2V7FA

Structure of p. abyssi rps19 protein
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
149
structure length
139
Chain Sequence
ATVYDVPGDLLVERVAQRLKEIPEIKPPEWAPFVKTLPEQEDWWYYRVASILRRVYLDGPVGIERLRTYYGGGHAPERFYKAGGSIIRKALQQLEAAGFVEKVPGKGRVITPKGRSFLDKIATELKKELEEIIPELKKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RPS19E SSU RIBOSOMAL PROTEIN S19E
publication title Molecular Basis of Diamond Blackfan Anemia: Structure and Function Analysis of Rps19.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Ribosomal protein
total genus 46
structure length 139
sequence length 149
ec nomenclature
pdb deposition date 2007-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01090 Ribosomal_S19e Ribosomal protein S19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2700 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2v7fA00
3J7AY 2V7FA
chains in the Genus database with same CATH superfamily
4FASD 3FKJA 2AXLA 3I56I 4HSTA 3VYRB 1KGSA 2NS7A 3DKWA 2V1NA 2Q8KA 1VQ5I 3HSEA 4F7ZA 3IP4B 3WU2C 5GAHJ 2VN2A 5E1WA 1BC8C 3S1NJ 5CKTA 2XKPA 3IHUA 4PJMA 3H3ZA 4ZYEA 2FBIA 4PJLA 1OR7C 1G3WA 3BG6A 4IX7A 1AA7A 2ID6A 3A0HC 3CCRI 1TC3C 4BL0B 3BTJA 2WB1N 3BR5A 4E4HA 3PIOF 4LLNA 4HG2A 1APLC 1FC3A 1E17A 3JTHA 4GXOA 1ZLJA 4GYGA 2L02A 2R4GA 1H9GA 4CZZA 1EA3A 3HOXJ 2BZTA 5DEQA 2HNHA 4AU7A 4C2TA 1LPQA 1DUXC 3E1SA 1GHCA 1ZRDA 2P5VA 5IPAA 3TDZC 3HC7A 4I09A 2STTA 4E7LA 1OCOH 1MBFA 1ON2A 1QA6A 3FM5A 2HVSA 4KMFA 4G7HF 2XPVA 2DOEA 1JUPA 4IXAA 4YG2F 4B09A 3FISA 3IC7A 3SDBA 2ACJA 2OUMA 3MKYB 1XDUA 1FJLA 4N9HA 1DU0A 1B59A 3OYMA 2L9NA 1TWAJ 2PMHA 3M9AA 2BBYA 2BOLA 4MEYF 2VJIA 3O8GA 1QVUA 5KHDA 2R5YB 3KP6A 5J3LA 4BHCA 4ZYGA 2HYFA 2AQFA 5LGUA 1E3PA 3CJRB 1S6LA 4NUBA 5ICCA 4ZTJA 1SFXA 1DPUA 3L1PA 2R5ZB 3V7RA 1NH3A 2OQGA 3X2QH 1SD4A 4D9JA 1QZEA 2A5WA 2J5PA 2MYSA 5HOOA 2VJJA 3VPRA 2XASA 4LG0B 2ETHA 1TP4A 2BXZA 3KX2A 3QPTA 4WF2A 4ASNA 1MH3A 1SVLA 2ZMEB 3BG5A 3I58A 1TT0A 2Y9YA 3ZQIA 4EJTA 3K4LA 3F9KA 2XAGA 1H8AC 2LBFB 2Y48A 3Q9VA 3OYJA 1SFOJ 4C3HJ 3SFIA 4A2UA 1W4MA 2K86A 2YU3A 5J4VA 1YG2A 1ZAOA 3V42A 3WE3A 3BG3A 2RNGA 3SEZA 4D0PA 2IBDA 2DJNA 2DYRH 3JAMK 2EQRA 2EIJH 2ECCA 3GZ5A 1OPCA 5F0FA 3REOA 5LHGA 3J81Z 1WJAA 1K78A 3TL4X 3M3YJ 3COAC 5H6QA 1OYIA 2PN6A 4LFUA 4A69C 1SAUA 1WFXA 4QIWN 3R61A 1UFMA 2EIKH 3FZVA 4UVCA 3DTKA 1KZHA 3A4CA 1OCPA 2OZ6A 4UUVA 1OYWA 2QQAA 1A35A 3W2VA 3ZQFA 1DPRA 1RR7A 1ITYA 5IT9Z 2OBPA 3RKYA 1SD7A 1HA8A 3DLLF 2P0WA 3HKZA 1TQIA 1ZG3A 2MC4A 1O7FA 2DTZA 2BEOA 4BHPA 4E70A 4KUMA 4Z6YA 5E8IA 4RM3A 2IA0A 1ENHA 4IRGA 2CU7A 2E60A 4IHSA 1Y6IA 1ZYRF 2M7BA 3MAJA 2DW4A 4ZYAA 4BDZA 5LHIA 1HOMA 5LRSA 3GUDA 3OYNA 5FLXZ 2GOMA 1IW7F 3F8MA 2QUFA 1JHFA 4ZZLA 2NVXJ 4YFXF 5KVRA 5ERIA 3HRTA 1IGNA 1UELB 4GCVA 4WXDA 2LREA 5LEKA 5EGOB 3RZOJ 1U6GA 1ORKA 3CMMA 5D8KB 3FK7A 2ZKZA 5DTDA 1DDNA 3KIOA 3BOQA 4RAGA 2HS5A 2E36A 2HVQA 1Z9CA 3I55I 1LFPA 1B72B 1P9QC 2MD5A 1YW8A 3BJOA 1YJNI 4WXCA 2V9KA 3I54A 1ZR4A 2DJIA 2HPIA 2IEKA 4ABZA 4IHXA 1X1AA 3L2VA 1OCRH 2EINH 4I2OA 2BVLA 2VXZA 2X4HA 2HU9A 5E3LA 1MMDA 4OMZA 2VONA 2VQGA 1BI0A 2XGDA 1XDSA 3TOBA 3D1NI 3S17J 4HV6A 1TNSA 5GAGJ 1K61A 2VQHA 4U88A 3HKZN 2VUMJ 3PO3J 3DEWA 3HOSA 2A6TA 2IPQX 2V9VA 4AVPA 2YPRA 3ABUA 1FY7A 4Q5SF 5D5WB 3B6CA 2XB0X 1OFCX 1UJ8A 3MQ0A 4KFCA 4BEHB 4V19K 2TDXA 3MZ8A 4OIRF 2CQ7A 2R7OA 3FXUA 2FOWA 2HDCA 2Z5UA 1MSFC 1VQ9I 1VQMI 3ZP5A 4RAZA 2R7RA 4PGGA 1MSEC 4XSXF 3S1QJ 5CQGA 2MC3A 4AUXA 1SMYF 4CZCA 3LNQA 1BL0A 2HZDA 1SFEA 1FYMA 2XV4S 4QPOA 3U9GA 1RIOH 5LFAA 4E7ZA 4PDKA 3FXLA 3GF2A 2G7HA 4OIPF 1TNTA 2NVYJ 2HTJA 2MH2A 4YRVA 3TW7A 1D0ZA 3TQNA 5IP6A 1C0WA 1R1UA 3RQIA 4L9TA 5LD2C 3SHFA 1FT9A 1SVOA 2OA4A 5IY5H 1ETQA 1S72I 5EEGA 5TJJA 1YS7A 3M4OJ 1D8JA 3S3NA 5DV5A 4M3FA 5C3EJ 2VIXA 4LK0F 3GTOJ 2QF7A 5ICFA 2FJ1A 3KEQA 1ZELA 1ETOA 4BJ6C 3O3KA 5K5RA 1WI3A 3L09A 4A3JJ 2ZFWA 3L2QA 3KPHA 4MQ9F 1J2XA 2KJBA 2QBYB 2DQRA 4XSZF 4IZZA 3GFLA 2KFDA 2FNPA 2STWA 1JKRC 1IRZA 2HDWA 2P81A 3UNGC 5E3OA 2ID3A 1ZGAA 2OTLI 3DU5A 5J4YA 5E79C 3MFKA 1W36D 1FSEA 4HLXA 4XQFA 4IO9F 1PDNC 2HQAA 3DBLB 1A36A 5DS9A 5CPRB 2ECBA 2VKEA 4DYQA 2W48A 3ABTA 1EV7A 4BS9A 3LQQA 2BVMA 5L3EA 5B66C 2GWRA 4ON0A 2KRHA 1E2XA 1XGOA 2ICWG 2QSHX 4B8XA 3S3OA 1YI2I 2EZLA 2IAIA 2OQRA 2QGUA 4XRSG 2W84A 2DMUA 2E7XA 4A0YA 2BE5F 1I1SA 1YX3A 5HDGA 1J7KA 3GFJA 5D5VB 1TWCJ 4RBOA 2EV5A 2CRGA 2QVOA 3JRHA 4BJ5C 1YTYA 5C4JJ 1O3TA 5EF6A 2WY7Q 1R5HA 5EG0B 2KQRA 4RB1A 1HSTA 5EJCA 3JRDA 2RDPA 2EFWA 1R58A 3AAFA 2RGVA 2HQ5A 3L2RA 3DKYA 5M3MJ 2BW3B 5DCMB 1K6OA 3TW6A 4HNVA 2VLAA 4EGYA 1YS6A 2M5WA 4GO1A 1OQYA 5J1RA 5FKMA 3O6BB 5GPCA 4Y13A 2L9RA 2K9NA 3L2UA 1R1TA 2D1VA 5HNFA 3TOAA 1Z6TA 3HG9A 3TDUC 2HTSA 3I4NJ 4H4KC 3EUAA 5EYRA 5DUKA 3LL7A 4DGWB 4BQAA 2FQ4A 2GA1A 5B1AH 3CESA 1ZGWA 2HEOA 1FBSA 2VKVA 3FK6A 2O0YA 2VBZA 4HRIA 4IHWA 5FLXK 3HTUA 2KKOA 2M8EA 1XMAA 2LK2A 4I99C 2YS9A 2GXAA 4IPAA 2EK5A 4A12A 1B9MA 1IJWC 2QSGX 3HUGA 3BQZA 5LBQA 3TP3A 4EM0B 3F3XA 4JX6A 1LNWA 1RC9A 2Y0SA 4U7BA 3CJNA 1MBHA 1LE8B 1Y39A 2WA0A 4IHYA 2F5FA 2H8RA 2O03A 2OCCH 2QKLB 4NHJA 2UZKA 2R7DA 5IP9J 1XPXA 2JTVA 2IXSA 3CCEI 2JZYA 2MABA 3K1NA 2DN0A 4ZDOA 1FTZA 3P9IA 1ZQ3P 1AU7A 5GTIC 1QHHD 3FKIJ 4B1RA 4RA2A 2LF7A 4HV5A 5F08A 4IJAA 4ZH4F 1R7JA 4U0WA 5DM7F 4FT8A 1F36A 5BQTA 1V5EA 1J09A 2ZFUA 2WTEA 2W7NA 2K4JA 3DPUA 3ASNH 2X6OA 2UXNA 1YW7A 1F1ZA 2JVHA 3PSFA 3M8FA 1USSA 1YOVB 2IS4A 5BPIA 4Y17A 3VDXA 2Y75A 2IP2A 2DTRA 1BM9A 1K6YA 1D1BA 4ZZDA 1IUFA 2PJRB 1XCBA 2HWVA 2KIUA 2XIGA 3LSTA 2QWWA 4A3IJ 1I5ZA 1F4KA 5GTHC 2CUEA 2FUG2 2M30A 4XOPA 1CF7B 5JLXA 4A0XA 1ZRFA 2Y0SN 3OV8A 2KDOA 2R7UA 2HKOA 3HGYA 3OS0A 2BY0A 1V54H 2JVGA 2W85A 3CTAA 2NYXA 1TQPA 3OOUA 1PUFB 1ERDA 3GMEA 1R1VA 5FB2A 5B3SH 5M5WJ 1ZG5A 5BS6A 3OY9A 5J8CA 1ZH5A 4NBQA 1MBEA 3VYTB 5L3FA 4UUSA 3C1DA 3HXLA 1N75A 1TW2A 2XGCA 3LA7A 3PUBA 1IZ1A 1EH8A 3R4KA 3U21A 3F6OA 4GDFA 2IGMA 1ETVA 1QZZA 3HSFA 3RPUA 2X48A 3OS2A 1SD5A 2XHKA 4G6DA 4CH7A 4A3MJ 1ETWA 2HR3A 3TO7A 2DMTA 1YIJI 3K1MA 1T56A 3KCCA 3LA2A 4OINF 1HQCA 1KU3A 3KEOA 4M9XA 4RMNA 3U1KA 2J5OA 3SXYA 5EDNA 5H6RA 2ISZA 2IGNA 2CYYA 2HGCA 3HJEA 2V26A 4AD9A 2CQXA 1R22A 4M9SA 2GQQA 2KMUA 4GGGA 3OYGA 1NK3P 2HYGD 1QPMA 1B4AA 3IKTA 1R23A 2M9HA 4FX4A 2DAOA 1T33A 2WBMA 4NQWB 5JVGF 4KJZA 4XN3A 2DU9A 2A69F 3LMMA 2P6TA 3C18A 3CP2A 1R49A 3HL2A 4E7JA 2RREA 2P7CB 3D0SA 3KP3A 4Y4RA 4Y52J 3HPGA 1I39A 1ZHFA 1QU3A 3DTEA 2QLZA 4A6EA 5KAFC 1P7JA 1G8XA 4D7MA 3IRRA 1R5ID 3H9JA 3PUFA 4AIKA 1OISA 2X1EA 2M4GA 3VSKA 3RKQA 3DPLC 5J8FA 3SEQA 3K7AJ 2LVSA 4RB2C 4YFKF 3OYHA 1LUJB 1LQ1A 2W4SA 1UCRA 2AS5F 1HKQA 5CVJA 1AOYA 1P4WA 2XDVA 1S7EA 3V7CA 3CCJI 2VASA 3ZMUA 5EEHA 4X1EA 4E7HA 1XD7A 1X4OA 3SFZA 1W36C 2R7WA 1G6NA 3R6SA 1IN4A 1QBJA 2VKHA 4D7NA 1VQ6I 3LFUA 5E1XA 1I6XA 5EZGA 4YIFA 3QWLA 1JE8A 3ZXSA 1MGTA 3DCFA 3PIPF 2M0CA 2ADUA 4OAZA 1CGPA 2BXYA 2P7VB 2IRFG 1PJRA 1EJ9A 2DBBA 4QWQA 4AIHA 1T6SA 3LSMA 1NG6A 4LK1F 4YEJA 2EZIA 3L7WA 1V4RA 3F23A 4ENMA 2JPCA 1I1GA 1X3ZB 1W7PA 3NARA 3BR1A 3DBHB 2R7VA 3E5XA 2LKPA 4HOBA 5GAEJ 1BW6A 2QZ8A 3KZIC 4MIMA 4WWCA 1VI0A 2FEZA 2JSCA 4HX4A 2XAFA 2GOXB 5ILSA 1Y0UA 4IVNA 4RAFA 2ZJRF 1ZG1A 4UY8I 1HW1A 2VC0A 1ZKGA 4R79A 1XC5A 3IRQA 3ELKA 2R3SA 1I27A 3NRVA 3GX4X 3BCAA 2VB6A 3D5RC 2XUBA 1N78A 4HX8A 5F6FA 3FXJA 2Q2EA 3K4JA 2L0KA 3H1CA 1YJ9I 5A2QZ 4A3BJ 2RC4A 2A3SA 2NVTJ 2L9VA 1U9OA 4HQMA 1AKHB 4K2EA 3ULQB 4KDPA 3BPVA 1K4TA 2QQ8A 2XAJA 3K9TA 3CUQA 4UXNA 4L9NA 3TKYA 2MD0A 4LITA 1SD6A 3ABLH 1Z7UA 3ZQLA 2M0MA 1B8IA 2EILH 1O3QA 2NS8A 3K4KA 4HQEA 1FMVA 