2VQLA

Crystal structure of porb from corynebacterium glutamicum (crystal form iii)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
76
structure length
76
Chain Sequence
LSPQYNWVACGILEGGLKAAGVLEEGQYNRELAEAIAAKGEGFWTTQFPQIGDWNEDQAAALADRAQTCGLVKADT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Putative Alpha-Helical Porin from Corynebacterium Glutamicum.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Membrane protein
molecule keywords UNCHARACTERIZED PROTEIN CGL0972
total genus 26
structure length 76
sequence length 76
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11565 PorB Alpha helical Porin B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1280 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vqlA00
2VQLA 2VQHA 2VQGA
chains in the Genus database with same CATH superfamily
1B9MA 4IO9F 2GQQA 3GX4X 2NRAC 1O3QA 1A35A 2GXGA 1IXSB 4DJAA 3CMMA 2ME6A 1JUSA 4WXCA 3S1MJ 1K61A 2NNNA 5C4JJ 2IS2A 4BACA 3HSEA 1NK3P 2WAQN 3CDIA 3DFGA 2L7FP 1HKSA 2BV6A 4U0WA 3ZQFA 2O8KA 3IH2A 2HOAA 1OCTC 3MMYB 2RC4A 4IHWA 1FTZA 2M9HA 3C2GA 3UNGC 1UHMA 5F0CA 1JTYA 2F48A 2XAQA 1O3RA 3FXKA 1SFUA 1RR7A 5GPCA 2KJCA 3FISA 2L7KA 2BY1A 2M0CA 3L9FA 2XUBA 1YRNA 2QA4I 3A01B 5K5RA 1OQYA 3GFMA 1WI3A 2BVLA 2M4GA 1Z7LA 4CDGA 4E7JA 5CVJA 5E3NA 4F3QA 2O0YA 4HX4A 1HW1A 1QHGA 3LMMA 1P92A 3OOPA 1T38A 2L4AA 2RQQA 4F52A 4XLPF 3L2QA 1KYWA 3HHGA 1MD0A 2OBPA 4BE0A 3WG9A 2ISYA 2BZTA 3CJNA 3HOSA 3DF8A 1WJBA 1TWAJ 2ADUA 3ULQB 3SXYA 5ICCA 5GAHJ 5HS8A 1NG7A 3GTQJ 3J80K 2OV7A 2GXAA 2OF7A 1N25A 4A2UA 3J7AO 2HU9A 3FDYA 4L5JA 1ETWA 1FPQA 1S7AA 2EBIA 2ZSHB 4LLLA 1BL0A 2Q8KA 3KX2A 3CCRI 4HBLA 4B44A 2VBZA 1MMSA 5F04A 5FO5A 5DM7F 4ZYHA 3LFKA 1Z9CA 1YOVB 2JK3A 3TW7A 3SEZA 3OYDA 5FJ8J 4U0YA 1TNSA 2AQFA 3EUAA 3M1CA 4M3BA 4XK4A 2ICWG 2PFBA 4ENMA 1VQKI 2XROA 1FBQA 1NHAA 1ODDA 1WQ2A 2XKOA 3GZNB 3K70D 4GRIA 5EZHA 1R9TJ 1T39A 2V7FA 1CF7B 4BS9A 1Y1WJ 4L18B 1MSFC 3ZMVA 1J7KA 5EDNA 4W97A 1R4MB 3P9IA 1JGSA 2LVSA 3M07A 3H36A 2EWNA 2Y30A 4I2OA 1BOAA 3HGGA 4PK4A 3I56I 4NC7A 3VOEA 2PLYA 4YFNF 2W82A 1Z3YA 5L3BA 5JVTA 4U88A 1UCRA 2M1BA 3ABTA 2ZMEA 2MW8A 4FX4A 1UB9A 3BR1A 3K0LA 5KAFC 2ZFWA 3JTGA 3RYRA 3RPQA 2WBMA 2IAIA 4DNCA 1YJ9I 3FXUA 4G94A 1Z05A 3K2ZA 3WU0A 3HZJA 1XC5A 1B8IA 4WXDA 5H2FC 1Z1DA 1FT9A 4GFBA 1Y39A 3CP2A 4XKBA 1IN8A 2R3SA 4E70A 2VODA 2Y0MA 1QZZA 5LFAA 4M6XA 2O03A 2V1XA 4A3EJ 3DBHB 2KDOA 3DKXA 4GO1A 1TZLA 2P5KA 4BDYA 2X48A 2P7VB 3ASNH 9ANTA 4AC0A 4IVNA 3DPTA 4B48A 1FLIA 3FM3A 1ZLKA 5D4RA 1ITYA 1JXSA 1XSVA 2CUEA 2O9LA 1KZHA 3KP3A 2MFZA 2MLGA 5CYVA 3E0JB 3TQNA 3ZR8X 1FEXA 1MIJA 2HYGD 3K2AA 2HQRA 3DLAA 4MTEA 3P7NA 4J00A 2ME0A 3K4KA 3OS1A 1FSHA 1ZG5A 1MMNA 3P9KA 3KFWX 3JAMZ 2F5EA 1F5TA 5IT9K 3BQYA 2X1CA 1I3QJ 2XSJC 2Z1DA 1UHSA 1G2HA 2FUG2 1U9NA 4XKVA 3NAUA 3S93A 4UUSA 1TWFJ 2CH0A 3V8KA 4AIDA 2K85A 1VQ5I 3G6EI 4AUXA 3PIOF 1AKHA 1XDSA 5K1YA 3HEFA 3OL3A 3WE2A 1MH3A 2Z3YA 3JRBA 5BNGA 4O6JA 5LLQA 4Y3OA 2XB5A 3PO2J 4BQOA 5IYCJ 3F8MA 1BA5A 3PNYA 2K27A 4JX6A 5L3EA 2LKPA 4DYCA 3T1BA 3OIPA 1B9NA 4KT6A 1TP4A 4UB6C 3BTIA 4DGWB 1IZ1A 4EM2A 4AVPA 1VQ8I 1TT0A 1JUMA 2IXSA 3OS2A 1K4SA 2HTJA 3S2DJ 1W7PD 2D1VA 2XF5A 4A3DJ 1AA7A 5DV5A 3BP8A 5HVQC 3HG9A 3H3ZA 3A1YA 2LDUA 3R6SA 2E7XA 2KJBA 3R4KA 2DW4A 1P9QC 4G6DA 1TL8A 2JMWA 2A69F 2E71A 2L2OA 1QO0D 2QKLB 2E36A 3HBLA 3HPGA 1R00A 5HLTA 1PYVA 1FP1D 1M1EB 4UHTA 2VL8A 1EH8A 2FBIA 4M74A 2HXOA 2E5ZA 2HS5A 1ZGJA 4Y17A 2ZXHA 1MDMB 1FIAA 2STTA 2QF7A 2DT7B 2LTPA 4OMZA 4OIOF 3R0AA 1G3TA 4AVZA 1SFKA 4MNUA 2ZJ2A 5DUIA 4X1EA 4HNTA 4C3HJ 2PQ8A 3KLOA 3HKZN 4UUVA 5H6RA 2R7RA 3BT9A 1FMWA 1V4RA 3CMEI 4Y52J 4O5VA 2K3PA 2DFEA 1G3WA 1TBXA 1ZG1A 1VQOI 3JCUC 2ELHA 4BEHB 2QEXI 2X6OA 2DYSH 3MEXA 4F93B 4UV8A 1QRYA 1IXCA 3HB9A 4IXAA 2ECCA 4JP0A 2DT5A 5HLIA 1DQUA 1OJLA 4F91B 1E3HA 4R1HA 3TO9A 3F21A 4I6ZA 1DU6A 1IRGA 4L5IA 1LFPA 3DCFA 2LKSA 3L1PA 1ZGAA 4WX9A 2RNGA 3RJPA 2ZCWA 4BGDA 1SANA 2DDAA 4G7HF 2P0WA 3CQZJ 4P9UA 3S16J 1K6OA 3N97A 3GMEA 1GV5A 2KZGA 4UNOA 3OWTA 3S1RJ 4HEA2 1X19A 4ZDLA 5IOZA 3F9KA 5B5EC 5ICGA 2NAZA 2E2HJ 2DA2A 3JW4A 3BPVA 4Q48A 1U0JA 1F43A 2A61A 4ZDPA 2O7OA 2EIMH 5EYRA 5LEKA 4A3JJ 2KMUA 2LMDA 1PJRA 2PMUA 2LF7A 2BBYA 2H1LA 4Q47A 1MJ9A 2GM4A 3B02A 2ZO4A 1WH7A 3BWGA 2EH3A 3DBLB 5DCMA 4XBFA 2PJPA 1LFBA 2KIQA 4D7MA 4HLYA 4G7OF 3MN2A 1DUXC 3MQ0A 5K5OA 5DD4A 2UXNA 2L54A 3H3UA 2V6CA 3HSRA 3G73A 2VUMJ 5M3MJ 3LSRA 2JRMA 2HNHA 4NQWB 2IS1A 2XRNA 3PFYA 2CJJA 4OMYA 2XF6A 4ESJA 3U9GA 2JRTA 3SFZA 3JRGA 2WV0A 3UR3C 2CQQA 1POGA 1BN5A 3WU1B 2NVTJ 3LQRA 2P8TA 4OIPF 3GBGA 2QUFA 5CVVA 2OTJI 3J81K 2F4IA 3CCQI 3W2WA 1SC7A 3FMRA 3KP6A 1DDNA 1UELB 3AG4H 3J7YJ 1FOKA 4L0YB 4CO8A 4LLNA 3WTWC 2WAFA 2KRHA 2OCEA 1DPRA 2L3DA 3Q9SA 4CCMA 1VTNC 2DK8A 2XSDC 4P96A 2YUSA 4D9JA 4K2EA 1YW9A 3OYLA 2BE5F 2NXNB 3LA2A 3KETA 3HKZA 1E3OC 1WJAA 4B1RA 2IW5A 2FSWA 1XDUA 3I0TA 2BY2A 2JA7J 4UY8I 4XN3A 2XAUA 2ISZA 2RQPA 5J3LA 4XRSG 1FYLA 2X1DA 1V3FA 4GXOA 4EEFG 1IV8A 3H5AA 4HX8A 1Z77A 1MDMA 3U21A 2M8EA 1T33A 3CUQB 1XCBA 2G9WA 2QCOA 4RAZA 2CFXA 5IT9Z 1KONA 4EATA 4DBRA 5AIPA 1FBUA 4E7IA 2DPDA 3S1QJ 4A3BJ 3E1SA 4UUTA 4ENKA 4N4OB 1GLNA 2HXIA 4XKWA 4ZTFA 4F7ZA 3TBIA 1D1CA 2GOMA 1K78A 4NC8A 3FXLA 2FXAA 1WJCA 1XCVA 4WXHA 3K4CA 2LK2A 2CWEA 2RAEA 2GAUA 1LDJA 4FX0A 5FLXK 3B6AA 2R7FA 1OYYA 1VQPI 1V5FA 4KMFA 3WTZA 3HTUA 2FMLA 1LEAA 4E7LA 1R49A 1QQIA 2VQGA 4DYQA 5FLXZ 2D45A 4NHJA 5B66C 3G71I 2X0LA 5ILVA 3CJQB 3DEEA 4CCOA 1MH4A 2DFHA 3GFLA 5IPAA 3EUHA 1V5EA 1XSXA 2R5ZA 2IA2A 3HTSB 2MG4A 5C3EJ 3F8CA 3CMAI 4EGZA 3AAFA 2HYFA 4PFOA 3OY9A 4BXFA 1DGRM 1ETQA 3D5RC 2ZJRF 4F55A 1V55H 3M3YJ 4HYEA 2DA5A 5HDGA 4IZZA 3BR5A 2MD5A 2DTZA 2ESHA 5D6FA 3MKZA 2J5PA 3QRFF 1Y8QB 1G3SA 2FOKA 4BY7J 3HGYA 2XPUA 1RRJA 3BZKA 1IC8A 4GGGA 3GWZA 2H6CA 3ABKH 4U7BA 2HDDA 1D5VA 3ABLH 2DMQA 1IRZA 4KIGA 1BJZA 3TW6A 4C2MJ 1N78A 3VYUB 1I6XA 2CQ7A 2LSOA 1IDZA 2A6TA 4EJVA 1LVAA 2EA2A 2P4WA 3KP7A 1HA8A 2JTVA 3D0SA 3FK7A 5CKTA 4L9TA 3GTJJ 2LP0A 2DOEA 1ON2A 3DU5A 3HM5A 4NNJA 4WWCA 1JKOC 1G3YA 4P55A 2H6BA 4CSWA 2KLOA 1G59A 2VIXA 4B4CA 4JX5A 1YJWI 1KQ9A 4CZCA 1TWCJ 3OS0A 3REOA 2KZVA 1I5ZA 1RC9A 2LY1A 4GCVA 3GFJA 2VBYA 1QZEA 3QPTA 4DIQA 1ZR2A 1ZK8A 1LKXA 2BW3B 3RIRA 4RAGA 2Y2ZA 3EYYA 4DYRA 3L2RA 2XAFA 4XIDA 3ECHA 2R92J 2Y0SN 1VZ0A 1VQ7I 2CSOA 3HRUA 3OSFA 1I6HJ 3RPUA 5DCFA 3BR6A 2FBKA 2FOWA 2IGOA 5E1ZB 5L3GA 1JGGA 4LG3A 2NVUB 2ZBKA 5M5WJ 4I99C 2DMNA 2E60A 2EQRA 2YPRA 1HW5A 4HV6A 5F1JA 2Z9OA 4PCQA 2YS9A 3PO3J 1RETA 4XSXF 4EJTA 2OQRA 3IH4A 2JA6J 3K4BA 3C1DA 4IHTA 1SMYF 2HPIA 5BS6A 5LGUA 1I50J 1TWGJ 4PJ0C 4J01A 2DDBA 3H35A 4BEHA 1IGNA 2YX4A 2EPFA 5IYDJ 4YG2F 2AS5F 2K9NA 3BJ6A 2Q0OA 1EJ9A 5E8GA 2GA2A 4XMYA 1WCMJ 2DMPA 5FGMA 3VEPA 1B6AA 5CJ9A 1OR7A 2M7AA 3T5XA 4QLCU 5LRRA 3OYNA 3CC4I 3IP4B 3BG7A 3JRCA 2UXXA 1RKWA 1B8IB 2E1CA 2MA3A 4RLQA 3VPRA 2BHZA 5K7FA 5BOXA 3GTLJ 1L0OC 2VASA 2DMTA 2CV0A 3AKZA 3LSTA 2PJRB 3RZOJ 3FMQA 1XB4A 2NVYJ 3CJRB 3B73A 2W4SA 4YIIA 3KEQA 2W00A 3DTEA 1MNMC 1TNTA 2AQEA 3K1PA 4L5EA 5GTHC 4AYBN 2IGKA 1XGOA 5E17F 3ZQLA 3SZPA 1TQMA 2Z16A 1FX7A 3S3MA 2P5LC 3JRHA 2QENA 2M8GX 4MEXF 1TWHJ 1X1DA 3HOZJ 4BJ6C 3JRDA 1OCOH 4XQFA 4C2TA 5E1XA 2A68F 2JT1A 3F72A 1HLVA 1S7OA 2O5RA 1XGNA 3I54A 1Z67A 2XASA 1KQ0A 2Y48A 3B6CA 4S0HB 1OISA 4ABZA 4JX4A 2JQ7A 3BZCA 1WWXA 3IWFA 1BIBA 3QU6A 1VNDA 1Z6RA 4HOBA 2J5OA 1W1WE 3E6MA 1H0MA 2E1MC 5FKKA 5EEHA 1E3PA 4P1WA 4A0ZA 1I39A 3CCSI 4MO7A 4IRHA 4EVIA 1MBHA 2R7TA 3G2BA 3CCEI 2V1UA 3W2AA 4A6EA 4ZH4F 4CZZA 3FM5A 1XMXA 4HA8A 2D2WA 