2M45A

Nmr solution structure of the c-terminus of the minichromosome maintenance protein mcm from sulfolobus solfataricus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
87
structure length
87
Chain Sequence
GSHMGESGKIDIDTIMTGKPKSAREKMMKIIEIIDSLAVSSECAKVKDILKEAQQVGIEKSNIEKLLTDMRKSGIIYEAKPECYKKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Minichromosome maintenance protein MCM
publication title Structure and regulatory role of the C-terminal winged helix domain of the archaeal minichromosome maintenance complex
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 27
structure length 87
sequence length 87
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2013-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2m45A00
2K4JA 2HEOA 5H6RA 1UHMA 2OD5A 2EJRA 1U6GA 4HOBA 4A6EA 4BXUA 4M72A 4ENKA 3CUOA 5L3FA 1Z05A 2HQNA 4YFKF 1SD5A 2KJBA 3TO6A 5E1ZB 5L3DA 2OBPA 4ZZDA 4BHCA 2LSOA 2CQKA 1P2FA 5H6QA 4MQ9F 1GXPA 1W7PA 4WX9A 1ZG5A 3RI4A 1P6RA 5BMZA 1R5GA 3QOPA 4L0ZB 3MEXA 1U3EM 2DT5A 3R6SA 2IP2A 4G8XA 4G6DA 2L54A 3U2RA 4KDPA 2FA5A 4EV0A 3ABTA 2KIFA 2XKOA 5D5VB 4XSZF 4NHJA 1YYVA 3V8JA 4GYGA 2IT0A 4L9JA 2QZ8A 5HDKA 1XN7A 1K6OA 5FGMA 4EM2A 1MDMB 1EH8A 2L02A 4A2UA 4HX8A 3HSEA 1D8JA 1LEAA 1UFMA 1UB9A 2PBIA 2EV6A 3ROUA 4YIIA 3GZ5A 4RB0A 4LJZF 3ZMSA 3KP4A 2HYGD 4UXNA 4LLLA 3SZTA 2A68F 1Z1DA 5HOOA 2P6SA 2XAQA 2K4BA 3P9KA 3SFZA 3HHHA 3B73A 1SAXA 2R7DA 3GZ6A 1D8KA 4EGZA 1HKSA 1DP7P 5ERIA 5EEHA 2KIUA 5JHUA 5CVVA 4XLPF 5D4RA 4G6QA 3FX3A 1FYLA 1LDJA 1G3YA 2VE9A 3L09A 3EUHA 2UWMA 2FBHA 1BIAA 3ML6A 4I0BA 2RQPA 3LA7A 4L9VA 3GX4X 5ED4A 4ZYGA 2IRFG 1IN8A 3ZPLA 3GEZA 1HW2A 4UV8A 3QP5A 2P5LC 1TQIA 3VFZA 3E6CC 5DEQA 3F22A 4IRIA 3ERED 2MD5A 3MZYA 3HOTA 4L9TA 4A0YA 2V79A 1IRGA 2EB7A 4Z2YA 2DW4A 3ZMVA 3I64A 2VC1A 1YS7A 1BOAA 2FEZA 1JHFA 3E6DA 4L5IA 3IHUA 2KRFA 3NRVA 1T98A 3WGGA 1W5SA 2ELHA 2M5WA 2O61A 3WU1B 3P9IA 3G73A 2Y0MA 3KLNA 4XSXF 2EA4A 4EJUA 1KYWA 4PGGA 2VOOA 3RKXA 3C3WA 3C7JA 4A5NA 2JRTA 1DPRA 3CJNA 3O6BB 5L3CA 2UZKA 2EFNA 2F2EA 5LHHA 1IXSB 1QZYA 2O8XA 3F8BA 5FO5A 3AAFA 2MBFA 2F5CA 1YTYA 3FMSA 3SZPA 3K69A 4N9HA 2FF4A 4ON0A 3WTZA 1ZYRF 4G94A 5IT9K 1X3UA 4E70A 2QQBA 5HS8A 2H6CA 2ZMEA 3K1NA 4IHSA 3HSFA 4RB3C 2O0YA 4O3MA 2EV0A 5DCMA 4A12A 2QBYB 2ZBKA 4I2OA 4IRGA 4BH9A 4ZH4F 4I01A 1KA8A 2O03A 1R36A 1XGNA 2PLYA 3DV8A 2MC3A 2GA1A 4RB2C 4N9IA 1USTA 3DPLC 1FBSA 4Y13A 1WRJA 1WI9A 4CICA 3GO5A 3K1PA 2D2WA 5KK1A 2WC2A 2P4WA 4U7DA 1REPC 1RUNA 4EQQA 4MGRA 4QLCU 1AWCA 2EFOA 5JR3A 4RGSA 4CDGA 2QLZA 3O3KA 3QPTA 3QRFF 1KU9A 1KYZA 2DBBA 2STTA 3C1DA 5H20A 1R5HA 4PCQA 2B0LA 1Z6TA 2FOKA 1MJAA 4P9FA 3KLOA 1B9MA 3MZHA 1LDDA 3L9FA 2DQLA 2GAUA 5TRDA 1O3SA 5KVRA 4UVAA 3KZZA 4HF1A 4IJAA 3EYIA 1YG2A 1PUEE 4A0ZA 2HKOA 4WWCA 3I4PA 1V3FA 5L3GA 3ABUA 1W7PB 4H0EA 4FT8A 1ZHFA 3WTWC 1OMIA 3GUDA 1VTNC 3MAJA 4ESJA 5JFRA 2VT2A 1KQ9A 1S8NA 4UV9A 2XVCA 4XRFA 3JAMZ 5AONA 1ZG1A 3BZ6A 3M8EA 3ZMZA 2L01A 2WTEA 3J80Z 1XDSA 3COAC 1DDNA 2YR2A 2MH9A 2YPRA 5E8IA 5J6XA 4KIBA 3IWFA 4G7OF 3R60A 2V1DA 2WV0A 2ISZA 1TQPA 2W84A 4LD5A 3U9GA 1SD6A 4CO8A 3R0JA 4GXOA 4RGUA 3JSOA 3L7WA 3ZN1A 1HKTA 1BI3A 3MWMA 2HQRA 4RGRA 4IXAA 1MZBA 3N4MA 3HTUA 2QBYA 2GA2A 3I58A 1I6XA 2V1XA 5DD4A 4UVCA 3WTYC 2OQRA 3TOBA 2NNNA 3KP5A 4HYEA 1OYIA 1C0WA 2G7UA 4U0YA 2VBZA 4HDUA 4RS8A 5D6FA 2P8TA 3FXQA 2DK5A 5ILVA 2KJCA 2Z33A 4HV5A 1UCRA 1R1UA 2GXBA 2E7XA 1XSXA 3J81Z 5LHGA 1BN5A 3P7NA 3L2CA 4NQWA 4EJVA 3K0LA 1B9NA 2V9VA 1IN6A 2O3FA 3KCCA 1XDUA 1FNNA 2ZCWA 5BPIA 2CYYA 1P4WA 3EDPA 1DPUA 1SFUA 2BE5F 4IVNA 1YFHA 1B1BA 2A6EF 5E20A 5L3EA 1DUXC 1TW3A 3CLOA 3RIRA 2ESNA 5LEJA 1QZZA 3LAPA 3GXOA 4LB5A 2QQ9A 4G9YA 5HLGA 2IJLA 2E1NA 5D5WB 2EFQA 2G9WA 2F5DA 3JAMK 3GFJA 1ZGJA 4S04A 2J5PA 2M87A 3J80K 2YX4A 3TO9A 3IRRA 4IF4A 1J59A 3HSRA 1F5TA 3GFLA 1LDKB 4Q5SF 3F3XA 2GQQA 4KICA 2K27A 4KMFA 2GWRA 3EYYA 1U5TC 1KQ0A 3RYPA 1P4AA 3ZMDA 1P92A 4LK1F 2ETHA 2A3SA 1Z91A 2XUBA 1L3LA 3F8MA 4LG0A 2K7LA 1FZPB 2NAZA 4AIHA 2ZNZA 5HLHA 2XKPA 1XSVA 1AOYA 2LDUA 5EEGA 3JW4A 2ZFWA 1J5YA 1TBXA 3L00A 4CXFA 2VONA 3E5XA 1RUOA 1IXRC 3FMRA 1P4XA 2BBYA 4KT5C 1R58A 3WTVC 4HF2A 3FXUA 2MLGA 4KIGA 5LLQA 3R0AA 1FY7A 4EJWA 4O6JA 1I1GA 4ETSA 4OIOF 4M6XA 3HYIA 2RNJA 4EM1A 1QO0D 3J81K 3E6BA 4ZYHA 2DFIA 4GCVA 3GYHX 2BYVE 3K9TA 3EETA 4GGGA 2ZMEB 2J5OA 3KEQA 3F6OA 2X4HA 3IRQA 3KP6A 5DCMB 2QENA 3TGNA 1PP7U 4FX4A 2DU9A 3ECHA 2HS5A 4HLYA 2KKOA 4UNOA 2VBWA 2MLKA 3DKWA 4L5JA 3V8KA 2ZO4A 1XGSA 1KU2A 1T38A 4U0VA 3M1EA 1G4DA 2UXXA 3E5UA 3M8FA 1R22A 2XASA 2VXZA 3RTRA 1KQ8A 4KA4A 4AVPA 2GIVA 4WCGA 4MHGA 2FSWA 2VBXA 3WG9A 3P9CA 3F8CA 3KP3A 2H27A 1IF1A 4HAMA 4KUMA 4O5VA 2FNPA 1B4AA 1YO5C 2EFWA 1S7AA 5DV5A 3BY6A 2PEXA 3D0SA 4OINF 1S29A 1JXSA 3LA3A 1F1ZA 3REOA 3ZP5A 3M9AA 3GFIA 3JTGA 1LVAA 1FP2A 4M9XA 5LRSA 4WF2A 5E1XA 3CUQA 4LLNA 3W6KB 3DFGA 1NHAA 1ZH5A 2L3DA 2O6GE 2PMHA 4JBAA 1ZRCA 3I59A 1IN7A 3CO7C 4Y15A 1OR7A 4KNYA 2FXAA 5ILUA 3PFIA 3N97A 4R1HA 1FYMA 1ZREA 1TTYA 4ENNA 3Q9VA 4ZYEA 2CSOA 1CGPA 4CYDA 4HDVA 1B6AA 1S3JA 5LHIA 2DI3A 4XLNF 1XGOA 4WK8F 5LBQA 1MGTA 1FT9A 1J7KA 1FOKA 1G3TA 5F1RA 4Q47A 2W85A 3TDUC 3HRMA 4I02A 2PN6A 1TLHB 2QVOA 4YG2F 4A5MA 1U2WA 4AIKA 5J8CA 5LRRA 4PDKA 1UHWA 1U5TA 5DYMA 3HUGA 1ZARA 3F21A 3VB2A 4UUVA 3DEUA 4F7ZA 1BI2A 1J2XA 4A6DA 2Z5UA 1HXDA 4K2EA 3RPUA 1YLFA 1Z7UA 4A0XA 3K2ZA 3ELKA 5DD8A 4UHTA 2OU2A 5TJJA 2Z9OA 3I0TA 3ZMTA 2CFXA 5HDNA 3F23A 3V4GA 2Q2EA 1TW2A 3NEUA 2DK8A 3LWFA 3BDDA 3TOAA 2M1BA 2VN2A 5CVRA 3WE3A 1EH6A 2H94A 3TKYA 4Y17A 5AIPA 1FWZA 3PQJA 4MQVA 1USSA 1O7LA 4IHTA 2FMYA 5E8GA 1LEBA 4I7HA 2OZUA 5D8LB 4I09A 4S05A 3B02A 2D45A 2OQGA 5FFZA 2PQ8A 3HRUA 2RN7A 5DCFA 1W5TA 3K1MA 3BWGA 5HS9A 1D3YA 1JGSA 4KN7X 5CVUA 4YIFA 1YW7A 5HS7A 4M74A 1HW1A 2IA2A 1FSHA 2RC4A 4JQFA 1O7FA 4KYWA 3T0YA 2Z3YA 5HVQC 2XAGA 3ECOA 1SFEA 1TNTA 2HWVA 1HSTA 1ZRDA 3T8TA 4EMSA 3KP7A 1ZRFA 4BHBA 1I1SA 5JVTA 1Z6RA 3SHFA 5K5OA 4N0BA 2LKPA 4DQ2A 3Q5FA 5JI6A 3F6VA 2YX7A 3BROA 4YFNF 4HA8A 4LLGF 1FP1D 2UXNA 4MEXF 1FX7A 4JK1X 1BC8C 1GXQA 2BGCA 2WWYA 2JSCA 2W57A 4HQMA 4LG0B 2XAHA 1JE8A 2IVMA 3VEPA 2ESHA 4EVIA 3R4KA 1T2KA 1FBQA 4HBLA 2L4AA 5E18F 2VODA 1W7PD 1CF7A 1LNWA 1PP8F 4CGZA 4LB6B 2A5YB 1KU3A 2VE8A 2HDCA 3G3ZA 3IKVA 3BPVA 5BS6A 3I53A 4Q4ZF 2XROA 1XGMA 3MQ0A 1ZLKA 1QPMA 2IA1A 1WQ2A 3T8RA 1WKMA 3SXYA 5E17F 1ZLJA 5IT3A 4LMYA 1STZA 3JSPA 4OMYA 2DPUA 1QQIA 5LGNA 3KE2A 4RB1A 3IKTA 1WSUA 5K1YA 2Y75A 4L0YB 1O3QA 1R7JA 5D8KB 4PZJA 4WXHA 4R8HA 1O57A 4WXCA 1BBYA 1SD4A 3DXJF 2L4MA 5K5QA 2R7FA 2XV4S 1WWXA 1LJ9A 3RJPA 1BJAA 3IWZA 2HOEA 1H9GA 5CVIA 1EV7A 4P9UA 4AIJA 2XAFA 2FNAA 1R23A 4RAZA 3E5QA 2M30A 4ZYDA 4CHUA 2CWEA 2JPCA 4KIFA 2F5FA 1YW9A 5BOXA 4XBFA 4MNUA 4M71A 3WE2A 2VC0A 4MEYF 4FX0A 4U88A 2QUFA 1K79A 2EV5A 5AIQA 3V7RA 1B59A 2EFPA 2ADUA 1S6LA 5ILSA 3CTAA 1EH7A 1T0FA 3BP8A 5FD5A 2DTRA 1XSDA 1ZG3A 4HF0A 2RV8A 3CUQB 1E2XA 1J75A 5CYVA 3V7SA 3MFKA 1MJBA 3PQKA 1H0MA 3I59B 5FD6A 4KMUX 2K86A 2HGCA 4HQEA 1IAWA 4Q48A 1K78A 4M6YA 4EGYA 1F4KA 4B8XA 1MD0A 4ESFA 2ZKZA 4KFCA 5L3BA 1YS6A 3IC7A 2CO5A 1IUYA 3E3VA 3FMQA 4AWXB 3FM5A 3WTSC 2P5KA 1KGSA 2JTVA 2M45A 2YSRA 2Z99A 3BOQA 3LQRA 5D6EA 1A04A 4OIPF 4BYYA 1ONVA 2FBKA 3LAJA 3GVAA 2XHKA 4L18B 2CGPA 1Y0UA 1BM9A 3BJAA 5E1WA 1G6NA 2OZ6A 4OOIA 1ON1A 1U5TB 1J0RA 3U1DA 1TNSA 3TO7A 5LEKA 2ZNYA 1BI1A 2EWNA 2QWWA 1Q1HA 2VT3A 2XAJA 3NQOA 1GVJA 5CJ9A 3WU0A 2HR3A 1OKRA 3ZQ7A 5HDGA 2KIMA 3H3ZA 4I98B 1L0OC 3C18A 2PJPA 4QWQA 1HW5A 2D1VA 3E6MA 3FHZA 1HBXG 2AXLA 5IT9Z 4OMZA 1OYWA 3Q9SA 4OIRF 3J7AO 4HV6A 3WODF 3QU3A 2HTJA 5LGUA 1XCVA 1G3WA 4L9NA 6PAXA 2Y48A 1IN4A 1BI0A 2PI0A 3I5UA 2XGXA 3GW2A 3CDHA 1R1TA 1FYKA 4TV7A 2NYXA 4HX4A 2NS0A 1IN5A 3HRTA 5D4SA 1JHHA 3DF8A 2JT1A 1HQCA 3SQNA 1O3RA 2RGVA 4KN4X 3D5LA 2JZYA 2PG4A 3HTSB 4LFUA 2R3SA 1QBJA 3KETA 5ICCA 1LQ1A 5D5XB 1Z9CA 4ZZLA 3ZN0A 1RZ4A 3CO6C 3FZVA 4ESBA 4OIQF 5ICEA 1RIOH 2D1HA 4WXDA 1R00A 1IZ1A 2CG4A 2Q0OA 3WTXC 2PMUA 3IL2A 4BHPA 2BV6A 1G3SA 2LF7A 3HRSA 2FBIA 1SFXA 4P5OA 4GYIA 4LGWA 4ENMA 4HLXA 2RVCA 2IA0A 2HZTA 4G7ZF 3GFMA 2FQ3A 2ACJA 1FC3A 1BC7C 1LB2A 1OYYA 4P96A 3LA2A 1MDMA 1R1VA 3RYRA 5DDGA 2OAZA 4IRHA 3V8LA 1O3TA 1ZAOA 2LNBA 2W25A 2DO7A 2Q8KA 4BQAA 5DUKA 1CF7B 3FM3A 1S7OA 1J9IA 2FU4A 3DQVC 4LK0F 3JTHA 2STWA 3I54A 5CVJA 2OA4A 4BNCA 2P5VA 4IPAA 2HTSA 3VODA 1SD7A 2PFBA 2A69F 2H6BA 2JPBA 1ULYA 2K02A 3ISPA 1ZN2A 5BQTA 2E1CA 3WTTC 3GWZA 4D0PA 2V6CA 4EJOA 1I5ZA 1HSJA 1QGPA 4RGXA 5A2QZ 2HKXA 1ON2A 3H92A 5ICGA 4ENJA 3S2WA 2W24A 2H09A 3BJ6A 3BJOA 2P7CB 1T6SA 2EK5A 1FLIA 3OOPA 2IPQX 5FFXA 1ODDA 2V1UA 3KZYA 1HKQA 5ICFA 1RI7A 4EM0B 3O2PE 3H3UA 4NB5A 5D5UB 1IRFA 3RKYA 5BPDA 3QU6A 2MH2A 1FSEA 1IW7F 1SMTA 3RPQA 3WGHA 4R79A 1PDNC 1E17A 2A61A 4HX7A 2ZXJA 3HIFA 2HFHA 1XD7A 2E7WA 2DQRA 4GO1A 3FXRA 3M7GA 2FRHA 2EA2A 3I71A 2FMLA 2MA3A 3QP6A 1GHCA 3DPTA 2LF8A 2NNYA 3BPXA 4M9SA 1IXCA 1KU7A 4I0AA 3KFWX 1FBUA 5LGTA 3FF5A 3KP2A 5FLXZ 1U78A 2AS5F 2A07F 1XB4A 4G7HF 3E97A 1YIOA 3HHGA 3RDIA 4OU0A 2VBYA 4MTDA 2P6TA 5F6FA 5DUIA 3FWEA 2XRNA 2DAOA 4UVBA 1U8RA 2F5EA 2P7VB 1K78B 3MCZA 1TQMA 4EJTA 1FPQA 2X0LA 2DPDA 2ISYA 2G7HA 2NRAC 4U0WA 2COMA 1T39A 1XCBA 2QM3A 3F72A 2TDXA 4M9ZA 2ZJ2A 1YW8A 3QAHA 4CZZA 3HOSA 5FB2A 5HLIA 1W4MA 3ULQB 4B09A 4MTEA 5A2QK 1ZGAA 2VOPA 2YU3A 3EQLF 1OPCA 4FHTA 3T5XA 4M73A 2C6YA 1F9NA 1MKMA 1QNTA 1XMKA 1RNLA 4DNCA 3OV8A 2XIGA 4HZFA 3V7CA 4U7BA 4ASNA 3W6JB 1H9TA 3LFKA 5K5RA 2CW0F 3DP7A 2QYOA 3RKWA 2BEOA 3F8NA 3TDZC 2GXGA 3T1BA 3WGIA 1K7AA 2RKHA 1V4RA 4P55A 2FE3A 4BAYA 1YQAA 1MJ9A 4YFXF 4AD9A 5J8FA 2QQAA 2RDPA 5CLSA 3R61A 3QPHA 4HW0A 3VOEA 3LSTA 3CUQC 1SMYF 5F64A 4PGHA 3WTUC 3ZMUA 2DLLA 2M8EA 3F8FA 3LQQA 3TQNA 2GZWA 4RAYA 5FLXK 2A6HF 3KEOA 1I27A 3GF2A 1D5VA 1XMAA 3GLXA 2HYFA 1BIBA 2IW5A
chains in the Genus database with same CATH superfamily
1VQ9I 2K4JA 2HEOA 5H6RA 1UHMA 3KX2A 2VQCA 1V5EA 4PJLA 2OD5A 2EJRA 2XGDA 1U6GA 4B3XA 2V9KA 3OL3A 1QA6A 1I3QJ 2UV1A 4HOBA 4A6EA 4BXUA 1RC9A 4CCNA 3OYBA 1UG2A 2CUJA 3FIWA 4M72A 4DBRA 4ENKA 3CUOA 5IOZA 3KYCB 2WAFA 1Z05A 3CDIA 5L3FA 4YRVA 2HQNA 2CUFA 1SD5A 4YFKF 4XOTA 5J3LA 2KJBA 3TO6A 2E1MC 3HEFA 1X2MA 5E1ZB 5L3DA 2BY3A 1MBJA 2OBPA 4ZZDA 4BHCA 2LSOA 2CQKA 1P2FA 5H6QA 4IQ4A 4MQ9F 1GXPA 1W7PA 2DOFA 4WX9A 4PSWA 3DTIA 1XX5A 1ZG5A 3RI4A 1P6RA 5GTHC 1WJCA 5KHDA 5KNLA 3KYLA 2JN6A 3ZQGA 5BMZA 1R5GA 2LD5A 1NK2P 5GAGJ 3QOPA 2XDVA 1WJEA 4L0ZB 3MEXA 1W5CC 3BG7A 2DT5A 3R6SA 2IP2A 1U3EM 1IDZA 4G8XA 4G6DA 2L54A 3U2RA 4KDPA 1BR4A 4ZYAA 2R5ZA 2FA5A 4EV0A 3TW7A 3VSKA 1BW5A 3ABTA 2EQRA 2KIFA 5F0HA 2CMPA 4E7JA 2EZKA 2ZMEC 2BZTA 2XKOA 2R7RA 2F5VA 2JQ7A 2HQAA 5D5VB 3CDLA 4XSZF 3HDDA 4NHJA 2JRMA 1YYVA 1T8IA 3V8JA 3W2WA 5E3LA 2QSGX 4GYGA 2LBFB 5GPCA 3PNVA 2B7EA 3PJRA 2IT0A 4L9JA 2QZ8A 2LOOA 3VWBA 5HDKA 1XN7A 3W2VA 2XF5A 5HLTA 1K6OA 5FGMA 4EM2A 4ZC3A 1MDMB 1EH8A 2L02A 3LSMA 2BHYA 4A2UA 2R4GA 1J09A 1OCOH 2LYCA 3G71I 4HX8A 3HSEA 3BZCA 1OCCH 1D8JA 1LEAA 1TWGJ 4BJTA 1UFMA 1UB9A 2PBIA 2EV6A 3ROUA 3JR9A 4YIIA 3GZ5A 3KZIC 2DA1A 1WJAA 2R0QC 4MIMA 2QCOA 4RB0A 1MSFC 3H9GA 4LJZF 3ZMSA 3KP4A 2HYGD 4UXNA 1HC8A 4LLLA 3SZTA 2A68F 1Z1DA 3BT9A 2P6SA 2E34A 5HOOA 2XAQA 2K4BA 3P9KA 3S3OA 3SFZA 1G8XA 3HHHA 1SVMA 2F4MB 1LUJB 2K5CA 2X6WA 3B73A 1SAXA 2R7DA 3GZ6A 3BCAA 1D8KA 4EGZA 1E3HA 1HKSA 3K4NA 1DP7P 5ERIA 5GTIC 2XGEA 2M8GX 5EEHA 2DFFA 2KIUA 4UB8C 4CH7A 5JHUA 5CVVA 4XLPF 4BDYA 5D4RA 1V54H 4G6QA 3SDGA 5IP9J 1DGRM 3FX3A 1K61A 1FYLA 4NC7A 1ZK8A 1LDJA 1G3YA 2VE9A 3L09A 1LFPA 3EUHA 1GUUA 2UWMA 2FBHA 1BIAA 2W00A 2R7SA 3ML6A 4I0BA 2RQPA 3DU5A 2CS3A 5C4XJ 3LA7A 4L9VA 3VDXA 3IH3A 4PFPA 4DZJA 3GX4X 2EPFA 4QPOA 4ZYGA 5ED4A 2IRFG 2NVTJ 3BR2A 1IN8A 3ZPLA 3GEZA 2R92J 4Y52J 1HW2A 3RPUD 3KEYA 4UV8A 2IGNA 1BW6A 2VQLA 3QP5A 5B1AH 2P5LC 2ZJPF 2KL4A 1IJWC 1TQIA 