2V7FA

Structure of p. abyssi rps19 protein
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
149
structure length
139
Chain Sequence
ATVYDVPGDLLVERVAQRLKEIPEIKPPEWAPFVKTLPEQEDWWYYRVASILRRVYLDGPVGIERLRTYYGGGHAPERFYKAGGSIIRKALQQLEAAGFVEKVPGKGRVITPKGRSFLDKIATELKKELEEIIPELKKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords RPS19E SSU RIBOSOMAL PROTEIN S19E
publication title Molecular Basis of Diamond Blackfan Anemia: Structure and Function Analysis of Rps19.
pubmed doi rcsb
source organism Pyrococcus abyssi
total genus 46
structure length 139
sequence length 149
ec nomenclature
pdb deposition date 2007-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01090 Ribosomal_S19e Ribosomal protein S19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2700 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2v7fA00
3J7AY 2V7FA
chains in the Genus database with same CATH superfamily
1E2XA 1K6YA 4FQGA 3SDGA 2EQRA 1LDDA 3WTWC 1PUFB 2MGQA 1RR8C 2NOGA 2DQRA 1GXPA 1ETKA 2UV1A 3BY6A 1D5VA 2Y30A 3RZDJ 3P9KA 1G8XA 2HOAA 2WBMA 4XBFA 5FJ8J 3S16J 1WJBA 3IH3A 2COMA 1V5GA 3RPQA 1IW7F 3F8MA 3I54A 3L00A 2LKSA 1T0FC 2Y48A 3KEOA 4MNUA 4CXFA 1WJFA 1HW2A 2VBWA 2CSOA 4V2FA 2K02A 4A5NA 2ZCWA 2R93J 3L7WA 5KHDA 1XSVA 4RAYA 2DTRA 2V79A 1ZQ3P 1SVLA 1MNDA 1I6HJ 2JMWA 4PK4A 2JZYA 3NRVA 3HC7A 2YSRA 4ITVA 4XORA 1MJBA 2XAHA 1F9NA 4CDGA 3OWTA 1JE8A 4QTRA 1O4XA 4BXUA 4BY7J 1J2XA 2VBYA 2VJ4A 3OY9A 1QQIA 2HFHA 3KYLA 2UWMA 3D0SA 2ZJPF 5TRDA 2XVCA 2K9MA 1BN5A 3KFWX 4XLEA 2OQRA 3I4NJ 2QQAA 3VYTB 4LG3A 1TWGJ 1UJ8A 3QPSA 5IP9J 3S3OA 1D1BA 2ICWG 1T56A 3FX3A 2E5NA 2HOSA 4IRIA 3O3KA 4RGXA 3GTLJ 1QHHD 2KIQA 1KA8A 3I64A 2QSFX 4Y7NJ 4HX7A 4LOCA 4U7BA 3ZMSA 3G71I 3VWBA 2NVTJ 1Q1HA 2MC4A 3A1YA 5EDNA 2GXBA 2EA4A 2E1MC 3K4KA 1IGNA 1N78A 1BW5A 5TGTA 2KJCA 1SD6A 1YW9A 3FXMA 1X1AA 1P7JA 3K10A 1D5YA 2HVRA 1UZCA 2Y0SA 4C30A 1H9GA 3MD2A 3FM3A 1SAXA 2ESHA 3WTYC 4NQWA 2VPLA 4PJJA 5CPRB 3K2ZA 2H27A 3UNGC 1Z9CA 2GA1A 3KZZA 1MH3A 4M3BA 1ZKGA 2F2EA 4MQ9F 1R23A 5GPAA 4BS9A 1L0OC 2I5UA 1R36A 3S1RJ 2H94A 3ABTA 5FGMA 1PP7U 1FBSA 3BWGA 1IJWC 1DPUA 2VQLA 4D5FA 1KQ9A 1S6LA 4XNFA 4CH7A 2HVSA 3CUQA 3GTGJ 3RQIA 4B48A 1BOAA 4ZYHA 2R7SA 1J9IA 2FMYA 4HW0A 1Y1WJ 2VE9A 5GAHJ 2FD5A 2V26A 2A05A 3BTLA 3GLXA 4BEHA 5M3FJ 2OV7A 1R49A 3HDDA 1ZLKA 1XMAA 3V42A 2FNAA 3OYGA 2XB0X 3S15J 4CCKA 5D5XB 2E7XA 3OYHA 2NS8A 4P5OA 2RNJA 3KIOA 3A0HC 4J01A 4ZH4F 5B3SH 3KLOA 1BM9A 4MQVA 2VOOA 1TZLA 3CMMA 3SEQA 3MZ8A 1X3UA 4IRGA 4GO1A 4HDVA 3F21A 4BL0B 4E7IA 2MH2A 3EUAA 2DA3A 4DZJA 2IEKA 3E97A 4V2GA 3AG1H 4YFNF 5EF6A 4MEYF 1MBHA 4QPOA 1F5TA 1X4PA 2M2EA 2E7WA 2HXOA 2F5VA 2KL4A 4EVIA 1WH7A 2Y9ZA 3OIQA 3DTKA 3KX2A 1VQ5I 2CV1A 2JK3A 5BOXA 1MDMB 3K4LA 3PUFA 2JPBA 1TWFJ 1UCRA 4XIDA 4Y4RA 2NVYJ 5AIQA 4A93J 3FXLA 2F6CA 5CLSA 2HKOA 3ZMVA 1DP7P 1IRZA 5J47A 4HF1A 5FRMA 2YU3A 4BUPA 2Z99A 3GVAA 3LSIA 2M0CA 2K86A 1YX5A 4U88A 4KISA 3BR3A 1QPIA 3S32A 4M72A 1IN8A 1W0TA 1ENHA 4RAFA 1V3FA 1YW7A 3HYIA 5H6QA 3IWFA 3GFLA 1MZBA 3J7YJ 1LNWA 1WVRA 3GFMA 2K40A 1RKWA 1G4DA 2V9VA 3E6MA 2DA1A 4HOBA 4D5CA 5HS8A 3QYBA 3OYLA 4IHTA 1X4OA 2BY1A 3AL0B 2AXTC 3RSNA 2Y75A 1MBGA 4X1EA 2STTA 5BS6A 3S1QJ 3QU6A 2F5EA 2HI3A 2DA4A 1ZLJA 3LA2A 3V8KA 3TQNA 2IS4A 2CUZA 5DCMA 2BY2A 2JVHA 4G6TB 1SVMA 2FQ4A 3G1OA 3RYPA 2PBIA 2J5OA 1P6RA 2K3PA 2AQFA 1TW3A 2MSYA 2G7UA 2ZXJA 4ZDPA 1O7LA 3EQLF 4NUBA 3CF5F 1YITI 2ISYA 2GXGA 4LLNA 3OMYA 3QWLA 1W36D 1KGSA 3Q0WA 4RB0A 2CUFA 1H0MA 1YW8A 5E17F 1MMNA 2KZGA 4F55A 1D0XA 4D1QA 4HNTA 3JRIA 3HOWJ 1Q1VA 1YRNB 1PP8F 1RETA 3K0LA 3PQKA 1X1PA 1NG7A 1X2MA 3FHNA 4AIJA 5M3MJ 4I2OA 2KT0A 4OWRB 1IO2A 3M3YJ 3FMSA 4AYBN 3A4CA 2QQ8A 2R7TA 4N4OB 2DW4A 5FFXA 2V9KA 3OYCA 5DUIA 3GUDA 2EB7A 1Y0UA 2OQGA 1GV5A 4C9YA 3I59A 4CYCB 5CYVA 4GRIA 4BQQA 2GWRA 2E36A 2FSWA 3COAC 2F5CA 3P7NA 5LGNA 3LQRA 3RQ4A 5EEAA 3U21A 4UB6C 2VC0A 4RLQA 4E7LA 5E1WA 4W1UA 2PJRB 3CZ6A 4AIHA 3GLLA 4G7OF 1VQKI 1SFKA 1E3HA 2KDZA 5HVQC 1XDUA 4ZDOA 5LEJA 3B6AA 4GCVA 1FOXA 3Q0UA 4MEXF 3FWEA 4M9XA 3KEYA 1XGOA 2IGNA 3WTSC 4ESJA 1JUMA 3TW7A 4RDUA 1T2KA 1IN7A 5E20A 4Z6YA 3KETA 4LK0F 3N4MA 1X1BA 5HDKA 4I6ZA 1WJAA 1V55H 2DA6A 2E1CA 2LMDA 3FXJA 2P8TA 2IGKA 1LE8A 5ERIA 3H35A 3BLYA 4A3KJ 4A3EJ 2V6CA 1Z0XA 4XN3A 4BYYA 1K7AA 2BV6A 1KYWA 1FP1D 2HTSA 4PJNA 5CJ9A 1R1VA 1FSEA 5EYRA 4M6YA 5H20A 4G7HF 5L3DA 3LNQA 2CQNA 2WAQA 3CCSI 2DFIA 3GTPJ 3EDPA 3E3VA 4GDFA 3DEEA 3S1NJ 4BJTA 2ZJQF 3C1DA 4ANJA 4N9IA 1B9MA 3IP4B 2L7MP 2ZFUA 1AU7A 3BZ6A 2XKPA 1BIBA 2R7OA 2RREA 2ZSHB 4M3GA 5DD8A 4B44A 5BQTA 3MKYB 4BNCA 1F43A 3M1EA 4EJUA 4JX6A 3JREA 4OMZA 2EFOA 3WU2C 2GLOA 3H5AA 4A69C 5EGOA 2V1DA 3HJEA 1OCPA 1L3LA 2GXAA 5CVIA 2K85A 2L7KA 4RAZA 2XROA 3KE2A 1T0FA 4RGRA 2Q8KA 4ZYDA 2VT3A 2QENA 2EZKA 3HRUA 4XMYA 1YFHA 3K7AJ 4GFBA 4Z2YA 3I55I 2DJNA 2RN7A 1IXSB 3F8BA 1YG2A 1U8BA 3F0CA 4C3JJ 2R7VA 1SVOA 1OLTA 2BZTA 2IGMA 1FZPB 3GTQJ 3CJTB 1D8KA 4RB3C 1BR1A 4PCQA 5ICGA 1XPXA 2LF7A 5E3NA 2XAGA 2KRCA 3E1SA 3DBHB 3MQ0A 4HLXA 1BL0A 4HG2A 3JRHA 4DIQA 3GZ5A 4UVBA 1R4NB 2CW8A 3LWFA 2KZVA 5JFRA 4A3GJ 2QWWA 1MMGA 3EETA 4XOTA 3M8EA 4KICA 3K4NA 2ZB9A 3ABKH 2CH0A 3LSGA 3CC4I 3BJ6A 5F6FA 1Z21A 1ON1A 1IDZA 2AHQA 5E3MA 2CU7A 3JRBA 1I3AA 2LTPA 1HW1A 3BC8A 3WODF 1MMSA 1ZGAA 3OSGA 1TLHB 1WGXA 2JUCA 5HDGA 4BKXA 3C2BA 2GZWA 4LIUA 3I53A 3C2GA 2NVUB 3IH2A 1OQYA 1XN7A 5GADJ 4IHVA 1RKTA 4DNCA 3QYEA 2W7NA 4MHGA 3BZCA 1FX7A 1WZ2A 5HDNA 1BI2A 2ZNYA 2W4SA 4JK1X 3OYNA 2FU4A 3HOSA 4B3AA 2WAEA 3LOCA 2OD5A 3V4GA 4UUVA 3TO9A 2VODA 1FTTA 1MJAA 4HF2A 5LHGA 2E1NA 1KU2A 1R5ID 1E17A 2BY0A 3KP7A 4DGWB 5IOYA 5ICCA 1IV6A 4IHXA 2HOTA 3WG7H 3HOYJ 2HYGD 4L9JA 2RQPA 4BHCA 2M87A 3Q5FA 3TP3A 3OS1A 2W85A 2CS3A 2XASA 3HZJA 3QP6A 2G9WA 4X6AJ 3HUGA 2L5QA 3DLLF 1WKMA 3WE2A 2EK5A 3W6JB 4D7MA 3NARA 2BBYA 4K2EA 1A04A 1LEBA 3CTAA 2XPVA 1T39A 2A3SA 3CCLI 4BBRJ 2OJED 5D5VB 4J00A 2O61A 4D9JA 3MZHA 1BI3A 1HC8A 2AS5F 1UFMA 2HYFA 1LFPA 1XMKA 1G59A 2CO5A 2MFZA 3TKYA 4Y13A 3ERMA 3OIPA 1S3JA 2XGDA 3S3NA 2FX0A 5FKKA 2EWNA 2IXSA 1BA5A 2HQNA 1ZK8A 4L0YB 5J1YA 3CCEI 3FISA 3PL8A 2Z2SB 1ERDA 5F1JA 2FOWA 4Y33A 2Q2EA 2LSOA 4XKWA 3BG3A 3DEUA 3MN2A 3Q0VA 3VYSB 2R7RA 5BMZA 1I27A 4ZYEA 1TP4A 3B6CA 1KQ0A 4ABZA 5FROA 4OU0A 1WJEA 3BJAA 2OC6A 3KCCA 3JTHA 1EKEA 1EF4A 4BDZA 4CSWA 1JUSA 4G6DA 2HEOA 5BPIA 1RESA 3TDUC 5L3BA 1A35A 4M3EA 4XONA 2M7AA 3K1MA 3GMEA 4HF0A 1GVJA 4A3IJ 4OIRF 2RDPA 5EG0B 2NS7A 1QPMA 3RPUA 2F4MB 3L09A 5FKOA 3F23A 2K5CA 3O2PE 3RI4A 2XKOA 1FLIA 1YI2I 3NWTA 2ECBA 1FY7A 5J40A 2WB1A 1K78A 1Z05A 2EFWA 5DM6F 2JA6J 4IEJA 2TRTA 4Y15A 2FUG2 1DU6A 3S93A 1FP2A 4AUXA 1DUXC 4LG0B 3MVPA 4DZPA 3I9V2 3AL0C 3NAUA 4XRMA 1QZEA 2DI3A 2VJ5A 3T1BA 2P5VA 3BCAA 3IH4A 4AC0A 3GWZA 2JT1A 4B8XA 4XRFA 3MFKA 4IOCF 4CCLA 1KU7A 2EFNA 1WCMJ 3L2WA 1IF1A 3SHFA 1O57A 3K1NA 3E5QA 2EZIA 4M6VA 3A03A 1ETYA 4F92B 4ZZDA 4IKFA 4UXNA 5K7HA 2P81A 4O5VA 2R7UA 4HEA2 2QF7A 2DT5A 4ZC3A 2WY8Q 3FDYA 1KYZA 4KDPA 2ZXIA 2R7QA 2HKXA 3HRMA 5CKTA 1WI3A 2EBIA 4P9UA 4FX0A 1B72A 3WHBA 5J6XA 1EH8A 1PUEE 3KP3A 3TOBA 4JOMA 1OCCH 3GYHX 1G3YA 1NH3A 1RUNA 3REOA 3PFYA 4KIBA 2ZMEB 2DODA 4UUSA 1KU9A 2M3AA 3RPUD 4B1RA 2TCTA 5KAFC 3F22A 1A31A 2LYCA 3K69A 3ISPA 1HOMA 1W7PA 1YO5C 3VYRB 2DPUA 5F1RA 4A0XA 1IRFA 1EA3A 4DBQA 4NNJA 1ZN2A 5HLIA 1WPKA 4LITA 4HNVA 2AXLA 2XF5A 4PGGA 4XLCA 2RC4A 1ZRCA 3GEZA 4FCYA 2XF7A 5GPCA 2EIKH 2EIJH 4N4NB 2XC7A 1VQ9I 4BJ6C 2Z1DA 2ID3A 4AIKA 1HDPA 1W5SA 1Y56A 5EJCA 1G3TA 2Z3YA 4C3HJ 2PX9A 3S2WA 3CP2A 3WHCA 2DYRH 2NVXJ 2EZHA 4MFEA 2CV2A 1FOWA 