1WCMJ

Complete 12-subunit rna polymerase ii at 3.8 angstrom
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Complete RNA Polymerase II and its Subcomplex,Rpb4/7
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1wcmJ00
1U78A 2JMWA 2XB5A 1DU0A 1XS9A 2AHQA 1BJZA 3PO2J 1UG2A 1T33A 4A3LJ 4A3BJ 4Y52J 1U9OA 3HDDA 3S17J 1Y1WJ 1VI0A 5C44J 5E3NA 3JRGA 3PM1A 2IBDA 3PO3J 3CQZJ 1WH7A 2CJJA 1XG1A 3GTLJ 5E3OA 4DZPA 2GBYA 3Q0WA 3VPRA 1FIAA 3HOXJ 3CMYA 2G0EA 4A3JJ 4BY1J 3S1RJ 5F27A 3DCFA 4D7MA 2JA8J 2FX0A 1ENHA 2XRLA 4I76A 3G1LA 2B63J 2QCOA 2NVYJ 1YRNA 2MSYA 1TWCJ 1JT6A 3S1NJ 3CCYA 3C2BA 4QSHA 5EZHA 1BL0A 4XRMA 4FE7A 2EQRA 1MNMC 2JN6A 2IAIA 3GTMJ 2E19A 2DMTA 5FKMA 2R7ZJ 4BY7J 1QVUA 1ITYA 2ECBA 3B6AA 3FKIJ 2M0CA 4DYCA 1ZTRA 1B8IA 5C4JJ 4MO7A 1IDZA 2DMUA 2LP0A 1MBKA 3BG5A 4X1EA 1O4XA 1ZQ3P 1TWFJ 4BKXA 3RZDJ 4MFDA 1UHSA 1XC5A 3BTLA 1HLVA 3ZQHA 2GM4A 1F36A 1DU6A 2E2IJ 1AKHA 4J19A 4AYBN 3FK6A 2DA2A 5EG0A 1JKQC 3FISA 1S7EA 1BW6A 3LSPA 3F0CA 2M9HA 1SANA 2DMQA 3ZOBA 2E2HJ 5M5XJ 3S14J 1FEXA 1FTZA 3K7AJ 3G1OA 3WHBA 3HOZJ 2EZIA 3BR6A 3HGGA 1P7IA 5DTDA 2JA5J 4QTRA 2LY9A 3TW6A 1F43A 4RDUA 5EDNA 4A3GJ 1HDDC 2GLOA 1MH4A 4W1UA 2O7OA 4XRSG 3HOUJ 3LNQA 2WV1A 1H8AC 1ETYA 1EF4A 1Q1VA 2VKEA 4BBRJ 2L7MP 1PUFB 4B3AA 3OSFA 1QPIA 3OIOA 2TRTA 1IV6A 2CUEA 3HOYJ 1JGGA 2JA6J 1JT0A 4V2GA 2JK3A 2ME6A 1WCMJ 2LFBA 3L1PA 4UUTA 5E3LA 1JJ6C 2XB0X 5J1UA 2HOSA 1TWGJ 3UKGA 2EZHA 1GDTA 3W6VA 4D5FA 2K9SA 4M3EA 1JKPC 2R93J 4BXXJ 1OFCX 3BTCA 4D5CA 2ZB9A 1A5JA 1FIPA 4M3FA 5E3MA 3H0GJ 5J1YA 4ABZA 2X9DA 5JLWA 1MBFA 1X2MA 1MBGA 2E1OA 2HOTA 1W0TA 1QRYA 2R5YA 2COBA 3JRFA 3Q0UA 1B72B 2XGCA 2Y2ZA 1E3OC 1B72A 1PUFA 2XPVA 2X48A 3A01A 3HBLA 3MN2A 1GV5A 5IYCJ 3QQAA 5C3EJ 1I3QJ 1WH5A 2NS8A 2X6OA 3JRCA 4RBOA 2DJNA 1ORKA 3JRIA 5M5WJ 1K61A 4JX5A 4DZJA 2XPUA 3IH4A 2LLKA 5GP9A 3HKZN 1X58A 3S1MJ 2NS7A 4M6VA 2VKVA 4UUSA 3GTPJ 2DA7A 5FKOA 1TC3C 3I4NJ 5F04A 5IP9J 2LTPA 1RKWA 3GTQJ 2CQQA 4FTHA 3GTJJ 1AKHB 5IOYA 1HF0A 1OJLA 4A69C 2NVXJ 2TCTA 2I10A 1MBJA 2OF7A 2HYJA 2OPTA 5FLVA 5IPAA 2FJ1A 5BNGA 1FJLA 4HNVA 1POGA 2L7FP 3LSJA 3E7LA 3JRHA 1HCRA 3GTKJ 5FKKA 2N8GA 4M3DA 4IHVA 3BTIA 1JUPA 2ME0A 3CDLA 1H88C 2R0QC 2R5ZA 1K83J 1RPWA 2JA7J 5DS9A 3Q3SA 5EEAA 4G12A 1LFBA 3BQYA 3QPSA 1ETWA 2XSDC 1IJWC 2KT0A 3MKLA 5FKNA 5K7FA 2K9NA 2Y31A 4MLOA 2XGEA 3ZQGA 2E2JJ 2O9LA 2R92J 3S15J 1GT0C 3HB9A 1ZR2A 3ZQCA 4C3IJ 1JKRC 1AU7A 1MBHA 2R5ZB 2NVQJ 3HM5A 3NARA 1I50J 2DA3A 1JTXA 1YRNB 3IH3A 5GPCA 5EYRA 1JTYA 2MW8A 4A3IJ 3BR0A 3SJMA 2CU7A 3BR5A 4JYKA 1IC8A 1AHDP 3ZQLA 4NDLA 4S0HB 1BW5A 1HOMA 5F0FA 1TWHJ 5M5YJ 2EH3A 2DA5A 2VI6A 2R5YB 2M34A 1OCTC 4A3FJ 3M3YJ 4A3CJ 2H1KA 4IHYA 1GUUA 3OSGA 2CRGA 1VNDA 1ETOA 1WPKA 5FKLA 1GV2A 3IV5A 2ID3A 5F1JA 1IDYA 1IG7A 2MGQA 1P7JA 2WAQN 3S2DJ 1Y1VJ 3K2AA 3TP0A 3TW7A 2NOGA 2EZKA 4D7NA 2JJ7A 3SDGA 2YU9J 4A3KJ 1ETXA 4FE4A 1RETA 3QPLA 3B6CA 1Z77A 3S1QJ 4A3EJ 3GTOJ 2HDDA 4MFEA 1W0UA 4XIDA 1IUFA 1JUSA 1ZR4A 4IEJA 4IHWA 2ID6A 2L0KA 9ANTA 1MBEA 4I6ZA 1ETVA 4IHXA 1UMQA 3LOCA 1RKTA 1BA5A 4L5EA 1QVTA 1X2NA 4AC0A 5IYDJ 3LSRA 3DEWA 1FTTA 2K9QA 2HXIA 4C2MJ 1D5YA 1IGNA 3HOVJ 5HODA 2LVSA 4FISA 4M3GA 3RQIA 1U9NA 2ELKA 1APLC 3BR2A 2MG4A 5IP7J 1MSFC 2LKXA 3GTGJ 1VF9A 4B4CA 2L9RA 5J3LA 5M3MJ 4X6AJ 3NAUA 5F08A 3TP3A 5F0CA 3Q0VA 2AO9A 5EGOB 3JRBA 3A03A 1G2HA 1ZKGA 1ETKA 3HOWJ 2PMZN 4QIWN 1LE8A 2H8RA 1T56A 2DMNA 5M3FJ 1LE8B 4BBSJ 2HXOA 3BT9A 1H89C 3SFIA 4B1RA 2Y9ZA 3BR3A 5IOZA 2HOAA 2ECCA 2WB1N 1TWAJ 2KDZA 1VFCA 1NTCA 3TEDA 1NK3P 3M4OJ 1OCPA 5IP6A 3GBGA 2LD5A 3G1MA 4C3JJ 3IH2A 2HQ5A 4MIMA 1LFUP 2DTZA 2D5VA 2IEKA 4XRSA 2EZLA 2JWTA 1JUMA 4XICA 3ZQFA 2LR8A 4M3BA 2HI3A 1B8IB 2P81A 4CYCA 4EEFG 4JP0A 3RKQA 4XK4A 1MH3A 3BG3A 4UUSB 2FD5A 2EBIA 3BR1A 2DA1A 3WHCA 3ZQIA 2XPWA 3A01B 3D1NI 3JRDA 4LOCA 2CUFA 5FLMJ 4AUXA 1WGXA 3O8GA 3JR9A 4A93J 3H3VK 1IRZA 4GFBA 1ETQA 2YS9A 5EF6A 2W48A 1CQTA 3BQZA 3S16J 2DA6A 1I6HJ 5K7HA 2NVTJ 4DYQA 5FJ8J 5IYBJ 4DYRA 2XGDA 2Y9YA 4A3DJ 4JX6A 3BTJA 1U8BA 3HEFA 5F0HA 1SFOJ 5EZGA 1A6IA 2QF7A 3FIWA 1JKOC 2VUMJ 4CYCB 2K40A 1ZGWA 2DA4A 2Y0SN 3BG9A 5EG0B 3LSGA 1RR7A 5EGOA 1R9TJ 1NK2P 2O8KA 1MSEC 3MVPA 1ZK8A 1WI3A 3O8HA 3I4MJ 1JJ8C 2YUSA 1GVDA 2DMPA 2M2EA 1HDPA 2RAEA 3RZOJ 4DW6A 3S2HJ 3FK7A 2FQ4A 2L7ZA 4W97A 5J1RA 4C3HJ 3JREA 2LK2A 4V2FA 2VPRA 2DN0A 4A3MJ 1Z0XA 3JRAA 4FCYA 2CQXA 1RESA 4Y7NJ 2M8GX 3A02A 5C4XJ 2Y30A 3HGYA 5JLXA 3OOUA 5K7ZA 4JX4A 5GPAA
chains in the Genus database with same CATH superfamily
1P9QC 2XB5A 4HOBA 2KIMA 2DOAA 4IQ4A 5D5XB 1D3YA 1R36A 4BNCA 5DV5A 3DKWA 3MCZA 3G71I 3WTZA 3M8EA 3DV8A 1RNLA 1U9OA 2VOPA 3OWTA 2HKOA 2LMDA 3S17J 5C44J 5E3NA 3CMAI 3W6KB 1QNTA 2Z33A 2IBDA 1REPC 3BG7A 1MMGA 5CVUA 1XG1A 1MMDA 3OR2C 2L2OA 2HTJA 3TDUC 2RNGA 3CJTB 4KNYA 4BY1J 1VQ6I 4L5IA 1FIAA 3VPRA 2P7CB 2G0EA 3KYCB 1BOAA 3S1RJ 1D0ZA 1DQUA 2LC2A 1U8RA 3OYBA 2FXAA 3AAFA 2NVYJ 2EIJH 1DPRA 2ELHA 2ICWG 2VXDA 2DQLA 4E7KA 3MZ8A 3V7RA 2F5VA 5EEHA 2OZUA 4I0AA 4CA0A 3HOSA 2P4WA 5B66C 2XVCA 5EZHA 2WV0A 3NWSA 2STWA 2EQRA 2VBYA 1I27A 1QBJA 1X1BA 4CCNA 1EV7A 3CP8A 2O61A 4CGZA 2FBIA 4C30A 3Q5FA 2GXBA 2LOOA 4BY7J 1QVUA 3AG2H 1A6QA 2M0CA 4RB2C 2DFHA 3H3ZA 5E1WA 1JI8A 2R7OA 1RC9A 4I01A 5L3BA 2W82A 3IRQA 2HVSA 3QRFF 2R7WA 2IP2A 1R4MB 4ESFA 1BR2A 4EJWA 2DK8A 1MBKA 3BG5A 3ECOA 1XMKA 3RZDJ 1YLFA 2M5WA 2O5RA 4RLFA 4CYDA 5LRSA 3OYHA 2E1CA 2QENA 1OCRH 2LNBA 2HYGD 5DM6F 4IXAA 2GM4A 3H5NA 3G4SI 3H9GA 3M9AA 1AKHA 3QP6A 1L3LA 2F48A 3ZGKA 4AYBN 5ICCA 4GYIA 1ZRDA 2ZC2A 2FE3A 3K4LA 3FISA 4KIFA 3LA3A 2M9HA 2LSOA 1SANA 2DMQA 2BVMA 2EV0A 5E18F 3S14J 1ZYRF 4ZTJA 2ZBKA 4UUVA 2OD5A 3WHBA 4EJUA 2EZIA 3CCMI 5D8KB 2ZMEB 2L02A 1I5ZA 1SC7A 3JSOA 1QZZA 3OL4A 2XKPA 3LQQA 4LD5A 2GLOA 3K9TA 3O2PE 1FBUA 4W1UA 2KIQA 4XRSG 2WV1A 1H8AC 2A68F 3ZQ7A 2MBFA 3F9KA 1Q1VA 4XQFA 1MNEA 3F21A 2EA4A 2QZ8A 2BE5F 5F64A 3TQNA 5D8LB 1YIJI 4LLNA 3OS2A 2TRTA 2V1NA 2CUEA 3HOYJ 3BLYA 5HVQC 3CCLI 3PFYA 5D5UB 1JT0A 3S32A 3U21A 3OYNA 3HHGA 3EUAA 1JJ6C 1FX7A 1XGNA 2XF5A 4MTDA 3ULQB 1ZG5A 1TWGJ 5J4YA 1G3YA 3W6VA 2JA2A 4DJAA 4DOZA 2IS4A 1EH8A 5HS9A 1SMYF 1BM9A 3H0GJ 3I0TA 2W00A 4GXOA 2X9DA 3ZQQA 2ZFWA 1W36D 1KQ9A 1MBFA 1X1AA 1X2MA 2BY0A 2E1OA 4LFUA 2VPLA 2ZMEC 2BHZA 2E60A 2XASA 1B72B 2YU3A 2CQKA 2Y2ZA 3GWZA 1IN6A 1OMIA 3FXLA 4GRIA 1ZG1A 5C3EJ 1BN5A 1XDUA 2NS8A 3LA7A 1R1UA 3DXJF 3SZGA 3QAHA 4JBAA 2H09A 4NC6A 2IGOA 4MEYF 5FFZA 4XBFA 4AYBA 3WGIA 4JX5A 3GFJA 3H5RA 4RB0A 1Y0UA 1Y6IA 2QLZA 3IH4A 2LLKA 4A2UA 1ZN2A 4N4OB 4BE0A 3ONQA 4BAYA 4R79A 3ZPLA 4B43A 3FF5A 4M6VA 3VYSB 4UUSA 3GTPJ 2DA7A 4LLLA 5J47A 3OS0A 2E7WA 1D0YA 2ZSIB 3OYEA 3DWLE 3GTJJ 4XLAA 1OYYA 2VBZA 2KFDA 1O7FA 2LF7A 1VQ5I 2OU2A 4A69C 3WTUC 2OCCH 2R7DA 4E7SA 3N4MA 1IN5A 1FMWA 1MBJA 2HYJA 4I09A 1R71A 1WRJA 4IQJA 3IKVA 1T0FA 2FJ1A 3H92A 2WWYA 4ENKA 1LDKB 3U2RA 3ZMZA 2R7UA 4M72A 3E7LA 2Z16A 2OQGA 2N8GA 3WTVC 3BTIA 1JUPA 2ME0A 1HSTA 3B73A 2KRHA 5A2QK 1KYZA 5DS9A 3MKWB 3TO6A 2A69F 2IGNA 4G12A 1LFBA 3L2VA 1FWZA 3BWGA 3O3KA 3MQ0A 5EEGA 3PNTA 5FKNA 2KP6A 3S3MA 1QGPA 2K9NA 2J5PA 2Y31A 2XGEA 4BH9A 3N05A 3S15J 4DBQA 4C3IJ 2PMUA 3HM5A 3MEXA 4XR6A 1I50J 2AS5F 1FMVA 1KA8A 5GPCA 4YRVA 2IW5A 1D1BA 3OR1C 2IS6A 3R4KA 4A3IJ 2OCEA 1WJCA 3GW2A 4MTEA 1C0WA 3NQOA 4S0HB 1J75A 1G59A 2MD0A 1LJ9A 1RR8C 4ZC3A 1YX5A 4EM0B 4BE2A 1YW7A 5DCFA 3M3YJ 1KU3A 4A3CJ 3F6VA 3GO5A 4HDUA 3K4MA 2ZSHB 2E1NA 1I6XA 2VKDA 4P9FA 2X6YA 2XKOA 3RKWA 2FNPA 1IG7A 2MGQA 3P5JA 1O3RA 4L9JA 1Z7UA 4BJTA 2ZXIA 2NOGA 2M7AA 1FP1D 3K4NA 2GIZA 1J5YA 2CW7A 1A31A 3SDGA 3J7YJ 5K5QA 3F8FA 2XV4S 1A35A 1USSA 1I1GA 2L54A 2O0YA 3B6CA 3OYCA 3BJAA 3VSKA 2UUZA 1USTA 4D0PA 3GTOJ 1W0UA 3E0JB 2L0KA 9ANTA 1MBEA 3I55I 1S72I 4XOTA 4KA4A 4BUPA 4E7ZA 2AQFA 2VJJA 4IPAA 2IS1A 2ETHA 4U88A 4XMYA 5IYDJ 4RLQA 2JT1A 3HRTA 3DKYA 1EH6A 4YIFA 2IA1A 1IGNA 2LVSA 4CCLA 1J2XA 2BZTA 2K3FA 4GCVA 5A2QZ 3GVAA 2IA2A 3MZHA 1SAXA 2G9WA 2VIXA 2PJRA 2GXAA 4X6AJ 5M3MJ 5J3LA 3OYIA 2ZJ2A 2FNAA 2IGMA 2AO9A 2VOOA 2GZWA 2XAGA 3JRBA 1IN4A 1XB4A 3PUBA 3W2VA 3A03A 4B44A 1KGSA 1PDNC 5E1ZB 3HOWJ 5KNLA 2KZGA 2H8RA 2V9PA 2MC3A 3PNYA 2J5OA 2HXOA 1H89C 2K86A 3I59A 1CF7A 3CZ6A 3KP5A 1N78A 2XAFA 4ZYAA 2X4HA 5DEQA 5IOZA 1BIAA 2HU9A 1OCCH 3MFKA 3M8FA 1P6RA 2KRFA 1XX5A 3ABTA 2QA4I 1N77A 3CESA 3GFMA 1X3WB 3I9V2 2M45A 3G1MA 3ERMA 4IJAA 4PJNA 1PJRA 4C3JJ 3K4JA 1YYVA 3RYRA 2IRFG 2UXXA 3ABLH 4UV8A 3DU6A 3E5XA 2GQQA 1YG2A 4NQWA 4OIPF 2P81A 4I98B 3H0DA 4KN7X 4A0YA 2EINH 3RKQA 4ENJA 1U5TB 1MH3A 3BG3A 2A07F 1HW5A 3P7NA 5DDGA 3KFWX 1AA7A 2XPWA 2W24A 1RUNA 3D1NI 3RI4A 4S04A 2FOWA 2ZMEA 1T8IA 1ULYA 1HA8A 4EQQA 1SVLA 3NWTA 1BIBA 2MH9A 1MMSA 2IJLA 3O8GA 3DF8A 3QWLA 3H3VK 2A5YB 1IRZA 5FRMA 4HX7A 3W2WA 4BDZA 4GFBA 4G9YA 3M1CA 3OOPA 3IKTA 1CQTA 