3OOPA

The structure of a protein with unknown function from listeria innocua clip11262
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
139
Chain Sequence
SNAMRGYYDEISFDVNTTAKKMHLFLMRSIASYDVTPEQWSVLEGIEANEPISQKEIALWTKKDTPTVNRIVDVLLRKELIVREIRRISLLSLTDKGRKETTELRDIVEASCEKMFAGVTRTDLEQFTAILKNISTNIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Lin2960 protein
publication title The structure of a protein with unknown function from Listeria innocua Clip11262
rcsb
source organism Listeria innocua
total genus 50
structure length 139
sequence length 143
ec nomenclature
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3oopA01
2VBWA 4Q48A 2HTSA 2RGVA 3W6JB 4MHGA 4LK0F 3ECOA 4R79A 1MGTA 4FT8A 4EGZA 3FWEA 4P9FA 3TOBA 4ZYGA 1MKMA 3BWGA 4B09A 2VE9A 1K79A 2MLKA 3WGGA 1SFEA 1B9MA 2FA5A 5CVVA 1LDKB 1C0WA 2H6CA 2FOKA 5E20A 3MEXA 3ULQB 4M73A 1FP1D 3C1DA 1P92A 2LF7A 2EV0A 3TOAA 2PN6A 4ON0A 3BPVA 2OQRA 3RYPA 2YX7A 3KETA 4ENMA 1LQ1A 1R1UA 4KNYA 1Q1HA 2AXLA 3QP6A 3F22A 4RGUA 2HYFA 2Y48A 2L3DA 5K5OA 1EH8A 2A6EF 2EJRA 1DUXC 3CO6C 3HHHA 3GXOA 3T8TA 4H0EA 4LLNA 1KA8A 3ZMTA 4HX7A 1P6RA 1FYKA 1R7JA 2H09A 2VONA 3V7RA 5EEHA 3M9AA 3R0AA 2O0YA 3E5UA 3E6DA 4K2EA 4O5VA 5E1WA 1R1VA 1JHHA 1GXPA 2PFBA 3GX4X 1U5TA 4PDKA 2VBZA 2XROA 3NEUA 3I0TA 1IUYA 1LDDA 5E18F 1NHAA 2BEOA 3VEPA 1FOKA 3HRSA 1XSVA 3GFMA 4DNCA 1I27A 1KU3A 5HOOA 3IRQA 2L54A 5L3BA 2QQBA 3LAPA 1P4XA 2PEXA 3AAFA 2ISZA 4LK1F 2MH2A 5ILUA 2RVCA 3E3VA 1SD6A 5J6XA 3COAC 4ENJA 1HKTA 3MZYA 4RB1A 2RC4A 3KP5A 3I59A 4ASNA 2BYVE 1FYLA 4CYDA 1SFUA 3CUOA 1FP2A 4DQ2A 1R5HA 2X0LA 2FBHA 4S05A 5D5WB 2Y0MA 3RYRA 2ISYA 5ICFA 3V4GA 3LQRA 2F2EA 4IXAA 1F9NA 4YIIA 4KICA 3F8FA 3P9KA 2YX4A 1XD7A 5LHHA 5E8GA 1QZYA 1CF7A 2PG4A 1Z91A 1XDSA 4U0WA 4Q5SF 2DT5A 3U9GA 1ZGAA 3TQNA 3CDHA 3ISPA 2K7LA 5LEKA 1KQ9A 3F6OA 1XDUA 2QQ9A 2ZJ2A 1TQPA 3FMSA 1DDNA 2FMLA 5FD5A 3TO7A 3F21A 1EV7A 4CO8A 2OBPA 5ILSA 4UHTA 2HFHA 1SMTA 5DV5A 5ICEA 3OOPA 4GYGA 2JRTA 2P7CB 4WXDA 2Q0OA 4I0AA 2F5FA 1W7PA 2MA3A 1XGMA 3KP3A 2CGPA 2XAGA 1R5GA 2W24A 1F5TA 2QQAA 1T98A 2OAZA 4PZJA 1OYIA 1R1TA 5HS7A 3LA7A 4ZZLA 2P5VA 4OINF 5ICGA 5L3GA 1PDNC 5DD4A 5K1YA 4M9ZA 4OIQF 2DW4A 5E17F 3GZ6A 3CUQC 1LVAA 2EV5A 5D4RA 2P6TA 2L02A 3HSFA 2O3FA 5A2QK 1B59A 2K4JA 2W25A 1O7FA 1FNNA 2OD5A 1F1ZA 4P55A 5ED4A 4EJTA 2DTRA 2OZUA 3PQJA 2D2WA 4NHJA 3V8KA 1ODDA 3BZ6A 1BJAA 1ZRFA 5D4SA 1ZLJA 3T8RA 2FNPA 3WTUC 1T38A 3HRMA 5D6EA 2GXBA 3GUDA 2JPBA 3CO7C 2V79A 1W5SA 5CVJA 1XSDA 3LWFA 3CUQB 5LEJA 1FT9A 2RQPA 1R58A 2GA2A 3FF5A 2F5EA 1ZGJA 3F3XA 3GYHX 2JTVA 4O3MA 1EH7A 4HA8A 3ZMSA 4ESJA 4M71A 3KLNA 1ON2A 2L4AA 4HLXA 2A69F 5BS6A 3F23A 4N0BA 2FU4A 2YPRA 1XSXA 5BQTA 4LB6B 4M9XA 1BC8C 2H6BA 3KE2A 1ZH5A 3PFIA 1A04A 3WTXC 4EV0A 3KZYA 2XASA 2ZCWA 3E97A 4KUMA 1WQ2A 1KYWA 4HV5A 2ZMEA 4G6DA 3WTSC 1FPQA 2HDCA 3REOA 4E70A 2HZTA 3DQVC 5FO5A 2R3SA 3NRVA 2VC0A 3SZTA 1TTYA 1TQMA 4G8XA 1U5TB 1USSA 4IVNA 2DAOA 4LG0B 3QOPA 2V1UA 3P7NA 3MFKA 2W85A 1IF1A 5DUKA 5H6RA 3RDIA 3TDZC 1HQCA 2G9WA 4ZYDA 4GCVA 1BIAA 4UNOA 2NS0A 2Q8KA 4XBFA 2VOOA 3J7AO 4G7ZF 4MEYF 4YG2F 3K0LA 1J2XA 4XLPF 1MZBA 1ZG5A 3QPTA 5HDNA 3I59B 4EM0B 2E1CA 4RS8A 4M9SA 3JAMZ 4L9VA 2XAJA 5DYMA 5HDKA 5FLXZ 1FWZA 1TBXA 1J9IA 2DPUA 4Q4ZF 1IN4A 4ENKA 1XB4A 1I6XA 1VTNC 2GXGA 5DCFA 2IRFG 2BV6A 1D8KA 5DCMA 4RAZA 2M45A 2FEZA 3H3UA 1QGPA 5BPIA 4CZZA 3WODF 1CF7B 1PUEE 1XN7A 4UXNA 3S2WA 3SQNA 2FNAA 2OA4A 2ZKZA 3F8CA 1ZRCA 5IT9K 2P4WA 2DPDA 4WK8F 1IXRC 2VT3A 4ENNA 5D6FA 1O7LA 3U2RA 1AOYA 2DQLA 2HKOA 1YS6A 3RKWA 1KU2A 2RN7A 3R60A 1B1BA 4IPAA 2VODA 1DPRA 1HW2A 3KP4A 3G3ZA 4QLCU 3V8JA 3IC7A 1KGSA 1JHFA 3BPXA 2FRHA 3ZMVA 1W7PB 3HIFA 4U7DA 4YFKF 1WWXA 3MQ0A 1WRJA 4F7ZA 4I98B 1P2FA 2J5PA 1FSEA 2P5KA 3SZPA 3RPUA 2M30A 5AIPA 2ACJA 2EA4A 1U3EM 1IXSB 1LNWA 3FXQA 1STZA 2IW5A 3CUQA 5CVUA 5F6FA 3H92A 4I02A 5KVRA 4GGGA 1ZAOA 1UCRA 3DPTA 3ZMUA 1ZREA 5AIQA 4FX0A 5IT3A 4RGXA 4EJWA 2KKOA 3WE3A 4HX4A 4CGZA 3KFWX 2IT0A 1FBSA 2QWWA 1HKQA 2GIVA 4EMSA 3H3ZA 4EJOA 1S29A 2FE3A 3IWFA 2WWYA 4MNUA 1KYZA 2ESNA 4HQEA 5FFXA 5LBQA 2ZXJA 4MGRA 4YFNF 1QO0D 1Z1DA 3TKYA 2O61A 3KP6A 3F8MA 3BOQA 2QUFA 4LLLA 3FMRA 1R23A 2EV6A 1YTYA 5JVTA 2HYGD 4PGHA 4CDGA 3O2PE 3HYIA 3C18A 4UV8A 3SXYA 3CJNA 1G3SA 3IHUA 3QU6A 2Z3YA 3RKYA 4LG0A 4R1HA 2H27A 5E1ZB 1REPC 1P4WA 2ZMEB 3Q9VA 5ILVA 2HWVA 2QM3A 3I4PA 2EA2A 4IRHA 4IF4A 2HR3A 3E6BA 5ICCA 3ZPLA 3I71A 3MWMA 3IL2A 3N97A 2NRAC 2M8EA 3E6CC 3M8FA 2XVCA 4MQVA 3LQQA 3F8NA 3EYYA 1HXDA 1YW7A 2LNBA 3RI4A 3MAJA 1SMYF 5JFRA 4LB5A 4U0VA 4KT5C 4RB0A 2JZYA 4HV6A 1IRFA 3I54A 4XSXF 2CFXA 1ZG3A 4P9UA 2VOPA 3JTHA 3TO9A 1J59A 2O6GE 4G94A 1BI1A 3DP7A 1HW1A 5CVIA 2VBXA 5D8LB 5F1RA 3FM5A 4MTEA 5H20A 3HRUA 1H9TA 1KQ0A 2EWNA 3G73A 4O6JA 5LHIA 1ONVA 1UB9A 2LF8A 4HYEA 3HTSB 4OIRF 2HGCA 3DV8A 4I2OA 3IWZA 4KMUX 2VXZA 1W5TA 4KIFA 1QBJA 4RGSA 2LDUA 3FXRA 4A12A 1BOAA 1U2WA 1T39A 2PLYA 5LGTA 1K78A 1ZYRF 3K1NA 2IA2A 3Q9SA 4L9JA 2HKXA 4KIBA 3I64A 5DCMB 1HBXG 1W4MA 3VOEA 3I53A 4RB2C 2EFNA 5HVQC 3KEOA 3BJOA 2FQ3A 4KYWA 4WCGA 1KQ8A 1YYVA 2NYXA 1D5VA 2B0LA 1XMKA 4R8HA 3T0YA 1RI7A 1BIBA 4HOBA 2H94A 3CTAA 3F72A 5LRSA 2W84A 2EK5A 2TDXA 3DEUA 1QNTA 2L4MA 2PI0A 3HSRA 1SD5A 2RV8A 3HUGA 2BGCA 1L3LA 4A5NA 4WWCA 2HOEA 3ERED 1YQAA 4FHTA 3EUHA 4EVIA 1E17A 2Z5UA 5HLGA 3JSPA 2D45A 1CGPA 1R36A 4RAYA 4AIKA 2KJBA 2K86A 4HX8A 5D5XB 2OQGA 1ZARA 4ZYHA 4Y15A 5HDGA 4EQQA 1BBYA 1HKSA 1SD4A 1BI3A 1TNSA 2KRFA 2D1VA 4HDVA 3EDPA 2DU9A 1G4DA 2EB7A 1OYYA 4OIPF 4G6QA 1S3JA 3ZMDA 1HSJA 4BHBA 2NNYA 2IA0A 3W6KB 4P5OA 4EJUA 1YG2A 3KEQA 5FFZA 5CJ9A 2GWRA 4D0PA 1O3TA 1JGSA 3E5QA 4WXHA 2M5WA 1XMAA 3ECHA 3HRTA 4BQAA 2Z99A 4XLNF 4I0BA 2LKPA 3GFIA 3WGIA 4L5IA 1LJ9A 5J8CA 4ZH4F 4GO1A 4OMZA 3GFJA 1ZRDA 2YSRA 4YIFA 4G7HF 1YLFA 1Z7UA 4RB3C 2EFOA 4L9NA 1J75A 1G3YA 2DK8A 3QRFF 1DPUA 3BJ6A 1I1SA 4EGYA 1BM9A 4U88A 3O6BB 2RKHA 2OU2A 4MTDA 2K4BA 2VN2A 4AD9A 2VE8A 2JT1A 2V1XA 2HQRA 3LFKA 2W57A 1ULYA 4ESBA 1IN8A 3T1BA 4JQFA 2STWA 4L18B 2UXNA 3QP5A 5L3CA 3B02A 3OV8A 1GHCA 1UFMA 2A5YB 4EM1A 5D5VB 1V3FA 1ZLKA 2R7DA 3ABTA 4BHCA 1MJ9A 4ZYEA 3K1PA 3M1EA 4OOIA 1OPCA 4CXFA 2G7HA 1I1GA 4N9IA 1HSTA 2XKOA 4UVCA 3JSOA 2GA1A 5D5UB 4BYYA 1PP8F 1Z6RA 1UHWA 2KIFA 4MEXF 2FMYA 2CYYA 2XHKA 3RIRA 4KA4A 1R22A 4A2UA 1OR7A 3J81Z 1LDJA 2DFIA 4Y17A 4HZFA 1Z6TA 4LJZF 2J5OA 4PCQA 3SFZA 3R4KA 2YU3A 3FM3A 4AIJA 1DP7P 1TLHB 2P6SA 1RNLA 1RUOA 4I01A 3V7SA 3V7CA 1OKRA 3FX3A 5HLHA 1E2XA 3WTTC 1SAXA 4G7OF 1K78B 4KN4X 1BI2A 2QLZA 2FBIA 2XRNA 3L09A 5LGUA 4XRFA 4S04A 3WE2A 2ZFWA 3TDUC 2IA1A 3WTYC 2E1NA 4M6YA 1FC3A 1J7KA 2XAHA 3L00A 2EFPA 3FZVA 3GEZA 2ADUA 4P96A 3KP2A 5AONA 2FXAA 4YFXF 5HS9A 2QENA 5LGNA 3LAJA 3VODA 4FX4A 2HEOA 5CVRA 1IZ1A 4N9HA 4IRGA 2MLGA 1L0OC 1G3WA 2A3SA 5FD6A 3KZZA 3J80Z 5BPDA 1S7OA 2DI3A 3KLOA 1T2KA 1FY7A 1H0MA 1ZG1A 1U78A 1H9GA 4LLGF 2X4HA 1LB2A 1S6LA 1KU9A 2Y75A 4L9TA 3L2CA 1SFXA 2PQ8A 1D3YA 4M74A 2A07F 4I7HA 1QQIA 3D0SA 2Q2EA 2DK5A 2QBYA 4Q47A 5HS8A 2A68F 2COMA 2GAUA 2PBIA 1OMIA 2R7FA 1Z05A 1O57A 4Z2YA 1U6GA 1U8RA 2GQQA 2PMHA 5DDGA 4LD5A 2VC1A 3ML6A 4L5JA 4HAMA 3PQKA 2IVMA 1T0FA 1QPMA 2CO5A 2OZ6A 2ZNYA 1MDMA 3EYIA 4BXUA 1I5ZA 1AWCA 1IN6A 3ZQ7A 4BH9A 1R00A 5E1XA 1PP7U 3HOSA 2FBKA 2K27A 4LGWA 3P9IA 5LRRA 3DXJF 3K9TA 3RJPA 2G7UA 2ETHA 3CLOA 5K5RA 3DF8A 3ZMZA 2HTJA 3DPLC 5LLQA 4U0YA 3R6SA 3ZN1A 3DFGA 4Y13A 1B9NA 1FBUA 3ABUA 5CYVA 4RGRA 1IAWA 3LSTA 1IRGA 2IPQX 1MJAA 4UVAA 1YS7A 3JTGA 2LSOA 3GFLA 3F6VA 4HDUA 4CHUA 1T6SA 2PMUA 3IKVA 4A6EA 4IHSA 2D1HA 3K2ZA 1IW7F 1YFHA 2BBYA 1KU7A 2EFWA 4GYIA 2CSOA 1S8NA 5K5QA 4MQ9F 4HF2A 3GVAA 2IP2A 3F8BA 5JI6A 1FLIA 3ZN0A 5FB2A 1ON1A 2UXXA 2E7WA 4HQMA 3P9CA 3QAHA 1J5YA 2BE5F 4A0XA 2XAFA 1YO5C 4BAYA 1OYWA 3GLXA 4KFCA 3QU3A 3WG9A 1JXSA 5EEGA 2KJCA 1IN7A 4JK1X 4XSZF 4KN7X 4CICA 2P8TA 4LFUA 3M8EA 3BP8A 3Q5FA 1P4AA 3FHZA 2UWMA 4EJVA 3RKXA 3E6MA 5JHUA 5HLIA 1GXQA 3L7WA 2CQKA 3KCCA 2XAQA 3GWZA 2XKPA 3KP7A 2P7VB 1O3QA 1XCBA 3T5XA 3LA2A 1Z9CA 4OU0A 1SD7A 3TGNA 3FXUA 2JPCA 1TQIA 2O03A 1O3SA 3BY6A 4UVBA 3VFZA 5L3EA 3M7GA 4OMYA 4IRIA 2VT2A 5JR3A 1TW3A 2CWEA 3WGHA 5KK1A 2NAZA 2KIUA 4IHTA 1Y0UA 3QPHA 2AS5F 2RDPA 5TJJA 1MJBA 2ESHA 2DO7A 2L01A 4NB5A 1MD0A 3GF2A 3MZHA 1HW5A 3SHFA 2XUBA 3BROA 3WU1B 4NQWA 5TRDA 2MC3A 5A2QZ 3U1DA 5F64A 3IRRA 5ERIA 4WX9A 2P5LC 2F5CA 3ZP5A 4ZZDA 5DUIA 1IN5A 1YIOA 2QVOA 4UV9A 4OIOF 3RPQA 1FSHA 2QYOA 1G3TA 2STTA 2MBFA 2VBYA 1D8JA 2IJLA 4G9YA 4I09A 2E7XA 4B8XA 4BNCA 2Z33A 2A61A 1USTA 2QBYB 1TW2A 2JSCA 3RTRA 2M87A 3V8LA 5CLSA 4HF1A 2ZBKA 2A6HF 5BOXA 3GO5A 5FGMA 3K1MA 2UZKA 4HW0A 3N4MA 1V4RA 3HOTA 5H6QA 3WU0A 4TV7A 2YR2A 3WTWC 5D8KB 1RZ4A 3K69A 3C3WA 2Z9OA 3I5UA 1MDMB 1U5TC 4PGGA 4KIGA 1FZPB 3WTZA 3MCZA 4L0ZB 3D5LA 2K02A 1JE8A 1TNTA 1B6AA 1UHMA 2XGXA 1XGSA 3BDDA 1X3UA 4WXCA 3ROUA 2DLLA 2XV4S 2DQRA 1LEAA 3VB2A 2DBBA 1W7PD 4AWXB 2HS5A 2FF4A 1XGNA 1O3RA 1S7AA 5J8FA 4M6XA 4L0YB 1FYMA 2HQNA 4A6DA 2XIGA 4A0YA 2PJPA 3BJAA 4ESFA 1XGOA 2ELHA 4WF2A 1K7AA 4A0ZA 1WKMA 2NNNA 3NQOA 1G6NA 2O8XA 4LMYA 5LHGA 3HSEA 3FMQA 4QWQA 4HLYA 1BC7C 4GXOA 4KMFA 2KIMA 3R0JA 6PAXA 1EH6A 5L3DA 1ZHFA 2QZ8A 3JAMK 1YW8A 1GVJA 2C6YA 3GW2A 3IKTA 1WI9A 4BHPA 3R61A 5FLXK 1ZN2A 3LA3A 2V9VA 3J81K 4UUVA 2V1DA 1WSUA 2F5DA 1IXCA 5E8IA 4KDPA 1XCVA 3HHGA 1F4KA 1BN5A 1QZZA 4AIHA 2WV0A 1BI0A 3JW4A 5DD8A 2MH9A 3DKWA 4EM2A 2EFQA 3I58A 3L9FA 3HTUA 2FSWA 3C7JA 5L3FA 2CW0F 3WTVC 4U7BA 4A5MA 2WTEA 3B73A 2RNJA 3EQLF 2MD5A 3GZ5A 3TO6A 1FX7A 3ELKA 1B4AA 2WC2A 5BMZA 5IT9Z 4ETSA 5DEQA 1K6OA 1RUNA 4M72A 4IJAA 4AVPA 2M1BA 2ZNZA 1FBQA 4JBAA 1LEBA 3O3KA 2CG4A 1YW9A 2V6CA 1J0RA 4HF0A 1RIOH 2GZWA 4HBLA 2ZO4A 3EETA 3E5XA 3J80K
chains in the Genus database with same CATH superfamily
1WGXA 2VBWA 3LNQA 3BZKA 1YIJI 4CUGA 3HM5A 4Q48A 2HTSA 2Q1ZB 2RGVA 4BXXJ 1ENHA 3W6JB 4MHGA 4PSWA 4LK0F 3ECOA 4R79A 1MGTA 4FT8A 4EATA 1LPQA 1W1WE 4EGZA 3FWEA 3CJQB 2M3AA 4P9FA 3TOBA 4ZYGA 3A01A 1MKMA 2W1OA 3BWGA 4B09A 2VE9A 4ZYAA 2OUMA 1BJZA 1K79A 3S16J 2MLKA 3WGGA 2E2IJ 2JA6J 1SFEA 1IC8A 1B9MA 2FA5A 5CVVA 4NQWB 2NOGA 1LDKB 5KAIC 2HVRA 1C0WA 2H6CA 3DTKA 3Q0WA 4PJLA 2E36A 2FOKA 5E20A 1NG7A 3FBNB 3MEXA 3PNTA 3ULQB 4M73A 2BXZA 1FP1D 3C1DA 1P92A 2LF7A 2LY1A 3VYRB 1MMSA 1NTCA 2EV0A 3GTKJ 2XPUA 3TOAA 2PN6A 4JX5A 4ON0A 3BPVA 4IEJA 4BEHA 3BR6A 4NNJA 5EDNA 2XSDC 2VL8A 3ABLH 4F55A 2CUJA 2OQRA 3RYPA 3ZXSA 4E7SA 2YX7A 2XAUA 3KETA 1S72I 2YU9J 4ENMA 1LQ1A 4FCYA 1R1UA 4KNYA 3JRBA 1Q1HA 2AXLA 3QP6A 1YJNI 3F22A 4RGUA 4B3XA 2HYFA 2Y48A 1D1AA 1OJLA 3CMEI 1UG0A 2L3DA 5K5OA 2NVUB 1EH8A 4ZDLA 1QA6A 2LP0A 2A6EF 2EJRA 3PIPF 3OSFA 1DUXC 3OWTA 1LFPA 2IGMA 3CO6C 2W4SA 3HHHA 2DFEA 3VYUB 2OC6A 4UB6C 3H5RA 1ACIA 1R71A 3GXOA 2DMQA 2DTZA 3T8TA 2JVGA 4H0EA 4LLNA 1KA8A 1RR7A 3ZMTA 4HX7A 1BA5A 1P6RA 1FYKA 1R7JA 2H09A 2VONA 3FKIJ 3SEZA 3V7RA 1DP3A 3K4LA 3DWLE 5EEHA 3M9AA 3R0AA 2O0YA 2Y31A 3E5UA 3E6DA 4A3IJ 4K2EA 4O5VA 4XRSA 2R7SA 1JUPA 1IG7A 1Z3YA 1VNDA 2F48A 1YX3A 5E1WA 4XKWA 2P0WA 1R1VA 5B66C 1JHHA 1GXPA 2PFBA 2KRHA 3PL8A 3GX4X 1U5TA 2L0KA 4HEA2 4PDKA 2VBZA 4RM2A 2XROA 3NEUA 3I0TA 5GAHJ 1IUYA 1LDDA 5E18F 1NHAA 4JOMA 2BEOA 1A6QA 2HNHA 1TWHJ 3VEPA 1FOKA 9ANTA 2KT0A 3HRSA 1XSVA 2HXOA 3GFMA 3IAS2 1TP4A 4DNCA 1I27A 3CCMI 1KU3A 5HOOA 3OS0A 4XICA 3IRQA 5J40A 2L54A 5L3BA 4IO9F 2QQBA 3LAPA 2X1DA 1P4XA 2PEXA 1IRZA 2D5VA 2WAFA 4CCKA 3AAFA 4M3BA 2ISZA 4GFBA 4LK1F 3OYCA 1R5ID 2EIJH 2MH2A 4A93J 5ILUA 2OCEA 3SZGA 2RVCA 2CV1A 2VI6A 3E3VA 4M3DA 4F93B 1FJLA 3RPUD 4GDFA 1SD6A 5J6XA 3COAC 3RQIA 1A31A 5FKLA 4ENJA 3GBGA 1HKTA 3MZYA 4RB1A 5IOZA 1JTXA 3P5JA 2RC4A 2PMZN 3KP5A 3I59A 5C3EJ 4ASNA 2BYVE 1FYLA 4CYDA 4FETA 1SFUA 4E7KA 3DU5A 3CUOA 1FP2A 1JI8A 4DQ2A 1R5HA 2X0LA 2FBHA 3FIWA 3OR1C 4S05A 2XPWA 5D5WB 2DA1A 2VB6A 3DKXA 1TWFJ 2Y0MA 3RYRA 2ISYA 