A 1IN7A 3F72A 1BL0A 1WJBA 5E3OA 4F7ZA 1JKOC 2HWVA 2QQAA 2OAZA 2QVOA 1UHWA 1MBFA 1HKSA 2Z1DA 2VB6A 3ZMZA 1ZG5A 4FX4A 3RYRA 1O3RA 3ROUA 1GLNA 1YW8A 2Z3YA 3BR3A 3LA3A 4F91B 1YJNI 1Y0NA 5ERIA 5DD8A 5D5UB 3EDPA 2RC4A 1QZZA 2XF6A 1IJWC 3L2VA 2CG4A 3C7JA 2DFFA 5GPAA 1AKHA 3SDBA 4M3EA 1OCPA 2ISZA 5EEGA 2E5NA 2QQBA 1IV8A 3C1DA 4RBOA 3EPZA 4EATA 3I4MJ 3LSRA 4BQOA 3JW4A 2LRDA 3RI4A 3WU2C 3B6AA 3ZQQA 3PFIA 3V8JA 3NWSA 3W3CA 2EZLA 4HNUA 2DMPA 1LJ9A 4KIBA 1UJ8A 4OIRF 1P6RA 2GIZA 4C3IJ 2HYGD 4I6ZA 2MABA 4KT5C 1FBUA 4FHTA 4W1UA 2J5OA 1FSHA 3WGIA 2BY2A 5EG0A 4A12A 2QENA 2CQ7A 4Y7NJ 3PQKA 5BNGA 3ZQIA 4A0XA 4IHYA 4XRFA 2L9VA 2W00A 3LSMA 2FU4A 4KIGA 4PK4A 2V1XA 4B09A 4B3AA 3KETA 4AU7A 1USSA 1BR4A 2F2EA 5LRRA 1W4MA 3SFIA 5B3SH 1F1ZA 4CYDA 1UAAA 2BHYA 1BI1A 4ZJZA 4G6TB 4HQMA 2JUGA 1X2MA 2VE9A 2YU9J 1LDJA 1SVMA 2P7CB 2UUZA 2JRTA 5EJCA 2DT5A 2EFNA 3C2BA 4BYYA 4DGWB 2F5VA 2R3SA 1WHUA 5FKMA 1IC8A 1P4WA 2IGMA 2Q2EB 4RMNA 1DP7P 2GXBA 2VOOA 5E3LA 3UKGA 3AG2H 2A5WA 2FXAA 2L9RA 4HNVA 3H9JA 5JHFA 3QAHA 3ABLH 4A3IJ 3I55I 2HEOA 2HTJA 1T38A 3VYUB 4X6AJ 2QF7A 1E3OC 4I01A 3GF2A 5D6FA 2HOAA 3OOPA 3VSLA 5C44J 3FIWA 4RLQA 2DI3A 3N97A 3I59A 2BOLA 2DYRH 2DCEA 3CO6C 3IL2A 2NOGA 1WGXA 1FMVA 1U5TA 2QGUA 3WE3A 1Z91A 4HLYA 5J40A 2VQGA 2V9PA 1JT6A 4C9YA 2JA5J 4A6DA 1PUFB 1WJEA 4CGZA 4D1QA 2DA2A 2VPLA 1T2KA 2ESHA 2YPRA 4I0BA 2LDUA 4S05A 3HL2A 2DA5A 4XR6A 5BOXA 2YSRA 1MBEA 2XIGA 4RM2A 4DYCA 5L3CA 1D5VA 1LEAA 1LVAA 4Y17A 3M7GA 3V8KA 1U6GA 2HYJA 4MTDA 2E1NA 3KYCB 1W1WE 2DQLA 3HOWJ 4MO7A 1R6RA 2A3SA 2V1DA 2JUCA 2DLLA 2NVXJ 3JRDA 2HGCA 1J5YA 2HDWA 1B72B 3DTIA 3LAPA 4B8XA 3GTGJ 1I1GA 3LOCA 4V19K 4EJWA 4BY7J 2ZJ2A 1EKEA 3MMYB 2VT3A 2IA0A 3GVAA 2IA1A 2VIXA 5F0CA 1GXQA 3F9KA 1FYLA 2OUMA 1ZHFA 2ZJQF 1FOWA 4HF1A 3NQOA 5J8FA 2X6WA 3QYFA 4ANJA 3CCYA 4PZJA 3FM5A 4OOIA 3CCEI 1AU7A 4AIDA 3K4CA 1TNSA 5IT9K 1RKWA 3QYBA 5DYMA 1FYKA 1WJ5A 4M74A 4DOZA 3PL8A 5JVTA 1BIBA 4ENKA 5HDGA 1LFUP 1JGGA 1E0EA 1WZ2A 3UNGC 4BNCA 1I50J 3H1CA 1JKRC 2FE3A 3JSPA 3FXMA 2HPIA 4XNFA 3LSHA 1XDUA 4C3HJ 4KMUX 3F21A 4B47A 5LGUA 4OIPF 3ZQ7A 1H88C 2CUZA 3JRIA 4Y33A 2Q2EA 2ZO4A 4MEXF 4D7NA 1D1AA 2O0YA 2F4MB 4IJAA 2JA6J 3QPHA 2CO5A 1HBXG 4XL9A 1MNEA 3FF5A 1K83J 4HEA2 2GAUA 3M9AA 1G3SA 3O2PE 4FCYA 3F0CA 1P2FA 3OL3A 2DAOA 4LJZF 5KNLA 1UZCA 2OZ6A 1QU3A 1T95A 1XMXA 3SZGA 1SVLA 4M3DA 1P4XA 2CQQA 3MKYB 2XSJC 2DOFA 3DBHB 2ELHA 1MMNA 2PX9A 4AUXA 3PO3J 3G2BA 2QBYA 4L9TA 3CO7C 2NS7A 4PGGA 3S2DJ 3TP3A 1XTAA 4BE1A 4LG0B 2V1NA 2CMPA 2L7FP 1QRYA 1DDNA 1FNNA 3FX3A 1VQNI 3MN2A 1VNDA 2M7BA 5ICEA 3ZOBA 1MD0A 1YIOA 3ZMTA 2Y2ZA 1U9OA 2A05A 2R7FA 5ICCA 3PFYA 4I0AA 3CCMI 3H92A 3DXJF 3BR6A 1VF9A 2ACJA 3DP7A 5M3FJ 1X3UA 3HPGA 5A2QK 1R4NB 4WF2A 5E1WA 3TQNA 4B4CA 4B43A 3OS1A 2VJ4A 5C4XJ 2EV0A 1MNDA 1Q1VA 2DT7B 1ZR4A 2P8TA 2RNGA 1IXSB 1U3EM 3ABMH 2ECBA 3MCZA 1LPQA 3H3VK 1LEBA 1EF4A 2DFEA 1HOMA 1Z05A 3DU5A 4NC7A 4Q5SF 4Y4RA 4J19A 1YTYA 4A3LJ 3H5NA 1OYIA 3VYSB 1XMKA 1JHFA 3W2VA 2L02A 1ON2A 1R7JA 3T8RA 4OIQF 4HX8A 3U21A 4WWCA 3JRCA 1O3SA 2XC7A 1FT9A 1TP4A 1X4PA 3TO9A 1S3JA 3SQNA 3COAC 4FASD 4ESFA 2M8EA 4Q48A 3SYTA 2BW3B 5B5EC 4MFDA 4EJTA 1TWHJ 2F4IA 2KRHA 2ZXJA 4HV5A 5E3MA 1HXDA 4GCVA 2Y31A 2WAEA 1VQKI 2GLOA 3PIOF 1XB4A 4FISA 4RM3A 4E70A 3HRUA 2PJPA 1NG7A 3AG4H 1S9HA 1YITI 1MNMC 2KQRA 1BM9A 1SFXA 3VSKA 1I3AA 3SEQA 1J7KA 2ZFUA 2QA4I 4IOAF 3RTRA 2H1KA 3KYDB 1K78B 5CJ9A 1B59A 1SC7A 2DA3A 5D8KB 3LWFA 2EFWA 3GTQJ 5FFZA 3ABTA 1VQ6I 1B4AA 4MIMA 2P7VB 2PEXA 3B73A 1DGWY 2CQXA 3SJMA 3GXOA 5HS9A 1LNWA 3TGNA 4XMYA 4B44A 5FRNA 2BXZA 1Z21A 5DM7F 2G7UA 2BVMA 3HEFA 1B72A 1VQ9I 1ON1A 3A0BC 4M6XA 5L3EA 3VPRA 4EGYA 3K70D 3FXUA 3FMRA 4X0GA 4E7JA 4A3KJ 3KPHA 2X9DA 2Z99A 1D8JA 1J09A 4UXNA 1V55H 2M87A 3OY9A 3RPUA 1FIAA 4N9IA 2R93J 2R5ZB 3EYYA 3LNQA 4NUBA 2KZGA 4GYGA 5HLIA 3DEUA 3IKVA 4R1HA 1R49A 3LSPA 2ZCWA 1MMDA 1IRZA 3EUHA 4MHGA 4D7MA 3ABUA 1R71A 2PG4A 1HKTA 2HI3A 2R5ZA 2Y9ZA 2HYFA 3TKYA 1DU0A 5IOYA 1KYZA 2QUFA 3E5QA 2UXNA 4V2FA 3IRQA 2P5LC 2UV1A 3AKZA 4BXUA 4IHSA 2RQQA 3Q9SA 4FE4A 3BZCA 4KICA 2A61A 2M8GX 3BG9A 5KAFC 3OSFA 2DJIA 4ZYAA 2HOTA 2A5YB 4HF0A 3KCCA 1TW3A 4M3FA 2ME6A 2O3FA 3ECOA 1GV2A 3WTYC 2L9SA 3I4PA 1YS7A 3OV8A 5CQGA 3O3KA 2DTRA 1JHHA 3M1CA 3ASOH 5GADJ 2KLOA 1U8BA 1K78A 2E35A 1VQPI 2QKLB 2ZBKA 4L9JA 4QPOA 1D1BA 4H4KC 5HNFA 2CQNA 2EFQA 1V5FA 2BY0A 2L9NA 2UWMA 1V4RA 3G71I 3AAFA 4XLFA 4BBSJ 2ZNYA 3BLYA 1IG7A 2V1UA 1DU6A 2ICWG 3TOBA 3S2HJ 4HDVA 2MSYA 5AONA 2HDCA 2XASA 1X1CA 3I64A 3A1YA 5GAGJ 2VN2A 5GTIC 5D5WB 1MDMA 2H27A 4LMYA 5FO5A 1Z6TA 1ZGWA 1JKQC 3F8FA 3CCLI 3K1PA 3PNYA 1QHGA 1IAWA 2FOKA 2IBDA 4PSWA 2OV7A 2Y9YA 3OS0A 4N4OB 3WTSC 2K02A 5TJJA 4C2UA 2IPQX 4P1WA 4L9NA 4BJTA 1XSVA 2G0EA 2PN6A 3IWFA 1IN6A 3SFZA 1ETQA 3CJNA 5KVRA 3G1OA 5LEJA 3FXKA 1RETA 2MYSA 2H6CA 5DCFA 1IN5A 2Y0SN 3HSRA 1U78A 1U5TB 1L0OC 2B7EA 1Q1HA 1LFBA 4LLLA 2IEKA 2M45A 3PJRA 1KA8A 1W36C 3C2HA 4II3A 3QU3A 4O5VA 2EB7A 2OA4A 4C30A 2HZTA 3GZNB 4L5EA 1ZRFA 2DQRA 3PSIA 4MNUA 4NC8A 4LLNA 2AXTC 3BTLA 2AS5F 5IYCJ 1CQTA 3IH4A 3JRBA 5BS6A 2HVRA 3CUQB 3FISA 2GXAA 2P0WA 2QSGX 4NB5A 5LHGA 3ZP5A 4KDPA 1MBGA 1K6OA 2P4WA 3N4MA 1Y0UA 2FUG2 2NS8A 4BHCA 4DBRA 1MMAA 4IRHA 2OF7A 3GWZA 3K4LA 4XORA 3L2WA 3E5UA 3LSJA 2PBIA 1KONA 2HS5A 2Y0MA 4BEHB 1TNTA 1XSDA 1HW2A 1Z1DA 1Z7UA 3K10A 2ZXIA 3W2AA 2Q0OA 2E1OA 3GLXA 2EA2A 4IVNA 4O6JA 1VQ5I 2ZKZA 3DV8A 3FWEA 4EJUA 2A6EF 2WBMA 3DU6A 1ZK8A 4XLAA 1YX5A 2XV4S 3F22A 4KITB 5D8LB 2MH9A 5K7HA 1FYMA 4CYCA 2K85A 4HLXA 3K70C 2Y0SA 3ISPA 5LGNA 3OOUA 2DMNA 1DPRA 3CCSI 4EGZA 5FB2A 5F6FA 2IA2A 2FF4A 2VJJA 3GFLA 1WFXA 2VUMJ 2E5ZA 4OMYA 4BU2A 2CW7A 3S1QJ 2VXDA 1SFKA 2DT6A 4KJZA 2A6HF 1N25A 3DLAA 2L01A 3J80K 1J59A 2K3FA 2HPMA 1F4KA 3CUQA 5H20A 1X4OA 2JN6A 3K4NA 1G6NA 2CGPA 5D5XB 1HF0A 2GBYA 4UVBA 1VQOI 1AA7A 3HKZA 4UNOA 2JVGA 1KU3A 1XDSA 3P5JA 3DBLB 2CUEA 4UUSA 1OJLA 4YEJA 2PI0A 4Q47A 2R7TA 3OYIA 2RAEA 4ZZLA 2FA5A 3G73A 1JKPC 4NQWB 5F1RA 2M4GA 2X48A 3JRGA 2E60A 1R5GA 2HFHA 2XGDA 2Z5UA 2STTA 4XN3A 2BHZA 1OCOH 2EV5A 3QRFF 1A04A 3BR5A 2XAFA 3FDYA 1VQMI 1M1EB 2LKSA 2LVSA 2Y48A 2X0LA 1U2WA 3BOQA 2VJ5A 2WA0A 1X1AA 3WHCA 2VKDA 3BG3A 1P7JA 3E6DA 3QOEA 1IXCA 1LDDA 4ON0A 2X6YA 1FBQA 1CF7B 3DKYA 4NDLA 1C0WA 2DO7A 3DKXA 2HTSA 2LP0A 3S14J 2BZTA 2WV0A 4OINF 2V9VA 2R7RA 4RDUA 2CS3A 1VTNC 3B6CA 4M72A 2DOAA 4AD9A 3N05A 1ORKA 3J81Z 3L2UA 1TC3C 3CJRB 2RN7A 2XAHA 3HHGA 2EPFA 2KMUA 3HSEA 3QP5A 1OCCH 2LKPA 1XD7A 2JZYA 4MTEA 2L3DA 2RKHA 1TT0A 1TW2A 3BR1A 3WU1B 4QWQA 2QLZA 2UZKA 2CRGA 1WJAA 1HSJA 1GVJA 3OYCA 4LG3A 1FLIA 2IJLA 3AG3H 4LITA 4KISA 3CD6I 3HM5A 1OYWA 1S5LC 2XVCA 3G1LA 1VI0A 3U1DA 2VQLA 3S3OA 1LDKB 1LUJB 4CICA 3PUBA 3I53A 4EJVA 3L09A 3V4GA 4RAFA 5D5VB 4B48A 3F8CA 1GDTA 1STZA 3L00A 3WG9A 2XKOA 3HRTA 4E7KA 4HBLA 1TQPA 3FKJA 5FD6A 2DDBA 1I1SA 3NARA 2EWNA 2CUJA 2CQKA 1E3HA 2HOEA 2XGEA 3FHZA 3IC7A 4ENNA 4HX7A 1G8XA 5HODA 1SD4A 5J6XA 2NVYJ 2P81A 1QZEA 4I99C 2ME0A 3VODA 4YFXF 1BW5A 4XK4A 2ZNZA 3DCFA 4B3XA 1FP2A 5ICGA 1SD5A 3HOVJ 2DW4A 4HG2A 4RGXA 4Y52J 1SD6A 2XPUA 1T56A 1LFPA 5EGOA 5IPAA 3QU6A 4HF2A 2EINH 1TQIA 1MIJA 1Y6IA 1T0FC 1X3WB 2K7LA 3I5UA 4Z2YA 4EVIA 2DA7A 2EILH 4GO1A 2JJ7A 3M8FA 2BVLA 2LMDA 2FBKA 4RGUA 3PIPF 5B1BH 2KIMA 1ITYA 3KP3A 3FXQA 3OYHA 1ETKA 1R4MB 5IOZA 1IXRC 2L7ZA 3HYIA 1SAUA 4JBAA 3FXOA 4A0YA 5D4RA 2C6YA 1V3FA 3D0SA 1G2HA 1XC5A 4C2MJ 2HXIA 4BEHA 2R4GA 5LFAA 4XLCA 4RAZA 1U5TC 3BCAA 1UCRA 3RKWA 1ZN2A 2X6XA 3VDXA 2PMZA 4U0YA 4ITVA 5LHIA 2O6GE 2M7AA 3HC7A 3S15J 1ETXA 4XM3A 4IHTA 2Q1ZB 3A03A 2JT1A 4ENMA 5EZHA 2XRLA 2AHQA 4BS9A 2BY1A 3E6MA 2O8KA 2D1VA 4U7BA 5CVJA 1WSUA 1OYYA 3DEWA 5F27A 3HOTA 2EBIA 2VC0A 4JX5A 2W4SA 3ELKA 1S72I 4R8HA 3S8PA 4HNTA 3K2ZA 2H8RA 1R1TA 4AM3A 5HLGA 2HZDA 4XOPA 3LFUA 5DTDA 3FK7A 3VWBA 2M4KA 5J47A 2E7WA 1TWGJ 4RGRA 3ESWB 2Q8KA 3W6JB 1KU7A 5EZGA 2LSOA 1W0TA 3FMSA 3SDGA 1P4AA 5KAIC 1YHQI 2R7UA 2F6CA 4C3JJ 2F5DA 1D3YA 3JSOA 4V2GA 1MBHA 2ZB9A 4HSTA 1J0RA 4A5NA 5HVQC 2KL4A 1MW7A 4L18B 2V79A 3BCBA 3L2QA 4M9SA 1KZHA 2J5PA 3PNTA 5AIQA 3FM3A 4M6VA 2FQ3A 3GX4X 4XQFA 1Y1WJ 2FNAA 2LC2A 3QOPA 1BC7C 2MFZA 3TW7A 1ZH5A 2DMUA 3BR2A 5E79C 1WWXA 4HW0A 5CPRB 5TGTA 4ZYEA 1XGNA 2GQQA 3NAUA 1B8IA 3G3ZA 4E7IA 1OMIA 3E5XA 3MEXA 3X2QH 3IV5A 1Z7LA 2IS1A 3E6CC 3VEPA 1CGPA 3GW2A 4YG2F 3TO6A 4I76A 3DFGA 4G6QA 4XLEA 3KP6A 1WPKA 1SFOJ 3H9QA 4A3BJ 3CCUI 1HKQA 2O5RA 4G94A 2O8XA 5FLXZ 1VQLI 4NBQA 3OYKA 2B0LA 3ZR8X 1USTA 2CW0F 4F92B 3REOA 2WWYA 2COMA 3RPQA 3Q5FA 2NYXA 3F6VA 4PJ0C 2B9SA 5JVGF 2LLKA 3K1MA 4ZTJA 5JLWA 1TT5B 2X85A 4GXOA 3RZDJ 1BJZA 3CDHA 3LA7A 1IUYA 3CCQI 1NTCA 3OYEA 1SEUA 2K4JA 4OIOF 1QHHD 4LK1F 2CYYA 5LD2C 3HIFA 4OMZA 1YS6A 1T8IA 4L9VA 1YRNB 4Z6YA 3G4SI 3JREA 3DTEA 2EZIA 2K4BA 3WGHA 3JTGA 3R4KA 5K5RA 1ZYRF 2R5YA 3HHHA 4CHUA 3CP2A 2H1LA 4HAMA 5HLHA 2LFBA 1IN4A 5KHDA 2HDDA 3BR0A 1IV6A 2FSWA 2IXSA 4ZZDA 1RUNA 1WVRA 4XKCA 2R5YB 4UV8A 1TZLA 4ZYGA 3I9V2 2M30A 2O61A 4G8XA 3GCMA 3TW6A 1FTTA 2MC4A 4LIUA 1X1BA 2DTZA 1T6SA 3JAMZ 5JHUA 3WTTC 4CCLA 2VKVA 4QTRA 2ELKA 4BE0A 3GMEA 2MD5A 3QPTA 4KN7X 1YRNA 2WAQA 4CCNA 2CV1A 2TCTA 3TP0A 4L5JA 1SD7A 5TRDA 1LQ1A 3MAJA 1SMYF 1IZ1A 1Y56A 5ICFA 1A35A 2WAFA 2FMLA 1R9TJ 4AVPA 4FT8A 3E6BA 2K86A 1ETOA 2GIVA 2QKMB 3FK6A 2QQ9A 2XAUA 4EEFG 1VQ7I 4PJMA 5M3MJ 3RQIA 2XF7A 2O03A 3ZQFA 3GTLJ 4KIFA 4YELA 3SEZA 1O3TA 2LD5A 4ZYHA 4DZPA 1UELB 2YU3A 3ERMA 5EYRA 1DPUA 2ZXHA 2LK2A 2QYOA 4CYCB 5D4SA 2GZWA 1Z9CA 4PFPA 4CZCA 3FKIJ 5FKLA 5FKNA 4OU0A 5DV5A 3RKYA 5DM6F 1SAXA 3CF5F 2VPRA 2H8WA 1CF7A 3HGYA 3HUGB 4KNYA 2FEZA 3UR3C 4JOMA 2HQAA 3CJQB 3FXLA 5GPCA 1QVTA 4PGHA 1PJRA 4CA0A 2K5CA 1O7FA 1P92A 2VBYA 1AHDP 4LFUA 4CSWA 4CO8A 2OTJI 4A3JJ 3ONQA 2FJ1A 4CCOA 2CUFA 4XOTA 4YIIA 1ZR2A 1ENHA 2GOMA 5EG0B 2WAQN 2M0MA 3JRAA 4B1RA 2ZMEB 4IHXA 1O3QA 4ZH4F 1H9TA 2DK5A 2OCCH 3NEUA 4N0BA 4WX9A 2PMZN 5FGMA 1ZREA 4NQWA 1KQ0A 2VL8A 3H9GA 5J3LA 3KZIC 4BHBA 2LY2A 4EM2A 3FBIB 3T0YA 3CMAI 2NNNA 1XPXA 3E0JB 1YOVB 2LBFB 1RESA 4E4HA 1ZLKA 5F0HA 2MA3A 4U87A 2IW5A 3ASNH 4IL6C 4IZZA 4OWRB 4PJLA 5K7FA 5EDNA 4S0HB 2W7NA 3GZ5A 2W57A 5F0FA 1XGMA 2QSFX 2COBA 3BTJA 1LE8A 3CMMA 1KU2A 3IAM2 1K7AA 5FRMA 1OCRH 3FMQA 1B6AA 5EEHA 4XKBA 1IDZA 2WC2A 4P9FA 3GFJA 2MLKA 3C18A 3S3NA 5FJ8J 4DBQA 3ZMDA 5A2QZ 4GYIA 2Z9OA 4FX0A 1TL8A 3IRRA 2ADUA 2MH2A 3Q9VA 5DUKA 5BPDA 3R0JA 2ZMEC 2WY7Q 2G9WA 3I4NJ 1FBSA 3O6BB 2X51A 1VZ0A 2VQCA 2O7OA 2P6TA 2MC3A 3H36A 2VKHA 2Y69H 1QQIA 2IGNA 4BDZA 1ZGAA 1MZBA 2IS2A 3QYEA 4D9JA 3C3WA 3H3UA 4XSXF 5KK1A 1JTXA 4WXDA 4FE7A 5CVVA 1QA6A 1W7PD 