1WCMJ

Complete 12-subunit rna polymerase ii at 3.8 angstrom
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structures of Complete RNA Polymerase II and its Subcomplex,Rpb4/7
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1wcmJ00
5IYCJ 4XIDA 2CU7A 2GM4A 1W0TA 2LVSA 3JRHA 1OFCX 2QF7A 1OCPA 3GTPJ 4MFEA 4RBOA 1E3OC 1TC3C 2E2IJ 1YRNA 3GTMJ 3SFIA 1JTYA 2LP0A 4M3GA 1ETQA 5DS9A 2DN0A 3OSGA 4M3FA 4IHVA 4UUSB 2DMUA 5IYDJ 1T56A 1T33A 1BL0A 3I4MJ 1WCMJ 4C3JJ 3HM5A 2YS9A 2E2HJ 2AO9A 4JYKA 4JX4A 1IGNA 4FISA 4AC0A 1ORKA 2HOAA 4X1EA 5IOYA 5F08A 1I50J 3IH3A 5C4XJ 2EQRA 3H3VK 3RZOJ 5GPAA 4B4CA 2Y2ZA 4M3BA 3LSPA 3ZOBA 2HI3A 3TP0A 1B72B 3W6VA 5BNGA 1FTTA 2CJJA 2Y30A 1FTZA 2LLKA 1RPWA 2M9HA 1Q1VA 5IPAA 3NARA 2YU9J 4M6VA 2L7MP 1FIPA 2EBIA 1D5YA 1WGXA 2DA3A 2X6OA 4D7NA 5M5YJ 3OIOA 1JKRC 2M0CA 5FJ8J 2AHQA 2EH3A 3Q3SA 1TWCJ 5IP9J 1ZR2A 3TW6A 1HLVA 2VI6A 4B3AA 4BBRJ 3QQAA 5E3LA 2MW8A 1AKHA 2L9RA 1TWHJ 1IDYA 2R5YA 3G1MA 5IP6A 1IRZA 1K83J 3IV5A 3S1MJ 3HOWJ 2KT0A 5M3FJ 1RR7A 4C3HJ 3FKIJ 2M2EA 1I3QJ 2JJ7A 2ECBA 5HODA 2M34A 4A3IJ 1TWAJ 1U78A 1BW6A 4DYCA 1U9NA 3JR9A 3BR0A 2R92J 2FJ1A 3OOUA 4W1UA 5EGOB 2Y9ZA 1IV6A 2VKEA 3BQYA 3GTQJ 9ANTA 3DEWA 3BG9A 3RKQA 3RZDJ 2HOSA 1BJZA 2E19A 3GTOJ 2WAQN 3JREA 3NAUA 3PO3J 2DA5A 1RKTA 3MKLA 2H8RA 3M3YJ 3K7AJ 4MFDA 1JGGA 4Y7NJ 2X9DA 4BY1J 1FIAA 1S7EA 4BXXJ 1APLC 3BTJA 4QTRA 5IYBJ 2OF7A 4B1RA 3TW7A 3LSRA 2NVQJ 5GP9A 3Q0WA 4IEJA 2DA6A 1SANA 1Y1VJ 1TWFJ 4C2MJ 4Y52J 2X48A 5J1UA 5E3MA 1JUSA 2IBDA 3ZQLA 4D5FA 3LSJA 3ZQIA 5FLMJ 3M4OJ 1B8IB 5FKMA 4BKXA 1WI3A 1HOMA 1PUFB 2HOTA 1X2MA 2XPVA 1AHDP 2VKVA 2TRTA 2IAIA 2EZIA 3BTLA 1ETWA 3UKGA 1O4XA 1ETKA 3ZQGA 3OSFA 5M3MJ 1TWGJ 2K9NA 4L5EA 3L1PA 3CMYA 1ZQ3P 1G2HA 5F0CA 3S2HJ 2W48A 3JRGA 2VUMJ 2DMQA 3F0CA 2CQXA 1MH3A 4A3BJ 1GV5A 2EZHA 4G12A 3Q0UA 3BTCA 4DYQA 3GTLJ 5EZHA 1K61A 1ETXA 1WH5A 4IHWA 3H0GJ 4C3IJ 2LKXA 2XGDA 2N8GA 4V2FA 4CYCB 2O8KA 2R93J 5EGOA 1P7IA 1ETYA 3RQIA 2FX0A 1X2NA 1R9TJ 1QRYA 1AU7A 2JMWA 2DA7A 3S1RJ 1VNDA 4LOCA 2QCOA 3PM1A 4FE7A 1ZK8A 3HOZJ 4A69C 4M3DA 1NK2P 1XS9A 2HQ5A 2XB0X 3HOXJ 1BW5A 1JJ6C 2ID6A 1MBGA 2R5ZB 3S17J 3FK6A 3TP3A 2NVYJ 3A01B 5EDNA 2H1KA 1X58A 2K9SA 3O8HA 2OPTA 1JJ8C 3ZQCA 4M3EA 3O8GA 2Y31A 2CQQA 1QVTA 4DZJA 3BTIA 4FE4A 2JA5J 2L7ZA 4A3LJ 1RESA 1EF4A 1POGA 4A3CJ 3ZQFA 3BQZA 5C3EJ 5F04A 2VPRA 2LR8A 3SDGA 3LNQA 3HGGA 3S2DJ 1U9OA 2GLOA 2DA4A 1JKOC 3IH2A 1VFCA 1WH7A 5EG0B 2HXOA 1BA5A 1PUFA 1IJWC 1F36A 2LD5A 1ZGWA 2NVXJ 1LFBA 1IG7A 4A3KJ 3A03A 3S15J 2YUSA 4FCYA 4I76A 2DA1A 3A02A 5J1RA 5JLXA 5JLWA 4UUSA 1OJLA 1IC8A 2ZB9A 3LSGA 3HBLA 1MBKA 3S16J 1JKQC 2MSYA 1VF9A 1HDDC 4MIMA 2XRLA 2NS8A 1U8BA 3CDLA 5F1JA 2MGQA 4J19A 3BR1A 1A5JA 2GBYA 3JRIA 2MG4A 4NDLA 1Y1WJ 1NTCA 4CYCA 1JT0A 2DJNA 1FEXA 1GVDA 1VI0A 2XGEA 5K7ZA 1GUUA 3S14J 2R0QC 3MN2A 1B72A 3HEFA 1UHSA 3C2BA 3ZQHA 4D7MA 1W0UA 4RDUA 1MBEA 1UMQA 1CQTA 4AUXA 4BBSJ 2ECCA 2TCTA 2COBA 3TEDA 4GFBA 3K2AA 5FKKA 5EEAA 3JRAA 3BT9A 2R5YB 2R5ZA 4QIWN 4MLOA 2B63J 1MH4A 3A01A 2JA6J 4XICA 2LTPA 2CRGA 3HOYJ 5EZGA 2ME0A 3G1LA 5FKOA 1UG2A 1IUFA 3CQZJ 4IHXA 1SFOJ 1GV2A 4AYBN 1ZTRA 1Z77A 1RKWA 5E3NA 2CUEA 3VPRA 2E2JJ 3G1OA 5IP7J 5GPCA 3BG3A 1FJLA 5EG0A 1QVUA 3BG5A 3Q0VA 4IHYA 5F0HA 5J3LA 1ETVA 3MVPA 2XPUA 5J1YA 4DW6A 5EYRA 1H89C 3WHBA 4DZPA 2O9LA 2DMPA 5F27A 4XRSA 4FTHA 1LE8B 1JKPC 1OCTC 5FLVA 2D5VA 2G0EA 2HXIA 5FKNA 1XC5A 2Y9YA 3JRFA 4HNVA 2FD5A 2XB5A 2DMTA 3HOVJ 3BR5A 1DU6A 3FIWA 5M5XJ 1H8AC 3QPSA 4UUTA 3JRCA 3LOCA 1HDPA 3DCFA 4XK4A 5F0FA 1ZR4A 3E7LA 1JUMA 3CCYA 2XGCA 2E1OA 4ABZA 5C4JJ 1WPKA 4EEFG 3GBGA 2M8GX 4JX6A 5FKLA 1JTXA 3S1NJ 2L7FP 3GTKJ 3HGYA 2DMNA 3SJMA 1IDZA 1MBJA 1MSFC 2NVTJ 3JRDA 3WHCA 2HDDA 3HDDA 3HB9A 3FK7A 1B8IA 2L0KA 1YRNB 4XRMA 4MO7A 1QPIA 1Z0XA 4A3JJ 3JRBA 3HKZN 2Y0SN 1MBHA 5M5WJ 5K7HA 3GTGJ 2XSDC 1XG1A 3BR3A 2JK3A 4XRSG 3B6CA 2RAEA 4A3MJ 5IOZA 4QSHA 2O7OA 1MNMC 2DTZA 5K7FA 1ENHA 1HCRA 3BR2A 3I4NJ 4D5CA 2ELKA 1HF0A 5EF6A 1JT6A 1F43A 4A3DJ 3HOUJ 2NOGA 4W97A 2ME6A 1MSEC 3FISA 1JUPA 1ITYA 1A6IA 2R7ZJ 1H88C 4X6AJ 2WB1N 2JA8J 1P7JA 2KDZA 2WV1A 2P81A 3D1NI 2EZLA 5DTDA 4A3GJ 1GDTA 5C44J 4A3FJ 1GT0C 3S1QJ 2FQ4A 1LE8A 2K40A 2LY9A 3B6AA 2JA7J 1AKHB 2EZKA 1LFUP 3GTJJ 4BY7J 2PMZN 3QPLA 2CUFA 1ETOA 4JP0A 3BR6A 2NS7A 2JN6A 1NK3P 2XPWA 5E3OA 2K9QA 2IEKA 2HYJA 1ZKGA 4A3EJ 2ID3A 4A93J 2LFBA 4S0HB 1RETA 3PO2J 1DU0A 4JX5A 2JWTA 2DA2A 2I10A 1I6HJ 3IH4A 4V2GA 4I6ZA 2LK2A 4DYRA 1MBFA
chains in the Genus database with same CATH superfamily
2OJED 3I56I 1E3HA 4KN7X 4XIDA 4LG0B 2O5RA 1W0TA 1NG7A 1ERDA 1G3YA 4ITVA 4RLFA 3F21A 1J2XA 2LP0A 4LB5A 3QPTA 2NNYA 3OSGA 4M3FA 1IN7A 5H20A 3DPTA 2HPIA 3VDXA 2W1OA 1T56A 5D6EA 4ENJA 3C2HA 3HM5A 5ERIA 2YS9A 2E2HJ 1A04A 2AO9A 2V6CA 4H4KC 4JX4A 2VQLA 4FISA 3KYLA 1R1UA 1MJ9A 2XVCA 4AC0A 1ORKA 4LIUA 4X1EA 5ICGA 1JHHA 4HQMA 2GZWA 2M5WA 3LSKA 1MNEA 2QQ8A 4KIBA 2PJPA 5E8GA 3KZIC 5GPAA 1V55H 4B4CA 5LHGA 3S3OA 5BPDA 2K7LA 1DP7P 1FTTA 1GXQA 5TJJA 3GEZA 4BEHB 3IL2A 2HS5A 4WK8F 2M9HA 5LEKA 5CPRB 5LHIA 4KIGA 1Q1HA 3RIRA 3D5LA 4U7BA 3NARA 1JXSA 3HTUA 1FIPA 2EBIA 1IN6A 1WGXA 3H35A 5M5YJ 2EV0A 3OYMA 2ZXWH 3BLYA 1JKRC 1A31A 1Z1DA 4L9JA 2M0CA 2OTLI 5FB2A 5J4VA 3Q3SA 1Z6TA 4G94A 4A2UA 5IP9J 1ZR2A 4RGXA 2VI6A 4MNUA 4EATA 1HLVA 4HYEA 2P6TA 5E3LA 2EA2A 2MW8A 2DPDA 2HGCA 1X4OA 2Q2EB 2BW3A 2LKSA 2R7RA 2W4SA 1N77A 2DK5A 1IDYA 4IQ4A 4XOTA 3G1MA 3V4GA 4BDZA 1ZREA 2VBWA 4IL6C 1BR4A 1IRZA 2Z5UA 4KMUX 1U8RA 1ZHFA 1VQKI 2KT0A 5ILVA 3I3LA 3RDIA 4C3HJ 2CQ7A 1TBXA 2JJ7A 2ECBA 4DBRA 4FT8A 2M34A 4C30A 4RGUA 2LNBA 1U78A 1D1AA 2BE5F 1BW6A 1MD0A 4Y3OA 4DGWB 3WE2A 1NHAA 4BQAA 4W1UA 1V3FA 3M7GA 1TP4A 3OWTA 5CVJA 2Y9ZA 3ABMH 2KIUA 3KE2A 3ZMTA 2PFBA 3BQYA 1QU3A 3GTQJ 1K6YA 2CFXA 3PL8A 3E5QA 4EJOA 2ZNZA 3HYIA 2FF4A 3RKQA 4UB6C 1BJZA 1YJ9I 2BEOA 2VBYA 2JPCA 3DFGA 3LA3A 4QPOA 1YG2A 3LFKA 3JREA 4XMYA 2XAGA 1LEAA 4CA0A 2A05A 2X1CA 2L2OA 3M3YJ 1JGGA 4Y7NJ 4L9NA 1OKRA 3QU3A 2VKDA 4EVIA 3BTJA 3ERMA 2YX7A 4E7ZA 4XLFA 4ZC3A 3E6CC 4PJ0C 4PJNA 4B1RA 2VT2A 2NVQJ 1VTNC 4IEJA 1YOVB 3P9IA 1TWFJ 4C2MJ 3L09A 2DCEA 1A6QA 4PSXA 5J1UA 4BNCA 3BZCA 5E3MA 5KCMA 3MKZA 3ZQLA 3LSJA 4PCQA 5FLMJ 4XL9A 1V54H 3FWEA 1TNSA 2AXLA 5HNHA 1PUFB 3J81Z 4UNOA 4XORA 2IAIA 2VPLA 1D0YA 1HKQA 4G8XA 3HRSA 4P5OA 3KZYA 2BVLA 1SAXA 1NG6A 2VOPA 3QOPA 5LGNA 5E1ZB 2JTVA 4L5EA 4DQ2A 3CMYA 2BHYA 1ZQ3P 3OYLA 5HDNA 3JRGA 2XF7A 1S72I 2DMQA 3F0CA 4LK1F 2X6XA 3V7RA 1S8NA 2ZFWA 5LRSA 5FLXK 4L5JA 3RYRA 3FXQA 3PSIA 2JUCA 2G7UA 2L9VA 5EZHA 3L9FA 2ZSIB 5EEHA 5IT3A 2HYGD 2XGDA 2N8GA 2R93J 2IS1A 3FXJA 3H9GA 3LQQA 5EGOA 1GVJA 4F92B 2HOEA 1KA8A 3RQIA 1FOXA 3CJTB 4KIFA 4AIHA 2JMWA 1TW3A 1BR2A 2LKPA 2DA7A 3T1BA 3WTSC 1UAAA 2QCOA 5CKTA 4CCOA 3HOZJ 2BBYA 4A69C 1J7KA 1NK2P 3DBLB 4EJVA 2OCCH 4HLYA 1KU2A 5J40A 5CJ9A 2ID6A 2P0WA 4M9SA 2R5ZB 2GOXB 3FHNA 3D5RC 3S17J 1FNNA 4P9UA 1X58A 2K9SA 3O8HA 4XM3A 4XSZF 1XCBA 2KPMA 4M3EA 2IVMA 4ZDPA 3GFMA 2IS4A 3O8GA 5DM7F 2BZTA 3FBIB 4DZJA 5HS7A 1EF4A 2JA5J 3R6SA 4OMYA 3BQZA 1BN5A 2LDUA 3CC4I 3BJ6A 5GADJ 4XLAA 1F9NA 5FRNA 2LR8A 5CQEA 2W84A 2QEXI 3SDGA 3FDYA 4IPAA 1LDDA 1ONVA 1RUNA 1W7PA 2HZDA 3S2DJ 2KZVA 2GLOA 3AG4H 1J0RA 3QU6A 1WH7A 4CDGA 2BY2A 1BA5A 2KZGA 1IJWC 2NVXJ 1ZGWA 1IN8A 4QPQA 1DQUA 5KAIC 4G7OF 3A03A 4R8HA 3S15J 5B1AH 4PK4A 2PJRA 2DOFA 4XR6A 4NB5A 2KLOA 4RA2A 1IRGA 2ZC2A 3FX3A 3QAHA 5JLWA 5JLXA 3OYHA 4ZYGA 4UUSA 4XLNF 1FZPB 2K3PA 5ICFA 1XGOA 2BYVE 5GAEJ 2M7AA 3LSGA 1FOKA 1K78B 2A5YB 1HDDC 4N4OB 3ESWB 1Z05A 2A61A 4IOAF 2F5EA 2NS8A 3E6BA 3C2GA 5GTIC 4BE1A 2OZ6A 2IS6A 4U87A 1WJFA 2P5VA 1A5JA 2GBYA 3I5UA 4NDLA 5D8LB 1NTCA 1F5TA 1ACIA 4HZFA 1TQMA 2IGKA 3CCJI 4B09A 1WFXA 3S14J 3EYIA 1HSTA 2R0QC 3TO9A 1UHSA 3ABKH 3WG7H 4M9XA 3N4MA 2E5ZA 2ECCA 1FP1D 3LA7A 2WC2A 2E34A 3GXOA 3F8NA 2BW3B 1MMDA 1BR1A 5FKKA 3IAS2 3BT9A 3IKTA 3AG1H 2QENA 2F4MB 4PUSA 2RNGA 1S7OA 1S3JA 3V7SA 2XC7A 4IHSA 2RC4A 2FSWA 3P9CA 2CWEA 2DI3A 3HOYJ 2ME0A 3F3XA 3G1LA 5FKOA 2LOOA 2GXGA 4BE2A 3W2AA 4KT6A 4M6XA 4HF1A 3CCRI 2DXIA 3PNVA 3HXLA 2VKHA 4A5MA 2DBBA 1SFOJ 1R4NB 4AYBN 1Z77A 1RKWA 2E1MC 3EQLF 1SC7A 1J75A 1PDNC 3L2VA 3UR3C 2E60A 5DUIA 4MEXF 5IP7J 3C3WA 5L3DA 3ZXSA 5GPCA 4KYWA 1FJLA 2R7QA 3Q0VA 1LVAA 4AIDA 4BACA 1ETVA 2IJLA 2V9VA 1IUYA 3KZZA 3WGGA 3JTHA 5FFXA 3KCCA 5LBQA 1Z9CA 3BY6A 1FC3A 3AKZA 2LF8A 2VL8A 2Y75A 4WXCA 1LE8B 5FLVA 4E7SA 2E7XA 5B66C 1BI1A 2V9KA 4Q48A 2F5VA 3JSOA 2PG4A 3G6EI 2DMTA 1ODDA 4UUTA 1IO2A 4B3XA 1S29A 2F5FA 2Q0OA 3FMSA 4HF0A 1R4MB 1FOYA 3QYBA 1E0EA 2RV8A 3KETA 1KQ8A 1XGNA 2XSJC 1OCRH 1UELB 4JX6A 4LMYA 2QSFX 1JTXA 1IZ1A 1ZH5A 1LVKA 2L7FP 1XPXA 5E1WA 2VE8A 1IDZA 2RKHA 4P9FA 4HDVA 1MSFC 2NVTJ 3EUHA 4FQGA 3CESA 3TGNA 5ICCA 2ICWG 2MBFA 3E5XA 4YELA 2NAZA 3V42A 2L0KA 