5ICFA 3V4GA 3G4SI 3JRAA 3LQRA 2F2EA 2DFHA 2B9SA 5F0CA 1I39A 4IXAA 2LREA 4JX4A 1F9NA 4YIIA 3A1YA 3DTEA 2L5QA 1Z77A 5DS9A 4KICA 3F8FA 1FOYA 1X1PA 2PMZA 3P9KA 2YX4A 1XD7A 2VUMJ 2ME6A 1ZQ3P 3D5SC 5LHHA 5E8GA 1QZYA 1CF7A 2PG4A 1SVOA 1Z91A 1XDSA 1MBEA 3CP8A 5FRNA 4U0WA 4Q5SF 2DT5A 3U9GA 1ZGAA 3OYHA 2DN0A 3CLQA 4IHVA 3TQNA 3HOYJ 2E5NA 3WG7H 1RETA 3CDHA 3ISPA 5E3MA 2K7LA 5LEKA 1KQ9A 1JT0A 3F6OA 2E2HJ 1B72B 1XDUA 1FTTA 2QQ9A 2ZJ2A 1TQPA 3G1LA 2KZGA 3FMSA 1DDNA 2FMLA 2AQEA 2JK3A 3BG3A 5FD5A 3TO7A 1ZTRA 3F21A 3MKYB 1EV7A 4CO8A 4XLCA 2OBPA 5ILSA 1JJ8C 4UHTA 2HFHA 1SMTA 5DV5A 5ICEA 1OCRH 2N8GA 3C2HA 3OOPA 4GYGA 3CD6I 2JRTA 2P7CB 3QQAA 4WXDA 2Q0OA 3ZQIA 1TT5B 4I0AA 2F5FA 1W7PA 2MA3A 1XGMA 3KP3A 4XN0A 2DJNA 2CGPA 1KONA 2JN6A 2XAGA 2WV1A 5CQGA 1JKOC 4PFOA 1R5GA 2IS2A 2W24A 4B44A 2ID6A 1O4XA 1F5TA 2VPLA 2QA4I 2QQAA 1T98A 2VJ4A 2OAZA 4PZJA 1OYIA 1R1TA 5HS7A 3LA7A 5J1UA 4ZZLA 2P5VA 3AFHA 5EG0B 1T56A 2CUEA 2IXSA 2Y30A 1ITYA 1MIJA 4OINF 4IZZA 2K9MA 5ICGA 1VQPI 5L3GA 1PDNC 5DD4A 1XC5A 5K1YA 4M9ZA 4OIQF 2DW4A 3OYAA 5E17F 1R4NB 3GZ6A 3CUQC 1XG1A 2PJRB 1LVAA 2EV5A 2P6TA 3FKJA 2LKSA 2L02A 3OL4A 3Q3SA 5D4RA 3HSFA 2O3FA 3V42A 4ZDPA 5M5YJ 5A2QK 1B59A 2K4JA 4DZJA 2IGKA 2W25A 1O7FA 1FNNA 2OD5A 1F1ZA 4P55A 5ED4A 4EJTA 3A4CA 3U1KA 2DTRA 3DBLB 1WJDA 2G0EA 2OZUA 3PQJA 2D2WA 2DA3A 2GOMA 4NHJA 3TW6A 3V8KA 1ODDA 3BZ6A 1BJAA 3FXMA 2E34A 2EILH 1ZRFA 1RKTA 1Z3XA 5D4SA 1ZLJA 3T8RA 2FNPA 4I99C 3WTUC 4RLFA 1T38A 2W7NA 2BY1A 3HRMA 5D6EA 1IV6A 2GXBA 3GUDA 2JPBA 3CO7C 3W2VA 4HG2A 2V79A 1W5SA 5CVJA 1XSDA 3LWFA 3CUQB 1WZ2A 2BZTA 4DBQA 5LEJA 1FT9A 2RQPA 1R58A 1ZR2A 2GA2A 3FF5A 3M1CA 2RAEA 2BHZA 3JRDA 2F5EA 1ZGJA 3F3XA 4M3EA 3GYHX 2JTVA 2MW8A 1Y6IA 4O3MA 2L7KA 2AHQA 1EH7A 4DBRA 4HA8A 4BEHB 3ZMSA 3CP2A 4ESJA 2CW7A 4M71A 2CQNA 1ON2A 3KLNA 3VPRA 4I6ZA 1AKHA 3L2VA 2MC4A 2L4AA 2VKEA 4CYCA 4HLXA 2R7RA 5F04A 3DBRB 2A69F 2EINH 4E7ZA 1WJAA 4XRSG 5BS6A 1YE9A 3F23A 3K70C 1X3ZB 1EKEA 4N0BA 4BY1J 2FU4A 2YPRA 4IOAF 1XSXA 4D7MA 3K4MA 5BQTA 4LB6B 4M9XA 1VQKI 1BC8C 2XB0X 3HC7A 5C44J 2E71A 4A3GJ 2H6BA 3KE2A 1ZH5A 3PFIA 3HPHA 2IBDA 1TZLA 3CCUI 1A04A 3WTXC 1Y8RB 1RESA 2LK2A 4EV0A 3KZYA 3G6EI 4FISA 1R49A 2XASA 4IL6C 3IH3A 2BY0A 2ZCWA 3E97A 1YOVB 3CC4I 3HPGA 1OQYA 4KUMA 3OR2C 1SANA 1WQ2A 2JA5J 1KYWA 4HV5A 2ZMEA 4OWRB 3BC8A 4G6DA 3WTSC 1WJEA 4XN3A 1FPQA 2E5ZA 1G59A 3ESWB 2HDCA 4C2UA 2OPTA 3REOA 1X1AA 4CSWA 4E70A 3KYLA 1Q1VA 2HZTA 3DQVC 5FO5A 4YIRX 2R3SA 3NRVA 3VSKA 2FD5A 2VC0A 1K4SA 3SZTA 1TTYA 3G1OA 1TQMA 5EEAA 2LG4A 1HLVA 4G8XA 1U5TB 4QPOA 1USSA 4IVNA 3HOWJ 2DAOA 4LG0B 5E3NA 3S15J 2HU9A 1OLTA 3QOPA 2V1UA 2LY9A 1XX5A 3O8GA 4F3QA 2H8RA 2NS8A 3P7NA 3MFKA 3GTLJ 4XM3A 3I4NJ 2W85A 1VQOI 3OIPA 5M3MJ 2M7BA 1IF1A 1R6RA 5DUKA 5FROA 5H6RA 4MLOA 2VIXA 3OL3A 2VKHA 3RDIA 3TDZC 4E7JA 1S7EA 1HQCA 2G9WA 4ZYDA 1G4DA 4GCVA 1BIAA 4UNOA 2HYJA 2NS0A 2Q8KA 1V55H 4XBFA 4DGWB 3KYCB 3LSHA 2VOOA 3J7AO 3HZJA 4HSRA 1BW5A 4G7ZF 4MEYF 2B7EA 4YG2F 1FEXA 2VJ5A 3K0LA 1WCMJ 1LFUP 1J2XA 4XLPF 4J00A 3HEFA 3HL2A 1MZBA 4ZJZA 1ZG5A 2JSPA 3QPTA 1JJ6C 1D1CA 5HDNA 3I59B 3CF5F 3PO2J 3LSGA 1QHGA 4EM0B 2E1CA 1X19A 4RS8A 2KRCA 4M9SA 4FASD 3JAMZ 2EZKA 4L9VA 2XAJA 5DYMA 5HDKA 3CC2I 2R5ZA 2X9DA 2ZJQF 5FLXZ 2CW8A 1FWZA 3OIQA 1TBXA 1J9IA 2DPUA 4Q4ZF 1IN4A 4ENKA 1XB4A 1I6XA 4B4CA 4A3FJ 2MGQA 1B72A 2O7OA 4C3IJ 4LIVA 2KISA 1EJ9A 1VTNC 2GXGA 3KIOA 5DCFA 2IRFG 1T95A 1D8KA 2BV6A 5DCMA 4RAZA 2IGNA 2HXIA 4XOPA 1MBFA 2M45A 2FEZA 3H3UA 4F52A 1QGPA 1IDYA 5BPIA 3J7YJ 2IAIA 4CZZA 3WODF 3BR3A 1CF7B 1PUEE 4KISA 1XN7A 4AUXA 4J01A 1MH3A 2QGUA 4UXNA 3OYFA 3S2WA 4LG3A 4V19K 3SQNA 2FNAA 2OA4A 2ZKZA 4BACA 3F8CA 3G71I 3DLAA 2DOAA 1ZRCA 2JVHA 5IT9K 1YHQI 1T8IA 2QSFX 2P4WA 5E79C 4WK8F 1IXRC 2DPDA 1FTZA 2VT3A 4ENNA 5D6FA 1O7LA 4V2GA 3U2RA 4NUBA 2E35A 3JRIA 2DQLA 2HKOA 1AOYA 1LKXA 1YS6A 3RKWA 1KU2A 2RN7A 3R60A 2K85A 4W1UA 1B1BA 4IPAA 2XGCA 1D5YA 2JRMA 4KJZA 1DPRA 1VQ6I 2VODA 1HW2A 3KP4A 3G3ZA 4QLCU 3V8JA 4BJ6C 3IC7A 3OIOA 4IQ4A 4XNFA 1KGSA 1I50J 1JHFA 3BPXA 2FRHA 2PJRA 3ZMVA 1YRNA 2ME0A 1W7PB 3HIFA 4Y33A 2VKVA 4U7DA 2XF6A 4YFKF 2R7QA 1WWXA 3ONQA 3MQ0A 2LY2A 1WRJA 1QVTA 2L2OA 5J4YA 4A3MJ 4CA0A 4F7ZA 5B1AH 4I98B 3MKWB 1P2FA 1A36A 2J5PA 4BE1A 4RMNA 1FSEA 1FIPA 2P5KA 1W36C 3SZPA 3QPLA 3RPUA 2M30A 2RREA 2VJJA 2HI3A 3CJTB 1GVDA 2JA7J 3GTMJ 3CC7I 5AIPA 2ACJA 2W48A 2YS9A 2EA4A 1U3EM 1IXSB 1OCPA 1LNWA 1UMQA 1X1BA 1Z7LA 3FXQA 1STZA 2IW5A 3HB9A 3MVPA 3CUQA 4BQOA 2E1MC 5CVUA 4JYKA 1K4TA 1U8BA 5F6FA 2OF7A 3HOXJ 1VQ7I 3H92A 4I02A 5KVRA 4GGGA 2WAQA 1ZAOA 2WY8Q 1UCRA 3DPTA 3OOUA 3ZMUA 3DLLF 1Z67A 4CCOA 3GMEA 1ZREA 4NDLA 2QKLB 5AIQA 4FX0A 2QEXI 5IT3A 2DOFA 4RGXA 4A3LJ 2I5UA 5EJCA 4EJWA 2KKOA 3WE3A 4HX4A 4D9JA 2BVLA 1K83J 4CGZA 3KFWX 2HPIA 2IT0A 2HDWA 4RM3A 1HCRA 3LSRA 2ICWG 1FBSA 2QWWA 1HKQA 2GIVA 5FKOA 2B63J 4AC0A 4QPQA 3KYDB 1LVKA 1P9QC 4EMSA 3H3ZA 4EJOA 2K9LA 5CKTA 2CJJA 1ZGWA 1E3OC 5FLVA 4IKFA 1S29A 2EPFA 1AHDP 3SJMA 2CFOA 1B8IA 3JREA 2IS1A 2X1EA 3M3YJ 4P1WA 1YITI 2FE3A 2E1MB 2EZIA 3IWFA 5K7FA 1EF4A 2WWYA 3F9KA 4MNUA 3CDIA 4Z6YA 1KYZA 3IUOA 2ESNA 4HQEA 3H9QA 2BXYA 5FFXA 3RZOJ 5LBQA 2ZXJA 2R7UA 2AQFA 3FISA 4MGRA 4YFNF 1QO0D 1Z1DA 2ZMEC 3TKYA 1SEUA 3HOVJ 3PO3J 4BE2A 1AKHB 2Y69H 2COBA 2O61A 3W6VA 3PNYA 3KP6A 2H1KA 1BR1A 3F8MA 2E2JJ 4CYCB 3BOQA 3CF2A 5GP9A 2QUFA 4XLHA 1WFXA 4DW6A 3DPUA 3RZDJ 4S0HB 1F36A 2LLKA 3PM1A 4LLLA 3FMRA 1R23A 1WJ5A 2EV6A 1YTYA 2OV7A 3BTJA 4EEFG 5JVTA 2XSJC 3MMYB 2HYGD 3CJRB 4X0GA 1AA7A 4PGHA 5HLTA 4CDGA 3O2PE 5DM7F 3CCSI 4ZDOA 1ETQA 3HYIA 2Y9ZA 5IPAA 3C18A 1LE8A 4UV8A 4YEJA 3SXYA 4BJ5C 3CJNA 2LMDA 1G3SA 3IHUA 3QU6A 2Z3YA 3RKYA 4LG0A 3G1MA 4R1HA 2ZJRF 3A02A 2FJ1A 2H27A 5E1ZB 3B6AA 1REPC 3LSMA 1P4WA 3HGYA 2ZMEB 3Q9VA 2QKMB 5ILVA 2HWVA 2QM3A 2EIMH 2EA2A 3I4PA 4IRHA 4IF4A 2HR3A 3E6BA 5ICCA 3ZPLA 1OCCH 3I71A 1F43A 1GV5A 2Y2ZA 1ETKA 5FKKA 1DU6A 3H9JA 4DIQA 2K3PA 3MWMA 2DODA 3ZRGA 3IL2A 3N97A 2NRAC 2M8EA 2MD0A 3E6CC 5HNHA 3M8FA 2XVCA 2KL4A 4MQVA 3LQQA 1PUFA 2ZSHB 3F8NA 1VZ0A 3EYYA 1HXDA 1YW7A 2LNBA 1ETVA 3RI4A 4NC8A 3BG5A 3MAJA 1G8XA 1SMYF 1JTYA 5JFRA 3LSPA 4FTHA 1QPIA 1LFBA 1S5LC 2H8WA 4LB5A 4U0VA 4KT5C 3CDLA 4RB0A 2JZYA 2HOSA 4HV6A 3C2BA 1IRFA 3I54A 4ITVA 4XSXF 1VFCA 5J1YA 2CFXA 4ZTFA 1N25A 1ZG3A 3A0BC 4P9UA 1CQTA 1MSFC 2VOPA 3CESA 2JUCA 3J7ZI 3TBIA 2OTJI 1MNDA 4PJMA 3JTHA 2NVYJ 3TO9A 4BS9A 1J59A 2O6GE 3FDYA 2F4OB 4G94A 1BI1A 3DP7A 3M8JA 3K10A 3OMYA 3H0DA 2X51A 1RC9A 1HW1A 1WH5A 5CVIA 2VBXA 5D8LB 5F1RA 3FM5A 4MTEA 5H20A 3HRUA 3PIOF 1KQ0A 2EWNA 3G73A 1H9TA 3AL0C 2LD5A 5KCMA 4O6JA 3K6GA 2VPRA 4AIDA 5LHIA 1ONVA 1UB9A 3E0JB 2LF8A 4HYEA 5CQEA 4UUSA 3L2RA 3HTSB 2MABA 1OFCX 4XLAA 4OIRF 4NBQA 2HGCA 3DV8A 1U0JA 4PUSA 4I2OA 3IWZA 3I56I 4KMUX 4E7IA 3S1RJ 2UUZA 4XIDA 3AG4H 3QOEA 2VQLA 4XK4A 1TWCJ 3RSNA 1ZK8A 2OTLI 2VXZA 1W5TA 4KIFA 4RBOA 1QBJA 4RGSA 2LDUA 4BUPA 3FXRA 4A12A 1BOAA 1TL8A 1GV2A 1IO2A 2R5ZB 3BQYA 1JUMA 1U2WA 2I10A 1T39A 2PLYA 5LGTA 1K78A 1ZYRF 3H5NA 3K1NA 4PK4A 3E7LA 2W82A 2Z16A 5C4XJ 1XMXA 4MFDA 2IA2A 3Q9SA 4L9JA 4BJTA 2HKXA 4KIBA 3I64A 2MG4A 5DCMB 3AL0B 2K5CA 2ZSIB 3Q0UA 3H36A 1HBXG 1W4MA 3IP4B 3VOEA 2LVSA 3D5RC 1VQMI 1POGA 3TL4X 3LOCA 3I53A 5EZHA 3OYIA 4XLFA 3HGGA 2VXDA 4RB2C 2EFNA 4H4KC 5HVQC 3KEOA 4IQJA 3BJOA 4RAGA 2FQ3A 4PJ0C 2R5YA 3UR3C 4KYWA 3K4CA 4WCGA 4CCJA 1KQ8A 2V7FA 3BTLA 1YYVA 2NYXA 1X58A 3DKYA 1D5VA 2Y9YA 1V54H 2B0LA 1XMKA 4R8HA 2E1OA 2AO9A 5JVGF 3T0YA 4A3CJ 1WJCA 5KAFC 2FX0A 1RI7A 1BIBA 3GTPJ 1MBGA 4HOBA 2H94A 5J1RA 4KT6A 3CTAA 1W0TA 3W3CA 3F72A 2EQRA 3SYTA 3JRGA 5LRSA 2W84A 2EK5A 2TDXA 2ZXWH 1X4OA 3DEUA 1QNTA 2L4MA 3CCYA 2PI0A 3QYBA 2HQAA 1RKWA 2AXTC 4CH7A 2BOLA 4BU2A 3HSRA 3WHBA 4PJNA 1SD5A 2RV8A 2XPVA 3HUGA 2XDVA 2BGCA 1A35A 1UJ8A 2ZXIA 1L3LA 4N4NB 2R0QC 4A5NA 1YRNB 4QSHA 4WWCA 2HOEA 3S93A 3TP3A 3ERED 2WY7Q 3HDDA 1YQAA 4FHTA 1BW6A 3EUHA 4EVIA 4B47A 5IP6A 1E17A 5F0HA 4V2FA 4XRMA 3DCFA 4F92B 1ETYA 3AG1H 1WVRA 2Z5UA 5HLGA 2LC2A 3JSPA 5F1JA 3S3NA 1N78A 3HJEA 1E3HA 4BXFA 2GM4A 2D45A 1T08B 3S1NJ 1CGPA 1R36A 4RAYA 4AIKA 4M6VA 2V9KA 5CPRB 2KJBA 3K2AA 2K86A 4HX8A 1MW7A 2KPMA 5D5XB 2L9NA 2JUGA 2OQGA 1ZARA 4ZYHA 2PX9A 1XTAA 4MFEA 4Y15A 1PVEA 5HDGA 4EQQA 1BBYA 1HKSA 1QHHD 1BI3A 1JUSA 1SD4A 1TNSA 3H9GA 3QYEA 2KRFA 2L7ZA 2D1VA 1D0ZA 2RQQA 1T0FC 2DU9A 3EDPA 2EB7A 1OYYA 4DZPA 4HDVA 2BVMA 3CCEI 3HG9A 5H2FC 4OIPF 5HODA 1Y1WJ 3A0HC 4G6QA 1S3JA 3B6CA 3QPSA 2LTPA 3ZMDA 1HSJA 4BHBA 4CZCA 2NNYA 3OYDA 1VQLI 2E19A 2IA0A 3W6KB 4MIMA 2F5VA 4P5OA 3LL7A 4EJUA 5M5WJ 1YG2A 1MBKA 1VQ9I 3KEQA 5FFZA 5CJ9A 2GWRA 4U87A 4D0PA 5FJ8J 1O3TA 2WA0A 3NAUA 5FKNA 4A3EJ 1B8IB 1JGSA 5IOYA 4Y3OA 3E5QA 4WXHA 2DA5A 4BQNA 4OAYA 2MFZA 1TC3C 2M5WA 1IGNA 1XMAA 3ECHA 3HRTA 4BQAA 1XPXA 3KZIC 2VKDA 3A2KA 2K9QA 2Z99A 4XLNF 4I0BA 2LKPA 2X48A 3GFIA 2BW3A 4B48A 1E0EA 3WGIA 4L5IA 1LJ9A 5J8CA 4E6KG 3BR2A 4ZH4F 4GO1A 4OMZA 1NH3A 3GFJA 1TWGJ 2HOAA 2VQCA 2X6OA 1ZRDA 3DEWA 2XF7A 2YSRA 4YIFA 4G7HF 1YLFA 1X3WB 2CQXA 1Z7UA 3BTIA 4RB3C 4E7HA 3OYEA 2EFOA 4L9NA 4II3A 3OY9A 3ZQLA 1J75A 1G3YA 2DK8A 1PYVA 3QRFF 1JGGA 1DPUA 3BJ6A 2K40A 4BDYA 1I1SA 4EGYA 3RQ4A 1OISA 2WB1N 1BM9A 4U88A 2XRLA 3HKZN 3ZQGA 1YJ9I 4CCNA 1IJWC 4B43A 3O6BB 2RKHA 2OU2A 1LE8B 4MTDA 5M3FJ 3PUBA 2K4BA 2VN2A 4AD9A 2IEKA 2Z2SB 5J3LA 4XLEA 4XKBA 1RR8C 2VE8A 2JT1A 3U21A 3GCMA 2P81A 2V1XA 1HDDC 2HOTA 2R93J 3S2DJ 2HQRA 3LFKA 2DMUA 2W57A 2R7VA 1ULYA 2DDAA 4ABZA 4ESBA 4BE0A 1IN8A 3T1BA 4JQFA 3DBHB 2STWA 4L18B 3FXOA 2UXNA 3QP5A 4C2TA 3TP0A 5L3CA 3KEYA 4GRIA 3IH2A 4BKXA 3SEQA 3B02A 3MKLA 3TW7A 2CQQA 3PSIA 4I76A 3OV8A 1GHCA 3TMOA 1UFMA 3QODA 3PSFA 4N4OB 2A5YB 4AYBN 4EM1A 5D5VB 3S8PA 3HKZA 1V3FA 3VSLA 1ZLKA 2R7DA 2EZLA 3ABTA 4BHCA 3ZQCA 2CV0A 1MJ9A 1S9HA 4ZYEA 4DOZA 3K1PA 1PUFB 1A6IA 3M1EA 3H0GJ 2KDOA 4OOIA 1OPCA 2ZFUA 4CXFA 1J09A 2G7HA 1I1GA 3L2QA 3FHNA 2OCCH 1RPWA 4N9IA 1HSTA 2XKOA 4UVCA 3JSOA 1UHSA 2GA1A 5K7HA 1IRXA 2KZVA 5D5UB 3LSJA 3BT9A 4BYYA 1Z6RA 1PP8F 1UHWA 4A3JJ 2KIFA 4AYBA 2ZXHA 1X2MA 5DM6F 3H3VK 4B3AA 3OYBA 1R9TJ 4MEXF 2JWTA 2NXNB 2FMYA 5J4VA 2CYYA 3GZNB 1W36D 2XHKA 4A3BJ 5B3SH 3RIRA 1WJBA 4UB8C 4KA4A 1R22A 4A2UA 2KQRA 1OR7A 1RRJA 4XKCA 2DT6A 3J81Z 1LDJA 2DFIA 4UUSB 4Y17A 2JJ7A 4HZFA 1Z6TA 4LJZF 2J5OA 5GTHC 4XORA 4XL9A 5E3LA 3H5AA 4PCQA 2M2EA 1IV8A 3SFZA 3R4KA 2VJIA 1VQ4I 2YU3A 3FM3A 4AIJA 1DP7P 4CCMA 1TLHB 2P6SA 1RNLA 1WPKA 5B5EC 4I01A 3V7SA 3V7CA 1RUOA 4YELA 1OKRA 4A3DJ 1BR2A 5JLWA 3FX3A 5HLHA 4ZTJA 4JP0A 1E2XA 3WTTC 1YX5A 1SAXA 4G7OF 1K78B 1W5CC 4KN4X 3KX2A 1BI2A 1Z0XA 2QLZA 2BY2A 3K7AJ 3SDGA 2FBIA 2XRNA 5GAEJ 2QCOA 2FQ4A 3L09A 5LGUA 3ZCOA 1P7IA 4XRFA 5EGOA 3FK7A 2BHYA 4S04A 3WE2A 2ZFWA 2GIZA 3TDUC 3JR9A 1TWAJ 2F4MB 2IA1A 2TCTA 2E1NA 4M6YA 3WTYC 1FC3A 1WJFA 2HDDA 1J7KA 2XAHA 2CQ7A 1G2HA 3CCLI 3L00A 2HZDA 3EUHC 2R5YB 2ECBA 2EFPA 2KP6A 3FZVA 4C9YA 2DT7B 1H89C 2X6XA 3GEZA 2ADUA 2QSHX 4P96A 2DYRH 3EPZA 4QTRA 1SVLA 1MMGA 3KP2A 2R7OA 3ZQHA 5AONA 2FXAA 4YFXF 5HS9A 5IP9J 3I55I 2QENA 3HXLA 4XQFA 2X85A 5LGNA 3HOZJ 3C2GA 3QYFA 2HPMA 3GTQJ 3LAJA 3ZQQA 3VODA 4FX4A 3SDBA 2HEOA 1I3AA 5CVRA 1IZ1A 4N9HA 4IRGA 3FXLA 3N05A 5F27A 3PNVA 2MLGA 2R4GA 3M4OJ 1L0OC 3HUGB 1G3WA 4MO7A 2A3SA 5FD6A 4LITA 1FOWA 3KZZA 2LRDA 3J80Z 5BPDA 2KFDA 2ZJPF 2MYSA 1S7OA 2DI3A 3KLOA 1T2KA 2V1NA 1FY7A 3K4NA 2I8DA 3ABKH 1H0MA 1ZG1A 1U78A 2KIQA 1H9GA 4LLGF 2X4HA 1LB2A 1S6LA 1KU9A 1JKQC 2Y75A 1BOBA 3AKZA 3JRHA 4L9TA 3L2CA 3BR5A 1SFXA 2DA2A 2PQ8A 4CCLA 4G6TB 5GPCA 3CCRI 1D3YA 2M0MA 4M74A 2A07F 4I7HA 1QQIA 3D0SA 4X1EA 4BL0B 1QVUA 4D5CA 2Q2EA 2DK5A 1MBJA 4D7NA 2QBYA 4Q47A 3EUAA 3ASOH 1AU7A 5HS8A 2M4GA 4XONA 1IUFA 2A68F 3GTJJ 2COMA 2A5WA 4A69C 1GDTA 2GAUA 3MKZA 2PBIA 1OMIA 3BQZA 2R7FA 1Z05A 1O57A 1N77A 4Z2YA 1U6GA 2DYSH 1U8RA 2BY3A 2GQQA 2PMHA 5DDGA 4LD5A 3OYLA 2VC1A 2R92J 3WHCA 