3LA3A 2JN6A 4UVAA 2X1DA 5ICGA 3WTSC 3L2CA 1LDDA 4KMUX 1VQNI 3FDYA 5FO5A 2LC2A 3BC8A 3HBLA 2L54A 1O4XA 4M73A 3VB2A 3M8EA 3CD6I 1GDTA 4EM2A 2E19A 1U2WA 3L00A 4I6ZA 2EV6A 2A07F 2VC1A 3NAUA 1K83J 2B7EA 2LR8A 2GZWA 3RZDJ 5E18F 1IRFA 1KYZA 3Q5FA 3JRGA 2FD5A 2Z99A 1MD0A 3ZQHA 2UXXA 4CCKA 2D45A 4P96A 3AG2H 2F5DA 2ZNZA 3EETA 3E6DA 1ETYA 3RPQA 3WTZA 3N97A 3WG9A 3MVPA 4EGZA 1RUNA 1OCZH 4XICA 1S5LC 4I0AA 3QYEA 2CS3A 4DOZA 2OV7A 2PBIA 3SZTA 2FXAA 3ML6A 2X9DA 3IWZA 4IHVA 2Z33A 1H0MA 2CW7A 2FOKA 3IUOA 3J80Z 4L5IA 2VI6A 1MIJA 4GRIA 1U8BA 3M8JA 3F8BA 3DU6A 4L5EA 2QYOA 5TRDA 4QSHA 2LY9A 3I59A 3MMYB 4LIUA 1IXCA 1FNNA 2DT6A 2L2OA 3S1MJ 4F93B 3D5SC 3ZRGA 4CICA 2WAQN 3CCVI 1JUMA 2EB7A 3A01B 3CLOA 3GTJJ 4CSWA 3V7SA 2NVUB 2N8GA 5ILVA 4I7HA 2FQ3A 2M3AA 3ASOH 4HNUA 1ZREA 3CP8A 2HYJA 2RN7A 4HW0A 3OYBA 1YHQI 2R7FA 2LSOA 2RKHA 3OSFA 1U78A 3G73A 1FSHA 1VZ0A 2HI3A 2OD5A 3GO5A 1EF4A 4A3FJ 4PJNA 1O3SA 2VBWA 3SDGA 5LRRA 2VPRA 3E5QA 1Z21A 3ZQQA 2RAEA 1ZR2A 1ZN2A 1VQKI 5KAIC 1JJ6C 4HF0A 2KRCA 2VT2A 1G59A 3VWBA 4UHTA 2P8TA 5IOYA 3J7ZI 1N77A 4XR6A 4AVZA 1UAAA 3IH4A 1JTXA 3DEUA 3FF5A 3WGHA 3WE2A 1TT5B 2LF8A 3P9CA 1REPC 4YFNF 5HNHA 1X3UA 5JI6A 3VOEA 4XLNF 5DM6F 1U3EM 1MBGA 3SYTA 5IYCJ 3GVAA 2ZXHA 1L0OC 4ZDPA 4RB3C 2ZCWA 1XTAA 5K7HA 2JK3A 1XG1A 1RESA 4W1UA 3WGGA 3E6BA 3DF8A 4XBFA 1RNLA 4AM3A 5ILUA 1WJDA 1HDDC 4RDUA 1U5TA 5AIPA 2CQKA 2E1CA 1NTCA 1IO2A 5HLHA 9ANTA 3T8RA 4RGUA 1XGNA 4P5OA 1W5SA 2DK8A 3A03A 2FSWA 4M9ZA 3JRFA 2FX0A 5FRNA 4B3XA 4BUPA 4KT6A 1LFUP 2V4JC 2Q1ZB 5FKLA 2V7FA 2V1XA 2H09A 1WJFA 1T0FA 3DEEA 4JP0A 1KU9A 2CSOA 2JA5J 4HF2A 4MLOA 1YRNA 4IQ4A 2HOEA 5K7ZA 1X1PA 2DI3A 1Q1VA 2XPWA 1XSDA 4ANJA 3CCUI 3TO9A 3I0TA 3MD2A 1HXDA 1IN5A 1TWHJ 2F4IA 2VKDA 1UB9A 3H3UA 3QPSA 4RAYA 3DP7A 5A2QK 2EV0A 4OAYA 2LP0A 2WV0A 1H89C 1HBXG 4A3GJ 4II2A 2F48A 4UV8A 1B6AA 1BOBA 3OL4A 1QZYA 3MKLA 3PNVA 4G8XA 5D6FA 3HSRA 3ROUA 3CCSI 2MG4A 5D8LB 1QQIA 5FLVA 3CDIA 1YLFA 1F5TA 1HKTA 2HXIA 1E0EA 5LGNA 1O57A 2MSYA 1ZLKA 4BYYA 2Y31A 4M3EA 2B63J 3K70D 5C44J 2PI0A 4EEFG 4MFDA 1JGSA 3KFWX 1K7AA 3PFIA 1FYLA 1G4DA 4JX4A 5HODA 2OJED 4RB0A 2OF7A 3BTLA 4PZJA 3BZKA 1Z7LA 1MMNA 3EYIA 2IS1A 3FBNB 3GYHX 5KNLA 2QKMB 1EH6A 4S04A 1K4SA 3B02A 2O6GE 1GUUA 4CCJA 2DMPA 2EZHA 2LFBA 2R7XA 2O7OA 2GXGA 2JA6J 1I6HJ 3K4CA 3BTCA 2O8KA 3EYYA 3LSIA 3H9QA 3K2ZA 3MKWB 4V2FA 3AG4H 3BLYA 2H8WA 2LKSA 1Y1VJ 3ZMVA 3I4MJ 2KISA 3T0YA 1PP8F 1U9NA 2ELKA 1KU7A 5LEJA 3ZPLA 4RS8A 1JKPC 2EJRA 5FD5A 2IW5A 4FHTA 5FRMA 3F0CA 4N9IA 4LJZF 5IYDJ 4C2MJ 2R5YA 4FETA 1RPWA 3I3LA 3HOVJ 3MEXA 1LVKA 4BAYA 1GVJA 3CLQA 4N4OB 3V4GA 4XMYA 4IRHA 1I50J 2DYSH 4V2GA 1ON1A 1WJBA 2XF5A 1Z3YA 3C7JA 2R5ZA 1V5FA 3QU6A 4BQNA 3C2HA 2Y30A 2KHMA 1FWZA 5LLQA 1YJWI 3H0GJ 2BHYA 1IV8A 4HAMA 4LG0A 1I3AA 3CF5F 1VNDA 2MGQA 3DQVC 1SMTA 2PMUA 3QYBA 3RI4A 1TWGJ 2ZMEA 1S7AA 3EUHA 2CV1A 5TISC 3Q0WA 1DGRM 4MHGA 3AKZA 2LBFA 1LJ9A 1BR2A 1BI2A 2ISYA 4I02A 4PSWA 2DA2A 3C2GA 4QLCU 4M6YA 2H94A 4NC7A 4EV0A 3SZGA 4LIVA 4CGZA 3VYSB 2Q0OA 1BIBA 2NRAC 3FMQA 3HOYJ 1MKMA 4HX7A 4DZJA 3FHNA 5H2FC 1UMQA 1IDYA 1MJBA 2NXNB 2DDAA 1Y56A 4CDGA 1LB2A 2IS2A 3M07A 5DD8A 4XLHA 2M45A 3GTMJ 1G3YA 3E3VA 3L9FA 4BHBA 4C2UA 3WTVC 1P2FA 5FKNA 2VPLA 2EFOA 1WRJA 3QOEA 1FLIA 3IV5A 5CJ9A 1WI9A 2DA5A 2IVMA 3CDLA 3MWMA 1SAXA 3O2PE 3SZPA 3J81K 2JMWA 3S93A 3HOTA 4BE0A 2CG4A 3EPZA 1UHSA 2KJCA 2XB5A 1KYWA 1QO0D 2V79A 1IN7A 2VJ4A 2DDBA 5HS8A 1WJCA 5HS7A 4XRMA 4FQGA 3ABMH 3OYEA 2COBA 4E6KG 1HW2A 4KIBA 1UHMA 2L5QA 1U0JA 3E0JB 5IT9K 4AWXB 2EFPA 2E1MC 3KEYA 5JHFA 5D4RA 1R5GA 1WQ2A 4F3QA 2K5CA 4CA0A 3BP8A 4M6XA 4JBAA 4U87A 2Y0MA 4HSRA 4FE4A 1DQUA 2O8XA 1HLVA 3KZYA 2BYVE 2NAZA 3OIPA 3S3MA 2JA2A 2WY8Q 1P6RA 2VOPA 4C9YA 1MMAA 2L7ZA 2ZSIB 5EGOA 1X4PA 3HZJA 3LAJA 3ZQGA 3RYPA 2CFXA 1IRGA 2Y9ZA 3FXRA 4Y15A 1TW3A 2CMPA 3FMSA 1B72A 2R92J 2DT5A 5M5XJ 4EJOA 1BC7C 3I53A 2XAUA 2XRNA 3OYDA 3S15J 3BWGA 1XSXA 2F5VA 4CUGA 2XPUA 1WWXA 3T5XA 2QCOA 2PX9A 4L0YB 1PVEA 1UG2A 2DOFA 3F8FA 3I71A 4J01A 1RRJA 1X58A 2CO5A 1GV5A 4IRIA 4GFBA 1H9TA 3K69A 3RQ4A 4XNFA 3PQJA 3DLAA 5D5XB 5EEAA 2X0LA 2KIMA 3GTKJ 1USTA 2FMYA 3M1CA 2A5YB 5F27A 1IUYA 2X6XA 2CUJA 4BEHA 2CW0F 4G7OF 2JJ7A 4DYRA 3ISPA 4ENJA 1L3LA 1VQ4I 1XB4A 3KE2A 2KIQA 3WTTC 3HYIA 4BQOA 5K5OA 4WXHA 5DUIA 1S3JA 3HOZJ 2DA7A 2IA1A 3BROA 1T38A 1RUOA 2DOAA 3OIOA 4XLCA 5DD4A 3F8CA 2EH3A 2W24A 2ELHA 3Q3SA 4DYCA 3RPUD 2XVCA 3GFMA 3WHCA 4JQFA 4WK8F 3VODA 3D5LA 1CQTA 3ECOA 3V8JA 2W82A 4B47A 1IV6A 2JT1A 4J19A 4JK1X 2HQNA 2ZBKA 1OKRA 2NOJB 4C30A 3J7AO 3EDPA 1QRYA 1MJ9A 2VBYA 4EQQA 1MDMB 1JJ8C 4CCLA 3GTGJ 1FOXA 3H5RA 2KZGA 1YX5A 2CW8A 3S1RJ 1J5YA 1OR7A 3K70C 3ONQA 3A2KA 2NNYA 3S2HJ 2QQ9A 3H0DA 3RSNA 1X3WB 1WZ2A 2X1CA 3VEPA 1T08B 4HDUA 3LWFA 4BGDA 3JREA 1SFKA 3DV8A 4L9VA 4LB6B 3RTRA 5DDGA 1F9NA 3MZHA 2A6HF 1D0XA 4BQQA 5B1BH 2IS6A 4AIJA 3DKXA 3W3CA 2W25A 1YYVA 1GT0C 2TRTA 4CYCA 1TTYA 2A05A 1IC8A 3MN2A 1FOKA 4CCOA 3RKXA 2JA7J 5J1YA 4BXFA 3WTUC 1GLNA 2UWMA 4PUSA 4C3JJ 1KA8A 2QENA 3G4SI 2LY2A 3FWEA 4XOTA 3RDIA 4BNCA 3SJMA 3A0BC 3ZQCA 3FX3A 3NQOA 2L7FP 1P4AA 4MTDA 3CUOA 1P7IA 4BBSJ 4U0YA 4C3IJ 3GBGA 1IXRC 3BJAA 2F4OB 4XORA 4Q48A 6PAXA 1BJAA 1WSUA 2CJJA 1J0RA 2K40A 1D0YA 5E20A 2E2HJ 2AO9A 1NHAA 2KIFA 2QA4I 2IA2A 1IDZA 2MLGA 3GW2A 1I3QJ 2HFHA 5LGTA 3GLLA 4QTRA 4MNUA 2LOOA 1RI7A 3HHGA 5GPAA 1HF0A 2JA8J 3FBIB 3NWTA 2DFFA 4ZYDA 3ZN0A 3PM1A 1FBUA 3HM5A 3Q9SA 1IG7A 2DQLA 2LG4A 2UUZA 1TZLA 2LNBA 5HDNA 2V6CA 1X2NA 2Z9OA 2JRMA 1BI1A 4M6VA 3G1MA 2DODA 3FMRA 2P4WA 4G6TB 3NWSA 3S2WA 2R93J 2ZXIA 1RKTA 3H3VK 1LEBA 2P5KA 3PFYA 1R36A 4NNJA 3BR6A 3KYCB 4CXFA 5BMZA 5IT3A 1FZPB 3K0LA 5E17F 3BR2A 3W2AA 1JKOC 3GFIA 4BE1A 1VQ7I 4LB5A 2XGXA 4O5VA 2R7TA 1LE8A 1WGXA 3P9KA 5E3NA 1YFHA 2DA4A 4P9FA 5IOZA 2E35A 2JUGA 2P6SA 2WC2A 1Z67A 3RCOA 5K5QA 2V1UA 3JAMZ 2O61A 4I76A 1GXPA 4B3AA 3CJTB 3GLXA 1JI8A 4KN4X 4HNTA 3F21A 3QAHA 2K27A 1QGPA 1XN7A 1P92A 1QNTA 4NDLA 1WH5A 2BV6A 2VQCA 3LSKA 5F1RA 3PL8A 3PSIA 1Z77A 1K78B 2NS0A 2E1MB 5E1ZB 3VSLA 1O3RA 2PFBA 3OYAA 3AL0C 4F92B 1W0TA 1DP7P 4PCQA 2K9LA 3QODA 5K7FA 1U5TB 2CH0A 2LD5A 1JT6A 2F5EA 2ZJQF 2DA6A 2E5NA 4ENNA 1WKMA 1XX5A 4KICA 4B4CA 1X2MA 4PJJA 3AG1H 1JXSA 2RNJA 2L4AA 1HSJA 2K85A 3LQRA 3ZN1A 2F4MB 2L4MA 3UR3C 1KONA 1YW9A 1KQ8A 2WAQA 3WU1B 3FIWA 3K4NA 4KISA 2ZNYA 4LLGF 3DTIA 1JHHA 2CWEA 1CF7A 3K10A 2E1OA 2EWNA 4YIIA 1X1CA 5JHUA 3V8LA 3JRIA 1PP7U 1EH7A 4RGRA 4AYBA 5CYVA 2R0QC 2W00A 5IP7J 1BOAA 4MTEA 4B43A 4RGSA 1GV2A 2F6CA 3CCYA 2ELJA 4BACA 1D1CA 4PSXA 3TO6A 4GYIA 1WPKA 3BPXA 2XGEA 3W2WA 4DIQA 1U8RA 1XSVA 2PEXA 3PO2J 2PG4A 4P1WA 3JTGA 1G3SA 1TLHB 2XF7A 5F04A 5J47A 2PJPA 3CCMI 2ZO4A 2EA4A 5BOXA 4ENKA 2FNAA 2E1NA 2E2JJ 1IRXA 2DMQA 3MKZA 4JOMA 1BA5A 5GP9A 5E3MA 4EJWA 4E7SA 4A3CJ 2H27A 1BI3A 1JGGA 1AHDP 2VQLA 4XRFA 3PQKA 4NQWA 3WTWC 1ZARA 4IF4A 3FXKA 3KLNA 3B6AA 5F0HA 3HOUJ 3I64A 2D1HA 3BQYA 2D2WA 3M1EA 2KL4A 2L7MP 3CJQB 3TBIA 3QRFF 1UHWA 3OR2C 3HEFA 3IH2A 4H0EA 3U2RA 1T98A 1VTNC 4HF1A 3KETA 4XKBA 4M3DA 5CVVA 3KP5A 4L0ZB 3I5UA 3TMOA 2K9SA 2MFZA 3CO7C 1XMKA 4AYBN 2DPUA 1Z05A 2VT3A 1IXSB 1V55H 2DK5A 3BTIA 4M72A 4QPQA 1Z1DA 2DFIA 4G7ZF 3QP5A 1IN6A 4ZJZA 4IOAF 1MMGA 2ZC2A 3ZCOA 1IAWA 3H35A 1B1BA 5GADJ 4W97A 2L9SA 4ESBA 5CVRA 1T39A 3PNYA 3C2BA 2HDDA 4CHUA 5FKKA 5E8GA 3KP2A 5M3FJ 1VFCA 3CMAI 1D5VA 3OMYA 3F72A 4FE7A 1S7OA 3OR1C 3I4PA 4EJUA 2Z3YA 3FXMA 4M3GA 4D5FA 1FYKA 3BY6A 4BH9A 3ZR8X 3JSPA 5HDKA 3S16J 4RLFA 1X19A 1HDPA 1B9NA 3L2WA 3ERMA 4KIFA 1MMSA 2YX4A 1W5CC 2VXDA 1HC8A 2M1BA 4CCNA 2K3FA 2OTJI 1TWFJ 1F43A 2LH9A 1NG7A 