2PG4A

Crystal structure of a putative dna binding protein (ape_0880a) from aeropyrum pernix k1 at 2.21 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
92
structure length
92
Chain Sequence
MDDETLRLQFGHLIRILPTLLEFEKKGYEPSLAEIVKASGVSEKTFFMGLKDRLIRAGLVKEETLSYRVKTLKLTEKGRRLAECLEKCRDVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Uncharacterized protein
publication title Crystal structure of uncharacterized protein (NP_147569.1) from Aeropyrum pernix at 2.21 A resolution
rcsb
source organism Aeropyrum pernix
total genus 31
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2pg4A00
3HOTA 2LKPA 5F1RA 2VE9A 4HX7A 1ZAOA 4RB1A 3R60A 5FO5A 4QWQA 2DTRA 2Z99A 2H6CA 1J2XA 4JBAA 3MZHA 4I09A 3JTGA 1K6OA 1BI0A 3IKVA 4BHPA 3I5UA 1YW8A 4OU0A 3V4GA 3F8FA 1IAWA 2D45A 2W84A 5HVQC 3F21A 2MA3A 4ZYEA 2G7UA 5L3DA 5ERIA 4Q48A 1GXQA 2HGCA 3GFMA 1WSUA 3J80Z 4XLNF 4IRIA 5H20A 4WXHA 1G3WA 2D1HA 2K86A 2GA1A 2P6TA 1IXRC 3IKTA 3MEXA 3J81Z 5CVRA 4IF4A 4P9FA 3Q5FA 4HF0A 2Q2EA 4JQFA 1AWCA 4M9XA 2DO7A 5JFRA 1S29A 5AIQA 1FC3A 5LBQA 2Z3YA 1R7JA 4EGZA 2UZKA 2HFHA 1ZLKA 3M9AA 4HX4A 4HDUA 3QRFF 1BI1A 3LFKA 2HR3A 3R6SA 4EMSA 1B4AA 1TQIA 4OIOF 1TLHB 4RS8A 3GZ5A 2A07F 5LHHA 2XAFA 4WXCA 2IP2A 3GF2A 2VBZA 4HOBA 1RI7A 4LJZF 2VC1A 3KP2A 5HDNA 2B0LA 2IJLA 1O7FA 3RI4A 1R23A 2CQKA 3ZMVA 3HUGA 5FFZA 4HDVA 4ON0A 2ESHA 3RPUA 3T5XA 3RKWA 1R00A 1AOYA 5IT3A 2P8TA 1TQMA 1ULYA 4LMYA 2VN2A 1CF7A 3T1BA 3I54A 5D6EA 1FSHA 4YIFA 5K5OA 2IA2A 2VC0A 5BPIA 3JW4A 5E17F 2OU2A 4I02A 3RYPA 2LDUA 2H27A 1YLFA 2HKXA 3HRUA 4ZYHA 2ZFWA 2YPRA 3B73A 1ZLJA 1XSVA 2FRHA 1TW3A 2IW5A 4XSXF 5J6XA 4ASNA 5CVVA 4ZH4F 3RPQA 1ON2A 3LQRA 1FYLA 1O7LA 3RDIA 2CWEA 2M1BA 2HQNA 2W24A 4KMFA 5A2QZ 5LRSA 2VBWA 3WGIA 3DXJF 5ED4A 3P9KA 2XV4S 4Q47A 1JGSA 1IZ1A 2P7VB 3F8CA 4R1HA 5CYVA 3FMQA 3W6KB 5D5XB 2NS0A 4G6QA 4HF1A 2GZWA 3L00A 3O2PE 3F72A 4XSZF 5DEQA 2EV6A 2KIFA 3ROUA 3ZP5A 4HW0A 3GEZA 3ECHA 4Q4ZF 1QPMA 3CDHA 4IVNA 1J59A 2STWA 2CO5A 4A0YA 4OIPF 4LG0B 2W57A 3BDDA 3EETA 1FP1D 4HZFA 5DV5A 4WK8F 3WU1B 1PDNC 2W25A 2X4HA 2QENA 1P2FA 3KP6A 3O3KA 5DDGA 1U5TA 2RKHA 3FHZA 3FM5A 1QGPA 2RNJA 4M6XA 3KEQA 2P6SA 5L3CA 1FLIA 3EQLF 3H3ZA 4ESJA 1MZBA 2EFNA 1C0WA 3FMRA 4RGSA 3TKYA 2A69F 1ZG3A 3TDZC 1IN4A 3K1MA 1J75A 4HF2A 3LA3A 4I2OA 2F5EA 2QBYB 3HTSB 1EV7A 1EH8A 2NNNA 3ELKA 1W7PB 3V7CA 1OKRA 1S7AA 3FXQA 1YQAA 1H0MA 2L4MA 4A0ZA 3REOA 1Z9CA 3SHFA 3W6JB 4A5NA 4MEXF 2XAGA 2HZTA 4GO1A 2O8XA 2K7LA 1SD6A 4PDKA 2ZXJA 4L9NA 4ENNA 3E5XA 1SD5A 2FEZA 3ERED 4YG2F 1K78A 1JXSA 4KMUX 3CUQC 3KCCA 5FB2A 4UVAA 3R4KA 3J7AO 4KUMA 1XSDA 3LA2A 1DPRA 5HOOA 2P5KA 5EEHA 1R5HA 2XAHA 4HV6A 4G7OF 5IT9Z 3GLXA 1RZ4A 4RB3C 1PP8F 2Z5UA 4OINF 4MTDA 3JAMZ 1IRFA 3GO5A 4OIRF 4O3MA 3ECOA 4OMZA 2IA1A 3VOEA 5LEJA 2COMA 2TDXA 1T98A 2J5OA 2MD5A 4U0VA 3I71A 4EM2A 4IHTA 1BIBA 4CZZA 1R1TA 1MGTA 4CXFA 4UUVA 5FLXK 3DEUA 2D1VA 5HLHA 3F6VA 4GYGA 4EJOA 2DPDA 3E5UA 3KEOA 1G4DA 4UV8A 4B8XA 3FWEA 1FYMA 4LLGF 4CHUA 3EDPA 3P9IA 1HBXG 5H6QA 2OQRA 4RB0A 5LGTA 4AIHA 1RUNA 2EK5A 3BP8A 3T8TA 1DP7P 4JK1X 2A61A 1ODDA 3CUQA 1J5YA 3WGHA 1FT9A 4TV7A 2CG4A 4M73A 3H3UA 4MQ9F 3VFZA 3RKXA 3GW2A 4KA4A 3GX4X 2QYOA 1O3TA 3U2RA 5LLQA 1HKSA 4D0PA 3IHUA 4MQVA 1SMYF 5BMZA 2EJRA 2AS5F 2ZNYA 1SFXA 1ZRFA 1I5ZA 2XKPA 1D5VA 4FT8A 1P6RA 4LFUA 3F22A 4A5MA 1SAXA 4OIQF 3D5LA 3BPVA 4ZYGA 3I53A 1ZG1A 4E70A 3GFJA 1IF1A 1H9TA 4O5VA 2K4JA 2UXNA 4RGXA 2WWYA 2M87A 4XBFA 3L09A 3DKWA 1REPC 3ML6A 3MQ0A 3TQNA 3FX3A 2Z33A 1Q1HA 4U7DA 2EV5A 2R7DA 4GCVA 3QOPA 3EYIA 3CO7C 2K02A 5CVIA 4G7HF 1QO0D 1LB2A 4KDPA 2PQ8A 5DYMA 1SFUA 2FE3A 2LNBA 1I6XA 1Z6TA 2MBFA 4ENJA 1HQCA 3V8KA 4NQWA 2L4AA 2ZJ2A 5H6RA 2GXGA 3DQVC 1LDDA 1X3UA 1O57A 2UXXA 2AXLA 2MLKA 2YSRA 2ISZA 1MD0A 5L3BA 5D8KB 3HOSA 4M72A 2F5FA 1G3SA 3WODF 3I59A 1TBXA 1OYIA 4F7ZA 3MWMA 3ZMSA 3E6BA 2STTA 4KIGA 5AIPA 4DNCA 1UFMA 1ON1A 3ZMZA 4N9IA 1ZRDA 2DAOA 3WTVC 4R79A 2EFOA 4XRFA 2YR2A 4BYYA 4HLXA 5CVUA 4WF2A 2Q8KA 2ZMEA 2EFPA 3KLNA 1IW7F 2PG4A 3U9GA 1IRGA 3KETA 2ELHA 5BPDA 2F5DA 4FHTA 1DPUA 1LEBA 2QM3A 2D2WA 2L02A 2V1XA 2E1CA 1L0OC 4YFNF 2V79A 1E17A 4P55A 5E18F 2DW4A 4HX8A 4DQ2A 1BIAA 3M8EA 2M5WA 1T2KA 3QU6A 2BEOA 2ADUA 1T38A 5ILSA 5L3GA 5LRRA 3KP3A 5FD5A 1XSXA 5DCMA 1A04A 1U6GA 2PEXA 4XLPF 1UHMA 5KVRA 1FBQA 2JPCA 2BBYA 4L18B 1ZN2A 2V6CA 1U5TC 3SZPA 4LK1F 2H6BA 2PBIA 3WTXC 1ZARA 2IVMA 1BI2A 4CDGA 3KP4A 1KU7A 2VT3A 2F2EA 1QZYA 3QP5A 3K1PA 2DT5A 2HYFA 1Z91A 3Q9VA 3F6OA 4YFKF 4UNOA 1WKMA 3DPTA 2XUBA 3E3VA 4Z2YA 3R0AA 2ZBKA 2NAZA 1PP7U 1UHWA 2XHKA 2RN7A 5CLSA 1W5SA 5AONA 5D8LB 4L0ZB 3F3XA 2K27A 4BNCA 3L9FA 5EEGA 3PFIA 5D5VB 2QZ8A 3NEUA 2JZYA 2QQAA 3PQJA 1Z05A 4A12A 3JTHA 4CO8A 4H0EA 3LSTA 2Z9OA 2DBBA 3I59B 4CGZA 2LSOA 4S04A 1OPCA 3CUOA 3QPTA 3KZZA 4HV5A 2RC4A 4U7BA 1Y0UA 1JHFA 3E5QA 3GXOA 3N97A 4IJAA 3L7WA 2GXBA 4EJUA 1S7OA 1FSEA 1YFHA 3CO6C 5BS6A 1SD4A 4MTEA 1DUXC 2Q0OA 1XDSA 2RV8A 3BWGA 2J5PA 2EA4A 2M8EA 3IL2A 1HSJA 1RUOA 2MLGA 1SFEA 2OD5A 4L0YB 1S3JA 1IN5A 1MDMA 3DV8A 3V7RA 3BJ6A 3O6BB 4WXDA 1S8NA 3E6CC 2ZNZA 1D8KA 3BPXA 1YIOA 3C1DA 1R1VA 3JAMK 1L3LA 4ZZLA 3L2CA 2BV6A 2XAJA 2DQRA 4LD5A 1CF7B 2HQRA 3V7SA 3ZMDA 1E2XA 3LAPA 2ESNA 3BROA 3TO6A 2VOPA 1SMTA 2JRTA 2E7XA 4RAYA 1W4MA 5LHIA 1QNTA 1W7PD 3K9TA 2M45A 5D5WB 1HKQA 5TJJA 3ABTA 3G3ZA 4ESFA 2WV0A 5HS7A 1LEAA 2ACJA 5ICEA 3WE3A 3RTRA 1R36A 2FOKA 4EM1A 2L01A 2KIMA 1HW1A 4I98B 3MAJA 1U3EM 4Y13A 2YX4A 5D6FA 4Y15A 4Q5SF 1XN7A 1TTYA 4G94A 1DDNA 4LB6B 1XGSA 5DUKA 5ICCA 3FM3A 3JSPA 3DFGA 2DI3A 4EVIA 3TOBA 1XCVA 1YO5C 1QZZA 3KP7A 5JHUA 4CICA 2EFWA 1P4XA 2A68F 3QAHA 1O3QA 4EJVA 2L54A 4B09A 4M9ZA 1LDKB 2VODA 3FF5A 2GWRA 2XROA 2GA2A 1USTA 4LGWA 3SXYA 2XRNA 1BOAA 3GUDA 3MCZA 2LF7A 3BY6A 1B9MA 5J8CA 5K1YA 3ULQB 1R22A 2OQGA 2CFXA 2KRFA 4U88A 4YFXF 4M71A 3HRSA 2MH9A 1YTYA 2RVCA 4ENKA 4M9SA 6PAXA 3EUHA 1Z1DA 2Y0MA 5FD6A 4PGGA 1J9IA 2QQ9A 3ZN0A 1S6LA 3C7JA 1KU3A 2GQQA 4G8XA 5ICGA 3SQNA 4NB5A 5L3FA 4IXAA 4L9TA 1U5TB 1WWXA 3K69A 2XGXA 3VEPA 2FBKA 4UHTA 1BM9A 4A6DA 1NHAA 2V1UA 2QUFA 2P4WA 2DLLA 3HIFA 1FP2A 1YYVA 4P9UA 1SD7A 1Z6RA 3P9CA 1KQ9A 3K0LA 1BN5A 4GYIA 4O6JA 2P7CB 3FXUA 4BQAA 5HS9A 4LB5A 1PUEE 2NRAC 1ZGAA 1D8JA 3GYHX 2KIUA 1F9NA 2Y75A 3KE2A 1B6AA 2EFQA 1HSTA 1FWZA 1XMAA 1G3TA 3KLOA 2DPUA 4EJTA 3QPHA 1MJ9A 3FZVA 2IRFG 4KN4X 2XIGA 4BHBA 3S2WA 1VTNC 1OMIA 1GHCA 3J80K 2M30A 1OYYA 2PN6A 1YS6A 3LWFA 2FMLA 1K78B 5FLXZ 5E8IA 3HRTA 4L9VA 2FSWA 2XASA 2QVOA 5ILVA 1P4AA 1XB4A 4R8HA 2ETHA 5F6FA 3RKYA 3TGNA 3J81K 1LJ9A 1GVJA 4NHJA 1FYKA 2RGVA 3HSEA 2BE5F 1B9NA 2P5LC 2CSOA 4LLNA 4BHCA 2FMYA 3AAFA 2PMHA 3CTAA 2QQBA 1HXDA 3V8JA 1LVAA 2K4BA 3WU0A 5HDGA 2CW0F 1XD7A 4UVCA 4FX4A 4IPAA 4EV0A 2VONA 2FNPA 4G7ZF 3V8LA 2BYVE 4HAMA 3TOAA 3QP6A 4RGUA 1USSA 1O3RA 1RIOH 3LAJA 3LQQA 4AIJA 3OOPA 2DK8A 4U0YA 1MJBA 5D4RA 3IC7A 3I0TA 5CJ9A 1FNNA 5D4SA 4G9YA 2PLYA 2HEOA 1F5TA 3I64A 5JI6A 5E20A 1FBSA 3GFLA 3R61A 1KA8A 3P7NA 3GZ6A 2XVCA 1YG2A 2H94A 2CGPA 1WI9A 1JE8A 4KNYA 3BOQA 2IA0A 2JPBA 4S05A 4BH9A 5K5QA 1QQIA 1I1SA 3SFZA 4KYWA 2R3SA 2KKOA 2HOEA 3CUQB 3GFIA 3ZMTA 1LDJA 2X0LA 1K7AA 4LG0A 2CYYA 1F4KA 3IWZA 1B1BA 1TNSA 4M74A 2O03A 3F8NA 4GGGA 1BJAA 2MC3A 2IT0A 2HKOA 3CJNA 5A2QK 3ABUA 4AVPA 1WRJA 3CLOA 4HBLA 3F8BA 1KGSA 5FGMA 5HDKA 1KYWA 4KN7X 1ZHFA 3JSOA 1ZG5A 5KK1A 1YS7A 2XAQA 5LEKA 2XKOA 4PCQA 5HS8A 1XCBA 2A5YB 4M6YA 1JHHA 2ISYA 3ISPA 1HW5A 5FFXA 4HQEA 4HA8A 4OOIA 4N0BA 3E6MA 4FX0A 2QBYA 1KU2A 3DF8A 1H9GA 1J7KA 2BGCA 1IUYA 4EQQA 2O6GE 3RJPA 3U1DA 3FMSA 4BAYA 1W7PA 4MGRA 1F1ZA 1WQ2A 2EV0A 2FNAA 4RB2C 1TQPA 5BOXA 3VODA 3R0JA 5JVTA 3WTSC 2A3SA 1T6SA 3I58A 1BC7C 4EM0B 4Y17A 5J8FA 2E1NA 3ZPLA 2FQ3A 1ZGJA 1MJAA 2OA4A 3KP5A 2HTSA 5HLGA 1R1UA 3KFWX 1UCRA 1KU9A 1KQ8A 2YU3A 3WTUC 5DCFA 3WTTC 3MFKA 2DU9A 1V4RA 2A6HF 3E97A 2G7HA 3I4PA 4L9JA 3HTUA 2P5VA 3C3WA 4A2UA 1EH7A 3RIRA 4MNUA 5D5UB 4LLLA 1FY7A 3HYIA 4I0AA 1FPQA 2FBIA 1TNTA 3WTZA 2VBYA 1R58A 2PFBA 4PZJA 1ZYRF 4L5JA 3GWZA 3HSFA 4GXOA 1STZA 4UV9A 3C18A 1IN6A 2DFIA 2FXAA 1XMKA 1IN7A 3ZMUA 1QBJA 2FBHA 4MHGA 2C6YA 1P92A 2ZMEB 3MZYA 4UVBA 1XDUA 5JR3A 3BJAA 3F23A 1ZH5A 2HDCA 5TRDA 4L5IA 5L3EA 4CYDA 3WE2A 5IT9K 1FX7A 1G3YA 3COAC 2V9VA 4RGRA 1W5TA 5DD8A 3F8MA 4EGYA 2O0YA 1KYZA 2A6EF 2HS5A 3IRQA 5LGUA 1MKMA 5DCMB 2RQPA 1OYWA 4YIIA 3GVAA 5K5RA 1U78A 3HHGA 1ZREA 1KQ0A 1BBYA 3HHHA 5ICFA 3WTWC 4P96A 2NNYA 1IXCA 2VXZA 1LQ1A 1FZPB 2O3FA 2OZUA 4N9HA 4KIFA 4ZZDA 1GXPA 3K2ZA 2WTEA 2DK5A 5F64A 4A6EA 4HYEA 1IXSB 2QWWA 4RAZA 5LGNA 1CGPA 3H92A 1HW2A 4BXUA 3HSRA 3SZTA 3TO7A 4KT5C 1XGNA 2RDPA 4G6DA 2F5CA 2NYXA 4LK0F 2PI0A 3M1EA 1BC8C 1K79A 2EA2A 2E7WA 1ONVA 1FOKA 4HLYA 2FU4A 1T0FA 3DPLC 3K1NA 4U0WA 4OMYA 2UWMA 4AIKA 1YW9A 1HKTA 4WWCA 2KJBA 3LA7A 3E6DA 2JT1A 5E1WA 4WCGA 2HWVA 4ENMA 4K2EA 4AD9A 1T39A 3NQOA 2PMUA 3PQKA 3TO9A 3OV8A 1Z7UA 3WTYC 2FA5A 3WGGA 2YX7A 4AWXB 2G9WA 3HRMA 2KJCA 4IRHA 2QLZA 3BJOA 4MEYF 4KICA 2EWNA 1ZRCA 3FXRA 1BI3A 2JSCA 5LHGA 3EYYA 1V3FA 1OR7A 1B59A 2WC2A 5ILUA 4P5OA 3D0SA 1TW2A 4I0BA 2ZKZA 1XGOA 2IPQX 1FBUA 2OAZA 3NRVA 3QU3A 2L3DA 5E1ZB 3IWFA 2W85A 4EJWA 5DD4A 5E8GA 3BZ6A 2H09A 2VT2A 2DQLA 1MDMB 3VB2A 2GAUA 2O61A 1P4WA 1EH6A 2OZ6A 3KZYA 4IHSA 2VOOA 4KFCA 3M7GA 3IRRA 1O3SA 4PGHA 3WG9A 3N4MA 2R7FA 3ZQ7A 4A0XA 3TDUC 1G6NA 5BQTA 3RYRA 4I01A 4UXNA 2HTJA 1D3YA 4ESBA 2VBXA 3B02A 3Q9SA 3G73A 4WX9A 1U2WA 1LNWA 1U8RA 3ZN1A 2PJPA 1J0RA 5E1XA 1I1GA 2LF8A 4QLCU 1UB9A 2GIVA 4HQMA 1I27A 2ZCWA 5DUIA 2VE8A 2V1DA 2Y48A 2JTVA 2ZO4A 4KIBA 3T0YA 5HLIA 1IN8A 2MH2A 1RNLA 4ZYDA 1XGMA 2FF4A 4I7HA 2OBPA 3M8FA 1YW7A 1R5GA 2EB7A 4ETSA 5CVJA 2HYGD 4IRGA 3T8RA 3DP7A
chains in the Genus database with same CATH superfamily
3B6CA 3HOTA 5E3NA 1JKRC 3GTMJ 2LKPA 2ZXIA 4Y52J 5F1RA 2VE9A 4HX7A 2PJRA 1ZAOA 4RB1A 3R60A 5FO5A 4QWQA 3ZQFA 2DTRA 2Z99A 2H6CA 1J2XA 1WJBA 4JBAA 3MZHA 2MABA 4I09A 1WZ2A 1ZQ3P 2X1DA 2XB5A 3SJMA 3JTGA 3OMYA 3BLYA 1BI0A 3IKVA 1K6OA 2WAFA 4C3JJ 3CCSI 4BHPA 5JVGF 3D5SC 1DU6A 4PJ0C 1OJLA 1OCOH 2FUG2 2ID3A 3I5UA 1VQ4I 1YW8A 3MVPA 3IUOA 4OU0A 3V4GA 3VYRB 1ZTRA 3F8FA 1IAWA 3JRFA 2OUMA 3OIQA 4PFOA 1FMWA 2D45A 2OV7A 2Z2SB 2NS7A 2W84A 1JKQC 5HVQC 3HKZA 3F21A 4Z6YA 2MA3A 3I55I 4ZYEA 2G7UA 2HPIA 3OL4A 5L3DA 5ERIA 4Q48A 1GXQA 2HGCA 4CSWA 5BNGA 3GFMA 2RNGA 1WH7A 2HQ5A 1WSUA 3J80Z 1JTYA 1HF0A 4XLNF 4IRIA 1RRJA 3OYIA 3K2AA 2JSPA 3CF2A 3K10A 1VQ5I 5H20A 4A3KJ 4ANJA 4WXHA 1G3WA 5K7HA 3JRHA 2D1HA 3K4JA 5F27A 2K86A 4E7ZA 2GA1A 2P6TA 1IXRC 3UR3C 2EIMH 2ZXWH 3MEXA 3IKTA 1YRNA 3ZQHA 3J81Z 3H9QA 4IF4A 4P9FA 5CVRA 3Q5FA 4HF0A 2PMZN 2Q2EA 4PUSA 4JQFA 1AWCA 1GVDA 4IZZA 2B63J 2IGNA 2DO7A 4M9XA 4XMYA 5JFRA 1S29A 5AIQA 4BJ6C 1FC3A 5LBQA 2Z3YA 4DYQA 1R7JA 1LPQA 4EGZA 4IHWA 2UZKA 2HFHA 3KIOA 3M9AA 1ZLKA 3LOCA 4HX4A 5EG0B 4D7MA 4HDUA 3QRFF 1BI1A 2M0MA 2HR3A 1D0XA 2L7FP 3LFKA 1D1CA 4M3GA 3R6SA 2DCEA 2R7ZJ 2R7TA 4EMSA 1B4AA 3JRGA 1B8IB 3E7LA 4I99C 4V2GA 1MBFA 4FTHA 1TQIA 3HGYA 2DOFA 4OIOF 1TLHB 4RS8A 3GZ5A 2A07F 2OPTA 5LHHA 4A3BJ 2XAFA 4WXCA 2IP2A 3DTEA 3GF2A 2VBZA 1ETVA 4HOBA 1RI7A 2ICWG 3OR1C 5KHDA 3K6GA 4LJZF 3PUFA 2MC4A 2VC1A 3HC7A 1BOBA 2R7UA 4BE2A 4IOCF 3KP2A 3ZQIA 5HDNA 1YIJI 1EA3A 2B0LA 4XLHA 2IJLA 2I8DA 4XKCA 3L2UA 1VQOI 1O7FA 3RI4A 1R23A 2CQKA 3ZMVA 3HUGA 1X3WB 5M5WJ 1IJWC 5FFZA 3WU2C 4HDVA 3CCEI 4ON0A 4D1QA 1G2HA 2VKHA 2ESHA 3WHCA 3RPUA 2FX0A 3T5XA 3RKWA 5B1BH 1R00A 1YITI 4E4HA 2LY2A 3A0BC 2AHQA 1AOYA 2L2OA 5IT3A 2P8TA 3J7YJ 3ZQCA 1TQMA 3OWTA 1ULYA 1X2MA 4LMYA 2VN2A 1CF7A 3T1BA 2HOTA 2R7VA 1SANA 3I54A 2WADA 5D6EA 1FSHA 2EZIA 4YIFA 5K5OA 2ME6A 2IA2A 2VC0A 5BPIA 3O8GA 3JW4A 5E17F 1X4PA 2OU2A 4I02A 3RYPA 3DLLF 2LDUA 1JTXA 3QWLA 2H27A 4IQJA 2HU9A 1YLFA 3GTGJ 2HKXA 3HRUA 4ZYHA 1G59A 2DTZA 2MSYA 2YPRA 2ZFWA 3B73A 1ZLJA 2VL8A 4DZPA 1XSVA 2FRHA 1TW3A 2L7KA 