3HUGA

Crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
80
structure length
80
Chain Sequence
DPEQSTPDEVNAALDRLLIADALAQLSAEHRAVIQRSYYRGWSTAQIATDLGIAEGTVKSRLHYAVRALRLTLQELGVTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/membrane protein
molecule keywords RNA polymerase sigma factor
publication title Structural and biochemical bases for the redox sensitivity of Mycobacterium tuberculosis RslA
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 29
structure length 80
sequence length 80
chains with identical sequence C, E, G, I, K, M, O, Q, S
ec nomenclature
pdb deposition date 2009-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hugA00
5BQTA 2BBYA 2VE8A 3ZMDA 5F1RA 2PMUA 4RAZA 1H9GA 1J7KA 4EGZA 1S6LA 5AONA 1CF7B 1U5TC 2R3SA 4U7BA 2L3DA 3I71A 1ZAOA 3BJAA 3F8BA 2K4BA 2A07F 3U1DA 2FA5A 1RUNA 2RQPA 2IPQX 1V3FA 3FMQA 3DEUA 3CO7C 2NRAC 4D0PA 2STTA 3K69A 3ZPLA 3I64A 3WGGA 2WV0A 3IKVA 1ZGAA 3RYPA 2Z9OA 1B9NA 1O3SA 5JVTA 4R8HA 4IHTA 1USTA 3Q5FA 5E8GA 2QQBA 3RYRA 1Z6RA 2Z33A 2ZNZA 2VBXA 1TNTA 4KFCA 2MLGA 3ULQB 2H6CA 3ZMVA 2HTSA 3SXYA 1K79A 3DXJF 4HF2A 2WTEA 1YO5C 4ESBA 2XRNA 2ZMEA 1Y0UA 2P4WA 1ON2A 1TLHB 2CSOA 5ILVA 5E1XA 3M8EA 4Q48A 1BC8C 1W4MA 2YU3A 2E7XA 2W25A 1OYYA 2V1UA 3F8MA 3M9AA 4P9UA 2ADUA 5D6EA 3I0TA 3MCZA 3SHFA 2DFIA 1BOAA 2ZBKA 3T8TA 4JBAA 1KYWA 1WWXA 1HW1A 2RGVA 4U88A 2XASA 5CVIA 1SFEA 3G73A 5J6XA 3BJOA 4TV7A 3JTGA 3ZMUA 1FSHA 5EEGA 4UXNA 4A5MA 2QM3A 2ELHA 2DT5A 2RNJA 1KU7A 4UNOA 2EWNA 1P4XA 2XKOA 2DQLA 1H9TA 1E2XA 2FBKA 4BH9A 2L54A 3WE2A 1REPC 1J9IA 3WGIA 4EGYA 4FHTA 3KP7A 2HYFA 4ZYDA 2PN6A 3KCCA 2UZKA 3ECOA 2STWA 5LGUA 5K1YA 2P6SA 4A12A 2G9WA 2FF4A 1DDNA 2QLZA 2ESHA 2A6EF 4M72A 1SMYF 1RUOA 4A6EA 2WC2A 2JTVA 4GGGA 2F5CA 2D45A 1K78A 1MD0A 1XSXA 4CICA 1KA8A 3KP4A 1NHAA 3F72A 1GXQA 3J80Z 2X4HA 2Q2EA 2FNAA 2NYXA 1U3EM 1LB2A 4GO1A 4LK0F 2MH9A 4LLLA 1O3RA 3VFZA 3IWZA 1YW7A 3GF2A 3WU1B 3KP3A 3F8NA 3R0JA 5D5UB 4RS8A 4S05A 1Z05A 4JQFA 1Q1HA 2V79A 3BY6A 3CUOA 5JFRA 1YS6A 1BN5A 3F23A 4PZJA 2P5VA 5CLSA 5DYMA 2A61A 1WKMA 3RJPA 4ZYEA 2HWVA 5E1WA 2D1HA 3KZZA 2ZMEB 1ZRFA 2C6YA 3C1DA 1J5YA 1P4AA 5D4RA 3WTTC 1QGPA 4MQVA 3E6BA 3GWZA 4HF0A 3E5XA 3K9TA 3CUQC 1ZG5A 3OOPA 3KLNA 3ZMZA 4YFKF 2UXXA 3R0AA 4XLPF 5L3GA 5IT3A 3GXOA 3E97A 4U7DA 1IXSB 1BI1A 3BP8A 3HRTA 1PP7U 2GWRA 4JK1X 1IUYA 3BPXA 1ZYRF 3BWGA 2VBWA 3ROUA 2TDXA 3FHZA 4EV0A 4G7HF 3FXQA 3BDDA 1L0OC 1U2WA 4L0ZB 2IA0A 5ICFA 2XROA 4KYWA 1STZA 2GQQA 1B6AA 2JRTA 4N0BA 1JE8A 2VN2A 4UV8A 4EJVA 1G3SA 3LFKA 2DAOA 3FM5A 4QLCU 3G3ZA 3GFIA 2KKOA 3GZ5A 2XGXA 4IRGA 1K78B 3PFIA 4KIGA 4LK1F 4RB0A 1XN7A 1ZHFA 1ZARA 5F64A 5HLIA 2LSOA 1LDJA 4RAYA 4NQWA 3E6MA 1HXDA 2B0LA 2Y75A 3V7CA 1O3TA 1YQAA 1I1SA 4EM0B 2JPCA 5FD5A 2W84A 4BHBA 5HDGA 3WE3A 1WSUA 1QZZA 1U5TA 2W24A 3K0LA 1IXCA 5DD4A 2M45A 2YPRA 1HW5A 1S7OA 2F5FA 2NS0A 3JAMK 4PGGA 2A69F 3I5UA 3GVAA 3KEOA 2CQKA 5K5OA 1P6RA 2QYOA 3L00A 3LWFA 2D1VA 1K6OA 3NEUA 5ICCA 3QOPA 5H6QA 4WXHA 1FPQA 2XVCA 5FD6A 2DLLA 4XBFA 2YR2A 4RGSA 5FGMA 1WI9A 3LAJA 1FC3A 3IC7A 1YW8A 3KP6A 3DV8A 5K5RA 1HQCA 2CYYA 1UFMA 1KU9A 2OQGA 4A0YA 4LD5A 2A3SA 1ZLJA 1OMIA 3ELKA 3SQNA 2HTJA 3BROA 3O3KA 4UHTA 2KJBA 2X0LA 3I53A 2VONA 2VOPA 1LDKB 4IRHA 4PCQA 1DPRA 4M6XA 2HDCA 3IRQA 1IF1A 1G3YA 4HQEA 5BS6A 2G7HA 1YTYA 4AIHA 1IRGA 1O7FA 4IF4A 4MTEA 3D5LA 5HDKA 2DO7A 5FLXZ 1GVJA 2V9VA 1F4KA 1FLIA 1MDMA 4A0ZA 5J8CA 1YFHA 3SZPA 4HZFA 1G3TA 1W5TA 1R1UA 2FEZA 4YFNF 2JPBA 5LRRA 3JTHA 4R79A 3HSRA 3PQKA 5CVJA 4ZZLA 3CDHA 2GZWA 5L3CA 2VOOA 2ZNYA 2DQRA 2G7UA 4ZYHA 3E6CC 2P6TA 1D5VA 3ML6A 1LNWA 2CO5A 1IN8A 2O61A 1IZ1A 5ICGA 5LHHA 2M5WA 5LGNA 2DW4A 2HEOA 4HA8A 2GXBA 1B9MA 3Q9SA 5DDGA 2QVOA 2XAGA 2OBPA 2PJPA 3SZTA 4RB1A 4EM1A 1YS7A 2CG4A 3U9GA 4G7OF 4HAMA 1FWZA 1S29A 1U5TB 3DKWA 2IT0A 3V8KA 2LKPA 3LQRA 1MJ9A 3WTWC 2V1DA 4I0BA 2DI3A 3EYYA 2CW0F 3EDPA 4FX0A 5HS9A 3IHUA 2EV5A 3JW4A 1KU2A 1EH6A 2V1XA 1RZ4A 1XSDA 3QP5A 1MJAA 1FP1D 2BYVE 1O3QA 4EJWA 2PLYA 2IP2A 4G6DA 3LA7A 4BXUA 2UWMA 4ENKA 1LDDA 1Z9CA 4CXFA 4WK8F 2KJCA 2IA2A 2PFBA 2HFHA 4KMUX 2HZTA 4E70A 1F5TA 1OYWA 3RIRA 1IW7F 3NQOA 1T2KA 1R22A 3J81K 2VBYA 1FX7A 4YFXF 1I1GA 4LLGF 3WU0A 2XAFA 3MWMA 1R7JA 4KIBA 1K7AA 5D8LB 3CUQA 1QPMA 1MDMB 3K1NA 3HOSA 3T0YA 1U6GA 4S04A 2MD5A 1QNTA 2P8TA 4BQAA 1ODDA 3P9CA 4OMZA 1R00A 4L5IA 4BNCA 3REOA 2H94A 4Y15A 4P9FA 3MFKA 1R1VA 3C7JA 1JGSA 1FY7A 2P7VB 4ZYGA 3FWEA 2D2WA 1XB4A 1FYMA 3MZYA 2GAUA 3TOAA 1FT9A 1ZGJA 1SD4A 5E1ZB 1LEBA 5H6RA 1XMAA 1SFUA 3FX3A 3ERED 4WWCA 1RI7A 4U0VA 4XLNF 2OD5A 1C0WA 5FLXK 3PQJA 5ICEA 4LG0A 5CVUA 4YIFA 1TW2A 3GLXA 3GFJA 1AWCA 1ZG3A 3CJNA 2J5PA 5HS8A 5BPDA 1BIAA 3V7RA 3RKXA 3KP2A 1SD5A 4U0YA 2A68F 2KIUA 5BOXA 5IT9K 3T5XA 5FO5A 4AIKA 3EQLF 2RDPA 2HGCA 2FSWA 4M9SA 4LMYA 4KIFA 2W57A 4B8XA 2WWYA 3T8RA 5HLHA 3P7NA 5LHGA 1D8JA 3SFZA 2W85A 4IPAA 1R36A 1TQPA 4OIRF 1J0RA 2GA2A 4HLXA 4KNYA 1BM9A 3QP6A 1XDUA 2E1NA 1LQ1A 2K02A 3D0SA 4MHGA 5AIQA 1I6XA 2K86A 4KUMA 4RB3C 4I01A 3LA3A 1DPUA 4GYGA 4G7ZF 2XAJA 3RDIA 5EEHA 4OINF 2HKXA 5KVRA 2H27A 1PUEE 2XKPA 4MTDA 2HQNA 4EJTA 2F2EA 1P2FA 4P96A 3F3XA 2M8EA 3CUQB 4M9XA 2VT3A 4ESJA 1ZN2A 2K7LA 4EJUA 3H92A 3CLOA 2Z3YA 2H6BA 1SAXA 2VBZA 3AAFA 5TJJA 1USSA 2O8XA 4LB6B 4I0AA 1E17A 1G4DA 3U2RA 4CGZA 5CVVA 5LLQA 5K5QA 5D4SA 2K27A 5L3BA 1MZBA 4A2UA 3Q9VA 2VC1A 5JHUA 2HR3A 4LB5A 2ZJ2A 4G9YA 1IRFA 2COMA 4L0YB 3L7WA 5DCFA 5HOOA 1Z6TA 5DCMA 1F1ZA 2F5EA 4P5OA 1Z91A 2J5OA 4ETSA 4HF1A 4XRFA 1ON1A 3F8FA 4EQQA 3L2CA 2IW5A 3KZYA 4Y13A 3HRUA 4EMSA 3EETA 2RN7A 2K4JA 4LG0B 1YYVA 2P5KA 4ZZDA 2Z99A 2LNBA 1XGOA 4CO8A 3ZMTA 1B1BA 1KGSA 1J59A 3FM3A 5AIPA 4GXOA 1R58A 1KQ8A 4HV6A 5CVRA 2HYGD 4G6QA 1QZYA 2XIGA 1XCBA 4LLNA 1KU3A 3VEPA 4KDPA 5L3EA 2HQRA 4I98B 3N4MA 4HLYA 4HX4A 3WODF 1HBXG 1FBUA 4A0XA 4ASNA 1SD7A 2MA3A 1W7PD 3MZHA 3BOQA 5A2QZ 1R5GA 3RPQA 4ZH4F 3GO5A 2ZO4A 3O6BB 1UHMA 5DUKA 2ZFWA 1TW3A 1MJBA 4O6JA 3GW2A 1T38A 2ISZA 5D5WB 2EV6A 4M9ZA 3HYIA 3HRMA 4CDGA 1D3YA 4F7ZA 1FYLA 1SFXA 3ZN0A 5FFZA 4XSXF 2EFNA 2QZ8A 3J80K 1GXPA 1R1TA 3IKTA 4KA4A 2P7CB 1FNNA 4G94A 1XGMA 1G3WA 1KYZA 4GCVA 4ON0A 2QENA 4ESFA 1RIOH 3WTXC 3H3ZA 1T39A 2XUBA 4GYIA 1Z1DA 3MEXA 1XGNA 3C3WA 3GEZA 5JI6A 5J8FA 2ZCWA 3WGHA 5DUIA 3BJ6A 1HSTA 2L02A 2MBFA 2L01A 5DV5A 1HKQA 3ZQ7A 1MGTA 4L9VA 3HTSB 5ILUA 1B4AA 2FOKA 3KFWX 3M7GA 1KQ9A 5LRSA 2ETHA 2O3FA 5ILSA 4CHUA 4DNCA 4NB5A 4L9TA 5DCMB 1G6NA 1O7LA 1HKTA 2P5LC 4B09A 1XCVA 4UVAA 1I5ZA 3EUHA 1BI3A 2Y0MA 3B02A 4WXCA 4L9NA 2YSRA 2VT2A 1A04A 3WTYC 3J7AO 4CZZA 2YX4A 3WTZA 5HDNA 2PI0A 2CGPA 5L3FA 2QBYA 4HYEA 4M71A 4HDVA 4OIPF 3VOEA 3M1EA 4WF2A 3W6KB 3HHGA 2FQ3A 2O0YA 3TO6A 5F6FA 3CO6C 1FOKA 2R7FA 3DQVC 1WRJA 4P55A 3W6JB 2QQAA 2FRHA 4OOIA 2NAZA 1ZRDA 3HUGA 4L5JA 5FB2A 3P9IA 3HSEA 5JR3A 5LEJA 3ZN1A 4YG2F 3WG9A 1P92A 2O03A 4R1HA 1SD6A 4IXAA 4OIQF 1XGSA 3I58A 5LHIA 4O5VA 2HS5A 1AOYA 4BAYA 3NRVA 1RNLA 2EFWA 4MEYF 4N9IA 3C18A 2EV0A 4A6DA 3RPUA 3R61A 5E17F 1U8RA 6PAXA 3E5QA 3TO9A 1FBQA 5ED4A 4Q47A 2EA4A 1BC7C 4ENNA 4PDKA 1JHHA 5KK1A 1YW9A 4UVBA 1J75A 2H09A 3S2WA 2HKOA 1XDSA 2EFOA 2JT1A 5A2QK 1IN5A 4BHPA 1O57A 2E7WA 3E6DA 1IN4A 2YX7A 4O3MA 3TOBA 2OZ6A 2PQ8A 2Q0OA 1S8NA 2XAHA 2ZKZA 4HV5A 1TBXA 2DTRA 3WTUC 1TNSA 4MEXF 4ENMA 4M6YA 3ECHA 1JXSA 2QWWA 2IVMA 2LDUA 2RKHA 1PDNC 2PEXA 4UVCA 2OZUA 4AD9A 4G8XA 3FZVA 3IRRA 2ISYA 2MC3A 3QRFF 5BMZA 4M73A 3HSFA 2BE5F 1DUXC 5FFXA 2QBYB 3KE2A 2A6HF 4WXDA 4HX7A 1BJAA 1CGPA 3DPTA 2QUFA 4I7HA 3KLOA 3JAMZ 3GUDA 3R4KA 1T98A 1UB9A 3GFLA 2FMYA 1S7AA 3F6OA 4BHCA 5D6FA 4N9HA 3K1PA 3R60A 2Y48A 3DF8A 4LFUA 2GIVA 5D8KB 3TDZC 4RGUA 3WTVC 3IL2A 3ZP5A 4U0WA 2R7DA 4XSZF 4AVPA 1V4RA 3FF5A 3TDUC 1WQ2A 4IJAA 2BGCA 2AS5F 1FYKA 2PG4A 1W5SA 1Z7UA 3VB2A 1ZH5A 1FSEA 3I4PA 2DU9A 4HQMA 1OKRA 3ABTA 2EB7A 3TO7A 2VE9A 4Q5SF 5DD8A 3RKWA 3DP7A 2MH2A 1IXRC 2FBIA 2ACJA 1W7PA 3WTSC 2BV6A 2GA1A 4AIJA 2M30A 3MQ0A 4I2OA 3RKYA 2UXNA 2O6GE 2VXZA 4A5NA 1QQIA 1SMTA 4IVNA 2EA2A 1DP7P 2IJLA 2FXAA 4BYYA 3N97A 4DQ2A 3QPTA 2FNPA 4EJOA 1X3UA 1OR7A 4LGWA 1VTNC 3HOTA 1TTYA 3LQQA 1B59A 4HW0A 5H20A 2VODA 1LJ9A 2RVCA 3BPVA 4QWQA 1FZPB 2AXLA 1XD7A 2PBIA 2VC0A 1IAWA 3VODA 5E8IA 2EJRA 5CYVA 4IRIA 2M1BA 2M87A 3L09A 1F9NA 4RB2C 3LSTA 1MKMA 2L4MA 1TQIA 4K2EA 1FBSA 1QBJA 3TGNA 1BIBA 5HS7A 3RTRA 1HW2A 2CWEA 3I59A 4RGXA 4FT8A 1QO0D 4UV9A 3OV8A 3H3UA 3JSPA 4FX4A 1TQMA 3V8JA 2XHKA 2NNYA 5HLGA 4AWXB 2XAQA 1L3LA 2CFXA 3HIFA 3V7SA 1JHFA 1EV7A 1UCRA 3RI4A 4KMFA 4LJZF 1BBYA 3LAPA 2DK5A 2MLKA 2A5YB 1ZLKA 1P4WA 3JSOA 1YIOA 3FMSA 3R6SA 2GXGA 3TKYA 5DEQA 3B73A 1BI0A 1EH8A 1H0MA 1UHWA 4IHSA 2JZYA 1BI2A 2KRFA 3CTAA 2DK8A 3F21A 4OU0A 5D5VB 3FXRA 2LF7A 2PMHA 1S3JA 4YIIA 4UUVA 3DPLC 1HKSA 1ONVA 5LGTA 4OMYA 4HOBA 4OIOF 1T6SA 1CF7A 4MQ9F 3M8FA 1OPCA 2RV8A 1PP8F 4H0EA 2OQRA 4PGHA 2L4AA 2OAZA 4I09A 1XMKA 3F22A 5E18F 3V8LA 3ISPA 1D8KA 2DPUA 2QQ9A 3EYIA 1IN6A 3QU3A 3IWFA 3J81Z 3P9KA 1ULYA 2IA1A 2ZXJA 3FMRA 4L9JA 3KP5A 3QU6A 3O2PE 4KT5C 4EVIA 1W7PB 4KN4X 2NNNA 1GHCA 2DPDA 3T1BA 1HSJA 4Q4ZF 2EFPA 3DFGA 2RC4A 3ZMSA 2DBBA 4MNUA 2FU4A 2Q8KA 3MAJA 1R5HA 4I02A 2XV4S 1LEAA 1YG2A 3HTUA 3QAHA 4MGRA 3GX4X 4KICA 5L3DA 2FE3A 2EFQA 2V6CA 3GZ6A 4Y17A 3GYHX 2OU2A 4RGRA 3K2ZA 2JSCA 5LEKA 3HHHA 4L18B 1I27A 4HX8A 1LVAA 1T0FA 3LA2A 3TQNA 2LF8A 3F8CA 3BZ6A 5HVQC 1U78A 2FMLA 5E20A 3COAC 3F6VA 5CJ9A 4Z2YA 1EH7A 1IN7A 1ZRCA 5ERIA 2ESNA 1R23A 4M74A 1OYIA 3I59B 4CYDA 3L9FA 3ABUA 2Z5UA 5D5XB 2OA4A 4WCGA 1FP2A 3K1MA 2F5DA 3FXUA 5TRDA 1YLFA 1J2XA 5BPIA 3QPHA 4EM2A 1ZG1A 4HDUA 3I54A 4HBLA 5LBQA 4ENJA 1XSVA 3V4GA 4WX9A 1KQ0A 2BEOA 3KETA 3E5UA 4NHJA 2HOEA 2FBHA 3E3VA 3HRSA 1ZREA 3GFMA 3KEQA 2E1CA 2KIFA 2KIMA 5IT9Z 4KN7X 2IRFG 2EK5A
chains in the Genus database with same CATH superfamily
2VQHA 3HOUJ 2X51A 1V55H 5BQTA 1R71A 3WHCA 2BBYA 1T08B 3UR3C 3WU2C 1VFCA 2VE8A 1WPKA 3ZMDA 5F1RA 4J19A 1ZTRA 2PMUA 3BR6A 4RAZA 1H9GA 2BVMA 1J7KA 4EGZA 2MFZA 3KX2A 1X58A 2IGOA 1S6LA 2L7FP 5AONA 2ZC2A 1IDZA 2E2IJ 1CF7B 4X1EA 5FKLA 5J47A 1VQKI 1U5TC 3JRBA 2HDWA 2R3SA 2L3DA 3I3LA 4U7BA 2CH0A 3I71A 3ZR8X 3S1QJ 1ZAOA 1X2NA 3BJAA 5F0HA 1GDTA 3F8BA 2LK2A 3VYTB 2K4BA 2A07F 2M34A 3U1DA 2FA5A 1Z21A 3CP2A 1RUNA 1YRNB 4HNUA 4XR6A 2TCTA 2X9DA 3GTMJ 2RQPA 2IPQX 1V3FA 2DCEA 3FMQA 1T8IA 3DEUA 2R5ZA 3CO7C 2UV1A 1SC7A 2YU9J 2NRAC 1E0EA 2KISA 4D0PA 3NARA 2STTA 4RAGA 2BXZA 3K69A 4KJZA 5KHDA 2OTLI 3W2AA 1S72I 2R5YA 3ZPLA 2B63J 3I64A 3WGGA 2WV0A 4AC0A 3IKVA 3S3OA 3K4MA 4C30A 1ZGAA 3CCUI 3RYPA 3PNYA 2Z9OA 1PUFA 2IGKA 2V6EA 2W7NA 3PFYA 1B9NA 1O3SA 5JVTA 2KZGA 4R8HA 4IHTA 4B47A 1USTA 2M7BA 3KIOA 3Q5FA 5E8GA 2QQBA 1TWCJ 3RYRA 1S9HA 3TP0A 1Z6RA 2Z33A 2JN6A 2LVSA 4E4HA 2ZNZA 2VBXA 1TNTA 4KFCA 1MH3A 4CZCA 2MLGA 3ULQB 5EEAA 3VDXA 1JT6A 2AHQA 2H6CA 2HQ5A 5EGOA 3HGYA 4XLCA 3ZMVA 2HTSA 3SXYA 1K79A 3DXJF 1LFUP 4HF2A 2WTEA 1YO5C 1SVMA 4ESBA 5EZHA 5M3FJ 2XRNA 2ZMEA 4A3CJ 4XRSA 4FE4A 4Y3OA 2KRCA 1Y0UA 2P4WA 1ON2A 1TLHB 2CSOA 5ILVA 2LOOA 4DZJA 5E1XA 3M8EA 4Q48A 1BC8C 3OYLA 3QWLA 2L7ZA 2ZXHA 1W4MA 2YU3A 3DWLE 2E7XA 5E3LA 1ETYA 1MBGA 2W25A 1ZK8A 5HODA 1OYYA 4KT6A 4OAZA 2V1UA 2NVTJ 2WY8Q 2M9HA 1HC8A 3F8MA 2EINH 3M9AA 4P9UA 2FQ4A 2ADUA 2L9SA 3H0GJ 3BG7A 5D6EA 3I0TA 2HPMA 4CA0A 3MCZA 3SHFA 2DFIA 1BOAA 2ZBKA 3T8TA 4JBAA 3TW6A 4A3BJ 3A4CA 4G12A 3OYKA 4RMNA 1KYWA 1WWXA 3MZ8A 2JWTA 3CDLA 1HW1A 2P0WA 3FBNB 4OAYA 2RGVA 3JRDA 1ETXA 2M0MA 1NG6A 2KRHA 5HLTA 1T56A 1UJ8A 4U88A 2XASA 5CVIA 3CMMA 1SFEA 4BACA 3G73A 5J6XA 3BJOA 2BXYA 4TV7A 3JTGA 2K9NA 3KYLA 3ZMUA 2GXAA 2FJ1A 1FSHA 5EEGA 3M3YJ 3BR5A 3OYJA 4UXNA 4A5MA 2QM3A 2DN0A 2H1KA 2ELHA 1FOWA 2M8GX 4A3KJ 2DT5A 2RNJA 1KU7A 4UNOA 2EWNA 1P4XA 2XKOA 4FETA 5TISC 2DQLA 3HG9A 4C3IJ 2R7WA 1H9TA 2DA1A 4ZYAA 1K61A 1E2XA 2FBKA 1WI3A 2L54A 4FISA 4BH9A 3GTGJ 3WE2A 3G2BA 2LD5A 2DMQA 