5BNGA

Monomer of tale type homeobox transcription factor meis1 complexes with specific dna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
59
structure length
59
Chain Sequence
PKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein/dna
molecule keywords Homeobox protein Meis2
publication title DNA-dependent formation of transcription factor pairs alters their binding specificity.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05920 Homeobox_KN Homeobox KN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5bngA00
5BNGA 3S17J 5F0CA 5IYCJ 1LE8A 3BR1A 1RPWA 4FISA 2M9HA 2M8GX 5FKMA 3Q0WA 3BR3A 3S1RJ 4FCYA 4XRSA 1MBKA 2MGQA 2K9NA 2DMPA 2EZLA 1GV5A 2K9QA 2CUFA 4UUSB 1MBHA 3IH3A 3GTLJ 1ITYA 1JT6A 3DEWA 3BG9A 2XGEA 2FD5A 1UMQA 5FKKA 5J1RA 2GM4A 1TC3C 2DA7A 3HOUJ 2HOAA 2AHQA 4C2MJ 2DA4A 1B8IA 1GDTA 3JRHA 2JA6J 5FLVA 3TP3A 2NS8A 1ETKA 2E1OA 2NOGA 3BR6A 1JTXA 1IG7A 1LFBA 1MSFC 4A3MJ 4Y7NJ 2JA7J 1OJLA 3JRFA 3O8HA 4A3CJ 1R9TJ 1CQTA 4IEJA 4A3LJ 5J1UA 3BR2A 4DZJA 5EDNA 2PMZN 3BQZA 1RR7A 3CCYA 1NK2P 3A01B 2M2EA 3HOYJ 1ZR2A 1Q1VA 2Y30A 3BTLA 3GTOJ 1IUFA 5IOYA 3HGYA 3LOCA 2ECCA 4W1UA 1TWAJ 1QRYA 1ETOA 1AKHA 1JTYA 2K40A 5K7FA 4DZPA 2MG4A 5IYBJ 1JJ6C 4A3JJ 1JUMA 3H3VK 5IPAA 2HXOA 2R0QC 5EG0B 3HBLA 1ZR4A 3CMYA 4G12A 2K9SA 4MO7A 5EZGA 5E3OA 2ZB9A 4XICA 2KDZA 3OSFA 3S16J 5F27A 1ORKA 4IHXA 2R5YB 3HGGA 2NS7A 3JRDA 4IHWA 2XGCA 3S1MJ 2DMTA 3HB9A 3FIWA 4QTRA 3HOXJ 2LD5A 2H8RA 3HEFA 1A6IA 2E19A 4V2GA 2EZHA 4JX4A 1RESA 5M3MJ 1HCRA 3A03A 2ME6A 2X48A 2YU9J 4HNVA 1G2HA 3NARA 3ZQCA 4UUSA 4AYBN 5M5YJ 3SJMA 3E7LA 4LOCA 1TWHJ 5GP9A 2WAQN 1UHSA 2TCTA 3FKIJ 1Z77A 2YS9A 1ENHA 2Y9YA 3RQIA 5FJ8J 1U78A 2ELKA 2LR8A 1K61A 1P7JA 1H8AC 1B72B 4A3IJ 2JJ7A 3JREA 4A3GJ 2DMUA 3FK7A 3VPRA 5FLMJ 4MLOA 5E3MA 1AHDP 3K7AJ 3WHBA 2OF7A 4XIDA 2WB1N 4D7NA 1A5JA 1X2MA 1FIPA 3A01A 3JR9A 4M3EA 3ZQIA 1PUFB 1VNDA 2GLOA 2QF7A 2CQXA 3JRCA 5F08A 3JRIA 3PM1A 4I6ZA 2XPWA 3HM5A 3RZDJ 1MBGA 1JKRC 3BQYA 1RKWA 3QQAA 4UUTA 2CRGA 2L0KA 2L7ZA 2Y0SN 3LNQA 3I4MJ 3PO2J 5HODA 4D5FA 4JP0A 1H89C 2Y31A 4EEFG 1Y1VJ 1IGNA 2COBA 2LKXA 3H0GJ 1XS9A 5F0HA 3C2BA 2R5YA 1IC8A 4MFDA 5EF6A 2ID3A 4Y52J 2NVXJ 2XB5A 1FEXA 1MH4A 1BW6A 4JYKA 1ETXA 3HOVJ 3G1OA 5FKNA 2EBIA 3RZOJ 2JK3A 2DMNA 2NVQJ 2DA5A 2IBDA 4M3BA 1YRNB 3GTKJ 1WGXA 5F04A 3BG3A 5C4JJ 4V2FA 4C3IJ 1QVUA 1JJ8C 4MIMA 5GPAA 1JKPC 1I50J 1OCTC 1B72A 1HDDC 1IDYA 5IP9J 1BL0A 3BTIA 2FQ4A 5C4XJ 2W48A 2HOSA 2D5VA 5EEAA 1DU6A 1U9NA 2X9DA 3BTCA 2R93J 5E3LA 1SANA 2AO9A 3BR0A 3LSGA 1QVTA 2R92J 2O9LA 1EF4A 1PUFA 3JRBA 2H1KA 2M34A 4C3JJ 2FJ1A 2GBYA 4BBSJ 3MN2A 3TEDA 1WH7A 2ME0A 4AUXA 2NVYJ 1DU0A 4A3FJ 2WV1A 1POGA 3OOUA 4MFEA 4BKXA 5F1JA 3F0CA 2VI6A 2E2HJ 4BY7J 3D1NI 1LE8B 3UKGA 3LSJA 4FE4A 5FKLA 1TWFJ 4CYCB 3ZQGA 2Y2ZA 3GTPJ 2QCOA 2O8KA 1XG1A 3NAUA 3HOZJ 1T56A 2RAEA 2P81A 5EGOB 3S15J 2VKVA 4DYRA 1BA5A 1XC5A 3K2AA 5K7ZA 1JKOC 4RBOA 4BY1J 4M3DA 1MBJA 4W97A 2IAIA 3SFIA 2DJNA 3S14J 2E2IJ 3PO3J 1ZTRA 3CDLA 1IV6A 1NTCA 2HOTA 3TW6A 2IEKA 3BR5A 3HOWJ 3M4OJ 3DCFA 1MSEC 2EZKA 1IRZA 2XGDA 2B63J 1B8IB 4DW6A 2LVSA 1ETVA 2R7ZJ 3GTJJ 1YRNA 1TWCJ 5GPCA 1X2NA 1QPIA 1MBEA 4B4CA 4QIWN 3JRGA 5J3LA 1BJZA 4AC0A 2LP0A 2JA5J 1ZKGA 2JN6A 3S2DJ 3OSGA 1O4XA 2E2JJ 2I10A 5IP7J 1I6HJ 2MSYA 3M3YJ 1GVDA 3BTJA 3QPLA 1GV2A 1JGGA 2G0EA 2XB0X 2LLKA 3FISA 1GT0C 4A93J 2DN0A 1S7EA 1UG2A 2LK2A 2EQRA 2XRLA 4IHYA 1JKQC 3GTQJ 3OIOA 3Q0UA 1VI0A 3SDGA 1X58A 1BW5A 3QPSA 2L9RA 5JLXA 4XRSG 5EG0A 5C44J 5K7HA 2KT0A 3GTGJ 4D7MA 2TRTA 1ZQ3P 3Q3SA 2FX0A 2CJJA 4QSHA 1HDPA 1AU7A 3RKQA 2MW8A 5EZHA 3S1QJ 1MNMC 4CYCA 4B3AA 1W0TA 4JX5A 3Q0VA 1RETA 1VF9A 2L7MP 5EGOA 1NK3P 4GFBA 5JLWA 1MBFA 2EH3A 2OPTA 5DS9A 4X6AJ 3O8GA 4FE7A 4L5EA 1ETYA 1P7IA 1T33A 3MKLA 1WCMJ 2ECBA 2CU7A 3GTMJ 2JWTA 3W6VA 4A3EJ 2Y9ZA 1H88C 4ABZA 3LSRA 3ZOBA 3G1MA 3HDDA 2DA3A 2NVTJ 2N8GA 4M6VA 5EYRA 1HLVA 4A69C 4DYQA 1OCPA 3MVPA 3IH2A 5E3NA 3S1NJ 1SFOJ 5IP6A 2HQ5A 2R5ZB 2XPUA 1TWGJ 4BXXJ 2VKEA 3IV5A 2L7FP 3CQZJ 3BT9A 1JT0A 5FKOA 2M0CA 1F36A 5J1YA 3GBGA 2JA8J 3WHCA 4D5CA 2LY9A 2DA1A 1JUPA 5M5XJ 3A02A 4A3DJ 4M3FA 5F0FA 2ID6A 3B6CA 4B1RA 4S0HB 1MH3A 3G1LA 1APLC 1WI3A 2DA2A 5C3EJ 1WPKA 4NDLA 1HOMA 3IH4A 1JUSA 9ANTA 3TW7A 1ZK8A 3FK6A 1ZGWA 1I3QJ 3B6AA 4J19A 3TP0A 4C3HJ 4A3BJ 3S2HJ 2X6OA 5M3FJ 1FIAA 1FTZA 1HF0A 3LSPA 1RKTA 2VPRA 2LTPA 3HKZN 4I76A 2O7OA 1OFCX 1ETQA 1FTTA 2DMQA 5DTDA 1IDZA 2LFBA 1Z0XA 2DA6A 4A3KJ 2CUEA 3ZQHA 5IYDJ 2XPVA 1Y1WJ 4XRMA 2VUMJ 1D5YA 1IJWC 1GUUA 4RDUA 3JRAA 4JX6A 4M3GA 1W0UA 4BBRJ 2DTZA 2JMWA 4X1EA 5M5WJ 1VFCA 3ZQLA 1U9OA 4IHVA 2R5ZA 1AKHB 1E3OC 2HYJA 1LFUP 3ZQFA 4FTHA 4XK4A 1ETWA 2CQQA 2XSDC 2YUSA 1K83J 2HI3A 5IOZA 2EZIA 3I4NJ 1F43A 3BG5A 2HXIA 3L1PA 4DYCA 1FJLA 1U8BA 2HDDA 1WH5A
chains in the Genus database with same CATH superfamily
2WAFA 3QP6A 5F0CA 1OCRH 1TQPA 4XLNF 3FHZA 3TQNA 2M8GX 3CF5F 4DJAA 3OV8A 3RCOA 1UHWA 2M7BA 5H6RA 4ZZDA 2QWWA 1YTYA 4F52A 4BH9A 4FCYA 4ENMA 2IS6A 1SMTA 2K9NA 2B7EA 1VQLI 1T0FC 2RNJA 2KPMA 3IH3A 3GTLJ 1JT6A 2NNNA 1D5VA 4ANJA 3I55I 3CCJI 1UMQA 1J5YA 4HZFA 3DTEA 3ABTA 5J1RA 2GM4A 2M8EA 2DA7A 2L9SA 2XAJA 4KA4A 2PI0A 3H3UA 3JCUC 1GDTA 3JRHA 4CCOA 4HSRA 2IGMA 2E1OA 2OCCH 4PJJA 1IG7A 1JTXA 2PFBA 1IN7A 1LFBA 4P1WA 5ICFA 2ZJRF 3MZHA 4IZZA 4Y7NJ 1OJLA 4CHUA 1R9TJ 2ZSIB 5BOXA 3BY6A 3BR2A 1F9NA 5FB2A 4N4OB 4E7IA 3BQZA 3AG1H 3CCYA 2X4HA 2YR2A 1XSVA 1BI1A 2UV1A 3CF2A 4LFUA 2VC0A 3HOYJ 1Q1VA 1SFXA 2LF8A 4XLEA 4HF0A 2CW0F 2ECCA 3DPTA 1JTYA 1NG6A 2V7FA 3PNYA 1TT5B 4II2A 4XN0A 5FD6A 1UAAA 1T08B 1RUNA 1JJ6C 4RA2A 5F6FA 5LGTA 1DGRM 1VQ5I 3U9GA 4B8XA 1ZR4A 2DOFA 3CMYA 1YW8A 3CJRB 4QPQA 3ZMTA 4FETA 2ZB9A 3OSFA 2V9PA 3ESWB 4ETSA 1ODDA 1D1AA 5L3BA 4QLCU 3HGGA 2WA0A 3E3VA 3Q9VA 3ZMDA 4ZZLA 1F5TA 1ZG5A 3HOXJ 3OR1C 3HEFA 5CVIA 2P5LC 1W5CC 2IA0A 2L5QA 3KEOA 4HNUA 1D0ZA 4P9FA 4AVZA 4V2GA 3T5XA 3TO6A 1BC7C 1DPUA 3IKTA 4D9JA 1UELB 4UXNA 1RESA 5M3MJ 2J5OA 5E79C 4J00A 4MHGA 1VQ8I 5FGMA 2YU9J 1Y56A 1G2HA 3S2WA 1N78A 4AYBA 3NARA 4I98B 4UUSA 3U1KA 4AYBN 2AS5F 3NEUA 4LOCA 4IRIA 2BHYA 1S3JA 4ZDLA 3G4SI 4M6YA 1MD0A 1Z77A 1ENHA 2RQQA 4KITB 2P4WA 2Y9YA 3WU1B 2ZMEA 5HLIA 1U78A 3N05A 2ELKA 5JVTA 4O6JA 2M7AA 2WBMA 2M45A 1Z91A 1P7JA 3OS0A 4A3IJ 2JRMA 2BE5F 4A3GJ 2OC6A 5ERIA 2HVQA 2CGPA 1YS6A 3DP7A 2EPFA 4RAGA 5E3MA 1AHDP 5JFRA 4GDFA 3LSHA 1FIPA 3N4MA 3K4KA 4P5OA 3CC4I 2ESHA 4OAYA 5CYVA 2H6CA 1MJBA 5DEQA 1PUFB 1KU3A 2KRFA 3P5JA 1XPXA 1QPMA 2GLOA 2FMLA 2QF7A 2W24A 4M72A 2OZUA 1EA3A 3GVAA 2X6YA 3CTAA 1T38A 2VT3A 3OS2A 1R4MB 3BQYA 2L0KA 3LNQA 2Y0SN 3PO2J 3L2VA 1IXCA 5HODA 3CC7I 3HSFA 2ISZA 4F3QA 3WG9A 2BW3A 4PK4A 3SFZA 2VASA 2VBXA 3H5RA 5DD8A 3TGNA 2LKXA 3CESA 2X85A 3PNVA 2ZXWH 1XS9A 2LBFB 5F0HA 2R5YA 2DFFA 1H9TA 1ZN2A 2IW5A 5DYMA 2XB5A 1MMGA 2CW7A 1BW6A 4PDKA 3F72A 3WE2A 3W6KB 3ECHA 1C0WA 3RJPA 2VIXA 1ETXA 2DW4A 2VJIA 4P55A 1MNDA 1RI7A 1X3WB 2NS0A 2BY0A 2VJ5A 2HFHA 2JK3A 3I9V2 3K69A 1OCOH 1USSA 3O2PE 2DMNA 3A2KA 2DA5A 2IBDA 1G3WA 1VZ0A 2GOXB 2LRDA 3LL7A 5KHDA 4S04A 2PMZA 3I4PA 5DCFA 4V2FA 3D5RC 4AIJA 1JKPC 1I50J 2K86A 5JVGF 3H9GA 2FXAA 1MJ9A 1MMAA 2W4SA 5KCMA 3EYIA 1BL0A 3BTIA 5E1WA 3R0JA 4HA8A 4HEA2 3K70C 3DFGA 2AQEA 1U9NA 2X9DA 2D1HA 1SANA 5CKTA 5KK1A 1R5GA 5H2FC 3OYJA 1XTAA 3GFMA 1AA7A 3I59A 3JRBA 4C3JJ 2GBYA 3TEDA 1WH7A 4Q48A 1K4TA 2CG4A 2NVYJ 3T1BA 1TNSA 1TTYA 1P4XA 3AAFA 4A3FJ 3OOUA 1FP1D 3A0BC 1I1GA 2OQGA 3LQRA 2E2HJ 4BY7J 3TOBA 3D1NI 2E1MB 3ZQGA 4PJ0C 1K78A 1D1CA 1W4MA 2QCOA 3HOZJ 1T56A 2RAEA 3QU3A 5J4VA 2KFDA 2P81A 2EFNA 4ASNA 4OWRB 3S15J 2VKVA 4DYRA 1BA5A 1YJ9I 1OYWA 2R4GA 4F92B 3CD6I 3D0SA 4W97A 2IAIA 1SD4A 2K5CA 1TQIA 2EK5A 3DKXA 3WU2C 1RZ4A 3BJAA 3CDLA 4EJTA 1Z7UA 1A31A 1S7OA 4L18B 4GRIA 3REOA 2DLLA 4I2OA 2B63J 1R58A 1W1WE 3RQ4A 2LVSA 1ETVA 4MQ9F 5LHGA 2FA5A 3VYTB 1FC3A 2Z9OA 3GTJJ 2XKPA 1J59A 3FXOA 2DPDA 3LA3A 3G73A 2R7XA 1MMSA 3JRGA 1BJZA 1BIAA 2FQ3A 2ADUA 2MBFA 2JA5J 1U2WA 3OSGA 3ZGKA 1PUEE 2OD5A 3M3YJ 2MFZA 2OJED 5CPRB 3FXRA 3DBHB 1H0MA 3JTGA 1GV2A 2QBYB 3F8NA 3LFUA 2FUG2 2D1VA 1S7EA 2ZNYA 1IO2A 1R23A 4XN3A 4BDYA 3GTQJ 2JPCA 2HYFA 3VOEA 5EG0A 3AG4H 1TNTA 1FSHA 2BVLA 3QP5A 3E1SA 3NRVA 4EQQA 1MDMA 4C2UA 3KCCA 3SDBA 1ZQ3P 2QQBA 4KN4X 3VB2A 3LSKA 1ZAOA 1KA8A 2OZ6A 4ZYHA 2EIKH 3Q3SA 1J2XA 2V6CA 1HDPA 1AU7A 2L4MA 4BYYA 2FOKA 2X1DA 3S1QJ 2RV8A 2HTSA 2P5VA 2DK8A 2BZTA 1M1EB 2K9MA 4BHBA 4B3AA 1W0TA 1ON2A 3SEZA 4EM2A 1QNTA 1BJAA 1VF9A 2XASA 3FXMA 4GFBA 4J01A 5HLGA 5LGUA 2R7UA 2VPLA 1HXDA 2MLKA 1YIOA 2COMA 4XLPF 3ZRGA 2E7XA 1WCMJ 2F5EA 5LRRA 3W6VA 5GAHJ 3Q5FA 5CVUA 4XONA 4ABZA 3MMYB 3ZOBA 5CVVA 2WC2A 3G1MA 4BE0A 3G71I 2E34A 3PSFA 2N8GA 4M6VA 4BDZA 1U3EM 1MW7A 2V9VA 5EYRA 2BXYA 4DYQA 3S1NJ 5KAIC 1WJ5A 2Z3YA 1TWGJ 2H1LA 5LHHA 1N75A 2VKEA 4XL9A 3HRMA 2ZJQF 4CUGA 2ZO4A 