2VQLA

Crystal structure of porb from corynebacterium glutamicum (crystal form iii)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
76
structure length
76
Chain Sequence
b'LSPQYNWVACGILEGGLKAAGVLEEGQYNRELAEAIAAKGEGFWTTQFPQIGDWNEDQAAALADRAQTCGLVKADT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UNCHARACTERIZED PROTEIN CGL0972
publication title A Putative Alpha-Helical Porin from Corynebacterium Glutamicum.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Membrane protein
total genus 26
structure length 76
sequence length 76
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11565 PorB Alpha helical Porin B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1280 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vqlA00
2VQLA 2VQHA 2VQGA
chains in the Genus database with same CATH superfamily
4P9FA 4BY7J 1JTXA 2X51A 1MMSA 1FOKA 1K4TA 4BBRJ 2ADUA 1OJLA 4RBOA 2JVGA 1JT0A 1HW2A 1QPIA 2F2EA 5B5EC 4OU0A 3WGGA 3CF2A 1XX5A 2E36A 1U2WA 3OYAA 4RGSA 3FHNA 3CESA 2LF7A 4IX7A 2A6EF 2WAEA 4RS8A 4PK4A 3PM1A 2IXSA 4ZYEA 3G3ZA 2PQ8A 4A3MJ 2VKDA 2KP6A 3ABLH 4P55A 2HVQA 4AIHA 2I5UA 1GXPA 1G2HA 4IXAA 4E7SA 2XAQA 2IA1A 5H20A 4B8XA 4JK1X 3T1BA 3V7SA 2LKXA 4BJ5C 2STWA 4CZCA 4QSHA 2HS5A 2VJ5A 3FBNB 4XKCA 1WJFA 3ECOA 4GCVA 2Q8KA 2NS8A 2WV1A 3GFJA 4A3EJ 3DEWA 1D0YA 3OY9A 3PUFA 4A93J 4U0WA 2IVMA 1QZEA 4QWQA 4AYBA 1ZLKA 4KITB 1TZLA 1ZREA 2P5LC 5GADJ 2DQRA 2XPUA 2L9VA 4XR6A 4EJVA 3F22A 4E7JA 2LSOA 2IJLA 3F0CA 1S72I 1HKTA 1JTYA 1IDYA 2V6CA 3VYSB 4LIUA 3IKVA 4RLFA 3HKZA 1MMGA 1W4MA 3BLYA 3F72A 4RGXA 1NHAA 2A61A 2XAHA 1TLHB 3H5NA 1IUFA 3LSIA 1ORKA 4OMYA 3WTTC 3MZYA 2OPTA 4KT6A 3O6BB 4KUMA 3I0TA 4ESFA 2IAIA 2F48A 2YUSA 1DP7P 2VODA 2A05A 1JJ6C 1O4XA 1BR4A 1SFUA 1IAWA 3E7LA 4UXNA 1P6RA 5CQEA 1TNSA 2FJ1A 4BHPA 4GGGA 3RKWA 1D5YA 3MD2A 4YIFA 2PN6A 4L18B 1SFXA 5FO5A 3OYMA 3ZMDA 3BWGA 1K7AA 2Q2EB 4B44A 1ETVA 2XV4S 2CW7A 2ZXWH 1C0WA 3SZGA 3M1EA 3DBHB 1T08B 4RM3A 4IHVA 1X58A 3OYCA 3HOWJ 4HDUA 3WTYC 1X19A 4UV9A 1LDDA 2OF7A 4EJOA 1MDMB 1IV6A 4KICA 5F0FA 1XC5A 2I10A 1DP3A 3VFZA 2XPWA 2ZMEB 5KVRA 1LFUP 3K4NA 3BG6A 2K5CA 3EQLF 2ISYA 1CQTA 3CJNA 3QP5A 4BXFA 2E2JJ 1ZG3A 2KIQA 1RKTA 1X3WB 1O3SA 4AUXA 3WG7H 1YW9A 2LLKA 3FIWA 1OMIA 1SVOA 3AL0B 3MMYB 2R7XA 3M07A 3TQNA 5J8CA 2JRTA 2EFOA 4XL9A 2QGUA 2J5OA 4ZDLA 4XONA 2H94A 1SVLA 1O7FA 3GZ5A 3MQ0A 1A04A 3CZ6A 3G1OA 4M3GA 2DK5A 3ZMTA 4LK0F 2DA6A 4J01A 4BXXJ 3K1PA 4XLNF 2F4MB 2ZJPF 1KQ8A 4CZZA 2EQRA 4DZPA 4GFBA 3J80Z 3I64A 1ETQA 4LB6B 3K2AA 5DUIA 2QWWA 3LQQA 2EILH 4RMNA 1WJBA 4PSWA 4W1UA 3U2RA 5EDNA 1KU7A 3OIPA 5DV5A 1GDTA 5M5YJ 3O8GA 1K6YA 1P4WA 1RZ4A 3E6BA 4HX7A 1A5JA 3ERMA 2P81A 3RI4A 2CQXA 3L2VA 4QLCU 3EDPA 1UAAA 2P5KA 1E0EA 2DU9A 2LMDA 2FMLA 1BR2A 5BOXA 3DEEA 3NARA 4L0ZB 3F9KA 3FZVA 5H2FC 4ANJA 3GZ6A 4KFCA 1SD7A 3C2GA 3KEYA 2VE8A 2Q1ZB 4F55A 2L9RA 2L0KA 3HB9A 1B9MA 5LHIA 1GLNA 2MLKA 2CFXA 4R1HA 4D1QA 4OOIA 4M71A 3RKXA 2CFOA 3SJMA 2B63J 4KIGA 3HSRA 1WCMJ 2XGEA 4WK8F 4G7ZF 3BCAA 1R5HA 3GO5A 1R23A 2YPRA 3FBIB 2WAQN 2BV6A 2XSDC 4A6EA 4G6DA 2VJIA 4JBAA 2YS9A 2BYVE 3K4CA 2VJ4A 2XRLA 4CYDA 2LFBA 1T0FA 3RQIA 4XRSA 1FT9A 5F0CA 3M7GA 2HNHA 1XMKA 3HHHA 1FOXA 4A6DA 1GV5A 2FX0A 4HSRA 5D5WB 2E2IJ 3HRSA 3A02A 2FF4A 2VASA 4HLXA 1ZELA 5CVUA 2QLZA 2HDDA 3EYIA 4PFPA 2PMHA 5FFZA 4BQQA 1R7JA 1E3OC 5LGNA 1VF9A 4WXCA 1ZN2A 3R60A 1LVAA 4XN3A 4F52A 2E5ZA 3ELKA 2F5DA 1WKMA 2DT5A 3BR1A 3GUDA 2MH2A 5HLIA 4KN7X 3D0SA 4XORA 4BEHB 5EEHA 5IYBJ 4IZZA 2YU9J 1YQAA 3OWTA 3FXRA 4F93B 3CMAI 1D1AA 3L2UA 2M34A 4JP0A 3PSFA 4MEYF 3HPHA 4MHGA 4CYCA 3EUHA 1Q1VA 5A2QK 2XHKA 3GBGA 4P96A 2O5RA 1G3WA 1T39A 2CV0A 3SHFA 2DT6A 2X0LA 2HOEA 3VSLA 4FISA 4G94A 1RRJA 3GVAA 2CQKA 4N9HA 3SYTA 1XB4A 2PMZA 3TO9A 4FETA 2ZFWA 4PZJA 3ZQFA 4H0EA 1FP1D 2HQRA 3BG5A 4BGDA 2NNNA 4C3JJ 1BIAA 2ZXIA 2LY2A 5IP9J 3S17J 3UR3C 1FZPB 3R61A 2V1UA 1T95A 3FXQA 2JPCA 4L5IA 4A3CJ 1PVEA 2EIJH 2CW0F 1S7OA 1HW1A 2JTVA 3DPUA 2HOSA 3S1MJ 4F3QA 1HQCA 3E6DA 1GVJA 3LSJA 5F04A 1BC7C 4ENKA 2IGOA 3C1DA 4GYIA 1IRGA 2HQAA 3FMRA 1OLTA 5ICGA 1J09A 2TCTA 2QCOA 3O2PE 3H9JA 4Q47A 4M6XA 4XIDA 2BGCA 1I6XA 4ITVA 3TO7A 2VE9A 3WTUC 4JQFA 2EWNA 3H92A 2PLYA 1S6LA 5KAFC 3D1NI 1W7PB 1BI0A 1YOVB 1TC3C 1JE8A 3RPQA 2HZDA 4EJWA 4IQJA 3F8CA 2FUG2 2R5ZA 4FASD 2CQQA 2VBYA 5E8IA 1MSFC 4CCMA 5H6QA 1YG2A 1LKXA 5E3LA 4PFOA 2R7OA 4IVNA 2LY9A 2MABA 1Y56A 4CCNA 3MKLA 5AIQA 1S8NA 3DEUA 3FX3A 1AA7A 5FKKA 4B48A 3DTEA 2DDBA 2DI3A 1TWHJ 3IHUA 4BJ6C 1P4AA 4UY8I 1FTTA 3B02A 2HVSA 5E1XA 1Z7UA 2JZYA 4MEXF 1A31A 2GWRA 3BZ6A 1EH8A 5DCMB 4MGRA 1R22A 3KZIC 2E1OA 5J1RA 1U5TB 1G4DA 4WCGA 2KDZA 5E8GA 4FQGA 3F6VA 4IHTA 2K9QA 2DLLA 2EB7A 3A0HC 2DA4A 3GWZA 4BAYA 1LE8B 2RNJA 4AIDA 2STTA 3PJRA 2JJ7A 2K3PA 2QQ9A 3ZPLA 5DM6F 1UG2A 3WTSC 1I5ZA 2CQ7A 1FC3A 1REPC 2F6CA 2IEKA 2LG4A 1EV7A 1XGMA 5IPAA 1BA5A 5HOOA 4D5FA 1K79A 3WU1B 4E7ZA 2OCCH 5K7ZA 3S2HJ 3M1CA 3K70D 4UV8A 2EK5A 3ABTA 4ZC3A 5A2QZ 1F5TA 3AG3H 2GXAA 4OIOF 3CD6I 2NVQJ 4D5CA 3I71A 4B4CA 2WADA 1Y8RB 1KYWA 3M8EA 1FEXA 3EYYA 1I27A 5D4RA 3DKYA 1YS6A 3MKWB 1U3EM 3CMYA 3DBLB 1WHUA 3GTQJ 1W7PD 5GPCA 3E97A 3S14J 4ZYDA 1ZH5A 2JA6J 2R7TA 3ABUA 1J2XA 2ZNZA 2QEXI 2EJRA 1P9QC 1E3PA 3OL3A 2JA7J 1V5EA 4LLLA 3D5RC 5L3CA 3K9TA 1POGA 1SD5A 2B0LA 4NB5A 1NG7A 3OYEA 2E1MC 3FK7A 3CMMA 2AO9A 3IUOA 5B66C 3QODA 4LMYA 2CG4A 3DP7A 5GTIC 2KRHA 2BW3A 4IQ4A 2LRDA 4MNUA 1XGNA 1UJ8A 2EV5A 4XRFA 2CUEA 2XF6A 5CQGA 2QBYB 1HOMA 3J7AO 4KN4X 5FRNA 4PGHA 5E20A 2BY3A 4IF4A 2QQBA 4LIVA 3G2BA 4Z6YA 4MTDA 3ZOBA 5ICCA 1PUFB 4A5NA 2P6SA 4N0BA 1MW7A 2UXXA 4I0BA 3VPRA 4B09A 3QPSA 3A1YA 4XRSG 2QZ8A 3GZNB 4JX6A 1X2NA 4ESBA 2LOOA 1R6RA 2VN2A 3I4NJ 3L00A 2RGVA 2VXZA 2YX7A 5E79C 3NAUA 2HTJA 3SZPA 2MW8A 1JJ8C 4KISA 1FIPA 3RQ4A 2DK8A 2NS0A 3ZGKA 1JUPA 2GA2A 3K10A 1ZRFA 4BQAA 5DS9A 2LYCA 3P7NA 5KK1A 2X1EA 2KLOA 2HR3A 1BW5A 4MO7A 1UHWA 1UHSA 5CPRB 3ZQHA 3FXUA 2DODA 5LHGA 5E18F 3HZJA 4JOMA 2E1CA 1MBEA 4PJMA 1FYMA 2Y9ZA 4XSZF 3S8PA 2CUJA 1DU6A 3EUHC 3WTWC 2Q2EA 2LH9A 1JUSA 1Z3YA 2M8EA 3LAJA 1MSEC 1MBGA 3DKXA 4UVBA 3HYIA 1OYYA 1PDNC 2EA4A 3CCJI 1FMWA 3FM5A 4RB0A 5DD8A 3HTSB 5HS8A 1H89C 1ETWA 1Y39A 5ICFA 1HDPA 1XD7A 3CCSI 1GVDA 1WFXA 2ZMEA 1ETKA 1TW2A 4BH9A 1YIOA 2R3SA 2GXBA 3CUOA 1KZHA 3WU2C 3C3WA 3BTCA 2XROA 2HFHA 2B7EA 1IN8A 1LDJA 2P8TA 1ODDA 2W00A 3H5AA 3TO6A 3HRMA 1FX7A 2BXZA 4PJ0C 2IS4A 1J75A 1XN7A 5BPDA 2VOPA 4KIFA 1QBJA 1AKHB 4ZDOA 1EKEA 3LMMA 3NWTA 2Z2SB 3JRHA 4BU2A 5HVQC 4V2FA 1MKMA 2E19A 4GXOA 4PGGA 1ZR4A 3TGNA 1B6AA 2DO7A 2IGMA 3QOPA 3M3YJ 1FBQA 4OAZA 5CKTA 2IP2A 4LFUA 3I59B 4HA8A 2GIVA 1MIJA 3GW2A 2E1NA 3OS1A 2WAQA 1TL8A 3IL2A 2W57A 3LSKA 4BHBA 4E7LA 2V9VA 1X2MA 1HSJA 3FKJA 4CCLA 3IAM2 2LNBA 2V6EA 3DV8A 1NH3A 4DZJA 4Y15A 2RVCA 2HZTA 3TP3A 5IOZA 3TDUC 5LGTA 1OCRH 4U7DA 1R71A 2ETHA 3H9QA 1SC7A 1FYLA 4JYKA 5J40A 1OCCH 2DAOA 2XGDA 2UZKA 1XTAA 1VTNC 2MSYA 3Q0WA 4YEJA 5HDKA 4C2UA 2YX4A 5H6RA 1B72B 4XMYA 1O3QA 1RI7A 2FNPA 4X6AJ 2HDWA 2BY1A 4HAMA 4EMSA 1RETA 3TOAA 3OR1C 1MBKA 3VWBA 2XGXA 1S5LC 3ZMSA 3Q0VA 4I6ZA 4CHUA 2V79A 3GFMA 3DPLC 2W84A 3KE2A 5L3BA 3CO6C 2Z5UA 3E5QA 2X85A 1V55H 3B6CA 2LKPA 1BL0A 2XB5A 2KRCA 1PP7U 1DU0A 1GHCA 3A01B 4ZTFA 2I8DA 3ASOH 2VXDA 4E4HA 3A2KA 1HCRA 1TT5B 4EEFG 3CDHA 1A35A 4CA0A 5JHFA 2VBWA 1FOYA 2UUZA 2KJBA 5KAIC 4ZDPA 2AHQA 4HYEA 4ZYHA 3TW6A 4L9JA 4HLYA 1VNDA 1OFCX 2QM3A 4TV7A 2ID6A 1Z3XA 1O7LA 1JUMA 3HEFA 4XN0A 2DOAA 3E0JB 3J80K 3NEUA 2KPMA 3H36A 2K85A 3IH4A 4DQ2A 3CCMI 4MIMA 1OISA 5B1BH 3GMEA 4ETSA 1D3YA 1FBSA 1XSXA 