2UV1A 1BC7C 2HVQA 1MBKA 2ZJPF 2ZSIB 5GAEJ 1FIPA 1Z7UA 1A5JA 5KHDA 3FXJA 4HNVA 2HZDA 4RLFA 2LYCA 1U8BA 2AXTC 1GXQA 1BR1A 1OYIA 4H0EA 3BC8A 1OCRH 2LF8A 2XAGA 3LL7A 2P5VA 2QQ8A 2K7LA 4LJZF 5B1AH 1SVOA 1XG1A 4CA0A 1SFXA 3KP4A 2LBFB 4DOZA 3KP2A 1U2WA 2X6YA 3T0YA 1R5ID 5D6EA 1YTYA 3MZ8A 3S15J 1WI9A 1IJWC 3BLYA 5IYBJ 3OYMA 4MHGA 1ZKGA 1Y56A 2XGDA 2VJJA 2X85A 2XAHA 1WPKA 3PQJA 5TJJA 1DU0A 1ZELA 4I7HA 1XX5A 1SVMA 3KYDB 4HQMA 2K9LA 3N4MA 2XGCA 2NOJB 3SDBA 3FBNB 3GF2A 4ZZDA 1X4OA 3Q0WA 4L0ZB 2CRGA 3L2VA 1IRFA 4OAYA 5HLHA 2W48A 1VQ4I 5FB2A 3S14J 3W6JB 3QYBA 1E2XA 3RDIA 2R7ZJ 3HRSA 3G1LA 2FNPA 1S8NA 5KVRA 3S17J 3ERED 3VYRB 1BBYA 2VBWA 2XPVA 1YIOA 2VKVA 3OYAA 2JPBA 3BTCA 1UZCA 1XN7A 2KIUA 1D1BA 1QNTA 2YSRA 3ZMUA 4BJ5C 4ANJA 1QBJA 1HKQA 3TOBA 5M5YJ 1K7AA 3PM1A 3S32A 4C3JJ 4ENNA 3O8GA 3DXJF 1KQ8A 4N9IA 3QOEA 3CESA 4KICA 2CV1A 2DXIA 4PJNA 1F4KA 3BG5A 3LSMA 4C9YA 4LG0B 3E3VA 3P9CA 1L3LA 1BW5A 4IHVA 4MFEA 3CLOA 2PI0A 2VKEA 2DO7A 3BG6A 2XGEA 4XRFA 3D1NI 4A6DA 4CICA 4ASNA 5A2QK 5JFRA 1GVJA 2IS4A 2CW0F 3R61A 2VXDA 1IN5A 1W7PA 4BYYA 3QODA 2IJLA 2QZ8A 3QPSA 3IUOA 1C0WA 4AIKA 2EIJH 4AIHA 3ZOBA 3CF2A 1RNLA 2TRTA 3H1CA 3WGHA 3UKGA 4M3GA 2BY3A 2GZWA 1MJAA 3GUDA 1Z91A 1J5YA 4KIBA 2F5FA 4IHYA 2C6YA 5B3SH 1Q1VA 4PJLA 3SZGA 5KNLA 5JHFA 5L3CA 1B59A 3LA7A 4M3FA 3RKXA 3WGIA 2CQXA 1NH3A 1J9IA 3M4OJ 3RI4A 2VQHA 3I9V2 5LD2C 2P81A 3V7RA 2K86A 4BHPA 2MYSA 2MGQA 1JT6A 5DYMA 4FQGA 1OCPA 1S5LC 3IAM2 1SFOJ 5IOYA 4X6AJ 4E7HA 4KIFA 2FU4A 2BW3A 3CUOA 1EF4A 5L3FA 1HKTA 2XVCA 5EJCA 1GVDA 2L5QA 1KU7A 4PGHA 1X1CA 1IRXA 3ZQGA 1X58A 3JTHA 2VJ5A 1RIOH 1BR4A 5KK1A 1RKTA 1AOYA 2ZB9A 1J75A 1Z21A 3BY6A 2K3FA 1NK2P 1RUOA 1O7FA 1QPIA 2I8DA 2O61A 1MNEA 3BOQA 3NARA 1Z6TA 2JPCA 1O7LA 1J09A 5J1YA 2E34A 1WGXA 4XSZF 2IA0A 3IKVA 4QWQA 4XLEA 5FLMJ 4CGZA 3W6KB 3V4GA 4I02A 3H0DA 5C4XJ 3J80Z 2MH2A 3ZQIA 5E1WA 4U7DA 1U8RA 3E6CC 3MZHA 3PNTA 4ZDOA 3FBIB 1BJAA 1MBEA 2R7WA 3BDDA 2KPMA 2M45A 6PAXA 3GCMA 2DK5A 1U78A 3W6VA 3ML6A 2A5YB 1F36A 2M7BA 2TDXA 1D1AA 2CYYA 1ZAOA 4IOCF 4HV5A 4GDFA 4I98B 4KN4X 1R58A 3HL2A 2RGVA 3MWMA 3EQLF 1LVKA 3D5SC 1JI8A 2DA3A 2V9PA 4ESBA 3G4SI 2PJRA 1PVEA 2JJ7A 2PN6A 1BI1A 4HW0A 3ZMSA 2WB1N 3COAC 3KZIC 5IP7J 2EZIA 1TC3C 2OQGA 5FRNA 3GO5A 3JR9A 1LDDA 2AXLA 1JKRC 2AHQA 1A31A 3GW2A 3DEWA 3OYBA 3GFIA 4E7SA 3F8BA 2Q2EA 2R4GA 5KAIC 2VB6A 3KE2A 3FXQA 1FZPB 5DEQA 4A3KJ 2IGNA 1A04A 3K4LA 4XR6A 1X2NA 1SD7A 2E1MB 3H5NA 4DZPA 1Z0XA 1HSTA 5BQTA 2JA5J 5J4VA 1IN7A 2YX7A 3O8HA 5GPAA 1VQ6I 4N4NB 3ZQHA 4B8XA 2I10A 5K7HA 3J81Z 3C7JA 2EV0A 3PIPF 2D5VA 2HZTA 3RKQA 3E5UA 1UG2A 3I59B 5EGOA 1IG7A 3J7ZI 2R7QA 2LY9A 1SAUA 3IAS2 3BG3A 1ZR4A 3LWFA 2ZXIA 5E18F 3K9TA 3CLQA 1D0ZA 4LK1F 2EFQA 1J2XA 2FEZA 3K6GA 1X2MA 2V9VA 3A0HC 5EEAA 3SFIA 1WH5A 1BI0A 3FKJA 2DOFA 2QQAA 4UB8C 3HOWJ 1KYZA 1QPMA 2QSFX 2G7UA 5AIQA 2HQAA 3QU3A 3TMOA 4AD9A 4G8XA 3ERMA 4KT5C 1ZG3A 3TGNA 2NVQJ 2AO9A 3LA3A 3MKYB 5E3OA 1H8AC 3A4CA 3ZQ7A 1VQNI 5F64A 4MFDA 3R60A 2COBA 4MQVA 2DPUA 2M3AA 3M1EA 1BIAA 1ZYRF 4JYKA 2OZ6A 2EB7A 1R36A 1KU3A 3ROUA 3WU2C 1ZGWA 4XOPA 3M8JA 3VFZA 3NRVA 2YR2A 3JREA 5FROA 1X1BA 2CG4A 1T8IA 4CHUA 3GZ6A 4M71A 4BQQA 3KYCB 5DD8A 2QLZA 3QWLA 2CGPA 1JHHA 4Z6YA 2EILH 1RPWA 3FKIJ 1Y1VJ 2Y31A 5HODA 3ONQA 3QYFA 3X2QH 2VI6A 1TTYA 2WY7Q 3OV8A 4OWRB 5J4YA 3I5UA 3BG9A 3QOPA 3E6DA 1XMKA 5EZGA 1WJ5A 4X0GA 4GYIA 2GLOA 4BY1J 2BVMA 2LY2A 2PMHA 3BR0A 3K69A 4UXNA 5JLXA 3HOUJ 2A3SA 5HLGA 1MW7A 2EZLA 3HHHA 3FZVA 3U2RA 3ZPLA 4B09A 3V7CA 4XLAA 1Y8RB 2VJ4A 1AU7A 1JT0A 2EJRA 4JBAA 2GOXB 1U9OA 1XD7A 3WODF 5ERIA 4RM2A 3KPHA 5EF6A 2XV4S 1UHWA 2B63J 3PQKA 1T0FA 5H6QA 2RREA 2RVCA 4BH9A 1GUUA 3HIFA 3IRQA 1EKEA 5M3FJ 2KHMA 2H27A 3Q0VA 4QPQA 1LEBA 1J59A 3AFHA 4M9ZA 4MGRA 3OR1C 3DP7A 1FOYA 3HSFA 3EDPA 3ZMZA 3BQZA 5GAGJ 1W7PB 1OYWA 4OU0A 1NG6A 1VQLI 1IN4A 4IL6C 1OMIA 2H8RA 5JLWA 3FIWA 4KA4A 2EFWA 3A02A 4RB0A 5GADJ 2EINH 1SFEA 2EV5A 4XLHA 5DS9A 4BAYA 1JE8A 1ETVA 1X3ZB 2STWA 5BPDA 4XM3A 2EIKH 2NNYA 4QSHA 1BI3A 3JSPA 2QGUA 3CCVI 2X1EA 4ENJA 1STZA 4ZZLA 5FKOA 3OYKA 3SHFA 1IDYA 3IL2A 3LSJA 3RKYA 3I4NJ 1X3UA 3F3XA 3PSFA 1B72A 1K79A 3CC7I 2BYVE 3QAHA 2LFBA 2V9KA 4NC6A 1GV2A 2VJIA 4NB5A 3VODA 3JAMK 3F0CA 3A01A 3VYTB 2Z2SB 1P6RA 4G6TB 4YRVA 4CCNA 2M4KA 5D5WB 1ETYA 4J19A 2FA5A 2HDWA 2QQ9A 2X6WA 2CFOA 1HQCA 3CC2I 4N0BA 2LLKA 3C3WA 3RSNA 4Q4ZF 3JRIA 3OR2C 5FFXA 2RV8A 1MGTA 3MKLA 3BPXA 1U5TB 1XPXA 3AL0B 3S2HJ 2BGCA 2Y75A 1QZYA 4OAZA 4A0YA 1W5SA 3DTIA 3T8RA 3BCBA 2VLAA 2ZJQF 1QVUA 2JVGA 2V79A 4KYWA 2HGCA 3I53A 2KFDA 4CCLA 2O8XA 3BTJA 4PDKA 4XLFA 4R79A 3DBRB 1HBXG 4RGXA 3BTLA 4IRIA 3HJEA 1LB2A 5LGNA 3RPUD 4MLOA 3IC7A 5F08A 5HDKA 2LR8A 4LITA 1N75A 2H09A 4BQAA 1IW7F 3K1MA 1R5HA 2ELJA 2IP2A 5CPRB 2MBFA 5HNFA 4RB1A 3HYIA 3LSIA 3CO6C 3ISPA 2DLLA 1LUJB 1TLHB 3EPZA 4FTHA 4PJMA 5FRMA 3KZZA 1QHHD 3M7GA 1TT5B 1TQPA 4F92B 3LSPA 3LAPA 5H20A 4CYCA 2K9QA 2IS6A 3WHBA 4M3EA 2L9RA 4B43A 2V1NA 1ZRCA 1W0UA 1H9TA 2HKOA 2HPMA 3OMYA 4Y13A 2HTSA 2FNAA 1MJBA 2ZNYA 3E5QA 4XONA 4EGYA 1REPC 3JRAA 4QPOA 2LREA 2M34A 2R7XA 4YFKF 1RR8C 2WA0A 2LRDA 4HZFA 3WGGA 1JTXA 3DWLE 4RDUA 2DU9A 3GYHX 2WTEA 2OJED 2IBDA 4DBQA 1HF0A 1D8JA 4CUGA 4KN7X 2E1NA 2UZKA 2ETHA 2IA1A 2P6TA 2WV1A 3KEOA 1O3TA 3QP5A 1OFCX 2DMUA 2MC4A 1FSEA 2Z99A 1QU3A 1YG2A 1MBFA 2DYRH 1T98A 2K9SA 2FQ3A 2BOLA 3U1KA 2EFPA 2JSCA 1K6YA 4V19K 4ZYAA 2NS7A 2OTLI 2CUFA 5FFZA 2ZXJA 3V8JA 5EG0A 1PP7U 4HF2A 4AYBA 4LLGF 3WHCA 1ZRDA 3I59A 4D5CA 4CXFA 2XC7A 2DA4A 2FE3A 4MEYF 4KNYA 4KMUX 3OIQA 4ZTJA 3TDUC 1H88C 4GYGA 1S7EA 4DQ2A 2V26A 3IWZA 3OYIA 3RQIA 5LHHA 5DTDA 2JWTA 3U1DA 1BC8C 3OYCA 2RDPA 1IN6A 3V8LA 5JHUA 2K4BA 2YU3A 4ZC3A 5HOOA 3IRRA 3AL0C 2ZC2A 1GHCA 1ZN2A 3C2HA 4RAYA 3T8TA 3EYIA 1R71A 2KP6A 3RQ4A 1WVRA 3M9AA 4BBRJ 3QP6A 1PUEE 3LQQA 3ZP5A 3CO7C 4L9JA 4S04A 2YU9J 1WKMA 3H9GA 2I5UA 4II2A 3ZGKA 2QYOA 1WJEA 4I01A 2DA1A 1IUFA 3CJTB 2X51A 2GBYA 1YI2I 2OC6A 2MH9A 2E2JJ 4Y7NJ 3WTSC 3K4JA 2ID6A 3S3NA 1R7JA 2OA4A 3Q9VA 4HDVA 1XS9A 1W36D 1W36C 4XN0A 4A3MJ 1BI2A 4BDZA 5J8FA 3LNQA 3K1NA 2ZNZA 2DJNA 4XOTA 1R22A 1LJ9A 3CCMI 5FLVA 1EH7A 3K4MA 2CMPA 2COMA 1OR7C 1P2FA 3G3ZA 2WAEA 1LE8B 2TCTA 3SJMA 3CP8A 2F5VA 2VT2A 4IPAA 4FT8A 3ZCOA 2JSPA 1KA8A 2UWMA 2FRHA 3EUHC 1X1AA 5GTIC 4LK0F 1FOXA 4KISA 5EEGA 2XB0X 4FE7A 2DT6A 3WG7H 3ZN0A 4M9SA 1YFHA 4UVBA 2HR3A 4Y15A 2OPTA 1X3WB 4PZJA 2W24A 1T56A 3AG2H 3O2PE 5L3DA 4D5FA 2CW8A 4JK1X 2KQRA 3E97A 5J1RA 1UAAA 3ECOA 3WTTC 3O3KA 3QQAA 2FQ4A 3HDDA 3OSGA 1K78B 5LBQA 5LEJA 4HQEA 2K9MA 3HOTA 1A36A 2VQLA 1P7JA 2FD5A 5AONA 3RYPA 4QTRA 2DOAA 4RS8A 3L2CA 3K7AJ 2VPLA 5JI6A 2QBYB 4HSRA 2LNBA 3ZMTA 2LOOA 1LNWA 4JQFA 4RMNA 3PFIA 1ETKA 2MLKA 4II3A 2RN7A 4I0BA 3CDLA 4IF4A 2BXZA 2W57A 4LB5A 1R6RA 3PSIA 1BOBA 3FX3A 2N8GA 3S8PA 1F9NA 1YRNB 1MBGA 4CCKA 4A3FJ 1NTCA 4XLNF 5IY5H 3QYEA 3LFUA 1TW3A 2KT0A 2OD5A 1D0YA 2CUJA 1CGPA 2A6EF 5DDGA 3S2WA 1FNNA 2D1HA 3SEQA 1JKQC 4D7NA 1FC3A 2ELKA 2RNJA 3H3VK 5TRDA 2H94A 1ULYA 2EK5A 1HSJA 2NOGA 3OOUA 5EGOB 1YW7A 2ESNA 3C2BA 4LIVA 2F5CA 3C18A 2BY0A 4LD5A 1U3EM 4DZJA 1YE9A 1I1GA 1ON1A 1U5TC 2DAOA 2GWRA 2NVXJ 3Q5FA 5D8LB 2M0MA 5FD5A 1VQ9I 4CYDA 2H1KA 5D5VB 2DQLA 2FBHA 3E6BA 1R1UA 4UVCA 3WTUC 1MSEC 2W25A 4B3XA 4HNUA 4EJUA 3TO7A 4E7KA 1F1ZA 2E7WA 2DFFA 2LBFA 2JA2A 2VE8A 4M6VA 5M5XJ 3HOVJ 1FYMA 5ILUA 1JUPA 2PMZN 2G0EA 2QKMB 4ZJZA 1JJ8C 3CF5F 2HOSA 2E5NA 4NUBA 2OZUA 4A0XA 3N05A 4V2FA 2DODA 2W7NA 4NQWA 4BQNA 2VONA 2PEXA 1FJLA 4ZYEA 2GIZA 5FD6A 3ZN1A 4A3IJ 4YFXF 3WE3A 5CQGA 1AWCA 2CQNA 2XGXA 4FE4A 4M3DA 2JUGA 2ZMEC 1XMAA 