2DQLA

Crystal structure of the circadian clock associated protein pex from anabaena
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
115
structure length
115
Chain Sequence
MKIEDIYQFFENPPPTYLCQEVAICYILYVLLQGESYGTELIQQLETEHPTYRLSDTVLYSAIKFLEDNRAITGYWKKLEGRGRPRRMYQVSPEWQHQAEDLARLWQNYIYVRTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functionally important structural elements of the cyanobacterial clock-related protein Pex.
pubmed doi rcsb
source organism Anabaena sp. pcc 7120
molecule tags Circadian clock protein
molecule keywords Pex protein
total genus 36
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dqlA00
1B4AA 3L9FA 4XSZF 2Q8KA 2JPCA 1UFMA 2VOPA 5IT9K 2XHKA 1ZAOA 4XLPF 1V3FA 1L0OC 3E5QA 4KIGA 5J6XA 2L54A 1K7AA 2PG4A 3ZMVA 3JTGA 4EMSA 2A69F 3F8BA 1JE8A 4ESFA 2UZKA 1F9NA 3GFLA 2NS0A 4OU0A 3KEOA 4P55A 1BIAA 5JHUA 2JSCA 4MEYF 4U7BA 1QO0D 5K5RA 1XGNA 1CF7B 1SD5A 3V8KA 2WC2A 3WODF 4LGWA 3I0TA 2STTA 3D5LA 3WU0A 2DLLA 3D0SA 3BROA 3P9CA 3O2PE 3J7AO 4YFKF 2UXXA 5HOOA 2L4AA 1BJAA 5JI6A 4BHBA 3LFKA 4HA8A 3K1MA 5D8KB 2L3DA 2OZ6A 4MQVA 3EYIA 1CGPA 1FPQA 2K27A 4U88A 2ESHA 2HKXA 5DUKA 1UHMA 4YIIA 4CICA 1Q1HA 4AIJA 1TLHB 3ELKA 2L01A 4A0XA 4HQEA 1ONVA 3KLNA 5DCFA 4E70A 1P4WA 1W4MA 3SZTA 4HF0A 3WTYC 5HLHA 5L3DA 1IN8A 1HQCA 1REPC 1XSXA 3LSTA 3C1DA 2O61A 4PCQA 1HKQA 1KQ9A 3L7WA 1YO5C 1DP7P 1W5TA 5DEQA 2GIVA 2E1NA 5H6RA 5LHIA 2HQNA 5F6FA 4FX0A 4Q5SF 3L09A 2GAUA 4OMZA 2BV6A 3HSFA 5LHGA 1FBUA 2EFPA 3E6CC 3RIRA 4HDVA 2KIFA 1K79A 4LB5A 4XSXF 3TDUC 3EYYA 4KIBA 4HZFA 1BM9A 3BPVA 4MQ9F 2CO5A 3J81Z 1EH6A 4ENMA 1R7JA 1MJBA 3QRFF 2D2WA 4XLNF 1YTYA 5ILUA 3F8NA 3JW4A 1O57A 1ZLKA 3L00A 5EEHA 3M1EA 5J8CA 2JPBA 4LK0F 3WTWC 1YW7A 3JAMK 2PFBA 2XAFA 1QZYA 3RPQA 1P6RA 4EJTA 1AOYA 2Z5UA 3ML6A 5BPDA 1DDNA 2DFIA 3JAMZ 1ZHFA 4Z2YA 3KP4A 4GXOA 5LEJA 4EV0A 1Z6RA 2GZWA 3GXOA 1LDKB 3GLXA 1QGPA 4ZZLA 4LLGF 5ILVA 1W7PB 5FD5A 2CFXA 1SD4A 4JBAA 5DCMB 5DYMA 4R8HA 3VODA 1HW2A 1YYVA 1KU9A 1ODDA 4ASNA 4M72A 2F5CA 1I1SA 3ZN0A 3BJOA 2QZ8A 1IZ1A 4EM2A 1KA8A 1FC3A 1IXCA 5HDGA 3T5XA 4BYYA 1T2KA 2OU2A 4ZZDA 2HGCA 4MNUA 5LHHA 3J80Z 1LEBA 2O0YA 1SFUA 2W84A 3HUGA 3FXRA 4EJVA 3IC7A 5K5QA 4HAMA 5L3CA 2XV4S 4LLNA 1FSEA 2ZMEA 1O3TA 3KZYA 1R58A 5H20A 4Q47A 3OOPA 4HBLA 4O6JA 3HOSA 4HX8A 2P5VA 2V1XA 3GO5A 4EQQA 2A61A 2E7WA 1G6NA 3R6SA 2XVCA 3MAJA 1TQPA 5DD4A 1Z1DA 2K4JA 2FU4A 3KP7A 1SD6A 1LB2A 3DP7A 2DTRA 3KLOA 1FYKA 1LDJA 1AWCA 2VT2A 4BHCA 2XROA 2ZJ2A 2PEXA 3B02A 1KU7A 3PFIA 2W24A 1FWZA 3WTZA 4ZYHA 3COAC 1I5ZA 4PZJA 3CO6C 3I58A 3I64A 4XRFA 3CTAA 2VBZA 2L02A 3MWMA 2ISZA 4HQMA 3F6VA 3GFMA 3F22A 2VBWA 2F5EA 4UV9A 3WTUC 1ON1A 2RKHA 2EFOA 4HOBA 1FBQA 4KIFA 6PAXA 5LGNA 3CLOA 2D45A 3WTSC 4M71A 1R5GA 2A5YB 1P4XA 2TDXA 2FBKA 1B59A 4YFXF 4IRGA 5FB2A 2IRFG 3SHFA 3MCZA 4Q4ZF 3RYRA 1WQ2A 2EFNA 3QU6A 4UVAA 4L0YB 4CYDA 4WK8F 1TQMA 2BBYA 2QVOA 1FP2A 1O7LA 3LAPA 1SMYF 5D5WB 2OD5A 1S3JA 1R00A 2QQ9A 3BDDA 4U0YA 2EJRA 1IF1A 1E17A 2RQPA 3IL2A 3G3ZA 2X0LA 3CJNA 1W5SA 3DF8A 2BEOA 2O3FA 3F21A 2RV8A 2YPRA 4OIPF 4RAZA 2DI3A 4I98B 1YS7A 1FYMA 1IAWA 1XB4A 2HS5A 2HEOA 1YIOA 3B73A 1ZG5A 1IN4A 3C3WA 4MTDA 1XSVA 3DPTA 1TBXA 5BPIA 1J0RA 1D8JA 3E5UA 4UUVA 2M45A 1GXPA 1YLFA 1FT9A 1XGOA 3V7SA 5K5OA 2QM3A 1T6SA 3O3KA 1FY7A 1IRGA 1RNLA 2FXAA 2Q2EA 4RGRA 4Y17A 4H0EA 3V8LA 2FF4A 3ABUA 1IN7A 5TRDA 5LEKA 4L5JA 1CF7A 3S2WA 1S6LA 3QPTA 4YG2F 4HF2A 2YX4A 1XN7A 3TOAA 3LA7A 3Q9SA 1J59A 1OKRA 1OYYA 3P9KA 3ZN1A 2DAOA 4RB3C 4G8XA 2IW5A 3EDPA 2VN2A 1R36A 3KCCA 3HIFA 2VONA 1GXQA 2K02A 2MBFA 1MD0A 2HR3A 3GUDA 5HDNA 4HX7A 3WU1B 3IRRA 4WWCA 3ZMUA 3E6DA 3V7RA 1R1UA 1ZGAA 1XDSA 1ZG1A 1RUOA 2V79A 1R22A 3W6JB 4P9FA 5LBQA 4BAYA 1ON2A 3F3XA 1XD7A 3M7GA 5L3BA 3CUQB 1WRJA 2NYXA 1YFHA 2YR2A 2RDPA 3FXQA 1WSUA 3HRSA 3TQNA 2OBPA 2MC3A 4FT8A 3SFZA 4L9TA 5HDKA 1ZLJA 2V6CA 1ULYA 1T39A 1BIBA 2ZXJA 5DCMA 3QAHA 3C18A 5ERIA 3IKVA 4IF4A 3M9AA 2JTVA 3E6MA 3QOPA 2Y75A 2V1DA 5E1WA 2CWEA 2K4BA 4UV8A 5L3FA 4LK1F 1T38A 2D1VA 3GZ6A 4EGYA 5D5XB 5KK1A 3ZQ7A 4RGSA 1EH7A 2ADUA 1UCRA 3I53A 4WX9A 2RN7A 2CSOA 5CLSA 2WTEA 4IVNA 4A6EA 2AXLA 1R23A 5D4SA 2GA1A 1LDDA 1FNNA 2LNBA 3K1PA 1KQ0A 4I2OA 4HV6A 1IRFA 2LSOA 1HXDA 1RI7A 1XCBA 3LQRA 3TO6A 4RB2C 3G73A 2M1BA 5E17F 2R7FA 3BOQA 4IXAA 3MQ0A 1G3WA 2FSWA 3GX4X 2FE3A 2EB7A 5D5VB 2IJLA 2Z3YA 1UB9A 3T8TA 2ZO4A 4N0BA 4A0ZA 3BWGA 1WI9A 1F1ZA 5DV5A 4CZZA 1BC7C 4B8XA 4BHPA 3RKXA 4YFNF 2A68F 4IHSA 4KA4A 2VOOA 3R0JA 3T8RA 1S7AA 5CVVA 2W85A 3E5XA 3LA2A 5LRSA 4QLCU 1STZA 3KP2A 4HX4A 3U2RA 2NNNA 4EM0B 3F8MA 2DPDA 1XSDA 4GCVA 2YSRA 2Y0MA 3E6BA 3ULQB 3WE2A 4P5OA 4N9HA 1HBXG 3ABTA 2PLYA 3H3ZA 3NRVA 5E8IA 2NRAC 1ZRFA 4ZYDA 4KT5C 5CYVA 5D8LB 4G94A 4DNCA 1KYWA 3KFWX 2HQRA 4K2EA 3M8EA 2OZUA 1B6AA 1RIOH 3KZZA 4KDPA 1MJAA 3TKYA 1U2WA 1HKSA 2CYYA 1DPRA 4KN4X 1O3SA 4HLXA 1G3SA 1USSA 2DU9A 5LGTA 3K69A 3VOEA 1XGSA 5JFRA 2IA2A 5F1RA 1K78B 5H6QA 5KVRA 4I0BA 4M73A 1BN5A 4WXCA 4IHTA 2EFQA 1GHCA 2ELHA 1I6XA 1ZARA 4UVCA 5ICEA 3I4PA 5FO5A 3WGHA 1ZN2A 1HSTA 2HZTA 2HOEA 3NQOA 1Z7UA 5K1YA 2COMA 3GW2A 1BI2A 3DPLC 3P9IA 3F23A 4RGUA 2J5OA 4ZYEA 2PJPA 5HS8A 2IA1A 1X3UA 2QBYB 1TQIA 4I0AA 3JTHA 3RI4A 1IUYA 3JSPA 2QYOA 4NHJA 1T0FA 4IRHA 4P9UA 2QQBA 1OR7A 3Q9VA 1K6OA 1USTA 3HTSB 3I71A 3AAFA 1OYIA 2HWVA 5FFXA 4L9JA 3KP3A 2EV6A 3EUHA 2JT1A 3VFZA 4OMYA 2GA2A 3I59A 2JRTA 2DT5A 1MDMA 2G9WA 5FFZA 3RYPA 2PBIA 2QQAA 2IP2A 2M30A 3BP8A 4GO1A 3M8FA 3BY6A 1J7KA 4PDKA 1W7PA 3KP6A 4ESBA 4G6QA 3RJPA 4A6DA 2HTJA 1B9MA 2EV5A 3IWFA 2W57A 2IA0A 4AIKA 4M9XA 2PI0A 4Q48A 4M6XA 3HRTA 2X4HA 5HVQC 3PQJA 4BH9A 2OA4A 3DQVC 3SQNA 1C0WA 1JHHA 4XBFA 3HHHA 3WTTC 4CHUA 3NEUA 4IJAA 2AS5F 3KEQA 5ICGA 4UVBA 5FD6A 2P4WA 2C6YA 1J2XA 4G6DA 1LNWA 2FMLA 3TOBA 4B09A 4GGGA 3HOTA 1RZ4A 4RAYA 1HW5A 2OQGA 2CG4A 3ZMDA 2K7LA 1JHFA 3FHZA 2DBBA 3P7NA 5CVUA 4A12A 2QWWA 5CVIA 3HRUA 3LQQA 2VC1A 2PQ8A 4UHTA 2MA3A 1PDNC 4LB6B 3MZHA 2FMYA 4U7DA 3FMRA 3N4MA 4ESJA 4LG0B 3CUOA 3R60A 1DPUA 3LA3A 3DV8A 4OIRF 2VT3A 3HTUA 3KP5A 3J81K 1O7FA 3WTXC 4L0ZB 4L9VA 1I27A 1H9GA 3ZMSA 2BYVE 2STWA 4LMYA 3PQKA 4EJWA 2FA5A 2PN6A 2F5FA 2LF8A 1SMTA 3DFGA 4JQFA 1LQ1A 2F2EA 2H27A 1JXSA 3W6KB 3VEPA 5E8GA 4G7HF 1H0MA 3BZ6A 1EH8A 1TNTA 2F5DA 4GYGA 4R79A 1QPMA 2MLKA 1S7OA 5IT9Z 1ZGJA 3V8JA 3WE3A 3FZVA 1XDUA 3VB2A 1PUEE 2R3SA 4RB1A 4EJUA 4G7ZF 1O3QA 2IPQX 2KIMA 3JSOA 3GYHX 1FYLA 4ZYGA 4KUMA 2DPUA 2XUBA 2IT0A 1ZRCA 1XMKA 3ECHA 3RPUA 3SXYA 4MHGA 1IXRC 1BI0A 3GWZA 3FX3A 2RVCA 3RKYA 1FZPB 2DK5A 1YW9A 2LKPA 5HLGA 2CQKA 5D6FA 1ZYRF 4MTEA 4EJOA 1J75A 4AD9A 2ZBKA 2FOKA 2GWRA 2QENA 2XAJA 1U5TC 2DQLA 2HFHA 2EFWA 2P5KA 5E1ZB 1WWXA 1JGSA 2XASA 2J5PA 5ILSA 4ENNA 1J5YA 1QQIA 1FBSA 1QNTA 3RDIA 2P7CB 2ZFWA 4IPAA 3QPHA 1S29A 3ROUA 1K78A 3CO7C 2Q0OA 3SZPA 4NB5A 3FWEA 2KJBA 4DQ2A 4PGGA 3FMSA 2XAHA 3GEZA 1U3EM 3U9GA 3FM3A 2P5LC 1U5TA 3V4GA 1XCVA 2QUFA 3HRMA 3BJAA 3GFIA 3WGIA 2VC0A 3DKWA 4KN7X 4EGZA 4IRIA 2BGCA 1SD7A 4LJZF 5F64A 1BI1A 2HKOA 1YS6A 1R5HA 5DUIA 2QBYA 4ENJA 3WGGA 4HW0A 1B1BA 3ZMZA 3MEXA 4M9SA 2VBYA 2KIUA 4RGXA 3T0YA 4RB0A 3RTRA 1G3YA 3REOA 3FXUA 2H6BA 2P7VB 1FSHA 4EVIA 1P2FA 1Y0UA 4JK1X 3IRQA 3ZP5A 3TO7A 1KGSA 1U6GA 4LLLA 3BPXA 4WCGA 3T1BA 3DEUA 2E1CA 1S8NA 4HV5A 1U8RA 5EEGA 1BOAA 4S04A 1B9NA 4CO8A 3CUQA 4GYIA 3F72A 2V1UA 1MDMB 3TO9A 2EA2A 5J8FA 3R4KA 4KYWA 2Z33A 1D3YA 2GXGA 2ZCWA 1KYZA 4KMUX 1OYWA 1KQ8A 1OPCA 3R61A 1TTYA 3IWZA 2MD5A 2H6CA 3TDZC 1Z6TA 2E7XA 1J9IA 5IT3A 2Z9OA 1MZBA 4O3MA 1SAXA 2EK5A 4CDGA 1EV7A 2Y48A 3F6OA 1MGTA 2DO7A 1O3RA 5BS6A 4YIFA 2V9VA 4LD5A 3ISPA 1SFXA 4FX4A 1FOKA 1VTNC 3MZYA 1FX7A 3QP5A 4L9NA 2XGXA 2ACJA 3K2ZA 2H09A 1BI3A 1V4RA 4UNOA 3FMQA 4S05A 2YX7A 3F8CA 4BNCA 2VE9A 5HS7A 4QWQA 5L3GA 4KMFA 4Y13A 1U5TB 2XIGA 2ZNZA 3HSEA 4EM1A 3QP6A 5AONA 4OIQF 2FNAA 1U78A 2DW4A 2XAGA 1LVAA 1ZRDA 3U1DA 4A5MA 1XMAA 1P4AA 5JVTA 2P8TA 3BJ6A 4BQAA 1T98A 1TNSA 3EETA 4A0YA 4Y15A 4ENKA 5E1XA 2HDCA 3WG9A 1ZREA 5FLXZ 2HYGD 2WWYA 1KU3A 2WV0A 3ZPLA 4P96A 3LWFA 2VODA 2UWMA 2H94A 1R1VA 3N97A 2KJCA 2PMUA 2BE5F 4HDUA 4U0VA 1R1TA 1P92A 4ETSA 3I59B 2ZKZA 2VE8A 3H3UA 3IKTA 2FNPA 4R1HA 2OQRA 5ICCA 3OV8A 5FLXK 4KNYA 1TW3A 2A6EF 4OOIA 1IXSB 1NHAA 2LF7A 2O03A 4O5VA 1DUXC 2FBHA 4RS8A 5JR3A 5ED4A 3KETA 4PGHA 3ERED 1LJ9A 4WXDA 1WKMA 2L4MA 2RC4A 2CGPA 2MLGA 3HSRA 1SFEA 1GVJA 3RKWA 4A2UA 3GFJA 4N9IA 2G7UA 1F5TA 5BQTA 5LLQA 4OIOF 3CUQC 2GXBA 1HW1A 1MJ9A 4A5NA 1G3TA 3KE2A 4HLYA 3ECOA 4M9ZA 2B0LA 1BBYA 4M6YA 3GF2A 2JZYA 4ON0A 4TV7A 4BXUA 5BOXA 1Z05A 2P6TA 2XRNA 2A3SA 1FP1D 3LAJA 3I54A 3E97A 1MKMA 4OINF 1QBJA 5AIQA 5L3EA 2ISYA 4L18B 2EA4A 5D5UB 3O6BB 5CVJA 2O6GE 2IVMA 2ETHA 1Z9CA 1LEAA 4WXHA 5E18F 1A04A 3FF5A 4MEXF 2MH9A 1F4KA 4F7ZA 2YU3A 3GVAA 1Z91A 2PMHA 4FHTA 2HTSA 3ZMTA 2G7HA 4KFCA 2QLZA 5AIPA 2DQRA 2ZNYA 4MGRA 5ICFA 1YG2A 5HS9A 4L5IA 3MFKA 1IW7F 1OMIA 2O8XA 5D4RA 4LFUA 4CXFA 2FRHA 2RGVA 5LGUA 1PP7U 2XAQA 2KRFA 1D5VA 1QZZA 2K86A 4AWXB 2LDUA 5A2QZ 1HKTA 3DXJF 3J80K 4I01A 4U0WA 4HYEA 5D6EA 2XKPA 2Z99A 2OAZA 5TJJA 1W7PD 3CDHA 2ESNA 3WTVC 4I7HA 2EV0A 2EWNA 3K9TA 1YQAA 1L3LA 1H9TA 1RUNA 3F8FA 2P6SA 4KICA 2RNJA 2XKOA 3GZ5A 2HYFA 3QU3A 2VXZA 5DDGA 1UHWA 4WF2A 5CVRA 4D0PA 3K0LA 1PP8F 3H92A 1KU2A 5LRRA 1I1GA 2VBXA 3EQLF 3IHUA 4G9YA 3C7JA 1XGMA 2DK8A 5HLIA 2A6HF 5A2QK 1YW8A 2M87A 5BMZA 1D8KA 2R7DA 3HHGA 2W25A 1ZH5A 3V7CA 2M8EA 2FEZA 2ZMEB 3R0AA 1IN6A 3Q5FA 4AVPA 4M74A 2D1HA 5DD8A 2A07F 4NQWA 1IN5A 1FLIA 2MH2A 2KKOA 4G7OF 1G4DA 3HYIA 1ZG3A 3TGNA 5FGMA 4AIHA 1TW2A 4ZH4F 2GQQA 1BC8C 5CJ9A 2UXNA 3L2CA 5E20A 2FQ3A 3I5UA 2CW0F 4LG0A 1HSJA 2NAZA 3K1NA 4I02A 2FBIA 1E2XA 4CGZA 4HF1A 4UXNA 2M5WA 2NNYA 3E3VA 4I09A 3FM5A
chains in the Genus database with same CATH superfamily
3OYCA 3I55I 1B4AA 3L9FA 2LKXA 2L5QA 4XSZF 4BS9A 2Q8KA 2JPCA 1UFMA 2DOEA 2VOPA 5IT9K 2XHKA 1ZAOA 4XLPF 1V3FA 1U8BA 1X1BA 1L0OC 3E5QA 4KIGA 1JI8A 4AUXA 5J6XA 2CV1A 3CCVI 2L54A 4XOTA 1K7AA 5M5WJ 5C4JJ 4RA2A 2PG4A 3WHCA 2GLOA 3ZMVA 4A3LJ 3JTGA 2IAIA 3K4KA 4EMSA 2LFBA 2A69F 3F8BA 3CP8A 1ETWA 3DKXA 2Y2ZA 4XRMA 1JE8A 4LOCA 4ESFA 3S16J 4OWRB 2UZKA 5E3OA 1F9NA 3GFLA 2CV2A 3PSFA 1X4OA 1MBFA 3H5AA 3K4LA 4L5EA 3CZ6A 4NNJA 1WJCA 3CQZJ 2NS0A 2IS6A 4OU0A 1IG7A 3KEOA 4P55A 1BIAA 1G8XA 5JHUA 2JSCA 2HVSA 4MEYF 5EG0A 4U7BA 3GTJJ 1QO0D 3CD6I 2EILH 4BEHB 5K5RA 2DMPA 3JRAA 3RZDJ 1YITI 1XGNA 1DU6A 1AKHA 2HXOA 2PMZN 1CF7B 3CLQA 1SD5A 3V8KA 2WC2A 1OR7C 3WODF 4LGWA 5HNFA 1R9TJ 3I0TA 1BL0A 2ZJPF 2STTA 2JUCA 3D5LA 4C3HJ 1N78A 1QA6A 3WU0A 2DLLA 3BZCA 3D0SA 2WBMA 3E0JB 1MMSA 3BROA 4DZPA 3H0DA 3P9CA 4M3DA 3RQIA 4A3JJ 1RKTA 1GV5A 3HGGA 1IRZA 3O2PE 3J7AO 1PYVA 4YFKF 2UXXA 5HOOA 4PK4A 2L4AA 1BJAA 2X48A 3FK7A 5JI6A 4BHBA 2L9SA 3ABMH 3LFKA 4HA8A 1RR7A 3K1MA 5D8KB 2L3DA 3BCAA 1MMGA 2VIXA 2OZ6A 4MQVA 3EYIA 1FTZA 1CGPA 1F36A 1FPQA 2K27A 4U88A 2ESHA 1OCOH 1SVMA 2HKXA 5DUKA 2EPFA 1UHMA 3JRBA 4YIIA 4CICA 2OTJI 1Q1HA 2M7AA 4AIJA 2K40A 1TLHB 3ELKA 2L01A 3VPRA 4A0XA 4HQEA 1A6QA 1ONVA 3KLNA 1WH7A 4FISA 2R7QA 4XONA 3CCSI 5DCFA 2R7ZJ 4E70A 2BY3A 1YX3A 1P4WA 1W1WE 1Y1WJ 1W4MA 1JGGA 2BOLA 3NARA 1PUFB 3SZTA 3NWSA 3HBLA 4HF0A 3WTYC 3DPUA 5HLHA 5L3DA 1IN8A 1Y8QB 3PIOF 4Z6YA 4BQNA 1HQCA 3K4MA 1REPC 1J09A 2JA6J 2XSJC 2XSDC 1XSXA 4IO9F 3TBIA 3LSTA 3C1DA 5H2FC 2O61A 2DYSH 4PCQA 2HNHA 1HKQA 1KQ9A 3L7WA 3PIPF 1TP4A 4PJNA 1YO5C 1FOWA 1H8AC 2KLOA 1DP7P 1W5TA 5DEQA 3S2DJ 2GIVA 2HYJA 2E1NA 9ANTA 5H6RA 3OYNA 3M1CA 5LHIA 2LLKA 1SEUA 1QZEA 3OL4A 2HQNA 5F6FA 4FX0A 2QSGX 1ZR4A 1X1PA 4GRIA 1CQTA 3L09A 3LSIA 2GAUA 3MVPA 4OMZA 4Q5SF 3ZQLA 1ETQA 2BV6A 3HSFA 5LHGA 3HOUJ 1FBUA 2R5ZA 3I4MJ 2EFPA 3E6CC 3RIRA 4HDVA 2NS7A 2KIFA 1K79A 1W36D 4E7SA 2CUFA 4CUGA 4LB5A 4XSXF 3TDUC 2VLAA 3A2KA 2K9MA 2KHMA 3EYYA 4KIBA 2LY9A 4HZFA 5FJ8J 4HPQA 1BM9A 3BPVA 4MQ9F 4CCKA 1GV2A 