3FMQA 1YW7A 4HV6A 1P4XA 2DCEA 1ACIA 1HBXG 2HOAA 1P92A 2MYSA 4IHYA 1U0JA 3M8JA 1J0RA 5F1RA 2IS1A 1KU9A 2BE5F 4AIKA 3BPVA 4CXFA 4KDPA 1X1DA 1FNNA 3M4OJ 2XF5A 1DGWY 1ULYA 3JRIA 1DGRM 2C6YA 3VOEA 2DA5A 1YRNA 3PNTA 1IRZA 1KYZA 5IT3A 1JHHA 3S2DJ 3IP4B 1QHGA 4X0GA 4ENNA 2M8GX 4IOCF 3P5JA 3QQAA 2MD0A 4WXHA 2FBIA 2OCEA 4CUGA 4BUPA 3NWSA 3JSPA 2NYXA 3HOSA 2UWMA 2DT7B 6PAXA 1W5TA 2R7QA 2RREA 3HJEA 1TBXA 1LNWA 1H8AC 2K86A 5K5RA 3S2WA 3WGIA 2HKOA 5JVGF 2CU7A 2ECBA 2VPRA 1Z1DA 3BTIA 5LLQA 5L3DA 2E60A 3KEQA 2EBIA 4EJTA 1I1SA 2CO5A 2H1LA 3TL4X 4EGYA 4D7NA 2WBMA 2O0YA 3VYUB 1QRYA 1QZYA 1X1PA 4LGWA 2FD5A 2Q0OA 2X6WA 2X6XA 1WJCA 3JRCA 3KYLA 2ELJA 2WC2A 1R1VA 3DU5A 4GO1A 3V8KA 3ZQGA 4EJUA 3PSIA 5FKLA 4DBRA 4J19A 2DFFA 2R92J 3HRTA 1I50J 2GAUA 2HKXA 2FOWA 3HG9A 3HOUJ 2KZVA 1NK3P 3AG2H 4DYQA 4DJAA 1TTYA 2BVMA 4BYYA 2VT2A 4EATA 1V5FA 2EA2A 2DFEA 3CCVI 3K0LA 5GAEJ 1OCZH 1W7PA 1IG7A 1W0UA 5LEJA 2MH9A 5M3MJ 1WSUA 1S3JA 3E3VA 3ONQA 4XKWA 3FWEA 2W48A 3LA2A 4BS9A 5E3MA 2KRFA 3SFZA 2P7CB 2W24A 3QPLA 1K4SA 1F43A 2XAJA 4DIQA 2K9LA 3KP7A 2E2HJ 3H0DA 4NC7A 2XPVA 4E7HA 4NUBA 5C4XJ 1F4KA 1VQ7I 1AOYA 4UUSB 1U78A 2ZMEC 2ZJ2A 3RKYA 3BQYA 2Z3YA 4XNFA 5DCMA 2K27A 3S15J 2A6TA 1MJBA 2VT3A 2WAFA 4HEA2 2NVYJ 3OS2A 3CJRB 3LL7A 1U9OA 4FE7A 5EZHA 4YIRX 2ZO4A 4A12A 3HGYA 5JI6A 3G6EI 3GTLJ 2RV8A 1IW7F 3BZCA 2PMUA 2A3SA 2CS3A 3IWZA 4ZJZA 4ZZLA 5EGOB 2ISZA 3HOVJ 4Q48A 4LB5A 4RB1A 1FP2A 4OMZA 1FSHA 3U1KA 5IP7J 4KMFA 4HX8A 1P7IA 2V26A 1G6NA 3L09A 4CCOA 3F8BA 1MH4A 1D1CA 4XLHA 2O8XA 2Z99A 1B59A 5EYRA 3ZMVA 3AKZA 2BY0A 5M3FJ 1ZGWA 2A07F 2CV2A 3RPUD 3BJOA 3CC4I 1FPQA 3HHGA 3QPTA 5M5XJ 2PFBA 4XQFA 3W6VA 4A0ZA 4YFNF 1YTYA 2HTSA 3E5XA 2QYOA 2ZKZA 2OU2A 4G8XA 2Y31A 2A68F 2OTJI 5TJJA 2JUGA 5CVVA 1T8IA 4L5EA 1V54H 3DQVC 5B1AH 4B43A 3KLOA 4CDGA 1WWXA 2L02A 3OIOA 4ZYGA 4KYWA 2KDOA 2M30A 3K4KA 4OIRF 2DYRH 3WTVC 4Q5SF 2XDVA 3JREA 3J7ZI 3I4PA 3DPTA 4IJAA 4B3XA 4HDVA 1PUEE 3GLLA 4PCQA 1JKOC 2NAZA 1GV2A 2ZJRF 4D9JA 3REOA 1D0XA 3VB2A 1OPCA 1Z05A 4EVIA 2PJRA 2ZXJA 4YFKF 3IWFA 3TP0A 1K6OA 1W5CC 3KZZA 2VLAA 5ILSA 1FSEA 1ZRCA 3H5RA 4IL6C 4IHXA 1W36D 2ZNYA 1TQMA 4M73A 1WI3A 5FKNA 1ZTRA 1BM9A 3ISPA 3DLAA 2COBA 4L0YB 3T8TA 3ZCOA 4M72A 1ZG1A 4M6YA 1Z0XA 1Z6RA 4UVCA 4OAYA 3CP8A 4Q4ZF 3N4MA 4QIWN 2P5VA 3EPZA 5IOYA 2OZ6A 1OYWA 1NG6A 3GYHX 1PUFA 3G1LA 1VQLI 2NVUB 3MAJA 1FIAA 1EF4A 5EG0A 3OYIA 3DTKA 1OCTC 2DJNA 3WTZA 2GOXB 2VQCA 1QO0D 3PQJA 1G8XA 2M7AA 1ON2A 1HKQA 2LREA 3GLXA 2RQQA 3IH3A 3KP3A 5HODA 2DFIA 1S9HA 2HOTA 4S05A 3PFIA 1RC9A 2L9NA 3BJ6A 4EQQA 4FTHA 5IY5H 1UMQA 2EPFA 2NNYA 3W6JB 4PSXA 3UKGA 4L9NA 1O3RA 1EH6A 1Z67A 2DOEA 2L4MA 1JKRC 1VQ8I 1VQPI 1FY7A 1H9TA 3DWLE 1QZZA 4O3MA 2JA8J 2GXGA 2MBFA 3HXLA 5E17F 2WV0A 2VI6A 5HS7A 1NTCA 5JFRA 2A69F 2EZIA 2R93J 3BR5A 3CCQI 3LA3A 4A0XA 3TOBA 3DFGA 2A5YB 4PJLA 3F8NA 1FBUA 3JRDA 2CJJA 1K83J 3CP2A 4I02A 4D0PA 2XB0X 5BMZA 1YJ9I 3OIQA 3L7WA 2PI0A 4BDZA 1DQUA 1N75A 4BQNA 3AAFA 1LEBA 3P9CA 1E2XA 2JPBA 3A03A 4E6KG 1R49A 4ASNA 1S7AA 2L7ZA 4G12A 2CWEA 2PX9A 2WY7Q 3LSPA 2JA5J 1VQNI 1CGPA 4A3BJ 4RAYA 4UHTA 1U8BA 3S32A 4XRMA 4LJZF 1XCVA 3OYJA 2DFHA 1R1UA 2L7FP 1LJ9A 1XG1A 2A6HF 3P9KA 2FA5A 1LUJB 3SXYA 3OYGA 2BVLA 2M2EA 2L7KA 4RB2C 5D5UB 3C7JA 3K70C 2CSOA 2O7OA 3BJAA 3HIFA 3P9IA 1VQMI 2AQFA 3WTXC 1AKHA 4DW6A 3HGGA 5F6FA 5J3LA 2NXNB 2R7WA 2M0CA 1X1CA 3CUQB 4XM3A 4LG0A 2EIKH 5BNGA 1MNDA 3GX4X 1TT0A 4FHTA 3I59A 1I1GA 3JTHA 1X4OA 2MA3A 2JUCA 3CDLA 1WJEA 3PQKA 2O8KA 5JHUA 4A3DJ 2FBKA 2LD5A 5E1ZB 1AWCA 3GTPJ 4PJNA 2ZC2A 3K4MA 5LRSA 2DYSH 4C3HJ 1I3AA 2KT0A 1SANA 4BE1A 2CV1A 2O61A 2VUMJ 4HF1A 3KX2A 4M3FA 4XLFA 2IBDA 2X4HA 2QUFA 3TBIA 1G3SA 2PBIA 1TWAJ 5DEQA 4S04A 2M87A 4XLEA 1IC8A 2JQ7A 3DXJF 2BY2A 4CGZA 1B72A 2CH0A 5EF6A 5KNLA 2Y9YA 2H09A 3FHZA 1IZ1A 2LC2A 1FJLA 4M6VA 3BQZA 4N4NB 3N97A 1PP8F 3OYBA 1ETYA 3GCMA 1BOAA 2X48A 2K4BA 4WX9A 3G73A 4G7HF 3FXOA 2PG4A 4WXDA 5TISC 4IRIA 5J8FA 4AM3A 1B4AA 2M9HA 1LFPA 3I4MJ 4LOCA 1RPWA 5DM7F 1AHDP 4O6JA 3RYPA 2Z33A 4BBSJ 3QP6A 5L3GA 2E7WA 3BR2A 4N4OB 3DBRB 1KQ0A 1S29A 1R5GA 4AU7A 2M7BA 3A01A 3QYEA 2DA7A 3F8MA 4L9TA 2H6BA 2ESNA 4NC6A 1J5YA 1OQYA 2Y0SN 2AXTC 4XSXF 2Z1DA 3TKYA 2PEXA 3PO2J 2D45A 1QHHD 4A0YA 2NS7A 2V1NA 3BG3A 2V4JC 5LGUA 4HSTA 3KETA 3IRRA 4C9YA 3KEOA 5TGTA 2VPLA 3BOQA 3CJTB 2L4AA 3ZQQA 2VJJA 4MTEA 2N8GA 1WI9A 2G7UA 3V4GA 3LFKA 4BQOA 3V8LA 3CLQA 2XRNA 1YX3A 3L2CA 1ERDA 2GM4A 4NC8A 1MJAA 3PUBA 3Q9SA 3QRFF 1FMVA 3SDGA 1Z77A 2H6CA 1APLC 2W85A 4A3GJ 2FQ3A 3VYRB 3HOXJ 4XLPF 1PJRA 4BKXA 1T56A 2FQ4A 3FXKA 4CSWA 1NK2P 2IS6A 2EZHA 2K3FA 5D5VB 1V4RA 2FMYA 1Y8QB 4RDUA 5F08A 3ROUA 1VFCA 2DTRA 1O57A 4MQ9F 2AXLA 2VC1A 4HF2A 1ZG5A 2DN0A 3IV5A 4FX0A 5DD4A 3I56I 3GTGJ 4AWXB 3KZYA 1R00A 1ZQ3P 2OA4A 4II2A 2HQNA 1MBHA 3HUGB 2H1KA 3MZHA 4CYCB 1Z9CA 1YITI 3BROA 4YFXF 2NOGA 3R0JA 2R7SA 4RAGA 2OV7A 1K61A 1ONVA 3ZQIA 1A6QA 1P2FA 4G9YA 2DDAA 5LFAA 1HC8A 3M8FA 1TW3A 1UFMA 5FLMJ 2UV1A 3JAMZ 1HDDC 2R7DA 2W7NA 3I54A 4BNCA 3RZDJ 3RPUA 3OMYA 3DF8A 4ENMA 1MDMA 2HXIA 1MBFA 4R79A 3WU0A 3KLNA 4IKFA 4NBQA 2ZSHB 1D8KA 3EUKL 5IYCJ 2AS5F 3KYDB 4BHCA 1IN4A 1UCRA 1ZKGA 3J81K 4F91B 2G7HA 2O3FA 2R0QC 4RAZA 1OKRA 1Q1HA 1Y6IA 3ZQLA 5LEKA 1QVUA 1SMTA 3K69A 4EM1A 1ZGAA 3BC8A 3FK6A 1WJDA 3S1NJ 5EEGA 3FXJA 2Y48A 4JX4A 4LITA 4EGZA 2CUZA 3GTJJ 4EM0B 5J4VA 2XUBA 1XPXA 2DMPA 2D1HA 2M45A 5J6XA 5IT9K 2MG4A 1OCPA 1ITYA 3AG4H 1ZAOA 2XAFA 5AIPA 2X6OA 3RTRA 2ICWG 2MC4A 1XMAA 4QPQA 3CCYA 1LQ1A 4UB8C 3J7YJ 3WHBA 1HKSA 2W82A 1WPKA 3HOZJ 2IA2A 1MGTA 4I0AA 4UUSA 2VIXA 3E1SA 1G3YA 1RR7A 1LPQA 3BT9A 3ZN0A 5JVTA 4XICA 1BC8C 2DW4A 3E6CC 2KIMA 2YU3A 3JCUC 1RNLA 3LSHA 1ENHA 3AFHA 3V7CA 1X1BA 1J9IA 1YX5A 3JSOA 1J59A 3FDYA 3I5UA 4FT8A 4OIPF 5LD2C 1IXCA 1YJWI 4A3FJ 1I3QJ 2DPDA 3HSEA 5FD5A 1YFHA 3Q9VA 5GTHC 1IN5A 1GUUA 3V8JA 2W1OA 4O5VA 4IPAA 3W2WA 1YE9A 2DTZA 2JT1A 1XDSA 3S3NA 2XGCA 2QKLB 3CC7I 1TWGJ 2ZFUA 3SEQA 2F4IA 2GOMA 2JWTA 4ZZDA 4LLGF 4UUVA 4UNOA 2IGKA 5CYVA 1UG0A 3K1MA 1SEUA 1HLVA 2DXIA 3MEXA 4IOAF 3RSNA 1DDNA 2GIZA 2JA2A 4XK4A 2MD5A 4A5MA 1V3FA 4BDYA 1O3TA 2D2WA 4H4KC 3QYBA 3ESWB 1IRFA 1MNEA 4XLCA 5ERIA 1Y1WJ 2X9DA 1X4PA 3HM5A 4B47A 3T5XA 2O03A 3AG1H 3C18A 1BI2A 5GAGJ 3GXOA 2Y30A 3OS0A 2IS2A 4UUTA 2RNGA 3OYFA 4Y13A 5E3NA 1EA3A 3RJPA 2L2OA 3L9FA 1R4MB 3ULQB 3WE3A 2FU4A 1ZR2A 1HA8A 2W25A 1F9NA 4U7BA 1W5SA 1D5VA 2FEZA 4ON0A 2V7FA 1EJ9A 2R7VA 5TRDA 3ABMH 2LP0A 2ZJQF 3MFKA 1ZRDA 1YS7A 3CCRI 4M3EA 2V9PA 5LBQA 2MC3A 4BACA 5D8KB 4XOTA 5IYDJ 5CJ9A 3FISA 3J81Z 1KU3A 5D6FA 5HDGA 4IHWA 1XSVA 1IO2A 2TRTA 3RYRA 4C2MJ 5HLGA 3GEZA 2FSWA 4NNJA 1R1TA 1U9NA 3LFUA 2BW3B 3RDIA 1IDZA 1WJ5A 4BEHA 4AC0A 2FE3A 5C44J 2K40A 2QQ8A 5IT9Z 1WQ2A 1ZK8A 3U21A 2R7ZJ 3K4BA 3PFYA 3ZQCA 1ETXA 4NDLA 5DDGA 2E71A 5L3EA 1R5ID 1S7EA 1SVMA 4EV0A 4DGWB 3F23A 3CCLI 1SFOJ 3OYHA 2FRHA 2EIMH 2VB6A 1STZA 5K5QA 3ZR8X 1OR7A 2JRMA 1YHQI 1N78A 5K7HA 2J5PA 2H8WA 3K1NA 5F1JA 5L3FA 1IRXA 3O3KA 4MLOA 2VKVA 3U1DA 3CCEI 1E3HA 4KT5C 4HZFA 5CVJA 4NQWB 5C3EJ 3GTKJ 4M3BA 1T6SA 4IEJA 3UNGC 2W4SA 4CH7A 4BY1J 3BR0A 4ENJA 1IN6A 4WWCA 4PUSA 2NRAC 1XSDA 2Y2ZA 2Z16A 5FKMA 4M9XA 3D5LA 2ZB9A 4IHSA 2G9WA 1OYIA 3G71I 3WGHA 4XOPA 4I76A 2BBYA 2E34A 3QYFA 3JR9A 2OUMA 2MLGA 5B3SH 3W2VA 4RGUA 4Y17A 2F5VA 5HNHA 3R0AA 3R6SA 4XBFA 3OSGA 2XAGA 1CF7B 2YSRA 1IF1A 1GT0C 3PL8A 3IC7A 3WODF 4BXUA 3OYKA 1MMNA 4DOZA 1MMAA 1RUOA 1QPMA 1HW5A 1JT6A 4XKVA 5F0HA 1B8IB 1K78B 5LRRA 2RQPA 2QSFX 4M74A 4MFEA 3OV8A 2LTPA 1Z6TA 2XC7A 2LDUA 1U8RA 3H35A 3L2WA 1KGSA 1T33A 3H9GA 2WWYA 3GF2A 5FD6A 2HVRA 