5FLXZ 4XRMA 2EILH 2BV6A 2HDWA 4MQVA 1QPIA 2DAOA 1T6SA 2CYYA 2DDBA 5FGMA 4Y13A 1X1CA 1CF7B 1W5TA 3K4CA 3HKZN 2VT3A 3U1DA 5J6XA 3S3MA 1B6AA 3BG6A 3COAC 2QZ8A 1XG1A 1TTYA 4A0YA 3AG3H 4BHPA 2XV4S 4XRSG 2IXSA 1X3UA 2DQRA 3B6CA 4E70A 4CYDA 4A3MJ 3CD6I 1ZLKA 5IOZA 3TKYA 3I53A 3DPLC 4HA8A 3H5RA 5K7FA 4ZYEA 2V1UA 2X0LA 1HCRA 3BCBA 3BR2A 3ZGKA 1WJEA 1I6XA 5HLGA 1G6NA 2E1MB 3HSEA 4KN4X 1O7LA 3U1KA 2L54A 5LGTA 1QQIA 3F9KA 2H09A 3FISA 1JUPA 2QGUA 1ITYA 3FKJA 3S3NA 4AU7A 3AG2H 1MNDA 2KDOA 1H88C 1WSUA 4GCVA 2DK8A 2ADUA 1I3AA 3DKXA 1P7JA 1H9TA 2WV1A 2A3SA 4A3FJ 4G7HF 4I01A 4GYIA 2ESNA 2JA7J 1AKHB 2EZKA 1LFUP 1X3WB 4BY7J 1ETOA 4JP0A 3I59B 4E7HA 3ROUA 3TMOA 3CP2A 3MMYB 3VYSB 2QSGX 1ZYRF 2HYJA 1O3TA 4AIKA 3G71I 2LFBA 3Q5FA 1OR7C 2FU4A 4HF2A 2R7TA 4GO1A 2JWTA 2DA2A 2I10A 2A6HF 2STTA 1S5LC 1VQ9I 4CZCA 2VBXA 5FRMA 4A12A 5BOXA 1MBFA 2PQ8A 1F1ZA 3VB2A 1YW8A 2CU7A 3V8KA 1XDSA 1F4KA 1OYWA 2LVSA 3NWSA 2EINH 1IXRC 1OCPA 1R7JA 2E7WA 2WAEA 4MFEA 4RBOA 1E3OC 1TC3C 3MKYB 1HW5A 1YRNA 5DDGA 3GTMJ 1JTYA 1FBQA 3WG9A 1EH7A 2EK5A 2DN0A 4M72A 4PGGA 1PJRA 4E6KG 3QRFF 5H2FC 1VQ4I 4UUSB 4IHVA 2IS2A 2DMUA 5IYDJ 4JBAA 2P6SA 3OYFA 3BJAA 1IRFA 3DV8A 2ZXJA 2KHMA 1T33A 2PBIA 2WB1A 4Q47A 1BL0A 1D8JA 2D1HA 5IY5H 2WADA 4U0WA 2VASA 1BJAA 2XKOA 2UUZA 5CQGA 4G6QA 4JYKA 2AS5F 2P7VB 4RAFA 1JI8A 4RM3A 2DT5A 1HKSA 3EETA 2HOAA 2QBYA 2F6CA 5F08A 4AWXB 3IH3A 4X0GA 5L3FA 1ZRDA 1QPMA 1Z3YA 2QUFA 3H3UA 3I71A 2L4MA 4IF4A 3OYJA 2VLAA 5DUKA 5GAGJ 2EFPA 4G6TB 3LFUA 3RKWA 4O6JA 4M3BA 2EIMH 2OQGA 1FBUA 3KX2A 3KEYA 3W6VA 3EUHC 5BNGA 3DU5A 1ZG5A 2Y30A 3PNYA 1FTZA 4UXNA 4RB1A 1Q1VA 2CQKA 2FMLA 3GZ5A 2K9LA 5FO5A 4M6VA 1O57A 3MCZA 3OIOA 5B3SH 2P7CB 3SZGA 4CZZA 2AHQA 2EH3A 5J8CA 1FP2A 2ZBKA 3UNGC 1YJWI 4B3AA 4LGWA 3FBNB 1FBSA 1SFXA 3GMEA 2L9RA 4BHBA 1U3EM 4LFUA 1USSA 4Q5SF 2M3AA 3WGHA 5IP6A 2A6EF 3NRVA 1K83J 3S1MJ 1P9QC 1YIOA 1RR7A 3R0JA 2Y0MA 4HNUA 3E5UA 4ESBA 1W36D 1I3QJ 2E35A 4PZJA 4YIFA 2GA1A 1WI9A 3SDBA 4NC8A 4A3IJ 3GFLA 1O7FA 3P7NA 1U9NA 2COMA 2B7EA 2R92J 2HKXA 3CF2A 2K9MA 2LBFB 2H8WA 3OOUA 5JVGF 3FXRA 1G3SA 2OQRA 1YTYA 2EJRA 1IV6A 1JGSA 3R4KA 3RKXA 2MC4A 3HJEA 3BJOA 3DEWA 3ELKA 4F3QA 3BG9A 4XKBA 4BQNA 2VQHA 4L18B 2E19A 2BVMA 3BDDA 1G4DA 3GTOJ 5KAFC 1MGTA 3RSNA 2L5QA 1SVMA 2M45A 3N05A 1UB9A 1LUJB 3TOBA 1ULYA 3V8JA 4BJTA 4QLCU 3F8FA 4BY1J 3HOSA 4QWQA 1RRJA 3WTZA 3DP7A 3K4BA 2X6YA 1APLC 4BJ6C 2DTRA 2LC2A 1BIBA 3ZMDA 2ZMEC 3EYYA 5EJCA 2OF7A 1UG0A 1KQ0A 3LSRA 4ZTFA 1MW7A 1OISA 3Q0WA 1Y1VJ 3R60A 4Y52J 1RC9A 2EV5A 2BY1A 2M8EA 2HTSA 1BOAA 2VXDA 3KLNA 1GXPA 2FBIA 2JPBA 5TRDA 2JZYA 1VQLI 1MDMA 1I1GA 2ELJA 3HIFA 1D0XA 2GWRA 3ZP5A 1AHDP 1V5EA 2VKVA 2DFFA 2YPRA 1YITI 3GF2A 5DCMB 3DKWA 2CG4A 3SEZA 3UKGA 1T0FA 5CYVA 2CGPA 1ETKA 3OSFA 1HXDA 2V9PA 1TWGJ 1W4MA 2K9NA 4XKWA 5M3MJ 4IVNA 5J4YA 3FXMA 2FOWA 3DLAA 3JSPA 2KIMA 2KQRA 2LMDA 4M71A 2WAQA 2CQXA 4A3BJ 2FOKA 1N78A 1Z7UA 4XONA 4G12A 2STWA 1MJAA 3DBHB 1U5TC 3Q0UA 2QSHX 4HBLA 2IA0A 2MC3A 1JE8A 1DUXC 3BROA 4DYQA 3L2CA 1ZRFA 3E3VA 1K61A 4BQOA 3WTYC 1R00A 1S9HA 3CUQC 2LKXA 1ZLJA 4V2FA 3DU6A 4B8XA 5LFAA 1E2XA 1TT0A 1MMNA 1P4AA 1MMGA 1QRYA 1AU7A 3F6OA 2LY1A 3HZJA 3S1RJ 4II2A 3PM1A 2UXNA 3OYAA 3NEUA 4OWRB 4FE7A 1G3TA 3T8TA 4N9HA 4E7IA 4NQWA 1XS9A 4E7JA 2HQ5A 2OBPA 3HOXJ 5AIQA 1R23A 2LF7A 2C6YA 1JJ6C 3OYNA 2DT7B 3TP3A 3A01B 3IWZA 3ZN0A 5EDNA 2F2EA 4BU2A 2KMUA 3CJRB 2BGCA 5E8IA 2ZMEB 2Y31A 1I1SA 1D8KA 2CQQA 1QVTA 3NQOA 4YEJA 4FHTA 1O3QA 3BTIA 2FNPA 1RZ4A 2L7ZA 4A3LJ 1SVOA 1SD5A 1POGA 2W25A 2IA2A 3M9AA 3W2WA 5C3EJ 4PFOA 2WY7Q 4F7ZA 5HDKA 3G73A 3VYTB 2V1NA 4XNFA 1QZYA 2VPRA 2Z2SB 3K6GA 3F72A 2OD5A 4JQFA 1FSHA 3Q9VA 4HSTA 4I99C 5HNFA 3HTSB 3S93A 5EG0B 2HXOA 3LSMA 3OL4A 1H9GA 2VIXA 4OIOF 3K0LA 1FYLA 4MHGA 4XN0A 2HPMA 2E36A 4IZZA 3ECOA 1T39A 2YUSA 5CLSA 4HPQA 4HV6A 1P2FA 1GLNA 3A02A 1U6GA 3I9V2 3T8RA 1Y0UA 3WTTC 1OJLA 2KIFA 2B9SA 2JRMA 3HBLA 4ZYDA 4WX9A 4ZTJA 2FMYA 1JKQC 2MSYA 4S04A 1SD7A 1BI0A 2XRLA 2Z9OA 1U5TB 1ZN2A 2K27A 3BZ6A 3I64A 5E79C 1T38A 5F1JA 2DT6A 4J19A 3JRIA 3VYUB 3CUQB 4CYCA 3PIPF 2DJNA 2I8DA 3F8MA 3KYCB 1FEXA 1HW2A 3F6VA 2X6WA 4Y33A 4LLLA 2XGEA 3K70D 1FYMA 1GUUA 2F5CA 1O3SA 3ZQHA 3TQNA 1W0UA 2KFDA 1WJCA 2P8TA 3BPXA 1CQTA 2OU2A 3PUBA 4AUXA 3K4KA 3I55I 2XKPA 2COBA 2VBZA 3H5AA 5EEAA 4CHUA 5DYMA 2EB7A 4QIWN 1AWCA 3OS2A 3W3CA 1HQCA 4GYGA 1IN5A 2JSCA 3TBIA 5EZGA 4UV9A 3CMEI 4L9TA 2JUGA 3CQZJ 1IUFA 3J7AY 2RGVA 5KVRA 1V5FA 2BOLA 4PFPA 1IXSB 1FX7A 1GV2A 4RB2C 4P55A 1ZTRA 4RAGA 2RREA 1N25A 1LDJA 3SZPA 5E3NA 4DNCA 2KRHA 2CUEA 1PUEE 5F6FA 3SZTA 3L2WA 3L7WA 2E71A 5LRRA 1D1BA 4Z6YA 1R58A 3PQJA 5L3GA 1QVUA 5J3LA 1ZRCA 3MVPA 3BPVA 2VJ4A 2XAUA 3AAFA 2VODA 4M6YA 1H89C 4RB0A 3CCQI 2QLZA 5F27A 4FTHA 2HXIA 1XC5A 2HYFA 2E1CA 3O3KA 4YG2F 1WZ2A 1J5YA 1DU6A 1P4XA 3FIWA 4XQFA 4RS8A 1HDPA 2R4GA 3GLLA 4XK4A 5F0FA 2LG4A 4PJLA 3E7LA 1EH6A 2ACJA 1JUMA 2XGCA 4ABZA 5C4JJ 4B47A 2IRFG 1FSEA 2M8GX 2MH2A 3BWGA 1UZCA 4PGHA 3OS1A 2VE9A 2RQQA 1FMVA 2DMNA 2MA3A 2XF6A 2ZJ2A 3HGYA 4BAYA 1MBJA 3JRDA 1WJAA 3R0AA 1MZBA 3HB9A 2P5LC 5L3BA 3GWZA 1UCRA 4BE0A 2FRHA 2RNJA 2H6CA 2W57A 2OA4A 4D9JA 2DYRH 1T2KA 4P96A 3QYFA 2B0LA 2EIKH 5M5WJ 3DEUA 5K7HA 2VJJA 2AXTC 3ZN1A 1QBJA 2XSDC 2DFIA 3BR3A 4L0YB 1KZHA 2JK3A 3RTRA 4MTDA 3V8LA 2EV6A 1SFKA 2RAEA 3I54A 5FFZA 2DJIA 3DTKA 3WTUC 1FMWA 2E1NA 1MNMC 2OCEA 3H92A 2DTZA 3H3ZA 4KISA 3GFIA 4D5CA 5D4RA 1MMAA 1TLHB 1F43A 4I0AA 2NOGA 2HVSA 3PFYA 1BM9A 3MD2A 4HOBA 4NC6A 4BXUA 2UZKA 1DGWY 4OMZA 5L3EA 4OOIA 4F52A 1B9MA 2HVRA 3JCUC 3OYDA 4IQJA 1RUOA 3PUFA 3KP7A 4NQWB 3MKWB 4I2OA 1R36A 2P81A 3OYBA 2EZLA 3K1PA 1GDTA 2XROA 3S1QJ 2QM3A 3U9GA 2QKLB 2QA4I 2VQGA 3EDPA 2K3FA 3B6AA 3HOTA 2O6GE 2W00A 1QHHD 4PJJA 4CSWA 2FXAA 3K4JA 4AM3A 3CJQB 3PFIA 3CMAI 4KNYA 2Y0SA 1ZKGA 4C2UA 4GXOA 1YW7A 2ID3A 2NNNA 3PO2J 3IHUA 4R79A 1DU0A 5A2QK 4V2GA 3QODA 3CF5F 2QQAA 2LK2A 2EFQA 4I6ZA 3LA2A 3MEXA 5IYCJ 1Z67A 1XMKA 4XKVA 2NOJB 2GM4A 1MMSA 3JRHA 2QF7A 3IAM2 3K1NA 5F1RA 3GTPJ 2FA5A 2E2IJ 3PSFA 2XIGA 3A4CA 3SFIA 3ML6A 4RAZA 4M3GA 2R7UA 3PIOF 4NBQA 2L3DA 3A0HC 3J80K 3GVAA 4IXAA 2L9SA 1OCZH 1R5HA 1R71A 1WCMJ 2GIVA 4C3JJ 3FHZA 3F22A 5KK1A 2EIJH 1IGNA 3F8CA 3N97A 4E7KA 2BXZA 3E0JB 1W36C 1I50J 1SD6A 3DTEA 5C4XJ 3DTIA 3FXKA 3CO6C 3OYGA 3DQVC 3H3VK 4F55A 4U0VA 2PMZA 2PMUA 2CSOA 3WTWC 2IT0A 2ZJRF 4H0EA 3LSPA 3ZOBA 1YS7A 3TP0A 1EA3A 4HLXA 4YIRX 2X1DA 2K4BA 2LLKA 1RPWA 3NWTA 3HRMA 3TDUC 4G6DA 2YU9J 4BJ5C 2L7MP 2DA3A 3X2QH 3K4LA 3K9TA 3GZ6A 4AIJA 1H0MA 2FBKA 1TWCJ 4WF2A 4HG2A 4ZDOA 4UY8I 4I09A 4RM2A 4UB8C 4O3MA 4U88A 3CCMI 1TWHJ 2P4WA 2IW5A 2MD5A 2EFOA 2R5YA 2JA2A 2M1BA 3OS0A 1BI3A 1YYVA 3K69A 4CO8A 4K2EA 2FEZA 1ZG3A 4F93B 3MFKA 3HUGA 1ZELA 3HOWJ 1TQIA 5HODA 1KONA 2XAHA 5CVRA 2DU9A 3C18A 4DYCA 2V7FA 3KP4A 3JR9A 3BR0A 4J01A 3VODA 2FJ1A 4KMFA 4LG0A 5EGOB 3V7CA 2EA4A 2OC6A 4O5VA 2VKEA 4OINF 4YFKF 3ECHA 2KJBA 4OIRF 2D1VA 5EEGA 3GX4X 2O3FA 2HOSA 5IT9K 1XN7A 3NAUA 2L7KA 3PO3J 2DA5A 1RKTA 3E6MA 2ZKZA 5E20A 3MKLA 1XD7A 2H8RA 3K7AJ 1SEUA 1B4AA 1KU7A 2KJCA 2DOEA 1XGSA 1KQ9A 4BXXJ 4UVBA 4HW0A 4HAMA 4QTRA 4FASD 3A0BC 3KYDB 2WWYA 2QVOA 1WWXA 2VC0A 2R7XA 4YFXF 1K7AA 2OAZA 3TW7A 3FXOA 5GP9A 4KT5C 2DA6A 1SANA 2XUBA 4JK1X 4PDKA 2Z1DA 1JHFA 5D5WB 3HPGA 2X48A 3RYPA 5GAHJ 4OIPF 3JW4A 4BEHA 3CLQA 3ZQIA 4D5FA 2V1DA 3OYKA 1W7PB 3B73A 3OR2C 4YIIA 1NH3A 1WI3A 4KITB 1P4WA 5BPIA 5JI6A 3LSTA 2DLLA 2HOTA 1VQNI 1X2MA 2XPVA 3EUAA 4XLPF 4BH9A 2Z3YA 2L01A 3OR1C 4CUGA 2PJRB 4U0YA 3BTLA 4LK0F 1ETWA 4HNTA 1O4XA 3ZQGA 3RQ4A 2Q2EA 3OY9A 4IX7A 1KYWA 1XSVA 1G2HA 3TOAA 3S2HJ 3GW2A 2BXYA 2VUMJ 5K5QA 1MH3A 1X19A 1TL8A 2EZHA 5AIPA 1PYVA 3T5XA 1BIAA 1XSDA 4YFNF 2NXNB 4EM0B 3HHHA 1Y8RB 2Y48A 3GZNB 3O6BB 3SFZA 3LMMA 2HEOA 4UVCA 4IHWA 4ENKA 3H0GJ 5B5EC 1ETYA 2BY0A 2FX0A 1X2NA 2FNAA 1R9TJ 1UFMA 2GA2A 3W2VA 5DD8A 2I5UA 3K10A 5LGUA 2VC1A 3H9QA 1Z3XA 4B48A 2VJ5A 2ZSHB 2HZTA 1PP8F 4M3DA 2CUJA 1RIOH 2M30A 2IP2A 3ASOH 5A2QZ 1BW5A 2ZCWA 2XAFA 2Y69H 4LD5A 2NVYJ 1XGMA 1G3WA 2UXXA 1FOWA 3ASNH 3ERED 2OPTA 1YX5A 3MQ0A 4ZZDA 4RAYA 4ZZLA 2R7DA 5LEJA 1RESA 3I58A 5LLQA 1L3LA 2QQBA 1I27A 1KYZA 2CW7A 3LAPA 3CCLI 4A3CJ 3OMYA 3ZQFA 1YW9A 3GUDA 3GYHX 3CCEI 3K70C 4IRGA 3ZQQA 3LNQA 2VOOA 2QWWA 1P6RA 1QA6A 2X51A 1S6LA 2PI0A 2DA4A 2O0YA 5TISC 2Q8KA 3IH2A 1VFCA 1X1PA 1JKOC 2H94A 4UUVA 2DQLA 1PUFA 1Z7LA 4NC7A 1LFBA 4A3KJ 1J59A 4ZJZA 1LPQA 3LWFA 2AQFA 1R5ID 4FCYA 1FPQA 3MZ8A 1BI2A 3CDHA 3J7YJ 2V6EA 3ABLH 2ZB9A 5LHHA 3FXLA 2MABA 3HSRA 4IHTA 3J81K 1MBKA 2EFNA 4XLCA 3RCOA 4MIMA 2ELHA 2DDAA 3FMRA 4DJAA 3FZVA 3ABTA 1ZGAA 1MKMA 1R1VA 5HLIA 2A69F 3BR1A 2MG4A 5BMZA 2V79A 1EH8A 1GHCA 1GVDA 4I0BA 4ESJA 3MN2A 5K1YA 1B72A 4RMNA 5HLTA 4D7MA 3C2BA 1VQMI 1MBEA 1UMQA 2V26A 3BC8A 3DWLE 3SEQA 