5BNGA

Monomer of tale type homeobox transcription factor meis1 complexes with specific dna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
59
structure length
59
Chain Sequence
PKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox protein Meis2
publication title DNA-dependent formation of transcription factor pairs alters their binding specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein/dna
total genus 15
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05920 Homeobox_KN Homeobox KN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5bngA00
2E19A 1ETOA 1W0UA 2X6OA 3TP3A 5F04A 2NVYJ 3PM1A 2JA6J 2HOSA 5FKOA 2ME6A 5IP6A 3ZOBA 1IDYA 2G0EA 4A3LJ 3FKIJ 4B4CA 2FJ1A 2B63J 4I6ZA 2IAIA 1P7IA 3BQZA 1BJZA 3O8HA 5EG0B 2HI3A 1ORKA 2HDDA 2R92J 3BG5A 1F43A 4HNVA 3M4OJ 1Y1VJ 1WPKA 2L7ZA 2N8GA 3SDGA 4MFEA 1X2NA 2HQ5A 4RDUA 2LY9A 2VI6A 5M5YJ 3NAUA 1FTTA 5FLMJ 1ZR2A 4W1UA 2Y31A 3GTLJ 3ZQLA 5EEAA 1MNMC 3L1PA 2COBA 2XGEA 1VF9A 2EBIA 3HOZJ 2DMPA 3Q0UA 2DA1A 5GP9A 4M3GA 5BNGA 4J19A 2RAEA 1GDTA 5GPAA 5F1JA 1WH7A 3H3VK 1UMQA 2XSDC 1FEXA 3BR1A 3A03A 4XK4A 2VPRA 3S17J 4A3IJ 4IHYA 1MBFA 5IOZA 3ZQGA 1U8BA 3S1QJ 3HOYJ 2ID6A 2EQRA 2NOGA 1TWGJ 3QPLA 1IRZA 4B3AA 4X6AJ 2NS7A 1B72B 3OSFA 2D5VA 1NTCA 1NK3P 1ZK8A 3MKLA 4MFDA 5E3LA 2LTPA 4A69C 4ABZA 4A3EJ 3LOCA 1JKQC 1VNDA 3FK7A 3GTMJ 1I6HJ 2XPUA 4BBSJ 3IH3A 4MO7A 3Q0WA 5EGOA 2DMTA 2IEKA 1JJ8C 4M3DA 4CYCA 2AHQA 3BTLA 1JT0A 2Y9YA 5EDNA 4A3GJ 1BL0A 2M34A 2XB5A 4A3KJ 1SFOJ 2JWTA 1H88C 2DA5A 5C4XJ 4LOCA 1FIAA 5J1YA 2O8KA 4NDLA 2R93J 2NVXJ 5F0HA 5IP7J 3HGYA 3K7AJ 1QVUA 2LLKA 2WV1A 1JUSA 4BKXA 2L9RA 1IJWC 1ENHA 3HOWJ 2DMNA 5EGOB 2XGCA 1ETVA 3HKZN 3LSRA 1ETKA 1H8AC 2K40A 1JKRC 4D7MA 4RBOA 2DA4A 1ITYA 1GT0C 2E2IJ 1NK2P 2JMWA 3IH4A 3C2BA 2TCTA 4EEFG 1HLVA 1TWCJ 5C3EJ 1UHSA 2MSYA 3OIOA 3VPRA 2KDZA 2DJNA 2K9QA 1MBEA 4A3DJ 1YRNB 3G1OA 4XRSA 2Y0SN 3MVPA 2L7FP 5EF6A 2ZB9A 2E2HJ 2JJ7A 4AC0A 4QTRA 5J1RA 3TW6A 2MG4A 2R0QC 1IV6A 3IV5A 3WHCA 3ZQCA 3MN2A 1JJ6C 3BR5A 5EZHA 3S16J 2DA6A 5IP9J 5F08A 3S2DJ 2XB0X 3QQAA 3JRBA 4FCYA 3S15J 2DMQA 1UG2A 2YU9J 3NARA 2HXIA 4BBRJ 1DU0A 4Y52J 1WCMJ 4UUTA 1WGXA 1RESA 5EZGA 3JRCA 1B72A 2YUSA 4C3IJ 1QPIA 2K9SA 4V2FA 5K7HA 2P81A 1E3OC 3BR0A 1BA5A 2L0KA 1RKTA 3G1MA 1OCTC 2KT0A 2R5ZB 4V2GA 3HGGA 3HOUJ 1I3QJ 4JX4A 1TC3C 4W97A 3S1MJ 2HOTA 2K9NA 3CMYA 2WAQN 1T33A 1S7EA 4JP0A 3S14J 1Z0XA 3A01B 2CU7A 3BR6A 5FLVA 2XRLA 2W48A 2PMZN 3GBGA 1B8IB 5F0CA 3HOXJ 3JR9A 3BR2A 1IGNA 4FTHA 3F0CA 1AU7A 3HEFA 1OJLA 3A02A 5IPAA 2LFBA 3IH2A 3TW7A 3HM5A 3Q0VA 2E2JJ 1ZKGA 2LK2A 4C3JJ 5M5WJ 1JT6A 3ZQFA 1JTXA 4A93J 1D5YA 1O4XA 3S2HJ 3FIWA 3RKQA 2LR8A 5J1UA 1MSFC 1ZTRA 3GTGJ 4D5CA 1JKOC 2E1OA 1ETYA 2Y2ZA 4DZJA 1ETWA 1A5JA 4A3JJ 5FKMA 1JGGA 2XGDA 1A6IA 2CQQA 1U9NA 1IDZA 1OFCX 5IYCJ 1U78A 5DTDA 1LFBA 4DW6A 5E3MA 3JRDA 3GTQJ 1R9TJ 2CUFA 5JLXA 3RZOJ 1OCPA 1YRNA 3PO3J 4IEJA 1LFUP 4JYKA 2MW8A 5FKLA 3CCYA 3SJMA 1DU6A 1U9OA 4QSHA 3BG9A 5K7ZA 5F27A 2CRGA 2TRTA 2R5YB 3HBLA 3BG3A 1ZQ3P 3LNQA 5FKNA 3G1LA 2OPTA 5M5XJ 1AHDP 5IYDJ 2FQ4A 5FJ8J 4A3MJ 2L7MP 1EF4A 3H0GJ 5C44J 2H1KA 3GTPJ 3PO2J 4M3BA 3DCFA 3GTKJ 5DS9A 3BR3A 2JA5J 4A3FJ 4G12A 1FIPA 1RPWA 2WB1N 4C3HJ 2JA7J 2MGQA 4IHVA 4X1EA 2AO9A 1ZGWA 1GV5A 2X48A 1XG1A 2M8GX 4QIWN 4C2MJ 2XPVA 2EZLA 2R5ZA 4BXXJ 1G2HA 2JA8J 1VFCA 2CJJA 4DYQA 1W0TA 2OF7A 3RQIA 3DEWA 3OSGA 1JTYA 3GTJJ 5F0FA 2M2EA 2GLOA 2CUEA 3Q3SA 1PUFA 2QF7A 4BY1J 4IHXA 3A01A 1MBGA 1HDDC 1MH4A 4DYRA 5E3OA 4XICA 1CQTA 2DTZA 1TWAJ 4JX5A 3ZQHA 1X58A 1B8IA 4S0HB 3BTIA 1WH5A 4D5FA 1Z77A 1F36A 1ETQA 5JLWA 1GUUA 3FISA 4Y7NJ 3K2AA 3JRAA 1MSEC 2GM4A 4FE7A 1HF0A 3OOUA 4A3CJ 4A3BJ 3GTOJ 2X9DA 5M3MJ 5EYRA 3SFIA 1HOMA 3LSPA 1LE8B 2EZHA 2HYJA 3TEDA 1XS9A 1PUFB 1MBHA 2LKXA 1WI3A 9ANTA 2I10A 1MH3A 1BW5A 2ME0A 3JRGA 1QRYA 2Y30A 1HCRA 1IG7A 5C4JJ 4FISA 3S1NJ 2NVQJ 4MIMA 3LSJA 5HODA 4UUSA 1Y1WJ 3CQZJ 1APLC 3JREA 2M0CA 2VKEA 1I50J 3JRFA 1MBKA 2DA2A 5IYBJ 4D7NA 1JUPA 3W6VA 2XPWA 2EH3A 4AYBN 2EZIA 2ECBA 3LSGA 3UKGA 2R5YA 3D1NI 2IBDA 3HB9A 1IC8A 1T56A 2ELKA 1GV2A 1SANA 2DN0A 3CDLA 2VUMJ 1X2MA 4JX6A 1ETXA 2YS9A 2VKVA 3BT9A 1FTZA 4UUSB 3M3YJ 2M9HA 5J3LA 1K61A 3HDDA 4GFBA 3WHBA 3FK6A 2ID3A 5GPCA 1RETA 1TWHJ 1RR7A 4M3EA 4BY7J 3E7LA 3B6AA 3ZQIA 1FJLA 2H8RA 3BTCA 4FE4A 3RZDJ 2O7OA 1AKHA 1RKWA 2JN6A 5M3FJ 3JRHA 3I4MJ 4B1RA 5K7FA 5E3NA 1K83J 2GBYA 3B6CA 2Y9ZA 1H89C 2FD5A 1TWFJ 2JK3A 1GVDA 1QVTA 2DMUA 1JKPC 2LP0A 2FX0A 3O8GA 2CQXA 2EZKA 4XRMA 5FKKA 4CYCB 2NVTJ 4MLOA 1IUFA 4XRSG 1HDPA 3JRIA 2DA3A 3TP0A 1XC5A 1POGA 2ECCA 4L5EA 5IOYA 2R7ZJ 4M3FA 3S1RJ 1BW6A 1VI0A 1JUMA 2QCOA 5EG0A 4DYCA 1P7JA 2DA7A 1AKHB 2HOAA 3BQYA 2LD5A 4M6VA 3QPSA 2O9LA 1LE8A 1MBJA 4XIDA 1ZR4A 4I76A 4IHWA 1Q1VA 2HXOA 2NS8A 4AUXA 3BTJA 3I4NJ 4DZPA 2LVSA 3HOVJ
chains in the Genus database with same CATH superfamily
1GLNA 3I53A 4WF2A 2IW5A 5F04A 1G3YA 2NVYJ 3GZNB 1AOYA 1YHQI 1ZH5A 5BPDA 2RNJA 3ZN1A 4UVCA 4G8XA 3OS1A 2KQRA 4KISA 1Z05A 4I6ZA 2HDCA 2DK5A 3QOEA 3O8HA 2B9SA 3R0JA 1S8NA 1O3RA 5LHIA 2M8EA 4HNVA 2YX4A 1Y56A 4BXUA 1WPKA 5D8LB 2WY7Q 2XVCA 4A6EA 1X2NA 2DPDA 1W7PB 3V8LA 2VE9A 2EA4A 2F4MB 3LWFA 4KMUX 2F6CA 3DTEA 3F72A 4BU2A 1Y0NA 3R0AA 1WJFA 3M8JA 2HVRA 3KP5A 3HOZJ 3Q0UA 4ANJA 1WZ2A 3SDBA 5H2FC 4M3GA 5LRSA 5BNGA 4TV7A 3LAPA 4B8XA 2MLKA 3ZMSA 1LPQA 1GDTA 4EJTA 3CJNA 1FEXA 4U87A 4KA4A 1MW7A 3OR1C 3ZQGA 4AIKA 2ID6A 1UCRA 3L00A 2EQRA 3DU6A 1TWGJ 2JSPA 4NBQA 3HJEA 4XOTA 1SC7A 2QENA 2EV6A 4NQWA 1LDDA 5E20A 1B72B 1FSHA 5GTHC 1X1BA 3CJRB 3G3ZA 5KHDA 3S3MA 3H5NA 3HZJA 2CWEA 1BI2A 2AS5F 2DDBA 1SVMA 4BHBA 3LOCA 3IKTA 1ZRCA 3GTMJ 5E1XA 1I6HJ 2XPUA 3PNVA 4BBSJ 1Y39A 3IH3A 2ZCWA 3Q0WA 4RGUA 2DMTA 1OCRH 1W1WE 3K0LA 2AHQA 4RB0A 4A3GJ 1I1GA 3O6BB 4UV9A 5CPRB 4UNOA 1SVLA 4JK1X 4M71A 1B1BA 3KYCB 1L3LA 5D6FA 2R7RA 2DA5A 1MMDA 2MYSA 2R4GA 1LQ1A 5C4XJ 4CCMA 4UB8C 4EJVA 1SAXA 3B73A 2Z9OA 5F0HA 1BI0A 3SFZA 1QVUA 2DQRA 2QM3A 2G7UA 2HU9A 2CQKA 3E97A 2L9RA 3EUHA 2RQQA 1ENHA 2PBIA 2O03A 2V79A 3V42A 4L18B 2DMNA 4E6KG 2IGOA 2ISZA 4B43A 4LFUA 4EATA 3HKZN 4HLXA 1YIJI 1XDSA 3LSRA 4L0ZB 1KA8A 1ZLJA 2NRAC 3OYIA 4D7MA 2NXNB 5AIQA 3V7CA 4BJ5C 1GT0C 3LSTA 1LVKA 2E60A 3IH4A 5IT9Z 1OR7C 2F4OB 1RIOH 5KCMA 4G6DA 1SFKA 5C3EJ 2MSYA 2VC0A 1YJNI 2WADA 3ML6A 1KQ8A 3ZMDA 2P7VB 2KDZA 4LGWA 2OZ6A 2M7BA 2DJNA 4YIFA 2JRMA 1YRNB 3G1OA 2EFPA 2ACJA 1U5TC 3QYEA 3KZYA 4LMYA 1V5FA 1B4AA 4FX0A 4AC0A 3TW6A 2F5EA 2DFHA 4DGWB 2R0QC 1HKTA 2PEXA 1TP4A 1ZREA 3L09A 1TBXA 5LD2C 4G7ZF 2DK8A 1CF7A 2EIJH 3E5QA 3MN2A 1BOBA 4GO1A 2DA6A 4Y3OA 1D3YA 3JRBA 4RLQA 1QU3A 4XSXF 2ZO4A 4IOCF 5TJJA 2DMQA 1FC3A 1UG2A 1XCVA 3J80K 3W2WA 1TT5B 3C7JA 5HLTA 2YU9J 1XDUA 3W6KB 1IXRC 2OBPA 3OYLA 1P4AA 1DU0A 1I27A 3W6JB 1EH8A 2NYXA 2K86A 3MZHA 2L4AA 3JRCA 3K4KA 3DEEA 1UELB 2EPFA 2QSGX 2K9SA 3CTAA 3NWTA 4RGRA 2XROA 4RB1A 1R22A 1R6RA 2FMLA 3B02A 3K70C 5CVJA 3KP4A 1CF7B 2Z3YA 2PJRA 3HOUJ 3J7AY 1TNSA 5J8CA 3CCLI 3ERED 4JX4A 4PJMA 3OYBA 3S1MJ 2I5UA 3KP3A 2A5WA 5HVQC 3CMYA 4K2EA 4PDKA 4YEJA 3CMMA 3VDXA 1XD7A 4HQMA 4JP0A 4FASD 4ESJA 2F5CA 3A01B 3HRSA 1B6AA 3L2VA 2XRLA 3C2GA 4XLEA 4ZZDA 1B8IB 3HOXJ 1E0EA 3JR9A 3BR2A 2AQEA 1R58A 2X1EA 3F0CA 1AU7A 3DTIA 2DW4A 1V4RA 4F92B 2A3SA 1ERDA 5L3DA 4KFCA 2GXBA 1R4MB 4Y15A 4XBFA 4D0PA 3AG1H 3Q0VA 2RQPA 2E35A 1OISA 4UV8A 2YSRA 1JTXA 2F2EA 1L0OC 2VJ5A 4DOZA 2XKPA 2RDPA 2E7WA 1TT0A 4EQQA 3FXQA 1VQ7I 1R71A 3JSPA 4M6YA 3U21A 1A36A 2MLGA 3OS0A 1ZTRA 2IA2A 4UB6C 1JKOC 1IV8A 1PP7U 4XKWA 3I5UA 3GFIA 3I54A 1ETWA 1P92A 4XKCA 2HPMA 1S7OA 4A3JJ 1A31A 5L3GA 4CUGA 1TTYA 2CQQA 5ILUA 1BOAA 1KONA 5IYCJ 2DXIA 3CDIA 5GAHJ 4QPQA 1LFBA 3GTQJ 2BY0A 5E3MA 3JRDA 1R49A 1IN4A 2CUFA 2HPIA 5FFZA 1XSXA 4IHTA 3IKVA 1LFUP 4JYKA 3KYLA 2MW8A 3SJMA 1HW5A 4E7HA 2K3FA 3KZZA 3WTWC 2WA0A 3S8PA 4BE2A 1TNTA 3HBLA 3Q5FA 5KVRA 1UZCA 2P4WA 1RR8C 3U1DA 3AFHA 2WAEA 3REOA 4RLFA 2DJIA 3W2AA 2MH2A 2L7MP 1VTNC 1EF4A 2ZJRF 3H0GJ 2VLAA 2CW8A 2VJ4A 2Y69H 3DCFA 3IWZA 2BZTA 4J01A 2VT2A 4N4NB 1OKRA 2KJBA 2JA7J 5KK1A 5EEHA 4I02A 3HUGA 2MGQA 1P2FA 2PN6A 2AO9A 3H5AA 4U7BA 1Y8RB 4C2MJ 4YFKF 5ED4A 2XPVA 3IRRA 2EZLA 2LKPA 3GFLA 3FXLA 1VFCA 5HOOA 4HPQA 3KFWX 3KYDB 2CGPA 1YW8A 4ZYDA 1ZHFA 5ERIA 3KLNA 3WGHA 3Q3SA 1PUFA 1LDKB 2PJPA 2K3PA 4DYRA 2LF8A 1Z67A 1YJ9I 1TWAJ 4G6TB 3CCMI 2RN7A 4A12A 1WH5A 4D9JA 5DCFA 2BOLA 3TBIA 4Y7NJ 3K2AA 2VJIA 1TQIA 4MNUA 3I3LA 2IP2A 5CVVA 3ZQQA 4A3BJ 2ZJPF 3COAC 1VQ8I 3ZQ7A 4WXDA 3BG6A 4UVAA 3LSPA 4P5OA 1FOYA 2EZHA 2V1UA 3C3WA 5A2QZ 3ASNH 1PUFB 3FMQA 4BHPA 3GX4X 2KLOA 3ZP5A 1EV7A 1U0JA 1QNTA 5D8KB 3A2KA 1I5ZA 1BW5A 2E34A 5JVGF 2OAZA 1USSA 3AG4H 3K4LA 4WXHA 4ZC3A 3CLOA 2E1MC 2X6WA 3S1NJ 3M1EA 4UUSA 3LSJA 2R7VA 2L9VA 3WGIA 5LEKA 2ZXWH 4OOIA 1BIAA 1T0FC 2GOMA 4HAMA 5CVRA 4GGGA 2A07F 4A0ZA 4PGGA 5IYBJ 