2OBPA 1RKWA 3BTJA 2OQRA 2EFWA 1YO5C 1H9GA 2L7MP 2LY1A 4G6QA 5FKOA 2HI3A 4U0VA 1R58A 1XMXA 1E17A 3J7AY 2KL4A 2VQGA 2HXOA 3ASNH 3H3UA 1Z91A 1U5TA 3CUQA 3R4KA 4F7ZA 2JVHA 4G6TB 5DTDA 4AVPA 4RLQA 1YLFA 1Z21A 2KFDA 3I53A 3AL0C 1B1BA 1DPRA 2K9MA 2XASA 3I9V2 3IAS2 1LE8A 1ZGJA 2LK2A 2Y0SA 2IA0A 4Y33A 1VQ9I 1FYKA 2KMUA 5J1YA 4AD9A 2ZBKA 3CMEI 2BXYA 3EETA 1LB2A 2LBFB 5C4JJ 3F21A 1Y1VJ 5DCFA 1BN5A 4KIBA 4DYRA 1JI8A 3W3CA 4I7HA 1W36C 3IH2A 2HGCA 4RB3C 2JMWA 3L2QA 1BW6A 2FBHA 3M9AA 4UB6C 1AU7A 2XSJC 3DTIA 1XGOA 4HX4A 2EV0A 2MFZA 5J47A 3W2AA 3JRAA 2Y75A 2HDCA 3V42A 5BQTA 5FRMA 4L5JA 1I39A 2P7VB 1TNTA 3F3XA 3HDDA 1R4NB 3MKYB 1LEAA 1XCBA 3CC2I 3ERED 4G7OF 2R5YB 2QA4I 2JN6A 3X2QH 3TW7A 2HPMA 3KIOA 3NRVA 2DMTA 3BTLA 3VEPA 4I09A 4E70A 4Y7NJ 2YR2A 3H1CA 5HS9A 2DPUA 4RA2A 4YIIA 5GAHJ 3KP6A 3Q0UA 3CQZJ 2M1BA 2XVCA 3BY6A 2DA3A 1BIBA 1H0MA 3MWMA 2BHZA 4QTRA 4LK1F 2KQRA 2Y69H 2H27A 1FTZA 3FM3A 3CO7C 4JX5A 3RCOA 2IGNA 5E1WA 1T38A 2VONA 3SFIA 2P4WA 4K2EA 4RAFA 2EZKA 2CGPA 4X1EA 2Z9OA 2DQLA 2KKOA 3K6GA 2QBYA 3F6OA 1JHFA 3DLLF 4MQVA 3ZQ7A 2UXNA 2Y0MA 5EZGA 2EFPA 3GTMJ 3KP4A 2K4JA 2CYYA 3U9GA 5ICEA 5K1YA 4EM2A 1WZ2A 2KISA 1VQ5I 1RIOH 3H3VK 1P7JA 4FE4A 5EJCA 1PYVA 3ZRGA 1W0TA 3HSFA 2VKHA 4ZTJA 1MH3A 1XDUA 1YJNI 2EH3A 2DOFA 2AQEA 3QAHA 3COAC 3IKTA 4I2OA 3C2BA 2CW8A 5DUKA 5FGMA 2DBBA 3BCBA 2WB1N 2V1DA 2VBZA 2HQ5A 5F64A 3LQRA 1KA8A 4N9IA 1X3UA 4XKBA 3MZ8A 2RAEA 1KQ9A 1YRNB 2FOKA 4V2GA 4HQMA 3KP2A 1DUXC 3HUGA 2IPQX 5HLHA 1XGSA 4CCKA 2KZGA 3HTUA 2ECCA 5FJ8J 1TQIA 3JRFA 1IN7A 3T8RA 4GDFA 1JKPC 3WG9A 4MFDA 4KJZA 2IT0A 2L5QA 4BE2A 1TQPA 2BOLA 3ZMUA 1GXQA 4D7MA 3E6MA 4AIJA 2X1CA 1MBJA 5FB2A 3BPXA 3GFIA 4DBQA 1QGPA 1OR7C 3B73A 1R36A 4C30A 4KNYA 3BZKA 5FROA 5D8LB 2F5EA 3QU6A 1MJ9A 1D8JA 2CUFA 2OQGA 4CCJA 1FLIA 2KHMA 4Z2YA 1TP4A 3DU6A 5F27A 3A4CA 4C3IJ 1WH7A 2G0EA 1RUNA 4NHJA 4AYBN 2HYJA 3MKZA 1JXSA 3A0BC 3W6KB 4LD5A 1WJAA 3BP8A 2H8RA 1A6IA 3NQOA 5K5OA 2OAZA 1R9TJ 5IP6A 1QVTA 4A69C 3VYTB 3ECHA 3O8HA 3HKZN 3TDZC 2E5NA 4Y4RA 1VZ0A 2K02A 1MZBA 1UHMA 2R7UA 5HDNA 2O9LA 3FF5A 1Z7LA 5HLTA 3JTGA 2ZXHA 2JK3A 3K2ZA 1L0OC 2GQQA 2VBXA 2EFQA 3BR3A 2HWVA 3Q5FA 2EV6A 3S16J 2F5FA 4YELA 2L9SA 4ZYAA 2WY8Q 1IUYA 1YI2I 1RR8C 4V19K 4OINF 3T0YA 2WTEA 3K4JA 3CDIA 2VC0A 4F92B 4HG2A 1A36A 4S0HB 1ZHFA 4E7KA 2OJED 3JAMK 4R8HA 4UVAA 3ZP5A 1X3ZB 3V7RA 1WVRA 1JKQC 1V5GA 1B9NA 2OTLI 3SQNA 2RKHA 3OYDA 4M9SA 4HW0A 1VI0A 4BL0B 2NVTJ 2XKOA 1Y0NA 2ELKA 1D0ZA 1LDKB 3JRGA 2RC4A 2FNAA 3G1MA 3MN2A 3DKWA 5BPIA 2R7RA 3BG7A 1U5TC 3HC7A 3CUQC 4HQEA 3QU3A 1UZCA 4YRVA 3VODA 1L3LA 4W97A 2BHYA 3ZXSA 3IRQA 2D5VA 5E3OA 1HF0A 1MNMC 1YIJI 3WE2A 3PNYA 2K7LA 2RDPA 2R7FA 3OR2C 1KONA 2IW5A 3KFWX 3MCZA 2LVSA 3I55I 3LNQA 4HPQA 1ZYRF 3LSMA 2E1MB 3GTOJ 1USSA 4P1WA 5ILUA 2NOJB 3RIRA 5ED4A 1YW8A 2XKPA 2WA0A 2M0MA 2HPIA 3PIOF 4IRHA 3OSFA 4PJJA 4GYGA 4A3IJ 1BBYA 3FXMA 3JW4A 3LSRA 3LSTA 5J1UA 5CVRA 1T98A 2DMQA 2L3DA 3CJQB 1ETOA 3QOEA 2ESHA 5GPAA 2HEOA 5BS6A 1D1BA 2BZTA 3CLOA 2QSGX 2XAUA 4Y52J 3S93A 2QQAA 2IRFG 1HSTA 5FLXK 4I01A 2VQHA 4HV5A 1QU3A 2PJRB 2E7XA 3TEDA 2V1XA 2P6TA 4ZH4F 3CF5F 2VL8A 2GLOA 1Y0UA 1IGNA 2VQLA 4L9VA 2EZLA 2X1DA 1VQ6I 3RKQA 3LWFA 3CCUI 1VQKI 1TWCJ 2ID3A 4AVZA 2RN7A 2FXAA 3HPGA 4QPOA 1FOWA 3SZTA 1IXSB 5DYMA 4WF2A 4FX4A 3HRUA 1QNTA 2EFNA 4J00A 2QVOA 5KCMA 2MGQA 1USTA 3S1RJ 3OYLA 3PO3J 4CICA 1TWFJ 4A3LJ 3FKIJ 2K9NA 2F4OB 1T0FC 3I58A 5CLSA 1XS9A 5EG0B 1W1WE 1F36A 3TMOA 3HOYJ 1X1AA 2EINH 1VQOI 2GBYA 1I6HJ 2OD5A 1H88C 1KU2A 2CRGA 4HBLA 2NVXJ 1UELB 3D5SC 2VOOA 3DCFA 4CO8A 3OOUA 1VQ4I 2X6YA 3LA7A 2DA1A 4NQWA 2QENA 3VSKA 1G59A 2P0WA 1IV8A 4YG2F 3PNVA 5D4SA 1JGSA 2CQNA 2DJIA 2M3AA 2XF7A 3BDDA 3OL4A 3ZN1A 3F8FA 4A3JJ 4KA4A 1BOBA 2ZCWA 4DYCA 1IJWC 4II3A 5HNFA 3N05A 5LHHA 2R4GA 3PIPF 1WGXA 3H3ZA 2K9SA 4KMUX 1WH5A 3ZMZA 4U0YA 1QQIA 3KPHA 5K7FA 2KIFA 2DMNA 4M3DA 4B3AA 3C2HA 1N25A 1SD6A 3RZOJ 1CF7A 4HOBA 1FWZA 3SEZA 1WRJA 2A5WA 3OYNA 2V9KA 4HF0A 5JLXA 2L01A 3HL2A 1LFBA 1BR1A 2OZUA 3EUAA 2GZWA 2L54A 1B8IA 1K78A 5FLVA 3FMSA 1UB9A 1SAXA 2ELHA 3S3OA 1YYVA 4BE0A 2OC6A 3S3MA 1EH7A 1OCOH 1BJAA 2GA1A 4U88A 2O6GE 3K7AJ 3Q3SA 3CTAA 1DPUA 5GP9A 2R5ZB 4OIQF 1G3TA 4I98B 2ME6A 1ZLJA 2JSPA 1BI3A 2VKEA 4C2TA 2DA2A 1M1EB 2HYGD 2PMZN 3L1PA 3WHCA 2LR8A 1ON1A 5JLWA 4FCYA 3HOTA 3G4SI 4Y3OA 4P9UA 5AONA 5FLXZ 4B1RA 4ESJA 2M4GA 2M4KA 1BI1A 1SFKA 3BG9A 4ABZA 2HU9A 2LF8A 4E7IA 2ZSIB 3ML6A 3KYCB 3KCCA 3SDBA 2M5WA 3B6AA 3MVPA 5D6EA 2ACJA 5JR3A 5EEAA 3VDXA 2F5CA 4DNCA 2QF7A 1SMYF 5EGOA 3L2RA 4LG0B 4IO9F 2QSHX 3FXLA 4BJTA 4RGRA 3GFLA 1SAUA 2PJPA 2QKMB 4P5OA 3JRBA 1N77A 3I3LA 5J4YA 1ZARA 1HXDA 1F1ZA 2XIGA 4U87A 1U6GA 1JGGA 5CVIA 3LSGA 4HRIA 2LKSA 4A3KJ 4A2UA 2DMUA 2JSCA 2LBFA 3HBLA 3H0GJ 4LG3A 3S1QJ 1MD0A 3K4LA 4IRGA 3E5UA 3BR6A 1BJZA 1T2KA 2HYFA 2CMPA 3QWLA 9ANTA 2B9SA 2TDXA 4PDKA 4RM2A 1MMDA 1SD4A 2ME0A 4M9ZA 5D5XB 1LVKA 5M5WJ 4XLAA 3QPHA 4LLNA 5ILVA 3LAPA 3OOPA 4HNUA 5FFXA 1SFEA 3ABKH 4GRIA 1IXRC 3LOCA 2E35A 2KIUA 4HNVA 2KJCA 4I99C 5KHDA 3KP5A 2R5YA 1RESA 4HNTA 1J7KA 1QA6A 2WB1A 4OWRB 2BEOA 2D1VA 2COMA
chains in the Genus database with same CATH topology
2LOOA 1R6RA 2X51A 2Y0SA 4Y33A 2VXZA 2JVGA 2KMUA 2WY7Q 3S32A 3CF2A 3OYJA 4KISA 3RQ4A 2LBFB 3OYAA 3FHNA 3CESA 3ZGKA 4IX7A 3W3CA 1W36C 2WAEA 3K10A 3L2QA 2LYCA 4PK4A 2IXSA 2XSJC 3DTIA 2X1EA 2KLOA 3OYGA 2BVLA 2MFZA 2L7KA 2VKDA 2KP6A 5CPRB 2HVQA 3W2AA 3K70C 4E7SA 3V42A 5FRMA 4BJ5C 4JOMA 4CZCA 4PJMA 2AQFA 2VJ5A 3FBNB 4XKCA 1WJFA 3MKYB 3S8PA 2CUJA 3EUHC 2LH9A 2R7WA 1D0YA 3OY9A 1X1CA 4XM3A 1Z3YA 3DKXA 4AYBA 2HPMA 4KITB 1TZLA 1MNDA 1TT0A 1X4OA 1FMWA 1WJEA 4XR6A 4E7JA 3VYSB 1WFXA 4PJNA 2KQRA 4LIUA 4RLFA 3K4MA 3RCOA 3HKZA 4BE1A 2CV1A 1MMGA 3BLYA 2IGNA 3KX2A 3H5NA 4XLFA 3TBIA 3LSIA 4KT6A 2W00A 3H5AA 4XLEA 3K6GA 2CH0A 1BR4A 5KNLA 2IS4A 2LC2A 5CQEA 4N4NB 3OYBA 4ZDOA 3MD2A 3LMMA 3NWTA 3OYMA 2Z2SB 4BU2A 5HVQC 2Q2EB 4B44A 1PYVA 3ZRGA 1LFPA 2CW7A 2IGMA 2VKHA 4ZTJA 3SZGA 4OAZA 5CKTA 2AQEA 2CW8A 3OS1A 4RM3A 2WAQA 3OYCA 4N4OB 4E7LA 3LSKA 1X19A 4AU7A 2M7BA 3BCBA 3QYEA 3FKJA 4CCLA 3IAM2 1DP3A 2V6EA 2Z1DA 3K4NA 4XKBA 3BG6A 1QHHD 2K5CA 2V1NA 2V4JC 4BXFA 3H9QA 4HSTA 4CCKA 4C9YA 5TGTA 2VPLA 3ZQQA 2VJJA 4KJZA 4YEJA 3AL0B 4C2UA 2L5QA 3MMYB 4BE2A 2R7XA 4BQOA 2BOLA 4XMYA 1YX3A 4XL9A 2X1CA 1ERDA 2HDWA 4NC8A 4ZDLA 4XONA 3PUBA 4DBQA 4C30A 1OR7C 3OR1C 1FMVA 3CZ6A 3VWBA 5FROA 3VYRB 1PJRA 4CCJA 4J01A 3DPLC 2KHMA 4CSWA 2IS6A 2X85A 3DU6A 3A4CA 2KRCA 3MKZA 4RMNA 4ZTFA 1WJBA 2I8DA 2VXDA 4PSWA 4E4HA 3A2KA 1WJAA 3OIPA 4CA0A 5JHFA 2UUZA 1K6YA 4II2A 4ZDPA 3HUGB 3VYTB 1Z3XA 3L2VA 2E5NA 4XN0A 2DOAA 4Y4RA 2R7SA 3E0JB 1VZ0A 2KPMA 1UAAA 2OV7A 1E0EA 1BR2A 2R7UA 3DEEA 5LFAA 3F9KA 2UV1A 1Z7LA 5HLTA 2DCEA 2ZXHA 2W7NA 4ANJA 3C2GA 2MYSA 3KEYA 2Q1ZB 4F55A 1U0JA 3M8JA 4YELA 2L9SA 3OMYA 2IS1A 4ZYAA 2WY8Q 1GLNA 4R79A 1X1DA 4IKFA 4D1QA 3K4JA 2ZSHB 3EUKL 2CFOA 2XF5A 1DGWY 4HG2A 4F91B 1DGRM 4E7KA 3BCAA 3FBIB 1Y6IA 3PNTA 3BC8A 1V5GA 2VJIA 1WJDA 3K4CA 2VJ4A 3IP4B 1QHGA 3OYDA 4X0GA 4LITA 4BL0B 2CUZA 1D0ZA 1LDKB 2MD0A 4CUGA 4BUPA 2HNHA 3NWSA 3HOSA 2R7RA 3BG7A 3HC7A 2UWMA 2DT7B 2R7QA 2RREA 4HSRA 4YRVA 2VASA 3ZXSA 1ZELA 3RTRA 2MC4A 2E60A 3PNYA 4QPQA 4PFPA 3OR2C 1JI8A 1KONA 3TL4X 4BQQA 4HPQA 3LSMA 2W82A 2WBMA 2E1MB 3VYUB 4P1WA 2NOJB 4XN3A 2X6WA 2VIXA 3E1SA 4F52A 2E5ZA 2X6XA 1WJCA 3KYLA 2ELJA 2WA0A 3DU5A 2M0MA 2HPIA 3PSIA 4XORA 4BEHB 4DBRA 3LSHA 3AFHA 4PJJA 1X1BA 1YX5A 3HG9A 3FDYA 4IZZA 2KZVA 5LD2C 3OWTA 4F93B 4DJAA 1D1AA 2BVMA 3CJQB 3L2UA 3QOEA 3PSFA 3HPHA 4EATA 1D1BA 