2DQLA

Crystal structure of the circadian clock associated protein pex from anabaena
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
115
structure length
115
Chain Sequence
MKIEDIYQFFENPPPTYLCQEVAICYILYVLLQGESYGTELIQQLETEHPTYRLSDTVLYSAIKFLEDNRAITGYWKKLEGRGRPRRMYQVSPEWQHQAEDLARLWQNYIYVRTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Circadian clock protein
molecule keywords Pex protein
publication title Functionally important structural elements of the cyanobacterial clock-related protein Pex.
pubmed doi rcsb
source organism Anabaena sp. pcc 7120
total genus 36
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dqlA00
1FNNA 3KP5A 1UHMA 3JW4A 4Q47A 2QYOA 4ZH4F 2W25A 1XGMA 4R8HA 1LEBA 1UHWA 5LLQA 3H3ZA 1Z05A 3KCCA 4RGSA 2KIMA 3V8LA 3RYPA 4B8XA 2A61A 4P9FA 3EDPA 2HZTA 2XROA 1AOYA 1BBYA 4FT8A 3Q5FA 5ILSA 1P92A 2C6YA 1KU2A 1W4MA 1S29A 1Z9CA 3BP8A 2W85A 3LA7A 4HBLA 3LA3A 2G7UA 5E1WA 1TLHB 3F72A 5K1YA 5LRSA 4KT5C 2RGVA 1KYZA 3LWFA 3KP2A 3O2PE 1K78B 4G7ZF 2ESHA 2PJPA 1KU7A 2GWRA 2YX4A 3V8JA 2HYGD 2ZNYA 1BC7C 3IWFA 5BS6A 2PEXA 2VOOA 3GZ6A 3Q9SA 3F8CA 4O3MA 5DUIA 2LKPA 4XRFA 3DF8A 5K5QA 3D0SA 2Y75A 2EV0A 1B9NA 1UB9A 1JHFA 2YR2A 3W6KB 5D8LB 4EV0A 1Z91A 3IHUA 3ZN1A 2EV6A 1PP8F 4EJVA 1H9GA 3E5XA 2VBWA 1SAXA 1GVJA 5HDGA 1ZG3A 1W5SA 4ZZDA 2PN6A 4MTEA 5IT9Z 5L3DA 1B6AA 2KIFA 1IUYA 5IT3A 2RC4A 1KQ8A 5KK1A 2FEZA 3G73A 2P4WA 1YIOA 4MQVA 4LLLA 2A6EF 4DQ2A 4ETSA 1YLFA 3FZVA 2QLZA 2OA4A 3WTZA 4Y15A 3DEUA 2FQ3A 1GXPA 3E6DA 1ZG1A 2Q0OA 3D5LA 3KLNA 2A68F 4BH9A 4RGXA 1TNSA 1HQCA 1TBXA 3E5QA 2EFOA 1HSTA 2JRTA 3SQNA 4RB3C 3QP5A 1LDDA 2FRHA 1OYYA 1P6RA 1QZZA 4KNYA 5CJ9A 2J5PA 4R1HA 1H0MA 4RB2C 4IHSA 3I71A 2CYYA 3C3WA 3R0JA 4GYIA 4M9XA 3ZMZA 2MD5A 4UVBA 1ZAOA 5E18F 1IXCA 3RDIA 5HDKA 4EJOA 5E8IA 1TW2A 1B9MA 2Z5UA 2Q8KA 2GQQA 2HYFA 2M30A 2LF7A 2M87A 1CF7B 4L18B 2EFQA 1WI9A 3NQOA 2V9VA 1TQMA 1V3FA 1J0RA 3ML6A 2UXXA 5HS8A 1IRFA 1LDKB 2XIGA 2VXZA 4IVNA 2HWVA 5ERIA 3CUQA 3EYYA 4LLGF 1R22A 4LMYA 3KP4A 1P4AA 1O7LA 3IL2A 2M8EA 1I27A 5CLSA 1FZPB 1T39A 5HLHA 1OYIA 1DPRA 2XVCA 2HGCA 3DV8A 4QLCU 3MQ0A 2NYXA 2R7FA 1KU9A 2KKOA 2Y48A 4WXDA 1SFXA 2KJCA 3JAMZ 1KQ9A 1ODDA 4KA4A 2FU4A 2G9WA 4MEXF 1FX7A 2EK5A 3ECOA 2BYVE 1LDJA 2CFXA 3IRRA 1JXSA 2K27A 3P9IA 1QNTA 1BOAA 5JVTA 2OAZA 1FYKA 4I0AA 1W7PA 3IKVA 3TQNA 5DV5A 3TGNA 2GXBA 3B02A 3BWGA 2PG4A 4UNOA 5HOOA 4I01A 3MCZA 3HRTA 2VN2A 3BY6A 4I2OA 1HKSA 1U6GA 1LJ9A 5HS9A 4EJTA 3LQRA 2PMHA 2F2EA 1F1ZA 1XDSA 4KFCA 1I1SA 2FBKA 3O6BB 5LEJA 3MAJA 4AIHA 1MJBA 2BV6A 4O6JA 3GZ5A 5CVUA 2P5LC 3REOA 1PUEE 3RKYA 1STZA 2V1DA 2CGPA 3RTRA 2QQBA 2KIUA 1U5TC 1S8NA 1U5TB 2A5YB 3LFKA 1RNLA 3MZYA 3VB2A 3ZP5A 5LGNA 1SMYF 4JK1X 3L2CA 5DYMA 2NAZA 2TDXA 1HKQA 2D1HA 3RKXA 2MLGA 1O3QA 1HW2A 2ISYA 2W24A 4L5JA 3BZ6A 4G6DA 5FGMA 3R0AA 2XAQA 1SD6A 4MEYF 4EM1A 1LVAA 4FX4A 4L0ZB 2PI0A 2NS0A 3JTHA 1BJAA 3TOAA 2YPRA 4HW0A 5BOXA 5AIQA 4GYGA 2JTVA 3GYHX 3FM3A 2QBYB 4OIRF 1D3YA 1HSJA 1YQAA 2EA2A 5D8KB 3HSFA 1ZRFA 3C1DA 4G7OF 2STTA 3H92A 3C7JA 3WTWC 3GF2A 3C18A 1HW5A 4JQFA 1S7AA 3VODA 4MTDA 1ZARA 4M9SA 2WC2A 3ZMTA 2PQ8A 1OR7A 2ZMEB 1F5TA 2H27A 4I98B 2XKPA 5FO5A 1BIBA 1Y0UA 1LNWA 1U78A 3QAHA 1KU3A 4IHTA 1QZYA 2H09A 5LGTA 2V1UA 1LEAA 5FFZA 3WGHA 2K7LA 4ZYEA 5DUKA 3L00A 1R5HA 4KN4X 3CO7C 1ON1A 2DQLA 2K4JA 1YS7A 3T5XA 5E20A 2YU3A 2L3DA 3JAMK 2XUBA 1MJ9A 3RJPA 2RNJA 3V4GA 4BQAA 5HVQC 1SFUA 4IRIA 3I64A 4L5IA 4AIJA 1BN5A 2MH9A 2ZFWA 2L4MA 4GO1A 3G3ZA 2F5CA 1IN7A 1SFEA 4KN7X 4UHTA 1ZH5A 4G94A 1OYWA 4A0YA 1GXQA 1CF7A 1BIAA 1ZRCA 2F5FA 1PDNC 2E1NA 3ZN0A 4UVCA 2NNYA 3F8BA 2E7XA 3BDDA 4O5VA 4MNUA 1G4DA 3SXYA 3GFIA 1P4WA 1T98A 3P9KA 1DPUA 3WODF 2V79A 3QOPA 2HDCA 1G3YA 1UFMA 1YO5C 4EM0B 4P55A 1IF1A 1FWZA 3KE2A 4OIQF 2KJBA 5ICCA 3NRVA 3T1BA 1FBUA 5ILUA 2F5EA 2P8TA 2GXGA 2Q2EA 1KA8A 5E1ZB 3DPTA 2CSOA 2NNNA 1IW7F 2HKXA 1B1BA 1G3TA 3GFLA 1XSDA 3FX3A 3R60A 1TQPA 3GFJA 2M1BA 2DPDA 2WTEA 2ZKZA 4OOIA 1ONVA 1UCRA 5JI6A 1IXRC 4HYEA 4OINF 4Q4ZF 4ESBA 2MA3A 2HR3A 4M74A 2W84A 3M9AA 4U0YA 1YW9A 2O61A 4HV5A 2VT3A 1XGSA 4KIBA 1YW8A 2LSOA 3WE3A 2DTRA 2PBIA 5K5OA 1YYVA 2XAJA 5J8CA 1YTYA 1FP1D 2BBYA 3EYIA 3P9CA 5J8FA 3GX4X 2DT5A 1EH6A 3TO9A 5D4SA 4LG0B 1F9NA 3K0LA 1G3WA 2K02A 4CHUA 2V1XA 5CVIA 2QUFA 4P9UA 2D45A 1F4KA 1BI3A 5ILVA 2OZ6A 3LQQA 4AIKA 3ABTA 3HSEA 5AIPA 1U5TA 2XHKA 3EUHA 3IRQA 4HX8A 3I59B 4KMFA 3MZHA 2K4BA 2IA2A 2FOKA 3WTSC 2DK5A 3BROA 2EJRA 2F5DA 2VE8A 1IXSB 1PP7U 5A2QK 4EJUA 1LQ1A 1J5YA 4KMUX 4PCQA 1B4AA 1O57A 1OPCA 2BE5F 4U7BA 2P5KA 3N97A 1T2KA 3W6JB 4FHTA 2M45A 4XSXF 5H6QA 5J6XA 2WV0A 3K1NA 4MGRA 3RKWA 2IW5A 1WSUA 2JPBA 1MZBA 4KIGA 3WTVC 1Z6TA 3O3KA 3QPTA 3HIFA 1QBJA 1IN5A 3K1MA 4M6YA 1A04A 1XSXA 1R7JA 3VOEA 2ACJA 2ZMEA 3KP3A 2MBFA 2ZBKA 1R5GA 4WK8F 1ULYA 4N0BA 1U8RA 2ETHA 3HOTA 4XLPF 4Y13A 3KZZA 3FXUA 3J7AO 3E6BA 5ICEA 2LF8A 3I54A 3ERED 2VONA 2FBHA 3SHFA 1YS6A 2ZCWA 2KRFA 3V7RA 2IT0A 3DP7A 4A12A 4KUMA 2AXLA 5D6EA 1ZGJA 2FF4A 4HF1A 5F64A 2IPQX 3ROUA 3K1PA 2IA0A 3BJOA 1TQIA 3COAC 1XGOA 3FHZA 4YIFA 4RS8A 2PMUA 1ON2A 2CW0F 1FBSA 3MWMA 3EQLF 3WE2A 3PQJA 1ZLJA 2B0LA 1HW1A 1O3SA 2E7WA 2P7CB 4WXHA 2VBYA 3B73A 2HKOA 1S6LA 3FXRA 1FY7A 2Z3YA 4OMYA 4ZYHA 3I5UA 2PFBA 2FSWA 2IVMA 1ZGAA 5CVJA 2JZYA 3BJ6A 2HQNA 2H6CA 2FNAA 2FMYA 4LD5A 3HSRA 1R58A 1BC8C 2EWNA 3E6MA 1J2XA 1O3TA 1JGSA 5HLGA 4IRHA 1FYMA 2L54A 3F21A 2DU9A 3WTTC 1FBQA 1P4XA 4P5OA 3PQKA 2HTJA 5FLXK 1BI0A 3U2RA 3ZPLA 1ZHFA 2M5WA 2XAGA 4UVAA 3R6SA 2YX7A 4RB0A 5CVRA 2IJLA 2EV5A 3K69A 4WXCA 1O7FA 2OD5A 4PZJA 5LRRA 2A3SA 3SFZA 3TO6A 3LSTA 3I0TA 2L01A 4G8XA 1D5VA 4KIFA 1JHHA 1ZRDA 1OMIA 4HF2A 3CJNA 1K78A 1MGTA 3LA2A 2XKOA 2VT2A 1O3RA 1R36A 4L9TA 3FF5A 5AONA 2R7DA 2RV8A 1OKRA 3GWZA 2EA4A 2X0LA 2D2WA 1QO0D 3BPVA 5BMZA 1Z1DA 3E97A 3RI4A 4LG0A 2A6HF 1K6OA 3HRUA 3QP6A 3TDZC 4UXNA 4M72A 1TTYA 2AS5F 6PAXA 4E70A 4OU0A 4WF2A 3FMSA 2QQAA 3KP7A 1TW3A 3DPLC 3F22A 5LBQA 4CZZA 5JFRA 5D5WB 3DKWA 3I59A 3KEQA 2VC0A 2W57A 2P6TA 1P2FA 3DQVC 5CYVA 5F6FA 2O6GE 4JBAA 4CGZA 3CLOA 4HAMA 3V7SA 4KICA 2O03A 1R1VA 2HEOA 2HQRA 1WKMA 5BPIA 3HTSB 2GAUA 5LHIA 5KVRA 3OOPA 2EFPA 5BQTA 3ZMUA 5L3EA 2MC3A 2H94A 3FMQA 2ZJ2A 1MDMB 2DI3A 4A0XA 5D5VB 1SD4A 4IJAA 4HLXA 5E1XA 1FSHA 1TNTA 2QVOA 3PFIA 3KZYA 3IKTA 2V6CA 1HKTA 2QZ8A 3GLXA 5A2QZ 1WQ2A 4GGGA 2RKHA 4EQQA 5DCFA 3QRFF 3RPUA 3FWEA 2XAHA 5ICFA 4ESJA 2HOEA 2OQGA 3T8TA 5D5UB 1KGSA 3ZQ7A 4BXUA 2EFWA 5L3BA 1XB4A 4S04A 2IP2A 2K86A 4ENMA 1EH7A 4HDVA 1EH8A 1QGPA 4RGRA 3FMRA 3ECHA 3J80Z 2ZXJA 1X3UA 4HA8A 2NRAC 4M73A 4EMSA 5DEQA 2FBIA 3CUQC 5FFXA 2DBBA 2GA2A 3CUQB 4N9IA 4QWQA 3IC7A 3V8KA 5F1RA 1FC3A 1L0OC 1KQ0A 2GZWA 3FM5A 1HBXG 3HTUA 3CDHA 2WWYA 5FB2A 4CXFA 3KLOA 1MKMA 2GIVA 1RUOA 3HHHA 1YG2A 3HRMA 4S05A 4M9ZA 4PGGA 3HYIA 1L3LA 2DFIA 1Q1HA 4R79A 2LNBA 3RPQA 2FMLA 3DXJF 5DCMB 3H3UA 1XD7A 3RYRA 3T0YA 2D1VA 5BPDA 4IRGA 3KEOA 4HX7A 3TO7A 1R1UA 4WCGA 4CDGA 1B59A 3GO5A 3ISPA 1J7KA 2VBZA 4AD9A 3M1EA 3K9TA 2L02A 2OBPA 1W7PD 1W7PB 4CYDA 4U7DA 1T6SA 1USTA 1R1TA 1YW7A 3M8FA 4IPAA 4A5MA 3WG9A 1RZ4A 1MJAA 3WTUC 2RDPA 2JT1A 3BJAA 1ZN2A 4ESFA 4N9HA 1WWXA 2FXAA 3GW2A 4A6DA 1DDNA 1BI2A 1RI7A 4KDPA 2Z99A 4ZYDA 2Z9OA 1XGNA 4LB5A 4L9VA 2CWEA 3WU1B 1S7OA 3TKYA 1XCBA 1WRJA 4I09A 3SZTA 1IN4A 2QM3A 2LDUA 1USSA 4OMZA 1E2XA 3LAJA 2Z33A 4IXAA 3TDUC 3WU0A 5FLXZ 3M8EA 3ULQB 2HTSA 4U0VA 4A6EA 2ZO4A 1QPMA 4D0PA 4BYYA 4ZZLA 5DDGA 1FLIA 1I5ZA 1NHAA 1G6NA 2COMA 3CO6C 3WGIA 4LGWA 1Z6RA 2UZKA 1J9IA 4HDUA 4CO8A 2DQRA 4L9NA 3F6VA 2ADUA 4CICA 4XSZF 3HRSA 2FNPA 1XDUA 5D5XB 2MH2A 3KFWX 2O3FA 2QBYA 5ICGA 1I1GA 1JE8A 2DAOA 3QU6A 5JR3A 3J81Z 1FT9A 2CG4A 3I4PA 3J80K 1XCVA 2RN7A 5CVVA 3P7NA 2DW4A 3ZMDA 4P96A 4I7HA 3F23A 1Z7UA 2J5OA 5LGUA 4U0WA 1R00A 4UV9A 3CTAA 3V7CA 1ZYRF 5HLIA 1ZG5A 2DO7A 4TV7A 1MDMA 3F8MA 2A07F 3BPXA 1K7AA 1J59A 1C0WA 4U88A 1BI1A 2QQ9A 3HHGA 1DUXC 3NEUA 4XLNF 1MD0A 4HQEA 4NB5A 3GEZA 1S3JA 4YFKF 1U3EM 1T0FA 4B09A 3KETA 2XAFA 1VTNC 1QQIA 3U1DA 2RVCA 2BEOA 1AWCA 3CUOA 1FPQA 4HF0A 3N4MA 4OIPF 1J75A 1XMKA 2OU2A 4RAYA 4M71A 2P6SA 5DD4A 2EFNA 4MQ9F 2HS5A 4UV8A 3FXQA 4G6QA 2DPUA 3MEXA 3QPHA 1SMTA 4GXOA 3QU3A 4BAYA 1IN8A 3LAPA 3DFGA 1K79A 2ISZA 4HX4A 2ESNA 1ZREA 4WX9A 5LHHA 4EJWA 2A69F 4LFUA 3EETA 1IAWA 1IRGA 4ZYGA 4EVIA 2UXNA 3TOBA 1SD5A 2DK8A 4OIOF 3R4KA 2IRFG 3L09A 3I53A 4HV6A 3WTXC 2RQPA 2CQKA 1V4RA 3HOSA 3OV8A 4ENKA 2FA5A 5L3GA 4HQMA 5DCMA 2HFHA 5JHUA 4WWCA 4YFXF 4IF4A 1XMAA 3E3VA 2P5VA 2Y0MA 3WTYC 3ABUA 5ED4A 3F6OA 4YFNF 4I02A 2P7VB 5LEKA 2O0YA 2VBXA 2L4AA 1T38A 1W5TA 5L3CA 3ELKA 3I58A 1FP2A 4BHBA 2OQRA 4LB6B 5DD8A 3WGGA 2IA1A 3L9FA 2QWWA 4ENJA 1FOKA 1LB2A 3L7WA 5E17F 5EEGA 2JSCA 4Q48A 5IT9K 4LJZF 3KP6A 4HZFA 4AVPA 5D6FA 4XBFA 1RIOH 3S2WA 1D8JA 2PLYA 3JSPA 3T8RA 3J81K 5H6RA 3GUDA 3AAFA 3Q9VA 4RGUA 5D4RA 1R23A 3VFZA 2JPCA 1U2WA 3E6CC 2XV4S 4EM2A 4LLNA 5HDNA 4Z2YA 4NQWA 3F8NA 2O8XA 4LK0F 3ZMSA 4YG2F 1D8KA 4BHCA 2CO5A 1XN7A 4NHJA 2VC1A 4H0EA 5E8GA 1ZLKA 1I6XA 4L9JA 4Y17A 4MHGA 4KYWA 1BM9A 4BHPA 3ZMVA 1FYLA 1REPC 1KYWA 4GCVA 2H6BA 1HXDA 1E17A 3VEPA 3R61A 4DNCA 1CGPA 2XRNA 4PGHA 1G3SA 1FSEA 2QENA 2VODA 4HOBA 5TRDA 1H9TA 4LK1F 4RB1A 3F8FA 4PDKA 4A5NA 4HLYA 2MLKA 4EGZA 3BOQA 2GA1A 4YIIA 5FD5A 3MFKA 4M6XA 4BNCA 5HS7A 2VE9A 2OZUA 4L0YB 2BGCA 5TJJA 1RUNA 3GFMA 4F7ZA 5FD6A 2ELHA 5H20A 3HUGA 4AWXB 4K2EA 1SD7A 3GVAA 2E1CA 4FX0A 3M7GA 2R3SA 2YSRA 3F3XA 4A2UA 2X4HA 2XASA 5L3FA 3E5UA 3GXOA 2VOPA 3RIRA 4A0ZA 1IZ1A 3IWZA 4ASNA 2ZNZA 1XSVA 4G9YA 1EV7A 2XGXA 4ENNA 4EGYA 1DP7P 4ON0A 5EEHA 4I0BA 5LHGA 2G7HA 3JTGA 1GHCA 2STWA 4UUVA 4Q5SF 1IN6A 3K2ZA 4RAZA 2UWMA 1YFHA 3U9GA 2EB7A 4G7HF 3SZPA 5K5RA 2DLLA 2FE3A 3JSOA
chains in the Genus database with same CATH superfamily
1FNNA 3CP2A 1Y1VJ 3KP5A 1UHMA 4A3IJ 4A3CJ 3JW4A 2VKVA 4Q47A 2QYOA 4ZC3A 4ZH4F 2EZIA 2W25A 2M2EA 4HSTA 5E3LA 1BW5A 1XGMA 4OAZA 2LOOA 2ZXIA 4R8HA 2CFOA 3GTOJ 1LEBA 2AQFA 3G1LA 1UHWA 5LLQA 4BE0A 4QTRA 3H3ZA 1ETOA 1Z05A 3AG2H 2E34A 3CC2I 3KCCA 3BLYA 5J1RA 1D0YA 2E36A 4RGSA 1ETKA 1ZKGA 2KIMA 2V4JC 5IOZA 3V8LA 4XKVA 3RYPA 4B8XA 1MMDA 3D5SC 1X1CA 2A61A 3D5RC 4P9FA 3EDPA 2HZTA 3QYEA 2XROA 1AOYA 1DQUA 1BBYA 3LNQA 4FT8A 2M4GA 2UUZA 3Q5FA 2XF7A 2IXSA 5ILSA 1YRNA 1P92A 3HJEA 2C6YA 3FXJA 2F5VA 3K7AJ 1KU2A 1W4MA 2WAEA 1S29A 1Z9CA 3BP8A 2W85A 3Q0UA 3G6EI 3LA7A 2KFDA 4HBLA 2L7FP 2VKHA 3A0HC 4CCKA 3I9V2 3LA3A 3L1PA 2G7UA 5E1WA 3JRDA 3GTMJ 1R9TJ 1UJ8A 3GTJJ 2CQ7A 2LP0A 2EBIA 3LSJA 3PNYA 1TLHB 1WPKA 3F72A 2RAEA 5K1YA 5LRSA 4AU7A 4KT5C 2RGVA 1KYZA 4RA2A 2KDOA 3LWFA 3KP2A 2GXAA 3O2PE 1K78B 2ZJQF 3VYUB 4G7ZF 1NK3P 2ESHA 1IRXA 2PJPA 2VL8A 1KU7A 2GWRA 4PFPA 2WAQN 2YX4A 3V8JA 3BR6A 2RREA 2HYGD 2K3FA 2ZNYA 5CQGA 5GADJ 1BC7C 3IWFA 1ETVA 2HNHA 5BS6A 2JJ7A 3PIOF 1IJWC 1IGNA 4V2FA 2HYJA 2PEXA 2VOOA 2COBA 2M9HA 3GZ6A 3Q9SA 3F8CA 5F0HA 4O3MA 5DUIA 1MBHA 2LKPA 1R6RA 4XRFA 3DF8A 3FBIB 5K5QA 2BXZA 3D0SA 2Y75A 4FISA 2E5ZA 2EV0A 1B9NA 1UB9A 1JHFA 1POGA 2JUCA 2YR2A 4N4OB 4E7HA 2X6YA 5HODA 2WAFA 4LIVA 3W6KB 2LTPA 2HZDA 5D8LB 4EV0A 1LUJB 1Z91A 3IHUA 3HGYA 5GTHC 4PK4A 2VQHA 3ZN1A 2EV6A 1PP8F 4EJVA 4BUPA 1H9GA 3E5XA 2VBWA 3CLQA 4D5CA 4UB6C 1SAXA 1GVJA 5HDGA 2NOGA 2YS9A 3CJTB 1ZG3A 3GCMA 1W5SA 4ZZDA 2PN6A 3I55I 3BG7A 3PUBA 1VQ6I 2XDVA 4MTEA 5IT9Z 4NDLA 5L3DA 1B6AA 1ENHA 2KIFA 3HC7A 1IUYA 1JUMA 5FKOA 4C3HJ 3CC7I 4BL0B 5IT3A 2RC4A 1KQ8A 4W1UA 3QWLA 5KK1A 2FEZA 3G73A 3G71I 2P4WA 1S72I 1MBEA 2NS7A 4F93B 1YIOA 2QKLB 4MQVA 1K4TA 4LLLA 2A6EF 3OYCA 1A6IA 4DQ2A 4ETSA 1YLFA 3FZVA 2QLZA 2HVRA 1OR7C 3TEDA 2OA4A 2L5QA 3WTZA 3E0JB 3P5JA 4Y15A 1AKHB 1JJ6C 3DEUA 5B3SH 2FQ3A 1GXPA 3E6DA 1ZG1A 3CJRB 4JX4A 2Y9ZA 2Q0OA 1R5ID 3D5LA 1ITYA 3KLNA 2A68F 4BH9A 4IOCF 4RGXA 1IDZA 1ZR4A 2QCOA 1TNSA 1HQCA 1I3QJ 2KP6A 3CCEI 1TBXA 3BTIA 3HXLA 2ECBA 1WGXA 3AFHA 