3ML6A 1JKRC 4L5JA 1HF0A 4HAMA 4LOCA 3PQKA 2QSGX 2IVMA 1YJWI 2DA4A 1T0FA 1QPMA 2CO5A 2OZ6A 2ZNYA 3LSKA 2XC7A 3CCQI 1MDMA 2JA8J 3EYIA 1Y56A 4BXUA 3S14J 1I5ZA 2V4JC 4FE4A 1IN6A 3F0CA 1AWCA 3ZQ7A 3HOUJ 4BH9A 1R00A 3AG2H 1FMWA 4OAZA 2L9RA 5E1XA 1PP7U 1MSEC 3HOSA 3GTGJ 2FBKA 4BBRJ 2LBFB 2K27A 4NC7A 4LGWA 3P9IA 5LRRA 1Y8QB 2F4IA 2LKXA 3DXJF 3K9TA 2BW3B 3MD2A 3S3MA 1NG6A 3RJPA 3CMAI 2G7UA 2ETHA 3CLOA 5K5RA 3DF8A 1MMAA 3ZMZA 2HTJA 3QWLA 1X1CA 2L7FP 3DPLC 3JRCA 1QRYA 3ZOBA 1MNEA 1UG2A 2LFBA 5LLQA 4U0YA 1V5FA 3R6SA 3ZN1A 3DFGA 4Y13A 1B9NA 1FBUA 3DU6A 3DEEA 3ABUA 5CYVA 2WBMA 3I3LA 3S1MJ 1P7JA 1SFOJ 2IS4A 4II2A 4RGRA 2NS7A 3NWSA 1IAWA 3LSTA 1IRGA 3H35A 2KHMA 4RDUA 2IPQX 1MJAA 1Z21A 5FKMA 3X2QH 2JA2A 4UVAA 2DMTA 3G2BA 1YS7A 3JTGA 2LSOA 4Y52J 2Z1DA 3ERMA 3GFLA 3ABMH 1KZHA 4C2MJ 1ETOA 2CS3A 3F6VA 2A05A 2M9HA 4HDUA 4CHUA 1T6SA 2ZC2A 3VDXA 2PMUA 3IKVA 3GLLA 3OS1A 4A6EA 4IHSA 2D1HA 3K2ZA 1IW7F 5LFAA 4D1QA 3ZQFA 1X1DA 2ELJA 4XR6A 1YFHA 3S17J 2BBYA 1KU7A 2EFWA 4GYIA 1UAAA 3DTIA 2CSOA 1S8NA 3K4KA 3SFIA 5K5QA 1OR7C 3MN2A 4MQ9F 4HF2A 3GVAA 1A5JA 5LD2C 2IP2A 3F8BA 5JI6A 1NK2P 1FLIA 1GUUA 1D1BA 3ZN0A 5FB2A 1ON1A 4BGDA 2UXXA 1JT6A 2E7WA 4HQMA 3OYNA 1IDZA 2KMUA 2V6EA 3P9CA 3QAHA 4Y7NJ 1J5YA 1U9OA 1K61A 2BE5F 4A0XA 2R7WA 2CMPA 2XAFA 1YO5C 4BAYA 1OYWA 3GLXA 4C3HJ 4KFCA 3QU3A 1Y0NA 3WG9A 1JXSA 5KHDA 2LYCA 5EEGA 2KJCA 2X6WA 5GAGJ 1IN7A 4JK1X 2XB5A 4XSZF 4KN7X 4CICA 2P8TA 1UELB 4LFUA 3M8EA 2CV2A 3BP8A 3Q5FA 1D0YA 3CMMA 1P4AA 3FHZA 2UWMA 1E3PA 4EJVA 3RKXA 3E6MA 5JHUA 5HLIA 1T33A 3FK6A 3IH4A 3OYGA 1GXQA 3L7WA 5KNLA 5IP7J 2CQKA 3KCCA 1APLC 2XAQA 3GWZA 3RCOA 2VQGA 2XKPA 1VF9A 3KP7A 2P7VB 4C30A 1O3QA 4LIUA 2YUSA 1K6YA 3LMMA 3D1NI 1XCBA 4E4HA 4IHXA 5EF6A 3H1CA 2EZHA 3L1PA 1QU3A 3T5XA 2W00A 3LA2A 1Z9CA 4OU0A 1OCZH 2KDZA 1GT0C 2V26A 1SD7A 4IHWA 1VQNI 3TGNA 3FXUA 2JPCA 1TQIA 2O03A 3BZCA 1O3SA 3BY6A 3S1QJ 3K4JA 1H88C 2X6YA 4UVBA 3VFZA 3FBIB 5L3EA 3M7GA 4OMYA 4IRIA 2VT2A 1EA3A 4G12A 5JR3A 2NVTJ 1TW3A 2UV1A 3K70D 2CUZA 2CWEA 5JHFA 1UZCA 5EGOB 1WH7A 5GPAA 5FLMJ 3WGHA 1DGWY 5KK1A 2NAZA 3J7AY 2KIUA 4IHTA 4BDZA 2VQHA 1Y1VJ 3L2WA 5B1BH 1Y0UA 3ASNH 3QPHA 2AS5F 2GXAA 3O8HA 5TISC 1I3QJ 2EH3A 2JMWA 3S3OA 2RDPA 3HBLA 1MJBA 5TJJA 1SC7A 2ESHA 3I4MJ 2DO7A 3CMYA 4UY8I 1FIAA 1FMVA 2L01A 4NB5A 2L9VA 1MD0A 5DTDA 1HOMA 2V9PA 3LFUA 3GF2A 3MZHA 3PFYA 1HW5A 3SHFA 3BROA 2H1LA 2GBYA 2XUBA 5GTIC 3WU1B 4IX7A 2LOOA 2K9NA 2XGEA 3NWTA 4NQWA 2MC3A 5TRDA 5A2QZ 5K7ZA 3E1SA 5F64A 3U1DA 2ELKA 3IRRA 3AG3H 2WAEA 5ERIA 4ZC3A 4DJAA 3OSGA 3FXJA 4WX9A 2P5LC 2IGOA 3ZR8X 2F5CA 3ZP5A 2ECCA 4W97A 4ZZDA 5DUIA 4XOTA 1IN5A 1YIOA 2QVOA 3VWBA 4HSTA 4UV9A 4OIOF 3RPQA 3BG7A 3A01B 3L2UA 2HVSA 3WU2C 1FSHA 2QYOA 3OYJA 1SAUA 1BR4A 1G3TA 2STTA 2MBFA 5M5XJ 3PJRA 2VBYA 1D8JA 4Y4RA 4BY7J 1X2NA 3IAM2 2IJLA 4G9YA 4I09A 3CCVI 2E7XA 3BLYA 4B8XA 4BNCA 2Z33A 1VQ8I 2A61A 5IYCJ 2DJIA 5EYRA 2Q2EB 4DYRA 3BR0A 1USTA 1M1EB 2QBYB 1TW2A 2JSCA 3RTRA 2M34A 2M87A 3V8LA 5CLSA 1ERDA 4HF1A 2ZBKA 2M4KA 4BQQA 1U9NA 2A6HF 5BOXA 4ANJA 3GO5A 3I9V2 2LBFA 1Y39A 3KPHA 5C4JJ 5FGMA 1X4PA 4X6AJ 3K1MA 4FE7A 2UZKA 1GLNA 2O5RA 4RAFA 2XGDA 3JCUC 4HW0A 3N4MA 2A6TA 1V4RA 3K4BA 3NARA 3HOTA 5H6QA 1N75A 3WU0A 4TV7A 3Q0VA 1SFKA 2YR2A 4E7LA 1DQUA 3WTWC 5TGTA 2O9LA 5EZGA 2L7MP 5D8KB 1RZ4A 3K69A 3UKGA 3C3WA 2Z9OA 3I5UA 2IS6A 1WHUA 2DFFA 2FUG2 1MDMB 4D5FA 1U5TC 4DYQA 4PGGA 3VYTB 1ETXA 4XKVA 4KIGA 1FZPB 2R7ZJ 3WTZA 3MCZA 1ZKGA 2CH0A 4L0ZB 3D5LA 2M8GX 2K02A 1JE8A 1HA8A 1TNTA 1LUJB 4M3FA 1VQ5I 4KITB 1B6AA 1UHMA 1V5EA 1V5GA 3CZ6A 3LSIA 2XGXA 1XGSA 2LH9A 3BDDA 4RA2A 4HNUA 1X3UA 4WXCA 3ROUA 2DLLA 2XV4S 4RLQA 2DQRA 1LEAA 3VB2A 2DBBA 1W7PD 4AWXB 2HS5A 2FF4A 5FRMA 1XGNA 1WI3A 1O3RA 1S7AA 5J8FA 4M6XA 4L0YB 1FYMA 3OS2A 2HQNA 4A3KJ 4A6DA 2XIGA 1DGRM 1MMDA 4A0YA 2PJPA 3BJAA 4DYCA 4ESFA 2WB1A 3CQZJ 2JQ7A 1XGOA 2ELHA 4WF2A 2CU7A 1K7AA 1QZEA 1JKPC 3A03A 4A0ZA 2OJED 2ZB9A 1WKMA 2NNNA 3NQOA 2CRGA 1G6NA 4HNTA 1ETWA 1ZELA 2O8XA 4NC6A 4LMYA 5LHGA 1MH4A 4JX6A 5F08A 3HSEA 3FMQA 3MZ8A 4QWQA 4AVZA 2EIKH 2EBIA 4IOCF 4HLYA 5GADJ 3BTCA 1BC7C 4GXOA 1DU0A 4KMFA 2KIMA 3R0JA 5E3OA 6PAXA 4PJJA 1EH6A 1R4MB 2QQ8A 5L3DA 1ZHFA 2XF5A 2QZ8A 3JAMK 2R7XA 1YW8A 1GVJA 2C6YA 2WADA 3GW2A 5JLXA 3IKTA 1WI9A 1HDPA 4BHPA 5IYDJ 4PFPA 3R61A 3OYMA 1NK3P 4XMYA 5FLXK 1ZN2A 1BL0A 2KLOA 1H8AC 4F91B 2CUFA 3VYSB 2TRTA 4M3GA 2VASA 2HQ5A 3LA3A 3BCBA 2V9VA 2DDBA 3J81K 2NOJB 4UUVA 2V1DA 1WSUA 2F5DA 4AM3A 1D0XA 1IXCA 5IYBJ 3UNGC 5E8IA 1PJRA 4J19A 4KDPA 3JRFA 1XCVA 3HHGA 4QIWN 3BG9A 3BCAA 4UUTA 4PSXA 2M0CA 3W2AA 4BBSJ 2ID3A 1BN5A 4HPQA 1F4KA 2HVQA 1QZZA 5IY5H 2DXIA 4AIHA 2VLAA 4HNVA 2WV0A 5J47A 1OCTC 2Y0SN 2O8KA 1BI0A 3JW4A 5DD8A 2DA7A 2FOWA 2K9SA 3ZGKA 3OYKA 3W2WA 2GLOA 2MH9A 1VI0A 1MNMC 3DKWA 3S32A 2X1CA 4EM2A 2EFQA 3I58A 3L9FA 3HTUA 1I6HJ 2FSWA 4C3JJ 3C7JA 5L3FA 3CCJI 2CW0F 2L9SA 1FOXA 3WTVC 1SVMA 1HC8A 2NVXJ 2DMNA 4YRVA 4U7BA 3M07A 1TT0A 2DMPA 4A5MA 2WTEA 2MSYA 1OCOH 2E60A 2GOXB 3B73A 2F6CA 2RNJA 3EQLF 2MD5A 2LR8A 4IHYA 3EUKL 3S2HJ 3GZ5A 3TO6A 1FX7A 1ZR4A 2RNGA 3ELKA 1B4AA 2WC2A 2Y0SA 5BMZA 5IT9Z 4ETSA 2NVQJ 4FQGA 5DEQA 2DOEA 1K6OA 4HRIA 4AU7A 4B1RA 5EG0A 1RUNA 2DCEA 5HNFA 4M72A 3BG6A 4IJAA 4AVPA 3GTOJ 5BNGA 2M1BA 3TEDA 2ZNZA 1W0UA 2K3FA 2R7TA 1FBQA 2DA6A 3FXKA 4JBAA 3IV5A 1MBHA 4L5EA 3O3KA 5F0FA 1LEBA 2CG4A 1YW9A 3BR1A 2QF7A 1YI2I 2V6CA 1J0RA 1MMNA 4HF0A 1XS9A 3PUFA 1RIOH 2GZWA 2M7AA 3RKQA 4HBLA 2ZO4A 3EETA 3E5XA 3J80K 2WAQN 1ORKA
chains in the Genus database with same CATH topology
2VBWA 4Q48A 2HTSA 2RGVA 3W6JB 4MHGA 4LK0F 3ECOA 4R79A 1MGTA 4FT8A 4EGZA 3FWEA 4P9FA 3TOBA 4ZYGA 1MKMA 3BWGA 4B09A 2VE9A 1K79A 2MLKA 3WGGA 1SFEA 1B9MA 2FA5A 5CVVA 1LDKB 1C0WA 2H6CA 2FOKA 5E20A 3MEXA 3ULQB 4M73A 1FP1D 3C1DA 1P92A 2LF7A 2EV0A 3TOAA 2PN6A 4ON0A 3BPVA 2OQRA 3RYPA 2YX7A 3KETA 4ENMA 1LQ1A 1R1UA 4KNYA 1Q1HA 2AXLA 3QP6A 3F22A 4RGUA 2HYFA 2Y48A 2L3DA 5K5OA 1EH8A 2A6EF 2EJRA 1DUXC 3CO6C 3HHHA 3GXOA 3T8TA 4H0EA 4LLNA 1KA8A 3ZMTA 4HX7A 1P6RA 1FYKA 1R7JA 2H09A 2VONA 3V7RA 5EEHA 3M9AA 3R0AA 2O0YA 3E5UA 3E6DA 4K2EA 4O5VA 5E1WA 1R1VA 1JHHA 1GXPA 2PFBA 3GX4X 1U5TA 4PDKA 2VBZA 2XROA 3NEUA 3I0TA 1IUYA 1LDDA 5E18F 1NHAA 2BEOA 3VEPA 1FOKA 3HRSA 1XSVA 3GFMA 4DNCA 1I27A 1KU3A 5HOOA 3IRQA 2L54A 5L3BA 2QQBA 3LAPA 1P4XA 2PEXA 3AAFA 2ISZA 4LK1F 2MH2A 5ILUA 2RVCA 3E3VA 1SD6A 5J6XA 3COAC 4ENJA 1HKTA 3MZYA 4RB1A 2RC4A 3KP5A 3I59A 4ASNA 2BYVE 1FYLA 4CYDA 1SFUA 3CUOA 1FP2A 4DQ2A 1R5HA 2X0LA 2FBHA 4S05A 5D5WB 2Y0MA 3RYRA 2ISYA 5ICFA 3V4GA 3LQRA 2F2EA 4IXAA 1F9NA 4YIIA 4KICA 3F8FA 3P9KA 2YX4A 1XD7A 5LHHA 5E8GA 1QZYA 1CF7A 2PG4A 1Z91A 1XDSA 4U0WA 4Q5SF 2DT5A 3U9GA 1ZGAA 3TQNA 3CDHA 3ISPA 2K7LA 5LEKA 1KQ9A 3F6OA 1XDUA 2QQ9A 2ZJ2A 1TQPA 3FMSA 1DDNA 2FMLA 5FD5A 3TO7A 3F21A 1EV7A 4CO8A 2OBPA 5ILSA 4UHTA 2HFHA 1SMTA 5DV5A 5ICEA 3OOPA 4GYGA 2JRTA 2P7CB 4WXDA 2Q0OA 4I0AA 2F5FA 1W7PA 2MA3A 1XGMA 3KP3A 2CGPA 2XAGA 1R5GA 2W24A 1F5TA 2QQAA 1T98A 2OAZA 4PZJA 1OYIA 1R1TA 5HS7A 3LA7A 4ZZLA 2P5VA 4OINF 5ICGA 5L3GA 1PDNC 5DD4A 5K1YA 4M9ZA 4OIQF 2DW4A 5E17F 3GZ6A 3CUQC 1LVAA 2EV5A 5D4RA 2P6TA 2L02A 3HSFA 2O3FA 5A2QK 1B59A 2K4JA 2W25A 1O7FA 1FNNA 2OD5A 1F1ZA 4P55A 5ED4A 4EJTA 2DTRA 2OZUA 3PQJA 2D2WA 4NHJA 3V8KA 1ODDA 3BZ6A 1BJAA 1ZRFA 5D4SA 1ZLJA 3T8RA 2FNPA 3WTUC 1T38A 3HRMA 5D6EA 2GXBA 3GUDA 2JPBA 3CO7C 2V79A 1W5SA 5CVJA 1XSDA 3LWFA 3CUQB 5LEJA 1FT9A 2RQPA 1R58A 2GA2A 3FF5A 2F5EA 1ZGJA 3F3XA 3GYHX 2JTVA 4O3MA 1EH7A 4HA8A 3ZMSA 4ESJA 4M71A 3KLNA 1ON2A 2L4AA 4HLXA 2A69F 5BS6A 3F23A 4N0BA 2FU4A 2YPRA 1XSXA 5BQTA 4LB6B 4M9XA 1BC8C 2H6BA 3KE2A 1ZH5A 3PFIA 1A04A 3WTXC 4EV0A 3KZYA 2XASA 2ZCWA 3E97A 4KUMA 1WQ2A 1KYWA 4HV5A 2ZMEA 4G6DA 3WTSC 1FPQA 2HDCA 3REOA 4E70A 2HZTA 3DQVC 5FO5A 2R3SA 3NRVA 2VC0A 3SZTA 1TTYA 1TQMA 4G8XA 1U5TB 1USSA 4IVNA 2DAOA 4LG0B 3QOPA 2V1UA 3P7NA 3MFKA 2W85A 1IF1A 5DUKA 5H6RA 3RDIA 3TDZC 1HQCA 2G9WA 4ZYDA 4GCVA 1BIAA 4UNOA 2NS0A 2Q8KA 4XBFA 2VOOA 3J7AO 4G7ZF 4MEYF 4YG2F 3K0LA 1J2XA 4XLPF 1MZBA 1ZG5A 3QPTA 5HDNA 3I59B 4EM0B 2E1CA 4RS8A 4M9SA 3JAMZ 4L9VA 2XAJA 5DYMA 5HDKA 5FLXZ 1FWZA 1TBXA 1J9IA 2DPUA 4Q4ZF 1IN4A 4ENKA 1XB4A 1I6XA 1VTNC 2GXGA 5DCFA 2IRFG 2BV6A 1D8KA 5DCMA 4RAZA 2M45A 2FEZA 3H3UA 1QGPA 5BPIA 4CZZA 3WODF 1CF7B 1PUEE 1XN7A 4UXNA 3S2WA 3SQNA 2FNAA 2OA4A 2ZKZA 3F8CA 1ZRCA 5IT9K 2P4WA 2DPDA 4WK8F 1IXRC 2VT3A 4ENNA 5D6FA 1O7LA 3U2RA 1AOYA 2DQLA 2HKOA 1YS6A 3RKWA 1KU2A 2RN7A 3R60A 1B1BA 4IPAA 2VODA 1DPRA 1HW2A 3KP4A 3G3ZA 4QLCU 3V8JA 3IC7A 1KGSA 1JHFA 3BPXA 2FRHA 3ZMVA 1W7PB 3HIFA 4U7DA 4YFKF 1WWXA 3MQ0A 1WRJA 4F7ZA 4I98B 1P2FA 2J5PA 1FSEA 2P5KA 3SZPA 3RPUA 2M30A 5AIPA 2ACJA 2EA4A 1U3EM 1IXSB 1LNWA 3FXQA 1STZA 2IW5A 3CUQA 5CVUA 5F6FA 3H92A 4I02A 5KVRA 4GGGA 1ZAOA 1UCRA 3DPTA 3ZMUA 1ZREA 5AIQA 4FX0A 5IT3A 4RGXA 4EJWA 2KKOA 3WE3A 4HX4A 4CGZA 3KFWX 2IT0A 1FBSA 2QWWA 1HKQA 2GIVA 4EMSA 3H3ZA 4EJOA 1S29A 2FE3A 3IWFA 2WWYA 4MNUA 1KYZA 2ESNA 4HQEA 5FFXA 5LBQA 2ZXJA 4MGRA 4YFNF 1QO0D 1Z1DA 3TKYA 2O61A 3KP6A 3F8MA 3BOQA 2QUFA 4LLLA 3FMRA 1R23A 2EV6A 1YTYA 5JVTA 2HYGD 4PGHA 4CDGA 3O2PE 3HYIA 3C18A 4UV8A 3SXYA 3CJNA 1G3SA 3IHUA 3QU6A 2Z3YA 3RKYA 4LG0A 4R1HA 2H27A 5E1ZB 1REPC 1P4WA 2ZMEB 3Q9VA 5ILVA 2HWVA 2QM3A 3I4PA 2EA2A 4IRHA 4IF4A 2HR3A 3E6BA 5ICCA 3ZPLA 3I71A 3MWMA 3IL2A 3N97A 2NRAC 2M8EA 3E6CC 3M8FA 2XVCA 4MQVA 3LQQA 3F8NA 3EYYA 1HXDA 1YW7A 2LNBA 3RI4A 3MAJA 1SMYF 5JFRA 4LB5A 4U0VA 4KT5C 4RB0A 2JZYA 4HV6A 1IRFA 3I54A 4XSXF 2CFXA 1ZG3A 4P9UA 2VOPA 3JTHA 3TO9A 1J59A 2O6GE 4G94A 1BI1A 3DP7A 1HW1A 5CVIA 2VBXA 5D8LB 5F1RA 3FM5A 4MTEA 5H20A 3HRUA 1H9TA 1KQ0A 2EWNA 3G73A 4O6JA 5LHIA 1ONVA 1UB9A 2LF8A 4HYEA 3HTSB 4OIRF 2HGCA 3DV8A 4I2OA 3IWZA 4KMUX 2VXZA 1W5TA 4KIFA 1QBJA 4RGSA 2LDUA 3FXRA 4A12A 1BOAA 1U2WA 1T39A 2PLYA 5LGTA 1K78A 1ZYRF 3K1NA 2IA2A 3Q9SA 4L9JA 2HKXA 4KIBA 3I64A 5DCMB 1HBXG 1W4MA 3VOEA 3I53A 4RB2C 2EFNA 5HVQC 3KEOA 3BJOA 2FQ3A 4KYWA 4WCGA 1KQ8A 1YYVA 2NYXA 1D5VA 2B0LA 1XMKA 4R8HA 3T0YA 1RI7A 1BIBA 4HOBA 2H94A 3CTAA 3F72A 5LRSA 2W84A 2EK5A 2TDXA 3DEUA 1QNTA 2L4MA 2PI0A 3HSRA 1SD5A 2RV8A 3HUGA 2BGCA 1L3LA 4A5NA 4WWCA 2HOEA 3ERED 1YQAA 4FHTA 3EUHA 4EVIA 1E17A 2Z5UA 5HLGA 3JSPA 2D45A 1CGPA 1R36A 4RAYA 4AIKA 2KJBA 2K86A 4HX8A 5D5XB 2OQGA 1ZARA 4ZYHA 4Y15A 5HDGA 4EQQA 1BBYA 1HKSA 1SD4A 1BI3A 1TNSA 2KRFA 2D1VA 4HDVA 3EDPA 2DU9A 1G4DA 2EB7A 1OYYA 4OIPF 4G6QA 1S3JA 3ZMDA 1HSJA 4BHBA 2NNYA 2IA0A 3W6KB 4P5OA 4EJUA 1YG2A 3KEQA 5FFZA 5CJ9A 2GWRA 4D0PA 1O3TA 1JGSA 3E5QA 4WXHA 2M5WA 1XMAA 3ECHA 3HRTA 4BQAA 2Z99A 4XLNF 4I0BA 2LKPA 3GFIA 3WGIA 4L5IA 1LJ9A 5J8CA 4ZH4F 4GO1A 4OMZA 3GFJA 1ZRDA 2YSRA 4YIFA 4G7HF 1YLFA 1Z7UA 4RB3C 2EFOA 4L9NA 1J75A 1G3YA 2DK8A 3QRFF 1DPUA 3BJ6A 1I1SA 4EGYA 1BM9A 4U88A 3O6BB 2RKHA 2OU2A 4MTDA 2K4BA 2VN2A 4AD9A 2VE8A 2JT1A 2V1XA 2HQRA 3LFKA 2W57A 1ULYA 4ESBA 1IN8A 3T1BA 4JQFA 2STWA 4L18B 2UXNA 3QP5A 5L3CA 3B02A 3OV8A 1GHCA 1UFMA 2A5YB 4EM1A 5D5VB 1V3FA 1ZLKA 2R7DA 3ABTA 4BHCA 1MJ9A 4ZYEA 3K1PA 3M1EA 4OOIA 1OPCA 4CXFA 2G7HA 1I1GA 4N9IA 1HSTA 2XKOA 4UVCA 3JSOA 2GA1A 5D5UB 4BYYA 1PP8F 1Z6RA 1UHWA 2KIFA 4MEXF 2FMYA 2CYYA 2XHKA 3RIRA 4KA4A 1R22A 4A2UA 1OR7A 3J81Z 1LDJA 2DFIA 4Y17A 4HZFA 1Z6TA 4LJZF 2J5OA 4PCQA 3SFZA 3R4KA 2YU3A 3FM3A 4AIJA 1DP7P 1TLHB 2P6SA 1RNLA 1RUOA 4I01A 3V7SA 3V7CA 1OKRA 3FX3A 5HLHA 1E2XA 3WTTC 1SAXA 4G7OF 1K78B 4KN4X 1BI2A 2QLZA 2FBIA 2XRNA 3L09A 5LGUA 4XRFA 4S04A 3WE2A 2ZFWA 3TDUC 2IA1A 3WTYC 2E1NA 4M6YA 1FC3A 1J7KA 2XAHA 3L00A 2EFPA 3FZVA 3GEZA 2ADUA 4P96A 3KP2A 5AONA 2FXAA 4YFXF 5HS9A 2QENA 5LGNA 3LAJA 3VODA 4FX4A 2HEOA 5CVRA 1IZ1A 4N9HA 4IRGA 2MLGA 1L0OC 1G3WA 2A3SA 5FD6A 3KZZA 3J80Z 5BPDA 1S7OA 2DI3A 3KLOA 1T2KA 1FY7A 1H0MA 1ZG1A 1U78A 1H9GA 4LLGF 2X4HA 1LB2A 1S6LA 1KU9A 2Y75A 4L9TA 3L2CA 1SFXA 2PQ8A 