1MMAA 5E3OA 1OKRA 3IC7A 2M8EA 5L3CA 2JA8J 4A3LJ 3GXOA 4JX5A 5A2QZ 5F08A 3EYIA 1XSDA 1XGNA 1UG2A 2E60A 2VKHA 3DU5A 1RZ4A 4XQFA 4ETSA 1UB9A 3T8RA 4KNYA 2M8GX 4EV0A 1ETWA 3R4KA 3H0DA 2LLKA 5C44J 2MLKA 3L2RA 3OOUA 4OIPF 1HKTA 4CCNA 1YS7A 2KQRA 4JX4A 4PGHA 4HV5A 3S1MJ 3CDLA 3S3MA 1FIAA 1E3PA 2W57A 2XRLA 2JN6A 3WGHA 1W7PD 4YIFA 4XSZF 4HBLA 5CVVA 2VT2A 2V1UA 3ABLH 1IRXA 1G3SA 5FRNA 3MCZA 1IG7A 2PJPA 2KLOA 3I3LA 5HLHA 1U8RA 5FB2A 2X1DA 2GA2A 2YPRA 2H09A 3M7GA 1CF7A 3FZVA 4I01A 3ZMDA 4KITB 1O3RA 2BW3A 4CO8A 5D5WB 3AAFA 4HQEA 2HQAA 1I6XA 4WXCA 2EILH 5J1RA 2AO9A 3PQJA 2O0YA 4ZTFA 1PUFA 1VQLI 1NTCA 4ZDLA 2X6XA 2Z5UA 3DFGA 1TBXA 5DTDA 2CQKA 1JT0A 5CQGA 5F0HA 1O3QA 1Y8RB 4D0PA 2ID6A 1T98A 3H3UA 4KT6A 3FK6A 2JVGA 4I99C 1P4WA 2P6SA 3BDDA 1VQPI 5DV5A 2KMUA 3H9QA 1J7KA 2H1KA 2I10A 4M9SA 4BE0A 2MYSA 3SEZA 2LK2A 2ZC2A 1J5YA 3I56I 2BEOA 1H8AC 2HR3A 2HDCA 1K61A 2H1LA 3H0GJ 2P5LC 4IX7A 4MGRA 1VFCA 1POGA 5IY5H 2IVMA 2KRHA 5CVJA 5E1ZB 3PNVA 3DPLC 5FLXZ 1ZARA 4FX4A 3HOZJ 5L3FA 1D1AA 5B66C 1F4KA 5K5OA 3PNTA 1BC7C 2DAOA 3FMRA 3JR9A 5JHUA 1AKHA 1D3YA 1MBJA 3Q9SA 5BPDA 1LJ9A 3BR6A 3HSRA 2DA7A 4BH9A 2H8RA 4L5IA 3HXLA 2XGEA 1USTA 5ED4A 3ERED 4XICA 4EMSA 4XR6A 3H1CA 4CYDA 5D4SA 1YX3A 3PO3J 2X85A 3BG9A 2P0WA 1Y1VJ 3RJPA 2CFOA 1IN6A 2R3SA 5L3GA 3CLQA 2X1EA 1U78A 2P7CB 1FJLA 3E6BA 2DT6A 5JLXA 2DQLA 1ETVA 1ORKA 1U9NA 5TISC 4E7JA 1YHQI 1LB2A 2WV0A 1HKSA 4ON0A 2OBPA 3HL2A 5GAGJ 2VBXA 5A2QK 1MMDA 4HX8A 3G2BA 1YQAA 5LGTA 1NHAA 3E0JB 1T95A 2X9DA 3PIPF 1VQOI 1X19A 3BG6A 3BJOA 1X58A 2ZSIB 1XDSA 5H6RA 2QBYB 2VXZA 3HRTA 4QPQA 3EUKL 3WTUC 4OMYA 3N05A 3HPHA 4XKCA 3HEFA 3M8FA 1MSFC 2K9NA 1R4MB 4DJAA 1OJLA 5KCMA 2HYJA 4L9VA 1Z67A 4XN0A 4B43A 2LKXA 3KLNA 3L2QA 3PSIA 4P1WA 3ULQB 3V7CA 2KHMA 3A0BC 1U5TB 5DUKA 3TGNA 3FKIJ 1BC8C 1TC3C 5M5YJ 4R8HA 2QEXI 3CCVI 1PJRA 1ZG3A 2ZO4A 3KYCB 3CMAI 4IVNA 3CCRI 3H36A 1QHGA 3OS2A 2VKEA 3ZQGA 1YIJI 2GAUA 3T5XA 1CGPA 2WB1N 3D5LA 2K3FA 1FBQA 4F3QA 4BDYA 3JCUC 2Z9OA 2XGCA 1IXRC 1N75A 4IQJA 2VOPA 3J81Z 3G1LA 2YU9J 4M3FA 1P7IA 4C2UA 4FE7A 1XTAA 3BQYA 3I71A 4OAZA 2GIZA 3TO6A 5JI6A 3ZQCA 2UXXA 5FLVA 1QBJA 5D5UB 3DLAA 1LVAA 3DTIA 2Y0MA 3VYUB 2L54A 1ZH5A 5EEHA 5J8CA 4G8XA 4WK8F 2IGOA 1JKRC 3VB2A 1HDDC 2XB5A 4EQQA 2LREA 1HLVA 4MTDA 2G7HA 3QPHA 3PFIA 1BIAA 2QYOA 3HGGA 3J7ZI 3FM5A 2X6WA 2QM3A 3C18A 4JYKA 4NC8A 4UHTA 4EM0B 5GAEJ 5ILSA 1RPWA 1LDKB 4LJZF 4M71A 2DDAA 2FOKA 2KRFA 1ITYA 4MIMA 2W82A 3OYKA 2R92J 2BVLA 1K79A 5J3LA 3BZKA 3SQNA 3BTJA 2LBFB 2MABA 1I39A 3JTGA 2XAFA 4HDUA 1TTYA 3F3XA 3QAHA 4Q47A 5K7FA 1YOVB 4LK1F 1GVDA 4I02A 1GUUA 3WGGA 2OTLI 4FT8A 3IRQA 4F93B 2M45A 2YX7A 2OZ6A 3EUHC 4ENNA 4CCJA 1BJZA 2DOEA 1SD4A 1WH5A 1TQMA 3M8JA 2MD5A 3J80Z 4RB1A 3ECOA 1TNSA 4LLLA 3CDHA 1S9HA 3SFIA 3OR2C 3WG9A 2H6BA 3SDBA 1TWCJ 1Z7LA 1S5LC 1MW7A 1V5FA 4IO9F 3G3ZA 4CGZA 2QA4I 5ICEA 3I4PA 2RV8A 3ZPLA 1C0WA 2VN2A 2DFHA 2VBZA 5KVRA 4EJVA 5K5RA 3OS0A 1ZG5A 1UAAA 1QZYA 2CQ7A 2MC3A 3JAMZ 2XRNA 4HAMA 1VQ4I 4A2UA 1KONA 3MEXA 3HOXJ 2L4MA 2NYXA 1ZG1A 2Y69H 2F4OB 1OCTC 2BGCA 4A6EA 2EPFA 2IS2A 3BPVA 3SZGA 3D1NI 2X4HA 2ZJ2A 2D5VA 2IS1A 2IBDA 5K5QA 1VQMI 2HDDA 4HA8A 1YRNA 3A01A 2EINH 4NC6A 4A3CJ 1I1GA 2XGXA 2ZKZA 1K6OA 1GV2A 4WX9A 5FKMA 4JBAA 2A61A 3OYAA 1TQIA 3I58A 2KIFA 1JGSA 3L9FA 5EZHA 3LAJA 1OCZH 2O3FA 3AKZA 4WXHA 1UHSA 4IJAA 3ABUA 4XRSG 3CCYA 1MBKA 3QODA 3KYDB 4I0BA 4BE2A 1V4RA 3E6CC 1UHMA 1W5TA 2LY1A 1JJ8C 2V1XA 1G3WA 4CYCA 1JI8A 2M7BA 4A0YA 4DOZA 1BR4A 2B7EA 3OL3A 5FD5A 2LH9A 3ROUA 4AVZA 2EFPA 1FEXA 2FJ1A 1SAUA 5H2FC 4IHYA 1VQ6I 1AOYA 1OMIA 2BVMA 4M73A 1XSXA 2E71A 3T0YA 2VI6A 2NS0A 2O8KA 4A3JJ 1I5ZA 2Y0SN 4KYWA 4CCOA 3CO6C 1P4AA 3RKYA 1T6SA 2RKHA 4E70A 2DA2A 1N77A 3FXKA 2R7XA 3JRFA 2ESNA 4PDKA 1LPQA 2O6GE 3ZRGA 1WJCA 1UMQA 3FIWA 2YX4A 2VB6A 1XCVA 4YEJA 2E5ZA 3ZQHA 5EZGA 4O3MA 5F64A 2E1MB 4L5EA 3HOVJ 2HXIA 3BPXA 4PUSA 4L18B 1B9NA 3CCQI 3OYIA 5HNFA 3HSFA 4AM3A 5CVRA 3LSMA 5D8KB 4KUMA 4XSXF 3AG3H 3QOPA 4LIVA 2VKDA 1XS9A 1KQ8A 3QPLA 4C2TA 2JA5J 2UUZA 2LRDA 3M9AA 2GQQA 3KZIC 2KIUA 3PUBA 2WADA 3OYDA 1FNNA 2YR2A 2BHYA 3JRCA 3KZYA 1D0ZA 4JP0A 4B09A 4HYEA 4IF4A 3ZGKA 2LY9A 3LSRA 9ANTA 3KP2A 1ZGJA 3WU0A 3MKWB 1YJNI 2STWA 2Z33A 1ZRFA 5HS9A 3HUGB 3GFJA 2ELHA 4DBRA 2D1HA 1IN5A 4F91B 2PMZA 3LA3A 2YS9A 2FMLA 3SZPA 2QZ8A 1A6QA 1KU3A 3R0JA 2FA5A 2M34A 4MO7A 4BHPA 3FBNB 5ICFA 1WHUA 1YE9A 2TDXA 1S7AA 3C7JA 2JUGA 3TDZC 4ZYAA 3AG4H 5AONA 2JA7J 2K9LA 1LVKA 4PJLA 1DGWY 2CV0A 3OYJA 1R6RA 5GTIC 4BQNA 1DGRM 3G1MA 3CQZJ 2EIMH 3CMEI 1QVTA 3FF5A 1S7OA 3TEDA 2K27A 2MH9A 4BACA 1QA6A 1PYVA 3CCMI 1HBXG 4E7SA 5JHFA 4FHTA 4WF2A 3VEPA 3AFHA 2E35A 4PSXA 3BTCA 2DOFA 3BOQA 2LR8A 1D1CA 3G4SI 2F48A 2P6TA 4FETA 3TO7A 4AWXB 4GXOA 1W1WE 1Y6IA 1YTYA 2ELJA 3IKVA 2GOXB 3H5RA 3HRSA 5B1BH 2FBKA 3ZCOA 1LQ1A 2WA0A 3ABMH 1BR2A 2OUMA 2PLYA 1OFCX 2NAZA 2Q1ZB 3EYYA 4A6DA 2OAZA 5LRSA 4EGZA 1J59A 2KP6A 3PJRA 4XKBA 4OOIA 3DQVC 4PZJA 3S2HJ 4G12A 3C3WA 3I5UA 3K4BA 4RLFA 4UVCA 1NG6A 2L9VA 3J7AO 1SFUA 2L9RA 5IYDJ 2HQRA 2XV4S 2IT0A 2EV5A 2OPTA 3QU3A 3L2UA 1OYYA 3JSPA 2RQQA 2WAFA 1EV7A 3ZMTA 2UXNA 4WXDA 3LMMA 2XAJA 4LLGF 2IA2A 4CICA 2DK5A 4I09A 2KDOA 1JT6A 2NVQJ 3P9IA 3ZQLA 5DDGA 3SZTA 2X6YA 4G9YA 3CCUI 3RKXA 4MTEA 3DBRB 2A68F 2QQBA 1BJAA 4Q48A 2EZLA 3C2HA 3WE3A 5LGUA 1B59A 4FTHA 1FYLA 1LFUP 5B5EC 5HOOA 3X2QH 1BW6A 3NQOA 3H3ZA 3QOEA 2LD5A 4C3IJ 2EFQA 1OPCA 3IWZA 4IHSA 4ENMA 1IN4A 2JSCA 5DEQA 2CUJA 1B72B 4AU7A 4RAGA 3GX4X 1GHCA 1I1SA 4B3XA 3WGIA 3Q9VA 1QO0D 1WFXA 3FXQA 3HKZA 1XG1A 2M30A 3J7AY 5E8IA 3OYFA 3ZQIA 2E2JJ 4P9FA 1K83J 1WQ2A 2XDVA 1XMXA 5F0FA 4QIWN 5F04A 1UG0A 1U2WA 2L9SA 1IV8A 2W24A 1W7PB 3WTTC 1ULYA 1ZYRF 3FXOA 4C2MJ 2HU9A 3GCMA 3VODA 4I0AA 4DQ2A 2FBIA 4DYRA 2BXYA 3DPUA 1U3EM 2A6EF 3S14J 2DTZA 3WU1B 1FWZA 1ZAOA 2BE5F 2DDBA 2O5RA 1Z7UA 2E34A 4FE4A 4NHJA 3FXUA 3MMYB 2R0QC 3DKXA 1FIPA 3W3CA 5ILVA 3IAS2 4RS8A 3H9JA 2R5YA 1TWHJ 1SFOJ 1B8IB 2DMUA 2MLGA 2OF7A 3I0TA 3ZP5A 4UY8I 1OR7C 5HLGA 3V7RA 5EG0A 4QLCU 4KJZA 4RM2A 2LF8A 4XM3A 2IAIA 4KMUX 3HHGA 1XC5A 2H6CA 1V5EA 2DT7B 2IA1A 1JUPA 1DP3A 2O9LA 5AIPA 1P2FA 3DKYA 3VSLA 3EUHA 3SXYA 1MIJA 3ZMZA 2E1OA 3GW2A 1VTNC 2JA2A 1DDNA 2WAQN 3OIOA 2R5ZA 4LG0A 3FBIB 4I76A 3CF2A 1JKOC 4CZCA 4S0HB 5LRRA 1RRJA 2IRFG 1HSJA 1MNEA 1XGSA 2PFBA 2XAUA 3HOUJ 2FRHA 1JHFA 2BHZA 2X6OA 2KKOA 4U0WA 3LFUA 4HQMA 3DKWA 2DYSH 2WC2A 4H0EA 3CDIA 2HTJA 3PIOF 2OA4A 3GO5A 1HW5A 1U6GA 4G94A 3ML6A 2B63J 4AIDA 3RCOA 1RR7A 2K9QA 1R1TA 3HBLA 4N0BA 5DYMA 1CF7B 2NRAC 4RGSA 4ESBA 2ISZA 1S8NA 2OTJI 3ASNH 4E6KG 3HTSB 2UZKA 4BBSJ 4KN7X 4CUGA 2I8DA 1R22A 2O03A 3L1PA 3ELKA 3OSFA 4V19K 4LB6B 3RDIA 1MH4A 3DP7A 4IRHA 2ME0A 4TV7A 4G7ZF 1I50J 2GM4A 1MBEA 1EH6A 2ZMEA 2L9NA 2KISA 4YRVA 1XD7A 2EV6A 4NDLA 1T38A 4R79A 1OCOH 2DLLA 1ZTRA 5TJJA 4NQWB 3UKGA 2DMNA 2A6TA 1R5HA 2H8WA 1TWAJ 3V8JA 4ZZLA 1FYKA 4BGDA 3F8CA 3MWMA 4EJTA 1LKXA 3CUQB 3NEUA 3RYRA 1XGMA 3GTKJ 4Q4ZF 2E2HJ 2HNHA 4IOAF 2VJJA 4M6XA 4XRSA 4BJ5C 1J0RA 4E4HA 1H89C 4PJMA 3LSTA 2PI0A 2PMZN 1MSEC 3K9TA 4BEHB 1AKHB 3LSPA 3VOEA 3DBLB 3K4MA 2R7FA 5D4RA 4II2A 1FYMA 4E7KA 1UHWA 1QRYA 2IA0A 1PVEA 3UR3C 3GBGA 1APLC 4QWQA 1WSUA 1EJ9A 1ODDA 2JRMA 2L02A 4RA2A 4L0ZB 3S17J 1AWCA 2K4JA 3F72A 3DCFA 3ZN1A 2A5YB 3LL7A 2ZFWA 3R0AA 4ZJZA 1Y0NA 2CMPA 4HSRA 3TBIA 4ASNA 5IT3A 3IRRA 1TNTA 2IS6A 4D7NA 2M5WA 2QSGX 1QZZA 3ZOBA 1K4TA 1GLNA 1ACIA 1W4MA 2X1CA 4I7HA 5IP7J 1R71A 1IAWA 1OCRH 1WJ5A 5IOZA 3VPRA 2CW7A 5FLMJ 1IRGA 1IUYA 4UVAA 4E7HA 4QSHA 1GXQA 2GBYA 3LSHA 3W2WA 1P4XA 1IDYA 4LFUA 2X48A 1MBFA 3DWLE 2LG4A 1Z6RA 2DO7A 