1JUPA 2KHMA 2XPWA 1V5GA 3T8RA 2EZIA 1OCOH 4WK8F 4FX4A 3LSGA 3TO7A 2R5YA 1FLIA 2IBDA 4EGZA 4CCOA 5DM6F 2WC2A 2P8TA 1T56A 2ELJA 3TOAA 2AQFA 1KU3A 1K79A 3CDLA 2XDVA 4ZDPA 2CW7A 2ELHA 4JX6A 3L2CA 1ETXA 2IXSA 1O7LA 3TQNA 2OV7A 2CG4A 1GXPA 5AIPA 2J5PA 4UUSB 5J3LA 1GXQA 3MCZA 3ECHA 3LL7A 4GFBA 3FK6A 3VYSB 2MC3A 2XAHA 2PLYA 2W00A 2HNHA 2P6TA 3ZQIA 1FJLA 4LK0F 2DI3A 3GZ5A 2EWNA 4AYBA 1N75A 4PSXA 4ZTFA 2A6HF 2JN6A 3RPQA 5M3FJ 3JRHA 4A0XA 5K7FA 1ON1A 4YFNF 2IVMA 1H89C 2Y9ZA 3CC4I 4GXOA 5ILVA 3IC7A 5IT3A 3CJTB 4HX8A 3WU2C 1GVDA 1R36A 2BYVE 4ESBA 5DUIA 2VJJA 2KZGA 2EZKA 2ZXIA 5FKKA 1OYWA 1J0RA 2NVTJ 4MLOA 3MZ8A 1VQLI 3F8NA 4XRSG 4C9YA 2DA3A 2FOWA 2LH9A 4L5EA 1W36D 2ZKZA 1YO5C 3E0JB 2CH0A 1ZG3A 2MH9A 5EG0A 3P9CA 2DA7A 2JRTA 3PFYA 5B5EC 4Q5SF 2AXTC 2HOAA 3C18A 4GYIA 1VQKI 3QPSA 4IHSA 3LA7A 1ZR4A 3K1MA 2X85A 5CQGA 1Z91A 4AUXA 2CW0F 1R5ID 3I4NJ 3R4KA 3HOVJ 1I39A 1W0UA 4MTDA 4ENNA 2PX9A 2IRFG 1Z6TA 2BVLA 5H20A 2JA6J 2L7KA 4XLCA 5AONA 4ZYEA 3S3OA 1MMNA 3ZOBA 2A68F 2FOKA 2G0EA 1E2XA 3FKIJ 4XLAA 2KL4A 2WAFA 3C1DA 3RKYA 2B63J 4RB2C 2IAIA 4CXFA 2V6EA 1P7IA 1O3QA 5EG0B 3NEUA 3GW2A 5LHGA 4NC6A 4IVNA 2HDDA 1S72I 3GLXA 3BG5A 3SQNA 3ECOA 1WQ2A 1Y1VJ 3VYUB 4MFEA 5M5YJ 3NAUA 3K4JA 1ZR2A 4YFXF 2Y0MA 2ZMEA 2EJRA 3R61A 3VB2A 1UG0A 5EEAA 1F1ZA 2ADUA 3L1PA 3RJPA 3DEUA 4XR6A 1P9QC 2XUBA 2D1HA 3G71I 3WTYC 2QWWA 3OYCA 4ASNA 2K7LA 2XAJA 3ERMA 2RAEA 2LY1A 5F1JA 3VYTB 2VBZA 4DBQA 3H3VK 1QHGA 3BR1A 4E7KA 1O7FA 2P7CB 1U8BA 3S1QJ 3EYYA 1R4NB 1ZLKA 2ZBKA 1T2KA 4YIRX 4KICA 4L9JA 2QVOA 4B3AA 4X6AJ 4F52A 2QQBA 3KX2A 1NTCA 1NK3P 3I59A 3MKLA 3ABLH 3H3UA 2QKLB 4AD9A 5BPIA 1IRFA 2UZKA 4A69C 4ABZA 3HG9A 2MD0A 1WI9A 3I0TA 3I71A 1IN8A 4H4KC 3FK7A 2L54A 2H6BA 2V1XA 2VQCA 3QODA 3BY6A 3BCAA 2LOOA 4CYCA 2COMA 3BTLA 4U88A 4XKBA 1BR4A 3WU0A 2M34A 2XB5A 2VPLA 1K6YA 1XB4A 1R5HA 1FIAA 4KN7X 1W36C 4NDLA 2PMZA 4LG0A 2R93J 1XGNA 3GWZA 2WBMA 1J9IA 3HGYA 2W25A 3Q9SA 1QPMA 2EIKH 2LLKA 2XAQA 3N05A 1JUSA 4MEXF 4BKXA 1QZYA 5HDKA 1IJWC 2DQLA 3KIOA 2HZTA 5JI6A 2VL8A 1FMWA 3JAMK 1G59A 2LC2A 4AIHA 5L3EA 2WV0A 4LLNA 3ZMTA 4HRIA 2QSHX 2V26A 4CZCA 3ROUA 3OMYA 1JKRC 1FPQA 4FT8A 2DA4A 2R7DA 4BL0B 1FYLA 1GVJA 2X1CA 3FBIB 3HHGA 3MQ0A 2TCTA 2M87A 4HNTA 5BOXA 4AIDA 4EJWA 4UHTA 3NWSA 1O57A 4LG0B 3CD6I 2CFOA 3EUKL 3K1PA 3BP8A 1NHAA 3GYHX 4RB3C 1W7PA 1IRGA 3LAJA 1MBEA 1ODDA 4MQVA 3H36A 3J7YJ 2C6YA 2QZ8A 2L7FP 1NG7A 3L2UA 1QBJA 4PGHA 2XIGA 2MG4A 1IV6A 4PJLA 3WHCA 3FXUA 1VQ5I 3P9IA 1LEBA 2QKMB 1ONVA 1JJ6C 3BR5A 3ZR8X 3K4CA 5EZHA 3IP4B 1U5TB 1XTAA 3KZIC 3S2DJ 4OMYA 4IO9F 1HSTA 4II2A 2DLLA 2HVQA 4BJTA 2HQNA 3CESA 1O3TA 5D5XB 3QPHA 1KQ9A 2W4SA 4EJUA 4UUTA 1ZGJA 3GFJA 1TQPA 3KP7A 1RESA 5FRMA 1B72A 3TO6A 4C3IJ 5GADJ 5K7HA 2IJLA 3BR0A 4HSRA 2DFFA 1CGPA 2L0KA 3E5XA 2Y0SA 3WE3A 1RKTA 3G1MA 4PSWA 1OCTC 3RKWA 2R5ZB 4V2GA 5D4SA 2VB6A 3H3ZA 4BAYA 2Q2EB 1FBUA 1PVEA 4OWRB 2X51A 3IAM2 2HOTA 2K9NA 2H1LA 4EM2A 1EA3A 2HYGD 2CMPA 3BJOA 2H8WA 4GYGA 3BZKA 5FD5A 1TZLA 1S7EA 1UHMA 1WJBA 3LFUA 2BV6A 1JHHA 1PYVA 2W48A 2JVGA 3AG2H 3GBGA 2JTVA 1W7PD 1BN5A 3L9FA 1K4SA 2BY1A 4XSZF 4E4HA 4BNCA 3HEFA 5LLQA 2A05A 4A5MA 1F5TA 3TW7A 3HM5A 2XF5A 4C3JJ 5M5WJ 4I0AA 2FBHA 3R6SA 4HBLA 4CCNA 4MTEA 3H1CA 3RKQA 4RGXA 4BQNA 2Y2ZA 3DP7A 1PDNC 1U8RA 4DZJA 3VWBA 4Y33A 2VC1A 5FKMA 1JGGA 2XGDA 1P4XA 1X4OA 5HS8A 5CQEA 1U9NA 4HG2A 3WU1B 2VODA 1FOWA 5HDGA 3CUQA 2H27A 2DAOA 1BBYA 3ZPLA 4LB6B 3RSNA 1BI1A 1YRNA 1X3WB 1XCBA 3CCYA 3PNTA 2NNYA 1Z7UA 4QSHA 3GMEA 1I3AA 1BR2A 1XGMA 4E70A 2FMYA 1SAUA 2TRTA 2ICWG 2QLZA 3FZVA 4PZJA 1ZQ3P 1JHFA 3LNQA 1E3HA 4XLHA 4FQGA 3E6DA 4V19K 2XF7A 2FQ3A 5FKNA 3G1LA 2BE5F 2J5OA 2Z16A 4CCLA 2FQ4A 4R79A 5K5OA 5FJ8J 4PJJA 1KZHA 4A3MJ 2I8DA 3GTPJ 3PO2J 4LIUA 4CICA 3GTKJ 5BS6A 3CUQB 4G12A 2K9LA 1RPWA 1YLFA 3WE2A 3I9V2 4C3HJ 3N4MA 4O3MA 4M73A 4X1EA 2M4KA 1ZGWA 5E8GA 1GV5A 1X1CA 2K5CA 2X48A 3TKYA 3OYAA 4UVBA 2O6GE 1XX5A 3M8FA 2MD5A 1RC9A 4EM0B 2BW3A 4C30A 4LG3A 4I0BA 4JOMA 3TL4X 2K4JA 4JQFA 3OYHA 2FXAA 2CJJA 2R7QA 3PQJA 3V4GA 4CA0A 5B1AH 1OCCH 1W0TA 1QZZA 3RQIA 3DEWA 4O5VA 1SFXA 1JTYA 3GTJJ 2W7NA 5F0FA 4XMYA 1LVAA 3FXMA 1HKQA 1B9NA 2QF7A 4FETA 3K4MA 3A01A 4M6XA 1MJAA 1REPC 1BR1A 1HDDC 2IPQX 2X4HA 4BYYA 5E3OA 2E5NA 1MNEA 2XASA 1X58A 4ZYGA 3OIPA 1B8IA 3KP2A 3BTIA 4D5FA 3PSFA 2FE3A 1ETQA 1VQ4I 3FISA 2HEOA 5E8IA 2VXZA 2HKOA 4WXCA 5D4RA 3Q9VA 2BW3B 1K78A 3K4BA 1BIBA 3K69A 1HXDA 2V7FA 4Q47A 3GTOJ 4HDVA 4BACA 3ISPA 5K5RA 4IJAA 1HOMA 3GLLA 3UR3C 5HNFA 1LE8B 1G4DA 4XL9A 5JVTA 4BDZA 4HF2A 4KJZA 3TEDA 1XS9A 4KN4X 3DPTA 4BQAA 2O61A 4OIRF 4B48A 1OLTA 2DU9A 3ZMUA 9ANTA 3F3XA 3JRGA 1JGSA 3AL0C 1QRYA 2Y30A 1HCRA 1IG7A 1Z6RA 3CCVI 4HEA2 3ABKH 4FISA 1FP2A 2VKDA 4RMNA 4MIMA 1K78B 5LGNA 3JREA 2F5VA 3VYRB 2XAFA 1VZ0A 1I50J 3JRFA 5D5UB 3LQQA 3W6VA 4AYBN 1XSVA 3K6GA 3LFKA 3UNGC 5IT9K 3HTSB 3UKGA 1YI2I 4L5IA 1XPXA 3I55I 2EFNA 1IXCA 3FXKA 1PP8F 1GV2A 2DN0A 4CHUA 3IRQA 3HXLA 4P55A 5F1RA 1A04A 4ZYHA 3MKWB 1IN5A 2A69F 2CO5A 3LSIA 1FMVA 1QZEA 1FTZA 2DO7A 1WRJA 2M0MA 4HOBA 3VODA 3WHBA 1S5LC 1UFMA 1TWHJ 1BC7C 2GAUA 1T39A 4M3EA 2L4MA 4L0YB 3E7LA 3B6AA 4G6QA 4BS9A 3CO6C 2H8RA 4FE4A 4MGRA 1M1EB 2DCEA 2V9PA 5LBQA 3RZDJ 3KPHA 1HQCA 4P1WA 1AWCA 3M07A 3SZTA 1OMIA 3OL4A 2VXDA 3I4MJ 4CYDA 3CC7I 3EUAA 3B6CA 4FHTA 2FD5A 3O3KA 5EJCA 4NHJA 4XLFA 1IO2A 2FBIA 1JKPC 3H92A 1T08B 3KLOA 3OYEA 4B3XA 3V8JA 4XRMA 4J00A 1IUYA 2E7XA 3MAJA 3JRIA 2LMDA 2G7HA 2YX7A 2ECCA 2R7ZJ 1FP1D 2R7TA 1RRJA 1H9TA 1TQMA 3ELKA 1VI0A 3E1SA 1VQ6I 2Q8KA 3TDZC 5K5QA 3EUHC 4DYCA 2CSOA 1O3SA 4GCVA 3OYNA 2JA2A 2L5QA 4O6JA 4UY8I 1J5YA 2O9LA 2PQ8A 2H09A 4DJAA 2R7WA 2GA1A 2DFIA 4I76A 1Q1VA 3WTVC 2NS8A 4N0BA 3BTJA 4DZPA 2M1BA 1Z1DA 1W4MA 2IS1A 4HX4A 4KNYA 1SD7A 2OUMA 1X1PA 1XMKA 3DKXA 2H94A 4M74A 5FKOA 2ME6A 3S32A 1FOKA 2HGCA 2GQQA 5EEGA 4B4CA 3MD2A 2BY3A 2WWYA 3ZRGA 1ZARA 1EKEA 2HI3A 2R92J 1MD0A 3KP6A 1F43A 1LDJA 2XAGA 4WWCA 2L7ZA 2N8GA 4RS8A 2FUG2 1XGSA 2HQ5A 1R23A 2VI6A 1FWZA 5J4YA 5J4VA 3CF2A 2RGVA 3BWGA 3QU6A 4AU7A 5FLMJ 4UUVA 4N9IA 2ZFWA 4W1UA 2VOOA 3DKWA 1SVOA 3ZQLA 3HTUA 2DFEA 1MNMC 3V7SA 3G73A 2JUCA 4LK1F 3IAS2 3RPUA 2XRNA 3MKYB 4BHCA 3L2QA 3EDPA 2LSOA 1RUOA 2RC4A 1N25A 4IQ4A 2V4JC 2V1NA 2HKXA 3S17J 3KEYA 4A3IJ 4IHYA 5IOZA 3HPHA 4UXNA 4AWXB 2QUFA 1D1BA 3OY9A 1G6NA 4ZJZA 3OSFA 5IY5H 2D5VA 1ZK8A 4MFDA 3LSKA 5TGTA 3O2PE 1UJ8A 3SZPA 5E3LA 2LTPA 2E1NA 4RAYA 5HS9A 3TO9A 2IS2A 4BGDA 4A3EJ 2QEXI 1Y8QB 4AVPA 1VNDA 1WFXA 1FBQA 4MO7A 5FLXZ 1DPUA 3BOQA 1DGRM 4KT5C 4CCKA 3OYJA 4BE1A 2IEKA 1JJ8C 4M3DA 3I58A 2Y9YA 4ZDOA 3W2VA 1J59A 4HW0A 1MMSA 3BLYA 2HTJA 1R7JA 3KEOA 2B0LA 5B3SH 2O8KA 3T5XA 2O3FA 3KE2A 3QAHA 4DIQA 3MZYA 4P9FA 4IL6C 1A6QA 2JSCA 2TDXA 5CKTA 3IUOA 3PIPF 4IXAA 1AA7A 3HOWJ 1D0YA 1RI7A 1G3TA 2FSWA 3BC8A 2P5LC 4BUPA 3BPVA 3MFKA 3HL2A 4I99C 2H6CA 1ETVA 3RI4A 1WKMA 5L3CA 4XRFA 1H8AC 3F8FA 3IWFA 1G8XA 4B09A 4RBOA 3N97A 4A5NA 1SEUA 4C2UA 4ETSA 2JMWA 3C2BA 5FRNA 4EGYA 5JHUA 4BE0A 4EEFG 3H9GA 3J7AO 3DKYA 1E3PA 1TWCJ 1UHSA 5A2QK 1LKXA 2LDUA 3OYDA 1ZRFA 3HSEA 2IGNA 3MWMA 2VBXA 3M9AA 5LFAA 2GIVA 2K9QA 5DDGA 4A3DJ 5D5VB 2Q0OA 3FXOA 4XRSA 2FU4A 2Y0SN 3C2HA 3CF5F 2JJ7A 4QTRA 4AIJA 5J1RA 4II3A 1ACIA 3IV5A 3ZQCA 2E5ZA 2KFDA 4ZZLA 2L9NA 2VE8A 4XLPF 2YU3A 3RQ4A 1UHWA 3A0BC 5IP9J 2IGMA 2MC4A 4DNCA 4N4OB 2VBYA 3OS2A 4FCYA 3DPLC 5LGTA 3S15J 3ESWB 2CQ7A 1XSDA 1WJEA 2LNBA 3NARA 1YS6A 2CFXA 2HXIA 1B59A 1WCMJ 2AXLA 2WTEA 1WGXA 2Z1DA 5EZGA 2OCEA 2RNGA 3HYIA 3RYPA 3SEZA 3J81Z 2YUSA 1QPIA 4V2FA 4I2OA 3L7WA 1E3OC 4BQOA 2W85A 3H35A 2KT0A 2Z99A 4HA8A 3HOTA 3I56I 3IL2A 3LSMA 2DDAA 2OTJI 3QRFF 4W97A 2UXNA 4Y4RA 1T33A 2ISYA 3L2WA 2QA4I 3JTHA 3VSKA 2A6TA 2O5RA 3U2RA 2X6YA 4AVZA 2RREA 4PJ0C 2IS4A 3BR6A 3FX3A 3QOPA 2RKHA 6PAXA 3P9KA 4KITB 2P0WA 3GXOA 3IHUA 4HSTA 3T1BA 3QP6A 2VQGA 4ON0A 3SHFA 4EMSA 4P9UA 2KZVA 3K4NA 4MQ9F 5IPAA 4Y17A 1C0WA 3IH2A 3RCOA 1FOXA 3X2QH 1D1CA 2QQ9A 2E2JJ 2KPMA 1X1AA 1JT6A 3ZQFA 3LA3A 3SYTA 1YYVA 3JSOA 2STTA 1KYWA 4L5JA 2LBFB 1D5YA 3R60A 2ZXJA 3ZXSA 1Y6IA 3FIWA 2WAQA 2LF7A 2LR8A 4YIIA 1MSFC 4QPOA 3T8TA 3GTGJ 3E3VA 1T6SA 2E1OA 2BHZA 1R00A 3CP2A 2OQRA 2F4IA 3G6EI 2VASA 4LIVA 1TL8A 1A5JA 1XMXA 1A6IA 1U6GA 1MMAA 1X19A 1OFCX 4NC8A 2DODA 3TGNA 2EK5A 3ZN0A 2M4GA 5DTDA 3CMAI 3FM3A 4BEHB 4I01A 3RZOJ 1OR7A 1OCPA 2BXYA 1JXSA 3PO3J 5JFRA 1ZGAA 1YW7A 4CZZA 2VKHA 1QA6A 3BG9A 5K7ZA 3GZ6A 4U0VA 2CRGA 4XORA 3BG3A 2IT0A 1H0MA 2ZXHA 2FEZA 5J47A 5DD8A 5E79C 2VOPA 1U5TA 2E71A 1HC8A 3BZ6A 2MBFA 5IYDJ 4LB5A 4M9SA 1IXSB 3J7ZI 3MMYB 5E1WA 2PG4A 2KP6A 4M3BA 4HNUA 4I98B 2WY8Q 3BR3A 2JA5J 2DT6A 4XN3A 1FIPA 3H5RA 3A0HC 4KUMA 2XKOA 2K4BA 4MHGA 4IHVA 2ETHA 3I64A 3FXRA 2Q1ZB 5HLGA 2EFOA 1XG1A 2R7FA 3HRMA 4YELA 4QIWN 1VQMI 4OIPF 3CCQI 3AAFA 2HQRA 1D8JA 2R5ZA 4BDYA 3OYGA 5ICEA 1G2HA 5E18F 