4ZDPA 1QPMA 5D4SA 1YQAA 3S16J 2DA6A 3V4GA 1I6HJ 5K7HA 2VBWA 2E1MC 3CUOA 2V9VA 3HZJA 4ESBA 2BVLA 2YSRA 4A3DJ 2LYCA 3S8PA 3ESWB 3T1BA 1FYLA 3HEFA 2GAUA 1EJ9A 3FXKA 3FIWA 2BHYA 2HQNA 1W4MA 5AONA 3LAPA 1FC3A 3M1EA 2BOLA 5KHDA 1BC8C 1WWXA 2X1EA 4UB6C 1WI3A 4WK8F 4H4KC 2WA0A 4LJZF 4E7JA 4MQVA 1B1BA 2XF7A 4PUSA 2FRHA 4IOCF 2RAEA 4DW6A 4ZDLA 4U7DA 2JUGA 3FK7A 1F9NA 2L7ZA 1MJAA 4C3HJ 5J1RA 2VASA 1SFKA 2H94A 5ICGA 1Z0XA 4U0VA 4YEJA 2LY1A 2M8GX 2BY3A 1M1EB 4C9YA 4JX4A 5BQTA 1OR7A 2VB6A 3O6BB 1UB9A 5GPAA 3FMSA 4KN4X 1TBXA 1WJFA 1U78A 1PP8F 3L00A 2DI3A 1ZG3A 1TQIA 2DPDA 2BBYA 1R23A 3CC4I 1B9NA 1FOWA 1BJZA 1U6GA 4HSRA 1T33A 2P0WA 1DGRM 4II2A 4Y52J 1S6LA 3I64A 1WHUA 3JRGA 1WVRA 2FQ3A 4N0BA 2JVHA 4FX0A 4B8XA 4E7IA 4V19K 1MDMB 2CJJA 1SFEA 2Z1DA 2F4IA 2BW3B 2DPUA 2LKSA 3GTLJ 2EA2A 1U5TA 2ZXJA 5F27A 3DCFA 2FX0A 1ENHA 2XRLA 1LEBA 4I76A 2QCOA 4M74A 3HJEA 4LGWA 4XLFA 5GAGJ 2F5FA 5GAHJ 1JT6A 1HC8A 2QQ9A 3WGGA 1MDMA 2ELJA 3CCVI 1GXQA 1AOYA 1YS7A 5FRNA 3RKYA 1MNMC 4AM3A 1DDNA 2MC4A 2VQGA 4WCGA 2IAIA 2FU4A 4E70A 2E19A 2DMTA 2XGXA 6PAXA 1Y39A 1TNTA 1GXPA 2BYVE 3KZIC 3B6AA 2MH2A 4MHGA 5J6XA 3CDIA 1TLHB 3EUHC 1D5VA 3JAMZ 2QUFA 2XROA 4LG0B 4FQGA 5HS7A 4FT8A 1IDZA 2DMUA 4PJLA 1ON1A 4X1EA 4XLCA 1SD4A 1O4XA 3K1PA 4GGGA 1VQ7I 2H6CA 4L9VA 1UHSA 4KIGA 3BTLA 4XSXF 1HLVA 2O03A 3TGNA 2DCEA 2KJCA 1LVKA 2BEOA 2F6CA 2F5EA 4FETA 2DA2A 4I0BA 1BW6A 3LSPA 3F0CA 4RGSA 4AIJA 2HNHA 5M5XJ 1K7AA 1FTZA 1ZELA 3HSEA 3I54A 3K7AJ 3G1OA 3BR6A 3HGGA 5DTDA 1XTAA 3QU6A 2JA5J 1F43A 4UNOA 4IHTA 4HV5A 2QBYA 3WTXC 4RDUA 2I5UA 5EDNA 5H6RA 2JPBA 4I02A 1Z7LA 3VODA 1TNSA 2EPFA 2O7OA 3PSIA 3LNQA 3KYLA 1DP7P 4XM3A 2WTEA 4B09A 4CHUA 3HYIA 4BBRJ 1PUFB 2DT5A 1L0OC 4XLEA 2W85A 1QPIA 2UWMA 2VQLA 1IV6A 2XRNA 3VDXA 1YHQI 3ABKH 4V2GA 3K4BA 5DD8A 2JK3A 3J81Z 1WCMJ 2ISYA 5E3LA 3S3NA 4OOIA 5FFXA 2H27A 4C2UA 2BXYA 2CV0A 2EZHA 4LIUA 1GDTA 4D5FA 2K9SA 3A1YA 1Y8RB 2R93J 3BTCA 4AWXB 2M30A 3DPLC 5HDGA 1FIPA 3C3WA 3CC7I 3H36A 1ONVA 5JLWA 1ZRCA 1P92A 5LLQA 2EV6A 2HPMA 2FA5A 4BQAA 2R5YA 3HHHA 1IN7A 4OIQF 2OTJI 5JI6A 1B72A 3MN2A 5IYCJ 5DUIA 3IUOA 3GF2A 1MIJA 3JRCA 5D6EA 4G94A 5M5WJ 2DJNA 3GZ5A 2E7XA 2KPMA 4LIVA 4DZJA 1XN7A 4LB5A 2VQHA 3OMYA 3HKZN 3H3UA 3W3CA 4G6TB 2HZDA 5FKOA 1TC3C 4R8HA 2W7NA 5F04A 5IP9J 1K78A 2L4MA 2FEZA 1WJAA 3DBLB 4EVIA 5LHHA 4OIOF 1AKHB 2NXNB 1GLNA 5IOYA 5J4VA 4BDYA 1DGWY 1ON2A 3BCBA 4XLHA 2NVXJ 5CVJA 2TCTA 3HUGB 3IWFA 2XUBA 1EA3A 5LHGA 5IPAA 3CO6C 4XOPA 3HOTA 2RGVA 5BNGA 4OAYA 3DPTA 5CYVA 4HNVA 3F23A 4MNUA 1HKQA 1K78B 3WU2C 4K2EA 4AU7A 3JRHA 4YFXF 5FKKA 1VQ9I 3V8JA 3HPGA 4M3DA 2Z99A 3ZMDA 5CQGA 2DODA 2R5ZA 1RPWA 2FOKA 1U2WA 1O3QA 3EUHA 1Z91A 3I56I 2XSDC 1IJWC 3FXRA 3I3LA 1O3SA 3OYAA 3MKLA 2QQ8A 4PJMA 4UVAA 2O9LA 3VWBA 1GT0C 3HB9A 4HBLA 1ZR2A 1JKRC 2R5ZB 4OMYA 2NVQJ 4PK4A 3QPTA 1V4RA 3NARA 1YRNB 4CICA 3P9KA 2A61A 1T38A 4A12A 1A36A 4EJOA 1JTYA 1TW3A 1D8JA 4NDLA 2Q8KA 4PJJA 2IA0A 4LMYA 4L18B 2VI6A 3W6JB 2H6BA 2M34A 3BDDA 1OCTC 4QPOA 1ZAOA 2JQ7A 1X4OA 2DDAA 2CRGA 3ASNH 1VNDA 3R6SA 2CGPA 5FO5A 1Y56A 2IPQX 3R61A 5AIPA 2ZNYA 1XSVA 1P4AA 1QZEA 3ABMH 1QA6A 5CVVA 1MNDA 3KETA 2XAHA 4E6KG 3TL4X 5K5RA 1Y1VJ 2JZYA 3A4CA 2B9SA 3CD6I 4P5OA 3TW7A 2NOJB 2HR3A 4D7NA 2DLLA 3D5SC 2YU9J 5IY5H 4HEA2 2WAEA 1RRJA 1RETA 2P8TA 1FBQA 1S7AA 3RPUD 4BHCA 4ESJA 1X4PA 2RKHA 2UZKA 3G2BA 5LBQA 1K4TA 2V1DA 4XIDA 1JUSA 3PNVA 1YITI 4IHWA 3D0SA 4I6ZA 3KP7A 3K69A 1J59A 2M3AA 4EGZA 4DQ2A 3OYGA 3E5QA 1B9MA 2HS5A 4IHXA 1UMQA 2OTLI 3I58A 2NS0A 1O7LA 3T8RA 3FZVA 3LSTA 2E34A 1QVTA 4L5EA 2CWEA 4AC0A 4KDPA 1PYVA 2K9QA 2P5VA 5FGMA 1FZPB 4HNUA 1G3SA 2K85A 3DBHB 2L9NA 1TT5B 4HF0A 3HOVJ 5D6FA 2DAOA 1V54H 3J80Z 1DP3A 4XKVA 2CQ7A 2F4OB 3RQIA 5BPDA 1O3TA 1IN8A 1KQ0A 2A05A 4M73A 1YJNI 2ELKA 3BR2A 4M9XA 2W84A 5IP7J 1W7PA 4JOMA 1R5ID 2CUZA 4A6EA 3ZP5A 3OYFA 2L9RA 1VTNC 2L01A 2CMPA 5F08A 1HW1A 4HQMA 3TP3A 5F0CA 3FX3A 2I8DA 2MLGA 4M71A 3RQ4A 3RJPA 4XORA 3GFLA 2MABA 1ZKGA 2PMZN 4QIWN 1LE8A 3HIFA 1T56A 5M3FJ 5E17F 3OS1A 4BBSJ 3ZN0A 4XN3A 5L3GA 2Y9ZA 4II3A 3BR3A 2HOAA 3FM5A 2NAZA 4NNJA 1F4KA 4P9UA 1TWAJ 3UNGC 1NTCA 2QKLB 4QPQA 2E36A 4BXFA 3CUQC 1RUOA 4CCOA 5GTHC 4KFCA 3HPHA 1LUJB 1WSUA 4U0WA 4P55A 1XSDA 3LWFA 1UZCA 2IEKA 2KMUA 2EZLA 1F1ZA 1BI1A 4XICA 3ZQFA 1TTYA 1B8IB 2HI3A 4ITVA 1WQ2A 4BQOA 4LG0A 1WJDA 3J7AO 3CC2I 1E0EA 4JQFA 2MFZA 5HLTA 4UUSB 1SD7A 3F8MA 3RPQA 4LLGF 1AWCA 2HEOA 3ZQIA 1W36C 1Z67A 2Z9OA 3KP4A 1K6YA 4N9HA 4DNCA 3JRDA 1D1CA 4LOCA 3SHFA 3JR9A 2VE8A 3V7SA 3ROUA 1KZHA 4EM1A 3BQZA 5F6FA 3OY9A 5TISC 1R49A 3WTWC 3FXJA 5FJ8J 5IYBJ 2EJRA 3NEUA 1EKEA 1P4WA 4BS9A 4JX6A 4IL6C 1U8BA 1SFOJ 2DFEA 5FLXZ 5L3DA 1JKOC 4LG3A 1T0FC 3EYYA 4HLYA 2OQRA 3L2UA 2VBXA 1TZLA 2DA4A 5L3FA 2K3PA 2GA2A 5EG0B 5EGOA 1MD0A 2KJBA 2O8KA 3IAM2 1V5GA 3O8HA 1FYKA 3I4MJ 1WJBA 1V55H 1R22A 4IO9F 3S3OA 2YUSA 3SZPA 2X0LA 2DMPA 2M2EA 2V6CA 2JSCA 2YR2A 4U87A 1FOKA 4CCJA 2PBIA 5J8FA 1FPQA 3KLOA 3EPZA 5HLGA 3WTTC 2NNYA 1VQKI 4HF2A 2Y69H 4G7ZF 2A6TA 4IVNA 1IXRC 3JRAA 4G7HF 1RESA 5HLHA 3A02A 2R7TA 5C4XJ 3FXOA 1MGTA 4KICA 2EILH 4WXCA 3TOBA 2WBMA 2CSOA 1ZLKA 3M07A 4ZZLA 2JMWA 3LSMA 5B1BH 1DU0A 4EMSA 2P7VB 1U3EM 2DBBA 2XC7A 1FBSA 3FMRA 3PO2J 1SAUA 5K5OA 1MMAA 5ERIA 2L9SA 2OZ6A 3L2RA 1IRXA 4A3LJ 2DU9A 4EGYA 2LY2A 3HDDA 1XGSA 2LDUA 5JVGF 4HX4A 1Y1WJ 3A0BC 3CF5F 3IAS2 4Y4RA 1Z6TA 3PM1A 1IV8A 3CQZJ 1WH7A 2CFOA 5CVRA 3TO9A 2M8EA 3WE3A 2K9MA 4BACA 3CMMA 2QYOA 3OYDA 5E3OA 2B7EA 3Q0WA 5JFRA 2GA1A 1IRFA 3A2KA 1D1AA 1HKTA 1UELB 1ZGJA 2IXSA 2XIGA 4D7MA 1IXSB 2JA8J 3GMEA 2GXGA 3G1LA 5JVTA 2H1LA 4BXUA 5ICEA 2PMHA 3DEEA 1TWCJ 2PQ8A 1HKSA 3S1NJ 1MKMA 1BOBA 3WGHA 3L2QA 1IXCA 3CCYA 2BGCA 2GWRA 1D8KA 3C2BA 4QSHA 1PUEE 4FE7A 3MMYB 3HUGA 1JE8A 2VL8A 3CP2A 2JN6A 3CCJI 5D4RA 2EFWA 4HG2A 3TMOA 2CYYA 2L9VA 3WTYC 3W2AA 2R7RA 4AIHA 2FBKA 4BJ5C 3FKIJ 2DJIA 3QU3A 5L3CA 2VQCA 5LFAA 3PUFA 1LVAA 3ASOH 4DYCA 1ZTRA 5GTIC 1XGOA 1YW9A 1B8IA 5E20A 3GYHX 3K6GA 3HTSB 4ZTFA 3BY6A 2D45A 3VSLA 2WY7Q 2A5WA 2LP0A 1P2FA 2EWNA 5J40A 1TWFJ 4BKXA 1IF1A 1IW7F 1P4XA 1XC5A 2V4JC 4AIDA 5BS6A 2XAJA 3ZQHA 5DYMA 1F36A 1DU6A 4XKBA 2E2IJ 3FDYA 4J19A 1OLTA 3FM3A 1UJ8A 2XDVA 3RYPA 1V5FA 3FK6A 4FHTA 2OC6A 3HRUA 2RN7A 1PP7U 2CQNA 4AVZA 3EDPA 2E2HJ 4L9NA 2NRAC 3TBIA 3U1KA 2DW4A 1BC7C 1OISA 3BJOA 2R3SA 3HKZA 4QLCU 3MWMA 4QTRA 2LY9A 3TW6A 1X1DA 2QM3A 2XAUA 2DYRH 5TGTA 1HDDC 3KEOA 4NBQA 1LDJA 3D5RC 3I53A 3ISPA 3LSHA 1E17A 2Q2EB 5CQEA 4NC8A 3LMMA 1CGPA 1ETYA 1EF4A 1NH3A 1OQYA 3FMQA 2JTVA 1LDDA 1ZARA 2E5ZA 2L7MP 4Y13A 3VB2A 1FNNA 2DT6A 5FLXK 1R5HA 2ESHA 1JGGA 3LQRA 4HF1A 2JA6J 3AG1H 3L09A 4BHBA 2LFBA 1GVJA 4ENNA 1E2XA 5ILUA 1G4DA 3LA2A 2XB0X 2F5DA 1WJEA 1UG0A 1N75A 2RVCA 2CV1A 4M3EA 2Y48A 1IUYA 4BXXJ 1OFCX 4D5CA 2ZB9A 3SDBA 3DLLF 4GYGA 4M3FA 5E3MA 4PZJA 2QSHX 5J1YA 4NQWB 1TQPA 4HLXA 5FB2A 4EM2A 5CPRB 2FSWA 2Q1ZB 1T98A 2HOTA 3JRFA 3Q0UA 2QWWA 3E6BA 2XGCA 3DPUA 4HX8A 1E3OC 3R0JA 3A01A 3SEZA 2DYSH 3IC7A 3G6EI 1GV5A 1YTYA 3QQAA 1I3QJ 1WH5A 3JTGA 3BPXA 4QWQA 3CF2A 3ZN1A 5LRRA 1KQ8A 2CUJA 3JRIA 4GDFA 3KEQA 1K61A 2XF6A 1E3HA 4KITB 5GP9A 1X1PA 4UB8C 2NS7A 4UXNA 4FX4A 2KDOA 5JHFA 4CZZA 1OPCA 2LTPA 5LEJA 1RKWA 1FP2A 3H35A 3RDIA 3GTQJ 4FTHA 1HF0A 5BMZA 4YFNF 4OAZA 1STZA 2L7KA 2X6WA 1MZBA 4MEXF 2I10A 2R7FA 1ZGAA 2OF7A 4IRHA 5FLVA 3T8TA 1DUXC 3L2WA 4IHSA 2GOXB 5BOXA 1FJLA 1NG7A 2L7FP 1XMAA 4G6DA 4BJ6C 1HCRA 2W25A 4Q47A 4XLNF 4BQNA 4KT6A 2V1UA 3KZYA 1YX3A 2VT2A 4UY8I 1H88C 1DPUA 3CCEI 3D5LA 4WF2A 2R0QC 3K70D 3E1SA 1HQCA 2DOEA 2JA7J 5KK1A 4PFOA 3Q3SA 3AL0C 5EEAA 2DFFA 4BE1A 1ETWA 3CJQB 3KPHA 4BQQA 5B5EC 3LSKA 4WXDA 4DBRA 2ZO4A 2HFHA 1Z9CA 2R7XA 2E2JJ 3CUQA 2R92J 3VYUB 1XDSA 5DCMB 5ILSA 4ANJA 4CSWA 2Q0OA 1YOVB 5KAIC 1AU7A 1MBHA 3KEYA 2HZTA 2CW8A 4UHTA 4F55A 3P9IA 2DA3A 1WI9A 1JTXA 4EJTA 2CW0F 2VJIA 3ZR8X 1FLIA 5EYRA 4XKCA 3VFZA 3BR0A 3GLXA 3SJMA 3BR5A 1AHDP 3ZQLA 3WG7H 3X2QH 2JPCA 1HOMA 5F0FA 1TWHJ 2HGCA 1SMTA 1MJBA 5TRDA 2PJPA 2QQAA 2R5YB 2KIUA 3WODF 1JHHA 3M7GA 3QP5A 2H1KA 4EJVA 2FBHA 3CCSI 3KIOA 4MQ9F 1ETOA 2LKPA 1B59A 4Z2YA 3H1CA 1SEUA 2Z2SB 1GV2A 3HTUA 1KONA 4R1HA 4BU2A 1UAAA 2KHMA 4ZYHA 2ID3A 4XRFA 1W5SA 5F1JA 3K1NA 1Z6RA 3K10A 2AQEA 2EFNA 2IT0A 3S2DJ 4AVPA 3AG3H 3TP0A 2EZKA 4Y15A 1UFMA 2X85A 2P6SA 4PJ0C 2EFOA 3CO7C 4A3KJ 1ETXA 1QQIA 4EV0A 1SVMA 2V79A 1Y8QB 3DU5A 1Z77A 4HPQA 3S1QJ 5D5VB 2EIKH 3AKZA 4A3EJ 2V7FA 2ADUA 4MFEA 3MD2A 1NHAA 1ZR4A 4IEJA 2KLOA 3K4KA 2ID6A 1SD6A 3VEPA 1ETVA 4S05A 1VQNI 2LG4A 2GIVA 3BZCA 2NVUB 2G7HA 1BA5A 4XONA 4ZYDA 1X2NA 3F3XA 1JGSA 2XAQA 3LSRA 2L4AA 2G7UA 2LREA 4P1WA 1VQ8I 4IOAF 4G6QA 4C2MJ 2ESNA 3L7WA 3ECHA 3OYLA 1V5EA 3BCAA 5TJJA 4FISA 4XLPF 3MAJA 3EYIA 1U9NA 1VQOI 2EV5A 5FROA 5IT9K 3EQLF 2LKXA 3GTGJ 1X3ZB 3QODA 4NHJA 