3MZYA 4KIFA 3F6VA 4KT5C 3CO7C 3DV8A 2VC1A 3CUOA 3K4JA 1FC3A 5FO5A 1HCRA 2W1OA 1O7FA 1Z91A 1H9TA 2IP2A 2CUEA 3EPZA 4A5MA 5C4JJ 3CC7I 2XPWA 3K6GA 3HB9A 2CYYA 1UELB 2ZXWH 2L4AA 4WWCA 4OAYA 2JQ7A 1B4AA 4ENJA 2W84A 3P9CA 3MAJA 5JVGF 2VJIA 4PSWA 3GZNB 5HODA 1ZR4A 2HQ5A 3BR1A 2HPMA 2DMPA 2G0EA 5D8LB 2GOMA 1B1BA 2P4WA 4XK4A 2L01A 3SFZA 3K70D 1ZGWA 2PN6A 2ZJRF 1ZRDA 2P5KA 1MNMC 1FT9A 2R4GA 2V4JC 3ZR8X 4NC7A 1IXCA 3GFIA 4XLNF 1D8JA 3BT9A 3TMOA 2C6YA 2VXDA 5FD6A 4S05A 2QQ9A 5D6EA 1LEAA 3F9KA 1B6AA 3PM1A 4LD5A 2DCEA 2BYVE 1VI0A 2QVOA 4UV9A 5LHHA 1YJWI 1I3QJ 2Y31A 4RMNA 3U1DA 2WY7Q 2QUFA 1P9QC 4XLPF 3LAPA 2Z16A 1IC8A 5EEGA 3R60A 1OYIA 1P92A 5DCMB 1GDTA 1ONVA 4BXXJ 2FE3A 2GIVA 2W48A 5E8GA 3FMQA 2F4IA 2HOEA 3LSJA 1SFXA 4HSTA 3H9GA 3GTJJ 2IPQX 3CC2I 2DMTA 2E19A 3SJMA 1Z6TA 2A6HF 1J75A 4Y52J 3TW6A 3E5UA 4I98B 5K1YA 3JRAA 2R7WA 4EM1A 3DPTA 2HZTA 4EJOA 4A12A 3HKZN 2PEXA 3CJQB 1EH7A 2VASA 2VONA 5BNGA 4II3A 3F8FA 3G6EI 3OR1C 4WCGA 1X1DA 2P7VB 2RVCA 1PDNC 2X0LA 2F5DA 4ENKA 2JPCA 1Z3XA 2XAQA 5CVUA 2XHKA 1RC9A 1AA7A 1SMYF 2ZNZA 2VKVA 1SD7A 4J19A 4U0VA 5HNHA 3QQAA 1A6IA 2NXNB 2BY3A 4IL6C 1VQNI 3Q3SA 2DJIA 2QBYA 2XF6A 3W2AA 4IQ4A 3I59B 2BXZA 2VQGA 4XLHA 1O3SA 1FMWA 1MDMA 5FLXK 2VQCA 4EEFG 2M1BA 1LDJA 1U9OA 5B1AH 4PJ0C 4R1HA 2QGUA 1AHDP 2ACJA 1U5TA 2DOAA 4FASD 2CW0F 4L5JA 2ADUA 3P5JA 3OYEA 1JTXA 1YYVA 2JJ7A 2LFBA 4YFXF 3H92A 2JWTA 4BQAA 5J1UA 3HM5A 4KIGA 4U0YA 2D2WA 3DEWA 2L7ZA 4P55A 3T8TA 3V8LA 2F5FA 3BROA 3HIFA 3RTRA 2V9PA 3BTIA 5LEKA 5FKLA 1MJ9A 4HZFA 1QVUA 4CZZA 1LE8B 4OIQF 3A01B 1IZ1A 2DXIA 5JLWA 4LB5A 2CG4A 1KZHA 1VQ7I 1YS6A 2VE8A 4OINF 4HNUA 3OYMA 1N25A 3NWSA 4AD9A 1ZHFA 3QRFF 4A3DJ 3H3VK 2K4BA 1HQCA 2FBHA 3O8HA 3K2AA 4EM2A 4YELA 5IP6A 4Q5SF 3CLOA 5E3LA 3IKTA 4P96A 1SC7A 4DW6A 3QPTA 3ZQFA 4XLAA 2CGPA 5KK1A 3OYBA 5C4XJ 1DQUA 3TOAA 6PAXA 1ZELA 2HZDA 4EATA 2KFDA 1K4SA 4MFDA 2BOLA 3BCBA 2XIGA 4UUTA 5CQEA 3ZQ7A 1S72I 1CQTA 1OR7A 2XUBA 5J4VA 2DBBA 5IYCJ 1Z3YA 2RAEA 5EGOB 1RIOH 3L2VA 2ZMEC 1VF9A 2PMUA 4HLYA 4HRIA 2LBFA 1FTZA 1FBUA 3PO2J 1F1ZA 2M4KA 2NNNA 2HPIA 3KPHA 3WTZA 1G2HA 2Y2ZA 1ZR2A 4A3BJ 4W97A 2V7FA 3GTMJ 3IUOA 4IZZA 4YFKF 3J81K 1SFEA 1REPC 3W6KB 1BOBA 2W25A 2VLAA 4CA0A 2LC2A 5M5XJ 1R7JA 2J5PA 1YJ9I 4RBOA 2FEZA 1VZ0A 4NBQA 1YIOA 4UV8A 2R7DA 4B47A 2HVQA 4G6QA 1Z77A 2LOOA 2DFEA 2M0MA 2L2OA 2OCCH 3S2DJ 3D5SC 2PJRA 5GTHC 1ETOA 3HG9A 1WI9A 3N97A 5F27A 3BR5A 3K70C 3E6DA 4H4KC 4YIRX 3DF8A 3KP4A 2DK8A 1TL8A 5GP9A 3CD6I 2IJLA 2LVSA 4KFCA 3WTXC 4HX4A 2N8GA 4ZYGA 4HPQA 3MKLA 5DD4A 1ZREA 1JGGA 1XB4A 3GF2A 4F7ZA 2FNPA 3WTVC 3S8PA 1IUFA 5DS9A 4FISA 1GT0C 3LFKA 4EJWA 5KAIC 3RKWA 3K4CA 5HS7A 2V6EA 4IPAA 2NNYA 1R1UA 3CJNA 2RGVA 3JRDA 2DA5A 4BHBA 3U2RA 3CESA 2DU9A 4BXFA 3JW4A 2EH3A 2ZXHA 4EGYA 1TQPA 1R00A 2LP0A 1SMTA 2L3DA 4N9HA 3KP6A 4RM3A 2M9HA 4HV6A 4M74A 1JTYA 3ASOH 2B0LA 2D1VA 3J80K 1HXDA 2PG4A 4KMFA 2Y9YA 4A3FJ 3IAM2 3CUQC 3FK7A 4RB2C 1FSHA 4BY1J 3CP8A 3OOPA 5LD2C 5K7ZA 3TL4X 4M3DA 2JTVA 3K1PA 5KNLA 5IT9Z 1VQ8I 4X0GA 2QKMB 1T08B 2MG4A 2YUSA 5D6FA 1HKQA 1ETQA 1MGTA 3JAMK 3RIRA 1FOYA 4CHUA 3R6SA 4YG2F 3G73A 3OV8A 1WWXA 4YIIA 4U87A 1JXSA 1B8IA 1Y8QB 2CFXA 3QYFA 2OCEA 4CCMA 3GZ6A 3GTOJ 2KJBA 2VPRA 3IHUA 3O8GA 3U1KA 1T33A 3JRGA 1RUOA 2HS5A 1STZA 1V54H 3B02A 4JQFA 4A3MJ 1BI0A 2L0KA 2Q2EB 4XOPA 2E2IJ 3A2KA 1VNDA 2VQHA 3PNYA 2FF4A 2A07F 2M4GA 2LY2A 3ONQA 2EA2A 4XL9A 3HSEA 1FPQA 4U7DA 1X2NA 2ME6A 1LUJB 3CJRB 1FMVA 2K9SA 2MD0A 3B73A 2QCOA 5JR3A 1W36C 2CQXA 1OYWA 3BP8A 2WWYA 3ECHA 5J8FA 1X1CA 3OL4A 4DYCA 2FQ3A 1T8IA 3HOTA 5LFAA 5FKNA 3V7SA 3CMYA 1FOKA 2KIMA 1W5CC 2K7LA 3F6OA 3HPGA 1J09A 3LQQA 5IYBJ 2DN0A 2HGCA 1XCBA 2QLZA 1XX5A 3FHZA 2W00A 4KA4A 2KPMA 3BG7A 3BR0A 4GYGA 2JRTA 3W2VA 2DFFA 4PFOA 1JKQC 3VFZA 2XSJC 1K78B 1Z1DA 5JVTA 4LMYA 3F8NA 3R61A 3ZN0A 2AQEA 4E7ZA 1JJ6C 2O8XA 1U0JA 4KN4X 5L3EA 3DXJF 2XPUA 3BR2A 3QP5A 1S29A 2CQQA 3ZMUA 2ETHA 1R58A 1JHHA 3BQZA 5ILUA 4L9NA 1TW2A 3PSFA 4BAYA 5M5WJ 3I4MJ 4MLOA 2MBFA 1SEUA 4XLFA 2R7ZJ 1U5TC 2V1NA 4PFPA 4Y3OA 1S7EA 2VIXA 2DPDA 2D45A 1M1EB 2A69F 2PQ8A 5LBQA 4UB8C 2IW5A 3U9GA 3L2CA 2ZBKA 2Q0OA 1HA8A 4L9TA 5IPAA 2R5YB 4ZTJA 1TT0A 2PMHA 3IL2A 5IT9K 1X3WB 1O3TA 1QNTA 2OZUA 2VUMJ 3MKZA 3DU6A 4UUSB 4BE1A 3DTEA 3H5NA 3HGYA 2CJJA 2CRGA 2L7FP 3LSKA 1MD0A 2MW8A 3LA7A 3VDXA 3W6VA 5FFZA 1ON2A 1E0EA 4GGGA 3HTUA 4A0ZA 4OIOF 1NK2P 3KEQA 4Y17A 5E18F 2QSHX 4IXAA 3CCJI 1SD5A 4F52A 3E5XA 2ELKA 3E7LA 4GYIA 1LFBA 3RKQA 2R5ZB 3BG5A 1DPRA 2LKPA 3SYTA 1NK3P 3M07A 2LNBA 2FXAA 1Y39A 1A36A 2O7OA 4NB5A 2WTEA 4AVPA 3HHHA 2JSPA 1TT5B 4O6JA 1QU3A 2OU2A 2HDWA 2LDUA 2VL8A 4XKVA 1W0UA 1H88C 5DCFA 1MKMA 5LHIA 5LLQA 1RNLA 2EJRA 1USSA 1WJDA 4B4CA 4BQOA 5HLTA 2MA3A 1X3ZB 2A5WA 4UNOA 1YLFA 1R9TJ 1G6NA 5E1XA 1SANA 5J4YA 3FKJA 4BU2A 2XSDC 1WRJA 4IHWA 1F36A 2DMQA 3RZOJ 1E3OC 4LGWA 1A5JA 1DU0A 2RNGA 1HSTA 3M1CA 3D5RC 3IV5A 1D0YA 1RI7A 3FXRA 2ECCA 4ESFA 2EV0A 3M4OJ 3ZQQA 1BI1A 1BBYA 2X51A 4S04A 3KP5A 2WV1A 5F0CA 5C3EJ 2NOJB 1R5GA 4AYBA 1HF0A 5E79C 1OISA 3O6BB 2B9SA 3ESWB 3A02A 2COBA 3TP0A 3VSKA 4RGUA 2BW3B 3ZXSA 5DM7F 1JKPC 3JSOA 4DYQA 1ETXA 3AG2H 1QGPA 4M9ZA 2CWEA 2HWVA 2QKLB
chains in the Genus database with same CATH topology
1K6YA 1G59A 1P9QC 2Z16A 2MFZA 3S3NA 3OIPA 3AKZA 2UV1A 2F4IA 3QODA 2IXSA 4BE2A 4HSTA 3H9GA 1G8XA 2LY1A 2WBMA 1JI8A 3PL8A 2M7BA 2Z2SB 1ERDA 1WJBA 4DOZA 1BR4A 3OL3A 4AVZA 2LH9A 4Y33A 1V5GA 4XKWA 1T0FC 1WJFA 2R7WA 3VYSB 2R7RA 3DPTA 1SAUA 5KHDA 5FROA 3CJQB 2BVMA 2VASA 1WJEA 2OC6A 4II3A 3OR1C 4CCOA 1MNDA 1X1DA 4BDZA 4PK4A 1N77A 4CSWA 2R7XA 3HC7A 4ITVA 1Z3XA 3ZRGA 4XORA 1AA7A 1WJCA 4XONA 2M7AA 3OWTA 2VB6A 5HNHA 4YEJA 2E5ZA 2VJ4A 3OY9A 3KYLA 2E1MB 2UWMA 2DJIA 4PUSA 2K9MA 4XLEA 2XF6A 3W2AA 4IQ4A 2K5CA 3OYIA 3VYTB 4LG3A 2VQGA 5HNFA 4XLHA 3LSMA 3NWTA 1FMWA 1D1BA 3S3OA 2VQCA 2E5NA 4LIVA 2VKDA 2WB1A 1QHHD 4U7BA 3VWBA 4C2TA 2UUZA 2LRDA 2DOAA 2MC4A 3A1YA 2FUG2 4FASD 3PUBA 2E1MC 3K4KA 2WADA 3OYDA 1N78A 3S93A 5TGTA 1D0ZA 1X1AA 3OYEA 3K10A 3I9V2 3AL0C 2HVRA 3ZGKA 2Y0SA 2VJ5A 4C30A 3BCAA 3MD2A 3MKWB 4CCLA 2VPLA 4PJJA 5CPRB 3L2WA 3UNGC 3HUGB 4DBRA 4F92B 4BS9A 4IKFA 3RTRA 4F91B 2R7UA 2PMZA 4HEA2 2VQLA 4ZC3A 4XNFA 2WY8Q 3FDYA 4CH7A 2DXIA 2HVSA 2ZXIA 2R7QA 4B48A 3FBNB 5CKTA 1YE9A 2R7SA 2JUGA 4HNUA 3OYMA 4ZYAA 3NWSA 4JOMA 2V26A 2K9LA 1LVKA 4PJLA 4BEHA 1DGWY 3PFYA 2OV7A 3OYJA 2CV0A 1R6RA 4YELA 3V42A 2M3AA 3OYGA 3RPUD 4CCKA 4BQNA 1DGRM 2LYCA 4XLAA 3OYHA 3OYBA 4BACA 1DQUA 1PYVA 4P5OA 3VYRB 1ZELA 2HZDA 4E7SA 1EA3A 5JHFA 4J01A 4EATA 3AFHA 2BOLA 3BCBA 4NNJA 5CQEA 4DBQA 4PSXA 4LITA 2XF5A 1Z3YA 4XLCA 1TZLA 3CMMA 3SEQA 1D1CA 3L2VA 4FETA 2XF7A 4HRIA 2LBFA 4N4NB 4BL0B 4E7IA 1Y6IA 2ELJA 2GOXB 3EUAA 2M4KA 3H5RA 2XC7A 4BJ6C 2HPIA 2Z1DA 3ZCOA 2WA0A 1BR2A 2OUMA 2Q1ZB 2V7FA 3IUOA 1Y56A 4IZZA 4QPOA 1BOBA 3CP2A 1X4PA 2KP6A 2VLAA 4XKBA 3PJRA 4CA0A 2LC2A 3DQVC 2CV2A 2F5VA 2KL4A 1MMAA 3K4BA 4RLFA 3OIQA 3DTKA 3KX2A 1NG6A 1VZ0A 2CV1A 4B47A 3K4LA 2HVQA 2LOOA 2E60A 2VKHA 3DU5A 4XQFA 2M0MA 2L2OA 4Y4RA 2F6CA 3D5SC 3L2UA 2PJRA 2RQQA 2WAFA 3H0DA 3L2RA 5FRMA 3OOUA 4BUPA 3HG9A 3LMMA 4CCNA 2KQRA 3LSIA 3K70C 1YX5A 2KDOA 4H4KC 4KISA 3S3MA 3S32A 2X6YA 4HPQA 3C2HA 1IRXA 5FRNA 5HOOA 2KLOA 3S8PA 3OYLA 3I3LA 3QYBA 1X4OA 3AL0B 3QOEA 2X1DA 3RSNA 3K4CA 4KITB 2V6EA 2BW3A 2HQAA 2CUJA 4AU7A 3CESA 2IS4A 2CUZA 4BXFA 2ZXHA 4B3XA 1WFXA 2JVHA 4ZTFA 4G6TB 3HKZA 4ZDLA 3J7AY 2X6XA 2K3PA 4ZDPA 3OYFA 2AQFA 4RM3A 5CQGA 4NUBA 2XDVA 4KT6A 1UG0A 2JVGA 2L9SA 3IAM2 3OMYA 1W36D 3CP8A 5LD2C 2HU9A 3TL4X 2KMUA 3H9QA 5KNLA 1MMNA 4X0GA 