3E97A 2M87A 2CV0A 5CVIA 4YIRX 1YITI 2RQPA 3M7GA 2IJLA 4S0HB 2VE9A 3A1YA 2GBYA 1MNEA 1RZ4A 4IOCF 4IEJA 2F2EA 4PK4A 3GZ6A 4MO7A 5L3CA 3MCZA 1WCMJ 1BJZA 2DCEA 5JR3A 3DBRB 2NOGA 2CUFA 5FFZA 3R60A 1D1AA 1HW5A 5FROA 3S2DJ 1OYYA 2H6BA 3I9V2 5KK1A 2OCEA 1AKHA 1ZGJA 2BGCA 2PMZA 2E71A 1PUEE 4D5CA 3IAM2 3OWTA 2QM3A 3CDHA 2ESHA 3QP6A 5J40A 2MW8A 3IKVA 2RV8A 1J9IA 3G2BA 5C4XJ 2O3FA 3GEZA 2XC7A 2R7ZJ 3H36A 4FISA 3IAS2 1A6QA 2K3PA 2M2EA 2MA3A 1RR8C 2FMLA 3HHHA 2KP6A 2L3DA 1VQLI 3BZ6A 4KNYA 1DGWY 2VODA 3HRMA 3CZ6A 5FGMA 3LAPA 2B9SA 2X6YA 3ZMSA 1T95A 3CUQC 1KQ9A 2DPDA 4P9UA 1WVRA 2G9WA 4I0BA 4UB8C 2O9LA 4IQJA 2EFNA 3O8HA 2DO7A 4O6JA 2DLLA 2YR2A 3WU0A 3ZOBA 2EBIA 3OIQA 2YUSA 4J00A 3W6VA 4O3MA 5AIQA 4A3DJ 3HUGB 1QVTA 3S8PA 4EM1A 3TP0A 3RYRA 2Y2ZA 4LD5A 2ZJPF 3E5UA 2PLYA 1SC7A 3ZGKA 3AL0B 3H92A 2E7WA 2PMZN 3W6JB 3U1DA 2K02A 4BU2A 1GVDA 2K9MA 3LSHA 1J59A 1J75A 4M74A 4PGHA 1N25A 1FIAA 1S8NA 2YU9J 3JRCA 3CO6C 2NNNA 4X0GA 1ACIA 3AG3H 2HOSA 1A04A 3DWLE 3HPHA 1SANA 1LFBA 2IGKA 3K4BA 4EJVA 2MH9A 3A01A 2LTPA 3J80K 1Z91A 2H1LA 1A5JA 4UUTA 3BT9A 4CCMA 2OPTA 3GWZA 1Z0XA 4BY1J 2JPBA 3HRUA 5KCMA 1XGSA 4G12A 1VQPI 4LGWA 3PJRA 5K1YA 1SVMA 1X1DA 1UZCA 1GXQA 1OCCH 4N0BA 2HKXA 4UVBA 2JSPA 1FEXA 5JFRA 1RKWA 4XK4A 3WTXC 1R4NB 4U7DA 3KYDB 2X51A 3CCLI 3H9GA 2EA2A 1Z6RA 2X85A 5L3GA 3P5JA 1JKQC 1JUSA 1WH7A 5D4SA 4F55A 3K2AA 4EATA 2E5ZA 5D6EA 2VBXA 3HB9A 3GTPJ 4WX9A 3C3WA 4RGXA 5CQEA 1FPQA 5B5EC 3CQZJ 3OL3A 2OC6A 3J7YJ 4Y33A 2GAUA 2E2IJ 1ULYA 1Y0NA 5DYMA 3QQAA 4UUSB 3LSJA 1ETXA 4Q47A 1VQOI 3E7LA 5CLSA 2WAFA 3DPTA 1NK2P 3IH3A 1HCRA 2GLOA 2GIVA 4MQVA 2XSDC 2XROA 5FFXA 1Y8RB 4U0VA 1AWCA 3GTLJ 1R00A 1TBXA 3JRAA 1A31A 2HPMA 3W6KB 4BE2A 2LLKA 4NC8A 5M5YJ 3R0JA 2FBKA 4MGRA 2KRFA 4CYCB 4HBLA 3E6MA 4ZC3A 2CFOA 2LKXA 2K9QA 3Q0VA 3CC2I 3R0AA 5HLTA 1D8KA 1HKSA 1R4MB 2KPMA 3H5NA 3OYFA 4KIGA 4G9YA 3K6GA 2FA5A 3G1LA 4DW6A 1YO5C 4XIDA 2X6WA 4DNCA 3GZNB 2Z16A 2Y69H 4BBRJ 1YIOA 2CV2A 2EIMH 4XM3A 3T1BA 4FTHA 2H1KA 3FHZA 4Z2YA 1ZRCA 2UV1A 5IYBJ 2WADA 1U5TC 1PYVA 3F8NA 1TQMA 4DZPA 4CO8A 2R7QA 3LOCA 2XSJC 4XRSA 4AIDA 3FM3A 3EQLF 4AC0A 1S9HA 4E7KA 4ITVA 3JSOA 2NVQJ 3P7NA 4A0ZA 1SFUA 2ESNA 1FMWA 2DFHA 1D5YA 5AONA 3AFHA 1XS9A 1T0FC 2HZTA 3DFGA 1ZK8A 5ED4A 2GXBA 3HOWJ 4LG3A 3OS1A 1SEUA 1FTTA 2D5VA 1A6IA 2GIZA 2V1DA 1LKXA 3HDDA 1X1BA 1QHGA 2ZXJA 4JX5A 3QOPA 3QPHA 2HXOA 2K7LA 4JYKA 4TV7A 3S14J 1IF1A 3LSGA 1WHUA 2PQ8A 4ZYHA 4PFOA 3K1PA 1ODDA 5CVUA 2M4KA 2E34A 1V3FA 2M34A 4I01A 3HIFA 3K4MA 4XL9A 4BXUA 2VJ5A 2LDUA 4A5NA 3UKGA 5HLIA 2CUZA 3G1OA 4ESJA 4DJAA 5LHHA 1EKEA 2RQQA 1MNMC 4HA8A 5J6XA 2K4BA 5JLWA 1KU2A 2YX7A 3CCQI 1MZBA 3GXOA 4WCGA 1XGMA 3KP7A 4KT5C 3J7AY 1T8IA 3T8TA 2LMDA 3BR0A 3GTQJ 4BDYA 2GM4A 3BZCA 1MBJA 1W7PB 3IWFA 1R71A 4NC6A 4G94A 3TEDA 3JRBA 3G6EI 2ME6A 4XLFA 3F6VA 2W57A 1R6RA 2P5LC 1BW5A 1VQ8I 4D1QA 4P55A 2DA3A 5FD6A 1BBYA 4OIQF 2A61A 4UB6C 1V5GA 1E3HA 4HEA2 1D3YA 2LY1A 2XAHA 4XKCA 4HLYA 2KT0A 2I10A 4NB5A 2G0EA 2I5UA 2Q2EB 3QYFA 4Q4ZF 2M7AA 3OYCA 5JVTA 3WGIA 3OYKA 1K79A 1VF9A 4XLPF 1G2HA 4B44A 1BR1A 2OAZA 2WAEA 2OZUA 3S32A 2IT0A 2EFQA 2O5RA 3A02A 2ZB9A 3HRSA 1T2KA 3CUQB 2HOAA 3OOPA 3HGGA 2OU2A 4X6AJ 2QBYA 4MFEA 3OYIA 1B8IB 2JRTA 4F91B 3BJ6A 3PNTA 5FLMJ 2JWTA 1XCVA 2HQRA 4BKXA 2DA1A 4DBQA 3WHBA 3BR3A 3G3ZA 5D5UB 1QPIA 2ZXWH 1KQ0A 4DBRA 2L01A 3LFKA 2BY2A 2VE8A 2IGOA 4A3EJ 2TCTA 1Z3XA 2I8DA 1W0UA 1POGA 4OU0A 4DQ2A 1OCTC 2RVCA 2XF6A 1MNDA 4RLQA 3TGNA 2W1OA 1FIPA 3KYLA 5DCFA 2QQBA 2ZMEC 2COMA 3EUHC 1LEAA 5F0CA 1BR4A 2LRDA 3RIRA 2LYCA 5FJ8J 3RJPA 1MH4A 1OMIA 3QPLA 4E7IA 2WV1A 4L18B 4L9JA 4IL6C 4I98B 3ZMZA 5ICEA 3OYLA 4LLLA 3GCMA 5EG0A 3BG9A 4B48A 2R7SA 2FU4A 3DXJF 4Y7NJ 3MZYA 4HDVA 1H88C 5EZHA 3B73A 1IN8A 2EZKA 1FBQA 4BJTA 2FE3A 1BN5A 3N05A 1WJ5A 4XLAA 3CC4I 2BW3A 4Y3OA 5H20A 4ESFA 5DCMA 1XMXA 1W1WE 3ZMDA 3G71I 3WTYC 3CF2A 4XKVA 3QU3A 1W7PD 2CQQA 3I59B 5TGTA 2ZSHB 4M3BA 4HPQA 4PFPA 4XONA 2Z2SB 5BNGA 4A6DA 4A3KJ 2A68F 3LSRA 3F22A 4IKFA 3N4MA 2XKOA 4XKWA 1FP1D 3Q0UA 1UG0A 4KN7X 1FP2A 2QEXI 1G3TA 3ECHA 3CMEI 1Y1WJ 3JCUC 3BG7A 5L3DA 4UV9A 2AQEA 2VOOA 3EUKL 2BHZA 4HZFA 3IL2A 4HYEA 4ZTFA 1LDKB 2L7KA 4F52A 4OMYA 4LMYA 2ME0A 1O7LA 1LVAA 2KZVA 2YSRA 3SQNA 3JR9A 1YQAA 4MEXF 3HTSB 3OSGA 4R8HA 2Z1DA 4LOCA 4CYDA 4KYWA 1MW7A 1P4XA 4KA4A 4YELA 2WWYA 1S29A 1RETA 1YE9A 3V8KA 3ZQ7A 1ONVA 2GA2A 4BXXJ 1FX7A 1FOWA 3WODF 3FXOA 4KITB 5L3BA 4ZDLA 3CMYA 1ETKA 4IHTA 4XN0A 2A6EF 2VL8A 2BY1A 4FX0A 4EVIA 1E3OC 3BDDA 2V6EA 2CGPA 3E6CC 3KLOA 2HOTA 2JUCA 3ESWB 2KDZA 2M8GX 3JW4A 3RKWA 2FRHA 5HLGA 1LDJA 2DMNA 2FF4A 1Q1HA 4OIOF 2XRLA 2V9PA 3VFZA 5FKOA 4ETSA 2C6YA 4PJ0C 1STZA 1WJEA 4II3A 2H6CA 4OOIA 3ABKH 3KP4A 2EPFA 1Y8QB 2B0LA 5BPDA 4XLEA 2DXIA 1M1EB 1JT0A 4A93J 2WB1A 2AXTC 2JQ7A 1BIAA 2XAQA 1FOYA 4UNOA 1TL8A 4BY7J 5HS9A 4EMSA 1DP3A 2CQNA 4L5JA 4N4NB 5F64A 1MBKA 1W5TA 2PJRA 2FBHA 5J1UA 2DT7B 3BCBA 1R9TJ 1MDMA 1YRNB 2HVRA 4FCYA 2QSFX 4OWRB 1MJAA 2DFEA 3NEUA 2ZJ2A 3CC7I 1DU6A 2F5CA 2G7UA 3H5AA 1PUFA 3ZMTA 5F1JA 1ZTRA 1JTYA 4M71A 4A5MA 2MLKA 2KLOA 3FXQA 4RM2A 1OLTA 4S05A 2BY3A 1OJLA 4G6QA 2AHQA 3WG7H 3LSPA 3VYUB 4R1HA 3ERED 4A3LJ 5HVQC 2MBFA 3KZZA
chains in the Genus database with same CATH topology
3OYEA 4FASD 3FKJA 4E6KG 4RMNA 3IAS2 2K3PA 4HSTA 3VYRB 2IGNA 2V1NA 2L5QA 1U0JA 2V26A 3E0JB 2KP6A 3IP4B 2E1MC 3KEYA 5JHFA 2KMUA 3OYGA 4F3QA 2K5CA 5CKTA 4CA0A 4PJMA 1DGWY 4PJLA 3CZ6A 1OR7C 4U87A 3BG6A 4HSRA 4IX7A 1AA7A 2X6YA 1T95A 1DQUA 2WBMA 4NQWB 4BL0B 4KJZA 4XN3A 4E4HA 3LMMA 3CP2A 3OIPA 3S3MA 2JA2A 4HG2A 4IQJA 2WY8Q 3HL2A 4E7JA 2RREA 4Y4RA 3HPGA 1QU3A 3DTEA 1MMAA 2ZSIB 2R4GA 4C9YA 3OIQA 1EA3A 1X4PA 4J00A 2HNHA 1G8XA 2CMPA 4AU7A 4C2TA 3H9JA 3HUGB 3E1SA 2X1EA 2XAUA 2M4GA 3HC7A 3S8PA 3VSKA 3OYDA 4E7LA 3DPLC 3SEQA 2HVSA 2F5VA 4CUGA 3OYHA 2W4SA 3ZGKA 3AL0B 2XDVA 3SDBA 2OUMA 4BU2A 3MKYB 2K9MA 2VASA 3LSHA 3OYMA 4J01A 2L9NA 4E7HA 1X4OA 2BOLA 4X0GA 2VJIA 1W36C 2R7WA 5KHDA 3RQ4A 2VKHA 3DWLE 3DLAA 3HPHA 4XNFA 2IGKA 3K4BA 3LFUA 2AQFA 3CJRB 4NUBA 3M1CA 3ZXSA 2X6XA 4ZTJA 2CUJA 4BEHA 4CCMA 4OAZA 1PJRA 5KCMA 4D9JA 3LSMA 2A5WA 1NG6A 2MYSA 4YEJA 5HOOA 2VJJA 4BQOA 3PJRA 3KX2A 2R7VA 1X1DA 1TT0A 2JSPA 3K4LA 3F9KA 2DOAA 4XLCA 2GOXB 2LBFB 3OYJA 3RPUD 2X51A 4JQFA 4R79A 3V42A 3D5LA 3H9GA 3BCAA 2X85A 2VB6A 2RNGA 2W82A 4B47A 3D5RC 3SEZA 4F55A 1N78A 2NOJB 4C30A 4EATA 2E5ZA 3K4JA 1WJAA 3TL4X 4CCLA 5CQEA 3H5RA 3OL3A 1SAUA 1WFXA 2OC6A 4Y33A 1YX5A 3DTKA 2CW8A 3A4CA 3K70C 3ONQA 3A2KA 2WAFA 3DPTA 2MD0A 4LITA 3W2VA 3H0DA 3RSNA 2M0MA 2X1CA 4BGDA 1SFKA 2HPMA 3K4KA 1FMVA 4BE2A 4NC8A 1HA8A 3RTRA 2P0WA 3HKZA 2X1DA 1D0XA 2MC4A 4BQQA 2IS6A 3DKXA 3FDYA 3W3CA 4ZC3A 2CFOA 4RM3A 2LC2A 3BC8A 5HLTA 2E60A 2KPMA 1Y6IA 3H5NA 2M7BA 3OYFA 4CCOA 4ZYAA 4BDZA 4BXFA 3K6GA 1GLNA 2X6WA 2UWMA 2Z16A 4PUSA 2CV2A 4XM3A 3OYNA 2LY2A 4XOTA 2GOMA 2UV1A 2WADA 1PYVA 2R7QA 3GBGA 1UELB 4CCKA 2LREA 2XSJC 3CMMA 4XORA 4E7KA 1S9HA 4ITVA 2HVQA 1LFPA 1FMWA 1D0YA 1P9QC 3AFHA 1T0FC 4LG3A 3OS1A 3QYEA 2V9KA 2LOOA 2CS3A 1LKXA 2DJIA 2HPIA 4DOZA 2OV7A 1X1BA 1QHGA 1X1AA 3L2VA 3FBIB 2CW7A 3NWTA 3IUOA 2BVLA 2VXZA 4GRIA 3LSGA 2HU9A 3M8JA 1MMDA 3DU6A 4PFOA 3MMYB 4LIUA 2VQGA 2DT6A 2LG4A 2UUZA 1TZLA 2L2OA 4F93B 3D5SC 3ZRGA 2M4KA 2VQHA 3K4MA 4XL9A 2VJ5A 3HOSA 2A6TA 4G6TB 2CUZA 3NWSA 2ZXIA 4DJAA 4CSWA 2RQQA 3PFYA 2M3AA 4NNJA 4HNUA 4BEHB 2R7OA 3CP8A 3OYBA 3W2AA 3J7AY 4BDYA 2R7RA 1VZ0A 4BE1A 5CQGA 2R7TA 4CZCA 4PJNA 2HZDA 4QPOA 2JUGA 1Z21A 5LFAA 3ZQQA 4E7ZA 4XLFA 3RCOA 1R6RA 3VWBA 2KRCA 1G59A 1JI8A 4HNTA 4D1QA 4YRVA 1N77A 1D0ZA 4XR6A 