2V7FA

Structure of p. abyssi rps19 protein
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
149
structure length
139
Chain Sequence
ATVYDVPGDLLVERVAQRLKEIPEIKPPEWAPFVKTLPEQEDWWYYRVASILRRVYLDGPVGIERLRTYYGGGHAPERFYKAGGSIIRKALQQLEAAGFVEKVPGKGRVITPKGRSFLDKIATELKKELEEIIPELKKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RPS19E SSU RIBOSOMAL PROTEIN S19E
publication title Molecular Basis of Diamond Blackfan Anemia: Structure and Function Analysis of Rps19.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Ribosomal protein
total genus 46
structure length 139
sequence length 149
ec nomenclature
pdb deposition date 2007-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01090 Ribosomal_S19e Ribosomal protein S19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2700 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2v7fA00
2V7FA 3J7AY
chains in the Genus database with same CATH superfamily
3QODA 4DOZA 1SEUA 1IRGA 1RIOH 4PJMA 1QBJA 4HQMA 4EJWA 1AKHB 1BR4A 1WWXA 3P9KA 3WGGA 2E5ZA 2E7WA 2F5DA 5M5YJ 2GIVA 2VASA 1XSXA 4L5JA 3B6AA 2W00A 3MQ0A 1A36A 3B02A 2ZJ2A 4ZYDA 1IN5A 2HWVA 3VYSB 2Z9OA 2JA6J 2XAHA 5AIQA 2DXIA 3OSFA 1A6IA 1UMQA 1FSHA 1F5TA 1S5LC 3LSPA 4ZDPA 1TWHJ 4I99C 5TRDA 4L5IA 3MZ8A 1N75A 1T33A 3HHGA 2D1HA 2K7LA 2VKEA 1R00A 1G8XA 3QYFA 2KMUA 3CCLI 4KNYA 3GTQJ 2J5OA 4IPAA 4KUMA 1KU2A 2HOTA 3BQZA 2R5ZA 2ME6A 5EZHA 3CJRB 4BY7J 2XKPA 3WTZA 2JZYA 3F8NA 3K4BA 1FYLA 3DLAA 3QPHA 2VLAA 1Y56A 3BTCA 2VPLA 3HOVJ 2B63J 1YTYA 4AIJA 4IXAA 3I58A 1K78A 2PJPA 2QQBA 1JHHA 4EJUA 3JRGA 3NRVA 2L9NA 5A2QZ 3GYHX 2K9MA 1MBJA 1X19A 2FEZA 3HRSA 3BPXA 1ZREA 3R4KA 5D5UB 3OYBA 2VJ5A 1FTTA 3GFLA 3WTXC 2DFFA 2EA4A 1TQIA 3BR6A 2O8XA 1ZG5A 1OCTC 3DEUA 2QQ9A 4P5OA 4YG2F 2F4OB 2R7DA 4RA2A 4U0VA 3KP3A 5HDNA 1KQ8A 2HZTA 4P96A 4ZYEA 3SXYA 2ZNZA 3VWBA 1JKQC 3KZZA 3WTTC 1IXSB 1JXSA 1VZ0A 1BI3A 2VUMJ 3V7RA 4M9XA 1ONVA 2DOEA 4C2TA 5F64A 2HVQA 1U0JA 4IRHA 3HRTA 3RPQA 3LAPA 1RI7A 1ZELA 4LGWA 2V9VA 1BI0A 1PUFB 3E0JB 1G3SA 4OMZA 4O3MA 4UUSA 4RB0A 3HSFA 1P7JA 3G1LA 4M3GA 3E5QA 1HW2A 2JA2A 3A0BC 2F48A 4BJ6C 4JOMA 4UUTA 2HYFA 4PJJA 5J8FA 3ABLH 3S17J 3WG7H 4I2OA 1YYVA 2LR8A 5LEKA 1P9QC 1HOMA 3BROA 5HS8A 5GAEJ 4BYYA 3FXKA 1A5JA 2A61A 1MDMB 1SVOA 5IYDJ 3MN2A 1IN4A 1LFPA 1OYYA 2CW7A 2PBIA 2QYOA 4FHTA 4HX8A 5F0FA 3COAC 4ZJZA 2ISZA 1T56A 4ENKA 3J7AO 3MKZA 5ILSA 5LBQA 3DLLF 1W5TA 5LEJA 3Q0UA 4G6QA 3L2VA 2HQ5A 4NNJA 1ZG1A 1ZLKA 3ULQB 3GW2A 5GTHC 5EGOB 1MNMC 1WHUA 2K02A 4ON0A 2FX0A 2Z33A 3ZMSA 3V42A 2M0CA 3HYIA 2F5EA 3M1EA 2H1LA 2R7QA 5FKOA 2EK5A 5DCMA 2ZCWA 1VQKI 2DU9A 2IBDA 1ZGAA 3IUOA 2VE9A 3C18A 4XLNF 1IG7A 2RDPA 5EG0A 5M3MJ 2KJCA 4FX0A 4HLYA 1D5VA 1Z67A 1IXCA 1GHCA 3HDDA 3J7YJ 1MMNA 4MHGA 3K70C 4IJAA 5B1AH 3HOTA 4IVNA 2BHYA 1TW2A 3BR5A 3HC7A 3PNTA 3KP2A 4GCVA 5HLHA 1VFCA 1ZRDA 3BR3A 1HF0A 1MH3A 3OY9A 3H5AA 4IL6C 1SFXA 4CCNA 1BA5A 1MMGA 5GAGJ 3KP4A 3ABKH 4QTRA 4D5FA 2MFZA 3LA2A 2RREA 4RMNA 1V5GA 1X1CA 4JK1X 4UVAA 4BH9A 3M8JA 3S1QJ 4PJNA 1OJLA 2TDXA 1SFOJ 2IGOA 2OQGA 3F0CA 2MLKA 2K3PA 2M4GA 3DEWA 2CUJA 1XD7A 2IGMA 2WBMA 4M6VA 1J59A 1IV8A 1R7JA 2ZMEB 3RQIA 1HW1A 2WB1N 1YO5C 4AVZA 1P7IA 4BQQA 3FHZA 4Q5SF 4Y52J 1YS7A 4HAMA 3OS0A 2KIQA 1S29A 3K9TA 2A6HF 2EWNA 3K1NA 3NAUA 3NARA 1FEXA 5K7ZA 3ZP5A 3L00A 3PSFA 1KU9A 3BCAA 2KKOA 4CYCA 1S9HA 3PNYA 1G6NA 4CH7A 2JN6A 2QKLB 1OCRH 1KONA 3M7GA 3P5JA 4HSRA 4HV5A 1SVMA 2IP2A 2PI0A 2DPDA 1QNTA 4MTEA 3OS2A 1BC8C 3OYDA 2IS2A 1XC5A 2NXNB 3G2BA 4GRIA 2NNNA 4ABZA 2CV1A 3U21A 1Y1WJ 5IY5H 4ENMA 4IEJA 4BEHB 1UELB 4L9JA 4AYBA 3OSGA 2VJIA 3F9KA 4P1WA 4RAGA 3MKWB 1UHMA 1E3OC 3HJEA 3A2KA 5HLGA 5C4XJ 3IWFA 4XN0A 3HUGB 5LRSA 5K5QA 2JA5J 4XRMA 1A04A 5EEGA 2LG4A 2BYVE 3R0JA 5J1UA 2KISA 4DZJA 1B72B 1BL0A 2DT7B 3EUHA 4E7IA 3JSPA 1ETKA 2Q2EA 1D1BA 1B59A 4H0EA 4NDLA 4A3IJ 1SC7A 2HNHA 1FBQA 3C2HA 1MBEA 4FETA 2ELHA 1QHHD 4A3JJ 4LIVA 2V7FA 4FE4A 1ODDA 2QVOA 3JRHA 4LLGF 2LKXA 3CO6C 1P6RA 2V1XA 2W7NA 2BY0A 1F4KA 4M74A 2CMPA 4ZYGA 1R5HA 2GAUA 3MKLA 1R1VA 2FF4A 3K2ZA 1MD0A 2VKVA 3I5UA 1NG7A 3KLNA 3W6KB 4AIDA 3O6BB 4HA8A 4E4HA 2ZJPF 4LB5A 1VNDA 3MD2A 2XIGA 5E1XA 1ETWA 1WFXA 3NQOA 3BJAA 5E1ZB 2OA4A 1STZA 3WODF 1EKEA 2VXDA 4PSXA 4A3BJ 1XTAA 2DMUA 4F7ZA 3FISA 4M3DA 1B6AA 1TWCJ 2CUFA 2Y69H 3A01B 4BHPA 2IGNA 2ZSHB 4XONA 1OYIA 1YX5A 3PIPF 2CQXA 2LK2A 5CVRA 1BOAA 1IAWA 1Z7UA 3I55I 1QO0D 1FP2A 1LVKA 2ZMEC 4WX9A 4I01A 1IRXA 4B8XA 1D5YA 3BR0A 4NUBA 2FE3A 3M1CA 4Y15A 4LITA 1BIBA 1ETVA 1V55H 2QLZA 3QU6A 4BE2A 2Y9ZA 1I5ZA 1J5YA 3IKVA 2STTA 2GIZA 3ZMUA 2MD0A 2RN7A 3F8CA 2FMYA 3LSIA 4N4NB 4UVBA 1LVAA 4AIHA 1IV6A 3VPRA 1X1DA 5CVVA 4LG0B 5D6FA 2DA7A 1JKPC 2J5PA 2Q0OA 1UHSA 3SEQA 3W2WA 2YX7A 1TWFJ 2GOXB 4LLLA 3RI4A 5D4RA 2YU9J 4A6DA 2X6YA 2WC2A 4C2MJ 4OIRF 4ZTFA 3JTHA 4L18B 1P4XA 1WPKA 3HOYJ 2PQ8A 2VC0A 4A3FJ 3F6OA 4YIRX 2HQNA 2PFBA 3KEYA 5FD6A 1MSFC 3I4PA 5ICCA 5HNHA 4XIDA 2DPUA 1USSA 2C6YA 3RKQA 4IZZA 2DDBA 2LP0A 1HC8A 1U5TB 2EJRA 1G59A 3W3CA 1PUEE 1JT0A 3R61A 2EFQA 3TDUC 3H36A 3HEFA 3DXJF 4A5MA 1K6OA 5DD4A 3OIQA 1EJ9A 4Q48A 3P7NA 3BP8A 1U78A 3BG7A 2JMWA 2JVHA 2E5NA 4TV7A 2OTLI 3LSTA 3S1MJ 2L2OA 2CQQA 4J01A 1FTZA 3I59B 3V8LA 3CUOA 1T08B 2NS7A 3K69A 1UB9A 1J2XA 3CESA 1I27A 4MFEA 4UY8I 2H27A 2IA0A 1AWCA 3ZXSA 2ACJA 4WWCA 2MD5A 3BZKA 3HSRA 3K0LA 3RQ4A 4RDUA 1A6QA 3S16J 4N0BA 2ZJRF 2V6CA 1GV2A 1VQ9I 3EPZA 3FWEA 3ABUA 1S7AA 5CQGA 2COMA 9ANTA 2VB6A 1G2HA 4BJTA 2M8GX 3K7AJ 1IZ1A 2R7FA 3CC2I 1IUYA 1XGNA 3ZMTA 4PDKA 2DK8A 1Z05A 2X9DA 4BQOA 3G71I 3PSIA 1T98A 3ESWB 3HOZJ 3TW7A 3K1PA 1XGSA 1B9NA 2K40A 3EYYA 4JQFA 5E1WA 5DDGA 2M30A 3L09A 5C4JJ 3HZJA 5FJ8J 2M45A 1LPQA 1J7KA 2LLKA 1ZQ3P 3L2UA 2CQ7A 4UXNA 2CV2A 1LJ9A 2EH3A 1X3ZB 3FHNA 3AG3H 3UKGA 2VQLA 3BDDA 4DBQA 1MBFA 1B1BA 2NVYJ 3D5SC 2DFHA 3PUBA 4IQJA 2VPRA 2DA2A 4LD5A 3CMAI 3QWLA 5KNLA 4HNUA 2EBIA 2RVCA 5JLWA 3KIOA 1BJAA 1XGOA 1YW8A 4O6JA 3DKYA 1OKRA 2B0LA 2K4JA 2IJLA 2UV1A 4FT8A 1T0FC 3O8GA 1UFMA 3E7LA 3LNQA 3NWSA 2XGEA 2ID3A 5F0HA 1K61A 1K4SA 3NEUA 1DDNA 3KETA 1T95A 2E2JJ 2XPVA 5KCMA 2ZBKA 2P4WA 1I1GA 1WCMJ 3UNGC 3H0DA 4I0AA 3N4MA 3W2VA 2DJIA 3KFWX 2ZO4A 3ASOH 3CUQC 1U5TC 2OC6A 2NOGA 1VQ6I 3DFGA 1PVEA 2V1UA 2LDUA 3GCMA 2Z3YA 3AAFA 5BMZA 2AHQA 3KX2A 1QVTA 3GZ6A 3CCSI 2H6BA 3QP6A 4U7BA 2QEXI 2NOJB 2DMQA 1FX7A 4AWXB 4BE1A 1Z7LA 2R3SA 2FJ1A 2LKSA 3E6MA 2ZJQF 3BQYA 1QA6A 2P5KA 3HM5A 4ZZLA 1XMAA 3D5LA 2Z16A 4JX5A 2Y0SN 2FU4A 2O7OA 1S6LA 1DU0A 1X4OA 1MGTA 4LK0F 4F52A 4QSHA 3I9V2 5FFXA 2OV7A 5LFAA 1ON1A 1R5GA 5IP7J 4A3EJ 2DYSH 2LOOA 2R93J 4ZTJA 2ELKA 4MLOA 3U2RA 2P8TA 1BIAA 4BS9A 3ZQHA 1T6SA 5A2QK 2X6XA 3CP8A 4PSWA 2K9NA 1BI2A 1ZRCA 1TWAJ 2HDDA 2COBA 3CCEI 2DMTA 4DBRA 1PDNC 1LKXA 1E0EA 4MNUA 5HLIA 3CCRI 1RR8C 4CCKA 3W6VA 1O7FA 3ELKA 3U1KA 2DI3A 2RGVA 2WV1A 2XAJA 2ISYA 3GFJA 2FOWA 2M7AA 2X6OA 4YIIA 2W85A 4HDUA 4RLFA 1W4MA 4DYRA 2FNPA 3OL3A 5FRNA 2ID6A 2ICWG 2QCOA 1QZZA 4XLCA 4F93B 1K4TA 2EIJH 2FD5A 2QM3A 3FX3A 4ZYAA 4ZYHA 1R22A 5J3LA 1YFHA 3O3KA 4G9YA 3GFMA 1GXQA 3TEDA 3S3MA 1OCZH 5E79C 4UB8C 2OTJI 3J81Z 2CO5A 1SFKA 3ERED 2RQPA 5ICGA 1R4MB 1ETQA 3EDPA 3OYHA 1JJ6C 4HF1A 3SZPA 1FBSA 1JUMA 1OLTA 2VC1A 2WAQN 3WTWC 2JUGA 5DM7F 2DT6A 3K1MA 4KIBA 1X2MA 3E6BA 3OMYA 3E6DA 2Y9YA 3T8RA 1A35A 5FROA 1KA8A 5IYCJ 2XRNA 4QPQA 2DBBA 2QF7A 4M71A 2JPCA 2CG4A 5F1RA 5L3BA 4RBOA 1YI2I 3K4CA 3HOWJ 3JREA 3FKJA 4ETSA 2G9WA 3B73A 2K9SA 3PO3J 4HYEA 4BKXA 5EYRA 4KISA 4D5CA 1IO2A 2IXSA 3WE2A 2LFBA 2BHZA 1WJBA 4KIGA 3ZQFA 2VQHA 2OCEA 1W0UA 4ZC3A 1YE9A 3K4LA 4CCJA 2DAOA 3DV8A 3EUAA 