2CO5A 3J81Z 1EH6A 4ENMA 1R7JA 2GIZA 3SJMA 1MJBA 1BR4A 3QRFF 1ZELA 3HPHA 1RC9A 2D2WA 3H0GJ 4XLNF 1YTYA 5ILUA 3F8NA 3JW4A 1O57A 1ZLKA 3FK6A 3L00A 3M1EA 5EEHA 5J8CA 4MIMA 2JPBA 2M4GA 2V9KA 2DFEA 4LK0F 3WTWC 5EDNA 3KYLA 1YW7A 2VKVA 3JAMK 2PFBA 2DA1A 2XAFA 1QZYA 3RPQA 1HF0A 2CQNA 1OISA 3G1MA 2M0CA 1P6RA 3A4CA 4EJTA 1FEXA 1AOYA 2Z5UA 3ML6A 1MNMC 4W1UA 3DKYA 5BPDA 1A31A 1ORKA 3JAMZ 2DFIA 1DDNA 1YJNI 1ZHFA 2JA2A 1R71A 1OCTC 4Z2YA 3CP2A 3GCMA 3KP4A 3M07A 4CCNA 5IOZA 4IEJA 4GXOA 5LEJA 3VYTB 2ID3A 1VQPI 4EV0A 5LD2C 1Z6RA 2WAFA 2GZWA 3GXOA 4XR6A 2RAEA 3DEEA 2G0EA 1LDKB 2O5RA 4XQFA 4AU7A 3HB9A 2LKSA 4ZDPA 2E5NA 3GLXA 2HZDA 2IGNA 1QGPA 1DP3A 4ZZLA 4LLGF 1RRJA 3HM5A 5ILVA 1W7PB 5FD5A 2CFXA 1SD4A 2M4KA 4JBAA 5DCMB 5DYMA 4R8HA 1X19A 3VODA 1HW2A 1YYVA 2HXIA 4ZDLA 1KU9A 1ODDA 4ASNA 4MO7A 4UB6C 2YUSA 3QPSA 5J40A 2Y9YA 3G4SI 3W6VA 4M72A 1MMNA 2F5CA 4NUBA 2LY2A 3OY9A 3U1KA 2DA6A 1JJ8C 1I1SA 5CPRB 3ZN0A 2O9LA 3JR9A 3ABLH 3BJOA 2KIQA 2KQRA 1SVOA 4RM2A 3OYHA 2QZ8A 2LBFB 3RZOJ 1IZ1A 1I39A 3MKZA 4S0HB 3PNYA 1M1EB 3RCOA 4EM2A 1N25A 1OFCX 1KA8A 3O8GA 1FC3A 1IXCA 5HDGA 2ZMEC 3T5XA 5EF6A 3D5SC 2QSHX 1FTTA 1V55H 2AQFA 1S72I 4NQWB 3OYGA 4BYYA 1T2KA 2OU2A 3DU5A 4ZZDA 2VUMJ 3LOCA 2HGCA 2JRMA 2E35A 2B9SA 1MMAA 4MNUA 5LHHA 4XRSA 3J80Z 3CMAI 2O0YA 1LEBA 1SFUA 2N8GA 2IXSA 2EH3A 2W84A 4E7LA 1VQ6I 3ASOH 3HUGA 1U9NA 2UUZA 4B1RA 3FXRA 3ABKH 2CUJA 4A3MJ 4EJVA 3CESA 3SFIA 2DDBA 4X1EA 3IC7A 3MD2A 5J1YA 5K5QA 4HAMA 5L3CA 2XV4S 1G2HA 4LLNA 1FSEA 2ZMEA 1O3TA 2IS4A 3Q0VA 1D1AA 3BR6A 3OYAA 3CCJI 3KZYA 3QPLA 1R58A 1XTAA 5H20A 4Q47A 3HZJA 1ZGWA 2R7TA 2XDVA 3OOPA 3KYCB 4HBLA 1POGA 2WA0A 4FETA 4O6JA 3HOSA 2BW3A 2JVGA 2OF7A 3RKQA 1T0FC 4B4CA 3GTQJ 4HX8A 3OYJA 3PO3J 4BL0B 3DLLF 4FTHA 2P5VA 2LC2A 3OSGA 2V1XA 3GO5A 2DA3A 4EQQA 2A61A 3HDDA 3RSNA 2E7WA 2B7EA 5J4YA 2I8DA 1VQ4I 1G6NA 3CMYA 1P9QC 2HPIA 3R6SA 2L7MP 2XVCA 3G1OA 1HA8A 3KYDB 3MAJA 2EQRA 5J47A 4B48A 1ACIA 4G12A 1TQPA 4OAYA 1IGNA 3J7ZI 5DD4A 3JRCA 4JX6A 4C3JJ 1Z1DA 4UUSB 3CDLA 2K4JA 2FU4A 1MMDA 3KP7A 2IS2A 1SD6A 3HEFA 1LB2A 3DP7A 4B47A 2DTRA 1WH5A 3KLOA 3L2VA 1FYKA 1LDJA 1AWCA 1VQOI 2VT2A 4BHCA 4HNVA 2H1LA 2XROA 3L2WA 3M8JA 2ZJ2A 2PEXA 3EUAA 3B02A 1BW6A 1KU7A 3PFIA 5FKOA 2W24A 5GPAA 1FWZA 3WTZA 1K83J 4ZYHA 3COAC 1BR1A 1R49A 1I5ZA 2XPVA 2R7XA 4PZJA 3CO6C 3W2VA 4DJAA 1TWGJ 3I58A 3I64A 4XRFA 1A6IA 3CTAA 2VBZA 3A03A 2F4OB 2A5WA 4ANJA 4XORA 3ZRGA 2L02A 3MWMA 2ISZA 4HQMA 3F6VA 3GFMA 3F22A 4G6TB 1JKOC 4YRVA 3TMOA 2VBWA 1WVRA 1BW5A 1T33A 2F5EA 4UV9A 4DW6A 3WTUC 3S3MA 1ON1A 2RKHA 3DTIA 3W3CA 3OIQA 2R7WA 3OYBA 3M4OJ 2W1OA 2HDWA 3JRHA 2EFOA 1EA3A 1YX5A 5EZHA 2CS3A 4HOBA 3BTLA 1FBQA 4KIFA 3JRDA 2M0MA 6PAXA 1NK2P 2BVMA 5LGNA 5C4XJ 1XG1A 3CLOA 4C3IJ 2D45A 2E2HJ 4XKVA 3WTSC 1KZHA 3ZXSA 1JUMA 5FKLA 1WJFA 4M71A 4BXFA 1R5GA 5EZGA 2A5YB 1P4XA 3WG7H 2TDXA 2FBKA 1B59A 4YFXF 4BBRJ 1G59A 4IRGA 5FB2A 3L2UA 4BJ6C 2IRFG 3SHFA 2FUG2 1EKEA 1DU0A 3IH2A 3MCZA 4Q4ZF 1LFBA 3RYRA 1WQ2A 2EIJH 5CQEA 2EFNA 1B72B 3QU6A 4UVAA 1HC8A 4L0YB 4CYDA 4WK8F 1TQMA 2LBFA 2BBYA 2QVOA 3CF5F 4BJTA 1FP2A 1O7LA 3LAPA 1W36C 1SMYF 2FOWA 4AIDA 5D5WB 2XF5A 1S9HA 2OD5A 1S3JA 3C2HA 3LFUA 2CUZA 1R00A 5B5EC 4HEA2 1PUFA 2QQ9A 3BDDA 4U0YA 2LD5A 2EJRA 1IF1A 1D1CA 1ITYA 1E17A 2RQPA 3GTMJ 3IL2A 3G3ZA 1H89C 2X0LA 3VSKA 2P0WA 1GUUA 3CJNA 2KFDA 5E3NA 4DYCA 5F1JA 1W5SA 3DF8A 3WU2C 1X2NA 3FXKA 2BEOA 2O3FA 3F21A 2RV8A 2TRTA 2YPRA 4OIPF 1W5CC 4RAZA 2DI3A 5J3LA 4I98B 1YS7A 3OYDA 1FYMA 1IAWA 1XB4A 3HOZJ 2OPTA 2HS5A 2HEOA 1YIOA 3G1LA 1RETA 5GAGJ 3B73A 1Y39A 1ZG5A 1IN4A 1B8IA 3DWLE 3C3WA 4MTDA 1XSVA 2QEXI 3DPTA 1UZCA 1TBXA 3ASNH 2E60A 1J0RA 5BPIA 1D8JA 3E5UA 1WPKA 2HVQA 1QU3A 4FQGA 2M45A 1GXPA 2LMDA 4UUVA 1YLFA 1FT9A 1XGOA 3V7SA 2VPLA 1AU7A 5K5OA 2QM3A 3E7LA 1T6SA 3BLYA 1FY7A 3O3KA 1IRGA 1RNLA 2FXAA 3LNQA 4BU2A 2Q2EA 4RGRA 3AG1H 4Y17A 4H0EA 3V8LA 1Z77A 3H9GA 2FF4A 2H8WA 3ABUA 2M7BA 1IN7A 3LSHA 2ZXWH 3CMMA 5TRDA 3AFHA 5LEKA 1JT0A 4PFOA 5GADJ 2DN0A 3B6AA 4L5JA 4IQ4A 1CF7A 3QYEA 3VWBA 3DTEA 1VI0A 2X1DA 5F04A 3S2WA 1S6LA 3QPTA 4YG2F 3K70C 4HF2A 2YX4A 1XN7A 3TOAA 1E3PA 3LA7A 1UELB 2K9LA 3Q9SA 1J59A 1OKRA 1OYYA 2QF7A 3BCBA 4Y3OA 3H35A 2ZB9A 3LL7A 3ZQHA 3P9KA 1TWAJ 2HQAA 3ZN1A 2DAOA 4RB3C 2WAQN 4G8XA 2IW5A 3EDPA 2QA4I 2VN2A 1R36A 2E34A 2I5UA 1UAAA 3KCCA 3HIFA 2VONA 4PUSA 4N4OB 1GXQA 2K02A 2MBFA 3VYRB 1MD0A 3SDGA 3GUDA 2DA5A 2HR3A 3AG2H 5HDNA 4HX7A 3WU1B 2VPRA 3IRRA 3HC7A 4WWCA 3O8HA 3ZMUA 4EATA 4AM3A 2HVRA 2DCEA 4IX7A 2GBYA 3K4NA 1OJLA 3E6DA 3QYFA 3V7RA 1R1UA 2R0QC 1ZGAA 3K4BA 4V19K 1XDSA 1ZG1A 1YRNA 1JTYA 3BG5A 2QCOA 1RUOA 2IGMA 3FXOA 2V79A 1R22A 3KEYA 3W6JB 1YHQI 4P9FA 5LBQA 4BAYA 2K9QA 1ON2A 3F3XA 1XD7A 3M7GA 4J00A 5L3BA 2K9NA 3MZ8A 2LTPA 1WRJA 3CUQB 2NYXA 3OIPA 1YFHA 3PJRA 1MNDA 4D5CA 2YR2A 1HOMA 2RDPA 2DTZA 3FXQA 3BC8A 2R92J 1WSUA 3HRSA 2FQ4A 1OCZH 4XNFA 3DBHB 5FRNA 3TQNA 2OBPA 2W4SA 4E7JA 2MC3A 4FT8A 3SFZA 5DS9A 4L9TA 2Y69H 3L2RA 2BHZA 5HDKA 4XLFA 3IAM2 1ZLJA 2V6CA 1ULYA 1T39A 1BIBA 2KDOA 1IDZA 2DJIA 2ZXJA 3K6GA 2QSFX 5DCMA 3QAHA 2IS1A 2E2JJ 1TZLA 3C18A 3OR2C 3S1NJ 1SVLA 5ERIA 3IKVA 4IF4A 4IOAF 3M9AA 3F0CA 4E6KG 5IP7J 2JTVA 3E6MA 2DMQA 3QOPA 2Y75A 2V1DA 5E1WA 2CWEA 2K4BA 2WY7Q 2AQEA 4BJ5C 4UV8A 1WZ2A 5L3FA 4LK1F 1T38A 2D1VA 1T08B 5FROA 1OCCH 4DZJA 2KMUA 1X1DA 3EUKL 3QWLA 1ETYA 4NDLA 4BQQA 3GZ6A 4EGYA 4M3EA 3A02A 4LG3A 5KK1A 5D5XB 2ELJA 3ZQ7A 5GAEJ 4RGSA 1EH7A 2ADUA 3GTOJ 1UCRA 3RPUD 3I53A 4WX9A 1ETXA 2RN7A 2OUMA 4ZTJA 2CSOA 5CLSA 2WTEA 4IVNA 4A6EA 2V6EA 1QHHD 2AXLA 4KJZA 3CCUI 1R23A 2OC6A 3K10A 5D4SA 4KISA 2GA1A 1LDDA 1FNNA 2LNBA 2R4GA 3K1PA 1KQ0A 1VQ9I 4I2OA 3BG9A 3IAS2 3DCFA 4HV6A 4JX5A 1IRFA 2HI3A 3VYUB 2LSOA 1HXDA 3AL0C 4X6AJ 1RI7A 1XCBA 4DYRA 3LQRA 3TO6A 4RB2C 3G73A 1TWCJ 2M1BA 1MSFC 4XKBA 4QSHA 5E17F 4YEJA 3J7AY 2R7FA 2JSPA 4RBOA 3BOQA 1SFKA 4IXAA 3DLAA 3MQ0A 1G3WA 2NVTJ 2FSWA 3GX4X 2FE3A 2EB7A 3Q0WA 5D5VB 5KAFC 2BZTA 2IJLA 2Z3YA 1UB9A 3T8TA 3ERMA 2V7FA 2DMUA 2ZO4A 5K7FA 3E1SA 1Z67A 3ZR8X 4N0BA 4A0ZA 1V5FA 3U21A 2MD0A 3BWGA 4QIWN 1WI9A 1F1ZA 1AA7A 3ZQFA 1IC8A 3FXJA 5DV5A 4CZZA 1BC7C 4B8XA 4BHPA 3RKXA 2VJIA 2A68F 4YFNF 4IHSA 3BG7A 4KA4A 2VOOA 4NC6A 3LSPA 3R0JA 3T8RA 1S7AA 2JQ7A 5CVVA 2W85A 3E5XA 2LG4A 3LA2A 4PSWA 3W2WA 1YJWI 5LRSA 1VZ0A 3HXLA 4QLCU 1D0YA 1STZA 2CW8A 3KP2A 1ZK8A 4HX4A 3U2RA 1VF9A 2NNNA 4EM0B 3F8MA 1A35A 2DPDA 4CA0A 4RMNA 3MKYB 1XSDA 2X85A 4GCVA 2YSRA 5KCMA 2Y0MA 3E6BA 3ULQB 3WE2A 4P5OA 4N9HA 1HBXG 1OCPA 2F48A 2KDZA 2L0KA 3ABTA 2VQCA 2EZKA 2I10A 3IP4B 2PLYA 2Y0SN 3H3ZA 2XB0X 2CQ7A 3NRVA 2VKEA 5E8IA 2B63J 5EYRA 1F43A 2CRGA 2NRAC 1D0ZA 2V9PA 1ZRFA 4ZYDA 3OR1C 4KT5C 2CH0A 2YS9A 4A3DJ 5CYVA 5D8LB 3S3NA 2VB6A 4G94A 2DFHA 4DNCA 1KYWA 3KFWX 2HQRA 2ZSIB 2VJJA 4MFEA 4K2EA 3M8EA 2OZUA 1B6AA 1RIOH 3KZZA 1N77A 4KDPA 1MJAA 3TKYA 1U2WA 1HKSA 2CYYA 1WGXA 3BR5A 4IQJA 2CU7A 5EGOA 1DPRA 3UR3C 4KN4X 3HG9A 2OCCH 4BACA 1O3SA 4HLXA 4M3FA 1G3SA 1USSA 1QVTA 2RQQA 2K3FA 2DU9A 5LGTA 3K69A 3VOEA 1XGSA 2NOJB 2R7SA 4XM3A 3OMYA 1K61A 1GVDA 1VNDA 1UG2A 3I4NJ 4DBRA 5JFRA 2IA2A 5F1RA 1K78B 2LR8A 5H6QA 4XMYA 2EINH 2V1NA 5KVRA 4I0BA 4M73A 1BN5A 1K6YA 2GOMA 2LREA 4WXCA 4IHTA 2IBDA 2EFQA 2M34A 2W7NA 1GHCA 1HDDC 2KZVA 3CJRB 2ELHA 1I6XA 2L2OA 1ZARA 4UVCA 5ICEA 3I4PA 5FO5A 3WGHA 1ZN2A 1HSTA 3SEQA 4FCYA 2HZTA 2A6TA 2DT7B 4BGDA 2HOEA 3IH4A 4M3GA 3NQOA 1YJ9I 4A3CJ 1QHGA 1Z7UA 1ZTRA 5K1YA 2YU9J 2WAQA 1WJEA 2COMA 1JTXA 1JUPA 3GW2A 1FIPA 2VI6A 1BI2A 3DPLC 2PJRA 1MBGA 3P9IA 3F23A 4RGUA 1P7JA 2J5OA 2K5CA 4ZYEA 3K4JA 4HSTA 2PJPA 3ZQGA 3SDBA 2AO9A 5HS8A 2DA4A 2IA1A 1SC7A 1X3UA 3MKWB 2LVSA 2QBYB 1TQIA 3J7YJ 4I0AA 3JTHA 3RI4A 5KHDA 1IUYA 3AL0B 4PSXA 3P5JA 4DIQA 5M5XJ 3JSPA 2QYOA 4NHJA 1T0FA 4IRHA 4P9UA 2QQBA 1OR7A 3Q9VA 1K6OA 1ZQ3P 3S2HJ 1USTA 4XRSG 3HTSB 3KIOA 3I71A 3AAFA 2R7UA 2L7FP 4MLOA 1OYIA 1WJBA 2KZGA 5FLMJ 2HWVA 5FFXA 4M3BA 4L9JA 3KP3A 2EV6A 3EUHA 2FD5A 2JA7J 3N05A 3FISA 2JT1A 3VFZA 4OMYA 2GA2A 3I59A 2JRTA 2DT5A 2EZLA 2PMZA 1S7EA 1JKRC 2MGQA 1MDMA 1I6HJ 4NBQA 2X6WA 1Q1VA 2G9WA 3IUOA 3GTPJ 5FFZA 3BG6A 1U9OA 4C30A 3RYPA 4XK4A 2PBIA 2QQAA 2Z2SB 2IP2A 2M30A 2DDAA 3BP8A 4GO1A 1QVUA 3M8FA 2NOGA 1FOYA 3BY6A 1J7KA 3DTKA 4J01A 4CZCA 4PDKA 1W7PA 3AG4H 3KP6A 4ESBA 2CFOA 4G6QA 2E2IJ 5IYCJ 3MKLA 4LITA 2ID6A 1QPIA 3RJPA 1AHDP 3FDYA 4A6DA 2HTJA 5IY5H 1B9MA 2EV5A 3IWFA 2W57A 5IOYA 2IA0A 4AIKA 4M9XA 3JRIA 1V5GA 2PI0A 1B72A 4IHXA 3L1PA 4Q48A 4M6XA 3IH3A 4XOPA 1YIJI 3I3LA 5M5YJ 5E3MA 3HRTA 2X4HA 1R4MB 2HQ5A 4LIUA 5FKNA 5HVQC 2HOSA 3PQJA 4BH9A 2OA4A 4LIVA 3DQVC 4A93J 4EEFG 2M9HA 5B3SH 5CQGA 3SQNA 1C0WA 2DXIA 1JHHA 4XBFA 3KZIC 1O4XA 4C2TA 1E3HA 3CMEI 3BQYA 3HHHA 3WTTC 1PJRA 4CHUA 2JWTA 1SANA 2ME6A 3NEUA 4IJAA 4HNTA 2AS5F 2ECCA 2MG4A 3KEQA 1OLTA 4RAFA 5ICGA 3LSGA 4UVBA 5FD6A 2P4WA 2XC7A 2C6YA 3L2QA 1J2XA 4G6DA 1LNWA 3OYIA 2FMLA 2KISA 2VJ4A 2DYRH 1FMVA 2VQGA 3QOEA 4XLAA 3BG3A 3TOBA 4B09A 4GGGA 2L9VA 3HOTA 1RZ4A 3IV5A 2OV7A 3CCLI 4RAYA 3OYEA 3S93A 3C2GA 5GP9A 2R5YA 1HW5A 1WFXA 2OQGA 1RPWA 2CG4A 3LSKA 1V5EA 1BA5A 3ZMDA 2VKHA 2K7LA 1JHFA 3FHZA 4D1QA 5IP9J 2DBBA 1NG7A 3P7NA 5CVUA 4A12A 4D7NA 4DYQA 1MW7A 2QWWA 5CVIA 3HRUA 3LQQA 2VC1A 2PQ8A 4B43A 4UHTA 2MA3A 2VQHA 2DT6A 1PDNC 4LB6B 3MZHA 2FMYA 4Y52J 4U7DA 3FMRA 2F6CA 3KX2A 3N4MA 2JVHA 2MABA 4ESJA 1Y56A 4LG0B 3CUOA 3H9QA 5DM7F 1E3OC 3R60A 1DPUA 3LA3A 3DV8A 3I9V2 4OIRF 2VT3A 3RQ4A 3HTUA 3KP5A 5GPCA 3J81K 3HL2A 1O7FA 3EPZA 3WTXC 1RKWA 3UKGA 3PNTA 2PJRB 4L0ZB 4L9VA 1Z0XA 1I27A 1H9GA 3X2QH 3ZMSA 4PJMA 2Q2EB 2BYVE 2STWA 4A3BJ 2X9DA 4LMYA 5E79C 1TC3C 3LSRA 1MH4A 2EZHA 4A69C 3PQKA 4EJWA 1B8IB 2FA5A 2PN6A 4A3EJ 2F5FA 2LF8A 1SMTA 3DFGA 4JQFA 2LOOA 4JYKA 1LQ1A 3GMEA 4X0GA 2F2EA 1NK3P 2H27A 1JXSA 3W6KB 2ECBA 4C2MJ 1TT0A 3VEPA 5E8GA 4G7HF 1H0MA 4CCOA 3BZ6A 1EH8A 4A3KJ 4QPOA 4RLFA 1YRNB 1TNTA 2F5DA 4GYGA 4R79A 1QPMA 2MLKA 2X1CA 3BTJA 1S7OA 5IT9Z 2MW8A 5K7HA 1ZGJA 3V8JA 3WE3A 5C3EJ 5FRMA 3FZVA 1XDUA 3S3OA 1MBEA 3BQZA 3VB2A 4CCJA 1PUEE 3CCQI 1T8IA 1GDTA 2R3SA 4RB1A 3HPGA 4EJUA 4G7ZF 1O3QA 2IPQX 2KIMA 3JSOA 3GYHX 4XLEA 1FYLA 5GTHC 4ZYGA 2AXTC 3HKZN 1X1CA 2JJ7A 4KUMA 2DPUA 2JA8J 2XUBA 4CCLA 1XPXA 2IT0A 2KRCA 1ZRCA 5F08A 1XMKA 3A1YA 3ECHA 2X6OA 3FBNB 3RPUA 4BEHA 2WB1N 2WADA 3VYSB 2R7RA 1APLC 3SXYA 3MMYB 4MHGA 1IXRC 1IRXA 1BI0A 4IKFA 3GWZA 2BVLA 1NTCA 3FX3A 2RVCA 3RKYA 3K70D 1FZPB 2DK5A 1YW9A 3H3VK 2LKPA 5HLGA 1OQYA 2CQKA 5D6FA 1ZYRF 4MTEA 4FASD 4EJOA 1J75A 1WI3A 2D5VA 4AD9A 2ZBKA 3OSFA 3GBGA 2FOKA 2GWRA 2QENA 1XX5A 2DFFA 5JVGF 1IUFA 3NWTA 2XAJA 4W97A 5DTDA 1U5TC 1YI2I 2DQLA 2HFHA 1ETOA 2RREA 5JHFA 2EFWA 1BOBA 3BR2A 3S1MJ 2P5KA 5E1ZB 1WWXA 2E5ZA 2ME0A 3CCYA 2XGEA 3M3YJ 1ENHA 1JGSA 4IHWA 2XASA 5EGOB 3TL4X 2J5PA 5ILSA 2E1OA 4ENNA 1J5YA 1QQIA 1RESA 1FBSA 1QNTA 1U0JA 2KP6A 2Y30A 4GFBA 2K3PA 3RDIA 2Q1ZB 4ZJZA 2P7CB 2ZFWA 3HOYJ 2ZXIA 4IPAA 1T56A 1S29A 3QPHA 3ROUA 1K78A 2ZJRF 3CO7C 2Q0OA 2EZIA 2LK2A 4A3GJ 2IGKA 1LVKA 3SZPA 5FLVA 2CV0A 4NB5A 4PJ0C 1D1BA 4FE7A 3MN2A 3FWEA 1QRYA 2KJBA 1TL8A 4DQ2A 1Y0NA 2XF6A 4PGGA 3FMSA 2XAHA 3GEZA 3JREA 1U3EM 3U9GA 5HODA 3FM3A 2KRHA 3QYBA 2P5LC 3JRGA 2AHQA 1FOXA 3ONQA 1U5TA 5EJCA 1XCVA 3V4GA 2LY1A 2QUFA 3HRMA 3BJAA 2R93J 3PL8A 3ZCOA 4QTRA 1XMXA 3GFIA 2UV1A 3WGIA 2VC0A 3DKWA 4KN7X 4EGZA 4IRIA 2BGCA 2HOAA 1SD7A 5IYBJ 4A3FJ 1RR8C 4LJZF 2ZC2A 1VQMI 5F64A 3G2BA 1BI1A 1WJAA 2HKOA 3OIOA 1YS6A 1R5ID 1TWFJ 1R5HA 3CF2A 5DUIA 2QBYA 4U87A 2ICWG 2E19A 2X1EA 3H1CA 5KNLA 4JOMA 4ENJA 3WGGA 4HW0A 3GZNB 3DBRB 3TW7A 1GT0C 1B1BA 3ZMZA 2HDDA 3MEXA 4M9SA 5M3MJ 2VBYA 2WY8Q 5JLXA 1YOVB 2KIUA 4RGXA 4II3A 2CQXA 3HGYA 3T0YA 4RB0A 4BBSJ 4BDZA 3RTRA 4IHYA 1VQNI 1MBKA 1G3YA 3FIWA 4PJJA 1S5LC 3REOA 3FXUA 2F5VA 2L7KA 2ELKA 2HU9A 5K7ZA 1Z3YA 2H6BA 2P7VB 1FSHA 3LSJA 4FE4A 4JP0A 3H5RA 4EVIA 1P2FA 3OS2A 2W00A 