2DQLA

Crystal structure of the circadian clock associated protein pex from anabaena
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
115
structure length
115
Chain Sequence
b'MKIEDIYQFFENPPPTYLCQEVAICYILYVLLQGESYGTELIQQLETEHPTYRLSDTVLYSAIKFLEDNRAITGYWKKLEGRGRPRRMYQVSPEWQHQAEDLARLWQNYIYVRTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pex protein
publication title Functionally important structural elements of the cyanobacterial clock-related protein Pex.
pubmed doi rcsb
source organism Anabaena sp. pcc 7120
molecule tags Circadian clock protein
total genus 36
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dqlA00
2PBIA 5DYMA 3GEZA 4ESJA 2O8XA 3G3ZA 4P96A 1U78A 2HGCA 1FBUA 1Z6RA 4LLNA 1U6GA 4EJTA 2CYYA 1AOYA 1S29A 2STTA 2EV0A 5FFXA 3GO5A 3JAMZ 1KYZA 3E3VA 3KETA 2VC1A 1XDUA 2ZFWA 3I59B 4E70A 2GIVA 1T0FA 4YFXF 4B8XA 2LF8A 2QLZA 3M1EA 3WTUC 3GX4X 2VBXA 4CGZA 3V7SA 4KIFA 4RGRA 2EJRA 1PP8F 2D1HA 4LG0A 1E17A 5ILUA 4K2EA 1ZG5A 2VC0A 3FM5A 3J7AO 4I0BA 4RGXA 3TO7A 3EYIA 1KU9A 3RDIA 2IP2A 3M9AA 1K6OA 1BOAA 5L3EA 1EV7A 4NB5A 5CVUA 3HHHA 1SFXA 3V4GA 3COAC 1ZGAA 2OBPA 1B1BA 3CUOA 4MEXF 2P5LC 2RKHA 3I64A 4M9XA 3E5XA 1SAXA 4BXUA 4Q4ZF 1RUOA 3NRVA 4KDPA 2ZJ2A 5IT9Z 1YLFA 2QQ9A 4EM0B 1Z9CA 3GFMA 1R36A 2EK5A 2GXGA 5L3CA 2K86A 4LD5A 3P7NA 4UV8A 5L3FA 2NYXA 2VOOA 1GXPA 3CUQB 3ZMSA 1BJAA 2XHKA 2IT0A 3P9KA 5E8IA 2DLLA 1IN8A 4YG2F 4UHTA 3QPHA 2ADUA 3HRUA 1O57A 3PQKA 3DKWA 1TLHB 5J6XA 3I4PA 1MD0A 2Y75A 2V6CA 3CTAA 1OKRA 2XV4S 4LFUA 5K1YA 1NHAA 3E6BA 2LNBA 2GA1A 2MLGA 2L4AA 1IW7F 1YW9A 4M6YA 4EMSA 2H94A 4ON0A 4PDKA 1XSVA 2QQBA 3TKYA 1SFEA 1R58A 3RPQA 5D4RA 2QBYB 2OA4A 2PFBA 4AD9A 1SD6A 5D6FA 3FMSA 3ZMTA 4GYIA 2UWMA 2P5KA 2CO5A 1O3TA 3IRRA 2DW4A 4M73A 4BHBA 2TDXA 1ON1A 1MJBA 2Q2EA 4QWQA 4MQ9F 1TQMA 3KZYA 1UHWA 2HOEA 3RKXA 3BPXA 1G4DA 1R22A 3GVAA 2QUFA 5FB2A 1ZG1A 3V7RA 4A2UA 3ECOA 3IHUA 4R1HA 1FNNA 2D45A 4R8HA 4M6XA 4A5NA 3JSPA 3KFWX 1HXDA 3GLXA 4IVNA 1G3YA 2E7XA 1KU2A 4PGGA 1T39A 3FXRA 2NRAC 5TRDA 5AONA 3K1MA 1TTYA 2E7WA 3BJ6A 5E1XA 2XAFA 1RI7A 3D5LA 4XSXF 1KQ8A 1U5TC 2ZBKA 1BIAA 2ISYA 1BM9A 3VODA 4KN7X 4U0VA 4HX4A 3KZZA 3ELKA 3MWMA 1YIOA 3IKVA 4I09A 4HX7A 2MC3A 2MBFA 3T0YA 2DK5A 4RGSA 3Q5FA 4LG0B 2R7FA 4A6EA 1HKTA 3DV8A 4L0YB 3MAJA 1R1TA 2PLYA 1BN5A 2XAQA 4R79A 1WI9A 2EV6A 1BI2A 2QQAA 5FO5A 3GFLA 4EM2A 3EETA 1F5TA 1J0RA 2B0LA 2KIMA 5ED4A 4A0ZA 1YS7A 3BWGA 1DPRA 4Q5SF 2RDPA 4HQMA 2KJBA 4G9YA 2HKOA 5BS6A 3F22A 1GHCA 4OIOF 2FA5A 2DBBA 1KQ0A 3LAJA 3TOAA 1L0OC 1P4AA 3B73A 3BPVA 1MJ9A 2GXBA 1IN5A 2X4HA 4RB0A 3U9GA 2STWA 5KK1A 1FP1D 1FP2A 1S7AA 1BI1A 1IUYA 1G6NA 2QZ8A 1ZLKA 4CICA 1W4MA 5FLXK 3JTHA 3V8LA 4HV5A 4EM1A 2W84A 2YX7A 4Z2YA 1S8NA 1R1UA 2BBYA 4BNCA 5HS7A 3Q9VA 5DCMB 1R00A 4CZZA 4CO8A 2X0LA 3ROUA 4EQQA 4M71A 2OD5A 2ZMEA 3KE2A 1DUXC 2ZCWA 4I7HA 1XMKA 2ZKZA 2JTVA 3FXQA 4MHGA 4Q47A 2L3DA 3WODF 1IXRC 2FEZA 4ASNA 4HLYA 3CO6C 5LGUA 1T2KA 3W6JB 5HDGA 5BQTA 1Z05A 1R7JA 1USSA 3RTRA 1J9IA 2L01A 1REPC 3NQOA 4I02A 5BPIA 4M72A 4M74A 3H92A 2FBIA 2K02A 5D5WB 3C3WA 4S05A 3ABUA 4IRHA 2G9WA 2V9VA 3J80K 4L5JA 4UUVA 3LA2A 4A5MA 5HOOA 2ZXJA 4G8XA 2L4MA 2ETHA 3IWFA 1F9NA 1ZGJA 1KU3A 3FMRA 3ZN1A 5EEHA 1TQPA 2JPCA 4IRIA 2YSRA 1FPQA 3WTZA 3KP3A 1FYMA 3HRTA 3K69A 1WRJA 2FXAA 1KYWA 4UVCA 2O0YA 3LSTA 4FX0A 1EH6A 2QWWA 3WTYC 4WX9A 5CJ9A 4ZYGA 2M5WA 2H27A 1XGMA 3P9CA 4Y15A 1BC7C 4ENMA 1BC8C 5ILSA 4NHJA 3FZVA 3R0AA 2VE8A 3QAHA 4EJUA 3FHZA 4AVPA 1T6SA 2DI3A 2CSOA 2YX4A 2A61A 2K7LA 2DPUA 2RQPA 2V1XA 1LDJA 3ECHA 1JHFA 3QOPA 2CFXA 1HQCA 1ODDA 2P4WA 2DO7A 1ZRCA 5F6FA 5FD6A 1LDDA 3E5UA 5E1ZB 1R5GA 5L3GA 4L9TA 1XSDA 3J81K 2IPQX 1SD4A 3W6KB 4GXOA 2EFWA 5ICCA 4IXAA 3HYIA 1MZBA 2Z99A 2CG4A 3LQQA 3MFKA 3HSEA 1IRFA 3HTSB 5TJJA 2DK8A 3GF2A 4P5OA 1J5YA 2NAZA 4JQFA 1G3WA 2VN2A 2IJLA 5LHIA 5BPDA 2FRHA 3JTGA 5FFZA 2OAZA 2BYVE 5LEKA 1YQAA 5FD5A 1YYVA 3F72A 4IJAA 2E1CA 4RB3C 3HTUA 2DQLA 1PDNC 2OQRA 3ULQB 1ZARA 3K0LA 3QRFF 3ML6A 3VB2A 2RC4A 3VFZA 4LB5A 2HR3A 2CQKA 4RAZA 2ZMEB 4HZFA 1P4WA 2HDCA 2W25A 1HW5A 3FMQA 5ICFA 3EYYA 3LQRA 3S2WA 3LWFA 1JGSA 1O3SA 5DUKA 1F1ZA 4IPAA 1IN7A 4FHTA 3HIFA 5DEQA 2BV6A 4KA4A 1G3TA 4EJVA 3TOBA 3KCCA 1USTA 1HW1A 2RVCA 1LEAA 2EA4A 3O6BB 4KN4X 3PFIA 3RKWA 5HS8A 4DQ2A 5ERIA 5DCMA 4UV9A 1V3FA 4L9NA 4KT5C 1W5TA 2HYGD 3TO6A 1WSUA 3I53A 3M7GA 2A3SA 4BAYA 2HKXA 4A6DA 2VBZA 1A04A 3H3UA 2K4BA 3ZP5A 2M30A 4JBAA 2UXXA 3VEPA 5EEGA 3QP5A 2EFOA 4JK1X 2ZNYA 4L9VA 2XUBA 2O61A 4ENJA 3T1BA 2HS5A 2E1NA 1OYWA 2RV8A 2BEOA 1LB2A 2XAHA 5DDGA 1SMYF 2L54A 3BZ6A 3I71A 1J2XA 3N97A 2VT3A 5E20A 4ZYEA 3RKYA 5J8FA 1KA8A 3IL2A 2VBWA 4IF4A 1B9NA 4GO1A 4RAYA 1SD5A 2VE9A 4L0ZB 3HHGA 2XASA 3RYRA 3EDPA 3R6SA 2Z3YA 4N9IA 2O03A 2MLKA 3J80Z 3QPTA 2R7DA 2PG4A 2P7VB 4KUMA 5LHHA 2JRTA 4P9FA 4PCQA 4MEYF 3M8FA 2P8TA 4ESFA 3CLOA 3F8NA 3ZMZA 1MJAA 3ZMUA 2DTRA 3F21A 3OV8A 2Z9OA 5CVIA 1J7KA 1DPUA 5H6RA 4QLCU 1JE8A 3GFJA 3DFGA 2WWYA 2P5VA 3ZMDA 2P6SA 1FZPB 2FE3A 3C1DA 5HDNA 1U5TB 1IN4A 3CDHA 3F23A 4M9ZA 2J5OA 2NNNA 4OIRF 2FNPA 1DP7P 1YFHA 1QQIA 3IWZA 2EFQA 4YIFA 3B02A 4Q48A 6PAXA 2IVMA 3H3ZA 2GAUA 4TV7A 1L3LA 1UFMA 1FX7A 2IA1A 4WF2A 2IA0A 5CVVA 4Y17A 4ENNA 1XSXA 5D8KB 4L18B 2GQQA 4YFNF 1TNTA 3J81Z 1U8RA 3GXOA 1O7LA 3L9FA 3RIRA 4A12A 1XGOA 2CGPA 5HLIA 4A0YA 3WTTC 4HF2A 1Y0UA 2DPDA 2CW0F 4LK0F 3I5UA 5HS9A 2KIUA 1P4XA 3SFZA 2K27A 2M45A 4LK1F 2O3FA 3L2CA 3TO9A 2IA2A 1LVAA 1JHHA 5K5OA 1W7PA 3WGGA 3MEXA 5A2QK 4P9UA 4N9HA 3IKTA 3K2ZA 3CJNA 3MZHA 4ZZDA 2JT1A 4F7ZA 3PQJA 5DD8A 2HEOA 2XGXA 2LSOA 2V79A 3K1PA 4RS8A 5ICEA 3GZ6A 2VT2A 3T8RA 1HKSA 1XB4A 2RN7A 1B9MA 2EFNA 4YFKF 2AS5F 5LEJA 1Z6TA 4G6DA 1QO0D 5E18F 3I54A 3WTWC 2W57A 2MD5A 2DT5A 1YTYA 2Q0OA 1WWXA 1S3JA 4M9SA 4L9JA 5LHGA 4EV0A 5D5UB 1MGTA 1I1GA 2ELHA 3D0SA 2M87A 4O5VA 1FOKA 1VTNC 2LF7A 1T98A 3N4MA 4FT8A 4U7BA 3L7WA 2KKOA 2XVCA 2Z33A 2AXLA 5AIQA 2HQNA 5D5VB 3G73A 1FLIA 2V1UA 1R1VA 4O3MA 4DNCA 1IAWA 2HTJA 1ZYRF 4HF1A 3WGHA 5E1WA 3FXUA 3C18A 3MZYA 1IRGA 1LJ9A 1XD7A 1XGSA 4GCVA 1FYLA 1CF7A 5JVTA 1PUEE 3JW4A 1BBYA 4EGYA 1WQ2A 4XRFA 2XKPA 4G6QA 3LA3A 3I58A 3F8FA 1ZH5A 3ABTA 5E8GA 4XBFA 4AWXB 2VODA 1IXCA 3GWZA 4PZJA 3QU3A 3DPTA 4G7HF 3RYPA 3WE2A 1J75A 3SXYA 1Z7UA 5CVRA 3U1DA 4MTEA 1ZRDA 1C0WA 4O6JA 5L3BA 3WU1B 2PQ8A 5D8LB 3ZPLA 3V8JA 3K1NA 4A0XA 4KFCA 1HBXG 5DCFA 3GW2A 1S6LA 3HOTA 3U2RA 2FNAA 4HW0A 4HAMA 4ENKA 1ONVA 2H6BA 2FBHA 4UVBA 2H09A 5FGMA 1UCRA 2PEXA 2XIGA 4WK8F 5LRSA 1F4KA 5K5QA 1ZLJA 5DUIA 4HYEA 2EB7A 1PP7U 1XCVA 1FY7A 4LLGF 4HF0A 4B09A 1GVJA 2WV0A 1OYYA 2UXNA 2Q8KA 3EQLF 3F6VA 1YS6A 4AIHA 3HOSA 1K79A 2XAJA 4HX8A 1I27A 1RNLA 4HDUA 2DU9A 5KVRA 4OMYA 4LLLA 5LRRA 4IHSA 4PGHA 2FOKA 4ESBA 4HLXA 1QGPA 3BJOA 4RB2C 1U5TA 5D6EA 2BGCA 1MDMA 2ZO4A 4EGZA 2J5PA 3M8EA 2QENA 2M8EA 3L00A 1R23A 3HUGA 2XROA 1W7PB 5DV5A 2DAOA 4MNUA 4BHPA 5CLSA 5IT3A 2PMHA 2XAGA 1HSJA 5LLQA 3T8TA 4U7DA 5LGTA 1OPCA 5JHUA 2R3SA 1H9GA 3V7CA 3IC7A 1FBSA 1ULYA 4BHCA 1FC3A 3DP7A 1ZG3A 5JFRA 3KP4A 1D3YA 4ZH4F 3BDDA 3QU6A 4HQEA 1Z1DA 3E6CC 4S04A 4BQAA 2JPBA 3R61A 5J8CA 1YW7A 2ISZA 2MA3A 3KLOA 4KNYA 3DXJF 2QVOA 3BP8A 4HBLA 3WTSC 2A6HF 3MQ0A 1TW2A 1E2XA 2EFPA 2VONA 1G3SA 3E5QA 2FF4A 1I6XA 2ESNA 2KRFA 4KIBA 3REOA 5HDKA 4MGRA 1D8KA 1ON2A 4LGWA 3FX3A 1P2FA 2OU2A 3KP7A 3FF5A 5A2QZ 2F5EA 3TQNA 2F2EA 3BOQA 4LMYA 2V1DA 4CXFA 3EUHA 3TGNA 1HW2A 2HWVA 5FLXZ 1OYIA 3KLNA 3P9IA 3CUQC 3WGIA 1DDNA 1TQIA 2NS0A 3BROA 4ZYDA 4EJOA 4I01A 5JI6A 4HA8A 1RIOH 1KGSA 5ILVA 4HOBA 1H0MA 1FWZA 1CF7B 1KU7A 3V8KA 3DQVC 1XGNA 3GZ5A 4AIKA 1HKQA 1TW3A 4WXHA 4WWCA 1AWCA 4LJZF 1V4RA 3ZQ7A 4U0YA 3IRQA 4KIGA 3ISPA 3LAPA 3KP2A 4Y13A 3O3KA 4UXNA 1P92A 3SZTA 3DF8A 2Z5UA 4KMUX 2CWEA 4FX4A 2EA2A 1O3QA 1TNSA 4WXDA 3AAFA 2G7UA 3DEUA 4U88A 2YR2A 4XLNF 3SQNA 2A68F 2GA2A 2A6EF 1GXQA 4OINF 3ZMVA 4OIQF 5H20A 2LDUA 1B6AA 5H6QA 5D5XB 1R5HA 2WTEA 2VOPA 1XMAA 2OQGA 1ZN2A 4KMFA 2H6CA 1KQ9A 2K4JA 2XKOA 4BYYA 2KJCA 1UHMA 3JSOA 4NQWA 2YU3A 3HRMA 2G7HA 2GWRA 1BI3A 2OZUA 1OMIA 2Y48A 1IXSB 3R4KA 1D5VA 1LNWA 3E6DA 3F3XA 5BMZA 2FQ3A 5LBQA 2F5FA 1MKMA 2FMYA 1FSHA 4OMZA 3MCZA 3NEUA 2MH2A 1W7PD 1BIBA 1J59A 1XN7A 3JAMK 5ICGA 1SD7A 1MDMB 3HRSA 1RZ4A 4YIIA 4I0AA 1K78A 3KEOA 1U3EM 4KYWA 3KP5A 1QNTA 3WG9A 2F5DA 2GZWA 5JR3A 1YG2A 3F8CA 4UNOA 2RNJA 4ETSA 1FBQA 3ERED 1UB9A 3RI4A 2F5CA 4CDGA 4UVAA 4AIJA 3WTXC 4HV6A 3C7JA 2PI0A 2QM3A 4MTDA 2EWNA 4OIPF 1LDKB 1RUNA 4I2OA 2YPRA 1T38A 1IN6A 4GGGA 3LA7A 2HZTA 1BI0A 1O3RA 3CO7C 3Q9SA 4G94A 1B4AA 1SMTA 3WU0A 4KICA 5HVQC 1TBXA 3WTVC 1OR7A 3QP6A 3F6OA 1W5SA 3R60A 4D0PA 2Y0MA 2MH9A 5L3DA 2M1BA 3LFKA 2PJPA 1YO5C 1EH7A 2XRNA 3I59A 4CHUA 1S7OA 1I5ZA 2P6TA 5HLGA 2W85A 2P7CB 5IT9K 3RPUA 3BY6A 4N0BA 1QBJA 1IZ1A 3GUDA 4I98B 4BH9A 2EV5A 4WXCA 1JXSA 2PN6A 3T5XA 3SHFA 1XCBA 2DQRA 1QZYA 2L02A 3E97A 4H0EA 2HYFA 5F64A 2NNYA 4IHTA 1LEBA 2HTSA 2IW5A 3TDZC 2VXZA 3BJAA 1O7FA 3TDUC 2KIFA 1SFUA 3DPLC 1CGPA 1HSTA 4G7OF 1LQ1A 2QYOA 3F8MA 2RGVA 4LB6B 2D1VA 1WKMA 5LGNA 2JZYA 4P55A 1ZREA 1I1SA 1IF1A 4MQVA 1FT9A 3KP6A 2DFIA 5CYVA 2HQRA 4HDVA 4RB1A 4EVIA 4IRGA 4XLPF 1FSEA 4RGUA 2D2WA 4ZYHA 2COMA 1EH8A 2ZNZA 2O6GE 3RJPA 5BOXA 3CUQA 1K7AA 2FMLA 3F8BA 2PMUA 4CYDA 1XDSA 4EJWA 2A07F 3FWEA 2W24A 1FYKA 2VBYA 2ESHA 3L09A 4G7ZF 1B59A 4XSZF 3SZPA 3K9TA 1U2WA 4OU0A 3VOEA 4WCGA 2C6YA 4ZZLA 3R0JA 3E6MA 1QPMA 1QZZA 3I0TA 2OZ6A 2WC2A 3WE3A 2QBYA 1P6RA 5F1RA 3ZN0A 3FM3A 1ZHFA 3O2PE 4U0WA 3GFIA 1ZRFA 2ACJA 1Q1HA 2UZKA 1STZA 5CVJA 5K5RA 2HFHA 1K78B 5AIPA 5HLHA 3GYHX 1ZAOA 3OOPA 2IRFG 4L5IA 3KEQA 5D4SA 2FSWA 2BE5F 3HSFA 4GYGA 2A5YB 2A69F 2LKPA 2FBKA 1Z91A 2FU4A 1X3UA 2JSCA 1H9TA 4OOIA 1YW8A 3HSRA 5DD4A 1D8JA 5E17F
chains in the Genus database with same CATH superfamily
2WAQA 2PBIA 5DYMA 3GEZA 4ESJA 2CFOA 2K9NA 3S32A 1SVMA 2JQ7A 3PUFA 3CMYA 2O8XA 1K61A 3G3ZA 3A01B 4P96A 1U78A 1UG0A 4BDZA 2HGCA 3CC2I 1FBUA 3DTEA 3H5AA 1D1AA 1Z6RA 5FKNA 4LLNA 2WB1A 2X51A 2HQ5A 5HLTA 1U6GA 2CUJA 3JRBA 4EJTA 2CYYA 1AOYA 1S29A 2STTA 3BG5A 1MNDA 2EV0A 5FFXA 3RCOA 3GO5A 3JAMZ 1KYZA 1CQTA 1V5FA 2DMPA 3E3VA 2VQCA 2VC1A 3KETA 1IV8A 1XDUA 2ZFWA 3I59B 5GTHC 4E70A 4XRSA 2VIXA 2GIVA 1T0FA 4YFXF 2O5RA 4B8XA 2HOTA 1Z3XA 1S72I 2LF8A 3E1SA 1G8XA 3A1YA 4FQGA 4OWRB 2QLZA 3M1EA 3WTUC 1A6QA 4OAZA 1TWAJ 4C3HJ 1RC9A 3GX4X 1I3AA 2VBXA 4CGZA 4P1WA 3V7SA 2VLAA 1XC5A 3JRAA 1PUFA 2HVRA 4KIFA 2KPMA 5EG0B 2Y30A 1YX3A 4RGRA 1V5GA 2EJRA 4AU7A 1PP8F 1JI8A 2D1HA 4LG0A 3PJRA 1E17A 1UG2A 5ILUA 4K2EA 1GV2A 1QVUA 1ZG5A 2VC0A 4NBQA 3VYTB 2I5UA 4RA2A 3BG9A 3FM5A 2IS4A 3J7AO 4I0BA 4RGXA 3TO7A 2MGQA 3EYIA 5F27A 4FE4A 4XOTA 1KU9A 2B7EA 4DOZA 4JYKA 3RDIA 2EZLA 3KYCB 2IP2A 3OIQA 3TBIA 3ZOBA 4E4HA 5F1JA 3M9AA 1K6OA 1BOAA 3LSRA 1Z21A 2M8GX 5L3EA 1EV7A 4NB5A 5CVUA 4DZPA 3HHHA 2CU7A 1SFXA 3V4GA 2R7UA 3LFUA 3COAC 3DKYA 2LKXA 2MC4A 1ZGAA 2OBPA 3JRCA 4E7HA 1MBHA 3IV5A 1B1BA 2ZJQF 2PMZA 4PSWA 3CUOA 4MEXF 4XIDA 2BXYA 2KDZA 2RKHA 3I64A 4B44A 3OYBA 2P5LC 1ETYA 4M9XA 3JRHA 2HNHA 3E5XA 4MLOA 4D5FA 1SAXA 3S1NJ 4BXUA 3CF5F 2VJJA 4Q4ZF 2F48A 1RUOA 3NRVA 4KDPA 1PJRA 2BHYA 2ZJ2A 5IT9Z 1YLFA 2QQ9A 4ZDPA 4EM0B 1Z9CA 1J09A 3SYTA 4IEJA 3GFMA 1R36A 2EK5A 1MBEA 2GXGA 4IQ4A 5L3CA 1FTTA 4RM2A 2K86A 2XAUA 4LD5A 2NXNB 2LMDA 3H0DA 3P7NA 4M3GA 4UV8A 4D5CA 5L3FA 3S3MA 2NYXA 4NNJA 2VOOA 1GXPA 3CUQB 3OR1C 2DA1A 3ZMSA 1P7IA 4BACA 1BJAA 1YIJI 2YU9J 2XHKA 2IT0A 2M0MA 3HG9A 3E0JB 1B72A 2QKMB 2JUGA 2DA6A 1WJ5A 2AHQA 3BG6A 3P9KA 1SFOJ 1O4XA 3ZXSA 5E8IA 2OTLI 3W6VA 2DLLA 1UAAA 1IN8A 2NOJB 3GTMJ 4YG2F 1T33A 4UHTA 2DA5A 3Q0WA 3QPHA 5LFAA 4IHVA 2ADUA 2X6WA 4XKVA 3HRUA 2EQRA 2HU9A 4JX5A 5GTIC 5IOZA 2HOAA 4IOAF 1O57A 3PQKA 3DKWA 1OJLA 1TLHB 5J6XA 3I4PA 1MD0A 2Y75A 2V6CA 3CTAA 1OKRA 2XV4S 4LFUA 5K1YA 1NHAA 3IH3A 3JRFA 3E6BA 5EZHA 3Q0VA 2L0KA 3GLLA 2XF7A 2R7RA 