2V7FA

Structure of p. abyssi rps19 protein
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
149
structure length
139
Chain Sequence
b'ATVYDVPGDLLVERVAQRLKEIPEIKPPEWAPFVKTLPEQEDWWYYRVASILRRVYLDGPVGIERLRTYYGGGHAPERFYKAGGSIIRKALQQLEAAGFVEKVPGKGRVITPKGRSFLDKIATELKKELEEIIPELKKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RPS19E SSU RIBOSOMAL PROTEIN S19E
publication title Molecular Basis of Diamond Blackfan Anemia: Structure and Function Analysis of Rps19.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Ribosomal protein
total genus 46
structure length 139
sequence length 149
ec nomenclature
pdb deposition date 2007-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01090 Ribosomal_S19e Ribosomal protein S19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2700 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2v7fA00
2V7FA 3J7AY
chains in the Genus database with same CATH superfamily
3BTJA 2JSPA 3BR2A 5D8KB 1OKRA 1C0WA 4PFOA 4I0AA 5ICEA 3BDDA 3TW6A 5HLTA 4HF1A 1K7AA 4CCMA 2F5VA 2Y2ZA 2WB1N 2XVCA 3FBIB 1XX5A 2JMWA 3E3VA 2DMUA 1TQPA 2KT0A 1SFUA 5L3EA 2CW0F 1RPWA 2EPFA 3KP5A 3W2VA 4PGHA 3CD6I 3WTTC 5LRSA 5HDNA 1N75A 1SANA 5DTDA 4IHSA 2JQ7A 1UCRA 2NXNB 4YIFA 3DPTA 2O8XA 4F52A 2KISA 4Y17A 4CCNA 3HL2A 3WTWC 2XKOA 1LB2A 1WQ2A 3HB9A 1W4MA 2M45A 2KKOA 1X58A 5F27A 2DFEA 2QQAA 3N05A 5FROA 3ZRGA 1S3JA 5BQTA 1UFMA 4CCJA 2XF5A 1GUUA 4MFEA 2QWWA 3KP6A 3SDBA 1BN5A 4IXAA 2ADUA 1PDNC 3M8JA 1ZH5A 5EYRA 1FP1D 3M7GA 1GV5A 2C6YA 1K79A 3M1CA 4KN7X 1T0FC 4M3DA 5KCMA 3GX4X 3NQOA 1A36A 2DT5A 4IO9F 2IA1A 2R5ZA 5CPRB 4NDLA 2WAQN 1OLTA 2QUFA 2MBFA 4DZPA 4LIUA 4ZTJA 3HG9A 1WFXA 1ONVA 1X4OA 2VJIA 1STZA 4A3BJ 3CCRI 1WKMA 2RC4A 3CDIA 2W84A 1O3QA 2XASA 4Z6YA 2BY3A 3S3OA 3A0BC 2ESNA 3G4SI 2Y0SN 1MNMC 4FETA 4BE1A 3CUQC 1P92A 2BY2A 2JZYA 4RMNA 5FLMJ 3HOTA 1IG7A 3VEPA 1SD5A 2M0MA 4PK4A 1S7EA 2LKXA 1NK3P 4R1HA 3PNYA 2JUCA 3WU2C 5LGNA 2LDUA 1MJBA 2K7LA 2XRNA 5J4YA 3LA7A 3A0HC 1VFCA 1HKTA 4F93B 1HF0A 2KRFA 1DPUA 1LDJA 1TQMA 4DZJA 1Z6TA 3QPSA 1O3TA 1I27A 3IUOA 1U2WA 1I1SA 5EZHA 3EETA 3T0YA 4B48A 2HVQA 5BNGA 2HZDA 3O8GA 2EFOA 4L5JA 2AS5F 4C2MJ 1D5VA 1T33A 2HGCA 4XORA 3GTJJ 3FXQA 3CUOA 5H6RA 1PVEA 3Q5FA 3K4LA 1D1BA 3K70D 3VWBA 1BW5A 3ZQIA 4M6VA 1CF7A 5E1WA 3H9QA 3HOVJ 3AFHA 3ZPLA 2V6EA 5FFZA 1FSEA 2K3PA 2PG4A 3K9TA 3S17J 1I3AA 1P4XA 5TISC 2F5EA 2KZVA 3RDIA 4ZZLA 4E7KA 3EUHC 1P9QC 2IAIA 2E7WA 1FTTA 2WB1A 3FXOA 1D1CA 2P7VB 2WA0A 2MABA 4BJ6C 4BL0B 2D2WA 2FE3A 2L5QA 2ZJ2A 3GO5A 1GVDA 3LSJA 2CO5A 3TQNA 4EM1A 1PYVA 4BQAA 1VI0A 1CGPA 3IAM2 2H09A 2HXIA 1A6QA 2DFFA 3OMYA 4MQ9F 5IY5H 2VOPA 1DQUA 2GQQA 3JRHA 2FBHA 5D8LB 4XQFA 4HNVA 4NC8A 5IP7J 3I9V2 2L01A 1IRFA 2PX9A 1P6RA 2R7OA 4XOPA 4XRSA 2H27A 4GGGA 4A6EA 5KAFC 3V7RA 5LHGA 1RKTA 1WJEA 4HEA2 1REPC 4XSZF 2EIKH 2K9SA 4XLFA 3AG4H 1J59A 2HDWA 4XR6A 3QYBA 1SD4A 2ZJRF 2AO9A 4A3KJ 2HOTA 1ZG1A 5FKMA 3ESWB 1H88C 1G4DA 2RQQA 3CLOA 5EEHA 2CQQA 1T0FA 2JVHA 2JK3A 3HRUA 3O6BB 4UVAA 4A3GJ 5IYDJ 2UV1A 3HSEA 4A3FJ 3I4NJ 2RREA 3MCZA 1W5SA 2WAQA 3WTXC 2LMDA 1JKOC 3CCQI 1K4TA 1BA5A 1LKXA 2V26A 2FF4A 3D5RC 2JPBA 1W36C 3GEZA 1HCRA 4F7ZA 4BXFA 3WTYC 2WTEA 1V5EA 4QPQA 2DDAA 4PUSA 1AA7A 2QQBA 5E8GA 4ENJA 2DQLA 2XAUA 4M3GA 1B59A 2CQXA 4BBRJ 4DOZA 1R5GA 1D8KA 3DKYA 2O61A 4Y33A 1QQIA 4BDZA 4C3HJ 3GUDA 3P9KA 4FISA 3JRCA 4BHCA 5L3CA 2F4IA 2W85A 3W2AA 1CQTA 1P4WA 4DYCA 2DA6A 5F64A 1IN4A 1XG1A 2L4MA 4ENMA 2Y48A 4S04A 2P4WA 4G9YA 4Y13A 2L7MP 4U0VA 3U1DA 2IS2A 4OIOF 3K4MA 5F0HA 1RUOA 3BG3A 2O7OA 1BI3A 4KFCA 1QVUA 3CCMI 1X3WB 2PQ8A 2VC1A 4RDUA 1QA6A 2E71A 1DDNA 1LFPA 1IDYA 3EUHA 2FRHA 1D0ZA 2A05A 4M6XA 1YE9A 3O8HA 2XSDC 1F4KA 3KYDB 2EFWA 4HA8A 4OIRF 3RKQA 4AM3A 5FD5A 2X6WA 1TW3A 3VSLA 4UB8C 1G8XA 1NH3A 3A4CA 3FXUA 3WGGA 4M3FA 4XRFA 3ZQFA 2GOMA 5FKOA 1U78A 3BY6A 2CS3A 1G3SA 5FKLA 2ZCWA 4IX7A 1R5ID 1R36A 4HSTA 2EA2A 1D8JA 4G6QA 5BPDA 2LG4A 5HLGA 5F1JA 3S1QJ 5D6FA 4BUPA 1T38A 4ZDLA 4LD5A 3PFIA 3ZMZA 2XUBA 4JBAA 4W97A 1U0JA 2JVGA 1O3SA 3OYIA 4IOAF 1HQCA 1UG2A 3WE3A 5L3GA 4BHBA 3C2BA 4PJLA 3SFIA 1I1GA 1K83J 2QBYA 4XSXF 2Q2EA 4UV9A 1S5LC 1WJFA 1ON2A 2Y31A 5B1AH 5F08A 5GP9A 3FX3A 3AG3H 3EUKL 3BG9A 3JRGA 1JUPA 3HYIA 4NNJA 2FJ1A 3KETA 2DLLA 2BHZA 4UV8A 4PJ0C 3DU5A 1XGOA 3TBIA 3I59B 4IHXA 4IHWA 4RBOA 3KZYA 4X0GA 1MDMB 2HR3A 3LNQA 4YFNF 4G12A 3DPLC 1XCBA 4M9ZA 1Y0NA 2MH2A 2P6TA 4L9NA 1NHAA 3ZMUA 1KU3A 2YX7A 2MYSA 1EV7A 3KP3A 4CYDA 1VTNC 2BY0A 1A35A 1BI0A 3PQJA 1JJ8C 4RLFA 2H6BA 3H9GA 5J40A 5HNHA 2R7RA 3HTUA 3H0GJ 3JRFA 2NVQJ 3CCVI 3QWLA 2HFHA 2E7XA 3F22A 4NC6A 2VKHA 2LREA 3BTLA 4Y7NJ 4WX9A 1E3OC 2Z5UA 5E1XA 3KIOA 2KDOA 1QBJA 1GVJA 1O3RA 2MC4A 2VPRA 2QF7A 1MBEA 1FMVA 4RGUA 2DJIA 5DYMA 3L2CA 3GTOJ 4DJAA 2CUEA 4M73A 1S7AA 2E1OA 2ZKZA 1DPRA 4PCQA 1KYZA 1QZYA 5E18F 3BZKA 2KZGA 1DGRM 3SZTA 2F4MB 4L18B 2QZ8A 2CYYA 1DP3A 1YIOA 3WTSC 2HOEA 4EGZA 1EKEA 3HOZJ 1W7PD 4XIDA 4KISA 2KJCA 2GIVA 3OIOA 2OBPA 4DBRA 3IKTA 3CJTB 1YIJI 2HI3A 4ZDPA 3U21A 4E6KG 3HTSB 1H9GA 3TDUC 3ABKH 4ZYHA 2F48A 2W57A 2CH0A 1TT0A 4C2TA 4AC0A 2Z2SB 2E2JJ 2LY1A 1J0RA 2HPMA 3CESA 1OYWA 3HOUJ 4WK8F 3DEUA 3DTIA 5H6QA 4RB0A 3FZVA 1Z7LA 1JTYA 1T98A 2GXAA 2R7TA 4V2FA 3ZQQA 1JJ6C 4LLNA 3Q0WA 3I71A 1ZKGA 3OYMA 4A3MJ 1K6OA 4K2EA 2GZWA 1FMWA 1JHFA 2LNBA 1SMTA 3TOBA 3LFUA 3JTGA 3Q9SA 3ZQCA 1ZRCA 1OMIA 2CSOA 3RPQA 1LVKA 2X4HA 3HIFA 3SYTA 3E6DA 3JAMK 1JGGA 2LC2A 4AU7A 3IWZA 4NQWA 4UB6C 1JGSA 4G7ZF 1ERDA 3PSFA 4N4OB 2W82A 1ITYA 2LOOA 5L3DA 1IJWC 3HM5A 4CICA 5L3FA 2FOKA 2HDCA 3TL4X 1S7OA 2YX4A 3CF5F 5C44J 3DBHB 4B44A 3TO9A 1QZEA 3QRFF 3RYRA 4BE0A 4P1WA 4HBLA 1OCRH 3ELKA 4ZDOA 4O3MA 2LY2A 4CCKA 4U0YA 4OIPF 3PFYA 2CJJA 2ZFWA 4V2GA 5J1UA 5J3LA 2XPVA 4CCOA 1IN7A 3WU1B 1WJDA 3HRSA 4LK1F 2MW8A 4L9JA 4D5CA 1MBHA 2XAHA 1J7KA 1HKQA 2B9SA 5HS7A 1Y6IA 2IBDA 1X1CA 1B72A 4PFPA 2A5YB 4XLPF 2VT3A 2P5KA 4HPQA 3V8JA 3E6BA 1ZARA 3E5QA 3S1RJ 1APLC 2DI3A 1POGA 1WVRA 2FU4A 3BG6A 3QPHA 2OZ6A 1H0MA 3U1KA 3EPZA 4BU2A 1X19A 3MQ0A 2X51A 5GAHJ 3TEDA 1ZQ3P 4JQFA 2RAEA 1YITI 5EEAA 1KONA 2BYVE 1TWGJ 3M9AA 2E60A 3W6KB 2P6SA 4OMZA 4L0YB 2BV6A 1JT0A 3LL7A 2V7FA 4RLQA 1IV6A 2OQRA 2JWTA 3LQQA 4II3A 4GYGA 2WWYA 3RKWA 3RSNA 5GTHC 2WBMA 1XSDA 2GM4A 3HSRA 4D5FA 1ON1A 2QENA 1FOXA 1TQIA 2IS1A 1WCMJ 1KU2A 2V9VA 5E20A 4A0XA 2ZXJA 2DT6A 3CTAA 5IT9K 2A6TA 2IGNA 3OYFA 2VPLA 4OMYA 4CXFA 3COAC 2QGUA 1HKSA 3BG7A 1VQKI 1UJ8A 4EJOA 3QYEA 3OWTA 2K9NA 4CUGA 5F0FA 3GTGJ 2Q2EB 1R5HA 1W0UA 1IAWA 4RA2A 3F72A 3WU0A 2E34A 1ORKA 2CQNA 3TGNA 2QA4I 3LFKA 1XMXA 3L2QA 4UUTA 4KITB 1EH6A 2VBWA 1WI9A 2Z16A 3F8CA 1IDZA 4OAYA 4PSWA 3FM3A 5GPCA 2L9RA 1T56A 3B73A 3WTZA 4HYEA 3BLYA 4DYRA 2DXIA 4BE2A 3H0DA 3S3MA 2M4KA 1TT5B 2K85A 3DLLF 1O57A 3GW2A 3LSKA 1ETWA 3QP5A 3LMMA 1N25A 5IP6A 2L7KA 3RPUA 3J81Z 4FT8A 1BOAA 1GXQA 3FISA 3B6AA 4ESFA 5JLXA 2DBBA 3BOQA 3VB2A 1R6RA 2F5FA 3R6SA 4WXHA 2Y9YA 5LRRA 4IEJA 5E8IA 1MMAA 2L2OA 2M5WA 2VASA 5B3SH 1XTAA 3ZCOA 3GFLA 2DMTA 3HKZN 2XF6A 3J80Z 3H3VK 1IXSB 3A03A 2ZC2A 4ANJA 3KE2A 3F0CA 2DPDA 2IW5A 2RDPA 2V1NA 2NVXJ 5FJ8J 3GFIA 3VYUB 2OUMA 4G7OF 3I4MJ 1TZLA 3MKLA 3OR1C 3OYCA 5CYVA 1IN8A 1TLHB 3FKIJ 3OYDA 4H0EA 4GDFA 2EZLA 5K7FA 2O5RA 4XLAA 2OQGA 5EDNA 5FLVA 3I56I 1R58A 3P9CA 4J01A 1BOBA 1FY7A 5EG0A 4YIRX 3ZQ7A 4IKFA 1FBQA 4Y15A 1IGNA 3K4BA 3MKYB 3HZJA 4N9HA 4OAZA 3KP2A 3PL8A 4BH9A 1MBKA 2EV0A 2OPTA 1R23A 2JA6J 2DMPA 2HOAA 2VJ5A 1ETKA 3PNTA 2ZNZA 5CVJA 2GA2A 4LGWA 2KJBA 4KN4X 2KIFA 5LFAA 4MFDA 4R79A 2X6OA 3R60A 1FLIA 3CCLI 2W25A 1B9MA 1F9NA 3HOYJ 4NQWB 3MAJA 