2KIUA 2Q2EA 3EYIA 1KQ0A 2EIMH 1MDMB 4DYQA 2UV1A 3WTZA 3FF5A 3L2RA 4AM3A 3DF8A 4F91B 2IS6A 2OF7A 5LEJA 4F93B 2JPCA 3OSGA 2V1DA 2ESHA 4Q48A 4PFPA 2M2EA 2GLOA 2CUEA 4BY1J 3EETA 3E5UA 2GZWA 3DQVC 5H6QA 1DDNA 2GOXB 1CQTA 3ZCOA 4U0YA 1YX3A 1T98A 3H0DA 2WB1A 2BXZA 5JLWA 1GUUA 2NOJB 3HPGA 5DEQA 2GM4A 1HF0A 1GHCA 3WODF 3OOUA 4A3CJ 3VSLA 1MIJA 4CDGA 4HLYA 2Z2SB 4RGSA 5M3MJ 2STWA 4KIBA 1HA8A 3SFIA 3U9GA 2V9VA 1V5EA 2IA0A 4WCGA 4DQ2A 2L9SA 2JUGA 5DCMB 1OYYA 2HQAA 2JPBA 3FMSA 2EILH 1DPRA 4H0EA 1DP7P 2LKXA 3F6VA 1SD6A 2LY2A 1WI3A 1B9MA 4OIOF 4BH9A 1STZA 1MH3A 4XOPA 3M8EA 2DOEA 4OINF 4RAGA 2RVCA 4LLLA 2KRHA 5C4JJ 5F64A 2K27A 1Y1WJ 5HODA 1V3FA 4G94A 3CQZJ 4RM2A 3SXYA 1APLC 3NQOA 2GXAA 2E1CA 3M1CA 3E6BA 2ZMEC 2ZJ2A 2V9KA 2VKEA 3F6OA 1YTYA 2L3DA 1KU2A 2DBBA 3ZMVA 1MBKA 2DA2A 4LJZF 3AL0B 1D5VA 4D7NA 3QP5A 5DYMA 4B47A 2ZC2A 1OYIA 3LMMA 3HOSA 1D1AA 2D45A 2Y75A 3A4CA 1SD5A 4BQQA 2ECBA 3QYFA 4PFOA 3DWLE 3J80Z 2FRHA 5TRDA 2XSJC 4Z6YA 3HB9A 1MKMA 3K70D 2ELKA 1SANA 2M3AA 1BM9A 1X2MA 4R8HA 4HZFA 2YS9A 3VEPA 1SMYF 3NRVA 3RYRA 2K9MA 3M3YJ 4GDFA 1LFPA 2M9HA 3M7GA 2PMUA 1QO0D 1X4PA 3HDDA 3OWTA 5GPCA 1IF1A 3ZGKA 5KAIC 2M30A 4BY7J 2KIQA 1X3ZB 1TW2A 2F5FA 3K10A 1S29A 3BTCA 1LNWA 4DBRA 4NQWB 1ON2A 1Y0UA 1YS7A 2UUZA 1AKHA 3BPXA 3K1NA 2KISA 5BQTA 4M9ZA 4B1RA 5CJ9A 1YX5A 1YJWI 2R7OA 2GBYA 4B44A 1U3EM 3ABMH 1TWFJ 2JT1A 4E7IA 4XNFA 5TISC 4I09A 2DMUA 1NG6A 4Z2YA 2XF6A 2LP0A 3O8GA 3PSIA 4OU0A 5GAGJ 2CQXA 4HV5A 1HKSA 2IA1A 3ZMZA 5HLHA 4EJOA 5JHFA 1ZELA 4M9XA 3TP0A 5L3FA 1XC5A 4EVIA 5IOYA 4IQJA 4M3FA 3S1RJ 2HFHA 5ICCA 1XMAA 1OCZH 1JUMA 2QCOA 2HZDA 1MMGA 4HQEA 1I1SA 3HRTA 2HVSA 2CUZA 2Z33A 2KRFA 1AKHB 1RNLA 2F5DA 3BQYA 2VBWA 1ZRDA 2GXGA 4M6VA 1LE8A 2QBYA 4HF1A 1FSEA 2HXOA 4XN0A 1I6XA 5K1YA 3OIQA 4CH7A 3GF2A 3S93A 2E19A 1ETOA 2BVMA 2X6OA 3TP3A 5BMZA 3PM1A 2HOSA 5IP6A 4ENMA 4HX7A 2MABA 1IDYA 4HYEA 4E7LA 4A3LJ 4ESFA 2FJ1A 4BXFA 1WVRA 3I4PA 1K7AA 1YITI 2M45A 3BQZA 1BJZA 3GVAA 3FHNA 1LJ9A 1MJBA 1XN7A 1ORKA 4LITA 4XKVA 1PUEE 4PJNA 4YRVA 3M4OJ 3SDGA 4KIGA 4NC7A 4N9HA 1T8IA 4RDUA 2LY9A 2QBYB 2JVHA 3DV8A 3H9JA 3PL8A 1FTTA 1WHUA 1Z21A 1J2XA 2ZFUA 3D5LA 2W82A 2Y31A 3F8CA 5F6FA 2DT5A 2VIXA 3D0SA 3GTLJ 2OC6A 1T0FA 2W1OA 2OJED 2COBA 2XGEA 4KIFA 4IX7A 4IF4A 1D0ZA 3KEQA 4E7ZA 1VF9A 1FY7A 2EBIA 2DMPA 1RZ4A 2DA1A 2M7AA 5GP9A 3BJAA 5LHHA 3FHZA 3GEZA 4J19A 4ENJA 1LUJB 5GPAA 3LQRA 1WH7A 5FROA 4EV0A 1UMQA 5E1ZB 2XSDC 3SZGA 5J40A 3A03A 4U0WA 4XK4A 2VPRA 3CDHA 1MBFA 2CV2A 2W57A 3HOYJ 3BDDA 3HRUA 2NOGA 3QPLA 2E1MB 1IRZA 4PCQA 4I7HA 4GRIA 1IN7A 2R7SA 1IZ1A 2PFBA 2NS7A 1J7KA 1T95A 3P7NA 2KIFA 1VQOI 5DM7F 1W5TA 2HYFA 1SD4A 4ZDLA 3WGGA 3HIFA 1VQNI 2LKSA 1BJAA 2KMUA 2EINH 3ASOH 2ZSHB 1JKQC 4CCJA 2CQNA 3FXJA 3ULQB 3E6CC 2PJRB 2DPUA 2FNPA 2OZUA 4IPAA 2EA2A 1KU9A 5EGOA 1Z3YA 2VQHA 3JTGA 1BC8C 4RAZA 1JT0A 4ENKA 4L9NA 5EDNA 2ZJQF 5GAEJ 1BL0A 4X0GA 2EV5A 2EFWA 1ZYRF 4A3KJ 1SFOJ 2JWTA 1H88C 4A2UA 2KJCA 4LOCA 3VFZA 2BEOA 5J1YA 1ZAOA 2X6XA 1KGSA 2CV1A 3JW4A 3LSHA 3T0YA 2NVXJ 2R3SA 5CLSA 5IP7J 3FKJA 2CYYA 3D5RC 4RAFA 3K7AJ 2O0YA 3WTSC 2WV1A 2UWMA 5E17F 2ESNA 5HLIA 3OV8A 2R7XA 1UAAA 5D5WB 2XC7A 4QWQA 3GCMA 3FMRA 1YE9A 2XGCA 5EGOB 4CGZA 3EPZA 4A0YA 3JCUC 3BZCA 1ETKA 2A6EF 2K40A 2W24A 1X1DA 1YFHA 1ITYA 2E2IJ 3CUQC 2X1DA 1NK2P 4KT6A 2FF4A 2HWVA 3GUDA 1HLVA 1FT9A 3RDIA 2RV8A 2CUJA 1TW3A 3OIOA 3VPRA 4IRHA 2QGUA 4U7DA 2K85A 2CV0A 3FBNB 2ZNZA 1DUXC 3TDUC 4OAYA 3MVPA 5EF6A 2ZB9A 4RM3A 2YPRA 2E2HJ 2PI0A 1KYZA 2JZYA 3F8MA 1NH3A 2XGXA 3TOBA 1WJDA 3TMOA 3DXJF 4HF0A 1G3WA 1YW9A 2HTSA 3HKZA 1W5CC 4ZYAA 3OOPA 3FDYA 1S3JA 1K4TA 3G4SI 3S16J 1Q1HA 1SMTA 2XB0X 3QQAA 5F08A 4HV6A 1OPCA 1Z9CA 3DBHB 2P5VA 3PFIA 5DV5A 4BBRJ 5ICGA 4Y52J 4LD5A 4L9VA 2QQAA 3MKZA 3BROA 3HUGB 4NB5A 2R7UA 4IOAF 2P81A 3BCBA 3D5SC 4LLGF 4ZH4F 1WJ5A 1BA5A 2VONA 1VQ9I 1VQPI 1U2WA 3WTXC 3HGGA 3BG7A 2LRDA 1QHHD 1YG2A 1I3QJ 3PUBA 1F9NA 2XHKA 1TC3C 1FBSA 5GTIC 3S3NA 2O8XA 5KAFC 2WAQN 2EFQA 5FGMA 3KETA 5H6RA 3QWLA 1HSJA 1H9GA 4G7HF 1MZBA 3S14J 1YIOA 2OA4A 1Z0XA 2CU7A 3CCSI 5FLVA 1FYMA 2PMZN 2DOFA 5F0CA 3F23A 1DQUA 1DP3A 5HS7A 1IGNA 4WX9A 2EB7A 4FTHA 1G3SA 5CVUA 1T38A 5CYVA 1OJLA 3A02A 2ZSIB 1P4WA 2LFBA 5FD6A 1IN6A 3K2ZA 2QYOA 5DUKA 5ICFA 2KIMA 3U1KA 1ZKGA 2LK2A 4NUBA 3DPUA 2E36A 2QQ8A 4A93J 4KDPA 1W5SA 5FO5A 2Y48A 1O4XA 3S2HJ 1DGWY 3FM5A 3FWEA 5J1UA 1N78A 3V7RA 4M72A 4D5CA 1ETYA 3VOEA 2OTLI 1J75A 2B7EA 1WSUA 1OQYA 1IDZA 3K9TA 1S6LA 5LGUA 1U78A 5J8FA 1WWXA 4DW6A 1R9TJ 5JLXA 2FBKA 3F22A 4IEJA 3AKZA 3HSFA 5FKLA 3F9KA 3RPUD 1DU6A 3WG9A 1U9OA 1EJ9A 1SFEA 4L9TA 2L2OA 5F27A 1USTA 2M5WA 1Z3XA 2LG4A 2R5YB 3G2BA 1S7AA 1WJAA 1V54H 2BY2A 2OPTA 5M5XJ 1AHDP 3PQKA 4XQFA 1RUNA 5LRRA 3CO7C 3MEXA 3KCCA 5J6XA 2L01A 3OR2C 5C44J 2H1KA 5L3BA 4QLCU 3DTKA 3EQLF 1J09A 3CCRI 3F8BA 4G9YA 5DS9A 4MEYF 4A3FJ 1HW2A 3OL3A 2DT7B 5KNLA 2WB1N 4Q4ZF 1LB2A 5D6EA 2HS5A 5B1BH 2BGCA 2LREA 2OU2A 4ITVA 2M8GX 4A6DA 2LYCA 4PUSA 2ZNYA 3V8KA 4KYWA 4IZZA 2V6CA 4F55A 2VQLA 1ULYA 4C2TA 4BXXJ 1QGPA 2JA8J 2EV0A 3GFMA 3PNYA 5HNHA 4S05A 1FNNA 4BJ6C 3P5JA 1UB9A 3HHHA 3RTRA 3CJQB 3CC2I 3H9QA 2DYSH 3ONQA 1S9HA 3DBRB 1R1UA 1YOVB 4F3QA 1MBGA 4IHXA 1IW7F 1MH4A 4XICA 3CZ6A 2DTZA 4JX5A 3ZQHA 3OYKA 1IAWA 4S0HB 4G7OF 1JE8A 1Z77A 3RKXA 3JAMZ 1F36A 1MJ9A 2P6SA 2Z5UA 1QQIA 4Y13A 3JRAA 1MSEC 5FLXK 1P6RA 3F21A 4OIQF 4FE7A 4S04A 4IRIA 5FFXA 2F48A 2X9DA 1FYKA 5EYRA 2DTRA 2LBFA 1R5GA 2HYJA 2VT3A 3CP8A 4XLNF 1MBHA 2YR2A 3GO5A 4EM1A 3OYFA 2I10A 3DFGA 4NNJA 3WG7H 2ME0A 1IRXA 2CS3A 3E6MA 3PJRA 2GA2A 5CVIA 3S2WA 4HDUA 3ABTA 4XM3A 1WJCA 3HC7A 3HSRA 4D1QA 2NVQJ 4E7SA 1A35A 4IRGA 2NVUB 2M0CA 4BEHA 4P96A 4OAZA 4CSWA 3PUFA 3DU5A 4XONA 3CCEI 2BBYA 2HR3A 3RIRA 1PJRA 2EH3A 1XGOA 2NNNA 2KRCA 4CO8A 4RA2A 3D1NI 2W84A 2OQGA 4ZTJA 2ZMEB 2IGKA 1EH6A 2GWRA 3CUOA 1IC8A 5B66C 3CCJI 2VUMJ 2NS0A 4R1HA 1N77A 1FZPB 2HDWA 2VKVA 1TLHB 1X3UA 1Z7LA 3BT9A 3QU3A 4JBAA 3CCUI 2L02A 3SEQA 1EH7A 2MA3A 3DLLF 1K61A 2VN2A 2ID3A 2X0LA 1ZN2A 1RETA 1F4KA 1LEAA 1SFUA 1YQAA 1R1TA 5HDNA 1RR7A 1ZG1A 2QSFX 3QYBA 1D8KA 2NAZA 2PMHA 1ZG5A 2O7OA 1RKWA 3I59B 2KKOA 2GIZA 3PIOF 1MDMA 3QPTA 2A61A 2OD5A 5E3NA 5JR3A 1K83J 3CLQA 1D0XA 3CMEI 2D2WA 2OCCH 2XAUA 2JK3A 1QVTA 3LA2A 3W3CA 3A1YA 3J81K 2UXXA 4E7JA 2FX0A 2A5YB 1MGTA 4OMZA 2HOEA 4CYCB 3WTTC 3AG3H 5ILSA 1IUFA 4IKFA 1HDPA 1E17A 1BI3A 2FA5A 1POGA 5DD4A 2DYRH 2FNAA 4PK4A 1BW6A 3OYMA 1KU7A 1R1VA 2G9WA 1P7JA 5FB2A 3BJ6A 1HW1A 1JI8A 2MFZA 2DOAA 2KDOA 2XV4S 3DLAA 2LD5A 2BHYA 3WTUC 2D1VA 1HBXG 1K6OA 1MBJA 3DBLB 4YG2F 4XIDA 2P5KA 1MNDA 1V55H 4IHWA 5DCMA 4F7ZA 4KMFA 2JQ7A 3ABUA 2LVSA 1FX7A 2K02A
chains in the Genus database with same CATH topology
2E19A 1ETOA 1W0UA 2X6OA 3TP3A 5F04A 2NVYJ 3PM1A 2JA6J 2HOSA 5FKOA 2ME6A 5IP6A 3ZOBA 1IDYA 2G0EA 4A3LJ 3FKIJ 4B4CA 2FJ1A 2B63J 4I6ZA 2IAIA 1P7IA 3BQZA 1BJZA 3O8HA 5EG0B 2HI3A 1ORKA 2HDDA 2R92J 3BG5A 1F43A 4HNVA 3M4OJ 1Y1VJ 1WPKA 2L7ZA 2N8GA 3SDGA 4MFEA 1X2NA 2HQ5A 4RDUA 2LY9A 2VI6A 5M5YJ 3NAUA 1FTTA 5FLMJ 1ZR2A 4W1UA 2Y31A 3GTLJ 3ZQLA 5EEAA 1MNMC 3L1PA 2COBA 2XGEA 1VF9A 2EBIA 3HOZJ 2DMPA 3Q0UA 2DA1A 5GP9A 4M3GA 5BNGA 4J19A 2RAEA 1GDTA 5GPAA 5F1JA 1WH7A 3H3VK 1UMQA 2XSDC 1FEXA 3BR1A 3A03A 4XK4A 2VPRA 3S17J 4A3IJ 4IHYA 1MBFA 5IOZA 3ZQGA 1U8BA 3S1QJ 3HOYJ 2ID6A 2EQRA 2NOGA 1TWGJ 3QPLA 1IRZA 4B3AA 4X6AJ 2NS7A 1B72B 3OSFA 2D5VA 1NTCA 1NK3P 1ZK8A 3MKLA 4MFDA 5E3LA 2LTPA 4A69C 4ABZA 4A3EJ 3LOCA 1JKQC 1VNDA 3FK7A 3GTMJ 1I6HJ 2XPUA 4BBSJ 3IH3A 4MO7A 3Q0WA 5EGOA 2DMTA 2IEKA 1JJ8C 4M3DA 4CYCA 2AHQA 3BTLA 1JT0A 2Y9YA 5EDNA 4A3GJ 1BL0A 2M34A 2XB5A 4A3KJ 1SFOJ 2JWTA 1H88C 2DA5A 5C4XJ 4LOCA 1FIAA 5J1YA 2O8KA 4NDLA 2R93J 2NVXJ 5F0HA 5IP7J 3HGYA 3K7AJ 1QVUA 2LLKA 2WV1A 1JUSA 4BKXA 2L9RA 1IJWC 1ENHA 3HOWJ 2DMNA 5EGOB 2XGCA 1ETVA 3HKZN 3LSRA 1ETKA 1H8AC 2K40A 1JKRC 4D7MA 4RBOA 2DA4A 1ITYA 1GT0C 2E2IJ 1NK2P 2JMWA 3IH4A 3C2BA 2TCTA 4EEFG 1HLVA 1TWCJ 5C3EJ 1UHSA 2MSYA 3OIOA 3VPRA 2KDZA 2DJNA 2K9QA 1MBEA 4A3DJ 1YRNB 3G1OA 4XRSA 2Y0SN 3MVPA 2L7FP 5EF6A 2ZB9A 2E2HJ 2JJ7A 4AC0A 4QTRA 5J1RA 3TW6A 2MG4A 2R0QC 1IV6A 3IV5A 3WHCA 3ZQCA 3MN2A 1JJ6C 3BR5A 5EZHA 3S16J 2DA6A 5IP9J 5F08A 3S2DJ 2XB0X 3QQAA 3JRBA 4FCYA 3S15J 2DMQA 1UG2A 2YU9J 3NARA 2HXIA 4BBRJ 1DU0A 4Y52J 1WCMJ 4UUTA 1WGXA 1RESA 5EZGA 3JRCA 1B72A 2YUSA 4C3IJ 1QPIA 2K9SA 4V2FA 5K7HA 2P81A 1E3OC 3BR0A 1BA5A 2L0KA 1RKTA 3G1MA 1OCTC 2KT0A 2R5ZB 4V2GA 3HGGA 3HOUJ 1I3QJ 4JX4A 1TC3C 4W97A 3S1MJ 2HOTA 2K9NA 3CMYA 2WAQN 1T33A 1S7EA 4JP0A 3S14J 1Z0XA 3A01B 2CU7A 3BR6A 5FLVA 2XRLA 2W48A 2PMZN 3GBGA 1B8IB 5F0CA 3HOXJ 3JR9A 3BR2A 1IGNA 4FTHA 3F0CA 1AU7A 3HEFA 1OJLA 3A02A 5IPAA 2LFBA 3IH2A 3TW7A 3HM5A 3Q0VA 2E2JJ 1ZKGA 2LK2A 4C3JJ 5M5WJ 1JT6A 3ZQFA 1JTXA 4A93J 1D5YA 1O4XA 3S2HJ 3FIWA 3RKQA 2LR8A 5J1UA 1MSFC 