2TDXA 3LSIA 2DU9A 4G9YA 2JTVA 5C3EJ 2PLYA 2RREA 5E20A 3I3LA 1T0FA 3OIOA 2FX0A 1ZELA 4QLCU 1G3TA 3HPHA 4ZYDA 1W5TA 3OYNA 1APLC 3GO5A 5HS8A 3S1RJ 2R7VA 2CV2A 1OPCA 3RKXA 4BQQA 4DYRA 1FMWA 2HQNA 1ETWA 1YQAA 2L54A 4QPQA 3LA2A 4M9ZA 3RDIA 1POGA 2V7FA 1IRXA 3LL7A 4DW6A 3JTHA 2QQ8A 5HDNA 2N8GA 3H35A 4RB2C 2L2OA 3TL4X 3SZPA 1ETYA 1GT0C 1H8AC 1IF1A 2ID3A 2NS0A 2W85A 4YRVA 1SFUA 4BXXJ 2OQGA 5GAEJ 3ZQHA 2ZSHB 3T8TA 4Y3OA 4M71A 3NRVA 3R60A 1P7IA 4WK8F 3CDIA 5CVRA 1PP8F 1OR7C 3M8JA 3IHUA 2K9SA 3V42A 3FXRA 2D5VA 1MH4A 2DODA 2FBHA 3Q3SA 2V6CA 4MEYF 4ESJA 1ETVA 1JJ8C 4P5OA 1G59A 3OL4A 4MFEA 4D5FA 5L3DA 2K9LA 5LRSA 2WY8Q 1IW7F 4KT6A 4M3BA 2M2EA 1LKXA 2VT2A 1U0JA 2RDPA 1W7PA 2YS9A 4UVAA 3J7YJ 3C2GA 2OCEA 4BQAA 4K2EA 2BY3A 4LD5A 3KLOA 4IQJA 1IRFA 4BAYA 4C2TA 4LOCA 1X1DA 5J8CA 2I10A 3AL0C 4WXHA 1MJBA 1NK2P 2P6SA 4YFKF 3DLLF 1Y1VJ 5DCMA 5J1RA 3K9TA 5HLTA 1BN5A 3Q0WA 3R0AA 2A68F 3SZTA 3PO2J 5CVIA 4IPAA 5JLXA 4HDUA 2FBIA 2CFOA 5H6QA 3K4KA 4BDYA 4UB6C 2QSHX 1FTZA 1FC3A 3VYRB 2NVQJ 1OR7A 1W7PB 1Y8RB 4CXFA 1JT0A 3GLLA 4XICA 4BH9A 3MKZA 4U7DA 2D1HA 2JPCA 1QO0D 1WI9A 3J7ZI 2HQ5A 2R7OA 2CWEA 4HA8A 5LHHA 4I09A 1KQ9A 4E7ZA 5LLQA 3GEZA 1IUFA 4BJ5C 5IY5H 4DIQA 3K69A 3IWZA 3S32A 5B1AH 2KPMA 3AL0B 2W82A 2E2IJ 1WCMJ 1SMTA 3F8NA 2AQFA 2X4HA 1IGNA 5KCMA 1U9NA 5L3FA 1YE9A 4IRGA 4XONA 3R6SA 1A31A 3TO7A 3P9IA 4AC0A 3ECHA 3BQZA 1ZG1A 2KRFA 1BI2A 1ZARA 2LH9A 3G1MA 4EJOA 1HDPA 3CC4I 4LB5A 3K0LA 5F04A 2B63J 3CESA 3TEDA 2DFIA 2F5CA 3S2WA 4L5IA 3U9GA 3WODF 3M4OJ 1UFMA 1RI7A 1JUMA 3RZOJ 2LY9A 4W97A 4IKFA 2JSCA 3LFKA 4PUSA 2LF8A 2VE8A 5GAHJ 4BGDA 2EFPA 5CLSA 5LEKA 1OFCX 3SHFA 3Q0VA 2D2WA 2M34A 1PP7U 2XROA 1MKMA 3CP8A 4EQQA 4G7OF 3CUQC 2GOXB 3H0GJ 4AYBN 1S8NA 3J81K 3F23A 1Z77A 1FY7A 1R22A 4JQFA 2H94A 5HOOA 5IP7J 1XN7A 4E7LA 1OCTC 1WJCA 3EUHC 3WHBA 3TDUC 4F55A 2KFDA 1ZKGA 2XB5A 1QZYA 2NRAC 2BV6A 4NC6A 1X2NA 1F43A 1TWCJ 2IRFG 5GP9A 1WI3A 1K4SA 5IYDJ 1XSXA 3BPVA 3OYMA 3W2WA 4WXCA 3DQVC 2AQEA 2NVUB 3LSKA 5ILSA 2KHMA 3NWTA 3A01A 4IOCF 4I2OA 1HW1A 4M9XA 1UG0A 2OU2A 1K79A 1WH7A 5BQTA 1HCRA 5FROA 2DK8A 1RR7A 1HQCA 5B66C 2QBYB 5JFRA 1OKRA 3IUOA 2JWTA 1N78A 4S04A 1H0MA 4DYQA 3G6EI 2XAGA 1SANA 2KKOA 4XLHA 2E1MB 1OLTA 2BGCA 2YX7A 2GA2A 2WADA 2XHKA 3ULQB 3S3MA 3WGGA 1YW7A 4U88A 4Y13A 2CV0A 4A5MA 4CZZA 3CMEI 3BTCA 2BW3A 2KP6A 1WKMA 3ZN1A 4D5CA 1HA8A 3BDDA 3KYLA 2IVMA 4F52A 3JR9A 1FZPB 3MD2A 4DNCA 2BBYA 3J7AO 3WU0A 4AYBA 1PVEA 5FD5A 4A69C 2A07F 1J9IA 2NNYA 3R61A 1V5EA 3VFZA 5AIPA 1ODDA 2QEXI 4ETSA 4M3GA 2UXXA 5FLMJ 3AFHA 5ED4A 1FX7A 1BJAA 3FHNA 2Z16A 1EH6A 2ID6A 2Y75A 2R7ZJ 3MKWB 3ZCOA 5FLVA 3SXYA 1RUOA 1TWAJ 4GDFA 3BT9A 3WTUC 2XUBA 1UB9A 1EH7A 3ZMVA 3CCVI 4AIKA 2L7MP 4BXFA 2KJBA 1X3ZB 3LAJA 2QZ8A 3K2AA 1XGOA 1QGPA 1KGSA 3IH2A 4E7HA 2R92J 2VODA 5LBQA 2JK3A 4HX4A 4JYKA 3OYDA 1BA5A 1I6XA 3WTWC 2IS4A 3HZJA 1MSFC 2LY1A 5EEAA 1XMAA 1JGSA 3U2RA 3WTXC 4BQNA 3RKQA 1R23A 2FRHA 3KP5A 4UB8C 4G7ZF 2A69F 2EIMH 2WV1A 5J4VA 1NK3P 1HC8A 3OYBA 2EH3A 5HDKA 2K9QA 2NAZA 4ESBA 3GTJJ 2RGVA 1TWFJ 1NH3A 2PJRA 5K5QA 4X1EA 4HSRA 4ZDOA 2XB0X 1BBYA 2KRCA 2JRMA 2M3AA 4FQGA 1N77A 1WRJA 1PUEE 5HNHA 1A36A 4L0YB 1RZ4A 3I54A 5M5YJ 3A0HC 4DZJA 4N4NB 4QSHA 3K7AJ 4QIWN 3JAMK 2NXNB 4P55A 3K6GA 5F1JA 3HTSB 4A3GJ 3V8LA 4HRIA 1XCVA 2YUSA 4KYWA 3ZMUA 2LBFA 3RYPA 5EGOB 5E8GA 2V4JC 3K4BA 2IGOA 2L4AA 2P5VA 5M5XJ 1K4TA 1MMSA 1KYWA 3T5XA 3CLQA 4AWXB 2XRNA 2DOEA 3P7NA 4AIHA 3IAS2 4F3QA 2H6BA 4RB0A 1YLFA 2ZFWA 2LG4A 3K4JA 4E7SA 2OZUA 1FP1D 1EH8A 2WTEA 3F8BA 1BW6A 2DJNA 4YFNF 4LLGF 3V7RA 3B02A 4LK0F 2OBPA 4UUSB 1RC9A 2CU7A 3DPUA 2F4OB 1D8KA 2X1DA 3H5RA 5E17F 4BKXA 2HKXA 3RJPA 1RNLA 2GXGA 3FXJA 1EJ9A 3GYHX 3BZ6A 1PYVA 5IT3A 1YI2I 4N9HA 5FFXA 5H2FC 3PM1A 5DUIA 2VC1A 4IXAA 2NOJB 1E3PA 1Z6RA 3GFIA 5J1UA 4MGRA 1DGRM 5IT9Z 4CUGA 1NG6A 1MBJA 5GTHC 3BZKA 2VLAA 1J2XA 4A6EA 5C4JJ 2X1CA 4CCJA 4XKWA 1B9NA 3HBLA 2FQ4A 4RAGA 4BE2A 2AO9A 3DPLC 3H5AA 3IH3A 3ML6A 4UVCA 1ZRCA 1FEXA 4LIVA 2ESNA 3HOSA 3WG7H 5CYVA 2L5QA 1D1CA 2HVSA 2OD5A 3QODA 5ILVA 4UY8I 2MBFA 1R5HA 3OR2C 5E1XA 1H89C 4OAZA 5CKTA 1A5JA 2DPDA 2XF5A 2ETHA 1KQ8A 2IT0A 3VB2A 2ZJPF 4IQ4A 4RAYA 1X58A 2FMYA 1RRJA 2EZKA 2GWRA 1ZQ3P 1F9NA 5LGTA 1QPMA 3ZN0A 5CVUA 1YX3A 1RPWA 1GHCA 3CDLA 4IRIA 1R58A 4PCQA 1MGTA 4ABZA 3KFWX 3KE2A 3HOUJ 4U0VA 2MW8A 3F6OA 4P96A 5K7ZA 3BP8A 1S29A 4CH7A 4XRSG 3DPTA 4A3EJ 1OCZH 2YR2A 2E34A 2EQRA 3I59B 5J4YA 4UHTA 1B9MA 3DBRB 3TOAA 1W0UA 1IN8A 3QQAA 5EF6A 1D0XA 4KFCA 1YW9A 4LB6B 3E1SA 3CZ6A 4HPQA 1BIAA 2L7KA 4YIRX 3L7WA 2ISYA 1BR2A 3L9FA 2OJED 1S7EA 3D5SC 5E8IA 4EMSA 1R1UA 2FNPA 2LTPA 2X1EA 2K40A 3CMYA 3CC7I 3WTZA 1JXSA 1AKHB 3M3YJ 2YX4A 2DA6A 4KN4X 2FD5A 2ZMEA 4PFOA 3WTVC 1T08B 2ECCA 3JRHA 2R0QC 4G7HF 5BPIA 2CH0A 3ABKH 4CDGA 3K1NA 1YYVA 2VBZA 5IP9J 2P5KA 5JI6A 1Y8QB 2XSDC 2V6EA 2K9MA 4XLNF 2W1OA 3LQRA 2M1BA 2ZSIB 4JX6A 3PUFA 2VKEA 3EQLF 3GUDA 4HQEA 1A6QA 4AVZA 2VBWA 1QNTA 1HDDC 1MDMB 1H9GA 2M9HA 2O9LA 2L0KA 2XGXA 1B8IB 3RPUD 2JA8J 5L3BA 2RV8A 1MSEC 4Q4ZF 1GUUA 3W6KB 3E7LA 4NNJA 1Y39A 1QVUA 3EUKL 1EV7A 3ZQCA 2R7DA 3MWMA 3M07A 1F5TA 3TBIA 1F36A 3OS2A 4L0ZB 3QWLA 1AOYA 1RIOH 2MD0A 2CW8A 3KLNA 1GXPA 2E2HJ 5BMZA 3KZZA 4DJAA 2DN0A 3BROA 5F08A 2K27A 3HJEA 3OMYA 4GRIA 4XIDA 1LB2A 4Y15A 3QPSA 2FOWA 5FKKA 1VQ4I 3M8EA 1X19A 2M5WA 3OYGA 1AWCA 3D1NI 1FPQA 4RS8A 3MZHA 2IS6A 4GGGA 4HV6A 1LE8B 3A4CA 2JPBA 3V7CA 2VBXA 1ONVA 4UV9A 3LQQA 5HS7A 1N75A 1R5ID 2E1CA 2DYSH 4F93B 3GBGA 3A02A 1V5GA 2LREA 3KIOA 5J1YA 5CQEA 2LYCA 2XKPA 3HGGA 3HRSA 2IGKA 4XSZF 4PJNA 4BACA 3P9KA 2W24A 1XGSA 1JE8A 3DF8A 1ZRDA 3MKLA 2VONA 3V7SA 4FTHA 5DD4A 4BUPA 2H09A 1E17A 4XN0A 4IEJA 1K6YA 3KP4A 4ENJA 3VOEA 1S7OA 4ZDPA 2Y30A 3O8HA 4P9UA 3CC2I 3WE2A 4A3DJ 1ZAOA 5DCMB 2L4MA 3S1MJ 3I0TA 4M6YA 3CCJI 2F5EA 1D5YA 3IP4B 3HOZJ 2MGQA 4XRSA 2E36A 2PJRB 4XRMA 2DPUA 2V26A 5IP6A 2LR8A 2I8DA 3KEYA 2E2JJ 1MJAA 4II2A 2JVHA 4JK1X 1HW5A 1T39A 3RIRA 2CSOA 3ZMSA 2RQPA 2OC6A 2HR3A 1WJFA 3ERED 1Z3XA 2KDOA 2PQ8A 4ZDLA 1PUFA 1S7AA 2EA4A 3KZYA 5FLXK 4FETA 3MZYA 2W48A 1V54H 1NHAA 2A6TA 3D5LA 2AXLA 4EM1A 1YG2A 3HTUA 1DUXC 1A6IA 2LNBA 3BTIA 3CQZJ 1WJDA 2LF7A 2DFHA 1G4DA 1GVDA 2KIFA 2VASA 1TQMA 1I3QJ 1FWZA 3DWLE 1BOBA 2E71A 1YJWI 4OAYA 4A93J 1UMQA 2BEOA 3L2CA 2ZC2A 1DP3A 3L1PA 3W6VA 2M0CA 2HQRA 2LKXA 3A2KA 5H6RA 3ZGKA 1W36D 1XX5A 2DA4A 2DXIA 3BC8A 4JX4A 1LVKA 2QCOA 3Q0UA 2EFOA 4KA4A 3HOXJ 3HDDA 1I5ZA 2HVQA 3HG9A 1EA3A 1Z3YA 2DMQA 4DQ2A 4XBFA 2QM3A 1Z0XA 3CUOA 1I27A 5FKOA 3HSFA 4YIFA 2I5UA 4UUVA 3S1NJ 1T33A 1Z67A 3KP2A 3DEEA 3HOYJ 1QPIA 3CJTB 3OR1C 3D5RC 1O4XA 4UUTA 4GFBA 3BJAA 2JMWA 4BL0B 2TRTA 3KEOA 3K4MA 1VFCA 4BJ6C 3L2RA 2RVCA 3OIPA 3T1BA 3IKTA 3HKZN 2XDVA 1SVOA 3H3ZA 3A01B 3VYTB 6PAXA 2KJCA 2D45A 1B1BA 4KUMA 3ZQLA 2JQ7A 2OTLI 4LG0A 1T98A 2BYVE 2PMUA 1U8RA 3CTAA 3OSGA 2KIUA 4XLPF 3S16J 1XCBA 2HKOA 9ANTA 2KISA 3GZ6A 4A0ZA 4O3MA 3U1KA 2GM4A 1JUSA 3OYAA 1ZGJA 3BPXA 3E3VA 2LOOA 1BOAA 1TLHB 3M1EA 2ELJA 4IO9F 1RKTA 1DQUA 1G3WA 2E1MC 1YFHA 2IAIA 1WQ2A 4A3FJ 1MH3A 2MG4A 2JA2A 3CF2A 1QBJA 2G7HA 4EM0B 3RQ4A 4BY1J 2VI6A 4J00A 1IO2A 1I39A 2OQRA 1XG1A 2W84A 3DKWA 4I7HA 3AG1H 1BI0A 1WH5A 1FJLA 2EIKH 2K9NA 3MZ8A 4U0WA 4IHWA 2EZHA 1UHMA 3ZRGA 4I02A 1UHSA 2OPTA 4JP0A 1FOYA 4RA2A 5E18F 3KP7A 1J75A 4AIJA 2WB1A 3BJOA 5IYBJ 2HU9A 3KX2A 2R7WA 3GTMJ 3RCOA 2F48A 3P9CA 3PSFA 3E97A 3PQJA 1O7LA 3MFKA 3EYIA 4A2UA 2DDAA 3RSNA 5TISC 4HYEA 2BXYA 4PDKA 1YIJI 2RNJA 3CCRI 3HRMA 4I98B 2BE5F 1ZLJA 5K1YA 2HNHA 2E19A 4A3CJ 1ZG3A 1ERDA 3TDZC 3HUGA 2STWA 1OQYA 3BQYA 1D0YA 1W5SA 5DS9A 3FZVA 3LMMA 1K61A 2V9KA 2NVTJ 1YO5C 3J80Z 3TMOA 3F3XA 4HZFA 1MBKA 2R7SA 1BR1A 1IDYA 4NHJA 2GA1A 3F8MA 4LGWA 3JCUC 3EETA 5ILUA 4CCMA 4PJJA 1O57A 2R7XA 3MQ0A 2CJJA 2DBBA 5E1ZB 1JTYA 2EK5A 1G3YA 3BG7A 1TTYA 2QWWA 3O8GA 3PNVA 3QP6A 1BC8C 1PDNC 3LSTA 2EV6A 3J7AY 1SFEA 4ASNA 4G6DA 4IHVA 1P9QC 3ZQGA 1L3LA 2EIJH 2XPWA 1MJ9A 3JRFA 2PFBA 3ZXSA 2X6OA 4ZC3A 1MMGA 2MLGA 3FBNB 2KIQA 4A3MJ 5L3GA 1IRGA 4IX7A 2WB1N 5JR3A 2KDZA 1E2XA 4H0EA 2EJRA 2XAQA 1ZTRA 2XAJA 3GFMA 1JI8A 1S6LA 1R1VA 4RB1A 3OYFA 1BI3A 3I58A 3GTKJ 2VOPA 3LSGA 5D6EA 2DA1A 1X1PA 4D0PA 2Z33A 4RGSA 3S93A 1RR8C 2K3PA 4BHPA 2HOSA 2JA7J 5E3NA 2HXOA 1JUPA 1R36A 4HOBA 4RB3C 3BY6A 3MVPA 2VJIA 1GV5A 3EUAA 4IF4A 4PSXA 1W5CC 5M5WJ 4E6KG 2IP2A 3I71A 1VQ8I 3BG6A 4XKVA 1OISA 2R7QA 1XS9A 3HXLA 3ZPLA 3H0DA 3S17J 1ULYA 4CCKA 3HB9A 3KEQA 1FIPA 3QPLA 2Z2SB 1KU9A 5F64A 5DDGA 4R79A 4WCGA 1I6HJ 1HLVA 4KMFA 3OWTA 1FSEA 4J01A 3BWGA 2ZXWH 2DMTA 2PMHA 1YJ9I 2XGCA 4M73A 1FOKA 2KT0A
chains in the Genus database with same CATH topology
4MQ9F 1TBXA 1HSTA 5DEQA 3BJ6A 3CLOA 5K5OA 1R00A 4TV7A 2F5FA 2E7XA 2W25A 2CFXA 4MQVA 2VXZA 1REPC 4EV0A 1IN7A 3F72A 4F7ZA 2HWVA 2QQAA 2OAZA 2QVOA 1UHWA 1HKSA 3ZMZA 1ZG5A 4FX4A 3RYRA 1O3RA 3ROUA 1YW8A 2Z3YA 3LA3A 5ERIA 5DD8A 5D5UB 3EDPA 2RC4A 1QZZA 2CG4A 3C7JA 2ISZA 5EEGA 2QQBA 3C1DA 3JW4A 3RI4A 3PFIA 3V8JA 1LJ9A 4KIBA 4OIRF 1P6RA 2HYGD 4KT5C 1FBUA 4FHTA 2J5OA 1FSHA 3WGIA 4A12A 2QENA 3PQKA 4A0XA 4XRFA 2FU4A 4KIGA 2V1XA 4B09A 3KETA 1USSA 2F2EA 5LRRA 1W4MA 1F1ZA 4CYDA 1BI1A 4HQMA 2VE9A 1LDJA 2P7CB 2JRTA 2DT5A 2EFNA 4BYYA 2R3SA 1P4WA 1DP7P 2GXBA 2VOOA 2FXAA 3QAHA 2HEOA 2HTJA 1T38A 4I01A 3GF2A 5D6FA 3OOPA 2DI3A 3N97A 3I59A 3CO6C 3IL2A 1U5TA 3WE3A 4HLYA 1Z91A 4A6DA 4CGZA 1T2KA 2ESHA 2YPRA 4I0BA 2LDUA 4S05A 5BOXA 2YSRA 2XIGA 5L3CA 1D5VA 1LEAA 1LVAA 4Y17A 3M7GA 3V8KA 1U6GA 4MTDA 2E1NA 2DQLA 2A3SA 2V1DA 2DLLA 2HGCA 1J5YA 3LAPA 4B8XA 1I1GA 4EJWA 2ZJ2A 2VT3A 2IA0A 3GVAA 2IA1A 1GXQA 1FYLA 1ZHFA 4HF1A 3NQOA 5J8FA 4PZJA 3FM5A 4OOIA 5IT9K 1TNSA 5DYMA 1FYKA 4M74A 5JVTA 1BIBA 4ENKA 5HDGA 4BNCA 2FE3A 3JSPA 1XDUA 4KMUX 3F21A 5LGUA 4OIPF 3ZQ7A 2Q2EA 2ZO4A 4MEXF 2O0YA 4IJAA 3QPHA 2CO5A 1HBXG 3FF5A 2GAUA 3M9AA 1G3SA 3O2PE 1P2FA 2DAOA 4LJZF 2OZ6A 1P4XA 2ELHA 2QBYA 4L9TA 3CO7C 4PGGA 4LG0B 1DDNA 1FNNA 3FX3A 5ICEA 3ZMTA 1MD0A 1YIOA 2R7FA 5ICCA 4I0AA 3H92A 3DXJF 2ACJA 3DP7A 1X3UA 5A2QK 4WF2A 5E1WA 3TQNA 2EV0A 2P8TA 1IXSB 1U3EM 3MCZA 1LEBA 1Z05A 4Q5SF 1YTYA 1OYIA 1XMKA 1JHFA 2L02A 1ON2A 1R7JA 3T8RA 4OIQF 4HX8A 4WWCA 1O3SA 1FT9A 3TO9A 1S3JA 3SQNA 3COAC 4ESFA 2M8EA 4Q48A 4EJTA 2ZXJA 4HV5A 1HXDA 4GCVA 1XB4A 4E70A 3HRUA 2PJPA 1BM9A 1SFXA 1J7KA 3RTRA 1K78B 5CJ9A 1B59A 5D8KB 2EFWA 3LWFA 5FFZA 3ABTA 1B4AA 2P7VB 2PEXA 3B73A 3GXOA 5HS9A 1LNWA 3TGNA 2G7UA 1ON1A 4M6XA 5L3EA 4EGYA 3FXUA 3FMRA 2Z99A 1D8JA 4UXNA 2M87A 3RPUA 4N9IA 3EYYA 5HLIA 4GYGA 3DEUA 3IKVA 4R1HA 2ZCWA 3EUHA 4MHGA 3ABUA 2PG4A 1HKTA 2HYFA 3TKYA 1KYZA 2QUFA 3E5QA 