1REPC 2LY2A 1J9IA 4D7NA 1JT0A 2VKEA 2RREA 2DDBA 3WGIA 1P7IA 2V7FA 4FHTA 4EGYA 2DT7B 3KP7A 2HYFA 4LOCA 4ZYDA 2E71A 2ME0A 2F4IA 2H8WA 2LKSA 2OUMA 2PN6A 3KCCA 2UZKA 1QU3A 3ECOA 2STWA 1ENHA 5LGUA 5K1YA 3DU5A 2P6SA 4A12A 2G9WA 2FF4A 1DDNA 2QLZA 4DIQA 5IOZA 2WV1A 2ESHA 2A6TA 1AA7A 2A6EF 3CC7I 3G1MA 4M72A 3HC7A 1SMYF 4BU2A 1RUOA 4A6EA 2IGMA 2EILH 1RRJA 2WC2A 1JUMA 2JTVA 5C4JJ 2VJIA 4GGGA 3VYSB 2F5CA 3OYHA 2D45A 1K78A 1MD0A 1XSXA 2HOAA 2L9VA 2QA4I 4CICA 4B1RA 2MC4A 2JRMA 2R5ZB 2ZJQF 1KA8A 3KP4A 2IEKA 1NHAA 3S1MJ 3W3CA 3F72A 1GXQA 3J80Z 2X4HA 2Q2EA 2DA5A 2FNAA 2R5YB 2NYXA 4BEHA 2PMZA 2QKLB 2W48A 3KYDB 4OWRB 3LNQA 1U3EM 1LB2A 4GO1A 4LK0F 2MH9A 4LLLA 2F4OB 1O3RA 1Y0NA 3VFZA 2B7EA 3IWZA 1YW7A 2JSPA 3GF2A 1VI0A 3WU1B 3KP3A 3EUAA 2GOMA 3F8NA 4XKCA 3R0JA 5D5UB 1A5JA 2IXSA 4RS8A 1GVDA 4S05A 1Z05A 4JQFA 1Q1HA 1Y8QB 2M4GA 2BY1A 2MSYA 2OJED 2V79A 2WA0A 3BY6A 3CUOA 3A0HC 5B66C 5JFRA 1YS6A 4CCKA 1IUFA 4Z6YA 1BN5A 3BZCA 3F23A 2IBDA 4PZJA 5EGOB 2P5VA 2QQ8A 5CLSA 3EUKL 2MW8A 5DYMA 5TGTA 2A61A 1BR2A 1WKMA 3FXKA 3RJPA 4ZYEA 2HWVA 5E1WA 2KP6A 2D1HA 4MFEA 3KZZA 2ZMEB 5M5YJ 1ZRFA 3JRCA 2B9SA 2C6YA 2KMUA 3C1DA 1HDDC 2VI6A 1BW5A 1J5YA 2VIXA 3GCMA 1P4AA 5D4RA 1MMAA 3WTTC 1X4OA 3HPHA 4LITA 4UUTA 4BBSJ 1QGPA 2E36A 1MMNA 4MQVA 3E6BA 1OCTC 3LSHA 3GWZA 1JUSA 2KIQA 4LIVA 4HF0A 2XPVA 4BDYA 3E5XA 3K9TA 3CUQC 4M6VA 1ZG5A 3OOPA 3W6VA 2CQQA 1WJEA 4BDZA 2I10A 3KLNA 5FROA 2D5VA 3ZMZA 4F3QA 3JCUC 4JX5A 2UXXA 4YFKF 2X48A 3L2RA 1ERDA 3R0AA 2XRLA 4XLPF 5L3GA 5IT3A 4CYCA 4RDUA 1JJ6C 2COBA 3LMMA 5FLMJ 4ZTFA 2DMNA 2R7OA 3LSJA 3GXOA 4M3FA 1A31A 4D5FA 3E1SA 3E97A 4U7DA 3S15J 1IXSB 1BI1A 3BP8A 2KHMA 3HRTA 4JX4A 1BJZA 4B3AA 4IHYA 1QHHD 1B72A 3I56I 1QRYA 1O4XA 4BGDA 1IG7A 3PSIA 1PP7U 5LD2C 2E35A 2GWRA 4JK1X 1IUYA 1NK2P 1V5FA 2ID3A 3BPXA 3WHBA 2BOLA 1ZYRF 3IP4B 5CPRB 4UUSA 3BWGA 3C2BA 2VBWA 3ROUA 3ESWB 2TDXA 3FHZA 2GIZA 2E19A 2VQGA 1LVKA 4EV0A 2RQQA 4G7HF 3FXQA 3BDDA 1L0OC 3DBRB 1U2WA 2I8DA 4L0ZB 2IA0A 1WJ5A 3FXOA 5ICFA 5FJ8J 1ACIA 2XROA 3HJEA 4KYWA 1LFBA 1BA5A 1GT0C 4XK4A 3JRIA 1STZA 1FOYA 2GQQA 5DM7F 3VYRB 2HZDA 1B6AA 2JRTA 4AM3A 1MNEA 4N0BA 1RKTA 1FJLA 1ZKGA 2WBMA 1HOMA 4GFBA 5FKOA 1JE8A 3FK7A 2VN2A 4UV8A 4EJVA 1G3SA 3LFKA 2DAOA 3FM5A 4QLCU 3G3ZA 1JKRC 3GFIA 2BZTA 2KKOA 5E3OA 3TBIA 1OFCX 3PL8A 3GZ5A 2H1LA 3EPZA 3HOVJ 4A3EJ 2K3FA 2CV1A 2XGXA 4IRGA 1MH4A 1K78B 3PFIA 2AQFA 4KIGA 1XPXA 4LK1F 2DJIA 3DEWA 4RB0A 1XN7A 2WAQN 1ZHFA 1ZARA 3DBLB 2DJNA 2K5CA 5F64A 4E6KG 3M4OJ 4ITVA 1YITI 1EF4A 5HLIA 2LSOA 1LDJA 4RAYA 2Q2EB 4HPQA 4NQWA 3E6MA 1HXDA 2B0LA 2Y75A 3FKJA 4BEHB 3ABMH 1VQ5I 3V7CA 3B6CA 1YQAA 1O3TA 1FMWA 1I1SA 1X4PA 4FASD 3RSNA 4EM0B 3UKGA 1ETVA 2JPCA 3PO3J 5FD5A 2LTPA 2W84A 4BHBA 2E34A 5HDGA 2FX0A 3SZGA 3WE3A 4IX7A 3K7AJ 1WSUA 1QZZA 1ITYA 1U5TA 2W24A 3K0LA 1IXCA 5DD4A 4X6AJ 1ETKA 1SANA 2M45A 2YPRA 1HW5A 2K9LA 1S7OA 5GADJ 2XGEA 2F5FA 2NS0A 2X6OA 3LL7A 3HM5A 2H8RA 3JAMK 4PGGA 5GTIC 2RNGA 2XGDA 1JTXA 2A69F 3I5UA 1LKXA 3GVAA 3K4JA 2CQKA 1Z7LA 1P6RA 3KEOA 5K5OA 1SFOJ 3LOCA 2QYOA 1U8BA 3L00A 1XMXA 5F1JA 3LWFA 2D1VA 1K6OA 3NEUA 3ZOBA 5ICCA 2LR8A 3VSKA 3QOPA 2WY7Q 2X85A 5H6QA 2VXDA 4WXHA 5GPAA 1FPQA 2XVCA 5FD6A 1G59A 2DLLA 4XBFA 2CV0A 4ZJZA 2YR2A 4RGSA 5FGMA 3OY9A 1WI9A 2LMDA 2LYCA 3LAJA 1FC3A 4QIWN 2MD0A 1OR7C 3IC7A 1YW8A 3KP6A 3DV8A 4AU7A 5K5RA 1HQCA 2CYYA 1UFMA 1KU9A 2OQGA 2LLKA 4A0YA 4LD5A 4D5CA 4XOPA 1IV6A 2A3SA 1ZLJA 2BY3A 3JRHA 3RZOJ 3CCSI 3G1OA 1OMIA 3ELKA 3SQNA 2HTJA 1RPWA 3BROA 1W0UA 3O3KA 1U0JA 3BG9A 4CYCB 4E7LA 3D5RC 4UHTA 2KJBA 2X0LA 3I53A 2VONA 2VOPA 1QZEA 1LDKB 4IRHA 4PCQA 3DTKA 1DPRA 4M6XA 3JR9A 2HDCA 4M3GA 4XLEA 3IRQA 1IF1A 1G3YA 4F92B 3H0DA 2YS9A 4HQEA 3OYNA 5BS6A 1B72B 2Z16A 2G7HA 3BCBA 1YTYA 4AIHA 1IRGA 4XL9A 3Q3SA 1O7FA 1VF9A 5EG0A 4IF4A 4MTEA 3L2VA 3D5LA 2R93J 1HF0A 1MMGA 5HDKA 2DO7A 2EQRA 3DEEA 2DDAA 3LSGA 4PUSA 4UUSB 5FLXZ 1GVJA 2V9VA 1F4KA 4U87A 1FLIA 1MDMA 3OL4A 4A0ZA 5J8CA 3MKWB 1YFHA 3SZPA 4AYBN 4HZFA 4DYCA 5IPAA 1G3TA 5IP6A 3L2QA 1F36A 1W5TA 1R1UA 2FEZA 2VKDA 2BHZA 2JPBA 4YFNF 1N78A 2K40A 5LRRA 1IC8A 3CESA 3JTHA 4R79A 3ZQGA 5DTDA 1D0XA 1MNMC 3O8GA 4M3EA 3TEDA 3Q0VA 3HSRA 3PQKA 5CVJA 4ZZLA 3CDHA 3HOXJ 3AG2H 1JUPA 2GZWA 2NOJB 5L3CA 2VOOA 2ZNYA 1BW6A 1IV8A 4II3A 4ZDPA 1MNDA 4KITB 2JA2A 3A01A 2DQRA 2G7UA 4ZYHA 5DM6F 3E6CC 1VQNI 4PJJA 2P6TA 4N4NB 3S8PA 3L1PA 1D5VA 3ML6A 1LNWA 1SFKA 3H9GA 1HCRA 3GMEA 3BR3A 2CO5A 1DGRM 2E2JJ 4BQQA 5IP9J 4NUBA 1IN8A 5E79C 5J4YA 3AL0B 2O61A 1IZ1A 5ICGA 5LHHA 1BR1A 2QKMB 2M5WA 2ZSHB 3FXJA 5LGNA 3SJMA 1R4MB 2DW4A 2XF6A 2HEOA 3JRAA 4HA8A 2CRGA 2GXBA 3CP8A 4HRIA 1B9MA 2O9LA 3Q9SA 5DDGA 2QVOA 2XAGA 4XN0A 3A02A 4NQWB 2OBPA 2PJPA 2EIJH 4IZZA 1YJ9I 1FOXA 2LY1A 3SZTA 2E1MC 1YE9A 2PJRA 4RB1A 4EM1A 1YS7A 3CF5F 2CG4A 1I6HJ 3U9GA 4G7OF 2L0KA 4HAMA 1FWZA 1S29A 1U5TB 2CW7A 1Y39A 3DKWA 2IT0A 5K7HA 3V8KA 2LKPA 1NG7A 3LQRA 3HDDA 1MJ9A 3I4MJ 3GZNB 3WTWC 2V1DA 4I0BA 3OSGA 3OYIA 3NWSA 1X3ZB 2BVLA 2DI3A 4ZDOA 4A3MJ 1R9TJ 2MG4A 2L9RA 3EYYA 3OIOA 2CW0F 3H5NA 3MMYB 3EDPA 4FX0A 2DYRH 2NOGA 5HS9A 3IHUA 3KYCB 4GDFA 2EV5A 1IO2A 3JW4A 5J1RA 1KU2A 2F6CA 1EH6A 2WB1A 2ZFUA 1TC3C 2ELJA 4BY1J 2V1XA 4N4OB 1MBEA 1RZ4A 3LFUA 1XSDA 3QP5A 1MJAA 1FP1D 2V9KA 2JUCA 5IOYA 2DOFA 3G4SI 2BYVE 1O3QA 4UB8C 4EJWA 4HSTA 4C3JJ 3DKYA 2PLYA 3UNGC 2IP2A 4JX6A 3RKQA 4B43A 5IYDJ 1WJFA 3HXLA 1N77A 4G6DA 3ZQIA 1W36C 3VWBA 2LBFB 3LA7A 4BXUA 4DGWB 3LSPA 2UWMA 4ENKA 1LDDA 1Z9CA 4CXFA 4WK8F 2Y31A 2KJCA 2VB6A 2QGUA 3RCOA 5B1AH 2IA2A 1UAAA 2PFBA 2HQAA 4CUGA 2HFHA 4KMUX 2HZTA 1MSEC 2VLAA 3X2QH 4CCNA 1WFXA 4E70A 1JTYA 5K7ZA 3E7LA 1K4TA 1F5TA 1OYWA 4XMYA 2YUSA 2LFBA 3ABLH 1T0FC 5JVGF 2VKVA 3RIRA 2V1NA 1IW7F 1YX5A 3NQOA 1VQOI 5F0CA 3RQIA 1T2KA 1R22A 3J81K 1POGA 2VBYA 1Z3YA 1FX7A 4YFXF 3D1NI 2CV2A 1P7JA 1I1GA 5FKKA 1YHQI 4DBRA 4YELA 5EDNA 4QPQA 4E7JA 4LLGF 1HLVA 3WU0A 5EG0B 4HG2A 2XAFA 3DBHB 3MWMA 1R7JA 4KIBA 1K7AA 1KONA 4C2TA 5D8LB 1UHSA 3OSFA 2DA3A 1LPQA 3K4CA 3CUQA 4IOCF 1QPMA 3HL2A 3G71I 4A3DJ 1MDMB 3K1NA 3CZ6A 3HOSA 3T0YA 1U6GA 5CQEA 4S04A 1K83J 4MLOA 2MD5A 1QNTA 2P8TA 4BQAA 1ODDA 3ZCOA 3P9CA 2ECBA 2HDDA 1XTAA 4OMZA 3VYUB 4IOAF 3K4NA 1R00A 4L5IA 1WJCA 2NS7A 4BNCA 2CUEA 3EUHC 3REOA 2H94A 4Y15A 4P9FA 3MFKA 1R1VA 1ORKA 5H2FC 3C7JA 2W1OA 3TMOA 1JGSA 1FY7A 2UUZA 3A01B 2P7VB 3LSIA 3BCAA 1D5YA 2CQ7A 5JLXA 5GP9A 2OC6A 4ZYGA 3FWEA 2D2WA 1XB4A 1FYMA 1JGGA 4FQGA 3MZYA 2Q1ZB 4L5EA 2DA4A 3A1YA 2DODA 2EZIA 2GAUA 2XDVA 1BOBA 3TOAA 1FT9A 1ZGJA 2E5ZA 4I76A 1SD4A 4IL6C 3H9QA 5E1ZB 1LEBA 5H6RA 2MGQA 2JVGA 1XMAA 2LH9A 3NWTA 4BE2A 1SFUA 3OL3A 3FX3A 3ERED 2L7MP 3BTCA 3L2UA 1WVRA 3J7AY 4WWCA 1RI7A 3OIPA 2ZJPF 4U0VA 3HOYJ 4XLNF 2JA6J 4PSXA 2L7KA 2OD5A 1C0WA 5FLXK 3PQJA 2PJRB 2MABA 2O5RA 3CCYA 5ICEA 4LG0A 1DP3A 2F48A 5CVUA 3I4NJ 4YIFA 1DQUA 1TW2A 2EBIA 3GLXA 3GFJA 3IH2A 1ZG3A 1AWCA 1FIPA 3CJNA 1H88C 1NH3A 2J5PA 5HNFA 2FUG2 5HS8A 3MN2A 5BPDA 1BIAA 3V7RA 2VJJA 3RKXA 3HEFA 1YJNI 3KP2A 1SD5A 4U0YA 4QPOA 2XC7A 2A68F 1RR8C 3A0BC 2KIUA 1VQ4I 4HNVA 5BOXA 5IT9K 3CQZJ 3QPLA 3T5XA 1Y1VJ 2BW3A 5FO5A 1QHGA 2X1DA 5F08A 2Y69H 4AIKA 3EQLF 3OR1C 4II2A 2RDPA 2HGCA 2FSWA 4M9SA 5M5WJ 4LMYA 4KIFA 1D1BA 1U9NA 2W57A 4FE7A 3OS0A 2E60A 1FEXA 1I39A 4HEA2 2JA7J 4V2GA 3C2GA 3DCFA 4B8XA 2WWYA 3T8RA 3RPUD 4MO7A 5HLHA 3S1NJ 3P7NA 3CD6I 5LHGA 3BQYA 2P81A 1D8JA 3SFZA 2W85A 4IPAA 1UG0A 3FXLA 1T33A 3C2HA 2ICWG 3FK6A 4XKBA 1R36A 1TQPA 4OIRF 1J0RA 2GA2A 4HLXA 4KNYA 2WAEA 4XLFA 3HKZN 2R7RA 4H4KC 4C2UA 5JHFA 5C4XJ 3CF2A 1H89C 1BM9A 3GBGA 3QP6A 3S32A 4XRSG 1XDUA 3CCVI 3S17J 2E1NA 1LQ1A 2K02A 3D0SA 4MHGA 4Y33A 5AIQA 1I6XA 2CUJA 2K86A 4KUMA 4BJ6C 5FLVA 4RB3C 1GV5A 2K85A 4IHVA 3LA3A 4I01A 1DPUA 1WZ2A 4DW6A 4GYGA 4CCLA 4G7ZF 2XAJA 3RDIA 2OCCH 1Q1VA 3LSRA 4EEFG 2CQXA 5EEHA 1MW7A 4OINF 3TP3A 2DMUA 4B3XA 2IS4A 2HKXA 5KVRA 2H27A 1PUEE 1I3QJ 3K70C 2XKPA 4MTDA 2N8GA 2HQNA 3JRFA 2F2EA 1P2FA 3AFHA 4EJTA 4P96A 3A03A 4PFPA 1N75A 3F3XA 2BY0A 2M8EA 3CUQB 3AG4H 2Y30A 5J3LA 4M9XA 2VT3A 4ESJA 1ZN2A 3MKYB 2K7LA 2HVQA 2DT6A 3H92A 3M1CA 4XORA 4EJUA 4NC8A 3CLOA 2Z3YA 3TL4X 2JA8J 4IKFA 2H6BA 1SAXA 2VPRA 2VBZA 3AAFA 2FD5A 2WADA 3P5JA 5TJJA 1USSA 2O8XA 4LB6B 1W5CC 3SFIA 4I0AA 3ZQQA 4B44A 4Y52J 1E17A 2PMZN 4IQJA 1G4DA 2Y2ZA 3U2RA 1X1DA 2V26A 4CGZA 1R6RA 5KNLA 3M07A 3HPGA 2IS1A 5E3NA 4Y4RA 1JJ8C 5F27A 5CVVA 2W00A 2HXOA 5LLQA 5K5QA 5D4SA 2K27A 1VQ6I 5L3BA 4XKVA 3BTJA 1MZBA 5EZGA 3V42A 4A2UA 3Q9VA 2VC1A 5JHUA 2HR3A 4LB5A 2ZJ2A 2XGCA 4M3DA 4G9YA 4D7MA 1D1AA 1IRFA 1VQPI 2COMA 3F9KA 3BT9A 4L0YB 4E7SA 2R4GA 2NS8A 3L2WA 3L7WA 1GV2A 2Z2SB 5DCFA 5HOOA 5FRNA 1TT5B 1Z6TA 2R7UA 1TWFJ 5DCMA 1F1ZA 2F5EA 1EA3A 1Z91A 2J5OA 2PX9A 4P5OA 2Y9ZA 1B8IA 1GUUA 4ETSA 4HF1A 2LG4A 2F4MB 2K9QA 3RQ4A 2JVHA 5E3MA 3RZDJ 4XRFA 1E3HA 1ON1A 3F8FA 4EQQA 3L2CA 2IW5A 3KZYA 4Y13A 3HRUA 3IAM2 4EMSA 3EETA 2Y0SN 2RN7A 4E7IA 2K4JA 1Z67A 3CJTB 4LG0B 1YYVA 3F0CA 2P5KA 4ZZDA 2Z99A 1V5GA 2LNBA 1XGOA 2VL8A 4CO8A 3ZMTA 1CQTA 5KCMA 4YEJA 2ME6A 3AG1H 1B1BA 1KGSA 2EZKA 1J59A 2VUMJ 4M3BA 4MIMA 3FM3A 2ZXIA 1MMDA 1DU6A 1A35A 2XF7A 4NC6A 5AIPA 4GXOA 1R58A 3CJQB 1KQ8A 4HV6A 2X6WA 5CVRA 4XOTA 4A3IJ 2BW3B 9ANTA 1JKPC 2HYGD 4G6QA 1QZYA 4A3JJ 2XIGA 1XCBA 4LLNA 1KU3A 1UG2A 1WCMJ 3VEPA 4A93J 4KDPA 2HPIA 4DYRA 2JUGA 2LC2A 4PJNA 3S14J 1YIJI 5L3EA 2HQRA 4I98B 3N4MA 4HLYA 1AU7A 4HX4A 3FIWA 4UB6C 3WODF 1HBXG 1FBUA 1TWGJ 4A0XA 4ASNA 1QA6A 1SD7A 1TP4A 2MA3A 1W7PD 3MZHA 3BOQA 1NTCA 1G8XA 2JQ7A 2ZXWH 5A2QZ 1R5GA 2IS6A 3RPQA 5IP7J 4ZH4F 4IQ4A 4XLAA 2R0QC 4F55A 4D9JA 3GO5A 2ZO4A 3O6BB 1UHMA 1VNDA 5DUKA 2R7VA 2ZFWA 3CLQA 1TW3A 1MJBA 4O6JA 5LFAA 2L2OA 3GW2A 1T38A 3LSMA 5J1YA 2ISZA 5D5WB 2EV6A 3SYTA 4M9ZA 2HVRA 4RAFA 3HYIA 3I9V2 3HRMA 5J40A 4XN3A 2V4JC 3ABKH 4CDGA 1QPIA 1D3YA 4F7ZA 3PIPF 3HOZJ 1X3WB 1FYLA 1SFXA 5F0FA 3ZN0A 5FFZA 4XSXF 4EATA 4Y7NJ 2DMTA 3HZJA 2EFNA 3S2HJ 1MBHA 4ABZA 2F5VA 2QZ8A 3HBLA 2LBFA 1WH7A 3J80K 1GXPA 1R1TA 3IKTA 4KA4A 3S3NA 2P7CB 2DFEA 1FNNA 3W2WA 3BC8A 4G94A 1XGMA 1VQ8I 1G3WA 3DKXA 1IRZA 3OS1A 1KYZA 4GCVA 4ON0A 2QENA 1V54H 4ESFA 1RIOH 3WTXC 3H3ZA 1P9QC 3U1KA 3K10A 1RKWA 4HSRA 1T39A 5J1UA 2XUBA 4GYIA 1Y56A 3MKZA 1Z1DA 1FTTA 3MEXA 3OWTA 1XGNA 3M8JA 3C3WA 3GEZA 5JI6A 5J8FA 3KPHA 1OJLA 3CMYA 2ZCWA 1S7EA 1LFPA 3WGHA 3QYBA 5DUIA 3BJ6A 1D1CA 1GLNA 1YX3A 2KT0A 3U21A 1HSTA 2L02A 2MBFA 2L01A 5DV5A 5GAEJ 3GTOJ 1HKQA 3ZQ7A 1MGTA 4L9VA 3HTSB 1R49A 5ILUA 1UMQA 1B4AA 3MKLA 2FOKA 3KFWX 3M7GA 1KQ9A 5LRSA 3B6AA 2ETHA 2O3FA 5ILSA 1ZR2A 4CHUA 4DNCA 2VPLA 3QOEA 4NB5A 3GTLJ 4BUPA 2E5NA 2DA6A 3H5AA 4L9TA 5DCMB 1G6NA 3J7YJ 3OR2C 1O7LA 1HKTA 4BS9A 1OCPA 1B8IB 2QSFX 2P5LC 2R92J 2VJ5A 4B09A 3JREA 1VQ7I 2R7TA 2ZB9A 3FDYA 1EKEA 1XCVA 1S5LC 4UVAA 1I5ZA 2Y9YA 3EUHA 1BI3A 4PK4A 2NVXJ 4AUXA 5B5EC 1MBJA 2JJ7A 2Y0MA 3B02A 3GTKJ 2R7ZJ 4WXCA 1N25A 3CJRB 4QSHA 4L9NA 2YSRA 2DFFA 2VT2A 3S93A 1A04A 2CW8A 2M4KA 2BHYA 2X1CA 3WTYC 3J7AO 4CZZA 1MSFC 3DTIA 3E0JB 2YX4A 3WTZA 5HDNA 1RETA 2PI0A 2Z1DA 3OYDA 4XQFA 2CGPA 1FIAA 1VQ9I 5L3FA 1ZQ3P 2QBYA 4HYEA 4M71A 1AHDP 3PUBA 1UELB 4HDVA 4OIPF 2IAIA 5M5XJ 2LY9A 3VOEA 4CCOA 2OPTA 3M1EA 2CFOA 4WF2A 2V9PA 3W6KB 3HHGA 1A36A 3AG3H 5IYBJ 4DYQA 2FQ3A 2O0YA 3TO6A 2KDZA 5F6FA 3CO6C 1FOKA 2E1MB 2R7FA 3DQVC 1WRJA 4P55A 3W6JB 3S16J 4CCMA 2QQAA 4BXXJ 2FRHA 4OOIA 5DS9A 2XPUA 2NAZA 5FKMA 1ZRDA 3HUGA 2HI3A 4L5JA 3FBIB 3AKZA 4LIUA 1LUJB 2AQEA 1JI8A 5FB2A 3P9IA 5GPCA 3HSEA 2K9MA 3OOUA 5JR3A 5LEJA 3ZN1A 4YG2F 4CCJA 3WG9A 3PUFA 4E7ZA 1XG1A 3MD2A 4MFDA 2CS3A 1Y1WJ 4UY8I 1P92A 3IH4A 2O03A 1WH5A 5F04A 4R1HA 1SD6A 3G1LA 4IXAA 3Q0UA 4OIQF 4RM3A 2L5QA 4J00A 3K4LA 1XGSA 3I58A 5LHIA 2DOEA 4O5VA 2HS5A 3SDBA 1W36D 1OCOH 1AOYA 4BAYA 3NRVA 1RNLA 4RM2A 3OYEA 2EFWA 2GBYA 1FMVA 4MEYF 5HNHA 2VASA 3H35A 2NXNB 4N9IA 4E7KA 1WJAA 4RLQA 3C18A 5B1BH 2EV0A 3DU6A 