1XCVA 3BC8A 4BL0B 2DOFA 3T0YA 3LSIA 2OUMA 1YS6A 3GXOA 4RM2A 3Q9VA 4BEHB 1YE9A 2OA4A 4ZZDA 5CKTA 2FMYA 1G2HA 2K02A 3IP4B 1ETKA 2PI0A 3V8KA 4F91B 1LE8B 3BG6A 3K4CA 3SFIA 2F4MB 1HW2A 2MA3A 1H0MA 5DCMA 2WB1N 1S5LC 1TL8A 3MKZA 2KDZA 1VFCA 1NK3P 1VQ4I 4CDGA 4F7ZA 2WAFA 2D1HA 5E79C 2VC1A 1OCPA 4LK0F 5JR3A 1W7PD 2ZXWH 4H0EA 4RAZA 2Z3YA 5IP6A 4C2TA 5DM7F 3ELKA 3GBGA 2V9KA 2STTA 4M9SA 2YX7A 3IH2A 1X3UA 2RQPA 3GCMA 4MIMA 1LFUP 3NRVA 1JUMA 3CJNA 4IX7A 3PFIA 5FD5A 2UXNA 4M3BA 3QYFA 2VC0A 4EEFG 1G3TA 4XK4A 5KVRA 4J01A 4N4NB 2EBIA 2QKMB 1T08B 3WHCA 3KYDB 2Y75A 3SEQA 4RAGA 1J9IA 2LRDA 4WXHA 5FLMJ 2K9LA 3EUKL 1WGXA 4HAMA 2K4JA 2KL4A 2L5QA 2YS9A 4RM3A 2F2EA 2MYSA 1BR1A 3C2GA 3OIQA 1LQ1A 4HA8A 4U0YA 1HSJA 2JRTA 3IL2A 3LAJA 2NYXA 4CCKA 4CUGA 3C1DA 2LH9A 3DTKA 4B47A 3ZMUA 3SXYA 1FYMA 5CVIA 2Y9YA 1S7OA 3GZNB 3BTJA 2V1XA 3I59B 3J81K 4WX9A 5H2FC 1RIOH 1A6IA 4LK1F 2DQRA 2QF7A 2QVOA 2ACJA 4HV6A 3RCOA 4IZZA 2VUMJ 2BW3A 4CYCB 2K40A 4ETSA 1ZGWA 1BBYA 2JRMA 2KISA 2Y0SN 4OMZA 3WG9A 5LD2C 3KP2A 4P96A 2M7BA 3JTHA 1MSEC 2Y0MA 4Y17A 1JJ8C 2KQRA 2CV2A 4WWCA 2R7VA 1Z3XA 1GVDA 2ZJRF 2O3FA 1MJ9A 3RIRA 3SZTA 4MGRA 4ZH4F 2H8WA 1HDPA 2ZXHA 5HLIA 5FD6A 3FHZA 2LBFB 1UHMA 3S2HJ 1OCOH 2P5LC 2E35A 2FQ4A 2BY2A 3BROA 3R60A 1YFHA 3BJ6A 3JREA 1OCZH 1A04A 2LK2A 3VYRB 1J0RA 2VPRA 3AFHA 2DN0A 4PSWA 4A3MJ 4M6XA 2WADA 3BP8A 4FCYA 2CQXA 4Y7NJ 2XSJC 1K4SA 5JLXA 4F92B 1X19A 5K7ZA 1CF7B 3FBNB 3V42A 4CO8A 2QBYB 1GHCA 4KYWA 1FSHA 5DD4A 1XS9A 1OKRA 2AHQA 1FOYA 4JK1X 3ERED 3CDHA 4BEHA 1UG2A 4A3BJ 3JCUC 5LEKA 3SFZA 1YO5C 4CCMA 1VI0A 2DDBA 4F3QA 2KZVA 2M0MA 4XKWA 2PMZA 3DBRB 3PO3J 4L0ZB 1OYIA 1TT0A 1JXSA 1B6AA 4F93B 2VN2A 4DZPA 2GBYA 3HOXJ 3CMYA 4DIQA 4OIRF 4A3JJ 2VLAA 1R6RA 5K1YA 3KCCA 4F52A 4M6YA 1KU9A 2B63J 1KU2A 1YRNA 4UVCA 4HSTA 2MSYA 5H6QA 4ENMA 2X1DA 2O6GE 5AIQA 3FXMA 4NB5A 1LKXA 4CXFA 2HQAA 4NC7A 2V26A 1BL0A 1T6SA 4XRMA 3RTRA 2HVQA 3DKXA 2Q2EA 5CLSA 3GTMJ 5FKMA 2E71A 2R7ZJ 1ITYA 1TQMA 2ECBA 3TO7A 5HNHA 3B02A 1VZ0A 5E8GA 5HDKA 4HYEA 4FASD 5GAEJ 3S2WA 1Z3YA 2P5KA 3RSNA 3FBIB 5C4JJ 3BZKA 1FY7A 3FHNA 1Q1HA 1SD5A 1XSXA 1XMXA 4MO7A 2P6TA 2FMLA 3IWZA 2AXTC 1ZQ3P 1ACIA 2VJ5A 2L3DA 2LF8A 5B1AH 3JSPA 4MFDA 3LFKA 2CO5A 2F5CA 1W5CC 1O57A 2IS2A 4HQEA 4EATA 3DP7A 1SFUA 1ODDA 2CG4A 3F8NA 2IGKA 4RAFA 2PLYA 3GUDA 2HDCA 2PX9A 5B3SH 5EG0A 1JKQC 4O3MA 1TW2A 1MW7A 1S7EA 1SVOA 3I5UA 4A0XA 3REOA 3GZ6A 3FKJA 2RNJA 1FEXA 3ZOBA 2VKHA 5ICFA 3HOZJ 3CJRB 1VQLI 1MMNA 3HSFA 4IRGA 1P7IA 1EH7A 2D1VA 1XPXA 2EB7A 3Q9SA 1ZLJA 4A3GJ 1F5TA 3AL0B 1OYWA 3I4PA 2EK5A 3WU1B 1MH4A 3G73A 4Y33A 1Z21A 1RZ4A 3HOUJ 1G6NA 4HW0A 1X1CA 2JSPA 5J8CA 3L9FA 5HS8A 2VKEA 3BOQA 1SFXA 1W7PB 3JW4A 2M4KA 4B3AA 4HNTA 3OYKA 4TV7A 3OSFA 1BI3A 1FT9A 3HSRA 3FXQA 3OIOA 1IZ1A 4RAYA 2LBFA 4UVBA 1KU7A 4GO1A 1D0XA 1QU3A 5H20A 4RMNA 2ME6A 3L1PA 4UUTA 4X0GA 2RC4A 3F8BA 3E5UA 4KMUX 5J1UA 1ZRFA 2HOSA 3UKGA 3GFIA 3E6DA 2EIMH 2XHKA 1JKPC 2Z5UA 2BV6A 3LL7A 2B0LA 1FOXA 2MD5A 2RQQA 1JHFA 4ZYGA 1A5JA 1K79A 2ISZA 2ZJPF 1BI0A 4ABZA 3P9CA 4BGDA 2VE9A 3CTAA 2VT3A 1MBGA 4RB1A 3J7AY 1W0TA 1QRYA 4HDVA 2COBA 2K7LA 2PEXA 3KE2A 4PGHA 4O6JA 2CS3A 1PUFA 2XPVA 2X48A 1R4NB 2BY1A 3HBLA 1UCRA 1KYWA 4IF4A 3KX2A 3FWEA 2X6OA 3ZMVA 2WY8Q 2KRCA 4RBOA 2EFQA 1ORKA 5JHUA 3WTSC 2K5CA 1BJAA 4B48A 2PFBA 2XPUA 3ML6A 4CZCA 3E6MA 1X58A 3G3ZA 3ZMTA 3S1MJ 3GX4X 1R5GA 4D9JA 2VKVA 4RS8A 3PIOF 1YJWI 4A5NA 3I4NJ 3RPUA 5LGNA 5HNFA 1QHGA 2CQQA 1NG6A 3J7ZI 3IHUA 1OJLA 1YIOA 3AG4H 3DFGA 4KT5C 1TP4A 1H9GA 2BXZA 2V6EA 3DQVC 2OPTA 2JVGA 3QOEA 5EJCA 3OYJA 1QHHD 1HBXG 3GLLA 1POGA 1FSEA 4BYYA 3LSJA 3GTKJ 1E3PA 3QYBA 4I99C 1K6OA 2YX4A 3SQNA 4BHPA 1G8XA 4IHVA 3KP3A 2C6YA 2WAQA 3CDLA 3CUQB 2OBPA 2WB1A 4Z6YA 1K83J 3ZRGA 4A6DA 2K27A 2RDPA 3H5AA 2RV8A 4RA2A 1N25A 3BQYA 2O8XA 3QPSA 5KAFC 3F22A 3HG9A 4Y3OA 1V3FA 1Y0NA 4O5VA 1PVEA 2QQBA 2KT0A 1T2KA 3HC7A 4ASNA 5K7FA 4MLOA 4A5MA 2A6HF 3OIPA 3ZQGA 1XGMA 4Q48A 2HPIA 3ZQCA 2OJED 2HWVA 1YI2I 2QGUA 3HL2A 1LEAA 1R1VA 4M9ZA 2CFXA 2HDWA 2ZFUA 4OINF 3PL8A 4ZJZA 4KMFA 3IH3A 2VODA 2AXLA 2HTSA 2ZNZA 5GADJ 2EFPA 2MW8A 2FUG2 4UV9A 1XD7A 2CU7A 4JYKA 1IC8A 1BW5A 5ILVA 4XL9A 3MZYA 4E4HA 3S93A 5M5YJ 2EH3A 2DA5A 4PCQA 4ZYEA 4XN0A 3PSFA 2HKXA 1VQMI 2HQRA 4PFPA 3V7CA 3QOPA 4A3FJ 3CCQI 3R0AA 3CMEI 2DK5A 3M8JA 1GUUA 4A0ZA 3OSGA 4IHYA 4B3XA 2W57A 1WPKA 1IAWA 4KIBA 2ZCWA 5FKLA 3PQJA 1LNWA 2VJ4A 3WE2A 5L3EA 3IV5A 4IKFA 1J7KA 1UHWA 2JUCA 4AIKA 1IDYA 1LFPA 1T39A 1P7JA 4HRIA 2COMA 2WAQN 1QZYA 3F6OA 3K2AA 3HRSA 3ZXSA 2D2WA 2JJ7A 4LITA 3DTEA 2YPRA 4FE4A 5ED4A 3OYMA 3QPLA 1HXDA 3H9JA 3J80K 3I71A 1I39A 1H9TA 2Y0SA 1I3AA 3CCRI 2HDDA 1IUFA 4I2OA 4XNFA 3VYTB 1Z1DA 4G8XA 2K4BA 2M87A 3KLNA 5IT9Z 2PG4A 2TDXA 3EETA 1BR4A 1R58A 2A3SA 3DEUA 5HOOA 1RI7A 1J09A 1RKTA 3LOCA 3PQKA 4KISA 3K2ZA 3TOAA 4U7BA 3C18A 1QO0D 3DEWA 1FTTA 3IRRA 2HXIA 2QSFX 2OAZA 5HDNA 1WFXA 3V8LA 1D5YA 3C2HA 1YJ9I 3F8CA 1T95A 4YG2F 4J00A 4YIRX 2HYFA 1I1SA 5HODA 1VQPI 2FF4A 4M3GA 1OR7C 4DGWB 2PN6A 1S29A 1R1TA 5LGUA 1APLC 2MG4A 4RGXA 1MSFC 4YFKF 2PJRB 4NUBA 3HXLA 1VF9A 3QYEA 5D5WB 4B4CA 2KIFA 2R4GA 3NAUA 2KKOA 3Q0VA 4ON0A 2DXIA 5EGOB 4L5JA 3VOEA 2GOMA 2RREA 4RGUA 3OL3A 3ABUA 2X6XA 2DMNA 1ZH5A 4I7HA 1Z05A 3BT9A 3CLOA 2E1MB 2M4GA 4B1RA 5BPIA 5E1XA 3K0LA 1BI2A 5DUKA 2ECCA 2HOEA 1IRGA 2W1OA 4HZFA 4E7HA 2A6EF 1S3JA 3GEZA 3TEDA 1WKMA 1LB2A 3C7JA 3M4OJ 4N9IA 3KP6A 4RGRA 3K70C 4IRIA 5LGTA 2LD5A 2HVRA 3U1DA 2HQ5A 2DTZA 2E5NA 2D5VA 4PSXA 4XRSA 2JWTA 4OU0A 3HRMA 4KUMA 2LR8A 4PDKA 4CYCA 4JP0A 3U9GA 1WJ5A 2DO7A 1YW8A 1U0JA 1ERDA 4YELA 5KCMA 2FD5A 1S8NA 3BR1A 3ZCOA 3A0HC 1XCBA 2DA1A 4OWRB 3ZMSA 3E97A 3A01B 3COAC 2X51A 2R7SA 3N97A 3RKXA 2IVMA 1WZ2A 2CUFA 4AUXA 1W5TA 4A93J 4Q5SF 2R7QA 2X1CA 1ETQA 3TDZC 2W48A 1S9HA 5EF6A 4RB3C 3PIPF 3L2CA 3FXUA 2QSGX 4PGGA 2NVTJ 4DYQA 3KZZA 1R00A 4KJZA 1W1WE 4L0YB 4G7OF 2W4SA 3MKYB 4DYRA 2XGDA 3DLAA 1IO2A 2DFIA 1ZHFA 5IT3A 2CH0A 5F0HA 3PJRA 3T5XA 2VONA 5EZGA 2OV7A 3DTIA 3H9QA 2MLKA 3BG9A 1NK2P 1R9TJ 1B4AA 1RR7A 3LSGA 3BZ6A 3TKYA 4AD9A 4D1QA 3CCUI 4E7LA 1G3WA 1ZK8A 3MVPA 5CJ9A 1R7JA 2DTRA 2NNNA 3JAMK 3F72A 1ZREA 3LFUA 2M1BA 3K1MA 3UR3C 5E8IA 2VXZA 3RZOJ 1U5TC 2DT7B 5LHIA 3E6CC 2ZKZA 4W97A 3SYTA 2ZJQF 2WC2A 5F1RA 3BPVA 4Q4ZF 4V2FA 3CLQA 4L9TA 4ZDOA 3QPHA 2UV1A 3WU0A 2Y30A 3HGYA 3E3VA 3OOUA 1LPQA 2QEXI 3OV8A 4CH7A 4YIIA 4XSZF 4LB6B
chains in the Genus database with same CATH topology
1U78A 2JMWA 2XB5A 1DU0A 1XS9A 2AHQA 1BJZA 3PO2J 1UG2A 1T33A 4A3LJ 4A3BJ 4Y52J 1U9OA 3HDDA 3S17J 1Y1WJ 1VI0A 5C44J 5E3NA 3JRGA 3PM1A 2IBDA 3PO3J 3CQZJ 1WH7A 2CJJA 1XG1A 3GTLJ 5E3OA 4DZPA 2GBYA 3Q0WA 3VPRA 1FIAA 3HOXJ 3CMYA 2G0EA 4A3JJ 4BY1J 3S1RJ 5F27A 3DCFA 4D7MA 2JA8J 2FX0A 1ENHA 2XRLA 4I76A 3G1LA 2B63J 2QCOA 2NVYJ 1YRNA 2MSYA 1TWCJ 1JT6A 3S1NJ 3CCYA 3C2BA 4QSHA 5EZHA 1BL0A 4XRMA 4FE7A 2EQRA 1MNMC 2JN6A 2IAIA 3GTMJ 2E19A 2DMTA 5FKMA 2R7ZJ 4BY7J 1QVUA 1ITYA 2ECBA 3B6AA 3FKIJ 2M0CA 4DYCA 1ZTRA 1B8IA 5C4JJ 4MO7A 1IDZA 2DMUA 2LP0A 1MBKA 3BG5A 4X1EA 1O4XA 1ZQ3P 1TWFJ 4BKXA 3RZDJ 4MFDA 1UHSA 1XC5A 3BTLA 1HLVA 3ZQHA 2GM4A 1F36A 1DU6A 2E2IJ 1AKHA 4J19A 4AYBN 3FK6A 2DA2A 5EG0A 1JKQC 3FISA 1S7EA 1BW6A 3LSPA 3F0CA 2M9HA 1SANA 2DMQA 3ZOBA 2E2HJ 5M5XJ 3S14J 1FEXA 1FTZA 3K7AJ 3G1OA 3WHBA 3HOZJ 2EZIA 3BR6A 3HGGA 1P7IA 5DTDA 2JA5J 4QTRA 2LY9A 3TW6A 1F43A 4RDUA 5EDNA 4A3GJ 1HDDC 2GLOA 1MH4A 4W1UA 2O7OA 4XRSG 3HOUJ 3LNQA 2WV1A 1H8AC 1ETYA 1EF4A 1Q1VA 2VKEA 4BBRJ 2L7MP 1PUFB 4B3AA 3OSFA 1QPIA 3OIOA 2TRTA 1IV6A 2CUEA 3HOYJ 1JGGA 2JA6J 1JT0A 4V2GA 2JK3A 2ME6A 1WCMJ 2LFBA 3L1PA 4UUTA 5E3LA 1JJ6C 2XB0X 5J1UA 2HOSA 1TWGJ 3UKGA 2EZHA 1GDTA 3W6VA 4D5FA 2K9SA 4M3EA 1JKPC 2R93J 4BXXJ 1OFCX 3BTCA 4D5CA 2ZB9A 1A5JA 1FIPA 4M3FA 5E3MA 3H0GJ 5J1YA 4ABZA 2X9DA 5JLWA 1MBFA 1X2MA 1MBGA 2E1OA 2HOTA 1W0TA 1QRYA 2R5YA 2COBA 3JRFA 3Q0UA 1B72B 2XGCA 2Y2ZA 1E3OC 1B72A 1PUFA 2XPVA 2X48A 3A01A 3HBLA 3MN2A 1GV5A 5IYCJ 3QQAA 5C3EJ 1I3QJ 1WH5A 2NS8A 2X6OA 3JRCA 4RBOA 2DJNA 1ORKA 3JRIA 5M5WJ 1K61A 4JX5A 4DZJA 2XPUA 3IH4A 2LLKA 5GP9A 3HKZN 1X58A 3S1MJ 2NS7A 4M6VA 2VKVA 4UUSA 3GTPJ 2DA7A 5FKOA 1TC3C 3I4NJ 5F04A 5IP9J 2LTPA 1RKWA 3GTQJ 2CQQA 4FTHA 3GTJJ 1AKHB 5IOYA 1HF0A 1OJLA 4A69C 2NVXJ 2TCTA 2I10A 1MBJA 2OF7A 2HYJA 2OPTA 5FLVA 5IPAA 2FJ1A 5BNGA 1FJLA 4HNVA 1POGA 2L7FP 3LSJA 3E7LA 3JRHA 1HCRA 3GTKJ 5FKKA 2N8GA 4M3DA 4IHVA 3BTIA 1JUPA 2ME0A 3CDLA 1H88C 2R0QC 2R5ZA 1K83J 1RPWA 2JA7J 5DS9A 3Q3SA 5EEAA 4G12A 1LFBA 3BQYA 3QPSA 1ETWA 2XSDC 1IJWC 2KT0A 3MKLA 5FKNA 5K7FA 2K9NA 2Y31A 4MLOA 2XGEA 3ZQGA 2E2JJ 2O9LA 2R92J 3S15J 1GT0C 3HB9A 1ZR2A 3ZQCA 4C3IJ 1JKRC 1AU7A 1MBHA 2R5ZB 2NVQJ 3HM5A 3NARA 1I50J 2DA3A 1JTXA 1YRNB 3IH3A 5GPCA 5EYRA 1JTYA 2MW8A 4A3IJ 3BR0A 3SJMA 2CU7A 3BR5A 4JYKA 