2VQLA

Crystal structure of porb from corynebacterium glutamicum (crystal form iii)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
76
structure length
76
Chain Sequence
LSPQYNWVACGILEGGLKAAGVLEEGQYNRELAEAIAAKGEGFWTTQFPQIGDWNEDQAAALADRAQTCGLVKADT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UNCHARACTERIZED PROTEIN CGL0972
publication title A Putative Alpha-Helical Porin from Corynebacterium Glutamicum.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Membrane protein
total genus 26
structure length 76
sequence length 76
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11565 PorB Alpha helical Porin B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1280 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vqlA00
2VQHA 2VQGA 2VQLA
chains in the Genus database with same CATH superfamily
2Z3YA 3HEFA 1A35A 1JTXA 4XLAA 2NXNB 4XOPA 2LVSA 2OUMA 3BZ6A 4OU0A 2DA7A 4BY1J 4FE4A 4XSZF 2CUEA 3CJQB 1HBXG 1Z91A 3LWFA 4B3XA 2FEZA 1MNEA 1DPRA 3BG6A 2LYCA 4ZYHA 3L9FA 3OS2A 4MFDA 2KHMA 2VB6A 4U7DA 1AA7A 2PG4A 3AFHA 4QTRA 4RM3A 4CA0A 5J4YA 1G8XA 2HXOA 4EQQA 2XROA 1HSTA 2A69F 1X4PA 2M3AA 2ZXIA 3OYJA 4II2A 5JLXA 1ZR2A 1U6GA 2OZ6A 4CCKA 2BVMA 3LA2A 3HRMA 3H3VK 5GAHJ 4KDPA 3A2KA 1TLHB 5E3NA 2DMQA 1Z0XA 3WTYC 1K4TA 4G12A 1S9HA 3FKJA 4ON0A 3TQNA 3CJNA 4QSHA 3F3XA 3BCAA 2NVUB 2FJ1A 4DZPA 4BXFA 1WGXA 3S1QJ 1OR7A 3CCQI 2ZC2A 3ZMDA 5HS8A 1NH3A 1GLNA 3G3ZA 2XDVA 3B6AA 3D0SA 1K6OA 1WJEA 2YPRA 2X1DA 4I99C 2DU9A 1YOVB 3PIPF 2QSFX 1DGWY 3F9KA 2JMWA 2F5FA 1SFEA 3TMOA 3DLLF 3OY9A 3DPLC 1IN5A 1JKRC 2MG4A 2EV0A 3KP5A 1MSFC 2VUMJ 2FBHA 2EFQA 1A04A 5DV5A 1SFOJ 1G59A 2TRTA 3H5NA 3QPHA 4NUBA 1MBJA 1BI1A 4IHVA 4HV5A 2M34A 1GT0C 1ZQ3P 1OR7C 2XAUA 3E97A 3TW6A 3IAM2 2WAEA 1F5TA 2E2HJ 5H6RA 1I5ZA 2W7NA 4A3BJ 1O3TA 2F6CA 4A93J 1YTYA 3PL8A 1WRJA 3FX3A 3RYPA 4Y17A 5HNHA 1EH6A 4XKWA 4F91B 3WGHA 3OYNA 3HOYJ 3LFKA 4RAGA 4TV7A 1B9NA 2X6WA 1SD5A 1Z7UA 4HNUA 3FKIJ 3OYFA 2L4MA 3W6JB 4MEYF 3UKGA 2GIZA 1P4AA 5FJ8J 2VE8A 2IRFG 3VB2A 4OIQF 3HIFA 3GXOA 3HJEA 3S1MJ 4PSXA 2X1CA 2XAFA 4L5JA 1XB4A 3Q0VA 2WV1A 3PFIA 2CU7A 3PNTA 3EUAA 2O61A 1QU3A 1PJRA 2MLGA 2HXIA 2IP2A 1IXRC 2COMA 4L0YB 3T1BA 1Y6IA 2H1LA 3SYTA 4U7BA 3HRTA 1RPWA 4Y13A 3PSIA 3F6OA 3LSMA 4RMNA 3U9GA 1VQ6I 3U1KA 1HW1A 1B72A 2M0CA 2DDBA 2DA4A 1HLVA 3OR1C 1TT5B 2X4HA 5DCMA 4Y52J 4A6DA 5JR3A 3KE2A 