1D1CA 1U2WA 3VSKA 4XLEA 4ENMA 2NVUB 3Q9SA 5FD5A 4V19K 3K2AA 3JRAA 1Y56A 2RDPA 2R5YB 2MLGA 2R5ZA 4HQEA 1W1WE 2WAFA 3DPUA 2K86A 2R7OA 4MLOA 2B63J 3DKYA 2JA6J 2RN7A 1ZARA 2EFWA 3ZPLA 4KA4A 2Z33A 2HDCA 2LTPA 3H1CA 1X1BA 2LH9A 2OV7A 3HSFA 1SMYF 4XN3A 2KRCA 4E7LA 1ZGJA 1V5GA 2HWVA 4IHXA 3RI4A 2KP6A 1TZLA 2LRDA 4AVPA 2KRFA 2H27A 1BOBA 2CUZA 4AD9A 1WKMA 1BC7C 4HX7A 4AVZA 3SHFA 2GQQA 3VPRA 1IRXA 3BG5A 5F0HA 3H36A 2GXAA 3RPQA 2JRTA 4BL0B 2XPUA 5JHFA 2XF5A 3M1CA 4G9YA 4RB3C 4EV0A 2NS0A 4DW6A 4MEYF 5DV5A 5EYRA 5E18F 2O61A 4BQQA 2X1EA 1OCOH 4XRSA 1WRJA 1OCTC 5FKNA 1YLFA 3LAJA 5DD4A 2K02A 2Y9YA 5H6RA 1QHGA 4HNVA 3JRFA 3AL0C 2VJIA 3CUOA 2XB5A 3QPHA 3K4NA 1K78A 1XDUA 1YHQI 5M5XJ 1VZ0A 1W5SA 3QPSA 1H8AC 3JRCA 3LOCA 1HW1A 1ZR4A 2XRNA 2E5NA 2BY3A 3CCYA 3PNTA 4MGRA 4OU0A 4DIQA 1WPKA 3O2PE 4EM2A 3GBGA 5LD2C 5FKLA 3CP8A 4TV7A 4ZDLA 4I7HA 4WCGA 3SJMA 4L0ZB 3VYRB 1WQ2A 3L2RA 1QZEA 4FX0A 2YU3A 2MFZA 3FM3A 1W5CC 4AYBA 4DOZA 1B8IA 2ZNYA 1X1DA 3RPUD 1YRNB 3OL3A 1HA8A 1Z0XA 2NRAC 4A3JJ 3HHGA 2J5OA 2R3SA 5CVVA 5D8KB 2HQAA 4HDUA 1X1AA 4IOCF 2ISZA 1SD4A 1MBHA 2R7SA 1RR8C 3F23A 1Y6IA 3GTGJ 2GIZA 3AFHA 4Y17A 2D2WA 1LFPA 1TNTA 3VWBA 1AOYA 5DCFA 2W82A 2O7OA 5HOOA 2QBYB 2A5WA 1ENHA 3OYCA 5HLHA 2ZJPF 1IN4A 3I4PA 3I4NJ 2ELKA 1HF0A 1HKTA 1JT6A 2OZUA 2PN6A 2Z99A 4NNJA 4A3DJ 2PLYA 4L9VA 4W97A 4J00A 3LSIA 1XSXA 4EJUA 4FETA 4I02A 2HNHA 5GTHC 2KKOA 4WWCA 1T08B 5D6FA 2R7ZJ 1DPUA 4X6AJ 4N0BA 2WB1N 3ZQ7A 4ETSA 1OLTA 4M73A 4IO9F 1I5ZA 1OCCH 3TO6A 1WVRA 4PSWA 3KEQA 2A68F 3U21A 2KDZA 5DTDA 5ICEA 4BS9A 1UHMA 2ZXIA 2ESHA 1LE8A 3FF5A 2HVQA 2K40A 4A0ZA 1T0FC 1YI2I 2IPQX 1FLIA 3QP5A 3AL0B 2HQRA 3QPLA 2CUFA 4WXDA 1C0WA 3OV8A 1LJ9A 3TDZC 1USTA 2G9WA 2CH0A 2JN6A 1NK3P 2XPWA 3M8JA 5E3OA 2K9QA 2IEKA 3S8PA 3HKZA 1Z91A 4L5IA 5JR3A 3S2WA 2L9NA 1WJ5A 3GFJA 1LQ1A 4I98B 1OMIA 2GAUA 2R7FA 2RVCA 1DGRM 1SMTA 1X3ZB 4S0HB 3KIOA 1I6HJ 3IH4A 3RJPA 4U7DA 4OIQF 4Y4RA 4DYRA 2O8XA 3A1YA 1FWZA 2DYSH 5D5VB 1OFCX 3DEEA 3MZYA 3J7ZI 1QGPA 5HDGA 1VQ5I 1ETQA 5DS9A 1CF7A 2GXBA 5TGTA 4KDPA 2FQ3A 4HRIA 1R22A 2CS3A 1B1BA 3BP8A 3I4MJ 2KIQA 1J09A 4M9ZA 3ZCOA 1G59A 4RLQA 2DODA 5IOYA 2CV1A 2V1XA 2EQRA 1QZZA 4CGZA 2JSPA 4HX4A 3RZOJ 4S05A 2Y2ZA 3ZRGA 3HPHA 4EJTA 3CLOA 2HI3A 1B72B 1AA7A 2ISYA 3CZ6A 2CJJA 2F48A 4M74A 1N75A 4A5NA 1MDMB 1HSJA 1IW7F 3ZMUA 5IPAA 1HC8A 4CCMA 1D5YA 2X6OA 4D7NA 2PX9A 4UHTA 2A6TA 4LITA 2Q1ZB 2WY8Q 2KL4A 3G4SI 5FJ8J 2VB6A 3JTGA 2P5KA 2W24A 3TW6A 2NYXA 4BBRJ 3QQAA 2JT1A 1AKHA 3OOPA 1EKEA 5CVIA 3J7AO 5HS8A 2HTJA 3I59A 1OQYA 2WA0A 1K79A 1XX5A 3FMQA 3IV5A 2RQPA 5M3FJ 3FKIJ 2M2EA 2CFOA 3C7JA 2FE3A 3G3ZA 2K5CA 3TO7A 1TWAJ 4LG3A 4ZH4F 4HSRA 3K2ZA 3IRRA 6PAXA 2XAJA 5K5OA 3ISPA 4CCJA 3HRUA 3CCVI 2CW8A 2GOMA 1VQPI 1D0ZA 2CV2A 3FM5A 2CW0F 3HG9A 4BYYA 9ANTA 2L02A 1O3RA 3D5SC 3RZDJ 3G2BA 3GCMA 3M07A 1IAWA 5B1BH 2WAQN 3HRTA 3GLXA 2IGOA 3E1SA 3E6DA 4XKCA 3SXYA 4MFDA 3L2QA 3CJNA 2X9DA 1VQOI 2DPUA 2YX4A 1DPRA 1FIAA 4MTEA 1S7EA 1QO0D 2G7HA 4HV5A 1YX3A 3SYTA 2LY2A 1STZA 5IYBJ 3CO7C 3L00A 4ZYHA 5ILSA 1J9IA 3MZHA 1JUSA 2IBDA 4JOMA 2OUMA 2ETHA 2MD0A 2W7NA 3D0SA 3M4OJ 3L2UA 2HU9A 4EQQA 2QYOA 1B8IB 2ZFUA 1D3YA 3MWMA 5FKMA 4BKXA 2HKOA 2TDXA 5BS6A 5KNLA 2CMPA 1HOMA 4ANJA 2QKMB 3CDIA 5E17F 4BXFA 2TRTA 1DP3A 1YO5C 1LDKB 2EZIA 3BG7A 2UV1A 3WODF 4PJMA 3JAMK 3I0TA 1XMXA 2MLKA 3L1PA 2L4AA 1CGPA 5J8FA 1ON2A 3WTXC 2X85A 5F0CA 2H1LA 2W48A 3W6JB 1YFHA 4CH7A 1UJ8A 3LL7A 4C9YA 1Y8QB 1OYIA 1GV5A 4LLNA 4G7ZF 1OR7A 4OAYA 3BTCA 3QWLA 1VQ6I 3GTLJ 4P1WA 2PMHA 3M8EA 1ETXA 3P5JA 1E3PA 1WH5A 4KUMA 5HS9A 2LBFA 4C3IJ 3B02A 3KP6A 4IRHA 4II3A 4BUPA 4CYCB 2O8KA 5JVTA 1P7IA 4F91B 4XBFA 3A2KA 4IRIA 1IXCA 5L3CA 1VNDA 2R7VA 1MIJA 4LOCA 4B44A 2LSOA 1RI7A 1ZK8A 1KU9A 3RPUA 3WU0A 3RKYA 4A0XA 1LB2A 4KICA 2J5PA 2XB0X 2M7BA 2M87A 1LEBA 1MBGA 2XDVA 3HC7A 3FK6A 2JVGA 2H1KA 4EGYA 2F5DA 5KHDA 1JJ8C 2JQ7A 3ZQCA 4EM1A 3K4MA 4XRFA 2M4GA 3OIQA 1IV8A 2M0MA 4FE4A 1WJBA 4E4HA 2ZXHA 3W6KB 4RGSA 2BHZA 1S7AA 4OAZA 5F04A 2X4HA 3FXUA 1FY7A 5ILUA 2YSRA 1P92A 2EPFA 3HGGA 1R5GA 4GGGA 2MH9A 3KP2A 1U9OA 1FT9A 4LJZF 1MJBA 3K1MA 4LIVA 5JHUA 1F36A 2LD5A 2VQCA 1IG7A 2XHKA 3M1EA 5DCMA 1T8IA 4Z2YA 4Y15A 1LNWA 1ZAOA 5HVQC 2WV0A 4CCNA 2PEXA 4I76A 2DA1A 1SAUA 5FROA 5J1RA 1XB4A 4ENNA 2IA1A 1IC8A 3EPZA 1SVLA 2DW4A 3MAJA 3PJRA 3GO5A 3KP5A 2WTEA 3S16J 1G8XA 1IF1A 2DO7A 3WTVC 2CO5A 1VF9A 3ULQB 3CCUI 5J47A 1B59A 4NHJA 5BQTA 2VXZA 1U8BA 1DDNA 1BBYA 3CDLA 2MGQA 3VEPA 4CCKA 2XASA 1Y1WJ 4N4NB 3LSHA 2A07F 4CXFA 1JT0A 2ZO4A 2YR2A 2LREA 4EMSA 5DM6F 3HL2A 1VI0A 1E17A 3LQRA 3P9KA 5K7ZA 1Y39A 5FD6A 2M4KA 4WXHA 4DBQA 4R1HA 3HEFA 1U0JA 4LB6B 3H0DA 4XOPA 1YQAA 2WBMA 3R61A 1SFEA 2DFEA 3CMMA 4RDUA 3CCSI 4BBSJ 4ON0A 1XTAA 2TCTA 3TEDA 4GFBA 1VQ8I 1WHUA 2FUG2 4LLGF 2QQ9A 3KFWX 4C2TA 4XSXF 3CC7I 3OYIA 1MH4A 3A01A 4XICA 2LYCA 1YS6A 3H9JA 2CRGA 1REPC 2ZMEA 3SQNA 1V4RA 2O03A 1ON1A 4HEA2 3T0YA 2HR3A 4UV8A 1UG2A 1YJNI 5D4SA 2H6BA 5E1XA 3IWFA 4XLHA 2UWMA 4KJZA 4YRVA 5K5RA 4BGDA 2XGXA 1UHWA 3KP3A 1K4SA 2E2JJ 3G1OA 3BG3A 3ABUA 3ZR8X 5EG0A 4IHYA 3DXJF 3VSLA 4HX8A 2EWNA 4A6EA 5J1YA 1YE9A 5JFRA 1R6RA 3CC2I 2W85A 1T98A 2VONA 5ED4A 3WHBA 4DZPA 2O9LA 3ONQA 3EUKL 1R49A 2DMPA 1A36A 4UVAA 1JKPC 2D5VA 1XCVA 2G0EA 2FBHA 3KEOA 3QP6A 2JVHA 1Z21A 2FD5A 3S32A 3ZMZA 4EGZA 4FX4A 3HOVJ 3BR5A 1TW2A 1U5TA 5H6QA 3DCFA 2MYSA 2F4IA 4NUBA 2E1OA 3M8FA 1I39A 3TL4X 2XAQA 3IUOA 4EEFG 2IGNA 3CUQA 3IKVA 2CV0A 3JAMZ 1Z6RA 3S1NJ 3GTKJ 3WE3A 2K85A 3QOEA 1EV7A 3J80Z 3WHCA 1A35A 3KPHA 2HDDA 4GRIA 5DEQA 1BC8C 3HDDA 3DF8A 1T95A 5D5XB 1YIJI 3VOEA 3FK7A 5D5UB 4KFCA 1M1EB 1EJ9A 4B43A 3BOQA 4MO7A 4N9IA 2F4OB 3JRBA 2VN2A 4GDFA 1ZG1A 2Y0SN 3BCAA 1D5VA 1OPCA 3F8BA 2D45A 1B9NA 5F64A 1LKXA 1K6OA 3WGIA 4IJAA 1K4TA 4QSHA 2HFHA 3DLLF 2R7WA 1VQ7I 1TT5B 3ZMVA 3IRQA 5EF6A 3VFZA 5CVUA 4ASNA 1FYKA 2CQNA 3HOUJ 1MSEC 2KISA 2ME6A 3WU1B 2OTJI 1W7PD 1A6IA 3OIPA 4CCLA 3IC7A 3C1DA 1XMAA 1OYYA 2JA8J 4BDYA 3E97A 1KGSA 3D1NI 4IKFA 3KLOA 3PQKA 4A3GJ 5C44J 1GT0C 1WJDA 2FQ4A 2ZJQF 3BZKA 4D1QA 1KU3A 3ZMSA 4ESFA 1HBXG 2LY9A 5AONA 1Y0NA 3GTJJ 2PMZN 2DFHA 3DBRB 3BR6A 3REOA 4BHCA 4D0PA 4EJWA 3OYEA 2NS7A 4Q4ZF 1SFUA 2DOAA 1TQPA 1R1TA 4ZYAA 1L0OC 2IGMA 3H5NA 3HUGB 2V4JC 3U2RA 2Z16A 1PVEA 3IP4B 2HQNA 4A3EJ 4A93J 3QYEA 1PP7U 1RETA 4A6DA 3CTAA 4JX5A 4MQ9F 3WU2C 1QNTA 1RNLA 2K4JA 4CICA 5IT9Z 4RGRA 1X4PA 2AQEA
chains in the Genus database with same CATH topology
5IYCJ 4XIDA 2CU7A 2GM4A 1W0TA 2LVSA 3JRHA 1OFCX 2QF7A 1OCPA 3GTPJ 4MFEA 4RBOA 1E3OC 1TC3C 2E2IJ 1YRNA 3GTMJ 3SFIA 1JTYA 2LP0A 4M3GA 1ETQA 5DS9A 2DN0A 3OSGA 4M3FA 4IHVA 4UUSB 2DMUA 5IYDJ 1T56A 1T33A 1BL0A 3I4MJ 1WCMJ 4C3JJ 3HM5A 2YS9A 2E2HJ 2AO9A 4JYKA 4JX4A 1IGNA 4FISA 4AC0A 1ORKA 2HOAA 4X1EA 5IOYA 5F08A 1I50J 3IH3A 5C4XJ 2EQRA 3H3VK 3RZOJ 5GPAA 4B4CA 2Y2ZA 4M3BA 3LSPA 3ZOBA 2HI3A 3TP0A 1B72B 3W6VA 5BNGA 1FTTA 2CJJA 2Y30A 1FTZA 2LLKA 1RPWA 2M9HA 1Q1VA 5IPAA 3NARA 2YU9J 4M6VA 2L7MP 1FIPA 2EBIA 1D5YA 1WGXA 2DA3A 2X6OA 4D7NA 5M5YJ 3OIOA 1JKRC 2M0CA 5FJ8J 2AHQA 2EH3A 3Q3SA 1TWCJ 5IP9J 1ZR2A 3TW6A 1HLVA 2VI6A 4B3AA 4BBRJ 3QQAA 5E3LA 2MW8A 1AKHA 2L9RA 1TWHJ 1IDYA 2R5YA 3G1MA 5IP6A 1IRZA 1K83J 3IV5A 3S1MJ 3HOWJ 2KT0A 5M3FJ 1RR7A 4C3HJ 3FKIJ 2M2EA 1I3QJ 2JJ7A 2ECBA 5HODA 2M34A 4A3IJ 1TWAJ 1U78A 1BW6A 4DYCA 1U9NA 3JR9A 3BR0A 2R92J 2FJ1A 3OOUA 4W1UA 5EGOB 2Y9ZA 1IV6A 2VKEA 3BQYA 3GTQJ 9ANTA 3DEWA 3BG9A 3RKQA 3RZDJ 2HOSA 1BJZA 2E19A 3GTOJ 2WAQN 3JREA 3NAUA 3PO3J 2DA5A 1RKTA 3MKLA 2H8RA 3M3YJ 3K7AJ 4MFDA 1JGGA 4Y7NJ 2X9DA 4BY1J 1FIAA 1S7EA 4BXXJ 1APLC 3BTJA 4QTRA 5IYBJ 2OF7A 4B1RA 3TW7A 3LSRA 2NVQJ 5GP9A 3Q0WA 4IEJA 2DA6A 1SANA 1Y1VJ 1TWFJ 4C2MJ 4Y52J 2X48A 5J1UA 5E3MA 1JUSA 2IBDA 3ZQLA 4D5FA 3LSJA 3ZQIA 5FLMJ 3M4OJ 1B8IB 5FKMA 4BKXA 1WI3A 1HOMA 1PUFB 2HOTA 1X2MA 2XPVA 1AHDP 2VKVA 2TRTA 2IAIA 2EZIA 3BTLA 1ETWA 3UKGA 1O4XA 1ETKA 3ZQGA 3OSFA 5M3MJ 1TWGJ 2K9NA 4L5EA 3L1PA 3CMYA 1ZQ3P 1G2HA 5F0CA 3S2HJ 2W48A 3JRGA 2VUMJ 2DMQA 3F0CA 2CQXA 1MH3A 4A3BJ 1GV5A 2EZHA 4G12A 3Q0UA 3BTCA 4DYQA 3GTLJ 5EZHA 1K61A 1ETXA 1WH5A 4IHWA 3H0GJ 4C3IJ 2LKXA 2XGDA 2N8GA 4V2FA 4CYCB 2O8KA 2R93J 5EGOA 1P7IA 1ETYA 3RQIA 2FX0A 1X2NA 1R9TJ 1QRYA 1AU7A 2JMWA 2DA7A 3S1RJ 1VNDA 4LOCA 2QCOA 3PM1A 4FE7A 1ZK8A 3HOZJ 4A69C 4M3DA 1NK2P 1XS9A 2HQ5A 2XB0X 3HOXJ 1BW5A 1JJ6C 2ID6A 1MBGA 2R5ZB 3S17J 3FK6A 3TP3A 2NVYJ 3A01B 5EDNA 2H1KA 1X58A 2K9SA 3O8HA 2OPTA 1JJ8C 3ZQCA 4M3EA 3O8GA 2Y31A 2CQQA 1QVTA 4DZJA 3BTIA 4FE4A 2JA5J 2L7ZA 4A3LJ 1RESA 1EF4A 1POGA 4A3CJ 3ZQFA 3BQZA 5C3EJ 5F04A 2VPRA 2LR8A 3SDGA 3LNQA 3HGGA 3S2DJ 1U9OA 2GLOA 2DA4A 1JKOC 3IH2A 1VFCA 1WH7A 5EG0B 2HXOA 1BA5A 1PUFA 1IJWC 1F36A 2LD5A 1ZGWA 2NVXJ 1LFBA 1IG7A 4A3KJ 3A03A 3S15J 2YUSA 4FCYA 4I76A 2DA1A 3A02A 5J1RA 