2GOXB 3CC2I 1Y0UA 4XLCA 4JK1X 3D1NI 3IRQA 3ZP5A 2XPUA 1BJZA 3TO7A 4BQOA 1KGSA 1U6GA 1WJDA 3BPXA 4LLLA 4ZTFA 2TCTA 4WCGA 3ZQQA 3BR1A 3SZGA 2Y31A 3T1BA 4YELA 3DEUA 2P81A 2E1CA 1S8NA 4HV5A 2JN6A 3DBLB 1Y1VJ 1U8RA 5EEGA 5J1UA 1BOAA 1R6RA 2M8GX 4S04A 1B9NA 4CO8A 2O8KA 5LFAA 3S17J 3CUQA 4GYIA 1SFOJ 3H9JA 3F72A 3I56I 2V1UA 1MDMB 5F27A 2LRDA 2WV1A 3KPHA 3TO9A 2EA2A 2DMNA 4ABZA 1JKPC 5J8FA 3R4KA 4KITB 4KYWA 2JA5J 2ZXHA 2Z33A 2QKLB 2DOAA 1IV6A 4UUTA 2GXGA 1D3YA 3AG3H 2ZCWA 1KYZA 3PM1A 1VQ8I 4AYBA 1R4NB 4KMUX 5JLWA 4NC8A 2HPMA 3VDXA 3OYFA 2K85A 1OYWA 1KQ8A 1OPCA 1SAUA 3R61A 3A01A 1TTYA 4MFDA 4BY7J 4DOZA 3IWZA 2MD5A 3OL3A 4XKCA 1V54H 2H6CA 1IO2A 2V26A 4CYCA 1JKQC 3CCRI 3TDZC 1Z6TA 2IEKA 2E7XA 1NH3A 1J9IA 2BXZA 5IT3A 4DBQA 2L9NA 2Z9OA 1MZBA 4Y4RA 3AKZA 5TISC 4O3MA 3K4CA 5B1BH 1SAXA 2EK5A 4CDGA 3TW6A 1EV7A 2Y48A 3DU6A 3F6OA 2CJJA 2KT0A 2XGDA 2DA2A 1LE8B 2H8RA 4V2FA 2ZFUA 5EEAA 1MGTA 3HKZA 2DO7A 1O3RA 5BS6A 2COBA 3FKIJ 4KT6A 4CH7A 3S1QJ 2NVYJ 2CW7A 2R5ZB 4YIFA 2V9VA 1DQUA 3LMMA 4LD5A 1MBHA 3ISPA 2EBIA 1SFXA 4FX4A 1FOKA 1XC5A 2VKDA 1VTNC 3MZYA 1FX7A 1HDPA 1Y8RB 3QP5A 4L9NA 2CQQA 3LSMA 2XGXA 2ACJA 4C2UA 1WCMJ 1DGWY 1JUSA 2H09A 1BI3A 1IDYA 1V4RA 3K2ZA 3QODA 4CCMA 4IZZA 1HLVA 3FMQA 4UNOA 4S05A 2YX7A 3FBIB 4N4NB 3F8CA 4QPQA 5J4VA 2VE9A 5KAIC 3CC7I 5HS7A 4QWQA 4BNCA 2JUGA 5L3GA 4KMFA 4Y13A 3PFYA 5CKTA 1W0UA 2IGOA 1U5TB 2NVUB 2XIGA 2ZNZA 3HSEA 1WJ5A 4EM1A 3CJQB 2R5YB 5F0HA 3QP6A 5AONA 5GAHJ 4C9YA 4OIQF 3BT9A 2XRLA 1X3ZB 2MYSA 2FNAA 1U78A 3A0HC 2OCEA 5EG0B 2DW4A 3OS0A 5HLTA 2XAGA 1LVAA 4OAZA 4F52A 2DMTA 1ZRDA 1Z3XA 3OWTA 5E3LA 3U1DA 4A5MA 1XMAA 1P4AA 2E1MC 5JVTA 2P8TA 1AKHB 2OTLI 4PJLA 2A05A 3UNGC 1UMQA 3BJ6A 3HJEA 1T98A 4BQAA 1TNSA 3EETA 4A0YA 4Y15A 4ENKA 5E1XA 4F3QA 1A5JA 2HDCA 3WG9A 1ERDA 3H5NA 2XF7A 5GTIC 3CJTB 4HNUA 2M3AA 1ZREA 3FXMA 5FLXZ 1IJWC 2HYGD 2WWYA 1KU3A 2DODA 2WV0A 3ZPLA 2BY2A 5IYDJ 4P96A 2KPMA 3LWFA 2HOTA 2VODA 2UWMA 2H94A 1R1VA 3CCEI 3ZOBA 4XN0A 4V2GA 3N97A 5HNHA 2KJCA 3EUHC 3HOXJ 1XS9A 2PMUA 2BE5F 4HDUA 1VQKI 2CUEA 2Y0SA 1H88C 1D0XA 4U0VA 1R1TA 1P92A 4ETSA 2E1MB 5IPAA 3I59B 2ZKZA 2VE8A 1FMWA 1GLNA 3H3UA 2QKMB 3IKTA 1I50J 2FNPA 4PFPA 3H36A 1VQLI 4R1HA 1ZKGA 2OQRA 1ETKA 5ICCA 3OV8A 3PNVA 5FLXK 2F4MB 2MFZA 4KNYA 1TW3A 1K4SA 2A6EF 4OOIA 1IXSB 1NHAA 1TT5B 3WHBA 3D5RC 1I3AA 2LF7A 2NS8A 2O03A 4O5VA 4BE1A 1DUXC 2FBHA 3OS1A 4E7IA 4RS8A 5JR3A 5ED4A 3KETA 4PGHA 3ERED 1LJ9A 4WXDA 2VJ5A 1WKMA 2L4MA 2RC4A 4YIRX 2OJED 5J1RA 4BE2A 1LUJB 2MLGA 2CGPA 3HSRA 4AYBN 1SFEA 2FX0A 1GVJA 3RKWA 4UY8I 4RM3A 4A2UA 3GFJA 4N9IA 1UHSA 2G7UA 3VSLA 4I6ZA 2QQ8A 2X51A 4HRIA 4II2A 1F5TA 5BQTA 5LLQA 1DGRM 4OIOF 2E36A 3CUQC 1EJ9A 3FXLA 2GXBA 1HW1A 1MJ9A 1FJLA 4A5NA 1A36A 2W48A 1G3TA 4RAGA 3KE2A 4HLYA 2NVQJ 1JT6A 3ECOA 4XKWA 3F9KA 4M9ZA 2B0LA 1BBYA 2EIMH 3V42A 4BUPA 5IP6A 4HG2A 4M6YA 3GF2A 1IV8A 5M3FJ 3JCUC 2JZYA 4ON0A 2X6YA 4TV7A 4BXUA 5BOXA 1Z05A 2XRNA 2P6TA 2XGCA 1ZR2A 2A3SA 3PO2J 4BY1J 1FP1D 1E0EA 3LAJA 3I54A 3E97A 1MKMA 4OINF 3JRFA 1D5YA 1QBJA 5AIQA 4IOCF 5L3EA 2ISYA 4L18B 1LFUP 4I99C 2EA4A 4BDYA 2NVXJ 5D5UB 1YE9A 4BE0A 3O6BB 5CVJA 2O6GE 2IVMA 2ETHA 2KL4A 1Z9CA 1LE8A 1LEAA 4WXHA 3Q3SA 4AC0A 1A04A 5E18F 2BXYA 3FF5A 4MEXF 5DM6F 2MH9A 1KONA 4H4KC 1F4KA 4F7ZA 2YU3A 2GXAA 1VQ5I 3CDIA 4E4HA 3GVAA 4XICA 1HCRA 1Z91A 2K9SA 2VASA 2PMHA 3DEWA 2MSYA 4XLHA 1UJ8A 3SEZA 2BW3B 3FHNA 4FHTA 2HTSA 3ZMTA 4F93B 1X2MA 2G7HA 4D7MA 4KFCA 4ZC3A 3BR0A 4GDFA 4F55A 1MNEA 3PSIA 4HSRA 3TP0A 2XB5A 3PUFA 4XIDA 2QLZA 5AIPA 2ZJQF 2DQRA 2ZNYA 4MGRA 5ICFA 1YG2A 5HS9A 4L5IA 3MFKA 1VFCA 3A0BC 1IW7F 3S8PA 1OMIA 2JMWA 1N75A 2O8XA 3Q0UA 3CC4I 5D4RA 4LFUA 4CXFA 3TEDA 3OOUA 4P1WA 2BHYA 2FRHA 4D5FA 2RGVA 2BY0A 2RNGA 5LGUA 3QQAA 2QGUA 2H1KA 1PP7U 2XAQA 4IL6C 2KRFA 2VL8A 3HOVJ 1D5VA 1QZZA 2K86A 3B6CA 4AWXB 2LDUA 4UUSA 5A2QZ 4IHVA 1HKTA 1X1AA 3DXJF 1LPQA 3G71I 3J80K 2XPWA 4I01A 4U0WA 4HYEA 5D6EA 3S32A 3GTLJ 2E71A 1LFPA 2XKPA 1X3WB 2WAEA 2OAZA 2Z99A 5TJJA 3OYLA 3CCMI 5C44J 1W7PD 4F91B 3CDHA 2EIKH 2VQLA 1Z21A 3BR3A 2ESNA 3WTVC 2X6XA 4F92B 3BTCA 4I7HA 2EV0A 2EWNA 2LYCA 5FKMA 2Y9ZA 4B44A 3K9TA 4E7KA 1YQAA 1MIJA 1L3LA 1H9TA 1RUNA 4DGWB 2NXNB 4AVZA 3F8FA 1OCRH 2P6SA 1NG6A 4Y33A 4KICA 5F0CA 2RNJA 2XKOA 3GZ5A 4RDUA 1Z7LA 2HYFA 3QU3A 2VXZA 5DDGA 2ZSHB 1UHWA 4WF2A 5CVRA 3ZQIA 4D0PA 3K0LA 1PP8F 2Z16A 3H92A 4ITVA 1KU2A 4J19A 4E7HA 5LRRA 1I1GA 2L7ZA 2VBXA 4UB8C 3EQLF 3IHUA 3GLLA 4G9YA 4CYCB 3C7JA 1XGMA 2CMPA 2DK8A 2A6HF 5HLIA 5A2QK 3GTKJ 3OYKA 2DJNA 2XAUA 1YW8A 2M87A 2DOFA 5B66C 3G6EI 3ZQCA 1MBJA 5BMZA 1D8KA 2R7DA 4E7ZA 3S15J 3ESWB 3HHGA 2W25A 3TP3A 3FKJA 1K4TA 1ZH5A 5TGTA 3HOWJ 5BNGA 1TWHJ 2M8EA 3V7CA 3A01B 1BR2A 2FEZA 1WHUA 3K7AJ 3W2AA 2ZMEB 3S1RJ 3R0AA 4D9JA 2V4JC 1IN6A 1X58A 3Q5FA 4AVPA 2PX9A 4M74A 1I3QJ 2D1HA 1EF4A 1MH3A 5DD8A 2A07F 4NQWA 1IN5A 5B1AH 1FLIA 1JJ6C 4XL9A 4Y7NJ 2MH2A 1UG0A 2F4IA 1PVEA 2KKOA 3OYMA 5F0FA 4G7OF 3C2BA 1G4DA 2JK3A 2R7OA 1LKXA 3HYIA 1ZG3A 3BTIA 3TGNA 2W82A 5FGMA 3HUGB 1FIAA 1P7IA 4AIHA 1T95A 4BXXJ 4RLQA 4BKXA 3SYTA 1TW2A 3ZGKA 4ZH4F 2MC4A 2GQQA 2L9RA 3PUBA 1BC8C 4A3IJ 2WB1A 5CJ9A 2UXNA 5E20A 3L2CA 2FQ3A 3I5UA 1Y6IA 3NAUA 1MSEC 2CW0F 4LG0A 2O7OA 1HSJA 2NAZA 2Z1DA 3K1NA 3K2AA 5FKKA 4M6VA 4I02A 3BZKA 4ZYAA 1W0TA 1X4PA 2FBIA 2GM4A 4NC7A 2BY1A 2LP0A 4B3AA 1E2XA 4CGZA 2DA7A 4XN3A 3S14J 2R7VA 4ZDOA 4HF1A 4I76A 4UXNA 2LH9A 4B3XA 2M5WA 2FJ1A 4JX4A 3GTGJ 2NNYA 1VQ7I 2VXDA 3E3VA 4I09A 3FM5A 4CSWA 2M2EA 1ETVA
chains in the Genus database with same CATH topology
1B4AA 3L9FA 4XSZF 2Q8KA 2JPCA 1UFMA 2VOPA 5IT9K 2XHKA 1ZAOA 4XLPF 1V3FA 1L0OC 3E5QA 4KIGA 5J6XA 2L54A 1K7AA 2PG4A 3ZMVA 3JTGA 4EMSA 2A69F 3F8BA 1JE8A 4ESFA 2UZKA 1F9NA 3GFLA 2NS0A 4OU0A 3KEOA 4P55A 1BIAA 5JHUA 2JSCA 4MEYF 4U7BA 1QO0D 5K5RA 1XGNA 1CF7B 1SD5A 3V8KA 2WC2A 3WODF 4LGWA 3I0TA 2STTA 3D5LA 3WU0A 2DLLA 3D0SA 3BROA 3P9CA 3O2PE 3J7AO 4YFKF 2UXXA 5HOOA 2L4AA 1BJAA 5JI6A 4BHBA 3LFKA 4HA8A 3K1MA 5D8KB 2L3DA 2OZ6A 4MQVA 3EYIA 1CGPA 1FPQA 2K27A 4U88A 2ESHA 2HKXA 5DUKA 1UHMA 4YIIA 4CICA 1Q1HA 4AIJA 1TLHB 3ELKA 2L01A 4A0XA 4HQEA 1ONVA 3KLNA 5DCFA 4E70A 1P4WA 1W4MA 3SZTA 4HF0A 3WTYC 5HLHA 5L3DA 1IN8A 1HQCA 1REPC 1XSXA 3LSTA 3C1DA 2O61A 4PCQA 1HKQA 1KQ9A 3L7WA 1YO5C 1DP7P 1W5TA 5DEQA 2GIVA 2E1NA 5H6RA 5LHIA 2HQNA 5F6FA 4FX0A 4Q5SF 3L09A 2GAUA 4OMZA 2BV6A 3HSFA 5LHGA 1FBUA 2EFPA 3E6CC 3RIRA 4HDVA 2KIFA 1K79A 4LB5A 4XSXF 3TDUC 3EYYA 4KIBA 4HZFA 1BM9A 3BPVA 4MQ9F 2CO5A 3J81Z 1EH6A 4ENMA 1R7JA 1MJBA 3QRFF 2D2WA 4XLNF 1YTYA 5ILUA 3F8NA 3JW4A 1O57A 1ZLKA 3L00A 5EEHA 3M1EA 5J8CA 2JPBA 4LK0F 3WTWC 1YW7A 3JAMK 2PFBA 2XAFA 1QZYA 3RPQA 1P6RA 4EJTA 1AOYA 2Z5UA 3ML6A 5BPDA 1DDNA 2DFIA 3JAMZ 1ZHFA 4Z2YA 3KP4A 4GXOA 5LEJA 4EV0A 1Z6RA 2GZWA 3GXOA 1LDKB 3GLXA 1QGPA 4ZZLA 4LLGF 5ILVA 1W7PB 5FD5A 2CFXA 1SD4A 4JBAA 5DCMB 5DYMA 4R8HA 3VODA 1HW2A 1YYVA 1KU9A 1ODDA 4ASNA 4M72A 2F5CA 1I1SA 3ZN0A 3BJOA 2QZ8A 1IZ1A 4EM2A 1KA8A 1FC3A 1IXCA 5HDGA 3T5XA 4BYYA 1T2KA 2OU2A 4ZZDA 2HGCA 4MNUA 5LHHA 3J80Z 1LEBA 2O0YA 1SFUA 2W84A 3HUGA 3FXRA 4EJVA 3IC7A 5K5QA 4HAMA 5L3CA 2XV4S 4LLNA 1FSEA 2ZMEA 1O3TA 3KZYA 1R58A 5H20A 4Q47A 3OOPA 4HBLA 4O6JA 3HOSA 4HX8A 2P5VA 2V1XA 3GO5A 4EQQA 2A61A 2E7WA 1G6NA 3R6SA 2XVCA 3MAJA 1TQPA 5DD4A 1Z1DA 2K4JA 2FU4A 3KP7A 1SD6A 1LB2A 3DP7A 2DTRA 3KLOA 1FYKA 1LDJA 1AWCA 2VT2A 4BHCA 2XROA 2ZJ2A 2PEXA 3B02A 1KU7A 3PFIA 2W24A 1FWZA 3WTZA 4ZYHA 3COAC 1I5ZA 4PZJA 3CO6C 3I58A 3I64A 4XRFA 3CTAA 2VBZA 2L02A 3MWMA 2ISZA 4HQMA 3F6VA 3GFMA 3F22A 2VBWA 2F5EA 4UV9A 3WTUC 1ON1A 2RKHA 2EFOA 4HOBA 1FBQA 4KIFA 6PAXA 5LGNA 3CLOA 2D45A 3WTSC 4M71A 1R5GA 2A5YB 1P4XA 2TDXA 2FBKA 1B59A 4YFXF 4IRGA 5FB2A 2IRFG 3SHFA 3MCZA 4Q4ZF 3RYRA 1WQ2A 2EFNA 3QU6A 4UVAA 4L0YB 4CYDA 4WK8F 1TQMA 2BBYA 2QVOA 1FP2A 1O7LA 3LAPA 1SMYF 5D5WB 2OD5A 1S3JA 1R00A 2QQ9A 3BDDA 4U0YA 2EJRA 1IF1A 1E17A 2RQPA 3IL2A 3G3ZA 2X0LA 3CJNA 1W5SA 3DF8A 2BEOA 2O3FA 3F21A 2RV8A 2YPRA 4OIPF 4RAZA 2DI3A 4I98B 1YS7A 1FYMA 1IAWA 1XB4A 2HS5A 2HEOA 1YIOA 3B73A 1ZG5A 1IN4A 3C3WA 4MTDA 1XSVA 3DPTA 1TBXA 5BPIA 1J0RA 1D8JA 3E5UA 4UUVA 2M45A 1GXPA 1YLFA 1FT9A 1XGOA 3V7SA 5K5OA 2QM3A 1T6SA 3O3KA 1FY7A 1IRGA 1RNLA 2FXAA 2Q2EA 4RGRA 4Y17A 4H0EA 3V8LA 2FF4A 3ABUA 1IN7A 5TRDA 5LEKA 4L5JA 1CF7A 3S2WA 1S6LA 3QPTA 4YG2F 4HF2A 2YX4A 1XN7A 3TOAA 3LA7A 3Q9SA 1J59A 1OKRA 1OYYA 3P9KA 3ZN1A 2DAOA 4RB3C 4G8XA 2IW5A 3EDPA 2VN2A 1R36A 3KCCA 3HIFA 2VONA 1GXQA 2K02A 2MBFA 1MD0A 2HR3A 3GUDA 5HDNA 4HX7A 3WU1B 3IRRA 4WWCA 3ZMUA 3E6DA 3V7RA 1R1UA 1ZGAA 1XDSA 1ZG1A 1RUOA 2V79A 1R22A 3W6JB 4P9FA 5LBQA 4BAYA 1ON2A 3F3XA 1XD7A 3M7GA 5L3BA 3CUQB 1WRJA 2NYXA 1YFHA 2YR2A 2RDPA 3FXQA 1WSUA 3HRSA 3TQNA 2OBPA 2MC3A 4FT8A 3SFZA 4L9TA 5HDKA 1ZLJA 2V6CA 1ULYA 1T39A 1BIBA 2ZXJA 5DCMA 3QAHA 3C18A 5ERIA 3IKVA 4IF4A 3M9AA 2JTVA 3E6MA 3QOPA 2Y75A 2V1DA 5E1WA 2CWEA 2K4BA 4UV8A 5L3FA 4LK1F 1T38A 2D1VA 3GZ6A 4EGYA 5D5XB 5KK1A 3ZQ7A 4RGSA 1EH7A 2ADUA 1UCRA 3I53A 4WX9A 2RN7A 2CSOA 5CLSA 2WTEA 4IVNA 4A6EA 2AXLA 1R23A 5D4SA 2GA1A 1LDDA 1FNNA 2LNBA 3K1PA 1KQ0A 4I2OA 4HV6A 1IRFA 2LSOA 1HXDA 1RI7A 1XCBA 3LQRA 3TO6A 4RB2C 3G73A 2M1BA 5E17F 2R7FA 3BOQA 4IXAA 3MQ0A 1G3WA 2FSWA 3GX4X 2FE3A 2EB7A 5D5VB 2IJLA 2Z3YA 1UB9A 3T8TA 2ZO4A 4N0BA 4A0ZA 3BWGA 1WI9A 1F1ZA 5DV5A 4CZZA 1BC7C 4B8XA 4BHPA 3RKXA 4YFNF 2A68F 4IHSA 4KA4A 2VOOA 3R0JA 3T8RA 1S7AA 5CVVA 2W85A 3E5XA 3LA2A 5LRSA 4QLCU 1STZA 3KP2A 4HX4A 3U2RA 2NNNA 4EM0B 3F8MA 2DPDA 1XSDA 4GCVA 2YSRA 2Y0MA 3E6BA 3ULQB 3WE2A 4P5OA 4N9HA 1HBXG 3ABTA 2PLYA 3H3ZA 3NRVA 5E8IA 2NRAC 1ZRFA 4ZYDA 4KT5C 5CYVA 5D8LB 4G94A 4DNCA 1KYWA 3KFWX 2HQRA 4K2EA 3M8EA 2OZUA 1B6AA 1RIOH 3KZZA 4KDPA 1MJAA 3TKYA 1U2WA 1HKSA 2CYYA 1DPRA 4KN4X 1O3SA 4HLXA 1G3SA 1USSA 2DU9A 5LGTA 3K69A 3VOEA 1XGSA 5JFRA 2IA2A 5F1RA 1K78B 5H6QA 5KVRA 4I0BA 4M73A 1BN5A 4WXCA 4IHTA 2EFQA 1GHCA 2ELHA 1I6XA 1ZARA 4UVCA 5ICEA 3I4PA 5FO5A 3WGHA 1ZN2A 1HSTA 2HZTA 2HOEA 3NQOA 1Z7UA 5K1YA 2COMA 3GW2A 1BI2A 3DPLC 3P9IA 3F23A 4RGUA 2J5OA 4ZYEA 2PJPA 5HS8A 2IA1A 1X3UA 2QBYB 1TQIA 4I0AA 3JTHA 3RI4A 1IUYA 3JSPA 2QYOA 4NHJA 1T0FA 4IRHA 4P9UA 2QQBA 1OR7A 3Q9VA 1K6OA 1USTA 3HTSB 3I71A 3AAFA 1OYIA 2HWVA 5FFXA 4L9JA 3KP3A 2EV6A 3EUHA 2JT1A 3VFZA 4OMYA 2GA2A 3I59A 2JRTA 2DT5A 1MDMA 2G9WA 5FFZA 3RYPA 2PBIA 2QQAA 2IP2A 2M30A 3BP8A 4GO1A 3M8FA 3BY6A 1J7KA 4PDKA 1W7PA 3KP6A 4ESBA 4G6QA 3RJPA 4A6DA 2HTJA 1B9MA 2EV5A 3IWFA 2W57A 2IA0A 4AIKA 4M9XA 2PI0A 4Q48A 4M6XA 3HRTA 2X4HA 5HVQC 3PQJA 4BH9A 2OA4A 3DQVC 3SQNA 1C0WA 1JHHA 4XBFA 3HHHA 3WTTC 4CHUA 3NEUA 4IJAA 2AS5F 3KEQA 5ICGA 4UVBA 5FD6A 2P4WA 2C6YA 1J2XA 4G6DA 1LNWA 2FMLA 3TOBA 4B09A 4GGGA 3HOTA 1RZ4A 4RAYA 1HW5A 2OQGA 2CG4A 3ZMDA 2K7LA 1JHFA 3FHZA 2DBBA 3P7NA 5CVUA 4A12A 2QWWA 5CVIA 3HRUA 3LQQA 2VC1A 2PQ8A 4UHTA 2MA3A 1PDNC 4LB6B 3MZHA 2FMYA 4U7DA 3FMRA 3N4MA 4ESJA 4LG0B 3CUOA 3R60A 1DPUA 3LA3A 3DV8A 4OIRF 2VT3A 3HTUA 3KP5A 3J81K 1O7FA 3WTXC 4L0ZB 4L9VA 1I27A 1H9GA 3ZMSA 2BYVE 2STWA 4LMYA 3PQKA 4EJWA 2FA5A 2PN6A 2F5FA 2LF8A 1SMTA 3DFGA 4JQFA 1LQ1A 2F2EA 2H27A 1JXSA 3W6KB 3VEPA 5E8GA 4G7HF 1H0MA 3BZ6A 1EH8A 1TNTA 2F5DA 4GYGA 4R79A 1QPMA 2MLKA 1S7OA 5IT9Z 1ZGJA 3V8JA 3WE3A 3FZVA 1XDUA 3VB2A 1PUEE 2R3SA 4RB1A 4EJUA 4G7ZF 1O3QA 2IPQX 2KIMA 3JSOA 3GYHX 1FYLA 4ZYGA 4KUMA 2DPUA 2XUBA 2IT0A 1ZRCA 1XMKA 3ECHA 3RPUA 3SXYA 4MHGA 1IXRC 1BI0A 3GWZA 3FX3A 2RVCA 3RKYA 1FZPB 2DK5A 1YW9A 2LKPA 5HLGA 2CQKA 5D6FA 1ZYRF 4MTEA 4EJOA 1J75A 4AD9A 2ZBKA 2FOKA 2GWRA 2QENA 2XAJA 1U5TC 2DQLA 2HFHA 2EFWA 2P5KA 5E1ZB 1WWXA 1JGSA 2XASA 2J5PA 5ILSA 4ENNA 1J5YA 1QQIA 1FBSA 1QNTA 3RDIA 2P7CB 2ZFWA 4IPAA 3QPHA 1S29A 3ROUA 1K78A 3CO7C 2Q0OA 3SZPA 4NB5A 3FWEA 2KJBA 4DQ2A 4PGGA 3FMSA 2XAHA 3GEZA 1U3EM 3U9GA 3FM3A 2P5LC 1U5TA 3V4GA 1XCVA 2QUFA 3HRMA 3BJAA 3GFIA 3WGIA 2VC0A 