3CQZJ 3QPHA 5FKOA 4IOAF 3GLXA 3FXLA 2VOOA 1F36A 2DOAA 4KUMA 2HGCA 3HC7A 5KAFC 4RMNA 3WHCA 1V5EA 2DA1A 1CF7B 1X1AA 2X51A 2H09A 5HLHA 1BR2A 2VKHA 1D1BA 2E71A 4M3FA 5CQGA 3GZ5A 2A68F 2BW3B 2ID6A 4LITA 3B6CA 2ZXJA 4WK8F 4RLQA 1SMYF 1MH3A 2ELJA 4S0HB 4AIKA 5LGNA 1TT0A 4G8XA 5C3EJ 1BI0A 1BIBA 3P9KA 4UV8A 1WPKA 2F5VA 2DYSH 4XBFA 3ABLH 1TBXA 5E8GA 3VYSB 3OYFA 4NDLA 2DOEA 1JUSA 3NWSA 1JHHA 4PZJA 3H9QA 4J19A 3LA2A 1SAUA 3QYEA 3S2HJ 1GXPA 2HNHA 5M3FJ 1HF0A 3KYCB 4BNCA 1RKTA 2XF7A 2LTPA 4BJTA 1Y0NA 1QA6A 3ELKA 3ZMUA 1VQ6I 2EJRA 2DMQA 5BPDA 1IDZA 4XNFA 1Z0XA 4A3KJ 3CC2I 1Y1WJ 2UXNA 2R7QA 1KONA 1LNWA 2LREA 3M8FA 2FBIA 3QPTA 3IRQA 1YIJI 1W0UA 1FWZA 1HW2A 5BQTA 4IQJA 4N0BA 5D5XB 2LYCA 2DTZA 5M5WJ 1YYVA 3FBNB 2DXIA 5K5RA 1ZHFA 3K4NA 1ETWA 1FBQA 2ESNA 1D0YA 2CQQA 2XSDC 3AKZA 2YUSA 1K83J 3WG7H 5IOZA 1EV7A 2EZIA 3KE2A 4A12A 1USTA 4WCGA 4DYCA 4XOTA 1ERDA 4XLCA 3CCVI 2QEXI 3OYNA 5BNGA 3S17J 1OR7C 5IYCJ 1LE8A 3BR1A 4KIGA 1A35A 4BEHA 2XF6A 5E1ZB 2M9HA 2IGNA 2QLZA 3HOSA 2QQ8A 4XM3A 1J09A 1OLTA 2WY8Q 2JVGA 3S1RJ 4UHTA 1MIJA 4XRSA 1QZZA 2MGQA 2VJ4A 3PFYA 5KVRA 2EFQA 2Z99A 2EZLA 3IAS2 2ZJPF 3WTZA 3I0TA 1I5ZA 1OISA 5KNLA 3CMAI 2MD0A 3BG9A 4PJLA 2M3AA 4FHTA 4JBAA 4P96A 1UB9A 4RS8A 5D6FA 3T8TA 2R7OA 5CJ9A 2VLAA 3HOUJ 3GFJA 1Z9CA 3ISPA 2HOAA 4C2MJ 5JI6A 1B8IA 2EFOA 3BP8A 1O3RA 3TP3A 2K27A 1X4OA 4YFNF 2GA2A 2R7TA 2ZJ2A 2NAZA 4RGRA 3LAPA 1L3LA 1XDSA 5ILUA 3KP7A 2Q8KA 3VSLA 2LOOA 4CXFA 3J7ZI 1KQ8A 3O8HA 3CO7C 3P9CA 2XSJC 2A5WA 5J1UA 4BAYA 4DZJA 2NRAC 5EDNA 5HDGA 1NK2P 4OIOF 2V1DA 1SD7A 2IA1A 3RDIA 1IUFA 3HPHA 5ICCA 2VXDA 3I5UA 5IOYA 5LLQA 3BOQA 1X1CA 1QHHD 3FX3A 4L9NA 4U88A 5AIPA 4D0PA 4ENKA 2NOJB 3BZCA 4B3XA 1ZELA 3KFWX 4DZPA 5K7FA 4Z6YA 4II3A 4BE2A 2DU9A 1JUMA 4NB5A 5A2QZ 3H3VK 2HXOA 1VQ9I 2R0QC 5EG0B 3HBLA 3L00A 3JSPA 3F9KA 2ZNZA 5EZGA 1W36C 1ZH5A 5E3OA 1ZG3A 3MAJA 4XICA 2KDZA 2EV0A 2XHKA 3DEUA 2EINH 2GXAA 5DUKA 1JE8A 3ROUA 1WVRA 1LQ1A 4M73A 3S1MJ 2LD5A 3FIWA 2H8RA 3FXUA 3KP3A 2W57A 4Y17A 2E19A 3CLQA 2L7KA 4ZH4F 2ZBKA 3GMEA 3IWFA 2XV4S 1HCRA 1IV8A 2X48A 3ASOH 1SAXA 1UCRA 2K9LA 4CCNA 2XRNA 5M5YJ 2WAQA 4JQFA 3CUQA 4G7OF 2YSRA 2WAQN 1UHSA 4Y13A 1RNLA 2JSPA 4NC8A 1YS7A 2A07F 3LMMA 3DPLC 4M71A 4XQFA 1BR4A 2CV1A 4KYWA 2XAUA 1HSJA 3WTXC 2LR8A 3ZMVA 4IVNA 3ZCOA 3WE3A 4OMZA 4UB6C 5J4YA 3SEQA 2QSHX 2DMUA 1N25A 3FK7A 3VPRA 1SFEA 5ICGA 3M1EA 1MKMA 2BY3A 4MLOA 1V55H 5IY5H 3K7AJ 2KRHA 5DM6F 2ZFWA 1A5JA 2XIGA 1XDUA 1AOYA 5EEHA 3CCUI 2K3FA 5HOOA 4XKBA 3A01A 4M3EA 5D8KB 1ZGJA 1XN7A 3L9FA 3IL2A 2KMUA 5IT3A 4HX7A 3JRCA 1SVOA 5F08A 3VYRB 2DFEA 1W5TA 3D5SC 4EVIA 1JKRC 5HNHA 3I4MJ 2L7ZA 4HDUA 1HKTA 4CICA 2RN7A 2KJBA 2YU3A 1Y1VJ 1XSXA 4LK0F 4LIVA 4HV6A 2COBA 1ULYA 5J8FA 3DXJF 3C2BA 1T6SA 3OIPA 1QU3A 5EF6A 4U7DA 2ID3A 5K5QA 1HW5A 4GYIA 2CS3A 4NQWB 2ICWG 3HUGB 4RAZA 2YX7A 3OYBA 3O6BB 1VQ7I 1MJAA 4JYKA 2UXXA 3F8MA 2B0LA 1TLHB 5LD2C 3HOVJ 3ZMSA 2EILH 3RZOJ 3HIFA 4ZYGA 5L3GA 4CCMA 3K2ZA 1UHMA 3BZKA 2HEOA 4G6QA 2CV0A 3A4CA 4O3MA 2NVQJ 4M3BA 5FFZA 2V4JC 1A04A 4XRFA 5F04A 3OYHA 1WJEA 2CQNA 4BJ6C 2STWA 4C3IJ 2XUBA 1QVUA 1JJ8C 4A2UA 2HS5A 2HPIA 1K6YA 3C7JA 1B6AA 1B72A 1HDDC 3UNGC 2Z2SB 2RGVA 1B4AA 2W48A 1IRXA 4AWXB 1X4PA 3F6VA 5K1YA 2GWRA 2R7WA 2HWVA 3QYBA 4IHTA 3IAM2 3E97A 4ZC3A 3RKWA 3HOTA 2AO9A 3BR0A 3LSGA 1QVTA 1J0RA 4I0AA 1YW7A 2CSOA 2M34A 2PBIA 3TKYA 1V5FA 5EEGA 4BBSJ 1ZRDA 2K4BA 1VQKI 1Z05A 1DU0A 3BG7A 4V19K 2WV1A 2EV5A 2P0WA 3GZNB 2XDVA 2Z5UA 4MFEA 4F7ZA 4I0BA 3PQKA 2G7HA 2KIFA 2HYGD 1G8XA 1LE8B 4B44A 3LSJA 4FE4A 4UVAA 1TWFJ 2IJLA 5FKLA 4BEHB 3UKGA 1J75A 3GTPJ 3KYDB 3B02A 1G4DA 3V7CA 2O8KA 3NAUA 2WWYA 4M6XA 1B9NA 3CZ6A 4KIBA 2NVUB 4YRVA 2O5RA 3BJOA 3I53A 3DBLB 3V8KA 3WTWC 1G3TA 2HDCA 1XC5A 3ABMH 1K4SA 4RBOA 2Z16A 1JGSA 4JK1X 4BY1J 4M3DA 1MBJA 4HF2A 2D2WA 2DJNA 3S14J 3CCSI 1ZTRA 4EM0B 2DTRA 2Y69H 3TW6A 2OTLI 2KIUA 1DDNA 4C2TA 3BR5A 2K7LA 3RPQA 1CGPA 2XGDA 1B8IB 4DW6A 3KEQA 3L2QA 3CJQB 1U5TB 2R7ZJ 3L2UA 1U5TC 2A05A 2LMDA 2Q2EA 4NNJA 4Y3OA 1R49A 4IL6C 4TV7A 1YRNA 5DM7F 5GPCA 1WZ2A 2B9SA 4QIWN 3MCZA 1X1PA 2VL8A 3K4BA 2M30A 3QOEA 1XGNA 2Y75A 3BZ6A 3JSOA 2JN6A 4L9VA 3S2DJ 1O4XA 2I10A 2LDUA 2ZKZA 2MH2A 3MZ8A 3DKWA 3GWZA 1FSEA 2CYYA 2A69F 3GFLA 4IPAA 4B47A 1GT0C 3FISA 4A93J 2JSCA 2XRLA 2EQRA 1J7KA 1F1ZA 2Y0SA 1JKQC 2F4MB 3OIOA 1LB2A 1X58A 3QPSA 4E7JA 1W5SA 3VDXA 4FX4A 2TRTA 4LG0A 2E5ZA 2EIJH 2OAZA 4QSHA 4UNOA 1IRFA 2MW8A 1FBSA 5E1XA 4CYCA 4JX5A 3K4LA 2DODA 4ZDOA 4LMYA 2R7SA 3Q0VA 2HKXA 3LWFA 1GLNA 5EGOA 5L3FA 1ACIA 1MBFA 2EH3A 2OPTA 4MNUA 1JHFA 3E6BA 4OMYA 2JZYA 4IRGA 2F5DA 3CUOA 4L0ZB 3MKLA 2ECBA 2CU7A 4E7LA 3K1NA 3GTMJ 3ML6A 2EIMH 4A3EJ 4G94A 3VSKA 4ESBA 2Z1DA 2V1XA 2BHZA 3LSRA 2P6TA 5ICEA 1S72I 4ZJZA 3PIPF 3T8RA 5DD4A 4IO9F 2QYOA 3RPUD 4EMSA 1U8RA 3MVPA 3IH2A 4U0WA 3HXLA 2BY1A 1ZYRF 3K4JA 2MABA 1Y0UA 2HQ5A 3HG9A 4BQNA 2XPUA 4WXHA 1VQMI 5J8CA 3IV5A 1SD6A 3J7AY 2XAQA 1Z6RA 1FYMA 1Y8QB 3BT9A 3AL0B 3AL0C 2M0CA 2FEZA 2K85A 2F2EA 1SFUA 1Z3XA 4U0VA 4I99C 2E1CA 4XR6A 3BDDA 1LJ9A 1YW9A 2E1MC 4BQOA 3ABKH 2QVOA 2VQCA 1R4NB 3A02A 1H9GA 3CO6C 3PFIA 4PGGA 1UG0A 4B1RA 3TO7A 3COAC 2O8XA 4YIIA 3O3KA 1ZRFA 2BXZA 3OYCA 2CQ7A 3K70D 4JOMA 2ELHA 4RAFA 4D1QA 3MFKA 2H8WA 5HNFA 4OIPF 1ZK8A 1KQ0A 3VEPA 3F3XA 3BJ6A 4MEYF 3TP0A 2VJJA 4A3BJ 3H92A 1FTZA 1WWXA 2HTJA 4BUPA 2KIMA 1OCZH 2XAFA 2VBZA 3KIOA 1FZPB 1FTTA 4PGHA 5DTDA 4PSXA 2LFBA 3ZQHA 1UZCA 3A1YA 2VC1A 2L9VA 3CJNA 2W7NA 3S8PA 2VUMJ 1D5YA 2IGOA 5FO5A 4GXOA 4RDUA 5TISC 1HW1A 1XGSA 1KZHA 3CCRI 3LA7A 4LLGF 1R5HA 3IC7A 4CA0A 2X6WA 3K1MA 1V4RA 2JMWA 2V26A 1Z3YA 3FM5A 3F8CA 2ETHA 4ZTJA 4XLHA 1U9OA 2R5ZA 3RI4A 2EA4A 2QKLB 3ZQFA 4FX0A 2I8DA 3KZZA 3PJRA 2HI3A 2CH0A 4XSZF 5IT9K 3OYEA 2IP2A 2M1BA 2IS2A 1Z1DA 3L1PA 2KJCA 1FJLA 5HDKA 4I02A 2QM3A 5AONA 1U8BA 3R60A 1TL8A 4HOBA 4KFCA 1IXSB 2FRHA 3EUHA 4I09A 3CMEI 2O6GE 3DLAA 1RPWA 1K79A 1P92A 1U6GA 2JPBA 1WJFA 1OMIA 2FNPA 3Q0WA 5FKMA 1LEAA 2M5WA 1LKXA 2V6EA 1X19A 3KYLA 5E17F 3DU6A 5GTIC 3H3ZA 1OCCH 3GW2A 3DTKA 4XKWA 2EFWA 4DNCA 2JRTA 3L2CA 3DEEA 2K9QA 1FP2A 4UUSB 3BCBA 1VTNC 1ITYA 1Z6TA 4BU2A 1XGMA 4YFKF 3DEWA 3E5QA 2CQKA 3MD2A 5TGTA 3GFIA 2OA4A 2Y0MA 3RYRA 2XROA 4HLYA 3M07A 2ZMEB 1TC3C 3TL4X 4HDVA 2ZMEC 3M9AA 5JHUA 2DA4A 3J80K 2JA6J 5FLVA 1TW2A 4E6KG 1WHUA 2NS8A 3EUAA 2NOGA 4DBRA 3E5UA 3K0LA 3TDUC 1F4KA 1Z21A 4NC6A 3CCEI 3ZPLA 5DV5A 3IUOA 2CMPA 3ASNH 3EDPA 3RKYA 2Q2EB 5D5WB 3MKYB 2STTA 4C30A 2O03A 2XAHA 1CQTA 1VQNI 3G3ZA 4IEJA 4A3CJ 2FU4A 1YX5A 3FMQA 5A2QK 2VQLA 2M2EA 1KU7A 3GXOA 1FBUA 2CW8A 1ZR2A 2DO7A 3BWGA 1S9HA 4L5JA 1LVAA 3WU0A 2H27A 5DDGA 3AG3H 4IJAA 4W1UA 3TBIA 1QRYA 1AKHA 4YELA 2VONA 3K10A 4HX4A 2MG4A 3CJTB 5BS6A 3CLOA 4A3JJ 3MQ0A 1R36A 2XKOA 3K4CA 2IVMA 1BC8C 4G12A 3C2HA 3F8FA 1IZ1A 1LFPA 2K9SA 3F8BA 4MO7A 4OU0A 3F6OA 4CDGA 4LG0B 2JA2A 4XKCA 4IHXA 2JVHA 3F22A 2R5YB 3JRDA 2NS7A 4IHWA 2XGCA 3G2BA 4EATA 2R7VA 3HZJA 3F23A 1FT9A 2DMTA 3WODF 4QTRA 4P9UA 2QGUA 3SZGA 1O57A 2M87A 3I58A 2P7VB 2EZHA 2DT6A 3JW4A 2JUGA 4HX8A 4JX4A 1T0FA 4CZZA 5HS7A 3VODA 5JR3A 3A03A 3V7RA 2ME6A 4XOPA 4MGRA 4HNVA 3ZQCA 2L01A 3OWTA 2KDOA 3E7LA 3SJMA 1IN4A 1TWHJ 3BC8A 4EGZA 2O0YA 4A6DA 3OY9A 2NXNB 1XX5A 2P8TA 3S32A 3PNTA 5FJ8J 4AU7A 3H1CA 2BVMA 1H8AC 4LB5A 2JJ7A 3OYKA 4AM3A 4LLLA 4A6EA 1D0XA 4PSWA 4M9ZA 1W7PD 2RKHA 3QRFF 5FLMJ 1V5GA 1GVJA 5LRSA 2A6HF 5LEJA 3H36A 1PJRA 2E1NA 2OF7A 3BG6A 3E6MA 3GLLA 4XIDA 1EJ9A 4D7NA 1KU9A 1Y39A 2CFOA 2DJIA 1IF1A 3I59B 4IOCF 4A5MA 5ED4A 5TJJA 2QQ9A 1S29A 1LDJA 1OYIA 3CDHA 4ENJA 2PQ8A 3JRIA 3PM1A 3SYTA 4I6ZA 2XPWA 3WTUC 3HM5A 3ZMZA 4BE1A 4BQAA 4B43A 1YJNI 1NG7A 4UUTA 2CRGA 2FF4A 4D5FA 2IPQX 1BR1A 4RGSA 1K78B 5IT9Z 2R7FA 2A5YB 1HKSA 4CZCA 2VBWA 3FHNA 3DF8A 3HHHA 4OIQF 4G7HF 3QU6A 2CV2A 3H0GJ 1NHAA 2F6CA 5L3DA 3GX4X 3S3NA 1NH3A 2BBYA 4RM2A 2VE8A 3HL2A 3J81K 4Y52J 1JXSA 2YX4A 3FBIB 3FM3A 1LUJB 1FY7A 3DTIA 2EBIA 4XKVA 3E6DA 3E5XA 4YG2F 2XF5A 3GUDA 3KETA 2R7RA 1QZYA 5FFXA 2FSWA 2F5CA 2Q1ZB 1TW3A 1WGXA 3EPZA 2BGCA 3BG3A 3OMYA 2E7WA 5C4JJ 3J80Z 4MIMA 1IDYA 3SZPA 3GF2A 5K5OA 2W84A 4BQQA 5C4XJ 4NBQA 5EEAA 3GCMA 1IN6A 4LK1F 3KP5A 2R93J 2R92J 4E7HA 1EF4A 3ZP5A 1ZLKA 4XLFA 1IXRC 1PUFA 2FNAA 2FJ1A 1MDMB 3FXKA 4U0YA 1YO5C 3OOPA 2P7CB 3OYLA 4QWQA 3PQJA 3U2RA 5CLSA 3RSNA 5F1JA 1J9IA 2QSGX 2IXSA 2VI6A 2EV6A 5D6EA 4BHPA 1X3UA 5E20A 4RAYA 3RPUA 2ACJA 2KZGA 3DLLF 4YIRX 2E60A 2H94A 1DUXC 1P9QC 2LBFA 4A0ZA 3K2AA 1JKOC 2JT1A 1WI9A 2RREA 3ECOA 2DCEA 3CCLI 4ZYDA 3OYDA 1IN8A 1EH7A 2E2IJ 3PO3J 4F93B 1DP3A 4HBLA 1FPQA 5H6QA 1XMAA 1NTCA 2HOTA 4RGUA 3M4OJ 4M74A 3DCFA 4EGYA 5FRNA 1YFHA 1IRZA 1MMNA 4YEJA 3K9TA 4ESJA 4ON0A 2VODA 4EV0A 4FQGA 1QGPA 1TWCJ 4RLFA 3PUBA 1QPIA 4OOIA 1MBEA 3DQVC 2IS1A 2KL4A 3J7YJ 3H0DA 1HKQA 2MLGA 4AC0A 5E18F 3KZIC 1N77A 2LP0A 3V4GA 4HNTA 