3S93A 3HPHA 4QWQA 2VOOA 2I5UA 1BC8C 4XICA 2HPIA 4XKWA 2ELKA 3ABLH 2RKHA 1YS6A 4AWXB 3J7AY 1R00A 2UXXA 3K1MA 4RAFA 3ERED 1Y1WJ 4XBFA 4YRVA 1J75A 2PMZN 1BM9A 2CV2A 3LA2A 3BCAA 5EZGA 4MEXF 1D0YA 2P81A 1I50J 4Z2YA 5K7HA 3QYFA 2PJRA 1BJZA 2VKDA 3I53A 4IVNA 2NS8A 4S0HB 4EEFG 5LEJA 4UUSA 2E35A 3TDZC 3M3YJ 4A6DA 1E3PA 1R22A 2R93J 1HW1A 3GLXA 2HNHA 1LVAA 2COBA 3UKGA 4A2UA 4EM2A 1JKRC 2WY8Q 5M3FJ 4XN0A 1O4XA 1WJAA 4L9VA 1B72B 6PAXA 2XGXA 2OJED 3AKZA 1ZK8A 1AU7A 2EH3A 3G6EI 2FNAA 2HQNA 2NS0A 1AHDP 1YJWI 1X1PA 2BXYA 1H8AC 3MMYB 3OR2C 4PJJA 1LFBA 2VQLA 4XLEA 1ZR2A 4ESBA 3H5AA 3HKZA 1UAAA 3F21A 2EV6A 3GXOA 5A2QZ 4WWCA 3V4GA 3CMEI 4EATA 1MKMA 1FBSA 4O6JA 4M6YA 1XS9A 3T5XA 2FD5A 3REOA 1FEXA 2COMA 3DKXA 1VNDA 3WG9A 2ZSIB 3ZMSA 3D1NI 1J5YA 3BZ6A 3LSRA 3FBNB 1MBFA 2G7UA 3B02A 2ZJQF 2LF7A 5GADJ 3S14J 2Z1DA 4F91B 4HLYA 2EZHA 2R7WA 2VJ4A 3CO6C 4IRGA 1B9NA 1G3YA 3KPHA 3SEZA 1GXPA 1A31A 4MLOA 3QPTA 3GMEA 1WH5A 3JRBA 3JRIA 2MD5A 2OA4A 3I59A 4LG0A 4BHPA 2XGDA 1MDMA 1UHSA 1V3FA 3AG1H 2PI0A 4FHTA 1EH8A 2AXTC 4QPOA 3HRMA 3J7YJ 3V7CA 2NOJB 1F5TA 2ZO4A 2PEXA 2Y75A 5FO5A 3DQVC 3UNGC 2HQ5A 5LGUA 2PJPA 1N78A 4LMYA 1XSVA 3AAFA 4A3JJ 1K61A 3CJQB 2CQKA 1JE8A 1E3HA 1YLFA 2XAJA 4KA4A 1SD7A 2IEKA 4BJ5C 3FK6A 4ZYEA 1PP7U 2H6CA 4LIVA 2CU7A 2EIJH 2JA8J 2PN6A 2F2EA 2R7FA 3I55I 3F6VA 3DEWA 4CZCA 2E36A 1XN7A 2BW3B 2HYGD 1RR8C 2R7SA 1BI2A 2PMZA 2FBKA 2R7QA 3AL0C 4D7MA 2K02A 1RUNA 3ZXSA 4RM2A 1RC9A 2KRHA 3LQRA 4ENNA 2GA1A 2HYFA 4JK1X 3SZGA 4UVBA 4BXUA 5HS8A 3MKZA 2NVYJ 1LUJB 5GPAA 1FT9A 1YHQI 2Z3YA 2EZKA 4DW6A 1HXDA 2VBYA 2HU9A 2V9PA 5HOOA 2H8WA 2LD5A 1YW7A 3V42A 1W5CC 1I6HJ 1IXRC 1VZ0A 1BI1A 2KLOA 3FMQA 3D0SA 3CF2A 2F4OB 4KIFA 2JT1A 2ZBKA 3S2WA 3I0TA 5HDKA 3GFMA 2H1KA 1BR1A 3OYJA 4O5VA 2VONA 2EJRA 3RKXA 5EG0B 2R5YB 2Y0MA 3IL2A 1R4MB 4XM3A 3L00A 4J00A 5D5VB 3A02A 1BC7C 2EBIA 3QU6A 4Q5SF 3QQAA 2JPCA 5KNLA 1SEUA 4XONA 1AKHB 1E0EA 3I64A 4FCYA 3F6OA 2OTJI 5E3MA 2XV4S 2R4GA 4KT5C 2HQAA 3FIWA 4A3IJ 1XGSA 4NUBA 1EA3A 4XN3A 3ECHA 4B1RA 2VKEA 4NC7A 1F43A 2FEZA 3L2VA 1R1UA 1IN6A 4CO8A 1JHHA 3GTLJ 4HLXA 1Q1VA 3F3XA 3KFWX 2OU2A 1BBYA 4IOCF 2NNYA 1UG0A 5FLXK 2CQ7A 2VT2A 4BNCA 4P96A 2GBYA 4I99C 4GO1A 3Q9VA 4N9IA 5BOXA 3PNVA 4BY7J 1U8RA 2FA5A 1ACIA 2WY7Q 2X1DA 2VXDA 1LE8B 3LOCA 1Y8QB 2MA3A 1YO5C 2B63J 2NOGA 5FKNA 2A68F 3SHFA 2PJRB 2JA7J 4Q47A 5DUKA 4JX6A 3MFKA 3DF8A 2K4BA 4UUSB 1NG6A 4KIBA 1R1TA 2CV0A 2CFOA 4GRIA 3DBLB 3HBLA 2MSYA 3I5UA 1F1ZA 4I6ZA 1I3QJ 2VODA 1AWCA 1LPQA 3S8PA 2ID6A 2FQ4A 4HRIA 3OY9A 2EWNA 2DA2A 2ZMEB 5LLQA 3P5JA 1KZHA 4RGRA 3A01A 1OCTC 2H8RA 1SVOA 2XHKA 2JRMA 5EGOB 5F04A 3GBGA 1VQMI 3EQLF 4EQQA 3SEQA 2KL4A 2RV8A 2DTRA 1A04A 2LLKA 2LF8A 1QO0D 2NVUB 4KICA 4N4NB 5D5XB 2A5WA 3BQYA 2LK2A 4I2OA 1O7FA 3ZN0A 2BY1A 2XSJC 3LAPA 1YOVB 4R8HA 3TO6A 1JT6A 3BT9A 1B4AA 1ETXA 1PJRA 4V19K 4JX4A 2LBFB 3K2ZA 2B7EA 2X9DA 2DA7A 4PSXA 4PZJA 4XKVA 2R0QC 2VQGA 2ESHA 3Q0VA 4HF0A 5IT3A 5J8FA 4PJNA 1FX7A 1FWZA 3OL4A 3S2HJ 2Q0OA 3CMMA 3E0JB 2TCTA 2OCEA 3LA3A 4LG0B 3I58A 3ZQLA 2QKLB 1G2HA 3K4JA 1OYYA 4HNTA 3D5LA 1DUXC 1DGWY 2YU3A 1R49A 4C2UA 5ICFA 4CDGA 2DJNA 2P0WA 2M4GA 2TDXA 4XLCA 3FKJA 4C3JJ 4LG3A 2KDZA 3E6CC 1SC7A 2VI6A 1H89C 3HOSA 2P5LC 1IV8A 1WHUA 2CMPA 2ELJA 2KIQA 3BR3A 3F8MA 3M4OJ 2ELHA 2RQPA 4L9TA 1UHWA 2EILH 1YG2A 2HTSA 2QSGX 1T2KA 1Z77A 3HUGA 1Z6RA 4AYBN 2QEXI 3GF2A 1Y1VJ 2MD0A 3FXMA 3GZNB 1HSJA 1ZR4A 1RI7A 1NTCA 3KP4A 5J6XA 2XROA 1Z1DA 2IT0A 2EK5A 4PGGA 3LSPA 3CC4I 3BZCA 5HLHA 3LSHA 4IF4A 3CMAI 1RETA 4FASD 2PMUA 4AUXA 1R7JA 1X1DA 3IKVA 4ZH4F 1Q1HA 2L9SA 5HLIA 3G71I 1VQ7I 3KP7A 1D1AA 1XMKA 2FXAA 5H2FC 1SAUA 2E2IJ 1YRNA 3ZR8X 2AQFA 3NAUA 4BY1J 3KEOA 4BAYA 3CP2A 5J8CA 2J5PA 3U9GA 3SQNA 2UUZA 5KAIC 3ZOBA 1YJNI 4A12A 1IC8A 1S72I 4KYWA 1MNEA 3MZYA 4Y52J 5TGTA 2VQCA 5IOYA 1FYMA 3I54A 2QM3A 3OOUA 1DP7P 1HDPA 1YJ9I 3WHBA 1MSFC 2HS5A 1ODDA 3NARA 4BBSJ 4BEHA 5DEQA 2NYXA 2QVOA 4II2A 4BDYA 2EA4A 2G7HA 4ETSA 5FB2A 3CJRB 2GXGA 1HW5A 3FWEA 1MNDA 2RNGA 1FIAA 2R7XA 5FGMA 2CW8A 3DEEA 3SXYA 3HPGA 5JVGF 2QLZA 1UELB 2KPMA 2WAEA 4A93J 2VJJA 2EIMH 5F0CA 1R71A 4HV5A 2ZJPF 3DWLE 3KLNA 3U2RA 4X1EA 1ZTRA 4HZFA 2ISZA 4CCLA 1HLVA 4GYIA 2STTA 4M72A 3KEYA 1ZRFA 3DCFA 3I4PA 2MLGA 1SAXA 4U7BA 1S8NA 4M9XA 1WH7A 1VQ6I 2K3FA 2ZNYA 1G59A 4PDKA 2GWRA 4LB6B 1MMGA 1P2FA 1N77A 1M1EB 3E97A 1B1BA 4BQNA 4N0BA 4UHTA 2L0KA 3EUAA 4ZYAA 3QU3A 3FDYA 1VQOI 3VSKA 4IHTA 4XOTA 3LSIA 2XGEA 4HNUA 5JHFA 5ICGA 4A0YA 3CZ6A 3CDLA 1U5TC 4M3BA 3C3WA 4EGYA 1RZ4A 5CVUA 2ECCA 1FIPA 2M87A 3CC2I 2L9VA 4JX5A 3TO7A 1KU9A 3K10A 4AYBA 2YS9A 1FJLA 3CMYA 3VOEA 1WWXA 2VKVA 1YX3A 4HOBA 4RS8A 2GXBA 4G6DA 2VBXA 4DNCA 3EDPA 3QPLA 1YYVA 3SZPA 4I7HA 1YX5A 3KX2A 4P9FA 1V54H 2BEOA 1SVMA 3ABUA 3A01B 1PUEE 4A5MA 3S1MJ 3C2GA 2V1XA 5DS9A 5DDGA 2DO7A 1K4SA 3AL0B 2X1EA 3H92A 4EVIA 3OYAA 1ZYRF 1ZGJA 3BR0A 3DBRB 3LSGA 2ME0A 2LR8A 3L2RA 4J19A 2A07F 2KHMA 4HX4A 2ZXHA 1IN5A 2Z33A 3IH3A 4A5NA 1IUFA 2HDDA 3E6MA 9ANTA 1YI2I 3VODA 2VQHA 3GTMJ 3DTKA 1TWAJ 3P9IA 3MEXA 4C9YA 5LHIA 4ITVA 4CHUA 2VIXA 3GVAA 3F8FA 4MO7A 3LWFA 3MZHA 1OQYA 3S3NA 4BACA 1TNSA 2X0LA 1MBGA 1P7IA 5FKKA 2DW4A 2R7UA 3CDHA 3HOWJ 3L9FA 2M3AA 1QHHD 3JRDA 2VN2A 1DU6A 2CUFA 4UVCA 4XNFA 1TWHJ 5L3BA 3FK7A 3S32A 2CG4A 4LITA 3J80K 2XPWA 1WSUA 3H9JA 1U9NA 3NWSA 4QTRA 1MMSA 3SFZA 3TMOA 4E7JA 1T6SA 4HAMA 3O3KA 3EYYA 3SDGA 1P7JA 1UHMA 4BXXJ 2HTJA 2BW3A 2F6CA 3HUGB 4XL9A 2ZMEC 3HGGA 1FZPB 1ZG3A 4BQOA 1SMYF 2EV5A 1JUMA 1QNTA 3WTUC 2DYSH 2JJ7A 4LJZF 3X2QH 5JLWA 2EFPA 2DU9A 3NWTA 3PO3J 3JRAA 2VE8A 5LEKA 1U8BA 5IT9Z 4A3DJ 4I09A 1MH3A 1U5TA 2DA1A 2X48A 2EQRA 2E1MB 1ZELA 2VB6A 1QVTA 1FPQA 2FOWA 2M8EA 3CCJI 2D5VA 3KZZA 2FMYA 3ML6A 5LGTA 1YRNB 3B6CA 3F23A 1MZBA 5CQGA 3DU6A 4X6AJ 4RB2C 1IXCA 2QKMB 2LKPA 5JI6A 3BJOA 4ZC3A 2ACJA 3ZMDA 4WXDA 5TRDA 3LSTA 4FTHA 2XAFA 1ZLKA 2IGKA 3HXLA 1ETOA 2DA4A 1TNTA 3VYSB 3C18A 2XDVA 1ZGWA 4XKBA 4BEHB 3K4KA 5ICCA 4HF2A 3OV8A 3ABMH 2R5YA 1W5TA 1LDKB 2KIUA 3BWGA 2L02A 4FE4A 3MKWB 1QGPA 1X3ZB 2A61A 1FYLA 4HQEA 5DV5A 2LH9A 3T8RA 1AKHA 1EH7A 4NBQA 2BBYA 1FC3A 4ZJZA 4HV6A 3W6JB 4AVZA 4IHYA 3M1EA 4LB5A 3S16J 2A6HF 2O8KA 5FRNA 3HHHA 2IXSA 2P8TA 2J5OA 3DPUA 4CGZA 1BIAA 2A69F 2E5ZA 4HQMA 3IHUA 2X6YA 3H35A 5F1RA 5K7ZA 5ED4A 2E5NA 2R7ZJ 2MFZA 2M7AA 3OSGA 2BVMA 1WJ5A 1OR7C 1KQ0A 1A5JA 3BP8A 1DU0A 2K5CA 3JREA 5KK1A 1JTXA 4LK0F 4BKXA 4IL6C 2NAZA 5B1BH 4AIHA 4ZYDA 2H1LA 3ISPA 2OD5A 2E1NA 4UUVA 2AHQA 2DOEA 4RB3C 2HKXA 2XRLA 1Z67A 4DQ2A 4A3LJ 3GZ6A 2YU9J 2MG4A 4HW0A 1ENHA 1LE8A 4XRMA 2Z99A 5CVVA 5DCMA 2YPRA 5A2QK 2K9LA 1FNNA 3LAJA 2H94A 3R4KA 2MGQA 2VE9A 3IRRA 2M0CA 1W36D 3MWMA 5DD8A 3DFGA 3DXJF 3BJAA 2KQRA 1IW7F 3JSPA 1IRZA 1MIJA 1QRYA 2B0LA 5M5XJ 2Y69H 4BQQA 2NVTJ 1H9TA 1KYWA 1W7PA 2WC2A 2QSHX 1FOWA 3RZOJ 1FSHA 2ZMEA 2F5DA 2FMLA 1P4AA 5EGOA 2MH9A 1HW2A 2O0YA 2DODA 1G3TA 3BR6A 1SFKA 2GOXB 3DV8A 4MIMA 4XLHA 5EJCA 2DMNA 2ICWG 3OOPA 4I98B 5F6FA 2HOSA 1ZAOA 4ON0A 2ME6A 3TKYA 1W0TA 3MN2A 3K0LA 2ECBA 2XAGA 1WPKA 2HYJA 2Y9ZA 2IRFG 5HODA 4MQVA 1ZG5A 5IYCJ 4UXNA 3H1CA 2VLAA 3N4MA 4AIKA 1J9IA 1ETYA 5E3OA 1TBXA 4RAGA 2M34A 2HXOA 3KYLA 1MH4A 3S15J 2LBFA 2VL8A 3L2WA 1B8IB 2BOLA 2OAZA 3KYCB 3LSMA 3BTCA 2NNNA 1FTZA 1L0OC 2YR2A 3GZ5A 2PLYA 2L3DA 4LOCA 1NK2P 1T39A 1Y56A 3TW7A 2V79A 3K1PA 4IRIA 3L7WA 3JR9A 2V1DA 1WZ2A 3OYNA 2E19A 1KGSA 3ASNH 4E70A 2P7CB 4U88A 3G1LA 1QU3A 4CH7A 3ULQB 3PQKA 2EZIA 4WCGA 2HEOA 2W48A 1Z21A 5ILSA 3RTRA 2K27A 5B66C 1ZREA 3JTHA 4I01A 3WG7H 3ZQGA 3IAS2 4W1UA 1X1BA 1ZHFA 3GWZA 1D5YA 3CCUI 2G9WA 1LQ1A 5D5UB 3G73A 1V55H 4D0PA 