1V5FA 2XAUA 3GBGA 2W1OA 3S93A 2O5RA 2CV0A 3W2WA 2DT6A 1YE9A 3VSLA 2VQHA 1QU3A 2PJRB 3S3NA 2QKLB 3SYTA 2ZFUA 3SEQA 2F4IA 2GOMA 2PMZA 4FETA 3ONQA 4XKWA 2VL8A 4BS9A 2IGKA 1UG0A 2VQLA 2X1DA 4BGDA 2DXIA 3RSNA 2JA2A 2ZXIA 4DIQA 2LY2A 2K9LA 4BDYA 4H4KC 3H0DA 4NC7A 3UR3C 4AVZA 3QYBA 4E7HA 4NUBA 3HPGA 4QPOA 1T95A 1MNEA 4XLCA 1X4PA 4B47A 3DPUA 4XNFA 3OS0A 2IS2A 4J00A 2A6TA 4F3QA 2WAFA 4HEA2 5KCMA 2RNGA 3OYLA 2IGOA 3OYFA 2HQAA 3OS2A 3CJRB 1EA3A 3LL7A 1OLTA 1T0FC 2L2OA 1J09A 1HA8A 3TMOA 1X1AA 3H9JA 4U7BA 4ZJZA 2CS3A 4ITVA 1UELB 2V7FA 3D5SC 2R7VA 4JQFA 3OOUA 2X6YA 2V26A 4CCOA 2HZDA 4F92B 4XLHA 1D1CA 3AKZA 4IQJA 3VSKA 2FUG2 1G59A 4BACA 4FASD 4XOTA 2CV2A 2P0WA 3RPUD 4CCMA 3PNVA 1LKXA 4XQFA 2DJIA 3OL4A 2M3AA 2XF7A 2R7OA 4PFOA 2MABA 1Y56A 1BOBA 4CCNA 4NNJA 4II3A 3LFUA 1AA7A 5HNFA 3N05A 2BW3B 3DTEA 4B48A 4BJ6C 1WJ5A 4BEHA 2R4GA 2HVSA 2JUGA 3DQVC 4B43A 3U21A 3K4BA 2KDOA 3K4KA 3PFYA 3C2HA 2XDVA 3SEZA 4DGWB 4B3XA 2A5WA 3DPTA 3OYNA 2V9KA 3OYHA 2VB6A 3ZR8X 3HL2A 1BR1A 4D9JA 3EUAA 1N78A 3PJRA 1D0XA 2K3PA 2PJRA 1IRXA 3S3OA 4MLOA 4BE0A 2OC6A 4NQWB 2VLAA 3S3MA 2F6CA 3H5RA 1W36D 2LG4A 3UNGC 2W4SA 4CH7A 5HOOA 2JSPA 3DLAA 4E7ZA 4PUSA 4C2TA 3M1CA 3ZCOA 3K70D 4ZC3A 2Z16A 3D5LA 4OAYA 3CP8A 3HOTA 4Y3OA 4XOPA 3QYFA 2OUMA 2WADA 2M4GA 3EPZA 2M4KA 3W2VA 1NG6A 1SFKA 5HNHA 2F5VA 4E7IA 2HU9A 2ZSIB 3DKYA 3MKWB 3SDBA 3OYIA 3DTKA 2R7TA 2GOXB 3VDXA 2VQCA 3PL8A 3L2RA 3OYKA 1MMNA 4DOZA 1G8XA 1MMAA 1P9QC 2M7AA 4BJTA 2LREA 1SAUA 2QKMB 2RQQA 3OL3A 4P5OA 1N77A 1V5EA 3I3LA 1S9HA 3D5RC 4U87A 4XKVA 2L9NA 3LSGA 4HRIA 2LBFA 1NG7A 3OYEA 2E1MC 4LG3A 4PSXA 3K4LA 2XC7A 3H35A 3CMMA 3IUOA 3L2WA 2CMPA 3H9GA 3DWLE 4RM2A 1MMDA 3QODA 2HVRA 3HXLA 1LVKA 2KRHA 2BW3A 4XLAA 4IQ4A 2LRDA 4HNUA 2LY1A 2XF6A 5CQGA 4GRIA 4PJLA 5FRNA 3J7AY 4LIVA 2KL4A 3CP2A 3G2BA 2VQGA 3OIQA 5KHDA 2JVHA 4G6TB 4HNTA 1MW7A 4BDZA 4RLQA 1DQUA 1Z21A 1N75A 3A1YA 4BQNA 3AL0C 2WB1A 2K9MA 4OWRB 3I9V2 4E6KG 3IAS2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQL A;  2VQH A;  2VQG A; 
#chains in the Genus database with same CATH topology
 4P9F A;  4BY7 J;  1JTX A;  2X51 A;  1MMS A;  1FOK A;  1K4T A;  4BBR J;  2ADU A;  1OJL A;  4RBO A;  2JVG A;  1JT0 A;  1HW2 A;  1QPI A;  2F2E A;  5B5E C;  4OU0 A;  3WGG A;  3CF2 A;  1XX5 A;  2E36 A;  1U2W A;  3OYA A;  4RGS A;  3FHN A;  3CES A;  2LF7 A;  4IX7 A;  2A6E F;  2WAE A;  4RS8 A;  4PK4 A;  3PM1 A;  2IXS A;  4ZYE A;  3G3Z A;  2PQ8 A;  4A3M J;  2VKD A;  2KP6 A;  3ABL H;  4P55 A;  2HVQ A;  4AIH A;  2I5U A;  1GXP A;  1G2H A;  4IXA A;  4E7S A;  2XAQ A;  2IA1 A;  5H20 A;  4B8X A;  4JK1 X;  3T1B A;  3V7S A;  2LKX A;  4BJ5 C;  2STW A;  4CZC A;  4QSH A;  2HS5 A;  2VJ5 A;  3FBN B;  4XKC A;  1WJF A;  3ECO A;  4GCV A;  2Q8K A;  2NS8 A;  2WV1 A;  3GFJ A;  4A3E J;  3DEW A;  1D0Y A;  3OY9 A;  3PUF A;  4A93 J;  4U0W A;  2IVM A;  1QZE A;  4QWQ A;  4AYB A;  1ZLK A;  4KIT B;  1TZL A;  1ZRE A;  2P5L C;  5GAD J;  2DQR A;  2XPU A;  2L9V A;  4XR6 A;  4EJV A;  3F22 A;  4E7J A;  2LSO A;  2IJL A;  3F0C A;  1S72 I;  1HKT A;  1JTY A;  1IDY A;  2V6C A;  3VYS B;  4LIU A;  3IKV A;  4RLF A;  3HKZ A;  1MMG A;  1W4M A;  3BLY A;  3F72 A;  4RGX A;  1NHA A;  2A61 A;  2XAH A;  1TLH B;  3H5N A;  1IUF A;  3LSI A;  1ORK A;  4OMY A;  3WTT C;  3MZY A;  2OPT A;  4KT6 A;  3O6B B;  4KUM A;  3I0T A;  4ESF A;  2IAI A;  2F48 A;  2YUS A;  1DP7 P;  2VOD A;  2A05 A;  1JJ6 C;  1O4X A;  1BR4 A;  1SFU A;  1IAW A;  3E7L A;  4UXN A;  1P6R A;  5CQE A;  1TNS A;  2FJ1 A;  4BHP A;  4GGG A;  3RKW A;  1D5Y A;  3MD2 A;  4YIF A;  2PN6 A;  4L18 B;  1SFX A;  5FO5 A;  3OYM A;  3ZMD A;  3BWG A;  1K7A A;  2Q2E B;  4B44 A;  1ETV A;  2XV4 S;  2CW7 A;  2ZXW H;  1C0W A;  3SZG A;  3M1E A;  3DBH B;  1T08 B;  4RM3 A;  4IHV A;  1X58 A;  3OYC A;  3HOW J;  4HDU A;  3WTY C;  1X19 A;  4UV9 A;  1LDD A;  2OF7 A;  4EJO A;  1MDM B;  1IV6 A;  4KIC A;  5F0F A;  1XC5 A;  2I10 A;  1DP3 A;  3VFZ A;  2XPW A;  2ZME B;  5KVR A;  1LFU P;  3K4N A;  3BG6 A;  2K5C A;  3EQL F;  2ISY A;  1CQT A;  3CJN A;  3QP5 A;  4BXF A;  2E2J J;  1ZG3 A;  2KIQ A;  1RKT A;  1X3W B;  1O3S A;  4AUX A;  3WG7 H;  1YW9 A;  2LLK A;  3FIW A;  1OMI A;  1SVO A;  3AL0 B;  3MMY B;  2R7X A;  3M07 A;  3TQN A;  5J8C A;  2JRT A;  2EFO A;  4XL9 A;  2QGU A;  2J5O A;  4ZDL A;  4XON A;  2H94 A;  1SVL A;  1O7F A;  3GZ5 A;  3MQ0 A;  1A04 A;  3CZ6 A;  3G1O A;  4M3G A;  2DK5 A;  3ZMT A;  4LK0 F;  2DA6 A;  4J01 A;  4BXX J;  3K1P A;  4XLN F;  2F4M B;  2ZJP F;  1KQ8 A;  4CZZ A;  2EQR A;  4DZP A;  4GFB A;  3J80 Z;  3I64 A;  1ETQ A;  4LB6 B;  3K2A A;  5DUI A;  2QWW A;  3LQQ A;  2EIL H;  4RMN A;  1WJB A;  4PSW A;  4W1U A;  3U2R A;  5EDN A;  1KU7 A;  3OIP A;  5DV5 A;  1GDT A;  5M5Y J;  3O8G A;  1K6Y A;  1P4W A;  1RZ4 A;  3E6B A;  4HX7 A;  1A5J A;  3ERM A;  2P81 A;  3RI4 A;  2CQX A;  3L2V A;  4QLC U;  3EDP A;  1UAA A;  2P5K A;  1E0E A;  2DU9 A;  2LMD A;  2FML A;  1BR2 A;  5BOX A;  3DEE A;  3NAR A;  4L0Z B;  3F9K A;  3FZV A;  5H2F C;  4ANJ A;  3GZ6 A;  4KFC A;  1SD7 A;  3C2G A;  3KEY A;  2VE8 A;  2Q1Z B;  4F55 A;  2L9R A;  2L0K A;  3HB9 A;  1B9M A;  5LHI A;  1GLN A;  2MLK A;  2CFX A;  4R1H A;  4D1Q A;  4OOI A;  4M71 A;  3RKX A;  2CFO A;  3SJM A;  2B63 J;  4KIG A;  3HSR A;  1WCM J;  2XGE A;  4WK8 F;  4G7Z F;  3BCA A;  1R5H A;  3GO5 A;  1R23 A;  2YPR A;  3FBI B;  2WAQ N;  2BV6 A;  2XSD C;  4A6E A;  4G6D A;  2VJI A;  4JBA A;  2YS9 A;  2BYV E;  3K4C A;  2VJ4 A;  2XRL A;  4CYD A;  2LFB A;  1T0F A;  3RQI A;  4XRS A;  1FT9 A;  5F0C A;  3M7G A;  2HNH A;  1XMK A;  3HHH A;  1FOX A;  4A6D A;  1GV5 A;  2FX0 A;  4HSR A;  5D5W B;  2E2I J;  3HRS A;  3A02 A;  2FF4 A;  2VAS A;  4HLX A;  1ZEL A;  5CVU A;  2QLZ A;  2HDD A;  3EYI A;  4PFP A;  2PMH A;  5FFZ A;  4BQQ A;  1R7J A;  1E3O C;  5LGN A;  1VF9 A;  4WXC A;  1ZN2 A;  3R60 A;  1LVA A;  4XN3 A;  4F52 A;  2E5Z A;  3ELK A;  2F5D A;  1WKM A;  2DT5 A;  3BR1 A;  3GUD A;  2MH2 A;  5HLI A;  4KN7 X;  3D0S A;  4XOR A;  4BEH B;  5EEH A;  5IYB J;  4IZZ A;  2YU9 J;  1YQA A;  3OWT A;  3FXR A;  4F93 B;  3CMA I;  1D1A A;  3L2U A;  2M34 A;  4JP0 A;  3PSF A;  4MEY F;  3HPH A;  4MHG A;  4CYC A;  3EUH A;  1Q1V A;  5A2Q K;  2XHK A;  3GBG A;  4P96 A;  2O5R A;  1G3W A;  1T39 A;  2CV0 A;  3SHF A;  2DT6 A;  2X0L A;  2HOE A;  3VSL A;  4FIS A;  4G94 A;  1RRJ A;  3GVA A;  2CQK A;  4N9H A;  3SYT A;  1XB4 A;  2PMZ A;  3TO9 A;  4FET A;  2ZFW A;  4PZJ A;  3ZQF A;  4H0E A;  1FP1 D;  2HQR A;  3BG5 A;  4BGD A;  2NNN A;  4C3J J;  1BIA A;  2ZXI A;  2LY2 A;  5IP9 J;  3S17 J;  3UR3 C;  1FZP B;  3R61 A;  2V1U A;  1T95 A;  3FXQ A;  2JPC A;  4L5I A;  4A3C J;  1PVE A;  2EIJ H;  2CW0 F;  1S7O A;  1HW1 A;  2JTV A;  3DPU A;  2HOS A;  3S1M J;  4F3Q A;  1HQC A;  3E6D A;  1GVJ A;  3LSJ A;  5F04 A;  1BC7 C;  4ENK A;  2IGO A;  3C1D A;  4GYI A;  1IRG A;  2HQA A;  3FMR A;  1OLT A;  5ICG A;  1J09 A;  2TCT A;  2QCO A;  3O2P E;  3H9J A;  4Q47 A;  4M6X A;  4XID A;  2BGC A;  1I6X A;  4ITV A;  3TO7 A;  2VE9 A;  3WTU C;  4JQF A;  2EWN A;  3H92 A;  2PLY A;  1S6L A;  5KAF C;  3D1N I;  1W7P B;  1BI0 A;  1YOV B;  1TC3 C;  1JE8 A;  3RPQ A;  2HZD A;  4EJW A;  4IQJ A;  3F8C A;  2FUG 2;  2R5Z A;  4FAS D;  2CQQ A;  2VBY A;  5E8I A;  1MSF C;  4CCM A;  5H6Q A;  1YG2 A;  1LKX A;  5E3L A;  4PFO A;  2R7O A;  4IVN A;  2LY9 A;  2MAB A;  1Y56 A;  4CCN A;  3MKL A;  5AIQ A;  1S8N A;  3DEU A;  3FX3 A;  1AA7 A;  5FKK A;  4B48 A;  3DTE A;  2DDB A;  2DI3 A;  1TWH J;  3IHU A;  