2E2JJ 3CCQI 2MSYA 2BV6A 5D4RA 4DIQA 2RQPA 1VQOI 3QPLA 2G0EA 2XB0X 2LLKA 3SZTA 4F91B 2R7DA 4HF1A 3EUKL 4IHYA 1XMKA 1A36A 2Q0OA 1VI0A 3SDGA 3QAHA 4Q4ZF 2L9RA 5C44J 4XRSG 2KT0A 1P4AA 2DFHA 2HVRA 3GTGJ 3BLYA 3WTTC 2DPUA 3LQQA 2CJJA 2J5PA 3PL8A 3IHUA 2WTEA 4Y33A 2IA2A 1KYWA 1OPCA 4IQ4A 1Y8RB 1O7FA 2O61A 1YOVB 2HDWA 4I7HA 1YI2I 2QSFX 5JLWA 4X6AJ 1O3SA 5DS9A 4GGGA 3WTYC 2DBBA 3J81Z 2A61A 1P7IA 1T33A 2BY2A 2F48A 1S7AA 3W2WA 4CO8A 2X0LA 1DPRA 1EH8A 5FRMA 3OL4A 2GQQA 5HDNA 2LKPA 2Y9ZA 2VT2A 4DOZA 2DQLA 5L3CA 3WTSC 3VYUB 3KP6A 2RDPA 4EJUA 4CCKA 5F1RA 3KX2A 3HDDA 2NVTJ 1FOYA 5CQEA 4R8HA 4XSXF 5LEKA 1OCPA 3AG2H 1SFOJ 5GAGJ 1OYYA 1WKMA 2PMHA 1R1VA 5IP6A 1G59A 5HS9A 4AIDA 1R00A 4BXXJ 4HYEA 2LY2A 2HQAA 1K7AA 1BM9A 3MKWB 2UUZA 3JAMK 1SEUA 3S3OA 1SVMA 3HPGA 3LSMA 2QBYA 1S8NA 2VXZA 3OIQA 5J1YA 1DP7P 3ZN1A 4D5CA 3OS1A 4A0YA 1SC7A 4HSTA 1T39A 1R1TA 1BOBA 1WJBA 5BMZA 3CMMA 4A3DJ 5D5UB 1FYLA 3HRSA 3HRTA 4Z2YA 2MD5A 3WGHA 5F0FA 4WX9A 2KQRA 5B1BH 1O3TA 4RM3A 3G1LA 1IUYA 1WI3A 2DA2A 2GOMA 2DAOA 2EWNA 2Z33A 2V9KA 2W25A 4A5NA 3IKVA 2P6SA 1D8KA 3L09A 3DPUA 4WXCA 4ITVA 1HOMA 1SFKA 3TW7A 1XGOA 3LAJA 2HPMA 1ZARA 1I3QJ 5J40A 2F4IA 3NQOA 4E7ZA 3ERED 2ZCWA 2HVSA 2KLOA 1X1DA 1T98A 1FIAA 1STZA 4ZYEA 2RNGA 3L7WA 1R71A 3LSPA 2GXGA 2VPRA 4I76A 2O7OA 3L2RA 1AWCA 5TRDA 5L3EA 1WQ2A 1YE9A 4DBQA 3GO5A 4KMUX 3DWLE 4XLAA 4MQVA 4HG2A 3PIOF 1WJDA 1IJWC 3JRAA 2K02A 4EJWA 2HU9A 1TP4A 2E35A 3K4MA 4E70A 1U0JA 1O3QA 3CDIA 2VQHA 1QHGA 4CCLA 3W6JB 3WGGA 4F55A 4EM1A 2WAEA 1E3OC 1WJCA 2LG4A 5ILVA 1LFUP 4CGZA 4FTHA 3IWZA 4CSWA 3I56I 3RIRA 1P4WA 2LY1A 2DK5A 3C1DA 4HPQA 2K4JA 3HHGA 3IP4B 1BBYA 3R6SA 3W3CA 4WXDA 1WH5A 5M5XJ 2XGXA 1IW7F 2OU2A 2EFPA 4YFXF 1A6QA 1RRJA 3MZYA 1CF7A 3ZXSA 2RVCA 4FISA 2C6YA 2X1CA 1FOKA 1E3PA 1XMXA 3BR3A 4H4KC 3CP2A 3PSIA 4UVBA 3TO9A 1W7PA 4A0XA 4RB1A 1MBKA 1E2XA 2DMPA 2L02A 2Y48A 2DDBA 1QZEA 1GV5A 1G6NA 4KN7X 3VWBA 2CUFA 6PAXA 4HRIA 1MBHA 1TQMA 1L0OC 2ISYA 1YG2A 3CUQB 2YPRA 5CVJA 2XGEA 3CUQC 2NNYA 1E17A 2CUZA 2VN2A 3KPHA 4PFOA 2FD5A 1HA8A 3QOPA 1G3YA 3DKYA 5FKKA 2IT0A 2PN6A 5J6XA 1K6OA 5B1AH 2IRFG 5FLXK 2JUCA 5CVRA 3VFZA 1B59A 2AHQA 1D8JA 2OQRA 1ETKA 3HRUA 1P2FA 3BR6A 1MSFC 3X2QH 4NC7A 4A3MJ 2JA7J 2I5UA 3JRFA 1DGWY 1FLIA 1FNNA 4A3LJ 4Q47A 4HAMA 2PMZN 1RR7A 3A01B 1UFMA 4RGXA 4GO1A 1R1UA 2Y30A 4YIFA 3BTLA 3LSIA 3GTOJ 2A6TA 3LSTA 3HGYA 3LOCA 1TWAJ 1ETOA 2XVCA 4Q5SF 2K40A 3OYMA 3ONQA 4RB0A 3FXQA 3I71A 5IYBJ 4BHCA 3KP2A 4O5VA 2DQRA 4UVCA 2QZ8A 2HQNA 5HLTA 3H5AA 5IPAA 5B3SH 4AIHA 2HOEA 3JAMZ 4MTDA 3HTSB 2TDXA 2GXBA 4B09A 4CH7A 2QENA 2L54A 3HSEA 1RC9A 4G6TB 1OR7A 3S16J 5F27A 1ORKA 3ZQ7A 5HVQC 2W1OA 3OL3A 3R4KA 4OAZA 4U7BA 3GYHX 3HB9A 5ILSA 5LBQA 1ON1A 2KKOA 1R6RA 1A6IA 1KGSA 1P6RA 3RTRA 2H6BA 5LHIA 3I3LA 1B9MA 2FOWA 1PP7U 3RYPA 2KRCA 3MEXA 2EB7A 1DQUA 4LLNA 2VOPA 1KU2A 3C18A 5GP9A 2D45A 2TCTA 3QWLA 2IS4A 1IAWA 4GCVA 2LH9A 2YS9A 3FKIJ 2XAGA 3WGIA 3RQIA 1HBXG 1K61A 3HYIA 1B72B 3JREA 4HW0A 2G7UA 4DQ2A 3GZ6A 3FDYA 5F64A 5D5VB 1REPC 1LDKB 3KP4A 2AQFA 3UR3C 2WB1A 3WHBA 2HR3A 2VKDA 2WB1N 4NUBA 4PJMA 2PJRA 4L5IA 3U21A 1X2MA 1G3SA 5GADJ 1ZREA 2ZXHA 4M9XA 4N9IA 3JR9A 3ZQIA 4L9TA 1VNDA 4HQEA 1D3YA 2CQXA 4IRHA 1LDDA 1YLFA 1EKEA 4H0EA 2QQAA 4BS9A 4M9SA 3RZDJ 2BOLA 1MBGA 2L4AA 1RKWA 3QQAA 4I01A 2QUFA 2XC7A 4IX7A 2L3DA 4JP0A 1H89C 4U87A 1LEBA 4EJOA 2Y31A 2GIZA 2MC3A 1ONVA 4UV9A 4EEFG 2AXLA 3T0YA 2KZVA 3I54A 1QBJA 3EETA 1IGNA 5DCMA 4BJ5C 1X1BA 1IRGA 1WRJA 1XD7A 1IC8A 4MFDA 3DBRB 1FX7A 2NVXJ 1BN5A 1FEXA 1MH4A 2DDAA 4PFPA 2MH9A 2DI3A 2KP6A 1FYKA 3RKXA 1Z67A 3G1OA 2CO5A 2DT5A 5FKNA 4GYGA 1FOXA 2HKOA 3G6EI 4EJVA 4BXUA 3C2GA 2LC2A 2CWEA 2KHMA 2WY7Q 3H9JA 3KZYA 4LJZF 5D4SA 5GTHC 1BI3A 1YRNB 3GTKJ 2KIQA 2MYSA 1I1SA 4KISA 5FLXZ 3ERMA 1ZRCA 1OQYA 4IKFA 5GPAA 2WV0A 1OCTC 4ESFA 2M0MA 5IP9J 2FQ4A 2MA3A 2HOSA 2D5VA 1DU6A 1GXQA 2F5FA 3H35A 2E36A 3DV8A 1LPQA 2MC4A 3BTCA 2HZDA 5E3LA 2X6XA 3HSRA 3M1CA 1RUOA 4XMYA 2O9LA 4BL0B 4HV5A 3V42A 1HSTA 2IGKA 3H5NA 2AXTC 3OYGA 2H1KA 3MN2A 1I27A 3AFHA 2ME0A 4C9YA 2QA4I 4AUXA 2R3SA 4E4HA 4KNYA 3E6CC 2GAUA 5FROA 1POGA 4BKXA 4LIUA 4PJNA 1SD5A 3F0CA 5EJCA 4CYDA 3HTUA 4LGWA 4CYCB 4IHSA 1PYVA 2Y2ZA 1BI2A 1PVEA 1XG1A 5JHFA 4HLXA 1KYZA 3J7AO 5EGOB 2FBKA 3IRRA 1FMVA 1RR8C 3MWMA 4WF2A 1W7PB 1VQPI 1WSUA 1T95A 5K7ZA 1BOAA 4LB6B 2V79A 1X3ZB 4Y4RA 4RB3C 2V1NA 2G9WA 2VBYA 1T8IA 3P9IA 3SFIA 4NQWA 5LFAA 3HUGA 2HQRA 1IV6A 3BROA 3SQNA 1XCBA 2IEKA 3ZR8X 1TZLA 2PMUA 3HOWJ 1IN5A 4OINF 4KT5C 1MSEC 2EZKA 4Y15A 3L2WA 1T2KA 2DFIA 2QKMB 3FMRA 3Q9SA 4IXAA 1S6LA 3FXJA 4KIFA 1YQAA 4CCJA 1X2NA 4B4CA 4AVPA 5J3LA 4WWCA 1O7LA 1XCVA 1ZKGA 1I6HJ 5IP7J 1YX3A 1MNEA 4K2EA 3V8JA 1E3HA 1GVDA 3BTJA 3OR2C 1V54H 1Y6IA 3MKZA 1JGGA 3M8JA 4HQMA 2DN0A 2BYVE 1UG2A 2LK2A 2BEOA 3ZN0A 3Q0UA 1B1BA 2PLYA 1MMDA 3K6GA 5DUIA 2ZXIA 1BW5A 5JLXA 1EH6A 1ZG1A 5K7HA 2W85A 4D7MA 3NWTA 2RC4A 4DGWB 3D5LA 2ZC2A 4KJZA 2FX0A 1SVLA 2CFXA 2WADA 1QQIA 3RKQA 4RB2C 5EZHA 1MNMC 1Z7LA 3I64A 4ZTFA 3KLNA 2JTVA 1QO0D 4NHJA 1OKRA 1PP8F 1RETA 2L7MP 1S5LC 4UB8C 4LD5A 3BCAA 3W2VA 1NK3P 2ZFUA 5AIQA 3SHFA 1KQ9A 2M4GA 4G6DA 5E8IA 3M8EA 3O8GA 3W2AA 2K3PA 3QYFA 2LKSA 3OYAA 3SXYA 4FE7A 4L5EA 1ETYA 2VB6A 4KICA 3FF5A 3K1PA 3WTVC 2PX9A 1VQ4I 1JI8A 2JWTA 4B48A 1YHQI 1H88C 1Q1HA 4MEXF 1E0EA 4PCQA 2GIVA 4MTEA 4E7SA 2FMYA 3P7NA 2OV7A 2DA3A 5BPIA 1U5TA 3E0JB 1MZBA 1HLVA 4A69C 5E3NA 3TMOA 2OTJI 4R79A 3R61A 4E7KA 4KMFA 2R5ZB 2X1EA 3ZQQA 2PEXA 5HS8A 4FT8A 2FBHA 2PJRB 5B5EC 1I3AA 3FMSA 2OUMA 2L7FP 3B73A 1JT0A 3FWEA 2NYXA 4ZYAA 1R5ID 2PJPA 3V8LA 3GBGA 2A6EF 5H20A 2JA8J 1ZGAA 2LY9A 3EUHC 5GAEJ 1JUPA 3OYIA 3GEZA 1GHCA 1FMWA 2KISA 4X0GA 2VQGA 1FOWA 2GZWA 2VE9A 1XB4A 2LSOA 1I6XA 2ZSHB 3CCMI 5FD5A 1HQCA 1APLC 1R7JA 4KDPA 3FKJA 3ABUA 1WJAA 2DT7B 2CUJA 4PUSA 5DCMB 3DU5A 4IF4A 2L9NA 2M4KA 3S93A 3N97A 2JQ7A 2FE3A 2L2OA 3TOAA 3M7GA 1LVKA 4R1HA 2E5NA 3U1DA 3ULQB 4L9JA 2O3FA 2UWMA 4G7ZF 2W00A 3KLOA 3IH4A 4KT6A 9ANTA 4L0YB 3JTHA 1ZLJA 3FK6A 1ZGWA 3QODA 3B6AA 4C3HJ 3C3WA 4FASD 3KEYA 4BXFA 2X6OA 2V1UA 2F4OB 3HKZA 4UUVA 1W36D 5J47A 3HJEA 2PG4A 2UZKA 2LF7A 3HKZN 1XSDA 1RIOH 2P5KA 1OFCX 3EYYA 1ETQA 1V3FA 1YJWI 2A3SA 2DA6A 2CUEA 5IYDJ 4LG3A 2XPVA 3R0AA 4XRMA 2OCEA 4AD9A 1HC8A 1GUUA 1PDNC 2DYRH 4JX6A 4M3GA 3LFKA 2EA2A 1R22A 3S3MA 1I39A 3A0HC 3V7SA 4ZDPA 3BPVA 4BBRJ 3F21A 4UY8I 4S05A 1UJ8A 4G9YA 2GA1A 4X1EA 2W82A 1YITI 4N4NB 4QPOA 3TDZC 3ZQLA 1VFCA 4IHVA 1AKHB 5D8LB 2OBPA 2HYJA 3PUFA 2LNBA 4XK4A 1WFXA 3FZVA 2HZTA 3CP8A 3I4NJ 1F43A 3BG5A 4OIRF 2HXIA 1MGTA 4XORA 3BPXA 5B66C 3EQLF 4BGDA 4ENNA 4BACA 2HDDA 4N9HA
chains in the Genus database with same CATH topology
5BNGA 3S17J 5F0CA 5IYCJ 1LE8A 3BR1A 1RPWA 4FISA 2M9HA 2M8GX 5FKMA 3Q0WA 3BR3A 3S1RJ 4FCYA 4XRSA 1MBKA 2MGQA 2K9NA 2DMPA 2EZLA 1GV5A 2K9QA 2CUFA 4UUSB 1MBHA 3IH3A 3GTLJ 1ITYA 1JT6A 3DEWA 3BG9A 2XGEA 2FD5A 1UMQA 5FKKA 5J1RA 2GM4A 1TC3C 2DA7A 3HOUJ 2HOAA 2AHQA 4C2MJ 2DA4A 1B8IA 1GDTA 3JRHA 2JA6J 5FLVA 3TP3A 2NS8A 1ETKA 2E1OA 2NOGA 3BR6A 1JTXA 1IG7A 1LFBA 1MSFC 4A3MJ 4Y7NJ 2JA7J 1OJLA 3JRFA 3O8HA 4A3CJ 1R9TJ 1CQTA 4IEJA 4A3LJ 5J1UA 3BR2A 4DZJA 5EDNA 2PMZN 3BQZA 1RR7A 3CCYA 1NK2P 3A01B 2M2EA 3HOYJ 1ZR2A 1Q1VA 2Y30A 3BTLA 3GTOJ 1IUFA 5IOYA 3HGYA 3LOCA 2ECCA 4W1UA 1TWAJ 1QRYA 1ETOA 1AKHA 1JTYA 2K40A 5K7FA 4DZPA 2MG4A 5IYBJ 1JJ6C 4A3JJ 1JUMA 3H3VK 5IPAA 2HXOA 2R0QC 5EG0B 3HBLA 1ZR4A 3CMYA 4G12A 2K9SA 4MO7A 5EZGA 5E3OA 2ZB9A 4XICA 2KDZA 3OSFA 3S16J 5F27A 1ORKA 4IHXA 2R5YB 3HGGA 2NS7A 3JRDA 4IHWA 2XGCA 3S1MJ 2DMTA 3HB9A 3FIWA 4QTRA 3HOXJ 2LD5A 2H8RA 3HEFA 1A6IA 2E19A 4V2GA 2EZHA 4JX4A 1RESA 5M3MJ 1HCRA 3A03A 2ME6A 2X48A 2YU9J 4HNVA 1G2HA 3NARA 3ZQCA 4UUSA 4AYBN 5M5YJ 3SJMA 3E7LA 4LOCA 1TWHJ 5GP9A 2WAQN 1UHSA 2TCTA 3FKIJ 1Z77A 2YS9A 1ENHA 2Y9YA 3RQIA 5FJ8J 1U78A 2ELKA 2LR8A 1K61A 1P7JA 1H8AC 1B72B 4A3IJ 2JJ7A 3JREA 4A3GJ 2DMUA 3FK7A 3VPRA 5FLMJ 4MLOA 5E3MA 1AHDP 3K7AJ 3WHBA 2OF7A 4XIDA 2WB1N 4D7NA 1A5JA 1X2MA 1FIPA 3A01A 3JR9A 4M3EA 3ZQIA 1PUFB 1VNDA 2GLOA 2QF7A 2CQXA 3JRCA 5F08A 3JRIA 3PM1A 4I6ZA 2XPWA 3HM5A 3RZDJ 1MBGA 1JKRC 3BQYA 1RKWA 3QQAA 4UUTA 2CRGA 2L0KA 2L7ZA 2Y0SN 3LNQA 3I4MJ 3PO2J 5HODA 4D5FA 4JP0A 1H89C 2Y31A 4EEFG 1Y1VJ 1IGNA 2COBA 2LKXA 3H0GJ 1XS9A 5F0HA 3C2BA 2R5YA 1IC8A 4MFDA 5EF6A 2ID3A 4Y52J 2NVXJ 2XB5A 1FEXA 1MH4A 1BW6A 4JYKA 1ETXA 3HOVJ 3G1OA 5FKNA 2EBIA 3RZOJ 2JK3A 2DMNA 2NVQJ 2DA5A 2IBDA 4M3BA 1YRNB 3GTKJ 1WGXA 5F04A 3BG3A 5C4JJ 4V2FA 4C3IJ 1QVUA 1JJ8C 4MIMA 5GPAA 1JKPC 1I50J 1OCTC 1B72A 1HDDC 1IDYA 5IP9J 1BL0A 3BTIA 2FQ4A 5C4XJ 2W48A 2HOSA 2D5VA 5EEAA 1DU6A 1U9NA 2X9DA 3BTCA 2R93J 5E3LA 1SANA 2AO9A 3BR0A 3LSGA 1QVTA 2R92J 2O9LA 1EF4A 1PUFA 3JRBA 2H1KA 2M34A 4C3JJ 2FJ1A 2GBYA 4BBSJ 3MN2A 3TEDA 1WH7A 2ME0A 4AUXA 2NVYJ 1DU0A 4A3FJ 