4B8XA

Near atomic resolution crystal structure of sco5413, a marr family transcriptional regulator from streptomyces coelicolor
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
144
structure length
139
Chain Sequence
GVPSMAAITSIMRAQQILLGEVDAVVKPYGLTFARYEALVLLTFSKSGELPMSKIGERLMVHPTSVTNTVDRLVRSGLVAKRPNPGTLATITDKGREVVEAATRDLMAMDFGLGAYDAEEGEIFAMLRPLRVAAGDFDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POSSIBLE MARR-TRANSCRIPTIONAL REGULATOR
publication title High Resolution Crystal Structure of Sco5413, a Widespread Actinomycete Marr Family Transcriptional Regulator of Unknown Function.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 52
structure length 139
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4b8xA00
3MQ0A 2L02A 1FC3A 2ELHA 3DP7A 2P6SA 3EETA 1P4WA 3LFKA 2W85A 1YW7A 4MGRA 2DU9A 4YFKF 1XN7A 4LFUA 1H9TA 4YFXF 4YG2F 2NYXA 4EMSA 2COMA 2OA4A 3GEZA 1P92A 5BPIA 1QO0D 1Q1HA 2HR3A 1HW1A 3BPXA 2IJLA 4FHTA 1YFHA 2XIGA 3L9FA 2NS0A 3GFIA 2XAQA 4RB0A 3V8LA 3KEOA 2Q0OA 4O6JA 3FMRA 1ON2A 2VN2A 2DPUA 1SFUA 3KP7A 2GA2A 1IAWA 3KEQA 4KIFA 2XAFA 3LA2A 3ELKA 3DPTA 5HOOA 3DEUA 3N97A 2PLYA 2O0YA 2FMLA 3MCZA 1UHMA 2HGCA 2GXBA 4WK8F 4O3MA 3OOPA 3PQJA 1RI7A 3IL2A 3IKVA 2Q8KA 3B02A 3E6BA 3S2WA 4LJZF 3ZN1A 4D0PA 4EVIA 1FY7A 4HX7A 4Q4ZF 4EJOA 1T0FA 2BE5F 2KJCA 4KN4X 2Z5UA 1RIOH 2HEOA 3EDPA 5BPDA 1G3YA 1B6AA 1IW7F 4HAMA 4U0VA 2V9VA 2VOPA 2XVCA 3V4GA 2ZXJA 2PMUA 3F3XA 4WWCA 2ACJA 5DD8A 3EQLF 2QBYA 1YLFA 3ZN0A 2FOKA 3IC7A 2QQ9A 4LB5A 3I54A 1SMTA 1QBJA 2A6HF 5K5OA 3GZ5A 3F6VA 3ZMUA 2QLZA 4OOIA 1ZAOA 5FO5A 5H6RA 3HIFA 4UHTA 4NQWA 3HSRA 2GIVA 5CYVA 1KQ8A 2ISYA 1DPUA 1BI3A 5ICEA 1Z91A 3R0AA 1R5GA 2FNAA 1P4AA 4CZZA 2DI3A 1MGTA 3MAJA 1JHFA 1U2WA 3D5LA 2GAUA 3F8NA 3FX3A 4KUMA 4L0ZB 2JTVA 4AD9A 1D8JA 4PGHA 1IN8A 3GVAA 2RV8A 1SD6A 1ODDA 1TQIA 1ZG3A 4LG0B 4XBFA 3K2ZA 2IA1A 2UXNA 3M9AA 4CDGA 4A6EA 3HRSA 1IN7A 3BWGA 1WWXA 5EEHA 2XKPA 2EV5A 2LKPA 4LK1F 1JGSA 5DD4A 1YIOA 1IN5A 3DPLC 1I6XA 5HLGA 3RJPA 2Y48A 3JAMZ 1MJ9A 1S3JA 2L54A 2EFPA 4IF4A 1X3UA 4RAZA 3HOSA 4EJVA 5AIPA 3O2PE 3MZYA 2X0LA 4EM2A 5CVJA 2ESNA 2NRAC 1TW2A 1YG2A 2VC0A 3GFLA 2R7DA 5D8LB 3RPUA 1ZRFA 3Q5FA 2VC1A 2HZTA 4L18B 2WWYA 4GGGA 2OQGA 5FLXZ 1IN6A 4OMYA 2GA1A 5DCFA 2Y0MA 2QM3A 1UFMA 2XUBA 1FSHA 1IF1A 1F1ZA 5HS8A 2MA3A 2QZ8A 5ICCA 2JPBA 4WXHA 1O3TA 4GCVA 1J9IA 3V8KA 2AS5F 2M87A 1FPQA 4IRGA 3I0TA 4P5OA 3M8EA 1HW5A 4MHGA 3F8FA 3P9KA 1XB4A 4B8XA 1FBUA 1OYWA 1BC8C 1J7KA 1LEBA 2Z99A 4ASNA 3M8FA 2IA0A 2RNJA 1KQ9A 1RUOA 2V1UA 3IKTA 2KKOA 4Q48A 4GYGA 1L0OC 3BROA 4RB1A 4ENNA 4OMZA 4RGUA 2ZCWA 2DK8A 2MLKA 2R3SA 3I53A 2STTA 4L0YB 3RIRA 4N0BA 2D45A 3LWFA 1P2FA 3F23A 2QWWA 4U0WA 1R22A 2A3SA 3LAPA 1TQPA 3MZHA 2VBWA 1J59A 3CDHA 3ABUA 2XHKA 1H0MA 4R1HA 3SHFA 2XAGA 1REPC 3K9TA 2FQ3A 2RC4A 1A04A 4XSZF 4RGXA 4HBLA 2STWA 4Y13A 1WKMA 5L3EA 4RGSA 2Y75A 4OU0A 2XGXA 2GXGA 4AIJA 3IWFA 2GWRA 3J81Z 1U8RA 3QU3A 1RZ4A 1FNNA 3F21A 4XRFA 5LGUA 4MNUA 3TOBA 2FBKA 4HDVA 1K78A 5F1RA 3QU6A 2ETHA 1S8NA 1R00A 3FXRA 1T6SA 5K1YA 3WTWC 2M45A 4PCQA 3HRTA 1AWCA 1YS6A 2DAOA 3TDUC 1HSJA 1TBXA 2DW4A 1LDDA 4G8XA 1T2KA 2R7FA 3BDDA 4U7DA 2O61A 4M9SA 3N4MA 3WTVC 3GF2A 3W6KB 2EB7A 1SD5A 4OIRF 4E70A 3CO7C 4XSXF 3EYIA 4PGGA 2P5LC 3BJ6A 2LNBA 1BC7C 4Q5SF 4HLYA 2FRHA 1Z6TA 1MDMA 1PP7U 2HYGD 2K27A 4EM1A 1FYLA 2M1BA 1TLHB 2HKXA 1FBSA 1BBYA 5HDKA 1B59A 4B09A 3JSPA 1G4DA 3DV8A 1FBQA 5HDGA 1U6GA 4LK0F 3WTXC 5L3FA 3P7NA 1KYZA 4EGYA 1JXSA 2CQKA 2DQLA 3FM5A 4PDKA 3J80Z 1Z1DA 2CSOA 3JW4A 1DPRA 4A6DA 3GYHX 2FMYA 5CVIA 4F7ZA 2VBYA 2H09A 4BHPA 5DUIA 3QPHA 1FYMA 1ZRCA 1MDMB 3R60A 4I02A 5A2QZ 4LD5A 4ZYEA 3CUQC 3E5UA 2IP2A 3MWMA 2DK5A 2CGPA 3BPVA 1YYVA 5HS9A 3T0YA 2NAZA 3TKYA 4CYDA 3H92A 1QPMA 2K4BA 4HX4A 2PMHA 2KIMA 4EV0A 4ZYDA 4BQAA 2ESHA 2KRFA 1FYKA 5HLHA 5KK1A 3IRQA 2V79A 4EQQA 1R5HA 2PEXA 2LF8A 1FSEA 1V3FA 4FX4A 1CGPA 1XSDA 1OPCA 1JE8A 2MH2A 3E6DA 1EH8A 2KIFA 2JSCA 1IRGA 1D8KA 4M74A 2YSRA 2P4WA 3REOA 5E1ZB 3I58A 3KFWX 4QLCU 1IRFA 1IXRC 3K69A 4IHSA 4QWQA 1PP8F 4A12A 3L00A 3IHUA 3WTUC 4ZZDA 1I1GA 3C7JA 3C18A 4LLLA 3VEPA 4H0EA 4PZJA 1DP7P 2LSOA 5ILSA 1R1VA 1ZARA 1YO5C 2DBBA 1ZREA 2O3FA 4HX8A 1XMKA 2OAZA 4MEYF 1QNTA 4MTEA 2W25A 2IVMA 2O6GE 4MQVA 1W4MA 2WTEA 1O7LA 1SD7A 2KJBA 4ENJA 1FZPB 3FF5A 2FXAA 3HOTA 2M30A 2X4HA 2CWEA 2UWMA 4HDUA 3CJNA 1LDJA 1ZN2A 5L3GA 4UVAA 4MEXF 2RVCA 4KICA 2CFXA 5DCMB 3WTZA 1MJAA 3JTHA 5JR3A 2ZFWA 2PG4A 3LQRA 1YW8A 3WE2A 2EK5A 4A2UA 2G9WA 4I0AA 1YTYA 2M8EA 2HTSA 4HA8A 5E17F 1FWZA 3WODF 5JI6A 1L3LA 4A0ZA 4LG0A 3WG9A 2VBXA 1U5TC 1RNLA 1K7AA 3SQNA 3HUGA 3E6MA 4HW0A 1TNSA 1R7JA 2CG4A 1FP1D 1J0RA 3NQOA 1Z9CA 2P8TA 5E1XA 4IRIA 4EGZA 2HTJA 3E97A 1F9NA 2FF4A 3DXJF 3VOEA 1DUXC 2A68F 1EV7A 3CUOA 2RKHA 1WSUA 3R6SA 2P7CB 1HKQA 4KFCA 1R23A 1K6OA 5LBQA 4CHUA 3H3UA 3SZPA 4YFNF 5K5RA 3F8MA 4L9TA 3HSFA 4UV9A 3RPQA 3KZYA 3GWZA 4S05A 3K0LA 3GW2A 5D8KB 1O57A 2DO7A 5D5WB 1HW2A 1PDNC 4RB3C 4ESFA 3LAJA 4A5NA 1F4KA 3BOQA 5IT3A 2PFBA 5BS6A 3E5XA 5HVQC 4M71A 1BIAA 1HBXG 3V8JA 1O3SA 1OR7A 1ONVA 4CXFA 1MD0A 4HZFA 3LA7A 3GZ6A 4IRHA 1FLIA 4LLNA 4L5IA 3HYIA 4M9XA 2EV0A 1I5ZA 2EWNA 3TO7A 4IVNA 2E1NA 2ZKZA 1FX7A 2TDXA 3F72A 5JHUA 2Z9OA 2KIUA 2ZJ2A 3WTTC 3GFMA 3CUQB 4AVPA 1W7PB 3LQQA 2B0LA 3F8CA 4BAYA 2IA2A 3L7WA 1I27A 1MZBA 1Z05A 2MLGA 2WV0A 2YR2A 5IT9K 2NNNA 3WU1B 1XGMA 2A07F 1HSTA 3GXOA 2CO5A 5H6QA 5E8GA 5ERIA 3DQVC 3ZMSA 4UV8A 4KMFA 3GX4X 4XLNF 3R61A 3U9GA 3RKXA 2Z33A 3V7RA 3ECOA 2DLLA 1HKTA 2YX7A 4LGWA 5LHIA 3FHZA 4I98B 3M1EA 1BM9A 3HHGA 1YQAA 2GZWA 3RKWA 3TDZC 2VBZA 5H20A 3V7CA 3LA3A 3P9CA 2Z3YA 2G7HA 4G7ZF 1HKSA 3E5QA 1ZGAA 3HTUA 1KQ0A 1KU3A 5FD5A 4P96A 1LJ9A 1IZ1A 4RS8A 2K4JA 3ZMZA 3TOAA 4ZYGA 5LHHA 1CF7B 2EFQA 2HDCA 5CJ9A 4IPAA 3JSOA 1ZLJA 1K79A 4KT5C 3J7AO 5DV5A 4EJTA 1XDSA 1QZZA 4KIBA 4G7OF 3WE3A 4DNCA 5HLIA 4G6QA 1OKRA 4G7HF 2EFNA 2YPRA 2MBFA 5TRDA 4GO1A 4HOBA 2FEZA 4P9UA 3GO5A 1WI9A 2VT3A 3ZQ7A 3KE2A 4HF1A 1TQMA 2J5PA 1OMIA 1R36A 3F6OA 4ZH4F 5LHGA 2QENA 2WC2A 4L9NA 2XAJA 1XGNA 2FA5A 3FXQA 2XASA 1USSA 2F5DA 2EV6A 2ADUA 1GXQA 1H9GA 4AWXB 1E17A 3K1NA 1U5TA 3RKYA 2EJRA 3G73A 3QRFF 3JTGA 2LF7A 3BJOA 3RYPA 3VB2A 2AXLA 2RQPA 1NHAA 2DFIA 3CLOA 1R1UA 1T38A 1J5YA 3BY6A 4M6YA 2A6EF 1XGOA 1BI2A 2L4MA 4O5VA 3KCCA 3GLXA 4ESJA 1G3TA 3L2CA 5TJJA 4A0XA 1GVJA 1U5TB 4ENKA 4DQ2A 1E2XA 1EH7A 1XD7A 4L9VA 3K1MA 4AIKA 2OQRA 5CVUA 5HDNA 1XCBA 3TGNA 4HF2A 1IXSB 1QZYA 4JQFA 5ICFA 3WU0A 2RN7A 3FM3A 5ED4A 3HTSB 5F6FA 3LSTA 2FBHA 5L3BA 1KGSA 3W6JB 1G3SA 3KZZA 4RGRA 1D3YA 2ZMEB 2VXZA 1FT9A 4NHJA 1IUYA 4A0YA 4BHBA 4BNCA 1B4AA 1FP2A 3COAC 3IWZA 3VODA 1TTYA 3FZVA 4BH9A 1ZG1A 4ETSA 3T1BA 1G6NA 4I2OA 3AAFA 2L01A 1YS7A 3KLOA 3SFZA 1Y0UA 4ZYHA 3KLNA 3WTYC 2PBIA 3I59B 5DEQA 4P55A 3KP6A 5J6XA 3NEUA 4M9ZA 1ULYA 1KU2A 5E20A 3QAHA 2F5CA 5DDGA 5ICGA 4IJAA 1LB2A 4UUVA 1HQCA 2J5OA 3P9IA 5D4SA 3B73A 5BQTA 5FFXA 2E1CA 1BI0A 2EA2A 2VONA 1P6RA 4M73A 1TW3A 4KYWA 2HOEA 4R79A 2HYFA 3ZMTA 1S29A 4R8HA 4Q47A 5DYMA 1BJAA 1KU7A 3R0JA 4FX0A 1QGPA 1C0WA 1TNTA 4BXUA 3IRRA 2XV4S 2BEOA 3DFGA 5FFZA 4U7BA 1W5TA 2C6YA 1I1SA 4N9HA 3C3WA 2GQQA 3RYRA 1V4RA 2K7LA 2RGVA 1W7PD 1S7AA 2LDUA 4WX9A 2D1VA 4RAYA 2IT0A 1OYYA 5DCMA 2H6CA 2EA4A 2UXXA 5AONA 3RI4A 4K2EA 2YU3A 4I09A 3E3VA 1LEAA 4MQ9F 4L5JA 4UNOA 2ZNZA 5LRRA 1D5VA 3CTAA 5LGTA 1Z7UA 5D4RA 5J8CA 1S6LA 3FXUA 4FT8A 4I01A 3KP4A 5BMZA 4UVCA 1STZA 3SXYA 3BZ6A 4HV5A 3WGHA 3PFIA 1O7FA 2K02A 5AIQA 1BI1A 1GHCA 5CLSA 5FGMA 3GFJA 2PJPA 3C1DA 4ESBA 5L3CA 1ZGJA 5EEGA 1DDNA 2OBPA 1LVAA 3L09A 1VTNC 4WCGA 4KIGA 3KETA 4U88A 1T39A 4M6XA 5JVTA 4HV6A 3Q9SA 4WXCA 3F8BA 2HWVA 2W84A 4LLGF 2DTRA 1IN4A 2BBYA 2BYVE 5E8IA 1ZLKA 3JAMK 4A5MA 4HYEA 2A69F 2V6CA 3RDIA 2IPQX 2QYOA 3O6BB 3TO6A 1ZHFA 2DT5A 2QBYB 5D5XB 2NNYA 1PUEE 5K5QA 2F5EA 1KU9A 4HF0A 3TQNA 4XLPF 5F64A 2JZYA 2JT1A 2VE9A 4OINF 2H6BA 2P5KA 1HXDA 1U3EM 4N9IA 5FLXK 2G7UA 4Y17A 3HHHA 1J75A 1EH6A 2ZNYA 4I0BA 4JBAA 2A5YB 4OIOF 1O3QA 2O8XA 3SZTA 2DPDA 5HS7A 6PAXA 2VODA 4EJWA 2HKOA 2W57A 3CUQA 1W7PA 3ZMVA 4EM0B 4S04A 1QQIA 3TO9A 1JHHA 4ZZLA 2V1XA 5D6EA 2FE3A 5E18F 3NRVA 2XROA 3KP5A 1U78A 4U0YA 1USTA 2CW0F 2JPCA 1BOAA 2A61A 3FMSA 3I5UA 2XKOA 4UVBA 3T8RA 4ENMA 1ZG5A 4LMYA 4Z2YA 1R58A 4UXNA 2CYYA 2IRFG 2HFHA 3BP8A 3QP5A 2H94A 1B1BA 2XRNA 2FU4A 4P9FA 3KP2A 5CVVA 1XDUA 4Y15A 3WTSC 5D6FA 3ABTA 3G3ZA 3MFKA 1MJBA 1CF7A 3ROUA 1ZRDA 1OYIA 3HRUA 2JRTA 1T98A 1UB9A 1J2XA 2OZUA 2QQAA 5ILUA 1S7OA 3QP6A 2M5WA 3I64A 2BV6A 3EUHA 2EFWA 1SMYF 3ZP5A 2F5FA 2HQRA 3I71A 2MH9A 2P7VB 3GUDA 5D5VB 4KDPA 1WRJA 4HQMA 4CO8A 2HS5A 4OIQF 4KN7X 2L3DA 3PQKA 3J81K 3F22A 1SD4A 1SFXA 4LB6B 1P4XA 2FNPA 2IW5A 2MD5A 2UZKA 3FMQA 5LEKA 2F2EA 1KYWA 2BGCA 2OU2A 2OZ6A 1IXCA 2E7XA 2E7WA 2K86A 2W24A 4ON0A 3M7GA 3U1DA 4G6DA 1ZYRF 3ULQB 5IT9Z 4BHCA 1B9NA 1KA8A 4WXDA 3DKWA 3ML6A 2ZO4A 2H27A 2VOOA 3FWEA 3I4PA 3DF8A 4GXOA 4I7HA 1UCRA 4TV7A 3OV8A 3HRMA 1GXPA 1Z6RA 4KMUX 3MEXA 1YW9A 4BYYA 3U2RA 5J8FA 1FOKA 2XAHA 3O3KA 2MC3A 5DUKA 1F5TA 2FBIA 4YIFA 2QQBA 5LGNA 3BJAA 5JFRA 4M72A 1ON1A 1LNWA 5LEJA 2EFOA 4HQEA 5LLQA 3ECHA 1LQ1A 2RDPA 4AIHA 1MKMA 4NB5A 3RTRA 1XCVA 5D5UB 4IHTA 3QOPA 3ZPLA 5L3DA 5BOXA 2HQNA 4KNYA 3J80K 3E6CC 2VT2A 4OIPF 3V7SA 1R1TA 2V1DA 2YX4A 2PI0A 4HLXA 3HSEA 2P6TA 1AOYA 2OD5A 1XSVA 5ILVA 2PN6A 3QPTA 5A2QK 1O3RA 2ZBKA 2P5VA 4YIIA 4CICA 2D1HA 5FD6A 4CGZA 2ISZA 2FSWA 3CO6C 4WF2A 2ZMEA 1ZH5A 4MTDA 3D0SA 1SFEA 1K78B 3T5XA 1W5SA 3ERED 2O03A 1BIBA 5CVRA 2D2WA 3WGGA 4RB2C 4JK1X 4G94A 3ISPA 2DQRA 1LDKB 5E1WA 2Q2EA 3I59A 2VE8A 3ZMDA 1UHWA 2QUFA 2QVOA 3VFZA 1G3WA 1B9MA 3Q9VA 2L4AA 3R4KA 1SAXA 4IXAA 3KP3A 1XGSA 3K1PA 1RUNA 4GYIA 5LRSA 4L9JA 1WQ2A 3EYYA 3WGIA 3T8TA 5FB2A 1BN5A 4KA4A 1XMAA 2PQ8A 4EJUA 1XSXA 5KVRA 3H3ZA 4G9YA
chains in the Genus database with same CATH superfamily
3MQ0A 2L02A 2R5ZA 4M3BA 1FC3A 2ELHA 3DP7A 2WA0A 3FISA 2P6SA 2DMTA 4NUBA 3EETA 3VWBA 1P4WA 3LFKA 2W85A 1YW7A 2BVLA 4MGRA 1DU0A 2DU9A 3HB9A 2GLOA 2M0MA 4YFKF 1RESA 1YHQI 5GAGJ 4BDYA 1XN7A 4LFUA 1H9TA 4YFXF 4YG2F 5EGOA 2NXNB 1VQ6I 2NYXA 4EMSA 1FEXA 4N4NB 2COMA 2L7ZA 1WFXA 2BOLA 1IJWC 1JGGA 3DKYA 3SJMA 4XLHA 2OA4A 3GEZA 1P92A 4BGDA 5BPIA 2R7WA 4BE1A 4BE0A 1QO0D 3J7YJ 3CC4I 1B72B 1Q1HA 2HR3A 1HW1A 3BPXA 3U1KA 2CH0A 5E3OA 1MMSA 2IJLA 4FHTA 5C3EJ 2VQGA 4A3GJ 1D0ZA 2NOJB 3PNYA 1YFHA 1OCZH 1T8IA 2XIGA 3L9FA 2NS0A 5DTDA 3ZQGA 3GFIA 1ERDA 5HNFA 4W97A 2XAQA 3NWSA 4RB0A 1H8AC 3V8LA 3KEOA 2Q0OA 4O6JA 1WH7A 2KFDA 2DA4A 2EIKH 3KYCB 3OIOA 3FMRA 1ON2A 1Y0NA 3AG2H 1HDPA 2VN2A 1VQOI 2DPUA 1SFUA 3BTIA 3KP7A 2GA2A 1IAWA 1PJRA 3KEQA 4KIFA 1BR4A 2XAFA 3LA2A 3ELKA 2V4JC 3DPTA 2AQEA 5HOOA 5EEAA 3DEUA 1MBKA 3N97A 3RQIA 2PLYA 2WB1N 2O0YA 2VUMJ 2FMLA 3MCZA 3AL0B 2XGDA 4PJMA 1UHMA 2Y31A 2HGCA 2W1OA 2GXBA 3BR0A 1YJWI 3LSJA 4WK8F 3MN2A 4O3MA 3WG7H 3FIWA 3OOPA 2M8GX 4E7HA 3PQJA 1RI7A 2VKHA 4EATA 3IL2A 3IKVA 4V19K 2Q8KA 3B02A 3E6BA 3S2WA 4LJZF 3ZN1A 3RPUD 4D0PA 1BJZA 4EVIA 5IP6A 4A3EJ 1FY7A 4HX7A 4Q4ZF 2V6EA 4EJOA 1T0FA 2BE5F 1ZELA 3VSLA 2KQRA 4D9JA 4IHXA 1NG6A 2GM4A 4E7SA 1HOMA 2GBYA 2K9LA 2KJCA 4KN4X 2Z5UA 1RIOH 2HEOA 5GAEJ 4BQQA 2WAEA 3EDPA 5BPDA 3SEZA 2DMUA 3CMMA 1G3YA 4B48A 2PJRA 2IGMA 1VQ9I 1B6AA 1IW7F 2GIZA 2LYCA 2QSFX 4HAMA 3ZCOA 2DOFA 3CCQI 3WHCA 1X1BA 4U0VA 3A02A 2HXIA 1MH3A 2V9VA 2VOPA 2JK3A 2XVCA 3V4GA 2ZXJA 2HZDA 2PMUA 4W1UA 1HF0A 3A2KA 3VSKA 3F3XA 4WWCA 3CCLI 2ACJA 5DD8A 3EQLF 4C2MJ 1YLFA 2QBYA 5LD2C 3ZN0A 3OMYA 2FOKA 3HPGA 3G1OA 2WB1A 3IC7A 2FJ1A 2QQ9A 2I8DA 4LB5A 3I54A 5KAFC 3CJTB 1SMTA 1QBJA 2A6HF 1SVLA 5K5OA 3GZ5A 1HLVA 3F6VA 3ZMUA 3BG9A 2QLZA 1JKRC 3OL4A 4OOIA 2P81A 4BACA 1RPWA 1X1CA 1ZAOA 2COBA 5FO5A 5H6RA 4BBRJ 3JRDA 5FLMJ 3HIFA 3GTMJ 4UHTA 2L7KA 4NQWA 3C2GA 3HSRA 3W2VA 2OUMA 2GIVA 1GT0C 1MMNA 3RCOA 1IGNA 5CYVA 