2M45A

Nmr solution structure of the c-terminus of the minichromosome maintenance protein mcm from sulfolobus solfataricus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
87
structure length
87
Chain Sequence
GSHMGESGKIDIDTIMTGKPKSAREKMMKIIEIIDSLAVSSECAKVKDILKEAQQVGIEKSNIEKLLTDMRKSGIIYEAKPECYKKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Minichromosome maintenance protein MCM
publication title Structure and regulatory role of the C-terminal winged helix domain of the archaeal minichromosome maintenance complex
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 27
structure length 87
sequence length 87
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2013-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2m45A00
2XIGA 3WTXC 5F1RA 1BI0A 1R36A 2VC1A 4U88A 5ICFA 1IW7F 3CLOA 3F3XA 3L7WA 4WXCA 1IN4A 4MEYF 5K5QA 2O0YA 4A5NA 2STWA 4HAMA 2FSWA 2RC4A 2J5PA 3VEPA 2K7LA 2DK5A 5K5OA 2CYYA 4EM1A 4G9YA 2IA2A 2FMYA 3KP5A 4IHTA 3QU3A 1TTYA 3IKVA 5CVIA 2VONA 2VE9A 3EUHA 3ROUA 2OQGA 2Y0MA 3QU6A 4UV8A 1FNNA 2D45A 3TDZC 3RYPA 2OZUA 3GW2A 5FD6A 1PDNC 1K7AA 5F64A 5ERIA 5H20A 4K2EA 2XVCA 4I09A 1VTNC 4R79A 2JSCA 2QWWA 2L4AA 1ZG1A 2Q2EA 2OBPA 1HXDA 2KRFA 2PFBA 5HS8A 3WTTC 1UHMA 2FOKA 2OZ6A 4H0EA 2EFPA 4HV6A 4ESBA 1ONVA 4UVAA 4KUMA 3I0TA 2D2WA 1ZG5A 1YW7A 5CVRA 4OIQF 1UFMA 4HF2A 3K9TA 4MQ9F 3P7NA 2GXGA 3EYIA 3ZP5A 1OR7A 2FMLA 5D6FA 2YSRA 2YPRA 3D5LA 1K79A 3KLNA 1U8RA 3HSEA 1RNLA 5DDGA 4M71A 1EH8A 3GWZA 4HW0A 5DD4A 4P5OA 1FP1D 1FX7A 4HF1A 3L09A 3HRSA 3JAMK 1GXQA 3WGIA 4NQWA 3AAFA 1JXSA 1MJBA 2FU4A 2EA4A 2Z33A 1LDDA 3G73A 5JVTA 3EETA 3R6SA 1Y0UA 3ABTA 5L3DA 3JAMZ 4G7OF 3I54A 4RGXA 3DP7A 3E6DA 5L3EA 1FOKA 1U5TA 4S04A 3EDPA 1IXSB 1O57A 1LJ9A 1TNTA 3QAHA 4F7ZA 2DQLA 4RB1A 2HKXA 3KP6A 1AOYA 4MTEA 3BJOA 1XMKA 1S6LA 1ODDA 3ZPLA 1ZH5A 2NNYA 1KYZA 3M1EA 2M1BA 4IXAA 3H3ZA 5L3BA 1XCBA 1QQIA 4CGZA 3NEUA 3K0LA 3QOPA 3E5QA 3BWGA 3CUOA 4M74A 3U2RA 2BBYA 3JSOA 2HR3A 2F5EA 4A6EA 1Z9CA 4EV0A 3IRRA 4OMYA 3GZ5A 1R00A 2FNPA 4HV5A 3K2ZA 2M5WA 3QPHA 4M9XA 4A0XA 3LA7A 2DI3A 1ZAOA 3C7JA 3TQNA 2F2EA 5LRRA 1XB4A 1R1VA 2L01A 3RPUA 1QZYA 5D8KB 4UNOA 3L00A 4P9FA 3ECOA 3MZHA 4IHSA 3LAPA 4UVCA 3O6BB 2KIMA 5E17F 3I4PA 3MZYA 4EVIA 3WTWC 5JR3A 2HS5A 4CYDA 2WWYA 4HZFA 1S7OA 2HKOA 1QPMA 2IA0A 1TQPA 2NRAC 5D5VB 2LNBA 4G7ZF 5LGNA 2EFOA 2FNAA 2ZMEB 1GVJA 4G94A 4ENJA 1YYVA 1R1UA 4YIFA 1WSUA 5E20A 5J8CA 1ZRDA 4L5JA 1F9NA 4A0ZA 1O3QA 4Q5SF 3KEQA 1BC7C 1HKQA 3PQKA 3NRVA 1ZHFA 2ZKZA 2W57A 1USTA 3FMQA 3ZMZA 4AIJA 1F1ZA 2M8EA 4OIRF 2P6TA 1WWXA 2IRFG 3DEUA 3VFZA 3F6VA 5HS7A 1FSHA 1IAWA 3FHZA 1G3WA 3U1DA 4L0YB 1RZ4A 4M6XA 2COMA 4PGGA 3KP3A 3I71A 2DTRA 1XSDA 2Z99A 5E18F 1OYIA 2P8TA 2PN6A 4L18B 1G6NA 1U5TC 1FY7A 4AD9A 2BEOA 4JQFA 2VODA 2VC0A 3M9AA 5J6XA 2RGVA 2RKHA 1H0MA 3KEOA 2VOPA 4G8XA 2HEOA 5HDNA 1ZREA 4M72A 4IRGA 2IA1A 3BOQA 2RV8A 3RI4A 1GHCA 2FF4A 2MH2A 1D3YA 3E6BA 4EQQA 2EV0A 3DFGA 3HUGA 5F6FA 5HOOA 2PQ8A 1ZN2A 4RB0A 2ESHA 2WV0A 1HW1A 2A69F 1R5HA 2ETHA 1XD7A 2CW0F 3GO5A 5LRSA 1S3JA 1AWCA 2Z9OA 4RB2C 1P4AA 3DPLC 3R4KA 4HA8A 2W25A 2JT1A 2C6YA 1BBYA 2ZCWA 5TJJA 4HDVA 5HDGA 4WF2A 4WWCA 3HRMA 5E8GA 1LDJA 3GFMA 3RKXA 3WE3A 2HGCA 5BOXA 3ISPA 3VB2A 3DQVC 2RQPA 2HOEA 3P9IA 2K27A 1V4RA 1YIOA 3QP6A 5DYMA 4EJUA 2GIVA 3F8NA 4HF0A 2V6CA 3M8FA 3GYHX 3B02A 5LHHA 4ENKA 3BY6A 2BGCA 2HQRA 2IVMA 3KETA 2L02A 4HLXA 3DKWA 4LG0B 4WCGA 4LLNA 4WXHA 3K1MA 1YS6A 4CO8A 2HQNA 2OA4A 1DDNA 3LSTA 4HLYA 1KYWA 2VBWA 3H92A 4BHBA 5LHIA 2E7WA 2Y75A 3FZVA 3ZMSA 4QLCU 5BS6A 2ELHA 1IF1A 5IT3A 4KIGA 2GA2A 2YU3A 1J5YA 4KMUX 4RAYA 3SXYA 4HBLA 2P7CB 3WGGA 2ZBKA 1R22A 4EJOA 2ISZA 1PP8F 3TKYA 4R1HA 1IN5A 2V1DA 4KIFA 4EM2A 2PG4A 2M30A 3T0YA 4O3MA 1J2XA 5E1ZB 3LFKA 4U0YA 4P55A 4BHPA 4KICA 1OPCA 2YR2A 3RYRA 4YFNF 2VXZA 1ON2A 3GF2A 5CVUA 4RS8A 1I27A 3CTAA 3FMSA 3KFWX 2A5YB 2GWRA 2OD5A 5CLSA 2K02A 1Z05A 1XCVA 3K1NA 1TLHB 2GZWA 4GYGA 2O03A 2FXAA 2DPDA 1PUEE 3ULQB 2ZXJA 2A3SA 3T1BA 3C3WA 1XGSA 1KQ9A 3T8RA 2QQ9A 1DP7P 1SD4A 1FPQA 3MQ0A 4A6DA 4RGUA 1UHWA 4Q4ZF 3IKTA 4MHGA 1IZ1A 3P9CA 1FYLA 4I98B 1FLIA 1H9TA 5DUIA 3FX3A 1W4MA 2LSOA 2XKOA 2IPQX 1TQIA 3DF8A 2DK8A 2IJLA 5E8IA 1EH6A 1KU7A 2V1UA 2EB7A 4O5VA 2MBFA 1XN7A 4OMZA 3RTRA 5HLIA 3F6OA 1K6OA 3NQOA 1TQMA 1LB2A 4CZZA 4RGRA 3Q9VA 2H6CA 2X4HA 4XSZF 5DV5A 2UZKA 2ZJ2A 3GFIA 1IN7A 4FHTA 4OIOF 3CJNA 5LLQA 3MAJA 5BPDA 5LHGA 2Z3YA 2XROA 3F8BA 1WRJA 5IT9K 3BROA 3ZN1A 2L54A 3ZMVA 4IRIA 3PQJA 3JW4A 1B9MA 3OV8A 2O3FA 2AXLA 1P4WA 3GUDA 4HYEA 4OU0A 2GQQA 3F23A 1RIOH 5IT9Z 1YTYA 2M87A 2K4BA 4OIPF 1BI2A 5FO5A 4NB5A 1W7PD 1J59A 1D8JA 1YFHA 2ZNYA 5ILVA 1BIAA 1IUYA 4DNCA 2DLLA 2MLGA 2TDXA 1T39A 3HHHA 1BI1A 2O6GE 4PGHA 5A2QK 2VE8A 2YX4A 4E70A 1EH7A 2M45A 4Y17A 3I5UA 2EV6A 1BI3A 2VN2A 1XSXA 1L3LA 3E3VA 3QRFF 2MD5A 1WI9A 4LFUA 5A2QZ 3F72A 1U3EM 5FFXA 1IRFA 2ZMEA 2E1NA 3CUQB 2EA2A 5FD5A 2OAZA 5LGTA 4MGRA 2H94A 5DUKA 5CJ9A 5EEHA 3ZMDA 3H3UA 4A5MA 1MJAA 4LK1F 1B6AA 1D5VA 2A6HF 1O3SA 2G9WA 3ECHA 4EGZA 5DD8A 4L0ZB 4HDUA 5D5WB 3GVAA 5FGMA 4HQMA 1HSJA 3TO7A 1HKSA 4LLGF 3JSPA 1PP7U 1I1GA 1W5SA 4LB5A 2A07F 1USSA 2RVCA 2EFNA 3T8TA 1E2XA 4GXOA 3ABUA 3E5XA 2E1CA 5AIPA 3ERED 4LD5A 1KQ0A 1JHFA 3GXOA 2MC3A 3PFIA 4ZYDA 2Z5UA 3I59B 3GFJA 4RB3C 3CO7C 3ML6A 2FE3A 5ILSA 3HYIA 3RDIA 3R61A 1H9GA 1XGOA 3ZN0A 2QBYB 3HRTA 1BN5A 1C0WA 2PLYA 3N4MA 2HYGD 5HS9A 1SFEA 1J9IA 1YS7A 1SD6A 2HFHA 2JTVA 3C1DA 3F8CA 3IWZA 2P4WA 4MEXF 1SMYF 2GXBA 5EEGA 5BMZA 1O3RA 2RN7A 4KFCA 1CF7B 1FT9A 1FZPB 3J81K 4M6YA 1I5ZA 3GX4X 1HQCA 3J7AO 5DEQA 4KN4X 3E5UA 2FA5A 1OYYA 2ZFWA 4LMYA 1ZG3A 1W7PB 2BYVE 1FYKA 2WC2A 1SD5A 1SFXA 3K1PA 3J81Z 1RUOA 2FBHA 3ZMUA 4U7BA 2FBIA 1ZYRF 3SZTA 2D1HA 2UXNA 2K4JA 3VOEA 1UCRA 4I7HA 2PI0A 3KZZA 5LEJA 1R7JA 4R8HA 5TRDA 1XSVA 1OMIA 2PEXA 1QO0D 4JBAA 2EV5A 3HIFA 4ZH4F 5LGUA 5D8LB 3HSFA 3E97A 3HSRA 2CG4A 3KCCA 6PAXA 1QBJA 3WU1B 2VT3A 1J75A 4LG0A 1O7LA 3MFKA 2FQ3A 3LA2A 1DPUA 3VODA 2G7HA 3BZ6A 1XMAA 2XAHA 2EWNA 2KKOA 3V7SA 2G7UA 4XLPF 2QQBA 3R60A 4IVNA 2P5KA 4M73A 1LEBA 1KQ8A 1YQAA 3BJAA 2JPBA 1O7FA 2CQKA 3KP7A 3D0SA 3LA3A 1L0OC 1ZRFA 2XV4S 2WTEA 3MCZA 2D1VA 1ZGJA 2MA3A 2XAGA 1JGSA 1U2WA 1IRGA 4Q47A 1T0FA 3V8JA 2XAJA 2PBIA 3HHGA 1HKTA 4GCVA 3V7RA 2OU2A 1ZLKA 1KA8A 1SD7A 1U6GA 4IPAA 2QUFA 5K5RA 1MGTA 2P5VA 3M7GA 2VBYA 5D4RA 5HLGA 2QYOA 4ETSA 4P96A 2RDPA 1B59A 3COAC 2CWEA 4N0BA 1E17A 5FFZA 5J8FA 2DT5A 4BNCA 2ISYA 3TO9A 4D0PA 1FP2A 1SMTA 1LNWA 4XRFA 1BC8C 1MJ9A 2HYFA 1I6XA 4U0VA 5AIQA 2LDUA 3KP2A 4O6JA 1Z1DA 3SZPA 4UV9A 2V9VA 4BH9A 3GZ6A 2EFQA 1T38A 3V8KA 3KLOA 5JFRA 4L9NA 2R7FA 2H09A 5ICEA 1J0RA 1KU2A 3TO6A 2V1XA 3HTUA 3WTSC 1S29A 1U78A 5E1XA 1IXCA 5D5XB 3EQLF 3ZMTA 2PJPA 2F5DA 4KMFA 2FEZA 3FM3A 2QZ8A 5H6QA 2A61A 2HZTA 5KVRA 1F4KA 1O3TA 3DV8A 2MH9A 4YIIA 4Q48A 1K78B 3S2WA 2XGXA 2VBZA 2XUBA 4RAZA 5DCMB 4YFKF 4I2OA 3V8LA 1Z6RA 2W85A 3IHUA 1FSEA 5JI6A 4A0YA 4AVPA 1ZARA 4UVBA 2CFXA 3KP4A 1MDMB 4N9IA 1FBUA 1FWZA 3DPTA 5BPIA 3LWFA 1EV7A 4HQEA 2UWMA 4S05A 2LF7A 5CVJA 2XKPA 1A04A 2CO5A 1B4AA 5H6RA 4B09A 3EYYA 4I0BA 4AWXB 4Y13A 4G7HF 4KNYA 2ZO4A 2QENA 3TOBA 5AONA 4CDGA 3RKYA 5ICCA 2A6EF 4ASNA 3W6JB 1D8KA 2LF8A 3RIRA 3IC7A 2XAFA 2B0LA 3CUQA 2CGPA 4U7DA 3RKWA 1FYMA 1KU9A 1MD0A 2DO7A 2L3DA 3WTYC 2CSOA 1ZLJA 3ZQ7A 2XAQA 4JK1X 3CDHA 1P92A 5L3FA 3SHFA 4XSXF 5HDKA 3IWFA 4GYIA 2R7DA 4Y15A 4FX0A 5HVQC 1XDSA 3FF5A 4ESFA 3BJ6A 1QGPA 3BDDA 4XLNF 4L9TA 1WQ2A 4L9VA 2Q0OA 2P5LC 4N9HA 3LAJA 1F5TA 4OINF 1HW5A 2F5FA 3WTUC 1B9NA 3HOSA 1Z91A 2DAOA 2A68F 3KE2A 4EJVA 3IL2A 4HX4A 2EFWA 1YW9A 3RJPA 5JHUA 4MNUA 3BPVA 1XGMA 4TV7A 5BQTA 3I59A 2L4MA 1RUNA 1FC3A 4PDKA 5CVVA 2K86A 1ZRCA 2QBYA 2F5CA 3L9FA 3Q9SA 4RGSA 1G3TA 1MZBA 4OOIA 2H27A 3O3KA 1UB9A 4KT5C 1KU3A 4M9ZA 4BAYA 1GXPA 1Z7UA 5ILUA 1SFUA 4ZZLA 5CYVA 2GA1A 1T2KA 1OYWA 1CF7A 3WGHA 1P2FA 1R58A 3C18A 1TW3A 4FT8A 2QLZA 3HOTA 4I0AA 4L9JA 2H6BA 1W7PA 1YO5C 2ZNZA 2R3SA 4L5IA 1YW8A 4KN7X 2STTA 1KGSA 3FM5A 4PCQA 4KYWA 1REPC 5L3GA 5HLHA 1X3UA 1FBQA 3F8FA 1LQ1A 1V3FA 1B1BA 4ENNA 3SFZA 1LEAA 4AIHA 1Q1HA 1NHAA 1IN8A 1QNTA 2IT0A 1TBXA 4KIBA 2ACJA 2V79A 3QPTA 2P6SA 3WTZA 1MKMA 3K69A 2XRNA 2W24A 1G3SA 5LBQA 4M9SA 5ED4A 5D4SA 2FRHA 1XDUA 4PZJA 3I53A 4IJAA 2HTJA 1JE8A 5D5UB 1BOAA 1TNSA 1RI7A 3CO6C 3CUQC 3DXJF 4HX8A 4HX7A 2UXXA 1R23A 3OOPA 4ZYEA 1OKRA 2FBKA 4LJZF 1U5TB 4EMSA 4U0WA 1T98A 4LLLA 1HBXG 3F21A 4HOBA 2NAZA 5KK1A 3JTHA 3R0AA 2MLKA 4XBFA 2QQAA 2VBXA 2GAUA 1DUXC 1WKMA 3U9GA 4YG2F 2YX7A 1W5TA 4CHUA 2QVOA 4G6QA 2RNJA 3TOAA 4ZYGA 4A12A 3MWMA 2VT2A 4EM0B 3JTGA 3GLXA 3FXQA 2E7XA 4WX9A 2EK5A 1TW2A 4CICA 2DFIA 1I1SA 1G4DA 3RPQA 4I01A 2BV6A 3QP5A 4LB6B 3B73A 4ZZDA 1JHHA 4KDPA 5FLXK 4LGWA 4FX4A 4EJWA 4UXNA 3LQQA 1P4XA 1P6RA 2DU9A 2PMUA 3HRUA 1BJAA 4GGGA 4QWQA 2DQRA 5E1WA 3TGNA 2DBBA 2KIUA 3GEZA 4BHCA 1ULYA 5FLXZ 3WU0A 3G3ZA 4AIKA 4BXUA 1HSTA 3F8MA 3WE2A 3WODF 3WTVC 2JZYA 4EGYA 3WG9A 5LEKA 4NHJA 4ESJA 1G3YA 3T5XA 1LVAA 1ON1A 4IF4A 1T6SA 3O2PE 3FWEA 1FBSA 4CXFA 3BP8A 3P9KA 3W6KB 2KJCA 3J80K 4G6DA 2O61A 2NNNA 5K1YA 3LQRA 1CGPA 2KIFA 3KZYA 1K78A 2JPCA 3REOA 3V4GA 4MTDA 1HW2A 2NS0A 3Q5FA 4ENMA 3E6MA 3J80Z 4A2UA 5DCMA 3IRQA 1S8NA 1J7KA 2VOOA 3GFLA 2Y48A 2AS5F 4UUVA 2KJBA 1IXRC 4MQVA 1IN6A 2XHKA 2Q8KA 4BYYA 1ZGAA 2ESNA 1MDMA 4IRHA 1STZA 4I02A 1XGNA 4UHTA 4WK8F 5D6EA 3L2CA 3BPXA 2NYXA 4KA4A 2IW5A 4P9UA 2LKPA 1S7AA 3R0JA 1QZZA 1YLFA 4YFXF 2BE5F 3F22A 2DW4A 5FB2A 3TDUC 5ICGA 2J5OA 3M8EA 2O8XA 2X0LA 3FXUA 4WXDA 3MEXA 4Z2YA 1LDKB 3V7CA 2P7VB 3SQNA 1SAXA 2EJRA 2IP2A 1Z6TA 3FXRA 2HTSA 2PMHA 4LK0F 3I64A 3N97A 4EJTA 1BM9A 4BQAA 4GO1A 2ADUA 4B8XA 2HWVA 1BIBA 3HTSB 4ON0A 1DPRA 3FMRA 5L3CA 3I58A 2HDCA 2XASA 4ZYHA 2OQRA 1R5GA 2DPUA 2JRTA 2QM3A 1YG2A 3ELKA 5DCFA 2W84A 3E6CC 1R1TA 4DQ2A
chains in the Genus database with same CATH superfamily
5J4VA 4HNUA 2F6CA 3PO2J 2ZJRF 1GVDA 5M5YJ 2XIGA 3WTXC 5F1RA 1BI0A 1R36A 2VC1A 2XDVA 4U88A 5ICFA 1PUFA 2WB1N 1Q1VA 1J09A 1D0XA 1YITI 1IW7F 3CLOA 3F3XA 4UUSB 3L7WA 4CZCA 2V26A 4II2A 4IKFA 2A05A 4PK4A 4WXCA 1BJZA 2O8KA 1IN4A 4MEYF 4NUBA 1ETYA 3DBHB 3OYBA 3OYDA 1TWAJ 5K5QA 2O0YA 4A5NA 3JRHA 2IAIA 2STWA 4HAMA 2FSWA 2OCCH 2RC4A 2VPRA 1GV2A 3G4SI 2J5PA 1BR2A 3VEPA 2K7LA 4DZJA 3S1RJ 1VFCA 2DK5A 5K5OA 2CYYA 4EM1A 1VQPI 4G9YA 2IA2A 1JJ6C 1VQ4I 2FMYA 3KP5A 4HG2A 2E5NA 4IO9F 4YRVA 2HXIA 4XN0A 4IHTA 1ACIA 3QU3A 1TTYA 4XLCA 3IKVA 5CVIA 3G71I 2E60A 2VONA 2ID3A 2OCEA 3OYAA 4B44A 1YX3A 2VE9A 3EUHA 4E7HA 3QWLA 1ZK8A 3ROUA 2NS8A 2OQGA 2Y0MA 3QU6A 4H4KC 4UV8A 1IV6A 4UY8I 1FNNA 4IZZA 2D45A 3TDZC 3RYPA 3FBNB 4B43A 2LY1A 1JI8A 1WJ5A 3CD6I 3CJTB 2IGOA 1W36D 3HGYA 1XX5A 2LBFA 2OZUA 3GW2A 1T33A 1V54H 2R7XA 1LFPA 2JVGA 5FD6A 1R4MB 1PDNC 2DA5A 1SEUA 3DTEA 1K7AA 5F64A 2JA2A 5ERIA 3L2RA 5H20A 3G1MA 2XVCA 4K2EA 4I09A 4C30A 1VTNC 3MD2A 4R79A 1IG7A 2JSCA 2QWWA 2W00A 2Y0SA 4N4OB 2QSFX 2L4AA 1ZG1A 4J00A 4ABZA 2Q2EA 2OBPA 1FTZA 1HXDA 1BL0A 5JVGF 2JA7J 2KRFA 2PFBA 2ZFUA 5HS8A 5J1YA 1WJFA 2DJNA 3WTTC 1UHMA 2FOKA 2L9SA 3G6EI 3UKGA 2OZ6A 4H0EA 3IV5A 2E19A 3VSLA 2QEXI 1WVRA 4KITB 1MMSA 1XC5A 2EFPA 4HV6A 4ESBA 1ONVA 4UVAA 3E1SA 4KUMA 3I0TA 2D2WA 2R7RA 1P9QC 1SVOA 3OYKA 3EPZA 4XL9A 5F08A 1ERDA 1LPQA 1OQYA 2M4GA 3BZKA 2MD0A 1I50J 3PNTA 1G59A 1ZG5A 1YW7A 5CVRA 3GTOJ 4OIQF 2KMUA 4BY7J 1UFMA 4HF2A 3K9TA 4MQ9F 3P7NA 1S72I 2GXGA 3EYIA 3ZP5A 1OR7A 2FMLA 5D6FA 4ZJZA 2YSRA 2YPRA 3D5LA 1ETOA 1K79A 3HOVJ 1ITYA 3KLNA 2XPWA 1U8RA 3HSEA 2IEKA 3CCMI 5GTHC 2DDAA 4OAZA 3FK7A 3AL0B 5IYDJ 4AC0A 4IEJA 1RNLA 4V2GA 5DDGA 4M71A 1EH8A 3GWZA 4HW0A 5DD4A 4RLFA 5EDNA 2Q1ZB 1FP1D 2RNGA 1FX7A 3ABLH 4P5OA 4DGWB 1ENHA 4HF1A 3L09A 1VQ9I 4CUGA 3HRSA 3JAMK 1GXQA 3WGIA 4UB8C 4NQWA 4B1RA 3AAFA 2X85A 1KZHA 1JKQC 1JXSA 1MJBA 2OF7A 4MFEA 3QYEA 1Z77A 5JLWA 2FU4A 1I3QJ 2EA4A 