1IC8A 1AHDP 3ZQLA 4NDLA 4S0HB 1BW5A 1HOMA 5F0FA 1TWHJ 5M5YJ 2EH3A 2DA5A 2VI6A 2R5YB 2M34A 1OCTC 4A3FJ 3M3YJ 4A3CJ 2H1KA 4IHYA 1GUUA 3OSGA 2CRGA 1VNDA 1ETOA 1WPKA 5FKLA 1GV2A 3IV5A 2ID3A 5F1JA 1IDYA 1IG7A 2MGQA 1P7JA 2WAQN 3S2DJ 1Y1VJ 3K2AA 3TP0A 3TW7A 2NOGA 2EZKA 4D7NA 2JJ7A 3SDGA 2YU9J 4A3KJ 1ETXA 4FE4A 1RETA 3QPLA 3B6CA 1Z77A 3S1QJ 4A3EJ 3GTOJ 2HDDA 4MFEA 1W0UA 4XIDA 1IUFA 1JUSA 1ZR4A 4IEJA 4IHWA 2ID6A 2L0KA 9ANTA 1MBEA 4I6ZA 1ETVA 4IHXA 1UMQA 3LOCA 1RKTA 1BA5A 4L5EA 1QVTA 1X2NA 4AC0A 5IYDJ 3LSRA 3DEWA 1FTTA 2K9QA 2HXIA 4C2MJ 1D5YA 1IGNA 3HOVJ 5HODA 2LVSA 4FISA 4M3GA 3RQIA 1U9NA 2ELKA 1APLC 3BR2A 2MG4A 5IP7J 1MSFC 2LKXA 3GTGJ 1VF9A 4B4CA 2L9RA 5J3LA 5M3MJ 4X6AJ 3NAUA 5F08A 3TP3A 5F0CA 3Q0VA 2AO9A 5EGOB 3JRBA 3A03A 1G2HA 1ZKGA 1ETKA 3HOWJ 2PMZN 4QIWN 1LE8A 2H8RA 1T56A 2DMNA 5M3FJ 1LE8B 4BBSJ 2HXOA 3BT9A 1H89C 3SFIA 4B1RA 2Y9ZA 3BR3A 5IOZA 2HOAA 2ECCA 2WB1N 1TWAJ 2KDZA 1VFCA 1NTCA 3TEDA 1NK3P 3M4OJ 1OCPA 5IP6A 3GBGA 2LD5A 3G1MA 4C3JJ 3IH2A 2HQ5A 4MIMA 1LFUP 2DTZA 2D5VA 2IEKA 4XRSA 2EZLA 2JWTA 1JUMA 4XICA 3ZQFA 2LR8A 4M3BA 2HI3A 1B8IB 2P81A 4CYCA 4EEFG 4JP0A 3RKQA 4XK4A 1MH3A 3BG3A 4UUSB 2FD5A 2EBIA 3BR1A 2DA1A 3WHCA 3ZQIA 2XPWA 3A01B 3D1NI 3JRDA 4LOCA 2CUFA 5FLMJ 4AUXA 1WGXA 3O8GA 3JR9A 4A93J 3H3VK 1IRZA 4GFBA 1ETQA 2YS9A 5EF6A 2W48A 1CQTA 3BQZA 3S16J 2DA6A 1I6HJ 5K7HA 2NVTJ 4DYQA 5FJ8J 5IYBJ 4DYRA 2XGDA 2Y9YA 4A3DJ 4JX6A 3BTJA 1U8BA 3HEFA 5F0HA 1SFOJ 5EZGA 1A6IA 2QF7A 3FIWA 1JKOC 2VUMJ 4CYCB 2K40A 1ZGWA 2DA4A 2Y0SN 3BG9A 5EG0B 3LSGA 1RR7A 5EGOA 1R9TJ 1NK2P 2O8KA 1MSEC 3MVPA 1ZK8A 1WI3A 3O8HA 3I4MJ 1JJ8C 2YUSA 1GVDA 2DMPA 2M2EA 1HDPA 2RAEA 3RZOJ 4DW6A 3S2HJ 3FK7A 2FQ4A 2L7ZA 4W97A 5J1RA 4C3HJ 3JREA 2LK2A 4V2FA 2VPRA 2DN0A 4A3MJ 1Z0XA 3JRAA 4FCYA 2CQXA 1RESA 4Y7NJ 2M8GX 3A02A 5C4XJ 2Y30A 3HGYA 5JLXA 3OOUA 5K7ZA 4JX4A 5GPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U78 A;  2JMW A;  2XB5 A;  1DU0 A;  1XS9 A;  2AHQ A;  1BJZ A;  3PO2 J;  1UG2 A;  1T33 A;  4A3L J;  4A3B J;  4Y52 J;  1U9O A;  3HDD A;  3S17 J;  1Y1W J;  1VI0 A;  5C44 J;  5E3N A;  3JRG A;  3PM1 A;  2IBD A;  3PO3 J;  3CQZ J;  1WH7 A;  2CJJ A;  1XG1 A;  3GTL J;  5E3O A;  4DZP A;  2GBY A;  3Q0W A;  3VPR A;  1FIA A;  3HOX J;  3CMY A;  2G0E A;  4A3J J;  4BY1 J;  3S1R J;  5F27 A;  3DCF A;  4D7M A;  2JA8 J;  2FX0 A;  1ENH A;  2XRL A;  4I76 A;  3G1L A;  2B63 J;  2QCO A;  2NVY J;  1YRN A;  2MSY A;  1TWC J;  1JT6 A;  3S1N J;  3CCY A;  3C2B A;  4QSH A;  5EZH A;  1BL0 A;  4XRM A;  4FE7 A;  2EQR A;  1MNM C;  2JN6 A;  2IAI A;  3GTM J;  2E19 A;  2DMT A;  5FKM A;  2R7Z J;  4BY7 J;  1QVU A;  1ITY A;  2ECB A;  3B6A A;  3FKI J;  2M0C A;  4DYC A;  1ZTR A;  1B8I A;  5C4J J;  4MO7 A;  1IDZ A;  2DMU A;  2LP0 A;  1MBK A;  3BG5 A;  4X1E A;  1O4X A;  1ZQ3 P;  1TWF J;  4BKX A;  3RZD J;  4MFD A;  1UHS A;  1XC5 A;  3BTL A;  1HLV A;  3ZQH A;  2GM4 A;  1F36 A;  1DU6 A;  2E2I J;  1AKH A;  4J19 A;  4AYB N;  3FK6 A;  2DA2 A;  5EG0 A;  1JKQ C;  3FIS A;  1S7E A;  1BW6 A;  3LSP A;  3F0C A;  2M9H A;  1SAN A;  2DMQ A;  3ZOB A;  2E2H J;  5M5X J;  3S14 J;  1FEX A;  1FTZ A;  3K7A J;  3G1O A;  3WHB A;  3HOZ J;  2EZI A;  3BR6 A;  3HGG A;  1P7I A;  5DTD A;  2JA5 J;  4QTR A;  2LY9 A;  3TW6 A;  1F43 A;  4RDU A;  5EDN A;  4A3G J;  1HDD C;  2GLO A;  1MH4 A;  4W1U A;  2O7O A;  4XRS G;  3HOU J;  3LNQ A;  2WV1 A;  1H8A C;  1ETY A;  1EF4 A;  1Q1V A;  2VKE A;  4BBR J;  2L7M P;  1PUF B;  4B3A A;  3OSF A;  1QPI A;  3OIO A;  2TRT A;  1IV6 A;  2CUE A;  3HOY J;  1JGG A;  2JA6 J;  1JT0 A;  4V2G A;  2JK3 A;  2ME6 A;  1WCM J;  2LFB A;  3L1P A;  4UUT A;  5E3L A;  1JJ6 C;  2XB0 X;  5J1U A;  2HOS A;  1TWG J;  3UKG A;  2EZH A;  1GDT A;  3W6V A;  4D5F A;  2K9S A;  4M3E A;  1JKP C;  2R93 J;  4BXX J;  1OFC X;  3BTC A;  4D5C A;  2ZB9 A;  1A5J A;  1FIP A;  4M3F A;  5E3M A;  3H0G J;  5J1Y A;  4ABZ A;  2X9D A;  5JLW A;  1MBF A;  1X2M A;  1MBG A;  2E1O A;  2HOT A;  1W0T A;  1QRY A;  2R5Y A;  2COB A;  3JRF A;  3Q0U A;  1B72 B;  2XGC A;  2Y2Z A;  1E3O C;  1B72 A;  1PUF A;  2XPV A;  2X48 A;  3A01 A;  3HBL A;  3MN2 A;  1GV5 A;  5IYC J;  3QQA A;  5C3E J;  1I3Q J;  1WH5 A;  2NS8 A;  2X6O A;  3JRC A;  4RBO A;  2DJN A;  1ORK A;  3JRI A;  5M5W J;  1K61 A;  4JX5 A;  4DZJ A;  2XPU A;  3IH4 A;  2LLK A;  5GP9 A;  3HKZ N;  1X58 A;  3S1M J;  2NS7 A;  4M6V A;  2VKV A;  4UUS A;  3GTP J;  2DA7 A;  5FKO A;  1TC3 C;  3I4N J;  5F04 A;  5IP9 J;  2LTP A;  1RKW A;  3GTQ J;  2CQQ A;  4FTH A;  3GTJ J;  1AKH B;  5IOY A;  1HF0 A;  1OJL A;  4A69 C;  2NVX J;  2TCT A;  2I10 A;  1MBJ A;  2OF7 A;  2HYJ A;  2OPT A;  5FLV A;  5IPA A;  2FJ1 A;  5BNG A;  1FJL A;  4HNV A;  1POG A;  2L7F P;  3LSJ A;  3E7L A;  3JRH A;  1HCR A;  3GTK J;  5FKK A;  2N8G A;  4M3D A;  4IHV A;  3BTI A;  1JUP A;  2ME0 A;  3CDL A;  1H88 C;  2R0Q C;  2R5Z A;  1K83 J;  1RPW A;  2JA7 J;  5DS9 A;  3Q3S A;  5EEA A;  4G12 A;  1LFB A;  3BQY A;  3QPS A;  1ETW A;  2XSD C;  1IJW C;  2KT0 A;  3MKL A;  5FKN A;  5K7F A;  2K9N A;  2Y31 A;  4MLO A;  2XGE A;  3ZQG A;  2E2J J;  2O9L A;  2R92 J;  3S15 J;  1GT0 C;  3HB9 A;  1ZR2 A;  3ZQC A;  4C3I J;  1JKR C;  1AU7 A;  1MBH A;  2R5Z B;  2NVQ J;  3HM5 A;  3NAR A;  1I50 J;  2DA3 A;  1JTX A;  1YRN B;  3IH3 A;  5GPC A;  5EYR A;  1JTY A;  2MW8 A;  4A3I J;  3BR0 A;  3SJM A;  2CU7 A;  3BR5 A;  4JYK A;  1IC8 A;  1AHD P;  3ZQL A;  4NDL A;  4S0H B;  1BW5 A;  1HOM A;  5F0F A;  1TWH J;  5M5Y J;  2EH3 A;  2DA5 A;  2VI6 A;  2R5Y B;  2M34 A;  1OCT C;  4A3F J;  3M3Y J;  4A3C J;  2H1K A;  4IHY A;  1GUU A;  3OSG A;  2CRG A;  1VND A;  1ETO A;  1WPK A;  5FKL A;  1GV2 A;  3IV5 A;  2ID3 A;  5F1J A;  1IDY A;  1IG7 A;  2MGQ A;  1P7J A;  2WAQ N;  3S2D J;  1Y1V J;  3K2A A;  3TP0 A;  3TW7 A;  2NOG A;  2EZK A;  4D7N A;  2JJ7 A;  3SDG A;  2YU9 J;  4A3K J;  1ETX A;  4FE4 A;  1RET A;  3QPL A;  3B6C A;  1Z77 A;  3S1Q J;  4A3E J;  3GTO J;  2HDD A;  4MFE A;  1W0U A;  4XID A;  1IUF A;  1JUS A;  1ZR4 A;  4IEJ A;  4IHW A;  2ID6 A;  2L0K A;  9ANT A;  1MBE A;  4I6Z A;  1ETV A;  4IHX A;  1UMQ A;  3LOC A;  1RKT A;  1BA5 A;  4L5E A;  1QVT A;  1X2N A;  4AC0 A;  5IYD J;  3LSR A;  3DEW A;  1FTT A;  2K9Q A;  2HXI A;  4C2M J;  1D5Y A;  1IGN A;  3HOV J;  5HOD A;  2LVS A;  4FIS A;  4M3G A;  3RQI A;  1U9N A;  2ELK A;  1APL C;  3BR2 A;  2MG4 A;  5IP7 J;  1MSF C;  2LKX A;  3GTG J;  1VF9 A;  4B4C A;  2L9R A;  5J3L A;  5M3M J;  4X6A J;  3NAU A;  5F08 A;  3TP3 A;  5F0C A;  3Q0V A;  2AO9 A;  5EGO B;  3JRB A;  3A03 A;  1G2H A;  1ZKG A;  1ETK A;  3HOW J;  2PMZ N;  4QIW N;  1LE8 A;  2H8R A;  1T56 A;  2DMN A;  5M3F J;  1LE8 B;  4BBS J;  2HXO A;  3BT9 A;  1H89 C;  3SFI A;  4B1R A;  2Y9Z A;  3BR3 A;  5IOZ A;  2HOA A;  2ECC A;  2WB1 N;  1TWA J;  2KDZ A;  1VFC A;  1NTC A;  3TED A;  1NK3 P;  3M4O J;  1OCP A;  5IP6 A;  3GBG A;  2LD5 A;  3G1M A;  4C3J J;  3IH2 A;  2HQ5 A;  4MIM A;  1LFU P;  2DTZ A;  2D5V A;  2IEK A;  4XRS A;  2EZL A;  2JWT A;  1JUM A;  4XIC A;  3ZQF A;  2LR8 A;  4M3B A;  2HI3 A;  1B8I B;  2P81 A;  4CYC A;  4EEF G;  4JP0 A;  3RKQ A;  4XK4 A;  1MH3 A;  3BG3 A;  4UUS B;  2FD5 A;  2EBI A;  3BR1 A;  2DA1 A;  3WHC A;  3ZQI A;  2XPW A;  3A01 B;  3D1N I;  3JRD A;  4LOC A;  2CUF A;  5FLM J;  4AUX A;  1WGX A;  3O8G A;  3JR9 A;  4A93 J;  3H3V K;  1IRZ A;  4GFB A;  1ETQ A;  2YS9 A;  5EF6 A;  2W48 A;  1CQT A;  3BQZ A;  3S16 J;  2DA6 A;  1I6H J;  5K7H A;  2NVT J;  4DYQ A;  5FJ8 J;  5IYB J;  4DYR A;  2XGD A;  2Y9Y A;  4A3D J;  4JX6 A;  3BTJ A;  1U8B A;  3HEF A;  5F0H A;  1SFO J;  5EZG A;  1A6I A;  2QF7 A;  3FIW A;  1JKO C;  2VUM J;  4CYC B;  2K40 A;  1ZGW A;  2DA4 A;  2Y0S N;  3BG9 A;  5EG0 B;  3LSG A;  1RR7 A;  5EGO A;  1R9T J;  1NK2 P;  2O8K A;  1MSE C;  3MVP A;  1ZK8 A;  1WI3 A;  3O8H A;  3I4M J;  1JJ8 C;  2YUS A;  1GVD A;  2DMP A;  2M2E A;  1HDP A;  2RAE A;  3RZO J;  4DW6 A;  3S2H J;  3FK7 A;  2FQ4 A;  2L7Z A;  4W97 A;  5J1R A;  4C3H J;  3JRE A;  2LK2 A;  4V2F A;  2VPR A;  2DN0 A;  4A3M J;  1Z0X A;  3JRA A;  4FCY A;  2CQX A;  1RES A;  4Y7N J;  2M8G X;  3A02 A;  5C4X J;  2Y30 A;  3HGY A;  5JLX A;  3OOU A;  5K7Z A;  4JX4 A;  5GPA A; 
#chains in the Genus database with same CATH topology