4A6DA 4NNJA 3RPUA 3R61A 5E17F 3PO2J 4RA2A 2XAUA 1U8RA 1OCZH 2JK3A 2FOWA 5BNGA 4KISA 6PAXA 3E5QA 3TO9A 1FBQA 1LE8A 5ED4A 4Q47A 4BKXA 1OCRH 2EA4A 2QEXI 3H9JA 4AIDA 4RLFA 1BC7C 4ENNA 4PDKA 1JHHA 5KK1A 2QSHX 1YW9A 3HOWJ 4UVBA 4IHWA 1J75A 2H09A 3BG6A 4JYKA 2G0EA 2HKOA 1XDSA 3IUOA 3S2WA 3QYFA 4YRVA 2EFOA 3OYBA 2K9SA 2JT1A 1T95A 1IN5A 1PYVA 3W2VA 5A2QK 4BHPA 1O57A 2LKXA 5KAIC 3DLAA 3OYMA 1FTZA 3BTLA 2E7WA 3E6DA 1IN4A 2M2EA 2YX7A 1BL0A 2EIKH 4O3MA 2KL4A 4XNFA 3G6EI 3TOBA 3ERMA 2OZ6A 2NVYJ 1TWAJ 3CDIA 2PQ8A 2DYSH 4BQOA 4E7HA 2Q0OA 1OCCH 2A05A 4BJTA 2JA5J 1S8NA 2OTJI 2XAHA 2ZKZA 4HV5A 4JP0A 1TBXA 2DTRA 4ANJA 1TNSA 3WTUC 4MEXF 2HOTA 2KDOA 4ENMA 4M6YA 4BXFA 3ECHA 1JXSA 3ASNH 3IH3A 2QWWA 2IVMA 3ZGKA 2RAEA 2LDUA 2RKHA 3K4BA 4CH7A 4PJMA 1JKQC 1PDNC 2DOAA 3S2DJ 5GAHJ 2WB1N 1I3AA 2PEXA 3H1CA 4UVCA 1MIJA 2VQCA 1Y6IA 5B3SH 3K2AA 2OZUA 3H5RA 4AD9A 4G8XA 2MYSA 3PNTA 3FZVA 4IO9F 1X1AA 2ECCA 3IRRA 2BY2A 4V2FA 3DPUA 1ZGWA 2ISYA 1VZ0A 1F43A 3WG7H 2MC3A 3QRFF 2KZVA 3OMYA 5BMZA 4M73A 3HSFA 3CC2I 1Z0XA 2W82A 2BE5F 1DUXC 2IS2A 4A69C 2A5WA 3HKZA 1MMSA 4F93B 5FFXA 4AVZA 2WAFA 2QBYB 3KE2A 1ETOA 2W4SA 4P1WA 2A6HF 1KZHA 4WXDA 4HX7A 2M3AA 1ZR4A 3CCJI 1BJAA 4DBQA 1CGPA 3DPTA 2QUFA 1W1WE 4I7HA 2GM4A 3KLOA 2R7XA 3JAMZ 1Y8RB 2HYJA 3GUDA 3R4KA 1HDPA 1IRXA 3OIQA 1T98A 1QVTA 1UB9A 2IGNA 3GFLA 5IY5H 2FMYA 4RBOA 1S7AA 2CUFA 3BG5A 3F6OA 2OV7A 1XC5A 4W1UA 4BHCA 5CQGA 2LREA 1K6YA 1ETQA 3S3MA 4ZTJA 1X1PA 5D6FA 1YJWI 4CSWA 3HUGB 4N9HA 5CKTA 1J09A 3K1PA 5K7FA 3R60A 4A3FJ 1ETWA 1D0YA 2XF5A 2Y48A 3DF8A 4LFUA 2GIVA 5D8KB 3TDZC 2EIMH 3SDGA 4RGUA 2VJ4A 3OYGA 3ONQA 3WTVC 3IL2A 1I50J 3ZP5A 1TT0A 3IAS2 2GLOA 4U0WA 1X1CA 2R7DA 2X6XA 4XSZF 2ELKA 2KPMA 4AVPA 1V4RA 3CCLI 3CMEI 2HU9A 2E2HJ 3FF5A 2XSJC 3TDUC 1WQ2A 4IJAA 2BGCA 1RESA 4XICA 2QF7A 3JRGA 2AS5F 2QSGX 1PVEA 1FYKA 2PG4A 1W5SA 4QTRA 1PUFB 3OS2A 4I99C 1Z7UA 3KEYA 2HVSA 3VB2A 1ZH5A 3A2KA 2HNHA 3BG3A 1FSEA 1R5ID 3I4PA 2DU9A 4HQMA 1OKRA 3FISA 4G6TB 3HB9A 3ABTA 1TZLA 2EB7A 3TO7A 2VE9A 4Q5SF 1X19A 3Q0WA 5DD8A 4JOMA 5JLWA 3NAUA 3BLYA 3DP7A 3RKWA 2MH2A 2AXTC 2ZMEC 1IXRC 2FBIA 2ACJA 4J01A 2VQLA 1W7PA 3WTSC 2R7SA 2BV6A 2GA1A 4AIJA 3QYEA 2M30A 1LE8B 3MQ0A 4I2OA 4A3LJ 1E3PA 4XIDA 4IEJA 2O7OA 3RKYA 2UXNA 2O6GE 1RR7A 2VXZA 4PJLA 1RC9A 1QQIA 4A5NA 2EZHA 1SMTA 2DMPA 4IVNA 2EA2A 2XPWA 1DP7P 1A6IA 2IJLA 2FXAA 4BYYA 3N97A 3K70D 4PFOA 4DQ2A 4B4CA 3QPTA 2FNPA 4EJOA 4F91B 1X3UA 3MVPA 2CMPA 3PSFA 2Y0SA 1OR7A 4LGWA 1VTNC 4FCYA 4YIRX 3N05A 3HOTA 1TTYA 3LQQA 3PNVA 1B59A 4HW0A 5H20A 3SEZA 2VODA 1LJ9A 2RVCA 3BPVA 4QWQA 1FZPB 2AXLA 1XD7A 2WAQA 2PBIA 3DLLF 2VC0A 1IAWA 1TWHJ 3VODA 5E8IA 3GTPJ 1X2MA 2EJRA 5CYVA 4IRIA 1IJWC 2EPFA 2M1BA 2M87A 3L09A 1F9NA 4PSWA 4RB2C 3OYCA 2X6YA 3LSTA 1MKMA 2L4MA 5EJCA 3GTJJ 1QVUA 1AKHA 1TQIA 3TW7A 4BJ5C 4NDLA 1EJ9A 3CCMI 1PJRA 4K2EA 3ZRGA 3HGGA 1FBSA 1QBJA 3TGNA 3CCQI 1WHUA 1BIBA 5GAGJ 5HS7A 3RTRA 1HW2A 2LRDA 3GLLA 1YOVB 2CWEA 2K3PA 3I59A 4RGXA 2EH3A 4FT8A 3ZQHA 1QO0D 4UV9A 1ZELA 5M3MJ 1OISA 3OV8A 2KQRA 3H3UA 4BY7J 3JSPA 3H3VK 2QCOA 2EZLA 1WJBA 3PM1A 4FX4A 1TQMA 4BQNA 1IGNA 5KAFC 3V8JA 5C44J 2XHKA 2CUZA 4XONA 4DOZA 2NNYA 5HLGA 4AWXB 1SAUA 2XAQA 4BE1A 1L3LA 2CU7A 1WJDA 3CC4I 2CFXA 4PJ0C 3HIFA 3V7SA 5J4VA 1JHFA 1EV7A 3O8HA 1MBFA 1VQMI 1UCRA 3RI4A 4KMFA 2I5UA 4BBRJ 4LJZF 3ZQLA 1BBYA 3LAPA 2DK5A 2X1EA 2MLKA 1NK3P 2AO9A 4A3GJ 5C3EJ 2A5YB 4B48A 1ZLKA 2GOXB 3LSKA 2DXIA 1P4WA 3JSOA 1XX5A 1YIOA 2XB0X 2OCEA 3FMSA 3R6SA 2GXGA 3TKYA 5DEQA 3QQAA 2ID6A 1X1BA 3B73A 1BI0A 1EH8A 1H0MA 1UHWA 3ZXSA 4IHSA 1DU0A 2JZYA 1BI2A 2KRFA 4C2MJ 3QODA 1XS9A 3CTAA 2DK8A 3F21A 4OU0A 4ZDLA 5D5VB 1Z77A 3FXRA 2LF7A 1VQLI 2PMHA 1S3JA 1APLC 4YIIA 4DJAA 4UUVA 3DPLC 1V5EA 3BZKA 1HKSA 1R4NB 1ONVA 1UZCA 5LGTA 4OMYA 3BTIA 4HOBA 4OIOF 1T6SA 1CF7A 4MQ9F 1SVOA 2DA2A 3M8FA 1OPCA 3IV5A 2RV8A 1PP8F 4H0EA 2OQRA 4PGHA 2L4AA 2OAZA 4I09A 1XMKA 3F22A 5E18F 1MBKA 4BL0B 1YRNA 3FXMA 4XM3A 3V8LA 3ISPA 4D1QA 1D8KA 1OQYA 2DPUA 2QQ9A 1Z3XA 2OF7A 3J7ZI 3EYIA 4FTHA 4ZC3A 3FHNA 4AYBA 1IN6A 3QU3A 2LP0A 3IWFA 3J81Z 3P9KA 1ULYA 3BR0A 1TL8A 2IA1A 2ZXJA 2M7AA 3FMRA 4X0GA 4L9JA 3KP5A 3QU6A 3FKIJ 3O2PE 4KT5C 4EVIA 1W7PB 4XLHA 4KN4X 2NNNA 1GHCA 2ZSIB 2XSDC 2DPDA 3T1BA 3VPRA 1HSJA 1U9OA 4Q4ZF 2KLOA 2TRTA 2EFPA 3DTEA 3ASOH 2R7QA 2O8KA 5FRMA 2VKHA 2L9NA 3DFGA 2RC4A 4LG3A 3ZMSA 4I6ZA 4S0HB 3K4KA 2DBBA 4XRMA 2CQNA 4MNUA 4DZPA 1DGWY 2FU4A 3VSLA 4HNTA 4NC7A 3MAJA 4W97A 2Q8KA 1R5HA 3BR2A 4I02A 2XV4S 1LEAA 1YG2A 3HTUA 3QAHA 4MGRA 3GX4X 3D5SC 3BQZA 4KICA 5L3DA 2FE3A 2EFQA 2V6CA 3KZIC 3GZ6A 2DA7A 2XB5A 4Y17A 3CCEI 3GYHX 3CCRI 2OU2A 4RGRA 4V19K 1BR4A 3H36A 4NBQA 1YI2I 1HA8A 3K2ZA 2JSCA 3SEQA 1A6QA 5LEKA 3HHHA 2DTZA 4L18B 1I27A 4HX8A 1LVAA 1T0FA 3LA2A 3TQNA 2LF8A 3ZQCA 2DFHA 3F8CA 3BZ6A 1AKHB 5HVQC 1U78A 2FMLA 5E20A 3COAC 1WGXA 1SVLA 5GTHC 3F6VA 5CJ9A 3BR1A 4Z2YA 1EH7A 1IN7A 1ZRCA 5ERIA 1K4SA 4XKWA 2ESNA 1R23A 4M74A 1OYIA 3I59B 4CYDA 4IHXA 3L9FA 3ABUA 3PIOF 2Z5UA 5D5XB 1M1EB 2KFDA 2OA4A 4WCGA 1FP2A 2M0CA 3K1MA 1G2HA 4F52A 2E1OA 2F5DA 2JMWA 3QPSA 3FXUA 3I55I 2NVQJ 1W0TA 5TRDA 1D0ZA 1J2XA 1YLFA 3CMAI 3QPHA 5BPIA 4EM2A 1ZG1A 1H8AC 4HDUA 2HOSA 3I54A 4HBLA 2HXIA 5LBQA 4ENJA 1SEUA 1XSVA 3V4GA 3S1RJ 3GTQJ 1IDYA 1JKOC 4WX9A 1KQ0A 3OYFA 2BEOA 3KETA 1E3OC 5EYRA 4BE0A 3E5UA 2NVUB 4NHJA 2HOEA 5FKNA 2FBHA 5EF6A 3E3VA 3HRSA 1ZREA 5IYCJ 3K6GA 3ZQFA 3GFMA 4C3HJ 3KEQA 2E1CA 2KIFA 3PJRA 4GRIA 2CJJA 2KIMA 5IT9Z 4KN7X 2IRFG 3AL0C 4C9YA 2ZJRF 2EK5A 1OLTA 3OYAA
chains in the Genus database with same CATH topology
5BQTA 2BBYA 2VE8A 3ZMDA 5F1RA 2PMUA 4RAZA 1H9GA 1J7KA 4EGZA 1S6LA 5AONA 1CF7B 1U5TC 2R3SA 4U7BA 2L3DA 3I71A 1ZAOA 3BJAA 3F8BA 2K4BA 2A07F 3U1DA 2FA5A 1RUNA 2RQPA 2IPQX 1V3FA 3FMQA 3DEUA 3CO7C 2NRAC 4D0PA 2STTA 3K69A 3ZPLA 3I64A 3WGGA 2WV0A 3IKVA 1ZGAA 3RYPA 2Z9OA 1B9NA 1O3SA 5JVTA 4R8HA 4IHTA 1USTA 3Q5FA 5E8GA 2QQBA 3RYRA 1Z6RA 2Z33A 2ZNZA 2VBXA 1TNTA 4KFCA 2MLGA 3ULQB 2H6CA 3ZMVA 2HTSA 3SXYA 1K79A 3DXJF 4HF2A 2WTEA 1YO5C 4ESBA 2XRNA 2ZMEA 1Y0UA 2P4WA 1ON2A 1TLHB 2CSOA 5ILVA 5E1XA 3M8EA 4Q48A 1BC8C 1W4MA 2YU3A 2E7XA 2W25A 1OYYA 2V1UA 3F8MA 3M9AA 4P9UA 2ADUA 5D6EA 3I0TA 3MCZA 3SHFA 2DFIA 1BOAA 2ZBKA 3T8TA 4JBAA 1KYWA 1WWXA 1HW1A 2RGVA 4U88A 2XASA 5CVIA 1SFEA 3G73A 5J6XA 3BJOA 4TV7A 3JTGA 3ZMUA 1FSHA 5EEGA 4UXNA 4A5MA 2QM3A 2ELHA 2DT5A 2RNJA 1KU7A 4UNOA 2EWNA 1P4XA 2XKOA 2DQLA 1H9TA 1E2XA 2FBKA 4BH9A 2L54A 3WE2A 1REPC 1J9IA 3WGIA 4EGYA 4FHTA 3KP7A 2HYFA 4ZYDA 2PN6A 3KCCA 2UZKA 3ECOA 2STWA 5LGUA 5K1YA 2P6SA 4A12A 2G9WA 2FF4A 1DDNA 2QLZA 2ESHA 2A6EF 4M72A 1SMYF 1RUOA 4A6EA 2WC2A 2JTVA 4GGGA 2F5CA 2D45A 1K78A 1MD0A 1XSXA 4CICA 1KA8A 3KP4A 1NHAA 3F72A 1GXQA 3J80Z 2X4HA 2Q2EA 2FNAA 2NYXA 1U3EM 1LB2A 4GO1A 4LK0F 2MH9A 4LLLA 1O3RA 3VFZA 3IWZA 1YW7A 3GF2A 3WU1B 3KP3A 3F8NA 3R0JA 5D5UB 4RS8A 4S05A 1Z05A 4JQFA 1Q1HA 2V79A 3BY6A 3CUOA 5JFRA 1YS6A 1BN5A 3F23A 4PZJA 2P5VA 5CLSA 5DYMA 2A61A 1WKMA 3RJPA 4ZYEA 2HWVA 5E1WA 2D1HA 3KZZA 2ZMEB 1ZRFA 2C6YA 3C1DA 1J5YA 1P4AA 5D4RA 3WTTC 1QGPA 4MQVA 3E6BA 3GWZA 4HF0A 3E5XA 3K9TA 3CUQC 1ZG5A 3OOPA 3KLNA 3ZMZA 4YFKF 2UXXA 3R0AA 4XLPF 5L3GA 5IT3A 3GXOA 3E97A 4U7DA 1IXSB 1BI1A 3BP8A 3HRTA 1PP7U 2GWRA 4JK1X 1IUYA 3BPXA 1ZYRF 3BWGA 2VBWA 3ROUA 2TDXA 3FHZA 4EV0A 4G7HF 3FXQA 3BDDA 1L0OC 1U2WA 4L0ZB 2IA0A 5ICFA 2XROA 4KYWA 1STZA 2GQQA 1B6AA 2JRTA 4N0BA 1JE8A 2VN2A 4UV8A 4EJVA 1G3SA 3LFKA 2DAOA 3FM5A 4QLCU 3G3ZA 3GFIA 2KKOA 3GZ5A 2XGXA 4IRGA 1K78B 3PFIA 4KIGA 4LK1F 4RB0A 1XN7A 1ZHFA 1ZARA 5F64A 5HLIA 2LSOA 1LDJA 4RAYA 4NQWA 3E6MA 1HXDA 2B0LA 2Y75A 3V7CA 1O3TA 1YQAA 1I1SA 4EM0B 2JPCA 5FD5A 2W84A 4BHBA 5HDGA 3WE3A 1WSUA 1QZZA 1U5TA 2W24A 3K0LA 1IXCA 5DD4A 2M45A 2YPRA 1HW5A 1S7OA 2F5FA 2NS0A 3JAMK 4PGGA 2A69F 3I5UA 3GVAA 3KEOA 2CQKA 5K5OA 1P6RA 2QYOA 3L00A 3LWFA 2D1VA 1K6OA 3NEUA 5ICCA 3QOPA 5H6QA 4WXHA 1FPQA 2XVCA 5FD6A 2DLLA 4XBFA 2YR2A 4RGSA 5FGMA 1WI9A 3LAJA 1FC3A 3IC7A 1YW8A 3KP6A 3DV8A 5K5RA 1HQCA 2CYYA 1UFMA 1KU9A 2OQGA 4A0YA 4LD5A 2A3SA 1ZLJA 1OMIA 3ELKA 3SQNA 2HTJA 3BROA 3O3KA 4UHTA 2KJBA 2X0LA 3I53A 2VONA 2VOPA 1LDKB 4IRHA 4PCQA 1DPRA 4M6XA 2HDCA 3IRQA 1IF1A 1G3YA 4HQEA 5BS6A 2G7HA 1YTYA 4AIHA 1IRGA 1O7FA 4IF4A 4MTEA 3D5LA 5HDKA 2DO7A 5FLXZ 1GVJA 2V9VA 1F4KA 1FLIA 1MDMA 4A0ZA 5J8CA 1YFHA 3SZPA 4HZFA 1G3TA 1W5TA 1R1UA 2FEZA 4YFNF 2JPBA 5LRRA 3JTHA 4R79A 3HSRA 3PQKA 5CVJA 4ZZLA 3CDHA 2GZWA 5L3CA 2VOOA 2ZNYA 2DQRA 2G7UA 4ZYHA 3E6CC 2P6TA 1D5VA 3ML6A 1LNWA 2CO5A 1IN8A 2O61A 1IZ1A 5ICGA 5LHHA 2M5WA 5LGNA 2DW4A 2HEOA 4HA8A 2GXBA 1B9MA 3Q9SA 5DDGA 2QVOA 2XAGA 2OBPA 2PJPA 3SZTA 4RB1A 4EM1A 1YS7A 2CG4A 3U9GA 4G7OF 4HAMA 1FWZA 1S29A 1U5TB 3DKWA 2IT0A 3V8KA 2LKPA 3LQRA 1MJ9A 3WTWC 2V1DA 4I0BA 2DI3A 3EYYA 2CW0F 3EDPA 4FX0A 5HS9A 3IHUA 2EV5A 3JW4A 1KU2A 1EH6A 2V1XA 1RZ4A 1XSDA 3QP5A 1MJAA 1FP1D 2BYVE 1O3QA 4EJWA 2PLYA 2IP2A 4G6DA 3LA7A 4BXUA 2UWMA 4ENKA 1LDDA 1Z9CA 4CXFA 4WK8F 2KJCA 2IA2A 2PFBA 2HFHA 4KMUX 2HZTA 4E70A 1F5TA 1OYWA 3RIRA 1IW7F 3NQOA 1T2KA 1R22A 3J81K 2VBYA 1FX7A 4YFXF 1I1GA 4LLGF 3WU0A 2XAFA 3MWMA 1R7JA 4KIBA 1K7AA 5D8LB 3CUQA 1QPMA 1MDMB 3K1NA 3HOSA 3T0YA 1U6GA 4S04A 2MD5A 1QNTA 2P8TA 4BQAA 1ODDA 3P9CA 4OMZA 1R00A 4L5IA 4BNCA 3REOA 2H94A 4Y15A 4P9FA 3MFKA 1R1VA 3C7JA 1JGSA 1FY7A 2P7VB 4ZYGA 3FWEA 2D2WA 1XB4A 1FYMA 3MZYA 2GAUA 3TOAA 1FT9A 1ZGJA 1SD4A 5E1ZB 1LEBA 5H6RA 1XMAA 1SFUA 3FX3A 3ERED 4WWCA 1RI7A 4U0VA 4XLNF 2OD5A 1C0WA 5FLXK 3PQJA 5ICEA 4LG0A 5CVUA 4YIFA 1TW2A 3GLXA 3GFJA 1AWCA 1ZG3A 3CJNA 2J5PA 5HS8A 5BPDA 1BIAA 3V7RA 3RKXA 3KP2A 1SD5A 4U0YA 2A68F 2KIUA 5BOXA 5IT9K 3T5XA 5FO5A 4AIKA 3EQLF 2RDPA 2HGCA 2FSWA 4M9SA 4LMYA 4KIFA 2W57A 4B8XA 2WWYA 3T8RA 5HLHA 3P7NA 5LHGA 1D8JA 3SFZA 2W85A 4IPAA 1R36A 1TQPA 4OIRF 1J0RA 2GA2A 4HLXA 4KNYA 1BM9A 3QP6A 1XDUA 2E1NA 1LQ1A 2K02A 3D0SA 4MHGA 5AIQA 1I6XA 2K86A 4KUMA 4RB3C 4I01A 3LA3A 1DPUA 4GYGA 4G7ZF 2XAJA 3RDIA 5EEHA 4OINF 2HKXA 5KVRA 2H27A 1PUEE 2XKPA 4MTDA 2HQNA 4EJTA 2F2EA 1P2FA 4P96A 3F3XA 2M8EA 3CUQB 4M9XA 2VT3A 4ESJA 1ZN2A 2K7LA 4EJUA 3H92A 3CLOA 2Z3YA 2H6BA 1SAXA 2VBZA 3AAFA 5TJJA 1USSA 2O8XA 4LB6B 4I0AA 1E17A 1G4DA 3U2RA 4CGZA 5CVVA 5LLQA 5K5QA 5D4SA 2K27A 5L3BA 1MZBA 4A2UA 3Q9VA 2VC1A 5JHUA 2HR3A 4LB5A 2ZJ2A 4G9YA 1IRFA 2COMA 4L0YB 3L7WA 5DCFA 5HOOA 1Z6TA 5DCMA 1F1ZA 2F5EA 4P5OA 1Z91A 2J5OA 4ETSA 4HF1A 4XRFA 1ON1A 3F8FA 4EQQA 3L2CA 2IW5A 3KZYA 4Y13A 3HRUA 4EMSA 3EETA 2RN7A 2K4JA 4LG0B 1YYVA 2P5KA 4ZZDA 2Z99A 2LNBA 1XGOA 4CO8A 3ZMTA 1B1BA 1KGSA 1J59A 3FM3A 5AIPA 4GXOA 1R58A 1KQ8A 4HV6A 5CVRA 2HYGD 4G6QA 1QZYA 2XIGA 1XCBA 4LLNA 1KU3A 3VEPA 4KDPA 5L3EA 2HQRA 4I98B 3N4MA 4HLYA 4HX4A 3WODF 1HBXG 1FBUA 4A0XA 4ASNA 1SD7A 2MA3A 1W7PD 3MZHA 3BOQA 5A2QZ 1R5GA 3RPQA 4ZH4F 3GO5A 2ZO4A 3O6BB 1UHMA 5DUKA 2ZFWA 1TW3A 1MJBA 4O6JA 3GW2A 1T38A 2ISZA 5D5WB 2EV6A 4M9ZA 3HYIA 3HRMA 4CDGA 1D3YA 4F7ZA 1FYLA 1SFXA 3ZN0A 5FFZA 4XSXF 2EFNA 2QZ8A 3J80K 1GXPA 1R1TA 3IKTA 4KA4A 2P7CB 1FNNA 4G94A 1XGMA 1G3WA 1KYZA 4GCVA 4ON0A 2QENA 4ESFA 1RIOH 3WTXC 3H3ZA 1T39A 2XUBA 4GYIA 1Z1DA 3MEXA 1XGNA 3C3WA 3GEZA 5JI6A 5J8FA 2ZCWA 3WGHA 5DUIA 3BJ6A 1HSTA 2L02A 2MBFA 2L01A 5DV5A 1HKQA 3ZQ7A 1MGTA 4L9VA 3HTSB 5ILUA 1B4AA 2FOKA 3KFWX 3M7GA 1KQ9A 5LRSA 2ETHA 2O3FA 5ILSA 4CHUA 4DNCA 4NB5A 4L9TA 5DCMB 1G6NA 1O7LA 1HKTA 2P5LC 4B09A 1XCVA 4UVAA 1I5ZA 3EUHA 1BI3A 2Y0MA 3B02A 4WXCA 4L9NA 2YSRA 2VT2A 1A04A 3WTYC 3J7AO 4CZZA 2YX4A 3WTZA 5HDNA 2PI0A 2CGPA 5L3FA 2QBYA 4HYEA 4M71A 4HDVA 4OIPF 3VOEA 3M1EA 4WF2A 3W6KB 3HHGA 2FQ3A 2O0YA 3TO6A 5F6FA 3CO6C 1FOKA 2R7FA 3DQVC 1WRJA 4P55A 3W6JB 2QQAA 2FRHA 4OOIA 2NAZA 1ZRDA 3HUGA 4L5JA 5FB2A 3P9IA 3HSEA 5JR3A 5LEJA 3ZN1A 4YG2F 3WG9A 1P92A 2O03A 4R1HA 1SD6A 4IXAA 4OIQF 1XGSA 3I58A 5LHIA 4O5VA 2HS5A 1AOYA 4BAYA 3NRVA 1RNLA 2EFWA 4MEYF 4N9IA 