5JLXA 5JLWA 4UUSA 1OJLA 1IC8A 2ZB9A 3LSGA 3HBLA 1MBKA 3S16J 1JKQC 2MSYA 1VF9A 1HDDC 4MIMA 2XRLA 2NS8A 1U8BA 3CDLA 5F1JA 2MGQA 4J19A 3BR1A 1A5JA 2GBYA 3JRIA 2MG4A 4NDLA 1Y1WJ 1NTCA 4CYCA 1JT0A 2DJNA 1FEXA 1GVDA 1VI0A 2XGEA 5K7ZA 1GUUA 3S14J 2R0QC 3MN2A 1B72A 3HEFA 1UHSA 3C2BA 3ZQHA 4D7MA 1W0UA 4RDUA 1MBEA 1UMQA 1CQTA 4AUXA 4BBSJ 2ECCA 2TCTA 2COBA 3TEDA 4GFBA 3K2AA 5FKKA 5EEAA 3JRAA 3BT9A 2R5YB 2R5ZA 4QIWN 4MLOA 2B63J 1MH4A 3A01A 2JA6J 4XICA 2LTPA 2CRGA 3HOYJ 5EZGA 2ME0A 3G1LA 5FKOA 1UG2A 1IUFA 3CQZJ 4IHXA 1SFOJ 1GV2A 4AYBN 1ZTRA 1Z77A 1RKWA 5E3NA 2CUEA 3VPRA 2E2JJ 3G1OA 5IP7J 5GPCA 3BG3A 1FJLA 5EG0A 1QVUA 3BG5A 3Q0VA 4IHYA 5F0HA 5J3LA 1ETVA 3MVPA 2XPUA 5J1YA 4DW6A 5EYRA 1H89C 3WHBA 4DZPA 2O9LA 2DMPA 5F27A 4XRSA 4FTHA 1LE8B 1JKPC 1OCTC 5FLVA 2D5VA 2G0EA 2HXIA 5FKNA 1XC5A 2Y9YA 3JRFA 4HNVA 2FD5A 2XB5A 2DMTA 3HOVJ 3BR5A 1DU6A 3FIWA 5M5XJ 1H8AC 3QPSA 4UUTA 3JRCA 3LOCA 1HDPA 3DCFA 4XK4A 5F0FA 1ZR4A 3E7LA 1JUMA 3CCYA 2XGCA 2E1OA 4ABZA 5C4JJ 1WPKA 4EEFG 3GBGA 2M8GX 4JX6A 5FKLA 1JTXA 3S1NJ 2L7FP 3GTKJ 3HGYA 2DMNA 3SJMA 1IDZA 1MBJA 1MSFC 2NVTJ 3JRDA 3WHCA 2HDDA 3HDDA 3HB9A 3FK7A 1B8IA 2L0KA 1YRNB 4XRMA 4MO7A 1QPIA 1Z0XA 4A3JJ 3JRBA 3HKZN 2Y0SN 1MBHA 5M5WJ 5K7HA 3GTGJ 2XSDC 1XG1A 3BR3A 2JK3A 4XRSG 3B6CA 2RAEA 4A3MJ 5IOZA 4QSHA 2O7OA 1MNMC 2DTZA 5K7FA 1ENHA 1HCRA 3BR2A 3I4NJ 4D5CA 2ELKA 1HF0A 5EF6A 1JT6A 1F43A 4A3DJ 3HOUJ 2NOGA 4W97A 2ME6A 1MSEC 3FISA 1JUPA 1ITYA 1A6IA 2R7ZJ 1H88C 4X6AJ 2WB1N 2JA8J 1P7JA 2KDZA 2WV1A 2P81A 3D1NI 2EZLA 5DTDA 4A3GJ 1GDTA 5C44J 4A3FJ 1GT0C 3S1QJ 2FQ4A 1LE8A 2K40A 2LY9A 3B6AA 2JA7J 1AKHB 2EZKA 1LFUP 3GTJJ 4BY7J 2PMZN 3QPLA 2CUFA 1ETOA 4JP0A 3BR6A 2NS7A 2JN6A 1NK3P 2XPWA 5E3OA 2K9QA 2IEKA 2HYJA 1ZKGA 4A3EJ 2ID3A 4A93J 2LFBA 4S0HB 1RETA 3PO2J 1DU0A 4JX5A 2JWTA 2DA2A 2I10A 1I6HJ 3IH4A 4V2GA 4I6ZA 2LK2A 4DYRA 1MBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYC J;  4XID A;  2CU7 A;  2GM4 A;  1W0T A;  2LVS A;  3JRH A;  1OFC X;  2QF7 A;  1OCP A;  3GTP J;  4MFE A;  4RBO A;  1E3O C;  1TC3 C;  2E2I J;  1YRN A;  3GTM J;  3SFI A;  1JTY A;  2LP0 A;  4M3G A;  1ETQ A;  5DS9 A;  2DN0 A;  3OSG A;  4M3F A;  4IHV A;  4UUS B;  2DMU A;  5IYD J;  1T56 A;  1T33 A;  1BL0 A;  3I4M J;  1WCM J;  4C3J J;  3HM5 A;  2YS9 A;  2E2H J;  2AO9 A;  4JYK A;  4JX4 A;  1IGN A;  4FIS A;  4AC0 A;  1ORK A;  2HOA A;  4X1E A;  5IOY A;  5F08 A;  1I50 J;  3IH3 A;  5C4X J;  2EQR A;  3H3V K;  3RZO J;  5GPA A;  4B4C A;  2Y2Z A;  4M3B A;  3LSP A;  3ZOB A;  2HI3 A;  3TP0 A;  1B72 B;  3W6V A;  5BNG A;  1FTT A;  2CJJ A;  2Y30 A;  1FTZ A;  2LLK A;  1RPW A;  2M9H A;  1Q1V A;  5IPA A;  3NAR A;  2YU9 J;  4M6V A;  2L7M P;  1FIP A;  2EBI A;  1D5Y A;  1WGX A;  2DA3 A;  2X6O A;  4D7N A;  5M5Y J;  3OIO A;  1JKR C;  2M0C A;  5FJ8 J;  2AHQ A;  2EH3 A;  3Q3S A;  1TWC J;  5IP9 J;  1ZR2 A;  3TW6 A;  1HLV A;  2VI6 A;  4B3A A;  4BBR J;  3QQA A;  5E3L A;  2MW8 A;  1AKH A;  2L9R A;  1TWH J;  1IDY A;  2R5Y A;  3G1M A;  5IP6 A;  1IRZ A;  1K83 J;  3IV5 A;  3S1M J;  3HOW J;  2KT0 A;  5M3F J;  1RR7 A;  4C3H J;  3FKI J;  2M2E A;  1I3Q J;  2JJ7 A;  2ECB A;  5HOD A;  2M34 A;  4A3I J;  1TWA J;  1U78 A;  1BW6 A;  4DYC A;  1U9N A;  3JR9 A;  3BR0 A;  2R92 J;  2FJ1 A;  3OOU A;  4W1U A;  5EGO B;  2Y9Z A;  1IV6 A;  2VKE A;  3BQY A;  3GTQ J;  9ANT A;  3DEW A;  3BG9 A;  3RKQ A;  3RZD J;  2HOS A;  1BJZ A;  2E19 A;  3GTO J;  2WAQ N;  3JRE A;  3NAU A;  3PO3 J;  2DA5 A;  1RKT A;  3MKL A;  2H8R A;  3M3Y J;  3K7A J;  4MFD A;  1JGG A;  4Y7N J;  2X9D A;  4BY1 J;  1FIA A;  1S7E A;  4BXX J;  1APL C;  3BTJ A;  4QTR A;  5IYB J;  2OF7 A;  4B1R A;  3TW7 A;  3LSR A;  2NVQ J;  5GP9 A;  3Q0W A;  4IEJ A;  2DA6 A;  1SAN A;  1Y1V J;  1TWF J;  4C2M J;  4Y52 J;  2X48 A;  5J1U A;  5E3M A;  1JUS A;  2IBD A;  3ZQL A;  4D5F A;  3LSJ A;  3ZQI A;  5FLM J;  3M4O J;  1B8I B;  5FKM A;  4BKX A;  1WI3 A;  1HOM A;  1PUF B;  2HOT A;  1X2M A;  2XPV A;  1AHD P;  2VKV A;  2TRT A;  2IAI A;  2EZI A;  3BTL A;  1ETW A;  3UKG A;  1O4X A;  1ETK A;  3ZQG A;  3OSF A;  5M3M J;  1TWG J;  2K9N A;  4L5E A;  3L1P A;  3CMY A;  1ZQ3 P;  1G2H A;  5F0C A;  3S2H J;  2W48 A;  3JRG A;  2VUM J;  2DMQ A;  3F0C A;  2CQX A;  1MH3 A;  4A3B J;  1GV5 A;  2EZH A;  4G12 A;  3Q0U A;  3BTC A;  4DYQ A;  3GTL J;  5EZH A;  1K61 A;  1ETX A;  1WH5 A;  4IHW A;  3H0G J;  4C3I J;  2LKX A;  2XGD A;  2N8G A;  4V2F A;  4CYC B;  2O8K A;  2R93 J;  5EGO A;  1P7I A;  1ETY A;  3RQI A;  2FX0 A;  1X2N A;  1R9T J;  1QRY A;  1AU7 A;  2JMW A;  2DA7 A;  3S1R J;  1VND A;  4LOC A;  2QCO A;  3PM1 A;  4FE7 A;  1ZK8 A;  3HOZ J;  4A69 C;  4M3D A;  1NK2 P;  1XS9 A;  2HQ5 A;  2XB0 X;  3HOX J;  1BW5 A;  1JJ6 C;  2ID6 A;  1MBG A;  2R5Z B;  3S17 J;  3FK6 A;  3TP3 A;  2NVY J;  3A01 B;  5EDN A;  2H1K A;  1X58 A;  2K9S A;  3O8H A;  2OPT A;  1JJ8 C;  3ZQC A;  4M3E A;  3O8G A;  2Y31 A;  2CQQ A;  1QVT A;  4DZJ A;  3BTI A;  4FE4 A;  2JA5 J;  2L7Z A;  4A3L J;  1RES A;  1EF4 A;  1POG A;  4A3C J;  3ZQF A;  3BQZ A;  5C3E J;  5F04 A;  2VPR A;  2LR8 A;  3SDG A;  3LNQ A;  3HGG A;  3S2D J;  1U9O A;  2GLO A;  2DA4 A;  1JKO C;  3IH2 A;  1VFC A;  1WH7 A;  5EG0 B;  2HXO A;  1BA5 A;  1PUF A;  1IJW C;  1F36 A;  2LD5 A;  1ZGW A;  2NVX J;  1LFB A;  1IG7 A;  4A3K J;  3A03 A;  3S15 J;  2YUS A;  4FCY A;  4I76 A;  2DA1 A;  3A02 A;  5J1R A;  5JLX A;  5JLW A;  4UUS A;  1OJL A;  1IC8 A;  2ZB9 A;  3LSG A;  3HBL A;  1MBK A;  3S16 J;  1JKQ C;  2MSY A;  1VF9 A;  1HDD C;  4MIM A;  2XRL A;  2NS8 A;  1U8B A;  3CDL A;  5F1J A;  2MGQ A;  4J19 A;  3BR1 A;  1A5J A;  2GBY A;  3JRI A;  2MG4 A;  4NDL A;  1Y1W J;  1NTC A;  4CYC A;  1JT0 A;  2DJN A;  1FEX A;  1GVD A;  1VI0 A;  2XGE A;  5K7Z A;  1GUU A;  3S14 J;  2R0Q C;  3MN2 A;  1B72 A;  3HEF A;  1UHS A;  3C2B A;  3ZQH A;  4D7M A;  1W0U A;  4RDU A;  1MBE A;  1UMQ A;  1CQT A;  4AUX A;  4BBS J;  2ECC A;  2TCT A;  2COB A;  3TED A;  4GFB A;  3K2A A;  5FKK A;  5EEA A;  3JRA A;  3BT9 A;  2R5Y B;  2R5Z A;  4QIW N;  4MLO A;  2B63 J;  1MH4 A;  3A01 A;  2JA6 J;  4XIC A;  2LTP A;  2CRG A;  3HOY J;  5EZG A;  2ME0 A;  3G1L A;  5FKO A;  1UG2 A;  1IUF A;  3CQZ J;  4IHX A;  1SFO J;  1GV2 A;  4AYB N;  1ZTR A;  1Z77 A;  1RKW A;  5E3N A;  2CUE A;  3VPR A;  2E2J J;  3G1O A;  5IP7 J;  5GPC A;  3BG3 A;  1FJL A;  5EG0 A;  1QVU A;  3BG5 A;  3Q0V A;  4IHY A;  5F0H A;  5J3L A;  1ETV A;  3MVP A;  2XPU A;  5J1Y A;  4DW6 A;  5EYR A;  1H89 C;  3WHB A;  4DZP A;  2O9L A;  2DMP A;  5F27 A;  4XRS A;  4FTH A;  1LE8 B;  1JKP C;  1OCT C;  5FLV A;  2D5V A;  2G0E A;  2HXI A;  5FKN A;  1XC5 A;  2Y9Y A;  3JRF A;  4HNV A;  2FD5 A;  2XB5 A;  2DMT A;  3HOV J;  3BR5 A;  1DU6 A;  3FIW A;  5M5X J;  1H8A C;  3QPS A;  4UUT A;  3JRC A;  3LOC A;  1HDP A;  3DCF A;  4XK4 A;  5F0F A;  1ZR4 A;  3E7L A;  1JUM A;  3CCY A;  2XGC A;  2E1O A;  4ABZ A;  5C4J J;  1WPK A;  4EEF G;  3GBG A;  2M8G X;  4JX6 A;  5FKL A;  1JTX A;  3S1N J;  2L7F P;  3GTK J;  3HGY A;  2DMN A;  3SJM A;  1IDZ A;  1MBJ A;  1MSF C;  2NVT J;  3JRD A;  3WHC A;  2HDD A;  3HDD A;  3HB9 A;  3FK7 A;  1B8I A;  2L0K A;  1YRN B;  4XRM A;  4MO7 A;  1QPI A;  1Z0X A;  4A3J J;  3JRB A;  3HKZ N;  2Y0S N;  1MBH A;  5M5W J;  5K7H A;  3GTG J;  2XSD C;  1XG1 A;  3BR3 A;  2JK3 A;  4XRS G;  3B6C A;  2RAE A;  4A3M J;  5IOZ A;  4QSH A;  2O7O A;  1MNM C;  2DTZ A;  5K7F A;  1ENH A;  1HCR A;  3BR2 A;  3I4N J;  4D5C A;  2ELK A;  1HF0 A;  5EF6 A;  1JT6 A;  1F43 A;  4A3D J;  3HOU J;  2NOG A;  4W97 A;  2ME6 A;  1MSE C;  3FIS A;  1JUP A;  1ITY A;  1A6I A;  2R7Z J;  1H88 C;  4X6A J;  2WB1 N;  2JA8 J;  1P7J A;  2KDZ A;  2WV1 A;  2P81 A;  3D1N I;  2EZL A;  5DTD A;  4A3G J;  1GDT A;  5C44 J;  4A3F J;  1GT0 C;  3S1Q J;  2FQ4 A;  1LE8 A;  2K40 A;  2LY9 A;  3B6A A;  2JA7 J;  1AKH B;  2EZK A;  1LFU P;  3GTJ J;  4BY7 J;  2PMZ N;  3QPL A;  2CUF A;  1ETO A;  4JP0 A;  3BR6 A;  2NS7 A;  2JN6 A;  1NK3 P;  2XPW A;  5E3O A;  2K9Q A;  2IEK A;  2HYJ A;  1ZKG A;  4A3E J;  2ID3 A;  4A93 J;  2LFB A;  4S0H B;  1RET A;  3PO2 J;  1DU0 A;  4JX5 A;  2JWT A;  2DA2 A;  2I10 A;  1I6H J;  3IH4 A;  4V2G A;  4I6Z A;  2LK2 A;  4DYR A;  1MBF A; 
#chains in the Genus database with same CATH topology