2R7RA 2IW5A 4XSXF 1MH3A 2E71A 2K85A 4AYBA 5J6XA 1MIJA 3HOYJ 1DP3A 4ASNA 5CVVA 3S1QJ 4ZH4F 1ZK8A 3RPQA 3QQAA 2WB1N 1ON2A 3LQRA 1QVUA 4BQOA 2LRDA 1W36D 3DU5A 1FYLA 1O7LA 3RDIA 2CWEA 2M1BA 3SFIA 2HQNA 2W24A 4KMFA 3G71I 4XK4A 1X58A 2IGMA 5A2QZ 5LRSA 2VBWA 3AKZA 1WJEA 3HOWJ 9ANTA 3WGIA 3DXJF 5ED4A 1R4NB 3P9KA 2GBYA 2XV4S 2XPVA 4G6TB 4Q47A 3VWBA 4M3BA 2BZTA 1JGSA 4CCKA 1IZ1A 2P7VB 4KISA 3F8CA 4R1HA 5CYVA 4DYRA 5J4YA 1FEXA 3VYTB 1PUFA 3FMQA 3W6KB 5D5XB 4B43A 3TBIA 5JHFA 3DEEA 1K61A 2DXIA 2CS3A 2NS0A 4G6QA 4HF1A 1GUUA 4MFDA 2GZWA 3L00A 2EILH 2KPMA 2E34A 3MKWB 3O2PE 3F72A 1A35A 3FXLA 4XSZF 3CCRI 4AM3A 1MBEA 5DEQA 1WJCA 1WH5A 2EV6A 2KIFA 4N4OB 4QPQA 1XMXA 2M4GA 3ROUA 3S1NJ 3ZP5A 4HW0A 4UY8I 2K9MA 1I39A 1H88C 2JMWA 3GEZA 2QA4I 3ECHA 1X1CA 4RA2A 3H1CA 4Q4ZF 4BEHB 2BY2A 2IBDA 1QPMA 2DT7B 1I3QJ 2OCEA 1SC7A 3CDHA 2E2IJ 4IVNA 3CMYA 1J59A 2STWA 2CO5A 4A0YA 4OIPF 4LG0B 2W57A 3BTJA 3BDDA 3EETA 1V54H 1FP1D 1D1BA 4HZFA 5DV5A 3ONQA 4WK8F 2V6EA 3WU1B 1PDNC 3GTPJ 1N78A 2W25A 2X4HA 3JCUC 1R6RA 2QENA 2R4GA 5IY5H 1P2FA 3KP6A 3O3KA 4FQGA 5DDGA 4B1RA 3VSKA 1U5TA 2RKHA 1X19A 3BC8A 3F0CA 3OYHA 3FHZA 4GRIA 3FM5A 5M5YJ 1A5JA 1RR8C 4YEJA 3OSGA 1QGPA 1TT5B 2RNJA 4M6XA 3KEQA 2F48A 2CH0A 2P6SA 4XR6A 3RCOA 2BXZA 5L3CA 2CUZA 5IP6A 1FLIA 3EQLF 4II2A 2LKSA 2KP6A 3H3ZA 4ESJA 3J7ZI 1MZBA 2EFNA 1C0WA 3C2HA 3FK6A 3FMRA 1IG7A 4RGSA 3TKYA 2A69F 1ZG3A 3HUGB 5IP9J 2LY1A 3TDZC 3OYGA 1AHDP 1IN4A 3K1MA 1KONA 1J75A 1WJAA 1S7EA 3IH3A 3LA3A 1AKHB 4HF2A 4I2OA 2VJ5A 2F5EA 3K4MA 1DGWY 2QBYB 3BG5A 3HTSB 2VQHA 1EV7A 1EH8A 2NNNA 4UUTA 2F6CA 3ELKA 2KDOA 4F92B 2LYCA 1W7PB 1MNMC 3V7CA 1OKRA 3AG2H 1VQ7I 3CJQB 1S7AA 3FXQA 3PL8A 2EIJH 2NOGA 1YQAA 1H0MA 2L4MA 4A0ZA 3REOA 1Z9CA 3SHFA 3W6JB 4A5NA 4MEXF 2M3AA 2YU9J 2CU7A 1TWFJ 2A6TA 2XAGA 3VSLA 2R5YA 2HZTA 4GO1A 2O8XA 2K7LA 4J00A 1SD6A 4PDKA 2ZXJA 4L9NA 4CH7A 4ENNA 3E5XA 1VFCA 1SD5A 1W5CC 2E1MB 2FEZA 2HOAA 2O5RA 3ERED 2ZJPF 2OC6A 2DMNA 4YG2F 3HB9A 3G4SI 2LVSA 4NC8A 4CYCB 2V4JC 1K78A 1NG6A 4RMNA 2R7SA 2H1KA 1JXSA 4KMUX 2ECCA 3CUQC 2XSJC 3DPUA 4W97A 1JJ6C 2D5VA 3KCCA 3QYFA 2QEXI 5FB2A 4UVAA 3R4KA 3J7AO 3CCYA 4KUMA 1ZR2A 1XSDA 2M2EA 1MMGA 2X9DA 1U8BA 3LA2A 2VIXA 1DPRA 4F55A 1BW5A 2CQXA 2R7XA 5HOOA 2Y31A 2P5KA 5EEHA 4HRIA 5GTIC 4LIVA 1R5HA 2VJ4A 2XAHA 4HV6A 1V55H 4G7OF 3H9JA 4KJZA 5IT9Z 3GLXA 2X51A 1RZ4A 4RB3C 1PP8F 1Y6IA 4RM2A 2WY7Q 4JP0A 4RM3A 2CV1A 2Z5UA 4OINF 5GTHC 4MTDA 2HDWA 3JAMZ 4XQFA 1IRFA 5C4JJ 3GO5A 4OIRF 4O3MA 3ECOA 4OMZA 1F36A 2IA1A 3CJTB 4ITVA 3VOEA 5KCMA 5LEJA 3V42A 5FRMA 2F4IA 3S2HJ 2COMA 3S1RJ 2TDXA 1T98A 4ZYAA 2J5OA 2MD5A 5DTDA 4HPQA 2DMTA 3BZCA 4U0VA 3I71A 1MBHA 4EM2A 4IHTA 1BIBA 1SVLA 4CZZA 4XOPA 1R1TA 1MGTA 4CXFA 4UUVA 1I3AA 5CKTA 5FLXK 1ENHA 3L2QA 2W7NA 1S9HA 1VQMI 1UG2A 2CUEA 3DEUA 2D1VA 4BJ5C 5HLHA 3F6VA 1H8AC 4GYGA 2NOJB 4EJOA 3GLLA 1SFOJ 3OYMA 3OL3A 3QPSA 2DPDA 3E5UA 5EDNA 3KEOA 3ESWB 3NWSA 1G4DA 4UV8A 4B8XA 3FWEA 1FYMA 4LLGF 1Z7LA 4CHUA 3EDPA 2DYRH 5IYCJ 2R0QC 1W36C 3S14J 2Q1ZB 3P9IA 3KYCB 3I3LA 2KFDA 1HBXG 5H6QA 2OQRA 2ME0A 2ZC2A 4RB0A 5LGTA 3FKIJ 2TRTA 1I6HJ 4AIHA 1LKXA 1RUNA 2EK5A 4M3DA 4RAGA 3A03A 5EEAA 3BP8A 1BJZA 1EKEA 3T8TA 1DP7P 4JK1X 2A61A 1ODDA 3CUQA 1R9TJ 3A2KA 1HOMA 2GIZA 3OYEA 1J5YA 3WGHA 1FT9A 4TV7A 5EGOA 3CCLI 1YOVB 2CG4A 1ETWA 3RSNA 4ZDLA 4M73A 5JLWA 1KZHA 3CDIA 4ZC3A 2N8GA 3H3UA 3CMMA 4MQ9F 2DA6A 1Z3XA 2BHZA 3VFZA 3TW6A 3GTLJ 4MFEA 3RKXA 3GW2A 3LSMA 4KA4A 3GX4X 2W00A 2QYOA 1W0UA 1O3TA 3CDLA 3TP3A 3U2RA 4BUPA 5LLQA 3RZOJ 2BVMA 1YJ9I 1HKSA 4D0PA 1S5LC 3IHUA 4MQVA 3JR9A 4V2FA 2I10A 1SMYF 2CW7A 2LKXA 2FD5A 5BMZA 3TMOA 2EJRA 1XG1A 5FKMA 2AS5F 1FIPA 2XPWA 2ZNYA 1SFXA 1ZRFA 1I5ZA 2XKPA 3HDDA 1D5VA 3WHBA 3K4KA 3Q0UA 3ERMA 4PJJA 1P7JA 4H4KC 4FT8A 1P6RA 4LFUA 3F22A 4A5MA 2HYJA 1SAXA 2E2JJ 3CD6I 1BR1A 2A05A 2WAQN 4OIQF 3D5LA 3S3MA 3BPVA 4ZTFA 4ZYGA 1P9QC 3I53A 2R92J 1ZG1A 3LSJA 4E70A 3PNVA 3GFJA 1IF1A 1H9TA 4MIMA 1WHUA 3BR6A 2ZMEC 4O5VA 2K4JA 2R7WA 2UXNA 1LFBA 2BY0A 1Z77A 1MNEA 2WY8Q 1OCTC 4RGXA 2WWYA 2M87A 1SVMA 4XBFA 5GAEJ 3L09A 2LREA 3DKWA 1REPC 3IH4A 2X6WA 1UHSA 5LFAA 3ML6A 1EJ9A 3MQ0A 3CMAI 2JN6A 3TQNA 2JWTA 2XPUA 3FX3A 3FBNB 2Z33A 2EZKA 4BY7J 5IOZA 1GV2A 2NS8A 2HVSA 1UG0A 1ETOA 1Q1HA 4OWRB 1B72A 4U7DA 2EV5A 4E7SA 4YIRX 3FHNA 4OAZA 2R7DA 4GCVA 4CCOA 2DT6A 1LE8B 3PJRA 1HCRA 3BR1A 1ORKA 2HVQA 1OCRH 4X0GA 3QOPA 2K3FA 2OF7A 3EYIA 2DN0A 3CO7C 2GOMA 2K02A 5CVIA 4G7HF 1QO0D 1LB2A 4KDPA 2EZHA 2PQ8A 4QTRA 3RQIA 5DYMA 2W4SA 2V9KA 1SFUA 3A4CA 4JX6A 2DA7A 2FE3A 3K70D 1BA5A 2VKDA 2M0CA 3HXLA 2LNBA 3OYBA 3CCMI 2H8RA 4A3DJ 4OAYA 1I6XA 3LSGA 1Z6TA 5M3FJ 2MBFA 4ENJA 4A3EJ 1HQCA 3V8KA 4NQWA 2Y30A 4A3MJ 1PVEA 2L4AA 1HC8A 3AL0C 2ZJ2A 5H6RA 2GXGA 2KQRA 2FJ1A 3DQVC 1LDDA 2HXOA 1X3UA 1X1AA 1O57A 2UXXA 2YSRA 1BR2A 2AXLA 2MLKA 1S72I 2ISZA 1MD0A 5L3BA 1N75A 5D8KB 3KYLA 3HOSA 3N05A 3H3VK 3HOZJ 4M72A 4PFPA 2F5FA 2VQGA 4F91B 3OYFA 1G3SA 3QYBA 3WODF 4RAFA 3I59A 1TBXA 1T8IA 1OYIA 1U0JA 4F7ZA 3MWMA 3ZMSA 3E6BA 2KDZA 2STTA 3M4OJ 3DTKA 3ZRGA 4KIGA 3JRBA 3CCVI 5AIPA 4DNCA 1UFMA 1PJRA 1ON1A 3ZOBA 4N9IA 3ZMZA 2Y0SN 1ZRDA 2CV2A 4X6AJ 3WG7H 2DAOA 3WTVC 4R79A 3S8PA 4HNVA 2EFOA 3U21A 2X6XA 1XC5A 4XRFA 2YR2A 3I56I 4BYYA 4Y7NJ 3AG4H 4BL0B 3FXOA 3BTLA 3A01A 4HLXA 5CVUA 3PFYA 4WF2A 3CMEI 3RZDJ 2G0EA 2ZMEA 2Q8KA 2EFPA 3KLNA 1IW7F 1LUJB 2PG4A 3U9GA 5M5XJ 2XC7A 1FTTA 3OS2A 1IRGA 3FKJA 3KETA 2ELHA 3M07A 5BPDA 4BU2A 2F5DA 1X1PA 2LR8A 4FHTA 1DPUA 1OLTA 4BDZA 1LEBA 2QM3A 1WJDA 4ZTJA 2D2WA 2L02A 2V1XA 2KLOA 3ABMH 2E1CA 1L0OC 4YFNF 1HDPA 5IYBJ 5GADJ 2IGOA 4GDFA 2V79A 1YE9A 1E17A 2RAEA 4P55A 2DMUA 5E18F 2DW4A 4HX8A 5FKLA 1BIAA 4DQ2A 1D1AA 2NXNB 3M8EA 2MG4A 4XRMA 4G12A 2M5WA 2M9HA 1T2KA 4C2TA 1WJFA 2DA4A 1UZCA 2JVGA 3QU6A 2BEOA 2ADUA 4N4NB 1JJ8C 1T38A 5ILSA 5L3GA 5DM7F 5LRRA 3ASNH 3KP3A 2I5UA 1XSXA 5FD5A 1FOXA 3LL7A 1JGGA 5DCMA 1UAAA 4BQNA 1A04A 1U6GA 1ETKA 1ZGWA 4Y3OA 1VNDA 2PEXA 4XLPF 1UHMA 5KVRA 1FBQA 2JPCA 4XN3A 4QIWN 2BBYA 4L18B 1XTAA 1ZN2A 1Z67A 2V6CA 1U5TC 3SZPA 3C2BA 4LK1F 5J40A 3Q0VA 2H6BA 3H5NA 2PBIA 3OYDA 3WTXC 2PJRB 1RKTA 2QSHX 3BTCA 1ZARA 2IVMA 3E1SA 4BQQA 2Z16A 1BI2A 5FJ8J 1WGXA 5GPAA 4CDGA 3KP4A 3JREA 2L7ZA 1KU7A 2VT3A 2F2EA 1QZYA 4GFBA 3QP5A 3K1PA 1SEUA 2IGKA 1JUMA 2DT5A 2HYFA 1Z91A 3Q9VA 3F6OA 4PK4A 4YFKF 4UNOA 2JA5J 1WKMA 3DPTA 2XUBA 2K40A 1QHGA 3E3VA 2VB6A 4Z2YA 3R0AA 2ZBKA 2NAZA 1PP7U 3UKGA 1UHWA 3CQZJ 2XHKA 2RN7A 3HKZN 5CLSA 1W5SA 4ZJZA 1YJNI 1T56A 4DZJA 5AONA 4IOAF 4E7HA 5D8LB 4L0ZB 3F3XA 5FLMJ 2K27A 4XRSA 4BNCA 3L9FA 5EEGA 4BBRJ 3PFIA 5D5VB 2QZ8A 5GP9A 1X1BA 2L7MP 3NEUA 4BBSJ 2JZYA 1D0ZA 2BY3A 2QQAA 3PQJA 3CCJI 1Z05A 4A12A 2BXYA 1K4SA 3EUAA 3JTHA 4CO8A 4H0EA 2KISA 3LSTA 4D5FA 2OJED 4CUGA 2Z9OA 3CC4I 2DBBA 4ZDOA 1YRNB 3I59B 3MN2A 4CGZA 2LSOA 4S04A 4D5CA 5IYDJ 1VQ6I 1OPCA 2L5QA 2Q2EB 3CUOA 3QPTA 1SAUA 3OIOA 2UUZA 2DJIA 3KZZA 1R4MB 4RDUA 1QU3A 3KPHA 4DIQA 4HV5A 2X1EA 4MLOA 2RC4A 4U7BA 1VQLI 1Y0UA 1JHFA 3E5QA 2NVXJ 3EPZA 2QSGX 4AVZA 1NK3P 1VZ0A 3GXOA 3N97A 2QCOA 1FTZA 1XX5A 4IJAA 3G1OA 5F0HA 5J47A 1MMDA 3L7WA 1FOWA 2K3PA 2GXBA 4EJUA 4JX4A 2FOWA 4II3A 1S7OA 1FSEA 1YFHA 3CO6C 2V7FA 5BS6A 3HJEA 1SD4A 4MTEA 3TEDA 2XGCA 1DUXC 2Q0OA 3C2GA 3KZIC 2LBFA 4JOMA 1VQ9I 1ZELA 1RKWA 1XDSA 4IHYA 2HVRA 2RV8A 4LG3A 3BWGA 2J5PA 2EA4A 2M8EA 3IL2A 1HSJA 1RUOA 4IL6C 2MLGA 2X6YA 2CV0A 3BZKA 3GTKJ 1SFEA 3OS0A 2OD5A 5LD2C 4L0YB 1S3JA 1IN5A 2ID6A 3DV8A 4M3EA 3V7RA 4HEA2 1MDMA 3BJ6A 4PJLA 3CZ6A 3PSIA 3O6BB 5F0FA 4WXDA 2H8WA 1S8NA 4C3IJ 1Y8RB 3CP8A 3E6CC 1FMVA 2ZNZA 3K70C 1D8KA 2VASA 3BPXA 5IP7J 4XLCA 1YIOA 2IXSA 2L9RA 1Y0NA 3C1DA 2LLKA 4NC6A 3AG3H 1R1VA 3E0JB 3JAMK 1L3LA 4ZZLA 3L2CA 2LY9A 2Y2ZA 2BV6A 1FOYA 2XAJA 2DQRA 4LD5A 1CF7B 2HQRA 3ABKH 2BHYA 2HZDA 3S3OA 3V7SA 2XF6A 3ZMDA 1E2XA 1TZLA 3VDXA 3EUHC 3FBIB 3LAPA 2ESNA 1WFXA 1VI0A 3BROA 3TO6A 2VOPA 3DKXA 3HPGA 1SMTA 2JRTA 2E7XA 1JUSA 4RAYA 1W4MA 4XLEA 2M7AA 5LHIA 3MKYB 5M3MJ 1QNTA 2XF7A 3B6AA 1W7PD 4PSWA 2R5ZA 3K9TA 2K9QA 2M45A 3IH2A 1W1WE 4HNUA 2MD0A 2QF7A 4DW6A 5D5WB 3KX2A 1HKQA 2QKLB 1WPKA 1UELB 5TJJA 3ABTA 4DBQA 4AYBN 4IO9F 3HPHA 3G3ZA 4FE7A 4ESFA 1RESA 2WV0A 5HS7A 4CCJA 1VQKI 4XKVA 1LEAA 3H9GA 1IV8A 3MMYB 5GAHJ 1MBJA 2ACJA 1NK2P 5ICEA 1MH4A 3WE3A 3RTRA 1PYVA 2DYSH 1HA8A 1R5ID 1R36A 2FOKA 4EM1A 2L01A 1RETA 2KIMA 1BW6A 1HW1A 4I98B 4M3FA 1OFCX 2LC2A 5TGTA 3MAJA 1U3EM 1RR7A 2YX4A 5D6FA 4Y13A 4Y15A 4XICA 1XN7A 1TTYA 4G94A 4Q5SF 1DDNA 4LB6B 4V19K 1XGSA 2MFZA 5DUKA 2X1CA 5ICCA 2KRCA 2OCCH 3FM3A 2AO9A 1YI2I 1IUFA 4DBRA 3JSPA 3DFGA 4B4CA 2DI3A 5K7FA 4EVIA 3JRIA 1PUFB 2R93J 5FKNA 3MKZA 3RKQA 3TOBA 1E3PA 1XCVA 2KZGA 2XGDA 4B3AA 1QZZA 3KP7A 5JHUA 1YO5C 4CICA 2EFWA 1P4XA 4C9YA 2A68F 3QAHA 2F4MB 1X3ZB 2WAEA 1O3QA 4EJVA 4XORA 1EF4A 2L54A 2KZVA 4LITA 4B09A 4M9ZA 1LDKB 2VODA 3FF5A 2GWRA 2XROA 2GA2A 1USTA 4LGWA 3MZ8A 2VXDA 2XRNA 1BOAA 2LOOA 3G1MA 3SXYA 3TP0A 2VQCA 3GUDA 5E79C 3MCZA 4F93B 2LF7A 3BY6A 4NNJA 4A3JJ 4NUBA 1B9MA 5J8CA 5K1YA 3CC2I 3ULQB 4S0HB 1R22A 3HOUJ 3I4MJ 4B3XA 2HNHA 3GTOJ 2OQGA 2JVHA 2CFXA 2KRFA 4U88A 3BCBA 4YFXF 4M71A 3KEYA 1IRZA 4BDYA 3HRSA 2MH9A 1YTYA 3Q0WA 2RVCA 4BE0A 4ENKA 4XKBA 1JKOC 4M9SA 1DGRM 1N77A 5F04A 3RQ4A 4AUXA 6PAXA 3EUHA 3LSRA 1Z1DA 3TW7A 2WV1A 2GXAA 2Y0MA 5KAFC 5FD6A 4PGGA 3IAM2 1CQTA 1J9IA 2QQ9A 3ZN0A 1S6LA 2DMQA 2DFHA 2UV1A 3C7JA 1KU3A 2GQQA 2KHMA 4G8XA 3SQNA 4NB5A 5ICGA 5L3FA 4IXAA 4L9TA 1U5TB 1WWXA 3K69A 2Y9YA 2XGXA 3Q3SA 4PJMA 5C3EJ 3VEPA 2FBKA 2ZFUA 4UHTA 1BM9A 5FKOA 3OYAA 2CMPA 2QKMB 2R7OA 4A6DA 1NHAA 2V1UA 2LK2A 1RC9A 2QUFA 4FCYA 2P4WA 2PMZA 4KITB 2DLLA 3HIFA 1D0YA 5F08A 1FP2A 1IC8A 1DU0A 1YYVA 4P9UA 2DDAA 2L9SA 3GMEA 4XLAA 1SD7A 1Z6RA 2XRLA 2CQQA 2F4OB 3P9CA 1KQ9A 2XGEA 3K0LA 5F1JA 2HQAA 1BN5A 4GYIA 4O6JA 1E0EA 2P7CB 3FXUA 1X1DA 4BQAA 2YUSA 3ABLH 5HS9A 5EZHA 4LB5A 1PUEE 1AA7A 4J01A 2NRAC 1WJ5A 1ZGAA 1D8JA 2HXIA 5KNLA 3BG9A 3GYHX 2KIUA 1F9NA 2Y75A 3BG7A 3KE2A 1B8IA 1B6AA 1YJWI 1QA6A 1MMAA 2EFQA 1HSTA 1FWZA 1XMAA 1G3TA 2MW8A 3KLOA 3OIPA 2DPUA 1HLVA 3QPHA 1MJ9A 4EJTA 3FZVA 3ZXSA 2IRFG 4IHXA 2CQNA 3S15J 1GV5A 4A3CJ 4KN4X 1TWCJ 3OR2C 2R5YB 2XIGA 1NG7A 4BHBA 3S2WA 1VTNC 1OMIA 1R49A 4CA0A 3W2VA 3FDYA 1GHCA 2X85A 3PIPF 2O8KA 4B44A 3J80K 2M30A 1OYYA 1JI8A 2PN6A 1YS6A 3LWFA 2FMLA 4UUSA 1K78B 2CQ7A 3K7AJ 5FLXZ 3A0HC 5E8IA 4D7NA 3HRTA 4L9VA 4CCLA 2FSWA 2XASA 2QVOA 5ILVA 1P4AA 1XB4A 2LD5A 4R8HA 2ETHA 3K4NA 3D5RC 5F6FA 3RKYA 2BW3A 3NAUA 3TGNA 3LSPA 5E3MA 3J81K 2R7QA 1LJ9A 2E35A 1GVJA 4NHJA 1FYKA 2RGVA 5F0CA 2PX9A 3HSEA 2BE5F 1B9NA 3ZQQA 2CUJA 2EQRA 2P5LC 2CSOA 4LLNA 4BHCA 4E7IA 3QPLA 2FMYA 2E60A 3AAFA 2PMHA 3CTAA 4RBOA 2QQBA 1YX5A 4XRSG 3S3NA 1HXDA 3V8JA 4BXXJ 5EF6A 1LVAA 2K4BA 3WU0A 1Y8QB 1IV6A 5HDGA 5C4XJ 2CW0F 2LMDA 2VQLA 1XD7A 2WB1A 4UVCA 3P5JA 4FX4A 4IPAA 1V5GA 4EV0A 2VONA 2FNPA 3HOXJ 4LIUA 4G7ZF 3V8LA 2BYVE 1V5FA 3FXMA 4HAMA 3TOAA 3J7AY 1K6YA 3LFUA 3QP6A 4RGUA 1USSA 1O3RA 4IHVA 1IGNA 4C30A 1RIOH 4IEJA 3LAJA 3LQQA 2QQ8A 3ZQGA 4AIJA 3OOPA 4XLFA 2DA1A 2DK8A 3DKYA 3W6VA 4U0YA 1MJBA 5D4RA 3PIOF 3IC7A 4Y33A 3I0TA 1OQYA 1VF9A 5CJ9A 3K4BA 1FNNA 5D4SA 4G9YA 5C44J 4A3GJ 3BTIA 1J09A 2PLYA 2HEOA 1F5TA 3SZGA 1N25A 3I64A 4HSTA 1U9NA 5JI6A 5E20A 2BVLA 3HZJA 1FBSA 3GFLA 3R61A 2HI3A 1KA8A 3P7NA 3S16J 3GZ6A 2XVCA 1YG2A 2H94A 2CGPA 1WI9A 1JE8A 3GCMA 1H89C 1MW7A 2DOAA 1MMSA 3MD2A 2X6OA 3TL4X 2IS6A 1K83J 2E1MC 3BOQA 4KNYA 2OTJI 2P0WA 2IA0A 2JPBA 2CFOA 5CQEA 4BH9A 4S05A 2CUFA 3O8HA 5K5QA 3BQZA 2JA8J 3OYJA 1QQIA 1I1SA 3S1MJ 3SFZA 4KYWA 2R3SA 4A3LJ 1F43A 2KKOA 3D1NI 2HOEA 3LMMA 4A3FJ 2M34A 3LSKA 2YS9A 3CUQB 3GFIA 2KIQA 4BEHA 3LNQA 3ZMTA 5EGOB 1LDJA 2X0LA 1MMNA 1K7AA 1Z0XA 3H36A 4LG0A 2CYYA 1F4KA 2COBA 3IWZA 1B1BA 1TNSA 3OOUA 4M74A 1RPWA 3BR2A 3OYCA 1QPIA 2O03A 3CCQI 1UMQA 2TCTA 3G6EI 3F8NA 