3VFZA 3E6CC 1FIPA 5EG0B 3H9QA 5DEQA 3J7ZI 3F22A 4IRIA 4E7KA 3TW6A 3L2UA 1H88C 3ERED 2MD5A 3MZYA 3GBGA 2L7FP 3HOTA 1GT0C 4L9TA 5J1YA 4A0YA 3PIOF 2V1NA 2V79A 1IRGA 2EB7A 4Z2YA 3DTKA 2DW4A 3ZMVA 3I64A 2VC1A 2DOAA 1YS7A 4DZPA 1BOAA 2FEZA 1JHFA 3E6DA 1SVLA 2JJ7A 4L5IA 3IHUA 2KRFA 3NRVA 3X2QH 1T98A 1LPQA 4FISA 3WGGA 1W5SA 1U0JA 1SC7A 2ELHA 2M5WA 3CP2A 2O61A 4PJMA 3A2KA 3FKJA 4J19A 2DYRH 1IC8A 2ECCA 3WU1B 3P9IA 3WHCA 1XPXA 3G73A 2Y0MA 3KLNA 2HZDA 4XSXF 1HCRA 2PJRA 3S17J 2YS9A 2EA4A 5FKKA 4EJUA 1KYWA 3CMMA 2GOXB 4PGGA 4YIRX 2LBFA 5EZGA 2AQFA 2VOOA 3VYUB 2F48A 1X4PA 3RKXA 3PO3J 3C3WA 3C7JA 3AG3H 4A5NA 4E4HA 1Y39A 2JRTA 2JA5J 1Y8RB 1DPRA 3E0JB 4OAYA 3G4SI 3SEQA 2DMUA 2KRCA 3CJNA 2Z2SB 2EH3A 3O6BB 1S7EA 5L3CA 4C30A 3DLLF 3CF5F 2UZKA 2EFNA 2F2EA 2KZGA 5LHHA 1X19A 1MBHA 1WH5A 1IXSB 2K85A 1QZYA 4XK4A 3CMEI 2HDWA 2QKMB 2X6OA 1ETQA 5KAFC 3PO2J 2JMWA 2LC2A 4CZCA 2O8XA 3F8BA 2M9HA 5FO5A 2R7VA 4UUTA 3AAFA 4PK4A 2VI6A 2MBFA 2MFZA 2KDZA 4E6KG 1MNDA 2XAUA 5J4YA 2DT7B 2F5CA 1OCPA 1YTYA 1R71A 3FMSA 3SZPA 2O8KA 3K69A 4N9HA 2FF4A 2BVMA 4ON0A 1ZR4A 4BBRJ 5GAEJ 1VFCA 3WTZA 1ZYRF 4G94A 4RAGA 5IT9K 1X3WB 3A1YA 3M8JA 1X3UA 3CCVI 2QSHX 3CCEI 1QU3A 5K7HA 4E70A 2QQBA 5HS8A 3HGGA 4D5FA 3HPHA 1LFBA 2H6CA 2ZMEA 5F04A 5EZHA 4I76A 1FOWA 1P7JA 3K1NA 4IHSA 3HSFA 2L7MP 3LSIA 4CUGA 4RB3C 5CQGA 2O0YA 2QA4I 4O3MA 2EV0A 5DCMA 3PM1A 4A12A 2WV1A 2G0EA 2QBYB 4U87A 2ZBKA 4I2OA 4CCMA 3G1MA 1YJ9I 1GDTA 4IRGA 4BH9A 4H4KC 2EIKH 4PJNA 1ETYA 2LKSA 3MKWB 4ZH4F 4D1QA 1X1BA 2XPVA 5EYRA 4I01A 5J47A 3CMYA 1Y1WJ 1KA8A 2O03A 4J00A 1TC3C 3D5SC 1R36A 1ETOA 1D1BA 5B3SH 1XGNA 3E1SA 2PLYA 1D5YA 4JYKA 3DV8A 2MC3A 2GA1A 4UY8I 4RB2C 4N9IA 3CP8A 1USTA 1B72B 3OY9A 3CJQB 2VUMJ 3DPLC 2ELJA 1FBSA 1HDPA 4DYCA 1WRJA 4Y13A 1WI9A 4CICA 2DN0A 4LIVA 3GO5A 3K1PA 2D2WA 4W97A 2WC2A 2P4WA 3LMMA 5KK1A 4U7DA 1R49A 4BQQA 5LD2C 1REPC 3HOWJ 1RUNA 4EQQA 4MGRA 4QLCU 3CCRI 1AWCA 2CJJA 5E3MA 2EFOA 4NQWB 5JR3A 1B8IA 4RGSA 2RNGA 1VQKI 4CDGA 3A0HC 2QLZA 2QQ8A 2ZXWH 3O3KA 3S1QJ 2JK3A 3QPTA 3L1PA 3QRFF 1AU7A 1WH7A 1R6RA 2KHMA 3W3CA 4HNVA 1IUFA 2VIXA 9ANTA 1VQ6I 4DBQA 2M4KA 5F1JA 1KU9A 1KYZA 2DBBA 2STTA 3C1DA 5H20A 3QODA 2VKEA 1R5HA 3RZDJ 4PCQA 2B0LA 1Z6TA 3FK7A 2DCEA 2FOKA 5IOYA 5DM7F 1MJAA 4XORA 2A6TA 3L2WA 4XICA 4P9FA 3KLOA 2CU7A 1BA5A 1B9MA 3MZHA 1LDDA 1D0YA 3L9FA 2DQLA 2GAUA 5TRDA 4UB6C 1O3SA 5KVRA 4UVAA 4HSRA 3KZZA 3LSKA 4HF1A 5E3NA 4IJAA 1XTAA 3EYIA 2L9VA 2Q1ZB 1YG2A 1Z7LA 5H2FC 4A0ZA 1PUEE 2HKOA 4WWCA 3I4PA 1V3FA 4F55A 4IHWA 4A3LJ 5L3GA 3ABUA 5EEAA 4JOMA 1W7PB 4H0EA 1PUFA 4FT8A 2DA7A 1ZHFA 3WTWC 4II2A 3NWSA 1OMIA 4ABZA 3GUDA 1VTNC 4BBSJ 3MAJA 4ESJA 5JFRA 2VT2A 1VQOI 4FE7A 2WB1N 2DJNA 1FMVA 1KQ9A 1S8NA 4UV9A 2XVCA 4XRFA 3JAMZ 2JA2A 2CW8A 2KT0A 3I4NJ 2WAQN 5AONA 1ZG1A 3BZ6A 3M8EA 3K10A 2JA7J 3QQAA 1BJZA 3ZMZA 2L01A 4QSHA 1Y56A 2DA5A 2MSYA 2WTEA 2R5ZB 3ERMA 3S2DJ 3J80Z 1XDSA 2Y30A 3COAC 1DDNA 2WA0A 2YR2A 2MH9A 2W1OA 2YPRA 5E8IA 2Y9ZA 5J6XA 2CH0A 4KIBA 4PUSA 3IWFA 3CCQI 3IUOA 2E2JJ 4AUXA 3S2HJ 4JX6A 2WY8Q 1A36A 3ASOH 3R60A 2D5VA 4G7OF 2OTJI 1JKPC 2V1DA 2WV0A 2ISZA 2OTLI 1TQPA 2W84A 3OYDA 4XQFA 2HPMA 4LD5A 5F0FA 1AHDP 3U9GA 2K9MA 4XLHA 1SD6A 1VNDA 2WBMA 4CO8A 3R0JA 4GXOA 4RGUA 4C2UA 3JSOA 3L7WA 2IS2A 3ZN1A 3AFHA 1HKTA 1BI3A 2HOTA 3MWMA 2HQRA 4RGRA 4IXAA 1MZBA 2R7OA 4XKCA 3N4MA 3HTUA 2QBYA 2GA2A 3I58A 3PSFA 2R7TA 3OR1C 1I6XA 1Z3YA 1X1CA 1LE8A 2V1XA 4E7ZA 3LOCA 5DD4A 5FKNA 4UVCA 3TL4X 3WTYC 4A3MJ 4A3BJ 1GVDA 2OQRA 2ZFUA 4V2FA 2KP6A 2VXDA 3TOBA 2NNNA 3OSGA 3UKGA 3KP5A 5F08A 3L2RA 3MZ8A 1RPWA 1WZ2A 4HYEA 1VQPI 4GDFA 4DYRA 1OYIA 1C0WA 2G7UA 4DJAA 3K70C 3OIOA 4U0YA 2VBZA 2E35A 4HDUA 2E5ZA 4RS8A 5D6FA 2P8TA 3FXQA 2DK5A 3I9V2 2XGCA 4PJ0C 2W7NA 5ILVA 2KJCA 2Z33A 3DWLE 4HV5A 1UCRA 1N75A 1R1UA 2GXBA 2K9QA 2E7XA 1SEUA 4IL6C 1ETKA 1XSXA 3KIOA 3S14J 3J81Z 4E7SA 2B63J 5LHGA 3ZQFA 2JA8J 1BN5A 3P7NA 1V5GA 2LTPA 3L2CA 3IV5A 3HOZJ 4NQWA 4EJVA 3K0LA 1OR7C 1V55H 1Y0NA 3BG9A 5TISC 1B9NA 2V9VA 1YJNI 4IOCF 1O4XA 1IN6A 4ITVA 2O3FA 3KCCA 2JWTA 5JHFA 1XDUA 3RQIA 1FNNA 2ZCWA 2FX0A 3CQZJ 5JLWA 3BLYA 4UUSA 5BPIA 1I6HJ 3HL2A 3S93A 2CYYA 1HOMA 1P4WA 4BE0A 4A3FJ 3GTGJ 4B4CA 3EDPA 4BS9A 1DPUA 1SFUA 2BE5F 2AO9A 1Y8QB 2LKXA 2KRHA 4IVNA 4A3EJ 1YFHA 1HA8A 1B1BA 2A6EF 3BTLA 4B44A 5E20A 5L3EA 1DUXC 1TW3A 2Y31A 1TWFJ 2HXOA 3CLOA 3RIRA 2ESNA 5LEJA 3JRHA 4FCYA 2DODA 1QZZA 5M5YJ 3LAPA 1P9QC 3SDBA 3GXOA 4LB5A 3BR1A 2MG4A 2QQ9A 4G9YA 4FASD 2OJED 5HLGA 2IJLA 2E1NA 1E3PA 5D5WB 1QZEA 3FHNA 3I56I 1JJ6C 3DCFA 2EFQA 2ID3A 2G9WA 2F5DA 3JAMK 3GFJA 4AYBN 1E0EA 1PVEA 1ZGJA 4S04A 2J5PA 2M87A 2EINH 4XOPA 1OLTA 3J80K 1D1CA 2YX4A 5GADJ 3TO9A 3ABMH 3HZJA 4IF4A 3IRRA 1J59A 3HSRA 4XNFA 3DTEA 3GFLA 1F5TA 4IOAF 5HODA 1RETA 3S8PA 1LDKB 4Q5SF 3F3XA 2GQQA 4KICA 1W1WE 2K27A 4KMFA 1N77A 2KQRA 3EPZA 1TP4A 2GWRA 3A4CA 3EYYA 1U5TC 2Y69H 4N4OB 3LNQA 3K70D 1YITI 1KQ0A 3HG9A 3RYPA 2E36A 1P4AA 2V26A 3FXOA 3ZMDA 2QEXI 4F93B 1P92A 2DFEA 3BTIA 4LK1F 2ETHA 2A3SA 1Z91A 1EKEA 1Y6IA 2VASA 2XUBA 1L3LA 3HOVJ 1LFUP 2LY1A 3F8MA 2PJRB 2L0KA 4N4NB 4LG0A 2XF7A 2EZLA 2K7LA 2LMDA 1FZPB 2NAZA 2V6EA 1LKXA 4AIHA 4AYBA 2ZNZA 1SFKA 5HLHA 1N78A 2XKPA 3OIQA 1XSVA 3HB9A 3M3YJ 1AOYA 4CCJA 2LDUA 5EEGA 2ID6A 4XRMA 4FTHA 1YJWI 2DT6A 3BTJA 3JW4A 3AL0B 2ZFWA 1J5YA 2L9SA 1R4NB 1TBXA 3L00A 4CXFA 2VONA 3SZGA 2LG4A 3K4JA 4PSXA 3E5XA 4BKXA 3K4MA 1RUOA 1IXRC 3EUKL 3FMRA 3G6EI 1P4XA 2BBYA 4KT5C 1YHQI 2E1MB 1JT0A 4OWRB 1R58A 2KIQA 3WTVC 3ESWB 3O8HA 2IXSA 4HF2A 3FXUA 1MMDA 2MLGA 4D9JA 4KIGA 5LLQA 1OCTC 2H27A 4E7IA 3R0AA 1FY7A 4EJWA 3CC2I 2OC6A 2OF7A 4O6JA 1I1GA 3LSPA 4ETSA 2R5YA 4OIOF 4M6XA 3HYIA 2RNJA 5J1UA 3JREA 4EM1A 1QO0D 3J81K 3S1MJ 1MMAA 3E6BA 4ZYHA 3M1CA 3HOXJ 2M0MA 1FTTA 2DFIA 4GCVA 1T08B 3GYHX 4BJ5C 4RAFA 4JX4A 4EATA 1VF9A 3CC7I 3QYEA 2BYVE 3K9TA 2Z16A 3EETA 4GGGA 3K6GA 2ZMEB 2B9SA 2J5OA 3KEQA 1W36C 2DA3A 4NNJA 1OCRH 3F6OA 2X4HA 1OQYA 3IRQA 3KP6A 5DCMB 2QENA 4AIDA 3TGNA 1GV2A 4NBQA 1PP7U 4FX4A 2DU9A 3LSHA 3ECHA 2HS5A 4HLYA 5FKMA 1X2NA 2DOEA 2KKOA 4DW6A 3IH4A 4UNOA 2VBWA 2NS8A 2MLKA 3DKWA 4L5JA 4BU2A 3RCOA 1ENHA 3V8KA 2ZO4A 1XGSA 4ZTFA 1KU2A 1FOXA 1T38A 3HPGA 3M1EA 4U0VA 2Q2EB 1G4DA 5FROA 4IQJA 3H0DA 3CESA 1QVUA 3U1KA 2IGOA 3ABLH 2UXXA 3E5UA 3SEZA 3M8FA 1R22A 5IYBJ 4GRIA 4RMNA 2XASA 2L2OA 2VXZA 3RTRA 1KQ8A 4BEHA 1G2HA 4YELA 3C2GA 4KA4A 1K6YA 4AVPA 2GIVA 2RREA 3SYTA 4MHGA 4WCGA 2FSWA 2VBXA 3WG9A 3P9CA 3F8CA 3KP3A 4MFDA 4A3KJ 1IF1A 4HAMA 4KUMA 1OJLA 4O5VA 4HNUA 3RKQA 2ECBA 2FNPA 3A0BC 2F4IA 2CQ7A 1B4AA 1YO5C 3OYNA 1B8IB 2N8GA 2L5QA 2DJIA 1S7AA 5DV5A 2EFWA 1TT0A 3BY6A 2PEXA 3D0SA 4OINF 4HRIA 1JUMA 3MKLA 1S29A 1Z67A 4LITA 4ZDOA 1JXSA 4CCOA 2GXAA 2XB0X 5EJCA 3LA3A 2X1EA 1F1ZA 3REOA 3HKZA 3ZP5A 4M3DA 2LREA 3M9AA 3GFIA 1MH3A 3JTGA 3BG6A 1LVAA 5GAHJ 1FP2A 4XLEA 2QKLB 3CJTB 4M9XA 5LRSA 3UNGC 4WF2A 5E1XA 3CUQA 4LLNA 3W6KB 3DFGA 1UHSA 1NHAA 1ZH5A 2L3DA 4KJZA 1OFCX 3TEDA 1VQ8I 2PMHA 4JBAA 5HNHA 1ZRCA 2O6GE 3I59A 1IN7A 3CO7C 4Y15A 4A69C 1OR7A 4LG3A 4KNYA 2MGQA 4IHXA 2FXAA 5B5EC 5ILUA 1VQMI 3PFIA 3JRFA 3N97A 4DYQA 4HEA2 3MVPA 2HYJA 4R1HA 1FYMA 1ZREA 1S9HA 2W48A 1TTYA 4ENNA 1W36D 3QPLA 4A3CJ 3Q9VA 4B1RA 4ZYEA 3IH2A 2CSOA 3IP4B 1PUFB 3HXLA 4Y4RA 4JP0A 4D7MA 1R4MB 1CGPA 4CYDA 2R7QA 4HDVA 2E19A 3FXMA 1FJLA 1S3JA 1B6AA 5LHIA 2DI3A 3ASNH 3VYRB 1T56A 4XLNF 1XGOA 3PSIA 4WK8F 4KT6A 3TP0A 2CV1A 5LBQA 1MGTA 4ZJZA 1FT9A 1SAUA 2MABA 1J7KA 4HPQA 1JGGA 1FOKA 1G3TA 5F1RA 3CCYA 4Q47A 2W85A 2JUGA 3FK6A 3TDUC 2DMNA 2F6CA 3HRMA 4I02A 2I10A 2PN6A 1TLHB 2QVOA 4NUBA 4YG2F 4A5MA 2IBDA 3JCUC 1U2WA 2ZJRF 4AIKA 5JLXA 3OWTA 4X0GA 2HI3A 1X1DA 1D0XA 5J8CA 2BW3A 3S15J 1MMGA 2KMUA 2K40A 5LRRA 4PDKA 1UHWA 1ZQ3P 3HBLA 2K9LA 2JUCA 3DLAA 1U5TA 5F0CA 3NWTA 2DMPA 2OCEA 2E5NA 4V19K 5DYMA 5M3MJ 2NS7A 3F9KA 3HUGA 4XN3A 1ZARA 3F21A 3VB2A 4A93J 4UUVA 3BCBA 1TT5B 2PMZN 3DEUA 3H5NA 4F7ZA 3ZQCA 2PX9A 2R7ZJ 1BI2A 1J2XA 4A6DA 2Z5UA 1HXDA 4K2EA 5CPRB 1LE8B 2X85A 1YLFA 3RPUA 1Z7UA 2AQEA 3K2ZA 3ELKA 4A0XA 5DD8A 4UHTA 2JVGA 3PFYA 2OU2A 5BNGA 1MBEA 3PUFA 5TJJA 3K4BA 3ONQA 2Z9OA 1NTCA 3I0TA 3ZMTA 2CFXA 3OSFA 5HDNA 2EBIA 2KZVA 2OV7A 3F23A 3V4GA 3HJEA 2Q2EA 1TW2A 3NEUA 2DK8A 3L2VA 1S5LC 3PUBA 1MBGA 3DBRB 3ZQQA 1ETWA 3LWFA 4AU7A 3BDDA 3TOAA 2LLKA 3SJMA 2M1BA 2VN2A 5CVRA 3WE3A 1D0ZA 4ANJA 2BY2A 2BVLA 2WAEA 2X1CA 1EH6A 2H94A 3TKYA 4XIDA 1YRNA 1T0FC 2GBYA 1BOBA 4Y17A 2LY9A 1A35A 4FQGA 5AIPA 1FWZA 4HSTA 1F36A 5IYDJ 3PQJA 2PMZA 2EZIA 4MQVA 4C3HJ 1IGNA 1USSA 1O7LA 1T33A 1QRYA 1TWCJ 1GLNA 3VYTB 3QYFA 2FMYA 5F27A 4IHTA 4EEFG 2HOAA 2NXNB 5FRMA 5E8GA 1LEBA 3JRIA 4I7HA 3GTLJ 2OZUA 5D8LB 4I09A 3DBLB 4S05A 3LSRA 2LK2A 3B02A 2D45A 5FRNA 2OQGA 5FFZA 2PQ8A 3HRUA 1VQNI 2K3PA 4RM3A 2HU9A 2RN7A 4F91B 4XLFA 1W5TA 5DCFA 3K1MA 4UUSB 3JRDA 1YI2I 3BWGA 5HS9A 2CUZA 1D3YA 1JGSA 4KN7X 3MMYB 5CVUA 1YW7A 4C3JJ 5HS7A 4YIFA 5JVGF 4M74A 2O7OA 1HW1A 1W0TA 4YEJA 1Z3XA 2XRLA 3DEEA 2KFDA 1MMSA 4DGWB 2IA2A 1FSHA 2RC4A 4JQFA 3JRCA 3K7AJ 1O7FA 4KYWA 4HG2A 3T0YA 1U9OA 3ZQHA 2H8RA 2K3FA 5EGOB 5FKLA 3Q0WA 2Z3YA 1QVTA 3H9JA 5HVQC 2XAGA 3ECOA 1W0UA 1SFEA 1TNTA 1I3AA 2E1OA 3BQZA 2HWVA 3GTMJ 1HSTA 2DA2A 1ZRDA 3ZGKA 3T8TA 5C4JJ 4EMSA 3KP7A 2VKVA 1ZRFA 4BHBA 2CQQA 1I1SA 3M07A 5JVTA 3OYKA 1D1AA 1Z6RA 3SHFA 1HF0A 5K5OA 2HOSA 2K9SA 4N0BA 2LKPA 4DQ2A 2V9PA 2FOWA 3Q5FA 5JI6A 3F6VA 4M3FA 3GZNB 2YX7A 3EUAA 4PJJA 4Y33A 3BROA 4IEJA 4YFNF 4HA8A 4LLGF 2R7XA 1FP1D 2UXNA 4XRSA 4MEXF 3VSLA 2ICWG 1FX7A 5IP7J 4A3IJ 4JK1X 2X6XA 1BC8C 1GXQA 2BGCA 2DMTA 4X1EA 2WWYA 3GTJJ 2JSCA 2X6YA 2W57A 1ETVA 2DYSH 1RR7A 1OCZH 3BZKA 2A5WA 2KLOA 2L7ZA 4HQMA 3S3MA 4LG0B 2XAHA 5IP6A 1LVKA 1JE8A 2IVMA 2H1LA 2DA4A 5IY5H 4E7LA 3ABKH 3VEPA 2ESHA 4EVIA 4NC8A 1G59A 2HQ5A 3R4KA 1T2KA 1FBQA 3HGYA 1Q1VA 4HBLA 4BJ6C 2L4AA 5E18F 2VODA 1W7PD 1CF7A 2CUEA 3OYCA 1LNWA 5B66C 1PP8F 4CGZA 2HDDA 4GFBA 4LB6B 3CC4I 4XL9A 2CV0A 2A5YB 4I99C 1KU3A 3DU6A 3BR3A 4B48A 2ZC2A 3G2BA 2VE8A 2HDCA 3G3ZA 2VJIA 2ELKA 3IKVA 4XR6A 1ZELA 5J1RA 3BPVA 3OYAA 5BS6A 2ZXIA 3I53A 4Q4ZF 2CV2A 1JJ8C 2XROA 1XGMA 2CW7A 3CF2A 3MQ0A 1ZLKA 1QPMA 3Q3SA 3K4CA 2IA1A 1WQ2A 3H0GJ 3T8RA 4ZTJA 3LL7A 1WKMA 2FUG2 3SXYA 5E17F 2DFHA 2R5YB 1ZLJA 5FLVA 5IT3A 4LMYA 1STZA 3JSPA 4OMYA 2DPUA 1QQIA 3GCMA 3OYFA 5LGNA 3KE2A 4RB1A 3IKTA 3CCJI 2QGUA 4XLAA 2ZSHB 4CCKA 1WSUA 3OR2C 2WADA 5K1YA 1N25A 3LFUA 3GTKJ 2Y75A 2M3AA 4L0YB 2GOMA 2OCCH 1O3QA 1R7JA 3OOUA 3AG4H 3OIPA 1A31A 5D8KB 4IO9F 4PZJA 4WXHA 3CJRB 4R8HA 1O57A 4WXCA 4B47A 1BBYA 1SD4A 2NVUB 3DXJF 2L4MA 2I5UA 1QHGA 5K5QA 2MC4A 5KAIC 3ZRGA 2TCTA 1MBKA 4OAZA 2R7FA 4MLOA 2XV4S 1WWXA 5FLMJ 1LJ9A 3OYGA 3RJPA 1BJAA 3IWZA 2HOEA 2I8DA 1H9GA 5CVIA 1EV7A 2A05A 3WU2C 4P9UA 1K4SA 4BL0B 4F52A 1RESA 1DP3A 2EILH 1UG0A 4AIJA 2XAFA 1H89C 3JRBA 2FNAA 1R23A 4RAZA 5B1BH 3E5QA 1IV6A 2M30A 4ZYDA 4CHUA 4XN0A 4V2GA 4W1UA 1VQ5I 2CWEA 2JPCA 3NARA 1UAAA 4BEHB 2LH9A 3Q0VA 4KIFA 2GM4A 3DBHB 2F5FA 1BR1A 4RLQA 2BXYA 3I4MJ 1MMNA 1YW9A 5BOXA 4XBFA 4MNUA 4M71A 3WE2A 4BE1A 4KITB 4C2MJ 4F92B 5EGOA 3KPHA 2VC0A 2VQHA 3UR3C 4MEYF 4FX0A 4U88A 3LSJA 2QUFA 1ZTRA 3DEWA 2IS1A 1K79A 2JSPA 2EV5A 5AIQA 1S72I 3HC7A 2R93J 1VI0A 3K4KA 3V7RA 3CCUI 1B59A 2EFPA 3RZOJ 2ADUA 2F4OB 3TBIA 1S6LA 5ILSA 2CFOA 1WJFA 3CTAA 2IS4A 1EH7A 4C2TA 3AL0C 1T0FA 3BP8A 2HPIA 5FD5A 1GV5A 1PYVA 2DTRA 1RKTA 1XSDA 1ZG3A 3M4OJ 4HF0A 4A3JJ 2RV8A 3CUQB 1E2XA 1J75A 5CYVA 3V7SA 3MFKA 2K9NA 4BY7J 2QSFX 4Z6YA 2LP0A 1VQ4I 1MJBA 5M5WJ 3PQKA 1H0MA 3BG5A 3FKIJ 3I59B 2IEKA 5FD6A 4KMUX 3A01A 4J01A 2K86A 5DS9A 2HGCA 4HQEA 3OS1A 4PFOA 1WFXA 1IAWA 4IHYA 4Q48A 1QHHD 2DTZA 1K78A 4M6YA 4EGYA 4XMYA 1F4KA 4B8XA 1MD0A 4ESFA 2M2EA 2ZKZA 4KFCA 5L3BA 1YS6A 2M34A 2RQQA 4XKWA 5M5XJ 1AKHB 2JA6J 2VJ4A 3CCLI 2V7FA 3C2HA 3IC7A 3TMOA 2CO5A 1IUYA 3E3VA 2JVHA 2LVSA 5GPAA 3FMQA 4AWXB 3FM5A 1YOVB 