2Z33A 1LDDA 5HNHA 5JVTA 3G73A 1APLC 3EETA 3FXKA 3R6SA 3C2HA 2QKMB 2MW8A 1AHDP 1Y0UA 3ABTA 5L3DA 2R7ZJ 2BVMA 1I3AA 1LUJB 4A3JJ 2X48A 2XPVA 3JAMZ 4G7OF 3OIOA 3I54A 1DP3A 4DW6A 1X58A 3BC8A 4RGXA 3DP7A 3E6DA 3RQ4A 1AKHA 3LL7A 4RMNA 5L3EA 1FOKA 1MBFA 1U5TA 4XRSG 2O7OA 3J7YJ 4S04A 3JRDA 3P5JA 4YEJA 2ID6A 3EDPA 1IXSB 3LSMA 1O57A 1LJ9A 1TNTA 2VKVA 3QAHA 4F7ZA 2LK2A 4G12A 3S3NA 3LSRA 2DQLA 4RB1A 2HKXA 3KP6A 1D1AA 1AOYA 4MTEA 3BJOA 3KPHA 3DBLB 4EEFG 1X1PA 1S6LA 1XMKA 1ODDA 5CQEA 3ZPLA 3UR3C 1ZH5A 4ZYAA 2NNYA 1KYZA 3PM1A 3M1EA 3CMMA 5TISC 2M1BA 4IXAA 2X6XA 2HYJA 3H3ZA 2HOTA 5L3BA 2ELKA 1XCBA 1QQIA 4CGZA 3NEUA 4F91B 2XSJC 2L9RA 4C2TA 1S7EA 1B8IA 1TWCJ 3K0LA 2RAEA 3A03A 1X1CA 2CQNA 3LSPA 3QOPA 1HC8A 2QGUA 3FISA 1R6RA 3E5QA 1ETXA 3M07A 3BWGA 3CUOA 1D5YA 3DU6A 3S1NJ 4M74A 3L2VA 3U2RA 5CQGA 3AG2H 2BBYA 2WAQA 3JSOA 2F4OB 2HR3A 1DGWY 3ZR8X 4D5CA 2E71A 2F5EA 1YI2I 4A6EA 3PO3J 1Z9CA 4EV0A 1UAAA 3IRRA 4MLOA 2E2JJ 2V6EA 4P1WA 3PNYA 4OMYA 3GZ5A 1R00A 2FNPA 5IYCJ 4HV5A 3K2ZA 3V42A 2M5WA 3QPHA 3EUHC 3RQIA 3KYDB 2JVHA 4M9XA 1ETWA 2VL8A 4A0XA 4LIUA 3LA7A 3B6AA 2N8GA 4IL6C 2DODA 2DI3A 1ZAOA 3C7JA 1N25A 3TQNA 2CU7A 2F2EA 5LRRA 1XB4A 2H8RA 1R1VA 2LYCA 2L01A 3PL8A 3RPUA 4ZTJA 4XOPA 1QZYA 2VASA 5DM7F 5M3FJ 5D8KB 4UNOA 3D5SC 4DJAA 3H5AA 3L00A 1WJCA 4C2UA 4RBOA 4P9FA 3ECOA 4A3FJ 3E0JB 4BGDA 3K7AJ 2K3PA 4MFDA 5FKMA 3MZHA 3AKZA 4IHSA 5E3LA 1E3OC 3LAPA 3TBIA 2WB1A 4UVCA 4QPQA 1QVUA 3O6BB 2KIMA 5E17F 3I4PA 3MZYA 4S0HB 3HM5A 4EVIA 3WTWC 2JUCA 5JR3A 2HS5A 1U9OA 4CYDA 4CSWA 2OV7A 2WWYA 1A31A 4HZFA 1S7OA 2BOLA 2ZXHA 2HKOA 1QPMA 2IA0A 2E1OA 3IH4A 1TQPA 1Y1WJ 5K7ZA 1JTXA 3JRGA 3IUOA 2NRAC 5D5VB 1NH3A 2LNBA 4G7ZF 1FJLA 5LGNA 2DN0A 2EFOA 2FNAA 2ZMEB 1GVJA 4G94A 4ENJA 1W0UA 4BJ5C 4BU2A 2B9SA 1ZQ3P 1OR7C 1YYVA 1R5ID 3W2VA 1R1UA 4YIFA 5FJ8J 1ORKA 4D7NA 1WSUA 5E20A 5J8CA 2EBIA 2KRHA 1ZRDA 1W36C 1UZCA 4L5JA 1F9NA 4AYBN 4A0ZA 3CQZJ 1O3QA 4Q5SF 3KEQA 1BC7C 3DKYA 1HKQA 4BXFA 1BW5A 2V9KA 4A3KJ 3PQKA 3NRVA 3J7ZI 3S17J 1ZHFA 4GFBA 3GTJJ 1LE8B 4IX7A 2ZKZA 2CV0A 2W57A 1OCCH 1USTA 2M34A 3DTKA 4NC6A 2COBA 2M7BA 3FMQA 3IP4B 4DZPA 3ZMZA 3OY9A 1F1ZA 2M8EA 4AIJA 4OIRF 2P6TA 3QOEA 1F43A 1I39A 3CCJI 1WWXA 2R5YB 3DEUA 3VFZA 3F6VA 1H88C 2IRFG 2VQLA 2NVQJ 1NK2P 5HS7A 1FSHA 1IAWA 4F3QA 2VJIA 3FHZA 1G3WA 3U1DA 2O5RA 4L0YB 1RZ4A 4M6XA 4XRSA 2COMA 1MH3A 4PGGA 1QRYA 3KP3A 5DS9A 1TP4A 3I71A 5IPAA 2NXNB 2M0CA 2DTRA 1XSDA 2DYRH 2Z99A 5E18F 1OYIA 1P7IA 2JRMA 2YU9J 3M4OJ 2P8TA 2PN6A 4L18B 4XKCA 1G6NA 1U5TC 3CC2I 1FY7A 4AD9A 3OYMA 1YRNB 2BEOA 4JQFA 4XKWA 2VODA 3E7LA 2I8DA 2E5ZA 2VC0A 3M9AA 2RGVA 4PSXA 5J6XA 3DCFA 4NNJA 2RKHA 1H0MA 3KEOA 2RREA 2VOPA 3ABMH 4G8XA 3BTLA 3ZQLA 3BCBA 5HDNA 2HEOA 1ZREA 1X4OA 4M72A 4IRGA 2IA1A 3BOQA 2RV8A 3KZIC 3RI4A 2KDZA 4A3IJ 2E1MB 3S1MJ 2FF4A 1GHCA 2JMWA 2MH2A 1FEXA 1D3YA 4EATA 3H0GJ 3E6BA 4EQQA 2EH3A 2VJ5A 2EV0A 3DFGA 4BBSJ 4RAFA 3HUGA 4FQGA 1CQTA 1Z7LA 5F6FA 5HOOA 2PQ8A 3MMYB 4ZTFA 2KDOA 3UNGC 1QPIA 2GXAA 1ZN2A 1BR4A 3CCSI 3LMMA 4RB0A 2ESHA 5EZGA 4BE0A 5FROA 2NVTJ 2WV0A 1HW1A 2A69F 1R5HA 3CMEI 5KCMA 1XD7A 2ETHA 4IQ4A 4F92B 2CW0F 2OC6A 1AU7A 3GO5A 2CUEA 4ANJA 5LRSA 1MBEA 1S3JA 1LKXA 1AWCA 3FXLA 2L7MP 2R4GA 1VQOI 1G8XA 4RB2C 2Z9OA 1P4AA 3DPLC 3R4KA 4HA8A 1LFUP 3SDGA 2EQRA 1TC3C 2W25A 2JT1A 5CKTA 1TL8A 2C6YA 2HI3A 2KHMA 3Q0WA 1BBYA 3CDLA 2ZCWA 4HNVA 5TJJA 3FHNA 1Y56A 4HDVA 2JUGA 2DA3A 5HDGA 1MW7A 3MN2A 4B3XA 4WF2A 4WWCA 3HRMA 2BXZA 5E8GA 1MMAA 1LDJA 2P0WA 3JREA 1JJ8C 3GBGA 3HOYJ 1V55H 3GFMA 3RKXA 3WE3A 2HGCA 4BUPA 2KQRA 3ONQA 4QSHA 2V9PA 4UUSA 4BE1A 4YIRX 3ISPA 5BOXA 1A5JA 3VB2A 3DQVC 3S93A 1YX5A 2RQPA 2HOEA 2ZXIA 1VZ0A 3P9IA 5EZHA 3A0HC 2K27A 1V4RA 1HOMA 3RZDJ 4Y3OA 1Z21A 4II3A 1RKTA 1YIOA 3QP6A 5DYMA 4EJUA 2GIVA 3F8NA 1PJRA 1X1BA 2V6CA 4HF0A 3M8FA 3GYHX 5H2FC 3B02A 3JR9A 5LHHA 4ENKA 2LTPA 2HVQA 2HQAA 3BY6A 2BGCA 1H8AC 2HQRA 2IVMA 4B47A 3KETA 5FRNA 1OCRH 2M9HA 1V5FA 2L02A 2QQ8A 4HLXA 1ETQA 3DKWA 2DFFA 4PJJA 4LG0B 4BQNA 4WCGA 4LLNA 4WXHA 3HC7A 3K1MA 1YS6A 1FOWA 3ZOBA 3SEQA 4CO8A 1X3ZB 2NOGA 4UB6C 2HQNA 2OA4A 3F9KA 1DDNA 3LSTA 4HLYA 1KYWA 1BOBA 1WCMJ 2P81A 2VBWA 3CDIA 4NDLA 2KLOA 2M2EA 3H92A 4HEA2 2HDWA 3LSIA 2LREA 2I10A 1Y6IA 2M7AA 4BHBA 5LHIA 4DYRA 2E7WA 2L7KA 2Y75A 3FZVA 3ZMSA 4QLCU 4IHVA 4XKVA 5BS6A 3I3LA 2ELHA 1IF1A 3D5RC 4ZDPA 3H0DA 3DLLF 5IT3A 4KIGA 2GA2A 2YU3A 4A3GJ 3VPRA 1QA6A 1J5YA 4KMUX 4IHXA 4RAYA 3SXYA 5J3LA 4BBRJ 4HBLA 4C3HJ 2A5WA 4D7MA 5KHDA 2CMPA 3WGGA 2ZBKA 2P7CB 4IOAF 3HKZN 3SFIA 3VWBA 1R22A 1Y1VJ 4EJOA 2X1DA 2ISZA 1PP8F 3TKYA 2QF7A 1X2MA 2LLKA 4R1HA 1OCOH 3ZQQA 1IN5A 2V1DA 4KIFA 4EM2A 2PG4A 1ZTRA 2BY3A 1Z3YA 2M30A 3T0YA 5GAEJ 4O3MA 1J2XA 5E1ZB 3AG1H 3LFKA 4U0YA 3H9JA 4P55A 4BHPA 4D9JA 2CJJA 4KICA 3JRFA 1OPCA 4Y52J 2YR2A 3JRAA 1OCZH 2L9NA 2E34A 3RYRA 2FX0A 4YFNF 2DOEA 2VXZA 1ON2A 1NK3P 3GF2A 5CVUA 4RS8A 1WFXA 1I27A 4Y4RA 3CTAA 3FMSA 3KFWX 5FKLA 4AIDA 2A5YB 4DYQA 2EZHA 2GWRA 1GDTA 2OD5A 5CLSA 2K02A 1Z05A 2VI6A 1XCVA 1QVTA 3K1NA 5B3SH 3K4MA 2HQ5A 1TLHB 2ECBA 2GZWA 4GYGA 4AYBA 2O03A 2FXAA 2GBYA 4X0GA 2DPDA 1PUEE 2IXSA 3ULQB 1T56A 2ZXJA 2XF5A 2E2IJ 2A3SA 3T1BA 3OYCA 3C3WA 1UG0A 1XGSA 2EINH 3JRIA 1KQ9A 2ZXWH 4XOTA 3T8RA 2QQ9A 5J1UA 1DP7P 2KIQA 1SD4A 5IOZA 3SZGA 2OUMA 1HDPA 1FPQA 3MQ0A 4M3GA 4A6DA 1FOXA 4RGUA 1UHWA 4Q4ZF 3IKTA 4FASD 4MHGA 1IZ1A 3BTJA 3P9CA 1FYLA 4I98B 2CUFA 1FLIA 3TP3A 1H9TA 5DUIA 3FX3A 3I4MJ 4A3LJ 1W4MA 2LSOA 2XKOA 2DA1A 3CF5F 4U87A 1ETVA 1A36A 2IPQX 1TQIA 2CQXA 2DK8A 3DF8A 2IJLA 3OYGA 1IV8A 5E8IA 2KP6A 1TWGJ 2NVXJ 1EH6A 1KU7A 5M3MJ 2R7WA 2V1UA 2EB7A 4JYKA 2TRTA 3DPUA 3NARA 4O5VA 3OMYA 2VUMJ 3A1YA 2PJRB 2HU9A 2MBFA 1XN7A 1POGA 4OMZA 3RTRA 5HLIA 3F6OA 1K6OA 1FIAA 3NQOA 4I99C 3F0CA 4BL0B 3H3VK 1TQMA 3HGGA 1LB2A 4CZZA 5B66C 4RGRA 3Q9VA 2H6CA 1Y39A 2X4HA 4XSZF 2Y69H 2A6TA 5DV5A 2GIZA 3OR1C 2UZKA 1K61A 4BDZA 2ZJ2A 1BR1A 2DDBA 3GFIA 1IN7A 4FHTA 1AA7A 4OIOF 3CJNA 2DXIA 2O9LA 5LLQA 1D1BA 3MAJA 3OS0A 5BPDA 2GOMA 4CCLA 3IH3A 5GAGJ 4PJNA 3W2AA 5LHGA 3OYLA 3CJRB 2Z3YA 2XROA 1MNMC 3F8BA 5TGTA 1WRJA 5IT9K 3BROA 3ZN1A 2L54A 3RSNA 4L5EA 3GLLA 3ZMVA 3HOWJ 5B1AH 4IRIA 3PQJA 3IAS2 3JW4A 4B48A 3MKYB 4B3AA 1B9MA 3OV8A 2O3FA 3GMEA 2AXLA 1P4WA 3HB9A 3GUDA 2Y2ZA 4HYEA 4M3BA 4OU0A 1RC9A 1VF9A 2GQQA 3F23A 1R9TJ 1RIOH 5IT9Z 1YTYA 2M87A 2K4BA 4OIPF 1BI2A 5FO5A 4NB5A 5B5EC 1W7PD 1J59A 1D8JA 3TW7A 3M1CA 3GCMA 1YFHA 3SEZA 3O8HA 3S3OA 2ZNYA 2VJJA 5ILVA 2EZKA 4A3BJ 1BIAA 1IUYA 4DNCA 2DLLA 2MLGA 2TDXA 1T39A 3HHHA 2XRLA 1BI1A 2O6GE 3BG3A 4PGHA 2VE8A 2YX4A 1UHSA 4E70A 5A2QK 1QHGA 1EH7A 2M45A 4IQJA 2JA8J 4Y17A 3OYNA 3QODA 2D5VA 4M6VA 3I5UA 2EV6A 1BI3A 2XGCA 5JHFA 2VN2A 1XSXA 4ZC3A 2WV1A 1L3LA 1TT5B 1TT0A 3E3VA 3ZQFA 2MD5A 3QRFF 1WI9A 3FXMA 4DBRA 4LFUA 5A2QZ 3F72A 1U3EM 5FFXA 1T95A 1IRFA 2QSHX 2ZMEA 5M5WJ 2E1NA 3CUQB 1LVKA 2EA2A 4IHWA 4YELA 5FD5A 2OAZA 5LGTA 4MGRA 2H94A 5DUKA 5CJ9A 1HDDC 5EEHA 1YJNI 1TWHJ 2EPFA 3ZMDA 3H3UA 3PFYA 2XF7A 4A5MA 4CYCB 1MJAA 2BW3B 4LK1F 3AL0C 1B6AA 1D5VA 4OWRB 2A6HF 1O3SA 4HSTA 4CCMA 1U0JA 3DTIA 4PFPA 2G9WA 5IP6A 3ECHA 4EGZA 3L1PA 1LE8A 2JSPA 5DD8A 1X4PA 4L0ZB 2VQCA 5C4XJ 4HDUA 2KISA 4A3MJ 5D5WB 3GVAA 1IDZA 1G2HA 1SVLA 1YIJI 3VYRB 5FGMA 4HQMA 1XS9A 2R5YA 4F55A 2KZGA 2CFOA 1HSJA 3BG7A 3TO7A 1HKSA 4LLGF 5JLXA 2EIKH 3JSPA 1PP7U 1I1GA 3TP0A 5KAIC 2K5CA 3HKZA 3DBRB 1W5SA 3FXJA 4LB5A 2A07F 1USSA 2RVCA 1OCPA 2EFNA 3T8TA 1VQLI 5IP7J 2EZLA 1N78A 4QPOA 1E2XA 3MKLA 1YRNA 2NOJB 4GXOA 1HF0A 4CA0A 2ZSIB 3ABUA 3E5XA 2E1CA 3GTMJ 1WH7A 2QCOA 4OAYA 3HXLA 5AIPA 1FOYA 3HZJA 3ERED 4LD5A 1KQ0A 3BTCA 1JHFA 3GXOA 2HDDA 3H5RA 2MC3A 1IGNA 1PYVA 3PFIA 2K3FA 3JRBA 4ZYDA 3PJRA 4CH7A 1WJDA 3ZQGA 3MVPA 2HZDA 3RCOA 1FIPA 3PSFA 3CP8A 2Z5UA 3O8GA 3I59B 3GFJA 4RB3C 2VJ4A 3CO7C 2VKEA 5EF6A 2WY8Q 3ML6A 2FE3A 5ILSA 3VYSB 3ZQCA 3HYIA 4BKXA 3RDIA 3R61A 1X1DA 1H9GA 1FMWA 1XGOA 3ZN0A 1VQ7I 3BR5A 2CW8A 2QBYB 4NBQA 4XN3A 3HRTA 5HNFA 1BN5A 4RA2A 2HVRA 1C0WA 2PLYA 3BG6A 3M8JA 5E3OA 3N4MA 2HYGD 3I4NJ 5HS9A 1SFEA 2R0QC 1J9IA 3ZCOA 1YS7A 1SD6A 2HFHA 2JTVA 3C1DA 1UJ8A 3F8CA 3IWZA 2P4WA 4BXXJ 4MEXF 5C4JJ 3H5NA 1SMYF 1TWFJ 3CMAI 2CV2A 2GXBA 5EEGA 5BMZA 1O3RA 5KAFC 2RN7A 4W1UA 3PIPF 1CF7B 1FT9A 3ESWB 1FZPB 4KFCA 3J81K 2R7QA 4M6YA 1I5ZA 5K7HA 1QHHD 3GX4X 3LFUA 1HQCA 1JTYA 3J7AO 1B72B 5EJCA 5DEQA 1UMQA 2LKSA 4KN4X 3E5UA 2FA5A 2CRGA 1OYYA 2LFBA 3QPSA 1UG2A 2ZFWA 4LMYA 2X6WA 4BE2A 2LY2A 1EKEA 3FIWA 1ZG3A 1W7PB 2BYVE 2MC4A 1FYKA 1VQKI 1JT0A 2WC2A 1IDYA 1SD5A 1SFXA 3K1PA 3J81Z 1WJAA 3CCEI 1RUOA 2R7SA 2FBHA 3ZMUA 5EGOB 3KIOA 4XLAA 4RAGA 4A69C 1YJWI 4U7BA 2FBIA 1ZYRF 2EZIA 3SZTA 1ETKA 4E7JA 2D1HA 2UXNA 2XAUA 2BVLA 2K4JA 2GM4A 3CCQI 1VQ6I 3VOEA 1D0YA 1UCRA 4I7HA 2K9MA 2PI0A 3KZZA 2DMTA 1R7JA 3CP2A 4R8HA 5LEJA 5TRDA 3BTIA 3WU2C 2DT7B 1GV5A 1XSVA 1OMIA 2PEXA 3DWLE 4RM3A 3KYLA 5FKKA 1QO0D 3FKJA 4XLHA 4JBAA 5M5XJ 3W2WA 2EV5A 3HIFA 2DA2A 1HA8A 2VKHA 4ZH4F 5LGUA 5D8LB 3HSFA 3E97A 2L7ZA 3HSRA 1TZLA 1JKRC 2CG4A 2KT0A 3KCCA 1Y8RB 1MH4A 2L5QA 2OTJI 1ZKGA 6PAXA 1QBJA 3EUAA 2VT3A 5C44J 3WU1B 1J75A 4LG0A 3J7AY 1O7LA 3MFKA 4E7IA 2FQ3A 2L2OA 3X2QH 2XGEA 3LA2A 3GTQJ 5IOYA 1DPUA 3VODA 4XORA 1JKPC 2G7HA 2ZMEC 3BZ6A 1XMAA 2F48A 2XAHA 2EWNA 2KKOA 1RESA 3V7SA 2DA4A 2G7UA 4XLPF 1OFCX 2QQBA 3R60A 4IVNA 2P5KA 1WJEA 4M73A 4D5FA 1R4NB 3VDXA 1LEBA 1X1AA 1KQ8A 4E7KA 1YQAA 9ANTA 3BJAA 3NAUA 3B6CA 2JPBA 1O7FA 4CCNA 2CQKA 3CCLI 3KP7A 2I5UA 3D0SA 3S14J 2FD5A 4RM2A 3LA3A 1L0OC 1DU0A 1ZRFA 2XV4S 3S2DJ 1PVEA 3BR1A 3WHBA 3S3MA 2WTEA 3MCZA 2D1VA 1ZGJA 2DA7A 1RPWA 3A01B 2MA3A 2XAGA 4J19A 1JGSA 1U2WA 3CC4I 2DMPA 3OYIA 1IRGA 2IS6A 4E4HA 1QU3A 4Q47A 2EIJH 1T0FA 3V8JA 2XAJA 4CCJA 2PBIA 3M3YJ 3OS1A 3HHGA 1HKTA 4GCVA 3V7RA 2OU2A 1ZLKA 1KA8A 2L9VA 3GTLJ 1Y0NA 2X6OA 1SD7A 4PJ0C 1U6GA 4IPAA 2QUFA 5K5RA 2NS7A 1MGTA 2P5VA 5F0CA 3M7GA 2V4JC 2VBYA 4ZDLA 4ITVA 5D4RA 1XTAA 3Q0UA 5HLGA 2QYOA 5HLTA 2W4SA 4XIDA 5FLMJ 4ETSA 4P96A 2FUG2 2RDPA 3C2GA 2LP0A 1B59A 3COAC 2CWEA 4N0BA 1E17A 3FBIB 3BQYA 1NTCA 4MIMA 5FFZA 5J8FA 2DT5A 4BNCA 2ISYA 3TO9A 2WADA 4PJMA 2E1MC 4D0PA 4XLFA 3KX2A 3VSKA 2HPMA 2BY0A 1FP2A 1RRJA 4XICA 3CF2A 1SMTA 1LNWA 3BR6A 4XRFA 1BC8C 1MJ9A 2HYFA 1I6XA 4U0VA 3ASNH 3TL4X 4FTHA 1SANA 1WHUA 5AIQA 3S2HJ 2LDUA 3KP2A 4Z6YA 5EG0B 4JX4A 2IGMA 2AQEA 2BY1A 4O6JA 1Z1DA 3HOZJ 3SZPA 3FXOA 4JX5A 1K6YA 4UV9A 3OYFA 2V9VA 4BH9A 3GZ6A 1S5LC 3CLQA 2EFQA 1T38A 2K9SA 1MMGA 4PUSA 3V8KA 1OCTC 4BACA 3K10A 4E7SA 3KLOA 5JFRA 3G1OA 4L9NA 2F4IA 3GTKJ 2R7FA 2R92J 2H09A 5J40A 5ICEA 1J0RA 4QIWN 1SFOJ 1KU2A 3TO6A 2V1XA 3HTUA 3WTSC 3BR2A 5C3EJ 1S29A 2X51A 1U78A 5E1XA 1IXCA 1OISA 2CUZA 5D5XB 3EQLF 4C3JJ 3ZMTA 2PJPA 2F5DA 4KMFA 3TW6A 2PJRA 2FEZA 3FM3A 4FE4A 2QZ8A 3PUBA 3BT9A 5GPAA 3N05A 1N77A 2GOXB 4LG3A 3DKXA 5H6QA 4BEHB 2A61A 2HZTA 5KVRA 2YS9A 3S32A 5GAHJ 1F4KA 1MMNA 3DU5A 3JRCA 1O3TA 3DV8A 4BY1J 3PSIA 2MH9A 4YIIA 1MSFC 2BHZA 1MBKA 2R93J 3CZ6A 4Q48A 1K78B 4A93J 4C9YA 2OPTA 3S2WA 3W6VA 3I56I 2VPLA 4M3DA 4N4NB 2XGXA 2VBZA 2XUBA 4RAZA 5DCMB 2JA5J 2LRDA 4Y7NJ 3CESA 4YFKF 1YE9A 4I2OA 3V8LA 2DCEA 1ZGWA 4XM3A 1Z6RA 2W85A 3IHUA 1FSEA 3VYUB 5JI6A 2XF6A 1JUPA 1Z0XA 4A0YA 5GTIC 4AVPA 1ZARA 1T08B 4UVBA 2CFXA 3KP4A 1MDMB 4N9IA 1IO2A 1FBUA 2R7OA 1FWZA 3DPTA 2K85A 2F5VA 1VQNI 3MKZA 3BG9A 2HXOA 5BPIA 4LOCA 1EA3A 3LWFA 4RLQA 1EV7A 4HQEA 3OS2A 2UWMA 4S05A 2LF7A 5CVJA 2XKPA 1RKWA 3H35A 1A04A 2FQ4A 1MBJA 2CO5A 4XQFA 4XK4A 1X3WB 1LFBA 1B4AA 4PJLA 3D1NI 5H6RA 4B09A 1DGRM 3EYYA 3HPHA 4I0BA 3K70D 4AWXB 4Y13A 4FISA 2VB6A 1V5EA 2ZC2A 4G7HF 4PSWA 5EYRA 4KNYA 4B4CA 3PUFA 3QPLA 2ZO4A 2QENA 4KISA 1VQ8I 4FETA 3TOBA 1T0FC 5AONA 3A4CA 4CDGA 3OL4A 3RKYA 5ICCA 2A6EF 3CJQB 3U21A 4ASNA 3W6JB 1D8KA 2LF8A 2CQQA 3RIRA 3IC7A 3BCAA 2XAFA 2B0LA 1YOVB 3AG3H 4V19K 3CUQA 4E7ZA 4U7DA 2CGPA 3RKWA 1FYMA 5K7FA 2KRCA 1KU9A 2XC7A 