1L0OC 1YLFA 2HI3A 1B8IB 2R5ZA 1T98A 4GXOA 5F1RA 1QHHD 4CYCB 2HDDA 3HB9A 5LRRA 3KP2A 1DDNA 3I3LA 1IXSB 2E7XA 2BW3B 2K5CA 5HOOA 1K61A 1FSHA 2P5LC 3T5XA 1W7PB 1FOXA 2VJ4A 3P7NA 3GF2A 5ILVA 1VQPI 3SQNA 2V1NA 3E3VA 2L54A 4HA8A 4CSWA 4E70A 1YG2A 2BY1A 2HOAA 5IYBJ 1ZR4A 3RJPA 3HOVJ 4IPAA 2PLYA 2XGEA 2DFHA 5JVGF 4P5OA 2FQ3A 2BHYA 1XMXA 3WTVC 3N05A 3CO7C 4ZTJA 1TL8A 3JRFA 3OYKA 1WSUA 1D1AA 2LKSA 4EEFG 4W97A 5CKTA 2F5VA 2CQQA 2W00A 2HEOA 1TQPA 2FXAA 1TW2A 5ERIA 2FU4A 3BG3A 5B1BH 2IJLA 1KZHA 4ASNA 4G7ZF 2E1CA 5HDGA 1XCVA 2XKPA 1TNTA 2JUGA 4GRIA 2Y69H 4HX4A 1IO2A 4ZYDA 4BXUA 3T8RA 1PUFB 5HS7A 5LGUA 3GTMJ 1ZYRF 4ZH4F 2IS4A 4KISA 2JA7J 3NWSA 1N77A 2K86A 2RGVA 1FJLA 4OMYA 1FBSA 2HOSA 4AU7A 3M8FA 3HOXJ 1HOMA 2EIMH 4BE0A 4UVAA 2X6OA 3ULQB 2EA4A 2EFWA 2LOOA 3S16J 2P7VB 2D1VA 2JRMA 2IGMA 4BQNA 2VT2A 3L2QA 4ZYGA 3M1CA 4E7HA 3E7LA 5EG0B 4B3AA 4G7OF 1V5EA 5J1RA 3RDIA 4AVPA 5A2QZ 1G2HA 2AXLA 1ETKA 4Q5SF 2V1UA 5BMZA 4XN3A 2BHZA 4LK1F 3FMRA 1WJ5A 4PUSA 5DTDA 1Z7LA 1W0UA 3W2AA 4HSTA 2XGDA 2CV1A 4CHUA 2FRHA 2MC3A 2I8DA 3VWBA 2JTVA 3AG3H 2P7CB 2Y0MA 1FMWA 2CSOA 4I0AA 1X1AA 4BXXJ 1KU9A 2ZFUA 2DFIA 2HNHA 3RKQA 4LG0B 4MTDA 4IXAA 1BIBA 4MFEA 3HUGB 3V4GA 2R5YB 2G7HA 5EEGA 5KHDA 3I58A 1OCCH 2ACJA 1VQMI 2IA2A 3DTEA 1JUMA 1O57A 2EK5A 2ELHA 4KICA 4BBRJ 2VQGA 3TOAA 3WGGA 2CJJA 4JQFA 4MQVA 4AIDA 2HQRA 3FXOA 2XAJA 2WAQN 4AYBN 4ETSA 2HS5A 4DZJA 2DLLA 1DGRM 5D5XB 1QZEA 4H4KC 3OYIA 1SFXA 2DA2A 3LQQA 3F8NA 2FX0A 1VI0A 3F23A 2F4IA 4Y3OA 3CESA 1R4MB 5CJ9A 2CW0F 4HG2A 3LSPA 1CQTA 1S3JA 1MBFA 2EZKA 1S29A 2Y31A 3PM1A 3ROUA 2OCEA 2A6HF 5E8GA 1MBKA 1WZ2A 1UZCA 1W4MA 2K7LA 2NOGA 1ERDA 4AVZA 4XSXF 2JT1A 3HOWJ 1Z3YA 2JK3A 3CO6C 4J01A 2TCTA 2LG4A 3CF5F 1FNNA 3CUOA 1N25A 5B3SH 4HNVA 1ZG1A 1UELB 5LRSA 1WCMJ 4RB3C 5FLXZ 3JTGA 4PJLA 3DU6A 3T8TA 1BR4A 3ABLH 1B8IA 1Z05A 4X1EA 1ETQA 4E4HA 4N4NB 2VQHA 4A5NA 3DEEA 3OOUA 5H6QA 4BHBA 4CYCA 1MGTA 4AYBA 2WAQA 3CF2A 3J80K 1RUNA 1G3SA 3HOUJ 3PFYA 4L5IA 1XCBA 3LNQA 5HS9A 3OYCA 2BW3A 3HOZJ 2VBZA 1W7PA 2ZJPF 5KNLA 5CVRA 1JJ6C 4XLEA 2HTSA 2VBWA 2GA2A 3F72A 2RDPA 2KRFA 3TGNA 1U9OA 2M4KA 2NYXA 3V8LA 2A3SA 1EJ9A 3NARA 4F52A 3FHNA 2CUZA 1VQLI 4A3FJ 3IH4A 3F6VA 2LY2A 2MSYA 3ESWB 4XLFA 2NVYJ 5F1JA 3DTIA 4FCYA 3WTTC 2QGUA 2GIVA 3AG1H 1D1BA 1YX5A 4ZC3A 3M9AA 3C2BA 2HPIA 4HF1A 2FNAA 3BQZA 2VQCA 1D0ZA 4HLXA 1X2MA 1MBEA 2M0MA 1X58A 1X3ZB 2L2OA 