4GGGA 1BJAA 2MC3A 2B9SA 2HKOA 2IT0A 3CJNA 5A2QK 3ABUA 1A6IA 1OCZH 2RQQA 4AVPA 4E7LA 1OCCH 1WRJA 3CLOA 4HBLA 3F8BA 3CCUI 2M7BA 4C2UA 3IAS2 3SDBA 3HL2A 2IEKA 2AQFA 1KGSA 4E6KG 5FGMA 5HDKA 1KYWA 4KN7X 1ZHFA 3S93A 5DS9A 3JSOA 1ZG5A 5KK1A 1K4TA 2K9LA 1YS7A 1FJLA 2XAQA 4JYKA 5LEKA 5HLTA 1GDTA 2XKOA 4PCQA 2ZSHB 5HS8A 1XCBA 2A5YB 4M6YA 4XIDA 1JHHA 2ISYA 2M4KA 1HW5A 3ISPA 4XKWA 2W1OA 3PNYA 5FFXA 4UUSB 4HQEA 4NDLA 2H1LA 5GPCA 1ETXA 2DA3A 4HA8A 1AKHA 3S17J 4OOIA 4N0BA 3E6MA 4FX0A 5KAIC 5GAGJ 2QBYA 3NARA 1KU2A 3DF8A 1H9GA 2BW3B 1J7KA 5FKKA 2BGCA 2GOXB 4B47A 1IUYA 4EQQA 2O6GE 3RJPA 3U1DA 3FMSA 2ELKA 2QGUA 4BAYA 1W7PA 4JX5A 4MGRA 3HOVJ 1F1ZA 2RREA 1WQ2A 2EV0A 2ZB9A 4E7KA 2FNAA 5EYRA 4RB2C 1TQPA 4QPOA 2HPMA 5BOXA 4M6VA 4BE1A 3VODA 2DODA 3R0JA 4AU7A 5JVTA 3IV5A 1TWGJ 4E7JA 4HG2A 2LFBA 3WTSC 2A3SA 4FASD 1T6SA 3PO2J 3I58A 1VQNI 1BC7C 5K7ZA 4EM0B 4Y17A 5J8FA 2E1NA 2ELJA 1I50J 2VKEA 4F3QA 1B72B 3ZPLA 2FQ3A 1ZGJA 1MJAA 1LVKA 2JK3A 4XNFA 3DLAA 2OA4A 1XS9A 3KP5A 1ZKGA 2HTSA 4BXFA 5HLGA 1Z21A 4CYCA 4F52A 1R1UA 4BGDA 3S32A 1TP4A 2KT0A 3KFWX 4L5EA 1V5EA 4A93J 2GLOA 1UCRA 5HNFA 1KU9A 1BR4A 2BY1A 3HG9A 4NQWB 2YU3A 3A02A 1KQ8A 3UNGC 3WTUC 4Y4RA 5DCFA 5FRNA 1ITYA 4IQ4A 5B66C 3WTTC 3MFKA 3GZNB 2DU9A 1V4RA 2A6HF 3E97A 2G7HA 3I4PA 4IX7A 4L9JA 3PNTA 3FIWA 4RLQA 1NH3A 3HTUA 1JUPA 3CJRB 2O7OA 2P5VA 3C3WA 2VPRA 4A2UA 1EH7A 3RIRA 4MNUA 5D5UB 4BACA 1AU7A 3NWTA 1Q1VA 4LLLA 1FY7A 4YELA 3HYIA 4CZCA 3CP2A 1A6QA 5J4VA 3L1PA 3PSFA 4I0AA 1FPQA 3W2AA 3L2RA 2FBIA 2DDBA 1R71A 2F5VA 1APLC 4CCMA 1W0TA 3H35A 1TNTA 3WTZA 2VBYA 2JUGA 1QZEA 1R58A 2PFBA 4PZJA 1ZYRF 1WI3A 4L5JA 2MYSA 3BR0A 4XOTA 3GWZA 3HSFA 3QOEA 1STZA 1X4OA 4GXOA 4UV9A 3G2BA 1OCPA 3F9KA 3C18A 1IN6A 2GM4A 2DFIA 2JUCA 5IOYA 2FXAA 3A1YA 2XF5A 1XMKA 1IN7A 3ZMUA 2VLAA 5HODA 3KYDB 3A01B 4A69C 1T33A 1QBJA 2FBHA 3BCAA 5J3LA 3ZGKA 4MHGA 2C6YA 1P92A 5IPAA 2ZMEB 1T0FC 3MZYA 2CW8A 4UVBA 4NC7A 1XDUA 1QRYA 4AIDA 2VJIA 5JR3A 3CF5F 2X48A 2NVQJ 1HDDC 3BJAA 1NTCA 1Y1VJ 3DTIA 1SVOA 3VYUB 3F23A 1ZH5A 2W48A 3DU6A 4KT6A 3HM5A 3BG3A 2LG4A 2HDCA 5TRDA 4L5IA 5L3EA 4CYDA 2CJJA 3WE2A 4FE4A 4HSRA 1Y1WJ 2OTLI 5IT9K 2A5WA 2K5CA 1FX7A 3SYTA 3JRCA 1G3YA 3MKLA 4MO7A 2V9VA 4RGRA 1W5TA 1Y56A 5CQGA 5DD8A 3COAC 3F8MA 4EGYA 2NVUB 2O0YA 3ZCOA 2Y9ZA 2IS4A 3EUKL 3DBRB 4IKFA 5EJCA 1KYZA 4YRVA 2DOEA 2A6EF 2HS5A 3IRQA 3ZQLA 4QSHA 3RPUD 1ETYA 3HEFA 4P1WA 5LGUA 1MKMA 4XM3A 2NVTJ 5DCMB 2RQPA 1T08B 2L9NA 1OYWA 4AC0A 4YIIA 3GVAA 5K5RA 4PSXA 4XN0A 1TL8A 1U78A 3HHGA 2JRMA 1ZREA 3H0GJ 3DBHB 3AL0B 1KQ0A 1BBYA 3HHHA 1XPXA 5ICFA 2V1NA 3WTWC 1IRXA 1TWAJ 4P96A 2IS1A 1OR7C 2NNYA 1Z3YA 1IXCA 1POGA 2VXZA 1IO2A 2AXTC 3L2VA 2JQ7A 3BT9A 4C2MJ 2KRHA 2DMPA 3BQYA 4BJTA 1LQ1A 4HNTA 1FZPB 2O3FA 2OZUA 2P81A 4N9HA 1ETQA 3DEWA 4KIFA 4ZZDA 1GXPA 1OISA 3K2ZA 3JRAA 2WTEA 1QHHD 2DK5A 5F64A 4DGWB 4XL9A 4A6EA 2VPLA 4HYEA 1IXSB 3CESA 1TWHJ 1JKPC 4EATA 3SEQA 2DFEA 3BR5A 1MBKA 5TISC 3PUBA 2QWWA 4RAZA 5LGNA 1CGPA 2WAQA 1YX3A 4LOCA 2Z1DA 3H92A 3GBGA 1HW2A 1T95A 4BXUA 3HSRA 2ZSIB 3SZTA 4EEFG 5E3OA 3TO7A 3FISA 3HGGA 2EH3A 2K9NA 1XGNA 4KT5C 2RDPA 4G6DA 1WCMJ 2F5CA 5J1YA 2NYXA 2FQ4A 2JA7J 3GTQJ 3QYEA 4LK0F 3M1EA 3CLQA 1BC8C 2PI0A 2M8GX 4BKXA 1K79A 3PM1A 2EA2A 2E7WA 2XB0X 3LSIA 1ONVA 1FOKA 4HLYA 2FU4A 1T0FA 3DPLC 3K1NA 4U0WA 4OMYA 4NBQA 2UWMA 4AIKA 1YW9A 1HKTA 4WWCA 3OYNA 2KJBA 2V26A 2DFFA 3LA7A 1X2NA 4W1UA 2E5NA 3E6DA 2JT1A 5JLXA 5E1WA 4C3HJ 1A31A 2IS2A 4WCGA 4BY1J 2HWVA 4ENMA 4UB8C 4K2EA 4AD9A 3VPRA 1T39A 1Y39A 3NQOA 4FETA 2PMUA 3PQKA 3FXJA 3TO9A 3OV8A 1Z7UA 1U9OA 3WTYC 2FA5A 2JA6J 4X1EA 2DJNA 1TC3C 1DQUA 3I4NJ 3WGGA 2YX7A 4AWXB 1GLNA 2G9WA 3HRMA 2KJCA 2XAUA 4IRHA 3U1KA 4B48A 4FISA 2BOLA 3DWLE 1LE8A 1ZR4A 1LFUP 2QLZA 3BJOA 4MEYF 4U87A 4KICA 4UB6C 2EWNA 3I9V2 3QODA 1ZRCA 3FXRA 3OYLA 1BI3A 5J1RA 2E36A 1E3OC 2EZLA 2JSCA 5LHGA 1D5YA 2B7EA 3EYYA 3OY9A 2JJ7A 3M8JA 1UJ8A 1WVRA 3GTJJ 4PJNA 4J19A 1V3FA 3BR3A 1O4XA 2L9VA 2NVYJ 3CC7I 1OR7A 5EZGA 2LBFB 3M3YJ 5H2FC 5DM6F 1B59A 1SFKA 2WC2A 5ILUA 4P5OA 1FIAA 2AQEA 3D0SA 1TW2A 4I0BA 2ZKZA 1XGOA 2IPQX 1FBUA 2OAZA 3W3CA 3NRVA 4CCNA 2W82A 2HOSA 2KL4A 3SEZA 1MSFC 1G8XA 3QU3A 3K4LA 4BS9A 4A3IJ 3W2WA 3LSHA 2L3DA 5B1AH 5E1ZB 1QVTA 3IWFA 2W85A 3HBLA 4DJAA 4EJWA 5DD4A 5E8GA 3BZ6A 2H09A 2VT2A 2DQLA 2EIKH 2JA2A 4RLFA 1MDMB 4D9JA 2VUMJ 2E5ZA 3SDGA 2Y0SA 3OS1A 4I6ZA 2WBMA 5CPRB 1IDZA 3VB2A 2ECBA 1IDYA 2GAUA 1YHQI 2EPFA 2O61A 2E19A 3IP4B 1M1EB 1P4WA 1EH6A 2OZ6A 3KZYA 4IHSA 2VOOA 2LTPA 4KFCA 3M7GA 2EINH 3IRRA 1O3SA 2DA5A 3ASOH 2CRGA 5EG0A 2L0KA 1JT6A 4PGHA 3PO3J 3M1CA 1MSEC 3WG9A 1ACIA 2VKVA 2XDVA 3N4MA 2O9LA 2MGQA 5E3LA 2EBIA 2IAIA 3X2QH 2R7FA 3ZQ7A 4A0XA 3TDUC 1G6NA 5BQTA 3RYRA 3FXKA 4I01A 4UXNA 2HTJA 4I76A 1D3YA 4ESBA 3S2DJ 2VBXA 2VJJA 3B02A 5J1UA 3Q9SA 3G73A 2R5ZB 3G1LA 4WX9A 1U2WA 1LNWA 1VQPI 1U8RA 1MBGA 3ZN1A 3AFHA 3OYKA 1A36A 2PJPA 2V9PA 1J0RA 3AG1H 2ZJRF 5E1XA 1I1GA 2Y69H 5HNHA 2LF8A 3H0DA 4DYCA 2HDDA 3DBLB 4QLCU 3ZR8X 3FK7A 1UB9A 1GT0C 2GIVA 2E2HJ 4ZDPA 3H5RA 2QSFX 2ZXHA 4HQMA 1I27A 2ZCWA 5DUIA 2DA2A 2VE8A 2V1DA 2Y48A 2JTVA 1P7IA 5FROA 2ZO4A 4KIBA 3BG6A 3T0YA 5HLIA 1MNDA 1IN8A 5B5EC 2MH2A 1VQ8I 4XONA 3L2WA 1E3HA 1RNLA 1LFPA 3H5AA 4ZYDA 1JT0A 1BL0A 2K9SA 2XSDC 1XGMA 2FF4A 3JRDA 4I7HA 2LP0A 2OBPA 4DOZA 3M8FA 2ZJQF 1YW7A 2KMUA 1TT0A 3OSFA 1R5GA 4ABZA 2EB7A 2WA0A 3DCFA 5B3SH 3VYSB 2E1OA 4ETSA 2VI6A 5CVJA 2HYGD 4IRGA 1ERDA 3K4CA 3T8RA 5FLVA 2LH9A 3DP7A
chains in the Genus database with same CATH topology
3HOTA 2LKPA 5F1RA 2VE9A 4HX7A 1ZAOA 4RB1A 3R60A 5FO5A 4QWQA 2DTRA 2Z99A 2H6CA 1J2XA 4JBAA 3MZHA 4I09A 3JTGA 1K6OA 1BI0A 3IKVA 4BHPA 3I5UA 1YW8A 4OU0A 3V4GA 3F8FA 1IAWA 2D45A 2W84A 5HVQC 3F21A 2MA3A 4ZYEA 2G7UA 5L3DA 5ERIA 4Q48A 1GXQA 2HGCA 3GFMA 1WSUA 3J80Z 4XLNF 4IRIA 5H20A 4WXHA 1G3WA 2D1HA 2K86A 2GA1A 2P6TA 1IXRC 3IKTA 3MEXA 3J81Z 5CVRA 4IF4A 4P9FA 3Q5FA 4HF0A 2Q2EA 4JQFA 1AWCA 4M9XA 2DO7A 5JFRA 1S29A 5AIQA 1FC3A 5LBQA 2Z3YA 1R7JA 4EGZA 2UZKA 2HFHA 1ZLKA 3M9AA 4HX4A 4HDUA 3QRFF 1BI1A 3LFKA 2HR3A 3R6SA 4EMSA 1B4AA 1TQIA 4OIOF 1TLHB 4RS8A 3GZ5A 2A07F 5LHHA 2XAFA 4WXCA 2IP2A 3GF2A 2VBZA 4HOBA 1RI7A 4LJZF 2VC1A 3KP2A 5HDNA 2B0LA 2IJLA 1O7FA 3RI4A 1R23A 2CQKA 3ZMVA 3HUGA 5FFZA 4HDVA 4ON0A 2ESHA 3RPUA 3T5XA 3RKWA 1R00A 1AOYA 5IT3A 2P8TA 1TQMA 1ULYA 4LMYA 2VN2A 1CF7A 3T1BA 3I54A 5D6EA 1FSHA 4YIFA 5K5OA 2IA2A 2VC0A 5BPIA 3JW4A 5E17F 2OU2A 4I02A 3RYPA 2LDUA 2H27A 1YLFA 2HKXA 3HRUA 4ZYHA 2ZFWA 2YPRA 3B73A 1ZLJA 1XSVA 2FRHA 1TW3A 2IW5A 4XSXF 5J6XA 4ASNA 5CVVA 4ZH4F 3RPQA 1ON2A 3LQRA 1FYLA 1O7LA 3RDIA 2CWEA 2M1BA 2HQNA 2W24A 4KMFA 5A2QZ 5LRSA 2VBWA 3WGIA 3DXJF 5ED4A 3P9KA 2XV4S 4Q47A 1JGSA 1IZ1A 2P7VB 3F8CA 4R1HA 5CYVA 3FMQA 3W6KB 5D5XB 2NS0A 4G6QA 4HF1A 2GZWA 3L00A 3O2PE 3F72A 4XSZF 5DEQA 2EV6A 2KIFA 3ROUA 3ZP5A 4HW0A 3GEZA 3ECHA 4Q4ZF 1QPMA 3CDHA 4IVNA 1J59A 2STWA 2CO5A 4A0YA 4OIPF 4LG0B 2W57A 3BDDA 3EETA 1FP1D 4HZFA 5DV5A 4WK8F 3WU1B 1PDNC 2W25A 2X4HA 2QENA 1P2FA 3KP6A 3O3KA 5DDGA 1U5TA 2RKHA 3FHZA 3FM5A 1QGPA 2RNJA 4M6XA 3KEQA 2P6SA 5L3CA 1FLIA 3EQLF 3H3ZA 4ESJA 1MZBA 2EFNA 1C0WA 3FMRA 4RGSA 3TKYA 2A69F 1ZG3A 3TDZC 1IN4A 3K1MA 1J75A 4HF2A 3LA3A 4I2OA 2F5EA 2QBYB 3HTSB 1EV7A 1EH8A 2NNNA 3ELKA 1W7PB 3V7CA 1OKRA 1S7AA 3FXQA 1YQAA 1H0MA 2L4MA 4A0ZA 3REOA 1Z9CA 3SHFA 3W6JB 4A5NA 4MEXF 2XAGA 2HZTA 4GO1A 2O8XA 2K7LA 1SD6A 4PDKA 2ZXJA 4L9NA 4ENNA 3E5XA 1SD5A 2FEZA 3ERED 4YG2F 1K78A 1JXSA 4KMUX 3CUQC 3KCCA 5FB2A 4UVAA 3R4KA 3J7AO 4KUMA 1XSDA 3LA2A 1DPRA 5HOOA 2P5KA 5EEHA 1R5HA 2XAHA 4HV6A 4G7OF 5IT9Z 3GLXA 1RZ4A 4RB3C 1PP8F 2Z5UA 4OINF 4MTDA 3JAMZ 1IRFA 3GO5A 4OIRF 4O3MA 3ECOA 4OMZA 2IA1A 3VOEA 5LEJA 2COMA 2TDXA 1T98A 2J5OA 2MD5A 4U0VA 3I71A 4EM2A 4IHTA 1BIBA 4CZZA 1R1TA 1MGTA 4CXFA 4UUVA 5FLXK 3DEUA 2D1VA 5HLHA 3F6VA 4GYGA 4EJOA 2DPDA 3E5UA 3KEOA 1G4DA 4UV8A 4B8XA 3FWEA 1FYMA 4LLGF 4CHUA 3EDPA 3P9IA 1HBXG 5H6QA 2OQRA 4RB0A 5LGTA 4AIHA 1RUNA 2EK5A 3BP8A 3T8TA 1DP7P 4JK1X 2A61A 1ODDA 3CUQA 1J5YA 3WGHA 1FT9A 4TV7A 2CG4A 4M73A 3H3UA 4MQ9F 3VFZA 3RKXA 3GW2A 4KA4A 3GX4X 2QYOA 1O3TA 3U2RA 5LLQA 1HKSA 4D0PA 3IHUA 4MQVA 1SMYF 5BMZA 2EJRA 2AS5F 2ZNYA 1SFXA 1ZRFA 1I5ZA 2XKPA 1D5VA 4FT8A 1P6RA 4LFUA 3F22A 4A5MA 1SAXA 4OIQF 3D5LA 3BPVA 4ZYGA 3I53A 1ZG1A 4E70A 3GFJA 1IF1A 1H9TA 4O5VA 2K4JA 2UXNA 4RGXA 2WWYA 2M87A 4XBFA 3L09A 3DKWA 1REPC 3ML6A 3MQ0A 3TQNA 3FX3A 2Z33A 1Q1HA 4U7DA 2EV5A 2R7DA 4GCVA 3QOPA 3EYIA 3CO7C 2K02A 5CVIA 4G7HF 1QO0D 1LB2A 4KDPA 2PQ8A 5DYMA 1SFUA 2FE3A 2LNBA 1I6XA 1Z6TA 2MBFA 4ENJA 1HQCA 3V8KA 4NQWA 2L4AA 2ZJ2A 5H6RA 2GXGA 3DQVC 1LDDA 1X3UA 1O57A 2UXXA 2AXLA 2MLKA 2YSRA 2ISZA 1MD0A 5L3BA 5D8KB 3HOSA 4M72A 2F5FA 1G3SA 3WODF 3I59A 1TBXA 1OYIA 4F7ZA 3MWMA 3ZMSA 3E6BA 2STTA 4KIGA 5AIPA 4DNCA 1UFMA 1ON1A 3ZMZA 4N9IA 1ZRDA 2DAOA 3WTVC 4R79A 2EFOA 4XRFA 2YR2A 4BYYA 4HLXA 5CVUA 4WF2A 2Q8KA 2ZMEA 2EFPA 3KLNA 1IW7F 2PG4A 3U9GA 1IRGA 3KETA 2ELHA 5BPDA 2F5DA 4FHTA 1DPUA 1LEBA 2QM3A 2D2WA 2L02A 2V1XA 2E1CA 1L0OC 4YFNF 2V79A 1E17A 4P55A 5E18F 2DW4A 4HX8A 4DQ2A 1BIAA 3M8EA 2M5WA 1T2KA 3QU6A 2BEOA 2ADUA 1T38A 5ILSA 5L3GA 5LRRA 3KP3A 5FD5A 1XSXA 5DCMA 1A04A 1U6GA 2PEXA 4XLPF 1UHMA 5KVRA 1FBQA 2JPCA 2BBYA 4L18B 1ZN2A 2V6CA 1U5TC 3SZPA 4LK1F 2H6BA 2PBIA 3WTXC 1ZARA 2IVMA 1BI2A 4CDGA 3KP4A 1KU7A 2VT3A 2F2EA 1QZYA 3QP5A 3K1PA 2DT5A 2HYFA 1Z91A 3Q9VA 3F6OA 4YFKF 4UNOA 1WKMA 3DPTA 2XUBA 3E3VA 4Z2YA 3R0AA 2ZBKA 2NAZA 1PP7U 1UHWA 2XHKA 2RN7A 5CLSA 1W5SA 5AONA 5D8LB 4L0ZB 3F3XA 2K27A 4BNCA 3L9FA 5EEGA 3PFIA 5D5VB 2QZ8A 3NEUA 2JZYA 2QQAA 3PQJA 1Z05A 4A12A 3JTHA 4CO8A 4H0EA 3LSTA 2Z9OA 2DBBA 3I59B 4CGZA 2LSOA 4S04A 1OPCA 3CUOA 3QPTA 3KZZA 4HV5A 2RC4A 4U7BA 1Y0UA 1JHFA 3E5QA 3GXOA 3N97A 4IJAA 3L7WA 2GXBA 4EJUA 1S7OA 1FSEA 1YFHA 3CO6C 5BS6A 1SD4A 4MTEA 1DUXC 2Q0OA 1XDSA 2RV8A 3BWGA 2J5PA 2EA4A 2M8EA 3IL2A 1HSJA 1RUOA 2MLGA 1SFEA 2OD5A 4L0YB 1S3JA 1IN5A 1MDMA 3DV8A 3V7RA 3BJ6A 3O6BB 4WXDA 1S8NA 3E6CC 2ZNZA 1D8KA 3BPXA 1YIOA 3C1DA 1R1VA 3JAMK 1L3LA 4ZZLA 3L2CA 2BV6A 2XAJA 2DQRA 4LD5A 1CF7B 2HQRA 3V7SA 3ZMDA 1E2XA 3LAPA 2ESNA 3BROA 3TO6A 2VOPA 1SMTA 2JRTA 2E7XA 4RAYA 1W4MA 5LHIA 1QNTA 1W7PD 3K9TA 2M45A 5D5WB 1HKQA 5TJJA 3ABTA 3G3ZA 4ESFA 2WV0A 5HS7A 1LEAA 2ACJA 5ICEA 3WE3A 3RTRA 1R36A 2FOKA 4EM1A 2L01A 2KIMA 1HW1A 4I98B 3MAJA 1U3EM 4Y13A 2YX4A 5D6FA 4Y15A 4Q5SF 1XN7A 1TTYA 4G94A 1DDNA 4LB6B 1XGSA 5DUKA 5ICCA 3FM3A 3JSPA 3DFGA 2DI3A 4EVIA 3TOBA 1XCVA 1YO5C 1QZZA 3KP7A 5JHUA 4CICA 2EFWA 1P4XA 2A68F 3QAHA 1O3QA 4EJVA 2L54A 4B09A 4M9ZA 1LDKB 2VODA 3FF5A 2GWRA 2XROA 2GA2A 1USTA 4LGWA 3SXYA 2XRNA 1BOAA 3GUDA 3MCZA 2LF7A 3BY6A 1B9MA 5J8CA 5K1YA 3ULQB 1R22A 2OQGA 2CFXA 2KRFA 4U88A 4YFXF 4M71A 3HRSA 2MH9A 1YTYA 2RVCA 4ENKA 4M9SA 6PAXA 3EUHA 1Z1DA 2Y0MA 5FD6A 4PGGA 1J9IA 2QQ9A 3ZN0A 1S6LA 3C7JA 1KU3A 2GQQA 4G8XA 5ICGA 3SQNA 4NB5A 5L3FA 4IXAA 4L9TA 1U5TB 1WWXA 3K69A 2XGXA 3VEPA 2FBKA 4UHTA 1BM9A 4A6DA 1NHAA 2V1UA 2QUFA 2P4WA 2DLLA 3HIFA 1FP2A 1YYVA 4P9UA 1SD7A 1Z6RA 3P9CA 1KQ9A 3K0LA 1BN5A 4GYIA 4O6JA 2P7CB 3FXUA 4BQAA 5HS9A 4LB5A 1PUEE 2NRAC 1ZGAA 1D8JA 3GYHX 2KIUA 1F9NA 2Y75A 3KE2A 1B6AA 2EFQA 1HSTA 1FWZA 1XMAA 1G3TA 3KLOA 2DPUA 4EJTA 3QPHA 1MJ9A 3FZVA 2IRFG 4KN4X 2XIGA 4BHBA 3S2WA 1VTNC 1OMIA 1GHCA 3J80K 2M30A 1OYYA 2PN6A 1YS6A 3LWFA 2FMLA 1K78B 5FLXZ 5E8IA 3HRTA 4L9VA 2FSWA 2XASA 2QVOA 5ILVA 1P4AA 1XB4A 4R8HA 2ETHA 5F6FA 3RKYA 3TGNA 3J81K 1LJ9A 1GVJA 4NHJA 1FYKA 2RGVA 3HSEA 2BE5F 1B9NA 2P5LC 2CSOA 4LLNA 4BHCA 2FMYA 3AAFA 2PMHA 3CTAA 2QQBA 1HXDA 3V8JA 1LVAA 2K4BA 3WU0A 5HDGA 2CW0F 1XD7A 4UVCA 4FX4A 4IPAA 4EV0A 2VONA 2FNPA 4G7ZF 3V8LA 2BYVE 4HAMA 3TOAA 3QP6A 4RGUA 1USSA 1O3RA 1RIOH 3LAJA 3LQQA 4AIJA 3OOPA 2DK8A 4U0YA 1MJBA 5D4RA 3IC7A 3I0TA 5CJ9A 1FNNA 5D4SA 4G9YA 2PLYA 2HEOA 1F5TA 3I64A 