4UUTA 5F27A 1IRXA 1MD0A 2DO7A 2L3DA 2ZJPF 2K9QA 3WTYC 3L2WA 2CSOA 1ZLJA 3ZQ7A 3G1LA 4CYCA 2XAQA 2BW3A 4QTRA 3QYBA 4JK1X 3CDHA 1HCRA 4A3CJ 1P92A 5L3FA 2PX9A 3SHFA 2FOWA 2CQ7A 4XSXF 3FKIJ 3HG9A 3WHCA 5HDKA 3IWFA 2KFDA 2IS4A 1D1CA 4GYIA 2R7DA 1VI0A 4Y15A 2ECCA 4FX0A 5HVQC 1XDSA 3FF5A 4ESFA 3BJ6A 1QGPA 3BDDA 1I6HJ 3MKWB 4XLNF 2Y9ZA 4L9TA 2NVYJ 4C3IJ 1WQ2A 3H36A 5E3NA 2R5ZB 1U9NA 4L9VA 2BY2A 2Q0OA 3OL3A 5HODA 1FMVA 1VQMI 1WJBA 2WA0A 2P5LC 5KNLA 4N9HA 1JT6A 3LAJA 4XLEA 1HLVA 1F5TA 1E0EA 4OINF 1HW5A 2F5FA 3K4KA 3WTUC 1B9NA 5B1BH 1PUFB 3HOSA 2DAOA 1Z91A 2AQFA 1A6IA 1WPKA 2AHQA 1QZEA 5F04A 1OJLA 2HOSA 2A68F 3KE2A 4DIQA 4EJVA 3IL2A 1BA5A 4NC7A 2ME6A 2PMZN 2W7NA 4HX4A 2EFWA 1YW9A 1A35A 3RJPA 2E2HJ 5JHUA 4X6AJ 2Z1DA 4MNUA 4E6KG 3OYHA 2XPUA 3BPVA 1FTTA 1XGMA 4TV7A 2BHYA 1K83J 5BQTA 3LSKA 3OYJA 3SYTA 1Z3XA 3I59A 2L4MA 3W3CA 2JN6A 1RUNA 1FC3A 4PDKA 5CVVA 1T8IA 3OWTA 2K86A 1ZRCA 1P7JA 2QBYA 3ZXSA 2F5CA 3GZNB 3L9FA 1MBHA 2DA6A 4KJZA 4J01A 3Q9SA 3L2QA 3LOCA 4RGSA 3H9QA 1G3TA 2IS2A 1MZBA 5GPCA 4OOIA 2LBFB 2H27A 1SAUA 1Y8QB 3HJEA 3O3KA 1UB9A 1R71A 4KT5C 2H1KA 1KU3A 1OLTA 1MIJA 1XG1A 2V1NA 4M9ZA 4BAYA 1GXPA 2VQGA 3OIQA 1Z7UA 5ILUA 5J1RA 1SFUA 4F52A 4HRIA 4ZZLA 5CYVA 2GA1A 1T2KA 2XGDA 3OOUA 4HSRA 1OYWA 1CF7A 3Q3SA 2Q2EB 1UELB 2DYSH 3WGHA 1P2FA 4A3EJ 2DMNA 2JA6J 3JCUC 3LSJA 1MMDA 1R58A 3C18A 2CV1A 1TW3A 1X2NA 4JX6A 1E3PA 1B72A 4FT8A 2QLZA 3HOTA 2DOFA 2MSYA 4I0AA 3LSGA 4L9JA 3RPUD 5LFAA 2H6BA 1DQUA 1W7PA 1YO5C 2ZNZA 2HNHA 2R3SA 3ZGKA 4L5IA 1YW8A 4KN7X 5EGOA 2STTA 1KGSA 2JWTA 3FM5A 2DMQA 2LKXA 2F4MB 4PCQA 4KYWA 1REPC 2XB5A 2DT6A 5L3GA 5HLHA 4IHYA 3S16J 1VNDA 1X3UA 3Q0VA 1FBQA 2E36A 3F8FA 2HPIA 2Y31A 1LQ1A 1V3FA 3U1KA 1D0ZA 4CCKA 1B1BA 3FDYA 4ENNA 1W5CC 3SFZA 2R7UA 1LEAA 4AIHA 4BS9A 4X1EA 1Q1HA 1NHAA 1IN8A 1QNTA 2IT0A 2VLAA 5E79C 5CPRB 3WG7H 1TBXA 4KIBA 1MBGA 1YHQI 2ACJA 2V79A 3QPTA 2K9LA 4MO7A 1IC8A 2K9NA 2P6SA 3WTZA 2X1CA 1MKMA 3K69A 2XRNA 2W24A 2W48A 4E7LA 1G3SA 5LBQA 4M9SA 5GP9A 2IBDA 5ED4A 5D4SA 2FRHA 2DJIA 4V2FA 4XRMA 1XDUA 4PFOA 4PZJA 3A0BC 3I53A 5BNGA 1H89C 2W82A 1Z67A 4IJAA 2HTJA 1JE8A 2Y9YA 5DTDA 3SJMA 5D5UB 1BOAA 4HPQA 1XMXA 2X6YA 1TNSA 3TEDA 4W97A 4NQWB 1RI7A 3K4CA 5F0FA 3CO6C 3CUQC 3DXJF 4HX8A 1JUSA 2LD5A 2LOOA 4HX7A 1EF4A 2UXXA 4AM3A 1WZ2A 3DEEA 1R23A 3OOPA 2OJED 1IRZA 2H8WA 2LC2A 2LG4A 2LMDA 3K4NA 1OKRA 4BQQA 4ZYEA 1GT0C 2FBKA 1AKHB 4LJZF 1U5TB 1WI3A 4AVZA 1O4XA 4EMSA 3OSGA 2B7EA 3HL2A 4U0WA 1T98A 3BLYA 4NC8A 2CUJA 4LLLA 1HBXG 2X9DA 3A01A 3F21A 4HOBA 4DOZA 2NAZA 1R49A 2ICWG 5KK1A 1ZELA 3JTHA 3R0AA 1WGXA 2MLKA 2IS1A 2RQQA 2YUSA 1K4TA 4XBFA 3HBLA 3K70C 3RZOJ 3CCUI 2EILH 2QQAA 2WAEA 3DLAA 1K4SA 4AU7A 2VBXA 2XSDC 2GAUA 1DUXC 1WKMA 3U9GA 4YG2F 2MYSA 2YX7A 1W5TA 3K4JA 4BDYA 5F0HA 1B8IB 3H9GA 4CHUA 2CS3A 3K4BA 2QVOA 3BG5A 2IGNA 4G6QA 1JGGA 2LH9A 2RNJA 3TOAA 4ZYGA 2K40A 2KL4A 5IP9J 2R7TA 1IUFA 2HOAA 4A12A 3MWMA 4ZDOA 2VT2A 1JUMA 4EM0B 1NG6A 1V5GA 3AG4H 5F1JA 3JTGA 3GLXA 4LIVA 2Z2SB 3FXQA 2L0KA 4CCOA 2E7XA 1KONA 3FK6A 4WX9A 2EK5A 1TW2A 2W1OA 4CICA 2DFIA 1NG7A 1I1SA 2JJ7A 1RETA 2X1EA 1SC7A 1GUUA 4XKBA 2Y0SN 2Z16A 1G4DA 2DFEA 3RPQA 4FCYA 4I01A 4KT6A 3TMOA 3PIOF 2BV6A 3QP5A 4LB6B 3NWSA 3B73A 4BJ6C 4ZZDA 1JHHA 1JKOC 5DM6F 5EG0A 2QKLB 4KDPA 2EIMH 2GLOA 2VXDA 5FLXK 4LGWA 1M1EB 4FX4A 3QYFA 4EJWA 4UXNA 2ZB9A 3LQQA 3H1CA 1MNEA 1P4XA 4C2MJ 1P6RA 2ELJA 2DU9A 2PMUA 3K6GA 3HRUA 2VKDA 1BJAA 4GGGA 3OR2C 4M3FA 2OTLI 4QWQA 2DQRA 2G0EA 2M3AA 2MABA 2UV1A 5E1WA 3OSFA 4M3EA 3TGNA 3HDDA 2DBBA 2KIUA 2M0MA 3GEZA 4BHCA 2FJ1A 1ULYA 3DEWA 5FLXZ 2LY9A 1W0TA 4Y33A 3WU0A 4GDFA 4BJTA 3G3ZA 1VQ5I 4AIKA 3HOUJ 2ZSHB 4BXUA 4HNTA 1HSTA 2XB0X 3F8MA 3WE2A 3WODF 3WTVC 1W1WE 4FE7A 2JZYA 4EGYA 3K2AA 3ERMA 3WG9A 5LEKA 4NHJA 2PMZA 4ESJA 1RR7A 3CMYA 1G3YA 2ME0A 3T5XA 4AUXA 3A2KA 1LVAA 3BR3A 1ON1A 2WAFA 4IF4A 4GRIA 3AFHA 4XMYA 1T6SA 2R7VA 4BEHA 3O2PE 2L7FP 2CW7A 3FWEA 1IJWC 1U8BA 3GTGJ 1FBSA 4CXFA 3BP8A 3P9KA 3CCYA 3W6KB 2KJCA 3J80K 4G6DA 2O61A 2B63J 3ZQHA 3MZ8A 3HPGA 2NNNA 2M8GX 3A02A 5K1YA 5FKNA 3IAM2 3I9V2 4D1QA 3LQRA 1E3HA 2JK3A 3HEFA 1F36A 2KIFA 1CGPA 3KZYA 1K78A 2MFZA 2JPCA 2V7FA 3REOA 3SDBA 3C2BA 3S15J 3V4GA 4MTDA 3ZQIA 1HW2A 1MSEC 2NS0A 3EUKL 3Q5FA 4ENMA 3E6MA 3J80Z 3LSHA 4A2UA 2AO9A 5DCMA 1S8NA 4DYCA 3IRQA 1J7KA 2LVSA 2VOOA 3GFLA 2Y48A 1X19A 2AS5F 3VYTB 2LR8A 5J47A 4UUVA 3ASOH 2KJBA 1IXRC 4JOMA 4MQVA 3S1QJ 1IN6A 3G2BA 5FRMA 1SVMA 3BR0A 2XHKA 2Q8KA 4BYYA 1ZGAA 3CC7I 4XR6A 5FKOA 3ZRGA 2ESNA 2DFHA 2VQHA 3KEYA 1MDMA 4IRHA 1STZA 4I02A 4DBQA 1XGNA 4LITA 4UHTA 4WK8F 2H1LA 5D6EA 3L2CA 3BPXA 3BQZA 3ABKH 2NYXA 2QSGX 4KA4A 4XNFA 3L2UA 2KZVA 2IW5A 4P9UA 3HOXJ 4G6TB 3NWTA 5LD2C 3OIPA 1ZR2A 2LKPA 5GADJ 1S7AA 1YJ9I 2CH0A 2TCTA 3R0JA 3S8PA 1QZZA 1YLFA 2M4KA 4YFXF 2DMUA 3QQAA 2BE5F 3F22A 3CCVI 2Y30A 2BXYA 2BZTA 3OYEA 2ZJQF 2DOAA 2DW4A 5FB2A 2HVSA 3TDUC 5ICGA 2WBMA 1XPXA 1MNDA 2J5OA 3M8EA 2QA4I 2O8XA 2X0LA 1ZR4A 5IY5H 1A6QA 2JQ7A 3FXUA 4WXDA 1BW6A 1DU6A 3MEXA 2DTZA 4Z2YA 2MGQA 2AXTC 1LDKB 3V7CA 3GTPJ 5FLVA 1GLNA 2WAQN 1SFKA 2IGKA 4RDUA 3HUGB 2MG4A 3I55I 2P7VB 2VIXA 3SQNA 1SAXA 2EJRA 3LNQA 2WY7Q 3K4LA 2IP2A 4JP0A 1Z6TA 3FXRA 2HTSA 2PMHA 4LK0F 3I64A 3N97A 4EJTA 1BM9A 4BQAA 4GO1A 2ADUA 4B8XA 4BQOA 2HWVA 2KPMA 3BZCA 1BIBA 3HTSB 3KYCB 4ON0A 2UUZA 4XONA 3PNVA 1S9HA 4A3DJ 1DPRA 3FMRA 5L3CA 3I58A 2NVUB 3IH2A 5EEAA 2HDCA 2XASA 1N75A 2E35A 4ZYHA 4I76A 1WH5A 2OQRA 3RKQA 1R5GA 2DPUA 4IOCF 2JRTA 4F93B 4I6ZA 2QM3A 1YG2A 3ELKA 3CCRI 5DCFA 2W84A 5E3MA 3E6CC 1R1TA 5J4YA 2R5ZA 1EJ9A 4DQ2A 1RR8C 5IYBJ
chains in the Genus database with same CATH topology
2XIGA 3WTXC 5F1RA 1BI0A 1R36A 2VC1A 4U88A 5ICFA 1IW7F 3CLOA 3F3XA 3L7WA 4WXCA 1IN4A 4MEYF 5K5QA 2O0YA 4A5NA 2STWA 4HAMA 2FSWA 2RC4A 2J5PA 3VEPA 2K7LA 2DK5A 5K5OA 2CYYA 4EM1A 4G9YA 2IA2A 2FMYA 3KP5A 4IHTA 3QU3A 1TTYA 3IKVA 5CVIA 2VONA 2VE9A 3EUHA 3ROUA 2OQGA 2Y0MA 3QU6A 4UV8A 1FNNA 2D45A 3TDZC 3RYPA 2OZUA 3GW2A 5FD6A 1PDNC 1K7AA 5F64A 5ERIA 5H20A 4K2EA 2XVCA 4I09A 1VTNC 4R79A 2JSCA 2QWWA 2L4AA 1ZG1A 2Q2EA 2OBPA 1HXDA 2KRFA 2PFBA 5HS8A 3WTTC 1UHMA 2FOKA 2OZ6A 4H0EA 2EFPA 4HV6A 4ESBA 1ONVA 4UVAA 4KUMA 3I0TA 2D2WA 1ZG5A 1YW7A 5CVRA 4OIQF 1UFMA 4HF2A 3K9TA 4MQ9F 3P7NA 2GXGA 3EYIA 3ZP5A 1OR7A 2FMLA 5D6FA 2YSRA 2YPRA 3D5LA 1K79A 3KLNA 1U8RA 3HSEA 1RNLA 5DDGA 4M71A 1EH8A 3GWZA 4HW0A 5DD4A 4P5OA 1FP1D 1FX7A 4HF1A 3L09A 3HRSA 3JAMK 1GXQA 3WGIA 4NQWA 3AAFA 1JXSA 1MJBA 2FU4A 2EA4A 2Z33A 1LDDA 3G73A 5JVTA 3EETA 3R6SA 1Y0UA 3ABTA 5L3DA 3JAMZ 4G7OF 3I54A 4RGXA 3DP7A 3E6DA 5L3EA 1FOKA 1U5TA 4S04A 3EDPA 1IXSB 1O57A 1LJ9A 1TNTA 3QAHA 4F7ZA 2DQLA 4RB1A 2HKXA 3KP6A 1AOYA 4MTEA 3BJOA 1XMKA 1S6LA 1ODDA 3ZPLA 1ZH5A 2NNYA 1KYZA 3M1EA 2M1BA 4IXAA 3H3ZA 5L3BA 1XCBA 1QQIA 4CGZA 3NEUA 3K0LA 3QOPA 3E5QA 3BWGA 3CUOA 4M74A 3U2RA 2BBYA 3JSOA 2HR3A 2F5EA 4A6EA 1Z9CA 4EV0A 3IRRA 4OMYA 3GZ5A 1R00A 2FNPA 4HV5A 3K2ZA 2M5WA 3QPHA 4M9XA 4A0XA 3LA7A 2DI3A 1ZAOA 3C7JA 3TQNA 2F2EA 5LRRA 1XB4A 1R1VA 2L01A 3RPUA 1QZYA 5D8KB 4UNOA 3L00A 4P9FA 3ECOA 3MZHA 4IHSA 3LAPA 4UVCA 3O6BB 2KIMA 5E17F 3I4PA 3MZYA 4EVIA 3WTWC 5JR3A 2HS5A 4CYDA 2WWYA 4HZFA 1S7OA 2HKOA 1QPMA 2IA0A 1TQPA 2NRAC 5D5VB 2LNBA 4G7ZF 5LGNA 2EFOA 2FNAA 2ZMEB 1GVJA 4G94A 4ENJA 1YYVA 1R1UA 4YIFA 1WSUA 5E20A 5J8CA 1ZRDA 4L5JA 1F9NA 4A0ZA 1O3QA 4Q5SF 3KEQA 1BC7C 1HKQA 3PQKA 3NRVA 1ZHFA 2ZKZA 2W57A 1USTA 3FMQA 3ZMZA 4AIJA 1F1ZA 2M8EA 4OIRF 2P6TA 1WWXA 2IRFG 3DEUA 3VFZA 3F6VA 5HS7A 1FSHA 1IAWA 3FHZA 1G3WA 3U1DA 4L0YB 1RZ4A 4M6XA 2COMA 4PGGA 3KP3A 3I71A 2DTRA 1XSDA 2Z99A 5E18F 1OYIA 2P8TA 2PN6A 4L18B 1G6NA 1U5TC 1FY7A 4AD9A 2BEOA 4JQFA 2VODA 2VC0A 3M9AA 5J6XA 2RGVA 2RKHA 1H0MA 3KEOA 2VOPA 4G8XA 2HEOA 5HDNA 1ZREA 4M72A 4IRGA 2IA1A 3BOQA 2RV8A 3RI4A 1GHCA 2FF4A 2MH2A 1D3YA 3E6BA 4EQQA 2EV0A 3DFGA 3HUGA 5F6FA 5HOOA 2PQ8A 1ZN2A 4RB0A 2ESHA 2WV0A 1HW1A 2A69F 1R5HA 2ETHA 1XD7A 2CW0F 3GO5A 5LRSA 1S3JA 1AWCA 2Z9OA 4RB2C 1P4AA 3DPLC 3R4KA 4HA8A 2W25A 2JT1A 2C6YA 1BBYA 2ZCWA 5TJJA 4HDVA 5HDGA 4WF2A 4WWCA 3HRMA 5E8GA 1LDJA 3GFMA 3RKXA 3WE3A 2HGCA 5BOXA 3ISPA 3VB2A 3DQVC 2RQPA 2HOEA 3P9IA 2K27A 1V4RA 1YIOA 3QP6A 5DYMA 4EJUA 2GIVA 3F8NA 4HF0A 2V6CA 3M8FA 3GYHX 3B02A 5LHHA 4ENKA 3BY6A 2BGCA 2HQRA 2IVMA 3KETA 2L02A 4HLXA 3DKWA 4LG0B 4WCGA 4LLNA 4WXHA 3K1MA 1YS6A 4CO8A 2HQNA 2OA4A 1DDNA 3LSTA 4HLYA 1KYWA 2VBWA 3H92A 4BHBA 5LHIA 2E7WA 2Y75A 3FZVA 3ZMSA 4QLCU 5BS6A 2ELHA 1IF1A 5IT3A 4KIGA 2GA2A 2YU3A 1J5YA 4KMUX 4RAYA 3SXYA 4HBLA 2P7CB 3WGGA 2ZBKA 1R22A 4EJOA 2ISZA 1PP8F 3TKYA 4R1HA 1IN5A 2V1DA 4KIFA 4EM2A 2PG4A 2M30A 3T0YA 4O3MA 1J2XA 5E1ZB 3LFKA 4U0YA 4P55A 4BHPA 4KICA 1OPCA 2YR2A 3RYRA 4YFNF 2VXZA 1ON2A 3GF2A 5CVUA 4RS8A 1I27A 3CTAA 3FMSA 3KFWX 2A5YB 2GWRA 2OD5A 5CLSA 2K02A 1Z05A 1XCVA 3K1NA 1TLHB 2GZWA 4GYGA 2O03A 2FXAA 2DPDA 1PUEE 3ULQB 2ZXJA 2A3SA 3T1BA 3C3WA 1XGSA 1KQ9A 3T8RA 2QQ9A 1DP7P 1SD4A 1FPQA 3MQ0A 4A6DA 4RGUA 1UHWA 4Q4ZF 3IKTA 4MHGA 1IZ1A 3P9CA 1FYLA 4I98B 1FLIA 1H9TA 5DUIA 3FX3A 1W4MA 2LSOA 2XKOA 2IPQX 1TQIA 3DF8A 2DK8A 2IJLA 5E8IA 1EH6A 1KU7A 2V1UA 2EB7A 4O5VA 2MBFA 1XN7A 4OMZA 3RTRA 5HLIA 3F6OA 1K6OA 3NQOA 1TQMA 1LB2A 4CZZA 4RGRA 3Q9VA 2H6CA 2X4HA 4XSZF 5DV5A 2UZKA 2ZJ2A 3GFIA 1IN7A 4FHTA 4OIOF 3CJNA 5LLQA 3MAJA 5BPDA 5LHGA 2Z3YA 2XROA 3F8BA 1WRJA 5IT9K 3BROA 3ZN1A 2L54A 3ZMVA 4IRIA 3PQJA 3JW4A 1B9MA 3OV8A 2O3FA 2AXLA 1P4WA 3GUDA 4HYEA 4OU0A 2GQQA 3F23A 1RIOH 5IT9Z 1YTYA 2M87A 2K4BA 4OIPF 1BI2A 5FO5A 4NB5A 1W7PD 1J59A 1D8JA 1YFHA 2ZNYA 5ILVA 1BIAA 1IUYA 4DNCA 2DLLA 2MLGA 2TDXA 1T39A 3HHHA 1BI1A 2O6GE 4PGHA 5A2QK 2VE8A 2YX4A 4E70A 1EH7A 2M45A 4Y17A 3I5UA 2EV6A 1BI3A 2VN2A 1XSXA 1L3LA 3E3VA 3QRFF 2MD5A 1WI9A 4LFUA 5A2QZ 3F72A 1U3EM 5FFXA 1IRFA 2ZMEA 2E1NA 3CUQB 2EA2A 5FD5A 2OAZA 5LGTA 4MGRA 2H94A 5DUKA 5CJ9A 5EEHA 3ZMDA 3H3UA 4A5MA 1MJAA 4LK1F 1B6AA 1D5VA 2A6HF 1O3SA 2G9WA 3ECHA 4EGZA 5DD8A 4L0ZB 4HDUA 5D5WB 3GVAA 5FGMA 4HQMA 1HSJA 3TO7A 1HKSA 4LLGF 3JSPA 1PP7U 1I1GA 1W5SA 4LB5A 2A07F 1USSA 2RVCA 2EFNA 3T8TA 1E2XA 4GXOA 3ABUA 3E5XA 2E1CA 5AIPA 3ERED 4LD5A 1KQ0A 1JHFA 3GXOA 2MC3A 3PFIA 4ZYDA 2Z5UA 3I59B 3GFJA 4RB3C 3CO7C 3ML6A 2FE3A 5ILSA 3HYIA 3RDIA 3R61A 1H9GA 1XGOA 3ZN0A 2QBYB 3HRTA 1BN5A 1C0WA 2PLYA 3N4MA 2HYGD 5HS9A 1SFEA 1J9IA 1YS7A 1SD6A 2HFHA 2JTVA 3C1DA 3F8CA 3IWZA 2P4WA 4MEXF 1SMYF 2GXBA 5EEGA 5BMZA 1O3RA 2RN7A 4KFCA 1CF7B 1FT9A 1FZPB 3J81K 4M6YA 1I5ZA 3GX4X 1HQCA 3J7AO 5DEQA 4KN4X 3E5UA 2FA5A 1OYYA 2ZFWA 4LMYA 1ZG3A 1W7PB 2BYVE 1FYKA 2WC2A 1SD5A 1SFXA 3K1PA 3J81Z 1RUOA 2FBHA 3ZMUA 4U7BA 2FBIA 1ZYRF 3SZTA 2D1HA 2UXNA 2K4JA 3VOEA 1UCRA 4I7HA 2PI0A 3KZZA 5LEJA 1R7JA 4R8HA 5TRDA 1XSVA 1OMIA 2PEXA 1QO0D 4JBAA 2EV5A 3HIFA 4ZH4F 5LGUA 5D8LB 3HSFA 3E97A 3HSRA 2CG4A 3KCCA 6PAXA 1QBJA 3WU1B 2VT3A 1J75A 4LG0A 1O7LA 3MFKA 2FQ3A 3LA2A 1DPUA 3VODA 2G7HA 3BZ6A 1XMAA 2XAHA 2EWNA 2KKOA 3V7SA 2G7UA 4XLPF 2QQBA 3R60A 4IVNA 2P5KA 4M73A 1LEBA 1KQ8A 1YQAA 3BJAA 2JPBA 1O7FA 2CQKA 3KP7A 3D0SA 3LA3A 1L0OC 1ZRFA 2XV4S 2WTEA 3MCZA 2D1VA 1ZGJA 2MA3A 2XAGA 1JGSA 1U2WA 1IRGA 4Q47A 1T0FA 3V8JA 2XAJA 2PBIA 3HHGA 1HKTA 4GCVA 3V7RA 2OU2A 1ZLKA 1KA8A 1SD7A 1U6GA 4IPAA 2QUFA 5K5RA 1MGTA 2P5VA 3M7GA 2VBYA 5D4RA 5HLGA 2QYOA 4ETSA 4P96A 2RDPA 1B59A 3COAC 2CWEA 4N0BA 1E17A 5FFZA 5J8FA 2DT5A 4BNCA 2ISYA 3TO9A 4D0PA 1FP2A 1SMTA 1LNWA 4XRFA 1BC8C 1MJ9A 2HYFA 1I6XA 4U0VA 5AIQA 2LDUA 3KP2A 4O6JA 1Z1DA 3SZPA 4UV9A 2V9VA 4BH9A 3GZ6A 2EFQA 1T38A 3V8KA 3KLOA 5JFRA 4L9NA 2R7FA 2H09A 5ICEA 1J0RA 1KU2A 3TO6A 2V1XA 3HTUA 3WTSC 1S29A 1U78A 5E1XA 1IXCA 5D5XB 3EQLF 3ZMTA 2PJPA 2F5DA 4KMFA 2FEZA 3FM3A 2QZ8A 5H6QA 2A61A 2HZTA 5KVRA 1F4KA 1O3TA 3DV8A 2MH9A 4YIIA 4Q48A 1K78B 3S2WA 2XGXA 2VBZA 2XUBA 4RAZA 5DCMB 4YFKF 4I2OA 3V8LA 1Z6RA 2W85A 3IHUA 1FSEA 5JI6A 4A0YA 4AVPA 1ZARA 4UVBA 2CFXA 3KP4A 