4O6JA 1USTA 1PUFA 2CO5A 1WJCA 5KAIC 5BPDA 1H8AC 1HDDC 5LFAA 3H0GJ 3H3UA 9ANTA 2V1DA 1JHFA 1R6RA 3L09A 3L2CA 1K6YA 3ZCOA 4DW6A 3J81K 1HCRA 1KQ0A 3J7ZI 2X6XA 1BR2A 4I98B 2FE3A 3VODA 2JZYA 3K2AA 4XOTA 1YJ9I 1VQ5I 4M9ZA 2RREA 3JRGA 3QYEA 5EG0A 2EZHA 1W36D 4PGGA 2JN6A 1V5FA 1O3RA 5HDKA 2XC7A 3JRAA 3S3MA 5FO5A 4OIRF 2F4MB 3BG5A 1K78B 1Q1VA 3BT9A 1MH3A 4A3GJ 3C2HA 3PUFA 2WBMA 5DD8A 1VQ9I 3HHHA 1ENHA 4LIVA 2WADA 1R58A 2P5KA 2LTPA 4DQ2A 4P96A 1X1CA 2OQGA 3M1EA 3RIRA 4BHPA 1ZRDA 4L9TA 4KYWA 1B1BA 4RGRA 3ERED 4EJWA 5DYMA 2VONA 4LG0A 3HL2A 1TC3C 2VOPA 4UHTA 1U5TB 5CQEA 3HUGA 4NB5A 1IN4A 2R5YA 5HLHA 1V54H 2QKLB 2VODA 1WH7A 2AQEA 1KONA 2GXBA 3ZQQA 5J47A 2FD5A 4A3DJ 3W3CA 5IY5H 1W5SA 3H3ZA 5C4JJ 3GLXA 3TP3A 3WHCA 5LEKA 2CW7A 3MD2A 4A12A 3ZOBA 1K4SA 2DA6A 1YQAA 4A0ZA 2XPWA 3EUHA 2ELKA 3VYRB 3CCRI 1A36A 4WX9A 1SVOA 3RCOA 2GAUA 3D5LA 1V55H 1UHMA 2IEKA 3ZGKA 1XDSA 1H9TA 4PJ0C 3BOQA 1OKRA 1D0XA 2OTLI 2C6YA 3RQ4A 5C4XJ 1U2WA 2M30A 1BBYA 1P2FA 2KIFA 2E34A 3VOEA 4ZDOA 5GPCA 2EBIA 4RGSA 3QYFA 1XTAA 3TKYA 4IHWA 1WQ2A 2DMTA 4HQEA 4LLNA 1ZLJA 5J4VA 2JSCA 2WY8Q 4WXDA 5L3CA 2YR2A 2VIXA 2XASA 2K27A 3DWLE 1D3YA 2V9PA 4IHXA 1WJFA 3ECHA 3EUHC 2VBXA 3QWLA 4FT8A 5LD2C 2CFXA 1ZKGA 4XKBA 3CQZJ 1R23A 1Y0NA 1Z9CA 2EQRA 3COAC 4M74A 2L02A 4BJ5C 5L3BA 2O8XA 3CD6I 1FZPB 1YW8A 2R7WA 4YIIA 4NDLA 4KMUX 2MW8A 2XPVA 4IO9F 4JP0A 1YI2I 5EEAA 3ZQIA 3TEDA 2I10A 5LHGA 1W7PD 3AKZA 4A2UA 1MKMA 4C9YA 3F22A 2F2EA 2AQFA 4I2OA 2QBYB 1F4KA 4RGUA 3IC7A 5EZGA 3QU3A 3WU1B 1HKTA 5GADJ 2L0KA 5DD4A 3FK7A 2CQKA 3FXLA 2Y75A 3WE2A 3IV5A 1WVRA 1NG7A 4DNCA 1DU6A 3WTSC 5TRDA 1OYYA 1W1WE 2CV0A 1D5YA 2EH3A 4CCOA 5CVIA 2HGCA 3S3OA 3K4KA 1Z1DA 5HNFA 3C1DA 1GVJA 4M6YA 2YUSA 2R92J 3A01B 3HM5A 2MGQA 3OOPA 3OMYA 4S0HB 1RUOA 4D0PA 1YO5C 2Q8KA 2DCEA 2Z5UA 2VE9A 1ZLKA 5H2FC 3SDBA 4PJNA 1A6IA 4YRVA 2ZCWA 1JE8A 1ETOA 4QLCU 3FBIB 2NVQJ 2E1OA 2TDXA 4B4CA 3OR2C 1B6AA 3VFZA 3I4MJ 3WU0A 2XRLA 4DJAA 2EFOA 3OV8A 2EA2A 3IH3A 3IL2A 2H8RA 4E7JA 4OAYA 3KZIC 3AG2H 4KIFA 3RI4A 2H27A 4UUSB 3OSGA 1Z21A 4RM2A 1K78A 1QA6A 2ID3A 2RAEA 4XK4A 1SAXA 1JKQC 3K4CA 4PCQA 3LSGA 5KAFC 4IQ4A 1GXQA 1TWCJ 3V8JA 1TT0A 1QVUA 4D5CA 5K5QA 2KIUA 2DTZA 3PJRA 1ZGJA 3K0LA 2WY7Q 4FTHA 2ELJA 3M07A 1HF0A 1U5TA 2EFNA 1L3LA 2EZIA 2DQRA 2PMHA 3GTGJ 4J19A 4N0BA 3CC7I 1QZZA 5DS9A 2OV7A 3CP2A 3SZPA 3N4MA 4BKXA 5DM7F 1QPMA 4JBAA 4CGZA 2R7FA 