1D3YA 4M74A 2A07F 4I7HA 1QQIA 3D0SA 2Q2EA 2DK5A 2QBYA 4Q47A 5HS8A 2A68F 2COMA 2GAUA 2PBIA 1OMIA 2R7FA 1Z05A 1O57A 4Z2YA 1U6GA 1U8RA 2GQQA 2PMHA 5DDGA 4LD5A 2VC1A 3ML6A 4L5JA 4HAMA 3PQKA 2IVMA 1T0FA 1QPMA 2CO5A 2OZ6A 2ZNYA 1MDMA 3EYIA 4BXUA 1I5ZA 1AWCA 1IN6A 3ZQ7A 4BH9A 1R00A 5E1XA 1PP7U 3HOSA 2FBKA 2K27A 4LGWA 3P9IA 5LRRA 3DXJF 3K9TA 3RJPA 2G7UA 2ETHA 3CLOA 5K5RA 3DF8A 3ZMZA 2HTJA 3DPLC 5LLQA 4U0YA 3R6SA 3ZN1A 3DFGA 4Y13A 1B9NA 1FBUA 3ABUA 5CYVA 4RGRA 1IAWA 3LSTA 1IRGA 2IPQX 1MJAA 4UVAA 1YS7A 3JTGA 2LSOA 3GFLA 3F6VA 4HDUA 4CHUA 1T6SA 2PMUA 3IKVA 4A6EA 4IHSA 2D1HA 3K2ZA 1IW7F 1YFHA 2BBYA 1KU7A 2EFWA 4GYIA 2CSOA 1S8NA 5K5QA 4MQ9F 4HF2A 3GVAA 2IP2A 3F8BA 5JI6A 1FLIA 3ZN0A 5FB2A 1ON1A 2UXXA 2E7WA 4HQMA 3P9CA 3QAHA 1J5YA 2BE5F 4A0XA 2XAFA 1YO5C 4BAYA 1OYWA 3GLXA 4KFCA 3QU3A 3WG9A 1JXSA 5EEGA 2KJCA 1IN7A 4JK1X 4XSZF 4KN7X 4CICA 2P8TA 4LFUA 3M8EA 3BP8A 3Q5FA 1P4AA 3FHZA 2UWMA 4EJVA 3RKXA 3E6MA 5JHUA 5HLIA 1GXQA 3L7WA 2CQKA 3KCCA 2XAQA 3GWZA 2XKPA 3KP7A 2P7VB 1O3QA 1XCBA 3T5XA 3LA2A 1Z9CA 4OU0A 1SD7A 3TGNA 3FXUA 2JPCA 1TQIA 2O03A 1O3SA 3BY6A 4UVBA 3VFZA 5L3EA 3M7GA 4OMYA 4IRIA 2VT2A 5JR3A 1TW3A 2CWEA 3WGHA 5KK1A 2NAZA 2KIUA 4IHTA 1Y0UA 3QPHA 2AS5F 2RDPA 5TJJA 1MJBA 2ESHA 2DO7A 2L01A 4NB5A 1MD0A 3GF2A 3MZHA 1HW5A 3SHFA 2XUBA 3BROA 3WU1B 4NQWA 5TRDA 2MC3A 5A2QZ 3U1DA 5F64A 3IRRA 5ERIA 4WX9A 2P5LC 2F5CA 3ZP5A 4ZZDA 5DUIA 1IN5A 1YIOA 2QVOA 4UV9A 4OIOF 3RPQA 1FSHA 2QYOA 1G3TA 2STTA 2MBFA 2VBYA 1D8JA 2IJLA 4G9YA 4I09A 2E7XA 4B8XA 4BNCA 2Z33A 2A61A 1USTA 2QBYB 1TW2A 2JSCA 3RTRA 2M87A 3V8LA 5CLSA 4HF1A 2ZBKA 2A6HF 5BOXA 3GO5A 5FGMA 3K1MA 2UZKA 4HW0A 3N4MA 1V4RA 3HOTA 5H6QA 3WU0A 4TV7A 2YR2A 3WTWC 5D8KB 1RZ4A 3K69A 3C3WA 2Z9OA 3I5UA 1MDMB 1U5TC 4PGGA 4KIGA 1FZPB 3WTZA 3MCZA 4L0ZB 3D5LA 2K02A 1JE8A 1TNTA 1B6AA 1UHMA 2XGXA 1XGSA 3BDDA 1X3UA 4WXCA 3ROUA 2DLLA 2XV4S 2DQRA 1LEAA 3VB2A 2DBBA 1W7PD 4AWXB 2HS5A 2FF4A 1XGNA 1O3RA 1S7AA 5J8FA 4M6XA 4L0YB 1FYMA 2HQNA 4A6DA 2XIGA 4A0YA 2PJPA 3BJAA 4ESFA 1XGOA 2ELHA 4WF2A 1K7AA 4A0ZA 1WKMA 2NNNA 3NQOA 1G6NA 2O8XA 4LMYA 5LHGA 3HSEA 3FMQA 4QWQA 4HLYA 1BC7C 4GXOA 4KMFA 2KIMA 3R0JA 6PAXA 1EH6A 5L3DA 1ZHFA 2QZ8A 3JAMK 1YW8A 1GVJA 2C6YA 3GW2A 3IKTA 1WI9A 4BHPA 3R61A 5FLXK 1ZN2A 3LA3A 2V9VA 3J81K 4UUVA 2V1DA 1WSUA 2F5DA 1IXCA 5E8IA 4KDPA 1XCVA 3HHGA 1F4KA 1BN5A 1QZZA 4AIHA 2WV0A 1BI0A 3JW4A 5DD8A 2MH9A 3DKWA 4EM2A 2EFQA 3I58A 3L9FA 3HTUA 2FSWA 3C7JA 5L3FA 2CW0F 3WTVC 4U7BA 4A5MA 2WTEA 3B73A 2RNJA 3EQLF 2MD5A 3GZ5A 3TO6A 1FX7A 3ELKA 1B4AA 2WC2A 5BMZA 5IT9Z 4ETSA 5DEQA 1K6OA 1RUNA 4M72A 4IJAA 4AVPA 2M1BA 2ZNZA 1FBQA 4JBAA 1LEBA 3O3KA 2CG4A 1YW9A 2V6CA 1J0RA 4HF0A 1RIOH 2GZWA 4HBLA 2ZO4A 3EETA 3E5XA 3J80K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VBW A;  4Q48 A;  2HTS A;  2RGV A;  3W6J B;  4MHG A;  4LK0 F;  3ECO A;  4R79 A;  1MGT A;  4FT8 A;  4EGZ A;  3FWE A;  4P9F A;  3TOB A;  4ZYG A;  1MKM A;  3BWG A;  4B09 A;  2VE9 A;  1K79 A;  2MLK A;  3WGG A;  1SFE A;  1B9M A;  2FA5 A;  5CVV A;  1LDK B;  1C0W A;  2H6C A;  2FOK A;  5E20 A;  3MEX A;  3ULQ B;  4M73 A;  1FP1 D;  3C1D A;  1P92 A;  2LF7 A;  2EV0 A;  3TOA A;  2PN6 A;  4ON0 A;  3BPV A;  2OQR A;  3RYP A;  2YX7 A;  3KET A;  4ENM A;  1LQ1 A;  1R1U A;  4KNY A;  1Q1H A;  2AXL A;  3QP6 A;  3F22 A;  4RGU A;  2HYF A;  2Y48 A;  2L3D A;  5K5O A;  1EH8 A;  2A6E F;  2EJR A;  1DUX C;  3CO6 C;  3HHH A;  3GXO A;  3T8T A;  4H0E A;  4LLN A;  1KA8 A;  3ZMT A;  4HX7 A;  1P6R A;  1FYK A;  1R7J A;  2H09 A;  2VON A;  3V7R A;  5EEH A;  3M9A A;  3R0A A;  2O0Y A;  3E5U A;  3E6D A;  4K2E A;  4O5V A;  5E1W A;  1R1V A;  1JHH A;  1GXP A;  2PFB A;  3GX4 X;  1U5T A;  4PDK A;  2VBZ A;  2XRO A;  3NEU A;  3I0T A;  1IUY A;  1LDD A;  5E18 F;  1NHA A;  2BEO A;  3VEP A;  1FOK A;  3HRS A;  1XSV A;  3GFM A;  4DNC A;  1I27 A;  1KU3 A;  5HOO A;  3IRQ A;  2L54 A;  5L3B A;  2QQB A;  3LAP A;  1P4X A;  2PEX A;  3AAF A;  2ISZ A;  4LK1 F;  2MH2 A;  5ILU A;  2RVC A;  3E3V A;  1SD6 A;  5J6X A;  3COA C;  4ENJ A;  1HKT A;  3MZY A;  4RB1 A;  2RC4 A;  3KP5 A;  3I59 A;  4ASN A;  2BYV E;  1FYL A;  4CYD A;  1SFU A;  3CUO A;  1FP2 A;  4DQ2 A;  1R5H A;  2X0L A;  2FBH A;  4S05 A;  5D5W B;  2Y0M A;  3RYR A;  2ISY A;  5ICF A;  3V4G A;  3LQR A;  2F2E A;  4IXA A;  1F9N A;  4YII A;  4KIC A;  3F8F A;  3P9K A;  2YX4 A;  1XD7 A;  5LHH A;  5E8G A;  1QZY A;  1CF7 A;  2PG4 A;  1Z91 A;  1XDS A;  4U0W A;  4Q5S F;  2DT5 A;  3U9G A;  1ZGA A;  3TQN A;  3CDH A;  3ISP A;  2K7L A;  5LEK A;  1KQ9 A;  3F6O A;  1XDU A;  2QQ9 A;  2ZJ2 A;  1TQP A;  3FMS A;  1DDN A;  2FML A;  5FD5 A;  3TO7 A;  3F21 A;  1EV7 A;  4CO8 A;  2OBP A;  5ILS A;  4UHT A;  2HFH A;  1SMT A;  5DV5 A;  5ICE A;  3OOP A;  4GYG A;  2JRT A;  2P7C B;  4WXD A;  2Q0O A;  4I0A A;  2F5F A;  1W7P A;  2MA3 A;  1XGM A;  3KP3 A;  2CGP A;  2XAG A;  1R5G A;  2W24 A;  1F5T A;  2QQA A;  1T98 A;  2OAZ A;  4PZJ A;  1OYI A;  1R1T A;  5HS7 A;  3LA7 A;  4ZZL A;  2P5V A;  4OIN F;  5ICG A;  5L3G A;  1PDN C;  5DD4 A;  5K1Y A;  4M9Z A;  4OIQ F;  2DW4 A;  5E17 F;  3GZ6 A;  3CUQ C;  1LVA A;  2EV5 A;  5D4R A;  2P6T A;  2L02 A;  3HSF A;  2O3F A;  5A2Q K;  1B59 A;  2K4J A;  2W25 A;  1O7F A;  1FNN A;  2OD5 A;  1F1Z A;  4P55 A;  5ED4 A;  4EJT A;  2DTR A;  2OZU A;  3PQJ A;  2D2W A;  4NHJ A;  3V8K A;  1ODD A;  3BZ6 A;  1BJA A;  1ZRF A;  5D4S A;  1ZLJ A;  3T8R A;  2FNP A;  3WTU C;  1T38 A;  3HRM A;  5D6E A;  2GXB A;  3GUD A;  2JPB A;  3CO7 C;  2V79 A;  1W5S A;  5CVJ A;  1XSD A;  3LWF A;  3CUQ B;  5LEJ A;  1FT9 A;  2RQP A;  1R58 A;  2GA2 A;  3FF5 A;  2F5E A;  1ZGJ A;  3F3X A;  3GYH X;  2JTV A;  4O3M A;  1EH7 A;  4HA8 A;  3ZMS A;  4ESJ A;  4M71 A;  3KLN A;  1ON2 A;  2L4A A;  4HLX A;  2A69 F;  5BS6 A;  3F23 A;  4N0B A;  2FU4 A;  2YPR A;  1XSX A;  5BQT A;  4LB6 B;  4M9X A;  1BC8 C;  2H6B A;  3KE2 A;  1ZH5 A;  3PFI A;  1A04 A;  3WTX C;  4EV0 A;  3KZY A;  2XAS A;  2ZCW A;  3E97 A;  4KUM A;  1WQ2 A;  1KYW A;  4HV5 A;  2ZME A;  4G6D A;  3WTS C;  1FPQ A;  2HDC A;  3REO A;  4E70 A;  2HZT A;  3DQV C;  5FO5 A;  2R3S A;  3NRV A;  2VC0 A;  3SZT A;  1TTY A;  1TQM A;  4G8X A;  1U5T B;  1USS A;  4IVN A;  2DAO A;  4LG0 B;  3QOP A;  2V1U A;  3P7N A;  3MFK A;  2W85 A;  1IF1 A;  5DUK A;  5H6R A;  3RDI A;  3TDZ C;  1HQC A;  2G9W A;  4ZYD A;  4GCV A;  1BIA A;  4UNO A;  2NS0 A;  2Q8K A;  4XBF A;  2VOO A;  3J7A O;  4G7Z F;  4MEY F;  4YG2 F;  3K0L A;  1J2X A;  4XLP F;  1MZB A;  1ZG5 A;  3QPT A;  5HDN A;  3I59 B;  4EM0 B;  2E1C A;  4RS8 A;  4M9S A;  3JAM Z;  4L9V A;  2XAJ A;  5DYM A;  5HDK A;  5FLX Z;  1FWZ A;  1TBX A;  1J9I A;  2DPU A;  4Q4Z F;  1IN4 A;  4ENK A;  1XB4 A;  1I6X A;  1VTN C;  2GXG A;  5DCF A;  2IRF G;  2BV6 A;  1D8K A;  5DCM A;  4RAZ A;  2M45 A;  2FEZ A;  3H3U A;  1QGP A;  5BPI A;  4CZZ A;  3WOD F;  1CF7 B;  1PUE E;  1XN7 A;  4UXN A;  3S2W A;  3SQN A;  2FNA A;  2OA4 A;  2ZKZ A;  3F8C A;  1ZRC A;  5IT9 K;  2P4W A;  2DPD A;  4WK8 F;  1IXR C;  2VT3 A;  4ENN A;  5D6F A;  1O7L A;  3U2R A;  1AOY A;  2DQL A;  2HKO A;  1YS6 A;  3RKW A;  1KU2 A;  2RN7 A;  3R60 A;  1B1B A;  4IPA A;  2VOD A;  1DPR A;  1HW2 A;  3KP4 A;  3G3Z A;  4QLC U;  3V8J A;  3IC7 A;  1KGS A;  1JHF A;  3BPX A;  2FRH A;  3ZMV A;  1W7P B;  3HIF A;  4U7D A;  4YFK F;  1WWX A;  3MQ0 A;  1WRJ A;  4F7Z A;  4I98 B;  1P2F A;  2J5P A;  1FSE A;  2P5K A;  3SZP A;  3RPU A;  2M30 A;  5AIP A;  2ACJ A;  2EA4 A;  1U3E M;  1IXS B;  1LNW A;  3FXQ A;  1STZ A;  2IW5 A;  3CUQ A;  5CVU A;  5F6F A;  3H92 A;  4I02 A;  5KVR A;  4GGG A;  1ZAO A;  1UCR A;  3DPT A;  3ZMU A;  1ZRE A;  5AIQ A;  4FX0 A;  5IT3 A;  4RGX A;  4EJW A;  2KKO A;  3WE3 A;  4HX4 A;  4CGZ A;  3KFW X;  2IT0 A;  1FBS A;  2QWW A;  1HKQ A;  2GIV A;  4EMS A;  3H3Z A;  4EJO A;  1S29 A;  2FE3 A;  3IWF A;  2WWY A;  4MNU A;  1KYZ A;  2ESN A;  4HQE A;  5FFX A;  5LBQ A;  2ZXJ A;  4MGR A;  4YFN F;  1QO0 D;  1Z1D A;  3TKY A;  2O61 A;  3KP6 A;  3F8M A;  3BOQ A;  2QUF A;  4LLL A;  3FMR A;  1R23 A;  2EV6 A;  1YTY A;  5JVT A;  2HYG D;  4PGH A;  4CDG A;  3O2P E;  3HYI A;  3C18 A;  4UV8 A;  3SXY A;  3CJN A;  1G3S A;  3IHU A;  3QU6 A;  2Z3Y A;  3RKY A;  4LG0 A;  4R1H A;  2H27 A;  5E1Z B;  1REP C;  1P4W A;  2ZME B;  3Q9V A;  5ILV A;  2HWV A;  2QM3 A;  3I4P A;  2EA2 A;  4IRH A;  4IF4 A;  2HR3 A;  3E6B A;  5ICC A;  3ZPL A;  3I71 A;  3MWM A;  3IL2 A;  3N97 A;  2NRA C;  2M8E A;  3E6C C;  3M8F A;  2XVC A;  4MQV A;  3LQQ A;  3F8N A;  3EYY A;  1HXD A;  1YW7 A;  2LNB A;  3RI4 A;  3MAJ A;  1SMY F;  5JFR A;  4LB5 A;  4U0V A;  4KT5 C;  4RB0 A;  2JZY A;  4HV6 A;  1IRF A;  3I54 A;  4XSX F;  2CFX A;  1ZG3 A;  4P9U A;  2VOP A;  3JTH A;  3TO9 A;  1J59 A;  2O6G E;  4G94 A;  1BI1 A;  3DP7 A;  1HW1 A;  5CVI A;  2VBX A;  5D8L B;  5F1R A;  3FM5 A;  4MTE A;  5H20 A;  3HRU A;  1H9T A;  1KQ0 A;  2EWN A;  3G73 A;  4O6J A;  5LHI A;  1ONV A;  1UB9 A;  2LF8 A;  4HYE A;  3HTS B;  4OIR F;  2HGC A;  3DV8 A;  4I2O A;  3IWZ A;  4KMU X;  2VXZ A;  1W5T A;  4KIF A;  1QBJ A;  4RGS A;  2LDU A;  3FXR A;  4A12 A;  1BOA A;  1U2W A;  1T39 A;  2PLY A;  5LGT A;  1K78 A;  1ZYR F;  3K1N A;  2IA2 A;  3Q9S A;  4L9J A;  2HKX A;  4KIB A;  3I64 A;  5DCM B;  1HBX G;  1W4M A;  3VOE A;  3I53 A;  4RB2 C;  2EFN A;  5HVQ C;  3KEO A;  3BJO A;  2FQ3 A;  4KYW A;  4WCG A;  1KQ8 A;  1YYV A;  2NYX A;  1D5V A;  2B0L A;  1XMK A;  4R8H A;  3T0Y A;  1RI7 A;  1BIB A;  4HOB A;  2H94 A;  3CTA A;  3F72 A;  5LRS A;  2W84 A;  2EK5 A;  2TDX A;  3DEU A;  1QNT A;  2L4M A;  2PI0 A;  3HSR A;  1SD5 A;  2RV8 A;  3HUG A;  2BGC A;  1L3L A;  4A5N A;  4WWC A;  2HOE A;  3ERE D;  1YQA A;  4FHT A;  3EUH A;  4EVI A;  1E17 A;  2Z5U A;  5HLG A;  3JSP A;  2D45 A;  1CGP A;  1R36 A;  4RAY A;  4AIK A;  2KJB A;  2K86 A;  4HX8 A;  5D5X B;  2OQG A;  1ZAR A;  4ZYH A;  4Y15 A;  5HDG A;  4EQQ A;  1BBY A;  1HKS A;  1SD4 A;  1BI3 A;  1TNS A;  2KRF A;  2D1V A;  4HDV A;  3EDP A;  2DU9 A;  1G4D A;  2EB7 A;  1OYY A;  4OIP F;  4G6Q A;  1S3J A;  3ZMD A;  1HSJ A;  4BHB A;  2NNY A;  2IA0 A;  3W6K B;  4P5O A;  4EJU A;  1YG2 A;  3KEQ A;  5FFZ A;  5CJ9 A;  2GWR A;  4D0P A;  1O3T A;  1JGS A;  3E5Q A;  4WXH A;  2M5W A;  1XMA A;  3ECH A;  3HRT A;  4BQA A;  2Z99 A;  4XLN F;  4I0B A;  2LKP A;  3GFI A;  3WGI A;  4L5I A;  1LJ9 A;  5J8C A;  4ZH4 F;  4GO1 A;  4OMZ A;  3GFJ A;  1ZRD A;  2YSR A;  4YIF A;  4G7H F;  1YLF A;  1Z7U A;  4RB3 C;  2EFO A;  4L9N A;  1J75 A;  1G3Y A;  2DK8 A;  3QRF F;  1DPU A;  3BJ6 A;  1I1S A;  4EGY A;  1BM9 A;  4U88 A;  3O6B B;  2RKH A;  2OU2 A;  4MTD A;  2K4B A;  2VN2 A;  4AD9 A;  2VE8 A;  2JT1 A;  2V1X A;  2HQR A;  3LFK A;  2W57 A;  1ULY A;  4ESB A;  1IN8 A;  3T1B A;  4JQF A;  2STW A;  4L18 B;  2UXN A;  3QP5 A;  5L3C A;  3B02 A;  3OV8 A;  1GHC A;  1UFM A;  2A5Y B;  4EM1 A;  5D5V B;  1V3F A;  1ZLK A;  2R7D A;  3ABT A;  4BHC A;  1MJ9 A;  4ZYE A;  3K1P A;  3M1E A;  4OOI A;  1OPC A;  4CXF A;  2G7H A;  1I1G A;  4N9I A;  1HST A;  2XKO A;  4UVC A;  3JSO A;  2GA1 A;  5D5U B;  4BYY A;  1PP8 F;  1Z6R A;  1UHW A;  2KIF A;  4MEX F;  2FMY A;  2CYY A;  2XHK A;  3RIR A;  4KA4 A;  1R22 A;  4A2U A;  1OR7 A;  3J81 Z;  1LDJ A;  2DFI A;  4Y17 A;  4HZF A;  1Z6T A;  4LJZ F;  2J5O A;  4PCQ A;  3SFZ A;  3R4K A;  2YU3 A;  3FM3 A;  4AIJ A;  1DP7 P;  1TLH B;  2P6S A;  1RNL A;  1RUO A;  4I01 A;  3V7S A;  3V7C A;  1OKR A;  3FX3 A;  5HLH A;  1E2X A;  3WTT C;  1SAX A;  4G7O F;  1K78 B;  4KN4 X;  1BI2 A;  2QLZ A;  2FBI A;  2XRN A;  3L09 A;  5LGU A;  4XRF A;  4S04 A;  3WE2 A;  2ZFW A;  3TDU C;  2IA1 A;  3WTY C;  2E1N A;  4M6Y A;  1FC3 A;  1J7K A;  2XAH A;  3L00 A;  2EFP A;  3FZV A;  3GEZ A;  2ADU A;  4P96 A;  3KP2 A;  5AON A;  2FXA