4DIQA 3CJRB 2LNBA 2GA1A 2MLGA 2L4AA 1IW7F 1YW9A 3LOCA 4M6YA 3PIOF 4EMSA 2H94A 4ON0A 4CCMA 4PDKA 3AL0C 2R7OA 1OCZH 1XSVA 4CYCA 3PSIA 2QQBA 3TKYA 1SFEA 1R58A 4QSHA 2K9QA 5EZGA 2E2IJ 1EF4A 3DCFA 1Q1VA 3RPQA 4D7NA 5D4RA 2OA4A 2QBYB 3S15J 1QVTA 2PFBA 4AD9A 5EGOA 1SD6A 2NVYJ 4BEHA 2JN6A 5D6FA 3FMSA 3ZMTA 2WADA 1GLNA 4GYIA 2UWMA 2P5KA 2CO5A 3MKLA 4D9JA 1O3TA 3IRRA 1WJCA 4C30A 2DW4A 4M73A 4BHBA 3I3LA 5IYBJ 2TDXA 1PVEA 2PJRA 4IHYA 1ON1A 3D5RC 1MBFA 1MJBA 2Q2EA 4QWQA 4MQ9F 5K7ZA 1TQMA 1JKPC 3KZYA 3G71I 3OS1A 1VQOI 1UHWA 2HOEA 3RKXA 3CF2A 3BPXA 4M3FA 3L1PA 1RESA 2Y9ZA 1B8IB 4XLEA 1G4DA 2JA6J 1R22A 3GVAA 2QUFA 1JUPA 5FB2A 1ZG1A 1FMVA 5E3MA 3V7RA 4A2UA 3ECOA 2NVQJ 3IHUA 1DP3A 4ZC3A 4DYCA 4R1HA 4YEJA 2CV1A 3DBRB 3LSIA 2Y0SA 1FNNA 3PUBA 2D45A 1YJ9I 3HDDA 4R8HA 4M6XA 4A5NA 3U21A 3JSPA 3KFWX 2KP6A 1HXDA 3GLXA 1DU6A 2RNGA 1G3YA 4IVNA 2E7XA 1KU2A 4PGGA 3JRGA 1T39A 3FXRA 2NRAC 2QGUA 2ME0A 5TRDA 4I76A 2CRGA 5AONA 3K1MA 1TTYA 2E7WA 3BJ6A 1NG6A 5E1XA 2XAFA 2CV2A 3J7AY 2RAEA 1RI7A 4DGWB 1UELB 3D5LA 2ELKA 2DYSH 3RPUD 4W97A 4C3JJ 3ZQIA 3JR9A 4MFEA 4XSXF 1KQ8A 1U5TC 3OYLA 1APLC 3QYFA 2ZBKA 2DA7A 2W00A 1BIAA 2ISYA 2H1KA 1BM9A 5KAIC 2V7FA 3VODA 4KN7X 4U0VA 1RRJA 4HX4A 3KZZA 3M1CA 4B47A 5M5YJ 3ELKA 3MWMA 3BLYA 3AG3H 2VL8A 3H9QA 1MBKA 1YIOA 3ESWB 2Z16A 1E3OC 3IKVA 2VKEA 2VQHA 4I09A 4A3CJ 4BXXJ 5M5WJ 1WCMJ 4HX7A 3OYKA 4IO9F 2MC3A 1PUFB 2NVUB 2EIMH 2MBFA 2F5VA 3T0YA 4E7ZA 3TEDA 2DK5A 1F36A 3HGYA 4RGSA 3Q5FA 4LG0B 2R7FA 4A6EA 1HKTA 4DZJA 3DV8A 5J3LA 2LKSA 5E3OA 4L0YB 3MAJA 1VF9A 2GXAA 2GM4A 1R1TA 2PLYA 1BN5A 2XAQA 2XGDA 5GAHJ 1JT0A 3AKZA 3K4KA 4R79A 2ZXHA 2EBIA 1WI9A 2VQLA 2EV6A 1BI2A 2QQAA 1WGXA 2W82A 5FO5A 3GFLA 3OYNA 1WJBA 2F4OB 4G12A 4EM2A 1ETQA 3GTJJ 1GT0C 3EETA 3KX2A 1F5TA 4RLQA 2E34A 1J0RA 2B0LA 2KIMA 1HDDC 3D1NI 3OYFA 2FD5A 2KT0A 5ED4A 1JTYA 1Y6IA 4A0ZA 4J19A 1YS7A 2K5CA 2DT6A 4JX6A 3BWGA 1DPRA 1GVDA 4Q5SF 2RDPA 4HQMA 2KJBA 4G9YA 2HKOA 4LIVA 5BS6A 3F22A 1GHCA 4OIOF 2FA5A 2L9RA 1ETKA 2DBBA 1KQ0A 4GFBA 3Q3SA 1A5JA 2Z2SB 3LAJA 5FKOA 3TOAA 1L0OC 1P4AA 3B73A 3BPVA 1MJ9A 3ABMH 4LIUA 1HOMA 3DTIA 5C4XJ 2GXBA 1IN5A 2X4HA 3FKIJ 2Z1DA 1QRYA 4RB0A 3U9GA 2STWA 5KK1A 1FP1D 3FIWA 5GPCA 3IAM2 1YE9A 1FP2A 1S7AA 3FBIB 1BI1A 2HPIA 1D0YA 1IUYA 1G6NA 2QZ8A 3MKZA 4D7MA 1ZLKA 1W36D 4CICA 3LSKA 4CZCA 1W4MA 2MFZA 3HOYJ 4A3IJ 3FXOA 3DBLB 3S17J 2HDWA 2EZIA 5FLXK 3JTHA 3V8LA 4HV5A 4EM1A 2W84A 2YX7A 2IS2A 4Z2YA 1VI0A 4XKWA 2L9NA 3ABLH 3GTOJ 1S8NA 1R1UA 1BR4A 1MSFC 2M9HA 2BBYA 4BNCA 3BT9A 5HS7A 3SDBA 3OYJA 3Q9VA 4OAYA 1R00A 5DCMB 2E2JJ 3HXLA 4CZZA 2OCEA 4CO8A 1B72B 2X0LA 5J47A 2EIKH 3FISA 3ROUA 4EQQA 4M71A 2OD5A 2ZMEA 2E1MC 3KE2A 2X6XA 4DYRA 1DUXC 5CKTA 3OMYA 3RSNA 4NC6A 2ZCWA 1HA8A 3O8GA 1FIPA 1W1WE 4I7HA 2AXTC 3TL4X 2CJJA 2WY8Q 1XMKA 3OS2A 3H5RA 2M3AA 2ZKZA 2JTVA 2WY7Q 3FXQA 4MHGA 2L9SA 3FXJA 4Q47A 1SANA 2L3DA 3WODF 1IXRC 2FEZA 4ASNA 2EZHA 3I4NJ 3CP2A 5FKMA 5J1UA 4HLYA 3MD2A 3CO6C 4CYCB 5LGUA 2DFFA 1T2KA 2XB0X 4XORA 3W6JB 5HDGA 5BQTA 3RZOJ 1Z05A 3BG3A 1R7JA 3M07A 4XM3A 1USSA 3RTRA 1LVKA 4BE1A 1XPXA 4IHWA 1J9IA 2L01A 1TWFJ 4L5EA 4B48A 1REPC 1W5CC 3NQOA 3CCJI 4I02A 2K9SA 5BPIA 1V54H 4M72A 4M74A 1VQ4I 4BEHB 3H92A 2B63J 2FBIA 2K02A 4JP0A 5D5WB 3C3WA 1IRZA 4A3JJ 4PJNA 4S05A 3IUOA 3ABUA 4IRHA 1T08B 3HBLA 2G9WA 2V9VA 3J80K 1DU0A 2FUG2 2PJRB 4L5JA 4UUVA 1IRXA 2DOAA 3LA2A 4A5MA 5HOOA 2Q2EB 4AVZA 2ZXJA 4G8XA 2L4MA 2ETHA 3IWFA 1F9NA 2XGCA 2JJ7A 1ZGJA 3ASNH 1KU3A 4W1UA 3SFIA 3FMRA 3ZN1A 5EEHA 1TQPA 3SJMA 3WU2C 2JPCA 5K7HA 4IRIA 2MW8A 4RBOA 2YSRA 1FPQA 2DMTA 3WTZA 2KQRA 2DA4A 3KP3A 1FYMA 3HRTA 3K69A 1ZKGA 1POGA 4A3FJ 1AHDP 3CCRI 4B3XA 1WRJA 2FXAA 3DEWA 3OR2C 4IX7A 2XSDC 1KYWA 4UVCA 2O0YA 3LSTA 4FX0A 5F0HA 2LLKA 1EH6A 2QWWA 1X4OA 3OWTA 3IH2A 3VDXA 2WAEA 3WTYC 1WJDA 4WX9A 4ZDOA 1AA7A 5CJ9A 4ZYGA 1TWCJ 2M5WA 1S5LC 2VKDA 2H27A 1XGMA 2LBFA 5J40A 3P9CA 4Y15A 1BC7C 3QQAA 1VFCA 4BJTA 3S1RJ 1H89C 2R93J 4BJ5C 4ENMA 1BR1A 4BDYA 2UV1A 1FOXA 1BC8C 5ILSA 4NHJA 3FZVA 3FXKA 2F4MB 2KFDA 3R0AA 2VE8A 3QAHA 4EJUA 2R7SA 4ZYAA 3FHZA 3K4BA 4AVPA 5LD2C 2EPFA 1QPIA 1T6SA 2E5NA 3ZQLA 2DI3A 4PJ0C 4F92B 2CSOA 2YX4A 3LNQA 2A61A 1UMQA 2K7LA 3CC7I 2DPUA 2RQPA 2V1XA 4BE0A 1WVRA 2I10A 1LDJA 4B43A 1NK3P 3ECHA 3S16J 2OF7A 3P5JA 1JHFA 3QOPA 4FASD 2LP0A 2CFXA 2XPWA 2R5YA 1HQCA 4XQFA 3G2BA 2ECBA 1ODDA 3AG4H 3VYSB 2P4WA 2JRMA 3OSFA 4Y33A 1KZHA 2DO7A 3QOEA 3L2WA 1ZRCA 3OSGA 5F6FA 5FD6A 1LDDA 3E5UA 5E1ZB 4BGDA 1R5GA 1SAUA 2Q1ZB 3JCUC 2VB6A 5L3GA 1T95A 1U9NA 3MN2A 4L9TA 4KT6A 1XSDA 4HSTA 3CCQI 3J81K 1A6IA 2DDAA 1Y1WJ 2IPQX 1SD4A 2WV1A 3W6KB 3OL3A 4GXOA 1XX5A 2EFWA 2ZXWH 5ICCA 4IXAA 4YIRX 3HYIA 1MZBA 2Z99A 4BQNA 2CG4A 2R7QA 3FKJA 4IOCF 3LQQA 3MFKA 3HSEA 1IRFA 5GAGJ 4XRMA 4A3BJ 1MMDA 3HTSB 2HPMA 1ZELA 2E19A 5TJJA 2DK8A 3GF2A 1OR7C 4P5OA 2Y69H 1J5YA 2JVHA 2EZKA 1K6YA 2NAZA 4HEA2 4JQFA 1JUSA 1G3WA 2VN2A 2IJLA 3PO3J 5LHIA 1ZGWA 3CCSI 5BPDA 1TC3C 2FRHA 4F91B 1E3PA 1Z0XA 4UB8C 4GRIA 1R4MB 3A0BC 3CMMA 3QPLA 3JTGA 5FFZA 3CZ6A 2OAZA 2BYVE 1FOYA 3ASOH 5LEKA 3VYRB 1YQAA 5FD5A 2MG4A 1YYVA 2CQNA 2BXZA 3F72A 3K2AA 3K10A 3GTLJ 4BKXA 4IJAA 2E1CA 4RB3C 5KNLA 3HTUA 3HOWJ 3OYIA 2GIZA 2DQLA 2CUFA 1PDNC 2KISA 4AYBN 2YS9A 4B3AA 2ZJRF 1VQ5I 1U0JA 3CJTB 3MKWB 2OQRA 2Y31A 3S8PA 3ULQB 1XMXA 1ZARA 4XRSG 2BY3A 2E5ZA 2ZC2A 3K0LA 4XR6A 2P81A 4HNUA 4YRVA 3PSFA 3QRFF 3ML6A 3VB2A 2DT7B 2LY1A 2RC4A 3LSMA 3CP8A 5IP7J 4XMYA 2ICWG 1MBJA 1MH4A 2IAIA 2KLOA 3FXMA 3VFZA 4LB5A 2HR3A 2CQKA 1VQKI 4RAZA 2L5QA 3L2RA 5C44J 3EPZA 2ZMEB 1Y56A 2P0WA 3QPSA 1ETXA 4ZDLA 2BY0A 4HZFA 4ZTFA 2G0EA 1P4WA 2HDCA 2EILH 2W25A 1HW5A 3FMQA 3BR5A 2QQ8A 4UUSA 5ICFA 3K4LA 3EYYA 3H3VK 3LQRA 4A3EJ 3S2WA 4RM3A 3LWFA 2VKHA 3BTJA 3BQZA 1JGSA 1O3SA 4XKCA 5DUKA 4BY1J 1F1ZA 3TW7A 3QYEA 1X1AA 3UR3C 3BTLA 4BU2A 5KCMA 4IPAA 1JUMA 4F55A 2K3PA 1IN7A 5DS9A 3K4CA 2QCOA 4FHTA 3M3YJ 3HIFA 5DEQA 2BV6A 4KA4A 1G3TA 4MIMA 4EJVA 4FE7A 3TOBA 3KCCA 1USTA 1HW1A 2RVCA 1BA5A 1LEAA 2FX0A 2EA4A 1X3WB 3O6BB 4KN4X 3PFIA 3RKWA 1BW6A 1RKWA 2E2HJ 1TWHJ 5HS8A 2JA2A 4DQ2A 2DODA 5ERIA 4QPOA 2DMUA 5DCMA 3BR0A 1FOWA 3KYLA 4UV9A 1V3FA 4L9NA 2EIJH 2VI6A 4KT5C 5J1RA 4YELA 1IDZA 4PJJA 1W5TA 1HDPA 2K3FA 3K4MA 5FKKA 2ZSHB 3CMAI 2HYGD 3TO6A 2R92J 2X1EA 1WSUA 5GADJ 1EJ9A 4A93J 3I53A 1XS9A 3S1QJ 1VNDA 2X1CA 3M7GA 2A3SA 4BAYA 2HKXA 2HYJA 3HKZN 4A6DA 1ACIA 1A31A 2VBZA 5HODA 2XRLA 2H8RA 1A04A 5J1YA 3H3UA 2K4BA 3MMYB 2AO9A 3NAUA 3ZP5A 2M30A 4JBAA 2LK2A 2UXXA 3VEPA 2X6YA 5EEGA 3LSGA 3QP5A 2EFOA 4JK1X 2ZNYA 1X58A 4L9VA 5F0CA 2XUBA 2O61A 2H1LA 2HS5A 3T1BA 4ENJA 2E1NA 2M4KA 1OYWA 2R5ZA 3AL0B 1LFBA 2RV8A 2BEOA 1LKXA 2ID6A 2XAHA 5DDGA 1LB2A 4IQJA 1VQNI 1BW5A 1N75A 1SMYF 2L54A 1YJWI 4BBSJ 3BZ6A 3I71A 2LBFB 1J2XA 4A69C 3N97A 2R0QC 2VT3A 1X4PA 5E20A 4FETA 4ZYEA 3C2GA 3RKYA 5J8FA 1KA8A 3IL2A 3S14J 2VBWA 2O9LA 4IF4A 3QYBA 1B9NA 4GO1A 4RAYA 3HJEA 1SD5A 2VE9A 1X2MA 5IY5H 4L0ZB 3HHGA 3HOZJ 2XASA 3ZRGA 3RYRA 3EDPA 3R6SA 1WI3A 2Z3YA 4N9IA 3TP3A 2A5WA 4NDLA 3ZQQA 2O03A 2MLKA 3J80Z 3QPTA 5F04A 3G6EI 2R7DA 3MKYB 2PG4A 2P7VB 4KUMA 5LHHA 2JRTA 2EH3A 4P9FA 1T56A 1AKHA 4CA0A 4PCQA 4MEYF 2R5YB 2DFEA 3M8FA 3A4CA 2QA4I 4NUBA 2P8TA 4ESFA 1YI2I 3CLOA 3F8NA 2XC7A 2Y9YA 1RKTA 1MMGA 3L2UA 2E60A 2JA5J 3ZMZA 1MJAA 3ZMUA 2DTRA 3F21A 2XSJC 3CD6I 2QEXI 1MNMC 2LC2A 3OV8A 3GCMA 4F3QA 2Z9OA 5CVIA 1J7KA 2TRTA 1DPUA 1QZEA 5H6RA 2DMNA 4QLCU 1JE8A 5C4JJ 1S7EA 3GFJA 1LE8A 3DFGA 2A05A 1MIJA 2HZDA 4XLFA 2WWYA 4BJ6C 2P5VA 3ZMDA 2ELJA 3HPHA 3WHBA 2R7VA 2P6SA 2OTJI 4C9YA 1FZPB 2FE3A 3C1DA 3S93A 5HDNA 2WA0A 2BOLA 2KZGA 1U5TB 1IN4A 3CDHA 3UNGC 3ZQFA 3F23A 4M9ZA 2J5OA 2NNNA 1MMSA 4OIRF 2FNPA 2OPTA 1DP7P 2V9KA 1YFHA 1IG7A 1QQIA 3OYMA 3IWZA 2EFQA 3K4JA 3B02A 4Q48A 4YIFA 2IVMA 3DBHB 5J4YA 4BXFA 1VQMI 6PAXA 3H3ZA 4FTHA 2GAUA 4TV7A 1L3LA 3HUGB 1UFMA 5CQEA 1JKOC 4S0HB 1FX7A 1BL0A 2R7ZJ 2IA1A 3KZIC 4WF2A 2IA0A 5CVVA 3NARA 1VQ8I 4Y17A 1XSXA 5D8KB 3J7ZI 4ENNA 4L18B 2GQQA 3UKGA 4YFNF 2DMQA 1NK2P 2HXOA 3FDYA 1TNTA 1SVOA 2X48A 3J81Z 2KZVA 3F0CA 5KAFC 4J00A 1U8RA 3GXOA 4CSWA 2NS8A 1O7LA 1MSEC 4F52A 3DKXA 3L9FA 3RIRA 4A12A 1YOVB 4CUGA 1XGOA 1X1DA 2CGPA 2KIQA 1ETVA 5HLIA 4A0YA 2IS1A 3WTTC 4HF2A 2VJIA 1Y0UA 5EDNA 3DPUA 2DPDA 2CW0F 3S3NA 4V2FA 3HM5A 4UUSB 4LK0F 1VQPI 2BW3A 4BE2A 3G1MA 3I5UA 3ZQHA 2GLOA 5HS9A 3PNVA 2DOEA 2KIUA 1P4XA 3SFZA 3CC4I 2UUZA 2K27A 2M45A 4LK1F 2VPLA 1WJFA 1K4TA 2O3FA 3CCUI 3L2CA 3BCBA 5IYDJ 3TO9A 1ERDA 2IA2A 1LVAA 1JHHA 5K5OA 1OCPA 4E7KA 4UB6C 3RQIA 1W7PA 5DTDA 3WGGA 1GUUA 1WFXA 3MEXA 5A2QK 2OCCH 3IAS2 4P9UA 4N9HA 3IKTA 3K2ZA 4Y3OA 3CJNA 1Z7LA 2X85A 3MZHA 3QODA 4U87A 4ZZDA 2IGMA 5FLVA 1UZCA 2R4GA 2JT1A 4M3DA 3CQZJ 3PQJA 4F7ZA 3HC7A 5DD8A 2HEOA 2XGXA 3EUHC 2LSOA 3OYAA 3OYGA 2V79A 3K1PA 4RS8A 1X1BA 3BQYA 2CQXA 5FJ8J 5ICEA 3L2QA 3GZ6A 2VT2A 2R7WA 5FKLA 3BZCA 3T8RA 1HCRA 1HKSA 3ABKH 2QF7A 1XB4A 2RN7A 1B9MA 3PFYA 4HRIA 2EFNA 5E3NA 4YFKF 1D0ZA 2AS5F 5LEJA 1SEUA 1OCTC 1Z6TA 4G6DA 2O7OA 3SDGA 2CUEA 1QO0D 1FEXA 3IH4A 2E1MB 5E18F 1JKRC 1X1CA 1SC7A 1ETOA 3I54A 3WTWC 3RZDJ 4UUTA 1JGGA 2W57A 2MD5A 3D5SC 1IO2A 4RDUA 2DT5A 4ZTJA 1YTYA 3J7YJ 2Q0OA 5EF6A 1WWXA 1WH7A 1TP4A 4V19K 3W2AA 1S3JA 4M9SA 4L9JA 5LHGA 4EV0A 5D5UB 1MGTA 4CCOA 3HOUJ 1I1GA 2ELHA 3D0SA 1AU7A 2M87A 4O5VA 1FOKA 3S3OA 1VTNC 2LF7A 1T98A 4XLAA 2L7MP 3OIPA 3N4MA 4FT8A 4U7BA 3L7WA 3GMEA 2R5ZB 2DFHA 2KKOA 2DA3A 2XVCA 2Z33A 2QKLB 4C2TA 2AXLA 5AIQA 2HQNA 3IP4B 2LR8A 5D5VB 3KYDB 3K70D 3G73A 1FLIA 4B4CA 2V1UA 1TZLA 2WB1N 1R1VA 4O3MA 2KRHA 3ONQA 4DNCA 3HGGA 1IAWA 2HTJA 1ZYRF 1BOBA 2LY2A 4HF1A 3GZNB 2GOMA 3WGHA 3ZQCA 5E1WA 3BZKA 3FXUA 3C18A 3MZYA 3DTKA 1IRGA 1Y8RB 1LJ9A 1XD7A 5B66C 1MW7A 1XGSA 4GCVA 3OYHA 1FYLA 1CF7A 5JVTA 1F43A 3JRDA 5EYRA 4ZJZA 4E7LA 1PUEE 3JW4A 2LFBA 4ABZA 2R7XA 1BBYA 3JREA 4EGYA 2GBYA 1WQ2A 3EUKL 3GBGA 1FIAA 1FMWA 4XRFA 2XKPA 4G6QA 3LA3A 1JT6A 5K7FA 1K83J 3DLLF 1IGNA 2NVXJ 2OV7A 3K4NA 3I58A 4XLHA 1WZ2A 3F8FA 1ZH5A 3V42A 2AQFA 3ABTA 5E8GA 1I50J 4XBFA 3N05A 4AWXB 1WJEA 5HNHA 2VODA 1IXCA 3GWZA 4PZJA 3PIPF 4LITA 3QU3A 1PYVA 1DGRM 3DPTA 3LMMA 3GTPJ 4G7HF 1R9TJ 2L7FP 3RYPA 3WE2A 1VQ9I 1J75A 4IKFA 4X1EA 1LE8B 3SXYA 1Z7UA 5CVRA 3DLAA 3U1DA 1A36A 3MZ8A 1MNEA 3EUAA 4MTEA 1ZRDA 1C0WA 1IUFA 1P9QC 4O6JA 5L3BA 3BR6A 2RREA 3WU1B 4C2UA 2NS7A 3DWLE 4RLFA 3FBNB 1IV6A 1H8AC 2PQ8A 3HZJA 5D8LB 3OYCA 3ZPLA 2V26A 1U8BA 3G1OA 3V8JA 3K1NA 2JK3A 4A0XA 2H8WA 5B1BH 2HQAA 4AC0A 4KFCA 1HBXG 9ANTA 3I9V2 3HPGA 4BS9A 2M7BA 5DCFA 3GW2A 2WAFA 2CUZA 1S6LA 3HOTA 3C2HA 3G4SI 3U2RA 2VPRA 2FNAA 4HW0A 4HAMA 5BNGA 3BR1A 2HOSA 2I8DA 1ONVA 3G1LA 4ENKA 2H6BA 2FBHA 4UVBA 4II2A 5JLWA 2H09A 1EA3A 5FGMA 3BC8A 2LYCA 1JJ8C 1UCRA 2PEXA 2L9VA 2XIGA 4WK8F 5LRSA 1VQLI 1F4KA 1RPWA 5B3SH 5K5QA 1ZLJA 5DUIA 4GDFA 4HYEA 2EB7A 1PP7U 1XCVA 1OISA 1FY7A 1Y0NA 2LG4A 4HF0A 4LLGF 4B09A 1GVJA 2WV0A 1OYYA 4IZZA 2NVTJ 3GTKJ 1YRNA 3PM1A 2UXNA 1M1EB 2Q8KA 2N8GA 3EQLF 1MBGA 3F6VA 1YS6A 1A35A 4AIHA 3A02A 3HOSA 1K79A 3CESA 2XAJA 2FQ4A 3CCMI 3AG1H 1Y1VJ 4HX8A 1RNLA 1I27A 4HDUA 1YX5A 3H9GA 4BBRJ 2DU9A 1MH3A 2BY2A 5KVRA 4LLLA 4OMYA 2M0CA 5LRRA 1QHGA 4IHSA 5M5XJ 4PGHA 2ECCA 2FOKA 4ESBA 2X9DA 4HLXA 1QGPA 2LOOA 1SVLA 3BJOA 4RB2C 1LFPA 1U5TA 3A2KA 4X6AJ 5D6EA 4A3LJ 2BGCA 3H36A 2BW3B 1MDMA 3QWLA 2ZO4A 5FROA 5F08A 4EGZA 2QSHX 2J5PA 2JA7J 4II3A 3M8EA 3CCEI 2QENA 2M8EA 4QPQA 3S2HJ 3L00A 1R23A 3HUGA 3FK6A 2XROA 1W7PB 5DV5A 2DAOA 3PL8A 4MNUA 4BHPA 2CQ7A 5CLSA 5IT3A 4A3DJ 2PMHA 2DYRH 1T8IA 5EJCA 4Y7NJ 3LL7A 2XAGA 1HSJA 3ZR8X 4C3IJ 5LLQA 1QA6A 4KISA 3T8TA 2XPUA 4U7DA 5LGTA 2JWTA 3A0HC 4XNFA 1OPCA 5E3LA 3WHCA 5JHUA 2R3SA 1H9GA 3V7CA 3IC7A 2BY1A 2MD0A 1FBSA 5IP6A 1DQUA 5F0FA 5GPAA 1ULYA 3M4OJ 4BHCA 4EEFG 1FC3A 3DP7A 2COBA 1ZG3A 4HG2A 5JFRA 5JLXA 3KP4A 2F6CA 1D3YA 4ZH4F 3BDDA 3QU6A 4G6TB 2F4IA 1YJNI 