1OR7A 2QYOA 1VQ9I 5DD4A 1Z7UA 2OF7A 1GHCA 2L7FP 4E7IA 2OTLI 4OINF 1XGNA 4E7LA 2M2EA 2QQ8A 1SFEA 2G0EA 4A69C 2QCOA 2W1OA 3AG2H 2RNJA 4B8XA 1S6LA 4A0ZA 5HVQC 2WADA 2LTPA 5JVTA 4HDUA 4ABZA 2ZXIA 2KRCA 4F55A 2KMUA 2BVLA 3A2KA 1RR7A 2MLKA 1V5FA 4JYKA 4I76A 5J1YA 2CGPA 1GV2A 4OIQF 3FM5A 3OIPA 5HS9A 3PO2J 5C4XJ 3HC7A 2FX0A 4XKCA 1S9HA 1ULYA 2EFNA 3IH4A 4MNUA 1FYKA 5CVIA 1MJAA 3F8BA 4E4HA 1O7LA 1MBJA 1U5TB 2GIZA 4D7NA 1IO2A 3C7JA 3H3ZA 3RI4A 3J7AO 3VDXA 2FQ3A 4TV7A 1OFCX 1NG7A 2R92J 3P7NA 3F9KA 2RVCA 3CCSI 3BROA 3GCMA 2VUMJ 2DTZA 3VFZA 2R7DA 4CYCB 1J2XA 3V7SA 3EYIA 1AOYA 2DYRH 1ZLJA 1ZN2A 3E5XA 2UZKA 4B47A 4EJWA 5FRMA 2YUSA 5D5WB 3BJ6A 3HEFA 3R0AA 5E3NA 5HDGA 2LKSA 4EJTA 2OC6A 1HOMA 4AIJA 4FQGA 5LHHA 3H3UA 3E5UA 4P55A 3S1NJ 5C4JJ 1YFHA 3H5NA 4OU0A 4PJMA 3RQ4A 1KQ8A 1HC8A 3KLOA 1LJ9A 1OPCA 1R1VA 5IYBJ 2CUJA 2F5CA 2R7VA 2GAUA 4XRSG 1LFUP 1VQ8I 2I8DA 3OS1A 2A6EF 1IZ1A 4NB5A 2DT7B 2XF7A 4S05A 3FXJA 3TP3A 4D1QA 3CCYA 4G6TB 4EMSA 5DCFA 5BMZA 4YFKF 1QZZA 2Y30A 3BPXA 2L9NA 1X4PA 3G1OA 3WHCA 2LP0A 2BE5F 4KIGA 4ZZDA 3OS0A 2XPUA 4KJZA 3CUQA 5JR3A 1UZCA 3GTQJ 2IGOA 3VYRB 2Y0SA 5FD6A 1XDSA 4YEJA 3OYEA 2DFHA 2JRTA 3SJMA 4B3AA 5D4SA 4D9JA 5J1RA 2FSWA 2WAFA 4ASNA 5D4RA 3BR5A 3R61A 1Y0UA 3MD2A 5DM7F 3H5RA 1YW8A 1HSTA 2DK8A 3M8EA 2M9HA 1PUFA 4M3EA 1D3YA 2VC0A 1XMAA 5AIPA 3N97A 2E1MC 1OCZH 1WJBA 3K2AA 3R0JA 3BC8A 3O2PE 4I02A 3DKWA 5DCMB 3E7LA 3FMSA 5CLSA 3BCBA 4HG2A 5BS6A 4CZZA 2DOAA 2LRDA 5AONA 4G7HF 1OJLA 1BR2A 2CV1A 3G2BA 3NEUA 3OIQA 2HVSA 1OCCH 2W24A 2CFXA 2XB5A 2IS4A 1WJCA 3HJEA 1JXSA 3NRVA 1TL8A 1JKQC 1TP4A 3T8TA 2NS7A 5E79C 3RPUD 1IUYA 5J47A 2V6CA 1W7PB 2M1BA 3WGIA 2WV1A 2JA2A 3RIRA 4Y3OA 3DTEA 1YS7A 4LLGF 4WXCA 3K7AJ 1EJ9A 2EB7A 3PSIA 3CP8A 1XD7A 3RQIA 3L1PA 1Z3YA 1K78A 3G3ZA 1YW9A 2K9QA 2O6GE 3KCCA 3HHGA 3M8FA 1Z0XA 3QOEA 2W00A 2L7ZA 2W7NA 1HA8A 2O03A 3ZGKA 5LD2C 5C3EJ 4ESJA 2DA5A 1V5GA 3QOPA 4MEYF 3KEQA 3K70C 3RYPA 1XPXA 3OYKA 2K86A 4AD9A 3W6VA 2R5ZB 1Z05A 3G1MA 5JHUA 5FLXZ 1RNLA 4YG2F 3CO7C 4UNOA 1BW6A 2BXZA 5B5EC 1MMNA 2K40A 2W4SA 4AVPA 2IGMA 3IH2A 3HGYA 1T8IA 4QIWN 2L54A 4RM3A 3CC7I 3IWFA 1TWFJ 4KDPA 1GDTA 1FP2A 4I0BA 3UR3C 4Y4RA 3WODF 5E1ZB 4NHJA 2FUG2 2M7BA 4P9UA 3F8NA 4F92B 4U0WA 5EEGA 3IC7A 3IV5A 3L2UA 1MD0A 1X2NA 4QLCU 1EF4A 3PUBA 4CSWA 2EFQA 2ZXWH 5CVRA 5K1YA 1FOYA 3PIPF 2EINH 2ETHA 4ZTFA 5JFRA 3FHZA 2QBYB 3PIOF 1MSEC 1K6YA 3BQZA 2DQRA 2VBZA 3C1DA 4JOMA 4IHVA 2DA3A 1PP8F 1XCVA 2KIMA 5E17F 5CQEA 5E3LA 4YIIA 3K4CA 1XC5A 2BHYA 2QQ9A 4YFXF 1A6IA 2HQRA 3ASOH 1D0XA 2BZTA 4Q48A 4RB1A 2CUZA 2HKOA 3PUFA 3T1BA 2HZTA 4H4KC 1CF7B 3JW4A 1VQLI 3GTKJ 2LYCA 3BR1A 3HRTA 3WTVC 2DPUA 3W3CA 2JN6A 4OWRB 3FXKA 3DP7A 4OOIA 1XB4A 2K4JA 3E1SA 2V4JC 1TW2A 1WGXA 2JUGA 4A3CJ 2IP2A 3FF5A 3H36A 2HWVA 1U3EM 1MGTA 2RN7A 3CCEI 1UB9A 3BTIA 5M5YJ 2IVMA 4C3IJ 2KFDA 4MTDA 5HNFA 1LEBA 1VQ4I 1Z9CA 2I10A 3BG5A 2V1UA 1ZGAA 2DDBA 1W1WE 2V9KA 3ZN1A 2DN0A 1LEAA 4XK4A 1I6XA 4DGWB 5BPIA 4E7HA 1BIBA 3M07A 3ONQA 4RGSA 1SFXA 2JTVA 3FXRA 3W2WA 5K5RA 1KU7A 4MTEA 1JI8A 4GXOA 1X1AA 2XB0X 3TP0A 1X3UA 2JSCA 3GTPJ 1I5ZA 1B6AA 4IRHA 3QP6A 4L5EA 5H20A 3K1NA 2GLOA 5CKTA 4B4CA 2D1HA 2IA2A 3IP4B 3C2HA 3HOXJ 1UMQA 1YTYA 3S2DJ 1TC3C 3FXLA 4F3QA 1JUSA 4AIDA 2M8GX 1QPMA 1E17A 3Q0UA 3CUQB 3MVPA 2OCCH 4BGDA 4IZZA 4LLLA 4HDVA 1E2XA 4HX8A 3L09A 4U7DA 1MW7A 4RAZA 2RGVA 1HDDC 3RZDJ 4EJUA 4MGRA 4M74A 1PUFB 1F36A 4B43A 3DLAA 2AQEA 2DFIA 2OZUA 1Y39A 2UWMA 3WGHA 1XGMA 3OSFA 4KNYA 5AIQA 4E7ZA 3KZIC 2O3FA 2TRTA 2ZFUA 1KQ9A 2IPQX 4DIQA 1MMDA 1FOKA 2STWA 5K5QA 2ZB9A 3FHNA 2LVSA 2XAQA 1JKPC 2ZSHB 5K5OA 1VQPI 1BJAA 4A3EJ 5DUIA 2ID3A 1R4NB 1MJ9A 1SVLA 4KT6A 4EM0B 2Z9OA 3JCUC 3JAMZ 5IOZA 1VQ5I 4M71A 2CW7A 4BYYA 5GTIC 1G6NA 2DMQA 2KP6A 3I3LA 2E1CA 1FBUA 5LBQA 3Q3SA 5GAGJ 1K78B 3OYLA 4DYQA 2ISYA 2CWEA 4EV0A 1G3WA 4RAYA 2PFBA 4G8XA 4IPAA 3RJPA 1B8IA 3J81K 4UY8I 2X85A 3PJRA 4L0ZB 5KVRA 1SFOJ 2PBIA 2DOFA 4HSRA 4FE7A 1T95A 3FMRA 2LY9A 2K9MA 3IRQA 3OL3A 3ECOA 5IP9J 5J4VA 4IQ4A 3RCOA 2FBIA 1RKWA 1WI3A 2MC3A 4WF2A 4C30A 1YQAA 3BPVA 2OV7A 3OS2A 4EJVA 1OISA 4P5OA 1TTYA 4ENKA 4KUMA 1GLNA 2E2HJ 4B3XA 4U87A 5D6EA 2IJLA 1LDDA 2L4AA 1L3LA 2DCEA 3JSOA 4KMUX 1OYIA 5ILVA 1LNWA 1Z3XA 2D1VA 2Q1ZB 3RKYA 4YELA 5KHDA 2Q8KA 4Q4ZF 1ETVA 2XKPA 3K69A 3TOAA 3GFJA 1RESA 1U9OA 5M5WJ 4QSHA 2D45A 3ZMTA 1X2MA 3MZ8A 3CQZJ 2XIGA 1ZRDA 1KA8A 4JP0A 3K4NA 2XGCA 4CA0A 3GYHX 1OCOH 1USTA 2QSFX 4FX4A 1RIOH 2WV0A 1QPIA 3A1YA 2JA5J 1IRXA 1U6GA 3QODA 2LFBA 2AXLA 5CJ9A 5EF6A 1IRGA 4BS9A 1VQNI 4XLNF 1XDUA 1USSA 4HX7A 2VXZA 1Y8RB 1Z91A 2YSRA 1SD6A 3VYTB 3ZP5A 4KMFA 2P5VA 1RRJA 2HVRA 3VPRA 3ERMA 3J7ZI 2DAOA 1XSXA 1HBXG 4FX0A 4MHGA 4GFBA 3V8KA 5ERIA 1WRJA 1TWCJ 1R9TJ 1J09A 4G94A 1VF9A 3ZMVA 1S29A 1IF1A 1BR4A 5DM6F 1GT0C 2DK5A 5GAEJ 4E7SA 1T08B 2UXNA 1I39A 2IS6A 4IJAA 4CYCA 1BL0A 4RGXA 3OYBA 4M9SA 4XMYA 2N8GA 2X6XA 3HSFA 2LSOA 4B09A 4LFUA 3D5SC 3ABTA 5IPAA 2IA0A 3GLLA 3V8LA 2NRAC 4GCVA 3K6GA 5FFXA 2A3SA 3ROUA 1QHGA 2CRGA 5TJJA 3HDDA 2O9LA 3PM1A 4DBQA 3WE2A 3CJNA 5M3MJ 2XC7A 4L5IA 4BJTA 1OCPA 2BGCA 1V4RA 3QAHA 4IQJA 2FNPA 3ZQHA 4ZYGA 2PMHA 2R3SA 3CLQA 1ETQA 3OYGA 5ILUA 2M30A 2X1CA 3OYHA
chains in the Genus database with same CATH topology
4E4HA 1X1CA 2JSPA 4PFPA 4HPQA 3CMMA 4PFOA 3E0JB 3VDXA 5HLTA 2QKLB 4CCMA 1NG7A 3K4JA 3BG6A 3D5LA 4HNTA 1DGWY 4C2UA 2F5VA 3F9KA 3EPZA 3FBIB 4BU2A 1X19A 2P0WA 2M4GA 2X51A 4XLCA 3FKJA 4LG3A 4JQFA 3HOSA 1KONA 2E60A 2CMPA 2ELJA 4B47A 3W2VA 5FRMA 3LL7A 2V7FA 4RLQA 2OC6A 1N75A 4II3A 3RSNA 3DPTA 2WBMA 4F52A 2MD0A 3H5NA 4PJMA 3RQ4A 4CCNA 2IS1A 2CUJA 2R7VA 3HL2A 2I8DA 3OS1A 2DT6A 2A6TA 3LSHA 2IGNA 2DT7B 2XF7A 3OYFA 2VPLA 4FASD 4D1QA 3BG7A 1X1DA 4G6TB 3N05A 5FROA 3ZRGA 2L9SA 3QYEA 3OWTA 4CCJA 2L9NA 4CUGA 1D1AA 1SAUA 1X4PA 2Q2EB 3ZR8X 2AQFA 2XF5A 3SDBA 3OS0A 4KJZA 3M8JA 2IGOA 3CP2A 3VYRB 2Y0SA 3L2QA 4KITB 2IS6A 3M1CA 4YEJA 3OYEA 1T0FC 2Z16A 2UUZA 4OAYA 4PSWA 5KCMA 4D9JA 2WAFA 3BLYA 1MNEA 2DXIA 5CPRB 3MD2A 5TGTA 3H0DA 2VQCA 4BE2A 1OLTA 3H5RA 3S3MA 2M4KA 3OOUA 3LSKA 4LIUA 4ZTJA 3HG9A 1WFXA 1X4OA 3LMMA 4BEHA 2L7KA 2VJIA 2E1MC 4II2A 4BDYA 1WJBA 3CJRB 3S3OA 3BC8A 1MNDA 2RNGA 2R7XA 3BCBA 2CW8A 3DEEA 4HG2A 4FETA 1R6RA 4BE1A 3HPGA 2DOAA 2LRDA 4RMNA 1UELB 2KPMA 1BR2A 2WAEA 3HOTA 3G2BA 2CV1A 3OIQA 2VJJA 2HVSA 2M0MA 4PK4A 2IS4A 1MMAA 1WJCA 2L2OA 3DWLE 3PNYA 4CCLA 3RPUD 2VASA 4F93B 3ZCOA 3KEYA 2JA2A 4Y3OA 3DTEA 2XF6A 4U7BA 4ANJA 3IUOA 3PSIA 3CP8A 2V1NA 1G59A 4B48A 1Z3YA 2HVQA 2HZDA 1MMGA 3QOEA 1N77A 2W00A 4XORA 4BQNA 2W7NA 1HA8A 3K4LA 1D1BA 3ZGKA 3VYUB 3K70D 2OUMA 5LD2C 3VWBA 3EUAA 4ZYAA 1TZLA 3FDYA 1V5GA 3H9QA 3AFHA 3OR1C 3VSKA 3K70C 4XOTA 3LSIA 3OYCA 2K3PA 3OYKA 2V6EA 4HNUA 3OYDA 4E7KA 2KZVA 5JHFA 2O5RA 3EUHC 1P9QC 4XLAA 2WB1A 4J01A 1D1CA 1MMNA 3CZ6A 2W4SA 1BOBA 2IGMA 2MABA 2WA0A 4BJ6C 4BL0B 2L5QA 4IKFA 4RM3A 1PYVA 3IAM2 3K4BA 3UR3C 3MKYB 4Y4RA 3OMYA 4OAZA 2FUG2 2M7BA 1DQUA 4F92B 3L2UA 3PL8A 4XQFA 3K10A 4AYBA 3PUBA 4NC8A 3I9V2 2VJ5A 4CSWA 2R7OA 4XOPA 3PNTA 1YX3A 4ZTFA 1WJEA 4HEA2 5LFAA 4R79A 1K6YA 1YX5A 4XLFA 3KX2A 2HDWA 4XR6A 4JOMA 3QYBA 4NQWB 5CQEA 3HPHA 3S93A 3C2GA 3AL0B 2X1EA 2HPIA 3K4CA 4XKWA 3OYAA 2RQQA 3L2RA 3J7AY 3LSGA 2JVHA 1D0XA 2UV1A 2KHMA 2CUZA 4YRVA 2ZXHA 2CV2A 3BCAA 4H4KC 2RREA 2VQHA 1D0YA 3DTKA 2WAQA 3QYFA 4C9YA 4ITVA 2LYCA 2PJRA 2VKDA 2VIXA 1LKXA 2V26A 3S3NA 3W3CA 4BACA 3D5RC 4OWRB 2HNHA 1W36C 3E1SA 2V4JC 4BXFA 2R7UA 2JUGA 2WY8Q 2M3AA 1V5EA 4QPQA 4XN0A 1WJAA 1QHHD 1AA7A 4PUSA 2XAUA 4XNFA 3S32A 4LITA 4DOZA 3DKYA 3AKZA 4Y33A 4BDZA 3H9JA 5HNFA 