A;  4YFX F;  5HS9 A;  2QEN A;  5LGN A;  3LAJ A;  3VOD A;  4FX4 A;  2HEO A;  5CVR A;  1IZ1 A;  4N9H A;  4IRG A;  2MLG A;  1L0O C;  1G3W A;  2A3S A;  5FD6 A;  3KZZ A;  3J80 Z;  5BPD A;  1S7O A;  2DI3 A;  3KLO A;  1T2K A;  1FY7 A;  1H0M A;  1ZG1 A;  1U78 A;  1H9G A;  4LLG F;  2X4H A;  1LB2 A;  1S6L A;  1KU9 A;  2Y75 A;  4L9T A;  3L2C A;  1SFX A;  2PQ8 A;  1D3Y A;  4M74 A;  2A07 F;  4I7H A;  1QQI A;  3D0S A;  2Q2E A;  2DK5 A;  2QBY A;  4Q47 A;  5HS8 A;  2A68 F;  2COM A;  2GAU A;  2PBI A;  1OMI A;  2R7F A;  1Z05 A;  1O57 A;  4Z2Y A;  1U6G A;  1U8R A;  2GQQ A;  2PMH A;  5DDG A;  4LD5 A;  2VC1 A;  3ML6 A;  4L5J A;  4HAM A;  3PQK A;  2IVM A;  1T0F A;  1QPM A;  2CO5 A;  2OZ6 A;  2ZNY A;  1MDM A;  3EYI A;  4BXU A;  1I5Z A;  1AWC A;  1IN6 A;  3ZQ7 A;  4BH9 A;  1R00 A;  5E1X A;  1PP7 U;  3HOS A;  2FBK A;  2K27 A;  4LGW A;  3P9I A;  5LRR A;  3DXJ F;  3K9T A;  3RJP A;  2G7U A;  2ETH A;  3CLO A;  5K5R A;  3DF8 A;  3ZMZ A;  2HTJ A;  3DPL C;  5LLQ A;  4U0Y A;  3R6S A;  3ZN1 A;  3DFG A;  4Y13 A;  1B9N A;  1FBU A;  3ABU A;  5CYV A;  4RGR A;  1IAW A;  3LST A;  1IRG A;  2IPQ X;  1MJA A;  4UVA A;  1YS7 A;  3JTG A;  2LSO A;  3GFL A;  3F6V A;  4HDU A;  4CHU A;  1T6S A;  2PMU A;  3IKV A;  4A6E A;  4IHS A;  2D1H A;  3K2Z A;  1IW7 F;  1YFH A;  2BBY A;  1KU7 A;  2EFW A;  4GYI A;  2CSO A;  1S8N A;  5K5Q A;  4MQ9 F;  4HF2 A;  3GVA A;  2IP2 A;  3F8B A;  5JI6 A;  1FLI A;  3ZN0 A;  5FB2 A;  1ON1 A;  2UXX A;  2E7W A;  4HQM A;  3P9C A;  3QAH A;  1J5Y A;  2BE5 F;  4A0X A;  2XAF A;  1YO5 C;  4BAY A;  1OYW A;  3GLX A;  4KFC A;  3QU3 A;  3WG9 A;  1JXS A;  5EEG A;  2KJC A;  1IN7 A;  4JK1 X;  4XSZ F;  4KN7 X;  4CIC A;  2P8T A;  4LFU A;  3M8E A;  3BP8 A;  3Q5F A;  1P4A A;  3FHZ A;  2UWM A;  4EJV A;  3RKX A;  3E6M A;  5JHU A;  5HLI A;  1GXQ A;  3L7W A;  2CQK A;  3KCC A;  2XAQ A;  3GWZ A;  2XKP A;  3KP7 A;  2P7V B;  1O3Q A;  1XCB A;  3T5X A;  3LA2 A;  1Z9C A;  4OU0 A;  1SD7 A;  3TGN A;  3FXU A;  2JPC A;  1TQI A;  2O03 A;  1O3S A;  3BY6 A;  4UVB A;  3VFZ A;  5L3E A;  3M7G A;  4OMY A;  4IRI A;  2VT2 A;  5JR3 A;  1TW3 A;  2CWE A;  3WGH A;  5KK1 A;  2NAZ A;  2KIU A;  4IHT A;  1Y0U A;  3QPH A;  2AS5 F;  2RDP A;  5TJJ A;  1MJB A;  2ESH A;  2DO7 A;  2L01 A;  4NB5 A;  1MD0 A;  3GF2 A;  3MZH A;  1HW5 A;  3SHF A;  2XUB A;  3BRO A;  3WU1 B;  4NQW A;  5TRD A;  2MC3 A;  5A2Q Z;  3U1D A;  5F64 A;  3IRR A;  5ERI A;  4WX9 A;  2P5L C;  2F5C A;  3ZP5 A;  4ZZD A;  5DUI A;  1IN5 A;  1YIO A;  2QVO A;  4UV9 A;  4OIO F;  3RPQ A;  1FSH A;  2QYO A;  1G3T A;  2STT A;  2MBF A;  2VBY A;  1D8J A;  2IJL A;  4G9Y A;  4I09 A;  2E7X A;  4B8X A;  4BNC A;  2Z33 A;  2A61 A;  1UST A;  2QBY B;  1TW2 A;  2JSC A;  3RTR A;  2M87 A;  3V8L A;  5CLS A;  4HF1 A;  2ZBK A;  2A6H F;  5BOX A;  3GO5 A;  5FGM A;  3K1M A;  2UZK A;  4HW0 A;  3N4M A;  1V4R A;  3HOT A;  5H6Q A;  3WU0 A;  4TV7 A;  2YR2 A;  3WTW C;  5D8K B;  1RZ4 A;  3K69 A;  3C3W A;  2Z9O A;  3I5U A;  1MDM B;  1U5T C;  4PGG A;  4KIG A;  1FZP B;  3WTZ A;  3MCZ A;  4L0Z B;  3D5L A;  2K02 A;  1JE8 A;  1TNT A;  1B6A A;  1UHM A;  2XGX A;  1XGS A;  3BDD A;  1X3U A;  4WXC A;  3ROU A;  2DLL A;  2XV4 S;  2DQR A;  1LEA A;  3VB2 A;  2DBB A;  1W7P D;  4AWX B;  2HS5 A;  2FF4 A;  1XGN A;  1O3R A;  1S7A A;  5J8F A;  4M6X A;  4L0Y B;  1FYM A;  2HQN A;  4A6D A;  2XIG A;  4A0Y A;  2PJP A;  3BJA A;  4ESF A;  1XGO A;  2ELH A;  4WF2 A;  1K7A A;  4A0Z A;  1WKM A;  2NNN A;  3NQO A;  1G6N A;  2O8X A;  4LMY A;  5LHG A;  3HSE A;  3FMQ A;  4QWQ A;  4HLY A;  1BC7 C;  4GXO A;  4KMF A;  2KIM A;  3R0J A;  6PAX A;  1EH6 A;  5L3D A;  1ZHF A;  2QZ8 A;  3JAM K;  1YW8 A;  1GVJ A;  2C6Y A;  3GW2 A;  3IKT A;  1WI9 A;  4BHP A;  3R61 A;  5FLX K;  1ZN2 A;  3LA3 A;  2V9V A;  3J81 K;  4UUV A;  2V1D A;  1WSU A;  2F5D A;  1IXC A;  5E8I A;  4KDP A;  1XCV A;  3HHG A;  1F4K A;  1BN5 A;  1QZZ A;  4AIH A;  2WV0 A;  1BI0 A;  3JW4 A;  5DD8 A;  2MH9 A;  3DKW A;  4EM2 A;  2EFQ A;  3I58 A;  3L9F A;  3HTU A;  2FSW A;  3C7J A;  5L3F A;  2CW0 F;  3WTV C;  4U7B A;  4A5M A;  2WTE A;  3B73 A;  2RNJ A;  3EQL F;  2MD5 A;  3GZ5 A;  3TO6 A;  1FX7 A;  3ELK A;  1B4A A;  2WC2 A;  5BMZ A;  5IT9 Z;  4ETS A;  5DEQ A;  1K6O A;  1RUN A;  4M72 A;  4IJA A;  4AVP A;  2M1B A;  2ZNZ A;  1FBQ A;  4JBA A;  1LEB A;  3O3K A;  2CG4 A;  1YW9 A;  2V6C A;  1J0R A;  4HF0 A;  1RIO H;  2GZW A;  4HBL A;  2ZO4 A;  3EET A;  3E5X A;  3J80 K; 
#chains in the Genus database with same CATH topology
 1WGX A;  2VBW A;  3LNQ A;  3BZK A;  1YIJ I;  4CUG A;  3HM5 A;  4Q48 A;  2HTS A;  2Q1Z B;  2RGV A;  4BXX J;  1ENH A;  3W6J B;  4MHG A;  4PSW A;  4LK0 F;  3ECO A;  4R79 A;  1MGT A;  4FT8 A;  4EAT A;  1LPQ A;  1W1W E;  4EGZ A;  3FWE A;  3CJQ B;  2M3A A;  4P9F A;  3TOB A;  4ZYG A;  3A01 A;  1MKM A;  2W1O A;  3BWG A;  4B09 A;  2VE9 A;  4ZYA A;  2OUM A;  1BJZ A;  1K79 A;  3S16 J;  2MLK A;  3WGG A;  2E2I J;  2JA6 J;  1SFE A;  1IC8 A;  1B9M A;  2FA5 A;  5CVV A;  4NQW B;  2NOG A;  1LDK B;  5KAI C;  2HVR A;  1C0W A;  2H6C A;  3DTK A;  3Q0W A;  4PJL A;  2E36 A;  2FOK A;  5E20 A;  1NG7 A;  3FBN B;  3MEX A;  3PNT A;  3ULQ B;  4M73 A;  2BXZ A;  1FP1 D;  3C1D A;  1P92 A;  2LF7 A;  2LY1 A;  3VYR B;  1MMS A;  1NTC A;  2EV0 A;  3GTK J;  2XPU A;  3TOA A;  2PN6 A;  4JX5 A;  4ON0 A;  3BPV A;  4IEJ A;  4BEH A;  3BR6 A;  4NNJ A;  5EDN A;  2XSD C;  2VL8 A;  3ABL H;  4F55 A;  2CUJ A;  2OQR A;  3RYP A;  3ZXS A;  4E7S A;  2YX7 A;  2XAU A;  3KET A;  1S72 I;  2YU9 J;  4ENM A;  1LQ1 A;  4FCY A;  1R1U A;  4KNY A;  3JRB A;  1Q1H A;  2AXL A;  3QP6 A;  1YJN I;  3F22 A;  4RGU A;  4B3X A;  2HYF A;  2Y48 A;  1D1A A;  1OJL A;  3CME I;  1UG0 A;  2L3D A;  5K5O A;  2NVU B;  1EH8 A;  4ZDL A;  1QA6 A;  2LP0 A;  2A6E F;  2EJR A;  3PIP F;  3OSF A;  1DUX C;  3OWT A;  1LFP A;  2IGM A;  3CO6 C;  2W4S A;  3HHH A;  2DFE A;  3VYU B;  2OC6 A;  4UB6 C;  3H5R A;  1ACI A;  1R71 A;  3GXO A;  2DMQ A;  2DTZ A;  3T8T A;  2JVG A;  4H0E A;  4LLN A;  1KA8 A;  1RR7 A;  3ZMT A;  4HX7 A;  1BA5 A;  1P6R A;  1FYK A;  1R7J A;  2H09 A;  2VON A;  3FKI J;  3SEZ A;  3V7R A;  1DP3 A;  3K4L A;  3DWL E;  5EEH A;  3M9A A;  3R0A A;  2O0Y A;  2Y31 A;  3E5U A;  3E6D A;  4A3I J;  4K2E A;  4O5V A;  4XRS A;  2R7S A;  1JUP A;  1IG7 A;  1Z3Y A;  1VND A;  2F48 A;  1YX3 A;  5E1W A;  4XKW A;  2P0W A;  1R1V A;  5B66 C;  1JHH A;  1GXP A;  2PFB A;  2KRH A;  3PL8 A;  3GX4 X;  1U5T A;  2L0K A;  4HEA 2;  4PDK A;  2VBZ A;  4RM2 A;  2XRO A;  3NEU A;  3I0T A;  5GAH J;  1IUY A;  1LDD A;  5E18 F;  1NHA A;  4JOM A;  2BEO A;  1A6Q A;  2HNH A;  1TWH J;  3VEP A;  1FOK A;  9ANT A;  2KT0 A;  3HRS A;  1XSV A;  2HXO A;  3GFM A;  3IAS 2;  1TP4 A;  4DNC A;  1I27 A;  3CCM I;  1KU3 A;  5HOO A;  3OS0 A;  4XIC A;  3IRQ A;  5J40 A;  2L54 A;  5L3B A;  4IO9 F;  2QQB A;  3LAP A;  2X1D A;  1P4X A;  2PEX A;  1IRZ A;  2D5V A;  2WAF A;  4CCK A;  3AAF A;  4M3B A;  2ISZ A;  4GFB A;  4LK1 F;  3OYC A;  1R5I D;  2EIJ H;  2MH2 A;  4A93 J;  5ILU A;  2OCE A;  3SZG A;  2RVC A;  2CV1 A;  2VI6 A;  3E3V A;  4M3D A;  4F93 B;  1FJL A;  3RPU D;  4GDF A;  1SD6 A;  5J6X A;  3COA C;  3RQI A;  1A31 A;  5FKL A;  4ENJ A;  3GBG A;  1HKT A;  3MZY A;  4RB1 A;  5IOZ A;  1JTX A;  3P5J A;  2RC4 A;  2PMZ N;  3KP5 A;  3I59 A;  5C3E J;  4ASN A;  2BYV E;  1FYL A;  4CYD A;  4FET A;  1SFU A;  4E7K A;  3DU5 A;  3CUO A;  1FP2 A;  1JI8 A;  4DQ2 A;  1R5H A;  2X0L A;  2FBH A;  3FIW A;  3OR1 C;  4S05 A;  2XPW A;  5D5W B;  2DA1 A;  2VB6 A;  3DKX A;  1TWF J;  2Y0M A;  3RYR A;  2ISY A;  5ICF A;  3V4G A;  3G4S I;  3JRA A;  3LQR A;  2F2E A;  2DFH A;  2B9S A;  5F0C A;  1I39 A;  4IXA A;  2LRE A;  4JX4 A;  1F9N A;  4YII A;  3A1Y A;  3DTE A;  2L5Q A;  1Z77 A;  5DS9 A;  4KIC A;  3F8F A;  1FOY A;  1X1P A;  2PMZ A;  3P9K A;  2YX4 A;  1XD7 A;  2VUM J;  2ME6 A;  1ZQ3 P;  3D5S C;  5LHH A;  5E8G A;  1QZY A;  1CF7 A;  2PG4 A;  1SVO A;  1Z91 A;  1XDS A;  1MBE A;  3CP8 A;  5FRN A;  4U0W A;  4Q5S F;  2DT5 A;  3U9G A;  1ZGA A;  3OYH A;  2DN0 A;  3CLQ A;  4IHV A;  3TQN A;  3HOY J;  2E5N A;  3WG7 H;  1RET A;  3CDH A;  3ISP A;  5E3M A;  2K7L A;  5LEK A;  1KQ9 A;  1JT0 A;  3F6O A;  2E2H J;  1B72 B;  1XDU A;  1FTT A;  2QQ9 A;  2ZJ2 A;  1TQP A;  3G1L A;  2KZG A;  3FMS A;  1DDN A;  2FML A;  2AQE A;  2JK3 A;  3BG3 A;  5FD5 A;  3TO7 A;  1ZTR A;  3F21 A;  3MKY B;  1EV7 A;  4CO8 A;  4XLC A;  2OBP A;  5ILS A;  1JJ8 C;  4UHT A;  2HFH A;  1SMT A;  5DV5 A;  5ICE A;  1OCR H;  2N8G A;  3C2H A;  3OOP A;  4GYG A;  3CD6 I;  2JRT A;  2P7C B;  3QQA A;  4WXD A;  2Q0O A;  3ZQI A;  1TT5 B;  4I0A A;  2F5F A;  1W7P A;  2MA3 A;  1XGM A;  3KP3 A;  4XN0 A;  2DJN A;  2CGP A;  1KON A;  2JN6 A;  2XAG A;  2WV1 A;  5CQG A;  1JKO C;  4PFO A;  1R5G A;  2IS2 A;  2W24 A;  4B44 A;  2ID6 A;  1O4X A;  1F5T A;  2VPL A;  2QA4 I;  2QQA A;  1T98 A;  2VJ4 A;  2OAZ A;  4PZJ A;  1OYI A;  1R1T A;  5HS7 A;  3LA7 A;  5J1U A;  4ZZL A;  2P5V A;  3AFH A;  5EG0 B;  1T56 A;  2CUE A;  2IXS A;  2Y30 A;  1ITY A;  1MIJ A;  4OIN F;  4IZZ A;  2K9M A;  5ICG A;  1VQP I;  5L3G A;  1PDN C;  5DD4 A;  1XC5 A;  5K1Y A;  4M9Z A;  4OIQ F;  2DW4 A;  3OYA A;  5E17 F;  1R4N B;  3GZ6 A;  3CUQ C;  1XG1 A;  2PJR B;  1LVA A;  2EV5 A;  2P6T A;  3FKJ A;  2LKS A;  2L02 A;  3OL4 A;  3Q3S A;  5D4R A;  3HSF A;  2O3F A;  3V42 A;  4ZDP A;  5M5Y J;  5A2Q K;  1B59 A;  2K4J A;  4DZJ A;  2IGK A;  2W25 A;  1O7F A;  1FNN A;  2OD5 A;  1F1Z A;  4P55 A;  5ED4 A;  4EJT A;  3A4C A;  3U1K A;  2DTR A;  3DBL B;  1WJD A;  2G0E A;  2OZU A;  3PQJ A;  2D2W A;  2DA3 A;  2GOM A;  4NHJ A;  3TW6 A;  3V8K A;  1ODD A;  3BZ6 A;  1BJA A;  3FXM A;  2E34 A;  2EIL H;  1ZRF A;  1RKT A;  1Z3X A;  5D4S A;  1ZLJ A;  3T8R A;  2FNP A;  4I99 C;  3WTU C;  4RLF A;  1T38 A;  2W7N A;  2BY1 A;  3HRM A;  5D6E A;  1IV6 A;  2GXB A;  3GUD A;  2JPB A;  3CO7 C;  3W2V A;  4HG2 A;  2V79 A;  1W5S A;  5CVJ A;  1XSD A;  3LWF A;  3CUQ B;  1WZ2 A;  2BZT A;  4DBQ A;  5LEJ A;  1FT9 A;  2RQP A;  1R58 A;  1ZR2 A;  2GA2 A;  3FF5 A;  3M1C A;  2RAE A;  2BHZ A;  3JRD A;  2F5E A;  1ZGJ A;  3F3X A;  4M3E A;  3GYH X;  2JTV A;  2MW8 A;  1Y6I A;  4O3M A;  2L7K A;  2AHQ A;  1EH7 A;  4DBR A;  4HA8 A;  4BEH B;  3ZMS A;  3CP2 A;  4ESJ A;  2CW7 A;  4M71 A;  2CQN A;  1ON2 A;  3KLN A;  3VPR A;  4I6Z A;  1AKH A;  3L2V A;  2MC4 A;  2L4A A;  2VKE A;  4CYC A;  4HLX A;  2R7R A;  5F04 A;  3DBR B;  2A69 F;  2EIN H;  4E7Z A;  1WJA A;  4XRS G;  5BS6 A;  1YE9 A;  3F23 A;  3K70 C;  1X3Z B;  1EKE A;  4N0B A;  4BY1 J;  2FU4 A;  2YPR A;  4IOA F;  1XSX A;  4D7M A;  3K4M A;  5BQT A;  4LB6 B;  4M9X A;  1VQK I;  1BC8 C;  2XB0 X;  3HC7 A;  5C44 J;  2E71 A;  4A3G J;  2H6B A;  3KE2 A;  1ZH5 A;  3PFI A;  3HPH A;  2IBD A;  1TZL A;  3CCU I;  1A04 A;  3WTX C;  1Y8R B;  1RES A;  2LK2 A;  4EV0 A;  3KZY A;  3G6E I;  4FIS A;  1R49 A;  2XAS A;  4IL6 C;  3IH3 A;  2BY0 A;  2ZCW A;  3E97 A;  1YOV B;  3CC4 I;  3HPG A;  1OQY A;  4KUM A;  3OR2 C;  1SAN A;  1WQ2 A;  2JA5 J;  1KYW A;  4HV5 A;  2ZME A;  4OWR B;  3BC8 A;  4G6D A;  3WTS C;  1WJE A;  4XN3 A;  1FPQ A;  2E5Z A;  1G59 A;  3ESW B;  2HDC A;  4C2U A;  2OPT A;  3REO A;  1X1A A;  4CSW A;  4E70 A;  3KYL A;  1Q1V A;  2HZT A;  3DQV C;  5FO5 A;  4YIR X;  2R3S A;  3NRV A;  3VSK A;  2FD5 A;  2VC0 A;  1K4S A;  3SZT A;  1TTY A;  3G1O A;  1TQM A;  5EEA A;  2LG4 A;  1HLV A;  4G8X A;  1U5T B;  4QPO A;  1USS A;  4IVN A;  3HOW J;  2DAO A;  4LG0 B;  5E3N A;  3S15 J;  2HU9 A;  1OLT A;  3QOP A;  2V1U A;  2LY9 A;  1XX5 A;  3O8G A;  4F3Q A;  2H8R A;  2NS8 A;  3P7N A;  3MFK A;  3GTL J;  4XM3 A;  3I4N J;  2W85 A;  1VQO I;  3OIP A;  5M3M J;  2M7B A;  1IF1 A;  1R6R