4BJ6 C;  1P4A A;  4UY8 I;  1FTT A;  3B02 A;  2HVS A;  5E1X A;  1Z7U A;  2JZY A;  4MEX F;  1A31 A;  2GWR A;  3BZ6 A;  1EH8 A;  5DCM B;  4MGR A;  1R22 A;  3KZI C;  2E1O A;  5J1R A;  1U5T B;  1G4D A;  4WCG A;  2KDZ A;  5E8G A;  4FQG A;  3F6V A;  4IHT A;  2K9Q A;  2DLL A;  2EB7 A;  3A0H C;  2DA4 A;  3GWZ A;  4BAY A;  1LE8 B;  2RNJ A;  4AID A;  2STT A;  3PJR A;  2JJ7 A;  2K3P A;  2QQ9 A;  3ZPL A;  5DM6 F;  1UG2 A;  3WTS C;  1I5Z A;  2CQ7 A;  1FC3 A;  1REP C;  2F6C A;  2IEK A;  2LG4 A;  1EV7 A;  1XGM A;  5IPA A;  1BA5 A;  5HOO A;  4D5F A;  1K79 A;  3WU1 B;  4E7Z A;  2OCC H;  5K7Z A;  3S2H J;  3M1C A;  3K70 D;  4UV8 A;  2EK5 A;  3ABT A;  4ZC3 A;  5A2Q Z;  1F5T A;  3AG3 H;  2GXA A;  4OIO F;  3CD6 I;  2NVQ J;  4D5C A;  3I71 A;  4B4C A;  2WAD A;  1Y8R B;  1KYW A;  3M8E A;  1FEX A;  3EYY A;  1I27 A;  5D4R A;  3DKY A;  1YS6 A;  3MKW B;  1U3E M;  3CMY A;  3DBL B;  1WHU A;  3GTQ J;  1W7P D;  5GPC A;  3E97 A;  3S14 J;  4ZYD A;  1ZH5 A;  2JA6 J;  2R7T A;  3ABU A;  1J2X A;  2ZNZ A;  2QEX I;  2EJR A;  1P9Q C;  1E3P A;  3OL3 A;  2JA7 J;  1V5E A;  4LLL A;  3D5R C;  5L3C A;  3K9T A;  1POG A;  1SD5 A;  2B0L A;  4NB5 A;  1NG7 A;  3OYE A;  2E1M C;  3FK7 A;  3CMM A;  2AO9 A;  3IUO A;  5B66 C;  3QOD A;  4LMY A;  2CG4 A;  3DP7 A;  5GTI C;  2KRH A;  2BW3 A;  4IQ4 A;  2LRD A;  4MNU A;  1XGN A;  1UJ8 A;  2EV5 A;  4XRF A;  2CUE A;  2XF6 A;  5CQG A;  2QBY B;  1HOM A;  3J7A O;  4KN4 X;  5FRN A;  4PGH A;  5E20 A;  2BY3 A;  4IF4 A;  2QQB A;  4LIV A;  3G2B A;  4Z6Y A;  4MTD A;  3ZOB A;  5ICC A;  1PUF B;  4A5N A;  2P6S A;  4N0B A;  1MW7 A;  2UXX A;  4I0B A;  3VPR A;  4B09 A;  3QPS A;  3A1Y A;  4XRS G;  2QZ8 A;  3GZN B;  4JX6 A;  1X2N A;  4ESB A;  2LOO A;  1R6R A;  2VN2 A;  3I4N J;  3L00 A;  2RGV A;  2VXZ A;  2YX7 A;  5E79 C;  3NAU A;  2HTJ A;  3SZP A;  2MW8 A;  1JJ8 C;  4KIS A;  1FIP A;  3RQ4 A;  2DK8 A;  2NS0 A;  3ZGK A;  1JUP A;  2GA2 A;  3K10 A;  1ZRF A;  4BQA A;  5DS9 A;  2LYC A;  3P7N A;  5KK1 A;  2X1E A;  2KLO A;  2HR3 A;  1BW5 A;  4MO7 A;  1UHW A;  1UHS A;  5CPR B;  3ZQH A;  3FXU A;  2DOD A;  5LHG A;  5E18 F;  3HZJ A;  4JOM A;  2E1C A;  1MBE A;  4PJM A;  1FYM A;  2Y9Z A;  4XSZ F;  3S8P A;  2CUJ A;  1DU6 A;  3EUH C;  3WTW C;  2Q2E A;  2LH9 A;  1JUS A;  1Z3Y A;  2M8E A;  3LAJ A;  1MSE C;  1MBG A;  3DKX A;  4UVB A;  3HYI A;  1OYY A;  1PDN C;  2EA4 A;  3CCJ I;  1FMW A;  3FM5 A;  4RB0 A;  5DD8 A;  3HTS B;  5HS8 A;  1H89 C;  1ETW A;  1Y39 A;  5ICF A;  1HDP A;  1XD7 A;  3CCS I;  1GVD A;  1WFX A;  2ZME A;  1ETK A;  1TW2 A;  4BH9 A;  1YIO A;  2R3S A;  2GXB A;  3CUO A;  1KZH A;  3WU2 C;  3C3W A;  3BTC A;  2XRO A;  2HFH A;  2B7E A;  1IN8 A;  1LDJ A;  2P8T A;  1ODD A;  2W00 A;  3H5A A;  3TO6 A;  3HRM A;  1FX7 A;  2BXZ A;  4PJ0 C;  2IS4 A;  1J75 A;  1XN7 A;  5BPD A;  2VOP A;  4KIF A;  1QBJ A;  1AKH B;  4ZDO A;  1EKE A;  3LMM A;  3NWT A;  2Z2S B;  3JRH A;  4BU2 A;  5HVQ C;  4V2F A;  1MKM A;  2E19 A;  4GXO A;  4PGG A;  1ZR4 A;  3TGN A;  1B6A A;  2DO7 A;  2IGM A;  3QOP A;  3M3Y J;  1FBQ A;  4OAZ A;  5CKT A;  2IP2 A;  4LFU A;  3I59 B;  4HA8 A;  2GIV A;  1MIJ A;  3GW2 A;  2E1N A;  3OS1 A;  2WAQ A;  1TL8 A;  3IL2 A;  2W57 A;  3LSK A;  4BHB A;  4E7L A;  2V9V A;  1X2M A;  1HSJ A;  3FKJ A;  4CCL A;  3IAM 2;  2LNB A;  2V6E A;  3DV8 A;  1NH3 A;  4DZJ A;  4Y15 A;  2RVC A;  2HZT A;  3TP3 A;  5IOZ A;  3TDU C;  5LGT A;  1OCR H;  4U7D A;  1R71 A;  2ETH A;  3H9Q A;  1SC7 A;  1FYL A;  4JYK A;  5J40 A;  1OCC H;  2DAO A;  2XGD A;  2UZK A;  1XTA A;  1VTN C;  2MSY A;  3Q0W A;  4YEJ A;  5HDK A;  4C2U A;  2YX4 A;  5H6R A;  1B72 B;  4XMY A;  1O3Q A;  1RI7 A;  2FNP A;  4X6A J;  2HDW A;  2BY1 A;  4HAM A;  4EMS A;  1RET A;  3TOA A;  3OR1 C;  1MBK A;  3VWB A;  2XGX A;  1S5L C;  3ZMS A;  3Q0V A;  4I6Z A;  4CHU A;  2V79 A;  3GFM A;  3DPL C;  2W84 A;  3KE2 A;  5L3B A;  3CO6 C;  2Z5U A;  3E5Q A;  2X85 A;  1V55 H;  3B6C A;  2LKP A;  1BL0 A;  2XB5 A;  2KRC A;  1PP7 U;  1DU0 A;  1GHC A;  3A01 B;  4ZTF A;  2I8D A;  3ASO H;  2VXD A;  4E4H A;  3A2K A;  1HCR A;  1TT5 B;  4EEF G;  3CDH A;  1A35 A;  4CA0 A;  5JHF A;  2VBW A;  1FOY A;  2UUZ A;  2KJB A;  5KAI C;  4ZDP A;  2AHQ A;  4HYE A;  4ZYH A;  3TW6 A;  4L9J A;  4HLY A;  1VND A;  1OFC X;  2QM3 A;  4TV7 A;  2ID6 A;  1Z3X A;  1O7L A;  1JUM A;  3HEF A;  4XN0 A;  2DOA A;  3E0J B;  3J80 K;  3NEU A;  2KPM A;  3H36 A;  2K85 A;  3IH4 A;  4DQ2 A;  3CCM I;  4MIM A;  1OIS A;  5B1B H;  3GME A;  4ETS A;  1D3Y A;  1FBS A;  1XSX A;  3FMQ A;  1YW7 A;  4HV6 A;  1P4X A;  2DCE A;  1ACI A;  1HBX G;  2HOA A;  1P92 A;  2MYS A;  4IHY A;  1U0J A;  3M8J A;  1J0R A;  5F1R A;  2IS1 A;  1KU9 A;  2BE5 F;  4AIK A;  3BPV A;  4CXF A;  4KDP A;  1X1D A;  1FNN A;  3M4O J;  2XF5 A;  1DGW Y;  1ULY A;  3JRI A;  1DGR M;  2C6Y A;  3VOE A;  2DA5 A;  1YRN A;  3PNT A;  1IRZ A;  1KYZ A;  5IT3 A;  1JHH A;  3S2D J;  3IP4 B;  1QHG A;  4X0G A;  4ENN A;  2M8G X;  4IOC F;  3P5J A;  3QQA A;  2MD0 A;  4WXH A;  2FBI A;  2OCE A;  4CUG A;  4BUP A;  3NWS A;  3JSP A;  2NYX A;  3HOS A;  2UWM A;  2DT7 B;  6PAX A;  1W5T A;  2R7Q A;  2RRE A;  3HJE A;  1TBX A;  1LNW A;  1H8A C;  2K86 A;  5K5R A;  3S2W A;  3WGI A;  2HKO A;  5JVG F;  2CU7 A;  2ECB A;  2VPR A;  1Z1D A;  3BTI A;  5LLQ A;  5L3D A;  2E60 A;  3KEQ A;  2EBI A;  4EJT A;  1I1S A;  2CO5 A;  2H1L A;  3TL4 X;  4EGY A;  4D7N A;  2WBM A;  2O0Y A;  3VYU B;  1QRY A;  1QZY A;  1X1P A;  4LGW A;  2FD5 A;  2Q0O A;  2X6W A;  2X6X A;  1WJC A;  3JRC A;  3KYL A;  2ELJ A;  2WC2 A;  1R1V A;  3DU5 A;  4GO1 A;  3V8K A;  3ZQG A;  4EJU A;  3PSI A;  5FKL A;  4DBR A;  4J19 A;  2DFF A;  2R92 J;  3HRT A;  1I50 J;  2GAU A;  2HKX A;  2FOW A;  3HG9 A;  3HOU J;  2KZV A;  1NK3 P;  3AG2 H;  4DYQ A;  4DJA A;  1TTY A;  2BVM A;  4BYY A;  2VT2 A;  4EAT A;  1V5F A;  2EA2 A;  2DFE A;  3CCV I;  3K0L A;  5GAE J;  1OCZ H;  1W7P A;  1IG7 A;  1W0U A;  5LEJ A;  2MH9 A;  5M3M J;  1WSU A;  1S3J A;  3E3V A;  3ONQ A;  4XKW A;  3FWE A;  2W48 A;  3LA2 A;  4BS9 A;  5E3M A;  2KRF A;  3SFZ A;  2P7C B;  2W24 A;  3QPL A;  1K4S A;  1F43 A;  2XAJ A;  4DIQ A;  2K9L A;  3KP7 A;  2E2H J;  3H0D A;  4NC7 A;  2XPV A;  4E7H A;  4NUB A;  5C4X J;  1F4K A;  1VQ7 I;  1AOY A;  4UUS B;  1U78 A;  2ZME C;  2ZJ2 A;  3RKY A;  3BQY A;  2Z3Y A;  4XNF A;  5DCM A;  2K27 A;  3S15 J;  2A6T A;  1MJB A;  2VT3 A;  2WAF A;  4HEA 2;  2NVY J;  3OS2 A;  3CJR B;  3LL7 A;  1U9O A;  4FE7 A;  5EZH A;  4YIR X;  2ZO4 A;  4A12 A;  3HGY A;  5JI6 A;  3G6E I;  3GTL J;  2RV8 A;  1IW7 F;  3BZC A;  2PMU A;  2A3S A;  2CS3 A;  3IWZ A;  4ZJZ A;  4ZZL A;  5EGO B;  2ISZ A;  3HOV J;  4Q48 A;  4LB5 A;  4RB1 A;  1FP2 A;  4OMZ A;  1FSH A;  3U1K A;  5IP7 J;  4KMF A;  4HX8 A;  1P7I A;  2V26 A;  1G6N A;  3L09 A;  4CCO A;  3F8B A;  1MH4 A;  1D1C A;  4XLH A;  2O8X A;  2Z99 A;  1B59 A;  5EYR A;  3ZMV A;  3AKZ A;  2BY0 A;  5M3F J;  1ZGW A;  2A07 F;  2CV2 A;  3RPU D;  3BJO A;  3CC4 I;  1FPQ A;  3HHG A;  3QPT A;  5M5X J;  2PFB A;  4XQF A;  3W6V A;  4A0Z A;  4YFN F;  1YTY A;  2HTS A;  3E5X A;  2QYO A;  2ZKZ A;  2OU2 A;  4G8X A;  2Y31 A;  2A68 F;  2OTJ I;  5TJJ A;  2JUG A;  5CVV A;  1T8I A;  4L5E A;  1V54 H;  3DQV C;  5B1A H;  4B43 A;  3KLO A;  4CDG A;  1WWX A;  2L02 A;  3OIO A;  4ZYG A;  4KYW A;  2KDO A;  2M30 A;  3K4K A;  4OIR F;  2DYR H;  3WTV C;  4Q5S F;  2XDV A;  3JRE A;  3J7Z I;  3I4P A;  3DPT A;  4IJA A;  4B3X A;  4HDV A;  1PUE E;  3GLL A;  4PCQ A;  1JKO C;  2NAZ A;  