3E5QA 3K4CA 1NK2P 2EFOA 1HSTA 1EKEA 2DJIA 2JRTA 3SQNA 2CH0A 2BY0A 4RB3C 4FTHA 3B6AA 3QP5A 5JVGF 1LDDA 2FRHA 3ZR8X 1OYYA 1P6RA 1QZZA 2XGCA 1XMXA 3GTLJ 4KNYA 1N78A 2CS3A 5CJ9A 2J5PA 3PM1A 4R1HA 1H0MA 1ZR2A 1ETWA 4RB2C 4IHSA 2IS6A 3I71A 2CYYA 2X1DA 3RPUD 3C3WA 3R0JA 2XB0X 4GYIA 2VPLA 3WHBA 5JHFA 1JJ8C 5BNGA 2OF7A 1WJBA 4M9XA 5LD2C 3ZMZA 2MD5A 4UVBA 1ZAOA 1D0ZA 3S32A 5E18F 1Y39A 1VQ5I 2K9SA 1IXCA 1X1DA 3ASNH 5IYBJ 3BG6A 3RDIA 3ZQQA 1V5FA 1D1AA 5HDKA 3CCVI 4EJOA 4B48A 5E8IA 1TW2A 1B9MA 2DA6A 2Z5UA 3BTLA 2Q8KA 1Z21A 3W2WA 2GQQA 4II2A 2HYFA 3BT9A 2M30A 3UNGC 2HOAA 2LF7A 4UB8C 2JA5J 2M87A 1CF7B 4L18B 2V6EA 2EFQA 1WI9A 2PJRB 3OIOA 3NQOA 4XICA 2V9VA 1TQMA 4Y4RA 3ZGKA 2CRGA 1V3FA 1J0RA 4BACA 3JRHA 2PMZN 1TT5B 4DIQA 3ML6A 4B1RA 2UXXA 5HS8A 1IRFA 1LDKB 1SAUA 1WZ2A 2XIGA 2VXZA 4IVNA 2HWVA 5ERIA 5E3MA 5FROA 2XAUA 1SEUA 1D5YA 3CUQA 2B7EA 3EYYA 4LLGF 1R22A 2L7MP 4LMYA 3CCSI 2EIMH 3KP4A 1P4AA 2X85A 1O7LA 3IL2A 2M8EA 3S17J 1I27A 4PUSA 4F91B 2DMQA 5CLSA 3IH2A 2QA4I 4A3KJ 3HBLA 1FZPB 2ZSHB 1T39A 5HLHA 1OYIA 1RETA 3DKXA 2IBDA 3QYFA 1DPRA 4BJ6C 2KL4A 2VQLA 2XVCA 2VUMJ 2HGCA 2Y31A 1N77A 3DV8A 2Q2EB 3MQ0A 4QLCU 3CDIA 2NYXA 2R7FA 1KU9A 2KKOA 2HXOA 2Y48A 1TWHJ 4WXDA 1SFXA 2KJCA 4CCMA 5HNHA 2E35A 4M3DA 3JAMZ 2R7UA 5DS9A 4OWRB 1KQ9A 1ODDA 3MKZA 4KA4A 2FU4A 1D1BA 4BJ5C 2G9WA 4MEXF 1VQMI 1QVUA 1FX7A 2MFZA 4A3GJ 2EK5A 1VQLI 3ECOA 4U87A 3S3OA 2BYVE 3DEWA 1LDJA 4B47A 1G8XA 2CFXA 1WJCA 3HOZJ 3IRRA 1XX5A 4IKFA 1NH3A 1JXSA 2K27A 3H9QA 3P9IA 4PJMA 3OS2A 3O8HA 1QNTA 4JX5A 1BOAA 1X4OA 3HM5A 4BE2A 1YHQI 5JVTA 2OAZA 1FYKA 1UAAA 2LG4A 4I0AA 2Y69H 2DMNA 2WAQA 5EZGA 1W7PA 2XC7A 3VSKA 3IKVA 3G4SI 3TQNA 1ETQA 5DV5A 3TGNA 2KRCA 3VPRA 4XONA 2GXBA 1VNDA 3B02A 3BWGA 2PG4A 4NUBA 4RLFA 5M3FJ 5HOOA 4I01A 4UNOA 2NVTJ 3IH3A 4XLEA 3MCZA 2B63J 1WJAA 3HRTA 2VN2A 2L9RA 3BY6A 4I2OA 1HKSA 3JRFA 4JX6A 4NBQA 1K61A 1U6GA 2QF7A 1LJ9A 5HS9A 4EJTA 2KQRA 3LQRA 2ELJA 5E79C 2PMHA 1Y0NA 1F1ZA 1XDSA 2F2EA 3K6GA 3CMEI 4KFCA 1I1SA 2BY2A 3RZOJ 1BR4A 2FBKA 3O6BB 5LEJA 3Q0WA 3MAJA 1E3PA 2Y2ZA 4AIHA 1WHUA 2FUG2 1IC8A 1MJBA 2BV6A 4O6JA 2NXNB 2W7NA 3GZ5A 2HU9A 5CVUA 3CZ6A 3ABKH 2BHZA 4IQ4A 2OUMA 2P5LC 3REOA 1PUEE 3RKYA 1STZA 2V1DA 2CGPA 3BCAA 2EILH 4IL6C 3RTRA 2W48A 2QQBA 5B66C 2KIUA 2EQRA 5TISC 1U5TC 1YE9A 1FOXA 1S8NA 1U5TB 1OLTA 2A5YB 3B6CA 3LFKA 1RNLA 1JKPC 3MZYA 2Y30A 1K6YA 2JN6A 3M4OJ 2XB5A 3VB2A 2Y9YA 3ZP5A 4C2MJ 3LSPA 2VKEA 4YELA 1UMQA 5LGNA 1SMYF 4JK1X 3L2CA 5DYMA 4A69C 4EEFG 4LG3A 4HPQA 1QPIA 2NAZA 1RESA 3QPSA 2TDXA 1HKQA 2D1HA 3RKXA 3LMMA 4XK4A 4DJAA 4D7NA 5H2FC 1UZCA 2MLGA 1O3QA 3CESA 1HW2A 2E2IJ 4CUGA 3KYCB 3DKYA 3ZQIA 2CUEA 1U0JA 2ISYA 2W24A 4L5JA 1E0EA 3S2DJ 4IHWA 1Y56A 3BZ6A 4G6DA 5FGMA 3W6VA 3R0AA 4B3AA 1FIPA 2XAQA 5F04A 1SD6A 4MEYF 4EM1A 1LVAA 4FX4A 4A3JJ 4L0ZB 2PI0A 2NS0A 3JTHA 2FJ1A 1BJAA 3ONQA 3TOAA 2YPRA 4HW0A 5BOXA 1X3WB 5AIQA 1WH5A 1F43A 4GYGA 2JTVA 3GYHX 1VI0A 3FM3A 2QBYB 4OIRF 5CQEA 1PJRA 1D3YA 1HSJA 1YQAA 2EA2A 5D8KB 3NWTA 3HSFA 2JWTA 1ZRFA 2E1OA 3C1DA 4G7OF 2STTA 4YIRX 3H92A 3C7JA 4BKXA 3WTWC 2AO9A 3GTQJ 3GF2A 4BE1A 5IP9J 3C18A 2K3PA 5K7ZA 1HW5A 3IUOA 2WB1N 4JQFA 3PNVA 1S7AA 3VODA 1TL8A 4MTDA 1ZARA 3K4NA 4M9SA 1R49A 4KT6A 2WC2A 3ZMTA 2PQ8A 1OR7A 3BR0A 2ZMEB 1F5TA 2H27A 1AKHA 4I98B 2XKPA 2L0KA 4XKCA 5KCMA 5FO5A 1BIBA 1Y0UA 4BXXJ 4RDUA 3H9GA 1LNWA 1U78A 5FJ8J 3QAHA 1KU3A 2E19A 3FK6A 4IHTA 1QZYA 3S3NA 1ETYA 3ESWB 3VDXA 2H09A 5LGTA 2DJNA 1BR2A 2V1UA 1LEAA 5FFZA 2IEKA 2OPTA 3WGHA 2K7LA 2CW7A 4ZYEA 3DEEA 4AVZA 5DUKA 3L00A 1R5HA 1LE8B 1MMNA 4KN4X 3CO7C 1ON1A 4GFBA 2DQLA 2K4JA 2R7SA 3MD2A 1WH7A 1DP3A 4GDFA 1F36A 4JP0A 3HOUJ 4OAYA 1ETXA 3CF5F 3FISA 1AHDP 2DMPA 4NC8A 1YS7A 2PMZA 3T5XA 1QA6A 5E20A 2YU3A 3LSRA 2L3DA 3FXMA 2EZLA 1Z3YA 3MN2A 3JAMK 2ICWG 5J1UA 4AM3A 2E60A 2LY1A 2XUBA 1MJ9A 3RJPA 2RNJA 3V4GA 4CCNA 5B5EC 4BQAA 5HVQC 1SFUA 4IRIA 3I64A 4L5IA 1R4MB 3LSKA 3CCQI 1K83J 4AIJA 1G59A 1BN5A 2MH9A 1JT6A 2ZFWA 2L4MA 4GO1A 2HI3A 3G3ZA 4HRIA 3OL4A 1PUFB 2F5CA 1IN7A 3H5RA 1SFEA 4KN7X 3RSNA 4XLCA 3A0BC 1MH3A 4BEHA 4UHTA 2KHMA 2DA3A 1ZH5A 4G94A 3A01A 3DCFA 1OYWA 4E7SA 1OISA 2GOXB 5EJCA 1GXQA 3CJQB 1BIAA 3TBIA 4A0YA 1CF7A 2E1MC 2DA1A 2XGDA 1ZRCA 2F5FA 1PDNC 3L2WA 2E1NA 3ZN0A 4UVCA 1X3ZB 2NNYA 3F8BA 1O4XA 2E7XA 1IG7A 1ERDA 3BDDA 4O5VA 4MNUA 1G4DA 3SXYA 3GFIA 4PJ0C 1P4WA 3AG3H 1T98A 3AG1H 3P9KA 1DPUA 3WODF 3S16J 2V79A 3QOPA 3JR9A 2L9NA 5CKTA 3OMYA 3SEZA 4IOAF 2HDCA 3HOXJ 2VB6A 1G3YA 1UFMA 1YO5C 4EM0B 4P55A 1IF1A 3M3YJ 1FWZA 3GMEA 2JA7J 3KE2A 4OIQF 3TP3A 3BZKA 2KJBA 5ICCA 3HOVJ 3NRVA 3T1BA 1FBUA 3OYDA 5ILUA 2F5EA 2BVMA 2LBFB 1X1PA 4B4CA 3HL2A 2LLKA 2P8TA 2RNGA 2GXGA 2Q2EA 1IRZA 1KA8A 5E1ZB 3DPTA 1SFKA 2CSOA 1HDDC 2NNNA 2VXDA 1IW7F 2HKXA 2IGKA 1B1BA 1G3TA 3GFLA 3QOEA 3RQ4A 1XSDA 3FX3A 3R60A 4PSXA 1TQPA 3GFJA 5GAHJ 1LPQA 3BR5A 2M1BA 2DPDA 2WTEA 2ZKZA 1WJ5A 4OOIA 3QQAA 1ONVA 3E7LA 2HQ5A 2HVQA 4RBOA 1UCRA 1RKTA 5JI6A 1BJZA 3FXKA 1IXRC 2F6CA 4C3IJ 3GTKJ 4A3DJ 4HYEA 4OINF 3ZQHA 4Q4ZF 1A5JA 5JLXA 5KHDA 4ESBA 3PFYA 2MA3A 4RM2A 1Q1VA 2HR3A 1FEXA 4M74A 2W84A 3M9AA 4U0YA 1VQ4I 1YW9A 2O61A 2E2JJ 4HV5A 3D1NI 2VT3A 1QHHD 1FIAA 1XGSA 1E3OC 4KIBA 2CUJA 1YW8A 4ANJA 3DU6A 4PJJA 2LSOA 3WE3A 2DTRA 5GPAA 4DW6A 1N75A 2ZXHA 3VSLA 4ITVA 2PBIA 5K5OA 3F0CA 1YYVA 4BY7J 2XAJA 4XRMA 5J8CA 1YTYA 1FP1D 2BBYA 4IO9F 3EYIA 2DFEA 3OYKA 2Q1ZB 3GBGA 4BDZA 3P9CA 5IY5H 5J8FA 3OYNA 3LSMA 3GX4X 2LFBA 4L5EA 3DU5A 4IHVA 2DT5A 1A6QA 1EH6A 3TO9A 5D4SA 3OYGA 2IAIA 3J7YJ 4LG0B 1F9NA 3K0LA 1X19A 3KPHA 1G3WA 2K40A 2K02A 1MMAA 4CHUA 2X1CA 2V1XA 1YJNI 5CVIA 2QUFA 2H1KA 1GVDA 4P9UA 3HB9A 2D45A 1F4KA 4BXFA 1BI3A 2MYSA 2LR8A 5ILVA 2OZ6A 3LQQA 4XLFA 4UUSB 3L2UA 1KONA 4AIKA 3ABTA 3HSEA 5AIPA 1U5TA 1HOMA 2XHKA 4E7KA 1T56A 3FXOA 3EUHA 3IRQA 4XL9A 4HX8A 2VASA 3I59B 4KMFA 5GAGJ 3MZHA 2EPFA 4RM3A 2CW8A 2K4BA 1BL0A 1SVLA 3OIPA 3AKZA 1A31A 1I39A 3NWSA 2IA2A 3E1SA 2WB1A 2V9PA 2FOKA 1OCPA 2ZJPF 3WTSC 2DK5A 3BROA 2R5ZB 2EJRA 2CU7A 3RZDJ 2ZJRF 2F5DA 2VE8A 1IXSB 5FKLA 3HKZN 2NVXJ 1PP7U 5A2QK 4EJUA 2L9VA 4FCYA 1LQ1A 5EGOB 1J5YA 4KMUX 4PCQA 3RQIA 1D1CA 1B4AA 1Z77A 1O57A 1OPCA 2BE5F 2KPMA 3FKJA 3JRGA 2JVHA 4U7BA 2P5KA 3N97A 3K2AA 1T2KA 3W6JB 4FHTA 4IHXA 2JA2A 1R4NB 1SVMA 4M6VA 3FXLA 2M45A 4XSXF 5H6QA 2R7OA 4RAGA 4EATA 5J6XA 2WV0A 4A93J 3K1NA 4MGRA 2ZXWH 3RKWA 1J09A 5E3OA 2IW5A 1TP4A 3H5NA 3KIOA 4XN0A 2JVGA 1WSUA 1HF0A 2HDWA 2O5RA 2JPBA 1MZBA 4KIGA 1SFOJ 3WTVC 1Z6TA 3O3KA 3OYBA 3QPTA 2LRDA 2ZB9A 3HIFA 1QBJA 1IN5A 4E7LA 3BQYA 3K1MA 4M6YA 1A04A 1XSXA 1R7JA 4HSRA 3VOEA 2JMWA 2VIXA 3X2QH 2ACJA 2ZMEA 1MBGA 3KP3A 2MBFA 2ZBKA 1R5GA 3IP4B 4MFDA 2PX9A 4UUTA 2M8GX 4WK8F 1AU7A 1ULYA 3FK7A 3HUGB 4N0BA 1B8IA 2R7ZJ 2VQCA 1U8RA 1HLVA 3H5AA 2ETHA 3HOTA 4XLPF 3CDLA 1XG1A 4Y13A 3KZZA 3FXUA 3J7AO 3E6BA 5ICEA 1TC3C 4MLOA 2LF8A 1D0XA 3I54A 1CQTA 3ERED 2VONA 2EINH 2VI6A 4XNFA 2FBHA 3FIWA 1LE8A 3SHFA 2V9KA 5E3NA 1YS6A 3S1RJ 4DZPA 2ZCWA 1GLNA 2EH3A 2KRFA 5GP9A 3V7RA 4YRVA 2IT0A 3DP7A 2CMPA 3SDBA 4A12A 4DYCA 3GTGJ 2LYCA 4KUMA 2AXLA 5D6EA 3BCBA 1ZGJA 2FF4A 1P7JA 4HF1A 5F64A 2JRMA 2IPQX 3ROUA 3K1PA 2BY1A 2IA0A 3BJOA 1TQIA 4XLAA 4M3BA 3COAC 1XGOA 4ZDLA 2BVLA 3FHZA 3DLAA 4YIFA 4DBRA 3WHCA 4PJLA 1RRJA 4RS8A 2PMUA 1ON2A 2DMTA 3CCUI 4XQFA 2CW0F 2ECCA 4B44A 1FBSA 2Y0SN 3MWMA 2HPIA 4A3FJ 1PUFA 3K70C 2L9SA 5M3MJ 3K70D 3EQLF 3WE2A 3PQJA 1ZLJA 1IV6A 1MSEC 1LKXA 2Z2SB 4I99C 3CC4I 2B0LA 5J3LA 1HW1A 2R5YB 1ZGWA 1O3SA 2W00A 1IO2A 3OWTA 4E6KG 2K9NA 1W0TA 3G2BA 1Y1WJ 3HZJA 1EJ9A 2KT0A 2E7WA 4RMNA 1JKQC 2P7CB 3V42A 3BG5A 4WXHA 2VBYA 3B73A 2HKOA 1S6LA 3ZQGA 1DU6A 1FOWA 3FXRA 1FY7A 2Z3YA 4OMYA 4RAFA 4ZYHA 3J7ZI 4CCJA 2X6OA 4Y33A 3I5UA 2PFBA 1GV2A 4AYBN 2CV2A 2DT6A 4AIDA 1S5LC 3GZNB 2LD5A 2H8RA 1T95A 3PUFA 2FOWA 1RR7A 2FSWA 2IVMA 3CCLI 1MMGA 4IHYA 2KDZA 1ZGAA 2R7TA 5CVJA 2JZYA 3BJ6A 2FD5A 2HQNA 2H6CA 4ZDOA 2K85A 3J7AY 3CCJI 3OSGA 1QRYA 1Z7LA 2QSFX 4FASD 2FNAA 3JRBA 3OYAA 2FMYA 2LBFA 4LD5A 2OJED 3HSRA 1R58A 3SEQA 1BC8C 2EWNA 3L2VA 2KRHA 3E6MA 1J2XA 2QKMB 1O3TA 1JGSA 4HNVA 5HLGA 4IRHA 1FYMA 3OYEA 2L54A 3F21A 4F92B 1UHSA 2O9LA 2DDBA 4BU2A 4D7MA 2R4GA 2DU9A 3WTTC 1FBQA 1P4XA 4P5OA 3PO2J 3PQKA 2UV1A 3HOYJ 2HTJA 4X0GA 2QSHX 4E7ZA 1BI0A 5FLXK 1JT0A 3U2RA 2M4KA 3ZPLA 1ZHFA 3HPGA 4S0HB 2M5WA 4YEJA 2XAGA 4UVAA 1FMWA 3R6SA 1SC7A 2YX7A 4RB0A 1LFBA 4M3FA 4MIMA 1XC5A 5CVRA 1WJEA 2IJLA 2EV5A 5KAFC 3K69A 4WXCA 1O7FA 3CCMI 2OD5A 2OC6A 4PZJA 5LRRA 3JREA 2KLOA 2A3SA 2CQXA 3SFZA 3TO6A 3LSTA 2I5UA 3OR1C 4C9YA 1JGGA 3I0TA 1HC8A 1TT0A 2L01A 4G8XA 3I56I 3AL0C 4XRSA 5EYRA 3AL0B 4E4HA 1D5VA 3L2RA 1ZELA 3S93A 4KIFA 4CCOA 1JHHA 1ZRDA 4V19K 1RKWA 1OMIA 3VYSB 4HF2A 1X1AA 3CJNA 2Z1DA 5DM7F 1T8IA 1K78A 1MGTA 3LA2A 3OS1A 2XKOA 2VT2A 3VWBA 3CCRI 1O3RA 2VKDA 1R36A 4L9TA 1HDPA 2X9DA 3FF5A 1QHGA 5AONA 2XPWA 1QU3A 2R7DA 2RV8A 3C2HA 1OKRA 3GWZA 2EA4A 2X0LA 2CQNA 3LOCA 5M5YJ 1VQ8I 1UG0A 2D2WA 2R7RA 1QO0D 3BPVA 3S2HJ 5BMZA 2P0WA 1Z1DA 3VYTB 3E97A 5HLTA 3RI4A 3HKZA 3ZQFA 3FDYA 2K9QA 3IAM2 5FKMA 4LG0A 2RQQA 2A6TA 1V54H 5KAIC 2A6HF 4XR6A 2R7WA 1K6OA 1Y6IA 3HRUA 3QP6A 2P81A 3TDZC 4UXNA 1S7EA 3OYJA 4M72A 2AHQA 2IGMA 1TTYA 2AS5F 6PAXA 4E70A 4OU0A 4WF2A 4XLHA 3IV5A 3FMSA 1G2HA 4UUSA 2JUGA 2QQAA 3KP7A 1TW3A 1UG2A 3DPLC 3F22A 5LBQA 2JSPA 4CZZA 5JLWA 5JFRA 2XF5A 5D5WB 3DKWA 3I59A 3OYMA 1XTAA 3KEQA 1WI3A 4XM3A 5DM6F 1OCTC 1Y8RB 3DTEA 5M5XJ 2DCEA 2VC0A 2W57A 2NVYJ 2P6TA 1P2FA 2JA6J 2R93J 2LY9A 3DQVC 2R5ZA 3KZIC 2ELKA 3BR2A 1T33A 5CYVA 3W2AA 4W97A 5J47A 4QIWN 5F6FA 5EGOA 2O6GE 2YU9J 4JBAA 4CGZA 3CLOA 2WY8Q 4HAMA 3V7SA 4KICA 2O03A 1R1VA 4J00A 1YJ9I 2HEOA 2HQRA 1JTXA 1WKMA 5BPIA 1FJLA 3HTSB 4ZJZA 1MNEA 2DA7A 2GAUA 5LHIA 5KVRA 3OOPA 4CA0A 1WVRA 2EFPA 2F4OB 3M1CA 2LKSA 2HOTA 5BQTA 3ZMUA 5L3EA 3Q0VA 2MC3A 3EUAA 2H94A 1MNDA 3FMQA 2ZJ2A 2VJJA 2BOLA 2ME6A 1MDMB 2DI3A 4A0XA 5D5VB 1SD4A 2M7BA 4QPQA 4IJAA 4HLXA 4RLQA 4DOZA 3OY9A 5E1XA 1FSHA 1NG6A 5FKNA 4CCLA 1TNTA 2QVOA 3PFIA 3JRIA 3KZYA 2BY3A 3IKTA 2DYRH 2V6CA 4BBRJ 1HKTA 5EDNA 1T0FC 5LFAA 2QZ8A 1MBJA 4IEJA 1MIJA 5F27A 3GLXA 2BHYA 2MW8A 3BC8A 5A2QZ 1WQ2A 4GGGA 2X6XA 1TWCJ 4PFOA 1X2NA 2KIQA 2RKHA 2Y0SA 4EQQA 1I3AA 5DCFA 5GPCA 3CD6I 3QRFF 3RPUA 3FWEA 2XAHA 5GAEJ 5ICFA 1RPWA 1APLC 3S1MJ 3MKWB 1X4PA 2EZKA 2VJ4A 4NC7A 2TCTA 4ESJA 2HOEA 2OQGA 3SDGA 3T8TA 2WY7Q 5D5UB 1KGSA 3ZQ7A 2NOJB 5J40A 4BXUA 2EFWA 1OFCX 5L3BA 3L2QA 1XB4A 3O8GA 4XKWA 3EUKL 4ZDPA 3OYLA 3OOUA 1BA5A 1OQYA 4S04A 2IP2A 2K86A 4ENMA 1VQ9I 1EH7A 3JRCA 4HDVA 1YI2I 1EH8A 2W82A 1QGPA 2IGNA 4RGRA 2IGOA 3FMRA 4D9JA 3ECHA 3J80Z 3ASOH 5F0CA 2ZXJA 1I50J 1FTZA 2PJRA 1X3UA 2E1MB 3QODA 3QPLA 4AYBA 4HA8A 4HNUA 2CUFA 5F0FA 3FKIJ 3CQZJ 2W4SA 2NRAC 5IP6A 4M73A 4EMSA 3OS0A 5DEQA 2FBIA 2GIZA 3CUQC 3I3LA 4C2TA 5FFXA 2DBBA 2GA2A 3BTCA 3CUQB 4N9IA 3H36A 4QWQA 1H89C 3IC7A 3V8KA 2G0EA 5F1RA 1N25A 1FC3A 3PSIA 4DBQA 3Q3SA 1W0UA 1L0OC 1KQ0A 2GZWA 3FM5A 1HBXG 2R5YA 1XS9A 3HTUA 3CDHA 4FE4A 3ZOBA 4A3EJ 2WWYA 2VPRA 3PSFA 3LSHA 5FB2A 4CXFA 1LFUP 3KLOA 3RCOA 1MKMA 1GV5A 2GIVA 3PO3J 1RUOA 3HHHA 2O7OA 3NAUA 1YG2A 3HRMA 4S05A 3UKGA 2R92J 1R71A 2V1NA 4GRIA 4M9ZA 2CV0A 4PGGA 3HYIA 1L3LA 2DFIA 1Q1HA 4R79A 2LNBA 3RPQA 2FMLA 4BQOA 1GT0C 9ANTA 3DXJF 3ZRGA 5DCMB 3H3UA 3H0GJ 2FQ4A 4XN3A 5FLMJ 1XD7A 3RYRA 2LK2A 3T0YA 2D1VA 3DBHB 4FE7A 4I6ZA 3S1NJ 5EEAA 4C30A 3BR3A 4C2UA 3AG4H 5BPDA 4IRGA 3U21A 3KEOA 4HX7A 1VQPI 3FHNA 3TO7A 2JA8J 3TL4X 3S15J 1R1UA 4WCGA 5DTDA 4CDGA 1B59A 4XRSG 3GO5A 4ABZA 2L7ZA 3K4LA 3ISPA 1J7KA 4KJZA 2VBZA 2MG4A 1VQ7I 4AD9A 3M1EA 2E71A 3K9TA 3I4MJ 4CSWA 2ZSIB 2L02A 2LC2A 1W7PD 2OBPA 1W7PB 4CYDA 2I10A 4U7DA 1T6SA 1USTA 1R1TA 1YW7A 2K9MA 3M8FA 2VJ5A 4XMYA 5EG0B 2DA4A 4IPAA 4A5MA 3WG9A 1HA8A 5J4YA 1RZ4A 1MJAA 3WTUC 2RDPA 1SVOA 2JT1A 4HEA2 1MBFA 2ID6A 3BJAA 1ZN2A 3LSIA 