A;  5DUK A;  5FRO A;  5H6R A;  4MLO A;  2VIX A;  3OL3 A;  2VKH A;  3RDI A;  3TDZ C;  4E7J A;  1S7E A;  1HQC A;  2G9W A;  4ZYD A;  1G4D A;  4GCV A;  1BIA A;  4UNO A;  2HYJ A;  2NS0 A;  2Q8K A;  1V55 H;  4XBF A;  4DGW B;  3KYC B;  3LSH A;  2VOO A;  3J7A O;  3HZJ A;  4HSR A;  1BW5 A;  4G7Z F;  4MEY F;  2B7E A;  4YG2 F;  1FEX A;  2VJ5 A;  3K0L A;  1WCM J;  1LFU P;  1J2X A;  4XLP F;  4J00 A;  3HEF A;  3HL2 A;  1MZB A;  4ZJZ A;  1ZG5 A;  2JSP A;  3QPT A;  1JJ6 C;  1D1C A;  5HDN A;  3I59 B;  3CF5 F;  3PO2 J;  3LSG A;  1QHG A;  4EM0 B;  2E1C A;  1X19 A;  4RS8 A;  2KRC A;  4M9S A;  4FAS D;  3JAM Z;  2EZK A;  4L9V A;  2XAJ A;  5DYM A;  5HDK A;  3CC2 I;  2R5Z A;  2X9D A;  2ZJQ F;  5FLX Z;  2CW8 A;  1FWZ A;  3OIQ A;  1TBX A;  1J9I A;  2DPU A;  4Q4Z F;  1IN4 A;  4ENK A;  1XB4 A;  1I6X A;  4B4C A;  4A3F J;  2MGQ A;  1B72 A;  2O7O A;  4C3I J;  4LIV A;  2KIS A;  1EJ9 A;  1VTN C;  2GXG A;  3KIO A;  5DCF A;  2IRF G;  1T95 A;  1D8K A;  2BV6 A;  5DCM A;  4RAZ A;  2IGN A;  2HXI A;  4XOP A;  1MBF A;  2M45 A;  2FEZ A;  3H3U A;  4F52 A;  1QGP A;  1IDY A;  5BPI A;  3J7Y J;  2IAI A;  4CZZ A;  3WOD F;  3BR3 A;  1CF7 B;  1PUE E;  4KIS A;  1XN7 A;  4AUX A;  4J01 A;  1MH3 A;  2QGU A;  4UXN A;  3OYF A;  3S2W A;  4LG3 A;  4V19 K;  3SQN A;  2FNA A;  2OA4 A;  2ZKZ A;  4BAC A;  3F8C A;  3G71 I;  3DLA A;  2DOA A;  1ZRC A;  2JVH A;  5IT9 K;  1YHQ I;  1T8I A;  2QSF X;  2P4W A;  5E79 C;  4WK8 F;  1IXR C;  2DPD A;  1FTZ A;  2VT3 A;  4ENN A;  5D6F A;  1O7L A;  4V2G A;  3U2R A;  4NUB A;  2E35 A;  3JRI A;  2DQL A;  2HKO A;  1AOY A;  1LKX A;  1YS6 A;  3RKW A;  1KU2 A;  2RN7 A;  3R60 A;  2K85 A;  4W1U A;  1B1B A;  4IPA A;  2XGC A;  1D5Y A;  2JRM A;  4KJZ A;  1DPR A;  1VQ6 I;  2VOD A;  1HW2 A;  3KP4 A;  3G3Z A;  4QLC U;  3V8J A;  4BJ6 C;  3IC7 A;  3OIO A;  4IQ4 A;  4XNF A;  1KGS A;  1I50 J;  1JHF A;  3BPX A;  2FRH A;  2PJR A;  3ZMV A;  1YRN A;  2ME0 A;  1W7P B;  3HIF A;  4Y33 A;  2VKV A;  4U7D A;  2XF6 A;  4YFK F;  2R7Q A;  1WWX A;  3ONQ A;  3MQ0 A;  2LY2 A;  1WRJ A;  1QVT A;  2L2O A;  5J4Y A;  4A3M J;  4CA0 A;  4F7Z A;  5B1A H;  4I98 B;  3MKW B;  1P2F A;  1A36 A;  2J5P A;  4BE1 A;  4RMN A;  1FSE A;  1FIP A;  2P5K A;  1W36 C;  3SZP A;  3QPL A;  3RPU A;  2M30 A;  2RRE A;  2VJJ A;  2HI3 A;  3CJT B;  1GVD A;  2JA7 J;  3GTM J;  3CC7 I;  5AIP A;  2ACJ A;  2W48 A;  2YS9 A;  2EA4 A;  1U3E M;  1IXS B;  1OCP A;  1LNW A;  1UMQ A;  1X1B A;  1Z7L A;  3FXQ A;  1STZ A;  2IW5 A;  3HB9 A;  3MVP A;  3CUQ A;  4BQO A;  2E1M C;  5CVU A;  4JYK A;  1K4T A;  1U8B A;  5F6F A;  2OF7 A;  3HOX J;  1VQ7 I;  3H92 A;  4I02 A;  5KVR A;  4GGG A;  2WAQ A;  1ZAO A;  2WY8 Q;  1UCR A;  3DPT A;  3OOU A;  3ZMU A;  3DLL F;  1Z67 A;  4CCO A;  3GME A;  1ZRE A;  4NDL A;  2QKL B;  5AIQ A;  4FX0 A;  2QEX I;  5IT3 A;  2DOF A;  4RGX A;  4A3L J;  2I5U A;  5EJC A;  4EJW A;  2KKO A;  3WE3 A;  4HX4 A;  4D9J A;  2BVL A;  1K83 J;  4CGZ A;  3KFW X;  2HPI A;  2IT0 A;  2HDW A;  4RM3 A;  1HCR A;  3LSR A;  2ICW G;  1FBS A;  2QWW A;  1HKQ A;  2GIV A;  5FKO A;  2B63 J;  4AC0 A;  4QPQ A;  3KYD B;  1LVK A;  1P9Q C;  4EMS A;  3H3Z A;  4EJO A;  2K9L A;  5CKT A;  2CJJ A;  1ZGW A;  1E3O C;  5FLV A;  4IKF A;  1S29 A;  2EPF A;  1AHD P;  3SJM A;  2CFO A;  1B8I A;  3JRE A;  2IS1 A;  2X1E A;  3M3Y J;  4P1W A;  1YIT I;  2FE3 A;  2E1M B;  2EZI A;  3IWF A;  5K7F A;  1EF4 A;  2WWY A;  3F9K A;  4MNU A;  3CDI A;  4Z6Y A;  1KYZ A;  3IUO A;  2ESN A;  4HQE A;  3H9Q A;  2BXY A;  5FFX A;  3RZO J;  5LBQ A;  2ZXJ A;  2R7U A;  2AQF A;  3FIS A;  4MGR A;  4YFN F;  1QO0 D;  1Z1D A;  2ZME C;  3TKY A;  1SEU A;  3HOV J;  3PO3 J;  4BE2 A;  1AKH B;  2Y69 H;  2COB A;  2O61 A;  3W6V A;  3PNY A;  3KP6 A;  2H1K A;  1BR1 A;  3F8M A;  2E2J J;  4CYC B;  3BOQ A;  3CF2 A;  5GP9 A;  2QUF A;  4XLH A;  1WFX A;  4DW6 A;  3DPU A;  3RZD J;  4S0H B;  1F36 A;  2LLK A;  3PM1 A;  4LLL A;  3FMR A;  1R23 A;  1WJ5 A;  2EV6 A;  1YTY A;  2OV7 A;  3BTJ A;  4EEF G;  5JVT A;  2XSJ C;  3MMY B;  2HYG D;  3CJR B;  4X0G A;  1AA7 A;  4PGH A;  5HLT A;  4CDG A;  3O2P E;  5DM7 F;  3CCS I;  4ZDO A;  1ETQ A;  3HYI A;  2Y9Z A;  5IPA A;  3C18 A;  1LE8 A;  4UV8 A;  4YEJ A;  3SXY A;  4BJ5 C;  3CJN A;  2LMD A;  1G3S A;  3IHU A;  3QU6 A;  2Z3Y A;  3RKY A;  4LG0 A;  3G1M A;  4R1H A;  2ZJR F;  3A02 A;  2FJ1 A;  2H27 A;  5E1Z B;  3B6A A;  1REP C;  3LSM A;  1P4W A;  3HGY A;  2ZME B;  3Q9V A;  2QKM B;  5ILV A;  2HWV A;  2QM3 A;  2EIM H;  2EA2 A;  3I4P A;  4IRH A;  4IF4 A;  2HR3 A;  3E6B A;  5ICC A;  3ZPL A;  1OCC H;  3I71 A;  1F43 A;  1GV5 A;  2Y2Z A;  1ETK A;  5FKK A;  1DU6 A;  3H9J A;  4DIQ A;  2K3P A;  3MWM A;  2DOD A;  3ZRG A;  3IL2 A;  3N97 A;  2NRA C;  2M8E A;  2MD0 A;  3E6C C;  5HNH A;  3M8F A;  2XVC A;  2KL4 A;  4MQV A;  3LQQ A;  1PUF A;  2ZSH B;  3F8N A;  1VZ0 A;  3EYY A;  1HXD A;  1YW7 A;  2LNB A;  1ETV A;  3RI4 A;  4NC8 A;  3BG5 A;  3MAJ A;  1G8X A;  1SMY F;  1JTY A;  5JFR A;  3LSP A;  4FTH A;  1QPI A;  1LFB A;  1S5L C;  2H8W A;  4LB5 A;  4U0V A;  4KT5 C;  3CDL A;  4RB0 A;  2JZY A;  2HOS A;  4HV6 A;  3C2B A;  1IRF A;  3I54 A;  4ITV A;  4XSX F;  1VFC A;  5J1Y A;  2CFX A;  4ZTF A;  1N25 A;  1ZG3 A;  3A0B C;  4P9U A;  1CQT A;  1MSF C;  2VOP A;  3CES A;  2JUC A;  3J7Z I;  3TBI A;  2OTJ I;  1MND A;  4PJM A;  3JTH A;  2NVY J;  3TO9 A;  4BS9 A;  1J59 A;  2O6G E;  3FDY A;  2F4O B;  4G94 A;  1BI1 A;  3DP7 A;  3M8J A;  3K10 A;  3OMY A;  3H0D A;  2X51 A;  1RC9 A;  1HW1 A;  1WH5 A;  5CVI A;  2VBX A;  5D8L B;  5F1R A;  3FM5 A;  4MTE A;  5H20 A;  3HRU A;  3PIO F;  1KQ0 A;  2EWN A;  3G73 A;  1H9T A;  3AL0 C;  2LD5 A;  5KCM A;  4O6J A;  3K6G A;  2VPR A;  4AID A;  5LHI A;  1ONV A;  1UB9 A;  3E0J B;  2LF8 A;  4HYE A;  5CQE A;  4UUS A;  3L2R A;  3HTS B;  2MAB A;  1OFC X;  4XLA A;  4OIR F;  4NBQ A;  2HGC A;  3DV8 A;  1U0J A;  4PUS A;  4I2O A;  3IWZ A;  3I56 I;  4KMU X;  4E7I A;  3S1R J;  2UUZ A;  4XID A;  3AG4 H;  3QOE A;  2VQL A;  4XK4 A;  1TWC J;  3RSN A;  1ZK8 A;  2OTL I;  2VXZ A;  1W5T A;  4KIF A;  4RBO A;  1QBJ A;  4RGS A;  2LDU A;  4BUP A;  3FXR A;  4A12 A;  1BOA A;  1TL8 A;  1GV2 A;  1IO2 A;  2R5Z B;  3BQY A;  1JUM A;  1U2W A;  2I10 A;  1T39 A;  2PLY A;  5LGT A;  1K78 A;  1ZYR F;  3H5N A;  3K1N A;  4PK4 A;  3E7L A;  2W82 A;  2Z16 A;  5C4X J;  1XMX A;  4MFD A;  2IA2 A;  3Q9S A;  4L9J A;  4BJT A;  2HKX A;  4KIB A;  3I64 A;  2MG4 A;  5DCM B;  3AL0 B;  2K5C A;  2ZSI B;  3Q0U A;  3H36 A;  1HBX G;  1W4M A;  3IP4 B;  3VOE A;  2LVS A;  3D5R C;  1VQM I;  1POG A;  3TL4 X;  3LOC A;  3I53 A;  5EZH A;  3OYI A;  4XLF A;  3HGG A;  2VXD A;  4RB2 C;  2EFN A;  4H4K C;  5HVQ C;  3KEO A;  4IQJ A;  3BJO A;  4RAG A;  2FQ3 A;  4PJ0 C;  2R5Y A;  3UR3 C;  4KYW A;  3K4C A;  4WCG A;  4CCJ A;  1KQ8 A;  2V7F A;  3BTL A;  1YYV A;  2NYX A;  1X58 A;  3DKY A;  1D5V A;  2Y9Y A;  1V54 H;  2B0L A;  1XMK A;  4R8H A;  2E1O A;  2AO9 A;  5JVG F;  3T0Y A;  4A3C J;  1WJC A;  5KAF C;  2FX0 A;  1RI7 A;  1BIB A;  3GTP J;  1MBG A;  4HOB A;  2H94 A;  5J1R A;  4KT6 A;  3CTA A;  1W0T A;  3W3C A;  3F72 A;  2EQR A;  3SYT A;  3JRG A;  5LRS A;  2W84 A;  2EK5 A;  2TDX A;  2ZXW H;  1X4O A;  3DEU A;  1QNT A;  2L4M A;  3CCY A;  2PI0 A;  3QYB A;  2HQA A;  1RKW A;  2AXT C;  4CH7 A;  2BOL A;  4BU2 A;  3HSR A;  3WHB A;  4PJN A;  1SD5 A;  2RV8 A;  2XPV A;  3HUG A;  2XDV A;  2BGC A;  1A35 A;  1UJ8 A;  2ZXI A;  1L3L A;  4N4N B;  2R0Q C;  4A5N A;  1YRN B;  4QSH A;  4WWC A;  2HOE A;  3S93 A;  3TP3 A;  3ERE D;  2WY7 Q;  3HDD A;  1YQA A;  4FHT A;  1BW6 A;  3EUH A;  4EVI A;  4B47 A;  5IP6 A;  1E17 A;  5F0H A;  4V2F A;  4XRM A;  3DCF A;  4F92 B;  1ETY A;  3AG1 H;  1WVR A;  2Z5U A;  5HLG A;  2LC2 A;  3JSP A;  5F1J A;  3S3N A;  1N78 A;  3HJE A;  1E3H A;  4BXF A;  2GM4 A;  2D45 A;  1T08 B;  3S1N J;  1CGP A;  1R36 A;  4RAY A;  4AIK A;  4M6V A;  2V9K A;  5CPR B;  2KJB A;  3K2A A;  2K86 A;  4HX8 A;  1MW7 A;  2KPM A;  5D5X B;  2L9N A;  2JUG A;  2OQG A;  1ZAR A;  4ZYH A;  2PX9 A;  1XTA A;  4MFE A;  4Y15 A;  1PVE A;  5HDG A;  4EQQ A;  1BBY A;  1HKS A;  1QHH D;  1BI3 A;  1JUS A;  1SD4 A;  1TNS A;  3H9G A;  3QYE A;  2KRF A;  2L7Z A;  2D1V A;  1D0Z A;  2RQQ A;  1T0F C;  2DU9 A;  3EDP A;  2EB7 A;  1OYY A;  4DZP A;  4HDV A;  2BVM A;  3CCE I;  3HG9 A;  5H2F C;  4OIP F;  5HOD A;  1Y1W J;  3A0H C;  4G6Q A;  1S3J A;  3B6C A;  3QPS A;  2LTP A;  3ZMD A;  1HSJ A;  4BHB A;  4CZC A;  2NNY A;  3OYD A;  1VQL I;  2E19 A;  2IA0 A;  3W6K B;  4MIM A;  2F5V A;  4P5O A;  3LL7 A;  4EJU A;  5M5W J;  1YG2 A;  1MBK A;  1VQ9 I;  3KEQ A;  5FFZ A;  5CJ9 A;  2GWR A;  4U87 A;  4D0P A;  5FJ8 J;  1O3T A;  2WA0 A;  3NAU A;  5FKN A;  4A3E J;  1B8I B;  1JGS A;  5IOY A;  4Y3O A;  3E5Q A;  4WXH A;  2DA5 A;  4BQN A;  4OAY A;  2MFZ A;  1TC3 C;  2M5W A;  1IGN A;  1XMA A;  3ECH A;  3HRT A;  4BQA A;  1XPX A;  3KZI C;  2VKD A;  3A2K A;  2K9Q A;  2Z99 A;  4XLN F;  4I0B A;  2LKP A;  2X48 A;  3GFI A;  2BW3 A;  4B48 A;  1E0E A;  3WGI A;  4L5I A;  1LJ9 A;  5J8C A;  4E6K G;  3BR2 A;  4ZH4 F;  4GO1 A;  4OMZ A;  1NH3 A;  3GFJ A;  1TWG J;  2HOA A;  2VQC A;  2X6O A;  1ZRD A;  3DEW A;  2XF7 A;  2YSR A;  4YIF A;  4G7H F;  1YLF A;  1X3W B;  2CQX A;  1Z7U A;  3BTI A;  4RB3 C;  4E7H A;  3OYE A;  2EFO A;  4L9N A;  4II3 A;  3OY9 A;  3ZQL A;  1J75 A;  1G3Y A;  2DK8 A;  1PYV A;  3QRF F;  1JGG A;  1DPU A;  3BJ6 A;  2K40 A;  4BDY A;  1I1S A;  4EGY A;  3RQ4 A;  1OIS A;  2WB1 N;  1BM9 A;  4U88 A;  2XRL A;  3HKZ N;  3ZQG A;  1YJ9 I;  4CCN A;  1IJW C;  4B43 A;  3O6B B;  2RKH A;  2OU2 A;  1LE8 B;  4MTD A;  5M3F J;  3PUB A;  2K4B A;  2VN2 A;  4AD9 A;  2IEK A;  2Z2S B;  5J3L A;  4XLE A;  4XKB A;  1RR8 C;  2VE8 A;  2JT1 A;  3U21 A;  3GCM A;  2P81 A;  2V1X A;  1HDD C;  2HOT A;  2R93 J;  3S2D J;  2HQR A;  3LFK A;  2DMU A;  2W57 A;  2R7V A;  1ULY A;  2DDA A;  4ABZ A;  4ESB A;  4BE0 A;  1IN8 A;  3T1B A;  4JQF A;  3DBH B;  2STW A;  4L18 B;  3FXO A;  2UXN A;  3QP5 A;  4C2T A;  3TP0 A;  5L3C A;  3KEY A;  4GRI A;  3IH2 A;  4BKX A;  3SEQ A;  3B02 A;  3MKL A;  3TW7 A;  2CQQ A;  3PSI A;  4I76 A;  3OV8 A;  1GHC A;  3TMO A;  1UFM A;  3QOD A;  3PSF A;  4N4O B;  2A5Y B;  4AYB N;  4EM1 A;  5D5V B;  3S8P A;  3HKZ A;  1V3F A;  3VSL A;  1ZLK A;  2R7D A;  2EZL A;  3ABT A;  4BHC A;  3ZQC A;  2CV0 A;  1MJ9 A;  1S9H A;  4ZYE A;  4DOZ A;  3K1P A;  1PUF B;  1A6I A;  3M1E A;  3H0G J;  2KDO A;  4OOI A;  1OPC A;  2ZFU A;  4CXF A;  1J09 A;  2G7H A;  1I1G A;  3L2Q A;  3FHN A;  2OCC H;  1RPW A;  4N9I A;  1HST A;  2XKO A;  4UVC A;  3JSO A;  1UHS A;  2GA1 A;  5K7H A;  1IRX A;  2KZV A;  5D5U B;  3LSJ A;  3BT9 A;  4BYY A;  1Z6R A;  1PP8 F;  1UHW A;  4A3J J;  2KIF A;  4AYB A;  2ZXH A;  1X2M A;  5DM6 F;  3H3V K;  4B3A A;  3OYB A;  1R9T J;  4MEX F;  2JWT A;  2NXN B;  2FMY A;  5J4V A;  2CYY A;  3GZN B;  1W36 D;  2XHK A;  4A3B J;  5B3S H;  3RIR A;  1WJB A;  4UB8 C;  4KA4 A;  1R22 A;  4A2U A;  2KQR A;  1OR7 A;  1RRJ A;  4XKC A;  2DT6 A;  3J81 Z;  1LDJ A;  2DFI A;  4UUS B;  4Y17 A;  2JJ7 A;  4HZF A;  1Z6T A;  4LJZ F;  2J5O A;  5GTH C;  4XOR A;  4XL9 A;  5E3L A;  3H5A A;  4PCQ A;  2M2E A;  1IV8 A;  3SFZ A;  3R4K A;  2VJI A;  1VQ4 I;  2YU3 A;  3FM3 A;  4AIJ A;  1DP7 P;  4CCM A;  1TLH B;  2P6S A;  1RNL A;  1WPK A;  5B5E C;  4I01 A;  3V7S A;  3V7C A;  1RUO A;  4YEL A;  1OKR A;  4A3D J;  1BR2 A;  5JLW A;  3FX3 A;  5HLH A;  4ZTJ A;  4JP0 A;  1E2X A;  3WTT C;  1YX5 A;  1SAX A;  4G7O F;  1K78 B;  1W5C C;  4KN4 X;  3KX2 A;  1BI2 A;  1Z0X A;  2QLZ A;  2BY2 A;  3K7A J;  3SDG A;  2FBI A;  2XRN A;  5GAE J;  2QCO A;  2FQ4 A;  3L09 A;  5LGU A;  3ZCO A;  1P7I A;  4XRF A;  5EGO A;  3FK7 