4GCVA 3DLAA 2HTJA 3HOSA 4NQWB 5EF6A 4QIWN 2K02A 2LD5A 2CWEA 2P81A 3BPVA 1O3SA 2HPMA 4LGWA 1QRYA 4AUXA 4N4OB 1Y0UA 4KNYA 1K83J 3CCSI 2L4AA 4ENKA 3FBNB 2MD5A 3KFWX 2OJED 5CLSA 1ZRFA 3MAJA 1U5TC 3MZ8A 4BY7J 4B48A 1AHDP 4PFPA 2R7VA 3LSJA 5E1WA 3R60A 3CMYA 5IP9J 2LFBA 2V1XA 4HF0A 1STZA 4XLCA 2ISZA 1FTZA 4MHGA 2ME0A 3WU2C 4OWRB 4C30A 1WJDA 1LFBA 1JT6A 1X1DA 2LBFB 4QPOA 2XIGA 1G6NA 1JGGA 2DA1A 4LIUA 1OPCA 1TQMA 2VPRA 2QF7A 2BBYA 1N75A 2W25A 1VQ4I 2V4JC 2E71A 3WE3A 1R1UA 4EM0B 2D5VA 2F48A 5HODA 1YJNI 2LY9A 4KITB 2A07F 4G6TB 4C3HJ 5DM6F 4A3MJ 3FXQA 3BROA 3WG9A 3DFGA 1XPXA 3NRVA 1HA8A 3J7YJ 1XSXA 2Y9ZA 4C2TA 4Y15A 3MKYB 2QBYA 1ZTRA 3H0DA 4KMFA 2NOJB 1U0JA 4JYKA 3UNGC 1OCPA 1XGOA 1LEAA 3GW2A 4WWCA 3MEXA 5ILSA 2GLOA 1R7JA 3ZXSA 1ZHFA 3I4NJ 1WFXA 4EJUA 2G9WA 2W84A 3KX2A 4HYEA 1QZYA 5TJJA 5DDGA 2K9NA 5BQTA 2FMLA 3JRIA 3P5JA 3K1NA 3QOPA 1GDTA 2VN2A 2GOMA 3JW4A 3BC8A 1LFPA 1RESA 1OCRH 2CUFA 2COBA 3DTKA 1J0RA 1R36A 3SEQA 3A01A 1T2KA 1JI8A 2E1MB 5IOYA 4LJZF 5JFRA 1OQYA 3P9CA 5DCFA 5J6XA 3ASOH 1BI2A 3HXLA 2O03A 3LAPA 3S93A 2JVGA 4KT5C 4M9XA 3M7GA 4D7NA 5D4SA 4YEJA 3BR2A 3K4MA 2XAQA 1KU2A 4XONA 3IRQA 3TP0A 3H5AA 4UUSA 4NBQA 4ESJA 2R7TA 5CVUA 1QPIA 4XRMA 2Z99A 1SAUA 2KJBA 2P5VA 3AG4H 4HW0A 1BW6A 5FFZA 4ZYAA 1ETVA 2M87A 4YFXF 3DU5A 1NK3P 3GVAA 3RPQA 2QWWA 3WTXC 5IT3A 1YE9A 1ZARA 2H09A 3U1DA 1V4RA 2W85A 4WK8F 2K4JA 1OYWA 2A68F 4JOMA 2V6EA 4IEJA 4K2EA 1XX5A 4F55A 2QSGX 1GV2A 4XBFA 3LQRA 2VLAA 3HC7A 4BU2A 4Y4RA 4B1RA 4UUVA 4XLNF 3HRSA 1IRGA 3LL7A 2D1HA 3BTJA 3P9IA 4XRSG 5K7HA 3S2HJ 1R4NB 2EFPA 1YYVA 4DYQA 1T95A 2W24A 4II3A 4KN4X 3UR3C 3NQOA 4B44A 3X2QH 4LMYA 1XSVA 3JRDA 3E6CC 3CC4I 1S8NA 2O6GE 3JREA 3BJOA 5DUIA 1UB9A 4NQWA 2XSJC 1RI7A 2RKHA 4HDUA 3KZYA 1OCZH 2ZNZA 3BZKA 1T38A 3BTLA 4EVIA 4MIMA 2OA4A 2VPLA 4HBLA 3F8CA 5LBQA 2P4WA 1HKQA 4OINF 1KU3A 2KQRA 5IOZA 3ZMUA 3PO3J 4U87A 2PJRB 2PI0A 1ETYA 2UXNA 5L3EA 5FKNA 1I3AA 2VL8A 1D8KA 4YIRX 4IOAF 3R4KA 4G6QA 1ZK8A 3E5UA 2P0WA 1GXPA 2Y9YA 2STTA 1RR8C 2LBFA 3HTSB 1HW2A 4RAZA 1TQIA 2J5PA 2O7OA 4PGHA 1SFUA 1IXCA 1S7EA 3GTOJ 3K4NA 3ZQGA 1KYWA 1YIOA 5DUKA 2V79A 1OMIA 3R61A 3O8GA 1FOWA 4A5MA 1QNTA 2CH0A 4IX7A 2KJCA 1C0WA 2XF6A 4A3KJ 3Q3SA 4YFNF 1S5LC 2MYSA 1I6HJ 1NHAA 3AAFA 3ZMSA 1X2NA 4LLGF 2GQQA 3I64A 4BACA 2NNYA 1R5HA 2A5WA 2VKEA 3ML6A 3CJRB 1JT0A 1MH4A 1REPC 1D1CA 1RIOH 2VKHA 1HSJA 5E79C 4MGRA 