2FQ4A 4ZDPA 1NG7A 1WCMJ 3WTSC 2P5KA 1KGSA 3C2BA 3CMAI 3OYLA 2JTVA 1JKRC 2M45A 2YSRA 2Z99A 3BOQA 1DGWY 3LQRA 5D6EA 2NOJB 1R9TJ 1JTYA 1A04A 4OIPF 4BYYA 3K2AA 3OS0A 1ONVA 4DOZA 1SANA 5E79C 2FBKA 5J4VA 3LAJA 1H8AC 1WGXA 4XLCA 2M0CA 2KISA 4B3AA 3GVAA 2XHKA 4L18B 2E2IJ 2CGPA 3H3VK 1Y0UA 2W82A 1VQLI 3W2AA 1BM9A 3BJAA 2BW3B 3NAUA 1Z77A 1EF4A 5E1WA 1G6NA 1HDDC 5C3EJ 1CQTA 2OZ6A 4OOIA 1P7IA 1ON1A 1U5TB 1J0RA 2H8WA 3U1DA 1TNSA 3TO7A 3B6CA 5LEKA 2ZNYA 1MIJA 3HUGB 2XB5A 1BI1A 2GIZA 2EWNA 2QWWA 2DDBA 1Q1HA 2W4SA 3H5RA 4I6ZA 2VT3A 3D5RC 2ZXHA 1HLVA 2XAJA 3NQOA 1MW7A 2CQXA 1GVJA 5CJ9A 3WU0A 5E3OA 2EIMH 1POGA 2HR3A 1NH3A 1OKRA 3ZQ7A 5HDGA 2KIMA 3H3ZA 4I98B 1MBFA 1L0OC 1Z21A 3C18A 3IAS2 4BDZA 2PJPA 5DM6F 3B6AA 4QWQA 5J40A 3CCMI 4X6AJ 3DPUA 2KDOA 1HW5A 2D1VA 3E6MA 3OS2A 3HKZN 4P1WA 3FHZA 4XONA 1HBXG 1QPIA 2AXLA 2VQGA 5M3FJ 5IT9Z 2MD0A 2Y2ZA 3FDYA 4OMZA 1OYWA 2E60A 3O8GA 3Q9SA 4OIRF 4QPQA 3J7AO 4HV6A 3WODF 5EDNA 3QU3A 2HTJA 3SFIA 5LGUA 1XCVA 1YRNB 3JRAA 1G3WA 1NG6A 4L9NA 4BUPA 4IZZA 1RKWA 2NVXJ 2Y48A 6PAXA 4BE2A 1IN4A 1BI0A 2PI0A 1ZKGA 3I5UA 2XGXA 3J7AY 3GW2A 3S32A 3CDHA 1R1TA 4A3DJ 2DMQA 1FYKA 3ZR8X 4NC6A 2P0WA 2AHQA 4TV7A 2ZB9A 2NYXA 5C44J 2L9RA 1OISA 3OYHA 3OYIA 4RDUA 4HX4A 3MN2A 3QWLA 1X3ZB 2VPLA 2YUSA 2NS0A 1IDYA 1IN5A 3HRTA 3FISA 5KCMA 3MKYB 5D4SA 1JHHA 3A03A 3DF8A 1ETXA 2JT1A 1HQCA 2X1DA 2X48A 3SQNA 1O3RA 2RGVA 4KN4X 3TP3A 3D5LA 1JI8A 3HM5A 1XMXA 2NOGA 2JZYA 2PG4A 1WVRA 3GLLA 3HTSB 4QIWN 4LFUA 1IG7A 4BY1J 2R3SA 1QBJA 5TGTA 3KETA 2HVQA 5ICCA 1LQ1A 5D5XB 1Z9CA 2ME6A 4ZZLA 2XSDC 3ZN0A 4IHVA 1RZ4A 4CYCB 3CO6C 4BXFA 4RM2A 3FZVA 2HVRA 2VJ5A 4ESBA 4OIQF 4CA0A 1DQUA 5ICEA 1RIOH 2D1HA 4WXDA 4IX7A 1R00A 2OUMA 1IZ1A 2CG4A 2Q0OA 4M3EA 3WTXC 2PMUA 3IL2A 4BHPA 4M3BA 1AKHA 2BV6A 1G3SA 5CQEA 2FJ1A 3G1LA 2LF7A 1VZ0A 3HRSA 2FBIA 1SFXA 4P5OA 4GYIA 4LGWA 3E7LA 4RBOA 4HLXA 4ENMA 2H1KA 2RVCA 1IV8A 1ZGWA 1T95A 2COBA 3CCSI 1DU6A 3H1CA 2IA0A 1UZCA 2OPTA 2HZTA 4G7ZF 3DKXA 2ZSIB 3Q0UA 3V42A 3ZQIA 2LRDA 1EA3A 3GFMA 1MNEA 2FQ3A 1JUPA 2IAIA 2ACJA 1FC3A 1BC7C 2Y0SN 1OYYA 5EF6A 1LB2A 4P96A 5CKTA 3H36A 1I39A 3LA2A 3H35A 1WJBA 4DIQA 3GTQJ 1MDMA 1R1VA 3BR6A 3RYRA 5DDGA 1E3OC 2OAZA 4IRHA 3V8LA 2P81A 2ME0A 1O3TA 5IPAA 3QOEA 1X58A 2DA6A 1ZAOA 1F43A 4LOCA 2LNBA 2W25A 2DO7A 2Q8KA 2M7BA 4BQAA 4MO7A 2L7KA 2MW8A 5DUKA 5FKOA 1CF7B 3BQYA 1BR2A 2VL8A 1IRXA 3FM3A 3P5JA 2E2HJ 4KISA 1S7OA 1RR8C 1J9IA 2FU4A 3PIPF 3BR0A 4D7NA 3AG2H 3DQVC 4LK0F 3JTHA 1SVOA 4C9YA 3S3NA 2Z1DA 3I54A 5CVJA 3ZOBA 2STWA 2XSJC 2OA4A 3ZQLA 4BNCA 2P5VA 4IPAA 3WHBA 2HTSA 2XPWA 2BY1A 4BQNA 2Y0SA 3VODA 1YIJI 1SD7A 2PFBA 1FOYA 1TWAJ 2A69F 3BR5A 2H6BA 2BXZA 2JPBA 1ULYA 2K02A 2XC7A 3D1NI 1YX5A 3ISPA 1ZN2A 5BQTA 2IGKA 2E1CA 4II3A 4XKVA 1IRZA 3N05A 5HNFA 4XRSG 3WTTC 3GWZA 1XG1A 4D0PA 2V6CA 4EJOA 2O9LA 1I5ZA 3PL8A 1HSJA 1QGPA 1WPKA 4RGXA 2M7AA 5A2QZ 2HKXA 1ITYA 1ON2A 2V4JC 3H92A 2WY7Q 5ICGA 3VPRA 1UMQA 4ENJA 3S2WA 3CZ6A 3F0CA 1YX3A 2W24A 2H09A 1M1EB 4QTRA 4F3QA 3BJ6A 1APLC 3BJOA 2P7CB 1T6SA 4HNTA 2EK5A 1FLIA 1RRJA 4BQOA 3OOPA 2DXIA 2IPQX 5FFXA 1ODDA 2V1UA 3KZYA 1I50J 3S1RJ 2UUZA 1JKQC 1HKQA 1MNMC 5ICFA 1RI7A 4EM0B 2QF7A 4BGDA 3O2PE 2LY2A 4S0HB 2BY0A 3H3UA 2X9DA 4NB5A 5D5UB 3HOYJ 1IRFA 3K4LA 3RKYA 1VQ7I 5BPDA 1ACIA 3QU6A 2NVYJ 4C3IJ 2MH2A 1FSEA 1IW7F 1SMTA 3I3LA 3RPQA 3WGHA 4R79A 1PDNC 1WHUA 1E17A 2A61A 2VJJA 1TZLA 4HX7A 1X1PA 2ZXJA 3FXKA 5EG0A 3HIFA 3LSGA 1MSEC 5GP9A 2HFHA 1XD7A 2CQNA 2E7WA 3MD2A 2DQRA 4GO1A 4AVZA 3FXRA 3M7GA 2FRHA 2EA2A 1FTZA 3CLQA 2VKDA 1TL8A 5FJ8J 2O5RA 3I71A 2NVQJ 1MH4A 2FMLA 1A6IA 4FE4A 4CYCA 4G6TB 4AM3A 2BHZA 2MA3A 3QP6A 1JKOC 1GHCA 3DPTA 3ZXSA 2LF8A 5K7FA 2NNYA 3BPXA 2VB6A 3FBIB 1IXCA 4M9SA 1KU7A 4I0AA 3KFWX 1FBUA 5LGTA 3PNYA 3HOUJ 3FF5A 4XKBA 3KP2A 3OYEA 3S16J 5FLXZ 1U78A 2AS5F 2E71A 2A07F 1XB4A 3BG3A 4M6VA 4G7HF 2FD5A 1WI3A 3E97A 1YIOA 3HHGA 3QPSA 3RSNA 2LR8A 3RDIA 3ZCOA 3I55I 4OU0A 2VBYA 1R5ID 3GMEA 4XM3A 4MTDA 2P6TA 4CCLA 5F6FA 1EJ9A 1X4OA 3H5AA 4Y3OA 4FETA 4L5EA 5DUIA 2X51A 1IO2A 3CD6I 1A5JA 2AXTC 1FMWA 3FWEA 2XPUA 2XRNA 2DAOA 4UVBA 3A01B 1JT6A 3IAM2 3AG1H 1U8RA 2HXIA 2F5EA 4AC0A 2P7VB 1K78B 4G12A 3MCZA 3JRGA 3U21A 1NK3P 4A3GJ 1TQMA 1JTXA 4EJTA 1FPQA 1WJ5A 2R7UA 2R7WA 2X0LA 3RQ4A 2DPDA 4D5CA 2ISYA 2G7HA 3MKZA 2NRAC 1ERDA 4U0WA 1JUSA 2COMA 1T39A 2RAEA 1XCBA 2QM3A 2VLAA 1UJ8A 1U9NA 3F72A 2TDXA 2KPMA 1Y1VJ 4M9ZA 2ZJ2A 1YW8A 3BC8A 3QAHA 4CZZA 2GLOA 4LIUA 5LFAA 3HOSA 3OYJA 3GTPJ 2IS6A 4ZDLA 5FB2A 4BACA 5HLIA 2L9NA 2MYSA 1BL0A 3A02A 2CRGA 3PNTA 2DDAA 2Y9YA 1W4MA 1AA7A 3ULQB 4B09A 4MTEA 1KONA 5A2QK 2ZJQF 3EUHC 3AKZA 1WJDA 4MFEA 1ZGAA 1SFOJ 2VOPA 2YU3A 3EQLF 2WB1A 3G1OA 1OPCA 4FHTA 3T5XA 1A6QA 4M73A 1F9NA 2C6YA 1MKMA 1QNTA 1V5FA 1XMKA 3VYSB 2WAQA 1KZHA 1RNLA 4DNCA 4RLFA 3FXJA 4IKFA 3OV8A 3OL4A 2XIGA 2VKHA 2EZHA 3OMYA 4HZFA 3V7CA 4U7BA 4ASNA 1DU0A 4RA2A 3DKYA 3W6JB 1H9TA 3LFKA 4BXXJ 4B43A 5K5RA 2CW0F 3DP7A 3OYMA 2EIJH 3BTCA 5IYCJ 2QYOA 3RKWA 2BEOA 3QYBA 3F8NA 3TDZC 3S1NJ 2GXGA 1ZR2A 3T1BA 3WGIA 1FEXA 1K7AA 2RKHA 2HVSA 2M4GA 1V4RA 4P55A 2BOLA 2FE3A 2IGMA 4BAYA 1K83J 1YQAA 1MJ9A 4YFXF 4AD9A 5K7ZA 1Z0XA 3L2QA 5J8FA 1B72A 1PJRA 2QQAA 2RDPA 5CLSA 3R61A 3QPHA 4HW0A 3GTOJ 3VOEA 4E7HA 3LSTA 3CUQC 1SMYF 5F64A 4PGHA 3WTUC 1XC5A 2XF6A 3KYDB 3W6VA 3ZMUA 2DLLA 2M8EA 3F8FA 3LQQA 3J7YJ 3TQNA 3FXLA 2GZWA 2LFBA 5DTDA 3FBNB 1ORKA 4RAYA 4Y7NJ 5FLXK 2A6HF 3KEOA 1I27A 2YU9J 3GF2A 4JX5A 4CSWA 1D5VA 1K4TA 1XMAA 1FIAA 2TRTA 1YE9A 3GLXA 4M3GA 2VPRA 1X1AA 3WG7H 4NDLA 1TWHJ 2HYFA 1U8BA 2HNHA 1XS9A 1BIBA 2IW5A 1UELB
chains in the Genus database with same CATH topology
2K4JA 2HEOA 5H6RA 1UHMA 2OD5A 2EJRA 1U6GA 4HOBA 4A6EA 4BXUA 4M72A 4ENKA 3CUOA 5L3FA 1Z05A 2HQNA 4YFKF 1SD5A 2KJBA 3TO6A 5E1ZB 5L3DA 2OBPA 4ZZDA 4BHCA 2LSOA 2CQKA 1P2FA 5H6QA 4MQ9F 1GXPA 1W7PA 4WX9A 1ZG5A 3RI4A 1P6RA 5BMZA 1R5GA 3QOPA 4L0ZB 3MEXA 1U3EM 2DT5A 3R6SA 2IP2A 4G8XA 4G6DA 2L54A 3U2RA 4KDPA 2FA5A 4EV0A 3ABTA 2KIFA 2XKOA 5D5VB 4XSZF 4NHJA 1YYVA 3V8JA 4GYGA 2IT0A 4L9JA 2QZ8A 5HDKA 1XN7A 1K6OA 5FGMA 4EM2A 1MDMB 1EH8A 2L02A 4A2UA 4HX8A 3HSEA 1D8JA 1LEAA 1UFMA 1UB9A 2PBIA 2EV6A 3ROUA 4YIIA 3GZ5A 4RB0A 4LJZF 3ZMSA 3KP4A 2HYGD 4UXNA 4LLLA 3SZTA 2A68F 1Z1DA 5HOOA 2P6SA 2XAQA 2K4BA 3P9KA 3SFZA 3HHHA 3B73A 1SAXA 2R7DA 3GZ6A 1D8KA 4EGZA 1HKSA 1DP7P 5ERIA 5EEHA 2KIUA 5JHUA 5CVVA 4XLPF 5D4RA 4G6QA 3FX3A 1FYLA 1LDJA 1G3YA 2VE9A 3L09A 3EUHA 2UWMA 2FBHA 1BIAA 3ML6A 4I0BA 2RQPA 3LA7A 4L9VA 3GX4X 5ED4A 4ZYGA 2IRFG 1IN8A 3ZPLA 3GEZA 1HW2A 4UV8A 3QP5A 2P5LC 1TQIA 3VFZA 3E6CC 5DEQA 3F22A 4IRIA 3ERED 2MD5A 3MZYA 3HOTA 4L9TA 4A0YA 2V79A 1IRGA 2EB7A 4Z2YA 2DW4A 3ZMVA 3I64A 2VC1A 1YS7A 1BOAA 2FEZA 1JHFA 3E6DA 4L5IA 3IHUA 2KRFA 3NRVA 1T98A 3WGGA 1W5SA 2ELHA 2M5WA 2O61A 3WU1B 3P9IA 3G73A 2Y0MA 3KLNA 4XSXF 2EA4A 4EJUA 1KYWA 4PGGA 2VOOA 3RKXA 3C3WA 3C7JA 4A5NA 2JRTA 1DPRA 3CJNA 3O6BB 5L3CA 2UZKA 2EFNA 2F2EA 5LHHA 1IXSB 1QZYA 2O8XA 3F8BA 5FO5A 3AAFA 2MBFA 2F5CA 1YTYA 3FMSA 3SZPA 3K69A 4N9HA 2FF4A 4ON0A 3WTZA 1ZYRF 4G94A 5IT9K 1X3UA 4E70A 2QQBA 5HS8A 2H6CA 2ZMEA 3K1NA 4IHSA 3HSFA 4RB3C 2O0YA 4O3MA 2EV0A 5DCMA 4A12A 2QBYB 2ZBKA 4I2OA 4IRGA 4BH9A 4ZH4F 4I01A 1KA8A 2O03A 1R36A 1XGNA 2PLYA 3DV8A 2MC3A 2GA1A 4RB2C 4N9IA 1USTA 3DPLC 1FBSA 4Y13A 1WRJA 1WI9A 4CICA 3GO5A 3K1PA 2D2WA 5KK1A 2WC2A 2P4WA 4U7DA 1REPC 1RUNA 4EQQA 4MGRA 4QLCU 1AWCA 2EFOA 5JR3A 4RGSA 4CDGA 2QLZA 3O3KA 3QPTA 3QRFF 1KU9A 1KYZA 2DBBA 2STTA 3C1DA 5H20A 1R5HA 4PCQA 2B0LA 1Z6TA 2FOKA 1MJAA 4P9FA 3KLOA 1B9MA 3MZHA 1LDDA 3L9FA 2DQLA 2GAUA 5TRDA 1O3SA 5KVRA 4UVAA 3KZZA 4HF1A 4IJAA 3EYIA 1YG2A 1PUEE 4A0ZA 2HKOA 4WWCA 3I4PA 1V3FA 5L3GA 3ABUA 1W7PB 4H0EA 4FT8A 1ZHFA 3WTWC 1OMIA 3GUDA 1VTNC 3MAJA 4ESJA 5JFRA 2VT2A 1KQ9A 1S8NA 4UV9A 2XVCA 4XRFA 3JAMZ 5AONA 1ZG1A 3BZ6A 3M8EA 3ZMZA 2L01A 2WTEA 3J80Z 1XDSA 3COAC 1DDNA 2YR2A 2MH9A 2YPRA 5E8IA 5J6XA 4KIBA 3IWFA 4G7OF 3R60A 2V1DA 2WV0A 2ISZA 1TQPA 2W84A 4LD5A 3U9GA 1SD6A 4CO8A 3R0JA 4GXOA 4RGUA 3JSOA 3L7WA 3ZN1A 1HKTA 1BI3A 3MWMA 2HQRA 4RGRA 4IXAA 1MZBA 3N4MA 3HTUA 2QBYA 2GA2A 3I58A 1I6XA 2V1XA 5DD4A 4UVCA 3WTYC 2OQRA 3TOBA 2NNNA 3KP5A 4HYEA 1OYIA 1C0WA 2G7UA 4U0YA 2VBZA 4HDUA 4RS8A 5D6FA 2P8TA 3FXQA 2DK5A 5ILVA 2KJCA 2Z33A 4HV5A 1UCRA 1R1UA 2GXBA 2E7XA 1XSXA 3J81Z 5LHGA 1BN5A 3P7NA 3L2CA 4NQWA 4EJVA 3K0LA 1B9NA 2V9VA 1IN6A 2O3FA 3KCCA 1XDUA 1FNNA 2ZCWA 5BPIA 2CYYA 1P4WA 3EDPA 1DPUA 1SFUA 2BE5F 4IVNA 1YFHA 1B1BA 2A6EF 5E20A 5L3EA 1DUXC 1TW3A 3CLOA 3RIRA 2ESNA 5LEJA 1QZZA 3LAPA 3GXOA 4LB5A 2QQ9A 4G9YA 5HLGA 2IJLA 2E1NA 5D5WB 2EFQA 2G9WA 2F5DA 3JAMK 3GFJA 1ZGJA 4S04A 2J5PA 2M87A 3J80K 2YX4A 3TO9A 3IRRA 4IF4A 1J59A 3HSRA 1F5TA 3GFLA 1LDKB 4Q5SF 3F3XA 2GQQA 4KICA 2K27A 4KMFA 2GWRA 3EYYA 1U5TC 1KQ0A 3RYPA 1P4AA 3ZMDA 1P92A 4LK1F 2ETHA 2A3SA 1Z91A 2XUBA 1L3LA 3F8MA 4LG0A 2K7LA 1FZPB 2NAZA 4AIHA 2ZNZA 5HLHA 2XKPA 1XSVA 1AOYA 2LDUA 5EEGA 3JW4A 2ZFWA 1J5YA 1TBXA 3L00A 4CXFA 2VONA 3E5XA 1RUOA 1IXRC 3FMRA 1P4XA 2BBYA 4KT5C 1R58A 3WTVC 4HF2A 3FXUA 2MLGA 4KIGA 5LLQA 3R0AA 1FY7A 4EJWA 4O6JA 1I1GA 4ETSA 4OIOF 4M6XA 3HYIA 2RNJA 4EM1A 1QO0D 3J81K 3E6BA 4ZYHA 2DFIA 4GCVA 3GYHX 2BYVE 3K9TA 3EETA 4GGGA 2ZMEB 2J5OA 3KEQA 3F6OA 2X4HA 3IRQA 3KP6A 5DCMB 2QENA 3TGNA 1PP7U 4FX4A 2DU9A 3ECHA 2HS5A 4HLYA 2KKOA 4UNOA 2VBWA 2MLKA 3DKWA 4L5JA 3V8KA 2ZO4A 1XGSA 1KU2A 1T38A 4U0VA 3M1EA 1G4DA 2UXXA 3E5UA 3M8FA 1R22A 2XASA 2VXZA 3RTRA 1KQ8A 4KA4A 4AVPA 2GIVA 4WCGA 4MHGA 2FSWA 2VBXA 3WG9A 3P9CA 3F8CA 3KP3A 2H27A 1IF1A 4HAMA 4KUMA 4O5VA 2FNPA 1B4AA 1YO5C 2EFWA 1S7AA 5DV5A 3BY6A 2PEXA 3D0SA 4OINF 1S29A 1JXSA 3LA3A 1F1ZA 3REOA 3ZP5A 3M9AA 3GFIA 3JTGA 1LVAA 1FP2A 4M9XA 5LRSA 4WF2A 5E1XA 3CUQA 4LLNA 3W6KB 3DFGA 1NHAA 1ZH5A 2L3DA 2O6GE 2PMHA 4JBAA 1ZRCA 3I59A 1IN7A 3CO7C 4Y15A 1OR7A 4KNYA 2FXAA 5ILUA 3PFIA 3N97A 4R1HA 1FYMA 1ZREA 1TTYA 4ENNA 3Q9VA 4ZYEA 2CSOA 1CGPA 4CYDA 4HDVA 1B6AA 1S3JA 5LHIA 2DI3A 4XLNF 1XGOA 4WK8F 5LBQA 1MGTA 1FT9A 1J7KA 1FOKA 1G3TA 5F1RA 4Q47A 2W85A 3TDUC 3HRMA 4I02A 2PN6A 1TLHB 2QVOA 4YG2F 4A5MA 1U2WA 4AIKA 5J8CA 5LRRA 4PDKA 1UHWA 1U5TA 5DYMA 3HUGA 1ZARA 3F21A 3VB2A 4UUVA 3DEUA 4F7ZA 1BI2A 1J2XA 4A6DA 2Z5UA 1HXDA 4K2EA 3RPUA 1YLFA 1Z7UA 4A0XA 3K2ZA 3ELKA 5DD8A 4UHTA 2OU2A 5TJJA 2Z9OA 3I0TA 3ZMTA 2CFXA 5HDNA 3F23A 3V4GA 2Q2EA 1TW2A 3NEUA 2DK8A 3LWFA 3BDDA 3TOAA 2M1BA 2VN2A 5CVRA 3WE3A 1EH6A 2H94A 3TKYA 4Y17A 5AIPA 1FWZA 3PQJA 4MQVA 1USSA 1O7LA 4IHTA 2FMYA 5E8GA 1LEBA 4I7HA 2OZUA 5D8LB 4I09A 4S05A 3B02A 2D45A 2OQGA 5FFZA 2PQ8A 3HRUA 2RN7A 5DCFA 1W5TA 3K1MA 3BWGA 5HS9A 1D3YA 1JGSA 4KN7X 5CVUA 4YIFA 1YW7A 5HS7A 4M74A 1HW1A 2IA2A 1FSHA 2RC4A 4JQFA 1O7FA 4KYWA 3T0YA 2Z3YA 5HVQC 2XAGA 3ECOA 1SFEA 1TNTA 2HWVA 1HSTA 1ZRDA 3T8TA 4EMSA 3KP7A 1ZRFA 4BHBA 1I1SA 5JVTA 1Z6RA 3SHFA 5K5OA 4N0BA 2LKPA 4DQ2A 3Q5FA 5JI6A 3F6VA 2YX7A 3BROA 4YFNF 4HA8A 4LLGF 1FP1D 2UXNA 4MEXF 1FX7A 4JK1X 1BC8C 1GXQA 2BGCA 2WWYA 2JSCA 2W57A 4HQMA 4LG0B 2XAHA 1JE8A 2IVMA 3VEPA 2ESHA 4EVIA 3R4KA 1T2KA 1FBQA 4HBLA 2L4AA 5E18F 2VODA 1W7PD 1CF7A 1LNWA 1PP8F 4CGZA 4LB6B 2A5YB 1KU3A 2VE8A 2HDCA 3G3ZA 3IKVA 3BPVA 5BS6A 3I53A 4Q4ZF 2XROA 1XGMA 3MQ0A 1ZLKA 1QPMA 2IA1A 1WQ2A 3T8RA 1WKMA 3SXYA 5E17F 1ZLJA 5IT3A 4LMYA 1STZA 3JSPA 4OMYA 2DPUA 1QQIA 5LGNA 3KE2A 4RB1A 3IKTA 1WSUA 5K1YA 2Y75A 4L0YB 1O3QA 1R7JA 5D8KB 4PZJA 4WXHA 4R8HA 1O57A 4WXCA 1BBYA 1SD4A 3DXJF 2L4MA 5K5QA 2R7FA 2XV4S 1WWXA 1LJ9A 3RJPA 1BJAA 3IWZA 2HOEA 1H9GA 5CVIA 1EV7A 4P9UA 4AIJA 2XAFA 2FNAA 1R23A 4RAZA 3E5QA 2M30A 4ZYDA 4CHUA 2CWEA 2JPCA 4KIFA 2F5FA 1YW9A 5BOXA 4XBFA 4MNUA 4M71A 3WE2A 2VC0A 4MEYF 4FX0A 4U88A 2QUFA 1K79A 2EV5A 5AIQA 3V7RA 1B59A 2EFPA 2ADUA 1S6LA 5ILSA 3CTAA 1EH7A 1T0FA 3BP8A 5FD5A 2DTRA 1XSDA 1ZG3A 4HF0A 2RV8A 3CUQB 1E2XA 1J75A 5CYVA 3V7SA 3MFKA 1MJBA 3PQKA 1H0MA 