1MDMB 4N9IA 1FBUA 1FWZA 3DPTA 5BPIA 3LWFA 1EV7A 4HQEA 2UWMA 4S05A 2LF7A 5CVJA 2XKPA 1A04A 2CO5A 1B4AA 5H6RA 4B09A 3EYYA 4I0BA 4AWXB 4Y13A 4G7HF 4KNYA 2ZO4A 2QENA 3TOBA 5AONA 4CDGA 3RKYA 5ICCA 2A6EF 4ASNA 3W6JB 1D8KA 2LF8A 3RIRA 3IC7A 2XAFA 2B0LA 3CUQA 2CGPA 4U7DA 3RKWA 1FYMA 1KU9A 1MD0A 2DO7A 2L3DA 3WTYC 2CSOA 1ZLJA 3ZQ7A 2XAQA 4JK1X 3CDHA 1P92A 5L3FA 3SHFA 4XSXF 5HDKA 3IWFA 4GYIA 2R7DA 4Y15A 4FX0A 5HVQC 1XDSA 3FF5A 4ESFA 3BJ6A 1QGPA 3BDDA 4XLNF 4L9TA 1WQ2A 4L9VA 2Q0OA 2P5LC 4N9HA 3LAJA 1F5TA 4OINF 1HW5A 2F5FA 3WTUC 1B9NA 3HOSA 1Z91A 2DAOA 2A68F 3KE2A 4EJVA 3IL2A 4HX4A 2EFWA 1YW9A 3RJPA 5JHUA 4MNUA 3BPVA 1XGMA 4TV7A 5BQTA 3I59A 2L4MA 1RUNA 1FC3A 4PDKA 5CVVA 2K86A 1ZRCA 2QBYA 2F5CA 3L9FA 3Q9SA 4RGSA 1G3TA 1MZBA 4OOIA 2H27A 3O3KA 1UB9A 4KT5C 1KU3A 4M9ZA 4BAYA 1GXPA 1Z7UA 5ILUA 1SFUA 4ZZLA 5CYVA 2GA1A 1T2KA 1OYWA 1CF7A 3WGHA 1P2FA 1R58A 3C18A 1TW3A 4FT8A 2QLZA 3HOTA 4I0AA 4L9JA 2H6BA 1W7PA 1YO5C 2ZNZA 2R3SA 4L5IA 1YW8A 4KN7X 2STTA 1KGSA 3FM5A 4PCQA 4KYWA 1REPC 5L3GA 5HLHA 1X3UA 1FBQA 3F8FA 1LQ1A 1V3FA 1B1BA 4ENNA 3SFZA 1LEAA 4AIHA 1Q1HA 1NHAA 1IN8A 1QNTA 2IT0A 1TBXA 4KIBA 2ACJA 2V79A 3QPTA 2P6SA 3WTZA 1MKMA 3K69A 2XRNA 2W24A 1G3SA 5LBQA 4M9SA 5ED4A 5D4SA 2FRHA 1XDUA 4PZJA 3I53A 4IJAA 2HTJA 1JE8A 5D5UB 1BOAA 1TNSA 1RI7A 3CO6C 3CUQC 3DXJF 4HX8A 4HX7A 2UXXA 1R23A 3OOPA 4ZYEA 1OKRA 2FBKA 4LJZF 1U5TB 4EMSA 4U0WA 1T98A 4LLLA 1HBXG 3F21A 4HOBA 2NAZA 5KK1A 3JTHA 3R0AA 2MLKA 4XBFA 2QQAA 2VBXA 2GAUA 1DUXC 1WKMA 3U9GA 4YG2F 2YX7A 1W5TA 4CHUA 2QVOA 4G6QA 2RNJA 3TOAA 4ZYGA 4A12A 3MWMA 2VT2A 4EM0B 3JTGA 3GLXA 3FXQA 2E7XA 4WX9A 2EK5A 1TW2A 4CICA 2DFIA 1I1SA 1G4DA 3RPQA 4I01A 2BV6A 3QP5A 4LB6B 3B73A 4ZZDA 1JHHA 4KDPA 5FLXK 4LGWA 4FX4A 4EJWA 4UXNA 3LQQA 1P4XA 1P6RA 2DU9A 2PMUA 3HRUA 1BJAA 4GGGA 4QWQA 2DQRA 5E1WA 3TGNA 2DBBA 2KIUA 3GEZA 4BHCA 1ULYA 5FLXZ 3WU0A 3G3ZA 4AIKA 4BXUA 1HSTA 3F8MA 3WE2A 3WODF 3WTVC 2JZYA 4EGYA 3WG9A 5LEKA 4NHJA 4ESJA 1G3YA 3T5XA 1LVAA 1ON1A 4IF4A 1T6SA 3O2PE 3FWEA 1FBSA 4CXFA 3BP8A 3P9KA 3W6KB 2KJCA 3J80K 4G6DA 2O61A 2NNNA 5K1YA 3LQRA 1CGPA 2KIFA 3KZYA 1K78A 2JPCA 3REOA 3V4GA 4MTDA 1HW2A 2NS0A 3Q5FA 4ENMA 3E6MA 3J80Z 4A2UA 5DCMA 3IRQA 1S8NA 1J7KA 2VOOA 3GFLA 2Y48A 2AS5F 4UUVA 2KJBA 1IXRC 4MQVA 1IN6A 2XHKA 2Q8KA 4BYYA 1ZGAA 2ESNA 1MDMA 4IRHA 1STZA 4I02A 1XGNA 4UHTA 4WK8F 5D6EA 3L2CA 3BPXA 2NYXA 4KA4A 2IW5A 4P9UA 2LKPA 1S7AA 3R0JA 1QZZA 1YLFA 4YFXF 2BE5F 3F22A 2DW4A 5FB2A 3TDUC 5ICGA 2J5OA 3M8EA 2O8XA 2X0LA 3FXUA 4WXDA 3MEXA 4Z2YA 1LDKB 3V7CA 2P7VB 3SQNA 1SAXA 2EJRA 2IP2A 1Z6TA 3FXRA 2HTSA 2PMHA 4LK0F 3I64A 3N97A 4EJTA 1BM9A 4BQAA 4GO1A 2ADUA 4B8XA 2HWVA 1BIBA 3HTSB 4ON0A 1DPRA 3FMRA 5L3CA 3I58A 2HDCA 2XASA 4ZYHA 2OQRA 1R5GA 2DPUA 2JRTA 2QM3A 1YG2A 3ELKA 5DCFA 2W84A 3E6CC 1R1TA 4DQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XIG A;  3WTX C;  5F1R A;  1BI0 A;  1R36 A;  2VC1 A;  4U88 A;  5ICF A;  1IW7 F;  3CLO A;  3F3X A;  3L7W A;  4WXC A;  1IN4 A;  4MEY F;  5K5Q A;  2O0Y A;  4A5N A;  2STW A;  4HAM A;  2FSW A;  2RC4 A;  2J5P A;  3VEP A;  2K7L A;  2DK5 A;  5K5O A;  2CYY A;  4EM1 A;  4G9Y A;  2IA2 A;  2FMY A;  3KP5 A;  4IHT A;  3QU3 A;  1TTY A;  3IKV A;  5CVI A;  2VON A;  2VE9 A;  3EUH A;  3ROU A;  2OQG A;  2Y0M A;  3QU6 A;  4UV8 A;  1FNN A;  2D45 A;  3TDZ C;  3RYP A;  2OZU A;  3GW2 A;  5FD6 A;  1PDN C;  1K7A A;  5F64 A;  5ERI A;  5H20 A;  4K2E A;  2XVC A;  4I09 A;  1VTN C;  4R79 A;  2JSC A;  2QWW A;  2L4A A;  1ZG1 A;  2Q2E A;  2OBP A;  1HXD A;  2KRF A;  2PFB A;  5HS8 A;  3WTT C;  1UHM A;  2FOK A;  2OZ6 A;  4H0E A;  2EFP A;  4HV6 A;  4ESB A;  1ONV A;  4UVA A;  4KUM A;  3I0T A;  2D2W A;  1ZG5 A;  1YW7 A;  5CVR A;  4OIQ F;  1UFM A;  4HF2 A;  3K9T A;  4MQ9 F;  3P7N A;  2GXG A;  3EYI A;  3ZP5 A;  1OR7 A;  2FML A;  5D6F A;  2YSR A;  2YPR A;  3D5L A;  1K79 A;  3KLN A;  1U8R A;  3HSE A;  1RNL A;  5DDG A;  4M71 A;  1EH8 A;  3GWZ A;  4HW0 A;  5DD4 A;  4P5O A;  1FP1 D;  1FX7 A;  4HF1 A;  3L09 A;  3HRS A;  3JAM K;  1GXQ A;  3WGI A;  4NQW A;  3AAF A;  1JXS A;  1MJB A;  2FU4 A;  2EA4 A;  2Z33 A;  1LDD A;  3G73 A;  5JVT A;  3EET A;  3R6S A;  1Y0U A;  3ABT A;  5L3D A;  3JAM Z;  4G7O F;  3I54 A;  4RGX A;  3DP7 A;  3E6D A;  5L3E A;  1FOK A;  1U5T A;  4S04 A;  3EDP A;  1IXS B;  1O57 A;  1LJ9 A;  1TNT A;  3QAH A;  4F7Z A;  2DQL A;  4RB1 A;  2HKX A;  3KP6 A;  1AOY A;  4MTE A;  3BJO A;  1XMK A;  1S6L A;  1ODD A;  3ZPL A;  1ZH5 A;  2NNY A;  1KYZ A;  3M1E A;  2M1B A;  4IXA A;  3H3Z A;  5L3B A;  1XCB A;  1QQI A;  4CGZ A;  3NEU A;  3K0L A;  3QOP A;  3E5Q A;  3BWG A;  3CUO A;  4M74 A;  3U2R A;  2BBY A;  3JSO A;  2HR3 A;  2F5E A;  4A6E A;  1Z9C A;  4EV0 A;  3IRR A;  4OMY A;  3GZ5 A;  1R00 A;  2FNP A;  4HV5 A;  3K2Z A;  2M5W A;  3QPH A;  4M9X A;  4A0X A;  3LA7 A;  2DI3 A;  1ZAO A;  3C7J A;  3TQN A;  2F2E A;  5LRR A;  1XB4 A;  1R1V A;  2L01 A;  3RPU A;  1QZY A;  5D8K B;  4UNO A;  3L00 A;  4P9F A;  3ECO A;  3MZH A;  4IHS A;  3LAP A;  4UVC A;  3O6B B;  2KIM A;  5E17 F;  3I4P A;  3MZY A;  4EVI A;  3WTW C;  5JR3 A;  2HS5 A;  4CYD A;  2WWY A;  4HZF A;  1S7O A;  2HKO A;  1QPM A;  2IA0 A;  1TQP A;  2NRA C;  5D5V B;  2LNB A;  4G7Z F;  5LGN A;  2EFO A;  2FNA A;  2ZME B;  1GVJ A;  4G94 A;  4ENJ A;  1YYV A;  1R1U A;  4YIF A;  1WSU A;  5E20 A;  5J8C A;  1ZRD A;  4L5J A;  1F9N A;  4A0Z A;  1O3Q A;  4Q5S F;  3KEQ A;  1BC7 C;  1HKQ A;  3PQK A;  3NRV A;  1ZHF A;  2ZKZ A;  2W57 A;  1UST A;  3FMQ A;  3ZMZ A;  4AIJ A;  1F1Z A;  2M8E A;  4OIR F;  2P6T A;  1WWX A;  2IRF G;  3DEU A;  3VFZ A;  3F6V A;  5HS7 A;  1FSH A;  1IAW A;  3FHZ A;  1G3W A;  3U1D A;  4L0Y B;  1RZ4 A;  4M6X A;  2COM A;  4PGG A;  3KP3 A;  3I71 A;  2DTR A;  1XSD A;  2Z99 A;  5E18 F;  1OYI A;  2P8T A;  2PN6 A;  4L18 B;  1G6N A;  1U5T C;  1FY7 A;  4AD9 A;  2BEO A;  4JQF A;  2VOD A;  2VC0 A;  3M9A A;  5J6X A;  2RGV A;  2RKH A;  1H0M A;  3KEO A;  2VOP A;  4G8X A;  2HEO A;  5HDN A;  1ZRE A;  4M72 A;  4IRG A;  2IA1 A;  3BOQ A;  2RV8 A;  3RI4 A;  1GHC A;  2FF4 A;  2MH2 A;  1D3Y A;  3E6B A;  4EQQ A;  2EV0 A;  3DFG A;  3HUG A;  5F6F A;  5HOO A;  2PQ8 A;  1ZN2 A;  4RB0 A;  2ESH A;  2WV0 A;  1HW1 A;  2A69 F;  1R5H A;  2ETH A;  1XD7 A;  2CW0 F;  3GO5 A;  5LRS A;  1S3J A;  1AWC A;  2Z9O A;  4RB2 C;  1P4A A;  3DPL C;  3R4K A;  4HA8 A;  2W25 A;  2JT1 A;  2C6Y A;  1BBY A;  2ZCW A;  5TJJ A;  4HDV A;  5HDG A;  4WF2 A;  4WWC A;  3HRM A;  5E8G A;  1LDJ A;  3GFM A;  3RKX A;  3WE3 A;  2HGC A;  5BOX A;  3ISP A;  3VB2 A;  3DQV C;  2RQP A;  2HOE A;  3P9I A;  2K27 A;  1V4R A;  1YIO A;  3QP6 A;  5DYM A;  4EJU A;  2GIV A;  3F8N A;  4HF0 A;  2V6C A;  3M8F A;  3GYH X;  3B02 A;  5LHH A;  4ENK A;  3BY6 A;  2BGC A;  2HQR A;  2IVM A;  3KET A;  2L02 A;  4HLX A;  3DKW A;  4LG0 B;  4WCG A;  4LLN A;  4WXH A;  3K1M A;  1YS6 A;  4CO8 A;  2HQN A;  2OA4 A;  1DDN A;  3LST A;  4HLY A;  1KYW A;  2VBW A;  3H92 A;  4BHB A;  5LHI A;  2E7W A;  2Y75 A;  3FZV A;  3ZMS A;  4QLC U;  5BS6 A;  2ELH A;  1IF1 A;  5IT3 A;  4KIG A;  2GA2 A;  2YU3 A;  1J5Y A;  4KMU X;  4RAY A;  3SXY A;  4HBL A;  2P7C B;  3WGG A;  2ZBK A;  1R22 A;  4EJO A;  2ISZ A;  1PP8 F;  3TKY A;  4R1H A;  1IN5 A;  2V1D A;  4KIF A;  4EM2 A;  2PG4 A;  2M30 A;  3T0Y A;  4O3M A;  1J2X A;  5E1Z B;  3LFK A;  4U0Y A;  4P55 A;  4BHP A;  4KIC A;  1OPC A;  2YR2 A;  3RYR A;  4YFN F;  2VXZ A;  1ON2 A;  3GF2 A;  5CVU A;  4RS8 A;  1I27 A;  3CTA A;  3FMS A;  3KFW X;  2A5Y B;  2GWR A;  2OD5 A;  5CLS A;  2K02 A;  1Z05 A;  1XCV A;  3K1N A;  1TLH B;  2GZW A;  4GYG A;  2O03 A;  2FXA A;  2DPD A;  1PUE E;  3ULQ B;  2ZXJ A;  2A3S A;  3T1B A;  3C3W A;  1XGS A;  1KQ9 A;  3T8R A;  2QQ9 A;  1DP7 P;  1SD4 A;  1FPQ A;  3MQ0 A;  4A6D A;  4RGU A;  1UHW A;  4Q4Z F;  3IKT A;  4MHG A;  1IZ1 A;  3P9C A;  1FYL A;  4I98 B;  1FLI A;  1H9T A;  5DUI A;  3FX3 A;  1W4M A;  2LSO A;  2XKO A;  2IPQ X;  1TQI A;  3DF8 A;  2DK8 A;  2IJL A;  5E8I A;  1EH6 A;  1KU7 A;  2V1U A;  2EB7 A;  4O5V A;  2MBF A;  1XN7 A;  4OMZ A;  3RTR A;  5HLI A;  3F6O A;  1K6O A;  3NQO A;  1TQM A;  1LB2 A;  4CZZ A;  4RGR A;  3Q9V A;  2H6C A;  2X4H A;  4XSZ F;  5DV5 A;  2UZK A;  2ZJ2 A;  3GFI A;  1IN7 A;  4FHT A;  4OIO F;  3CJN A;  5LLQ A;  3MAJ A;  5BPD A;  5LHG A;  2Z3Y A;  2XRO A;  3F8B A;  1WRJ A;  5IT9 K;  3BRO A;  3ZN1 A;  2L54 A;  3ZMV A;  4IRI A;  3PQJ A;  3JW4 A;  1B9M A;  3OV8 A;  2O3F A;  2AXL A;  1P4W A;  3GUD A;  4HYE A;  4OU0 A;  2GQQ A;  3F23 A;  1RIO H;  5IT9 Z;  1YTY A;  2M87 A;  2K4B A;  4OIP F;  1BI2 A;  5FO5 A;  4NB5 A;  1W7P D;  1J59 A;  1D8J A;  1YFH A;  2ZNY A;  5ILV A;  1BIA A;  1IUY A;  4DNC A;  2DLL A;  2MLG A;  2TDX A;  1T39 A;  3HHH A;  1BI1 A;  2O6G E;  4PGH A;  5A2Q K;  2VE8 A;  2YX4 A;  4E70 A;  1EH7 A;  2M45 A;  4Y17 A;  3I5U A;  2EV6 A;  1BI3 A;  2VN2 A;  1XSX A;  1L3L A;  3E3V A;  3QRF F;  2MD5 A;  1WI9 A;  4LFU A;  5A2Q Z;  3F72 A;  1U3E M;  5FFX A;  1IRF A;  2ZME A;  2E1N A;  3CUQ B;  2EA2 A;  5FD5 A;  2OAZ A;  5LGT A;  4MGR A;  2H94 A;  5DUK A;  5CJ9 A;  5EEH A;  3ZMD A;  3H3U A;  4A5M A;  1MJA A;  4LK1 F;  1B6A A;  1D5V A;  2A6H F;  1O3S A;  2G9W A;  3ECH A;  4EGZ A;  5DD8 A;  4L0Z B;  4HDU A;  5D5W B;  3GVA A;  5FGM A;  4HQM A;  1HSJ A;  3TO7 A;  1HKS A;  4LLG F;  3JSP A;  1PP7 U;  1I1G A;  1W5S A;  4LB5 A;  2A07 F;  1USS A;  2RVC A;  2EFN A;  3T8T A;  1E2X A;  4GXO A;  3ABU A;  3E5X A;  2E1C A;  5AIP A;  3ERE D;  4LD5 A;  1KQ0 A;  1JHF A;  3GXO A;  2MC3 A;  3PFI A;  4ZYD A;  2Z5U A;  3I59 B;  3GFJ A;  4RB3 C;  3CO7 C;  3ML6 A;  2FE3 A;  5ILS A;  3HYI A;  3RDI A;  3R61 A;  1H9G A;  1XGO A;  3ZN0 A;  2QBY B;  3HRT A;  1BN5 A;  1C0W A;  2PLY A;  3N4M A;  2HYG D;  5HS9 A;  1SFE A;  1J9I A;  1YS7 A;  1SD6 A;  2HFH A;  2JTV A;  3C1D A;  3F8C A;  3IWZ A;  2P4W A;  4MEX F;  1SMY F;  2GXB A;  5EEG A;  5BMZ A;  1O3R A;  2RN7 A;  4KFC A;  1CF7 B;  1FT9 A;  1FZP B;  3J81 K;  4M6Y A;  1I5Z A;  3GX4 X;  1HQC A;  3J7A O;  5DEQ A;  4KN4 X;  3E5U A;  2FA5 A;  1OYY A;  2ZFW A;  4LMY A;  1ZG3 A;  1W7P B;  2BYV E;  1FYK A;  2WC2 A;  1SD5 A;  1SFX A;  3K1P A;  3J81 Z;  1RUO A;  2FBH A;  3ZMU A;  4U7B A;  2FBI A;  1ZYR F;  3SZT A;  2D1H A;  2UXN A;  2K4J A;  3VOE A;  1UCR A;  4I7H A;  2PI0 A;  3KZZ A;  5LEJ A;  1R7J A;  4R8H A;  5TRD A;  1XSV A;  1OMI A;  2PEX A;  1QO0 D;  4JBA A;  2EV5 A;  3HIF A;  4ZH4 F;  5LGU A;  5D8L B;  3HSF A;  3E97 A;  3HSR A;  2CG4 A;  3KCC A;  6PAX A;  1QBJ A;  3WU1 B;  2VT3 A;  1J75 A;  4LG0 A;  1O7L A;  3MFK A;  2FQ3 A;  3LA2 A;  1DPU A;  3VOD A;  2G7H A;  3BZ6 A;  1XMA A;  2XAH A;  2EWN A;  2KKO A;  3V7S A;  2G7U A;  4XLP F;  2QQB A;  3R60 A;  4IVN A;  2P5K A;  4M73 A;  1LEB A;  1KQ8 A;  1YQA A;  3BJA A;  2JPB A;  1O7F A;  2CQK A;  3KP7 A;  3D0S A;  3LA3 A;  1L0O C;  1ZRF A;  2XV4 S;  2WTE A;  3MCZ A;  2D1V A;  1ZGJ A;  2MA3 A;  2XAG A;  1JGS A;  1U2W A;  1IRG A;  4Q47 A;  1T0F A;  3V8J A;  2XAJ A;  2PBI A;  3HHG A;  1HKT A;  4GCV A;  3V7R A;  2OU2 A;  1ZLK A;  1KA8 A;  1SD7 A;  1U6G A;  4IPA A;  2QUF A;  5K5R A;  1MGT A;  2P5V A;  3M7G A;  2VBY A;  5D4R A;  5HLG A;  2QYO A;  4ETS A;  4P96 A;  2RDP A;  1B59 A;  3COA C;  2CWE A;  4N0B A;  1E17 A;  5FFZ A;  5J8F A;  2DT5 A;  4BNC A;  2ISY A;  3TO9 A;  4D0P A;  1FP2 A;  1SMT A;  1LNW A;  4XRF A;  1BC8 C;  1MJ9 A;  2HYF A;  1I6X A;  4U0V A;  5AIQ A;  2LDU A;  3KP2 A;  4O6J A;  1Z1D A;  3SZP A;  4UV9 A;  2V9V A;  4BH9 A;  3GZ6 A;  2EFQ A;  1T38 A;  3V8K A;  3KLO A;  5JFR A;  4L9N A;  2R7F A;  2H09 A;  5ICE A;  1J0R A;  1KU2 A;  3TO6 A;  2V1X A;  3HTU A;  3WTS C;  1S29 A;  1U78 A;  5E1X A;  1IXC A;  5D5X B;  3EQL F;  3ZMT A;  2PJP A;  2F5D A;  4KMF A;  2FEZ A;  3FM3 A;  2QZ8 A;  5H6Q A;  2A61 A;  2HZT A;  5KVR A;  1F4K A;  1O3T A;  3DV8 A;  2MH9 A;  4YII A;  4Q48 A;  1K78 B;  3S2W A;  2XGX A;  2VBZ A;  2XUB A;  4RAZ A;  5DCM B;  4YFK F;  4I2O A;  3V8L A;  1Z6R A;  2W85 A;  3IHU A;  1FSE A;  5JI6 A;  4A0Y A;  4AVP A;  1ZAR A;  4UVB A;  2CFX A;  3KP4 A;  1MDM B;  4N9I A;  1FBU A;  1FWZ A;  3DPT A;  5BPI A;  3LWF A;  1EV7 A;  4HQE A;  2UWM A;  4S05 A;  2LF7 A;  5CVJ A;  2XKP A;  1A04 A;  2CO5 A;  1B4A A;  5H6R A;  4B09 A;  3EYY A;  4I0B A;  4AWX B;  4Y13 A;  4G7H F;  4KNY A;  2ZO4 A;  2QEN A;  3TOB A;  5AON A;  4CDG A;  3RKY A;  5ICC A;  2A6E F;  4ASN A;  3W6J B;  1D8K A;  2LF8 A;  3RIR A;  3IC7 A;  2XAF A;  2B0L A;  3CUQ A;  2CGP A;  4U7D A;  3RKW A;  1FYM A;  1KU9 A;  1MD0 A;  2DO7 A;  2L3D A;  3WTY C;  2CSO A;  1ZLJ A;  3ZQ7 A;  2XAQ A;  4JK1 X;  3CDH A;  1P92 A;  5L3F A;  3SHF A;  4XSX F;  5HDK A;  3IWF A;  4GYI A;  2R7D A;  4Y15 A;  4FX0 A;  5HVQ C;  1XDS A;  3FF5 A;  4ESF A;  3BJ6 A;  1QGP A;  3BDD A;  4XLN F;  4L9T A;  1WQ2 A;  4L9V A;  2Q0O A;  2P5L C;  4N9H A;  3LAJ A;  1F5T A;  4OIN F;  1HW5 A;  2F5F A;  3WTU C;  1B9N A;  3HOS A;  1Z91 A;  2DAO A;  2A68 F;  3KE2 A;  4EJV A;  3IL2 A;  4HX4 A;  2EFW A;  1YW9 A;  3RJP A;  5JHU A;  4MNU A;  3BPV A;  1XGM A;  4TV7 A;  5BQT A;  3I59 A;  2L4M A;  1RUN A;  1FC3 A;  4PDK A;  5CVV A;  2K86 A;  1ZRC A;  2QBY A;  2F5C A;  3L9F A;  3Q9S A;  4RGS A;  1G3T A;  1MZB A;  4OOI A;  2H27 A;  3O3K A;  1UB9 A;  4KT5 C;  1KU3 A;  4M9Z A;  4BAY A;  1GXP A;  1Z7U A;  5ILU A;  1SFU A;  4ZZL A;  5CYV A;  2GA1 A;  1T2K A;  1OYW A;  1CF7 A;  3WGH A;  1P2F A;  1R58 A;  3C18 A;  1TW3 A;  4FT8 A;  2QLZ A;  3HOT A;  4I0A A;  4L9J A;  2H6B A;  1W7P A;  1YO5 C;  2ZNZ A;  2R3S A;  4L5I A;  1YW8 A;  4KN7 X;  2STT A;  1KGS A;  3FM5 A;  4PCQ A;  4KYW A;  1REP C;  5L3G A;  5HLH A;  1X3U A;  1FBQ A;  3F8F A;  1LQ1 A;  1V3F A;  1B1B A;  4ENN A;  3SFZ A;  1LEA A;  4AIH A;  1Q1H A;  1NHA A;  1IN8 A;  1QNT A;  2IT0 A;  1TBX A;  4KIB A;  2ACJ A;  2V79 A;  3QPT A;  2P6S A;  3WTZ A;  1MKM A;  3K69 A;  2XRN A;  2W24 A;  1G3S A;  5LBQ A;  4M9S A;  5ED4 A;  5D4S A;  2FRH A;  1XDU A;  4PZJ A;  3I53 A;  4IJA A;  2HTJ A;  1JE8 A;  5D5U B;  1BOA A;  1TNS A;  1RI7 A;  3CO6 C;  3CUQ C;  3DXJ F;  4HX8 A;  4HX7 A;  2UXX A;  1R23 A;  3OOP A;  4ZYE A;  1OKR A;  2FBK A;  4LJZ F;  1U5T B;  4EMS A;  4U0W A;  1T98 A;  4LLL A;  1HBX G;  3F21 A;  4HOB A;  2NAZ A;  5KK1 A;  3JTH A;  3R0A A;  2MLK A;  4XBF A;  2QQA A;  2VBX A;  2GAU A;  1DUX C;  1WKM A;  3U9G A;  4YG2 F;  2YX7 A;  1W5T A;  4CHU A;  2QVO A;  4G6Q A;  2RNJ A;  3TOA A;  4ZYG A;  4A12 A;  3MWM A;  2VT2 A;  4EM0 B;  3JTG A;  3GLX A;  3FXQ A;  2E7X A;  4WX9 A;  2EK5 A;  1TW2 A;  4CIC A;  2DFI A;  1I1S A;  1G4D A;  3RPQ A;  4I01 A;  2BV6 A;  3QP5 A;  4LB6 B;  3B73 A;  4ZZD A;  1JHH A;  4KDP A;  5FLX K;  4LGW A;  4FX4 A;  4EJW A;  4UXN A;  3LQQ A;  1P4X A;  1P6R A;  2DU9 A;  2PMU A;  3HRU A;  1BJA A;  4GGG A;  4QWQ A;  2DQR A;  5E1W A;  3TGN A;  2DBB A;  2KIU A;  3GEZ A;  4BHC A;  1ULY A;  5FLX Z;  3WU0 A;  3G3Z A;  4AIK A;  4BXU A;  1HST A;  3F8M A;  3WE2 A;  3WOD F;  3WTV C;  2JZY A;  4EGY A;  3WG9 A;  5LEK A;  4NHJ A;  4ESJ A;  1G3Y A;  3T5X A;  1LVA A;  1ON1 A;  4IF4 A;  1T6S A;  3O2P E;  3FWE A;  1FBS A;  4CXF A;  3BP8 A;  3P9K A;  3W6K B;  2KJC A;  3J80 K;  4G6D A;  2O61 A;  2NNN A;  5K1Y A;  3LQR A;  1CGP A;  2KIF A;  3KZY A;  1K78 A;  2JPC A;  3REO A;  3V4G A;  4MTD A;  1HW2 A;  2NS0 A;  3Q5F A;  4ENM A;  3E6M A;  3J80 Z;  4A2U A;  5DCM A;  3IRQ A;  1S8N A;  1J7K A;  2VOO A;  3GFL A;  2Y48 A;  2AS5 F;  4UUV A;  2KJB A;  1IXR C;  4MQV A;  1IN6 A;  2XHK A;  2Q8K A;  4BYY A;  1ZGA A;  2ESN A;  1MDM A;  4IRH A;  1STZ A;  4I02 A;  1XGN A;  4UHT A;  4WK8 F;  5D6E A;  3L2C A;  3BPX A;  2NYX A;  4KA4 A;  2IW5 A;  4P9U A;  2LKP A;  1S7A A;  3R0J A;  1QZZ A;  1YLF A;  4YFX F;  2BE5 F;  3F22 A;  2DW4 A;  5FB2 A;  3TDU C;  5ICG A;  2J5O A;  3M8E A;  2O8X A;  2X0L A;  3FXU A;  4WXD A;  3MEX A;  4Z2Y A;  1LDK B;  3V7C A;  2P7V B;  3SQN A;  1SAX A;  2EJR A;  2IP2 A;  1Z6T A;  3FXR A;  2HTS A;  2PMH A;  4LK0 F;  3I64 A;  3N97 A;  4EJT A;  1BM9 A;  4BQA A;  4GO1 A;  2ADU A;  4B8X A;  2HWV A;  1BIB A;  3HTS B;  4ON0 A;  1DPR A;  3FMR A;  5L3C A;  3I58 A;  2HDC A;  2XAS A;  4ZYH A;  2OQR A;  1R5G A;  2DPU A;  2JRT A;  2QM3 A;  1YG2 A;  3ELK A;  5DCF A;  2W84 A;  3E6C C;  1R1T A;  4DQ2 A; 
#chains in the Genus database with same CATH topology
 5J4V A;  4HNU A;  2F6C A;  3PO2 J;  2ZJR F;  1GVD A;  5M5Y J;  2XIG A;  3WTX C;  5F1R A;  1BI0 A;  1R36 A;  2VC1 A;  2XDV A;  4U88 A;  5ICF A;  1PUF A;  2WB1 N;  1Q1V A;  1J09 A;  1D0X A;  1YIT I;  1IW7 F;  3CLO A;  3F3X A;  4UUS B;  3L7W A;  4CZC A;  2V26 A;  4II2 A;  4IKF A;  2A05 A;  4PK4 A;  4WXC A;  1BJZ A;  2O8K A;  1IN4 A;  4MEY F;  4NUB A;  1ETY A;  3DBH B;  3OYB A;  3OYD A;  1TWA J;  5K5Q A;  2O0Y A;  4A5N A;  3JRH A;  2IAI A;  2STW A;  4HAM A;  2FSW A;  2OCC H;  2RC4 A;  2VPR A;  1GV2 A;  3G4S I;  2J5P A;  1BR2 A;  3VEP A;  2K7L A;  4DZJ A;  3S1R J;  1VFC A;  2DK5 A;  5K5O A;  2CYY A;  4EM1 A;  1VQP I;  4G9Y A;  2IA2 A;  1JJ6 C;  1VQ4 I;  2FMY A;  3KP5 A;  4HG2 A;  2E5N A;  4IO9 F;  4YRV A;  2HXI A;  4XN0 A;  4IHT A;  1ACI A;  3QU3 A;  1TTY A;  4XLC A;  3IKV A;  5CVI A;  3G71 I;  2E60 A;  2VON A;  2ID3 A;  2OCE A;  3OYA A;  4B44 A;  1YX3 A;  2VE9 A;  3EUH A;  4E7H A;  3QWL A;  1ZK8 A;  3ROU A;  2NS8 A;  2OQG A;  2Y0M A;  3QU6 A;  4H4K C;  4UV8 A;  1IV6 A;  4UY8 I;  1FNN A;  4IZZ A;  2D45 A;  3TDZ C;  3RYP A;  3FBN B;  4B43 A;  2LY1 A;  1JI8 A;  1WJ5 A;  3CD6 I;  3CJT B;  2IGO A;  1W36 D;  3HGY A;  1XX5 A;  2LBF A;  2OZU A;  3GW2 A;  1T33 A;  1V54 H;  2R7X A;  1LFP A;  2JVG A;  5FD6 A;  1R4M B;  1PDN C;  2DA5 A;  1SEU A;  3DTE A;  1K7A A;  5F64 A;  2JA2 A;  5ERI A;  3L2R A;  5H20 A;  3G1M A;  2XVC A;  4K2E A;  4I09 A;  4C30 A;  1VTN C;  3MD2 A;  4R79 A;  1IG7 A;  2JSC A;  2QWW A;  2W00 A;  2Y0S A;  4N4O B;  2QSF X;  2L4A A;  1ZG1 A;  4J00 A;  4ABZ A;  2Q2E A;  2OBP A;  1FTZ A;  1HXD A;  1BL0 A;  5JVG F;  2JA7 J;  2KRF A;  2PFB A;  2ZFU A;  5HS8 A;  5J1Y A;  1WJF A;  2DJN A;  3WTT C;  1UHM A;  2FOK A;  2L9S A;  3G6E I;  3UKG A;  2OZ6 A;  4H0E A;  3IV5 A;  2E19 A;  3VSL A;  2QEX I;  1WVR A;  4KIT B;  1MMS A;  1XC5 A;  2EFP A;  4HV6 A;  4ESB A;  1ONV A;  4UVA A;  3E1S A;  4KUM A;  3I0T A;  2D2W A;  2R7R A;  1P9Q C;  1SVO A;  3OYK A;  3EPZ A;  4XL9 A;  5F08 A;  1ERD A;  1LPQ A;  1OQY A;  2M4G A;  3BZK A;  2MD0 A;  1I50 J;  3PNT A;  1G59 A;  1ZG5 A;  1YW7 A;  5CVR A;  3GTO J;  4OIQ F;  2KMU A;  4BY7 J;  1UFM A;  4HF2 A;  3K9T A;  4MQ9 F;  3P7N A;  1S72 I;  2GXG A;  3EYI A;  3ZP5 A;  1OR7 A;  2FML A;  5D6F A;  4ZJZ A;  2YSR A;  2YPR A;  3D5L A;  1ETO A;  1K79 A;  3HOV J;  1ITY A;  3KLN A;  2XPW A;  1U8R A;  3HSE A;  2IEK A;  3CCM I;  5GTH C;  2DDA A;  4OAZ A;  3FK7 A;  3AL0 B;  5IYD J;  4AC0 A;  4IEJ A;  1RNL A;  4V2G A;  5DDG A;  4M71 A;  1EH8 A;  3GWZ A;  4HW0 A;  5DD4 A;  4RLF A;  5EDN A;  2Q1Z B;  1FP1 D;  2RNG A;  1FX7 A;  3ABL H;  4P5O A;  4DGW B;  1ENH A;  4HF1 A;  3L09 A;  1VQ9 I;  4CUG A;  3HRS A;  3JAM K;  1GXQ A;  3WGI A;  4UB8 C;  4NQW A;  4B1R A;  3AAF A;  2X85 A;  1KZH A;  1JKQ C;  1JXS A;  1MJB A;  2OF7 A;  4MFE A;  3QYE A;  1Z77 A;  5JLW A;  2FU4 A;  1I3Q J;  2EA4 A;  2Z33 A;  1LDD A;  5HNH A;  5JVT A;  3G73 A;  1APL C;  3EET A;  3FXK A;  3R6S A;  3C2H A;  2QKM B;  2MW8 A;  1AHD P;  1Y0U A;  3ABT A;  5L3D A;  2R7Z J;  2BVM A;  1I3A A;  1LUJ B;  4A3J J;  2X48 A;  2XPV A;  3JAM Z;  4G7O F;  3OIO A;  3I54 A;  1DP3 A;  4DW6 A;  1X58 A;  3BC8 A;  4RGX A;  3DP7 A;  3E6D A;  3RQ4 A;  1AKH A;  3LL7 A;  4RMN A;  5L3E A;  1FOK A;  1MBF A;  1U5T A;  4XRS G;  2O7O A;  3J7Y J;  4S04 A;  3JRD A;  3P5J A;  4YEJ A;  2ID6 A;  3EDP A;  1IXS B;  3LSM A;  1O57 A;  1LJ9 A;  1TNT A;  2VKV A;  3QAH A;  4F7Z A;  2LK2 A;  4G12 A;  3S3N A;  3LSR A;  2DQL A;  4RB1 A;  2HKX A;  3KP6 A;  1D1A A;  1AOY A;  4MTE A;  3BJO A;  3KPH A;  3DBL B;  4EEF G;  1X1P A;  1S6L A;  1XMK A;  1ODD A;  5CQE A;  3ZPL A;  3UR3 C;  1ZH5 A;  4ZYA A;  2NNY A;  1KYZ A;  3PM1 A;  3M1E A;  3CMM A;  5TIS C;  2M1B A;  4IXA A;  2X6X A;  2HYJ A;  3H3Z A;  2HOT A;  5L3B A;  2ELK A;  1XCB A;  1QQI A;  4CGZ A;  3NEU A;  4F91 B;  2XSJ C;  2L9R A;  4C2T A;  1S7E A;  1B8I A;  1TWC J;  3K0L A;  2RAE A;  3A03 A;  1X1C A;  2CQN A;  3LSP A;  3QOP A;  1HC8 A;  2QGU A;  3FIS A;  1R6R A;  3E5Q A;  1ETX A;  3M07 A;  3BWG A;  3CUO A;  1D5Y A;  3DU6 A;  3S1N J;  4M74 A;  3L2V A;  3U2R A;  5CQG A;  3AG2 H;  2BBY A;  2WAQ A;  3JSO A;  2F4O B;  2HR3 A;  1DGW Y;  3ZR8 X;  4D5C A;  2E71 A;  2F5E A;  1YI2 I;  4A6E A;  3PO3 J;  1Z9C A;  4EV0 A;  1UAA A;  3IRR A;  4MLO A;  2E2J J;  2V6E A;  4P1W A;  3PNY A;  4OMY A;  3GZ5 A;  1R00 A;  2FNP A;  5IYC J;  4HV5 A;  3K2Z A;  3V42 A;  2M5W A;  3QPH A;  3EUH C;  3RQI A;  3KYD B;  2JVH A;  4M9X A;  1ETW A;  2VL8 A;  4A0X A;  4LIU A;  3LA7 A;  3B6A A;  2N8G A;  4IL6 C;  2DOD A;  2DI3 A;  1ZAO A;  3C7J A;  1N25 A;  3TQN A;  2CU7 A;  2F2E A;  5LRR A;  1XB4 A;  2H8R A;  1R1V A;  2LYC A;  2L01 A;  3PL8 A;  3RPU A;  4ZTJ A;  4XOP A;  1QZY A;  2VAS A;  5DM7 F;  5M3F J;  5D8K B;  4UNO A;  3D5S C;  4DJA A;  3H5A A;  3L00 A;  1WJC A;  4C2U A;  4RBO A;  4P9F A;  3ECO A;  4A3F J;  3E0J B;  4BGD A;  3K7A J;  2K3P A;  4MFD A;  5FKM A;  3MZH A;  3AKZ A;  4IHS A;  5E3L A;  1E3O C;  3LAP A;  3TBI A;  2WB1 A;  4UVC A;  4QPQ A;  1QVU A;  3O6B B;  2KIM A;  5E17 F;  3I4P A;  3MZY A;  4S0H B;  3HM5 A;  4EVI A;  3WTW C;  2JUC A;  5JR3 A;  2HS5 A;  1U9O A;  4CYD A;  4CSW A;  2OV7 A;  2WWY A;  1A31 A;  4HZF A;  1S7O A;  2BOL A;  2ZXH A;  2HKO A;  1QPM A;  2IA0 A;  2E1O A;  3IH4 A;  1TQP A;  1Y1W J;  5K7Z A;  1JTX A;  3JRG A;  3IUO A;  2NRA C;  5D5V B;  1NH3 A;  2LNB A;  4G7Z F;  1FJL A;  5LGN A;  2DN0 A;  2EFO A;  2FNA A;  2ZME B;  1GVJ A;  4G94 A;  4ENJ A;  1W0U A;  4BJ5 C;  4BU2 A;  2B9S A;  1ZQ3 P;  1OR7 C;  1YYV A;  1R5I D;  3W2V A;  1R1U A;  4YIF A;  5FJ8 J;  1ORK A;  4D7N A;  1WSU A;  5E20 A;  5J8C A;  2EBI A;  2KRH A;  1ZRD A;  1W36 C;  1UZC A;  4L5J A;  1F9N A;  4AYB N;  4A0Z A;  3CQZ J;  1O3Q A;  4Q5S F;  3KEQ A;  1BC7 C;  3DKY A;  1HKQ A;  4BXF A;  1BW5 A;  2V9K A;  4A3K J;  3PQK A;  3NRV A;  3J7Z I;  3S17 J;  1ZHF A;  4GFB A;  3GTJ J;  1LE8 B;  4IX7 A;  2ZKZ A;  2CV0 A;  2W57 A;  1OCC H;  1UST A;  2M34 A;  3DTK A;  4NC6 A;  2COB A;  2M7B A;  3FMQ A;  3IP4 B;  4DZP A;  3ZMZ A;  3OY9 A;  1F1Z A;  2M8E A;  4AIJ A;  4OIR F;  2P6T A;  3QOE A;  1F43 A;  1I39 A;  3CCJ I;  1WWX A;  2R5Y B;  3DEU A;  3VFZ A;  3F6V A;  1H88 C;  2IRF G;  2VQL A;  2NVQ J;  1NK2 P;  5HS7 A;  1FSH A;  1IAW A;  4F3Q A;  2VJI A;  3FHZ A;  1G3W A;  3U1D A;  2O5R A;  4L0Y B;  1RZ4 A;  4M6X A;  4XRS A;  2COM A;  1MH3 A;  4PGG A;  1QRY A;  3KP3 A;  5DS9 A;  1TP4 A;  3I71 A;  5IPA A;  2NXN B;  2M0C A;  2DTR A;  1XSD A;  2DYR H;  2Z99 A;  5E18 F;  1OYI A;  1P7I A;  2JRM A;  2YU9 J;  3M4O J;  2P8T A;  2PN6 A;  4L18 B;  4XKC A;  1G6N A;  1U5T C;  3CC2 I;  1FY7 A;  4AD9 A;  3OYM A;  1YRN B;  2BEO A;  4JQF A;  4XKW A;  2VOD A;  3E7L A;  2I8D A;  2E5Z A;  2VC0 A;  3M9A A;  2RGV A;  4PSX A;  5J6X A;  3DCF A;  4NNJ A;  2RKH A;  1H0M A;  3KEO A;  2RRE A;  2VOP A;  3ABM H;  4G8X A;  3BTL A;  3ZQL A;  3BCB A;  5HDN A;  2HEO A;  1ZRE A;  1X4O A;  4M72 A;  4IRG A;  2IA1 A;  3BOQ A;  2RV8 A;  3KZI C;  3RI4 A;  2KDZ A;  4A3I J;  2E1M B;  3S1M J;  2FF4 A;  1GHC A;  2JMW A;  