1KQ8A 3G4SI 2KHMA 5K7ZA 2ISYA 4YRVA 4BL0B 1BI3A 1DPUA 5ICEA 3SZGA 1Z91A 3R0AA 1R5GA 2FNAA 2K5CA 1P4AA 4CZZA 2DI3A 1MGTA 2IGOA 4CZCA 3MAJA 1JHFA 1U2WA 2CQNA 2EZIA 4AM3A 3D5LA 2GAUA 2EINH 3F8NA 3FX3A 2K3FA 4JYKA 4KUMA 2M7AA 2E1MC 1N75A 4L0ZB 1RKTA 2BY1A 2DCEA 2JTVA 3B6AA 4ZDLA 4A3JJ 4AD9A 1D8JA 4PGHA 1IN8A 2OTJI 3GVAA 3H36A 2OCEA 4DYQA 2RV8A 1SD6A 3CCUI 1IO2A 1ODDA 1TQIA 1ZG3A 4NQWB 4XBFA 4LG0B 5M5YJ 1NTCA 3K2ZA 2IA1A 2RNGA 4UUSA 2UXNA 3M9AA 4CDGA 4A6EA 3HRSA 2DTZA 4X0GA 2BW3A 1IN7A 3KZIC 3BWGA 3CCRI 3DWLE 3HUGB 1VQ8I 1WWXA 2HQ5A 4A3KJ 3TW7A 2A05A 3ONQA 5EEHA 2BY2A 4XR6A 2DFFA 3TMOA 2H1KA 2XKPA 2M3AA 2EV5A 2LKPA 4LK1F 1JGSA 3HJEA 4NBQA 1YIOA 5DD4A 1IN5A 3DPLC 1I6XA 2LY2A 5HLGA 3PUFA 3RJPA 1VQKI 2Y48A 3JAMZ 2AXTC 1MJ9A 1S3JA 5EG0A 2L54A 2EFPA 4XKCA 4IF4A 1X3UA 1YOVB 4RAZA 2BY3A 3HOSA 4GDFA 4EJVA 5AIPA 4ZJZA 2M9HA 3O2PE 3I4NJ 4XORA 2AHQA 3HOVJ 1MW7A 2IGKA 3MZYA 2X0LA 4EM2A 5CVJA 2ESNA 2ME6A 3Q0WA 3P5JA 2NRAC 2CMPA 5TGTA 1TW2A 4RAGA 2DA5A 3BR1A 1YG2A 2LKSA 2VC0A 3GFLA 3UKGA 2R7DA 1JJ8C 5D8LB 3RPUA 3ASOH 1JI8A 1ZRFA 1OLTA 3Q5FA 3UR3C 1SFKA 3S1RJ 5E3NA 4IOCF 3RZOJ 2VC1A 2HZTA 4L18B 2WWYA 4GGGA 1RRJA 5KNLA 2OQGA 2X6YA 5FLXZ 3VYSB 4AUXA 2UV1A 1IN6A 4Z6YA 4OMYA 2GA1A 1X4PA 2LC2A 4JX5A 5DCFA 2JMWA 1P7JA 2Y0MA 2QM3A 1UFMA 2XUBA 3HG9A 2R5YB 1FSHA 1U8BA 4B3XA 1IF1A 1F1ZA 5HS8A 2TCTA 4I6ZA 3ZQIA 2MA3A 4ZDPA 2E34A 1TWCJ 2QZ8A 5TISC 2R7XA 5ICCA 2JPBA 4WXHA 1O3TA 4GCVA 1J9IA 3V8KA 5DM6F 2AS5F 2M87A 1W36D 1FPQA 4IRGA 1M1EB 1QHGA 1MIJA 1JUMA 3I0TA 2ID3A 4P5OA 2XPWA 3M8EA 2CQQA 2JA7J 1LUJB 2V9PA 1HW5A 4MHGA 3F8FA 3P9KA 1XB4A 2X85A 4B8XA 4C3IJ 1FBUA 5M3MJ 1R71A 1OYWA 2E19A 4XN3A 4FISA 4Y52J 1BC8C 3K4MA 4BU2A 1J7KA 1LEBA 3RQ4A 4HNUA 2Z99A 4ASNA 1K4TA 3GTOJ 3M8FA 3OS0A 1P7IA 2EIMH 2IA0A 1KQ9A 2RNJA 1RUOA 2V1UA 1ETQA 3PO2J 3IKTA 2KKOA 5M3FJ 4Q48A 4GYGA 1L0OC 3BROA 4RB1A 4ENNA 4OMZA 4RGUA 2ZCWA 2DK8A 2K9QA 4J00A 3CESA 2MLKA 2R3SA 3I53A 1MMAA 2STTA 4L0YB 4FCYA 3FBNB 3RIRA 3BZCA 4OWRB 4IQ4A 3RSNA 1X3WB 4XRSA 4N0BA 2D45A 4HSRA 3K4LA 4D5FA 4J19A 4DBRA 2FUG2 4C3HJ 1OCOH 3LWFA 2B7EA 4ZTJA 3K70D 1JKPC 1P2FA 3OYIA 3F23A 2ZSIB 2QWWA 1YJNI 5M5XJ 4U0WA 1R22A 2A3SA 5C44J 3LAPA 3GLLA 3O8GA 3IUOA 1TQPA 3X2QH 3MZHA 1VFCA 3OYLA 2VBWA 2LP0A 4BEHA 5J4VA 2AO9A 2ECBA 4IHVA 1J59A 4B47A 3CDHA 3ABUA 3L2VA 2XHKA 1H0MA 4R1HA 3SHFA 3LSHA 2XAGA 2E2HJ 1REPC 4YELA 3K9TA 2FQ3A 3L2QA 4Y7NJ 2XC7A 4MFEA 2CUEA 2RC4A 3GTJJ 1A04A 4IZZA 1TWHJ 4XSZF 2A6TA 4RGXA 2XPUA 4HBLA 4E4HA 2STWA 4LITA 4Y13A 1WKMA 2HI3A 1BA5A 1TWGJ 5L3EA 3MZ8A 4RGSA 3JRHA 5EYRA 2Y75A 4OU0A 2XGXA 3HGGA 3J7ZI 2GXGA 3S3MA 4AIJA 3IWFA 2GWRA 3AKZA 3J81Z 1U8RA 5F04A 2CQ7A 3QU3A 4I76A 3S2DJ 1RZ4A 1FNNA 2K85A 2VJ4A 1E0EA 3F21A 1JUSA 4XRFA 4C3JJ 4E7IA 2I10A 4QTRA 4A3CJ 5LGUA 5JVGF 1LE8B 4D1QA 2WY7Q 2EZKA 4MNUA 1AKHB 3IAS2 3TOBA 2FBKA 1SANA 4HG2A 4HDVA 1V55H 1K78A 5E79C 2IAIA 3TBIA 1PUFA 4XKBA 5EZHA 5F1RA 3QU6A 2W4SA 2ETHA 1S8NA 1R00A 4HNVA 2DJNA 3FXRA 3CMAI 4CSWA 5LFAA 5FRMA 1T6SA 2O8KA 2G0EA 5K1YA 3WTWC 2M45A 4PCQA 3HRTA 1AWCA 4QPQA 1YS6A 2DAOA 3TDUC 1E3HA 3ZR8X 3DTEA 1MBEA 4C2TA 1HSJA 2LLKA 1TBXA 2DW4A 4FETA 1JT6A 1LDDA 4G8XA 1T2KA 2R7FA 3BDDA 4U7DA 3GTGJ 4M9SA 2O61A 3N4MA 3WTVC 2KIQA 3OIPA 5FKLA 3GF2A 3CF5F 1IRXA 2DXIA 3W6KB 2EB7A 3QODA 3S17J 1SD5A 3DKXA 4C30A 4OIRF 2XGCA 4E70A 2EH3A 3CO7C 1WI3A 3CP8A 4XSXF 3EYIA 2WAQN 1V5GA 4PGGA 3K4BA 2P5LC 2ZJPF 3BJ6A 2LNBA 1BC7C 2VPLA 4Q5SF 2I5UA 2CFOA 2FRHA 4II3A 1Z6TA 4HLYA 4IEJA 2CW8A 1MDMA 1PP7U 1QHHD 2HYGD 2K27A 4EM1A 1FYLA 2M1BA 1TLHB 2HKXA 1I3QJ 1FBSA 2VI6A 1K6YA 1BBYA 3OYEA 3CZ6A 5HDKA 1B59A 4B09A 3JSPA 1G4DA 3BC8A 3DV8A 3K2AA 3QWLA 3HOZJ 2HXOA 1FBQA 1I50J 5HDGA 1U6GA 4AC0A 4LK0F 3WTXC 4RDUA 5L3FA 3KEYA 3KX2A 1LKXA 3P7NA 3CJQB 1KYZA 3TW6A 4EGYA 1JXSA 5FRNA 2CQKA 2R92J 2DQLA 3FM5A 3K10A 3J7AY 4PDKA 4BS9A 3J80Z 1Z1DA 2CSOA 3JW4A 1DPRA 4H4KC 4A6DA 2FOWA 2FMYA 3GYHX 2R4GA 2E1MB 5CVIA 3SYTA 4F7ZA 2VBYA 2H09A 2ELJA 4BHPA 2JUCA 5DUIA 2R7TA 3QPHA 1FYMA 4MIMA 1VQLI 1ZRCA 1MDMB 3R60A 5J4YA 2X1DA 3VYRB 4I02A 2GOXB 5A2QZ 4LD5A 4ZYEA 5BNGA 3CUQC 4GRIA 1Y8QB 3E5UA 3H9JA 2IP2A 3MWMA 2DK5A 2WAQA 2CGPA 3BPVA 4XLAA 1YYVA 3B6CA 5HS9A 1B8IB 4A3DJ 2H8RA 1B72A 3H0GJ 3T0YA 2NAZA 1OR7C 3TKYA 4CYDA 3H92A 1QPMA 3G71I 2MW8A 2XAUA 3L2RA 2K4BA 4HX4A 5K7HA 2PMHA 3K6GA 2VQCA 2KIMA 3K4JA 5F1JA 4RLFA 3JRIA 2JA8J 4EV0A 5FROA 4ZYDA 3HOUJ 1ZQ3P 4XN0A 1HDDC 3S32A 4BQAA 1QVTA 2ESHA 3ZQCA 2KRFA 1FYKA 1OCCH 3JR9A 4UB6C 3MKZA 5HLHA 1JTXA 1FOXA 2E60A 3PIOF 4E7KA 1VQ4I 5KK1A 3IRQA 2V79A 4RM3A 5GP9A 4YIRX 2QSHX 4EQQA 1GLNA 4HPQA 2KRHA 1S7EA 4Y33A 1R5HA 2PEXA 2LF8A 1FSEA 1V3FA 2IBDA 5H2FC 4FX4A 1I6HJ 2QKMB 5CKTA 4DIQA 3S8PA 1ITYA 2DFEA 3ZRGA 1CGPA 4KT6A 4ZYAA 1XSDA 3S1QJ 1YIJI 1OPCA 4AVZA 5IY5H 1JE8A 4CUGA 3CMEI 3LSRA 2MH2A 4EEFG 3E6DA 1EH8A 2KIFA 2JSCA 5EZGA 1YRNB 5J3LA 1IRGA 1D8KA 1S9HA 4M74A 3HOWJ 5FKNA 3OR2C 3ZQLA 2YSRA 2P4WA 3REOA 3HL2A 4A3LJ 3A4CA 3M3YJ 5E1ZB 3I58A 3KFWX 3TEDA 1VQMI 1X1DA 1GDTA 4QLCU 1IRFA 2IS4A 3ABLH 4HEA2 3QYEA 4X1EA 2DYSH 2A5WA 1IXRC 1TT5B 2CJJA 2OCCH 4FE7A 2CW7A 3EUAA 3EPZA 5IOYA 3K69A 4IHSA 1WJAA 4QWQA 1UG2A 2HDWA 4F92B 4A12A 1PP8F 3L00A 3CCYA 3IHUA 3WTUC 4ZZDA 1G2HA 3BCBA 3KPHA 1I1GA 3C7JA 3E0JB 4BY7J 1RETA 3A0BC 3C18A 4LLLA 3K4NA 3VEPA 4PZJA 4H0EA 1DP3A 4DZJA 1DP7P 5J47A 2LSOA 5ILSA 4F55A 1R1VA 1ZARA 1YO5C 4M3FA 2DBBA 2WV1A 1ZREA 2O3FA 4HX8A 1XMKA 2VASA 4KITB 2OAZA 4MEYF 3ASNH 1QNTA 4MTEA 4CCOA 3MKLA 2X6OA 2W25A 4XIDA 2IVMA 1GV5A 2O6GE 2CUJA 4IO9F 4MO7A 3LSGA 2NVQJ 4BXFA 4MQVA 5J1UA 1W4MA 1YJ9I 2WTEA 4BXXJ 1D1CA 1O7LA 3DEEA 1SD7A 4DOZA 3IH4A 2L9SA 3PM1A 3MKYB 2KJBA 2OF7A 2XF5A 2XPVA 4FTHA 4ENJA 1FZPB 3FF5A 4IOAF 2JQ7A 3OS1A 2FXAA 3QYFA 3GMEA 4JP0A 2ECCA 3HOTA 1FOWA 3OL3A 2M30A 3HDDA 2X4HA 5IP9J 3OYHA 1Y39A 3DTIA 4U87A 2CWEA 2UWMA 4HDUA 2DJIA 2PMZN 3CJNA 1LDJA 1UHSA 1ZN2A 3M8JA 5J40A 4UVAA 5L3GA 4LOCA 4MEXF 2KL4A 4V2GA 2RVCA 4KICA 2NVXJ 4N4OB 2CFXA 1QU3A 5DCMB 3WTZA 1MJAA 1D1BA 3A0HC 3JTHA 3L2UA 5JR3A 4GFBA 2ZFWA 1X58A 1MMGA 2PG4A 3LQRA 1YW8A 1XMXA 2ICWG 2Z16A 3WE2A 2EK5A 4A2UA 1D1AA 2G9WA 4I0AA 4RAFA 1YTYA 2M8EA 2R93J 3MD2A 1MNMC 1ETXA 4M3EA 1WJEA 5C4JJ 1QPIA 2HTSA 4HA8A 3HZJA 5E17F 2DFHA 1FWZA 3WODF 5JI6A 1L3LA 1JJ6C 4A0ZA 4LG0A 4OAZA 3WG9A 4M3GA 5M5WJ 2VBXA 1TL8A 1U5TC 1RNLA 2CV2A 2XB0X 3DTKA 1K7AA 5F27A 5IYCJ 3SQNA 3HUGA 3E6MA 1BR2A 2L0KA 4HW0A 3PFYA 1BL0A 4CYCB 1TNSA 1R7JA 2CG4A 1FP1D 4OAYA 1J0RA 2Y2ZA 3OYFA 2LY1A 3NQOA 4JX6A 3AG3H 2HOTA 4DJAA 1Z9CA 3CF2A 2LKXA 1F43A 2E71A 2P8TA 5E1XA 2PMZA 4BBSJ 4IRIA 2VQHA 4EGZA 3C2BA 2HTJA 3E97A 1BOBA 1DQUA 1F9NA 4ITVA 2FF4A 3AFHA 3VYTB 1GVDA 1IRZA 1LFBA 2L7FP 3DXJF 3S93A 2CUFA 3VOEA 1DUXC 3U21A 2A68F 1EV7A 5B66C 1Y1VJ 3CUOA 3M1CA 2RKHA 1WSUA 3K4CA 3TP3A 1MBHA 4E7JA 2DMQA 1N25A 3R6SA 4D5CA 3BR2A 2P7CB 1HKQA 2EBIA 5JLWA 1R23A 4KFCA 1K6OA 3MMYB 2HVSA 1P9QC 1Y56A 2LR8A 2M4GA 3VYUB 4XQFA 3H3UA 5IPAA 3SZPA 5LBQA 4CHUA 4YFNF 3C2HA 3S16J 2XDVA 4G12A 5K5RA 1VQPI 4M6VA 3F8MA 3CC2I 4L9TA 3HSFA 4UV9A 3RPQA 2X1EA 3KZYA 2ZXIA 1Y1WJ 3GWZA 3FXMA 3E7LA 4S05A 3K0LA 3RZDJ 3GW2A 3I9V2 5D8KB 2R5YA 1O57A 2DO7A 5D5WB 4B3AA 1HW2A 4XNFA 2W7NA 1PDNC 4RB3C 3W6VA 3HKZN 3KYDB 1KZHA 3S14J 4ESFA 1O4XA 4NC7A 3LAJA 3WHBA 3DCFA 4A5NA 1F4KA 2K3PA 5FKKA 4BQNA 3BOQA 5IT3A 4BKXA 1YE9A 2PFBA 1K61A 5BS6A 3OS2A 3W2AA 4A93J 4D7NA 3OYBA 3E5XA 4NC8A 5HVQC 4M71A 1YX3A 1BIAA 3OYCA 3JRGA 1HBXG 1APLC 3V8JA 1O3SA 1OR7A 1Q1VA 4RLQA 2HYJA 1BR1A 2NVUB 1W1WE 2EQRA 1ONVA 5HODA 5FJ8J 2DA7A 4CXFA 1MD0A 2E1OA 4XKVA 4X6AJ 4HZFA 3LA7A 2YUSA 2BXZA 4IRHA 3GZ6A 4LLNA 1FLIA 2XRLA 2R7ZJ 4B44A 1K4SA 4L5IA 3HYIA 1R9TJ 1FMWA 4UY8I 4M9XA 2EV0A 4DW6A 2FQ4A 1I5ZA 1E3PA 2EWNA 3BTCA 3TO7A 3BQZA 4L5EA 2Y9ZA 4IVNA 2E1NA 2ZKZA 1FTTA 1FX7A 2TDXA 3F72A 1DGWY 4XRSG 1YITI 3DBRB 5JHUA 4DYRA 2Z9OA 1MBJA 2KIUA 2ZJ2A 2DMNA 3WTTC 3A01B 3GFMA 3CUQB 4DBQA 3FXJA 4AVPA 1W7PB 4V2FA 2KLOA 3W2WA 3LQQA 2B0LA 3F8CA 4BAYA 2IA2A 3L7WA 4PSWA 1I27A 3S2HJ 1MZBA 1Z05A 2MLGA 4E7LA 2WV0A 3BTJA 4CCMA 2YR2A 5IT9K 2NNNA 3WU1B 1XGMA 2A07F 1HSTA 3GXOA 2CO5A 2LK2A 5H6QA 1KONA 1UAAA 3FKJA 5E8GA 5ERIA 2UUZA 4C9YA 2IS1A 1Z67A 2IGNA 3DQVC 3ZMSA 4UV8A 4KMFA 3GX4X 4XLNF 1JKOC 3R61A 3U9GA 2JA2A 3OYJA 3RKXA 2Z33A 2VXDA 2E5ZA 3V7RA 3ECOA 2DLLA 1HKTA 2KT0A 4NNJA 2ID6A 2YX7A 2MYSA 2OPTA 4LGWA 5LHIA 3FHZA 2VPRA 4I98B 3M1EA 1BM9A 2DN0A 3HHGA 1YQAA 2GZWA 3G6EI 3RKWA 3I55I 3TDZC 2VBZA 2BZTA 5H20A 1AHDP 3V7CA 5B1AH 3LA3A 2LMDA 3P9CA 1RKWA 3GCMA 2Z3YA 2LBFB 4B43A 2G7HA 4G7ZF 1HKSA 3E5QA 1ZGAA 4IKFA 3HTUA 2K9MA 3LMMA 1KQ0A 1KU3A 2LOOA 5FD5A 4P96A 1Z0XA 2B63J 1LJ9A 1IZ1A 2R7RA 4RS8A 2K4JA 3ZMZA 1XS9A 3QOEA 2JUGA 3TOAA 4ZYGA 2VIXA 1QZEA 4RMNA 3S3NA 5LHHA 3D5RC 1CF7B 2EFQA 2HDCA 5CQGA 4CA0A 5CJ9A 4IPAA 3JSOA 2VB6A 2X51A 1LE8A 1AKHA 1ZLJA 1K79A 4KT5C 3J7AO 5DV5A 4EJTA 1XDSA 1QZZA 4KIBA 1VQNI 1VI0A 4G7OF 2ZJQF 3WE3A 3LSPA 3S3OA 3BR6A 3AG4H 3ERMA 4DNCA 5HLIA 4G6QA 1A5JA 3OOUA 1POGA 1T0FC 1OKRA 3TP0A 4G7HF 4A3IJ 1XX5A 3OYGA 3RKQA 3CDLA 3NARA 1S72I 2EFNA 3F9KA 2X48A 2RAEA 2YPRA 2ZFUA 2MBFA 1LPQA 1A31A 1IG7A 5TRDA 4GO1A 4HOBA 4FQGA 2FEZA 3BR5A 1IV8A 4P9UA 1T56A 3GO5A 4ZDOA 1WI9A 2VT3A 3QPSA 2B9SA 1IC8A 2HDDA 3ZQ7A 3KE2A 5FKMA 4HF1A 1TQMA 2J5PA 1OMIA 3FHNA 1OQYA 1R36A 1A6QA 3K7AJ 1N77A 3F6OA 1XPXA 4ZH4F 3PO3J 1UZCA 5LHGA 4FE4A 2QENA 2WC2A 1JT0A 4L9NA 2ZB9A 2HPIA 4JX4A 4PJLA 3JRAA 3BG6A 2XAJA 1XGNA 4XL9A 2FA5A 1RC9A 3FXQA 2XASA 1USSA 5E3LA 5B3SH 2F5DA 2EILH 2EV6A 2ADUA 1GXQA 1H9GA 4AWXB 1E17A 3BG7A 3I3LA 3K1NA 1U5TA 2XGEA 1OISA 3QYBA 3RKYA 4BJ6C 2EJRA 3QQAA 5GTHC 4PJNA 9ANTA 2V1NA 3G73A 3QRFF 3JTGA 2LF7A 2MFZA 2V7FA 3BJOA 1MH4A 3Q0UA 2VKVA 3RYPA 3VB2A 2AXLA 2W00A 2RQPA 1NHAA 2DFIA 3CLOA 3PSFA 4UB8C 5EDNA 1R1UA 1T38A 2X6XA 5J1RA 3PNVA 1J5YA 1X3ZB 3BY6A 4M6YA 1H89C 1H88C 2BVMA 2A6EF 2FD5A 1XGOA 1EF4A 1BI2A 2L4MA 4O5VA 3KCCA 3WU2C 3GLXA 1ZTRA 3CDIA 1J09A 1OCTC 4ESJA 1G3TA 3E1SA 2OJED 2DYRH 3G2BA 2XF7A 4YEJA 3CMYA 2DA3A 2Q1ZB 3L2CA 4CCNA 4BJ5C 2W48A 3HGYA 3HEFA 5TJJA 2Y30A 1GVJA 4A0XA 5IP7J 3L2WA 1U5TB 4ENKA 4DQ2A 1E2XA 1EH7A 2FX0A 1B8IA 2ZXHA 4II2A 1FTZA 2VKDA 1VZ0A 1XD7A 4L9VA 3V42A 3GTLJ 3K1MA 4AIKA 2OQRA 2DMPA 4XK4A 4BE2A 5CVUA 5HDNA 1XCBA 2WY8Q 1ZR2A 3TGNA 2OV7A 4HF2A 2JRMA 1IXSB 2O7OA 1QZYA 4JQFA 5ICFA 5GPCA 2KISA 3WU0A 2RN7A 3FM3A 3F0CA 4PJ0C 5ED4A 1ENHA 3HTSB 2L9RA 2R7QA 5F6FA 3IV5A 3LSTA 1PYVA 2FBHA 5L3BA 1FIAA 3LSIA 1KGSA 3W6JB 1G3SA 5F0FA 1Z77A 3H5RA 1Z3YA 2Y0SN 2DOEA 1ETKA 1U9OA 3ABKH 3KZZA 4RGRA 2F4MB 5F0CA 1A35A 1D3YA 1NK3P 2O9LA 2KMUA 2ZMEB 2VXZA 4KJZA 3OY9A 1V5EA 1FT9A 3BG5A 1U9NA 4BQOA 3K4KA 4NHJA 4A0YA 4BHBA 4BNCA 1IUYA 1B4AA 1ZR4A 1FP2A 3COAC 3IWZA 3MVPA 3VODA 4KISA 5K7FA 4MFDA 1TTYA 1UMQA 3H9QA 1DU6A 4E7ZA 1VQ7I 3FZVA 2VQLA 4BH9A 2NS7A 3DPUA 1ZG1A 4ETSA 3T1BA 1YRNA 1G6NA 4BY1J 4I2OA 3AAFA 4HSTA 2XB5A 3NAUA 2L01A 1YS7A 4P1WA 2AQFA 3KLOA 4QPOA 1JTYA 3SFZA 1Y0UA 2KRCA 4ZYHA 3KLNA 1ZK8A 3G1LA 1NG7A 3WTYC 2PBIA 2Q2EB 1UJ8A 3I59B 3OYNA 5DEQA 1MSFC 4P55A 3KP6A 5J6XA 2RQQA 3NEUA 4XOPA 2DDAA 2TRTA 4M9ZA 1A6IA 1ULYA 1D0XA 1KU2A 3QAHA 4PJJA 2MC4A 5E20A 2F5CA 5DDGA 5ICGA 3CCEI 2JVGA 4IJAA 2HPMA 3CCSI 1LB2A 2QQ8A 4UUVA 1HQCA 2J5OA 1PVEA 3P9IA 5D4SA 3B73A 5BQTA 2Y0SA 1RR7A 5FFXA 3OR1C 1BI0A 2E1CA 2EA2A 4IHYA 2VONA 2VL8A 4CCKA 1P6RA 2PX9A 4M73A 1TW3A 4KYWA 2MG4A 2CS3A 2R7OA 2HOEA 1MBGA 4R79A 3JREA 2HYFA 5HLTA 4A3MJ 3DEWA 5GADJ 2ELKA 2JSPA 3ZMTA 1S29A 3CLQA 4MLOA 3PSIA 3SFIA 1W0UA 4R8HA 2QF7A 4Q47A 2R5ZB 1AU7A 2V26A 5DYMA 1BJAA 1KU7A 1NK2P 3R0JA 1GUUA 2DT7B 2JWTA 1SFOJ 4FX0A 2W82A 1QGPA 2XSJC 1C0WA 1MMDA 2R7VA 1TNTA 4BXUA 1WJBA 3EUHC 4AIDA 3IRRA 3GTKJ 1SEUA 3BLYA 1OCRH 3SDBA 2XV4S 2BEOA 3HC7A 3DFGA 2NVYJ 5EGOB 5FFZA 3ZQFA 4U7BA 1W5TA 2C6YA 1I1SA 3M07A 4N9HA 3C3WA 2GQQA 