1GV2 A;  2ZJR F;  4D9J A;  3REO A;  1D0X A;  3VB2 A;  1OPC A;  1Z05 A;  4EVI A;  2PJR A;  2ZXJ A;  4YFK F;  3IWF A;  3TP0 A;  1K6O A;  1W5C C;  3KZZ A;  2VLA A;  5ILS A;  1FSE A;  1ZRC A;  3H5R A;  4IL6 C;  4IHX A;  1W36 D;  2ZNY A;  1TQM A;  4M73 A;  1WI3 A;  5FKN A;  1ZTR A;  1BM9 A;  3ISP A;  3DLA A;  2COB A;  4L0Y B;  3T8T A;  3ZCO A;  4M72 A;  1ZG1 A;  4M6Y A;  1Z0X A;  1Z6R A;  4UVC A;  4OAY A;  3CP8 A;  4Q4Z F;  3N4M A;  4QIW N;  2P5V A;  3EPZ A;  5IOY A;  2OZ6 A;  1OYW A;  1NG6 A;  3GYH X;  1PUF A;  3G1L A;  1VQL I;  2NVU B;  3MAJ A;  1FIA A;  1EF4 A;  5EG0 A;  3OYI A;  3DTK A;  1OCT C;  2DJN A;  3WTZ A;  2GOX B;  2VQC A;  1QO0 D;  3PQJ A;  1G8X A;  2M7A A;  1ON2 A;  1HKQ A;  2LRE A;  3GLX A;  2RQQ A;  3IH3 A;  3KP3 A;  5HOD A;  2DFI A;  1S9H A;  2HOT A;  4S05 A;  3PFI A;  1RC9 A;  2L9N A;  3BJ6 A;  4EQQ A;  4FTH A;  5IY5 H;  1UMQ A;  2EPF A;  2NNY A;  3W6J B;  4PSX A;  3UKG A;  4L9N A;  1O3R A;  1EH6 A;  1Z67 A;  2DOE A;  2L4M A;  1JKR C;  1VQ8 I;  1VQP I;  1FY7 A;  1H9T A;  3DWL E;  1QZZ A;  4O3M A;  2JA8 J;  2GXG A;  2MBF A;  3HXL A;  5E17 F;  2WV0 A;  2VI6 A;  5HS7 A;  1NTC A;  5JFR A;  2A69 F;  2EZI A;  2R93 J;  3BR5 A;  3CCQ I;  3LA3 A;  4A0X A;  3TOB A;  3DFG A;  2A5Y B;  4PJL A;  3F8N A;  1FBU A;  3JRD A;  2CJJ A;  1K83 J;  3CP2 A;  4I02 A;  4D0P A;  2XB0 X;  5BMZ A;  1YJ9 I;  3OIQ A;  3L7W A;  2PI0 A;  4BDZ A;  1DQU A;  1N75 A;  4BQN A;  3AAF A;  1LEB A;  3P9C A;  1E2X A;  2JPB A;  3A03 A;  4E6K G;  1R49 A;  4ASN A;  1S7A A;  2L7Z A;  4G12 A;  2CWE A;  2PX9 A;  2WY7 Q;  3LSP A;  2JA5 J;  1VQN I;  1CGP A;  4A3B J;  4RAY A;  4UHT A;  1U8B A;  3S32 A;  4XRM A;  4LJZ F;  1XCV A;  3OYJ A;  2DFH A;  1R1U A;  2L7F P;  1LJ9 A;  1XG1 A;  2A6H F;  3P9K A;  2FA5 A;  1LUJ B;  3SXY A;  3OYG A;  2BVL A;  2M2E A;  2L7K A;  4RB2 C;  5D5U B;  3C7J A;  3K70 C;  2CSO A;  2O7O A;  3BJA A;  3HIF A;  3P9I A;  1VQM I;  2AQF A;  3WTX C;  1AKH A;  4DW6 A;  3HGG A;  5F6F A;  5J3L A;  2NXN B;  2R7W A;  2M0C A;  1X1C A;  3CUQ B;  4XM3 A;  4LG0 A;  2EIK H;  5BNG A;  1MND A;  3GX4 X;  1TT0 A;  4FHT A;  3I59 A;  1I1G A;  3JTH A;  1X4O A;  2MA3 A;  2JUC A;  3CDL A;  1WJE A;  3PQK A;  2O8K A;  5JHU A;  4A3D J;  2FBK A;  2LD5 A;  5E1Z B;  1AWC A;  3GTP J;  4PJN A;  2ZC2 A;  3K4M A;  5LRS A;  2DYS H;  4C3H J;  1I3A A;  2KT0 A;  1SAN A;  4BE1 A;  2CV1 A;  2O61 A;  2VUM J;  4HF1 A;  3KX2 A;  4M3F A;  4XLF A;  2IBD A;  2X4H A;  2QUF A;  3TBI A;  1G3S A;  2PBI A;  1TWA J;  5DEQ A;  4S04 A;  2M87 A;  4XLE A;  1IC8 A;  2JQ7 A;  3DXJ F;  2BY2 A;  4CGZ A;  1B72 A;  2CH0 A;  5EF6 A;  5KNL A;  2Y9Y A;  2H09 A;  3FHZ A;  1IZ1 A;  2LC2 A;  1FJL A;  4M6V A;  3BQZ A;  4N4N B;  3N97 A;  1PP8 F;  3OYB A;  1ETY A;  3GCM A;  1BOA A;  2X48 A;  2K4B A;  4WX9 A;  3G73 A;  4G7H F;  3FXO A;  2PG4 A;  4WXD A;  5TIS C;  4IRI A;  5J8F A;  4AM3 A;  1B4A A;  2M9H A;  1LFP A;  3I4M J;  4LOC A;  1RPW A;  5DM7 F;  1AHD P;  4O6J A;  3RYP A;  2Z33 A;  4BBS J;  3QP6 A;  5L3G A;  2E7W A;  3BR2 A;  4N4O B;  3DBR B;  1KQ0 A;  1S29 A;  1R5G A;  4AU7 A;  2M7B A;  3A01 A;  3QYE A;  2DA7 A;  3F8M A;  4L9T A;  2H6B A;  2ESN A;  4NC6 A;  1J5Y A;  1OQY A;  2Y0S N;  2AXT C;  4XSX F;  2Z1D A;  3TKY A;  2PEX A;  3PO2 J;  2D45 A;  1QHH D;  4A0Y A;  2NS7 A;  2V1N A;  3BG3 A;  2V4J C;  5LGU A;  4HST A;  3KET A;  3IRR A;  4C9Y A;  3KEO A;  5TGT A;  2VPL A;  3BOQ A;  3CJT B;  2L4A A;  3ZQQ A;  2VJJ A;  4MTE A;  2N8G A;  1WI9 A;  2G7U A;  3V4G A;  3LFK A;  4BQO A;  3V8L A;  3CLQ A;  2XRN A;  1YX3 A;  3L2C A;  1ERD A;  2GM4 A;  4NC8 A;  1MJA A;  3PUB A;  3Q9S A;  3QRF F;  1FMV A;  3SDG A;  1Z77 A;  2H6C A;  1APL C;  2W85 A;  4A3G J;  2FQ3 A;  3VYR B;  3HOX J;  4XLP F;  1PJR A;  4BKX A;  1T56 A;  2FQ4 A;  3FXK A;  4CSW A;  1NK2 P;  2IS6 A;  2EZH A;  2K3F A;  5D5V B;  1V4R A;  2FMY A;  1Y8Q B;  4RDU A;  5F08 A;  3ROU A;  1VFC A;  2DTR A;  1O57 A;  4MQ9 F;  2AXL A;  2VC1 A;  4HF2 A;  1ZG5 A;  2DN0 A;  3IV5 A;  4FX0 A;  5DD4 A;  3I56 I;  3GTG J;  4AWX B;  3KZY A;  1R00 A;  1ZQ3 P;  2OA4 A;  4II2 A;  2HQN A;  1MBH A;  3HUG B;  2H1K A;  3MZH A;  4CYC B;  1Z9C A;  1YIT I;  3BRO A;  4YFX F;  2NOG A;  3R0J A;  2R7S A;  4RAG A;  2OV7 A;  1K61 A;  1ONV A;  3ZQI A;  1A6Q A;  1P2F A;  4G9Y A;  2DDA A;  5LFA A;  1HC8 A;  3M8F A;  1TW3 A;  1UFM A;  5FLM J;  2UV1 A;  3JAM Z;  1HDD C;  2R7D A;  2W7N A;  3I54 A;  4BNC A;  3RZD J;  3RPU A;  3OMY A;  3DF8 A;  4ENM A;  1MDM A;  2HXI A;  1MBF A;  4R79 A;  3WU0 A;  3KLN A;  4IKF A;  4NBQ A;  2ZSH B;  1D8K A;  3EUK L;  5IYC J;  2AS5 F;  3KYD B;  4BHC A;  1IN4 A;  1UCR A;  1ZKG A;  3J81 K;  4F91 B;  2G7H A;  2O3F A;  2R0Q C;  4RAZ A;  1OKR A;  1Q1H A;  1Y6I A;  3ZQL A;  5LEK A;  1QVU A;  1SMT A;  3K69 A;  4EM1 A;  1ZGA A;  3BC8 A;  3FK6 A;  1WJD A;  3S1N J;  5EEG A;  3FXJ A;  2Y48 A;  4JX4 A;  4LIT A;  4EGZ A;  2CUZ A;  3GTJ J;  4EM0 B;  5J4V A;  2XUB A;  1XPX A;  2DMP A;  2D1H A;  2M45 A;  5J6X A;  5IT9 K;  2MG4 A;  1OCP A;  1ITY A;  3AG4 H;  1ZAO A;  2XAF A;  5AIP A;  2X6O A;  3RTR A;  2ICW G;  2MC4 A;  1XMA A;  4QPQ A;  3CCY A;  1LQ1 A;  4UB8 C;  3J7Y J;  3WHB A;  1HKS A;  2W82 A;  1WPK A;  3HOZ J;  2IA2 A;  1MGT A;  4I0A A;  4UUS A;  2VIX A;  3E1S A;  1G3Y A;  1RR7 A;  1LPQ A;  3BT9 A;  3ZN0 A;  5JVT A;  4XIC A;  1BC8 C;  2DW4 A;  3E6C C;  2KIM A;  2YU3 A;  3JCU C;  1RNL A;  3LSH A;  1ENH A;  3AFH A;  3V7C A;  1X1B A;  1J9I A;  1YX5 A;  3JSO A;  1J59 A;  3FDY A;  3I5U A;  4FT8 A;  4OIP F;  5LD2 C;  1IXC A;  1YJW I;  4A3F J;  1I3Q J;  2DPD A;  3HSE A;  5FD5 A;  1YFH A;  3Q9V A;  5GTH C;  1IN5 A;  1GUU A;  3V8J A;  2W1O A;  4O5V A;  4IPA A;  3W2W A;  1YE9 A;  2DTZ A;  2JT1 A;  1XDS A;  3S3N A;  2XGC A;  2QKL B;  3CC7 I;  1TWG J;  2ZFU A;  3SEQ A;  2F4I A;  2GOM A;  2JWT A;  4ZZD A;  4LLG F;  4UUV A;  4UNO A;  2IGK A;  5CYV A;  1UG0 A;  3K1M A;  1SEU A;  1HLV A;  2DXI A;  3MEX A;  4IOA F;  3RSN A;  1DDN A;  2GIZ A;  2JA2 A;  4XK4 A;  2MD5 A;  4A5M A;  1V3F A;  4BDY A;  1O3T A;  2D2W A;  4H4K C;  3QYB A;  3ESW B;  1IRF A;  1MNE A;  4XLC A;  5ERI A;  1Y1W J;  2X9D A;  1X4P A;  3HM5 A;  4B47 A;  3T5X A;  2O03 A;  3AG1 H;  3C18 A;  1BI2 A;  5GAG J;  3GXO A;  2Y30 A;  3OS0 A;  2IS2 A;  4UUT A;  2RNG A;  3OYF A;  4Y13 A;  5E3N A;  1EA3 A;  3RJP A;  2L2O A;  3L9F A;  1R4M B;  3ULQ B;  3WE3 A;  2FU4 A;  1ZR2 A;  1HA8 A;  2W25 A;  1F9N A;  4U7B A;  1W5S A;  1D5V A;  2FEZ A;  4ON0 A;  2V7F A;  1EJ9 A;  2R7V A;  5TRD A;  3ABM H;  2LP0 A;  2ZJQ F;  3MFK A;  1ZRD A;  1YS7 A;  3CCR I;  4M3E A;  2V9P A;  5LBQ A;  2MC3 A;  4BAC A;  5D8K B;  4XOT A;  5IYD J;  5CJ9 A;  3FIS A;  3J81 Z;  1KU3 A;  5D6F A;  5HDG A;  4IHW A;  1XSV A;  1IO2 A;  2TRT A;  3RYR A;  4C2M J;  5HLG A;  3GEZ A;  2FSW A;  4NNJ A;  1R1T A;  1U9N A;  3LFU A;  2BW3 B;  3RDI A;  1IDZ A;  1WJ5 A;  4BEH A;  4AC0 A;  2FE3 A;  5C44 J;  2K40 A;  2QQ8 A;  5IT9 Z;  1WQ2 A;  1ZK8 A;  3U21 A;  2R7Z J;  3K4B A;  3PFY A;  3ZQC A;  1ETX A;  4NDL A;  5DDG A;  2E71 A;  5L3E A;  1R5I D;  1S7E A;  1SVM A;  4EV0 A;  4DGW B;  3F23 A;  3CCL I;  1SFO J;  3OYH A;  2FRH A;  2EIM H;  2VB6 A;  1STZ A;  5K5Q A;  3ZR8 X;  1OR7 A;  2JRM A;  1YHQ I;  1N78 A;  5K7H A;  2J5P A;  2H8W A;  3K1N A;  5F1J A;  5L3F A;  1IRX A;  3O3K A;  4MLO A;  2VKV A;  3U1D A;  3CCE I;  1E3H A;  4KT5 C;  4HZF A;  5CVJ A;  4NQW B;  5C3E J;  3GTK J;  4M3B A;  1T6S A;  