3I59B 5FD6A 4KMUX 2K86A 2HGCA 4HQEA 1IAWA 4Q48A 1K78A 4M6YA 4EGYA 1F4KA 4B8XA 1MD0A 4ESFA 2ZKZA 4KFCA 5L3BA 1YS6A 3IC7A 2CO5A 1IUYA 3E3VA 3FMQA 4AWXB 3FM5A 3WTSC 2P5KA 1KGSA 2JTVA 2M45A 2YSRA 2Z99A 3BOQA 3LQRA 5D6EA 1A04A 4OIPF 4BYYA 1ONVA 2FBKA 3LAJA 3GVAA 2XHKA 4L18B 2CGPA 1Y0UA 1BM9A 3BJAA 5E1WA 1G6NA 2OZ6A 4OOIA 1ON1A 1U5TB 1J0RA 3U1DA 1TNSA 3TO7A 5LEKA 2ZNYA 1BI1A 2EWNA 2QWWA 1Q1HA 2VT3A 2XAJA 3NQOA 1GVJA 5CJ9A 3WU0A 2HR3A 1OKRA 3ZQ7A 5HDGA 2KIMA 3H3ZA 4I98B 1L0OC 3C18A 2PJPA 4QWQA 1HW5A 2D1VA 3E6MA 3FHZA 1HBXG 2AXLA 5IT9Z 4OMZA 1OYWA 3Q9SA 4OIRF 3J7AO 4HV6A 3WODF 3QU3A 2HTJA 5LGUA 1XCVA 1G3WA 4L9NA 6PAXA 2Y48A 1IN4A 1BI0A 2PI0A 3I5UA 2XGXA 3GW2A 3CDHA 1R1TA 1FYKA 4TV7A 2NYXA 4HX4A 2NS0A 1IN5A 3HRTA 5D4SA 1JHHA 3DF8A 2JT1A 1HQCA 3SQNA 1O3RA 2RGVA 4KN4X 3D5LA 2JZYA 2PG4A 3HTSB 4LFUA 2R3SA 1QBJA 3KETA 5ICCA 1LQ1A 5D5XB 1Z9CA 4ZZLA 3ZN0A 1RZ4A 3CO6C 3FZVA 4ESBA 4OIQF 5ICEA 1RIOH 2D1HA 4WXDA 1R00A 1IZ1A 2CG4A 2Q0OA 3WTXC 2PMUA 3IL2A 4BHPA 2BV6A 1G3SA 2LF7A 3HRSA 2FBIA 1SFXA 4P5OA 4GYIA 4LGWA 4ENMA 4HLXA 2RVCA 2IA0A 2HZTA 4G7ZF 3GFMA 2FQ3A 2ACJA 1FC3A 1BC7C 1LB2A 1OYYA 4P96A 3LA2A 1MDMA 1R1VA 3RYRA 5DDGA 2OAZA 4IRHA 3V8LA 1O3TA 1ZAOA 2LNBA 2W25A 2DO7A 2Q8KA 4BQAA 5DUKA 1CF7B 3FM3A 1S7OA 1J9IA 2FU4A 3DQVC 4LK0F 3JTHA 2STWA 3I54A 5CVJA 2OA4A 4BNCA 2P5VA 4IPAA 2HTSA 3VODA 1SD7A 2PFBA 2A69F 2H6BA 2JPBA 1ULYA 2K02A 3ISPA 1ZN2A 5BQTA 2E1CA 3WTTC 3GWZA 4D0PA 2V6CA 4EJOA 1I5ZA 1HSJA 1QGPA 4RGXA 5A2QZ 2HKXA 1ON2A 3H92A 5ICGA 4ENJA 3S2WA 2W24A 2H09A 3BJ6A 3BJOA 2P7CB 1T6SA 2EK5A 1FLIA 3OOPA 2IPQX 5FFXA 1ODDA 2V1UA 3KZYA 1HKQA 5ICFA 1RI7A 4EM0B 3O2PE 3H3UA 4NB5A 5D5UB 1IRFA 3RKYA 5BPDA 3QU6A 2MH2A 1FSEA 1IW7F 1SMTA 3RPQA 3WGHA 4R79A 1PDNC 1E17A 2A61A 4HX7A 2ZXJA 3HIFA 2HFHA 1XD7A 2E7WA 2DQRA 4GO1A 3FXRA 3M7GA 2FRHA 2EA2A 3I71A 2FMLA 2MA3A 3QP6A 1GHCA 3DPTA 2LF8A 2NNYA 3BPXA 4M9SA 1IXCA 1KU7A 4I0AA 3KFWX 1FBUA 5LGTA 3FF5A 3KP2A 5FLXZ 1U78A 2AS5F 2A07F 1XB4A 4G7HF 3E97A 1YIOA 3HHGA 3RDIA 4OU0A 2VBYA 4MTDA 2P6TA 5F6FA 5DUIA 3FWEA 2XRNA 2DAOA 4UVBA 1U8RA 2F5EA 2P7VB 1K78B 3MCZA 1TQMA 4EJTA 1FPQA 2X0LA 2DPDA 2ISYA 2G7HA 2NRAC 4U0WA 2COMA 1T39A 1XCBA 2QM3A 3F72A 2TDXA 4M9ZA 2ZJ2A 1YW8A 3QAHA 4CZZA 3HOSA 5FB2A 5HLIA 1W4MA 3ULQB 4B09A 4MTEA 5A2QK 1ZGAA 2VOPA 2YU3A 3EQLF 1OPCA 4FHTA 3T5XA 4M73A 2C6YA 1F9NA 1MKMA 1QNTA 1XMKA 1RNLA 4DNCA 3OV8A 2XIGA 4HZFA 3V7CA 4U7BA 4ASNA 3W6JB 1H9TA 3LFKA 5K5RA 2CW0F 3DP7A 2QYOA 3RKWA 2BEOA 3F8NA 3TDZC 2GXGA 3T1BA 3WGIA 1K7AA 2RKHA 1V4RA 4P55A 2FE3A 4BAYA 1YQAA 1MJ9A 4YFXF 4AD9A 5J8FA 2QQAA 2RDPA 5CLSA 3R61A 3QPHA 4HW0A 3VOEA 3LSTA 3CUQC 1SMYF 5F64A 4PGHA 3WTUC 3ZMUA 2DLLA 2M8EA 3F8FA 3LQQA 3TQNA 2GZWA 4RAYA 5FLXK 2A6HF 3KEOA 1I27A 3GF2A 1D5VA 1XMAA 3GLXA 2HYFA 1BIBA 2IW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K4J A;  2HEO A;  5H6R A;  1UHM A;  2OD5 A;  2EJR A;  1U6G A;  4HOB A;  4A6E A;  4BXU A;  4M72 A;  4ENK A;  3CUO A;  5L3F A;  1Z05 A;  2HQN A;  4YFK F;  1SD5 A;  2KJB A;  3TO6 A;  5E1Z B;  5L3D A;  2OBP A;  4ZZD A;  4BHC A;  2LSO A;  2CQK A;  1P2F A;  5H6Q A;  4MQ9 F;  1GXP A;  1W7P A;  4WX9 A;  1ZG5 A;  3RI4 A;  1P6R A;  5BMZ A;  1R5G A;  3QOP A;  4L0Z B;  3MEX A;  1U3E M;  2DT5 A;  3R6S A;  2IP2 A;  4G8X A;  4G6D A;  2L54 A;  3U2R A;  4KDP A;  2FA5 A;  4EV0 A;  3ABT A;  2KIF A;  2XKO A;  5D5V B;  4XSZ F;  4NHJ A;  1YYV A;  3V8J A;  4GYG A;  2IT0 A;  4L9J A;  2QZ8 A;  5HDK A;  1XN7 A;  1K6O A;  5FGM A;  4EM2 A;  1MDM B;  1EH8 A;  2L02 A;  4A2U A;  4HX8 A;  3HSE A;  1D8J A;  1LEA A;  1UFM A;  1UB9 A;  2PBI A;  2EV6 A;  3ROU A;  4YII A;  3GZ5 A;  4RB0 A;  4LJZ F;  3ZMS A;  3KP4 A;  2HYG D;  4UXN A;  4LLL A;  3SZT A;  2A68 F;  1Z1D A;  5HOO A;  2P6S A;  2XAQ A;  2K4B A;  3P9K A;  3SFZ A;  3HHH A;  3B73 A;  1SAX A;  2R7D A;  3GZ6 A;  1D8K A;  4EGZ A;  1HKS A;  1DP7 P;  5ERI A;  5EEH A;  2KIU A;  5JHU A;  5CVV A;  4XLP F;  5D4R A;  4G6Q A;  3FX3 A;  1FYL A;  1LDJ A;  1G3Y A;  2VE9 A;  3L09 A;  3EUH A;  2UWM A;  2FBH A;  1BIA A;  3ML6 A;  4I0B A;  2RQP A;  3LA7 A;  4L9V A;  3GX4 X;  5ED4 A;  4ZYG A;  2IRF G;  1IN8 A;  3ZPL A;  3GEZ A;  1HW2 A;  4UV8 A;  3QP5 A;  2P5L C;  1TQI A;  3VFZ A;  3E6C C;  5DEQ A;  3F22 A;  4IRI A;  3ERE D;  2MD5 A;  3MZY A;  3HOT A;  4L9T A;  4A0Y A;  2V79 A;  1IRG A;  2EB7 A;  4Z2Y A;  2DW4 A;  3ZMV A;  3I64 A;  2VC1 A;  1YS7 A;  1BOA A;  2FEZ A;  1JHF A;  3E6D A;  4L5I A;  3IHU A;  2KRF A;  3NRV A;  1T98 A;  3WGG A;  1W5S A;  2ELH A;  2M5W A;  2O61 A;  3WU1 B;  3P9I A;  3G73 A;  2Y0M A;  3KLN A;  4XSX F;  2EA4 A;  4EJU A;  1KYW A;  4PGG A;  2VOO A;  3RKX A;  3C3W A;  3C7J A;  4A5N A;  2JRT A;  1DPR A;  3CJN A;  3O6B B;  5L3C A;  2UZK A;  2EFN A;  2F2E A;  5LHH A;  1IXS B;  1QZY A;  2O8X A;  3F8B A;  5FO5 A;  3AAF A;  2MBF A;  2F5C A;  1YTY A;  3FMS A;  3SZP A;  3K69 A;  4N9H A;  2FF4 A;  4ON0 A;  3WTZ A;  1ZYR F;  4G94 A;  5IT9 K;  1X3U A;  4E70 A;  2QQB A;  5HS8 A;  2H6C A;  2ZME A;  3K1N A;  4IHS A;  3HSF A;  4RB3 C;  2O0Y A;  4O3M A;  2EV0 A;  5DCM A;  4A12 A;  2QBY B;  2ZBK A;  4I2O A;  4IRG A;  4BH9 A;  4ZH4 F;  4I01 A;  1KA8 A;  2O03 A;  1R36 A;  1XGN A;  2PLY A;  3DV8 A;  2MC3 A;  2GA1 A;  4RB2 C;  4N9I A;  1UST A;  3DPL C;  1FBS A;  4Y13 A;  1WRJ A;  1WI9 A;  4CIC A;  3GO5 A;  3K1P A;  2D2W A;  5KK1 A;  2WC2 A;  2P4W A;  4U7D A;  1REP C;  1RUN A;  4EQQ A;  4MGR A;  4QLC U;  1AWC A;  2EFO A;  5JR3 A;  4RGS A;  4CDG A;  2QLZ A;  3O3K A;  3QPT A;  3QRF F;  1KU9 A;  1KYZ A;  2DBB A;  2STT A;  3C1D A;  5H20 A;  1R5H A;  4PCQ A;  2B0L A;  1Z6T A;  2FOK A;  1MJA A;  4P9F A;  3KLO A;  1B9M A;  3MZH A;  1LDD A;  3L9F A;  2DQL A;  2GAU A;  5TRD A;  1O3S A;  5KVR A;  4UVA A;  3KZZ A;  4HF1 A;  4IJA A;  3EYI A;  1YG2 A;  1PUE E;  4A0Z A;  2HKO A;  4WWC A;  3I4P A;  1V3F A;  5L3G A;  3ABU A;  1W7P B;  4H0E A;  4FT8 A;  1ZHF A;  3WTW C;  1OMI A;  3GUD A;  1VTN C;  3MAJ A;  4ESJ A;  5JFR A;  2VT2 A;  1KQ9 A;  1S8N A;  4UV9 A;  2XVC A;  4XRF A;  3JAM Z;  5AON A;  1ZG1 A;  3BZ6 A;  3M8E A;  3ZMZ A;  2L01 A;  2WTE A;  3J80 Z;  1XDS A;  3COA C;  1DDN A;  2YR2 A;  2MH9 A;  2YPR A;  5E8I A;  5J6X A;  4KIB A;  3IWF A;  4G7O F;  3R60 A;  2V1D A;  2WV0 A;  2ISZ A;  1TQP A;  2W84 A;  4LD5 A;  3U9G A;  1SD6 A;  4CO8 A;  3R0J A;  4GXO A;  4RGU A;  3JSO A;  3L7W A;  3ZN1 A;  1HKT A;  1BI3 A;  3MWM A;  2HQR A;  4RGR A;  4IXA A;  1MZB A;  3N4M A;  3HTU A;  2QBY A;  2GA2 A;  3I58 A;  1I6X A;  2V1X A;  5DD4 A;  4UVC A;  3WTY C;  2OQR A;  3TOB A;  2NNN A;  3KP5 A;  4HYE A;  1OYI A;  1C0W A;  2G7U A;  4U0Y A;  2VBZ A;  4HDU A;  4RS8 A;  5D6F A;  2P8T A;  3FXQ A;  2DK5 A;  5ILV A;  2KJC A;  2Z33 A;  4HV5 A;  1UCR A;  1R1U A;  2GXB A;  2E7X A;  1XSX A;  3J81 Z;  5LHG A;  1BN5 A;  3P7N A;  3L2C A;  4NQW A;  4EJV A;  3K0L A;  1B9N A;  2V9V A;  1IN6 A;  2O3F A;  3KCC A;  1XDU A;  1FNN A;  2ZCW A;  5BPI A;  2CYY A;  1P4W A;  3EDP A;  1DPU A;  1SFU A;  2BE5 F;  4IVN A;  1YFH A;  1B1B A;  2A6E F;  5E20 A;  5L3E A;  1DUX C;  1TW3 A;  3CLO A;  3RIR A;  2ESN A;  5LEJ A;  1QZZ A;  3LAP A;  3GXO A;  4LB5 A;  2QQ9 A;  4G9Y A;  5HLG A;  2IJL A;  2E1N A;  5D5W B;  2EFQ A;  2G9W A;  2F5D A;  3JAM K;  3GFJ A;  1ZGJ A;  4S04 A;  2J5P A;  2M87 A;  3J80 K;  2YX4 A;  3TO9 A;  3IRR A;  4IF4 A;  1J59 A;  3HSR A;  1F5T A;  3GFL A;  1LDK B;  4Q5S F;  3F3X A;  2GQQ A;  4KIC A;  2K27 A;  4KMF A;  2GWR A;  3EYY A;  1U5T C;  1KQ0 A;  3RYP A;  1P4A A;  3ZMD A;  1P92 A;  4LK1 F;  2ETH A;  2A3S A;  1Z91 A;  2XUB A;  1L3L A;  3F8M A;  4LG0 A;  2K7L A;  1FZP B;  2NAZ A;  4AIH A;  2ZNZ A;  5HLH A;  2XKP A;  1XSV A;  1AOY A;  2LDU A;  5EEG A;  3JW4 A;  2ZFW A;  1J5Y A;  1TBX A;  3L00 A;  4CXF A;  2VON A;  3E5X A;  1RUO A;  1IXR C;  3FMR A;  1P4X A;  2BBY A;  4KT5 C;  1R58 A;  3WTV C;  4HF2 A;  3FXU A;  2MLG A;  4KIG A;  5LLQ A;  3R0A A;  1FY7 A;  4EJW A;  4O6J A;  1I1G A;  4ETS A;  4OIO F;  4M6X A;  3HYI A;  2RNJ A;  4EM1 A;  1QO0 D;  3J81 K;  3E6B A;  4ZYH A;  2DFI A;  4GCV A;  3GYH X;  2BYV E;  3K9T A;  3EET A;  4GGG A;  2ZME B;  2J5O A;  3KEQ A;  3F6O A;  2X4H A;  3IRQ A;  3KP6 A;  5DCM B;  2QEN A;  3TGN A;  1PP7 U;  4FX4 A;  2DU9 A;  3ECH A;  2HS5 A;  4HLY A;  2KKO A;  4UNO A;  2VBW A;  2MLK A;  3DKW A;  4L5J A;  3V8K A;  2ZO4 A;  1XGS A;  1KU2 A;  1T38 A;  4U0V A;  3M1E A;  1G4D A;  2UXX A;  3E5U A;  3M8F A;  1R22 A;  2XAS A;  2VXZ A;  3RTR A;  1KQ8 A;  4KA4 A;  4AVP A;  2GIV A;  4WCG A;  4MHG A;  2FSW A;  2VBX A;  3WG9 A;  3P9C A;  3F8C A;  3KP3 A;  2H27 A;  1IF1 A;  4HAM A;  4KUM A;  4O5V A;  2FNP A;  1B4A A;  1YO5 C;  2EFW A;  1S7A A;  5DV5 A;  3BY6 A;  2PEX A;  3D0S A;  4OIN F;  1S29 A;  1JXS A;  3LA3 A;  1F1Z A;  3REO A;  3ZP5 A;  3M9A A;  3GFI A;  3JTG A;  1LVA A;  1FP2 A;  4M9X A;  5LRS A;  4WF2 A;  5E1X A;  3CUQ A;  4LLN A;  3W6K B;  3DFG A;  1NHA A;  1ZH5 A;  2L3D A;  2O6G E;  2PMH A;  4JBA A;  1ZRC A;  3I59 A;  1IN7 A;  3CO7 C;  4Y15 A;  1OR7 A;  4KNY A;  2FXA A;  5ILU A;  3PFI A;  3N97 A;  4R1H A;  1FYM A;  1ZRE A;  1TTY A;  4ENN A;  3Q9V A;  4ZYE A;  2CSO A;  1CGP A;  4CYD A;  4HDV A;  1B6A A;  1S3J A;  5LHI A;  2DI3 A;  4XLN F;  1XGO A;  4WK8 F;  5LBQ A;  1MGT A;  1FT9 A;  1J7K A;  1FOK A;  1G3T A;  5F1R A;  4Q47 A;  2W85 A;  3TDU C;  3HRM A;  4I02 A;  2PN6 A;  1TLH B;  2QVO A;  4YG2 F;  4A5M A;  1U2W A;  4AIK A;  5J8C A;  5LRR A;  4PDK A;  1UHW A;  1U5T A;  5DYM A;  3HUG A;  1ZAR A;  3F21 A;  3VB2 A;  4UUV A;  3DEU A;  4F7Z A;  1BI2 A;  1J2X A;  4A6D A;  2Z5U A;  1HXD A;  4K2E A;  3RPU A;  1YLF A;  1Z7U A;  4A0X A;  3K2Z A;  3ELK A;  5DD8 A;  4UHT A;  2OU2 A;  5TJJ A;  2Z9O A;  3I0T A;  3ZMT A;  2CFX A;  5HDN A;  3F23 A;  3V4G A;  2Q2E A;  1TW2 A;  3NEU A;  2DK8 A;  3LWF A;  3BDD A;  3TOA A;  2M1B A;  2VN2 A;  5CVR A;  3WE3 A;  1EH6 A;  2H94 A;  3TKY A;  4Y17 A;  5AIP A;  1FWZ A;  3PQJ A;  4MQV A;  1USS A;  1O7L A;  4IHT A;  2FMY A;  5E8G A;  1LEB A;  4I7H A;  2OZU A;  5D8L B;  4I09 A;  4S05 A;  3B02 A;  2D45 A;  2OQG A;  5FFZ A;  2PQ8 A;  3HRU A;  2RN7 A;  5DCF A;  1W5T A;  3K1M A;  3BWG A;  5HS9 A;  1D3Y A;  1JGS A;  4KN7 X;  5CVU A;  4YIF A;  1YW7 A;  5HS7 A;  4M74 A;  1HW1 A;  2IA2 A;  1FSH A;  2RC4 A;  4JQF A;  1O7F A;  4KYW A;  3T0Y A;  2Z3Y A;  5HVQ C;  2XAG A;  3ECO A;  1SFE A;  1TNT A;  2HWV A;  1HST A;  1ZRD A;  3T8T A;  4EMS A;  3KP7 A;  1ZRF A;  4BHB A;  1I1S A;  5JVT A;  1Z6R A;  3SHF A;  5K5O A;  4N0B A;  2LKP A;  4DQ2 A;  3Q5F A;  5JI6 A;  3F6V A;  2YX7 A;  3BRO A;  4YFN F;  4HA8 A;  4LLG F;  1FP1 D;  2UXN A;  4MEX F;  1FX7 A;  4JK1 X;  1BC8 C;  1GXQ A;  2BGC A;  2WWY A;  2JSC A;  2W57 A;  4HQM A;  4LG0 B;  2XAH A;  1JE8 A;  2IVM A;  3VEP A;  2ESH A;  4EVI A;  3R4K A;  1T2K A;  1FBQ A;  4HBL A;  2L4A A;  5E18 F;  2VOD A;  1W7P D;  1CF7 A;  1LNW A;  1PP8 F;  4CGZ A;  4LB6 B;  2A5Y B;  1KU3 A;  2VE8 A;  2HDC A;  3G3Z A;  3IKV A;  3BPV A;  5BS6 A;  3I53 A;  4Q4Z F;  2XRO A;  1XGM A;  3MQ0 A;  1ZLK A;  1QPM A;  2IA1 A;  1WQ2 A;  3T8R A;  1WKM A;  3SXY A;  5E17 F;  1ZLJ A;  5IT3 A;  4LMY A;  1STZ A;  3JSP A;  4OMY A;  2DPU A;  1QQI A;  5LGN A;  3KE2 A;  4RB1 A;  3IKT A;  1WSU A;  5K1Y A;  2Y75 A;  4L0Y B;  1O3Q A;  1R7J A;  5D8K B;  4PZJ A;  4WXH A;  4R8H A;  1O57 A;  4WXC A;  1BBY A;  1SD4 A;  3DXJ F;  2L4M A;  5K5Q A;  2R7F A;  2XV4 S;  1WWX A;  1LJ9 A;  3RJP A;  1BJA A;  3IWZ A;  2HOE A;  1H9G A;  5CVI A;  1EV7 A;  4P9U A;  4AIJ A;  2XAF A;  2FNA A;  1R23 A;  4RAZ A;  3E5Q A;  2M30 A;  4ZYD A;  4CHU A;  2CWE A;  2JPC A;  4KIF A;  2F5F A;  1YW9 A;  5BOX A;  4XBF A;  4MNU A;  4M71 A;  3WE2 