3RYRA 1V4RA 1AA7A 2K7LA 3HPHA 1TP4A 1FOYA 2RGVA 2F4IA 1WPKA 2F5VA 1W7PD 1S7AA 2LDUA 1Z7LA 3VDXA 4WX9A 1U0JA 2D1VA 4RAYA 2IT0A 1OYYA 5DCMA 3IP4B 2H6CA 2EA4A 4B1RA 2UXXA 5AONA 2LRDA 2X6WA 1Y8RB 2HOAA 2R7UA 3RI4A 1IUFA 2IEKA 3JRFA 3JCUC 4K2EA 1TT0A 2L2OA 1X19A 3H5NA 1X1PA 2YU3A 4QSHA 4I09A 3E3VA 1ACIA 2YU9J 1LEAA 4MQ9F 4RBOA 2HNHA 1T08B 2LREA 4L5JA 5B5EC 2VJIA 2ZNZA 4UNOA 5LRRA 3N05A 3ESWB 2EIJH 4XLFA 1D5VA 3CTAA 1D0YA 2M4KA 4RA2A 3FKIJ 1SVOA 2LH9A 5LGTA 2LD5A 1Z7UA 4F93B 5D4RA 4XLCA 3GBGA 4XOTA 3S15J 2OC6A 3CP2A 5J8CA 3OYMA 1HC8A 2QA4I 2DOAA 4CYCA 1S6LA 4DYCA 3FXKA 3FXUA 4FT8A 4I01A 2HQAA 3KP4A 5BMZA 2HU9A 4UVCA 4BJTA 1STZA 3OIQA 3SXYA 4IQJA 3BZ6A 4HV5A 3WGHA 2CUZA 3PFIA 1FIPA 1O7FA 2DA6A 2K02A 2LVSA 3D5SC 5AIQA 1BI1A 1GHCA 3H9GA 5CLSA 2KDZA 3OWTA 3L1PA 5FGMA 3GFJA 4G6TB 2PJPA 3C1DA 4ESBA 1ETVA 5L3CA 1ZGJA 5EEGA 1TZLA 1UG0A 1UELB 1DDNA 2OBPA 2XF6A 2JA5J 1LVAA 3L09A 2M34A 2Z2SB 4I99C 4F52A 1VTNC 4WCGA 4KIGA 3OYAA 5KCMA 2HOSA 2EZHA 5CPRB 3KETA 4U88A 1T39A 1E3OC 4M6XA 3LOCA 2GXAA 4E6KG 5IYBJ 5EF6A 5JVTA 1EJ9A 4F91B 4HV6A 4Y3OA 3Q9SA 4WXCA 5E3MA 3F8BA 2HWVA 4ABZA 2W84A 2PJRB 1CQTA 4LLGF 2JA6J 2DTRA 4XLEA 1IN4A 2BBYA 2BYVE 5E8IA 1ZLKA 3JAMK 3CCMI 4A5MA 4HYEA 2A69F 3CD6I 2V6CA 3RDIA 2IPQX 2E36A 4F3QA 3LFUA 2QYOA 3O6BB 3TO6A 4QIWN 3BCAA 4FASD 3CQZJ 1ZHFA 2DT5A 2QBYB 3EUKL 5D5XB 2NNYA 3D1NI 4J01A 3BQYA 1PUEE 1R6RA 5K5QA 2F5EA 3HOXJ 1KU9A 1EA3A 2CV0A 4HF0A 1ETOA 5C4XJ 2ZMEC 4LIVA 3SDGA 1T95A 3TQNA 4XLPF 2ZJRF 3G1MA 5F64A 4XKWA 2JZYA 1LFUP 2JT1A 2VE9A 1W36C 2E35A 4OINF 2H6BA 2P5KA 1HXDA 3H0DA 2BXYA 4N9IA 1U3EM 5FLXK 2G7UA 2WADA 2KZGA 4Y17A 2DDBA 2K40A 4DGWB 1LVKA 2CQXA 4PFPA 4IL6C 1I3AA 2VJJA 3HHHA 2KDOA 1ZGWA 3LNQA 3CCJI 1EH6A 4AU7A 1J75A 1VF9A 1QVUA 2ZNYA 4I0BA 4JBAA 4XMYA 2A5YB 3CCVI 4OIOF 1O3QA 2O8XA 3SZTA 2K9NA 1TWFJ 2DPDA 1XC5A 1VQ5I 5HS7A 6PAXA 3FK7A 2VODA 4ZTFA 4EJWA 2DA2A 1JUPA 3JRCA 2HKOA 1ETWA 4C2UA 2W57A 3A01A 3CUQA 2E2JJ 2F4OB 1W7PA 2X9DA 5F0HA 3I4MJ 5EJCA 3Q3SA 1N78A 3ZMVA 4EM0B 4S04A 1QQIA 3TO9A 1JHHA 2EPFA 4ZZLA 2V1XA 5D6EA 2FE3A 5E18F 3LL7A 3H1CA 3NRVA 5FLVA 2XROA 3KP5A 1W5CC 1U78A 1LFPA 3PIPF 2KP6A 4U0YA 5KHDA 2RREA 1USTA 2CW0F 3GTPJ 2JPCA 1BOAA 2A61A 3FMSA 4UUSB 3I5UA 3K70C 3PUBA 2XKOA 2NVTJ 3OYKA 2ZSHB 3ZQQA 2BW3B 2DODA 4UVBA 1V5FA 3T8RA 4DZPA 4XRMA 4ENMA 1ZG5A 3DLLF 1MNEA 4LMYA 2O5RA 4Z2YA 1R58A 3CJRB 4JOMA 1RR8C 4A69C 1XG1A 4ANJA 2Z1DA 4UXNA 3DBHB 4PSXA 2CYYA 2IRFG 4XM3A 2HFHA 3BP8A 3PJRA 1OCPA 2MABA 3QP5A 1Z3XA 2H94A 1B1BA 5EG0B 3FDYA 1SVMA 2LBFA 2V9KA 1R49A 2XRNA 1OFCX 1BW6A 2QSGX 2FU4A 3HKZA 4P9FA 5GAHJ 2VKEA 3KP2A 3ZOBA 3DLAA 5CVVA 1XDUA 4Y15A 3WTSC 2Y69H 5D6FA 4B4CA 3ABTA 3IAM2 3G3ZA 2VJ5A 3BT9A 1MJBA 3MFKA 2CU7A 3BR3A 1A36A 1CF7A 3AL0C 4D7MA 3ROUA 1Y6IA 1ZRDA 1S5LC 1OYIA 3HRUA 2JRTA 1T98A 1UB9A 5DS9A 1J2XA 1R5ID 2CRGA 2OZUA 2QKLB 2QQAA 2DA1A 5ILUA 1S7OA 1X4OA 3QP6A 3OYDA 2M5WA 2E2IJ 3I64A 2BV6A 4M3DA 4XICA 3EUHA 3QPLA 2EZLA 2EFWA 1SMYF 3ZP5A 2F5FA 2HQRA 2IS6A 1BW5A 3I71A 3GTQJ 1V54H 3ABMH 2MH9A 2P7VB 3GUDA 5D5VB 4KDPA 1WRJA 4HQMA 4CO8A 2HS5A 1HCRA 2L7MP 4OIQF 4KN7X 2L3DA 3PQKA 5FKOA 3J81K 3F22A 4PFOA 1SD4A 1SFXA 3W3CA 1VNDA 1R4MB 3Q0VA 4LB6B 4CCLA 2F48A 1YI2I 1OJLA 3M4OJ 4CCJA 1P4XA 2FNPA 2IW5A 2MD5A 2UZKA 1SC7A 2BHYA 3FMQA 5LEKA 1WHUA 2F2EA 5DM7F 1KYWA 2BGCA 3AG1H 1QA6A 3BTLA 3HBLA 1D5YA 2OU2A 2OZ6A 1IXCA 2E7XA 2E7WA 2K86A 2W24A 4PK4A 4ON0A 3M7GA 3U1DA 4G6DA 1YX5A 2NOGA 5KAIC 1TC3C 1ZYRF 3ULQB 5IT9Z 4BHCA 2P0WA 1B9NA 2QCOA 3ZXSA 1KA8A 3KYLA 4WXDA 3DKWA 3ML6A 3DU5A 3UNGC 2CV1A 2ZO4A 2H27A 3TL4X 3NWTA 2JJ7A 2VOOA 3FWEA 3I4PA 3ZQHA 3DF8A 4GXOA 1XTAA 4I7HA 1UCRA 4TV7A 3OV8A 1WJFA 3HRMA 1GXPA 4BUPA 1Z6RA 4KMUX 4AYBN 3MEXA 3CC7I 2HVQA 2ZC2A 1YW9A 2MD0A 4BYYA 3ZGKA 3BG3A 2F6CA 3U2RA 2M2EA 5J8FA 2IXSA 1FOKA 2XAHA 3O3KA 2R0QC 2MC3A 1FMVA 5DUKA 3FXOA 1F5TA 2FBIA 4YIFA 2D5VA 4Y4RA 1WJDA 5F08A 5GPAA 4LG3A 2QQBA 1R4NB 5LGNA 1F36A 2MSYA 3I56I 3A1YA 1W0TA 3BJAA 1K83J 1MBFA 5JFRA 4M72A 2H1LA 3SEQA 1ON1A 2ZXWH 1IV6A 1X2NA 1Z21A 1LNWA 5LEJA 2QGUA 3FXLA 2EFOA 3LSKA 5IOZA 3PNTA 4HQEA 5LLQA 2E5NA 3FK6A 4RM2A 3ECHA 1LQ1A 2RDPA 2HVRA 1TWAJ 1QRYA 2LTPA 4AIHA 1MKMA 4NB5A 3RTRA 4BDZA 1XCVA 4BEHB 2R7SA 2BHZA 3BZKA 1X2MA 5D5UB 4IHWA 2L5QA 2VLAA 4IHTA 3QOPA 3ZPLA 5L3DA 2K9SA 5BOXA 2HQNA 3MKWB 1X1AA 4KNYA 3J80K 3E6CC 2VT2A 4OIPF 1EKEA 1ORKA 3V7SA 2L9VA 1R1TA 3OSFA 2V1DA 2OTLI 2H8WA 2YX4A 2PI0A 3GZNB 3IH2A 4HLXA 3JRBA 3HSEA 2P6TA 1AOYA 3HXLA 2OD5A 1WVRA 1XSVA 1G59A 5ILVA 4AYBA 1WCMJ 2PN6A 2NS8A 3QPTA 1IDYA 4UUTA 5A2QK 2WBMA 1G8XA 4NC6A 5B1BH 1O3RA 2ZBKA 1ZKGA 2P5VA 4YIIA 4CICA 3FBIB 2LY9A 2D1HA 1MSEC 5FD6A 4CGZA 2BY0A 2LG4A 2L9NA 2YS9A 3KIOA 2ISZA 1JKQC 2FSWA 3A03A 3CO6C 4WF2A 2ZMEA 3S1NJ 4CH7A 4PUSA 2WAFA 1IDZA 1WH5A 3HM5A 1ZH5A 1DGRM 4MTDA 3D0SA 1SFEA 1K78B 3VPRA 1PUFB 3T5XA 1W5SA 4A3FJ 2KZVA 3ERED 4IX7A 4HRIA 1GV2A 2O03A 1BIBA 1T33A 1I39A 5CVRA 3LSMA 2D2WA 1FJLA 3WGGA 4RB2C 3O8HA 4JK1X 1WZ2A 2X1CA 3HOYJ 4G94A 3ISPA 4XONA 2DQRA 1NH3A 2QEXI 1LDKB 5E1WA 2Q2EA 3I59A 2VE8A 3ZMDA 5JHFA 1HA8A 4A3BJ 1UHWA 1WJCA 2QUFA 3PL8A 2KPMA 2JN6A 2QVOA 3VFZA 1G3WA 1MNDA 2GOMA 1B9MA 5JLXA 2M0CA 3Q9VA 2ME0A 2Y9YA 2L4AA 3R4KA 1SAXA 1WGXA 4IXAA 3OSGA 3KP3A 2IS2A 2JVHA 1XGSA 3K1PA 4HNTA 1RUNA 4S0HB 5IYDJ 4NDLA 4GYIA 3S1MJ 5LRSA 2DT6A 2N8GA 4LIUA 4L9JA 1WQ2A 2M7BA 3DBLB 5HNHA 3EYYA 3H5AA 5J1YA 3WGIA 3T8TA 1WJ5A 3H35A 4ZC3A 5FB2A 5CQEA 1BN5A 4KA4A 2MGQA 5GTIC 1XMAA 3H3VK 2PQ8A 3IH3A 3DU6A 2LFBA 4EJUA 1XSXA 1ETYA 5KVRA 1SAUA 2XSDC 3H3ZA 4G9YA
chains in the Genus database with same CATH topology
3MQ0A 2L02A 1FC3A 2ELHA 3DP7A 2P6SA 3EETA 1P4WA 3LFKA 2W85A 1YW7A 4MGRA 2DU9A 4YFKF 1XN7A 4LFUA 1H9TA 4YFXF 4YG2F 2NYXA 4EMSA 2COMA 2OA4A 3GEZA 1P92A 5BPIA 1QO0D 1Q1HA 2HR3A 1HW1A 3BPXA 2IJLA 4FHTA 1YFHA 2XIGA 3L9FA 2NS0A 3GFIA 2XAQA 4RB0A 3V8LA 3KEOA 2Q0OA 4O6JA 3FMRA 1ON2A 2VN2A 2DPUA 1SFUA 3KP7A 2GA2A 1IAWA 3KEQA 4KIFA 2XAFA 3LA2A 3ELKA 3DPTA 5HOOA 3DEUA 3N97A 2PLYA 2O0YA 2FMLA 3MCZA 1UHMA 2HGCA 2GXBA 4WK8F 4O3MA 3OOPA 3PQJA 1RI7A 3IL2A 3IKVA 2Q8KA 3B02A 3E6BA 3S2WA 4LJZF 3ZN1A 4D0PA 4EVIA 1FY7A 4HX7A 4Q4ZF 4EJOA 1T0FA 2BE5F 2KJCA 4KN4X 2Z5UA 1RIOH 2HEOA 3EDPA 5BPDA 1G3YA 1B6AA 1IW7F 4HAMA 4U0VA 2V9VA 2VOPA 2XVCA 3V4GA 2ZXJA 2PMUA 3F3XA 4WWCA 2ACJA 5DD8A 3EQLF 2QBYA 1YLFA 3ZN0A 2FOKA 3IC7A 2QQ9A 4LB5A 3I54A 1SMTA 1QBJA 2A6HF 5K5OA 3GZ5A 3F6VA 3ZMUA 2QLZA 4OOIA 1ZAOA 5FO5A 5H6RA 3HIFA 4UHTA 4NQWA 3HSRA 2GIVA 5CYVA 1KQ8A 2ISYA 1DPUA 1BI3A 5ICEA 1Z91A 3R0AA 1R5GA 2FNAA 1P4AA 4CZZA 2DI3A 1MGTA 3MAJA 1JHFA 1U2WA 3D5LA 2GAUA 3F8NA 3FX3A 4KUMA 4L0ZB 2JTVA 4AD9A 1D8JA 4PGHA 1IN8A 3GVAA 2RV8A 1SD6A 1ODDA 1TQIA 1ZG3A 4LG0B 4XBFA 3K2ZA 2IA1A 2UXNA 3M9AA 4CDGA 4A6EA 3HRSA 1IN7A 3BWGA 1WWXA 5EEHA 2XKPA 2EV5A 2LKPA 4LK1F 1JGSA 5DD4A 1YIOA 1IN5A 3DPLC 1I6XA 5HLGA 3RJPA 2Y48A 3JAMZ 1MJ9A 1S3JA 2L54A 2EFPA 4IF4A 1X3UA 4RAZA 3HOSA 4EJVA 5AIPA 3O2PE 3MZYA 2X0LA 4EM2A 5CVJA 2ESNA 2NRAC 1TW2A 1YG2A 2VC0A 3GFLA 2R7DA 5D8LB 3RPUA 1ZRFA 3Q5FA 2VC1A 2HZTA 4L18B 2WWYA 4GGGA 2OQGA 5FLXZ 1IN6A 4OMYA 2GA1A 5DCFA 2Y0MA 2QM3A 1UFMA 2XUBA 1FSHA 1IF1A 1F1ZA 5HS8A 2MA3A 2QZ8A 5ICCA 2JPBA 4WXHA 1O3TA 4GCVA 1J9IA 3V8KA 2AS5F 2M87A 1FPQA 4IRGA 3I0TA 4P5OA 3M8EA 1HW5A 4MHGA 3F8FA 3P9KA 1XB4A 4B8XA 1FBUA 1OYWA 1BC8C 1J7KA 1LEBA 2Z99A 4ASNA 3M8FA 2IA0A 2RNJA 1KQ9A 1RUOA 2V1UA 3IKTA 2KKOA 4Q48A 4GYGA 1L0OC 3BROA 4RB1A 4ENNA 4OMZA 4RGUA 2ZCWA 2DK8A 2MLKA 2R3SA 3I53A 2STTA 4L0YB 3RIRA 4N0BA 2D45A 3LWFA 1P2FA 3F23A 2QWWA 4U0WA 1R22A 2A3SA 3LAPA 1TQPA 3MZHA 2VBWA 1J59A 3CDHA 3ABUA 2XHKA 1H0MA 4R1HA 3SHFA 2XAGA 1REPC 3K9TA 2FQ3A 2RC4A 1A04A 4XSZF 4RGXA 4HBLA 2STWA 4Y13A 1WKMA 5L3EA 4RGSA 2Y75A 4OU0A 2XGXA 2GXGA 4AIJA 3IWFA 2GWRA 3J81Z 1U8RA 3QU3A 1RZ4A 1FNNA 3F21A 4XRFA 5LGUA 4MNUA 3TOBA 2FBKA 4HDVA 1K78A 5F1RA 3QU6A 2ETHA 1S8NA 1R00A 3FXRA 1T6SA 5K1YA 3WTWC 2M45A 4PCQA 3HRTA 1AWCA 1YS6A 2DAOA 3TDUC 1HSJA 1TBXA 2DW4A 1LDDA 4G8XA 1T2KA 2R7FA 3BDDA 4U7DA 2O61A 4M9SA 3N4MA 3WTVC 3GF2A 3W6KB 2EB7A 1SD5A 4OIRF 4E70A 3CO7C 4XSXF 3EYIA 4PGGA 2P5LC 3BJ6A 2LNBA 1BC7C 4Q5SF 4HLYA 2FRHA 1Z6TA 1MDMA 1PP7U 2HYGD 2K27A 4EM1A 1FYLA 2M1BA 1TLHB 2HKXA 1FBSA 1BBYA 5HDKA 1B59A 4B09A 3JSPA 1G4DA 3DV8A 1FBQA 5HDGA 1U6GA 4LK0F 3WTXC 5L3FA 3P7NA 1KYZA 4EGYA 1JXSA 2CQKA 2DQLA 3FM5A 4PDKA 3J80Z 1Z1DA 2CSOA 3JW4A 1DPRA 4A6DA 3GYHX 2FMYA 5CVIA 4F7ZA 2VBYA 2H09A 4BHPA 5DUIA 3QPHA 1FYMA 1ZRCA 1MDMB 3R60A 4I02A 5A2QZ 4LD5A 4ZYEA 3CUQC 3E5UA 2IP2A 3MWMA 2DK5A 2CGPA 3BPVA 1YYVA 5HS9A 3T0YA 2NAZA 3TKYA 4CYDA 3H92A 1QPMA 2K4BA 4HX4A 2PMHA 2KIMA 4EV0A 4ZYDA 4BQAA 2ESHA 2KRFA 1FYKA 5HLHA 5KK1A 3IRQA 2V79A 4EQQA 1R5HA 2PEXA 2LF8A 1FSEA 1V3FA 4FX4A 1CGPA 1XSDA 1OPCA 1JE8A 2MH2A 3E6DA 1EH8A 2KIFA 2JSCA 1IRGA 1D8KA 4M74A 2YSRA 2P4WA 3REOA 5E1ZB 3I58A 3KFWX 4QLCU 1IRFA 1IXRC 3K69A 4IHSA 4QWQA 1PP8F 4A12A 3L00A 3IHUA 3WTUC 4ZZDA 1I1GA 3C7JA 3C18A 4LLLA 3VEPA 4H0EA 4PZJA 1DP7P 2LSOA 5ILSA 1R1VA 1ZARA 1YO5C 2DBBA 1ZREA 2O3FA 4HX8A 1XMKA 2OAZA 4MEYF 1QNTA 4MTEA 2W25A 2IVMA 2O6GE 4MQVA 1W4MA 2WTEA 1O7LA 1SD7A 2KJBA 4ENJA 1FZPB 3FF5A 2FXAA 3HOTA 2M30A 2X4HA 2CWEA 2UWMA 4HDUA 3CJNA 1LDJA 1ZN2A 5L3GA 4UVAA 4MEXF 2RVCA 4KICA 2CFXA 5DCMB 3WTZA 1MJAA 3JTHA 5JR3A 2ZFWA 2PG4A 3LQRA 1YW8A 3WE2A 2EK5A 4A2UA 2G9WA 4I0AA 1YTYA 2M8EA 2HTSA 4HA8A 5E17F 1FWZA 3WODF 5JI6A 1L3LA 4A0ZA 4LG0A 3WG9A 2VBXA 1U5TC 1RNLA 1K7AA 3SQNA 3HUGA 3E6MA 4HW0A 1TNSA 1R7JA 2CG4A 1FP1D 1J0RA 3NQOA 1Z9CA 2P8TA 5E1XA 4IRIA 4EGZA 2HTJA 3E97A 1F9NA 2FF4A 3DXJF 3VOEA 1DUXC 2A68F 1EV7A 3CUOA 2RKHA 1WSUA 3R6SA 2P7CB 1HKQA 4KFCA 1R23A 1K6OA 5LBQA 4CHUA 3H3UA 3SZPA 4YFNF 5K5RA 3F8MA 4L9TA 3HSFA 4UV9A 3RPQA 3KZYA 3GWZA 4S05A 3K0LA 3GW2A 5D8KB 1O57A 2DO7A 5D5WB 1HW2A 1PDNC 4RB3C 4ESFA 3LAJA 4A5NA 1F4KA 3BOQA 5IT3A 2PFBA 5BS6A 3E5XA 5HVQC 4M71A 1BIAA 1HBXG 3V8JA 1O3SA 1OR7A 1ONVA 4CXFA 1MD0A 4HZFA 3LA7A 3GZ6A 4IRHA 1FLIA 4LLNA 4L5IA 3HYIA 4M9XA 2EV0A 1I5ZA 2EWNA 3TO7A 4IVNA 2E1NA 2ZKZA 1FX7A 2TDXA 3F72A 5JHUA 2Z9OA 2KIUA 2ZJ2A 3WTTC 3GFMA 3CUQB 4AVPA 1W7PB 3LQQA 2B0LA 3F8CA 4BAYA 2IA2A 3L7WA 1I27A 1MZBA 1Z05A 2MLGA 2WV0A 2YR2A 5IT9K 2NNNA 3WU1B 1XGMA 2A07F 1HSTA 3GXOA 2CO5A 5H6QA 5E8GA 5ERIA 3DQVC 3ZMSA 4UV8A 4KMFA 3GX4X 4XLNF 3R61A 3U9GA 3RKXA 2Z33A 3V7RA 3ECOA 2DLLA 1HKTA 2YX7A 4LGWA 5LHIA 3FHZA 4I98B 3M1EA 1BM9A 3HHGA 1YQAA 2GZWA 3RKWA 3TDZC 2VBZA 5H20A 3V7CA 3LA3A 3P9CA 2Z3YA 2G7HA 4G7ZF 1HKSA 3E5QA 1ZGAA 3HTUA 1KQ0A 1KU3A 5FD5A 4P96A 1LJ9A 1IZ1A 4RS8A 2K4JA 3ZMZA 3TOAA 4ZYGA 5LHHA 1CF7B 2EFQA 2HDCA 5CJ9A 4IPAA 3JSOA 1ZLJA 1K79A 4KT5C 3J7AO 5DV5A 4EJTA 1XDSA 1QZZA 4KIBA 4G7OF 3WE3A 4DNCA 5HLIA 4G6QA 1OKRA 4G7HF 2EFNA 2YPRA 2MBFA 5TRDA 4GO1A 4HOBA 2FEZA 4P9UA 3GO5A 1WI9A 2VT3A 3ZQ7A 3KE2A 4HF1A 1TQMA 2J5PA 1OMIA 1R36A 3F6OA 4ZH4F 5LHGA 2QENA 2WC2A 4L9NA 2XAJA 1XGNA 2FA5A 3FXQA 2XASA 1USSA 2F5DA 2EV6A 2ADUA 1GXQA 1H9GA 4AWXB 1E17A 3K1NA 1U5TA 3RKYA 2EJRA 3G73A 3QRFF 3JTGA 2LF7A 3BJOA 3RYPA 3VB2A 2AXLA 2RQPA 1NHAA 2DFIA 3CLOA 1R1UA 1T38A 1J5YA 3BY6A 4M6YA 2A6EF 1XGOA 1BI2A 2L4MA 4O5VA 3KCCA 3GLXA 4ESJA 1G3TA 3L2CA 5TJJA 4A0XA 1GVJA 1U5TB 4ENKA 4DQ2A 1E2XA 1EH7A 1XD7A 4L9VA 3K1MA 4AIKA 2OQRA 5CVUA 5HDNA 1XCBA 3TGNA 4HF2A 1IXSB 1QZYA 4JQFA 5ICFA 3WU0A 2RN7A 3FM3A 5ED4A 3HTSB 5F6FA 3LSTA 2FBHA 5L3BA 1KGSA 3W6JB 1G3SA 3KZZA 4RGRA 1D3YA 2ZMEB 2VXZA 1FT9A 4NHJA 1IUYA 4A0YA 4BHBA 4BNCA 1B4AA 1FP2A 3COAC 3IWZA 3VODA 1TTYA 3FZVA 4BH9A 1ZG1A 4ETSA 3T1BA 1G6NA 4I2OA 3AAFA 2L01A 1YS7A 3KLOA 3SFZA 1Y0UA 4ZYHA 3KLNA 3WTYC 2PBIA 3I59B 5DEQA 4P55A 3KP6A 5J6XA 3NEUA 4M9ZA 1ULYA 1KU2A 5E20A 3QAHA 2F5CA 5DDGA 5ICGA 4IJAA 1LB2A 4UUVA 1HQCA 2J5OA 3P9IA 5D4SA 3B73A 5BQTA 5FFXA 2E1CA 1BI0A 2EA2A 2VONA 1P6RA 4M73A 