4HQEA 1Z1DA 3OIOA 4HNTA 3E6CC 4S04A 5FLMJ 4BQAA 1P7JA 2HVSA 2JPBA 3R61A 4E7JA 2RQQA 1NTCA 1TT0A 5J8CA 5GP9A 1YW7A 2ISZA 2MA3A 3KLOA 5IPAA 5M3MJ 4KNYA 3DXJF 1Y39A 2ZMEC 2QVOA 3BP8A 4HBLA 3WTSC 2A6HF 1E0EA 4PUSA 3CMEI 3MQ0A 1TW2A 3NWSA 1E2XA 4AIDA 2EFPA 3W2WA 2VONA 4RAFA 2ZFUA 2Y0SN 2KMUA 2ME6A 1G3SA 2DDBA 3E5QA 2FF4A 2JUCA 2DJIA 1I6XA 2DOFA 3BTCA 2ESNA 4XOPA 2KRFA 1V55H 4KIBA 3REOA 2LH9A 1E3HA 5HDKA 4MGRA 1D8KA 1ON2A 1WHUA 4LGWA 3FX3A 1D1BA 1P2FA 2OU2A 3KP7A 3FF5A 5A2QZ 2VJ4A 2F5EA 3TQNA 2F2EA 3BOQA 4LMYA 2V1DA 1W0TA 4CXFA 4LG3A 3PNYA 3EUHA 2TCTA 3TGNA 1HW2A 2HWVA 5FLXZ 3ZCOA 2DJNA 2Y2ZA 1OYIA 4XK4A 3KLNA 4AM3A 1XG1A 3P9IA 1LPQA 3CUQC 3WGIA 4Y52J 1QHHD 3KPHA 4CCNA 1DDNA 1TQIA 4DBRA 5H2FC 2NS0A 3BROA 1V5EA 2OUMA 4ZYDA 4EJOA 4I01A 2XB5A 4CCJA 2E71A 2IGNA 5JI6A 5TISC 2ZB9A 4HA8A 1RIOH 1KGSA 5ILVA 4FCYA 1W36C 4HOBA 1H0MA 5TGTA 2ID3A 1FWZA 3H0GJ 1CF7B 3JRIA 2XPVA 1KU7A 2JVGA 2MYSA 3V8KA 3H1CA 4XN0A 3DQVC 5IOYA 3KEYA 3VPRA 1XGNA 3LSPA 1W0UA 2CH0A 4JX4A 3GZ5A 3CCLI 4AIKA 1HKQA 1TW3A 1OQYA 4BQOA 4XICA 4RMNA 4WXHA 4WWCA 2K40A 1AWCA 2XF6A 1V4RA 4LJZF 2BHZA 3ZQ7A 4U0YA 4KIGA 3ISPA 3IRQA 1IJWC 4EATA 3LAPA 1I39A 3KP2A 1Z3YA 4RAGA 1MMNA 1D0XA 4CH7A 4Y13A 2R7TA 1N78A 5E17F 3MVPA 2IXSA 3O3KA 4UXNA 5HNFA 4AYBA 1P92A 3U1KA 1ZTRA 5EEAA 3SZTA 3DF8A 2LY9A 1VQ7I 2QSGX 2Z5UA 4KMUX 2CWEA 4PJLA 4FX4A 2EA2A 4A3MJ 2CV0A 5M3FJ 3F9KA 4I6ZA 2IEKA 2NOGA 1O3QA 1ENHA 1TNSA 4WXDA 3AAFA 2E36A 2G7UA 2DN0A 3DEUA 4U88A 2YR2A 4XLNF 3SQNA 3HOXJ 2A68F 2GA2A 2A6EF 5FRMA 1GXQA 4OINF 1H88C 3ZMVA 1EKEA 4OIQF 5DM7F 2HI3A 4HPQA 5H20A 3K70C 2LDUA 1B6AA 5H6QA 3H35A 1WPKA 5D5XB 1R5HA 2QSFX 5B5EC 4BL0B 2X6OA 2X1DA 2WTEA 4Y4RA 2VUMJ 2DA2A 1BJZA 3ERMA 2VOPA 1ETWA 3KIOA 2VQGA 2B9SA 1OLTA 1XMAA 2OQGA 1ZN2A 2VJ5A 2ZJPF 2H6CA 3ZQGA 4KMFA 5IP9J 1KQ9A 3SEQA 2K4JA 2XKOA 2LRDA 4BYYA 2OJED 2KJCA 5CQGA 1UHMA 3JSOA 1YRNB 1ORKA 2LD5A 2DTZA 4NQWA 2YU3A 3S1MJ 2MABA 1G59A 3HRMA 2G7HA 3CJQB 3Q0UA 4M3BA 2GWRA 3B6AA 1BI3A 4BUPA 1OFCX 2OZUA 1DGWY 1OMIA 2Y48A 1IXSB 4KJZA 3R4KA 5GAEJ 1LNWA 1D5VA 3W2VA 1LFUP 3E6DA 3F3XA 5BMZA 2FQ3A 5LBQA 2F5FA 1MKMA 2FMYA 3HL2A 2V9PA 1FSHA 4PFOA 4OMZA 3MCZA 4C2MJ 3GTGJ 3PO2J 4MFDA 3CCVI 3NEUA 2CMPA 2MH2A 1W7PD 4JOMA 1BIBA 2LREA 1J59A 1XN7A 3JAMK 3OYDA 5ICGA 1ZQ3P 2CS3A 1YITI 2E1OA 3I56I 3S2DJ 1SD7A 5JVGF 1MDMB 2KRCA 3HRSA 1JJ6C 1I3QJ 3FK7A 2D5VA 2VASA 1D5YA 1T0FC 4NC8A 1RZ4A 4YIIA 4B1RA 4I0AA 4QIWN 1K78A 5CPRB 3E7LA 3KEOA 3W3CA 1U3EM 4I99C 4KYWA 3KP5A 1QNTA 1R49A 3WG9A 4BY7J 2F5DA 2GZWA 1RETA 2JMWA 2K85A 4J01A 5JR3A 2E35A 1X2NA 3BTIA 1D1CA 4DW6A 1ZR4A 1YG2A 3F8CA 3OS0A 4UNOA 2RNJA 2XGEA 4ETSA 1FBQA 2CW7A 3ERED 1UB9A 3HKZA 3VSLA 4N4OB 3RI4A 1VZ0A 2F5CA 3VSKA 4UVAA 3HEFA 4CDGA 4AIJA 2K9LA 2M7AA 3WTXC 4HV6A 3C7JA 1KONA 4XL9A 2QM3A 2PI0A 3HOVJ 4M6VA 4MTDA 2EWNA 4OIPF 1LDKB 1RUNA 4I2OA 2OC6A 2YPRA 1FTZA 1T38A 2MSYA 1IN6A 4GGGA 1Y8QB 3LA7A 2HZTA 1BI0A 1O3RA 3CO7C 3BR3A 2CW8A 3Q9SA 4G94A 1B4AA 1N77A 1JKQC 1OCOH 1SMTA 2VXDA 1R4NB 3WU0A 1JTXA 1BR2A 4KICA 2AQEA 2M34A 5HVQC 1VQ6I 1R5ID 1TBXA 3WTVC 3A01A 3M8JA 2W7NA 3TP0A 1OR7A 1UJ8A 3QP6A 3F6OA 1W5SA 3R60A 1NG7A 2M4GA 3BR2A 4D0PA 4ITVA 1K4SA 2Y0MA 1AKHB 3VYUB 2MH9A 5L3DA 2M1BA 3LFKA 2PJPA 1YO5C 4DBQA 3RQ4A 1EH7A 4A3KJ 2XRNA 3I59A 4E6KG 4H4KC 4CHUA 1S7OA 1TWGJ 1I5ZA 1X3ZB 3PNTA 3LSJA 1FJLA 2LTPA 2P6TA 5HLGA 1R71A 2GOXB 3K7AJ 1G2HA 2W85A 3BG7A 5B1AH 2P7CB 2HXIA 3FHNA 2HDDA 5IT9K 3K6GA 3CDIA 3RPUA 2W1OA 2EINH 3BY6A 4N0BA 5DM6F 3H9JA 1QBJA 3HB9A 4N4NB 1YHQI 5EG0A 1IZ1A 3GUDA 4I98B 4BH9A 2EV5A 4WXCA 1JXSA 4PK4A 3SEZA 2JSPA 2PN6A 2IGKA 2BVMA 3T5XA 4BQQA 3SHFA 3AFHA 1N25A 1I6HJ 1XCBA 2YUSA 4ANJA 2DQRA 2XF5A 4E7SA 1QZYA 2L02A 2O8KA 3E97A 4H0EA 2HYFA 5F64A 4D1QA 2BVLA 2NNYA 4IHTA 1LEBA 2HTSA 1R6RA 2IW5A 3TDZC 2VXZA 4DYQA 2CQQA 4NC7A 3B6CA 1ITYA 3BJAA 1GDTA 1O7FA 3TDUC 2KIFA 2VKVA 1HC8A 1SFUA 3CCYA 3DPLC 1CGPA 1HSTA 2JA8J 4G7OF 1LQ1A 2DXIA 2L2OA 4LOCA 2QYOA 3BCAA 1X19A 3F8MA 2LVSA 2RGVA 4LB6B 2D1VA 4FISA 2WAQN 1WKMA 1HF0A 3TMOA 2IGOA 2JZYA 5LGNA 1QU3A 4PJMA 3ZGKA 4P55A 5E79C 1ZREA 1I1SA 1IF1A 4MQVA 3SZGA 1FT9A 3KP6A 2DFIA 3AG2H 2FJ1A 1S9HA 4XLCA 1HLVA 5CYVA 2HQRA 4HDVA 2IS6A 4RB1A 4EVIA 4CCLA 2IBDA 1Z77A 4F93B 4IRGA 4XLPF 1FSEA 4RGUA 2D2WA 1OCCH 4ZYHA 2W48A 2COMA 1EH8A 2ZNZA 3OY9A 2O6GE 5C3EJ 2A6TA 4HNVA 2L7ZA 3RJPA 1X1PA 5EGOB 5BOXA 1TL8A 3OL4A 5FRNA 3CUQA 3DU6A 4MO7A 2BZTA 1K7AA 2FMLA 4XN3A 2L7KA 2W4SA 1Z67A 3A03A 3F8BA 3FXLA 2PMUA 4HSRA 1XDSA 4CYDA 4EJWA 4A3GJ 2K9MA 2A07F 3GTQJ 1WH5A 2XDVA 3FWEA 2V1NA 2W24A 2FOWA 1FYKA 2VBYA 2ZXIA 3I55I 4IHXA 1UHSA 4QTRA 2ESHA 3I4MJ 3OYEA 1MMAA 3L09A 4G7ZF 4IL6C 1B59A 1TT5B 2DCEA 4M3EA 4X0GA 4XSZF 3SZPA 3K9TA 4DJAA 1U2WA 4OU0A 3VOEA 2WBMA 3C2BA 3NWTA 4XONA 4WCGA 2C6YA 4CCKA 4NQWB 4ZZLA 1OCRH 1XTAA 3VWBA 3R0JA 3E6MA 1QPMA 1QZZA 3I0TA 2OZ6A 2WC2A 2M2EA 3WE3A 3H5NA 2ZSIB 4E7IA 1ZK8A 2QBYA 1P6RA 4PSXA 1RR7A 3L2VA 4V2GA 4UY8I 5F1RA 3ZN0A 5J4VA 1LUJB 2KDOA 3FM3A 1ZHFA 2PMZN 3O2PE 4U0WA 2V4JC 3GFIA 1ZRFA 3TW6A 2ACJA 3DEEA 1Q1HA 2UZKA 1GV5A 1STZA 4KITB 2KL4A 5CVJA 5K5RA 3DU5A 2HFHA 3CLQA 1K78B 5AIPA 5JHFA 2HVQA 5HLHA 3GYHX 1ZAOA 3LSHA 3OOPA 1SFKA 4Z6YA 2IRFG 4L5IA 3KEQA 5KHDA 2PX9A 1WJAA 4PFPA 5D4SA 4AUXA 3WG7H 1B8IA 2FSWA 2BE5F 1RR8C 3HSFA 3O8HA 1IDYA 1ZR2A 1IC8A 2V6EA 4GYGA 3OOUA 2A5YB 3RKQA 2A69F 2LKPA 2FBKA 1Z91A 2KHMA 2FU4A 1NH3A 1X3UA 2JSCA 1H9TA 4OOIA 1YW8A 3CDLA 3HSRA 5DD4A 5IYCJ 1D8JA 4XKBA 1U9OA 3X2QH
chains in the Genus database with same CATH topology
2PBIA 5DYMA 3GEZA 4ESJA 2O8XA 3G3ZA 4P96A 1U78A 2HGCA 1FBUA 1Z6RA 4LLNA 1U6GA 4EJTA 2CYYA 1AOYA 1S29A 2STTA 2EV0A 5FFXA 3GO5A 3JAMZ 1KYZA 3E3VA 3KETA 2VC1A 1XDUA 2ZFWA 3I59B 4E70A 2GIVA 1T0FA 4YFXF 4B8XA 2LF8A 2QLZA 3M1EA 3WTUC 3GX4X 2VBXA 4CGZA 3V7SA 4KIFA 4RGRA 2EJRA 1PP8F 2D1HA 4LG0A 1E17A 5ILUA 4K2EA 1ZG5A 2VC0A 3FM5A 3J7AO 4I0BA 4RGXA 3TO7A 3EYIA 1KU9A 3RDIA 2IP2A 3M9AA 1K6OA 1BOAA 5L3EA 1EV7A 4NB5A 5CVUA 3HHHA 1SFXA 3V4GA 3COAC 1ZGAA 2OBPA 1B1BA 3CUOA 4MEXF 2P5LC 2RKHA 3I64A 4M9XA 3E5XA 1SAXA 4BXUA 4Q4ZF 1RUOA 3NRVA 4KDPA 2ZJ2A 5IT9Z 1YLFA 2QQ9A 4EM0B 1Z9CA 3GFMA 1R36A 2EK5A 2GXGA 5L3CA 2K86A 4LD5A 3P7NA 4UV8A 5L3FA 2NYXA 2VOOA 1GXPA 3CUQB 3ZMSA 1BJAA 2XHKA 2IT0A 3P9KA 5E8IA 2DLLA 1IN8A 4YG2F 4UHTA 3QPHA 2ADUA 3HRUA 1O57A 3PQKA 3DKWA 1TLHB 5J6XA 3I4PA 1MD0A 2Y75A 2V6CA 3CTAA 1OKRA 2XV4S 4LFUA 5K1YA 1NHAA 3E6BA 2LNBA 2GA1A 2MLGA 2L4AA 1IW7F 1YW9A 4M6YA 4EMSA 2H94A 4ON0A 4PDKA 1XSVA 2QQBA 3TKYA 1SFEA 1R58A 3RPQA 5D4RA 2QBYB 2OA4A 2PFBA 4AD9A 1SD6A 5D6FA 3FMSA 3ZMTA 4GYIA 2UWMA 2P5KA 2CO5A 1O3TA 3IRRA 2DW4A 4M73A 4BHBA 2TDXA 1ON1A 1MJBA 2Q2EA 4QWQA 4MQ9F 1TQMA 3KZYA 1UHWA 2HOEA 3RKXA 3BPXA 1G4DA 1R22A 3GVAA 2QUFA 5FB2A 1ZG1A 3V7RA 4A2UA 3ECOA 3IHUA 4R1HA 1FNNA 2D45A 4R8HA 4M6XA 4A5NA 3JSPA 3KFWX 1HXDA 3GLXA 4IVNA 1G3YA 2E7XA 1KU2A 4PGGA 1T39A 3FXRA 2NRAC 5TRDA 5AONA 3K1MA 1TTYA 2E7WA 3BJ6A 5E1XA 2XAFA 1RI7A 3D5LA 4XSXF 1KQ8A 1U5TC 2ZBKA 1BIAA 2ISYA 1BM9A 3VODA 4KN7X 4U0VA 4HX4A 3KZZA 3ELKA 3MWMA 1YIOA 3IKVA 4I09A 4HX7A 2MC3A 2MBFA 3T0YA 2DK5A 4RGSA 3Q5FA 4LG0B 2R7FA 4A6EA 1HKTA 3DV8A 4L0YB 3MAJA 1R1TA 2PLYA 1BN5A 2XAQA 4R79A 1WI9A 2EV6A 1BI2A 2QQAA 5FO5A 3GFLA 4EM2A 3EETA 1F5TA 1J0RA 2B0LA 2KIMA 5ED4A 4A0ZA 1YS7A 3BWGA 1DPRA 4Q5SF 2RDPA 4HQMA 2KJBA 4G9YA 2HKOA 5BS6A 3F22A 1GHCA 4OIOF 2FA5A 2DBBA 1KQ0A 3LAJA 3TOAA 1L0OC 1P4AA 3B73A 3BPVA 1MJ9A 2GXBA 1IN5A 2X4HA 4RB0A 3U9GA 2STWA 5KK1A 1FP1D 1FP2A 1S7AA 1BI1A 1IUYA 1G6NA 2QZ8A 1ZLKA 4CICA 1W4MA 5FLXK 3JTHA 3V8LA 4HV5A 4EM1A 2W84A 2YX7A 4Z2YA 1S8NA 1R1UA 2BBYA 4BNCA 5HS7A 3Q9VA 5DCMB 1R00A 4CZZA 4CO8A 2X0LA 3ROUA 4EQQA 4M71A 2OD5A 2ZMEA 3KE2A 1DUXC 2ZCWA 4I7HA 1XMKA 2ZKZA 2JTVA 3FXQA 4MHGA 4Q47A 2L3DA 3WODF 1IXRC 2FEZA 4ASNA 4HLYA 3CO6C 5LGUA 1T2KA 3W6JB 5HDGA 5BQTA 1Z05A 1R7JA 1USSA 3RTRA 1J9IA 2L01A 1REPC 3NQOA 4I02A 5BPIA 4M72A 4M74A 3H92A 2FBIA 2K02A 5D5WB 3C3WA 4S05A 3ABUA 4IRHA 2G9WA 2V9VA 3J80K 4L5JA 4UUVA 3LA2A 4A5MA 5HOOA 2ZXJA 4G8XA 2L4MA 2ETHA 3IWFA 1F9NA 1ZGJA 1KU3A 3FMRA 3ZN1A 5EEHA 1TQPA 2JPCA 4IRIA 2YSRA 1FPQA 3WTZA 3KP3A 1FYMA 3HRTA 3K69A 1WRJA 2FXAA 1KYWA 4UVCA 2O0YA 3LSTA 4FX0A 1EH6A 2QWWA 3WTYC 4WX9A 5CJ9A 4ZYGA 2M5WA 2H27A 1XGMA 3P9CA 4Y15A 1BC7C 4ENMA 1BC8C 5ILSA 4NHJA 3FZVA 3R0AA 2VE8A 3QAHA 4EJUA 3FHZA 4AVPA 1T6SA 2DI3A 2CSOA 2YX4A 2A61A 2K7LA 2DPUA 2RQPA 2V1XA 1LDJA 3ECHA 1JHFA 3QOPA 2CFXA 1HQCA 1ODDA 2P4WA 2DO7A 1ZRCA 5F6FA 5FD6A 1LDDA 3E5UA 5E1ZB 1R5GA 5L3GA 4L9TA 1XSDA 3J81K 2IPQX 1SD4A 3W6KB 4GXOA 2EFWA 5ICCA 4IXAA 3HYIA 1MZBA 2Z99A 2CG4A 3LQQA 3MFKA 3HSEA 1IRFA 3HTSB 5TJJA 2DK8A 3GF2A 4P5OA 1J5YA 2NAZA 4JQFA 1G3WA 2VN2A 2IJLA 5LHIA 5BPDA 2FRHA 3JTGA 5FFZA 2OAZA 2BYVE 5LEKA 1YQAA 5FD5A 1YYVA 3F72A 4IJAA 2E1CA 4RB3C 3HTUA 2DQLA 1PDNC 2OQRA 3ULQB 1ZARA 3K0LA 3QRFF 3ML6A 3VB2A 2RC4A 3VFZA 4LB5A 2HR3A 2CQKA 4RAZA 2ZMEB 4HZFA 1P4WA 2HDCA 2W25A 1HW5A 3FMQA 5ICFA 3EYYA 3LQRA 3S2WA 3LWFA 1JGSA 1O3SA 5DUKA 1F1ZA 4IPAA 1IN7A 4FHTA 3HIFA 5DEQA 2BV6A 4KA4A 1G3TA 4EJVA 3TOBA 3KCCA 1USTA 1HW1A 2RVCA 1LEAA 2EA4A 3O6BB 4KN4X 3PFIA 3RKWA 5HS8A 4DQ2A 5ERIA 5DCMA 4UV9A 1V3FA 4L9NA 4KT5C 1W5TA 2HYGD 3TO6A 1WSUA 3I53A 3M7GA 2A3SA 4BAYA 2HKXA 4A6DA 2VBZA 1A04A 3H3UA 2K4BA 3ZP5A 2M30A 4JBAA 2UXXA 3VEPA 5EEGA 3QP5A 2EFOA 4JK1X 2ZNYA 4L9VA 2XUBA 2O61A 4ENJA 3T1BA 2HS5A 2E1NA 1OYWA 2RV8A 2BEOA 1LB2A 2XAHA 5DDGA 1SMYF 2L54A 3BZ6A 3I71A 1J2XA 3N97A 2VT3A 5E20A 4ZYEA 3RKYA 5J8FA 1KA8A 3IL2A 2VBWA 4IF4A 1B9NA 4GO1A 4RAYA 1SD5A 2VE9A 4L0ZB 3HHGA 2XASA 3RYRA 3EDPA 3R6SA 2Z3YA 4N9IA 2O03A 2MLKA 3J80Z 3QPTA 2R7DA 2PG4A 2P7VB 4KUMA 5LHHA 2JRTA 4P9FA 4PCQA 4MEYF 3M8FA 2P8TA 4ESFA 3CLOA 3F8NA 3ZMZA 1MJAA 3ZMUA 2DTRA 3F21A 3OV8A 2Z9OA 5CVIA 1J7KA 1DPUA 5H6RA 4QLCU 1JE8A 3GFJA 3DFGA 2WWYA 2P5VA 3ZMDA 2P6SA 1FZPB 2FE3A 3C1DA 5HDNA 1U5TB 1IN4A 3CDHA 3F23A 4M9ZA 2J5OA 2NNNA 4OIRF 2FNPA 1DP7P 1YFHA 1QQIA 3IWZA 2EFQA 4YIFA 3B02A 4Q48A 6PAXA 2IVMA 3H3ZA 2GAUA 4TV7A 1L3LA 1UFMA 1FX7A 2IA1A 4WF2A 2IA0A 5CVVA 4Y17A 4ENNA 1XSXA 5D8KB 4L18B 2GQQA 4YFNF 1TNTA 3J81Z 1U8RA 3GXOA 1O7LA 3L9FA 3RIRA 4A12A 1XGOA 2CGPA 5HLIA 4A0YA 3WTTC 4HF2A 1Y0UA 2DPDA 2CW0F 4LK0F 3I5UA 5HS9A 2KIUA 1P4XA 3SFZA 2K27A 2M45A 4LK1F 2O3FA 3L2CA 3TO9A 2IA2A 1LVAA 1JHHA 5K5OA 1W7PA 3WGGA 3MEXA 5A2QK 4P9UA 4N9HA 3IKTA 3K2ZA 3CJNA 3MZHA 4ZZDA 2JT1A 4F7ZA 3PQJA 5DD8A 2HEOA 2XGXA 2LSOA 2V79A 3K1PA 4RS8A 5ICEA 3GZ6A 2VT2A 3T8RA 1HKSA 1XB4A 2RN7A 1B9MA 2EFNA 4YFKF 2AS5F 5LEJA 1Z6TA 4G6DA 1QO0D 5E18F 3I54A 3WTWC 2W57A 2MD5A 2DT5A 1YTYA 2Q0OA 1WWXA 1S3JA 4M9SA 4L9JA 5LHGA 4EV0A 5D5UB 1MGTA 1I1GA 2ELHA 3D0SA 2M87A 4O5VA 1FOKA 1VTNC 2LF7A 1T98A 3N4MA 4FT8A 4U7BA 3L7WA 2KKOA 2XVCA 2Z33A 2AXLA 5AIQA 2HQNA 5D5VB 3G73A 1FLIA 2V1UA 1R1VA 4O3MA 4DNCA 1IAWA 2HTJA 1ZYRF 4HF1A 3WGHA 5E1WA 3FXUA 3C18A 3MZYA 1IRGA 1LJ9A 1XD7A 1XGSA 4GCVA 1FYLA 1CF7A 5JVTA 1PUEE 3JW4A 1BBYA 4EGYA 1WQ2A 4XRFA 2XKPA 4G6QA 3LA3A 3I58A 3F8FA 1ZH5A 3ABTA 5E8GA 4XBFA 4AWXB 2VODA 1IXCA 3GWZA 4PZJA 3QU3A 3DPTA 4G7HF 3RYPA 3WE2A 1J75A 3SXYA 1Z7UA 5CVRA 3U1DA 4MTEA 1ZRDA 1C0WA 4O6JA 5L3BA 3WU1B 2PQ8A 5D8LB 3ZPLA 3V8JA 3K1NA 4A0XA 4KFCA 1HBXG 5DCFA 3GW2A 1S6LA 3HOTA 3U2RA 2FNAA 4HW0A 4HAMA 4ENKA 1ONVA 2H6BA 2FBHA 4UVBA 2H09A 5FGMA 1UCRA 2PEXA 2XIGA 4WK8F 5LRSA 1F4KA 5K5QA 1ZLJA 5DUIA 4HYEA 2EB7A 1PP7U 1XCVA 1FY7A 4LLGF 4HF0A 4B09A 1GVJA 2WV0A 1OYYA 2UXNA 2Q8KA 3EQLF 3F6VA 1YS6A 4AIHA 3HOSA 1K79A 2XAJA 4HX8A 1I27A 1RNLA 4HDUA 2DU9A 5KVRA 4OMYA 4LLLA 5LRRA 4IHSA 4PGHA 2FOKA 4ESBA 4HLXA 1QGPA 3BJOA 4RB2C 1U5TA 5D6EA 2BGCA 1MDMA 2ZO4A 4EGZA 2J5PA 3M8EA 2QENA 2M8EA 3L00A 1R23A 3HUGA 2XROA 1W7PB 5DV5A 2DAOA 4MNUA 4BHPA 5CLSA 5IT3A 2PMHA 2XAGA 1HSJA 5LLQA 3T8TA 4U7DA 5LGTA 1OPCA 