2WV1A 1POGA 3OOUA 4MFEA 4BKXA 5F1JA 3F0CA 2VI6A 2E2HJ 4BY7J 3D1NI 1LE8B 3UKGA 3LSJA 4FE4A 5FKLA 1TWFJ 4CYCB 3ZQGA 2Y2ZA 3GTPJ 2QCOA 2O8KA 1XG1A 3NAUA 3HOZJ 1T56A 2RAEA 2P81A 5EGOB 3S15J 2VKVA 4DYRA 1BA5A 1XC5A 3K2AA 5K7ZA 1JKOC 4RBOA 4BY1J 4M3DA 1MBJA 4W97A 2IAIA 3SFIA 2DJNA 3S14J 2E2IJ 3PO3J 1ZTRA 3CDLA 1IV6A 1NTCA 2HOTA 3TW6A 2IEKA 3BR5A 3HOWJ 3M4OJ 3DCFA 1MSEC 2EZKA 1IRZA 2XGDA 2B63J 1B8IB 4DW6A 2LVSA 1ETVA 2R7ZJ 3GTJJ 1YRNA 1TWCJ 5GPCA 1X2NA 1QPIA 1MBEA 4B4CA 4QIWN 3JRGA 5J3LA 1BJZA 4AC0A 2LP0A 2JA5J 1ZKGA 2JN6A 3S2DJ 3OSGA 1O4XA 2E2JJ 2I10A 5IP7J 1I6HJ 2MSYA 3M3YJ 1GVDA 3BTJA 3QPLA 1GV2A 1JGGA 2G0EA 2XB0X 2LLKA 3FISA 1GT0C 4A93J 2DN0A 1S7EA 1UG2A 2LK2A 2EQRA 2XRLA 4IHYA 1JKQC 3GTQJ 3OIOA 3Q0UA 1VI0A 3SDGA 1X58A 1BW5A 3QPSA 2L9RA 5JLXA 4XRSG 5EG0A 5C44J 5K7HA 2KT0A 3GTGJ 4D7MA 2TRTA 1ZQ3P 3Q3SA 2FX0A 2CJJA 4QSHA 1HDPA 1AU7A 3RKQA 2MW8A 5EZHA 3S1QJ 1MNMC 4CYCA 4B3AA 1W0TA 4JX5A 3Q0VA 1RETA 1VF9A 2L7MP 5EGOA 1NK3P 4GFBA 5JLWA 1MBFA 2EH3A 2OPTA 5DS9A 4X6AJ 3O8GA 4FE7A 4L5EA 1ETYA 1P7IA 1T33A 3MKLA 1WCMJ 2ECBA 2CU7A 3GTMJ 2JWTA 3W6VA 4A3EJ 2Y9ZA 1H88C 4ABZA 3LSRA 3ZOBA 3G1MA 3HDDA 2DA3A 2NVTJ 2N8GA 4M6VA 5EYRA 1HLVA 4A69C 4DYQA 1OCPA 3MVPA 3IH2A 5E3NA 3S1NJ 1SFOJ 5IP6A 2HQ5A 2R5ZB 2XPUA 1TWGJ 4BXXJ 2VKEA 3IV5A 2L7FP 3CQZJ 3BT9A 1JT0A 5FKOA 2M0CA 1F36A 5J1YA 3GBGA 2JA8J 3WHCA 4D5CA 2LY9A 2DA1A 1JUPA 5M5XJ 3A02A 4A3DJ 4M3FA 5F0FA 2ID6A 3B6CA 4B1RA 4S0HB 1MH3A 3G1LA 1APLC 1WI3A 2DA2A 5C3EJ 1WPKA 4NDLA 1HOMA 3IH4A 1JUSA 9ANTA 3TW7A 1ZK8A 3FK6A 1ZGWA 1I3QJ 3B6AA 4J19A 3TP0A 4C3HJ 4A3BJ 3S2HJ 2X6OA 5M3FJ 1FIAA 1FTZA 1HF0A 3LSPA 1RKTA 2VPRA 2LTPA 3HKZN 4I76A 2O7OA 1OFCX 1ETQA 1FTTA 2DMQA 5DTDA 1IDZA 2LFBA 1Z0XA 2DA6A 4A3KJ 2CUEA 3ZQHA 5IYDJ 2XPVA 1Y1WJ 4XRMA 2VUMJ 1D5YA 1IJWC 1GUUA 4RDUA 3JRAA 4JX6A 4M3GA 1W0UA 4BBRJ 2DTZA 2JMWA 4X1EA 5M5WJ 1VFCA 3ZQLA 1U9OA 4IHVA 2R5ZA 1AKHB 1E3OC 2HYJA 1LFUP 3ZQFA 4FTHA 4XK4A 1ETWA 2CQQA 2XSDC 2YUSA 1K83J 2HI3A 5IOZA 2EZIA 3I4NJ 1F43A 3BG5A 2HXIA 3L1PA 4DYCA 1FJLA 1U8BA 2HDDA 1WH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BNG A;  3S17 J;  5F0C A;  5IYC J;  1LE8 A;  3BR1 A;  1RPW A;  4FIS A;  2M9H A;  2M8G X;  5FKM A;  3Q0W A;  3BR3 A;  3S1R J;  4FCY A;  4XRS A;  1MBK A;  2MGQ A;  2K9N A;  2DMP A;  2EZL A;  1GV5 A;  2K9Q A;  2CUF A;  4UUS B;  1MBH A;  3IH3 A;  3GTL J;  1ITY A;  1JT6 A;  3DEW A;  3BG9 A;  2XGE A;  2FD5 A;  1UMQ A;  5FKK A;  5J1R A;  2GM4 A;  1TC3 C;  2DA7 A;  3HOU J;  2HOA A;  2AHQ A;  4C2M J;  2DA4 A;  1B8I A;  1GDT A;  3JRH A;  2JA6 J;  5FLV A;  3TP3 A;  2NS8 A;  1ETK A;  2E1O A;  2NOG A;  3BR6 A;  1JTX A;  1IG7 A;  1LFB A;  1MSF C;  4A3M J;  4Y7N J;  2JA7 J;  1OJL A;  3JRF A;  3O8H A;  4A3C J;  1R9T J;  1CQT A;  4IEJ A;  4A3L J;  5J1U A;  3BR2 A;  4DZJ A;  5EDN A;  2PMZ N;  3BQZ A;  1RR7 A;  3CCY A;  1NK2 P;  3A01 B;  2M2E A;  3HOY J;  1ZR2 A;  1Q1V A;  2Y30 A;  3BTL A;  3GTO J;  1IUF A;  5IOY A;  3HGY A;  3LOC A;  2ECC A;  4W1U A;  1TWA J;  1QRY A;  1ETO A;  1AKH A;  1JTY A;  2K40 A;  5K7F A;  4DZP A;  2MG4 A;  5IYB J;  1JJ6 C;  4A3J J;  1JUM A;  3H3V K;  5IPA A;  2HXO A;  2R0Q C;  5EG0 B;  3HBL A;  1ZR4 A;  3CMY A;  4G12 A;  2K9S A;  4MO7 A;  5EZG A;  5E3O A;  2ZB9 A;  4XIC A;  2KDZ A;  3OSF A;  3S16 J;  5F27 A;  1ORK A;  4IHX A;  2R5Y B;  3HGG A;  2NS7 A;  3JRD A;  4IHW A;  2XGC A;  3S1M J;  2DMT A;  3HB9 A;  3FIW A;  4QTR A;  3HOX J;  2LD5 A;  2H8R A;  3HEF A;  1A6I A;  2E19 A;  4V2G A;  2EZH A;  4JX4 A;  1RES A;  5M3M J;  1HCR A;  3A03 A;  2ME6 A;  2X48 A;  2YU9 J;  4HNV A;  1G2H A;  3NAR A;  3ZQC A;  4UUS A;  4AYB N;  5M5Y J;  3SJM A;  3E7L A;  4LOC A;  1TWH J;  5GP9 A;  2WAQ N;  1UHS A;  2TCT A;  3FKI J;  1Z77 A;  2YS9 A;  1ENH A;  2Y9Y A;  3RQI A;  5FJ8 J;  1U78 A;  2ELK A;  2LR8 A;  1K61 A;  1P7J A;  1H8A C;  1B72 B;  4A3I J;  2JJ7 A;  3JRE A;  4A3G J;  2DMU A;  3FK7 A;  3VPR A;  5FLM J;  4MLO A;  5E3M A;  1AHD P;  3K7A J;  3WHB A;  2OF7 A;  4XID A;  2WB1 N;  4D7N A;  1A5J A;  1X2M A;  1FIP A;  3A01 A;  3JR9 A;  4M3E A;  3ZQI A;  1PUF B;  1VND A;  2GLO A;  2QF7 A;  2CQX A;  3JRC A;  5F08 A;  3JRI A;  3PM1 A;  4I6Z A;  2XPW A;  3HM5 A;  3RZD J;  1MBG A;  1JKR C;  3BQY A;  1RKW A;  3QQA A;  4UUT A;  2CRG A;  2L0K A;  2L7Z A;  2Y0S N;  3LNQ A;  3I4M J;  3PO2 J;  5HOD A;  4D5F A;  4JP0 A;  1H89 C;  2Y31 A;  4EEF G;  1Y1V J;  1IGN A;  2COB A;  2LKX A;  3H0G J;  1XS9 A;  5F0H A;  3C2B A;  2R5Y A;  1IC8 A;  4MFD A;  5EF6 A;  2ID3 A;  4Y52 J;  2NVX J;  2XB5 A;  1FEX A;  1MH4 A;  1BW6 A;  4JYK A;  1ETX A;  3HOV J;  3G1O A;  5FKN A;  2EBI A;  3RZO J;  2JK3 A;  2DMN A;  2NVQ J;  2DA5 A;  2IBD A;  4M3B A;  1YRN B;  3GTK J;  1WGX A;  5F04 A;  3BG3 A;  5C4J J;  4V2F A;  4C3I J;  1QVU A;  1JJ8 C;  4MIM A;  5GPA A;  1JKP C;  1I50 J;  1OCT C;  1B72 A;  1HDD C;  1IDY A;  5IP9 J;  1BL0 A;  3BTI A;  2FQ4 A;  5C4X J;  2W48 A;  2HOS A;  2D5V A;  5EEA A;  1DU6 A;  1U9N A;  2X9D A;  3BTC A;  2R93 J;  5E3L A;  1SAN A;  2AO9 A;  3BR0 A;  3LSG A;  1QVT A;  2R92 J;  2O9L A;  1EF4 A;  1PUF A;  3JRB A;  2H1K A;  2M34 A;  4C3J J;  2FJ1 A;  2GBY A;  4BBS J;  3MN2 A;  3TED A;  1WH7 A;  2ME0 A;  4AUX A;  2NVY J;  1DU0 A;  4A3F J;  2WV1 A;  1POG A;  3OOU A;  4MFE A;  4BKX A;  5F1J A;  3F0C A;  2VI6 A;  2E2H J;  4BY7 J;  3D1N I;  1LE8 B;  3UKG A;  3LSJ A;  4FE4 A;  5FKL A;  1TWF J;  4CYC B;  3ZQG A;  2Y2Z A;  3GTP J;  2QCO A;  2O8K A;  1XG1 A;  3NAU A;  3HOZ J;  1T56 A;  2RAE A;  2P81 A;  5EGO B;  3S15 J;  2VKV A;  4DYR A;  1BA5 A;  1XC5 A;  3K2A A;  5K7Z A;  1JKO C;  4RBO A;  4BY1 J;  4M3D A;  1MBJ A;  4W97 A;  2IAI A;  3SFI A;  2DJN A;  3S14 J;  2E2I J;  3PO3 J;  1ZTR A;  3CDL A;  1IV6 A;  1NTC A;  2HOT A;  3TW6 A;  2IEK A;  3BR5 A;  3HOW J;  3M4O J;  3DCF A;  1MSE C;  2EZK A;  1IRZ A;  2XGD A;  2B63 J;  1B8I B;  4DW6 A;  2LVS A;  1ETV A;  2R7Z J;  3GTJ J;  1YRN A;  1TWC J;  5GPC A;  1X2N A;  1QPI A;  1MBE A;  4B4C A;  4QIW N;  3JRG A;  5J3L A;  1BJZ A;  4AC0 A;  2LP0 A;  2JA5 J;  1ZKG A;  2JN6 A;  3S2D J;  3OSG A;  1O4X A;  2E2J J;  2I10 A;  5IP7 J;  1I6H J;  2MSY A;  3M3Y J;  1GVD A;  3BTJ A;  3QPL A;  1GV2 A;  1JGG A;  2G0E A;  2XB0 X;  2LLK A;  3FIS A;  1GT0 C;  4A93 J;  2DN0 A;  1S7E A;  1UG2 A;  2LK2 A;  2EQR A;  2XRL A;  4IHY A;  1JKQ C;  3GTQ J;  3OIO A;  3Q0U A;  1VI0 A;  3SDG A;  1X58 A;  1BW5 A;  3QPS A;  2L9R A;  5JLX A;  4XRS G;  5EG0 A;  5C44 J;  5K7H A;  2KT0 A;  3GTG J;  4D7M A;  2TRT A;  1ZQ3 P;  3Q3S A;  2FX0 A;  2CJJ A;  4QSH A;  1HDP A;  1AU7 A;  3RKQ A;  2MW8 A;  5EZH A;  3S1Q J;  1MNM C;  4CYC A;  4B3A A;  1W0T A;  4JX5 A;  3Q0V A;  1RET A;  1VF9 A;  2L7M P;  5EGO A;  1NK3 P;  4GFB A;  5JLW A;  1MBF A;  2EH3 A;  2OPT A;  5DS9 A;  4X6A J;  3O8G A;  4FE7 A;  4L5E A;  1ETY A;  1P7I A;  1T33 A;  3MKL A;  1WCM J;  2ECB A;  2CU7 A;  3GTM J;  2JWT A;  3W6V A;  4A3E J;  2Y9Z A;  1H88 C;  4ABZ A;  3LSR A;  3ZOB A;  3G1M A;  3HDD A;  2DA3 A;  2NVT J;  2N8G A;  4M6V A;  5EYR A;  1HLV A;  4A69 C;  4DYQ A;  1OCP A;  3MVP A;  3IH2 A;  5E3N A;  3S1N J;  1SFO J;  5IP6 A;  2HQ5 A;  2R5Z B;  2XPU A;  1TWG J;  4BXX J;  2VKE A;  3IV5 A;  2L7F P;  3CQZ J;  3BT9 A;  1JT0 A;  5FKO A;  2M0C A;  1F36 A;  5J1Y A;  3GBG A;  2JA8 J;  3WHC A;  4D5C A;  2LY9 A;  2DA1 A;  1JUP A;  5M5X J;  3A02 A;  4A3D J;  4M3F A;  5F0F A;  2ID6 A;  3B6C A;  4B1R A;  4S0H B;  1MH3 A;  3G1L A;  1APL C;  1WI3 A;  2DA2 A;  5C3E J;  1WPK A;  4NDL A;  1HOM A;  3IH4 A;  1JUS A;  9ANT A;  3TW7 A;  1ZK8 A;  3FK6 A;  1ZGW A;  1I3Q J;  3B6A A;  4J19 A;  3TP0 A;  4C3H J;  4A3B J;  3S2H J;  2X6O A;  5M3F J;  1FIA A;  1FTZ A;  1HF0 A;  3LSP A;  1RKT A;  2VPR A;  2LTP A;  3HKZ N;  4I76 A;  2O7O A;  1OFC X;  1ETQ A;  1FTT A;  2DMQ A;  5DTD A;  1IDZ A;  2LFB A;  1Z0X A;  2DA6 A;  4A3K J;  2CUE A;  3ZQH A;  5IYD J;  2XPV A;  1Y1W J;  4XRM A;  2VUM J;  1D5Y A;  1IJW C;  1GUU A;  4RDU A;  3JRA A;  4JX6 A;  4M3G A;  1W0U A;  4BBR J;  2DTZ A;  2JMW A;  4X1E A;  5M5W J;  1VFC A;  3ZQL A;  1U9O A;  4IHV A;  2R5Z A;  1AKH B;  1E3O C;  2HYJ A;  1LFU P;  3ZQF A;  4FTH A;  4XK4 A;  1ETW A;  2CQQ A;  2XSD C;  2YUS A;  1K83 J;  2HI3 A;  5IOZ A;  2EZI A;  3I4N J;  1F43 A;  3BG5 A;  2HXI A;  3L1P A;  4DYC A;  1FJL A;  1U8B A;  2HDD A;  1WH5 A; 
#chains in the Genus database with same CATH topology