1BOBA 4CYCB 2XGEA 4ESFA 4G12A 3A1YA 4B3XA 4DGWB 3BZCA 3CCYA 3H35A 3HEFA 1A35A 1ZTRA 4N9HA 3CMAI 1WWXA 3OR2C 2DOFA 2FXAA 3GW2A 4A6DA 1DDNA 1BI2A 1RI7A 3KYDB 4AUXA 4KDPA 2LMDA 2Z99A 4ZYDA 2Z9OA 1XGNA 1QVTA 2K5CA 4IQJA 1LFPA 4LB5A 4L9VA 2CWEA 3WU1B 1S7OA 3TKYA 1XCBA 1WRJA 4I09A 3SZTA 1EA3A 1V5GA 2BW3B 1KZHA 4NQWB 1IN4A 3M8JA 1B72B 3C2GA 2QM3A 2LDUA 4XKBA 2F4MB 1USSA 4V2GA 2IS2A 4OMZA 3DPUA 1E2XA 4MFEA 2M0CA 3LAJA 2Z33A 2EIKH 4E7IA 4IXAA 4BBSJ 3LFUA 3TDUC 2R7VA 2QGUA 3WU0A 1MMSA 1Y8QB 5FLXZ 3M8EA 3WG7H 2QSGX 4HG2A 1H88C 3ULQB 2HTSA 4U0VA 3GLLA 4A6EA 4BS9A 3BG9A 3KEYA 2ZO4A 5FRMA 1QPMA 4II3A 3IAS2 3OYHA 4D0PA 1Z3XA 3EPZA 4BYYA 1YJWI 4ZZLA 3S1QJ 5IYDJ 5DDGA 3H9JA 1I5ZA 1NHAA 1FLIA 1G6NA 2COMA 1V55H 4NC6A 4A3BJ 3CO6C 3G1MA 3DWLE 3WGIA 3I4NJ 1U9NA 4LGWA 5IP7J 1JI8A 2ID3A 1IUFA 1Z6RA 4Y3OA 1W1WE 2UZKA 1NG7A 1J9IA 4HDUA 4CO8A 2MGQA 3DLLF 1FOYA 2DQRA 4L9NA 2X48A 3F6VA 2ADUA 5B1AH 2OCEA 4JOMA 2BZTA 2I8DA 1OCCH 4CICA 2A5WA 4FQGA 4XSZF 1OCRH 4F3QA 2VLAA 3HRSA 2FNPA 5HNFA 1SANA 1XDUA 5D5XB 2MH2A 3KFWX 2O3FA 1K4SA 2MABA 5KNLA 2QBYA 5ICGA 1I1GA 1JUSA 2Z16A 2AQEA 3K4KA 1P7IA 1JE8A 2DAOA 3QU6A 4D5FA 3MMYB 2WV1A 5JR3A 3N05A 3J81Z 2CUZA 1FT9A 2CG4A 2TRTA 3I4PA 3J80K 2HQAA 3A4CA 5F08A 4E7JA 4BGDA 1XCVA 2LREA 2RN7A 2DA2A 5CVVA 3JRAA 1WCMJ 3RKQA 3P7NA 2DW4A 3ZMDA 2CQQA 2GOMA 4P96A 4I7HA 2X6WA 3F23A 2HVSA 1Z7UA 2J5OA 5LGUA 3PIPF 4LOCA 1V5EA 1TWGJ 2M0MA 3S8PA 4U0WA 1R00A 4UV9A 3CTAA 2QQ8A 3BTJA 5IYCJ 3V7CA 1ZYRF 5HLIA 2M34A 2EZHA 5GTIC 1ZG5A 1VQNI 2DO7A 4TV7A 3C2BA 1VFCA 3F8MA 1MDMA 2KISA 2A07F 3BPXA 1W5CC 2XPVA 4DYRA 1K7AA 1J59A 1C0WA 4U88A 2E5NA 2XRLA 1BI1A 2QQ9A 5C44J 3HHGA 3S14J 1DUXC 3NEUA 1S9HA 1YIJI 4XLNF 1MD0A 3CMMA 4HQEA 3TW7A 4NB5A 3GEZA 1S3JA 3ABLH 4YFKF 1U3EM 1T0FA 4NNJA 2H8WA 4B09A 1PVEA 3KETA 2XAFA 1VTNC 1QQIA 3U1DA 5J1YA 2RVCA 3H1CA 1GUUA 1T08B 2BEOA 1AWCA 3CUOA 3DBLB 3LL7A 1FPQA 4HF0A 3N4MA 1DU0A 4OIPF 1J75A 1X2MA 1XMKA 2OU2A 5J4VA 1LVKA 4RAYA 2GLOA 2CV1A 4M71A 2P6SA 1IV8A 1TWFJ 5DD4A 2MSYA 2EFNA 4MQ9F 2HS5A 4UV8A 4BEHB 1WJFA 3FXQA 3A01B 1X58A 4G6QA 2VQGA 2GBYA 3HPHA 2DPUA 3MEXA 3QPHA 1SMTA 3S3MA 4GXOA 4DYQA 2XF6A 3F9KA 3QU3A 1MH4A 4BAYA 1IN8A 3LAPA 1XPXA 3DFGA 1K79A 2ISZA 2DOAA 4BJTA 3HDDA 3BG3A 4HX4A 2ESNA 1U8BA 2A05A 1ZREA 4WX9A 2DTZA 5LHHA 4EJWA 2A69F 4LFUA 3EETA 4X6AJ 1IAWA 1IRGA 3A02A 4ZYGA 2JK3A 4EVIA 2UXNA 1OCOH 3TOBA 4XIDA 1VF9A 1SD5A 1JKRC 2DK8A 1MW7A 1MNMC 4LITA 1GDTA 4OIOF 3R4KA 4KITB 2IRFG 2EIJH 5M5WJ 3L09A 3SFIA 1ZQ3P 3UR3C 4ZTFA 3K4MA 3I53A 4HV6A 3WTXC 2RQPA 1MBKA 2CQKA 4X1EA 1V4RA 3HOSA 3OV8A 3PJRA 4ENKA 3H0DA 4QPOA 2N8GA 4BQQA 1WFXA 4CZCA 2FA5A 2CJJA 3K4BA 5L3GA 4HQMA 1X1BA 1MSFC 5DCMA 1YRNB 2HFHA 5JHUA 4WWCA 4YFXF 3NARA 4IF4A 1XMAA 3E3VA 2DODA 2P5VA 2Y0MA 3WTYC 3VYRB 1OJLA 2WA0A 3ABUA 2OTJI 2F48A 5ED4A 3F6OA 4YFNF 2L7KA 4I02A 1ORKA 2P7VB 5LEKA 2KZGA 2O0YA 5EF6A 2VBXA 2L4AA 1T38A 1UELB 1W5TA 5L3CA 3ELKA 3I58A 1FP2A 4LB6B 2OQRA 4BHBA 3JCUC 5DD8A 3WGGA 2IA1A 3L9FA 4HNTA 2QWWA 2NS8A 3KX2A 4P1WA 3SZGA 5EG0A 4ENJA 2WBMA 1FOKA 3BQZA 1P9QC 2B9SA 1LB2A 2HPMA 1JUPA 3CF2A 3L7WA 5E17F 2R7QA 5EEGA 2O8KA 2JSCA 4Q48A 1WJDA 5IT9K 4LJZF 2FX0A 4CYCA 2DN0A 3KP6A 4IZZA 2QEXI 1BR1A 2YUSA 1DGRM 4HZFA 3ZQLA 4AVPA 1OCZH 1RR8C 5D6FA 3H3VK 3OSFA 4PJNA 4QSHA 2H1LA 4XBFA 1JKOC 3TP0A 1RIOH 4J01A 1BW6A 1DGWY 3OL3A 4I76A 3S2WA 4UY8I 3SJMA 1D8JA 2PLYA 2MD0A 3M07A 2MC4A 3JSPA 3T8RA 5K7FA 3J81K 5H6RA 4KISA 2KMUA 3GUDA 3AAFA 3Q9VA 1U9OA 1H8AC 3GTPJ 2HDDA 2AXTC 4RGUA 3ZCOA 5D4RA 2WADA 1R23A 3VFZA 4BY1J 2JPCA 5F1JA 1HCRA 1U2WA 3HOWJ 1I6HJ 2IS1A 3E6CC 2XV4S 4EM2A 4LLNA 2ME0A 5IPAA 5C3EJ 4D1QA 5HDNA 2BW3A 4Z2YA 4NQWA 3F8NA 1B72A 2O8XA 4LK0F 3ZMSA 4YG2F 2XSDC 1D8KA 2K9LA 4ZYAA 5FLVA 3EUHC 3LSGA 5K7HA 1FTTA 3PNTA 4BHCA 4M3EA 2CO5A 1XN7A 4NHJA 2LH9A 1Z67A 2VC1A 3CP8A 4MO7A 3OYIA 4H0EA 5E8GA 1ZLKA 1I6XA 1Z0XA 1RC9A 2V26A 4L9JA 3A03A 4Y17A 1NTCA 3MZ8A 4MHGA 2R0QC 2DA5A 2D5VA 4KYWA 2ZC2A 3ABMH 1BM9A 3W3CA 1VZ0A 4BHPA 3ZMVA 1FYLA 5C4XJ 4LIUA 1REPC 3BR1A 1KYWA 1ZK8A 3DTIA 4GCVA 2LVSA 2H6BA 1HXDA 1E17A 3VEPA 3R61A 4XOTA 4DNCA 4CH7A 3MKYB 1TWAJ 2F4IA 1M1EB 4IX7A 1CGPA 2DT7B 2XRNA 4J19A 5B1BH 4PGHA 2OCCH 4JYKA 1G3SA 1FSEA 2QENA 3A2KA 1E3HA 2NVQJ 2DFHA 2VODA 2DYSH 4HOBA 1YOVB 3G1OA 5TRDA 4H4KC 1H9TA 2KZVA 3QYBA 4XORA 4A3MJ 4LK1F 2LY2A 4RB1A 3F8FA 4PDKA 4A5NA 4B43A 4HLYA 2MLKA 4EGZA 3BOQA 3HG9A 4FETA 2GA1A 4YIIA 5FD5A 4AC0A 4Y7NJ 4BQNA 3MFKA 2LKXA 1W36C 4N4NB 3FBNB 3U1KA 1W36D 2DFFA 4M6XA 3IH4A 2ZMEC 3DBRB 5HS7A 4BNCA 4ZTJA 4Y52J 2VE9A 2OZUA 4Z6YA 5IOYA 3DTKA 4XOPA 1PYVA 1A36A 4L0YB 2BGCA 5TJJA 3OYFA 1RUNA 2OTLI 2IS4A 3GFMA 4F7ZA 2OV7A 5FD6A 3TMOA 3TW6A 1B8IB 4M3GA 3MKLA 1ACIA 2ELHA 5H20A 2VJIA 3HUGA 4AWXB 4K2EA 1YX3A 3ZXSA 3K10A 1SD7A 3GVAA 2E1CA 4FX0A 2JQ7A 3CMYA 2W1OA 5EZHA 2NVUB 3M7GA 2R3SA 2YSRA 3ERMA 2DDAA 3K4JA 3F3XA 2DMUA 2XSJC 1VQOI 4A2UA 2X4HA 4F52A 5CPRB 2XASA 2HXIA 3KYLA 2DOEA 2ZFUA 3E5UA 3GXOA 4C3JJ 4F55A 5L3FA 3ZQCA 2VOPA 3RIRA 2DXIA 4A0ZA 4BDYA 2V7FA 1IZ1A 1FMVA 3IWZA 1EF4A 4ASNA 2GM4A 1JTYA 2ZNZA 2BXYA 4DZJA 1XSVA 4G9YA 2HOSA 1EV7A 2XGXA 4ENNA 3W2VA 3HGGA 2XPUA 3WU2C 4G6TB 3SYTA 1YX5A 4EGYA 1DP7P 1VQKI 3PL8A 4ON0A 5EEHA 4I0BA 2M7AA 5LHGA 2G7HA 3JTGA 1GHCA 2STWA 4UUVA 5FRNA 4Q5SF 1TZLA 1IN6A 2X1EA 3K2ZA 2L2OA 5TGTA 1YITI 4PSWA 4RAZA 2UWMA 1YFHA 2X51A 3U9GA 2EB7A 4G7HF 3SZPA 3OIQA 5K5RA 3MVPA 1AA7A 2DLLA 2R7XA 1IDYA 1QZEA 2FE3A 2M3AA 4A3LJ 5C4JJ 5FKKA 2E2HJ 3JSOA
chains in the Genus database with same CATH topology
1FNNA 3KP5A 1UHMA 3JW4A 4Q47A 2QYOA 4ZH4F 2W25A 1XGMA 4R8HA 1LEBA 1UHWA 5LLQA 3H3ZA 1Z05A 3KCCA 4RGSA 2KIMA 3V8LA 3RYPA 4B8XA 2A61A 4P9FA 3EDPA 2HZTA 2XROA 1AOYA 1BBYA 4FT8A 3Q5FA 5ILSA 1P92A 2C6YA 1KU2A 1W4MA 1S29A 1Z9CA 3BP8A 2W85A 3LA7A 4HBLA 3LA3A 2G7UA 5E1WA 1TLHB 3F72A 5K1YA 5LRSA 4KT5C 2RGVA 1KYZA 3LWFA 3KP2A 3O2PE 1K78B 4G7ZF 2ESHA 2PJPA 1KU7A 2GWRA 2YX4A 3V8JA 2HYGD 2ZNYA 1BC7C 3IWFA 5BS6A 2PEXA 2VOOA 3GZ6A 3Q9SA 3F8CA 4O3MA 5DUIA 2LKPA 4XRFA 3DF8A 5K5QA 3D0SA 2Y75A 2EV0A 1B9NA 1UB9A 1JHFA 2YR2A 3W6KB 5D8LB 4EV0A 1Z91A 3IHUA 3ZN1A 2EV6A 1PP8F 4EJVA 1H9GA 3E5XA 2VBWA 1SAXA 1GVJA 5HDGA 1ZG3A 1W5SA 4ZZDA 2PN6A 4MTEA 5IT9Z 5L3DA 1B6AA 2KIFA 1IUYA 5IT3A 2RC4A 1KQ8A 5KK1A 2FEZA 3G73A 2P4WA 1YIOA 4MQVA 4LLLA 2A6EF 4DQ2A 4ETSA 1YLFA 3FZVA 2QLZA 2OA4A 3WTZA 4Y15A 3DEUA 2FQ3A 1GXPA 3E6DA 1ZG1A 2Q0OA 3D5LA 3KLNA 2A68F 4BH9A 4RGXA 1TNSA 1HQCA 1TBXA 3E5QA 2EFOA 1HSTA 2JRTA 3SQNA 4RB3C 3QP5A 1LDDA 2FRHA 1OYYA 1P6RA 1QZZA 4KNYA 5CJ9A 2J5PA 4R1HA 1H0MA 4RB2C 4IHSA 3I71A 2CYYA 3C3WA 3R0JA 4GYIA 4M9XA 3ZMZA 2MD5A 4UVBA 1ZAOA 5E18F 1IXCA 3RDIA 5HDKA 4EJOA 5E8IA 1TW2A 1B9MA 2Z5UA 2Q8KA 2GQQA 2HYFA 2M30A 2LF7A 2M87A 1CF7B 4L18B 2EFQA 1WI9A 3NQOA 2V9VA 1TQMA 1V3FA 1J0RA 3ML6A 2UXXA 5HS8A 1IRFA 1LDKB 2XIGA 2VXZA 4IVNA 2HWVA 5ERIA 3CUQA 3EYYA 4LLGF 1R22A 4LMYA 3KP4A 1P4AA 1O7LA 3IL2A 2M8EA 1I27A 5CLSA 1FZPB 1T39A 5HLHA 1OYIA 1DPRA 2XVCA 2HGCA 3DV8A 4QLCU 3MQ0A 2NYXA 2R7FA 1KU9A 2KKOA 2Y48A 4WXDA 1SFXA 2KJCA 3JAMZ 1KQ9A 1ODDA 4KA4A 2FU4A 2G9WA 4MEXF 1FX7A 2EK5A 3ECOA 2BYVE 1LDJA 2CFXA 3IRRA 1JXSA 2K27A 3P9IA 1QNTA 1BOAA 5JVTA 2OAZA 1FYKA 4I0AA 1W7PA 3IKVA 3TQNA 5DV5A 3TGNA 2GXBA 3B02A 3BWGA 2PG4A 4UNOA 5HOOA 4I01A 3MCZA 3HRTA 2VN2A 3BY6A 4I2OA 1HKSA 1U6GA 1LJ9A 5HS9A 4EJTA 3LQRA 2PMHA 2F2EA 1F1ZA 1XDSA 4KFCA 1I1SA 2FBKA 3O6BB 5LEJA 3MAJA 4AIHA 1MJBA 2BV6A 4O6JA 3GZ5A 5CVUA 2P5LC 3REOA 1PUEE 3RKYA 1STZA 2V1DA 2CGPA 3RTRA 2QQBA 2KIUA 1U5TC 1S8NA 1U5TB 2A5YB 3LFKA 1RNLA 3MZYA 3VB2A 3ZP5A 5LGNA 1SMYF 4JK1X 3L2CA 5DYMA 2NAZA 2TDXA 1HKQA 2D1HA 3RKXA 2MLGA 1O3QA 1HW2A 2ISYA 2W24A 4L5JA 3BZ6A 4G6DA 5FGMA 3R0AA 2XAQA 1SD6A 4MEYF 4EM1A 1LVAA 4FX4A 4L0ZB 2PI0A 2NS0A 3JTHA 1BJAA 3TOAA 2YPRA 4HW0A 5BOXA 5AIQA 4GYGA 2JTVA 3GYHX 3FM3A 2QBYB 4OIRF 1D3YA 1HSJA 1YQAA 2EA2A 5D8KB 3HSFA 1ZRFA 3C1DA 4G7OF 2STTA 3H92A 3C7JA 3WTWC 3GF2A 3C18A 1HW5A 4JQFA 1S7AA 3VODA 4MTDA 1ZARA 4M9SA 2WC2A 3ZMTA 2PQ8A 1OR7A 2ZMEB 1F5TA 2H27A 4I98B 2XKPA 5FO5A 1BIBA 1Y0UA 1LNWA 1U78A 3QAHA 1KU3A 4IHTA 1QZYA 2H09A 5LGTA 2V1UA 1LEAA 5FFZA 3WGHA 2K7LA 4ZYEA 5DUKA 3L00A 1R5HA 4KN4X 3CO7C 1ON1A 2DQLA 2K4JA 1YS7A 3T5XA 5E20A 2YU3A 2L3DA 3JAMK 2XUBA 1MJ9A 3RJPA 2RNJA 3V4GA 4BQAA 5HVQC 1SFUA 4IRIA 3I64A 4L5IA 4AIJA 1BN5A 2MH9A 2ZFWA 2L4MA 4GO1A 3G3ZA 2F5CA 1IN7A 1SFEA 4KN7X 4UHTA 1ZH5A 4G94A 1OYWA 4A0YA 1GXQA 1CF7A 1BIAA 1ZRCA 2F5FA 1PDNC 2E1NA 3ZN0A 4UVCA 2NNYA 3F8BA 2E7XA 3BDDA 4O5VA 4MNUA 1G4DA 3SXYA 3GFIA 1P4WA 1T98A 3P9KA 1DPUA 3WODF 2V79A 3QOPA 2HDCA 1G3YA 1UFMA 1YO5C 4EM0B 4P55A 1IF1A 1FWZA 3KE2A 4OIQF 2KJBA 5ICCA 3NRVA 3T1BA 1FBUA 5ILUA 2F5EA 2P8TA 2GXGA 2Q2EA 1KA8A 5E1ZB 3DPTA 2CSOA 2NNNA 1IW7F 2HKXA 1B1BA 1G3TA 3GFLA 1XSDA 3FX3A 3R60A 1TQPA 3GFJA 2M1BA 2DPDA 2WTEA 2ZKZA 4OOIA 1ONVA 1UCRA 5JI6A 1IXRC 4HYEA 4OINF 4Q4ZF 4ESBA 2MA3A 2HR3A 4M74A 2W84A 3M9AA 4U0YA 1YW9A 2O61A 4HV5A 2VT3A 1XGSA 4KIBA 1YW8A 2LSOA 3WE3A 2DTRA 2PBIA 5K5OA 1YYVA 2XAJA 5J8CA 1YTYA 1FP1D 2BBYA 3EYIA 3P9CA 5J8FA 3GX4X 2DT5A 1EH6A 3TO9A 5D4SA 4LG0B 1F9NA 3K0LA 1G3WA 2K02A 4CHUA 2V1XA 5CVIA 2QUFA 4P9UA 2D45A 1F4KA 1BI3A 5ILVA 2OZ6A 3LQQA 4AIKA 3ABTA 3HSEA 5AIPA 1U5TA 2XHKA 3EUHA 3IRQA 4HX8A 3I59B 4KMFA 3MZHA 2K4BA 2IA2A 2FOKA 3WTSC 2DK5A 3BROA 2EJRA 2F5DA 2VE8A 1IXSB 1PP7U 5A2QK 4EJUA 1LQ1A 1J5YA 4KMUX 4PCQA 1B4AA 1O57A 1OPCA 2BE5F 4U7BA 2P5KA 3N97A 1T2KA 3W6JB 4FHTA 2M45A 4XSXF 5H6QA 5J6XA 2WV0A 3K1NA 4MGRA 3RKWA 2IW5A 1WSUA 2JPBA 1MZBA 4KIGA 3WTVC 1Z6TA 3O3KA 3QPTA 3HIFA 1QBJA 1IN5A 3K1MA 4M6YA 1A04A 1XSXA 1R7JA 3VOEA 2ACJA 2ZMEA 3KP3A 2MBFA 2ZBKA 1R5GA 4WK8F 1ULYA 4N0BA 1U8RA 2ETHA 3HOTA 4XLPF 4Y13A 3KZZA 3FXUA 3J7AO 3E6BA 5ICEA 2LF8A 3I54A 3ERED 2VONA 2FBHA 3SHFA 1YS6A 2ZCWA 2KRFA 3V7RA 2IT0A 3DP7A 4A12A 4KUMA 2AXLA 5D6EA 1ZGJA 2FF4A 4HF1A 5F64A 2IPQX 3ROUA 3K1PA 2IA0A 3BJOA 1TQIA 3COAC 1XGOA 3FHZA 4YIFA 4RS8A 2PMUA 1ON2A 2CW0F 1FBSA 3MWMA 3EQLF 3WE2A 3PQJA 1ZLJA 2B0LA 1HW1A 1O3SA 2E7WA 2P7CB 4WXHA 2VBYA 3B73A 2HKOA 1S6LA 3FXRA 1FY7A 2Z3YA 4OMYA 4ZYHA 3I5UA 2PFBA 2FSWA 2IVMA 1ZGAA 5CVJA 2JZYA 3BJ6A 2HQNA 2H6CA 2FNAA 2FMYA 4LD5A 3HSRA 1R58A 1BC8C 2EWNA 3E6MA 1J2XA 1O3TA 1JGSA 5HLGA 4IRHA 1FYMA 2L54A 3F21A 2DU9A 3WTTC 1FBQA 1P4XA 4P5OA 3PQKA 2HTJA 5FLXK 1BI0A 3U2RA 3ZPLA 1ZHFA 2M5WA 2XAGA 4UVAA 3R6SA 2YX7A 4RB0A 5CVRA 2IJLA 2EV5A 3K69A 4WXCA 1O7FA 2OD5A 4PZJA 5LRRA 2A3SA 3SFZA 3TO6A 3LSTA 3I0TA 2L01A 4G8XA 1D5VA 4KIFA 1JHHA 1ZRDA 1OMIA 4HF2A 3CJNA 1K78A 1MGTA 3LA2A 2XKOA 2VT2A 1O3RA 1R36A 4L9TA 3FF5A 5AONA 2R7DA 2RV8A 1OKRA 3GWZA 2EA4A 2X0LA 2D2WA 1QO0D 3BPVA 5BMZA 1Z1DA 3E97A 3RI4A 4LG0A 2A6HF 1K6OA 3HRUA 3QP6A 3TDZC 4UXNA 4M72A 1TTYA 2AS5F 6PAXA 4E70A 4OU0A 4WF2A 3FMSA 2QQAA 3KP7A 1TW3A 3DPLC 3F22A 5LBQA 4CZZA 5JFRA 5D5WB 3DKWA 3I59A 3KEQA 2VC0A 2W57A 2P6TA 1P2FA 3DQVC 5CYVA 5F6FA 2O6GE 4JBAA 4CGZA 3CLOA 4HAMA 3V7SA 4KICA 2O03A 1R1VA 2HEOA 2HQRA 1WKMA 5BPIA 3HTSB 2GAUA 5LHIA 5KVRA 3OOPA 2EFPA 5BQTA 3ZMUA 5L3EA 2MC3A 2H94A 3FMQA 2ZJ2A 1MDMB 2DI3A 4A0XA 5D5VB 1SD4A 4IJAA 4HLXA 5E1XA 1FSHA 1TNTA 2QVOA 3PFIA 3KZYA 3IKTA 2V6CA 1HKTA 2QZ8A 3GLXA 5A2QZ 1WQ2A 4GGGA 2RKHA 4EQQA 5DCFA 3QRFF 3RPUA 3FWEA 2XAHA 5ICFA 4ESJA 2HOEA 2OQGA 3T8TA 5D5UB 1KGSA 3ZQ7A 4BXUA 2EFWA 5L3BA 1XB4A 4S04A 2IP2A 2K86A 4ENMA 1EH7A 4HDVA 1EH8A 1QGPA 4RGRA 3FMRA 3ECHA 3J80Z 2ZXJA 1X3UA 4HA8A 2NRAC 4M73A 4EMSA 5DEQA 2FBIA 3CUQC 5FFXA 2DBBA 2GA2A 3CUQB 4N9IA 4QWQA 3IC7A 3V8KA 5F1RA 1FC3A 1L0OC 1KQ0A 2GZWA 3FM5A 1HBXG 3HTUA 3CDHA 2WWYA 5FB2A 4CXFA 3KLOA 1MKMA 2GIVA 1RUOA 3HHHA 1YG2A 3HRMA 4S05A 4M9ZA 4PGGA 3HYIA 1L3LA 2DFIA 1Q1HA 4R79A 2LNBA 3RPQA 2FMLA 3DXJF 5DCMB 3H3UA 1XD7A 3RYRA 3T0YA 2D1VA 5BPDA 4IRGA 3KEOA 4HX7A 3TO7A 1R1UA 4WCGA 