3DKWA 4KN7X 4EGZA 4IRIA 2BGCA 1SD7A 4LJZF 5F64A 1BI1A 2HKOA 1YS6A 1R5HA 5DUIA 2QBYA 4ENJA 3WGGA 4HW0A 1B1BA 3ZMZA 3MEXA 4M9SA 2VBYA 2KIUA 4RGXA 3T0YA 4RB0A 3RTRA 1G3YA 3REOA 3FXUA 2H6BA 2P7VB 1FSHA 4EVIA 1P2FA 1Y0UA 4JK1X 3IRQA 3ZP5A 3TO7A 1KGSA 1U6GA 4LLLA 3BPXA 4WCGA 3T1BA 3DEUA 2E1CA 1S8NA 4HV5A 1U8RA 5EEGA 1BOAA 4S04A 1B9NA 4CO8A 3CUQA 4GYIA 3F72A 2V1UA 1MDMB 3TO9A 2EA2A 5J8FA 3R4KA 4KYWA 2Z33A 1D3YA 2GXGA 2ZCWA 1KYZA 4KMUX 1OYWA 1KQ8A 1OPCA 3R61A 1TTYA 3IWZA 2MD5A 2H6CA 3TDZC 1Z6TA 2E7XA 1J9IA 5IT3A 2Z9OA 1MZBA 4O3MA 1SAXA 2EK5A 4CDGA 1EV7A 2Y48A 3F6OA 1MGTA 2DO7A 1O3RA 5BS6A 4YIFA 2V9VA 4LD5A 3ISPA 1SFXA 4FX4A 1FOKA 1VTNC 3MZYA 1FX7A 3QP5A 4L9NA 2XGXA 2ACJA 3K2ZA 2H09A 1BI3A 1V4RA 4UNOA 3FMQA 4S05A 2YX7A 3F8CA 4BNCA 2VE9A 5HS7A 4QWQA 5L3GA 4KMFA 4Y13A 1U5TB 2XIGA 2ZNZA 3HSEA 4EM1A 3QP6A 5AONA 4OIQF 2FNAA 1U78A 2DW4A 2XAGA 1LVAA 1ZRDA 3U1DA 4A5MA 1XMAA 1P4AA 5JVTA 2P8TA 3BJ6A 4BQAA 1T98A 1TNSA 3EETA 4A0YA 4Y15A 4ENKA 5E1XA 2HDCA 3WG9A 1ZREA 5FLXZ 2HYGD 2WWYA 1KU3A 2WV0A 3ZPLA 4P96A 3LWFA 2VODA 2UWMA 2H94A 1R1VA 3N97A 2KJCA 2PMUA 2BE5F 4HDUA 4U0VA 1R1TA 1P92A 4ETSA 3I59B 2ZKZA 2VE8A 3H3UA 3IKTA 2FNPA 4R1HA 2OQRA 5ICCA 3OV8A 5FLXK 4KNYA 1TW3A 2A6EF 4OOIA 1IXSB 1NHAA 2LF7A 2O03A 4O5VA 1DUXC 2FBHA 4RS8A 5JR3A 5ED4A 3KETA 4PGHA 3ERED 1LJ9A 4WXDA 1WKMA 2L4MA 2RC4A 2CGPA 2MLGA 3HSRA 1SFEA 1GVJA 3RKWA 4A2UA 3GFJA 4N9IA 2G7UA 1F5TA 5BQTA 5LLQA 4OIOF 3CUQC 2GXBA 1HW1A 1MJ9A 4A5NA 1G3TA 3KE2A 4HLYA 3ECOA 4M9ZA 2B0LA 1BBYA 4M6YA 3GF2A 2JZYA 4ON0A 4TV7A 4BXUA 5BOXA 1Z05A 2P6TA 2XRNA 2A3SA 1FP1D 3LAJA 3I54A 3E97A 1MKMA 4OINF 1QBJA 5AIQA 5L3EA 2ISYA 4L18B 2EA4A 5D5UB 3O6BB 5CVJA 2O6GE 2IVMA 2ETHA 1Z9CA 1LEAA 4WXHA 5E18F 1A04A 3FF5A 4MEXF 2MH9A 1F4KA 4F7ZA 2YU3A 3GVAA 1Z91A 2PMHA 4FHTA 2HTSA 3ZMTA 2G7HA 4KFCA 2QLZA 5AIPA 2DQRA 2ZNYA 4MGRA 5ICFA 1YG2A 5HS9A 4L5IA 3MFKA 1IW7F 1OMIA 2O8XA 5D4RA 4LFUA 4CXFA 2FRHA 2RGVA 5LGUA 1PP7U 2XAQA 2KRFA 1D5VA 1QZZA 2K86A 4AWXB 2LDUA 5A2QZ 1HKTA 3DXJF 3J80K 4I01A 4U0WA 4HYEA 5D6EA 2XKPA 2Z99A 2OAZA 5TJJA 1W7PD 3CDHA 2ESNA 3WTVC 4I7HA 2EV0A 2EWNA 3K9TA 1YQAA 1L3LA 1H9TA 1RUNA 3F8FA 2P6SA 4KICA 2RNJA 2XKOA 3GZ5A 2HYFA 3QU3A 2VXZA 5DDGA 1UHWA 4WF2A 5CVRA 4D0PA 3K0LA 1PP8F 3H92A 1KU2A 5LRRA 1I1GA 2VBXA 3EQLF 3IHUA 4G9YA 3C7JA 1XGMA 2DK8A 5HLIA 2A6HF 5A2QK 1YW8A 2M87A 5BMZA 1D8KA 2R7DA 3HHGA 2W25A 1ZH5A 3V7CA 2M8EA 2FEZA 2ZMEB 3R0AA 1IN6A 3Q5FA 4AVPA 4M74A 2D1HA 5DD8A 2A07F 4NQWA 1IN5A 1FLIA 2MH2A 2KKOA 4G7OF 1G4DA 3HYIA 1ZG3A 3TGNA 5FGMA 4AIHA 1TW2A 4ZH4F 2GQQA 1BC8C 5CJ9A 2UXNA 3L2CA 5E20A 2FQ3A 3I5UA 2CW0F 4LG0A 1HSJA 2NAZA 3K1NA 4I02A 2FBIA 1E2XA 4CGZA 4HF1A 4UXNA 2M5WA 2NNYA 3E3VA 4I09A 3FM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B4A A;  3L9F A;  4XSZ F;  2Q8K A;  2JPC A;  1UFM A;  2VOP A;  5IT9 K;  2XHK A;  1ZAO A;  4XLP F;  1V3F A;  1L0O C;  3E5Q A;  4KIG A;  5J6X A;  2L54 A;  1K7A A;  2PG4 A;  3ZMV A;  3JTG A;  4EMS A;  2A69 F;  3F8B A;  1JE8 A;  4ESF A;  2UZK A;  1F9N A;  3GFL A;  2NS0 A;  4OU0 A;  3KEO A;  4P55 A;  1BIA A;  5JHU A;  2JSC A;  4MEY F;  4U7B A;  1QO0 D;  5K5R A;  1XGN A;  1CF7 B;  1SD5 A;  3V8K A;  2WC2 A;  3WOD F;  4LGW A;  3I0T A;  2STT A;  3D5L A;  3WU0 A;  2DLL A;  3D0S A;  3BRO A;  3P9C A;  3O2P E;  3J7A O;  4YFK F;  2UXX A;  5HOO A;  2L4A A;  1BJA A;  5JI6 A;  4BHB A;  3LFK A;  4HA8 A;  3K1M A;  5D8K B;  2L3D A;  2OZ6 A;  4MQV A;  3EYI A;  1CGP A;  1FPQ A;  2K27 A;  4U88 A;  2ESH A;  2HKX A;  5DUK A;  1UHM A;  4YII A;  4CIC A;  1Q1H A;  4AIJ A;  1TLH B;  3ELK A;  2L01 A;  4A0X A;  4HQE A;  1ONV A;  3KLN A;  5DCF A;  4E70 A;  1P4W A;  1W4M A;  3SZT A;  4HF0 A;  3WTY C;  5HLH A;  5L3D A;  1IN8 A;  1HQC A;  1REP C;  1XSX A;  3LST A;  3C1D A;  2O61 A;  4PCQ A;  1HKQ A;  1KQ9 A;  3L7W A;  1YO5 C;  1DP7 P;  1W5T A;  5DEQ A;  2GIV A;  2E1N A;  5H6R A;  5LHI A;  2HQN A;  5F6F A;  4FX0 A;  4Q5S F;  3L09 A;  2GAU A;  4OMZ A;  2BV6 A;  3HSF A;  5LHG A;  1FBU A;  2EFP A;  3E6C C;  3RIR A;  4HDV A;  2KIF A;  1K79 A;  4LB5 A;  4XSX F;  3TDU C;  3EYY A;  4KIB A;  4HZF A;  1BM9 A;  3BPV A;  4MQ9 F;  2CO5 A;  3J81 Z;  1EH6 A;  4ENM A;  1R7J A;  1MJB A;  3QRF F;  2D2W A;  4XLN F;  1YTY A;  5ILU A;  3F8N A;  3JW4 A;  1O57 A;  1ZLK A;  3L00 A;  5EEH A;  3M1E A;  5J8C A;  2JPB A;  4LK0 F;  3WTW C;  1YW7 A;  3JAM K;  2PFB A;  2XAF A;  1QZY A;  3RPQ A;  1P6R A;  4EJT A;  1AOY A;  2Z5U A;  3ML6 A;  5BPD A;  1DDN A;  2DFI A;  3JAM Z;  1ZHF A;  4Z2Y A;  3KP4 A;  4GXO A;  5LEJ A;  4EV0 A;  1Z6R A;  2GZW A;  3GXO A;  1LDK B;  3GLX A;  1QGP A;  4ZZL A;  4LLG F;  5ILV A;  1W7P B;  5FD5 A;  2CFX A;  1SD4 A;  4JBA A;  5DCM B;  5DYM A;  4R8H A;  3VOD A;  1HW2 A;  1YYV A;  1KU9 A;  1ODD A;  4ASN A;  4M72 A;  2F5C A;  1I1S A;  3ZN0 A;  3BJO A;  2QZ8 A;  1IZ1 A;  4EM2 A;  1KA8 A;  1FC3 A;  1IXC A;  5HDG A;  3T5X A;  4BYY A;  1T2K A;  2OU2 A;  4ZZD A;  2HGC A;  4MNU A;  5LHH A;  3J80 Z;  1LEB A;  2O0Y A;  1SFU A;  2W84 A;  3HUG A;  3FXR A;  4EJV A;  3IC7 A;  5K5Q A;  4HAM A;  5L3C A;  2XV4 S;  4LLN A;  1FSE A;  2ZME A;  1O3T A;  3KZY A;  1R58 A;  5H20 A;  4Q47 A;  3OOP A;  4HBL A;  4O6J A;  3HOS A;  4HX8 A;  2P5V A;  2V1X A;  3GO5 A;  4EQQ A;  2A61 A;  2E7W A;  1G6N A;  3R6S A;  2XVC A;  3MAJ A;  1TQP A;  5DD4 A;  1Z1D A;  2K4J A;  2FU4 A;  3KP7 A;  1SD6 A;  1LB2 A;  3DP7 A;  2DTR A;  3KLO A;  1FYK A;  1LDJ A;  1AWC A;  2VT2 A;  4BHC A;  2XRO A;  2ZJ2 A;  2PEX A;  3B02 A;  1KU7 A;  3PFI A;  2W24 A;  1FWZ A;  3WTZ A;  4ZYH A;  3COA C;  1I5Z A;  4PZJ A;  3CO6 C;  3I58 A;  3I64 A;  4XRF A;  3CTA A;  2VBZ A;  2L02 A;  3MWM A;  2ISZ A;  4HQM A;  3F6V A;  3GFM A;  3F22 A;  2VBW A;  2F5E A;  4UV9 A;  3WTU C;  1ON1 A;  2RKH A;  2EFO A;  4HOB A;  1FBQ A;  4KIF A;  6PAX A;  5LGN A;  3CLO A;  2D45 A;  3WTS C;  4M71 A;  1R5G A;  2A5Y B;  1P4X A;  2TDX A;  2FBK A;  1B59 A;  4YFX F;  4IRG A;  5FB2 A;  2IRF G;  3SHF A;  3MCZ A;  4Q4Z F;  3RYR A;  1WQ2 A;  2EFN A;  3QU6 A;  4UVA A;  4L0Y B;  4CYD A;  4WK8 F;  1TQM A;  2BBY A;  2QVO A;  1FP2 A;  1O7L A;  3LAP A;  1SMY F;  5D5W B;  2OD5 A;  1S3J A;  1R00 A;  2QQ9 A;  3BDD A;  4U0Y A;  2EJR A;  1IF1 A;  1E17 A;  2RQP A;  3IL2 A;  3G3Z A;  2X0L A;  3CJN A;  1W5S A;  3DF8 A;  2BEO A;  2O3F A;  3F21 A;  2RV8 A;  2YPR A;  4OIP F;  4RAZ A;  2DI3 A;  4I98 B;  1YS7 A;  1FYM A;  1IAW A;  1XB4 A;  2HS5 A;  2HEO A;  1YIO A;  3B73 A;  1ZG5 A;  1IN4 A;  3C3W A;  4MTD A;  1XSV A;  3DPT A;  1TBX A;  5BPI A;  1J0R A;  1D8J A;  3E5U A;  4UUV A;  2M45 A;  1GXP A;  1YLF A;  1FT9 A;  1XGO A;  3V7S A;  5K5O A;  2QM3 A;  1T6S A;  3O3K A;  1FY7 A;  1IRG A;  1RNL A;  2FXA A;  2Q2E A;  4RGR A;  4Y17 A;  4H0E A;  3V8L A;  2FF4 A;  3ABU A;  1IN7 A;  5TRD A;  5LEK A;  4L5J A;  1CF7 A;  3S2W A;  1S6L A;  3QPT A;  4YG2 F;  4HF2 A;  2YX4 A;  1XN7 A;  3TOA A;  3LA7 A;  3Q9S A;  1J59 A;  1OKR A;  1OYY A;  3P9K A;  3ZN1 A;  2DAO A;  4RB3 C;  4G8X A;  2IW5 A;  3EDP A;  2VN2 A;  1R36 A;  3KCC A;  3HIF A;  2VON A;  1GXQ A;  2K02 A;  2MBF A;  1MD0 A;  2HR3 A;  3GUD A;  5HDN A;  4HX7 A;  3WU1 B;  3IRR A;  4WWC A;  3ZMU A;  3E6D A;  3V7R A;  1R1U A;  1ZGA A;  1XDS A;  1ZG1 A;  1RUO A;  2V79 A;  1R22 A;  3W6J B;  4P9F A;  5LBQ A;  4BAY A;  1ON2 A;  3F3X A;  1XD7 A;  3M7G A;  5L3B A;  3CUQ B;  1WRJ A;  2NYX A;  1YFH A;  2YR2 A;  2RDP A;  3FXQ A;  1WSU A;  3HRS A;  3TQN A;  2OBP A;  2MC3 A;  4FT8 A;  3SFZ A;  4L9T A;  5HDK A;  1ZLJ A;  2V6C A;  1ULY A;  1T39 A;  1BIB A;  2ZXJ A;  5DCM A;  3QAH A;  3C18 A;  5ERI A;  3IKV A;  4IF4 A;  3M9A A;  2JTV A;  3E6M A;  3QOP A;  2Y75 A;  2V1D A;  5E1W A;  2CWE A;  2K4B A;  4UV8 A;  5L3F A;  4LK1 F;  1T38 A;  2D1V A;  3GZ6 A;  4EGY A;  5D5X B;  5KK1 A;  3ZQ7 A;  4RGS A;  1EH7 A;  2ADU A;  1UCR A;  3I53 A;  4WX9 A;  2RN7 A;  2CSO A;  5CLS A;  2WTE A;  4IVN A;  4A6E A;  2AXL A;  1R23 A;  5D4S A;  2GA1 A;  1LDD A;  1FNN A;  2LNB A;  3K1P A;  1KQ0 A;  4I2O A;  4HV6 A;  1IRF A;  2LSO A;  1HXD A;  1RI7 A;  1XCB A;  3LQR A;  3TO6 A;  4RB2 C;  3G73 A;  2M1B A;  5E17 F;  2R7F A;  3BOQ A;  4IXA A;  3MQ0 A;  1G3W A;  2FSW A;  3GX4 X;  2FE3 A;  2EB7 A;  5D5V B;  2IJL A;  2Z3Y A;  1UB9 A;  3T8T A;  2ZO4 A;  4N0B A;  4A0Z A;  3BWG A;  1WI9 A;  1F1Z A;  5DV5 A;  4CZZ A;  1BC7 C;  4B8X A;  4BHP A;  3RKX A;  4YFN F;  2A68 F;  4IHS A;  4KA4 A;  2VOO A;  3R0J A;  3T8R A;  1S7A A;  5CVV A;  2W85 A;  3E5X A;  3LA2 A;  5LRS A;  4QLC U;  1STZ A;  3KP2 A;  4HX4 A;  3U2R A;  2NNN A;  4EM0 B;  3F8M A;  2DPD A;  1XSD A;  4GCV A;  2YSR A;  2Y0M A;  3E6B A;  3ULQ B;  3WE2 A;  4P5O A;  4N9H A;  1HBX G;  3ABT A;  2PLY A;  3H3Z A;  3NRV A;  5E8I A;  2NRA C;  1ZRF A;  4ZYD A;  4KT5 C;  5CYV A;  5D8L B;  4G94 A;  4DNC A;  1KYW A;  3KFW X;  2HQR A;  4K2E A;  3M8E A;  2OZU A;  1B6A A;  1RIO H;  3KZZ A;  4KDP A;  1MJA A;  3TKY A;  1U2W A;  1HKS A;  2CYY A;  1DPR A;  4KN4 X;  1O3S A;  4HLX A;  1G3S A;  1USS A;  2DU9 A;  5LGT A;  3K69 A;  3VOE A;  1XGS A;  5JFR A;  2IA2 A;  5F1R A;  1K78 B;  5H6Q A;  5KVR A;  4I0B A;  4M73 A;  1BN5 A;  4WXC A;  4IHT A;  2EFQ A;  1GHC A;  2ELH A;  1I6X A;  1ZAR A;  4UVC A;  5ICE A;  3I4P A;  5FO5 A;  3WGH A;  1ZN2 A;  1HST A;  2HZT A;  2HOE A;  3NQO A;  1Z7U A;  5K1Y A;  2COM A;  3GW2 A;  1BI2 A;  3DPL C;  3P9I A;  3F23 A;  4RGU A;  2J5O A;  4ZYE A;  2PJP A;  5HS8 A;  2IA1 A;  1X3U A;  2QBY B;  1TQI A;  4I0A A;  3JTH A;  3RI4 A;  1IUY A;  3JSP A;  2QYO A;  4NHJ A;  1T0F A;  4IRH A;  4P9U A;  2QQB A;  1OR7 A;  3Q9V A;  1K6O A;  1UST A;  3HTS B;  3I71 A;  3AAF A;  1OYI A;  2HWV A;  5FFX A;  4L9J A;  3KP3 A;  2EV6 A;  3EUH A;  2JT1 A;  3VFZ A;  4OMY A;  2GA2 A;  3I59 A;  2JRT A;  2DT5 A;  1MDM A;  2G9W A;  5FFZ A;  3RYP A;  2PBI A;  2QQA A;  2IP2 A;  2M30 A;  3BP8 A;  4GO1 A;  3M8F A;  3BY6 A;  1J7K A;  4PDK A;  1W7P A;  3KP6 A;  4ESB A;  4G6Q A;  3RJP A;  4A6D A;  2HTJ A;  1B9M A;  2EV5 A;  3IWF A;  2W57 A;  2IA0 A;  4AIK A;  4M9X A;  2PI0 A;  4Q48 A;  4M6X A;  3HRT A;  2X4H A;  5HVQ C;  3PQJ A;  4BH9 A;  2OA4 A;  3DQV C;  3SQN A;  1C0W A;  1JHH A;  4XBF A;  3HHH A;  3WTT C;  4CHU A;  3NEU A;  4IJA A;  2AS5 F;  3KEQ A;  5ICG A;  4UVB A;  5FD6 A;  2P4W A;  2C6Y A;  1J2X A;  4G6D A;  1LNW A;  2FML A;  3TOB A;  4B09 A;  4GGG A;  3HOT A;  1RZ4 A;  4RAY A;  1HW5 A;  2OQG A;  2CG4 A;  3ZMD A;  2K7L A;  1JHF A;  3FHZ A;  2DBB A;  3P7N A;  5CVU A;  4A12 A;  2QWW A;  5CVI A;  3HRU A;  3LQQ A;  2VC1 A;  2PQ8 A;  4UHT A;  2MA3 A;  1PDN C;  4LB6 B;  3MZH A;  2FMY A;  4U7D A;  3FMR A;  3N4M A;  4ESJ A;  4LG0 B;  3CUO A;  3R60 A;  1DPU A;  3LA3 A;  3DV8 A;  4OIR F;  2VT3 A;  3HTU A;  3KP5 A;  3J81 K;  1O7F A;  3WTX C;  4L0Z B;  4L9V A;  1I27 A;  1H9G A;  3ZMS A;  2BYV E;  2STW A;  4LMY A;  3PQK A;  4EJW A;  2FA5 A;  2PN6 A;  2F5F A;  2LF8 A;  1SMT A;  3DFG A;  4JQF A;  1LQ1 A;  2F2E A;  2H27 A;  1JXS A;  3W6K B;  3VEP A;  5E8G A;  4G7H F;  1H0M A;  3BZ6 A;  1EH8 A;  1TNT A;  2F5D A;  4GYG A;  4R79 A;  1QPM A;  2MLK A;  1S7O A;  5IT9 Z;  1ZGJ A;  3V8J A;  3WE3 A;  3FZV A;  1XDU A;  3VB2 A;  1PUE E;  2R3S A;  4RB1 A;  4EJU A;  4G7Z F;  1O3Q A;  2IPQ X;  2KIM A;  3JSO A;  3GYH X;  1FYL A;  4ZYG A;  4KUM A;  2DPU A;  2XUB A;  2IT0 A;  1ZRC A;  1XMK A;  3ECH A;  3RPU A;  3SXY A;  4MHG A;  1IXR C;  1BI0 A;  3GWZ A;  3FX3 A;  2RVC A;  3RKY A;  1FZP B;  2DK5 A;  1YW9 A;  2LKP A;  5HLG A;  2CQK A;  5D6F A;  1ZYR F;  4MTE A;  4EJO A;  1J75 A;  4AD9 A;  2ZBK A;  2FOK A;  2GWR A;  2QEN A;  2XAJ A;  1U5T C;  2DQL A;  2HFH A;  2EFW A;  2P5K A;  5E1Z B;  1WWX A;  1JGS A;  2XAS