2EV6A 2MSYA 2PX9A 4D1QA 2R5YB 3S3OA 1LE8A 3DPLC 3MFKA 1B1BA 2F2EA 3NWSA 3W3CA 5FKMA 2HOTA 1YJNI 5DM6F 4HAMA 2O3FA 4HRIA 1OPCA 1IUYA 4BNCA 2L02A 4RB3C 4IRGA 4WCGA 4CYCB 4JOMA 1S3JA 1WRJA 2A05A 1JHFA 1USSA 3HUGB 4WK8F 2WC2A 3HUGA 1CF7A 2ZFUA 1KU9A 2ZKZA 2IVMA 4HPQA 3DU6A 4BE1A 4LIUA 1XGMA 3DKWA 4A5NA 4C2UA 2QM3A 4IJAA 3VB2A 1SAXA 3FXRA 4Z2YA 1JJ6C 1PUFA 2HVSA 4KDPA 1IO2A 2KL4A 3QPLA 4BJTA 1LPQA 4WF2A 1RUNA 2DA6A 5ICFA 2L01A 2VBXA 1FMVA 4MTDA 3IH3A 4E6KG 3I71A 2QSGX 2UUZA 2DA7A 2VOOA 1Y0NA 2A5WA 2VXZA 4XNFA 4E4HA 2KDZA 2FX0A 3K10A 1R1TA 4QIWN 3EETA 4A12A 4BXXJ 1EV7A 2LKXA 1XSDA 2BHYA 1QVTA 1FP2A 3HC7A 5KCMA 1S6LA 2XAJA 2B0LA 2K5CA 1ZH5A 2IPQX 3ESWB 4W1UA 4IKFA 1MBJA 2PBIA 3OL4A 5BPIA 1IAWA 4XLCA 3ZQCA 3AG1H 1HC8A 2NS8A 4V2GA 1ZREA 2KRCA 2HEOA 4R8HA 4XICA 2XDVA 3GTKJ 3HRMA 1W5CC 3KP5A 1O3SA 4EMSA 1T95A 5D5XB 4AM3A 3GEZA 3I64A 2M30A 2EFOA 2E1OA 4LOCA 3J7AY 2X6XA 3DLLF 4IOAF 2XRLA 4M72A 2GA1A 4HX7A 5J47A 3VWBA 3HXLA 4EM0B 3SZTA 3ELKA 1I3AA 1IXRC 4E7ZA 2XPWA 4MQ9F 3RZDJ 1FWZA 3M8EA 3WTYC 3MD2A 1HDPA 1X1PA 2H8WA 4XL9A 2VPRA 1YO5C 2CU7A 3JSOA 3CMYA 2JA8J 4RGUA 3ZMDA 1IV6A 2R0QC 1AKHB 2OU2A 3A2KA 1TQIA 2M5WA 1H9GA 4M73A 4P5OA 5JR3A 4EM1A 4N9HA 2A07F 4BL0B 1T2KA 1U5TA 3FXOA 3V7SA 3MZYA 3Q3SA 3DQVC 2LD5A 2GXBA 2LC2A 3KEYA 3M8FA 4C3IJ 5B1BH 1LQ1A 1Y0UA 1ORKA 2Q1ZB 3G1OA 3L2UA 5FKNA 4RBOA 4A3LJ 1E0EA 3DPUA 5BMZA 2XKPA 4HF0A 2OUMA 4LFUA 1U6GA 2IGMA 3FK6A 3HOXJ 1SD5A 3I4MJ 4H4KC 3RCOA 4OIQF 2R5YA 5K5QA 1D0XA 5IT3A 3OYGA 3IV5A 3D5LA 2R7OA 5D4SA 2E2IJ 1W5TA 2VN2A 5E3LA 3I55I 3H9QA 3QPHA 4Y33A 4BXUA 2KKOA 1HXDA 2W84A 2Z33A 2R7SA 3F8NA 4TV7A 2EZKA 1YIJI 3VSLA 1ZLJA 2IRFG 1BM9A 1RESA 1MZBA 1B4AA 3LSGA 5D8KB 2L0KA 1HW2A 5FKLA 1T0FC 2VE9A 1ACIA 3ZRGA 4HLXA 3VSKA 5E8IA 4RGRA 2QBYA 1DGWY 3GTMJ 3TP0A 3OYJA 1SD6A 1YW8A 1S9HA 5TISC 1WHUA 4P9FA 3ASOH 4YELA 2Y9YA 1WZ2A 1Q1HA 5CLSA 1R4NB 2F4MB 3TP3A 1ZRFA 3H9JA 2ID3A 2LG4A 2F6CA 3BJOA 1A6IA 3NQOA 2K02A 4LGWA 1HCRA 3CUQA 2MC3A 4HSTA 2Q2EB 1YS6A 1YS7A 2KISA 1ONVA 2VKDA 2K4JA 2WAQA 3OIOA 2VC0A 2DFIA 4FHTA 1DP3A 3ABUA 1MMGA 1YX5A 3I58A 2M87A 5ED4A 1FYKA 5GP9A 5ILSA 2VQCA 4YEJA 1OCCH 1LDKB 4PGGA 4I0AA 4I76A 5F0FA 1RI7A 3BJAA 3GLLA 5DUKA 2P7CB 1I27A 4BUPA 3DV8A 1QGPA 3F6OA 3FWEA 3GXOA 3GTGJ 4LMYA 2A6HF 4PUSA 2HKXA 5TGTA 5DCMB 3LAJA 2PG4A 4BU2A 3GTPJ 1P4AA 4FASD 2WB1A 2VKHA 1ETOA 1Z3XA 3MAJA 4L9VA 2FF4A 3OYFA 1K4TA 2R5ZB 1ETXA 3IHUA 3PNVA 1XTAA 3TO6A 4MIMA 2DBBA 5HS7A 1OKRA 1V5GA 3WTXC 5J8CA 2O6GE 3O6BB 1VQMI 2XF7A 3WTVC 4BHBA 1K83J 1KU2A 2JVHA 5HNHA 4ETSA 4FETA 2KIFA 3AG3H 3OYEA 4ITVA 1YQAA 2PMZA 3E5XA 5F6FA 5D5UB 1O4XA 4UUSB 1V54H 1AHDP 1SD4A 4IQJA 4I09A 2EZHA 1QA6A 3I3LA 1IF1A 3LOCA 1B72B 4AU7A 3PJRA 1D8KA 2HVRA 2W85A 3KZYA 5HS9A 3CCLI 3L2WA 5CVRA 3RKWA 4OIRF 1YYVA 2EA4A 3KLNA 1OLTA 1SMTA 1G6NA 1HOMA 2FMYA 3V42A 4A3CJ 2L4MA 3GVAA 3E7LA 1MKMA 2NYXA 3BR3A 4XKCA 2KRFA 4UV9A 1UJ8A 4C30A 1YLFA 3FF5A 5A2QZ 4KFCA 3FMSA 4RB2C 1ZQ3P 2HYJA 1FBSA 4A69C 3A0BC 4RAFA 3H5RA 1D3YA 1HDDC 4U0VA 1WFXA 1EH6A 4O3MA 2DCEA 2VC1A 4IHSA 2E19A 3G1MA 1YITI 4RA2A 2NS0A 1LFUP 2XHKA 4KUMA 3VDXA 1USTA 4OINF 3K4NA 2ACJA 4M6YA 2JZYA 3ABMH 4CCJA 3VYSB 3LSHA 4BKXA 3GZ5A 5CQEA 3RTRA 1PP8F 1O57A 3H92A 4G12A 4A93J 1TW2A 1EA3A 2K40A 3DTKA 4FCYA 3F22A 5LHIA 2Y9ZA 3SQNA 2B7EA 3CZ6A 2JN6A 3KCCA 3L09A 2DTRA 2WY8Q 1UMQA 2P6SA 4NDLA 4ZYDA 4KITB 4EV0A 4RM3A 4B47A 2QVOA 4PSXA 3TKYA 5C44J 2EFNA 2L7MP 4YIFA 1FTTA 5JVGF 4HF1A 3BR2A 4L9NA 1N77A 5IP6A 1P7IA 2Z5UA 1WSUA 2HI3A 4UVAA 2ECBA 2JUCA 4OOIA 3CCJI 4PFPA 3KIOA 1VI0A 2DQRA 1P4XA 3A03A 3TOAA 3HRTA 4KJZA 3L7WA 4FISA 1ZHFA 1UG0A 5E20A 1VFCA 1R23A 4BBSJ 2DJIA 1T08B 5J1UA 4RGSA 4NBQA 2QWWA 3GTOJ 4XRSA 2L7ZA 3BROA 3TL4X 4ZYGA 4HG2A 4ESFA 4LG0A 1SEUA 2IEKA 1JKPC 3OYHA 3MVPA 1S29A 2Y69H 3PUFA 4AWXB 2OCCH 3F6VA 3TEDA 1RZ4A 4HDUA 4IEJA 3CTAA 1MNDA 4LB6B 3P5JA 2HOEA 4Y4RA 3H0GJ 4IX7A 2B9SA 1YX3A 2CV2A 3PL8A 2V1DA 1DPUA 2F4OB 5EG0B 2XIGA 2Y0SA 1GT0C 1S72I 1YHQI 1Y6IA 5LHGA 1DP7P 4XORA 3JRFA 3F23A 1W0TA 3KYLA 2DI3A 5IP9J 3MKWB 4XRMA 1E17A 1BR2A 5LGTA 1ZTRA 3FXMA 4Q5SF 4BE2A 1VF9A 5CVUA 1ENHA 1P4WA 2G7HA 1KGSA 3Q0UA 2VOPA 1PDNC 2R7DA 3PUBA 4ON0A 3ZXSA 1APLC 2R93J 5J40A 4G6QA 4EQQA 3ZQQA 3MCZA 4M9XA 4EJOA 1OCZH 3R0JA 2GIVA 2ZXWH 1WJDA 1H89C 2BXYA 3K70C 3BZ6A 4G7ZF 3FHZA 4B3AA 3IKTA 3CUQC 2CUZA 2IT0A 4A5MA 3S1NJ 4A3GJ 4U87A 1T6SA 2HQ5A 1D5YA 2CQKA 1G4DA 1R5GA 4YIRX 2V6EA 1BW6A 1X4PA 2LH9A 1A6QA 5K7ZA 2X9DA 1G8XA 2MD0A 1GXPA 2VT3A 2CW7A 1GDTA 2FJ1A 2M2EA 2OAZA 5J6XA 4G9YA 2WWYA 3HPHA 3LSKA 3SDGA 2MABA 2QSHX 2CO5A 2RKHA 1SVLA 4CH7A 2R7VA 2R7UA 4S05A 2QQBA 2F5DA 5LRSA 2HFHA 1J0RA 5E3MA 2KIMA 3I4PA 2E35A 4D0PA 2WADA 1ERDA 2L9NA 1UFMA 3HOYJ 2L9SA 4DW6A 1XGSA 4BHCA 3GLXA 3W2VA 2HQNA 3CD6I 1R1VA 2V4JC 3F8FA 3BCAA 5F27A 2CS3A 2L9VA 5CVIA 4EJWA 1PUFB 3CDHA 1FOWA 2X4HA 5E79C 3CCYA 5F1RA 1FY7A 4IQ4A 3CCUI 2ZMEB 3EUKL 3NWTA 4PJJA 3TDZC 3DKYA 2DN0A 3NEUA 4AIJA 1MMAA 2BEOA 1I1SA 5F0HA 1CQTA 2HDCA 3SYTA 1W4MA 1MMDA 1WJFA 3FHNA 5ICEA 4PSWA 4IHXA 5HDNA 2HWVA 2W1OA 3L00A 3DEUA 1ZARA
chains in the Genus database with same CATH topology
4JOMA 3HUGB 3MKYB 4DJAA 3CMMA 3A4CA 4U7BA 2ZFUA 2IS2A 4BACA 4HPQA 3DU6A 4BE1A 2M3AA 4LIUA 4C2UA 1N78A 3VYUB 4XOPA 3M8JA 2HVSA 2A6TA 2KL4A 3MMYB 4BJTA 3C2GA 1HA8A 3UNGC 5FROA 1X1BA 5CKTA 4BQQA 1FMVA 3DU5A 4E6KG 4NNJA 2UUZA 2A5WA 2VXZA 2L7KA 4CSWA 4XNFA 2KLOA 3ONQA 3QYFA 2WY7Q 2VIXA 4E4HA 1G59A 4OWRB 2BVLA 4CZCA 2M4GA 1Z7LA 3K10A 3OS0A 4E7JA 2KZVA 4F3QA 1WJ5A 1QHGA 3LMMA 2LY1A 4X0GA 2BVMA 2LY2A 2RQQA 3HC7A 5KCMA 4F52A 2K5CA 4DIQA 3L2QA 1LKXA 2BW3B 1MW7A 3L2RA 1VZ0A 4BE0A 4IKFA 3OL4A 3HOSA 4XLAA 2VJ4A 4XLCA 2IGOA 1WJBA 2GOXB 4LG3A 2KRCA 2XDVA 2E60A 4RM2A 1NG7A 1T95A 2OV7A 2RREA 3J7AY 2X6XA 3K4BA 2KHMA 2HU9A 3FDYA 3VWBA 2HPIA 4QPQA 2ZSHB 3HXLA 3AFHA 4J01A 3KX2A 3OR1C 4E7ZA 4B44A 3H35A 4BEHA 3MD2A 1NG6A 4XL9A 3SEZA 3OYDA 4XMYA 3EUAA 2AQFA 3M1CA 2M7AA 4XLHA 3OYNA 3IP4B 3A2KA 3BG7A 4P5OA 4BL0B 4XM3A 4RLQA 2X1EA 3K70D 4GRIA 2V7FA 3DQVC 3OYKA 4BS9A 2LC2A 2VASA 3KEYA 3PSFA 2CV0A 3AKZA 2PJRB 2Q1ZB 2V9KA 3L2UA 3CJRB 2W4SA 2VJIA 4PK4A 1E0EA 3DPUA 4NC7A 2W00A 2W82A 3DTEA 3VYTB 1Z3YA 2OUMA 2Z2SB 2AQEA 4G6TB 4YRVA 4CCNA 2M4KA 2IGMA 4H4KC 3RCOA 2IGKA 2HDWA 3S3MA 1D0XA 2X6WA 2Z16A 2CFOA 3OYGA 3D5LA 2R7OA 2WBMA 3H9QA 1X1DA 4Y33A 4BJ6C 4XQFA 4C2TA 3RSNA 2R7SA 3OR2C 3VSLA 2O5RA 3LSGA 3AL0B 4OAZA 3CP2A 1T0FC 4XKBA 3DTIA 3BCBA 3ZRGA 2VLAA 3VSKA 2JVGA 1DGWY 3OYJA 4CCLA 5LFAA 4XLFA 1S9HA 4R79A 2KDOA 3DKXA 1TZLA 4YELA 2E1MC 4BDYA 4P1WA 3RPUD 3DPTA 4MLOA 4B48A 3H9JA 2R7TA 3G2BA 4LITA 1N75A 2LG4A 2F6CA 2MFZA 3W2AA 2ELJA 3E0JB 5CPRB 3ZR8X 4HSTA 2UV1A 5HNFA 2HVQA 2Q2EB 3DLAA 2ZSIB 4J00A 3OS1A 3K4KA 2VKDA 2WAQA 5KHDA 3LSIA 1MMNA 2HZDA 4RLFA 2LYCA 3EPZA 4PJMA 5FRMA 1DP3A 1BR1A 1QHHD 2X1CA 1MMGA 1YX5A 3BC8A 3LL7A 2XSJC 2Z1DA 4F92B 2VQCA 2FUG2 4YEJA 4CA0A 1LDKB 4XKVA 2IS6A 3S93A 2LBFB 4DOZA 2X6YA 2CH0A 4BUPA 4B43A 2V1NA 2HPMA 3OMYA 4PUSA 3BLYA 3OL3A 5TGTA 3OYMA 4XONA 4BU2A 4QPOA 4Y3OA 2LREA 4FASD 1Y56A 2R7XA 2VJJA 2VKHA 2WB1A 2X85A 1Z3XA 4BQOA 2WA0A 1ZELA 2LRDA 3OYFA 3PNYA 3PNVA 2K9LA 3DWLE 3OIPA 4KT6A 2NOJB 3SDBA 3FBNB 4DGWB 4DBQA 1V5GA 1X4OA 4CUGA 1TT0A 3L2VA 2IXSA 2XF7A 3OS2A 4OAYA 2XF5A 1AA7A 2JVHA 5HNHA 2MC4A 4FETA 5HVQC 3QYBA 3HG9A 3A1YA 1QU3A 3OYEA 4ITVA 2PMZA 1P9QC 2BOLA 1K6YA 2L2OA 2QKLB 4ZYAA 4IQJA 3VYRB 3HPGA 5HLTA 1PYVA 4AYBA 3I3LA 3OYAA 2VL8A 4AU7A 3PJRA 2HVRA 2XC7A 3L2WA 2E5ZA 3OIQA 1D1BA 4ZTJA 2ZXHA 4BJ5C 4ANJA 2V26A 1OLTA 3OYIA 2DT7B 3V42A 3S32A 4AVZA 1SFKA 3OYCA 4XKCA 5HOOA 4ZC3A 3AL0C 3QOEA 4HNTA 3CESA 4C30A 2CV1A 2DXIA 4PJNA 3C2HA 3LSMA 4C9YA 2R7RA 1FMWA 2KP6A 3RQ4A 2K3PA 3BG6A 2IS4A 3H5RA 3H9GA 4BEHB 4II2A 3ZGKA 2VXDA 1WJEA 1WFXA 4F93B 2X51A 2DCEA 3QODA 3IUOA 2OC6A 3K4JA 3S3NA 1W36D 3CF2A 1W36C 4XN0A 3VDXA 4BDZA 1DQUA 3K4NA 4F91B 4CCJA 3VYSB 3LSHA 4PJLA 4XOTA 3SZGA 5CQEA 5KNLA 5JHFA 3RTRA 1LFPA 3K4MA 2CMPA 2RNGA 1OR7C 4BGDA 2WAEA 1EA3A 2P0WA 3DTKA 3CP8A 2F5VA 3ZCOA 2VQHA 3CZ6A 3I9V2 2JSPA 2WY8Q 3OWTA 2UWMA 3EUHC 5LD2C 1X1AA 4HEA2 1X19A 4KITB 4KISA 2MYSA 4ZDLA 4RM3A 4B47A 3F9KA 4PSXA 3IAM2 2DT6A 1U0JA 4E7HA 1N77A 4ZDPA 2BW3A 2CW8A 4PFPA 2KQRA 2KMUA 1UAAA 1PJRA 2L5QA 1X1CA 1IRXA 4KJZA 2VJ5A 1UG0A 1BR4A 2K9MA 3HOTA 2VQLA 1Z21A 2DJIA 2DOAA 2VPLA 4HSRA 2I8DA 1MNEA 3TL4X 2HNHA 4NQWB 2IS1A 2LOOA 3PFYA 4JQFA 4RMNA 4HG2A 1J09A 3OYHA 2XF6A 4XLEA 3UR3C 4II3A 3H0DA 1MNDA 3GBGA 3PNTA 4Y4RA 4ZDOA 4IX7A 3FBIB 1R6RA 3PSIA 1BOBA 1YX3A 2CV2A 2F4IA 3PL8A 2R7WA 2KPMA 3W2WA 3S8PA 2Y0SA 4CCKA 1UELB 1Y6IA 4XORA 3QYEA 3LFUA 3KYLA 2M7BA 2WAFA 1D1AA 3MKWB 2KRHA 4CCMA 1BR2A 1D0YA 2CUJA 4BE2A 3HL2A 4D9JA 1LVKA 3D5SC 3PUBA 1JI8A 3SEQA 3OYLA 3ZXSA 3HKZA 1WJAA 2PJRA 3ZQQA 4XN3A 2XAUA 3OOUA 1WJDA 4LIVA 3K70C 2X1DA 5FRNA 3H5AA 3U21A 2CUZA 1YE9A 4U87A 3OYBA 4E7SA 2V6EA 1KONA 4EATA 4DBRA 1X4PA 2LH9A 4E7IA 2M0MA 2R4GA 1G8XA 2MD0A 2VB6A 2CW7A 3E1SA 4N4OB 2IGNA 1GLNA 3K4LA 4XKWA 4XR6A 4ZTFA 3HPHA 2E1MB 3H5NA 3LSKA 3TBIA 1D1CA 4B3XA 4HNUA 2GOMA 2MABA 4NC8A 2R7VA 1WJCA 4CH7A 4E7KA 2R7UA 2LBFA 3K4CA 2JA2A 4N4NB 2QKMB 4ZJZA 2E5NA 1V5FA 4NUBA 2WADA 1ERDA 2L9NA 3N05A 2L9SA 2W7NA 4E7LA 3W2VA 4BQNA 2VQGA 2V4JC 2R7QA 1SAUA 3BCAA 3IAS2 2CS3A 3CJQB 3DEEA 4CCOA 2ZXIA 5CQGA 1V5EA 1D0ZA 2JUGA 4IQ4A 3K6GA 4D1QA 3EUKL 3NWTA 4PJJA 3S3OA 3DKYA 3OY9A 4PFOA 1MMAA 4BXFA 1DGRM 3DPLC 3D5RC 4F55A 3FKJA 3NWSA 3W3CA 3SYTA 4IZZA 4HRIA 1MMDA 1WJFA 3FHNA 3MKZA 4PSWA 2HQAA 2W1OA 3TMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQL A;  2VQH A;  2VQG A; 
#chains in the Genus database with same CATH topology
 1B9M A;  4IO9 F;  2GQQ A;  3GX4 X;  2NRA C;  1O3Q A;  1A35 A;  2GXG A;  1IXS B;  4DJA A;  3CMM A;  2ME6 A;  1JUS A;  4WXC A;  3S1M J;  1K61 A;  2NNN A;  5C4J J;  2IS2 A;  4BAC A;  3HSE A;  1NK3 P;  2WAQ N;  3CDI A;  3DFG A;  2L7F P;  1HKS A;  2BV6 A;  4U0W A;  3ZQF A;  2O8K A;  3IH2 A;  2HOA A;  1OCT C;  3MMY B;  2RC4 A;  4IHW A;  1FTZ A;  2M9H A;  3C2G A;  3UNG C;  1UHM A;  5F0C A;  1JTY A;  2F48 A;  2XAQ A;  1O3R A;  3FXK A;  1SFU A;  1RR7 A;  5GPC A;  2KJC A;  3FIS A;  2L7K A;  2BY1 A;  2M0C A;  3L9F A;  2XUB A;  1YRN A;  2QA4 I;  3A01 B;  5K5R A;  1OQY A;  3GFM A;  1WI3 A;  2BVL A;  2M4G A;  1Z7L A;  4CDG A;  4E7J A;  5CVJ A;  5E3N A;  4F3Q A;  2O0Y A;  4HX4 A;  1HW1 A;  1QHG A;  3LMM A;  1P92 A;  3OOP A;  1T38 A;  2L4A A;  2RQQ A;  4F52 A;  4XLP F;  3L2Q A;  1KYW A;  3HHG A;  1MD0 A;  2OBP A;  4BE0 A;  3WG9 A;  2ISY A;  2BZT A;  3CJN A;  3HOS A;  3DF8 A;  1WJB A;  1TWA J;  2ADU A;  3ULQ B;  3SXY A;  5ICC A;  5GAH J;  5HS8 A;  1NG7 A;  3GTQ J;  3J80 K;  2OV7 A;  2GXA A;  2OF7 A;  1N25 A;  4A2U A;  3J7A O;  2HU9 A;  3FDY A;  4L5J A;  1ETW A;  1FPQ A;  1S7A A;  2EBI A;  2ZSH B;  4LLL A;  1BL0 A;  2Q8K A;  3KX2 A;  3CCR I;  4HBL A;  4B44 A;  2VBZ A;  1MMS A;  5F04 A;  5FO5 A;  5DM7 F;  4ZYH A;  3LFK A;  1Z9C A;  1YOV B;  2JK3 A;  3TW7 A;  3SEZ A;  3OYD A;  5FJ8 J;  4U0Y A;  1TNS A;  2AQF A;  3EUA A;  3M1C A;  4M3B A;  4XK4 A;  2ICW G;  2PFB A;  4ENM A;  1VQK I;  2XRO A;  1FBQ A;  1NHA A;  1ODD A;  1WQ2 A;  2XKO A;  3GZN B;  3K70 D;  4GRI A;  5EZH A;  1R9T J;  1T39 A;  2V7F A;  1CF7 B;  4BS9 A;  1Y1W J;  4L18 B;  1MSF C;  3ZMV A;  1J7K A;  5EDN A;  4W97 A;  1R4M B;  3P9I A;  1JGS A;  2LVS A;  3M07 A;  3H36 A;  2EWN A;  2Y30 A;  4I2O A;  1BOA A;  3HGG A;  4PK4 A;  3I56 I;  4NC7 A;  3VOE A;  2PLY A;  4YFN F;  2W82 A;  1Z3Y A;  5L3B A;  5JVT A;  4U88 A;  1UCR A;  2M1B A;  3ABT A;  2ZME A;  2MW8 A;  4FX4 A;  1UB9 A;  3BR1 A;  3K0L A;  5KAF C;  2ZFW A;  3JTG A;  3RYR A;  3RPQ A;  2WBM A;  2IAI A;  4DNC A;  1YJ9 I;  3FXU A;  4G94 A;  1Z05 A;  3K2Z A;  3WU0 A;  3HZJ A;  1XC5 A;  1B8I A;  4WXD A;  5H2F C;  1Z1D A;  1FT9 A;  4GFB A;  1Y39 A;  3CP2 A;  4XKB A;  1IN8 A;  2R3S A;  4E70 A;  2VOD A;  2Y0M A;  1QZZ A;  5LFA A;  4M6X A;  2O03 A;  2V1X A;  4A3E J;  3DBH B;  2KDO A;  3DKX A;  4GO1 A;  1TZL A;  2P5K A;  4BDY A;  2X48 A;  2P7V B;  3ASN H;  9ANT A;  4AC0 A;  4IVN A;  3DPT A;  4B48 A;  1FLI A;  3FM3 A;  1ZLK A;  5D4R A;  1ITY A;  1JXS A;  1XSV A;  2CUE A;  2O9L A;  1KZH A;  3KP3 A;  2MFZ A;  2MLG A;  5CYV A;  3E0J B;  3TQN A;  3ZR8 X;  1FEX A;  1MIJ A;  2HYG D;  3K2A A;  2HQR A;  3DLA A;  4MTE A;  3P7N A;  4J00 A;  2ME0 A;  3K4K A;  3OS1 A;  1FSH A;  1ZG5 A;  1MMN A;  3P9K A;  3KFW X;  3JAM Z;  2F5E A;  1F5T A;  5IT9 K;  3BQY A;  2X1C A;  1I3Q J;  2XSJ C;  2Z1D A;  1UHS A;  1G2H A;  2FUG 2;  1U9N A;  4XKV A;  3NAU A;  3S93 A;  4UUS A;  1TWF J;  2CH0 A;  3V8K A;  4AID A;  2K85 A;  1VQ5 I;  3G6E I;  4AUX A;  3PIO F;  1AKH A;  1XDS A;  5K1Y A;  3HEF A;  3OL3 A;  3WE2 A;  1MH3 A;  2Z3Y A;  3JRB A;  5BNG A;  4O6J A;  5LLQ A;  4Y3O A;  2XB5 A;  3PO2 J;  4BQO A;  5IYC J;  3F8M A;  1BA5 A;  3PNY A;  2K27 A;  4JX6 A;  5L3E A;  2LKP A;  4DYC A;  3T1B A;  3OIP A;  1B9N A;  4KT6 A;  1TP4 A;  4UB6 C;  3BTI A;  4DGW B;  1IZ1 A;  4EM2 A;  4AVP A;  1VQ8 I;  1TT0 A;  1JUM A;  2IXS A;  3OS2 A;  1K4S A;  2HTJ A;  3S2D J;  1W7P D;  2D1V A;  2XF5 A;  4A3D J;  1AA7 A;  5DV5 A;  3BP8 A;  5HVQ C;  3HG9 A;  3H3Z A;  3A1Y A;  2LDU A;  3R6S A;  2E7X A;  2KJB A;  3R4K A;  2DW4 A;  1P9Q C;  4G6D A;  1TL8 A;  2JMW A;  2A69 F;  2E71 A;  2L2O A;  1QO0 D;  2QKL B;  2E36 A;  3HBL A;  3HPG A;  1R00 A;  5HLT A;  1PYV A;  1FP1 D;  1M1E B;  4UHT A;  2VL8 A;  1EH8 A;  2FBI A;  4M74 A;  2HXO A;  2E5Z A;  2HS5 A;  1ZGJ A;  4Y17 A;  2ZXH A;  1MDM B;  1FIA A;  2STT A;  2QF7 A;  2DT7 B;  2LTP A;  4OMZ A;  4OIO F;  3R0A A;  1G3T A;  4AVZ A;  1SFK A;  4MNU A;  2ZJ2 A;  5DUI A;  4X1E A;  4HNT A;  4C3H J;  2PQ8 A;  3KLO A;  3HKZ N;  4UUV A;  5H6R A;  2R7R A;  3BT9 A;  1FMW A;  1V4R A;  3CME I;  4Y52 J;  4O5V A;  2K3P A;  2DFE A;  1G3W A;  1TBX A;  1ZG1 A;  1VQO I;  3JCU C;  2ELH A;  4BEH B;  2QEX I;  2X6O A;  2DYS H;  3MEX A;  4F93 B;  4UV8 A;  1QRY A;  1IXC A;  3HB9 A;  4IXA A;  2ECC A;  4JP0 A;  2DT5 A;  5HLI A;  1DQU A;  1OJL A;  4F91 B;  1E3H A;  4R1H A;  3TO9 A;  3F21 A;  4I6Z A;  1DU6 A;  1IRG A;  4L5I A;  1LFP A;  3DCF A;  2LKS A;  3L1P A;  1ZGA A;  4WX9 A;  2RNG A;  3RJP A;  2ZCW A;  4BGD A;  1SAN A;  2DDA A;  4G7H F;  2P0W A;  3CQZ J;  4P9U A;  3S16 J;  1K6O A;  3N97 A;  3GME A;  1GV5 A;  2KZG A;  4UNO A;  3OWT A;  3S1R J;  4HEA 2;  1X19 A;  4ZDL A;  5IOZ A;  3F9K A;  5B5E C;  5ICG A;  2NAZ A;  2E2H J;  2DA2 A;  3JW4 A;  3BPV A;  4Q48 A;  1U0J A;  1F43 A;  2A61 A;  4ZDP A;  2O7O A;  2EIM H;  5EYR A;  5LEK A;  4A3J J;  2KMU A;  2LMD A;  1PJR A;  2PMU A;  2LF7 A;  2BBY A;  2H1L A;  4Q47 A;  1MJ9 A;  2GM4 A;  3B02 A;  2ZO4 A;  1WH7 A;  3BWG A;  2EH3 A;  3DBL B;  5DCM A;  4XBF A;  2PJP A;  1LFB A;  2KIQ A;  4D7M A;  4HLY A;  4G7O F;  3MN2 A;  1DUX C;  3MQ0 A;  5K5O A;  5DD4 A;  2UXN A;  2L54 A;  3H3U A;  2V6C A;  3HSR A;  3G73 A;  2VUM J;  5M3M J;  3LSR A;  2JRM A;  2HNH A;  4NQW B;  2IS1 A;  2XRN A;  3PFY A;  2CJJ A;  4OMY A;  2XF6 A;  