 2OJE D;  3I56 I;  1E3H A;  4KN7 X;  4XID A;  4LG0 B;  2O5R A;  1W0T A;  1NG7 A;  1ERD A;  1G3Y A;  4ITV A;  4RLF A;  3F21 A;  1J2X A;  2LP0 A;  4LB5 A;  3QPT A;  2NNY A;  3OSG A;  4M3F A;  1IN7 A;  5H20 A;  3DPT A;  2HPI A;  3VDX A;  2W1O A;  1T56 A;  5D6E A;  4ENJ A;  3C2H A;  3HM5 A;  5ERI A;  2YS9 A;  2E2H J;  1A04 A;  2AO9 A;  2V6C A;  4H4K C;  4JX4 A;  2VQL A;  4FIS A;  3KYL A;  1R1U A;  1MJ9 A;  2XVC A;  4AC0 A;  1ORK A;  4LIU A;  4X1E A;  5ICG A;  1JHH A;  4HQM A;  2GZW A;  2M5W A;  3LSK A;  1MNE A;  2QQ8 A;  4KIB A;  2PJP A;  5E8G A;  3KZI C;  5GPA A;  1V55 H;  4B4C A;  5LHG A;  3S3O A;  5BPD A;  2K7L A;  1DP7 P;  1FTT A;  1GXQ A;  5TJJ A;  3GEZ A;  4BEH B;  3IL2 A;  2HS5 A;  4WK8 F;  2M9H A;  5LEK A;  5CPR B;  5LHI A;  4KIG A;  1Q1H A;  3RIR A;  3D5L A;  4U7B A;  3NAR A;  1JXS A;  3HTU A;  1FIP A;  2EBI A;  1IN6 A;  1WGX A;  3H35 A;  5M5Y J;  2EV0 A;  3OYM A;  2ZXW H;  3BLY A;  1JKR C;  1A31 A;  1Z1D A;  4L9J A;  2M0C A;  2OTL I;  5FB2 A;  5J4V A;  3Q3S A;  1Z6T A;  4G94 A;  4A2U A;  5IP9 J;  1ZR2 A;  4RGX A;  2VI6 A;  4MNU A;  4EAT A;  1HLV A;  4HYE A;  2P6T A;  5E3L A;  2EA2 A;  2MW8 A;  2DPD A;  2HGC A;  1X4O A;  2Q2E B;  2BW3 A;  2LKS A;  2R7R A;  2W4S A;  1N77 A;  2DK5 A;  1IDY A;  4IQ4 A;  4XOT A;  3G1M A;  3V4G A;  4BDZ A;  1ZRE A;  2VBW A;  4IL6 C;  1BR4 A;  1IRZ A;  2Z5U A;  4KMU X;  1U8R A;  1ZHF A;  1VQK I;  2KT0 A;  5ILV A;  3I3L A;  3RDI A;  4C3H J;  2CQ7 A;  1TBX A;  2JJ7 A;  2ECB A;  4DBR A;  4FT8 A;  2M34 A;  4C30 A;  4RGU A;  2LNB A;  1U78 A;  1D1A A;  2BE5 F;  1BW6 A;  1MD0 A;  4Y3O A;  4DGW B;  3WE2 A;  1NHA A;  4BQA A;  4W1U A;  1V3F A;  3M7G A;  1TP4 A;  3OWT A;  5CVJ A;  2Y9Z A;  3ABM H;  2KIU A;  3KE2 A;  3ZMT A;  2PFB A;  3BQY A;  1QU3 A;  3GTQ J;  1K6Y A;  2CFX A;  3PL8 A;  3E5Q A;  4EJO A;  2ZNZ A;  3HYI A;  2FF4 A;  3RKQ A;  4UB6 C;  1BJZ A;  1YJ9 I;  2BEO A;  2VBY A;  2JPC A;  3DFG A;  3LA3 A;  4QPO A;  1YG2 A;  3LFK A;  3JRE A;  4XMY A;  2XAG A;  1LEA A;  4CA0 A;  2A05 A;  2X1C A;  2L2O A;  3M3Y J;  1JGG A;  4Y7N J;  4L9N A;  1OKR A;  3QU3 A;  2VKD A;  4EVI A;  3BTJ A;  3ERM A;  2YX7 A;  4E7Z A;  4XLF A;  4ZC3 A;  3E6C C;  4PJ0 C;  4PJN A;  4B1R A;  2VT2 A;  2NVQ J;  1VTN C;  4IEJ A;  1YOV B;  3P9I A;  1TWF J;  4C2M J;  3L09 A;  2DCE A;  1A6Q A;  4PSX A;  5J1U A;  4BNC A;  3BZC A;  5E3M A;  5KCM A;  3MKZ A;  3ZQL A;  3LSJ A;  4PCQ A;  5FLM J;  4XL9 A;  1V54 H;  3FWE A;  1TNS A;  2AXL A;  5HNH A;  1PUF B;  3J81 Z;  4UNO A;  4XOR A;  2IAI A;  2VPL A;  1D0Y A;  1HKQ A;  4G8X A;  3HRS A;  4P5O A;  3KZY A;  2BVL A;  1SAX A;  1NG6 A;  2VOP A;  3QOP A;  5LGN A;  5E1Z B;  2JTV A;  4L5E A;  4DQ2 A;  3CMY A;  2BHY A;  1ZQ3 P;  3OYL A;  5HDN A;  3JRG A;  2XF7 A;  1S72 I;  2DMQ A;  3F0C A;  4LK1 F;  2X6X A;  3V7R A;  1S8N A;  2ZFW A;  5LRS A;  5FLX K;  4L5J A;  3RYR A;  3FXQ A;  3PSI A;  2JUC A;  2G7U A;  2L9V A;  5EZH A;  3L9F A;  2ZSI B;  5EEH A;  5IT3 A;  2HYG D;  2XGD A;  2N8G A;  2R93 J;  2IS1 A;  3FXJ A;  3H9G A;  3LQQ A;  5EGO A;  1GVJ A;  4F92 B;  2HOE A;  1KA8 A;  3RQI A;  1FOX A;  3CJT B;  4KIF A;  4AIH A;  2JMW A;  1TW3 A;  1BR2 A;  2LKP A;  2DA7 A;  3T1B A;  3WTS C;  1UAA A;  2QCO A;  5CKT A;  4CCO A;  3HOZ J;  2BBY A;  4A69 C;  1J7K A;  1NK2 P;  3DBL B;  4EJV A;  2OCC H;  4HLY A;  1KU2 A;  5J40 A;  5CJ9 A;  2ID6 A;  2P0W A;  4M9S A;  2R5Z B;  2GOX B;  3FHN A;  3D5R C;  3S17 J;  1FNN A;  4P9U A;  1X58 A;  2K9S A;  3O8H A;  4XM3 A;  4XSZ F;  1XCB A;  2KPM A;  4M3E A;  2IVM A;  4ZDP A;  3GFM A;  2IS4 A;  3O8G A;  5DM7 F;  2BZT A;  3FBI B;  4DZJ A;  5HS7 A;  1EF4 A;  2JA5 J;  3R6S A;  4OMY A;  3BQZ A;  1BN5 A;  2LDU A;  3CC4 I;  3BJ6 A;  5GAD J;  4XLA A;  1F9N A;  5FRN A;  2LR8 A;  5CQE A;  2W84 A;  2QEX I;  3SDG A;  3FDY A;  4IPA A;  1LDD A;  1ONV A;  1RUN A;  1W7P A;  2HZD A;  3S2D J;  2KZV A;  2GLO A;  3AG4 H;  1J0R A;  3QU6 A;  1WH7 A;  4CDG A;  2BY2 A;  1BA5 A;  2KZG A;  1IJW C;  2NVX J;  1ZGW A;  1IN8 A;  4QPQ A;  1DQU A;  5KAI C;  4G7O F;  3A03 A;  4R8H A;  3S15 J;  5B1A H;  4PK4 A;  2PJR A;  2DOF A;  4XR6 A;  4NB5 A;  2KLO A;  4RA2 A;  1IRG A;  2ZC2 A;  3FX3 A;  3QAH A;  5JLW A;  5JLX A;  3OYH A;  4ZYG A;  4UUS A;  4XLN F;  1FZP B;  2K3P A;  5ICF A;  1XGO A;  2BYV E;  5GAE J;  2M7A A;  3LSG A;  1FOK A;  1K78 B;  2A5Y B;  1HDD C;  4N4O B;  3ESW B;  1Z05 A;  2A61 A;  4IOA F;  2F5E A;  2NS8 A;  3E6B A;  3C2G A;  5GTI C;  4BE1 A;  2OZ6 A;  2IS6 A;  4U87 A;  1WJF A;  2P5V A;  1A5J A;  2GBY A;  3I5U A;  4NDL A;  5D8L B;  1NTC A;  1F5T A;  1ACI A;  4HZF A;  1TQM A;  2IGK A;  3CCJ I;  4B09 A;  1WFX A;  3S14 J;  3EYI A;  1HST A;  2R0Q C;  3TO9 A;  1UHS A;  3ABK H;  3WG7 H;  4M9X A;  3N4M A;  2E5Z A;  2ECC A;  1FP1 D;  3LA7 A;  2WC2 A;  2E34 A;  3GXO A;  3F8N A;  2BW3 B;  1MMD A;  1BR1 A;  5FKK A;  3IAS 2;  3BT9 A;  3IKT A;  3AG1 H;  2QEN A;  2F4M B;  4PUS A;  2RNG A;  1S7O A;  1S3J A;  3V7S A;  2XC7 A;  4IHS A;  2RC4 A;  2FSW A;  3P9C A;  2CWE A;  2DI3 A;  3HOY J;  2ME0 A;  3F3X A;  3G1L A;  5FKO A;  2LOO A;  2GXG A;  4BE2 A;  3W2A A;  4KT6 A;  4M6X A;  4HF1 A;  3CCR I;  2DXI A;  3PNV A;  3HXL A;  2VKH A;  4A5M A;  2DBB A;  1SFO J;  1R4N B;  4AYB N;  1Z77 A;  1RKW A;  2E1M C;  3EQL F;  1SC7 A;  1J75 A;  1PDN C;  3L2V A;  3UR3 C;  2E60 A;  5DUI A;  4MEX F;  5IP7 J;  3C3W A;  5L3D A;  3ZXS A;  5GPC A;  4KYW A;  1FJL A;  2R7Q A;  3Q0V A;  1LVA A;  4AID A;  4BAC A;  1ETV A;  2IJL A;  2V9V A;  1IUY A;  3KZZ A;  3WGG A;  3JTH A;  5FFX A;  3KCC A;  5LBQ A;  1Z9C A;  3BY6 A;  1FC3 A;  3AKZ A;  2LF8 A;  2VL8 A;  2Y75 A;  4WXC A;  1LE8 B;  5FLV A;  4E7S A;  2E7X A;  5B66 C;  1BI1 A;  2V9K A;  4Q48 A;  2F5V A;  3JSO A;  2PG4 A;  3G6E I;  2DMT A;  1ODD A;  4UUT A;  1IO2 A;  4B3X A;  1S29 A;  2F5F A;  2Q0O A;  3FMS A;  4HF0 A;  1R4M B;  1FOY A;  3QYB A;  1E0E A;  2RV8 A;  3KET A;  1KQ8 A;  1XGN A;  2XSJ C;  1OCR H;  1UEL B;  4JX6 A;  4LMY A;  2QSF X;  1JTX A;  1IZ1 A;  1ZH5 A;  1LVK A;  2L7F P;  1XPX A;  5E1W A;  2VE8 A;  1IDZ A;  2RKH A;  4P9F A;  4HDV A;  1MSF C;  2NVT J;  3EUH A;  4FQG A;  3CES A;  3TGN A;  5ICC A;  2ICW G;  2MBF A;  3E5X A;  4YEL A;  2NAZ A;  3V42 A;  2L0K A;  5FLX Z;  4XRM A;  2EIL H;  2BV6 A;  2HDW A;  4MQV A;  1QPI A;  2DAO A;  1T6S A;  2CYY A;  2DDB A;  5FGM A;  4Y13 A;  1X1C A;  1CF7 B;  1W5T A;  3K4C A;  3HKZ N;  2VT3 A;  3U1D A;  5J6X A;  3S3M A;  1B6A A;  3BG6 A;  3COA C;  2QZ8 A;  1XG1 A;  1TTY A;  4A0Y A;  3AG3 H;  4BHP A;  2XV4 S;  4XRS G;  2IXS A;  1X3U A;  2DQR A;  3B6C A;  4E70 A;  4CYD A;  4A3M J;  3CD6 I;  1ZLK A;  5IOZ A;  3TKY A;  3I53 A;  3DPL C;  4HA8 A;  3H5R A;  5K7F A;  4ZYE A;  2V1U A;  2X0L A;  1HCR A;  3BCB A;  3BR2 A;  3ZGK A;  1WJE A;  1I6X A;  5HLG A;  1G6N A;  2E1M B;  3HSE A;  4KN4 X;  1O7L A;  3U1K A;  2L54 A;  5LGT A;  1QQI A;  3F9K A;  2H09 A;  3FIS A;  1JUP A;  2QGU A;  1ITY A;  3FKJ A;  3S3N A;  4AU7 A;  3AG2 H;  1MND A;  2KDO A;  1H88 C;  1WSU A;  4GCV A;  2DK8 A;  2ADU A;  1I3A A;  3DKX A;  1P7J A;  1H9T A;  2WV1 A;  2A3S A;  4A3F J;  4G7H F;  4I01 A;  4GYI A;  2ESN A;  2JA7 J;  1AKH B;  2EZK A;  1LFU P;  1X3W B;  4BY7 J;  1ETO A;  4JP0 A;  3I59 B;  4E7H A;  3ROU A;  3TMO A;  3CP2 A;  3MMY B;  3VYS B;  2QSG X;  1ZYR F;  2HYJ A;  1O3T A;  4AIK A;  3G71 I;  2LFB A;  3Q5F A;  1OR7 C;  2FU4 A;  4HF2 A;  2R7T A;  4GO1 A;  2JWT A;  2DA2 A;  2I10 A;  2A6H F;  2STT A;  1S5L C;  1VQ9 I;  4CZC A;  2VBX A;  5FRM A;  4A12 A;  5BOX A;  1MBF A;  2PQ8 A;  1F1Z A;  3VB2 A;  1YW8 A;  2CU7 A;  3V8K A;  1XDS A;  1F4K A;  1OYW A;  2LVS A;  3NWS A;  2EIN H;  1IXR C;  1OCP A;  1R7J A;  2E7W A;  2WAE A;  4MFE A;  4RBO A;  1E3O C;  1TC3 C;  3MKY B;  1HW5 A;  1YRN A;  5DDG A;  3GTM J;  1JTY A;  1FBQ A;  3WG9 A;  1EH7 A;  2EK5 A;  2DN0 A;  4M72 A;  4PGG A;  1PJR A;  4E6K G;  3QRF F;  5H2F C;  1VQ4 I;  4UUS B;  4IHV A;  2IS2 A;  2DMU A;  5IYD J;  4JBA A;  2P6S A;  3OYF A;  3BJA A;  1IRF A;  3DV8 A;  2ZXJ A;  2KHM A;  1T33 A;  2PBI A;  2WB1 A;  4Q47 A;  1BL0 A;  1D8J A;  2D1H A;  5IY5 H;  2WAD A;  4U0W A;  2VAS A;  1BJA A;  2XKO A;  2UUZ A;  5CQG A;  4G6Q A;  4JYK A;  2AS5 F;  2P7V B;  4RAF A;  1JI8 A;  4RM3 A;  2DT5 A;  1HKS A;  3EET A;  2HOA A;  2QBY A;  2F6C A;  5F08 A;  4AWX B;  3IH3 A;  4X0G A;  5L3F A;  1ZRD A;  1QPM A;  1Z3Y A;  2QUF A;  3H3U A;  3I71 A;  2L4M A;  4IF4 A;  3OYJ A;  2VLA A;  5DUK A;  5GAG J;  2EFP A;  4G6T B;  3LFU A;  3RKW A;  4O6J A;  4M3B A;  2EIM H;  2OQG A;  1FBU A;  3KX2 A;  3KEY A;  3W6V A;  3EUH C;  5BNG A;  3DU5 A;  1ZG5 A;  2Y30 A;  3PNY A;  1FTZ A;  4UXN A;  4RB1 A;  1Q1V A;  2CQK A;  2FML A;  3GZ5 A;  2K9L A;  5FO5 A;  4M6V A;  1O57 A;  3MCZ A;  3OIO A;  5B3S H;  2P7C B;  3SZG A;  4CZZ A;  2AHQ A;  2EH3 A;  5J8C A;  1FP2 A;  2ZBK A;  3UNG C;  1YJW I;  4B3A A;  4LGW A;  3FBN B;  1FBS A;  1SFX A;  3GME A;  2L9R A;  4BHB A;  1U3E M;  4LFU A;  1USS A;  4Q5S F;  2M3A A;  3WGH A;  5IP6 A;  2A6E F;  3NRV A;  1K83 J;  3S1M J;  1P9Q C;  1YIO