3MMYB 2F4IA 3OR2C 2VQLA 4PJJA 3NWSA 4XLEA 3W2AA 2V9KA 3TMOA 4E7JA 3H5AA 3HKZA 4DGWB 1UAAA 4E7HA 2IS2A 4EATA 3ONQA 3W2WA 3K4MA 2BW3A 2F6CA 3HUGB 3DKXA 4XL9A 2ZSIB 1JI8A 1X1AA 4BQOA 3FBNB 2Z1DA 1LFPA 5CKTA 4F91B 2R7WA 1D0ZA 3IP4B 2VJ4A 3C2HA 1YE9A 3NWTA 3SEZA 4MLOA 4F3QA 2E1MB 1ZELA 2X6WA 2VB6A 3VSLA 1G8XA 3A4CA 5CQGA 4QPOA 3DU6A 2NOJB 2QKMB 4BGDA 4IZZA 4ZC3A 2GOMA 1MW7A 3DQVC 3UNGC 2CS3A 2IGKA 1N78A 3HXLA 4IX7A 3VYSB 3CJQB 4B43A 2XDVA 4HSTA 3DLAA 2AQEA 4XKBA 4BEHB 3K4KA 2UWMA 2LG4A 1LDKB 4BJ5C 4BUPA 4LIVA 3MKWB 4ZDLA 4E7ZA 2ZFUA 2LH9A 1U0JA 1MMDA 2JVGA 4AVZA 4DIQA 4ZJZA 3OYIA 4CZCA 2BW3B 3FHNA 4PJLA 5FRNA 2ZSHB 2IXSA 2R7SA 3DPUA 2E5ZA 2PMZA 2X6YA 3H35A 2R7QA 4KT6A 3AL0C 2E5NA 1WJFA 2MFZA 2M7AA 3ZXSA 4RM2A 2BVMA 2KRHA 1WJ5A 1OR7C 2CW7A 3EUKL 4NNJA 2KP6A 3SZGA 2K5CA 3I3LA 3MKZA 3DU5A 3TBIA 3OYLA 2HU9A 5HOOA 4X0GA 3V42A 2X85A 1VZ0A 3PJRA 2KLOA 3DPLC 3CF2A 4HSRA 2K9LA 2MYSA 1T95A 2K9MA 3OL3A 4IQ4A 3RCOA 1BR1A 1W36D 4RLFA 3OYJA 3H9GA 4C30A 2OV7A 5HNHA 3OS2A 4P5OA 2R7RA 2KQRA 1GLNA 4B3XA 2VKHA 4XM3A 4J00A 4BQQA 2LREA 4U87A 5KNLA 2KDOA 4XONA 1E0EA 2DCEA 2MC4A 1FMVA 1Z3XA 2DJIA 4DJAA 2Q1ZB 4YELA 2R4GA 2HQAA 1SFKA 2GOXB 4XLHA 5KHDA 4NUBA 1EA3A 4XN3A 4NC7A 1DGRM 1DP3A 3L2VA 3K4NA 4CA0A 3A1YA 1IRXA 4KISA 4DBRA 3QODA 2VLAA 1UG0A 4ZDPA 3U21A 4E6KG 4BS9A 2CH0A 1TT0A 4C2TA 2Z2SB 2VXZA 2LY1A 3PNVA 3KYLA 2LBFA 2VL8A 3VYTB 3L2WA 2HPMA 3CESA 2BOLA 2WY7Q 2X1DA 2VXDA 3LSMA 2HVRA 3DTIA 1Z7LA 1J09A 2PJRB 1Y56A 2R7TA 3ZQQA 1NG6A 3OYNA 3OYMA 2CV0A 2CFOA 1BR4A 4GRIA 1QU3A 4CH7A 1FMWA 4E7SA 3LFUA 3S8PA 1LVKA 3OYBA 3SYTA 3OY9A 4HRIA 1Z21A 4XMYA 3RTRA 2X6XA 2LC2A 4AU7A 3IAS2 1X1BA 1ERDA 3PSFA 3D5SC 3GBGA 4N4OB 2W82A 2LOOA 3SEQA 2KL4A 3K6GA 4E7IA 4E7LA 1QHGA 3TL4X 4N4NB 2W1OA 4DBQA 2A5WA 5HVQC 2WADA 4B44A 2XC7A 2ZXIA 2KRCA 4P1WA 4BJTA 4F55A 4BE0A 4ZDOA 2KMUA 2BVLA 3A2KA 4IQJA 2XSJC 2LY2A 4CCKA 1V5FA 3PFYA 3OIPA 1PJRA 3HC7A 2LBFB 4CCOA 4XKCA 4XKVA 4PSXA 3OYGA 1WJDA 1S9HA 2VQGA 2X1CA 3OYHA 4PJNA 3OL4A 1Y6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V7F A;  3J7A Y; 
#chains in the Genus database with same CATH topology
 3BTJ A;  2JSP A;  3BR2 A;  5D8K B;  1OKR A;  1C0W A;  4PFO A;  4I0A A;  5ICE A;  3BDD A;  3TW6 A;  5HLT A;  4HF1 A;  1K7A A;  4CCM A;  2F5V A;  2Y2Z A;  2WB1 N;  2XVC A;  3FBI B;  1XX5 A;  2JMW A;  3E3V A;  2DMU A;  1TQP A;  2KT0 A;  1SFU A;  5L3E A;  2CW0 F;  1RPW A;  2EPF A;  3KP5 A;  3W2V A;  4PGH A;  3CD6 I;  3WTT C;  5LRS A;  5HDN A;  1N75 A;  1SAN A;  5DTD A;  4IHS A;  2JQ7 A;  1UCR A;  2NXN B;  4YIF A;  3DPT A;  2O8X A;  4F52 A;  2KIS A;  4Y17 A;  4CCN A;  3HL2 A;  3WTW C;  2XKO A;  1LB2 A;  1WQ2 A;  3HB9 A;  1W4M A;  2M45 A;  2KKO A;  1X58 A;  5F27 A;  2DFE A;  2QQA A;  3N05 A;  5FRO A;  3ZRG A;  1S3J A;  5BQT A;  1UFM A;  4CCJ A;  2XF5 A;  1GUU A;  4MFE A;  2QWW A;  3KP6 A;  3SDB A;  1BN5 A;  4IXA A;  2ADU A;  1PDN C;  3M8J A;  1ZH5 A;  5EYR A;  1FP1 D;  3M7G A;  1GV5 A;  2C6Y A;  1K79 A;  3M1C A;  4KN7 X;  1T0F C;  4M3D A;  5KCM A;  3GX4 X;  3NQO A;  1A36 A;  2DT5 A;  4IO9 F;  2IA1 A;  2R5Z A;  5CPR B;  4NDL A;  2WAQ N;  1OLT A;  2QUF A;  2MBF A;  4DZP A;  4LIU A;  4ZTJ A;  3HG9 A;  1WFX A;  1ONV A;  1X4O A;  2VJI A;  1STZ A;  4A3B J;  3CCR I;  1WKM A;  2RC4 A;  3CDI A;  2W84 A;  1O3Q A;  2XAS A;  4Z6Y A;  2BY3 A;  3S3O A;  3A0B C;  2ESN A;  3G4S I;  2Y0S N;  1MNM C;  4FET A;  4BE1 A;  3CUQ C;  1P92 A;  2BY2 A;  2JZY A;  4RMN A;  5FLM J;  3HOT A;  1IG7 A;  3VEP A;  1SD5 A;  2M0M A;  4PK4 A;  1S7E A;  2LKX A;  1NK3 P;  4R1H A;  3PNY A;  2JUC A;  3WU2 C;  5LGN A;  2LDU A;  1MJB A;  2K7L A;  2XRN A;  5J4Y A;  3LA7 A;  3A0H C;  1VFC A;  1HKT A;  4F93 B;  1HF0 A;  2KRF A;  1DPU A;  1LDJ A;  1TQM A;  4DZJ A;  1Z6T A;  3QPS A;  1O3T A;  1I27 A;  3IUO A;  1U2W A;  1I1S A;  5EZH A;  3EET A;  3T0Y A;  4B48 A;  2HVQ A;  5BNG A;  2HZD A;  3O8G A;  2EFO A;  4L5J A;  2AS5 F;  4C2M J;  1D5V A;  1T33 A;  2HGC A;  4XOR A;  3GTJ J;  3FXQ A;  3CUO A;  5H6R A;  1PVE A;  3Q5F A;  3K4L A;  1D1B A;  3K70 D;  3VWB A;  1BW5 A;  3ZQI A;  4M6V A;  1CF7 A;  5E1W A;  3H9Q A;  3HOV J;  3AFH A;  3ZPL A;  2V6E A;  5FFZ A;  1FSE A;  2K3P A;  2PG4 A;  3K9T A;  3S17 J;  1I3A A;  1P4X A;  5TIS C;  2F5E A;  2KZV A;  3RDI A;  4ZZL A;  4E7K A;  3EUH C;  1P9Q C;  2IAI A;  2E7W A;  1FTT A;  2WB1 A;  3FXO A;  1D1C A;  2P7V B;  2WA0 A;  2MAB A;  4BJ6 C;  4BL0 B;  2D2W A;  2FE3 A;  2L5Q A;  2ZJ2 A;  3GO5 A;  1GVD A;  3LSJ A;  2CO5 A;  3TQN A;  4EM1 A;  1PYV A;  4BQA A;  1VI0 A;  1CGP A;  3IAM 2;  2H09 A;  2HXI A;  1A6Q A;  2DFF A;  3OMY A;  4MQ9 F;  5IY5 H;  2VOP A;  1DQU A;  2GQQ A;  3JRH A;  2FBH A;  5D8L B;  4XQF A;  4HNV A;  4NC8 A;  5IP7 J;  3I9V 2;  2L01 A;  1IRF A;  2PX9 A;  1P6R A;  2R7O A;  4XOP A;  4XRS A;  2H27 A;  4GGG A;  4A6E A;  5KAF C;  3V7R A;  5LHG A;  1RKT A;  1WJE A;  4HEA 2;  1REP C;  4XSZ F;  2EIK H;  2K9S A;  4XLF A;  3AG4 H;  1J59 A;  2HDW A;  4XR6 A;  3QYB A;  1SD4 A;  2ZJR F;  2AO9 A;  4A3K J;  2HOT A;  1ZG1 A;  5FKM A;  3ESW B;  1H88 C;  1G4D A;  2RQQ A;  3CLO A;  5EEH A;  2CQQ A;  1T0F A;  2JVH A;  2JK3 A;  3HRU A;  3O6B B;  4UVA A;  4A3G J;  5IYD J;  2UV1 A;  3HSE A;  4A3F J;  3I4N J;  2RRE A;  3MCZ A;  1W5S A;  2WAQ A;  3WTX C;  2LMD A;  1JKO C;  3CCQ I;  1K4T A;  1BA5 A;  1LKX A;  2V26 A;  2FF4 A;  3D5R C;  2JPB A;  1W36 C;  3GEZ A;  1HCR A;  4F7Z A;  4BXF A;  3WTY C;  2WTE A;  1V5E A;  4QPQ A;  2DDA A;  4PUS A;  1AA7 A;  2QQB A;  5E8G A;  4ENJ A;  2DQL A;  2XAU A;  4M3G A;  1B59 A;  2CQX A;  4BBR J;  4DOZ A;  1R5G A;  1D8K A;  3DKY A;  2O61 A;  4Y33 A;  1QQI A;  4BDZ A;  4C3H J;  3GUD A;  3P9K A;  4FIS A;  3JRC A;  4BHC A;  5L3C A;  2F4I A;  2W85 A;  3W2A A;  1CQT A;  1P4W A;  4DYC A;  2DA6 A;  5F64 A;  1IN4 A;  1XG1 A;  2L4M A;  4ENM A;  2Y48 A;  4S04 A;  2P4W A;  4G9Y A;  4Y13 A;  2L7M P;  4U0V A;  3U1D A;  2IS2 A;  4OIO F;  3K4M A;  5F0H A;  1RUO A;  3BG3 A;  2O7O A;  1BI3 A;  4KFC A;  1QVU A;  3CCM I;  1X3W B;  2PQ8 A;  2VC1 A;  4RDU A;  1QA6 A;  2E71 A;  1DDN A;  1LFP A;  1IDY A;  3EUH A;  2FRH A;  1D0Z A;  2A05 A;  4M6X A;  1YE9 A;  3O8H A;  2XSD C;  1F4K A;  3KYD B;  2EFW A;  4HA8 A;  4OIR F;  3RKQ A;  4AM3 A;  5FD5 A;  2X6W A;  1TW3 A;  3VSL A;  4UB8 C;  1G8X A;  1NH3 A;  3A4C A;  3FXU A;  3WGG A;  4M3F A;  4XRF A;  3ZQF A;  2GOM A;  5FKO A;  1U78 A;  3BY6 A;  2CS3 A;  1G3S A;  5FKL A;  2ZCW A;  4IX7 A;  1R5I D;  1R36 A;  4HST A;  2EA2 A;  1D8J A;  4G6Q A;  5BPD A;  2LG4 A;  5HLG A;  5F1J A;  3S1Q J;  5D6F A;  4BUP A;  1T38 A;  4ZDL A;  4LD5 A;  3PFI A;  3ZMZ A;  2XUB A;  4JBA A;  4W97 A;  1U0J A;  2JVG A;  1O3S A;  3OYI A;  4IOA F;  1HQC A;  1UG2 A;  3WE3 A;  5L3G A;  4BHB A;  3C2B A;  4PJL A;  3SFI A;  1I1G A;  1K83 J;  2QBY A;  4XSX F;  2Q2E A;  4UV9 A;  1S5L C;  1WJF A;  1ON2 A;  2Y31 A;  5B1A H;  5F08 A;  5GP9 A;  3FX3 A;  3AG3 H;  3EUK L;  3BG9 A;  3JRG A;  1JUP A;  3HYI A;  4NNJ A;  2FJ1 A;  3KET A;  2DLL A;  2BHZ A;  4UV8 A;  4PJ0 C;  3DU5 A;  1XGO A;  3TBI A;  3I59 B;  4IHX A;  4IHW A;  4RBO A;  3KZY A;  4X0G A;  1MDM B;  2HR3 A;  3LNQ A;  4YFN F;  4G12 A;  3DPL C;  1XCB A;  4M9Z A;  1Y0N A;  2MH2 A;  2P6T A;  4L9N A;  1NHA A;  3ZMU A;  1KU3 A;  2YX7 A;  2MYS A;  1EV7 A;  3KP3 A;  4CYD A;  1VTN C;  2BY0 A;  1A35 A;  1BI0 A;  3PQJ A;  1JJ8 C;  4RLF A;  2H6B A;  3H9G A;  5J40 A;  5HNH A;  2R7R A;  3HTU A;  3H0G J;  3JRF A;  2NVQ J;  