5JHUA 2R3SA 1H9GA 3V7CA 3IC7A 1FBSA 1ULYA 4BHCA 1FC3A 3DP7A 1ZG3A 5JFRA 3KP4A 1D3YA 4ZH4F 3BDDA 3QU6A 4HQEA 1Z1DA 3E6CC 4S04A 4BQAA 2JPBA 3R61A 5J8CA 1YW7A 2ISZA 2MA3A 3KLOA 4KNYA 3DXJF 2QVOA 3BP8A 4HBLA 3WTSC 2A6HF 3MQ0A 1TW2A 1E2XA 2EFPA 2VONA 1G3SA 3E5QA 2FF4A 1I6XA 2ESNA 2KRFA 4KIBA 3REOA 5HDKA 4MGRA 1D8KA 1ON2A 4LGWA 3FX3A 1P2FA 2OU2A 3KP7A 3FF5A 5A2QZ 2F5EA 3TQNA 2F2EA 3BOQA 4LMYA 2V1DA 4CXFA 3EUHA 3TGNA 1HW2A 2HWVA 5FLXZ 1OYIA 3KLNA 3P9IA 3CUQC 3WGIA 1DDNA 1TQIA 2NS0A 3BROA 4ZYDA 4EJOA 4I01A 5JI6A 4HA8A 1RIOH 1KGSA 5ILVA 4HOBA 1H0MA 1FWZA 1CF7B 1KU7A 3V8KA 3DQVC 1XGNA 3GZ5A 4AIKA 1HKQA 1TW3A 4WXHA 4WWCA 1AWCA 4LJZF 1V4RA 3ZQ7A 4U0YA 3IRQA 4KIGA 3ISPA 3LAPA 3KP2A 4Y13A 3O3KA 4UXNA 1P92A 3SZTA 3DF8A 2Z5UA 4KMUX 2CWEA 4FX4A 2EA2A 1O3QA 1TNSA 4WXDA 3AAFA 2G7UA 3DEUA 4U88A 2YR2A 4XLNF 3SQNA 2A68F 2GA2A 2A6EF 1GXQA 4OINF 3ZMVA 4OIQF 5H20A 2LDUA 1B6AA 5H6QA 5D5XB 1R5HA 2WTEA 2VOPA 1XMAA 2OQGA 1ZN2A 4KMFA 2H6CA 1KQ9A 2K4JA 2XKOA 4BYYA 2KJCA 1UHMA 3JSOA 4NQWA 2YU3A 3HRMA 2G7HA 2GWRA 1BI3A 2OZUA 1OMIA 2Y48A 1IXSB 3R4KA 1D5VA 1LNWA 3E6DA 3F3XA 5BMZA 2FQ3A 5LBQA 2F5FA 1MKMA 2FMYA 1FSHA 4OMZA 3MCZA 3NEUA 2MH2A 1W7PD 1BIBA 1J59A 1XN7A 3JAMK 5ICGA 1SD7A 1MDMB 3HRSA 1RZ4A 4YIIA 4I0AA 1K78A 3KEOA 1U3EM 4KYWA 3KP5A 1QNTA 3WG9A 2F5DA 2GZWA 5JR3A 1YG2A 3F8CA 4UNOA 2RNJA 4ETSA 1FBQA 3ERED 1UB9A 3RI4A 2F5CA 4CDGA 4UVAA 4AIJA 3WTXC 4HV6A 3C7JA 2PI0A 2QM3A 4MTDA 2EWNA 4OIPF 1LDKB 1RUNA 4I2OA 2YPRA 1T38A 1IN6A 4GGGA 3LA7A 2HZTA 1BI0A 1O3RA 3CO7C 3Q9SA 4G94A 1B4AA 1SMTA 3WU0A 4KICA 5HVQC 1TBXA 3WTVC 1OR7A 3QP6A 3F6OA 1W5SA 3R60A 4D0PA 2Y0MA 2MH9A 5L3DA 2M1BA 3LFKA 2PJPA 1YO5C 1EH7A 2XRNA 3I59A 4CHUA 1S7OA 1I5ZA 2P6TA 5HLGA 2W85A 2P7CB 5IT9K 3RPUA 3BY6A 4N0BA 1QBJA 1IZ1A 3GUDA 4I98B 4BH9A 2EV5A 4WXCA 1JXSA 2PN6A 3T5XA 3SHFA 1XCBA 2DQRA 1QZYA 2L02A 3E97A 4H0EA 2HYFA 5F64A 2NNYA 4IHTA 1LEBA 2HTSA 2IW5A 3TDZC 2VXZA 3BJAA 1O7FA 3TDUC 2KIFA 1SFUA 3DPLC 1CGPA 1HSTA 4G7OF 1LQ1A 2QYOA 3F8MA 2RGVA 4LB6B 2D1VA 1WKMA 5LGNA 2JZYA 4P55A 1ZREA 1I1SA 1IF1A 4MQVA 1FT9A 3KP6A 2DFIA 5CYVA 2HQRA 4HDVA 4RB1A 4EVIA 4IRGA 4XLPF 1FSEA 4RGUA 2D2WA 4ZYHA 2COMA 1EH8A 2ZNZA 2O6GE 3RJPA 5BOXA 3CUQA 1K7AA 2FMLA 3F8BA 2PMUA 4CYDA 1XDSA 4EJWA 2A07F 3FWEA 2W24A 1FYKA 2VBYA 2ESHA 3L09A 4G7ZF 1B59A 4XSZF 3SZPA 3K9TA 1U2WA 4OU0A 3VOEA 4WCGA 2C6YA 4ZZLA 3R0JA 3E6MA 1QPMA 1QZZA 3I0TA 2OZ6A 2WC2A 3WE3A 2QBYA 1P6RA 5F1RA 3ZN0A 3FM3A 1ZHFA 3O2PE 4U0WA 3GFIA 1ZRFA 2ACJA 1Q1HA 2UZKA 1STZA 5CVJA 5K5RA 2HFHA 1K78B 5AIPA 5HLHA 3GYHX 1ZAOA 3OOPA 2IRFG 4L5IA 3KEQA 5D4SA 2FSWA 2BE5F 3HSFA 4GYGA 2A5YB 2A69F 2LKPA 2FBKA 1Z91A 2FU4A 1X3UA 2JSCA 1H9TA 4OOIA 1YW8A 3HSRA 5DD4A 1D8JA 5E17F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PBI A;  5DYM A;  3GEZ A;  4ESJ A;  2O8X A;  3G3Z A;  4P96 A;  1U78 A;  2HGC A;  1FBU A;  1Z6R A;  4LLN A;  1U6G A;  4EJT A;  2CYY A;  1AOY A;  1S29 A;  2STT A;  2EV0 A;  5FFX A;  3GO5 A;  3JAM Z;  1KYZ A;  3E3V A;  3KET A;  2VC1 A;  1XDU A;  2ZFW A;  3I59 B;  4E70 A;  2GIV A;  1T0F A;  4YFX F;  4B8X A;  2LF8 A;  2QLZ A;  3M1E A;  3WTU C;  3GX4 X;  2VBX A;  4CGZ A;  3V7S A;  4KIF A;  4RGR A;  2EJR A;  1PP8 F;  2D1H A;  4LG0 A;  1E17 A;  5ILU A;  4K2E A;  1ZG5 A;  2VC0 A;  3FM5 A;  3J7A O;  4I0B A;  4RGX A;  3TO7 A;  3EYI A;  1KU9 A;  3RDI A;  2IP2 A;  3M9A A;  1K6O A;  1BOA A;  5L3E A;  1EV7 A;  4NB5 A;  5CVU A;  3HHH A;  1SFX A;  3V4G A;  3COA C;  1ZGA A;  2OBP A;  1B1B A;  3CUO A;  4MEX F;  2P5L C;  2RKH A;  3I64 A;  4M9X A;  3E5X A;  1SAX A;  4BXU A;  4Q4Z F;  1RUO A;  3NRV A;  4KDP A;  2ZJ2 A;  5IT9 Z;  1YLF A;  2QQ9 A;  4EM0 B;  1Z9C A;  3GFM A;  1R36 A;  2EK5 A;  2GXG A;  5L3C A;  2K86 A;  4LD5 A;  3P7N A;  4UV8 A;  5L3F A;  2NYX A;  2VOO A;  1GXP A;  3CUQ B;  3ZMS A;  1BJA A;  2XHK A;  2IT0 A;  3P9K A;  5E8I A;  2DLL A;  1IN8 A;  4YG2 F;  4UHT A;  3QPH A;  2ADU A;  3HRU A;  1O57 A;  3PQK A;  3DKW A;  1TLH B;  5J6X A;  3I4P A;  1MD0 A;  2Y75 A;  2V6C A;  3CTA A;  1OKR A;  2XV4 S;  4LFU A;  5K1Y A;  1NHA A;  3E6B A;  2LNB A;  2GA1 A;  2MLG A;  2L4A A;  1IW7 F;  1YW9 A;  4M6Y A;  4EMS A;  2H94 A;  4ON0 A;  4PDK A;  1XSV A;  2QQB A;  3TKY A;  1SFE A;  1R58 A;  3RPQ A;  5D4R A;  2QBY B;  2OA4 A;  2PFB A;  4AD9 A;  1SD6 A;  5D6F A;  3FMS A;  3ZMT A;  4GYI A;  2UWM A;  2P5K A;  2CO5 A;  1O3T A;  3IRR A;  2DW4 A;  4M73 A;  4BHB A;  2TDX A;  1ON1 A;  1MJB A;  2Q2E A;  4QWQ A;  4MQ9 F;  1TQM A;  3KZY A;  1UHW A;  2HOE A;  3RKX A;  3BPX A;  1G4D A;  1R22 A;  3GVA A;  2QUF A;  5FB2 A;  1ZG1 A;  3V7R A;  4A2U A;  3ECO A;  3IHU A;  4R1H A;  1FNN A;  2D45 A;  4R8H A;  4M6X A;  4A5N A;  3JSP A;  3KFW X;  1HXD A;  3GLX A;  4IVN A;  1G3Y A;  2E7X A;  1KU2 A;  4PGG A;  1T39 A;  3FXR A;  2NRA C;  5TRD A;  5AON A;  3K1M A;  1TTY A;  2E7W A;  3BJ6 A;  5E1X A;  2XAF A;  1RI7 A;  3D5L A;  4XSX F;  1KQ8 A;  1U5T C;  2ZBK A;  1BIA A;  2ISY A;  1BM9 A;  3VOD A;  4KN7 X;  4U0V A;  4HX4 A;  3KZZ A;  3ELK A;  3MWM A;  1YIO A;  3IKV A;  4I09 A;  4HX7 A;  2MC3 A;  2MBF A;  3T0Y A;  2DK5 A;  4RGS A;  3Q5F A;  4LG0 B;  2R7F A;  4A6E A;  1HKT A;  3DV8 A;  4L0Y B;  3MAJ A;  1R1T A;  2PLY A;  1BN5 A;  2XAQ A;  4R79 A;  1WI9 A;  2EV6 A;  1BI2 A;  2QQA A;  5FO5 A;  3GFL A;  4EM2 A;  3EET A;  1F5T A;  1J0R A;  2B0L A;  2KIM A;  5ED4 A;  4A0Z A;  1YS7 A;  3BWG A;  1DPR A;  4Q5S F;  2RDP A;  4HQM A;  2KJB A;  4G9Y A;  2HKO A;  5BS6 A;  3F22 A;  1GHC A;  4OIO F;  2FA5 A;  2DBB A;  1KQ0 A;  3LAJ A;  3TOA A;  1L0O C;  1P4A A;  3B73 A;  3BPV A;  1MJ9 A;  2GXB A;  1IN5 A;  2X4H A;  4RB0 A;  3U9G A;  2STW A;  5KK1 A;  1FP1 D;  1FP2 A;  1S7A A;  1BI1 A;  1IUY A;  1G6N A;  2QZ8 A;  1ZLK A;  4CIC A;  1W4M A;  5FLX K;  3JTH A;  3V8L A;  4HV5 A;  4EM1 A;  2W84 A;  2YX7 A;  4Z2Y A;  1S8N A;  1R1U A;  2BBY A;  4BNC A;  5HS7 A;  3Q9V A;  5DCM B;  1R00 A;  4CZZ A;  4CO8 A;  2X0L A;  3ROU A;  4EQQ A;  4M71 A;  2OD5 A;  2ZME A;  3KE2 A;  1DUX C;  2ZCW A;  4I7H A;  1XMK A;  2ZKZ A;  2JTV A;  3FXQ A;  4MHG A;  4Q47 A;  2L3D A;  3WOD F;  1IXR C;  2FEZ A;  4ASN A;  4HLY A;  3CO6 C;  5LGU A;  1T2K A;  3W6J B;  5HDG A;  5BQT A;  1Z05 A;  1R7J A;  1USS A;  3RTR A;  1J9I A;  2L01 A;  1REP C;  3NQO A;  4I02 A;  5BPI A;  4M72 A;  4M74 A;  3H92 A;  2FBI A;  2K02 A;  5D5W B;  3C3W A;  4S05 A;  3ABU A;  4IRH A;  2G9W A;  2V9V A;  3J80 K;  4L5J A;  4UUV A;  3LA2 A;  4A5M A;  5HOO A;  2ZXJ A;  4G8X A;  2L4M A;  2ETH A;  3IWF A;  1F9N A;  1ZGJ A;  1KU3 A;  3FMR A;  3ZN1 A;  5EEH A;  1TQP A;  2JPC A;  4IRI A;  2YSR A;  1FPQ A;  3WTZ A;  3KP3 A;  1FYM A;  3HRT A;  3K69 A;  1WRJ A;  2FXA A;  1KYW A;  4UVC A;  2O0Y A;  3LST A;  4FX0 A;  1EH6 A;  2QWW A;  3WTY C;  4WX9 A;  5CJ9 A;  4ZYG A;  2M5W A;  2H27 A;  1XGM A;  3P9C A;  4Y15 A;  1BC7 C;  4ENM A;  1BC8 C;  5ILS A;  4NHJ A;  3FZV A;  3R0A A;  2VE8 A;  3QAH A;  4EJU A;  3FHZ A;  4AVP A;  1T6S A;  2DI3 A;  2CSO A;  2YX4 A;  2A61 A;  2K7L A;  2DPU A;  2RQP A;  2V1X A;  1LDJ A;  3ECH A;  1JHF A;  3QOP A;  2CFX A;  1HQC A;  1ODD A;  2P4W A;  2DO7 A;  1ZRC A;  5F6F A;  5FD6 A;  1LDD A;  3E5U A;  5E1Z B;  1R5G A;  5L3G A;  4L9T A;  1XSD A;  3J81 K;  2IPQ X;  1SD4 A;  3W6K B;  4GXO A;  2EFW A;  5ICC A;  4IXA A;  3HYI A;  1MZB A;  2Z99 A;  2CG4 A;  3LQQ A;  3MFK A;  3HSE A;  1IRF A;  3HTS B;  5TJJ A;  2DK8 A;  3GF2 A;  4P5O A;  1J5Y A;  2NAZ A;  4JQF A;  1G3W A;  2VN2 A;  2IJL A;  5LHI A;  5BPD A;  2FRH A;  3JTG A;  5FFZ A;  2OAZ A;  2BYV E;  5LEK A;  1YQA A;  5FD5 A;  1YYV A;  3F72 A;  4IJA A;  2E1C A;  4RB3 C;  3HTU A;  2DQL A;  1PDN C;  2OQR A;  3ULQ B;  1ZAR A;  3K0L A;  3QRF F;  3ML6 A;  3VB2 A;  2RC4 A;  3VFZ A;  4LB5 A;  2HR3 A;  2CQK A;  4RAZ A;  2ZME B;  4HZF A;  1P4W A;  2HDC A;  2W25 A;  1HW5 A;  3FMQ A;  5ICF A;  3EYY A;  3LQR A;  3S2W A;  3LWF A;  1JGS A;  1O3S A;  5DUK A;  1F1Z A;  4IPA A;  1IN7 A;  4FHT A;  3HIF A;  5DEQ A;  2BV6 A;  4KA4 A;  1G3T A;  4EJV A;  3TOB A;  3KCC A;  1UST A;  1HW1 A;  2RVC A;  1LEA A;  2EA4 A;  3O6B B;  4KN4 X;  3PFI A;  3RKW A;  5HS8 A;  4DQ2 A;  5ERI A;  5DCM A;  4UV9 A;  1V3F A;  4L9N A;  4KT5 C;  1W5T A;  2HYG D;  3TO6 A;  1WSU A;  3I53 A;  3M7G A;  2A3S A;  4BAY A;  2HKX A;  4A6D A;  2VBZ A;  1A04 A;  3H3U A;  2K4B A;  3ZP5 A;  2M30 A;  4JBA A;  2UXX A;  3VEP A;  5EEG A;  3QP5 A;  2EFO A;  4JK1 X;  2ZNY A;  4L9V A;  2XUB A;  2O61 A;  4ENJ A;  3T1B A;  2HS5 A;  2E1N A;  1OYW A;  2RV8 A;  2BEO A;  1LB2 A;  2XAH A;  5DDG A;  1SMY F;  2L54 A;  3BZ6 A;  3I71 A;  1J2X A;  3N97 A;  2VT3 A;  5E20 A;  4ZYE A;  3RKY A;  5J8F A;  1KA8 A;  3IL2 A;  2VBW A;  4IF4 A;  1B9N A;  4GO1 A;  4RAY A;  1SD5 A;  2VE9 A;  4L0Z B;  3HHG A;  2XAS A;  3RYR A;  3EDP A;  3R6S A;  2Z3Y A;  4N9I A;  2O03 A;  2MLK A;  3J80 Z;  3QPT A;  2R7D A;  2PG4 A;  2P7V B;  4KUM A;  5LHH A;  2JRT A;  4P9F A;  4PCQ A;  4MEY F;  3M8F A;  2P8T A;  4ESF A;  3CLO A;  3F8N A;  3ZMZ A;  1MJA A;  3ZMU A;  2DTR A;  3F21 A;  3OV8 A;  2Z9O A;  5CVI A;  1J7K A;  1DPU A;  5H6R A;  4QLC U;  1JE8 A;  3GFJ A;  3DFG A;  2WWY A;  2P5V A;  3ZMD A;  2P6S A;  1FZP B;  2FE3 A;  3C1D A;  5HDN A;  1U5T B;  1IN4 A;  3CDH A;  3F23 A;  4M9Z A;  2J5O A;  2NNN A;  4OIR F;  2FNP A;  1DP7 P;  1YFH A;  1QQI A;  3IWZ A;  2EFQ A;  4YIF A;  3B02 A;  4Q48 A;  6PAX A;  2IVM A;  3H3Z A;  2GAU A;  4TV7 A;  1L3L A;  1UFM A;  1FX7 A;  2IA1 A;  4WF2 A;  2IA0 A;  5CVV A;  4Y17 A;  4ENN A;  1XSX A;  5D8K B;  4L18 B;  2GQQ A;  4YFN F;  1TNT A;  3J81 Z;  1U8R A;  3GXO A;  1O7L A;  3L9F A;  3RIR A;  4A12 A;  1XGO A;  2CGP A;  5HLI A;  4A0Y A;  3WTT C;  4HF2 A;  1Y0U A;  2DPD A;  2CW0 F;  4LK0 F;  3I5U A;  5HS9 A;  2KIU A;  1P4X A;  3SFZ A;  2K27 A;  2M45 A;  4LK1 F;  2O3F A;  3L2C A;  3TO9 A;  2IA2 A;  1LVA A;  1JHH A;  5K5O A;  1W7P A;  3WGG A;  3MEX A;  5A2Q K;  4P9U A;  4N9H A;  3IKT A;  3K2Z A;  3CJN A;  3MZH A;  4ZZD A;  2JT1 A;  4F7Z A;  3PQJ A;  5DD8 A;  2HEO A;  2XGX A;  2LSO A;  2V79 A;  3K1P A;  4RS8 A;  5ICE A;  3GZ6 A;  2VT2 A;  3T8R A;  1HKS A;  1XB4 A;  2RN7 A;  1B9M A;  2EFN A;  4YFK F;  2AS5 F;  5LEJ A;  1Z6T A;  4G6D A;  1QO0 D;  5E18 F;  3I54 A;  3WTW C;  2W57 A;  2MD5 A;  2DT5 A;  1YTY A;  2Q0O A;  1WWX A;  1S3J A;  4M9S A;  4L9J A;  5LHG A;  4EV0 A;  5D5U B;  1MGT A;  1I1G A;  2ELH A;  3D0S A;  2M87 A;  4O5V A;  1FOK A;  1VTN C;  2LF7 A;  1T98 A;  3N4M A;  4FT8 A;  4U7B A;  3L7W A;  2KKO A;  2XVC A;  2Z33 A;  2AXL A;  5AIQ A;  2HQN A;  5D5V B;  3G73 A;  1FLI A;  2V1U A;  1R1V A;  4O3M A;  4DNC A;  1IAW A;  2HTJ A;  1ZYR F;  4HF1 A;  3WGH A;  5E1W A;  3FXU A;  3C18 A;  3MZY A;  1IRG A;  1LJ9 A;  1XD7 A;  1XGS A;  4GCV A;  1FYL A;  1CF7 A;  5JVT A;  1PUE E;  3JW4 A;  1BBY A;  4EGY A;  1WQ2 A;  4XRF A;  2XKP A;  4G6Q A;  3LA3 A;  3I58 A;  3F8F A;  1ZH5 A;  3ABT A;  5E8G A;  4XBF A;  4AWX B;  2VOD A;  1IXC A;  3GWZ A;  4PZJ A;  3QU3 A;  3DPT A;  4G7H F;  3RYP A;  3WE2 A;  1J75 A;  3SXY A;  1Z7U A;  5CVR A;  3U1D A;  4MTE A;  1ZRD A;  1C0W A;  4O6J A;  5L3B A;  3WU1 B;  2PQ8 A;  5D8L B;  3ZPL A;  3V8J A;  3K1N A;  4A0X A;  4KFC A;  1HBX G;  5DCF A;  3GW2 A;  1S6L A;  3HOT A;  3U2R A;  2FNA A;  4HW0 A;  4HAM A;  4ENK A;  1ONV A;  2H6B A;  2FBH A;  4UVB A;  2H09 A;  5FGM A;  1UCR A;  2PEX A;  2XIG A;  4WK8 F;  5LRS A;  1F4K A;  5K5Q A;  1ZLJ A;  5DUI A;  4HYE A;  2EB7 A;  1PP7 U;  1XCV A;  1FY7 A;  4LLG F;  4HF0 A;  4B09 A;  1GVJ A;  2WV0 A;  1OYY A;  2UXN A;  2Q8K A;  3EQL F;  3F6V A;  1YS6 A;  4AIH A;  3HOS A;  1K79 A;  2XAJ A;  4HX8 A;  1I27 A;  1RNL A;  4HDU A;  2DU9 A;  5KVR A;  4OMY