4ESJ A;  3U9G A;  2JRT A;  3SFZ A;  3JRG A;  2WV0 A;  3UR3 C;  2CQQ A;  1POG A;  1BN5 A;  3WU1 B;  2NVT J;  3LQR A;  2P8T A;  4OIP F;  3GBG A;  2QUF A;  5CVV A;  2OTJ I;  3J81 K;  2F4I A;  3CCQ I;  3W2W A;  1SC7 A;  3FMR A;  3KP6 A;  1DDN A;  1UEL B;  3AG4 H;  3J7Y J;  1FOK A;  4L0Y B;  4CO8 A;  4LLN A;  3WTW C;  2WAF A;  2KRH A;  2OCE A;  1DPR A;  2L3D A;  3Q9S A;  4CCM A;  1VTN C;  2DK8 A;  2XSD C;  4P96 A;  2YUS A;  4D9J A;  4K2E A;  1YW9 A;  3OYL A;  2BE5 F;  2NXN B;  3LA2 A;  3KET A;  3HKZ A;  1E3O C;  1WJA A;  4B1R A;  2IW5 A;  2FSW A;  1XDU A;  3I0T A;  2BY2 A;  2JA7 J;  4UY8 I;  4XN3 A;  2XAU A;  2ISZ A;  2RQP A;  5J3L A;  4XRS G;  1FYL A;  2X1D A;  1V3F A;  4GXO A;  4EEF G;  1IV8 A;  3H5A A;  4HX8 A;  1Z77 A;  1MDM A;  3U21 A;  2M8E A;  1T33 A;  3CUQ B;  1XCB A;  2G9W A;  2QCO A;  4RAZ A;  2CFX A;  5IT9 Z;  1KON A;  4EAT A;  4DBR A;  5AIP A;  1FBU A;  4E7I A;  2DPD A;  3S1Q J;  4A3B J;  3E1S A;  4UUT A;  4ENK A;  4N4O B;  1GLN A;  2HXI A;  4XKW A;  4ZTF A;  4F7Z A;  3TBI A;  1D1C A;  2GOM A;  1K78 A;  4NC8 A;  3FXL A;  2FXA A;  1WJC A;  1XCV A;  4WXH A;  3K4C A;  2LK2 A;  2CWE A;  2RAE A;  2GAU A;  1LDJ A;  4FX0 A;  5FLX K;  3B6A A;  2R7F A;  1OYY A;  1VQP I;  1V5F A;  4KMF A;  3WTZ A;  3HTU A;  2FML A;  1LEA A;  4E7L A;  1R49 A;  1QQI A;  2VQG A;  4DYQ A;  5FLX Z;  2D45 A;  4NHJ A;  5B66 C;  3G71 I;  2X0L A;  5ILV A;  3CJQ B;  3DEE A;  4CCO A;  1MH4 A;  2DFH A;  3GFL A;  5IPA A;  3EUH A;  1V5E A;  1XSX A;  2R5Z A;  2IA2 A;  3HTS B;  2MG4 A;  5C3E J;  3F8C A;  3CMA I;  4EGZ A;  3AAF A;  2HYF A;  4PFO A;  3OY9 A;  4BXF A;  1DGR M;  1ETQ A;  3D5R C;  2ZJR F;  4F55 A;  1V55 H;  3M3Y J;  4HYE A;  2DA5 A;  5HDG A;  4IZZ A;  3BR5 A;  2MD5 A;  2DTZ A;  2ESH A;  5D6F A;  3MKZ A;  2J5P A;  3QRF F;  1Y8Q B;  1G3S A;  2FOK A;  4BY7 J;  3HGY A;  2XPU A;  1RRJ A;  3BZK A;  1IC8 A;  4GGG A;  3GWZ A;  2H6C A;  3ABK H;  4U7B A;  2HDD A;  1D5V A;  3ABL H;  2DMQ A;  1IRZ A;  4KIG A;  1BJZ A;  3TW6 A;  4C2M J;  1N78 A;  3VYU B;  1I6X A;  2CQ7 A;  2LSO A;  1IDZ A;  2A6T A;  4EJV A;  1LVA A;  2EA2 A;  2P4W A;  3KP7 A;  1HA8 A;  2JTV A;  3D0S A;  3FK7 A;  5CKT A;  4L9T A;  3GTJ J;  2LP0 A;  2DOE A;  1ON2 A;  3DU5 A;  3HM5 A;  4NNJ A;  4WWC A;  1JKO C;  1G3Y A;  4P55 A;  2H6B A;  4CSW A;  2KLO A;  1G59 A;  2VIX A;  4B4C A;  4JX5 A;  1YJW I;  1KQ9 A;  4CZC A;  1TWC J;  3OS0 A;  3REO A;  2KZV A;  1I5Z A;  1RC9 A;  2LY1 A;  4GCV A;  3GFJ A;  2VBY A;  1QZE A;  3QPT A;  4DIQ A;  1ZR2 A;  1ZK8 A;  1LKX A;  2BW3 B;  3RIR A;  4RAG A;  2Y2Z A;  3EYY A;  4DYR A;  3L2R A;  2XAF A;  4XID A;  3ECH A;  2R92 J;  2Y0S N;  1VZ0 A;  1VQ7 I;  2CSO A;  3HRU A;  3OSF A;  1I6H J;  3RPU A;  5DCF A;  3BR6 A;  2FBK A;  2FOW A;  2IGO A;  5E1Z B;  5L3G A;  1JGG A;  4LG3 A;  2NVU B;  2ZBK A;  5M5W J;  4I99 C;  2DMN A;  2E60 A;  2EQR A;  2YPR A;  1HW5 A;  4HV6 A;  5F1J A;  2Z9O A;  4PCQ A;  2YS9 A;  3PO3 J;  1RET A;  4XSX F;  4EJT A;  2OQR A;  3IH4 A;  2JA6 J;  3K4B A;  3C1D A;  4IHT A;  1SMY F;  2HPI A;  5BS6 A;  5LGU A;  1I50 J;  1TWG J;  4PJ0 C;  4J01 A;  2DDB A;  3H35 A;  4BEH A;  1IGN A;  2YX4 A;  2EPF A;  5IYD J;  4YG2 F;  2AS5 F;  2K9N A;  3BJ6 A;  2Q0O A;  1EJ9 A;  5E8G A;  2GA2 A;  4XMY A;  1WCM J;  2DMP A;  5FGM A;  3VEP A;  1B6A A;  5CJ9 A;  1OR7 A;  2M7A A;  3T5X A;  4QLC U;  5LRR A;  3OYN A;  3CC4 I;  3IP4 B;  3BG7 A;  3JRC A;  2UXX A;  1RKW A;  1B8I B;  2E1C A;  2MA3 A;  4RLQ A;  3VPR A;  2BHZ A;  5K7F A;  5BOX A;  3GTL J;  1L0O C;  2VAS A;  2DMT A;  2CV0 A;  3AKZ A;  3LST A;  2PJR B;  3RZO J;  3FMQ A;  1XB4 A;  2NVY J;  3CJR B;  3B73 A;  2W4S A;  4YII A;  3KEQ A;  2W00 A;  3DTE A;  1MNM C;  1TNT A;  2AQE A;  3K1P A;  4L5E A;  5GTH C;  4AYB N;  2IGK A;  1XGO A;  5E17 F;  3ZQL A;  3SZP A;  1TQM A;  2Z16 A;  1FX7 A;  3S3M A;  2P5L C;  3JRH A;  2QEN A;  2M8G X;  4MEX F;  1TWH J;  1X1D A;  3HOZ J;  4BJ6 C;  3JRD A;  1OCO H;  4XQF A;  4C2T A;  5E1X A;  2A68 F;  2JT1 A;  3F72 A;  1HLV A;  1S7O A;  2O5R A;  1XGN A;  3I54 A;  1Z67 A;  2XAS A;  1KQ0 A;  2Y48 A;  3B6C A;  4S0H B;  1OIS A;  4ABZ A;  4JX4 A;  2JQ7 A;  3BZC A;  1WWX A;  3IWF A;  1BIB A;  3QU6 A;  1VND A;  1Z6R A;  4HOB A;  2J5O A;  1W1W E;  3E6M A;  1H0M A;  2E1M C;  5FKK A;  5EEH A;  1E3P A;  4P1W A;  4A0Z A;  1I39 A;  3CCS I;  4MO7 A;  4IRH A;  4EVI A;  1MBH A;  2R7T A;  3G2B A;  3CCE I;  2V1U A;  3W2A A;  4A6E A;  4ZH4 F;  4CZZ A;  3FM5 A;  1XMX A;  4HA8 A;  2D2W A;  2UV1 A;  1BC7 C;  2HVQ A;  1MBK A;  2ZJP F;  2ZSI B;  5GAE J;  1FIP A;  1Z7U A;  1A5J A;  5KHD A;  3FXJ A;  4HNV A;  2HZD A;  4RLF A;  2LYC A;  1U8B A;  2AXT C;  1GXQ A;  1BR1 A;  1OYI A;  4H0E A;  3BC8 A;  1OCR H;  2LF8 A;  2XAG A;  3LL7 A;  2P5V A;  2QQ8 A;  2K7L A;  4LJZ F;  5B1A H;  1SVO A;  1XG1 A;  4CA0 A;  1SFX A;  3KP4 A;  2LBF B;  4DOZ A;  3KP2 A;  1U2W A;  2X6Y A;  3T0Y A;  1R5I D;  5D6E A;  1YTY A;  3MZ8 A;  3S15 J;  1WI9 A;  1IJW C;  3BLY A;  5IYB J;  3OYM A;  4MHG A;  1ZKG A;  1Y56 A;  2XGD A;  2VJJ A;  2X85 A;  2XAH A;  1WPK A;  3PQJ A;  5TJJ A;  1DU0 A;  1ZEL A;  4I7H A;  1XX5 A;  1SVM A;  3KYD B;  4HQM A;  2K9L A;  3N4M A;  2XGC A;  2NOJ B;  3SDB A;  3FBN B;  3GF2 A;  4ZZD A;  1X4O A;  3Q0W A;  4L0Z B;  2CRG A;  3L2V A;  1IRF A;  4OAY A;  5HLH A;  2W48 A;  1VQ4 I;  5FB2 A;  3S14 J;  3W6J B;  3QYB A;  1E2X A;  3RDI A;  2R7Z J;  3HRS A;  3G1L A;  2FNP A;  1S8N A;  5KVR A;  3S17 J;  3ERE D;  3VYR B;  1BBY A;  2VBW A;  2XPV A;  1YIO A;  2VKV A;  3OYA A;  2JPB A;  3BTC A;  1UZC A;  1XN7 A;  2KIU A;  1D1B A;  1QNT A;  2YSR A;  3ZMU A;  4BJ5 C;  4ANJ A;  1QBJ A;  1HKQ A;  3TOB A;  5M5Y J;  1K7A A;  3PM1 A;  3S32 A;  4C3J J;  4ENN A;  3O8G A;  3DXJ F;  1KQ8 A;  4N9I A;  3QOE A;  3CES A;  4KIC A;  2CV1 A;  2DXI A;  4PJN A;  1F4K A;  3BG5 A;  3LSM A;  4C9Y A;  4LG0 B;  3E3V A;  3P9C A;  1L3L A;  1BW5 A;  4IHV A;  4MFE A;  3CLO A;  2PI0 A;  2VKE A;  2DO7 A;  3BG6 A;  2XGE A;  4XRF A;  3D1N I;  4A6D A;  4CIC A;  4ASN A;  5A2Q K;  5JFR A;  1GVJ A;  2IS4 A;  2CW0 F;  3R61 A;  2VXD A;  1IN5 A;  1W7P A;  4BYY A;  3QOD A;  2IJL A;  2QZ8 A;  3QPS A;  3IUO A;  1C0W A;  4AIK A;  2EIJ H;  4AIH A;  3ZOB A;  3CF2 A;  1RNL A;  2TRT A;  3H1C A;  3WGH A;  3UKG A;  4M3G A;  2BY3 A;  2GZW A;  1MJA A;  3GUD A;  1Z91 A;  1J5Y A;  4KIB A;  2F5F A;  4IHY A;  2C6Y A;  5B3S H;  1Q1V A;  4PJL A;  3SZG A;  5KNL A;  5JHF A;  5L3C A;  1B59 A;  3LA7 A;  4M3F A;  3RKX A;  3WGI A;  2CQX A;  1NH3 A;  1J9I A;  3M4O J;  3RI4 A;  2VQH A;  3I9V 2;  5LD2 C;  2P81 A;  3V7R A;  2K86 A;  4BHP A;  2MYS A;  2MGQ A;  1JT6 A;  5DYM A;  4FQG A;  1OCP A;  1S5L C;  3IAM 2;  1SFO J;  5IOY A;  4X6A J;  4E7H A;  4KIF A;  2FU4 A;  2BW3 A;  3CUO A;  1EF4 A;  5L3F A;  1HKT A;  2XVC A;  5EJC A;  1GVD A;  2L5Q A;  1KU7 A;  4PGH A;  1X1C A;  1IRX A;  3ZQG A;  1X58 A;  3JTH A;  2VJ5 A;  1RIO H;  1BR4 A;  5KK1 A;  1RKT A;  1AOY A;  2ZB9 A;  1J75 A;  1Z21 A;  3BY6 A;  2K3F A;  1NK2 P;  1RUO A;  1O7F A;  1QPI A;  2I8D A;  2O61 A;  1MNE A;  3BOQ A;  3NAR A;  1Z6T A;  2JPC A;  1O7L A;  1J09 A;  5J1Y A;  2E34 A;  1WGX A;  4XSZ F;  2IA0 A;  3IKV A;  4QWQ A;  4XLE A;  5FLM J;  4CGZ A;  3W6K B;  3V4G A;  4I02 A;  3H0D A;  5C4X J;  3J80 Z;  2MH2 A;  3ZQI A;  5E1W A;  4U7D A;  1U8R A;  3E6C C;  3MZH A;  3PNT A;  4ZDO A;  3FBI B;  1BJA A;  1MBE A;  2R7W A;  3BDD A;  2KPM A;  2M45 A;  6PAX A;  