5JI6A 5E20A 1FBSA 3GFLA 3R61A 1KA8A 3P7NA 3GZ6A 2XVCA 1YG2A 2H94A 2CGPA 1WI9A 1JE8A 4KNYA 3BOQA 2IA0A 2JPBA 4S05A 4BH9A 5K5QA 1QQIA 1I1SA 3SFZA 4KYWA 2R3SA 2KKOA 2HOEA 3CUQB 3GFIA 3ZMTA 1LDJA 2X0LA 1K7AA 4LG0A 2CYYA 1F4KA 3IWZA 1B1BA 1TNSA 4M74A 2O03A 3F8NA 4GGGA 1BJAA 2MC3A 2IT0A 2HKOA 3CJNA 5A2QK 3ABUA 4AVPA 1WRJA 3CLOA 4HBLA 3F8BA 1KGSA 5FGMA 5HDKA 1KYWA 4KN7X 1ZHFA 3JSOA 1ZG5A 5KK1A 1YS7A 2XAQA 5LEKA 2XKOA 4PCQA 5HS8A 1XCBA 2A5YB 4M6YA 1JHHA 2ISYA 3ISPA 1HW5A 5FFXA 4HQEA 4HA8A 4OOIA 4N0BA 3E6MA 4FX0A 2QBYA 1KU2A 3DF8A 1H9GA 1J7KA 2BGCA 1IUYA 4EQQA 2O6GE 3RJPA 3U1DA 3FMSA 4BAYA 1W7PA 4MGRA 1F1ZA 1WQ2A 2EV0A 2FNAA 4RB2C 1TQPA 5BOXA 3VODA 3R0JA 5JVTA 3WTSC 2A3SA 1T6SA 3I58A 1BC7C 4EM0B 4Y17A 5J8FA 2E1NA 3ZPLA 2FQ3A 1ZGJA 1MJAA 2OA4A 3KP5A 2HTSA 5HLGA 1R1UA 3KFWX 1UCRA 1KU9A 1KQ8A 2YU3A 3WTUC 5DCFA 3WTTC 3MFKA 2DU9A 1V4RA 2A6HF 3E97A 2G7HA 3I4PA 4L9JA 3HTUA 2P5VA 3C3WA 4A2UA 1EH7A 3RIRA 4MNUA 5D5UB 4LLLA 1FY7A 3HYIA 4I0AA 1FPQA 2FBIA 1TNTA 3WTZA 2VBYA 1R58A 2PFBA 4PZJA 1ZYRF 4L5JA 3GWZA 3HSFA 4GXOA 1STZA 4UV9A 3C18A 1IN6A 2DFIA 2FXAA 1XMKA 1IN7A 3ZMUA 1QBJA 2FBHA 4MHGA 2C6YA 1P92A 2ZMEB 3MZYA 4UVBA 1XDUA 5JR3A 3BJAA 3F23A 1ZH5A 2HDCA 5TRDA 4L5IA 5L3EA 4CYDA 3WE2A 5IT9K 1FX7A 1G3YA 3COAC 2V9VA 4RGRA 1W5TA 5DD8A 3F8MA 4EGYA 2O0YA 1KYZA 2A6EF 2HS5A 3IRQA 5LGUA 1MKMA 5DCMB 2RQPA 1OYWA 4YIIA 3GVAA 5K5RA 1U78A 3HHGA 1ZREA 1KQ0A 1BBYA 3HHHA 5ICFA 3WTWC 4P96A 2NNYA 1IXCA 2VXZA 1LQ1A 1FZPB 2O3FA 2OZUA 4N9HA 4KIFA 4ZZDA 1GXPA 3K2ZA 2WTEA 2DK5A 5F64A 4A6EA 4HYEA 1IXSB 2QWWA 4RAZA 5LGNA 1CGPA 3H92A 1HW2A 4BXUA 3HSRA 3SZTA 3TO7A 4KT5C 1XGNA 2RDPA 4G6DA 2F5CA 2NYXA 4LK0F 2PI0A 3M1EA 1BC8C 1K79A 2EA2A 2E7WA 1ONVA 1FOKA 4HLYA 2FU4A 1T0FA 3DPLC 3K1NA 4U0WA 4OMYA 2UWMA 4AIKA 1YW9A 1HKTA 4WWCA 2KJBA 3LA7A 3E6DA 2JT1A 5E1WA 4WCGA 2HWVA 4ENMA 4K2EA 4AD9A 1T39A 3NQOA 2PMUA 3PQKA 3TO9A 3OV8A 1Z7UA 3WTYC 2FA5A 3WGGA 2YX7A 4AWXB 2G9WA 3HRMA 2KJCA 4IRHA 2QLZA 3BJOA 4MEYF 4KICA 2EWNA 1ZRCA 3FXRA 1BI3A 2JSCA 5LHGA 3EYYA 1V3FA 1OR7A 1B59A 2WC2A 5ILUA 4P5OA 3D0SA 1TW2A 4I0BA 2ZKZA 1XGOA 2IPQX 1FBUA 2OAZA 3NRVA 3QU3A 2L3DA 5E1ZB 3IWFA 2W85A 4EJWA 5DD4A 5E8GA 3BZ6A 2H09A 2VT2A 2DQLA 1MDMB 3VB2A 2GAUA 2O61A 1P4WA 1EH6A 2OZ6A 3KZYA 4IHSA 2VOOA 4KFCA 3M7GA 3IRRA 1O3SA 4PGHA 3WG9A 3N4MA 2R7FA 3ZQ7A 4A0XA 3TDUC 1G6NA 5BQTA 3RYRA 4I01A 4UXNA 2HTJA 1D3YA 4ESBA 2VBXA 3B02A 3Q9SA 3G73A 4WX9A 1U2WA 1LNWA 1U8RA 3ZN1A 2PJPA 1J0RA 5E1XA 1I1GA 2LF8A 4QLCU 1UB9A 2GIVA 4HQMA 1I27A 2ZCWA 5DUIA 2VE8A 2V1DA 2Y48A 2JTVA 2ZO4A 4KIBA 3T0YA 5HLIA 1IN8A 2MH2A 1RNLA 4ZYDA 1XGMA 2FF4A 4I7HA 2OBPA 3M8FA 1YW7A 1R5GA 2EB7A 4ETSA 5CVJA 2HYGD 4IRGA 3T8RA 3DP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOT A;  2LKP A;  5F1R A;  2VE9 A;  4HX7 A;  1ZAO A;  4RB1 A;  3R60 A;  5FO5 A;  4QWQ A;  2DTR A;  2Z99 A;  2H6C A;  1J2X A;  4JBA A;  3MZH A;  4I09 A;  3JTG A;  1K6O A;  1BI0 A;  3IKV A;  4BHP A;  3I5U A;  1YW8 A;  4OU0 A;  3V4G A;  3F8F A;  1IAW A;  2D45 A;  2W84 A;  5HVQ C;  3F21 A;  2MA3 A;  4ZYE A;  2G7U A;  5L3D A;  5ERI A;  4Q48 A;  1GXQ A;  2HGC A;  3GFM A;  1WSU A;  3J80 Z;  4XLN F;  4IRI A;  5H20 A;  4WXH A;  1G3W A;  2D1H A;  2K86 A;  2GA1 A;  2P6T A;  1IXR C;  3IKT A;  3MEX A;  3J81 Z;  5CVR A;  4IF4 A;  4P9F A;  3Q5F A;  4HF0 A;  2Q2E A;  4JQF A;  1AWC A;  4M9X A;  2DO7 A;  5JFR A;  1S29 A;  5AIQ A;  1FC3 A;  5LBQ A;  2Z3Y A;  1R7J A;  4EGZ A;  2UZK A;  2HFH A;  1ZLK A;  3M9A A;  4HX4 A;  4HDU A;  3QRF F;  1BI1 A;  3LFK A;  2HR3 A;  3R6S A;  4EMS A;  1B4A A;  1TQI A;  4OIO F;  1TLH B;  4RS8 A;  3GZ5 A;  2A07 F;  5LHH A;  2XAF A;  4WXC A;  2IP2 A;  3GF2 A;  2VBZ A;  4HOB A;  1RI7 A;  4LJZ F;  2VC1 A;  3KP2 A;  5HDN A;  2B0L A;  2IJL A;  1O7F A;  3RI4 A;  1R23 A;  2CQK A;  3ZMV A;  3HUG A;  5FFZ A;  4HDV A;  4ON0 A;  2ESH A;  3RPU A;  3T5X A;  3RKW A;  1R00 A;  1AOY A;  5IT3 A;  2P8T A;  1TQM A;  1ULY A;  4LMY A;  2VN2 A;  1CF7 A;  3T1B A;  3I54 A;  5D6E A;  1FSH A;  4YIF A;  5K5O A;  2IA2 A;  2VC0 A;  5BPI A;  3JW4 A;  5E17 F;  2OU2 A;  4I02 A;  3RYP A;  2LDU A;  2H27 A;  1YLF A;  2HKX A;  3HRU A;  4ZYH A;  2ZFW A;  2YPR A;  3B73 A;  1ZLJ A;  1XSV A;  2FRH A;  1TW3 A;  2IW5 A;  4XSX F;  5J6X A;  4ASN A;  5CVV A;  4ZH4 F;  3RPQ A;  1ON2 A;  3LQR A;  1FYL A;  1O7L A;  3RDI A;  2CWE A;  2M1B A;  2HQN A;  2W24 A;  4KMF A;  5A2Q Z;  5LRS A;  2VBW A;  3WGI A;  3DXJ F;  5ED4 A;  3P9K A;  2XV4 S;  4Q47 A;  1JGS A;  1IZ1 A;  2P7V B;  3F8C A;  4R1H A;  5CYV A;  3FMQ A;  3W6K B;  5D5X B;  2NS0 A;  4G6Q A;  4HF1 A;  2GZW A;  3L00 A;  3O2P E;  3F72 A;  4XSZ F;  5DEQ A;  2EV6 A;  2KIF A;  3ROU A;  3ZP5 A;  4HW0 A;  3GEZ A;  3ECH A;  4Q4Z F;  1QPM A;  3CDH A;  4IVN A;  1J59 A;  2STW A;  2CO5 A;  4A0Y A;  4OIP F;  4LG0 B;  2W57 A;  3BDD A;  3EET A;  1FP1 D;  4HZF A;  5DV5 A;  4WK8 F;  3WU1 B;  1PDN C;  2W25 A;  2X4H A;  2QEN A;  1P2F A;  3KP6 A;  3O3K A;  5DDG A;  1U5T A;  2RKH A;  3FHZ A;  3FM5 A;  1QGP A;  2RNJ A;  4M6X A;  3KEQ A;  2P6S A;  5L3C A;  1FLI A;  3EQL F;  3H3Z A;  4ESJ A;  1MZB A;  2EFN A;  1C0W A;  3FMR A;  4RGS A;  3TKY A;  2A69 F;  1ZG3 A;  3TDZ C;  1IN4 A;  3K1M A;  1J75 A;  4HF2 A;  3LA3 A;  4I2O A;  2F5E A;  2QBY B;  3HTS B;  1EV7 A;  1EH8 A;  2NNN A;  3ELK A;  1W7P B;  3V7C A;  1OKR A;  1S7A A;  3FXQ A;  1YQA A;  1H0M A;  2L4M A;  4A0Z A;  3REO A;  1Z9C A;  3SHF A;  3W6J B;  4A5N A;  4MEX F;  2XAG A;  2HZT A;  4GO1 A;  2O8X A;  2K7L A;  1SD6 A;  4PDK A;  2ZXJ A;  4L9N A;  4ENN A;  3E5X A;  1SD5 A;  2FEZ A;  3ERE D;  4YG2 F;  1K78 A;  1JXS A;  4KMU X;  3CUQ C;  3KCC A;  5FB2 A;  4UVA A;  3R4K A;  3J7A O;  4KUM A;  1XSD A;  3LA2 A;  1DPR A;  5HOO A;  2P5K A;  5EEH A;  1R5H A;  2XAH A;  4HV6 A;  4G7O F;  5IT9 Z;  3GLX A;  1RZ4 A;  4RB3 C;  1PP8 F;  2Z5U A;  4OIN F;  4MTD A;  3JAM Z;  1IRF A;  3GO5 A;  4OIR F;  4O3M A;  3ECO A;  4OMZ A;  2IA1 A;  3VOE A;  5LEJ A;  2COM A;  2TDX A;  1T98 A;  2J5O A;  2MD5 A;  4U0V A;  3I71 A;  4EM2 A;  4IHT A;  1BIB A;  4CZZ A;  1R1T A;  1MGT A;  4CXF A;  4UUV A;  5FLX K;  3DEU A;  2D1V A;  5HLH A;  3F6V A;  4GYG A;  4EJO A;  2DPD A;  3E5U A;  3KEO A;  1G4D A;  4UV8 A;  4B8X A;  3FWE A;  1FYM A;  4LLG F;  4CHU A;  3EDP A;  3P9I A;  1HBX G;  5H6Q A;  2OQR A;  4RB0 A;  5LGT A;  4AIH A;  1RUN A;  2EK5 A;  3BP8 A;  3T8T A;  1DP7 P;  4JK1 X;  2A61 A;  1ODD A;  3CUQ A;  1J5Y A;  3WGH A;  1FT9 A;  4TV7 A;  2CG4 A;  4M73 A;  3H3U A;  4MQ9 F;  3VFZ A;  3RKX A;  3GW2 A;  4KA4 A;  3GX4 X;  2QYO A;  1O3T A;  3U2R A;  5LLQ A;  1HKS A;  4D0P A;  3IHU A;  4MQV A;  1SMY F;  5BMZ A;  2EJR A;  2AS5 F;  2ZNY A;  1SFX A;  1ZRF A;  1I5Z A;  2XKP A;  1D5V A;  4FT8 A;  1P6R A;  4LFU A;  3F22 A;  4A5M A;  1SAX A;  4OIQ F;  3D5L A;  3BPV A;  4ZYG A;  3I53 A;  1ZG1 A;  4E70 A;  3GFJ A;  1IF1 A;  1H9T A;  4O5V A;  2K4J A;  2UXN A;  4RGX A;  2WWY A;  2M87 A;  4XBF A;  3L09 A;  3DKW A;  1REP C;  3ML6 A;  3MQ0 A;  3TQN A;  3FX3 A;  2Z33 A;  1Q1H A;  4U7D A;  2EV5 A;  2R7D A;  4GCV A;  3QOP A;  3EYI A;  3CO7 C;  2K02 A;  5CVI A;  4G7H F;  1QO0 D;  1LB2 A;  4KDP A;  2PQ8 A;  5DYM A;  1SFU A;  2FE3 A;  2LNB A;  1I6X A;  1Z6T A;  2MBF A;  4ENJ A;  1HQC A;  3V8K A;  4NQW A;  2L4A A;  2ZJ2 A;  5H6R A;  2GXG A;  3DQV C;  1LDD A;  1X3U A;  1O57 A;  2UXX A;  2AXL A;  2MLK A;  2YSR A;  2ISZ A;  1MD0 A;  5L3B A;  5D8K B;  3HOS A;  4M72 A;  2F5F A;  1G3S A;  3WOD F;  3I59 A;  1TBX A;  1OYI A;  4F7Z A;  3MWM A;  3ZMS A;  3E6B A;  2STT A;  4KIG A;  5AIP A;  4DNC A;  1UFM A;  1ON1 A;  3ZMZ A;  4N9I A;  1ZRD A;  2DAO A;  3WTV C;  4R79 A;  2EFO A;  4XRF A;  2YR2 A;  4BYY A;  4HLX A;  5CVU A;  4WF2 A;  2Q8K A;  2ZME A;  2EFP A;  3KLN A;  1IW7 F;  2PG4 A;  3U9G A;  1IRG A;  3KET A;  2ELH A;  5BPD A;  2F5D A;  4FHT A;  1DPU A;  1LEB A;  2QM3 A;  2D2W A;  2L02 A;  2V1X A;  2E1C A;  1L0O C;  4YFN F;  2V79 A;  1E17 A;  4P55 A;  5E18 F;  2DW4 A;  4HX8 A;  4DQ2 A;  1BIA A;  3M8E A;  2M5W A;  1T2K A;  3QU6 A;  2BEO A;  2ADU A;  1T38 A;  5ILS A;  5L3G A;  5LRR A;  3KP3 A;  5FD5 A;  1XSX A;  5DCM A;  1A04 A;  1U6G A;  2PEX A;  4XLP F;  1UHM A;  5KVR A;  1FBQ A;  2JPC A;  2BBY A;  4L18 B;  1ZN2 A;  2V6C A;  1U5T C;  3SZP A;  4LK1 F;  2H6B A;  2PBI A;  3WTX C;  1ZAR A;  2IVM A;  1BI2 A;  4CDG A;  3KP4 A;  1KU7 A;  2VT3 A;  2F2E A;  1QZY A;  3QP5 A;  3K1P A;  2DT5 A;  2HYF A;  1Z91 A;  3Q9V A;  3F6O A;  4YFK F;  4UNO A;  1WKM A;  3DPT A;  2XUB A;  3E3V A;  4Z2Y A;  3R0A A;  2ZBK A;  2NAZ A;  1PP7 U;  1UHW A;  2XHK A;  2RN7 A;  5CLS A;  1W5S A;  5AON A;  5D8L B;  4L0Z B;  3F3X A;  2K27 A;  4BNC A;  3L9F A;  5EEG A;  3PFI A;  5D5V B;  2QZ8 A;  3NEU A;  2JZY A;  2QQA A;  3PQJ A;  1Z05 A;  4A12 A;  3JTH A;  4CO8 A;  4H0E A;  3LST A;  2Z9O A;  2DBB A;  3I59 B;  4CGZ A;  2LSO A;  4S04 A;  1OPC A;  3CUO A;  3QPT A;  3KZZ A;  4HV5 A;  2RC4 A;  4U7B A;  1Y0U A;  1JHF A;  3E5Q A;  3GXO A;  3N97 A;  4IJA A;  3L7W A;  2GXB A;  4EJU A;  1S7O A;  1FSE A;  1YFH A;  3CO6 C;  5BS6 A;  1SD4 A;  4MTE A;  1DUX C;  2Q0O A;  1XDS A;  2RV8 A;  3BWG A;  2J5P A;  2EA4 A;  2M8E A;  3IL2 A;  1HSJ A;  1RUO A;  2MLG A;  1SFE A;  2OD5 A;  4L0Y B;  1S3J A;  1IN5 A;  1MDM A;  3DV8 A;  3V7R A;  3BJ6 A;  3O6B B;  4WXD A;  1S8N A;  3E6C C;  2ZNZ A;  1D8K A;  3BPX A;  1YIO A;  3C1D A;  1R1V A;  3JAM K;  1L3L A;  4ZZL A;  3L2C A;  2BV6 A;  2XAJ A;  2DQR A;  4LD5 A;  1CF7 B;  2HQR A;  3V7S A;  3ZMD A;  1E2X A;  3LAP A;  2ESN A;  3BRO A;  3TO6 A;  2VOP A;  1SMT A;  2JRT A;  2E7X A;  4RAY A;  1W4M A;  5LHI A;  1QNT A;  1W7P D;  3K9T A;  2M45 A;  5D5W B;  1HKQ A;  5TJJ A;  3ABT A;  3G3Z A;  4ESF A;  2WV0 A;  5HS7 A;  1LEA A;  2ACJ A;  5ICE A;  3WE3 A;  3RTR A;  1R36 A;  2FOK A;  4EM1 A;  2L01 A;  2KIM A;  1HW1 A;  4I98 B;  3MAJ A;  1U3E M;  4Y13 A;  2YX4 A;  5D6F A;  4Y15 A;  4Q5S F;  1XN7 A;  1TTY A;  4G94 A;  1DDN A;  4LB6 B;  1XGS A;  5DUK A;  5ICC A;  3FM3 A;  3JSP A;  3DFG A;  2DI3 A;  4EVI A;  3TOB A;  1XCV A;  1YO5 C;  1QZZ A;  3KP7 A;  5JHU A;  4CIC A;  2EFW A;  1P4X A;  2A68 F;  3QAH A;  1O3Q A;  4EJV A;  2L54 A;  4B09 A;  4M9Z A;  1LDK B;  2VOD A;  3FF5 A;  2GWR A;  2XRO A;  2GA2 A;  1UST A;  4LGW A;  3SXY A;  2XRN A;  1BOA A;  3GUD A;  3MCZ A;  2LF7 A;  3BY6 A;  1B9M A;  5J8C A;  5K1Y A;  3ULQ B;  1R22 A;  2OQG A;  2CFX A;  2KRF A;  4U88 A;  4YFX F;  4M71 A;  3HRS A;  2MH9 A;  1YTY A;  2RVC A;  4ENK A;  4M9S A;  6PAX A;  3EUH A;  1Z1D A;  2Y0M A;  5FD6 A;  4PGG A;  1J9I A;  2QQ9 A;  3ZN0 A;  1S6L A;  3C7J A;  1KU3 A;  2GQQ A;  4G8X A;  5ICG A;  3SQN A;  4NB5 A;  5L3F A;  4IXA A;  4L9T A;  1U5T B;  1WWX A;  3K69 A;  2XGX A;  3VEP A;  2FBK A;  4UHT A;  1BM9 A;  4A6D A;  1NHA A;  2V1U A;  2QUF A;  2P4W A;  2DLL A;  3HIF A;  1FP2 A;  1YYV A;  4P9U A;  1SD7 A;  1Z6R A;  3P9C A;  1KQ9 A;  3K0L A;  1BN5 A;  4GYI A;  4O6J A;  2P7C B;  3FXU A;  4BQA A;  5HS9 A;  4LB5 A;  1PUE E;  2NRA C;  1ZGA A;  1D8J A;  3GYH X;  2KIU A;  1F9N A;  2Y75 A;  3KE2 A;  1B6A A;  2EFQ A;  1HST A;  1FWZ A;  1XMA A;  1G3T A;  3KLO A;  2DPU A;  4EJT A;  3QPH A;  1MJ9 A;  3FZV A;  2IRF G;  4KN4 X;  2XIG A;  4BHB A;  3S2W A;  1VTN C;  1OMI A;  1GHC A;  3J80 K;  2M30 A;  1OYY A;  2PN6 A;  1YS6 A;  3LWF A;  2FML A;  1K78 B;  5FLX Z;  5E8I A;  3HRT A;  4L9V A;  2FSW A;  2XAS A;  2QVO A;  5ILV A;  1P4A A;  1XB4 A;  4R8H A;  2ETH A;  5F6F A;  3RKY A;  3TGN A;  3J81 K;  1LJ9 A;  1GVJ A;  4NHJ A;  1FYK A;  2RGV A;  3HSE A;  2BE5 F;  1B9N A;  2P5L C;  2CSO A;  4LLN A;  4BHC A;  2FMY A;  3AAF A;  2PMH A;  3CTA A;  2QQB A;  1HXD A;  3V8J