A;  4LLL A;  5LRR A;  4IHS A;  4PGH A;  2FOK A;  4ESB A;  4HLX A;  1QGP A;  3BJO A;  4RB2 C;  1U5T A;  5D6E A;  2BGC A;  1MDM A;  2ZO4 A;  4EGZ A;  2J5P A;  3M8E A;  2QEN A;  2M8E A;  3L00 A;  1R23 A;  3HUG A;  2XRO A;  1W7P B;  5DV5 A;  2DAO A;  4MNU A;  4BHP A;  5CLS A;  5IT3 A;  2PMH A;  2XAG A;  1HSJ A;  5LLQ A;  3T8T A;  4U7D A;  5LGT A;  1OPC A;  5JHU A;  2R3S A;  1H9G A;  3V7C A;  3IC7 A;  1FBS A;  1ULY A;  4BHC A;  1FC3 A;  3DP7 A;  1ZG3 A;  5JFR A;  3KP4 A;  1D3Y A;  4ZH4 F;  3BDD A;  3QU6 A;  4HQE A;  1Z1D A;  3E6C C;  4S04 A;  4BQA A;  2JPB A;  3R61 A;  5J8C A;  1YW7 A;  2ISZ A;  2MA3 A;  3KLO A;  4KNY A;  3DXJ F;  2QVO A;  3BP8 A;  4HBL A;  3WTS C;  2A6H F;  3MQ0 A;  1TW2 A;  1E2X A;  2EFP A;  2VON A;  1G3S A;  3E5Q A;  2FF4 A;  1I6X A;  2ESN A;  2KRF A;  4KIB A;  3REO A;  5HDK A;  4MGR A;  1D8K A;  1ON2 A;  4LGW A;  3FX3 A;  1P2F A;  2OU2 A;  3KP7 A;  3FF5 A;  5A2Q Z;  2F5E A;  3TQN A;  2F2E A;  3BOQ A;  4LMY A;  2V1D A;  4CXF A;  3EUH A;  3TGN A;  1HW2 A;  2HWV A;  5FLX Z;  1OYI A;  3KLN A;  3P9I A;  3CUQ C;  3WGI A;  1DDN A;  1TQI A;  2NS0 A;  3BRO A;  4ZYD A;  4EJO A;  4I01 A;  5JI6 A;  4HA8 A;  1RIO H;  1KGS A;  5ILV A;  4HOB A;  1H0M A;  1FWZ A;  1CF7 B;  1KU7 A;  3V8K A;  3DQV C;  1XGN A;  3GZ5 A;  4AIK A;  1HKQ A;  1TW3 A;  4WXH A;  4WWC A;  1AWC A;  4LJZ F;  1V4R A;  3ZQ7 A;  4U0Y A;  3IRQ A;  4KIG A;  3ISP A;  3LAP A;  3KP2 A;  4Y13 A;  3O3K A;  4UXN A;  1P92 A;  3SZT A;  3DF8 A;  2Z5U A;  4KMU X;  2CWE A;  4FX4 A;  2EA2 A;  1O3Q A;  1TNS A;  4WXD A;  3AAF A;  2G7U A;  3DEU A;  4U88 A;  2YR2 A;  4XLN F;  3SQN A;  2A68 F;  2GA2 A;  2A6E F;  1GXQ A;  4OIN F;  3ZMV A;  4OIQ F;  5H20 A;  2LDU A;  1B6A A;  5H6Q A;  5D5X B;  1R5H A;  2WTE A;  2VOP A;  1XMA A;  2OQG A;  1ZN2 A;  4KMF A;  2H6C A;  1KQ9 A;  2K4J A;  2XKO A;  4BYY A;  2KJC A;  1UHM A;  3JSO A;  4NQW A;  2YU3 A;  3HRM A;  2G7H A;  2GWR A;  1BI3 A;  2OZU A;  1OMI A;  2Y48 A;  1IXS B;  3R4K A;  1D5V A;  1LNW A;  3E6D A;  3F3X A;  5BMZ A;  2FQ3 A;  5LBQ A;  2F5F A;  1MKM A;  2FMY A;  1FSH A;  4OMZ A;  3MCZ A;  3NEU A;  2MH2 A;  1W7P D;  1BIB A;  1J59 A;  1XN7 A;  3JAM K;  5ICG A;  1SD7 A;  1MDM B;  3HRS A;  1RZ4 A;  4YII A;  4I0A A;  1K78 A;  3KEO A;  1U3E M;  4KYW A;  3KP5 A;  1QNT A;  3WG9 A;  2F5D A;  2GZW A;  5JR3 A;  1YG2 A;  3F8C A;  4UNO A;  2RNJ A;  4ETS A;  1FBQ A;  3ERE D;  1UB9 A;  3RI4 A;  2F5C A;  4CDG A;  4UVA A;  4AIJ A;  3WTX C;  4HV6 A;  3C7J A;  2PI0 A;  2QM3 A;  4MTD A;  2EWN A;  4OIP F;  1LDK B;  1RUN A;  4I2O A;  2YPR A;  1T38 A;  1IN6 A;  4GGG A;  3LA7 A;  2HZT A;  1BI0 A;  1O3R A;  3CO7 C;  3Q9S A;  4G94 A;  1B4A A;  1SMT A;  3WU0 A;  4KIC A;  5HVQ C;  1TBX A;  3WTV C;  1OR7 A;  3QP6 A;  3F6O A;  1W5S A;  3R60 A;  4D0P A;  2Y0M A;  2MH9 A;  5L3D A;  2M1B A;  3LFK A;  2PJP A;  1YO5 C;  1EH7 A;  2XRN A;  3I59 A;  4CHU A;  1S7O A;  1I5Z A;  2P6T A;  5HLG A;  2W85 A;  2P7C B;  5IT9 K;  3RPU A;  3BY6 A;  4N0B A;  1QBJ A;  1IZ1 A;  3GUD A;  4I98 B;  4BH9 A;  2EV5 A;  4WXC A;  1JXS A;  2PN6 A;  3T5X A;  3SHF A;  1XCB A;  2DQR A;  1QZY A;  2L02 A;  3E97 A;  4H0E A;  2HYF A;  5F64 A;  2NNY A;  4IHT A;  1LEB A;  2HTS A;  2IW5 A;  3TDZ C;  2VXZ A;  3BJA A;  1O7F A;  3TDU C;  2KIF A;  1SFU A;  3DPL C;  1CGP A;  1HST A;  4G7O F;  1LQ1 A;  2QYO A;  3F8M A;  2RGV A;  4LB6 B;  2D1V A;  1WKM A;  5LGN A;  2JZY A;  4P55 A;  1ZRE A;  1I1S A;  1IF1 A;  4MQV A;  1FT9 A;  3KP6 A;  2DFI A;  5CYV A;  2HQR A;  4HDV A;  4RB1 A;  4EVI A;  4IRG A;  4XLP F;  1FSE A;  4RGU A;  2D2W A;  4ZYH A;  2COM A;  1EH8 A;  2ZNZ A;  2O6G E;  3RJP A;  5BOX A;  3CUQ A;  1K7A A;  2FML A;  3F8B A;  2PMU A;  4CYD A;  1XDS A;  4EJW A;  2A07 F;  3FWE A;  2W24 A;  1FYK A;  2VBY A;  2ESH A;  3L09 A;  4G7Z F;  1B59 A;  4XSZ F;  3SZP A;  3K9T A;  1U2W A;  4OU0 A;  3VOE A;  4WCG A;  2C6Y A;  4ZZL A;  3R0J A;  3E6M A;  1QPM A;  1QZZ A;  3I0T A;  2OZ6 A;  2WC2 A;  3WE3 A;  2QBY A;  1P6R A;  5F1R A;  3ZN0 A;  3FM3 A;  1ZHF A;  3O2P E;  4U0W A;  3GFI A;  1ZRF A;  2ACJ A;  1Q1H A;  2UZK A;  1STZ A;  5CVJ A;  5K5R A;  2HFH A;  1K78 B;  5AIP A;  5HLH A;  3GYH X;  1ZAO A;  3OOP A;  2IRF G;  4L5I A;  3KEQ A;  5D4S A;  2FSW A;  2BE5 F;  3HSF A;  4GYG A;  2A5Y B;  2A69 F;  2LKP A;  2FBK A;  1Z91 A;  2FU4 A;  1X3U A;  2JSC A;  1H9T A;  4OOI A;  1YW8 A;  3HSR A;  5DD4 A;  1D8J A;  5E17 F; 
#chains in the Genus database with same CATH topology
 2WAQ A;  2PBI A;  5DYM A;  3GEZ A;  4ESJ A;  2CFO A;  2K9N A;  3S32 A;  1SVM A;  2JQ7 A;  3PUF A;  3CMY A;  2O8X A;  1K61 A;  3G3Z A;  3A01 B;  4P96 A;  1U78 A;  1UG0 A;  4BDZ A;  2HGC A;  3CC2 I;  1FBU A;  3DTE A;  3H5A A;  1D1A A;  1Z6R A;  5FKN A;  4LLN A;  2WB1 A;  2X51 A;  2HQ5 A;  5HLT A;  1U6G A;  2CUJ A;  3JRB A;  4EJT A;  2CYY A;  1AOY A;  1S29 A;  2STT A;  3BG5 A;  1MND A;  2EV0 A;  5FFX A;  3RCO A;  3GO5 A;  3JAM Z;  1KYZ A;  1CQT A;  1V5F A;  2DMP A;  3E3V A;  2VQC A;  2VC1 A;  3KET A;  1IV8 A;  1XDU A;  2ZFW A;  3I59 B;  5GTH C;  4E70 A;  4XRS A;  2VIX A;  2GIV A;  1T0F A;  4YFX F;  2O5R A;  4B8X A;  2HOT A;  1Z3X A;  1S72 I;  2LF8 A;  3E1S A;  1G8X A;  3A1Y A;  4FQG A;  4OWR B;  2QLZ A;  3M1E A;  3WTU C;  1A6Q A;  4OAZ A;  1TWA J;  4C3H J;  1RC9 A;  3GX4 X;  1I3A A;  2VBX A;  4CGZ A;  4P1W A;  3V7S A;  2VLA A;  1XC5 A;  3JRA A;  1PUF A;  2HVR A;  4KIF A;  2KPM A;  5EG0 B;  2Y30 A;  1YX3 A;  4RGR A;  1V5G A;  2EJR A;  4AU7 A;  1PP8 F;  1JI8 A;  2D1H A;  4LG0 A;  3PJR A;  1E17 A;  1UG2 A;  5ILU A;  4K2E A;  1GV2 A;  1QVU A;  1ZG5 A;  2VC0 A;  4NBQ A;  3VYT B;  2I5U A;  4RA2 A;  3BG9 A;  3FM5 A;  2IS4 A;  3J7A O;  4I0B A;  4RGX A;  3TO7 A;  2MGQ A;  3EYI A;  5F27 A;  4FE4 A;  4XOT A;  1KU9 A;  2B7E A;  4DOZ A;  4JYK A;  3RDI A;  2EZL A;  3KYC B;  2IP2 A;  3OIQ A;  3TBI A;  3ZOB A;  4E4H A;  5F1J A;  3M9A A;  1K6O A;  1BOA A;  3LSR A;  1Z21 A;  2M8G X;  5L3E A;  1EV7 A;  4NB5 A;  5CVU A;  4DZP A;  3HHH A;  2CU7 A;  1SFX A;  3V4G A;  2R7U A;  3LFU A;  3COA C;  3DKY A;  2LKX A;  2MC4 A;  1ZGA A;  2OBP A;  3JRC A;  4E7H A;  1MBH A;  3IV5 A;  1B1B A;  2ZJQ F;  2PMZ A;  4PSW A;  3CUO A;  4MEX F;  4XID A;  2BXY A;  2KDZ A;  2RKH A;  3I64 A;  4B44 A;  3OYB A;  2P5L C;  1ETY A;  4M9X A;  3JRH A;  2HNH A;  3E5X A;  4MLO A;  4D5F A;  1SAX A;  3S1N J;  4BXU A;  3CF5 F;  2VJJ A;  4Q4Z F;  2F48 A;  1RUO A;  3NRV A;  4KDP A;  1PJR A;  2BHY A;  2ZJ2 A;  5IT9 Z;  1YLF A;  2QQ9 A;  4ZDP A;  4EM0 B;  1Z9C A;  1J09 A;  3SYT A;  4IEJ A;  3GFM A;  1R36 A;  2EK5 A;  1MBE A;  2GXG A;  4IQ4 A;  5L3C A;  1FTT A;  4RM2 A;  2K86 A;  2XAU A;  4LD5 A;  2NXN B;  2LMD A;  3H0D A;  3P7N A;  4M3G A;  4UV8 A;  4D5C A;  5L3F A;  3S3M A;  2NYX A;  4NNJ A;  2VOO A;  1GXP A;  3CUQ B;  3OR1 C;  2DA1 A;  3ZMS A;  1P7I A;  4BAC A;  1BJA A;  1YIJ I;  2YU9 J;  2XHK A;  2IT0 A;  2M0M A;  3HG9 A;  3E0J B;  1B72 A;  2QKM B;  2JUG A;  2DA6 A;  1WJ5 A;  2AHQ A;  3BG6 A;  3P9K A;  1SFO J;  1O4X A;  3ZXS A;  5E8I A;  2OTL I;  3W6V A;  2DLL A;  1UAA A;  1IN8 A;  2NOJ B;  3GTM J;  4YG2 F;  1T33 A;  4UHT A;  2DA5 A;  3Q0W A;  3QPH A;  5LFA A;  4IHV A;  2ADU A;  2X6W A;  4XKV A;  3HRU A;  2EQR A;  2HU9 A;  4JX5 A;  5GTI C;  5IOZ A;  2HOA A;  4IOA F;  1O57 A;  3PQK A;  3DKW A;  1OJL A;  1TLH B;  5J6X A;  3I4P A;  1MD0 A;  2Y75 A;  2V6C A;  3CTA A;  1OKR A;  2XV4 S;  4LFU A;  5K1Y A;  1NHA A;  3IH3 A;  3JRF A;  3E6B A;  5EZH A;  3Q0V A;  2L0K A;  3GLL A;  2XF7 A;  2R7R A;  4DIQ A;  3CJR B;  2LNB A;  2GA1 A;  2MLG A;  2L4A A;  1IW7 F;  1YW9 A;  3LOC A;  4M6Y A;  3PIO F;  4EMS A;  2H94 A;  4ON0 A;  4CCM A;  4PDK A;  3AL0 C;  2R7O A;  1OCZ H;  1XSV A;  4CYC A;  3PSI A;  2QQB A;  3TKY A;  1SFE A;  1R58 A;  4QSH A;  2K9Q A;  5EZG A;  2E2I J;  1EF4 A;  3DCF A;  1Q1V A;  3RPQ A;  4D7N A;  5D4R A;  2OA4 A;  2QBY B;  3S15 J;  1QVT A;  2PFB A;  4AD9 A;  5EGO A;  1SD6 A;  2NVY J;  4BEH A;  2JN6 A;  5D6F A;  3FMS A;  3ZMT A;  2WAD A;  1GLN A;  4GYI A;  2UWM A;  2P5K A;  2CO5 A;  3MKL A;  4D9J A;  1O3T A;  3IRR A;  1WJC A;  4C30 A;  2DW4 A;  4M73 A;  4BHB A;  3I3L A;  5IYB J;  2TDX A;  1PVE A;  2PJR A;  4IHY A;  1ON1 A;  3D5R C;  1MBF A;  1MJB A;  2Q2E A;  4QWQ A;  4MQ9 F;  5K7Z A;  1TQM A;  1JKP C;  3KZY A;  3G71 I;  3OS1 A;  1VQO I;  1UHW A;  2HOE A;  3RKX A;  3CF2 A;  3BPX A;  4M3F A;  3L1P A;  1RES A;  2Y9Z A;  1B8I B;  4XLE A;  1G4D A;  2JA6 J;  1R22 A;  3GVA A;  2QUF A;  1JUP A;  5FB2 A;  1ZG1 A;  1FMV A;  5E3M A;  3V7R A;  4A2U A;  3ECO A;  2NVQ J;  3IHU A;  1DP3 A;  4ZC3 A;  4DYC A;  4R1H A;  4YEJ A;  2CV1 A;  3DBR B;  3LSI A;  2Y0S A;  1FNN A;  3PUB A;  2D45 A;  1YJ9 I;  3HDD A;  4R8H A;  4M6X A;  4A5N A;  3U21 A;  3JSP A;  3KFW X;  2KP6 A;  1HXD A;  3GLX A;  1DU6 A;  2RNG A;  1G3Y A;  4IVN A;  2E7X A;  1KU2 A;  4PGG A;  3JRG A;  1T39 A;  3FXR A;  2NRA C;  2QGU A;  2ME0 A;  5TRD A;  4I76 A;  2CRG A;  5AON A;  3K1M A;  1TTY A;  2E7W A;  3BJ6 A;  1NG6 A;  5E1X A;  2XAF A;  2CV2 A;  3J7A Y;  2RAE A;  1RI7 A;  4DGW B;  1UEL B;  3D5L A;  2ELK A;  2DYS H;  3RPU D;  4W97 A;  4C3J J;  3ZQI A;  3JR9 A;  4MFE A;  4XSX F;  1KQ8 A;  1U5T C;  3OYL A;  1APL C;  3QYF A;  2ZBK A;  2DA7 A;  2W00 A;  1BIA A;  2ISY A;  2H1K A;  1BM9 A;  5KAI C;  2V7F A;  3VOD A;  4KN7 X;  4U0V A;  1RRJ A;  4HX4 A;  3KZZ A;  3M1C A;  4B47 A;  5M5Y J;  3ELK A;  3MWM A;  3BLY A;  3AG3 H;  2VL8 A;  3H9Q A;  1MBK A;  1YIO A;  3ESW B;  2Z16 A;  1E3O C;  3IKV A;  2VKE A;  2VQH A;  4I09 A;  4A3C J;  4BXX J;  5M5W J;  1WCM J;  4HX7 A;  3OYK A;  4IO9 F;  2MC3 A;  1PUF B;  2NVU B;  2EIM H;  2MBF A;  2F5V A;  3T0Y A;  4E7Z A;  3TED A;  2DK5 A;  1F36 A;  3HGY A;  4RGS A;  3Q5F A;  4LG0 B;  2R7F A;  4A6E A;  1HKT A;  4DZJ A;  3DV8 A;  5J3L A;  2LKS A;  5E3O A;  4L0Y B;  3MAJ A;  1VF9 A;  2GXA A;  2GM4 A;  1R1T A;  2PLY A;  1BN5 A;  2XAQ A;  2XGD A;  5GAH J;  1JT0 A;  3AKZ A;  3K4K A;  4R79 A;  2ZXH A;  2EBI A;  1WI9 A;  2VQL A;  2EV6 A;  1BI2 A;  2QQA A;  1WGX A;  2W82 A;  5FO5 A;  3GFL A;  3OYN A;  1WJB A;  2F4O B;  4G12 A;  4EM2 A;  1ETQ A;  3GTJ J;  1GT0 C;  3EET A;  3KX2 A;  1F5T A;  4RLQ A;  2E34 A;  1J0R A;  2B0L A;  2KIM A;  1HDD C;  3D1N I;  3OYF A;  2FD5 A;  2KT0 A;  5ED4 A;  1JTY A;  1Y6I A;  4A0Z A;  4J19 A;  1YS7 A;  2K5C A;  2DT6 A;  4JX6 A;  3BWG A;  1DPR A;  1GVD A;  4Q5S F;  2RDP A;  4HQM A;  2KJB A;  4G9Y A;  2HKO A;  4LIV A;  5BS6 A;  3F22 A;  1GHC A;  4OIO F;  2FA5 A;  2L9R A;  1ETK A;  2DBB A;  1KQ0 A;  4GFB A;  3Q3S A;  1A5J A;  2Z2S B;  3LAJ A;  5FKO A;  3TOA A;  1L0O C;  1P4A A;  3B73 A;  3BPV A;  1MJ9 A;  3ABM H;  4LIU A;  1HOM A;  3DTI A;  5C4X J;  2GXB A;  1IN5 A;  2X4H A;  3FKI J;  2Z1D A;  1QRY A;  4RB0 A;  3U9G A;  2STW A;  5KK1 A;  1FP1 D;  3FIW A;  5GPC A;  3IAM 2;  1YE9 A;  1FP2 A;  1S7A A;  3FBI B;  1BI1 A;  2HPI A;  1D0Y A;  1IUY A;  1G6N A;  2QZ8 A;  3MKZ A;  4D7M A;  1ZLK A;  1W36 D;  4CIC A;  3LSK A;  4CZC A;  1W4M A;  2MFZ A;  3HOY J;  4A3I J;  3FXO A;  3DBL B;  3S17 J;  2HDW A;  2EZI A;  5FLX K;  3JTH A;  3V8L A;  4HV5 A;  4EM1 A;  2W84 A;  2YX7 A;  2IS2 A;  4Z2Y A;  1VI0 A;  4XKW A;  2L9N A;  3ABL H;  3GTO J;  1S8N A;  1R1U A;  1BR4 A;  1MSF C;  2M9H A;  2BBY A;  4BNC A;  3BT9 A;  5HS7 A;  3SDB A;  3OYJ A;  3Q9V A;  4OAY A;  1R00 A;  5DCM B;  2E2J J;  3HXL A;  4CZZ A;  2OCE A;  4CO8 A;  1B72 B;  2X0L A;  5J47 A;  2EIK H;  3FIS A;  3ROU A;  4EQQ A;  4M71 A;  2OD5 A;  2ZME A;  2E1M C;  3KE2 A;  2X6X A;  4DYR A;  1DUX C;  5CKT A;  3OMY A;  3RSN A;  4NC6 A;  2ZCW A;  1HA8 A;  3O8G A;  1FIP