2MH2 A;  1FEX A;  1D3Y A;  4EAT A;  3H0G J;  3E6B A;  4EQQ A;  2EH3 A;  2VJ5 A;  2EV0 A;  3DFG A;  4BBS J;  4RAF A;  3HUG A;  4FQG A;  1CQT A;  1Z7L A;  5F6F A;  5HOO A;  2PQ8 A;  3MMY B;  4ZTF A;  2KDO A;  3UNG C;  1QPI A;  2GXA A;  1ZN2 A;  1BR4 A;  3CCS I;  3LMM A;  4RB0 A;  2ESH A;  5EZG A;  4BE0 A;  5FRO A;  2NVT J;  2WV0 A;  1HW1 A;  2A69 F;  1R5H A;  3CME I;  5KCM A;  1XD7 A;  2ETH A;  4IQ4 A;  4F92 B;  2CW0 F;  2OC6 A;  1AU7 A;  3GO5 A;  2CUE A;  4ANJ A;  5LRS A;  1MBE A;  1S3J A;  1LKX A;  1AWC A;  3FXL A;  2L7M P;  2R4G A;  1VQO I;  1G8X A;  4RB2 C;  2Z9O A;  1P4A A;  3DPL C;  3R4K A;  4HA8 A;  1LFU P;  3SDG A;  2EQR A;  1TC3 C;  2W25 A;  2JT1 A;  5CKT A;  1TL8 A;  2C6Y A;  2HI3 A;  2KHM A;  3Q0W A;  1BBY A;  3CDL A;  2ZCW A;  4HNV A;  5TJJ A;  3FHN A;  1Y56 A;  4HDV A;  2JUG A;  2DA3 A;  5HDG A;  1MW7 A;  3MN2 A;  4B3X A;  4WF2 A;  4WWC A;  3HRM A;  2BXZ A;  5E8G A;  1MMA A;  1LDJ A;  2P0W A;  3JRE A;  1JJ8 C;  3GBG A;  3HOY J;  1V55 H;  3GFM A;  3RKX A;  3WE3 A;  2HGC A;  4BUP A;  2KQR A;  3ONQ A;  4QSH A;  2V9P A;  4UUS A;  4BE1 A;  4YIR X;  3ISP A;  5BOX A;  1A5J A;  3VB2 A;  3DQV C;  3S93 A;  1YX5 A;  2RQP A;  2HOE A;  2ZXI A;  1VZ0 A;  3P9I A;  5EZH A;  3A0H C;  2K27 A;  1V4R A;  1HOM A;  3RZD J;  4Y3O A;  1Z21 A;  4II3 A;  1RKT A;  1YIO A;  3QP6 A;  5DYM A;  4EJU A;  2GIV A;  3F8N A;  1PJR A;  1X1B A;  2V6C A;  4HF0 A;  3M8F A;  3GYH X;  5H2F C;  3B02 A;  3JR9 A;  5LHH A;  4ENK A;  2LTP A;  2HVQ A;  2HQA A;  3BY6 A;  2BGC A;  1H8A C;  2HQR A;  2IVM A;  4B47 A;  3KET A;  5FRN A;  1OCR H;  2M9H A;  1V5F A;  2L02 A;  2QQ8 A;  4HLX A;  1ETQ A;  3DKW A;  2DFF A;  4PJJ A;  4LG0 B;  4BQN A;  4WCG A;  4LLN A;  4WXH A;  3HC7 A;  3K1M A;  1YS6 A;  1FOW A;  3ZOB A;  3SEQ A;  4CO8 A;  1X3Z B;  2NOG A;  4UB6 C;  2HQN A;  2OA4 A;  3F9K A;  1DDN A;  3LST A;  4HLY A;  1KYW A;  1BOB A;  1WCM J;  2P81 A;  2VBW A;  3CDI A;  4NDL A;  2KLO A;  2M2E A;  3H92 A;  4HEA 2;  2HDW A;  3LSI A;  2LRE A;  2I10 A;  1Y6I A;  2M7A A;  4BHB A;  5LHI A;  4DYR A;  2E7W A;  2L7K A;  2Y75 A;  3FZV A;  3ZMS A;  4QLC U;  4IHV A;  4XKV A;  5BS6 A;  3I3L A;  2ELH A;  1IF1 A;  3D5R C;  4ZDP A;  3H0D A;  3DLL F;  5IT3 A;  4KIG A;  2GA2 A;  2YU3 A;  4A3G J;  3VPR A;  1QA6 A;  1J5Y A;  4KMU X;  4IHX A;  4RAY A;  3SXY A;  5J3L A;  4BBR J;  4HBL A;  4C3H J;  2A5W A;  4D7M A;  5KHD A;  2CMP A;  3WGG A;  2ZBK A;  2P7C B;  4IOA F;  3HKZ N;  3SFI A;  3VWB A;  1R22 A;  1Y1V J;  4EJO A;  2X1D A;  2ISZ A;  1PP8 F;  3TKY A;  2QF7 A;  1X2M A;  2LLK A;  4R1H A;  1OCO H;  3ZQQ A;  1IN5 A;  2V1D A;  4KIF A;  4EM2 A;  2PG4 A;  1ZTR A;  2BY3 A;  1Z3Y A;  2M30 A;  3T0Y A;  5GAE J;  4O3M A;  1J2X A;  5E1Z B;  3AG1 H;  3LFK A;  4U0Y A;  3H9J A;  4P55 A;  4BHP A;  4D9J A;  2CJJ A;  4KIC A;  3JRF A;  1OPC A;  4Y52 J;  2YR2 A;  3JRA A;  1OCZ H;  2L9N A;  2E34 A;  3RYR A;  2FX0 A;  4YFN F;  2DOE A;  2VXZ A;  1ON2 A;  1NK3 P;  3GF2 A;  5CVU A;  4RS8 A;  1WFX A;  1I27 A;  4Y4R A;  3CTA A;  3FMS A;  3KFW X;  5FKL A;  4AID A;  2A5Y B;  4DYQ A;  2EZH A;  2GWR A;  1GDT A;  2OD5 A;  5CLS A;  2K02 A;  1Z05 A;  2VI6 A;  1XCV A;  1QVT A;  3K1N A;  5B3S H;  3K4M A;  2HQ5 A;  1TLH B;  2ECB A;  2GZW A;  4GYG A;  4AYB A;  2O03 A;  2FXA A;  2GBY A;  4X0G A;  2DPD A;  1PUE E;  2IXS A;  3ULQ B;  1T56 A;  2ZXJ A;  2XF5 A;  2E2I J;  2A3S A;  3T1B A;  3OYC A;  3C3W A;  1UG0 A;  1XGS A;  2EIN H;  3JRI A;  1KQ9 A;  2ZXW H;  4XOT A;  3T8R A;  2QQ9 A;  5J1U A;  1DP7 P;  2KIQ A;  1SD4 A;  5IOZ A;  3SZG A;  2OUM A;  1HDP A;  1FPQ A;  3MQ0 A;  4M3G A;  4A6D A;  1FOX A;  4RGU A;  1UHW A;  4Q4Z F;  3IKT A;  4FAS D;  4MHG A;  1IZ1 A;  3BTJ A;  3P9C A;  1FYL A;  4I98 B;  2CUF A;  1FLI A;  3TP3 A;  1H9T A;  5DUI A;  3FX3 A;  3I4M J;  4A3L J;  1W4M A;  2LSO A;  2XKO A;  2DA1 A;  3CF5 F;  4U87 A;  1ETV A;  1A36 A;  2IPQ X;  1TQI A;  2CQX A;  2DK8 A;  3DF8 A;  2IJL A;  3OYG A;  1IV8 A;  5E8I A;  2KP6 A;  1TWG J;  2NVX J;  1EH6 A;  1KU7 A;  5M3M J;  2R7W A;  2V1U A;  2EB7 A;  4JYK A;  2TRT A;  3DPU A;  3NAR A;  4O5V A;  3OMY A;  2VUM J;  3A1Y A;  2PJR B;  2HU9 A;  2MBF A;  1XN7 A;  1POG A;  4OMZ A;  3RTR A;  5HLI A;  3F6O A;  1K6O A;  1FIA A;  3NQO A;  4I99 C;  3F0C A;  4BL0 B;  3H3V K;  1TQM A;  3HGG A;  1LB2 A;  4CZZ A;  5B66 C;  4RGR A;  3Q9V A;  2H6C A;  1Y39 A;  2X4H A;  4XSZ F;  2Y69 H;  2A6T A;  5DV5 A;  2GIZ A;  3OR1 C;  2UZK A;  1K61 A;  4BDZ A;  2ZJ2 A;  1BR1 A;  2DDB A;  3GFI A;  1IN7 A;  4FHT A;  1AA7 A;  4OIO F;  3CJN A;  2DXI A;  2O9L A;  5LLQ A;  1D1B A;  3MAJ A;  3OS0 A;  5BPD A;  2GOM A;  4CCL A;  3IH3 A;  5GAG J;  4PJN A;  3W2A A;  5LHG A;  3OYL A;  3CJR B;  2Z3Y A;  2XRO A;  1MNM C;  3F8B A;  5TGT A;  1WRJ A;  5IT9 K;  3BRO A;  3ZN1 A;  2L54 A;  3RSN A;  4L5E A;  3GLL A;  3ZMV A;  3HOW J;  5B1A H;  4IRI A;  3PQJ A;  3IAS 2;  3JW4 A;  4B48 A;  3MKY B;  4B3A A;  1B9M A;  3OV8 A;  2O3F A;  3GME A;  2AXL A;  1P4W A;  3HB9 A;  3GUD A;  2Y2Z A;  4HYE A;  4M3B A;  4OU0 A;  1RC9 A;  1VF9 A;  2GQQ A;  3F23 A;  1R9T J;  1RIO H;  5IT9 Z;  1YTY A;  2M87 A;  2K4B A;  4OIP F;  1BI2 A;  5FO5 A;  4NB5 A;  5B5E C;  1W7P D;  1J59 A;  1D8J A;  3TW7 A;  3M1C A;  3GCM A;  1YFH A;  3SEZ A;  3O8H A;  3S3O A;  2ZNY A;  2VJJ A;  5ILV A;  2EZK A;  4A3B J;  1BIA A;  1IUY A;  4DNC A;  2DLL A;  2MLG A;  2TDX A;  1T39 A;  3HHH A;  2XRL A;  1BI1 A;  2O6G E;  3BG3 A;  4PGH A;  2VE8 A;  2YX4 A;  1UHS A;  4E70 A;  5A2Q K;  1QHG A;  1EH7 A;  2M45 A;  4IQJ A;  2JA8 J;  4Y17 A;  3OYN A;  3QOD A;  2D5V A;  4M6V A;  3I5U A;  2EV6 A;  1BI3 A;  2XGC A;  5JHF A;  2VN2 A;  1XSX A;  4ZC3 A;  2WV1 A;  1L3L A;  1TT5 B;  1TT0 A;  3E3V A;  3ZQF A;  2MD5 A;  3QRF F;  1WI9 A;  3FXM A;  4DBR A;  4LFU A;  5A2Q Z;  3F72 A;  1U3E M;  5FFX A;  1T95 A;  1IRF A;  2QSH X;  2ZME A;  5M5W J;  2E1N A;  3CUQ B;  1LVK A;  2EA2 A;  4IHW A;  4YEL A;  5FD5 A;  2OAZ A;  5LGT A;  4MGR A;  2H94 A;  5DUK A;  5CJ9 A;  1HDD C;  5EEH A;  1YJN I;  1TWH J;  2EPF A;  3ZMD A;  3H3U A;  3PFY A;  2XF7 A;  4A5M A;  4CYC B;  1MJA A;  2BW3 B;  4LK1 F;  3AL0 C;  1B6A A;  1D5V A;  4OWR B;  2A6H F;  1O3S A;  4HST A;  4CCM A;  1U0J A;  3DTI A;  4PFP A;  2G9W A;  5IP6 A;  3ECH A;  4EGZ A;  3L1P A;  1LE8 A;  2JSP A;  5DD8 A;  1X4P A;  4L0Z B;  2VQC A;  5C4X J;  4HDU A;  2KIS A;  4A3M J;  5D5W B;  3GVA A;  1IDZ A;  1G2H A;  1SVL A;  1YIJ I;  3VYR B;  5FGM A;  4HQM A;  1XS9 A;  2R5Y A;  4F55 A;  2KZG A;  2CFO A;  1HSJ A;  3BG7 A;  3TO7 A;  1HKS A;  4LLG F;  5JLX A;  2EIK H;  3JSP A;  1PP7 U;  1I1G A;  3TP0 A;  5KAI C;  2K5C A;  3HKZ A;  3DBR B;  1W5S A;  3FXJ A;  4LB5 A;  2A07 F;  1USS A;  2RVC A;  1OCP A;  2EFN A;  3T8T A;  1VQL I;  5IP7 J;  2EZL A;  1N78 A;  4QPO A;  1E2X A;  3MKL A;  1YRN A;  2NOJ B;  4GXO A;  1HF0 A;  4CA0 A;  2ZSI B;  3ABU A;  3E5X A;  2E1C A;  3GTM J;  1WH7 A;  2QCO A;  4OAY A;  3HXL A;  5AIP A;  1FOY A;  3HZJ A;  3ERE D;  4LD5 A;  1KQ0 A;  3BTC A;  1JHF A;  3GXO A;  2HDD A;  3H5R A;  2MC3 A;  1IGN A;  1PYV A;  3PFI A;  2K3F A;  3JRB A;  4ZYD A;  3PJR A;  4CH7 A;  1WJD A;  3ZQG A;  3MVP A;  2HZD A;  3RCO A;  1FIP A;  3PSF A;  3CP8 A;  2Z5U A;  3O8G A;  3I59 B;  3GFJ A;  4RB3 C;  2VJ4 A;  3CO7 C;  2VKE A;  5EF6 A;  2WY8 Q;  3ML6 A;  2FE3 A;  5ILS A;  3VYS B;  3ZQC A;  3HYI A;  4BKX A;  3RDI A;  3R61 A;  1X1D A;  1H9G A;  1FMW A;  1XGO A;  3ZN0 A;  1VQ7 I;  3BR5 A;  2CW8 A;  2QBY B;  4NBQ A;  4XN3 A;  3HRT A;  5HNF A;  1BN5 A;  4RA2 A;  2HVR A;  1C0W A;  2PLY A;  3BG6 A;  3M8J A;  5E3O A;  3N4M A;  2HYG D;  3I4N J;  5HS9 A;  1SFE A;  2R0Q C;  1J9I A;  3ZCO A;  1YS7 A;  1SD6 A;  2HFH A;  2JTV A;  3C1D A;  1UJ8 A;  3F8C A;  3IWZ A;  2P4W A;  4BXX J;  4MEX F;  5C4J J;  3H5N A;  1SMY F;  1TWF J;  3CMA I;  2CV2 A;  2GXB A;  5EEG A;  5BMZ A;  1O3R A;  5KAF C;  2RN7 A;  4W1U A;  3PIP F;  1CF7 B;  1FT9 A;  3ESW B;  1FZP B;  4KFC A;  3J81 K;  2R7Q A;  4M6Y A;  1I5Z A;  5K7H A;  1QHH D;  3GX4 X;  3LFU A;  1HQC A;  1JTY A;  3J7A O;  1B72 B;  5EJC A;  5DEQ A;  1UMQ A;  2LKS A;  4KN4 X;  3E5U A;  2FA5 A;  2CRG A;  1OYY A;  2LFB A;  3QPS A;  1UG2 A;  2ZFW A;  4LMY A;  2X6W A;  4BE2 A;  2LY2 A;  1EKE A;  3FIW A;  1ZG3 A;  1W7P B;  2BYV E;  2MC4 A;  1FYK A;  1VQK I;  1JT0 A;  2WC2 A;  1IDY A;  1SD5 A;  1SFX A;  3K1P A;  3J81 Z;  1WJA A;  3CCE I;  1RUO A;  2R7S A;  2FBH A;  3ZMU A;  5EGO B;  3KIO A;  4XLA A;  4RAG A;  4A69 C;  1YJW I;  4U7B A;  2FBI A;  1ZYR F;  2EZI A;  3SZT A;  1ETK A;  4E7J A;  2D1H A;  2UXN A;  2XAU A;  2BVL A;  2K4J A;  2GM4 A;  3CCQ I;  1VQ6 I;  3VOE A;  1D0Y A;  1UCR A;  4I7H A;  2K9M A;  2PI0 A;  3KZZ A;  2DMT A;  1R7J A;  3CP2 A;  4R8H A;  5LEJ A;  5TRD A;  3BTI A;  3WU2 C;  2DT7 B;  1GV5 A;  1XSV A;  1OMI A;  2PEX A;  3DWL E;  4RM3 A;  3KYL A;  5FKK A;  1QO0 D;  3FKJ A;  4XLH A;  4JBA A;  5M5X J;  3W2W A;  2EV5 A;  3HIF A;  2DA2 A;  1HA8 A;  2VKH A;  4ZH4 F;  5LGU A;  5D8L B;  3HSF A;  3E97 A;  2L7Z A;  3HSR A;  1TZL A;  1JKR C;  2CG4 A;  2KT0 A;  3KCC A;  1Y8R B;  1MH4 A;  2L5Q A;  2OTJ I;  1ZKG A;  6PAX A;  1QBJ A;  3EUA A;  2VT3 A;  5C44 J;  3WU1 B;  1J75 A;  4LG0 A;  3J7A Y;  1O7L A;  3MFK A;  4E7I A;  2FQ3 A;  2L2O A;  3X2Q H;  2XGE A;  3LA2 A;  3GTQ J;  5IOY A;  1DPU A;  3VOD A;  4XOR A;  1JKP C;  2G7H A;  2ZME C;  3BZ6 A;  1XMA A;  2F48 A;  2XAH A;  2EWN A;  2KKO A;  1RES A;  3V7S A;  2DA4 A;  2G7U A;  4XLP F;  1OFC X;  2QQB A;  3R60 A;  4IVN A;  2P5K A;  1WJE A;  4M73 A;  4D5F A;  1R4N B;  3VDX A;  1LEB A;  1X1A A;  1KQ8 A;  4E7K A;  1YQA A;  9ANT A;  3BJA A;  3NAU A;  3B6C A;  2JPB A;  1O7F A;  4CCN A;  2CQK A;  3CCL I;  3KP7 A;  2I5U A;  3D0S A;  3S14 J;  2FD5 A;  4RM2 A;  3LA3 A;  1L0O C;  1DU0 A;  1ZRF A;  2XV4 S;  3S2D J;  1PVE A;  3BR1 A;  3WHB A;  3S3M A;  2WTE A;  3MCZ A;  2D1V A;  1ZGJ A;  2DA7 A;  1RPW A;  3A01 B;  2MA3 A;  2XAG A;  4J19 A;  1JGS A;  1U2W A;  3CC4 I;  2DMP A;  3OYI A;  1IRG A;  2IS6 A;  4E4H A;  1QU3 A;  4Q47 A;  2EIJ H;  1T0F A;  3V8J A;  2XAJ A;  4CCJ A;  2PBI A;  3M3Y J;  3OS1 A;  3HHG A;  1HKT A;  4GCV A;  3V7R A;  2OU2 A;  1ZLK A;  1KA8 A;  2L9V A;  3GTL J;  1Y0N A;  2X6O A;  1SD7 A;  4PJ0 C;  1U6G A;  4IPA A;  2QUF A;  5K5R A;  2NS7 A;  1MGT A;  2P5V A;  5F0C A;  3M7G A;  2V4J C;  2VBY A;  4ZDL A;  4ITV A;  5D4R A;  1XTA A;  3Q0U A;  5HLG A;  2QYO A;  5HLT A;  2W4S A;  4XID A;  5FLM J;  4ETS A;  4P96 A;  2FUG 2;  2RDP A;  3C2G A;  2LP0 A;  1B59 A;  3COA C;  2CWE A;  4N0B A;  1E17 A;  3FBI B;  3BQY A;  1NTC A;  4MIM A;  5FFZ A;  5J8F A;  2DT5 A;  4BNC A;  2ISY A;  3TO9 A;  2WAD A;  4PJM A;  2E1M C;  4D0P A;  4XLF A;  3KX2 A;  3VSK A;  2HPM A;  2BY0 A;  1FP2 A;  1RRJ A;  4XIC A;  3CF2 A;  1SMT A;  1LNW A;  3BR6 A;  4XRF A;  1BC8 C;  1MJ9 A;  2HYF A;  1I6X A;  4U0V A;  3ASN H;  3TL4 X;  4FTH A;  1SAN A;  1WHU A;  5AIQ A;  3S2H J;  2LDU A;  3KP2 A;  4Z6Y A;  5EG0 B;  4JX4 A;  2IGM A;  2AQE A;  2BY1 A;  4O6J A;  1Z1D A;  3HOZ J;  3SZP A;  3FXO A;  4JX5 A;  1K6Y A;  4UV9 A;  3OYF A;  2V9V A;  4BH9 A;  3GZ6 A;  1S5L C;  3CLQ A;  2EFQ A;  1T38 A;  2K9S A;  1MMG A;  4PUS A;  3V8K A;  1OCT C;  4BAC A;  3K10 A;  4E7S A;  3KLO A;  5JFR A;  3G1O A;  4L9N A;  2F4I A;  3GTK J;  2R7F A;  2R92 J;  2H09 A;  5J40 A;  5ICE A;  1J0R A;  4QIW N;  1SFO J;  1KU2 A;  3TO6 A;  2V1X A;  3HTU A;  3WTS C;  3BR2 A;  5C3E J;  1S29 A;  2X51 A;  1U78 A;  5E1X A;  1IXC A;  1OIS A;  2CUZ A;  5D5X B;  3EQL F;  4C3J J;  3ZMT A;  2PJP A;  2F5D A;  4KMF A;  3TW6 A;  2PJR A;  2FEZ A;  3FM3 A;  4FE4 A;  2QZ8 A;  3PUB A;  3BT9 A;  5GPA