1ZTRA 3GTGJ 4D5CA 1JKOC 2E1OA 1ETYA 2Y2ZA 4DZJA 1ETWA 1A5JA 4A3JJ 5FKMA 1JGGA 2XGDA 1A6IA 2CQQA 1U9NA 1IDZA 1OFCX 5IYCJ 1U78A 5DTDA 1LFBA 4DW6A 5E3MA 3JRDA 3GTQJ 1R9TJ 2CUFA 5JLXA 3RZOJ 1OCPA 1YRNA 3PO3J 4IEJA 1LFUP 4JYKA 2MW8A 5FKLA 3CCYA 3SJMA 1DU6A 1U9OA 4QSHA 3BG9A 5K7ZA 5F27A 2CRGA 2TRTA 2R5YB 3HBLA 3BG3A 1ZQ3P 3LNQA 5FKNA 3G1LA 2OPTA 5M5XJ 1AHDP 5IYDJ 2FQ4A 5FJ8J 4A3MJ 2L7MP 1EF4A 3H0GJ 5C44J 2H1KA 3GTPJ 3PO2J 4M3BA 3DCFA 3GTKJ 5DS9A 3BR3A 2JA5J 4A3FJ 4G12A 1FIPA 1RPWA 2WB1N 4C3HJ 2JA7J 2MGQA 4IHVA 4X1EA 2AO9A 1ZGWA 1GV5A 2X48A 1XG1A 2M8GX 4QIWN 4C2MJ 2XPVA 2EZLA 2R5ZA 4BXXJ 1G2HA 2JA8J 1VFCA 2CJJA 4DYQA 1W0TA 2OF7A 3RQIA 3DEWA 3OSGA 1JTYA 3GTJJ 5F0FA 2M2EA 2GLOA 2CUEA 3Q3SA 1PUFA 2QF7A 4BY1J 4IHXA 3A01A 1MBGA 1HDDC 1MH4A 4DYRA 5E3OA 4XICA 1CQTA 2DTZA 1TWAJ 4JX5A 3ZQHA 1X58A 1B8IA 4S0HB 3BTIA 1WH5A 4D5FA 1Z77A 1F36A 1ETQA 5JLWA 1GUUA 3FISA 4Y7NJ 3K2AA 3JRAA 1MSEC 2GM4A 4FE7A 1HF0A 3OOUA 4A3CJ 4A3BJ 3GTOJ 2X9DA 5M3MJ 5EYRA 3SFIA 1HOMA 3LSPA 1LE8B 2EZHA 2HYJA 3TEDA 1XS9A 1PUFB 1MBHA 2LKXA 1WI3A 9ANTA 2I10A 1MH3A 1BW5A 2ME0A 3JRGA 1QRYA 2Y30A 1HCRA 1IG7A 5C4JJ 4FISA 3S1NJ 2NVQJ 4MIMA 3LSJA 5HODA 4UUSA 1Y1WJ 3CQZJ 1APLC 3JREA 2M0CA 2VKEA 1I50J 3JRFA 1MBKA 2DA2A 5IYBJ 4D7NA 1JUPA 3W6VA 2XPWA 2EH3A 4AYBN 2EZIA 2ECBA 3LSGA 3UKGA 2R5YA 3D1NI 2IBDA 3HB9A 1IC8A 1T56A 2ELKA 1GV2A 1SANA 2DN0A 3CDLA 2VUMJ 1X2MA 4JX6A 1ETXA 2YS9A 2VKVA 3BT9A 1FTZA 4UUSB 3M3YJ 2M9HA 5J3LA 1K61A 3HDDA 4GFBA 3WHBA 3FK6A 2ID3A 5GPCA 1RETA 1TWHJ 1RR7A 4M3EA 4BY7J 3E7LA 3B6AA 3ZQIA 1FJLA 2H8RA 3BTCA 4FE4A 3RZDJ 2O7OA 1AKHA 1RKWA 2JN6A 5M3FJ 3JRHA 3I4MJ 4B1RA 5K7FA 5E3NA 1K83J 2GBYA 3B6CA 2Y9ZA 1H89C 2FD5A 1TWFJ 2JK3A 1GVDA 1QVTA 2DMUA 1JKPC 2LP0A 2FX0A 3O8GA 2CQXA 2EZKA 4XRMA 5FKKA 4CYCB 2NVTJ 4MLOA 1IUFA 4XRSG 1HDPA 3JRIA 2DA3A 3TP0A 1XC5A 1POGA 2ECCA 4L5EA 5IOYA 2R7ZJ 4M3FA 3S1RJ 1BW6A 1VI0A 1JUMA 2QCOA 5EG0A 4DYCA 1P7JA 2DA7A 1AKHB 2HOAA 3BQYA 2LD5A 4M6VA 3QPSA 2O9LA 1LE8A 1MBJA 4XIDA 1ZR4A 4I76A 4IHWA 1Q1VA 2HXOA 2NS8A 4AUXA 3BTJA 3I4NJ 4DZPA 2LVSA 3HOVJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E19 A;  1ETO A;  1W0U A;  2X6O A;  3TP3 A;  5F04 A;  2NVY J;  3PM1 A;  2JA6 J;  2HOS A;  5FKO A;  2ME6 A;  5IP6 A;  3ZOB A;  1IDY A;  2G0E A;  4A3L J;  3FKI J;  4B4C A;  2FJ1 A;  2B63 J;  4I6Z A;  2IAI A;  1P7I A;  3BQZ A;  1BJZ A;  3O8H A;  5EG0 B;  2HI3 A;  1ORK A;  2HDD A;  2R92 J;  3BG5 A;  1F43 A;  4HNV A;  3M4O J;  1Y1V J;  1WPK A;  2L7Z A;  2N8G A;  3SDG A;  4MFE A;  1X2N A;  2HQ5 A;  4RDU A;  2LY9 A;  2VI6 A;  5M5Y J;  3NAU A;  1FTT A;  5FLM J;  1ZR2 A;  4W1U A;  2Y31 A;  3GTL J;  3ZQL A;  5EEA A;  1MNM C;  3L1P A;  2COB A;  2XGE A;  1VF9 A;  2EBI A;  3HOZ J;  2DMP A;  3Q0U A;  2DA1 A;  5GP9 A;  4M3G A;  5BNG A;  4J19 A;  2RAE A;  1GDT A;  5GPA A;  5F1J A;  1WH7 A;  3H3V K;  1UMQ A;  2XSD C;  1FEX A;  3BR1 A;  3A03 A;  4XK4 A;  2VPR A;  3S17 J;  4A3I J;  4IHY A;  1MBF A;  5IOZ A;  3ZQG A;  1U8B A;  3S1Q J;  3HOY J;  2ID6 A;  2EQR A;  2NOG A;  1TWG J;  3QPL A;  1IRZ A;  4B3A A;  4X6A J;  2NS7 A;  1B72 B;  3OSF A;  2D5V A;  1NTC A;  1NK3 P;  1ZK8 A;  3MKL A;  4MFD A;  5E3L A;  2LTP A;  4A69 C;  4ABZ A;  4A3E J;  3LOC A;  1JKQ C;  1VND A;  3FK7 A;  3GTM J;  1I6H J;  2XPU A;  4BBS J;  3IH3 A;  4MO7 A;  3Q0W A;  5EGO A;  2DMT A;  2IEK A;  1JJ8 C;  4M3D A;  4CYC A;  2AHQ A;  3BTL A;  1JT0 A;  2Y9Y A;  5EDN A;  4A3G J;  1BL0 A;  2M34 A;  2XB5 A;  4A3K J;  1SFO J;  2JWT A;  1H88 C;  2DA5 A;  5C4X J;  4LOC A;  1FIA A;  5J1Y A;  2O8K A;  4NDL A;  2R93 J;  2NVX J;  5F0H A;  5IP7 J;  3HGY A;  3K7A J;  1QVU A;  2LLK A;  2WV1 A;  1JUS A;  4BKX A;  2L9R A;  1IJW C;  1ENH A;  3HOW J;  2DMN A;  5EGO B;  2XGC A;  1ETV A;  3HKZ N;  3LSR A;  1ETK A;  1H8A C;  2K40 A;  1JKR C;  4D7M A;  4RBO A;  2DA4 A;  1ITY A;  1GT0 C;  2E2I J;  1NK2 P;  2JMW A;  3IH4 A;  3C2B A;  2TCT A;  4EEF G;  1HLV A;  1TWC J;  5C3E J;  1UHS A;  2MSY A;  3OIO A;  3VPR A;  2KDZ A;  2DJN A;  2K9Q A;  1MBE A;  4A3D J;  1YRN B;  3G1O A;  4XRS A;  2Y0S N;  3MVP A;  2L7F P;  5EF6 A;  2ZB9 A;  2E2H J;  2JJ7 A;  4AC0 A;  4QTR A;  5J1R A;  3TW6 A;  2MG4 A;  2R0Q C;  1IV6 A;  3IV5 A;  3WHC A;  3ZQC A;  3MN2 A;  1JJ6 C;  3BR5 A;  5EZH A;  3S16 J;  2DA6 A;  5IP9 J;  5F08 A;  3S2D J;  2XB0 X;  3QQA A;  3JRB A;  4FCY A;  3S15 J;  2DMQ A;  1UG2 A;  2YU9 J;  3NAR A;  2HXI A;  4BBR J;  1DU0 A;  4Y52 J;  1WCM J;  4UUT A;  1WGX A;  1RES A;  5EZG A;  3JRC A;  1B72 A;  2YUS A;  4C3I J;  1QPI A;  2K9S A;  4V2F A;  5K7H A;  2P81 A;  1E3O C;  3BR0 A;  1BA5 A;  2L0K A;  1RKT A;  3G1M A;  1OCT C;  2KT0 A;  2R5Z B;  4V2G A;  3HGG A;  3HOU J;  1I3Q J;  4JX4 A;  1TC3 C;  4W97 A;  3S1M J;  2HOT A;  2K9N A;  3CMY A;  2WAQ N;  1T33 A;  1S7E A;  4JP0 A;  3S14 J;  1Z0X A;  3A01 B;  2CU7 A;  3BR6 A;  5FLV A;  2XRL A;  2W48 A;  2PMZ N;  3GBG A;  1B8I B;  5F0C A;  3HOX J;  3JR9 A;  3BR2 A;  1IGN A;  4FTH A;  3F0C A;  1AU7 A;  3HEF A;  1OJL A;  3A02 A;  5IPA A;  2LFB A;  3IH2 A;  3TW7 A;  3HM5 A;  3Q0V A;  2E2J J;  1ZKG A;  2LK2 A;  4C3J J;  5M5W J;  1JT6 A;  3ZQF A;  1JTX A;  4A93 J;  1D5Y A;  1O4X A;  3S2H J;  3FIW A;  3RKQ A;  2LR8 A;  5J1U A;  1MSF C;  1ZTR A;  3GTG J;  4D5C A;  1JKO C;  2E1O A;  1ETY A;  2Y2Z A;  4DZJ A;  1ETW A;  1A5J A;  4A3J J;  5FKM A;  1JGG A;  2XGD A;  1A6I A;  2CQQ A;  1U9N A;  1IDZ A;  1OFC X;  5IYC J;  1U78 A;  5DTD A;  1LFB A;  4DW6 A;  5E3M A;  3JRD A;  3GTQ J;  1R9T J;  2CUF A;  5JLX A;  3RZO J;  1OCP A;  1YRN A;  3PO3 J;  4IEJ A;  1LFU P;  4JYK A;  2MW8 A;  5FKL A;  3CCY A;  3SJM A;  1DU6 A;  1U9O A;  4QSH A;  3BG9 A;  5K7Z A;  5F27 A;  2CRG A;  2TRT A;  2R5Y B;  3HBL A;  3BG3 A;  1ZQ3 P;  3LNQ A;  5FKN A;  3G1L A;  2OPT A;  5M5X J;  1AHD P;  5IYD J;  2FQ4 A;  5FJ8 J;  4A3M J;  2L7M P;  1EF4 A;  3H0G J;  5C44 J;  2H1K A;  3GTP J;  3PO2 J;  4M3B A;  3DCF A;  3GTK J;  5DS9 A;  3BR3 A;  2JA5 J;  4A3F J;  4G12 A;  1FIP A;  1RPW A;  2WB1 N;  4C3H J;  2JA7 J;  2MGQ A;  4IHV A;  4X1E A;  2AO9 A;  1ZGW A;  1GV5 A;  2X48 A;  1XG1 A;  2M8G X;  4QIW N;  4C2M J;  2XPV A;  2EZL A;  2R5Z A;  4BXX J;  1G2H A;  2JA8 J;  1VFC A;  2CJJ A;  4DYQ A;  1W0T A;  2OF7 A;  3RQI A;  3DEW A;  3OSG A;  1JTY A;  3GTJ J;  5F0F A;  2M2E A;  2GLO A;  2CUE A;  3Q3S A;  1PUF A;  2QF7 A;  4BY1 J;  4IHX A;  3A01 A;  1MBG A;  1HDD C;  1MH4 A;  4DYR A;  5E3O A;  4XIC A;  1CQT A;  2DTZ A;  1TWA J;  4JX5 A;  3ZQH A;  1X58 A;  1B8I A;  4S0H B;  3BTI A;  1WH5 A;  4D5F A;  1Z77 A;  1F36 A;  1ETQ A;  5JLW A;  1GUU A;  3FIS A;  4Y7N J;  3K2A A;  3JRA A;  1MSE C;  2GM4 A;  4FE7 A;  1HF0 A;  3OOU A;  4A3C J;  4A3B J;  3GTO J;  2X9D A;  5M3M J;  5EYR A;  3SFI A;  1HOM A;  3LSP A;  1LE8 B;  2EZH A;  2HYJ A;  3TED A;  1XS9 A;  1PUF B;  1MBH A;  2LKX A;  1WI3 A;  9ANT A;  2I10 A;  1MH3 A;  1BW5 A;  2ME0 A;  3JRG A;  1QRY A;  2Y30 A;  1HCR A;  1IG7 A;  5C4J J;  4FIS A;  3S1N J;  2NVQ J;  4MIM A;  3LSJ A;  5HOD A;  4UUS A;  1Y1W J;  3CQZ J;  1APL C;  3JRE A;  2M0C A;  2VKE A;  1I50 J;  3JRF A;  1MBK A;  2DA2 A;  5IYB J;  4D7N A;  1JUP A;  3W6V A;  2XPW A;  2EH3 A;  4AYB N;  2EZI A;  2ECB A;  3LSG A;  3UKG A;  2R5Y A;  3D1N I;  2IBD A;  3HB9 A;  1IC8 A;  1T56 A;  2ELK A;  1GV2 A;  1SAN A;  2DN0 A;  3CDL A;  2VUM J;  1X2M A;  4JX6 A;  1ETX A;  2YS9 A;  2VKV A;  3BT9 A;  1FTZ A;  4UUS B;  3M3Y J;  2M9H A;  5J3L A;  1K61 A;  3HDD A;  4GFB A;  3WHB A;  3FK6 A;  2ID3 A;  5GPC A;  1RET A;  1TWH J;  1RR7 A;  4M3E A;  4BY7 J;  3E7L A;  3B6A A;  3ZQI A;  1FJL A;  2H8R A;  3BTC A;  4FE4 A;  3RZD J;  2O7O A;  1AKH A;  1RKW A;  2JN6 A;  5M3F J;  3JRH A;  3I4M J;  4B1R A;  5K7F A;  5E3N A;  1K83 J;  2GBY A;  3B6C A;  2Y9Z A;  1H89 C;  2FD5 A;  1TWF J;  2JK3 A;  1GVD A;  1QVT A;  2DMU A;  1JKP C;  2LP0 A;  2FX0 A;  3O8G A;  2CQX A;  2EZK A;  4XRM A;  5FKK A;  4CYC B;  2NVT J;  4MLO A;  1IUF A;  4XRS G;  1HDP A;  3JRI A;  2DA3 A;  3TP0 A;  1XC5 A;  1POG A;  2ECC A;  4L5E A;  5IOY A;  2R7Z J;  4M3F A;  3S1R J;  1BW6 A;  1VI0 A;  1JUM A;  2QCO A;  5EG0 A;  4DYC A;  1P7J A;  2DA7 A;  1AKH B;  2HOA A;  3BQY A;  2LD5 A;  4M6V A;  3QPS A;  2O9L A;  1LE8 A;  1MBJ A;  4XID A;  1ZR4 A;  4I76 A;  4IHW A;  1Q1V A;  2HXO A;  2NS8 A;  4AUX A;  3BTJ A;  3I4N J;  4DZP A;  2LVS A;  3HOV J; 
#chains in the Genus database with same CATH topology