4UV9A 1D0ZA 2FUG2 3K4JA 3S1NJ 4Y33A 1E3HA 4EEFG 1RESA 1AU7A 4FCYA 5LRRA 4UHTA 1JKOC 3H5RA 3CMEI 1QZYA 1BW5A 4IHYA 5FLXZ 2JSCA 4A3KJ 2K85A 2BW3A 2OF7A 3QOEA 2EV0A 3PNVA 4F92B 3TQNA 1YIJI 4A69C 1AOYA 4G7OF 4XORA 3KYCB 4KN7X 3H3VK 1G3WA 4MQ9F 1NK2P 3U9GA 4HW0A 1CF7A 4PUSA 2DA3A 3CCMI 3MEXA 1WZ2A 3HTSB 5CVIA 3QPSA 1O3RA 1GT0C 4IHWA 1J75A 1Z91A 2RKHA 2KL4A 1DUXC 1XDUA 4M6YA 4UUSB 3M8FA 3FXQA 2MH2A 3M9AA 3OYEA 1WJCA 1MKMA 3S2HJ 1JE8A 4KA4A 4UB6C 2JJ7A 2XROA 3ZGKA 1S7EA 4D7MA 3O2PE 2EFOA 2F4IA 2CFOA 3CLQA 3FK7A 4EM0B 2DK5A 3QYBA 1D8JA 3KP6A 3J80Z 1V4RA 3A1YA 4OAZA 1F43A 2K27A 5D4SA 5C3EJ 2R7RA 4JYKA 2KIUA 2PMZN 3RZDJ 3ZOBA 2M4KA 2ETHA 3JAMZ 3KZYA 1QZEA 1YITI 1BM9A 5H2FC 3MMYB 2KT0A 4LMYA 5EJCA 3JSOA 3LSKA 4LFUA 2CRGA 4EQQA 3HOUJ 2R7VA 2YX4A 3B6CA 3CTAA 2K86A 4E7SA 1JTYA 3RDIA 2W24A 4DGWB 4LB6B 2IT0A 1J0RA 4U0YA 3JRFA 5BPDA 3KE2A 4B47A 1RKTA 1XSDA 2XSJC 2JTVA 1S3JA 2EZKA 2BVLA 4B1RA 1T8IA 4A0ZA 3OWTA 3DQVC 2O0YA 3ZCOA 2BY2A 1D1AA 2M9HA 5DCMB 5GPAA 4WF2A 3S3NA 2RNGA 4A3CJ 1VTNC 5HLTA 2JK3A 5EG0B 2MYSA 4EMSA 3BJOA 3QYEA 3C3WA 1E3PA 2DQRA 4PGGA 4XRSA 3ABMH 2Y31A 1FJLA 2QQ8A 3W2AA 1XMKA 3E97A 1XN7A 4HQEA 4PFPA 2PX9A 2R5YA 3DTKA 3F21A 1TP4A 3S8PA 3FXMA 3HGGA 4XRFA 2ME0A 2ZNYA 1UAAA 1FSEA 1P4AA 3PJRA 2EB7A 3F8MA 2Q8KA 2CJJA 3H3ZA 4HRIA 2HVSA 1TC3C 2LREA 4RGUA 3I54A 5EZGA 5IT3A 4CCMA 4OAYA 2DT5A 2DJNA 2V26A 4XSXF 4S0HB 3CDIA 2DMPA 3HRUA 5ILVA 4Y17A 3BG3A 4ENJA 3L2QA 3WTSC 4W1UA 4HX4A 2OZUA 4QWQA 2VOOA 4B3AA 3MWMA 3LQQA 3QAHA 1U8BA 2X51A 2OD5A 3MKYB 2NNYA 4KIFA 2EILH 3L9FA 5FLMJ 3S93A 3H9GA 5JLXA 2DA5A 1MIJA 1SMTA 2L3DA 2LRDA 4B48A 4CYCB 4BHCA 2M3AA 1VQNI 3KPHA 4PCQA 2DA4A 5LD2C 2EFPA 3P9CA 3ZQCA 4D7NA 3VYRB 4FE7A 2EV5A 2VQCA 1MMDA 3IC7A 2KZGA 2V4JC 2TRTA 4HEA2 5CVUA 2XRLA 2YUSA 4X0GA 1BW6A 3I53A 4KN4X 1XG1A 3LSGA 2X85A 4CXFA 3PL8A 2E19A 2FBIA 3OIOA 4XM3A 5DCFA 4ZH4F 3AFHA 5E3OA 2E60A 2M2EA 3OYLA 3Q0WA 4D0PA 5EDNA 3Q0VA 4ZZDA 2LC2A 4Z2YA 3WGHA 1P92A 3CF5F 2O03A 2OJED 2Q2EB 3JRBA 1Y1VJ 3OYMA 4M3BA 3CCJI 2EZHA 1SMYF 3VDXA 4MQVA 4XL9A 1YJ9I 1RNLA 2P5VA 3PQKA 4IOAF 1I6HJ 2R7UA 2L5QA 1MZBA 3CCQI 4OIQF 1POGA 4M3FA 2QUFA 3JTGA 4BBSJ 4IX7A 2HXIA 2DTRA 2P7VB 1MBGA 4QPOA 5F27A 3H3UA 1OR7A 4GYIA 2M7BA 3WE3A 3HL2A 3BR1A 3SDGA 2VXZA 1D0XA 3RPUA 3IHUA 4G12A 1G3TA 1RKWA 3LWFA 4AU7A 1X3WB 1BC7C 3GTKJ 3VSLA 4AC0A 2DQLA 3PIOF 3FXLA 4L9NA 1ENHA 4A3DJ 1ZARA 5FKLA 4U87A 1DPUA 5BNGA 2DDAA 2HGCA 3KYLA 2NRAC 2FBHA 1X3UA 3C7JA 2LBFA 4PJ0C 4GDFA 3FM3A 1W5CC 4OIPF 3BZ6A 3IH2A 2GXGA 1MBKA 1R6RA 3D0SA 4F55A 3EUKL 1KZHA 1R49A 5GPCA 1H0MA 1XSVA 1IC8A 3GTLJ 5LHHA 3FK6A 4EV0A 1QHGA 3AG4H 4HOBA 1IJWC 2D1VA 3HKZN 4CSWA 5FKKA 3TO7A 2F6CA 1ON2A 3L7WA 2X48A 4FISA 2R7OA 5J47A 2R7XA 3S2DJ 2QZ8A 2W57A 1VF9A 2HKXA 2AO9A 2M0MA 3WHCA 1KQ0A 1OCCH 4N9IA 4Y3OA 3DP7A 2V9KA 4M9SA 3RYPA 3GTMJ 1R5ID 1MJ9A 4XNFA 1XDSA 1DP7P 3F72A 5FLVA 3BOQA 3IL2A 1W7PA 4S04A 1USTA 3BG5A 3UR3C 3F22A 5IT9Z 4XLEA 1D1CA 1U2WA 5CJ9A 4CICA 3BWGA 3FBIB 4YFNF 1ZLJA 1LFBA 1PP8F 5FKMA 5E20A 5LHIA 3GTGJ 1IRZA 2OCCH 2HYGD 2XAGA 1E17A 2FA5A 3BG6A 2VE8A 2DODA 1XCBA 1EV7A 2P0WA 3BC8A 3REOA 5ED4A 3EUHC 1ETOA 5JR3A 3ONQA 3RKWA 3M8EA 2NYXA 4JBAA 4PFOA 2O3FA 3G3ZA 5TGTA 3OYKA 4KICA 2FQ3A 3WU2C 4BGDA 1IDYA 1QU3A 3DU5A 3BJ6A 4L9VA 4HNTA 4MEXF 4N9HA 2VBWA 2AQFA 3O8HA 2UZKA 5ICEA 1ORKA 1T38A 2IAIA 5J40A 4WK8F 3SDBA 4OINF 3GLLA 1R36A 4KMFA 3QQAA 4XICA 2VODA 3ASNH 3BTIA 2H94A 5FGMA 2OQRA 1BR2A 1ZKGA 2GA2A 5J1RA 2R7WA 1FMVA 4OWRB 2CW0F 4H4KC 3I4NJ 1R71A 5TJJA 3BT9A 1SFUA 2XASA 2ESNA 2P81A 2O8KA 1K83J 3KZIC 3C2BA 2IVMA 5HNFA 2W84A 1QPIA 2RV8A 2XV4S 3DF8A 5HODA 5IOZA 2DOAA 3V8KA 2XPUA 5KAFC 5E8IA 1WVRA 2FRHA 2XC7A 3ZMZA 1ZK8A 2ZXWH 4R8HA 4Q47A 2PMUA 1VQ8I 4M9ZA 1S72I 1VI0A 2XB5A 4LIUA 5IYBJ 2MH9A 4G7HF 4BXFA 3OR1C 3HOXJ 2MA3A 1JI8A 4MFDA 1JHFA 5DUIA 2F4MB 4XN3A 2VIXA 2CQNA 3VOEA 1Q1VA 5HS9A 4HBLA 4A6EA 4BXUA 5IP6A 2WB1A 2LSOA 3DEEA 2FQ4A 1K79A 3WGIA 3OYFA 3ROUA 1RETA 1IUFA 2GZWA 2VL8A 5F1JA 1LDDA 3IAS2 4A2UA 2L7ZA 2PG4A 2ZSIB 4GGGA 4XOTA 5C44J 2Y30A 4IO9F 1TL8A 4YFXF 3H92A 2HEOA 1MH4A 3Q5FA 2XF6A 4P55A 1EF4A 1B9MA 1FOYA 4A3GJ 1XS9A 2YR2A 3DWLE 1RPWA 3LA3A 4I09A 3E6CC 3GWZA 5DUKA 3FXRA 2E71A 4IKFA 3OYCA 2LNBA 4IRIA 2ESHA 5M5XJ 1UHWA 2BZTA 2PMHA 5JFRA 2JWTA 2KQRA 3SEZA 4AIKA 1IXRC 2IPQX 2RQQA 2ZFWA 4HG2A 2M87A 3J81K 1FIPA 4RGSA 2F5CA 2P6SA 5BS6A 1DPRA 2VT3A 3ZQLA 3DKWA 1YX3A 5FO5A 3KCCA 2WADA 3SQNA 1Z0XA 1RRJA 3V7CA 4XLHA 3LFUA 5LLQA 4V19K 1IRFA 1YIOA 2E1CA 2L0KA 2Y2ZA 2WY7Q 1O7LA 2HPIA 1ZTRA 1MJAA 1V5FA 2KHMA 2XAFA 3CCVI 3OV8A 1BOBA 1KU3A 4O5VA 3WTVC 4ZDLA 5EEAA 5TISC 3P9IA 4G8XA 1RC9A 2QA4I 5KAIC 5D5XB 1Z77A 2DOFA 2CV0A 1I3QJ 1R9TJ 3KEQA 1YS6A 4D9JA 2HZDA 5DD8A 2L4MA 1FBUA 3I0TA 4RM2A 2CWEA 3TP3A 2E1OA 4BUPA 4Y13A 1DGWY 3M4OJ 5HS7A 3FKIJ 1LDJA 1L3LA 5EF6A 4RB1A 3J7ZI 2KRHA 4BDYA 4NB5A 2W25A 5FLXK 4EGYA 3BLYA 2BOLA 4XLAA 2WY8Q 3H0GJ 5D5WB 1ZR4A 4I0BA 4XKCA 3BZCA 3IH4A 2EFNA 3E3VA 1ZH5A 1EH7A 3LL7A 5M5WJ 4OOIA 5K7FA 2KIFA 4GXOA 2R92J 2O61A 1QPMA 4X6AJ 4KDPA 3PM1A 1SD4A 2L7MP 4NC8A 5LGUA 4IOCF 4C2UA 5DYMA 2DFIA 3SYTA 3WU1B 4CA0A 2V6EA 1SD5A 2H09A 4WXDA 2H8WA 4BL0B 4CYDA 1WH7A 2A3SA 4IHSA 1WQ2A 3GBGA 3DTEA 3G4SI 2CSOA 3ERMA 1V5EA 3WU0A 1CGPA 4QLCU 4V2FA 5FB2A 5K7HA 3CDHA 5KK1A 3JAMK 2ZXHA 4ESFA 3OYAA 1N77A 5HDGA 1GUUA 4LOCA 3RSNA 1OISA 2BEOA 2VJ4A 4AM3A 1YRNA 3Q3SA 4Q4ZF 1B4AA 3HPHA 3VYTB 2YPRA 3G6EI 3GLXA 4G7ZF 3TDZC 1JGSA 5IOYA 3ABTA 3BPVA 4L0YB 1LQ1A 5DV5A 3WTUC 1MJBA 3F3XA 3A0HC 3T8TA 3IRQA 3TO6A 2XF5A 3F23A 4CZCA 4HNVA 3BY6A 3HXLA 3DPLC 3GO5A 3F8FA 2JT1A 4LK1F 5K5OA 3HB9A 2QBYB 2F2EA 1X2NA 2PJRA 1DGRM 1S7OA 4XSZF 1W36D 2BW3B 1LB2A 2Z2SB 5E3MA 1NG6A 2UWMA 1ZGWA 3CLOA 3PUFA 1LDKB 4XR6A 2HOSA 2L7KA 3E5UA 1X1BA 4B4CA 1CF7B 1WI3A 3HG9A 4HLXA 4I7HA 3CC7I 3W6JB 4CO8A 2MSYA 1DU6A 2NS0A 4U88A 4A3MJ 2G7UA 3K4NA 4R1HA 1CQTA 4HV6A 2HTJA 2VJJA 2LD5A 1A31A 3OL4A 1M1EB 3GTPJ 1P2FA 1S8NA 2RAEA 2V9PA 1KYWA 5GAHJ 5JI6A 2MG4A 1FYMA 3TBIA 5F6FA 2QSFX 1SAUA 4B43A 4FASD 5BPIA 4C3JJ 4R79A 1OYWA 2Y75A 3OYGA 2VI6A 2B7EA 2EQRA 2WV0A 1NH3A 1O4XA 1TQMA 1IN8A 4KT6A 5ILUA 1HXDA 2HOAA 4C9YA 1Z6RA 2VONA 3AG1H 1WKMA 2IA1A 2XAUA 3OS1A 3KLOA 2L4AA 3ZMDA 4IHTA 1X4PA 4MGRA 3TGNA 3PO2J 4YIFA 3GTJJ 3MAJA 1F36A 1Y6IA 2GLOA 4I6ZA 4LJZF 2QBYA 4I98B 2KZVA 2EINH 1QRYA 1HBXG 1I50J 1FMWA 3GZNB 3FXUA 4M73A 4DYQA 1LE8A 2MW8A 3BR2A 4OIOF 1WI9A 3RYRA 2K4BA 2JVGA 1Z3XA 5FFZA 2KFDA 2DLLA 1KQ9A 3MCZA 2NVQJ 1DP3A 2F5FA 1HLVA 2HFHA 4EVIA 2L7FP 3I4MJ 2R7SA 2BBYA 4ENNA 1T2KA 5FKNA 2ZXJA 4IRGA 3HIFA 3JW4A 1QVUA 3VSKA 3WG9A 3I71A 5HDKA 1IDZA 5HOOA 1O3TA 2R5YB 2JA7J 4CCOA 2LMDA 1Y8RB 2CUEA 2ECCA 3N05A 2QENA 1VQ4I 2CUZA 3DPUA 3K4KA 2O9LA 1JUSA 3RTRA 4C3HJ 1U8RA 5F04A 1O3QA 2WA0A 4RGRA 4A5NA 2KP6A 2TCTA 1Y0UA 4YRVA 4XQFA 1B8IA 3RKXA 3EETA 1ETXA 1I1SA 3RPUD 2Y48A 2R7ZJ 2HQRA 2OPTA 2BY1A 4NC7A 4I02A 3N97A 2V1DA 3QP5A 4AD9A 1HKQA 3SZTA 5D5VB 4FTHA 1SAXA 4AVPA 2Y0SA 1WJFA 3GF2A 2OAZA 2PEXA 1ZHFA 2EZIA 1HSTA 4RLQA 3I56I 3IKTA 4GFBA 3QPTA 3JRAA 2QGUA 4MO7A 1WJEA 4DIQA 2KDOA 2HKOA 2UXNA 3OYNA 4G6DA 4XBFA 4BU2A 2R4GA 3LSMA 1U9OA 1JT6A 2MLGA 3CJTB 1X1PA 2X1DA 5J1YA 3C1DA 4M72A 4CCLA 3DBRB 3ZQIA 2DMNA 2KDZA 2K9LA 3WHBA 1HQCA 1R4NB 3X2QH 5JHUA 1MW7A 2A6EF 1AKHA 2XGXA 4AYBN 2QWWA 4E7HA 2MC3A 1Z6TA 3DTIA 2Z99A 1LEBA 3F8BA 3SZGA 1KU7A 2E7XA 4A0YA 1UCRA 1XGMA 4EJVA 2GXAA 5GP9A 2VBZA 3HBLA 4Y4RA 4ASNA 1VQLI 1W7PD 2PLYA 2KJBA 1YG2A 2BXZA 5DTDA 3VODA 2QSGX 1BBYA 2DA1A 4E7KA 1W0TA 2BVMA 1Y39A 2HQAA 3HHHA 2K9QA 1FC3A 2QSHX 