3DPUA 4F55A 4BE0A 2MYSA 2QKMB 3SEZA 1D0XA 4D1QA 4HNTA 2O5RA 1LFPA 4IX7A 1NG7A 3FHNA 2KRHA 3MMYB 3PNVA 3DKXA 3DPLC 4OWRB 4U87A 3W3CA 1D1AA 3IAS2 3QYFA 3H9JA 3PNTA 4CCMA 3A4CA 2R7TA 4N4OB 2V9KA 3OYCA 1OR7C 4KJZA 4RM2A 4XM3A 4C9YA 4BQQA 4GRIA 4JQFA 2Q2EB 3A2KA 4XOPA 3HXLA 2VQHA 1V5EA 3PNYA 2DT7B 1DP3A 2M4GA 3RQ4A 2LY2A 3ONQA 3U21A 4XL9A 3DKYA 4XR6A 4RLQA 3VSLA 1YX3A 4E7LA 2PJRB 2X85A 3CZ6A 2P0WA 3CJRB 1FMVA 1SFKA 2JA2A 2MD0A 2CFOA 5HVQC 2X1EA 3FBIB 3CF2A 4ZDOA 4CZCA 2DT6A 4E7JA 1W36C 1MNEA 3HL2A 1X1CA 3OL4A 1MMDA 2XAUA 3KEYA 3G2BA 2IGNA 3E0JB 3HOTA 1T95A 3LFUA 5LFAA 1X19A 3BG6A 2ZSIB 2VXZA 3HPGA 4QPQA 3EUKL 1X1BA 3N05A 3HPHA 1WJAA 1J09A 4XKCA 3RCOA 2IGKA 4DJAA 2W00A 5KCMA 3H35A 2KPMA 3BG7A 3BLYA 3W2VA 4PFOA 4XN0A 4B43A 4E6KG 2XSJC 4XN3A 3L2QA 3PSIA 4P1WA 4CUGA 2I8DA 2KHMA 2AQEA 4E7ZA 1PJRA 4PJNA 1U0JA 2L9NA 4YRVA 1QHGA 2WAQA 3OS2A 4R79A 3DEEA 4BJTA 4ANJA 3D5LA 3IP4B 4F3QA 4NQWB 3PSFA 2ZFUA 4BDYA 2A6TA 4B44A 2R7OA 2ZSHB 2RREA 4MLOA 3MKYB 1N75A 4IQJA 4XLFA 4Y3OA 2V1NA 4PFPA 4C2UA 2VIXA 3H5AA 4OAZA 4BGDA 1LKXA 2L7KA 3DLAA 3DTIA 3VYUB 2HNHA 4XMYA 1HA8A 2IGOA 2VJJA 4BJ5C 4E4HA 1TT0A 4ZTJA 4PJMA 4BEHB 3MKZA 2R7VA 3DU6A 3K4MA 1OLTA 2IGMA 2LREA 3DTEA 4II2A 4BE1A 3H5NA 4E7KA 1BR1A 3UR3C 3GBGA 3LSKA 2KRCA 3E1SA 3VDXA 2X6WA 1E0EA 4HG2A 4NC8A 4DIQA 2CW8A 3LL7A 1LDKB 4ZJZA 2CMPA 4F52A 4HSRA 3TBIA 2KZVA 2W82A 1MMGA 3OYKA 4XOTA 2BVLA 3K4NA 2IS6A 2CH0A 3LSGA 3SYTA 2LBFB 2MABA 1Z21A 1GLNA 2X1CA 2JSPA 1WJ5A 2CW7A 3BC8A 4F93B 4E7HA 1QU3A 2HDWA 4XKVA 2VL8A 3EUHC 3LSHA 3W2WA 4CCJA 4LIUA 3C2GA 1WJDA 3DWLE 4BQOA 5HLTA 2LG4A 2A5WA 3M8JA 3K4JA 3QYEA 3FKJA 4BU2A 2W7NA 1S9HA 2W1OA 3EPZA 2W4SA 3OR2C 3OYNA 3SDBA 3HOSA 3K6GA 1Z7LA 1UELB 1MW7A 1V5FA 4OAYA 2WAEA 2VJIA 4PSWA 2RNGA 2HPMA 3OS0A 1UAAA 2GOMA 3M1CA 3D5RC 3K70D 1D0YA 4DGWB 1KONA 3ZQQA 2R4GA 2V4JC 3ZR8X 4NC7A 2X51A 3OS1A 2CS3A 3TMOA 2L5QA 2NOJB 2VXDA 4AYBA 2IS2A 2IS1A 3SZGA 3F9KA 2DCEA 3VSKA 2BW3B 3ZXSA 4J00A 4D9JA 3OYAA 4RMNA 2WY7Q 2QKLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A Y;  2V7F A; 
#chains in the Genus database with same CATH topology
 1E2X A;  1K6Y A;  4FQG A;  3SDG A;  2EQR A;  1LDD A;  3WTW C;  1PUF B;  2MGQ A;  1RR8 C;  2NOG A;  2DQR A;  1GXP A;  1ETK A;  2UV1 A;  3BY6 A;  1D5V A;  2Y30 A;  3RZD J;  3P9K A;  1G8X A;  2HOA A;  2WBM A;  4XBF A;  5FJ8 J;  3S16 J;  1WJB A;  3IH3 A;  2COM A;  1V5G A;  3RPQ A;  1IW7 F;  3F8M A;  3I54 A;  3L00 A;  2LKS A;  1T0F C;  2Y48 A;  3KEO A;  4MNU A;  4CXF A;  1WJF A;  1HW2 A;  2VBW A;  2CSO A;  4V2F A;  2K02 A;  4A5N A;  2ZCW A;  2R93 J;  3L7W A;  5KHD A;  1XSV A;  4RAY A;  2DTR A;  2V79 A;  1ZQ3 P;  1SVL A;  1MND A;  1I6H J;  2JMW A;  4PK4 A;  2JZY A;  3NRV A;  3HC7 A;  2YSR A;  4ITV A;  4XOR A;  1MJB A;  2XAH A;  1F9N A;  4CDG A;  3OWT A;  1JE8 A;  4QTR A;  1O4X A;  4BXU A;  4BY7 J;  1J2X A;  2VBY A;  2VJ4 A;  3OY9 A;  1QQI A;  2HFH A;  3KYL A;  2UWM A;  3D0S A;  2ZJP F;  5TRD A;  2XVC A;  2K9M A;  1BN5 A;  3KFW X;  4XLE A;  2OQR A;  3I4N J;  2QQA A;  3VYT B;  4LG3 A;  1TWG J;  1UJ8 A;  3QPS A;  5IP9 J;  3S3O A;  1D1B A;  2ICW G;  1T56 A;  3FX3 A;  2E5N A;  2HOS A;  4IRI A;  3O3K A;  4RGX A;  3GTL J;  1QHH D;  2KIQ A;  1KA8 A;  3I64 A;  2QSF X;  4Y7N J;  4HX7 A;  4LOC A;  4U7B A;  3ZMS A;  3G71 I;  3VWB A;  2NVT J;  1Q1H A;  2MC4 A;  3A1Y A;  5EDN A;  2GXB A;  2EA4 A;  2E1M C;  3K4K A;  1IGN A;  1N78 A;  1BW5 A;  5TGT A;  2KJC A;  1SD6 A;  1YW9 A;  3FXM A;  1X1A A;  1P7J A;  3K10 A;  1D5Y A;  2HVR A;  1UZC A;  2Y0S A;  4C30 A;  1H9G A;  3MD2 A;  3FM3 A;  1SAX A;  2ESH A;  3WTY C;  4NQW A;  2VPL A;  4PJJ A;  5CPR B;  3K2Z A;  2H27 A;  3UNG C;  1Z9C A;  2GA1 A;  3KZZ A;  1MH3 A;  4M3B A;  1ZKG A;  2F2E A;  4MQ9 F;  1R23 A;  5GPA A;  4BS9 A;  1L0O C;  2I5U A;  1R36 A;  3S1R J;  2H94 A;  3ABT A;  5FGM A;  1PP7 U;  1FBS A;  3BWG A;  1IJW C;  1DPU A;  2VQL A;  4D5F A;  1KQ9 A;  1S6L A;  4XNF A;  4CH7 A;  2HVS A;  3CUQ A;  3GTG J;  3RQI A;  4B48 A;  1BOA A;  4ZYH A;  2R7S A;  1J9I A;  2FMY A;  4HW0 A;  1Y1W J;  2VE9 A;  5GAH J;  2FD5 A;  2V26 A;  2A05 A;  3BTL A;  3GLX A;  4BEH A;  5M3F J;  2OV7 A;  1R49 A;  3HDD A;  1ZLK A;  1XMA A;  3V42 A;  2FNA A;  3OYG A;  2XB0 X;  3S15 J;  4CCK A;  5D5X B;  2E7X A;  3OYH A;  2NS8 A;  4P5O A;  2RNJ A;  3KIO A;  3A0H C;  4J01 A;  4ZH4 F;  5B3S H;  3KLO A;  1BM9 A;  4MQV A;  2VOO A;  1TZL A;  3CMM A;  3SEQ A;  3MZ8 A;  1X3U A;  4IRG A;  4GO1 A;  4HDV A;  3F21 A;  4BL0 B;  4E7I A;  2MH2 A;  3EUA A;  2DA3 A;  4DZJ A;  2IEK A;  3E97 A;  4V2G A;  3AG1 H;  4YFN F;  5EF6 A;  4MEY F;  1MBH A;  4QPO A;  1F5T A;  1X4P A;  2M2E A;  2E7W A;  2HXO A;  2F5V A;  2KL4 A;  4EVI A;  1WH7 A;  2Y9Z A;  3OIQ A;  3DTK A;  3KX2 A;  1VQ5 I;  2CV1 A;  2JK3 A;  5BOX A;  1MDM B;  3K4L A;  3PUF A;  2JPB A;  1TWF J;  1UCR A;  4XID A;  4Y4R A;  2NVY J;  5AIQ A;  4A93 J;  3FXL A;  2F6C A;  5CLS A;  2HKO A;  3ZMV A;  1DP7 P;  1IRZ A;  5J47 A;  4HF1 A;  5FRM A;  2YU3 A;  4BUP A;  2Z99 A;  3GVA A;  3LSI A;  2M0C A;  2K86 A;  1YX5 A;  4U88 A;  4KIS A;  3BR3 A;  1QPI A;  3S32 A;  4M72 A;  1IN8 A;  1W0T A;  1ENH A;  4RAF A;  1V3F A;  1YW7 A;  3HYI A;  5H6Q A;  3IWF A;  3GFL A;  1MZB A;  3J7Y J;  1LNW A;  1WVR A;  3GFM A;  2K40 A;  1RKW A;  1G4D A;  2V9V A;  3E6M A;  2DA1 A;  4HOB A;  4D5C A;  5HS8 A;  3QYB A;  3OYL A;  4IHT A;  1X4O A;  2BY1 A;  3AL0 B;  2AXT C;  3RSN A;  2Y75 A;  1MBG A;  4X1E A;  2STT A;  5BS6 A;  3S1Q J;  3QU6 A;  2F5E A;  2HI3 A;  2DA4 A;  1ZLJ A;  3LA2 A;  3V8K A;  3TQN A;  2IS4 A;  2CUZ A;  5DCM A;  2BY2 A;  2JVH A;  4G6T B;  1SVM A;  2FQ4 A;  3G1O A;  3RYP A;  2PBI A;  2J5O A;  1P6R A;  2K3P A;  2AQF A;  1TW3 A;  2MSY A;  2G7U A;  2ZXJ A;  4ZDP A;  1O7L A;  3EQL F;  4NUB A;  3CF5 F;  1YIT I;  2ISY A;  2GXG A;  4LLN A;  3OMY A;  3QWL A;  1W36 D;  1KGS A;  3Q0W A;  4RB0 A;  2CUF A;  1H0M A;  1YW8 A;  5E17 F;  1MMN A;  2KZG A;  4F55 A;  1D0X A;  4D1Q A;  4HNT A;  3JRI A;  3HOW J;  1Q1V A;  1YRN B;  1PP8 F;  1RET A;  3K0L A;  3PQK A;  1X1P A;  1NG7 A;  1X2M A;  3FHN A;  4AIJ A;  5M3M J;  4I2O A;  2KT0 A;  4OWR B;  1IO2 A;  3M3Y J;  3FMS A;  4AYB N;  3A4C A;  2QQ8 A;  2R7T A;  4N4O B;  2DW4 A;  5FFX A;  2V9K A;  3OYC A;  5DUI A;  3GUD A;  2EB7 A;  1Y0U A;  2OQG A;  1GV5 A;  4C9Y A;  3I59 A;  4CYC B;  5CYV A;  4GRI A;  4BQQ A;  2GWR A;  2E36 A;  2FSW A;  3COA C;  2F5C A;  3P7N A;  5LGN A;  3LQR A;  3RQ4 A;  5EEA A;  3U21 A;  4UB6 C;  2VC0 A;  4RLQ A;  4E7L A;  5E1W A;  4W1U A;  2PJR B;  3CZ6 A;  4AIH A;  3GLL A;  4G7O F;  1VQK I;  1SFK A;  1E3H A;  2KDZ A;  5HVQ C;  1XDU A;  4ZDO A;  5LEJ A;  3B6A A;  4GCV A;  1FOX A;  3Q0U A;  4MEX F;  3FWE A;  4M9X A;  3KEY A;  1XGO A;  2IGN A;  3WTS C;  4ESJ A;  1JUM A;  3TW7 A;  4RDU A;  1T2K A;  1IN7 A;  5E20 A;  4Z6Y A;  3KET A;  4LK0 F;  3N4M A;  1X1B A;  5HDK A;  4I6Z A;  1WJA A;  1V55 H;  2DA6 A;  2E1C A;  2LMD A;  3FXJ A;  2P8T A;  2IGK A;  1LE8 A;  5ERI A;  3H35 A;  3BLY A;  4A3K J;  4A3E J;  2V6C A;  1Z0X A;  4XN3 A;  4BYY A;  1K7A A;  2BV6 A;  1KYW A;  1FP1 D;  2HTS A;  4PJN A;  5CJ9 A;  1R1V A;  1FSE A;  5EYR A;  4M6Y A;  5H20 A;  4G7H F;  5L3D A;  3LNQ A;  2CQN A;  2WAQ A;  3CCS I;  2DFI A;  3GTP J;  3EDP A;  3E3V A;  4GDF A;  3DEE A;  3S1N J;  4BJT A;  2ZJQ F;  3C1D A;  4ANJ A;  4N9I A;  1B9M A;  3IP4 B;  2L7M P;  2ZFU A;  1AU7 A;  3BZ6 A;  2XKP A;  1BIB A;  2R7O A;  2RRE A;  2ZSH B;  