4CDGA 1B59A 3GO5A 3ISPA 1J7KA 2VBZA 4AD9A 3M1EA 3K9TA 2L02A 2OBPA 1W7PD 1W7PB 4CYDA 4U7DA 1T6SA 1USTA 1R1TA 1YW7A 3M8FA 4IPAA 4A5MA 3WG9A 1RZ4A 1MJAA 3WTUC 2RDPA 2JT1A 3BJAA 1ZN2A 4ESFA 4N9HA 1WWXA 2FXAA 3GW2A 4A6DA 1DDNA 1BI2A 1RI7A 4KDPA 2Z99A 4ZYDA 2Z9OA 1XGNA 4LB5A 4L9VA 2CWEA 3WU1B 1S7OA 3TKYA 1XCBA 1WRJA 4I09A 3SZTA 1IN4A 2QM3A 2LDUA 1USSA 4OMZA 1E2XA 3LAJA 2Z33A 4IXAA 3TDUC 3WU0A 5FLXZ 3M8EA 3ULQB 2HTSA 4U0VA 4A6EA 2ZO4A 1QPMA 4D0PA 4BYYA 4ZZLA 5DDGA 1FLIA 1I5ZA 1NHAA 1G6NA 2COMA 3CO6C 3WGIA 4LGWA 1Z6RA 2UZKA 1J9IA 4HDUA 4CO8A 2DQRA 4L9NA 3F6VA 2ADUA 4CICA 4XSZF 3HRSA 2FNPA 1XDUA 5D5XB 2MH2A 3KFWX 2O3FA 2QBYA 5ICGA 1I1GA 1JE8A 2DAOA 3QU6A 5JR3A 3J81Z 1FT9A 2CG4A 3I4PA 3J80K 1XCVA 2RN7A 5CVVA 3P7NA 2DW4A 3ZMDA 4P96A 4I7HA 3F23A 1Z7UA 2J5OA 5LGUA 4U0WA 1R00A 4UV9A 3CTAA 3V7CA 1ZYRF 5HLIA 1ZG5A 2DO7A 4TV7A 1MDMA 3F8MA 2A07F 3BPXA 1K7AA 1J59A 1C0WA 4U88A 1BI1A 2QQ9A 3HHGA 1DUXC 3NEUA 4XLNF 1MD0A 4HQEA 4NB5A 3GEZA 1S3JA 4YFKF 1U3EM 1T0FA 4B09A 3KETA 2XAFA 1VTNC 1QQIA 3U1DA 2RVCA 2BEOA 1AWCA 3CUOA 1FPQA 4HF0A 3N4MA 4OIPF 1J75A 1XMKA 2OU2A 4RAYA 4M71A 2P6SA 5DD4A 2EFNA 4MQ9F 2HS5A 4UV8A 3FXQA 4G6QA 2DPUA 3MEXA 3QPHA 1SMTA 4GXOA 3QU3A 4BAYA 1IN8A 3LAPA 3DFGA 1K79A 2ISZA 4HX4A 2ESNA 1ZREA 4WX9A 5LHHA 4EJWA 2A69F 4LFUA 3EETA 1IAWA 1IRGA 4ZYGA 4EVIA 2UXNA 3TOBA 1SD5A 2DK8A 4OIOF 3R4KA 2IRFG 3L09A 3I53A 4HV6A 3WTXC 2RQPA 2CQKA 1V4RA 3HOSA 3OV8A 4ENKA 2FA5A 5L3GA 4HQMA 5DCMA 2HFHA 5JHUA 4WWCA 4YFXF 4IF4A 1XMAA 3E3VA 2P5VA 2Y0MA 3WTYC 3ABUA 5ED4A 3F6OA 4YFNF 4I02A 2P7VB 5LEKA 2O0YA 2VBXA 2L4AA 1T38A 1W5TA 5L3CA 3ELKA 3I58A 1FP2A 4BHBA 2OQRA 4LB6B 5DD8A 3WGGA 2IA1A 3L9FA 2QWWA 4ENJA 1FOKA 1LB2A 3L7WA 5E17F 5EEGA 2JSCA 4Q48A 5IT9K 4LJZF 3KP6A 4HZFA 4AVPA 5D6FA 4XBFA 1RIOH 3S2WA 1D8JA 2PLYA 3JSPA 3T8RA 3J81K 5H6RA 3GUDA 3AAFA 3Q9VA 4RGUA 5D4RA 1R23A 3VFZA 2JPCA 1U2WA 3E6CC 2XV4S 4EM2A 4LLNA 5HDNA 4Z2YA 4NQWA 3F8NA 2O8XA 4LK0F 3ZMSA 4YG2F 1D8KA 4BHCA 2CO5A 1XN7A 4NHJA 2VC1A 4H0EA 5E8GA 1ZLKA 1I6XA 4L9JA 4Y17A 4MHGA 4KYWA 1BM9A 4BHPA 3ZMVA 1FYLA 1REPC 1KYWA 4GCVA 2H6BA 1HXDA 1E17A 3VEPA 3R61A 4DNCA 1CGPA 2XRNA 4PGHA 1G3SA 1FSEA 2QENA 2VODA 4HOBA 5TRDA 1H9TA 4LK1F 4RB1A 3F8FA 4PDKA 4A5NA 4HLYA 2MLKA 4EGZA 3BOQA 2GA1A 4YIIA 5FD5A 3MFKA 4M6XA 4BNCA 5HS7A 2VE9A 2OZUA 4L0YB 2BGCA 5TJJA 1RUNA 3GFMA 4F7ZA 5FD6A 2ELHA 5H20A 3HUGA 4AWXB 4K2EA 1SD7A 3GVAA 2E1CA 4FX0A 3M7GA 2R3SA 2YSRA 3F3XA 4A2UA 2X4HA 2XASA 5L3FA 3E5UA 3GXOA 2VOPA 3RIRA 4A0ZA 1IZ1A 3IWZA 4ASNA 2ZNZA 1XSVA 4G9YA 1EV7A 2XGXA 4ENNA 4EGYA 1DP7P 4ON0A 5EEHA 4I0BA 5LHGA 2G7HA 3JTGA 1GHCA 2STWA 4UUVA 4Q5SF 1IN6A 3K2ZA 4RAZA 2UWMA 1YFHA 3U9GA 2EB7A 4G7HF 3SZPA 5K5RA 2DLLA 2FE3A 3JSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FNN A;  3KP5 A;  1UHM A;  3JW4 A;  4Q47 A;  2QYO A;  4ZH4 F;  2W25 A;  1XGM A;  4R8H A;  1LEB A;  1UHW A;  5LLQ A;  3H3Z A;  1Z05 A;  3KCC A;  4RGS A;  2KIM A;  3V8L A;  3RYP A;  4B8X A;  2A61 A;  4P9F A;  3EDP A;  2HZT A;  2XRO A;  1AOY A;  1BBY A;  4FT8 A;  3Q5F A;  5ILS A;  1P92 A;  2C6Y A;  1KU2 A;  1W4M A;  1S29 A;  1Z9C A;  3BP8 A;  2W85 A;  3LA7 A;  4HBL A;  3LA3 A;  2G7U A;  5E1W A;  1TLH B;  3F72 A;  5K1Y A;  5LRS A;  4KT5 C;  2RGV A;  1KYZ A;  3LWF A;  3KP2 A;  3O2P E;  1K78 B;  4G7Z F;  2ESH A;  2PJP A;  1KU7 A;  2GWR A;  2YX4 A;  3V8J A;  2HYG D;  2ZNY A;  1BC7 C;  3IWF A;  5BS6 A;  2PEX A;  2VOO A;  3GZ6 A;  3Q9S A;  3F8C A;  4O3M A;  5DUI A;  2LKP A;  4XRF A;  3DF8 A;  5K5Q A;  3D0S A;  2Y75 A;  2EV0 A;  1B9N A;  1UB9 A;  1JHF A;  2YR2 A;  3W6K B;  5D8L B;  4EV0 A;  1Z91 A;  3IHU A;  3ZN1 A;  2EV6 A;  1PP8 F;  4EJV A;  1H9G A;  3E5X A;  2VBW A;  1SAX A;  1GVJ A;  5HDG A;  1ZG3 A;  1W5S A;  4ZZD A;  2PN6 A;  4MTE A;  5IT9 Z;  5L3D A;  1B6A A;  2KIF A;  1IUY A;  5IT3 A;  2RC4 A;  1KQ8 A;  5KK1 A;  2FEZ A;  3G73 A;  2P4W A;  1YIO A;  4MQV A;  4LLL A;  2A6E F;  4DQ2 A;  4ETS A;  1YLF A;  3FZV A;  2QLZ A;  2OA4 A;  3WTZ A;  4Y15 A;  3DEU A;  2FQ3 A;  1GXP A;  3E6D A;  1ZG1 A;  2Q0O A;  3D5L A;  3KLN A;  2A68 F;  4BH9 A;  4RGX A;  1TNS A;  1HQC A;  1TBX A;  3E5Q A;  2EFO A;  1HST A;  2JRT A;  3SQN A;  4RB3 C;  3QP5 A;  1LDD A;  2FRH A;  1OYY A;  1P6R A;  1QZZ A;  4KNY A;  5CJ9 A;  2J5P A;  4R1H A;  1H0M A;  4RB2 C;  4IHS A;  3I71 A;  2CYY A;  3C3W A;  3R0J A;  4GYI A;  4M9X A;  3ZMZ A;  2MD5 A;  4UVB A;  1ZAO A;  5E18 F;  1IXC A;  3RDI A;  5HDK A;  4EJO A;  5E8I A;  1TW2 A;  1B9M A;  2Z5U A;  2Q8K A;  2GQQ A;  2HYF A;  2M30 A;  2LF7 A;  2M87 A;  1CF7 B;  4L18 B;  2EFQ A;  1WI9 A;  3NQO A;  2V9V A;  1TQM A;  1V3F A;  1J0R A;  3ML6 A;  2UXX A;  5HS8 A;  1IRF A;  1LDK B;  2XIG A;  2VXZ A;  4IVN A;  2HWV A;  5ERI A;  3CUQ A;  3EYY A;  4LLG F;  1R22 A;  4LMY A;  3KP4 A;  1P4A A;  1O7L A;  3IL2 A;  2M8E A;  1I27 A;  5CLS A;  1FZP B;  1T39 A;  5HLH A;  1OYI A;  1DPR A;  2XVC A;  2HGC A;  3DV8 A;  4QLC U;  3MQ0 A;  2NYX A;  2R7F A;  1KU9 A;  2KKO A;  2Y48 A;  4WXD A;  1SFX A;  2KJC A;  3JAM Z;  1KQ9 A;  1ODD A;  4KA4 A;  2FU4 A;  2G9W A;  4MEX F;  1FX7 A;  2EK5 A;  3ECO A;  2BYV E;  1LDJ A;  2CFX A;  3IRR A;  1JXS A;  2K27 A;  3P9I A;  1QNT A;  1BOA A;  5JVT A;  2OAZ A;  1FYK A;  4I0A A;  1W7P A;  3IKV A;  3TQN A;  5DV5 A;  3TGN A;  2GXB A;  3B02 A;  3BWG A;  2PG4 A;  4UNO A;  5HOO A;  4I01 A;  3MCZ A;  3HRT A;  2VN2 A;  3BY6 A;  4I2O A;  1HKS A;  1U6G A;  1LJ9 A;  5HS9 A;  4EJT A;  3LQR A;  2PMH A;  2F2E A;  1F1Z A;  1XDS A;  4KFC A;  1I1S A;  2FBK A;  3O6B B;  5LEJ A;  3MAJ A;  4AIH A;  1MJB A;  2BV6 A;  4O6J A;  3GZ5 A;  5CVU A;  2P5L C;  3REO A;  1PUE E;  3RKY A;  1STZ A;  2V1D A;  2CGP A;  3RTR A;  2QQB A;  2KIU A;  1U5T C;  1S8N A;  1U5T B;  2A5Y B;  3LFK A;  1RNL A;  3MZY A;  3VB2 A;  3ZP5 A;  5LGN A;  1SMY F;  4JK1 X;  3L2C A;  5DYM A;  2NAZ A;  2TDX A;  1HKQ A;  2D1H A;  3RKX A;  2MLG A;  1O3Q A;  1HW2 A;  2ISY A;  2W24 A;  4L5J A;  3BZ6 A;  4G6D A;  5FGM A;  3R0A A;  2XAQ A;  1SD6 A;  4MEY F;  4EM1 A;  1LVA A;  4FX4 A;  4L0Z B;  2PI0 A;  2NS0 A;  3JTH A;  1BJA A;  3TOA A;  2YPR A;  4HW0 A;  5BOX A;  5AIQ A;  4GYG A;  2JTV A;  3GYH X;  3FM3 A;  2QBY B;  4OIR F;  1D3Y A;  1HSJ A;  1YQA A;  2EA2 A;  5D8K B;  3HSF A;  1ZRF A;  3C1D A;  4G7O F;  2STT A;  3H92 A;  3C7J A;  3WTW C;  3GF2 A;  3C18 A;  1HW5 A;  4JQF A;  1S7A A;  3VOD A;  4MTD A;  1ZAR A;  4M9S A;  2WC2 A;  3ZMT A;  2PQ8 A;  1OR7 A;  2ZME B;  1F5T A;  2H27 A;  4I98 B;  2XKP A;  5FO5 A;  1BIB A;  1Y0U A;  1LNW A;  1U78 A;  3QAH A;  1KU3 A;  4IHT A;  1QZY A;  2H09 A;  5LGT A;  2V1U A;  1LEA A;  5FFZ A;  3WGH A;  2K7L A;  4ZYE A;  5DUK A;  3L00 A;  1R5H A;  4KN4 X;  3CO7 C;  1ON1 A;  2DQL A;  2K4J A;  1YS7 A;  3T5X A;  5E20 A;  2YU3 A;  2L3D A;  3JAM K;  2XUB A;  1MJ9 A;  3RJP A;  2RNJ A;  3V4G A;  4BQA A;  5HVQ C;  1SFU A;  4IRI A;  3I64 A;  4L5I A;  4AIJ A;  1BN5 A;  2MH9 A;  2ZFW A;  2L4M A;  4GO1 A;  3G3Z A;  2F5C A;  1IN7 A;  1SFE A;  4KN7 X;  4UHT A;  1ZH5 A;  4G94 A;  1OYW A;  4A0Y A;  1GXQ A;  1CF7 A;  1BIA A;  1ZRC A;  2F5F A;  1PDN C;  2E1N A;  3ZN0 A;  4UVC A;  2NNY A;  3F8B A;  2E7X A;  3BDD A;  4O5V A;  4MNU A;  1G4D A;  3SXY A;  3GFI A;  1P4W A;  1T98 A;  3P9K A;  1DPU A;  3WOD F;  2V79 A;  3QOP A;  2HDC A;  1G3Y A;  1UFM A;  1YO5 C;  4EM0 B;  4P55 A;  1IF1 A;  1FWZ A;  3KE2 A;  4OIQ F;  2KJB A;  5ICC A;  3NRV A;  3T1B A;  1FBU A;  5ILU A;  2F5E A;  2P8T A;  2GXG A;  2Q2E A;  1KA8 A;  5E1Z B;  3DPT A;  2CSO A;  2NNN A;  1IW7 F;  2HKX A;  1B1B A;  1G3T A;  3GFL A;  1XSD A;  3FX3 A;  3R60 A;  1TQP A;  3GFJ A;  2M1B A;  2DPD A;  2WTE A;  2ZKZ A;  4OOI A;  1ONV A;  1UCR A;  5JI6 A;  1IXR C;  4HYE A;  4OIN F;  4Q4Z F;  4ESB A;  2MA3 A;  2HR3 A;  4M74 A;  2W84 A;  3M9A A;  4U0Y A;  1YW9 A;  2O61 A;  4HV5 A;  2VT3 A;  1XGS A;  4KIB A;  1YW8 A;  2LSO A;  3WE3 A;  2DTR A;  2PBI A;  5K5O A;  1YYV A;  2XAJ A;  5J8C A;  1YTY A;  1FP1 D;  2BBY A;  3EYI A;  3P9C A;  5J8F A;  3GX4 X;  2DT5 A;  1EH6 A;  3TO9 A;  5D4S A;  4LG0 B;  1F9N A;  3K0L A;  1G3W A;  2K02 A;  4CHU A;  2V1X A;  5CVI A;  2QUF A;  4P9U A;  2D45 A;  1F4K A;  1BI3 A;  5ILV A;  2OZ6 A;  3LQQ A;  4AIK A;  3ABT A;  3HSE A;  5AIP A;  1U5T A;  2XHK A;  3EUH A;  3IRQ A;  4HX8 A;  3I59 B;  4KMF A;  3MZH A;  2K4B A;  2IA2 A;  2FOK A;  3WTS C;  2DK5 A;  3BRO A;  2EJR A;  2F5D A;  2VE8 A;  1IXS B;  1PP7 U;  5A2Q K;  4EJU A;  1LQ1 A;  1J5Y A;  4KMU X;  4PCQ A;  1B4A A;  1O57 A;  1OPC A;  2BE5 F;  4U7B A;  2P5K A;  3N97 A;  1T2K A;  3W6J B;  4FHT A;  2M45 A;  4XSX F;  5H6Q A;  5J6X A;  2WV0 A;  3K1N A;  4MGR A;  3RKW A;  2IW5 A;  1WSU A;  2JPB A;  1MZB A;  4KIG A;  3WTV C;  1Z6T A;  3O3K A;  3QPT A;  3HIF A;  1QBJ A;  1IN5 A;  3K1M A;  4M6Y A;  1A04 A;  1XSX A;  1R7J A;  3VOE A;  2ACJ A;  2ZME A;  3KP3 A;  2MBF A;  2ZBK A;  1R5G A;  4WK8 F;  1ULY A;  4N0B A;  1U8R A;  2ETH A;  3HOT A;  4XLP F;  4Y13 A;  3KZZ A;  3FXU A;  3J7A O;  3E6B A;  5ICE A;  2LF8 A;  3I54 A;  3ERE D;  2VON A;  2FBH A;  3SHF A;  1YS6 A;  2ZCW A;  2KRF A;  3V7R A;  2IT0 A;  3DP7 A;  4A12 A;  4KUM A;  2AXL A;  5D6E A;  1ZGJ A;  2FF4 A;  4HF1 A;  5F64 A;  2IPQ X;  3ROU A;  3K1P A;  2IA0 A;  3BJO A;  1TQI A;  3COA C;  1XGO A;  3FHZ A;  4YIF A;  4RS8 A;  2PMU A;  1ON2 A;  2CW0 F;  1FBS A;  3MWM A;  3EQL F;  3WE2 A;  3PQJ A;  1ZLJ A;  2B0L A;  1HW1 A;  1O3S A;  2E7W A;  2P7C B;  4WXH A;  2VBY A;  3B73 A;  2HKO A;  1S6L A;  3FXR A;  1FY7 A;  2Z3Y A;  4OMY A;  4ZYH A;  3I5U A;  2PFB A;  2FSW A;  2IVM A;  1ZGA A;  5CVJ A;  2JZY A;  3BJ6 A;  2HQN A;  2H6C A;  2FNA A;  2FMY A;  4LD5 A;  3HSR A;  1R58 A;  1BC8 C;  2EWN A;  3E6M A;  1J2X A;  1O3T A;  1JGS A;  5HLG A;  4IRH A;  1FYM A;  2L54 A;  3F21 A;  2DU9 A;  3WTT C;  1FBQ A;  1P4X A;  4P5O A;  3PQK A;  2HTJ A;  5FLX K;  1BI0 A;  3U2R A;  3ZPL A;  1ZHF A;  2M5W A;  2XAG A;  4UVA A;  3R6S A;  2YX7 A;  4RB0 A;  5CVR A;  2IJL A;  2EV5 A;  3K69 A;  4WXC A;  1O7F A;  2OD5 A;  4PZJ A;  5LRR A;  2A3S A;  3SFZ A;  3TO6 A;  3LST A;  3I0T A;  2L01 A;  4G8X A;  1D5V A;  4KIF A;  1JHH A;  1ZRD A;  1OMI A;  4HF2 A;  3CJN A;  1K78 A;  1MGT A;  3LA2 A;  2XKO A;  2VT2 A;  1O3R A;  1R36 A;  4L9T A;  3FF5 A;  5AON A;  2R7D A;  2RV8 A;  1OKR A;  3GWZ A;  2EA4 A;  2X0L A;  2D2W A;  1QO0 D;  3BPV A;  5BMZ A;  1Z1D A;  3E97 A;  3RI4 A;  4LG0 A;  2A6H F;  1K6O A;  3HRU A;  3QP6 A;  3TDZ C;  4UXN A;  4M72 A;  1TTY A;  2AS5 F;  6PAX A;  4E70 A;  4OU0 A;  4WF2 A;  3FMS A;  2QQA A;  3KP7 A;  1TW3 A;  3DPL C;  3F22 A;  5LBQ A;  4CZZ A;  5JFR A;  5D5W B;  3DKW A;  3I59 A;  3KEQ A;  2VC0 A;  2W57 A;  2P6T A;  1P2F A;  3DQV C;  5CYV A;  5F6F A;  2O6G E;  4JBA A;  4CGZ A;  3CLO A;  4HAM A;  3V7S A;  4KIC A;  2O03 A;  1R1V A;  2HEO A;  2HQR A;  1WKM A;  5BPI A;  3HTS B;  2GAU A;  5LHI A;  5KVR A;  3OOP A;  2EFP A;  5BQT A;  3ZMU A;  5L3E A;  2MC3 A;  2H94 A;  3FMQ A;  2ZJ2 A;  1MDM B;  2DI3 A;  4A0X A;  5D5V B;  1SD4 A;  4IJA A;  4HLX A;  5E1X A;  1FSH A;  1TNT A;  2QVO A;  3PFI A;  3KZY A;  3IKT A;  2V6C A;  1HKT A;  2QZ8 A;  3GLX A;  5A2Q Z;  1WQ2 A;  4GGG A;  2RKH A;  4EQQ A;  5DCF A;  3QRF F;  3RPU A;  3FWE A;  2XAH A;  5ICF A;  4ESJ A;  2HOE A;  2OQG A;  3T8T A;  5D5U B;  1KGS A;  3ZQ7 A;  4BXU A;  2EFW A;  5L3B A;  1XB4 A;  4S04 A;  2IP2 A;  2K86 A;  4ENM A;  1EH7 A;  4HDV A;  1EH8 A;  1QGP A;  4RGR A;  3FMR A;  3ECH A;  3J80 Z;  2ZXJ A;  1X3U A;  4HA8 A;  2NRA C;  4M73 A;  4EMS A;  5DEQ A;  2FBI A;  3CUQ C;  5FFX A;  2DBB A;  2GA2 A;  3CUQ B;  4N9I A;  4QWQ A;  3IC7 A;  3V8K A;  5F1R A;  1FC3 A;  1L0O C;  1KQ0 A;  2GZW A;  3FM5 