3GCM A;  2DK5 A;  1U78 A;  3W6V A;  3ML6 A;  2A5Y B;  1F36 A;  2M7B A;  2TDX A;  1D1A A;  2CYY A;  1ZAO A;  4IOC F;  4HV5 A;  4GDF A;  4I98 B;  4KN4 X;  1R58 A;  3HL2 A;  2RGV A;  3MWM A;  3EQL F;  1LVK A;  3D5S C;  1JI8 A;  2DA3 A;  2V9P A;  4ESB A;  3G4S I;  2PJR A;  1PVE A;  2JJ7 A;  2PN6 A;  1BI1 A;  4HW0 A;  3ZMS A;  2WB1 N;  3COA C;  3KZI C;  5IP7 J;  2EZI A;  1TC3 C;  2OQG A;  5FRN A;  3GO5 A;  3JR9 A;  1LDD A;  2AXL A;  1JKR C;  2AHQ A;  1A31 A;  3GW2 A;  3DEW A;  3OYB A;  3GFI A;  4E7S A;  3F8B A;  2Q2E A;  2R4G A;  5KAI C;  2VB6 A;  3KE2 A;  3FXQ A;  1FZP B;  5DEQ A;  4A3K J;  2IGN A;  1A04 A;  3K4L A;  4XR6 A;  1X2N A;  1SD7 A;  2E1M B;  3H5N A;  4DZP A;  1Z0X A;  1HST A;  5BQT A;  2JA5 J;  5J4V A;  1IN7 A;  2YX7 A;  3O8H A;  5GPA A;  1VQ6 I;  4N4N B;  3ZQH A;  4B8X A;  2I10 A;  5K7H A;  3J81 Z;  3C7J A;  2EV0 A;  3PIP F;  2D5V A;  2HZT A;  3RKQ A;  3E5U A;  1UG2 A;  3I59 B;  5EGO A;  1IG7 A;  3J7Z I;  2R7Q A;  2LY9 A;  1SAU A;  3IAS 2;  3BG3 A;  1ZR4 A;  3LWF A;  2ZXI A;  5E18 F;  3K9T A;  3CLQ A;  1D0Z A;  4LK1 F;  2EFQ A;  1J2X A;  2FEZ A;  3K6G A;  1X2M A;  2V9V A;  3A0H C;  5EEA A;  3SFI A;  1WH5 A;  1BI0 A;  3FKJ A;  2DOF A;  2QQA A;  4UB8 C;  3HOW J;  1KYZ A;  1QPM A;  2QSF X;  2G7U A;  5AIQ A;  2HQA A;  3QU3 A;  3TMO A;  4AD9 A;  4G8X A;  3ERM A;  4KT5 C;  1ZG3 A;  3TGN A;  2NVQ J;  2AO9 A;  3LA3 A;  3MKY B;  5E3O A;  1H8A C;  3A4C A;  3ZQ7 A;  1VQN I;  5F64 A;  4MFD A;  3R60 A;  2COB A;  4MQV A;  2DPU A;  2M3A A;  3M1E A;  1BIA A;  1ZYR F;  4JYK A;  2OZ6 A;  2EB7 A;  1R36 A;  1KU3 A;  3ROU A;  3WU2 C;  1ZGW A;  4XOP A;  3M8J A;  3VFZ A;  3NRV A;  2YR2 A;  3JRE A;  5FRO A;  1X1B A;  2CG4 A;  1T8I A;  4CHU A;  3GZ6 A;  4M71 A;  4BQQ A;  3KYC B;  5DD8 A;  2QLZ A;  3QWL A;  2CGP A;  1JHH A;  4Z6Y A;  2EIL H;  1RPW A;  3FKI J;  1Y1V J;  2Y31 A;  5HOD A;  3ONQ A;  3QYF A;  3X2Q H;  2VI6 A;  1TTY A;  2WY7 Q;  3OV8 A;  4OWR B;  5J4Y A;  3I5U A;  3BG9 A;  3QOP A;  3E6D A;  1XMK A;  5EZG A;  1WJ5 A;  4X0G A;  4GYI A;  2GLO A;  4BY1 J;  2BVM A;  2LY2 A;  2PMH A;  3BR0 A;  3K69 A;  4UXN A;  5JLX A;  3HOU J;  2A3S A;  5HLG A;  1MW7 A;  2EZL A;  3HHH A;  3FZV A;  3U2R A;  3ZPL A;  4B09 A;  3V7C A;  4XLA A;  1Y8R B;  2VJ4 A;  1AU7 A;  1JT0 A;  2EJR A;  4JBA A;  2GOX B;  1U9O A;  1XD7 A;  3WOD F;  5ERI A;  4RM2 A;  3KPH A;  5EF6 A;  2XV4 S;  1UHW A;  2B63 J;  3PQK A;  1T0F A;  5H6Q A;  2RRE A;  2RVC A;  4BH9 A;  1GUU A;  3HIF A;  3IRQ A;  1EKE A;  5M3F J;  2KHM A;  2H27 A;  3Q0V A;  4QPQ A;  1LEB A;  1J59 A;  3AFH A;  4M9Z A;  4MGR A;  3OR1 C;  3DP7 A;  1FOY A;  3HSF A;  3EDP A;  3ZMZ A;  3BQZ A;  5GAG J;  1W7P B;  1OYW A;  4OU0 A;  1NG6 A;  1VQL I;  1IN4 A;  4IL6 C;  1OMI A;  2H8R A;  5JLW A;  3FIW A;  4KA4 A;  2EFW A;  3A02 A;  4RB0 A;  5GAD J;  2EIN H;  1SFE A;  2EV5 A;  4XLH A;  5DS9 A;  4BAY A;  1JE8 A;  1ETV A;  1X3Z B;  2STW A;  5BPD A;  4XM3 A;  2EIK H;  2NNY A;  4QSH A;  1BI3 A;  3JSP A;  2QGU A;  3CCV I;  2X1E A;  4ENJ A;  1STZ A;  4ZZL A;  5FKO A;  3OYK A;  3SHF A;  1IDY A;  3IL2 A;  3LSJ A;  3RKY A;  3I4N J;  1X3U A;  3F3X A;  3PSF A;  1B72 A;  1K79 A;  3CC7 I;  2BYV E;  3QAH A;  2LFB A;  2V9K A;  4NC6 A;  1GV2 A;  2VJI A;  4NB5 A;  3VOD A;  3JAM K;  3F0C A;  3A01 A;  3VYT B;  2Z2S B;  1P6R A;  4G6T B;  4YRV A;  4CCN A;  2M4K A;  5D5W B;  1ETY A;  4J19 A;  2FA5 A;  2HDW A;  2QQ9 A;  2X6W A;  2CFO A;  1HQC A;  3CC2 I;  4N0B A;  2LLK A;  3C3W A;  3RSN A;  4Q4Z F;  3JRI A;  3OR2 C;  5FFX A;  2RV8 A;  1MGT A;  3MKL A;  3BPX A;  1U5T B;  1XPX A;  3AL0 B;  3S2H J;  2BGC A;  2Y75 A;  1QZY A;  4OAZ A;  4A0Y A;  1W5S A;  3DTI A;  3T8R A;  3BCB A;  2VLA A;  2ZJQ F;  1QVU A;  2JVG A;  2V79 A;  4KYW A;  2HGC A;  3I53 A;  2KFD A;  4CCL A;  2O8X A;  3BTJ A;  4PDK A;  4XLF A;  4R79 A;  3DBR B;  1HBX G;  4RGX A;  3BTL A;  4IRI A;  3HJE A;  1LB2 A;  5LGN A;  3RPU D;  4MLO A;  3IC7 A;  5F08 A;  5HDK A;  2LR8 A;  4LIT A;  1N75 A;  2H09 A;  4BQA A;  1IW7 F;  3K1M A;  1R5H A;  2ELJ A;  2IP2 A;  5CPR B;  2MBF A;  5HNF A;  4RB1 A;  3HYI A;  3LSI A;  3CO6 C;  3ISP A;  2DLL A;  1LUJ B;  1TLH B;  3EPZ A;  4FTH A;  4PJM A;  5FRM A;  3KZZ A;  1QHH D;  3M7G A;  1TT5 B;  1TQP A;  4F92 B;  3LSP A;  3LAP A;  5H20 A;  4CYC A;  2K9Q A;  2IS6 A;  3WHB A;  4M3E A;  2L9R A;  4B43 A;  2V1N A;  1ZRC A;  1W0U A;  1H9T A;  2HKO A;  2HPM A;  3OMY A;  4Y13 A;  2HTS A;  2FNA A;  1MJB A;  2ZNY A;  3E5Q A;  4XON A;  4EGY A;  1REP C;  3JRA A;  4QPO A;  2LRE A;  2M34 A;  2R7X A;  4YFK F;  1RR8 C;  2WA0 A;  2LRD A;  4HZF A;  3WGG A;  1JTX A;  3DWL E;  4RDU A;  2DU9 A;  3GYH X;  2WTE A;  2OJE D;  2IBD A;  4DBQ A;  1HF0 A;  1D8J A;  4CUG A;  4KN7 X;  2E1N A;  2UZK A;  2ETH A;  2IA1 A;  2P6T A;  2WV1 A;  3KEO A;  1O3T A;  3QP5 A;  1OFC X;  2DMU A;  2MC4 A;  1FSE A;  2Z99 A;  1QU3 A;  1YG2 A;  1MBF A;  2DYR H;  1T98 A;  2K9S A;  2FQ3 A;  2BOL A;  3U1K A;  2EFP A;  2JSC A;  1K6Y A;  4V19 K;  4ZYA A;  2NS7 A;  2OTL I;  2CUF A;  5FFZ A;  2ZXJ A;  3V8J A;  5EG0 A;  1PP7 U;  4HF2 A;  4AYB A;  4LLG F;  3WHC A;  1ZRD A;  3I59 A;  4D5C A;  4CXF A;  2XC7 A;  2DA4 A;  2FE3 A;  4MEY F;  4KNY A;  4KMU X;  3OIQ A;  4ZTJ A;  3TDU C;  1H88 C;  4GYG A;  1S7E A;  4DQ2 A;  2V26 A;  3IWZ A;  3OYI A;  3RQI A;  5LHH A;  5DTD A;  2JWT A;  3U1D A;  1BC8 C;  3OYC A;  2RDP A;  1IN6 A;  3V8L A;  5JHU A;  2K4B A;  2YU3 A;  4ZC3 A;  5HOO A;  3IRR A;  3AL0 C;  2ZC2 A;  1GHC A;  1ZN2 A;  3C2H A;  4RAY A;  3T8T A;  3EYI A;  1R71 A;  2KP6 A;  3RQ4 A;  1WVR A;  3M9A A;  4BBR J;  3QP6 A;  1PUE E;  3LQQ A;  3ZP5 A;  3CO7 C;  4L9J A;  4S04 A;  2YU9 J;  1WKM A;  3H9G A;  2I5U A;  4II2 A;  3ZGK A;  2QYO A;  1WJE A;  4I01 A;  2DA1 A;  1IUF A;  3CJT B;  2X51 A;  2GBY A;  1YI2 I;  2OC6 A;  2MH9 A;  2E2J J;  4Y7N J;  3WTS C;  3K4J A;  2ID6 A;  3S3N A;  1R7J A;  2OA4 A;  3Q9V A;  4HDV A;  1XS9 A;  1W36 D;  1W36 C;  4XN0 A;  4A3M J;  1BI2 A;  4BDZ A;  5J8F A;  3LNQ A;  3K1N A;  2ZNZ A;  2DJN A;  4XOT A;  1R22 A;  1LJ9 A;  3CCM I;  5FLV A;  1EH7 A;  3K4M A;  2CMP A;  2COM A;  1OR7 C;  1P2F A;  3G3Z A;  2WAE A;  1LE8 B;  2TCT A;  3SJM A;  3CP8 A;  2F5V A;  2VT2 A;  4IPA A;  4FT8 A;  3ZCO A;  2JSP A;  1KA8 A;  2UWM A;  2FRH A;  3EUH C;  1X1A A;  5GTI C;  4LK0 F;  1FOX A;  4KIS A;  5EEG A;  2XB0 X;  4FE7 A;  2DT6 A;  3WG7 H;  3ZN0 A;  4M9S A;  1YFH A;  4UVB A;  2HR3 A;  4Y15 A;  2OPT A;  1X3W B;  4PZJ A;  2W24 A;  1T56 A;  3AG2 H;  3O2P E;  5L3D A;  4D5F A;  2CW8 A;  4JK1 X;  2KQR A;  3E97 A;  5J1R A;  1UAA A;  3ECO A;  3WTT C;  3O3K A;  3QQA A;  2FQ4 A;  3HDD A;  3OSG A;  1K78 B;  5LBQ A;  5LEJ A;  4HQE A;  2K9M A;  3HOT A;  1A36 A;  2VQL A;  1P7J A;  2FD5 A;  5AON A;  3RYP A;  4QTR A;  2DOA A;  4RS8 A;  3L2C A;  3K7A J;  2VPL A;  5JI6 A;  2QBY B;  4HSR A;  2LNB A;  3ZMT A;  2LOO A;  1LNW A;  4JQF A;  4RMN A;  3PFI A;  1ETK A;  2MLK A;  4II3 A;  2RN7 A;  4I0B A;  3CDL A;  4IF4 A;  2BXZ A;  2W57 A;  4LB5 A;  1R6R A;  3PSI A;  1BOB A;  3FX3 A;  2N8G A;  3S8P A;  1F9N A;  1YRN B;  1MBG A;  4CCK A;  4A3F J;  1NTC A;  4XLN F;  5IY5 H;  3QYE A;  3LFU A;  1TW3 A;  2KT0 A;  2OD5 A;  1D0Y A;  2CUJ A;  1CGP A;  2A6E F;  5DDG A;  3S2W A;  1FNN A;  2D1H A;  3SEQ A;  1JKQ C;  4D7N A;  1FC3 A;  2ELK A;  2RNJ A;  3H3V K;  5TRD A;  2H94 A;  1ULY A;  2EK5 A;  1HSJ A;  2NOG A;  3OOU A;  5EGO B;  1YW7 A;  2ESN A;  3C2B A;  