 2WAF A;  3QP6 A;  5F0C A;  1OCR H;  1TQP A;  4XLN F;  3FHZ A;  3TQN A;  2M8G X;  3CF5 F;  4DJA A;  3OV8 A;  3RCO A;  1UHW A;  2M7B A;  5H6R A;  4ZZD A;  2QWW A;  1YTY A;  4F52 A;  4BH9 A;  4FCY A;  4ENM A;  2IS6 A;  1SMT A;  2K9N A;  2B7E A;  1VQL I;  1T0F C;  2RNJ A;  2KPM A;  3IH3 A;  3GTL J;  1JT6 A;  2NNN A;  1D5V A;  4ANJ A;  3I55 I;  3CCJ I;  1UMQ A;  1J5Y A;  4HZF A;  3DTE A;  3ABT A;  5J1R A;  2GM4 A;  2M8E A;  2DA7 A;  2L9S A;  2XAJ A;  4KA4 A;  2PI0 A;  3H3U A;  3JCU C;  1GDT A;  3JRH A;  4CCO A;  4HSR A;  2IGM A;  2E1O A;  2OCC H;  4PJJ A;  1IG7 A;  1JTX A;  2PFB A;  1IN7 A;  1LFB A;  4P1W A;  5ICF A;  2ZJR F;  3MZH A;  4IZZ A;  4Y7N J;  1OJL A;  4CHU A;  1R9T J;  2ZSI B;  5BOX A;  3BY6 A;  3BR2 A;  1F9N A;  5FB2 A;  4N4O B;  4E7I A;  3BQZ A;  3AG1 H;  3CCY A;  2X4H A;  2YR2 A;  1XSV A;  1BI1 A;  2UV1 A;  3CF2 A;  4LFU A;  2VC0 A;  3HOY J;  1Q1V A;  1SFX A;  2LF8 A;  4XLE A;  4HF0 A;  2CW0 F;  2ECC A;  3DPT A;  1JTY A;  1NG6 A;  2V7F A;  3PNY A;  1TT5 B;  4II2 A;  4XN0 A;  5FD6 A;  1UAA A;  1T08 B;  1RUN A;  1JJ6 C;  4RA2 A;  5F6F A;  5LGT A;  1DGR M;  1VQ5 I;  3U9G A;  4B8X A;  1ZR4 A;  2DOF A;  3CMY A;  1YW8 A;  3CJR B;  4QPQ A;  3ZMT A;  4FET A;  2ZB9 A;  3OSF A;  2V9P A;  3ESW B;  4ETS A;  1ODD A;  1D1A A;  5L3B A;  4QLC U;  3HGG A;  2WA0 A;  3E3V A;  3Q9V A;  3ZMD A;  4ZZL A;  1F5T A;  1ZG5 A;  3HOX J;  3OR1 C;  3HEF A;  5CVI A;  2P5L C;  1W5C C;  2IA0 A;  2L5Q A;  3KEO A;  4HNU A;  1D0Z A;  4P9F A;  4AVZ A;  4V2G A;  3T5X A;  3TO6 A;  1BC7 C;  1DPU A;  3IKT A;  4D9J A;  1UEL B;  4UXN A;  1RES A;  5M3M J;  2J5O A;  5E79 C;  4J00 A;  4MHG A;  1VQ8 I;  5FGM A;  2YU9 J;  1Y56 A;  1G2H A;  3S2W A;  1N78 A;  4AYB A;  3NAR A;  4I98 B;  4UUS A;  3U1K A;  4AYB N;  2AS5 F;  3NEU A;  4LOC A;  4IRI A;  2BHY A;  1S3J A;  4ZDL A;  3G4S I;  4M6Y A;  1MD0 A;  1Z77 A;  1ENH A;  2RQQ A;  4KIT B;  2P4W A;  2Y9Y A;  3WU1 B;  2ZME A;  5HLI A;  1U78 A;  3N05 A;  2ELK A;  5JVT A;  4O6J A;  2M7A A;  2WBM A;  2M45 A;  1Z91 A;  1P7J A;  3OS0 A;  4A3I J;  2JRM A;  2BE5 F;  4A3G J;  2OC6 A;  5ERI A;  2HVQ A;  2CGP A;  1YS6 A;  3DP7 A;  2EPF A;  4RAG A;  5E3M A;  1AHD P;  5JFR A;  4GDF A;  3LSH A;  1FIP A;  3N4M A;  3K4K A;  4P5O A;  3CC4 I;  2ESH A;  4OAY A;  5CYV A;  2H6C A;  1MJB A;  5DEQ A;  1PUF B;  1KU3 A;  2KRF A;  3P5J A;  1XPX A;  1QPM A;  2GLO A;  2FML A;  2QF7 A;  2W24 A;  4M72 A;  2OZU A;  1EA3 A;  3GVA A;  2X6Y A;  3CTA A;  1T38 A;  2VT3 A;  3OS2 A;  1R4M B;  3BQY A;  2L0K A;  3LNQ A;  2Y0S N;  3PO2 J;  3L2V A;  1IXC A;  5HOD A;  3CC7 I;  3HSF A;  2ISZ A;  4F3Q A;  3WG9 A;  2BW3 A;  4PK4 A;  3SFZ A;  2VAS A;  2VBX A;  3H5R A;  5DD8 A;  3TGN A;  2LKX A;  3CES A;  2X85 A;  3PNV A;  2ZXW H;  1XS9 A;  2LBF B;  5F0H A;  2R5Y A;  2DFF A;  1H9T A;  1ZN2 A;  2IW5 A;  5DYM A;  2XB5 A;  1MMG A;  2CW7 A;  1BW6 A;  4PDK A;  3F72 A;  3WE2 A;  3W6K B;  3ECH A;  1C0W A;  3RJP A;  2VIX A;  1ETX A;  2DW4 A;  2VJI A;  4P55 A;  1MND A;  1RI7 A;  1X3W B;  2NS0 A;  2BY0 A;  2VJ5 A;  2HFH A;  2JK3 A;  3I9V 2;  3K69 A;  1OCO H;  1USS A;  3O2P E;  2DMN A;  3A2K A;  2DA5 A;  2IBD A;  1G3W A;  1VZ0 A;  2GOX B;  2LRD A;  3LL7 A;  5KHD A;  4S04 A;  2PMZ A;  3I4P A;  5DCF A;  4V2F A;  3D5R C;  4AIJ A;  1JKP C;  1I50 J;  2K86 A;  5JVG F;  3H9G A;  2FXA A;  1MJ9 A;  1MMA A;  2W4S A;  5KCM A;  3EYI A;  1BL0 A;  3BTI A;  5E1W A;  3R0J A;  4HA8 A;  4HEA 2;  3K70 C;  3DFG A;  2AQE A;  1U9N A;  2X9D A;  2D1H A;  1SAN A;  5CKT A;  5KK1 A;  1R5G A;  5H2F C;  3OYJ A;  1XTA A;  3GFM A;  1AA7 A;  3I59 A;  3JRB A;  4C3J J;  2GBY A;  3TED A;  1WH7 A;  4Q48 A;  1K4T A;  2CG4 A;  2NVY J;  3T1B A;  1TNS A;  1TTY A;  1P4X A;  3AAF A;  4A3F J;  3OOU A;  1FP1 D;  3A0B C;  1I1G A;  2OQG A;  3LQR A;  2E2H J;  4BY7 J;  3TOB A;  3D1N I;  2E1M B;  3ZQG A;  4PJ0 C;  1K78 A;  1D1C A;  1W4M A;  2QCO A;  3HOZ J;  1T56 A;  2RAE A;  3QU3 A;  5J4V A;  2KFD A;  2P81 A;  2EFN A;  4ASN A;  4OWR B;  3S15 J;  2VKV A;  4DYR A;  1BA5 A;  1YJ9 I;  1OYW A;  2R4G A;  4F92 B;  3CD6 I;  3D0S A;  4W97 A;  2IAI A;  1SD4 A;  2K5C A;  1TQI A;  2EK5 A;  3DKX A;  3WU2 C;  1RZ4 A;  3BJA A;  3CDL A;  4EJT A;  1Z7U A;  1A31 A;  1S7O A;  4L18 B;  4GRI A;  3REO A;  2DLL A;  4I2O A;  2B63 J;  1R58 A;  1W1W E;  3RQ4 A;  2LVS A;  1ETV A;  4MQ9 F;  5LHG A;  2FA5 A;  3VYT B;  1FC3 A;  2Z9O A;  3GTJ J;  2XKP A;  1J59 A;  3FXO A;  2DPD A;  3LA3 A;  3G73 A;  2R7X A;  1MMS A;  3JRG A;  1BJZ A;  1BIA A;  2FQ3 A;  2ADU A;  2MBF A;  2JA5 J;  1U2W A;  3OSG A;  3ZGK A;  1PUE E;  2OD5 A;  3M3Y J;  2MFZ A;  2OJE D;  5CPR B;  3FXR A;  3DBH B;  1H0M A;  3JTG A;  1GV2 A;  2QBY B;  3F8N A;  3LFU A;  2FUG 2;  2D1V A;  1S7E A;  2ZNY A;  1IO2 A;  1R23 A;  4XN3 A;  4BDY A;  3GTQ J;  2JPC A;  2HYF A;  3VOE A;  5EG0 A;  3AG4 H;  1TNT A;  1FSH A;  2BVL A;  3QP5 A;  3E1S A;  3NRV A;  4EQQ A;  1MDM A;  4C2U A;  3KCC A;  3SDB A;  1ZQ3 P;  2QQB A;  4KN4 X;  3VB2 A;  3LSK A;  1ZAO A;  1KA8 A;  2OZ6 A;  4ZYH A;  2EIK H;  3Q3S A;  1J2X A;  2V6C A;  1HDP A;  1AU7 A;  2L4M A;  4BYY A;  2FOK A;  2X1D A;  3S1Q J;  2RV8 A;  2HTS A;  2P5V A;  2DK8 A;  2BZT A;  1M1E B;  2K9M A;  4BHB A;  4B3A A;  1W0T A;  1ON2 A;  3SEZ A;  4EM2 A;  1QNT A;  1BJA A;  1VF9 A;  2XAS A;  3FXM A;  4GFB A;  4J01 A;  5HLG A;  5LGU A;  2R7U A;  2VPL A;  1HXD A;  2MLK A;  1YIO A;  2COM A;  4XLP F;  3ZRG A;  2E7X A;  1WCM J;  2F5E A;  5LRR A;  3W6V A;  5GAH J;  3Q5F A;  5CVU A;  4XON A;  4ABZ A;  3MMY B;  3ZOB A;  5CVV A;  2WC2 A;  3G1M A;  4BE0 A;  3G71 I;  2E34 A;  3PSF A;  2N8G A;  4M6V A;  4BDZ A;  1U3E M;  1MW7 A;  2V9V A;  5EYR A;  2BXY A;  4DYQ A;  3S1N J;  5KAI C;  1WJ5 A;  2Z3Y A;  1TWG J;  2H1L A;  5LHH A;  1N75 A;  2VKE A;  4XL9 A;  3HRM A;  2ZJQ F;  4CUG A;  2ZO4 A;  3CQZ J;  3QPH A;  5FKO A;  4IOA F;  3GLX A;  3FXL A;  2VOO A;  1F36 A;  2DOA A;  4KUM A;  2HGC A;  3HC7 A;  5KAF C;  4RMN A;  3WHC A;  1V5E A;  2DA1 A;  1CF7 B;  1X1A A;  2X51 A;  2H09 A;  5HLH A;  1BR2 A;  2VKH A;  1D1B A;  2E71 A;  4M3F A;  5CQG A;  3GZ5 A;  2A68 F;  2BW3 B;  2ID6 A;  4LIT A;  3B6C A;  2ZXJ A;  4WK8 F;  4RLQ A;  1SMY F;  1MH3 A;  2ELJ A;  4S0H B;  4AIK A;  5LGN A;  1TT0 A;  4G8X A;  5C3E J;  1BI0 A;  1BIB A;  3P9K A;  4UV8 A;  1WPK A;  2F5V A;  2DYS H;  4XBF A;  3ABL H;  1TBX A;  5E8G A;  3VYS B;  3OYF A;  4NDL A;  2DOE A;  1JUS A;  3NWS A;  1JHH A;  4PZJ A;  3H9Q A;  4J19 A;  3LA2 A;  1SAU A;  3QYE A;  3S2H J;  1GXP A;  2HNH A;  5M3F J;  1HF0 A;  3KYC B;  4BNC A;  1RKT A;  2XF7 A;  2LTP A;  4BJT A;  1Y0N A;  1QA6 A;  3ELK A;  3ZMU A;  1VQ6 I;  2EJR A;  2DMQ A;  5BPD A;  1IDZ A;  4XNF A;  1Z0X A;  4A3K J;  3CC2 I;  1Y1W J;  2UXN A;  2R7Q A;  1KON A;  1LNW A;  2LRE A;  3M8F A;  2FBI A;  3QPT A;  3IRQ A;  1YIJ I;  1W0U A;  1FWZ A;  1HW2 A;  5BQT A;  4IQJ A;  4N0B A;  5D5X B;  2LYC A;  2DTZ A;  5M5W J;  1YYV A;  3FBN B;  2DXI A;  5K5R A;  1ZHF A;  3K4N A;  1ETW A;  1FBQ A;  2ESN A;  1D0Y A;  2CQQ A;  2XSD C;  3AKZ A;  2YUS A;  1K83 J;  3WG7 H;  5IOZ A;  1EV7 A;  2EZI A;  3KE2 A;  4A12 A;  1UST A;  4WCG A;  4DYC A;  4XOT A;  1ERD A;  4XLC A;  3CCV I;  2QEX I;  3OYN A;  5BNG A;  3S17 J;  1OR7 C;  5IYC J;  1LE8 A;  3BR1 A;  4KIG A;  1A35 A;  4BEH A;  2XF6 A;  5E1Z B;  2M9H A;  2IGN A;  2QLZ A;  3HOS A;  2QQ8 A;  4XM3 A;  1J09 A;  1OLT A;  2WY8 Q;  2JVG A;  3S1R J;  4UHT A;  1MIJ A;  4XRS A;  1QZZ A;  2MGQ A;  2VJ4 A;  3PFY A;  5KVR A;  2EFQ A;  2Z99 A;  2EZL A;  3IAS 2;  2ZJP F;  3WTZ A;  3I0T A;  1I5Z A;  1OIS A;  5KNL A;  3CMA I;  2MD0 A;  3BG9 A;  4PJL A;  2M3A A;  4FHT A;  4JBA A;  4P96 A;  1UB9 A;  4RS8 A;  5D6F A;  3T8T A;  2R7O A;  5CJ9 A;  2VLA A;  3HOU J;  3GFJ A;  1Z9C A;  3ISP A;  2HOA A;  4C2M J;  5JI6 A;  1B8I A;  2EFO A;  3BP8 A;  1O3R A;  3TP3 A;  2K27 A;  1X4O A;  4YFN F;  2GA2 A;  2R7T A;  2ZJ2 A;  2NAZ A;  4RGR A;  3LAP A;  1L3L A;  1XDS A;  5ILU A;  3KP7 A;  2Q8K A;  3VSL A;  2LOO A;  4CXF A;  3J7Z I;  1KQ8 A;  3O8H A;  3CO7 C;  3P9C A;  2XSJ C;  2A5W A;  5J1U A;  4BAY A;  4DZJ A;  2NRA C;  5EDN A;  5HDG A;  1NK2 P;  4OIO F;  2V1D A;  1SD7 A;  2IA1 A;  3RDI A;  1IUF A;  3HPH A;  5ICC A;  2VXD A;  3I5U A;  5IOY A;  5LLQ A;  3BOQ A;  1X1C A;  1QHH D;  3FX3 A;  4L9N A;  4U88 A;  5AIP A;  4D0P A;  4ENK A;  2NOJ B;  3BZC A;  4B3X A;  1ZEL A;  3KFW X;  4DZP A;  5K7F A;  4Z6Y A;  4II3 A;  4BE2 A;  2DU9 A;  1JUM A;  4NB5 A;  5A2Q Z;  3H3V K;  2HXO A;  1VQ9 I;  2R0Q C;  5EG0 B;  3HBL A;  3L00 A;  3JSP A;  3F9K A;  2ZNZ A;  5EZG A;  1W36 C;  1ZH5 A;  5E3O A;  1ZG3 A;  3MAJ A;  4XIC A;  2KDZ A;  2EV0 A;  2XHK A;  3DEU A;  2EIN H;  2GXA A;  5DUK A;  1JE8 A;  3ROU A;  1WVR A;  1LQ1 A;  4M73 A;  3S1M J;  2LD5 A;  3FIW A;  2H8R A;  3FXU A;  3KP3 A;  2W57 A;  4Y17 A;  2E19 A;  3CLQ A;  2L7K A;  4ZH4 F;  2ZBK A;  3GME A;  3IWF A;  2XV4 S;  1HCR A;  1IV8 A;  2X48 A;  