4IEJ A;  3UNG C;  2W4S A;  4CH7 A;  4BY1 J;  3BR0 A;  4ENJ A;  1IN6 A;  4WWC A;  4PUS A;  2NRA C;  1XSD A;  2Y2Z A;  2Z16 A;  5FKM A;  4M9X A;  3D5L A;  2ZB9 A;  4IHS A;  2G9W A;  1OYI A;  3G71 I;  3WGH A;  4XOP A;  4I76 A;  2BBY A;  2E34 A;  3QYF A;  3JR9 A;  2OUM A;  2MLG A;  5B3S H;  3W2V A;  4RGU A;  4Y17 A;  2F5V A;  5HNH A;  3R0A A;  3R6S A;  4XBF A;  3OSG A;  2XAG A;  1CF7 B;  2YSR A;  1IF1 A;  1GT0 C;  3PL8 A;  3IC7 A;  3WOD F;  4BXU A;  3OYK A;  1MMN A;  4DOZ A;  1MMA A;  1RUO A;  1QPM A;  1HW5 A;  1JT6 A;  4XKV A;  5F0H A;  1B8I B;  1K78 B;  5LRR A;  2RQP A;  2QSF X;  4M74 A;  4MFE A;  3OV8 A;  2LTP A;  1Z6T A;  2XC7 A;  2LDU A;  1U8R A;  3H35 A;  3L2W A;  1KGS A;  1T33 A;  3H9G A;  2WWY A;  3GF2 A;  5FD6 A;  2HVR A;  2OBP A;  1RKW A;  3BTJ A;  2OQR A;  2EFW A;  1YO5 C;  1H9G A;  2L7M P;  2LY1 A;  4G6Q A;  5FKO A;  2HI3 A;  4U0V A;  1R58 A;  1XMX A;  1E17 A;  3J7A Y;  2KL4 A;  2VQG A;  2HXO A;  3ASN H;  3H3U A;  1Z91 A;  1U5T A;  3CUQ A;  3R4K A;  4F7Z A;  2JVH A;  4G6T B;  5DTD A;  4AVP A;  4RLQ A;  1YLF A;  1Z21 A;  2KFD A;  3I53 A;  3AL0 C;  1B1B A;  1DPR A;  2K9M A;  2XAS A;  3I9V 2;  3IAS 2;  1LE8 A;  1ZGJ A;  2LK2 A;  2Y0S A;  2IA0 A;  4Y33 A;  1VQ9 I;  1FYK A;  2KMU A;  5J1Y A;  4AD9 A;  2ZBK A;  3CME I;  2BXY A;  3EET A;  1LB2 A;  2LBF B;  5C4J J;  3F21 A;  1Y1V J;  5DCF A;  1BN5 A;  4KIB A;  4DYR A;  1JI8 A;  3W3C A;  4I7H A;  1W36 C;  3IH2 A;  2HGC A;  4RB3 C;  2JMW A;  3L2Q A;  1BW6 A;  2FBH A;  3M9A A;  4UB6 C;  1AU7 A;  2XSJ C;  3DTI A;  1XGO A;  4HX4 A;  2EV0 A;  2MFZ A;  5J47 A;  3W2A A;  3JRA A;  2Y75 A;  2HDC A;  3V42 A;  5BQT A;  5FRM A;  4L5J A;  1I39 A;  2P7V B;  1TNT A;  3F3X A;  3HDD A;  1R4N B;  3MKY B;  1LEA A;  1XCB A;  3CC2 I;  3ERE D;  4G7O F;  2R5Y B;  2QA4 I;  2JN6 A;  3X2Q H;  3TW7 A;  2HPM A;  3KIO A;  3NRV A;  2DMT A;  3BTL A;  3VEP A;  4I09 A;  4E70 A;  4Y7N J;  2YR2 A;  3H1C A;  5HS9 A;  2DPU A;  4RA2 A;  4YII A;  5GAH J;  3KP6 A;  3Q0U A;  3CQZ J;  2M1B A;  2XVC A;  3BY6 A;  2DA3 A;  1BIB A;  1H0M A;  3MWM A;  2BHZ A;  4QTR A;  4LK1 F;  2KQR A;  2Y69 H;  2H27 A;  1FTZ A;  3FM3 A;  3CO7 C;  4JX5 A;  3RCO A;  2IGN A;  5E1W A;  1T38 A;  2VON A;  3SFI A;  2P4W A;  4K2E A;  4RAF A;  2EZK A;  2CGP A;  4X1E A;  2Z9O A;  2DQL A;  2KKO A;  3K6G A;  2QBY A;  3F6O A;  1JHF A;  3DLL F;  4MQV A;  3ZQ7 A;  2UXN A;  2Y0M A;  5EZG A;  2EFP A;  3GTM J;  3KP4 A;  2K4J A;  2CYY A;  3U9G A;  5ICE A;  5K1Y A;  4EM2 A;  1WZ2 A;  2KIS A;  1VQ5 I;  1RIO H;  3H3V K;  1P7J A;  4FE4 A;  5EJC A;  1PYV A;  3ZRG A;  1W0T A;  3HSF A;  2VKH A;  4ZTJ A;  1MH3 A;  1XDU A;  1YJN I;  2EH3 A;  2DOF A;  2AQE A;  3QAH A;  3COA C;  3IKT A;  4I2O A;  3C2B A;  2CW8 A;  5DUK A;  5FGM A;  2DBB A;  3BCB A;  2WB1 N;  2V1D A;  2VBZ A;  2HQ5 A;  5F64 A;  3LQR A;  1KA8 A;  4N9I A;  1X3U A;  4XKB A;  3MZ8 A;  2RAE A;  1KQ9 A;  1YRN B;  2FOK A;  4V2G A;  4HQM A;  3KP2 A;  1DUX C;  3HUG A;  2IPQ X;  5HLH A;  1XGS A;  4CCK A;  2KZG A;  3HTU A;  2ECC A;  5FJ8 J;  1TQI A;  3JRF A;  1IN7 A;  3T8R A;  4GDF A;  1JKP C;  3WG9 A;  4MFD A;  4KJZ A;  2IT0 A;  2L5Q A;  4BE2 A;  1TQP A;  2BOL A;  3ZMU A;  1GXQ A;  4D7M A;  3E6M A;  4AIJ A;  2X1C A;  1MBJ A;  5FB2 A;  3BPX A;  3GFI A;  4DBQ A;  1QGP A;  1OR7 C;  3B73 A;  1R36 A;  4C30 A;  4KNY A;  3BZK A;  5FRO A;  5D8L B;  2F5E A;  3QU6 A;  1MJ9 A;  1D8J A;  2CUF A;  2OQG A;  4CCJ A;  1FLI A;  2KHM A;  4Z2Y A;  1TP4 A;  3DU6 A;  5F27 A;  3A4C A;  4C3I J;  1WH7 A;  2G0E A;  1RUN A;  4NHJ A;  4AYB N;  2HYJ A;  3MKZ A;  1JXS A;  3A0B C;  3W6K B;  4LD5 A;  1WJA A;  3BP8 A;  2H8R A;  1A6I A;  3NQO A;  5K5O A;  2OAZ A;  1R9T J;  5IP6 A;  1QVT A;  4A69 C;  3VYT B;  3ECH A;  3O8H A;  3HKZ N;  3TDZ C;  2E5N A;  4Y4R A;  1VZ0 A;  2K02 A;  1MZB A;  1UHM A;  2R7U A;  5HDN A;  2O9L A;  3FF5 A;  1Z7L A;  5HLT A;  3JTG A;  2ZXH A;  2JK3 A;  3K2Z A;  1L0O C;  2GQQ A;  2VBX A;  2EFQ A;  3BR3 A;  2HWV A;  3Q5F A;  2EV6 A;  3S16 J;  2F5F A;  4YEL A;  2L9S A;  4ZYA A;  2WY8 Q;  1IUY A;  1YI2 I;  1RR8 C;  4V19 K;  4OIN F;  3T0Y A;  2WTE A;  3K4J A;  3CDI A;  2VC0 A;  4F92 B;  4HG2 A;  1A36 A;  4S0H B;  1ZHF A;  4E7K A;  2OJE D;  3JAM K;  4R8H A;  4UVA A;  3ZP5 A;  1X3Z B;  3V7R A;  1WVR A;  1JKQ C;  1V5G A;  1B9N A;  2OTL I;  3SQN A;  2RKH A;  3OYD A;  4M9S A;  4HW0 A;  1VI0 A;  4BL0 B;  2NVT J;  2XKO A;  1Y0N A;  2ELK A;  1D0Z A;  1LDK B;  3JRG A;  2RC4 A;  2FNA A;  3G1M A;  3MN2 A;  3DKW A;  5BPI A;  2R7R A;  3BG7 A;  1U5T C;  3HC7 A;  3CUQ C;  4HQE A;  3QU3 A;  1UZC A;  4YRV A;  3VOD A;  1L3L A;  4W97 A;  2BHY A;  3ZXS A;  3IRQ A;  2D5V A;  5E3O A;  1HF0 A;  1MNM C;  1YIJ I;  3WE2 A;  3PNY A;  2K7L A;  2RDP A;  2R7F A;  3OR2 C;  1KON A;  2IW5 A;  3KFW X;  3MCZ A;  2LVS A;  3I55 I;  3LNQ A;  4HPQ A;  1ZYR F;  3LSM A;  2E1M B;  3GTO J;  1USS A;  4P1W A;  5ILU A;  2NOJ B;  3RIR A;  5ED4 A;  1YW8 A;  2XKP A;  2WA0 A;  2M0M A;  2HPI A;  3PIO F;  4IRH A;  3OSF A;  4PJJ A;  4GYG A;  4A3I J;  1BBY A;  3FXM A;  3JW4 A;  3LSR A;  3LST A;  5J1U A;  5CVR A;  1T98 A;  2DMQ A;  2L3D A;  3CJQ B;  1ETO A;  3QOE A;  2ESH A;  5GPA A;  2HEO A;  5BS6 A;  1D1B A;  2BZT A;  3CLO A;  2QSG X;  2XAU A;  4Y52 J;  3S93 A;  2QQA A;  2IRF G;  1HST A;  5FLX K;  4I01 A;  2VQH A;  4HV5 A;  1QU3 A;  2PJR B;  2E7X A;  3TED A;  2V1X A;  2P6T A;  4ZH4 F;  3CF5 F;  2VL8 A;  2GLO A;  1Y0U A;  1IGN A;  2VQL A;  4L9V A;  2EZL A;  2X1D A;  1VQ6 I;  3RKQ A;  3LWF A;  3CCU I;  1VQK I;  1TWC J;  2ID3 A;  4AVZ A;  2RN7 A;  2FXA A;  3HPG A;  4QPO A;  1FOW A;  3SZT A;  1IXS B;  5DYM A;  4WF2 A;  4FX4 A;  3HRU A;  1QNT A;  2EFN A;  4J00 A;  2QVO A;  5KCM A;  2MGQ A;  1UST A;  3S1R J;  3OYL A;  3PO3 J;  4CIC A;  1TWF J;  4A3L J;  3FKI J;  2K9N A;  2F4O B;  1T0F C;  3I58 A;  5CLS A;  1XS9 A;  5EG0 B;  1W1W E;  1F36 A;  3TMO A;  3HOY J;  1X1A A;  2EIN H;  1VQO I;  2GBY A;  1I6H J;  2OD5 A;  1H88 C;  1KU2 A;  2CRG A;  4HBL A;  2NVX J;  1UEL B;  3D5S C;  2VOO A;  3DCF A;  4CO8 A;  3OOU A;  1VQ4 I;  2X6Y A;  3LA7 A;  2DA1 A;  4NQW A;  2QEN A;  3VSK A;  1G59 A;  2P0W A;  1IV8 A;  4YG2 F;  3PNV A;  5D4S A;  1JGS A;  2CQN A;  2DJI A;  2M3A A;  2XF7 A;  3BDD A;  3OL4 A;  3ZN1 A;  3F8F A;  4A3J J;  4KA4 A;  1BOB A;  2ZCW A;  4DYC A;  1IJW C;  4II3 A;  5HNF A;  3N05 A;  5LHH A;  2R4G A;  3PIP F;  1WGX A;  3H3Z A;  2K9S A;  4KMU X;  1WH5 A;  3ZMZ A;  4U0Y A;  1QQI A;  3KPH A;  5K7F A;  2KIF A;  2DMN A;  4M3D A;  4B3A A;  3C2H A;  1N25 A;  1SD6 A;  3RZO J;  1CF7 A;  4HOB A;  1FWZ A;  3SEZ A;  1WRJ A;  2A5W A;  3OYN A;  2V9K A;  4HF0 A;  5JLX A;  2L01 A;  3HL2 A;  1LFB A;  1BR1 A;  2OZU A;  3EUA A;  2GZW A;  2L54 A;  1B8I A;  1K78 A;  5FLV A;  3FMS A;  1UB9 A;  1SAX A;  2ELH A;  3S3O A;  1YYV A;  4BE0 A;  2OC6 A;  3S3M A;  1EH7 A;  1OCO H;  1BJA A;  2GA1 A;  4U88 A;  2O6G E;  3K7A J;  3Q3S A;  3CTA A;  1DPU A;  5GP9 A;  2R5Z B;  4OIQ F;  1G3T A;  4I98 B;  2ME6 A;  1ZLJ A;  2JSP A;  1BI3 A;  2VKE A;  4C2T A;  2DA2 A;  1M1E B;  2HYG D;  2PMZ N;  3L1P A;  3WHC A;  2LR8 A;  1ON1 A;  5JLW A;  4FCY A;  3HOT A;  3G4S I;  4Y3O A;  4P9U A;  5AON A;  5FLX Z;  4B1R A;  4ESJ A;  2M4G A;  2M4K A;  1BI1 A;  1SFK A;  3BG9 A;  4ABZ A;  2HU9 A;  2LF8 A;  4E7I A;  2ZSI B;  3ML6 A;  3KYC B;  3KCC A;  3SDB A;  2M5W A;  3B6A A;  3MVP A;  5D6E A;  2ACJ A;  5JR3 A;  5EEA A;  3VDX A;  2F5C A;  4DNC A;  2QF7 A;  1SMY F;  5EGO A;  3L2R A;  4LG0 B;  4IO9 F;  2QSH X;  3FXL A;  4BJT A;  4RGR A;  3GFL A;  1SAU A;  2PJP A;  2QKM B;  4P5O A;  3JRB A;  1N77 A;  3I3L A;  5J4Y A;  1ZAR A;  1HXD A;  1F1Z A;  2XIG A;  4U87 A;  1U6G A;  1JGG A;  5CVI A;  3LSG A;  4HRI A;  2LKS A;  4A3K J;  4A2U A;  2DMU A;  2JSC A;  2LBF A;  3HBL A;  3H0G J;  4LG3 A;  3S1Q J;  1MD0 A;  3K4L A;  4IRG A;  3E5U A;  3BR6 A;  1BJZ A;  1T2K A;  2HYF A;  2CMP A;  3QWL A;  9ANT A;  2B9S A;  2TDX A;  4PDK A;  4RM2 A;  1MMD A;  1SD4 A;  2ME0 A;  4M9Z A;  5D5X B;  1LVK A;  5M5W J;  4XLA A;  3QPH A;  4LLN A;  5ILV A;  3LAP A;  3OOP A;  4HNU A;  5FFX A;  1SFE A;  3ABK H;  4GRI A;  1IXR C;  3LOC A;  2E35 A;  2KIU A;  4HNV A;  2KJC A;  4I99 C;  5KHD A;  3KP5 A;  2R5Y A;  1RES A;  4HNT A;  1J7K A;  1QA6 A;  2WB1 A;  4OWR B;  2BEO A;  2D1V A;  2COM A; 