4LIV A;  2F5C A;  3C18 A;  2BY0 A;  4LD5 A;  1U3E M;  4DZJ A;  1YE9 A;  1I1G A;  1ON1 A;  1U5T C;  2DAO A;  2GWR A;  2NVX J;  3Q5F A;  5D8L B;  2M0M A;  5FD5 A;  1VQ9 I;  4CYD A;  2H1K A;  5D5V B;  2DQL A;  2FBH A;  3E6B A;  1R1U A;  4UVC A;  3WTU C;  1MSE C;  2W25 A;  4B3X A;  4HNU A;  4EJU A;  3TO7 A;  4E7K A;  1F1Z A;  2E7W A;  2DFF A;  2LBF A;  2JA2 A;  2VE8 A;  4M6V A;  5M5X J;  3HOV J;  1FYM A;  5ILU A;  1JUP A;  2PMZ N;  2G0E A;  2QKM B;  4ZJZ A;  1JJ8 C;  3CF5 F;  2HOS A;  2E5N A;  4NUB A;  2OZU A;  4A0X A;  3N05 A;  4V2F A;  2DOD A;  2W7N A;  4NQW A;  4BQN A;  2VON A;  2PEX A;  1FJL A;  4ZYE A;  2GIZ A;  5FD6 A;  3ZN1 A;  4A3I J;  4YFX F;  3WE3 A;  5CQG A;  1AWC A;  2CQN A;  2XGX A;  4FE4 A;  4M3D A;  2JUG A;  2ZME C;  1XMA A;  2EV6 A;  2MSY A;  2PX9 A;  4D1Q A;  2R5Y B;  3S3O A;  1LE8 A;  3DPL C;  3MFK A;  1B1B A;  2F2E A;  3NWS A;  3W3C A;  5FKM A;  2HOT A;  1YJN I;  5DM6 F;  4HAM A;  2O3F A;  4HRI A;  1OPC A;  1IUY A;  4BNC A;  2L02 A;  4RB3 C;  4IRG A;  4WCG A;  4CYC B;  4JOM A;  1S3J A;  1WRJ A;  2A05 A;  1JHF A;  1USS A;  3HUG B;  4WK8 F;  2WC2 A;  3HUG A;  1CF7 A;  2ZFU A;  1KU9 A;  2ZKZ A;  2IVM A;  4HPQ A;  3DU6 A;  4BE1 A;  4LIU A;  1XGM A;  3DKW A;  4A5N A;  4C2U A;  2QM3 A;  4IJA A;  3VB2 A;  1SAX A;  3FXR A;  4Z2Y A;  1JJ6 C;  1PUF A;  2HVS A;  4KDP A;  1IO2 A;  2KL4 A;  3QPL A;  4BJT A;  1LPQ A;  4WF2 A;  1RUN A;  2DA6 A;  5ICF A;  2L01 A;  2VBX A;  1FMV A;  4MTD A;  3IH3 A;  4E6K G;  3I71 A;  2QSG X;  2UUZ A;  2DA7 A;  2VOO A;  1Y0N A;  2A5W A;  2VXZ A;  4XNF A;  4E4H A;  2KDZ A;  2FX0 A;  3K10 A;  1R1T A;  4QIW N;  3EET A;  4A12 A;  4BXX J;  1EV7 A;  2LKX A;  1XSD A;  2BHY A;  1QVT A;  1FP2 A;  3HC7 A;  5KCM A;  1S6L A;  2XAJ A;  2B0L A;  2K5C A;  1ZH5 A;  2IPQ X;  3ESW B;  4W1U A;  4IKF A;  1MBJ A;  2PBI A;  3OL4 A;  5BPI A;  1IAW A;  4XLC A;  3ZQC A;  3AG1 H;  1HC8 A;  2NS8 A;  4V2G A;  1ZRE A;  2KRC A;  2HEO A;  4R8H A;  4XIC A;  2XDV A;  3GTK J;  3HRM A;  1W5C C;  3KP5 A;  1O3S A;  4EMS A;  1T95 A;  5D5X B;  4AM3 A;  3GEZ A;  3I64 A;  2M30 A;  2EFO A;  2E1O A;  4LOC A;  3J7A Y;  2X6X A;  3DLL F;  4IOA F;  2XRL A;  4M72 A;  2GA1 A;  4HX7 A;  5J47 A;  3VWB A;  3HXL A;  4EM0 B;  3SZT A;  3ELK A;  1I3A A;  1IXR C;  4E7Z A;  2XPW A;  4MQ9 F;  3RZD J;  1FWZ A;  3M8E A;  3WTY C;  3MD2 A;  1HDP A;  1X1P A;  2H8W A;  4XL9 A;  2VPR A;  1YO5 C;  2CU7 A;  3JSO A;  3CMY A;  2JA8 J;  4RGU A;  3ZMD A;  1IV6 A;  2R0Q C;  1AKH B;  2OU2 A;  3A2K A;  1TQI A;  2M5W A;  1H9G A;  4M73 A;  4P5O A;  5JR3 A;  4EM1 A;  4N9H A;  2A07 F;  4BL0 B;  1T2K A;  1U5T A;  3FXO A;  3V7S A;  3MZY A;  3Q3S A;  3DQV C;  2LD5 A;  2GXB A;  2LC2 A;  3KEY A;  3M8F A;  4C3I J;  5B1B H;  1LQ1 A;  1Y0U A;  1ORK A;  2Q1Z B;  3G1O A;  3L2U A;  5FKN A;  4RBO A;  4A3L J;  1E0E A;  3DPU A;  5BMZ A;  2XKP A;  4HF0 A;  2OUM A;  4LFU A;  1U6G A;  2IGM A;  3FK6 A;  3HOX J;  1SD5 A;  3I4M J;  4H4K C;  3RCO A;  4OIQ F;  2R5Y A;  5K5Q A;  1D0X A;  5IT3 A;  3OYG A;  3IV5 A;  3D5L A;  2R7O A;  5D4S A;  2E2I J;  1W5T A;  2VN2 A;  5E3L A;  3I55 I;  3H9Q A;  3QPH A;  4Y33 A;  4BXU A;  2KKO A;  1HXD A;  2W84 A;  2Z33 A;  2R7S A;  3F8N A;  4TV7 A;  2EZK A;  1YIJ I;  3VSL A;  1ZLJ A;  2IRF G;  1BM9 A;  1RES A;  1MZB A;  1B4A A;  3LSG A;  5D8K B;  2L0K A;  1HW2 A;  5FKL A;  1T0F C;  2VE9 A;  1ACI A;  3ZRG A;  4HLX A;  3VSK A;  5E8I A;  4RGR A;  2QBY A;  1DGW Y;  3GTM J;  3TP0 A;  3OYJ A;  1SD6 A;  1YW8 A;  1S9H A;  5TIS C;  1WHU A;  4P9F A;  3ASO H;  4YEL A;  2Y9Y A;  1WZ2 A;  1Q1H A;  5CLS A;  1R4N B;  2F4M B;  3TP3 A;  1ZRF A;  3H9J A;  2ID3 A;  2LG4 A;  2F6C A;  3BJO A;  1A6I A;  3NQO A;  2K02 A;  4LGW A;  1HCR A;  3CUQ A;  2MC3 A;  4HST A;  2Q2E B;  1YS6 A;  1YS7 A;  2KIS A;  1ONV A;  2VKD A;  2K4J A;  2WAQ A;  3OIO A;  2VC0 A;  2DFI A;  4FHT A;  1DP3 A;  3ABU A;  1MMG A;  1YX5 A;  3I58 A;  2M87 A;  5ED4 A;  1FYK A;  5GP9 A;  5ILS A;  2VQC A;  4YEJ A;  1OCC H;  1LDK B;  4PGG A;  4I0A A;  4I76 A;  5F0F A;  1RI7 A;  3BJA A;  3GLL A;  5DUK A;  2P7C B;  1I27 A;  4BUP A;  3DV8 A;  1QGP A;  3F6O A;  3FWE A;  3GXO A;  3GTG J;  4LMY A;  2A6H F;  4PUS A;  2HKX A;  5TGT A;  5DCM B;  3LAJ A;  2PG4 A;  4BU2 A;  3GTP J;  1P4A A;  4FAS D;  2WB1 A;  2VKH A;  1ETO A;  1Z3X A;  3MAJ A;  4L9V A;  2FF4 A;  3OYF A;  1K4T A;  2R5Z B;  1ETX A;  3IHU A;  3PNV A;  1XTA A;  3TO6 A;  4MIM A;  2DBB A;  5HS7 A;  1OKR A;  1V5G A;  3WTX C;  5J8C A;  2O6G E;  3O6B B;  1VQM I;  2XF7 A;  3WTV C;  4BHB A;  1K83 J;  1KU2 A;  2JVH A;  5HNH A;  4ETS A;  4FET A;  2KIF A;  3AG3 H;  3OYE A;  4ITV A;  1YQA A;  2PMZ A;  3E5X A;  5F6F A;  5D5U B;  1O4X A;  4UUS B;  1V54 H;  1AHD P;  1SD4 A;  4IQJ A;  4I09 A;  2EZH A;  1QA6 A;  3I3L A;  1IF1 A;  3LOC A;  1B72 B;  4AU7 A;  3PJR A;  1D8K A;  2HVR A;  2W85 A;  3KZY A;  5HS9 A;  3CCL I;  3L2W A;  5CVR A;  3RKW A;  4OIR F;  1YYV A;  2EA4 A;  3KLN A;  1OLT A;  1SMT A;  1G6N A;  1HOM A;  2FMY A;  3V42 A;  4A3C J;  2L4M A;  3GVA A;  3E7L A;  1MKM A;  2NYX A;  3BR3 A;  4XKC A;  2KRF A;  4UV9 A;  1UJ8 A;  4C30 A;  1YLF A;  3FF5 A;  5A2Q Z;  4KFC A;  3FMS A;  4RB2 C;  1ZQ3 P;  2HYJ A;  1FBS A;  4A69 C;  3A0B C;  4RAF A;  3H5R A;  1D3Y A;  1HDD C;  4U0V A;  1WFX A;  1EH6 A;  4O3M A;  2DCE A;  2VC1 A;  4IHS A;  2E19 A;  3G1M A;  1YIT I;  4RA2 A;  2NS0 A;  1LFU P;  2XHK A;  4KUM A;  3VDX A;  1UST A;  4OIN F;  3K4N A;  2ACJ A;  4M6Y A;  2JZY A;  3ABM H;  4CCJ A;  3VYS B;  3LSH A;  4BKX A;  3GZ5 A;  5CQE A;  3RTR A;  1PP8 F;  1O57 A;  3H92 A;  4G12 A;  4A93 J;  1TW2 A;  1EA3 A;  2K40 A;  3DTK A;  4FCY A;  3F22 A;  5LHI A;  2Y9Z A;  3SQN A;  2B7E A;  3CZ6 A;  2JN6 A;  3KCC A;  3L09 A;  2DTR A;  2WY8 Q;  1UMQ A;  2P6S A;  4NDL A;  4ZYD A;  4KIT B;  4EV0 A;  4RM3 A;  4B47 A;  2QVO A;  4PSX A;  3TKY A;  5C44 J;  2EFN A;  2L7M P;  4YIF A;  1FTT A;  5JVG F;  4HF1 A;  3BR2 A;  4L9N A;  1N77 A;  5IP6 A;  1P7I A;  2Z5U A;  1WSU A;  2HI3 A;  4UVA A;  2ECB A;  2JUC A;  4OOI A;  3CCJ I;  4PFP A;  3KIO A;  1VI0 A;  2DQR A;  1P4X A;  3A03 A;  3TOA A;  3HRT A;  4KJZ A;  3L7W A;  4FIS A;  1ZHF A;  1UG0 A;  5E20 A;  1VFC A;  1R23 A;  4BBS J;  2DJI A;  1T08 B;  5J1U A;  4RGS A;  4NBQ A;  2QWW A;  3GTO J;  4XRS A;  2L7Z A;  3BRO A;  3TL4 X;  4ZYG A;  4HG2 A;  4ESF A;  4LG0 A;  1SEU A;  2IEK A;  1JKP C;  3OYH A;  3MVP A;  1S29 A;  2Y69 H;  3PUF A;  4AWX B;  2OCC H;  3F6V A;  3TED A;  1RZ4 A;  4HDU A;  4IEJ A;  3CTA A;  1MND A;  4LB6 B;  3P5J A;  2HOE A;  4Y4R A;  3H0G J;  4IX7 A;  2B9S A;  1YX3 A;  2CV2 A;  3PL8 A;  2V1D A;  1DPU A;  2F4O B;  5EG0 B;  2XIG A;  2Y0S A;  1GT0 C;  1S72 I;  1YHQ I;  1Y6I A;  5LHG A;  1DP7 P;  4XOR A;  3JRF A;  3F23 A;  1W0T A;  3KYL A;  2DI3 A;  5IP9 J;  3MKW B;  4XRM A;  1E17 A;  1BR2 A;  5LGT A;  1ZTR A;  3FXM A;  4Q5S F;  4BE2 A;  1VF9 A;  5CVU A;  1ENH A;  1P4W A;  2G7H A;  1KGS A;  3Q0U A;  2VOP A;  1PDN C;  2R7D A;  3PUB A;  4ON0 A;  3ZXS A;  1APL C;  2R93 J;  5J40 A;  4G6Q A;  4EQQ A;  3ZQQ A;  3MCZ A;  4M9X A;  4EJO A;  1OCZ H;  3R0J A;  2GIV A;  2ZXW H;  1WJD A;  1H89 C;  2BXY A;  3K70 C;  3BZ6 A;  4G7Z F;  3FHZ A;  4B3A A;  3IKT A;  3CUQ C;  2CUZ A;  2IT0 A;  4A5M A;  3S1N J;  4A3G J;  4U87 A;  1T6S A;  2HQ5 A;  1D5Y A;  2CQK A;  1G4D A;  1R5G A;  4YIR X;  2V6E A;  1BW6 A;  1X4P A;  2LH9 A;  1A6Q A;  5K7Z A;  2X9D A;  1G8X A;  2MD0 A;  1GXP A;  2VT3 A;  2CW7 A;  1GDT A;  2FJ1 A;  2M2E A;  2OAZ A;  5J6X A;  4G9Y A;  2WWY A;  3HPH A;  3LSK A;  3SDG A;  2MAB A;  2QSH X;  2CO5 A;  2RKH A;  1SVL A;  4CH7 A;  2R7V A;  2R7U A;  4S05 A;  2QQB A;  2F5D A;  5LRS A;  2HFH A;  1J0R A;  5E3M A;  2KIM A;  3I4P A;  2E35 A;  4D0P A;  2WAD A;  1ERD A;  2L9N A;  1UFM A;  3HOY J;  2L9S A;  4DW6 A;  1XGS A;  4BHC A;  3GLX A;  3W2V A;  2HQN A;  3CD6 I;  1R1V A;  2V4J C;  3F8F A;  3BCA A;  5F27 A;  2CS3 A;  2L9V A;  5CVI A;  4EJW A;  1PUF B;  3CDH A;  1FOW A;  2X4H A;  5E79 C;  3CCY A;  5F1R A;  1FY7 A;  4IQ4 A;  3CCU I;  2ZME B;  3EUK L;  3NWT A;  4PJJ A;  3TDZ C;  3DKY A;  2DN0 A;  3NEU A;  4AIJ A;  1MMA A;  2BEO A;  1I1S A;  5F0H A;  1CQT A;  2HDC A;  3SYT A;  1W4M A;  1MMD A;  1WJF A;  3FHN A;  5ICE A;  4PSW A;  4IHX A;  5HDN A;  2HWV A;  2W1O A;  3L00 A;  3DEU A;  1ZAR A; 