4M3G A;  5DD8 A;  4B44 A;  5BQT A;  3MKY B;  4BNC A;  1F43 A;  3M1E A;  4EJU A;  4JX6 A;  3JRE A;  4OMZ A;  2EFO A;  3WU2 C;  2GLO A;  3H5A A;  4A69 C;  5EGO A;  2V1D A;  3HJE A;  1OCP A;  1L3L A;  2GXA A;  5CVI A;  2K85 A;  2L7K A;  4RAZ A;  2XRO A;  3KE2 A;  1T0F A;  4RGR A;  2Q8K A;  4ZYD A;  2VT3 A;  2QEN A;  2EZK A;  3HRU A;  4XMY A;  1YFH A;  3K7A J;  4GFB A;  4Z2Y A;  3I55 I;  2DJN A;  2RN7 A;  1IXS B;  3F8B A;  1YG2 A;  1U8B A;  3F0C A;  4C3J J;  2R7V A;  1SVO A;  1OLT A;  2BZT A;  2IGM A;  1FZP B;  3GTQ J;  3CJT B;  1D8K A;  4RB3 C;  1BR1 A;  4PCQ A;  5ICG A;  1XPX A;  2LF7 A;  5E3N A;  2XAG A;  2KRC A;  3E1S A;  3DBH B;  3MQ0 A;  4HLX A;  1BL0 A;  4HG2 A;  3JRH A;  4DIQ A;  3GZ5 A;  4UVB A;  1R4N B;  2CW8 A;  3LWF A;  2KZV A;  5JFR A;  4A3G J;  2QWW A;  1MMG A;  3EET A;  4XOT A;  3M8E A;  4KIC A;  3K4N A;  2ZB9 A;  3ABK H;  2CH0 A;  3LSG A;  3CC4 I;  3BJ6 A;  5F6F A;  1Z21 A;  1ON1 A;  1IDZ A;  2AHQ A;  5E3M A;  2CU7 A;  3JRB A;  1I3A A;  2LTP A;  1HW1 A;  3BC8 A;  3WOD F;  1MMS A;  1ZGA A;  3OSG A;  1TLH B;  1WGX A;  2JUC A;  5HDG A;  4BKX A;  3C2B A;  2GZW A;  4LIU A;  3I53 A;  3C2G A;  2NVU B;  3IH2 A;  1OQY A;  1XN7 A;  5GAD J;  4IHV A;  1RKT A;  4DNC A;  3QYE A;  2W7N A;  4MHG A;  3BZC A;  1FX7 A;  1WZ2 A;  5HDN A;  1BI2 A;  2ZNY A;  2W4S A;  4JK1 X;  3OYN A;  2FU4 A;  3HOS A;  4B3A A;  2WAE A;  3LOC A;  2OD5 A;  3V4G A;  4UUV A;  3TO9 A;  2VOD A;  1FTT A;  1MJA A;  4HF2 A;  5LHG A;  2E1N A;  1KU2 A;  1R5I D;  1E17 A;  2BY0 A;  3KP7 A;  4DGW B;  5IOY A;  5ICC A;  1IV6 A;  4IHX A;  2HOT A;  3WG7 H;  3HOY J;  2HYG D;  4L9J A;  2RQP A;  4BHC A;  2M87 A;  3Q5F A;  3TP3 A;  3OS1 A;  2W85 A;  2CS3 A;  2XAS A;  3HZJ A;  3QP6 A;  2G9W A;  4X6A J;  3HUG A;  2L5Q A;  3DLL F;  1WKM A;  3WE2 A;  2EK5 A;  3W6J B;  4D7M A;  3NAR A;  2BBY A;  4K2E A;  1A04 A;  1LEB A;  3CTA A;  2XPV A;  1T39 A;  2A3S A;  3CCL I;  4BBR J;  2OJE D;  5D5V B;  4J00 A;  2O61 A;  4D9J A;  3MZH A;  1BI3 A;  1HC8 A;  2AS5 F;  1UFM A;  2HYF A;  1LFP A;  1XMK A;  1G59 A;  2CO5 A;  2MFZ A;  3TKY A;  4Y13 A;  3ERM A;  3OIP A;  1S3J A;  2XGD A;  3S3N A;  2FX0 A;  5FKK A;  2EWN A;  2IXS A;  1BA5 A;  2HQN A;  1ZK8 A;  4L0Y B;  5J1Y A;  3CCE I;  3FIS A;  3PL8 A;  2Z2S B;  1ERD A;  5F1J A;  2FOW A;  4Y33 A;  2Q2E A;  2LSO A;  4XKW A;  3BG3 A;  3DEU A;  3MN2 A;  3Q0V A;  3VYS B;  2R7R A;  5BMZ A;  1I27 A;  4ZYE A;  1TP4 A;  3B6C A;  1KQ0 A;  4ABZ A;  5FRO A;  4OU0 A;  1WJE A;  3BJA A;  2OC6 A;  3KCC A;  3JTH A;  1EKE A;  1EF4 A;  4BDZ A;  4CSW A;  1JUS A;  4G6D A;  2HEO A;  5BPI A;  1RES A;  3TDU C;  5L3B A;  1A35 A;  4M3E A;  4XON A;  2M7A A;  3K1M A;  3GME A;  4HF0 A;  1GVJ A;  4A3I J;  4OIR F;  2RDP A;  5EG0 B;  2NS7 A;  1QPM A;  3RPU A;  2F4M B;  3L09 A;  5FKO A;  3F23 A;  2K5C A;  3O2P E;  3RI4 A;  2XKO A;  1FLI A;  1YI2 I;  3NWT A;  2ECB A;  1FY7 A;  5J40 A;  2WB1 A;  1K78 A;  1Z05 A;  2EFW A;  5DM6 F;  2JA6 J;  4IEJ A;  2TRT A;  4Y15 A;  2FUG 2;  1DU6 A;  3S93 A;  1FP2 A;  4AUX A;  1DUX C;  4LG0 B;  3MVP A;  4DZP A;  3I9V 2;  3AL0 C;  3NAU A;  4XRM A;  1QZE A;  2DI3 A;  2VJ5 A;  3T1B A;  2P5V A;  3BCA A;  3IH4 A;  4AC0 A;  3GWZ A;  2JT1 A;  4B8X A;  4XRF A;  3MFK A;  4IOC F;  4CCL A;  1KU7 A;  2EFN A;  1WCM J;  3L2W A;  1IF1 A;  3SHF A;  1O57 A;  3K1N A;  3E5Q A;  2EZI A;  4M6V A;  3A03 A;  1ETY A;  4F92 B;  4ZZD A;  4IKF A;  4UXN A;  5K7H A;  2P81 A;  4O5V A;  2R7U A;  4HEA 2;  2QF7 A;  2DT5 A;  4ZC3 A;  2WY8 Q;  3FDY A;  1KYZ A;  4KDP A;  2ZXI A;  2R7Q A;  2HKX A;  3HRM A;  5CKT A;  1WI3 A;  2EBI A;  4P9U A;  4FX0 A;  1B72 A;  3WHB A;  5J6X A;  1EH8 A;  1PUE E;  3KP3 A;  3TOB A;  4JOM A;  1OCC H;  3GYH X;  1G3Y A;  1NH3 A;  1RUN A;  3REO A;  3PFY A;  4KIB A;  2ZME B;  2DOD A;  4UUS A;  1KU9 A;  2M3A A;  3RPU D;  4B1R A;  2TCT A;  5KAF C;  3F22 A;  1A31 A;  2LYC A;  3K69 A;  3ISP A;  1HOM A;  1W7P A;  1YO5 C;  3VYR B;  2DPU A;  5F1R A;  4A0X A;  1IRF A;  1EA3 A;  4DBQ A;  4NNJ A;  1ZN2 A;  5HLI A;  1WPK A;  4LIT A;  4HNV A;  2AXL A;  2XF5 A;  4PGG A;  4XLC A;  2RC4 A;  1ZRC A;  3GEZ A;  4FCY A;  2XF7 A;  5GPC A;  2EIK H;  2EIJ H;  4N4N B;  2XC7 A;  1VQ9 I;  4BJ6 C;  2Z1D A;  2ID3 A;  4AIK A;  1HDP A;  1W5S A;  1Y56 A;  5EJC A;  1G3T A;  2Z3Y A;  4C3H J;  2PX9 A;  3S2W A;  3CP2 A;  3WHC A;  2DYR H;  2NVX J;  2EZH A;  4MFE A;  2CV2 A;  1FOW A;  1MMA A;  5E3O A;  1OKR A;  3IC7 A;  2M8E A;  5L3C A;  2JA8 J;  4A3L J;  3GXO A;  4JX5 A;  5A2Q Z;  5F08 A;  3EYI A;  1XSD A;  1XGN A;  1UG2 A;  2E60 A;  2VKH A;  3DU5 A;  1RZ4 A;  4XQF A;  4ETS A;  1UB9 A;  3T8R A;  4KNY A;  2M8G X;  4EV0 A;  1ETW A;  3R4K A;  3H0D A;  2LLK A;  5C44 J;  2MLK A;  3L2R A;  3OOU A;  4OIP F;  1HKT A;  4CCN A;  1YS7 A;  2KQR A;  4JX4 A;  4PGH A;  4HV5 A;  3S1M J;  3CDL A;  3S3M A;  1FIA A;  1E3P A;  2W57 A;  2XRL A;  2JN6 A;  3WGH A;  1W7P D;  4YIF A;  4XSZ F;  4HBL A;  5CVV A;  2VT2 A;  2V1U A;  3ABL H;  1IRX A;  1G3S A;  5FRN A;  3MCZ A;  1IG7 A;  2PJP A;  2KLO A;  3I3L A;  5HLH A;  1U8R A;  5FB2 A;  2X1D A;  2GA2 A;  2YPR A;  2H09 A;  3M7G A;  1CF7 A;  3FZV A;  4I01 A;  3ZMD A;  4KIT B;  1O3R A;  2BW3 A;  4CO8 A;  5D5W B;  3AAF A;  4HQE A;  2HQA A;  1I6X A;  4WXC A;  2EIL H;  5J1R A;  2AO9 A;  3PQJ A;  2O0Y A;  4ZTF A;  1PUF A;  1VQL I;  1NTC A;  4ZDL A;  2X6X A;  2Z5U A;  3DFG A;  1TBX A;  5DTD A;  2CQK A;  1JT0 A;  5CQG A;  5F0H A;  1O3Q A;  1Y8R B;  4D0P A;  2ID6 A;  1T98 A;  3H3U A;  4KT6 A;  3FK6 A;  2JVG A;  4I99 C;  1P4W A;  2P6S A;  3BDD A;  1VQP I;  5DV5 A;  2KMU A;  3H9Q A;  1J7K A;  2H1K A;  2I10 A;  4M9S A;  4BE0 A;  2MYS A;  3SEZ A;  2LK2 A;  2ZC2 A;  1J5Y A;  3I56 I;  2BEO A;  1H8A C;  2HR3 A;  2HDC A;  1K61 A;  2H1L A;  3H0G J;  2P5L C;  4IX7 A;  4MGR A;  1VFC A;  1POG A;  5IY5 H;  2IVM A;  2KRH A;  5CVJ A;  5E1Z B;  3PNV A;  3DPL C;  5FLX Z;  1ZAR A;  4FX4 A;  3HOZ J;  5L3F A;  1D1A A;  5B66 C;  1F4K A;  5K5O A;  3PNT A;  1BC7 C;  2DAO A;  3FMR A;  3JR9 A;  5JHU A;  1AKH A;  1D3Y A;  1MBJ A;  3Q9S A;  5BPD A;  1LJ9 A;  3BR6 A;  3HSR A;  2DA7 A;  4BH9 A;  2H8R A;  4L5I A;  3HXL A;  2XGE A;  1UST A;  5ED4 A;  3ERE D;  4XIC A;  4EMS A;  4XR6 A;  3H1C A;  4CYD A;  5D4S A;  1YX3 A;  3PO3 J;  2X85 A;  3BG9 A;  2P0W A;  1Y1V J;  3RJP A;  2CFO A;  1IN6 A;  2R3S A;  5L3G A;  3CLQ A;  2X1E A;  1U78 A;  2P7C B;  1FJL A;  3E6B A;  2DT6 A;  5JLX A;  2DQL A;  1ETV A;  1ORK A;  1U9N A;  5TIS C;  4E7J A;  1YHQ I;  1LB2 A;  2WV0 A;  1HKS A;  4ON0 A;  2OBP A;  3HL2 A;  5GAG J;  2VBX A;  5A2Q K;  1MMD A;  4HX8 A;  3G2B A;  1YQA A;  5LGT A;  1NHA A;  3E0J B;  1T95 A;  2X9D A;  3PIP F;  1VQO I;  1X19 A;  3BG6 A;  3BJO A;  1X58 A;  2ZSI B;  1XDS A;  5H6R A;  2QBY B;  2VXZ A;  3HRT A;  4QPQ A;  3EUK L;  3WTU C;  4OMY A;  3N05 A;  3HPH A;  4XKC A;  3HEF A;  3M8F A;  1MSF C;  2K9N A;  1R4M B;  4DJA A;  1OJL A;  5KCM A;  2HYJ A;  4L9V A;  1Z67 A;  4XN0 A;  4B43 A;  2LKX A;  3KLN A;  3L2Q A;  3PSI A;  4P1W A;  3ULQ B;  3V7C A;  2KHM A;  3A0B C;  1U5T B;  5DUK A;  3TGN A;  3FKI J;  1BC8 C;  1TC3 C;  5M5Y J;  4R8H A;  2QEX I;  3CCV I;  1PJR A;  1ZG3 A;  2ZO4 A;  3KYC B;  3CMA I;  4IVN A;  3CCR I;  3H36 A;  1QHG A;  3OS2 A;  2VKE A;  3ZQG A;  1YIJ I;  2GAU A;  3T5X A;  1CGP A;  2WB1 N;  3D5L A;  2K3F A;  1FBQ A;  4F3Q A;  4BDY A;  3JCU C;  2Z9O A;  2XGC A;  1IXR C;  1N75 A;  4IQJ A;  2VOP A;  3J81 Z;  