A;  2VC0 A;  4MEY F;  4FX0 A;  4U88 A;  2QUF A;  1K79 A;  2EV5 A;  5AIQ A;  3V7R A;  1B59 A;  2EFP A;  2ADU A;  1S6L A;  5ILS A;  3CTA A;  1EH7 A;  1T0F A;  3BP8 A;  5FD5 A;  2DTR A;  1XSD A;  1ZG3 A;  4HF0 A;  2RV8 A;  3CUQ B;  1E2X A;  1J75 A;  5CYV A;  3V7S A;  3MFK A;  1MJB A;  3PQK A;  1H0M A;  3I59 B;  5FD6 A;  4KMU X;  2K86 A;  2HGC A;  4HQE A;  1IAW A;  4Q48 A;  1K78 A;  4M6Y A;  4EGY A;  1F4K A;  4B8X A;  1MD0 A;  4ESF A;  2ZKZ A;  4KFC A;  5L3B A;  1YS6 A;  3IC7 A;  2CO5 A;  1IUY A;  3E3V A;  3FMQ A;  4AWX B;  3FM5 A;  3WTS C;  2P5K A;  1KGS A;  2JTV A;  2M45 A;  2YSR A;  2Z99 A;  3BOQ A;  3LQR A;  5D6E A;  1A04 A;  4OIP F;  4BYY A;  1ONV A;  2FBK A;  3LAJ A;  3GVA A;  2XHK A;  4L18 B;  2CGP A;  1Y0U A;  1BM9 A;  3BJA A;  5E1W A;  1G6N A;  2OZ6 A;  4OOI A;  1ON1 A;  1U5T B;  1J0R A;  3U1D A;  1TNS A;  3TO7 A;  5LEK A;  2ZNY A;  1BI1 A;  2EWN A;  2QWW A;  1Q1H A;  2VT3 A;  2XAJ A;  3NQO A;  1GVJ A;  5CJ9 A;  3WU0 A;  2HR3 A;  1OKR A;  3ZQ7 A;  5HDG A;  2KIM A;  3H3Z A;  4I98 B;  1L0O C;  3C18 A;  2PJP A;  4QWQ A;  1HW5 A;  2D1V A;  3E6M A;  3FHZ A;  1HBX G;  2AXL A;  5IT9 Z;  4OMZ A;  1OYW A;  3Q9S A;  4OIR F;  3J7A O;  4HV6 A;  3WOD F;  3QU3 A;  2HTJ A;  5LGU A;  1XCV A;  1G3W A;  4L9N A;  6PAX A;  2Y48 A;  1IN4 A;  1BI0 A;  2PI0 A;  3I5U A;  2XGX A;  3GW2 A;  3CDH A;  1R1T A;  1FYK A;  4TV7 A;  2NYX A;  4HX4 A;  2NS0 A;  1IN5 A;  3HRT A;  5D4S A;  1JHH A;  3DF8 A;  2JT1 A;  1HQC A;  3SQN A;  1O3R A;  2RGV A;  4KN4 X;  3D5L A;  2JZY A;  2PG4 A;  3HTS B;  4LFU A;  2R3S A;  1QBJ A;  3KET A;  5ICC A;  1LQ1 A;  5D5X B;  1Z9C A;  4ZZL A;  3ZN0 A;  1RZ4 A;  3CO6 C;  3FZV A;  4ESB A;  4OIQ F;  5ICE A;  1RIO H;  2D1H A;  4WXD A;  1R00 A;  1IZ1 A;  2CG4 A;  2Q0O A;  3WTX C;  2PMU A;  3IL2 A;  4BHP A;  2BV6 A;  1G3S A;  2LF7 A;  3HRS A;  2FBI A;  1SFX A;  4P5O A;  4GYI A;  4LGW A;  4ENM A;  4HLX A;  2RVC A;  2IA0 A;  2HZT A;  4G7Z F;  3GFM A;  2FQ3 A;  2ACJ A;  1FC3 A;  1BC7 C;  1LB2 A;  1OYY A;  4P96 A;  3LA2 A;  1MDM A;  1R1V A;  3RYR A;  5DDG A;  2OAZ A;  4IRH A;  3V8L A;  1O3T A;  1ZAO A;  2LNB A;  2W25 A;  2DO7 A;  2Q8K A;  4BQA A;  5DUK A;  1CF7 B;  3FM3 A;  1S7O A;  1J9I A;  2FU4 A;  3DQV C;  4LK0 F;  3JTH A;  2STW A;  3I54 A;  5CVJ A;  2OA4 A;  4BNC A;  2P5V A;  4IPA A;  2HTS A;  3VOD A;  1SD7 A;  2PFB A;  2A69 F;  2H6B A;  2JPB A;  1ULY A;  2K02 A;  3ISP A;  1ZN2 A;  5BQT A;  2E1C A;  3WTT C;  3GWZ A;  4D0P A;  2V6C A;  4EJO A;  1I5Z A;  1HSJ A;  1QGP A;  4RGX A;  5A2Q Z;  2HKX A;  1ON2 A;  3H92 A;  5ICG A;  4ENJ A;  3S2W A;  2W24 A;  2H09 A;  3BJ6 A;  3BJO A;  2P7C B;  1T6S A;  2EK5 A;  1FLI A;  3OOP A;  2IPQ X;  5FFX A;  1ODD A;  2V1U A;  3KZY A;  1HKQ A;  5ICF A;  1RI7 A;  4EM0 B;  3O2P E;  3H3U A;  4NB5 A;  5D5U B;  1IRF A;  3RKY A;  5BPD A;  3QU6 A;  2MH2 A;  1FSE A;  1IW7 F;  1SMT A;  3RPQ A;  3WGH A;  4R79 A;  1PDN C;  1E17 A;  2A61 A;  4HX7 A;  2ZXJ A;  3HIF A;  2HFH A;  1XD7 A;  2E7W A;  2DQR A;  4GO1 A;  3FXR A;  3M7G A;  2FRH A;  2EA2 A;  3I71 A;  2FML A;  2MA3 A;  3QP6 A;  1GHC A;  3DPT A;  2LF8 A;  2NNY A;  3BPX A;  4M9S A;  1IXC A;  1KU7 A;  4I0A A;  3KFW X;  1FBU A;  5LGT A;  3FF5 A;  3KP2 A;  5FLX Z;  1U78 A;  2AS5 F;  2A07 F;  1XB4 A;  4G7H F;  3E97 A;  1YIO A;  3HHG A;  3RDI A;  4OU0 A;  2VBY A;  4MTD A;  2P6T A;  5F6F A;  5DUI A;  3FWE A;  2XRN A;  2DAO A;  4UVB A;  1U8R A;  2F5E A;  2P7V B;  1K78 B;  3MCZ A;  1TQM A;  4EJT A;  1FPQ A;  2X0L A;  2DPD A;  2ISY A;  2G7H A;  2NRA C;  4U0W A;  2COM A;  1T39 A;  1XCB A;  2QM3 A;  3F72 A;  2TDX A;  4M9Z A;  2ZJ2 A;  1YW8 A;  3QAH A;  4CZZ A;  3HOS A;  5FB2 A;  5HLI A;  1W4M A;  3ULQ B;  4B09 A;  4MTE A;  5A2Q K;  1ZGA A;  2VOP A;  2YU3 A;  3EQL F;  1OPC A;  4FHT A;  3T5X A;  4M73 A;  2C6Y A;  1F9N A;  1MKM A;  1QNT A;  1XMK A;  1RNL A;  4DNC A;  3OV8 A;  2XIG A;  4HZF A;  3V7C A;  4U7B A;  4ASN A;  3W6J B;  1H9T A;  3LFK A;  5K5R A;  2CW0 F;  3DP7 A;  2QYO A;  3RKW A;  2BEO A;  3F8N A;  3TDZ C;  2GXG A;  3T1B A;  3WGI A;  1K7A A;  2RKH A;  1V4R A;  4P55 A;  2FE3 A;  4BAY A;  1YQA A;  1MJ9 A;  4YFX F;  4AD9 A;  5J8F A;  2QQA A;  2RDP A;  5CLS A;  3R61 A;  3QPH A;  4HW0 A;  3VOE A;  3LST A;  3CUQ C;  1SMY F;  5F64 A;  4PGH A;  3WTU C;  3ZMU A;  2DLL A;  2M8E A;  3F8F A;  3LQQ A;  3TQN A;  2GZW A;  4RAY A;  5FLX K;  2A6H F;  3KEO A;  1I27 A;  3GF2 A;  1D5V A;  1XMA A;  3GLX A;  2HYF A;  1BIB A;  2IW5 A; 
#chains in the Genus database with same CATH topology
 1VQ9 I;  2K4J A;  2HEO A;  5H6R A;  1UHM A;  3KX2 A;  2VQC A;  1V5E A;  4PJL A;  2OD5 A;  2EJR A;  2XGD A;  1U6G A;  4B3X A;  2V9K A;  3OL3 A;  1QA6 A;  1I3Q J;  2UV1 A;  4HOB A;  4A6E A;  4BXU A;  1RC9 A;  4CCN A;  3OYB A;  1UG2 A;  2CUJ A;  3FIW A;  4M72 A;  4DBR A;  4ENK A;  3CUO A;  5IOZ A;  3KYC B;  2WAF A;  1Z05 A;  3CDI A;  5L3F A;  4YRV A;  2HQN A;  2CUF A;  1SD5 A;  4YFK F;  4XOT A;  5J3L A;  2KJB A;  3TO6 A;  2E1M C;  3HEF A;  1X2M A;  5E1Z B;  5L3D A;  2BY3 A;  1MBJ A;  2OBP A;  4ZZD A;  4BHC A;  2LSO A;  2CQK A;  1P2F A;  5H6Q A;  4IQ4 A;  4MQ9 F;  1GXP A;  1W7P A;  2DOF A;  4WX9 A;  4PSW A;  3DTI A;  1XX5 A;  1ZG5 A;  3RI4 A;  1P6R A;  5GTH C;  1WJC A;  5KHD A;  5KNL A;  3KYL A;  2JN6 A;  3ZQG A;  5BMZ A;  1R5G A;  2LD5 A;  1NK2 P;  5GAG J;  3QOP A;  2XDV A;  1WJE A;  4L0Z B;  3MEX A;  1W5C C;  3BG7 A;  2DT5 A;  3R6S A;  2IP2 A;  1U3E M;  1IDZ A;  4G8X A;  4G6D A;  2L54 A;  3U2R A;  4KDP A;  1BR4 A;  4ZYA A;  2R5Z A;  2FA5 A;  4EV0 A;  3TW7 A;  3VSK A;  1BW5 A;  3ABT A;  2EQR A;  2KIF A;  5F0H A;  2CMP A;  4E7J A;  2EZK A;  2ZME C;  2BZT A;  2XKO A;  2R7R A;  2F5V A;  2JQ7 A;  2HQA A;  5D5V B;  3CDL A;  4XSZ F;  3HDD A;  4NHJ A;  2JRM A;  1YYV A;  1T8I A;  3V8J A;  3W2W A;  5E3L A;  2QSG X;  4GYG A;  2LBF B;  5GPC A;  3PNV A;  2B7E A;  3PJR A;  2IT0 A;  4L9J A;  2QZ8 A;  2LOO A;  3VWB A;  5HDK A;  1XN7 A;  3W2V A;  2XF5 A;  5HLT A;  1K6O A;  5FGM A;  4EM2 A;  4ZC3 A;  1MDM B;  1EH8 A;  2L02 A;  3LSM A;  2BHY A;  4A2U A;  2R4G A;  1J09 A;  1OCO H;  2LYC A;  3G71 I;  4HX8 A;  3HSE A;  3BZC A;  1OCC H;  1D8J A;  1LEA A;  1TWG J;  4BJT A;  1UFM A;  1UB9 A;  2PBI A;  2EV6 A;  3ROU A;  3JR9 A;  4YII A;  3GZ5 A;  3KZI C;  2DA1 A;  1WJA A;  2R0Q C;  4MIM A;  2QCO A;  4RB0 A;  1MSF C;  3H9G A;  4LJZ F;  3ZMS A;  3KP4 A;  2HYG D;  4UXN A;  1HC8 A;  4LLL A;  3SZT A;  2A68 F;  1Z1D A;  3BT9 A;  2P6S A;  2E34 A;  5HOO A;  2XAQ A;  2K4B A;  3P9K A;  3S3O A;  3SFZ A;  1G8X A;  3HHH A;  1SVM A;  2F4M B;  1LUJ B;  2K5C A;  2X6W A;  3B73 A;  1SAX A;  2R7D A;  3GZ6 A;  3BCA A;  1D8K A;  4EGZ A;  1E3H A;  1HKS A;  3K4N A;  1DP7 P;  5ERI A;  5GTI C;  2XGE A;  2M8G X;  5EEH A;  2DFF A;  2KIU A;  4UB8 C;  4CH7 A;  5JHU A;  5CVV A;  4XLP F;  4BDY A;  5D4R A;  1V54 H;  4G6Q A;  3SDG A;  5IP9 J;  1DGR M;  3FX3 A;  1K61 A;  1FYL A;  4NC7 A;  1ZK8 A;  1LDJ A;  1G3Y A;  2VE9 A;  3L09 A;  1LFP A;  3EUH A;  1GUU A;  2UWM A;  2FBH A;  1BIA A;  2W00 A;  2R7S A;  3ML6 A;  4I0B A;  2RQP A;  3DU5 A;  2CS3 A;  5C4X J;  3LA7 A;  4L9V A;  3VDX A;  3IH3 A;  4PFP A;  4DZJ A;  3GX4 X;  2EPF A;  4QPO A;  4ZYG A;  5ED4 A;  2IRF G;  2NVT J;  3BR2 A;  1IN8 A;  3ZPL A;  3GEZ A;  2R92 J;  4Y52 J;  1HW2 A;  3RPU D;  3KEY A;  4UV8 A;  2IGN A;  1BW6 A;  2VQL A;  3QP5 A;  5B1A H;  2P5L C;  2ZJP F;  2KL4 A;  1IJW C;  1TQI A;  3VFZ A;  3E6C C;  1FIP A;  5EG0 B;  3H9Q A;  5DEQ A;  3J7Z I;  3F22 A;  4IRI A;  4E7K A;  3TW6 A;  3L2U A;  1H88 C;  3ERE D;  2MD5 A;  3MZY A;  3GBG A;  2L7F P;  3HOT A;  1GT0 C;  4L9T A;  5J1Y A;  4A0Y A;  3PIO F;  2V1N A;  2V79 A;  1IRG A;  2EB7 A;  4Z2Y A;  3DTK A;  2DW4 A;  3ZMV A;  3I64 A;  2VC1 A;  2DOA A;  1YS7 A;  4DZP A;  1BOA A;  2FEZ A;  1JHF A;  3E6D A;  1SVL A;  2JJ7 A;  4L5I A;  3IHU A;  2KRF A;  3NRV A;  3X2Q H;  1T98 A;  1LPQ A;  4FIS A;  3WGG A;  1W5S A;  1U0J A;  1SC7 A;  2ELH A;  2M5W A;  3CP2 A;  2O61 A;  4PJM A;  3A2K A;  3FKJ A;  4J19 A;  2DYR H;  1IC8 A;  2ECC A;  3WU1 B;  3P9I A;  3WHC A;  1XPX A;  3G73 A;  2Y0M A;  3KLN A;  2HZD A;  4XSX F;  1HCR A;  2PJR A;  3S17 J;  2YS9 A;  2EA4 A;  5FKK A;  4EJU A;  1KYW A;  3CMM A;  2GOX B;  4PGG A;  4YIR X;  2LBF A;  5EZG A;  2AQF A;  2VOO A;  3VYU B;  2F48 A;  1X4P A;  3RKX A;  3PO3 J;  3C3W A;  3C7J A;  3AG3 H;  4A5N A;  4E4H A;  1Y39 A;  2JRT A;  2JA5 J;  1Y8R B;  1DPR A;  3E0J B;  4OAY A;  3G4S I;  3SEQ A;  2DMU A;  2KRC A;  3CJN A;  2Z2S B;  2EH3 A;  3O6B B;  1S7E A;  5L3C A;  4C30 A;  3DLL F;  3CF5 F;  2UZK A;  2EFN A;  2F2E A;  2KZG A;  5LHH A;  1X19 A;  1MBH A;  1WH5 A;  1IXS B;  2K85 A;  1QZY A;  4XK4 A;  3CME I;  2HDW A;  2QKM B;  2X6O A;  1ETQ A;  5KAF C;  3PO2 J;  2JMW A;  2LC2 A;  4CZC A;  2O8X A;  3F8B A;  2M9H A;  5FO5 A;  2R7V A;  4UUT A;  3AAF A;  4PK4 A;  2VI6 A;  2MBF A;  2MFZ A;  2KDZ A;  4E6K G;  1MND A;  2XAU A;  5J4Y A;  2DT7 B;  2F5C A;  1OCP A;  1YTY A;  1R71 A;  3FMS A;  3SZP A;  2O8K A;  3K69 A;  4N9H A;  2FF4 A;  2BVM A;  4ON0 A;  1ZR4 A;  4BBR J;  5GAE J;  1VFC A;  3WTZ A;  1ZYR F;  4G94 A;  4RAG A;  5IT9 K;  1X3W B;  3A1Y A;  3M8J A;  1X3U A;  3CCV I;  2QSH X;  3CCE I;  1QU3 A;  5K7H A;  4E70 A;  2QQB A;  5HS8 A;  3HGG A;  4D5F A;  3HPH A;  1LFB A;  2H6C A;  2ZME A;  5F04 A;  5EZH A;  4I76 A;  1FOW A;  1P7J A;  3K1N A;  4IHS A;  3HSF A;  2L7M P;  3LSI A;  4CUG A;  4RB3 C;  5CQG A;  2O0Y A;  2QA4 I;  4O3M A;  2EV0 A;  5DCM A;  3PM1 A;  4A12 A;  2WV1 A;  2G0E A;  2QBY B;  4U87 A;  2ZBK A;  4I2O A;  4CCM A;  3G1M A;  1YJ9 I;  1GDT A;  4IRG A;  4BH9 A;  4H4K C;  2EIK H;  4PJN A;  1ETY A;  2LKS A;  3MKW B;  4ZH4 F;  4D1Q A;  1X1B A;  2XPV A;  5EYR A;  4I01 A;  5J47 A;  3CMY A;  1Y1W J;  1KA8 A;  2O03 A;  4J00 A;  1TC3 C;  3D5S C;  1R36 A;  1ETO A;  1D1B A;  5B3S H;  1XGN A;  3E1S A;  2PLY A;  1D5Y A;  4JYK A;  3DV8 A;  2MC3 A;  2GA1 A;  4UY8 I;  4RB2 C;  4N9I A;  3CP8 A;  1UST A;  1B72 B;  3OY9 A;  3CJQ B;  2VUM J;  3DPL C;  2ELJ A;  1FBS A;  1HDP A;  4DYC A;  1WRJ A;  4Y13 A;  1WI9 A;  4CIC A;  2DN0 A;  4LIV A;  3GO5 A;  3K1P A;  2D2W A;  4W97 A;  2WC2 A;  2P4W A;  3LMM A;  5KK1 A;  4U7D A;  1R49 A;  4BQQ A;  5LD2 C;  1REP C;  3HOW J;  1RUN A;  4EQQ A;  4MGR A;  4QLC U;  3CCR I;  1AWC A;  2CJJ A;  5E3M A;  2EFO A;  4NQW B;  5JR3 A;  1B8I A;  4RGS A;  2RNG A;  1VQK I;  4CDG A;  3A0H C;  2QLZ A;  2QQ8 A;  2ZXW H;  3O3K A;  3S1Q J;  2JK3 A;  3QPT A;  3L1P A;  3QRF F;  1AU7 A;  1WH7 A;  1R6R A;  2KHM A;  3W3C A;  4HNV A;  1IUF A;  2VIX A;  9ANT A;  1VQ6 I;  4DBQ A;  2M4K A;  5F1J A;  1KU9 A;  1KYZ A;  2DBB A;  2STT A;  3C1D A;  5H20 A;  3QOD A;  2VKE A;  1R5H A;  3RZD J;  4PCQ A;  2B0L A;  1Z6T A;  3FK7 A;  2DCE A;  2FOK A;  5IOY A;  5DM7 F;  1MJA A;  4XOR A;  2A6T A;  3L2W A;  4XIC A;  4P9F A;  3KLO A;  2CU7 A;  1BA5 A;  1B9M A;  3MZH A;  1LDD A;  1D0Y A;  3L9F A;  2DQL A;  2GAU A;  5TRD A;  4UB6 C;  1O3S A;  5KVR A;  4UVA A;  4HSR A;  3KZZ A;  3LSK A;  4HF1 A;  5E3N A;  4IJA A;  1XTA A;  3EYI A;  2L9V A;  2Q1Z B;  1YG2 A;  1Z7L A;  5H2F C;  4A0Z A;  1PUE E;  2HKO A;  4WWC A;  3I4P A;  1V3F A;  4F55 A;  4IHW A;  4A3L J;  5L3G A;  3ABU A;  5EEA A;  4JOM A;  1W7P B;  4H0E A;  1PUF A;  4FT8 A;  2DA7 A;  1ZHF A;  3WTW C;  4II2 A;  3NWS A;  1OMI A;  4ABZ A;  3GUD A;  1VTN C;  4BBS J;  3MAJ A;  4ESJ A;  5JFR A;  2VT2 A;  1VQO I;  4FE7 A;  2WB1 N;  2DJN A;  1FMV A;  1KQ9 A;  1S8N A;  4UV9 A;  2XVC A;  4XRF A;  3JAM Z;  2JA2 A;  2CW8 A;  2KT0 A;  3I4N J;  2WAQ N;  5AON A;  1ZG1 A;  3BZ6 A;  3M8E A;  3K10 A;  2JA7 J;  3QQA A;  