1TW3A 4KYWA 2HOEA 4R79A 2HYFA 3ZMTA 1S29A 4R8HA 4Q47A 5DYMA 1BJAA 1KU7A 3R0JA 4FX0A 1QGPA 1C0WA 1TNTA 4BXUA 3IRRA 2XV4S 2BEOA 3DFGA 5FFZA 4U7BA 1W5TA 2C6YA 1I1SA 4N9HA 3C3WA 2GQQA 3RYRA 1V4RA 2K7LA 2RGVA 1W7PD 1S7AA 2LDUA 4WX9A 2D1VA 4RAYA 2IT0A 1OYYA 5DCMA 2H6CA 2EA4A 2UXXA 5AONA 3RI4A 4K2EA 2YU3A 4I09A 3E3VA 1LEAA 4MQ9F 4L5JA 4UNOA 2ZNZA 5LRRA 1D5VA 3CTAA 5LGTA 1Z7UA 5D4RA 5J8CA 1S6LA 3FXUA 4FT8A 4I01A 3KP4A 5BMZA 4UVCA 1STZA 3SXYA 3BZ6A 4HV5A 3WGHA 3PFIA 1O7FA 2K02A 5AIQA 1BI1A 1GHCA 5CLSA 5FGMA 3GFJA 2PJPA 3C1DA 4ESBA 5L3CA 1ZGJA 5EEGA 1DDNA 2OBPA 1LVAA 3L09A 1VTNC 4WCGA 4KIGA 3KETA 4U88A 1T39A 4M6XA 5JVTA 4HV6A 3Q9SA 4WXCA 3F8BA 2HWVA 2W84A 4LLGF 2DTRA 1IN4A 2BBYA 2BYVE 5E8IA 1ZLKA 3JAMK 4A5MA 4HYEA 2A69F 2V6CA 3RDIA 2IPQX 2QYOA 3O6BB 3TO6A 1ZHFA 2DT5A 2QBYB 5D5XB 2NNYA 1PUEE 5K5QA 2F5EA 1KU9A 4HF0A 3TQNA 4XLPF 5F64A 2JZYA 2JT1A 2VE9A 4OINF 2H6BA 2P5KA 1HXDA 1U3EM 4N9IA 5FLXK 2G7UA 4Y17A 3HHHA 1J75A 1EH6A 2ZNYA 4I0BA 4JBAA 2A5YB 4OIOF 1O3QA 2O8XA 3SZTA 2DPDA 5HS7A 6PAXA 2VODA 4EJWA 2HKOA 2W57A 3CUQA 1W7PA 3ZMVA 4EM0B 4S04A 1QQIA 3TO9A 1JHHA 4ZZLA 2V1XA 5D6EA 2FE3A 5E18F 3NRVA 2XROA 3KP5A 1U78A 4U0YA 1USTA 2CW0F 2JPCA 1BOAA 2A61A 3FMSA 3I5UA 2XKOA 4UVBA 3T8RA 4ENMA 1ZG5A 4LMYA 4Z2YA 1R58A 4UXNA 2CYYA 2IRFG 2HFHA 3BP8A 3QP5A 2H94A 1B1BA 2XRNA 2FU4A 4P9FA 3KP2A 5CVVA 1XDUA 4Y15A 3WTSC 5D6FA 3ABTA 3G3ZA 3MFKA 1MJBA 1CF7A 3ROUA 1ZRDA 1OYIA 3HRUA 2JRTA 1T98A 1UB9A 1J2XA 2OZUA 2QQAA 5ILUA 1S7OA 3QP6A 2M5WA 3I64A 2BV6A 3EUHA 2EFWA 1SMYF 3ZP5A 2F5FA 2HQRA 3I71A 2MH9A 2P7VB 3GUDA 5D5VB 4KDPA 1WRJA 4HQMA 4CO8A 2HS5A 4OIQF 4KN7X 2L3DA 3PQKA 3J81K 3F22A 1SD4A 1SFXA 4LB6B 1P4XA 2FNPA 2IW5A 2MD5A 2UZKA 3FMQA 5LEKA 2F2EA 1KYWA 2BGCA 2OU2A 2OZ6A 1IXCA 2E7XA 2E7WA 2K86A 2W24A 4ON0A 3M7GA 3U1DA 4G6DA 1ZYRF 3ULQB 5IT9Z 4BHCA 1B9NA 1KA8A 4WXDA 3DKWA 3ML6A 2ZO4A 2H27A 2VOOA 3FWEA 3I4PA 3DF8A 4GXOA 4I7HA 1UCRA 4TV7A 3OV8A 3HRMA 1GXPA 1Z6RA 4KMUX 3MEXA 1YW9A 4BYYA 3U2RA 5J8FA 1FOKA 2XAHA 3O3KA 2MC3A 5DUKA 1F5TA 2FBIA 4YIFA 2QQBA 5LGNA 3BJAA 5JFRA 4M72A 1ON1A 1LNWA 5LEJA 2EFOA 4HQEA 5LLQA 3ECHA 1LQ1A 2RDPA 4AIHA 1MKMA 4NB5A 3RTRA 1XCVA 5D5UB 4IHTA 3QOPA 3ZPLA 5L3DA 5BOXA 2HQNA 4KNYA 3J80K 3E6CC 2VT2A 4OIPF 3V7SA 1R1TA 2V1DA 2YX4A 2PI0A 4HLXA 3HSEA 2P6TA 1AOYA 2OD5A 1XSVA 5ILVA 2PN6A 3QPTA 5A2QK 1O3RA 2ZBKA 2P5VA 4YIIA 4CICA 2D1HA 5FD6A 4CGZA 2ISZA 2FSWA 3CO6C 4WF2A 2ZMEA 1ZH5A 4MTDA 3D0SA 1SFEA 1K78B 3T5XA 1W5SA 3ERED 2O03A 1BIBA 5CVRA 2D2WA 3WGGA 4RB2C 4JK1X 4G94A 3ISPA 2DQRA 1LDKB 5E1WA 2Q2EA 3I59A 2VE8A 3ZMDA 1UHWA 2QUFA 2QVOA 3VFZA 1G3WA 1B9MA 3Q9VA 2L4AA 3R4KA 1SAXA 4IXAA 3KP3A 1XGSA 3K1PA 1RUNA 4GYIA 5LRSA 4L9JA 1WQ2A 3EYYA 3WGIA 3T8TA 5FB2A 1BN5A 4KA4A 1XMAA 2PQ8A 4EJUA 1XSXA 5KVRA 3H3ZA 4G9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MQ0 A;  2L02 A;  1FC3 A;  2ELH A;  3DP7 A;  2P6S A;  3EET A;  1P4W A;  3LFK A;  2W85 A;  1YW7 A;  4MGR A;  2DU9 A;  4YFK F;  1XN7 A;  4LFU A;  1H9T A;  4YFX F;  4YG2 F;  2NYX A;  4EMS A;  2COM A;  2OA4 A;  3GEZ A;  1P92 A;  5BPI A;  1QO0 D;  1Q1H A;  2HR3 A;  1HW1 A;  3BPX A;  2IJL A;  4FHT A;  1YFH A;  2XIG A;  3L9F A;  2NS0 A;  3GFI A;  2XAQ A;  4RB0 A;  3V8L A;  3KEO A;  2Q0O A;  4O6J A;  3FMR A;  1ON2 A;  2VN2 A;  2DPU A;  1SFU A;  3KP7 A;  2GA2 A;  1IAW A;  3KEQ A;  4KIF A;  2XAF A;  3LA2 A;  3ELK A;  3DPT A;  5HOO A;  3DEU A;  3N97 A;  2PLY A;  2O0Y A;  2FML A;  3MCZ A;  1UHM A;  2HGC A;  2GXB A;  4WK8 F;  4O3M A;  3OOP A;  3PQJ A;  1RI7 A;  3IL2 A;  3IKV A;  2Q8K A;  3B02 A;  3E6B A;  3S2W A;  4LJZ F;  3ZN1 A;  4D0P A;  4EVI A;  1FY7 A;  4HX7 A;  4Q4Z F;  4EJO A;  1T0F A;  2BE5 F;  2KJC A;  4KN4 X;  2Z5U A;  1RIO H;  2HEO A;  3EDP A;  5BPD A;  1G3Y A;  1B6A A;  1IW7 F;  4HAM A;  4U0V A;  2V9V A;  2VOP A;  2XVC A;  3V4G A;  2ZXJ A;  2PMU A;  3F3X A;  4WWC A;  2ACJ A;  5DD8 A;  3EQL F;  2QBY A;  1YLF A;  3ZN0 A;  2FOK A;  3IC7 A;  2QQ9 A;  4LB5 A;  3I54 A;  1SMT A;  1QBJ A;  2A6H F;  5K5O A;  3GZ5 A;  3F6V A;  3ZMU A;  2QLZ A;  4OOI A;  1ZAO A;  5FO5 A;  5H6R A;  3HIF A;  4UHT A;  4NQW A;  3HSR A;  2GIV A;  5CYV A;  1KQ8 A;  2ISY A;  1DPU A;  1BI3 A;  5ICE A;  1Z91 A;  3R0A A;  1R5G A;  2FNA A;  1P4A A;  4CZZ A;  2DI3 A;  1MGT A;  3MAJ A;  1JHF A;  1U2W A;  3D5L A;  2GAU A;  3F8N A;  3FX3 A;  4KUM A;  4L0Z B;  2JTV A;  4AD9 A;  1D8J A;  4PGH A;  1IN8 A;  3GVA A;  2RV8 A;  1SD6 A;  1ODD A;  1TQI A;  1ZG3 A;  4LG0 B;  4XBF A;  3K2Z A;  2IA1 A;  2UXN A;  3M9A A;  4CDG A;  4A6E A;  3HRS A;  1IN7 A;  3BWG A;  1WWX A;  5EEH A;  2XKP A;  2EV5 A;  2LKP A;  4LK1 F;  1JGS A;  5DD4 A;  1YIO A;  1IN5 A;  3DPL C;  1I6X A;  5HLG A;  3RJP A;  2Y48 A;  3JAM Z;  1MJ9 A;  1S3J A;  2L54 A;  2EFP A;  4IF4 A;  1X3U A;  4RAZ A;  3HOS A;  4EJV A;  5AIP A;  3O2P E;  3MZY A;  2X0L A;  4EM2 A;  5CVJ A;  2ESN A;  2NRA C;  1TW2 A;  1YG2 A;  2VC0 A;  3GFL A;  2R7D A;  5D8L B;  3RPU A;  1ZRF A;  3Q5F A;  2VC1 A;  2HZT A;  4L18 B;  2WWY A;  4GGG A;  2OQG A;  5FLX Z;  1IN6 A;  4OMY A;  2GA1 A;  5DCF A;  2Y0M A;  2QM3 A;  1UFM A;  2XUB A;  1FSH A;  1IF1 A;  1F1Z A;  5HS8 A;  2MA3 A;  2QZ8 A;  5ICC A;  2JPB A;  4WXH A;  1O3T A;  4GCV A;  1J9I A;  3V8K A;  2AS5 F;  2M87 A;  1FPQ A;  4IRG A;  3I0T A;  4P5O A;  3M8E A;  1HW5 A;  4MHG A;  3F8F A;  3P9K A;  1XB4 A;  4B8X A;  1FBU A;  1OYW A;  1BC8 C;  1J7K A;  1LEB A;  2Z99 A;  4ASN A;  3M8F A;  2IA0 A;  2RNJ A;  1KQ9 A;  1RUO A;  2V1U A;  3IKT A;  2KKO A;  4Q48 A;  4GYG A;  1L0O C;  3BRO A;  4RB1 A;  4ENN A;  4OMZ A;  4RGU A;  2ZCW A;  2DK8 A;  2MLK A;  2R3S A;  3I53 A;  2STT A;  4L0Y B;  3RIR A;  4N0B A;  2D45 A;  3LWF A;  1P2F A;  3F23 A;  2QWW A;  4U0W A;  1R22 A;  2A3S A;  3LAP A;  1TQP A;  3MZH A;  2VBW A;  1J59 A;  3CDH A;  3ABU A;  2XHK A;  1H0M A;  4R1H A;  3SHF A;  2XAG A;  1REP C;  3K9T A;  2FQ3 A;  2RC4 A;  1A04 A;  4XSZ F;  4RGX A;  4HBL A;  2STW A;  4Y13 A;  1WKM A;  5L3E A;  4RGS A;  2Y75 A;  4OU0 A;  2XGX A;  2GXG A;  4AIJ A;  3IWF A;  2GWR A;  3J81 Z;  1U8R A;  3QU3 A;  1RZ4 A;  1FNN A;  3F21 A;  4XRF A;  5LGU A;  4MNU A;  3TOB A;  2FBK A;  4HDV A;  1K78 A;  5F1R A;  3QU6 A;  2ETH A;  1S8N A;  1R00 A;  3FXR A;  1T6S A;  5K1Y A;  3WTW C;  2M45 A;  4PCQ A;  3HRT A;  1AWC A;  1YS6 A;  2DAO A;  3TDU C;  1HSJ A;  1TBX A;  2DW4 A;  1LDD A;  4G8X A;  1T2K A;  2R7F A;  3BDD A;  4U7D A;  2O61 A;  4M9S A;  3N4M A;  3WTV C;  3GF2 A;  3W6K B;  2EB7 A;  1SD5 A;  4OIR F;  4E70 A;  3CO7 C;  4XSX F;  3EYI A;  4PGG A;  2P5L C;  3BJ6 A;  2LNB A;  1BC7 C;  4Q5S F;  4HLY A;  2FRH A;  1Z6T A;  1MDM A;  1PP7 U;  2HYG D;  2K27 A;  4EM1 A;  1FYL A;  2M1B A;  1TLH B;  2HKX A;  1FBS A;  1BBY A;  5HDK A;  1B59 A;  4B09 A;  3JSP A;  1G4D A;  3DV8 A;  1FBQ A;  5HDG A;  1U6G A;  4LK0 F;  3WTX C;  5L3F A;  3P7N A;  1KYZ A;  4EGY A;  1JXS A;  2CQK A;  2DQL A;  3FM5 A;  4PDK A;  3J80 Z;  1Z1D A;  2CSO A;  3JW4 A;  1DPR A;  4A6D A;  3GYH X;  2FMY A;  5CVI A;  4F7Z A;  2VBY A;  2H09 A;  4BHP A;  5DUI A;  3QPH A;  1FYM A;  1ZRC A;  1MDM B;  3R60 A;  4I02 A;  5A2Q Z;  4LD5 A;  4ZYE A;  3CUQ C;  3E5U A;  2IP2 A;  3MWM A;  2DK5 A;  2CGP A;  3BPV A;  1YYV A;  5HS9 A;  3T0Y A;  2NAZ A;  3TKY A;  4CYD A;  3H92 A;  1QPM A;  2K4B A;  4HX4 A;  2PMH A;  2KIM A;  4EV0 A;  4ZYD A;  4BQA A;  2ESH A;  2KRF A;  1FYK A;  5HLH A;  5KK1 A;  3IRQ A;  2V79 A;  4EQQ A;  1R5H A;  2PEX A;  2LF8 A;  1FSE A;  1V3F A;  4FX4 A;  1CGP A;  1XSD A;  1OPC A;  1JE8 A;  2MH2 A;  3E6D A;  1EH8 A;  2KIF A;  2JSC A;  1IRG A;  1D8K A;  4M74 A;  2YSR A;  2P4W A;  3REO A;  5E1Z B;  3I58 A;  3KFW X;  4QLC U;  1IRF A;  1IXR C;  3K69 A;  4IHS A;  4QWQ A;  1PP8 F;  4A12 A;  3L00 A;  3IHU A;  3WTU C;  4ZZD A;  1I1G A;  3C7J A;  3C18 A;  4LLL A;  3VEP A;  4H0E A;  4PZJ A;  1DP7 P;  2LSO A;  5ILS A;  1R1V A;  1ZAR A;  1YO5 C;  2DBB A;  1ZRE A;  2O3F A;  4HX8 A;  1XMK A;  2OAZ A;  4MEY F;  1QNT A;  4MTE A;  2W25 A;  2IVM A;  2O6G E;  4MQV A;  1W4M A;  2WTE A;  1O7L A;  1SD7 A;  2KJB A;  4ENJ A;  1FZP B;  3FF5 A;  2FXA A;  3HOT A;  2M30 A;  2X4H A;  2CWE A;  2UWM A;  4HDU A;  3CJN A;  1LDJ A;  1ZN2 A;  5L3G A;  4UVA A;  4MEX F;  2RVC A;  4KIC A;  2CFX A;  5DCM B;  3WTZ A;  1MJA A;  3JTH A;  5JR3 A;  2ZFW A;  2PG4 A;  3LQR A;  1YW8 A;  3WE2 A;  2EK5 A;  4A2U A;  2G9W A;  4I0A A;  1YTY A;  2M8E A;  2HTS A;  4HA8 A;  5E17 F;  1FWZ A;  3WOD F;  5JI6 A;  1L3L A;  4A0Z A;  4LG0 A;  3WG9 A;  2VBX A;  1U5T C;  1RNL A;  1K7A A;  3SQN A;  3HUG A;  3E6M A;  4HW0 A;  1TNS A;  1R7J A;  2CG4 A;  1FP1 D;  1J0R A;  3NQO A;  1Z9C A;  2P8T A;  5E1X A;  4IRI A;  4EGZ A;  2HTJ A;  3E97 A;  1F9N A;  2FF4 A;  3DXJ F;  3VOE A;  1DUX C;  2A68 F;  1EV7 A;  3CUO A;  2RKH A;  1WSU A;  3R6S A;  2P7C B;  1HKQ A;  4KFC A;  1R23 A;  1K6O A;  5LBQ A;  4CHU A;  3H3U A;  3SZP A;  4YFN F;  5K5R A;  3F8M A;  4L9T A;  3HSF A;  4UV9 A;  3RPQ A;  3KZY A;  3GWZ A;  4S05 A;  3K0L A;  3GW2 A;  5D8K B;  1O57 A;  2DO7 A;  5D5W B;  1HW2 A;  1PDN C;  4RB3 C;  4ESF A;  3LAJ A;  4A5N A;  1F4K A;  3BOQ A;  5IT3 A;  2PFB A;  5BS6 A;  3E5X A;  5HVQ C;  4M71 A;  1BIA A;  1HBX G;  3V8J A;  1O3S A;  1OR7 A;  1ONV A;  4CXF A;  1MD0 A;  4HZF A;  3LA7 A;  3GZ6 A;  4IRH A;  1FLI A;  4LLN A;  4L5I A;  3HYI A;  4M9X A;  2EV0 A;  1I5Z A;  2EWN A;  3TO7 A;  4IVN A;  2E1N A;  2ZKZ A;  1FX7 A;  2TDX A;  3F72 A;  5JHU A;  2Z9O A;  2KIU A;  2ZJ2 A;  3WTT C;  3GFM A;  3CUQ B;  4AVP A;  1W7P B;  3LQQ A;  2B0L A;  3F8C A;  4BAY A;  2IA2 A;  3L7W A;  1I27 A;  1MZB A;  1Z05 A;  2MLG A;  2WV0 A;  2YR2 A;  5IT9 K;  2NNN A;  3WU1 B;  1XGM A;  2A07 F;  1HST A;  3GXO A;  2CO5 A;  5H6Q A;  5E8G A;  5ERI A;  3DQV C;  3ZMS A;  4UV8 A;  4KMF A;  3GX4 X;  4XLN F;  3R61 A;  3U9G A;  3RKX A;  2Z33 A;  3V7R A;  3ECO A;  2DLL A;  1HKT A;  2YX7 A;  4LGW A;  5LHI A;  3FHZ A;  4I98 B;  3M1E A;  1BM9 A;  3HHG A;  1YQA A;  2GZW A;  3RKW A;  3TDZ C;  2VBZ A;  5H20 A;  3V7C A;  3LA3 A;  3P9C A;  2Z3Y A;  2G7H A;  4G7Z F;  1HKS A;  3E5Q A;  1ZGA A;  3HTU A;  1KQ0 A;  1KU3 A;  5FD5 A;  4P96 A;  1LJ9 A;  1IZ1 A;  4RS8 A;  2K4J A;  3ZMZ A;  3TOA A;  4ZYG A;  5LHH A;  1CF7 B;  2EFQ A;  2HDC A;  5CJ9 A;  4IPA A;  3JSO A;  1ZLJ A;  1K79 A;  4KT5 C;  3J7A O;  5DV5 A;  4EJT A;  1XDS A;  1QZZ A;  4KIB A;  4G7O F;  3WE3 A;  4DNC A;  5HLI A;  4G6Q A;  1OKR A;  4G7H F;  2EFN A;  2YPR A;  2MBF A;  5TRD A;  4GO1 A;  4HOB A;  2FEZ A;  4P9U A;  3GO5 A;  1WI9 A;  2VT3 A;  3ZQ7 A;  3KE2 A;  4HF1 A;  1TQM A;  2J5P A;  1OMI A;  1R36 A;  3F6O A;  4ZH4 F;  5LHG A;  2QEN A;  2WC2 A;  4L9N A;  2XAJ A;  1XGN A;  2FA5 A;  3FXQ A;  2XAS A;  1USS A;  2F5D A;  2EV6 A;  2ADU A;  1GXQ A;  1H9G A;  4AWX B;  1E17 A;  3K1N A;  1U5T A;  3RKY A;  2EJR A;  3G73 A;  3QRF F;  3JTG A;  2LF7 A;  3BJO A;  3RYP A;  3VB2 A;  2AXL A;  2RQP A;  1NHA A;  2DFI A;  3CLO A;  1R1U A;  1T38 A;  1J5Y A;  3BY6 A;  4M6Y A;  2A6E F;  1XGO A;  1BI2 A;  2L4M A;  4O5V A;  3KCC A;  3GLX A;  4ESJ A;  1G3T A;  3L2C A;  5TJJ A;  4A0X A;  1GVJ A;  1U5T B;  4ENK A;  4DQ2 A;  1E2X A;  1EH7 A;  1XD7 A;  4L9V A;  3K1M A;  4AIK A;  2OQR A;  5CVU A;  5HDN A;  1XCB A;  3TGN A;  4HF2 A;  1IXS B;  1QZY A;  4JQF A;  5ICF A;  3WU0 A;  2RN7 A;  3FM3 A;  5ED4 A;  3HTS B;  5F6F A;  3LST A;  2FBH A;  5L3B A;  1KGS A;  3W6J B;  1G3S A;  3KZZ A;  4RGR A;  1D3Y A;  2ZME B;  2VXZ A;  1FT9 A;  4NHJ A;  1IUY A;  4A0Y A;  4BHB A;  4BNC A;  1B4A A;  1FP2 A;  3COA C;  3IWZ A;  3VOD A;  1TTY A;  3FZV A;  4BH9 A;  1ZG1 A;  4ETS A;  3T1B A;  1G6N A;  4I2O A;  3AAF A;  2L01 A;  1YS7 A;  3KLO A;  3SFZ A;  1Y0U