 1P9Q C;  2XB5 A;  4HOB A;  2KIM A;  2DOA A;  4IQ4 A;  5D5X B;  1D3Y A;  1R36 A;  4BNC A;  5DV5 A;  3DKW A;  3MCZ A;  3G71 I;  3WTZ A;  3M8E A;  3DV8 A;  1RNL A;  1U9O A;  2VOP A;  3OWT A;  2HKO A;  2LMD A;  3S17 J;  5C44 J;  5E3N A;  3CMA I;  3W6K B;  1QNT A;  2Z33 A;  2IBD A;  1REP C;  3BG7 A;  1MMG A;  5CVU A;  1XG1 A;  1MMD A;  3OR2 C;  2L2O A;  2HTJ A;  3TDU C;  2RNG A;  3CJT B;  4KNY A;  4BY1 J;  1VQ6 I;  4L5I A;  1FIA A;  3VPR A;  2P7C B;  2G0E A;  3KYC B;  1BOA A;  3S1R J;  1D0Z A;  1DQU A;  2LC2 A;  1U8R A;  3OYB A;  2FXA A;  3AAF A;  2NVY J;  2EIJ H;  1DPR A;  2ELH A;  2ICW G;  2VXD A;  2DQL A;  4E7K A;  3MZ8 A;  3V7R A;  2F5V A;  5EEH A;  2OZU A;  4I0A A;  4CA0 A;  3HOS A;  2P4W A;  5B66 C;  2XVC A;  5EZH A;  2WV0 A;  3NWS A;  2STW A;  2EQR A;  2VBY A;  1I27 A;  1QBJ A;  1X1B A;  4CCN A;  1EV7 A;  3CP8 A;  2O61 A;  4CGZ A;  2FBI A;  4C30 A;  3Q5F A;  2GXB A;  2LOO A;  4BY7 J;  1QVU A;  3AG2 H;  1A6Q A;  2M0C A;  4RB2 C;  2DFH A;  3H3Z A;  5E1W A;  1JI8 A;  2R7O A;  1RC9 A;  4I01 A;  5L3B A;  2W82 A;  3IRQ A;  2HVS A;  3QRF F;  2R7W A;  2IP2 A;  1R4M B;  4ESF A;  1BR2 A;  4EJW A;  2DK8 A;  1MBK A;  3BG5 A;  3ECO A;  1XMK A;  3RZD J;  1YLF A;  2M5W A;  2O5R A;  4RLF A;  4CYD A;  5LRS A;  3OYH A;  2E1C A;  2QEN A;  1OCR H;  2LNB A;  2HYG D;  5DM6 F;  4IXA A;  2GM4 A;  3H5N A;  3G4S I;  3H9G A;  3M9A A;  1AKH A;  3QP6 A;  1L3L A;  2F48 A;  3ZGK A;  4AYB N;  5ICC A;  4GYI A;  1ZRD A;  2ZC2 A;  2FE3 A;  3K4L A;  3FIS A;  4KIF A;  3LA3 A;  2M9H A;  2LSO A;  1SAN A;  2DMQ A;  2BVM A;  2EV0 A;  5E18 F;  3S14 J;  1ZYR F;  4ZTJ A;  2ZBK A;  4UUV A;  2OD5 A;  3WHB A;  4EJU A;  2EZI A;  3CCM I;  5D8K B;  2ZME B;  2L02 A;  1I5Z A;  1SC7 A;  3JSO A;  1QZZ A;  3OL4 A;  2XKP A;  3LQQ A;  4LD5 A;  2GLO A;  3K9T A;  3O2P E;  1FBU A;  4W1U A;  2KIQ A;  4XRS G;  2WV1 A;  1H8A C;  2A68 F;  3ZQ7 A;  2MBF A;  3F9K A;  1Q1V A;  4XQF A;  1MNE A;  3F21 A;  2EA4 A;  2QZ8 A;  2BE5 F;  5F64 A;  3TQN A;  5D8L B;  1YIJ I;  4LLN A;  3OS2 A;  2TRT A;  2V1N A;  2CUE A;  3HOY J;  3BLY A;  5HVQ C;  3CCL I;  3PFY A;  5D5U B;  1JT0 A;  3S32 A;  3U21 A;  3OYN A;  3HHG A;  3EUA A;  1JJ6 C;  1FX7 A;  1XGN A;  2XF5 A;  4MTD A;  3ULQ B;  1ZG5 A;  1TWG J;  5J4Y A;  1G3Y A;  3W6V A;  2JA2 A;  4DJA A;  4DOZ A;  2IS4 A;  1EH8 A;  5HS9 A;  1SMY F;  1BM9 A;  3H0G J;  3I0T A;  2W00 A;  4GXO A;  2X9D A;  3ZQQ A;  2ZFW A;  1W36 D;  1KQ9 A;  1MBF A;  1X1A A;  1X2M A;  2BY0 A;  2E1O A;  4LFU A;  2VPL A;  2ZME C;  2BHZ A;  2E60 A;  2XAS A;  1B72 B;  2YU3 A;  2CQK A;  2Y2Z A;  3GWZ A;  1IN6 A;  1OMI A;  3FXL A;  4GRI A;  1ZG1 A;  5C3E J;  1BN5 A;  1XDU A;  2NS8 A;  3LA7 A;  1R1U A;  3DXJ F;  3SZG A;  3QAH A;  4JBA A;  2H09 A;  4NC6 A;  2IGO A;  4MEY F;  5FFZ A;  4XBF A;  4AYB A;  3WGI A;  4JX5 A;  3GFJ A;  3H5R A;  4RB0 A;  1Y0U A;  1Y6I A;  2QLZ A;  3IH4 A;  2LLK A;  4A2U A;  1ZN2 A;  4N4O B;  4BE0 A;  3ONQ A;  4BAY A;  4R79 A;  3ZPL A;  4B43 A;  3FF5 A;  4M6V A;  3VYS B;  4UUS A;  3GTP J;  2DA7 A;  4LLL A;  5J47 A;  3OS0 A;  2E7W A;  1D0Y A;  2ZSI B;  3OYE A;  3DWL E;  3GTJ J;  4XLA A;  1OYY A;  2VBZ A;  2KFD A;  1O7F A;  2LF7 A;  1VQ5 I;  2OU2 A;  4A69 C;  3WTU C;  2OCC H;  2R7D A;  4E7S A;  3N4M A;  1IN5 A;  1FMW A;  1MBJ A;  2HYJ A;  4I09 A;  1R71 A;  1WRJ A;  4IQJ A;  3IKV A;  1T0F A;  2FJ1 A;  3H92 A;  2WWY A;  4ENK A;  1LDK B;  3U2R A;  3ZMZ A;  2R7U A;  4M72 A;  3E7L A;  2Z16 A;  2OQG A;  2N8G A;  3WTV C;  3BTI A;  1JUP A;  2ME0 A;  1HST A;  3B73 A;  2KRH A;  5A2Q K;  1KYZ A;  5DS9 A;  3MKW B;  3TO6 A;  2A69 F;  2IGN A;  4G12 A;  1LFB A;  3L2V A;  1FWZ A;  3BWG A;  3O3K A;  3MQ0 A;  5EEG A;  3PNT A;  5FKN A;  2KP6 A;  3S3M A;  1QGP A;  2K9N A;  2J5P A;  2Y31 A;  2XGE A;  4BH9 A;  3N05 A;  3S15 J;  4DBQ A;  4C3I J;  2PMU A;  3HM5 A;  3MEX A;  4XR6 A;  1I50 J;  2AS5 F;  1FMV A;  1KA8 A;  5GPC A;  4YRV A;  2IW5 A;  1D1B A;  3OR1 C;  2IS6 A;  3R4K A;  4A3I J;  2OCE A;  1WJC A;  3GW2 A;  4MTE A;  1C0W A;  3NQO A;  4S0H B;  1J75 A;  1G59 A;  2MD0 A;  1LJ9 A;  1RR8 C;  4ZC3 A;  1YX5 A;  4EM0 B;  4BE2 A;  1YW7 A;  5DCF A;  3M3Y J;  1KU3 A;  4A3C J;  3F6V A;  3GO5 A;  4HDU A;  3K4M A;  2ZSH B;  2E1N A;  1I6X A;  2VKD A;  4P9F A;  2X6Y A;  2XKO A;  3RKW A;  2FNP A;  1IG7 A;  2MGQ A;  3P5J A;  1O3R A;  4L9J A;  1Z7U A;  4BJT A;  2ZXI A;  2NOG A;  2M7A A;  1FP1 D;  3K4N A;  2GIZ A;  1J5Y A;  2CW7 A;  1A31 A;  3SDG A;  3J7Y J;  5K5Q A;  3F8F A;  2XV4 S;  1A35 A;  1USS A;  1I1G A;  2L54 A;  2O0Y A;  3B6C A;  3OYC A;  3BJA A;  3VSK A;  2UUZ A;  1UST A;  4D0P A;  3GTO J;  1W0U A;  3E0J B;  2L0K A;  9ANT A;  1MBE A;  3I55 I;  1S72 I;  4XOT A;  4KA4 A;  4BUP A;  4E7Z A;  2AQF A;  2VJJ A;  4IPA A;  2IS1 A;  2ETH A;  4U88 A;  4XMY A;  5IYD J;  4RLQ A;  2JT1 A;  3HRT A;  3DKY A;  1EH6 A;  4YIF A;  2IA1 A;  1IGN A;  2LVS A;  4CCL A;  1J2X A;  2BZT A;  2K3F A;  4GCV A;  5A2Q Z;  3GVA A;  2IA2 A;  3MZH A;  1SAX A;  2G9W A;  2VIX A;  2PJR A;  2GXA A;  4X6A J;  5M3M J;  5J3L A;  3OYI A;  2ZJ2 A;  2FNA A;  2IGM A;  2AO9 A;  2VOO A;  2GZW A;  2XAG A;  3JRB A;  1IN4 A;  1XB4 A;  3PUB A;  3W2V A;  3A03 A;  4B44 A;  1KGS A;  1PDN C;  5E1Z B;  3HOW J;  5KNL A;  2KZG A;  2H8R A;  2V9P A;  2MC3 A;  3PNY A;  2J5O A;  2HXO A;  1H89 C;  2K86 A;  3I59 A;  1CF7 A;  3CZ6 A;  3KP5 A;  1N78 A;  2XAF A;  4ZYA A;  2X4H A;  5DEQ A;  5IOZ A;  1BIA A;  2HU9 A;  1OCC H;  3MFK A;  3M8F A;  1P6R A;  2KRF A;  1XX5 A;  3ABT A;  2QA4 I;  1N77 A;  3CES A;  3GFM A;  1X3W B;  3I9V 2;  2M45 A;  3G1M A;  3ERM A;  4IJA A;  4PJN A;  1PJR A;  4C3J J;  3K4J A;  1YYV A;  3RYR A;  2IRF G;  2UXX A;  3ABL H;  4UV8 A;  3DU6 A;  3E5X A;  2GQQ A;  1YG2 A;  4NQW A;  4OIP F;  2P81 A;  4I98 B;  3H0D A;  4KN7 X;  4A0Y A;  2EIN H;  3RKQ A;  4ENJ A;  1U5T B;  1MH3 A;  3BG3 A;  2A07 F;  1HW5 A;  3P7N A;  5DDG A;  3KFW X;  1AA7 A;  2XPW A;  2W24 A;  1RUN A;  3D1N I;  3RI4 A;  4S04 A;  2FOW A;  2ZME A;  1T8I A;  1ULY A;  1HA8 A;  4EQQ A;  1SVL A;  3NWT A;  1BIB A;  2MH9 A;  1MMS A;  2IJL A;  3O8G A;  3DF8 A;  3QWL A;  3H3V K;  2A5Y B;  1IRZ A;  5FRM A;  4HX7 A;  3W2W A;  4BDZ A;  4GFB A;  4G9Y A;  3M1C A;  3OOP A;  3IKT A;  1CQT A;  4ZDP A;  1QPM A;  5D4S A;  1YQA A;  3S16 J;  2DA6 A;  3V4G A;  1I6H J;  5K7H A;  2VBW A;  2E1M C;  3CUO A;  2V9V A;  3HZJ A;  4ESB A;  2BVL A;  2YSR A;  4A3D J;  2LYC A;  3S8P A;  3ESW B;  3T1B A;  1FYL A;  3HEF A;  2GAU A;  1EJ9 A;  3FXK A;  3FIW A;  2BHY A;  2HQN A;  1W4M A;  5AON A;  3LAP A;  1FC3 A;  3M1E A;  2BOL A;  5KHD A;  1BC8 C;  1WWX A;  2X1E A;  4UB6 C;  1WI3 A;  4WK8 F;  4H4K C;  2WA0 A;  4LJZ F;  4E7J A;  4MQV A;  1B1B A;  2XF7 A;  4PUS A;  2FRH A;  4IOC F;  2RAE A;  4DW6 A;  4ZDL A;  4U7D A;  2JUG A;  3FK7 A;  1F9N A;  2L7Z A;  1MJA A;  4C3H J;  5J1R A;  2VAS A;  1SFK A;  2H94 A;  5ICG A;  1Z0X A;  4U0V A;  4YEJ A;  2LY1 A;  2M8G X;  2BY3 A;  1M1E B;  4C9Y A;  4JX4 A;  5BQT A;  1OR7 A;  2VB6 A;  3O6B B;  1UB9 A;  5GPA A;  3FMS A;  4KN4 X;  1TBX A;  1WJF A;  1U78 A;  1PP8 F;  3L00 A;  2DI3 A;  1ZG3 A;  1TQI A;  2DPD A;  2BBY A;  1R23 A;  3CC4 I;  1B9N A;  1FOW A;  1BJZ A;  1U6G A;  4HSR A;  1T33 A;  2P0W A;  1DGR M;  4II2 A;  4Y52 J;  1S6L A;  3I64 A;  1WHU A;  3JRG A;  1WVR A;  2FQ3 A;  4N0B A;  2JVH A;  4FX0 A;  4B8X A;  4E7I A;  4V19 K;  1MDM B;  2CJJ A;  1SFE A;  2Z1D A;  2F4I A;  2BW3 B;  2DPU A;  2LKS A;  3GTL J;  2EA2 A;  1U5T A;  2ZXJ A;  5F27 A;  3DCF A;  2FX0 A;  1ENH A;  2XRL A;  1LEB A;  4I76 A;  2QCO A;  4M74 A;  3HJE A;  4LGW A;  4XLF A;  5GAG J;  2F5F A;  5GAH J;  1JT6 A;  1HC8 A;  2QQ9 A;  3WGG A;  1MDM A;  2ELJ A;  3CCV I;  1GXQ A;  1AOY A;  1YS7 A;  5FRN A;  3RKY A;  1MNM C;  4AM3 A;  1DDN A;  2MC4 A;  2VQG A;  4WCG A;  2IAI A;  2FU4 A;  4E70 A;  2E19 A;  2DMT A;  2XGX A;  6PAX A;  1Y39 A;  1TNT A;  1GXP A;  2BYV E;  3KZI C;  3B6A A;  2MH2 A;  4MHG A;  5J6X A;  3CDI A;  1TLH B;  3EUH C;  1D5V A;  3JAM Z;  2QUF A;  2XRO A;  4LG0 B;  4FQG A;  5HS7 A;  4FT8 A;  1IDZ A;  2DMU A;  4PJL A;  1ON1 A;  4X1E A;  4XLC A;  1SD4 A;  1O4X A;  3K1P A;  4GGG A;  1VQ7 I;  2H6C A;  4L9V A;  1UHS A;  4KIG A;  3BTL A;  4XSX F;  1HLV A;  2O03 A;  3TGN A;  2DCE A;  2KJC A;  1LVK A;  2BEO A;  2F6C A;  2F5E A;  4FET A;  2DA2 A;  4I0B A;  1BW6 A;  3LSP A;  3F0C A;  4RGS A;  4AIJ A;  2HNH A;  5M5X J;  1K7A A;  1FTZ A;  1ZEL A;  3HSE A;  3I54 A;  3K7A J;  3G1O A;  3BR6 A;  3HGG A;  5DTD A;  1XTA A;  3QU6 A;  2JA5 J;  1F43 A;  4UNO A;  4IHT A;  4HV5 A;  2QBY A;  3WTX C;  4RDU A;  2I5U A;  5EDN A;  5H6R A;  2JPB A;  4I02 A;  1Z7L A;  3VOD A;  1TNS A;  2EPF A;  2O7O A;  3PSI A;  3LNQ A;  3KYL A;  1DP7 P;  4XM3 A;  2WTE A;  4B09 A;  4CHU A;  3HYI A;  4BBR J;  1PUF B;  2DT5 A;  1L0O C;  4XLE A;  2W85 A;  1QPI A;  2UWM A;  2VQL A;  1IV6 A;  2XRN A;  3VDX A;  1YHQ I;  3ABK H;  4V2G A;  3K4B A;  5DD8 A;  2JK3 A;  3J81 Z;  1WCM J;  2ISY A;  5E3L A;  3S3N A;  4OOI A;  5FFX A;  2H27 A;  4C2U A;  2BXY A;  2CV0 A;  