3C18A 2EV0A 4A6DA 3RPUA 3R61A 5E17F 1U8RA 6PAXA 3E5QA 3TO9A 1FBQA 5ED4A 4Q47A 2EA4A 1BC7C 4ENNA 4PDKA 1JHHA 5KK1A 1YW9A 4UVBA 1J75A 2H09A 3S2WA 2HKOA 1XDSA 2EFOA 2JT1A 5A2QK 1IN5A 4BHPA 1O57A 2E7WA 3E6DA 1IN4A 2YX7A 4O3MA 3TOBA 2OZ6A 2PQ8A 2Q0OA 1S8NA 2XAHA 2ZKZA 4HV5A 1TBXA 2DTRA 3WTUC 1TNSA 4MEXF 4ENMA 4M6YA 3ECHA 1JXSA 2QWWA 2IVMA 2LDUA 2RKHA 1PDNC 2PEXA 4UVCA 2OZUA 4AD9A 4G8XA 3FZVA 3IRRA 2ISYA 2MC3A 3QRFF 5BMZA 4M73A 3HSFA 2BE5F 1DUXC 5FFXA 2QBYB 3KE2A 2A6HF 4WXDA 4HX7A 1BJAA 1CGPA 3DPTA 2QUFA 4I7HA 3KLOA 3JAMZ 3GUDA 3R4KA 1T98A 1UB9A 3GFLA 2FMYA 1S7AA 3F6OA 4BHCA 5D6FA 4N9HA 3K1PA 3R60A 2Y48A 3DF8A 4LFUA 2GIVA 5D8KB 3TDZC 4RGUA 3WTVC 3IL2A 3ZP5A 4U0WA 2R7DA 4XSZF 4AVPA 1V4RA 3FF5A 3TDUC 1WQ2A 4IJAA 2BGCA 2AS5F 1FYKA 2PG4A 1W5SA 1Z7UA 3VB2A 1ZH5A 1FSEA 3I4PA 2DU9A 4HQMA 1OKRA 3ABTA 2EB7A 3TO7A 2VE9A 4Q5SF 5DD8A 3RKWA 3DP7A 2MH2A 1IXRC 2FBIA 2ACJA 1W7PA 3WTSC 2BV6A 2GA1A 4AIJA 2M30A 3MQ0A 4I2OA 3RKYA 2UXNA 2O6GE 2VXZA 4A5NA 1QQIA 1SMTA 4IVNA 2EA2A 1DP7P 2IJLA 2FXAA 4BYYA 3N97A 4DQ2A 3QPTA 2FNPA 4EJOA 1X3UA 1OR7A 4LGWA 1VTNC 3HOTA 1TTYA 3LQQA 1B59A 4HW0A 5H20A 2VODA 1LJ9A 2RVCA 3BPVA 4QWQA 1FZPB 2AXLA 1XD7A 2PBIA 2VC0A 1IAWA 3VODA 5E8IA 2EJRA 5CYVA 4IRIA 2M1BA 2M87A 3L09A 1F9NA 4RB2C 3LSTA 1MKMA 2L4MA 1TQIA 4K2EA 1FBSA 1QBJA 3TGNA 1BIBA 5HS7A 3RTRA 1HW2A 2CWEA 3I59A 4RGXA 4FT8A 1QO0D 4UV9A 3OV8A 3H3UA 3JSPA 4FX4A 1TQMA 3V8JA 2XHKA 2NNYA 5HLGA 4AWXB 2XAQA 1L3LA 2CFXA 3HIFA 3V7SA 1JHFA 1EV7A 1UCRA 3RI4A 4KMFA 4LJZF 1BBYA 3LAPA 2DK5A 2MLKA 2A5YB 1ZLKA 1P4WA 3JSOA 1YIOA 3FMSA 3R6SA 2GXGA 3TKYA 5DEQA 3B73A 1BI0A 1EH8A 1H0MA 1UHWA 4IHSA 2JZYA 1BI2A 2KRFA 3CTAA 2DK8A 3F21A 4OU0A 5D5VB 3FXRA 2LF7A 2PMHA 1S3JA 4YIIA 4UUVA 3DPLC 1HKSA 1ONVA 5LGTA 4OMYA 4HOBA 4OIOF 1T6SA 1CF7A 4MQ9F 3M8FA 1OPCA 2RV8A 1PP8F 4H0EA 2OQRA 4PGHA 2L4AA 2OAZA 4I09A 1XMKA 3F22A 5E18F 3V8LA 3ISPA 1D8KA 2DPUA 2QQ9A 3EYIA 1IN6A 3QU3A 3IWFA 3J81Z 3P9KA 1ULYA 2IA1A 2ZXJA 3FMRA 4L9JA 3KP5A 3QU6A 3O2PE 4KT5C 4EVIA 1W7PB 4KN4X 2NNNA 1GHCA 2DPDA 3T1BA 1HSJA 4Q4ZF 2EFPA 3DFGA 2RC4A 3ZMSA 2DBBA 4MNUA 2FU4A 2Q8KA 3MAJA 1R5HA 4I02A 2XV4S 1LEAA 1YG2A 3HTUA 3QAHA 4MGRA 3GX4X 4KICA 5L3DA 2FE3A 2EFQA 2V6CA 3GZ6A 4Y17A 3GYHX 2OU2A 4RGRA 3K2ZA 2JSCA 5LEKA 3HHHA 4L18B 1I27A 4HX8A 1LVAA 1T0FA 3LA2A 3TQNA 2LF8A 3F8CA 3BZ6A 5HVQC 1U78A 2FMLA 5E20A 3COAC 3F6VA 5CJ9A 4Z2YA 1EH7A 1IN7A 1ZRCA 5ERIA 2ESNA 1R23A 4M74A 1OYIA 3I59B 4CYDA 3L9FA 3ABUA 2Z5UA 5D5XB 2OA4A 4WCGA 1FP2A 3K1MA 2F5DA 3FXUA 5TRDA 1YLFA 1J2XA 5BPIA 3QPHA 4EM2A 1ZG1A 4HDUA 3I54A 4HBLA 5LBQA 4ENJA 1XSVA 3V4GA 4WX9A 1KQ0A 2BEOA 3KETA 3E5UA 4NHJA 2HOEA 2FBHA 3E3VA 3HRSA 1ZREA 3GFMA 3KEQA 2E1CA 2KIFA 2KIMA 5IT9Z 4KN7X 2IRFG 2EK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BQT A;  2BBY A;  2VE8 A;  3ZMD A;  5F1R A;  2PMU A;  4RAZ A;  1H9G A;  1J7K A;  4EGZ A;  1S6L A;  5AON A;  1CF7 B;  1U5T C;  2R3S A;  4U7B A;  2L3D A;  3I71 A;  1ZAO A;  3BJA A;  3F8B A;  2K4B A;  2A07 F;  3U1D A;  2FA5 A;  1RUN A;  2RQP A;  2IPQ X;  1V3F A;  3FMQ A;  3DEU A;  3CO7 C;  2NRA C;  4D0P A;  2STT A;  3K69 A;  3ZPL A;  3I64 A;  3WGG A;  2WV0 A;  3IKV A;  1ZGA A;  3RYP A;  2Z9O A;  1B9N A;  1O3S A;  5JVT A;  4R8H A;  4IHT A;  1UST A;  3Q5F A;  5E8G A;  2QQB A;  3RYR A;  1Z6R A;  2Z33 A;  2ZNZ A;  2VBX A;  1TNT A;  4KFC A;  2MLG A;  3ULQ B;  2H6C A;  3ZMV A;  2HTS A;  3SXY A;  1K79 A;  3DXJ F;  4HF2 A;  2WTE A;  1YO5 C;  4ESB A;  2XRN A;  2ZME A;  1Y0U A;  2P4W A;  1ON2 A;  1TLH B;  2CSO A;  5ILV A;  5E1X A;  3M8E A;  4Q48 A;  1BC8 C;  1W4M A;  2YU3 A;  2E7X A;  2W25 A;  1OYY A;  2V1U A;  3F8M A;  3M9A A;  4P9U A;  2ADU A;  5D6E A;  3I0T A;  3MCZ A;  3SHF A;  2DFI A;  1BOA A;  2ZBK A;  3T8T A;  4JBA A;  1KYW A;  1WWX A;  1HW1 A;  2RGV A;  4U88 A;  2XAS A;  5CVI A;  1SFE A;  3G73 A;  5J6X A;  3BJO A;  4TV7 A;  3JTG A;  3ZMU A;  1FSH A;  5EEG A;  4UXN A;  4A5M A;  2QM3 A;  2ELH A;  2DT5 A;  2RNJ A;  1KU7 A;  4UNO A;  2EWN A;  1P4X A;  2XKO A;  2DQL A;  1H9T A;  1E2X A;  2FBK A;  4BH9 A;  2L54 A;  3WE2 A;  1REP C;  1J9I A;  3WGI A;  4EGY A;  4FHT A;  3KP7 A;  2HYF A;  4ZYD A;  2PN6 A;  3KCC A;  2UZK A;  3ECO A;  2STW A;  5LGU A;  5K1Y A;  2P6S A;  4A12 A;  2G9W A;  2FF4 A;  1DDN A;  2QLZ A;  2ESH A;  2A6E F;  4M72 A;  1SMY F;  1RUO A;  4A6E A;  2WC2 A;  2JTV A;  4GGG A;  2F5C A;  2D45 A;  1K78 A;  1MD0 A;  1XSX A;  4CIC A;  1KA8 A;  3KP4 A;  1NHA A;  3F72 A;  1GXQ A;  3J80 Z;  2X4H A;  2Q2E A;  2FNA A;  2NYX A;  1U3E M;  1LB2 A;  4GO1 A;  4LK0 F;  2MH9 A;  4LLL A;  1O3R A;  3VFZ A;  3IWZ A;  1YW7 A;  3GF2 A;  3WU1 B;  3KP3 A;  3F8N A;  3R0J A;  5D5U B;  4RS8 A;  4S05 A;  1Z05 A;  4JQF A;  1Q1H A;  2V79 A;  3BY6 A;  3CUO A;  5JFR A;  1YS6 A;  1BN5 A;  3F23 A;  4PZJ A;  2P5V A;  5CLS A;  5DYM A;  2A61 A;  1WKM A;  3RJP A;  4ZYE A;  2HWV A;  5E1W A;  2D1H A;  3KZZ A;  2ZME B;  1ZRF A;  2C6Y A;  3C1D A;  1J5Y A;  1P4A A;  5D4R A;  3WTT C;  1QGP A;  4MQV A;  3E6B A;  3GWZ A;  4HF0 A;  3E5X A;  3K9T A;  3CUQ C;  1ZG5 A;  3OOP A;  3KLN A;  3ZMZ A;  4YFK F;  2UXX A;  3R0A A;  4XLP F;  5L3G A;  5IT3 A;  3GXO A;  3E97 A;  4U7D A;  1IXS B;  1BI1 A;  3BP8 A;  3HRT A;  1PP7 U;  2GWR A;  4JK1 X;  1IUY A;  3BPX A;  1ZYR F;  3BWG A;  2VBW A;  3ROU A;  2TDX A;  3FHZ A;  4EV0 A;  4G7H F;  3FXQ A;  3BDD A;  1L0O C;  1U2W A;  4L0Z B;  2IA0 A;  5ICF A;  2XRO A;  4KYW A;  1STZ A;  2GQQ A;  1B6A A;  2JRT A;  4N0B A;  1JE8 A;  2VN2 A;  4UV8 A;  4EJV A;  1G3S A;  3LFK A;  2DAO A;  3FM5 A;  4QLC U;  3G3Z A;  3GFI A;  2KKO A;  3GZ5 A;  2XGX A;  4IRG A;  1K78 B;  3PFI A;  4KIG A;  4LK1 F;  4RB0 A;  1XN7 A;  1ZHF A;  1ZAR A;  5F64 A;  5HLI A;  2LSO A;  1LDJ A;  4RAY A;  4NQW A;  3E6M A;  1HXD A;  2B0L A;  2Y75 A;  3V7C A;  1O3T A;  1YQA A;  1I1S A;  4EM0 B;  2JPC A;  5FD5 A;  2W84 A;  4BHB A;  5HDG A;  3WE3 A;  1WSU A;  1QZZ A;  1U5T A;  2W24 A;  3K0L A;  1IXC A;  5DD4 A;  2M45 A;  2YPR A;  1HW5 A;  1S7O A;  2F5F A;  2NS0 A;  3JAM K;  4PGG A;  2A69 F;  3I5U A;  3GVA A;  3KEO A;  2CQK A;  5K5O A;  1P6R A;  2QYO A;  3L00 A;  3LWF A;  2D1V A;  1K6O A;  3NEU A;  5ICC A;  3QOP A;  5H6Q A;  4WXH A;  1FPQ A;  2XVC A;  5FD6 A;  2DLL A;  4XBF A;  2YR2 A;  4RGS A;  5FGM A;  1WI9 A;  3LAJ A;  1FC3 A;  3IC7 A;  1YW8 A;  3KP6 A;  3DV8 A;  5K5R A;  1HQC A;  2CYY A;  1UFM A;  1KU9 A;  2OQG A;  4A0Y A;  4LD5 A;  2A3S A;  1ZLJ A;  1OMI A;  3ELK A;  3SQN A;  2HTJ A;  3BRO A;  3O3K A;  4UHT A;  2KJB A;  2X0L A;  3I53 A;  2VON A;  2VOP A;  1LDK B;  4IRH A;  4PCQ A;  1DPR A;  4M6X A;  2HDC A;  3IRQ A;  1IF1 A;  1G3Y A;  4HQE A;  5BS6 A;  2G7H A;  1YTY A;  4AIH A;  1IRG A;  1O7F A;  4IF4 A;  4MTE A;  3D5L A;  5HDK A;  2DO7 A;  5FLX Z;  1GVJ A;  2V9V A;  1F4K A;  1FLI A;  1MDM A;  4A0Z A;  5J8C A;  1YFH A;  3SZP A;  4HZF A;  1G3T A;  1W5T A;  1R1U A;  2FEZ A;  4YFN F;  2JPB A;  5LRR A;  3JTH A;  4R79 A;  3HSR A;  3PQK A;  5CVJ A;  4ZZL A;  3CDH A;  2GZW A;  5L3C A;  2VOO A;  2ZNY A;  2DQR A;  2G7U A;  4ZYH A;  3E6C C;  2P6T A;  1D5V A;  3ML6 A;  1LNW A;  2CO5 A;  1IN8 A;  2O61 A;  1IZ1 A;  5ICG A;  5LHH A;  2M5W A;  5LGN A;  2DW4 A;  2HEO A;  4HA8 A;  2GXB A;  1B9M A;  3Q9S A;  5DDG A;  2QVO A;  2XAG A;  2OBP A;  2PJP A;  3SZT A;  4RB1 A;  4EM1 A;  1YS7 A;  2CG4 A;  3U9G A;  4G7O F;  4HAM A;  1FWZ A;  1S29 A;  1U5T B;  3DKW A;  2IT0 A;  3V8K A;  2LKP A;  3LQR A;  1MJ9 A;  3WTW C;  2V1D A;  4I0B A;  2DI3 A;  3EYY A;  2CW0 F;  3EDP A;  4FX0 A;  5HS9 A;  3IHU A;  2EV5 A;  3JW4 A;  1KU2 A;  1EH6 A;  2V1X A;  1RZ4 A;  1XSD A;  3QP5 A;  1MJA A;  1FP1 D;  2BYV E;  1O3Q A;  4EJW A;  2PLY A;  2IP2 A;  4G6D A;  3LA7 A;  4BXU A;  2UWM A;  4ENK A;  1LDD A;  1Z9C A;  4CXF A;  4WK8 F;  2KJC A;  2IA2 A;  2PFB A;  2HFH A;  4KMU X;  2HZT A;  4E70 A;  1F5T A;  1OYW A;  3RIR A;  1IW7 F;  3NQO A;  1T2K A;  1R22 A;  3J81 K;  2VBY A;  1FX7 A;  4YFX F;  1I1G A;  4LLG F;  3WU0 A;  2XAF A;  3MWM A;  1R7J A;  4KIB A;  1K7A A;  5D8L B;  3CUQ A;  1QPM A;  1MDM B;  3K1N A;  3HOS A;  3T0Y A;  1U6G A;  4S04 A;  2MD5 A;  1QNT A;  2P8T A;  4BQA A;  1ODD A;  3P9C A;  4OMZ A;  1R00 A;  4L5I A;  4BNC A;  3REO A;  2H94 A;  4Y15 A;  4P9F A;  3MFK A;  1R1V A;  3C7J A;  1JGS A;  1FY7 A;  2P7V B;  4ZYG A;  3FWE A;  2D2W A;  1XB4 A;  1FYM A;  3MZY A;  2GAU A;  3TOA A;  1FT9 A;  1ZGJ A;  1SD4 A;  5E1Z B;  1LEB A;  5H6R A;  1XMA A;  1SFU A;  3FX3 A;  3ERE D;  4WWC A;  1RI7 A;  4U0V A;  4XLN F;  2OD5 A;  1C0W A;  5FLX K;  3PQJ A;  5ICE A;  4LG0 A;  5CVU A;  4YIF A;  1TW2 A;  3GLX A;  3GFJ A;  1AWC A;  1ZG3 A;  3CJN A;  2J5P A;  5HS8 A;  5BPD A;  1BIA A;  3V7R A;  3RKX A;  3KP2 A;  1SD5 A;  4U0Y A;  2A68 F;  2KIU A;  5BOX A;  5IT9 K;  3T5X A;  5FO5 A;  4AIK A;  3EQL F;  2RDP A;  2HGC A;  2FSW A;  4M9S A;  4LMY A;  4KIF A;  2W57 A;  4B8X A;  2WWY A;  3T8R A;  5HLH A;  3P7N A;  5LHG A;  1D8J A;  3SFZ A;  2W85 A;  4IPA A;  1R36 A;  1TQP A;  4OIR F;  1J0R A;  2GA2 A;  4HLX A;  4KNY A;  1BM9 A;  3QP6 A;  1XDU A;  2E1N A;  1LQ1 A;  2K02 A;  3D0S A;  4MHG A;  5AIQ A;  1I6X A;  2K86 A;  4KUM A;  4RB3 C;  4I01 A;  3LA3 A;  1DPU A;  4GYG A;  4G7Z F;  2XAJ A;  3RDI A;  5EEH A;  4OIN F;  2HKX A;  5KVR A;  2H27 A;  1PUE E;  2XKP A;  4MTD A;  2HQN A;  4EJT A;  2F2E A;  1P2F A;  4P96 A;  3F3X A;  2M8E A;  3CUQ B;  4M9X A;  2VT3 A;  4ESJ A;  1ZN2 A;  2K7L A;  4EJU A;  3H92 A;  3CLO A;  2Z3Y A;  2H6B A;  1SAX A;  2VBZ A;  3AAF A;  5TJJ A;  1USS A;  2O8X A;  4LB6 B;  4I0A A;  1E17 A;  1G4D A;  3U2R A;  4CGZ A;  5CVV A;  5LLQ A;  5K5Q A;  5D4S A;  2K27 A;  5L3B A;  1MZB A;  4A2U A;  3Q9V A;  2VC1 A;  5JHU A;  2HR3 A;  4LB5 A;  2ZJ2 A;  4G9Y A;  1IRF A;  2COM A;  4L0Y B;  3L7W A;  5DCF A;  5HOO A;  1Z6T A;  5DCM A;  1F1Z A;  2F5E A;  4P5O A;  1Z91 A;  2J5O A;  4ETS A;  4HF1 A;  4XRF A;  1ON1 A;  3F8F A;  4EQQ A;  3L2C A;  2IW5 A;  3KZY A;  4Y13 A;  3HRU A;  4EMS A;  3EET A;  2RN7 A;  2K4J A;  4LG0 B;  1YYV A;  2P5K A;  4ZZD A;  2Z99 A;  2LNB A;  1XGO A;  4CO8 A;  3ZMT A;  1B1B A;  1KGS A;  1J59 A;  3FM3 A;  5AIP A;  4GXO A;  1R58 A;  1KQ8 A;  4HV6 A;  5CVR A;  2HYG D;  4G6Q A;  1QZY A;  2XIG A;  1XCB A;  4LLN A;  1KU3 A;  3VEP A;  4KDP A;  5L3E A;  2HQR A;  4I98 B;  3N4M A;  4HLY A;  4HX4 A;  3WOD F;  1HBX G;  1FBU A;  4A0X A;  4ASN A;  1SD7 A;  2MA3 A;  1W7P D;  3MZH A;  3BOQ A;  5A2Q Z;  1R5G A;  3RPQ A;  4ZH4 F;  3GO5 A;  2ZO4 A;  3O6B B;  1UHM A;  5DUK A;  2ZFW A;  1TW3 A;  1MJB A;  4O6J A;  3GW2 A;  1T38 A;  2ISZ A;  5D5W B;  2EV6 A;  4M9Z A;  3HYI A;  3HRM A;  4CDG A;  1D3Y A;  4F7Z A;  1FYL A;  1SFX A;  3ZN0 A;  5FFZ A;  4XSX F;  2EFN A;  2QZ8 A;  3J80 K;  1GXP A;  1R1T A;  3IKT A;  4KA4 A;  2P7C B;  1FNN A;  4G94 A;  1XGM A;  1G3W A;  1KYZ A;  4GCV A;  4ON0 A;  2QEN A;  4ESF A;  1RIO H;  3WTX C;  3H3Z A;  1T39 A;  2XUB A;  4GYI A;  1Z1D A;  3MEX A;  1XGN A;  3C3W A;  3GEZ A;  5JI6 A;  5J8F A;  2ZCW A;  3WGH A;  5DUI A;  3BJ6 A;  1HST A;  2L02 A;  2MBF A;  2L01 A;  5DV5 A;  1HKQ A;  3ZQ7 A;  1MGT A;  4L9V A;  3HTS B;  5ILU A;  1B4A A;  2FOK A;  3KFW X;  3M7G A;  1KQ9 A;  5LRS A;  2ETH A;  2O3F A;  5ILS A;  4CHU A;  4DNC A;  4NB5 A;  4L9T A;  5DCM B;  1G6N A;  1O7L A;  1HKT A;  2P5L C;  4B09 A;  1XCV A;  4UVA A;  1I5Z A;  3EUH A;  1BI3 A;  2Y0M A;  3B02 A;  4WXC A;  4L9N A;  2YSR A;  2VT2 A;  1A04 A;  3WTY C;  3J7A O;  4CZZ A;  2YX4 A;  3WTZ A;  5HDN A;  2PI0 A;  2CGP A;  5L3F A;  2QBY A;  4HYE A;  4M71 A;  4HDV A;  4OIP F;  3VOE A;  3M1E A;  4WF2 A;  3W6K B;  3HHG A;  2FQ3 A;  2O0Y A;  3TO6 A;  5F6F A;  3CO6 C;  1FOK A;  