2UXNA 3IRQA 2P5LC 4BXUA 4IHSA 3Q9SA 4KICA 2A61A 2A5YB 4HF0A 3KCCA 1TW3A 2O3FA 3ECOA 3WTYC 3I4PA 1YS7A 3OV8A 3O3KA 1JHHA 2DTRA 1K78A 2ZBKA 4L9JA 2EFQA 2UWMA 1V4RA 3AAFA 2ZNYA 2V1UA 3TOBA 4HDVA 5AONA 2HDCA 2XASA 3I64A 5D5WB 2VN2A 1MDMA 2H27A 4LMYA 5FO5A 1Z6TA 3F8FA 3K1PA 1IAWA 2FOKA 3WTSC 2K02A 5TJJA 2IPQX 4L9NA 1XSVA 2PN6A 3IWFA 1IN6A 3SFZA 3CJNA 5KVRA 5LEJA 2H6CA 5DCFA 1IN5A 3HSRA 1U78A 1U5TB 1L0OC 1Q1HA 4LLLA 2M45A 1KA8A 3QU3A 4O5VA 2EB7A 2OA4A 2HZTA 1ZRFA 2DQRA 4MNUA 4LLNA 2AS5F 5BS6A 3CUQB 4NB5A 5LHGA 4KDPA 3ZP5A 1K6OA 2P4WA 3N4MA 1Y0UA 4BHCA 4IRHA 3GWZA 3E5UA 2PBIA 2HS5A 2Y0MA 1TNTA 1XSDA 1HW2A 1Z1DA 1Z7UA 2Q0OA 3GLXA 2EA2A 4IVNA 4O6JA 2ZKZA 3DV8A 3FWEA 4EJUA 2A6EF 2XV4S 3F22A 5D8LB 2MH9A 1FYMA 4HLXA 3ISPA 5LGNA 1DPRA 4EGZA 5FB2A 5F6FA 2IA2A 2FF4A 3GFLA 4OMYA 2A6HF 2L01A 3J80K 1J59A 1F4KA 3CUQA 5H20A 2CGPA 1G6NA 5D5XB 4UVBA 4UNOA 1KU3A 1XDSA 2PI0A 4Q47A 4ZZLA 2FA5A 3G73A 5F1RA 1R5GA 2HFHA 2Z5UA 2STTA 2EV5A 3QRFF 1A04A 2XAFA 2Y48A 2X0LA 1U2WA 3BOQA 3E6DA 1IXCA 1LDDA 4ON0A 1FBQA 1CF7B 1C0WA 2DO7A 2HTSA 2WV0A 4OINF 2V9VA 1VTNC 4M72A 4AD9A 3J81Z 2RN7A 2XAHA 3HHGA 3HSEA 3QP5A 2LKPA 1XD7A 2JZYA 4MTEA 2L3DA 2RKHA 1TW2A 3WU1B 4QWQA 2QLZA 2UZKA 1HSJA 1GVJA 1FLIA 2IJLA 1OYWA 2XVCA 3U1DA 1LDKB 4CICA 3I53A 4EJVA 3L09A 3V4GA 5D5VB 3F8CA 1STZA 3L00A 3WG9A 2XKOA 3HRTA 4HBLA 1TQPA 5FD6A 1I1SA 2EWNA 2CQKA 2HOEA 3FHZA 4ENNA 3IC7A 4HX7A 1SD4A 5J6XA 3VODA 4YFXF 2ZNZA 1FP2A 5ICGA 1SD5A 2DW4A 4RGXA 1SD6A 3QU6A 4HF2A 1TQIA 2K7LA 3I5UA 4EVIA 4Z2YA 4GO1A 3M8FA 4RGUA 2FBKA 2KIMA 3KP3A 3FXQA 1IXRC 3HYIA 4JBAA 4A0YA 5D4RA 2C6YA 1V3FA 3D0SA 4RAZA 1U5TC 1UCRA 3RKWA 1ZN2A 4U0YA 5LHIA 2O6GE 4IHTA 2JT1A 4ENMA 3E6MA 2D1VA 4U7BA 5CVJA 1WSUA 1OYYA 3HOTA 2VC0A 3ELKA 4R8HA 3K2ZA 1R1TA 5HLGA 2E7WA 4RGRA 2Q8KA 3W6JB 1KU7A 2LSOA 3FMSA 1P4AA 2F5DA 1D3YA 3JSOA 1J0RA 4A5NA 5HVQC 4L18B 2V79A 4M9SA 2J5PA 5AIQA 3FM3A 3GX4X 2FQ3A 2FNAA 3QOPA 1BC7C 1ZH5A 1WWXA 4HW0A 4ZYEA 1XGNA 2GQQA 3G3ZA 1OMIA 3E5XA 3MEXA 3E6CC 3VEPA 1CGPA 3GW2A 4YG2F 3TO6A 3DFGA 4G6QA 3KP6A 1HKQA 4G94A 2O8XA 5FLXZ 2B0LA 1USTA 2CW0F 3REOA 2WWYA 2COMA 3RPQA 3Q5FA 2NYXA 3F6VA 3K1MA 4GXOA 3CDHA 3LA7A 1IUYA 2K4JA 4OIOF 4LK1F 2CYYA 3HIFA 4OMZA 1YS6A 4L9VA 2K4BA 3WGHA 3JTGA 3R4KA 5K5RA 1ZYRF 3HHHA 4CHUA 4HAMA 5HLHA 1IN4A 2FSWA 4ZZDA 1RUNA 4UV8A 4ZYGA 2M30A 2O61A 4G8XA 5JHUA 1T6SA 3JAMZ 3WTTC 2MD5A 3QPTA 4KN7X 4L5JA 1SD7A 5TRDA 1LQ1A 3MAJA 1SMYF 1IZ1A 5ICFA 2FMLA 4AVPA 4FT8A 3E6BA 2K86A 2GIVA 2QQ9A 2O03A 4KIFA 1O3TA 4ZYHA 2YU3A 1DPUA 2QYOA 5D4SA 2GZWA 1Z9CA 3RKYA 4OU0A 5DV5A 1SAXA 1CF7A 4KNYA 2FEZA 4PGHA 1O7FA 1P92A 2VBYA 4LFUA 4CO8A 4YIIA 2ZMEB 1O3QA 4ZH4F 1H9TA 2DK5A 3NEUA 4N0BA 4WX9A 5FGMA 1ZREA 4NQWA 1KQ0A 4EM2A 4BHBA 3T0YA 2NNNA 1ZLKA 2MA3A 2IW5A 3GZ5A 2W57A 1XGMA 1KU2A 1K7AA 3FMQA 1B6AA 5EEHA 2WC2A 4P9FA 3GFJA 2MLKA 3C18A 3ZMDA 5A2QZ 4GYIA 2Z9OA 4FX0A 3IRRA 2ADUA 2MH2A 3Q9VA 5DUKA 5BPDA 3R0JA 2G9WA 1FBSA 3O6BB 2P6TA 2MC3A 1QQIA 1ZGAA 1MZBA 3C3WA 3H3UA 4XSXF 5KK1A 4WXDA 5CVVA 1W7PD 2TDXA 2DU9A 4G9YA 2JTVA 2PLYA 5E20A 1T0FA 4QLCU 1G3TA 4ZYDA 1W5TA 3GO5A 5HS8A 1OPCA 3RKXA 2HQNA 1YQAA 2L54A 3LA2A 4M9ZA 3RDIA 3JTHA 5HDNA 4RB2C 3SZPA 1IF1A 2NS0A 2W85A 1SFUA 2OQGA 3T8TA 4M71A 3NRVA 3R60A 4WK8F 5CVRA 1PP8F 3IHUA 3FXRA 2FBHA 2V6CA 4MEYF 4ESJA 4P5OA 5L3DA 5LRSA 1IW7F 2VT2A 2RDPA 1W7PA 4UVAA 4BQAA 4K2EA 4LD5A 3KLOA 1IRFA 4BAYA 5J8CA 4WXHA 1MJBA 2P6SA 4YFKF 5DCMA 3K9TA 1BN5A 3R0AA 2A68F 3SZTA 5CVIA 4IPAA 4HDUA 2FBIA 5H6QA 1FC3A 1OR7A 1W7PB 4CXFA 4BH9A 4U7DA 2D1HA 2JPCA 1QO0D 1WI9A 2CWEA 4HA8A 5LHHA 4I09A 1KQ9A 5LLQA 3GEZA 3K69A 3IWZA 1SMTA 3F8NA 2X4HA 5L3FA 4IRGA 3R6SA 3TO7A 3P9IA 1ZG1A 3ECHA 2KRFA 1BI2A 1ZARA 4EJOA 4LB5A 3K0LA 2DFIA 2F5CA 3S2WA 4L5IA 3U9GA 3WODF 1UFMA 1RI7A 2JSCA 3LFKA 2LF8A 2VE8A 2EFPA 5CLSA 5LEKA 3SHFA 2D2WA 1PP7U 2XROA 1MKMA 4EQQA 4G7OF 3CUQC 3F23A 3J81K 1S8NA 1FY7A 1R22A 4JQFA 2H94A 5HOOA 1XN7A 3TDUC 1QZYA 2NRAC 2BV6A 2IRFG 1XSXA 3BPVA 4WXCA 3DQVC 5ILSA 4I2OA 1HW1A 4M9XA 2OU2A 1K79A 5BQTA 2DK8A 1HQCA 2QBYB 5JFRA 1OKRA 4S04A 1H0MA 2XAGA 2KKOA 2YX7A 2BGCA 2GA2A 2XHKA 3ULQB 3WGGA 1YW7A 4U88A 4Y13A 4A5MA 4CZZA 1WKMA 3ZN1A 3BDDA 2IVMA 1FZPB 4DNCA 2BBYA 3J7AO 3WU0A 2A07F 5FD5A 1J9IA 2NNYA 3R61A 3VFZA 5AIPA 1ODDA 4ETSA 2UXXA 5ED4A 1FX7A 1BJAA 1EH6A 2Y75A 3SXYA 1RUOA 3WTUC 2XUBA 1UB9A 1EH7A 3ZMVA 4AIKA 2KJBA 3LAJA 2QZ8A 1XGOA 1QGPA 1KGSA 2VODA 5LBQA 4HX4A 1I6XA 3WTWC 1XMAA 1JGSA 3U2RA 3WTXC 1R23A 2FRHA 3KP5A 4G7ZF 2A69F 5HDKA 2NAZA 4ESBA 2RGVA 5K5QA 1BBYA 1WRJA 1PUEE 4L0YB 1RZ4A 3I54A 3HTSB 3JAMK 4P55A 3V8LA 1XCVA 4KYWA 3ZMUA 3RYPA 5E8GA 2L4AA 2P5VA 1KYWA 3T5XA 4AWXB 2XRNA 3P7NA 4AIHA 2H6BA 4RB0A 1YLFA 2ZFWA 2OZUA 1FP1D 1EH8A 2WTEA 3F8BA 4YFNF 4LLGF 3V7RA 3B02A 4LK0F 2OBPA 1D8KA 5E17F 2HKXA 3RJPA 1RNLA 2GXGA 3GYHX 3BZ6A 5IT3A 5FFXA 4N9HA 5DUIA 2VC1A 4IXAA 5IT9Z 1Z6RA 3GFIA 4MGRA 1J2XA 4A6EA 1B9NA 3DPLC 3ML6A 4UVCA 1ZRCA 2ESNA 3HOSA 5CYVA 2OD5A 5ILVA 2MBFA 1R5HA 5E1XA 2DPDA 2ETHA 1KQ8A 2IT0A 3VB2A 4RAYA 2FMYA 2GWRA 1F9NA 5LGTA 1QPMA 3ZN0A 5CVUA 1GHCA 4IRIA 1R58A 4PCQA 1MGTA 3KFWX 3KE2A 4U0VA 3F6OA 4P96A 3BP8A 1S29A 3DPTA 2YR2A 3I59B 4UHTA 1B9MA 3TOAA 1IN8A 4KFCA 1YW9A 4LB6B 1BIAA 3L7WA 2ISYA 3L9FA 5E8IA 4EMSA 1R1UA 2FNPA 3WTZA 1JXSA 2YX4A 4KN4X 2ZMEA 3WTVC 4G7HF 5BPIA 4CDGA 3K1NA 1YYVA 2VBZA 2P5KA 5JI6A 4XLNF 3LQRA 2M1BA 3EQLF 3GUDA 4HQEA 2VBWA 1QNTA 1MDMB 1H9GA 2XGXA 5L3BA 2RV8A 4Q4ZF 3W6KB 1EV7A 2R7DA 3MWMA 1F5TA 4L0ZB 1AOYA 1RIOH 3KLNA 1GXPA 5BMZA 3KZZA 3BROA 2K27A 1LB2A 4Y15A 3M8EA 1AWCA 2M5WA 1FPQA 4RS8A 3MZHA 4GGGA 4HV6A 2JPBA 3V7CA 2VBXA 1ONVA 4UV9A 3LQQA 5HS7A 2E1CA 3HRSA 2XKPA 4XSZF 3P9KA 2W24A 1XGSA 1JE8A 3DF8A 1ZRDA 2VONA 3V7SA 5DD4A 2H09A 1E17A 3KP4A 4ENJA 3VOEA 1S7OA 4P9UA 3WE2A 1ZAOA 5DCMB 2L4MA 3I0TA 4M6YA 2F5EA 2DPUA 1MJAA 4JK1X 1HW5A 1T39A 3RIRA 2CSOA 3ZMSA 2RQPA 2HR3A 3ERED 2PQ8A 1S7AA 2EA4A 3KZYA 5FLXK 3MZYA 4EM1A 1NHAA 1DUXC 3D5LA 2AXLA 1YG2A 3HTUA 2LNBA 2LF7A 1G4DA 2KIFA 1TQMA 1FWZA 2BEOA 3L2CA 2HQRA 5H6RA 2EFOA 4KA4A 1I5ZA 4DQ2A 4XBFA 2QM3A 3CUOA 1I27A 3HSFA 4YIFA 4UUVA 3KP2A 3BJAA 3KEOA 2RVCA 3T1BA 3IKTA 3H3ZA 6PAXA 2KJCA 2D45A 1B1BA 4KUMA 4LG0A 1T98A 2BYVE 2PMUA 1U8RA 3CTAA 2KIUA 4XLPF 1XCBA 2HKOA 3GZ6A 4A0ZA 4O3MA 1ZGJA 3BPXA 3E3VA 1BOAA 1TLHB 3M1EA 1G3WA 1YFHA 1WQ2A 1QBJA 2G7HA 4EM0B 2OQRA 2W84A 3DKWA 4I7HA 1BI0A 4U0WA 1UHMA 4I02A 5E18F 3KP7A 1J75A 4AIJA 3BJOA 3P9CA 3E97A 3PQJA 1O7LA 3MFKA 3EYIA 4A2UA 4HYEA 4PDKA 2RNJA 3HRMA 4I98B 2BE5F 1ZLJA 5K1YA 1ZG3A 2STWA 3HUGA 3TDZC 1W5SA 3FZVA 1YO5C 3J80Z 3F3XA 4HZFA 4NHJA 2GA1A 3F8MA 4LGWA 3EETA 5ILUA 1O57A 3MQ0A 2DBBA 5E1ZB 2EK5A 1G3YA 1TTYA 2QWWA 3QP6A 1BC8C 1PDNC 3LSTA 2EV6A 1SFEA 4ASNA 4G6DA 1L3LA 1MJ9A 2PFBA 2MLGA 5L3GA 1IRGA 5JR3A 1E2XA 4H0EA 2EJRA 2XAQA 3GFMA 2XAJA 1S6LA 1R1VA 4RB1A 1BI3A 3I58A 2VOPA 5D6EA 4D0PA 2Z33A 4RGSA 4BHPA 1R36A 4HOBA 4RB3C 3BY6A 4IF4A 2IP2A 3I71A 3ZPLA 1ULYA 3KEQA 1KU9A 5F64A 5DDGA 4R79A 4WCGA 4KMFA 1FSEA 3BWGA 2PMHA 1FOKA 4M73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MQ9 F;  1TBX A;  1HST A;  5DEQ A;  3BJ6 A;  3CLO A;  5K5O A;  1R00 A;  4TV7 A;  2F5F A;  2E7X A;  2W25 A;  2CFX A;  4MQV A;  2VXZ A;  1REP C;  4EV0 A;  1IN7 A;  3F72 A;  4F7Z A;  2HWV A;  2QQA A;  2OAZ A;  2QVO A;  1UHW A;  1HKS A;  3ZMZ A;  1ZG5 A;  4FX4 A;  3RYR A;  1O3R A;  3ROU A;  1YW8 A;  2Z3Y A;  3LA3 A;  5ERI A;  5DD8 A;  5D5U B;  3EDP A;  2RC4 A;  1QZZ A;  2CG4 A;  3C7J A;  2ISZ A;  5EEG A;  2QQB A;  3C1D A;  3JW4 A;  3RI4 A;  3PFI A;  3V8J A;  1LJ9 A;  4KIB A;  4OIR F;  1P6R A;  2HYG D;  4KT5 C;  1FBU A;  4FHT A;  2J5O A;  1FSH A;  3WGI A;  4A12 A;  2QEN A;  3PQK A;  4A0X A;  4XRF A;  2FU4 A;  4KIG A;  2V1X A;  4B09 A;  3KET A;  1USS A;  2F2E A;  5LRR A;  1W4M A;  1F1Z A;  4CYD A;  1BI1 A;  4HQM A;  2VE9 A;  1LDJ A;  2P7C B;  2JRT A;  2DT5 A;  2EFN A;  4BYY A;  2R3S A;  1P4W A;  1DP7 P;  2GXB A;  2VOO A;  2FXA A;  3QAH A;  2HEO A;  2HTJ A;  1T38 A;  4I01 A;  3GF2 A;  5D6F A;  3OOP A;  2DI3 A;  3N97 A;  3I59 A;  3CO6 C;  3IL2 A;  1U5T A;  3WE3 A;  4HLY A;  1Z91 A;  4A6D A;  4CGZ A;  1T2K A;  2ESH A;  2YPR A;  4I0B A;  2LDU A;  4S05 A;  5BOX A;  2YSR A;  2XIG A;  5L3C A;  1D5V A;  1LEA A;  1LVA A;  4Y17 A;  3M7G A;  3V8K A;  1U6G A;  4MTD A;  2E1N A;  2DQL A;  2A3S A;  2V1D A;  2DLL A;  2HGC A;  1J5Y A;  3LAP A;  4B8X A;  1I1G A;  4EJW A;  2ZJ2 A;  2VT3 A;  2IA0 A;  3GVA A;  2IA1 A;  1GXQ A;  1FYL A;  1ZHF A;  4HF1 A;  3NQO A;  5J8F A;  4PZJ A;  3FM5 A;  4OOI A;  5IT9 K;  1TNS A;  5DYM A;  1FYK A;  4M74 A;  5JVT A;  1BIB A;  4ENK A;  5HDG A;  4BNC A;  2FE3 A;  3JSP A;  1XDU A;  4KMU X;  3F21 A;  5LGU A;  4OIP F;  3ZQ7 A;  2Q2E A;  2ZO4 A;  4MEX F;  2O0Y A;  4IJA A;  3QPH A;  2CO5 A;  1HBX G;  3FF5 A;  2GAU A;  3M9A A;  1G3S A;  3O2P E;  1P2F A;  2DAO A;  4LJZ F;  2OZ6 A;  1P4X A;  2ELH A;  2QBY A;  4L9T A;  3CO7 C;  4PGG A;  4LG0 B;  1DDN A;  1FNN A;  3FX3 A;  5ICE A;  3ZMT A;  1MD0 A;  1YIO A;  2R7F A;  5ICC A;  4I0A A;  3H92 A;  3DXJ F;  2ACJ A;  3DP7 A;  1X3U A;  5A2Q K;  4WF2 A;  5E1W A;  3TQN A;  2EV0 A;  2P8T A;  1IXS B;  1U3E M;  3MCZ A;  1LEB A;  1Z05 A;  4Q5S F;  1YTY A;  1OYI A;  1XMK A;  1JHF A;  2L02 A;  1ON2 A;  1R7J A;  3T8R A;  4OIQ F;  4HX8 A;  4WWC A;  1O3S A;  1FT9 A;  3TO9 A;  1S3J A;  3SQN A;  3COA C;  4ESF A;  2M8E A;  4Q48 A;  4EJT A;  2ZXJ A;  4HV5 A;  1HXD A;  4GCV A;  1XB4 A;  4E70 A;  3HRU A;  2PJP A;  1BM9 A;  1SFX A;  1J7K A;  3RTR A;  1K78 B;  5CJ9 A;  1B59 A;  5D8K B;  2EFW A;  3LWF A;  5FFZ A;  3ABT A;  1B4A A;  2P7V B;  2PEX A;  3B73 A;  3GXO A;  5HS9 A;  1LNW A;  3TGN A;  2G7U A;  1ON1 A;  4M6X A;  5L3E A;  4EGY A;  3FXU A;  3FMR A;  2Z99 A;  1D8J A;  4UXN A;  2M87 A;  3RPU A;  4N9I A;  3EYY A;  5HLI A;  4GYG A;  3DEU A;  3IKV A;  4R1H A;  2ZCW A;  3EUH A;  4MHG A;  3ABU A;  2PG4 A;  1HKT A;  2HYF A;  3TKY A;  1KYZ A;  2QUF A;  3E5Q A;  2UXN A;  3IRQ A;  2P5L C;  4BXU A;  4IHS A;  3Q9S A;  4KIC A;  2A61 A;  2A5Y B;  4HF0 A;  3KCC A;  1TW3 A;  2O3F A;  3ECO A;  3WTY C;  3I4P A;  1YS7 A;  3OV8 A;  3O3K A;  1JHH A;  2DTR A;  1K78 A;  2ZBK A;  4L9J A;  2EFQ A;  2UWM A;  1V4R A;  3AAF A;  2ZNY A;  2V1U A;  3TOB A;  4HDV A;  5AON A;  2HDC A;  2XAS A;  3I64 A;  5D5W B;  2VN2 A;  1MDM A;  2H27 A;  4LMY A;  5FO5 A;  1Z6T A;  3F8F A;  3K1P A;  1IAW A;  2FOK A;  3WTS C;  2K02 A;  5TJJ A;  2IPQ X;  4L9N A;  1XSV A;  2PN6 A;  