2EZH A;  4LIU A;  1GDT A;  4D5F A;  2K9S A;  3A1Y A;  1Y8R B;  2R93 J;  3BTC A;  4AWX B;  2M30 A;  3DPL C;  5HDG A;  1FIP A;  3C3W A;  3CC7 I;  3H36 A;  1ONV A;  5JLW A;  1ZRC A;  1P92 A;  5LLQ A;  2EV6 A;  2HPM A;  2FA5 A;  4BQA A;  2R5Y A;  3HHH A;  1IN7 A;  4OIQ F;  2OTJ I;  5JI6 A;  1B72 A;  3MN2 A;  5IYC J;  5DUI A;  3IUO A;  3GF2 A;  1MIJ A;  3JRC A;  5D6E A;  4G94 A;  5M5W J;  2DJN A;  3GZ5 A;  2E7X A;  2KPM A;  4LIV A;  4DZJ A;  1XN7 A;  4LB5 A;  2VQH A;  3OMY A;  3HKZ N;  3H3U A;  3W3C A;  4G6T B;  2HZD A;  5FKO A;  1TC3 C;  4R8H A;  2W7N A;  5F04 A;  5IP9 J;  1K78 A;  2L4M A;  2FEZ A;  1WJA A;  3DBL B;  4EVI A;  5LHH A;  4OIO F;  1AKH B;  2NXN B;  1GLN A;  5IOY A;  5J4V A;  4BDY A;  1DGW Y;  1ON2 A;  3BCB A;  4XLH A;  2NVX J;  5CVJ A;  2TCT A;  3HUG B;  3IWF A;  2XUB A;  1EA3 A;  5LHG A;  5IPA A;  3CO6 C;  4XOP A;  3HOT A;  2RGV A;  5BNG A;  4OAY A;  3DPT A;  5CYV A;  4HNV A;  3F23 A;  4MNU A;  1HKQ A;  1K78 B;  3WU2 C;  4K2E A;  4AU7 A;  3JRH A;  4YFX F;  5FKK A;  1VQ9 I;  3V8J A;  3HPG A;  4M3D A;  2Z99 A;  3ZMD A;  5CQG A;  2DOD A;  2R5Z A;  1RPW A;  2FOK A;  1U2W A;  1O3Q A;  3EUH A;  1Z91 A;  3I56 I;  2XSD C;  1IJW C;  3FXR A;  3I3L A;  1O3S A;  3OYA A;  3MKL A;  2QQ8 A;  4PJM A;  4UVA A;  2O9L A;  3VWB A;  1GT0 C;  3HB9 A;  4HBL A;  1ZR2 A;  1JKR C;  2R5Z B;  4OMY A;  2NVQ J;  4PK4 A;  3QPT A;  1V4R A;  3NAR A;  1YRN B;  4CIC A;  3P9K A;  2A61 A;  1T38 A;  4A12 A;  1A36 A;  4EJO A;  1JTY A;  1TW3 A;  1D8J A;  4NDL A;  2Q8K A;  4PJJ A;  2IA0 A;  4LMY A;  4L18 B;  2VI6 A;  3W6J B;  2H6B A;  2M34 A;  3BDD A;  1OCT C;  4QPO A;  1ZAO A;  2JQ7 A;  1X4O A;  2DDA A;  2CRG A;  3ASN H;  1VND A;  3R6S A;  2CGP A;  5FO5 A;  1Y56 A;  2IPQ X;  3R61 A;  5AIP A;  2ZNY A;  1XSV A;  1P4A A;  1QZE A;  3ABM H;  1QA6 A;  5CVV A;  1MND A;  3KET A;  2XAH A;  4E6K G;  3TL4 X;  5K5R A;  1Y1V J;  2JZY A;  3A4C A;  2B9S A;  3CD6 I;  4P5O A;  3TW7 A;  2NOJ B;  2HR3 A;  4D7N A;  2DLL A;  3D5S C;  2YU9 J;  5IY5 H;  4HEA 2;  2WAE A;  1RRJ A;  1RET A;  2P8T A;  1FBQ A;  1S7A A;  3RPU D;  4BHC A;  4ESJ A;  1X4P A;  2RKH A;  2UZK A;  3G2B A;  5LBQ A;  1K4T A;  2V1D A;  4XID A;  1JUS A;  3PNV A;  1YIT I;  4IHW A;  3D0S A;  4I6Z A;  3KP7 A;  3K69 A;  1J59 A;  2M3A A;  4EGZ A;  4DQ2 A;  3OYG A;  3E5Q A;  1B9M A;  2HS5 A;  4IHX A;  1UMQ A;  2OTL I;  3I58 A;  2NS0 A;  1O7L A;  3T8R A;  3FZV A;  3LST A;  2E34 A;  1QVT A;  4L5E A;  2CWE A;  4AC0 A;  4KDP A;  1PYV A;  2K9Q A;  2P5V A;  5FGM A;  1FZP B;  4HNU A;  1G3S A;  2K85 A;  3DBH B;  2L9N A;  1TT5 B;  4HF0 A;  3HOV J;  5D6F A;  2DAO A;  1V54 H;  3J80 Z;  1DP3 A;  4XKV A;  2CQ7 A;  2F4O B;  3RQI A;  5BPD A;  1O3T A;  1IN8 A;  1KQ0 A;  2A05 A;  4M73 A;  1YJN I;  2ELK A;  3BR2 A;  4M9X A;  2W84 A;  5IP7 J;  1W7P A;  4JOM A;  1R5I D;  2CUZ A;  4A6E A;  3ZP5 A;  3OYF A;  2L9R A;  1VTN C;  2L01 A;  2CMP A;  5F08 A;  1HW1 A;  4HQM A;  3TP3 A;  5F0C A;  3FX3 A;  2I8D A;  2MLG A;  4M71 A;  3RQ4 A;  3RJP A;  4XOR A;  3GFL A;  2MAB A;  1ZKG A;  2PMZ N;  4QIW N;  1LE8 A;  3HIF A;  1T56 A;  5M3F J;  5E17 F;  3OS1 A;  4BBS J;  3ZN0 A;  4XN3 A;  5L3G A;  2Y9Z A;  4II3 A;  3BR3 A;  2HOA A;  3FM5 A;  2NAZ A;  4NNJ A;  1F4K A;  4P9U A;  1TWA J;  3UNG C;  1NTC A;  2QKL B;  4QPQ A;  2E36 A;  4BXF A;  3CUQ C;  1RUO A;  4CCO A;  5GTH C;  4KFC A;  3HPH A;  1LUJ B;  1WSU A;  4U0W A;  4P55 A;  1XSD A;  3LWF A;  1UZC A;  2IEK A;  2KMU A;  2EZL A;  1F1Z A;  1BI1 A;  4XIC A;  3ZQF A;  1TTY A;  1B8I B;  2HI3 A;  4ITV A;  1WQ2 A;  4BQO A;  4LG0 A;  1WJD A;  3J7A O;  3CC2 I;  1E0E A;  4JQF A;  2MFZ A;  5HLT A;  4UUS B;  1SD7 A;  3F8M A;  3RPQ A;  4LLG F;  1AWC A;  2HEO A;  3ZQI A;  1W36 C;  1Z67 A;  2Z9O A;  3KP4 A;  1K6Y A;  4N9H A;  4DNC A;  3JRD A;  1D1C A;  4LOC A;  3SHF A;  3JR9 A;  2VE8 A;  3V7S A;  3ROU A;  1KZH A;  4EM1 A;  3BQZ A;  5F6F A;  3OY9 A;  5TIS C;  1R49 A;  3WTW C;  3FXJ A;  5FJ8 J;  5IYB J;  2EJR A;  3NEU A;  1EKE A;  1P4W A;  4BS9 A;  4JX6 A;  4IL6 C;  1U8B A;  1SFO J;  2DFE A;  5FLX Z;  5L3D A;  1JKO C;  4LG3 A;  1T0F C;  3EYY A;  4HLY A;  2OQR A;  3L2U A;  2VBX A;  1TZL A;  2DA4 A;  5L3F A;  2K3P A;  2GA2 A;  5EG0 B;  5EGO A;  1MD0 A;  2KJB A;  2O8K A;  3IAM 2;  1V5G A;  3O8H A;  1FYK A;  3I4M J;  1WJB A;  1V55 H;  1R22 A;  4IO9 F;  3S3O A;  2YUS A;  3SZP A;  2X0L A;  2DMP A;  2M2E A;  2V6C A;  2JSC A;  2YR2 A;  4U87 A;  1FOK A;  4CCJ A;  2PBI A;  5J8F A;  1FPQ A;  3KLO A;  3EPZ A;  5HLG A;  3WTT C;  2NNY A;  1VQK I;  4HF2 A;  2Y69 H;  4G7Z F;  2A6T A;  4IVN A;  1IXR C;  3JRA A;  4G7H F;  1RES A;  5HLH A;  3A02 A;  2R7T A;  5C4X J;  3FXO A;  1MGT A;  4KIC A;  2EIL H;  4WXC A;  3TOB A;  2WBM A;  2CSO A;  1ZLK A;  3M07 A;  4ZZL A;  2JMW A;  3LSM A;  5B1B H;  1DU0 A;  4EMS A;  2P7V B;  1U3E M;  2DBB A;  2XC7 A;  1FBS A;  3FMR A;  3PO2 J;  1SAU A;  5K5O A;  1MMA A;  5ERI A;  2L9S A;  2OZ6 A;  3L2R A;  1IRX A;  4A3L J;  2DU9 A;  4EGY A;  2LY2 A;  3HDD A;  1XGS A;  2LDU A;  5JVG F;  4HX4 A;  1Y1W J;  3A0B C;  3CF5 F;  3IAS 2;  4Y4R A;  1Z6T A;  3PM1 A;  1IV8 A;  3CQZ J;  1WH7 A;  2CFO A;  5CVR A;  3TO9 A;  2M8E A;  3WE3 A;  2K9M A;  4BAC A;  3CMM A;  2QYO A;  3OYD A;  5E3O A;  2B7E A;  3Q0W A;  5JFR A;  2GA1 A;  1IRF A;  3A2K A;  1D1A A;  1HKT A;  1UEL B;  1ZGJ A;  2IXS A;  2XIG A;  4D7M A;  1IXS B;  2JA8 J;  3GME A;  2GXG A;  3G1L A;  5JVT A;  2H1L A;  4BXU A;  5ICE A;  2PMH A;  3DEE A;  1TWC J;  2PQ8 A;  1HKS A;  3S1N J;  1MKM A;  1BOB A;  3WGH A;  3L2Q A;  1IXC A;  3CCY A;  2BGC A;  2GWR A;  1D8K A;  3C2B A;  4QSH A;  1PUE E;  4FE7 A;  3MMY B;  3HUG A;  1JE8 A;  2VL8 A;  3CP2 A;  2JN6 A;  3CCJ I;  5D4R A;  2EFW A;  4HG2 A;  3TMO A;  2CYY A;  2L9V A;  3WTY C;  3W2A A;  2R7R A;  4AIH A;  2FBK A;  4BJ5 C;  3FKI J;  2DJI A;  3QU3 A;  5L3C A;  2VQC A;  5LFA A;  3PUF A;  1LVA A;  3ASO H;  4DYC A;  1ZTR A;  5GTI C;  1XGO A;  1YW9 A;  1B8I A;  5E20 A;  3GYH X;  3K6G A;  3HTS B;  4ZTF A;  3BY6 A;  2D45 A;  3VSL A;  2WY7 Q;  2A5W A;  2LP0 A;  1P2F A;  2EWN A;  5J40 A;  1TWF J;  4BKX A;  1IF1 A;  1IW7 F;  1P4X A;  1XC5 A;  2V4J C;  4AID A;  5BS6 A;  2XAJ A;  3ZQH A;  5DYM A;  1F36 A;  1DU6 A;  4XKB A;  2E2I J;  3FDY A;  4J19 A;  1OLT A;  3FM3 A;  1UJ8 A;  2XDV A;  3RYP A;  1V5F A;  3FK6 A;  4FHT A;  2OC6 A;  3HRU A;  2RN7 A;  1PP7 U;  2CQN A;  4AVZ A;  3EDP A;  2E2H J;  4L9N A;  2NRA C;  3TBI A;  3U1K A;  2DW4 A;  1BC7 C;  1OIS A;  3BJO A;  2R3S A;  3HKZ A;  4QLC U;  3MWM A;  4QTR A;  2LY9 A;  3TW6 A;  1X1D A;  2QM3 A;  2XAU A;  2DYR H;  5TGT A;  1HDD C;  3KEO A;  4NBQ A;  1LDJ A;  3D5R C;  3I53 A;  3ISP A;  3LSH A;  1E17 A;  2Q2E B;  5CQE A;  4NC8 A;  3LMM A;  1CGP A;  1ETY A;  1EF4 A;  1NH3 A;  1OQY A;  3FMQ A;  2JTV A;  1LDD A;  1ZAR A;  2E5Z A;  2L7M P;  4Y13 A;  3VB2 A;  1FNN A;  2DT6 A;  5FLX K;  1R5H A;  2ESH A;  1JGG A;  3LQR A;  4HF1 A;  2JA6 J;  3AG1 H;  3L09 A;  4BHB A;  2LFB A;  1GVJ A;  4ENN A;  1E2X A;  5ILU A;  1G4D A;  3LA2 A;  2XB0 X;  2F5D A;  1WJE A;  1UG0 A;  1N75 A;  2RVC A;  2CV1 A;  4M3E A;  2Y48 A;  1IUY A;  4BXX J;  1OFC X;  4D5C A;  2ZB9 A;  3SDB A;  3DLL F;  4GYG A;  4M3F A;  5E3M A;  4PZJ A;  2QSH X;  5J1Y A;  4NQW B;  1TQP A;  4HLX A;  5FB2 A;  4EM2 A;  5CPR B;  2FSW A;  2Q1Z B;  1T98 A;  2HOT A;  3JRF A;  3Q0U A;  2QWW A;  3E6B A;  2XGC A;  3DPU A;  4HX8 A;  1E3O C;  3R0J A;  3A01 A;  3SEZ A;  2DYS H;  3IC7 A;  3G6E I;  1GV5 A;  1YTY A;  3QQA A;  1I3Q J;  1WH5 A;  3JTG A;  3BPX A;  4QWQ A;  3CF2 A;  3ZN1 A;  5LRR A;  1KQ8 A;  2CUJ A;  3JRI A;  4GDF A;  3KEQ A;  1K61 A;  2XF6 A;  1E3H A;  4KIT B;  5GP9 A;  1X1P A;  4UB8 C;  2NS7 A;  4UXN A;  4FX4 A;  2KDO A;  5JHF A;  4CZZ A;  1OPC A;  2LTP A;  5LEJ A;  1RKW A;  1FP2 A;  3H35 A;  3RDI A;  3GTQ J;  4FTH A;  1HF0 A;  5BMZ A;  4YFN F;  4OAZ A;  1STZ A;  2L7K A;  2X6W A;  1MZB A;  4MEX F;  2I10 A;  2R7F A;  1ZGA A;  2OF7 A;  4IRH A;  5FLV A;  3T8T A;  1DUX C;  3L2W A;  4IHS A;  2GOX B;  5BOX A;  1FJL A;  1NG7 A;  2L7F P;  1XMA A;  4G6D A;  4BJ6 C;  1HCR A;  2W25 A;  4Q47 A;  4XLN F;  4BQN A;  4KT6 A;  2V1U A;  3KZY A;  1YX3 A;  2VT2 A;  4UY8 I;  1H88 C;  1DPU A;  3CCE I;  3D5L A;  4WF2 A;  2R0Q C;  3K70 D;  3E1S A;  1HQC A;  2DOE A;  2JA7 J;  5KK1 A;  4PFO A;  3Q3S A;  3AL0 C;  5EEA A;  2DFF A;  4BE1 A;  1ETW A;  3CJQ B;  3KPH A;  4BQQ A;  5B5E C;  3LSK A;  4WXD A;  4DBR A;  2ZO4 A;  2HFH A;  1Z9C A;  2R7X A;  2E2J J;  3CUQ A;  2R92 J;  3VYU B;  1XDS A;  5DCM B;  5ILS A;  4ANJ A;  4CSW A;  2Q0O A;  1YOV B;  5KAI C;  1AU7 