4AVZA 1UAAA 1V5GA 5LD2C 4HEA2 2LY1A 4XKCA 5HNHA 2VQCA 3LSKA 3S3NA 3PL8A 2Q2EB 3PSIA 3SYTA 2VIXA 3QYFA 3OYCA 2M7AA 2ZXHA 4ZDPA 3OYKA 1ZELA 2E1MB 4B44A 1BR1A 2WAEA 3VSLA 4BJ6C 3S32A 3OYAA 3AL0C 2O5RA 4F92B 3L2QA 2K9LA 3QODA 2CH0A 4IZZA 1WJDA 2E5NA 4PJJA 2HDWA 3UNGC 3DU5A 3OYIA 4F91B 1W36D 3PNTA 4XQFA 2HQAA 4P5OA 3UR3C 1KONA 5FRNA 4B3XA 4BUPA 4DBQA 4KT6A 5CPRB 2V4JC 2WAQA 2Q1ZB 3K4NA 4KISA 4BS9A 3DTIA 2V7FA 4DBRA 2BVMA 1WJFA 3K10A 3DEEA 2IGOA 2KRHA 1Z3XA 2I8DA 4MLOA 1X1CA 4IQ4A 3S3OA 2XF6A 1MNDA 4RLQA 4AYBA 2W1OA 2W00A 4ANJA 1YX3A 3KYLA 4B43A 3MD2A 3EUHC 2F4IA 2VKDA 1BR4A 2LRDA 2F6CA 4BJ5C 2LYCA 4OAYA 2ELJA 4BACA 1D1CA 4E7IA 4II2A 4PSXA 2WY7Q 1BOBA 2KQRA 3OL4A 3PNVA 3W2WA 4DIQA 3OYLA 4P1WA 4B48A 2XF7A 2R7SA 3L2RA 3DKYA 2BW3B 4BJTA 1E0EA 3N05A 2VLAA 1IRXA 1WJ5A 4XLAA 2BW3A 4Y3OA 3MKZA 4JOMA 3L2UA 3CF2A 4XKVA 3K70D 4E7SA 5HNFA 5TGTA 2ZSHB 2VQLA 3HG9A 4HPQA 4PFPA 4H4KC 3EUAA 4XONA 2Z2SB 3LL7A 4DGWB 1Z7LA 1MMNA 2IS1A 3CESA 3FBNB 4IKFA 5KNLA 2QKMB 4XKWA 4HRIA 1UG0A 2KL4A 3CJQB 3TBIA 3OR2C 4CCJA 3BG7A 2R7XA 2AQEA 4XKBA 3EUKL 4ZTFA 3K4CA 3LSIA 3TMOA 3H9QA 2MFZA 1LDKB 2L7KA 2Y0SA 4F52A 4U7BA 3MKWB 2WA0A 4QPQA 2KZVA 3BLYA 4ZJZA 2QKLB 2Z1DA 1MMGA 3ZCOA 1MW7A 3H35A 2L9SA 4YELA 2IXSA 1YE9A 3PNYA 2MABA 5FRMA 4ZDOA 4KITB 1QHHD 4FETA 3I3LA 1LVKA 3OMYA 4ZDLA 4N4OB 4XN0A 3OR1C 4XMYA 2VL8A 2V6EA 1WJBA 2XF5A 1V5EA 1Z3YA 1J09A 3ZR8X 2ZFUA 2W7NA 1V5FA 4RLFA 3DPUA 4BQNA 3C2HA 1X19A 2KHMA 3L2WA 2JVHA 2VXDA 3PSFA 3DQVC 3QYBA 4CCNA 4II3A 1WJEA 2IS4A 2LH9A 2CV1A 1NG7A 1DGRM 4XLEA 2DXIA 3VDXA 3AKZA 2CV0A 2LBFA 2WB1A 1BR2A 4PSWA 3C2GA 1K6YA 4NC7A 3SZGA 3A1YA 4LIVA 1D1BA 3VYSB 1MNEA 2PJRB 1DP3A 4PK4A 3FHNA 2FUG2 4XOPA 4N4NB 2PJRA 1Y56A 2KDOA 2IS2A 2R7UA 2DCEA 2DT7B 3BCBA 3OS0A 4XLHA 1D1AA 2JVGA 5FROA 2HVRA 4C2UA 1ERDA 3OOUA 4OWRB 3I9V2 2VPLA 3QOEA 3OY9A 3H5AA 3VYTB 2PMZA 3HXLA 1N75A 3PUBA 3U21A 3IAM2 3OWTA 2KLOA 3S93A 3HOTA 4BE0A 2IGMA 3EPZA 4RM2A 1OLTA 3OS2A 4CH7A 3VYUB 2VJ4A 1WJCA 5HVQC 3G2BA 2XC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A Y;  2V7F A; 
#chains in the Genus database with same CATH topology
 4FAS D;  3FKJ A;  2AXL A;  3I56 I;  4HST A;  3VYR B;  1KGS A;  2NS7 A;  3DKW A;  2V1N A;  2Q8K A;  1VQ5 I;  3HSE A;  4F7Z A;  3IP4 B;  3WU2 C;  5GAH J;  2VN2 A;  5E1W A;  1BC8 C;  3S1N J;  5CKT A;  2XKP A;  3IHU A;  4PJM A;  3H3Z A;  4ZYE A;  2FBI A;  4PJL A;  1OR7 C;  1G3W A;  3BG6 A;  4IX7 A;  1AA7 A;  2ID6 A;  3A0H C;  3CCR I;  1TC3 C;  4BL0 B;  3BTJ A;  2WB1 N;  3BR5 A;  4E4H A;  3PIO F;  4LLN A;  4HG2 A;  1APL C;  1FC3 A;  1E17 A;  3JTH A;  4GXO A;  1ZLJ A;  4GYG A;  2L02 A;  2R4G A;  1H9G A;  4CZZ A;  1EA3 A;  3HOX J;  2BZT A;  5DEQ A;  2HNH A;  4AU7 A;  4C2T A;  1LPQ A;  1DUX C;  3E1S A;  1GHC A;  1ZRD A;  2P5V A;  5IPA A;  3TDZ C;  3HC7 A;  4I09 A;  2STT A;  4E7L A;  1OCO H;  1MBF A;  1ON2 A;  1QA6 A;  3FM5 A;  2HVS A;  4KMF A;  4G7H F;  2XPV A;  2DOE A;  1JUP A;  4IXA A;  4YG2 F;  4B09 A;  3FIS A;  3IC7 A;  3SDB A;  2ACJ A;  2OUM A;  3MKY B;  1XDU A;  1FJL A;  4N9H A;  1DU0 A;  1B59 A;  3OYM A;  2L9N A;  1TWA J;  2PMH A;  3M9A A;  2BBY A;  2BOL A;  4MEY F;  2VJI A;  3O8G A;  1QVU A;  5KHD A;  2R5Y B;  3KP6 A;  5J3L A;  4BHC A;  4ZYG A;  2HYF A;  2AQF A;  5LGU A;  1E3P A;  3CJR B;  1S6L A;  4NUB A;  5ICC A;  4ZTJ A;  1SFX A;  1DPU A;  3L1P A;  2R5Z B;  3V7R A;  1NH3 A;  2OQG A;  3X2Q H;  1SD4 A;  4D9J A;  1QZE A;  2A5W A;  2J5P A;  2MYS A;  5HOO A;  2VJJ A;  3VPR A;  2XAS A;  4LG0 B;  2ETH A;  1TP4 A;  2BXZ A;  3KX2 A;  3QPT A;  4WF2 A;  4ASN A;  1MH3 A;  1SVL A;  2ZME B;  3BG5 A;  3I58 A;  1TT0 A;  2Y9Y A;  3ZQI A;  4EJT A;  3K4L A;  3F9K A;  2XAG A;  1H8A C;  2LBF B;  2Y48 A;  3Q9V A;  3OYJ A;  1SFO J;  4C3H J;  3SFI A;  4A2U A;  1W4M A;  2K86 A;  2YU3 A;  5J4V A;  1YG2 A;  1ZAO A;  3V42 A;  3WE3 A;  3BG3 A;  2RNG A;  3SEZ A;  4D0P A;  2IBD A;  2DJN A;  2DYR H;  3JAM K;  2EQR A;  2EIJ H;  2ECC A;  3GZ5 A;  1OPC A;  5F0F A;  3REO A;  5LHG A;  3J81 Z;  1WJA A;  1K78 A;  3TL4 X;  3M3Y J;  3COA C;  5H6Q A;  1OYI A;  2PN6 A;  4LFU A;  4A69 C;  1SAU A;  1WFX A;  4QIW N;  3R61 A;  1UFM A;  2EIK H;  3FZV A;  4UVC A;  3DTK A;  1KZH A;  3A4C A;  1OCP A;  2OZ6 A;  4UUV A;  1OYW A;  2QQA A;  1A35 A;  3W2V A;  3ZQF A;  1DPR A;  1RR7 A;  1ITY A;  5IT9 Z;  2OBP A;  3RKY A;  1SD7 A;  1HA8 A;  3DLL F;  2P0W A;  3HKZ A;  1TQI A;  1ZG3 A;  2MC4 A;  1O7F A;  2DTZ A;  2BEO A;  4BHP A;  4E70 A;  4KUM A;  4Z6Y A;  5E8I A;  4RM3 A;  2IA0 A;  1ENH A;  4IRG A;  2CU7 A;  2E60 A;  4IHS A;  1Y6I A;  1ZYR F;  2M7B A;  3MAJ A;  2DW4 A;  4ZYA A;  4BDZ A;  5LHI A;  1HOM A;  5LRS A;  3GUD A;  3OYN A;  5FLX Z;  2GOM A;  1IW7 F;  3F8M A;  2QUF A;  1JHF A;  4ZZL A;  2NVX J;  4YFX F;  5KVR A;  5ERI A;  3HRT A;  1IGN A;  1UEL B;  4GCV A;  4WXD A;  2LRE A;  5LEK A;  5EGO B;  3RZO J;  1U6G A;  1ORK A;  3CMM A;  5D8K B;  3FK7 A;  2ZKZ A;  5DTD A;  1DDN A;  3KIO A;  3BOQ A;  4RAG A;  2HS5 A;  2E36 A;  2HVQ A;  1Z9C A;  3I55 I;  1LFP A;  1B72 B;  1P9Q C;  2MD5 A;  1YW8 A;  3BJO A;  1YJN I;  4WXC A;  2V9K A;  3I54 A;  1ZR4 A;  2DJI A;  2HPI A;  2IEK A;  4ABZ A;  4IHX A;  1X1A A;  3L2V A;  1OCR H;  2EIN H;  4I2O A;  2BVL A;  2VXZ A;  2X4H A;  2HU9 A;  5E3L A;  1MMD A;  4OMZ A;  2VON A;  2VQG A;  1BI0 A;  2XGD A;  1XDS A;  3TOB A;  3D1N I;  3S17 J;  4HV6 A;  1TNS A;  5GAG J;  1K61 A;  2VQH A;  4U88 A;  3HKZ N;  2VUM J;  3PO3 J;  3DEW A;  3HOS A;  2A6T A;  2IPQ X;  2V9V A;  4AVP A;  2YPR A;  3ABU A;  1FY7 A;  4Q5S F;  5D5W B;  3B6C A;  2XB0 X;  1OFC X;  1UJ8 A;  3MQ0 A;  4KFC A;  4BEH B;  4V19 K;  2TDX A;  3MZ8 A;  4OIR F;  2CQ7 A;  2R7O A;  3FXU A;  2FOW A;  2HDC A;  2Z5U A;  1MSF C;  1VQ9 I;  1VQM I;  3ZP5 A;  4RAZ A;  2R7R A;  4PGG A;  1MSE C;  4XSX F;  3S1Q J;  5CQG A;  2MC3 A;  4AUX A;  1SMY F;  4CZC A;  3LNQ A;  1BL0 A;  2HZD A;  1SFE A;  1FYM A;  2XV4 S;  4QPO A;  3U9G A;  1RIO H;  5LFA A;  4E7Z A;  4PDK A;  3FXL A;  3GF2 A;  2G7H A;  4OIP F;  1TNT A;  2NVY J;  2HTJ A;  2MH2 A;  4YRV A;  3TW7 A;  1D0Z A;  3TQN A;  5IP6 A;  1C0W A;  1R1U A;  3RQI A;  4L9T A;  5LD2 C;  3SHF A;  1FT9 A;  1SVO A;  2OA4 A;  5IY5 H;  1ETQ A;  1S72 I;  5EEG A;  5TJJ A;  1YS7 A;  3M4O J;  1D8J A;  3S3N A;  5DV5 A;  4M3F A;  5C3E J;  2VIX A;  4LK0 F;  3GTO J;  2QF7 A;  5ICF A;  2FJ1 A;  3KEQ A;  1ZEL A;  1ETO A;  4BJ6 C;  3O3K A;  5K5R A;  1WI3 A;  3L09 A;  4A3J J;  2ZFW A;  3L2Q A;  3KPH A;  4MQ9 F;  1J2X A;  2KJB A;  2QBY B;  2DQR A;  4XSZ F;  4IZZ A;  3GFL A;  2KFD A;  2FNP A;  2STW A;  1JKR C;  1IRZ A;  2HDW A;  2P81 A;  3UNG C;  5E3O A;  2ID3 A;  1ZGA A;  2OTL I;  3DU5 A;  5J4Y A;  5E79 C;  3MFK A;  1W36 D;  1FSE A;  4HLX A;  4XQF A;  4IO9 F;  1PDN C;  2HQA A;  3DBL B;  1A36 A;  5DS9 A;  5CPR B;  2ECB A;  2VKE A;  4DYQ A;  2W48 A;  3ABT A;  1EV7 A;  4BS9 A;  3LQQ A;  2BVM A;  5L3E A;  5B66 C;  2GWR A;  4ON0 A;  2KRH A;  1E2X A;  1XGO A;  2ICW G;  2QSH X;  4B8X A;  3S3O A;  1YI2 I;  2EZL A;  2IAI A;  2OQR A;  2QGU A;  4XRS G;  2W84 A;  2DMU A;  2E7X A;  4A0Y A;  2BE5 F;  1I1S A;  1YX3 A;  5HDG A;  1J7K A;  3GFJ A;  5D5V B;  1TWC J;  4RBO A;  2EV5 A;  2CRG A;  2QVO A;  3JRH A;  4BJ5 C;  1YTY A;  5C4J J;  1O3T A;  5EF6 A;  2WY7 Q;  1R5H A;  5EG0 B;  2KQR A;  4RB1 A;  1HST A;  5EJC A;  3JRD A;  2RDP A;  2EFW A;  1R58 A;  3AAF A;  2RGV A;  2HQ5 A;  3L2R A;  3DKY A;  5M3M J;  2BW3 B;  5DCM B;  1K6O A;  