#chains in the Genus database with same CATH homology
 4JOM A;  3HUG B;  3MKY B;  4DJA A;  3CMM A;  3A4C A;  4U7B A;  2ZFU A;  2IS2 A;  4BAC A;  4HPQ A;  3DU6 A;  4BE1 A;  2M3A A;  4LIU A;  4C2U A;  1N78 A;  3VYU B;  4XOP A;  3M8J A;  2HVS A;  2A6T A;  2KL4 A;  3MMY B;  4BJT A;  3C2G A;  1HA8 A;  3UNG C;  5FRO A;  1X1B A;  5CKT A;  4BQQ A;  1FMV A;  3DU5 A;  4E6K G;  4NNJ A;  2UUZ A;  2A5W A;  2VXZ A;  2L7K A;  4CSW A;  4XNF A;  2KLO A;  3ONQ A;  3QYF A;  2WY7 Q;  2VIX A;  4E4H A;  1G59 A;  4OWR B;  2BVL A;  4CZC A;  2M4G A;  1Z7L A;  3K10 A;  3OS0 A;  4E7J A;  2KZV A;  4F3Q A;  1WJ5 A;  1QHG A;  3LMM A;  2LY1 A;  4X0G A;  2BVM A;  2LY2 A;  2RQQ A;  3HC7 A;  5KCM A;  4F52 A;  2K5C A;  4DIQ A;  3L2Q A;  1LKX A;  2BW3 B;  1MW7 A;  3L2R A;  1VZ0 A;  4BE0 A;  4IKF A;  3OL4 A;  3HOS A;  4XLA A;  2VJ4 A;  4XLC A;  2IGO A;  1WJB A;  2GOX B;  4LG3 A;  2KRC A;  2XDV A;  2E60 A;  4RM2 A;  1NG7 A;  1T95 A;  2OV7 A;  2RRE A;  3J7A Y;  2X6X A;  3K4B A;  2KHM A;  2HU9 A;  3FDY A;  3VWB A;  2HPI A;  4QPQ A;  2ZSH B;  3HXL A;  3AFH A;  4J01 A;  3KX2 A;  3OR1 C;  4E7Z A;  4B44 A;  3H35 A;  4BEH A;  3MD2 A;  1NG6 A;  4XL9 A;  3SEZ A;  3OYD A;  4XMY A;  3EUA A;  2AQF A;  3M1C A;  2M7A A;  4XLH A;  3OYN A;  3IP4 B;  3A2K A;  3BG7 A;  4P5O A;  4BL0 B;  4XM3 A;  4RLQ A;  2X1E A;  3K70 D;  4GRI A;  2V7F A;  3DQV C;  3OYK A;  4BS9 A;  2LC2 A;  2VAS A;  3KEY A;  3PSF A;  2CV0 A;  3AKZ A;  2PJR B;  2Q1Z B;  2V9K A;  3L2U A;  3CJR B;  2W4S A;  2VJI A;  4PK4 A;  1E0E A;  3DPU A;  4NC7 A;  2W00 A;  2W82 A;  3DTE A;  3VYT B;  1Z3Y A;  2OUM A;  2Z2S B;  2AQE A;  4G6T B;  4YRV A;  4CCN A;  2M4K A;  2IGM A;  4H4K C;  3RCO A;  2IGK A;  2HDW A;  3S3M A;  1D0X A;  2X6W A;  2Z16 A;  2CFO A;  3OYG A;  3D5L A;  2R7O A;  2WBM A;  3H9Q A;  1X1D A;  4Y33 A;  4BJ6 C;  4XQF A;  4C2T A;  3RSN A;  2R7S A;  3OR2 C;  3VSL A;  2O5R A;  3LSG A;  3AL0 B;  4OAZ A;  3CP2 A;  1T0F C;  4XKB A;  3DTI A;  3BCB A;  3ZRG A;  2VLA A;  3VSK A;  2JVG A;  1DGW Y;  3OYJ A;  4CCL A;  5LFA A;  4XLF A;  1S9H A;  4R79 A;  2KDO A;  3DKX A;  1TZL A;  4YEL A;  2E1M C;  4BDY A;  4P1W A;  3RPU D;  3DPT A;  4MLO A;  4B48 A;  3H9J A;  2R7T A;  3G2B A;  4LIT A;  1N75 A;  2LG4 A;  2F6C A;  2MFZ A;  3W2A A;  2ELJ A;  3E0J B;  5CPR B;  3ZR8 X;  4HST A;  2UV1 A;  5HNF A;  2HVQ A;  2Q2E B;  3DLA A;  2ZSI B;  4J00 A;  3OS1 A;  3K4K A;  2VKD A;  2WAQ A;  5KHD A;  3LSI A;  1MMN A;  2HZD A;  4RLF A;  2LYC A;  3EPZ A;  4PJM A;  5FRM A;  1DP3 A;  1BR1 A;  1QHH D;  2X1C A;  1MMG A;  1YX5 A;  3BC8 A;  3LL7 A;  2XSJ C;  2Z1D A;  4F92 B;  2VQC A;  2FUG 2;  4YEJ A;  4CA0 A;  1LDK B;  4XKV A;  2IS6 A;  3S93 A;  2LBF B;  4DOZ A;  2X6Y A;  2CH0 A;  4BUP A;  4B43 A;  2V1N A;  2HPM A;  3OMY A;  4PUS A;  3BLY A;  3OL3 A;  5TGT A;  3OYM A;  4XON A;  4BU2 A;  4QPO A;  4Y3O A;  2LRE A;  4FAS D;  1Y56 A;  2R7X A;  2VJJ A;  2VKH A;  2WB1 A;  2X85 A;  1Z3X A;  4BQO A;  2WA0 A;  1ZEL A;  2LRD A;  3OYF A;  3PNY A;  3PNV A;  2K9L A;  3DWL E;  3OIP A;  4KT6 A;  2NOJ B;  3SDB A;  3FBN B;  4DGW B;  4DBQ A;  1V5G A;  1X4O A;  4CUG A;  1TT0 A;  3L2V A;  2IXS A;  2XF7 A;  3OS2 A;  4OAY A;  2XF5 A;  1AA7 A;  2JVH A;  5HNH A;  2MC4 A;  4FET A;  5HVQ C;  3QYB A;  3HG9 A;  3A1Y A;  1QU3 A;  3OYE A;  4ITV A;  2PMZ A;  1P9Q C;  2BOL A;  1K6Y A;  2L2O A;  2QKL B;  4ZYA A;  4IQJ A;  3VYR B;  3HPG A;  5HLT A;  1PYV A;  4AYB A;  3I3L A;  3OYA A;  2VL8 A;  4AU7 A;  3PJR A;  2HVR A;  2XC7 A;  3L2W A;  2E5Z A;  3OIQ A;  1D1B A;  4ZTJ A;  2ZXH A;  4BJ5 C;  4ANJ A;  2V26 A;  1OLT A;  3OYI A;  2DT7 B;  3V42 A;  3S32 A;  4AVZ A;  1SFK A;  3OYC A;  4XKC A;  5HOO A;  4ZC3 A;  3AL0 C;  3QOE A;  4HNT A;  3CES A;  4C30 A;  2CV1 A;  2DXI A;  4PJN A;  3C2H A;  3LSM A;  4C9Y A;  2R7R A;  1FMW A;  2KP6 A;  3RQ4 A;  2K3P A;  3BG6 A;  2IS4 A;  3H5R A;  3H9G A;  4BEH B;  4II2 A;  3ZGK A;  2VXD A;  1WJE A;  1WFX A;  4F93 B;  2X51 A;  2DCE A;  3QOD A;  3IUO A;  2OC6 A;  3K4J A;  3S3N A;  1W36 D;  3CF2 A;  1W36 C;  4XN0 A;  3VDX A;  4BDZ A;  1DQU A;  3K4N A;  4F91 B;  4CCJ A;  3VYS B;  3LSH A;  4PJL A;  4XOT A;  3SZG A;  5CQE A;  5KNL A;  5JHF A;  3RTR A;  1LFP A;  3K4M A;  2CMP A;  2RNG A;  1OR7 C;  4BGD A;  2WAE A;  1EA3 A;  2P0W A;  3DTK A;  3CP8 A;  2F5V A;  3ZCO A;  2VQH A;  3CZ6 A;  3I9V 2;  2JSP A;  2WY8 Q;  3OWT A;  2UWM A;  3EUH C;  5LD2 C;  1X1A A;  4HEA 2;  1X19 A;  4KIT B;  4KIS A;  2MYS A;  4ZDL A;  4RM3 A;  4B47 A;  3F9K A;  4PSX A;  3IAM 2;  2DT6 A;  1U0J A;  4E7H A;  1N77 A;  4ZDP A;  2BW3 A;  2CW8 A;  4PFP A;  2KQR A;  2KMU A;  1UAA A;  1PJR A;  2L5Q A;  1X1C A;  1IRX A;  4KJZ A;  2VJ5 A;  1UG0 A;  1BR4 A;  2K9M A;  3HOT A;  2VQL A;  1Z21 A;  2DJI A;  2DOA A;  2VPL A;  4HSR A;  2I8D A;  1MNE A;  3TL4 X;  2HNH A;  4NQW B;  2IS1 A;  2LOO A;  3PFY A;  4JQF A;  4RMN A;  4HG2 A;  1J09 A;  3OYH A;  2XF6 A;  4XLE A;  3UR3 C;  4II3 A;  3H0D A;  1MND A;  3GBG A;  3PNT A;  4Y4R A;  4ZDO A;  4IX7 A;  3FBI B;  1R6R A;  3PSI A;  1BOB A;  1YX3 A;  2CV2 A;  2F4I A;  3PL8 A;  2R7W A;  2KPM A;  3W2W A;  3S8P A;  2Y0S A;  4CCK A;  1UEL B;  1Y6I A;  4XOR A;  3QYE A;  3LFU A;  3KYL A;  2M7B A;  2WAF A;  1D1A A;  3MKW B;  2KRH A;  4CCM A;  1BR2 A;  1D0Y A;  2CUJ A;  4BE2 A;  3HL2 A;  4D9J A;  1LVK A;  3D5S C;  3PUB A;  1JI8 A;  3SEQ A;  3OYL A;  3ZXS A;  3HKZ A;  1WJA A;  2PJR A;  3ZQQ A;  4XN3 A;  2XAU A;  3OOU A;  1WJD A;  4LIV A;  3K70 C;  2X1D A;  5FRN A;  3H5A A;  3U21 A;  2CUZ A;  1YE9 A;  4U87 A;  3OYB A;  4E7S A;  2V6E A;  1KON A;  4EAT A;  4DBR A;  1X4P A;  2LH9 A;  4E7I A;  2M0M A;  2R4G A;  1G8X A;  2MD0 A;  2VB6 A;  2CW7 A;  3E1S A;  4N4O B;  2IGN A;  1GLN A;  3K4L A;  4XKW A;  4XR6 A;  4ZTF A;  3HPH A;  2E1M B;  3H5N A;  3LSK A;  3TBI A;  1D1C A;  4B3X A;  4HNU A;  2GOM A;  2MAB A;  4NC8 A;  2R7V A;  1WJC A;  4CH7 A;  4E7K A;  2R7U A;  2LBF A;  3K4C A;  2JA2 A;  4N4N B;  2QKM B;  4ZJZ A;  2E5N A;  1V5F A;  4NUB A;  2WAD A;  1ERD A;  2L9N A;  3N05 A;  2L9S A;  2W7N A;  4E7L A;  3W2V A;  4BQN A;  2VQG A;  2V4J C;  2R7Q A;  1SAU A;  3BCA A;  3IAS 2;  2CS3 A;  3CJQ B;  3DEE A;  4CCO A;  2ZXI A;  5CQG A;  1V5E A;  1D0Z A;  2JUG A;  4IQ4 A;  3K6G A;  4D1Q A;  3EUK L;  3NWT A;  4PJJ A;  3S3O A;  3DKY A;  3OY9 A;  4PFO A;  1MMA A;  4BXF A;  1DGR M;  3DPL C;  3D5R C;  4F55 A;  3FKJ A;  3NWS A;  3W3C A;  3SYT A;  4IZZ A;  4HRI A;  1MMD A;  1WJF A;  3FHN A;  3MKZ A;  4PSW A;  2HQA A;  2W1O A;  3TMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...