3G1L A;  2YU9 J;  4M3F A;  1P7I A;  4C2U A;  4FE7 A;  1XTA A;  3BQY A;  3I71 A;  4OAZ A;  2GIZ A;  3TO6 A;  5JI6 A;  3ZQC A;  2UXX A;  5FLV A;  1QBJ A;  5D5U B;  3DLA A;  1LVA A;  3DTI A;  2Y0M A;  3VYU B;  2L54 A;  1ZH5 A;  5EEH A;  5J8C A;  4G8X A;  4WK8 F;  2IGO A;  1JKR C;  3VB2 A;  1HDD C;  2XB5 A;  4EQQ A;  2LRE A;  1HLV A;  4MTD A;  2G7H A;  3QPH A;  3PFI A;  1BIA A;  2QYO A;  3HGG A;  3J7Z I;  3FM5 A;  2X6W A;  2QM3 A;  3C18 A;  4JYK A;  4NC8 A;  4UHT A;  4EM0 B;  5GAE J;  5ILS A;  1RPW A;  1LDK B;  4LJZ F;  4M71 A;  2DDA A;  2FOK A;  2KRF A;  1ITY A;  4MIM A;  2W82 A;  3OYK A;  2R92 J;  2BVL A;  1K79 A;  5J3L A;  3BZK A;  3SQN A;  3BTJ A;  2LBF B;  2MAB A;  1I39 A;  3JTG A;  2XAF A;  4HDU A;  1TTY A;  3F3X A;  3QAH A;  4Q47 A;  5K7F A;  1YOV B;  4LK1 F;  1GVD A;  4I02 A;  1GUU A;  3WGG A;  2OTL I;  4FT8 A;  3IRQ A;  4F93 B;  2M45 A;  2YX7 A;  2OZ6 A;  3EUH C;  4ENN A;  4CCJ A;  1BJZ A;  2DOE A;  1SD4 A;  1WH5 A;  1TQM A;  3M8J A;  2MD5 A;  3J80 Z;  4RB1 A;  3ECO A;  1TNS A;  4LLL A;  3CDH A;  1S9H A;  3SFI A;  3OR2 C;  3WG9 A;  2H6B A;  3SDB A;  1TWC J;  1Z7L A;  1S5L C;  1MW7 A;  1V5F A;  4IO9 F;  3G3Z A;  4CGZ A;  2QA4 I;  5ICE A;  3I4P A;  2RV8 A;  3ZPL A;  1C0W A;  2VN2 A;  2DFH A;  2VBZ A;  5KVR A;  4EJV A;  5K5R A;  3OS0 A;  1ZG5 A;  1UAA A;  1QZY A;  2CQ7 A;  2MC3 A;  3JAM Z;  2XRN A;  4HAM A;  1VQ4 I;  4A2U A;  1KON A;  3MEX A;  3HOX J;  2L4M A;  2NYX A;  1ZG1 A;  2Y69 H;  2F4O B;  1OCT C;  2BGC A;  4A6E A;  2EPF A;  2IS2 A;  3BPV A;  3SZG A;  3D1N I;  2X4H A;  2ZJ2 A;  2D5V A;  2IS1 A;  2IBD A;  5K5Q A;  1VQM I;  2HDD A;  4HA8 A;  1YRN A;  3A01 A;  2EIN H;  4NC6 A;  4A3C J;  1I1G A;  2XGX A;  2ZKZ A;  1K6O A;  1GV2 A;  4WX9 A;  5FKM A;  4JBA A;  2A61 A;  3OYA A;  1TQI A;  3I58 A;  2KIF A;  1JGS A;  3L9F A;  5EZH A;  3LAJ A;  1OCZ H;  2O3F A;  3AKZ A;  4WXH A;  1UHS A;  4IJA A;  3ABU A;  4XRS G;  3CCY A;  1MBK A;  3QOD A;  3KYD B;  4I0B A;  4BE2 A;  1V4R A;  3E6C C;  1UHM A;  1W5T A;  2LY1 A;  1JJ8 C;  2V1X A;  1G3W A;  4CYC A;  1JI8 A;  2M7B A;  4A0Y A;  4DOZ A;  1BR4 A;  2B7E A;  3OL3 A;  5FD5 A;  2LH9 A;  3ROU A;  4AVZ A;  2EFP A;  1FEX A;  2FJ1 A;  1SAU A;  5H2F C;  4IHY A;  1VQ6 I;  1AOY A;  1OMI A;  2BVM A;  4M73 A;  1XSX A;  2E71 A;  3T0Y A;  2VI6 A;  2NS0 A;  2O8K A;  4A3J J;  1I5Z A;  2Y0S N;  4KYW A;  4CCO A;  3CO6 C;  1P4A A;  3RKY A;  1T6S A;  2RKH A;  4E70 A;  2DA2 A;  1N77 A;  3FXK A;  2R7X A;  3JRF A;  2ESN A;  4PDK A;  1LPQ A;  2O6G E;  3ZRG A;  1WJC A;  1UMQ A;  3FIW A;  2YX4 A;  2VB6 A;  1XCV A;  4YEJ A;  2E5Z A;  3ZQH A;  5EZG A;  4O3M A;  5F64 A;  2E1M B;  4L5E A;  3HOV J;  2HXI A;  3BPX A;  4PUS A;  4L18 B;  1B9N A;  3CCQ I;  3OYI A;  5HNF A;  3HSF A;  4AM3 A;  5CVR A;  3LSM A;  5D8K B;  4KUM A;  4XSX F;  3AG3 H;  3QOP A;  4LIV A;  2VKD A;  1XS9 A;  1KQ8 A;  3QPL A;  4C2T A;  2JA5 J;  2UUZ A;  2LRD A;  3M9A A;  2GQQ A;  3KZI C;  2KIU A;  3PUB A;  2WAD A;  3OYD A;  1FNN A;  2YR2 A;  2BHY A;  3JRC A;  3KZY A;  1D0Z A;  4JP0 A;  4B09 A;  4HYE A;  4IF4 A;  3ZGK A;  2LY9 A;  3LSR A;  9ANT A;  3KP2 A;  1ZGJ A;  3WU0 A;  3MKW B;  1YJN I;  2STW A;  2Z33 A;  1ZRF A;  5HS9 A;  3HUG B;  3GFJ A;  2ELH A;  4DBR A;  2D1H A;  1IN5 A;  4F91 B;  2PMZ A;  3LA3 A;  2YS9 A;  2FML A;  3SZP A;  2QZ8 A;  1A6Q A;  1KU3 A;  3R0J A;  2FA5 A;  2M34 A;  4MO7 A;  4BHP A;  3FBN B;  5ICF A;  1WHU A;  1YE9 A;  2TDX A;  1S7A A;  3C7J A;  2JUG A;  3TDZ C;  4ZYA A;  3AG4 H;  5AON A;  2JA7 J;  2K9L A;  1LVK A;  4PJL A;  1DGW Y;  2CV0 A;  3OYJ A;  1R6R A;  5GTI C;  4BQN A;  1DGR M;  3G1M A;  3CQZ J;  2EIM H;  3CME I;  1QVT A;  3FF5 A;  1S7O A;  3TED A;  2K27 A;  2MH9 A;  4BAC A;  1QA6 A;  1PYV A;  3CCM I;  1HBX G;  4E7S A;  5JHF A;  4FHT A;  4WF2 A;  3VEP A;  3AFH A;  2E35 A;  4PSX A;  3BTC A;  2DOF A;  3BOQ A;  2LR8 A;  1D1C A;  3G4S I;  2F48 A;  2P6T A;  4FET A;  3TO7 A;  4AWX B;  4GXO A;  1W1W E;  1Y6I A;  1YTY A;  2ELJ A;  3IKV A;  2GOX B;  3H5R A;  3HRS A;  5B1B H;  2FBK A;  3ZCO A;  1LQ1 A;  2WA0 A;  3ABM H;  1BR2 A;  2OUM A;  2PLY A;  1OFC X;  2NAZ A;  2Q1Z B;  3EYY A;  4A6D A;  2OAZ A;  5LRS A;  4EGZ A;  1J59 A;  2KP6 A;  3PJR A;  4XKB A;  4OOI A;  3DQV C;  4PZJ A;  3S2H J;  4G12 A;  3C3W A;  3I5U A;  3K4B A;  4RLF A;  4UVC A;  1NG6 A;  2L9V A;  3J7A O;  1SFU A;  2L9R A;  5IYD J;  2HQR A;  2XV4 S;  2IT0 A;  2EV5 A;  2OPT A;  3QU3 A;  3L2U A;  1OYY A;  3JSP A;  2RQQ A;  2WAF A;  1EV7 A;  3ZMT A;  2UXN A;  4WXD A;  3LMM A;  2XAJ A;  4LLG F;  2IA2 A;  4CIC A;  2DK5 A;  4I09 A;  2KDO A;  1JT6 A;  2NVQ J;  3P9I A;  3ZQL A;  5DDG A;  3SZT A;  2X6Y A;  4G9Y A;  3CCU I;  3RKX A;  4MTE A;  3DBR B;  2A68 F;  2QQB A;  1BJA A;  4Q48 A;  2EZL A;  3C2H A;  3WE3 A;  5LGU A;  1B59 A;  4FTH A;  1FYL A;  1LFU P;  5B5E C;  5HOO A;  3X2Q H;  1BW6 A;  3NQO A;  3H3Z A;  3QOE A;  2LD5 A;  4C3I J;  2EFQ A;  1OPC A;  3IWZ A;  4IHS A;  4ENM A;  1IN4 A;  2JSC A;  5DEQ A;  2CUJ A;  1B72 B;  4AU7 A;  4RAG A;  3GX4 X;  1GHC A;  1I1S A;  4B3X A;  3WGI A;  3Q9V A;  1QO0 D;  1WFX A;  3FXQ A;  3HKZ A;  1XG1 A;  2M30 A;  3J7A Y;  5E8I A;  3OYF A;  3ZQI A;  2E2J J;  4P9F A;  1K83 J;  1WQ2 A;  2XDV A;  1XMX A;  5F0F A;  4QIW N;  5F04 A;  1UG0 A;  1U2W A;  2L9S A;  1IV8 A;  2W24 A;  1W7P B;  3WTT C;  1ULY A;  1ZYR F;  3FXO A;  4C2M J;  2HU9 A;  3GCM A;  3VOD A;  4I0A A;  4DQ2 A;  2FBI A;  4DYR A;  2BXY A;  3DPU A;  1U3E M;  2A6E F;  3S14 J;  2DTZ A;  3WU1 B;  1FWZ A;  1ZAO A;  2BE5 F;  2DDB A;  2O5R A;  1Z7U A;  2E34 A;  4FE4 A;  4NHJ A;  3FXU A;  3MMY B;  2R0Q C;  3DKX A;  1FIP A;  3W3C A;  5ILV A;  3IAS 2;  4RS8 A;  3H9J A;  2R5Y A;  1TWH J;  1SFO J;  1B8I B;  2DMU A;  2MLG A;  2OF7 A;  3I0T A;  3ZP5 A;  4UY8 I;  1OR7 C;  5HLG A;  3V7R A;  5EG0 A;  4QLC U;  4KJZ A;  4RM2 A;  2LF8 A;  4XM3 A;  2IAI A;  4KMU X;  3HHG A;  1XC5 A;  2H6C A;  1V5E A;  2DT7 B;  2IA1 A;  1JUP A;  1DP3 A;  2O9L A;  5AIP A;  1P2F A;  3DKY A;  3VSL A;  3EUH A;  3SXY A;  1MIJ A;  3ZMZ A;  2E1O A;  3GW2 A;  1VTN C;  2JA2 A;  1DDN A;  2WAQ N;  3OIO A;  2R5Z A;  4LG0 A;  3FBI B;  4I76 A;  3CF2 A;  1JKO C;  4CZC A;  4S0H B;  5LRR A;  1RRJ A;  2IRF G;  1HSJ A;  1MNE A;  1XGS A;  2PFB A;  2XAU A;  3HOU J;  2FRH A;  1JHF A;  2BHZ A;  2X6O A;  2KKO A;  4U0W A;  3LFU A;  4HQM A;  3DKW A;  2DYS H;  2WC2 A;  4H0E A;  3CDI A;  2HTJ A;  3PIO F;  2OA4 A;  3GO5 A;  1HW5 A;  1U6G A;  4G94 A;  3ML6 A;  2B63 J;  4AID A;  3RCO A;  1RR7 A;  2K9Q A;  1R1T A;  3HBL A;  4N0B A;  5DYM A;  1CF7 B;  2NRA C;  4RGS A;  4ESB A;  2ISZ A;  1S8N A;  2OTJ I;  3ASN H;  4E6K G;  3HTS B;  2UZK A;  4BBS J;  4KN7 X;  4CUG A;  2I8D A;  1R22 A;  2O03 A;  3L1P A;  3ELK A;  3OSF A;  4V19 K;  4LB6 B;  3RDI A;  1MH4 A;  3DP7 A;  4IRH A;  2ME0 A;  4TV7 A;  4G7Z F;  1I50 J;  2GM4 A;  1MBE A;  1EH6 A;  2ZME A;  2L9N A;  2KIS A;  4YRV A;  1XD7 A;  2EV6 A;  4NDL A;  1T38 A;  4R79 A;  1OCO H;  2DLL A;  1ZTR A;  5TJJ A;  4NQW B;  3UKG A;  2DMN A;  2A6T A;  1R5H A;  2H8W A;  1TWA J;  3V8J A;  4ZZL A;  1FYK A;  4BGD A;  3F8C A;  3MWM A;  4EJT A;  1LKX A;  3CUQ B;  3NEU A;  3RYR A;  1XGM A;  3GTK J;  4Q4Z F;  2E2H J;  2HNH A;  4IOA F;  2VJJ A;  4M6X A;  4XRS A;  4BJ5 C;  1J0R A;  4E4H A;  1H89 C;  4PJM A;  3LST A;  2PI0 A;  2PMZ N;  1MSE C;  3K9T A;  4BEH B;  1AKH B;  3LSP A;  3VOE A;  3DBL B;  3K4M A;  2R7F A;  5D4R A;  4II2 A;  1FYM A;  