A;  4ZYH A;  3KLN A;  3WTY C;  2PBI A;  3I59 B;  5DEQ A;  4P55 A;  3KP6 A;  5J6X A;  3NEU A;  4M9Z A;  1ULY A;  1KU2 A;  5E20 A;  3QAH A;  2F5C A;  5DDG A;  5ICG A;  4IJA A;  1LB2 A;  4UUV A;  1HQC A;  2J5O A;  3P9I A;  5D4S A;  3B73 A;  5BQT A;  5FFX A;  2E1C A;  1BI0 A;  2EA2 A;  2VON A;  1P6R A;  4M73 A;  1TW3 A;  4KYW A;  2HOE A;  4R79 A;  2HYF A;  3ZMT A;  1S29 A;  4R8H A;  4Q47 A;  5DYM A;  1BJA A;  1KU7 A;  3R0J A;  4FX0 A;  1QGP A;  1C0W A;  1TNT A;  4BXU A;  3IRR A;  2XV4 S;  2BEO A;  3DFG A;  5FFZ A;  4U7B A;  1W5T A;  2C6Y A;  1I1S A;  4N9H A;  3C3W A;  2GQQ A;  3RYR A;  1V4R A;  2K7L A;  2RGV A;  1W7P D;  1S7A A;  2LDU A;  4WX9 A;  2D1V A;  4RAY A;  2IT0 A;  1OYY A;  5DCM A;  2H6C A;  2EA4 A;  2UXX A;  5AON A;  3RI4 A;  4K2E A;  2YU3 A;  4I09 A;  3E3V A;  1LEA A;  4MQ9 F;  4L5J A;  4UNO A;  2ZNZ A;  5LRR A;  1D5V A;  3CTA A;  5LGT A;  1Z7U A;  5D4R A;  5J8C A;  1S6L A;  3FXU A;  4FT8 A;  4I01 A;  3KP4 A;  5BMZ A;  4UVC A;  1STZ A;  3SXY A;  3BZ6 A;  4HV5 A;  3WGH A;  3PFI A;  1O7F A;  2K02 A;  5AIQ A;  1BI1 A;  1GHC A;  5CLS A;  5FGM A;  3GFJ A;  2PJP A;  3C1D A;  4ESB A;  5L3C A;  1ZGJ A;  5EEG A;  1DDN A;  2OBP A;  1LVA A;  3L09 A;  1VTN C;  4WCG A;  4KIG A;  3KET A;  4U88 A;  1T39 A;  4M6X A;  5JVT A;  4HV6 A;  3Q9S A;  4WXC A;  3F8B A;  2HWV A;  2W84 A;  4LLG F;  2DTR A;  1IN4 A;  2BBY A;  2BYV E;  5E8I A;  1ZLK A;  3JAM K;  4A5M A;  4HYE A;  2A69 F;  2V6C A;  3RDI A;  2IPQ X;  2QYO A;  3O6B B;  3TO6 A;  1ZHF A;  2DT5 A;  2QBY B;  5D5X B;  2NNY A;  1PUE E;  5K5Q A;  2F5E A;  1KU9 A;  4HF0 A;  3TQN A;  4XLP F;  5F64 A;  2JZY A;  2JT1 A;  2VE9 A;  4OIN F;  2H6B A;  2P5K A;  1HXD A;  1U3E M;  4N9I A;  5FLX K;  2G7U A;  4Y17 A;  3HHH A;  1J75 A;  1EH6 A;  2ZNY A;  4I0B A;  4JBA A;  2A5Y B;  4OIO F;  1O3Q A;  2O8X A;  3SZT A;  2DPD A;  5HS7 A;  6PAX A;  2VOD A;  4EJW A;  2HKO A;  2W57 A;  3CUQ A;  1W7P A;  3ZMV A;  4EM0 B;  4S04 A;  1QQI A;  3TO9 A;  1JHH A;  4ZZL A;  2V1X A;  5D6E A;  2FE3 A;  5E18 F;  3NRV A;  2XRO A;  3KP5 A;  1U78 A;  4U0Y A;  1UST A;  2CW0 F;  2JPC A;  1BOA A;  2A61 A;  3FMS A;  3I5U A;  2XKO A;  4UVB A;  3T8R A;  4ENM A;  1ZG5 A;  4LMY A;  4Z2Y A;  1R58 A;  4UXN A;  2CYY A;  2IRF G;  2HFH A;  3BP8 A;  3QP5 A;  2H94 A;  1B1B A;  2XRN A;  2FU4 A;  4P9F A;  3KP2 A;  5CVV A;  1XDU A;  4Y15 A;  3WTS C;  5D6F A;  3ABT A;  3G3Z A;  3MFK A;  1MJB A;  1CF7 A;  3ROU A;  1ZRD A;  1OYI A;  3HRU A;  2JRT A;  1T98 A;  1UB9 A;  1J2X A;  2OZU A;  2QQA A;  5ILU A;  1S7O A;  3QP6 A;  2M5W A;  3I64 A;  2BV6 A;  3EUH A;  2EFW A;  1SMY F;  3ZP5 A;  2F5F A;  2HQR A;  3I71 A;  2MH9 A;  2P7V B;  3GUD A;  5D5V B;  4KDP A;  1WRJ A;  4HQM A;  4CO8 A;  2HS5 A;  4OIQ F;  4KN7 X;  2L3D A;  3PQK A;  3J81 K;  3F22 A;  1SD4 A;  1SFX A;  4LB6 B;  1P4X A;  2FNP A;  2IW5 A;  2MD5 A;  2UZK A;  3FMQ A;  5LEK A;  2F2E A;  1KYW A;  2BGC A;  2OU2 A;  2OZ6 A;  1IXC A;  2E7X A;  2E7W A;  2K86 A;  2W24 A;  4ON0 A;  3M7G A;  3U1D A;  4G6D A;  1ZYR F;  3ULQ B;  5IT9 Z;  4BHC A;  1B9N A;  1KA8 A;  4WXD A;  3DKW A;  3ML6 A;  2ZO4 A;  2H27 A;  2VOO A;  3FWE A;  3I4P A;  3DF8 A;  4GXO A;  4I7H A;  1UCR A;  4TV7 A;  3OV8 A;  3HRM A;  1GXP A;  1Z6R A;  4KMU X;  3MEX A;  1YW9 A;  4BYY A;  3U2R A;  5J8F A;  1FOK A;  2XAH A;  3O3K A;  2MC3 A;  5DUK A;  1F5T A;  2FBI A;  4YIF A;  2QQB A;  5LGN A;  3BJA A;  5JFR A;  4M72 A;  1ON1 A;  1LNW A;  5LEJ A;  2EFO A;  4HQE A;  5LLQ A;  3ECH A;  1LQ1 A;  2RDP A;  4AIH A;  1MKM A;  4NB5 A;  3RTR A;  1XCV A;  5D5U B;  4IHT A;  3QOP A;  3ZPL A;  5L3D A;  5BOX A;  2HQN A;  4KNY A;  3J80 K;  3E6C C;  2VT2 A;  4OIP F;  3V7S A;  1R1T A;  2V1D A;  2YX4 A;  2PI0 A;  4HLX A;  3HSE A;  2P6T A;  1AOY A;  2OD5 A;  1XSV A;  5ILV A;  2PN6 A;  3QPT A;  5A2Q K;  1O3R A;  2ZBK A;  2P5V A;  4YII A;  4CIC A;  2D1H A;  5FD6 A;  4CGZ A;  2ISZ A;  2FSW A;  3CO6 C;  4WF2 A;  2ZME A;  1ZH5 A;  4MTD A;  3D0S A;  1SFE A;  1K78 B;  3T5X A;  1W5S A;  3ERE D;  2O03 A;  1BIB A;  5CVR A;  2D2W A;  3WGG A;  4RB2 C;  4JK1 X;  4G94 A;  3ISP A;  2DQR A;  1LDK B;  5E1W A;  2Q2E A;  3I59 A;  2VE8 A;  3ZMD A;  1UHW A;  2QUF A;  2QVO A;  3VFZ A;  1G3W A;  1B9M A;  3Q9V A;  2L4A A;  3R4K A;  1SAX A;  4IXA A;  3KP3 A;  1XGS A;  3K1P A;  1RUN A;  4GYI A;  5LRS A;  4L9J A;  1WQ2 A;  3EYY A;  3WGI A;  3T8T A;  5FB2 A;  1BN5 A;  4KA4 A;  1XMA A;  2PQ8 A;  4EJU A;  1XSX A;  5KVR A;  3H3Z A;  4G9Y A; 
#chains in the Genus database with same CATH topology
 3MQ0 A;  2L02 A;  2R5Z A;  4M3B A;  1FC3 A;  2ELH A;  3DP7 A;  2WA0 A;  3FIS A;  2P6S A;  2DMT A;  4NUB A;  3EET A;  3VWB A;  1P4W A;  3LFK A;  2W85 A;  1YW7 A;  2BVL A;  4MGR A;  1DU0 A;  2DU9 A;  3HB9 A;  2GLO A;  2M0M A;  4YFK F;  1RES A;  1YHQ I;  5GAG J;  4BDY A;  1XN7 A;  4LFU A;  1H9T A;  4YFX F;  4YG2 F;  5EGO A;  2NXN B;  1VQ6 I;  2NYX A;  4EMS A;  1FEX A;  4N4N B;  2COM A;  2L7Z A;  1WFX A;  2BOL A;  1IJW C;  1JGG A;  3DKY A;  3SJM A;  4XLH A;  2OA4 A;  3GEZ A;  1P92 A;  4BGD A;  5BPI A;  2R7W A;  4BE1 A;  4BE0 A;  1QO0 D;  3J7Y J;  3CC4 I;  1B72 B;  1Q1H A;  2HR3 A;  1HW1 A;  3BPX A;  3U1K A;  2CH0 A;  5E3O A;  1MMS A;  2IJL A;  4FHT A;  5C3E J;  2VQG A;  4A3G J;  1D0Z A;  2NOJ B;  3PNY A;  1YFH A;  1OCZ H;  1T8I A;  2XIG A;  3L9F A;  2NS0 A;  5DTD A;  3ZQG A;  3GFI A;  1ERD A;  5HNF A;  4W97 A;  2XAQ A;  3NWS A;  4RB0 A;  1H8A C;  3V8L A;  3KEO A;  2Q0O A;  4O6J A;  1WH7 A;  2KFD A;  2DA4 A;  2EIK H;  3KYC B;  3OIO A;  3FMR A;  1ON2 A;  1Y0N A;  3AG2 H;  1HDP A;  2VN2 A;  1VQO I;  2DPU A;  1SFU A;  3BTI A;  3KP7 A;  2GA2 A;  1IAW A;  1PJR A;  3KEQ A;  4KIF A;  1BR4 A;  2XAF A;  3LA2 A;  3ELK A;  2V4J C;  3DPT A;  2AQE A;  5HOO A;  5EEA A;  3DEU A;  1MBK A;  3N97 A;  3RQI A;  2PLY A;  2WB1 N;  2O0Y A;  2VUM J;  2FML A;  3MCZ A;  3AL0 B;  2XGD A;  4PJM A;  1UHM A;  2Y31 A;  2HGC A;  2W1O A;  2GXB A;  3BR0 A;  1YJW I;  3LSJ A;  4WK8 F;  3MN2 A;  4O3M A;  3WG7 H;  3FIW A;  3OOP A;  2M8G X;  4E7H A;  3PQJ A;  1RI7 A;  2VKH A;  4EAT A;  3IL2 A;  3IKV A;  4V19 K;  2Q8K A;  3B02 A;  3E6B A;  3S2W A;  4LJZ F;  3ZN1 A;  3RPU D;  4D0P A;  1BJZ A;  4EVI A;  5IP6 A;  4A3E J;  1FY7 A;  4HX7 A;  4Q4Z F;  2V6E A;  4EJO A;  1T0F A;  2BE5 F;  1ZEL A;  3VSL A;  2KQR A;  4D9J A;  4IHX A;  1NG6 A;  2GM4 A;  4E7S A;  1HOM A;  2GBY A;  2K9L A;  2KJC A;  4KN4 X;  2Z5U A;  1RIO H;  2HEO A;  5GAE J;  4BQQ A;  2WAE A;  3EDP A;  5BPD A;  3SEZ A;  2DMU A;  3CMM A;  1G3Y A;  4B48 A;  2PJR A;  2IGM A;  1VQ9 I;  1B6A A;  1IW7 F;  2GIZ A;  2LYC A;  2QSF X;  4HAM A;  3ZCO A;  2DOF A;  3CCQ I;  3WHC A;  1X1B A;  4U0V A;  3A02 A;  2HXI A;  1MH3 A;  2V9V A;  2VOP A;  2JK3 A;  2XVC A;  3V4G A;  2ZXJ A;  2HZD A;  2PMU A;  4W1U A;  1HF0 A;  3A2K A;  3VSK A;  3F3X A;  4WWC A;  3CCL I;  2ACJ A;  5DD8 A;  3EQL F;  4C2M J;  1YLF A;  2QBY A;  5LD2 C;  3ZN0 A;  3OMY A;  2FOK A;  3HPG A;  3G1O A;  2WB1 A;  3IC7 A;  2FJ1 A;  2QQ9 A;  2I8D A;  4LB5 A;  3I54 A;  5KAF C;  3CJT B;  1SMT A;  1QBJ A;  2A6H F;  1SVL A;  5K5O A;  3GZ5 A;  1HLV A;  3F6V A;  3ZMU A;  3BG9 A;  2QLZ A;  1JKR C;  3OL4 A;  4OOI A;  2P81 A;  4BAC A;  1RPW A;  1X1C A;  1ZAO A;  2COB A;  5FO5 A;  5H6R A;  4BBR J;  3JRD A;  5FLM J;  3HIF A;  3GTM J;  4UHT A;  2L7K A;  4NQW A;  3C2G A;  3HSR A;  3W2V A;  2OUM A;  2GIV A;  1GT0 C;  1MMN A;  3RCO A;  1IGN A;  5CYV A;  1KQ8 A;  3G4S I;  2KHM A;  5K7Z A;  2ISY A;  4YRV A;  4BL0 B;  1BI3 A;  1DPU A;  5ICE A;  3SZG A;  1Z91 A;  3R0A A;  1R5G A;  2FNA A;  2K5C A;  1P4A A;  4CZZ A;  2DI3 A;  1MGT A;  2IGO A;  4CZC A;  3MAJ A;  1JHF A;  1U2W A;  2CQN A;  2EZI A;  4AM3 A;  3D5L A;  2GAU A;  2EIN H;  3F8N A;  3FX3 A;  2K3F A;  4JYK A;  4KUM A;  2M7A A;  2E1M C;  1N75 A;  4L0Z B;  1RKT A;  2BY1 A;  2DCE A;  2JTV A;  3B6A A;  4ZDL A;  4A3J J;  4AD9 A;  1D8J A;  4PGH A;  1IN8 A;  2OTJ I;  3GVA A;  3H36 A;  2OCE A;  4DYQ A;  2RV8 A;  1SD6 A;  3CCU I;  1IO2 A;  1ODD A;  1TQI A;  1ZG3 A;  4NQW B;  4XBF A;  4LG0 B;  5M5Y J;  1NTC A;  3K2Z A;  2IA1 A;  2RNG A;  4UUS A;  2UXN A;  3M9A A;  4CDG A;  4A6E A;  3HRS A;  2DTZ A;  4X0G A;  2BW3 A;  1IN7 A;  3KZI C;  3BWG A;  3CCR I;  3DWL E;  3HUG B;  1VQ8 I;  1WWX A;  2HQ5 A;  4A3K J;  3TW7 A;  2A05 A;  3ONQ A;  5EEH A;  2BY2 A;  4XR6 A;  2DFF A;  3TMO A;  2H1K A;  2XKP A;  2M3A A;  2EV5 A;  2LKP A;  4LK1 F;  1JGS A;  3HJE A;  4NBQ A;  1YIO A;  5DD4 A;  1IN5 A;  3DPL C;  1I6X A;  2LY2 A;  5HLG A;  3PUF A;  3RJP A;  1VQK I;  2Y48 A;  3JAM Z;  2AXT C;  1MJ9 A;  1S3J A;  5EG0 A;  2L54 A;  2EFP A;  4XKC A;  4IF4 A;  1X3U A;  1YOV B;  4RAZ A;  2BY3 A;  3HOS A;  4GDF A;  4EJV A;  5AIP A;  4ZJZ A;  2M9H A;  3O2P E;  3I4N J;  4XOR A;  2AHQ A;  3HOV J;  1MW7 A;  2IGK A;  3MZY A;  2X0L A;  4EM2 A;  5CVJ A;  2ESN A;  2ME6 A;  3Q0W A;  3P5J A;  2NRA C;  2CMP A;  5TGT A;  1TW2 A;  4RAG A;  2DA5 A;  3BR1 A;  1YG2 A;  2LKS A;  2VC0 A;  3GFL A;  3UKG A;  2R7D A;  1JJ8 C;  5D8L B;  3RPU A;  3ASO H;  1JI8 A;  1ZRF A;  1OLT A;  3Q5F A;  3UR3 C;  1SFK A;  3S1R J;  5E3N A;  4IOC F;  3RZO J;  2VC1 A;  2HZT A;  4L18 B;  2WWY A;  4GGG A;  1RRJ A;  5KNL A;  2OQG A;  2X6Y A;  5FLX Z;  3VYS B;  4AUX A;  2UV1 A;  1IN6 A;  4Z6Y A;  4OMY A;  2GA1 A;  1X4P A;  2LC2 A;  4JX5 A;  5DCF A;  2JMW A;  1P7J A;  2Y0M A;  2QM3 A;  1UFM A;  2XUB A;  3HG9 A;  2R5Y B;  1FSH A;  1U8B A;  4B3X A;  1IF1 A;  1F1Z A;  5HS8 A;  2TCT A;  4I6Z A;  3ZQI A;  2MA3 A;  4ZDP A;  2E34 A;  1TWC J;  2QZ8 A;  5TIS C;  2R7X A;  5ICC A;  2JPB A;  4WXH A;  1O3T A;  4GCV A;  1J9I A;  3V8K A;  5DM6 F;  2AS5 F;  2M87 A;  1W36 D;  1FPQ A;  4IRG A;  1M1E B;  1QHG A;  1MIJ A;  1JUM A;  3I0T A;  2ID3 A;  4P5O A;  2XPW A;  3M8E A;  2CQQ A;  2JA7 J;  1LUJ B;  2V9P A;  1HW5 A;  4MHG A;  3F8F A;  3P9K A;  1XB4 A;  2X85 A;  4B8X A;  4C3I J;  1FBU A;  5M3M J;  1R71 A;  1OYW A;  2E19 A;  4XN3 A;  4FIS A;  4Y52 J;  1BC8 C;  3K4M A;  4BU2 A;  1J7K A;  1LEB A;  3RQ4 A;  4HNU A;  2Z99 A;  4ASN A;  1K4T A;  3GTO J;  3M8F A;  3OS0 A;  1P7I A;  2EIM H;  2IA0 A;  1KQ9 A;  2RNJ A;  1RUO A;  2V1U A;  1ETQ A;  3PO2 J;  3IKT A;  2KKO A;  5M3F J;  4Q48 A;  4GYG A;  1L0O C;  3BRO A;  4RB1 A;  4ENN A;  4OMZ A;  4RGU A;  2ZCW A;  2DK8 A;  2K9Q A;  4J00 A;  3CES A;  2MLK A;  2R3S A;  3I53 A;  1MMA A;  2STT A;  4L0Y B;  4FCY A;  3FBN B;  3RIR A;  3BZC A;  4OWR B;  4IQ4 A;  3RSN A;  1X3W B;  4XRS A;  4N0B A;  2D45 A;  4HSR A;  3K4L A;  4D5F A;  4J19 A;  4DBR A;  2FUG 2;  4C3H J;  1OCO H;  3LWF A;  2B7E A;  4ZTJ A;  3K70 D;  1JKP C;  1P2F A;  3OYI A;  3F23 A;  2ZSI B;  2QWW A;  1YJN I;  5M5X J;  4U0W A;  1R22 A;  2A3S A;  5C44 J;  3LAP A;  3GLL A;  3O8G A;  3IUO A;  1TQP A;  3X2Q H;  3MZH A;  1VFC A;  3OYL A;  2VBW A;  2LP0 A;  4BEH A;  5J4V A;  2AO9 A;  2ECB A;  4IHV A;  1J59 A;  4B47 A;  3CDH A;  3ABU A;  3L2V A;  2XHK A;  1H0M A;  4R1H A;  3SHF A;  3LSH A;  2XAG A;  2E2H J;  1REP C;  4YEL A;  3K9T A;  2FQ3 A;  3L2Q A;  4Y7N J;  2XC7 A;  4MFE A;  2CUE A;  2RC4 A;  3GTJ J;  1A04 A;  4IZZ A;  1TWH J;  4XSZ F;  2A6T A;  4RGX A;  2XPU A;  4HBL A;  4E4H A;  2STW A;  4LIT A;  4Y13 A;  1WKM A;  2HI3 A;  1BA5 A;  1TWG J;  5L3E A;  3MZ8 A;  4RGS A;  3JRH A;  5EYR A;  2Y75 A;  4OU0 A;  2XGX A;  3HGG A;  3J7Z I;  2GXG A;  3S3M A;  4AIJ A;  3IWF A;  2GWR A;  3AKZ A;  3J81 Z;  1U8R A;  5F04 A;  2CQ7 A;  3QU3 A;  4I76 A;  3S2D J;  1RZ4 A;  1FNN A;  2K85 A;  2VJ4 A;  1E0E A;  3F21 A;  1JUS A;  4XRF A;  4C3J J;  4E7I A;  2I10 A;  4QTR A;  4A3C J;  5LGU A;  5JVG F;  1LE8 B;  4D1Q A;  2WY7 Q;  