3IWF A;  1IN6 A;  3SFZ A;  3CJN A;  5KVR A;  5LEJ A;  2H6C A;  5DCF A;  1IN5 A;  3HSR A;  1U78 A;  1U5T B;  1L0O C;  1Q1H A;  4LLL A;  2M45 A;  1KA8 A;  3QU3 A;  4O5V A;  2EB7 A;  2OA4 A;  2HZT A;  1ZRF A;  2DQR A;  4MNU A;  4LLN A;  2AS5 F;  5BS6 A;  3CUQ B;  4NB5 A;  5LHG A;  4KDP A;  3ZP5 A;  1K6O A;  2P4W A;  3N4M A;  1Y0U A;  4BHC A;  4IRH A;  3GWZ A;  3E5U A;  2PBI A;  2HS5 A;  2Y0M A;  1TNT A;  1XSD A;  1HW2 A;  1Z1D A;  1Z7U A;  2Q0O A;  3GLX A;  2EA2 A;  4IVN A;  4O6J A;  2ZKZ A;  3DV8 A;  3FWE A;  4EJU A;  2A6E F;  2XV4 S;  3F22 A;  5D8L B;  2MH9 A;  1FYM A;  4HLX A;  3ISP A;  5LGN A;  1DPR A;  4EGZ A;  5FB2 A;  5F6F A;  2IA2 A;  2FF4 A;  3GFL A;  4OMY A;  2A6H F;  2L01 A;  3J80 K;  1J59 A;  1F4K A;  3CUQ A;  5H20 A;  2CGP A;  1G6N A;  5D5X B;  4UVB A;  4UNO A;  1KU3 A;  1XDS A;  2PI0 A;  4Q47 A;  4ZZL A;  2FA5 A;  3G73 A;  5F1R A;  1R5G A;  2HFH A;  2Z5U A;  2STT A;  2EV5 A;  3QRF F;  1A04 A;  2XAF A;  2Y48 A;  2X0L A;  1U2W A;  3BOQ A;  3E6D A;  1IXC A;  1LDD A;  4ON0 A;  1FBQ A;  1CF7 B;  1C0W A;  2DO7 A;  2HTS A;  2WV0 A;  4OIN F;  2V9V A;  1VTN C;  4M72 A;  4AD9 A;  3J81 Z;  2RN7 A;  2XAH A;  3HHG A;  3HSE A;  3QP5 A;  2LKP A;  1XD7 A;  2JZY A;  4MTE A;  2L3D A;  2RKH A;  1TW2 A;  3WU1 B;  4QWQ A;  2QLZ A;  2UZK A;  1HSJ A;  1GVJ A;  1FLI A;  2IJL A;  1OYW A;  2XVC A;  3U1D A;  1LDK B;  4CIC A;  3I53 A;  4EJV A;  3L09 A;  3V4G A;  5D5V B;  3F8C A;  1STZ A;  3L00 A;  3WG9 A;  2XKO A;  3HRT A;  4HBL A;  1TQP A;  5FD6 A;  1I1S A;  2EWN A;  2CQK A;  2HOE A;  3FHZ A;  4ENN A;  3IC7 A;  4HX7 A;  1SD4 A;  5J6X A;  3VOD A;  4YFX F;  2ZNZ A;  1FP2 A;  5ICG A;  1SD5 A;  2DW4 A;  4RGX A;  1SD6 A;  3QU6 A;  4HF2 A;  1TQI A;  2K7L A;  3I5U A;  4EVI A;  4Z2Y A;  4GO1 A;  3M8F A;  4RGU A;  2FBK A;  2KIM A;  3KP3 A;  3FXQ A;  1IXR C;  3HYI A;  4JBA A;  4A0Y A;  5D4R A;  2C6Y A;  1V3F A;  3D0S A;  4RAZ A;  1U5T C;  1UCR A;  3RKW A;  1ZN2 A;  4U0Y A;  5LHI A;  2O6G E;  4IHT A;  2JT1 A;  4ENM A;  3E6M A;  2D1V A;  4U7B A;  5CVJ A;  1WSU A;  1OYY A;  3HOT A;  2VC0 A;  3ELK A;  4R8H A;  3K2Z A;  1R1T A;  5HLG A;  2E7W A;  4RGR A;  2Q8K A;  3W6J B;  1KU7 A;  2LSO A;  3FMS A;  1P4A A;  2F5D A;  1D3Y A;  3JSO A;  1J0R A;  4A5N A;  5HVQ C;  4L18 B;  2V79 A;  4M9S A;  2J5P A;  5AIQ A;  3FM3 A;  3GX4 X;  2FQ3 A;  2FNA A;  3QOP A;  1BC7 C;  1ZH5 A;  1WWX A;  4HW0 A;  4ZYE A;  1XGN A;  2GQQ A;  3G3Z A;  1OMI A;  3E5X A;  3MEX A;  3E6C C;  3VEP A;  1CGP A;  3GW2 A;  4YG2 F;  3TO6 A;  3DFG A;  4G6Q A;  3KP6 A;  1HKQ A;  4G94 A;  2O8X A;  5FLX Z;  2B0L A;  1UST A;  2CW0 F;  3REO A;  2WWY A;  2COM A;  3RPQ A;  3Q5F A;  2NYX A;  3F6V A;  3K1M A;  4GXO A;  3CDH A;  3LA7 A;  1IUY A;  2K4J A;  4OIO F;  4LK1 F;  2CYY A;  3HIF A;  4OMZ A;  1YS6 A;  4L9V A;  2K4B A;  3WGH A;  3JTG A;  3R4K A;  5K5R A;  1ZYR F;  3HHH A;  4CHU A;  4HAM A;  5HLH A;  1IN4 A;  2FSW A;  4ZZD A;  1RUN A;  4UV8 A;  4ZYG A;  2M30 A;  2O61 A;  4G8X A;  5JHU A;  1T6S A;  3JAM Z;  3WTT C;  2MD5 A;  3QPT A;  4KN7 X;  4L5J A;  1SD7 A;  5TRD A;  1LQ1 A;  3MAJ A;  1SMY F;  1IZ1 A;  5ICF A;  2FML A;  4AVP A;  4FT8 A;  3E6B A;  2K86 A;  2GIV A;  2QQ9 A;  2O03 A;  4KIF A;  1O3T A;  4ZYH A;  2YU3 A;  1DPU A;  2QYO A;  5D4S A;  2GZW A;  1Z9C A;  3RKY A;  4OU0 A;  5DV5 A;  1SAX A;  1CF7 A;  4KNY A;  2FEZ A;  4PGH A;  1O7F A;  1P92 A;  2VBY A;  4LFU A;  4CO8 A;  4YII A;  2ZME B;  1O3Q A;  4ZH4 F;  1H9T A;  2DK5 A;  3NEU A;  4N0B A;  4WX9 A;  5FGM A;  1ZRE A;  4NQW A;  1KQ0 A;  4EM2 A;  4BHB A;  3T0Y A;  2NNN A;  1ZLK A;  2MA3 A;  2IW5 A;  3GZ5 A;  2W57 A;  1XGM A;  1KU2 A;  1K7A A;  3FMQ A;  1B6A A;  5EEH A;  2WC2 A;  4P9F A;  3GFJ A;  2MLK A;  3C18 A;  3ZMD A;  5A2Q Z;  4GYI A;  2Z9O A;  4FX0 A;  3IRR A;  2ADU A;  2MH2 A;  3Q9V A;  5DUK A;  5BPD A;  3R0J A;  2G9W A;  1FBS A;  3O6B B;  2P6T A;  2MC3 A;  1QQI A;  1ZGA A;  1MZB A;  3C3W A;  3H3U A;  4XSX F;  5KK1 A;  4WXD A;  5CVV A;  1W7P D;  2TDX A;  2DU9 A;  4G9Y A;  2JTV A;  2PLY A;  5E20 A;  1T0F A;  4QLC U;  1G3T A;  4ZYD A;  1W5T A;  3GO5 A;  5HS8 A;  1OPC A;  3RKX A;  2HQN A;  1YQA A;  2L54 A;  3LA2 A;  4M9Z A;  3RDI A;  3JTH A;  5HDN A;  4RB2 C;  3SZP A;  1IF1 A;  2NS0 A;  2W85 A;  1SFU A;  2OQG A;  3T8T A;  4M71 A;  3NRV A;  3R60 A;  4WK8 F;  5CVR A;  1PP8 F;  3IHU A;  3FXR A;  2FBH A;  2V6C A;  4MEY F;  4ESJ A;  4P5O A;  5L3D A;  5LRS A;  1IW7 F;  2VT2 A;  2RDP A;  1W7P A;  4UVA A;  4BQA A;  4K2E A;  4LD5 A;  3KLO A;  1IRF A;  4BAY A;  5J8C A;  4WXH A;  1MJB A;  2P6S A;  4YFK F;  5DCM A;  3K9T A;  1BN5 A;  3R0A A;  2A68 F;  3SZT A;  5CVI A;  4IPA A;  4HDU A;  2FBI A;  5H6Q A;  1FC3 A;  1OR7 A;  1W7P B;  4CXF A;  4BH9 A;  4U7D A;  2D1H A;  2JPC A;  1QO0 D;  1WI9 A;  2CWE A;  4HA8 A;  5LHH A;  4I09 A;  1KQ9 A;  5LLQ A;  3GEZ A;  3K69 A;  3IWZ A;  1SMT A;  3F8N A;  2X4H A;  5L3F A;  4IRG A;  3R6S A;  3TO7 A;  3P9I A;  1ZG1 A;  3ECH A;  2KRF A;  1BI2 A;  1ZAR A;  4EJO A;  4LB5 A;  3K0L A;  2DFI A;  2F5C A;  3S2W A;  4L5I A;  3U9G A;  3WOD F;  1UFM A;  1RI7 A;  2JSC A;  3LFK A;  2LF8 A;  2VE8 A;  2EFP A;  5CLS A;  5LEK A;  3SHF A;  2D2W A;  1PP7 U;  2XRO A;  1MKM A;  4EQQ A;  4G7O F;  3CUQ C;  3F23 A;  3J81 K;  1S8N A;  1FY7 A;  1R22 A;  4JQF A;  2H94 A;  5HOO A;  1XN7 A;  3TDU C;  1QZY A;  2NRA C;  2BV6 A;  2IRF G;  1XSX A;  3BPV A;  4WXC A;  3DQV C;  5ILS A;  4I2O A;  1HW1 A;  4M9X A;  2OU2 A;  1K79 A;  5BQT A;  2DK8 A;  1HQC A;  2QBY B;  5JFR A;  1OKR A;  4S04 A;  1H0M A;  2XAG A;  2KKO A;  2YX7 A;  2BGC A;  2GA2 A;  2XHK A;  3ULQ B;  3WGG A;  1YW7 A;  4U88 A;  4Y13 A;  4A5M A;  4CZZ A;  1WKM A;  3ZN1 A;  3BDD A;  2IVM A;  1FZP B;  4DNC A;  2BBY A;  3J7A O;  3WU0 A;  2A07 F;  5FD5 A;  1J9I A;  2NNY A;  3R61 A;  3VFZ A;  5AIP A;  1ODD A;  4ETS A;  2UXX A;  5ED4 A;  1FX7 A;  1BJA A;  1EH6 A;  2Y75 A;  3SXY A;  1RUO A;  3WTU C;  2XUB A;  1UB9 A;  1EH7 A;  3ZMV A;  4AIK A;  2KJB A;  3LAJ A;  2QZ8 A;  1XGO A;  1QGP A;  1KGS A;  2VOD A;  5LBQ A;  4HX4 A;  1I6X A;  3WTW C;  1XMA A;  1JGS A;  3U2R A;  3WTX C;  1R23 A;  2FRH A;  3KP5 A;  4G7Z F;  2A69 F;  5HDK A;  2NAZ A;  4ESB A;  2RGV A;  5K5Q A;  1BBY A;  1WRJ A;  1PUE E;  4L0Y B;  1RZ4 A;  3I54 A;  3HTS B;  3JAM K;  4P55 A;  3V8L A;  1XCV A;  4KYW A;  3ZMU A;  3RYP A;  5E8G A;  2L4A A;  2P5V A;  1KYW A;  3T5X A;  4AWX B;  2XRN A;  3P7N A;  4AIH A;  2H6B A;  4RB0 A;  1YLF A;  2ZFW A;  2OZU A;  1FP1 D;  1EH8 A;  2WTE A;  3F8B A;  4YFN F;  4LLG F;  3V7R A;  3B02 A;  4LK0 F;  2OBP A;  1D8K A;  5E17 F;  2HKX A;  3RJP A;  1RNL A;  2GXG A;  3GYH X;  3BZ6 A;  5IT3 A;  5FFX A;  4N9H A;  5DUI A;  2VC1 A;  4IXA A;  5IT9 Z;  1Z6R A;  3GFI A;  4MGR A;  1J2X A;  4A6E A;  1B9N A;  3DPL C;  3ML6 A;  4UVC A;  1ZRC A;  2ESN A;  3HOS A;  5CYV A;  2OD5 A;  5ILV A;  2MBF A;  1R5H A;  5E1X A;  2DPD A;  2ETH A;  1KQ8 A;  2IT0 A;  3VB2 A;  4RAY A;  2FMY A;  2GWR A;  1F9N A;  5LGT A;  1QPM A;  3ZN0 A;  5CVU A;  1GHC A;  4IRI A;  1R58 A;  4PCQ A;  1MGT A;  3KFW X;  3KE2 A;  4U0V A;  3F6O A;  4P96 A;  3BP8 A;  1S29 A;  3DPT A;  2YR2 A;  3I59 B;  4UHT A;  1B9M A;  3TOA A;  1IN8 A;  4KFC A;  1YW9 A;  4LB6 B;  1BIA A;  3L7W A;  2ISY A;  3L9F A;  5E8I A;  4EMS A;  1R1U A;  2FNP A;  3WTZ A;  1JXS A;  2YX4 A;  4KN4 X;  2ZME A;  3WTV C;  4G7H F;  5BPI A;  4CDG A;  3K1N A;  1YYV A;  2VBZ A;  2P5K A;  5JI6 A;  4XLN F;  3LQR A;  2M1B A;  3EQL F;  3GUD A;  4HQE A;  2VBW A;  1QNT A;  1MDM B;  1H9G A;  2XGX A;  5L3B A;  2RV8 A;  4Q4Z F;  3W6K B;  1EV7 A;  2R7D A;  3MWM A;  1F5T A;  4L0Z B;  1AOY A;  1RIO H;  3KLN A;  1GXP A;  5BMZ A;  3KZZ A;  3BRO A;  2K27 A;  1LB2 A;  4Y15 A;  3M8E A;  1AWC A;  2M5W A;  1FPQ A;  4RS8 A;  3MZH A;  4GGG A;  4HV6 A;  2JPB A;  3V7C A;  2VBX A;  1ONV A;  4UV9 A;  3LQQ A;  5HS7 A;  2E1C A;  3HRS A;  2XKP A;  4XSZ F;  3P9K A;  2W24 A;  1XGS A;  1JE8 A;  3DF8 A;  1ZRD A;  2VON A;  3V7S A;  5DD4 A;  2H09 A;  1E17 A;  3KP4 A;  4ENJ A;  3VOE A;  1S7O A;  4P9U A;  3WE2 A;  1ZAO A;  5DCM B;  2L4M A;  3I0T A;  4M6Y A;  2F5E A;  2DPU A;  1MJA A;  4JK1 X;  1HW5 A;  1T39 A;  3RIR A;  2CSO A;  3ZMS A;  2RQP A;  2HR3 A;  3ERE D;  2PQ8 A;  1S7A A;  2EA4 A;  3KZY A;  5FLX K;  3MZY A;  4EM1 A;  1NHA A;  1DUX C;  3D5L A;  2AXL A;  1YG2 A;  3HTU A;  2LNB A;  2LF7 A;  1G4D A;  2KIF A;  1TQM A;  1FWZ A;  2BEO A;  3L2C A;  2HQR A;  5H6R A;  2EFO A;  4KA4 A;  1I5Z A;  4DQ2 A;  4XBF A;  2QM3 A;  3CUO A;  1I27 A;  3HSF A;  4YIF A;  4UUV A;  3KP2 A;  3BJA A;  3KEO A;  2RVC A;  3T1B A;  3IKT A;  3H3Z A;  6PAX A;  2KJC A;  2D45 A;  1B1B A;  4KUM A;  4LG0 A;  1T98 A;  2BYV E;  2PMU A;  1U8R A;  3CTA A;  2KIU A;  4XLP F;  1XCB A;  2HKO A;  3GZ6 A;  4A0Z A;  4O3M A;  1ZGJ A;  3BPX A;  3E3V A;  1BOA A;  1TLH B;  3M1E A;  1G3W A;  1YFH A;  1WQ2 A;  1QBJ A;  2G7H A;  4EM0 B;  2OQR A;  2W84 A;  3DKW A;  4I7H A;  1BI0 A;  4U0W A;  1UHM A;  4I02 A;  5E18 F;  3KP7 A;  1J75 A;  4AIJ A;  3BJO A;  3P9C A;  3E97 A;  3PQJ A;  1O7L A;  3MFK A;  3EYI A;  4A2U A;  4HYE A;  4PDK A;  2RNJ A;  3HRM A;  4I98 B;  2BE5 F;  1ZLJ A;  5K1Y A;  1ZG3 A;  2STW A;  3HUG A;  3TDZ C;  1W5S A;  3FZV A;  1YO5 C;  3J80 Z;  3F3X A;  4HZF A;  4NHJ A;  2GA1 A;  3F8M A;  4LGW A;  3EET A;  5ILU A;  1O57 A;  3MQ0 A;  2DBB A;  5E1Z B;  2EK5 A;  1G3Y A;  1TTY A;  2QWW A;  3QP6 A;  1BC8 C;  1PDN C;  3LST A;  2EV6 A;  1SFE A;  4ASN A;  4G6D A;  1L3L A;  1MJ9 A;  2PFB A;  2MLG A;  5L3G A;  1IRG A;  5JR3 A;  1E2X A;  4H0E A;  2EJR A;  2XAQ A;  3GFM A;  2XAJ A;  1S6L A;  1R1V A;  4RB1 A;  1BI3 A;  3I58 A;  2VOP A;  5D6E A;  4D0P A;  2Z33 A;  4RGS A;  4BHP A;  1R36 A;  4HOB A;  4RB3 C;  3BY6 A;  4IF4 A;  2IP2 A;  3I71 A;  3ZPL A;  1ULY A;  3KEQ A;  1KU9 A;  5F64 A;  5DDG A;  4R79 A;  4WCG A;  4KMF A;  1FSE A;  3BWG A;  2PMH A;  1FOK A;  4M73 A; 
#chains in the Genus database with same CATH topology