A;  1RR7 A;  3R0J A;  2Y0M A;  4HNU A;  3E5U A;  4ESB A;  1W36 D;  1I3Q J;  2E35 A;  4PZJ A;  4YIF A;  2GA1 A;  1WI9 A;  3SDB A;  4NC8 A;  4A3I J;  3GFL A;  1O7F A;  3P7N A;  1U9N A;  2COM A;  2B7E A;  2R92 J;  2HKX A;  3CF2 A;  2K9M A;  2LBF B;  2H8W A;  3OOU A;  5JVG F;  3FXR A;  1G3S A;  2OQR A;  1YTY A;  2EJR A;  1IV6 A;  1JGS A;  3R4K A;  3RKX A;  2MC4 A;  3HJE A;  3BJO A;  3DEW A;  3ELK A;  4F3Q A;  3BG9 A;  4XKB A;  4BQN A;  2VQH A;  4L18 B;  2E19 A;  2BVM A;  3BDD A;  1G4D A;  3GTO J;  5KAF C;  1MGT A;  3RSN A;  2L5Q A;  1SVM A;  2M45 A;  3N05 A;  1UB9 A;  1LUJ B;  3TOB A;  1ULY A;  3V8J A;  4BJT A;  4QLC U;  3F8F A;  4BY1 J;  3HOS A;  4QWQ A;  1RRJ A;  3WTZ A;  3DP7 A;  3K4B A;  2X6Y A;  1APL C;  4BJ6 C;  2DTR A;  2LC2 A;  1BIB A;  3ZMD A;  2ZME C;  3EYY A;  5EJC A;  2OF7 A;  1UG0 A;  1KQ0 A;  3LSR A;  4ZTF A;  1MW7 A;  1OIS A;  3Q0W A;  1Y1V J;  3R60 A;  4Y52 J;  1RC9 A;  2EV5 A;  2BY1 A;  2M8E A;  2HTS A;  1BOA A;  2VXD A;  3KLN A;  1GXP A;  2FBI A;  2JPB A;  5TRD A;  2JZY A;  1VQL I;  1MDM A;  1I1G A;  2ELJ A;  3HIF A;  1D0X A;  2GWR A;  3ZP5 A;  1AHD P;  1V5E A;  2VKV A;  2DFF A;  2YPR A;  1YIT I;  3GF2 A;  5DCM B;  3DKW A;  2CG4 A;  3SEZ A;  3UKG A;  1T0F A;  5CYV A;  2CGP A;  1ETK A;  3OSF A;  1HXD A;  2V9P A;  1TWG J;  1W4M A;  2K9N A;  4XKW A;  5M3M J;  4IVN A;  5J4Y A;  3FXM A;  2FOW A;  3DLA A;  3JSP A;  2KIM A;  2KQR A;  2LMD A;  4M71 A;  2WAQ A;  2CQX A;  4A3B J;  2FOK A;  1N78 A;  1Z7U A;  4XON A;  4G12 A;  2STW A;  1MJA A;  3DBH B;  1U5T C;  3Q0U A;  2QSH X;  4HBL A;  2IA0 A;  2MC3 A;  1JE8 A;  1DUX C;  3BRO A;  4DYQ A;  3L2C A;  1ZRF A;  3E3V A;  1K61 A;  4BQO A;  3WTY C;  1R00 A;  1S9H A;  3CUQ C;  2LKX A;  1ZLJ A;  4V2F A;  3DU6 A;  4B8X A;  5LFA A;  1E2X A;  1TT0 A;  1MMN A;  1P4A A;  1MMG A;  1QRY A;  1AU7 A;  3F6O A;  2LY1 A;  3HZJ A;  3S1R J;  4II2 A;  3PM1 A;  2UXN A;  3OYA A;  3NEU A;  4OWR B;  4FE7 A;  1G3T A;  3T8T A;  4N9H A;  4E7I A;  4NQW A;  1XS9 A;  4E7J A;  2HQ5 A;  2OBP A;  3HOX J;  5AIQ A;  1R23 A;  2LF7 A;  2C6Y A;  1JJ6 C;  3OYN A;  2DT7 B;  3TP3 A;  3A01 B;  3IWZ A;  3ZN0 A;  5EDN A;  2F2E A;  4BU2 A;  2KMU A;  3CJR B;  2BGC A;  5E8I A;  2ZME B;  2Y31 A;  1I1S A;  1D8K A;  2CQQ A;  1QVT A;  3NQO A;  4YEJ A;  4FHT A;  1O3Q A;  3BTI A;  2FNP A;  1RZ4 A;  2L7Z A;  4A3L J;  1SVO A;  1SD5 A;  1POG A;  2W25 A;  2IA2 A;  3M9A A;  3W2W A;  5C3E J;  4PFO A;  2WY7 Q;  4F7Z A;  5HDK A;  3G73 A;  3VYT B;  2V1N A;  4XNF A;  1QZY A;  2VPR A;  2Z2S B;  3K6G A;  3F72 A;  2OD5 A;  4JQF A;  1FSH A;  3Q9V A;  4HST A;  4I99 C;  5HNF A;  3HTS B;  3S93 A;  5EG0 B;  2HXO A;  3LSM A;  3OL4 A;  1H9G A;  2VIX A;  4OIO F;  3K0L A;  1FYL A;  4MHG A;  4XN0 A;  2HPM A;  2E36 A;  4IZZ A;  3ECO A;  1T39 A;  2YUS A;  5CLS A;  4HPQ A;  4HV6 A;  1P2F A;  1GLN A;  3A02 A;  1U6G A;  3I9V 2;  3T8R A;  1Y0U A;  3WTT C;  1OJL A;  2KIF A;  2B9S A;  2JRM A;  3HBL A;  4ZYD A;  4WX9 A;  4ZTJ A;  2FMY A;  1JKQ C;  2MSY A;  4S04 A;  1SD7 A;  1BI0 A;  2XRL A;  2Z9O A;  1U5T B;  1ZN2 A;  2K27 A;  3BZ6 A;  3I64 A;  5E79 C;  1T38 A;  5F1J A;  2DT6 A;  4J19 A;  3JRI A;  3VYU B;  3CUQ B;  4CYC A;  3PIP F;  2DJN A;  2I8D A;  3F8M A;  3KYC B;  1FEX A;  1HW2 A;  3F6V A;  2X6W A;  4Y33 A;  4LLL A;  2XGE A;  3K70 D;  1FYM A;  1GUU A;  2F5C A;  1O3S A;  3ZQH A;  3TQN A;  1W0U A;  2KFD A;  1WJC A;  2P8T A;  3BPX A;  1CQT A;  2OU2 A;  3PUB A;  4AUX A;  3K4K A;  3I55 I;  2XKP A;  2COB A;  2VBZ A;  3H5A A;  5EEA A;  4CHU A;  5DYM A;  2EB7 A;  4QIW N;  1AWC A;  3OS2 A;  3W3C A;  1HQC A;  4GYG A;  1IN5 A;  2JSC A;  3TBI A;  5EZG A;  4UV9 A;  3CME I;  4L9T A;  2JUG A;  3CQZ J;  1IUF A;  3J7A Y;  2RGV A;  5KVR A;  1V5F A;  2BOL A;  4PFP A;  1IXS B;  1FX7 A;  1GV2 A;  4RB2 C;  4P55 A;  1ZTR A;  4RAG A;  2RRE A;  1N25 A;  1LDJ A;  3SZP A;  5E3N A;  4DNC A;  2KRH A;  2CUE A;  1PUE E;  5F6F A;  3SZT A;  3L2W A;  3L7W A;  2E71 A;  5LRR A;  1D1B A;  4Z6Y A;  1R58 A;  3PQJ A;  5L3G A;  1QVU A;  5J3L A;  1ZRC A;  3MVP A;  3BPV A;  2VJ4 A;  2XAU A;  3AAF A;  2VOD A;  4M6Y A;  1H89 C;  4RB0 A;  3CCQ I;  2QLZ A;  5F27 A;  4FTH A;  2HXI A;  1XC5 A;  2HYF A;  2E1C A;  3O3K A;  4YG2 F;  1WZ2 A;  1J5Y A;  1DU6 A;  1P4X A;  3FIW A;  4XQF A;  4RS8 A;  1HDP A;  2R4G A;  3GLL A;  4XK4 A;  5F0F A;  2LG4 A;  4PJL A;  3E7L A;  1EH6 A;  2ACJ A;  1JUM A;  2XGC A;  4ABZ A;  5C4J J;  4B47 A;  2IRF G;  1FSE A;  2M8G X;  2MH2 A;  3BWG A;  1UZC A;  4PGH A;  3OS1 A;  2VE9 A;  2RQQ A;  1FMV A;  2DMN A;  2MA3 A;  2XF6 A;  2ZJ2 A;  3HGY A;  4BAY A;  1MBJ A;  3JRD A;  1WJA A;  3R0A A;  1MZB A;  3HB9 A;  2P5L C;  5L3B A;  3GWZ A;  1UCR A;  4BE0 A;  2FRH A;  2RNJ A;  2H6C A;  2W57 A;  2OA4 A;  4D9J A;  2DYR H;  1T2K A;  4P96 A;  3QYF A;  2B0L A;  2EIK H;  5M5W J;  3DEU A;  5K7H A;  2VJJ A;  2AXT C;  3ZN1 A;  1QBJ A;  2XSD C;  2DFI A;  3BR3 A;  4L0Y B;  1KZH A;  2JK3 A;  3RTR A;  4MTD A;  3V8L A;  2EV6 A;  1SFK A;  2RAE A;  3I54 A;  5FFZ A;  2DJI A;  3DTK A;  3WTU C;  1FMW A;  2E1N A;  1MNM C;  2OCE A;  3H92 A;  2DTZ A;  3H3Z A;  4KIS A;  3GFI A;  4D5C A;  5D4R A;  1MMA A;  1TLH B;  1F43 A;  4I0A A;  2NOG A;  2HVS A;  3PFY A;  1BM9 A;  3MD2 A;  4HOB A;  4NC6 A;  4BXU A;  2UZK A;  1DGW Y;  4OMZ A;  5L3E A;  4OOI A;  4F52 A;  1B9M A;  2HVR A;  3JCU C;  3OYD A;  4IQJ A;  1RUO A;  3PUF A;  3KP7 A;  4NQW B;  3MKW B;  4I2O A;  1R36 A;  2P81 A;  3OYB A;  2EZL A;  3K1P A;  1GDT A;  2XRO A;  3S1Q J;  2QM3 A;  3U9G A;  2QKL B;  2QA4 I;  2VQG A;  3EDP A;  2K3F A;  3B6A A;  3HOT A;  2O6G E;  2W00 A;  1QHH D;  4PJJ A;  4CSW A;  2FXA A;  3K4J A;  4AM3 A;  3CJQ B;  3PFI A;  3CMA I;  4KNY A;  2Y0S A;  1ZKG A;  4C2U A;  4GXO A;  1YW7 A;  2ID3 A;  2NNN A;  3PO2 J;  3IHU A;  4R79 A;  1DU0 A;  5A2Q K;  4V2G A;  3QOD A;  3CF5 F;  2QQA A;  2LK2 A;  2EFQ A;  4I6Z A;  3LA2 A;  3MEX A;  5IYC J;  1Z67 A;  1XMK A;  4XKV A;  2NOJ B;  2GM4 A;  1MMS A;  3JRH A;  2QF7 A;  3IAM 2;  3K1N A;  5F1R A;  3GTP J;  2FA5 A;  2E2I J;  3PSF A;  2XIG A;  3A4C A;  3SFI A;  3ML6 A;  4RAZ A;  4M3G A;  2R7U A;  3PIO F;  4NBQ A;  2L3D A;  3A0H C;  3J80 K;  3GVA A;  4IXA A;  2L9S A;  1OCZ H;  1R5H A;  1R71 A;  1WCM J;  2GIV A;  4C3J J;  3FHZ A;  3F22 A;  5KK1 A;  2EIJ H;  1IGN A;  3F8C A;  3N97 A;  4E7K A;  2BXZ A;  3E0J B;  1W36 C;  1I50 J;  1SD6 A;  3DTE A;  5C4X J;  3DTI A;  3FXK A;  3CO6 C;  3OYG A;  3DQV C;  3H3V K;  4F55 A;  4U0V A;  2PMZ A;  2PMU A;  2CSO A;  3WTW C;  2IT0 A;  2ZJR F;  4H0E A;  3LSP A;  3ZOB A;  1YS7 A;  3TP0 A;  1EA3 A;  4HLX A;  4YIR X;  2X1D A;  2K4B A;  2LLK A;  1RPW A;  3NWT A;  3HRM A;  3TDU C;  4G6D A;  2YU9 J;  4BJ5 C;  2L7M P;  2DA3 A;  3X2Q H;  3K4L A;  3K9T A;  3GZ6 A;  4AIJ A;  1H0M A;  2FBK A;  1TWC J;  4WF2 A;  4HG2 A;  4ZDO A;  4UY8 I;  4I09 A;  4RM2 A;  4UB8 C;  4O3M A;  4U88 A;  3CCM I;  1TWH J;  2P4W A;  2IW5 A;  2MD5 A;  2EFO A;  2R5Y A;  2JA2 A;  2M1B A;  3OS0 A;  1BI3 A;  1YYV A;  3K69 A;  4CO8 A;  4K2E A;  2FEZ A;  1ZG3 A;  4F93 B;  3MFK A;  3HUG A;  1ZEL A;  3HOW J;  1TQI A;  5HOD A;  1KON A;  2XAH A;  5CVR A;  2DU9 A;  3C18 A;  4DYC A;  2V7F A;  3KP4 A;  3JR9 A;  3BR0 A;  4J01 A;  3VOD A;  2FJ1 A;  4KMF A;  4LG0 A;  5EGO B;  3V7C A;  2EA4 A;  2OC6 A;  4O5V A;  2VKE A;  4OIN F;  4YFK F;  3ECH A;  2KJB A;  4OIR F;  2D1V A;  5EEG A;  3GX4 X;  2O3F A;  2HOS A;  5IT9 K;  1XN7 A;  3NAU A;  2L7K A;  3PO3 J;  2DA5 A;  1RKT A;  3E6M A;  2ZKZ A;  5E20 A;  3MKL A;  1XD7 A;  2H8R A;  3K7A J;  1SEU A;  1B4A A;  1KU7 A;  2KJC A;  2DOE A;  1XGS A;  1KQ9 A;  4BXX J;  4UVB A;  4HW0 A;  4HAM A;  4QTR A;  4FAS D;  3A0B C;  3KYD B;  2WWY A;  2QVO A;  1WWX A;  2VC0 A;  2R7X A;  4YFX F;  1K7A A;  2OAZ A;  3TW7 A;  3FXO A;  5GP9 A;  4KT5 C;  2DA6 A;  1SAN A;  2XUB A;  4JK1 X;  4PDK A;  2Z1D A;  1JHF A;  5D5W B;  3HPG A;  2X48 A;  3RYP A;  5GAH J;  4OIP F;  3JW4 A;  4BEH A;  3CLQ A;  3ZQI A;  4D5F A;  2V1D A;  3OYK A;  1W7P B;  3B73 A;  3OR2 C;  4YII A;  1NH3 A;  1WI3 A;  4KIT B;  1P4W A;  5BPI A;  5JI6 A;  3LST A;  2DLL A;  2HOT A;  1VQN I;  1X2M A;  2XPV A;  3EUA A;  4XLP F;  4BH9 A;  2Z3Y A;  2L01 A;  3OR1 C;  4CUG A;  2PJR B;  4U0Y A;  3BTL A;  4LK0 F;  1ETW A;  4HNT A;  1O4X A;  3ZQG A;  3RQ4 A;  2Q2E A;  3OY9 A;  4IX7 A;  1KYW A;  1XSV A;  1G2H A;  3TOA A;  3S2H J;  3GW2 A;  2BXY A;  2VUM J;  5K5Q A;  1MH3 A;  1X19 A;  1TL8 A;  2EZH A;  5AIP A;  1PYV A;  3T5X A;  1BIA A;  1XSD A;  4YFN F;  2NXN B;  4EM0 B;  3HHH A;  1Y8R B;  2Y48 A;  3GZN B;  3O6B B;  3SFZ A;  3LMM A;  2HEO A;  