A;  1MBH A;  3KEY A;  2HZT A;  2CW8 A;  4UHT A;  4F55 A;  3P9I A;  2DA3 A;  1WI9 A;  1JTX A;  4EJT A;  2CW0 F;  2VJI A;  3ZR8 X;  1FLI A;  5EYR A;  4XKC A;  3VFZ A;  3BR0 A;  3GLX A;  3SJM A;  3BR5 A;  1AHD P;  3ZQL A;  3WG7 H;  3X2Q H;  2JPC A;  1HOM A;  5F0F A;  1TWH J;  2HGC A;  1SMT A;  1MJB A;  5TRD A;  2PJP A;  2QQA A;  2R5Y B;  2KIU A;  3WOD F;  1JHH A;  3M7G A;  3QP5 A;  2H1K A;  4EJV A;  2FBH A;  3CCS I;  3KIO A;  4MQ9 F;  1ETO A;  2LKP A;  1B59 A;  4Z2Y A;  3H1C A;  1SEU A;  2Z2S B;  1GV2 A;  3HTU A;  1KON A;  4R1H A;  4BU2 A;  1UAA A;  2KHM A;  4ZYH A;  2ID3 A;  4XRF A;  1W5S A;  5F1J A;  3K1N A;  1Z6R A;  3K10 A;  2AQE A;  2EFN A;  2IT0 A;  3S2D J;  4AVP A;  3AG3 H;  3TP0 A;  2EZK A;  4Y15 A;  1UFM A;  2X85 A;  2P6S A;  4PJ0 C;  2EFO A;  3CO7 C;  4A3K J;  1ETX A;  1QQI A;  4EV0 A;  1SVM A;  2V79 A;  1Y8Q B;  3DU5 A;  1Z77 A;  4HPQ A;  3S1Q J;  5D5V B;  2EIK H;  3AKZ A;  4A3E J;  2V7F A;  2ADU A;  4MFE A;  3MD2 A;  1NHA A;  1ZR4 A;  4IEJ A;  2KLO A;  3K4K A;  2ID6 A;  1SD6 A;  3VEP A;  1ETV A;  4S05 A;  1VQN I;  2LG4 A;  2GIV A;  3BZC A;  2NVU B;  2G7H A;  1BA5 A;  4XON A;  4ZYD A;  1X2N A;  3F3X A;  1JGS A;  2XAQ A;  3LSR A;  2L4A A;  2G7U A;  2LRE A;  4P1W A;  1VQ8 I;  4IOA F;  4G6Q A;  4C2M J;  2ESN A;  3L7W A;  3ECH A;  3OYL A;  1V5E A;  3BCA A;  5TJJ A;  4FIS A;  4XLP F;  3MAJ A;  3EYI A;  1U9N A;  1VQO I;  2EV5 A;  5FRO A;  5IT9 K;  3EQL F;  2LKX A;  3GTG J;  1X3Z B;  3QOD A;  4NHJ A;  1XCV A;  3BC8 A;  4BL0 B;  2DOF A;  3T0Y A;  3LSI A;  2OUM A;  1YS6 A;  3GXO A;  4RM2 A;  3Q9V A;  4BEH B;  1YE9 A;  2OA4 A;  4ZZD A;  5CKT A;  2FMY A;  1G2H A;  2K02 A;  3IP4 B;  1ETK A;  2PI0 A;  3V8K A;  4F91 B;  1LE8 B;  3BG6 A;  3K4C A;  3SFI A;  2F4M B;  1HW2 A;  2MA3 A;  1H0M A;  5DCM A;  2WB1 N;  1S5L C;  1TL8 A;  3MKZ A;  2KDZ A;  1VFC A;  1NK3 P;  1VQ4 I;  4CDG A;  4F7Z A;  2WAF A;  2D1H A;  5E79 C;  2VC1 A;  1OCP A;  4LK0 F;  5JR3 A;  1W7P D;  2ZXW H;  4H0E A;  4RAZ A;  2Z3Y A;  5IP6 A;  4C2T A;  5DM7 F;  3ELK A;  3GBG A;  2V9K A;  2STT A;  4M9S A;  2YX7 A;  3IH2 A;  1X3U A;  2RQP A;  3GCM A;  4MIM A;  1LFU P;  3NRV A;  1JUM A;  3CJN A;  4IX7 A;  3PFI A;  5FD5 A;  2UXN A;  4M3B A;  3QYF A;  2VC0 A;  4EEF G;  1G3T A;  4XK4 A;  5KVR A;  4J01 A;  4N4N B;  2EBI A;  2QKM B;  1T08 B;  3WHC A;  3KYD B;  2Y75 A;  3SEQ A;  4RAG A;  1J9I A;  2LRD A;  4WXH A;  5FLM J;  2K9L A;  3EUK L;  1WGX A;  4HAM A;  2K4J A;  2KL4 A;  2L5Q A;  2YS9 A;  4RM3 A;  2F2E A;  2MYS A;  1BR1 A;  3C2G A;  3OIQ A;  1LQ1 A;  4HA8 A;  4U0Y A;  1HSJ A;  2JRT A;  3IL2 A;  3LAJ A;  2NYX A;  4CCK A;  4CUG A;  3C1D A;  2LH9 A;  3DTK A;  4B47 A;  3ZMU A;  3SXY A;  1FYM A;  5CVI A;  2Y9Y A;  1S7O A;  3GZN B;  3BTJ A;  2V1X A;  3I59 B;  3J81 K;  4WX9 A;  5H2F C;  1RIO H;  1A6I A;  4LK1 F;  2DQR A;  2QF7 A;  2QVO A;  2ACJ A;  4HV6 A;  3RCO A;  4IZZ A;  2VUM J;  2BW3 A;  4CYC B;  2K40 A;  4ETS A;  1ZGW A;  1BBY A;  2JRM A;  2KIS A;  2Y0S N;  4OMZ A;  3WG9 A;  5LD2 C;  3KP2 A;  4P96 A;  2M7B A;  3JTH A;  1MSE C;  2Y0M A;  4Y17 A;  1JJ8 C;  2KQR A;  2CV2 A;  4WWC A;  2R7V A;  1Z3X A;  1GVD A;  2ZJR F;  2O3F A;  1MJ9 A;  3RIR A;  3SZT A;  4MGR A;  4ZH4 F;  2H8W A;  1HDP A;  2ZXH A;  5HLI A;  5FD6 A;  3FHZ A;  2LBF B;  1UHM A;  3S2H J;  1OCO H;  2P5L C;  2E35 A;  2FQ4 A;  2BY2 A;  3BRO A;  3R60 A;  1YFH A;  3BJ6 A;  3JRE A;  1OCZ H;  1A04 A;  2LK2 A;  3VYR B;  1J0R A;  2VPR A;  3AFH A;  2DN0 A;  4PSW A;  4A3M J;  4M6X A;  2WAD A;  3BP8 A;  4FCY A;  2CQX A;  4Y7N J;  2XSJ C;  1K4S A;  5JLX A;  4F92 B;  1X19 A;  5K7Z A;  1CF7 B;  3FBN B;  3V42 A;  4CO8 A;  2QBY B;  1GHC A;  4KYW A;  1FSH A;  5DD4 A;  1XS9 A;  1OKR A;  2AHQ A;  1FOY A;  4JK1 X;  3ERE D;  3CDH A;  4BEH A;  1UG2 A;  4A3B J;  3JCU C;  5LEK A;  3SFZ A;  1YO5 C;  4CCM A;  1VI0 A;  2DDB A;  4F3Q A;  2KZV A;  2M0M A;  4XKW A;  2PMZ A;  3DBR B;  3PO3 J;  4L0Z B;  1OYI A;  1TT0 A;  1JXS A;  1B6A A;  4F93 B;  2VN2 A;  4DZP A;  2GBY A;  3HOX J;  3CMY A;  4DIQ A;  4OIR F;  4A3J J;  2VLA A;  1R6R A;  5K1Y A;  3KCC A;  4F52 A;  4M6Y A;  1KU9 A;  2B63 J;  1KU2 A;  1YRN A;  4UVC A;  4HST A;  2MSY A;  5H6Q A;  4ENM A;  2X1D A;  2O6G E;  5AIQ A;  3FXM A;  4NB5 A;  1LKX A;  4CXF A;  2HQA A;  4NC7 A;  2V26 A;  1BL0 A;  1T6S A;  4XRM A;  3RTR A;  2HVQ A;  3DKX A;  2Q2E A;  5CLS A;  3GTM J;  5FKM A;  2E71 A;  2R7Z J;  1ITY A;  1TQM A;  2ECB A;  3TO7 A;  5HNH A;  3B02 A;  1VZ0 A;  5E8G A;  5HDK A;  4HYE A;  4FAS D;  5GAE J;  3S2W A;  1Z3Y A;  2P5K A;  3RSN A;  3FBI B;  5C4J J;  3BZK A;  1FY7 A;  3FHN A;  1Q1H A;  1SD5 A;  1XSX A;  1XMX A;  4MO7 A;  2P6T A;  2FML A;  3IWZ A;  2AXT C;  1ZQ3 P;  1ACI A;  2VJ5 A;  2L3D A;  2LF8 A;  5B1A H;  3JSP A;  4MFD A;  3LFK A;  2CO5 A;  2F5C A;  1W5C C;  1O57 A;  2IS2 A;  4HQE A;  4EAT A;  3DP7 A;  1SFU A;  1ODD A;  2CG4 A;  3F8N A;  2IGK A;  4RAF A;  2PLY A;  3GUD A;  2HDC A;  2PX9 A;  5B3S H;  5EG0 A;  1JKQ C;  4O3M A;  1TW2 A;  1MW7 A;  1S7E A;  1SVO A;  3I5U A;  4A0X A;  3REO A;  3GZ6 A;  3FKJ A;  2RNJ A;  1FEX A;  3ZOB A;  2VKH A;  5ICF A;  3HOZ J;  3CJR B;  1VQL I;  1MMN A;  3HSF A;  4IRG A;  1P7I A;  1EH7 A;  2D1V A;  1XPX A;  2EB7 A;  3Q9S A;  1ZLJ A;  4A3G J;  1F5T A;  3AL0 B;  1OYW A;  3I4P A;  2EK5 A;  3WU1 B;  1MH4 A;  3G73 A;  4Y33 A;  1Z21 A;  1RZ4 A;  3HOU J;  1G6N A;  4HW0 A;  1X1C A;  2JSP A;  5J8C A;  3L9F A;  5HS8 A;  2VKE A;  3BOQ A;  1SFX A;  1W7P B;  3JW4 A;  2M4K A;  4B3A A;  4HNT A;  3OYK A;  4TV7 A;  3OSF A;  1BI3 A;  1FT9 A;  3HSR A;  3FXQ A;  3OIO A;  1IZ1 A;  4RAY A;  2LBF A;  4UVB A;  1KU7 A;  4GO1 A;  1D0X A;  1QU3 A;  5H20 A;  4RMN A;  2ME6 A;  3L1P A;  4UUT A;  4X0G A;  2RC4 A;  3F8B A;  3E5U A;  4KMU X;  5J1U A;  1ZRF A;  2HOS A;  3UKG A;  3GFI A;  3E6D A;  2EIM H;  2XHK A;  1JKP C;  2Z5U A;  2BV6 A;  3LL7 A;  2B0L A;  1FOX A;  2MD5 A;  2RQQ A;  1JHF A;  4ZYG A;  1A5J A;  1K79 A;  2ISZ A;  2ZJP F;  1BI0 A;  4ABZ A;  3P9C A;  4BGD A;  2VE9 A;  3CTA A;  2VT3 A;  1MBG A;  4RB1 A;  3J7A Y;  1W0T A;  1QRY A;  4HDV A;  2COB A;  2K7L A;  2PEX A;  3KE2 A;  4PGH A;  4O6J A;  2CS3 A;  1PUF A;  2XPV A;  2X48 A;  1R4N B;  2BY1 A;  3HBL A;  1UCR A;  1KYW A;  4IF4 A;  3KX2 A;  3FWE A;  2X6O A;  3ZMV A;  2WY8 Q;  2KRC A;  4RBO A;  2EFQ A;  1ORK A;  5JHU A;  3WTS C;  2K5C A;  1BJA A;  4B48 A;  2PFB A;  2XPU A;  3ML6 A;  4CZC A;  3E6M A;  1X58 A;  3G3Z A;  3ZMT A;  3S1M J;  3GX4 X;  1R5G A;  4D9J A;  2VKV A;  4RS8 A;  3PIO F;  1YJW I;  4A5N A;  3I4N J;  3RPU A;  5LGN A;  5HNF A;  1QHG A;  2CQQ A;  1NG6 A;  3J7Z I;  3IHU A;  1OJL A;  1YIO A;  3AG4 H;  3DFG A;  4KT5 C;  1TP4 A;  1H9G A;  2BXZ A;  2V6E A;  3DQV C;  2OPT A;  2JVG A;  3QOE A;  5EJC A;  3OYJ A;  1QHH D;  1HBX G;  3GLL A;  1POG A;  1FSE A;  4BYY A;  3LSJ A;  3GTK J;  1E3P A;  3QYB A;  4I99 C;  1K6O A;  2YX4 A;  3SQN A;  4BHP A;  1G8X A;  4IHV A;  3KP3 A;  2C6Y A;  2WAQ A;  3CDL A;  3CUQ B;  2OBP A;  2WB1 A;  4Z6Y A;  1K83 J;  3ZRG A;  4A6D A;  2K27 A;  2RDP A;  3H5A A;  2RV8 A;  4RA2 A;  1N25 A;  3BQY A;  2O8X A;  3QPS A;  5KAF C;  3F22 A;  3HG9 A;  4Y3O A;  1V3F A;  1Y0N A;  4O5V A;  1PVE A;  2QQB A;  2KT0 A;  1T2K A;  3HC7 A;  4ASN A;  5K7F A;  4MLO A;  4A5M A;  2A6H F;  3OIP A;  3ZQG A;  1XGM A;  4Q48 A;  2HPI A;  3ZQC A;  2OJE D;  2HWV A;  1YI2 I;  2QGU A;  3HL2 A;  1LEA A;  1R1V A;  4M9Z A;  2CFX A;  2HDW A;  2ZFU A;  4OIN F;  3PL8 A;  4ZJZ A;  4KMF A;  3IH3 A;  2VOD A;  2AXL A;  2HTS A;  2ZNZ A;  5GAD J;  2EFP A;  2MW8 A;  2FUG 2;  4UV9 A;  1XD7 A;  2CU7 A;  4JYK A;  1IC8 A;  1BW5 A;  5ILV A;  4XL9 A;  3MZY A;  4E4H A;  3S93 A;  5M5Y J;  2EH3 A;  2DA5 A;  4PCQ A;  4ZYE A;  4XN0 A;  3PSF A;  2HKX A;  1VQM I;  2HQR A;  4PFP A;  3V7C A;  3QOP A;  4A3F J;  3CCQ I;  3R0A A;  3CME I;  2DK5 A;  3M8J A;  1GUU A;  4A0Z A;  3OSG A;  4IHY A;  4B3X A;  2W57 A;  1WPK A;  1IAW A;  4KIB A;  2ZCW A;  5FKL A;  3PQJ A;  1LNW A;  2VJ4 A;  3WE2 A;  5L3E A;  3IV5 A;  4IKF A;  1J7K A;  1UHW A;  2JUC A;  4AIK A;  1IDY A;  1LFP A;  1T39 A;  1P7J A;  4HRI A;  2COM A;  2WAQ N;  1QZY A;  3F6O A;  3K2A A;  3HRS A;  3ZXS A;  2D2W A;  2JJ7 A;  4LIT A;  3DTE A;  2YPR A;  4FE4 A;  5ED4 A;  3OYM A;  3QPL A;  1HXD A;  3H9J A;  3J80 K;  3I71 A;  1I39 A;  1H9T A;  2Y0S A;  1I3A A;  3CCR I;  2HDD A;  1IUF A;  4I2O A;  4XNF A;  3VYT B;  1Z1D A;  4G8X A;  2K4B A;  2M87 A;  3KLN A;  5IT9 Z;  2PG4 A;  2TDX A;  3EET A;  1BR4 A;  1R58 A;  2A3S A;  3DEU A;  5HOO A;  1RI7 A;  1J09 A;  1RKT A;  3LOC A;  3PQK A;  4KIS A;  3K2Z A;  