2R7F A;  3DQV C;  1WRJ A;  4P55 A;  3W6J B;  2QQA A;  2FRH A;  4OOI A;  2NAZ A;  1ZRD A;  3HUG A;  4L5J A;  5FB2 A;  3P9I A;  3HSE A;  5JR3 A;  5LEJ A;  3ZN1 A;  4YG2 F;  3WG9 A;  1P92 A;  2O03 A;  4R1H A;  1SD6 A;  4IXA A;  4OIQ F;  1XGS A;  3I58 A;  5LHI A;  4O5V A;  2HS5 A;  1AOY A;  4BAY A;  3NRV A;  1RNL A;  2EFW A;  4MEY F;  4N9I A;  3C18 A;  2EV0 A;  4A6D A;  3RPU A;  3R61 A;  5E17 F;  1U8R A;  6PAX A;  3E5Q A;  3TO9 A;  1FBQ A;  5ED4 A;  4Q47 A;  2EA4 A;  1BC7 C;  4ENN A;  4PDK A;  1JHH A;  5KK1 A;  1YW9 A;  4UVB A;  1J75 A;  2H09 A;  3S2W A;  2HKO A;  1XDS A;  2EFO A;  2JT1 A;  5A2Q K;  1IN5 A;  4BHP A;  1O57 A;  2E7W A;  3E6D A;  1IN4 A;  2YX7 A;  4O3M A;  3TOB A;  2OZ6 A;  2PQ8 A;  2Q0O A;  1S8N A;  2XAH A;  2ZKZ A;  4HV5 A;  1TBX A;  2DTR A;  3WTU C;  1TNS A;  4MEX F;  4ENM A;  4M6Y A;  3ECH A;  1JXS A;  2QWW A;  2IVM A;  2LDU A;  2RKH A;  1PDN C;  2PEX A;  4UVC A;  2OZU A;  4AD9 A;  4G8X A;  3FZV A;  3IRR A;  2ISY A;  2MC3 A;  3QRF F;  5BMZ A;  4M73 A;  3HSF A;  2BE5 F;  1DUX C;  5FFX A;  2QBY B;  3KE2 A;  2A6H F;  4WXD A;  4HX7 A;  1BJA A;  1CGP A;  3DPT A;  2QUF A;  4I7H A;  3KLO A;  3JAM Z;  3GUD A;  3R4K A;  1T98 A;  1UB9 A;  3GFL A;  2FMY A;  1S7A A;  3F6O A;  4BHC A;  5D6F A;  4N9H A;  3K1P A;  3R60 A;  2Y48 A;  3DF8 A;  4LFU A;  2GIV A;  5D8K B;  3TDZ C;  4RGU A;  3WTV C;  3IL2 A;  3ZP5 A;  4U0W A;  2R7D A;  4XSZ F;  4AVP A;  1V4R A;  3FF5 A;  3TDU C;  1WQ2 A;  4IJA A;  2BGC A;  2AS5 F;  1FYK A;  2PG4 A;  1W5S A;  1Z7U A;  3VB2 A;  1ZH5 A;  1FSE A;  3I4P A;  2DU9 A;  4HQM A;  1OKR A;  3ABT A;  2EB7 A;  3TO7 A;  2VE9 A;  4Q5S F;  5DD8 A;  3RKW A;  3DP7 A;  2MH2 A;  1IXR C;  2FBI A;  2ACJ A;  1W7P A;  3WTS C;  2BV6 A;  2GA1 A;  4AIJ A;  2M30 A;  3MQ0 A;  4I2O A;  3RKY A;  2UXN A;  2O6G E;  2VXZ A;  4A5N A;  1QQI A;  1SMT A;  4IVN A;  2EA2 A;  1DP7 P;  2IJL A;  2FXA A;  4BYY A;  3N97 A;  4DQ2 A;  3QPT A;  2FNP A;  4EJO A;  1X3U A;  1OR7 A;  4LGW A;  1VTN C;  3HOT A;  1TTY A;  3LQQ A;  1B59 A;  4HW0 A;  5H20 A;  2VOD A;  1LJ9 A;  2RVC A;  3BPV A;  4QWQ A;  1FZP B;  2AXL A;  1XD7 A;  2PBI A;  2VC0 A;  1IAW A;  3VOD A;  5E8I A;  2EJR A;  5CYV A;  4IRI A;  2M1B A;  2M87 A;  3L09 A;  1F9N A;  4RB2 C;  3LST A;  1MKM A;  2L4M A;  1TQI A;  4K2E A;  1FBS A;  1QBJ A;  3TGN A;  1BIB A;  5HS7 A;  3RTR A;  1HW2 A;  2CWE A;  3I59 A;  4RGX A;  4FT8 A;  1QO0 D;  4UV9 A;  3OV8 A;  3H3U A;  3JSP A;  4FX4 A;  1TQM A;  3V8J A;  2XHK A;  2NNY A;  5HLG A;  4AWX B;  2XAQ A;  1L3L A;  2CFX A;  3HIF A;  3V7S A;  1JHF A;  1EV7 A;  1UCR A;  3RI4 A;  4KMF A;  4LJZ F;  1BBY A;  3LAP A;  2DK5 A;  2MLK A;  2A5Y B;  1ZLK A;  1P4W A;  3JSO A;  1YIO A;  3FMS A;  3R6S A;  2GXG A;  3TKY A;  5DEQ A;  3B73 A;  1BI0 A;  1EH8 A;  1H0M A;  1UHW A;  4IHS A;  2JZY A;  1BI2 A;  2KRF A;  3CTA A;  2DK8 A;  3F21 A;  4OU0 A;  5D5V B;  3FXR A;  2LF7 A;  2PMH A;  1S3J A;  4YII A;  4UUV A;  3DPL C;  1HKS A;  1ONV A;  5LGT A;  4OMY A;  4HOB A;  4OIO F;  1T6S A;  1CF7 A;  4MQ9 F;  3M8F A;  1OPC A;  2RV8 A;  1PP8 F;  4H0E A;  2OQR A;  4PGH A;  2L4A A;  2OAZ A;  4I09 A;  1XMK A;  3F22 A;  5E18 F;  3V8L A;  3ISP A;  1D8K A;  2DPU A;  2QQ9 A;  3EYI A;  1IN6 A;  3QU3 A;  3IWF A;  3J81 Z;  3P9K A;  1ULY A;  2IA1 A;  2ZXJ A;  3FMR A;  4L9J A;  3KP5 A;  3QU6 A;  3O2P E;  4KT5 C;  4EVI A;  1W7P B;  4KN4 X;  2NNN A;  1GHC A;  2DPD A;  3T1B A;  1HSJ A;  4Q4Z F;  2EFP A;  3DFG A;  2RC4 A;  3ZMS A;  2DBB A;  4MNU A;  2FU4 A;  2Q8K A;  3MAJ A;  1R5H A;  4I02 A;  2XV4 S;  1LEA A;  1YG2 A;  3HTU A;  3QAH A;  4MGR A;  3GX4 X;  4KIC A;  5L3D A;  2FE3 A;  2EFQ A;  2V6C A;  3GZ6 A;  4Y17 A;  3GYH X;  2OU2 A;  4RGR A;  3K2Z A;  2JSC A;  5LEK A;  3HHH A;  4L18 B;  1I27 A;  4HX8 A;  1LVA A;  1T0F A;  3LA2 A;  3TQN A;  2LF8 A;  3F8C A;  3BZ6 A;  5HVQ C;  1U78 A;  2FML A;  5E20 A;  3COA C;  3F6V A;  5CJ9 A;  4Z2Y A;  1EH7 A;  1IN7 A;  1ZRC A;  5ERI A;  2ESN A;  1R23 A;  4M74 A;  1OYI A;  3I59 B;  4CYD A;  3L9F A;  3ABU A;  2Z5U A;  5D5X B;  2OA4 A;  4WCG A;  1FP2 A;  3K1M A;  2F5D A;  3FXU A;  5TRD A;  1YLF A;  1J2X A;  5BPI A;  3QPH A;  4EM2 A;  1ZG1 A;  4HDU A;  3I54 A;  4HBL A;  5LBQ A;  4ENJ A;  1XSV A;  3V4G A;  4WX9 A;  1KQ0 A;  2BEO A;  3KET A;  3E5U A;  4NHJ A;  2HOE A;  2FBH A;  3E3V A;  3HRS A;  1ZRE A;  3GFM A;  3KEQ A;  2E1C A;  2KIF A;  2KIM A;  5IT9 Z;  4KN7 X;  2IRF G;  2EK5 A; 
#chains in the Genus database with same CATH topology
 2VQH A;  3HOU J;  2X51 A;  1V55 H;  5BQT A;  1R71 A;  3WHC A;  2BBY A;  1T08 B;  3UR3 C;  3WU2 C;  1VFC A;  2VE8 A;  1WPK A;  3ZMD A;  5F1R A;  4J19 A;  1ZTR A;  2PMU A;  3BR6 A;  4RAZ A;  1H9G A;  2BVM A;  1J7K A;  4EGZ A;  2MFZ A;  3KX2 A;  1X58 A;  2IGO A;  1S6L A;  2L7F P;  5AON A;  2ZC2 A;  1IDZ A;  2E2I J;  1CF7 B;  4X1E A;  5FKL A;  5J47 A;  1VQK I;  1U5T C;  3JRB A;  2HDW A;  2R3S A;  2L3D A;  3I3L A;  4U7B A;  2CH0 A;  3I71 A;  3ZR8 X;  3S1Q J;  1ZAO A;  1X2N A;  3BJA A;  5F0H A;  1GDT A;  3F8B A;  2LK2 A;  3VYT B;  2K4B A;  2A07 F;  2M34 A;  3U1D A;  2FA5 A;  1Z21 A;  3CP2 A;  1RUN A;  1YRN B;  4HNU A;  4XR6 A;  2TCT A;  2X9D A;  3GTM J;  2RQP A;  2IPQ X;  1V3F A;  2DCE A;  3FMQ A;  1T8I A;  3DEU A;  2R5Z A;  3CO7 C;  2UV1 A;  1SC7 A;  2YU9 J;  2NRA C;  1E0E A;  2KIS A;  4D0P A;  3NAR A;  2STT A;  4RAG A;  2BXZ A;  3K69 A;  4KJZ A;  5KHD A;  2OTL I;  3W2A A;  1S72 I;  2R5Y A;  3ZPL A;  2B63 J;  3I64 A;  3WGG A;  2WV0 A;  4AC0 A;  3IKV A;  3S3O A;  3K4M A;  4C30 A;  1ZGA A;  3CCU I;  3RYP A;  3PNY A;  2Z9O A;  1PUF A;  2IGK A;  2V6E A;  2W7N A;  3PFY A;  1B9N A;  1O3S A;  5JVT A;  2KZG A;  4R8H A;  4IHT A;  4B47 A;  1UST A;  2M7B A;  3KIO A;  3Q5F A;  5E8G A;  2QQB A;  1TWC J;  3RYR A;  1S9H A;  3TP0 A;  1Z6R A;  2Z33 A;  2JN6 A;  2LVS A;  4E4H A;  2ZNZ A;  2VBX A;  1TNT A;  4KFC A;  1MH3 A;  4CZC A;  2MLG A;  3ULQ B;  5EEA A;  3VDX A;  1JT6 A;  2AHQ A;  2H6C A;  2HQ5 A;  5EGO A;  3HGY A;  4XLC A;  3ZMV A;  2HTS A;  3SXY A;  1K79 A;  3DXJ F;  1LFU P;  4HF2 A;  2WTE A;  1YO5 C;  1SVM A;  4ESB A;  5EZH A;  5M3F J;  2XRN A;  2ZME A;  4A3C J;  4XRS A;  4FE4 A;  4Y3O A;  2KRC A;  1Y0U A;  2P4W A;  1ON2 A;  1TLH B;  2CSO A;  5ILV A;  2LOO A;  4DZJ A;  5E1X A;  3M8E A;  4Q48 A;  1BC8 C;  3OYL A;  3QWL A;  2L7Z A;  2ZXH A;  1W4M A;  2YU3 A;  3DWL E;  2E7X A;  5E3L A;  1ETY A;  1MBG A;  2W25 A;  1ZK8 A;  5HOD A;  1OYY A;  4KT6 A;  4OAZ A;  2V1U A;  2NVT J;  2WY8 Q;  2M9H A;  1HC8 A;  3F8M A;  2EIN H;  3M9A A;  4P9U A;  2FQ4 A;  2ADU A;  2L9S A;  3H0G J;  3BG7 A;  5D6E A;  3I0T A;  2HPM A;  4CA0 A;  3MCZ A;  3SHF A;  2DFI A;  1BOA A;  2ZBK A;  3T8T A;  4JBA A;  3TW6 A;  4A3B J;  3A4C A;  4G12 A;  3OYK A;  4RMN A;  1KYW A;  1WWX A;  3MZ8 A;  2JWT A;  3CDL A;  1HW1 A;  2P0W A;  3FBN B;  4OAY A;  2RGV A;  3JRD A;  1ETX A;  2M0M A;  1NG6 A;  2KRH A;  5HLT A;  1T56 A;  1UJ8 A;  4U88 A;  2XAS A;  5CVI A;  3CMM A;  1SFE A;  4BAC A;  3G73 A;  5J6X A;  3BJO A;  2BXY A;  4TV7 A;  3JTG A;  2K9N A;  3KYL A;  3ZMU A;  2GXA A;  2FJ1 A;  1FSH A;  5EEG A;  3M3Y J;  3BR5 A;  3OYJ A;  4UXN A;  4A5M A;  2QM3 A;  2DN0 A;  2H1K A;  2ELH A;  1FOW A;  2M8G X;  4A3K J;  2DT5 A;  2RNJ A;  1KU7 A;  4UNO A;  2EWN A;  1P4X A;  2XKO A;  4FET A;  5TIS C;  2DQL A;  3HG9 A;  4C3I J;  2R7W A;  1H9T A;  2DA1 A;  4ZYA A;  1K61 A;  1E2X A;  2FBK A;  1WI3 A;  2L54 A;  4FIS A;  4BH9 A;  3GTG J;  3WE2 A;  3G2B A;  2LD5 A;  2DMQ A;  1REP C;  2LY2 A;  1J9I A;  4D7N A;  1JT0 A;  2VKE A;  2RRE A;  2DDB A;  3WGI A;  1P7I A;  2V7F A;  4FHT A;  4EGY A;  2DT7 B;  3KP7 A;  2HYF A;  4LOC A;  4ZYD A;  2E71 A;  2ME0 A;  2F4I A;  2H8W A;  2LKS A;  2OUM A;  2PN6 A;  3KCC A;  2UZK A;  1QU3 A;  3ECO A;  2STW A;  1ENH A;  5LGU A;  5K1Y A;  3DU5 A;  2P6S A;  4A12 A;  2G9W A;  2FF4 A;  1DDN A;  2QLZ A;  4DIQ A;  5IOZ A;  2WV1 A;  2ESH A;  2A6T A;  1AA7 A;  2A6E F;  3CC7 I;  3G1M A;  4M72 A;  3HC7 A;  1SMY F;  4BU2 A;  1RUO A;  4A6E A;  2IGM A;  2EIL H;  1RRJ A;  2WC2 A;  1JUM A;  2JTV A;  5C4J J;  2VJI A;  4GGG A;  3VYS B;  2F5C A;  3OYH A;  2D45 A;  1K78 A;  1MD0 A;  1XSX A;  2HOA A;  2L9V A;  2QA4 I;  4CIC A;  4B1R A;  2MC4 A;  2JRM A;  2R5Z B;  2ZJQ F;  1KA8 A;  3KP4 A;  2IEK A;  1NHA A;  3S1M J;  3W3C A;  3F72 A;  1GXQ A;  3J80 Z;  2X4H A;  2Q2E A;  2DA5 A;  2FNA A;  2R5Y B;  2NYX A;  4BEH A;  2PMZ A;  2QKL B;  2W48 A;  3KYD B;  4OWR B;  3LNQ A;  1U3E M;  1LB2 A;  4GO1 A;  4LK0 F;  2MH9 A;  4LLL A;  2F4O B;  1O3R A;  1Y0N A;  3VFZ A;  2B7E A;  3IWZ A;  1YW7 A;  2JSP A;  3GF2 A;  1VI0 A;  3WU1 B;  3KP3 A;  3EUA A;  2GOM A;  3F8N A;  4XKC A;  3R0J A;  5D5U B;  1A5J A;  2IXS A;  4RS8 A;  1GVD A;  4S05 A;  1Z05 A;  4JQF A;  1Q1H A;  1Y8Q B;  2M4G A;  2BY1 A;  2MSY A;  2OJE D;  2V79 A;  2WA0 A;  3BY6 A;  3CUO A;  3A0H C;  5B66 C;  5JFR A;  1YS6 A;  4CCK A;  1IUF A;  4Z6Y A;  1BN5 A;  3BZC A;  3F23 A;  2IBD A;  4PZJ A;  5EGO B;  2P5V A;  2QQ8 A;  5CLS A;  3EUK L;  2MW8 A;  5DYM A;  5TGT A;  2A61 A;  1BR2 A;  1WKM A;  3FXK A;  3RJP A;  4ZYE A;  2HWV A;  5E1W A;  2KP6 A;  2D1H A;  4MFE A;  3KZZ A;  2ZME B;  5M5Y J;  1ZRF A;  3JRC A;  2B9S A;  2C6Y A;  2KMU A;  3C1D A;  1HDD C;  2VI6 A;  1BW5 A;  1J5Y A;  2VIX A;  3GCM A;  1P4A A;  5D4R A;  1MMA A;  3WTT C;  1X4O A;  3HPH A;  4LIT A;  4UUT A;  4BBS J;  1QGP A;  2E36 A;  1MMN A;  4MQV A;  3E6B A;  1OCT C;  3LSH A;  3GWZ A;  1JUS A;  2KIQ A;  4LIV A;  4HF0 A;  2XPV A;  4BDY A;  3E5X A;  3K9T A;  3CUQ C;  4M6V A;  1ZG5 A;  3OOP A;  3W6V A;  2CQQ A;  1WJE A;  4BDZ A;  2I10 A;  3KLN A;  5FRO A;  2D5V A;  3ZMZ A;  4F3Q A;  3JCU C;  4JX5 A;  2UXX A;  4YFK F;  2X48 A;  3L2R A;  1ERD A;  3R0A A;  2XRL A;  4XLP F;  5L3G A;  5IT3 A;  4CYC A;  4RDU A;  1JJ6 C;  2COB A;  3LMM A;  5FLM J;  4ZTF A;  2DMN A;  2R7O A;  3LSJ A;  3GXO A;  4M3F A;  1A31 A;  4D5F A;  3E1S A;  3E97 A;  4U7D A;  3S15 J;  1IXS B;  1BI1 A;  3BP8 A;  2KHM A;  3HRT A;  4JX4 A;  1BJZ A;  4B3A A;  4IHY A;  1QHH D;  1B72 A;  3I56 I;  1QRY A;  1O4X A;  4BGD A;  1IG7 A;  3PSI A;  1PP7 U;  5LD2 C;  2E35 A;  2GWR A;  4JK1 X;  1IUY A;  1NK2 P;  1V5F A;  2ID3 A;  3BPX A;  3WHB A;  2BOL A;  1ZYR F;  3IP4 B;  5CPR B;  4UUS A;  3BWG A;  3C2B A;  2VBW A;  3ROU A;  3ESW B;  2TDX A;  3FHZ A;  2GIZ A;  2E19 A;  2VQG A;  1LVK A;  4EV0 A;  2RQQ A;  4G7H F;  3FXQ A;  3BDD A;  1L0O C;  3DBR B;  1U2W A;  2I8D A;  4L0Z B;  2IA0 A;  1WJ5 A;  3FXO A;  5ICF A;  5FJ8 J;  1ACI A;  2XRO A;  3HJE A;  4KYW A;  1LFB A;  1BA5 A;  1GT0 C;  4XK4 A;  3JRI A;  1STZ A;  1FOY A;  2GQQ A;  5DM7 F;  3VYR B;  2HZD A;  1B6A A;  2JRT A;  4AM3 A;  1MNE A;  4N0B A;  1RKT A;  1FJL A;  1ZKG A;  2WBM A;  1HOM A;  4GFB A;  5FKO A;  1JE8 A;  3FK7 A;  2VN2 A;  4UV8 A;  4EJV A;  1G3S A;  3LFK A;  2DAO A;  3FM5 A;  4QLC U;  3G3Z A;  1JKR C;  3GFI A;  2BZT A;  2KKO A;  5E3O A;  3TBI A;  1OFC X;  3PL8 A;  3GZ5 A;  2H1L A;  3EPZ A;  3HOV J;  4A3E J;  2K3F A;  2CV1 A;  2XGX A;  4IRG A;  1MH4 A;  1K78 B;  3PFI A;  2AQF A;  4KIG A;  1XPX A;  4LK1 F;  2DJI A;  3DEW A;  4RB0 A;  1XN7 A;  2WAQ N;  1ZHF A;  1ZAR A;  3DBL B;  2DJN A;  2K5C A;  5F64 A;  4E6K G;  3M4O J;  4ITV A;  1YIT I;  1EF4 A;  5HLI A;  2LSO A;  1LDJ A;  4RAY A;  2Q2E B;  4HPQ A;  4NQW A;  3E6M A;  1HXD A;  2B0L A;  2Y75 A;  3FKJ A;  4BEH B;  3ABM H;  1VQ5 I;  3V7C A;  3B6C A;  1YQA A;  1O3T A;  1FMW A;  1I1S A;  1X4P A;  4FAS D;  3RSN A;  4EM0 B;  3UKG A;  1ETV A;  2JPC A;  3PO3 J;  5FD5 A;  2LTP A;  2W84 A;  4BHB A;  2E34 A;  5HDG A;  2FX0 A;  3SZG A;  3WE3 A;  4IX7 