A;  1HBX G;  3HTU A;  3CDH A;  2WWY A;  5FB2 A;  4CXF A;  3KLO A;  1MKM A;  2GIV A;  1RUO A;  3HHH A;  1YG2 A;  3HRM A;  4S05 A;  4M9Z A;  4PGG A;  3HYI A;  1L3L A;  2DFI A;  1Q1H A;  4R79 A;  2LNB A;  3RPQ A;  2FML A;  3DXJ F;  5DCM B;  3H3U A;  1XD7 A;  3RYR A;  3T0Y A;  2D1V A;  5BPD A;  4IRG A;  3KEO A;  4HX7 A;  3TO7 A;  1R1U A;  4WCG A;  4CDG A;  1B59 A;  3GO5 A;  3ISP A;  1J7K A;  2VBZ A;  4AD9 A;  3M1E A;  3K9T A;  2L02 A;  2OBP A;  1W7P D;  1W7P B;  4CYD A;  4U7D A;  1T6S A;  1UST A;  1R1T A;  1YW7 A;  3M8F A;  4IPA A;  4A5M A;  3WG9 A;  1RZ4 A;  1MJA A;  3WTU C;  2RDP A;  2JT1 A;  3BJA A;  1ZN2 A;  4ESF A;  4N9H A;  1WWX A;  2FXA A;  3GW2 A;  4A6D A;  1DDN A;  1BI2 A;  1RI7 A;  4KDP A;  2Z99 A;  4ZYD A;  2Z9O A;  1XGN A;  4LB5 A;  4L9V A;  2CWE A;  3WU1 B;  1S7O A;  3TKY A;  1XCB A;  1WRJ A;  4I09 A;  3SZT A;  1IN4 A;  2QM3 A;  2LDU A;  1USS A;  4OMZ A;  1E2X A;  3LAJ A;  2Z33 A;  4IXA A;  3TDU C;  3WU0 A;  5FLX Z;  3M8E A;  3ULQ B;  2HTS A;  4U0V A;  4A6E A;  2ZO4 A;  1QPM A;  4D0P A;  4BYY A;  4ZZL A;  5DDG A;  1FLI A;  1I5Z A;  1NHA A;  1G6N A;  2COM A;  3CO6 C;  3WGI A;  4LGW A;  1Z6R A;  2UZK A;  1J9I A;  4HDU A;  4CO8 A;  2DQR A;  4L9N A;  3F6V A;  2ADU A;  4CIC A;  4XSZ F;  3HRS A;  2FNP A;  1XDU A;  5D5X B;  2MH2 A;  3KFW X;  2O3F A;  2QBY A;  5ICG A;  1I1G A;  1JE8 A;  2DAO A;  3QU6 A;  5JR3 A;  3J81 Z;  1FT9 A;  2CG4 A;  3I4P A;  3J80 K;  1XCV A;  2RN7 A;  5CVV A;  3P7N A;  2DW4 A;  3ZMD A;  4P96 A;  4I7H A;  3F23 A;  1Z7U A;  2J5O A;  5LGU A;  4U0W A;  1R00 A;  4UV9 A;  3CTA A;  3V7C A;  1ZYR F;  5HLI A;  1ZG5 A;  2DO7 A;  4TV7 A;  1MDM A;  3F8M A;  2A07 F;  3BPX A;  1K7A A;  1J59 A;  1C0W A;  4U88 A;  1BI1 A;  2QQ9 A;  3HHG A;  1DUX C;  3NEU A;  4XLN F;  1MD0 A;  4HQE A;  4NB5 A;  3GEZ A;  1S3J A;  4YFK F;  1U3E M;  1T0F A;  4B09 A;  3KET A;  2XAF A;  1VTN C;  1QQI A;  3U1D A;  2RVC A;  2BEO A;  1AWC A;  3CUO A;  1FPQ A;  4HF0 A;  3N4M A;  4OIP F;  1J75 A;  1XMK A;  2OU2 A;  4RAY A;  4M71 A;  2P6S A;  5DD4 A;  2EFN A;  4MQ9 F;  2HS5 A;  4UV8 A;  3FXQ A;  4G6Q A;  2DPU A;  3MEX A;  3QPH A;  1SMT A;  4GXO A;  3QU3 A;  4BAY A;  1IN8 A;  3LAP A;  3DFG A;  1K79 A;  2ISZ A;  4HX4 A;  2ESN A;  1ZRE A;  4WX9 A;  5LHH A;  4EJW A;  2A69 F;  4LFU A;  3EET A;  1IAW A;  1IRG A;  4ZYG A;  4EVI A;  2UXN A;  3TOB A;  1SD5 A;  2DK8 A;  4OIO F;  3R4K A;  2IRF G;  3L09 A;  3I53 A;  4HV6 A;  3WTX C;  2RQP A;  2CQK A;  1V4R A;  3HOS A;  3OV8 A;  4ENK A;  2FA5 A;  5L3G A;  4HQM A;  5DCM A;  2HFH A;  5JHU A;  4WWC A;  4YFX F;  4IF4 A;  1XMA A;  3E3V A;  2P5V A;  2Y0M A;  3WTY C;  3ABU A;  5ED4 A;  3F6O A;  4YFN F;  4I02 A;  2P7V B;  5LEK A;  2O0Y A;  2VBX A;  2L4A A;  1T38 A;  1W5T A;  5L3C A;  3ELK A;  3I58 A;  1FP2 A;  4BHB A;  2OQR A;  4LB6 B;  5DD8 A;  3WGG A;  2IA1 A;  3L9F A;  2QWW A;  4ENJ A;  1FOK A;  1LB2 A;  3L7W A;  5E17 F;  5EEG A;  2JSC A;  4Q48 A;  5IT9 K;  4LJZ F;  3KP6 A;  4HZF A;  4AVP A;  5D6F A;  4XBF A;  1RIO H;  3S2W A;  1D8J A;  2PLY A;  3JSP A;  3T8R A;  3J81 K;  5H6R A;  3GUD A;  3AAF A;  3Q9V A;  4RGU A;  5D4R A;  1R23 A;  3VFZ A;  2JPC A;  1U2W A;  3E6C C;  2XV4 S;  4EM2 A;  4LLN A;  5HDN A;  4Z2Y A;  4NQW A;  3F8N A;  2O8X A;  4LK0 F;  3ZMS A;  4YG2 F;  1D8K A;  4BHC A;  2CO5 A;  1XN7 A;  4NHJ A;  2VC1 A;  4H0E A;  5E8G A;  1ZLK A;  1I6X A;  4L9J A;  4Y17 A;  4MHG A;  4KYW A;  1BM9 A;  4BHP A;  3ZMV A;  1FYL A;  1REP C;  1KYW A;  4GCV A;  2H6B A;  1HXD A;  1E17 A;  3VEP A;  3R61 A;  4DNC A;  1CGP A;  2XRN A;  4PGH A;  1G3S A;  1FSE A;  2QEN A;  2VOD A;  4HOB A;  5TRD A;  1H9T A;  4LK1 F;  4RB1 A;  3F8F A;  4PDK A;  4A5N A;  4HLY A;  2MLK A;  4EGZ A;  3BOQ A;  2GA1 A;  4YII A;  5FD5 A;  3MFK A;  4M6X A;  4BNC A;  5HS7 A;  2VE9 A;  2OZU A;  4L0Y B;  2BGC A;  5TJJ A;  1RUN A;  3GFM A;  4F7Z A;  5FD6 A;  2ELH A;  5H20 A;  3HUG A;  4AWX B;  4K2E A;  1SD7 A;  3GVA A;  2E1C A;  4FX0 A;  3M7G A;  2R3S A;  2YSR A;  3F3X A;  4A2U A;  2X4H A;  2XAS A;  5L3F A;  3E5U A;  3GXO A;  2VOP A;  3RIR A;  4A0Z A;  1IZ1 A;  3IWZ A;  4ASN A;  2ZNZ A;  1XSV A;  4G9Y A;  1EV7 A;  2XGX A;  4ENN A;  4EGY A;  1DP7 P;  4ON0 A;  5EEH A;  4I0B A;  5LHG A;  2G7H A;  3JTG A;  1GHC A;  2STW A;  4UUV A;  4Q5S F;  1IN6 A;  3K2Z A;  4RAZ A;  2UWM A;  1YFH A;  3U9G A;  2EB7 A;  4G7H F;  3SZP A;  5K5R A;  2DLL A;  2FE3 A;  3JSO A; 
#chains in the Genus database with same CATH topology
 1FNN A;  3CP2 A;  1Y1V J;  3KP5 A;  1UHM A;  4A3I J;  4A3C J;  3JW4 A;  2VKV A;  4Q47 A;  2QYO A;  4ZC3 A;  4ZH4 F;  2EZI A;  2W25 A;  2M2E A;  4HST A;  5E3L A;  1BW5 A;  1XGM A;  4OAZ A;  2LOO A;  2ZXI A;  4R8H A;  2CFO A;  3GTO J;  1LEB A;  2AQF A;  3G1L A;  1UHW A;  5LLQ A;  4BE0 A;  4QTR A;  3H3Z A;  1ETO A;  1Z05 A;  3AG2 H;  2E34 A;  3CC2 I;  3KCC A;  3BLY A;  5J1R A;  1D0Y A;  2E36 A;  4RGS A;  1ETK A;  1ZKG A;  2KIM A;  2V4J C;  5IOZ A;  3V8L A;  4XKV A;  3RYP A;  4B8X A;  1MMD A;  3D5S C;  1X1C A;  2A61 A;  3D5R C;  4P9F A;  3EDP A;  2HZT A;  3QYE A;  2XRO A;  1AOY A;  1DQU A;  1BBY A;  3LNQ A;  4FT8 A;  2M4G A;  2UUZ A;  3Q5F A;  2XF7 A;  2IXS A;  5ILS A;  1YRN A;  1P92 A;  3HJE A;  2C6Y A;  3FXJ A;  2F5V A;  3K7A J;  1KU2 A;  1W4M A;  2WAE A;  1S29 A;  1Z9C A;  3BP8 A;  2W85 A;  3Q0U A;  3G6E I;  3LA7 A;  2KFD A;  4HBL A;  2L7F P;  2VKH A;  3A0H C;  4CCK A;  3I9V 2;  3LA3 A;  3L1P A;  2G7U A;  5E1W A;  3JRD A;  3GTM J;  1R9T J;  1UJ8 A;  3GTJ J;  2CQ7 A;  2LP0 A;  2EBI A;  3LSJ A;  3PNY A;  1TLH B;  1WPK A;  3F72 A;  2RAE A;  5K1Y A;  5LRS A;  4AU7 A;  4KT5 C;  2RGV A;  1KYZ A;  4RA2 A;  2KDO A;  3LWF A;  3KP2 A;  2GXA A;  3O2P E;  1K78 B;  2ZJQ F;  3VYU B;  4G7Z F;  1NK3 P;  2ESH A;  1IRX A;  2PJP A;  2VL8 A;  1KU7 A;  2GWR A;  4PFP A;  2WAQ N;  2YX4 A;  3V8J A;  3BR6 A;  2RRE A;  2HYG D;  2K3F A;  2ZNY A;  5CQG A;  5GAD J;  1BC7 C;  3IWF A;  1ETV A;  2HNH A;  5BS6 A;  2JJ7 A;  3PIO F;  1IJW C;  1IGN A;  4V2F A;  2HYJ A;  2PEX A;  2VOO A;  2COB A;  2M9H A;  3GZ6 A;  3Q9S A;  3F8C A;  5F0H A;  4O3M A;  5DUI A;  1MBH A;  2LKP A;  1R6R A;  4XRF A;  3DF8 A;  3FBI B;  5K5Q A;  2BXZ A;  3D0S A;  2Y75 A;  4FIS A;  2E5Z A;  2EV0 A;  1B9N A;  1UB9 A;  1JHF A;  1POG A;  2JUC A;  2YR2 A;  4N4O B;  4E7H A;  2X6Y A;  5HOD A;  2WAF A;  4LIV A;  3W6K B;  2LTP A;  2HZD A;  5D8L B;  4EV0 A;  1LUJ B;  1Z91 A;  3IHU A;  3HGY A;  5GTH C;  4PK4 A;  2VQH A;  3ZN1 A;  2EV6 A;  1PP8 F;  4EJV A;  4BUP A;  1H9G A;  3E5X A;  2VBW A;  3CLQ A;  4D5C A;  4UB6 C;  1SAX A;  1GVJ A;  5HDG A;  2NOG A;  2YS9 A;  3CJT B;  1ZG3 A;  3GCM A;  1W5S A;  4ZZD A;  2PN6 A;  3I55 I;  3BG7 A;  3PUB A;  1VQ6 I;  2XDV A;  4MTE A;  5IT9 Z;  4NDL A;  5L3D A;  1B6A A;  1ENH A;  2KIF A;  3HC7 A;  1IUY A;  1JUM A;  5FKO A;  4C3H J;  3CC7 I;  4BL0 B;  5IT3 A;  2RC4 A;  1KQ8 A;  4W1U A;  3QWL A;  5KK1 A;  2FEZ A;  3G73 A;  3G71 I;  2P4W A;  1S72 I;  1MBE A;  2NS7 A;  4F93 B;  1YIO A;  2QKL B;  4MQV A;  1K4T A;  4LLL A;  2A6E F;  3OYC A;  1A6I A;  4DQ2 A;  4ETS A;  1YLF A;  3FZV A;  2QLZ A;  2HVR A;  1OR7 C;  3TED A;  2OA4 A;  2L5Q A;  3WTZ A;  3E0J B;  3P5J A;  4Y15 A;  1AKH B;  1JJ6 C;  3DEU A;  5B3S H;  2FQ3 A;  1GXP A;  3E6D A;  1ZG1 A;  3CJR B;  4JX4 A;  2Y9Z A;  2Q0O A;  1R5I D;  3D5L A;  1ITY A;  3KLN A;  2A68 F;  4BH9 A;  4IOC F;  4RGX A;  1IDZ A;  1ZR4 A;  2QCO A;  1TNS A;  1HQC A;  1I3Q J;  2KP6 A;  3CCE I;  1TBX A;  3BTI A;  3HXL A;  2ECB A;  1WGX A;  3AFH A;  3E5Q A;  3K4C A;  1NK2 P;  2EFO A;  1HST A;  1EKE A;  2DJI A;  2JRT A;  3SQN A;  2CH0 A;  2BY0 A;  4RB3 C;  4FTH A;  3B6A A;  3QP5 A;  5JVG F;  1LDD A;  2FRH A;  3ZR8 X;  1OYY A;  1P6R A;  1QZZ A;  2XGC A;  1XMX A;  3GTL J;  4KNY A;  1N78 A;  2CS3 A;  5CJ9 A;  2J5P A;  3PM1 A;  4R1H A;  1H0M A;  1ZR2 A;  1ETW A;  4RB2 C;  4IHS A;  2IS6 A;  3I71 A;  2CYY A;  2X1D A;  3RPU D;  3C3W A;  3R0J A;  2XB0 X;  4GYI A;  2VPL A;  3WHB A;  5JHF A;  1JJ8 C;  5BNG A;  2OF7 A;  1WJB A;  4M9X A;  5LD2 C;  3ZMZ A;  2MD5 A;  4UVB A;  1ZAO A;  1D0Z A;  3S32 A;  5E18 F;  1Y39 A;  1VQ5 I;  2K9S A;  1IXC A;  1X1D A;  3ASN H;  5IYB J;  3BG6 A;  3RDI A;  3ZQQ A;  1V5F A;  1D1A A;  5HDK A;  3CCV I;  4EJO A;  4B48 A;  5E8I A;  1TW2 A;  1B9M A;  2DA6 A;  2Z5U A;  3BTL A;  2Q8K A;  1Z21 A;  3W2W A;  2GQQ A;  4II2 A;  2HYF A;  3BT9 A;  2M30 A;  3UNG C;  2HOA A;  2LF7 A;  4UB8 C;  2JA5 J;  2M87 A;  1CF7 B;  4L18 B;  2V6E A;  2EFQ A;  1WI9 A;  2PJR B;  3OIO A;  3NQO A;  4XIC A;  2V9V A;  1TQM A;  4Y4R A;  3ZGK A;  2CRG A;  1V3F A;  1J0R A;  4BAC A;  3JRH A;  2PMZ N;  1TT5 B;  4DIQ A;  3ML6 A;  4B1R A;  2UXX A;  5HS8 A;  1IRF A;  1LDK B;  1SAU A;  1WZ2 A;  2XIG A;  2VXZ A;  4IVN A;  2HWV A;  5ERI A;  5E3M A;  5FRO A;  2XAU A;  1SEU A;  1D5Y A;  3CUQ A;  2B7E A;  3EYY A;  4LLG F;  1R22 A;  2L7M P;  4LMY A;  3CCS I;  2EIM H;  3KP4 A;  1P4A A;  2X85 A;  1O7L A;  3IL2 A;  2M8E A;  3S17 J;  1I27 A;  4PUS A;  4F91 B;  2DMQ A;  5CLS A;  3IH2 A;  2QA4 I;  4A3K J;  3HBL A;  1FZP B;  2ZSH B;  1T39 A;  5HLH A;  1OYI A;  1RET A;  3DKX A;  2IBD A;  3QYF A;  1DPR A;  4BJ6 C;  2KL4 A;  2VQL A;  2XVC A;  2VUM J;  2HGC A;  2Y31 A;  1N77 A;  3DV8 A;  2Q2E B;  3MQ0 A;  4QLC U;  3CDI A;  2NYX A;  2R7F A;  1KU9 A;  2KKO A;  2HXO A;  2Y48 A;  1TWH J;  4WXD A;  1SFX A;  2KJC A;  4CCM A;  5HNH A;  2E35 A;  4M3D A;  3JAM Z;  2R7U A;  5DS9 A;  4OWR B;  1KQ9 A;  1ODD A;  3MKZ A;  4KA4 A;  2FU4 A;  1D1B A;  4BJ5 C;  2G9W A;  4MEX F;  1VQM I;  1QVU A;  1FX7 A;  2MFZ A;  4A3G J;  2EK5 A;  1VQL I;  3ECO A;  4U87 A;  3S3O A;  2BYV E;  3DEW A;  1LDJ A;  4B47 A;  1G8X A;  2CFX A;  1WJC A;  3HOZ J;  3IRR A;  1XX5 A;  4IKF A;  1NH3 A;  1JXS A;  2K27 A;  3H9Q A;  3P9I A;  4PJM A;  3OS2 A;  3O8H A;  1QNT A;  4JX5 A;  1BOA A;  1X4O A;  3HM5 A;  4BE2 A;  1YHQ I;  5JVT A;  2OAZ A;  1FYK A;  1UAA A;  2LG4 A;  4I0A A;  2Y69 H;  2DMN A;  2WAQ A;  5EZG A;  1W7P A;  2XC7 A;  3VSK A;  3IKV A;  3G4S I;  3TQN A;  1ETQ A;  5DV5 A;  3TGN A;  2KRC A;  3VPR A;  4XON A;  2GXB A;  1VND A;  3B02 A;  3BWG A;  2PG4 A;  4NUB A;  4RLF A;  5M3F J;  5HOO A;  4I01 A;  4UNO A;  2NVT J;  3IH3 A;  4XLE A;  3MCZ A;  2B63 J;  1WJA A;  3HRT A;  2VN2 A;  2L9R A;  3BY6 A;  4I2O A;  1HKS A;  3JRF A;  4JX6 A;  4NBQ A;  1K61 A;  1U6G A;  2QF7 A;  1LJ9 A;  5HS9 A;  4EJT A;  2KQR A;  3LQR A;  2ELJ A;  5E79 C;  2PMH A;  1Y0N A;  1F1Z A;  1XDS A;  2F2E A;  3K6G A;  3CME I;  4KFC A;  1I1S A;  2BY2 A;  3RZO J;  1BR4 A;  2FBK A;  3O6B B;  5LEJ A;  3Q0W A;  3MAJ A;  1E3P A;  2Y2Z A;  4AIH A;  1WHU A;  2FUG 2;  1IC8 A;  1MJB A;  2BV6 A;  4O6J A;  2NXN B;  2W7N A;  3GZ5 A;  2HU9 A;  5CVU A;  3CZ6 A;  3ABK H;  2BHZ A;  4IQ4 A;  2OUM A;  2P5L C;  3REO A;  1PUE E;  3RKY A;  1STZ A;  2V1D A;  2CGP A;  3BCA A;  2EIL H;  4IL6 C;  3RTR A;  2W48 A;  2QQB A;  5B66 C;  2KIU A;  2EQR A;  5TIS C;  1U5T C;  1YE9 A;  1FOX A;  1S8N A;  1U5T B;  1OLT A;  2A5Y B;  3B6C A;  3LFK A;  1RNL A;  1JKP C;  3MZY A;  2Y30 A;  1K6Y A;  2JN6 A;  3M4O J;  2XB5 A;  3VB2 A;  2Y9Y A;  3ZP5 A;  4C2M J;  3LSP A;  2VKE A;  4YEL A;  1UMQ A;  5LGN A;  1SMY F;  4JK1 X;  3L2C A;  5DYM A;  4A69 C;  4EEF G;  4LG3 A;  4HPQ A;  1QPI A;  2NAZ A;  1RES A;  3QPS A;  2TDX A;  1HKQ A;  2D1H A;  3RKX A;  3LMM A;  4XK4 A;  4DJA A;  4D7N A;  5H2F C;  1UZC A;  2MLG A;  1O3Q A;  3CES A;  1HW2 A;  2E2I J;  4CUG A;  3KYC B;  3DKY A;  3ZQI A;  2CUE A;  1U0J A;  2ISY A;  2W24 A;  4L5J A;  1E0E A;  3S2D J;  4IHW A;  1Y56 A;  3BZ6 A;  4G6D A;  5FGM A;  3W6V A;  3R0A A;  4B3A