3CCV I;  3QWL A;  2HFH A;  2E7X A;  3F22 A;  4NC6 A;  2VKH A;  2LRE A;  3BTL A;  4Y7N J;  4WX9 A;  1E3O C;  2Z5U A;  5E1X A;  3KIO A;  2KDO A;  1QBJ A;  1GVJ A;  1O3R A;  2MC4 A;  2VPR A;  2QF7 A;  1MBE A;  1FMV A;  4RGU A;  2DJI A;  5DYM A;  3L2C A;  3GTO J;  4DJA A;  2CUE A;  4M73 A;  1S7A A;  2E1O A;  2ZKZ A;  1DPR A;  4PCQ A;  1KYZ A;  1QZY A;  5E18 F;  3BZK A;  2KZG A;  1DGR M;  3SZT A;  2F4M B;  4L18 B;  2QZ8 A;  2CYY A;  1DP3 A;  1YIO A;  3WTS C;  2HOE A;  4EGZ A;  1EKE A;  3HOZ J;  1W7P D;  4XID A;  4KIS A;  2KJC A;  2GIV A;  3OIO A;  2OBP A;  4DBR A;  3IKT A;  3CJT B;  1YIJ I;  2HI3 A;  4ZDP A;  3U21 A;  4E6K G;  3HTS B;  1H9G A;  3TDU C;  3ABK H;  4ZYH A;  2F48 A;  2W57 A;  2CH0 A;  1TT0 A;  4C2T A;  4AC0 A;  2Z2S B;  2E2J J;  2LY1 A;  1J0R A;  2HPM A;  3CES A;  1OYW A;  3HOU J;  4WK8 F;  3DEU A;  3DTI A;  5H6Q A;  4RB0 A;  3FZV A;  1Z7L A;  1JTY A;  1T98 A;  2GXA A;  2R7T A;  4V2F A;  3ZQQ A;  1JJ6 C;  4LLN A;  3Q0W A;  3I71 A;  1ZKG A;  3OYM A;  4A3M J;  1K6O A;  4K2E A;  2GZW A;  1FMW A;  1JHF A;  2LNB A;  1SMT A;  3TOB A;  3LFU A;  3JTG A;  3Q9S A;  3ZQC A;  1ZRC A;  1OMI A;  2CSO A;  3RPQ A;  1LVK A;  2X4H A;  3HIF A;  3SYT A;  3E6D A;  3JAM K;  1JGG A;  2LC2 A;  4AU7 A;  3IWZ A;  4NQW A;  4UB6 C;  1JGS A;  4G7Z F;  1ERD A;  3PSF A;  4N4O B;  2W82 A;  1ITY A;  2LOO A;  5L3D A;  1IJW C;  3HM5 A;  4CIC A;  5L3F A;  2FOK A;  2HDC A;  3TL4 X;  1S7O A;  2YX4 A;  3CF5 F;  5C44 J;  3DBH B;  4B44 A;  3TO9 A;  1QZE A;  3QRF F;  3RYR A;  4BE0 A;  4P1W A;  4HBL A;  1OCR H;  3ELK A;  4ZDO A;  4O3M A;  2LY2 A;  4CCK A;  4U0Y A;  4OIP F;  3PFY A;  2CJJ A;  2ZFW A;  4V2G A;  5J1U A;  5J3L A;  2XPV A;  4CCO A;  1IN7 A;  3WU1 B;  1WJD A;  3HRS A;  4LK1 F;  2MW8 A;  4L9J A;  4D5C A;  1MBH A;  2XAH A;  1J7K A;  1HKQ A;  2B9S A;  5HS7 A;  1Y6I A;  2IBD A;  1X1C A;  1B72 A;  4PFP A;  2A5Y B;  4XLP F;  2VT3 A;  2P5K A;  4HPQ A;  3V8J A;  3E6B A;  1ZAR A;  3E5Q A;  3S1R J;  1APL C;  2DI3 A;  1POG A;  1WVR A;  2FU4 A;  3BG6 A;  3QPH A;  2OZ6 A;  1H0M A;  3U1K A;  3EPZ A;  4BU2 A;  1X19 A;  3MQ0 A;  2X51 A;  5GAH J;  3TED A;  1ZQ3 P;  4JQF A;  2RAE A;  1YIT I;  5EEA A;  1KON A;  2BYV E;  1TWG J;  3M9A A;  2E60 A;  3W6K B;  2P6S A;  4OMZ A;  4L0Y B;  2BV6 A;  1JT0 A;  3LL7 A;  2V7F A;  4RLQ A;  1IV6 A;  2OQR A;  2JWT A;  3LQQ A;  4II3 A;  4GYG A;  2WWY A;  3RKW A;  3RSN A;  5GTH C;  2WBM A;  1XSD A;  2GM4 A;  3HSR A;  4D5F A;  1ON1 A;  2QEN A;  1FOX A;  1TQI A;  2IS1 A;  1WCM J;  1KU2 A;  2V9V A;  5E20 A;  4A0X A;  2ZXJ A;  2DT6 A;  3CTA A;  5IT9 K;  2A6T A;  2IGN A;  3OYF A;  2VPL A;  4OMY A;  4CXF A;  3COA C;  2QGU A;  1HKS A;  3BG7 A;  1VQK I;  1UJ8 A;  4EJO A;  3QYE A;  3OWT A;  2K9N A;  4CUG A;  5F0F A;  3GTG J;  2Q2E B;  1R5H A;  1W0U A;  1IAW A;  4RA2 A;  3F72 A;  3WU0 A;  2E34 A;  1ORK A;  2CQN A;  3TGN A;  2QA4 I;  3LFK A;  1XMX A;  3L2Q A;  4UUT A;  4KIT B;  1EH6 A;  2VBW A;  1WI9 A;  2Z16 A;  3F8C A;  1IDZ A;  4OAY A;  4PSW A;  3FM3 A;  5GPC A;  2L9R A;  1T56 A;  3B73 A;  3WTZ A;  4HYE A;  3BLY A;  4DYR A;  2DXI A;  4BE2 A;  3H0D A;  3S3M A;  2M4K A;  1TT5 B;  2K85 A;  3DLL F;  1O57 A;  3GW2 A;  3LSK A;  1ETW A;  3QP5 A;  3LMM A;  1N25 A;  5IP6 A;  2L7K A;  3RPU A;  3J81 Z;  4FT8 A;  1BOA A;  1GXQ A;  3FIS A;  3B6A A;  4ESF A;  5JLX A;  2DBB A;  3BOQ A;  3VB2 A;  1R6R A;  2F5F A;  3R6S A;  4WXH A;  2Y9Y A;  5LRR A;  4IEJ A;  5E8I A;  1MMA A;  2L2O A;  2M5W A;  2VAS A;  5B3S H;  1XTA A;  3ZCO A;  3GFL A;  2DMT A;  3HKZ N;  2XF6 A;  3J80 Z;  3H3V K;  1IXS B;  3A03 A;  2ZC2 A;  4ANJ A;  3KE2 A;  3F0C A;  2DPD A;  2IW5 A;  2RDP A;  2V1N A;  2NVX J;  5FJ8 J;  3GFI A;  3VYU B;  2OUM A;  4G7O F;  3I4M J;  1TZL A;  3MKL A;  3OR1 C;  3OYC A;  5CYV A;  1IN8 A;  1TLH B;  3FKI J;  3OYD A;  4H0E A;  4GDF A;  2EZL A;  5K7F A;  2O5R A;  4XLA A;  2OQG A;  5EDN A;  5FLV A;  3I56 I;  1R58 A;  3P9C A;  4J01 A;  1BOB A;  1FY7 A;  5EG0 A;  4YIR X;  3ZQ7 A;  4IKF A;  1FBQ A;  4Y15 A;  1IGN A;  3K4B A;  3MKY B;  3HZJ A;  4N9H A;  4OAZ A;  3KP2 A;  3PL8 A;  4BH9 A;  1MBK A;  2EV0 A;  2OPT A;  1R23 A;  2JA6 J;  2DMP A;  2HOA A;  2VJ5 A;  1ETK A;  3PNT A;  2ZNZ A;  5CVJ A;  2GA2 A;  4LGW A;  2KJB A;  4KN4 X;  2KIF A;  5LFA A;  4MFD A;  4R79 A;  2X6O A;  3R60 A;  1FLI A;  3CCL I;  2W25 A;  1B9M A;  1F9N A;  3HOY J;  4NQW B;  3MAJ A;  3S93 A;  3HPH A;  4QWQ A;  2VOO A;  2I5U A;  1BC8 C;  4XIC A;  2HPI A;  4XKW A;  2ELK A;  3ABL H;  2RKH A;  1YS6 A;  4AWX B;  3J7A Y;  1R00 A;  2UXX A;  3K1M A;  4RAF A;  3ERE D;  1Y1W J;  4XBF A;  4YRV A;  1J75 A;  2PMZ N;  1BM9 A;  2CV2 A;  3LA2 A;  3BCA A;  5EZG A;  4MEX F;  1D0Y A;  2P81 A;  1I50 J;  4Z2Y A;  5K7H A;  3QYF A;  2PJR A;  1BJZ A;  2VKD A;  3I53 A;  4IVN A;  2NS8 A;  4S0H B;  4EEF G;  5LEJ A;  4UUS A;  2E35 A;  3TDZ C;  3M3Y J;  4A6D A;  1E3P A;  1R22 A;  2R93 J;  1HW1 A;  3GLX A;  2HNH A;  1LVA A;  2COB A;  3UKG A;  4A2U A;  4EM2 A;  1JKR C;  2WY8 Q;  5M3F J;  4XN0 A;  1O4X A;  1WJA A;  4L9V A;  1B72 B;  6PAX A;  2XGX A;  2OJE D;  3AKZ A;  1ZK8 A;  1AU7 A;  2EH3 A;  3G6E I;  2FNA A;  2HQN A;  2NS0 A;  1AHD P;  1YJW I;  1X1P A;  2BXY A;  1H8A C;  3MMY B;  3OR2 C;  4PJJ A;  1LFB A;  2VQL A;  4XLE A;  1ZR2 A;  4ESB A;  3H5A A;  3HKZ A;  1UAA A;  3F21 A;  2EV6 A;  3GXO A;  5A2Q Z;  4WWC A;  3V4G A;  3CME I;  4EAT A;  1MKM A;  1FBS A;  4O6J A;  4M6Y A;  1XS9 A;  3T5X A;  2FD5 A;  3REO A;  1FEX A;  2COM A;  3DKX A;  1VND A;  3WG9 A;  2ZSI B;  3ZMS A;  3D1N I;  1J5Y A;  3BZ6 A;  3LSR A;  3FBN B;  1MBF A;  2G7U A;  3B02 A;  2ZJQ F;  2LF7 A;  5GAD J;  3S14 J;  2Z1D A;  4F91 B;  4HLY A;  2EZH A;  2R7W A;  2VJ4 A;  3CO6 C;  4IRG A;  1B9N A;  1G3Y A;  3KPH A;  3SEZ A;  1GXP A;  1A31 A;  4MLO A;  3QPT A;  3GME A;  1WH5 A;  3JRB A;  3JRI A;  2MD5 A;  2OA4 A;  3I59 A;  4LG0 A;  4BHP A;  2XGD A;  1MDM A;  1UHS A;  1V3F A;  3AG1 H;  2PI0 A;  4FHT A;  1EH8 A;  2AXT C;  4QPO A;  3HRM A;  3J7Y J;  3V7C A;  2NOJ B;  1F5T A;  2ZO4 A;  2PEX A;  2Y75 A;  5FO5 A;  3DQV C;  3UNG C;  2HQ5 A;  5LGU A;  2PJP A;  1N78 A;  4LMY A;  1XSV A;  3AAF A;  4A3J J;  1K61 A;  3CJQ B;  2CQK A;  1JE8 A;  1E3H A;  1YLF A;  2XAJ A;  4KA4 A;  1SD7 A;  2IEK A;  4BJ5 C;  3FK6 A;  4ZYE A;  1PP7 U;  2H6C A;  4LIV A;  2CU7 A;  2EIJ H;  2JA8 J;  2PN6 A;  2F2E A;  2R7F A;  3I55 I;  3F6V A;  3DEW A;  4CZC A;  2E36 A;  1XN7 A;  2BW3 B;  2HYG D;  1RR8 C;  2R7S A;  1BI2 A;  2PMZ A;  2FBK A;  2R7Q A;  3AL0 C;  4D7M A;  2K02 A;  1RUN A;  3ZXS A;  4RM2 A;  1RC9 A;  2KRH A;  3LQR A;  4ENN A;  2GA1 A;  2HYF A;  4JK1 X;  3SZG A;  4UVB A;  4BXU A;  5HS8 A;  3MKZ A;  2NVY J;  1LUJ B;  5GPA A;  1FT9 A;  1YHQ I;  2Z3Y A;  2EZK A;  4DW6 A;  1HXD A;  2VBY A;  2HU9 A;  2V9P A;  5HOO A;  2H8W A;  2LD5 A;  1YW7 A;  3V42 A;  1W5C C;  1I6H J;  1IXR C;  1VZ0 A;  1BI1 A;  2KLO A;  3FMQ A;  3D0S A;  3CF2 A;  2F4O B;  4KIF A;  2JT1 A;  2ZBK A;  3S2W A;  3I0T A;  5HDK A;  3GFM A;  2H1K A;  1BR1 A;  3OYJ A;  4O5V A;  2VON A;  2EJR A;  3RKX A;  5EG0 B;  2R5Y B;  2Y0M A;  3IL2 A;  1R4M B;  4XM3 A;  3L00 A;  4J00 A;  5D5V B;  3A02 A;  1BC7 C;  2EBI A;  3QU6 A;  4Q5S F;  3QQA A;  2JPC A;  5KNL A;  1SEU A;  4XON A;  1AKH B;  1E0E A;  3I64 A;  4FCY A;  3F6O A;  2OTJ I;  5E3M A;  2XV4 S;  2R4G A;  4KT5 C;  2HQA A;  3FIW A;  4A3I J;  1XGS A;  4NUB A;  1EA3 A;  4XN3 A;  3ECH A;  4B1R A;  2VKE A;  