3TW6 A;  4HNV A;  2VLA A;  4EGY A;  1YS6 A;  2M5W A;  4GO1 A;  1OQY A;  5J1R A;  5FKM A;  3O6B B;  5GPC A;  4Y13 A;  2L9R A;  2K9N A;  3L2U A;  1R1T A;  2D1V A;  5HNF A;  3TOA A;  1Z6T A;  3HG9 A;  3TDU C;  2HTS A;  3I4N J;  4H4K C;  3EUA A;  5EYR A;  5DUK A;  3LL7 A;  4DGW B;  4BQA A;  2FQ4 A;  2GA1 A;  5B1A H;  3CES A;  1ZGW A;  2HEO A;  1FBS A;  2VKV A;  3FK6 A;  2O0Y A;  2VBZ A;  4HRI A;  4IHW A;  5FLX K;  3HTU A;  2KKO A;  2M8E A;  1XMA A;  2LK2 A;  4I99 C;  2YS9 A;  2GXA A;  4IPA A;  2EK5 A;  4A12 A;  1B9M A;  1IJW C;  2QSG X;  3HUG A;  3BQZ A;  5LBQ A;  3TP3 A;  4EM0 B;  3F3X A;  4JX6 A;  1LNW A;  1RC9 A;  2Y0S A;  4U7B A;  3CJN A;  1MBH A;  1LE8 B;  1Y39 A;  2WA0 A;  4IHY A;  2F5F A;  2H8R A;  2O03 A;  2OCC H;  2QKL B;  4NHJ A;  2UZK A;  2R7D A;  5IP9 J;  1XPX A;  2JTV A;  2IXS A;  3CCE I;  2JZY A;  2MAB A;  3K1N A;  2DN0 A;  4ZDO A;  1FTZ A;  3P9I A;  1ZQ3 P;  1AU7 A;  5GTI C;  1QHH D;  3FKI J;  4B1R A;  4RA2 A;  2LF7 A;  4HV5 A;  5F08 A;  4IJA A;  4ZH4 F;  1R7J A;  4U0W A;  5DM7 F;  4FT8 A;  1F36 A;  5BQT A;  1V5E A;  1J09 A;  2ZFU A;  2WTE A;  2W7N A;  2K4J A;  3DPU A;  3ASN H;  2X6O A;  2UXN A;  1YW7 A;  1F1Z A;  2JVH A;  3PSF A;  3M8F A;  1USS A;  1YOV B;  2IS4 A;  5BPI A;  4Y17 A;  3VDX A;  2Y75 A;  2IP2 A;  2DTR A;  1BM9 A;  1K6Y A;  1D1B A;  4ZZD A;  1IUF A;  2PJR B;  1XCB A;  2HWV A;  2KIU A;  2XIG A;  3LST A;  2QWW A;  4A3I J;  1I5Z A;  1F4K A;  5GTH C;  2CUE A;  2FUG 2;  2M30 A;  4XOP A;  1CF7 B;  5JLX A;  4A0X A;  1ZRF A;  2Y0S N;  3OV8 A;  2KDO A;  2R7U A;  2HKO A;  3HGY A;  3OS0 A;  2BY0 A;  1V54 H;  2JVG A;  2W85 A;  3CTA A;  2NYX A;  1TQP A;  3OOU A;  1PUF B;  1ERD A;  3GME A;  1R1V A;  5FB2 A;  5B3S H;  5M5W J;  1ZG5 A;  5BS6 A;  3OY9 A;  5J8C A;  1ZH5 A;  4NBQ A;  1MBE A;  3VYT B;  5L3F A;  4UUS A;  3C1D A;  3HXL A;  1N75 A;  1TW2 A;  2XGC A;  3LA7 A;  3PUB A;  1IZ1 A;  1EH8 A;  3R4K A;  3U21 A;  3F6O A;  4GDF A;  2IGM A;  1ETV A;  1QZZ A;  3HSF A;  3RPU A;  2X48 A;  3OS2 A;  1SD5 A;  2XHK A;  4G6D A;  4CH7 A;  4A3M J;  1ETW A;  2HR3 A;  3TO7 A;  2DMT A;  1YIJ I;  3K1M A;  1T56 A;  3KCC A;  3LA2 A;  4OIN F;  1HQC A;  1KU3 A;  3KEO A;  4M9X A;  4RMN A;  3U1K A;  2J5O A;  3SXY A;  5EDN A;  5H6R A;  2ISZ A;  2IGN A;  2CYY A;  2HGC A;  3HJE A;  2V26 A;  4AD9 A;  2CQX A;  1R22 A;  4M9S A;  2GQQ A;  2KMU A;  4GGG A;  3OYG A;  1NK3 P;  2HYG D;  1QPM A;  1B4A A;  3IKT A;  1R23 A;  2M9H A;  4FX4 A;  2DAO A;  1T33 A;  2WBM A;  4NQW B;  5JVG F;  4KJZ A;  4XN3 A;  2DU9 A;  2A69 F;  3LMM A;  2P6T A;  3C18 A;  3CP2 A;  1R49 A;  3HL2 A;  4E7J A;  2RRE A;  2P7C B;  3D0S A;  3KP3 A;  4Y4R A;  4Y52 J;  3HPG A;  1I39 A;  1ZHF A;  1QU3 A;  3DTE A;  2QLZ A;  4A6E A;  5KAF C;  1P7J A;  1G8X A;  4D7M A;  3IRR A;  1R5I D;  3H9J A;  3PUF A;  4AIK A;  1OIS A;  2X1E A;  2M4G A;  3VSK A;  3RKQ A;  3DPL C;  5J8F A;  3SEQ A;  3K7A J;  2LVS A;  4RB2 C;  4YFK F;  3OYH A;  1LUJ B;  1LQ1 A;  2W4S A;  1UCR A;  2AS5 F;  1HKQ A;  5CVJ A;  1AOY A;  1P4W A;  2XDV A;  1S7E A;  3V7C A;  3CCJ I;  2VAS A;  3ZMU A;  5EEH A;  4X1E A;  4E7H A;  1XD7 A;  1X4O A;  3SFZ A;  1W36 C;  2R7W A;  1G6N A;  3R6S A;  1IN4 A;  1QBJ A;  2VKH A;  4D7N A;  1VQ6 I;  3LFU A;  5E1X A;  1I6X A;  5EZG A;  4YIF A;  3QWL A;  1JE8 A;  3ZXS A;  1MGT A;  3DCF A;  3PIP F;  2M0C A;  2ADU A;  4OAZ A;  1CGP A;  2BXY A;  2P7V B;  2IRF G;  1PJR A;  1EJ9 A;  2DBB A;  4QWQ A;  4AIH A;  1T6S A;  3LSM A;  1NG6 A;  4LK1 F;  4YEJ A;  2EZI A;  3L7W A;  1V4R A;  3F23 A;  4ENM A;  2JPC A;  1I1G A;  1X3Z B;  1W7P A;  3NAR A;  3BR1 A;  3DBH B;  2R7V A;  3E5X A;  2LKP A;  4HOB A;  5GAE J;  1BW6 A;  2QZ8 A;  3KZI C;  4MIM A;  4WWC A;  1VI0 A;  2FEZ A;  2JSC A;  4HX4 A;  2XAF A;  2GOX B;  5ILS A;  1Y0U A;  4IVN A;  4RAF A;  2ZJR F;  1ZG1 A;  4UY8 I;  1HW1 A;  2VC0 A;  1ZKG A;  4R79 A;  1XC5 A;  3IRQ A;  3ELK A;  2R3S A;  1I27 A;  3NRV A;  3GX4 X;  3BCA A;  2VB6 A;  3D5R C;  2XUB A;  1N78 A;  4HX8 A;  5F6F A;  3FXJ A;  2Q2E A;  3K4J A;  2L0K A;  3H1C A;  1YJ9 I;  5A2Q Z;  4A3B J;  2RC4 A;  2A3S A;  2NVT J;  2L9V A;  1U9O A;  4HQM A;  1AKH B;  4K2E A;  3ULQ B;  4KDP A;  3BPV A;  1K4T A;  2QQ8 A;  2XAJ A;  3K9T A;  3CUQ A;  4UXN A;  4L9N A;  3TKY A;  2MD0 A;  4LIT A;  1SD6 A;  3ABL H;  1Z7U A;  3ZQL A;  2M0M A;  1B8I A;  2EIL H;  1O3Q A;  2NS8 A;  3K4K A;  4HQE A;  1FMV A;  3LA3 A;  2JN6 A;  4UVA A;  2X1D A;  5ICG A;  3WTS C;  3L2C A;  1LDD A;  4KMU X;  1VQN I;  3FDY A;  5FO5 A;  2LC2 A;  3BC8 A;  3HBL A;  2L54 A;  1O4X A;  4M73 A;  3VB2 A;  3M8E A;  3CD6 I;  1GDT A;  4EM2 A;  2E19 A;  1U2W A;  3L00 A;  4I6Z A;  2EV6 A;  2A07 F;  2VC1 A;  3NAU A;  1K83 J;  2B7E A;  2LR8 A;  2GZW A;  3RZD J;  5E18 F;  1IRF A;  1KYZ A;  3Q5F A;  3JRG A;  2FD5 A;  2Z99 A;  1MD0 A;  3ZQH A;  2UXX A;  4CCK A;  2D45 A;  4P96 A;  3AG2 H;  2F5D A;  2ZNZ A;  3EET A;  3E6D A;  1ETY A;  3RPQ A;  3WTZ A;  3N97 A;  3WG9 A;  3MVP A;  4EGZ A;  1RUN A;  1OCZ H;  4XIC A;  1S5L C;  4I0A A;  3QYE A;  2CS3 A;  4DOZ A;  2OV7 A;  2PBI A;  3SZT A;  2FXA A;  3ML6 A;  2X9D A;  3IWZ A;  4IHV A;  2Z33 A;  1H0M A;  2CW7 A;  2FOK A;  3IUO A;  3J80 Z;  4L5I A;  2VI6 A;  1MIJ A;  4GRI A;  1U8B A;  3M8J A;  3F8B A;  3DU6 A;  4L5E A;  2QYO A;  5TRD A;  4QSH A;  2LY9 A;  3I59 A;  3MMY B;  4LIU A;  1IXC A;  1FNN A;  2DT6 A;  2L2O A;  3S1M J;  4F93 B;  3D5S C;  3ZRG A;  4CIC A;  2WAQ N;  3CCV I;  1JUM A;  2EB7 A;  3A01 B;  3CLO A;  3GTJ J;  4CSW A;  3V7S A;  2NVU B;  2N8G A;  5ILV A;  4I7H A;  2FQ3 A;  2M3A A;  3ASO H;  4HNU A;  1ZRE A;  3CP8 A;  2HYJ A;  2RN7 A;  4HW0 A;  3OYB A;  1YHQ I;  2R7F A;  2LSO A;  2RKH A;  3OSF A;  1U78 A;  3G73 A;  1FSH A;  1VZ0 A;  2HI3 A;  2OD5 A;  3GO5 A;  1EF4 A;  4A3F J;  4PJN A;  1O3S A;  2VBW A;  3SDG A;  5LRR A;  2VPR A;  3E5Q A;  1Z21 A;  3ZQQ A;  2RAE A;  1ZR2 A;  1ZN2 A;  1VQK I;  5KAI C;  1JJ6 C;  4HF0 A;  2KRC A;  2VT2 A;  1G59 A;  3VWB A;  4UHT A;  2P8T A;  5IOY A;  3J7Z I;  1N77 A;  4XR6 A;  4AVZ A;  1UAA A;  3IH4 A;  1JTX A;  3DEU A;  3FF5 A;  3WGH A;  3WE2 A;  1TT5 B;  2LF8 A;  3P9C A;  1REP C;  4YFN F;  5HNH A;  1X3U A;  5JI6 A;  3VOE A;  4XLN F;  5DM6 F;  1U3E M;  1MBG A;  3SYT A;  5IYC J;  3GVA A;  2ZXH A;  1L0O C;  4ZDP A;  4RB3 C;  2ZCW A;  1XTA A;  5K7H A;  2JK3 A;  1XG1 A;  1RES A;  4W1U A;  3WGG A;  3E6B A;  3DF8 A;  4XBF A;  1RNL A;  4AM3 A;  5ILU A;  1WJD A;  1HDD C;  4RDU A;  1U5T A;  5AIP A;  2CQK A;  2E1C A;  1NTC A;  1IO2 A;  5HLH A;  9ANT A;  3T8R A;  4RGU A;  1XGN A;  4P5O A;  1W5S A;  2DK8 A;  3A03 A;  2FSW A;  4M9Z A;  3JRF A;  2FX0 A;  5FRN A;  4B3X A;  4BUP A;  4KT6 A;  1LFU P;  2V4J C;  2Q1Z B;  5FKL A;  2V7F A;  2V1X A;  2H09 A;  1WJF A;  1T0F A;  3DEE A;  4JP0 A;  1KU9 A;  2CSO A;  2JA5 J;  4HF2 A;  4MLO A;  1YRN A;  4IQ4 A;  2HOE A;  5K7Z A;  1X1P A;  2DI3 A;  1Q1V A;  2XPW A;  1XSD A;  4ANJ A;  3CCU I;  3TO9 A;  3I0T A;  3MD2 A;  1HXD A;  1IN5 A;  1TWH J;  2F4I A;  2VKD A;  1UB9 A;  3H3U A;  3QPS A;  4RAY A;  3DP7 A;  5A2Q K;  2EV0 A;  4OAY A;  2LP0 A;  2WV0 A;  1H89 C;  1HBX G;  4A3G J;  4II2 A;  2F48 A;  4UV8 A;  1B6A A;  1BOB A;  3OL4 A;  1QZY A;  3MKL A;  3PNV A;  4G8X A;  5D6F A;  3HSR A;  3ROU A;  3CCS I;  2MG4 A;  5D8L B;  1QQI A;  5FLV A;  3CDI A;  1YLF A;  1F5T A;  1HKT A;  2HXI A;  1E0E A;  5LGN A;  1O57 A;  2MSY A;  1ZLK A;  4BYY A;  2Y31 A;  4M3E A;  2B63 J;  3K70 D;  5C44 