A;  1FIP A;  2XAQ A;  5F04 A;  1SD6 A;  4MEY F;  4EM1 A;  1LVA A;  4FX4 A;  4A3J J;  4L0Z B;  2PI0 A;  2NS0 A;  3JTH A;  2FJ1 A;  1BJA A;  3ONQ A;  3TOA A;  2YPR A;  4HW0 A;  5BOX A;  1X3W B;  5AIQ A;  1WH5 A;  1F43 A;  4GYG A;  2JTV A;  3GYH X;  1VI0 A;  3FM3 A;  2QBY B;  4OIR F;  5CQE A;  1PJR A;  1D3Y A;  1HSJ A;  1YQA A;  2EA2 A;  5D8K B;  3NWT A;  3HSF A;  2JWT A;  1ZRF A;  2E1O A;  3C1D A;  4G7O F;  2STT A;  4YIR X;  3H92 A;  3C7J A;  4BKX A;  3WTW C;  2AO9 A;  3GTQ J;  3GF2 A;  4BE1 A;  5IP9 J;  3C18 A;  2K3P A;  5K7Z A;  1HW5 A;  3IUO A;  2WB1 N;  4JQF A;  3PNV A;  1S7A A;  3VOD A;  1TL8 A;  4MTD A;  1ZAR A;  3K4N A;  4M9S A;  1R49 A;  4KT6 A;  2WC2 A;  3ZMT A;  2PQ8 A;  1OR7 A;  3BR0 A;  2ZME B;  1F5T A;  2H27 A;  1AKH A;  4I98 B;  2XKP A;  2L0K A;  4XKC A;  5KCM A;  5FO5 A;  1BIB A;  1Y0U A;  4BXX J;  4RDU A;  3H9G A;  1LNW A;  1U78 A;  5FJ8 J;  3QAH A;  1KU3 A;  2E19 A;  3FK6 A;  4IHT A;  1QZY A;  3S3N A;  1ETY A;  3ESW B;  3VDX A;  2H09 A;  5LGT A;  2DJN A;  1BR2 A;  2V1U A;  1LEA A;  5FFZ A;  2IEK A;  2OPT A;  3WGH A;  2K7L A;  2CW7 A;  4ZYE A;  3DEE A;  4AVZ A;  5DUK A;  3L00 A;  1R5H A;  1LE8 B;  1MMN A;  4KN4 X;  3CO7 C;  1ON1 A;  4GFB A;  2DQL A;  2K4J A;  2R7S A;  3MD2 A;  1WH7 A;  1DP3 A;  4GDF A;  1F36 A;  4JP0 A;  3HOU J;  4OAY A;  1ETX A;  3CF5 F;  3FIS A;  1AHD P;  2DMP A;  4NC8 A;  1YS7 A;  2PMZ A;  3T5X A;  1QA6 A;  5E20 A;  2YU3 A;  3LSR A;  2L3D A;  3FXM A;  2EZL A;  1Z3Y A;  3MN2 A;  3JAM K;  2ICW G;  5J1U A;  4AM3 A;  2E60 A;  2LY1 A;  2XUB A;  1MJ9 A;  3RJP A;  2RNJ A;  3V4G A;  4CCN A;  5B5E C;  4BQA A;  5HVQ C;  1SFU A;  4IRI A;  3I64 A;  4L5I A;  1R4M B;  3LSK A;  3CCQ I;  1K83 J;  4AIJ A;  1G59 A;  1BN5 A;  2MH9 A;  1JT6 A;  2ZFW A;  2L4M A;  4GO1 A;  2HI3 A;  3G3Z A;  4HRI A;  3OL4 A;  1PUF B;  2F5C A;  1IN7 A;  3H5R A;  1SFE A;  4KN7 X;  3RSN A;  4XLC A;  3A0B C;  1MH3 A;  4BEH A;  4UHT A;  2KHM A;  2DA3 A;  1ZH5 A;  4G94 A;  3A01 A;  3DCF A;  1OYW A;  4E7S A;  1OIS A;  2GOX B;  5EJC A;  1GXQ A;  3CJQ B;  1BIA A;  3TBI A;  4A0Y A;  1CF7 A;  2E1M C;  2DA1 A;  2XGD A;  1ZRC A;  2F5F A;  1PDN C;  3L2W A;  2E1N A;  3ZN0 A;  4UVC A;  1X3Z B;  2NNY A;  3F8B A;  1O4X A;  2E7X A;  1IG7 A;  1ERD A;  3BDD A;  4O5V A;  4MNU A;  1G4D A;  3SXY A;  3GFI A;  4PJ0 C;  1P4W A;  3AG3 H;  1T98 A;  3AG1 H;  3P9K A;  1DPU A;  3WOD F;  3S16 J;  2V79 A;  3QOP A;  3JR9 A;  2L9N A;  5CKT A;  3OMY A;  3SEZ A;  4IOA F;  2HDC A;  3HOX J;  2VB6 A;  1G3Y A;  1UFM A;  1YO5 C;  4EM0 B;  4P55 A;  1IF1 A;  3M3Y J;  1FWZ A;  3GME A;  2JA7 J;  3KE2 A;  4OIQ F;  3TP3 A;  3BZK A;  2KJB A;  5ICC A;  3HOV J;  3NRV A;  3T1B A;  1FBU A;  3OYD A;  5ILU A;  2F5E A;  2BVM A;  2LBF B;  1X1P A;  4B4C A;  3HL2 A;  2LLK A;  2P8T A;  2RNG A;  2GXG A;  2Q2E A;  1IRZ A;  1KA8 A;  5E1Z B;  3DPT A;  1SFK A;  2CSO A;  1HDD C;  2NNN A;  2VXD A;  1IW7 F;  2HKX A;  2IGK A;  1B1B A;  1G3T A;  3GFL A;  3QOE A;  3RQ4 A;  1XSD A;  3FX3 A;  3R60 A;  4PSX A;  1TQP A;  3GFJ A;  5GAH J;  1LPQ A;  3BR5 A;  2M1B A;  2DPD A;  2WTE A;  2ZKZ A;  1WJ5 A;  4OOI A;  3QQA A;  1ONV A;  3E7L A;  2HQ5 A;  2HVQ A;  4RBO A;  1UCR A;  1RKT A;  5JI6 A;  1BJZ A;  3FXK A;  1IXR C;  2F6C A;  4C3I J;  3GTK J;  4A3D J;  4HYE A;  4OIN F;  3ZQH A;  4Q4Z F;  1A5J A;  5JLX A;  5KHD A;  4ESB A;  3PFY A;  2MA3 A;  4RM2 A;  1Q1V A;  2HR3 A;  1FEX A;  4M74 A;  2W84 A;  3M9A A;  4U0Y A;  1VQ4 I;  1YW9 A;  2O61 A;  2E2J J;  4HV5 A;  3D1N I;  2VT3 A;  1QHH D;  1FIA A;  1XGS A;  1E3O C;  4KIB A;  2CUJ A;  1YW8 A;  4ANJ A;  3DU6 A;  4PJJ A;  2LSO A;  3WE3 A;  2DTR A;  5GPA A;  4DW6 A;  1N75 A;  2ZXH A;  3VSL A;  4ITV A;  2PBI A;  5K5O A;  3F0C A;  1YYV A;  4BY7 J;  2XAJ A;  4XRM A;  5J8C A;  1YTY A;  1FP1 D;  2BBY A;  4IO9 F;  3EYI A;  2DFE A;  3OYK A;  2Q1Z B;  3GBG A;  4BDZ A;  3P9C A;  5IY5 H;  5J8F A;  3OYN A;  3LSM A;  3GX4 X;  2LFB A;  4L5E A;  3DU5 A;  4IHV A;  2DT5 A;  1A6Q A;  1EH6 A;  3TO9 A;  5D4S A;  3OYG A;  2IAI A;  3J7Y J;  4LG0 B;  1F9N A;  3K0L A;  1X19 A;  3KPH A;  1G3W A;  2K40 A;  2K02 A;  1MMA A;  4CHU A;  2X1C A;  2V1X A;  1YJN I;  5CVI A;  2QUF A;  2H1K A;  1GVD A;  4P9U A;  3HB9 A;  2D45 A;  1F4K A;  4BXF A;  1BI3 A;  2MYS A;  2LR8 A;  5ILV A;  2OZ6 A;  3LQQ A;  4XLF A;  4UUS B;  3L2U A;  1KON A;  4AIK A;  3ABT A;  3HSE A;  5AIP A;  1U5T A;  1HOM A;  2XHK A;  4E7K A;  1T56 A;  3FXO A;  3EUH A;  3IRQ A;  4XL9 A;  4HX8 A;  2VAS A;  3I59 B;  4KMF A;  5GAG J;  3MZH A;  2EPF A;  4RM3 A;  2CW8 A;  2K4B A;  1BL0 A;  1SVL A;  3OIP A;  3AKZ A;  1A31 A;  1I39 A;  3NWS A;  2IA2 A;  3E1S A;  2WB1 A;  2V9P A;  2FOK A;  1OCP A;  2ZJP F;  3WTS C;  2DK5 A;  3BRO A;  2R5Z B;  2EJR A;  2CU7 A;  3RZD J;  2ZJR F;  2F5D A;  2VE8 A;  1IXS B;  5FKL A;  3HKZ N;  2NVX J;  1PP7 U;  5A2Q K;  4EJU A;  2L9V A;  4FCY A;  1LQ1 A;  5EGO B;  1J5Y A;  4KMU X;  4PCQ A;  3RQI A;  1D1C A;  1B4A A;  1Z77 A;  1O57 A;  1OPC A;  2BE5 F;  2KPM A;  3FKJ A;  3JRG A;  2JVH A;  4U7B A;  2P5K A;  3N97 A;  3K2A A;  1T2K A;  3W6J B;  4FHT A;  4IHX A;  2JA2 A;  1R4N B;  1SVM A;  4M6V A;  3FXL A;  2M45 A;  4XSX F;  5H6Q A;  2R7O A;  4RAG A;  4EAT A;  5J6X A;  2WV0 A;  4A93 J;  3K1N A;  4MGR A;  2ZXW H;  3RKW A;  1J09 A;  5E3O A;  2IW5 A;  1TP4 A;  3H5N A;  3KIO A;  4XN0 A;  2JVG A;  1WSU A;  1HF0 A;  2HDW A;  2O5R A;  2JPB A;  1MZB A;  4KIG A;  1SFO J;  3WTV C;  1Z6T A;  3O3K A;  3OYB A;  3QPT A;  2LRD A;  2ZB9 A;  3HIF A;  1QBJ A;  1IN5 A;  4E7L A;  3BQY A;  3K1M A;  4M6Y A;  1A04 A;  1XSX A;  1R7J A;  4HSR A;  3VOE A;  2JMW A;  2VIX A;  3X2Q H;  2ACJ A;  2ZME A;  1MBG A;  3KP3 A;  2MBF A;  2ZBK A;  1R5G A;  3IP4 B;  4MFD A;  2PX9 A;  4UUT A;  2M8G X;  4WK8 F;  1AU7 A;  1ULY A;  3FK7 A;  3HUG B;  4N0B A;  1B8I A;  2R7Z J;  2VQC A;  1U8R A;  1HLV A;  3H5A A;  2ETH A;  3HOT A;  4XLP F;  3CDL A;  1XG1 A;  4Y13 A;  3KZZ A;  3FXU A;  3J7A O;  3E6B A;  5ICE A;  1TC3 C;  4MLO A;  2LF8 A;  1D0X A;  3I54 A;  1CQT A;  3ERE D;  2VON A;  2EIN H;  2VI6 A;  4XNF A;  2FBH A;  3FIW A;  1LE8 A;  3SHF A;  2V9K A;  5E3N A;  1YS6 A;  3S1R J;  4DZP A;  2ZCW A;  1GLN A;  2EH3 A;  2KRF A;  5GP9 A;  3V7R A;  4YRV A;  2IT0 A;  3DP7 A;  2CMP A;  3SDB A;  4A12 A;  4DYC A;  3GTG J;  2LYC A;  4KUM A;  2AXL A;  5D6E A;  3BCB A;  1ZGJ A;  2FF4 A;  1P7J A;  4HF1 A;  5F64 A;  2JRM A;  2IPQ X;  3ROU A;  3K1P A;  2BY1 A;  2IA0 A;  3BJO A;  1TQI A;  4XLA A;  4M3B A;  3COA C;  1XGO A;  4ZDL A;  2BVL A;  3FHZ A;  3DLA A;  4YIF A;  4DBR A;  3WHC A;  4PJL A;  1RRJ A;  4RS8 A;  2PMU A;  1ON2 A;  2DMT A;  3CCU I;  4XQF A;  2CW0 F;  2ECC A;  4B44 A;  1FBS A;  2Y0S N;  3MWM A;  2HPI A;  4A3F J;  1PUF A;  3K70 C;  2L9S A;  5M3M J;  3K70 D;  3EQL F;  3WE2 A;  3PQJ A;  1ZLJ A;  1IV6 A;  1MSE C;  1LKX A;  2Z2S B;  4I99 C;  3CC4 I;  2B0L A;  5J3L A;  1HW1 A;  2R5Y B;  1ZGW A;  1O3S A;  2W00 A;  1IO2 A;  3OWT A;  4E6K G;  2K9N A;  1W0T A;  3G2B A;  1Y1W J;  3HZJ A;  1EJ9 A;  2KT0 A;  2E7W A;  4RMN A;  1JKQ C;  2P7C B;  3V42 A;  3BG5 A;  4WXH A;  2VBY A;  3B73 A;  2HKO A;  1S6L A;  3ZQG A;  1DU6 A;  1FOW A;  3FXR A;  1FY7 A;  2Z3Y A;  4OMY A;  4RAF A;  4ZYH A;  3J7Z I;  4CCJ A;  2X6O A;  4Y33 A;  3I5U A;  2PFB A;  1GV2 A;  4AYB N;  2CV2 A;  2DT6 A;  4AID A;  1S5L C;  3GZN B;  2LD5 A;  2H8R A;  1T95 A;  3PUF A;  2FOW A;  1RR7 A;  2FSW A;  2IVM A;  3CCL I;  1MMG A;  4IHY A;  2KDZ A;  1ZGA A;  2R7T A;  5CVJ A;  2JZY A;  3BJ6 A;  2FD5 A;  2HQN A;  2H6C A;  4ZDO A;  2K85 A;  3J7A Y;  3CCJ I;  3OSG A;  1QRY A;  1Z7L A;  2QSF X;  4FAS D;  2FNA A;  3JRB A;  3OYA A;  2FMY A;  2LBF A;  4LD5 A;  2OJE D;  3HSR A;  1R58 A;  3SEQ A;  1BC8 C;  2EWN A;  3L2V A;  2KRH A;  3E6M A;  1J2X A;  2QKM B;  1O3T A;  1JGS A;  4HNV A;  5HLG A;  4IRH A;  1FYM A;  3OYE A;  2L54 A;  3F21 A;  4F92 B;  1UHS A;  2O9L A;  2DDB A;  4BU2 A;  4D7M A;  2R4G A;  2DU9 A;  3WTT C;  1FBQ A;  1P4X A;  4P5O A;  3PO2 J;  3PQK A;  2UV1 A;  3HOY J;  2HTJ A;  4X0G A;  2QSH X;  4E7Z A;  1BI0 A;  5FLX K;  1JT0 A;  3U2R A;  2M4K A;  3ZPL A;  1ZHF A;  3HPG A;  4S0H B;  2M5W A;  4YEJ A;  2XAG A;  4UVA A;  1FMW A;  3R6S A;  1SC7 A;  2YX7 A;  4RB0 A;  1LFB A;  4M3F A;  4MIM A;  1XC5 A;  5CVR A;  1WJE A;  2IJL A;  2EV5 A;  5KAF C;  3K69 A;  4WXC A;  1O7F A;  3CCM I;  2OD5 A;  2OC6 A;  4PZJ A;  5LRR A;  3JRE A;  2KLO A;  2A3S A;  2CQX A;  3SFZ A;  3TO6 A;  3LST A;  2I5U A;  3OR1 C;  4C9Y A;  1JGG A;  3I0T A;  1HC8 A;  1TT0 A;  2L01 A;  4G8X A;  3I56 I;  3AL0 C;  4XRS A;  5EYR A;  3AL0 B;  4E4H A;  1D5V A;  3L2R A;  1ZEL A;  3S93 A;  4KIF A;  4CCO A;  1JHH A;  1ZRD A;  4V19 K;  1RKW A;  1OMI A;  3VYS B;  4HF2 A;  1X1A A;  3CJN A;  2Z1D A;  5DM7 F;  1T8I A;  1K78 A;  1MGT A;  3LA2 A;  3OS1 A;  2XKO A;  2VT2 A;  3VWB A;  3CCR I;  1O3R A;  2VKD A;  1R36 A;  4L9T A;  1HDP A;  2X9D A;  3FF5 A;  1QHG A;  5AON A;  2XPW A;  1QU3 A;  2R7D A;  2RV8 A;  3C2H A;  1OKR A;  3GWZ A;  2EA4 A;  2X0L A;  2CQN A;  3LOC A;  5M5Y J;  1VQ8 I;  1UG0 A;  2D2W A;  2R7R A;  1QO0 D;  3BPV A;  3S2H J;  5BMZ A;  2P0W A;  1Z1D A;  3VYT B;  3E97 A;  5HLT A;  3RI4 A;  3HKZ A;  3ZQF A;  3FDY A;  2K9Q A;  3IAM 2;  5FKM A;  4LG0 A;  2RQQ A;  2A6T A;  1V54 H;  5KAI C;  2A6H F;  4XR6 A;  2R7W A;  1K6O A;  1Y6I A;  3HRU A;  3QP6 A;  2P81 A;  3TDZ C;  4UXN A;  1S7E A;  3OYJ A;  4M72 A;  2AHQ A;  2IGM A;  1TTY A;  2AS5 F;  6PAX A;  4E70 A;  4OU0 A;  4WF2 A;  4XLH A;  3IV5 A;  3FMS A;  1G2H A;  4UUS A;  2JUG A;  2QQA A;  3KP7 A;  1TW3 A;  1UG2 A;  3DPL C;  3F22 A;  5LBQ A;  2JSP A;  4CZZ A;  5JLW A;  5JFR A;  2XF5 A;  5D5W B;  3DKW A;  3I59 A;  3OYM A;  1XTA A;  3KEQ A;  1WI3 A;  4XM3 A;  5DM6 F;  1OCT C;  1Y8R B;  3DTE A;  5M5X J;  2DCE A;  2VC0 A;  2W57 A;  2NVY J;  2P6T A;  1P2F A;  2JA6 J;  2R93 J;  2LY9 A;  3DQV C;  2R5Z A;  3KZI C;  2ELK A;  3BR2 A;  1T33 A;  5CYV A;  3W2A A;  4W97 A;  5J47 A;  4QIW N;  5F6F A;  5EGO A;  2O6G E;  2YU9 J;  4JBA A;  4CGZ A;  3CLO A;  2WY8 Q;  4HAM A;  3V7S A;  4KIC A;  2O03 A;  1R1V A;  4J00 A;  1YJ9 I;  2HEO A;  2HQR A;  1JTX A;  1WKM A;  5BPI A;  1FJL A;  3HTS B;  4ZJZ A;  1MNE A;  2DA7 A;  2GAU A;  5LHI A;  5KVR A;  3OOP A;  4CA0 A;  1WVR A;  2EFP A;  2F4O B;  3M1C A;  2LKS A;  2HOT A;  5BQT A;  3ZMU A;  5L3E A;  3Q0V A;  2MC3 A;  3EUA A;  2H94 A;  1MND A;  3FMQ A;  2ZJ2 A;  2VJJ A;  2BOL A;  2ME6 A;  1MDM B;  2DI3 A;  4A0X A;  5D5V B;  1SD4 A;  2M7B A;  4QPQ A;  4IJA A;  4HLX A;  4RLQ A;  4DOZ A;  3OY9 A;  5E1X A;  1FSH A;  1NG6 A;  5FKN A;  4CCL A;  1TNT A;  2QVO A;  3PFI A;  3JRI A;  3KZY A;  2BY3 A;  3IKT A;  2DYR H;  2V6C A;  4BBR J;  1HKT A;  5EDN A;  1T0F C;  5LFA A;  2QZ8 A;  1MBJ A;  4IEJ A;  1MIJ A;  5F27 A;  3GLX A;  2BHY A;  2MW8 A;  3BC8 A;  5A2Q Z;  1WQ2 A;  4GGG A;  2X6X A;  1TWC J;  4PFO A;  1X2N A;  2KIQ A;  2RKH A;  2Y0S A;  4EQQ A;  1I3A A;  5DCF A;  5GPC A;  3CD6 I;  3QRF F;  3RPU A;  3FWE A;  2XAH A;  5GAE J;  5ICF A;  1RPW A;  1APL C;  3S1M J;  3MKW B;  1X4P A;  2EZK A;  2VJ4 A;  4NC7 A;  2TCT A;  4ESJ A;  2HOE A;  2OQG A;  3SDG A;  3T8T A;  2WY7 Q;  5D5U B;  1KGS A;  3ZQ7 A;  2NOJ B;  5J40 A;  4BXU A;  2EFW A;  1OFC X;  5L3B A;  3L2Q A;  1XB4 A;  3O8G A;  4XKW A;  3EUK L;  4ZDP A;  3OYL A;  3OOU A;  1BA5 A;  1OQY A;  4S04 A;  2IP2 A;  2K86 A;  4ENM A;  1VQ9 I;  1EH7 A;  3JRC A;  4HDV A;  1YI2 I;  1EH8 A;  2W82 A;  1QGP A;  2IGN A;  4RGR A;  2IGO A;  3FMR A;  4D9J A;  3ECH A;  3J80 Z;  3ASO H;  5F0C A;  2ZXJ A;  1I50 J;  1FTZ A;  2PJR A;  1X3U A;  2E1M B;  3QOD A;  3QPL