4NC7 A;  1F43 A;  2FEZ A;  3L2V A;  1R1U A;  1IN6 A;  4CO8 A;  1JHH A;  3GTL J;  4HLX A;  1Q1V A;  3F3X A;  3KFW X;  2OU2 A;  1BBY A;  4IOC F;  2NNY A;  1UG0 A;  5FLX K;  2CQ7 A;  2VT2 A;  4BNC A;  4P96 A;  2GBY A;  4I99 C;  4GO1 A;  3Q9V A;  4N9I A;  5BOX A;  3PNV A;  4BY7 J;  1U8R A;  2FA5 A;  1ACI A;  2WY7 Q;  2X1D A;  2VXD A;  1LE8 B;  3LOC A;  1Y8Q B;  2MA3 A;  1YO5 C;  2B63 J;  2NOG A;  5FKN A;  2A68 F;  3SHF A;  2PJR B;  2JA7 J;  4Q47 A;  5DUK A;  4JX6 A;  3MFK A;  3DF8 A;  2K4B A;  4UUS B;  1NG6 A;  4KIB A;  1R1T A;  2CV0 A;  2CFO A;  4GRI A;  3DBL B;  3HBL A;  2MSY A;  3I5U A;  1F1Z A;  4I6Z A;  1I3Q J;  2VOD A;  1AWC A;  1LPQ A;  3S8P A;  2ID6 A;  2FQ4 A;  4HRI A;  3OY9 A;  2EWN A;  2DA2 A;  2ZME B;  5LLQ A;  3P5J A;  1KZH A;  4RGR A;  3A01 A;  1OCT C;  2H8R A;  1SVO A;  2XHK A;  2JRM A;  5EGO B;  5F04 A;  3GBG A;  1VQM I;  3EQL F;  4EQQ A;  3SEQ A;  2KL4 A;  2RV8 A;  2DTR A;  1A04 A;  2LLK A;  2LF8 A;  1QO0 D;  2NVU B;  4KIC A;  4N4N B;  5D5X B;  2A5W A;  3BQY A;  2LK2 A;  4I2O A;  1O7F A;  3ZN0 A;  2BY1 A;  2XSJ C;  3LAP A;  1YOV B;  4R8H A;  3TO6 A;  1JT6 A;  3BT9 A;  1B4A A;  1ETX A;  1PJR A;  4V19 K;  4JX4 A;  2LBF B;  3K2Z A;  2B7E A;  2X9D A;  2DA7 A;  4PSX A;  4PZJ A;  4XKV A;  2R0Q C;  2VQG A;  2ESH A;  3Q0V A;  4HF0 A;  5IT3 A;  5J8F A;  4PJN A;  1FX7 A;  1FWZ A;  3OL4 A;  3S2H J;  2Q0O A;  3CMM A;  3E0J B;  2TCT A;  2OCE A;  3LA3 A;  4LG0 B;  3I58 A;  3ZQL A;  2QKL B;  1G2H A;  3K4J A;  1OYY A;  4HNT A;  3D5L A;  1DUX C;  1DGW Y;  2YU3 A;  1R49 A;  4C2U A;  5ICF A;  4CDG A;  2DJN A;  2P0W A;  2M4G A;  2TDX A;  4XLC A;  3FKJ A;  4C3J J;  4LG3 A;  2KDZ A;  3E6C C;  1SC7 A;  2VI6 A;  1H89 C;  3HOS A;  2P5L C;  1IV8 A;  1WHU A;  2CMP A;  2ELJ A;  2KIQ A;  3BR3 A;  3F8M A;  3M4O J;  2ELH A;  2RQP A;  4L9T A;  1UHW A;  2EIL H;  1YG2 A;  2HTS A;  2QSG X;  1T2K A;  1Z77 A;  3HUG A;  1Z6R A;  4AYB N;  2QEX I;  3GF2 A;  1Y1V J;  2MD0 A;  3FXM A;  3GZN B;  1HSJ A;  1ZR4 A;  1RI7 A;  1NTC A;  3KP4 A;  5J6X A;  2XRO A;  1Z1D A;  2IT0 A;  2EK5 A;  4PGG A;  3LSP A;  3CC4 I;  3BZC A;  5HLH A;  3LSH A;  4IF4 A;  3CMA I;  1RET A;  4FAS D;  2PMU A;  4AUX A;  1R7J A;  1X1D A;  3IKV A;  4ZH4 F;  1Q1H A;  2L9S A;  5HLI A;  3G71 I;  1VQ7 I;  3KP7 A;  1D1A A;  1XMK A;  2FXA A;  5H2F C;  1SAU A;  2E2I J;  1YRN A;  3ZR8 X;  2AQF A;  3NAU A;  4BY1 J;  3KEO A;  4BAY A;  3CP2 A;  5J8C A;  2J5P A;  3U9G A;  3SQN A;  2UUZ A;  5KAI C;  3ZOB A;  1YJN I;  4A12 A;  1IC8 A;  1S72 I;  4KYW A;  1MNE A;  3MZY A;  4Y52 J;  5TGT A;  2VQC A;  5IOY A;  1FYM A;  3I54 A;  2QM3 A;  3OOU A;  1DP7 P;  1HDP A;  1YJ9 I;  3WHB A;  1MSF C;  2HS5 A;  1ODD A;  3NAR A;  4BBS J;  4BEH A;  5DEQ A;  2NYX A;  2QVO A;  4II2 A;  4BDY A;  2EA4 A;  2G7H A;  4ETS A;  5FB2 A;  3CJR B;  2GXG A;  1HW5 A;  3FWE A;  1MND A;  2RNG A;  1FIA A;  2R7X A;  5FGM A;  2CW8 A;  3DEE A;  3SXY A;  3HPG A;  5JVG F;  2QLZ A;  1UEL B;  2KPM A;  2WAE A;  4A93 J;  2VJJ A;  2EIM H;  5F0C A;  1R71 A;  4HV5 A;  2ZJP F;  3DWL E;  3KLN A;  3U2R A;  4X1E A;  1ZTR A;  4HZF A;  2ISZ A;  4CCL A;  1HLV A;  4GYI A;  2STT A;  4M72 A;  3KEY A;  1ZRF A;  3DCF A;  3I4P A;  2MLG A;  1SAX A;  4U7B A;  1S8N A;  4M9X A;  1WH7 A;  1VQ6 I;  2K3F A;  2ZNY A;  1G59 A;  4PDK A;  2GWR A;  4LB6 B;  1MMG A;  1P2F A;  1N77 A;  1M1E B;  3E97 A;  1B1B A;  4BQN A;  4N0B A;  4UHT A;  2L0K A;  3EUA A;  4ZYA A;  3QU3 A;  3FDY A;  1VQO I;  3VSK A;  4IHT A;  4XOT A;  3LSI A;  2XGE A;  4HNU A;  5JHF A;  5ICG A;  4A0Y A;  3CZ6 A;  3CDL A;  1U5T C;  4M3B A;  3C3W A;  4EGY A;  1RZ4 A;  5CVU A;  2ECC A;  1FIP A;  2M87 A;  3CC2 I;  2L9V A;  4JX5 A;  3TO7 A;  1KU9 A;  3K10 A;  4AYB A;  2YS9 A;  1FJL A;  3CMY A;  3VOE A;  1WWX A;  2VKV A;  1YX3 A;  4HOB A;  4RS8 A;  2GXB A;  4G6D A;  2VBX A;  4DNC A;  3EDP A;  3QPL A;  1YYV A;  3SZP A;  4I7H A;  1YX5 A;  3KX2 A;  4P9F A;  1V54 H;  2BEO A;  1SVM A;  3ABU A;  3A01 B;  1PUE E;  4A5M A;  3S1M J;  3C2G A;  2V1X A;  5DS9 A;  5DDG A;  2DO7 A;  1K4S A;  3AL0 B;  2X1E A;  3H92 A;  4EVI A;  3OYA A;  1ZYR F;  1ZGJ A;  3BR0 A;  3DBR B;  3LSG A;  2ME0 A;  2LR8 A;  3L2R A;  4J19 A;  2A07 F;  2KHM A;  4HX4 A;  2ZXH A;  1IN5 A;  2Z33 A;  3IH3 A;  4A5N A;  1IUF A;  2HDD A;  3E6M A;  9ANT A;  1YI2 I;  3VOD A;  2VQH A;  3GTM J;  3DTK A;  1TWA J;  3P9I A;  3MEX A;  4C9Y A;  5LHI A;  4ITV A;  4CHU A;  2VIX A;  3GVA A;  3F8F A;  4MO7 A;  3LWF A;  3MZH A;  1OQY A;  3S3N A;  4BAC A;  1TNS A;  2X0L A;  1MBG A;  1P7I A;  5FKK A;  2DW4 A;  2R7U A;  3CDH A;  3HOW J;  3L9F A;  2M3A A;  1QHH D;  3JRD A;  2VN2 A;  1DU6 A;  2CUF A;  4UVC A;  4XNF A;  1TWH J;  5L3B A;  3FK7 A;  3S32 A;  2CG4 A;  4LIT A;  3J80 K;  2XPW A;  1WSU A;  3H9J A;  1U9N A;  3NWS A;  4QTR A;  1MMS A;  3SFZ A;  3TMO A;  4E7J A;  1T6S A;  4HAM A;  3O3K A;  3EYY A;  3SDG A;  1P7J A;  1UHM A;  4BXX J;  2HTJ A;  2BW3 A;  2F6C A;  3HUG B;  4XL9 A;  2ZME C;  3HGG A;  1FZP B;  1ZG3 A;  4BQO A;  1SMY F;  2EV5 A;  1JUM A;  1QNT A;  3WTU C;  2DYS H;  2JJ7 A;  4LJZ F;  3X2Q H;  5JLW A;  2EFP A;  2DU9 A;  3NWT A;  3PO3 J;  3JRA A;  2VE8 A;  5LEK A;  1U8B A;  5IT9 Z;  4A3D J;  4I09 A;  1MH3 A;  1U5T A;  2DA1 A;  2X48 A;  2EQR A;  2E1M B;  1ZEL A;  2VB6 A;  1QVT A;  1FPQ A;  2FOW A;  2M8E A;  3CCJ I;  2D5V A;  3KZZ A;  2FMY A;  3ML6 A;  5LGT A;  1YRN B;  3B6C A;  3F23 A;  1MZB A;  5CQG A;  3DU6 A;  4X6A J;  4RB2 C;  1IXC A;  2QKM B;  2LKP A;  5JI6 A;  3BJO A;  4ZC3 A;  2ACJ A;  3ZMD A;  4WXD A;  5TRD A;  3LST A;  4FTH A;  2XAF A;  1ZLK A;  2IGK A;  3HXL A;  1ETO A;  2DA4 A;  1TNT A;  3VYS B;  3C18 A;  2XDV A;  1ZGW A;  4XKB A;  4BEH B;  3K4K A;  5ICC A;  4HF2 A;  3OV8 A;  3ABM H;  2R5Y A;  1W5T A;  1LDK B;  2KIU A;  3BWG A;  2L02 A;  4FE4 A;  3MKW B;  1QGP A;  1X3Z B;  2A61 A;  1FYL A;  4HQE A;  5DV5 A;  2LH9 A;  3T8R A;  1AKH A;  1EH7 A;  4NBQ A;  2BBY A;  1FC3 A;  4ZJZ A;  4HV6 A;  3W6J B;  4AVZ A;  4IHY A;  3M1E A;  4LB5 A;  3S16 J;  2A6H F;  2O8K A;  5FRN A;  3HHH A;  2IXS A;  2P8T A;  2J5O A;  3DPU A;  4CGZ A;  1BIA A;  2A69 F;  2E5Z A;  4HQM A;  3IHU A;  2X6Y A;  3H35 A;  5F1R A;  5K7Z A;  5ED4 A;  2E5N A;  2R7Z J;  2MFZ A;  2M7A A;  3OSG A;  2BVM A;  1WJ5 A;  1OR7 C;  1KQ0 A;  1A5J A;  3BP8 A;  1DU0 A;  2K5C A;  3JRE A;  5KK1 A;  1JTX A;  4LK0 F;  4BKX A;  4IL6 C;  2NAZ A;  5B1B H;  4AIH A;  4ZYD A;  2H1L A;  3ISP A;  2OD5 A;  2E1N A;  4UUV A;  2AHQ A;  2DOE A;  4RB3 C;  2HKX A;  2XRL A;  1Z67 A;  4DQ2 A;  4A3L J;  3GZ6 A;  2YU9 J;  2MG4 A;  4HW0 A;  1ENH A;  1LE8 A;  4XRM A;  2Z99 A;  5CVV A;  5DCM A;  2YPR A;  5A2Q K;  2K9L A;  1FNN A;  3LAJ A;  2H94 A;  3R4K A;  2MGQ A;  2VE9 A;  3IRR A;  2M0C A;  1W36 D;  3MWM A;  5DD8 A;  3DFG A;  3DXJ F;  3BJA A;  2KQR A;  1IW7 F;  3JSP A;  1IRZ A;  1MIJ A;  1QRY A;  2B0L A;  5M5X J;  2Y69 H;  4BQQ A;  2NVT J;  1H9T A;  1KYW A;  1W7P A;  2WC2 A;  2QSH X;  1FOW A;  3RZO J;  1FSH A;  2ZME A;  2F5D A;  2FML A;  1P4A A;  5EGO A;  2MH9 A;  1HW2 A;  2O0Y A;  2DOD A;  1G3T A;  3BR6 A;  1SFK A;  2GOX B;  3DV8 A;  4MIM A;  4XLH A;  5EJC A;  2DMN A;  2ICW G;  3OOP A;  4I98 B;  5F6F A;  2HOS A;  1ZAO A;  4ON0 A;  2ME6 A;  3TKY A;  1W0T A;  3MN2 A;  3K0L A;  2ECB A;  2XAG A;  1WPK A;  2HYJ A;  2Y9Z A;  2IRF G;  5HOD A;  4MQV A;  1ZG5 A;  5IYC J;  4UXN A;  3H1C A;  2VLA A;  3N4M A;  4AIK A;  1J9I A;  1ETY A;  5E3O A;  1TBX A;  4RAG