A;  1W1W E;  4I7H A;  2AXT C;  3TL4 X;  2CJJ A;  2WY8 Q;  1XMK A;  3OS2 A;  3H5R A;  2M3A A;  2ZKZ A;  2JTV A;  2WY7 Q;  3FXQ A;  4MHG A;  2L9S A;  3FXJ A;  4Q47 A;  1SAN A;  2L3D A;  3WOD F;  1IXR C;  2FEZ A;  4ASN A;  2EZH A;  3I4N J;  3CP2 A;  5FKM A;  5J1U A;  4HLY A;  3MD2 A;  3CO6 C;  4CYC B;  5LGU A;  2DFF A;  1T2K A;  2XB0 X;  4XOR A;  3W6J B;  5HDG A;  5BQT A;  3RZO J;  1Z05 A;  3BG3 A;  1R7J A;  3M07 A;  4XM3 A;  1USS A;  3RTR A;  1LVK A;  4BE1 A;  1XPX A;  4IHW A;  1J9I A;  2L01 A;  1TWF J;  4L5E A;  4B48 A;  1REP C;  1W5C C;  3NQO A;  3CCJ I;  4I02 A;  2K9S A;  5BPI A;  1V54 H;  4M72 A;  4M74 A;  1VQ4 I;  4BEH B;  3H92 A;  2B63 J;  2FBI A;  2K02 A;  4JP0 A;  5D5W B;  3C3W A;  1IRZ A;  4A3J J;  4PJN A;  4S05 A;  3IUO A;  3ABU A;  4IRH A;  1T08 B;  3HBL A;  2G9W A;  2V9V A;  3J80 K;  1DU0 A;  2FUG 2;  2PJR B;  4L5J A;  4UUV A;  1IRX A;  2DOA A;  3LA2 A;  4A5M A;  5HOO A;  2Q2E B;  4AVZ A;  2ZXJ A;  4G8X A;  2L4M A;  2ETH A;  3IWF A;  1F9N A;  2XGC A;  2JJ7 A;  1ZGJ A;  3ASN H;  1KU3 A;  4W1U A;  3SFI A;  3FMR A;  3ZN1 A;  5EEH A;  1TQP A;  3SJM A;  3WU2 C;  2JPC A;  5K7H A;  4IRI A;  2MW8 A;  4RBO A;  2YSR A;  1FPQ A;  2DMT A;  3WTZ A;  2KQR A;  2DA4 A;  3KP3 A;  1FYM A;  3HRT A;  3K69 A;  1ZKG A;  1POG A;  4A3F J;  1AHD P;  3CCR I;  4B3X A;  1WRJ A;  2FXA A;  3DEW A;  3OR2 C;  4IX7 A;  2XSD C;  1KYW A;  4UVC A;  2O0Y A;  3LST A;  4FX0 A;  5F0H A;  2LLK A;  1EH6 A;  2QWW A;  1X4O A;  3OWT A;  3IH2 A;  3VDX A;  2WAE A;  3WTY C;  1WJD A;  4WX9 A;  4ZDO A;  1AA7 A;  5CJ9 A;  4ZYG A;  1TWC J;  2M5W A;  1S5L C;  2VKD A;  2H27 A;  1XGM A;  2LBF A;  5J40 A;  3P9C A;  4Y15 A;  1BC7 C;  3QQA A;  1VFC A;  4BJT A;  3S1R J;  1H89 C;  2R93 J;  4BJ5 C;  4ENM A;  1BR1 A;  4BDY A;  2UV1 A;  1FOX A;  1BC8 C;  5ILS A;  4NHJ A;  3FZV A;  3FXK A;  2F4M B;  2KFD A;  3R0A A;  2VE8 A;  3QAH A;  4EJU A;  2R7S A;  4ZYA A;  3FHZ A;  3K4B A;  4AVP A;  5LD2 C;  2EPF A;  1QPI A;  1T6S A;  2E5N A;  3ZQL A;  2DI3 A;  4PJ0 C;  4F92 B;  2CSO A;  2YX4 A;  3LNQ A;  2A61 A;  1UMQ A;  2K7L A;  3CC7 I;  2DPU A;  2RQP A;  2V1X A;  4BE0 A;  1WVR A;  2I10 A;  1LDJ A;  4B43 A;  1NK3 P;  3ECH A;  3S16 J;  2OF7 A;  3P5J A;  1JHF A;  3QOP A;  4FAS D;  2LP0 A;  2CFX A;  2XPW A;  2R5Y A;  1HQC A;  4XQF A;  3G2B A;  2ECB A;  1ODD A;  3AG4 H;  3VYS B;  2P4W A;  2JRM A;  3OSF A;  4Y33 A;  1KZH A;  2DO7 A;  3QOE A;  3L2W A;  1ZRC A;  3OSG A;  5F6F A;  5FD6 A;  1LDD A;  3E5U A;  5E1Z B;  4BGD A;  1R5G A;  1SAU A;  2Q1Z B;  3JCU C;  2VB6 A;  5L3G A;  1T95 A;  1U9N A;  3MN2 A;  4L9T A;  4KT6 A;  1XSD A;  4HST A;  3CCQ I;  3J81 K;  1A6I A;  2DDA A;  1Y1W J;  2IPQ X;  1SD4 A;  2WV1 A;  3W6K B;  3OL3 A;  4GXO A;  1XX5 A;  2EFW A;  2ZXW H;  5ICC A;  4IXA A;  4YIR X;  3HYI A;  1MZB A;  2Z99 A;  4BQN A;  2CG4 A;  2R7Q A;  3FKJ A;  4IOC F;  3LQQ A;  3MFK A;  3HSE A;  1IRF A;  5GAG J;  4XRM A;  4A3B J;  1MMD A;  3HTS B;  2HPM A;  1ZEL A;  2E19 A;  5TJJ A;  2DK8 A;  3GF2 A;  1OR7 C;  4P5O A;  2Y69 H;  1J5Y A;  2JVH A;  2EZK A;  1K6Y A;  2NAZ A;  4HEA 2;  4JQF A;  1JUS A;  1G3W A;  2VN2 A;  2IJL A;  3PO3 J;  5LHI A;  1ZGW A;  3CCS I;  5BPD A;  1TC3 C;  2FRH A;  4F91 B;  1E3P A;  1Z0X A;  4UB8 C;  4GRI A;  1R4M B;  3A0B C;  3CMM A;  3QPL A;  3JTG A;  5FFZ A;  3CZ6 A;  2OAZ A;  2BYV E;  1FOY A;  3ASO H;  5LEK A;  3VYR B;  1YQA A;  5FD5 A;  2MG4 A;  1YYV A;  2CQN A;  2BXZ A;  3F72 A;  3K2A A;  3K10 A;  3GTL J;  4BKX A;  4IJA A;  2E1C A;  4RB3 C;  5KNL A;  3HTU A;  3HOW J;  3OYI A;  2GIZ A;  2DQL A;  2CUF A;  1PDN C;  2KIS A;  4AYB N;  2YS9 A;  4B3A A;  2ZJR F;  1VQ5 I;  1U0J A;  3CJT B;  3MKW B;  2OQR A;  2Y31 A;  3S8P A;  3ULQ B;  1XMX A;  1ZAR A;  4XRS G;  2BY3 A;  2E5Z A;  2ZC2 A;  3K0L A;  4XR6 A;  2P81 A;  4HNU A;  4YRV A;  3PSF A;  3QRF F;  3ML6 A;  3VB2 A;  2DT7 B;  2LY1 A;  2RC4 A;  3LSM A;  3CP8 A;  5IP7 J;  4XMY A;  2ICW G;  1MBJ A;  1MH4 A;  2IAI A;  2KLO A;  3FXM A;  3VFZ A;  4LB5 A;  2HR3 A;  2CQK A;  1VQK I;  4RAZ A;  2L5Q A;  3L2R A;  5C44 J;  3EPZ A;  2ZME B;  1Y56 A;  2P0W A;  3QPS A;  1ETX A;  4ZDL A;  2BY0 A;  4HZF A;  4ZTF A;  2G0E A;  1P4W A;  2HDC A;  2EIL H;  2W25 A;  1HW5 A;  3FMQ A;  3BR5 A;  2QQ8 A;  4UUS A;  5ICF A;  3K4L A;  3EYY A;  3H3V K;  3LQR A;  4A3E J;  3S2W A;  4RM3 A;  3LWF A;  2VKH A;  3BTJ A;  3BQZ A;  1JGS A;  1O3S A;  4XKC A;  5DUK A;  4BY1 J;  1F1Z A;  3TW7 A;  3QYE A;  1X1A A;  3UR3 C;  3BTL A;  4BU2 A;  5KCM A;  4IPA A;  1JUM A;  4F55 A;  2K3P A;  1IN7 A;  5DS9 A;  3K4C A;  2QCO A;  4FHT A;  3M3Y J;  3HIF A;  5DEQ A;  2BV6 A;  4KA4 A;  1G3T A;  4MIM A;  4EJV A;  4FE7 A;  3TOB A;  3KCC A;  1UST A;  1HW1 A;  2RVC A;  1BA5 A;  1LEA A;  2FX0 A;  2EA4 A;  1X3W B;  3O6B B;  4KN4 X;  3PFI A;  3RKW A;  1BW6 A;  1RKW A;  2E2H J;  1TWH J;  5HS8 A;  2JA2 A;  4DQ2 A;  2DOD A;  5ERI A;  4QPO A;  2DMU A;  5DCM A;  3BR0 A;  1FOW A;  3KYL A;  4UV9 A;  1V3F A;  4L9N A;  2EIJ H;  2VI6 A;  4KT5 C;  5J1R A;  4YEL A;  1IDZ A;  4PJJ A;  1W5T A;  1HDP A;  2K3F A;  3K4M A;  5FKK A;  2ZSH B;  3CMA I;  2HYG D;  3TO6 A;  2R92 J;  2X1E A;  1WSU A;  5GAD J;  1EJ9 A;  4A93 J;  3I53 A;  1XS9 A;  3S1Q J;  1VND A;  2X1C A;  3M7G A;  2A3S A;  4BAY A;  2HKX A;  2HYJ A;  3HKZ N;  4A6D A;  1ACI A;  1A31 A;  2VBZ A;  5HOD A;  2XRL A;  2H8R A;  1A04 A;  5J1Y A;  3H3U A;  2K4B A;  3MMY B;  2AO9 A;  3NAU A;  3ZP5 A;  2M30 A;  4JBA A;  2LK2 A;  2UXX A;  3VEP A;  2X6Y A;  5EEG A;  3LSG A;  3QP5 A;  2EFO A;  4JK1 X;  2ZNY A;  1X58 A;  4L9V A;  5F0C A;  2XUB A;  2O61 A;  2H1L A;  2HS5 A;  3T1B A;  4ENJ A;  2E1N A;  2M4K A;  1OYW A;  2R5Z A;  3AL0 B;  1LFB A;  2RV8 A;  2BEO A;  1LKX A;  2ID6 A;  2XAH A;  5DDG A;  1LB2 A;  4IQJ A;  1VQN I;  1BW5 A;  1N75 A;  1SMY F;  2L54 A;  1YJW I;  4BBS J;  3BZ6 A;  3I71 A;  2LBF B;  1J2X A;  4A69 C;  3N97 A;  2R0Q C;  2VT3 A;  1X4P A;  5E20 A;  4FET A;  4ZYE A;  3C2G A;  3RKY A;  5J8F A;  1KA8 A;  3IL2 A;  3S14 J;  2VBW A;  2O9L A;  4IF4 A;  3QYB A;  1B9N A;  4GO1 A;  4RAY A;  3HJE A;  1SD5 A;  2VE9 A;  1X2M A;  5IY5 H;  4L0Z B;  3HHG A;  3HOZ J;  2XAS A;  3ZRG A;  3RYR A;  3EDP A;  3R6S A;  1WI3 A;  2Z3Y A;  4N9I A;  3TP3 A;  2A5W A;  4NDL A;  3ZQQ A;  2O03 A;  2MLK A;  3J80 Z;  3QPT A;  5F04 A;  3G6E I;  2R7D A;  3MKY B;  2PG4 A;  2P7V B;  4KUM A;  5LHH A;  2JRT A;  2EH3 A;  4P9F A;  1T56 A;  1AKH A;  4CA0 A;  4PCQ A;  4MEY F;  2R5Y B;  2DFE A;  3M8F A;  3A4C A;  2QA4 I;  4NUB A;  2P8T A;  4ESF A;  1YI2 I;  3CLO A;  3F8N A;  2XC7 A;  2Y9Y A;  1RKT A;  1MMG A;  3L2U A;  2E60 A;  2JA5 J;  3ZMZ A;  1MJA A;  3ZMU A;  2DTR A;  3F21 A;  2XSJ C;  3CD6 I;  2QEX I;  1MNM C;  2LC2 A;  3OV8 A;  3GCM A;  4F3Q A;  2Z9O A;  5CVI A;  1J7K A;  2TRT A;  1DPU A;  1QZE A;  5H6R A;  2DMN A;  4QLC U;  1JE8 A;  5C4J J;  1S7E A;  3GFJ A;  1LE8 A;  3DFG A;  2A05 A;  1MIJ A;  2HZD A;  4XLF A;  2WWY A;  4BJ6 C;  2P5V A;  3ZMD A;  2ELJ A;  3HPH A;  3WHB A;  2R7V A;  2P6S A;  2OTJ I;  4C9Y A;  1FZP B;  2FE3 A;  3C1D A;  3S93 A;  5HDN A;  2WA0 A;  2BOL A;  2KZG A;  1U5T B;  1IN4 A;  3CDH A;  3UNG C;  3ZQF A;  3F23 A;  4M9Z A;  2J5O A;  2NNN A;  1MMS A;  4OIR F;  2FNP A;  2OPT A;  1DP7 P;  2V9K A;  1YFH A;  1IG7 A;  1QQI A;  3OYM A;  3IWZ A;  2EFQ A;  3K4J A;  3B02 A;  4Q48 A;  4YIF A;  2IVM A;  3DBH B;  5J4Y A;  4BXF A;  1VQM I;  6PAX A;  3H3Z A;  4FTH A;  2GAU A;  4TV7 A;  1L3L A;  3HUG B;  1UFM A;  5CQE A;  1JKO C;  4S0H B;  1FX7 A;  1BL0 A;  2R7Z J;  2IA1 A;  3KZI C;  4WF2 A;  2IA0 A;  5CVV A;  3NAR A;  1VQ8 I;  4Y17 A;  1XSX A;  5D8K B;  3J7Z I;  4ENN A;  4L18 B;  2GQQ A;  3UKG A;  4YFN F;  2DMQ A;  1NK2 P;  2HXO A;  3FDY A;  1TNT A;  1SVO A;  2X48 A;  3J81 Z;  2KZV A;  3F0C A;  5KAF C;  4J00 A;  1U8R A;  3GXO A;  4CSW A;  2NS8 A;  1O7L A;  1MSE C;  4F52 A;  3DKX A;  3L9F A;  3RIR A;  4A12 A;  1YOV B;  4CUG A;  1XGO A;  1X1D A;  2CGP A;  2KIQ A;  1ETV A;  5HLI A;  4A0Y A;  2IS1 A;  3WTT C;  4HF2 A;  2VJI A;  1Y0U A;  5EDN A;  3DPU A;  2DPD A;  2CW0 F;  3S3N A;  4V2F A;  3HM5 A;  4UUS B;  4LK0 F;  1VQP I;  2BW3 A;  4BE2 A;  3G1M A;  3I5U A;  3ZQH A;  2GLO A;  5HS9 A;  3PNV A;  2DOE A;  2KIU A;  1P4X A;  3SFZ A;  3CC4 I;  2UUZ A;  2K27 A;  2M45 A;  4LK1 F;  2VPL A;  1WJF A;  1K4T A;  2O3F A;  3CCU I;  3L2C A;  3BCB A;  5IYD J;  3TO9 A;  1ERD A;  2IA2 A;  1LVA A;  1JHH A;  5K5O A;  1OCP A;  4E7K A;  4UB6 C;  3RQI A;  1W7P A;  5DTD A;  3WGG A;  1GUU A;  1WFX A;  3MEX A;  5A2Q K;  2OCC H;  3IAS 2;  4P9U A;  4N9H A;  3IKT A;  3K2Z A;  4Y3O A;  3CJN A;  1Z7L A;  2X85 A;  3MZH A;  3QOD A;  4U87 A;  4ZZD A;  2IGM A;  5FLV A;  1UZC A;  2R4G A;  2JT1 A;  4M3D A;  3CQZ J;  3PQJ A;  4F7Z A;  3HC7 A;  5DD8 A;  2HEO A;  2XGX A;  3EUH C;  2LSO A;  3OYA A;  3OYG A;  2V79 A;  3K1P A;  4RS8 A;  1X1B A;  3BQY A;  2CQX A;  5FJ8 J;  5ICE A;  3L2Q A;  3GZ6 A;  2VT2 A;  2R7W A;  5FKL A;  3BZC A;  3T8R A;  1HCR A;  1HKS A;  3ABK H;  2QF7 A;  1XB4 A;  2RN7 A;  1B9M A;  3PFY A;  4HRI A;  2EFN A;  5E3N A;  4YFK F;  1D0Z A;  2AS5 F;  5LEJ A;  1SEU A;  1OCT C;  1Z6T A;  4G6D A;  2O7O A;  3SDG A;  2CUE A;  1QO0 D;  1FEX A;  3IH4 A;  2E1M B;  5E18 F;  1JKR C;  1X1C A;  1SC7 A;  1ETO A;  3I54 A;  3WTW C;  3RZD J;  4UUT A;  1JGG A;  2W57 A;  2MD5 A;  3D5S C;  1IO2 A;  4RDU A;  2DT5 A;  4ZTJ A;  1YTY A;  3J7Y J;  2Q0O A;  5EF6 A;  1WWX A;  1WH7 A;  1TP4 A;  4V19 K;  3W2A A;  1S3J A;  4M9S A;  4L9J A;  5LHG A;  4EV0 A;  5D5U B;  1MGT A;  4CCO A;  3HOU J;  1I1G A;  2ELH A;  3D0S A;  1AU7 A;  2M87 A;  4O5V A;  1FOK A;  3S3O A;  1VTN C;  2LF7 A;  1T98 A;  4XLA A;  2L7M P;  3OIP A;  3N4M A;  4FT8 A;  4U7B A;  3L7W A;  3GME A;  2R5Z B;  2DFH A;  2KKO A;  2DA3 A;  2XVC A;  2Z33 A;  2QKL B;  4C2T A;  2AXL A;  5AIQ A;  2HQN A;  3IP4 B;  2LR8 A;  5D5V B;  3KYD B;  3K70 D;  3G73 A;  1FLI A;  4B4C A;  2V1U A;  1TZL A;  2WB1 N;  1R1V A;  4O3M A;  2KRH A;  3ONQ A;  4DNC A;  3HGG A;  1IAW A;  2HTJ A;  1ZYR F;  1BOB A;  2LY2 A;  4HF1 A;  3GZN B;  2GOM A;  3WGH A;  3ZQC A;  5E1W A;  3BZK A;  3FXU A;  3C18 A;  3MZY A;  3DTK A;  1IRG A;  1Y8R B;  1LJ9 A;  1XD7 A;  5B66 C;  1MW7 A;  1XGS A;  4GCV A;  3OYH A;  1FYL A;  1CF7 A;  5JVT A;  1F43 A;  3JRD A;  5EYR A;  4ZJZ A;  4E7L A;  1PUE E;  3JW4 A;  2LFB A;  4ABZ A;  2R7X A;  1BBY A;  3JRE A;  4EGY A;  2GBY A;  1WQ2 A;  3EUK L;  3GBG A;  1FIA A;  1FMW A;  4XRF A;  2XKP A;  4G6Q A;  3LA3 A;  1JT6 A;  5K7F A;  1K83 J;  3DLL F;  1IGN A;  2NVX J;  2OV7 A;  3K4N A;  3I58 A;  4XLH A;  1WZ2 A;  3F8F A;  1ZH5 A;  3V42 A;  2AQF A;  3ABT A;  5E8G A;  1I50 J;  4XBF A;  3N05 A;  4AWX B;  1WJE A;  5HNH A;  2VOD A;  1IXC A;  3GWZ A;  4PZJ A;  3PIP F;  4LIT A;  3QU3 A;  1PYV A;  1DGR M;  3DPT A;  3LMM A;  3GTP J;  4G7H F;  1R9T J;  2L7F P;  3RYP A;  3WE2 A;  1VQ9 I;  1J75 A;  4IKF A;  4X1E A;  1LE8 B;  3SXY A;  1Z7U A;  5CVR A;  3DLA A;  3U1D A;  1A36 A;  3MZ8 A;  1MNE A;  3EUA A;  4MTE A;  1ZRD A;  1C0W A;  1IUF A;  1P9Q C;  4O6J A;  5L3B A;  3BR6 A;  2RRE A;  3WU1 B;  4C2U A;  2NS7 A;  3DWL E;  4RLF A;  3FBN B;  1IV6 A;  1H8A C;  2PQ8 A;  3HZJ A;  5D8L B;  3OYC A;  3ZPL A;  2V26 A;  1U8B A;  3G1O A;  3V8J A;  3K1N A;  2JK3 A;  4A0X A;  2H8W A;  5B1B H;  2HQA A;  4AC0 A;  4KFC A;  1HBX G;  9ANT A;  3I9V 2;  3HPG A;  4BS9 A;  2M7B A;  5DCF A;  3GW2 A;  2WAF A;  2CUZ A;  1S6L A;  3HOT A;  3C2H A;  3G4S I;  3U2R A;  2VPR A;  2FNA A;  4HW0 A;  4HAM A;  5BNG A;  3BR1 A;  2HOS A;  2I8D A;  1ONV A;  3G1L A;  4ENK A;  2H6B A;  2FBH A;  4UVB A;  4II2 A;  5JLW A;  2H09 