A;  2BHY A;  4S04 A;  3WE2 A;  2ZFW A;  2GIZ A;  3TDU C;  3JR9 A;  1TWA J;  2F4M B;  2IA1 A;  2TCT A;  2E1N A;  4M6Y A;  3WTY C;  1FC3 A;  1WJF A;  2HDD A;  1J7K A;  2XAH A;  2CQ7 A;  1G2H A;  3CCL I;  3L00 A;  2HZD A;  3EUH C;  2R5Y B;  2ECB A;  2EFP A;  2KP6 A;  3FZV A;  4C9Y A;  2DT7 B;  1H89 C;  2X6X A;  3GEZ A;  2ADU A;  2QSH X;  4P96 A;  2DYR H;  3EPZ A;  4QTR A;  1SVL A;  1MMG A;  3KP2 A;  2R7O A;  3ZQH A;  5AON A;  2FXA A;  4YFX F;  5HS9 A;  5IP9 J;  3I55 I;  2QEN A;  3HXL A;  4XQF A;  2X85 A;  5LGN A;  3HOZ J;  3C2G A;  3QYF A;  2HPM A;  3GTQ J;  3LAJ A;  3ZQQ A;  3VOD A;  4FX4 A;  3SDB A;  2HEO A;  1I3A A;  5CVR A;  1IZ1 A;  4N9H A;  4IRG A;  3FXL A;  3N05 A;  5F27 A;  3PNV A;  2MLG A;  2R4G A;  3M4O J;  1L0O C;  3HUG B;  1G3W A;  4MO7 A;  2A3S A;  5FD6 A;  4LIT A;  1FOW A;  3KZZ A;  2LRD A;  3J80 Z;  5BPD A;  2KFD A;  2ZJP F;  2MYS A;  1S7O A;  2DI3 A;  3KLO A;  1T2K A;  2V1N A;  1FY7 A;  3K4N A;  2I8D A;  3ABK H;  1H0M A;  1ZG1 A;  1U78 A;  2KIQ A;  1H9G A;  4LLG F;  2X4H A;  1LB2 A;  1S6L A;  1KU9 A;  1JKQ C;  2Y75 A;  1BOB A;  3AKZ A;  3JRH A;  4L9T A;  3L2C A;  3BR5 A;  1SFX A;  2DA2 A;  2PQ8 A;  4CCL A;  4G6T B;  5GPC A;  3CCR I;  1D3Y A;  2M0M A;  4M74 A;  2A07 F;  4I7H A;  1QQI A;  3D0S A;  4X1E A;  4BL0 B;  1QVU A;  4D5C A;  2Q2E A;  2DK5 A;  1MBJ A;  4D7N A;  2QBY A;  4Q47 A;  3EUA A;  3ASO H;  1AU7 A;  5HS8 A;  2M4G A;  4XON A;  1IUF A;  2A68 F;  3GTJ J;  2COM A;  2A5W A;  4A69 C;  1GDT A;  2GAU A;  3MKZ A;  2PBI A;  1OMI A;  3BQZ A;  2R7F A;  1Z05 A;  1O57 A;  1N77 A;  4Z2Y A;  1U6G A;  2DYS H;  1U8R A;  2BY3 A;  2GQQ A;  2PMH A;  5DDG A;  4LD5 A;  3OYL A;  2VC1 A;  2R92 J;  3WHC A;  3ML6 A;  1JKR C;  4L5J A;  1HF0 A;  4HAM A;  4LOC A;  3PQK A;  2QSG X;  2IVM A;  1YJW I;  2DA4 A;  1T0F A;  1QPM A;  2CO5 A;  2OZ6 A;  2ZNY A;  3LSK A;  2XC7 A;  3CCQ I;  1MDM A;  2JA8 J;  3EYI A;  1Y56 A;  4BXU A;  3S14 J;  1I5Z A;  2V4J C;  4FE4 A;  1IN6 A;  3F0C A;  1AWC A;  3ZQ7 A;  3HOU J;  4BH9 A;  1R00 A;  3AG2 H;  1FMW A;  4OAZ A;  2L9R A;  5E1X A;  1PP7 U;  1MSE C;  3HOS A;  3GTG J;  2FBK A;  4BBR J;  2LBF B;  2K27 A;  4NC7 A;  4LGW A;  3P9I A;  5LRR A;  1Y8Q B;  2F4I A;  2LKX A;  3DXJ F;  3K9T A;  2BW3 B;  3MD2 A;  3S3M A;  1NG6 A;  3RJP A;  3CMA I;  2G7U A;  2ETH A;  3CLO A;  5K5R A;  3DF8 A;  1MMA A;  3ZMZ A;  2HTJ A;  3QWL A;  1X1C A;  2L7F P;  3DPL C;  3JRC A;  1QRY A;  3ZOB A;  1MNE A;  1UG2 A;  2LFB A;  5LLQ A;  4U0Y A;  1V5F A;  3R6S A;  3ZN1 A;  3DFG A;  4Y13 A;  1B9N A;  1FBU A;  3DU6 A;  3DEE A;  3ABU A;  5CYV A;  2WBM A;  3I3L A;  3S1M J;  1P7J A;  1SFO J;  2IS4 A;  4II2 A;  4RGR A;  2NS7 A;  3NWS A;  1IAW A;  3LST A;  1IRG A;  3H35 A;  2KHM A;  4RDU A;  2IPQ X;  1MJA A;  1Z21 A;  5FKM A;  3X2Q H;  2JA2 A;  4UVA A;  2DMT A;  3G2B A;  1YS7 A;  3JTG A;  2LSO A;  4Y52 J;  2Z1D A;  3ERM A;  3GFL A;  3ABM H;  1KZH A;  4C2M J;  1ETO A;  2CS3 A;  3F6V A;  2A05 A;  2M9H A;  4HDU A;  4CHU A;  1T6S A;  2ZC2 A;  3VDX A;  2PMU A;  3IKV A;  3GLL A;  3OS1 A;  4A6E A;  4IHS A;  2D1H A;  3K2Z A;  1IW7 F;  5LFA A;  4D1Q A;  3ZQF A;  1X1D A;  2ELJ A;  4XR6 A;  1YFH A;  3S17 J;  2BBY A;  1KU7 A;  2EFW A;  4GYI A;  1UAA A;  3DTI A;  2CSO A;  1S8N A;  3K4K A;  3SFI A;  5K5Q A;  1OR7 C;  3MN2 A;  4MQ9 F;  4HF2 A;  3GVA A;  1A5J A;  5LD2 C;  2IP2 A;  3F8B A;  5JI6 A;  1NK2 P;  1FLI A;  1GUU A;  1D1B A;  3ZN0 A;  5FB2 A;  1ON1 A;  4BGD A;  2UXX A;  1JT6 A;  2E7W A;  4HQM A;  3OYN A;  1IDZ A;  2KMU A;  2V6E A;  3P9C A;  3QAH A;  4Y7N J;  1J5Y A;  1U9O A;  1K61 A;  2BE5 F;  4A0X A;  2R7W A;  2CMP A;  2XAF A;  1YO5 C;  4BAY A;  1OYW A;  3GLX A;  4C3H J;  4KFC A;  3QU3 A;  1Y0N A;  3WG9 A;  1JXS A;  5KHD A;  2LYC A;  5EEG A;  2KJC A;  2X6W A;  5GAG J;  1IN7 A;  4JK1 X;  2XB5 A;  4XSZ F;  4KN7 X;  4CIC A;  2P8T A;  1UEL B;  4LFU A;  3M8E A;  2CV2 A;  3BP8 A;  3Q5F A;  1D0Y A;  3CMM A;  1P4A A;  3FHZ A;  2UWM A;  1E3P A;  4EJV A;  3RKX A;  3E6M A;  5JHU A;  5HLI A;  1T33 A;  3FK6 A;  3IH4 A;  3OYG A;  1GXQ A;  3L7W A;  5KNL A;  5IP7 J;  2CQK A;  3KCC A;  1APL C;  2XAQ A;  3GWZ A;  3RCO A;  2VQG A;  2XKP A;  1VF9 A;  3KP7 A;  2P7V B;  4C30 A;  1O3Q A;  4LIU A;  2YUS A;  1K6Y A;  3LMM A;  3D1N I;  1XCB A;  4E4H A;  4IHX A;  5EF6 A;  3H1C A;  2EZH A;  3L1P A;  1QU3 A;  3T5X A;  2W00 A;  3LA2 A;  1Z9C A;  4OU0 A;  1OCZ H;  2KDZ A;  1GT0 C;  2V26 A;  1SD7 A;  4IHW A;  1VQN I;  3TGN A;  3FXU A;  2JPC A;  1TQI A;  2O03 A;  3BZC A;  1O3S A;  3BY6 A;  3S1Q J;  3K4J A;  1H88 C;  2X6Y A;  4UVB A;  3VFZ A;  3FBI B;  5L3E A;  3M7G A;  4OMY A;  4IRI A;  2VT2 A;  1EA3 A;  4G12 A;  5JR3 A;  2NVT J;  1TW3 A;  2UV1 A;  3K70 D;  2CUZ A;  2CWE A;  5JHF A;  1UZC A;  5EGO B;  1WH7 A;  5GPA A;  5FLM J;  3WGH A;  1DGW Y;  5KK1 A;  2NAZ A;  3J7A Y;  2KIU A;  4IHT A;  4BDZ A;  2VQH A;  1Y1V J;  3L2W A;  5B1B H;  1Y0U A;  3ASN H;  3QPH A;  2AS5 F;  2GXA A;  3O8H A;  5TIS C;  1I3Q J;  2EH3 A;  2JMW A;  3S3O A;  2RDP A;  3HBL A;  1MJB A;  5TJJ A;  1SC7 A;  2ESH A;  3I4M J;  2DO7 A;  3CMY A;  4UY8 I;  1FIA A;  1FMV A;  2L01 A;  4NB5 A;  2L9V A;  1MD0 A;  5DTD A;  1HOM A;  2V9P A;  3LFU A;  3GF2 A;  3MZH A;  3PFY A;  1HW5 A;  3SHF A;  3BRO A;  2H1L A;  2GBY A;  2XUB A;  5GTI C;  3WU1 B;  4IX7 A;  2LOO A;  2K9N A;  2XGE A;  3NWT A;  4NQW A;  2MC3 A;  5TRD A;  5A2Q Z;  5K7Z A;  3E1S A;  5F64 A;  3U1D A;  2ELK A;  3IRR A;  3AG3 H;  2WAE A;  5ERI A;  4ZC3 A;  4DJA A;  3OSG A;  3FXJ A;  4WX9 A;  2P5L C;  2IGO A;  3ZR8 X;  2F5C A;  3ZP5 A;  2ECC A;  4W97 A;  4ZZD A;  5DUI A;  4XOT A;  1IN5 A;  1YIO A;  2QVO A;  3VWB A;  4HST A;  4UV9 A;  4OIO F;  3RPQ A;  3BG7 A;  3A01 B;  3L2U A;  2HVS A;  3WU2 C;  1FSH A;  2QYO A;  3OYJ A;  1SAU A;  1BR4 A;  1G3T A;  2STT A;  2MBF A;  5M5X J;  3PJR A;  2VBY A;  1D8J A;  4Y4R A;  4BY7 J;  1X2N A;  3IAM 2;  2IJL A;  4G9Y A;  4I09 A;  3CCV I;  2E7X A;  3BLY A;  4B8X A;  4BNC A;  2Z33 A;  1VQ8 I;  2A61 A;  5IYC J;  2DJI A;  5EYR A;  2Q2E B;  4DYR A;  3BR0 A;  1UST A;  1M1E B;  2QBY B;  1TW2 A;  2JSC A;  3RTR A;  2M34 A;  2M87 A;  3V8L A;  5CLS A;  1ERD A;  4HF1 A;  2ZBK A;  2M4K A;  4BQQ A;  1U9N A;  2A6H F;  5BOX A;  4ANJ A;  3GO5 A;  3I9V 2;  2LBF A;  1Y39 A;  3KPH A;  5C4J J;  5FGM A;  1X4P A;  4X6A J;  3K1M A;  4FE7 A;  2UZK A;  1GLN A;  2O5R A;  4RAF A;  2XGD A;  3JCU C;  4HW0 A;  3N4M A;  2A6T A;  1V4R A;  3K4B A;  3NAR A;  3HOT A;  5H6Q A;  1N75 A;  3WU0 A;  4TV7 A;  3Q0V A;  1SFK A;  2YR2 A;  4E7L A;  1DQU A;  3WTW C;  5TGT A;  2O9L A;  5EZG A;  2L7M P;  5D8K B;  1RZ4 A;  3K69 A;  3UKG A;  3C3W A;  2Z9O A;  3I5U A;  2IS6 A;  1WHU A;  2DFF A;  2FUG 2;  1MDM B;  4D5F A;  1U5T C;  4DYQ A;  4PGG A;  3VYT B;  1ETX A;  4XKV A;  4KIG A;  1FZP B;  2R7Z J;  3WTZ A;  3MCZ A;  1ZKG A;  2CH0 A;  4L0Z B;  3D5L A;  2M8G X;  2K02 A;  1JE8 A;  1HA8 A;  1TNT A;  1LUJ B;  4M3F A;  1VQ5 I;  4KIT B;  1B6A A;  1UHM A;  1V5E A;  1V5G A;  3CZ6 A;  3LSI A;  2XGX A;  1XGS A;  2LH9 A;  3BDD A;  4RA2 A;  4HNU A;  1X3U A;  4WXC A;  3ROU A;  2DLL A;  2XV4 S;  4RLQ A;  2DQR A;  1LEA A;  3VB2 A;  2DBB A;  1W7P D;  4AWX B;  2HS5 A;  2FF4 A;  5FRM A;  1XGN A;  1WI3 A;  1O3R A;  1S7A A;  5J8F A;  4M6X A;  4L0Y B;  1FYM A;  3OS2 A;  2HQN A;  4A3K J;  4A6D A;  2XIG A;  1DGR M;  1MMD A;  4A0Y A;  2PJP A;  3BJA A;  4DYC A;  4ESF A;  2WB1 A;  3CQZ J;  2JQ7 A;  1XGO A;  2ELH A;  4WF2 A;  2CU7 A;  1K7A A;  1QZE A;  1JKP C;  3A03 A;  4A0Z A;  2OJE D;  2ZB9 A;  1WKM A;  2NNN A;  3NQO A;  2CRG A;  1G6N A;  4HNT A;  1ETW A;  1ZEL A;  2O8X A;  4NC6 A;  4LMY A;  5LHG A;  1MH4 A;  4JX6 A;  5F08 A;  3HSE A;  3FMQ A;  3MZ8 A;  4QWQ A;  4AVZ A;  2EIK H;  2EBI A;  4IOC F;  4HLY A;  5GAD J;  3BTC A;  1BC7 C;  4GXO A;  1DU0 A;  4KMF A;  2KIM A;  3R0J A;  5E3O A;  6PAX A;  4PJJ A;  1EH6 A;  1R4M B;  2QQ8 A;  5L3D A;  1ZHF A;  2XF5 A;  2QZ8 A;  3JAM K;  2R7X A;  1YW8 A;  1GVJ A;  2C6Y A;  2WAD A;  3GW2 A;  5JLX A;  3IKT A;  1WI9 A;  1HDP A;  4BHP A;  5IYD J;  4PFP A;  3R61 A;  3OYM A;  1NK3 P;  4XMY A;  5FLX K;  1ZN2 A;  1BL0 A;  2KLO A;  1H8A C;  4F91 B;  2CUF A;  3VYS B;  2TRT A;  4M3G A;  2VAS A;  2HQ5 A;  3LA3 A;  3BCB A;  2V9V A;  2DDB A;  3J81 K;  2NOJ B;  4UUV A;  2V1D A;  1WSU A;  2F5D A;  4AM3 A;  1D0X A;  1IXC A;  5IYB J;  3UNG C;  5E8I A;  1PJR A;  4J19 A;  4KDP A;  3JRF A;  1XCV A;  3HHG A;  4QIW N;  3BG9 A;  3BCA A;  4UUT A;  4PSX A;  2M0C A;  3W2A A;  4BBS J;  2ID3 A;  1BN5 A;  4HPQ A;  1F4K A;  2HVQ A;  1QZZ A;  5IY5 H;  2DXI A;  4AIH A;  2VLA A;  4HNV A;  2WV0 A;  5J47 A;  1OCT C;  2Y0S N;  2O8K A;  1BI0 A;  3JW4 A;  5DD8 A;  2DA7 A;  2FOW A;  2K9S A;  3ZGK A;  3OYK A;  3W2W A;  2GLO A;  2MH9 A;  1VI0 A;  1MNM C;  3DKW A;  3S32 A;  2X1C A;  4EM2 A;  2EFQ A;  3I58 A;  3L9F A;  3HTU A;  1I6H J;  2FSW A;  4C3J J;  3C7J A;  5L3F A;  3CCJ I;  2CW0 F;  2L9S A;  1FOX A;  3WTV C;  1SVM A;  1HC8 A;  2NVX J;  2DMN A;  4YRV A;  4U7B A;  3M07 A;  1TT0 A;  2DMP A;  4A5M A;  2WTE A;  2MSY A;  1OCO H;  2E60 A;  2GOX B;  3B73 A;  2F6C A;  2RNJ A;  3EQL F;  2MD5 A;  2LR8 A;  4IHY A;  3EUK L;  3S2H J;  3GZ5 A;  3TO6 A;  1FX7 A;  1ZR4 A;  2RNG A;  3ELK A;  1B4A A;  2WC2 A;  2Y0S A;  5BMZ A;  5IT9 Z;  4ETS A;  2NVQ J;  4FQG A;  5DEQ A;  2DOE A;  1K6O A;  4HRI A;  4AU7 A;  4B1R A;  5EG0 A;  1RUN A;  2DCE A;  5HNF A;  4M72 A;  3BG6 A;  4IJA A;  4AVP A;  3GTO J;  5BNG A;  2M1B A;  3TED A;  2ZNZ A;  1W0U A;  2K3F A;  2R7T A;  1FBQ A;  2DA6 A;  3FXK A;  4JBA A;  3IV5 A;  1MBH A;  4L5E A;  3O3K A;  5F0F A;  1LEB A;  2CG4 A;  1YW9 A;  3BR1 A;  2QF7 A;  1YI2 I;  2V6C A;  1J0R A;  1MMN A;  4HF0 A;  1XS9 A;  3PUF A;  1RIO H;  2GZW A;  2M7A A;  3RKQ A;  4HBL A;  2ZO4 A;  3EET A;  3E5X A;  3J80 K;  2WAQ N;  1ORK A; 
#chains in the Genus database with same CATH homology