2HOEA 2IA0A 3D5SC 5LEJA 3SEZA 1IRXA 4BQOA 1X19A 3G1MA 1TBXA 4U0WA 3S1RJ 5J1UA 3PNVA 1J9IA 1ZG5A 2OF7A 2H6CA 4M6XA 2E60A 2J5OA 1BJZA 1B59A 2X9DA 3MKZA 4A3JJ 2HFHA 1BI3A 3S3NA 4D1QA 4A6EA 3S17J 2H6BA 1WPKA 2YU3A 5BNGA 2ZBKA 5K5OA 2VXDA 2ME6A 4I09A 4UB6C 2K3PA 4Q47A 1IN8A 2ID6A 1LE8B 1YS6A 4YFKF 5HDNA 3IWZA 1T8IA 4Z2YA 4L0ZB 4CCNA 3RZOJ 3SZGA 2CUJA 3MMYB 3DKWA 3HKZN 4XRFA 3Q9SA 1MBHA 1BIAA 1RNLA 4EJVA 2MFZA 1XMAA 2YX4A 4XN0A 1HC8A 4PSWA 5LGNA 1PUEE 2X85A 4PZJA 3HZJA 2RNGA 1JKPC 2CGPA 1FYMA 2UXXA 3RKYA 2D45A 3GTQJ 4ENMA 3RPUA 1TWHJ 2E1MC 4XM3A 5JHUA 1LFUP 2FNPA 1FIPA 3IKVA 1R1TA 3L1PA 4L9JA 4RB1A 3ECOA 3DCFA 2DJNA 2JPCA 4RLQA 2EB7A 3ZN1A 4ESBA 2GWRA 4E6KG 3TDUC 2PJPA 3G6EI 1F1ZA 4G8XA 1E3HA 2IA1A 1LUJB 1ZN2A 2OQRA 3FWEA 5IPAA 4ENJA 4NC7A 4CCLA 2KISA 3H35A 2XVCA 2JVHA 2M2EA 2R3SA 3SFZA 4DOZA 1FY7A 2RQPA 4ABZA 5J3LA 3JSPA 4FETA 3G1OA 2X48A 3HKZA 4BQAA 1JKOC 4MLOA 1YFHA 3DV8A 3W2VA 2E2IJ 3HRUA 1BR1A 1KGSA 3O3KA 1S6LA 5IP7J 1T39A 2ZJRF 3CCMI 4FE7A 2QQBA 3CLQA 3HPGA 1NTCA 2WB1N 3KPHA 5HLIA 1DU0A 3SDGA 3GEZA 2WWYA 1Y56A 4U0YA 1LVAA 4FASD 3DXJF 1N78A 4WXCA 4Q4ZF 4LK0F 2RQQA 2WV0A 5FRMA 4BE2A 4U0VA 2DBBA 2GA1A 1V5GA 4IQJA 4RS8A 3ZQLA 2PJRA 4B43A 3S15J 3CCVI 2OU2A 4F7ZA 2PEXA 5AIPA 5ICGA 4LD5A 2CW8A 2DT5A 1JXSA 4R8HA 4OIPF 4PJJA 5EJCA 4M72A 1AU7A 1MD0A 1T33A 2HQ5A 1ZH5A 3CUQB 1TZLA 1WWXA 1XDUA 2G7UA 2ESHA 1QO0D 5F27A 1LKXA 2V26A 2ZKZA 3MZYA 1ON1A 4S04A 1FTTA 1IRZA 1MSEC 2ZMEB 1LEBA 2BZTA 3MWMA 1B9MA 1T6SA 4UVCA 1EH7A 1WHUA 2XAHA 5IT9K 4YG2F 3GLLA 2WB1A 2R7UA 3K4LA 1OYIA 5J8FA 3GMEA 3LOCA 1EKEA 5D8KB 4M9SA 5CYVA 4JX4A 1UMQA 3V8KA 3WTWC 3CCYA 2A61A 3SZTA 1FBUA 3I54A 4IJAA 4D9JA 5TISC 1Z6RA 4BYYA 1O4XA 5EDNA 4I01A 4MEXF 1X4OA 3FXJA 4XR6A 5IYCJ 2BXZA 5B1AH 4P1WA 2ZXJA 1O7LA 2K3FA 1AKHB 1PP8F 3VSKA 2E1NA 2HKXA 6PAXA 1MIJA 4IHSA 3RZDJ 2G0EA 3KP3A 4G7HF 3J7AO 4CDGA 3IUOA 1R22A 5B66C 3JAMK 3D1NI 1I3QJ 2IW5A 1FYKA 2P6TA 5K5RA 3FMSA 4RB2C 3HPHA 2W1OA 2M1BA 3U2RA 3ZQ7A 4HSRA 4GGGA 3I56I 2CRGA 1TWAJ 4XORA 3FISA 1I1SA 1MMNA 5BOXA 1MZBA 5E18F 2QSHX 3E6BA 4HQMA 3ZP5A 1LE8A 2EIKH 3J80Z 3F8FA 2EZLA 1W5CC 2BV6A 1ZGAA 3K1PA 4F92B 3O2PE 2DI3A 2M9HA 3K4BA 4ANJA 1BOAA 3I5UA 3WTUC 4O3MA 2KPMA 2HYJA 3ZRGA 2DK5A 4C3JJ 1K7AA 2EJRA 4CCJA 4KA4A 1UAAA 2IBDA 2BY3A 1FWZA 4ZDPA 3HGGA 1QGPA 5KK1A 4CYDA 4EGZA 2FBKA 4GFBA 4UB8C 3WGIA 3RQIA 2KL4A 1D0YA 2NS8A 3K69A 