A;  3K7A J;  1WSU A;  1QZZ A;  1ITY A;  1U5T A;  2W24 A;  3K0L A;  1IXC A;  5DD4 A;  4X6A J;  1ETK A;  1SAN A;  2M45 A;  2YPR A;  1HW5 A;  2K9L A;  1S7O A;  5GAD J;  2XGE A;  2F5F A;  2NS0 A;  2X6O A;  3LL7 A;  3HM5 A;  2H8R A;  3JAM K;  4PGG A;  5GTI C;  2RNG A;  2XGD A;  1JTX A;  2A69 F;  3I5U A;  1LKX A;  3GVA A;  3K4J A;  2CQK A;  1Z7L A;  1P6R A;  3KEO A;  5K5O A;  1SFO J;  3LOC A;  2QYO A;  1U8B A;  3L00 A;  1XMX A;  5F1J A;  3LWF A;  2D1V A;  1K6O A;  3NEU A;  3ZOB A;  5ICC A;  2LR8 A;  3VSK A;  3QOP A;  2WY7 Q;  2X85 A;  5H6Q A;  2VXD A;  4WXH A;  5GPA A;  1FPQ A;  2XVC A;  5FD6 A;  1G59 A;  2DLL A;  4XBF A;  2CV0 A;  4ZJZ A;  2YR2 A;  4RGS A;  5FGM A;  3OY9 A;  1WI9 A;  2LMD A;  2LYC A;  3LAJ A;  1FC3 A;  4QIW N;  2MD0 A;  1OR7 C;  3IC7 A;  1YW8 A;  3KP6 A;  3DV8 A;  4AU7 A;  5K5R A;  1HQC A;  2CYY A;  1UFM A;  1KU9 A;  2OQG A;  2LLK A;  4A0Y A;  4LD5 A;  4D5C A;  4XOP A;  1IV6 A;  2A3S A;  1ZLJ A;  2BY3 A;  3JRH A;  3RZO J;  3CCS I;  3G1O A;  1OMI A;  3ELK A;  3SQN A;  2HTJ A;  1RPW A;  3BRO A;  1W0U A;  3O3K A;  1U0J A;  3BG9 A;  4CYC B;  4E7L A;  3D5R C;  4UHT A;  2KJB A;  2X0L A;  3I53 A;  2VON A;  2VOP A;  1QZE A;  1LDK B;  4IRH A;  4PCQ A;  3DTK A;  1DPR A;  4M6X A;  3JR9 A;  2HDC A;  4M3G A;  4XLE A;  3IRQ A;  1IF1 A;  1G3Y A;  4F92 B;  3H0D A;  2YS9 A;  4HQE A;  3OYN A;  5BS6 A;  1B72 B;  2Z16 A;  2G7H A;  3BCB A;  1YTY A;  4AIH A;  1IRG A;  4XL9 A;  3Q3S A;  1O7F A;  1VF9 A;  5EG0 A;  4IF4 A;  4MTE A;  3L2V A;  3D5L A;  2R93 J;  1HF0 A;  1MMG A;  5HDK A;  2DO7 A;  2EQR A;  3DEE A;  2DDA A;  3LSG A;  4PUS A;  4UUS B;  5FLX Z;  1GVJ A;  2V9V A;  1F4K A;  4U87 A;  1FLI A;  1MDM A;  3OL4 A;  4A0Z A;  5J8C A;  3MKW B;  1YFH A;  3SZP A;  4AYB N;  4HZF A;  4DYC A;  5IPA A;  1G3T A;  5IP6 A;  3L2Q A;  1F36 A;  1W5T A;  1R1U A;  2FEZ A;  2VKD A;  2BHZ A;  2JPB A;  4YFN F;  1N78 A;  2K40 A;  5LRR A;  1IC8 A;  3CES A;  3JTH A;  4R79 A;  3ZQG A;  5DTD A;  1D0X A;  1MNM C;  3O8G A;  4M3E A;  3TED A;  3Q0V A;  3HSR A;  3PQK A;  5CVJ A;  4ZZL A;  3CDH A;  3HOX J;  3AG2 H;  1JUP A;  2GZW A;  2NOJ B;  5L3C A;  2VOO A;  2ZNY A;  1BW6 A;  1IV8 A;  4II3 A;  4ZDP A;  1MND A;  4KIT B;  2JA2 A;  3A01 A;  2DQR A;  2G7U A;  4ZYH A;  5DM6 F;  3E6C C;  1VQN I;  4PJJ A;  2P6T A;  4N4N B;  3S8P A;  3L1P A;  1D5V A;  3ML6 A;  1LNW A;  1SFK A;  3H9G A;  1HCR A;  3GME A;  3BR3 A;  2CO5 A;  1DGR M;  2E2J J;  4BQQ A;  5IP9 J;  4NUB A;  1IN8 A;  5E79 C;  5J4Y A;  3AL0 B;  2O61 A;  1IZ1 A;  5ICG A;  5LHH A;  1BR1 A;  2QKM B;  2M5W A;  2ZSH B;  3FXJ A;  5LGN A;  3SJM A;  1R4M B;  2DW4 A;  2XF6 A;  2HEO A;  3JRA A;  4HA8 A;  2CRG A;  2GXB A;  3CP8 A;  4HRI A;  1B9M A;  2O9L A;  3Q9S A;  5DDG A;  2QVO A;  2XAG A;  4XN0 A;  3A02 A;  4NQW B;  2OBP A;  2PJP A;  2EIJ H;  4IZZ A;  1YJ9 I;  1FOX A;  2LY1 A;  3SZT A;  2E1M C;  1YE9 A;  2PJR A;  4RB1 A;  4EM1 A;  1YS7 A;  3CF5 F;  2CG4 A;  1I6H J;  3U9G A;  4G7O F;  2L0K A;  4HAM A;  1FWZ A;  1S29 A;  1U5T B;  2CW7 A;  1Y39 A;  3DKW A;  2IT0 A;  5K7H A;  3V8K A;  2LKP A;  1NG7 A;  3LQR A;  3HDD A;  1MJ9 A;  3I4M J;  3GZN B;  3WTW C;  2V1D A;  4I0B A;  3OSG A;  3OYI A;  3NWS A;  1X3Z B;  2BVL A;  2DI3 A;  4ZDO A;  4A3M J;  1R9T J;  2MG4 A;  2L9R A;  3EYY A;  3OIO A;  2CW0 F;  3H5N A;  3MMY B;  3EDP A;  4FX0 A;  2DYR H;  2NOG A;  5HS9 A;  3IHU A;  3KYC B;  4GDF A;  2EV5 A;  1IO2 A;  3JW4 A;  5J1R A;  1KU2 A;  2F6C A;  1EH6 A;  2WB1 A;  2ZFU A;  1TC3 C;  2ELJ A;  4BY1 J;  2V1X A;  4N4O B;  1MBE A;  1RZ4 A;  3LFU A;  1XSD A;  3QP5 A;  1MJA A;  1FP1 D;  2V9K A;  2JUC A;  5IOY A;  2DOF A;  3G4S I;  2BYV E;  1O3Q A;  4UB8 C;  4EJW A;  4HST A;  4C3J J;  3DKY A;  2PLY A;  3UNG C;  2IP2 A;  4JX6 A;  3RKQ A;  4B43 A;  5IYD J;  1WJF A;  3HXL A;  1N77 A;  4G6D A;  3ZQI A;  1W36 C;  3VWB A;  2LBF B;  3LA7 A;  4BXU A;  4DGW B;  3LSP A;  2UWM A;  4ENK A;  1LDD A;  1Z9C A;  4CXF A;  4WK8 F;  2Y31 A;  2KJC A;  2VB6 A;  2QGU A;  3RCO A;  5B1A H;  2IA2 A;  1UAA A;  2PFB A;  2HQA A;  4CUG A;  2HFH A;  4KMU X;  2HZT A;  1MSE C;  2VLA A;  3X2Q H;  4CCN A;  1WFX A;  4E70 A;  1JTY A;  5K7Z A;  3E7L A;  1K4T A;  1F5T A;  1OYW A;  4XMY A;  2YUS A;  2LFB A;  3ABL H;  1T0F C;  5JVG F;  2VKV A;  3RIR A;  2V1N A;  1IW7 F;  1YX5 A;  3NQO A;  1VQO I;  5F0C A;  3RQI A;  1T2K A;  1R22 A;  3J81 K;  1POG A;  2VBY A;  1Z3Y A;  1FX7 A;  4YFX F;  3D1N I;  2CV2 A;  1P7J A;  1I1G A;  5FKK A;  1YHQ I;  4DBR A;  4YEL A;  5EDN A;  4QPQ A;  4E7J A;  4LLG F;  1HLV A;  3WU0 A;  5EG0 B;  4HG2 A;  2XAF A;  3DBH B;  3MWM A;  1R7J A;  4KIB A;  1K7A A;  1KON A;  4C2T A;  5D8L B;  1UHS A;  3OSF A;  2DA3 A;  1LPQ A;  3K4C A;  3CUQ A;  4IOC F;  1QPM A;  3HL2 A;  3G71 I;  4A3D J;  1MDM B;  3K1N A;  3CZ6 A;  3HOS A;  3T0Y A;  1U6G A;  5CQE A;  4S04 A;  1K83 J;  4MLO A;  2MD5 A;  1QNT A;  2P8T A;  4BQA A;  1ODD A;  3ZCO A;  3P9C A;  2ECB A;  2HDD A;  1XTA A;  4OMZ A;  3VYU B;  4IOA F;  3K4N A;  1R00 A;  4L5I A;  1WJC A;  2NS7 A;  4BNC A;  2CUE A;  3EUH C;  3REO A;  2H94 A;  4Y15 A;  4P9F A;  3MFK A;  1R1V A;  1ORK A;  5H2F C;  3C7J A;  2W1O A;  3TMO A;  1JGS A;  1FY7 A;  2UUZ A;  3A01 B;  2P7V B;  3LSI A;  3BCA A;  1D5Y A;  2CQ7 A;  5JLX A;  5GP9 A;  2OC6 A;  4ZYG A;  3FWE A;  2D2W A;  1XB4 A;  1FYM A;  1JGG A;  4FQG A;  3MZY A;  2Q1Z B;  4L5E A;  2DA4 A;  3A1Y A;  2DOD A;  2EZI A;  2GAU A;  2XDV A;  1BOB A;  3TOA A;  1FT9 A;  1ZGJ A;  2E5Z A;  4I76 A;  1SD4 A;  4IL6 C;  3H9Q A;  5E1Z B;  1LEB A;  5H6R A;  2MGQ A;  2JVG A;  1XMA A;  2LH9 A;  3NWT A;  4BE2 A;  1SFU A;  3OL3 A;  3FX3 A;  3ERE D;  2L7M P;  3BTC A;  3L2U A;  1WVR A;  3J7A Y;  4WWC A;  1RI7 A;  3OIP A;  2ZJP F;  4U0V A;  3HOY J;  4XLN F;  2JA6 J;  4PSX A;  2L7K A;  2OD5 A;  1C0W A;  5FLX K;  3PQJ A;  2PJR B;  2MAB A;  2O5R A;  3CCY A;  5ICE A;  4LG0 A;  1DP3 A;  2F48 A;  5CVU A;  3I4N J;  4YIF A;  1DQU A;  1TW2 A;  2EBI A;  3GLX A;  3GFJ A;  3IH2 A;  1ZG3 A;  1AWC A;  1FIP A;  3CJN A;  1H88 C;  1NH3 A;  2J5P A;  5HNF A;  2FUG 2;  5HS8 A;  3MN2 A;  5BPD A;  1BIA A;  3V7R A;  2VJJ A;  3RKX A;  3HEF A;  1YJN I;  3KP2 A;  1SD5 A;  4U0Y A;  4QPO A;  2XC7 A;  2A68 F;  1RR8 C;  3A0B C;  2KIU A;  1VQ4 I;  4HNV A;  5BOX A;  5IT9 K;  3CQZ J;  3QPL A;  3T5X A;  1Y1V J;  2BW3 A;  5FO5 A;  1QHG A;  2X1D A;  5F08 A;  2Y69 H;  4AIK A;  3EQL F;  3OR1 C;  4II2 A;  2RDP A;  2HGC A;  2FSW A;  4M9S A;  5M5W J;  4LMY A;  4KIF A;  1D1B A;  1U9N A;  2W57 A;  4FE7 A;  3OS0 A;  2E60 A;  1FEX A;  1I39 A;  4HEA 2;  2JA7 J;  4V2G A;  3C2G A;  3DCF A;  4B8X A;  2WWY A;  3T8R A;  3RPU D;  4MO7 A;  5HLH A;  3S1N J;  3P7N A;  3CD6 I;  5LHG A;  3BQY A;  2P81 A;  1D8J A;  3SFZ A;  2W85 A;  4IPA A;  1UG0 A;  3FXL A;  1T33 A;  3C2H A;  2ICW G;  3FK6 A;  4XKB A;  1R36 A;  1TQP A;  4OIR F;  1J0R A;  2GA2 A;  4HLX A;  4KNY A;  2WAE A;  4XLF A;  3HKZ N;  2R7R A;  4H4K C;  4C2U A;  5JHF A;  5C4X J;  3CF2 A;  1H89 C;  1BM9 A;  3GBG A;  3QP6 A;  3S32 A;  4XRS G;  1XDU A;  3CCV I;  3S17 J;  2E1N A;  1LQ1 A;  2K02 A;  3D0S A;  4MHG A;  4Y33 A;  5AIQ A;  1I6X A;  2CUJ A;  2K86 A;  4KUM A;  4BJ6 C;  5FLV A;  4RB3 C;  1GV5 A;  2K85 A;  4IHV A;  3LA3 A;  4I01 A;  1DPU A;  1WZ2 A;  4DW6 A;  4GYG A;  4CCL A;  4G7Z F;  2XAJ A;  3RDI A;  2OCC H;  1Q1V A;  3LSR A;  4EEF G;  2CQX A;  5EEH A;  1MW7 A;  4OIN F;  3TP3 A;  2DMU A;  4B3X A;  2IS4 A;  2HKX A;  5KVR A;  2H27 A;  1PUE E;  1I3Q J;  3K70 C;  2XKP A;  4MTD A;  2N8G A;  2HQN A;  3JRF A;  2F2E A;  1P2F A;  3AFH A;  4EJT A;  4P96 A;  3A03 A;  4PFP A;  1N75 A;  3F3X A;  2BY0 A;  2M8E A;  3CUQ B;  3AG4 H;  2Y30 A;  5J3L A;  4M9X A;  2VT3 A;  4ESJ A;  1ZN2 A;  3MKY B;  2K7L A;  2HVQ A;  2DT6 A;  3H92 A;  3M1C A;  4XOR A;  4EJU A;  4NC8 A;  3CLO A;  2Z3Y A;  3TL4 X;  2JA8 J;  4IKF A;  2H6B A;  1SAX A;  2VPR A;  2VBZ A;  3AAF A;  2FD5 A;  2WAD A;  3P5J A;  5TJJ A;  1USS A;  2O8X A;  4LB6 B;  1W5C C;  3SFI A;  4I0A A;  3ZQQ A;  4B44 A;  4Y52 J;  1E17 A;  2PMZ N;  4IQJ A;  1G4D A;  2Y2Z A;  3U2R A;  1X1D A;  2V26 A;  4CGZ A;  1R6R A;  5KNL A;  3M07 A;  3HPG A;  2IS1 A;  5E3N A;  4Y4R A;  1JJ8 C;  5F27 A;  5CVV A;  2W00 A;  2HXO A;  5LLQ A;  5K5Q A;  5D4S A;  2K27 A;  1VQ6 I;  5L3B A;  4XKV A;  3BTJ A;  1MZB A;  5EZG A;  3V42 A;  4A2U A;  3Q9V A;  2VC1 A;  5JHU A;  2HR3 A;  4LB5 A;  2ZJ2 A;  2XGC A;  4M3D A;  4G9Y A;  4D7M A;  1D1A A;  1IRF A;  1VQP I;  2COM A;  3F9K A;  3BT9 A;  4L0Y B;  4E7S A;  2R4G A;  2NS8 A;  3L2W A;  3L7W A;  1GV2 A;  2Z2S B;  5DCF A;  5HOO A;  5FRN A;  1TT5 B;  1Z6T A;  2R7U A;  1TWF J;  5DCM A;  1F1Z A;  2F5E A;  1EA3 A;  1Z91 A;  2J5O A;  2PX9 A;  4P5O A;  2Y9Z A;  1B8I A;  1GUU A;  4ETS A;  4HF1 A;  2LG4 A;  2F4M B;  2K9Q A;  3RQ4 A;  2JVH A;  5E3M A;  3RZD J;  4XRF A;  1E3H A;  1ON1 A;  3F8F A;  4EQQ A;  3L2C A;  2IW5 A;  3KZY A;  4Y13 A;  3HRU A;  3IAM 2;  4EMS A;  3EET A;  2Y0S N;  2RN7 A;  4E7I A;  2K4J A;  1Z67 A;  3CJT B;  4LG0 B;  1YYV A;  3F0C A;  2P5K A;  4ZZD A;  2Z99 A;  1V5G A;  2LNB A;  1XGO A;  2VL8 A;  4CO8 A;  3ZMT A;  1CQT A;  5KCM A;  4YEJ A;  2ME6 A;  3AG1 H;  1B1B A;  1KGS A;  2EZK A;  1J59 A;  2VUM J;  4M3B A;  4MIM A;  3FM3 A;  2ZXI A;  1MMD A;  1DU6 A;  1A35 A;  2XF7 A;  4NC6 A;  5AIP A;  4GXO A;  1R58 A;  3CJQ B;  1KQ8 A;  4HV6 A;  2X6W A;  5CVR A;  4XOT A;  4A3I J;  2BW3 B;  9ANT A;  1JKP C;  2HYG D;  4G6Q A;  1QZY A;  4A3J J;  2XIG A;  1XCB A;  4LLN A;  1KU3 A;  1UG2 A;  1WCM J;  3VEP A;  4A93 J;  4KDP A;  2HPI A;  4DYR A;  2JUG A;  2LC2 A;  4PJN A;  3S14 J;  1YIJ I;  5L3E A;  2HQR A;  4I98 B;  3N4M A;  4HLY A;  1AU7 A;  4HX4 A;  3FIW A;  4UB6 C;  3WOD F;  1HBX G;  1FBU A;  1TWG J;  4A0X A;  4ASN A;  1QA6 A;  1SD7 A;  1TP4 A;  2MA3 A;  1W7P D;  3MZH A;  3BOQ A;  1NTC A;  1G8X A;  2JQ7 A;  2ZXW H;  5A2Q Z;  1R5G A;  2IS6 A;  3RPQ A;  5IP7 J;  4ZH4 F;  4IQ4 A;  4XLA A;  2R0Q C;  4F55 A;  4D9J A;  3GO5 A;  2ZO4 A;  3O6B B;  1UHM A;  1VND A;  5DUK A;  2R7V A;  2ZFW A;  3CLQ A;  1TW3 A;  1MJB A;  4O6J A;  5LFA A;  2L2O A;  3GW2 A;  1T38 A;  3LSM A;  5J1Y A;  2ISZ A;  5D5W B;  2EV6 A;  3SYT A;  4M9Z A;  2HVR A;  4RAF A;  3HYI A;  3I9V 2;  3HRM A;  5J40 A;  4XN3 A;  2V4J C;  3ABK H;  4CDG A;  1QPI A;  1D3Y A;  4F7Z A;  3PIP F;  3HOZ J;  1X3W B;  1FYL A;  1SFX A;  5F0F A;  3ZN0 A;  5FFZ A;  4XSX F;  4EAT A;  4Y7N J;  2DMT A;  3HZJ A;  2EFN A;  3S2H J;  1MBH A;  4ABZ A;  2F5V A;  2QZ8 A;  3HBL A;  2LBF A;  1WH7 A;  3J80 K;  1GXP A;  1R1T A;  3IKT A;  4KA4 A;  3S3N A;  2P7C B;  2DFE A;  1FNN A;  3W2W A;  3BC8 A;  4G94 A;  1XGM A;  1VQ8 I;  1G3W A;  3DKX A;  1IRZ A;  3OS1 A;  1KYZ A;  4GCV A;  4ON0 A;  2QEN A;  1V54 H;  4ESF A;  1RIO H;  3WTX C;  3H3Z A;  1P9Q C;  3U1K A;  3K10 A;  1RKW A;  4HSR A;  1T39 A;  5J1U A;  2XUB A;  4GYI A;  1Y56 A;  3MKZ A;  1Z1D A;  1FTT A;  3MEX A;  3OWT A;  1XGN A;  3M8J A;  3C3W A;  3GEZ A;  5JI6 A;  5J8F A;  3KPH A;  1OJL A;  3CMY A;  2ZCW A;  1S7E A;  1LFP A;  3WGH A;  3QYB A;  5DUI A;  3BJ6 A;  1D1C A;  1GLN A;  1YX3 A;  2KT0 A;  3U21 A;  1HST A;  2L02 A;  2MBF A;  2L01 A;  5DV5 A;  5GAE J;  3GTO J;  1HKQ A;  3ZQ7 A;  1MGT A;  4L9V A;  3HTS B;  1R49 A;  5ILU A;  1UMQ A;  1B4A A;  3MKL A;  2FOK A;  3KFW X;  3M7G A;  1KQ9 A;  5LRS A;  3B6A A;  2ETH A;  2O3F A;  5ILS A;  1ZR2 A;  4CHU A;  4DNC A;  2VPL A;  3QOE A;  4NB5 A;  3GTL J;  4BUP A;  2E5N A;  2DA6 A;  3H5A A;  4L9T A;  5DCM B;  1G6N A;  3J7Y J;  3OR2 C;  1O7L A;  1HKT A;  4BS9 A;  1OCP A;  1B8I B;  2QSF X;  2P5L C;  2R92 J;  2VJ5 A;  4B09 A;  3JRE A;  