 4MQ9 F;  4MLO A;  1ACI A;  1TBX A;  1HST A;  3BG5 A;  3OYL A;  5DEQ A;  3GTO J;  1FOX A;  3BJ6 A;  3OIQ A;  3CLO A;  2VQH A;  3I56 I;  1JJ6 C;  5K5O A;  3GTP J;  1R00 A;  3DTK A;  4TV7 A;  1D0Z A;  4G12 A;  2F5F A;  2JSP A;  4BBR J;  2ZJR F;  2E7X A;  2XPV A;  3OYJ A;  4RLF A;  2W25 A;  4ZTF A;  2KZV A;  2CFX A;  4MQV A;  2VXZ A;  1REP C;  1UG2 A;  4EV0 A;  1IN7 A;  3F72 A;  1BL0 A;  1WJB A;  5E3O A;  4F7Z A;  1JKO C;  2HWV A;  2QQA A;  2OAZ A;  2QVO A;  1UHW A;  1MBF A;  1HKS A;  2Z1D A;  2VB6 A;  3ZMZ A;  1ZG5 A;  4FX4 A;  3RYR A;  1O3R A;  3ROU A;  1GLN A;  1YW8 A;  2Z3Y A;  3BR3 A;  3LA3 A;  4F91 B;  1YJN I;  1Y0N A;  5ERI A;  5DD8 A;  5D5U B;  3EDP A;  2RC4 A;  1QZZ A;  2XF6 A;  1IJW C;  3L2V A;  2CG4 A;  3C7J A;  2DFF A;  5GPA A;  1AKH A;  3SDB A;  4M3E A;  1OCP A;  2ISZ A;  5EEG A;  2E5N A;  2QQB A;  1IV8 A;  3C1D A;  4RBO A;  3EPZ A;  4EAT A;  3I4M J;  3LSR A;  4BQO A;  3JW4 A;  2LRD A;  3RI4 A;  3WU2 C;  3B6A A;  3ZQQ A;  3PFI A;  3V8J A;  3NWS A;  3W3C A;  2EZL A;  4HNU A;  2DMP A;  1LJ9 A;  4KIB A;  1UJ8 A;  4OIR F;  1P6R A;  2GIZ A;  4C3I J;  2HYG D;  4I6Z A;  2MAB A;  4KT5 C;  1FBU A;  4FHT A;  4W1U A;  2J5O A;  1FSH A;  3WGI A;  2BY2 A;  5EG0 A;  4A12 A;  2QEN A;  2CQ7 A;  4Y7N J;  3PQK A;  5BNG A;  3ZQI A;  4A0X A;  4IHY A;  4XRF A;  2L9V A;  2W00 A;  3LSM A;  2FU4 A;  4KIG A;  4PK4 A;  2V1X A;  4B09 A;  4B3A A;  3KET A;  4AU7 A;  1USS A;  1BR4 A;  2F2E A;  5LRR A;  1W4M A;  3SFI A;  5B3S H;  1F1Z A;  4CYD A;  1UAA A;  2BHY A;  1BI1 A;  4ZJZ A;  4G6T B;  4HQM A;  2JUG A;  1X2M A;  2VE9 A;  2YU9 J;  1LDJ A;  1SVM A;  2P7C B;  2UUZ A;  2JRT A;  5EJC A;  2DT5 A;  2EFN A;  3C2B A;  4BYY A;  4DGW B;  2F5V A;  2R3S A;  1WHU A;  5FKM A;  1IC8 A;  1P4W A;  2IGM A;  2Q2E B;  4RMN A;  1DP7 P;  2GXB A;  2VOO A;  5E3L A;  3UKG A;  3AG2 H;  2A5W A;  2FXA A;  2L9R A;  4HNV A;  3H9J A;  5JHF A;  3QAH A;  3ABL H;  4A3I J;  3I55 I;  2HEO A;  2HTJ A;  1T38 A;  3VYU B;  4X6A J;  2QF7 A;  1E3O C;  4I01 A;  3GF2 A;  5D6F A;  2HOA A;  3OOP A;  3VSL A;  5C44 J;  3FIW A;  4RLQ A;  2DI3 A;  3N97 A;  3I59 A;  2BOL A;  2DYR H;  2DCE A;  3CO6 C;  3IL2 A;  2NOG A;  1WGX A;  1FMV A;  1U5T A;  2QGU A;  3WE3 A;  1Z91 A;  4HLY A;  5J40 A;  2VQG A;  2V9P A;  1JT6 A;  4C9Y A;  2JA5 J;  4A6D A;  1PUF B;  1WJE A;  4CGZ A;  4D1Q A;  2DA2 A;  2VPL A;  1T2K A;  2ESH A;  2YPR A;  4I0B A;  2LDU A;  4S05 A;  3HL2 A;  2DA5 A;  4XR6 A;  5BOX A;  2YSR A;  1MBE A;  2XIG A;  4RM2 A;  4DYC A;  5L3C A;  1D5V A;  1LEA A;  1LVA A;  4Y17 A;  3M7G A;  3V8K A;  1U6G A;  2HYJ A;  4MTD A;  2E1N A;  3KYC B;  1W1W E;  2DQL A;  3HOW J;  4MO7 A;  1R6R A;  2A3S A;  2V1D A;  2JUC A;  2DLL A;  2NVX J;  3JRD A;  2HGC A;  1J5Y A;  2HDW A;  1B72 B;  3DTI A;  3LAP A;  4B8X A;  3GTG J;  1I1G A;  3LOC A;  4V19 K;  4EJW A;  4BY7 J;  2ZJ2 A;  1EKE A;  3MMY B;  2VT3 A;  2IA0 A;  3GVA A;  2IA1 A;  2VIX A;  5F0C A;  1GXQ A;  3F9K A;  1FYL A;  2OUM A;  1ZHF A;  2ZJQ F;  1FOW A;  4HF1 A;  3NQO A;  5J8F A;  2X6W A;  3QYF A;  4ANJ A;  3CCY A;  4PZJ A;  3FM5 A;  4OOI A;  3CCE I;  1AU7 A;  4AID A;  3K4C A;  1TNS A;  5IT9 K;  1RKW A;  3QYB A;  5DYM A;  1FYK A;  1WJ5 A;  4M74 A;  4DOZ A;  3PL8 A;  5JVT A;  1BIB A;  4ENK A;  5HDG A;  1LFU P;  1JGG A;  1E0E A;  1WZ2 A;  3UNG C;  4BNC A;  1I50 J;  3H1C A;  1JKR C;  2FE3 A;  3JSP A;  3FXM A;  2HPI A;  4XNF A;  3LSH A;  1XDU A;  4C3H J;  4KMU X;  3F21 A;  4B47 A;  5LGU A;  4OIP F;  3ZQ7 A;  1H88 C;  2CUZ A;  3JRI A;  4Y33 A;  2Q2E A;  2ZO4 A;  4MEX F;  4D7N A;  1D1A A;  2O0Y A;  2F4M B;  4IJA A;  2JA6 J;  3QPH A;  2CO5 A;  1HBX G;  4XL9 A;  1MNE A;  3FF5 A;  1K83 J;  4HEA 2;  2GAU A;  3M9A A;  1G3S A;  3O2P E;  4FCY A;  3F0C A;  1P2F A;  3OL3 A;  2DAO A;  4LJZ F;  5KNL A;  1UZC A;  2OZ6 A;  1QU3 A;  1T95 A;  1XMX A;  3SZG A;  1SVL A;  4M3D A;  1P4X A;  2CQQ A;  3MKY B;  2XSJ C;  2DOF A;  3DBH B;  2ELH A;  1MMN A;  2PX9 A;  4AUX A;  3PO3 J;  3G2B A;  2QBY A;  4L9T A;  3CO7 C;  2NS7 A;  4PGG A;  3S2D J;  3TP3 A;  1XTA A;  4BE1 A;  4LG0 B;  2V1N A;  2CMP A;  2L7F P;  1QRY A;  1DDN A;  1FNN A;  3FX3 A;  1VQN I;  3MN2 A;  1VND A;  2M7B A;  5ICE A;  3ZOB A;  1MD0 A;  1YIO A;  3ZMT A;  2Y2Z A;  1U9O A;  2A05 A;  2R7F A;  5ICC A;  3PFY A;  4I0A A;  3CCM I;  3H92 A;  3DXJ F;  3BR6 A;  1VF9 A;  2ACJ A;  3DP7 A;  5M3F J;  1X3U A;  3HPG A;  5A2Q K;  1R4N B;  4WF2 A;  5E1W A;  3TQN A;  4B4C A;  4B43 A;  3OS1 A;  2VJ4 A;  5C4X J;  2EV0 A;  1MND A;  1Q1V A;  2DT7 B;  1ZR4 A;  2P8T A;  2RNG A;  1IXS B;  1U3E M;  3ABM H;  2ECB A;  3MCZ A;  1LPQ A;  3H3V K;  1LEB A;  1EF4 A;  2DFE A;  1HOM A;  1Z05 A;  3DU5 A;  4NC7 A;  4Q5S F;  4Y4R A;  4J19 A;  1YTY A;  4A3L J;  3H5N A;  1OYI A;  3VYS B;  1XMK A;  1JHF A;  3W2V A;  2L02 A;  1ON2 A;  1R7J A;  3T8R A;  4OIQ F;  4HX8 A;  3U21 A;  4WWC A;  3JRC A;  1O3S A;  2XC7 A;  1FT9 A;  1TP4 A;  1X4P A;  3TO9 A;  1S3J A;  3SQN A;  3COA C;  4FAS D;  4ESF A;  2M8E A;  4Q48 A;  3SYT A;  2BW3 B;  5B5E C;  4MFD A;  4EJT A;  1TWH J;  2F4I A;  2KRH A;  2ZXJ A;  4HV5 A;  5E3M A;  1HXD A;  4GCV A;  2Y31 A;  2WAE A;  1VQK I;  2GLO A;  3PIO F;  1XB4 A;  4FIS A;  4RM3 A;  4E70 A;  3HRU A;  2PJP A;  1NG7 A;  3AG4 H;  1S9H A;  1YIT I;  1MNM C;  2KQR A;  1BM9 A;  1SFX A;  3VSK A;  1I3A A;  3SEQ A;  1J7K A;  2ZFU A;  2QA4 I;  4IOA F;  3RTR A;  2H1K A;  3KYD B;  1K78 B;  5CJ9 A;  1B59 A;  1SC7 A;  2DA3 A;  5D8K B;  3LWF A;  2EFW A;  3GTQ J;  5FFZ A;  3ABT A;  1VQ6 I;  1B4A A;  4MIM A;  2P7V B;  2PEX A;  3B73 A;  1DGW Y;  2CQX A;  3SJM A;  3GXO A;  5HS9 A;  1LNW A;  3TGN A;  4XMY A;  4B44 A;  5FRN A;  2BXZ A;  1Z21 A;  5DM7 F;  2G7U A;  2BVM A;  3HEF A;  1B72 A;  1VQ9 I;  1ON1 A;  3A0B C;  4M6X A;  5L3E A;  3VPR A;  4EGY A;  3K70 D;  3FXU A;  3FMR A;  4X0G A;  4E7J A;  4A3K J;  3KPH A;  2X9D A;  2Z99 A;  1D8J A;  1J09 A;  4UXN A;  1V55 H;  2M87 A;  3OY9 A;  3RPU A;  1FIA A;  4N9I A;  2R93 J;  2R5Z B;  3EYY A;  3LNQ A;  4NUB A;  2KZG A;  4GYG A;  5HLI A;  3DEU A;  3IKV A;  4R1H A;  1R49 A;  3LSP A;  2ZCW A;  1MMD A;  1IRZ A;  3EUH A;  4MHG A;  4D7M A;  3ABU A;  1R71 A;  2PG4 A;  1HKT A;  2HI3 A;  2R5Z A;  2Y9Z A;  2HYF A;  3TKY A;  1DU0 A;  5IOY A;  1KYZ A;  2QUF A;  3E5Q A;  2UXN A;  4V2F A;  3IRQ A;  2P5L C;  2UV1 A;  3AKZ A;  4BXU A;  4IHS A;  2RQQ A;  3Q9S A;  4FE4 A;  3BZC A;  4KIC A;  2A61 A;  2M8G X;  3BG9 A;  5KAF C;  3OSF A;  2DJI A;  4ZYA A;  2HOT A;  2A5Y B;  4HF0 A;  3KCC A;  1TW3 A;  4M3F A;  2ME6 A;  2O3F A;  3ECO A;  1GV2 A;  3WTY C;  2L9S A;  3I4P A;  1YS7 A;  3OV8 A;  5CQG A;  3O3K A;  2DTR A;  1JHH A;  3M1C A;  3ASO H;  5GAD J;  2KLO A;  1U8B A;  1K78 A;  2E35 A;  1VQP I;  2QKL B;  2ZBK A;  4L9J A;  4QPO A;  1D1B A;  4H4K C;  5HNF A;  2CQN A;  2EFQ A;  1V5F A;  2BY0 A;  2L9N A;  2UWM A;  1V4R A;  3G71 I;  3AAF A;  4XLF A;  4BBS J;  2ZNY A;  3BLY A;  1IG7 A;  2V1U A;  1DU6 A;  2ICW G;  3TOB A;  3S2H J;  4HDV A;  2MSY A;  5AON A;  2HDC A;  2XAS A;  1X1C A;  3I64 A;  3A1Y A;  5GAG J;  2VN2 A;  5GTI C;  5D5W B;  1MDM A;  2H27 A;  4LMY A;  5FO5 A;  1Z6T A;  1ZGW A;  1JKQ C;  3F8F A;  3CCL I;  3K1P A;  3PNY A;  1QHG A;  1IAW A;  2FOK A;  2IBD A;  4PSW A;  2OV7 A;  2Y9Y A;  3OS0 A;  4N4O B;  3WTS C;  2K02 A;  5TJJ A;  4C2U A;  2IPQ X;  4P1W A;  4L9N A;  4BJT A;  1XSV A;  2G0E A;  2PN6 A;  3IWF A;  1IN6 A;  3SFZ A;  1ETQ A;  3CJN A;  5KVR A;  3G1O A;  5LEJ A;  3FXK A;  1RET A;  2MYS A;  2H6C A;  5DCF A;  1IN5 A;  2Y0S N;  3HSR A;  1U78 A;  1U5T B;  1L0O C;  2B7E A;  1Q1H A;  1LFB A;  4LLL A;  2IEK A;  2M45 A;  3PJR A;  1KA8 A;  1W36 C;  3C2H A;  4II3 A;  3QU3 A;  4O5V A;  2EB7 A;  2OA4 A;  4C30 A;  2HZT A;  3GZN B;  4L5E A;  1ZRF A;  2DQR A;  3PSI A;  4MNU A;  4NC8 A;  4LLN A;  2AXT C;  3BTL A;  2AS5 F;  5IYC J;  1CQT A;  3IH4 A;  3JRB A;  5BS6 A;  2HVR A;  3CUQ B;  3FIS A;  2GXA A;  2P0W A;  2QSG X;  4NB5 A;  5LHG A;  3ZP5 A;  4KDP A;  1MBG A;  1K6O A;  2P4W A;  3N4M A;  1Y0U A;  2FUG 2;  2NS8 A;  4BHC A;  4DBR A;  1MMA A;  4IRH A;  2OF7 A;  3GWZ A;  3K4L A;  4XOR A;  3L2W A;  3E5U A;  3LSJ A;  2PBI A;  1KON A;  2HS5 A;  2Y0M A;  4BEH B;  1TNT A;  1XSD A;  1HW2 A;  1Z1D A;  1Z7U A;  3K10 A;  2ZXI A;  3W2A A;  2Q0O A;  2E1O A;  3GLX A;  2EA2 A;  4IVN A;  4O6J A;  1VQ5 I;  2ZKZ A;  3DV8 A;  3FWE A;  4EJU A;  2A6E F;  2WBM A;  3DU6 A;  1ZK8 A;  4XLA A;  1YX5 A;  2XV4 S;  3F22 A;  4KIT B;  5D8L B;  2MH9 A;  5K7H A;  1FYM A;  4CYC A;  2K85 A;  4HLX A;  3K70 C;  2Y0S A;  3ISP A;  5LGN A;  3OOU A;  2DMN A;  1DPR A;  3CCS I;  4EGZ A;  5FB2 A;  5F6F A;  2IA2 A;  2FF4 A;  2VJJ A;  3GFL A;  1WFX A;  2VUM J;  2E5Z A;  4OMY A;  4BU2 A;  2CW7 A;  3S1Q J;  2VXD A;  1SFK A;  2DT6 A;  4KJZ A;  2A6H F;  1N25 A;  3DLA A;  2L01 A;  3J80 K;  1J59 A;  2K3F A;  2HPM A;  1F4K A;  3CUQ A;  5H20 A;  1X4O A;  2JN6 A;  3K4N A;  1G6N A;  2CGP A;  5D5X B;  1HF0 A;  2GBY A;  4UVB A;  1VQO I;  1AA7 A;  3HKZ A;  4UNO A;  2JVG A;  1KU3 A;  1XDS A;  3P5J A;  3DBL B;  2CUE A;  4UUS A;  1OJL A;  4YEJ A;  2PI0 A;  4Q47 A;  2R7T A;  3OYI A;  2RAE A;  4ZZL A;  2FA5 A;  3G73 A;  1JKP C;  4NQW B;  5F1R A;  2M4G A;  2X48 A;  3JRG A;  2E60 A;  1R5G A;  2HFH A;  2XGD A;  2Z5U A;  2STT A;  4XN3 A;  2BHZ A;  1OCO H;  2EV5 A;  3QRF F;  1A04 A;  3BR5 A;  2XAF A;  3FDY A;  1VQM I;  1M1E B;  2LKS A;  2LVS A;  2Y48 A;  2X0L A;  1U2W A;  3BOQ A;  2VJ5 A;  2WA0 A;  1X1A A;  3WHC A;  2VKD A;  3BG3 A;  1P7J A;  3E6D A;  3QOE A;  1IXC A;  1LDD A;  4ON0 A;  2X6Y A;  1FBQ A;  1CF7 B;  3DKY A;  4NDL A;  1C0W A;  2DO7 A;  3DKX A;  2HTS A;  2LP0 A;  3S14 J;  2BZT A;  2WV0 A;  4OIN F;  2V9V A;  2R7R A;  4RDU A;  2CS3 A;  1VTN C;  3B6C A;  4M72 A;  2DOA A;  4AD9 A;  3N05 A;  1ORK A;  3J81 Z;  3L2U A;  1TC3 C;  3CJR B;  2RN7 A;  2XAH A;  3HHG A;  2EPF A;  2KMU A;  3HSE A;  3QP5 A;  1OCC H;  2LKP A;  1XD7 A;  2JZY A;  4MTE A;  2L3D A;  2RKH A;  1TT0 A;  1TW2 A;  3BR1 A;  3WU1 B;  4QWQ A;  2QLZ A;  2UZK A;  2CRG A;  1WJA A;  1HSJ A;  1GVJ A;  3OYC A;  4LG3 A;  1FLI A;  2IJL A;  3AG3 H;  4LIT A;  4KIS A;  3CD6 I;  3HM5 A;  1OYW A;  1S5L C;  2XVC A;  3G1L A;  1VI0 A;  3U1D A;  2VQL A;  3S3O A;  1LDK B;  1LUJ B;  4CIC A;  3PUB A;  3I53 A;  4EJV A;  3L09 A;  3V4G A;  4RAF A;  5D5V B;  4B48 A;  3F8C A;  1GDT A;  1STZ A;  3L00 A;  3WG9 A;  2XKO A;  3HRT A;  4E7K A;  4HBL A;  1TQP A;  3FKJ A;  5FD6 A;  2DDB A;  1I1S A;  3NAR A;  2EWN A;  2CUJ A;  2CQK A;  1E3H A;  2HOE A;  2XGE A;  3FHZ A;  3IC7 A;  4ENN A;  4HX7 A;  1G8X A;  5HOD A;  1SD4 A;  5J6X A;  2NVY J;  2P81 A;  1QZE A;  4I99 C;  2ME0 A;  3VOD A;  4YFX F;  1BW5 A;  4XK4 A;  2ZNZ A;  3DCF A;  4B3X A;  1FP2 A;  5ICG A;  1SD5 A;  3HOV J;  2DW4 A;  4HG2 A;  4RGX A;  4Y52 J;  1SD6 A;  