 1GLN A;  3I53 A;  4WF2 A;  2IW5 A;  5F04 A;  1G3Y A;  2NVY J;  3GZN B;  1AOY A;  1YHQ I;  1ZH5 A;  5BPD A;  2RNJ A;  3ZN1 A;  4UVC A;  4G8X A;  3OS1 A;  2KQR A;  4KIS A;  1Z05 A;  4I6Z A;  2HDC A;  2DK5 A;  3QOE A;  3O8H A;  2B9S A;  3R0J A;  1S8N A;  1O3R A;  5LHI A;  2M8E A;  4HNV A;  2YX4 A;  1Y56 A;  4BXU A;  1WPK A;  5D8L B;  2WY7 Q;  2XVC A;  4A6E A;  1X2N A;  2DPD A;  1W7P B;  3V8L A;  2VE9 A;  2EA4 A;  2F4M B;  3LWF A;  4KMU X;  2F6C A;  3DTE A;  3F72 A;  4BU2 A;  1Y0N A;  3R0A A;  1WJF A;  3M8J A;  2HVR A;  3KP5 A;  3HOZ J;  3Q0U A;  4ANJ A;  1WZ2 A;  3SDB A;  5H2F C;  4M3G A;  5LRS A;  5BNG A;  4TV7 A;  3LAP A;  4B8X A;  2MLK A;  3ZMS A;  1LPQ A;  1GDT A;  4EJT A;  3CJN A;  1FEX A;  4U87 A;  4KA4 A;  1MW7 A;  3OR1 C;  3ZQG A;  4AIK A;  2ID6 A;  1UCR A;  3L00 A;  2EQR A;  3DU6 A;  1TWG J;  2JSP A;  4NBQ A;  3HJE A;  4XOT A;  1SC7 A;  2QEN A;  2EV6 A;  4NQW A;  1LDD A;  5E20 A;  1B72 B;  1FSH A;  5GTH C;  1X1B A;  3CJR B;  3G3Z A;  5KHD A;  3S3M A;  3H5N A;  3HZJ A;  2CWE A;  1BI2 A;  2AS5 F;  2DDB A;  1SVM A;  4BHB A;  3LOC A;  3IKT A;  1ZRC A;  3GTM J;  5E1X A;  1I6H J;  2XPU A;  3PNV A;  4BBS J;  1Y39 A;  3IH3 A;  2ZCW A;  3Q0W A;  4RGU A;  2DMT A;  1OCR H;  1W1W E;  3K0L A;  2AHQ A;  4RB0 A;  4A3G J;  1I1G A;  3O6B B;  4UV9 A;  5CPR B;  4UNO A;  1SVL A;  4JK1 X;  4M71 A;  1B1B A;  3KYC B;  1L3L A;  5D6F A;  2R7R A;  2DA5 A;  1MMD A;  2MYS A;  2R4G A;  1LQ1 A;  5C4X J;  4CCM A;  4UB8 C;  4EJV A;  1SAX A;  3B73 A;  2Z9O A;  5F0H A;  1BI0 A;  3SFZ A;  1QVU A;  2DQR A;  2QM3 A;  2G7U A;  2HU9 A;  2CQK A;  3E97 A;  2L9R A;  3EUH A;  2RQQ A;  1ENH A;  2PBI A;  2O03 A;  2V79 A;  3V42 A;  4L18 B;  2DMN A;  4E6K G;  2IGO A;  2ISZ A;  4B43 A;  4LFU A;  4EAT A;  3HKZ N;  4HLX A;  1YIJ I;  1XDS A;  3LSR A;  4L0Z B;  1KA8 A;  1ZLJ A;  2NRA C;  3OYI A;  4D7M A;  2NXN B;  5AIQ A;  3V7C A;  4BJ5 C;  1GT0 C;  3LST A;  1LVK A;  2E60 A;  3IH4 A;  5IT9 Z;  1OR7 C;  2F4O B;  1RIO H;  5KCM A;  4G6D A;  1SFK A;  5C3E J;  2MSY A;  2VC0 A;  1YJN I;  2WAD A;  3ML6 A;  1KQ8 A;  3ZMD A;  2P7V B;  2KDZ A;  4LGW A;  2OZ6 A;  2M7B A;  2DJN A;  4YIF A;  2JRM A;  1YRN B;  3G1O A;  2EFP A;  2ACJ A;  1U5T C;  3QYE A;  3KZY A;  4LMY A;  1V5F A;  1B4A A;  4FX0 A;  4AC0 A;  3TW6 A;  2F5E A;  2DFH A;  4DGW B;  2R0Q C;  1HKT A;  2PEX A;  1TP4 A;  1ZRE A;  3L09 A;  1TBX A;  5LD2 C;  4G7Z F;  2DK8 A;  1CF7 A;  2EIJ H;  3E5Q A;  3MN2 A;  1BOB A;  4GO1 A;  2DA6 A;  4Y3O A;  1D3Y A;  3JRB A;  4RLQ A;  1QU3 A;  4XSX F;  2ZO4 A;  4IOC F;  5TJJ A;  2DMQ A;  1FC3 A;  1UG2 A;  1XCV A;  3J80 K;  3W2W A;  1TT5 B;  3C7J A;  5HLT A;  2YU9 J;  1XDU A;  3W6K B;  1IXR C;  2OBP A;  3OYL A;  1P4A A;  1DU0 A;  1I27 A;  3W6J B;  1EH8 A;  2NYX A;  2K86 A;  3MZH A;  2L4A A;  3JRC A;  3K4K A;  3DEE A;  1UEL B;  2EPF A;  2QSG X;  2K9S A;  3CTA A;  3NWT A;  4RGR A;  2XRO A;  4RB1 A;  1R22 A;  1R6R A;  2FML A;  3B02 A;  3K70 C;  5CVJ A;  3KP4 A;  1CF7 B;  2Z3Y A;  2PJR A;  3HOU J;  3J7A Y;  1TNS A;  5J8C A;  3CCL I;  3ERE D;  4JX4 A;  4PJM A;  3OYB A;  3S1M J;  2I5U A;  3KP3 A;  2A5W A;  5HVQ C;  3CMY A;  4K2E A;  4PDK A;  4YEJ A;  3CMM A;  3VDX A;  1XD7 A;  4HQM A;  4JP0 A;  4FAS D;  4ESJ A;  2F5C A;  3A01 B;  3HRS A;  1B6A A;  3L2V A;  2XRL A;  3C2G A;  4XLE A;  4ZZD A;  1B8I B;  3HOX J;  1E0E A;  3JR9 A;  3BR2 A;  2AQE A;  1R58 A;  2X1E A;  3F0C A;  1AU7 A;  3DTI A;  2DW4 A;  1V4R A;  4F92 B;  2A3S A;  1ERD A;  5L3D A;  4KFC A;  2GXB A;  1R4M B;  4Y15 A;  4XBF A;  4D0P A;  3AG1 H;  3Q0V A;  2RQP A;  2E35 A;  1OIS A;  4UV8 A;  2YSR A;  1JTX A;  2F2E A;  1L0O C;  2VJ5 A;  4DOZ A;  2XKP A;  2RDP A;  2E7W A;  1TT0 A;  4EQQ A;  3FXQ A;  1VQ7 I;  1R71 A;  3JSP A;  4M6Y A;  3U21 A;  1A36 A;  2MLG A;  3OS0 A;  1ZTR A;  2IA2 A;  4UB6 C;  1JKO C;  1IV8 A;  1PP7 U;  4XKW A;  3I5U A;  3GFI A;  3I54 A;  1ETW A;  1P92 A;  4XKC A;  2HPM A;  1S7O A;  4A3J J;  1A31 A;  5L3G A;  4CUG A;  1TTY A;  2CQQ A;  5ILU A;  1BOA A;  1KON A;  5IYC J;  2DXI A;  3CDI A;  5GAH J;  4QPQ A;  1LFB A;  3GTQ J;  2BY0 A;  5E3M A;  3JRD A;  1R49 A;  1IN4 A;  2CUF A;  2HPI A;  5FFZ A;  1XSX A;  4IHT A;  3IKV A;  1LFU P;  4JYK A;  3KYL A;  2MW8 A;  3SJM A;  1HW5 A;  4E7H A;  2K3F A;  3KZZ A;  3WTW C;  2WA0 A;  3S8P A;  4BE2 A;  1TNT A;  3HBL A;  3Q5F A;  5KVR A;  1UZC A;  2P4W A;  1RR8 C;  3U1D A;  3AFH A;  2WAE A;  3REO A;  4RLF A;  2DJI A;  3W2A A;  2MH2 A;  2L7M P;  1VTN C;  1EF4 A;  2ZJR F;  3H0G J;  2VLA A;  2CW8 A;  2VJ4 A;  2Y69 H;  3DCF A;  3IWZ A;  2BZT A;  4J01 A;  2VT2 A;  4N4N B;  1OKR A;  2KJB A;  2JA7 J;  5KK1 A;  5EEH A;  4I02 A;  3HUG A;  2MGQ A;  1P2F A;  2PN6 A;  2AO9 A;  3H5A A;  4U7B A;  1Y8R B;  4C2M J;  4YFK F;  5ED4 A;  2XPV A;  3IRR A;  2EZL A;  2LKP A;  3GFL A;  3FXL A;  1VFC A;  5HOO A;  4HPQ A;  3KFW X;  3KYD B;  2CGP A;  1YW8 A;  4ZYD A;  1ZHF A;  5ERI A;  3KLN A;  3WGH A;  3Q3S A;  1PUF A;  1LDK B;  2PJP A;  2K3P A;  4DYR A;  2LF8 A;  1Z67 A;  1YJ9 I;  1TWA J;  4G6T B;  3CCM I;  2RN7 A;  4A12 A;  1WH5 A;  4D9J A;  5DCF A;  2BOL A;  3TBI A;  4Y7N J;  3K2A A;  2VJI A;  1TQI A;  4MNU A;  3I3L A;  2IP2 A;  5CVV A;  3ZQQ A;  4A3B J;  2ZJP F;  3COA C;  1VQ8 I;  3ZQ7 A;  4WXD A;  3BG6 A;  4UVA A;  3LSP A;  4P5O A;  1FOY A;  2EZH A;  2V1U A;  3C3W A;  5A2Q Z;  3ASN H;  1PUF B;  3FMQ A;  4BHP A;  3GX4 X;  2KLO A;  3ZP5 A;  1EV7 A;  1U0J A;  1QNT A;  5D8K B;  3A2K A;  1I5Z A;  1BW5 A;  2E34 A;  5JVG F;  2OAZ A;  1USS A;  3AG4 H;  3K4L A;  4WXH A;  4ZC3 A;  3CLO A;  2E1M C;  2X6W A;  3S1N J;  3M1E A;  4UUS A;  3LSJ A;  2R7V A;  2L9V A;  3WGI A;  5LEK A;  2ZXW H;  4OOI A;  1BIA A;  1T0F C;  2GOM A;  4HAM A;  5CVR A;  4GGG A;  2A07 F;  4A0Z A;  4PGG A;  5IYB J;  1JUP A;  2KHM A;  2XPW A;  1V5G A;  3T8R A;  2EZI A;  1OCO H;  4WK8 F;  4FX4 A;  3LSG A;  3TO7 A;  2R5Y A;  1FLI A;  2IBD A;  4EGZ A;  4CCO A;  5DM6 F;  2WC2 A;  2P8T A;  1T56 A;  2ELJ A;  3TOA A;  2AQF A;  1KU3 A;  1K79 A;  3CDL A;  2XDV A;  4ZDP A;  2CW7 A;  2ELH A;  4JX6 A;  3L2C A;  1ETX A;  2IXS A;  1O7L A;  3TQN A;  2OV7 A;  2CG4 A;  1GXP A;  5AIP A;  2J5P A;  4UUS B;  5J3L A;  1GXQ A;  3MCZ A;  3ECH A;  3LL7 A;  4GFB A;  3FK6 A;  3VYS B;  2MC3 A;  2XAH A;  2PLY A;  2W00 A;  2HNH A;  2P6T A;  3ZQI A;  1FJL A;  4LK0 F;  2DI3 A;  3GZ5 A;  2EWN A;  4AYB A;  1N75 A;  4PSX A;  4ZTF A;  2A6H F;  2JN6 A;  3RPQ A;  5M3F J;  3JRH A;  4A0X A;  5K7F A;  1ON1 A;  4YFN F;  2IVM A;  1H89 C;  2Y9Z A;  3CC4 I;  4GXO A;  5ILV A;  3IC7 A;  5IT3 A;  3CJT B;  4HX8 A;  3WU2 C;  1GVD A;  1R36 A;  2BYV E;  4ESB A;  5DUI A;  2VJJ A;  2KZG A;  2EZK A;  2ZXI A;  5FKK A;  1OYW A;  1J0R A;  2NVT J;  4MLO A;  3MZ8 A;  1VQL I;  3F8N A;  4XRS G;  4C9Y A;  2DA3 A;  2FOW A;  2LH9 A;  4L5E A;  1W36 D;  2ZKZ A;  1YO5 C;  3E0J B;  2CH0 A;  1ZG3 A;  2MH9 A;  5EG0 A;  3P9C A;  2DA7 A;  2JRT A;  3PFY A;  5B5E C;  4Q5S F;  2AXT C;  2HOA A;  3C18 A;  4GYI A;  1VQK I;  3QPS A;  4IHS A;  3LA7 A;  1ZR4 A;  3K1M A;  2X85 A;  5CQG A;  1Z91 A;  4AUX A;  2CW0 F;  1R5I D;  3I4N J;  3R4K A;  3HOV J;  1I39 A;  1W0U A;  4MTD A;  4ENN A;  2PX9 A;  2IRF G;  1Z6T A;  2BVL A;  5H20 A;  2JA6 J;  2L7K A;  4XLC A;  5AON A;  4ZYE A;  3S3O A;  1MMN A;  3ZOB A;  2A68 F;  2FOK A;  2G0E A;  1E2X A;  3FKI J;  4XLA A;  2KL4 A;  2WAF A;  3C1D A;  3RKY A;  2B63 J;  4RB2 C;  2IAI A;  4CXF A;  2V6E A;  1P7I A;  1O3Q A;  5EG0 B;  3NEU A;  3GW2 A;  5LHG A;  4NC6 A;  4IVN A;  2HDD A;  1S72 I;  3GLX A;  3BG5 A;  3SQN A;  3ECO A;  1WQ2 A;  1Y1V J;  3VYU B;  4MFE A;  5M5Y J;  3NAU A;  3K4J A;  1ZR2 A;  4YFX F;  2Y0M A;  2ZME A;  2EJR A;  3R61 A;  3VB2 A;  1UG0 A;  5EEA A;  1F1Z A;  2ADU A;  3L1P A;  3RJP A;  3DEU A;  4XR6 A;  1P9Q C;  2XUB A;  2D1H A;  3G71 I;  3WTY C;  2QWW A;  3OYC A;  4ASN A;  2K7L A;  2XAJ A;  3ERM A;  2RAE A;  2LY1 A;  5F1J A;  3VYT B;  2VBZ A;  4DBQ A;  3H3V K;  1QHG A;  3BR1 A;  4E7K A;  1O7F A;  2P7C B;  1U8B A;  3S1Q J;  3EYY A;  1R4N B;  1ZLK A;  2ZBK A;  1T2K A;  4YIR X;  4KIC A;  4L9J A;  2QVO A;  4B3A A;  4X6A J;  4F52 A;  2QQB A;  3KX2 A;  1NTC A;  1NK3 P;  3I59 A;  3MKL A;  3ABL H;  3H3U A;  2QKL B;  4AD9 A;  5BPI A;  1IRF A;  2UZK A;  4A69 C;  4ABZ A;  3HG9 A;  2MD0 A;  1WI9 A;  3I0T A;  3I71 A;  1IN8 A;  4H4K C;  3FK7 A;  2L54 A;  2H6B A;  2V1X A;  2VQC A;  3QOD A;  3BY6 A;  3BCA A;  2LOO A;  4CYC A;  2COM A;  3BTL A;  4U88 A;  4XKB A;  1BR4 A;  3WU0 A;  2M34 A;  2XB5 A;  2VPL A;  1K6Y A;  1XB4 A;  1R5H A;  1FIA A;  4KN7 X;  1W36 C;  4NDL A;  2PMZ A;  4LG0 A;  2R93 J;  1XGN A;  3GWZ A;  2WBM A;  1J9I A;  3HGY A;  2W25 A;  3Q9S A;  1QPM A;  2EIK H;  2LLK A;  2XAQ A;  3N05 A;  1JUS A;  4MEX F;  4BKX A;  1QZY A;  5HDK A;  1IJW C;  2DQL A;  3KIO A;  2HZT A;  5JI6 A;  2VL8 A;  1FMW A;  3JAM K;  1G59 A;  2LC2 A;  4AIH A;  5L3E A;  2WV0 A;  4LLN A;  3ZMT A;  