1ZGWA 4EGYA 3ABUA 2K9SA 3RPUD 2UV1A 2FMYA 2KFDA 2M7AA 5L3GA 4EJOA 1SMTA 1F43A 3QP5A 3QODA 3S8PA 2DK8A 3H5RA 3O6BB 3K4JA 3AL0B 3BG9A 5J1YA 1FLIA 3QPTA 3J7AY 3CDLA 2L7ZA 3IH2A 2YX7A 4IRIA 4HZFA 2EILH 5J40A 5HVQC 1USSA 3W6VA 3HOTA 1H0MA 1A6QA 3Q0WA 1OFCX 2DOAA 3VDXA 3BR1A 3D5RC 2IPQX 4UUTA 3ZMZA 4DYCA 1MJAA 2V9KA 2OCCH 1RKTA 5GPAA 3ZQCA 3M4OJ 2WC2A 2W57A 2KMUA 3FM3A 1SFKA 3E6MA 2AHQA 4FX4A 3BJAA 3WODF 4D7MA 3R6SA 3J81Z 3ZMTA 3C7JA 2OZUA 5LGTA 4YELA 3M3YJ 4NHJA 2XKOA 3VPRA 3BR3A 3PSFA 4LB6B 1FYLA 1Y1WJ 4IVNA 3BLYA 4P55A 4XMYA 4XNFA 4M6VA 2CQXA 4IHYA 1Q1HA 2ZXWH 2L7KA 2BVLA 2LY1A 1LB2A 5AIQA 2DT6A 3K2ZA 1I50J 2KIQA 2KDOA 3A0BC 3OIPA 4EM1A 1VFCA 3CUQA 1MNMC 2E5ZA 1ON2A 4FX0A 2VI6A 2B9SA 1JHHA 1GVDA 1FSEA 4YIFA 2Y0SN 5GAEJ 1X1BA 2PX9A 4BNCA 4BQQA 4HEA2 3CJTB 3NEUA 1W0TA 2ZMEA 3L2WA 2M8EA 2KLOA 3KP6A 1LNWA 4PK4A 4G9YA 2B63J 1UG0A 3I4PA 5F0CA 3CMMA 2NNNA 2Y30A 3BTCA 2QQ8A 2VASA 4EATA 5JHFA 1SEUA 1KU7A 5D6EA 1IDZA 2D2WA 2IGNA 4HAMA 4IZZA 3PO2J 2PMZN 3OIQA 2IGOA 3GZNB 4A3EJ 4L9NA 3O8HA 4HOBA 3L00A 4MTEA 5B5EC 3CUQC 2R7DA 3EETA 3F21A 2E2JJ 2HU9A 3CP8A 3IRRA 4HRIA 1ZG3A 3TL4X 1M1EB 2FQ4A 3T0YA 5FLMJ 3LSHA 3RKXA 4M3DA 4E7SA 1AKHA 1YRNB 3LMMA 3H1CA 3TDZC 3LSTA 2E7WA 4KN7X 5D6FA 4BL0B 5F0HA 1ITYA 2ZMEC 2QQ9A 3H36A 5K1YA 2JJ7A 2IAIA 2ADUA 2ZJ2A 1HQCA 2W48A 4BDZA 5M3FJ 2X6YA 3DKXA 1H88C 2HYFA 3KEYA 4OOIA 2LC2A 1WI9A 1R49A 1X1PA 4I7HA 3G2BA 5E3MA 4RBOA 2DMNA 1R5GA 4PFOA 4V19K 2M5WA 3ERMA 3Q9VA 2K4BA 2CQNA 2PFBA 2LH9A 2XF7A 3P9KA 2Q0OA 4L5EA 3FXRA 5FD5A 1PP7U 4LITA 1IV8A 1U78A 2WTEA 2OPTA 1WJBA 1XD7A 2PMZA 3TO7A 4HF2A 4BBSJ 5D5WB 5D4RA 2R7OA 1RETA 2JWTA 2B7EA 3REOA 2O9LA 2DJIA 3RKWA 1LJ9A 2JUCA 2ZFWA 4KT6A 3HSFA 3GCMA 3HHGA 1XGNA 2EIJH 4BH9A 5C44J 3OYLA 2L01A 1R1VA 1QBJA 4E7IA 4MNUA 2XPUA 4Y7NJ 2FOWA 4B09A 1G3WA 1UHSA 2FSWA 4E7ZA 4I0BA 1Y39A 1NK2P 5C3EJ 4BAYA 2QLZA 3M8JA 3K7AJ 1IDYA 2XV4S 2VQLA 4A3CJ 2EWNA 2M45A 3BPXA 1BA5A 4CCMA 3BQYA 5LHHA 1VQOI 2L5QA 3CMEI 1LPQA 3QOEA 4R1HA 2KKOA 4N9HA 4UNOA 4Y33A 2OAZA 1T0FA 4C3IJ 2ISYA 3I71A 3MCZA 4UV8A 5IYDJ 1FMVA 2OBPA 2AO9A 2VXZA 2BYVE 3EYIA 1GHCA 3H92A 4IOCF 5F0FA 3GFIA 1WH5A 2NS7A 1R9TJ 3SXYA 3S14J 3MN2A 3I55I 1HKSA 2F5CA 2GM4A 2QCOA 4CICA 2MC4A 3C2GA 3LSKA 5E17F 2OD5A 1H89C 3GX4X 2CS3A 1LDKB 3NWTA 2CG4A 3AL0C 1PDNC 1RKWA 1WJAA 1E17A 4BEHB 3FDYA 2KIMA 2PBIA 4MQ9F 2JA2A 2F5DA 5BS6A 4M3FA 