A;  1LVA A;  2K4B A;  3WU0 A;  5HDG A;  2CW0 F;  1XD7 A;  4UVC A;  4FX4 A;  4IPA A;  4EV0 A;  2VON A;  2FNP A;  4G7Z F;  3V8L A;  2BYV E;  4HAM A;  3TOA A;  3QP6 A;  4RGU A;  1USS A;  1O3R A;  1RIO H;  3LAJ A;  3LQQ A;  4AIJ A;  3OOP A;  2DK8 A;  4U0Y A;  1MJB A;  5D4R A;  3IC7 A;  3I0T A;  5CJ9 A;  1FNN A;  5D4S A;  4G9Y A;  2PLY A;  2HEO A;  1F5T A;  3I64 A;  5JI6 A;  5E20 A;  1FBS A;  3GFL A;  3R61 A;  1KA8 A;  3P7N A;  3GZ6 A;  2XVC A;  1YG2 A;  2H94 A;  2CGP A;  1WI9 A;  1JE8 A;  4KNY A;  3BOQ A;  2IA0 A;  2JPB A;  4S05 A;  4BH9 A;  5K5Q A;  1QQI A;  1I1S A;  3SFZ A;  4KYW A;  2R3S A;  2KKO A;  2HOE A;  3CUQ B;  3GFI A;  3ZMT A;  1LDJ A;  2X0L A;  1K7A A;  4LG0 A;  2CYY A;  1F4K A;  3IWZ A;  1B1B A;  1TNS A;  4M74 A;  2O03 A;  3F8N A;  4GGG A;  1BJA A;  2MC3 A;  2IT0 A;  2HKO A;  3CJN A;  5A2Q K;  3ABU A;  4AVP A;  1WRJ A;  3CLO A;  4HBL A;  3F8B A;  1KGS A;  5FGM A;  5HDK A;  1KYW A;  4KN7 X;  1ZHF A;  3JSO A;  1ZG5 A;  5KK1 A;  1YS7 A;  2XAQ A;  5LEK A;  2XKO A;  4PCQ A;  5HS8 A;  1XCB A;  2A5Y B;  4M6Y A;  1JHH A;  2ISY A;  3ISP A;  1HW5 A;  5FFX A;  4HQE A;  4HA8 A;  4OOI A;  4N0B A;  3E6M A;  4FX0 A;  2QBY A;  1KU2 A;  3DF8 A;  1H9G A;  1J7K A;  2BGC A;  1IUY A;  4EQQ A;  2O6G E;  3RJP A;  3U1D A;  3FMS A;  4BAY A;  1W7P A;  4MGR A;  1F1Z A;  1WQ2 A;  2EV0 A;  2FNA A;  4RB2 C;  1TQP A;  5BOX A;  3VOD A;  3R0J A;  5JVT A;  3WTS C;  2A3S A;  1T6S A;  3I58 A;  1BC7 C;  4EM0 B;  4Y17 A;  5J8F A;  2E1N A;  3ZPL A;  2FQ3 A;  1ZGJ A;  1MJA A;  2OA4 A;  3KP5 A;  2HTS A;  5HLG A;  1R1U A;  3KFW X;  1UCR A;  1KU9 A;  1KQ8 A;  2YU3 A;  3WTU C;  5DCF A;  3WTT C;  3MFK A;  2DU9 A;  1V4R A;  2A6H F;  3E97 A;  2G7H A;  3I4P A;  4L9J A;  3HTU A;  2P5V A;  3C3W A;  4A2U A;  1EH7 A;  3RIR A;  4MNU A;  5D5U B;  4LLL A;  1FY7 A;  3HYI A;  4I0A A;  1FPQ A;  2FBI A;  1TNT A;  3WTZ A;  2VBY A;  1R58 A;  2PFB A;  4PZJ A;  1ZYR F;  4L5J A;  3GWZ A;  3HSF A;  4GXO A;  1STZ A;  4UV9 A;  3C18 A;  1IN6 A;  2DFI A;  2FXA A;  1XMK A;  1IN7 A;  3ZMU A;  1QBJ A;  2FBH A;  4MHG A;  2C6Y A;  1P92 A;  2ZME B;  3MZY A;  4UVB A;  1XDU A;  5JR3 A;  3BJA A;  3F23 A;  1ZH5 A;  2HDC A;  5TRD A;  4L5I A;  5L3E A;  4CYD A;  3WE2 A;  5IT9 K;  1FX7 A;  1G3Y A;  3COA C;  2V9V A;  4RGR A;  1W5T A;  5DD8 A;  3F8M A;  4EGY A;  2O0Y A;  1KYZ A;  2A6E F;  2HS5 A;  3IRQ A;  5LGU A;  1MKM A;  5DCM B;  2RQP A;  1OYW A;  4YII A;  3GVA A;  5K5R A;  1U78 A;  3HHG A;  1ZRE A;  1KQ0 A;  1BBY A;  3HHH A;  5ICF A;  3WTW C;  4P96 A;  2NNY A;  1IXC A;  2VXZ A;  1LQ1 A;  1FZP B;  2O3F A;  2OZU A;  4N9H A;  4KIF A;  4ZZD A;  1GXP A;  3K2Z A;  2WTE A;  2DK5 A;  5F64 A;  4A6E A;  4HYE A;  1IXS B;  2QWW A;  4RAZ A;  5LGN A;  1CGP A;  3H92 A;  1HW2 A;  4BXU A;  3HSR A;  3SZT A;  3TO7 A;  4KT5 C;  1XGN A;  2RDP A;  4G6D A;  2F5C A;  2NYX A;  4LK0 F;  2PI0 A;  3M1E A;  1BC8 C;  1K79 A;  2EA2 A;  2E7W A;  1ONV A;  1FOK A;  4HLY A;  2FU4 A;  1T0F A;  3DPL C;  3K1N A;  4U0W A;  4OMY A;  2UWM A;  4AIK A;  1YW9 A;  1HKT A;  4WWC A;  2KJB A;  3LA7 A;  3E6D A;  2JT1 A;  5E1W A;  4WCG A;  2HWV A;  4ENM A;  4K2E A;  4AD9 A;  1T39 A;  3NQO A;  2PMU A;  3PQK A;  3TO9 A;  3OV8 A;  1Z7U A;  3WTY C;  2FA5 A;  3WGG A;  2YX7 A;  4AWX B;  2G9W A;  3HRM A;  2KJC A;  4IRH A;  2QLZ A;  3BJO A;  4MEY F;  4KIC A;  2EWN A;  1ZRC A;  3FXR A;  1BI3 A;  2JSC A;  5LHG A;  3EYY A;  1V3F A;  1OR7 A;  1B59 A;  2WC2 A;  5ILU A;  4P5O A;  3D0S A;  1TW2 A;  4I0B A;  2ZKZ A;  1XGO A;  2IPQ X;  1FBU A;  2OAZ A;  3NRV A;  3QU3 A;  2L3D A;  5E1Z B;  3IWF A;  2W85 A;  4EJW A;  5DD4 A;  5E8G A;  3BZ6 A;  2H09 A;  2VT2 A;  2DQL A;  1MDM B;  3VB2 A;  2GAU A;  2O61 A;  1P4W A;  1EH6 A;  2OZ6 A;  3KZY A;  4IHS A;  2VOO A;  4KFC A;  3M7G A;  3IRR A;  1O3S A;  4PGH A;  3WG9 A;  3N4M A;  2R7F A;  3ZQ7 A;  4A0X A;  3TDU C;  1G6N A;  5BQT A;  3RYR A;  4I01 A;  4UXN A;  2HTJ A;  1D3Y A;  4ESB A;  2VBX A;  3B02 A;  3Q9S A;  3G73 A;  4WX9 A;  1U2W A;  1LNW A;  1U8R A;  3ZN1 A;  2PJP A;  1J0R A;  5E1X A;  1I1G A;  2LF8 A;  4QLC U;  1UB9 A;  2GIV A;  4HQM A;  1I27 A;  2ZCW A;  5DUI A;  2VE8 A;  2V1D A;  2Y48 A;  2JTV A;  2ZO4 A;  4KIB A;  3T0Y A;  5HLI A;  1IN8 A;  2MH2 A;  1RNL A;  4ZYD A;  1XGM A;  2FF4 A;  4I7H A;  2OBP A;  3M8F A;  1YW7 A;  1R5G A;  2EB7 A;  4ETS A;  5CVJ A;  2HYG D;  4IRG A;  3T8R A;  3DP7 A; 
#chains in the Genus database with same CATH topology
 3B6C A;  3HOT A;  5E3N A;  1JKR C;  3GTM J;  2LKP A;  2ZXI A;  4Y52 J;  5F1R A;  2VE9 A;  4HX7 A;  2PJR A;  1ZAO A;  4RB1 A;  3R60 A;  5FO5 A;  4QWQ A;  3ZQF A;  2DTR A;  2Z99 A;  2H6C A;  1J2X A;  1WJB A;  4JBA A;  3MZH A;  2MAB A;  4I09 A;  1WZ2 A;  1ZQ3 P;  2X1D A;  2XB5 A;  3SJM A;  3JTG A;  3OMY A;  3BLY A;  1BI0 A;  3IKV A;  1K6O A;  2WAF A;  4C3J J;  3CCS I;  4BHP A;  5JVG F;  3D5S C;  1DU6 A;  4PJ0 C;  1OJL A;  1OCO H;  2FUG 2;  2ID3 A;  3I5U A;  1VQ4 I;  1YW8 A;  3MVP A;  3IUO A;  4OU0 A;  3V4G A;  3VYR B;  1ZTR A;  3F8F A;  1IAW A;  3JRF A;  2OUM A;  3OIQ A;  4PFO A;  1FMW A;  2D45 A;  2OV7 A;  2Z2S B;  2NS7 A;  2W84 A;  1JKQ C;  5HVQ C;  3HKZ A;  3F21 A;  4Z6Y A;  2MA3 A;  3I55 I;  4ZYE A;  2G7U A;  2HPI A;  3OL4 A;  5L3D A;  5ERI A;  4Q48 A;  1GXQ A;  2HGC A;  4CSW A;  5BNG A;  3GFM A;  2RNG A;  1WH7 A;  2HQ5 A;  1WSU A;  3J80 Z;  1JTY A;  1HF0 A;  4XLN F;  4IRI A;  1RRJ A;  3OYI A;  3K2A A;  2JSP A;  3CF2 A;  3K10 A;  1VQ5 I;  5H20 A;  4A3K J;  4ANJ A;  4WXH A;  1G3W A;  5K7H A;  3JRH A;  2D1H A;  3K4J A;  5F27 A;  2K86 A;  4E7Z A;  2GA1 A;  2P6T A;  1IXR C;  3UR3 C;  2EIM H;  2ZXW H;  3MEX A;  3IKT A;  1YRN A;  3ZQH A;  3J81 Z;  3H9Q A;  4IF4 A;  4P9F A;  5CVR A;  3Q5F A;  4HF0 A;  2PMZ N;  2Q2E A;  4PUS A;  4JQF A;  1AWC A;  1GVD A;  4IZZ A;  2B63 J;  2IGN A;  2DO7 A;  4M9X A;  4XMY A;  5JFR A;  1S29 A;  5AIQ A;  4BJ6 C;  1FC3 A;  5LBQ A;  2Z3Y A;  4DYQ A;  1R7J A;  1LPQ A;  4EGZ A;  4IHW A;  2UZK A;  2HFH A;  3KIO A;  3M9A A;  1ZLK A;  3LOC A;  4HX4 A;  5EG0 B;  4D7M A;  4HDU A;  3QRF F;  1BI1 A;  2M0M A;  2HR3 A;  1D0X A;  2L7F P;  3LFK A;  1D1C A;  4M3G A;  3R6S A;  2DCE A;  2R7Z J;  2R7T A;  4EMS A;  1B4A A;  3JRG A;  1B8I B;  3E7L A;  4I99 C;  4V2G A;  1MBF A;  4FTH A;  1TQI A;  3HGY A;  2DOF A;  4OIO F;  1TLH B;  4RS8 A;  3GZ5 A;  2A07 F;  2OPT A;  5LHH A;  4A3B J;  2XAF A;  4WXC A;  2IP2 A;  3DTE A;  3GF2 A;  2VBZ A;  1ETV A;  4HOB A;  1RI7 A;  2ICW G;  3OR1 C;  5KHD A;  3K6G A;  4LJZ F;  3PUF A;  2MC4 A;  2VC1 A;  3HC7 A;  1BOB A;  2R7U A;  4BE2 A;  4IOC F;  3KP2 A;  3ZQI A;  5HDN A;  1YIJ I;  1EA3 A;  2B0L A;  4XLH A;  2IJL A;  2I8D A;  4XKC A;  3L2U A;  1VQO I;  1O7F A;  3RI4 A;  1R23 A;  2CQK A;  3ZMV A;  3HUG A;  1X3W B;  5M5W J;  1IJW C;  5FFZ A;  3WU2 C;  4HDV A;  3CCE I;  4ON0 A;  4D1Q A;  1G2H A;  2VKH A;  2ESH A;  3WHC A;  3RPU A;  2FX0 A;  3T5X A;  3RKW A;  5B1B H;  1R00 A;  1YIT I;  4E4H A;  2LY2 A;  3A0B C;  2AHQ A;  1AOY A;  2L2O A;  5IT3 A;  2P8T A;  3J7Y J;  3ZQC A;  1TQM A;  3OWT A;  1ULY A;  1X2M A;  4LMY A;  2VN2 A;  1CF7 A;  3T1B A;  2HOT A;  2R7V A;  1SAN A;  3I54 A;  2WAD A;  5D6E A;  1FSH A;  2EZI A;  4YIF A;  5K5O A;  2ME6 A;  2IA2 A;  2VC0 A;  5BPI A;  3O8G A;  3JW4 A;  5E17 F;  1X4P A;  2OU2 A;  4I02 A;  3RYP A;  3DLL F;  2LDU A;  1JTX A;  3QWL A;  2H27 A;  4IQJ A;  2HU9 A;  1YLF A;  3GTG J;  2HKX A;  3HRU A;  4ZYH A;  1G59 A;  2DTZ A;  2MSY A;  2YPR A;  2ZFW A;  3B73 A;  1ZLJ A;  2VL8 A;  4DZP A;  1XSV A;  2FRH A;  1TW3 A;  2L7K A;  2R7R A;  2IW5 A;  4XSX F;  1MH3 A;  2E71 A;  2K85 A;  4AYB A;  5J6X A;  1MIJ A;  3HOY J;  1DP3 A;  4ASN A;  5CVV A;  3S1Q J;  4ZH4 F;  1ZK8 A;  3RPQ A;  3QQA A;  2WB1 N;  1ON2 A;  3LQR A;  1QVU A;  4BQO A;  2LRD A;  1W36 D;  3DU5 A;  1FYL A;  1O7L A;  3RDI A;  2CWE A;  2M1B A;  3SFI A;  2HQN A;  2W24 A;  4KMF A;  3G71 I;  4XK4 A;  1X58 A;  2IGM A;  5A2Q Z;  5LRS A;  2VBW A;  3AKZ A;  1WJE A;  3HOW J;  9ANT A;  3WGI A;  3DXJ F;  5ED4 A;  1R4N B;  3P9K A;  2GBY A;  2XV4 S;  2XPV A;  4G6T B;  4Q47 A;  3VWB A;  4M3B A;  2BZT A;  1JGS A;  4CCK A;  1IZ1 A;  2P7V B;  4KIS A;  3F8C A;  4R1H A;  5CYV A;  4DYR A;  5J4Y A;  1FEX A;  3VYT B;  1PUF A;  3FMQ A;  3W6K B;  5D5X B;  4B43 A;  3TBI A;  5JHF A;  3DEE A;  1K61 A;  2DXI A;  2CS3 A;  2NS0 A;  4G6Q A;  4HF1 A;  1GUU A;  4MFD A;  2GZW A;  3L00 A;  2EIL H;  2KPM A;  2E34 A;  3MKW B;  3O2P E;  3F72 A;  1A35 A;  3FXL A;  4XSZ F;  3CCR I;  4AM3 A;  1MBE A;  5DEQ A;  1WJC A;  1WH5 A;  2EV6 A;  2KIF A;  4N4O B;  4QPQ A;  1XMX A;  2M4G A;  3ROU A;  3S1N J;  3ZP5 A;  4HW0 A;  4UY8 I;  2K9M A;  1I39 A;  1H88 C;  2JMW A;  3GEZ A;  2QA4 I;  3ECH A;  1X1C A;  4RA2 A;  3H1C A;  4Q4Z F;  4BEH B;  2BY2 A;  2IBD A;  1QPM A;  2DT7 B;  1I3Q J;  2OCE A;  1SC7 A;  3CDH A;  2E2I J;  4IVN A;  3CMY A;  1J59 A;  2STW A;  2CO5 A;  4A0Y A;  4OIP F;  4LG0 B;  2W57 A;  3BTJ A;  3BDD A;  3EET A;  1V54 H;  1FP1 D;  1D1B A;  4HZF A;  5DV5 A;  3ONQ A;  4WK8 F;  2V6E A;  3WU1 B;  1PDN C;  3GTP J;  1N78 A;  2W25 A;  2X4H A;  3JCU C;  1R6R A;  2QEN A;  2R4G A;  5IY5 H;  1P2F A;  3KP6 A;  3O3K A;  4FQG A;  5DDG A;  4B1R A;  3VSK A;  1U5T A;  2RKH A;  1X19 A;  3BC8 A;  3F0C A;  3OYH A;  3FHZ A;  4GRI A;  3FM5 A;  5M5Y J;  1A5J A;  1RR8 C;  4YEJ A;  3OSG A;  1QGP A;  1TT5 B;  2RNJ A;  4M6X A;  3KEQ A;  2F48 A;  2CH0 A;  2P6S A;  4XR6 A;  3RCO A;  2BXZ A;  5L3C A;  2CUZ A;  5IP6 A;  1FLI A;  3EQL F;  4II2 A;  2LKS A;  2KP6 A;  3H3Z A;  4ESJ A;  3J7Z I;  1MZB A;  2EFN A;  1C0W A;  3C2H A;  3FK6 A;  3FMR A;  1IG7 A;  4RGS A;  3TKY A;  2A69 F;  1ZG3 A;  3HUG B;  5IP9 J;  2LY1 A;  3TDZ C;  3OYG A;  1AHD P;  1IN4 A;  3K1M A;  1KON A;  1J75 A;  1WJA A;  1S7E A;  3IH3 A;  3LA3 A;  1AKH B;  4HF2 A;  4I2O A;  2VJ5 A;  2F5E A;  3K4M A;  1DGW Y;  2QBY B;  3BG5 A;  3HTS B;  2VQH A;  1EV7 A;  1EH8 A;  2NNN A;  4UUT A;  2F6C A;  3ELK A;  2KDO A;  4F92 B;  2LYC A;  1W7P B;  1MNM C;  3V7C A;  1OKR A;  3AG2 H;  1VQ7 I;  3CJQ B;  1S7A A;  3FXQ A;  3PL8 A;  2EIJ H;  2NOG A;  1YQA A;  1H0M A;  2L4M A;  4A0Z A;  3REO A;  1Z9C A;  3SHF A;  3W6J B;  4A5N A;  4MEX F;  2M3A A;  2YU9 J;  2CU7 A;  1TWF J;  2A6T A;  2XAG A;  3VSL A;  2R5Y A;  2HZT A;  4GO1 A;  2O8X A;  2K7L A;  4J00 A;  1SD6 A;  4PDK A;  2ZXJ A;  4L9N A;  4CH7 A;  4ENN A;  3E5X A;  1VFC A;  1SD5 A;  1W5C C;  2E1M B;  2FEZ A;  2HOA A;  2O5R A;  3ERE D;  2ZJP F;  2OC6 A;  2DMN A;  4YG2 F;  3HB9 A;  3G4S I;  2LVS A;  4NC8 A;  4CYC B;  2V4J C;  1K78 A;  1NG6 A;  4RMN A;  2R7S A;  2H1K A;  1JXS A;  4KMU X;  2ECC A;  3CUQ C;  2XSJ C;  3DPU A;  4W97 A;  1JJ6 C;  2D5V A;  3KCC A;  3QYF A;  2QEX I;  5FB2 A;  4UVA A;  3R4K A;  3J7A O;  3CCY A;  4KUM A;  1ZR2 A;  1XSD A;  2M2E A;  1MMG A;  2X9D A;  1U8B A;  3LA2 A;  2VIX A;  1DPR A;  4F55 A;  1BW5 A;  2CQX A;  2R7X A;  5HOO A;  2Y31 A;  2P5K A;  5EEH A;  4HRI A;  5GTI C;  4LIV A;  1R5H A;  2VJ4 A;  2XAH A;  4HV6 A;  1V55 H;  4G7O F;  3H9J A;  4KJZ A;  5IT9 Z;  3GLX A;  2X51 A;  1RZ4 A;  4RB3 C;  1PP8 F;  1Y6I A;  4RM2 A;  2WY7 Q;  4JP0 A;  4RM3 A;  2CV1 A;  2Z5U A;  4OIN F;  5GTH C;  4MTD A;  2HDW A;  3JAM Z;  4XQF A;  1IRF A;  5C4J J;  3GO5 A;  4OIR F;  4O3M A;  3ECO A;  4OMZ A;  1F36 A;  2IA1 A;  3CJT B;  4ITV A;  3VOE A;  5KCM A;  5LEJ A;  3V42 A;  5FRM A;  2F4I A;  3S2H J;  2COM A;  3S1R J;  2TDX A;  1T98 A;  4ZYA A;  2J5O A;  2MD5 A;  5DTD A;  4HPQ A;  2DMT A;  3BZC A;  4U0V A;  3I71 A;  1MBH A;  4EM2 A;  4IHT A;  1BIB A;  1SVL A;  4CZZ A;  4XOP A;  1R1T A;  1MGT A;  4CXF A;  