J;  2PI0 A;  4EEF G;  4MFD A;  1JGS A;  3KFW X;  1K7A A;  3PFI A;  1FYL A;  1G4D A;  4JX4 A;  5HOD A;  2OJE D;  4RB0 A;  2OF7 A;  3BTL A;  4PZJ A;  3BZK A;  1Z7L A;  1MMN A;  3EYI A;  2IS1 A;  3FBN B;  3GYH X;  5KNL A;  2QKM B;  1EH6 A;  4S04 A;  1K4S A;  3B02 A;  2O6G E;  1GUU A;  4CCJ A;  2DMP A;  2EZH A;  2LFB A;  2R7X A;  2O7O A;  2GXG A;  2JA6 J;  1I6H J;  3K4C A;  3BTC A;  2O8K A;  3EYY A;  3LSI A;  3H9Q A;  3K2Z A;  3MKW B;  4V2F A;  3AG4 H;  3BLY A;  2H8W A;  2LKS A;  1Y1V J;  3ZMV A;  3I4M J;  2KIS A;  3T0Y A;  1PP8 F;  1U9N A;  2ELK A;  1KU7 A;  5LEJ A;  3ZPL A;  4RS8 A;  1JKP C;  2EJR A;  5FD5 A;  2IW5 A;  4FHT A;  5FRM A;  3F0C A;  4N9I A;  4LJZ F;  5IYD J;  4C2M J;  2R5Y A;  4FET A;  1RPW A;  3I3L A;  3HOV J;  3MEX A;  1LVK A;  4BAY A;  1GVJ A;  3CLQ A;  4N4O B;  3V4G A;  4XMY A;  4IRH A;  1I50 J;  2DYS H;  4V2G A;  1ON1 A;  1WJB A;  2XF5 A;  1Z3Y A;  3C7J A;  2R5Z A;  1V5F A;  3QU6 A;  4BQN A;  3C2H A;  2Y30 A;  2KHM A;  1FWZ A;  5LLQ A;  1YJW I;  3H0G J;  2BHY A;  1IV8 A;  4HAM A;  4LG0 A;  1I3A A;  3CF5 F;  1VND A;  2MGQ A;  3DQV C;  1SMT A;  2PMU A;  3QYB A;  3RI4 A;  1TWG J;  2ZME A;  1S7A A;  3EUH A;  2CV1 A;  5TIS C;  3Q0W A;  1DGR M;  4MHG A;  3AKZ A;  2LBF A;  1LJ9 A;  1BR2 A;  1BI2 A;  2ISY A;  4I02 A;  4PSW A;  2DA2 A;  3C2G A;  4QLC U;  4M6Y A;  2H94 A;  4NC7 A;  4EV0 A;  3SZG A;  4LIV A;  4CGZ A;  3VYS B;  2Q0O A;  1BIB A;  2NRA C;  3FMQ A;  3HOY J;  1MKM A;  4HX7 A;  4DZJ A;  3FHN A;  5H2F C;  1UMQ A;  1IDY A;  1MJB A;  2NXN B;  2DDA A;  1Y56 A;  4CDG A;  1LB2 A;  2IS2 A;  3M07 A;  5DD8 A;  4XLH A;  2M45 A;  3GTM J;  1G3Y A;  3E3V A;  3L9F A;  4BHB A;  4C2U A;  3WTV C;  1P2F A;  5FKN A;  2VPL A;  2EFO A;  1WRJ A;  3QOE A;  1FLI A;  3IV5 A;  5CJ9 A;  1WI9 A;  2DA5 A;  2IVM A;  3CDL A;  3MWM A;  1SAX A;  3O2P E;  3SZP A;  3J81 K;  2JMW A;  3S93 A;  3HOT A;  4BE0 A;  2CG4 A;  3EPZ A;  1UHS A;  2KJC A;  2XB5 A;  1KYW A;  1QO0 D;  2V79 A;  1IN7 A;  2VJ4 A;  2DDB A;  5HS8 A;  1WJC A;  5HS7 A;  4XRM A;  4FQG A;  3ABM H;  3OYE A;  2COB A;  4E6K G;  1HW2 A;  4KIB A;  1UHM A;  2L5Q A;  1U0J A;  3E0J B;  5IT9 K;  4AWX B;  2EFP A;  2E1M C;  3KEY A;  5JHF A;  5D4R A;  1R5G A;  1WQ2 A;  4F3Q A;  2K5C A;  4CA0 A;  3BP8 A;  4M6X A;  4JBA A;  4U87 A;  2Y0M A;  4HSR A;  4FE4 A;  1DQU A;  2O8X A;  1HLV A;  3KZY A;  2BYV E;  2NAZ A;  3OIP A;  3S3M A;  2JA2 A;  2WY8 Q;  1P6R A;  2VOP A;  4C9Y A;  1MMA A;  2L7Z A;  2ZSI B;  5EGO A;  1X4P A;  3HZJ A;  3LAJ A;  3ZQG A;  3RYP A;  2CFX A;  1IRG A;  2Y9Z A;  3FXR A;  4Y15 A;  1TW3 A;  2CMP A;  3FMS A;  1B72 A;  2R92 J;  2DT5 A;  5M5X J;  4EJO A;  1BC7 C;  3I53 A;  2XAU A;  2XRN A;  3OYD A;  3S15 J;  3BWG A;  1XSX A;  2F5V A;  4CUG A;  2XPU A;  1WWX A;  3T5X A;  2QCO A;  2PX9 A;  4L0Y B;  1PVE A;  1UG2 A;  2DOF A;  3F8F A;  3I71 A;  4J01 A;  1RRJ A;  1X58 A;  2CO5 A;  1GV5 A;  4IRI A;  4GFB A;  1H9T A;  3K69 A;  3RQ4 A;  4XNF A;  3PQJ A;  3DLA A;  5D5X B;  5EEA A;  2X0L A;  2KIM A;  3GTK J;  1UST A;  2FMY A;  3M1C A;  2A5Y B;  5F27 A;  1IUY A;  2X6X A;  2CUJ A;  4BEH A;  2CW0 F;  4G7O F;  2JJ7 A;  4DYR A;  3ISP A;  4ENJ A;  1L3L A;  1VQ4 I;  1XB4 A;  3KE2 A;  2KIQ A;  3WTT C;  3HYI A;  4BQO A;  5K5O A;  4WXH A;  5DUI A;  1S3J A;  3HOZ J;  2DA7 A;  2IA1 A;  3BRO A;  1T38 A;  1RUO A;  2DOA A;  3OIO A;  4XLC A;  5DD4 A;  3F8C A;  2EH3 A;  2W24 A;  2ELH A;  3Q3S A;  4DYC A;  3RPU D;  2XVC A;  3GFM A;  3WHC A;  4JQF A;  4WK8 F;  3VOD A;  3D5L A;  1CQT A;  3ECO A;  3V8J A;  2W82 A;  4B47 A;  1IV6 A;  2JT1 A;  4J19 A;  4JK1 X;  2HQN A;  2ZBK A;  1OKR A;  2NOJ B;  4C30 A;  3J7A O;  3EDP A;  1QRY A;  1MJ9 A;  2VBY A;  4EQQ A;  1MDM B;  1JJ8 C;  4CCL A;  3GTG J;  1FOX A;  3H5R A;  2KZG A;  1YX5 A;  2CW8 A;  3S1R J;  1J5Y A;  1OR7 A;  3K70 C;  3ONQ A;  3A2K A;  2NNY A;  3S2H J;  2QQ9 A;  3H0D A;  3RSN A;  1X3W B;  1WZ2 A;  2X1C A;  3VEP A;  1T08 B;  4HDU A;  3LWF A;  4BGD A;  3JRE A;  1SFK A;  3DV8 A;  4L9V A;  4LB6 B;  3RTR A;  5DDG A;  1F9N A;  3MZH A;  2A6H F;  1D0X A;  4BQQ A;  5B1B H;  2IS6 A;  4AIJ A;  3DKX A;  3W3C A;  2W25 A;  1YYV A;  1GT0 C;  2TRT A;  4CYC A;  1TTY A;  2A05 A;  1IC8 A;  3MN2 A;  1FOK A;  4CCO A;  3RKX A;  2JA7 J;  5J1Y A;  4BXF A;  3WTU C;  1GLN A;  2UWM A;  4PUS A;  4C3J J;  1KA8 A;  2QEN A;  3G4S I;  2LY2 A;  3FWE A;  4XOT A;  3RDI A;  4BNC A;  3SJM A;  3A0B C;  3ZQC A;  3FX3 A;  3NQO A;  2L7F P;  1P4A A;  4MTD A;  3CUO A;  1P7I A;  4BBS J;  4U0Y A;  4C3I J;  3GBG A;  1IXR C;  3BJA A;  2F4O B;  4XOR A;  4Q48 A;  6PAX A;  1BJA A;  1WSU A;  2CJJ A;  1J0R A;  2K40 A;  1D0Y A;  5E20 A;  2E2H J;  2AO9 A;  1NHA A;  2KIF A;  2QA4 I;  2IA2 A;  1IDZ A;  2MLG A;  3GW2 A;  1I3Q J;  2HFH A;  5LGT A;  3GLL A;  4QTR A;  4MNU A;  2LOO A;  1RI7 A;  3HHG A;  5GPA A;  1HF0 A;  2JA8 J;  3FBI B;  3NWT A;  2DFF A;  4ZYD A;  3ZN0 A;  3PM1 A;  1FBU A;  3HM5 A;  3Q9S A;  1IG7 A;  2DQL A;  2LG4 A;  2UUZ A;  1TZL A;  2LNB A;  5HDN A;  2V6C A;  1X2N A;  2Z9O A;  2JRM A;  1BI1 A;  4M6V A;  3G1M A;  2DOD A;  3FMR A;  2P4W A;  4G6T B;  3NWS A;  3S2W A;  2R93 J;  2ZXI A;  1RKT A;  3H3V K;  1LEB A;  2P5K A;  3PFY A;  1R36 A;  4NNJ A;  3BR6 A;  3KYC B;  4CXF A;  5BMZ A;  5IT3 A;  1FZP B;  3K0L A;  5E17 F;  3BR2 A;  3W2A A;  1JKO C;  3GFI A;  4BE1 A;  1VQ7 I;  4LB5 A;  2XGX A;  4O5V A;  2R7T A;  1LE8 A;  1WGX A;  3P9K A;  5E3N A;  1YFH A;  2DA4 A;  4P9F A;  5IOZ A;  2E35 A;  2JUG A;  2P6S A;  2WC2 A;  1Z67 A;  3RCO A;  5K5Q A;  2V1U A;  3JAM Z;  2O61 A;  4I76 A;  1GXP A;  4B3A A;  3CJT B;  3GLX A;  1JI8 A;  4KN4 X;  4HNT A;  3F21 A;  3QAH A;  2K27 A;  1QGP A;  1XN7 A;  1P92 A;  1QNT A;  4NDL A;  1WH5 A;  2BV6 A;  2VQC A;  3LSK A;  5F1R A;  3PL8 A;  3PSI A;  1Z77 A;  1K78 B;  2NS0 A;  2E1M B;  5E1Z B;  3VSL A;  1O3R A;  2PFB A;  3OYA A;  3AL0 C;  4F92 B;  1W0T A;  1DP7 P;  4PCQ A;  2K9L A;  3QOD A;  5K7F A;  1U5T B;  2CH0 A;  2LD5 A;  1JT6 A;  2F5E A;  2ZJQ F;  2DA6 A;  2E5N A;  4ENN A;  1WKM A;  1XX5 A;  4KIC A;  4B4C A;  1X2M A;  4PJJ A;  3AG1 H;  1JXS A;  2RNJ A;  2L4A A;  1HSJ A;  2K85 A;  3LQR A;  3ZN1 A;  2F4M B;  2L4M A;  3UR3 C;  1KON A;  1YW9 A;  1KQ8 A;  2WAQ A;  3WU1 B;  3FIW A;  3K4N A;  4KIS A;  2ZNY A;  4LLG F;  3DTI A;  1JHH A;  2CWE A;  1CF7 A;  3K10 A;  2E1O A;  2EWN A;  4YII A;  1X1C A;  5JHU A;  3V8L A;  3JRI A;  1PP7 U;  1EH7 A;  4RGR A;  4AYB A;  5CYV A;  2R0Q C;  2W00 A;  5IP7 J;  1BOA A;  4MTE A;  4B43 A;  4RGS A;  1GV2 A;  2F6C A;  3CCY A;  2ELJ A;  4BAC A;  1D1C A;  4PSX A;  3TO6 A;  4GYI A;  1WPK A;  3BPX A;  2XGE A;  3W2W A;  4DIQ A;  1U8R A;  1XSV A;  2PEX A;  3PO2 J;  2PG4 A;  4P1W A;  3JTG A;  1G3S A;  1TLH B;  2XF7 A;  5F04 A;  5J47 A;  2PJP A;  3CCM I;  2ZO4 A;  2EA4 A;  5BOX A;  4ENK A;  2FNA A;  2E1N A;  2E2J J;  1IRX A;  2DMQ A;  3MKZ A;  4JOM A;  1BA5 A;  5GP9 A;  5E3M A;  4EJW A;  4E7S A;  4A3C J;  2H27 A;  1BI3 A;  1JGG A;  1AHD P;  2VQL A;  4XRF A;  3PQK A;  4NQW A;  3WTW C;  1ZAR A;  4IF4 A;  3FXK A;  3KLN A;  3B6A A;  5F0H A;  3HOU J;  3I64 A;  2D1H A;  3BQY A;  2D2W A;  3M1E A;  2KL4 A;  2L7M P;  3CJQ B;  3TBI A;  3QRF F;  1UHW A;  3OR2 C;  3HEF A;  3IH2 A;  4H0E A;  3U2R A;  1T98 A;  1VTN C;  4HF1 A;  3KET A;  4XKB A;  4M3D A;  5CVV A;  3KP5 A;  4L0Z B;  3I5U A;  3TMO A;  2K9S A;  2MFZ A;  3CO7 C;  1XMK A;  4AYB N;  2DPU A;  1Z05 A;  2VT3 A;  1IXS B;  1V55 