4E7K A;  1UHW A;  1QRY A;  2IA0 A;  1PVE A;  3UR3 C;  3GBG A;  1APL C;  4QWQ A;  1WSU A;  1EJ9 A;  1ODD A;  2JRM A;  2L02 A;  4RA2 A;  4L0Z B;  3S17 J;  1AWC A;  2K4J A;  3F72 A;  3DCF A;  3ZN1 A;  2A5Y B;  3LL7 A;  2ZFW A;  3R0A A;  4ZJZ A;  1Y0N A;  2CMP A;  4HSR A;  3TBI A;  4ASN A;  5IT3 A;  3IRR A;  1TNT A;  2IS6 A;  4D7N A;  2M5W A;  2QSG X;  1QZZ A;  3ZOB A;  1K4T A;  1GLN A;  1ACI A;  1W4M A;  2X1C A;  4I7H A;  5IP7 J;  1R71 A;  1IAW A;  1OCR H;  1WJ5 A;  5IOZ A;  3VPR A;  2CW7 A;  5FLM J;  1IRG A;  1IUY A;  4UVA A;  4E7H A;  4QSH A;  1GXQ A;  2GBY A;  3LSH A;  3W2W A;  1P4X A;  1IDY A;  4LFU A;  2X48 A;  1MBF A;  3DWL E;  2LG4 A;  1Z6R A;  2DO7 A;  3MZY A;  4KIF A;  3F6V A;  4KT5 C;  3CO7 C;  3DV8 A;  2VC1 A;  3CUO A;  3K4J A;  1FC3 A;  5FO5 A;  1HCR A;  2W1O A;  1O7F A;  1Z91 A;  1H9T A;  2IP2 A;  2CUE A;  3EPZ A;  4A5M A;  5C4J J;  3CC7 I;  2XPW A;  3K6G A;  3HB9 A;  2CYY A;  1UEL B;  2ZXW H;  2L4A A;  4WWC A;  4OAY A;  2JQ7 A;  1B4A A;  4ENJ A;  2W84 A;  3P9C A;  3MAJ A;  5JVG F;  2VJI A;  4PSW A;  3GZN B;  5HOD A;  1ZR4 A;  2HQ5 A;  3BR1 A;  2HPM A;  2DMP A;  2G0E A;  5D8L B;  2GOM A;  1B1B A;  2P4W A;  4XK4 A;  2L01 A;  3SFZ A;  3K70 D;  1ZGW A;  2PN6 A;  2ZJR F;  1ZRD A;  2P5K A;  1MNM C;  1FT9 A;  2R4G A;  2V4J C;  3ZR8 X;  4NC7 A;  1IXC A;  3GFI A;  4XLN F;  1D8J A;  3BT9 A;  3TMO A;  2C6Y A;  2VXD A;  5FD6 A;  4S05 A;  2QQ9 A;  5D6E A;  1LEA A;  3F9K A;  1B6A A;  3PM1 A;  4LD5 A;  2DCE A;  2BYV E;  1VI0 A;  2QVO A;  4UV9 A;  5LHH A;  1YJW I;  1I3Q J;  2Y31 A;  4RMN A;  3U1D A;  2WY7 Q;  2QUF A;  1P9Q C;  4XLP F;  3LAP A;  2Z16 A;  1IC8 A;  5EEG A;  3R60 A;  1OYI A;  1P92 A;  5DCM B;  1GDT A;  1ONV A;  4BXX J;  2FE3 A;  2GIV A;  2W48 A;  5E8G A;  3FMQ A;  2F4I A;  2HOE A;  3LSJ A;  1SFX A;  4HST A;  3H9G A;  3GTJ J;  2IPQ X;  3CC2 I;  2DMT A;  2E19 A;  3SJM A;  1Z6T A;  2A6H F;  1J75 A;  4Y52 J;  3TW6 A;  3E5U A;  4I98 B;  5K1Y A;  3JRA A;  2R7W A;  4EM1 A;  3DPT A;  2HZT A;  4EJO A;  4A12 A;  3HKZ N;  2PEX A;  3CJQ B;  1EH7 A;  2VAS A;  2VON A;  5BNG A;  4II3 A;  3F8F A;  3G6E I;  3OR1 C;  4WCG A;  1X1D A;  2P7V B;  2RVC A;  1PDN C;  2X0L A;  2F5D A;  4ENK A;  2JPC A;  1Z3X A;  2XAQ A;  5CVU A;  2XHK A;  1RC9 A;  1AA7 A;  1SMY F;  2ZNZ A;  2VKV A;  1SD7 A;  4J19 A;  4U0V A;  5HNH A;  3QQA A;  1A6I A;  2NXN B;  2BY3 A;  4IL6 C;  1VQN I;  3Q3S A;  2DJI A;  2QBY A;  2XF6 A;  3W2A A;  4IQ4 A;  3I59 B;  2BXZ A;  2VQG A;  4XLH A;  1O3S A;  1FMW A;  1MDM A;  5FLX K;  2VQC A;  4EEF G;  2M1B A;  1LDJ A;  1U9O A;  5B1A H;  4PJ0 C;  4R1H A;  2QGU A;  1AHD P;  2ACJ A;  1U5T A;  2DOA A;  4FAS D;  2CW0 F;  4L5J A;  2ADU A;  3P5J A;  3OYE A;  1JTX A;  1YYV A;  2JJ7 A;  2LFB A;  4YFX F;  3H92 A;  2JWT A;  4BQA A;  5J1U A;  3HM5 A;  4KIG A;  4U0Y A;  2D2W A;  3DEW A;  2L7Z A;  4P55 A;  3T8T A;  3V8L A;  2F5F A;  3BRO A;  3HIF A;  3RTR A;  2V9P A;  3BTI A;  5LEK A;  5FKL A;  1MJ9 A;  4HZF A;  1QVU A;  4CZZ A;  1LE8 B;  4OIQ F;  3A01 B;  1IZ1 A;  2DXI A;  5JLW A;  4LB5 A;  2CG4 A;  1KZH A;  1VQ7 I;  1YS6 A;  2VE8 A;  4OIN F;  4HNU A;  3OYM A;  1N25 A;  3NWS A;  4AD9 A;  1ZHF A;  3QRF F;  4A3D J;  3H3V K;  2K4B A;  1HQC A;  2FBH A;  3O8H A;  3K2A A;  4EM2 A;  4YEL A;  5IP6 A;  4Q5S F;  3CLO A;  5E3L A;  3IKT A;  4P96 A;  1SC7 A;  4DW6 A;  3QPT A;  3ZQF A;  4XLA A;  2CGP A;  5KK1 A;  3OYB A;  5C4X J;  1DQU A;  3TOA A;  6PAX A;  1ZEL A;  2HZD A;  4EAT A;  2KFD A;  1K4S A;  4MFD A;  2BOL A;  3BCB A;  2XIG A;  4UUT A;  5CQE A;  3ZQ7 A;  1S72 I;  1CQT A;  1OR7 A;  2XUB A;  5J4V A;  2DBB A;  5IYC J;  1Z3Y A;  2RAE A;  5EGO B;  1RIO H;  3L2V A;  2ZME C;  1VF9 A;  2PMU A;  4HLY A;  4HRI A;  2LBF A;  1FTZ A;  1FBU A;  3PO2 J;  1F1Z A;  2M4K A;  2NNN A;  2HPI A;  3KPH A;  3WTZ A;  1G2H A;  2Y2Z A;  1ZR2 A;  4A3B J;  4W97 A;  2V7F A;  3GTM J;  3IUO A;  4IZZ A;  4YFK F;  3J81 K;  1SFE A;  1REP C;  3W6K B;  1BOB A;  2W25 A;  2VLA A;  4CA0 A;  2LC2 A;  5M5X J;  1R7J A;  2J5P A;  1YJ9 I;  4RBO A;  2FEZ A;  1VZ0 A;  4NBQ A;  1YIO A;  4UV8 A;  2R7D A;  4B47 A;  2HVQ A;  4G6Q A;  1Z77 A;  2LOO A;  2DFE A;  2M0M A;  2L2O A;  2OCC H;  3S2D J;  3D5S C;  2PJR A;  5GTH C;  1ETO A;  3HG9 A;  1WI9 A;  3N97 A;  5F27 A;  3BR5 A;  3K70 C;  3E6D A;  4H4K C;  4YIR X;  3DF8 A;  3KP4 A;  2DK8 A;  1TL8 A;  5GP9 A;  3CD6 I;  2IJL A;  2LVS A;  4KFC A;  3WTX C;  4HX4 A;  2N8G A;  4ZYG A;  4HPQ A;  3MKL A;  5DD4 A;  1ZRE A;  1JGG A;  1XB4 A;  3GF2 A;  4F7Z A;  2FNP A;  3WTV C;  3S8P A;  1IUF A;  5DS9 A;  4FIS A;  1GT0 C;  3LFK A;  4EJW A;  5KAI C;  3RKW A;  3K4C A;  5HS7 A;  2V6E A;  4IPA A;  2NNY A;  1R1U A;  3CJN A;  2RGV A;  3JRD A;  2DA5 A;  4BHB A;  3U2R A;  3CES A;  2DU9 A;  4BXF A;  3JW4 A;  2EH3 A;  2ZXH A;  4EGY A;  1TQP A;  1R00 A;  2LP0 A;  1SMT A;  2L3D A;  4N9H A;  3KP6 A;  4RM3 A;  2M9H A;  4HV6 A;  4M74 A;  1JTY A;  3ASO H;  2B0L A;  2D1V A;  3J80 K;  1HXD A;  2PG4 A;  4KMF A;  2Y9Y A;  4A3F J;  3IAM 2;  3CUQ C;  3FK7 A;  4RB2 C;  1FSH A;  4BY1 J;  3CP8 A;  3OOP A;  5LD2 C;  5K7Z A;  3TL4 X;  4M3D A;  2JTV A;  3K1P A;  5KNL A;  5IT9 Z;  1VQ8 I;  4X0G A;  2QKM B;  1T08 B;  2MG4 A;  2YUS A;  5D6F A;  1HKQ A;  1ETQ A;  1MGT A;  3JAM K;  3RIR A;  1FOY A;  4CHU A;  3R6S A;  4YG2 F;  3G73 A;  3OV8 A;  1WWX A;  4YII A;  4U87 A;  1JXS A;  1B8I A;  1Y8Q B;  2CFX A;  3QYF A;  2OCE A;  4CCM A;  3GZ6 A;  3GTO J;  2KJB A;  2VPR A;  3IHU A;  3O8G A;  3U1K A;  1T33 A;  3JRG A;  1RUO A;  2HS5 A;  1STZ A;  1V54 H;  3B02 A;  4JQF A;  4A3M J;  1BI0 A;  2L0K A;  2Q2E B;  4XOP A;  2E2I J;  3A2K A;  1VND A;  2VQH A;  3PNY A;  2FF4 A;  2A07 F;  2M4G A;  2LY2 A;  3ONQ A;  2EA2 A;  4XL9 A;  3HSE A;  1FPQ A;  4U7D A;  1X2N A;  2ME6 A;  1LUJ B;  3CJR B;  1FMV A;  2K9S A;  2MD0 A;  3B73 A;  2QCO A;  5JR3 A;  1W36 C;  2CQX A;  1OYW A;  3BP8 A;  2WWY A;  3ECH A;  5J8F A;  1X1C A;  3OL4 A;  4DYC A;  2FQ3 A;  1T8I A;  3HOT A;  5LFA A;  5FKN A;  3V7S A;  3CMY A;  1FOK A;  2KIM A;  1W5C C;  2K7L A;  3F6O A;  3HPG A;  1J09 A;  3LQQ A;  5IYB J;  2DN0 A;  2HGC A;  1XCB A;  2QLZ A;  1XX5 A;  3FHZ A;  2W00 A;  4KA4 A;  2KPM A;  3BG7 A;  3BR0 A;  4GYG A;  2JRT A;  3W2V A;  2DFF A;  4PFO A;  1JKQ C;  3VFZ A;  2XSJ C;  1K78 B;  1Z1D A;  5JVT A;  4LMY A;  3F8N A;  3R61 A;  3ZN0 A;  2AQE A;  4E7Z A;  1JJ6 C;  2O8X A;  1U0J A;  4KN4 X;  5L3E A;  3DXJ F;  2XPU A;  3BR2 A;  3QP5 A;  1S29 A;  2CQQ A;  3ZMU A;  2ETH A;  1R58 A;  1JHH A;  3BQZ A;  5ILU A;  4L9N A;  1TW2 A;  3PSF A;  4BAY A;  5M5W J;  3I4M J;  4MLO A;  2MBF A;  1SEU A;  4XLF A;  2R7Z J;  1U5T C;  2V1N A;  4PFP A;  4Y3O A;  1S7E A;  2VIX A;  2DPD A;  2D45 A;  1M1E B;  2A69 F;  2PQ8 A;  5LBQ A;  4UB8 C;  2IW5 A;  3U9G A;  3L2C A;  2ZBK A;  2Q0O A;  1HA8 A;  4L9T A;  5IPA A;  2R5Y B;  4ZTJ A;  1TT0 A;  2PMH A;  3IL2 A;  5IT9 K;  1X3W B;  1O3T A;  1QNT A;  2OZU A;  2VUM J;  3MKZ A;  3DU6 A;  4UUS B;  4BE1 A;  3DTE A;  3H5N A;  3HGY A;  2CJJ A;  2CRG A;  2L7F P;  3LSK A;  1MD0 A;  2MW8 A;  3LA7 A;  3VDX A;  3W6V A;  5FFZ A;  1ON2 A;  1E0E A;  4GGG A;  3HTU A;  4A0Z A;  4OIO F;  1NK2 P;  3KEQ A;  4Y17 A;  5E18 F;  2QSH X;  4IXA A;  3CCJ I;  1SD5 A;  4F52 A;  3E5X A;  2ELK A;  3E7L A;  4GYI A;  1LFB A;  3RKQ A;  2R5Z B;  3BG5 A;  1DPR A;  2LKP A;  3SYT A;  1NK3 P;  3M07 A;  2LNB A;  2FXA A;  1Y39 A;  1A36 A;  2O7O A;  4NB5 A;  2WTE A;  4AVP A;  3HHH A;  2JSP A;  1TT5 B;  4O6J A;  1QU3 A;  2OU2 A;  2HDW A;  2LDU A;  2VL8 A;  4XKV A;  1W0U A;  1H88 C;  5DCF A;  1MKM A;  5LHI A;  5LLQ A;  1RNL A;  2EJR A;  1USS A;  1WJD A;  4B4C A;  4BQO A;  5HLT A;  2MA3 A;  1X3Z B;  2A5W A;  4UNO A;  1YLF A;  1R9T J;  1G6N A;  5E1X A;  1SAN A;  5J4Y A;  3FKJ A;  4BU2 A;  2XSD C;  1WRJ A;  4IHW A;  1F36 A;  2DMQ A;  3RZO J;  1E3O C;  4LGW A;  1A5J A;  1DU0 A;  2RNG A;  1HST A;  3M1C A;  3D5R C;  3IV5 A;  1D0Y A;  1RI7 A;  3FXR A;  2ECC A;  4ESF A;  2EV0 A;  3M4O J;  3ZQQ A;  1BI1 A;  1BBY A;  2X51 A;  4S04 A;  3KP5 A;  2WV1 A;  5F0C A;  5C3E J;  2NOJ B;  1R5G A;  4AYB A;  1HF0 A;  5E79 C;  1OIS A;  3O6B B;  2B9S A;  3ESW B;  3A02 A;  2COB A;  3TP0 A;  3VSK A;  4RGU A;  2BW3 B;  3ZXS A;  5DM7 F;  1JKP C;  3JSO A;  4DYQ A;  1ETX A;  3AG2 H;  1QGP A;  4M9Z A;  2CWE A;  2HWV A;  2QKL B; 