3JRHA 2Y2ZA 2H8WA 1J2XA 1YITI 1T0FC 1JJ8C 4NNJA 1IW7F 1BJAA 1GV5A 4KJZA 5FKLA 4EV0A 3G71I 1A5JA 2HZDA 3KYDB 2K9QA 4BJ6C 3FK6A 3KP7A 4O5VA 4MO7A 2LMDA 3CMAI 1ZRCA 2ZB9A 3F8BA 3QPLA 2FF4A 2UUZA 3CCEI 3DQVC 1BI0A 4ZDLA 4CZCA 2VOOA 1JTYA 2LRDA 1FPQA 3B6CA 5CVVA 2R7ZJ 3FXUA 3ZMVA 2X0LA 2MD0A 3GZ6A 1Y1VJ 1MJBA 1MBGA 4EM2A 4V2GA 2O0YA 2Y48A 2L9RA 3MVPA 3LSRA 3ABMH 2IS6A 1IV6A 3H9JA 3I59B 5AONA 5HLGA 3JTHA 1K79A 3WHBA 3GUDA 2QZ8A 4XRSA 1MMGA 1YW9A 3HSRA 2VJIA 3NAUA 5K7FA 1ETWA 5KVRA 2HVRA 4AIKA 2NVTJ 4HNTA 4W1UA 1UJ8A 1XC5A 3PNYA 3SJMA 3SHFA 2CV2A 1VQKI 1R00A 5HLTA 3CCJI 4I76A 2KZGA 3BY6A 2FOKA 3KCCA 4AD9A 5A2QK 2BE5F 2ZNYA 1P6RA 2YU9J 3GTJJ 4HLYA 3ZR8X 2ZJQF 3ISPA 3KYCB 1GUUA 1XG1A 3TO6A 1YRNA 3CDIA 3DF8A 2HWVA 5F08A 1FEXA 3K70C 2NS0A 3OYAA 2QVOA 3QPSA 1YHQI 3U21A 4C2MJ 3MZHA 2E19A 3VSLA 1ETXA 1E0EA 1DQUA 2W82A 2H94A 3I9V2 4KFCA 2DA5A 1X3UA 1ZREA 4KUMA 2P8TA 5M3MJ 4HPQA 3TOBA 3OIOA 4WF2A 2Z33A 3HBLA 5E3LA 1FC3A 4FISA 3E5XA 1MJ9A 4FQGA 1XSDA 2B0LA 2UWMA 1D8JA 3ZN0A 2HOTA 1ZAOA 2E5NA 3BG7A 1KA8A 1LDJA 2LKPA 2DPUA 3JRCA 4P9UA 2DTRA 2LREA 3IAS2 1W5TA 1BC8C 1J7KA 1H9GA 4XKVA 3OYDA 2DDAA 1HDPA 2LR8A 5M5YJ 3CC2I 1OISA 1FT9A 1P92A 5KCMA 4UV9A 4HX7A 1XGMA 3FIWA 4PJMA 2K85A 4GO1A 3DEWA 2RVCA 2QA4I 2PQ8A 2Z2SB 2HQAA 3CZ6A 4UVBA 5EGOB 1VQ7I 2KP6A 3FXKA 1G4DA 4NC8A 1MW7A 2PN6A 2IS2A 2VJ5A 2LF8A 2HVSA 3E0JB 4WXHA 3RTRA 3GO5A 5CVJA 1TWGJ 5FLXK 1XGSA 3OL4A 2GBYA 3I0TA 4HV6A 2ZO4A 2L9VA 1BC7C 1J09A 3EUKL 3H9QA 1MMAA 5D8LB 3ABTA 2MH2A 4IRHA 3Q0UA 3RYRA 4CXFA 4FHTA 5GTIC 4BJTA 5J8CA 1Z3XA 4RAFA 4E7KA 1LVKA 2AS5F 2W4SA 3GZ5A 1EV7A 3BJ6A 1T56A 1UCRA 3F8MA 2XAGA 3K1MA 1IC8A 3GWZA 3A02A 2JA8J 4A0YA 2L9NA 3TBIA 4BEHA 4ZZDA 1OLTA 1U8RA 1B4AA 3CTAA 5F64A 4GYIA 1S7OA 2UZKA 3MFKA 1VQ8I 4X6AJ 3I53A 4UY8I 1OCOH 3KLOA 5ICFA 2BY0A 2XF5A 3DPTA 3BCBA 1IJWC 4GDFA 1IN7A 5JI6A 3G73A 1IRFA 3ZQFA 2CMPA 2DFFA 4RA2A 4RB0A 3M8EA 4B47A 1ZELA 2R0QC 3IWFA 2DMPA 5FFXA 4AM3A 1MNDA 1J59A 2L7MP 3E6DA 2ZSHB 4AWXB 2JPBA 5E20A 3HG9A 2Z16A 1TW3A 5JLWA 3I59A 2CFOA 2F5EA 2BEOA 4M3BA 3FHZA 1OCTC 3GTLJ 4OIOF 2OC6A 2MH9A 4Z6YA 2RV8A 1Y8RB 3B02A 3K70D 5H20A 1W36C 3A03A 1U9NA 5LHIA 1VQNI 3LA7A 4XL9A 2CQ7A 2HDWA 2EPFA 3QQAA 1E3PA 3DKYA 1Z6TA 1JUPA 2E35A 2N8GA 4L9VA 3OYHA 3FMQA 3OYBA 2M8GX 4XLPF 4GYGA 4IF4A 3BWGA 4DYRA 3QRFF 2EV5A 1DPUA 3OYMA 4BS9A 2PMUA 3ZPLA 2L9SA 3TW7A 1DUXC 