2E36A 2WAQA 3V4GA 4RAZA 4XKBA 5E18F 1Z9CA 2HOEA 3IAM2 1TQPA 4PJLA 2FBKA 2KRFA 2WAFA 4A3LJ 3ZN1A 2HVRA 1ERDA 1WJAA 1H9TA 1OCPA 1R1TA 2UXXA 5ICFA 1HKSA 1NHAA 1O57A 3I3LA 4XKWA 3RJPA 2GM4A 5IT9K 3DPTA 1G4DA 3HRMA 4V2GA 1TBXA 1W36C 2EIKH 3KYDB 3U1DA 5FD5A 3GUDA 4BDZA 4EGZA 3LMMA 2D5VA 2ADUA 3R60A 1QGPA 4HDVA 4F3QA 3JRCA 1HSJA 2XHKA 1GLNA 4DJAA 3FDYA 3D1NI 2N8GA 3BG9A 1WSUA 3CJQB 2DA6A 1JUPA 1H88C 4D1QA 1ZG3A 2LBFB 5CLSA 4EM2A 3HPGA 4JX6A 2BXYA 4B09A 5LGTA 5CPRB 5DS9A 3KP5A 4RAFA 4CHUA 1L0OC 5GADJ 2P5LC 1F9NA 1P4WA 3BTLA 3V8JA 1C0WA 3S15J 1AA7A 1X58A 1ULYA 4UUVA 2LH9A 4S05A 2M34A 3CO7C 3H9JA 4BY1J 2L9VA 3J7AY 3ZQGA 2DYRH 1J9IA 3PFYA 3R0AA 3S14J 2LVSA 1W1WE 5H20A 5IPAA 2HU9A 1BJZA 3T5XA 1GVJA 3H1CA 3OOUA 4LG3A 2W1OA 1RUNA 2LY9A 1ZN2A 3C2GA 4E7JA 1ZR2A 2MC4A 2E2HJ 2NAZA 1YHQI 2EV6A 4XLPF 5B5EC 3TMOA 1PUFA 1HKTA 2BY3A 3ECOA 3L2RA 2IGKA 4EJOA 1ZYRF 4IQ4A 1HCRA 2Q1ZB 1Z3YA 2IEKA 2MBFA 1PYVA 2A6TA 2GWRA 1LNWA 1UG2A 3RIRA 3TOAA 4IHVA 1W7PB 4C3IJ 4LLNA 1MNDA 3T0YA 2IS4A 1YQAA 2VOPA 4FQGA 5EEHA 3G1MA 2PMZA 3MVPA 5DEQA 4A0XA 5B3SH 4WCGA 2P7CB 3TKYA 2BE5F 1MDMA 3KEOA 2HS5A 4PK4A 3K6GA 3IH3A 1K6YA 2JRTA 2E1MB 1G3YA 1VQ5I 3A03A 3Q9SA 5FRMA 1XPXA 4E7LA 4WXHA 4ZDOA 4ESBA 1EA3A 3IWZA 1I3AA 4XKVA 4P9UA 2GQQA 4RB3C 2XKOA 5EGOA 2YSRA 3OYIA 1T39A 1KGSA 1UG0A 4N4OB 2MABA 1FWZA 2Z5UA 4KT5C 3MZYA 5JVTA 3CDLA 5BOXA 2DFEA 3CMMA 3LSRA 3QRFF 2FMLA 4DZPA 5M3FJ 1WGXA 1OFCX 5F08A 1OR7C 4A12A 3BTJA 3ISPA 3H35A 4RM3A 4DNCA 5B1BH 3QU3A 2UUZA 5D8LB 3H5NA 2LF8A 4CDGA 1FPQA 1FOWA 4XK4A 3OYJA 1R58A 3CCYA 3TO9A 4KITB 1MSEC 1Y8QB 4XMYA 2JSPA 2DN0A 3K4MA 4JP0A 2IA2A 4QIWN 3JRDA 3NWTA 3GVAA 2KIMA 4E7ZA 2DW4A 3PQJA 1JKRC 4NC6A 4U7DA 3CQZJ 2M8EA 1UJ8A 2K3FA 4A93J 3FXOA 2CH0A 2O6GE 1WRJA 1JTXA 2YU3A 3LSJA 2CGPA 5E8GA 2QQAA 1YJNI 4ITVA 1DQUA 3ZR8X 5B66C 2BV6A 2XF7A 5E3NA 2ZMEA 5H6RA 3AG2H 2CFXA 4U0WA 1VQOI 4E70A 2H8RA 3KP7A 1E2XA 1TNSA 2Z1DA 2M1BA 2HYJA 3ZMVA 2M5WA 4MTDA 3GTOJ 1WH5A 1HW5A 3SFZA 3F6VA 3JRIA 1RUOA 3FMQA 1Z1DA 5D6EA 3SFIA 4UV8A 2IRFG 2VT2A 1YOVB 4L5EA 2IW5A 4B3XA 3LAJA 1U6GA 4BHBA 5LHGA 1PP7U 3RZOJ 5BQTA 4Y7NJ 2XGDA 5J4VA 2LY2A 3ZQQA 1U3EM 1GVDA 2E34A 3TW6A 3OIPA 2LF7A 2E1MC 4BEHA 2HTSA 2OZ6A 5DM6F 3RCOA 3LOCA 1LFUP 1U9NA 2CS3A 3EYIA 3ML6A 5KVRA 2I8DA 3PFIA 3AL0B 3HUGA 3LSHA 1FZPB 5E3LA 1VQMI 4Z6YA 3MFKA 4M6XA 3TL4X 2X6WA 4XRSG 4RB2C 1B72A 3HTUA 1SD6A 2LYCA 2V79A 2ZKZA 4CUGA 4NBQA 5F0CA 3DCFA 2ZB9A 1XMXA 3GZ5A 1HDPA 1X1AA 1Y0NA 2W48A 1J09A 3A02A 3DU6A 1FOXA 5L3DA 1SD7A 4DQ2A 5L3CA 2ECBA 3CF2A 3ECHA 2CU7A 2KPMA 2W4SA 3LA7A 4NHJA 1WJ5A 2XAQA 2K5CA 4RS8A 3LFKA 3FBNB 2EA2A 1LEAA 2KLOA 1YJWI 2CYYA 3I64A 4E6KG 4UVCA 5H6QA 4G94A 4WXCA 2D2WA 2G7HA 2B9SA 1W5SA 4BNCA 4DYCA 4IHXA 1FNNA 2ZXIA 2JQ7A 3QOPA 1TW3A 3IRRA 3L2CA 3CUQB 5J8CA 1MMSA 3ZN0A 4DW6A 3M3YJ 3GXOA 3A01A 2JA8J 4OMYA 1Q1HA 1SFEA 1RR7A 1GV5A 3HKZA 2JPBA 1SANA 4GO1A 4IF4A 2W82A 2L01A 1MMAA 1R23A 5L3GA 2L02A 1EH6A 1TT0A 5CKTA 1GXPA 3E5XA 1K7AA 2H1KA 2E2IJ 2A5WA 2AQEA 4JX4A 4BE0A 3OOPA 3K2AA 2EIMH 4EATA 3EQLF 2HDCA 2XSDC 2VBXA 1F1ZA 1WJDA 3FMSA 2FSWA 4HSTA 2WAEA 2STWA 1I6XA 2DCEA 4W97A 2HPMA 2GOMA 4LG0A 3VFZA 1MNEA 2L9RA 4K2EA 3G1OA 3FF5A 2X0LA 2F5VA 1FP1D 2GBYA 4II3A 3L2WA 1TZLA 1QQIA 4MIMA 1TTYA 4ANJA 1T0FA 4UNOA 2IS6A 3HOSA 1YRNB 1D0YA 2CQKA 3HSEA 1FLIA 3FIWA 1UZCA 1R1UA 3H9QA 1D3YA 2PN6A 4NQWB 1FOKA 3AL0C 2Y0MA 4BACA 2NS8A 2A05A 2ZFUA 3TOBA 4GYGA 3G73A 2XB0X 3FXJA 2XDVA 3CUQA 1U5TA 4FX4A 3VYUB 4X1EA 2NVTJ 3CC4I 1VQPI 4OU0A 3FMRA 1AHDP 4PGHA 1IN6A 3BCBA 3L1PA 2PJRB 1ACIA 5AIPA 2I5UA 1ZAOA 5CVJA 1ETYA 2HR3A 1TWGJ 1D8KA 2G0EA 2OBPA 3I59A 2FXAA 2VKHA 5ERIA 1NK3P 2DO7A 1EH8A 2OUMA 4HF2A 2JUCA 1TNTA 2VN2A 4XOPA 3D5RC 3A4CA 4XLFA 4MEYF 3DBHB 3CJNA 2LTPA 4P9FA 4PZJA 3MZHA 4II2A 1YLFA 4BXXJ 4HZFA 1PJRA 3CZ6A 3SHFA 1XX5A 1TLHB 2I10A 2P6TA 4I76A 3VB2A 3OR2C 4BBRJ 3E1SA 4BQNA 1N78A 4AUXA 2E1NA 3J80K 2KRCA 1HA8A 3FZVA 5HVQC 4YEJA 1GDTA 3CP2A 2NVXJ 1IW7F 4C30A 1YW9A 1SVLA 3GX4X 4L0ZB 1LUJB 3T1BA 2XUBA 4RGXA 1FYKA 3HGYA 4HPQA 4KFCA 1H89C 3WTYC 2QKMB 2XGCA 1BR1A 4NQWA 6PAXA 2WTEA 3DKXA 2JRMA 3AKZA 2O5RA 2VBYA 3ZPLA 4J19A 2X1CA 4ESJA 2XPWA 2IS1A 2VKDA 3Q9VA 3IP4B 5CYVA 1ZGJA 2VQGA 4RAYA 5JHFA 4KYWA 5L3EA 2YS9A 2AXLA 4G6TB 4F91B 1H8AC 3JCUC 5J6XA 5LGNA 3JR9A 2ZC2A 4EJTA 2AXTC 2CW8A 1LE8B 2XVCA 5L3FA 2GA1A 2RC4A 4HF0A 1Z21A 2DTZA 3R6SA 2AS5F 2RNJA 2L9SA 4BJ5C 2R7TA 3S3OA 1IN7A 3ZRGA 4M3EA 2H6CA 2MGQA 1XCVA 1FY7A 1OPCA 5K1YA 5AONA 2A68F 2HDWA 3RKYA 1OCOH 3LQRA 4L9TA 3CD6I 5E17F 3GFIA 1I39A 1MBHA 1APLC 2BGCA 1ZRFA 5K5RA 3QPLA 2HI3A 3V7SA 5J4YA 5JVGF 1ITYA 2L54A 1RZ4A 2FOKA 1FT9A 2EZLA 4KMUX 4J00A 1KYZA 1FIAA 2D45A 1B8IB 1JGGA 4BQAA 5KHDA 3S1RJ 3IV5A 3SJMA 2R0QC 2FNAA 1VQ7I 2OU2A 2X1EA 3FM5A 3GEZA 1HDDC 1N25A 1JJ8C 1IGNA 2HXOA 5GTIC 2A5YB 1XB4A 2EFWA 3K70D 3S2WA 2R5ZB 1REPC 1BI1A 2LY1A 5IP9J 2E35A 2LKPA 1O3SA 4CZZA 1OQYA 2ELJA 1H9GA 4HX7A 3CMYA 2WWYA 1NTCA 1V3FA 4CGZA 3VEPA 3ZQ7A 2X4HA 5CQEA 1OMIA 3M07A 1K78B 1V54H 3TP0A 4BAYA 3DBLB 2NVUB 2A69F 2GXBA 4YELA 1BN5A 1YW7A 3S32A 2A07F 2V1NA 3CCUI 3K10A 3GMEA 4KJZA 4EM1A 2EPFA 4B44A 5D8KB 4YFKF 1TT5B 1IF1A
chains in the Genus database with same CATH topology
3DKYA 3QODA 3SDBA 4DOZA 2LH9A 2UV1A 1T0FC 4PJMA 3NWSA 3H9JA 3J7AY 1BR4A 3PFYA 1BR2A 2E5ZA 2HU9A 2R7WA 1T95A 1FMVA 4OWRB 2VASA 3OOUA 4H4KC 4LG3A 5KCMA 2W1OA 2W00A 3UNGC 3C2GA 3H0DA 4E7JA 3VYSB 2MC4A 3W2VA 2DJIA 2OC6A 2DXIA 3TMOA 5HNFA 3L2RA 2IGKA 4ZDPA 2DOAA 4IQ4A 1N75A 3KX2A 2Q1ZB 1Z3YA 4U7BA 2XC7A 1G8XA 1PYVA 2A6TA 2NOJB 3QYFA 2KMUA 4BE1A 1Z7LA 1MNDA 2IS4A 4LIUA 2PMZA 3CJRB 4BXFA 3OR1C 3D5LA 2Z16A 3K4BA 1JI8A 3DLAA 4XN3A 2VLAA 2VIXA 1Y56A 1X4OA 4PK4A 2VPLA 3K6GA 1K6YA 2E1MB 2WB1A 4F52A 3DEEA 3I9V2 2OV7A 5LFAA 3OYFA 2LOOA 5FRMA 2L9NA 4E7LA 2K9MA 4ZDOA 4ZTJA 1EA3A 1X19A 4MLOA 4BS9A 4XKVA 2VL8A 2X6XA 3CP8A 3IAS2 4PSWA 4XOTA 2ZSIB 3OYBA 2VJ5A 3OYIA 1UG0A 4N4OB 2MABA 4DBRA 1LKXA 3CMMA 1E0EA 2XF6A 4P5OA 4CCKA 1OR7C 3DWLE 3H35A 4RM3A 3VWBA 2M7AA 2UUZA 3H5NA 4RLFA 1VZ0A 3OL3A 4IKFA 3OYCA 5FRNA 4C2TA 4XLCA 3OYJA 2HVQA 1U0JA 4F93B 4ZYAA 1ZELA 3E0JB 2KQRA 4KITB 3SEZA 4XMYA 2JSPA 3S3MA 3K4MA 2RQQA 3NWTA 1SFKA 4HG2A 4E7ZA 3OYHA 1OLTA 2JA2A 2JUGA 4BJ6C 2DT6A 4JOMA 3OMYA 4PJJA 5FROA 1YX3A 4QPQA 2CH0A 2WADA 1P9QC 4XLHA 3LFUA 2WY7Q 3K4CA 4ITVA 2HPIA 1DQUA 3FKJA 2CW7A 1LFPA 3ZR8X 2XF7A 4ZJZA 1V5FA 2KHMA 4KISA 3MKZA 1BOBA 2IXSA 3L2VA 1WJBA 4NNJA 2Z1DA 2VQHA 4ZDLA 4ZC3A 1YE9A 3K4LA 4CCJA 2CV0A 3EUAA 4D9JA 2HZDA 1D0ZA 2FUG2 3K4JA 3V42A 4Y33A 2R7QA 4RM2A 4B3XA 4BUPA 1DGWY 3H5RA 2KRHA 4BDYA 2BW3A 3IUOA 3QOEA 2LY2A 3PNVA 3ZQQA 3BLYA 2BOLA 4XLAA 4F92B 2WY8Q 4XORA 3OIPA 2E1MC 4XKCA 4BEHA 4PUSA 3LL7A 3RCOA 1MMNA 2CS3A 3K70C 2I8DA 3HOTA 3AL0B 3LSHA 2KL4A 3HC7A 3PNTA 4NC8A 3OYEA 1WJCA 4C2UA 3TL4X 2X6WA 3OY9A 3H5AA 3SYTA 4CA0A 2V6EA 2LYCA 3ZGKA 4BL0B 2F4IA 4CCNA 4CUGA 2CFOA 1MMGA 1X1AA 2MFZA 3QYBA 3GBGA 2RREA 1J09A 3A1YA 1V5GA 3DTEA 3DU6A 4OAZA 4RMNA 1X1CA 1V5EA 3M8JA 3CF2A 4PJNA 2R7RA 2KPMA 2M4KA 2W4SA 2IGOA 1WJ5A 2ZXHA 2K5CA 3MMYB 3OYAA 2K3PA 2M4GA 1N77A 2CUJA 2IGMA 2WBMA 3LSKA 3RSNA 3FBNB 2VJ4A 2R7VA 2KLOA 4E7SA 4AVZA 3HPHA 3VYTB 4DGWB 4BQQA 4E6KG 3OS0A 4B47A 2XSJC 2BVLA 2XF5A 3PSFA 2ZXIA 3BCAA 3OWTA 4CZCA 3DQVC 1S9HA 3PNYA 3HXLA 3ZCOA 3DPLC 4CH7A 1D1AA 2QKLB 1KONA 4HSRA 3S3NA 2RNGA 1DGRM 2PJRA 1W36D 2BW3B 2Z2SB 3OS2A 1NG6A 2UWMA 3OYDA 5HLTA 2IS2A 3G2BA 4GRIA 1LDKB 2MYSA 4XR6A 3HKZA 3U21A 2CV1A 3QYEA 2L7KA 4BEHB 1UELB 4AYBA 1X1BA 2VJIA 3F9KA 4P1WA 2W82A 3MKWB 3HG9A 