4UVC A;  4IHW A;  4ENK A;  3H0G J;  5B5E C;  1ETY A;  2BY0 A;  2FX0 A;  1X2N A;  2FNA A;  1R9T J;  1UFM A;  2GA2 A;  3W2V A;  5DD8 A;  2I5U A;  3K10 A;  5LGU A;  2VC1 A;  3H9Q A;  1Z3X A;  4B48 A;  2VJ5 A;  2ZSH B;  2HZT A;  1PP8 F;  4M3D A;  2CUJ A;  1RIO H;  2M30 A;  2IP2 A;  3ASO H;  5A2Q Z;  1BW5 A;  2ZCW A;  2XAF A;  2Y69 H;  4LD5 A;  2NVY J;  1XGM A;  1G3W A;  2UXX A;  1FOW A;  3ASN H;  3ERE D;  2OPT A;  1YX5 A;  3MQ0 A;  4ZZD A;  4RAY A;  4ZZL A;  2R7D A;  5LEJ A;  1RES A;  3I58 A;  5LLQ A;  1L3L A;  2QQB A;  1I27 A;  1KYZ A;  2CW7 A;  3LAP A;  3CCL I;  4A3C J;  3OMY A;  3ZQF A;  1YW9 A;  3GUD A;  3GYH X;  3CCE I;  3K70 C;  4IRG A;  3ZQQ A;  3LNQ A;  2VOO A;  2QWW A;  1P6R A;  1QA6 A;  2X51 A;  1S6L A;  2PI0 A;  2DA4 A;  2O0Y A;  5TIS C;  2Q8K A;  3IH2 A;  1VFC A;  1X1P A;  1JKO C;  2H94 A;  4UUV A;  2DQL A;  1PUF A;  1Z7L A;  4NC7 A;  1LFB A;  4A3K J;  1J59 A;  4ZJZ A;  1LPQ A;  3LWF A;  2AQF A;  1R5I D;  4FCY A;  1FPQ A;  3MZ8 A;  1BI2 A;  3CDH A;  3J7Y J;  2V6E A;  3ABL H;  2ZB9 A;  5LHH A;  3FXL A;  2MAB A;  3HSR A;  4IHT A;  3J81 K;  1MBK A;  2EFN A;  4XLC A;  3RCO A;  4MIM A;  2ELH A;  2DDA A;  3FMR A;  4DJA A;  3FZV A;  3ABT A;  1ZGA A;  1MKM A;  1R1V A;  5HLI A;  2A69 F;  3BR1 A;  2MG4 A;  5BMZ A;  2V79 A;  1EH8 A;  1GHC A;  1GVD A;  4I0B A;  4ESJ A;  3MN2 A;  5K1Y A;  1B72 A;  4RMN A;  5HLT A;  4D7M A;  3C2B A;  1VQM I;  1MBE A;  1UMQ A;  2V26 A;  3BC8 A;  3DWL E;  3SEQ A;  1D1C A;  1U2W A;  3VSK A;  4XLE A;  4ENM A;  2NVU B;  3Q9S A;  5FD5 A;  4V19 K;  3K2A A;  3JRA A;  1Y56 A;  2RDP A;  2R5Y B;  2MLG A;  2R5Z A;  4HQE A;  1W1W E;  2WAF A;  3DPU A;  2K86 A;  2R7O A;  4MLO A;  2B63 J;  3DKY A;  2JA6 J;  2RN7 A;  1ZAR A;  2EFW A;  3ZPL A;  4KA4 A;  2Z33 A;  2HDC A;  2LTP A;  3H1C A;  1X1B A;  2LH9 A;  2OV7 A;  3HSF A;  1SMY F;  4XN3 A;  2KRC A;  4E7L A;  1ZGJ A;  1V5G A;  2HWV A;  4IHX A;  3RI4 A;  2KP6 A;  1TZL A;  2LRD A;  4AVP A;  2KRF A;  2H27 A;  1BOB A;  2CUZ A;  4AD9 A;  1WKM A;  1BC7 C;  4HX7 A;  4AVZ A;  3SHF A;  2GQQ A;  3VPR A;  1IRX A;  3BG5 A;  5F0H A;  3H36 A;  2GXA A;  3RPQ A;  2JRT A;  4BL0 B;  2XPU A;  5JHF A;  2XF5 A;  3M1C A;  4G9Y A;  4RB3 C;  4EV0 A;  2NS0 A;  4DW6 A;  4MEY F;  5DV5 A;  5EYR A;  5E18 F;  2O61 A;  4BQQ A;  2X1E A;  1OCO H;  4XRS A;  1WRJ A;  1OCT C;  5FKN A;  1YLF A;  3LAJ A;  5DD4 A;  2K02 A;  2Y9Y A;  5H6R A;  1QHG A;  4HNV A;  3JRF A;  3AL0 C;  2VJI A;  3CUO A;  2XB5 A;  3QPH A;  3K4N A;  1K78 A;  1XDU A;  1YHQ I;  5M5X J;  1VZ0 A;  1W5S A;  3QPS A;  1H8A C;  3JRC A;  3LOC A;  1HW1 A;  1ZR4 A;  2XRN A;  2E5N A;  2BY3 A;  3CCY A;  3PNT A;  4MGR A;  4OU0 A;  4DIQ A;  1WPK A;  3O2P E;  4EM2 A;  3GBG A;  5LD2 C;  5FKL A;  3CP8 A;  4TV7 A;  4ZDL A;  4I7H A;  4WCG A;  3SJM A;  4L0Z B;  3VYR B;  1WQ2 A;  3L2R A;  1QZE A;  4FX0 A;  2YU3 A;  2MFZ A;  3FM3 A;  1W5C C;  4AYB A;  4DOZ A;  1B8I A;  2ZNY A;  1X1D A;  3RPU D;  1YRN B;  3OL3 A;  1HA8 A;  1Z0X A;  2NRA C;  4A3J J;  3HHG A;  2J5O A;  2R3S A;  5CVV A;  5D8K B;  2HQA A;  4HDU A;  1X1A A;  4IOC F;  2ISZ A;  1SD4 A;  1MBH A;  2R7S A;  1RR8 C;  3F23 A;  1Y6I A;  3GTG J;  2GIZ A;  3AFH A;  4Y17 A;  2D2W A;  1LFP A;  1TNT A;  3VWB A;  1AOY A;  5DCF A;  2W82 A;  2O7O A;  5HOO A;  2QBY B;  2A5W A;  1ENH A;  3OYC A;  5HLH A;  2ZJP F;  1IN4 A;  3I4P A;  3I4N J;  2ELK A;  1HF0 A;  1HKT A;  1JT6 A;  2OZU A;  2PN6 A;  2Z99 A;  4NNJ A;  4A3D J;  2PLY A;  4L9V A;  4W97 A;  4J00 A;  3LSI A;  1XSX A;  4EJU A;  4FET A;  4I02 A;  2HNH A;  5GTH C;  2KKO A;  4WWC A;  1T08 B;  5D6F A;  2R7Z J;  1DPU A;  4X6A J;  4N0B A;  2WB1 N;  3ZQ7 A;  4ETS A;  1OLT A;  4M73 A;  4IO9 F;  1I5Z A;  1OCC H;  3TO6 A;  1WVR A;  4PSW A;  3KEQ A;  2A68 F;  3U21 A;  2KDZ A;  5DTD A;  5ICE A;  4BS9 A;  1UHM A;  2ZXI A;  2ESH A;  1LE8 A;  3FF5 A;  2HVQ A;  2K40 A;  4A0Z A;  1T0F C;  1YI2 I;  2IPQ X;  1FLI A;  3QP5 A;  3AL0 B;  2HQR A;  3QPL A;  2CUF A;  4WXD A;  1C0W A;  3OV8 A;  1LJ9 A;  3TDZ C;  1UST A;  2G9W A;  2CH0 A;  2JN6 A;  1NK3 P;  2XPW A;  3M8J A;  5E3O A;  2K9Q A;  2IEK A;  3S8P A;  3HKZ A;  1Z91 A;  4L5I A;  5JR3 A;  3S2W A;  2L9N A;  1WJ5 A;  3GFJ A;  1LQ1 A;  4I98 B;  1OMI A;  2GAU A;  2R7F A;  2RVC A;  1DGR M;  1SMT A;  1X3Z B;  4S0H B;  3KIO A;  1I6H J;  3IH4 A;  3RJP A;  4U7D A;  4OIQ F;  4Y4R A;  4DYR A;  2O8X A;  3A1Y A;  1FWZ A;  2DYS H;  5D5V B;  1OFC X;  3DEE A;  3MZY A;  3J7Z I;  1QGP A;  5HDG A;  1VQ5 I;  1ETQ A;  5DS9 A;  1CF7 A;  2GXB A;  5TGT A;  4KDP A;  2FQ3 A;  4HRI A;  1R22 A;  2CS3 A;  1B1B A;  3BP8 A;  3I4M J;  2KIQ A;  1J09 A;  4M9Z A;  3ZCO A;  1G59 A;  4RLQ A;  2DOD A;  5IOY A;  2CV1 A;  2V1X A;  2EQR A;  1QZZ A;  4CGZ A;  2JSP A;  4HX4 A;  3RZO J;  4S05 A;  2Y2Z A;  3ZRG A;  3HPH A;  4EJT A;  3CLO A;  2HI3 A;  1B72 B;  1AA7 A;  2ISY A;  3CZ6 A;  2CJJ A;  2F48 A;  4M74 A;  1N75 A;  4A5N A;  1MDM B;  1HSJ A;  1IW7 F;  3ZMU A;  5IPA A;  1HC8 A;  4CCM A;  1D5Y A;  2X6O A;  4D7N A;  2PX9 A;  4UHT A;  2A6T A;  4LIT A;  2Q1Z B;  2WY8 Q;  2KL4 A;  3G4S I;  5FJ8 J;  2VB6 A;  3JTG A;  2P5K A;  2W24 A;  3TW6 A;  2NYX A;  4BBR J;  3QQA A;  2JT1 A;  1AKH A;  3OOP A;  1EKE A;  5CVI A;  3J7A O;  5HS8 A;  2HTJ A;  3I59 A;  1OQY A;  2WA0 A;  1K79 A;  1XX5 A;  3FMQ A;  3IV5 A;  2RQP A;  5M3F J;  3FKI J;  2M2E A;  2CFO A;  3C7J A;  2FE3 A;  3G3Z A;  2K5C A;  3TO7 A;  1TWA J;  4LG3 A;  4ZH4 F;  4HSR A;  3K2Z A;  3IRR A;  6PAX A;  2XAJ A;  5K5O A;  3ISP A;  4CCJ A;  3HRU A;  3CCV I;  2CW8 A;  2GOM A;  1VQP I;  1D0Z A;  2CV2 A;  3FM5 A;  2CW0 F;  3HG9 A;  4BYY A;  9ANT A;  2L02 A;  1O3R A;  3D5S C;  3RZD J;  3G2B A;  3GCM A;  3M07 A;  1IAW A;  5B1B H;  2WAQ N;  3HRT A;  3GLX A;  2IGO A;  3E1S A;  3E6D A;  4XKC A;  3SXY A;  4MFD A;  3L2Q A;  3CJN A;  2X9D A;  1VQO I;  2DPU A;  2YX4 A;  1DPR A;  1FIA A;  4MTE A;  1S7E A;  1QO0 D;  2G7H A;  4HV5 A;  1YX3 A;  3SYT A;  2LY2 A;  1STZ A;  5IYB J;  3CO7 C;  3L00 A;  4ZYH A;  5ILS A;  1J9I A;  3MZH A;  1JUS A;  2IBD A;  4JOM A;  2OUM A;  2ETH A;  2MD0 A;  2W7N A;  3D0S A;  3M4O J;  3L2U A;  2HU9 A;  4EQQ A;  2QYO A;  1B8I B;  2ZFU A;  1D3Y A;  3MWM A;  5FKM A;  4BKX A;  2HKO A;  2TDX A;  5BS6 A;  5KNL A;  2CMP A;  1HOM A;  4ANJ A;  2QKM B;  3CDI A;  5E17 F;  4BXF A;  2TRT A;  1DP3 A;  1YO5 C;  1LDK B;  2EZI A;  3BG7 A;  2UV1 A;  3WOD F;  4PJM A;  3JAM K;  3I0T A;  1XMX A;  2MLK A;  3L1P A;  2L4A A;  1CGP A;  5J8F A;  1ON2 A;  3WTX C;  2X85 A;  5F0C A;  2H1L A;  2W48 A;  3W6J B;  1YFH A;  4CH7 A;  1UJ8 A;  3LL7 A;  4C9Y A;  1Y8Q B;  1OYI A;  1GV5 A;  4LLN A;  4G7Z F;  1OR7 A;  4OAY A;  3BTC A;  3QWL A;  1VQ6 I;  3GTL J;  4P1W A;  2PMH A;  3M8E A;  1ETX A;  3P5J A;  1E3P A;  1WH5 A;  4KUM A;  5HS9 A;  2LBF A;  4C3I J;  3B02 A;  3KP6 A;  4IRH A;  4II3 A;  4BUP A;  4CYC B;  2O8K A;  5JVT A;  1P7I A;  4F91 B;  4XBF A;  3A2K A;  4IRI A;  1IXC A;  5L3C A;  1VND A;  2R7V A;  1MIJ A;  4LOC A;  4B44 A;  2LSO A;  1RI7 A;  1ZK8 A;  1KU9 A;  3RPU A;  3WU0 A;  3RKY A;  4A0X A;  1LB2 A;  4KIC A;  2J5P A;  2XB0 X;  2M7B A;  2M87 A;  1LEB A;  1MBG A;  2XDV A;  3HC7 A;  3FK6 A;  2JVG A;  2H1K A;  4EGY A;  2F5D A;  5KHD A;  1JJ8 C;  2JQ7 A;  3ZQC A;  4EM1 A;  3K4M A;  4XRF A;  2M4G A;  3OIQ A;  1IV8 A;  2M0M A;  4FE4 A;  1WJB A;  4E4H A;  2ZXH A;  3W6K B;  4RGS A;  2BHZ A;  1S7A A;  4OAZ A;  5F04 A;  2X4H A;  3FXU A;  1FY7 A;  5ILU A;  2YSR A;  1P92 A;  2EPF A;  3HGG A;  1R5G A;  4GGG A;  2MH9 A;  3KP2 A;  1U9O A;  1FT9 A;  4LJZ F;  1MJB A;  3K1M A;  4LIV A;  5JHU A;  1F36 A;  2LD5 A;  2VQC A;  1IG7 A;  2XHK A;  3M1E A;  5DCM A;  1T8I A;  4Z2Y A;  4Y15 A;  1LNW A;  1ZAO A;  5HVQ C;  2WV0 A;  4CCN A;  2PEX A;  4I76 A;  2DA1 A;  1SAU A;  5FRO A;  5J1R A;  1XB4 A;  4ENN A;  2IA1 A;  1IC8 A;  3EPZ A;  1SVL A;  2DW4 A;  3MAJ A;  3PJR A;  3GO5 A;  3KP5 A;  2WTE A;  3S16 J;  1G8X A;  1IF1 A;  2DO7 A;  3WTV C;  2CO5 A;  1VF9 A;  3ULQ B;  3CCU I;  5J47 A;  1B59 A;  4NHJ A;  5BQT A;  2VXZ A;  1U8B A;  1DDN A;  1BBY A;  3CDL A;  2MGQ A;  3VEP A;  4CCK A;  2XAS A;  1Y1W J;  4N4N B;  3LSH A;  2A07 F;  4CXF A;  1JT0 A;  2ZO4 A;  2YR2 A;  2LRE A;  4EMS A;  5DM6 F;  3HL2 A;  1VI0 A;  1E17 A;  3LQR A;  3P9K A;  5K7Z A;  1Y39 A;  5FD6 A;  2M4K A;  4WXH A;  4DBQ A;  4R1H A;  3HEF A;  1U0J A;  4LB6 B;  3H0D A;  4XOP A;  1YQA A;  2WBM A;  3R61 A;  1SFE A;  2DFE A;  3CMM A;  4RDU A;  3CCS I;  4BBS J;  4ON0 A;  1XTA A;  2TCT A;  3TED A;  4GFB A;  1VQ8 I;  1WHU A;  2FUG 2;  4LLG F;  2QQ9 A;  3KFW X;  4C2T A;  4XSX F;  3CC7 I;  3OYI A;  