2XPU A;  1T56 A;  1LFP A;  5EGO A;  5IPA A;  3QU6 A;  4HF2 A;  2EIN H;  1TQI A;  1MIJ A;  1Y6I A;  1T0F C;  1X3W B;  2K7L A;  3I5U A;  4Z2Y A;  4EVI A;  2DA7 A;  2EIL H;  4GO1 A;  2JJ7 A;  3M8F A;  2BVL A;  2LMD A;  2FBK A;  4RGU A;  3PIP F;  5B1B H;  2KIM A;  1ITY A;  3KP3 A;  3FXQ A;  3OYH A;  1ETK A;  1R4M B;  5IOZ A;  1IXR C;  2L7Z A;  3HYI A;  1SAU A;  4JBA A;  3FXO A;  4A0Y A;  5D4R A;  2C6Y A;  1V3F A;  3D0S A;  1G2H A;  1XC5 A;  4C2M J;  2HXI A;  4BEH A;  2R4G A;  5LFA A;  4XLC A;  4RAZ A;  1U5T C;  3BCA A;  1UCR A;  3RKW A;  1ZN2 A;  2X6X A;  3VDX A;  2PMZ A;  4U0Y A;  4ITV A;  5LHI A;  2O6G E;  2M7A A;  3HC7 A;  3S15 J;  1ETX A;  4XM3 A;  4IHT A;  2Q1Z B;  3A03 A;  2JT1 A;  4ENM A;  5EZH A;  2XRL A;  2AHQ A;  4BS9 A;  2BY1 A;  3E6M A;  2O8K A;  2D1V A;  4U7B A;  5CVJ A;  1WSU A;  1OYY A;  3DEW A;  5F27 A;  3HOT A;  2EBI A;  2VC0 A;  4JX5 A;  2W4S A;  3ELK A;  1S72 I;  4R8H A;  3S8P A;  4HNT A;  3K2Z A;  2H8R A;  1R1T A;  4AM3 A;  5HLG A;  2HZD A;  4XOP A;  3LFU A;  5DTD A;  3FK7 A;  3VWB A;  2M4K A;  5J47 A;  2E7W A;  1TWG J;  4RGR A;  3ESW B;  2Q8K A;  3W6J B;  1KU7 A;  5EZG A;  2LSO A;  1W0T A;  3FMS A;  3SDG A;  1P4A A;  5KAI C;  1YHQ I;  2R7U A;  2F6C A;  4C3J J;  2F5D A;  1D3Y A;  3JSO A;  4V2G A;  1MBH A;  2ZB9 A;  4HST A;  1J0R A;  4A5N A;  5HVQ C;  2KL4 A;  1MW7 A;  4L18 B;  2V79 A;  3BCB A;  3L2Q A;  4M9S A;  1KZH A;  2J5P A;  3PNT A;  5AIQ A;  3FM3 A;  4M6V A;  2FQ3 A;  3GX4 X;  4XQF A;  1Y1W J;  2FNA A;  2LC2 A;  3QOP A;  1BC7 C;  2MFZ A;  3TW7 A;  1ZH5 A;  2DMU A;  3BR2 A;  5E79 C;  1WWX A;  4HW0 A;  5CPR B;  5TGT A;  4ZYE A;  1XGN A;  2GQQ A;  3NAU A;  1B8I A;  3G3Z A;  4E7I A;  1OMI A;  3E5X A;  3MEX A;  3X2Q H;  3IV5 A;  1Z7L A;  2IS1 A;  3E6C C;  3VEP A;  1CGP A;  3GW2 A;  4YG2 F;  3TO6 A;  4I76 A;  3DFG A;  4G6Q A;  4XLE A;  3KP6 A;  1WPK A;  1SFO J;  3H9Q A;  4A3B J;  3CCU I;  1HKQ A;  2O5R A;  4G94 A;  2O8X A;  5FLX Z;  1VQL I;  4NBQ A;  3OYK A;  2B0L A;  3ZR8 X;  1UST A;  2CW0 F;  4F92 B;  3REO A;  2WWY A;  2COM A;  3RPQ A;  3Q5F A;  2NYX A;  3F6V A;  4PJ0 C;  2B9S A;  5JVG F;  2LLK A;  3K1M A;  4ZTJ A;  5JLW A;  1TT5 B;  2X85 A;  4GXO A;  3RZD J;  1BJZ A;  3CDH A;  3LA7 A;  1IUY A;  3CCQ I;  1NTC A;  3OYE A;  1SEU A;  2K4J A;  4OIO F;  1QHH D;  4LK1 F;  2CYY A;  5LD2 C;  3HIF A;  4OMZ A;  1YS6 A;  1T8I A;  4L9V A;  1YRN B;  4Z6Y A;  3G4S I;  3JRE A;  3DTE A;  2EZI A;  2K4B A;  3WGH A;  3JTG A;  3R4K A;  5K5R A;  1ZYR F;  2R5Y A;  3HHH A;  4CHU A;  3CP2 A;  2H1L A;  4HAM A;  5HLH A;  2LFB A;  1IN4 A;  5KHD A;  2HDD A;  3BR0 A;  1IV6 A;  2FSW A;  2IXS A;  4ZZD A;  1RUN A;  1WVR A;  4XKC A;  2R5Y B;  4UV8 A;  1TZL A;  4ZYG A;  3I9V 2;  2M30 A;  2O61 A;  4G8X A;  3GCM A;  3TW6 A;  1FTT A;  2MC4 A;  4LIU A;  1X1B A;  2DTZ A;  1T6S A;  3JAM Z;  5JHU A;  3WTT C;  4CCL A;  2VKV A;  4QTR A;  2ELK A;  4BE0 A;  3GME A;  2MD5 A;  3QPT A;  4KN7 X;  1YRN A;  2WAQ A;  4CCN A;  2CV1 A;  2TCT A;  3TP0 A;  4L5J A;  1SD7 A;  5TRD A;  1LQ1 A;  3MAJ A;  1SMY F;  1IZ1 A;  1Y56 A;  5ICF A;  1A35 A;  2WAF A;  2FML A;  1R9T J;  4AVP A;  4FT8 A;  3E6B A;  2K86 A;  1ETO A;  2GIV A;  2QKM B;  3FK6 A;  2QQ9 A;  2XAU A;  4EEF G;  1VQ7 I;  4PJM A;  5M3M J;  3RQI A;  2XF7 A;  2O03 A;  3ZQF A;  3GTL J;  4KIF A;  4YEL A;  3SEZ A;  1O3T A;  2LD5 A;  4ZYH A;  4DZP A;  1UEL B;  2YU3 A;  3ERM A;  5EYR A;  1DPU A;  2ZXH A;  2LK2 A;  2QYO A;  4CYC B;  5D4S A;  2GZW A;  1Z9C A;  4PFP A;  4CZC A;  3FKI J;  5FKL A;  5FKN A;  4OU0 A;  5DV5 A;  3RKY A;  5DM6 F;  1SAX A;  3CF5 F;  2VPR A;  2H8W A;  1CF7 A;  3HGY A;  3HUG B;  4KNY A;  2FEZ A;  3UR3 C;  4JOM A;  2HQA A;  3CJQ B;  3FXL A;  5GPC A;  1QVT A;  4PGH A;  1PJR A;  4CA0 A;  2K5C A;  1O7F A;  1P92 A;  2VBY A;  1AHD P;  4LFU A;  4CSW A;  4CO8 A;  2OTJ I;  4A3J J;  3ONQ A;  2FJ1 A;  4CCO A;  2CUF A;  4XOT A;  4YII A;  1ZR2 A;  1ENH A;  2GOM A;  5EG0 B;  2WAQ N;  2M0M A;  3JRA A;  4B1R A;  2ZME B;  4IHX A;  1O3Q A;  4ZH4 F;  1H9T A;  2DK5 A;  2OCC H;  3NEU A;  4N0B A;  4WX9 A;  2PMZ N;  5FGM A;  1ZRE A;  4NQW A;  1KQ0 A;  2VL8 A;  3H9G A;  5J3L A;  3KZI C;  4BHB A;  2LY2 A;  4EM2 A;  3FBI B;  3T0Y A;  3CMA I;  2NNN A;  1XPX A;  3E0J B;  1YOV B;  2LBF B;  1RES A;  4E4H A;  1ZLK A;  5F0H A;  2MA3 A;  4U87 A;  2IW5 A;  3ASN H;  4IL6 C;  4IZZ A;  4OWR B;  4PJL A;  5K7F A;  5EDN A;  4S0H B;  2W7N A;  3GZ5 A;  2W57 A;  5F0F A;  1XGM A;  2QSF X;  2COB A;  3BTJ A;  1LE8 A;  3CMM A;  1KU2 A;  3IAM 2;  1K7A A;  5FRM A;  1OCR H;  3FMQ A;  1B6A A;  5EEH A;  4XKB A;  1IDZ A;  2WC2 A;  4P9F A;  3GFJ A;  2MLK A;  3C18 A;  3S3N A;  5FJ8 J;  4DBQ A;  3ZMD A;  5A2Q Z;  4GYI A;  2Z9O A;  4FX0 A;  1TL8 A;  3IRR A;  2ADU A;  2MH2 A;  3Q9V A;  5DUK A;  5BPD A;  3R0J A;  2ZME C;  2WY7 Q;  2G9W A;  3I4N J;  1FBS A;  3O6B B;  2X51 A;  1VZ0 A;  2VQC A;  2O7O A;  2P6T A;  2MC3 A;  3H36 A;  2VKH A;  2Y69 H;  1QQI A;  2IGN A;  4BDZ A;  1ZGA A;  1MZB A;  2IS2 A;  3QYE A;  4D9J A;  3C3W A;  3H3U A;  4XSX F;  5KK1 A;  1JTX A;  4WXD A;  4FE7 A;  5CVV A;  1QA6 A;  1W7P D;  2TDX A;  3LSI A;  2DU9 A;  4G9Y A;  2JTV A;  5C3E J;  2PLY A;  2RRE A;  5E20 A;  3I3L A;  1T0F A;  3OIO A;  2FX0 A;  1ZEL A;  4QLC U;  1G3T A;  3HPH A;  4ZYD A;  1W5T A;  3OYN A;  1APL C;  3GO5 A;  5HS8 A;  3S1R J;  2R7V A;  2CV2 A;  1OPC A;  3RKX A;  4BQQ A;  4DYR A;  1FMW A;  2HQN A;  1ETW A;  1YQA A;  2L54 A;  4QPQ A;  3LA2 A;  4M9Z A;  3RDI A;  1POG A;  2V7F A;  1IRX A;  3LL7 A;  4DW6 A;  3JTH A;  2QQ8 A;  5HDN A;  2N8G A;  3H35 A;  4RB2 C;  2L2O A;  3TL4 X;  3SZP A;  1ETY A;  1GT0 C;  1H8A C;  1IF1 A;  2ID3 A;  2NS0 A;  2W85 A;  4YRV A;  1SFU A;  4BXX J;  2OQG A;  5GAE J;  3ZQH A;  2ZSH B;  3T8T A;  4Y3O A;  4M71 A;  3NRV A;  3R60 A;  1P7I A;  4WK8 F;  3CDI A;  5CVR A;  1PP8 F;  1OR7 C;  3M8J A;  3IHU A;  2K9S A;  3V42 A;  3FXR A;  2D5V A;  1MH4 A;  2DOD A;  2FBH A;  3Q3S A;  2V6C A;  4MEY F;  4ESJ A;  1ETV A;  1JJ8 C;  4P5O A;  1G59 A;  3OL4 A;  4MFE A;  4D5F A;  5L3D A;  2K9L A;  5LRS A;  2WY8 Q;  1IW7 F;  4KT6 A;  4M3B A;  2M2E A;  1LKX A;  2VT2 A;  1U0J A;  2RDP A;  1W7P A;  2YS9 A;  4UVA A;  3J7Y J;  3C2G A;  2OCE A;  4BQA A;  4K2E A;  2BY3 A;  4LD5 A;  3KLO A;  4IQJ A;  1IRF A;  4BAY A;  4C2T A;  4LOC A;  1X1D A;  5J8C A;  2I10 A;  3AL0 C;  4WXH A;  1MJB A;  1NK2 P;  2P6S A;  4YFK F;  3DLL F;  1Y1V J;  5DCM A;  5J1R A;  3K9T A;  5HLT A;  1BN5 A;  3Q0W A;  3R0A A;  2A68 F;  3SZT A;  3PO2 J;  5CVI A;  4IPA A;  5JLX A;  4HDU A;  2FBI A;  2CFO A;  5H6Q A;  3K4K A;  4BDY A;  4UB6 C;  2QSH X;  1FTZ A;  1FC3 A;  3VYR B;  2NVQ J;  1OR7 A;  1W7P B;  1Y8R B;  4CXF A;  1JT0 A;  3GLL A;  4XIC A;  4BH9 A;  3MKZ A;  4U7D A;  2D1H A;  2JPC A;  1QO0 D;  1WI9 A;  3J7Z I;  2HQ5 A;  2R7O A;  2CWE A;  4HA8 A;  5LHH A;  4I09 A;  1KQ9 A;  4E7Z A;  5LLQ A;  3GEZ A;  1IUF A;  4BJ5 C;  5IY5 H;  4DIQ A;  3K69 A;  3IWZ A;  3S32 A;  5B1A H;  2KPM A;  3AL0 B;  2W82 A;  2E2I J;  1WCM J;  1SMT A;  3F8N A;  2AQF A;  2X4H A;  1IGN A;  5KCM A;  1U9N A;  5L3F A;  1YE9 A;  4IRG A;  4XON A;  3R6S A;  1A31 A;  3TO7 A;  3P9I A;  4AC0 A;  3ECH A;  3BQZ A;  1ZG1 A;  2KRF A;  1BI2 A;  1ZAR A;  2LH9 A;  3G1M A;  4EJO A;  1HDP A;  3CC4 I;  4LB5 A;  3K0L A;  5F04 A;  2B63 J;  3CES A;  3TED A;  2DFI A;  2F5C A;  3S2W A;  4L5I A;  3U9G A;  3WOD F;  3M4O J;  1UFM A;  1RI7 A;  1JUM A;  3RZO J;  2LY9 A;  4W97 A;  4IKF A;  2JSC A;  3LFK A;  4PUS A;  2LF8 A;  2VE8 A;  5GAH J;  4BGD A;  2EFP A;  5CLS A;  5LEK A;  1OFC X;  3SHF A;  3Q0V A;  2D2W A;  2M34 A;  1PP7 U;  2XRO A;  1MKM A;  3CP8 A;  4EQQ A;  4G7O F;  3CUQ C;  2GOX B;  3H0G J;  4AYB N;  1S8N A;  3J81 K;  3F23 A;  1Z77 A;  1FY7 A;  1R22 A;  4JQF A;  2H94 A;  5HOO A;  5IP7 J;  1XN7 A;  4E7L A;  1OCT C;  1WJC A;  3EUH C;  3WHB A;  3TDU C;  4F55 A;  2KFD A;  1ZKG A;  2XB5 A;  1QZY A;  2NRA C;  2BV6 A;  4NC6 A;  1X2N A;  1F43 A;  1TWC J;  2IRF G;  5GP9 A;  1WI3 A;  1K4S A;  5IYD J;  1XSX A;  3BPV A;  3OYM A;  3W2W A;  4WXC A;  3DQV C;  2AQE A;  2NVU B;  3LSK A;  5ILS A;  2KHM A;  3NWT A;  3A01 A;  4IOC F;  4I2O A;  1HW1 A;  4M9X A;  1UG0 A;  2OU2 A;  1K79 A;  1WH7 A;  5BQT A;  1HCR A;  5FRO A;  2DK8 A;  1RR7 A;  1HQC A;  5B66 C;  2QBY B;  5JFR A;  1OKR A;  3IUO A;  2JWT A;  1N78 A;  4S04 A;  1H0M A;  4DYQ A;  3G6E I;  2XAG A;  1SAN A;  2KKO A;  4XLH A;  2E1M B;  1OLT A;  2BGC A;  2YX7 A;  2GA2 A;  2WAD A;  2XHK A;  3ULQ B;  3S3M A;  3WGG A;  1YW7 A;  4U88 A;  4Y13 A;  2CV0 A;  4A5M A;  4CZZ A;  3CME I;  3BTC A;  2BW3 A;  2KP6 A;  1WKM A;  3ZN1 A;  4D5C A;  1HA8 A;  3BDD A;  3KYL A;  2IVM A;  4F52 A;  3JR9 A;  1FZP B;  3MD2 A;  4DNC A;  2BBY A;  3J7A O;  3WU0 A;  4AYB A;  1PVE A;  5FD5 A;  4A69 C;  2A07 F;  1J9I A;  2NNY A;  3R61 A;  1V5E A;  3VFZ A;  5AIP A;  1ODD A;  2QEX I;  4ETS A;  4M3G A;  2UXX A;  5FLM J;  3AFH A;  5ED4 A;  1FX7 A;  1BJA A;  3FHN A;  2Z16 A;  1EH6 A;  2ID6 A;  2Y75 A;  2R7Z J;  3MKW B;  3ZCO A;  5FLV A;  3SXY A;  1RUO A;  1TWA J;  4GDF A;  3BT9 A;  3WTU C;  2XUB A;  1UB9 A;  1EH7 A;  3ZMV A;  3CCV I;  4AIK A;  2L7M P;  4BXF A;  2KJB A;  1X3Z B;  3LAJ A;  2QZ8 A;  3K2A A;  1XGO A;  1QGP A;  1KGS A;  3IH2 A;  4E7H A;  2R92 J;  2VOD A;  5LBQ A;  2JK3 A;  4HX4 A;  4JYK A;  3OYD A;  1BA5 A;  1I6X A;  3WTW C;  2IS4 A;  3HZJ A;  1MSF C;  2LY1 A;  5EEA A;  1XMA A;  1JGS A;  3U2R A;  3WTX C;  4BQN A;  3RKQ A;  1R23 A;  2FRH A;  3KP5 A;  4UB8 C;  4G7Z F;  2A69 F;  2EIM H;  2WV1 A;  5J4V A;  1NK3 P;  1HC8 A;  3OYB A;  2EH3 A;  5HDK A;  2K9Q A;  2NAZ A;  4ESB A;  3GTJ J;  2RGV A;  1TWF J;  1NH3 A;  2PJR A;  5K5Q A;  4X1E A;  4HSR A;  4ZDO A;  2XB0 X;  1BBY A;  2KRC A;  2JRM A;  2M3A A;  4FQG A;  1N77 A;  1WRJ A;  1PUE E;  5HNH A;  1A36 A;  4L0Y B;  1RZ4 A;  3I54 A;  5M5Y J;  3A0H C;  4DZJ A;  4N4N B;  4QSH A;  3K7A J;  4QIW N;  3JAM K;  2NXN B;  4P55 A;  3K6G A;  5F1J A;  3HTS B;  4A3G J;  3V8L A;  4HRI A;  1XCV A;  2YUS A;  4KYW A;  3ZMU A;  2LBF A;  3RYP A;  5EGO B;  5E8G A;  2V4J C;  3K4B A;  2IGO A;  2L4A A;  2P5V A;  5M5X J;  1K4T A;  1MMS A;  1KYW A;  3T5X A;  3CLQ A;  4AWX B;  2XRN A;  2DOE A;  3P7N A;  4AIH A;  3IAS 2;  4F3Q A;  2H6B A;  4RB0 A;  1YLF A;  2ZFW A;  2LG4 A;  3K4J A;  4E7S A;  2OZU A;  1FP1 D;  1EH8 A;  2WTE A;  3F8B A;  1BW6 A;  2DJN