4UUV A;  1I3A A;  5CKT A;  5FLX K;  1ENH A;  3L2Q A;  2W7N A;  1S9H A;  1VQM I;  1UG2 A;  2CUE A;  3DEU A;  2D1V A;  4BJ5 C;  5HLH A;  3F6V A;  1H8A C;  4GYG A;  2NOJ B;  4EJO A;  3GLL A;  1SFO J;  3OYM A;  3OL3 A;  3QPS A;  2DPD A;  3E5U A;  5EDN A;  3KEO A;  3ESW B;  3NWS A;  1G4D A;  4UV8 A;  4B8X A;  3FWE A;  1FYM A;  4LLG F;  1Z7L A;  4CHU A;  3EDP A;  2DYR H;  5IYC J;  2R0Q C;  1W36 C;  3S14 J;  2Q1Z B;  3P9I A;  3KYC B;  3I3L A;  2KFD A;  1HBX G;  5H6Q A;  2OQR A;  2ME0 A;  2ZC2 A;  4RB0 A;  5LGT A;  3FKI J;  2TRT A;  1I6H J;  4AIH A;  1LKX A;  1RUN A;  2EK5 A;  4M3D A;  4RAG A;  3A03 A;  5EEA A;  3BP8 A;  1BJZ A;  1EKE A;  3T8T A;  1DP7 P;  4JK1 X;  2A61 A;  1ODD A;  3CUQ A;  1R9T J;  3A2K A;  1HOM A;  2GIZ A;  3OYE A;  1J5Y A;  3WGH A;  1FT9 A;  4TV7 A;  5EGO A;  3CCL I;  1YOV B;  2CG4 A;  1ETW A;  3RSN A;  4ZDL A;  4M73 A;  5JLW A;  1KZH A;  3CDI A;  4ZC3 A;  2N8G A;  3H3U A;  3CMM A;  4MQ9 F;  2DA6 A;  1Z3X A;  2BHZ A;  3VFZ A;  3TW6 A;  3GTL J;  4MFE A;  3RKX A;  3GW2 A;  3LSM A;  4KA4 A;  3GX4 X;  2W00 A;  2QYO A;  1W0U A;  1O3T A;  3CDL A;  3TP3 A;  3U2R A;  4BUP A;  5LLQ A;  3RZO J;  2BVM A;  1YJ9 I;  1HKS A;  4D0P A;  1S5L C;  3IHU A;  4MQV A;  3JR9 A;  4V2F A;  2I10 A;  1SMY F;  2CW7 A;  2LKX A;  2FD5 A;  5BMZ A;  3TMO A;  2EJR A;  1XG1 A;  5FKM A;  2AS5 F;  1FIP A;  2XPW A;  2ZNY A;  1SFX A;  1ZRF A;  1I5Z A;  2XKP A;  3HDD A;  1D5V A;  3WHB A;  3K4K A;  3Q0U A;  3ERM A;  4PJJ A;  1P7J A;  4H4K C;  4FT8 A;  1P6R A;  4LFU A;  3F22 A;  4A5M A;  2HYJ A;  1SAX A;  2E2J J;  3CD6 I;  1BR1 A;  2A05 A;  2WAQ N;  4OIQ F;  3D5L A;  3S3M A;  3BPV A;  4ZTF A;  4ZYG A;  1P9Q C;  3I53 A;  2R92 J;  1ZG1 A;  3LSJ A;  4E70 A;  3PNV A;  3GFJ A;  1IF1 A;  1H9T A;  4MIM A;  1WHU A;  3BR6 A;  2ZME C;  4O5V A;  2K4J A;  2R7W A;  2UXN A;  1LFB A;  2BY0 A;  1Z77 A;  1MNE A;  2WY8 Q;  1OCT C;  4RGX A;  2WWY A;  2M87 A;  1SVM A;  4XBF A;  5GAE J;  3L09 A;  2LRE A;  3DKW A;  1REP C;  3IH4 A;  2X6W A;  1UHS A;  5LFA A;  3ML6 A;  1EJ9 A;  3MQ0 A;  3CMA I;  2JN6 A;  3TQN A;  2JWT A;  2XPU A;  3FX3 A;  3FBN B;  2Z33 A;  2EZK A;  4BY7 J;  5IOZ A;  1GV2 A;  2NS8 A;  2HVS A;  1UG0 A;  1ETO A;  1Q1H A;  4OWR B;  1B72 A;  4U7D A;  2EV5 A;  4E7S A;  4YIR X;  3FHN A;  4OAZ A;  2R7D A;  4GCV A;  4CCO A;  2DT6 A;  1LE8 B;  3PJR A;  1HCR A;  3BR1 A;  1ORK A;  2HVQ A;  1OCR H;  4X0G A;  3QOP A;  2K3F A;  2OF7 A;  3EYI A;  2DN0 A;  3CO7 C;  2GOM A;  2K02 A;  5CVI A;  4G7H F;  1QO0 D;  1LB2 A;  4KDP A;  2EZH A;  2PQ8 A;  4QTR A;  3RQI A;  5DYM A;  2W4S A;  2V9K A;  1SFU A;  3A4C A;  4JX6 A;  2DA7 A;  2FE3 A;  3K70 D;  1BA5 A;  2VKD A;  2M0C A;  3HXL A;  2LNB A;  3OYB A;  3CCM I;  2H8R A;  4A3D J;  4OAY A;  1I6X A;  3LSG A;  1Z6T A;  5M3F J;  2MBF A;  4ENJ A;  4A3E J;  1HQC A;  3V8K A;  4NQW A;  2Y30 A;  4A3M J;  1PVE A;  2L4A A;  1HC8 A;  3AL0 C;  2ZJ2 A;  5H6R A;  2GXG A;  2KQR A;  2FJ1 A;  3DQV C;  1LDD A;  2HXO A;  1X3U A;  1X1A A;  1O57 A;  2UXX A;  2YSR A;  1BR2 A;  2AXL A;  2MLK A;  1S72 I;  2ISZ A;  1MD0 A;  5L3B A;  1N75 A;  5D8K B;  3KYL A;  3HOS A;  3N05 A;  3H3V K;  3HOZ J;  4M72 A;  4PFP A;  2F5F A;  2VQG A;  4F91 B;  3OYF A;  1G3S A;  3QYB A;  3WOD F;  4RAF A;  3I59 A;  1TBX A;  1T8I A;  1OYI A;  1U0J A;  4F7Z A;  3MWM A;  3ZMS A;  3E6B A;  2KDZ A;  2STT A;  3M4O J;  3DTK A;  3ZRG A;  4KIG A;  3JRB A;  3CCV I;  5AIP A;  4DNC A;  1UFM A;  1PJR A;  1ON1 A;  3ZOB A;  4N9I A;  3ZMZ A;  2Y0S N;  1ZRD A;  2CV2 A;  4X6A J;  3WG7 H;  2DAO A;  3WTV C;  4R79 A;  3S8P A;  4HNV A;  2EFO A;  3U21 A;  2X6X A;  1XC5 A;  4XRF A;  2YR2 A;  3I56 I;  4BYY A;  4Y7N J;  3AG4 H;  4BL0 B;  3FXO A;  3BTL A;  3A01 A;  4HLX A;  5CVU A;  3PFY A;  4WF2 A;  3CME I;  3RZD J;  2G0E A;  2ZME A;  2Q8K A;  2EFP A;  3KLN A;  1IW7 F;  1LUJ B;  2PG4 A;  3U9G A;  5M5X J;  2XC7 A;  1FTT A;  3OS2 A;  1IRG A;  3FKJ A;  3KET A;  2ELH A;  3M07 A;  5BPD A;  4BU2 A;  2F5D A;  1X1P A;  2LR8 A;  4FHT A;  1DPU A;  1OLT A;  4BDZ A;  1LEB A;  2QM3 A;  1WJD A;  4ZTJ A;  2D2W A;  2L02 A;  2V1X A;  2KLO A;  3ABM H;  2E1C A;  1L0O C;  4YFN F;  1HDP A;  5IYB J;  5GAD J;  2IGO A;  4GDF A;  2V79 A;  1YE9 A;  1E17 A;  2RAE A;  4P55 A;  2DMU A;  5E18 F;  2DW4 A;  4HX8 A;  5FKL A;  1BIA A;  4DQ2 A;  1D1A A;  2NXN B;  3M8E A;  2MG4 A;  4XRM A;  4G12 A;  2M5W A;  2M9H A;  1T2K A;  4C2T A;  1WJF A;  2DA4 A;  1UZC A;  2JVG A;  3QU6 A;  2BEO A;  2ADU A;  4N4N B;  1JJ8 C;  1T38 A;  5ILS A;  5L3G A;  5DM7 F;  5LRR A;  3ASN H;  3KP3 A;  2I5U A;  1XSX A;  5FD5 A;  1FOX A;  3LL7 A;  1JGG A;  5DCM A;  1UAA A;  4BQN A;  1A04 A;  1U6G A;  1ETK A;  1ZGW A;  4Y3O A;  1VND A;  2PEX A;  4XLP F;  1UHM A;  5KVR A;  1FBQ A;  2JPC A;  4XN3 A;  4QIW N;  2BBY A;  4L18 B;  1XTA A;  1ZN2 A;  1Z67 A;  2V6C A;  1U5T C;  3SZP A;  3C2B A;  4LK1 F;  5J40 A;  3Q0V A;  2H6B A;  3H5N A;  2PBI A;  3OYD A;  3WTX C;  2PJR B;  1RKT A;  2QSH X;  3BTC A;  1ZAR A;  2IVM A;  3E1S A;  4BQQ A;  2Z16 A;  1BI2 A;  5FJ8 J;  1WGX A;  5GPA A;  4CDG A;  3KP4 A;  3JRE A;  2L7Z A;  1KU7 A;  2VT3 A;  2F2E A;  1QZY A;  4GFB A;  3QP5 A;  3K1P A;  1SEU A;  2IGK A;  1JUM A;  2DT5 A;  2HYF A;  1Z91 A;  3Q9V A;  3F6O A;  4PK4 A;  4YFK F;  4UNO A;  2JA5 J;  1WKM A;  3DPT A;  2XUB A;  2K40 A;  1QHG A;  3E3V A;  2VB6 A;  4Z2Y A;  3R0A A;  2ZBK A;  2NAZ A;  1PP7 U;  3UKG A;  1UHW A;  3CQZ J;  2XHK A;  2RN7 A;  3HKZ N;  5CLS A;  1W5S A;  4ZJZ A;  1YJN I;  1T56 A;  4DZJ A;  5AON A;  4IOA F;  4E7H A;  5D8L B;  4L0Z B;  3F3X A;  5FLM J;  2K27 A;  4XRS A;  4BNC A;  3L9F A;  5EEG A;  4BBR J;  3PFI A;  5D5V B;  2QZ8 A;  5GP9 A;  1X1B A;  2L7M P;  3NEU A;  4BBS J;  2JZY A;  1D0Z A;  2BY3 A;  2QQA A;  3PQJ A;  3CCJ I;  1Z05 A;  4A12 A;  2BXY A;  1K4S A;  3EUA A;  3JTH A;  4CO8 A;  4H0E A;  2KIS A;  3LST A;  4D5F A;  2OJE D;  4CUG A;  2Z9O A;  3CC4 I;  2DBB A;  4ZDO A;  1YRN B;  3I59 B;  3MN2 A;  4CGZ A;  2LSO A;  4S04 A;  4D5C A;  5IYD J;  1VQ6 I;  1OPC A;  2L5Q A;  2Q2E B;  3CUO A;  3QPT A;  1SAU A;  3OIO A;  2UUZ A;  2DJI A;  3KZZ A;  1R4M B;  4RDU A;  1QU3 A;  3KPH A;  4DIQ A;  4HV5 A;  2X1E A;  4MLO A;  2RC4 A;  4U7B A;  1VQL I;  1Y0U A;  1JHF A;  3E5Q A;  2NVX J;  3EPZ A;  2QSG X;  4AVZ A;  1NK3 P;  1VZ0 A;  3GXO A;  3N97 A;  2QCO A;  1FTZ A;  1XX5 A;  4IJA A;  3G1O A;  5F0H A;  5J47 A;  1MMD A;  3L7W A;  1FOW A;  2K3P A;  2GXB A;  4EJU A;  4JX4 A;  2FOW A;  4II3 A;  1S7O A;  1FSE A;  1YFH A;  3CO6 C;  2V7F A;  5BS6 A;  3HJE A;  1SD4 A;  4MTE A;  3TED A;  2XGC A;  1DUX C;  2Q0O A;  3C2G A;  3KZI C;  2LBF A;  4JOM A;  1VQ9 I;  1ZEL A;  1RKW A;  1XDS A;  4IHY A;  2HVR A;  2RV8 A;  4LG3 A;  3BWG A;  2J5P A;  2EA4 A;  2M8E A;  3IL2 A;  1HSJ A;  1RUO A;  4IL6 C;  2MLG A;  2X6Y A;  2CV0 A;  3BZK A;  3GTK J;  1SFE A;  3OS0 A;  2OD5 A;  5LD2 C;  4L0Y B;  1S3J A;  1IN5 A;  2ID6 A;  3DV8 A;  4M3E A;  3V7R A;  4HEA 2;  1MDM A;  3BJ6 A;  4PJL A;  3CZ6 A;  3PSI A;  3O6B B;  5F0F A;  4WXD A;  2H8W A;  1S8N A;  4C3I J;  1Y8R B;  3CP8 A;  3E6C C;  1FMV A;  2ZNZ A;  3K70 C;  1D8K A;  2VAS A;  3BPX A;  5IP7 J;  4XLC A;  1YIO A;  2IXS A;  2L9R A;  1Y0N A;  3C1D A;  2LLK A;  4NC6 A;  3AG3 H;  1R1V A;  3E0J B;  3JAM K;  1L3L A;  4ZZL A;  3L2C A;  2LY9 A;  2Y2Z A;  2BV6 A;  1FOY A;  2XAJ A;  2DQR A;  4LD5 A;  1CF7 B;  2HQR A;  3ABK H;  2BHY A;  2HZD A;  3S3O A;  3V7S A;  2XF6 A;  3ZMD A;  1E2X A;  1TZL A;  3VDX A;  3EUH C;  3FBI B;  3LAP A;  2ESN A;  1WFX A;  1VI0 A;  3BRO A;  3TO6 A;  2VOP A;  3DKX A;  3HPG A;  1SMT A;  2JRT A;  2E7X A;  1JUS A;  4RAY A;  1W4M A;  4XLE A;  2M7A A;  5LHI A;  3MKY B;  5M3M J;  1QNT A;  2XF7 A;  3B6A A;  1W7P D;  4PSW A;  2R5Z A;  3K9T A;  2K9Q A;  2M45 A;  3IH2 A;  1W1W E;  4HNU A;  2MD0 A;  2QF7 A;  4DW6 A;  5D5W B;  3KX2 A;  1HKQ A;  2QKL B;  1WPK A;  1UEL B;  5TJJ A;  3ABT A;  4DBQ A;  4AYB N;  4IO9 F;  3HPH A;  3G3Z A;  4FE7 A;  4ESF A;  1RES A;  2WV0 A;  5HS7 A;  4CCJ A;  1VQK I;  4XKV A;  1LEA A;  3H9G A;  1IV8 A;  3MMY B;  5GAH J;  1MBJ A;  2ACJ A;  1NK2 P;  5ICE A;  1MH4 A;  3WE3 A;  3RTR A;  1PYV A;  2DYS H;  1HA8 A;  1R5I D;  1R36 A;  2FOK A;  4EM1 A;  2L01 A;  1RET A;  2KIM A;  1BW6 A;  1HW1 A;  4I98 B;  4M3F A;  1OFC X;  2LC2 A;  5TGT A;  3MAJ A;  1U3E M;  1RR7 A;  2YX4 A;  5D6F A;  4Y13 A;  4Y15 A;  4XIC A;  1XN7 A;  1TTY A;  4G94 A;  4Q5S F;  1DDN A;  4LB6 B;  4V19 K;  1XGS A;  2MFZ A;  5DUK A;  2X1C A;  5ICC A;  2KRC A;  2OCC H;  3FM3 A;  2AO9 A;  1YI2 I;  1IUF A;  4DBR A;  3JSP A;  3DFG A;  4B4C A;  2DI3 A;  5K7F A;  4EVI A;  3JRI A;  1PUF B;  2R93 J;  5FKN A;  3MKZ A;  3RKQ A;  3TOB A;  1E3P A;  1XCV A;  2KZG A;  2XGD A;  4B3A A;  1QZZ A;  3KP7 A;  5JHU A;  1YO5 C;  4CIC A;  2EFW A;  1P4X A;  4C9Y A;  2A68 F;  3QAH A;  2F4M B;  1X3Z B;  2WAE A;  1O3Q A;  4EJV A;  4XOR A;  1EF4 A;  2L54 A;  2KZV A;  4LIT A;  4B09 A;  4M9Z A;  1LDK B;  2VOD A;  3FF5 A;  2GWR A;  2XRO A;  2GA2 A;  1UST A;  4LGW A;  3MZ8 A;  2VXD A;  2XRN A;  1BOA A;  2LOO A;  3G1M A;  3SXY A;  3TP0 A;  2VQC A;  3GUD A;  5E79 C;  3MCZ A;  4F93 B;  2LF7 A;  3BY6 A;  4NNJ A;  4A3J J;  4NUB A;  1B9M A;  5J8C A;  5K1Y A;  3CC2 I;  3ULQ B;  4S0H B;  1R22 A;  3HOU J;  3I4M J;  4B3X A;  2HNH A;  3GTO J;  2OQG A;  2JVH A;  2CFX A;  2KRF A;  4U88 A;  3BCB A;  4YFX F;  4M71 A;  3KEY A;  1IRZ A;  4BDY A;  3HRS A;  2MH9 A;  1YTY A;  3Q0W A;  2RVC A;  4BE0 A;  4ENK A;  4XKB A;  1JKO C;  4M9S A;  1DGR M;  1N77 A;  5F04 A;  3RQ4 A;  4AUX A;  6PAX A;  3EUH A;  3LSR A;  1Z1D A;  3TW7 A;  2WV1 A;  2GXA A;  2Y0M A;  5KAF C;  5FD6 A;  4PGG A;  3IAM 2;  1CQT A;  1J9I A;  2QQ9 A;  3ZN0 A;  1S6L A;  2DMQ A;  2DFH A;  2UV1 A;  3C7J A;  1KU3 A;  2GQQ A;  2KHM A;  4G8X A;  3SQN A;  4NB5 A;  5ICG A;  5L3F A;  4IXA A;  4L9T A;  1U5T B;  1WWX A;  3K69 A;  2Y9Y A;  2XGX A;  3Q3S A;  4PJM A;  5C3E J;  3VEP A;  2FBK A;  2ZFU A;  4UHT A;  1BM9 A;  5FKO A;  3OYA A;  2CMP A;  2QKM B;  2R7O A;  4A6D A;  1NHA A;  2V1U A;  2LK2 A;  1RC9 A;  2QUF A;  4FCY A;  2P4W A;  2PMZ A;  4KIT B;  2DLL A;  3HIF A;  1D0Y A;  5F08 A;  1FP2 A;  1IC8 A;  1DU0 A;  1YYV A;  4P9U A;  2DDA A;  2L9S A;  3GME A;  4XLA A;  1SD7 A;  1Z6R A;  2XRL A;  2CQQ A;  2F4O B;  3P9C A;  1KQ9 A;  2XGE A;  3K0L A;  5F1J A;  2HQA A;  1BN5 A;  4GYI A;  4O6J A;  1E0E A;  2P7C B;  3FXU A;  1X1D A;  4BQA A;  2YUS A;  3ABL H;  5HS9 A;  5EZH A;  4LB5 A;  1PUE E;  1AA7 A;  4J01 A;  2NRA C;  1WJ5 A;  1ZGA A;  1D8J A;  2HXI A;  5KNL A;  3BG9 A;  3GYH X;  2KIU A;  1F9N A;  2Y75 A;  3BG7 A;  3KE2 A;  1B8I A;  1B6A A;  1YJW I;  1QA6 A;  1MMA A;  2EFQ A;  1HST A;  1FWZ A;  1XMA A;  1G3T A;  2MW8 A;  3KLO A;  3OIP A;  2DPU A;  1HLV A;  3QPH A;  1MJ9 A;  4EJT A;  3FZV A;  3ZXS A;  2IRF G;  4IHX A;  2CQN A;  3S15 J;  1GV5 A;  4A3C J;  4KN4 X;  1TWC J;  3OR2 C;  2R5Y B;  2XIG A;  1NG7 A;  4BHB A;  3S2W A;  1VTN C;  1OMI A;  1R49 A;  4CA0 A;  3W2V A;  3FDY A;  1GHC A;  2X85 A;  3PIP F;  2O8K A;  4B44 A;  3J80 K;  2M30 A;  1OYY A;  1JI8 A;  2PN6 A;  1YS6 A;  3LWF A;  2FML A;  4UUS A;  1K78 B;  2CQ7 A;  3K7A J;  5FLX Z;  3A0H C;  5E8I A;  4D7N A;  3HRT A;  4L9V A;  4CCL A;  2FSW A;  2XAS A;  2QVO A;  5ILV A;  1P4A A;  1XB4 A;  2LD5 A;  4R8H A;  2ETH A;  3K4N A;  3D5R C;  5F6F A;  3RKY A;  2BW3 A;  3NAU A;  3TGN A;  3LSP A;  5E3M A;  3J81 K;  2R7Q A;  1LJ9 A;  2E35 A;  1GVJ A;  4NHJ A;  1FYK A;  2RGV A;  5F0C A;  2PX9 A;  3HSE A;  2BE5 F;  1B9N A;  3ZQQ A;  2CUJ A;  2EQR A;  2P5L C;  2CSO A;  4LLN A;  4BHC A;  4E7I A;  3QPL A;  2FMY