3ASO H;  1SAX A;  1UCR A;  2K9L A;  4CCN A;  2XRN A;  5M5Y J;  2WAQ A;  4JQF A;  3CUQ A;  4G7O F;  2YSR A;  2WAQ N;  1UHS A;  4Y13 A;  1RNL A;  2JSP A;  4NC8 A;  1YS7 A;  2A07 F;  3LMM A;  3DPL C;  4M71 A;  4XQF A;  1BR4 A;  2CV1 A;  4KYW A;  2XAU A;  1HSJ A;  3WTX C;  2LR8 A;  3ZMV A;  4IVN A;  3ZCO A;  3WE3 A;  4OMZ A;  4UB6 C;  5J4Y A;  3SEQ A;  2QSH X;  2DMU A;  1N25 A;  3FK7 A;  3VPR A;  1SFE A;  5ICG A;  3M1E A;  1MKM A;  2BY3 A;  4MLO A;  1V55 H;  5IY5 H;  3K7A J;  2KRH A;  5DM6 F;  2ZFW A;  1A5J A;  2XIG A;  1XDU A;  1AOY A;  5EEH A;  3CCU I;  2K3F A;  5HOO A;  4XKB A;  3A01 A;  4M3E A;  5D8K B;  1ZGJ A;  1XN7 A;  3L9F A;  3IL2 A;  2KMU A;  5IT3 A;  4HX7 A;  3JRC A;  1SVO A;  5F08 A;  3VYR B;  2DFE A;  1W5T A;  3D5S C;  4EVI A;  1JKR C;  5HNH A;  3I4M J;  2L7Z A;  4HDU A;  1HKT A;  4CIC A;  2RN7 A;  2KJB A;  2YU3 A;  1Y1V J;  1XSX A;  4LK0 F;  4LIV A;  4HV6 A;  2COB A;  1ULY A;  5J8F A;  3DXJ F;  3C2B A;  1T6S A;  3OIP A;  1QU3 A;  5EF6 A;  4U7D A;  2ID3 A;  5K5Q A;  1HW5 A;  4GYI A;  2CS3 A;  4NQW B;  2ICW G;  3HUG B;  4RAZ A;  2YX7 A;  3OYB A;  3O6B B;  1VQ7 I;  1MJA A;  4JYK A;  2UXX A;  3F8M A;  2B0L A;  1TLH B;  5LD2 C;  3HOV J;  3ZMS A;  2EIL H;  3RZO J;  3HIF A;  4ZYG A;  5L3G A;  4CCM A;  3K2Z A;  1UHM A;  3BZK A;  2HEO A;  4G6Q A;  2CV0 A;  3A4C A;  4O3M A;  2NVQ J;  4M3B A;  5FFZ A;  2V4J C;  1A04 A;  4XRF A;  5F04 A;  3OYH A;  1WJE A;  2CQN A;  4BJ6 C;  2STW A;  4C3I J;  2XUB A;  1QVU A;  1JJ8 C;  4A2U A;  2HS5 A;  2HPI A;  1K6Y A;  3C7J A;  1B6A A;  1B72 A;  1HDD C;  3UNG C;  2Z2S B;  2RGV A;  1B4A A;  2W48 A;  1IRX A;  4AWX B;  1X4P A;  3F6V A;  5K1Y A;  2GWR A;  2R7W A;  2HWV A;  3QYB A;  4IHT A;  3IAM 2;  3E97 A;  4ZC3 A;  3RKW A;  3HOT A;  2AO9 A;  3BR0 A;  3LSG A;  1QVT A;  1J0R A;  4I0A A;  1YW7 A;  2CSO A;  2M34 A;  2PBI A;  3TKY A;  1V5F A;  5EEG A;  4BBS J;  1ZRD A;  2K4B A;  1VQK I;  1Z05 A;  1DU0 A;  3BG7 A;  4V19 K;  2WV1 A;  2EV5 A;  2P0W A;  3GZN B;  2XDV A;  2Z5U A;  4MFE A;  4F7Z A;  4I0B A;  3PQK A;  2G7H A;  2KIF A;  2HYG D;  1G8X A;  1LE8 B;  4B44 A;  3LSJ A;  4FE4 A;  4UVA A;  1TWF J;  2IJL A;  5FKL A;  4BEH B;  3UKG A;  1J75 A;  3GTP J;  3KYD B;  3B02 A;  1G4D A;  3V7C A;  2O8K A;  3NAU A;  2WWY A;  4M6X A;  1B9N A;  3CZ6 A;  4KIB A;  2NVU B;  4YRV A;  2O5R A;  3BJO A;  3I53 A;  3DBL B;  3V8K A;  3WTW C;  1G3T A;  2HDC A;  1XC5 A;  3ABM H;  1K4S A;  4RBO A;  2Z16 A;  1JGS A;  4JK1 X;  4BY1 J;  4M3D A;  1MBJ A;  4HF2 A;  2D2W A;  2DJN A;  3S14 J;  3CCS I;  1ZTR A;  4EM0 B;  2DTR A;  2Y69 H;  3TW6 A;  2OTL I;  2KIU A;  1DDN A;  4C2T A;  3BR5 A;  2K7L A;  3RPQ A;  1CGP A;  2XGD A;  1B8I B;  4DW6 A;  3KEQ A;  3L2Q A;  3CJQ B;  1U5T B;  2R7Z J;  3L2U A;  1U5T C;  2A05 A;  2LMD A;  2Q2E A;  4NNJ A;  4Y3O A;  1R49 A;  4IL6 C;  4TV7 A;  1YRN A;  5DM7 F;  5GPC A;  1WZ2 A;  2B9S A;  4QIW N;  3MCZ A;  1X1P A;  2VL8 A;  3K4B A;  2M30 A;  3QOE A;  1XGN A;  2Y75 A;  3BZ6 A;  3JSO A;  2JN6 A;  4L9V A;  3S2D J;  1O4X A;  2I10 A;  2LDU A;  2ZKZ A;  2MH2 A;  3MZ8 A;  3DKW A;  3GWZ A;  1FSE A;  2CYY A;  2A69 F;  3GFL A;  4IPA A;  4B47 A;  1GT0 C;  3FIS A;  4A93 J;  2JSC A;  2XRL A;  2EQR A;  1J7K A;  1F1Z A;  2Y0S A;  1JKQ C;  2F4M B;  3OIO A;  1LB2 A;  1X58 A;  3QPS A;  4E7J A;  1W5S A;  3VDX A;  4FX4 A;  2TRT A;  4LG0 A;  2E5Z A;  2EIJ H;  2OAZ A;  4QSH A;  4UNO A;  1IRF A;  2MW8 A;  1FBS A;  5E1X A;  4CYC A;  4JX5 A;  3K4L A;  2DOD A;  4ZDO A;  4LMY A;  2R7S A;  3Q0V A;  2HKX A;  3LWF A;  1GLN A;  5EGO A;  5L3F A;  1ACI A;  1MBF A;  2EH3 A;  2OPT A;  4MNU A;  1JHF A;  3E6B A;  4OMY A;  2JZY A;  4IRG A;  2F5D A;  3CUO A;  4L0Z B;  3MKL A;  2ECB A;  2CU7 A;  4E7L A;  3K1N A;  3GTM J;  3ML6 A;  2EIM H;  4A3E J;  4G94 A;  3VSK A;  4ESB A;  2Z1D A;  2V1X A;  2BHZ A;  3LSR A;  2P6T A;  5ICE A;  1S72 I;  4ZJZ A;  3PIP F;  3T8R A;  5DD4 A;  4IO9 F;  2QYO A;  3RPU D;  4EMS A;  1U8R A;  3MVP A;  3IH2 A;  4U0W A;  3HXL A;  2BY1 A;  1ZYR F;  3K4J A;  2MAB A;  1Y0U A;  2HQ5 A;  3HG9 A;  4BQN A;  2XPU A;  4WXH A;  1VQM I;  5J8C A;  3IV5 A;  1SD6 A;  3J7A Y;  2XAQ A;  1Z6R A;  1FYM A;  1Y8Q B;  3BT9 A;  3AL0 B;  3AL0 C;  2M0C A;  2FEZ A;  2K85 A;  2F2E A;  1SFU A;  1Z3X A;  4U0V A;  4I99 C;  2E1C A;  4XR6 A;  3BDD A;  1LJ9 A;  1YW9 A;  2E1M C;  4BQO A;  3ABK H;  2QVO A;  2VQC A;  1R4N B;  3A02 A;  1H9G A;  3CO6 C;  3PFI A;  4PGG A;  1UG0 A;  4B1R A;  3TO7 A;  3COA C;  2O8X A;  4YII A;  3O3K A;  1ZRF A;  2BXZ A;  3OYC A;  2CQ7 A;  3K70 D;  4JOM A;  2ELH A;  4RAF A;  4D1Q A;  3MFK A;  2H8W A;  5HNF A;  4OIP F;  1ZK8 A;  1KQ0 A;  3VEP A;  3F3X A;  3BJ6 A;  4MEY F;  3TP0 A;  2VJJ A;  4A3B J;  3H92 A;  1FTZ A;  1WWX A;  2HTJ A;  4BUP A;  2KIM A;  1OCZ H;  2XAF A;  2VBZ A;  3KIO A;  1FZP B;  1FTT A;  4PGH A;  5DTD A;  4PSX A;  2LFB A;  3ZQH A;  1UZC A;  3A1Y A;  2VC1 A;  2L9V A;  3CJN A;  2W7N A;  3S8P A;  2VUM J;  1D5Y A;  2IGO A;  5FO5 A;  4GXO A;  4RDU A;  5TIS C;  1HW1 A;  1XGS A;  1KZH A;  3CCR I;  3LA7 A;  4LLG F;  1R5H A;  3IC7 A;  4CA0 A;  2X6W A;  3K1M A;  1V4R A;  2JMW A;  2V26 A;  1Z3Y A;  3FM5 A;  3F8C A;  2ETH A;  4ZTJ A;  4XLH A;  1U9O A;  2R5Z A;  3RI4 A;  2EA4 A;  2QKL B;  3ZQF A;  4FX0 A;  2I8D A;  3KZZ A;  3PJR A;  2HI3 A;  2CH0 A;  4XSZ F;  5IT9 K;  3OYE A;  2IP2 A;  2M1B A;  2IS2 A;  1Z1D A;  3L1P A;  2KJC A;  1FJL A;  5HDK A;  4I02 A;  2QM3 A;  5AON A;  1U8B A;  3R60 A;  1TL8 A;  4HOB A;  4KFC A;  1IXS B;  2FRH A;  3EUH A;  4I09 A;  3CME I;  2O6G E;  3DLA A;  1RPW A;  1K79 A;  1P92 A;  1U6G A;  2JPB A;  1WJF A;  1OMI A;  2FNP A;  3Q0W A;  5FKM A;  1LEA A;  2M5W A;  1LKX A;  2V6E A;  1X19 A;  3KYL A;  5E17 F;  3DU6 A;  5GTI C;  3H3Z A;  1OCC H;  3GW2 A;  3DTK A;  4XKW A;  2EFW A;  4DNC A;  2JRT A;  3L2C A;  3DEE A;  2K9Q A;  1FP2 A;  4UUS B;  3BCB A;  1VTN C;  1ITY A;  1Z6T A;  4BU2 A;  1XGM A;  4YFK F;  3DEW A;  3E5Q A;  2CQK A;  3MD2 A;  5TGT A;  3GFI A;  2OA4 A;  2Y0M A;  3RYR A;  2XRO A;  4HLY A;  3M07 A;  2ZME B;  1TC3 C;  3TL4 X;  4HDV A;  2ZME C;  3M9A A;  5JHU A;  2DA4 A;  3J80 K;  2JA6 J;  5FLV A;  1TW2 A;  4E6K G;  1WHU A;  2NS8 A;  3EUA A;  2NOG A;  4DBR A;  3E5U A;  3K0L A;  3TDU C;  1F4K A;  1Z21 A;  4NC6 A;  3CCE I;  3ZPL A;  5DV5 A;  3IUO A;  2CMP A;  3ASN H;  3EDP A;  3RKY A;  2Q2E B;  5D5W B;  3MKY B;  2STT A;  4C30 A;  2O03 A;  2XAH A;  1CQT A;  1VQN I;  3G3Z A;  4IEJ A;  4A3C J;  2FU4 A;  1YX5 A;  3FMQ A;  5A2Q K;  2VQL A;  2M2E A;  1KU7 A;  3GXO A;  1FBU A;  2CW8 A;  1ZR2 A;  2DO7 A;  3BWG A;  1S9H A;  4L5J A;  1LVA A;  3WU0 A;  2H27 A;  5DDG A;  3AG3 H;  4IJA A;  4W1U A;  3TBI A;  1QRY A;  1AKH A;  4YEL A;  2VON A;  3K10 A;  4HX4 A;  2MG4 A;  3CJT B;  5BS6 A;  3CLO A;  4A3J J;  3MQ0 A;  1R36 A;  2XKO A;  3K4C A;  2IVM A;  1BC8 C;  4G12 A;  3C2H A;  3F8F A;  1IZ1 A;  1LFP A;  2K9S A;  3F8B A;  4MO7 A;  4OU0 A;  3F6O A;  4CDG A;  4LG0 B;  2JA2 A;  4XKC A;  4IHX A;  2JVH A;  3F22 A;  2R5Y B;  3JRD A;  2NS7 A;  4IHW A;  2XGC A;  3G2B A;  4EAT A;  2R7V A;  3HZJ A;  3F23 A;  1FT9 A;  2DMT A;  3WOD F;  4QTR A;  4P9U A;  2QGU A;  3SZG A;  1O57 A;  2M87 A;  3I58 A;  2P7V B;  2EZH A;  2DT6 A;  3JW4 A;  2JUG A;  4HX8 A;  4JX4 A;  1T0F A;  4CZZ A;  5HS7 A;  3VOD A;  5JR3 A;  3A03 A;  3V7R A;  2ME6 A;  4XOP A;  4MGR A;  4HNV A;  3ZQC A;  2L01 A;  3OWT A;  2KDO A;  3E7L A;  3SJM A;  1IN4 A;  1TWH J;  3BC8 A;  4EGZ A;  2O0Y A;  4A6D A;  3OY9 A;  2NXN B;  1XX5 A;  2P8T A;  3S32 A;  3PNT A;  5FJ8 J;  4AU7 A;  3H1C A;  2BVM A;  1H8A C;  4LB5 A;  2JJ7 A;  3OYK A;  4AM3 A;  4LLL A;  4A6E A;  1D0X A;  4PSW A;  4M9Z A;  1W7P D;  2RKH A;  3QRF F;  5FLM J;  1V5G A;  1GVJ A;  5LRS A;  2A6H F;  5LEJ A;  3H36 A;  1PJR A;  2E1N A;  2OF7 A;  3BG6 A;  3E6M A;  3GLL A;  4XID A;  1EJ9 A;  4D7N A;  1KU9 A;  1Y39 A;  2CFO A;  2DJI A;  1IF1 A;  3I59 B;  4IOC F;  4A5M A;  5ED4 A;  5TJJ A;  2QQ9 A;  1S29 A;  1LDJ A;  1OYI A;  3CDH A;  4ENJ A;  2PQ8 A;  3JRI A;  3PM1 A;  3SYT A;  4I6Z A;  2XPW A;  3WTU C;  3HM5 A;  3ZMZ A;  4BE1 A;  4BQA A;  4B43 A;  1YJN I;  1NG7 A;  4UUT A;  2CRG A;  2FF4 A;  4D5F A;  2IPQ X;  1BR1 A;  4RGS A;  1K78 B;  5IT9 Z;  2R7F A;  2A5Y B;  1HKS A;  4CZC A;  2VBW A;  3FHN A;  3DF8 A;  3HHH A;  4OIQ F;  4G7H F;  3QU6 A;  2CV2 A;  3H0G J;  1NHA A;  2F6C A;  5L3D A;  3GX4 X;  3S3N A;  1NH3 A;  2BBY A;  4RM2 A;  2VE8 A;  3HL2 A;  3J81 K;  4Y52 J;  1JXS A;  2YX4 A;  3FBI B;  3FM3 A;  1LUJ B;  1FY7 A;  3DTI A;  2EBI A;  4XKV A;  3E6D A;  3E5X A;  4YG2 F;  2XF5 A;  3GUD A;  3KET A;  2R7R A;  1QZY A;  5FFX A;  2FSW A;  