A;  3N05 A;  1N77 A;  2GOX B;  4LG3 A;  3DKX A;  5H6Q A;  4BEH B;  2A61 A;  2HZT A;  5KVR A;  2YS9 A;  3S32 A;  5GAH J;  1F4K A;  1MMN A;  3DU5 A;  3JRC A;  1O3T A;  3DV8 A;  4BY1 J;  3PSI A;  2MH9 A;  4YII A;  1MSF C;  2BHZ A;  1MBK A;  2R93 J;  3CZ6 A;  4Q48 A;  1K78 B;  4A93 J;  4C9Y A;  2OPT A;  3S2W A;  3W6V A;  3I56 I;  2VPL A;  4M3D A;  4N4N B;  2XGX A;  2VBZ A;  2XUB A;  4RAZ A;  5DCM B;  2JA5 J;  2LRD A;  4Y7N J;  3CES A;  4YFK F;  1YE9 A;  4I2O A;  3V8L A;  2DCE A;  1ZGW A;  4XM3 A;  1Z6R A;  2W85 A;  3IHU A;  1FSE A;  3VYU B;  5JI6 A;  2XF6 A;  1JUP A;  1Z0X A;  4A0Y A;  5GTI C;  4AVP A;  1ZAR A;  1T08 B;  4UVB A;  2CFX A;  3KP4 A;  1MDM B;  4N9I A;  1IO2 A;  1FBU A;  2R7O A;  1FWZ A;  3DPT A;  2K85 A;  2F5V A;  1VQN I;  3MKZ A;  3BG9 A;  2HXO A;  5BPI A;  4LOC A;  1EA3 A;  3LWF A;  4RLQ A;  1EV7 A;  4HQE A;  3OS2 A;  2UWM A;  4S05 A;  2LF7 A;  5CVJ A;  2XKP A;  1RKW A;  3H35 A;  1A04 A;  2FQ4 A;  1MBJ A;  2CO5 A;  4XQF A;  4XK4 A;  1X3W B;  1LFB A;  1B4A A;  4PJL A;  3D1N I;  5H6R A;  4B09 A;  1DGR M;  3EYY A;  3HPH A;  4I0B A;  3K70 D;  4AWX B;  4Y13 A;  4FIS A;  2VB6 A;  1V5E A;  2ZC2 A;  4G7H F;  4PSW A;  5EYR A;  4KNY A;  4B4C A;  3PUF A;  3QPL A;  2ZO4 A;  2QEN A;  4KIS A;  1VQ8 I;  4FET A;  3TOB A;  1T0F C;  5AON A;  3A4C A;  4CDG A;  3OL4 A;  3RKY A;  5ICC A;  2A6E F;  3CJQ B;  3U21 A;  4ASN A;  3W6J B;  1D8K A;  2LF8 A;  2CQQ A;  3RIR A;  3IC7 A;  3BCA A;  2XAF A;  2B0L A;  1YOV B;  3AG3 H;  4V19 K;  3CUQ A;  4E7Z A;  4U7D A;  2CGP A;  3RKW A;  1FYM A;  5K7F A;  2KRC A;  1KU9 A;  2XC7 A;  4UUT A;  5F27 A;  1IRX A;  1MD0 A;  2DO7 A;  2L3D A;  2ZJP F;  2K9Q A;  3WTY C;  3L2W A;  2CSO A;  1ZLJ A;  3ZQ7 A;  3G1L A;  4CYC A;  2XAQ A;  2BW3 A;  4QTR A;  3QYB A;  4JK1 X;  3CDH A;  1HCR A;  4A3C J;  1P92 A;  5L3F A;  2PX9 A;  3SHF A;  2FOW A;  2CQ7 A;  4XSX F;  3FKI J;  3HG9 A;  3WHC A;  5HDK A;  3IWF A;  2KFD A;  2IS4 A;  1D1C A;  4GYI A;  2R7D A;  1VI0 A;  4Y15 A;  2ECC A;  4FX0 A;  5HVQ C;  1XDS A;  3FF5 A;  4ESF A;  3BJ6 A;  1QGP A;  3BDD A;  1I6H J;  3MKW B;  4XLN F;  2Y9Z A;  4L9T A;  2NVY J;  4C3I J;  1WQ2 A;  3H36 A;  5E3N A;  2R5Z B;  1U9N A;  4L9V A;  2BY2 A;  2Q0O A;  3OL3 A;  5HOD A;  1FMV A;  1VQM I;  1WJB A;  2WA0 A;  2P5L C;  5KNL A;  4N9H A;  1JT6 A;  3LAJ A;  4XLE A;  1HLV A;  1F5T A;  1E0E A;  4OIN F;  1HW5 A;  2F5F A;  3K4K A;  3WTU C;  1B9N A;  5B1B H;  1PUF B;  3HOS A;  2DAO A;  1Z91 A;  2AQF A;  1A6I A;  1WPK A;  2AHQ A;  1QZE A;  5F04 A;  1OJL A;  2HOS A;  2A68 F;  3KE2 A;  4DIQ A;  4EJV A;  3IL2 A;  1BA5 A;  4NC7 A;  2ME6 A;  2PMZ N;  2W7N A;  4HX4 A;  2EFW A;  1YW9 A;  1A35 A;  3RJP A;  2E2H J;  5JHU A;  4X6A J;  2Z1D A;  4MNU A;  4E6K G;  3OYH A;  2XPU A;  3BPV A;  1FTT A;  1XGM A;  4TV7 A;  2BHY A;  1K83 J;  5BQT A;  3LSK A;  3OYJ A;  3SYT A;  1Z3X A;  3I59 A;  2L4M A;  3W3C A;  2JN6 A;  1RUN A;  1FC3 A;  4PDK A;  5CVV A;  1T8I A;  3OWT A;  2K86 A;  1ZRC A;  1P7J A;  2QBY A;  3ZXS A;  2F5C A;  3GZN B;  3L9F A;  1MBH A;  2DA6 A;  4KJZ A;  4J01 A;  3Q9S A;  3L2Q A;  3LOC A;  4RGS A;  3H9Q A;  1G3T A;  2IS2 A;  1MZB A;  5GPC A;  4OOI A;  2LBF B;  2H27 A;  1SAU A;  1Y8Q B;  3HJE A;  3O3K A;  1UB9 A;  1R71 A;  4KT5 C;  2H1K A;  1KU3 A;  1OLT A;  1MIJ A;  1XG1 A;  2V1N A;  4M9Z A;  4BAY A;  1GXP A;  2VQG A;  3OIQ A;  1Z7U A;  5ILU A;  5J1R A;  1SFU A;  4F52 A;  4HRI A;  4ZZL A;  5CYV A;  2GA1 A;  1T2K A;  2XGD A;  3OOU A;  4HSR A;  1OYW A;  1CF7 A;  3Q3S A;  2Q2E B;  1UEL B;  2DYS H;  3WGH A;  1P2F A;  4A3E J;  2DMN A;  2JA6 J;  3JCU C;  3LSJ A;  1MMD A;  1R58 A;  3C18 A;  2CV1 A;  1TW3 A;  1X2N A;  4JX6 A;  1E3P A;  1B72 A;  4FT8 A;  2QLZ A;  3HOT A;  2DOF A;  2MSY A;  4I0A A;  3LSG A;  4L9J A;  3RPU D;  5LFA A;  2H6B A;  1DQU A;  1W7P A;  1YO5 C;  2ZNZ A;  2HNH A;  2R3S A;  3ZGK A;  4L5I A;  1YW8 A;  4KN7 X;  5EGO A;  2STT A;  1KGS A;  2JWT A;  3FM5 A;  2DMQ A;  2LKX A;  2F4M B;  4PCQ A;  4KYW A;  1REP C;  2XB5 A;  2DT6 A;  5L3G A;  5HLH A;  4IHY A;  3S16 J;  1VND A;  1X3U A;  3Q0V A;  1FBQ A;  2E36 A;  3F8F A;  2HPI A;  2Y31 A;  1LQ1 A;  1V3F A;  3U1K A;  1D0Z A;  4CCK A;  1B1B A;  3FDY A;  4ENN A;  1W5C C;  3SFZ A;  2R7U A;  1LEA A;  4AIH A;  4BS9 A;  4X1E A;  1Q1H A;  1NHA A;  1IN8 A;  1QNT A;  2IT0 A;  2VLA A;  5E79 C;  5CPR B;  3WG7 H;  1TBX A;  4KIB A;  1MBG A;  1YHQ I;  2ACJ A;  2V79 A;  3QPT A;  2K9L A;  4MO7 A;  1IC8 A;  2K9N A;  2P6S A;  3WTZ A;  2X1C A;  1MKM A;  3K69 A;  2XRN A;  2W24 A;  2W48 A;  4E7L A;  1G3S A;  5LBQ A;  4M9S A;  5GP9 A;  2IBD A;  5ED4 A;  5D4S A;  2FRH A;  2DJI A;  4V2F A;  4XRM A;  1XDU A;  4PFO A;  4PZJ A;  3A0B C;  3I53 A;  5BNG A;  1H89 C;  2W82 A;  1Z67 A;  4IJA A;  2HTJ A;  1JE8 A;  2Y9Y A;  5DTD A;  3SJM A;  5D5U B;  1BOA A;  4HPQ A;  1XMX A;  2X6Y A;  1TNS A;  3TED A;  4W97 A;  4NQW B;  1RI7 A;  3K4C A;  5F0F A;  3CO6 C;  3CUQ C;  3DXJ F;  4HX8 A;  1JUS A;  2LD5 A;  2LOO A;  4HX7 A;  1EF4 A;  2UXX A;  4AM3 A;  1WZ2 A;  3DEE A;  1R23 A;  3OOP A;  2OJE D;  1IRZ A;  2H8W A;  2LC2 A;  2LG4 A;  2LMD A;  3K4N A;  1OKR A;  4BQQ A;  4ZYE A;  1GT0 C;  2FBK A;  1AKH B;  4LJZ F;  1U5T B;  1WI3 A;  4AVZ A;  1O4X A;  4EMS A;  3OSG A;  2B7E A;  3HL2 A;  4U0W A;  1T98 A;  3BLY A;  4NC8 A;  2CUJ A;  4LLL A;  1HBX G;  2X9D A;  3A01 A;  3F21 A;  4HOB A;  4DOZ A;  2NAZ A;  1R49 A;  2ICW G;  5KK1 A;  1ZEL A;  3JTH A;  3R0A A;  1WGX A;  2MLK A;  2IS1 A;  2RQQ A;  2YUS A;  1K4T A;  4XBF A;  3HBL A;  3K70 C;  3RZO J;  3CCU I;  2EIL H;  2QQA A;  2WAE A;  3DLA A;  1K4S A;  4AU7 A;  2VBX A;  2XSD C;  2GAU A;  1DUX C;  1WKM A;  3U9G A;  4YG2 F;  2MYS A;  2YX7 A;  1W5T A;  3K4J A;  4BDY A;  5F0H A;  1B8I B;  3H9G A;  4CHU A;  2CS3 A;  3K4B A;  2QVO A;  3BG5 A;  2IGN A;  4G6Q A;  1JGG A;  2LH9 A;  2RNJ A;  3TOA A;  4ZYG A;  2K40 A;  2KL4 A;  5IP9 J;  2R7T A;  1IUF A;  2HOA A;  4A12 A;  3MWM A;  4ZDO A;  2VT2 A;  1JUM A;  4EM0 B;  1NG6 A;  1V5G A;  3AG4 H;  5F1J A;  3JTG A;  3GLX A;  4LIV A;  2Z2S B;  3FXQ A;  2L0K A;  4CCO A;  2E7X A;  1KON A;  3FK6 A;  4WX9 A;  2EK5 A;  1TW2 A;  2W1O A;  4CIC A;  2DFI A;  1NG7 A;  1I1S A;  2JJ7 A;  1RET A;  2X1E A;  1SC7 A;  1GUU A;  4XKB A;  2Y0S N;  2Z16 A;  1G4D A;  2DFE A;  3RPQ A;  4FCY A;  4I01 A;  4KT6 A;  3TMO A;  3PIO F;  2BV6 A;  3QP5 A;  4LB6 B;  3NWS A;  3B73 A;  4BJ6 C;  4ZZD A;  1JHH A;  1JKO C;  5DM6 F;  5EG0 A;  2QKL B;  4KDP A;  2EIM H;  2GLO A;  2VXD A;  5FLX K;  4LGW A;  1M1E B;  4FX4 A;  3QYF A;  4EJW A;  4UXN A;  2ZB9 A;  3LQQ A;  3H1C A;  1MNE A;  1P4X A;  4C2M J;  1P6R A;  2ELJ A;  2DU9 A;  2PMU A;  3K6G A;  3HRU A;  2VKD A;  1BJA A;  4GGG A;  3OR2 C;  4M3F A;  2OTL I;  4QWQ A;  2DQR A;  2G0E A;  2M3A A;  2MAB A;  2UV1 A;  5E1W A;  3OSF A;  4M3E A;  3TGN A;  3HDD A;  2DBB A;  2KIU A;  2M0M A;  3GEZ A;  4BHC A;  2FJ1 A;  1ULY A;  3DEW A;  5FLX Z;  2LY9 A;  1W0T A;  4Y33 A;  3WU0 A;  4GDF A;  4BJT A;  3G3Z A;  1VQ5 I;  4AIK A;  3HOU J;  2ZSH B;  4BXU A;  4HNT A;  1HST A;  2XB0 X;  3F8M A;  3WE2 A;  3WOD F;  3WTV C;  1W1W E;  4FE7 A;  2JZY A;  4EGY A;  3K2A A;  3ERM A;  3WG9 A;  5LEK A;  4NHJ A;  2PMZ A;  4ESJ A;  1RR7 A;  3CMY A;  1G3Y A;  2ME0 A;  3T5X A;  4AUX A;  3A2K A;  1LVA A;  3BR3 A;  1ON1 A;  2WAF A;  4IF4 A;  4GRI A;  3AFH A;  4XMY A;  1T6S A;  2R7V A;  4BEH A;  3O2P E;  2L7F P;  2CW7 A;  3FWE A;  1IJW C;  1U8B A;  3GTG J;  1FBS A;  4CXF A;  3BP8 A;  3P9K A;  3CCY A;  3W6K B;  2KJC A;  3J80 K;  4G6D A;  2O61 A;  2B63 J;  3ZQH A;  3MZ8 A;  3HPG A;  2NNN A;  2M8G X;  3A02 A;  5K1Y A;  5FKN A;  3IAM 2;  3I9V 2;  4D1Q A;  3LQR A;  1E3H A;  2JK3 A;  3HEF A;  1F36 A;  2KIF A;  1CGP A;  3KZY A;  1K78 A;  2MFZ A;  2JPC A;  2V7F A;  3REO A;  3SDB A;  3C2B A;  3S15 J;  3V4G A;  4MTD A;  3ZQI A;  1HW2 A;  1MSE C;  2NS0 A;  3EUK L;  3Q5F A;  4ENM A;  3E6M A;  3J80 Z;  3LSH A;  4A2U A;  2AO9 A;  5DCM A;  1S8N A;  4DYC A;  3IRQ A;  1J7K A;  2LVS A;  2VOO A;  3GFL A;  2Y48 A;  1X19 A;  2AS5 F;  3VYT B;  2LR8 A;  5J47 A;  4UUV A;  3ASO H;  2KJB A;  1IXR C;  4JOM A;  4MQV A;  3S1Q J;  1IN6 A;  3G2B A;  5FRM A;  1SVM A;  3BR0 A;  2XHK A;  2Q8K A;  4BYY A;  1ZGA A;  3CC7 I;  4XR6 A;  5FKO A;  3ZRG A;  2ESN A;  2DFH A;  2VQH A;  3KEY A;  1MDM A;  4IRH A;  1STZ A;  4I02 A;  4DBQ A;  1XGN A;  4LIT A;  4UHT A;  4WK8 F;  2H1L A;  5D6E A;  3L2C A;  3BPX A;  3BQZ A;  3ABK H;  2NYX A;  2QSG X;  4KA4 A;  4XNF A;  3L2U A;  2KZV A;  2IW5 A;  4P9U A;  3HOX J;  4G6T B;  3NWT A;  5LD2 C;  3OIP A;  1ZR2 A;  2LKP A;  5GAD J;  1S7A A;  1YJ9 I;  2CH0 A;  2TCT A;  3R0J A;  3S8P A;  1QZZ A;  1YLF A;  2M4K A;  4YFX F;  2DMU A;  3QQA A;  2BE5 F;  3F22 A;  3CCV I;  2Y30 A;  2BXY A;  2BZT A;  3OYE A;  2ZJQ F;  2DOA A;  2DW4 A;  5FB2 A;  2HVS A;  3TDU C;  5ICG A;  2WBM A;  1XPX A;  1MND A;  2J5O A;  3M8E A;  2QA4 I;  2O8X A;  2X0L A;  1ZR4 A;  5IY5 H;  1A6Q A;  2JQ7 A;  3FXU A;  4WXD A;  1BW6 A;  1DU6 A;  3MEX A;  2DTZ A;  4Z2Y A;  2MGQ A;  2AXT C;  1LDK B;  3V7C A;  3GTP J;  5FLV A;  1GLN A;  2WAQ N;  1SFK A;  2IGK A;  4RDU A;  3HUG B;  2MG4 A;  3I55 I;  2P7V B;  2VIX A;  3SQN A;  1SAX A;  2EJR A;  3LNQ A;  2WY7 Q;  3K4L A;  2IP2 A;  4JP0 A;  1Z6T A;  3FXR A;  2HTS A;  2PMH A;  4LK0 F;  3I64 A;  3N97 A;  4EJT A;  1BM9 A;  4BQA A;  4GO1 A;  2ADU A;  4B8X A;  4BQO A;  2HWV A;  2KPM A;  3BZC A;  1BIB A;  3HTS B;  3KYC B;  4ON0 A;  2UUZ A;  4XON A;  3PNV A;  1S9H A;  4A3D J;  1DPR A;  3FMR A;  5L3C A;  3I58 A;  2NVU B;  3IH2 A;  5EEA A;  2HDC A;  2XAS A;  1N75 A;  2E35 A;  4ZYH A;  4I76 A;  1WH5 A;  2OQR A;  3RKQ A;  1R5G A;  2DPU A;  4IOC F;  2JRT A;  4F93 B;  4I6Z A;  2QM3 A;  1YG2 A;  3ELK A;  3CCR I;  5DCF A;  2W84 A;  5E3M A;  3E6C C;  1R1T A;  5J4Y A;  2R5Z A;  1EJ9 A;  4DQ2 A;  1RR8 C;  5IYB J; 
#chains in the Genus database with same CATH homology