A;  4YFN F;  4LLG F;  3V7R A;  3B02 A;  4LK0 F;  2OBP A;  4UUS B;  1RC9 A;  2CU7 A;  3DPU A;  2F4O B;  1D8K A;  2X1D A;  3H5R A;  5E17 F;  4BKX A;  2HKX A;  3RJP A;  1RNL A;  2GXG A;  3FXJ A;  1EJ9 A;  3GYH X;  3BZ6 A;  1PYV A;  5IT3 A;  1YI2 I;  4N9H A;  5FFX A;  5H2F C;  3PM1 A;  5DUI A;  2VC1 A;  4IXA A;  2NOJ B;  1E3P A;  1Z6R A;  3GFI A;  5J1U A;  4MGR A;  1DGR M;  5IT9 Z;  4CUG A;  1NG6 A;  1MBJ A;  5GTH C;  3BZK A;  2VLA A;  1J2X A;  4A6E A;  5C4J J;  2X1C A;  4CCJ A;  4XKW A;  1B9N A;  3HBL A;  2FQ4 A;  4RAG A;  4BE2 A;  2AO9 A;  3DPL C;  3H5A A;  3IH3 A;  3ML6 A;  4UVC A;  1ZRC A;  1FEX A;  4LIV A;  2ESN A;  3HOS A;  3WG7 H;  5CYV A;  2L5Q A;  1D1C A;  2HVS A;  2OD5 A;  3QOD A;  5ILV A;  4UY8 I;  2MBF A;  1R5H A;  3OR2 C;  5E1X A;  1H89 C;  4OAZ A;  5CKT A;  1A5J A;  2DPD A;  2XF5 A;  2ETH A;  1KQ8 A;  2IT0 A;  3VB2 A;  2ZJP F;  4IQ4 A;  4RAY A;  1X58 A;  2FMY A;  1RRJ A;  2EZK A;  2GWR A;  1ZQ3 P;  1F9N A;  5LGT A;  1QPM A;  3ZN0 A;  5CVU A;  1YX3 A;  1RPW A;  1GHC A;  3CDL A;  4IRI A;  1R58 A;  4PCQ A;  1MGT A;  4ABZ A;  3KFW X;  3KE2 A;  3HOU J;  4U0V A;  2MW8 A;  3F6O A;  4P96 A;  5K7Z A;  3BP8 A;  1S29 A;  4CH7 A;  4XRS G;  3DPT A;  4A3E J;  1OCZ H;  2YR2 A;  2E34 A;  2EQR A;  3I59 B;  5J4Y A;  4UHT A;  1B9M A;  3DBR B;  3TOA A;  1W0U A;  1IN8 A;  3QQA A;  5EF6 A;  1D0X A;  4KFC A;  1YW9 A;  4LB6 B;  3E1S A;  3CZ6 A;  4HPQ A;  1BIA A;  2L7K A;  4YIR X;  3L7W A;  2ISY A;  1BR2 A;  3L9F A;  2OJE D;  1S7E A;  3D5S C;  5E8I A;  4EMS A;  1R1U A;  2FNP A;  2LTP A;  2X1E A;  2K40 A;  3CMY A;  3CC7 I;  3WTZ A;  1JXS A;  1AKH B;  3M3Y J;  2YX4 A;  2DA6 A;  4KN4 X;  2FD5 A;  2ZME A;  4PFO A;  3WTV C;  1T08 B;  2ECC A;  3JRH A;  2R0Q C;  4G7H F;  5BPI A;  2CH0 A;  3ABK H;  4CDG A;  3K1N A;  1YYV A;  2VBZ A;  5IP9 J;  2P5K A;  5JI6 A;  1Y8Q B;  2XSD C;  2V6E A;  2K9M A;  4XLN F;  2W1O A;  3LQR A;  2M1B A;  2ZSI B;  4JX6 A;  3PUF A;  2VKE A;  3EQL F;  3GUD A;  4HQE A;  1A6Q A;  4AVZ A;  2VBW A;  1QNT A;  1HDD C;  1MDM B;  1H9G A;  2M9H A;  2O9L A;  2L0K A;  2XGX A;  1B8I B;  3RPU D;  2JA8 J;  5L3B A;  2RV8 A;  1MSE C;  4Q4Z F;  1GUU A;  3W6K B;  3E7L A;  4NNJ A;  1Y39 A;  1QVU A;  3EUK L;  1EV7 A;  3ZQC A;  2R7D A;  3MWM A;  3M07 A;  1F5T A;  3TBI A;  1F36 A;  3OS2 A;  4L0Z B;  3QWL A;  1AOY A;  1RIO H;  2MD0 A;  2CW8 A;  3KLN A;  1GXP A;  2E2H J;  5BMZ A;  3KZZ A;  4DJA A;  2DN0 A;  3BRO A;  5F08 A;  2K27 A;  3HJE A;  3OMY A;  4GRI A;  4XID A;  1LB2 A;  4Y15 A;  3QPS A;  2FOW A;  5FKK A;  1VQ4 I;  3M8E A;  1X19 A;  2M5W A;  3OYG A;  1AWC A;  3D1N I;  1FPQ A;  4RS8 A;  3MZH A;  2IS6 A;  4GGG A;  4HV6 A;  1LE8 B;  3A4C A;  2JPB A;  3V7C A;  2VBX A;  1ONV A;  4UV9 A;  3LQQ A;  5HS7 A;  1N75 A;  1R5I D;  2E1C A;  2DYS H;  4F93 B;  3GBG A;  3A02 A;  1V5G A;  2LRE A;  3KIO A;  5J1Y A;  5CQE A;  2LYC A;  2XKP A;  3HGG A;  3HRS A;  2IGK A;  4XSZ F;  4PJN A;  4BAC A;  3P9K A;  2W24 A;  1XGS A;  1JE8 A;  3DF8 A;  1ZRD A;  3MKL A;  2VON A;  3V7S A;  4FTH A;  5DD4 A;  4BUP A;  2H09 A;  1E17 A;  4XN0 A;  4IEJ A;  1K6Y A;  3KP4 A;  4ENJ A;  3VOE A;  1S7O A;  4ZDP A;  2Y30 A;  3O8H A;  4P9U A;  3CC2 I;  3WE2 A;  4A3D J;  1ZAO A;  5DCM B;  2L4M A;  3S1M J;  3I0T A;  4M6Y A;  3CCJ I;  2F5E A;  1D5Y A;  3IP4 B;  3HOZ J;  2MGQ A;  4XRS A;  2E36 A;  2PJR B;  4XRM A;  2DPU A;  2V26 A;  5IP6 A;  2LR8 A;  2I8D A;  3KEY A;  2E2J J;  1MJA A;  4II2 A;  2JVH A;  4JK1 X;  1HW5 A;  1T39 A;  3RIR A;  2CSO A;  3ZMS A;  2RQP A;  2OC6 A;  2HR3 A;  1WJF A;  3ERE D;  1Z3X A;  2KDO A;  2PQ8 A;  4ZDL A;  1PUF A;  1S7A A;  2EA4 A;  3KZY A;  5FLX K;  4FET A;  3MZY A;  2W48 A;  1V54 H;  1NHA A;  2A6T A;  3D5L A;  2AXL A;  4EM1 A;  1YG2 A;  3HTU A;  1DUX C;  1A6I A;  2LNB A;  3BTI A;  3CQZ J;  1WJD A;  2LF7 A;  2DFH A;  1G4D A;  1GVD A;  2KIF A;  2VAS A;  1TQM A;  1I3Q J;  1FWZ A;  3DWL E;  1BOB A;  2E71 A;  1YJW I;  4OAY A;  4A93 J;  1UMQ A;  2BEO A;  3L2C A;  2ZC2 A;  1DP3 A;  3L1P A;  3W6V A;  2M0C A;  2HQR A;  2LKX A;  3A2K A;  5H6R A;  3ZGK A;  1W36 D;  1XX5 A;  2DA4 A;  2DXI A;  3BC8 A;  4JX4 A;  1LVK A;  2QCO A;  3Q0U A;  2EFO A;  4KA4 A;  3HOX J;  3HDD A;  1I5Z A;  2HVQ A;  3HG9 A;  1EA3 A;  1Z3Y A;  2DMQ A;  4DQ2 A;  4XBF A;  2QM3 A;  1Z0X A;  3CUO A;  1I27 A;  5FKO A;  3HSF A;  4YIF A;  2I5U A;  4UUV A;  3S1N J;  1T33 A;  1Z67 A;  3KP2 A;  3DEE A;  3HOY J;  1QPI A;  3CJT B;  3OR1 C;  3D5R C;  1O4X A;  4UUT A;  4GFB A;  3BJA A;  2JMW A;  4BL0 B;  2TRT A;  3KEO A;  3K4M A;  1VFC A;  4BJ6 C;  3L2R A;  2RVC A;  3OIP A;  3T1B A;  3IKT A;  3HKZ N;  2XDV A;  1SVO A;  3H3Z A;  3A01 B;  3VYT B;  6PAX A;  2KJC A;  2D45 A;  1B1B A;  4KUM A;  3ZQL A;  2JQ7 A;  2OTL I;  4LG0 A;  1T98 A;  2BYV E;  2PMU A;  1U8R A;  3CTA A;  3OSG A;  2KIU A;  4XLP F;  3S16 J;  1XCB A;  2HKO A;  9ANT A;  2KIS A;  3GZ6 A;  4A0Z A;  4O3M A;  3U1K A;  2GM4 A;  1JUS A;  3OYA A;  1ZGJ A;  3BPX A;  3E3V A;  2LOO A;  1BOA A;  1TLH B;  3M1E A;  2ELJ A;  4IO9 F;  1RKT A;  1DQU A;  1G3W A;  2E1M C;  1YFH A;  2IAI A;  1WQ2 A;  4A3F J;  1MH3 A;  2MG4 A;  2JA2 A;  3CF2 A;  1QBJ A;  2G7H A;  4EM0 B;  3RQ4 A;  4BY1 J;  2VI6 A;  4J00 A;  1IO2 A;  1I39 A;  2OQR A;  1XG1 A;  2W84 A;  3DKW A;  4I7H A;  3AG1 H;  1BI0 A;  1WH5 A;  1FJL A;  2EIK H;  2K9N A;  3MZ8 A;  4U0W A;  4IHW A;  2EZH A;  1UHM A;  3ZRG A;  4I02 A;  1UHS A;  2OPT A;  4JP0 A;  1FOY A;  4RA2 A;  5E18 F;  3KP7 A;  1J75 A;  4AIJ A;  2WB1 A;  3BJO A;  5IYB J;  2HU9 A;  3KX2 A;  2R7W A;  3GTM J;  3RCO A;  2F48 A;  3P9C A;  3PSF A;  3E97 A;  3PQJ A;  1O7L A;  3MFK A;  3EYI A;  4A2U A;  2DDA A;  3RSN A;  5TIS C;  4HYE A;  2BXY A;  4PDK A;  1YIJ I;  2RNJ A;  3CCR I;  3HRM A;  4I98 B;  2BE5 F;  1ZLJ A;  5K1Y A;  2HNH A;  2E19 A;  4A3C J;  1ZG3 A;  1ERD A;  3TDZ C;  3HUG A;  2STW A;  1OQY A;  3BQY A;  1D0Y A;  1W5S A;  5DS9 A;  3FZV A;  3LMM A;  1K61 A;  2V9K A;  2NVT J;  1YO5 C;  3J80 Z;  3TMO A;  3F3X A;  4HZF A;  1MBK A;  2R7S A;  1BR1 A;  1IDY A;  4NHJ A;  2GA1 A;  3F8M A;  4LGW A;  3JCU C;  3EET A;  5ILU A;  4CCM A;  4PJJ A;  1O57 A;  2R7X A;  3MQ0 A;  2CJJ A;  2DBB A;  5E1Z B;  1JTY A;  2EK5 A;  1G3Y A;  3BG7 A;  1TTY A;  2QWW A;  3O8G A;  3PNV A;  3QP6 A;  1BC8 C;  1PDN C;  3LST A;  2EV6 A;  3J7A Y;  1SFE A;  4ASN A;  4G6D A;  4IHV A;  1P9Q C;  3ZQG A;  1L3L A;  2EIJ H;  2XPW A;  1MJ9 A;  3JRF A;  2PFB A;  3ZXS A;  2X6O A;  4ZC3 A;  1MMG A;  2MLG A;  3FBN B;  2KIQ A;  4A3M J;  5L3G A;  1IRG A;  4IX7 A;  2WB1 N;  5JR3 A;  2KDZ A;  1E2X A;  4H0E A;  2EJR A;  2XAQ A;  1ZTR A;  2XAJ A;  3GFM A;  1JI8 A;  1S6L A;  1R1V A;  4RB1 A;  3OYF A;  1BI3 A;  3I58 A;  3GTK J;  2VOP A;  3LSG A;  5D6E A;  2DA1 A;  1X1P A;  4D0P A;  2Z33 A;  4RGS A;  3S93 A;  1RR8 C;  2K3P A;  4BHP A;  2HOS A;  2JA7 J;  5E3N A;  2HXO A;  1JUP A;  1R36 A;  4HOB A;  4RB3 C;  3BY6 A;  3MVP A;  2VJI A;  1GV5 A;  3EUA A;  4IF4 A;  4PSX A;  1W5C C;  5M5W J;  4E6K G;  2IP2 A;  3I71 A;  1VQ8 I;  3BG6 A;  4XKV A;  1OIS A;  2R7Q A;  1XS9 A;  3HXL A;  3ZPL A;  3H0D A;  3S17 J;  1ULY A;  4CCK A;  3HB9 A;  3KEQ A;  1FIP A;  3QPL A;  2Z2S B;  1KU9 A;  5F64 A;  5DDG A;  4R79 A;  4WCG A;  1I6H J;  1HLV A;  4KMF A;  3OWT A;  1FSE A;  4J01 A;  3BWG A;  2ZXW H;  2DMT A;  2PMH A;  1YJ9 I;  2XGC A;  4M73 A;  1FOK A;  2KT0 A; 
#chains in the Genus database with same CATH homology
 4MQ9 F;  1TBX A;  1HST A;  5DEQ A;  3BJ6 A;  3CLO A;  5K5O A;  1R00 A;  4TV7 A;  2F5F A;  2E7X A;  2W25 A;  2CFX A;  4MQV A;  2VXZ A;  1REP C;  4EV0 A;  1IN7 A;  3F72 A;  4F7Z A;  2HWV A;  2QQA A;  2OAZ A;  2QVO A;  1UHW A;  1HKS A;  3ZMZ A;  1ZG5 A;  4FX4 A;  3RYR A;  1O3R A;  3ROU A;  1YW8 A;  2Z3Y A;  3LA3 A;  5ERI A;  5DD8 A;  5D5U B;  3EDP A;  2RC4 A;  1QZZ A;  2CG4 A;  3C7J A;  2ISZ A;  5EEG A;  2QQB A;  3C1D A;  3JW4 A;  3RI4 A;  3PFI A;  3V8J A;  1LJ9 A;  4KIB A;  4OIR F;  1P6R A;  2HYG D;  4KT5 C;  1FBU A;  4FHT A;  2J5O A;  1FSH A;  3WGI A;  4A12 A;  2QEN A;  3PQK A;  4A0X A;  4XRF A;  2FU4 A;  4KIG A;  2V1X A;  4B09 A;  3KET A;  1USS A;  2F2E A;  5LRR A;  1W4M A;  1F1Z A;  4CYD A;  1BI1 A;  4HQM A;  2VE9 A;  1LDJ A;  2P7C B;  2JRT A;  2DT5 A;  2EFN A;  4BYY A;  2R3S A;  1P4W A;  1DP7 P;  2GXB A;  2VOO A;  2FXA A;  3QAH A;  2HEO A;  2HTJ A;  1T38 A;  4I01 A;  3GF2 A;  5D6F A;  3OOP A;  2DI3 A;  3N97 A;  3I59 A;  3CO6 C;  3IL2 A;  1U5T A;  3WE3 A;  4HLY A;  1Z91 A;  4A6D A;  4CGZ A;  1T2K A;  2ESH A;  2YPR A;  4I0B A;  2LDU A;  4S05 A;  5BOX A;  2YSR A;  2XIG A;  5L3C A;  1D5V A;  1LEA A;  1LVA A;  4Y17 A;  3M7G A;  3V8K A;  1U6G A;  4MTD A;  2E1N A;  2DQL A;  2A3S A;  2V1D A;  2DLL A;  2HGC A;  1J5Y A;  3LAP A;  4B8X A;  1I1G A;  4EJW A;  2ZJ2 A;  2VT3 A;  2IA0 A;  3GVA A;  2IA1 A;  1GXQ A;  1FYL A;  1ZHF A;  4HF1 A;  3NQO A;  5J8F A;  4PZJ A;  3FM5 A;  4OOI A;  5IT9 K;  1TNS A;  5DYM A;  1FYK A;  4M74 A;  5JVT A;  1BIB A;  4ENK A;  5HDG A;  4BNC A;  2FE3 A;  3JSP A;  1XDU A;  4KMU X;  3F21 A;  5LGU A;  4OIP F;  3ZQ7 A;  2Q2E A;  2ZO4 A;  4MEX F;  2O0Y A;  4IJA A;  3QPH A;  2CO5 A;  1HBX G;  3FF5 A;  2GAU A;  3M9A A;  1G3S A;  3O2P E;  1P2F A;  2DAO A;  4LJZ F;  2OZ6 A;  1P4X A;  2ELH A;  2QBY A;  4L9T A;  3CO7 C;  4PGG A;  4LG0 B;  1DDN A;  1FNN A;  3FX3 A;  5ICE A;  3ZMT A;  1MD0 A;  1YIO A;  2R7F A;  5ICC A;  4I0A A;  3H92 A;  3DXJ F;  2ACJ A;  3DP7 A;  1X3U A;  5A2Q K;  4WF2 A;  5E1W A;  3TQN A;  2EV0 A;  2P8T A;  1IXS B;  1U3E M;  3MCZ A;  1LEB A;  1Z05 A;  4Q5S F;  1YTY A;  1OYI A;  1XMK A;  1JHF A;  2L02 A;  1ON2 A;  1R7J A;  3T8R A;  4OIQ F;  4HX8 A;  4WWC A;  1O3S A;  1FT9 A;  3TO9 A;  1S3J A;  3SQN A;  3COA C;  4ESF A;  2M8E A;  4Q48 A;  4EJT A;  2ZXJ A;  4HV5 A;  1HXD A;  4GCV A;  1XB4 A;  4E70 A;  3HRU A;  2PJP A;  1BM9 A;  1SFX A;  1J7K A;  3RTR A;  1K78 B;  5CJ9 A;  1B59 A;  5D8K B;  2EFW A;  3LWF A;  5FFZ A;  3ABT A;  1B4A A;  2P7V B;  2PEX A;  3B73 A;  3GXO A;  5HS9 A;  1LNW A;  3TGN A;  2G7U A;  1ON1 A;  4M6X A;  5L3E A;  4EGY A;  3FXU A;  3FMR A;  2Z99 A;  1D8J A;  4UXN A;  2M87 A;  3RPU A;  4N9I A;  3EYY A;  5HLI A;  4GYG A;  3DEU A;  3IKV A;  4R1H A;  2ZCW A;  3EUH A;  4MHG A;  3ABU A;  2PG4 A;  1HKT A;  2HYF A;  3TKY A;  1KYZ A;  2QUF A;  3E5Q A;  2UXN A;  3IRQ A;  2P5L C;  4BXU A;  4IHS A;  3Q9S A;  4KIC A;  2A61 A;  