A;  2J5P A;  5ILS A;  4ENN A;  1J5Y A;  1QQI A;  1FBS A;  1QNT A;  3RDI A;  2P7C B;  2ZFW A;  4IPA A;  3QPH A;  1S29 A;  3ROU A;  1K78 A;  3CO7 C;  2Q0O A;  3SZP A;  4NB5 A;  3FWE A;  2KJB A;  4DQ2 A;  4PGG A;  3FMS A;  2XAH A;  3GEZ A;  1U3E M;  3U9G A;  3FM3 A;  2P5L C;  1U5T A;  3V4G A;  1XCV A;  2QUF A;  3HRM A;  3BJA A;  3GFI A;  3WGI A;  2VC0 A;  3DKW A;  4KN7 X;  4EGZ A;  4IRI A;  2BGC A;  1SD7 A;  4LJZ F;  5F64 A;  1BI1 A;  2HKO A;  1YS6 A;  1R5H A;  5DUI A;  2QBY A;  4ENJ A;  3WGG A;  4HW0 A;  1B1B A;  3ZMZ A;  3MEX A;  4M9S A;  2VBY A;  2KIU A;  4RGX A;  3T0Y A;  4RB0 A;  3RTR A;  1G3Y A;  3REO A;  3FXU A;  2H6B A;  2P7V B;  1FSH A;  4EVI A;  1P2F A;  1Y0U A;  4JK1 X;  3IRQ A;  3ZP5 A;  3TO7 A;  1KGS A;  1U6G A;  4LLL A;  3BPX A;  4WCG A;  3T1B A;  3DEU A;  2E1C A;  1S8N A;  4HV5 A;  1U8R A;  5EEG A;  1BOA A;  4S04 A;  1B9N A;  4CO8 A;  3CUQ A;  4GYI A;  3F72 A;  2V1U A;  1MDM B;  3TO9 A;  2EA2 A;  5J8F A;  3R4K A;  4KYW A;  2Z33 A;  1D3Y A;  2GXG A;  2ZCW A;  1KYZ A;  4KMU X;  1OYW A;  1KQ8 A;  1OPC A;  3R61 A;  1TTY A;  3IWZ A;  2MD5 A;  2H6C A;  3TDZ C;  1Z6T A;  2E7X A;  1J9I A;  5IT3 A;  2Z9O A;  1MZB A;  4O3M A;  1SAX A;  2EK5 A;  4CDG A;  1EV7 A;  2Y48 A;  3F6O A;  1MGT A;  2DO7 A;  1O3R A;  5BS6 A;  4YIF A;  2V9V A;  4LD5 A;  3ISP A;  1SFX A;  4FX4 A;  1FOK A;  1VTN C;  3MZY A;  1FX7 A;  3QP5 A;  4L9N A;  2XGX A;  2ACJ A;  3K2Z A;  2H09 A;  1BI3 A;  1V4R A;  4UNO A;  3FMQ A;  4S05 A;  2YX7 A;  3F8C A;  4BNC A;  2VE9 A;  5HS7 A;  4QWQ A;  5L3G A;  4KMF A;  4Y13 A;  1U5T B;  2XIG A;  2ZNZ A;  3HSE A;  4EM1 A;  3QP6 A;  5AON A;  4OIQ F;  2FNA A;  1U78 A;  2DW4 A;  2XAG A;  1LVA A;  1ZRD A;  3U1D A;  4A5M A;  1XMA A;  1P4A A;  5JVT A;  2P8T A;  3BJ6 A;  4BQA A;  1T98 A;  1TNS A;  3EET A;  4A0Y A;  4Y15 A;  4ENK A;  5E1X A;  2HDC A;  3WG9 A;  1ZRE A;  5FLX Z;  2HYG D;  2WWY A;  1KU3 A;  2WV0 A;  3ZPL A;  4P96 A;  3LWF A;  2VOD A;  2UWM A;  2H94 A;  1R1V A;  3N97 A;  2KJC A;  2PMU A;  2BE5 F;  4HDU A;  4U0V A;  1R1T A;  1P92 A;  4ETS A;  3I59 B;  2ZKZ A;  2VE8 A;  3H3U A;  3IKT A;  2FNP A;  4R1H A;  2OQR A;  5ICC A;  3OV8 A;  5FLX K;  4KNY A;  1TW3 A;  2A6E F;  4OOI A;  1IXS B;  1NHA A;  2LF7 A;  2O03 A;  4O5V A;  1DUX C;  2FBH A;  4RS8 A;  5JR3 A;  5ED4 A;  3KET A;  4PGH A;  3ERE D;  1LJ9 A;  4WXD A;  1WKM A;  2L4M A;  2RC4 A;  2CGP A;  2MLG A;  3HSR A;  1SFE A;  1GVJ A;  3RKW A;  4A2U A;  3GFJ A;  4N9I A;  2G7U A;  1F5T A;  5BQT A;  5LLQ A;  4OIO F;  3CUQ C;  2GXB A;  1HW1 A;  1MJ9 A;  4A5N A;  1G3T A;  3KE2 A;  4HLY A;  3ECO A;  4M9Z A;  2B0L A;  1BBY A;  4M6Y A;  3GF2 A;  2JZY A;  4ON0 A;  4TV7 A;  4BXU A;  5BOX A;  1Z05 A;  2P6T A;  2XRN A;  2A3S A;  1FP1 D;  3LAJ A;  3I54 A;  3E97 A;  1MKM A;  4OIN F;  1QBJ A;  5AIQ A;  5L3E A;  2ISY A;  4L18 B;  2EA4 A;  5D5U B;  3O6B B;  5CVJ A;  2O6G E;  2IVM A;  2ETH A;  1Z9C A;  1LEA A;  4WXH A;  5E18 F;  1A04 A;  3FF5 A;  4MEX F;  2MH9 A;  1F4K A;  4F7Z A;  2YU3 A;  3GVA A;  1Z91 A;  2PMH A;  4FHT A;  2HTS A;  3ZMT A;  2G7H A;  4KFC A;  2QLZ A;  5AIP A;  2DQR A;  2ZNY A;  4MGR A;  5ICF A;  1YG2 A;  5HS9 A;  4L5I A;  3MFK A;  1IW7 F;  1OMI A;  2O8X A;  5D4R A;  4LFU A;  4CXF A;  2FRH A;  2RGV A;  5LGU A;  1PP7 U;  2XAQ A;  2KRF A;  1D5V A;  1QZZ A;  2K86 A;  4AWX B;  2LDU A;  5A2Q Z;  1HKT A;  3DXJ F;  3J80 K;  4I01 A;  4U0W A;  4HYE A;  5D6E A;  2XKP A;  2Z99 A;  2OAZ A;  5TJJ A;  1W7P D;  3CDH A;  2ESN A;  3WTV C;  4I7H A;  2EV0 A;  2EWN A;  3K9T A;  1YQA A;  1L3L A;  1H9T A;  1RUN A;  3F8F A;  2P6S A;  4KIC A;  2RNJ A;  2XKO A;  3GZ5 A;  2HYF A;  3QU3 A;  2VXZ A;  5DDG A;  1UHW A;  4WF2 A;  5CVR A;  4D0P A;  3K0L A;  1PP8 F;  3H92 A;  1KU2 A;  5LRR A;  1I1G A;  2VBX A;  3EQL F;  3IHU A;  4G9Y A;  3C7J A;  1XGM A;  2DK8 A;  5HLI A;  2A6H F;  5A2Q K;  1YW8 A;  2M87 A;  5BMZ A;  1D8K A;  2R7D A;  3HHG A;  2W25 A;  1ZH5 A;  3V7C A;  2M8E A;  2FEZ A;  2ZME B;  3R0A A;  1IN6 A;  3Q5F A;  4AVP A;  4M74 A;  2D1H A;  5DD8 A;  2A07 F;  4NQW A;  1IN5 A;  1FLI A;  2MH2 A;  2KKO A;  4G7O F;  1G4D A;  3HYI A;  1ZG3 A;  3TGN A;  5FGM A;  4AIH A;  1TW2 A;  4ZH4 F;  2GQQ A;  1BC8 C;  5CJ9 A;  2UXN A;  3L2C A;  5E20 A;  2FQ3 A;  3I5U A;  2CW0 F;  4LG0 A;  1HSJ A;  2NAZ A;  3K1N A;  4I02 A;  2FBI A;  1E2X A;  4CGZ A;  4HF1 A;  4UXN A;  2M5W A;  2NNY A;  3E3V A;  4I09 A;  3FM5 A; 
#chains in the Genus database with same CATH topology
 3OYC A;  3I55 I;  1B4A A;  3L9F A;  2LKX A;  2L5Q A;  4XSZ F;  4BS9 A;  2Q8K A;  2JPC A;  1UFM A;  2DOE A;  2VOP A;  5IT9 K;  2XHK A;  1ZAO A;  4XLP F;  1V3F A;  1U8B A;  1X1B A;  1L0O C;  3E5Q A;  4KIG A;  1JI8 A;  4AUX A;  5J6X A;  2CV1 A;  3CCV I;  2L54 A;  4XOT A;  1K7A A;  5M5W J;  5C4J J;  4RA2 A;  2PG4 A;  3WHC A;  2GLO A;  3ZMV A;  4A3L J;  3JTG A;  2IAI A;  3K4K A;  4EMS A;  2LFB A;  2A69 F;  3F8B A;  3CP8 A;  1ETW A;  3DKX A;  2Y2Z A;  4XRM A;  1JE8 A;  4LOC A;  4ESF A;  3S16 J;  4OWR B;  2UZK A;  5E3O A;  1F9N A;  3GFL A;  2CV2 A;  3PSF A;  1X4O A;  1MBF A;  3H5A A;  3K4L A;  4L5E A;  3CZ6 A;  4NNJ A;  1WJC A;  3CQZ J;  2NS0 A;  2IS6 A;  4OU0 A;  1IG7 A;  3KEO A;  4P55 A;  1BIA A;  1G8X A;  5JHU A;  2JSC A;  2HVS A;  4MEY F;  5EG0 A;  4U7B A;  3GTJ J;  1QO0 D;  3CD6 I;  2EIL H;  4BEH B;  5K5R A;  2DMP A;  3JRA A;  3RZD J;  1YIT I;  1XGN A;  1DU6 A;  1AKH A;  2HXO A;  2PMZ N;  1CF7 B;  3CLQ A;  1SD5 A;  3V8K A;  2WC2 A;  1OR7 C;  3WOD F;  4LGW A;  5HNF A;  1R9T J;  3I0T A;  1BL0 A;  2ZJP F;  2STT A;  2JUC A;  3D5L A;  4C3H J;  1N78 A;  1QA6 A;  3WU0 A;  2DLL A;  3BZC A;  3D0S A;  2WBM A;  3E0J B;  1MMS A;  3BRO A;  4DZP A;  3H0D A;  3P9C A;  4M3D A;  3RQI A;  4A3J J;  1RKT A;  1GV5 A;  3HGG A;  1IRZ A;  3O2P E;  3J7A O;  1PYV A;  4YFK F;  2UXX A;  5HOO A;  4PK4 A;  2L4A A;  1BJA A;  2X48 A;  3FK7 A;  5JI6 A;  4BHB A;  2L9S A;  3ABM H;  3LFK A;  4HA8 A;  1RR7 A;  3K1M A;  5D8K B;  2L3D A;  3BCA A;  1MMG A;  2VIX A;  2OZ6 A;  4MQV A;  3EYI A;  1FTZ A;  1CGP A;  1F36 A;  1FPQ A;  2K27 A;  4U88 A;  2ESH A;  1OCO H;  1SVM A;  2HKX A;  5DUK A;  2EPF A;  1UHM A;  3JRB A;  4YII A;  4CIC A;  2OTJ I;  1Q1H A;  2M7A A;  4AIJ A;  2K40 A;  1TLH B;  3ELK A;  2L01 A;  3VPR A;  4A0X A;  4HQE A;  1A6Q A;  1ONV A;  3KLN A;  1WH7 A;  4FIS A;  2R7Q A;  4XON A;  3CCS I;  5DCF A;  2R7Z J;  4E70 A;  2BY3 A;  1YX3 A;  1P4W A;  1W1W E;  1Y1W J;  1W4M A;  1JGG A;  2BOL A;  3NAR A;  1PUF B;  3SZT A;  3NWS A;  3HBL A;  4HF0 A;  3WTY C;  3DPU A;  5HLH A;  5L3D A;  1IN8 A;  1Y8Q B;  3PIO F;  4Z6Y A;  4BQN A;  1HQC A;  3K4M A;  1REP C;  1J09 A;  2JA6 J;  2XSJ C;  2XSD C;  1XSX A;  4IO9 F;  3TBI A;  3LST A;  3C1D A;  5H2F C;  2O61 A;  2DYS H;  4PCQ A;  2HNH A;  1HKQ A;  1KQ9 A;  3L7W A;  3PIP F;  1TP4 A;  4PJN A;  1YO5 C;  1FOW A;  1H8A C;  2KLO A;  1DP7 P;  1W5T A;  5DEQ A;  3S2D J;  2GIV A;  2HYJ A;  2E1N A;  9ANT A;  5H6R A;  3OYN A;  3M1C A;  5LHI A;  2LLK A;  1SEU A;  1QZE A;  3OL4 A;  2HQN A;  5F6F A;  4FX0 A;  2QSG X;  1ZR4 A;  1X1P A;  4GRI A;  1CQT A;  3L09 A;  3LSI A;  2GAU A;  3MVP A;  4OMZ A;  4Q5S F;  3ZQL A;  1ETQ A;  2BV6 A;  3HSF A;  5LHG A;  3HOU J;  1FBU A;  2R5Z A;  3I4M J;  2EFP A;  3E6C C;  3RIR A;  4HDV A;  2NS7 A;  2KIF A;  1K79 A;  1W36 D;  4E7S A;  2CUF A;  4CUG A;  4LB5 A;  4XSX F;  3TDU C;  2VLA A;  3A2K A;  2K9M A;  2KHM A;  3EYY A;  4KIB A;  2LY9 A;  4HZF A;  5FJ8 J;  4HPQ A;  1BM9 A;  3BPV A;  4MQ9 F;  4CCK A;  1GV2 A;  2CO5 A;  3J81 Z;  1EH6 A;  4ENM A;  1R7J A;  2GIZ A;  3SJM A;  1MJB A;  1BR4 A;  3QRF F;  1ZEL A;  3HPH A;  1RC9 A;  2D2W A;  3H0G J;  4XLN F;  1YTY A;  5ILU A;  3F8N A;  3JW4 A;  1O57 A;  1ZLK A;  3FK6 A;  3L00 A;  3M1E A;  5EEH A;  5J8C A;  4MIM A;  2JPB A;  2M4G A;  2V9K A;  2DFE A;  4LK0 F;  3WTW C;  5EDN A;  3KYL A;  1YW7 A;  2VKV A;  3JAM K;  2PFB A;  2DA1 A;  2XAF A;  1QZY A;  3RPQ A;  1HF0 A;  2CQN A;  1OIS A;  3G1M A;  2M0C A;  1P6R A;  3A4C A;  4EJT A;  1FEX A;  1AOY A;  2Z5U A;  3ML6 A;  1MNM C;  4W1U A;  3DKY A;  5BPD A;  1A31 A;  1ORK A;  3JAM Z;  2DFI A;  1DDN A;  1YJN I;  1ZHF A;  2JA2 A;  1R71 A;  1OCT C;  4Z2Y A;  3CP2 A;  3GCM A;  3KP4 A;  3M07 A;  4CCN A;  5IOZ A;  4IEJ A;  4GXO A;  5LEJ A;  3VYT B;  2ID3 A;  1VQP I;  4EV0 A;  5LD2 C;  1Z6R A;  2WAF A;  2GZW A;  3GXO A;  4XR6 A;  2RAE A;  3DEE A;  2G0E A;  1LDK B;  2O5R A;  4XQF A;  4AU7 A;  3HB9 A;  2LKS A;  4ZDP A;  2E5N A;  3GLX A;  2HZD A;  2IGN A;  1QGP A;  1DP3 A;  4ZZL A;  4LLG F;  1RRJ A;  3HM5 A;  5ILV A;  1W7P B;  5FD5 A;  2CFX A;  1SD4 A;  2M4K A;  4JBA A;  5DCM B;  5DYM A;  4R8H A;  1X19 A;  3VOD A;  1HW2 A;  1YYV A;  2HXI A;  4ZDL A;  1KU9 A;  1ODD A;  4ASN A;  4MO7 A;  4UB6 C;  2YUS A;  3QPS A;  5J40 A;  2Y9Y A;  3G4S I;  3W6V A;  4M72 A;  1MMN A;  2F5C A;  4NUB A;  2LY2 A;  3OY9 A;  3U1K A;  2DA6 A;  1JJ8 C;  1I1S A;  5CPR B;  3ZN0 A;  2O9L A;  3JR9 A;  3ABL H;  3BJO A;  2KIQ A;  2KQR A;  1SVO A;  4RM2 A;  3OYH A;  2QZ8 A;  2LBF B;  3RZO J;  1IZ1 A;  1I39 A;  3MKZ A;  4S0H B;  3PNY A;  1M1E B;  3RCO A;  4EM2 A;  1N25 A;  1OFC X;  1KA8 A;  3O8G A;  1FC3 A;  1IXC A;  5HDG A;  2ZME C;  3T5X A;  5EF6 A;  3D5S C;  2QSH X;  1FTT A;  1V55 H;  2AQF A;  1S72 I;  4NQW B;  3OYG A;  4BYY A;  1T2K A;  2OU2 A;  3DU5 A;  4ZZD A;  2VUM J;  3LOC A;  2HGC A;  2JRM A;  2E35 A;  2B9S A;  1MMA A;  4MNU A;  5LHH A;  4XRS A;  3J80 Z;  3CMA I;  2O0Y A;  1LEB A;  1SFU A;  2N8G A;  2IXS A;  2EH3 A;  2W84 A;  4E7L A;  1VQ6 I;  3ASO H;  3HUG A;  1U9N A;  2UUZ A;  4B1R A;  3FXR A;  3ABK H;  2CUJ A;  4A3M J;  4EJV A;  3CES A;  3SFI A;  2DDB A;  4X1E A;  3IC7 A;  3MD2 A;  5J1Y A;  5K5Q A;  4HAM A;  5L3C A;  2XV4 S;  1G2H A;  4LLN A;  1FSE A;  2ZME A;  1O3T A;  2IS4 A;  3Q0V A;  1D1A A;  3BR6 A;  3OYA A;  3CCJ I;  3KZY A;  3QPL A;  1R58 A;  1XTA A;  5H20 A;  4Q47 A;  3HZJ A;  1ZGW A;  2R7T A;  2XDV A;  3OOP A;  3KYC B;  4HBL A;  1POG A;  2WA0 A;  4FET A;  4O6J A;  3HOS A;  2BW3 A;  2JVG A;  2OF7 A;  3RKQ A;  1T0F C;  4B4C A;  3GTQ J;  4HX8 A;  3OYJ A;  3PO3 J;  4BL0 B;  3DLL F;  4FTH A;  2P5V A;  2LC2 A;  3OSG A;  2V1X A;  3GO5 A;  2DA3 A;  4EQQ A;  2A61 A;  3HDD A;  3RSN A;  2E7W A;  2B7E A;  5J4Y A;  2I8D A;  1VQ4 I;  1G6N A;  3CMY A;  1P9Q C;  2HPI A;  3R6S A;  2L7M P;  2XVC A;  3G1O A;  1HA8 A;  3KYD B;  3MAJ A;  2EQR A;  5J47 A;  4B48 A;  1ACI A;  4G12 A;  1TQP A;  4OAY A;  1IGN A;  3J7Z I;  5DD4 A;  3JRC A;  4JX6 A;  4C3J J;  1Z1D A;  4UUS B;  3CDL A;  2K4J A;  2FU4 A;  1MMD A;  3KP7 A;  2IS2 A;  1SD6 A;  3HEF A;  1LB2 A;  3DP7 A;  4B47 A;  2DTR A;  1WH5 A;  3KLO A;  3L2V A;  1FYK A;  1LDJ A;  1AWC A;  1VQO I;  2VT2 A;  4BHC A;  4HNV A;  2H1L A;  2XRO A;  3L2W A;  3M8J A;  2ZJ2 A;  2PEX A;  3EUA A;  3B02 A;  1BW6 A;  1KU7 A;  3PFI A;  5FKO A;  2W24 A;  5GPA A;  1FWZ A;  3WTZ A;  1K83 J;  4ZYH A;  3COA C;  1BR1 A;  1R49 A;  1I5Z A;  2XPV A;  2R7X A;  4PZJ A;  3CO6 C;  3W2V A;  4DJA A;  1TWG J;  3I58 A;  3I64 A;  4XRF A;  1A6I A;  3CTA A;  2VBZ A;  3A03 A;  2F4O B;  2A5W A;  4ANJ A;  4XOR A;  3ZRG A;  2L02 A;  3MWM A;  2ISZ A;  4HQM A;  3F6V A;  3GFM A;  3F22 A;  4G6T B;  1JKO C;  4YRV A;  3TMO A;  2VBW A;  1WVR A;  1BW5 A;  1T33 A;  2F5E A;  4UV9 A;  4DW6 A;  3WTU C;  3S3M A;  1ON1 A;  2RKH A;  3DTI A;  3W3C A;  3OIQ A;  2R7W A;  3OYB A;  3M4O J;  2W1O A;  2HDW A;  3JRH A;  2EFO A;  1EA3 A;  1YX5 A;  5EZH A;  2CS3 A;  4HOB A;  3BTL A;  1FBQ A;  4KIF A;  3JRD A;  2M0M A;  6PAX A;  1NK2 P;  2BVM A;  5LGN A;  5C4X J;  1XG1 A;  3CLO A;  4C3I J;  2D45 