3A2KA 1MMAA 4XN0A 3W2AA 3HUGB 3K4NA 1TT0A 5CKTA 4PFPA 2VJJA 2LG4A 3DTKA 2A5WA 2AQEA 3OL4A 4BE0A 2DT7B 4EATA 3S8PA 3TBIA 4E7IA 1UAAA 1D1BA 1WJDA 1SAUA 4B43A 4FASD 3PJRA 4R79A 4HSTA 2WAEA 2DCEA 2HPMA 2GOMA 2HNHA 1MNEA 3OYGA 3C2HA 4FETA 4HRIA 2HVSA 1QHHD 2LREA 2V7FA 4LIVA 2F5VA 4KT6A 4II3A 4CCMA 4OAYA 2V26A 1TZLA 3L2WA 4ANJA 2W7NA 2IS6A 4C9YA 3HOSA 3L2QA 2CMPA 1D0YA 2XAUA 3OS1A 3AL0C 3H9QA 4NQWB 1NG7A 2X51A 4E4HA 4BACA 3MKYB 1X4PA 3MD2A 2ZFUA 1WFXA 1Y6IA 3H9GA 3S93A 2XDVA 3VYUB 2LRDA 2VXDA 4B48A 2KZVA 2M3AA 4PSXA 1FMWA 5LD2C 3BCBA 2PJRB 3VYRB 2IGNA 2ZSHB 4XONA 2JVGA 2VQCA 1YX5A 1Z3XA 1MMDA 2V4JC 1DP3A 4HEA2 2VKHA 1LVKA 4X0GA 1IRXA 2R7SA 3LSGA 2X85A 2OUMA 3PL8A 3VSKA 4XM3A 4XOPA 4NUBA 3D5RC 3AFHA 3A4CA 4XLFA 3M1CA 5HOOA 4LITA 2E60A 3OYLA 4BE2A 4CCOA 4II2A 1PJRA 3CZ6A 3N05A 2LC2A 2CUZA 2MD0A 3DPUA 3K4KA 3OR2C 2Q2EB 3E1SA 4BQNA 3RTRA 1N78A 3LSIA 4N4NB 3OYMA 2WA0A 2KP6A 2KRCA 1X1DA 4YRVA 3VDXA 4XQFA 1HA8A 5HVQC 4YEJA 2R7UA 4XL9A 3CP2A 4C30A 3RPUD 2L5QA 4NC7A 3SEQA 3W2WA 2GOXB 4IX7A 2X6YA 4HPQA 4QPOA 2QKMB 1BR1A 2Y0SA 1WJFA 4ZTFA 2M7BA 3HL2A 3DKXA 3AKZA 2O5RA 2VXZA 1D0XA 4RLQA 4AU7A 3KEYA 2X1CA 3VSLA 5HNHA 2IS1A 2VKDA 3IP4B 4IZZA 4U87A 5JHFA 2VQGA 1WJEA 3KYLA 1G59A 4G6TB 2KDOA 3W3CA 4DIQA 4F91B 3OYNA 2LBFA 4BU2A 2R4GA 3LSMA 2CW8A 1Z21A 2X1DA 1R6RA 4F55A 3OIQA 3EUKL 4CCLA 2L9SA 3BG7A 2JVHA 2E5NA 2K9LA 4BJ5C 2R7TA 1QHGA 2L2OA 3S3OA 4J01A 3ZRGA 4CSWA 1MW7A 3CESA 4E7HA 2HDWA 2F6CA 3ZXSA 3DTIA 3RQ4A 2R7OA 3SZGA 2R7XA 3EPZA 4Y4RA 5CQGA 2M0MA 2VB6A 4E7KA 4BJTA 2BVMA 2HQAA 4Y3OA 4J00A 2V9KA 2WAQA 4XKBA 4BQOA 3IAM2 3PSIA 4PJLA 4XNFA 5KHDA 2WAFA 2X1EA 2HVRA 3UR3C 1WJAA 1ERDA 4XLEA 1D1CA 4JQFA 4XKWA 3I3LA 3DPTA 3FBIB 3K70D 1W36C 3L2UA 2LY1A 4BDZA 2CV2A 3LMMA 3FHNA 2ELJA 4F3QA 1GLNA 3BG6A 2VQLA 3FDYA 4DJAA 4DBQA 2P0WA 3BC8A 3D5SC 3CJQB 3EUHC 5CQEA 3ONQA 3PUBA 4PFOA 4D1QA 4IQJA 2LBFB 5TGTA 3OYKA 1QU3A 4BGDA 5KNLA 3DU5A 3HPGA 4YELA 4HNTA 3S32A 5CPRB 2V1NA 4HNUA 3K10A 4KJZA 2AQFA 4B44A 1AA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V7F A;  3J7A Y; 
#chains in the Genus database with same CATH topology
 3QOD A;  4DOZ A;  1SEU A;  1IRG A;  1RIO H;  4PJM A;  1QBJ A;  4HQM A;  4EJW A;  1AKH B;  1BR4 A;  1WWX A;  3P9K A;  3WGG A;  2E5Z A;  2E7W A;  2F5D A;  5M5Y J;  2GIV A;  2VAS A;  1XSX A;  4L5J A;  3B6A A;  2W00 A;  3MQ0 A;  1A36 A;  3B02 A;  2ZJ2 A;  4ZYD A;  1IN5 A;  2HWV A;  3VYS B;  2Z9O A;  2JA6 J;  2XAH A;  5AIQ A;  2DXI A;  3OSF A;  1A6I A;  1UMQ A;  1FSH A;  1F5T A;  1S5L C;  3LSP A;  4ZDP A;  1TWH J;  4I99 C;  5TRD A;  4L5I A;  3MZ8 A;  1N75 A;  1T33 A;  3HHG A;  2D1H A;  2K7L A;  2VKE A;  1R00 A;  1G8X A;  3QYF A;  2KMU A;  3CCL I;  4KNY A;  3GTQ J;  2J5O A;  4IPA A;  4KUM A;  1KU2 A;  2HOT A;  3BQZ A;  2R5Z A;  2ME6 A;  5EZH A;  3CJR B;  4BY7 J;  2XKP A;  3WTZ A;  2JZY A;  3F8N A;  3K4B A;  1FYL A;  3DLA A;  3QPH A;  2VLA A;  1Y56 A;  3BTC A;  2VPL A;  3HOV J;  2B63 J;  1YTY A;  4AIJ A;  4IXA A;  3I58 A;  1K78 A;  2PJP A;  2QQB A;  1JHH A;  4EJU A;  3JRG A;  3NRV A;  2L9N A;  5A2Q Z;  3GYH X;  2K9M A;  1MBJ A;  1X19 A;  2FEZ A;  3HRS A;  3BPX A;  1ZRE A;  3R4K A;  5D5U B;  3OYB A;  2VJ5 A;  1FTT A;  3GFL A;  3WTX C;  2DFF A;  2EA4 A;  1TQI A;  3BR6 A;  2O8X A;  1ZG5 A;  1OCT C;  3DEU A;  2QQ9 A;  4P5O A;  4YG2 F;  2F4O B;  2R7D A;  4RA2 A;  4U0V A;  3KP3 A;  5HDN A;  1KQ8 A;  2HZT A;  4P96 A;  4ZYE A;  3SXY A;  2ZNZ A;  3VWB A;  1JKQ C;  3KZZ A;  3WTT C;  1IXS B;  1JXS A;  1VZ0 A;  1BI3 A;  2VUM J;  3V7R A;  4M9X A;  1ONV A;  2DOE A;  4C2T A;  5F64 A;  2HVQ A;  1U0J A;  4IRH A;  3HRT A;  3RPQ A;  3LAP A;  1RI7 A;  1ZEL A;  4LGW A;  2V9V A;  1BI0 A;  1PUF B;  3E0J B;  1G3S A;  4OMZ A;  4O3M A;  4UUS A;  4RB0 A;  3HSF A;  1P7J A;  3G1L A;  4M3G A;  3E5Q A;  1HW2 A;  2JA2 A;  3A0B C;  2F48 A;  4BJ6 C;  4JOM A;  4UUT A;  2HYF A;  4PJJ A;  5J8F A;  3ABL H;  3S17 J;  3WG7 H;  4I2O A;  1YYV A;  2LR8 A;  5LEK A;  1P9Q C;  1HOM A;  3BRO A;  5HS8 A;  5GAE J;  4BYY A;  3FXK A;  1A5J A;  2A61 A;  1MDM B;  1SVO A;  5IYD J;  3MN2 A;  1IN4 A;  1LFP A;  1OYY A;  2CW7 A;  2PBI A;  2QYO A;  4FHT A;  4HX8 A;  5F0F A;  3COA C;  4ZJZ A;  2ISZ A;  1T56 A;  4ENK A;  3J7A O;  3MKZ A;  5ILS A;  5LBQ A;  3DLL F;  1W5T A;  5LEJ A;  3Q0U A;  4G6Q A;  3L2V A;  2HQ5 A;  4NNJ A;  1ZG1 A;  1ZLK A;  3ULQ B;  3GW2 A;  5GTH C;  5EGO B;  1MNM C;  1WHU A;  2K02 A;  4ON0 A;  2FX0 A;  2Z33 A;  3ZMS A;  3V42 A;  2M0C A;  3HYI A;  2F5E A;  3M1E A;  2H1L A;  2R7Q A;  5FKO A;  2EK5 A;  5DCM A;  2ZCW A;  1VQK I;  2DU9 A;  2IBD A;  1ZGA A;  3IUO A;  2VE9 A;  3C18 A;  4XLN F;  1IG7 A;  2RDP A;  5EG0 A;  5M3M J;  2KJC A;  4FX0 A;  4HLY A;  1D5V A;  1Z67 A;  1IXC A;  1GHC A;  3HDD A;  3J7Y J;  1MMN A;  4MHG A;  3K70 C;  4IJA A;  5B1A H;  3HOT A;  4IVN A;  2BHY A;  1TW2 A;  3BR5 A;  3HC7 A;  3PNT A;  3KP2 A;  4GCV A;  5HLH A;  1VFC A;  1ZRD A;  3BR3 A;  1HF0 A;  1MH3 A;  3OY9 A;  3H5A A;  4IL6 C;  1SFX A;  4CCN A;  1BA5 A;  1MMG A;  5GAG J;  3KP4 A;  3ABK H;  4QTR A;  4D5F A;  2MFZ A;  3LA2 A;  2RRE A;  4RMN A;  1V5G A;  1X1C A;  4JK1 X;  4UVA A;  4BH9 A;  3M8J A;  3S1Q J;  4PJN A;  1OJL A;  2TDX A;  1SFO J;  2IGO A;  2OQG A;  3F0C A;  2MLK A;  2K3P A;  2M4G A;  3DEW A;  2CUJ A;  1XD7 A;  2IGM A;  2WBM A;  4M6V A;  1J59 A;  1IV8 A;  1R7J A;  2ZME B;  3RQI A;  1HW1 A;  2WB1 N;  1YO5 C;  4AVZ A;  1P7I A;  4BQQ A;  3FHZ A;  4Q5S F;  4Y52 J;  1YS7 A;  4HAM A;  3OS0 A;  2KIQ A;  1S29 A;  3K9T A;  2A6H F;  2EWN A;  3K1N A;  3NAU A;  3NAR A;  1FEX A;  5K7Z A;  3ZP5 A;  3L00 A;  3PSF A;  1KU9 A;  3BCA A;  2KKO A;  4CYC A;  1S9H A;  3PNY A;  1G6N A;  4CH7 A;  2JN6 A;  2QKL B;  1OCR H;  1KON A;  3M7G A;  3P5J A;  4HSR A;  4HV5 A;  1SVM A;  2IP2 A;  2PI0 A;  2DPD A;  1QNT A;  4MTE A;  3OS2 A;  1BC8 C;  3OYD A;  2IS2 A;  1XC5 A;  2NXN B;  3G2B A;  4GRI A;  2NNN A;  4ABZ A;  2CV1 A;  3U21 A;  1Y1W J;  5IY5 H;  4ENM A;  4IEJ A;  4BEH B;  1UEL B;  4L9J A;  4AYB A;  3OSG A;  2VJI A;  3F9K A;  4P1W A;  4RAG A;  3MKW B;  1UHM A;  1E3O C;  3HJE A;  3A2K A;  5HLG A;  5C4X J;  3IWF A;  4XN0 A;  3HUG B;  5LRS A;  5K5Q A;  2JA5 J;  4XRM A;  1A04 A;  5EEG A;  2LG4 A;  2BYV E;  3R0J A;  5J1U A;  2KIS A;  4DZJ A;  1B72 B;  1BL0 A;  2DT7 B;  3EUH A;  4E7I A;  3JSP A;  1ETK A;  2Q2E A;  1D1B A;  1B59 A;  4H0E A;  4NDL A;  4A3I J;  1SC7 A;  2HNH A;  1FBQ A;  3C2H A;  1MBE A;  4FET A;  2ELH A;  1QHH D;  4A3J J;  4LIV A;  2V7F A;  4FE4 A;  1ODD A;  2QVO A;  3JRH A;  4LLG F;  2LKX A;  3CO6 C;  1P6R A;  2V1X A;  2W7N A;  2BY0 A;  1F4K A;  4M74 A;  2CMP A;  4ZYG A;  1R5H A;  2GAU A;  3MKL A;  1R1V A;  2FF4 A;  3K2Z A;  1MD0 A;  2VKV A;  3I5U A;  1NG7 A;  3KLN A;  3W6K B;  4AID A;  3O6B B;  4HA8 A;  4E4H A;  2ZJP F;  4LB5 A;  1VND A;  3MD2 A;  2XIG A;  5E1X A;  1ETW A;  1WFX A;  3NQO A;  3BJA A;  5E1Z B;  2OA4 A;  1STZ A;  3WOD F;  1EKE A;  2VXD A;  4PSX A;  4A3B J;  1XTA A;  2DMU A;  4F7Z A;  3FIS A;  4M3D A;  1B6A A;  1TWC J;  2CUF A;  2Y69 H;  3A01 B;  4BHP A;  2IGN A;  2ZSH B;  4XON A;  1OYI A;  1YX5 A;  3PIP F;  2CQX A;  2LK2 A;  5CVR A;  1BOA A;  1IAW A;  1Z7U A;  3I55 I;  1QO0 D;  1FP2 A;  1LVK A;  2ZME C;  4WX9 A;  4I01 A;  1IRX A;  4B8X A;  1D5Y A;  3BR0 A;  4NUB A;  2FE3 A;  3M1C A;  4Y15 A;  4LIT A;  1BIB A;  1ETV A;  1V55 H;  2QLZ A;  3QU6 A;  4BE2 A;  2Y9Z A;  1I5Z A;  1J5Y A;  3IKV A;  2STT A;  2GIZ A;  