#chains in the Genus database with same CATH homology
 2LOO A;  1R6R A;  2X51 A;  2Y0S A;  4Y33 A;  2VXZ A;  2JVG A;  2KMU A;  2WY7 Q;  3S32 A;  3CF2 A;  3OYJ A;  4KIS A;  3RQ4 A;  2LBF B;  3OYA A;  3FHN A;  3CES A;  3ZGK A;  4IX7 A;  3W3C A;  1W36 C;  2WAE A;  3K10 A;  3L2Q A;  2LYC A;  4PK4 A;  2IXS A;  2XSJ C;  3DTI A;  2X1E A;  2KLO A;  3OYG A;  2BVL A;  2MFZ A;  2L7K A;  2VKD A;  2KP6 A;  5CPR B;  2HVQ A;  3W2A A;  3K70 C;  4E7S A;  3V42 A;  5FRM A;  4BJ5 C;  4JOM A;  4CZC A;  4PJM A;  2AQF A;  2VJ5 A;  3FBN B;  4XKC A;  1WJF A;  3MKY B;  3S8P A;  2CUJ A;  3EUH C;  2LH9 A;  2R7W A;  1D0Y A;  3OY9 A;  1X1C A;  4XM3 A;  1Z3Y A;  3DKX A;  4AYB A;  2HPM A;  4KIT B;  1TZL A;  1MND A;  1TT0 A;  1X4O A;  1FMW A;  1WJE A;  4XR6 A;  4E7J A;  3VYS B;  1WFX A;  4PJN A;  2KQR A;  4LIU A;  4RLF A;  3K4M A;  3RCO A;  3HKZ A;  4BE1 A;  2CV1 A;  1MMG A;  3BLY A;  2IGN A;  3KX2 A;  3H5N A;  4XLF A;  3TBI A;  3LSI A;  4KT6 A;  2W00 A;  3H5A A;  4XLE A;  3K6G A;  2CH0 A;  1BR4 A;  5KNL A;  2IS4 A;  2LC2 A;  5CQE A;  4N4N B;  3OYB A;  4ZDO A;  3MD2 A;  3LMM A;  3NWT A;  3OYM A;  2Z2S B;  4BU2 A;  5HVQ C;  2Q2E B;  4B44 A;  1PYV A;  3ZRG A;  1LFP A;  2CW7 A;  2IGM A;  2VKH A;  4ZTJ A;  3SZG A;  4OAZ A;  5CKT A;  2AQE A;  2CW8 A;  3OS1 A;  4RM3 A;  2WAQ A;  3OYC A;  4N4O B;  4E7L A;  3LSK A;  1X19 A;  4AU7 A;  2M7B A;  3BCB A;  3QYE A;  3FKJ A;  4CCL A;  3IAM 2;  1DP3 A;  2V6E A;  2Z1D A;  3K4N A;  4XKB A;  3BG6 A;  1QHH D;  2K5C A;  2V1N A;  2V4J C;  4BXF A;  3H9Q A;  4HST A;  4CCK A;  4C9Y A;  5TGT A;  2VPL A;  3ZQQ A;  2VJJ A;  4KJZ A;  4YEJ A;  3AL0 B;  4C2U A;  2L5Q A;  3MMY B;  4BE2 A;  2R7X A;  4BQO A;  2BOL A;  4XMY A;  1YX3 A;  4XL9 A;  2X1C A;  1ERD A;  2HDW A;  4NC8 A;  4ZDL A;  4XON A;  3PUB A;  4DBQ A;  4C30 A;  1OR7 C;  3OR1 C;  1FMV A;  3CZ6 A;  3VWB A;  5FRO A;  3VYR B;  1PJR A;  4CCJ A;  4J01 A;  3DPL C;  2KHM A;  4CSW A;  2IS6 A;  2X85 A;  3DU6 A;  3A4C A;  2KRC A;  3MKZ A;  4RMN A;  4ZTF A;  1WJB A;  2I8D A;  2VXD A;  4PSW A;  4E4H A;  3A2K A;  1WJA A;  3OIP A;  4CA0 A;  5JHF A;  2UUZ A;  1K6Y A;  4II2 A;  4ZDP A;  3HUG B;  3VYT B;  1Z3X A;  3L2V A;  2E5N A;  4XN0 A;  2DOA A;  4Y4R A;  2R7S A;  3E0J B;  1VZ0 A;  2KPM A;  1UAA A;  2OV7 A;  1E0E A;  1BR2 A;  2R7U A;  3DEE A;  5LFA A;  3F9K A;  2UV1 A;  1Z7L A;  5HLT A;  2DCE A;  2ZXH A;  2W7N A;  4ANJ A;  3C2G A;  2MYS A;  3KEY A;  2Q1Z B;  4F55 A;  1U0J A;  3M8J A;  4YEL A;  2L9S A;  3OMY A;  2IS1 A;  4ZYA A;  2WY8 Q;  1GLN A;  4R79 A;  1X1D A;  4IKF A;  4D1Q A;  3K4J A;  2ZSH B;  3EUK L;  2CFO A;  2XF5 A;  1DGW Y;  4HG2 A;  4F91 B;  1DGR M;  4E7K A;  3BCA A;  3FBI B;  1Y6I A;  3PNT A;  3BC8 A;  1V5G A;  2VJI A;  1WJD A;  3K4C A;  2VJ4 A;  3IP4 B;  1QHG A;  3OYD A;  4X0G A;  4LIT A;  4BL0 B;  2CUZ A;  1D0Z A;  1LDK B;  2MD0 A;  4CUG A;  4BUP A;  2HNH A;  3NWS A;  3HOS A;  2R7R A;  3BG7 A;  3HC7 A;  2UWM A;  2DT7 B;  2R7Q A;  2RRE A;  4HSR A;  4YRV A;  2VAS A;  3ZXS A;  1ZEL A;  3RTR A;  2MC4 A;  2E60 A;  3PNY A;  4QPQ A;  4PFP A;  3OR2 C;  1JI8 A;  1KON A;  3TL4 X;  4BQQ A;  4HPQ A;  3LSM A;  2W82 A;  2WBM A;  2E1M B;  3VYU B;  4P1W A;  2NOJ B;  4XN3 A;  2X6W A;  2VIX A;  3E1S A;  4F52 A;  2E5Z A;  2X6X A;  1WJC A;  3KYL A;  2ELJ A;  2WA0 A;  3DU5 A;  2M0M A;  2HPI A;  3PSI A;  4XOR A;  4BEH B;  4DBR A;  3LSH A;  3AFH A;  4PJJ A;  1X1B A;  1YX5 A;  3HG9 A;  3FDY A;  4IZZ A;  2KZV A;  5LD2 C;  3OWT A;  4F93 B;  4DJA A;  1D1A A;  2BVM A;  3CJQ B;  3L2U A;  3QOE A;  3PSF A;  3HPH A;  4EAT A;  1D1B A;  1V5F A;  2XAU A;  3GBG A;  2W1O A;  3S93 A;  2O5R A;  2CV0 A;  3W2W A;  2DT6 A;  1YE9 A;  3VSL A;  2VQH A;  1QU3 A;  2PJR B;  3S3N A;  2QKL B;  3SYT A;  2ZFU A;  3SEQ A;  2F4I A;  2GOM A;  2PMZ A;  4FET A;  3ONQ A;  4XKW A;  2VL8 A;  4BS9 A;  2IGK A;  1UG0 A;  2VQL A;  2X1D A;  4BGD A;  2DXI A;  3RSN A;  2JA2 A;  2ZXI A;  4DIQ A;  2LY2 A;  2K9L A;  4BDY A;  4H4K C;  3H0D A;  4NC7 A;  3UR3 C;  4AVZ A;  3QYB A;  4E7H A;  4NUB A;  3HPG A;  4QPO A;  1T95 A;  1MNE A;  4XLC A;  1X4P A;  4B47 A;  3DPU A;  4XNF A;  3OS0 A;  2IS2 A;  4J00 A;  2A6T A;  4F3Q A;  2WAF A;  4HEA 2;  5KCM A;  2RNG A;  3OYL A;  2IGO A;  3OYF A;  2HQA A;  3OS2 A;  3CJR B;  1EA3 A;  3LL7 A;  1OLT A;  1T0F C;  2L2O A;  1J09 A;  1HA8 A;  3TMO A;  1X1A A;  3H9J A;  4U7B A;  4ZJZ A;  2CS3 A;  4ITV A;  1UEL B;  2V7F A;  3D5S C;  2R7V A;  4JQF A;  3OOU A;  2X6Y A;  2V26 A;  4CCO A;  2HZD A;  4F92 B;  4XLH A;  1D1C A;  3AKZ A;  4IQJ A;  3VSK A;  2FUG 2;  1G59 A;  4BAC A;  4FAS D;  4XOT A;  2CV2 A;  2P0W A;  3RPU D;  4CCM A;  3PNV A;  1LKX A;  4XQF A;  2DJI A;  3OL4 A;  2M3A A;  2XF7 A;  2R7O A;  4PFO A;  2MAB A;  1Y56 A;  1BOB A;  4CCN A;  4NNJ A;  4II3 A;  3LFU A;  1AA7 A;  5HNF A;  3N05 A;  2BW3 B;  3DTE A;  4B48 A;  4BJ6 C;  1WJ5 A;  4BEH A;  2R4G A;  2HVS A;  2JUG A;  3DQV C;  4B43 A;  3U21 A;  3K4B A;  2KDO A;  3K4K A;  3PFY A;  3C2H A;  2XDV A;  3SEZ A;  4DGW B;  4B3X A;  2A5W A;  3DPT A;  3OYN A;  2V9K A;  3OYH A;  2VB6 A;  3ZR8 X;  3HL2 A;  1BR1 A;  4D9J A;  3EUA A;  1N78 A;  3PJR A;  1D0X A;  2K3P A;  2PJR A;  1IRX A;  3S3O A;  4MLO A;  4BE0 A;  2OC6 A;  4NQW B;  2VLA A;  3S3M A;  2F6C A;  3H5R A;  1W36 D;  2LG4 A;  3UNG C;  2W4S A;  4CH7 A;  5HOO A;  2JSP A;  3DLA A;  4E7Z A;  4PUS A;  4C2T A;  3M1C A;  3ZCO A;  3K70 D;  4ZC3 A;  2Z16 A;  3D5L A;  4OAY A;  3CP8 A;  3HOT A;  4Y3O A;  4XOP A;  3QYF A;  2OUM A;  2WAD A;  2M4G A;  3EPZ A;  2M4K A;  3W2V A;  1NG6 A;  1SFK A;  5HNH A;  2F5V A;  4E7I A;  2HU9 A;  2ZSI B;  3DKY A;  3MKW B;  3SDB A;  3OYI A;  3DTK A;  2R7T A;  2GOX B;  3VDX A;  2VQC A;  3PL8 A;  3L2R A;  3OYK A;  1MMN A;  4DOZ A;  1G8X A;  1MMA A;  1P9Q C;  2M7A A;  4BJT A;  2LRE A;  1SAU A;  2QKM B;  2RQQ A;  3OL3 A;  4P5O A;  1N77 A;  1V5E A;  3I3L A;  1S9H A;  3D5R C;  4U87 A;  4XKV A;  2L9N A;  3LSG A;  4HRI A;  2LBF A;  1NG7 A;  3OYE A;  2E1M C;  4LG3 A;  4PSX A;  3K4L A;  2XC7 A;  3H35 A;  3CMM A;  3IUO A;  3L2W A;  2CMP A;  3H9G A;  3DWL E;  4RM2 A;  1MMD A;  3QOD A;  2HVR A;  3HXL A;  1LVK A;  2KRH A;  2BW3 A;  4XLA A;  4IQ4 A;  2LRD A;  4HNU A;  2LY1 A;  2XF6 A;  5CQG A;  4GRI A;  4PJL A;  5FRN A;  3J7A Y;  4LIV A;  2KL4 A;  3CP2 A;  3G2B A;  2VQG A;  3OIQ A;  5KHD A;  2JVH A;  4G6T B;  4HNT A;  1MW7 A;  4BDZ A;  4RLQ A;  1DQU A;  1Z21 A;  1N75 A;  3A1Y A;  4BQN A;  3AL0 C;  2WB1 A;  2K9M A;  4OWR B;  3I9V 2;  4E6K G;  3IAS 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...