A;  2M34 A;  2HXO A;  3KYL A;  1MH4 A;  3S15 J;  2LBF A;  2VL8 A;  3L2W A;  1B8I B;  2BOL A;  2OAZ A;  3KYC B;  3LSM A;  3BTC A;  2NNN A;  1FTZ A;  1L0O C;  2YR2 A;  3GZ5 A;  2PLY A;  2L3D A;  4LOC A;  1NK2 P;  1T39 A;  1Y56 A;  3TW7 A;  2V79 A;  3K1P A;  4IRI A;  3L7W A;  3JR9 A;  2V1D A;  1WZ2 A;  3OYN A;  2E19 A;  1KGS A;  3ASN H;  4E70 A;  2P7C B;  4U88 A;  3G1L A;  1QU3 A;  4CH7 A;  3ULQ B;  3PQK A;  2EZI A;  4WCG A;  2HEO A;  2W48 A;  1Z21 A;  5ILS A;  3RTR A;  2K27 A;  5B66 C;  1ZRE A;  3JTH A;  4I01 A;  3WG7 H;  3ZQG A;  3IAS 2;  4W1U A;  1X1B A;  1ZHF A;  3GWZ A;  1D5Y A;  3CCU I;  2G9W A;  1LQ1 A;  5D5U B;  3G73 A;  1V55 H;  4D0P A;  1OR7 A;  2QYO A;  1VQ9 I;  5DD4 A;  1Z7U A;  2OF7 A;  1GHC A;  2L7F P;  4E7I A;  2OTL I;  4OIN F;  1XGN A;  4E7L A;  2M2E A;  2QQ8 A;  1SFE A;  2G0E A;  4A69 C;  2QCO A;  2W1O A;  3AG2 H;  2RNJ A;  4B8X A;  1S6L A;  4A0Z A;  5HVQ C;  2WAD A;  2LTP A;  5JVT A;  4HDU A;  4ABZ A;  2ZXI A;  2KRC A;  4F55 A;  2KMU A;  2BVL A;  3A2K A;  1RR7 A;  2MLK A;  1V5F A;  4JYK A;  4I76 A;  5J1Y A;  2CGP A;  1GV2 A;  4OIQ F;  3FM5 A;  3OIP A;  5HS9 A;  3PO2 J;  5C4X J;  3HC7 A;  2FX0 A;  4XKC A;  1S9H A;  1ULY A;  2EFN A;  3IH4 A;  4MNU A;  1FYK A;  5CVI A;  1MJA A;  3F8B A;  4E4H A;  1O7L A;  1MBJ A;  1U5T B;  2GIZ A;  4D7N A;  1IO2 A;  3C7J A;  3H3Z A;  3RI4 A;  3J7A O;  3VDX A;  2FQ3 A;  4TV7 A;  1OFC X;  1NG7 A;  2R92 J;  3P7N A;  3F9K A;  2RVC A;  3CCS I;  3BRO A;  3GCM A;  2VUM J;  2DTZ A;  3VFZ A;  2R7D A;  4CYC B;  1J2X A;  3V7S A;  3EYI A;  1AOY A;  2DYR H;  1ZLJ A;  1ZN2 A;  3E5X A;  2UZK A;  4B47 A;  4EJW A;  5FRM A;  2YUS A;  5D5W B;  3BJ6 A;  3HEF A;  3R0A A;  5E3N A;  5HDG A;  2LKS A;  4EJT A;  2OC6 A;  1HOM A;  4AIJ A;  4FQG A;  5LHH A;  3H3U A;  3E5U A;  4P55 A;  3S1N J;  5C4J J;  1YFH A;  3H5N A;  4OU0 A;  4PJM A;  3RQ4 A;  1KQ8 A;  1HC8 A;  3KLO A;  1LJ9 A;  1OPC A;  1R1V A;  5IYB J;  2CUJ A;  2F5C A;  2R7V A;  2GAU A;  4XRS G;  1LFU P;  1VQ8 I;  2I8D A;  3OS1 A;  2A6E F;  1IZ1 A;  4NB5 A;  2DT7 B;  2XF7 A;  4S05 A;  3FXJ A;  3TP3 A;  4D1Q A;  3CCY A;  4G6T B;  4EMS A;  5DCF A;  5BMZ A;  4YFK F;  1QZZ A;  2Y30 A;  3BPX A;  2L9N A;  1X4P A;  3G1O A;  3WHC A;  2LP0 A;  2BE5 F;  4KIG A;  4ZZD A;  3OS0 A;  2XPU A;  4KJZ A;  3CUQ A;  5JR3 A;  1UZC A;  3GTQ J;  2IGO A;  3VYR B;  2Y0S A;  5FD6 A;  1XDS A;  4YEJ A;  3OYE A;  2DFH A;  2JRT A;  3SJM A;  4B3A A;  5D4S A;  4D9J A;  5J1R A;  2FSW A;  2WAF A;  4ASN A;  5D4R A;  3BR5 A;  3R61 A;  1Y0U A;  3MD2 A;  5DM7 F;  3H5R A;  1YW8 A;  1HST A;  2DK8 A;  3M8E A;  2M9H A;  1PUF A;  4M3E A;  1D3Y A;  2VC0 A;  1XMA A;  5AIP A;  3N97 A;  2E1M C;  1OCZ H;  1WJB A;  3K2A A;  3R0J A;  3BC8 A;  3O2P E;  4I02 A;  3DKW A;  5DCM B;  3E7L A;  3FMS A;  5CLS A;  3BCB A;  4HG2 A;  5BS6 A;  4CZZ A;  2DOA A;  2LRD A;  5AON A;  4G7H F;  1OJL A;  1BR2 A;  2CV1 A;  3G2B A;  3NEU A;  3OIQ A;  2HVS A;  1OCC H;  2W24 A;  2CFX A;  2XB5 A;  2IS4 A;  1WJC A;  3HJE A;  1JXS A;  3NRV A;  1TL8 A;  1JKQ C;  1TP4 A;  3T8T A;  2NS7 A;  5E79 C;  3RPU D;  1IUY A;  5J47 A;  2V6C A;  1W7P B;  2M1B A;  3WGI A;  2WV1 A;  2JA2 A;  3RIR A;  4Y3O A;  3DTE A;  1YS7 A;  4LLG F;  4WXC A;  3K7A J;  1EJ9 A;  2EB7 A;  3PSI A;  3CP8 A;  1XD7 A;  3RQI A;  3L1P A;  1Z3Y A;  1K78 A;  3G3Z A;  1YW9 A;  2K9Q A;  2O6G E;  3KCC A;  3HHG A;  3M8F A;  1Z0X A;  3QOE A;  2W00 A;  2L7Z A;  2W7N A;  1HA8 A;  2O03 A;  3ZGK A;  5LD2 C;  5C3E J;  4ESJ A;  2DA5 A;  1V5G A;  3QOP A;  4MEY F;  3KEQ A;  3K70 C;  3RYP A;  1XPX A;  3OYK A;  2K86 A;  4AD9 A;  3W6V A;  2R5Z B;  1Z05 A;  3G1M A;  5JHU A;  5FLX Z;  1RNL A;  4YG2 F;  3CO7 C;  4UNO A;  1BW6 A;  2BXZ A;  5B5E C;  1MMN A;  2K40 A;  2W4S A;  4AVP A;  2IGM A;  3IH2 A;  3HGY A;  1T8I A;  4QIW N;  2L54 A;  4RM3 A;  3CC7 I;  3IWF A;  1TWF J;  4KDP A;  1GDT A;  1FP2 A;  4I0B A;  3UR3 C;  4Y4R A;  3WOD F;  5E1Z B;  4NHJ A;  2FUG 2;  2M7B A;  4P9U A;  3F8N A;  4F92 B;  4U0W A;  5EEG A;  3IC7 A;  3IV5 A;  3L2U A;  1MD0 A;  1X2N A;  4QLC U;  1EF4 A;  3PUB A;  4CSW A;  2EFQ A;  2ZXW H;  5CVR A;  5K1Y A;  1FOY A;  3PIP F;  2EIN H;  2ETH A;  4ZTF A;  5JFR A;  3FHZ A;  2QBY B;  3PIO F;  1MSE C;  1K6Y A;  3BQZ A;  2DQR A;  2VBZ A;  3C1D A;  4JOM A;  4IHV A;  2DA3 A;  1PP8 F;  1XCV A;  2KIM A;  5E17 F;  5CQE A;  5E3L A;  4YII A;  3K4C A;  1XC5 A;  2BHY A;  2QQ9 A;  4YFX F;  1A6I A;  2HQR A;  3ASO H;  1D0X A;  2BZT A;  4Q48 A;  4RB1 A;  2CUZ A;  2HKO A;  3PUF A;  3T1B A;  2HZT A;  4H4K C;  1CF7 B;  3JW4 A;  1VQL I;  3GTK J;  2LYC A;  3BR1 A;  3HRT A;  3WTV C;  2DPU A;  3W3C A;  2JN6 A;  4OWR B;  3FXK A;  3DP7 A;  4OOI A;  1XB4 A;  2K4J A;  3E1S A;  2V4J C;  1TW2 A;  1WGX A;  2JUG A;  4A3C J;  2IP2 A;  3FF5 A;  3H36 A;  2HWV A;  1U3E M;  1MGT A;  2RN7 A;  3CCE I;  1UB9 A;  3BTI A;  5M5Y J;  2IVM A;  4C3I J;  2KFD A;  4MTD A;  5HNF A;  1LEB A;  1VQ4 I;  1Z9C A;  2I10 A;  3BG5 A;  2V1U A;  1ZGA A;  2DDB A;  1W1W E;  2V9K A;  3ZN1 A;  2DN0 A;  1LEA A;  4XK4 A;  1I6X A;  4DGW B;  5BPI A;  4E7H A;  1BIB A;  3M07 A;  3ONQ A;  4RGS A;  1SFX A;  2JTV A;  3FXR A;  3W2W A;  5K5R A;  1KU7 A;  4MTE A;  1JI8 A;  4GXO A;  1X1A A;  2XB0 X;  3TP0 A;  1X3U A;  2JSC A;  3GTP J;  1I5Z A;  1B6A A;  4IRH A;  3QP6 A;  4L5E A;  5H20 A;  3K1N A;  2GLO A;  5CKT A;  4B4C A;  2D1H A;  2IA2 A;  3IP4 B;  3C2H A;  3HOX J;  1UMQ A;  1YTY A;  3S2D J;  1TC3 C;  3FXL A;  4F3Q A;  1JUS A;  4AID A;  2M8G X;  1QPM A;  1E17 A;  3Q0U A;  3CUQ B;  3MVP A;  2OCC H;  4BGD A;  4IZZ A;  4LLL A;  4HDV A;  1E2X A;  4HX8 A;  3L09 A;  4U7D A;  1MW7 A;  4RAZ A;  2RGV A;  1HDD C;  3RZD J;  4EJU A;  4MGR A;  4M74 A;  1PUF B;  1F36 A;  4B43 A;  3DLA A;  2AQE A;  2DFI A;  2OZU A;  1Y39 A;  2UWM A;  3WGH A;  1XGM A;  3OSF A;  4KNY A;  5AIQ A;  4E7Z A;  3KZI C;  2O3F A;  2TRT A;  2ZFU A;  1KQ9 A;  2IPQ X;  4DIQ A;  1MMD A;  1FOK A;  2STW A;  5K5Q A;  2ZB9 A;  3FHN A;  2LVS A;  2XAQ A;  1JKP C;  2ZSH B;  5K5O A;  1VQP I;  1BJA A;  4A3E J;  5DUI A;  2ID3 A;  1R4N B;  1MJ9 A;  1SVL A;  4KT6 A;  4EM0 B;  2Z9O A;  3JCU C;  3JAM Z;  5IOZ A;  1VQ5 I;  4M71 A;  2CW7 A;  4BYY A;  5GTI C;  1G6N A;  2DMQ A;  2KP6 A;  3I3L A;  2E1C A;  1FBU A;  5LBQ A;  3Q3S A;  5GAG J;  1K78 B;  3OYL A;  4DYQ A;  2ISY A;  2CWE A;  4EV0 A;  1G3W A;  4RAY A;  2PFB A;  4G8X A;  4IPA A;  3RJP A;  1B8I A;  3J81 K;  4UY8 I;  2X85 A;  3PJR A;  4L0Z B;  5KVR A;  1SFO J;  2PBI A;  2DOF A;  4HSR A;  4FE7 A;  1T95 A;  3FMR A;  2LY9 A;  2K9M A;  3IRQ A;  3OL3 A;  3ECO A;  5IP9 J;  5J4V A;  4IQ4 A;  3RCO A;  2FBI A;  1RKW A;  1WI3 A;  2MC3 A;  4WF2 A;  4C30 A;  1YQA A;  3BPV A;  2OV7 A;  3OS2 A;  4EJV A;  1OIS A;  4P5O A;  1TTY A;  4ENK A;  4KUM A;  1GLN A;  2E2H J;  4B3X A;  4U87 A;  5D6E A;  2IJL A;  1LDD A;  2L4A A;  1L3L A;  2DCE A;  3JSO A;  4KMU X;  1OYI A;  5ILV A;  1LNW A;  1Z3X A;  2D1V A;  2Q1Z B;  3RKY A;  4YEL A;  5KHD A;  2Q8K A;  4Q4Z F;  1ETV A;  2XKP A;  3K69 A;  3TOA A;  3GFJ A;  1RES A;  1U9O A;  5M5W J;  4QSH A;  2D45 A;  3ZMT A;  1X2M A;  3MZ8 A;  3CQZ J;  2XIG A;  1ZRD A;  1KA8 A;  4JP0 A;  3K4N A;  2XGC A;  4CA0 A;  3GYH X;  1OCO H;  1UST A;  2QSF X;  4FX4 A;  1RIO H;  2WV0 A;  1QPI A;  3A1Y A;  2JA5 J;  1IRX A;  1U6G A;  3QOD A;  2LFB A;  2AXL A;  5CJ9 A;  5EF6 A;  1IRG A;  4BS9 A;  1VQN I;  4XLN F;  1XDU A;  1USS A;  4HX7 A;  2VXZ A;  1Y8R B;  1Z91 A;  2YSR A;  1SD6 A;  3VYT B;  3ZP5 A;  4KMF A;  2P5V A;  1RRJ A;  2HVR A;  3VPR A;  3ERM A;  3J7Z I;  2DAO A;  1XSX A;  1HBX G;  4FX0 A;  4MHG A;  4GFB A;  3V8K A;  5ERI A;  1WRJ A;  1TWC J;  1R9T J;  1J09 A;  4G94 A;  1VF9 A;  3ZMV A;  1S29 A;  1IF1 A;  1BR4 A;  5DM6 F;  1GT0 C;  2DK5 A;  5GAE J;  4E7S A;  1T08 B;  2UXN A;  1I39 A;  2IS6 A;  4IJA A;  4CYC A;  1BL0 A;  4RGX A;  3OYB A;  4M9S A;  4XMY A;  2N8G A;  2X6X A;  3HSF A;  2LSO A;  4B09 A;  4LFU A;  3D5S C;  3ABT A;  5IPA A;  2IA0 A;  3GLL A;  3V8L A;  2NRA C;  4GCV A;  3K6G A;  5FFX A;  2A3S A;  3ROU A;  1QHG A;  2CRG A;  5TJJ A;  3HDD A;  2O9L A;  3PM1 A;  4DBQ A;  3WE2 A;  3CJN A;  5M3M J;  2XC7 A;  4L5I A;  4BJT A;  1OCP A;  2BGC A;  1V4R A;  3QAH A;  4IQJ A;  2FNP A;  3ZQH A;  4ZYG A;  2PMH A;  2R3S A;  3CLQ A;  1ETQ A;  3OYG A;  5ILU A;  2M30 A;  2X1C A;  3OYH A; 