4HRI A;  2QSH X;  2V26 A;  4CZC A;  3ROU A;  3OMY A;  1JKR C;  1FPQ A;  4FT8 A;  2DA4 A;  2R7D A;  4BL0 B;  1FYL A;  1GVJ A;  2X1C A;  3FBI B;  3HHG A;  3MQ0 A;  2TCT A;  2M87 A;  4HNT A;  5BOX A;  4AID A;  4EJW A;  4UHT A;  3NWS A;  1O57 A;  4LG0 B;  3CD6 I;  2CFO A;  3EUK L;  3K1P A;  3BP8 A;  1NHA A;  3GYH X;  4RB3 C;  1W7P A;  1IRG A;  3LAJ A;  1MBE A;  1ODD A;  4MQV A;  3H36 A;  3J7Y J;  2C6Y A;  2QZ8 A;  2L7F P;  1NG7 A;  3L2U A;  1QBJ A;  4PGH A;  2XIG A;  2MG4 A;  1IV6 A;  4PJL A;  3WHC A;  3FXU A;  1VQ5 I;  3P9I A;  1LEB A;  2QKM B;  1ONV A;  1JJ6 C;  3BR5 A;  3ZR8 X;  3K4C A;  5EZH A;  3IP4 B;  1U5T B;  1XTA A;  3KZI C;  3S2D J;  4OMY A;  4IO9 F;  1HST A;  4II2 A;  2DLL A;  2HVQ A;  4BJT A;  2HQN A;  3CES A;  1O3T A;  5D5X B;  3QPH A;  1KQ9 A;  2W4S A;  4EJU A;  4UUT A;  1ZGJ A;  3GFJ A;  1TQP A;  3KP7 A;  1RES A;  5FRM A;  1B72 A;  3TO6 A;  4C3I J;  5GAD J;  5K7H A;  2IJL A;  3BR0 A;  4HSR A;  2DFF A;  1CGP A;  2L0K A;  3E5X A;  2Y0S A;  3WE3 A;  1RKT A;  3G1M A;  4PSW A;  1OCT C;  3RKW A;  2R5Z B;  4V2G A;  5D4S A;  2VB6 A;  3H3Z A;  4BAY A;  2Q2E B;  1FBU A;  1PVE A;  4OWR B;  2X51 A;  3IAM 2;  2HOT A;  2K9N A;  2H1L A;  4EM2 A;  1EA3 A;  2HYG D;  2CMP A;  3BJO A;  2H8W A;  4GYG A;  3BZK A;  5FD5 A;  1TZL A;  1S7E A;  1UHM A;  1WJB A;  3LFU A;  2BV6 A;  1JHH A;  1PYV A;  2W48 A;  2JVG A;  3AG2 H;  3GBG A;  2JTV A;  1W7P D;  1BN5 A;  3L9F A;  1K4S A;  2BY1 A;  4XSZ F;  4E4H A;  4BNC A;  3HEF A;  5LLQ A;  2A05 A;  4A5M A;  1F5T A;  3TW7 A;  3HM5 A;  2XF5 A;  4C3J J;  5M5W J;  4I0A A;  2FBH A;  3R6S A;  4HBL A;  4CCN A;  4MTE A;  3H1C A;  3RKQ A;  4RGX A;  4BQN A;  2Y2Z A;  3DP7 A;  1PDN C;  1U8R A;  4DZJ A;  3VWB A;  4Y33 A;  2VC1 A;  5FKM A;  1JGG A;  2XGD A;  1P4X A;  1X4O A;  5HS8 A;  5CQE A;  1U9N A;  4HG2 A;  3WU1 B;  2VOD A;  1FOW A;  5HDG A;  3CUQ A;  2H27 A;  2DAO A;  1BBY A;  3ZPL A;  4LB6 B;  3RSN A;  1BI1 A;  1YRN A;  1X3W B;  1XCB A;  3CCY A;  3PNT A;  2NNY A;  1Z7U A;  4QSH A;  3GME A;  1I3A A;  1BR2 A;  1XGM A;  4E70 A;  2FMY A;  1SAU A;  2TRT A;  2ICW G;  2QLZ A;  3FZV A;  4PZJ A;  1ZQ3 P;  1JHF A;  3LNQ A;  1E3H A;  4XLH A;  4FQG A;  3E6D A;  4V19 K;  2XF7 A;  2FQ3 A;  5FKN A;  3G1L A;  2BE5 F;  2J5O A;  2Z16 A;  4CCL A;  2FQ4 A;  4R79 A;  5K5O A;  5FJ8 J;  4PJJ A;  1KZH A;  4A3M J;  2I8D A;  3GTP J;  3PO2 J;  4LIU A;  4CIC A;  3GTK J;  5BS6 A;  3CUQ B;  4G12 A;  2K9L A;  1RPW A;  1YLF A;  3WE2 A;  3I9V 2;  4C3H J;  3N4M A;  4O3M A;  4M73 A;  4X1E A;  2M4K A;  1ZGW A;  5E8G A;  1GV5 A;  1X1C A;  2K5C A;  2X48 A;  3TKY A;  3OYA A;  4UVB A;  2O6G E;  1XX5 A;  3M8F A;  2MD5 A;  1RC9 A;  4EM0 B;  2BW3 A;  4C30 A;  4LG3 A;  4I0B A;  4JOM A;  3TL4 X;  2K4J A;  4JQF A;  3OYH A;  2FXA A;  2CJJ A;  2R7Q A;  3PQJ A;  3V4G A;  4CA0 A;  5B1A H;  1OCC H;  1W0T A;  1QZZ A;  3RQI A;  3DEW A;  4O5V A;  1SFX A;  1JTY A;  3GTJ J;  2W7N A;  5F0F A;  4XMY A;  1LVA A;  3FXM A;  1HKQ A;  1B9N A;  2QF7 A;  4FET A;  3K4M A;  3A01 A;  4M6X A;  1MJA A;  1REP C;  1BR1 A;  1HDD C;  2IPQ X;  2X4H A;  4BYY A;  5E3O A;  2E5N A;  1MNE A;  2XAS A;  1X58 A;  4ZYG A;  3OIP A;  1B8I A;  3KP2 A;  3BTI A;  4D5F A;  3PSF A;  2FE3 A;  1ETQ A;  1VQ4 I;  3FIS A;  2HEO A;  5E8I A;  2VXZ A;  2HKO A;  4WXC A;  5D4R A;  3Q9V A;  2BW3 B;  1K78 A;  3K4B A;  1BIB A;  3K69 A;  1HXD A;  2V7F A;  4Q47 A;  3GTO J;  4HDV A;  4BAC A;  3ISP A;  5K5R A;  4IJA A;  1HOM A;  3GLL A;  3UR3 C;  5HNF A;  1LE8 B;  1G4D A;  4XL9 A;  5JVT A;  4BDZ A;  4HF2 A;  4KJZ A;  3TED A;  1XS9 A;  4KN4 X;  3DPT A;  4BQA A;  2O61 A;  4OIR F;  4B48 A;  1OLT A;  2DU9 A;  3ZMU A;  9ANT A;  3F3X A;  3JRG A;  1JGS A;  3AL0 C;  1QRY A;  2Y30 A;  1HCR A;  1IG7 A;  1Z6R A;  3CCV I;  4HEA 2;  3ABK H;  4FIS A;  1FP2 A;  2VKD A;  4RMN A;  4MIM A;  1K78 B;  5LGN A;  3JRE A;  2F5V A;  3VYR B;  2XAF A;  1VZ0 A;  1I50 J;  3JRF A;  5D5U B;  3LQQ A;  3W6V A;  4AYB N;  1XSV A;  3K6G A;  3LFK A;  3UNG C;  5IT9 K;  3HTS B;  3UKG A;  1YI2 I;  4L5I A;  1XPX A;  3I55 I;  2EFN A;  1IXC A;  3FXK A;  1PP8 F;  1GV2 A;  2DN0 A;  4CHU A;  3IRQ A;  3HXL A;  4P55 A;  5F1R A;  1A04 A;  4ZYH A;  3MKW B;  1IN5 A;  2A69 F;  2CO5 A;  3LSI A;  1FMV A;  1QZE A;  1FTZ A;  2DO7 A;  1WRJ A;  2M0M A;  4HOB A;  3VOD A;  3WHB A;  1S5L C;  1UFM A;  1TWH J;  1BC7 C;  2GAU A;  1T39 A;  4M3E A;  2L4M A;  4L0Y B;  3E7L A;  3B6A A;  4G6Q A;  4BS9 A;  3CO6 C;  2H8R A;  4FE4 A;  4MGR A;  1M1E B;  2DCE A;  2V9P A;  5LBQ A;  3RZD J;  3KPH A;  1HQC A;  4P1W A;  1AWC A;  3M07 A;  3SZT A;  1OMI A;  3OL4 A;  2VXD A;  3I4M J;  4CYD A;  3CC7 I;  3EUA A;  3B6C A;  4FHT A;  2FD5 A;  3O3K A;  5EJC A;  4NHJ A;  4XLF A;  1IO2 A;  2FBI A;  1JKP C;  3H92 A;  1T08 B;  3KLO A;  3OYE A;  4B3X A;  3V8J A;  4XRM A;  4J00 A;  1IUY A;  2E7X A;  3MAJ A;  3JRI A;  2LMD A;  2G7H A;  2YX7 A;  2ECC A;  2R7Z J;  1FP1 D;  2R7T A;  1RRJ A;  1H9T A;  1TQM A;  3ELK A;  1VI0 A;  3E1S A;  1VQ6 I;  2Q8K A;  3TDZ C;  5K5Q A;  3EUH C;  4DYC A;  2CSO A;  1O3S A;  4GCV A;  3OYN A;  2JA2 A;  2L5Q A;  4O6J A;  4UY8 I;  1J5Y A;  2O9L A;  2PQ8 A;  2H09 A;  4DJA A;  2R7W A;  2GA1 A;  2DFI A;  4I76 A;  1Q1V A;  3WTV C;  2NS8 A;  4N0B A;  3BTJ A;  4DZP A;  2M1B A;  1Z1D A;  1W4M A;  2IS1 A;  4HX4 A;  4KNY A;  1SD7 A;  2OUM A;  1X1P A;  1XMK A;  3DKX A;  2H94 A;  4M74 A;  5FKO A;  2ME6 A;  3S32 A;  1FOK A;  2HGC A;  2GQQ A;  5EEG A;  4B4C A;  3MD2 A;  2BY3 A;  2WWY A;  3ZRG A;  1ZAR A;  1EKE A;  2HI3 A;  2R92 J;  1MD0 A;  3KP6 A;  1F43 A;  1LDJ A;  2XAG A;  4WWC A;  2L7Z A;  2N8G A;  4RS8 A;  2FUG 2;  1XGS A;  2HQ5 A;  1R23 A;  2VI6 A;  1FWZ A;  5J4Y A;  5J4V A;  3CF2 A;  2RGV A;  3BWG A;  3QU6 A;  4AU7 A;  5FLM J;  4UUV A;  4N9I A;  2ZFW A;  4W1U A;  2VOO A;  3DKW A;  1SVO A;  3ZQL A;  3HTU A;  2DFE A;  1MNM C;  3V7S A;  3G73 A;  2JUC A;  4LK1 F;  3IAS 2;  3RPU A;  2XRN A;  3MKY B;  4BHC A;  3L2Q A;  3EDP A;  2LSO A;  1RUO A;  2RC4 A;  1N25 A;  4IQ4 A;  2V4J C;  2V1N A;  2HKX A;  3S17 J;  3KEY A;  4A3I J;  4IHY A;  5IOZ A;  3HPH A;  4UXN A;  4AWX B;  2QUF A;  1D1B A;  3OY9 A;  1G6N A;  4ZJZ A;  3OSF A;  5IY5 H;  2D5V A;  1ZK8 A;  4MFD A;  3LSK A;  5TGT A;  3O2P E;  1UJ8 A;  3SZP A;  5E3L A;  2LTP A;  2E1N A;  4RAY A;  5HS9 A;  3TO9 A;  2IS2 A;  4BGD A;  4A3E J;  2QEX I;  1Y8Q B;  4AVP A;  1VND A;  1WFX A;  1FBQ A;  4MO7 A;  5FLX Z;  1DPU A;  3BOQ A;  1DGR M;  4KT5 C;  4CCK A;  3OYJ A;  4BE1 A;  2IEK A;  1JJ8 C;  4M3D A;  3I58 A;  2Y9Y A;  4ZDO A;  3W2V A;  1J59 A;  4HW0 A;  1MMS A;  3BLY A;  2HTJ A;  1R7J A;  3KEO A;  2B0L A;  5B3S H;  2O8K A;  3T5X A;  2O3F A;  3KE2 A;  3QAH A;  4DIQ A;  3MZY A;  4P9F A;  4IL6 C;  1A6Q A;  2JSC A;  2TDX A;  5CKT A;  3IUO A;  3PIP F;  4IXA A;  1AA7 A;  3HOW J;  1D0Y A;  1RI7 A;  1G3T A;  2FSW A;  3BC8 A;  2P5L C;  4BUP A;  3BPV A;  3MFK A;  3HL2 A;  4I99 C;  2H6C A;  1ETV A;  3RI4 A;  1WKM A;  5L3C A;  4XRF A;  1H8A C;  3F8F A;  3IWF A;  1G8X A;  4B09 A;  4RBO A;  3N97 A;  4A5N A;  1SEU A;  4C2U A;  4ETS A;  2JMW A;  3C2B A;  5FRN A;  4EGY A;  5JHU A;  4BE0 A;  4EEF G;  3H9G A;  3J7A O;  3DKY A;  1E3P A;  1TWC J;  1UHS A;  5A2Q K;  1LKX A;  2LDU A;  3OYD A;  1ZRF A;  3HSE A;  2IGN A;  3MWM A;  2VBX A;  3M9A A;  5LFA A;  2GIV A;  2K9Q A;  5DDG A;  4A3D J;  5D5V B;  2Q0O A;  3FXO A;  4XRS A;  2FU4 A;  2Y0S N;  3C2H A;  3CF5 F;  2JJ7 A;  4QTR A;  4AIJ A;  5J1R A;  4II3 A;  1ACI A;  3IV5 A;  3ZQC A;  2E5Z A;  2KFD A;  4ZZL A;  2L9N A;  2VE8 A;  4XLP F;  2YU3 A;  3RQ4 A;  1UHW A;  3A0B C;  5IP9 J;  2IGM A;  2MC4 A;  4DNC A;  4N4O B;  2VBY A;  3OS2 A;  4FCY A;  3DPL C;  5LGT A;  3S15 J;  3ESW B;  2CQ7 A;  1XSD A;  1WJE A;  2LNB A;  3NAR A;  1YS6 A;  2CFX A;  2HXI A;  1B59 A;  1WCM J;  2AXL A;  2WTE A;  1WGX A;  2Z1D A;  5EZG A;  2OCE A;  2RNG A;  3HYI A;  3RYP A;  3SEZ A;  3J81 Z;  2YUS A;  1QPI A;  4V2F A;  4I2O A;  3L7W A;  1E3O C;  4BQO A;  2W85 A;  3H35 A;  2KT0 A;  2Z99 A;  4HA8 A;  3HOT A;  3I56 I;  3IL2 A;  3LSM A;  2DDA A;  2OTJ I;  3QRF F;  4W97 A;  2UXN A;  4Y4R A;  1T33 A;  2ISY A;  3L2W A;  2QA4 I;  3JTH A;  3VSK A;  2A6T A;  2O5R A;  3U2R A;  2X6Y A;  4AVZ A;  2RRE A;  4PJ0 C;  2IS4 A;  3BR6 A;  3FX3 A;  3QOP A;  2RKH A;  6PAX A;  3P9K A;  4KIT B;  2P0W A;  3GXO A;  3IHU A;  4HST A;  3T1B A;  3QP6 A;  2VQG A;  4ON0 A;  3SHF A;  4EMS A;  4P9U A;  2KZV A;  3K4N A;  4MQ9 F;  5IPA A;  4Y17 A;  1C0W A;  3IH2 A;  3RCO A;  1FOX A;  3X2Q H;  1D1C A;  2QQ9 A;  2E2J J;  2KPM A;  1X1A A;  1JT6 A;  3ZQF A;  3LA3 A;  3SYT A;  1YYV A;  3JSO A;  2STT A;  1KYW A;  