2A5Y B;  4HF0 A;  3KCC A;  1TW3 A;  2O3F A;  3ECO A;  3WTY C;  3I4P A;  1YS7 A;  3OV8 A;  3O3K A;  1JHH A;  2DTR A;  1K78 A;  2ZBK A;  4L9J A;  2EFQ A;  2UWM A;  1V4R A;  3AAF A;  2ZNY A;  2V1U A;  3TOB A;  4HDV A;  5AON A;  2HDC A;  2XAS A;  3I64 A;  5D5W B;  2VN2 A;  1MDM A;  2H27 A;  4LMY A;  5FO5 A;  1Z6T A;  3F8F A;  3K1P A;  1IAW A;  2FOK A;  3WTS C;  2K02 A;  5TJJ A;  2IPQ X;  4L9N A;  1XSV A;  2PN6 A;  3IWF A;  1IN6 A;  3SFZ A;  3CJN A;  5KVR A;  5LEJ A;  2H6C A;  5DCF A;  1IN5 A;  3HSR A;  1U78 A;  1U5T B;  1L0O C;  1Q1H A;  4LLL A;  2M45 A;  1KA8 A;  3QU3 A;  4O5V A;  2EB7 A;  2OA4 A;  2HZT A;  1ZRF A;  2DQR A;  4MNU A;  4LLN A;  2AS5 F;  5BS6 A;  3CUQ B;  4NB5 A;  5LHG A;  4KDP A;  3ZP5 A;  1K6O A;  2P4W A;  3N4M A;  1Y0U A;  4BHC A;  4IRH A;  3GWZ A;  3E5U A;  2PBI A;  2HS5 A;  2Y0M A;  1TNT A;  1XSD A;  1HW2 A;  1Z1D A;  1Z7U A;  2Q0O A;  3GLX A;  2EA2 A;  4IVN A;  4O6J A;  2ZKZ A;  3DV8 A;  3FWE A;  4EJU A;  2A6E F;  2XV4 S;  3F22 A;  5D8L B;  2MH9 A;  1FYM A;  4HLX A;  3ISP A;  5LGN A;  1DPR A;  4EGZ A;  5FB2 A;  5F6F A;  2IA2 A;  2FF4 A;  3GFL A;  4OMY A;  2A6H F;  2L01 A;  3J80 K;  1J59 A;  1F4K A;  3CUQ A;  5H20 A;  2CGP A;  1G6N A;  5D5X B;  4UVB A;  4UNO A;  1KU3 A;  1XDS A;  2PI0 A;  4Q47 A;  4ZZL A;  2FA5 A;  3G73 A;  5F1R A;  1R5G A;  2HFH A;  2Z5U A;  2STT A;  2EV5 A;  3QRF F;  1A04 A;  2XAF A;  2Y48 A;  2X0L A;  1U2W A;  3BOQ A;  3E6D A;  1IXC A;  1LDD A;  4ON0 A;  1FBQ A;  1CF7 B;  1C0W A;  2DO7 A;  2HTS A;  2WV0 A;  4OIN F;  2V9V A;  1VTN C;  4M72 A;  4AD9 A;  3J81 Z;  2RN7 A;  2XAH A;  3HHG A;  3HSE A;  3QP5 A;  2LKP A;  1XD7 A;  2JZY A;  4MTE A;  2L3D A;  2RKH A;  1TW2 A;  3WU1 B;  4QWQ A;  2QLZ A;  2UZK A;  1HSJ A;  1GVJ A;  1FLI A;  2IJL A;  1OYW A;  2XVC A;  3U1D A;  1LDK B;  4CIC A;  3I53 A;  4EJV A;  3L09 A;  3V4G A;  5D5V B;  3F8C A;  1STZ A;  3L00 A;  3WG9 A;  2XKO A;  3HRT A;  4HBL A;  1TQP A;  5FD6 A;  1I1S A;  2EWN A;  2CQK A;  2HOE A;  3FHZ A;  4ENN A;  3IC7 A;  4HX7 A;  1SD4 A;  5J6X A;  3VOD A;  4YFX F;  2ZNZ A;  1FP2 A;  5ICG A;  1SD5 A;  2DW4 A;  4RGX A;  1SD6 A;  3QU6 A;  4HF2 A;  1TQI A;  2K7L A;  3I5U A;  4EVI A;  4Z2Y A;  4GO1 A;  3M8F A;  4RGU A;  2FBK A;  2KIM A;  3KP3 A;  3FXQ A;  1IXR C;  3HYI A;  4JBA A;  4A0Y A;  5D4R A;  2C6Y A;  1V3F A;  3D0S A;  4RAZ A;  1U5T C;  1UCR A;  3RKW A;  1ZN2 A;  4U0Y A;  5LHI A;  2O6G E;  4IHT A;  2JT1 A;  4ENM A;  3E6M A;  2D1V A;  4U7B A;  5CVJ A;  1WSU A;  1OYY A;  3HOT A;  2VC0 A;  3ELK A;  4R8H A;  3K2Z A;  1R1T A;  5HLG A;  2E7W A;  4RGR A;  2Q8K A;  3W6J B;  1KU7 A;  2LSO A;  3FMS A;  1P4A A;  2F5D A;  1D3Y A;  3JSO A;  1J0R A;  4A5N A;  5HVQ C;  4L18 B;  2V79 A;  4M9S A;  2J5P A;  5AIQ A;  3FM3 A;  3GX4 X;  2FQ3 A;  2FNA A;  3QOP A;  1BC7 C;  1ZH5 A;  1WWX A;  4HW0 A;  4ZYE A;  1XGN A;  2GQQ A;  3G3Z A;  1OMI A;  3E5X A;  3MEX A;  3E6C C;  3VEP A;  1CGP A;  3GW2 A;  4YG2 F;  3TO6 A;  3DFG A;  4G6Q A;  3KP6 A;  1HKQ A;  4G94 A;  2O8X A;  5FLX Z;  2B0L A;  1UST A;  2CW0 F;  3REO A;  2WWY A;  2COM A;  3RPQ A;  3Q5F A;  2NYX A;  3F6V A;  3K1M A;  4GXO A;  3CDH A;  3LA7 A;  1IUY A;  2K4J A;  4OIO F;  4LK1 F;  2CYY A;  3HIF A;  4OMZ A;  1YS6 A;  4L9V A;  2K4B A;  3WGH A;  3JTG A;  3R4K A;  5K5R A;  1ZYR F;  3HHH A;  4CHU A;  4HAM A;  5HLH A;  1IN4 A;  2FSW A;  4ZZD A;  1RUN A;  4UV8 A;  4ZYG A;  2M30 A;  2O61 A;  4G8X A;  5JHU A;  1T6S A;  3JAM Z;  3WTT C;  2MD5 A;  3QPT A;  4KN7 X;  4L5J A;  1SD7 A;  5TRD A;  1LQ1 A;  3MAJ A;  1SMY F;  1IZ1 A;  5ICF A;  2FML A;  4AVP A;  4FT8 A;  3E6B A;  2K86 A;  2GIV A;  2QQ9 A;  2O03 A;  4KIF A;  1O3T A;  4ZYH A;  2YU3 A;  1DPU A;  2QYO A;  5D4S A;  2GZW A;  1Z9C A;  3RKY A;  4OU0 A;  5DV5 A;  1SAX A;  1CF7 A;  4KNY A;  2FEZ A;  4PGH A;  1O7F A;  1P92 A;  2VBY A;  4LFU A;  4CO8 A;  4YII A;  2ZME B;  1O3Q A;  4ZH4 F;  1H9T A;  2DK5 A;  3NEU A;  4N0B A;  4WX9 A;  5FGM A;  1ZRE A;  4NQW A;  1KQ0 A;  4EM2 A;  4BHB A;  3T0Y A;  2NNN A;  1ZLK A;  2MA3 A;  2IW5 A;  3GZ5 A;  2W57 A;  1XGM A;  1KU2 A;  1K7A A;  3FMQ A;  1B6A A;  5EEH A;  2WC2 A;  4P9F A;  3GFJ A;  2MLK A;  3C18 A;  3ZMD A;  5A2Q Z;  4GYI A;  2Z9O A;  4FX0 A;  3IRR A;  2ADU A;  2MH2 A;  3Q9V A;  5DUK A;  5BPD A;  3R0J A;  2G9W A;  1FBS A;  3O6B B;  2P6T A;  2MC3 A;  1QQI A;  1ZGA A;  1MZB A;  3C3W A;  3H3U A;  4XSX F;  5KK1 A;  4WXD A;  5CVV A;  1W7P D;  2TDX A;  2DU9 A;  4G9Y A;  2JTV A;  2PLY A;  5E20 A;  1T0F A;  4QLC U;  1G3T A;  4ZYD A;  1W5T A;  3GO5 A;  5HS8 A;  1OPC A;  3RKX A;  2HQN A;  1YQA A;  2L54 A;  3LA2 A;  4M9Z A;  3RDI A;  3JTH A;  5HDN A;  4RB2 C;  3SZP A;  1IF1 A;  2NS0 A;  2W85 A;  1SFU A;  2OQG A;  3T8T A;  4M71 A;  3NRV A;  3R60 A;  4WK8 F;  5CVR A;  1PP8 F;  3IHU A;  3FXR A;  2FBH A;  2V6C A;  4MEY F;  4ESJ A;  4P5O A;  5L3D A;  5LRS A;  1IW7 F;  2VT2 A;  2RDP A;  1W7P A;  4UVA A;  4BQA A;  4K2E A;  4LD5 A;  3KLO A;  1IRF A;  4BAY A;  5J8C A;  4WXH A;  1MJB A;  2P6S A;  4YFK F;  5DCM A;  3K9T A;  1BN5 A;  3R0A A;  2A68 F;  3SZT A;  5CVI A;  4IPA A;  4HDU A;  2FBI A;  5H6Q A;  1FC3 A;  1OR7 A;  1W7P B;  4CXF A;  4BH9 A;  4U7D A;  2D1H A;  2JPC A;  1QO0 D;  1WI9 A;  2CWE A;  4HA8 A;  5LHH A;  4I09 A;  1KQ9 A;  5LLQ A;  3GEZ A;  3K69 A;  3IWZ A;  1SMT A;  3F8N A;  2X4H A;  5L3F A;  4IRG A;  3R6S A;  3TO7 A;  3P9I A;  1ZG1 A;  3ECH A;  2KRF A;  1BI2 A;  1ZAR A;  4EJO A;  4LB5 A;  3K0L A;  2DFI A;  2F5C A;  3S2W A;  4L5I A;  3U9G A;  3WOD F;  1UFM A;  1RI7 A;  2JSC A;  3LFK A;  2LF8 A;  2VE8 A;  2EFP A;  5CLS A;  5LEK A;  3SHF A;  2D2W A;  1PP7 U;  2XRO A;  1MKM A;  4EQQ A;  4G7O F;  3CUQ C;  3F23 A;  3J81 K;  1S8N A;  1FY7 A;  1R22 A;  4JQF A;  2H94 A;  5HOO A;  1XN7 A;  3TDU C;  1QZY A;  2NRA C;  2BV6 A;  2IRF G;  1XSX A;  3BPV A;  4WXC A;  3DQV C;  5ILS A;  4I2O A;  1HW1 A;  4M9X A;  2OU2 A;  1K79 A;  5BQT A;  2DK8 A;  1HQC A;  2QBY B;  5JFR A;  1OKR A;  4S04 A;  1H0M A;  2XAG A;  2KKO A;  2YX7 A;  2BGC A;  2GA2 A;  2XHK A;  3ULQ B;  3WGG A;  1YW7 A;  4U88 A;  4Y13 A;  4A5M A;  4CZZ A;  1WKM A;  3ZN1 A;  3BDD A;  2IVM A;  1FZP B;  4DNC A;  2BBY A;  3J7A O;  3WU0 A;  2A07 F;  5FD5 A;  1J9I A;  2NNY A;  3R61 A;  3VFZ A;  5AIP A;  1ODD A;  4ETS A;  2UXX A;  5ED4 A;  1FX7 A;  1BJA A;  1EH6 A;  2Y75 A;  3SXY A;  1RUO A;  3WTU C;  2XUB A;  1UB9 A;  1EH7 A;  3ZMV A;  4AIK A;  2KJB A;  3LAJ A;  2QZ8 A;  1XGO A;  1QGP A;  1KGS A;  2VOD A;  5LBQ A;  4HX4 A;  1I6X A;  3WTW C;  1XMA A;  1JGS A;  3U2R A;  3WTX C;  1R23 A;  2FRH A;  3KP5 A;  4G7Z F;  2A69 F;  5HDK A;  2NAZ A;  4ESB A;  2RGV A;  5K5Q A;  1BBY A;  1WRJ A;  1PUE E;  4L0Y B;  1RZ4 A;  3I54 A;  3HTS B;  3JAM K;  4P55 A;  3V8L A;  1XCV A;  4KYW A;  3ZMU A;  3RYP A;  5E8G A;  2L4A A;  2P5V A;  1KYW A;  3T5X A;  4AWX B;  2XRN A;  3P7N A;  4AIH A;  2H6B A;  4RB0 A;  1YLF A;  2ZFW A;  2OZU A;  1FP1 D;  1EH8 A;  2WTE A;  3F8B A;  4YFN F;  4LLG F;  3V7R A;  3B02 A;  4LK0 F;  2OBP A;  1D8K A;  5E17 F;  2HKX A;  3RJP A;  1RNL A;  2GXG A;  3GYH X;  3BZ6 A;  5IT3 A;  5FFX A;  4N9H A;  5DUI A;  2VC1 A;  4IXA A;  5IT9 Z;  1Z6R A;  3GFI A;  4MGR A;  1J2X A;  4A6E A;  1B9N A;  3DPL C;  3ML6 A;  4UVC A;  1ZRC A;  2ESN A;  3HOS A;  5CYV A;  2OD5 A;  5ILV A;  2MBF A;  1R5H A;  5E1X A;  2DPD A;  2ETH A;  1KQ8 A;  2IT0 A;  3VB2 A;  4RAY A;  2FMY A;  2GWR A;  1F9N A;  5LGT A;  1QPM A;  3ZN0 A;  5CVU A;  1GHC A;  4IRI A;  1R58 A;  4PCQ A;  1MGT A;  3KFW X;  3KE2 A;  4U0V A;  3F6O A;  4P96 A;  3BP8 A;  1S29 A;  3DPT A;  2YR2 A;  3I59 B;  4UHT A;  1B9M A;  3TOA A;  1IN8 A;  4KFC A;  1YW9 A;  4LB6 B;  1BIA A;  3L7W A;  2ISY A;  3L9F A;  5E8I A;  4EMS A;  1R1U A;  2FNP A;  3WTZ A;  1JXS A;  2YX4 A;  4KN4 X;  2ZME A;  3WTV C;  4G7H F;  5BPI A;  4CDG A;  3K1N A;  1YYV A;  2VBZ A;  2P5K A;  5JI6 A;  4XLN F;  3LQR A;  2M1B A;  3EQL F;  3GUD A;  4HQE A;  2VBW A;  1QNT A;  1MDM B;  1H9G A;  2XGX A;  5L3B A;  2RV8 A;  4Q4Z F;  3W6K B;  1EV7 A;  2R7D A;  3MWM A;  1F5T A;  4L0Z B;  1AOY A;  1RIO H;  3KLN A;  1GXP A;  5BMZ A;  3KZZ A;  3BRO A;  2K27 A;  1LB2 A;  4Y15 A;  3M8E A;  1AWC A;  2M5W A;  1FPQ A;  4RS8 A;  3MZH A;  4GGG A;  4HV6 A;  2JPB A;  3V7C A;  2VBX A;  1ONV A;  4UV9 A;  3LQQ A;  5HS7 A;  2E1C A;  3HRS A;  2XKP A;  4XSZ F;  3P9K A;  2W24 A;  1XGS A;  1JE8 A;  3DF8 A;  1ZRD A;  2VON A;  3V7S A;  5DD4 A;  2H09 A;  1E17 A;  3KP4 A;  4ENJ A;  3VOE A;  1S7O A;  4P9U A;  3WE2 A;  1ZAO A;  5DCM B;  2L4M A;  3I0T A;  4M6Y A;  2F5E A;  2DPU A;  1MJA A;  4JK1 X;  1HW5 A;  1T39 A;  3RIR A;  2CSO A;  3ZMS A;  2RQP A;  2HR3 A;  3ERE D;  2PQ8 A;  1S7A A;  2EA4 A;  3KZY A;  5FLX K;  3MZY A;  4EM1 A;  1NHA A;  1DUX C;  3D5L A;  2AXL A;  1YG2 A;  3HTU A;  2LNB A;  2LF7 A;  1G4D A;  2KIF A;  1TQM A;  1FWZ A;  2BEO A;  3L2C A;  2HQR A;  5H6R A;  2EFO A;  4KA4 A;  1I5Z A;  4DQ2 A;  4XBF A;  2QM3 A;  3CUO A;  1I27 A;  3HSF A;  4YIF A;  4UUV A;  3KP2 A;  3BJA A;  3KEO A;  2RVC A;  3T1B A;  3IKT A;  3H3Z A;  6PAX A;  2KJC A;  2D45 A;  1B1B A;  4KUM A;  4LG0 A;  1T98 A;  2BYV E;  2PMU A;  1U8R A;  3CTA A;  2KIU A;  4XLP F;  1XCB A;  2HKO A;  3GZ6 A;  4A0Z A;  4O3M A;  1ZGJ A;  3BPX A;  3E3V A;  1BOA A;  1TLH B;  3M1E A;  1G3W A;  1YFH A;  1WQ2 A;  1QBJ A;  2G7H A;  4EM0 B;  2OQR A;  2W84 A;  3DKW A;  4I7H A;  1BI0 A;  4U0W A;  1UHM A;  4I02 A;  5E18 F;  3KP7 A;  1J75 A;  4AIJ A;  3BJO A;  3P9C A;  3E97 A;  3PQJ A;  1O7L A;  3MFK A;  3EYI A;  4A2U A;  4HYE A;  4PDK A;  2RNJ A;  3HRM A;  4I98 B;  2BE5 F;  1ZLJ A;  5K1Y A;  1ZG3 A;  2STW A;  3HUG A;  3TDZ C;  1W5S A;  3FZV A;  1YO5 C;  3J80 Z;  3F3X A;  4HZF A;  4NHJ A;  2GA1 A;  3F8M A;  4LGW A;  3EET A;  5ILU A;  1O57 A;  3MQ0 A;  2DBB A;  5E1Z B;  2EK5 A;  1G3Y A;  1TTY A;  2QWW A;  3QP6 A;  1BC8 C;  1PDN C;  3LST A;  2EV6 A;  1SFE A;  4ASN A;  4G6D A;  1L3L A;  1MJ9 A;  2PFB A;  2MLG A;  5L3G A;  1IRG A;  5JR3 A;  1E2X A;  4H0E A;  2EJR A;  2XAQ A;  3GFM A;  2XAJ A;  1S6L A;  1R1V A;  4RB1 A;  1BI3 A;  3I58 A;  2VOP A;  5D6E A;  4D0P A;  2Z33 A;  4RGS A;  4BHP A;  1R36 A;  4HOB A;  4RB3 C;  3BY6 A;  4IF4 A;  2IP2 A;  3I71 A;  3ZPL A;  1ULY A;  3KEQ A;  1KU9 A;  5F64 A;  5DDG A;  4R79 A;  4WCG A;  4KMF A;  1FSE A;  3BWG A;  2PMH A;  1FOK A;  4M73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...