2F5C A;  2Q1Z B;  1TW3 A;  1WGX A;  3EPZ A;  2BGC A;  3BG3 A;  3OMY A;  2E7W A;  5C4J J;  3J80 Z;  4MIM A;  1IDY A;  3SZP A;  3GF2 A;  5K5O A;  2W84 A;  4BQQ A;  5C4X J;  4NBQ A;  5EEA A;  3GCM A;  1IN6 A;  4LK1 F;  3KP5 A;  2R93 J;  2R92 J;  4E7H A;  1EF4 A;  3ZP5 A;  1ZLK A;  4XLF A;  1IXR C;  1PUF A;  2FNA A;  2FJ1 A;  1MDM B;  3FXK A;  4U0Y A;  1YO5 C;  3OOP A;  2P7C B;  3OYL A;  4QWQ A;  3PQJ A;  3U2R A;  5CLS A;  3RSN A;  5F1J A;  1J9I A;  2QSG X;  2IXS A;  2VI6 A;  2EV6 A;  5D6E A;  4BHP A;  1X3U A;  5E20 A;  4RAY A;  3RPU A;  2ACJ A;  2KZG A;  3DLL F;  4YIR X;  2E60 A;  2H94 A;  1DUX C;  1P9Q C;  2LBF A;  4A0Z A;  3K2A A;  1JKO C;  2JT1 A;  1WI9 A;  2RRE A;  3ECO A;  2DCE A;  3CCL I;  4ZYD A;  3OYD A;  1IN8 A;  1EH7 A;  2E2I J;  3PO3 J;  4F93 B;  1DP3 A;  4HBL A;  1FPQ A;  5H6Q A;  1XMA A;  1NTC A;  2HOT A;  4RGU A;  3M4O J;  4M74 A;  3DCF A;  4EGY A;  5FRN A;  1YFH A;  1IRZ A;  1MMN A;  4YEJ A;  3K9T A;  4ESJ A;  4ON0 A;  2VOD A;  4EV0 A;  4FQG A;  1QGP A;  1TWC J;  4RLF A;  3PUB A;  1QPI A;  4OOI A;  1MBE A;  3DQV C;  2IS1 A;  2KL4 A;  3J7Y J;  3H0D A;  1HKQ A;  2MLG A;  4AC0 A;  5E18 F;  3KZI C;  1N77 A;  2LP0 A;  3V4G A;  4HNT A;  2E2J J;  3CCQ I;  2MSY A;  2BV6 A;  5D4R A;  4DIQ A;  2RQP A;  1VQO I;  3QPL A;  2G0E A;  2XB0 X;  2LLK A;  3SZT A;  4F91 B;  2R7D A;  4HF1 A;  3EUK L;  4IHY A;  1XMK A;  1A36 A;  2Q0O A;  1VI0 A;  3SDG A;  3QAH A;  4Q4Z F;  2L9R A;  5C44 J;  4XRS G;  2KT0 A;  1P4A A;  2DFH A;  2HVR A;  3GTG J;  3BLY A;  3WTT C;  2DPU A;  3LQQ A;  2CJJ A;  2J5P A;  3PL8 A;  3IHU A;  2WTE A;  4Y33 A;  2IA2 A;  1KYW A;  1OPC A;  4IQ4 A;  1Y8R B;  1O7F A;  2O61 A;  1YOV B;  2HDW A;  4I7H A;  1YI2 I;  2QSF X;  5JLW A;  4X6A J;  1O3S A;  5DS9 A;  4GGG A;  3WTY C;  2DBB A;  3J81 Z;  2A61 A;  1P7I A;  1T33 A;  2BY2 A;  2F48 A;  1S7A A;  3W2W A;  4CO8 A;  2X0L A;  1DPR A;  1EH8 A;  5FRM A;  3OL4 A;  2GQQ A;  5HDN A;  2LKP A;  2Y9Z A;  2VT2 A;  4DOZ A;  2DQL A;  5L3C A;  3WTS C;  3VYU B;  3KP6 A;  2RDP A;  4EJU A;  4CCK A;  5F1R A;  3KX2 A;  3HDD A;  2NVT J;  1FOY A;  5CQE A;  4R8H A;  4XSX F;  5LEK A;  1OCP A;  3AG2 H;  1SFO J;  5GAG J;  1OYY A;  1WKM A;  2PMH A;  1R1V A;  5IP6 A;  1G59 A;  5HS9 A;  4AID A;  1R00 A;  4BXX J;  4HYE A;  2LY2 A;  2HQA A;  1K7A A;  1BM9 A;  3MKW B;  2UUZ A;  3JAM K;  1SEU A;  3S3O A;  1SVM A;  3HPG A;  3LSM A;  2QBY A;  1S8N A;  2VXZ A;  3OIQ A;  5J1Y A;  1DP7 P;  3ZN1 A;  4D5C A;  3OS1 A;  4A0Y A;  1SC7 A;  4HST A;  1T39 A;  1R1T A;  1BOB A;  1WJB A;  5BMZ A;  3CMM A;  4A3D J;  5D5U B;  1FYL A;  3HRS A;  3HRT A;  4Z2Y A;  2MD5 A;  3WGH A;  5F0F A;  4WX9 A;  2KQR A;  5B1B H;  1O3T A;  4RM3 A;  3G1L A;  1IUY A;  1WI3 A;  2DA2 A;  2GOM A;  2DAO A;  2EWN A;  2Z33 A;  2V9K A;  2W25 A;  4A5N A;  3IKV A;  2P6S A;  1D8K A;  3L09 A;  3DPU A;  4WXC A;  4ITV A;  1HOM A;  1SFK A;  3TW7 A;  1XGO A;  3LAJ A;  2HPM A;  1ZAR A;  1I3Q J;  5J40 A;  2F4I A;  3NQO A;  4E7Z A;  3ERE D;  2ZCW A;  2HVS A;  2KLO A;  1X1D A;  1T98 A;  1FIA A;  1STZ A;  4ZYE A;  2RNG A;  3L7W A;  1R71 A;  3LSP A;  2GXG A;  2VPR A;  4I76 A;  2O7O A;  3L2R A;  1AWC A;  5TRD A;  5L3E A;  1WQ2 A;  1YE9 A;  4DBQ A;  3GO5 A;  4KMU X;  3DWL E;  4XLA A;  4MQV A;  4HG2 A;  3PIO F;  1WJD A;  1IJW C;  3JRA A;  2K02 A;  4EJW A;  2HU9 A;  1TP4 A;  2E35 A;  3K4M A;  4E70 A;  1U0J A;  1O3Q A;  3CDI A;  2VQH A;  1QHG A;  4CCL A;  3W6J B;  3WGG A;  4F55 A;  4EM1 A;  2WAE A;  1E3O C;  1WJC A;  2LG4 A;  5ILV A;  1LFU P;  4CGZ A;  4FTH A;  3IWZ A;  4CSW A;  3I56 I;  3RIR A;  1P4W A;  2LY1 A;  2DK5 A;  3C1D A;  4HPQ A;  2K4J A;  3HHG A;  3IP4 B;  1BBY A;  3R6S A;  3W3C A;  4WXD A;  1WH5 A;  5M5X J;  2XGX A;  1IW7 F;  2OU2 A;  2EFP A;  4YFX F;  1A6Q A;  1RRJ A;  3MZY A;  1CF7 A;  3ZXS A;  2RVC A;  4FIS A;  2C6Y A;  2X1C A;  1FOK A;  1E3P A;  1XMX A;  3BR3 A;  4H4K C;  3CP2 A;  3PSI A;  4UVB A;  3TO9 A;  1W7P A;  4A0X A;  4RB1 A;  1MBK A;  1E2X A;  2DMP A;  2L02 A;  2Y48 A;  2DDB A;  1QZE A;  1GV5 A;  1G6N A;  4KN7 X;  3VWB A;  2CUF A;  6PAX A;  4HRI A;  1MBH A;  1TQM A;  1L0O C;  2ISY A;  1YG2 A;  3CUQ B;  2YPR A;  5CVJ A;  2XGE A;  3CUQ C;  2NNY A;  1E17 A;  2CUZ A;  2VN2 A;  3KPH A;  4PFO A;  2FD5 A;  1HA8 A;  3QOP A;  1G3Y A;  3DKY A;  5FKK A;  2IT0 A;  2PN6 A;  5J6X A;  1K6O A;  5B1A H;  2IRF G;  5FLX K;  2JUC A;  5CVR A;  3VFZ A;  1B59 A;  2AHQ A;  1D8J A;  2OQR A;  1ETK A;  3HRU A;  1P2F A;  3BR6 A;  1MSF C;  3X2Q H;  4NC7 A;  4A3M J;  2JA7 J;  2I5U A;  3JRF A;  1DGW Y;  1FLI A;  1FNN A;  4A3L J;  4Q47 A;  4HAM A;  2PMZ N;  1RR7 A;  3A01 B;  1UFM A;  4RGX A;  4GO1 A;  1R1U A;  2Y30 A;  4YIF A;  3BTL A;  3LSI A;  3GTO J;  2A6T A;  3LST A;  3HGY A;  3LOC A;  1TWA J;  1ETO A;  2XVC A;  4Q5S F;  2K40 A;  3OYM A;  3ONQ A;  4RB0 A;  3FXQ A;  3I71 A;  5IYB J;  4BHC A;  3KP2 A;  4O5V A;  2DQR A;  4UVC A;  2QZ8 A;  2HQN A;  5HLT A;  3H5A A;  5IPA A;  5B3S H;  4AIH A;  2HOE A;  3JAM Z;  4MTD A;  3HTS B;  2TDX A;  2GXB A;  4B09 A;  4CH7 A;  2QEN A;  2L54 A;  3HSE A;  1RC9 A;  4G6T B;  1OR7 A;  3S16 J;  5F27 A;  1ORK A;  3ZQ7 A;  5HVQ C;  2W1O A;  3OL3 A;  3R4K A;  4OAZ A;  4U7B A;  3GYH X;  3HB9 A;  5ILS A;  5LBQ A;  1ON1 A;  2KKO A;  1R6R A;  1A6I A;  1KGS A;  1P6R A;  3RTR A;  2H6B A;  5LHI A;  3I3L A;  1B9M A;  2FOW A;  1PP7 U;  3RYP A;  2KRC A;  3MEX A;  2EB7 A;  1DQU A;  4LLN A;  2VOP A;  1KU2 A;  3C18 A;  5GP9 A;  2D45 A;  2TCT A;  3QWL A;  2IS4 A;  1IAW A;  4GCV A;  2LH9 A;  2YS9 A;  3FKI J;  2XAG A;  3WGI A;  3RQI A;  1HBX G;  1K61 A;  3HYI A;  1B72 B;  3JRE A;  4HW0 A;  2G7U A;  4DQ2 A;  3GZ6 A;  3FDY A;  5F64 A;  5D5V B;  1REP C;  1LDK B;  3KP4 A;  2AQF A;  3UR3 C;  2WB1 A;  3WHB A;  2HR3 A;  2VKD A;  2WB1 N;  4NUB A;  4PJM A;  2PJR A;  4L5I A;  3U21 A;  1X2M A;  1G3S A;  5GAD J;  1ZRE A;  2ZXH A;  4M9X A;  4N9I A;  3JR9 A;  3ZQI A;  4L9T A;  1VND A;  4HQE A;  1D3Y A;  2CQX A;  4IRH A;  1LDD A;  1YLF A;  1EKE A;  4H0E A;  2QQA A;  4BS9 A;  4M9S A;  3RZD J;  2BOL A;  1MBG A;  2L4A A;  1RKW A;  3QQA A;  4I01 A;  2QUF A;  2XC7 A;  4IX7 A;  2L3D A;  4JP0 A;  1H89 C;  4U87 A;  1LEB A;  4EJO A;  2Y31 A;  2GIZ A;  2MC3 A;  1ONV A;  4UV9 A;  4EEF G;  2AXL A;  3T0Y A;  2KZV A;  3I54 A;  1QBJ A;  3EET A;  1IGN A;  5DCM A;  4BJ5 C;  1X1B A;  1IRG A;  1WRJ A;  1XD7 A;  1IC8 A;  4MFD A;  3DBR B;  1FX7 A;  2NVX J;  1BN5 A;  1FEX A;  1MH4 A;  2DDA A;  4PFP A;  2MH9 A;  2DI3 A;  2KP6 A;  1FYK A;  3RKX A;  1Z67 A;  3G1O A;  2CO5 A;  2DT5 A;  5FKN A;  4GYG A;  1FOX A;  2HKO A;  3G6E I;  4EJV A;  4BXU A;  3C2G A;  2LC2 A;  2CWE A;  2KHM A;  2WY7 Q;  3H9J A;  3KZY A;  4LJZ F;  5D4S A;  5GTH C;  1BI3 A;  1YRN B;  3GTK J;  2KIQ A;  2MYS A;  1I1S A;  4KIS A;  5FLX Z;  3ERM A;  1ZRC A;  1OQY A;  4IKF A;  5GPA A;  2WV0 A;  1OCT C;  4ESF A;  2M0M A;  5IP9 J;  2FQ4 A;  2MA3 A;  2HOS A;  2D5V A;  1DU6 A;  1GXQ A;  2F5F A;  3H35 A;  2E36 A;  3DV8 A;  1LPQ A;  2MC4 A;  3BTC A;  2HZD A;  5E3L A;  2X6X A;  3HSR A;  3M1C A;  1RUO A;  4XMY A;  2O9L A;  4BL0 B;  4HV5 A;  3V42 A;  1HST A;  2IGK A;  3H5N A;  2AXT C;  3OYG A;  2H1K A;  3MN2 A;  1I27 A;  3AFH A;  2ME0 A;  4C9Y A;  2QA4 I;  4AUX A;  2R3S A;  4E4H A;  4KNY A;  3E6C C;  2GAU A;  5FRO A;  1POG A;  4BKX A;  4LIU A;  4PJN A;  1SD5 A;  3F0C A;  5EJC A;  4CYD A;  3HTU A;  4LGW A;  4CYC B;  4IHS A;  1PYV A;  2Y2Z A;  1BI2 A;  1PVE A;  1XG1 A;  5JHF A;  4HLX A;  1KYZ A;  3J7A O;  5EGO B;  2FBK A;  3IRR A;  1FMV A;  1RR8 C;  3MWM A;  4WF2 A;  1W7P B;  1VQP I;  1WSU A;  1T95 A;  5K7Z A;  1BOA A;  4LB6 B;  2V79 A;  1X3Z B;  4Y4R A;  4RB3 C;  2V1N A;  2G9W A;  2VBY A;  1T8I A;  3P9I A;  3SFI A;  4NQW A;  5LFA A;  3HUG A;  2HQR A;  1IV6 A;  3BRO A;  3SQN A;  1XCB A;  2IEK A;  3ZR8 X;  1TZL A;  2PMU A;  3HOW J;  1IN5 A;  4OIN F;  4KT5 C;  1MSE C;  2EZK A;  4Y15 A;  3L2W A;  1T2K A;  2DFI A;  2QKM B;  3FMR A;  3Q9S A;  4IXA A;  1S6L A;  3FXJ A;  4KIF A;  1YQA A;  4CCJ A;  1X2N A;  4B4C A;  4AVP A;  5J3L A;  4WWC A;  1O7L A;  1XCV A;  1ZKG A;  1I6H J;  5IP7 J;  1YX3 A;  1MNE A;  4K2E A;  3V8J A;  1E3H A;  1GVD A;  3BTJ A;  3OR2 C;  1V54 H;  1Y6I A;  3MKZ A;  1JGG A;  3M8J A;  4HQM A;  2DN0 A;  2BYV E;  1UG2 A;  2LK2 A;  2BEO A;  3ZN0 A;  3Q0U A;  1B1B A;  2PLY A;  1MMD A;  3K6G A;  5DUI A;  2ZXI A;  1BW5 A;  5JLX A;  1EH6 A;  1ZG1 A;  5K7H A;  2W85 A;  4D7M A;  3NWT A;  2RC4 A;  4DGW B;  3D5L A;  2ZC2 A;  4KJZ A;  2FX0 A;  1SVL A;  2CFX A;  2WAD A;  1QQI A;  3RKQ A;  4RB2 C;  5EZH A;  1MNM C;  1Z7L A;  3I64 A;  4ZTF A;  3KLN A;  2JTV A;  1QO0 D;  