1VQ7 I;  2R7T A;  2ZB9 A;  3FDY A;  1EKE A;  1XCV A;  1S5L C;  4UVA A;  1I5Z A;  2Y9Y A;  3EUH A;  1BI3 A;  4PK4 A;  2NVX J;  4AUX A;  5B5E C;  1MBJ A;  2JJ7 A;  2Y0M A;  3B02 A;  3GTK J;  2R7Z J;  4WXC A;  1N25 A;  3CJR B;  4QSH A;  4L9N A;  2YSR A;  2DFF A;  2VT2 A;  3S93 A;  1A04 A;  2CW8 A;  2M4K A;  2BHY A;  2X1C A;  3WTY C;  3J7A O;  4CZZ A;  1MSF C;  3DTI A;  3E0J B;  2YX4 A;  3WTZ A;  5HDN A;  1RET A;  2PI0 A;  2Z1D A;  3OYD A;  4XQF A;  2CGP A;  1FIA A;  1VQ9 I;  5L3F A;  1ZQ3 P;  2QBY A;  4HYE A;  4M71 A;  1AHD P;  3PUB A;  1UEL B;  4HDV A;  4OIP F;  2IAI A;  5M5X J;  2LY9 A;  3VOE A;  4CCO A;  2OPT A;  3M1E A;  2CFO A;  4WF2 A;  2V9P A;  3W6K B;  3HHG A;  1A36 A;  3AG3 H;  5IYB J;  4DYQ A;  2FQ3 A;  2O0Y A;  3TO6 A;  2KDZ A;  5F6F A;  3CO6 C;  1FOK A;  2E1M B;  2R7F A;  3DQV C;  1WRJ A;  4P55 A;  3W6J B;  3S16 J;  4CCM A;  2QQA A;  4BXX J;  2FRH A;  4OOI A;  5DS9 A;  2XPU A;  2NAZ A;  5FKM A;  1ZRD A;  3HUG A;  2HI3 A;  4L5J A;  3FBI B;  3AKZ A;  4LIU A;  1LUJ B;  2AQE A;  1JI8 A;  5FB2 A;  3P9I A;  5GPC A;  3HSE A;  2K9M A;  3OOU A;  5JR3 A;  5LEJ A;  3ZN1 A;  4YG2 F;  4CCJ A;  3WG9 A;  3PUF A;  4E7Z A;  1XG1 A;  3MD2 A;  4MFD A;  2CS3 A;  1Y1W J;  4UY8 I;  1P92 A;  3IH4 A;  2O03 A;  1WH5 A;  5F04 A;  4R1H A;  1SD6 A;  3G1L A;  4IXA A;  3Q0U A;  4OIQ F;  4RM3 A;  2L5Q A;  4J00 A;  3K4L A;  1XGS A;  3I58 A;  5LHI A;  2DOE A;  4O5V A;  2HS5 A;  3SDB A;  1W36 D;  1OCO H;  1AOY A;  4BAY A;  3NRV A;  1RNL A;  4RM2 A;  3OYE A;  2EFW A;  2GBY A;  1FMV A;  4MEY F;  5HNH A;  2VAS A;  3H35 A;  2NXN B;  4N9I A;  4E7K A;  1WJA A;  4RLQ A;  3C18 A;  5B1B H;  2EV0 A;  3DU6 A;  4A6D A;  4NNJ A;  3RPU A;  3R61 A;  5E17 F;  3PO2 J;  4RA2 A;  2XAU A;  1U8R A;  1OCZ H;  2JK3 A;  2FOW A;  5BNG A;  4KIS A;  6PAX A;  3E5Q A;  3TO9 A;  1FBQ A;  1LE8 A;  5ED4 A;  4Q47 A;  4BKX A;  1OCR H;  2EA4 A;  2QEX I;  3H9J A;  4AID A;  4RLF A;  1BC7 C;  4ENN A;  4PDK A;  1JHH A;  5KK1 A;  2QSH X;  1YW9 A;  3HOW J;  4UVB A;  4IHW A;  1J75 A;  2H09 A;  3BG6 A;  4JYK A;  2G0E A;  2HKO A;  1XDS A;  3IUO A;  3S2W A;  3QYF A;  4YRV A;  2EFO A;  3OYB A;  2K9S A;  2JT1 A;  1T95 A;  1IN5 A;  1PYV A;  3W2V A;  5A2Q K;  4BHP A;  1O57 A;  2LKX A;  5KAI C;  3DLA A;  3OYM A;  1FTZ A;  3BTL A;  2E7W A;  3E6D A;  1IN4 A;  2M2E A;  2YX7 A;  1BL0 A;  2EIK H;  4O3M A;  2KL4 A;  4XNF A;  3G6E I;  3TOB A;  3ERM A;  2OZ6 A;  2NVY J;  1TWA J;  3CDI A;  2PQ8 A;  2DYS H;  4BQO A;  4E7H A;  2Q0O A;  1OCC H;  2A05 A;  4BJT A;  2JA5 J;  1S8N A;  2OTJ I;  2XAH A;  2ZKZ A;  4HV5 A;  4JP0 A;  1TBX A;  2DTR A;  4ANJ A;  1TNS A;  3WTU C;  4MEX F;  2HOT A;  2KDO A;  4ENM A;  4M6Y A;  4BXF A;  3ECH A;  1JXS A;  3ASN H;  3IH3 A;  2QWW A;  2IVM A;  3ZGK A;  2RAE A;  2LDU A;  2RKH A;  3K4B A;  4CH7 A;  4PJM A;  1JKQ C;  1PDN C;  2DOA A;  3S2D J;  5GAH J;  2WB1 N;  1I3A A;  2PEX A;  3H1C A;  4UVC A;  1MIJ A;  2VQC A;  1Y6I A;  5B3S H;  3K2A A;  2OZU A;  3H5R A;  4AD9 A;  4G8X A;  2MYS A;  3PNT A;  3FZV A;  4IO9 F;  1X1A A;  2ECC A;  3IRR A;  2BY2 A;  4V2F A;  3DPU A;  1ZGW A;  2ISY A;  1VZ0 A;  1F43 A;  3WG7 H;  2MC3 A;  3QRF F;  2KZV A;  3OMY A;  5BMZ A;  4M73 A;  3HSF A;  3CC2 I;  1Z0X A;  2W82 A;  2BE5 F;  1DUX C;  2IS2 A;  4A69 C;  2A5W A;  3HKZ A;  1MMS A;  4F93 B;  5FFX A;  4AVZ A;  2WAF A;  2QBY B;  3KE2 A;  1ETO A;  2W4S A;  4P1W A;  2A6H F;  1KZH A;  4WXD A;  4HX7 A;  2M3A A;  1ZR4 A;  3CCJ I;  1BJA A;  4DBQ A;  1CGP A;  3DPT A;  2QUF A;  1W1W E;  4I7H A;  2GM4 A;  3KLO A;  2R7X A;  3JAM Z;  1Y8R B;  2HYJ A;  3GUD A;  3R4K A;  1HDP A;  1IRX A;  3OIQ A;  1T98 A;  1QVT A;  1UB9 A;  2IGN A;  3GFL A;  5IY5 H;  2FMY A;  4RBO A;  1S7A A;  2CUF A;  3BG5 A;  3F6O A;  2OV7 A;  1XC5 A;  4W1U A;  4BHC A;  5CQG A;  2LRE A;  1K6Y A;  1ETQ A;  3S3M A;  4ZTJ A;  1X1P A;  5D6F A;  1YJW I;  4CSW A;  3HUG B;  4N9H A;  5CKT A;  1J09 A;  3K1P A;  5K7F A;  3R60 A;  4A3F J;  1ETW A;  1D0Y A;  2XF5 A;  2Y48 A;  3DF8 A;  4LFU A;  2GIV A;  5D8K B;  3TDZ C;  2EIM H;  3SDG A;  4RGU A;  2VJ4 A;  3OYG A;  3ONQ A;  3WTV C;  3IL2 A;  1I50 J;  3ZP5 A;  1TT0 A;  3IAS 2;  2GLO A;  4U0W A;  1X1C A;  2R7D A;  2X6X A;  4XSZ F;  2ELK A;  2KPM A;  4AVP A;  1V4R A;  3CCL I;  3CME I;  2HU9 A;  2E2H J;  3FF5 A;  2XSJ C;  3TDU C;  1WQ2 A;  4IJA A;  2BGC A;  1RES A;  4XIC A;  2QF7 A;  3JRG A;  2AS5 F;  2QSG X;  1PVE A;  1FYK A;  2PG4 A;  1W5S A;  4QTR A;  1PUF B;  3OS2 A;  4I99 C;  1Z7U A;  3KEY A;  2HVS A;  3VB2 A;  1ZH5 A;  3A2K A;  2HNH A;  3BG3 A;  1FSE A;  1R5I D;  3I4P A;  2DU9 A;  4HQM A;  1OKR A;  3FIS A;  4G6T B;  3HB9 A;  3ABT A;  1TZL A;  2EB7 A;  3TO7 A;  2VE9 A;  4Q5S F;  1X19 A;  3Q0W A;  5DD8 A;  4JOM A;  5JLW A;  3NAU A;  3BLY A;  3DP7 A;  3RKW A;  2MH2 A;  2AXT C;  2ZME C;  1IXR C;  2FBI A;  2ACJ A;  4J01 A;  2VQL A;  1W7P A;  3WTS C;  2R7S A;  2BV6 A;  2GA1 A;  4AIJ A;  3QYE A;  2M30 A;  1LE8 B;  3MQ0 A;  4I2O A;  4A3L J;  1E3P A;  4XID A;  4IEJ A;  2O7O A;  3RKY A;  2UXN A;  2O6G E;  1RR7 A;  2VXZ A;  4PJL A;  1RC9 A;  1QQI A;  4A5N A;  2EZH A;  1SMT A;  2DMP A;  4IVN A;  2EA2 A;  2XPW A;  1DP7 P;  1A6I A;  2IJL A;  2FXA A;  4BYY A;  3N97 A;  3K70 D;  4PFO A;  4DQ2 A;  4B4C A;  3QPT A;  2FNP A;  4EJO A;  4F91 B;  1X3U A;  3MVP A;  2CMP A;  3PSF A;  2Y0S A;  1OR7 A;  4LGW A;  1VTN C;  4FCY A;  4YIR X;  3N05 A;  3HOT A;  1TTY A;  3LQQ A;  3PNV A;  1B59 A;  4HW0 A;  5H20 A;  3SEZ A;  2VOD A;  1LJ9 A;  2RVC A;  3BPV A;  4QWQ A;  1FZP B;  2AXL A;  1XD7 A;  2WAQ A;  2PBI A;  3DLL F;  2VC0 A;  1IAW A;  1TWH J;  3VOD A;  5E8I A;  3GTP J;  1X2M A;  2EJR A;  5CYV A;  4IRI A;  1IJW C;  2EPF A;  2M1B A;  2M87 A;  3L09 A;  1F9N A;  4PSW A;  4RB2 C;  3OYC A;  2X6Y A;  3LST A;  1MKM A;  2L4M A;  5EJC A;  3GTJ J;  1QVU A;  1AKH A;  1TQI A;  3TW7 A;  4BJ5 C;  4NDL A;  1EJ9 A;  3CCM I;  1PJR A;  4K2E A;  3ZRG A;  3HGG A;  1FBS A;  1QBJ A;  3TGN A;  3CCQ I;  1WHU A;  1BIB A;  5GAG J;  5HS7 A;  3RTR A;  1HW2 A;  2LRD A;  3GLL A;  1YOV B;  2CWE A;  2K3P A;  3I59 A;  4RGX A;  2EH3 A;  4FT8 A;  3ZQH A;  1QO0 D;  4UV9 A;  1ZEL A;  5M3M J;  1OIS A;  3OV8 A;  2KQR A;  3H3U A;  4BY7 J;  3JSP A;  3H3V K;  2QCO A;  2EZL A;  1WJB A;  3PM1 A;  4FX4 A;  1TQM A;  4BQN A;  1IGN A;  5KAF C;  3V8J A;  5C44 J;  2XHK A;  2CUZ A;  4XON A;  4DOZ A;  2NNY A;  5HLG A;  4AWX B;  1SAU A;  2XAQ A;  4BE1 A;  1L3L A;  2CU7 A;  1WJD A;  3CC4 I;  2CFX A;  4PJ0 C;  3HIF A;  3V7S A;  5J4V A;  1JHF A;  1EV7 A;  3O8H A;  1MBF A;  1VQM I;  1UCR A;  3RI4 A;  4KMF A;  2I5U A;  4BBR J;  4LJZ F;  3ZQL A;  1BBY A;  3LAP A;  2DK5 A;  2X1E A;  2MLK A;  1NK3 P;  2AO9 A;  4A3G J;  5C3E J;  2A5Y B;  4B48 A;  1ZLK A;  2GOX B;  3LSK A;  2DXI A;  1P4W A;  3JSO A;  1XX5 A;  1YIO A;  2XB0 X;  2OCE A;  3FMS A;  3R6S A;  2GXG A;  3TKY A;  5DEQ A;  3QQA A;  2ID6 A;  1X1B A;  3B73 A;  1BI0 A;  1EH8 A;  1H0M A;  1UHW A;  3ZXS A;  4IHS A;  1DU0 A;  2JZY A;  1BI2 A;  2KRF A;  4C2M J;  3QOD A;  1XS9 A;  3CTA A;  2DK8 A;  3F21 A;  4OU0 A;  4ZDL A;  5D5V B;  1Z77 A;  3FXR A;  2LF7 A;  1VQL I;  2PMH A;  1S3J A;  1APL C;  4YII A;  4DJA A;  4UUV A;  3DPL C;  1V5E A;  3BZK A;  1HKS A;  1R4N B;  1ONV A;  1UZC A;  5LGT A;  4OMY A;  3BTI A;  4HOB A;  4OIO F;  1T6S A;  1CF7 A;  4MQ9 F;  1SVO A;  2DA2 A;  3M8F A;  1OPC A;  3IV5 A;  2RV8 A;  1PP8 F;  4H0E A;  2OQR A;  4PGH A;  2L4A A;  2OAZ A;  4I09 A;  1XMK A;  3F22 A;  5E18 F;  1MBK A;  4BL0 B;  1YRN A;  3FXM A;  4XM3 A;  3V8L A;  3ISP A;  4D1Q A;  1D8K A;  1OQY A;  2DPU A;  2QQ9 A;  1Z3X A;  2OF7 A;  3J7Z I;  3EYI A;  4FTH A;  4ZC3 A;  3FHN A;  4AYB A;  1IN6 A;  3QU3 A;  2LP0 A;  3IWF A;  3J81 Z;  3P9K A;  1ULY A;  3BR0 A;  1TL8 A;  2IA1 A;  2ZXJ A;  2M7A A;  3FMR A;  4X0G A;  4L9J A;  3KP5 A;  3QU6 A;  3FKI J;  3O2P E;  4KT5 C;  4EVI A;  1W7P B;  4XLH A;  4KN4 X;  2NNN A;  1GHC A;  2ZSI B;  2XSD C;  2DPD A;  3T1B A;  3VPR A;  1HSJ A;  1U9O A;  4Q4Z F;  2KLO A;  2TRT A;  2EFP A;  3DTE A;  3ASO H;  2R7Q A;  2O8K A;  5FRM A;  2VKH A;  2L9N A;  3DFG A;  2RC4 A;  4LG3 A;  3ZMS A;  4I6Z A;  4S0H B;  3K4K A;  2DBB A;  4XRM A;  2CQN A;  4MNU A;  4DZP A;  1DGW Y;  2FU4 A;  3VSL A;  4HNT A;  4NC7 A;  3MAJ A;  4W97 A;  2Q8K A;  1R5H A;  3BR2 A;  4I02 A;  2XV4 S;  1LEA A;  1YG2 A;  3HTU A;  3QAH A;  4MGR A;  3GX4 X;  3D5S C;  3BQZ A;  4KIC A;  5L3D A;  2FE3 A;  2EFQ A;  2V6C A;  3KZI C;  3GZ6 A;  2DA7 A;  2XB5 A;  4Y17 A;  3CCE I;  3GYH X;  3CCR I;  2OU2 A;  4RGR A;  4V19 K;  1BR4 A;  3H36 A;  4NBQ A;  1YI2 I;  1HA8 A;  3K2Z A;  2JSC A;  3SEQ A;  1A6Q A;  5LEK A;  3HHH A;  2DTZ A;  4L18 B;  1I27 A;  4HX8 A;  1LVA A;  1T0F A;  3LA2 A;  3TQN A;  2LF8 A;  3ZQC A;  2DFH A;  3F8C A;  3BZ6 A;  1AKH B;  5HVQ C;  1U78 A;  2FML A;  5E20 A;  3COA C;  1WGX A;  1SVL A;  5GTH C;  3F6V A;  5CJ9 A;  3BR1 A;  4Z2Y A;  1EH7 A;  1IN7 A;  1ZRC A;  5ERI A;  1K4S A;  4XKW A;  2ESN A;  1R23 A;  4M74 A;  1OYI A;  3I59 B;  4CYD A;  4IHX A;  3L9F A;  3ABU A;  3PIO F;  2Z5U A;  5D5X B;  1M1E B;  2KFD A;  2OA4 A;  4WCG A;  1FP2 A;  2M0C A;  3K1M A;  1G2H A;  4F52 A;  2E1O A;  2F5D A;  2JMW A;  3QPS A;  3FXU A;  3I55 I;  2NVQ J;  1W0T A;  5TRD A;  1D0Z A;  1J2X A;  1YLF A;  3CMA I;  3QPH A;  5BPI A;  4EM2 A;  1ZG1 A;  1H8A C;  4HDU A;  2HOS A;  3I54 A;  4HBL A;  2HXI A;  5LBQ A;  4ENJ A;  1SEU A;  1XSV A;  3V4G A;  3S1R J;  3GTQ J;  1IDY A;  1JKO C;  4WX9 A;  1KQ0 A;  3OYF A;  2BEO A;  3KET A;  1E3O C;  5EYR A;  4BE0 A;  3E5U A;  2NVU B;  4NHJ A;  2HOE A;  5FKN A;  2FBH A;  5EF6 A;  3E3V A;  3HRS A;  1ZRE A;  5IYC J;  3K6G A;  3ZQF A;  3GFM A;  4C3H J;  3KEQ A;  2E1C A;  2KIF A;  3PJR A;  4GRI A;  2CJJ A;  2KIM A;  5IT9 Z;  4KN7 X;  2IRF G;  3AL0 C;  4C9Y A;  2ZJR F;  2EK5 A;  1OLT A;  3OYA A; 
#chains in the Genus database with same CATH homology