3TOA A;  4U7B A;  3C18 A;  1QO0 D;  3DEW A;  1FTT A;  3IRR A;  2HXI A;  2QSF X;  2OAZ A;  5HDN A;  1WFX A;  3V8L A;  1D5Y A;  3C2H A;  1YJ9 I;  3F8C A;  1T95 A;  4YG2 F;  4J00 A;  4YIR X;  2HYF A;  1I1S A;  5HOD A;  1VQP I;  2FF4 A;  4M3G A;  1OR7 C;  4DGW B;  2PN6 A;  1S29 A;  1R1T A;  5LGU A;  1APL C;  2MG4 A;  4RGX A;  1MSF C;  4YFK F;  2PJR B;  4NUB A;  3HXL A;  1VF9 A;  3QYE A;  5D5W B;  4B4C A;  2KIF A;  2R4G A;  3NAU A;  2KKO A;  3Q0V A;  4ON0 A;  2DXI A;  5EGO B;  4L5J A;  3VOE A;  2GOM A;  2RRE A;  4RGU A;  3OL3 A;  3ABU A;  2X6X A;  2DMN A;  1ZH5 A;  4I7H A;  1Z05 A;  3BT9 A;  3CLO A;  2E1M B;  2M4G A;  4B1R A;  5BPI A;  5E1X A;  3K0L A;  1BI2 A;  5DUK A;  2ECC A;  2HOE A;  1IRG A;  2W1O A;  4HZF A;  4E7H A;  2A6E F;  1S3J A;  3GEZ A;  3TED A;  1WKM A;  1LB2 A;  3C7J A;  3M4O J;  4N9I A;  3KP6 A;  4RGR A;  3K70 C;  4IRI A;  5LGT A;  2LD5 A;  2HVR A;  3U1D A;  2HQ5 A;  2DTZ A;  2E5N A;  2D5V A;  4PSX A;  4XRS A;  2JWT A;  4OU0 A;  3HRM A;  4KUM A;  2LR8 A;  4PDK A;  4CYC A;  4JP0 A;  3U9G A;  1WJ5 A;  2DO7 A;  1YW8 A;  1U0J A;  1ERD A;  4YEL A;  5KCM A;  2FD5 A;  1S8N A;  3BR1 A;  3ZCO A;  3A0H C;  1XCB A;  2DA1 A;  4OWR B;  3ZMS A;  3E97 A;  3A01 B;  3COA C;  2X51 A;  2R7S A;  3N97 A;  3RKX A;  2IVM A;  1WZ2 A;  2CUF A;  4AUX A;  1W5T A;  4A93 J;  4Q5S F;  2R7Q A;  2X1C A;  1ETQ A;  3TDZ C;  2W48 A;  1S9H A;  5EF6 A;  4RB3 C;  3PIP F;  3L2C A;  3FXU A;  2QSG X;  4PGG A;  2NVT J;  4DYQ A;  3KZZ A;  1R00 A;  4KJZ A;  1W1W E;  4L0Y B;  4G7O F;  2W4S A;  3MKY B;  4DYR A;  2XGD A;  3DLA A;  1IO2 A;  2DFI A;  1ZHF A;  5IT3 A;  2CH0 A;  5F0H A;  3PJR A;  3T5X A;  2VON A;  5EZG A;  2OV7 A;  3DTI A;  3H9Q A;  2MLK A;  3BG9 A;  1NK2 P;  1R9T J;  1B4A A;  1RR7 A;  3LSG A;  3BZ6 A;  3TKY A;  4AD9 A;  4D1Q A;  3CCU I;  4E7L A;  1G3W A;  1ZK8 A;  3MVP A;  5CJ9 A;  1R7J A;  2DTR A;  2NNN A;  3JAM K;  3F72 A;  1ZRE A;  3LFU A;  2M1B A;  3K1M A;  3UR3 C;  5E8I A;  2VXZ A;  3RZO J;  1U5T C;  2DT7 B;  5LHI A;  3E6C C;  2ZKZ A;  4W97 A;  3SYT A;  2ZJQ F;  2WC2 A;  5F1R A;  3BPV A;  4Q4Z F;  4V2F A;  3CLQ A;  4L9T A;  4ZDO A;  3QPH A;  2UV1 A;  3WU0 A;  2Y30 A;  3HGY A;  3E3V A;  3OOU A;  1LPQ A;  2QEX I;  3OV8 A;  4CH7 A;  4YII A;  4XSZ F;  4LB6 B; 
#chains in the Genus database with same CATH homology
 1U78 A;  2JMW A;  2XB5 A;  1DU0 A;  1XS9 A;  2AHQ A;  1BJZ A;  3PO2 J;  1UG2 A;  1T33 A;  4A3L J;  4A3B J;  4Y52 J;  1U9O A;  3HDD A;  3S17 J;  1Y1W J;  1VI0 A;  5C44 J;  5E3N A;  3JRG A;  3PM1 A;  2IBD A;  3PO3 J;  3CQZ J;  1WH7 A;  2CJJ A;  1XG1 A;  3GTL J;  5E3O A;  4DZP A;  2GBY A;  3Q0W A;  3VPR A;  1FIA A;  3HOX J;  3CMY A;  2G0E A;  4A3J J;  4BY1 J;  3S1R J;  5F27 A;  3DCF A;  4D7M A;  2JA8 J;  2FX0 A;  1ENH A;  2XRL A;  4I76 A;  3G1L A;  2B63 J;  2QCO A;  2NVY J;  1YRN A;  2MSY A;  1TWC J;  1JT6 A;  3S1N J;  3CCY A;  3C2B A;  4QSH A;  5EZH A;  1BL0 A;  4XRM A;  4FE7 A;  2EQR A;  1MNM C;  2JN6 A;  2IAI A;  3GTM J;  2E19 A;  2DMT A;  5FKM A;  2R7Z J;  4BY7 J;  1QVU A;  1ITY A;  2ECB A;  3B6A A;  3FKI J;  2M0C A;  4DYC A;  1ZTR A;  1B8I A;  5C4J J;  4MO7 A;  1IDZ A;  2DMU A;  2LP0 A;  1MBK A;  3BG5 A;  4X1E A;  1O4X A;  1ZQ3 P;  1TWF J;  4BKX A;  3RZD J;  4MFD A;  1UHS A;  1XC5 A;  3BTL A;  1HLV A;  3ZQH A;  2GM4 A;  1F36 A;  1DU6 A;  2E2I J;  1AKH A;  4J19 A;  4AYB N;  3FK6 A;  2DA2 A;  5EG0 A;  1JKQ C;  3FIS A;  1S7E A;  1BW6 A;  3LSP A;  3F0C A;  2M9H A;  1SAN A;  2DMQ A;  3ZOB A;  2E2H J;  5M5X J;  3S14 J;  1FEX A;  1FTZ A;  3K7A J;  3G1O A;  3WHB A;  3HOZ J;  2EZI A;  3BR6 A;  3HGG A;  1P7I A;  5DTD A;  2JA5 J;  4QTR A;  2LY9 A;  3TW6 A;  1F43 A;  4RDU A;  5EDN A;  4A3G J;  1HDD C;  2GLO A;  1MH4 A;  4W1U A;  2O7O A;  4XRS G;  3HOU J;  3LNQ A;  2WV1 A;  1H8A C;  1ETY A;  1EF4 A;  1Q1V A;  2VKE A;  4BBR J;  2L7M P;  1PUF B;  4B3A A;  3OSF A;  1QPI A;  3OIO A;  2TRT A;  1IV6 A;  2CUE A;  3HOY J;  1JGG A;  2JA6 J;  1JT0 A;  4V2G A;  2JK3 A;  2ME6 A;  1WCM J;  2LFB A;  3L1P A;  4UUT A;  5E3L A;  1JJ6 C;  2XB0 X;  5J1U A;  2HOS A;  1TWG J;  3UKG A;  2EZH A;  1GDT A;  3W6V A;  4D5F A;  2K9S A;  4M3E A;  1JKP C;  2R93 J;  4BXX J;  1OFC X;  3BTC A;  4D5C A;  2ZB9 A;  1A5J A;  1FIP A;  4M3F A;  5E3M A;  3H0G J;  5J1Y A;  4ABZ A;  2X9D A;  5JLW A;  1MBF A;  1X2M A;  1MBG A;  2E1O A;  2HOT A;  1W0T A;  1QRY A;  2R5Y A;  2COB A;  3JRF A;  3Q0U A;  1B72 B;  2XGC A;  2Y2Z A;  1E3O C;  1B72 A;  1PUF A;  2XPV A;  2X48 A;  3A01 A;  3HBL A;  3MN2 A;  1GV5 A;  5IYC J;  3QQA A;  5C3E J;  1I3Q J;  1WH5 A;  2NS8 A;  2X6O A;  3JRC A;  4RBO A;  2DJN A;  1ORK A;  3JRI A;  5M5W J;  1K61 A;  4JX5 A;  4DZJ A;  2XPU A;  3IH4 A;  2LLK A;  5GP9 A;  3HKZ N;  1X58 A;  3S1M J;  2NS7 A;  4M6V A;  2VKV A;  4UUS A;  3GTP J;  2DA7 A;  5FKO A;  1TC3 C;  3I4N J;  5F04 A;  5IP9 J;  2LTP A;  1RKW A;  3GTQ J;  2CQQ A;  4FTH A;  3GTJ J;  1AKH B;  5IOY A;  1HF0 A;  1OJL A;  4A69 C;  2NVX J;  2TCT A;  2I10 A;  1MBJ A;  2OF7 A;  2HYJ A;  2OPT A;  5FLV A;  5IPA A;  2FJ1 A;  5BNG A;  1FJL A;  4HNV A;  1POG A;  2L7F P;  3LSJ A;  3E7L A;  3JRH A;  1HCR A;  3GTK J;  5FKK A;  2N8G A;  4M3D A;  4IHV A;  3BTI A;  1JUP A;  2ME0 A;  3CDL A;  1H88 C;  2R0Q C;  2R5Z A;  1K83 J;  1RPW A;  2JA7 J;  5DS9 A;  3Q3S A;  5EEA A;  4G12 A;  1LFB A;  3BQY A;  3QPS A;  1ETW A;  2XSD C;  1IJW C;  2KT0 A;  3MKL A;  5FKN A;  5K7F A;  2K9N A;  2Y31 A;  4MLO A;  2XGE A;  3ZQG A;  2E2J J;  2O9L A;  2R92 J;  3S15 J;  1GT0 C;  3HB9 A;  1ZR2 A;  3ZQC A;  4C3I J;  1JKR C;  1AU7 A;  1MBH A;  2R5Z B;  2NVQ J;  3HM5 A;  3NAR A;  1I50 J;  2DA3 A;  1JTX A;  1YRN B;  3IH3 A;  5GPC A;  5EYR A;  1JTY A;  2MW8 A;  4A3I J;  3BR0 A;  3SJM A;  2CU7 A;  3BR5 A;  4JYK A;  1IC8 A;  1AHD P;  3ZQL A;  4NDL A;  4S0H B;  1BW5 A;  1HOM A;  5F0F A;  1TWH J;  5M5Y J;  2EH3 A;  2DA5 A;  2VI6 A;  2R5Y B;  2M34 A;  1OCT C;  4A3F J;  3M3Y J;  4A3C J;  2H1K A;  4IHY A;  1GUU A;  3OSG A;  2CRG A;  1VND A;  1ETO A;  1WPK A;  5FKL A;  1GV2 A;  3IV5 A;  2ID3 A;  5F1J A;  1IDY A;  1IG7 A;  2MGQ A;  1P7J A;  2WAQ N;  3S2D J;  1Y1V J;  3K2A A;  3TP0 A;  3TW7 A;  2NOG A;  2EZK A;  4D7N A;  2JJ7 A;  3SDG A;  2YU9 J;  4A3K J;  1ETX A;  4FE4 A;  1RET A;  3QPL A;  3B6C A;  1Z77 A;  3S1Q J;  4A3E J;  3GTO J;  2HDD A;  4MFE A;  1W0U A;  4XID A;  1IUF A;  1JUS A;  1ZR4 A;  4IEJ A;  4IHW A;  2ID6 A;  2L0K A;  9ANT A;  1MBE A;  4I6Z A;  1ETV A;  4IHX A;  1UMQ A;  3LOC A;  1RKT A;  1BA5 A;  4L5E A;  1QVT A;  1X2N A;  4AC0 A;  5IYD J;  3LSR A;  3DEW A;  1FTT A;  2K9Q A;  2HXI A;  4C2M J;  1D5Y A;  1IGN A;  3HOV J;  5HOD A;  2LVS A;  4FIS A;  4M3G A;  3RQI A;  1U9N A;  2ELK A;  1APL C;  3BR2 A;  2MG4 A;  5IP7 J;  1MSF C;  2LKX A;  3GTG J;  1VF9 A;  4B4C A;  2L9R A;  5J3L A;  5M3M J;  4X6A J;  3NAU A;  5F08 A;  3TP3 A;  5F0C A;  3Q0V A;  2AO9 A;  5EGO B;  3JRB A;  3A03 A;  1G2H A;  1ZKG A;  1ETK A;  3HOW J;  2PMZ N;  4QIW N;  1LE8 A;  2H8R A;  1T56 A;  2DMN A;  5M3F J;  1LE8 B;  4BBS J;  2HXO A;  3BT9 A;  1H89 C;  3SFI A;  4B1R A;  2Y9Z A;  3BR3 A;  5IOZ A;  2HOA A;  2ECC A;  2WB1 N;  1TWA J;  2KDZ A;  1VFC A;  1NTC A;  3TED A;  1NK3 P;  3M4O J;  1OCP A;  5IP6 A;  3GBG A;  2LD5 A;  3G1M A;  4C3J J;  3IH2 A;  2HQ5 A;  4MIM A;  1LFU P;  2DTZ A;  2D5V A;  2IEK A;  4XRS A;  2EZL A;  2JWT A;  1JUM A;  4XIC A;  3ZQF A;  2LR8 A;  4M3B A;  2HI3 A;  1B8I B;  2P81 A;  4CYC A;  4EEF G;  4JP0 A;  3RKQ A;  4XK4 A;  1MH3 A;  3BG3 A;  4UUS B;  2FD5 A;  2EBI A;  3BR1 A;  2DA1 A;  3WHC A;  3ZQI A;  2XPW A;  3A01 B;  3D1N I;  3JRD A;  4LOC A;  2CUF A;  5FLM J;  4AUX A;  1WGX A;  3O8G A;  3JR9 A;  4A93 J;  3H3V K;  1IRZ A;  4GFB A;  1ETQ A;  2YS9 A;  5EF6 A;  2W48 A;  1CQT A;  3BQZ A;  3S16 J;  2DA6 A;  1I6H J;  5K7H A;  2NVT J;  4DYQ A;  5FJ8 J;  5IYB J;  4DYR A;  2XGD A;  2Y9Y A;  4A3D J;  4JX6 A;  3BTJ A;  1U8B A;  3HEF A;  5F0H A;  1SFO J;  5EZG A;  1A6I A;  2QF7 A;  3FIW A;  1JKO C;  2VUM J;  4CYC B;  2K40 A;  1ZGW A;  2DA4 A;  2Y0S N;  3BG9 A;  5EG0 B;  3LSG A;  1RR7 A;  5EGO A;  1R9T J;  1NK2 P;  2O8K A;  1MSE C;  3MVP A;  1ZK8 A;  1WI3 A;  3O8H A;  3I4M J;  1JJ8 C;  2YUS A;  1GVD A;  2DMP A;  2M2E A;  1HDP A;  2RAE A;  3RZO J;  4DW6 A;  3S2H J;  3FK7 A;  2FQ4 A;  2L7Z A;  4W97 A;  5J1R A;  4C3H J;  3JRE A;  2LK2 A;  4V2F A;  2VPR A;  2DN0 A;  4A3M J;  1Z0X A;  3JRA A;  4FCY A;  2CQX A;  1RES A;  4Y7N J;  2M8G X;  3A02 A;  5C4X J;  2Y30 A;  3HGY A;  5JLX A;  3OOU A;  5K7Z A;  4JX4 A;  5GPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...