4L5J A;  2LBF B;  1D5Y A;  3R60 A;  2ZXJ A;  3ZXS A;  1Y6I A;  3FIW A;  2WAQ A;  2LF7 A;  2LR8 A;  4YII A;  1MSF C;  4QPO A;  3T8T A;  3GTG J;  3E3V A;  1T6S A;  2E1O A;  2BHZ A;  1R00 A;  3CP2 A;  2OQR A;  2F4I A;  3G6E I;  2VAS A;  4LIV A;  1TL8 A;  1A5J A;  1XMX A;  1A6I A;  1U6G A;  1MMA A;  1X19 A;  1OFC X;  4NC8 A;  2DOD A;  3TGN A;  2EK5 A;  3ZN0 A;  2M4G A;  5DTD A;  3CMA I;  3FM3 A;  4BEH B;  4I01 A;  3RZO J;  1OR7 A;  1OCP A;  2BXY A;  1JXS A;  3PO3 J;  5JFR A;  1ZGA A;  1YW7 A;  4CZZ A;  2VKH A;  1QA6 A;  3BG9 A;  5K7Z A;  3GZ6 A;  4U0V A;  2CRG A;  4XOR A;  3BG3 A;  2IT0 A;  1H0M A;  2ZXH A;  2FEZ A;  5J47 A;  5DD8 A;  5E79 C;  2VOP A;  1U5T A;  2E71 A;  1HC8 A;  3BZ6 A;  2MBF A;  5IYD J;  4LB5 A;  4M9S A;  1IXS B;  3J7Z I;  3MMY B;  5E1W A;  2PG4 A;  2KP6 A;  4M3B A;  4HNU A;  4I98 B;  2WY8 Q;  3BR3 A;  2JA5 J;  2DT6 A;  4XN3 A;  1FIP A;  3H5R A;  3A0H C;  4KUM A;  2XKO A;  2K4B A;  4MHG A;  4IHV A;  2ETH A;  3I64 A;  3FXR A;  2Q1Z B;  5HLG A;  2EFO A;  1XG1 A;  2R7F A;  3HRM A;  4YEL A;  4QIW N;  1VQM I;  4OIP F;  3CCQ I;  3AAF A;  2HQR A;  1D8J A;  2R5Z A;  4BDY A;  3OYG A;  5ICE A;  1G2H A;  5E18 F;  2KIU A;  2Q2E A;  3EYI A;  1KQ0 A;  2EIM H;  1MDM B;  4DYQ A;  2UV1 A;  3WTZ A;  3FF5 A;  3L2R A;  4AM3 A;  3DF8 A;  4F91 B;  2IS6 A;  2OF7 A;  5LEJ A;  4F93 B;  2JPC A;  3OSG A;  2V1D A;  2ESH A;  4Q48 A;  4PFP A;  2M2E A;  2GLO A;  2CUE A;  4BY1 J;  3EET A;  3E5U A;  2GZW A;  3DQV C;  5H6Q A;  1DDN A;  2GOX B;  1CQT A;  3ZCO A;  4U0Y A;  1YX3 A;  1T98 A;  3H0D A;  2WB1 A;  2BXZ A;  5JLW A;  1GUU A;  2NOJ B;  3HPG A;  5DEQ A;  2GM4 A;  1HF0 A;  1GHC A;  3WOD F;  3OOU A;  4A3C J;  3VSL A;  1MIJ A;  4CDG A;  4HLY A;  2Z2S B;  4RGS A;  5M3M J;  2STW A;  4KIB A;  1HA8 A;  3SFI A;  3U9G A;  2V9V A;  1V5E A;  2IA0 A;  4WCG A;  4DQ2 A;  2L9S A;  2JUG A;  5DCM B;  1OYY A;  2HQA A;  2JPB A;  3FMS A;  2EIL H;  1DPR A;  4H0E A;  1DP7 P;  2LKX A;  3F6V A;  1SD6 A;  2LY2 A;  1WI3 A;  1B9M A;  4OIO F;  4BH9 A;  1STZ A;  1MH3 A;  4XOP A;  3M8E A;  2DOE A;  4OIN F;  4RAG A;  2RVC A;  4LLL A;  2KRH A;  5C4J J;  5F64 A;  2K27 A;  1Y1W J;  5HOD A;  1V3F A;  4G94 A;  3CQZ J;  4RM2 A;  3SXY A;  1APL C;  3NQO A;  2GXA A;  2E1C A;  3M1C A;  3E6B A;  2ZME C;  2ZJ2 A;  2V9K A;  2VKE A;  3F6O A;  1YTY A;  2L3D A;  1KU2 A;  2DBB A;  3ZMV A;  1MBK A;  2DA2 A;  4LJZ F;  3AL0 B;  1D5V A;  4D7N A;  3QP5 A;  5DYM A;  4B47 A;  2ZC2 A;  1OYI A;  3LMM A;  3HOS A;  1D1A A;  2D45 A;  2Y75 A;  3A4C A;  1SD5 A;  4BQQ A;  2ECB A;  3QYF A;  4PFO A;  3DWL E;  3J80 Z;  2FRH A;  5TRD A;  2XSJ C;  4Z6Y A;  3HB9 A;  1MKM A;  3K70 D;  2ELK A;  1SAN A;  2M3A A;  1BM9 A;  1X2M A;  4R8H A;  4HZF A;  2YS9 A;  3VEP A;  1SMY F;  3NRV A;  3RYR A;  2K9M A;  3M3Y J;  4GDF A;  1LFP A;  2M9H A;  3M7G A;  2PMU A;  1QO0 D;  1X4P A;  3HDD A;  3OWT A;  5GPC A;  1IF1 A;  3ZGK A;  5KAI C;  2M30 A;  4BY7 J;  2KIQ A;  1X3Z B;  1TW2 A;  2F5F A;  3K10 A;  1S29 A;  3BTC A;  1LNW A;  4DBR A;  4NQW B;  1ON2 A;  1Y0U A;  1YS7 A;  2UUZ A;  1AKH A;  3BPX A;  3K1N A;  2KIS A;  5BQT A;  4M9Z A;  4B1R A;  5CJ9 A;  1YX5 A;  1YJW I;  2R7O A;  2GBY A;  4B44 A;  1U3E M;  3ABM H;  1TWF J;  2JT1 A;  4E7I A;  4XNF A;  5TIS C;  4I09 A;  2DMU A;  1NG6 A;  4Z2Y A;  2XF6 A;  2LP0 A;  3O8G A;  3PSI A;  4OU0 A;  5GAG J;  2CQX A;  4HV5 A;  1HKS A;  2IA1 A;  3ZMZ A;  5HLH A;  4EJO A;  5JHF A;  1ZEL A;  4M9X A;  3TP0 A;  5L3F A;  1XC5 A;  4EVI A;  5IOY A;  4IQJ A;  4M3F A;  3S1R J;  2HFH A;  5ICC A;  1XMA A;  1OCZ H;  1JUM A;  2QCO A;  2HZD A;  1MMG A;  4HQE A;  1I1S A;  3HRT A;  2HVS A;  2CUZ A;  2Z33 A;  2KRF A;  1AKH B;  1RNL A;  2F5D A;  3BQY A;  2VBW A;  1ZRD A;  2GXG A;  4M6V A;  1LE8 A;  2QBY A;  4HF1 A;  1FSE A;  2HXO A;  4XN0 A;  1I6X A;  5K1Y A;  3OIQ A;  4CH7 A;  3GF2 A;  3S93 A;  2E19 A;  1ETO A;  2BVM A;  2X6O A;  3TP3 A;  5BMZ A;  3PM1 A;  2HOS A;  5IP6 A;  4ENM A;  4HX7 A;  2MAB A;  1IDY A;  4HYE A;  4E7L A;  4A3L J;  4ESF A;  2FJ1 A;  4BXF A;  1WVR A;  3I4P A;  1K7A A;  1YIT I;  2M45 A;  3BQZ A;  1BJZ A;  3GVA A;  3FHN A;  1LJ9 A;  1MJB A;  1XN7 A;  1ORK A;  4LIT A;  4XKV A;  1PUE E;  4PJN A;  4YRV A;  3M4O J;  3SDG A;  4KIG A;  4NC7 A;  4N9H A;  1T8I A;  4RDU A;  2LY9 A;  2QBY B;  2JVH A;  3DV8 A;  3H9J A;  3PL8 A;  1FTT A;  1WHU A;  1Z21 A;  1J2X A;  2ZFU A;  3D5L A;  2W82 A;  2Y31 A;  3F8C A;  5F6F A;  2DT5 A;  2VIX A;  3D0S A;  3GTL J;  2OC6 A;  1T0F A;  2W1O A;  2OJE D;  2COB A;  2XGE A;  4KIF A;  4IX7 A;  4IF4 A;  1D0Z A;  3KEQ A;  4E7Z A;  1VF9 A;  1FY7 A;  2EBI A;  2DMP A;  1RZ4 A;  2DA1 A;  2M7A A;  5GP9 A;  3BJA A;  5LHH A;  3FHZ A;  3GEZ A;  4J19 A;  4ENJ A;  1LUJ B;  5GPA A;  3LQR A;  1WH7 A;  5FRO A;  4EV0 A;  1UMQ A;  5E1Z B;  2XSD C;  3SZG A;  5J40 A;  3A03 A;  4U0W A;  4XK4 A;  2VPR A;  3CDH A;  1MBF A;  2CV2 A;  2W57 A;  3HOY J;  3BDD A;  3HRU A;  2NOG A;  3QPL A;  2E1M B;  1IRZ A;  4PCQ A;  4I7H A;  4GRI A;  1IN7 A;  2R7S A;  1IZ1 A;  2PFB A;  2NS7 A;  1J7K A;  1T95 A;  3P7N A;  2KIF A;  1VQO I;  5DM7 F;  1W5T A;  2HYF A;  1SD4 A;  4ZDL A;  3WGG A;  3HIF A;  1VQN I;  2LKS A;  1BJA A;  2KMU A;  2EIN H;  3ASO H;  2ZSH B;  1JKQ C;  4CCJ A;  2CQN A;  3FXJ A;  3ULQ B;  3E6C C;  2PJR B;  2DPU A;  2FNP A;  2OZU A;  4IPA A;  2EA2 A;  1KU9 A;  5EGO A;  1Z3Y A;  2VQH A;  3JTG A;  1BC8 C;  4RAZ A;  1JT0 A;  4ENK A;  4L9N A;  5EDN A;  2ZJQ F;  5GAE J;  1BL0 A;  4X0G A;  2EV5 A;  2EFW A;  1ZYR F;  4A3K J;  1SFO J;  2JWT A;  1H88 C;  4A2U A;  2KJC A;  4LOC A;  3VFZ A;  2BEO A;  5J1Y A;  1ZAO A;  2X6X A;  1KGS A;  2CV1 A;  3JW4 A;  3LSH A;  3T0Y A;  2NVX J;  2R3S A;  5CLS A;  5IP7 J;  3FKJ A;  2CYY A;  3D5R C;  4RAF A;  3K7A J;  2O0Y A;  3WTS C;  2WV1 A;  2UWM A;  5E17 F;  2ESN A;  5HLI A;  3OV8 A;  2R7X A;  1UAA A;  5D5W B;  2XC7 A;  4QWQ A;  3GCM A;  3FMR A;  1YE9 A;  2XGC A;  5EGO B;  4CGZ A;  3EPZ A;  4A0Y A;  3JCU C;  3BZC A;  1ETK A;  2A6E F;  2K40 A;  2W24 A;  1X1D A;  1YFH A;  1ITY A;  2E2I J;  3CUQ C;  2X1D A;  1NK2 P;  4KT6 A;  2FF4 A;  2HWV A;  3GUD A;  1HLV A;  1FT9 A;  3RDI A;  2RV8 A;  2CUJ A;  1TW3 A;  3OIO A;  3VPR A;  4IRH A;  2QGU A;  4U7D A;  2K85 A;  2CV0 A;  3FBN B;  2ZNZ A;  1DUX C;  3TDU C;  4OAY A;  3MVP A;  5EF6 A;  2ZB9 A;  4RM3 A;  2YPR A;  2E2H J;  2PI0 A;  1KYZ A;  2JZY A;  3F8M A;  1NH3 A;  2XGX A;  3TOB A;  1WJD A;  3TMO A;  3DXJ F;  4HF0 A;  1G3W A;  1YW9 A;  2HTS A;  3HKZ A;  1W5C C;  4ZYA A;  3OOP A;  3FDY A;  1S3J A;  1K4T A;  3G4S I;  3S16 J;  1Q1H A;  1SMT A;  2XB0 X;  3QQA A;  5F08 A;  4HV6 A;  1OPC A;  1Z9C A;  3DBH B;  2P5V A;  3PFI A;  5DV5 A;  4BBR J;  5ICG A;  4Y52 J;  4LD5 A;  4L9V A;  2QQA A;  3MKZ A;  3BRO A;  3HUG B;  4NB5 A;  2R7U A;  4IOA F;  2P81 A;  3BCB A;  3D5S C;  4LLG F;  4ZH4 F;  1WJ5 A;  1BA5 A;  2VON A;  1VQ9 I;  1VQP I;  1U2W A;  3WTX C;  3HGG A;  3BG7 A;  2LRD A;  1QHH D;  1YG2 A;  1I3Q J;  3PUB A;  1F9N A;  2XHK A;  1TC3 C;  1FBS A;  5GTI C;  3S3N A;  2O8X A;  5KAF C;  2WAQ N;  2EFQ A;  5FGM A;  3KET A;  5H6R A;  3QWL A;  1HSJ A;  1H9G A;  4G7H F;  1MZB A;  3S14 J;  1YIO A;  2OA4 A;  1Z0X A;  2CU7 A;  3CCS I;  5FLV A;  1FYM A;  2PMZ N;  2DOF A;  5F0C A;  3F23 A;  1DQU A;  1DP3 A;  5HS7 A;  1IGN A;  4WX9 A;  2EB7 A;  4FTH A;  1G3S A;  5CVU A;  1T38 A;  5CYV A;  1OJL A;  3A02 A;  2ZSI B;  1P4W A;  2LFB A;  5FD6 A;  1IN6 A;  3K2Z A;  2QYO A;  5DUK A;  5ICF A;  2KIM A;  3U1K A;  1ZKG A;  2LK2 A;  4NUB A;  3DPU A;  2E36 A;  2QQ8 A;  4A93 J;  4KDP A;  1W5S A;  5FO5 A;  2Y48 A;  1O4X A;  3S2H J;  1DGW Y;  3FM5 A;  3FWE A;  5J1U A;  1N78 A;  3V7R A;  4M72 A;  4D5C A;  1ETY A;  3VOE A;  2OTL I;  1J75 A;  2B7E A;  1WSU A;  1OQY A;  1IDZ A;  3K9T A;  1S6L A;  5LGU A;  1U78 A;  5J8F A;  1WWX A;  4DW6 A;  1R9T J;  5JLX A;  2FBK A;  3F22 A;  4IEJ A;  3AKZ A;  3HSF A;  5FKL A;  3F9K A;  3RPU D;  1DU6 A;  3WG9 A;  1U9O A;  1EJ9 A;  1SFE A;  4L9T A;  2L2O A;  5F27 A;  1UST A;  2M5W A;  1Z3X A;  2LG4 A;  2R5Y B;  3G2B A;  1S7A A;  1WJA A;  1V54 H;  2BY2 A;  2OPT A;  5M5X J;  1AHD P;  3PQK A;  4XQF A;  1RUN A;  5LRR A;  3CO7 C;  3MEX A;  3KCC A;  5J6X A;  2L01 A;  3OR2 C;  5C44 J;  2H1K A;  5L3B A;  4QLC U;  3DTK A;  3EQL F;  1J09 A;  3CCR I;  3F8B A;  4G9Y A;  5DS9 A;  4MEY F;  4A3F J;  1HW2 A;  3OL3 A;  2DT7 B;  5KNL A;  2WB1 N;  4Q4Z F;  1LB2 A;  5D6E A;  2HS5 A;  5B1B H;  2BGC A;  2LRE A;  2OU2 A;  4ITV A;  2M8G X;  4A6D A;  2LYC A;  4PUS A;  2ZNY A;  3V8K A;  4KYW A;  4IZZ A;  2V6C A;  4F55 A;  2VQL A;  1ULY A;  4C2T A;  4BXX J;  1QGP A;  2JA8 J;  2EV0 A;  3GFM