A;  1EA3 A;  5FGM A;  3BC8 A;  2LYC A;  1JJ8 C;  1UCR A;  2PEX A;  2L9V A;  2XIG A;  4WK8 F;  5LRS A;  1VQL I;  1F4K A;  1RPW A;  5B3S H;  5K5Q A;  1ZLJ A;  5DUI A;  4GDF A;  4HYE A;  2EB7 A;  1PP7 U;  1XCV A;  1OIS A;  1FY7 A;  1Y0N A;  2LG4 A;  4HF0 A;  4LLG F;  4B09 A;  1GVJ A;  2WV0 A;  1OYY A;  4IZZ A;  2NVT J;  3GTK J;  1YRN A;  3PM1 A;  2UXN A;  1M1E B;  2Q8K A;  2N8G A;  3EQL F;  1MBG A;  3F6V A;  1YS6 A;  1A35 A;  4AIH A;  3A02 A;  3HOS A;  1K79 A;  3CES A;  2XAJ A;  2FQ4 A;  3CCM I;  3AG1 H;  1Y1V J;  4HX8 A;  1RNL A;  1I27 A;  4HDU A;  1YX5 A;  3H9G A;  4BBR J;  2DU9 A;  1MH3 A;  2BY2 A;  5KVR A;  4LLL A;  4OMY A;  2M0C A;  5LRR A;  1QHG A;  4IHS A;  5M5X J;  4PGH A;  2ECC A;  2FOK A;  4ESB A;  2X9D A;  4HLX A;  1QGP A;  2LOO A;  1SVL A;  3BJO A;  4RB2 C;  1LFP A;  1U5T A;  3A2K A;  4X6A J;  5D6E A;  4A3L J;  2BGC A;  3H36 A;  2BW3 B;  1MDM A;  3QWL A;  2ZO4 A;  5FRO A;  5F08 A;  4EGZ A;  2QSH X;  2J5P A;  2JA7 J;  4II3 A;  3M8E A;  3CCE I;  2QEN A;  2M8E A;  4QPQ A;  3S2H J;  3L00 A;  1R23 A;  3HUG A;  3FK6 A;  2XRO A;  1W7P B;  5DV5 A;  2DAO A;  3PL8 A;  4MNU A;  4BHP A;  2CQ7 A;  5CLS A;  5IT3 A;  4A3D J;  2PMH A;  2DYR H;  1T8I A;  5EJC A;  4Y7N J;  3LL7 A;  2XAG A;  1HSJ A;  3ZR8 X;  4C3I J;  5LLQ A;  1QA6 A;  4KIS A;  3T8T A;  2XPU A;  4U7D A;  5LGT A;  2JWT A;  3A0H C;  4XNF A;  1OPC A;  5E3L A;  3WHC A;  5JHU A;  2R3S A;  1H9G A;  3V7C A;  3IC7 A;  2BY1 A;  2MD0 A;  1FBS A;  5IP6 A;  1DQU A;  5F0F A;  5GPA A;  1ULY A;  3M4O J;  4BHC A;  4EEF G;  1FC3 A;  3DP7 A;  2COB A;  1ZG3 A;  4HG2 A;  5JFR A;  5JLX A;  3KP4 A;  2F6C A;  1D3Y A;  4ZH4 F;  3BDD A;  3QU6 A;  4G6T B;  2F4I A;  1YJN I;  4HQE A;  1Z1D A;  3OIO A;  4HNT A;  3E6C C;  4S04 A;  5FLM J;  4BQA A;  1P7J A;  2HVS A;  2JPB A;  3R61 A;  4E7J A;  2RQQ A;  1NTC A;  1TT0 A;  5J8C A;  5GP9 A;  1YW7 A;  2ISZ A;  2MA3 A;  3KLO A;  5IPA A;  5M3M J;  4KNY A;  3DXJ F;  1Y39 A;  2ZME C;  2QVO A;  3BP8 A;  4HBL A;  3WTS C;  2A6H F;  1E0E A;  4PUS A;  3CME I;  3MQ0 A;  1TW2 A;  3NWS A;  1E2X A;  4AID A;  2EFP A;  3W2W A;  2VON A;  4RAF A;  2ZFU A;  2Y0S N;  2KMU A;  2ME6 A;  1G3S A;  2DDB A;  3E5Q A;  2FF4 A;  2JUC A;  2DJI A;  1I6X A;  2DOF A;  3BTC A;  2ESN A;  4XOP A;  2KRF A;  1V55 H;  4KIB A;  3REO A;  2LH9 A;  1E3H A;  5HDK A;  4MGR A;  1D8K A;  1ON2 A;  1WHU A;  4LGW A;  3FX3 A;  1D1B A;  1P2F A;  2OU2 A;  3KP7 A;  3FF5 A;  5A2Q Z;  2VJ4 A;  2F5E A;  3TQN A;  2F2E A;  3BOQ A;  4LMY A;  2V1D A;  1W0T A;  4CXF A;  4LG3 A;  3PNY A;  3EUH A;  2TCT A;  3TGN A;  1HW2 A;  2HWV A;  5FLX Z;  3ZCO A;  2DJN A;  2Y2Z A;  1OYI A;  4XK4 A;  3KLN A;  4AM3 A;  1XG1 A;  3P9I A;  1LPQ A;  3CUQ C;  3WGI A;  4Y52 J;  1QHH D;  3KPH A;  4CCN A;  1DDN A;  1TQI A;  4DBR A;  5H2F C;  2NS0 A;  3BRO A;  1V5E A;  2OUM A;  4ZYD A;  4EJO A;  4I01 A;  2XB5 A;  4CCJ A;  2E71 A;  2IGN A;  5JI6 A;  5TIS C;  2ZB9 A;  4HA8 A;  1RIO H;  1KGS A;  5ILV A;  4FCY A;  1W36 C;  4HOB A;  1H0M A;  5TGT A;  2ID3 A;  1FWZ A;  3H0G J;  1CF7 B;  3JRI A;  2XPV A;  1KU7 A;  2JVG A;  2MYS A;  3V8K A;  3H1C A;  4XN0 A;  3DQV C;  5IOY A;  3KEY A;  3VPR A;  1XGN A;  3LSP A;  1W0U A;  2CH0 A;  4JX4 A;  3GZ5 A;  3CCL I;  4AIK A;  1HKQ A;  1TW3 A;  1OQY A;  4BQO A;  4XIC A;  4RMN A;  4WXH A;  4WWC A;  2K40 A;  1AWC A;  2XF6 A;  1V4R A;  4LJZ F;  2BHZ A;  3ZQ7 A;  4U0Y A;  4KIG A;  3ISP A;  3IRQ A;  1IJW C;  4EAT A;  3LAP A;  1I39 A;  3KP2 A;  1Z3Y A;  4RAG A;  1MMN A;  1D0X A;  4CH7 A;  4Y13 A;  2R7T A;  1N78 A;  5E17 F;  3MVP A;  2IXS A;  3O3K A;  4UXN A;  5HNF A;  4AYB A;  1P92 A;  3U1K A;  1ZTR A;  5EEA A;  3SZT A;  3DF8 A;  2LY9 A;  1VQ7 I;  2QSG X;  2Z5U A;  4KMU X;  2CWE A;  4PJL A;  4FX4 A;  2EA2 A;  4A3M J;  2CV0 A;  5M3F J;  3F9K A;  4I6Z A;  2IEK A;  2NOG A;  1O3Q A;  1ENH A;  1TNS A;  4WXD A;  3AAF A;  2E36 A;  2G7U A;  2DN0 A;  3DEU A;  4U88 A;  2YR2 A;  4XLN F;  3SQN A;  3HOX J;  2A68 F;  2GA2 A;  2A6E F;  5FRM A;  1GXQ A;  4OIN F;  1H88 C;  3ZMV A;  1EKE A;  4OIQ F;  5DM7 F;  2HI3 A;  4HPQ A;  5H20 A;  3K70 C;  2LDU A;  1B6A A;  5H6Q A;  3H35 A;  1WPK A;  5D5X B;  1R5H A;  2QSF X;  5B5E C;  4BL0 B;  2X6O A;  2X1D A;  2WTE A;  4Y4R A;  2VUM J;  2DA2 A;  1BJZ A;  3ERM A;  2VOP A;  1ETW A;  3KIO A;  2VQG A;  2B9S A;  1OLT A;  1XMA A;  2OQG A;  1ZN2 A;  2VJ5 A;  2ZJP F;  2H6C A;  3ZQG A;  4KMF A;  5IP9 J;  1KQ9 A;  3SEQ A;  2K4J A;  2XKO A;  2LRD A;  4BYY A;  2OJE D;  2KJC A;  5CQG A;  1UHM A;  3JSO A;  1YRN B;  1ORK A;  2LD5 A;  2DTZ A;  4NQW A;  2YU3 A;  3S1M J;  2MAB A;  1G59 A;  3HRM A;  2G7H A;  3CJQ B;  3Q0U A;  4M3B A;  2GWR A;  3B6A A;  1BI3 A;  4BUP A;  1OFC X;  2OZU A;  1DGW Y;  1OMI A;  2Y48 A;  1IXS B;  4KJZ A;  3R4K A;  5GAE J;  1LNW A;  1D5V A;  3W2V A;  1LFU P;  3E6D A;  3F3X A;  5BMZ A;  2FQ3 A;  5LBQ A;  2F5F A;  1MKM A;  2FMY A;  3HL2 A;  2V9P A;  1FSH A;  4PFO A;  4OMZ A;  3MCZ A;  4C2M J;  3GTG J;  3PO2 J;  4MFD A;  3CCV I;  3NEU A;  2CMP A;  2MH2 A;  1W7P D;  4JOM A;  1BIB A;  2LRE A;  1J59 A;  1XN7 A;  3JAM K;  3OYD A;  5ICG A;  1ZQ3 P;  2CS3 A;  1YIT I;  2E1O A;  3I56 I;  3S2D J;  1SD7 A;  5JVG F;  1MDM B;  2KRC A;  3HRS A;  1JJ6 C;  1I3Q J;  3FK7 A;  2D5V A;  2VAS A;  1D5Y A;  1T0F C;  4NC8 A;  1RZ4 A;  4YII A;  4B1R A;  4I0A A;  4QIW N;  1K78 A;  5CPR B;  3E7L A;  3KEO A;  3W3C A;  1U3E M;  4I99 C;  4KYW A;  3KP5 A;  1QNT A;  1R49 A;  3WG9 A;  4BY7 J;  2F5D A;  2GZW A;  1RET A;  2JMW A;  2K85 A;  4J01 A;  5JR3 A;  2E35 A;  1X2N A;  3BTI A;  1D1C A;  4DW6 A;  1ZR4 A;  1YG2 A;  3F8C A;  3OS0 A;  4UNO A;  2RNJ A;  2XGE A;  4ETS A;  1FBQ A;  2CW7 A;  3ERE D;  1UB9 A;  3HKZ A;  3VSL A;  4N4O B;  3RI4 A;  1VZ0 A;  2F5C A;  3VSK A;  4UVA A;  3HEF A;  4CDG A;  4AIJ A;  2K9L A;  2M7A A;  3WTX C;  4HV6 A;  3C7J A;  1KON A;  4XL9 A;  2QM3 A;  2PI0 A;  3HOV J;  4M6V A;  4MTD A;  2EWN A;  4OIP F;  1LDK B;  1RUN A;  4I2O A;  2OC6 A;  2YPR A;  1FTZ A;  1T38 A;  2MSY A;  1IN6 A;  4GGG A;  1Y8Q B;  3LA7 A;  2HZT A;  1BI0 A;  1O3R A;  3CO7 C;  3BR3 A;  2CW8 A;  3Q9S A;  4G94 A;  1B4A A;  1N77 A;  1JKQ C;  1OCO H;  1SMT A;  2VXD A;  1R4N B;  3WU0 A;  1JTX A;  1BR2 A;  4KIC A;  2AQE A;  2M34 A;  5HVQ C;  1VQ6 I;  1R5I D;  1TBX A;  3WTV C;  3A01 A;  3M8J A;  2W7N A;  3TP0 A;  1OR7 A;  1UJ8 A;  3QP6 A;  3F6O A;  1W5S A;  3R60 A;  1NG7 A;  2M4G A;  3BR2 A;  4D0P A;  4ITV A;  1K4S A;  2Y0M A;  1AKH B;  3VYU B;  2MH9 A;  5L3D A;  2M1B A;  3LFK A;  2PJP A;  1YO5 C;  4DBQ A;  3RQ4 A;  1EH7 A;  4A3K J;  2XRN A;  3I59 A;  4E6K G;  4H4K C;  4CHU A;  1S7O A;  1TWG J;  1I5Z A;  1X3Z B;  3PNT A;  3LSJ A;  1FJL A;  2LTP A;  2P6T A;  5HLG A;  1R71 A;  2GOX B;  3K7A J;  1G2H A;  2W85 A;  3BG7 A;  5B1A H;  2P7C B;  2HXI A;  3FHN A;  2HDD A;  5IT9 K;  3K6G A;  3CDI A;  3RPU A;  2W1O A;  2EIN H;  3BY6 A;  4N0B A;  5DM6 F;  3H9J A;  1QBJ A;  3HB9 A;  4N4N B;  1YHQ I;  5EG0 A;  1IZ1 A;  3GUD A;  4I98 B;  4BH9 A;  2EV5 A;  4WXC A;  1JXS A;  4PK4 A;  3SEZ A;  2JSP A;  2PN6 A;  2IGK A;  2BVM A;  3T5X A;  4BQQ A;  3SHF A;  3AFH A;  1N25 A;  1I6H J;  1XCB A;  2YUS A;  4ANJ A;  2DQR A;  2XF5 A;  4E7S A;  1QZY A;  2L02 A;  2O8K A;  3E97 A;  4H0E A;  2HYF A;  5F64 A;  4D1Q A;  2BVL A;  2NNY A;  4IHT A;  1LEB A;  2HTS A;  1R6R A;  2IW5 A;  3TDZ C;  2VXZ A;  4DYQ A;  2CQQ A;  4NC7 A;  3B6C A;  1ITY A;  3BJA A;  1GDT A;  1O7F A;  3TDU C;  2KIF A;  2VKV A;  1HC8 A;  1SFU A;  3CCY A;  3DPL C;  1CGP A;  1HST A;  2JA8 J;  4G7O F;  1LQ1 A;  2DXI A;  2L2O A;  4LOC A;  2QYO A;  3BCA A;  1X19 A;  3F8M A;  2LVS A;  2RGV A;  4LB6 B;  2D1V A;  4FIS A;  2WAQ N;  1WKM A;  1HF0 A;  3TMO A;  2IGO A;  2JZY A;  5LGN A;  1QU3 A;  4PJM A;  3ZGK A;  4P55 A;  5E79 C;  1ZRE A;  1I1S A;  1IF1 A;  4MQV A;  3SZG A;  1FT9 A;  3KP6 A;  2DFI A;  3AG2 H;  2FJ1 A;  1S9H A;  4XLC A;  1HLV A;  5CYV A;  2HQR A;  4HDV A;  2IS6 A;  4RB1 A;  4EVI A;  4CCL A;  2IBD A;  1Z77 A;  4F93 B;  4IRG A;  4XLP F;  1FSE A;  4RGU A;  2D2W A;  1OCC H;  4ZYH A;  2W48 A;  2COM A;  1EH8 A;  2ZNZ A;  3OY9 A;  2O6G E;  5C3E J;  2A6T A;  4HNV A;  2L7Z A;  3RJP A;  1X1P A;  5EGO B;  5BOX A;  1TL8 A;  3OL4 A;  5FRN A;  3CUQ A;  3DU6 A;  4MO7 A;  2BZT A;  1K7A A;  2FML A;  4XN3 A;  2L7K A;  2W4S A;  1Z67 A;  3A03 A;  3F8B A;  3FXL A;  2PMU A;  4HSR A;  1XDS A;  4CYD A;  4EJW A;  4A3G J;  2K9M A;  2A07 F;  3GTQ J;  1WH5 A;  2XDV A;  3FWE A;  2V1N A;  2W24 A;  2FOW A;  1FYK A;  2VBY A;  2ZXI A;  3I55 I;  4IHX A;  1UHS A;  4QTR A;  2ESH A;  3I4M J;  3OYE A;  1MMA A;  3L09 A;  4G7Z F;  4IL6 C;  1B59 A;  1TT5 B;  2DCE A;  4M3E A;  4X0G A;  4XSZ F;  3SZP A;  3K9T A;  4DJA A;  1U2W A;  4OU0 A;  3VOE A;  2WBM A;  3C2B A;  3NWT A;  4XON A;  4WCG A;  2C6Y A;  4CCK A;  4NQW B;  4ZZL A;  1OCR H;  1XTA A;  3VWB A;  3R0J A;  3E6M A;  1QPM A;  1QZZ A;  3I0T A;  2OZ6 A;  2WC2 A;  2M2E A;  3WE3 A;  3H5N A;  2ZSI B;  4E7I A;  1ZK8 A;  2QBY A;  1P6R A;  4PSX A;  1RR7 A;  3L2V A;  4V2G A;  4UY8 I;  5F1R A;  3ZN0 A;  5J4V A;  1LUJ B;  2KDO A;  3FM3 A;  1ZHF A;  2PMZ N;  3O2P E;  4U0W A;  2V4J C;  3GFI A;  1ZRF A;  3TW6 A;  2ACJ A;  3DEE A;  1Q1H A;  2UZK A;  1GV5 A;  1STZ A;  4KIT B;  2KL4 A;  5CVJ A;  5K5R A;  3DU5 A;  2HFH A;  3CLQ A;  1K78 B;  5AIP A;  5JHF A;  2HVQ A;  5HLH A;  3GYH X;  1ZAO A;  3LSH A;  3OOP A;  1SFK A;  4Z6Y A;  2IRF G;  4L5I A;  3KEQ A;  5KHD A;  2PX9 A;  1WJA A;  4PFP A;  5D4S A;  4AUX A;  3WG7 H;  1B8I A;  2FSW A;  2BE5 F;  1RR8 C;  3HSF A;  3O8H A;  1IDY A;  1ZR2 A;  1IC8 A;  2V6E A;  4GYG A;  3OOU A;  2A5Y B;  3RKQ A;  2A69 F;  2LKP A;  2FBK A;  1Z91 A;  2KHM A;  2FU4 A;  1NH3 A;  1X3U A;  2JSC A;  1H9T A;  4OOI A;  1YW8 A;  3CDL A;  3HSR A;  5DD4 A;  5IYC J;  1D8J A;  4XKB A;  1U9O A;  3X2Q H; 
#chains in the Genus database with same CATH homology