A;  4AYB A;  4HA8 A;  4HNU A;  2CUF A;  5F0F A;  3FKI J;  3CQZ J;  2W4S A;  2NRA C;  5IP6 A;  4M73 A;  4EMS A;  3OS0 A;  5DEQ A;  2FBI A;  2GIZ A;  3CUQ C;  3I3L A;  4C2T A;  5FFX A;  2DBB A;  2GA2 A;  3BTC A;  3CUQ B;  4N9I A;  3H36 A;  4QWQ A;  1H89 C;  3IC7 A;  3V8K A;  2G0E A;  5F1R A;  1N25 A;  1FC3 A;  3PSI A;  4DBQ A;  3Q3S A;  1W0U A;  1L0O C;  1KQ0 A;  2GZW A;  3FM5 A;  1HBX G;  2R5Y A;  1XS9 A;  3HTU A;  3CDH A;  4FE4 A;  3ZOB A;  4A3E J;  2WWY A;  2VPR A;  3PSF A;  3LSH A;  5FB2 A;  4CXF A;  1LFU P;  3KLO A;  3RCO A;  1MKM A;  1GV5 A;  2GIV A;  3PO3 J;  1RUO A;  3HHH A;  2O7O A;  3NAU A;  1YG2 A;  3HRM A;  4S05 A;  3UKG A;  2R92 J;  1R71 A;  2V1N A;  4GRI A;  4M9Z A;  2CV0 A;  4PGG A;  3HYI A;  1L3L A;  2DFI A;  1Q1H A;  4R79 A;  2LNB A;  3RPQ A;  2FML A;  4BQO A;  1GT0 C;  9ANT A;  3DXJ F;  3ZRG A;  5DCM B;  3H3U A;  3H0G J;  2FQ4 A;  4XN3 A;  5FLM J;  1XD7 A;  3RYR A;  2LK2 A;  3T0Y A;  2D1V A;  3DBH B;  4FE7 A;  4I6Z A;  3S1N J;  5EEA A;  4C30 A;  3BR3 A;  4C2U A;  3AG4 H;  5BPD A;  4IRG A;  3U21 A;  3KEO A;  4HX7 A;  1VQP I;  3FHN A;  3TO7 A;  2JA8 J;  3TL4 X;  3S15 J;  1R1U A;  4WCG A;  5DTD A;  4CDG A;  1B59 A;  4XRS G;  3GO5 A;  4ABZ A;  2L7Z A;  3K4L A;  3ISP A;  1J7K A;  4KJZ A;  2VBZ A;  2MG4 A;  1VQ7 I;  4AD9 A;  3M1E A;  2E71 A;  3K9T A;  3I4M J;  4CSW A;  2ZSI B;  2L02 A;  2LC2 A;  1W7P D;  2OBP A;  1W7P B;  4CYD A;  2I10 A;  4U7D A;  1T6S A;  1UST A;  1R1T A;  1YW7 A;  2K9M A;  3M8F A;  2VJ5 A;  4XMY A;  5EG0 B;  2DA4 A;  4IPA A;  4A5M A;  3WG9 A;  1HA8 A;  5J4Y A;  1RZ4 A;  1MJA A;  3WTU C;  2RDP A;  1SVO A;  2JT1 A;  4HEA 2;  1MBF A;  2ID6 A;  3BJA A;  1ZN2 A;  3LSI A;  1BOB A;  4CYC B;  2XGE A;  4ESF A;  4G12 A;  3A1Y A;  4B3X A;  4DGW B;  3BZC A;  3CCY A;  3H35 A;  3HEF A;  1A35 A;  1ZTR A;  4N9H A;  3CMA I;  1WWX A;  3OR2 C;  2DOF A;  2FXA A;  3GW2 A;  4A6D A;  1DDN A;  1BI2 A;  1RI7 A;  3KYD B;  4AUX A;  4KDP A;  2LMD A;  2Z99 A;  4ZYD A;  2Z9O A;  1XGN A;  1QVT A;  2K5C A;  4IQJ A;  1LFP A;  4LB5 A;  4L9V A;  2CWE A;  3WU1 B;  1S7O A;  3TKY A;  1XCB A;  1WRJ A;  4I09 A;  3SZT A;  1EA3 A;  1V5G A;  2BW3 B;  1KZH A;  4NQW B;  1IN4 A;  3M8J A;  1B72 B;  3C2G A;  2QM3 A;  2LDU A;  4XKB A;  2F4M B;  1USS A;  4V2G A;  2IS2 A;  4OMZ A;  3DPU A;  1E2X A;  4MFE A;  2M0C A;  3LAJ A;  2Z33 A;  2EIK H;  4E7I A;  4IXA A;  4BBS J;  3LFU A;  3TDU C;  2R7V A;  2QGU A;  3WU0 A;  1MMS A;  1Y8Q B;  5FLX Z;  3M8E A;  3WG7 H;  2QSG X;  4HG2 A;  1H88 C;  3ULQ B;  2HTS A;  4U0V A;  3GLL A;  4A6E A;  4BS9 A;  3BG9 A;  3KEY A;  2ZO4 A;  5FRM A;  1QPM A;  4II3 A;  3IAS 2;  3OYH A;  4D0P A;  1Z3X A;  3EPZ A;  4BYY A;  1YJW I;  4ZZL A;  3S1Q J;  5IYD J;  5DDG A;  3H9J A;  1I5Z A;  1NHA A;  1FLI A;  1G6N A;  2COM A;  1V55 H;  4NC6 A;  4A3B J;  3CO6 C;  3G1M A;  3DWL E;  3WGI A;  3I4N J;  1U9N A;  4LGW A;  5IP7 J;  1JI8 A;  2ID3 A;  1IUF A;  1Z6R A;  4Y3O A;  1W1W E;  2UZK A;  1NG7 A;  1J9I A;  4HDU A;  4CO8 A;  2MGQ A;  3DLL F;  1FOY A;  2DQR A;  4L9N A;  2X48 A;  3F6V A;  2ADU A;  5B1A H;  2OCE A;  4JOM A;  2BZT A;  2I8D A;  1OCC H;  4CIC A;  2A5W A;  4FQG A;  4XSZ F;  1OCR H;  4F3Q A;  2VLA A;  3HRS A;  2FNP A;  5HNF A;  1SAN A;  1XDU A;  5D5X B;  2MH2 A;  3KFW X;  2O3F A;  1K4S A;  2MAB A;  5KNL A;  2QBY A;  5ICG A;  1I1G A;  1JUS A;  2Z16 A;  2AQE A;  3K4K A;  1P7I A;  1JE8 A;  2DAO A;  3QU6 A;  4D5F A;  3MMY B;  2WV1 A;  5JR3 A;  3N05 A;  3J81 Z;  2CUZ A;  1FT9 A;  2CG4 A;  2TRT A;  3I4P A;  3J80 K;  2HQA A;  3A4C A;  5F08 A;  4E7J A;  4BGD A;  1XCV A;  2LRE A;  2RN7 A;  2DA2 A;  5CVV A;  3JRA A;  1WCM J;  3RKQ A;  3P7N A;  2DW4 A;  3ZMD A;  2CQQ A;  2GOM A;  4P96 A;  4I7H A;  2X6W A;  3F23 A;  2HVS A;  1Z7U A;  2J5O A;  5LGU A;  3PIP F;  4LOC A;  1V5E A;  1TWG J;  2M0M A;  3S8P A;  4U0W A;  1R00 A;  4UV9 A;  3CTA A;  2QQ8 A;  3BTJ A;  5IYC J;  3V7C A;  1ZYR F;  5HLI A;  2M34 A;  2EZH A;  5GTI C;  1ZG5 A;  1VQN I;  2DO7 A;  4TV7 A;  3C2B A;  1VFC A;  3F8M A;  1MDM A;  2KIS A;  2A07 F;  3BPX A;  1W5C C;  2XPV A;  4DYR A;  1K7A A;  1J59 A;  1C0W A;  4U88 A;  2E5N A;  2XRL A;  1BI1 A;  2QQ9 A;  5C44 J;  3HHG A;  3S14 J;  1DUX C;  3NEU A;  1S9H A;  1YIJ I;  4XLN F;  1MD0 A;  3CMM A;  4HQE A;  3TW7 A;  4NB5 A;  3GEZ A;  1S3J A;  3ABL H;  4YFK F;  1U3E M;  1T0F A;  4NNJ A;  2H8W A;  4B09 A;  1PVE A;  3KET A;  2XAF A;  1VTN C;  1QQI A;  3U1D A;  5J1Y A;  2RVC A;  3H1C A;  1GUU A;  1T08 B;  2BEO A;  1AWC A;  3CUO A;  3DBL B;  3LL7 A;  1FPQ A;  4HF0 A;  3N4M A;  1DU0 A;  4OIP F;  1J75 A;  1X2M A;  1XMK A;  2OU2 A;  5J4V A;  1LVK A;  4RAY A;  2GLO A;  2CV1 A;  4M71 A;  2P6S A;  1IV8 A;  1TWF J;  5DD4 A;  2MSY A;  2EFN A;  4MQ9 F;  2HS5 A;  4UV8 A;  4BEH B;  1WJF A;  3FXQ A;  3A01 B;  1X58 A;  4G6Q A;  2VQG A;  2GBY A;  3HPH A;  2DPU A;  3MEX A;  3QPH A;  1SMT A;  3S3M A;  4GXO A;  4DYQ A;  2XF6 A;  3F9K A;  3QU3 A;  1MH4 A;  4BAY A;  1IN8 A;  3LAP A;  1XPX A;  3DFG A;  1K79 A;  2ISZ A;  2DOA A;  4BJT A;  3HDD A;  3BG3 A;  4HX4 A;  2ESN A;  1U8B A;  2A05 A;  1ZRE A;  4WX9 A;  2DTZ A;  5LHH A;  4EJW A;  2A69 F;  4LFU A;  3EET A;  4X6A J;  1IAW A;  1IRG A;  3A02 A;  4ZYG A;  2JK3 A;  4EVI A;  2UXN A;  1OCO H;  3TOB A;  4XID A;  1VF9 A;  1SD5 A;  1JKR C;  2DK8 A;  1MW7 A;  1MNM C;  4LIT A;  1GDT A;  4OIO F;  3R4K A;  4KIT B;  2IRF G;  2EIJ H;  5M5W J;  3L09 A;  3SFI A;  1ZQ3 P;  3UR3 C;  4ZTF A;  3K4M A;  3I53 A;  4HV6 A;  3WTX C;  2RQP A;  1MBK A;  2CQK A;  4X1E A;  1V4R A;  3HOS A;  3OV8 A;  3PJR A;  4ENK A;  3H0D A;  4QPO A;  2N8G A;  4BQQ A;  1WFX A;  4CZC A;  2FA5 A;  2CJJ A;  3K4B A;  5L3G A;  4HQM A;  1X1B A;  1MSF C;  5DCM A;  1YRN B;  2HFH A;  5JHU A;  4WWC A;  4YFX F;  3NAR A;  4IF4 A;  1XMA A;  3E3V A;  2DOD A;  2P5V A;  2Y0M A;  3WTY C;  3VYR B;  1OJL A;  2WA0 A;  3ABU A;  2OTJ I;  2F48 A;  5ED4 A;  3F6O A;  4YFN F;  2L7K A;  4I02 A;  1ORK A;  2P7V B;  5LEK A;  2KZG A;  2O0Y A;  5EF6 A;  2VBX A;  2L4A A;  1T38 A;  1UEL B;  1W5T A;  5L3C A;  3ELK A;  3I58 A;  1FP2 A;  4LB6 B;  2OQR A;  4BHB A;  3JCU C;  5DD8 A;  3WGG A;  2IA1 A;  3L9F A;  4HNT A;  2QWW A;  2NS8 A;  3KX2 A;  4P1W A;  3SZG A;  5EG0 A;  4ENJ A;  2WBM A;  1FOK A;  3BQZ A;  1P9Q C;  2B9S A;  1LB2 A;  2HPM A;  1JUP A;  3CF2 A;  3L7W A;  5E17 F;  2R7Q A;  5EEG A;  2O8K A;  2JSC A;  4Q48 A;  1WJD A;  5IT9 K;  4LJZ F;  2FX0 A;  4CYC A;  2DN0 A;  3KP6 A;  4IZZ A;  2QEX I;  1BR1 A;  2YUS A;  1DGR M;  4HZF A;  3ZQL A;  4AVP A;  1OCZ H;  1RR8 C;  5D6F A;  3H3V K;  3OSF A;  4PJN A;  4QSH A;  2H1L A;  4XBF A;  1JKO C;  3TP0 A;  1RIO H;  4J01 A;  1BW6 A;  1DGW Y;  3OL3 A;  4I76 A;  3S2W A;  4UY8 I;  3SJM A;  1D8J A;  2PLY A;  2MD0 A;  3M07 A;  2MC4 A;  3JSP A;  3T8R A;  5K7F A;  3J81 K;  5H6R A;  4KIS A;  2KMU A;  3GUD A;  3AAF A;  3Q9V A;  1U9O A;  1H8A C;  3GTP J;  2HDD A;  2AXT C;  4RGU A;  3ZCO A;  5D4R A;  2WAD A;  1R23 A;  3VFZ A;  4BY1 J;  2JPC A;  5F1J A;  1HCR A;  1U2W A;  3HOW J;  1I6H J;  2IS1 A;  3E6C C;  2XV4 S;  4EM2 A;  4LLN A;  2ME0 A;  5IPA A;  5C3E J;  4D1Q A;  5HDN A;  2BW3 A;  4Z2Y A;  4NQW A;  3F8N A;  1B72 A;  2O8X A;  4LK0 F;  3ZMS A;  4YG2 F;  2XSD C;  1D8K A;  2K9L A;  4ZYA A;  5FLV A;  3EUH C;  3LSG A;  5K7H A;  1FTT A;  3PNT A;  4BHC A;  4M3E A;  2CO5 A;  1XN7 A;  4NHJ A;  2LH9 A;  1Z67 A;  2VC1 A;  3CP8 A;  4MO7 A;  3OYI A;  4H0E A;  5E8G A;  1ZLK A;  1I6X A;  1Z0X A;  1RC9 A;  2V26 A;  4L9J A;  3A03 A;  4Y17 A;  1NTC A;  3MZ8 A;  4MHG A;  2R0Q C;  2DA5 A;  2D5V A;  4KYW A;  2ZC2 A;  3ABM H;  1BM9 A;  3W3C A;  1VZ0 A;  4BHP A;  3ZMV A;  1FYL A;  5C4X J;  4LIU A;  1REP C;  3BR1 A;  1KYW A;  1ZK8 A;  3DTI A;  4GCV A;  2LVS A;  2H6B A;  1HXD A;  1E17 A;  3VEP A;  3R61 A;  4XOT A;  4DNC A;  4CH7 A;  3MKY B;  1TWA J;  2F4I A;  1M1E B;  4IX7 A;  1CGP A;  2DT7 B;  2XRN A;  4J19 A;  5B1B H;  4PGH A;  2OCC H;  4JYK A;  1G3S A;  1FSE A;  2QEN A;  3A2K A;  1E3H A;  2NVQ J;  2DFH A;  2VOD A;  2DYS H;  4HOB A;  1YOV B;  3G1O A;  5TRD A;  4H4K C;  1H9T A;  2KZV A;  3QYB A;  4XOR A;  4A3M J;  4LK1 F;  2LY2 A;  4RB1 A;  3F8F A;  4PDK A;  4A5N A;  4B43 A;  4HLY A;  2MLK A;  4EGZ A;  3BOQ A;  3HG9 A;  4FET A;  2GA1 A;  4YII A;  5FD5 A;  4AC0 A;  4Y7N J;  4BQN A;  3MFK A;  2LKX A;  1W36 C;  4N4N B;  3FBN B;  3U1K A;  1W36 D;  2DFF A;  4M6X A;  3IH4 A;  2ZME C;  3DBR B;  5HS7 A;  4BNC A;  4ZTJ A;  4Y52 J;  2VE9 A;  2OZU A;  4Z6Y A;  5IOY A;  3DTK A;  4XOP A;  1PYV A;  1A36 A;  4L0Y B;  2BGC A;  5TJJ A;  3OYF A;  1RUN A;  2OTL I;  2IS4 A;  3GFM A;  4F7Z A;  2OV7 A;  5FD6 A;  3TMO A;  3TW6 A;  1B8I B;  4M3G A;  3MKL A;  1ACI A;  2ELH A;  5H20 A;  2VJI A;  3HUG A;  4AWX B;  4K2E A;  1YX3 A;  3ZXS A;  3K10 A;  1SD7 A;  3GVA A;  2E1C A;  4FX0 A;  2JQ7 A;  3CMY A;  2W1O A;  5EZH A;  2NVU B;  3M7G A;  2R3S A;  2YSR A;  3ERM A;  2DDA A;  3K4J A;  3F3X A;  2DMU A;  2XSJ C;  1VQO I;  4A2U A;  2X4H A;  4F52 A;  5CPR B;  2XAS A;  2HXI A;  3KYL A;  2DOE A;  2ZFU A;  3E5U A;  3GXO A;  4C3J J;  4F55 A;  5L3F A;  3ZQC A;  2VOP A;  3RIR A;  2DXI A;  4A0Z A;  4BDY A;  2V7F A;  1IZ1 A;  1FMV A;  3IWZ A;  1EF4 A;  4ASN A;  2GM4 A;  1JTY A;  2ZNZ A;  2BXY A;  4DZJ A;  1XSV A;  4G9Y A;  2HOS A;  1EV7 A;  2XGX A;  4ENN A;  3W2V A;  3HGG A;  2XPU A;  3WU2 C;  4G6T B;  3SYT A;  1YX5 A;  4EGY A;  1DP7 P;  1VQK I;  3PL8 A;  4ON0 A;  5EEH A;  4I0B A;  2M7A A;  5LHG A;  2G7H A;  3JTG A;  1GHC A;  2STW A;  4UUV A;  5FRN A;  4Q5S F;  1TZL A;  1IN6 A;  2X1E A;  3K2Z A;  2L2O A;  5TGT A;  1YIT I;  4PSW A;  4RAZ A;  2UWM A;  1YFH A;  2X51 A;  3U9G A;  2EB7 A;  4G7H F;  3SZP A;  3OIQ A;  5K5R A;  3MVP A;  1AA7 A;  2DLL A;  2R7X A;  1IDY A;  1QZE A;  2FE3 A;  2M3A A;  4A3L J;  5C4J J;  5FKK A;  2E2H J;  3JSO A; 
#chains in the Genus database with same CATH homology