1BJZ A;  3ZMZ A;  2L01 A;  4QSH A;  1Y56 A;  2DA5 A;  2MSY A;  2WTE A;  2R5Z B;  3ERM A;  3S2D J;  3J80 Z;  1XDS A;  2Y30 A;  3COA C;  1DDN A;  2WA0 A;  2YR2 A;  2MH9 A;  2W1O A;  2YPR A;  5E8I A;  2Y9Z A;  5J6X A;  2CH0 A;  4KIB A;  4PUS A;  3IWF A;  3CCQ I;  3IUO A;  2E2J J;  4AUX A;  3S2H J;  4JX6 A;  2WY8 Q;  1A36 A;  3ASO H;  3R60 A;  2D5V A;  4G7O F;  2OTJ I;  1JKP C;  2V1D A;  2WV0 A;  2ISZ A;  2OTL I;  1TQP A;  2W84 A;  3OYD A;  4XQF A;  2HPM A;  4LD5 A;  5F0F A;  1AHD P;  3U9G A;  2K9M A;  4XLH A;  1SD6 A;  1VND A;  2WBM A;  4CO8 A;  3R0J A;  4GXO A;  4RGU A;  4C2U A;  3JSO A;  3L7W A;  2IS2 A;  3ZN1 A;  3AFH A;  1HKT A;  1BI3 A;  2HOT A;  3MWM A;  2HQR A;  4RGR A;  4IXA A;  1MZB A;  2R7O A;  4XKC A;  3N4M A;  3HTU A;  2QBY A;  2GA2 A;  3I58 A;  3PSF A;  2R7T A;  3OR1 C;  1I6X A;  1Z3Y A;  1X1C A;  1LE8 A;  2V1X A;  4E7Z A;  3LOC A;  5DD4 A;  5FKN A;  4UVC A;  3TL4 X;  3WTY C;  4A3M J;  4A3B J;  1GVD A;  2OQR A;  2ZFU A;  4V2F A;  2KP6 A;  2VXD A;  3TOB A;  2NNN A;  3OSG A;  3UKG A;  3KP5 A;  5F08 A;  3L2R A;  3MZ8 A;  1RPW A;  1WZ2 A;  4HYE A;  1VQP I;  4GDF A;  4DYR A;  1OYI A;  1C0W A;  2G7U A;  4DJA A;  3K70 C;  3OIO A;  4U0Y A;  2VBZ A;  2E35 A;  4HDU A;  2E5Z A;  4RS8 A;  5D6F A;  2P8T A;  3FXQ A;  2DK5 A;  3I9V 2;  2XGC A;  4PJ0 C;  2W7N A;  5ILV A;  2KJC A;  2Z33 A;  3DWL E;  4HV5 A;  1UCR A;  1N75 A;  1R1U A;  2GXB A;  2K9Q A;  2E7X A;  1SEU A;  4IL6 C;  1ETK A;  1XSX A;  3KIO A;  3S14 J;  3J81 Z;  4E7S A;  2B63 J;  5LHG A;  3ZQF A;  2JA8 J;  1BN5 A;  3P7N A;  1V5G A;  2LTP A;  3L2C A;  3IV5 A;  3HOZ J;  4NQW A;  4EJV A;  3K0L A;  1OR7 C;  1V55 H;  1Y0N A;  3BG9 A;  5TIS C;  1B9N A;  2V9V A;  1YJN I;  4IOC F;  1O4X A;  1IN6 A;  4ITV A;  2O3F A;  3KCC A;  2JWT A;  5JHF A;  1XDU A;  3RQI A;  1FNN A;  2ZCW A;  2FX0 A;  3CQZ J;  5JLW A;  3BLY A;  4UUS A;  5BPI A;  1I6H J;  3HL2 A;  3S93 A;  2CYY A;  1HOM A;  1P4W A;  4BE0 A;  4A3F J;  3GTG J;  4B4C A;  3EDP A;  4BS9 A;  1DPU A;  1SFU A;  2BE5 F;  2AO9 A;  1Y8Q B;  2LKX A;  2KRH A;  4IVN A;  4A3E J;  1YFH A;  1HA8 A;  1B1B A;  2A6E F;  3BTL A;  4B44 A;  5E20 A;  5L3E A;  1DUX C;  1TW3 A;  2Y31 A;  1TWF J;  2HXO A;  3CLO A;  3RIR A;  2ESN A;  5LEJ A;  3JRH A;  4FCY A;  2DOD A;  1QZZ A;  5M5Y J;  3LAP A;  1P9Q C;  3SDB A;  3GXO A;  4LB5 A;  3BR1 A;  2MG4 A;  2QQ9 A;  4G9Y A;  4FAS D;  2OJE D;  5HLG A;  2IJL A;  2E1N A;  1E3P A;  5D5W B;  1QZE A;  3FHN A;  3I56 I;  1JJ6 C;  3DCF A;  2EFQ A;  2ID3 A;  2G9W A;  2F5D A;  3JAM K;  3GFJ A;  4AYB N;  1E0E A;  1PVE A;  1ZGJ A;  4S04 A;  2J5P A;  2M87 A;  2EIN H;  4XOP A;  1OLT A;  3J80 K;  1D1C A;  2YX4 A;  5GAD J;  3TO9 A;  3ABM H;  3HZJ A;  4IF4 A;  3IRR A;  1J59 A;  3HSR A;  4XNF A;  3DTE A;  3GFL A;  1F5T A;  4IOA F;  5HOD A;  1RET A;  3S8P A;  1LDK B;  4Q5S F;  3F3X A;  2GQQ A;  4KIC A;  1W1W E;  2K27 A;  4KMF A;  1N77 A;  2KQR A;  3EPZ A;  1TP4 A;  2GWR A;  3A4C A;  3EYY A;  1U5T C;  2Y69 H;  4N4O B;  3LNQ A;  3K70 D;  1YIT I;  1KQ0 A;  3HG9 A;  3RYP A;  2E36 A;  1P4A A;  2V26 A;  3FXO A;  3ZMD A;  2QEX I;  4F93 B;  1P92 A;  2DFE A;  3BTI A;  4LK1 F;  2ETH A;  2A3S A;  1Z91 A;  1EKE A;  1Y6I A;  2VAS A;  2XUB A;  1L3L A;  3HOV J;  1LFU P;  2LY1 A;  3F8M A;  2PJR B;  2L0K A;  4N4N B;  4LG0 A;  2XF7 A;  2EZL A;  2K7L A;  2LMD A;  1FZP B;  2NAZ A;  2V6E A;  1LKX A;  4AIH A;  4AYB A;  2ZNZ A;  1SFK A;  5HLH A;  1N78 A;  2XKP A;  3OIQ A;  1XSV A;  3HB9 A;  3M3Y J;  1AOY A;  4CCJ A;  2LDU A;  5EEG A;  2ID6 A;  4XRM A;  4FTH A;  1YJW I;  2DT6 A;  3BTJ A;  3JW4 A;  3AL0 B;  2ZFW A;  1J5Y A;  2L9S A;  1R4N B;  1TBX A;  3L00 A;  4CXF A;  2VON A;  3SZG A;  2LG4 A;  3K4J A;  4PSX A;  3E5X A;  4BKX A;  3K4M A;  1RUO A;  1IXR C;  3EUK L;  3FMR A;  3G6E I;  1P4X A;  2BBY A;  4KT5 C;  1YHQ I;  2E1M B;  1JT0 A;  4OWR B;  1R58 A;  2KIQ A;  3WTV C;  3ESW B;  3O8H A;  2IXS A;  4HF2 A;  3FXU A;  1MMD A;  2MLG A;  4D9J A;  4KIG A;  5LLQ A;  1OCT C;  2H27 A;  4E7I A;  3R0A A;  1FY7 A;  4EJW A;  3CC2 I;  2OC6 A;  2OF7 A;  4O6J A;  1I1G A;  3LSP A;  4ETS A;  2R5Y A;  4OIO F;  4M6X A;  3HYI A;  2RNJ A;  5J1U A;  3JRE A;  4EM1 A;  1QO0 D;  3J81 K;  3S1M J;  1MMA A;  3E6B A;  4ZYH A;  3M1C A;  3HOX J;  2M0M A;  1FTT A;  2DFI A;  4GCV A;  1T08 B;  3GYH X;  4BJ5 C;  4RAF A;  4JX4 A;  4EAT A;  1VF9 A;  3CC7 I;  3QYE A;  2BYV E;  3K9T A;  2Z16 A;  3EET A;  4GGG A;  3K6G A;  2ZME B;  2B9S A;  2J5O A;  3KEQ A;  1W36 C;  2DA3 A;  4NNJ A;  1OCR H;  3F6O A;  2X4H A;  1OQY A;  3IRQ A;  3KP6 A;  5DCM B;  2QEN A;  4AID A;  3TGN A;  1GV2 A;  4NBQ A;  1PP7 U;  4FX4 A;  2DU9 A;  3LSH A;  3ECH A;  2HS5 A;  4HLY A;  5FKM A;  1X2N A;  2DOE A;  2KKO A;  4DW6 A;  3IH4 A;  4UNO A;  2VBW A;  2NS8 A;  2MLK A;  3DKW A;  4L5J A;  4BU2 A;  3RCO A;  1ENH A;  3V8K A;  2ZO4 A;  1XGS A;  4ZTF A;  1KU2 A;  1FOX A;  1T38 A;  3HPG A;  3M1E A;  4U0V A;  2Q2E B;  1G4D A;  5FRO A;  4IQJ A;  3H0D A;  3CES A;  1QVU A;  3U1K A;  2IGO A;  3ABL H;  2UXX A;  3E5U A;  3SEZ A;  3M8F A;  1R22 A;  5IYB J;  4GRI A;  4RMN A;  2XAS A;  2L2O A;  2VXZ A;  3RTR A;  1KQ8 A;  4BEH A;  1G2H A;  4YEL A;  3C2G A;  4KA4 A;  1K6Y A;  4AVP A;  2GIV A;  2RRE A;  3SYT A;  4MHG A;  4WCG A;  2FSW A;  2VBX A;  3WG9 A;  3P9C A;  3F8C A;  3KP3 A;  4MFD A;  4A3K J;  1IF1 A;  4HAM A;  4KUM A;  1OJL A;  4O5V A;  4HNU A;  3RKQ A;  2ECB A;  2FNP A;  3A0B C;  2F4I A;  2CQ7 A;  1B4A A;  1YO5 C;  3OYN A;  1B8I B;  2N8G A;  2L5Q A;  2DJI A;  1S7A A;  5DV5 A;  2EFW A;  1TT0 A;  3BY6 A;  2PEX A;  3D0S A;  4OIN F;  4HRI A;  1JUM A;  3MKL A;  1S29 A;  1Z67 A;  4LIT A;  4ZDO A;  1JXS A;  4CCO A;  2GXA A;  2XB0 X;  5EJC A;  3LA3 A;  2X1E A;  1F1Z A;  3REO A;  3HKZ A;  3ZP5 A;  4M3D A;  2LRE A;  3M9A A;  3GFI A;  1MH3 A;  3JTG A;  3BG6 A;  1LVA A;  5GAH J;  1FP2 A;  4XLE A;  2QKL B;  3CJT B;  4M9X A;  5LRS A;  3UNG C;  4WF2 A;  5E1X A;  3CUQ A;  4LLN A;  3W6K B;  3DFG A;  1UHS A;  1NHA A;  1ZH5 A;  2L3D A;  4KJZ A;  1OFC X;  3TED A;  1VQ8 I;  2PMH A;  4JBA A;  5HNH A;  1ZRC A;  2O6G E;  3I59 A;  1IN7 A;  3CO7 C;  4Y15 A;  4A69 C;  1OR7 A;  4LG3 A;  4KNY A;  2MGQ A;  4IHX A;  2FXA A;  5B5E C;  5ILU A;  1VQM I;  3PFI A;  3JRF A;  3N97 A;  4DYQ A;  4HEA 2;  3MVP A;  2HYJ A;  4R1H A;  1FYM A;  1ZRE A;  1S9H A;  2W48 A;  1TTY A;  4ENN A;  1W36 D;  3QPL A;  4A3C J;  3Q9V A;  4B1R A;  4ZYE A;  3IH2 A;  2CSO A;  3IP4 B;  1PUF B;  3HXL A;  4Y4R A;  4JP0 A;  4D7M A;  1R4M B;  1CGP A;  4CYD A;  2R7Q A;  4HDV A;  2E19 A;  3FXM A;  1FJL A;  1S3J A;  1B6A A;  5LHI A;  2DI3 A;  3ASN H;  3VYR B;  1T56 A;  4XLN F;  1XGO A;  3PSI A;  4WK8 F;  4KT6 A;  3TP0 A;  2CV1 A;  5LBQ A;  1MGT A;  4ZJZ A;  1FT9 A;  1SAU A;  2MAB A;  1J7K A;  4HPQ A;  1JGG A;  1FOK A;  1G3T A;  5F1R A;  3CCY A;  4Q47 A;  2W85 A;  2JUG A;  3FK6 A;  3TDU C;  2DMN A;  2F6C A;  3HRM A;  4I02 A;  2I10 A;  2PN6 A;  1TLH B;  2QVO A;  4NUB A;  4YG2 F;  4A5M A;  2IBD A;  3JCU C;  1U2W A;  2ZJR F;  4AIK A;  5JLX A;  3OWT A;  4X0G A;  2HI3 A;  1X1D A;  1D0X A;  5J8C A;  2BW3 A;  3S15 J;  1MMG A;  2KMU A;  2K40 A;  5LRR A;  4PDK A;  1UHW A;  1ZQ3 P;  3HBL A;  2K9L A;  2JUC A;  3DLA A;  1U5T A;  5F0C A;  3NWT A;  2DMP A;  2OCE A;  2E5N A;  4V19 K;  5DYM A;  5M3M J;  2NS7 A;  3F9K A;  3HUG A;  4XN3 A;  1ZAR A;  3F21 A;  3VB2 A;  4A93 J;  4UUV A;  3BCB A;  1TT5 B;  2PMZ N;  3DEU A;  3H5N A;  4F7Z A;  3ZQC A;  2PX9 A;  2R7Z J;  1BI2 A;  1J2X A;  4A6D A;  2Z5U A;  1HXD A;  4K2E A;  5CPR B;  1LE8 B;  2X85 A;  1YLF A;  3RPU A;  1Z7U A;  2AQE A;  3K2Z A;  3ELK A;  4A0X A;  5DD8 A;  4UHT A;  2JVG A;  3PFY A;  2OU2 A;  5BNG A;  1MBE A;  3PUF A;  5TJJ A;  3K4B A;  3ONQ A;  2Z9O A;  1NTC A;  3I0T A;  3ZMT A;  2CFX A;  3OSF A;  5HDN A;  2EBI A;  2KZV A;  2OV7 A;  3F23 A;  3V4G A;  3HJE A;  2Q2E A;  1TW2 A;  3NEU A;  2DK8 A;  3L2V A;  1S5L C;  3PUB A;  1MBG A;  3DBR B;  3ZQQ A;  1ETW A;  3LWF A;  4AU7 A;  3BDD A;  3TOA A;  2LLK A;  3SJM A;  2M1B A;  2VN2 A;  5CVR A;  3WE3 A;  1D0Z A;  4ANJ A;  2BY2 A;  2BVL A;  2WAE A;  2X1C A;  1EH6 A;  2H94 A;  3TKY A;  4XID A;  1YRN A;  1T0F C;  2GBY A;  1BOB A;  4Y17 A;  2LY9 A;  1A35 A;  4FQG A;  5AIP A;  1FWZ A;  4HST A;  1F36 A;  5IYD J;  3PQJ A;  2PMZ A;  2EZI A;  4MQV A;  4C3H J;  1IGN A;  1USS A;  1O7L A;  1T33 A;  1QRY A;  1TWC J;  1GLN A;  3VYT B;  3QYF A;  2FMY A;  5F27 A;  4IHT A;  4EEF G;  2HOA A;  2NXN B;  5FRM A;  5E8G A;  1LEB A;  3JRI A;  4I7H A;  3GTL J;  2OZU A;  5D8L B;  4I09 A;  3DBL B;  4S05 A;  3LSR A;  2LK2 A;  3B02 A;  2D45 A;  5FRN A;  2OQG A;  5FFZ A;  2PQ8 A;  3HRU A;  1VQN I;  2K3P A;  4RM3 A;  2HU9 A;  2RN7 A;  4F91 B;  4XLF A;  1W5T A;  5DCF A;  3K1M A;  4UUS B;  3JRD A;  1YI2 I;  3BWG A;  5HS9 A;  2CUZ A;  1D3Y A;  1JGS A;  4KN7 X;  3MMY B;  5CVU A;  1YW7 A;  4C3J J;  5HS7 A;  4YIF A;  5JVG F;  4M74 A;  2O7O A;  1HW1 A;  1W0T A;  4YEJ A;  1Z3X A;  2XRL A;  3DEE A;  2KFD A;  1MMS A;  4DGW B;  2IA2 A;  1FSH A;  2RC4 A;  4JQF A;  3JRC A;  3K7A J;  1O7F A;  4KYW A;  4HG2 A;  3T0Y A;  1U9O A;  3ZQH A;  2H8R A;  2K3F A;  5EGO B;  5FKL A;  3Q0W A;  2Z3Y A;  1QVT A;  3H9J A;  5HVQ C;  2XAG A;  3ECO A;  1W0U A;  1SFE A;  1TNT A;  1I3A A;  2E1O A;  3BQZ A;  2HWV A;  3GTM J;  1HST A;  2DA2 A;  1ZRD A;  3ZGK A;  3T8T A;  5C4J J;  4EMS A;  3KP7 A;  2VKV A;  1ZRF A;  4BHB A;  2CQQ A;  1I1S A;  3M07 A;  5JVT A;  3OYK A;  1D1A A;  1Z6R A;  3SHF A;  1HF0 A;  5K5O A;  2HOS A;  2K9S A;  4N0B A;  2LKP A;  4DQ2 A;  2V9P A;  2FOW A;  3Q5F A;  5JI6 A;  3F6V A;  4M3F A;  3GZN B;  2YX7 A;  3EUA A;  4PJJ A;  4Y33 A;  3BRO A;  4IEJ A;  4YFN F;  4HA8 A;  4LLG F;  2R7X A;  1FP1 D;  2UXN A;  4XRS A;  4MEX F;  3VSL A;  2ICW G;  1FX7 A;  5IP7 J;  4A3I J;  4JK1 X;  2X6X A;  1BC8 C;  1GXQ A;  2BGC A;  2DMT A;  4X1E A;  2WWY A;  3GTJ J;  2JSC A;  2X6Y A;  2W57 A;  1ETV A;  2DYS H;  1RR7 A;  1OCZ H;  3BZK A;  2A5W A;  2KLO A;  2L7Z A;  4HQM A;  3S3M A;  4LG0 B;  2XAH A;  5IP6 A;  1LVK A;  1JE8 A;  2IVM A;  2H1L A;  2DA4 A;  5IY5 H;  4E7L A;  3ABK H;  3VEP A;  2ESH A;  4EVI A;  4NC8 A;  1G59 A;  2HQ5 A;  3R4K A;  1T2K A;  1FBQ A;  3HGY A;  1Q1V A;  4HBL A;  4BJ6 C;  2L4A A;  5E18 F;  2VOD A;  1W7P D;  1CF7 A;  2CUE A;  3OYC A;  1LNW A;  5B66 C;  1PP8 F;  4CGZ A;  2HDD A;  4GFB A;  4LB6 B;  3CC4 I;  4XL9 A;  2CV0 A;  2A5Y B;  4I99 C;  1KU3 A;  3DU6 A;  3BR3 A;  4B48 A;  2ZC2 A;  3G2B A;  2VE8 A;  2HDC A;  3G3Z A;  2VJI A;  2ELK A;  3IKV A;  4XR6 A;  1ZEL A;  5J1R A;  3BPV A;  3OYA A;  5BS6 A;  2ZXI A;  3I53 A;  4Q4Z F;  2CV2 A;  1JJ8 C;  2XRO A;  1XGM A;  2CW7 A;  3CF2 A;  3MQ0 A;  1ZLK A;  1QPM A;  3Q3S A;  3K4C A;  2IA1 A;  1WQ2 A;  3H0G J;  3T8R A;  4ZTJ A;  3LL7 A;  1WKM A;  2FUG 2;  3SXY A;  5E17 F;  2DFH A;  2R5Y B;  1ZLJ A;  5FLV A;  5IT3 A;  4LMY A;  1STZ A;  3JSP A;  4OMY A;  2DPU A;  1QQI A;  3GCM A;  3OYF A;  5LGN A;  3KE2 A;  4RB1 A;  3IKT A;  3CCJ I;  2QGU A;  4XLA A;  2ZSH B;  4CCK A;  1WSU A;  3OR2 C;  2WAD A;  5K1Y A;  1N25 A;  3LFU A;  3GTK J;  2Y75 A;  2M3A A;  4L0Y B;  2GOM A;  2OCC H;  1O3Q A;  1R7J A;  3OOU A;  3AG4 H;  3OIP A;  1A31 A;  5D8K B;  4IO9 F;  4PZJ A;  4WXH A;  3CJR B;  4R8H A;  1O57 A;  4WXC A;  4B47 A;  1BBY A;  1SD4 A;  2NVU B;  3DXJ F;  2L4M A;  2I5U A;  1QHG A;  5K5Q A;  2MC4 A;  5KAI C;  3ZRG A;  2TCT A;  1MBK A;  4OAZ A;  2R7F A;  4MLO A;  2XV4 S;  1WWX A;  5FLM J;  1LJ9 A;  3OYG A;  3RJP A;  1BJA A;  3IWZ A;  2HOE A;  2I8D A;  1H9G A;  5CVI A;  1EV7 A;  2A05 A;  3WU2 C;  4P9U A;  1K4S A;  4BL0 B;  4F52 A;  1RES