 2PBI A;  5DYM A;  3GEZ A;  4ESJ A;  2O8X A;  3G3Z A;  4P96 A;  1U78 A;  2HGC A;  1FBU A;  1Z6R A;  4LLN A;  1U6G A;  4EJT A;  2CYY A;  1AOY A;  1S29 A;  2STT A;  2EV0 A;  5FFX A;  3GO5 A;  3JAM Z;  1KYZ A;  3E3V A;  3KET A;  2VC1 A;  1XDU A;  2ZFW A;  3I59 B;  4E70 A;  2GIV A;  1T0F A;  4YFX F;  4B8X A;  2LF8 A;  2QLZ A;  3M1E A;  3WTU C;  3GX4 X;  2VBX A;  4CGZ A;  3V7S A;  4KIF A;  4RGR A;  2EJR A;  1PP8 F;  2D1H A;  4LG0 A;  1E17 A;  5ILU A;  4K2E A;  1ZG5 A;  2VC0 A;  3FM5 A;  3J7A O;  4I0B A;  4RGX A;  3TO7 A;  3EYI A;  1KU9 A;  3RDI A;  2IP2 A;  3M9A A;  1K6O A;  1BOA A;  5L3E A;  1EV7 A;  4NB5 A;  5CVU A;  3HHH A;  1SFX A;  3V4G A;  3COA C;  1ZGA A;  2OBP A;  1B1B A;  3CUO A;  4MEX F;  2P5L C;  2RKH A;  3I64 A;  4M9X A;  3E5X A;  1SAX A;  4BXU A;  4Q4Z F;  1RUO A;  3NRV A;  4KDP A;  2ZJ2 A;  5IT9 Z;  1YLF A;  2QQ9 A;  4EM0 B;  1Z9C A;  3GFM A;  1R36 A;  2EK5 A;  2GXG A;  5L3C A;  2K86 A;  4LD5 A;  3P7N A;  4UV8 A;  5L3F A;  2NYX A;  2VOO A;  1GXP A;  3CUQ B;  3ZMS A;  1BJA A;  2XHK A;  2IT0 A;  3P9K A;  5E8I A;  2DLL A;  1IN8 A;  4YG2 F;  4UHT A;  3QPH A;  2ADU A;  3HRU A;  1O57 A;  3PQK A;  3DKW A;  1TLH B;  5J6X A;  3I4P A;  1MD0 A;  2Y75 A;  2V6C A;  3CTA A;  1OKR A;  2XV4 S;  4LFU A;  5K1Y A;  1NHA A;  3E6B A;  2LNB A;  2GA1 A;  2MLG A;  2L4A A;  1IW7 F;  1YW9 A;  4M6Y A;  4EMS A;  2H94 A;  4ON0 A;  4PDK A;  1XSV A;  2QQB A;  3TKY A;  1SFE A;  1R58 A;  3RPQ A;  5D4R A;  2QBY B;  2OA4 A;  2PFB A;  4AD9 A;  1SD6 A;  5D6F A;  3FMS A;  3ZMT A;  4GYI A;  2UWM A;  2P5K A;  2CO5 A;  1O3T A;  3IRR A;  2DW4 A;  4M73 A;  4BHB A;  2TDX A;  1ON1 A;  1MJB A;  2Q2E A;  4QWQ A;  4MQ9 F;  1TQM A;  3KZY A;  1UHW A;  2HOE A;  3RKX A;  3BPX A;  1G4D A;  1R22 A;  3GVA A;  2QUF A;  5FB2 A;  1ZG1 A;  3V7R A;  4A2U A;  3ECO A;  3IHU A;  4R1H A;  1FNN A;  2D45 A;  4R8H A;  4M6X A;  4A5N A;  3JSP A;  3KFW X;  1HXD A;  3GLX A;  4IVN A;  1G3Y A;  2E7X A;  1KU2 A;  4PGG A;  1T39 A;  3FXR A;  2NRA C;  5TRD A;  5AON A;  3K1M A;  1TTY A;  2E7W A;  3BJ6 A;  5E1X A;  2XAF A;  1RI7 A;  3D5L A;  4XSX F;  1KQ8 A;  1U5T C;  2ZBK A;  1BIA A;  2ISY A;  1BM9 A;  3VOD A;  4KN7 X;  4U0V A;  4HX4 A;  3KZZ A;  3ELK A;  3MWM A;  1YIO A;  3IKV A;  4I09 A;  4HX7 A;  2MC3 A;  2MBF A;  3T0Y A;  2DK5 A;  4RGS A;  3Q5F A;  4LG0 B;  2R7F A;  4A6E A;  1HKT A;  3DV8 A;  4L0Y B;  3MAJ A;  1R1T A;  2PLY A;  1BN5 A;  2XAQ A;  4R79 A;  1WI9 A;  2EV6 A;  1BI2 A;  2QQA A;  5FO5 A;  3GFL A;  4EM2 A;  3EET A;  1F5T A;  1J0R A;  2B0L A;  2KIM A;  5ED4 A;  4A0Z A;  1YS7 A;  3BWG A;  1DPR A;  4Q5S F;  2RDP A;  4HQM A;  2KJB A;  4G9Y A;  2HKO A;  5BS6 A;  3F22 A;  1GHC A;  4OIO F;  2FA5 A;  2DBB A;  1KQ0 A;  3LAJ A;  3TOA A;  1L0O C;  1P4A A;  3B73 A;  3BPV A;  1MJ9 A;  2GXB A;  1IN5 A;  2X4H A;  4RB0 A;  3U9G A;  2STW A;  5KK1 A;  1FP1 D;  1FP2 A;  1S7A A;  1BI1 A;  1IUY A;  1G6N A;  2QZ8 A;  1ZLK A;  4CIC A;  1W4M A;  5FLX K;  3JTH A;  3V8L A;  4HV5 A;  4EM1 A;  2W84 A;  2YX7 A;  4Z2Y A;  1S8N A;  1R1U A;  2BBY A;  4BNC A;  5HS7 A;  3Q9V A;  5DCM B;  1R00 A;  4CZZ A;  4CO8 A;  2X0L A;  3ROU A;  4EQQ A;  4M71 A;  2OD5 A;  2ZME A;  3KE2 A;  1DUX C;  2ZCW A;  4I7H A;  1XMK A;  2ZKZ A;  2JTV A;  3FXQ A;  4MHG A;  4Q47 A;  2L3D A;  3WOD F;  1IXR C;  2FEZ A;  4ASN A;  4HLY A;  3CO6 C;  5LGU A;  1T2K A;  3W6J B;  5HDG A;  5BQT A;  1Z05 A;  1R7J A;  1USS A;  3RTR A;  1J9I A;  2L01 A;  1REP C;  3NQO A;  4I02 A;  5BPI A;  4M72 A;  4M74 A;  3H92 A;  2FBI A;  2K02 A;  5D5W B;  3C3W A;  4S05 A;  3ABU A;  4IRH A;  2G9W A;  2V9V A;  3J80 K;  4L5J A;  4UUV A;  3LA2 A;  4A5M A;  5HOO A;  2ZXJ A;  4G8X A;  2L4M A;  2ETH A;  3IWF A;  1F9N A;  1ZGJ A;  1KU3 A;  3FMR A;  3ZN1 A;  5EEH A;  1TQP A;  2JPC A;  4IRI A;  2YSR A;  1FPQ A;  3WTZ A;  3KP3 A;  1FYM A;  3HRT A;  3K69 A;  1WRJ A;  2FXA A;  1KYW A;  4UVC A;  2O0Y A;  3LST A;  4FX0 A;  1EH6 A;  2QWW A;  3WTY C;  4WX9 A;  5CJ9 A;  4ZYG A;  2M5W A;  2H27 A;  1XGM A;  3P9C A;  4Y15 A;  1BC7 C;  4ENM A;  1BC8 C;  5ILS A;  4NHJ A;  3FZV A;  3R0A A;  2VE8 A;  3QAH A;  4EJU A;  3FHZ A;  4AVP A;  1T6S A;  2DI3 A;  2CSO A;  2YX4 A;  2A61 A;  2K7L A;  2DPU A;  2RQP A;  2V1X A;  1LDJ A;  3ECH A;  1JHF A;  3QOP A;  2CFX A;  1HQC A;  1ODD A;  2P4W A;  2DO7 A;  1ZRC A;  5F6F A;  5FD6 A;  1LDD A;  3E5U A;  5E1Z B;  1R5G A;  5L3G A;  4L9T A;  1XSD A;  3J81 K;  2IPQ X;  1SD4 A;  3W6K B;  4GXO A;  2EFW A;  5ICC A;  4IXA A;  3HYI A;  1MZB A;  2Z99 A;  2CG4 A;  3LQQ A;  3MFK A;  3HSE A;  1IRF A;  3HTS B;  5TJJ A;  2DK8 A;  3GF2 A;  4P5O A;  1J5Y A;  2NAZ A;  4JQF A;  1G3W A;  2VN2 A;  2IJL A;  5LHI A;  5BPD A;  2FRH A;  3JTG A;  5FFZ A;  2OAZ A;  2BYV E;  5LEK A;  1YQA A;  5FD5 A;  1YYV A;  3F72 A;  4IJA A;  2E1C A;  4RB3 C;  3HTU A;  2DQL A;  1PDN C;  2OQR A;  3ULQ B;  1ZAR A;  3K0L A;  3QRF F;  3ML6 A;  3VB2 A;  2RC4 A;  3VFZ A;  4LB5 A;  2HR3 A;  2CQK A;  4RAZ A;  2ZME B;  4HZF A;  1P4W A;  2HDC A;  2W25 A;  1HW5 A;  3FMQ A;  5ICF A;  3EYY A;  3LQR A;  3S2W A;  3LWF A;  1JGS A;  1O3S A;  5DUK A;  1F1Z A;  4IPA A;  1IN7 A;  4FHT A;  3HIF A;  5DEQ A;  2BV6 A;  4KA4 A;  1G3T A;  4EJV A;  3TOB A;  3KCC A;  1UST A;  1HW1 A;  2RVC A;  1LEA A;  2EA4 A;  3O6B B;  4KN4 X;  3PFI A;  3RKW A;  5HS8 A;  4DQ2 A;  5ERI A;  5DCM A;  4UV9 A;  1V3F A;  4L9N A;  4KT5 C;  1W5T A;  2HYG D;  3TO6 A;  1WSU A;  3I53 A;  3M7G A;  2A3S A;  4BAY A;  2HKX A;  4A6D A;  2VBZ A;  1A04 A;  3H3U A;  2K4B A;  3ZP5 A;  2M30 A;  4JBA A;  2UXX A;  3VEP A;  5EEG A;  3QP5 A;  2EFO A;  4JK1 X;  2ZNY A;  4L9V A;  2XUB A;  2O61 A;  4ENJ A;  3T1B A;  2HS5 A;  2E1N A;  1OYW A;  2RV8 A;  2BEO A;  1LB2 A;  2XAH A;  5DDG A;  1SMY F;  2L54 A;  3BZ6 A;  3I71 A;  1J2X A;  3N97 A;  2VT3 A;  5E20 A;  4ZYE A;  3RKY A;  5J8F A;  1KA8 A;  3IL2 A;  2VBW A;  4IF4 A;  1B9N A;  4GO1 A;  4RAY A;  1SD5 A;  2VE9 A;  4L0Z B;  3HHG A;  2XAS A;  3RYR A;  3EDP A;  3R6S A;  2Z3Y A;  4N9I A;  2O03 A;  2MLK A;  3J80 Z;  3QPT A;  2R7D A;  2PG4 A;  2P7V B;  4KUM A;  5LHH A;  2JRT A;  4P9F A;  4PCQ A;  4MEY F;  3M8F A;  2P8T A;  4ESF A;  3CLO A;  3F8N A;  3ZMZ A;  1MJA A;  3ZMU A;  2DTR A;  3F21 A;  3OV8 A;  2Z9O A;  5CVI A;  1J7K A;  1DPU A;  5H6R A;  4QLC U;  1JE8 A;  3GFJ A;  3DFG A;  2WWY A;  2P5V A;  3ZMD A;  2P6S A;  1FZP B;  2FE3 A;  3C1D A;  5HDN A;  1U5T B;  1IN4 A;  3CDH A;  3F23 A;  4M9Z A;  2J5O A;  2NNN A;  4OIR F;  2FNP A;  1DP7 P;  1YFH A;  1QQI A;  3IWZ A;  2EFQ A;  4YIF A;  3B02 A;  4Q48 A;  6PAX A;  2IVM A;  3H3Z A;  2GAU A;  4TV7 A;  1L3L A;  1UFM A;  1FX7 A;  2IA1 A;  4WF2 A;  2IA0 A;  5CVV A;  4Y17 A;  4ENN A;  1XSX A;  5D8K B;  4L18 B;  2GQQ A;  4YFN F;  1TNT A;  3J81 Z;  1U8R A;  3GXO A;  1O7L A;  3L9F A;  3RIR A;  4A12 A;  1XGO A;  2CGP A;  5HLI A;  4A0Y A;  3WTT C;  4HF2 A;  1Y0U A;  2DPD A;  2CW0 F;  4LK0 F;  3I5U A;  5HS9 A;  2KIU A;  1P4X A;  3SFZ A;  2K27 A;  2M45 A;  4LK1 F;  2O3F A;  3L2C A;  3TO9 A;  2IA2 A;  1LVA A;  1JHH A;  5K5O A;  1W7P A;  3WGG A;  3MEX A;  5A2Q K;  4P9U A;  4N9H A;  3IKT A;  3K2Z A;  3CJN A;  3MZH A;  4ZZD A;  2JT1 A;  4F7Z A;  3PQJ A;  5DD8 A;  2HEO A;  2XGX A;  2LSO A;  2V79 A;  3K1P A;  4RS8 A;  5ICE A;  3GZ6 A;  2VT2 A;  3T8R A;  1HKS A;  1XB4 A;  2RN7 A;  1B9M A;  2EFN A;  4YFK F;  2AS5 F;  5LEJ A;  1Z6T A;  4G6D A;  1QO0 D;  5E18 F;  3I54 A;  3WTW C;  2W57 A;  2MD5 A;  2DT5 A;  1YTY A;  2Q0O A;  1WWX A;  1S3J A;  4M9S A;  4L9J A;  5LHG A;  4EV0 A;  5D5U B;  1MGT A;  1I1G A;  2ELH A;  3D0S A;  2M87 A;  4O5V A;  1FOK A;  1VTN C;  2LF7 A;  1T98 A;  3N4M A;  4FT8 A;  4U7B A;  3L7W A;  2KKO A;  2XVC A;  2Z33 A;  2AXL A;  5AIQ A;  2HQN A;  5D5V B;  3G73 A;  1FLI A;  2V1U A;  1R1V A;  4O3M A;  4DNC A;  1IAW A;  2HTJ A;  1ZYR F;  4HF1 A;  3WGH A;  5E1W A;  3FXU A;  3C18 A;  3MZY A;  1IRG A;  1LJ9 A;  1XD7 A;  1XGS A;  4GCV A;  1FYL A;  1CF7 A;  5JVT A;  1PUE E;  3JW4 A;  1BBY A;  4EGY A;  1WQ2 A;  4XRF A;  2XKP A;  4G6Q A;  3LA3 A;  3I58 A;  3F8F A;  1ZH5 A;  3ABT A;  5E8G A;  4XBF A;  4AWX B;  2VOD A;  1IXC A;  3GWZ A;  4PZJ A;  3QU3 A;  3DPT A;  4G7H F;  3RYP A;  3WE2 A;  1J75 A;  3SXY A;  1Z7U A;  5CVR A;  3U1D A;  4MTE A;  1ZRD A;  1C0W A;  4O6J A;  5L3B A;  3WU1 B;  2PQ8 A;  5D8L B;  3ZPL A;  3V8J A;  3K1N A;  4A0X A;  4KFC A;  1HBX G;  5DCF A;  3GW2 A;  1S6L A;  3HOT A;  3U2R A;  2FNA A;  4HW0 A;  4HAM A;  4ENK A;  1ONV A;  2H6B A;  2FBH A;  4UVB A;  2H09 A;  5FGM A;  1UCR A;  2PEX A;  2XIG A;  4WK8 F;  5LRS A;  1F4K A;  5K5Q A;  1ZLJ A;  5DUI A;  4HYE A;  2EB7 A;  1PP7 U;  1XCV A;  1FY7 A;  4LLG F;  4HF0 A;  4B09 A;  1GVJ A;  2WV0 A;  1OYY A;  2UXN A;  2Q8K A;  3EQL F;  3F6V A;  1YS6 A;  4AIH A;  3HOS A;  1K79 A;  2XAJ A;  4HX8 A;  1I27 A;  1RNL A;  4HDU A;  2DU9 A;  5KVR A;  4OMY A;  4LLL A;  5LRR A;  4IHS A;  4PGH A;  2FOK A;  4ESB A;  4HLX A;  1QGP A;  3BJO A;  4RB2 C;  1U5T A;  5D6E A;  2BGC A;  1MDM A;  2ZO4 A;  4EGZ A;  2J5P A;  3M8E A;  2QEN A;  2M8E A;  3L00 A;  1R23 A;  3HUG A;  2XRO A;  1W7P B;  5DV5 A;  2DAO A;  4MNU A;  4BHP A;  5CLS A;  5IT3 A;  2PMH A;  2XAG A;  1HSJ A;  5LLQ A;  3T8T A;  4U7D A;  5LGT A;  1OPC A;  5JHU A;  2R3S A;  1H9G A;  3V7C A;  3IC7 A;  1FBS A;  1ULY A;  4BHC A;  1FC3 A;  3DP7 A;  1ZG3 A;  5JFR A;  3KP4 A;  1D3Y A;  4ZH4 F;  3BDD A;  3QU6 A;  4HQE A;  1Z1D A;  3E6C C;  4S04 A;  4BQA A;  2JPB A;  3R61 A;  5J8C A;  1YW7 A;  2ISZ A;  2MA3 A;  3KLO A;  4KNY A;  3DXJ F;  2QVO A;  3BP8 A;  4HBL A;  3WTS C;  2A6H F;  3MQ0 A;  1TW2 A;  1E2X A;  2EFP A;  2VON A;  1G3S A;  3E5Q A;  2FF4 A;  1I6X A;  2ESN A;  2KRF A;  4KIB A;  3REO A;  5HDK A;  4MGR A;  1D8K A;  1ON2 A;  4LGW A;  3FX3 A;  1P2F A;  2OU2 A;  3KP7 A;  3FF5 A;  5A2Q Z;  2F5E A;  3TQN A;  2F2E A;  3BOQ A;  4LMY A;  2V1D A;  4CXF A;  3EUH A;  3TGN A;  1HW2 A;  2HWV A;  5FLX Z;  1OYI A;  3KLN A;  3P9I A;  3CUQ C;  3WGI A;  1DDN A;  1TQI A;  2NS0 A;  3BRO A;  4ZYD A;  4EJO A;  4I01 A;  5JI6 A;  4HA8 A;  1RIO H;  1KGS A;  5ILV A;  4HOB A;  1H0M A;  1FWZ A;  1CF7 B;  1KU7 A;  3V8K A;  3DQV C;  1XGN A;  3GZ5 A;  4AIK A;  1HKQ A;  1TW3 A;  4WXH A;  4WWC A;  1AWC A;  4LJZ F;  1V4R A;  3ZQ7 A;  4U0Y A;  3IRQ A;  4KIG A;  3ISP A;  3LAP A;  3KP2 A;  4Y13 A;  3O3K A;  4UXN A;  1P92 A;  3SZT A;  3DF8 A;  2Z5U A;  4KMU X;  2CWE A;  4FX4 A;  2EA2 A;  1O3Q A;  1TNS A;  4WXD A;  3AAF A;  2G7U A;  3DEU A;  4U88 A;  2YR2 A;  4XLN F;  3SQN A;  2A68 F;  2GA2 A;  2A6E F;  1GXQ A;  4OIN F;  3ZMV A;  4OIQ F;  5H20 A;  2LDU A;  1B6A A;  5H6Q A;  5D5X B;  1R5H A;  2WTE A;  2VOP A;  1XMA A;  2OQG A;  1ZN2 A;  4KMF A;  2H6C A;  1KQ9 A;  2K4J A;  2XKO A;  4BYY A;  2KJC A;  1UHM A;  3JSO A;  4NQW A;  2YU3 A;  3HRM A;  2G7H A;  2GWR A;  1BI3 A;  2OZU A;  1OMI A;  2Y48 A;  1IXS B;  3R4K A;  1D5V A;  1LNW A;  3E6D A;  3F3X A;  5BMZ A;  2FQ3 A;  5LBQ A;  2F5F A;  1MKM A;  2FMY A;  1FSH A;  4OMZ A;  3MCZ A;  3NEU A;  2MH2 A;  1W7P D;  1BIB A;  1J59 A;  1XN7 A;  3JAM K;  5ICG A;  1SD7 A;  1MDM B;  3HRS A;  1RZ4 A;  4YII A;  4I0A A;  1K78 A;  3KEO A;  1U3E M;  4KYW A;  3KP5 A;  1QNT A;  3WG9 A;  2F5D A;  2GZW A;  5JR3 A;  1YG2 A;  3F8C A;  4UNO A;  2RNJ A;  4ETS A;  1FBQ A;  3ERE D;  1UB9 A;  3RI4 A;  2F5C A;  4CDG A;  4UVA A;  4AIJ A;  3WTX C;  4HV6 A;  3C7J A;  2PI0 A;  2QM3 A;  4MTD A;  2EWN A;  4OIP F;  1LDK B;  1RUN A;  4I2O A;  2YPR A;  1T38 A;  1IN6 A;  4GGG A;  3LA7 A;  2HZT A;  1BI0 A;  1O3R A;  3CO7 C;  3Q9S A;  4G94 A;  1B4A A;  1SMT A;  3WU0 A;  4KIC A;  5HVQ C;  1TBX A;  3WTV C;  1OR7 A;  3QP6 A;  3F6O A;  1W5S A;  3R60 A;  4D0P A;  2Y0M A;  2MH9 A;  5L3D A;  2M1B A;  3LFK A;  2PJP A;  1YO5 C;  1EH7 A;  2XRN A;  3I59 A;  4CHU A;  1S7O A;  1I5Z A;  2P6T A;  5HLG A;  2W85 A;  2P7C B;  5IT9 K;  3RPU A;  3BY6 A;  4N0B A;  1QBJ A;  1IZ1 A;  3GUD A;  4I98 B;  4BH9 A;  2EV5 A;  4WXC A;  1JXS A;  2PN6 A;  3T5X A;  3SHF A;  1XCB A;  2DQR A;  1QZY A;  2L02 A;  3E97 A;  4H0E A;  2HYF A;  5F64 A;  2NNY A;  4IHT A;  1LEB A;  2HTS A;  2IW5 A;  3TDZ C;  2VXZ A;  3BJA A;  1O7F A;  3TDU C;  2KIF A;  1SFU A;  3DPL C;  1CGP A;  1HST A;  4G7O F;  1LQ1 A;  2QYO A;  3F8M A;  2RGV A;  4LB6 B;  2D1V A;  1WKM A;  5LGN A;  2JZY A;  4P55 A;  1ZRE A;  1I1S A;  1IF1 A;  4MQV A;  1FT9 A;  3KP6 A;  2DFI A;  5CYV A;  2HQR A;  4HDV A;  4RB1 A;  4EVI A;  4IRG A;  4XLP F;  1FSE A;  4RGU A;  2D2W A;  4ZYH A;  2COM A;  1EH8 A;  2ZNZ A;  2O6G E;  3RJP A;  5BOX A;  3CUQ A;  1K7A A;  2FML A;  3F8B A;  2PMU A;  4CYD A;  1XDS A;  4EJW A;  2A07 F;  3FWE A;  2W24 A;  1FYK A;  2VBY A;  2ESH A;  3L09 A;  4G7Z F;  1B59 A;  4XSZ F;  3SZP A;  3K9T A;  1U2W A;  4OU0 A;  3VOE A;  4WCG A;  2C6Y A;  4ZZL A;  3R0J A;  3E6M A;  1QPM A;  1QZZ A;  3I0T A;  2OZ6 A;  2WC2 A;  3WE3 A;  2QBY A;  1P6R A;  5F1R A;  3ZN0 A;  3FM3 A;  1ZHF A;  3O2P E;  4U0W A;  3GFI A;  1ZRF A;  2ACJ A;  1Q1H A;  2UZK A;  1STZ A;  5CVJ A;  5K5R A;  2HFH A;  1K78 B;  5AIP A;  5HLH A;  3GYH X;  1ZAO A;  3OOP A;  2IRF G;  4L5I A;  3KEQ A;  5D4S A;  2FSW A;  2BE5 F;  3HSF A;  4GYG A;  2A5Y B;  2A69 F;  2LKP A;  2FBK A;  1Z91 A;  2FU4 A;  1X3U A;  2JSC A;  1H9T A;  4OOI A;  1YW8 A;  3HSR A;  5DD4 A;  1D8J A;  5E17 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...