A;  2E2H J;  4XKV A;  3WTS C;  1KZH A;  3ZXS A;  1JUM A;  5FKL A;  1WJF A;  4M71 A;  4BXF A;  1R5G A;  5EZG A;  2A5Y B;  1P4X A;  3WG7 H;  2TDX A;  2FBK A;  1B59 A;  4YFX F;  4BBR J;  1G59 A;  4IRG A;  5FB2 A;  3L2U A;  4BJ6 C;  2IRF G;  3SHF A;  2FUG 2;  1EKE A;  1DU0 A;  3IH2 A;  3MCZ A;  4Q4Z F;  1LFB A;  3RYR A;  1WQ2 A;  2EIJ H;  5CQE A;  2EFN A;  1B72 B;  3QU6 A;  4UVA A;  1HC8 A;  4L0Y B;  4CYD A;  4WK8 F;  1TQM A;  2LBF A;  2BBY A;  2QVO A;  3CF5 F;  4BJT A;  1FP2 A;  1O7L A;  3LAP A;  1W36 C;  1SMY F;  2FOW A;  4AID A;  5D5W B;  2XF5 A;  1S9H A;  2OD5 A;  1S3J A;  3C2H A;  3LFU A;  2CUZ A;  1R00 A;  5B5E C;  4HEA 2;  1PUF A;  2QQ9 A;  3BDD A;  4U0Y A;  2LD5 A;  2EJR A;  1IF1 A;  1D1C A;  1ITY A;  1E17 A;  2RQP A;  3GTM J;  3IL2 A;  3G3Z A;  1H89 C;  2X0L A;  3VSK A;  2P0W A;  1GUU A;  3CJN A;  2KFD A;  5E3N A;  4DYC A;  5F1J A;  1W5S A;  3DF8 A;  3WU2 C;  1X2N A;  3FXK A;  2BEO A;  2O3F A;  3F21 A;  2RV8 A;  2TRT A;  2YPR A;  4OIP F;  1W5C C;  4RAZ A;  2DI3 A;  5J3L A;  4I98 B;  1YS7 A;  3OYD A;  1FYM A;  1IAW A;  1XB4 A;  3HOZ J;  2OPT A;  2HS5 A;  2HEO A;  1YIO A;  3G1L A;  1RET A;  5GAG J;  3B73 A;  1Y39 A;  1ZG5 A;  1IN4 A;  1B8I A;  3DWL E;  3C3W A;  4MTD A;  1XSV A;  2QEX I;  3DPT A;  1UZC A;  1TBX A;  3ASN H;  2E60 A;  1J0R A;  5BPI A;  1D8J A;  3E5U A;  1WPK A;  2HVQ A;  1QU3 A;  4FQG A;  2M45 A;  1GXP A;  2LMD A;  4UUV A;  1YLF A;  1FT9 A;  1XGO A;  3V7S A;  2VPL A;  1AU7 A;  5K5O A;  2QM3 A;  3E7L A;  1T6S A;  3BLY A;  1FY7 A;  3O3K A;  1IRG A;  1RNL A;  2FXA A;  3LNQ A;  4BU2 A;  2Q2E A;  4RGR A;  3AG1 H;  4Y17 A;  4H0E A;  3V8L A;  1Z77 A;  3H9G A;  2FF4 A;  2H8W A;  3ABU A;  2M7B A;  1IN7 A;  3LSH A;  2ZXW H;  3CMM A;  5TRD A;  3AFH A;  5LEK A;  1JT0 A;  4PFO A;  5GAD J;  2DN0 A;  3B6A A;  4L5J A;  4IQ4 A;  1CF7 A;  3QYE A;  3VWB A;  3DTE A;  1VI0 A;  2X1D A;  5F04 A;  3S2W A;  1S6L A;  3QPT A;  4YG2 F;  3K70 C;  4HF2 A;  2YX4 A;  1XN7 A;  3TOA A;  1E3P A;  3LA7 A;  1UEL B;  2K9L A;  3Q9S A;  1J59 A;  1OKR A;  1OYY A;  2QF7 A;  3BCB A;  4Y3O A;  3H35 A;  2ZB9 A;  3LL7 A;  3ZQH A;  3P9K A;  1TWA J;  2HQA A;  3ZN1 A;  2DAO A;  4RB3 C;  2WAQ N;  4G8X A;  2IW5 A;  3EDP A;  2QA4 I;  2VN2 A;  1R36 A;  2E34 A;  2I5U A;  1UAA A;  3KCC A;  3HIF A;  2VON A;  4PUS A;  4N4O B;  1GXQ A;  2K02 A;  2MBF A;  3VYR B;  1MD0 A;  3SDG A;  3GUD A;  2DA5 A;  2HR3 A;  3AG2 H;  5HDN A;  4HX7 A;  3WU1 B;  2VPR A;  3IRR A;  3HC7 A;  4WWC A;  3O8H A;  3ZMU A;  4EAT A;  4AM3 A;  2HVR A;  2DCE A;  4IX7 A;  2GBY A;  3K4N A;  1OJL A;  3E6D A;  3QYF A;  3V7R A;  1R1U A;  2R0Q C;  1ZGA A;  3K4B A;  4V19 K;  1XDS A;  1ZG1 A;  1YRN A;  1JTY A;  3BG5 A;  2QCO A;  1RUO A;  2IGM A;  3FXO A;  2V79 A;  1R22 A;  3KEY A;  3W6J B;  1YHQ I;  4P9F A;  5LBQ A;  4BAY A;  2K9Q A;  1ON2 A;  3F3X A;  1XD7 A;  3M7G A;  4J00 A;  5L3B A;  2K9N A;  3MZ8 A;  2LTP A;  1WRJ A;  3CUQ B;  2NYX A;  3OIP A;  1YFH A;  3PJR A;  1MND A;  4D5C A;  2YR2 A;  1HOM A;  2RDP A;  2DTZ A;  3FXQ A;  3BC8 A;  2R92 J;  1WSU A;  3HRS A;  2FQ4 A;  1OCZ H;  4XNF A;  3DBH B;  5FRN A;  3TQN A;  2OBP A;  2W4S A;  4E7J A;  2MC3 A;  4FT8 A;  3SFZ A;  5DS9 A;  4L9T A;  2Y69 H;  3L2R A;  2BHZ A;  5HDK A;  4XLF A;  3IAM 2;  1ZLJ A;  2V6C A;  1ULY A;  1T39 A;  1BIB A;  2KDO A;  1IDZ A;  2DJI A;  2ZXJ A;  3K6G A;  2QSF X;  5DCM A;  3QAH A;  2IS1 A;  2E2J J;  1TZL A;  3C18 A;  3OR2 C;  3S1N J;  1SVL A;  5ERI A;  3IKV A;  4IF4 A;  4IOA F;  3M9A A;  3F0C A;  4E6K G;  5IP7 J;  2JTV A;  3E6M A;  2DMQ A;  3QOP A;  2Y75 A;  2V1D A;  5E1W A;  2CWE A;  2K4B A;  2WY7 Q;  2AQE A;  4BJ5 C;  4UV8 A;  1WZ2 A;  5L3F A;  4LK1 F;  1T38 A;  2D1V A;  1T08 B;  5FRO A;  1OCC H;  4DZJ A;  2KMU A;  1X1D A;  3EUK L;  3QWL A;  1ETY A;  4NDL A;  4BQQ A;  3GZ6 A;  4EGY A;  4M3E A;  3A02 A;  4LG3 A;  5KK1 A;  5D5X B;  2ELJ A;  3ZQ7 A;  5GAE J;  4RGS A;  1EH7 A;  2ADU A;  3GTO J;  1UCR A;  3RPU D;  3I53 A;  4WX9 A;  1ETX A;  2RN7 A;  2OUM A;  4ZTJ A;  2CSO A;  5CLS A;  2WTE A;  4IVN A;  4A6E A;  2V6E A;  1QHH D;  2AXL A;  4KJZ A;  3CCU I;  1R23 A;  2OC6 A;  3K10 A;  5D4S A;  4KIS A;  2GA1 A;  1LDD A;  1FNN A;  2LNB A;  2R4G A;  3K1P A;  1KQ0 A;  1VQ9 I;  4I2O A;  3BG9 A;  3IAS 2;  3DCF A;  4HV6 A;  4JX5 A;  1IRF A;  2HI3 A;  3VYU B;  2LSO A;  1HXD A;  3AL0 C;  4X6A J;  1RI7 A;  1XCB A;  4DYR A;  3LQR A;  3TO6 A;  4RB2 C;  3G73 A;  1TWC J;  2M1B A;  1MSF C;  4XKB A;  4QSH A;  5E17 F;  4YEJ A;  3J7A Y;  2R7F A;  2JSP A;  4RBO A;  3BOQ A;  1SFK A;  4IXA A;  3DLA A;  3MQ0 A;  1G3W A;  2NVT J;  2FSW A;  3GX4 X;  2FE3 A;  2EB7 A;  3Q0W A;  5D5V B;  5KAF C;  2BZT A;  2IJL A;  2Z3Y A;  1UB9 A;  3T8T A;  3ERM A;  2V7F A;  2DMU A;  2ZO4 A;  5K7F A;  3E1S A;  1Z67 A;  3ZR8 X;  4N0B A;  4A0Z A;  1V5F A;  3U21 A;  2MD0 A;  3BWG A;  4QIW N;  1WI9 A;  1F1Z A;  1AA7 A;  3ZQF A;  1IC8 A;  3FXJ A;  5DV5 A;  4CZZ A;  1BC7 C;  4B8X A;  4BHP A;  3RKX A;  2VJI A;  2A68 F;  4YFN F;  4IHS A;  3BG7 A;  4KA4 A;  2VOO A;  4NC6 A;  3LSP A;  3R0J A;  3T8R A;  1S7A A;  2JQ7 A;  5CVV A;  2W85 A;  3E5X A;  2LG4 A;  3LA2 A;  4PSW A;  3W2W A;  1YJW I;  5LRS A;  1VZ0 A;  3HXL A;  4QLC U;  1D0Y A;  1STZ A;  2CW8 A;  3KP2 A;  1ZK8 A;  4HX4 A;  3U2R A;  1VF9 A;  2NNN A;  4EM0 B;  3F8M A;  1A35 A;  2DPD A;  4CA0 A;  4RMN A;  3MKY B;  1XSD A;  2X85 A;  4GCV A;  2YSR A;  5KCM A;  2Y0M A;  3E6B A;  3ULQ B;  3WE2 A;  4P5O A;  4N9H A;  1HBX G;  1OCP A;  2F48 A;  2KDZ A;  2L0K A;  3ABT A;  2VQC A;  2EZK A;  2I10 A;  3IP4 B;  2PLY A;  2Y0S N;  3H3Z A;  2XB0 X;  2CQ7 A;  3NRV A;  2VKE A;  5E8I A;  2B63 J;  5EYR A;  1F43 A;  2CRG A;  2NRA C;  1D0Z A;  2V9P A;  1ZRF A;  4ZYD A;  3OR1 C;  4KT5 C;  2CH0 A;  2YS9 A;  4A3D J;  5CYV A;  5D8L B;  3S3N A;  2VB6 A;  4G94 A;  2DFH A;  4DNC A;  1KYW A;  3KFW X;  2HQR A;  2ZSI B;  2VJJ A;  4MFE A;  4K2E A;  3M8E A;  2OZU A;  1B6A A;  1RIO H;  3KZZ A;  1N77 A;  4KDP A;  1MJA A;  3TKY A;  1U2W A;  1HKS A;  2CYY A;  1WGX A;  3BR5 A;  4IQJ A;  2CU7 A;  5EGO A;  1DPR A;  3UR3 C;  4KN4 X;  3HG9 A;  2OCC H;  4BAC A;  1O3S A;  4HLX A;  4M3F A;  1G3S A;  1USS A;  1QVT A;  2RQQ A;  2K3F A;  2DU9 A;  5LGT A;  3K69 A;  3VOE A;  1XGS A;  2NOJ B;  2R7S A;  4XM3 A;  3OMY A;  1K61 A;  1GVD A;  1VND A;  1UG2 A;  3I4N J;  4DBR A;  5JFR A;  2IA2 A;  5F1R A;  1K78 B;  2LR8 A;  5H6Q A;  4XMY A;  2EIN H;  2V1N A;  5KVR A;  4I0B A;  4M73 A;  1BN5 A;  1K6Y A;  2GOM A;  2LRE A;  4WXC A;  4IHT A;  2IBD A;  2EFQ A;  2M34 A;  2W7N A;  1GHC A;  1HDD C;  2KZV A;  3CJR B;  2ELH A;  1I6X A;  2L2O A;  1ZAR A;  4UVC A;  5ICE A;  3I4P A;  5FO5 A;  3WGH A;  1ZN2 A;  1HST A;  3SEQ A;  4FCY A;  2HZT A;  2A6T A;  2DT7 B;  4BGD A;  2HOE A;  3IH4 A;  4M3G A;  3NQO A;  1YJ9 I;  4A3C J;  1QHG A;  1Z7U A;  1ZTR A;  5K1Y A;  2YU9 J;  2WAQ A;  1WJE A;  2COM A;  1JTX A;  1JUP A;  3GW2 A;  1FIP A;  2VI6 A;  1BI2 A;  3DPL C;  2PJR A;  1MBG A;  3P9I A;  3F23 A;  4RGU A;  1P7J A;  2J5O A;  2K5C A;  4ZYE A;  3K4J A;  4HST A;  2PJP A;  3ZQG A;  3SDB A;  2AO9 A;  5HS8 A;  2DA4 A;  2IA1 A;  1SC7 A;  1X3U A;  3MKW B;  2LVS A;  2QBY B;  1TQI A;  3J7Y J;  4I0A A;  3JTH A;  3RI4 A;  5KHD A;  1IUY A;  3AL0 B;  4PSX A;  3P5J A;  4DIQ A;  5M5X J;  3JSP A;  2QYO A;  4NHJ A;  1T0F A;  4IRH A;  4P9U A;  2QQB A;  1OR7 A;  3Q9V A;  1K6O A;  1ZQ3 P;  3S2H J;  1UST A;  4XRS G;  3HTS B;  3KIO A;  3I71 A;  3AAF A;  2R7U A;  2L7F P;  4MLO A;  1OYI A;  1WJB A;  2KZG A;  5FLM J;  2HWV A;  5FFX A;  4M3B A;  4L9J A;  3KP3 A;  2EV6 A;  3EUH A;  2FD5 A;  2JA7 J;  3N05 A;  3FIS A;  2JT1 A;  3VFZ A;  4OMY A;  2GA2 A;  3I59 A;  2JRT A;  2DT5 A;  2EZL A;  2PMZ A;  1S7E A;  1JKR C;  2MGQ A;  1MDM A;  1I6H J;  4NBQ A;  2X6W A;  1Q1V A;  2G9W A;  3IUO A;  3GTP J;  5FFZ A;  3BG6 A;  1U9O A;  4C30 A;  3RYP A;  4XK4 A;  2PBI A;  2QQA A;  2Z2S B;  2IP2 A;  2M30 A;  2DDA A;  3BP8 A;  4GO1 A;  1QVU A;  3M8F A;  2NOG A;  1FOY A;  3BY6 A;  1J7K A;  3DTK A;  4J01 A;  4CZC A;  4PDK A;  1W7P A;  3AG4 H;  3KP6 A;  4ESB A;  2CFO A;  4G6Q A;  2E2I J;  5IYC J;  3MKL A;  4LIT A;  2ID6 A;  1QPI A;  3RJP A;  1AHD P;  3FDY A;  4A6D A;  2HTJ A;  5IY5 H;  1B9M A;  2EV5 A;  3IWF A;  2W57 A;  5IOY A;  2IA0 A;  4AIK A;  4M9X A;  3JRI A;  1V5G A;  2PI0 A;  1B72 A;  4IHX A;  3L1P A;  4Q48 A;  4M6X A;  3IH3 A;  4XOP A;  1YIJ I;  3I3L A;  5M5Y J;  5E3M A;  3HRT A;  2X4H A;  1R4M B;  2HQ5 A;  4LIU A;  5FKN A;  5HVQ C;  2HOS A;  3PQJ A;  4BH9 A;  2OA4 A;  4LIV A;  3DQV C;  4A93 J;  4EEF G;  2M9H A;  5B3S H;  5CQG A;  3SQN A;  1C0W A;  2DXI A;  1JHH A;  4XBF A;  3KZI C;  1O4X A;  4C2T A;  1E3H A;  3CME I;  3BQY A;  3HHH A;  3WTT C;  1PJR A;  4CHU A;  2JWT A;  1SAN A;  2ME6 A;  3NEU A;  4IJA A;  4HNT A;  2AS5 F;  2ECC A;  2MG4 A;  3KEQ A;  1OLT A;  4RAF A;  5ICG A;  3LSG A;  4UVB A;  5FD6 A;  2P4W A;  2XC7 A;  2C6Y A;  3L2Q A;  1J2X A;  4G6D A;  1LNW A;  3OYI A;  2FML A;  2KIS A;  2VJ4 A;  2DYR H;  1FMV A;  2VQG A;  3QOE A;  4XLA A;  3BG3 A;  3TOB A;  4B09 A;  4GGG A;  2L9V A;  3HOT A;  1RZ4 A;  3IV5 A;  2OV7 A;  3CCL I;  4RAY A;  3OYE A;  3S93 A;  3C2G A;  5GP9 A;  2R5Y A;  1HW5 A;  1WFX A;  2OQG A;  1RPW A;  2CG4 A;  3LSK A;  1V5E A;  1BA5 A;  3ZMD A;  2VKH A;  2K7L A;  1JHF A;  3FHZ A;  4D1Q A;  5IP9 J;  2DBB A;  1NG7 A;  3P7N A;  5CVU A;  4A12 A;  4D7N A;  4DYQ A;  1MW7 A;  2QWW A;  5CVI A;  3HRU A;  3LQQ A;  2VC1 A;  2PQ8 A;  4B43 A;  4UHT A;  2MA3 A;  2VQH A;  2DT6 A;  1PDN C;  4LB6 B;  3MZH A;  2FMY A;  4Y52 J;  4U7D A;  3FMR A;  2F6C A;  3KX2 A;  3N4M A;  2JVH A;  2MAB A;  4ESJ A;  1Y56 A;  4LG0 B;  3CUO A;  3H9Q A;  5DM7 F;  1E3O C;  3R60 A;  1DPU A;  3LA3 A;  3DV8 A;  3I9V 2;  4OIR F;  2VT3 A;  3RQ4 A;  3HTU A;  3KP5 A;  5GPC A;  3J81 K;  3HL2 A;  1O7F A;  3EPZ A;  3WTX C;  1RKW A;  3UKG A;  3PNT A;  2PJR B;  4L0Z B;  4L9V A;  1Z0X A;  1I27 A;  1H9G A;  3X2Q H;  3ZMS A;  4PJM A;  2Q2E B;  2BYV E;  2STW A;  4A3B J;  2X9D A;  4LMY A;  5E79 C;  1TC3 C;  3LSR A;  1MH4 A;  2EZH A;  4A69 C;  3PQK A;  4EJW A;  1B8I B;  2FA5 A;  2PN6 A;  4A3E J;  2F5F A;  2LF8 A;  1SMT A;  3DFG A;  4JQF A;  2LOO A;  4JYK A;  1LQ1 A;  3GME A;  4X0G A;  2F2E A;  1NK3 P;  2H27 A;  1JXS A;  3W6K B;  2ECB A;  4C2M J;  1TT0 A;  3VEP A;  5E8G A;  4G7H F;  1H0M A;  4CCO A;  3BZ6 A;  1EH8 A;  4A3K J;  4QPO A;  4RLF A;  1YRN B;  1TNT A;  2F5D A;  4GYG A;  4R79 A;  1QPM A;  2MLK A;  2X1C A;  3BTJ A;  1S7O A;  5IT9 Z;  2MW8 A;  5K7H A;  1ZGJ A;  3V8J A;  3WE3 A;  5C3E J;  5FRM A;  3FZV A;  1XDU A;  3S3O A;  1MBE A;  3BQZ A;  3VB2 A;  4CCJ A;  1PUE E;  3CCQ I;  1T8I A;  1GDT A;  2R3S A;  4RB1 A;  3HPG A;  4EJU A;  4G7Z F;  1O3Q A;  2IPQ X;  2KIM A;  3JSO A;  3GYH X;  4XLE A;  1FYL A;  5GTH C;  4ZYG A;  2AXT C;  3HKZ N;  1X1C A;  2JJ7 A;  4KUM A;  2DPU A;  2JA8 J;  2XUB A;  4CCL A;  1XPX A;  2IT0 A;  2KRC A;  1ZRC A;  5F08 A;  1XMK A;  3A1Y A;  3ECH A;  2X6O A;  3FBN B;  3RPU A;  4BEH A;  2WB1 N;  2WAD A;  3VYS B;  2R7R A;  1APL C;  3SXY A;  3MMY B;  4MHG A;  1IXR C;  1IRX A;  1BI0 A;  4IKF A;  3GWZ A;  2BVL A;  1NTC A;  3FX3 A;  2RVC A;  3RKY A;  3K70 D;  1FZP B;  2DK5 A;  1YW9 A;  3H3V K;  2LKP A;  5HLG A;  1OQY A;  2CQK A;  5D6F A;  1ZYR F;  4MTE A;  4FAS D;  4EJO A;  1J75 A;  1WI3 A;  2D5V A;  4AD9 A;  2ZBK A;  3OSF A;  3GBG A;  2FOK A;  2GWR A;  2QEN A;  1XX5 A;  2DFF A;  5JVG F;  1IUF A;  3NWT A;  2XAJ A;  4W97 A;  5DTD A;  1U5T C;  1YI2 I;  2DQL A;  2HFH A;  1ETO A;  2RRE A;  5JHF A;  2EFW A;  1BOB A;  3BR2 A;  3S1M J;  2P5K A;  5E1Z