3ZMU A;  2MD0 A;  2RN7 A;  3F8C A;  2FMY A;  3LSI A;  4N4N B;  4UVB A;  1LVA A;  4AIH A;  1IV6 A;  3VPR A;  1X1D A;  5CVV A;  4LG0 B;  5D6F A;  2DA7 A;  1JKP C;  2J5P A;  2Q0O A;  1UHS A;  3SEQ A;  3W2W A;  2YX7 A;  1TWF J;  2GOX B;  4LLL A;  3RI4 A;  5D4R A;  2YU9 J;  4A6D A;  2X6Y A;  2WC2 A;  4C2M J;  4OIR F;  4ZTF A;  3JTH A;  4L18 B;  1P4X A;  1WPK A;  3HOY J;  2PQ8 A;  2VC0 A;  4A3F J;  3F6O A;  4YIR X;  2HQN A;  2PFB A;  3KEY A;  5FD6 A;  1MSF C;  3I4P A;  5ICC A;  5HNH A;  4XID A;  2DPU A;  1USS A;  2C6Y A;  3RKQ A;  4IZZ A;  2DDB A;  2LP0 A;  1HC8 A;  1U5T B;  2EJR A;  1G59 A;  3W3C A;  1PUE E;  1JT0 A;  3R61 A;  2EFQ A;  3TDU C;  3H36 A;  3HEF A;  3DXJ F;  4A5M A;  1K6O A;  5DD4 A;  3OIQ A;  1EJ9 A;  4Q48 A;  3P7N A;  3BP8 A;  1U78 A;  3BG7 A;  2JMW A;  2JVH A;  2E5N A;  4TV7 A;  2OTL I;  3LST A;  3S1M J;  2L2O A;  2CQQ A;  4J01 A;  1FTZ A;  3I59 B;  3V8L A;  3CUO A;  1T08 B;  2NS7 A;  3K69 A;  1UB9 A;  1J2X A;  3CES A;  1I27 A;  4MFE A;  4UY8 I;  2H27 A;  2IA0 A;  1AWC A;  3ZXS A;  2ACJ A;  4WWC A;  2MD5 A;  3BZK A;  3HSR A;  3K0L A;  3RQ4 A;  4RDU A;  1A6Q A;  3S16 J;  4N0B A;  2ZJR F;  2V6C A;  1GV2 A;  1VQ9 I;  3EPZ A;  3FWE A;  3ABU A;  1S7A A;  5CQG A;  2COM A;  9ANT A;  2VB6 A;  1G2H A;  4BJT A;  2M8G X;  3K7A J;  1IZ1 A;  2R7F A;  3CC2 I;  1IUY A;  1XGN A;  3ZMT A;  4PDK A;  2DK8 A;  1Z05 A;  2X9D A;  4BQO A;  3G71 I;  3PSI A;  1T98 A;  3ESW B;  3HOZ J;  3TW7 A;  3K1P A;  1XGS A;  1B9N A;  2K40 A;  3EYY A;  4JQF A;  5E1W A;  5DDG A;  2M30 A;  3L09 A;  5C4J J;  3HZJ A;  5FJ8 J;  2M45 A;  1LPQ A;  1J7K A;  2LLK A;  1ZQ3 P;  3L2U A;  2CQ7 A;  4UXN A;  2CV2 A;  1LJ9 A;  2EH3 A;  1X3Z B;  3FHN A;  3AG3 H;  3UKG A;  2VQL A;  3BDD A;  4DBQ A;  1MBF A;  1B1B A;  2NVY J;  3D5S C;  2DFH A;  3PUB A;  4IQJ A;  2VPR A;  2DA2 A;  4LD5 A;  3CMA I;  3QWL A;  5KNL A;  4HNU A;  2EBI A;  2RVC A;  5JLW A;  3KIO A;  1BJA A;  1XGO A;  1YW8 A;  4O6J A;  3DKY A;  1OKR A;  2B0L A;  2K4J A;  2IJL A;  2UV1 A;  4FT8 A;  1T0F C;  3O8G A;  1UFM A;  3E7L A;  3LNQ A;  3NWS A;  2XGE A;  2ID3 A;  5F0H A;  1K61 A;  1K4S A;  3NEU A;  1DDN A;  3KET A;  1T95 A;  2E2J J;  2XPV A;  5KCM A;  2ZBK A;  2P4W A;  1I1G A;  1WCM J;  3UNG C;  3H0D A;  4I0A A;  3N4M A;  3W2V A;  2DJI A;  3KFW X;  2ZO4 A;  3ASO H;  3CUQ C;  1U5T C;  2OC6 A;  2NOG A;  1VQ6 I;  3DFG A;  1PVE A;  2V1U A;  2LDU A;  3GCM A;  2Z3Y A;  3AAF A;  5BMZ A;  2AHQ A;  3KX2 A;  1QVT A;  3GZ6 A;  3CCS I;  2H6B A;  3QP6 A;  4U7B A;  2QEX I;  2NOJ B;  2DMQ A;  1FX7 A;  4AWX B;  4BE1 A;  1Z7L A;  2R3S A;  2FJ1 A;  2LKS A;  3E6M A;  2ZJQ F;  3BQY A;  1QA6 A;  2P5K A;  3HM5 A;  4ZZL A;  1XMA A;  3D5L A;  2Z16 A;  4JX5 A;  2Y0S N;  2FU4 A;  2O7O A;  1S6L A;  1DU0 A;  1X4O A;  1MGT A;  4LK0 F;  4F52 A;  4QSH A;  3I9V 2;  5FFX A;  2OV7 A;  5LFA A;  1ON1 A;  1R5G A;  5IP7 J;  4A3E J;  2DYS H;  2LOO A;  2R93 J;  4ZTJ A;  2ELK A;  4MLO A;  3U2R A;  2P8T A;  1BIA A;  4BS9 A;  3ZQH A;  1T6S A;  5A2Q K;  2X6X A;  3CP8 A;  4PSW A;  2K9N A;  1BI2 A;  1ZRC A;  1TWA J;  2HDD A;  2COB A;  3CCE I;  2DMT A;  4DBR A;  1PDN C;  1LKX A;  1E0E A;  4MNU A;  5HLI A;  3CCR I;  1RR8 C;  4CCK A;  3W6V A;  1O7F A;  3ELK A;  3U1K A;  2DI3 A;  2RGV A;  2WV1 A;  2XAJ A;  2ISY A;  3GFJ A;  2FOW A;  2M7A A;  2X6O A;  4YII A;  2W85 A;  4HDU A;  4RLF A;  1W4M A;  4DYR A;  2FNP A;  3OL3 A;  5FRN A;  2ID6 A;  2ICW G;  2QCO A;  1QZZ A;  4XLC A;  4F93 B;  1K4T A;  2EIJ H;  2FD5 A;  2QM3 A;  3FX3 A;  4ZYA A;  4ZYH A;  1R22 A;  5J3L A;  1YFH A;  3O3K A;  4G9Y A;  3GFM A;  1GXQ A;  3TED A;  3S3M A;  1OCZ H;  5E79 C;  4UB8 C;  2OTJ I;  3J81 Z;  2CO5 A;  1SFK A;  3ERE D;  2RQP A;  5ICG A;  1R4M B;  1ETQ A;  3EDP A;  3OYH A;  1JJ6 C;  4HF1 A;  3SZP A;  1FBS A;  1JUM A;  1OLT A;  2VC1 A;  2WAQ N;  3WTW C;  2JUG A;  5DM7 F;  2DT6 A;  3K1M A;  4KIB A;  1X2M A;  3E6B A;  3OMY A;  3E6D A;  2Y9Y A;  3T8R A;  1A35 A;  5FRO A;  1KA8 A;  5IYC J;  2XRN A;  4QPQ A;  2DBB A;  2QF7 A;  4M71 A;  2JPC A;  2CG4 A;  5F1R A;  5L3B A;  4RBO A;  1YI2 I;  3K4C A;  3HOW J;  3JRE A;  3FKJ A;  4ETS A;  2G9W A;  3B73 A;  2K9S A;  3PO3 J;  4HYE A;  4BKX A;  5EYR A;  4KIS A;  4D5C A;  1IO2 A;  2IXS A;  3WE2 A;  2LFB A;  2BHZ A;  1WJB A;  4KIG A;  3ZQF A;  2VQH A;  2OCE A;  1W0U A;  4ZC3 A;  1YE9 A;  3K4L A;  4CCJ A;  2DAO A;  3DV8 A;  3EUA A;  4UV9 A;  1D0Z A;  2FUG 2;  3K4J A;  3S1N J;  4Y33 A;  1E3H A;  4EEF G;  1RES A;  1AU7 A;  4FCY A;  5LRR A;  4UHT A;  1JKO C;  3H5R A;  3CME I;  1QZY A;  1BW5 A;  4IHY A;  5FLX Z;  2JSC A;  4A3K J;  2K85 A;  2BW3 A;  2OF7 A;  3QOE A;  2EV0 A;  3PNV A;  4F92 B;  3TQN A;  1YIJ I;  4A69 C;  1AOY A;  4G7O F;  4XOR A;  3KYC B;  4KN7 X;  3H3V K;  1G3W A;  4MQ9 F;  1NK2 P;  3U9G A;  4HW0 A;  1CF7 A;  4PUS A;  2DA3 A;  3CCM I;  3MEX A;  1WZ2 A;  3HTS B;  5CVI A;  3QPS A;  1O3R A;  1GT0 C;  4IHW A;  1J75 A;  1Z91 A;  2RKH A;  2KL4 A;  1DUX C;  1XDU A;  4M6Y A;  4UUS B;  3M8F A;  3FXQ A;  2MH2 A;  3M9A A;  3OYE A;  1WJC A;  1MKM A;  3S2H J;  1JE8 A;  4KA4 A;  4UB6 C;  2JJ7 A;  2XRO A;  3ZGK A;  1S7E A;  4D7M A;  3O2P E;  2EFO A;  2F4I A;  2CFO A;  3CLQ A;  3FK7 A;  4EM0 B;  2DK5 A;  3QYB A;  1D8J A;  3KP6 A;  3J80 Z;  1V4R A;  3A1Y A;  4OAZ A;  1F43 A;  2K27 A;  5D4S A;  5C3E J;  2R7R A;  4JYK A;  2KIU A;  2PMZ N;  3RZD J;  3ZOB A;  2M4K A;  2ETH A;  3JAM Z;  3KZY A;  1QZE A;  1YIT I;  1BM9 A;  5H2F C;  3MMY B;  2KT0 A;  4LMY A;  5EJC A;  3JSO A;  3LSK A;  4LFU A;  2CRG A;  4EQQ A;  3HOU J;  2R7V A;  2YX4 A;  3B6C A;  3CTA A;  2K86 A;  4E7S A;  1JTY A;  3RDI A;  2W24 A;  4DGW B;  4LB6 B;  2IT0 A;  1J0R A;  4U0Y A;  3JRF A;  5BPD A;  3KE2 A;  4B47 A;  1RKT A;  1XSD A;  2XSJ C;  2JTV A;  1S3J A;  2EZK A;  2BVL A;  4B1R A;  1T8I A;  4A0Z A;  3OWT A;  3DQV C;  2O0Y A;  3ZCO A;  2BY2 A;  1D1A A;  2M9H A;  5DCM B;  5GPA A;  4WF2 A;  3S3N A;  2RNG A;  4A3C J;  1VTN C;  5HLT A;  2JK3 A;  5EG0 B;  2MYS A;  4EMS A;  3BJO A;  3QYE A;  3C3W A;  1E3P A;  2DQR A;  4PGG A;  4XRS A;  3ABM H;  2Y31 A;  1FJL A;  2QQ8 A;  3W2A A;  1XMK A;  3E97 A;  1XN7 A;  4HQE A;  4PFP A;  2PX9 A;  2R5Y A;  3DTK A;  3F21 A;  1TP4 A;  3S8P A;  3FXM A;  3HGG A;  4XRF A;  2ME0 A;  2ZNY A;  1UAA A;  1FSE A;  1P4A A;  3PJR A;  2EB7 A;  3F8M A;  2Q8K A;  2CJJ A;  3H3Z A;  4HRI A;  2HVS A;  1TC3 C;  2LRE A;  4RGU A;  3I54 A;  5EZG A;  5IT3 A;  4CCM A;  4OAY A;  2DT5 A;  2DJN A;  2V26 A;  4XSX F;  4S0H B;  3CDI A;  2DMP A;  3HRU A;  5ILV A;  4Y17 A;  3BG3 A;  4ENJ A;  3L2Q A;  3WTS C;  4W1U A;  4HX4 A;  2OZU A;  4QWQ A;  2VOO A;  4B3A A;  3MWM A;  3LQQ A;  3QAH A;  1U8B A;  2X51 A;  2OD5 A;  3MKY B;  2NNY A;  4KIF A;  2EIL H;  3L9F A;  5FLM J;  3S93 A;  3H9G A;  5JLX A;  2DA5 A;  1MIJ A;  1SMT A;  2L3D A;  2LRD A;  4B48 A;  4CYC B;  4BHC A;  2M3A A;  1VQN I;  3KPH A;  4PCQ A;  2DA4 A;  5LD2 C;  2EFP A;  3P9C A;  3ZQC A;  4D7N A;  3VYR B;  4FE7 A;  2EV5 A;  2VQC A;  1MMD A;  3IC7 A;  2KZG A;  2V4J C;  2TRT A;  4HEA 2;  5CVU A;  2XRL A;  2YUS A;  4X0G A;  1BW6 A;  3I53 A;  4KN4 X;  1XG1 A;  3LSG A;  2X85 A;  4CXF A;  3PL8 A;  2E19 A;  2FBI A;  3OIO A;  4XM3 A;  5DCF A;  4ZH4 F;  3AFH A;  5E3O A;  2E60 A;  2M2E A;  3OYL A;  3Q0W A;  4D0P A;  5EDN A;  3Q0V A;  4ZZD A;  2LC2 A;  4Z2Y A;  3WGH A;  1P92 A;  3CF5 F;  2O03 A;  2OJE D;  2Q2E B;  3JRB A;  1Y1V J;  3OYM A;  4M3B A;  3CCJ I;  