H;  2DK5 A;  3BTI A;  4M72 A;  4QPQ A;  1Z1D A;  2DFI A;  4G7Z F;  3QP5 A;  1IN6 A;  4ZJZ A;  4IOA F;  1MMG A;  2ZC2 A;  3ZCO A;  1IAW A;  3H35 A;  1B1B A;  5GAD J;  4W97 A;  2L9S A;  4ESB A;  5CVR A;  1T39 A;  3PNY A;  3C2B A;  2HDD A;  4CHU A;  5FKK A;  5E8G A;  3KP2 A;  5M3F J;  1VFC A;  3CMA I;  1D5V A;  3OMY A;  3F72 A;  4FE7 A;  1S7O A;  3OR1 C;  3I4P A;  4EJU A;  2Z3Y A;  3FXM A;  4M3G A;  4D5F A;  1FYK A;  3BY6 A;  4BH9 A;  3ZR8 X;  3JSP A;  5HDK A;  3S16 J;  4RLF A;  1X19 A;  1HDP A;  1B9N A;  3L2W A;  3ERM A;  4KIF A;  1MMS A;  2YX4 A;  1W5C C;  2VXD A;  1HC8 A;  2M1B A;  4CCN A;  2K3F A;  2OTJ I;  1TWF J;  1F43 A;  2LH9 A;  1NG7 A;  3E97 A;  2M87 A;  2CV0 A;  5CVI A;  4YIR X;  1YIT I;  2RQP A;  3M7G A;  2IJL A;  4S0H B;  2VE9 A;  3A1Y A;  2GBY A;  1MNE A;  1RZ4 A;  4IOC F;  4IEJ A;  2F2E A;  4PK4 A;  3GZ6 A;  4MO7 A;  5L3C A;  3MCZ A;  1WCM J;  1BJZ A;  2DCE A;  5JR3 A;  3DBR B;  2NOG A;  2CUF A;  5FFZ A;  3R60 A;  1D1A A;  1HW5 A;  5FRO A;  3S2D J;  1OYY A;  2H6B A;  3I9V 2;  5KK1 A;  2OCE A;  1AKH A;  1ZGJ A;  2BGC A;  2PMZ A;  2E71 A;  1PUE E;  4D5C A;  3IAM 2;  3OWT A;  2QM3 A;  3CDH A;  2ESH A;  3QP6 A;  5J40 A;  2MW8 A;  3IKV A;  2RV8 A;  1J9I A;  3G2B A;  5C4X J;  2O3F A;  3GEZ A;  2XC7 A;  2R7Z J;  3H36 A;  4FIS A;  3IAS 2;  1A6Q A;  2K3P A;  2M2E A;  2MA3 A;  1RR8 C;  2FML A;  3HHH A;  2KP6 A;  2L3D A;  1VQL I;  3BZ6 A;  4KNY A;  1DGW Y;  2VOD A;  3HRM A;  3CZ6 A;  5FGM A;  3LAP A;  2B9S A;  2X6Y A;  3ZMS A;  1T95 A;  3CUQ C;  1KQ9 A;  2DPD A;  4P9U A;  1WVR A;  2G9W A;  4I0B A;  4UB8 C;  2O9L A;  4IQJ A;  2EFN A;  3O8H A;  2DO7 A;  4O6J A;  2DLL A;  2YR2 A;  3WU0 A;  3ZOB A;  2EBI A;  3OIQ A;  2YUS A;  4J00 A;  3W6V A;  4O3M A;  5AIQ A;  4A3D J;  3HUG B;  1QVT A;  3S8P A;  4EM1 A;  3TP0 A;  3RYR A;  2Y2Z A;  4LD5 A;  2ZJP F;  3E5U A;  2PLY A;  1SC7 A;  3ZGK A;  3AL0 B;  3H92 A;  2E7W A;  2PMZ N;  3W6J B;  3U1D A;  2K02 A;  4BU2 A;  1GVD A;  2K9M A;  3LSH A;  1J59 A;  1J75 A;  4M74 A;  4PGH A;  1N25 A;  1FIA A;  1S8N A;  2YU9 J;  3JRC A;  3CO6 C;  2NNN A;  4X0G A;  1ACI A;  3AG3 H;  2HOS A;  1A04 A;  3DWL E;  3HPH A;  1SAN A;  1LFB A;  2IGK A;  3K4B A;  4EJV A;  2MH9 A;  3A01 A;  2LTP A;  3J80 K;  1Z91 A;  2H1L A;  1A5J A;  4UUT A;  3BT9 A;  4CCM A;  2OPT A;  3GWZ A;  1Z0X A;  4BY1 J;  2JPB A;  3HRU A;  5KCM A;  1XGS A;  4G12 A;  1VQP I;  4LGW A;  3PJR A;  5K1Y A;  1SVM A;  1X1D A;  1UZC A;  1GXQ A;  1OCC H;  4N0B A;  2HKX A;  4UVB A;  2JSP A;  1FEX A;  5JFR A;  1RKW A;  4XK4 A;  3WTX C;  1R4N B;  4U7D A;  3KYD B;  2X51 A;  3CCL I;  3H9G A;  2EA2 A;  1Z6R A;  2X85 A;  5L3G A;  3P5J A;  1JKQ C;  1JUS A;  1WH7 A;  5D4S A;  4F55 A;  3K2A A;  4EAT A;  2E5Z A;  5D6E A;  2VBX A;  3HB9 A;  3GTP J;  4WX9 A;  3C3W A;  4RGX A;  5CQE A;  1FPQ A;  5B5E C;  3CQZ J;  3OL3 A;  2OC6 A;  3J7Y J;  4Y33 A;  2GAU A;  2E2I J;  1ULY A;  1Y0N A;  5DYM A;  3QQA A;  4UUS B;  3LSJ A;  1ETX A;  4Q47 A;  1VQO I;  3E7L A;  5CLS A;  2WAF A;  3DPT A;  1NK2 P;  3IH3 A;  1HCR A;  2GLO A;  2GIV A;  4MQV A;  2XSD C;  2XRO A;  5FFX A;  1Y8R B;  4U0V A;  1AWC A;  3GTL J;  1R00 A;  1TBX A;  3JRA A;  1A31 A;  2HPM A;  3W6K B;  4BE2 A;  2LLK A;  4NC8 A;  5M5Y J;  3R0J A;  2FBK A;  4MGR A;  2KRF A;  4CYC B;  4HBL A;  3E6M A;  4ZC3 A;  2CFO A;  2LKX A;  2K9Q A;  3Q0V A;  3CC2 I;  3R0A A;  5HLT A;  1D8K A;  1HKS A;  1R4M B;  2KPM A;  3H5N A;  3OYF A;  4KIG A;  4G9Y A;  3K6G A;  2FA5 A;  3G1L A;  4DW6 A;  1YO5 C;  4XID A;  2X6W A;  4DNC A;  3GZN B;  2Z16 A;  2Y69 H;  4BBR J;  1YIO A;  2CV2 A;  2EIM H;  4XM3 A;  3T1B A;  4FTH A;  2H1K A;  3FHZ A;  4Z2Y A;  1ZRC A;  2UV1 A;  5IYB J;  2WAD A;  1U5T C;  1PYV A;  3F8N A;  1TQM A;  4DZP A;  4CO8 A;  2R7Q A;  3LOC A;  2XSJ C;  4XRS A;  4AID A;  3FM3 A;  3EQL F;  4AC0 A;  1S9H A;  4E7K A;  4ITV A;  3JSO A;  2NVQ J;  3P7N A;  4A0Z A;  1SFU A;  2ESN A;  1FMW A;  2DFH A;  1D5Y A;  5AON A;  3AFH A;  1XS9 A;  1T0F C;  2HZT A;  3DFG A;  1ZK8 A;  5ED4 A;  2GXB A;  3HOW J;  4LG3 A;  3OS1 A;  1SEU A;  1FTT A;  2D5V A;  1A6I A;  2GIZ A;  2V1D A;  1LKX A;  3HDD A;  1X1B A;  1QHG A;  2ZXJ A;  4JX5 A;  3QOP A;  3QPH A;  2HXO A;  2K7L A;  4JYK A;  4TV7 A;  3S14 J;  1IF1 A;  3LSG A;  1WHU A;  2PQ8 A;  4ZYH A;  4PFO A;  3K1P A;  1ODD A;  5CVU A;  2M4K A;  2E34 A;  1V3F A;  2M34 A;  4I01 A;  3HIF A;  3K4M A;  4XL9 A;  4BXU A;  2VJ5 A;  2LDU A;  4A5N A;  3UKG A;  5HLI A;  2CUZ A;  3G1O A;  4ESJ A;  4DJA A;  5LHH A;  1EKE A;  2RQQ A;  1MNM C;  4HA8 A;  5J6X A;  2K4B A;  5JLW A;  1KU2 A;  2YX7 A;  3CCQ I;  1MZB A;  3GXO A;  4WCG A;  1XGM A;  3KP7 A;  4KT5 C;  3J7A Y;  1T8I A;  3T8T A;  2LMD A;  3BR0 A;  3GTQ J;  4BDY A;  2GM4 A;  3BZC A;  1MBJ A;  1W7P B;  3IWF A;  1R71 A;  4NC6 A;  4G94 A;  3TED A;  3JRB A;  3G6E I;  2ME6 A;  4XLF A;  3F6V A;  2W57 A;  1R6R A;  2P5L C;  1BW5 A;  1VQ8 I;  4D1Q A;  4P55 A;  2DA3 A;  5FD6 A;  1BBY A;  4OIQ F;  2A61 A;  4UB6 C;  1V5G A;  1E3H A;  4HEA 2;  1D3Y A;  2LY1 A;  2XAH A;  4XKC A;  4HLY A;  2KT0 A;  2I10 A;  4NB5 A;  2G0E A;  2I5U A;  2Q2E B;  3QYF A;  4Q4Z F;  2M7A A;  3OYC A;  5JVT A;  3WGI A;  3OYK A;  1K79 A;  1VF9 A;  4XLP F;  1G2H A;  4B44 A;  1BR1 A;  2OAZ A;  2WAE A;  2OZU A;  3S32 A;  2IT0 A;  2EFQ A;  2O5R A;  3A02 A;  2ZB9 A;  3HRS A;  1T2K A;  3CUQ B;  2HOA A;  3OOP A;  3HGG A;  2OU2 A;  4X6A J;  2QBY A;  4MFE A;  3OYI A;  1B8I B;  2JRT A;  4F91 B;  3BJ6 A;  3PNT A;  5FLM J;  2JWT A;  1XCV A;  2HQR A;  4BKX A;  2DA1 A;  4DBQ A;  3WHB A;  3BR3 A;  3G3Z A;  5D5U B;  1QPI A;  2ZXW H;  1KQ0 A;  4DBR A;  2L01 A;  3LFK A;  2BY2 A;  2VE8 A;  2IGO A;  4A3E J;  2TCT A;  1Z3X A;  2I8D A;  1W0U A;  1POG A;  4OU0 A;  4DQ2 A;  1OCT C;  2RVC A;  2XF6 A;  1MND A;  4RLQ A;  3TGN A;  2W1O A;  1FIP A;  3KYL A;  5DCF A;  2QQB A;  2ZME C;  2COM A;  3EUH C;  1LEA A;  5F0C A;  1BR4 A;  2LRD A;  3RIR A;  2LYC A;  5FJ8 J;  3RJP A;  1MH4 A;  1OMI A;  3QPL A;  4E7I A;  2WV1 A;  4L18 B;  4L9J A;  4IL6 C;  4I98 B;  3ZMZ A;  5ICE A;  3OYL A;  4LLL A;  3GCM A;  5EG0 A;  3BG9 A;  4B48 A;  2R7S A;  2FU4 A;  3DXJ F;  4Y7N J;  3MZY A;  4HDV A;  1H88 C;  5EZH A;  3B73 A;  1IN8 A;  2EZK A;  1FBQ A;  4BJT A;  2FE3 A;  1BN5 A;  3N05 A;  1WJ5 A;  4XLA A;  3CC4 I;  2BW3 A;  4Y3O A;  5H20 A;  4ESF A;  5DCM A;  1XMX A;  1W1W E;  3ZMD A;  3G71 I;  3WTY C;  3CF2 A;  4XKV A;  3QU3 A;  1W7P D;  2CQQ A;  3I59 B;  5TGT A;  2ZSH B;  4M3B A;  4HPQ A;  4PFP A;  4XON A;  2Z2S B;  5BNG A;  4A6D A;  4A3K J;  2A68 F;  3LSR A;  3F22 A;  4IKF A;  3N4M A;  2XKO A;  4XKW A;  1FP1 D;  3Q0U A;  1UG0 A;  4KN7 X;  1FP2 A;  2QEX I;  1G3T A;  3ECH A;  3CME I;  1Y1W J;  3JCU C;  3BG7 A;  5L3D A;  4UV9 A;  2AQE A;  2VOO A;  3EUK L;  2BHZ A;  4HZF A;  3IL2 A;  4HYE A;  4ZTF A;  1LDK B;  2L7K A;  4F52 A;  4OMY A;  4LMY A;  2ME0 A;  1O7L A;  1LVA A;  2KZV A;  2YSR A;  3SQN A;  3JR9 A;  1YQA A;  4MEX F;  3HTS B;  3OSG A;  4R8H A;  2Z1D A;  4LOC A;  4CYD A;  4KYW A;  1MW7 A;  1P4X A;  4KA4 A;  4YEL A;  2WWY A;  1S29 A;  1RET A;  1YE9 A;  3V8K A;  3ZQ7 A;  1ONV A;  2GA2 A;  4BXX J;  1FX7 A;  1FOW A;  3WOD F;  3FXO A;  4KIT B;  5L3B A;  4ZDL A;  3CMY A;  1ETK A;  4IHT A;  4XN0 A;  2A6E F;  2VL8 A;  2BY1 A;  4FX0 A;  4EVI A;  1E3O C;  3BDD A;  2V6E A;  2CGP A;  3E6C C;  3KLO A;  2HOT A;  2JUC A;  3ESW B;  2KDZ A;  2M8G X;  3JW4 A;  3RKW A;  2FRH A;  5HLG A;  1LDJ A;  2DMN A;  2FF4 A;  1Q1H A;  4OIO F;  2XRL A;  2V9P A;  3VFZ A;  5FKO A;  4ETS A;  2C6Y A;  4PJ0 C;  1STZ A;  1WJE A;  4II3 A;  2H6C A;  4OOI A;  3ABK H;  3KP4 A;  2EPF A;  1Y8Q B;  2B0L A;  5BPD A;  4XLE A;  2DXI A;  1M1E B;  1JT0 A;  4A93 J;  2WB1 A;  2AXT C;  2JQ7 A;  1BIA A;  2XAQ A;  1FOY A;  4UNO A;  1TL8 A;  4BY7 J;  5HS9 A;  4EMS A;  1DP3 A;  2CQN A;  4L5J A;  4N4N B;  5F64 A;  1MBK A;  1W5T A;  2PJR A;  2FBH A;  5J1U A;  2DT7 B;  3BCB A;  1R9T J;  1MDM A;  1YRN B;  2HVR A;  4FCY A;  2QSF X;  4OWR B;  1MJA A;  2DFE A;  3NEU A;  2ZJ2 A;  3CC7 I;  1DU6 A;  2F5C A;  2G7U A;  3H5A A;  1PUF A;  3ZMT A;  5F1J A;  1ZTR A;  1JTY A;  4M71 A;  4A5M A;  2MLK A;  2KLO A;  3FXQ A;  4RM2 A;  1OLT A;  4S05 A;  2BY3 A;  1OJL A;  4G6Q A;  2AHQ A;  3WG7 H;  3LSP A;  3VYU B;  4R1H A;  3ERE D;  4A3L J;  5HVQ C;  2MBF A;  3KZZ A; 