B;  1WWX A;  2E5Z A;  2ME0 A;  3CCY A;  2XGE A;  3M3Y J;  1ENH A;  1JGS A;  4IHW A;  2XAS A;  5EGO B;  3TL4 X;  2J5P A;  5ILS A;  2E1O A;  4ENN A;  1J5Y A;  1QQI A;  1RES A;  1FBS A;  1QNT A;  1U0J A;  2KP6 A;  2Y30 A;  4GFB A;  2K3P A;  3RDI A;  2Q1Z B;  4ZJZ A;  2P7C B;  2ZFW A;  3HOY J;  2ZXI A;  4IPA A;  1T56 A;  1S29 A;  3QPH A;  3ROU A;  1K78 A;  2ZJR F;  3CO7 C;  2Q0O A;  2EZI A;  2LK2 A;  4A3G J;  2IGK A;  1LVK A;  3SZP A;  5FLV A;  2CV0 A;  4NB5 A;  4PJ0 C;  1D1B A;  4FE7 A;  3MN2 A;  3FWE A;  1QRY A;  2KJB A;  1TL8 A;  4DQ2 A;  1Y0N A;  2XF6 A;  4PGG A;  3FMS A;  2XAH A;  3GEZ A;  3JRE A;  1U3E M;  3U9G A;  5HOD A;  3FM3 A;  2KRH A;  3QYB A;  2P5L C;  3JRG A;  2AHQ A;  1FOX A;  3ONQ A;  1U5T A;  5EJC A;  1XCV A;  3V4G A;  2LY1 A;  2QUF A;  3HRM A;  3BJA A;  2R93 J;  3PL8 A;  3ZCO A;  4QTR A;  1XMX A;  3GFI A;  2UV1 A;  3WGI A;  2VC0 A;  3DKW A;  4KN7 X;  4EGZ A;  4IRI A;  2BGC A;  2HOA A;  1SD7 A;  5IYB J;  4A3F J;  1RR8 C;  4LJZ F;  2ZC2 A;  1VQM I;  5F64 A;  3G2B A;  1BI1 A;  1WJA A;  2HKO A;  3OIO A;  1YS6 A;  1R5I D;  1TWF J;  1R5H A;  3CF2 A;  5DUI A;  2QBY A;  4U87 A;  2ICW G;  2E19 A;  2X1E A;  3H1C A;  5KNL A;  4JOM A;  4ENJ A;  3WGG A;  4HW0 A;  3GZN B;  3DBR B;  3TW7 A;  1GT0 C;  1B1B A;  3ZMZ A;  2HDD A;  3MEX A;  4M9S A;  5M3M J;  2VBY A;  2WY8 Q;  5JLX A;  1YOV B;  2KIU A;  4RGX A;  4II3 A;  2CQX A;  3HGY A;  3T0Y A;  4RB0 A;  4BBS J;  4BDZ A;  3RTR A;  4IHY A;  1VQN I;  1MBK A;  1G3Y A;  3FIW A;  4PJJ A;  1S5L C;  3REO A;  3FXU A;  2F5V A;  2L7K A;  2ELK A;  2HU9 A;  5K7Z A;  1Z3Y A;  2H6B A;  2P7V B;  1FSH A;  3LSJ A;  4FE4 A;  4JP0 A;  3H5R A;  4EVI A;  1P2F A;  3OS2 A;  2W00 A;  2GOX B;  3CC2 I;  1Y0U A;  4XLC A;  4JK1 X;  3D1N I;  3IRQ A;  3ZP5 A;  2XPU A;  1BJZ A;  3TO7 A;  4BQO A;  1KGS A;  1U6G A;  1WJD A;  3BPX A;  4LLL A;  4ZTF A;  2TCT A;  4WCG A;  3ZQQ A;  3BR1 A;  3SZG A;  2Y31 A;  3T1B A;  4YEL A;  3DEU A;  2P81 A;  2E1C A;  1S8N A;  4HV5 A;  2JN6 A;  3DBL B;  1Y1V J;  1U8R A;  5EEG A;  5J1U A;  1BOA A;  1R6R A;  2M8G X;  4S04 A;  1B9N A;  4CO8 A;  2O8K A;  5LFA A;  3S17 J;  3CUQ A;  4GYI A;  1SFO J;  3H9J A;  3F72 A;  3I56 I;  2V1U A;  1MDM B;  5F27 A;  2LRD A;  2WV1 A;  3KPH A;  3TO9 A;  2EA2 A;  2DMN A;  4ABZ A;  1JKP C;  5J8F A;  3R4K A;  4KIT B;  4KYW A;  2JA5 J;  2ZXH A;  2Z33 A;  2QKL B;  2DOA A;  1IV6 A;  4UUT A;  2GXG A;  1D3Y A;  3AG3 H;  2ZCW A;  1KYZ A;  3PM1 A;  1VQ8 I;  4AYB A;  1R4N B;  4KMU X;  5JLW A;  4NC8 A;  2HPM A;  3VDX A;  3OYF A;  2K85 A;  1OYW A;  1KQ8 A;  1OPC A;  1SAU A;  3R61 A;  3A01 A;  1TTY A;  4MFD A;  4BY7 J;  4DOZ A;  3IWZ A;  2MD5 A;  3OL3 A;  4XKC A;  1V54 H;  2H6C A;  1IO2 A;  2V26 A;  4CYC A;  1JKQ C;  3CCR I;  3TDZ C;  1Z6T A;  2IEK A;  2E7X A;  1NH3 A;  1J9I A;  2BXZ A;  5IT3 A;  4DBQ A;  2L9N A;  2Z9O A;  1MZB A;  4Y4R A;  3AKZ A;  5TIS C;  4O3M A;  3K4C A;  5B1B H;  1SAX A;  2EK5 A;  4CDG A;  3TW6 A;  1EV7 A;  2Y48 A;  3DU6 A;  3F6O A;  2CJJ A;  2KT0 A;  2XGD A;  2DA2 A;  1LE8 B;  2H8R A;  4V2F A;  2ZFU A;  5EEA A;  1MGT A;  3HKZ A;  2DO7 A;  1O3R A;  5BS6 A;  2COB A;  3FKI J;  4KT6 A;  4CH7 A;  3S1Q J;  2NVY J;  2CW7 A;  2R5Z B;  4YIF A;  2V9V A;  1DQU A;  3LMM A;  4LD5 A;  1MBH A;  3ISP A;  2EBI A;  1SFX A;  4FX4 A;  1FOK A;  1XC5 A;  2VKD A;  1VTN C;  3MZY A;  1FX7 A;  1HDP A;  1Y8R B;  3QP5 A;  4L9N A;  2CQQ A;  3LSM A;  2XGX A;  2ACJ A;  4C2U A;  1WCM J;  1DGW Y;  1JUS A;  2H09 A;  1BI3 A;  1IDY A;  1V4R A;  3K2Z A;  3QOD A;  4CCM A;  4IZZ A;  1HLV A;  3FMQ A;  4UNO A;  4S05 A;  2YX7 A;  3FBI B;  4N4N B;  3F8C A;  4QPQ A;  5J4V A;  2VE9 A;  5KAI C;  3CC7 I;  5HS7 A;  4QWQ A;  4BNC A;  2JUG A;  5L3G A;  4KMF A;  4Y13 A;  3PFY A;  5CKT A;  1W0U A;  2IGO A;  1U5T B;  2NVU B;  2XIG A;  2ZNZ A;  3HSE A;  1WJ5 A;  4EM1 A;  3CJQ B;  2R5Y B;  5F0H A;  3QP6 A;  5AON A;  5GAH J;  4C9Y A;  4OIQ F;  3BT9 A;  2XRL A;  1X3Z B;  2MYS A;  2FNA A;  1U78 A;  3A0H C;  2OCE A;  5EG0 B;  2DW4 A;  3OS0 A;  5HLT A;  2XAG A;  1LVA A;  4OAZ A;  4F52 A;  2DMT A;  1ZRD A;  1Z3X A;  3OWT A;  5E3L A;  3U1D A;  4A5M A;  1XMA A;  1P4A A;  2E1M C;  5JVT A;  2P8T A;  1AKH B;  2OTL I;  4PJL A;  2A05 A;  3UNG C;  1UMQ A;  3BJ6 A;  3HJE A;  1T98 A;  4BQA A;  1TNS A;  3EET A;  4A0Y A;  4Y15 A;  4ENK A;  5E1X A;  4F3Q A;  1A5J A;  2HDC A;  3WG9 A;  1ERD A;  3H5N A;  2XF7 A;  5GTI C;  3CJT B;  4HNU A;  2M3A A;  1ZRE A;  3FXM A;  5FLX Z;  1IJW C;  2HYG D;  2WWY A;  1KU3 A;  2DOD A;  2WV0 A;  3ZPL A;  2BY2 A;  5IYD J;  4P96 A;  2KPM A;  3LWF A;  2HOT A;  2VOD A;  2UWM A;  2H94 A;  1R1V A;  3CCE I;  3ZOB A;  4XN0 A;  4V2G A;  3N97 A;  5HNH A;  2KJC A;  3EUH C;  3HOX J;  1XS9 A;  2PMU A;  2BE5 F;  4HDU A;  1VQK I;  2CUE A;  2Y0S A;  1H88 C;  1D0X A;  4U0V A;  1R1T A;  1P92 A;  4ETS A;  2E1M B;  5IPA A;  3I59 B;  2ZKZ A;  2VE8 A;  1FMW A;  1GLN A;  3H3U A;  2QKM B;  3IKT A;  1I50 J;  2FNP A;  4PFP A;  3H36 A;  1VQL I;  4R1H A;  1ZKG A;  2OQR A;  1ETK A;  5ICC A;  3OV8 A;  3PNV A;  5FLX K;  2F4M B;  2MFZ A;  4KNY A;  1TW3 A;  1K4S A;  2A6E F;  4OOI A;  1IXS B;  1NHA A;  1TT5 B;  3WHB A;  3D5R C;  1I3A A;  2LF7 A;  2NS8 A;  2O03 A;  4O5V A;  4BE1 A;  1DUX C;  2FBH A;  3OS1 A;  4E7I A;  4RS8 A;  5JR3 A;  5ED4 A;  3KET A;  4PGH A;  3ERE D;  1LJ9 A;  4WXD A;  2VJ5 A;  1WKM A;  2L4M A;  2RC4 A;  4YIR X;  2OJE D;  5J1R A;  4BE2 A;  1LUJ B;  2MLG A;  2CGP A;  3HSR A;  4AYB N;  1SFE A;  2FX0 A;  1GVJ A;  3RKW A;  4UY8 I;  4RM3 A;  4A2U A;  3GFJ A;  4N9I A;  1UHS A;  2G7U A;  3VSL A;  4I6Z A;  2QQ8 A;  2X51 A;  4HRI A;  4II2 A;  1F5T A;  5BQT A;  5LLQ A;  1DGR M;  4OIO F;  2E36 A;  3CUQ C;  1EJ9 A;  3FXL A;  2GXB A;  1HW1 A;  1MJ9 A;  1FJL A;  4A5N A;  1A36 A;  2W48 A;  1G3T A;  4RAG A;  3KE2 A;  4HLY A;  2NVQ J;  1JT6 A;  3ECO A;  4XKW A;  3F9K A;  4M9Z A;  2B0L A;  1BBY A;  2EIM H;  3V42 A;  4BUP A;  5IP6 A;  4HG2 A;  4M6Y A;  3GF2 A;  1IV8 A;  5M3F J;  3JCU C;  2JZY A;  4ON0 A;  2X6Y A;  4TV7 A;  4BXU A;  5BOX A;  1Z05 A;  2XRN A;  2P6T A;  2XGC A;  1ZR2 A;  2A3S A;  3PO2 J;  4BY1 J;  1FP1 D;  1E0E A;  3LAJ A;  3I54 A;  3E97 A;  1MKM A;  4OIN F;  3JRF A;  1D5Y A;  1QBJ A;  5AIQ A;  4IOC F;  5L3E A;  2ISY A;  4L18 B;  1LFU P;  4I99 C;  2EA4 A;  4BDY A;  2NVX J;  5D5U B;  1YE9 A;  4BE0 A;  3O6B B;  5CVJ A;  2O6G E;  2IVM A;  2ETH A;  2KL4 A;  1Z9C A;  1LE8 A;  1LEA A;  4WXH A;  3Q3S A;  4AC0 A;  1A04 A;  5E18 F;  2BXY A;  3FF5 A;  4MEX F;  5DM6 F;  2MH9 A;  1KON A;  4H4K C;  1F4K A;  4F7Z A;  2YU3 A;  2GXA A;  1VQ5 I;  3CDI A;  4E4H A;  3GVA A;  4XIC A;  1HCR A;  1Z91 A;  2K9S A;  2VAS A;  2PMH A;  3DEW A;  2MSY A;  4XLH A;  1UJ8 A;  3SEZ A;  2BW3 B;  3FHN A;  4FHT A;  2HTS A;  3ZMT A;  4F93 B;  1X2M A;  2G7H A;  4D7M A;  4KFC A;  4ZC3 A;  3BR0 A;  4GDF A;  4F55 A;  1MNE A;  3PSI A;  4HSR A;  3TP0 A;  2XB5 A;  3PUF A;  4XID A;  2QLZ A;  5AIP A;  2ZJQ F;  2DQR A;  2ZNY A;  4MGR A;  5ICF A;  1YG2 A;  5HS9 A;  4L5I A;  3MFK A;  1VFC A;  3A0B C;  1IW7 F;  3S8P A;  1OMI A;  2JMW A;  1N75 A;  2O8X A;  3Q0U A;  3CC4 I;  5D4R A;  4LFU A;  4CXF A;  3TED A;  3OOU A;  4P1W A;  2BHY A;  2FRH A;  4D5F A;  2RGV A;  2BY0 A;  2RNG A;  5LGU A;  3QQA A;  2QGU A;  2H1K A;  1PP7 U;  2XAQ A;  4IL6 C;  2KRF A;  2VL8 A;  3HOV J;  1D5V A;  1QZZ A;  2K86 A;  3B6C A;  4AWX B;  2LDU A;  4UUS A;  5A2Q Z;  4IHV A;  1HKT A;  1X1A A;  3DXJ F;  1LPQ A;  3G71 I;  3J80 K;  2XPW A;  4I01 A;  4U0W A;  4HYE A;  5D6E A;  3S32 A;  3GTL J;  2E71 A;  1LFP A;  2XKP A;  1X3W B;  2WAE A;  2OAZ A;  2Z99 A;  5TJJ A;  3OYL A;  3CCM I;  5C44 J;  1W7P D;  4F91 B;  3CDH A;  2EIK H;  2VQL A;  1Z21 A;  3BR3 A;  2ESN A;  3WTV C;  2X6X A;  4F92 B;  3BTC A;  4I7H A;  2EV0 A;  2EWN A;  2LYC A;  5FKM A;  2Y9Z A;  4B44 A;  3K9T A;  4E7K A;  1YQA A;  1MIJ A;  1L3L A;  1H9T A;  1RUN A;  4DGW B;  2NXN B;  4AVZ A;  3F8F A;  1OCR H;  2P6S A;  1NG6 A;  4Y33 A;  4KIC A;  5F0C A;  2RNJ A;  2XKO A;  3GZ5 A;  4RDU A;  1Z7L A;  2HYF A;  3QU3 A;  2VXZ A;  5DDG A;  2ZSH B;  1UHW A;  4WF2 A;  5CVR A;  3ZQI A;  4D0P A;  3K0L A;  1PP8 F;  2Z16 A;  3H92 A;  4ITV A;  1KU2 A;  4J19 A;  4E7H A;  5LRR A;  1I1G A;  2L7Z A;  2VBX A;  4UB8 C;  3EQL F;  3IHU A;  3GLL A;  4G9Y A;  4CYC B;  3C7J A;  1XGM A;  2CMP A;  2DK8 A;  2A6H F;  5HLI A;  5A2Q K;  3GTK J;  3OYK A;  2DJN A;  2XAU A;  1YW8 A;  2M87 A;  2DOF A;  5B66 C;  3G6E I;  3ZQC A;  1MBJ A;  5BMZ A;  1D8K A;  2R7D A;  4E7Z A;  3S15 J;  3ESW B;  3HHG A;  2W25 A;  3TP3 A;  3FKJ A;  1K4T A;  1ZH5 A;  5TGT A;  3HOW J;  5BNG A;  1TWH J;  2M8E A;  3V7C A;  3A01 B;  1BR2 A;  2FEZ A;  1WHU A;  3K7A J;  3W2A A;  2ZME B;  3S1R J;  3R0A A;  4D9J A;  2V4J C;  1IN6 A;  1X58 A;  3Q5F A;  4AVP A;  2PX9 A;  4M74 A;  1I3Q J;  2D1H A;  1EF4 A;  1MH3 A;  5DD8 A;  2A07 F;  4NQW A;  1IN5 A;  5B1A H;  1FLI A;  1JJ6 C;  4XL9 A;  4Y7N J;  2MH2 A;  1UG0 A;  2F4I A;  1PVE A;  2KKO A;  3OYM A;  5F0F A;  4G7O F;  3C2B A;  1G4D A;  2JK3 A;  2R7O A;  1LKX A;  3HYI A;  1ZG3 A;  3BTI A;  3TGN A;  2W82 A;  5FGM A;  3HUG B;  1FIA A;  1P7I A;  4AIH A;  1T95 A;  4BXX J;  4RLQ A;  4BKX A;  3SYT A;  1TW2 A;  3ZGK A;  4ZH4 F;  2MC4 A;  2GQQ A;  2L9R A;  3PUB A;  1BC8 C;  4A3I J;  2WB1 A;  5CJ9 A;  2UXN A;  5E20 A;  3L2C A;  2FQ3 A;  3I5U A;  1Y6I A;  3NAU A;  1MSE C;  2CW0 F;  4LG0 A;  2O7O A;  1HSJ A;  2NAZ A;  2Z1D A;  3K1N A;  3K2A A;  5FKK A;  4M6V A;  4I02 A;  3BZK A;  4ZYA A;  1W0T A;  1X4P A;  2FBI A;  2GM4 A;  4NC7 A;  2BY1 A;  2LP0 A;  4B3A A;  1E2X A;  4CGZ A;  2DA7 A;  4XN3 A;  3S14 J;  2R7V A;  4ZDO A;  4HF1 A;  4I76 A;  4UXN A;  2LH9 A;  4B3X A;  2M5W A;  2FJ1 A;  4JX4 A;  3GTG J;  2NNY A;  1VQ7 I;  2VXD A;  3E3V A;  4I09 A;  3FM5 A;  4CSW A;  2M2E A;  1ETV A; 
#chains in the Genus database with same CATH homology