#chains in the Genus database with same CATH homology
 1K6Y A;  1G59 A;  1P9Q C;  2Z16 A;  2MFZ A;  3S3N A;  3OIP A;  3AKZ A;  2UV1 A;  2F4I A;  3QOD A;  2IXS A;  4BE2 A;  4HST A;  3H9G A;  1G8X A;  2LY1 A;  2WBM A;  1JI8 A;  3PL8 A;  2M7B A;  2Z2S B;  1ERD A;  1WJB A;  4DOZ A;  1BR4 A;  3OL3 A;  4AVZ A;  2LH9 A;  4Y33 A;  1V5G A;  4XKW A;  1T0F C;  1WJF A;  2R7W A;  3VYS B;  2R7R A;  3DPT A;  1SAU A;  5KHD A;  5FRO A;  3CJQ B;  2BVM A;  2VAS A;  1WJE A;  2OC6 A;  4II3 A;  3OR1 C;  4CCO A;  1MND A;  1X1D A;  4BDZ A;  4PK4 A;  1N77 A;  4CSW A;  2R7X A;  3HC7 A;  4ITV A;  1Z3X A;  3ZRG A;  4XOR A;  1AA7 A;  1WJC A;  4XON A;  2M7A A;  3OWT A;  2VB6 A;  5HNH A;  4YEJ A;  2E5Z A;  2VJ4 A;  3OY9 A;  3KYL A;  2E1M B;  2UWM A;  2DJI A;  4PUS A;  2K9M A;  4XLE A;  2XF6 A;  3W2A A;  4IQ4 A;  2K5C A;  3OYI A;  3VYT B;  4LG3 A;  2VQG A;  5HNF A;  4XLH A;  3LSM A;  3NWT A;  1FMW A;  1D1B A;  3S3O A;  2VQC A;  2E5N A;  4LIV A;  2VKD A;  2WB1 A;  1QHH D;  4U7B A;  3VWB A;  4C2T A;  2UUZ A;  2LRD A;  2DOA A;  2MC4 A;  3A1Y A;  2FUG 2;  4FAS D;  3PUB A;  2E1M C;  3K4K A;  2WAD A;  3OYD A;  1N78 A;  3S93 A;  5TGT A;  1D0Z A;  1X1A A;  3OYE A;  3K10 A;  3I9V 2;  3AL0 C;  2HVR A;  3ZGK A;  2Y0S A;  2VJ5 A;  4C30 A;  3BCA A;  3MD2 A;  3MKW B;  4CCL A;  2VPL A;  4PJJ A;  5CPR B;  3L2W A;  3UNG C;  3HUG B;  4DBR A;  4F92 B;  4BS9 A;  4IKF A;  3RTR A;  4F91 B;  2R7U A;  2PMZ A;  4HEA 2;  2VQL A;  4ZC3 A;  4XNF A;  2WY8 Q;  3FDY A;  4CH7 A;  2DXI A;  2HVS A;  2ZXI A;  2R7Q A;  4B48 A;  3FBN B;  5CKT A;  1YE9 A;  2R7S A;  2JUG A;  4HNU A;  3OYM A;  4ZYA A;  3NWS A;  4JOM A;  2V26 A;  2K9L A;  1LVK A;  4PJL A;  4BEH A;  1DGW Y;  3PFY A;  2OV7 A;  3OYJ A;  2CV0 A;  1R6R A;  4YEL A;  3V42 A;  2M3A A;  3OYG A;  3RPU D;  4CCK A;  4BQN A;  1DGR M;  2LYC A;  4XLA A;  3OYH A;  3OYB A;  4BAC A;  1DQU A;  1PYV A;  4P5O A;  3VYR B;  1ZEL A;  2HZD A;  4E7S A;  1EA3 A;  5JHF A;  4J01 A;  4EAT A;  3AFH A;  2BOL A;  3BCB A;  4NNJ A;  5CQE A;  4DBQ A;  4PSX A;  4LIT A;  2XF5 A;  1Z3Y A;  4XLC A;  1TZL A;  3CMM A;  3SEQ A;  1D1C A;  3L2V A;  4FET A;  2XF7 A;  4HRI A;  2LBF A;  4N4N B;  4BL0 B;  4E7I A;  1Y6I A;  2ELJ A;  2GOX B;  3EUA A;  2M4K A;  3H5R A;  2XC7 A;  4BJ6 C;  2HPI A;  2Z1D A;  3ZCO A;  2WA0 A;  1BR2 A;  2OUM A;  2Q1Z B;  2V7F A;  3IUO A;  1Y56 A;  4IZZ A;  4QPO A;  1BOB A;  3CP2 A;  1X4P A;  2KP6 A;  2VLA A;  4XKB A;  3PJR A;  4CA0 A;  2LC2 A;  3DQV C;  2CV2 A;  2F5V A;  2KL4 A;  1MMA A;  3K4B A;  4RLF A;  3OIQ A;  3DTK A;  3KX2 A;  1NG6 A;  1VZ0 A;  2CV1 A;  4B47 A;  3K4L A;  2HVQ A;  2LOO A;  2E60 A;  2VKH A;  3DU5 A;  4XQF A;  2M0M A;  2L2O A;  4Y4R A;  2F6C A;  3D5S C;  3L2U A;  2PJR A;  2RQQ A;  2WAF A;  3H0D A;  3L2R A;  5FRM A;  3OOU A;  4BUP A;  3HG9 A;  3LMM A;  4CCN A;  2KQR A;  3LSI A;  3K70 C;  1YX5 A;  2KDO A;  4H4K C;  4KIS A;  3S3M A;  3S32 A;  2X6Y A;  4HPQ A;  3C2H A;  1IRX A;  5FRN A;  5HOO A;  2KLO A;  3S8P A;  3OYL A;  3I3L A;  3QYB A;  1X4O A;  3AL0 B;  3QOE A;  2X1D A;  3RSN A;  3K4C A;  4KIT B;  2V6E A;  2BW3 A;  2HQA A;  2CUJ A;  4AU7 A;  3CES A;  2IS4 A;  2CUZ A;  4BXF A;  2ZXH A;  4B3X A;  1WFX A;  2JVH A;  4ZTF A;  4G6T B;  3HKZ A;  4ZDL A;  3J7A Y;  2X6X A;  2K3P A;  4ZDP A;  3OYF A;  2AQF A;  4RM3 A;  5CQG A;  4NUB A;  2XDV A;  4KT6 A;  1UG0 A;  2JVG A;  2L9S A;  3IAM 2;  3OMY A;  1W36 D;  3CP8 A;  5LD2 C;  2HU9 A;  3TL4 X;  2KMU A;  3H9Q A;  5KNL A;  1MMN A;  4X0G A;  3DPU A;  4F55 A;  4BE0 A;  2MYS A;  2QKM B;  3SEZ A;  1D0X A;  4D1Q A;  4HNT A;  2O5R A;  1LFP A;  4IX7 A;  1NG7 A;  3FHN A;  2KRH A;  3MMY B;  3PNV A;  3DKX A;  3DPL C;  4OWR B;  4U87 A;  3W3C A;  1D1A A;  3IAS 2;  3QYF A;  3H9J A;  3PNT A;  4CCM A;  3A4C A;  2R7T A;  4N4O B;  2V9K A;  3OYC A;  1OR7 C;  4KJZ A;  4RM2 A;  4XM3 A;  4C9Y A;  4BQQ A;  4GRI A;  4JQF A;  2Q2E B;  3A2K A;  4XOP A;  3HXL A;  2VQH A;  1V5E A;  3PNY A;  2DT7 B;  1DP3 A;  2M4G A;  3RQ4 A;  2LY2 A;  3ONQ A;  3U21 A;  4XL9 A;  3DKY A;  4XR6 A;  4RLQ A;  3VSL A;  1YX3 A;  4E7L A;  2PJR B;  2X85 A;  3CZ6 A;  2P0W A;  3CJR B;  1FMV A;  1SFK A;  2JA2 A;  2MD0 A;  2CFO A;  5HVQ C;  2X1E A;  3FBI B;  3CF2 A;  4ZDO A;  4CZC A;  2DT6 A;  4E7J A;  1W36 C;  1MNE A;  3HL2 A;  1X1C A;  3OL4 A;  1MMD A;  2XAU A;  3KEY A;  3G2B A;  2IGN A;  3E0J B;  3HOT A;  1T95 A;  3LFU A;  5LFA A;  1X19 A;  3BG6 A;  2ZSI B;  2VXZ A;  3HPG A;  4QPQ A;  3EUK L;  1X1B A;  3N05 A;  3HPH A;  1WJA A;  1J09 A;  4XKC A;  3RCO A;  2IGK A;  4DJA A;  2W00 A;  5KCM A;  3H35 A;  2KPM A;  3BG7 A;  3BLY A;  3W2V A;  4PFO A;  4XN0 A;  4B43 A;  4E6K G;  2XSJ C;  4XN3 A;  3L2Q A;  3PSI A;  4P1W A;  4CUG A;  2I8D A;  2KHM A;  2AQE A;  4E7Z A;  1PJR A;  4PJN A;  1U0J A;  2L9N A;  4YRV A;  1QHG A;  2WAQ A;  3OS2 A;  4R79 A;  3DEE A;  4BJT A;  4ANJ A;  3D5L A;  3IP4 B;  4F3Q A;  4NQW B;  3PSF A;  2ZFU A;  4BDY A;  2A6T A;  4B44 A;  2R7O A;  2ZSH B;  2RRE A;  4MLO A;  3MKY B;  1N75 A;  4IQJ A;  4XLF A;  4Y3O A;  2V1N A;  4PFP A;  4C2U A;  2VIX A;  3H5A A;  4OAZ A;  4BGD A;  1LKX A;  2L7K A;  3DLA A;  3DTI A;  3VYU B;  2HNH A;  4XMY A;  1HA8 A;  2IGO A;  2VJJ A;  4BJ5 C;  4E4H A;  1TT0 A;  4ZTJ A;  4PJM A;  4BEH B;  3MKZ A;  2R7V A;  3DU6 A;  3K4M A;  1OLT A;  2IGM A;  2LRE A;  3DTE A;  4II2 A;  4BE1 A;  3H5N A;  4E7K A;  1BR1 A;  3UR3 C;  3GBG A;  3LSK A;  2KRC A;  3E1S A;  3VDX A;  2X6W A;  1E0E A;  4HG2 A;  4NC8 A;  4DIQ A;  2CW8 A;  3LL7 A;  1LDK B;  4ZJZ A;  2CMP A;  4F52 A;  4HSR A;  3TBI A;  2KZV A;  2W82 A;  1MMG A;  3OYK A;  4XOT A;  2BVL A;  3K4N A;  2IS6 A;  2CH0 A;  3LSG A;  3SYT A;  2LBF B;  2MAB A;  1Z21 A;  1GLN A;  2X1C A;  2JSP A;  1WJ5 A;  2CW7 A;  3BC8 A;  4F93 B;  4E7H A;  1QU3 A;  2HDW A;  4XKV A;  2VL8 A;  3EUH C;  3LSH A;  3W2W A;  4CCJ A;  4LIU A;  3C2G A;  1WJD A;  3DWL E;  4BQO A;  5HLT A;  2LG4 A;  2A5W A;  3M8J A;  3K4J A;  3QYE A;  3FKJ A;  4BU2 A;  2W7N A;  1S9H A;  2W1O A;  3EPZ A;  2W4S A;  3OR2 C;  3OYN A;  3SDB A;  3HOS A;  3K6G A;  1Z7L A;  1UEL B;  1MW7 A;  1V5F A;  4OAY A;  2WAE A;  2VJI A;  4PSW A;  2RNG A;  2HPM A;  3OS0 A;  1UAA A;  2GOM A;  3M1C A;  3D5R C;  3K70 D;  1D0Y A;  4DGW B;  1KON A;  3ZQQ A;  2R4G A;  2V4J C;  3ZR8 X;  4NC7 A;  2X51 A;  3OS1 A;  2CS3 A;  3TMO A;  2L5Q A;  2NOJ B;  2VXD A;  4AYB A;  2IS2 A;  2IS1 A;  3SZG A;  3F9K A;  2DCE A;  3VSK A;  2BW3 B;  3ZXS A;  4J00 A;  4D9J A;  3OYA A;  4RMN A;  2WY7 Q;  2QKL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...