1MH4 A;  3A01 A;  4XIC A;  2LYC A;  1YS6 A;  3H9J A;  2CRG A;  1REP C;  2ZME A;  3SQN A;  1V4R A;  2O03 A;  1ON1 A;  4HEA 2;  3T0Y A;  2HR3 A;  4UV8 A;  1UG2 A;  1YJN I;  5D4S A;  2H6B A;  5E1X A;  3IWF A;  4XLH A;  2UWM A;  4KJZ A;  4YRV A;  5K5R A;  4BGD A;  2XGX A;  1UHW A;  3KP3 A;  1K4S A;  2E2J J;  3G1O A;  3BG3 A;  3ABU A;  3ZR8 X;  5EG0 A;  4IHY A;  3DXJ F;  3VSL A;  4HX8 A;  2EWN A;  4A6E A;  5J1Y A;  1YE9 A;  5JFR A;  1R6R A;  3CC2 I;  2W85 A;  1T98 A;  2VON A;  5ED4 A;  3WHB A;  4DZP A;  2O9L A;  3ONQ A;  3EUK L;  1R49 A;  2DMP A;  1A36 A;  4UVA A;  1JKP C;  2D5V A;  1XCV A;  2G0E A;  2FBH A;  3KEO A;  3QP6 A;  2JVH A;  1Z21 A;  2FD5 A;  3S32 A;  3ZMZ A;  4EGZ A;  4FX4 A;  3HOV J;  3BR5 A;  1TW2 A;  1U5T A;  5H6Q A;  3DCF A;  2MYS A;  2F4I A;  4NUB A;  2E1O A;  3M8F A;  1I39 A;  3TL4 X;  2XAQ A;  3IUO A;  4EEF G;  2IGN A;  3CUQ A;  3IKV A;  2CV0 A;  3JAM Z;  1Z6R A;  3S1N J;  3GTK J;  3WE3 A;  2K85 A;  3QOE A;  1EV7 A;  3J80 Z;  3WHC A;  1A35 A;  3KPH A;  2HDD A;  4GRI A;  5DEQ A;  1BC8 C;  3HDD A;  3DF8 A;  1T95 A;  5D5X B;  1YIJ I;  3VOE A;  3FK7 A;  5D5U B;  4KFC A;  1M1E B;  1EJ9 A;  4B43 A;  3BOQ A;  4MO7 A;  4N9I A;  2F4O B;  3JRB A;  2VN2 A;  4GDF A;  1ZG1 A;  2Y0S N;  3BCA A;  1D5V A;  1OPC A;  3F8B A;  2D45 A;  1B9N A;  5F64 A;  1LKX A;  1K6O A;  3WGI A;  4IJA A;  1K4T A;  4QSH A;  2HFH A;  3DLL F;  2R7W A;  1VQ7 I;  1TT5 B;  3ZMV A;  3IRQ A;  5EF6 A;  3VFZ A;  5CVU A;  4ASN A;  1FYK A;  2CQN A;  3HOU J;  1MSE C;  2KIS A;  2ME6 A;  3WU1 B;  2OTJ I;  1W7P D;  1A6I A;  3OIP A;  4CCL A;  3IC7 A;  3C1D A;  1XMA A;  1OYY A;  2JA8 J;  4BDY A;  3E97 A;  1KGS A;  3D1N I;  4IKF A;  3KLO A;  3PQK A;  4A3G J;  5C44 J;  1GT0 C;  1WJD A;  2FQ4 A;  2ZJQ F;  3BZK A;  4D1Q A;  1KU3 A;  3ZMS A;  4ESF A;  1HBX G;  2LY9 A;  5AON A;  1Y0N A;  3GTJ J;  2PMZ N;  2DFH A;  3DBR B;  3BR6 A;  3REO A;  4BHC A;  4D0P A;  4EJW A;  3OYE A;  2NS7 A;  4Q4Z F;  1SFU A;  2DOA A;  1TQP A;  1R1T A;  4ZYA A;  1L0O C;  2IGM A;  3H5N A;  3HUG B;  2V4J C;  3U2R A;  2Z16 A;  1PVE A;  3IP4 B;  2HQN A;  4A3E J;  4A93 J;  3QYE A;  1PP7 U;  1RET A;  4A6D A;  3CTA A;  4JX5 A;  4MQ9 F;  3WU2 C;  1QNT A;  1RNL A;  2K4J A;  4CIC A;  5IT9 Z;  4RGR A;  1X4P A;  2AQE A; 
#chains in the Genus database with same CATH homology
 5IYC J;  4XID A;  2CU7 A;  2GM4 A;  1W0T A;  2LVS A;  3JRH A;  1OFC X;  2QF7 A;  1OCP A;  3GTP J;  4MFE A;  4RBO A;  1E3O C;  1TC3 C;  2E2I J;  1YRN A;  3GTM J;  3SFI A;  1JTY A;  2LP0 A;  4M3G A;  1ETQ A;  5DS9 A;  2DN0 A;  3OSG A;  4M3F A;  4IHV A;  4UUS B;  2DMU A;  5IYD J;  1T56 A;  1T33 A;  1BL0 A;  3I4M J;  1WCM J;  4C3J J;  3HM5 A;  2YS9 A;  2E2H J;  2AO9 A;  4JYK A;  4JX4 A;  1IGN A;  4FIS A;  4AC0 A;  1ORK A;  2HOA A;  4X1E A;  5IOY A;  5F08 A;  1I50 J;  3IH3 A;  5C4X J;  2EQR A;  3H3V K;  3RZO J;  5GPA A;  4B4C A;  2Y2Z A;  4M3B A;  3LSP A;  3ZOB A;  2HI3 A;  3TP0 A;  1B72 B;  3W6V A;  5BNG A;  1FTT A;  2CJJ A;  2Y30 A;  1FTZ A;  2LLK A;  1RPW A;  2M9H A;  1Q1V A;  5IPA A;  3NAR A;  2YU9 J;  4M6V A;  2L7M P;  1FIP A;  2EBI A;  1D5Y A;  1WGX A;  2DA3 A;  2X6O A;  4D7N A;  5M5Y J;  3OIO A;  1JKR C;  2M0C A;  5FJ8 J;  2AHQ A;  2EH3 A;  3Q3S A;  1TWC J;  5IP9 J;  1ZR2 A;  3TW6 A;  1HLV A;  2VI6 A;  4B3A A;  4BBR J;  3QQA A;  5E3L A;  2MW8 A;  1AKH A;  2L9R A;  1TWH J;  1IDY A;  2R5Y A;  3G1M A;  5IP6 A;  1IRZ A;  1K83 J;  3IV5 A;  3S1M J;  3HOW J;  2KT0 A;  5M3F J;  1RR7 A;  4C3H J;  3FKI J;  2M2E A;  1I3Q J;  2JJ7 A;  2ECB A;  5HOD A;  2M34 A;  4A3I J;  1TWA J;  1U78 A;  1BW6 A;  4DYC A;  1U9N A;  3JR9 A;  3BR0 A;  2R92 J;  2FJ1 A;  3OOU A;  4W1U A;  5EGO B;  2Y9Z A;  1IV6 A;  2VKE A;  3BQY A;  3GTQ J;  9ANT A;  3DEW A;  3BG9 A;  3RKQ A;  3RZD J;  2HOS A;  1BJZ A;  2E19 A;  3GTO J;  2WAQ N;  3JRE A;  3NAU A;  3PO3 J;  2DA5 A;  1RKT A;  3MKL A;  2H8R A;  3M3Y J;  3K7A J;  4MFD A;  1JGG A;  4Y7N J;  2X9D A;  4BY1 J;  1FIA A;  1S7E A;  4BXX J;  1APL C;  3BTJ A;  4QTR A;  5IYB J;  2OF7 A;  4B1R A;  3TW7 A;  3LSR A;  2NVQ J;  5GP9 A;  3Q0W A;  4IEJ A;  2DA6 A;  1SAN A;  1Y1V J;  1TWF J;  4C2M J;  4Y52 J;  2X48 A;  5J1U A;  5E3M A;  1JUS A;  2IBD A;  3ZQL A;  4D5F A;  3LSJ A;  3ZQI A;  5FLM J;  3M4O J;  1B8I B;  5FKM A;  4BKX A;  1WI3 A;  1HOM A;  1PUF B;  2HOT A;  1X2M A;  2XPV A;  1AHD P;  2VKV A;  2TRT A;  2IAI A;  2EZI A;  3BTL A;  1ETW A;  3UKG A;  1O4X A;  1ETK A;  3ZQG A;  3OSF A;  5M3M J;  1TWG J;  2K9N A;  4L5E A;  3L1P A;  3CMY A;  1ZQ3 P;  1G2H A;  5F0C A;  3S2H J;  2W48 A;  3JRG A;  2VUM J;  2DMQ A;  3F0C A;  2CQX A;  1MH3 A;  4A3B J;  1GV5 A;  2EZH A;  4G12 A;  3Q0U A;  3BTC A;  4DYQ A;  3GTL J;  5EZH A;  1K61 A;  1ETX A;  1WH5 A;  4IHW A;  3H0G J;  4C3I J;  2LKX A;  2XGD A;  2N8G A;  4V2F A;  4CYC B;  2O8K A;  2R93 J;  5EGO A;  1P7I A;  1ETY A;  3RQI A;  2FX0 A;  1X2N A;  1R9T J;  1QRY A;  1AU7 A;  2JMW A;  2DA7 A;  3S1R J;  1VND A;  4LOC A;  2QCO A;  3PM1 A;  4FE7 A;  1ZK8 A;  3HOZ J;  4A69 C;  4M3D A;  1NK2 P;  1XS9 A;  2HQ5 A;  2XB0 X;  3HOX J;  1BW5 A;  1JJ6 C;  2ID6 A;  1MBG A;  2R5Z B;  3S17 J;  3FK6 A;  3TP3 A;  2NVY J;  3A01 B;  5EDN A;  2H1K A;  1X58 A;  2K9S A;  3O8H A;  2OPT A;  1JJ8 C;  3ZQC A;  4M3E A;  3O8G A;  2Y31 A;  2CQQ A;  1QVT A;  4DZJ A;  3BTI A;  4FE4 A;  2JA5 J;  2L7Z A;  4A3L J;  1RES A;  1EF4 A;  1POG A;  4A3C J;  3ZQF A;  3BQZ A;  5C3E J;  5F04 A;  2VPR A;  2LR8 A;  3SDG A;  3LNQ A;  3HGG A;  3S2D J;  1U9O A;  2GLO A;  2DA4 A;  1JKO C;  3IH2 A;  1VFC A;  1WH7 A;  5EG0 B;  2HXO A;  1BA5 A;  1PUF A;  1IJW C;  1F36 A;  2LD5 A;  1ZGW A;  2NVX J;  1LFB A;  1IG7 A;  4A3K J;  3A03 A;  3S15 J;  2YUS A;  4FCY A;  4I76 A;  2DA1 A;  3A02 A;  5J1R A;  5JLX A;  5JLW A;  4UUS A;  1OJL A;  1IC8 A;  2ZB9 A;  3LSG A;  3HBL A;  1MBK A;  3S16 J;  1JKQ C;  2MSY A;  1VF9 A;  1HDD C;  4MIM A;  2XRL A;  2NS8 A;  1U8B A;  3CDL A;  5F1J A;  2MGQ A;  4J19 A;  3BR1 A;  1A5J A;  2GBY A;  3JRI A;  2MG4 A;  4NDL A;  1Y1W J;  1NTC A;  4CYC A;  1JT0 A;  2DJN A;  1FEX A;  1GVD A;  1VI0 A;  2XGE A;  5K7Z A;  1GUU A;  3S14 J;  2R0Q C;  3MN2 A;  1B72 A;  3HEF A;  1UHS A;  3C2B A;  3ZQH A;  4D7M A;  1W0U A;  4RDU A;  1MBE A;  1UMQ A;  1CQT A;  4AUX A;  4BBS J;  2ECC A;  2TCT A;  2COB A;  3TED A;  4GFB A;  3K2A A;  5FKK A;  5EEA A;  3JRA A;  3BT9 A;  2R5Y B;  2R5Z A;  4QIW N;  4MLO A;  2B63 J;  1MH4 A;  3A01 A;  2JA6 J;  4XIC A;  2LTP A;  2CRG A;  3HOY J;  5EZG A;  2ME0 A;  3G1L A;  5FKO A;  1UG2 A;  1IUF A;  3CQZ J;  4IHX A;  1SFO J;  1GV2 A;  4AYB N;  1ZTR A;  1Z77 A;  1RKW A;  5E3N A;  2CUE A;  3VPR A;  2E2J J;  3G1O A;  5IP7 J;  5GPC A;  3BG3 A;  1FJL A;  5EG0 A;  1QVU A;  3BG5 A;  3Q0V A;  4IHY A;  5F0H A;  5J3L A;  1ETV A;  3MVP A;  2XPU A;  5J1Y A;  4DW6 A;  5EYR A;  1H89 C;  3WHB A;  4DZP A;  2O9L A;  2DMP A;  5F27 A;  4XRS A;  4FTH A;  1LE8 B;  1JKP C;  1OCT C;  5FLV A;  2D5V A;  2G0E A;  2HXI A;  5FKN A;  1XC5 A;  2Y9Y A;  3JRF A;  4HNV A;  2FD5 A;  2XB5 A;  2DMT A;  3HOV J;  3BR5 A;  1DU6 A;  3FIW A;  5M5X J;  1H8A C;  3QPS A;  4UUT A;  3JRC A;  3LOC A;  1HDP A;  3DCF A;  4XK4 A;  5F0F A;  1ZR4 A;  3E7L A;  1JUM A;  3CCY A;  2XGC A;  2E1O A;  4ABZ A;  5C4J J;  1WPK A;  4EEF G;  3GBG A;  2M8G X;  4JX6 A;  5FKL A;  1JTX A;  3S1N J;  2L7F P;  3GTK J;  3HGY A;  2DMN A;  3SJM A;  1IDZ A;  1MBJ A;  1MSF C;  2NVT J;  3JRD A;  3WHC A;  2HDD A;  3HDD A;  3HB9 A;  3FK7 A;  1B8I A;  2L0K A;  1YRN B;  4XRM A;  4MO7 A;  1QPI A;  1Z0X A;  4A3J J;  3JRB A;  3HKZ N;  2Y0S N;  1MBH A;  5M5W J;  5K7H A;  3GTG J;  2XSD C;  1XG1 A;  3BR3 A;  2JK3 A;  4XRS G;  3B6C A;  2RAE A;  4A3M J;  5IOZ A;  4QSH A;  2O7O A;  1MNM C;  2DTZ A;  5K7F A;  1ENH A;  1HCR A;  3BR2 A;  3I4N J;  4D5C A;  2ELK A;  1HF0 A;  5EF6 A;  1JT6 A;  1F43 A;  4A3D J;  3HOU J;  2NOG A;  4W97 A;  2ME6 A;  1MSE C;  3FIS A;  1JUP A;  1ITY A;  1A6I A;  2R7Z J;  1H88 C;  4X6A J;  2WB1 N;  2JA8 J;  1P7J A;  2KDZ A;  2WV1 A;  2P81 A;  3D1N I;  2EZL A;  5DTD A;  4A3G J;  1GDT A;  5C44 J;  4A3F J;  1GT0 C;  3S1Q J;  2FQ4 A;  1LE8 A;  2K40 A;  2LY9 A;  3B6A A;  2JA7 J;  1AKH B;  2EZK A;  1LFU P;  3GTJ J;  4BY7 J;  2PMZ N;  3QPL A;  2CUF A;  1ETO A;  4JP0 A;  3BR6 A;  2NS7 A;  2JN6 A;  1NK3 P;  2XPW A;  5E3O A;  2K9Q A;  2IEK A;  2HYJ A;  1ZKG A;  4A3E J;  2ID3 A;  4A93 J;  2LFB A;  4S0H B;  1RET A;  3PO2 J;  1DU0 A;  4JX5 A;  2JWT A;  2DA2 A;  2I10 A;  1I6H J;  3IH4 A;  4V2G A;  4I6Z A;  2LK2 A;  4DYR A;  1MBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...