A;  1DP3 A;  2EIL H;  1UG0 A;  4AIJ A;  2XAF A;  1H89 C;  3JRB A;  2FNA A;  1R23 A;  4RAZ A;  5B1B H;  3E5Q A;  1IV6 A;  2M30 A;  4ZYD A;  4CHU A;  4XN0 A;  4V2G A;  4W1U A;  1VQ5 I;  2CWE A;  2JPC A;  3NAR A;  1UAA A;  4BEH B;  2LH9 A;  3Q0V A;  4KIF A;  2GM4 A;  3DBH B;  2F5F A;  1BR1 A;  4RLQ A;  2BXY A;  3I4M J;  1MMN A;  1YW9 A;  5BOX A;  4XBF A;  4MNU A;  4M71 A;  3WE2 A;  4BE1 A;  4KIT B;  4C2M J;  4F92 B;  5EGO A;  3KPH A;  2VC0 A;  2VQH A;  3UR3 C;  4MEY F;  4FX0 A;  4U88 A;  3LSJ A;  2QUF A;  1ZTR A;  3DEW A;  2IS1 A;  1K79 A;  2JSP A;  2EV5 A;  5AIQ A;  1S72 I;  3HC7 A;  2R93 J;  1VI0 A;  3K4K A;  3V7R A;  3CCU I;  1B59 A;  2EFP A;  3RZO J;  2ADU A;  2F4O B;  3TBI A;  1S6L A;  5ILS A;  2CFO A;  1WJF A;  3CTA A;  2IS4 A;  1EH7 A;  4C2T A;  3AL0 C;  1T0F A;  3BP8 A;  2HPI A;  5FD5 A;  1GV5 A;  1PYV A;  2DTR A;  1RKT A;  1XSD A;  1ZG3 A;  3M4O J;  4HF0 A;  4A3J J;  2RV8 A;  3CUQ B;  1E2X A;  1J75 A;  5CYV A;  3V7S A;  3MFK A;  2K9N A;  4BY7 J;  2QSF X;  4Z6Y A;  2LP0 A;  1VQ4 I;  1MJB A;  5M5W J;  3PQK A;  1H0M A;  3BG5 A;  3FKI J;  3I59 B;  2IEK A;  5FD6 A;  4KMU X;  3A01 A;  4J01 A;  2K86 A;  5DS9 A;  2HGC A;  4HQE A;  3OS1 A;  4PFO A;  1WFX A;  1IAW A;  4IHY A;  4Q48 A;  1QHH D;  2DTZ A;  1K78 A;  4M6Y A;  4EGY A;  4XMY A;  1F4K A;  4B8X A;  1MD0 A;  4ESF A;  2M2E A;  2ZKZ A;  4KFC A;  5L3B A;  1YS6 A;  2M34 A;  2RQQ A;  4XKW A;  5M5X J;  1AKH B;  2JA6 J;  2VJ4 A;  3CCL I;  2V7F A;  3C2H A;  3IC7 A;  3TMO A;  2CO5 A;  1IUY A;  3E3V A;  2JVH A;  2LVS A;  5GPA A;  3FMQ A;  4AWX B;  3FM5 A;  1YOV B;  2FQ4 A;  4ZDP A;  1NG7 A;  1WCM J;  3WTS C;  2P5K A;  1KGS A;  3C2B A;  3CMA I;  3OYL A;  2JTV A;  1JKR C;  2M45 A;  2YSR A;  2Z99 A;  3BOQ A;  1DGW Y;  3LQR A;  5D6E A;  2NOJ B;  1R9T J;  1JTY A;  1A04 A;  4OIP F;  4BYY A;  3K2A A;  3OS0 A;  1ONV A;  4DOZ A;  1SAN A;  5E79 C;  2FBK A;  5J4V A;  3LAJ A;  1H8A C;  1WGX A;  4XLC A;  2M0C A;  2KIS A;  4B3A A;  3GVA A;  2XHK A;  4L18 B;  2E2I J;  2CGP A;  3H3V K;  1Y0U A;  2W82 A;  1VQL I;  3W2A A;  1BM9 A;  3BJA A;  2BW3 B;  3NAU A;  1Z77 A;  1EF4 A;  5E1W A;  1G6N A;  1HDD C;  5C3E J;  1CQT A;  2OZ6 A;  4OOI A;  1P7I A;  1ON1 A;  1U5T B;  1J0R A;  2H8W A;  3U1D A;  1TNS A;  3TO7 A;  3B6C A;  5LEK A;  2ZNY A;  1MIJ A;  3HUG B;  2XB5 A;  1BI1 A;  2GIZ A;  2EWN A;  2QWW A;  2DDB A;  1Q1H A;  2W4S A;  3H5R A;  4I6Z A;  2VT3 A;  3D5R C;  2ZXH A;  1HLV A;  2XAJ A;  3NQO A;  1MW7 A;  2CQX A;  1GVJ A;  5CJ9 A;  3WU0 A;  5E3O A;  2EIM H;  1POG A;  2HR3 A;  1NH3 A;  1OKR A;  3ZQ7 A;  5HDG A;  2KIM A;  3H3Z A;  4I98 B;  1MBF A;  1L0O C;  1Z21 A;  3C18 A;  3IAS 2;  4BDZ A;  2PJP A;  5DM6 F;  3B6A A;  4QWQ A;  5J40 A;  3CCM I;  4X6A J;  3DPU A;  2KDO A;  1HW5 A;  2D1V A;  3E6M A;  3OS2 A;  3HKZ N;  4P1W A;  3FHZ A;  4XON A;  1HBX G;  1QPI A;  2AXL A;  2VQG A;  5M3F J;  5IT9 Z;  2MD0 A;  2Y2Z A;  3FDY A;  4OMZ A;  1OYW A;  2E60 A;  3O8G A;  3Q9S A;  4OIR F;  4QPQ A;  3J7A O;  4HV6 A;  3WOD F;  5EDN A;  3QU3 A;  2HTJ A;  3SFI A;  5LGU A;  1XCV A;  1YRN B;  3JRA A;  1G3W A;  1NG6 A;  4L9N A;  4BUP A;  4IZZ A;  1RKW A;  2NVX J;  2Y48 A;  6PAX A;  4BE2 A;  1IN4 A;  1BI0 A;  2PI0 A;  1ZKG A;  3I5U A;  2XGX A;  3J7A Y;  3GW2 A;  3S32 A;  3CDH A;  1R1T A;  4A3D J;  2DMQ A;  1FYK A;  3ZR8 X;  4NC6 A;  2P0W A;  2AHQ A;  4TV7 A;  2ZB9 A;  2NYX A;  5C44 J;  2L9R A;  1OIS A;  3OYH A;  3OYI A;  4RDU A;  4HX4 A;  3MN2 A;  3QWL A;  1X3Z B;  2VPL A;  2YUS A;  2NS0 A;  1IDY A;  1IN5 A;  3HRT A;  3FIS A;  5KCM A;  3MKY B;  5D4S A;  1JHH A;  3A03 A;  3DF8 A;  1ETX A;  2JT1 A;  1HQC A;  2X1D A;  2X48 A;  3SQN A;  1O3R A;  2RGV A;  4KN4 X;  3TP3 A;  3D5L A;  1JI8 A;  3HM5 A;  1XMX A;  2NOG A;  2JZY A;  2PG4 A;  1WVR A;  3GLL A;  3HTS B;  4QIW N;  4LFU A;  1IG7 A;  4BY1 J;  2R3S A;  1QBJ A;  5TGT A;  3KET A;  2HVQ A;  5ICC A;  1LQ1 A;  5D5X B;  1Z9C A;  2ME6 A;  4ZZL A;  2XSD C;  3ZN0 A;  4IHV A;  1RZ4 A;  4CYC B;  3CO6 C;  4BXF A;  4RM2 A;  3FZV A;  2HVR A;  2VJ5 A;  4ESB A;  4OIQ F;  4CA0 A;  1DQU A;  5ICE A;  1RIO H;  2D1H A;  4WXD A;  4IX7 A;  1R00 A;  2OUM A;  1IZ1 A;  2CG4 A;  2Q0O A;  4M3E A;  3WTX C;  2PMU A;  3IL2 A;  4BHP A;  4M3B A;  1AKH A;  2BV6 A;  1G3S A;  5CQE A;  2FJ1 A;  3G1L A;  2LF7 A;  1VZ0 A;  3HRS A;  2FBI A;  1SFX A;  4P5O A;  4GYI A;  4LGW A;  3E7L A;  4RBO A;  4HLX A;  4ENM A;  2H1K A;  2RVC A;  1IV8 A;  1ZGW A;  1T95 A;  2COB A;  3CCS I;  1DU6 A;  3H1C A;  2IA0 A;  1UZC A;  2OPT A;  2HZT A;  4G7Z F;  3DKX A;  2ZSI B;  3Q0U A;  3V42 A;  3ZQI A;  2LRD A;  1EA3 A;  3GFM A;  1MNE A;  2FQ3 A;  1JUP A;  2IAI A;  2ACJ A;  1FC3 A;  1BC7 C;  2Y0S N;  1OYY A;  5EF6 A;  1LB2 A;  4P96 A;  5CKT A;  3H36 A;  1I39 A;  3LA2 A;  3H35 A;  1WJB A;  4DIQ A;  3GTQ J;  1MDM A;  1R1V A;  3BR6 A;  3RYR A;  5DDG A;  1E3O C;  2OAZ A;  4IRH A;  3V8L A;  2P81 A;  2ME0 A;  1O3T A;  5IPA A;  3QOE A;  1X58 A;  2DA6 A;  1ZAO A;  1F43 A;  4LOC A;  2LNB A;  2W25 A;  2DO7 A;  2Q8K A;  2M7B A;  4BQA A;  4MO7 A;  2L7K A;  2MW8 A;  5DUK A;  5FKO A;  1CF7 B;  3BQY A;  1BR2 A;  2VL8 A;  1IRX A;  3FM3 A;  3P5J A;  2E2H J;  4KIS A;  1S7O A;  1RR8 C;  1J9I A;  2FU4 A;  3PIP F;  3BR0 A;  4D7N A;  3AG2 H;  3DQV C;  4LK0 F;  3JTH A;  1SVO A;  4C9Y A;  3S3N A;  2Z1D A;  3I54 A;  5CVJ A;  3ZOB A;  2STW A;  2XSJ C;  2OA4 A;  3ZQL A;  4BNC A;  2P5V A;  4IPA A;  3WHB A;  2HTS A;  2XPW A;  2BY1 A;  4BQN A;  2Y0S A;  3VOD A;  1YIJ I;  1SD7 A;  2PFB A;  1FOY A;  1TWA J;  2A69 F;  3BR5 A;  2H6B A;  2BXZ A;  2JPB A;  1ULY A;  2K02 A;  2XC7 A;  3D1N I;  1YX5 A;  3ISP A;  1ZN2 A;  5BQT A;  2IGK A;  2E1C A;  4II3 A;  4XKV A;  1IRZ A;  3N05 A;  5HNF A;  4XRS G;  3WTT C;  3GWZ A;  1XG1 A;  4D0P A;  2V6C A;  4EJO A;  2O9L A;  1I5Z A;  3PL8 A;  1HSJ A;  1QGP A;  1WPK A;  4RGX A;  2M7A A;  5A2Q Z;  2HKX A;  1ITY A;  1ON2 A;  2V4J C;  3H92 A;  2WY7 Q;  5ICG A;  3VPR A;  1UMQ A;  4ENJ A;  3S2W A;  3CZ6 A;  3F0C A;  1YX3 A;  2W24 A;  2H09 A;  1M1E B;  4QTR A;  4F3Q A;  3BJ6 A;  1APL C;  3BJO A;  2P7C B;  1T6S A;  4HNT A;  2EK5 A;  1FLI A;  1RRJ A;  4BQO A;  3OOP A;  2DXI A;  2IPQ X;  5FFX A;  1ODD A;  2V1U A;  3KZY A;  1I50 J;  3S1R J;  2UUZ A;  1JKQ C;  1HKQ A;  1MNM C;  5ICF A;  1RI7 A;  4EM0 B;  2QF7 A;  4BGD A;  3O2P E;  2LY2 A;  4S0H B;  2BY0 A;  3H3U A;  2X9D A;  4NB5 A;  5D5U B;  3HOY J;  1IRF A;  3K4L A;  3RKY A;  1VQ7 I;  5BPD A;  1ACI A;  3QU6 A;  2NVY J;  4C3I J;  2MH2 A;  1FSE A;  1IW7 F;  1SMT A;  3I3L A;  3RPQ A;  3WGH A;  4R79 A;  1PDN C;  1WHU A;  1E17 A;  2A61 A;  2VJJ A;  1TZL A;  4HX7 A;  1X1P A;  2ZXJ A;  3FXK A;  5EG0 A;  3HIF A;  3LSG A;  1MSE C;  5GP9 A;  2HFH A;  1XD7 A;  2CQN A;  2E7W A;  3MD2 A;  2DQR A;  4GO1 A;  4AVZ A;  3FXR A;  3M7G A;  2FRH A;  2EA2 A;  1FTZ A;  3CLQ A;  2VKD A;  1TL8 A;  5FJ8 J;  2O5R A;  3I71 A;  2NVQ J;  1MH4 A;  2FML A;  1A6I A;  4FE4 A;  4CYC A;  4G6T B;  4AM3 A;  2BHZ A;  2MA3 A;  3QP6 A;  1JKO C;  1GHC A;  3DPT A;  3ZXS A;  2LF8 A;  5K7F A;  2NNY A;  3BPX A;  2VB6 A;  3FBI B;  1IXC A;  4M9S A;  1KU7 A;  4I0A A;  3KFW X;  1FBU A;  5LGT A;  3PNY A;  3HOU J;  3FF5 A;  4XKB A;  3KP2 A;  3OYE A;  3S16 J;  5FLX Z;  1U78 A;  2AS5 F;  2E71 A;  2A07 F;  1XB4 A;  3BG3 A;  4M6V A;  4G7H F;  2FD5 A;  1WI3 A;  3E97 A;  1YIO A;  3HHG A;  3QPS A;  3RSN A;  2LR8 A;  3RDI A;  3ZCO A;  3I55 I;  4OU0 A;  2VBY A;  1R5I D;  3GME A;  4XM3 A;  4MTD A;  2P6T A;  4CCL A;  5F6F A;  1EJ9 A;  1X4O A;  3H5A A;  4Y3O A;  4FET A;  4L5E A;  5DUI A;  2X51 A;  1IO2 A;  3CD6 I;  1A5J A;  2AXT C;  1FMW A;  3FWE A;  2XPU A;  2XRN A;  2DAO A;  4UVB A;  3A01 B;  1JT6 A;  3IAM 2;  3AG1 H;  1U8R A;  2HXI A;  2F5E A;  4AC0 A;  2P7V B;  1K78 B;  4G12 A;  3MCZ A;  3JRG A;  3U21 A;  1NK3 P;  4A3G J;  1TQM A;  1JTX A;  4EJT A;  1FPQ A;  1WJ5 A;  2R7U A;  2R7W A;  2X0L A;  3RQ4 A;  2DPD A;  4D5C A;  2ISY A;  2G7H A;  3MKZ A;  2NRA C;  1ERD A;  4U0W A;  1JUS A;  2COM A;  1T39 A;  2RAE A;  1XCB A;  2QM3 A;  2VLA A;  1UJ8 A;  1U9N A;  3F72 A;  2TDX A;  2KPM A;  1Y1V J;  4M9Z A;  2ZJ2 A;  1YW8 A;  3BC8 A;  3QAH A;  4CZZ A;  2GLO A;  4LIU A;  5LFA A;  3HOS A;  3OYJ A;  3GTP J;  2IS6 A;  4ZDL A;  5FB2 A;  4BAC A;  5HLI A;  2L9N A;  2MYS A;  1BL0 A;  3A02 A;  2CRG A;  3PNT A;  2DDA A;  2Y9Y A;  1W4M A;  1AA7 A;  3ULQ B;  4B09 A;  4MTE A;  1KON A;  5A2Q K;  2ZJQ F;  3EUH C;  3AKZ A;  1WJD A;  4MFE A;  1ZGA A;  1SFO J;  2VOP A;  2YU3 A;  3EQL F;  2WB1 A;  3G1O A;  1OPC A;  4FHT A;  3T5X A;  1A6Q A;  4M73 A;  1F9N A;  2C6Y A;  1MKM A;  1QNT A;  1V5F A;  1XMK A;  3VYS B;  2WAQ A;  1KZH A;  1RNL A;  4DNC A;  4RLF A;  3FXJ A;  4IKF A;  3OV8 A;  3OL4 A;  2XIG A;  2VKH A;  2EZH A;  3OMY A;  4HZF A;  3V7C A;  4U7B A;  4ASN A;  1DU0 A;  4RA2 A;  3DKY A;  3W6J B;  1H9T A;  3LFK A;  4BXX J;  4B43 A;  5K5R A;  2CW0 F;  3DP7 A;  3OYM A;  2EIJ H;  3BTC A;  5IYC J;  2QYO A;  3RKW A;  2BEO A;  3QYB A;  3F8N A;  3TDZ C;  3S1N J;  2GXG A;  1ZR2 A;  3T1B A;  3WGI A;  1FEX A;  1K7A A;  2RKH A;  2HVS A;  2M4G A;  1V4R A;  4P55 A;  2BOL A;  2FE3 A;  2IGM A;  4BAY A;  1K83 J;  1YQA A;  1MJ9 A;  4YFX F;  4AD9 A;  5K7Z A;  1Z0X A;  3L2Q A;  5J8F A;  1B72 A;  1PJR A;  2QQA A;  2RDP A;  5CLS A;  3R61 A;  3QPH A;  4HW0 A;  3GTO J;  3VOE A;  4E7H A;  3LST A;  3CUQ C;  1SMY F;  5F64 A;  4PGH A;  3WTU C;  1XC5 A;  2XF6 A;  3KYD B;  3W6V A;  3ZMU A;  2DLL A;  2M8E A;  3F8F A;  3LQQ A;  3J7Y J;  3TQN A;  3FXL A;  2GZW A;  2LFB A;  5DTD A;  3FBN B;  1ORK A;  4RAY A;  4Y7N J;  5FLX K;  2A6H F;  3KEO A;  1I27 A;  2YU9 J;  3GF2 A;  4JX5 A;  4CSW A;  1D5V A;  1K4T A;  1XMA A;  1FIA A;  2TRT A;  1YE9 A;  3GLX A;  4M3G A;  2VPR A;  1X1A A;  3WG7 H;  4NDL A;  1TWH J;  2HYF A;  1U8B A;  2HNH A;  1XS9 A;  1BIB A;  2IW5 A;  1UEL B; 
#chains in the Genus database with same CATH homology