2EZH A;  1SMY F;  3VDX A;  4MQV A;  4XL9 A;  1YJ9 I;  1RNL A;  2P5V A;  3PQK A;  4IOA F;  1I6H J;  2R7U A;  2L5Q A;  1MZB A;  3CCQ I;  4OIQ F;  1POG A;  4M3F A;  2QUF A;  3JTG A;  4BBS J;  4IX7 A;  2HXI A;  2DTR A;  2P7V B;  1MBG A;  4QPO A;  5F27 A;  3H3U A;  1OR7 A;  4GYI A;  2M7B A;  3WE3 A;  3HL2 A;  3BR1 A;  3SDG A;  2VXZ A;  1D0X A;  3RPU A;  3IHU A;  4G12 A;  1G3T A;  1RKW A;  3LWF A;  4AU7 A;  1X3W B;  1BC7 C;  3GTK J;  3VSL A;  4AC0 A;  2DQL A;  3PIO F;  3FXL A;  4L9N A;  1ENH A;  4A3D J;  1ZAR A;  5FKL A;  4U87 A;  1DPU A;  5BNG A;  2DDA A;  2HGC A;  3KYL A;  2NRA C;  2FBH A;  1X3U A;  3C7J A;  2LBF A;  4PJ0 C;  4GDF A;  3FM3 A;  1W5C C;  4OIP F;  3BZ6 A;  3IH2 A;  2GXG A;  1MBK A;  1R6R A;  3D0S A;  4F55 A;  3EUK L;  1KZH A;  1R49 A;  5GPC A;  1H0M A;  1XSV A;  1IC8 A;  3GTL J;  5LHH A;  3FK6 A;  4EV0 A;  1QHG A;  3AG4 H;  4HOB A;  1IJW C;  2D1V A;  3HKZ N;  4CSW A;  5FKK A;  3TO7 A;  2F6C A;  1ON2 A;  3L7W A;  2X48 A;  4FIS A;  2R7O A;  5J47 A;  2R7X A;  3S2D J;  2QZ8 A;  2W57 A;  1VF9 A;  2HKX A;  2AO9 A;  2M0M A;  3WHC A;  1KQ0 A;  1OCC H;  4N9I A;  4Y3O A;  3DP7 A;  2V9K A;  4M9S A;  3RYP A;  3GTM J;  1R5I D;  1MJ9 A;  4XNF A;  1XDS A;  1DP7 P;  3F72 A;  5FLV A;  3BOQ A;  3IL2 A;  1W7P A;  4S04 A;  1UST A;  3BG5 A;  3UR3 C;  3F22 A;  5IT9 Z;  4XLE A;  1D1C A;  1U2W A;  5CJ9 A;  4CIC A;  3BWG A;  3FBI B;  4YFN F;  1ZLJ A;  1LFB A;  1PP8 F;  5FKM A;  5E20 A;  5LHI A;  3GTG J;  1IRZ A;  2OCC H;  2HYG D;  2XAG A;  1E17 A;  2FA5 A;  3BG6 A;  2VE8 A;  2DOD A;  1XCB A;  1EV7 A;  2P0W A;  3BC8 A;  3REO A;  5ED4 A;  3EUH C;  1ETO A;  5JR3 A;  3ONQ A;  3RKW A;  3M8E A;  2NYX A;  4JBA A;  4PFO A;  2O3F A;  3G3Z A;  5TGT A;  3OYK A;  4KIC A;  2FQ3 A;  3WU2 C;  4BGD A;  1IDY A;  1QU3 A;  3DU5 A;  3BJ6 A;  4L9V A;  4HNT A;  4MEX F;  4N9H A;  2VBW A;  2AQF A;  3O8H A;  2UZK A;  5ICE A;  1ORK A;  1T38 A;  2IAI A;  5J40 A;  4WK8 F;  3SDB A;  4OIN F;  3GLL A;  1R36 A;  4KMF A;  3QQA A;  4XIC A;  2VOD A;  3ASN H;  3BTI A;  2H94 A;  5FGM A;  2OQR A;  1BR2 A;  1ZKG A;  2GA2 A;  5J1R A;  2R7W A;  1FMV A;  4OWR B;  2CW0 F;  4H4K C;  3I4N J;  1R71 A;  5TJJ A;  3BT9 A;  1SFU A;  2XAS A;  2ESN A;  2P81 A;  2O8K A;  1K83 J;  3KZI C;  3C2B A;  2IVM A;  5HNF A;  2W84 A;  1QPI A;  2RV8 A;  2XV4 S;  3DF8 A;  5HOD A;  5IOZ A;  2DOA A;  3V8K A;  2XPU A;  5KAF C;  5E8I A;  1WVR A;  2FRH A;  2XC7 A;  3ZMZ A;  1ZK8 A;  2ZXW H;  4R8H A;  4Q47 A;  2PMU A;  1VQ8 I;  4M9Z A;  1S72 I;  1VI0 A;  2XB5 A;  4LIU A;  5IYB J;  2MH9 A;  4G7H F;  4BXF A;  3OR1 C;  3HOX J;  2MA3 A;  1JI8 A;  4MFD A;  1JHF A;  5DUI A;  2F4M B;  4XN3 A;  2VIX A;  2CQN A;  3VOE A;  1Q1V A;  5HS9 A;  4HBL A;  4A6E A;  4BXU A;  5IP6 A;  2WB1 A;  2LSO A;  3DEE A;  2FQ4 A;  1K79 A;  3WGI A;  3OYF A;  3ROU A;  1RET A;  1IUF A;  2GZW A;  2VL8 A;  5F1J A;  1LDD A;  3IAS 2;  4A2U A;  2L7Z A;  2PG4 A;  2ZSI B;  4GGG A;  4XOT A;  5C44 J;  2Y30 A;  4IO9 F;  1TL8 A;  4YFX F;  3H92 A;  2HEO A;  1MH4 A;  3Q5F A;  2XF6 A;  4P55 A;  1EF4 A;  1B9M A;  1FOY A;  4A3G J;  1XS9 A;  2YR2 A;  3DWL E;  1RPW A;  3LA3 A;  4I09 A;  3E6C C;  3GWZ A;  5DUK A;  3FXR A;  2E71 A;  4IKF A;  3OYC A;  2LNB A;  4IRI A;  2ESH A;  5M5X J;  1UHW A;  2BZT A;  2PMH A;  5JFR A;  2JWT A;  2KQR A;  3SEZ A;  4AIK A;  1IXR C;  2IPQ X;  2RQQ A;  2ZFW A;  4HG2 A;  2M87 A;  3J81 K;  1FIP A;  4RGS A;  2F5C A;  2P6S A;  5BS6 A;  1DPR A;  2VT3 A;  3ZQL A;  3DKW A;  1YX3 A;  5FO5 A;  3KCC A;  2WAD A;  3SQN A;  1Z0X A;  1RRJ A;  3V7C A;  4XLH A;  3LFU A;  5LLQ A;  4V19 K;  1IRF A;  1YIO A;  2E1C A;  2L0K A;  2Y2Z A;  2WY7 Q;  1O7L A;  2HPI A;  1ZTR A;  1MJA A;  1V5F A;  2KHM A;  2XAF A;  3CCV I;  3OV8 A;  1BOB A;  1KU3 A;  4O5V A;  3WTV C;  4ZDL A;  5EEA A;  5TIS C;  3P9I A;  4G8X A;  1RC9 A;  2QA4 I;  5KAI C;  5D5X B;  1Z77 A;  2DOF A;  2CV0 A;  1I3Q J;  1R9T J;  3KEQ A;  1YS6 A;  4D9J A;  2HZD A;  5DD8 A;  2L4M A;  1FBU A;  3I0T A;  4RM2 A;  2CWE A;  3TP3 A;  2E1O A;  4BUP A;  4Y13 A;  1DGW Y;  3M4O J;  5HS7 A;  3FKI J;  1LDJ A;  1L3L A;  5EF6 A;  4RB1 A;  3J7Z I;  2KRH A;  4BDY A;  4NB5 A;  2W25 A;  5FLX K;  4EGY A;  3BLY A;  2BOL A;  4XLA A;  2WY8 Q;  3H0G J;  5D5W B;  1ZR4 A;  4I0B A;  4XKC A;  3BZC A;  3IH4 A;  2EFN A;  3E3V A;  1ZH5 A;  1EH7 A;  3LL7 A;  5M5W J;  4OOI A;  5K7F A;  2KIF A;  4GXO A;  2R92 J;  2O61 A;  1QPM A;  4X6A J;  4KDP A;  3PM1 A;  1SD4 A;  2L7M P;  4NC8 A;  5LGU A;  4IOC F;  4C2U A;  5DYM A;  2DFI A;  3SYT A;  3WU1 B;  4CA0 A;  2V6E A;  1SD5 A;  2H09 A;  4WXD A;  2H8W A;  4BL0 B;  4CYD A;  1WH7 A;  2A3S A;  4IHS A;  1WQ2 A;  3GBG A;  3DTE A;  3G4S I;  2CSO A;  3ERM A;  1V5E A;  3WU0 A;  1CGP A;  4QLC U;  4V2F A;  5FB2 A;  5K7H A;  3CDH A;  5KK1 A;  3JAM K;  2ZXH A;  4ESF A;  3OYA A;  1N77 A;  5HDG A;  1GUU A;  4LOC A;  3RSN A;  1OIS A;  2BEO A;  2VJ4 A;  4AM3 A;  1YRN A;  3Q3S A;  4Q4Z F;  1B4A A;  3HPH A;  3VYT B;  2YPR A;  3G6E I;  3GLX A;  4G7Z F;  3TDZ C;  1JGS A;  5IOY A;  3ABT A;  3BPV A;  4L0Y B;  1LQ1 A;  5DV5 A;  3WTU C;  1MJB A;  3F3X A;  3A0H C;  3T8T A;  3IRQ A;  3TO6 A;  2XF5 A;  3F23 A;  4CZC A;  4HNV A;  3BY6 A;  3HXL A;  3DPL C;  3GO5 A;  3F8F A;  2JT1 A;  4LK1 F;  5K5O A;  3HB9 A;  2QBY B;  2F2E A;  1X2N A;  2PJR A;  1DGR M;  1S7O A;  4XSZ F;  1W36 D;  2BW3 B;  1LB2 A;  2Z2S B;  5E3M A;  1NG6 A;  2UWM A;  1ZGW A;  3CLO A;  3PUF A;  1LDK B;  4XR6 A;  2HOS A;  2L7K A;  3E5U A;  1X1B A;  4B4C A;  1CF7 B;  1WI3 A;  3HG9 A;  4HLX A;  4I7H A;  3CC7 I;  3W6J B;  4CO8 A;  2MSY A;  1DU6 A;  2NS0 A;  4U88 A;  4A3M J;  2G7U A;  3K4N A;  4R1H A;  1CQT A;  4HV6 A;  2HTJ A;  2VJJ A;  2LD5 A;  1A31 A;  3OL4 A;  1M1E B;  3GTP J;  1P2F A;  1S8N A;  2RAE A;  2V9P A;  1KYW A;  5GAH J;  5JI6 A;  2MG4 A;  1FYM A;  3TBI A;  5F6F A;  2QSF X;  1SAU A;  4B43 A;  4FAS D;  5BPI A;  4C3J J;  4R79 A;  1OYW A;  2Y75 A;  3OYG A;  2VI6 A;  2B7E A;  2EQR A;  2WV0 A;  1NH3 A;  1O4X A;  1TQM A;  1IN8 A;  4KT6 A;  5ILU A;  1HXD A;  2HOA A;  4C9Y A;  1Z6R A;  2VON A;  3AG1 H;  1WKM A;  2IA1 A;  2XAU A;  3OS1 A;  3KLO A;  2L4A A;  3ZMD A;  4IHT A;  1X4P A;  4MGR A;  3TGN A;  3PO2 J;  4YIF A;  3GTJ J;  3MAJ A;  1F36 A;  1Y6I A;  2GLO A;  4I6Z A;  4LJZ F;  2QBY A;  4I98 B;  2KZV A;  2EIN H;  1QRY A;  1HBX G;  1I50 J;  1FMW A;  3GZN B;  3FXU A;  4M73 A;  4DYQ A;  1LE8 A;  2MW8 A;  3BR2 A;  4OIO F;  1WI9 A;  3RYR A;  2K4B A;  2JVG A;  1Z3X A;  5FFZ A;  2KFD A;  2DLL A;  1KQ9 A;  3MCZ A;  2NVQ J;  1DP3 A;  2F5F A;  1HLV A;  2HFH A;  4EVI A;  2L7F P;  3I4M J;  2R7S A;  2BBY A;  4ENN A;  1T2K A;  5FKN A;  2ZXJ A;  4IRG A;  3HIF A;  3JW4 A;  1QVU A;  3VSK A;  3WG9 A;  3I71 A;  5HDK A;  1IDZ A;  5HOO A;  1O3T A;  2R5Y B;  2JA7 J;  4CCO A;  2LMD A;  1Y8R B;  2CUE A;  2ECC A;  3N05 A;  2QEN A;  1VQ4 I;  2CUZ A;  3DPU A;  3K4K A;  2O9L A;  1JUS A;  3RTR A;  4C3H J;  1U8R A;  5F04 A;  1O3Q A;  2WA0 A;  4RGR A;  4A5N A;  2KP6 A;  2TCT A;  1Y0U A;  4YRV A;  4XQF A;  1B8I A;  3RKX A;  3EET A;  1ETX A;  1I1S A;  3RPU D;  2Y48 A;  2R7Z J;  2HQR A;  2OPT A;  2BY1 A;  4NC7 A;  4I02 A;  3N97 A;  2V1D A;  3QP5 A;  4AD9 A;  1HKQ A;  3SZT A;  5D5V B;  4FTH A;  1SAX A;  4AVP A;  2Y0S A;  1WJF A;  3GF2 A;  2OAZ A;  2PEX A;  1ZHF A;  2EZI A;  1HST A;  4RLQ A;  3I56 I;  3IKT A;  4GFB A;  3QPT A;  3JRA A;  2QGU A;  4MO7 A;  1WJE A;  4DIQ A;  2KDO A;  2HKO A;  2UXN A;  3OYN A;  4G6D A;  4XBF A;  4BU2 A;  2R4G A;  3LSM A;  1U9O A;  1JT6 A;  2MLG A;  3CJT B;  1X1P A;  2X1D A;  5J1Y A;  3C1D A;  4M72 A;  4CCL A;  3DBR B;  3ZQI A;  2DMN A;  2KDZ A;  2K9L A;  3WHB A;  1HQC A;  1R4N B;  3X2Q H;  5JHU A;  1MW7 A;  2A6E F;  1AKH A;  2XGX A;  4AYB N;  2QWW A;  4E7H A;  2MC3 A;  1Z6T A;  3DTI A;  2Z99 A;  1LEB A;  3F8B A;  3SZG A;  1KU7 A;  2E7X A;  4A0Y A;  1UCR A;  1XGM A;  4EJV A;  2GXA A;  5GP9 A;  2VBZ A;  3HBL A;  4Y4R A;  4ASN A;  1VQL I;  1W7P D;  2PLY A;  2KJB A;  1YG2 A;  2BXZ A;  5DTD A;  3VOD A;  2QSG X;  1BBY A;  2DA1 A;  4E7K A;  1W0T A;  2BVM A;  1Y39 A;  2HQA A;  3HHH A;  2K9Q A;  1FC3 A;  2QSH X;  2E36 A;  2WAQ A;  3V4G A;  4RAZ A;  4XKB A;  5E18 F;  1Z9C A;  2HOE A;  3IAM 2;  1TQP A;  4PJL A;  2FBK A;  2KRF A;  2WAF A;  4A3L J;  3ZN1 A;  2HVR A;  1ERD A;  1WJA A;  1H9T A;  1OCP A;  1R1T A;  2UXX A;  5ICF A;  1HKS A;  1NHA A;  1O57 A;  3I3L A;  4XKW A;  3RJP A;  2GM4 A;  5IT9 K;  3DPT A;  1G4D A;  3HRM A;  4V2G A;  1TBX A;  1W36 C;  2EIK H;  3KYD B;  3U1D A;  5FD5 A;  3GUD A;  4BDZ A;  4EGZ A;  3LMM A;  2D5V A;  2ADU A;  3R60 A;  1QGP A;  4HDV A;  4F3Q A;  3JRC A;  1HSJ A;  2XHK A;  1GLN A;  4DJA A;  3FDY A;  3D1N I;  2N8G A;  3BG9 A;  1WSU A;  3CJQ B;  2DA6 A;  1JUP A;  1H88 C;  4D1Q A;  1ZG3 A;  2LBF B;  5CLS A;  4EM2 A;  3HPG A;  4JX6 A;  2BXY A;  4B09 A;  5LGT A;  5CPR B;  5DS9 A;  3KP5 A;  4RAF A;  4CHU A;  1L0O C;  5GAD J;  2P5L C;  1F9N A;  1P4W A;  3BTL A;  3V8J A;  1C0W A;  3S15 J;  1AA7 A;  1X58 A;  1ULY A;  4UUV A;  2LH9 A;  4S05 A;  2M34 A;  3CO7 C;  3H9J A;  4BY1 J;  2L9V A;  3J7A Y;  3ZQG A;  2DYR H;  1J9I A;  3PFY A;  3R0A A;  3S14 J;  2LVS A;  1W1W E;  5H20 A;  5IPA A;  2HU9 A;  1BJZ A;  3T5X A;  1GVJ A;  3H1C A;  3OOU A;  4LG3 A;  2W1O A;  1RUN A;  2LY9 A;  1ZN2 A;  3C2G A;  4E7J A;  1ZR2 A;  2MC4 A;  2E2H J;  2NAZ A;  1YHQ I;  2EV6 A;  4XLP F;  5B5E C;  3TMO A;  1PUF A;  1HKT A;  2BY3 A;  3ECO A;  3L2R A;  2IGK A;  4EJO A;  1ZYR F;  4IQ4 A;  1HCR A;  2Q1Z B;  1Z3Y A;  2IEK A;  2MBF A;  1PYV A;  2A6T A;  2GWR A;  1LNW A;  1UG2 A;  3RIR A;  3TOA A;  4IHV A;  1W7P B;  4C3I J;  4LLN A;  1MND A;  3T0Y A;  2IS4 A;  1YQA A;  2VOP A;  4FQG A;  5EEH A;  3G1M A;  2PMZ A;  3MVP A;  5DEQ A;  4A0X A;  5B3S H;  4WCG A;  2P7C B;  3TKY A;  2BE5 F;  1MDM A;  3KEO A;  2HS5 A;  4PK4 A;  3K6G A;  3IH3 A;  1K6Y A;  2JRT A;  2E1M B;  1G3Y A;  1VQ5 I;  3A03 A;  3Q9S A;  5FRM A;  1XPX A;  4E7L A;  4WXH A;  4ZDO A;  4ESB A;  1EA3 A;  3IWZ A;  1I3A A;  4XKV A;  4P9U A;  2GQQ A;  4RB3 C;  2XKO A;  5EGO A;  2YSR A;  3OYI A;  1T39 A;  1KGS A;  1UG0 A;  4N4O B;  2MAB A;  1FWZ A;  2Z5U A;  4KT5 C;  3MZY A;  5JVT A;  3CDL A;  5BOX A;  2DFE A;  3CMM A;  3LSR A;  3QRF F;  2FML A;  4DZP A;  5M3F J;  1WGX A;  1OFC X;  5F08 A;  1OR7 C;  4A12 A;  3BTJ A;  3ISP A;  3H35 A;  4RM3 A;  4DNC A;  5B1B H;  3QU3 A;  2UUZ A;  5D8L B;  3H5N A;  2LF8 A;  4CDG A;  1FPQ A;  1FOW A;  4XK4 A;  3OYJ A;  1R58 A;  3CCY A;  3TO9 A;  4KIT B;  1MSE C;  1Y8Q B;  4XMY A;  2JSP A;  2DN0 A;  3K4M A;  4JP0 A;  2IA2 A;  4QIW N;  3JRD A;  3NWT A;  3GVA A;  2KIM A;  4E7Z A;  2DW4 A;  3PQJ A;  1JKR C;  4NC6 A;  4U7D A;  3CQZ J;  2M8E A;  1UJ8 A;  2K3F A;  4A93 J;  3FXO A;  2CH0 A;  2O6G E;  1WRJ A;  1JTX A;  2YU3 A;  3LSJ A;  2CGP A;  5E8G A;  2QQA A;  1YJN I;  4ITV A;  1DQU A;  3ZR8 X;  5B66 C;  2BV6 A;  2XF7 A;  5E3N A;  2ZME A;  5H6R A;  3AG2 H;  2CFX A;  4U0W A;  1VQO I;  4E70 A;  2H8R A;  3KP7 A;  1E2X A;  1TNS A;  2Z1D A;  2M1B A;  2HYJ A;  3ZMV A;  2M5W A;  4MTD A;  3GTO J;  1WH5 A;  1HW5 A;  3SFZ A;  3F6V A;  3JRI A;  1RUO A;  3FMQ A;  1Z1D A;  5D6E A;  3SFI A;  4UV8 A;  2IRF G;  2VT2 A;  1YOV B;  4L5E A;  2IW5 A;  4B3X A;  3LAJ A;  1U6G A;  4BHB A;  5LHG A;  1PP7 U;  3RZO J;  5BQT A;  4Y7N J;  2XGD A;  5J4V A;  2LY2 A;  3ZQQ A;  1U3E M;  1GVD A;  2E34 A;  3TW6 A;  3OIP A;  2LF7 A;  2E1M C;  4BEH A;  2HTS A;  2OZ6 A;  5DM6 F;  3RCO A;  3LOC A;  1LFU P;  1U9N A;  2CS3 A;  3EYI A;  3ML6 A;  5KVR A;  2I8D A;  3PFI A;  3AL0 B;  3HUG A;  3LSH A;  1FZP B;  5E3L A;  1VQM I;  4Z6Y A;  3MFK A;  4M6X A;  3TL4 X;  2X6W A;  4XRS G;  4RB2 C;  1B72 A;  3HTU A;  1SD6 A;  2LYC A;  2V79 A;  2ZKZ A;  4CUG A;  4NBQ A;  5F0C A;  3DCF A;  2ZB9 A;  1XMX A;  3GZ5 A;  1HDP A;  1X1A A;  1Y0N A;  2W48 A;  1J09 A;  3A02 A;  3DU6 A;  1FOX A;  5L3D A;  1SD7 A;  4DQ2 A;  5L3C A;  2ECB A;  3CF2 A;  3ECH A;  2CU7 A;  2KPM A;  2W4S A;  3LA7 A;  4NHJ A;  1WJ5 A;  2XAQ A;  2K5C A;  4RS8 A;  3LFK A;  3FBN B;  2EA2 A;  1LEA A;  2KLO A;  1YJW I;  2CYY A;  3I64 A;  4E6K G;  4UVC A;  5H6Q A;  4G94 A;  4WXC A;  2D2W A;  2G7H A;  2B9S A;  1W5S A;  4BNC A;  4DYC A;  4IHX A;  1FNN A;  2ZXI A;  2JQ7 A;  3QOP A;  1TW3 A;  3IRR A;  3L2C A;  3CUQ B;  5J8C A;  1MMS A;  3ZN0 A;  4DW6 A;  3M3Y J;  3GXO A;  3A01 A;  2JA8 J;  4OMY A;  1Q1H A;  1SFE A;  1RR7 A;  1GV5 A;  3HKZ A;  2JPB A;  1SAN A;  4GO1 A;  4IF4 A;  2W82 A;  2L01 A;  1MMA A;  1R23 A;  5L3G A;  2L02 A;  1EH6 A;  1TT0 A;  5CKT A;  1GXP A;  3E5X A;  1K7A A;  2H1K A;  2E2I J;  2A5W A;  2AQE A;  4JX4 A;  4BE0 A;  3OOP A;  3K2A A;  2EIM H;  4EAT A;  3EQL F;  2HDC A;  2XSD C;  2VBX A;  1F1Z A;  1WJD A;  3FMS A;  2FSW A;  4HST A;  2WAE A;  2STW A;  1I6X A;  2DCE A;  4W97 A;  2HPM A;  2GOM A;  4LG0 A;  3VFZ A;  1MNE A;  2L9R A;  4K2E A;  3G1O A;  3FF5 A;  2X0L A;  2F5V A;  1FP1 D;  2GBY A;  4II3 A;  3L2W A;  1TZL A;  1QQI A;  4MIM A;  1TTY A;  4ANJ A;  1T0F A;  4UNO A;  2IS6 A;  3HOS A;  1YRN B;  1D0Y A;  2CQK A;  3HSE A;  1FLI A;  3FIW A;  1UZC A;  1R1U A;  3H9Q A;  1D3Y A;  2PN6 A;  4NQW B;  1FOK A;  3AL0 C;  2Y0M A;  4BAC A;  2NS8 A;  2A05 A;  2ZFU A;  3TOB A;  4GYG A;  3G73 A;  2XB0 X;  3FXJ A;  2XDV A;  3CUQ A;  1U5T A;  4FX4 A;  3VYU B;  4X1E A;  2NVT J;  3CC4 I;  1VQP I;  4OU0 A;  3FMR A;  1AHD P;  4PGH A;  1IN6 A;  3BCB A;  3L1P A;  2PJR B;  1ACI A;  5AIP A;  2I5U A;  1ZAO A;  5CVJ A;  1ETY A;  2HR3 A;  1TWG J;  1D8K A;  2G0E A;  2OBP A;  3I59 A;  2FXA A;  2VKH A;  5ERI A;  1NK3 P;  2DO7 A;  1EH8 A;  2OUM A;  4HF2 A;  2JUC A;  1TNT A;  2VN2 A;  4XOP A;  3D5R C;  3A4C A;  4XLF A;  4MEY F;  3DBH B;  3CJN A;  2LTP A;  4P9F A;  4PZJ A;  3MZH A;  4II2 A;  1YLF A;  4BXX J;  4HZF A;  1PJR A;  3CZ6 A;  3SHF A;  1XX5 A;  1TLH B;  2I10 A;  2P6T A;  4I76 A;  3VB2 A;  3OR2 C;  4BBR J;  3E1S A;  4BQN A;  1N78 A;  4AUX A;  2E1N A;  3J80 K;  2KRC A;  1HA8 A;  3FZV A;  5HVQ C;  4YEJ A;  1GDT A;  3CP2 A;  2NVX J;  1IW7 F;  4C30 A;  1YW9 A;  1SVL A;  3GX4 X;  4L0Z B;  1LUJ B;  3T1B A;  2XUB A;  4RGX A;  1FYK A;  3HGY A;  4HPQ A;  4KFC A;  1H89 C;  3WTY C;  2QKM B;  2XGC A;  1BR1 A;  4NQW A;  6PAX A;  2WTE A;  3DKX A;  2JRM A;  3AKZ A;  2O5R A;  2VBY A;  3ZPL A;  4J19 A;  2X1C A;  4ESJ A;  2XPW A;  2IS1 A;  2VKD A;  3Q9V A;  3IP4 B;  5CYV A;  1ZGJ A;  2VQG A;  4RAY A;  5JHF A;  4KYW A;  5L3E A;  2YS9 A;  2AXL A;  4G6T B;  4F91 B;  1H8A C;  3JCU C;  5J6X A;  5LGN A;  3JR9 A;  2ZC2 A;  4EJT A;  2AXT C;  2CW8 A;  1LE8 B;  2XVC A;  5L3F A;  2GA1 A;  2RC4 A;  4HF0 A;  1Z21 A;  2DTZ A;  3R6S A;  2AS5 F;  2RNJ A;  2L9S A;  4BJ5 C;  2R7T A;  3S3O A;  1IN7 A;  3ZRG A;  4M3E A;  2H6C A;  2MGQ A;  1XCV A;  1FY7 A;  1OPC A;  5K1Y A;  5AON A;  2A68 F;  2HDW A;  3RKY A;  1OCO H;  3LQR A;  4L9T A;  3CD6 I;  5E17 F;  3GFI A;  1I39 A;  1MBH A;  1APL C;  2BGC A;  1ZRF A;  5K5R A;  3QPL A;  2HI3 A;  3V7S A;  5J4Y A;  5JVG F;  1ITY A;  2L54 A;  1RZ4 A;  2FOK A;  1FT9 A;  2EZL A;  4KMU X;  4J00 A;  1KYZ A;  1FIA A;  2D45 A;  1B8I B;  1JGG A;  4BQA A;  5KHD A;  3S1R J;  3IV5 A;  3SJM A;  2R0Q C;  2FNA A;  1VQ7 I;  2OU2 A;  2X1E A;  3FM5 A;  3GEZ A;  1HDD C;  1N25 A;  1JJ8 C;  1IGN A;  2HXO A;  5GTI C;  2A5Y B;  1XB4 A;  2EFW A;  3K70 D;  3S2W A;  2R5Z B;  1REP C;  1BI1 A;  2LY1 A;  5IP9 J;  2E35 A;  2LKP A;  1O3S A;  4CZZ A;  1OQY A;  2ELJ A;  1H9G A;  4HX7 A;  3CMY A;  2WWY A;  1NTC A;  1V3F A;  4CGZ A;  3VEP A;  3ZQ7 A;  2X4H A;  5CQE A;  1OMI A;  3M07 A;  1K78 B;  1V54 H;  3TP0 A;  4BAY A;  3DBL B;  2NVU B;  2A69 F;  2GXB A;  4YEL A;  1BN5 A;  1YW7 A;  3S32 A;  2A07 F;  2V1N A;  3CCU I;  3K10 A;  3GME A;  4KJZ A;  4EM1 A;  2EPF A;  4B44 A;  5D8K B;  4YFK F;  1TT5 B;  1IF1 A; 