 1FNN A;  3KP5 A;  1UHM A;  3JW4 A;  4Q47 A;  2QYO A;  4ZH4 F;  2W25 A;  1XGM A;  4R8H A;  1LEB A;  1UHW A;  5LLQ A;  3H3Z A;  1Z05 A;  3KCC A;  4RGS A;  2KIM A;  3V8L A;  3RYP A;  4B8X A;  2A61 A;  4P9F A;  3EDP A;  2HZT A;  2XRO A;  1AOY A;  1BBY A;  4FT8 A;  3Q5F A;  5ILS A;  1P92 A;  2C6Y A;  1KU2 A;  1W4M A;  1S29 A;  1Z9C A;  3BP8 A;  2W85 A;  3LA7 A;  4HBL A;  3LA3 A;  2G7U A;  5E1W A;  1TLH B;  3F72 A;  5K1Y A;  5LRS A;  4KT5 C;  2RGV A;  1KYZ A;  3LWF A;  3KP2 A;  3O2P E;  1K78 B;  4G7Z F;  2ESH A;  2PJP A;  1KU7 A;  2GWR A;  2YX4 A;  3V8J A;  2HYG D;  2ZNY A;  1BC7 C;  3IWF A;  5BS6 A;  2PEX A;  2VOO A;  3GZ6 A;  3Q9S A;  3F8C A;  4O3M A;  5DUI A;  2LKP A;  4XRF A;  3DF8 A;  5K5Q A;  3D0S A;  2Y75 A;  2EV0 A;  1B9N A;  1UB9 A;  1JHF A;  2YR2 A;  3W6K B;  5D8L B;  4EV0 A;  1Z91 A;  3IHU A;  3ZN1 A;  2EV6 A;  1PP8 F;  4EJV A;  1H9G A;  3E5X A;  2VBW A;  1SAX A;  1GVJ A;  5HDG A;  1ZG3 A;  1W5S A;  4ZZD A;  2PN6 A;  4MTE A;  5IT9 Z;  5L3D A;  1B6A A;  2KIF A;  1IUY A;  5IT3 A;  2RC4 A;  1KQ8 A;  5KK1 A;  2FEZ A;  3G73 A;  2P4W A;  1YIO A;  4MQV A;  4LLL A;  2A6E F;  4DQ2 A;  4ETS A;  1YLF A;  3FZV A;  2QLZ A;  2OA4 A;  3WTZ A;  4Y15 A;  3DEU A;  2FQ3 A;  1GXP A;  3E6D A;  1ZG1 A;  2Q0O A;  3D5L A;  3KLN A;  2A68 F;  4BH9 A;  4RGX A;  1TNS A;  1HQC A;  1TBX A;  3E5Q A;  2EFO A;  1HST A;  2JRT A;  3SQN A;  4RB3 C;  3QP5 A;  1LDD A;  2FRH A;  1OYY A;  1P6R A;  1QZZ A;  4KNY A;  5CJ9 A;  2J5P A;  4R1H A;  1H0M A;  4RB2 C;  4IHS A;  3I71 A;  2CYY A;  3C3W A;  3R0J A;  4GYI A;  4M9X A;  3ZMZ A;  2MD5 A;  4UVB A;  1ZAO A;  5E18 F;  1IXC A;  3RDI A;  5HDK A;  4EJO A;  5E8I A;  1TW2 A;  1B9M A;  2Z5U A;  2Q8K A;  2GQQ A;  2HYF A;  2M30 A;  2LF7 A;  2M87 A;  1CF7 B;  4L18 B;  2EFQ A;  1WI9 A;  3NQO A;  2V9V A;  1TQM A;  1V3F A;  1J0R A;  3ML6 A;  2UXX A;  5HS8 A;  1IRF A;  1LDK B;  2XIG A;  2VXZ A;  4IVN A;  2HWV A;  5ERI A;  3CUQ A;  3EYY A;  4LLG F;  1R22 A;  4LMY A;  3KP4 A;  1P4A A;  1O7L A;  3IL2 A;  2M8E A;  1I27 A;  5CLS A;  1FZP B;  1T39 A;  5HLH A;  1OYI A;  1DPR A;  2XVC A;  2HGC A;  3DV8 A;  4QLC U;  3MQ0 A;  2NYX A;  2R7F A;  1KU9 A;  2KKO A;  2Y48 A;  4WXD A;  1SFX A;  2KJC A;  3JAM Z;  1KQ9 A;  1ODD A;  4KA4 A;  2FU4 A;  2G9W A;  4MEX F;  1FX7 A;  2EK5 A;  3ECO A;  2BYV E;  1LDJ A;  2CFX A;  3IRR A;  1JXS A;  2K27 A;  3P9I A;  1QNT A;  1BOA A;  5JVT A;  2OAZ A;  1FYK A;  4I0A A;  1W7P A;  3IKV A;  3TQN A;  5DV5 A;  3TGN A;  2GXB A;  3B02 A;  3BWG A;  2PG4 A;  4UNO A;  5HOO A;  4I01 A;  3MCZ A;  3HRT A;  2VN2 A;  3BY6 A;  4I2O A;  1HKS A;  1U6G A;  1LJ9 A;  5HS9 A;  4EJT A;  3LQR A;  2PMH A;  2F2E A;  1F1Z A;  1XDS A;  4KFC A;  1I1S A;  2FBK A;  3O6B B;  5LEJ A;  3MAJ A;  4AIH A;  1MJB A;  2BV6 A;  4O6J A;  3GZ5 A;  5CVU A;  2P5L C;  3REO A;  1PUE E;  3RKY A;  1STZ A;  2V1D A;  2CGP A;  3RTR A;  2QQB A;  2KIU A;  1U5T C;  1S8N A;  1U5T B;  2A5Y B;  3LFK A;  1RNL A;  3MZY A;  3VB2 A;  3ZP5 A;  5LGN A;  1SMY F;  4JK1 X;  3L2C A;  5DYM A;  2NAZ A;  2TDX A;  1HKQ A;  2D1H A;  3RKX A;  2MLG A;  1O3Q A;  1HW2 A;  2ISY A;  2W24 A;  4L5J A;  3BZ6 A;  4G6D A;  5FGM A;  3R0A A;  2XAQ A;  1SD6 A;  4MEY F;  4EM1 A;  1LVA A;  4FX4 A;  4L0Z B;  2PI0 A;  2NS0 A;  3JTH A;  1BJA A;  3TOA A;  2YPR A;  4HW0 A;  5BOX A;  5AIQ A;  4GYG A;  2JTV A;  3GYH X;  3FM3 A;  2QBY B;  4OIR F;  1D3Y A;  1HSJ A;  1YQA A;  2EA2 A;  5D8K B;  3HSF A;  1ZRF A;  3C1D A;  4G7O F;  2STT A;  3H92 A;  3C7J A;  3WTW C;  3GF2 A;  3C18 A;  1HW5 A;  4JQF A;  1S7A A;  3VOD A;  4MTD A;  1ZAR A;  4M9S A;  2WC2 A;  3ZMT A;  2PQ8 A;  1OR7 A;  2ZME B;  1F5T A;  2H27 A;  4I98 B;  2XKP A;  5FO5 A;  1BIB A;  1Y0U A;  1LNW A;  1U78 A;  3QAH A;  1KU3 A;  4IHT A;  1QZY A;  2H09 A;  5LGT A;  2V1U A;  1LEA A;  5FFZ A;  3WGH A;  2K7L A;  4ZYE A;  5DUK A;  3L00 A;  1R5H A;  4KN4 X;  3CO7 C;  1ON1 A;  2DQL A;  2K4J A;  1YS7 A;  3T5X A;  5E20 A;  2YU3 A;  2L3D A;  3JAM K;  2XUB A;  1MJ9 A;  3RJP A;  2RNJ A;  3V4G A;  4BQA A;  5HVQ C;  1SFU A;  4IRI A;  3I64 A;  4L5I A;  4AIJ A;  1BN5 A;  2MH9 A;  2ZFW A;  2L4M A;  4GO1 A;  3G3Z A;  2F5C A;  1IN7 A;  1SFE A;  4KN7 X;  4UHT A;  1ZH5 A;  4G94 A;  1OYW A;  4A0Y A;  1GXQ A;  1CF7 A;  1BIA A;  1ZRC A;  2F5F A;  1PDN C;  2E1N A;  3ZN0 A;  4UVC A;  2NNY A;  3F8B A;  2E7X A;  3BDD A;  4O5V A;  4MNU A;  1G4D A;  3SXY A;  3GFI A;  1P4W A;  1T98 A;  3P9K A;  1DPU A;  3WOD F;  2V79 A;  3QOP A;  2HDC A;  1G3Y A;  1UFM A;  1YO5 C;  4EM0 B;  4P55 A;  1IF1 A;  1FWZ A;  3KE2 A;  4OIQ F;  2KJB A;  5ICC A;  3NRV A;  3T1B A;  1FBU A;  5ILU A;  2F5E A;  2P8T A;  2GXG A;  2Q2E A;  1KA8 A;  5E1Z B;  3DPT A;  2CSO A;  2NNN A;  1IW7 F;  2HKX A;  1B1B A;  1G3T A;  3GFL A;  1XSD A;  3FX3 A;  3R60 A;  1TQP A;  3GFJ A;  2M1B A;  2DPD A;  2WTE A;  2ZKZ A;  4OOI A;  1ONV A;  1UCR A;  5JI6 A;  1IXR C;  4HYE A;  4OIN F;  4Q4Z F;  4ESB A;  2MA3 A;  2HR3 A;  4M74 A;  2W84 A;  3M9A A;  4U0Y A;  1YW9 A;  2O61 A;  4HV5 A;  2VT3 A;  1XGS A;  4KIB A;  1YW8 A;  2LSO A;  3WE3 A;  2DTR A;  2PBI A;  5K5O A;  1YYV A;  2XAJ A;  5J8C A;  1YTY A;  1FP1 D;  2BBY A;  3EYI A;  3P9C A;  5J8F A;  3GX4 X;  2DT5 A;  1EH6 A;  3TO9 A;  5D4S A;  4LG0 B;  1F9N A;  3K0L A;  1G3W A;  2K02 A;  4CHU A;  2V1X A;  5CVI A;  2QUF A;  4P9U A;  2D45 A;  1F4K A;  1BI3 A;  5ILV A;  2OZ6 A;  3LQQ A;  4AIK A;  3ABT A;  3HSE A;  5AIP A;  1U5T A;  2XHK A;  3EUH A;  3IRQ A;  4HX8 A;  3I59 B;  4KMF A;  3MZH A;  2K4B A;  2IA2 A;  2FOK A;  3WTS C;  2DK5 A;  3BRO A;  2EJR A;  2F5D A;  2VE8 A;  1IXS B;  1PP7 U;  5A2Q K;  4EJU A;  1LQ1 A;  1J5Y A;  4KMU X;  4PCQ A;  1B4A A;  1O57 A;  1OPC A;  2BE5 F;  4U7B A;  2P5K A;  3N97 A;  1T2K A;  3W6J B;  4FHT A;  2M45 A;  4XSX F;  5H6Q A;  5J6X A;  2WV0 A;  3K1N A;  4MGR A;  3RKW A;  2IW5 A;  1WSU A;  2JPB A;  1MZB A;  4KIG A;  3WTV C;  1Z6T A;  3O3K A;  3QPT A;  3HIF A;  1QBJ A;  1IN5 A;  3K1M A;  4M6Y A;  1A04 A;  1XSX A;  1R7J A;  3VOE A;  2ACJ A;  2ZME A;  3KP3 A;  2MBF A;  2ZBK A;  1R5G A;  4WK8 F;  1ULY A;  4N0B A;  1U8R A;  2ETH A;  3HOT A;  4XLP F;  4Y13 A;  3KZZ A;  3FXU A;  3J7A O;  3E6B A;  5ICE A;  2LF8 A;  3I54 A;  3ERE D;  2VON A;  2FBH A;  3SHF A;  1YS6 A;  2ZCW A;  2KRF A;  3V7R A;  2IT0 A;  3DP7 A;  4A12 A;  4KUM A;  2AXL A;  5D6E A;  1ZGJ A;  2FF4 A;  4HF1 A;  5F64 A;  2IPQ X;  3ROU A;  3K1P A;  2IA0 A;  3BJO A;  1TQI A;  3COA C;  1XGO A;  3FHZ A;  4YIF A;  4RS8 A;  2PMU A;  1ON2 A;  2CW0 F;  1FBS A;  3MWM A;  3EQL F;  3WE2 A;  3PQJ A;  1ZLJ A;  2B0L A;  1HW1 A;  1O3S A;  2E7W A;  2P7C B;  4WXH A;  2VBY A;  3B73 A;  2HKO A;  1S6L A;  3FXR A;  1FY7 A;  2Z3Y A;  4OMY A;  4ZYH A;  3I5U A;  2PFB A;  2FSW A;  2IVM A;  1ZGA A;  5CVJ A;  2JZY A;  3BJ6 A;  2HQN A;  2H6C A;  2FNA A;  2FMY A;  4LD5 A;  3HSR A;  1R58 A;  1BC8 C;  2EWN A;  3E6M A;  1J2X A;  1O3T A;  1JGS A;  5HLG A;  4IRH A;  1FYM A;  2L54 A;  3F21 A;  2DU9 A;  3WTT C;  1FBQ A;  1P4X A;  4P5O A;  3PQK A;  2HTJ A;  5FLX K;  1BI0 A;  3U2R A;  3ZPL A;  1ZHF A;  2M5W A;  2XAG A;  4UVA A;  3R6S A;  2YX7 A;  4RB0 A;  5CVR A;  2IJL A;  2EV5 A;  3K69 A;  4WXC A;  1O7F A;  2OD5 A;  4PZJ A;  5LRR A;  2A3S A;  3SFZ A;  3TO6 A;  3LST A;  3I0T A;  2L01 A;  4G8X A;  1D5V A;  4KIF A;  1JHH A;  1ZRD A;  1OMI A;  4HF2 A;  3CJN A;  1K78 A;  1MGT A;  3LA2 A;  2XKO A;  2VT2 A;  1O3R A;  1R36 A;  4L9T A;  3FF5 A;  5AON A;  2R7D A;  2RV8 A;  1OKR A;  3GWZ A;  2EA4 A;  2X0L A;  2D2W A;  1QO0 D;  3BPV A;  5BMZ A;  1Z1D A;  3E97 A;  3RI4 A;  4LG0 A;  2A6H F;  1K6O A;  3HRU A;  3QP6 A;  3TDZ C;  4UXN A;  4M72 A;  1TTY A;  2AS5 F;  6PAX A;  4E70 A;  4OU0 A;  4WF2 A;  3FMS A;  2QQA A;  3KP7 A;  1TW3 A;  3DPL C;  3F22 A;  5LBQ A;  4CZZ A;  5JFR A;  5D5W B;  3DKW A;  3I59 A;  3KEQ A;  2VC0 A;  2W57 A;  2P6T A;  1P2F A;  3DQV C;  5CYV A;  5F6F A;  2O6G E;  4JBA A;  4CGZ A;  3CLO A;  4HAM A;  3V7S A;  4KIC A;  2O03 A;  1R1V A;  2HEO A;  2HQR A;  1WKM A;  5BPI A;  3HTS B;  2GAU A;  5LHI A;  5KVR A;  3OOP A;  2EFP A;  5BQT A;  3ZMU A;  5L3E A;  2MC3 A;  2H94 A;  3FMQ A;  2ZJ2 A;  1MDM B;  2DI3 A;  4A0X A;  5D5V B;  1SD4 A;  4IJA A;  4HLX A;  5E1X A;  1FSH A;  1TNT A;  2QVO A;  3PFI A;  3KZY A;  3IKT A;  2V6C A;  1HKT A;  2QZ8 A;  3GLX A;  5A2Q Z;  1WQ2 A;  4GGG A;  2RKH A;  4EQQ A;  5DCF A;  3QRF F;  3RPU A;  3FWE A;  2XAH A;  5ICF A;  4ESJ A;  2HOE A;  2OQG A;  3T8T A;  5D5U B;  1KGS A;  3ZQ7 A;  4BXU A;  2EFW A;  5L3B A;  1XB4 A;  4S04 A;  2IP2 A;  2K86 A;  4ENM A;  1EH7 A;  4HDV A;  1EH8 A;  1QGP A;  4RGR A;  3FMR A;  3ECH A;  3J80 Z;  2ZXJ A;  1X3U A;  4HA8 A;  2NRA C;  4M73 A;  4EMS A;  5DEQ A;  2FBI A;  3CUQ C;  5FFX A;  2DBB A;  2GA2 A;  3CUQ B;  4N9I A;  4QWQ A;  3IC7 A;  3V8K A;  5F1R A;  1FC3 A;  1L0O C;  1KQ0 A;  2GZW A;  3FM5 A;  1HBX G;  3HTU A;  3CDH A;  2WWY A;  5FB2 A;  4CXF A;  3KLO A;  1MKM A;  2GIV A;  1RUO A;  3HHH A;  1YG2 A;  3HRM A;  4S05 A;  4M9Z A;  4PGG A;  3HYI A;  1L3L A;  2DFI A;  1Q1H A;  4R79 A;  2LNB A;  3RPQ A;  2FML A;  3DXJ F;  5DCM B;  3H3U A;  1XD7 A;  3RYR A;  3T0Y A;  2D1V A;  5BPD A;  4IRG A;  3KEO A;  4HX7 A;  3TO7 A;  1R1U A;  4WCG A;  4CDG A;  1B59 A;  3GO5 A;  3ISP A;  1J7K A;  2VBZ A;  4AD9 A;  3M1E A;  3K9T A;  2L02 A;  2OBP A;  1W7P D;  1W7P B;  4CYD A;  4U7D A;  1T6S A;  1UST A;  1R1T A;  1YW7 A;  3M8F A;  4IPA A;  4A5M A;  3WG9 A;  1RZ4 A;  1MJA A;  3WTU C;  2RDP A;  2JT1 A;  3BJA A;  1ZN2 A;  4ESF A;  4N9H A;  1WWX A;  2FXA A;  3GW2 A;  4A6D A;  1DDN A;  1BI2 A;  1RI7 A;  4KDP A;  2Z99 A;  4ZYD A;  2Z9O A;  1XGN A;  4LB5 A;  4L9V A;  2CWE A;  3WU1 B;  1S7O A;  3TKY A;  1XCB A;  1WRJ A;  4I09 A;  3SZT A;  1IN4 A;  2QM3 A;  2LDU A;  1USS A;  4OMZ A;  1E2X A;  3LAJ A;  2Z33 A;  4IXA A;  3TDU C;  3WU0 A;  5FLX Z;  3M8E A;  3ULQ B;  2HTS A;  4U0V A;  4A6E A;  2ZO4 A;  1QPM A;  4D0P A;  4BYY A;  4ZZL A;  5DDG A;  1FLI A;  1I5Z A;  1NHA A;  1G6N A;  2COM A;  3CO6 C;  3WGI A;  4LGW A;  1Z6R A;  2UZK A;  1J9I A;  4HDU A;  4CO8 A;  2DQR A;  4L9N A;  3F6V A;  2ADU A;  4CIC A;  4XSZ F;  3HRS A;  2FNP A;  1XDU A;  5D5X B;  2MH2 A;  3KFW X;  2O3F A;  2QBY A;  5ICG A;  1I1G A;  1JE8 A;  2DAO A;  3QU6 A;  5JR3 A;  3J81 Z;  1FT9 A;  2CG4 A;  3I4P A;  3J80 K;  1XCV A;  2RN7 A;  5CVV A;  3P7N A;  2DW4 A;  3ZMD A;  4P96 A;  4I7H A;  3F23 A;  1Z7U A;  2J5O A;  5LGU A;  4U0W A;  1R00 A;  4UV9 A;  3CTA A;  3V7C A;  1ZYR F;  5HLI A;  1ZG5 A;  2DO7 A;  4TV7 A;  1MDM A;  3F8M A;  2A07 F;  3BPX A;  1K7A A;  1J59 A;  1C0W A;  4U88 A;  1BI1 A;  2QQ9 A;  3HHG A;  1DUX C;  3NEU A;  4XLN F;  1MD0 A;  4HQE A;  4NB5 A;  3GEZ A;  1S3J A;  4YFK F;  1U3E M;  1T0F A;  4B09 A;  3KET A;  2XAF A;  1VTN C;  1QQI A;  3U1D A;  2RVC A;  2BEO A;  1AWC A;  3CUO A;  1FPQ A;  4HF0 A;  3N4M A;  4OIP F;  1J75 A;  1XMK A;  2OU2 A;  4RAY A;  4M71 A;  2P6S A;  5DD4 A;  2EFN A;  4MQ9 F;  2HS5 A;  4UV8 A;  3FXQ A;  4G6Q A;  2DPU A;  3MEX A;  3QPH A;  1SMT A;  4GXO A;  3QU3 A;  4BAY A;  1IN8 A;  3LAP A;  3DFG A;  1K79 A;  2ISZ A;  4HX4 A;  2ESN A;  1ZRE A;  4WX9 A;  5LHH A;  4EJW A;  2A69 F;  4LFU A;  3EET A;  1IAW A;  1IRG A;  4ZYG A;  4EVI A;  2UXN A;  3TOB A;  1SD5 A;  2DK8 A;  4OIO F;  3R4K A;  2IRF G;  3L09 A;  3I53 A;  4HV6 A;  3WTX C;  2RQP A;  2CQK A;  1V4R A;  3HOS A;  3OV8 A;  4ENK A;  2FA5 A;  5L3G A;  4HQM A;  5DCM A;  2HFH A;  5JHU A;  4WWC A;  4YFX F;  4IF4 A;  1XMA A;  3E3V A;  2P5V A;  2Y0M A;  3WTY C;  3ABU A;  5ED4 A;  3F6O A;  4YFN F;  4I02 A;  2P7V B;  5LEK A;  2O0Y A;  2VBX A;  2L4A A;  1T38 A;  1W5T A;  5L3C A;  3ELK A;  3I58 A;  1FP2 A;  4BHB A;  2OQR A;  4LB6 B;  5DD8 A;  3WGG A;  2IA1 A;  3L9F A;  2QWW A;  4ENJ A;  1FOK A;  1LB2 A;  3L7W A;  5E17 F;  5EEG A;  2JSC A;  4Q48 A;  5IT9 K;  4LJZ F;  3KP6 A;  4HZF A;  4AVP A;  5D6F A;  4XBF A;  1RIO H;  3S2W A;  1D8J A;  2PLY A;  3JSP A;  3T8R A;  3J81 K;  5H6R A;  3GUD A;  3AAF A;  3Q9V A;  4RGU A;  5D4R A;  1R23 A;  3VFZ A;  2JPC A;  1U2W A;  3E6C C;  2XV4 S;  4EM2 A;  4LLN A;  5HDN A;  4Z2Y A;  4NQW A;  3F8N A;  2O8X A;  4LK0 F;  3ZMS A;  4YG2 F;  1D8K A;  4BHC A;  2CO5 A;  1XN7 A;  4NHJ A;  2VC1 A;  4H0E A;  5E8G A;  1ZLK A;  1I6X A;  4L9J A;  4Y17 A;  4MHG A;  4KYW A;  1BM9 A;  4BHP A;  3ZMV A;  1FYL A;  1REP C;  1KYW A;  4GCV A;  2H6B A;  1HXD A;  1E17 A;  3VEP A;  3R61 A;  4DNC A;  1CGP A;  2XRN A;  4PGH A;  1G3S A;  1FSE A;  2QEN A;  2VOD A;  4HOB A;  5TRD A;  1H9T A;  4LK1 F;  4RB1 A;  3F8F A;  4PDK A;  4A5N A;  4HLY A;  2MLK A;  4EGZ A;  3BOQ A;  2GA1 A;  4YII A;  5FD5 A;  3MFK A;  4M6X A;  4BNC A;  5HS7 A;  2VE9 A;  2OZU A;  4L0Y B;  2BGC A;  5TJJ A;  1RUN A;  3GFM A;  4F7Z A;  5FD6 A;  2ELH A;  5H20 A;  3HUG A;  4AWX B;  4K2E A;  1SD7 A;  3GVA A;  2E1C A;  4FX0 A;  3M7G A;  2R3S A;  2YSR A;  3F3X A;  4A2U A;  2X4H A;  2XAS A;  5L3F A;  3E5U A;  3GXO A;  2VOP A;  3RIR A;  4A0Z A;  1IZ1 A;  3IWZ A;  4ASN A;  2ZNZ A;  1XSV A;  4G9Y A;  1EV7 A;  2XGX A;  4ENN A;  4EGY A;  1DP7 P;  4ON0 A;  5EEH A;  4I0B A;  5LHG A;  2G7H A;  3JTG A;  1GHC A;  2STW A;  4UUV A;  4Q5S F;  1IN6 A;  3K2Z A;  4RAZ A;  2UWM A;  1YFH A;  3U9G A;  2EB7 A;  4G7H F;  3SZP A;  5K5R A;  2DLL A;  2FE3 A;  3JSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...