4NHJ A;  1OKR A;  1PP8 F;  1RET A;  2L7M P;  1S5L C;  4UB8 C;  4LD5 A;  3BCA A;  3W2V A;  1NK3 P;  2ZFU A;  5AIQ A;  3SHF A;  1KQ9 A;  2M4G A;  4G6D A;  5E8I A;  3M8E A;  3O8G A;  3W2A A;  2K3P A;  3QYF A;  2LKS A;  3OYA A;  3SXY A;  4FE7 A;  4L5E A;  1ETY A;  2VB6 A;  4KIC A;  3FF5 A;  3K1P A;  3WTV C;  2PX9 A;  1VQ4 I;  1JI8 A;  2JWT A;  4B48 A;  1YHQ I;  1H88 C;  1Q1H A;  4MEX F;  1E0E A;  4PCQ A;  2GIV A;  4MTE A;  4E7S A;  2FMY A;  3P7N A;  2OV7 A;  2DA3 A;  5BPI A;  1U5T A;  3E0J B;  1MZB A;  1HLV A;  4A69 C;  5E3N A;  3TMO A;  2OTJ I;  4R79 A;  3R61 A;  4E7K A;  4KMF A;  2R5Z B;  2X1E A;  3ZQQ A;  2PEX A;  5HS8 A;  4FT8 A;  2FBH A;  2PJR B;  5B5E C;  1I3A A;  3FMS A;  2OUM A;  2L7F P;  3B73 A;  1JT0 A;  3FWE A;  2NYX A;  4ZYA A;  1R5I D;  2PJP A;  3V8L A;  3GBG A;  2A6E F;  5H20 A;  2JA8 J;  1ZGA A;  2LY9 A;  3EUH C;  5GAE J;  1JUP A;  3OYI A;  3GEZ A;  1GHC A;  1FMW A;  2KIS A;  4X0G A;  2VQG A;  1FOW A;  2GZW A;  2VE9 A;  1XB4 A;  2LSO A;  1I6X A;  2ZSH B;  3CCM I;  5FD5 A;  1HQC A;  1APL C;  1R7J A;  4KDP A;  3FKJ A;  3ABU A;  1WJA A;  2DT7 B;  2CUJ A;  4PUS A;  5DCM B;  3DU5 A;  4IF4 A;  2L9N A;  2M4K A;  3S93 A;  3N97 A;  2JQ7 A;  2FE3 A;  2L2O A;  3TOA A;  3M7G A;  1LVK A;  4R1H A;  2E5N A;  3U1D A;  3ULQ B;  4L9J A;  2O3F A;  2UWM A;  4G7Z F;  2W00 A;  3KLO A;  3IH4 A;  4KT6 A;  9ANT A;  4L0Y B;  3JTH A;  1ZLJ A;  3FK6 A;  1ZGW A;  3QOD A;  3B6A A;  4C3H J;  3C3W A;  4FAS D;  3KEY A;  4BXF A;  2X6O A;  2V1U A;  2F4O B;  3HKZ A;  4UUV A;  1W36 D;  5J47 A;  3HJE A;  2PG4 A;  2UZK A;  2LF7 A;  3HKZ N;  1XSD A;  1RIO H;  2P5K A;  1OFC X;  3EYY A;  1ETQ A;  1V3F A;  1YJW I;  2A3S A;  2DA6 A;  2CUE A;  5IYD J;  4LG3 A;  2XPV A;  3R0A A;  4XRM A;  2OCE A;  4AD9 A;  1HC8 A;  1GUU A;  1PDN C;  2DYR H;  4JX6 A;  4M3G A;  3LFK A;  2EA2 A;  1R22 A;  3S3M A;  1I39 A;  3A0H C;  3V7S A;  4ZDP A;  3BPV A;  4BBR J;  3F21 A;  4UY8 I;  4S05 A;  1UJ8 A;  4G9Y A;  2GA1 A;  4X1E A;  2W82 A;  1YIT I;  4N4N B;  4QPO A;  3TDZ C;  3ZQL A;  1VFC A;  4IHV A;  1AKH B;  5D8L B;  2OBP A;  2HYJ A;  3PUF A;  2LNB A;  4XK4 A;  1WFX A;  3FZV A;  2HZT A;  3CP8 A;  3I4N J;  1F43 A;  3BG5 A;  4OIR F;  2HXI A;  1MGT A;  4XOR A;  3BPX A;  5B66 C;  3EQL F;  4BGD A;  4ENN A;  4BAC A;  2HDD A;  4N9H A; 
#chains in the Genus database with same CATH homology
 5BNG A;  3S17 J;  5F0C A;  5IYC J;  1LE8 A;  3BR1 A;  1RPW A;  4FIS A;  2M9H A;  2M8G X;  5FKM A;  3Q0W A;  3BR3 A;  3S1R J;  4FCY A;  4XRS A;  1MBK A;  2MGQ A;  2K9N A;  2DMP A;  2EZL A;  1GV5 A;  2K9Q A;  2CUF A;  4UUS B;  1MBH A;  3IH3 A;  3GTL J;  1ITY A;  1JT6 A;  3DEW A;  3BG9 A;  2XGE A;  2FD5 A;  1UMQ A;  5FKK A;  5J1R A;  2GM4 A;  1TC3 C;  2DA7 A;  3HOU J;  2HOA A;  2AHQ A;  4C2M J;  2DA4 A;  1B8I A;  1GDT A;  3JRH A;  2JA6 J;  5FLV A;  3TP3 A;  2NS8 A;  1ETK A;  2E1O A;  2NOG A;  3BR6 A;  1JTX A;  1IG7 A;  1LFB A;  1MSF C;  4A3M J;  4Y7N J;  2JA7 J;  1OJL A;  3JRF A;  3O8H A;  4A3C J;  1R9T J;  1CQT A;  4IEJ A;  4A3L J;  5J1U A;  3BR2 A;  4DZJ A;  5EDN A;  2PMZ N;  3BQZ A;  1RR7 A;  3CCY A;  1NK2 P;  3A01 B;  2M2E A;  3HOY J;  1ZR2 A;  1Q1V A;  2Y30 A;  3BTL A;  3GTO J;  1IUF A;  5IOY A;  3HGY A;  3LOC A;  2ECC A;  4W1U A;  1TWA J;  1QRY A;  1ETO A;  1AKH A;  1JTY A;  2K40 A;  5K7F A;  4DZP A;  2MG4 A;  5IYB J;  1JJ6 C;  4A3J J;  1JUM A;  3H3V K;  5IPA A;  2HXO A;  2R0Q C;  5EG0 B;  3HBL A;  1ZR4 A;  3CMY A;  4G12 A;  2K9S A;  4MO7 A;  5EZG A;  5E3O A;  2ZB9 A;  4XIC A;  2KDZ A;  3OSF A;  3S16 J;  5F27 A;  1ORK A;  4IHX A;  2R5Y B;  3HGG A;  2NS7 A;  3JRD A;  4IHW A;  2XGC A;  3S1M J;  2DMT A;  3HB9 A;  3FIW A;  4QTR A;  3HOX J;  2LD5 A;  2H8R A;  3HEF A;  1A6I A;  2E19 A;  4V2G A;  2EZH A;  4JX4 A;  1RES A;  5M3M J;  1HCR A;  3A03 A;  2ME6 A;  2X48 A;  2YU9 J;  4HNV A;  1G2H A;  3NAR A;  3ZQC A;  4UUS A;  4AYB N;  5M5Y J;  3SJM A;  3E7L A;  4LOC A;  1TWH J;  5GP9 A;  2WAQ N;  1UHS A;  2TCT A;  3FKI J;  1Z77 A;  2YS9 A;  1ENH A;  2Y9Y A;  3RQI A;  5FJ8 J;  1U78 A;  2ELK A;  2LR8 A;  1K61 A;  1P7J A;  1H8A C;  1B72 B;  4A3I J;  2JJ7 A;  3JRE A;  4A3G J;  2DMU A;  3FK7 A;  3VPR A;  5FLM J;  4MLO A;  5E3M A;  1AHD P;  3K7A J;  3WHB A;  2OF7 A;  4XID A;  2WB1 N;  4D7N A;  1A5J A;  1X2M A;  1FIP A;  3A01 A;  3JR9 A;  4M3E A;  3ZQI A;  1PUF B;  1VND A;  2GLO A;  2QF7 A;  2CQX A;  3JRC A;  5F08 A;  3JRI A;  3PM1 A;  4I6Z A;  2XPW A;  3HM5 A;  3RZD J;  1MBG A;  1JKR C;  3BQY A;  1RKW A;  3QQA A;  4UUT A;  2CRG A;  2L0K A;  2L7Z A;  2Y0S N;  3LNQ A;  3I4M J;  3PO2 J;  5HOD A;  4D5F A;  4JP0 A;  1H89 C;  2Y31 A;  4EEF G;  1Y1V J;  1IGN A;  2COB A;  2LKX A;  3H0G J;  1XS9 A;  5F0H A;  3C2B A;  2R5Y A;  1IC8 A;  4MFD A;  5EF6 A;  2ID3 A;  4Y52 J;  2NVX J;  2XB5 A;  1FEX A;  1MH4 A;  1BW6 A;  4JYK A;  1ETX A;  3HOV J;  3G1O A;  5FKN A;  2EBI A;  3RZO J;  2JK3 A;  2DMN A;  2NVQ J;  2DA5 A;  2IBD A;  4M3B A;  1YRN B;  3GTK J;  1WGX A;  5F04 A;  3BG3 A;  5C4J J;  4V2F A;  4C3I J;  1QVU A;  1JJ8 C;  4MIM A;  5GPA A;  1JKP C;  1I50 J;  1OCT C;  1B72 A;  1HDD C;  1IDY A;  5IP9 J;  1BL0 A;  3BTI A;  2FQ4 A;  5C4X J;  2W48 A;  2HOS A;  2D5V A;  5EEA A;  1DU6 A;  1U9N A;  2X9D A;  3BTC A;  2R93 J;  5E3L A;  1SAN A;  2AO9 A;  3BR0 A;  3LSG A;  1QVT A;  2R92 J;  2O9L A;  1EF4 A;  1PUF A;  3JRB A;  2H1K A;  2M34 A;  4C3J J;  2FJ1 A;  2GBY A;  4BBS J;  3MN2 A;  3TED A;  1WH7 A;  2ME0 A;  4AUX A;  2NVY J;  1DU0 A;  4A3F J;  2WV1 A;  1POG A;  3OOU A;  4MFE A;  4BKX A;  5F1J A;  3F0C A;  2VI6 A;  2E2H J;  4BY7 J;  3D1N I;  1LE8 B;  3UKG A;  3LSJ A;  4FE4 A;  5FKL A;  1TWF J;  4CYC B;  3ZQG A;  2Y2Z A;  3GTP J;  2QCO A;  2O8K A;  1XG1 A;  3NAU A;  3HOZ J;  1T56 A;  2RAE A;  2P81 A;  5EGO B;  3S15 J;  2VKV A;  4DYR A;  1BA5 A;  1XC5 A;  3K2A A;  5K7Z A;  1JKO C;  4RBO A;  4BY1 J;  4M3D A;  1MBJ A;  4W97 A;  2IAI A;  3SFI A;  2DJN A;  3S14 J;  2E2I J;  3PO3 J;  1ZTR A;  3CDL A;  1IV6 A;  1NTC A;  2HOT A;  3TW6 A;  2IEK A;  3BR5 A;  3HOW J;  3M4O J;  3DCF A;  1MSE C;  2EZK A;  1IRZ A;  2XGD A;  2B63 J;  1B8I B;  4DW6 A;  2LVS A;  1ETV A;  2R7Z J;  3GTJ J;  1YRN A;  1TWC J;  5GPC A;  1X2N A;  1QPI A;  1MBE A;  4B4C A;  4QIW N;  3JRG A;  5J3L A;  1BJZ A;  4AC0 A;  2LP0 A;  2JA5 J;  1ZKG A;  2JN6 A;  3S2D J;  3OSG A;  1O4X A;  2E2J J;  2I10 A;  5IP7 J;  1I6H J;  2MSY A;  3M3Y J;  1GVD A;  3BTJ A;  3QPL A;  1GV2 A;  1JGG A;  2G0E A;  2XB0 X;  2LLK A;  3FIS A;  1GT0 C;  4A93 J;  2DN0 A;  1S7E A;  1UG2 A;  2LK2 A;  2EQR A;  2XRL A;  4IHY A;  1JKQ C;  3GTQ J;  3OIO A;  3Q0U A;  1VI0 A;  3SDG A;  1X58 A;  1BW5 A;  3QPS A;  2L9R A;  5JLX A;  4XRS G;  5EG0 A;  5C44 J;  5K7H A;  2KT0 A;  3GTG J;  4D7M A;  2TRT A;  1ZQ3 P;  3Q3S A;  2FX0 A;  2CJJ A;  4QSH A;  1HDP A;  1AU7 A;  3RKQ A;  2MW8 A;  5EZH A;  3S1Q J;  1MNM C;  4CYC A;  4B3A A;  1W0T A;  4JX5 A;  3Q0V A;  1RET A;  1VF9 A;  2L7M P;  5EGO A;  1NK3 P;  4GFB A;  5JLW A;  1MBF A;  2EH3 A;  2OPT A;  5DS9 A;  4X6A J;  3O8G A;  4FE7 A;  4L5E A;  1ETY A;  1P7I A;  1T33 A;  3MKL A;  1WCM J;  2ECB A;  2CU7 A;  3GTM J;  2JWT A;  3W6V A;  4A3E J;  2Y9Z A;  1H88 C;  4ABZ A;  3LSR A;  3ZOB A;  3G1M A;  3HDD A;  2DA3 A;  2NVT J;  2N8G A;  4M6V A;  5EYR A;  1HLV A;  4A69 C;  4DYQ A;  1OCP A;  3MVP A;  3IH2 A;  5E3N A;  3S1N J;  1SFO J;  5IP6 A;  2HQ5 A;  2R5Z B;  2XPU A;  1TWG J;  4BXX J;  2VKE A;  3IV5 A;  2L7F P;  3CQZ J;  3BT9 A;  1JT0 A;  5FKO A;  2M0C A;  1F36 A;  5J1Y A;  3GBG A;  2JA8 J;  3WHC A;  4D5C A;  2LY9 A;  2DA1 A;  1JUP A;  5M5X J;  3A02 A;  4A3D J;  4M3F A;  5F0F A;  2ID6 A;  3B6C A;  4B1R A;  4S0H B;  1MH3 A;  3G1L A;  1APL C;  1WI3 A;  2DA2 A;  5C3E J;  1WPK A;  4NDL A;  1HOM A;  3IH4 A;  1JUS A;  9ANT A;  3TW7 A;  1ZK8 A;  3FK6 A;  1ZGW A;  1I3Q J;  3B6A A;  4J19 A;  3TP0 A;  4C3H J;  4A3B J;  3S2H J;  2X6O A;  5M3F J;  1FIA A;  1FTZ A;  1HF0 A;  3LSP A;  1RKT A;  2VPR A;  2LTP A;  3HKZ N;  4I76 A;  2O7O A;  1OFC X;  1ETQ A;  1FTT A;  2DMQ A;  5DTD A;  1IDZ A;  2LFB A;  1Z0X A;  2DA6 A;  4A3K J;  2CUE A;  3ZQH A;  5IYD J;  2XPV A;  1Y1W J;  4XRM A;  2VUM J;  1D5Y A;  1IJW C;  1GUU A;  4RDU A;  3JRA A;  4JX6 A;  4M3G A;  1W0U A;  4BBR J;  2DTZ A;  2JMW A;  4X1E A;  5M5W J;  1VFC A;  3ZQL A;  1U9O A;  4IHV A;  2R5Z A;  1AKH B;  1E3O C;  2HYJ A;  1LFU P;  3ZQF A;  4FTH A;  4XK4 A;  1ETW A;  2CQQ A;  2XSD C;  2YUS A;  1K83 J;  2HI3 A;  5IOZ A;  2EZI A;  3I4N J;  1F43 A;  3BG5 A;  2HXI A;  3L1P A;  4DYC A;  1FJL A;  1U8B A;  2HDD A;  1WH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...