#chains in the Genus database with same CATH homology
 4E4H A;  1X1C A;  2JSP A;  4PFP A;  4HPQ A;  3CMM A;  4PFO A;  3E0J B;  3VDX A;  5HLT A;  2QKL B;  4CCM A;  1NG7 A;  3K4J A;  3BG6 A;  3D5L A;  4HNT A;  1DGW Y;  4C2U A;  2F5V A;  3F9K A;  3EPZ A;  3FBI B;  4BU2 A;  1X19 A;  2P0W A;  2M4G A;  2X51 A;  4XLC A;  3FKJ A;  4LG3 A;  4JQF A;  3HOS A;  1KON A;  2E60 A;  2CMP A;  2ELJ A;  4B47 A;  3W2V A;  5FRM A;  3LL7 A;  2V7F A;  4RLQ A;  2OC6 A;  1N75 A;  4II3 A;  3RSN A;  3DPT A;  2WBM A;  4F52 A;  2MD0 A;  3H5N A;  4PJM A;  3RQ4 A;  4CCN A;  2IS1 A;  2CUJ A;  2R7V A;  3HL2 A;  2I8D A;  3OS1 A;  2DT6 A;  2A6T A;  3LSH A;  2IGN A;  2DT7 B;  2XF7 A;  3OYF A;  2VPL A;  4FAS D;  4D1Q A;  3BG7 A;  1X1D A;  4G6T B;  3N05 A;  5FRO A;  3ZRG A;  2L9S A;  3QYE A;  3OWT A;  4CCJ A;  2L9N A;  4CUG A;  1D1A A;  1SAU A;  1X4P A;  2Q2E B;  3ZR8 X;  2AQF A;  2XF5 A;  3SDB A;  3OS0 A;  4KJZ A;  3M8J A;  2IGO A;  3CP2 A;  3VYR B;  2Y0S A;  3L2Q A;  4KIT B;  2IS6 A;  3M1C A;  4YEJ A;  3OYE A;  1T0F C;  2Z16 A;  2UUZ A;  4OAY A;  4PSW A;  5KCM A;  4D9J A;  2WAF A;  3BLY A;  1MNE A;  2DXI A;  5CPR B;  3MD2 A;  5TGT A;  3H0D A;  2VQC A;  4BE2 A;  1OLT A;  3H5R A;  3S3M A;  2M4K A;  3OOU A;  3LSK A;  4LIU A;  4ZTJ A;  3HG9 A;  1WFX A;  1X4O A;  3LMM A;  4BEH A;  2L7K A;  2VJI A;  2E1M C;  4II2 A;  4BDY A;  1WJB A;  3CJR B;  3S3O A;  3BC8 A;  1MND A;  2RNG A;  2R7X A;  3BCB A;  2CW8 A;  3DEE A;  4HG2 A;  4FET A;  1R6R A;  4BE1 A;  3HPG A;  2DOA A;  2LRD A;  4RMN A;  1UEL B;  2KPM A;  1BR2 A;  2WAE A;  3HOT A;  3G2B A;  2CV1 A;  3OIQ A;  2VJJ A;  2HVS A;  2M0M A;  4PK4 A;  2IS4 A;  1MMA A;  1WJC A;  2L2O A;  3DWL E;  3PNY A;  4CCL A;  3RPU D;  2VAS A;  4F93 B;  3ZCO A;  3KEY A;  2JA2 A;  4Y3O A;  3DTE A;  2XF6 A;  4U7B A;  4ANJ A;  3IUO A;  3PSI A;  3CP8 A;  2V1N A;  1G59 A;  4B48 A;  1Z3Y A;  2HVQ A;  2HZD A;  1MMG A;  3QOE A;  1N77 A;  2W00 A;  4XOR A;  4BQN A;  2W7N A;  1HA8 A;  3K4L A;  1D1B A;  3ZGK A;  3VYU B;  3K70 D;  2OUM A;  5LD2 C;  3VWB A;  3EUA A;  4ZYA A;  1TZL A;  3FDY A;  1V5G A;  3H9Q A;  3AFH A;  3OR1 C;  3VSK A;  3K70 C;  4XOT A;  3LSI A;  3OYC A;  2K3P A;  3OYK A;  2V6E A;  4HNU A;  3OYD A;  4E7K A;  2KZV A;  5JHF A;  2O5R A;  3EUH C;  1P9Q C;  4XLA A;  2WB1 A;  4J01 A;  1D1C A;  1MMN A;  3CZ6 A;  2W4S A;  1BOB A;  2IGM A;  2MAB A;  2WA0 A;  4BJ6 C;  4BL0 B;  2L5Q A;  4IKF A;  4RM3 A;  1PYV A;  3IAM 2;  3K4B A;  3UR3 C;  3MKY B;  4Y4R A;  3OMY A;  4OAZ A;  2FUG 2;  2M7B A;  1DQU A;  4F92 B;  3L2U A;  3PL8 A;  4XQF A;  3K10 A;  4AYB A;  3PUB A;  4NC8 A;  3I9V 2;  2VJ5 A;  4CSW A;  2R7O A;  4XOP A;  3PNT A;  1YX3 A;  4ZTF A;  1WJE A;  4HEA 2;  5LFA A;  4R79 A;  1K6Y A;  1YX5 A;  4XLF A;  3KX2 A;  2HDW A;  4XR6 A;  4JOM A;  3QYB A;  4NQW B;  5CQE A;  3HPH A;  3S93 A;  3C2G A;  3AL0 B;  2X1E A;  2HPI A;  3K4C A;  4XKW A;  3OYA A;  2RQQ A;  3L2R A;  3J7A Y;  3LSG A;  2JVH A;  1D0X A;  2UV1 A;  2KHM A;  2CUZ A;  4YRV A;  2ZXH A;  2CV2 A;  3BCA A;  4H4K C;  2RRE A;  2VQH A;  1D0Y A;  3DTK A;  2WAQ A;  3QYF A;  4C9Y A;  4ITV A;  2LYC A;  2PJR A;  2VKD A;  2VIX A;  1LKX A;  2V26 A;  3S3N A;  3W3C A;  4BAC A;  3D5R C;  4OWR B;  2HNH A;  1W36 C;  3E1S A;  2V4J C;  4BXF A;  2R7U A;  2JUG A;  2WY8 Q;  2M3A A;  1V5E A;  4QPQ A;  4XN0 A;  1WJA A;  1QHH D;  1AA7 A;  4PUS A;  2XAU A;  4XNF A;  3S32 A;  4LIT A;  4DOZ A;  3DKY A;  3AKZ A;  4Y33 A;  4BDZ A;  3H9J A;  5HNF A;  3MMY B;  2F4I A;  3OR2 C;  2VQL A;  4PJJ A;  3NWS A;  4XLE A;  3W2A A;  2V9K A;  3TMO A;  4E7J A;  3H5A A;  3HKZ A;  4DGW B;  1UAA A;  4E7H A;  2IS2 A;  4EAT A;  3ONQ A;  3W2W A;  3K4M A;  2BW3 A;  2F6C A;  3HUG B;  3DKX A;  4XL9 A;  2ZSI B;  1JI8 A;  1X1A A;  4BQO A;  3FBN B;  2Z1D A;  1LFP A;  5CKT A;  4F91 B;  2R7W A;  1D0Z A;  3IP4 B;  2VJ4 A;  3C2H A;  1YE9 A;  3NWT A;  3SEZ A;  4MLO A;  4F3Q A;  2E1M B;  1ZEL A;  2X6W A;  2VB6 A;  3VSL A;  1G8X A;  3A4C A;  5CQG A;  4QPO A;  3DU6 A;  2NOJ B;  2QKM B;  4BGD A;  4IZZ A;  4ZC3 A;  2GOM A;  1MW7 A;  3DQV C;  3UNG C;  2CS3 A;  2IGK A;  1N78 A;  3HXL A;  4IX7 A;  3VYS B;  3CJQ B;  4B43 A;  2XDV A;  4HST A;  3DLA A;  2AQE A;  4XKB A;  4BEH B;  3K4K A;  2UWM A;  2LG4 A;  1LDK B;  4BJ5 C;  4BUP A;  4LIV A;  3MKW B;  4ZDL A;  4E7Z A;  2ZFU A;  2LH9 A;  1U0J A;  1MMD A;  2JVG A;  4AVZ A;  4DIQ A;  4ZJZ A;  3OYI A;  4CZC A;  2BW3 B;  3FHN A;  4PJL A;  5FRN A;  2ZSH B;  2IXS A;  2R7S A;  3DPU A;  2E5Z A;  2PMZ A;  2X6Y A;  3H35 A;  2R7Q A;  4KT6 A;  3AL0 C;  2E5N A;  1WJF A;  2MFZ A;  2M7A A;  3ZXS A;  4RM2 A;  2BVM A;  2KRH A;  1WJ5 A;  1OR7 C;  2CW7 A;  3EUK L;  4NNJ A;  2KP6 A;  3SZG A;  2K5C A;  3I3L A;  3MKZ A;  3DU5 A;  3TBI A;  3OYL A;  2HU9 A;  5HOO A;  4X0G A;  3V42 A;  2X85 A;  1VZ0 A;  3PJR A;  2KLO A;  3DPL C;  3CF2 A;  4HSR A;  2K9L A;  2MYS A;  1T95 A;  2K9M A;  3OL3 A;  4IQ4 A;  3RCO A;  1BR1 A;  1W36 D;  4RLF A;  3OYJ A;  3H9G A;  4C30 A;  2OV7 A;  5HNH A;  3OS2 A;  4P5O A;  2R7R A;  2KQR A;  1GLN A;  4B3X A;  2VKH A;  4XM3 A;  4J00 A;  4BQQ A;  2LRE A;  4U87 A;  5KNL A;  2KDO A;  4XON A;  1E0E A;  2DCE A;  2MC4 A;  1FMV A;  1Z3X A;  2DJI A;  4DJA A;  2Q1Z B;  4YEL A;  2R4G A;  2HQA A;  1SFK A;  2GOX B;  4XLH A;  5KHD A;  4NUB A;  1EA3 A;  4XN3 A;  4NC7 A;  1DGR M;  1DP3 A;  3L2V A;  3K4N A;  4CA0 A;  3A1Y A;  1IRX A;  4KIS A;  4DBR A;  3QOD A;  2VLA A;  1UG0 A;  4ZDP A;  3U21 A;  4E6K G;  4BS9 A;  2CH0 A;  1TT0 A;  4C2T A;  2Z2S B;  2VXZ A;  2LY1 A;  3PNV A;  3KYL A;  2LBF A;  2VL8 A;  3VYT B;  3L2W A;  2HPM A;  3CES A;  2BOL A;  2WY7 Q;  2X1D A;  2VXD A;  3LSM A;  2HVR A;  3DTI A;  1Z7L A;  1J09 A;  2PJR B;  1Y56 A;  2R7T A;  3ZQQ A;  1NG6 A;  3OYN A;  3OYM A;  2CV0 A;  2CFO A;  1BR4 A;  4GRI A;  1QU3 A;  4CH7 A;  1FMW A;  4E7S A;  3LFU A;  3S8P A;  1LVK A;  3OYB A;  3SYT A;  3OY9 A;  4HRI A;  1Z21 A;  4XMY A;  3RTR A;  2X6X A;  2LC2 A;  4AU7 A;  3IAS 2;  1X1B A;  1ERD A;  3PSF A;  3D5S C;  3GBG A;  4N4O B;  2W82 A;  2LOO A;  3SEQ A;  2KL4 A;  3K6G A;  4E7I A;  4E7L A;  1QHG A;  3TL4 X;  4N4N B;  2W1O A;  4DBQ A;  2A5W A;  5HVQ C;  2WAD A;  4B44 A;  2XC7 A;  2ZXI A;  2KRC A;  4P1W A;  4BJT A;  4F55 A;  4BE0 A;  4ZDO A;  2KMU A;  2BVL A;  3A2K A;  4IQJ A;  2XSJ C;  2LY2 A;  4CCK A;  1V5F A;  3PFY A;  3OIP A;  1PJR A;  3HC7 A;  2LBF B;  4CCO A;  4XKC A;  4XKV A;  4PSX A;  3OYG A;  1WJD A;  1S9H A;  2VQG A;  2X1C A;  3OYH A;  4PJN A;  3OL4 A;  1Y6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...