 5BQT A;  2BBY A;  2VE8 A;  3ZMD A;  5F1R A;  2PMU A;  4RAZ A;  1H9G A;  1J7K A;  4EGZ A;  1S6L A;  5AON A;  1CF7 B;  1U5T C;  2R3S A;  4U7B A;  2L3D A;  3I71 A;  1ZAO A;  3BJA A;  3F8B A;  2K4B A;  2A07 F;  3U1D A;  2FA5 A;  1RUN A;  2RQP A;  2IPQ X;  1V3F A;  3FMQ A;  3DEU A;  3CO7 C;  2NRA C;  4D0P A;  2STT A;  3K69 A;  3ZPL A;  3I64 A;  3WGG A;  2WV0 A;  3IKV A;  1ZGA A;  3RYP A;  2Z9O A;  1B9N A;  1O3S A;  5JVT A;  4R8H A;  4IHT A;  1UST A;  3Q5F A;  5E8G A;  2QQB A;  3RYR A;  1Z6R A;  2Z33 A;  2ZNZ A;  2VBX A;  1TNT A;  4KFC A;  2MLG A;  3ULQ B;  2H6C A;  3ZMV A;  2HTS A;  3SXY A;  1K79 A;  3DXJ F;  4HF2 A;  2WTE A;  1YO5 C;  4ESB A;  2XRN A;  2ZME A;  1Y0U A;  2P4W A;  1ON2 A;  1TLH B;  2CSO A;  5ILV A;  5E1X A;  3M8E A;  4Q48 A;  1BC8 C;  1W4M A;  2YU3 A;  2E7X A;  2W25 A;  1OYY A;  2V1U A;  3F8M A;  3M9A A;  4P9U A;  2ADU A;  5D6E A;  3I0T A;  3MCZ A;  3SHF A;  2DFI A;  1BOA A;  2ZBK A;  3T8T A;  4JBA A;  1KYW A;  1WWX A;  1HW1 A;  2RGV A;  4U88 A;  2XAS A;  5CVI A;  1SFE A;  3G73 A;  5J6X A;  3BJO A;  4TV7 A;  3JTG A;  3ZMU A;  1FSH A;  5EEG A;  4UXN A;  4A5M A;  2QM3 A;  2ELH A;  2DT5 A;  2RNJ A;  1KU7 A;  4UNO A;  2EWN A;  1P4X A;  2XKO A;  2DQL A;  1H9T A;  1E2X A;  2FBK A;  4BH9 A;  2L54 A;  3WE2 A;  1REP C;  1J9I A;  3WGI A;  4EGY A;  4FHT A;  3KP7 A;  2HYF A;  4ZYD A;  2PN6 A;  3KCC A;  2UZK A;  3ECO A;  2STW A;  5LGU A;  5K1Y A;  2P6S A;  4A12 A;  2G9W A;  2FF4 A;  1DDN A;  2QLZ A;  2ESH A;  2A6E F;  4M72 A;  1SMY F;  1RUO A;  4A6E A;  2WC2 A;  2JTV A;  4GGG A;  2F5C A;  2D45 A;  1K78 A;  1MD0 A;  1XSX A;  4CIC A;  1KA8 A;  3KP4 A;  1NHA A;  3F72 A;  1GXQ A;  3J80 Z;  2X4H A;  2Q2E A;  2FNA A;  2NYX A;  1U3E M;  1LB2 A;  4GO1 A;  4LK0 F;  2MH9 A;  4LLL A;  1O3R A;  3VFZ A;  3IWZ A;  1YW7 A;  3GF2 A;  3WU1 B;  3KP3 A;  3F8N A;  3R0J A;  5D5U B;  4RS8 A;  4S05 A;  1Z05 A;  4JQF A;  1Q1H A;  2V79 A;  3BY6 A;  3CUO A;  5JFR A;  1YS6 A;  1BN5 A;  3F23 A;  4PZJ A;  2P5V A;  5CLS A;  5DYM A;  2A61 A;  1WKM A;  3RJP A;  4ZYE A;  2HWV A;  5E1W A;  2D1H A;  3KZZ A;  2ZME B;  1ZRF A;  2C6Y A;  3C1D A;  1J5Y A;  1P4A A;  5D4R A;  3WTT C;  1QGP A;  4MQV A;  3E6B A;  3GWZ A;  4HF0 A;  3E5X A;  3K9T A;  3CUQ C;  1ZG5 A;  3OOP A;  3KLN A;  3ZMZ A;  4YFK F;  2UXX A;  3R0A A;  4XLP F;  5L3G A;  5IT3 A;  3GXO A;  3E97 A;  4U7D A;  1IXS B;  1BI1 A;  3BP8 A;  3HRT A;  1PP7 U;  2GWR A;  4JK1 X;  1IUY A;  3BPX A;  1ZYR F;  3BWG A;  2VBW A;  3ROU A;  2TDX A;  3FHZ A;  4EV0 A;  4G7H F;  3FXQ A;  3BDD A;  1L0O C;  1U2W A;  4L0Z B;  2IA0 A;  5ICF A;  2XRO A;  4KYW A;  1STZ A;  2GQQ A;  1B6A A;  2JRT A;  4N0B A;  1JE8 A;  2VN2 A;  4UV8 A;  4EJV A;  1G3S A;  3LFK A;  2DAO A;  3FM5 A;  4QLC U;  3G3Z A;  3GFI A;  2KKO A;  3GZ5 A;  2XGX A;  4IRG A;  1K78 B;  3PFI A;  4KIG A;  4LK1 F;  4RB0 A;  1XN7 A;  1ZHF A;  1ZAR A;  5F64 A;  5HLI A;  2LSO A;  1LDJ A;  4RAY A;  4NQW A;  3E6M A;  1HXD A;  2B0L A;  2Y75 A;  3V7C A;  1O3T A;  1YQA A;  1I1S A;  4EM0 B;  2JPC A;  5FD5 A;  2W84 A;  4BHB A;  5HDG A;  3WE3 A;  1WSU A;  1QZZ A;  1U5T A;  2W24 A;  3K0L A;  1IXC A;  5DD4 A;  2M45 A;  2YPR A;  1HW5 A;  1S7O A;  2F5F A;  2NS0 A;  3JAM K;  4PGG A;  2A69 F;  3I5U A;  3GVA A;  3KEO A;  2CQK A;  5K5O A;  1P6R A;  2QYO A;  3L00 A;  3LWF A;  2D1V A;  1K6O A;  3NEU A;  5ICC A;  3QOP A;  5H6Q A;  4WXH A;  1FPQ A;  2XVC A;  5FD6 A;  2DLL A;  4XBF A;  2YR2 A;  4RGS A;  5FGM A;  1WI9 A;  3LAJ A;  1FC3 A;  3IC7 A;  1YW8 A;  3KP6 A;  3DV8 A;  5K5R A;  1HQC A;  2CYY A;  1UFM A;  1KU9 A;  2OQG A;  4A0Y A;  4LD5 A;  2A3S A;  1ZLJ A;  1OMI A;  3ELK A;  3SQN A;  2HTJ A;  3BRO A;  3O3K A;  4UHT A;  2KJB A;  2X0L A;  3I53 A;  2VON A;  2VOP A;  1LDK B;  4IRH A;  4PCQ A;  1DPR A;  4M6X A;  2HDC A;  3IRQ A;  1IF1 A;  1G3Y A;  4HQE A;  5BS6 A;  2G7H A;  1YTY A;  4AIH A;  1IRG A;  1O7F A;  4IF4 A;  4MTE A;  3D5L A;  5HDK A;  2DO7 A;  5FLX Z;  1GVJ A;  2V9V A;  1F4K A;  1FLI A;  1MDM A;  4A0Z A;  5J8C A;  1YFH A;  3SZP A;  4HZF A;  1G3T A;  1W5T A;  1R1U A;  2FEZ A;  4YFN F;  2JPB A;  5LRR A;  3JTH A;  4R79 A;  3HSR A;  3PQK A;  5CVJ A;  4ZZL A;  3CDH A;  2GZW A;  5L3C A;  2VOO A;  2ZNY A;  2DQR A;  2G7U A;  4ZYH A;  3E6C C;  2P6T A;  1D5V A;  3ML6 A;  1LNW A;  2CO5 A;  1IN8 A;  2O61 A;  1IZ1 A;  5ICG A;  5LHH A;  2M5W A;  5LGN A;  2DW4 A;  2HEO A;  4HA8 A;  2GXB A;  1B9M A;  3Q9S A;  5DDG A;  2QVO A;  2XAG A;  2OBP A;  2PJP A;  3SZT A;  4RB1 A;  4EM1 A;  1YS7 A;  2CG4 A;  3U9G A;  4G7O F;  4HAM A;  1FWZ A;  1S29 A;  1U5T B;  3DKW A;  2IT0 A;  3V8K A;  2LKP A;  3LQR A;  1MJ9 A;  3WTW C;  2V1D A;  4I0B A;  2DI3 A;  3EYY A;  2CW0 F;  3EDP A;  4FX0 A;  5HS9 A;  3IHU A;  2EV5 A;  3JW4 A;  1KU2 A;  1EH6 A;  2V1X A;  1RZ4 A;  1XSD A;  3QP5 A;  1MJA A;  1FP1 D;  2BYV E;  1O3Q A;  4EJW A;  2PLY A;  2IP2 A;  4G6D A;  3LA7 A;  4BXU A;  2UWM A;  4ENK A;  1LDD A;  1Z9C A;  4CXF A;  4WK8 F;  2KJC A;  2IA2 A;  2PFB A;  2HFH A;  4KMU X;  2HZT A;  4E70 A;  1F5T A;  1OYW A;  3RIR A;  1IW7 F;  3NQO A;  1T2K A;  1R22 A;  3J81 K;  2VBY A;  1FX7 A;  4YFX F;  1I1G A;  4LLG F;  3WU0 A;  2XAF A;  3MWM A;  1R7J A;  4KIB A;  1K7A A;  5D8L B;  3CUQ A;  1QPM A;  1MDM B;  3K1N A;  3HOS A;  3T0Y A;  1U6G A;  4S04 A;  2MD5 A;  1QNT A;  2P8T A;  4BQA A;  1ODD A;  3P9C A;  4OMZ A;  1R00 A;  4L5I A;  4BNC A;  3REO A;  2H94 A;  4Y15 A;  4P9F A;  3MFK A;  1R1V A;  3C7J A;  1JGS A;  1FY7 A;  2P7V B;  4ZYG A;  3FWE A;  2D2W A;  1XB4 A;  1FYM A;  3MZY A;  2GAU A;  3TOA A;  1FT9 A;  1ZGJ A;  1SD4 A;  5E1Z B;  1LEB A;  5H6R A;  1XMA A;  1SFU A;  3FX3 A;  3ERE D;  4WWC A;  1RI7 A;  4U0V A;  4XLN F;  2OD5 A;  1C0W A;  5FLX K;  3PQJ A;  5ICE A;  4LG0 A;  5CVU A;  4YIF A;  1TW2 A;  3GLX A;  3GFJ A;  1AWC A;  1ZG3 A;  3CJN A;  2J5P A;  5HS8 A;  5BPD A;  1BIA A;  3V7R A;  3RKX A;  3KP2 A;  1SD5 A;  4U0Y A;  2A68 F;  2KIU A;  5BOX A;  5IT9 K;  3T5X A;  5FO5 A;  4AIK A;  3EQL F;  2RDP A;  2HGC A;  2FSW A;  4M9S A;  4LMY A;  4KIF A;  2W57 A;  4B8X A;  2WWY A;  3T8R A;  5HLH A;  3P7N A;  5LHG A;  1D8J A;  3SFZ A;  2W85 A;  4IPA A;  1R36 A;  1TQP A;  4OIR F;  1J0R A;  2GA2 A;  4HLX A;  4KNY A;  1BM9 A;  3QP6 A;  1XDU A;  2E1N A;  1LQ1 A;  2K02 A;  3D0S A;  4MHG A;  5AIQ A;  1I6X A;  2K86 A;  4KUM A;  4RB3 C;  4I01 A;  3LA3 A;  1DPU A;  4GYG A;  4G7Z F;  2XAJ A;  3RDI A;  5EEH A;  4OIN F;  2HKX A;  5KVR A;  2H27 A;  1PUE E;  2XKP A;  4MTD A;  2HQN A;  4EJT A;  2F2E A;  1P2F A;  4P96 A;  3F3X A;  2M8E A;  3CUQ B;  4M9X A;  2VT3 A;  4ESJ A;  1ZN2 A;  2K7L A;  4EJU A;  3H92 A;  3CLO A;  2Z3Y A;  2H6B A;  1SAX A;  2VBZ A;  3AAF A;  5TJJ A;  1USS A;  2O8X A;  4LB6 B;  4I0A A;  1E17 A;  1G4D A;  3U2R A;  4CGZ A;  5CVV A;  5LLQ A;  5K5Q A;  5D4S A;  2K27 A;  5L3B A;  1MZB A;  4A2U A;  3Q9V A;  2VC1 A;  5JHU A;  2HR3 A;  4LB5 A;  2ZJ2 A;  4G9Y A;  1IRF A;  2COM A;  4L0Y B;  3L7W A;  5DCF A;  5HOO A;  1Z6T A;  5DCM A;  1F1Z A;  2F5E A;  4P5O A;  1Z91 A;  2J5O A;  4ETS A;  4HF1 A;  4XRF A;  1ON1 A;  3F8F A;  4EQQ A;  3L2C A;  2IW5 A;  3KZY A;  4Y13 A;  3HRU A;  4EMS A;  3EET A;  2RN7 A;  2K4J A;  4LG0 B;  1YYV A;  2P5K A;  4ZZD A;  2Z99 A;  2LNB A;  1XGO A;  4CO8 A;  3ZMT A;  1B1B A;  1KGS A;  1J59 A;  3FM3 A;  5AIP A;  4GXO A;  1R58 A;  1KQ8 A;  4HV6 A;  5CVR A;  2HYG D;  4G6Q A;  1QZY A;  2XIG A;  1XCB A;  4LLN A;  1KU3 A;  3VEP A;  4KDP A;  5L3E A;  2HQR A;  4I98 B;  3N4M A;  4HLY A;  4HX4 A;  3WOD F;  1HBX G;  1FBU A;  4A0X A;  4ASN A;  1SD7 A;  2MA3 A;  1W7P D;  3MZH A;  3BOQ A;  5A2Q Z;  1R5G A;  3RPQ A;  4ZH4 F;  3GO5 A;  2ZO4 A;  3O6B B;  1UHM A;  5DUK A;  2ZFW A;  1TW3 A;  1MJB A;  4O6J A;  3GW2 A;  1T38 A;  2ISZ A;  5D5W B;  2EV6 A;  4M9Z A;  3HYI A;  3HRM A;  4CDG A;  1D3Y A;  4F7Z A;  1FYL A;  1SFX A;  3ZN0 A;  5FFZ A;  4XSX F;  2EFN A;  2QZ8 A;  3J80 K;  1GXP A;  1R1T A;  3IKT A;  4KA4 A;  2P7C B;  1FNN A;  4G94 A;  1XGM A;  1G3W A;  1KYZ A;  4GCV A;  4ON0 A;  2QEN A;  4ESF A;  1RIO H;  3WTX C;  3H3Z A;  1T39 A;  2XUB A;  4GYI A;  1Z1D A;  3MEX A;  1XGN A;  3C3W A;  3GEZ A;  5JI6 A;  5J8F A;  2ZCW A;  3WGH A;  5DUI A;  3BJ6 A;  1HST A;  2L02 A;  2MBF A;  2L01 A;  5DV5 A;  1HKQ A;  3ZQ7 A;  1MGT A;  4L9V A;  3HTS B;  5ILU A;  1B4A A;  2FOK A;  3KFW X;  3M7G A;  1KQ9 A;  5LRS A;  2ETH A;  2O3F A;  5ILS A;  4CHU A;  4DNC A;  4NB5 A;  4L9T A;  5DCM B;  1G6N A;  1O7L A;  1HKT A;  2P5L C;  4B09 A;  1XCV A;  4UVA A;  1I5Z A;  3EUH A;  1BI3 A;  2Y0M A;  3B02 A;  4WXC A;  4L9N A;  2YSR A;  2VT2 A;  1A04 A;  3WTY C;  3J7A O;  4CZZ A;  2YX4 A;  3WTZ A;  5HDN A;  2PI0 A;  2CGP A;  5L3F A;  2QBY A;  4HYE A;  4M71 A;  4HDV A;  4OIP F;  3VOE A;  3M1E A;  4WF2 A;  3W6K B;  3HHG A;  2FQ3 A;  2O0Y A;  3TO6 A;  5F6F A;  3CO6 C;  1FOK A;  2R7F A;  3DQV C;  1WRJ A;  4P55 A;  3W6J B;  2QQA A;  2FRH A;  4OOI A;  2NAZ A;  1ZRD A;  3HUG A;  4L5J A;  5FB2 A;  3P9I A;  3HSE A;  5JR3 A;  5LEJ A;  3ZN1 A;  4YG2 F;  3WG9 A;  1P92 A;  2O03 A;  4R1H A;  1SD6 A;  4IXA A;  4OIQ F;  1XGS A;  3I58 A;  5LHI A;  4O5V A;  2HS5 A;  1AOY A;  4BAY A;  3NRV A;  1RNL A;  2EFW A;  4MEY F;  4N9I A;  3C18 A;  2EV0 A;  4A6D A;  3RPU A;  3R61 A;  5E17 F;  1U8R A;  6PAX A;  3E5Q A;  3TO9 A;  1FBQ A;  5ED4 A;  4Q47 A;  2EA4 A;  1BC7 C;  4ENN A;  4PDK A;  1JHH A;  5KK1 A;  1YW9 A;  4UVB A;  1J75 A;  2H09 A;  3S2W A;  2HKO A;  1XDS A;  2EFO A;  2JT1 A;  5A2Q K;  1IN5 A;  4BHP A;  1O57 A;  2E7W A;  3E6D A;  1IN4 A;  2YX7 A;  4O3M A;  3TOB A;  2OZ6 A;  2PQ8 A;  2Q0O A;  1S8N A;  2XAH A;  2ZKZ A;  4HV5 A;  1TBX A;  2DTR A;  3WTU C;  1TNS A;  4MEX F;  4ENM A;  4M6Y A;  3ECH A;  1JXS A;  2QWW A;  2IVM A;  2LDU A;  2RKH A;  1PDN C;  2PEX A;  4UVC A;  2OZU A;  4AD9 A;  4G8X A;  3FZV A;  3IRR A;  2ISY A;  2MC3 A;  3QRF F;  5BMZ A;  4M73 A;  3HSF A;  2BE5 F;  1DUX C;  5FFX A;  2QBY B;  3KE2 A;  2A6H F;  4WXD A;  4HX7 A;  1BJA A;  1CGP A;  3DPT A;  2QUF A;  4I7H A;  3KLO A;  3JAM Z;  3GUD A;  3R4K A;  1T98 A;  1UB9 A;  3GFL A;  2FMY A;  1S7A A;  3F6O A;  4BHC A;  5D6F A;  4N9H A;  3K1P A;  3R60 A;  2Y48 A;  3DF8 A;  4LFU A;  2GIV A;  5D8K B;  3TDZ C;  4RGU A;  3WTV C;  3IL2 A;  3ZP5 A;  4U0W A;  2R7D A;  4XSZ F;  4AVP A;  1V4R A;  3FF5 A;  3TDU C;  1WQ2 A;  4IJA A;  2BGC A;  2AS5 F;  1FYK A;  2PG4 A;  1W5S A;  1Z7U A;  3VB2 A;  1ZH5 A;  1FSE A;  3I4P A;  2DU9 A;  4HQM A;  1OKR A;  3ABT A;  2EB7 A;  3TO7 A;  2VE9 A;  4Q5S F;  5DD8 A;  3RKW A;  3DP7 A;  2MH2 A;  1IXR C;  2FBI A;  2ACJ A;  1W7P A;  3WTS C;  2BV6 A;  2GA1 A;  4AIJ A;  2M30 A;  3MQ0 A;  4I2O A;  3RKY A;  2UXN A;  2O6G E;  2VXZ A;  4A5N A;  1QQI A;  1SMT A;  4IVN A;  2EA2 A;  1DP7 P;  2IJL A;  2FXA A;  4BYY A;  3N97 A;  4DQ2 A;  3QPT A;  2FNP A;  4EJO A;  1X3U A;  1OR7 A;  4LGW A;  1VTN C;  3HOT A;  1TTY A;  3LQQ A;  1B59 A;  4HW0 A;  5H20 A;  2VOD A;  1LJ9 A;  2RVC A;  3BPV A;  4QWQ A;  1FZP B;  2AXL A;  1XD7 A;  2PBI A;  2VC0 A;  1IAW A;  3VOD A;  5E8I A;  2EJR A;  5CYV A;  4IRI A;  2M1B A;  2M87 A;  3L09 A;  1F9N A;  4RB2 C;  3LST A;  1MKM A;  2L4M A;  1TQI A;  4K2E A;  1FBS A;  1QBJ A;  3TGN A;  1BIB A;  5HS7 A;  3RTR A;  1HW2 A;  2CWE A;  3I59 A;  4RGX A;  4FT8 A;  1QO0 D;  4UV9 A;  3OV8 A;  3H3U A;  3JSP A;  4FX4 A;  1TQM A;  3V8J A;  2XHK A;  2NNY A;  5HLG A;  4AWX B;  2XAQ A;  1L3L A;  2CFX A;  3HIF A;  3V7S A;  1JHF A;  1EV7 A;  1UCR A;  3RI4 A;  4KMF A;  4LJZ F;  1BBY A;  3LAP A;  2DK5 A;  2MLK A;  2A5Y B;  1ZLK A;  1P4W A;  3JSO A;  1YIO A;  3FMS A;  3R6S A;  2GXG A;  3TKY A;  5DEQ A;  3B73 A;  1BI0 A;  1EH8 A;  1H0M A;  1UHW A;  4IHS A;  2JZY A;  1BI2 A;  2KRF A;  3CTA A;  2DK8 A;  3F21 A;  4OU0 A;  5D5V B;  3FXR A;  2LF7 A;  2PMH A;  1S3J A;  4YII A;  4UUV A;  3DPL C;  1HKS A;  1ONV A;  5LGT A;  4OMY A;  4HOB A;  4OIO F;  1T6S A;  1CF7 A;  4MQ9 F;  3M8F A;  1OPC A;  2RV8 A;  1PP8 F;  4H0E A;  2OQR A;  4PGH A;  2L4A A;  2OAZ A;  4I09 A;  1XMK A;  3F22 A;  5E18 F;  3V8L A;  3ISP A;  1D8K A;  2DPU A;  2QQ9 A;  3EYI A;  1IN6 A;  3QU3 A;  3IWF A;  3J81 Z;  3P9K A;  1ULY A;  2IA1 A;  2ZXJ A;  3FMR A;  4L9J A;  3KP5 A;  3QU6 A;  3O2P E;  4KT5 C;  4EVI A;  1W7P B;  4KN4 X;  2NNN A;  1GHC A;  2DPD A;  3T1B A;  1HSJ A;  4Q4Z F;  2EFP A;  3DFG A;  2RC4 A;  3ZMS A;  2DBB A;  4MNU A;  2FU4 A;  2Q8K A;  3MAJ A;  1R5H A;  4I02 A;  2XV4 S;  1LEA A;  1YG2 A;  3HTU A;  3QAH A;  4MGR A;  3GX4 X;  4KIC A;  5L3D A;  2FE3 A;  2EFQ A;  2V6C A;  3GZ6 A;  4Y17 A;  3GYH X;  2OU2 A;  4RGR A;  3K2Z A;  2JSC A;  5LEK A;  3HHH A;  4L18 B;  1I27 A;  4HX8 A;  1LVA A;  1T0F A;  3LA2 A;  3TQN A;  2LF8 A;  3F8C A;  3BZ6 A;  5HVQ C;  1U78 A;  2FML A;  5E20 A;  3COA C;  3F6V A;  5CJ9 A;  4Z2Y A;  1EH7 A;  1IN7 A;  1ZRC A;  5ERI A;  2ESN A;  1R23 A;  4M74 A;  1OYI A;  3I59 B;  4CYD A;  3L9F A;  3ABU A;  2Z5U A;  5D5X B;  2OA4 A;  4WCG A;  1FP2 A;  3K1M A;  2F5D A;  3FXU A;  5TRD A;  1YLF A;  1J2X A;  5BPI A;  3QPH A;  4EM2 A;  1ZG1 A;  4HDU A;  3I54 A;  4HBL A;  5LBQ A;  4ENJ A;  1XSV A;  3V4G A;  4WX9 A;  1KQ0 A;  2BEO A;  3KET A;  3E5U A;  4NHJ A;  2HOE A;  2FBH A;  3E3V A;  3HRS A;  1ZRE A;  3GFM A;  3KEQ A;  2E1C A;  2KIF A;  2KIM A;  5IT9 Z;  4KN7 X;  2IRF G;  2EK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...