#chains in the Genus database with same CATH homology
 3DKY A;  3QOD A;  3SDB A;  4DOZ A;  2LH9 A;  2UV1 A;  1T0F C;  4PJM A;  3NWS A;  3H9J A;  3J7A Y;  1BR4 A;  3PFY A;  1BR2 A;  2E5Z A;  2HU9 A;  2R7W A;  1T95 A;  1FMV A;  4OWR B;  2VAS A;  3OOU A;  4H4K C;  4LG3 A;  5KCM A;  2W1O A;  2W00 A;  3UNG C;  3C2G A;  3H0D A;  4E7J A;  3VYS B;  2MC4 A;  3W2V A;  2DJI A;  2OC6 A;  2DXI A;  3TMO A;  5HNF A;  3L2R A;  2IGK A;  4ZDP A;  2DOA A;  4IQ4 A;  1N75 A;  3KX2 A;  2Q1Z B;  1Z3Y A;  4U7B A;  2XC7 A;  1G8X A;  1PYV A;  2A6T A;  2NOJ B;  3QYF A;  2KMU A;  4BE1 A;  1Z7L A;  1MND A;  2IS4 A;  4LIU A;  2PMZ A;  3CJR B;  4BXF A;  3OR1 C;  3D5L A;  2Z16 A;  3K4B A;  1JI8 A;  3DLA A;  4XN3 A;  2VLA A;  2VIX A;  1Y56 A;  1X4O A;  4PK4 A;  2VPL A;  3K6G A;  1K6Y A;  2E1M B;  2WB1 A;  4F52 A;  3DEE A;  3I9V 2;  2OV7 A;  5LFA A;  3OYF A;  2LOO A;  5FRM A;  2L9N A;  4E7L A;  2K9M A;  4ZDO A;  4ZTJ A;  1EA3 A;  1X19 A;  4MLO A;  4BS9 A;  4XKV A;  2VL8 A;  2X6X A;  3CP8 A;  3IAS 2;  4PSW A;  4XOT A;  2ZSI B;  3OYB A;  2VJ5 A;  3OYI A;  1UG0 A;  4N4O B;  2MAB A;  4DBR A;  1LKX A;  3CMM A;  1E0E A;  2XF6 A;  4P5O A;  4CCK A;  1OR7 C;  3DWL E;  3H35 A;  4RM3 A;  3VWB A;  2M7A A;  2UUZ A;  3H5N A;  4RLF A;  1VZ0 A;  3OL3 A;  4IKF A;  3OYC A;  5FRN A;  4C2T A;  4XLC A;  3OYJ A;  2HVQ A;  1U0J A;  4F93 B;  4ZYA A;  1ZEL A;  3E0J B;  2KQR A;  4KIT B;  3SEZ A;  4XMY A;  2JSP A;  3S3M A;  3K4M A;  2RQQ A;  3NWT A;  1SFK A;  4HG2 A;  4E7Z A;  3OYH A;  1OLT A;  2JA2 A;  2JUG A;  4BJ6 C;  2DT6 A;  4JOM A;  3OMY A;  4PJJ A;  5FRO A;  1YX3 A;  4QPQ A;  2CH0 A;  2WAD A;  1P9Q C;  4XLH A;  3LFU A;  2WY7 Q;  3K4C A;  4ITV A;  2HPI A;  1DQU A;  3FKJ A;  2CW7 A;  1LFP A;  3ZR8 X;  2XF7 A;  4ZJZ A;  1V5F A;  2KHM A;  4KIS A;  3MKZ A;  1BOB A;  2IXS A;  3L2V A;  1WJB A;  4NNJ A;  2Z1D A;  2VQH A;  4ZDL A;  4ZC3 A;  1YE9 A;  3K4L A;  4CCJ A;  2CV0 A;  3EUA A;  4D9J A;  2HZD A;  1D0Z A;  2FUG 2;  3K4J A;  3V42 A;  4Y33 A;  2R7Q A;  4RM2 A;  4B3X A;  4BUP A;  1DGW Y;  3H5R A;  2KRH A;  4BDY A;  2BW3 A;  3IUO A;  3QOE A;  2LY2 A;  3PNV A;  3ZQQ A;  3BLY A;  2BOL A;  4XLA A;  4F92 B;  2WY8 Q;  4XOR A;  3OIP A;  2E1M C;  4XKC A;  4BEH A;  4PUS A;  3LL7 A;  3RCO A;  1MMN A;  2CS3 A;  3K70 C;  2I8D A;  3HOT A;  3AL0 B;  3LSH A;  2KL4 A;  3HC7 A;  3PNT A;  4NC8 A;  3OYE A;  1WJC A;  4C2U A;  3TL4 X;  2X6W A;  3OY9 A;  3H5A A;  3SYT A;  4CA0 A;  2V6E A;  2LYC A;  3ZGK A;  4BL0 B;  2F4I A;  4CCN A;  4CUG A;  2CFO A;  1MMG A;  1X1A A;  2MFZ A;  3QYB A;  3GBG A;  2RRE A;  1J09 A;  3A1Y A;  1V5G A;  3DTE A;  3DU6 A;  4OAZ A;  4RMN A;  1X1C A;  1V5E A;  3M8J A;  3CF2 A;  4PJN A;  2R7R A;  2KPM A;  2M4K A;  2W4S A;  2IGO A;  1WJ5 A;  2ZXH A;  2K5C A;  3MMY B;  3OYA A;  2K3P A;  2M4G A;  1N77 A;  2CUJ A;  2IGM A;  2WBM A;  3LSK A;  3RSN A;  3FBN B;  2VJ4 A;  2R7V A;  2KLO A;  4E7S A;  4AVZ A;  3HPH A;  3VYT B;  4DGW B;  4BQQ A;  4E6K G;  3OS0 A;  4B47 A;  2XSJ C;  2BVL A;  2XF5 A;  3PSF A;  2ZXI A;  3BCA A;  3OWT A;  4CZC A;  3DQV C;  1S9H A;  3PNY A;  3HXL A;  3ZCO A;  3DPL C;  4CH7 A;  1D1A A;  2QKL B;  1KON A;  4HSR A;  3S3N A;  2RNG A;  1DGR M;  2PJR A;  1W36 D;  2BW3 B;  2Z2S B;  3OS2 A;  1NG6 A;  2UWM A;  3OYD A;  5HLT A;  2IS2 A;  3G2B A;  4GRI A;  1LDK B;  2MYS A;  4XR6 A;  3HKZ A;  3U21 A;  2CV1 A;  3QYE A;  2L7K A;  4BEH B;  1UEL B;  4AYB A;  1X1B A;  2VJI A;  3F9K A;  4P1W A;  2W82 A;  3MKW B;  3HG9 A;  3A2K A;  1MMA A;  4XN0 A;  3W2A A;  3HUG B;  3K4N A;  1TT0 A;  5CKT A;  4PFP A;  2VJJ A;  2LG4 A;  3DTK A;  2A5W A;  2AQE A;  3OL4 A;  4BE0 A;  2DT7 B;  4EAT A;  3S8P A;  3TBI A;  4E7I A;  1UAA A;  1D1B A;  1WJD A;  1SAU A;  4B43 A;  4FAS D;  3PJR A;  4R79 A;  4HST A;  2WAE A;  2DCE A;  2HPM A;  2GOM A;  2HNH A;  1MNE A;  3OYG A;  3C2H A;  4FET A;  4HRI A;  2HVS A;  1QHH D;  2LRE A;  2V7F A;  4LIV A;  2F5V A;  4KT6 A;  4II3 A;  4CCM A;  4OAY A;  2V26 A;  1TZL A;  3L2W A;  4ANJ A;  2W7N A;  2IS6 A;  4C9Y A;  3HOS A;  3L2Q A;  2CMP A;  1D0Y A;  2XAU A;  3OS1 A;  3AL0 C;  3H9Q A;  4NQW B;  1NG7 A;  2X51 A;  4E4H A;  4BAC A;  3MKY B;  1X4P A;  3MD2 A;  2ZFU A;  1WFX A;  1Y6I A;  3H9G A;  3S93 A;  2XDV A;  3VYU B;  2LRD A;  2VXD A;  4B48 A;  2KZV A;  2M3A A;  4PSX A;  1FMW A;  5LD2 C;  3BCB A;  2PJR B;  3VYR B;  2IGN A;  2ZSH B;  4XON A;  2JVG A;  2VQC A;  1YX5 A;  1Z3X A;  1MMD A;  2V4J C;  1DP3 A;  4HEA 2;  2VKH A;  1LVK A;  4X0G A;  1IRX A;  2R7S A;  3LSG A;  2X85 A;  2OUM A;  3PL8 A;  3VSK A;  4XM3 A;  4XOP A;  4NUB A;  3D5R C;  3AFH A;  3A4C A;  4XLF A;  3M1C A;  5HOO A;  4LIT A;  2E60 A;  3OYL A;  4BE2 A;  4CCO A;  4II2 A;  1PJR A;  3CZ6 A;  3N05 A;  2LC2 A;  2CUZ A;  2MD0 A;  3DPU A;  3K4K A;  3OR2 C;  2Q2E B;  3E1S A;  4BQN A;  3RTR A;  1N78 A;  3LSI A;  4N4N B;  3OYM A;  2WA0 A;  2KP6 A;  2KRC A;  1X1D A;  4YRV A;  3VDX A;  4XQF A;  1HA8 A;  5HVQ C;  4YEJ A;  2R7U A;  4XL9 A;  3CP2 A;  4C30 A;  3RPU D;  2L5Q A;  4NC7 A;  3SEQ A;  3W2W A;  2GOX B;  4IX7 A;  2X6Y A;  4HPQ A;  4QPO A;  2QKM B;  1BR1 A;  2Y0S A;  1WJF A;  4ZTF A;  2M7B A;  3HL2 A;  3DKX A;  3AKZ A;  2O5R A;  2VXZ A;  1D0X A;  4RLQ A;  4AU7 A;  3KEY A;  2X1C A;  3VSL A;  5HNH A;  2IS1 A;  2VKD A;  3IP4 B;  4IZZ A;  4U87 A;  5JHF A;  2VQG A;  1WJE A;  3KYL A;  1G59 A;  4G6T B;  2KDO A;  3W3C A;  4DIQ A;  4F91 B;  3OYN A;  2LBF A;  4BU2 A;  2R4G A;  3LSM A;  2CW8 A;  1Z21 A;  2X1D A;  1R6R A;  4F55 A;  3OIQ A;  3EUK L;  4CCL A;  2L9S A;  3BG7 A;  2JVH A;  2E5N A;  2K9L A;  4BJ5 C;  2R7T A;  1QHG A;  2L2O A;  3S3O A;  4J01 A;  3ZRG A;  4CSW A;  1MW7 A;  3CES A;  4E7H A;  2HDW A;  2F6C A;  3ZXS A;  3DTI A;  3RQ4 A;  2R7O A;  3SZG A;  2R7X A;  3EPZ A;  4Y4R A;  5CQG A;  2M0M A;  2VB6 A;  4E7K A;  4BJT A;  2BVM A;  2HQA A;  4Y3O A;  4J00 A;  2V9K A;  2WAQ A;  4XKB A;  4BQO A;  3IAM 2;  3PSI A;  4PJL A;  4XNF A;  5KHD A;  2WAF A;  2X1E A;  2HVR A;  3UR3 C;  1WJA A;  1ERD A;  4XLE A;  1D1C A;  4JQF A;  4XKW A;  3I3L A;  3DPT A;  3FBI B;  3K70 D;  1W36 C;  3L2U A;  2LY1 A;  4BDZ A;  2CV2 A;  3LMM A;  3FHN A;  2ELJ A;  4F3Q A;  1GLN A;  3BG6 A;  2VQL A;  3FDY A;  4DJA A;  4DBQ A;  2P0W A;  3BC8 A;  3D5S C;  3CJQ B;  3EUH C;  5CQE A;  3ONQ A;  3PUB A;  4PFO A;  4D1Q A;  4IQJ A;  2LBF B;  5TGT A;  3OYK A;  1QU3 A;  4BGD A;  5KNL A;  3DU5 A;  3HPG A;  4YEL A;  4HNT A;  3S32 A;  5CPR B;  2V1N A;  4HNU A;  3K10 A;  4KJZ A;  2AQF A;  4B44 A;  1AA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...