 2K4J A;  2HEO A;  5H6R A;  1UHM A;  2OD5 A;  2EJR A;  1U6G A;  4HOB A;  4A6E A;  4BXU A;  4M72 A;  4ENK A;  3CUO A;  5L3F A;  1Z05 A;  2HQN A;  4YFK F;  1SD5 A;  2KJB A;  3TO6 A;  5E1Z B;  5L3D A;  2OBP A;  4ZZD A;  4BHC A;  2LSO A;  2CQK A;  1P2F A;  5H6Q A;  4MQ9 F;  1GXP A;  1W7P A;  4WX9 A;  1ZG5 A;  3RI4 A;  1P6R A;  5BMZ A;  1R5G A;  3QOP A;  4L0Z B;  3MEX A;  1U3E M;  2DT5 A;  3R6S A;  2IP2 A;  4G8X A;  4G6D A;  2L54 A;  3U2R A;  4KDP A;  2FA5 A;  4EV0 A;  3ABT A;  2KIF A;  2XKO A;  5D5V B;  4XSZ F;  4NHJ A;  1YYV A;  3V8J A;  4GYG A;  2IT0 A;  4L9J A;  2QZ8 A;  5HDK A;  1XN7 A;  1K6O A;  5FGM A;  4EM2 A;  1MDM B;  1EH8 A;  2L02 A;  4A2U A;  4HX8 A;  3HSE A;  1D8J A;  1LEA A;  1UFM A;  1UB9 A;  2PBI A;  2EV6 A;  3ROU A;  4YII A;  3GZ5 A;  4RB0 A;  4LJZ F;  3ZMS A;  3KP4 A;  2HYG D;  4UXN A;  4LLL A;  3SZT A;  2A68 F;  1Z1D A;  5HOO A;  2P6S A;  2XAQ A;  2K4B A;  3P9K A;  3SFZ A;  3HHH A;  3B73 A;  1SAX A;  2R7D A;  3GZ6 A;  1D8K A;  4EGZ A;  1HKS A;  1DP7 P;  5ERI A;  5EEH A;  2KIU A;  5JHU A;  5CVV A;  4XLP F;  5D4R A;  4G6Q A;  3FX3 A;  1FYL A;  1LDJ A;  1G3Y A;  2VE9 A;  3L09 A;  3EUH A;  2UWM A;  2FBH A;  1BIA A;  3ML6 A;  4I0B A;  2RQP A;  3LA7 A;  4L9V A;  3GX4 X;  5ED4 A;  4ZYG A;  2IRF G;  1IN8 A;  3ZPL A;  3GEZ A;  1HW2 A;  4UV8 A;  3QP5 A;  2P5L C;  1TQI A;  3VFZ A;  3E6C C;  5DEQ A;  3F22 A;  4IRI A;  3ERE D;  2MD5 A;  3MZY A;  3HOT A;  4L9T A;  4A0Y A;  2V79 A;  1IRG A;  2EB7 A;  4Z2Y A;  2DW4 A;  3ZMV A;  3I64 A;  2VC1 A;  1YS7 A;  1BOA A;  2FEZ A;  1JHF A;  3E6D A;  4L5I A;  3IHU A;  2KRF A;  3NRV A;  1T98 A;  3WGG A;  1W5S A;  2ELH A;  2M5W A;  2O61 A;  3WU1 B;  3P9I A;  3G73 A;  2Y0M A;  3KLN A;  4XSX F;  2EA4 A;  4EJU A;  1KYW A;  4PGG A;  2VOO A;  3RKX A;  3C3W A;  3C7J A;  4A5N A;  2JRT A;  1DPR A;  3CJN A;  3O6B B;  5L3C A;  2UZK A;  2EFN A;  2F2E A;  5LHH A;  1IXS B;  1QZY A;  2O8X A;  3F8B A;  5FO5 A;  3AAF A;  2MBF A;  2F5C A;  1YTY A;  3FMS A;  3SZP A;  3K69 A;  4N9H A;  2FF4 A;  4ON0 A;  3WTZ A;  1ZYR F;  4G94 A;  5IT9 K;  1X3U A;  4E70 A;  2QQB A;  5HS8 A;  2H6C A;  2ZME A;  3K1N A;  4IHS A;  3HSF A;  4RB3 C;  2O0Y A;  4O3M A;  2EV0 A;  5DCM A;  4A12 A;  2QBY B;  2ZBK A;  4I2O A;  4IRG A;  4BH9 A;  4ZH4 F;  4I01 A;  1KA8 A;  2O03 A;  1R36 A;  1XGN A;  2PLY A;  3DV8 A;  2MC3 A;  2GA1 A;  4RB2 C;  4N9I A;  1UST A;  3DPL C;  1FBS A;  4Y13 A;  1WRJ A;  1WI9 A;  4CIC A;  3GO5 A;  3K1P A;  2D2W A;  5KK1 A;  2WC2 A;  2P4W A;  4U7D A;  1REP C;  1RUN A;  4EQQ A;  4MGR A;  4QLC U;  1AWC A;  2EFO A;  5JR3 A;  4RGS A;  4CDG A;  2QLZ A;  3O3K A;  3QPT A;  3QRF F;  1KU9 A;  1KYZ A;  2DBB A;  2STT A;  3C1D A;  5H20 A;  1R5H A;  4PCQ A;  2B0L A;  1Z6T A;  2FOK A;  1MJA A;  4P9F A;  3KLO A;  1B9M A;  3MZH A;  1LDD A;  3L9F A;  2DQL A;  2GAU A;  5TRD A;  1O3S A;  5KVR A;  4UVA A;  3KZZ A;  4HF1 A;  4IJA A;  3EYI A;  1YG2 A;  1PUE E;  4A0Z A;  2HKO A;  4WWC A;  3I4P A;  1V3F A;  5L3G A;  3ABU A;  1W7P B;  4H0E A;  4FT8 A;  1ZHF A;  3WTW C;  1OMI A;  3GUD A;  1VTN C;  3MAJ A;  4ESJ A;  5JFR A;  2VT2 A;  1KQ9 A;  1S8N A;  4UV9 A;  2XVC A;  4XRF A;  3JAM Z;  5AON A;  1ZG1 A;  3BZ6 A;  3M8E A;  3ZMZ A;  2L01 A;  2WTE A;  3J80 Z;  1XDS A;  3COA C;  1DDN A;  2YR2 A;  2MH9 A;  2YPR A;  5E8I A;  5J6X A;  4KIB A;  3IWF A;  4G7O F;  3R60 A;  2V1D A;  2WV0 A;  2ISZ A;  1TQP A;  2W84 A;  4LD5 A;  3U9G A;  1SD6 A;  4CO8 A;  3R0J A;  4GXO A;  4RGU A;  3JSO A;  3L7W A;  3ZN1 A;  1HKT A;  1BI3 A;  3MWM A;  2HQR A;  4RGR A;  4IXA A;  1MZB A;  3N4M A;  3HTU A;  2QBY A;  2GA2 A;  3I58 A;  1I6X A;  2V1X A;  5DD4 A;  4UVC A;  3WTY C;  2OQR A;  3TOB A;  2NNN A;  3KP5 A;  4HYE A;  1OYI A;  1C0W A;  2G7U A;  4U0Y A;  2VBZ A;  4HDU A;  4RS8 A;  5D6F A;  2P8T A;  3FXQ A;  2DK5 A;  5ILV A;  2KJC A;  2Z33 A;  4HV5 A;  1UCR A;  1R1U A;  2GXB A;  2E7X A;  1XSX A;  3J81 Z;  5LHG A;  1BN5 A;  3P7N A;  3L2C A;  4NQW A;  4EJV A;  3K0L A;  1B9N A;  2V9V A;  1IN6 A;  2O3F A;  3KCC A;  1XDU A;  1FNN A;  2ZCW A;  5BPI A;  2CYY A;  1P4W A;  3EDP A;  1DPU A;  1SFU A;  2BE5 F;  4IVN A;  1YFH A;  1B1B A;  2A6E F;  5E20 A;  5L3E A;  1DUX C;  1TW3 A;  3CLO A;  3RIR A;  2ESN A;  5LEJ A;  1QZZ A;  3LAP A;  3GXO A;  4LB5 A;  2QQ9 A;  4G9Y A;  5HLG A;  2IJL A;  2E1N A;  5D5W B;  2EFQ A;  2G9W A;  2F5D A;  3JAM K;  3GFJ A;  1ZGJ A;  4S04 A;  2J5P A;  2M87 A;  3J80 K;  2YX4 A;  3TO9 A;  3IRR A;  4IF4 A;  1J59 A;  3HSR A;  1F5T A;  3GFL A;  1LDK B;  4Q5S F;  3F3X A;  2GQQ A;  4KIC A;  2K27 A;  4KMF A;  2GWR A;  3EYY A;  1U5T C;  1KQ0 A;  3RYP A;  1P4A A;  3ZMD A;  1P92 A;  4LK1 F;  2ETH A;  2A3S A;  1Z91 A;  2XUB A;  1L3L A;  3F8M A;  4LG0 A;  2K7L A;  1FZP B;  2NAZ A;  4AIH A;  2ZNZ A;  5HLH A;  2XKP A;  1XSV A;  1AOY A;  2LDU A;  5EEG A;  3JW4 A;  2ZFW A;  1J5Y A;  1TBX A;  3L00 A;  4CXF A;  2VON A;  3E5X A;  1RUO A;  1IXR C;  3FMR A;  1P4X A;  2BBY A;  4KT5 C;  1R58 A;  3WTV C;  4HF2 A;  3FXU A;  2MLG A;  4KIG A;  5LLQ A;  3R0A A;  1FY7 A;  4EJW A;  4O6J A;  1I1G A;  4ETS A;  4OIO F;  4M6X A;  3HYI A;  2RNJ A;  4EM1 A;  1QO0 D;  3J81 K;  3E6B A;  4ZYH A;  2DFI A;  4GCV A;  3GYH X;  2BYV E;  3K9T A;  3EET A;  4GGG A;  2ZME B;  2J5O A;  3KEQ A;  3F6O A;  2X4H A;  3IRQ A;  3KP6 A;  5DCM B;  2QEN A;  3TGN A;  1PP7 U;  4FX4 A;  2DU9 A;  3ECH A;  2HS5 A;  4HLY A;  2KKO A;  4UNO A;  2VBW A;  2MLK A;  3DKW A;  4L5J A;  3V8K A;  2ZO4 A;  1XGS A;  1KU2 A;  1T38 A;  4U0V A;  3M1E A;  1G4D A;  2UXX A;  3E5U A;  3M8F A;  1R22 A;  2XAS A;  2VXZ A;  3RTR A;  1KQ8 A;  4KA4 A;  4AVP A;  2GIV A;  4WCG A;  4MHG A;  2FSW A;  2VBX A;  3WG9 A;  3P9C A;  3F8C A;  3KP3 A;  2H27 A;  1IF1 A;  4HAM A;  4KUM A;  4O5V A;  2FNP A;  1B4A A;  1YO5 C;  2EFW A;  1S7A A;  5DV5 A;  3BY6 A;  2PEX A;  3D0S A;  4OIN F;  1S29 A;  1JXS A;  3LA3 A;  1F1Z A;  3REO A;  3ZP5 A;  3M9A A;  3GFI A;  3JTG A;  1LVA A;  1FP2 A;  4M9X A;  5LRS A;  4WF2 A;  5E1X A;  3CUQ A;  4LLN A;  3W6K B;  3DFG A;  1NHA A;  1ZH5 A;  2L3D A;  2O6G E;  2PMH A;  4JBA A;  1ZRC A;  3I59 A;  1IN7 A;  3CO7 C;  4Y15 A;  1OR7 A;  4KNY A;  2FXA A;  5ILU A;  3PFI A;  3N97 A;  4R1H A;  1FYM A;  1ZRE A;  1TTY A;  4ENN A;  3Q9V A;  4ZYE A;  2CSO A;  1CGP A;  4CYD A;  4HDV A;  1B6A A;  1S3J A;  5LHI A;  2DI3 A;  4XLN F;  1XGO A;  4WK8 F;  5LBQ A;  1MGT A;  1FT9 A;  1J7K A;  1FOK A;  1G3T A;  5F1R A;  4Q47 A;  2W85 A;  3TDU C;  3HRM A;  4I02 A;  2PN6 A;  1TLH B;  2QVO A;  4YG2 F;  4A5M A;  1U2W A;  4AIK A;  5J8C A;  5LRR A;  4PDK A;  1UHW A;  1U5T A;  5DYM A;  3HUG A;  1ZAR A;  3F21 A;  3VB2 A;  4UUV A;  3DEU A;  4F7Z A;  1BI2 A;  1J2X A;  4A6D A;  2Z5U A;  1HXD A;  4K2E A;  3RPU A;  1YLF A;  1Z7U A;  4A0X A;  3K2Z A;  3ELK A;  5DD8 A;  4UHT A;  2OU2 A;  5TJJ A;  2Z9O A;  3I0T A;  3ZMT A;  2CFX A;  5HDN A;  3F23 A;  3V4G A;  2Q2E A;  1TW2 A;  3NEU A;  2DK8 A;  3LWF A;  3BDD A;  3TOA A;  2M1B A;  2VN2 A;  5CVR A;  3WE3 A;  1EH6 A;  2H94 A;  3TKY A;  4Y17 A;  5AIP A;  1FWZ A;  3PQJ A;  4MQV A;  1USS A;  1O7L A;  4IHT A;  2FMY A;  5E8G A;  1LEB A;  4I7H A;  2OZU A;  5D8L B;  4I09 A;  4S05 A;  3B02 A;  2D45 A;  2OQG A;  5FFZ A;  2PQ8 A;  3HRU A;  2RN7 A;  5DCF A;  1W5T A;  3K1M A;  3BWG A;  5HS9 A;  1D3Y A;  1JGS A;  4KN7 X;  5CVU A;  4YIF A;  1YW7 A;  5HS7 A;  4M74 A;  1HW1 A;  2IA2 A;  1FSH A;  2RC4 A;  4JQF A;  1O7F A;  4KYW A;  3T0Y A;  2Z3Y A;  5HVQ C;  2XAG A;  3ECO A;  1SFE A;  1TNT A;  2HWV A;  1HST A;  1ZRD A;  3T8T A;  4EMS A;  3KP7 A;  1ZRF A;  4BHB A;  1I1S A;  5JVT A;  1Z6R A;  3SHF A;  5K5O A;  4N0B A;  2LKP A;  4DQ2 A;  3Q5F A;  5JI6 A;  3F6V A;  2YX7 A;  3BRO A;  4YFN F;  4HA8 A;  4LLG F;  1FP1 D;  2UXN A;  4MEX F;  1FX7 A;  4JK1 X;  1BC8 C;  1GXQ A;  2BGC A;  2WWY A;  2JSC A;  2W57 A;  4HQM A;  4LG0 B;  2XAH A;  1JE8 A;  2IVM A;  3VEP A;  2ESH A;  4EVI A;  3R4K A;  1T2K A;  1FBQ A;  4HBL A;  2L4A A;  5E18 F;  2VOD A;  1W7P D;  1CF7 A;  1LNW A;  1PP8 F;  4CGZ A;  4LB6 B;  2A5Y B;  1KU3 A;  2VE8 A;  2HDC A;  3G3Z A;  3IKV A;  3BPV A;  5BS6 A;  3I53 A;  4Q4Z F;  2XRO A;  1XGM A;  3MQ0 A;  1ZLK A;  1QPM A;  2IA1 A;  1WQ2 A;  3T8R A;  1WKM A;  3SXY A;  5E17 F;  1ZLJ A;  5IT3 A;  4LMY A;  1STZ A;  3JSP A;  4OMY A;  2DPU A;  1QQI A;  5LGN A;  3KE2 A;  4RB1 A;  3IKT A;  1WSU A;  5K1Y A;  2Y75 A;  4L0Y B;  1O3Q A;  1R7J A;  5D8K B;  4PZJ A;  4WXH A;  4R8H A;  1O57 A;  4WXC A;  1BBY A;  1SD4 A;  3DXJ F;  2L4M A;  5K5Q A;  2R7F A;  2XV4 S;  1WWX A;  1LJ9 A;  3RJP A;  1BJA A;  3IWZ A;  2HOE A;  1H9G A;  5CVI A;  1EV7 A;  4P9U A;  4AIJ A;  2XAF A;  2FNA A;  1R23 A;  4RAZ A;  3E5Q A;  2M30 A;  4ZYD A;  4CHU A;  2CWE A;  2JPC A;  4KIF A;  2F5F A;  1YW9 A;  5BOX A;  4XBF A;  4MNU A;  4M71 A;  3WE2 A;  2VC0 A;  4MEY F;  4FX0 A;  4U88 A;  2QUF A;  1K79 A;  2EV5 A;  5AIQ A;  3V7R A;  1B59 A;  2EFP A;  2ADU A;  1S6L A;  5ILS A;  3CTA A;  1EH7 A;  1T0F A;  3BP8 A;  5FD5 A;  2DTR A;  1XSD A;  1ZG3 A;  4HF0 A;  2RV8 A;  3CUQ B;  1E2X A;  1J75 A;  5CYV A;  3V7S A;  3MFK A;  1MJB A;  3PQK A;  1H0M A;  3I59 B;  5FD6 A;  4KMU X;  2K86 A;  2HGC A;  4HQE A;  1IAW A;  4Q48 A;  1K78 A;  4M6Y A;  4EGY A;  1F4K A;  4B8X A;  1MD0 A;  4ESF A;  2ZKZ A;  4KFC A;  5L3B A;  1YS6 A;  3IC7 A;  2CO5 A;  1IUY A;  3E3V A;  3FMQ A;  4AWX B;  3FM5 A;  3WTS C;  2P5K A;  1KGS A;  2JTV A;  2M45 A;  2YSR A;  2Z99 A;  3BOQ A;  3LQR A;  5D6E A;  1A04 A;  4OIP F;  4BYY A;  1ONV A;  2FBK A;  3LAJ A;  3GVA A;  2XHK A;  4L18 B;  2CGP A;  1Y0U A;  1BM9 A;  3BJA A;  5E1W A;  1G6N A;  2OZ6 A;  4OOI A;  1ON1 A;  1U5T B;  1J0R A;  3U1D A;  1TNS A;  3TO7 A;  5LEK A;  2ZNY A;  1BI1 A;  2EWN A;  2QWW A;  1Q1H A;  2VT3 A;  2XAJ A;  3NQO A;  1GVJ A;  5CJ9 A;  3WU0 A;  2HR3 A;  1OKR A;  3ZQ7 A;  5HDG A;  2KIM A;  3H3Z A;  4I98 B;  1L0O C;  3C18 A;  2PJP A;  4QWQ A;  1HW5 A;  2D1V A;  3E6M A;  3FHZ A;  1HBX G;  2AXL A;  5IT9 Z;  4OMZ A;  1OYW A;  3Q9S A;  4OIR F;  3J7A O;  4HV6 A;  3WOD F;  3QU3 A;  2HTJ A;  5LGU A;  1XCV A;  1G3W A;  4L9N A;  6PAX A;  2Y48 A;  1IN4 A;  1BI0 A;  2PI0 A;  3I5U A;  2XGX A;  3GW2 A;  3CDH A;  1R1T A;  1FYK A;  4TV7 A;  2NYX A;  4HX4 A;  2NS0 A;  1IN5 A;  3HRT A;  5D4S A;  1JHH A;  3DF8 A;  2JT1 A;  1HQC A;  3SQN A;  1O3R A;  2RGV A;  4KN4 X;  3D5L A;  2JZY A;  2PG4 A;  3HTS B;  4LFU A;  2R3S A;  1QBJ A;  3KET A;  5ICC A;  1LQ1 A;  5D5X B;  1Z9C A;  4ZZL A;  3ZN0 A;  1RZ4 A;  3CO6 C;  3FZV A;  4ESB A;  4OIQ F;  5ICE A;  1RIO H;  2D1H A;  4WXD A;  1R00 A;  1IZ1 A;  2CG4 A;  2Q0O A;  3WTX C;  2PMU A;  3IL2 A;  4BHP A;  2BV6 A;  1G3S A;  2LF7 A;  3HRS A;  2FBI A;  1SFX A;  4P5O A;  4GYI A;  4LGW A;  4ENM A;  4HLX A;  2RVC A;  2IA0 A;  2HZT A;  4G7Z F;  3GFM A;  2FQ3 A;  2ACJ A;  1FC3 A;  1BC7 C;  1LB2 A;  1OYY A;  4P96 A;  3LA2 A;  1MDM A;  1R1V A;  3RYR A;  5DDG A;  2OAZ A;  4IRH A;  3V8L A;  1O3T A;  1ZAO A;  2LNB A;  2W25 A;  2DO7 A;  2Q8K A;  4BQA A;  5DUK A;  1CF7 B;  3FM3 A;  1S7O A;  1J9I A;  2FU4 A;  3DQV C;  4LK0 F;  3JTH A;  2STW A;  3I54 A;  5CVJ A;  2OA4 A;  4BNC A;  2P5V A;  4IPA A;  2HTS A;  3VOD A;  1SD7 A;  2PFB A;  2A69 F;  2H6B A;  2JPB A;  1ULY A;  2K02 A;  3ISP A;  1ZN2 A;  5BQT A;  2E1C A;  3WTT C;  3GWZ A;  4D0P A;  2V6C A;  4EJO A;  1I5Z A;  1HSJ A;  1QGP A;  4RGX A;  5A2Q Z;  2HKX A;  1ON2 A;  3H92 A;  5ICG A;  4ENJ A;  3S2W A;  2W24 A;  2H09 A;  3BJ6 A;  3BJO A;  2P7C B;  1T6S A;  2EK5 A;  1FLI A;  3OOP A;  2IPQ X;  5FFX A;  1ODD A;  2V1U A;  3KZY A;  1HKQ A;  5ICF A;  1RI7 A;  4EM0 B;  3O2P E;  3H3U A;  4NB5 A;  5D5U B;  1IRF A;  3RKY A;  5BPD A;  3QU6 A;  2MH2 A;  1FSE A;  1IW7 F;  1SMT A;  3RPQ A;  3WGH A;  4R79 A;  1PDN C;  1E17 A;  2A61 A;  4HX7 A;  2ZXJ A;  3HIF A;  2HFH A;  1XD7 A;  2E7W A;  2DQR A;  4GO1 A;  3FXR A;  3M7G A;  2FRH A;  2EA2 A;  3I71 A;  2FML A;  2MA3 A;  3QP6 A;  1GHC A;  3DPT A;  2LF8 A;  2NNY A;  3BPX A;  4M9S A;  1IXC A;  1KU7 A;  4I0A A;  3KFW X;  1FBU A;  5LGT A;  3FF5 A;  3KP2 A;  5FLX Z;  1U78 A;  2AS5 F;  2A07 F;  1XB4 A;  4G7H F;  3E97 A;  1YIO A;  3HHG A;  3RDI A;  4OU0 A;  2VBY A;  4MTD A;  2P6T A;  5F6F A;  5DUI A;  3FWE A;  2XRN A;  2DAO A;  4UVB A;  1U8R A;  2F5E A;  2P7V B;  1K78 B;  3MCZ A;  1TQM A;  4EJT A;  1FPQ A;  2X0L A;  2DPD A;  2ISY A;  2G7H A;  2NRA C;  4U0W A;  2COM A;  1T39 A;  1XCB A;  2QM3 A;  3F72 A;  2TDX A;  4M9Z A;  2ZJ2 A;  1YW8 A;  3QAH A;  4CZZ A;  3HOS A;  5FB2 A;  5HLI A;  1W4M A;  3ULQ B;  4B09 A;  4MTE A;  5A2Q K;  1ZGA A;  2VOP A;  2YU3 A;  3EQL F;  1OPC A;  4FHT A;  3T5X A;  4M73 A;  2C6Y A;  1F9N A;  1MKM A;  1QNT A;  1XMK A;  1RNL A;  4DNC A;  3OV8 A;  2XIG A;  4HZF A;  3V7C A;  4U7B A;  4ASN A;  3W6J B;  1H9T A;  3LFK A;  5K5R A;  2CW0 F;  3DP7 A;  2QYO A;  3RKW A;  2BEO A;  3F8N A;  3TDZ C;  2GXG A;  3T1B A;  3WGI A;  1K7A A;  2RKH A;  1V4R A;  4P55 A;  2FE3 A;  4BAY A;  1YQA A;  1MJ9 A;  4YFX F;  4AD9 A;  5J8F A;  2QQA A;  2RDP A;  5CLS A;  3R61 A;  3QPH A;  4HW0 A;  3VOE A;  3LST A;  3CUQ C;  1SMY F;  5F64 A;  4PGH A;  3WTU C;  3ZMU A;  2DLL A;  2M8E A;  3F8F A;  3LQQ A;  3TQN A;  2GZW A;  4RAY A;  5FLX K;  2A6H F;  3KEO A;  1I27 A;  3GF2 A;  1D5V A;  1XMA A;  3GLX A;  2HYF A;  1BIB A;  2IW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...