 2VBW A;  4Q48 A;  2HTS A;  2RGV A;  3W6J B;  4MHG A;  4LK0 F;  3ECO A;  4R79 A;  1MGT A;  4FT8 A;  4EGZ A;  3FWE A;  4P9F A;  3TOB A;  4ZYG A;  1MKM A;  3BWG A;  4B09 A;  2VE9 A;  1K79 A;  2MLK A;  3WGG A;  1SFE A;  1B9M A;  2FA5 A;  5CVV A;  1LDK B;  1C0W A;  2H6C A;  2FOK A;  5E20 A;  3MEX A;  3ULQ B;  4M73 A;  1FP1 D;  3C1D A;  1P92 A;  2LF7 A;  2EV0 A;  3TOA A;  2PN6 A;  4ON0 A;  3BPV A;  2OQR A;  3RYP A;  2YX7 A;  3KET A;  4ENM A;  1LQ1 A;  1R1U A;  4KNY A;  1Q1H A;  2AXL A;  3QP6 A;  3F22 A;  4RGU A;  2HYF A;  2Y48 A;  2L3D A;  5K5O A;  1EH8 A;  2A6E F;  2EJR A;  1DUX C;  3CO6 C;  3HHH A;  3GXO A;  3T8T A;  4H0E A;  4LLN A;  1KA8 A;  3ZMT A;  4HX7 A;  1P6R A;  1FYK A;  1R7J A;  2H09 A;  2VON A;  3V7R A;  5EEH A;  3M9A A;  3R0A A;  2O0Y A;  3E5U A;  3E6D A;  4K2E A;  4O5V A;  5E1W A;  1R1V A;  1JHH A;  1GXP A;  2PFB A;  3GX4 X;  1U5T A;  4PDK A;  2VBZ A;  2XRO A;  3NEU A;  3I0T A;  1IUY A;  1LDD A;  5E18 F;  1NHA A;  2BEO A;  3VEP A;  1FOK A;  3HRS A;  1XSV A;  3GFM A;  4DNC A;  1I27 A;  1KU3 A;  5HOO A;  3IRQ A;  2L54 A;  5L3B A;  2QQB A;  3LAP A;  1P4X A;  2PEX A;  3AAF A;  2ISZ A;  4LK1 F;  2MH2 A;  5ILU A;  2RVC A;  3E3V A;  1SD6 A;  5J6X A;  3COA C;  4ENJ A;  1HKT A;  3MZY A;  4RB1 A;  2RC4 A;  3KP5 A;  3I59 A;  4ASN A;  2BYV E;  1FYL A;  4CYD A;  1SFU A;  3CUO A;  1FP2 A;  4DQ2 A;  1R5H A;  2X0L A;  2FBH A;  4S05 A;  5D5W B;  2Y0M A;  3RYR A;  2ISY A;  5ICF A;  3V4G A;  3LQR A;  2F2E A;  4IXA A;  1F9N A;  4YII A;  4KIC A;  3F8F A;  3P9K A;  2YX4 A;  1XD7 A;  5LHH A;  5E8G A;  1QZY A;  1CF7 A;  2PG4 A;  1Z91 A;  1XDS A;  4U0W A;  4Q5S F;  2DT5 A;  3U9G A;  1ZGA A;  3TQN A;  3CDH A;  3ISP A;  2K7L A;  5LEK A;  1KQ9 A;  3F6O A;  1XDU A;  2QQ9 A;  2ZJ2 A;  1TQP A;  3FMS A;  1DDN A;  2FML A;  5FD5 A;  3TO7 A;  3F21 A;  1EV7 A;  4CO8 A;  2OBP A;  5ILS A;  4UHT A;  2HFH A;  1SMT A;  5DV5 A;  5ICE A;  3OOP A;  4GYG A;  2JRT A;  2P7C B;  4WXD A;  2Q0O A;  4I0A A;  2F5F A;  1W7P A;  2MA3 A;  1XGM A;  3KP3 A;  2CGP A;  2XAG A;  1R5G A;  2W24 A;  1F5T A;  2QQA A;  1T98 A;  2OAZ A;  4PZJ A;  1OYI A;  1R1T A;  5HS7 A;  3LA7 A;  4ZZL A;  2P5V A;  4OIN F;  5ICG A;  5L3G A;  1PDN C;  5DD4 A;  5K1Y A;  4M9Z A;  4OIQ F;  2DW4 A;  5E17 F;  3GZ6 A;  3CUQ C;  1LVA A;  2EV5 A;  5D4R A;  2P6T A;  2L02 A;  3HSF A;  2O3F A;  5A2Q K;  1B59 A;  2K4J A;  2W25 A;  1O7F A;  1FNN A;  2OD5 A;  1F1Z A;  4P55 A;  5ED4 A;  4EJT A;  2DTR A;  2OZU A;  3PQJ A;  2D2W A;  4NHJ A;  3V8K A;  1ODD A;  3BZ6 A;  1BJA A;  1ZRF A;  5D4S A;  1ZLJ A;  3T8R A;  2FNP A;  3WTU C;  1T38 A;  3HRM A;  5D6E A;  2GXB A;  3GUD A;  2JPB A;  3CO7 C;  2V79 A;  1W5S A;  5CVJ A;  1XSD A;  3LWF A;  3CUQ B;  5LEJ A;  1FT9 A;  2RQP A;  1R58 A;  2GA2 A;  3FF5 A;  2F5E A;  1ZGJ A;  3F3X A;  3GYH X;  2JTV A;  4O3M A;  1EH7 A;  4HA8 A;  3ZMS A;  4ESJ A;  4M71 A;  3KLN A;  1ON2 A;  2L4A A;  4HLX A;  2A69 F;  5BS6 A;  3F23 A;  4N0B A;  2FU4 A;  2YPR A;  1XSX A;  5BQT A;  4LB6 B;  4M9X A;  1BC8 C;  2H6B A;  3KE2 A;  1ZH5 A;  3PFI A;  1A04 A;  3WTX C;  4EV0 A;  3KZY A;  2XAS A;  2ZCW A;  3E97 A;  4KUM A;  1WQ2 A;  1KYW A;  4HV5 A;  2ZME A;  4G6D A;  3WTS C;  1FPQ A;  2HDC A;  3REO A;  4E70 A;  2HZT A;  3DQV C;  5FO5 A;  2R3S A;  3NRV A;  2VC0 A;  3SZT A;  1TTY A;  1TQM A;  4G8X A;  1U5T B;  1USS A;  4IVN A;  2DAO A;  4LG0 B;  3QOP A;  2V1U A;  3P7N A;  3MFK A;  2W85 A;  1IF1 A;  5DUK A;  5H6R A;  3RDI A;  3TDZ C;  1HQC A;  2G9W A;  4ZYD A;  4GCV A;  1BIA A;  4UNO A;  2NS0 A;  2Q8K A;  4XBF A;  2VOO A;  3J7A O;  4G7Z F;  4MEY F;  4YG2 F;  3K0L A;  1J2X A;  4XLP F;  1MZB A;  1ZG5 A;  3QPT A;  5HDN A;  3I59 B;  4EM0 B;  2E1C A;  4RS8 A;  4M9S A;  3JAM Z;  4L9V A;  2XAJ A;  5DYM A;  5HDK A;  5FLX Z;  1FWZ A;  1TBX A;  1J9I A;  2DPU A;  4Q4Z F;  1IN4 A;  4ENK A;  1XB4 A;  1I6X A;  1VTN C;  2GXG A;  5DCF A;  2IRF G;  2BV6 A;  1D8K A;  5DCM A;  4RAZ A;  2M45 A;  2FEZ A;  3H3U A;  1QGP A;  5BPI A;  4CZZ A;  3WOD F;  1CF7 B;  1PUE E;  1XN7 A;  4UXN A;  3S2W A;  3SQN A;  2FNA A;  2OA4 A;  2ZKZ A;  3F8C A;  1ZRC A;  5IT9 K;  2P4W A;  2DPD A;  4WK8 F;  1IXR C;  2VT3 A;  4ENN A;  5D6F A;  1O7L A;  3U2R A;  1AOY A;  2DQL A;  2HKO A;  1YS6 A;  3RKW A;  1KU2 A;  2RN7 A;  3R60 A;  1B1B A;  4IPA A;  2VOD A;  1DPR A;  1HW2 A;  3KP4 A;  3G3Z A;  4QLC U;  3V8J A;  3IC7 A;  1KGS A;  1JHF A;  3BPX A;  2FRH A;  3ZMV A;  1W7P B;  3HIF A;  4U7D A;  4YFK F;  1WWX A;  3MQ0 A;  1WRJ A;  4F7Z A;  4I98 B;  1P2F A;  2J5P A;  1FSE A;  2P5K A;  3SZP A;  3RPU A;  2M30 A;  5AIP A;  2ACJ A;  2EA4 A;  1U3E M;  1IXS B;  1LNW A;  3FXQ A;  1STZ A;  2IW5 A;  3CUQ A;  5CVU A;  5F6F A;  3H92 A;  4I02 A;  5KVR A;  4GGG A;  1ZAO A;  1UCR A;  3DPT A;  3ZMU A;  1ZRE A;  5AIQ A;  4FX0 A;  5IT3 A;  4RGX A;  4EJW A;  2KKO A;  3WE3 A;  4HX4 A;  4CGZ A;  3KFW X;  2IT0 A;  1FBS A;  2QWW A;  1HKQ A;  2GIV A;  4EMS A;  3H3Z A;  4EJO A;  1S29 A;  2FE3 A;  3IWF A;  2WWY A;  4MNU A;  1KYZ A;  2ESN A;  4HQE A;  5FFX A;  5LBQ A;  2ZXJ A;  4MGR A;  4YFN F;  1QO0 D;  1Z1D A;  3TKY A;  2O61 A;  3KP6 A;  3F8M A;  3BOQ A;  2QUF A;  4LLL A;  3FMR A;  1R23 A;  2EV6 A;  1YTY A;  5JVT A;  2HYG D;  4PGH A;  4CDG A;  3O2P E;  3HYI A;  3C18 A;  4UV8 A;  3SXY A;  3CJN A;  1G3S A;  3IHU A;  3QU6 A;  2Z3Y A;  3RKY A;  4LG0 A;  4R1H A;  2H27 A;  5E1Z B;  1REP C;  1P4W A;  2ZME B;  3Q9V A;  5ILV A;  2HWV A;  2QM3 A;  3I4P A;  2EA2 A;  4IRH A;  4IF4 A;  2HR3 A;  3E6B A;  5ICC A;  3ZPL A;  3I71 A;  3MWM A;  3IL2 A;  3N97 A;  2NRA C;  2M8E A;  3E6C C;  3M8F A;  2XVC A;  4MQV A;  3LQQ A;  3F8N A;  3EYY A;  1HXD A;  1YW7 A;  2LNB A;  3RI4 A;  3MAJ A;  1SMY F;  5JFR A;  4LB5 A;  4U0V A;  4KT5 C;  4RB0 A;  2JZY A;  4HV6 A;  1IRF A;  3I54 A;  4XSX F;  2CFX A;  1ZG3 A;  4P9U A;  2VOP A;  3JTH A;  3TO9 A;  1J59 A;  2O6G E;  4G94 A;  1BI1 A;  3DP7 A;  1HW1 A;  5CVI A;  2VBX A;  5D8L B;  5F1R A;  3FM5 A;  4MTE A;  5H20 A;  3HRU A;  1H9T A;  1KQ0 A;  2EWN A;  3G73 A;  4O6J A;  5LHI A;  1ONV A;  1UB9 A;  2LF8 A;  4HYE A;  3HTS B;  4OIR F;  2HGC A;  3DV8 A;  4I2O A;  3IWZ A;  4KMU X;  2VXZ A;  1W5T A;  4KIF A;  1QBJ A;  4RGS A;  2LDU A;  3FXR A;  4A12 A;  1BOA A;  1U2W A;  1T39 A;  2PLY A;  5LGT A;  1K78 A;  1ZYR F;  3K1N A;  2IA2 A;  3Q9S A;  4L9J A;  2HKX A;  4KIB A;  3I64 A;  5DCM B;  1HBX G;  1W4M A;  3VOE A;  3I53 A;  4RB2 C;  2EFN A;  5HVQ C;  3KEO A;  3BJO A;  2FQ3 A;  4KYW A;  4WCG A;  1KQ8 A;  1YYV A;  2NYX A;  1D5V A;  2B0L A;  1XMK A;  4R8H A;  3T0Y A;  1RI7 A;  1BIB A;  4HOB A;  2H94 A;  3CTA A;  3F72 A;  5LRS A;  2W84 A;  2EK5 A;  2TDX A;  3DEU A;  1QNT A;  2L4M A;  2PI0 A;  3HSR A;  1SD5 A;  2RV8 A;  3HUG A;  2BGC A;  1L3L A;  4A5N A;  4WWC A;  2HOE A;  3ERE D;  1YQA A;  4FHT A;  3EUH A;  4EVI A;  1E17 A;  2Z5U A;  5HLG A;  3JSP A;  2D45 A;  1CGP A;  1R36 A;  4RAY A;  4AIK A;  2KJB A;  2K86 A;  4HX8 A;  5D5X B;  2OQG A;  1ZAR A;  4ZYH A;  4Y15 A;  5HDG A;  4EQQ A;  1BBY A;  1HKS A;  1SD4 A;  1BI3 A;  1TNS A;  2KRF A;  2D1V A;  4HDV A;  3EDP A;  2DU9 A;  1G4D A;  2EB7 A;  1OYY A;  4OIP F;  4G6Q A;  1S3J A;  3ZMD A;  1HSJ A;  4BHB A;  2NNY A;  2IA0 A;  3W6K B;  4P5O A;  4EJU A;  1YG2 A;  3KEQ A;  5FFZ A;  5CJ9 A;  2GWR A;  4D0P A;  1O3T A;  1JGS A;  3E5Q A;  4WXH A;  2M5W A;  1XMA A;  3ECH A;  3HRT A;  4BQA A;  2Z99 A;  4XLN F;  4I0B A;  2LKP A;  3GFI A;  3WGI A;  4L5I A;  1LJ9 A;  5J8C A;  4ZH4 F;  4GO1 A;  4OMZ A;  3GFJ A;  1ZRD A;  2YSR A;  4YIF A;  4G7H F;  1YLF A;  1Z7U A;  4RB3 C;  2EFO A;  4L9N A;  1J75 A;  1G3Y A;  2DK8 A;  3QRF F;  1DPU A;  3BJ6 A;  1I1S A;  4EGY A;  1BM9 A;  4U88 A;  3O6B B;  2RKH A;  2OU2 A;  4MTD A;  2K4B A;  2VN2 A;  4AD9 A;  2VE8 A;  2JT1 A;  2V1X A;  2HQR A;  3LFK A;  2W57 A;  1ULY A;  4ESB A;  1IN8 A;  3T1B A;  4JQF A;  2STW A;  4L18 B;  2UXN A;  3QP5 A;  5L3C A;  3B02 A;  3OV8 A;  1GHC A;  1UFM A;  2A5Y B;  4EM1 A;  5D5V B;  1V3F A;  1ZLK A;  2R7D A;  3ABT A;  4BHC A;  1MJ9 A;  4ZYE A;  3K1P A;  3M1E A;  4OOI A;  1OPC A;  4CXF A;  2G7H A;  1I1G A;  4N9I A;  1HST A;  2XKO A;  4UVC A;  3JSO A;  2GA1 A;  5D5U B;  4BYY A;  1PP8 F;  1Z6R A;  1UHW A;  2KIF A;  4MEX F;  2FMY A;  2CYY A;  2XHK A;  3RIR A;  4KA4 A;  1R22 A;  4A2U A;  1OR7 A;  3J81 Z;  1LDJ A;  2DFI A;  4Y17 A;  4HZF A;  1Z6T A;  4LJZ F;  2J5O A;  4PCQ A;  3SFZ A;  3R4K A;  2YU3 A;  3FM3 A;  4AIJ A;  1DP7 P;  1TLH B;  2P6S A;  1RNL A;  1RUO A;  4I01 A;  3V7S A;  3V7C A;  1OKR A;  3FX3 A;  5HLH A;  1E2X A;  3WTT C;  1SAX A;  4G7O F;  1K78 B;  4KN4 X;  1BI2 A;  2QLZ A;  2FBI A;  2XRN A;  3L09 A;  5LGU A;  4XRF A;  4S04 A;  3WE2 A;  2ZFW A;  3TDU C;  2IA1 A;  3WTY C;  2E1N A;  4M6Y A;  1FC3 A;  1J7K A;  2XAH A;  3L00 A;  2EFP A;  3FZV A;  3GEZ A;  2ADU A;  4P96 A;  3KP2 A;  5AON A;  2FXA A;  4YFX F;  5HS9 A;  2QEN A;  5LGN A;  3LAJ A;  3VOD A;  4FX4 A;  2HEO A;  5CVR A;  1IZ1 A;  4N9H A;  4IRG A;  2MLG A;  1L0O C;  1G3W A;  2A3S A;  5FD6 A;  3KZZ A;  3J80 Z;  5BPD A;  1S7O A;  2DI3 A;  3KLO A;  1T2K A;  1FY7 A;  1H0M A;  1ZG1 A;  1U78 A;  1H9G A;  4LLG F;  2X4H A;  1LB2 A;  1S6L A;  1KU9 A;  2Y75 A;  4L9T A;  3L2C A;  1SFX A;  2PQ8 A;  1D3Y A;  4M74 A;  2A07 F;  4I7H A;  1QQI A;  3D0S A;  2Q2E A;  2DK5 A;  2QBY A;  4Q47 A;  5HS8 A;  2A68 F;  2COM A;  2GAU A;  2PBI A;  1OMI A;  2R7F A;  1Z05 A;  1O57 A;  4Z2Y A;  1U6G A;  1U8R A;  2GQQ A;  2PMH A;  5DDG A;  4LD5 A;  2VC1 A;  3ML6 A;  4L5J A;  4HAM A;  3PQK A;  2IVM A;  1T0F A;  1QPM A;  2CO5 A;  2OZ6 A;  2ZNY A;  1MDM A;  3EYI A;  4BXU A;  1I5Z A;  1AWC A;  1IN6 A;  3ZQ7 A;  4BH9 A;  1R00 A;  5E1X A;  1PP7 U;  3HOS A;  2FBK A;  2K27 A;  4LGW A;  3P9I A;  5LRR A;  3DXJ F;  3K9T A;  3RJP A;  2G7U A;  2ETH A;  3CLO A;  5K5R A;  3DF8 A;  3ZMZ A;  2HTJ A;  3DPL C;  5LLQ A;  4U0Y A;  3R6S A;  3ZN1 A;  3DFG A;  4Y13 A;  1B9N A;  1FBU A;  3ABU A;  5CYV A;  4RGR A;  1IAW A;  3LST A;  1IRG A;  2IPQ X;  1MJA A;  4UVA A;  1YS7 A;  3JTG A;  2LSO A;  3GFL A;  3F6V A;  4HDU A;  4CHU A;  1T6S A;  2PMU A;  3IKV A;  4A6E A;  4IHS A;  2D1H A;  3K2Z A;  1IW7 F;  1YFH A;  2BBY A;  1KU7 A;  2EFW A;  4GYI A;  2CSO A;  1S8N A;  5K5Q A;  4MQ9 F;  4HF2 A;  3GVA A;  2IP2 A;  3F8B A;  5JI6 A;  1FLI A;  3ZN0 A;  5FB2 A;  1ON1 A;  2UXX A;  2E7W A;  4HQM A;  3P9C A;  3QAH A;  1J5Y A;  2BE5 F;  4A0X A;  2XAF A;  1YO5 C;  4BAY A;  1OYW A;  3GLX A;  4KFC A;  3QU3 A;  3WG9 A;  1JXS A;  5EEG A;  2KJC A;  1IN7 A;  4JK1 X;  4XSZ F;  4KN7 X;  4CIC A;  2P8T A;  4LFU A;  3M8E A;  3BP8 A;  3Q5F A;  1P4A A;  3FHZ A;  2UWM A;  4EJV A;  3RKX A;  3E6M A;  5JHU A;  5HLI A;  1GXQ A;  3L7W A;  2CQK A;  3KCC A;  2XAQ A;  3GWZ A;  2XKP A;  3KP7 A;  2P7V B;  1O3Q A;  1XCB A;  3T5X A;  3LA2 A;  1Z9C A;  4OU0 A;  1SD7 A;  3TGN A;  3FXU A;  2JPC A;  1TQI A;  2O03 A;  1O3S A;  3BY6 A;  4UVB A;  3VFZ A;  5L3E A;  3M7G A;  4OMY A;  4IRI A;  2VT2 A;  5JR3 A;  1TW3 A;  2CWE A;  3WGH A;  5KK1 A;  2NAZ A;  2KIU A;  4IHT A;  1Y0U A;  3QPH A;  2AS5 F;  2RDP A;  5TJJ A;  1MJB A;  2ESH A;  2DO7 A;  2L01 A;  4NB5 A;  1MD0 A;  3GF2 A;  3MZH A;  1HW5 A;  3SHF A;  2XUB A;  3BRO A;  3WU1 B;  4NQW A;  5TRD A;  2MC3 A;  5A2Q Z;  3U1D A;  5F64 A;  3IRR A;  5ERI A;  4WX9 A;  2P5L C;  2F5C A;  3ZP5 A;  4ZZD A;  5DUI A;  1IN5 A;  1YIO A;  2QVO A;  4UV9 A;  4OIO F;  3RPQ A;  1FSH A;  2QYO A;  1G3T A;  2STT A;  2MBF A;  2VBY A;  1D8J A;  2IJL A;  4G9Y A;  4I09 A;  2E7X A;  4B8X A;  4BNC A;  2Z33 A;  2A61 A;  1UST A;  2QBY B;  1TW2 A;  2JSC A;  3RTR A;  2M87 A;  3V8L A;  5CLS A;  4HF1 A;  2ZBK A;  2A6H F;  5BOX A;  3GO5 A;  5FGM A;  3K1M A;  2UZK A;  4HW0 A;  3N4M A;  1V4R A;  3HOT A;  5H6Q A;  3WU0 A;  4TV7 A;  2YR2 A;  3WTW C;  5D8K B;  1RZ4 A;  3K69 A;  3C3W A;  2Z9O A;  3I5U A;  1MDM B;  1U5T C;  4PGG A;  4KIG A;  1FZP B;  3WTZ A;  3MCZ A;  4L0Z B;  3D5L A;  2K02 A;  1JE8 A;  1TNT A;  1B6A A;  1UHM A;  2XGX A;  1XGS A;  3BDD A;  1X3U A;  4WXC A;  3ROU A;  2DLL A;  2XV4 S;  2DQR A;  1LEA A;  3VB2 A;  2DBB A;  1W7P D;  4AWX B;  2HS5 A;  2FF4 A;  1XGN A;  1O3R A;  1S7A A;  5J8F A;  4M6X A;  4L0Y B;  1FYM A;  2HQN A;  4A6D A;  2XIG A;  4A0Y A;  2PJP A;  3BJA A;  4ESF A;  1XGO A;  2ELH A;  4WF2 A;  1K7A A;  4A0Z A;  1WKM A;  2NNN A;  3NQO A;  1G6N A;  2O8X A;  4LMY A;  5LHG A;  3HSE A;  3FMQ A;  4QWQ A;  4HLY A;  1BC7 C;  4GXO A;  4KMF A;  2KIM A;  3R0J A;  6PAX A;  1EH6 A;  5L3D A;  1ZHF A;  2QZ8 A;  3JAM K;  1YW8 A;  1GVJ A;  2C6Y A;  3GW2 A;  3IKT A;  1WI9 A;  4BHP A;  3R61 A;  5FLX K;  1ZN2 A;  3LA3 A;  2V9V A;  3J81 K;  4UUV A;  2V1D A;  1WSU A;  2F5D A;  1IXC A;  5E8I A;  4KDP A;  1XCV A;  3HHG A;  1F4K A;  1BN5 A;  1QZZ A;  4AIH A;  2WV0 A;  1BI0 A;  3JW4 A;  5DD8 A;  2MH9 A;  3DKW A;  4EM2 A;  2EFQ A;  3I58 A;  3L9F A;  3HTU A;  2FSW A;  3C7J A;  5L3F A;  2CW0 F;  3WTV C;  4U7B A;  4A5M A;  2WTE A;  3B73 A;  2RNJ A;  3EQL F;  2MD5 A;  3GZ5 A;  3TO6 A;  1FX7 A;  3ELK A;  1B4A A;  2WC2 A;  5BMZ A;  5IT9 Z;  4ETS A;  5DEQ A;  1K6O A;  1RUN A;  4M72 A;  4IJA A;  4AVP A;  2M1B A;  2ZNZ A;  1FBQ A;  4JBA A;  1LEB A;  3O3K A;  2CG4 A;  1YW9 A;  2V6C A;  1J0R A;  4HF0 A;  1RIO H;  2GZW A;  4HBL A;  2ZO4 A;  3EET A;  3E5X A;  3J80 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...