2EZK A;  4MNU A;  1AKH B;  3IAS 2;  3TOB A;  2FBK A;  1SAN A;  4HG2 A;  4HDV A;  1V55 H;  1K78 A;  5E79 C;  2IAI A;  3TBI A;  1PUF A;  4XKB A;  5EZH A;  5F1R A;  3QU6 A;  2W4S A;  2ETH A;  1S8N A;  1R00 A;  4HNV A;  2DJN A;  3FXR A;  3CMA I;  4CSW A;  5LFA A;  5FRM A;  1T6S A;  2O8K A;  2G0E A;  5K1Y A;  3WTW C;  2M45 A;  4PCQ A;  3HRT A;  1AWC A;  4QPQ A;  1YS6 A;  2DAO A;  3TDU C;  1E3H A;  3ZR8 X;  3DTE A;  1MBE A;  4C2T A;  1HSJ A;  2LLK A;  1TBX A;  2DW4 A;  4FET A;  1JT6 A;  1LDD A;  4G8X A;  1T2K A;  2R7F A;  3BDD A;  4U7D A;  3GTG J;  4M9S A;  2O61 A;  3N4M A;  3WTV C;  2KIQ A;  3OIP A;  5FKL A;  3GF2 A;  3CF5 F;  1IRX A;  2DXI A;  3W6K B;  2EB7 A;  3QOD A;  3S17 J;  1SD5 A;  3DKX A;  4C30 A;  4OIR F;  2XGC A;  4E70 A;  2EH3 A;  3CO7 C;  1WI3 A;  3CP8 A;  4XSX F;  3EYI A;  2WAQ N;  1V5G A;  4PGG A;  3K4B A;  2P5L C;  2ZJP F;  3BJ6 A;  2LNB A;  1BC7 C;  2VPL A;  4Q5S F;  2I5U A;  2CFO A;  2FRH A;  4II3 A;  1Z6T A;  4HLY A;  4IEJ A;  2CW8 A;  1MDM A;  1PP7 U;  1QHH D;  2HYG D;  2K27 A;  4EM1 A;  1FYL A;  2M1B A;  1TLH B;  2HKX A;  1I3Q J;  1FBS A;  2VI6 A;  1K6Y A;  1BBY A;  3OYE A;  3CZ6 A;  5HDK A;  1B59 A;  4B09 A;  3JSP A;  1G4D A;  3BC8 A;  3DV8 A;  3K2A A;  3QWL A;  3HOZ J;  2HXO A;  1FBQ A;  1I50 J;  5HDG A;  1U6G A;  4AC0 A;  4LK0 F;  3WTX C;  4RDU A;  5L3F A;  3KEY A;  3KX2 A;  1LKX A;  3P7N A;  3CJQ B;  1KYZ A;  3TW6 A;  4EGY A;  1JXS A;  5FRN A;  2CQK A;  2R92 J;  2DQL A;  3FM5 A;  3K10 A;  3J7A Y;  4PDK A;  4BS9 A;  3J80 Z;  1Z1D A;  2CSO A;  3JW4 A;  1DPR A;  4H4K C;  4A6D A;  2FOW A;  2FMY A;  3GYH X;  2R4G A;  2E1M B;  5CVI A;  3SYT A;  4F7Z A;  2VBY A;  2H09 A;  2ELJ A;  4BHP A;  2JUC A;  5DUI A;  2R7T A;  3QPH A;  1FYM A;  4MIM A;  1VQL I;  1ZRC A;  1MDM B;  3R60 A;  5J4Y A;  2X1D A;  3VYR B;  4I02 A;  2GOX B;  5A2Q Z;  4LD5 A;  4ZYE A;  5BNG A;  3CUQ C;  4GRI A;  1Y8Q B;  3E5U A;  3H9J A;  2IP2 A;  3MWM A;  2DK5 A;  2WAQ A;  2CGP A;  3BPV A;  4XLA A;  1YYV A;  3B6C A;  5HS9 A;  1B8I B;  4A3D J;  2H8R A;  1B72 A;  3H0G J;  3T0Y A;  2NAZ A;  1OR7 C;  3TKY A;  4CYD A;  3H92 A;  1QPM A;  3G71 I;  2MW8 A;  2XAU A;  3L2R A;  2K4B A;  4HX4 A;  5K7H A;  2PMH A;  3K6G A;  2VQC A;  2KIM A;  3K4J A;  5F1J A;  4RLF A;  3JRI A;  2JA8 J;  4EV0 A;  5FRO A;  4ZYD A;  3HOU J;  1ZQ3 P;  4XN0 A;  1HDD C;  3S32 A;  4BQA A;  1QVT A;  2ESH A;  3ZQC A;  2KRF A;  1FYK A;  1OCC H;  3JR9 A;  4UB6 C;  3MKZ A;  5HLH A;  1JTX A;  1FOX A;  2E60 A;  3PIO F;  4E7K A;  1VQ4 I;  5KK1 A;  3IRQ A;  2V79 A;  4RM3 A;  5GP9 A;  4YIR X;  2QSH X;  4EQQ A;  1GLN A;  4HPQ A;  2KRH A;  1S7E A;  4Y33 A;  1R5H A;  2PEX A;  2LF8 A;  1FSE A;  1V3F A;  2IBD A;  5H2F C;  4FX4 A;  1I6H J;  2QKM B;  5CKT A;  4DIQ A;  3S8P A;  1ITY A;  2DFE A;  3ZRG A;  1CGP A;  4KT6 A;  4ZYA A;  1XSD A;  3S1Q J;  1YIJ I;  1OPC A;  4AVZ A;  5IY5 H;  1JE8 A;  4CUG A;  3CME I;  3LSR A;  2MH2 A;  4EEF G;  3E6D A;  1EH8 A;  2KIF A;  2JSC A;  5EZG A;  1YRN B;  5J3L A;  1IRG A;  1D8K A;  1S9H A;  4M74 A;  3HOW J;  5FKN A;  3OR2 C;  3ZQL A;  2YSR A;  2P4W A;  3REO A;  3HL2 A;  4A3L J;  3A4C A;  3M3Y J;  5E1Z B;  3I58 A;  3KFW X;  3TED A;  1VQM I;  1X1D A;  1GDT A;  4QLC U;  1IRF A;  2IS4 A;  3ABL H;  4HEA 2;  3QYE A;  4X1E A;  2DYS H;  2A5W A;  1IXR C;  1TT5 B;  2CJJ A;  2OCC H;  4FE7 A;  2CW7 A;  3EUA A;  3EPZ A;  5IOY A;  3K69 A;  4IHS A;  1WJA A;  4QWQ A;  1UG2 A;  2HDW A;  4F92 B;  4A12 A;  1PP8 F;  3L00 A;  3CCY A;  3IHU A;  3WTU C;  4ZZD A;  1G2H A;  3BCB A;  3KPH A;  1I1G A;  3C7J A;  3E0J B;  4BY7 J;  1RET A;  3A0B C;  3C18 A;  4LLL A;  3K4N A;  3VEP A;  4PZJ A;  4H0E A;  1DP3 A;  4DZJ A;  1DP7 P;  5J47 A;  2LSO A;  5ILS A;  4F55 A;  1R1V A;  1ZAR A;  1YO5 C;  4M3F A;  2DBB A;  2WV1 A;  1ZRE A;  2O3F A;  4HX8 A;  1XMK A;  2VAS A;  4KIT B;  2OAZ A;  4MEY F;  3ASN H;  1QNT A;  4MTE A;  4CCO A;  3MKL A;  2X6O A;  2W25 A;  4XID A;  2IVM A;  1GV5 A;  2O6G E;  2CUJ A;  4IO9 F;  4MO7 A;  3LSG A;  2NVQ J;  4BXF A;  4MQV A;  5J1U A;  1W4M A;  1YJ9 I;  2WTE A;  4BXX J;  1D1C A;  1O7L A;  3DEE A;  1SD7 A;  4DOZ A;  3IH4 A;  2L9S A;  3PM1 A;  3MKY B;  2KJB A;  2OF7 A;  2XF5 A;  2XPV A;  4FTH A;  4ENJ A;  1FZP B;  3FF5 A;  4IOA F;  2JQ7 A;  3OS1 A;  2FXA A;  3QYF A;  3GME A;  4JP0 A;  2ECC A;  3HOT A;  1FOW A;  3OL3 A;  2M30 A;  3HDD A;  2X4H A;  5IP9 J;  3OYH A;  1Y39 A;  3DTI A;  4U87 A;  2CWE A;  2UWM A;  4HDU A;  2DJI A;  2PMZ N;  3CJN A;  1LDJ A;  1UHS A;  1ZN2 A;  3M8J A;  5J40 A;  4UVA A;  5L3G A;  4LOC A;  4MEX F;  2KL4 A;  4V2G A;  2RVC A;  4KIC A;  2NVX J;  4N4O B;  2CFX A;  1QU3 A;  5DCM B;  3WTZ A;  1MJA A;  1D1B A;  3A0H C;  3JTH A;  3L2U A;  5JR3 A;  4GFB A;  2ZFW A;  1X58 A;  1MMG A;  2PG4 A;  3LQR A;  1YW8 A;  1XMX A;  2ICW G;  2Z16 A;  3WE2 A;  2EK5 A;  4A2U A;  1D1A A;  2G9W A;  4I0A A;  4RAF A;  1YTY A;  2M8E A;  2R93 J;  3MD2 A;  1MNM C;  1ETX A;  4M3E A;  1WJE A;  5C4J J;  1QPI A;  2HTS A;  4HA8 A;  3HZJ A;  5E17 F;  2DFH A;  1FWZ A;  3WOD F;  5JI6 A;  1L3L A;  1JJ6 C;  4A0Z A;  4LG0 A;  4OAZ A;  3WG9 A;  4M3G A;  5M5W J;  2VBX A;  1TL8 A;  1U5T C;  1RNL A;  2CV2 A;  2XB0 X;  3DTK A;  1K7A A;  5F27 A;  5IYC J;  3SQN A;  3HUG A;  3E6M A;  1BR2 A;  2L0K A;  4HW0 A;  3PFY A;  1BL0 A;  4CYC B;  1TNS A;  1R7J A;  2CG4 A;  1FP1 D;  4OAY A;  1J0R A;  2Y2Z A;  3OYF A;  2LY1 A;  3NQO A;  4JX6 A;  3AG3 H;  2HOT A;  4DJA A;  1Z9C A;  3CF2 A;  2LKX A;  1F43 A;  2E71 A;  2P8T A;  5E1X A;  2PMZ A;  4BBS J;  4IRI A;  2VQH A;  4EGZ A;  3C2B A;  2HTJ A;  3E97 A;  1BOB A;  1DQU A;  1F9N A;  4ITV A;  2FF4 A;  3AFH A;  3VYT B;  1GVD A;  1IRZ A;  1LFB A;  2L7F P;  3DXJ F;  3S93 A;  2CUF A;  3VOE A;  1DUX C;  3U21 A;  2A68 F;  1EV7 A;  5B66 C;  1Y1V J;  3CUO A;  3M1C A;  2RKH A;  1WSU A;  3K4C A;  3TP3 A;  1MBH A;  4E7J A;  2DMQ A;  1N25 A;  3R6S A;  4D5C A;  3BR2 A;  2P7C B;  1HKQ A;  2EBI A;  5JLW A;  1R23 A;  4KFC A;  1K6O A;  3MMY B;  2HVS A;  1P9Q C;  1Y56 A;  2LR8 A;  2M4G A;  3VYU B;  4XQF A;  3H3U A;  5IPA A;  3SZP A;  5LBQ A;  4CHU A;  4YFN F;  3C2H A;  3S16 J;  2XDV A;  4G12 A;  5K5R A;  1VQP I;  4M6V A;  3F8M A;  3CC2 I;  4L9T A;  3HSF A;  4UV9 A;  3RPQ A;  2X1E A;  3KZY A;  2ZXI A;  1Y1W J;  3GWZ A;  3FXM A;  3E7L A;  4S05 A;  3K0L A;  3RZD J;  3GW2 A;  3I9V 2;  5D8K B;  2R5Y A;  1O57 A;  2DO7 A;  5D5W B;  4B3A A;  1HW2 A;  4XNF A;  2W7N A;  1PDN C;  4RB3 C;  3W6V A;  3HKZ N;  3KYD B;  1KZH A;  3S14 J;  4ESF A;  1O4X A;  4NC7 A;  3LAJ A;  3WHB A;  3DCF A;  4A5N A;  1F4K A;  2K3P A;  5FKK A;  4BQN A;  3BOQ A;  5IT3 A;  4BKX A;  1YE9 A;  2PFB A;  1K61 A;  5BS6 A;  3OS2 A;  3W2A A;  4A93 J;  4D7N A;  3OYB A;  3E5X A;  4NC8 A;  5HVQ C;  4M71 A;  1YX3 A;  1BIA A;  3OYC A;  3JRG A;  1HBX G;  1APL C;  3V8J A;  1O3S A;  1OR7 A;  1Q1V A;  4RLQ A;  2HYJ A;  1BR1 A;  2NVU B;  1W1W E;  2EQR A;  1ONV A;  5HOD A;  5FJ8 J;  2DA7 A;  4CXF A;  1MD0 A;  2E1O A;  4XKV A;  4X6A J;  4HZF A;  3LA7 A;  2YUS A;  2BXZ A;  4IRH A;  3GZ6 A;  4LLN A;  1FLI A;  2XRL A;  2R7Z J;  4B44 A;  1K4S A;  4L5I A;  3HYI A;  1R9T J;  1FMW A;  4UY8 I;  4M9X A;  2EV0 A;  4DW6 A;  2FQ4 A;  1I5Z A;  1E3P A;  2EWN A;  3BTC A;  3TO7 A;  3BQZ A;  4L5E A;  2Y9Z A;  4IVN A;  2E1N A;  2ZKZ A;  1FTT A;  1FX7 A;  2TDX A;  3F72 A;  1DGW Y;  4XRS G;  1YIT I;  3DBR B;  5JHU A;  4DYR A;  2Z9O A;  1MBJ A;  2KIU A;  2ZJ2 A;  2DMN A;  3WTT C;  3A01 B;  3GFM A;  3CUQ B;  4DBQ A;  3FXJ A;  4AVP A;  1W7P B;  4V2F A;  2KLO A;  3W2W A;  3LQQ A;  2B0L A;  3F8C A;  4BAY A;  2IA2 A;  3L7W A;  4PSW A;  1I27 A;  3S2H J;  1MZB A;  1Z05 A;  2MLG A;  4E7L A;  2WV0 A;  3BTJ A;  4CCM A;  2YR2 A;  5IT9 K;  2NNN A;  3WU1 B;  1XGM A;  2A07 F;  1HST A;  3GXO A;  2CO5 A;  2LK2 A;  5H6Q A;  1KON A;  1UAA A;  3FKJ A;  5E8G A;  5ERI A;  2UUZ A;  4C9Y A;  2IS1 A;  1Z67 A;  2IGN A;  3DQV C;  3ZMS A;  4UV8 A;  4KMF A;  3GX4 X;  4XLN F;  1JKO C;  3R61 A;  3U9G A;  2JA2 A;  3OYJ A;  3RKX A;  2Z33 A;  2VXD A;  2E5Z A;  3V7R A;  3ECO A;  2DLL A;  1HKT A;  2KT0 A;  4NNJ A;  2ID6 A;  2YX7 A;  2MYS A;  2OPT A;  4LGW A;  5LHI A;  3FHZ A;  2VPR A;  4I98 B;  3M1E A;  1BM9 A;  2DN0 A;  3HHG A;  1YQA A;  2GZW A;  3G6E I;  3RKW A;  3I55 I;  3TDZ C;  2VBZ A;  2BZT A;  5H20 A;  1AHD P;  3V7C A;  5B1A H;  3LA3 A;  2LMD A;  3P9C A;  1RKW A;  3GCM A;  2Z3Y A;  2LBF B;  4B43 A;  2G7H A;  4G7Z F;  1HKS A;  3E5Q A;  1ZGA A;  4IKF A;  3HTU A;  2K9M A;  3LMM A;  1KQ0 A;  1KU3 A;  2LOO A;  5FD5 A;  4P96 A;  1Z0X A;  2B63 J;  1LJ9 A;  1IZ1 A;  2R7R A;  4RS8 A;  2K4J A;  3ZMZ A;  1XS9 A;  3QOE A;  2JUG A;  3TOA A;  4ZYG A;  2VIX A;  1QZE A;  4RMN A;  3S3N A;  5LHH A;  3D5R C;  1CF7 B;  2EFQ A;  2HDC A;  5CQG A;  4CA0 A;  5CJ9 A;  4IPA A;  3JSO A;  2VB6 A;  2X51 A;  1LE8 A;  1AKH A;  1ZLJ A;  1K79 A;  4KT5 C;  3J7A O;  5DV5 A;  4EJT A;  1XDS A;  1QZZ A;  4KIB A;  1VQN I;  1VI0 A;  4G7O F;  2ZJQ F;  3WE3 A;  3LSP A;  3S3O A;  3BR6 A;  3AG4 H;  3ERM A;  4DNC A;  5HLI A;  4G6Q A;  1A5J A;  3OOU A;  1POG A;  1T0F C;  1OKR A;  3TP0 A;  4G7H F;  4A3I J;  1XX5 A;  3OYG A;  3RKQ A;  3CDL A;  3NAR A;  1S72 I;  2EFN A;  3F9K A;  2X48 A;  2RAE A;  2YPR A;  2ZFU A;  2MBF A;  1LPQ A;  1A31 A;  1IG7 A;  5TRD A;  4GO1 A;  4HOB A;  4FQG A;  2FEZ A;  3BR5 A;  1IV8 A;  4P9U A;  1T56 A;  3GO5 A;  4ZDO A;  1WI9 A;  2VT3 A;  3QPS A;  2B9S A;  1IC8 A;  2HDD A;  3ZQ7 A;  3KE2 A;  5FKM A;  4HF1 A;  1TQM A;  2J5P A;  1OMI A;  3FHN A;  1OQY A;  1R36 A;  1A6Q A;  3K7A J;  1N77 A;  3F6O A;  1XPX A;  4ZH4 F;  3PO3 J;  1UZC A;  5LHG A;  4FE4 A;  2QEN A;  2WC2 A;  1JT0 A;  4L9N A;  2ZB9 A;  2HPI A;  4JX4 A;  4PJL A;  3JRA A;  3BG6 A;  2XAJ A;  1XGN A;  4XL9 A;  2FA5 A;  1RC9 A;  3FXQ A;  2XAS A;  1USS A;  5E3L A;  5B3S H;  2F5D A;  2EIL H;  2EV6 A;  2ADU A;  1GXQ A;  1H9G A;  4AWX B;  1E17 A;  3BG7 A;  3I3L A;  3K1N A;  1U5T A;  2XGE A;  1OIS A;  3QYB A;  3RKY A;  4BJ6 C;  2EJR A;  3QQA A;  5GTH C;  4PJN A;  9ANT A;  2V1N A;  3G73 A;  3QRF F;  3JTG A;  2LF7 A;  2MFZ A;  2V7F A;  3BJO A;  1MH4 A;  3Q0U A;  2VKV A;  3RYP A;  3VB2 A;  2AXL A;  2W00 A;  2RQP A;  1NHA A;  2DFI A;  3CLO A;  3PSF A;  4UB8 C;  5EDN A;  1R1U A;  1T38 A;  2X6X A;  5J1R A;  3PNV A;  1J5Y A;  1X3Z B;  3BY6 A;  4M6Y A;  1H89 C;  1H88 C;  2BVM A;  2A6E F;  2FD5 A;  1XGO A;  1EF4 A;  1BI2 A;  2L4M A;  4O5V A;  3KCC A;  3WU2 C;  3GLX A;  1ZTR A;  3CDI A;  1J09 A;  1OCT C;  4ESJ A;  1G3T A;  3E1S A;  2OJE D;  2DYR H;  3G2B A;  2XF7 A;  4YEJ A;  3CMY A;  2DA3 A;  2Q1Z B;  3L2C A;  4CCN A;  4BJ5 C;  2W48 A;  3HGY A;  3HEF A;  5TJJ A;  2Y30 A;  1GVJ A;  4A0X A;  5IP7 J;  3L2W A;  1U5T B;  4ENK A;  4DQ2 A;  1E2X A;  1EH7 A;  2FX0 A;  1B8I A;  2ZXH A;  4II2 A;  1FTZ A;  2VKD A;  1VZ0 A;  1XD7 A;  4L9V A;  3V42 A;  3GTL J;  3K1M A;  4AIK A;  2OQR A;  2DMP A;  4XK4 A;  4BE2 A;  5CVU A;  5HDN A;  1XCB A;  2WY8 Q;  1ZR2 A;  3TGN A;  2OV7 A;  4HF2 A;  2JRM A;  1IXS B;  2O7O A;  1QZY A;  4JQF A;  5ICF A;  5GPC A;  2KIS A;  3WU0 A;  2RN7 A;  3FM3 A;  3F0C A;  4PJ0 C;  5ED4 A;  1ENH A;  3HTS B;  2L9R A;  2R7Q A;  5F6F A;  3IV5 A;  3LST A;  1PYV A;  2FBH A;  5L3B A;  1FIA A;  3LSI A;  1KGS A;  3W6J B;  1G3S A;  5F0F A;  1Z77 A;  3H5R A;  1Z3Y A;  2Y0S N;  2DOE A;  1ETK A;  1U9O A;  3ABK H;  3KZZ A;  4RGR A;  2F4M B;  5F0C A;  1A35 A;  1D3Y A;  1NK3 P;  2O9L A;  2KMU A;  2ZME B;  2VXZ A;  4KJZ A;  3OY9 A;  1V5E A;  1FT9 A;  3BG5 A;  1U9N A;  4BQO A;  3K4K A;  4NHJ A;  4A0Y A;  4BHB A;  4BNC A;  1IUY A;  1B4A A;  1ZR4 A;  1FP2 A;  3COA C;  3IWZ A;  3MVP A;  3VOD A;  4KIS A;  5K7F A;  4MFD A;  1TTY A;  1UMQ A;  3H9Q A;  1DU6 A;  4E7Z A;  1VQ7 I;  3FZV A;  2VQL A;  4BH9 A;  2NS7 A;  3DPU A;  1ZG1 A;  4ETS A;  3T1B A;  1YRN A;  1G6N A;  4BY1 J;  4I2O A;  3AAF A;  4HST A;  2XB5 A;  3NAU A;  2L01 A;  1YS7 A;  4P1W A;  2AQF A;  3KLO A;  4QPO A;  1JTY A;  3SFZ A;  1Y0U A;  2KRC A;  4ZYH A;  3KLN A;  1ZK8 A;  3G1L A;  1NG7 A;  3WTY C;  2PBI A;  2Q2E B;  1UJ8 A;  3I59 B;  3OYN A;  5DEQ A;  1MSF C;  4P55 A;  3KP6 A;  5J6X A;  2RQQ A;  3NEU A;  4XOP A;  2DDA A;  2TRT A;  4M9Z A;  1A6I A;  1ULY A;  1D0X A;  1KU2 A;  3QAH A;  4PJJ A;  2MC4 A;  5E20 A;  2F5C A;  5DDG A;  5ICG A;  3CCE I;  2JVG A;  4IJA A;  2HPM A;  3CCS I;  1LB2 A;  2QQ8 A;  4UUV A;  1HQC A;  2J5O A;  1PVE A;  3P9I A;  5D4S A;  3B73 A;  5BQT A;  2Y0S A;  1RR7 A;  5FFX A;  3OR1 C;  1BI0 A;  2E1C A;  2EA2 A;  4IHY A;  2VON A;  2VL8 A;  4CCK A;  1P6R A;  2PX9 A;  4M73 A;  1TW3 A;  4KYW A;  2MG4 A;  2CS3 A;  2R7O A;  2HOE A;  1MBG A;  4R79 A;  3JRE A;  2HYF A;  5HLT A;  4A3M J;  3DEW A;  5GAD J;  2ELK A;  2JSP A;  3ZMT A;  1S29 A;  3CLQ A;  4MLO A;  3PSI A;  3SFI A;  1W0U A;  4R8H A;  2QF7 A;  4Q47 A;  2R5Z B;  1AU7 A;  2V26 A;  5DYM A;  1BJA A;  1KU7 A;  1NK2 P;  3R0J A;  1GUU A;  2DT7 B;  2JWT A;  1SFO J;  4FX0 A;  2W82 A;  1QGP A;  2XSJ C;  1C0W A;  1MMD A;  2R7V A;  1TNT A;  4BXU A;  1WJB A;  3EUH C;  4AID A;  3IRR A;  3GTK J;  1SEU A;  3BLY A;  1OCR H;  3SDB A;  2XV4 S;  2BEO A;  3HC7 A;  3DFG A;  2NVY J;  5EGO B;  5FFZ A;  3ZQF A;  4U7B A;  1W5T A;  2C6Y A;  1I1S A;  3M07 A;  4N9H A;  3C3W A;  2GQQ A;  3RYR A;  1V4R A;  1AA7 A;  2K7L A;  3HPH A;  1TP4 A;  1FOY A;  2RGV A;  2F4I A;  1WPK A;  2F5V A;  1W7P D;  1S7A A;  2LDU A;  1Z7L A;  3VDX A;  4WX9 A;  1U0J A;  2D1V A;  4RAY A;  2IT0 A;  1OYY A;  5DCM A;  3IP4 B;  2H6C A;  2EA4 A;  4B1R A;  2UXX A;  5AON A;  2LRD A;  2X6W A;  1Y8R B;  2HOA A;  2R7U A;  3RI4 A;  1IUF A;  2IEK A;  3JRF A;  3JCU C;  4K2E A;  1TT0 A;  2L2O A;  1X19 A;  3H5N A;  1X1P A;  2YU3 A;  4QSH A;  4I09 A;  3E3V A;  1ACI A;  2YU9 J;  1LEA A;  4MQ9 F;  4RBO A;  2HNH A;  1T08 B;  2LRE A;  4L5J A;  5B5E C;  2VJI A;  2ZNZ A;  4UNO A;  5LRR A;  3N05 A;  3ESW B;  2EIJ H;  4XLF A;  1D5V A;  3CTA A;  1D0Y A;  2M4K A;  4RA2 A;  3FKI J;  1SVO A;  2LH9 A;  5LGT A;  2LD5 A;  1Z7U A;  4F93 B;  5D4R A;  4XLC A;  3GBG A;  4XOT A;  3S15 J;  2OC6 A;  3CP2 A;  5J8C A;  3OYM A;  1HC8 A;  2QA4 I;  2DOA A;  4CYC A;  1S6L A;  4DYC A;  3FXK A;  3FXU A;  4FT8 A;  4I01 A;  2HQA A;  3KP4 A;  5BMZ A;  2HU9 A;  4UVC A;  4BJT A;  1STZ A;  3OIQ A;  3SXY A;  4IQJ A;  3BZ6 A;  4HV5 A;  3WGH A;  2CUZ A;  3PFI A;  1FIP A;  1O7F A;  2DA6 A;  2K02 A;  2LVS A;  3D5S C;  5AIQ A;  1BI1 A;  1GHC A;  3H9G A;  5CLS A;  2KDZ A;  3OWT A;  3L1P A;  5FGM A;  3GFJ A;  4G6T B;  2PJP A;  3C1D A;  4ESB A;  1ETV A;  5L3C A;  1ZGJ A;  5EEG A;  1TZL A;  1UG0 A;  1UEL B;  1DDN A;  2OBP A;  2XF6 A;  2JA5 J;  1LVA A;  3L09 A;  2M34 A;  2Z2S B;  4I99 C;  4F52 A;  1VTN C;  4WCG A;  4KIG A;  3OYA A;  5KCM A;  2HOS A;  2EZH A;  5CPR B;  3KET A;  4U88 A;  1T39 A;  1E3O C;  4M6X A;  3LOC A;  2GXA A;  4E6K G;  5IYB J;  5EF6 A;  5JVT A;  1EJ9 A;  4F91 B;  4HV6 A;  4Y3O A;  3Q9S A;  4WXC A;  5E3M A;  3F8B A;  2HWV A;  4ABZ A;  2W84 A;  2PJR B;  1CQT A;  4LLG F;  2JA6 J;  2DTR A;  4XLE A;  1IN4 A;  2BBY A;  2BYV E;  5E8I A;  1ZLK A;  3JAM K;  3CCM I;  4A5M A;  4HYE A;  2A69 F;  3CD6 I;  2V6C A;  3RDI A;  2IPQ X;  2E36 A;  4F3Q A;  3LFU A;  2QYO A;  3O6B B;  3TO6 A;  4QIW N;  3BCA A;  4FAS D;  3CQZ J;  1ZHF A;  2DT5 A;  2QBY B;  3EUK L;  5D5X B;  2NNY A;  3D1N I;  4J01 A;  3BQY A;  1PUE E;  1R6R A;  5K5Q A;  2F5E A;  3HOX J;  1KU9 A;  1EA3 A;  2CV0 A;  4HF0 A;  1ETO A;  5C4X J;  2ZME C;  4LIV A;  3SDG A;  1T95 A;  3TQN A;  4XLP F;  2ZJR F;  3G1M A;  5F64 A;  4XKW A;  2JZY A;  1LFU P;  2JT1 A;  2VE9 A;  1W36 C;  2E35 A;  4OIN F;  2H6B A;  2P5K A;  1HXD A;  3H0D A;  2BXY A;  4N9I A;  1U3E M;  5FLX K;  2G7U A;  2WAD A;  2KZG A;  4Y17 A;  2DDB A;  2K40 A;  4DGW B;  1LVK A;  2CQX A;  4PFP A;  4IL6 C;  1I3A A;  2VJJ A;  3HHH A;  2KDO A;  1ZGW A;  3LNQ A;  3CCJ I;  1EH6 A;  4AU7 A;  1J75 A;  1VF9 A;  1QVU A;  2ZNY A;  4I0B A;  4JBA A;  4XMY A;  2A5Y B;  3CCV I;  4OIO F;  1O3Q A;  2O8X A;  3SZT A;  2K9N A;  1TWF J;  2DPD A;  1XC5 A;  1VQ5 I;  5HS7 A;  6PAX A;  3FK7 A;  2VOD A;  4ZTF A;  4EJW A;  2DA2 A;  1JUP A;  3JRC A;  2HKO A;  1ETW A;  4C2U A;  2W57 A;  3A01 A;  3CUQ A;  2E2J J;  2F4O B;  1W7P A;  2X9D A;  5F0H A;  3I4M J;  5EJC A;  3Q3S A;  1N78 A;  3ZMV A;  4EM0 B;  4S04 A;  1QQI A;  3TO9 A;  1JHH A;  2EPF A;  4ZZL A;  2V1X A;  5D6E A;  2FE3 A;  5E18 F;  3LL7 A;  3H1C A;  3NRV A;  5FLV A;  2XRO A;  3KP5 A;  1W5C C;  1U78 A;  1LFP A;  3PIP F;  2KP6 A;  4U0Y A;  5KHD A;  2RRE A;  1UST A;  2CW0 F;  3GTP J;  2JPC A;  1BOA A;  2A61 A;  3FMS A;  4UUS B;  3I5U A;  3K70 C;  3PUB A;  2XKO A;  2NVT J;  3OYK A;  2ZSH B;  3ZQQ A;  2BW3 B;  2DOD A;  4UVB A;  1V5F A;  3T8R A;  4DZP A;  4XRM A;  4ENM A;  1ZG5 A;  3DLL F;  1MNE A;  4LMY A;  2O5R A;  4Z2Y A;  1R58 A;  3CJR B;  4JOM A;  1RR8 C;  4A69 C;  1XG1 A;  4ANJ A;  2Z1D A;  4UXN A;  3DBH B;  4PSX A;  2CYY A;  2IRF G;  4XM3 A;  2HFH A;  3BP8 A;  3PJR A;  1OCP A;  2MAB A;  3QP5 A;  1Z3X A;  2H94 A;  1B1B A;  5EG0 B;  3FDY A;  1SVM A;  2LBF A;  2V9K A;  1R49 A;  2XRN A;  1OFC X;  1BW6 A;  2QSG X;  2FU4 A;  3HKZ A;  4P9F A;  5GAH J;  2VKE A;  3KP2 A;  3ZOB A;  3DLA A;  5CVV A;  1XDU A;  4Y15 A;  3WTS C;  2Y69 H;  5D6F A;  4B4C A;  3ABT A;  3IAM 2;  3G3Z A;  2VJ5 A;  3BT9 A;  1MJB A;  3MFK A;  2CU7 A;  3BR3 A;  1A36 A;  1CF7 A;  3AL0 C;  4D7M A;  3ROU A;  1Y6I A;  1ZRD A;  1S5L C;  1OYI A;  3HRU A;  2JRT A;  1T98 A;  1UB9 A;  5DS9 A;  1J2X A;  1R5I D;  2CRG A;  2OZU A;  2QKL B;  2QQA A;  2DA1 A;  5ILU A;  1S7O A;  1X4O A;  3QP6 A;  3OYD A;  2M5W A;  2E2I J;  3I64 A;  2BV6 A;  4M3D A;  4XIC A;  3EUH A;  3QPL A;  2EZL A;  2EFW A;  1SMY F;  3ZP5 A;  2F5F A;  2HQR A;  2IS6 A;  1BW5 A;  3I71 A;  3GTQ J;  1V54 H;  3ABM H;  2MH9 A;  2P7V B;  3GUD A;  5D5V B;  4KDP A;  1WRJ A;  4HQM A;  4CO8 A;  2HS5 A;  1HCR A;  2L7M P;  4OIQ F;  4KN7 X;  2L3D A;  3PQK A;  5FKO A;  3J81 K;  3F22 A;  4PFO A;  1SD4 A;  1SFX A;  3W3C A;  1VND A;  1R4M B;  3Q0V A;  4LB6 B;  4CCL A;  2F48 A;  1YI2 I;  1OJL A;  3M4O J;  4CCJ A;  1P4X A;  2FNP A;  2IW5 A;  2MD5 A;  2UZK A;  1SC7 A;  2BHY A;  3FMQ A;  5LEK A;  1WHU A;  2F2E A;  5DM7 F;  1KYW A;  2BGC A;  3AG1 H;  1QA6 A;  3BTL A;  3HBL A;  1D5Y A;  2OU2 A;  2OZ6 A;  1IXC A;  2E7X A;  2E7W A;  2K86 A;  2W24 A;  4PK4 A;  4ON0 A;  3M7G A;  3U1D A;  4G6D A;  1YX5 A;  2NOG A;  5KAI C;  1TC3 C;  1ZYR F;  3ULQ B;  5IT9 Z;  4BHC A;  2P0W A;  1B9N A;  2QCO A;  3ZXS A;  1KA8 A;  3KYL A;  4WXD A;  3DKW A;  3ML6 A;  3DU5 A;  3UNG C;  2CV1 A;  2ZO4 A;  2H27 A;  3TL4 X;  3NWT A;  2JJ7 A;  2VOO A;  3FWE A;  3I4P A;  3ZQH A;  3DF8 A;  4GXO A;  1XTA A;  4I7H A;  1UCR A;  4TV7 A;  3OV8 A;  1WJF A;  3HRM A;  1GXP A;  4BUP A;  1Z6R A;  4KMU X;  4AYB N;  3MEX A;  3CC7 I;  2HVQ A;  2ZC2 A;  1YW9 A;  2MD0 A;  4BYY A;  3ZGK A;  3BG3 A;  2F6C A;  3U2R A;  2M2E A;  5J8F A;  2IXS A;  1FOK A;  2XAH A;  3O3K A;  2R0Q C;  2MC3 A;  1FMV A;  5DUK A;  3FXO A;  1F5T A;  2FBI A;  4YIF A;  2D5V A;  4Y4R A;  1WJD A;  5F08 A;  5GPA A;  4LG3 A;  2QQB A;  1R4N B;  5LGN A;  1F36 A;  2MSY A;  3I56 I;  3A1Y A;  1W0T A;  3BJA A;  1K83 J;  1MBF A;  5JFR A;  4M72 A;  2H1L A;  3SEQ A;  1ON1 A;  2ZXW H;  1IV6 A;  1X2N A;  1Z21 A;  1LNW A;  5LEJ A;  2QGU A;  3FXL A;  2EFO A;  3LSK A;  5IOZ A;  3PNT A;  4HQE A;  5LLQ A;  2E5N A;  3FK6 A;  4RM2 A;  3ECH A;  1LQ1 A;  2RDP A;  2HVR A;  1TWA J;  1QRY A;  2LTP A;  4AIH A;  1MKM A;  4NB5 A;  3RTR A;  4BDZ A;  1XCV A;  4BEH B;  2R7S A;  2BHZ A;  3BZK A;  1X2M A;  5D5U B;  4IHW A;  2L5Q A;  2VLA A;  4IHT A;  3QOP A;  3ZPL A;  5L3D A;  2K9S A;  5BOX A;  2HQN A;  3MKW B;  1X1A A;  4KNY A;  3J80 K;  3E6C C;  2VT2 A;  4OIP F;  1EKE A;  1ORK A;  3V7S A;  2L9V A;  1R1T A;  3OSF A;  2V1D A;  2OTL I;  2H8W A;  2YX4 A;  2PI0 A;  3GZN B;  3IH2 A;  4HLX A;  3JRB A;  3HSE A;  2P6T A;  1AOY A;  3HXL A;  2OD5 A;  1WVR A;  1XSV A;  1G59 A;  5ILV A;  4AYB A;  1WCM J;  2PN6 A;  2NS8 A;  3QPT A;  1IDY A;  4UUT A;  5A2Q K;  2WBM A;  1G8X A;  4NC6 A;  5B1B H;  1O3R A;  2ZBK A;  1ZKG A;  2P5V A;  4YII A;  4CIC A;  3FBI B;  2LY9 A;  2D1H A;  1MSE C;  5FD6 A;  4CGZ A;  2BY0 A;  2LG4 A;  2L9N A;  2YS9 A;  3KIO A;  2ISZ A;  1JKQ C;  2FSW A;  3A03 A;  3CO6 C;  4WF2 A;  2ZME A;  3S1N J;  4CH7 A;  4PUS A;  2WAF A;  1IDZ A;  1WH5 A;  3HM5 A;  1ZH5 A;  1DGR M;  4MTD A;  3D0S A;  1SFE A;  1K78 B;  3VPR A;  1PUF B;  3T5X A;  1W5S A;  4A3F J;  2KZV A;  3ERE D;  4IX7 A;  4HRI A;  1GV2 A;  2O03 A;  1BIB A;  1T33 A;  1I39 A;  5CVR A;  3LSM A;  2D2W A;  1FJL A;  3WGG A;  4RB2 C;  3O8H A;  4JK1 X;  1WZ2 A;  2X1C A;  3HOY J;  4G94 A;  3ISP A;  4XON A;  2DQR A;  1NH3 A;  2QEX I;  1LDK B;  5E1W A;  2Q2E A;  3I59 A;  2VE8 A;  3ZMD A;  5JHF A;  1HA8 A;  4A3B J;  1UHW A;  1WJC A;  2QUF A;  3PL8 A;  2KPM A;  2JN6 A;  2QVO A;  3VFZ A;  1G3W A;  1MND A;  2GOM A;  1B9M A;  5JLX A;  2M0C A;  3Q9V A;  2ME0 A;  2Y9Y A;  2L4A A;  3R4K A;  1SAX A;  1WGX A;  4IXA A;  3OSG A;  3KP3 A;  2IS2 A;  2JVH A;  1XGS A;  3K1P A;  4HNT A;  1RUN A;  4S0H B;  5IYD J;  4NDL A;  4GYI A;  3S1M J;  5LRS A;  2DT6 A;  2N8G A;  4LIU A;  4L9J A;  1WQ2 A;  2M7B A;  3DBL B;  5HNH A;  3EYY A;  3H5A A;  5J1Y A;  3WGI A;  3T8T A;  1WJ5 A;  3H35 A;  4ZC3 A;  5FB2 A;  5CQE A;  1BN5 A;  4KA4 A;  2MGQ A;  5GTI C;  1XMA A;  3H3V K;  2PQ8 A;  3IH3 A;  3DU6 A;  2LFB A;  4EJU A;  1XSX A;  1ETY A;  5KVR A;  1SAU A;  2XSD C;  3H3Z A;  4G9Y A; 
#chains in the Genus database with same CATH homology