A;  2E60 A;  3AAF A;  2PMH A;  3CTA A;  4RBO A;  2QQB A;  1YX5 A;  4XRS G;  3S3N A;  1HXD A;  3V8J A;  4BXX J;  5EF6 A;  1LVA A;  2K4B A;  3WU0 A;  1Y8Q B;  1IV6 A;  5HDG A;  5C4X J;  2CW0 F;  2LMD A;  2VQL A;  1XD7 A;  2WB1 A;  4UVC A;  3P5J A;  4FX4 A;  4IPA A;  1V5G A;  4EV0 A;  2VON A;  2FNP A;  3HOX J;  4LIU A;  4G7Z F;  3V8L A;  2BYV E;  1V5F A;  3FXM A;  4HAM A;  3TOA A;  3J7A Y;  1K6Y A;  3LFU A;  3QP6 A;  4RGU A;  1USS A;  1O3R A;  4IHV A;  1IGN A;  4C30 A;  1RIO H;  4IEJ A;  3LAJ A;  3LQQ A;  2QQ8 A;  3ZQG A;  4AIJ A;  3OOP A;  4XLF A;  2DA1 A;  2DK8 A;  3DKY A;  3W6V A;  4U0Y A;  1MJB A;  5D4R A;  3PIO F;  3IC7 A;  4Y33 A;  3I0T A;  1OQY A;  1VF9 A;  5CJ9 A;  3K4B A;  1FNN A;  5D4S A;  4G9Y A;  5C44 J;  4A3G J;  3BTI A;  1J09 A;  2PLY A;  2HEO A;  1F5T A;  3SZG A;  1N25 A;  3I64 A;  4HST A;  1U9N A;  5JI6 A;  5E20 A;  2BVL A;  3HZJ A;  1FBS A;  3GFL A;  3R61 A;  2HI3 A;  1KA8 A;  3P7N A;  3S16 J;  3GZ6 A;  2XVC A;  1YG2 A;  2H94 A;  2CGP A;  1WI9 A;  1JE8 A;  3GCM A;  1H89 C;  1MW7 A;  2DOA A;  1MMS A;  3MD2 A;  2X6O A;  3TL4 X;  2IS6 A;  1K83 J;  2E1M C;  3BOQ A;  4KNY A;  2OTJ I;  2P0W A;  2IA0 A;  2JPB A;  2CFO A;  5CQE A;  4BH9 A;  4S05 A;  2CUF A;  3O8H A;  5K5Q A;  3BQZ A;  2JA8 J;  3OYJ A;  1QQI A;  1I1S A;  3S1M J;  3SFZ A;  4KYW A;  2R3S A;  4A3L J;  1F43 A;  2KKO A;  3D1N I;  2HOE A;  3LMM A;  4A3F J;  2M34 A;  3LSK A;  2YS9 A;  3CUQ B;  3GFI A;  2KIQ A;  4BEH A;  3LNQ A;  3ZMT A;  5EGO B;  1LDJ A;  2X0L A;  1MMN A;  1K7A A;  1Z0X A;  3H36 A;  4LG0 A;  2CYY A;  1F4K A;  2COB A;  3IWZ A;  1B1B A;  1TNS A;  3OOU A;  4M74 A;  1RPW A;  3BR2 A;  3OYC A;  1QPI A;  2O03 A;  3CCQ I;  1UMQ A;  2TCT A;  3G6E I;  3F8N A;  4GGG A;  1BJA A;  2MC3 A;  2B9S A;  2HKO A;  2IT0 A;  3CJN A;  5A2Q K;  3ABU A;  1A6I A;  1OCZ H;  2RQQ A;  4AVP A;  4E7L A;  1OCC H;  1WRJ A;  3CLO A;  4HBL A;  3F8B A;  3CCU I;  2M7B A;  4C2U A;  3IAS 2;  3SDB A;  3HL2 A;  2IEK A;  2AQF A;  1KGS A;  4E6K G;  5FGM A;  5HDK A;  1KYW A;  4KN7 X;  1ZHF A;  3S93 A;  5DS9 A;  3JSO A;  1ZG5 A;  5KK1 A;  1K4T A;  2K9L A;  1YS7 A;  1FJL A;  2XAQ A;  4JYK A;  5LEK A;  5HLT A;  1GDT A;  2XKO A;  4PCQ A;  2ZSH B;  5HS8 A;  1XCB A;  2A5Y B;  4M6Y A;  4XID A;  1JHH A;  2ISY A;  2M4K A;  1HW5 A;  3ISP A;  4XKW A;  2W1O A;  3PNY A;  5FFX A;  4UUS B;  4HQE A;  4NDL A;  2H1L A;  5GPC A;  1ETX A;  2DA3 A;  4HA8 A;  1AKH A;  3S17 J;  4OOI A;  4N0B A;  3E6M A;  4FX0 A;  5KAI C;  5GAG J;  2QBY A;  3NAR A;  1KU2 A;  3DF8 A;  1H9G A;  2BW3 B;  1J7K A;  5FKK A;  2BGC A;  2GOX B;  4B47 A;  1IUY A;  4EQQ A;  2O6G E;  3RJP A;  3U1D A;  3FMS A;  2ELK A;  2QGU A;  4BAY A;  1W7P A;  4JX5 A;  4MGR A;  3HOV J;  1F1Z A;  2RRE A;  1WQ2 A;  2EV0 A;  2ZB9 A;  4E7K A;  2FNA A;  5EYR A;  4RB2 C;  1TQP A;  4QPO A;  2HPM A;  5BOX A;  4M6V A;  4BE1 A;  3VOD A;  2DOD A;  3R0J A;  4AU7 A;  5JVT A;  3IV5 A;  1TWG J;  4E7J A;  4HG2 A;  2LFB A;  3WTS C;  2A3S A;  4FAS D;  1T6S A;  3PO2 J;  3I58 A;  1VQN I;  1BC7 C;  5K7Z A;  4EM0 B;  4Y17 A;  5J8F A;  2E1N A;  2ELJ A;  1I50 J;  2VKE A;  4F3Q A;  1B72 B;  3ZPL A;  2FQ3 A;  1ZGJ A;  1MJA A;  1LVK A;  2JK3 A;  4XNF A;  3DLA A;  2OA4 A;  1XS9 A;  3KP5 A;  1ZKG A;  2HTS A;  4BXF A;  5HLG A;  1Z21 A;  4CYC A;  4F52 A;  1R1U A;  4BGD A;  3S32 A;  1TP4 A;  2KT0 A;  3KFW X;  4L5E A;  1V5E A;  4A93 J;  2GLO A;  1UCR A;  5HNF A;  1KU9 A;  1BR4 A;  2BY1 A;  3HG9 A;  4NQW B;  2YU3 A;  3A02 A;  1KQ8 A;  3UNG C;  3WTU C;  4Y4R A;  5DCF A;  5FRN A;  1ITY A;  4IQ4 A;  5B66 C;  3WTT C;  3MFK A;  3GZN B;  2DU9 A;  1V4R A;  2A6H F;  3E97 A;  2G7H A;  3I4P A;  4IX7 A;  4L9J A;  3PNT A;  3FIW A;  4RLQ A;  1NH3 A;  3HTU A;  1JUP A;  3CJR B;  2O7O A;  2P5V A;  3C3W A;  2VPR A;  4A2U A;  1EH7 A;  3RIR A;  4MNU A;  5D5U B;  4BAC A;  1AU7 A;  3NWT A;  1Q1V A;  4LLL A;  1FY7 A;  4YEL A;  3HYI A;  4CZC A;  3CP2 A;  1A6Q A;  5J4V A;  3L1P A;  3PSF A;  4I0A A;  1FPQ A;  3W2A A;  3L2R A;  2FBI A;  2DDB A;  1R71 A;  2F5V A;  1APL C;  4CCM A;  1W0T A;  3H35 A;  1TNT A;  3WTZ A;  2VBY A;  2JUG A;  1QZE A;  1R58 A;  2PFB A;  4PZJ A;  1ZYR F;  1WI3 A;  4L5J A;  2MYS A;  3BR0 A;  4XOT A;  3GWZ A;  3HSF A;  3QOE A;  1STZ A;  1X4O A;  4GXO A;  4UV9 A;  3G2B A;  1OCP A;  3F9K A;  3C18 A;  1IN6 A;  2GM4 A;  2DFI A;  2JUC A;  5IOY A;  2FXA A;  3A1Y A;  2XF5 A;  1XMK A;  1IN7 A;  3ZMU A;  2VLA A;  5HOD A;  3KYD B;  3A01 B;  4A69 C;  1T33 A;  1QBJ A;  2FBH A;  3BCA A;  5J3L A;  3ZGK A;  4MHG A;  2C6Y A;  1P92 A;  5IPA A;  2ZME B;  1T0F C;  3MZY A;  2CW8 A;  4UVB A;  4NC7 A;  1XDU A;  1QRY A;  4AID A;  2VJI A;  5JR3 A;  3CF5 F;  2X48 A;  2NVQ J;  1HDD C;  3BJA A;  1NTC A;  1Y1V J;  3DTI A;  1SVO A;  3VYU B;  3F23 A;  1ZH5 A;  2W48 A;  3DU6 A;  4KT6 A;  3HM5 A;  3BG3 A;  2LG4 A;  2HDC A;  5TRD A;  4L5I A;  5L3E A;  4CYD A;  2CJJ A;  3WE2 A;  4FE4 A;  4HSR A;  1Y1W J;  2OTL I;  5IT9 K;  2A5W A;  2K5C A;  1FX7 A;  3SYT A;  3JRC A;  1G3Y A;  3MKL A;  4MO7 A;  2V9V A;  4RGR A;  1W5T A;  1Y56 A;  5CQG A;  5DD8 A;  3COA C;  3F8M A;  4EGY A;  2NVU B;  2O0Y A;  3ZCO A;  2Y9Z A;  2IS4 A;  3EUK L;  3DBR B;  4IKF A;  5EJC A;  1KYZ A;  4YRV A;  2DOE A;  2A6E F;  2HS5 A;  3IRQ A;  3ZQL A;  4QSH A;  3RPU D;  1ETY A;  3HEF A;  4P1W A;  5LGU A;  1MKM A;  4XM3 A;  2NVT J;  5DCM B;  2RQP A;  1T08 B;  2L9N A;  1OYW A;  4AC0 A;  4YII A;  3GVA A;  5K5R A;  4PSX A;  4XN0 A;  1TL8 A;  1U78 A;  3HHG A;  2JRM A;  1ZRE A;  3H0G J;  3DBH B;  3AL0 B;  1KQ0 A;  1BBY A;  3HHH A;  1XPX A;  5ICF A;  2V1N A;  3WTW C;  1IRX A;  1TWA J;  4P96 A;  2IS1 A;  1OR7 C;  2NNY A;  1Z3Y A;  1IXC A;  1POG A;  2VXZ A;  1IO2 A;  2AXT C;  3L2V A;  2JQ7 A;  3BT9 A;  4C2M J;  2KRH A;  2DMP A;  3BQY A;  4BJT A;  1LQ1 A;  4HNT A;  1FZP B;  2O3F A;  2OZU A;  2P81 A;  4N9H A;  1ETQ A;  3DEW A;  4KIF A;  4ZZD A;  1GXP A;  1OIS A;  3K2Z A;  3JRA A;  2WTE A;  1QHH D;  2DK5 A;  5F64 A;  4DGW B;  4XL9 A;  4A6E A;  2VPL A;  4HYE A;  1IXS B;  3CES A;  1TWH J;  1JKP C;  4EAT A;  3SEQ A;  2DFE A;  3BR5 A;  1MBK A;  5TIS C;  3PUB A;  2QWW A;  4RAZ A;  5LGN A;  1CGP A;  2WAQ A;  1YX3 A;  4LOC A;  2Z1D A;  3H92 A;  3GBG A;  1HW2 A;  1T95 A;  4BXU A;  3HSR A;  2ZSI B;  3SZT A;  4EEF G;  5E3O A;  3TO7 A;  3FIS A;  3HGG A;  2EH3 A;  2K9N A;  1XGN A;  4KT5 C;  2RDP A;  4G6D A;  1WCM J;  2F5C A;  5J1Y A;  2NYX A;  2FQ4 A;  2JA7 J;  3GTQ J;  3QYE A;  4LK0 F;  3M1E A;  3CLQ A;  1BC8 C;  2PI0 A;  2M8G X;  4BKX A;  1K79 A;  3PM1 A;  2EA2 A;  2E7W A;  2XB0 X;  3LSI A;  1ONV A;  1FOK A;  4HLY A;  2FU4 A;  1T0F A;  3DPL C;  3K1N A;  4U0W A;  4OMY A;  4NBQ A;  2UWM A;  4AIK A;  1YW9 A;  1HKT A;  4WWC A;  3OYN A;  2KJB A;  2V26 A;  2DFF A;  3LA7 A;  1X2N A;  4W1U A;  2E5N A;  3E6D A;  2JT1 A;  5JLX A;  5E1W A;  4C3H J;  1A31 A;  2IS2 A;  4WCG A;  4BY1 J;  2HWV A;  4ENM A;  4UB8 C;  4K2E A;  4AD9 A;  3VPR A;  1T39 A;  1Y39 A;  3NQO A;  4FET A;  2PMU A;  3PQK A;  3FXJ A;  3TO9 A;  3OV8 A;  1Z7U A;  1U9O A;  3WTY C;  2FA5 A;  2JA6 J;  4X1E A;  2DJN A;  1TC3 C;  1DQU A;  3I4N J;  3WGG A;  2YX7 A;  4AWX B;  1GLN A;  2G9W A;  3HRM A;  2KJC A;  2XAU A;  4IRH A;  3U1K A;  4B48 A;  4FIS A;  2BOL A;  3DWL E;  1LE8 A;  1ZR4 A;  1LFU P;  2QLZ A;  3BJO A;  4MEY F;  4U87 A;  4KIC A;  4UB6 C;  2EWN A;  3I9V 2;  3QOD A;  1ZRC A;  3FXR A;  3OYL A;  1BI3 A;  5J1R A;  2E36 A;  1E3O C;  2EZL A;  2JSC A;  5LHG A;  1D5Y A;  2B7E A;  3EYY A;  3OY9 A;  2JJ7 A;  3M8J A;  1UJ8 A;  1WVR A;  3GTJ J;  4PJN A;  4J19 A;  1V3F A;  3BR3 A;  1O4X A;  2L9V A;  2NVY J;  3CC7 I;  1OR7 A;  5EZG A;  2LBF B;  3M3Y J;  5H2F C;  5DM6 F;  1B59 A;  1SFK A;  2WC2 A;  5ILU A;  4P5O A;  1FIA A;  2AQE A;  3D0S A;  1TW2 A;  4I0B A;  2ZKZ A;  1XGO A;  2IPQ X;  1FBU A;  2OAZ A;  3W3C A;  3NRV A;  4CCN A;  2W82 A;  2HOS A;  2KL4 A;  3SEZ A;  1MSF C;  1G8X A;  3QU3 A;  3K4L A;  4BS9 A;  4A3I J;  3W2W A;  3LSH A;  2L3D A;  5B1A H;  5E1Z B;  1QVT A;  3IWF A;  2W85 A;  3HBL A;  4DJA A;  4EJW A;  5DD4 A;  5E8G A;  3BZ6 A;  2H09 A;  2VT2 A;  2DQL A;  2EIK H;  2JA2 A;  4RLF A;  1MDM B;  4D9J A;  2VUM J;  2E5Z A;  3SDG A;  2Y0S A;  3OS1 A;  4I6Z A;  2WBM A;  5CPR B;  1IDZ A;  3VB2 A;  2ECB A;  1IDY A;  2GAU A;  1YHQ I;  2EPF A;  2O61 A;  2E19 A;  3IP4 B;  1M1E B;  1P4W A;  1EH6 A;  2OZ6 A;  3KZY A;  4IHS A;  2VOO A;  2LTP A;  4KFC A;  3M7G A;  2EIN H;  3IRR A;  1O3S A;  2DA5 A;  3ASO H;  2CRG A;  5EG0 A;  2L0K A;  1JT6 A;  4PGH A;  3PO3 J;  3M1C A;  1MSE C;  3WG9 A;  1ACI A;  2VKV A;  2XDV A;  3N4M A;  2O9L A;  2MGQ A;  5E3L A;  2EBI A;  2IAI A;  3X2Q H;  2R7F A;  3ZQ7 A;  4A0X A;  3TDU C;  1G6N A;  5BQT A;  3RYR A;  3FXK A;  4I01 A;  4UXN A;  2HTJ A;  4I76 A;  1D3Y A;  4ESB A;  3S2D J;  2VBX A;  2VJJ A;  3B02 A;  5J1U A;  3Q9S A;  3G73 A;  2R5Z B;  3G1L A;  4WX9 A;  1U2W A;  1LNW A;  1VQP I;  1U8R A;  1MBG A;  3ZN1 A;  3AFH A;  3OYK A;  1A36 A;  2PJP A;  2V9P A;  1J0R A;  3AG1 H;  2ZJR F;  5E1X A;  1I1G A;  2Y69 H;  5HNH A;  2LF8 A;  3H0D A;  4DYC A;  2HDD A;  3DBL B;  4QLC U;  3ZR8 X;  3FK7 A;  1UB9 A;  1GT0 C;  2GIV A;  2E2H J;  4ZDP A;  3H5R A;  2QSF X;  2ZXH A;  4HQM A;  1I27 A;  2ZCW A;  5DUI A;  2DA2 A;  2VE8 A;  2V1D A;  2Y48 A;  2JTV A;  1P7I A;  5FRO A;  2ZO4 A;  4KIB A;  3BG6 A;  3T0Y A;  5HLI A;  1MND A;  1IN8 A;  5B5E C;  2MH2 A;  1VQ8 I;  4XON A;  3L2W A;  1E3H A;  1RNL A;  1LFP A;  3H5A A;  4ZYD A;  1JT0 A;  1BL0 A;  2K9S A;  2XSD C;  1XGM A;  2FF4 A;  3JRD A;  4I7H A;  2LP0 A;  2OBP A;  4DOZ A;  3M8F A;  2ZJQ F;  1YW7 A;  2KMU A;  1TT0 A;  3OSF A;  1R5G A;  4ABZ A;  2EB7 A;  2WA0 A;  3DCF A;  5B3S H;  3VYS B;  2E1O A;  4ETS A;  2VI6 A;  5CVJ A;  2HYG D;  4IRG A;  1ERD A;  3K4C A;  3T8R A;  5FLV A;  2LH9 A;  3DP7 A; 
#chains in the Genus database with same CATH homology