 2XIG A;  3WTX C;  5F1R A;  1BI0 A;  1R36 A;  2VC1 A;  4U88 A;  5ICF A;  1IW7 F;  3CLO A;  3F3X A;  3L7W A;  4WXC A;  1IN4 A;  4MEY F;  5K5Q A;  2O0Y A;  4A5N A;  2STW A;  4HAM A;  2FSW A;  2RC4 A;  2J5P A;  3VEP A;  2K7L A;  2DK5 A;  5K5O A;  2CYY A;  4EM1 A;  4G9Y A;  2IA2 A;  2FMY A;  3KP5 A;  4IHT A;  3QU3 A;  1TTY A;  3IKV A;  5CVI A;  2VON A;  2VE9 A;  3EUH A;  3ROU A;  2OQG A;  2Y0M A;  3QU6 A;  4UV8 A;  1FNN A;  2D45 A;  3TDZ C;  3RYP A;  2OZU A;  3GW2 A;  5FD6 A;  1PDN C;  1K7A A;  5F64 A;  5ERI A;  5H20 A;  4K2E A;  2XVC A;  4I09 A;  1VTN C;  4R79 A;  2JSC A;  2QWW A;  2L4A A;  1ZG1 A;  2Q2E A;  2OBP A;  1HXD A;  2KRF A;  2PFB A;  5HS8 A;  3WTT C;  1UHM A;  2FOK A;  2OZ6 A;  4H0E A;  2EFP A;  4HV6 A;  4ESB A;  1ONV A;  4UVA A;  4KUM A;  3I0T A;  2D2W A;  1ZG5 A;  1YW7 A;  5CVR A;  4OIQ F;  1UFM A;  4HF2 A;  3K9T A;  4MQ9 F;  3P7N A;  2GXG A;  3EYI A;  3ZP5 A;  1OR7 A;  2FML A;  5D6F A;  2YSR A;  2YPR A;  3D5L A;  1K79 A;  3KLN A;  1U8R A;  3HSE A;  1RNL A;  5DDG A;  4M71 A;  1EH8 A;  3GWZ A;  4HW0 A;  5DD4 A;  4P5O A;  1FP1 D;  1FX7 A;  4HF1 A;  3L09 A;  3HRS A;  3JAM K;  1GXQ A;  3WGI A;  4NQW A;  3AAF A;  1JXS A;  1MJB A;  2FU4 A;  2EA4 A;  2Z33 A;  1LDD A;  3G73 A;  5JVT A;  3EET A;  3R6S A;  1Y0U A;  3ABT A;  5L3D A;  3JAM Z;  4G7O F;  3I54 A;  4RGX A;  3DP7 A;  3E6D A;  5L3E A;  1FOK A;  1U5T A;  4S04 A;  3EDP A;  1IXS B;  1O57 A;  1LJ9 A;  1TNT A;  3QAH A;  4F7Z A;  2DQL A;  4RB1 A;  2HKX A;  3KP6 A;  1AOY A;  4MTE A;  3BJO A;  1XMK A;  1S6L A;  1ODD A;  3ZPL A;  1ZH5 A;  2NNY A;  1KYZ A;  3M1E A;  2M1B A;  4IXA A;  3H3Z A;  5L3B A;  1XCB A;  1QQI A;  4CGZ A;  3NEU A;  3K0L A;  3QOP A;  3E5Q A;  3BWG A;  3CUO A;  4M74 A;  3U2R A;  2BBY A;  3JSO A;  2HR3 A;  2F5E A;  4A6E A;  1Z9C A;  4EV0 A;  3IRR A;  4OMY A;  3GZ5 A;  1R00 A;  2FNP A;  4HV5 A;  3K2Z A;  2M5W A;  3QPH A;  4M9X A;  4A0X A;  3LA7 A;  2DI3 A;  1ZAO A;  3C7J A;  3TQN A;  2F2E A;  5LRR A;  1XB4 A;  1R1V A;  2L01 A;  3RPU A;  1QZY A;  5D8K B;  4UNO A;  3L00 A;  4P9F A;  3ECO A;  3MZH A;  4IHS A;  3LAP A;  4UVC A;  3O6B B;  2KIM A;  5E17 F;  3I4P A;  3MZY A;  4EVI A;  3WTW C;  5JR3 A;  2HS5 A;  4CYD A;  2WWY A;  4HZF A;  1S7O A;  2HKO A;  1QPM A;  2IA0 A;  1TQP A;  2NRA C;  5D5V B;  2LNB A;  4G7Z F;  5LGN A;  2EFO A;  2FNA A;  2ZME B;  1GVJ A;  4G94 A;  4ENJ A;  1YYV A;  1R1U A;  4YIF A;  1WSU A;  5E20 A;  5J8C A;  1ZRD A;  4L5J A;  1F9N A;  4A0Z A;  1O3Q A;  4Q5S F;  3KEQ A;  1BC7 C;  1HKQ A;  3PQK A;  3NRV A;  1ZHF A;  2ZKZ A;  2W57 A;  1UST A;  3FMQ A;  3ZMZ A;  4AIJ A;  1F1Z A;  2M8E A;  4OIR F;  2P6T A;  1WWX A;  2IRF G;  3DEU A;  3VFZ A;  3F6V A;  5HS7 A;  1FSH A;  1IAW A;  3FHZ A;  1G3W A;  3U1D A;  4L0Y B;  1RZ4 A;  4M6X A;  2COM A;  4PGG A;  3KP3 A;  3I71 A;  2DTR A;  1XSD A;  2Z99 A;  5E18 F;  1OYI A;  2P8T A;  2PN6 A;  4L18 B;  1G6N A;  1U5T C;  1FY7 A;  4AD9 A;  2BEO A;  4JQF A;  2VOD A;  2VC0 A;  3M9A A;  5J6X A;  2RGV A;  2RKH A;  1H0M A;  3KEO A;  2VOP A;  4G8X A;  2HEO A;  5HDN A;  1ZRE A;  4M72 A;  4IRG A;  2IA1 A;  3BOQ A;  2RV8 A;  3RI4 A;  1GHC A;  2FF4 A;  2MH2 A;  1D3Y A;  3E6B A;  4EQQ A;  2EV0 A;  3DFG A;  3HUG A;  5F6F A;  5HOO A;  2PQ8 A;  1ZN2 A;  4RB0 A;  2ESH A;  2WV0 A;  1HW1 A;  2A69 F;  1R5H A;  2ETH A;  1XD7 A;  2CW0 F;  3GO5 A;  5LRS A;  1S3J A;  1AWC A;  2Z9O A;  4RB2 C;  1P4A A;  3DPL C;  3R4K A;  4HA8 A;  2W25 A;  2JT1 A;  2C6Y A;  1BBY A;  2ZCW A;  5TJJ A;  4HDV A;  5HDG A;  4WF2 A;  4WWC A;  3HRM A;  5E8G A;  1LDJ A;  3GFM A;  3RKX A;  3WE3 A;  2HGC A;  5BOX A;  3ISP A;  3VB2 A;  3DQV C;  2RQP A;  2HOE A;  3P9I A;  2K27 A;  1V4R A;  1YIO A;  3QP6 A;  5DYM A;  4EJU A;  2GIV A;  3F8N A;  4HF0 A;  2V6C A;  3M8F A;  3GYH X;  3B02 A;  5LHH A;  4ENK A;  3BY6 A;  2BGC A;  2HQR A;  2IVM A;  3KET A;  2L02 A;  4HLX A;  3DKW A;  4LG0 B;  4WCG A;  4LLN A;  4WXH A;  3K1M A;  1YS6 A;  4CO8 A;  2HQN A;  2OA4 A;  1DDN A;  3LST A;  4HLY A;  1KYW A;  2VBW A;  3H92 A;  4BHB A;  5LHI A;  2E7W A;  2Y75 A;  3FZV A;  3ZMS A;  4QLC U;  5BS6 A;  2ELH A;  1IF1 A;  5IT3 A;  4KIG A;  2GA2 A;  2YU3 A;  1J5Y A;  4KMU X;  4RAY A;  3SXY A;  4HBL A;  2P7C B;  3WGG A;  2ZBK A;  1R22 A;  4EJO A;  2ISZ A;  1PP8 F;  3TKY A;  4R1H A;  1IN5 A;  2V1D A;  4KIF A;  4EM2 A;  2PG4 A;  2M30 A;  3T0Y A;  4O3M A;  1J2X A;  5E1Z B;  3LFK A;  4U0Y A;  4P55 A;  4BHP A;  4KIC A;  1OPC A;  2YR2 A;  3RYR A;  4YFN F;  2VXZ A;  1ON2 A;  3GF2 A;  5CVU A;  4RS8 A;  1I27 A;  3CTA A;  3FMS A;  3KFW X;  2A5Y B;  2GWR A;  2OD5 A;  5CLS A;  2K02 A;  1Z05 A;  1XCV A;  3K1N A;  1TLH B;  2GZW A;  4GYG A;  2O03 A;  2FXA A;  2DPD A;  1PUE E;  3ULQ B;  2ZXJ A;  2A3S A;  3T1B A;  3C3W A;  1XGS A;  1KQ9 A;  3T8R A;  2QQ9 A;  1DP7 P;  1SD4 A;  1FPQ A;  3MQ0 A;  4A6D A;  4RGU A;  1UHW A;  4Q4Z F;  3IKT A;  4MHG A;  1IZ1 A;  3P9C A;  1FYL A;  4I98 B;  1FLI A;  1H9T A;  5DUI A;  3FX3 A;  1W4M A;  2LSO A;  2XKO A;  2IPQ X;  1TQI A;  3DF8 A;  2DK8 A;  2IJL A;  5E8I A;  1EH6 A;  1KU7 A;  2V1U A;  2EB7 A;  4O5V A;  2MBF A;  1XN7 A;  4OMZ A;  3RTR A;  5HLI A;  3F6O A;  1K6O A;  3NQO A;  1TQM A;  1LB2 A;  4CZZ A;  4RGR A;  3Q9V A;  2H6C A;  2X4H A;  4XSZ F;  5DV5 A;  2UZK A;  2ZJ2 A;  3GFI A;  1IN7 A;  4FHT A;  4OIO F;  3CJN A;  5LLQ A;  3MAJ A;  5BPD A;  5LHG A;  2Z3Y A;  2XRO A;  3F8B A;  1WRJ A;  5IT9 K;  3BRO A;  3ZN1 A;  2L54 A;  3ZMV A;  4IRI A;  3PQJ A;  3JW4 A;  1B9M A;  3OV8 A;  2O3F A;  2AXL A;  1P4W A;  3GUD A;  4HYE A;  4OU0 A;  2GQQ A;  3F23 A;  1RIO H;  5IT9 Z;  1YTY A;  2M87 A;  2K4B A;  4OIP F;  1BI2 A;  5FO5 A;  4NB5 A;  1W7P D;  1J59 A;  1D8J A;  1YFH A;  2ZNY A;  5ILV A;  1BIA A;  1IUY A;  4DNC A;  2DLL A;  2MLG A;  2TDX A;  1T39 A;  3HHH A;  1BI1 A;  2O6G E;  4PGH A;  5A2Q K;  2VE8 A;  2YX4 A;  4E70 A;  1EH7 A;  2M45 A;  4Y17 A;  3I5U A;  2EV6 A;  1BI3 A;  2VN2 A;  1XSX A;  1L3L A;  3E3V A;  3QRF F;  2MD5 A;  1WI9 A;  4LFU A;  5A2Q Z;  3F72 A;  1U3E M;  5FFX A;  1IRF A;  2ZME A;  2E1N A;  3CUQ B;  2EA2 A;  5FD5 A;  2OAZ A;  5LGT A;  4MGR A;  2H94 A;  5DUK A;  5CJ9 A;  5EEH A;  3ZMD A;  3H3U A;  4A5M A;  1MJA A;  4LK1 F;  1B6A A;  1D5V A;  2A6H F;  1O3S A;  2G9W A;  3ECH A;  4EGZ A;  5DD8 A;  4L0Z B;  4HDU A;  5D5W B;  3GVA A;  5FGM A;  4HQM A;  1HSJ A;  3TO7 A;  1HKS A;  4LLG F;  3JSP A;  1PP7 U;  1I1G A;  1W5S A;  4LB5 A;  2A07 F;  1USS A;  2RVC A;  2EFN A;  3T8T A;  1E2X A;  4GXO A;  3ABU A;  3E5X A;  2E1C A;  5AIP A;  3ERE D;  4LD5 A;  1KQ0 A;  1JHF A;  3GXO A;  2MC3 A;  3PFI A;  4ZYD A;  2Z5U A;  3I59 B;  3GFJ A;  4RB3 C;  3CO7 C;  3ML6 A;  2FE3 A;  5ILS A;  3HYI A;  3RDI A;  3R61 A;  1H9G A;  1XGO A;  3ZN0 A;  2QBY B;  3HRT A;  1BN5 A;  1C0W A;  2PLY A;  3N4M A;  2HYG D;  5HS9 A;  1SFE A;  1J9I A;  1YS7 A;  1SD6 A;  2HFH A;  2JTV A;  3C1D A;  3F8C A;  3IWZ A;  2P4W A;  4MEX F;  1SMY F;  2GXB A;  5EEG A;  5BMZ A;  1O3R A;  2RN7 A;  4KFC A;  1CF7 B;  1FT9 A;  1FZP B;  3J81 K;  4M6Y A;  1I5Z A;  3GX4 X;  1HQC A;  3J7A O;  5DEQ A;  4KN4 X;  3E5U A;  2FA5 A;  1OYY A;  2ZFW A;  4LMY A;  1ZG3 A;  1W7P B;  2BYV E;  1FYK A;  2WC2 A;  1SD5 A;  1SFX A;  3K1P A;  3J81 Z;  1RUO A;  2FBH A;  3ZMU A;  4U7B A;  2FBI A;  1ZYR F;  3SZT A;  2D1H A;  2UXN A;  2K4J A;  3VOE A;  1UCR A;  4I7H A;  2PI0 A;  3KZZ A;  5LEJ A;  1R7J A;  4R8H A;  5TRD A;  1XSV A;  1OMI A;  2PEX A;  1QO0 D;  4JBA A;  2EV5 A;  3HIF A;  4ZH4 F;  5LGU A;  5D8L B;  3HSF A;  3E97 A;  3HSR A;  2CG4 A;  3KCC A;  6PAX A;  1QBJ A;  3WU1 B;  2VT3 A;  1J75 A;  4LG0 A;  1O7L A;  3MFK A;  2FQ3 A;  3LA2 A;  1DPU A;  3VOD A;  2G7H A;  3BZ6 A;  1XMA A;  2XAH A;  2EWN A;  2KKO A;  3V7S A;  2G7U A;  4XLP F;  2QQB A;  3R60 A;  4IVN A;  2P5K A;  4M73 A;  1LEB A;  1KQ8 A;  1YQA A;  3BJA A;  2JPB A;  1O7F A;  2CQK A;  3KP7 A;  3D0S A;  3LA3 A;  1L0O C;  1ZRF A;  2XV4 S;  2WTE A;  3MCZ A;  2D1V A;  1ZGJ A;  2MA3 A;  2XAG A;  1JGS A;  1U2W A;  1IRG A;  4Q47 A;  1T0F A;  3V8J A;  2XAJ A;  2PBI A;  3HHG A;  1HKT A;  4GCV A;  3V7R A;  2OU2 A;  1ZLK A;  1KA8 A;  1SD7 A;  1U6G A;  4IPA A;  2QUF A;  5K5R A;  1MGT A;  2P5V A;  3M7G A;  2VBY A;  5D4R A;  5HLG A;  2QYO A;  4ETS A;  4P96 A;  2RDP A;  1B59 A;  3COA C;  2CWE A;  4N0B A;  1E17 A;  5FFZ A;  5J8F A;  2DT5 A;  4BNC A;  2ISY A;  3TO9 A;  4D0P A;  1FP2 A;  1SMT A;  1LNW A;  4XRF A;  1BC8 C;  1MJ9 A;  2HYF A;  1I6X A;  4U0V A;  5AIQ A;  2LDU A;  3KP2 A;  4O6J A;  1Z1D A;  3SZP A;  4UV9 A;  2V9V A;  4BH9 A;  3GZ6 A;  2EFQ A;  1T38 A;  3V8K A;  3KLO A;  5JFR A;  4L9N A;  2R7F A;  2H09 A;  5ICE A;  1J0R A;  1KU2 A;  3TO6 A;  2V1X A;  3HTU A;  3WTS C;  1S29 A;  1U78 A;  5E1X A;  1IXC A;  5D5X B;  3EQL F;  3ZMT A;  2PJP A;  2F5D A;  4KMF A;  2FEZ A;  3FM3 A;  2QZ8 A;  5H6Q A;  2A61 A;  2HZT A;  5KVR A;  1F4K A;  1O3T A;  3DV8 A;  2MH9 A;  4YII A;  4Q48 A;  1K78 B;  3S2W A;  2XGX A;  2VBZ A;  2XUB A;  4RAZ A;  5DCM B;  4YFK F;  4I2O A;  3V8L A;  1Z6R A;  2W85 A;  3IHU A;  1FSE A;  5JI6 A;  4A0Y A;  4AVP A;  1ZAR A;  4UVB A;  2CFX A;  3KP4 A;  1MDM B;  4N9I A;  1FBU A;  1FWZ A;  3DPT A;  5BPI A;  3LWF A;  1EV7 A;  4HQE A;  2UWM A;  4S05 A;  2LF7 A;  5CVJ A;  2XKP A;  1A04 A;  2CO5 A;  1B4A A;  5H6R A;  4B09 A;  3EYY A;  4I0B A;  4AWX B;  4Y13 A;  4G7H F;  4KNY A;  2ZO4 A;  2QEN A;  3TOB A;  5AON A;  4CDG A;  3RKY A;  5ICC A;  2A6E F;  4ASN A;  3W6J B;  1D8K A;  2LF8 A;  3RIR A;  3IC7 A;  2XAF A;  2B0L A;  3CUQ A;  2CGP A;  4U7D A;  3RKW A;  1FYM A;  1KU9 A;  1MD0 A;  2DO7 A;  2L3D A;  3WTY C;  2CSO A;  1ZLJ A;  3ZQ7 A;  2XAQ A;  4JK1 X;  3CDH A;  1P92 A;  5L3F A;  3SHF A;  4XSX F;  5HDK A;  3IWF A;  4GYI A;  2R7D A;  4Y15 A;  4FX0 A;  5HVQ C;  1XDS A;  3FF5 A;  4ESF A;  3BJ6 A;  1QGP A;  3BDD A;  4XLN F;  4L9T A;  1WQ2 A;  4L9V A;  2Q0O A;  2P5L C;  4N9H A;  3LAJ A;  1F5T A;  4OIN F;  1HW5 A;  2F5F A;  3WTU C;  1B9N A;  3HOS A;  1Z91 A;  2DAO A;  2A68 F;  3KE2 A;  4EJV A;  3IL2 A;  4HX4 A;  2EFW A;  1YW9 A;  3RJP A;  5JHU A;  4MNU A;  3BPV A;  1XGM A;  4TV7 A;  5BQT A;  3I59 A;  2L4M A;  1RUN A;  1FC3 A;  4PDK A;  5CVV A;  2K86 A;  1ZRC A;  2QBY A;  2F5C A;  3L9F A;  3Q9S A;  4RGS A;  1G3T A;  1MZB A;  4OOI A;  2H27 A;  3O3K A;  1UB9 A;  4KT5 C;  1KU3 A;  4M9Z A;  4BAY A;  1GXP A;  1Z7U A;  5ILU A;  1SFU A;  4ZZL A;  5CYV A;  2GA1 A;  1T2K A;  1OYW A;  1CF7 A;  3WGH A;  1P2F A;  1R58 A;  3C18 A;  1TW3 A;  4FT8 A;  2QLZ A;  3HOT A;  4I0A A;  4L9J A;  2H6B A;  1W7P A;  1YO5 C;  2ZNZ A;  2R3S A;  4L5I A;  1YW8 A;  4KN7 X;  2STT A;  1KGS A;  3FM5 A;  4PCQ A;  4KYW A;  1REP C;  5L3G A;  5HLH A;  1X3U A;  1FBQ A;  3F8F A;  1LQ1 A;  1V3F A;  1B1B A;  4ENN A;  3SFZ A;  1LEA A;  4AIH A;  1Q1H A;  1NHA A;  1IN8 A;  1QNT A;  2IT0 A;  1TBX A;  4KIB A;  2ACJ A;  2V79 A;  3QPT A;  2P6S A;  3WTZ A;  1MKM A;  3K69 A;  2XRN A;  2W24 A;  1G3S A;  5LBQ A;  4M9S A;  5ED4 A;  5D4S A;  2FRH A;  1XDU A;  4PZJ A;  3I53 A;  4IJA A;  2HTJ A;  1JE8 A;  5D5U B;  1BOA A;  1TNS A;  1RI7 A;  3CO6 C;  3CUQ C;  3DXJ F;  4HX8 A;  4HX7 A;  2UXX A;  1R23 A;  3OOP A;  4ZYE A;  1OKR A;  2FBK A;  4LJZ F;  1U5T B;  4EMS A;  4U0W A;  1T98 A;  4LLL A;  1HBX G;  3F21 A;  4HOB A;  2NAZ A;  5KK1 A;  3JTH A;  3R0A A;  2MLK A;  4XBF A;  2QQA A;  2VBX A;  2GAU A;  1DUX C;  1WKM A;  3U9G A;  4YG2 F;  2YX7 A;  1W5T A;  4CHU A;  2QVO A;  4G6Q A;  2RNJ A;  3TOA A;  4ZYG A;  4A12 A;  3MWM A;  2VT2 A;  4EM0 B;  3JTG A;  3GLX A;  3FXQ A;  2E7X A;  4WX9 A;  2EK5 A;  1TW2 A;  4CIC A;  2DFI A;  1I1S A;  1G4D A;  3RPQ A;  4I01 A;  2BV6 A;  3QP5 A;  4LB6 B;  3B73 A;  4ZZD A;  1JHH A;  4KDP A;  5FLX K;  4LGW A;  4FX4 A;  4EJW A;  4UXN A;  3LQQ A;  1P4X A;  1P6R A;  2DU9 A;  2PMU A;  3HRU A;  1BJA A;  4GGG A;  4QWQ A;  2DQR A;  5E1W A;  3TGN A;  2DBB A;  2KIU A;  3GEZ A;  4BHC A;  1ULY A;  5FLX Z;  3WU0 A;  3G3Z A;  4AIK A;  4BXU A;  1HST A;  3F8M A;  3WE2 A;  3WOD F;  3WTV C;  2JZY A;  4EGY A;  3WG9 A;  5LEK A;  4NHJ A;  4ESJ A;  1G3Y A;  3T5X A;  1LVA A;  1ON1 A;  4IF4 A;  1T6S A;  3O2P E;  3FWE A;  1FBS A;  4CXF A;  3BP8 A;  3P9K A;  3W6K B;  2KJC A;  3J80 K;  4G6D A;  2O61 A;  2NNN A;  5K1Y A;  3LQR A;  1CGP A;  2KIF A;  3KZY A;  1K78 A;  2JPC A;  3REO A;  3V4G A;  4MTD A;  1HW2 A;  2NS0 A;  3Q5F A;  4ENM A;  3E6M A;  3J80 Z;  4A2U A;  5DCM A;  3IRQ A;  1S8N A;  1J7K A;  2VOO A;  3GFL A;  2Y48 A;  2AS5 F;  4UUV A;  2KJB A;  1IXR C;  4MQV A;  1IN6 A;  2XHK A;  2Q8K A;  4BYY A;  1ZGA A;  2ESN A;  1MDM A;  4IRH A;  1STZ A;  4I02 A;  1XGN A;  4UHT A;  4WK8 F;  5D6E A;  3L2C A;  3BPX A;  2NYX A;  4KA4 A;  2IW5 A;  4P9U A;  2LKP A;  1S7A A;  3R0J A;  1QZZ A;  1YLF A;  4YFX F;  2BE5 F;  3F22 A;  2DW4 A;  5FB2 A;  3TDU C;  5ICG A;  2J5O A;  3M8E A;  2O8X A;  2X0L A;  3FXU A;  4WXD A;  3MEX A;  4Z2Y A;  1LDK B;  3V7C A;  2P7V B;  3SQN A;  1SAX A;  2EJR A;  2IP2 A;  1Z6T A;  3FXR A;  2HTS A;  2PMH A;  4LK0 F;  3I64 A;  3N97 A;  4EJT A;  1BM9 A;  4BQA A;  4GO1 A;  2ADU A;  4B8X A;  2HWV A;  1BIB A;  3HTS B;  4ON0 A;  1DPR A;  3FMR A;  5L3C A;  3I58 A;  2HDC A;  2XAS A;  4ZYH A;  2OQR A;  1R5G A;  2DPU A;  2JRT A;  2QM3 A;  1YG2 A;  3ELK A;  5DCF A;  2W84 A;  3E6C C;  1R1T A;  4DQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...