 3MQ0 A;  2L02 A;  1FC3 A;  2ELH A;  3DP7 A;  2P6S A;  3EET A;  1P4W A;  3LFK A;  2W85 A;  1YW7 A;  4MGR A;  2DU9 A;  4YFK F;  1XN7 A;  4LFU A;  1H9T A;  4YFX F;  4YG2 F;  2NYX A;  4EMS A;  2COM A;  2OA4 A;  3GEZ A;  1P92 A;  5BPI A;  1QO0 D;  1Q1H A;  2HR3 A;  1HW1 A;  3BPX A;  2IJL A;  4FHT A;  1YFH A;  2XIG A;  3L9F A;  2NS0 A;  3GFI A;  2XAQ A;  4RB0 A;  3V8L A;  3KEO A;  2Q0O A;  4O6J A;  3FMR A;  1ON2 A;  2VN2 A;  2DPU A;  1SFU A;  3KP7 A;  2GA2 A;  1IAW A;  3KEQ A;  4KIF A;  2XAF A;  3LA2 A;  3ELK A;  3DPT A;  5HOO A;  3DEU A;  3N97 A;  2PLY A;  2O0Y A;  2FML A;  3MCZ A;  1UHM A;  2HGC A;  2GXB A;  4WK8 F;  4O3M A;  3OOP A;  3PQJ A;  1RI7 A;  3IL2 A;  3IKV A;  2Q8K A;  3B02 A;  3E6B A;  3S2W A;  4LJZ F;  3ZN1 A;  4D0P A;  4EVI A;  1FY7 A;  4HX7 A;  4Q4Z F;  4EJO A;  1T0F A;  2BE5 F;  2KJC A;  4KN4 X;  2Z5U A;  1RIO H;  2HEO A;  3EDP A;  5BPD A;  1G3Y A;  1B6A A;  1IW7 F;  4HAM A;  4U0V A;  2V9V A;  2VOP A;  2XVC A;  3V4G A;  2ZXJ A;  2PMU A;  3F3X A;  4WWC A;  2ACJ A;  5DD8 A;  3EQL F;  2QBY A;  1YLF A;  3ZN0 A;  2FOK A;  3IC7 A;  2QQ9 A;  4LB5 A;  3I54 A;  1SMT A;  1QBJ A;  2A6H F;  5K5O A;  3GZ5 A;  3F6V A;  3ZMU A;  2QLZ A;  4OOI A;  1ZAO A;  5FO5 A;  5H6R A;  3HIF A;  4UHT A;  4NQW A;  3HSR A;  2GIV A;  5CYV A;  1KQ8 A;  2ISY A;  1DPU A;  1BI3 A;  5ICE A;  1Z91 A;  3R0A A;  1R5G A;  2FNA A;  1P4A A;  4CZZ A;  2DI3 A;  1MGT A;  3MAJ A;  1JHF A;  1U2W A;  3D5L A;  2GAU A;  3F8N A;  3FX3 A;  4KUM A;  4L0Z B;  2JTV A;  4AD9 A;  1D8J A;  4PGH A;  1IN8 A;  3GVA A;  2RV8 A;  1SD6 A;  1ODD A;  1TQI A;  1ZG3 A;  4LG0 B;  4XBF A;  3K2Z A;  2IA1 A;  2UXN A;  3M9A A;  4CDG A;  4A6E A;  3HRS A;  1IN7 A;  3BWG A;  1WWX A;  5EEH A;  2XKP A;  2EV5 A;  2LKP A;  4LK1 F;  1JGS A;  5DD4 A;  1YIO A;  1IN5 A;  3DPL C;  1I6X A;  5HLG A;  3RJP A;  2Y48 A;  3JAM Z;  1MJ9 A;  1S3J A;  2L54 A;  2EFP A;  4IF4 A;  1X3U A;  4RAZ A;  3HOS A;  4EJV A;  5AIP A;  3O2P E;  3MZY A;  2X0L A;  4EM2 A;  5CVJ A;  2ESN A;  2NRA C;  1TW2 A;  1YG2 A;  2VC0 A;  3GFL A;  2R7D A;  5D8L B;  3RPU A;  1ZRF A;  3Q5F A;  2VC1 A;  2HZT A;  4L18 B;  2WWY A;  4GGG A;  2OQG A;  5FLX Z;  1IN6 A;  4OMY A;  2GA1 A;  5DCF A;  2Y0M A;  2QM3 A;  1UFM A;  2XUB A;  1FSH A;  1IF1 A;  1F1Z A;  5HS8 A;  2MA3 A;  2QZ8 A;  5ICC A;  2JPB A;  4WXH A;  1O3T A;  4GCV A;  1J9I A;  3V8K A;  2AS5 F;  2M87 A;  1FPQ A;  4IRG A;  3I0T A;  4P5O A;  3M8E A;  1HW5 A;  4MHG A;  3F8F A;  3P9K A;  1XB4 A;  4B8X A;  1FBU A;  1OYW A;  1BC8 C;  1J7K A;  1LEB A;  2Z99 A;  4ASN A;  3M8F A;  2IA0 A;  2RNJ A;  1KQ9 A;  1RUO A;  2V1U A;  3IKT A;  2KKO A;  4Q48 A;  4GYG A;  1L0O C;  3BRO A;  4RB1 A;  4ENN A;  4OMZ A;  4RGU A;  2ZCW A;  2DK8 A;  2MLK A;  2R3S A;  3I53 A;  2STT A;  4L0Y B;  3RIR A;  4N0B A;  2D45 A;  3LWF A;  1P2F A;  3F23 A;  2QWW A;  4U0W A;  1R22 A;  2A3S A;  3LAP A;  1TQP A;  3MZH A;  2VBW A;  1J59 A;  3CDH A;  3ABU A;  2XHK A;  1H0M A;  4R1H A;  3SHF A;  2XAG A;  1REP C;  3K9T A;  2FQ3 A;  2RC4 A;  1A04 A;  4XSZ F;  4RGX A;  4HBL A;  2STW A;  4Y13 A;  1WKM A;  5L3E A;  4RGS A;  2Y75 A;  4OU0 A;  2XGX A;  2GXG A;  4AIJ A;  3IWF A;  2GWR A;  3J81 Z;  1U8R A;  3QU3 A;  1RZ4 A;  1FNN A;  3F21 A;  4XRF A;  5LGU A;  4MNU A;  3TOB A;  2FBK A;  4HDV A;  1K78 A;  5F1R A;  3QU6 A;  2ETH A;  1S8N A;  1R00 A;  3FXR A;  1T6S A;  5K1Y A;  3WTW C;  2M45 A;  4PCQ A;  3HRT A;  1AWC A;  1YS6 A;  2DAO A;  3TDU C;  1HSJ A;  1TBX A;  2DW4 A;  1LDD A;  4G8X A;  1T2K A;  2R7F A;  3BDD A;  4U7D A;  2O61 A;  4M9S A;  3N4M A;  3WTV C;  3GF2 A;  3W6K B;  2EB7 A;  1SD5 A;  4OIR F;  4E70 A;  3CO7 C;  4XSX F;  3EYI A;  4PGG A;  2P5L C;  3BJ6 A;  2LNB A;  1BC7 C;  4Q5S F;  4HLY A;  2FRH A;  1Z6T A;  1MDM A;  1PP7 U;  2HYG D;  2K27 A;  4EM1 A;  1FYL A;  2M1B A;  1TLH B;  2HKX A;  1FBS A;  1BBY A;  5HDK A;  1B59 A;  4B09 A;  3JSP A;  1G4D A;  3DV8 A;  1FBQ A;  5HDG A;  1U6G A;  4LK0 F;  3WTX C;  5L3F A;  3P7N A;  1KYZ A;  4EGY A;  1JXS A;  2CQK A;  2DQL A;  3FM5 A;  4PDK A;  3J80 Z;  1Z1D A;  2CSO A;  3JW4 A;  1DPR A;  4A6D A;  3GYH X;  2FMY A;  5CVI A;  4F7Z A;  2VBY A;  2H09 A;  4BHP A;  5DUI A;  3QPH A;  1FYM A;  1ZRC A;  1MDM B;  3R60 A;  4I02 A;  5A2Q Z;  4LD5 A;  4ZYE A;  3CUQ C;  3E5U A;  2IP2 A;  3MWM A;  2DK5 A;  2CGP A;  3BPV A;  1YYV A;  5HS9 A;  3T0Y A;  2NAZ A;  3TKY A;  4CYD A;  3H92 A;  1QPM A;  2K4B A;  4HX4 A;  2PMH A;  2KIM A;  4EV0 A;  4ZYD A;  4BQA A;  2ESH A;  2KRF A;  1FYK A;  5HLH A;  5KK1 A;  3IRQ A;  2V79 A;  4EQQ A;  1R5H A;  2PEX A;  2LF8 A;  1FSE A;  1V3F A;  4FX4 A;  1CGP A;  1XSD A;  1OPC A;  1JE8 A;  2MH2 A;  3E6D A;  1EH8 A;  2KIF A;  2JSC A;  1IRG A;  1D8K A;  4M74 A;  2YSR A;  2P4W A;  3REO A;  5E1Z B;  3I58 A;  3KFW X;  4QLC U;  1IRF A;  1IXR C;  3K69 A;  4IHS A;  4QWQ A;  1PP8 F;  4A12 A;  3L00 A;  3IHU A;  3WTU C;  4ZZD A;  1I1G A;  3C7J A;  3C18 A;  4LLL A;  3VEP A;  4H0E A;  4PZJ A;  1DP7 P;  2LSO A;  5ILS A;  1R1V A;  1ZAR A;  1YO5 C;  2DBB A;  1ZRE A;  2O3F A;  4HX8 A;  1XMK A;  2OAZ A;  4MEY F;  1QNT A;  4MTE A;  2W25 A;  2IVM A;  2O6G E;  4MQV A;  1W4M A;  2WTE A;  1O7L A;  1SD7 A;  2KJB A;  4ENJ A;  1FZP B;  3FF5 A;  2FXA A;  3HOT A;  2M30 A;  2X4H A;  2CWE A;  2UWM A;  4HDU A;  3CJN A;  1LDJ A;  1ZN2 A;  5L3G A;  4UVA A;  4MEX F;  2RVC A;  4KIC A;  2CFX A;  5DCM B;  3WTZ A;  1MJA A;  3JTH A;  5JR3 A;  2ZFW A;  2PG4 A;  3LQR A;  1YW8 A;  3WE2 A;  2EK5 A;  4A2U A;  2G9W A;  4I0A A;  1YTY A;  2M8E A;  2HTS A;  4HA8 A;  5E17 F;  1FWZ A;  3WOD F;  5JI6 A;  1L3L A;  4A0Z A;  4LG0 A;  3WG9 A;  2VBX A;  1U5T C;  1RNL A;  1K7A A;  3SQN A;  3HUG A;  3E6M A;  4HW0 A;  1TNS A;  1R7J A;  2CG4 A;  1FP1 D;  1J0R A;  3NQO A;  1Z9C A;  2P8T A;  5E1X A;  4IRI A;  4EGZ A;  2HTJ A;  3E97 A;  1F9N A;  2FF4 A;  3DXJ F;  3VOE A;  1DUX C;  2A68 F;  1EV7 A;  3CUO A;  2RKH A;  1WSU A;  3R6S A;  2P7C B;  1HKQ A;  4KFC A;  1R23 A;  1K6O A;  5LBQ A;  4CHU A;  3H3U A;  3SZP A;  4YFN F;  5K5R A;  3F8M A;  4L9T A;  3HSF A;  4UV9 A;  3RPQ A;  3KZY A;  3GWZ A;  4S05 A;  3K0L A;  3GW2 A;  5D8K B;  1O57 A;  2DO7 A;  5D5W B;  1HW2 A;  1PDN C;  4RB3 C;  4ESF A;  3LAJ A;  4A5N A;  1F4K A;  3BOQ A;  5IT3 A;  2PFB A;  5BS6 A;  3E5X A;  5HVQ C;  4M71 A;  1BIA A;  1HBX G;  3V8J A;  1O3S A;  1OR7 A;  1ONV A;  4CXF A;  1MD0 A;  4HZF A;  3LA7 A;  3GZ6 A;  4IRH A;  1FLI A;  4LLN A;  4L5I A;  3HYI A;  4M9X A;  2EV0 A;  1I5Z A;  2EWN A;  3TO7 A;  4IVN A;  2E1N A;  2ZKZ A;  1FX7 A;  2TDX A;  3F72 A;  5JHU A;  2Z9O A;  2KIU A;  2ZJ2 A;  3WTT C;  3GFM A;  3CUQ B;  4AVP A;  1W7P B;  3LQQ A;  2B0L A;  3F8C A;  4BAY A;  2IA2 A;  3L7W A;  1I27 A;  1MZB A;  1Z05 A;  2MLG A;  2WV0 A;  2YR2 A;  5IT9 K;  2NNN A;  3WU1 B;  1XGM A;  2A07 F;  1HST A;  3GXO A;  2CO5 A;  5H6Q A;  5E8G A;  5ERI A;  3DQV C;  3ZMS A;  4UV8 A;  4KMF A;  3GX4 X;  4XLN F;  3R61 A;  3U9G A;  3RKX A;  2Z33 A;  3V7R A;  3ECO A;  2DLL A;  1HKT A;  2YX7 A;  4LGW A;  5LHI A;  3FHZ A;  4I98 B;  3M1E A;  1BM9 A;  3HHG A;  1YQA A;  2GZW A;  3RKW A;  3TDZ C;  2VBZ A;  5H20 A;  3V7C A;  3LA3 A;  3P9C A;  2Z3Y A;  2G7H A;  4G7Z F;  1HKS A;  3E5Q A;  1ZGA A;  3HTU A;  1KQ0 A;  1KU3 A;  5FD5 A;  4P96 A;  1LJ9 A;  1IZ1 A;  4RS8 A;  2K4J A;  3ZMZ A;  3TOA A;  4ZYG A;  5LHH A;  1CF7 B;  2EFQ A;  2HDC A;  5CJ9 A;  4IPA A;  3JSO A;  1ZLJ A;  1K79 A;  4KT5 C;  3J7A O;  5DV5 A;  4EJT A;  1XDS A;  1QZZ A;  4KIB A;  4G7O F;  3WE3 A;  4DNC A;  5HLI A;  4G6Q A;  1OKR A;  4G7H F;  2EFN A;  2YPR A;  2MBF A;  5TRD A;  4GO1 A;  4HOB A;  2FEZ A;  4P9U A;  3GO5 A;  1WI9 A;  2VT3 A;  3ZQ7 A;  3KE2 A;  4HF1 A;  1TQM A;  2J5P A;  1OMI A;  1R36 A;  3F6O A;  4ZH4 F;  5LHG A;  2QEN A;  2WC2 A;  4L9N A;  2XAJ A;  1XGN A;  2FA5 A;  3FXQ A;  2XAS A;  1USS A;  2F5D A;  2EV6 A;  2ADU A;  1GXQ A;  1H9G A;  4AWX B;  1E17 A;  3K1N A;  1U5T A;  3RKY A;  2EJR A;  3G73 A;  3QRF F;  3JTG A;  2LF7 A;  3BJO A;  3RYP A;  3VB2 A;  2AXL A;  2RQP A;  1NHA A;  2DFI A;  3CLO A;  1R1U A;  1T38 A;  1J5Y A;  3BY6 A;  4M6Y A;  2A6E F;  1XGO A;  1BI2 A;  2L4M A;  4O5V A;  3KCC A;  3GLX A;  4ESJ A;  1G3T A;  3L2C A;  5TJJ A;  4A0X A;  1GVJ A;  1U5T B;  4ENK A;  4DQ2 A;  1E2X A;  1EH7 A;  1XD7 A;  4L9V A;  3K1M A;  4AIK A;  2OQR A;  5CVU A;  5HDN A;  1XCB A;  3TGN A;  4HF2 A;  1IXS B;  1QZY A;  4JQF A;  5ICF A;  3WU0 A;  2RN7 A;  3FM3 A;  5ED4 A;  3HTS B;  5F6F A;  3LST A;  2FBH A;  5L3B A;  1KGS A;  3W6J B;  1G3S A;  3KZZ A;  4RGR A;  1D3Y A;  2ZME B;  2VXZ A;  1FT9 A;  4NHJ A;  1IUY A;  4A0Y A;  4BHB A;  4BNC A;  1B4A A;  1FP2 A;  3COA C;  3IWZ A;  3VOD A;  1TTY A;  3FZV A;  4BH9 A;  1ZG1 A;  4ETS A;  3T1B A;  1G6N A;  4I2O A;  3AAF A;  2L01 A;  1YS7 A;  3KLO A;  3SFZ A;  1Y0U A;  4ZYH A;  3KLN A;  3WTY C;  2PBI A;  3I59 B;  5DEQ A;  4P55 A;  3KP6 A;  5J6X A;  3NEU A;  4M9Z A;  1ULY A;  1KU2 A;  5E20 A;  3QAH A;  2F5C A;  5DDG A;  5ICG A;  4IJA A;  1LB2 A;  4UUV A;  1HQC A;  2J5O A;  3P9I A;  5D4S A;  3B73 A;  5BQT A;  5FFX A;  2E1C A;  1BI0 A;  2EA2 A;  2VON A;  1P6R A;  4M73 A;  1TW3 A;  4KYW A;  2HOE A;  4R79 A;  2HYF A;  3ZMT A;  1S29 A;  4R8H A;  4Q47 A;  5DYM A;  1BJA A;  1KU7 A;  3R0J A;  4FX0 A;  1QGP A;  1C0W A;  1TNT A;  4BXU A;  3IRR A;  2XV4 S;  2BEO A;  3DFG A;  5FFZ A;  4U7B A;  1W5T A;  2C6Y A;  1I1S A;  4N9H A;  3C3W A;  2GQQ A;  3RYR A;  1V4R A;  2K7L A;  2RGV A;  1W7P D;  1S7A A;  2LDU A;  4WX9 A;  2D1V A;  4RAY A;  2IT0 A;  1OYY A;  5DCM A;  2H6C A;  2EA4 A;  2UXX A;  5AON A;  3RI4 A;  4K2E A;  2YU3 A;  4I09 A;  3E3V A;  1LEA A;  4MQ9 F;  4L5J A;  4UNO A;  2ZNZ A;  5LRR A;  1D5V A;  3CTA A;  5LGT A;  1Z7U A;  5D4R A;  5J8C A;  1S6L A;  3FXU A;  4FT8 A;  4I01 A;  3KP4 A;  5BMZ A;  4UVC A;  1STZ A;  3SXY A;  3BZ6 A;  4HV5 A;  3WGH A;  3PFI A;  1O7F A;  2K02 A;  5AIQ A;  1BI1 A;  1GHC A;  5CLS A;  5FGM A;  3GFJ A;  2PJP A;  3C1D A;  4ESB A;  5L3C A;  1ZGJ A;  5EEG A;  1DDN A;  2OBP A;  1LVA A;  3L09 A;  1VTN C;  4WCG A;  4KIG A;  3KET A;  4U88 A;  1T39 A;  4M6X A;  5JVT A;  4HV6 A;  3Q9S A;  4WXC A;  3F8B A;  2HWV A;  2W84 A;  4LLG F;  2DTR A;  1IN4 A;  2BBY A;  2BYV E;  5E8I A;  1ZLK A;  3JAM K;  4A5M A;  4HYE A;  2A69 F;  2V6C A;  3RDI A;  2IPQ X;  2QYO A;  3O6B B;  3TO6 A;  1ZHF A;  2DT5 A;  2QBY B;  5D5X B;  2NNY A;  1PUE E;  5K5Q A;  2F5E A;  1KU9 A;  4HF0 A;  3TQN A;  4XLP F;  5F64 A;  2JZY A;  2JT1 A;  2VE9 A;  4OIN F;  2H6B A;  2P5K A;  1HXD A;  1U3E M;  4N9I A;  5FLX K;  2G7U A;  4Y17 A;  3HHH A;  1J75 A;  1EH6 A;  2ZNY A;  4I0B A;  4JBA A;  2A5Y B;  4OIO F;  1O3Q A;  2O8X A;  3SZT A;  2DPD A;  5HS7 A;  6PAX A;  2VOD A;  4EJW A;  2HKO A;  2W57 A;  3CUQ A;  1W7P A;  3ZMV A;  4EM0 B;  4S04 A;  1QQI A;  3TO9 A;  1JHH A;  4ZZL A;  2V1X A;  5D6E A;  2FE3 A;  5E18 F;  3NRV A;  2XRO A;  3KP5 A;  1U78 A;  4U0Y A;  1UST A;  2CW0 F;  2JPC A;  1BOA A;  2A61 A;  3FMS A;  3I5U A;  2XKO A;  4UVB A;  3T8R A;  4ENM A;  1ZG5 A;  4LMY A;  4Z2Y A;  1R58 A;  4UXN A;  2CYY A;  2IRF G;  2HFH A;  3BP8 A;  3QP5 A;  2H94 A;  1B1B A;  2XRN A;  2FU4 A;  4P9F A;  3KP2 A;  5CVV A;  1XDU A;  4Y15 A;  3WTS C;  5D6F A;  3ABT A;  3G3Z A;  3MFK A;  1MJB A;  1CF7 A;  3ROU A;  1ZRD A;  1OYI A;  3HRU A;  2JRT A;  1T98 A;  1UB9 A;  1J2X A;  2OZU A;  2QQA A;  5ILU A;  1S7O A;  3QP6 A;  2M5W A;  3I64 A;  2BV6 A;  3EUH A;  2EFW A;  1SMY F;  3ZP5 A;  2F5F A;  2HQR A;  3I71 A;  2MH9 A;  2P7V B;  3GUD A;  5D5V B;  4KDP A;  1WRJ A;  4HQM A;  4CO8 A;  2HS5 A;  4OIQ F;  4KN7 X;  2L3D A;  3PQK A;  3J81 K;  3F22 A;  1SD4 A;  1SFX A;  4LB6 B;  1P4X A;  2FNP A;  2IW5 A;  2MD5 A;  2UZK A;  3FMQ A;  5LEK A;  2F2E A;  1KYW A;  2BGC A;  2OU2 A;  2OZ6 A;  1IXC A;  2E7X A;  2E7W A;  2K86 A;  2W24 A;  4ON0 A;  3M7G A;  3U1D A;  4G6D A;  1ZYR F;  3ULQ B;  5IT9 Z;  4BHC A;  1B9N A;  1KA8 A;  4WXD A;  3DKW A;  3ML6 A;  2ZO4 A;  2H27 A;  2VOO A;  3FWE A;  3I4P A;  3DF8 A;  4GXO A;  4I7H A;  1UCR A;  4TV7 A;  3OV8 A;  3HRM A;  1GXP A;  1Z6R A;  4KMU X;  3MEX A;  1YW9 A;  4BYY A;  3U2R A;  5J8F A;  1FOK A;  2XAH A;  3O3K A;  2MC3 A;  5DUK A;  1F5T A;  2FBI A;  4YIF A;  2QQB A;  5LGN A;  3BJA A;  5JFR A;  4M72 A;  1ON1 A;  1LNW A;  5LEJ A;  2EFO A;  4HQE A;  5LLQ A;  3ECH A;  1LQ1 A;  2RDP A;  4AIH A;  1MKM A;  4NB5 A;  3RTR A;  1XCV A;  5D5U B;  4IHT A;  3QOP A;  3ZPL A;  5L3D A;  5BOX A;  2HQN A;  4KNY A;  3J80 K;  3E6C C;  2VT2 A;  4OIP F;  3V7S A;  1R1T A;  2V1D A;  2YX4 A;  2PI0 A;  4HLX A;  3HSE A;  2P6T A;  1AOY A;  2OD5 A;  1XSV A;  5ILV A;  2PN6 A;  3QPT A;  5A2Q K;  1O3R A;  2ZBK A;  2P5V A;  4YII A;  4CIC A;  2D1H A;  5FD6 A;  4CGZ A;  2ISZ A;  2FSW A;  3CO6 C;  4WF2 A;  2ZME A;  1ZH5 A;  4MTD A;  3D0S A;  1SFE A;  1K78 B;  3T5X A;  1W5S A;  3ERE D;  2O03 A;  1BIB A;  5CVR A;  2D2W A;  3WGG A;  4RB2 C;  4JK1 X;  4G94 A;  3ISP A;  2DQR A;  1LDK B;  5E1W A;  2Q2E A;  3I59 A;  2VE8 A;  3ZMD A;  1UHW A;  2QUF A;  2QVO A;  3VFZ A;  1G3W A;  1B9M A;  3Q9V A;  2L4A A;  3R4K A;  1SAX A;  4IXA A;  3KP3 A;  1XGS A;  3K1P A;  1RUN A;  4GYI A;  5LRS A;  4L9J A;  1WQ2 A;  3EYY A;  3WGI A;  3T8T A;  5FB2 A;  1BN5 A;  4KA4 A;  1XMA A;  2PQ8 A;  4EJU A;  1XSX A;  5KVR A;  3H3Z A;  4G9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...