 1B4A A;  3L9F A;  4XSZ F;  2Q8K A;  2JPC A;  1UFM A;  2VOP A;  5IT9 K;  2XHK A;  1ZAO A;  4XLP F;  1V3F A;  1L0O C;  3E5Q A;  4KIG A;  5J6X A;  2L54 A;  1K7A A;  2PG4 A;  3ZMV A;  3JTG A;  4EMS A;  2A69 F;  3F8B A;  1JE8 A;  4ESF A;  2UZK A;  1F9N A;  3GFL A;  2NS0 A;  4OU0 A;  3KEO A;  4P55 A;  1BIA A;  5JHU A;  2JSC A;  4MEY F;  4U7B A;  1QO0 D;  5K5R A;  1XGN A;  1CF7 B;  1SD5 A;  3V8K A;  2WC2 A;  3WOD F;  4LGW A;  3I0T A;  2STT A;  3D5L A;  3WU0 A;  2DLL A;  3D0S A;  3BRO A;  3P9C A;  3O2P E;  3J7A O;  4YFK F;  2UXX A;  5HOO A;  2L4A A;  1BJA A;  5JI6 A;  4BHB A;  3LFK A;  4HA8 A;  3K1M A;  5D8K B;  2L3D A;  2OZ6 A;  4MQV A;  3EYI A;  1CGP A;  1FPQ A;  2K27 A;  4U88 A;  2ESH A;  2HKX A;  5DUK A;  1UHM A;  4YII A;  4CIC A;  1Q1H A;  4AIJ A;  1TLH B;  3ELK A;  2L01 A;  4A0X A;  4HQE A;  1ONV A;  3KLN A;  5DCF A;  4E70 A;  1P4W A;  1W4M A;  3SZT A;  4HF0 A;  3WTY C;  5HLH A;  5L3D A;  1IN8 A;  1HQC A;  1REP C;  1XSX A;  3LST A;  3C1D A;  2O61 A;  4PCQ A;  1HKQ A;  1KQ9 A;  3L7W A;  1YO5 C;  1DP7 P;  1W5T A;  5DEQ A;  2GIV A;  2E1N A;  5H6R A;  5LHI A;  2HQN A;  5F6F A;  4FX0 A;  4Q5S F;  3L09 A;  2GAU A;  4OMZ A;  2BV6 A;  3HSF A;  5LHG A;  1FBU A;  2EFP A;  3E6C C;  3RIR A;  4HDV A;  2KIF A;  1K79 A;  4LB5 A;  4XSX F;  3TDU C;  3EYY A;  4KIB A;  4HZF A;  1BM9 A;  3BPV A;  4MQ9 F;  2CO5 A;  3J81 Z;  1EH6 A;  4ENM A;  1R7J A;  1MJB A;  3QRF F;  2D2W A;  4XLN F;  1YTY A;  5ILU A;  3F8N A;  3JW4 A;  1O57 A;  1ZLK A;  3L00 A;  5EEH A;  3M1E A;  5J8C A;  2JPB A;  4LK0 F;  3WTW C;  1YW7 A;  3JAM K;  2PFB A;  2XAF A;  1QZY A;  3RPQ A;  1P6R A;  4EJT A;  1AOY A;  2Z5U A;  3ML6 A;  5BPD A;  1DDN A;  2DFI A;  3JAM Z;  1ZHF A;  4Z2Y A;  3KP4 A;  4GXO A;  5LEJ A;  4EV0 A;  1Z6R A;  2GZW A;  3GXO A;  1LDK B;  3GLX A;  1QGP A;  4ZZL A;  4LLG F;  5ILV A;  1W7P B;  5FD5 A;  2CFX A;  1SD4 A;  4JBA A;  5DCM B;  5DYM A;  4R8H A;  3VOD A;  1HW2 A;  1YYV A;  1KU9 A;  1ODD A;  4ASN A;  4M72 A;  2F5C A;  1I1S A;  3ZN0 A;  3BJO A;  2QZ8 A;  1IZ1 A;  4EM2 A;  1KA8 A;  1FC3 A;  1IXC A;  5HDG A;  3T5X A;  4BYY A;  1T2K A;  2OU2 A;  4ZZD A;  2HGC A;  4MNU A;  5LHH A;  3J80 Z;  1LEB A;  2O0Y A;  1SFU A;  2W84 A;  3HUG A;  3FXR A;  4EJV A;  3IC7 A;  5K5Q A;  4HAM A;  5L3C A;  2XV4 S;  4LLN A;  1FSE A;  2ZME A;  1O3T A;  3KZY A;  1R58 A;  5H20 A;  4Q47 A;  3OOP A;  4HBL A;  4O6J A;  3HOS A;  4HX8 A;  2P5V A;  2V1X A;  3GO5 A;  4EQQ A;  2A61 A;  2E7W A;  1G6N A;  3R6S A;  2XVC A;  3MAJ A;  1TQP A;  5DD4 A;  1Z1D A;  2K4J A;  2FU4 A;  3KP7 A;  1SD6 A;  1LB2 A;  3DP7 A;  2DTR A;  3KLO A;  1FYK A;  1LDJ A;  1AWC A;  2VT2 A;  4BHC A;  2XRO A;  2ZJ2 A;  2PEX A;  3B02 A;  1KU7 A;  3PFI A;  2W24 A;  1FWZ A;  3WTZ A;  4ZYH A;  3COA C;  1I5Z A;  4PZJ A;  3CO6 C;  3I58 A;  3I64 A;  4XRF A;  3CTA A;  2VBZ A;  2L02 A;  3MWM A;  2ISZ A;  4HQM A;  3F6V A;  3GFM A;  3F22 A;  2VBW A;  2F5E A;  4UV9 A;  3WTU C;  1ON1 A;  2RKH A;  2EFO A;  4HOB A;  1FBQ A;  4KIF A;  6PAX A;  5LGN A;  3CLO A;  2D45 A;  3WTS C;  4M71 A;  1R5G A;  2A5Y B;  1P4X A;  2TDX A;  2FBK A;  1B59 A;  4YFX F;  4IRG A;  5FB2 A;  2IRF G;  3SHF A;  3MCZ A;  4Q4Z F;  3RYR A;  1WQ2 A;  2EFN A;  3QU6 A;  4UVA A;  4L0Y B;  4CYD A;  4WK8 F;  1TQM A;  2BBY A;  2QVO A;  1FP2 A;  1O7L A;  3LAP A;  1SMY F;  5D5W B;  2OD5 A;  1S3J A;  1R00 A;  2QQ9 A;  3BDD A;  4U0Y A;  2EJR A;  1IF1 A;  1E17 A;  2RQP A;  3IL2 A;  3G3Z A;  2X0L A;  3CJN A;  1W5S A;  3DF8 A;  2BEO A;  2O3F A;  3F21 A;  2RV8 A;  2YPR A;  4OIP F;  4RAZ A;  2DI3 A;  4I98 B;  1YS7 A;  1FYM A;  1IAW A;  1XB4 A;  2HS5 A;  2HEO A;  1YIO A;  3B73 A;  1ZG5 A;  1IN4 A;  3C3W A;  4MTD A;  1XSV A;  3DPT A;  1TBX A;  5BPI A;  1J0R A;  1D8J A;  3E5U A;  4UUV A;  2M45 A;  1GXP A;  1YLF A;  1FT9 A;  1XGO A;  3V7S A;  5K5O A;  2QM3 A;  1T6S A;  3O3K A;  1FY7 A;  1IRG A;  1RNL A;  2FXA A;  2Q2E A;  4RGR A;  4Y17 A;  4H0E A;  3V8L A;  2FF4 A;  3ABU A;  1IN7 A;  5TRD A;  5LEK A;  4L5J A;  1CF7 A;  3S2W A;  1S6L A;  3QPT A;  4YG2 F;  4HF2 A;  2YX4 A;  1XN7 A;  3TOA A;  3LA7 A;  3Q9S A;  1J59 A;  1OKR A;  1OYY A;  3P9K A;  3ZN1 A;  2DAO A;  4RB3 C;  4G8X A;  2IW5 A;  3EDP A;  2VN2 A;  1R36 A;  3KCC A;  3HIF A;  2VON A;  1GXQ A;  2K02 A;  2MBF A;  1MD0 A;  2HR3 A;  3GUD A;  5HDN A;  4HX7 A;  3WU1 B;  3IRR A;  4WWC A;  3ZMU A;  3E6D A;  3V7R A;  1R1U A;  1ZGA A;  1XDS A;  1ZG1 A;  1RUO A;  2V79 A;  1R22 A;  3W6J B;  4P9F A;  5LBQ A;  4BAY A;  1ON2 A;  3F3X A;  1XD7 A;  3M7G A;  5L3B A;  3CUQ B;  1WRJ A;  2NYX A;  1YFH A;  2YR2 A;  2RDP A;  3FXQ A;  1WSU A;  3HRS A;  3TQN A;  2OBP A;  2MC3 A;  4FT8 A;  3SFZ A;  4L9T A;  5HDK A;  1ZLJ A;  2V6C A;  1ULY A;  1T39 A;  1BIB A;  2ZXJ A;  5DCM A;  3QAH A;  3C18 A;  5ERI A;  3IKV A;  4IF4 A;  3M9A A;  2JTV A;  3E6M A;  3QOP A;  2Y75 A;  2V1D A;  5E1W A;  2CWE A;  2K4B A;  4UV8 A;  5L3F A;  4LK1 F;  1T38 A;  2D1V A;  3GZ6 A;  4EGY A;  5D5X B;  5KK1 A;  3ZQ7 A;  4RGS A;  1EH7 A;  2ADU A;  1UCR A;  3I53 A;  4WX9 A;  2RN7 A;  2CSO A;  5CLS A;  2WTE A;  4IVN A;  4A6E A;  2AXL A;  1R23 A;  5D4S A;  2GA1 A;  1LDD A;  1FNN A;  2LNB A;  3K1P A;  1KQ0 A;  4I2O A;  4HV6 A;  1IRF A;  2LSO A;  1HXD A;  1RI7 A;  1XCB A;  3LQR A;  3TO6 A;  4RB2 C;  3G73 A;  2M1B A;  5E17 F;  2R7F A;  3BOQ A;  4IXA A;  3MQ0 A;  1G3W A;  2FSW A;  3GX4 X;  2FE3 A;  2EB7 A;  5D5V B;  2IJL A;  2Z3Y A;  1UB9 A;  3T8T A;  2ZO4 A;  4N0B A;  4A0Z A;  3BWG A;  1WI9 A;  1F1Z A;  5DV5 A;  4CZZ A;  1BC7 C;  4B8X A;  4BHP A;  3RKX A;  4YFN F;  2A68 F;  4IHS A;  4KA4 A;  2VOO A;  3R0J A;  3T8R A;  1S7A A;  5CVV A;  2W85 A;  3E5X A;  3LA2 A;  5LRS A;  4QLC U;  1STZ A;  3KP2 A;  4HX4 A;  3U2R A;  2NNN A;  4EM0 B;  3F8M A;  2DPD A;  1XSD A;  4GCV A;  2YSR A;  2Y0M A;  3E6B A;  3ULQ B;  3WE2 A;  4P5O A;  4N9H A;  1HBX G;  3ABT A;  2PLY A;  3H3Z A;  3NRV A;  5E8I A;  2NRA C;  1ZRF A;  4ZYD A;  4KT5 C;  5CYV A;  5D8L B;  4G94 A;  4DNC A;  1KYW A;  3KFW X;  2HQR A;  4K2E A;  3M8E A;  2OZU A;  1B6A A;  1RIO H;  3KZZ A;  4KDP A;  1MJA A;  3TKY A;  1U2W A;  1HKS A;  2CYY A;  1DPR A;  4KN4 X;  1O3S A;  4HLX A;  1G3S A;  1USS A;  2DU9 A;  5LGT A;  3K69 A;  3VOE A;  1XGS A;  5JFR A;  2IA2 A;  5F1R A;  1K78 B;  5H6Q A;  5KVR A;  4I0B A;  4M73 A;  1BN5 A;  4WXC A;  4IHT A;  2EFQ A;  1GHC A;  2ELH A;  1I6X A;  1ZAR A;  4UVC A;  5ICE A;  3I4P A;  5FO5 A;  3WGH A;  1ZN2 A;  1HST A;  2HZT A;  2HOE A;  3NQO A;  1Z7U A;  5K1Y A;  2COM A;  3GW2 A;  1BI2 A;  3DPL C;  3P9I A;  3F23 A;  4RGU A;  2J5O A;  4ZYE A;  2PJP A;  5HS8 A;  2IA1 A;  1X3U A;  2QBY B;  1TQI A;  4I0A A;  3JTH A;  3RI4 A;  1IUY A;  3JSP A;  2QYO A;  4NHJ A;  1T0F A;  4IRH A;  4P9U A;  2QQB A;  1OR7 A;  3Q9V A;  1K6O A;  1UST A;  3HTS B;  3I71 A;  3AAF A;  1OYI A;  2HWV A;  5FFX A;  4L9J A;  3KP3 A;  2EV6 A;  3EUH A;  2JT1 A;  3VFZ A;  4OMY A;  2GA2 A;  3I59 A;  2JRT A;  2DT5 A;  1MDM A;  2G9W A;  5FFZ A;  3RYP A;  2PBI A;  2QQA A;  2IP2 A;  2M30 A;  3BP8 A;  4GO1 A;  3M8F A;  3BY6 A;  1J7K A;  4PDK A;  1W7P A;  3KP6 A;  4ESB A;  4G6Q A;  3RJP A;  4A6D A;  2HTJ A;  1B9M A;  2EV5 A;  3IWF A;  2W57 A;  2IA0 A;  4AIK A;  4M9X A;  2PI0 A;  4Q48 A;  4M6X A;  3HRT A;  2X4H A;  5HVQ C;  3PQJ A;  4BH9 A;  2OA4 A;  3DQV C;  3SQN A;  1C0W A;  1JHH A;  4XBF A;  3HHH A;  3WTT C;  4CHU A;  3NEU A;  4IJA A;  2AS5 F;  3KEQ A;  5ICG A;  4UVB A;  5FD6 A;  2P4W A;  2C6Y A;  1J2X A;  4G6D A;  1LNW A;  2FML A;  3TOB A;  4B09 A;  4GGG A;  3HOT A;  1RZ4 A;  4RAY A;  1HW5 A;  2OQG A;  2CG4 A;  3ZMD A;  2K7L A;  1JHF A;  3FHZ A;  2DBB A;  3P7N A;  5CVU A;  4A12 A;  2QWW A;  5CVI A;  3HRU A;  3LQQ A;  2VC1 A;  2PQ8 A;  4UHT A;  2MA3 A;  1PDN C;  4LB6 B;  3MZH A;  2FMY A;  4U7D A;  3FMR A;  3N4M A;  4ESJ A;  4LG0 B;  3CUO A;  3R60 A;  1DPU A;  3LA3 A;  3DV8 A;  4OIR F;  2VT3 A;  3HTU A;  3KP5 A;  3J81 K;  1O7F A;  3WTX C;  4L0Z B;  4L9V A;  1I27 A;  1H9G A;  3ZMS A;  2BYV E;  2STW A;  4LMY A;  3PQK A;  4EJW A;  2FA5 A;  2PN6 A;  2F5F A;  2LF8 A;  1SMT A;  3DFG A;  4JQF A;  1LQ1 A;  2F2E A;  2H27 A;  1JXS A;  3W6K B;  3VEP A;  5E8G A;  4G7H F;  1H0M A;  3BZ6 A;  1EH8 A;  1TNT A;  2F5D A;  4GYG A;  4R79 A;  1QPM A;  2MLK A;  1S7O A;  5IT9 Z;  1ZGJ A;  3V8J A;  3WE3 A;  3FZV A;  1XDU A;  3VB2 A;  1PUE E;  2R3S A;  4RB1 A;  4EJU A;  4G7Z F;  1O3Q A;  2IPQ X;  2KIM A;  3JSO A;  3GYH X;  1FYL A;  4ZYG A;  4KUM A;  2DPU A;  2XUB A;  2IT0 A;  1ZRC A;  1XMK A;  3ECH A;  3RPU A;  3SXY A;  4MHG A;  1IXR C;  1BI0 A;  3GWZ A;  3FX3 A;  2RVC A;  3RKY A;  1FZP B;  2DK5 A;  1YW9 A;  2LKP A;  5HLG A;  2CQK A;  5D6F A;  1ZYR F;  4MTE A;  4EJO A;  1J75 A;  4AD9 A;  2ZBK A;  2FOK A;  2GWR A;  2QEN A;  2XAJ A;  1U5T C;  2DQL A;  2HFH A;  2EFW A;  2P5K A;  5E1Z B;  1WWX A;  1JGS A;  2XAS A;  2J5P A;  5ILS A;  4ENN A;  1J5Y A;  1QQI A;  1FBS A;  1QNT A;  3RDI A;  2P7C B;  2ZFW A;  4IPA A;  3QPH A;  1S29 A;  3ROU A;  1K78 A;  3CO7 C;  2Q0O A;  3SZP A;  4NB5 A;  3FWE A;  2KJB A;  4DQ2 A;  4PGG A;  3FMS A;  2XAH A;  3GEZ A;  1U3E M;  3U9G A;  3FM3 A;  2P5L C;  1U5T A;  3V4G A;  1XCV A;  2QUF A;  3HRM A;  3BJA A;  3GFI A;  3WGI A;  2VC0 A;  3DKW A;  4KN7 X;  4EGZ A;  4IRI A;  2BGC A;  1SD7 A;  4LJZ F;  5F64 A;  1BI1 A;  2HKO A;  1YS6 A;  1R5H A;  5DUI A;  2QBY A;  4ENJ A;  3WGG A;  4HW0 A;  1B1B A;  3ZMZ A;  3MEX A;  4M9S A;  2VBY A;  2KIU A;  4RGX A;  3T0Y A;  4RB0 A;  3RTR A;  1G3Y A;  3REO A;  3FXU A;  2H6B A;  2P7V B;  1FSH A;  4EVI A;  1P2F A;  1Y0U A;  4JK1 X;  3IRQ A;  3ZP5 A;  3TO7 A;  1KGS A;  1U6G A;  4LLL A;  3BPX A;  4WCG A;  3T1B A;  3DEU A;  2E1C A;  1S8N A;  4HV5 A;  1U8R A;  5EEG A;  1BOA A;  4S04 A;  1B9N A;  4CO8 A;  3CUQ A;  4GYI A;  3F72 A;  2V1U A;  1MDM B;  3TO9 A;  2EA2 A;  5J8F A;  3R4K A;  4KYW A;  2Z33 A;  1D3Y A;  2GXG A;  2ZCW A;  1KYZ A;  4KMU X;  1OYW A;  1KQ8 A;  1OPC A;  3R61 A;  1TTY A;  3IWZ A;  2MD5 A;  2H6C A;  3TDZ C;  1Z6T A;  2E7X A;  1J9I A;  5IT3 A;  2Z9O A;  1MZB A;  4O3M A;  1SAX A;  2EK5 A;  4CDG A;  1EV7 A;  2Y48 A;  3F6O A;  1MGT A;  2DO7 A;  1O3R A;  5BS6 A;  4YIF A;  2V9V A;  4LD5 A;  3ISP A;  1SFX A;  4FX4 A;  1FOK A;  1VTN C;  3MZY A;  1FX7 A;  3QP5 A;  4L9N A;  2XGX A;  2ACJ A;  3K2Z A;  2H09 A;  1BI3 A;  1V4R A;  4UNO A;  3FMQ A;  4S05 A;  2YX7 A;  3F8C A;  4BNC A;  2VE9 A;  5HS7 A;  4QWQ A;  5L3G A;  4KMF A;  4Y13 A;  1U5T B;  2XIG A;  2ZNZ A;  3HSE A;  4EM1 A;  3QP6 A;  5AON A;  4OIQ F;  2FNA A;  1U78 A;  2DW4 A;  2XAG A;  1LVA A;  1ZRD A;  3U1D A;  4A5M A;  1XMA A;  1P4A A;  5JVT A;  2P8T A;  3BJ6 A;  4BQA A;  1T98 A;  1TNS A;  3EET A;  4A0Y A;  4Y15 A;  4ENK A;  5E1X A;  2HDC A;  3WG9 A;  1ZRE A;  5FLX Z;  2HYG D;  2WWY A;  1KU3 A;  2WV0 A;  3ZPL A;  4P96 A;  3LWF A;  2VOD A;  2UWM A;  2H94 A;  1R1V A;  3N97 A;  2KJC A;  2PMU A;  2BE5 F;  4HDU A;  4U0V A;  1R1T A;  1P92 A;  4ETS A;  3I59 B;  2ZKZ A;  2VE8 A;  3H3U A;  3IKT A;  2FNP A;  4R1H A;  2OQR A;  5ICC A;  3OV8 A;  5FLX K;  4KNY A;  1TW3 A;  2A6E F;  4OOI A;  1IXS B;  1NHA A;  2LF7 A;  2O03 A;  4O5V A;  1DUX C;  2FBH A;  4RS8 A;  5JR3 A;  5ED4 A;  3KET A;  4PGH A;  3ERE D;  1LJ9 A;  4WXD A;  1WKM A;  2L4M A;  2RC4 A;  2CGP A;  2MLG A;  3HSR A;  1SFE A;  1GVJ A;  3RKW A;  4A2U A;  3GFJ A;  4N9I A;  2G7U A;  1F5T A;  5BQT A;  5LLQ A;  4OIO F;  3CUQ C;  2GXB A;  1HW1 A;  1MJ9 A;  4A5N A;  1G3T A;  3KE2 A;  4HLY A;  3ECO A;  4M9Z A;  2B0L A;  1BBY A;  4M6Y A;  3GF2 A;  2JZY A;  4ON0 A;  4TV7 A;  4BXU A;  5BOX A;  1Z05 A;  2P6T A;  2XRN A;  2A3S A;  1FP1 D;  3LAJ A;  3I54 A;  3E97 A;  1MKM A;  4OIN F;  1QBJ A;  5AIQ A;  5L3E A;  2ISY A;  4L18 B;  2EA4 A;  5D5U B;  3O6B B;  5CVJ A;  2O6G E;  2IVM A;  2ETH A;  1Z9C A;  1LEA A;  4WXH A;  5E18 F;  1A04 A;  3FF5 A;  4MEX F;  2MH9 A;  1F4K A;  4F7Z A;  2YU3 A;  3GVA A;  1Z91 A;  2PMH A;  4FHT A;  2HTS A;  3ZMT A;  2G7H A;  4KFC A;  2QLZ A;  5AIP A;  2DQR A;  2ZNY A;  4MGR A;  5ICF A;  1YG2 A;  5HS9 A;  4L5I A;  3MFK A;  1IW7 F;  1OMI A;  2O8X A;  5D4R A;  4LFU A;  4CXF A;  2FRH A;  2RGV A;  5LGU A;  1PP7 U;  2XAQ A;  2KRF A;  1D5V A;  1QZZ A;  2K86 A;  4AWX B;  2LDU A;  5A2Q Z;  1HKT A;  3DXJ F;  3J80 K;  4I01 A;  4U0W A;  4HYE A;  5D6E A;  2XKP A;  2Z99 A;  2OAZ A;  5TJJ A;  1W7P D;  3CDH A;  2ESN A;  3WTV C;  4I7H A;  2EV0 A;  2EWN A;  3K9T A;  1YQA A;  1L3L A;  1H9T A;  1RUN A;  3F8F A;  2P6S A;  4KIC A;  2RNJ A;  2XKO A;  3GZ5 A;  2HYF A;  3QU3 A;  2VXZ A;  5DDG A;  1UHW A;  4WF2 A;  5CVR A;  4D0P A;  3K0L A;  1PP8 F;  3H92 A;  1KU2 A;  5LRR A;  1I1G A;  2VBX A;  3EQL F;  3IHU A;  4G9Y A;  3C7J A;  1XGM A;  2DK8 A;  5HLI A;  2A6H F;  5A2Q K;  1YW8 A;  2M87 A;  5BMZ A;  1D8K A;  2R7D A;  3HHG A;  2W25 A;  1ZH5 A;  3V7C A;  2M8E A;  2FEZ A;  2ZME B;  3R0A A;  1IN6 A;  3Q5F A;  4AVP A;  4M74 A;  2D1H A;  5DD8 A;  2A07 F;  4NQW A;  1IN5 A;  1FLI A;  2MH2 A;  2KKO A;  4G7O F;  1G4D A;  3HYI A;  1ZG3 A;  3TGN A;  5FGM A;  4AIH A;  1TW2 A;  4ZH4 F;  2GQQ A;  1BC8 C;  5CJ9 A;  2UXN A;  3L2C A;  5E20 A;  2FQ3 A;  3I5U A;  2CW0 F;  4LG0 A;  1HSJ A;  2NAZ A;  3K1N A;  4I02 A;  2FBI A;  1E2X A;  4CGZ A;  4HF1 A;  4UXN A;  2M5W A;  2NNY A;  3E3V A;  4I09 A;  3FM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...