A;  3PNY A;  5HNH A;  4S05 A;  1FNN A;  4BJ6 C;  3P5J A;  1UB9 A;  3HHH A;  3RTR A;  3CJQ B;  3CC2 I;  3H9Q A;  2DYS H;  3ONQ A;  1S9H A;  3DBR B;  1R1U A;  1YOV B;  4F3Q A;  1MBG A;  4IHX A;  1IW7 F;  1MH4 A;  4XIC A;  3CZ6 A;  2DTZ A;  4JX5 A;  3ZQH A;  3OYK A;  1IAW A;  4S0H B;  4G7O F;  1JE8 A;  1Z77 A;  3RKX A;  3JAM Z;  1F36 A;  1MJ9 A;  2P6S A;  2Z5U A;  1QQI A;  4Y13 A;  3JRA A;  1MSE C;  5FLX K;  1P6R A;  3F21 A;  4OIQ F;  4FE7 A;  4S04 A;  4IRI A;  5FFX A;  2F48 A;  2X9D A;  1FYK A;  5EYR A;  2DTR A;  2LBF A;  1R5G A;  2HYJ A;  2VT3 A;  3CP8 A;  4XLN F;  1MBH A;  2YR2 A;  3GO5 A;  4EM1 A;  3OYF A;  2I10 A;  3DFG A;  4NNJ A;  3WG7 H;  2ME0 A;  1IRX A;  2CS3 A;  3E6M A;  3PJR A;  2GA2 A;  5CVI A;  3S2W A;  4HDU A;  3ABT A;  4XM3 A;  1WJC A;  3HC7 A;  3HSR A;  4D1Q A;  2NVQ J;  4E7S A;  1A35 A;  4IRG A;  2NVU B;  2M0C A;  4BEH A;  4P96 A;  4OAZ A;  4CSW A;  3PUF A;  3DU5 A;  4XON A;  3CCE I;  2BBY A;  2HR3 A;  3RIR A;  1PJR A;  2EH3 A;  1XGO A;  2NNN A;  2KRC A;  4CO8 A;  4RA2 A;  3D1N I;  2W84 A;  2OQG A;  4ZTJ A;  2ZME B;  2IGK A;  1EH6 A;  2GWR A;  3CUO A;  1IC8 A;  5B66 C;  3CCJ I;  2VUM J;  2NS0 A;  4R1H A;  1N77 A;  1FZP B;  2HDW A;  2VKV A;  1TLH B;  1X3U A;  1Z7L A;  3BT9 A;  3QU3 A;  4JBA A;  3CCU I;  2L02 A;  3SEQ A;  1EH7 A;  2MA3 A;  3DLL F;  1K61 A;  2VN2 A;  2ID3 A;  2X0L A;  1ZN2 A;  1RET A;  1F4K A;  1LEA A;  1SFU A;  1YQA A;  1R1T A;  5HDN A;  1RR7 A;  1ZG1 A;  2QSF X;  3QYB A;  1D8K A;  2NAZ A;  2PMH A;  1ZG5 A;  2O7O A;  1RKW A;  3I59 B;  2KKO A;  2GIZ A;  3PIO F;  1MDM A;  3QPT A;  2A61 A;  2OD5 A;  5E3N A;  5JR3 A;  1K83 J;  3CLQ A;  1D0X A;  3CME I;  2D2W A;  2OCC H;  2XAU A;  2JK3 A;  1QVT A;  3LA2 A;  3W3C A;  3A1Y A;  3J81 K;  2UXX A;  4E7J A;  2FX0 A;  2A5Y B;  1MGT A;  4OMZ A;  2HOE A;  4CYC B;  3WTT C;  3AG3 H;  5ILS A;  1IUF A;  4IKF A;  1HDP A;  1E17 A;  1BI3 A;  2FA5 A;  1POG A;  5DD4 A;  2DYR H;  2FNA A;  4PK4 A;  1BW6 A;  3OYM A;  1KU7 A;  1R1V A;  2G9W A;  1P7J A;  5FB2 A;  3BJ6 A;  1HW1 A;  1JI8 A;  2MFZ A;  2DOA A;  2KDO A;  2XV4 S;  3DLA A;  2LD5 A;  2BHY A;  3WTU C;  2D1V A;  1HBX G;  1K6O A;  1MBJ A;  3DBL B;  4YG2 F;  4XID A;  2P5K A;  1MND A;  1V55 H;  4IHW A;  5DCM A;  4F7Z A;  4KMF A;  2JQ7 A;  3ABU A;  2LVS A;  1FX7 A;  2K02 A; 
#chains in the Genus database with same CATH homology
 2E19 A;  1ETO A;  1W0U A;  2X6O A;  3TP3 A;  5F04 A;  2NVY J;  3PM1 A;  2JA6 J;  2HOS A;  5FKO A;  2ME6 A;  5IP6 A;  3ZOB A;  1IDY A;  2G0E A;  4A3L J;  3FKI J;  4B4C A;  2FJ1 A;  2B63 J;  4I6Z A;  2IAI A;  1P7I A;  3BQZ A;  1BJZ A;  3O8H A;  5EG0 B;  2HI3 A;  1ORK A;  2HDD A;  2R92 J;  3BG5 A;  1F43 A;  4HNV A;  3M4O J;  1Y1V J;  1WPK A;  2L7Z A;  2N8G A;  3SDG A;  4MFE A;  1X2N A;  2HQ5 A;  4RDU A;  2LY9 A;  2VI6 A;  5M5Y J;  3NAU A;  1FTT A;  5FLM J;  1ZR2 A;  4W1U A;  2Y31 A;  3GTL J;  3ZQL A;  5EEA A;  1MNM C;  3L1P A;  2COB A;  2XGE A;  1VF9 A;  2EBI A;  3HOZ J;  2DMP A;  3Q0U A;  2DA1 A;  5GP9 A;  4M3G A;  5BNG A;  4J19 A;  2RAE A;  1GDT A;  5GPA A;  5F1J A;  1WH7 A;  3H3V K;  1UMQ A;  2XSD C;  1FEX A;  3BR1 A;  3A03 A;  4XK4 A;  2VPR A;  3S17 J;  4A3I J;  4IHY A;  1MBF A;  5IOZ A;  3ZQG A;  1U8B A;  3S1Q J;  3HOY J;  2ID6 A;  2EQR A;  2NOG A;  1TWG J;  3QPL A;  1IRZ A;  4B3A A;  4X6A J;  2NS7 A;  1B72 B;  3OSF A;  2D5V A;  1NTC A;  1NK3 P;  1ZK8 A;  3MKL A;  4MFD A;  5E3L A;  2LTP A;  4A69 C;  4ABZ A;  4A3E J;  3LOC A;  1JKQ C;  1VND A;  3FK7 A;  3GTM J;  1I6H J;  2XPU A;  4BBS J;  3IH3 A;  4MO7 A;  3Q0W A;  5EGO A;  2DMT A;  2IEK A;  1JJ8 C;  4M3D A;  4CYC A;  2AHQ A;  3BTL A;  1JT0 A;  2Y9Y A;  5EDN A;  4A3G J;  1BL0 A;  2M34 A;  2XB5 A;  4A3K J;  1SFO J;  2JWT A;  1H88 C;  2DA5 A;  5C4X J;  4LOC A;  1FIA A;  5J1Y A;  2O8K A;  4NDL A;  2R93 J;  2NVX J;  5F0H A;  5IP7 J;  3HGY A;  3K7A J;  1QVU A;  2LLK A;  2WV1 A;  1JUS A;  4BKX A;  2L9R A;  1IJW C;  1ENH A;  3HOW J;  2DMN A;  5EGO B;  2XGC A;  1ETV A;  3HKZ N;  3LSR A;  1ETK A;  1H8A C;  2K40 A;  1JKR C;  4D7M A;  4RBO A;  2DA4 A;  1ITY A;  1GT0 C;  2E2I J;  1NK2 P;  2JMW A;  3IH4 A;  3C2B A;  2TCT A;  4EEF G;  1HLV A;  1TWC J;  5C3E J;  1UHS A;  2MSY A;  3OIO A;  3VPR A;  2KDZ A;  2DJN A;  2K9Q A;  1MBE A;  4A3D J;  1YRN B;  3G1O A;  4XRS A;  2Y0S N;  3MVP A;  2L7F P;  5EF6 A;  2ZB9 A;  2E2H J;  2JJ7 A;  4AC0 A;  4QTR A;  5J1R A;  3TW6 A;  2MG4 A;  2R0Q C;  1IV6 A;  3IV5 A;  3WHC A;  3ZQC A;  3MN2 A;  1JJ6 C;  3BR5 A;  5EZH A;  3S16 J;  2DA6 A;  5IP9 J;  5F08 A;  3S2D J;  2XB0 X;  3QQA A;  3JRB A;  4FCY A;  3S15 J;  2DMQ A;  1UG2 A;  2YU9 J;  3NAR A;  2HXI A;  4BBR J;  1DU0 A;  4Y52 J;  1WCM J;  4UUT A;  1WGX A;  1RES A;  5EZG A;  3JRC A;  1B72 A;  2YUS A;  4C3I J;  1QPI A;  2K9S A;  4V2F A;  5K7H A;  2P81 A;  1E3O C;  3BR0 A;  1BA5 A;  2L0K A;  1RKT A;  3G1M A;  1OCT C;  2KT0 A;  2R5Z B;  4V2G A;  3HGG A;  3HOU J;  1I3Q J;  4JX4 A;  1TC3 C;  4W97 A;  3S1M J;  2HOT A;  2K9N A;  3CMY A;  2WAQ N;  1T33 A;  1S7E A;  4JP0 A;  3S14 J;  1Z0X A;  3A01 B;  2CU7 A;  3BR6 A;  5FLV A;  2XRL A;  2W48 A;  2PMZ N;  3GBG A;  1B8I B;  5F0C A;  3HOX J;  3JR9 A;  3BR2 A;  1IGN A;  4FTH A;  3F0C A;  1AU7 A;  3HEF A;  1OJL A;  3A02 A;  5IPA A;  2LFB A;  3IH2 A;  3TW7 A;  3HM5 A;  3Q0V A;  2E2J J;  1ZKG A;  2LK2 A;  4C3J J;  5M5W J;  1JT6 A;  3ZQF A;  1JTX A;  4A93 J;  1D5Y A;  1O4X A;  3S2H J;  3FIW A;  3RKQ A;  2LR8 A;  5J1U A;  1MSF C;  1ZTR A;  3GTG J;  4D5C A;  1JKO C;  2E1O A;  1ETY A;  2Y2Z A;  4DZJ A;  1ETW A;  1A5J A;  4A3J J;  5FKM A;  1JGG A;  2XGD A;  1A6I A;  2CQQ A;  1U9N A;  1IDZ A;  1OFC X;  5IYC J;  1U78 A;  5DTD A;  1LFB A;  4DW6 A;  5E3M A;  3JRD A;  3GTQ J;  1R9T J;  2CUF A;  5JLX A;  3RZO J;  1OCP A;  1YRN A;  3PO3 J;  4IEJ A;  1LFU P;  4JYK A;  2MW8 A;  5FKL A;  3CCY A;  3SJM A;  1DU6 A;  1U9O A;  4QSH A;  3BG9 A;  5K7Z A;  5F27 A;  2CRG A;  2TRT A;  2R5Y B;  3HBL A;  3BG3 A;  1ZQ3 P;  3LNQ A;  5FKN A;  3G1L A;  2OPT A;  5M5X J;  1AHD P;  5IYD J;  2FQ4 A;  5FJ8 J;  4A3M J;  2L7M P;  1EF4 A;  3H0G J;  5C44 J;  2H1K A;  3GTP J;  3PO2 J;  4M3B A;  3DCF A;  3GTK J;  5DS9 A;  3BR3 A;  2JA5 J;  4A3F J;  4G12 A;  1FIP A;  1RPW A;  2WB1 N;  4C3H J;  2JA7 J;  2MGQ A;  4IHV A;  4X1E A;  2AO9 A;  1ZGW A;  1GV5 A;  2X48 A;  1XG1 A;  2M8G X;  4QIW N;  4C2M J;  2XPV A;  2EZL A;  2R5Z A;  4BXX J;  1G2H A;  2JA8 J;  1VFC A;  2CJJ A;  4DYQ A;  1W0T A;  2OF7 A;  3RQI A;  3DEW A;  3OSG A;  1JTY A;  3GTJ J;  5F0F A;  2M2E A;  2GLO A;  2CUE A;  3Q3S A;  1PUF A;  2QF7 A;  4BY1 J;  4IHX A;  3A01 A;  1MBG A;  1HDD C;  1MH4 A;  4DYR A;  5E3O A;  4XIC A;  1CQT A;  2DTZ A;  1TWA J;  4JX5 A;  3ZQH A;  1X58 A;  1B8I A;  4S0H B;  3BTI A;  1WH5 A;  4D5F A;  1Z77 A;  1F36 A;  1ETQ A;  5JLW A;  1GUU A;  3FIS A;  4Y7N J;  3K2A A;  3JRA A;  1MSE C;  2GM4 A;  4FE7 A;  1HF0 A;  3OOU A;  4A3C J;  4A3B J;  3GTO J;  2X9D A;  5M3M J;  5EYR A;  3SFI A;  1HOM A;  3LSP A;  1LE8 B;  2EZH A;  2HYJ A;  3TED A;  1XS9 A;  1PUF B;  1MBH A;  2LKX A;  1WI3 A;  9ANT A;  2I10 A;  1MH3 A;  1BW5 A;  2ME0 A;  3JRG A;  1QRY A;  2Y30 A;  1HCR A;  1IG7 A;  5C4J J;  4FIS A;  3S1N J;  2NVQ J;  4MIM A;  3LSJ A;  5HOD A;  4UUS A;  1Y1W J;  3CQZ J;  1APL C;  3JRE A;  2M0C A;  2VKE A;  1I50 J;  3JRF A;  1MBK A;  2DA2 A;  5IYB J;  4D7N A;  1JUP A;  3W6V A;  2XPW A;  2EH3 A;  4AYB N;  2EZI A;  2ECB A;  3LSG A;  3UKG A;  2R5Y A;  3D1N I;  2IBD A;  3HB9 A;  1IC8 A;  1T56 A;  2ELK A;  1GV2 A;  1SAN A;  2DN0 A;  3CDL A;  2VUM J;  1X2M A;  4JX6 A;  1ETX A;  2YS9 A;  2VKV A;  3BT9 A;  1FTZ A;  4UUS B;  3M3Y J;  2M9H A;  5J3L A;  1K61 A;  3HDD A;  4GFB A;  3WHB A;  3FK6 A;  2ID3 A;  5GPC A;  1RET A;  1TWH J;  1RR7 A;  4M3E A;  4BY7 J;  3E7L A;  3B6A A;  3ZQI A;  1FJL A;  2H8R A;  3BTC A;  4FE4 A;  3RZD J;  2O7O A;  1AKH A;  1RKW A;  2JN6 A;  5M3F J;  3JRH A;  3I4M J;  4B1R A;  5K7F A;  5E3N A;  1K83 J;  2GBY A;  3B6C A;  2Y9Z A;  1H89 C;  2FD5 A;  1TWF J;  2JK3 A;  1GVD A;  1QVT A;  2DMU A;  1JKP C;  2LP0 A;  2FX0 A;  3O8G A;  2CQX A;  2EZK A;  4XRM A;  5FKK A;  4CYC B;  2NVT J;  4MLO A;  1IUF A;  4XRS G;  1HDP A;  3JRI A;  2DA3 A;  3TP0 A;  1XC5 A;  1POG A;  2ECC A;  4L5E A;  5IOY A;  2R7Z J;  4M3F A;  3S1R J;  1BW6 A;  1VI0 A;  1JUM A;  2QCO A;  5EG0 A;  4DYC A;  1P7J A;  2DA7 A;  1AKH B;  2HOA A;  3BQY A;  2LD5 A;  4M6V A;  3QPS A;  2O9L A;  1LE8 A;  1MBJ A;  4XID A;  1ZR4 A;  4I76 A;  4IHW A;  1Q1V A;  2HXO A;  2NS8 A;  4AUX A;  3BTJ A;  3I4N J;  4DZP A;  2LVS A;  3HOV J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...