#chains in the Genus database with same CATH homology
 3OYE A;  4FAS D;  3FKJ A;  4E6K G;  4RMN A;  3IAS 2;  2K3P A;  4HST A;  3VYR B;  2IGN A;  2V1N A;  2L5Q A;  1U0J A;  2V26 A;  3E0J B;  2KP6 A;  3IP4 B;  2E1M C;  3KEY A;  5JHF A;  2KMU A;  3OYG A;  4F3Q A;  2K5C A;  5CKT A;  4CA0 A;  4PJM A;  1DGW Y;  4PJL A;  3CZ6 A;  1OR7 C;  4U87 A;  3BG6 A;  4HSR A;  4IX7 A;  1AA7 A;  2X6Y A;  1T95 A;  1DQU A;  2WBM A;  4NQW B;  4BL0 B;  4KJZ A;  4XN3 A;  4E4H A;  3LMM A;  3CP2 A;  3OIP A;  3S3M A;  2JA2 A;  4HG2 A;  4IQJ A;  2WY8 Q;  3HL2 A;  4E7J A;  2RRE A;  4Y4R A;  3HPG A;  1QU3 A;  3DTE A;  1MMA A;  2ZSI B;  2R4G A;  4C9Y A;  3OIQ A;  1EA3 A;  1X4P A;  4J00 A;  2HNH A;  1G8X A;  2CMP A;  4AU7 A;  4C2T A;  3H9J A;  3HUG B;  3E1S A;  2X1E A;  2XAU A;  2M4G A;  3HC7 A;  3S8P A;  3VSK A;  3OYD A;  4E7L A;  3DPL C;  3SEQ A;  2HVS A;  2F5V A;  4CUG A;  3OYH A;  2W4S A;  3ZGK A;  3AL0 B;  2XDV A;  3SDB A;  2OUM A;  4BU2 A;  3MKY B;  2K9M A;  2VAS A;  3LSH A;  3OYM A;  4J01 A;  2L9N A;  4E7H A;  1X4O A;  2BOL A;  4X0G A;  2VJI A;  1W36 C;  2R7W A;  5KHD A;  3RQ4 A;  2VKH A;  3DWL E;  3DLA A;  3HPH A;  4XNF A;  2IGK A;  3K4B A;  3LFU A;  2AQF A;  3CJR B;  4NUB A;  3M1C A;  3ZXS A;  2X6X A;  4ZTJ A;  2CUJ A;  4BEH A;  4CCM A;  4OAZ A;  1PJR A;  5KCM A;  4D9J A;  3LSM A;  2A5W A;  1NG6 A;  2MYS A;  4YEJ A;  5HOO A;  2VJJ A;  4BQO A;  3PJR A;  3KX2 A;  2R7V A;  1X1D A;  1TT0 A;  2JSP A;  3K4L A;  3F9K A;  2DOA A;  4XLC A;  2GOX B;  2LBF B;  3OYJ A;  3RPU D;  2X51 A;  4JQF A;  4R79 A;  3V42 A;  3D5L A;  3H9G A;  3BCA A;  2X85 A;  2VB6 A;  2RNG A;  2W82 A;  4B47 A;  3D5R C;  3SEZ A;  4F55 A;  1N78 A;  2NOJ B;  4C30 A;  4EAT A;  2E5Z A;  3K4J A;  1WJA A;  3TL4 X;  4CCL A;  5CQE A;  3H5R A;  3OL3 A;  1SAU A;  1WFX A;  2OC6 A;  4Y33 A;  1YX5 A;  3DTK A;  2CW8 A;  3A4C A;  3K70 C;  3ONQ A;  3A2K A;  2WAF A;  3DPT A;  2MD0 A;  4LIT A;  3W2V A;  3H0D A;  3RSN A;  2M0M A;  2X1C A;  4BGD A;  1SFK A;  2HPM A;  3K4K A;  1FMV A;  4BE2 A;  4NC8 A;  1HA8 A;  3RTR A;  2P0W A;  3HKZ A;  2X1D A;  1D0X A;  2MC4 A;  4BQQ A;  2IS6 A;  3DKX A;  3FDY A;  3W3C A;  4ZC3 A;  2CFO A;  4RM3 A;  2LC2 A;  3BC8 A;  5HLT A;  2E60 A;  2KPM A;  1Y6I A;  3H5N A;  2M7B A;  3OYF A;  4CCO A;  4ZYA A;  4BDZ A;  4BXF A;  3K6G A;  1GLN A;  2X6W A;  2UWM A;  2Z16 A;  4PUS A;  2CV2 A;  4XM3 A;  3OYN A;  2LY2 A;  4XOT A;  2GOM A;  2UV1 A;  2WAD A;  1PYV A;  2R7Q A;  3GBG A;  1UEL B;  4CCK A;  2LRE A;  2XSJ C;  3CMM A;  4XOR A;  4E7K A;  1S9H A;  4ITV A;  2HVQ A;  1LFP A;  1FMW A;  1D0Y A;  1P9Q C;  3AFH A;  1T0F C;  4LG3 A;  3OS1 A;  3QYE A;  2V9K A;  2LOO A;  2CS3 A;  1LKX A;  2DJI A;  2HPI A;  4DOZ A;  2OV7 A;  1X1B A;  1QHG A;  1X1A A;  3L2V A;  3FBI B;  2CW7 A;  3NWT A;  3IUO A;  2BVL A;  2VXZ A;  4GRI A;  3LSG A;  2HU9 A;  3M8J A;  1MMD A;  3DU6 A;  4PFO A;  3MMY B;  4LIU A;  2VQG A;  2DT6 A;  2LG4 A;  2UUZ A;  1TZL A;  2L2O A;  4F93 B;  3D5S C;  3ZRG A;  2M4K A;  2VQH A;  3K4M A;  4XL9 A;  2VJ5 A;  3HOS A;  2A6T A;  4G6T B;  2CUZ A;  3NWS A;  2ZXI A;  4DJA A;  4CSW A;  2RQQ A;  3PFY A;  2M3A A;  4NNJ A;  4HNU A;  4BEH B;  2R7O A;  3CP8 A;  3OYB A;  3W2A A;  3J7A Y;  4BDY A;  2R7R A;  1VZ0 A;  4BE1 A;  5CQG A;  2R7T A;  4CZC A;  4PJN A;  2HZD A;  4QPO A;  2JUG A;  1Z21 A;  5LFA A;  3ZQQ A;  4E7Z A;  4XLF A;  3RCO A;  1R6R A;  3VWB A;  2KRC A;  1G59 A;  1JI8 A;  4HNT A;  4D1Q A;  4YRV A;  1N77 A;  1D0Z A;  4XR6 A;  4AVZ A;  1UAA A;  1V5G A;  5LD2 C;  4HEA 2;  2LY1 A;  4XKC A;  5HNH A;  2VQC A;  3LSK A;  3S3N A;  3PL8 A;  2Q2E B;  3PSI A;  3SYT A;  2VIX A;  3QYF A;  3OYC A;  2M7A A;  2ZXH A;  4ZDP A;  3OYK A;  1ZEL A;  2E1M B;  4B44 A;  1BR1 A;  2WAE A;  3VSL A;  4BJ6 C;  3S32 A;  3OYA A;  3AL0 C;  2O5R A;  4F92 B;  3L2Q A;  2K9L A;  3QOD A;  2CH0 A;  4IZZ A;  1WJD A;  2E5N A;  4PJJ A;  2HDW A;  3UNG C;  3DU5 A;  3OYI A;  4F91 B;  1W36 D;  3PNT A;  4XQF A;  2HQA A;  4P5O A;  3UR3 C;  1KON A;  5FRN A;  4B3X A;  4BUP A;  4DBQ A;  4KT6 A;  5CPR B;  2V4J C;  2WAQ A;  2Q1Z B;  3K4N A;  4KIS A;  4BS9 A;  3DTI A;  2V7F A;  4DBR A;  2BVM A;  1WJF A;  3K10 A;  3DEE A;  2IGO A;  2KRH A;  1Z3X A;  2I8D A;  4MLO A;  1X1C A;  4IQ4 A;  3S3O A;  2XF6 A;  1MND A;  4RLQ A;  4AYB A;  2W1O A;  2W00 A;  4ANJ A;  1YX3 A;  3KYL A;  4B43 A;  3MD2 A;  3EUH C;  2F4I A;  2VKD A;  1BR4 A;  2LRD A;  2F6C A;  4BJ5 C;  2LYC A;  4OAY A;  2ELJ A;  4BAC A;  1D1C A;  4E7I A;  4II2 A;  4PSX A;  2WY7 Q;  1BOB A;  2KQR A;  3OL4 A;  3PNV A;  3W2W A;  4DIQ A;  3OYL A;  4P1W A;  4B48 A;  2XF7 A;  2R7S A;  3L2R A;  3DKY A;  2BW3 B;  4BJT A;  1E0E A;  3N05 A;  2VLA A;  1IRX A;  1WJ5 A;  4XLA A;  2BW3 A;  4Y3O A;  3MKZ A;  4JOM A;  3L2U A;  3CF2 A;  4XKV A;  3K70 D;  4E7S A;  5HNF A;  5TGT A;  2ZSH B;  2VQL A;  3HG9 A;  4HPQ A;  4PFP A;  4H4K C;  3EUA A;  4XON A;  2Z2S B;  3LL7 A;  4DGW B;  1Z7L A;  1MMN A;  2IS1 A;  3CES A;  3FBN B;  4IKF A;  5KNL A;  2QKM B;  4XKW A;  4HRI A;  1UG0 A;  2KL4 A;  3CJQ B;  3TBI A;  3OR2 C;  4CCJ A;  3BG7 A;  2R7X A;  2AQE A;  4XKB A;  3EUK L;  4ZTF A;  3K4C A;  3LSI A;  3TMO A;  3H9Q A;  2MFZ A;  1LDK B;  2L7K A;  2Y0S A;  4F52 A;  4U7B A;  3MKW B;  2WA0 A;  4QPQ A;  2KZV A;  3BLY A;  4ZJZ A;  2QKL B;  2Z1D A;  1MMG A;  3ZCO A;  1MW7 A;  3H35 A;  2L9S A;  4YEL A;  2IXS A;  1YE9 A;  3PNY A;  2MAB A;  5FRM A;  4ZDO A;  4KIT B;  1QHH D;  4FET A;  3I3L A;  1LVK A;  3OMY A;  4ZDL A;  4N4O B;  4XN0 A;  3OR1 C;  4XMY A;  2VL8 A;  2V6E A;  1WJB A;  2XF5 A;  1V5E A;  1Z3Y A;  1J09 A;  3ZR8 X;  2ZFU A;  2W7N A;  1V5F A;  4RLF A;  3DPU A;  4BQN A;  3C2H A;  1X19 A;  2KHM A;  3L2W A;  2JVH A;  2VXD A;  3PSF A;  3DQV C;  3QYB A;  4CCN A;  4II3 A;  1WJE A;  2IS4 A;  2LH9 A;  2CV1 A;  1NG7 A;  1DGR M;  4XLE A;  2DXI A;  3VDX A;  3AKZ A;  2CV0 A;  2LBF A;  2WB1 A;  1BR2 A;  4PSW A;  3C2G A;  1K6Y A;  4NC7 A;  3SZG A;  3A1Y A;  4LIV A;  1D1B A;  3VYS B;  1MNE A;  2PJR B;  1DP3 A;  4PK4 A;  3FHN A;  2FUG 2;  4XOP A;  4N4N B;  2PJR A;  1Y56 A;  2KDO A;  2IS2 A;  2R7U A;  2DCE A;  2DT7 B;  3BCB A;  3OS0 A;  4XLH A;  1D1A A;  2JVG A;  5FRO A;  2HVR A;  4C2U A;  1ERD A;  3OOU A;  4OWR B;  3I9V 2;  2VPL A;  3QOE A;  3OY9 A;  3H5A A;  3VYT B;  2PMZ A;  3HXL A;  1N75 A;  3PUB A;  3U21 A;  3IAM 2;  3OWT A;  2KLO A;  3S93 A;  3HOT A;  4BE0 A;  2IGM A;  3EPZ A;  4RM2 A;  1OLT A;  3OS2 A;  4CH7 A;  3VYU B;  2VJ4 A;  1WJC A;  5HVQ C;  3G2B A;  2XC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...