 3HOT A;  2LKP A;  5F1R A;  2VE9 A;  4HX7 A;  1ZAO A;  4RB1 A;  3R60 A;  5FO5 A;  4QWQ A;  2DTR A;  2Z99 A;  2H6C A;  1J2X A;  4JBA A;  3MZH A;  4I09 A;  3JTG A;  1K6O A;  1BI0 A;  3IKV A;  4BHP A;  3I5U A;  1YW8 A;  4OU0 A;  3V4G A;  3F8F A;  1IAW A;  2D45 A;  2W84 A;  5HVQ C;  3F21 A;  2MA3 A;  4ZYE A;  2G7U A;  5L3D A;  5ERI A;  4Q48 A;  1GXQ A;  2HGC A;  3GFM A;  1WSU A;  3J80 Z;  4XLN F;  4IRI A;  5H20 A;  4WXH A;  1G3W A;  2D1H A;  2K86 A;  2GA1 A;  2P6T A;  1IXR C;  3IKT A;  3MEX A;  3J81 Z;  5CVR A;  4IF4 A;  4P9F A;  3Q5F A;  4HF0 A;  2Q2E A;  4JQF A;  1AWC A;  4M9X A;  2DO7 A;  5JFR A;  1S29 A;  5AIQ A;  1FC3 A;  5LBQ A;  2Z3Y A;  1R7J A;  4EGZ A;  2UZK A;  2HFH A;  1ZLK A;  3M9A A;  4HX4 A;  4HDU A;  3QRF F;  1BI1 A;  3LFK A;  2HR3 A;  3R6S A;  4EMS A;  1B4A A;  1TQI A;  4OIO F;  1TLH B;  4RS8 A;  3GZ5 A;  2A07 F;  5LHH A;  2XAF A;  4WXC A;  2IP2 A;  3GF2 A;  2VBZ A;  4HOB A;  1RI7 A;  4LJZ F;  2VC1 A;  3KP2 A;  5HDN A;  2B0L A;  2IJL A;  1O7F A;  3RI4 A;  1R23 A;  2CQK A;  3ZMV A;  3HUG A;  5FFZ A;  4HDV A;  4ON0 A;  2ESH A;  3RPU A;  3T5X A;  3RKW A;  1R00 A;  1AOY A;  5IT3 A;  2P8T A;  1TQM A;  1ULY A;  4LMY A;  2VN2 A;  1CF7 A;  3T1B A;  3I54 A;  5D6E A;  1FSH A;  4YIF A;  5K5O A;  2IA2 A;  2VC0 A;  5BPI A;  3JW4 A;  5E17 F;  2OU2 A;  4I02 A;  3RYP A;  2LDU A;  2H27 A;  1YLF A;  2HKX A;  3HRU A;  4ZYH A;  2ZFW A;  2YPR A;  3B73 A;  1ZLJ A;  1XSV A;  2FRH A;  1TW3 A;  2IW5 A;  4XSX F;  5J6X A;  4ASN A;  5CVV A;  4ZH4 F;  3RPQ A;  1ON2 A;  3LQR A;  1FYL A;  1O7L A;  3RDI A;  2CWE A;  2M1B A;  2HQN A;  2W24 A;  4KMF A;  5A2Q Z;  5LRS A;  2VBW A;  3WGI A;  3DXJ F;  5ED4 A;  3P9K A;  2XV4 S;  4Q47 A;  1JGS A;  1IZ1 A;  2P7V B;  3F8C A;  4R1H A;  5CYV A;  3FMQ A;  3W6K B;  5D5X B;  2NS0 A;  4G6Q A;  4HF1 A;  2GZW A;  3L00 A;  3O2P E;  3F72 A;  4XSZ F;  5DEQ A;  2EV6 A;  2KIF A;  3ROU A;  3ZP5 A;  4HW0 A;  3GEZ A;  3ECH A;  4Q4Z F;  1QPM A;  3CDH A;  4IVN A;  1J59 A;  2STW A;  2CO5 A;  4A0Y A;  4OIP F;  4LG0 B;  2W57 A;  3BDD A;  3EET A;  1FP1 D;  4HZF A;  5DV5 A;  4WK8 F;  3WU1 B;  1PDN C;  2W25 A;  2X4H A;  2QEN A;  1P2F A;  3KP6 A;  3O3K A;  5DDG A;  1U5T A;  2RKH A;  3FHZ A;  3FM5 A;  1QGP A;  2RNJ A;  4M6X A;  3KEQ A;  2P6S A;  5L3C A;  1FLI A;  3EQL F;  3H3Z A;  4ESJ A;  1MZB A;  2EFN A;  1C0W A;  3FMR A;  4RGS A;  3TKY A;  2A69 F;  1ZG3 A;  3TDZ C;  1IN4 A;  3K1M A;  1J75 A;  4HF2 A;  3LA3 A;  4I2O A;  2F5E A;  2QBY B;  3HTS B;  1EV7 A;  1EH8 A;  2NNN A;  3ELK A;  1W7P B;  3V7C A;  1OKR A;  1S7A A;  3FXQ A;  1YQA A;  1H0M A;  2L4M A;  4A0Z A;  3REO A;  1Z9C A;  3SHF A;  3W6J B;  4A5N A;  4MEX F;  2XAG A;  2HZT A;  4GO1 A;  2O8X A;  2K7L A;  1SD6 A;  4PDK A;  2ZXJ A;  4L9N A;  4ENN A;  3E5X A;  1SD5 A;  2FEZ A;  3ERE D;  4YG2 F;  1K78 A;  1JXS A;  4KMU X;  3CUQ C;  3KCC A;  5FB2 A;  4UVA A;  3R4K A;  3J7A O;  4KUM A;  1XSD A;  3LA2 A;  1DPR A;  5HOO A;  2P5K A;  5EEH A;  1R5H A;  2XAH A;  4HV6 A;  4G7O F;  5IT9 Z;  3GLX A;  1RZ4 A;  4RB3 C;  1PP8 F;  2Z5U A;  4OIN F;  4MTD A;  3JAM Z;  1IRF A;  3GO5 A;  4OIR F;  4O3M A;  3ECO A;  4OMZ A;  2IA1 A;  3VOE A;  5LEJ A;  2COM A;  2TDX A;  1T98 A;  2J5O A;  2MD5 A;  4U0V A;  3I71 A;  4EM2 A;  4IHT A;  1BIB A;  4CZZ A;  1R1T A;  1MGT A;  4CXF A;  4UUV A;  5FLX K;  3DEU A;  2D1V A;  5HLH A;  3F6V A;  4GYG A;  4EJO A;  2DPD A;  3E5U A;  3KEO A;  1G4D A;  4UV8 A;  4B8X A;  3FWE A;  1FYM A;  4LLG F;  4CHU A;  3EDP A;  3P9I A;  1HBX G;  5H6Q A;  2OQR A;  4RB0 A;  5LGT A;  4AIH A;  1RUN A;  2EK5 A;  3BP8 A;  3T8T A;  1DP7 P;  4JK1 X;  2A61 A;  1ODD A;  3CUQ A;  1J5Y A;  3WGH A;  1FT9 A;  4TV7 A;  2CG4 A;  4M73 A;  3H3U A;  4MQ9 F;  3VFZ A;  3RKX A;  3GW2 A;  4KA4 A;  3GX4 X;  2QYO A;  1O3T A;  3U2R A;  5LLQ A;  1HKS A;  4D0P A;  3IHU A;  4MQV A;  1SMY F;  5BMZ A;  2EJR A;  2AS5 F;  2ZNY A;  1SFX A;  1ZRF A;  1I5Z A;  2XKP A;  1D5V A;  4FT8 A;  1P6R A;  4LFU A;  3F22 A;  4A5M A;  1SAX A;  4OIQ F;  3D5L A;  3BPV A;  4ZYG A;  3I53 A;  1ZG1 A;  4E70 A;  3GFJ A;  1IF1 A;  1H9T A;  4O5V A;  2K4J A;  2UXN A;  4RGX A;  2WWY A;  2M87 A;  4XBF A;  3L09 A;  3DKW A;  1REP C;  3ML6 A;  3MQ0 A;  3TQN A;  3FX3 A;  2Z33 A;  1Q1H A;  4U7D A;  2EV5 A;  2R7D A;  4GCV A;  3QOP A;  3EYI A;  3CO7 C;  2K02 A;  5CVI A;  4G7H F;  1QO0 D;  1LB2 A;  4KDP A;  2PQ8 A;  5DYM A;  1SFU A;  2FE3 A;  2LNB A;  1I6X A;  1Z6T A;  2MBF A;  4ENJ A;  1HQC A;  3V8K A;  4NQW A;  2L4A A;  2ZJ2 A;  5H6R A;  2GXG A;  3DQV C;  1LDD A;  1X3U A;  1O57 A;  2UXX A;  2AXL A;  2MLK A;  2YSR A;  2ISZ A;  1MD0 A;  5L3B A;  5D8K B;  3HOS A;  4M72 A;  2F5F A;  1G3S A;  3WOD F;  3I59 A;  1TBX A;  1OYI A;  4F7Z A;  3MWM A;  3ZMS A;  3E6B A;  2STT A;  4KIG A;  5AIP A;  4DNC A;  1UFM A;  1ON1 A;  3ZMZ A;  4N9I A;  1ZRD A;  2DAO A;  3WTV C;  4R79 A;  2EFO A;  4XRF A;  2YR2 A;  4BYY A;  4HLX A;  5CVU A;  4WF2 A;  2Q8K A;  2ZME A;  2EFP A;  3KLN A;  1IW7 F;  2PG4 A;  3U9G A;  1IRG A;  3KET A;  2ELH A;  5BPD A;  2F5D A;  4FHT A;  1DPU A;  1LEB A;  2QM3 A;  2D2W A;  2L02 A;  2V1X A;  2E1C A;  1L0O C;  4YFN F;  2V79 A;  1E17 A;  4P55 A;  5E18 F;  2DW4 A;  4HX8 A;  4DQ2 A;  1BIA A;  3M8E A;  2M5W A;  1T2K A;  3QU6 A;  2BEO A;  2ADU A;  1T38 A;  5ILS A;  5L3G A;  5LRR A;  3KP3 A;  5FD5 A;  1XSX A;  5DCM A;  1A04 A;  1U6G A;  2PEX A;  4XLP F;  1UHM A;  5KVR A;  1FBQ A;  2JPC A;  2BBY A;  4L18 B;  1ZN2 A;  2V6C A;  1U5T C;  3SZP A;  4LK1 F;  2H6B A;  2PBI A;  3WTX C;  1ZAR A;  2IVM A;  1BI2 A;  4CDG A;  3KP4 A;  1KU7 A;  2VT3 A;  2F2E A;  1QZY A;  3QP5 A;  3K1P A;  2DT5 A;  2HYF A;  1Z91 A;  3Q9V A;  3F6O A;  4YFK F;  4UNO A;  1WKM A;  3DPT A;  2XUB A;  3E3V A;  4Z2Y A;  3R0A A;  2ZBK A;  2NAZ A;  1PP7 U;  1UHW A;  2XHK A;  2RN7 A;  5CLS A;  1W5S A;  5AON A;  5D8L B;  4L0Z B;  3F3X A;  2K27 A;  4BNC A;  3L9F A;  5EEG A;  3PFI A;  5D5V B;  2QZ8 A;  3NEU A;  2JZY A;  2QQA A;  3PQJ A;  1Z05 A;  4A12 A;  3JTH A;  4CO8 A;  4H0E A;  3LST A;  2Z9O A;  2DBB A;  3I59 B;  4CGZ A;  2LSO A;  4S04 A;  1OPC A;  3CUO A;  3QPT A;  3KZZ A;  4HV5 A;  2RC4 A;  4U7B A;  1Y0U A;  1JHF A;  3E5Q A;  3GXO A;  3N97 A;  4IJA A;  3L7W A;  2GXB A;  4EJU A;  1S7O A;  1FSE A;  1YFH A;  3CO6 C;  5BS6 A;  1SD4 A;  4MTE A;  1DUX C;  2Q0O A;  1XDS A;  2RV8 A;  3BWG A;  2J5P A;  2EA4 A;  2M8E A;  3IL2 A;  1HSJ A;  1RUO A;  2MLG A;  1SFE A;  2OD5 A;  4L0Y B;  1S3J A;  1IN5 A;  1MDM A;  3DV8 A;  3V7R A;  3BJ6 A;  3O6B B;  4WXD A;  1S8N A;  3E6C C;  2ZNZ A;  1D8K A;  3BPX A;  1YIO A;  3C1D A;  1R1V A;  3JAM K;  1L3L A;  4ZZL A;  3L2C A;  2BV6 A;  2XAJ A;  2DQR A;  4LD5 A;  1CF7 B;  2HQR A;  3V7S A;  3ZMD A;  1E2X A;  3LAP A;  2ESN A;  3BRO A;  3TO6 A;  2VOP A;  1SMT A;  2JRT A;  2E7X A;  4RAY A;  1W4M A;  5LHI A;  1QNT A;  1W7P D;  3K9T A;  2M45 A;  5D5W B;  1HKQ A;  5TJJ A;  3ABT A;  3G3Z A;  4ESF A;  2WV0 A;  5HS7 A;  1LEA A;  2ACJ A;  5ICE A;  3WE3 A;  3RTR A;  1R36 A;  2FOK A;  4EM1 A;  2L01 A;  2KIM A;  1HW1 A;  4I98 B;  3MAJ A;  1U3E M;  4Y13 A;  2YX4 A;  5D6F A;  4Y15 A;  4Q5S F;  1XN7 A;  1TTY A;  4G94 A;  1DDN A;  4LB6 B;  1XGS A;  5DUK A;  5ICC A;  3FM3 A;  3JSP A;  3DFG A;  2DI3 A;  4EVI A;  3TOB A;  1XCV A;  1YO5 C;  1QZZ A;  3KP7 A;  5JHU A;  4CIC A;  2EFW A;  1P4X A;  2A68 F;  3QAH A;  1O3Q A;  4EJV A;  2L54 A;  4B09 A;  4M9Z A;  1LDK B;  2VOD A;  3FF5 A;  2GWR A;  2XRO A;  2GA2 A;  1UST A;  4LGW A;  3SXY A;  2XRN A;  1BOA A;  3GUD A;  3MCZ A;  2LF7 A;  3BY6 A;  1B9M A;  5J8C A;  5K1Y A;  3ULQ B;  1R22 A;  2OQG A;  2CFX A;  2KRF A;  4U88 A;  4YFX F;  4M71 A;  3HRS A;  2MH9 A;  1YTY A;  2RVC A;  4ENK A;  4M9S A;  6PAX A;  3EUH A;  1Z1D A;  2Y0M A;  5FD6 A;  4PGG A;  1J9I A;  2QQ9 A;  3ZN0 A;  1S6L A;  3C7J A;  1KU3 A;  2GQQ A;  4G8X A;  5ICG A;  3SQN A;  4NB5 A;  5L3F A;  4IXA A;  4L9T A;  1U5T B;  1WWX A;  3K69 A;  2XGX A;  3VEP A;  2FBK A;  4UHT A;  1BM9 A;  4A6D A;  1NHA A;  2V1U A;  2QUF A;  2P4W A;  2DLL A;  3HIF A;  1FP2 A;  1YYV A;  4P9U A;  1SD7 A;  1Z6R A;  3P9C A;  1KQ9 A;  3K0L A;  1BN5 A;  4GYI A;  4O6J A;  2P7C B;  3FXU A;  4BQA A;  5HS9 A;  4LB5 A;  1PUE E;  2NRA C;  1ZGA A;  1D8J A;  3GYH X;  2KIU A;  1F9N A;  2Y75 A;  3KE2 A;  1B6A A;  2EFQ A;  1HST A;  1FWZ A;  1XMA A;  1G3T A;  3KLO A;  2DPU A;  4EJT A;  3QPH A;  1MJ9 A;  3FZV A;  2IRF G;  4KN4 X;  2XIG A;  4BHB A;  3S2W A;  1VTN C;  1OMI A;  1GHC A;  3J80 K;  2M30 A;  1OYY A;  2PN6 A;  1YS6 A;  3LWF A;  2FML A;  1K78 B;  5FLX Z;  5E8I A;  3HRT A;  4L9V A;  2FSW A;  2XAS A;  2QVO A;  5ILV A;  1P4A A;  1XB4 A;  4R8H A;  2ETH A;  5F6F A;  3RKY A;  3TGN A;  3J81 K;  1LJ9 A;  1GVJ A;  4NHJ A;  1FYK A;  2RGV A;  3HSE A;  2BE5 F;  1B9N A;  2P5L C;  2CSO A;  4LLN A;  4BHC A;  2FMY A;  3AAF A;  2PMH A;  3CTA A;  2QQB A;  1HXD A;  3V8J A;  1LVA A;  2K4B A;  3WU0 A;  5HDG A;  2CW0 F;  1XD7 A;  4UVC A;  4FX4 A;  4IPA A;  4EV0 A;  2VON A;  2FNP A;  4G7Z F;  3V8L A;  2BYV E;  4HAM A;  3TOA A;  3QP6 A;  4RGU A;  1USS A;  1O3R A;  1RIO H;  3LAJ A;  3LQQ A;  4AIJ A;  3OOP A;  2DK8 A;  4U0Y A;  1MJB A;  5D4R A;  3IC7 A;  3I0T A;  5CJ9 A;  1FNN A;  5D4S A;  4G9Y A;  2PLY A;  2HEO A;  1F5T A;  3I64 A;  5JI6 A;  5E20 A;  1FBS A;  3GFL A;  3R61 A;  1KA8 A;  3P7N A;  3GZ6 A;  2XVC A;  1YG2 A;  2H94 A;  2CGP A;  1WI9 A;  1JE8 A;  4KNY A;  3BOQ A;  2IA0 A;  2JPB A;  4S05 A;  4BH9 A;  5K5Q A;  1QQI A;  1I1S A;  3SFZ A;  4KYW A;  2R3S A;  2KKO A;  2HOE A;  3CUQ B;  3GFI A;  3ZMT A;  1LDJ A;  2X0L A;  1K7A A;  4LG0 A;  2CYY A;  1F4K A;  3IWZ A;  1B1B A;  1TNS A;  4M74 A;  2O03 A;  3F8N A;  4GGG A;  1BJA A;  2MC3 A;  2IT0 A;  2HKO A;  3CJN A;  5A2Q K;  3ABU A;  4AVP A;  1WRJ A;  3CLO A;  4HBL A;  3F8B A;  1KGS A;  5FGM A;  5HDK A;  1KYW A;  4KN7 X;  1ZHF A;  3JSO A;  1ZG5 A;  5KK1 A;  1YS7 A;  2XAQ A;  5LEK A;  2XKO A;  4PCQ A;  5HS8 A;  1XCB A;  2A5Y B;  4M6Y A;  1JHH A;  2ISY A;  3ISP A;  1HW5 A;  5FFX A;  4HQE A;  4HA8 A;  4OOI A;  4N0B A;  3E6M A;  4FX0 A;  2QBY A;  1KU2 A;  3DF8 A;  1H9G A;  1J7K A;  2BGC A;  1IUY A;  4EQQ A;  2O6G E;  3RJP A;  3U1D A;  3FMS A;  4BAY A;  1W7P A;  4MGR A;  1F1Z A;  1WQ2 A;  2EV0 A;  2FNA A;  4RB2 C;  1TQP A;  5BOX A;  3VOD A;  3R0J A;  5JVT A;  3WTS C;  2A3S A;  1T6S A;  3I58 A;  1BC7 C;  4EM0 B;  4Y17 A;  5J8F A;  2E1N A;  3ZPL A;  2FQ3 A;  1ZGJ A;  1MJA A;  2OA4 A;  3KP5 A;  2HTS A;  5HLG A;  1R1U A;  3KFW X;  1UCR A;  1KU9 A;  1KQ8 A;  2YU3 A;  3WTU C;  5DCF A;  3WTT C;  3MFK A;  2DU9 A;  1V4R A;  2A6H F;  3E97 A;  2G7H A;  3I4P A;  4L9J A;  3HTU A;  2P5V A;  3C3W A;  4A2U A;  1EH7 A;  3RIR A;  4MNU A;  5D5U B;  4LLL A;  1FY7 A;  3HYI A;  4I0A A;  1FPQ A;  2FBI A;  1TNT A;  3WTZ A;  2VBY A;  1R58 A;  2PFB A;  4PZJ A;  1ZYR F;  4L5J A;  3GWZ A;  3HSF A;  4GXO A;  1STZ A;  4UV9 A;  3C18 A;  1IN6 A;  2DFI A;  2FXA A;  1XMK A;  1IN7 A;  3ZMU A;  1QBJ A;  2FBH A;  4MHG A;  2C6Y A;  1P92 A;  2ZME B;  3MZY A;  4UVB A;  1XDU A;  5JR3 A;  3BJA A;  3F23 A;  1ZH5 A;  2HDC A;  5TRD A;  4L5I A;  5L3E A;  4CYD A;  3WE2 A;  5IT9 K;  1FX7 A;  1G3Y A;  3COA C;  2V9V A;  4RGR A;  1W5T A;  5DD8 A;  3F8M A;  4EGY A;  2O0Y A;  1KYZ A;  2A6E F;  2HS5 A;  3IRQ A;  5LGU A;  1MKM A;  5DCM B;  2RQP A;  1OYW A;  4YII A;  3GVA A;  5K5R A;  1U78 A;  3HHG A;  1ZRE A;  1KQ0 A;  1BBY A;  3HHH A;  5ICF A;  3WTW C;  4P96 A;  2NNY A;  1IXC A;  2VXZ A;  1LQ1 A;  1FZP B;  2O3F A;  2OZU A;  4N9H A;  4KIF A;  4ZZD A;  1GXP A;  3K2Z A;  2WTE A;  2DK5 A;  5F64 A;  4A6E A;  4HYE A;  1IXS B;  2QWW A;  4RAZ A;  5LGN A;  1CGP A;  3H92 A;  1HW2 A;  4BXU A;  3HSR A;  3SZT A;  3TO7 A;  4KT5 C;  1XGN A;  2RDP A;  4G6D A;  2F5C A;  2NYX A;  4LK0 F;  2PI0 A;  3M1E A;  1BC8 C;  1K79 A;  2EA2 A;  2E7W A;  1ONV A;  1FOK A;  4HLY A;  2FU4 A;  1T0F A;  3DPL C;  3K1N A;  4U0W A;  4OMY A;  2UWM A;  4AIK A;  1YW9 A;  1HKT A;  4WWC A;  2KJB A;  3LA7 A;  3E6D A;  2JT1 A;  5E1W A;  4WCG A;  2HWV A;  4ENM A;  4K2E A;  4AD9 A;  1T39 A;  3NQO A;  2PMU A;  3PQK A;  3TO9 A;  3OV8 A;  1Z7U A;  3WTY C;  2FA5 A;  3WGG A;  2YX7 A;  4AWX B;  2G9W A;  3HRM A;  2KJC A;  4IRH A;  2QLZ A;  3BJO A;  4MEY F;  4KIC A;  2EWN A;  1ZRC A;  3FXR A;  1BI3 A;  2JSC A;  5LHG A;  3EYY A;  1V3F A;  1OR7 A;  1B59 A;  2WC2 A;  5ILU A;  4P5O A;  3D0S A;  1TW2 A;  4I0B A;  2ZKZ A;  1XGO A;  2IPQ X;  1FBU A;  2OAZ A;  3NRV A;  3QU3 A;  2L3D A;  5E1Z B;  3IWF A;  2W85 A;  4EJW A;  5DD4 A;  5E8G A;  3BZ6 A;  2H09 A;  2VT2 A;  2DQL A;  1MDM B;  3VB2 A;  2GAU A;  2O61 A;  1P4W A;  1EH6 A;  2OZ6 A;  3KZY A;  4IHS A;  2VOO A;  4KFC A;  3M7G A;  3IRR A;  1O3S A;  4PGH A;  3WG9 A;  3N4M A;  2R7F A;  3ZQ7 A;  4A0X A;  3TDU C;  1G6N A;  5BQT A;  3RYR A;  4I01 A;  4UXN A;  2HTJ A;  1D3Y A;  4ESB A;  2VBX A;  3B02 A;  3Q9S A;  3G73 A;  4WX9 A;  1U2W A;  1LNW A;  1U8R A;  3ZN1 A;  2PJP A;  1J0R A;  5E1X A;  1I1G A;  2LF8 A;  4QLC U;  1UB9 A;  2GIV A;  4HQM A;  1I27 A;  2ZCW A;  5DUI A;  2VE8 A;  2V1D A;  2Y48 A;  2JTV A;  2ZO4 A;  4KIB A;  3T0Y A;  5HLI A;  1IN8 A;  2MH2 A;  1RNL A;  4ZYD A;  1XGM A;  2FF4 A;  4I7H A;  2OBP A;  3M8F A;  1YW7 A;  1R5G A;  2EB7 A;  4ETS A;  5CVJ A;  2HYG D;  4IRG A;  3T8R A;  3DP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...