4ZYEA 1QQIA 2JA6J 3DPUA 4ZTFA 2LF7A 5K7ZA 2LLKA 1FP2A 5ICCA 4L18B 2DODA 3HDDA 1P7JA 5FKKA 2DW4A 3B73A 2GZWA 1KQ8A 4CUGA 3GTKJ 1I6XA 2KRCA 2LP0A 3E5QA 3VYUB 5M5XJ 3V7CA 3JSOA 4ENNA 1TTYA 2ZXHA 1ACIA 4F93B 2R7RA 1RR7A 3SFIA 1F36A 3G4SI 4JX6A 3VYSB 4X0GA 2V6CA 3IHUA 4QWQA 3DBHB 3IP4B 4IL6C 5EZHA 4JX5A 2GXGA 3EPZA 1R5ID 1VNDA 1IUYA 4ZZLA 2O3FA 2IT0A 2VC1A 2MBFA 4BDYA 1BN5A 2ICWG 1TWFJ 4PDKA 2F4OB 3ELKA 5FGMA 3HSEA 1JUSA 3CCLI 5M5WJ 1CGPA 1R71A 2GOXB 3EQLF 3V7SA 2LSOA 2DYSH 1P9QC 5EGOA 4I6ZA 1BOBA 2XUBA 3LFUA 4U88A 4AC0A 2IVMA 2VKVA 5E8IA 2Z9OA 1CF7B 1TP4A 3W6KB 1YJWI 1F9NA 3KEOA 5D5UB 2QQAA 1P4WA 1HXDA 1ULYA 1Z77A 5GTHC 3K10A 2VT3A 1VTNC 2HZTA 5BPIA 1IG7A 2KRHA 5L3FA 3PQJA 4M3GA 1VZ0A 1AWCA 3BR6A 2DT7B 1MDMB 1IAWA 2FUG2 1XMKA 2DMUA 2BY2A 1T08B 2HYGD 2Q1ZB 2H1KA 3F0CA 4R79A 2EV6A 1EF4A 4JK1X 3S2WA 3RSNA 2Q2EB 1LDDA 2DQLA 2LK2A 3KIOA 4RLFA 2O8KA 2BOLA 1SD6A 2K9MA 3OWTA 4DBRA 5GAGJ 2JA5J 5D5VB 1LQ1A 2K40A 3JCUC 3ZQHA 3KYLA 4BUPA 3FZVA 4AIHA 3BDDA 2ZSIB 2YS9A 4S05A 4ITVA 4DBQA 3L2RA 2XGCA 4ESFA 3DBLB 4KIBA 4LG3A 3MKLA 3KZZA 2HDCA 2MABA 1ODDA 2V7FA 3A4CA 3OYEA 1RC9A 4EMSA 1U8BA 1FIAA 2NRAC 1IN6A 3BTIA 3L2UA 4J00A 1WI3A 1UHWA 2JSPA 1QVTA 4XIDA 2JQ7A 2XRNA 2DOEA 2LNBA 2QKMB 2XB0X 2MLKA 2DAOA 2RN7A 3QP6A 3FXMA 3Q5FA 1O7FA 2AXTC 2NAZA 1D5VA 1NG6A 1WKMA 5F04A 2R7QA 2V9VA 2X1EA 2LKXA 3A0HC 3KEQA 1BL0A 3S2DJ 5E3OA 1JGSA 1FOYA 3TO9A 2XSDC 2XHKA 1FX7A 5FD6A 5ED4A 4A3IJ 3GBGA 1S72I 5ICEA 5FB2A 2R93J 1XN7A 1FOKA 5FLVA 5E1XA 4H0EA 2RC4A 2ESNA 4G94A 1SMYF 2A6EF 2P6SA 2CYYA 4QPQA 1S7AA 2Z1DA 2WA0A 4LLLA 1PVEA 1POGA 2FBIA 2JRTA 2VC0A 1P7IA 1QHGA 4A3LJ 1G3TA 2STWA 1Y8QB 5EEHA 1OJLA 2R7XA 3PQKA 3DP7A 1YX3A 2LDUA 1YS7A 3LA3A 4XLHA 5FKOA 2M4GA 4G6DA 5DEQA 1AOYA 3A1YA 1HW5A 2RNJA 4NC6A 1DP3A 1SC7A 2QENA 1RZ4A 3L2VA 4BE1A 2HVQA 4RDUA 2QYOA 2WAFA 2A5YB 3L7WA 4UXNA 3OS1A 4N9IA 1SVMA 4XICA 1O3QA 3OS0A 4Q48A 1IGNA 4KIGA 1EA3A 4ZJZA 3GFMA 4HDVA 1PYVA 2EINH 1UFMA 3QAHA 4F3QA 4RAYA 1MMDA 2XB5A 1TNSA 3PUBA 4WCGA 5IT9Z 1X3WB 3VEPA 4M73A 1BM9A 3FM5A 3K6GA 5TGTA 1J75A 4V2FA 2HR3A 3WG7H 3V42A 1DP7P 4CZZA 5E1ZB 3MQ0A 2IGKA 2QM3A 1BW5A 2ETHA 2E36A 2DN0A 3C3WA 3HTUA 4P9FA 5FRNA 2R4GA 4BHCA 3ABKH 3KLNA 1SANA 3DBRB 1EH8A 3HGYA 4D5FA 1KYZA 5CPRB 5IP6A 1I27A 1VF9A 3DEUA 3E1SA 2DXIA 3OL3A 3K9TA 2ECBA 4LOCA 1XS9A 3KP4A 4E7LA 4A69C 2O5RA 1YIJI 3CDHA 3S32A 1CF7A 3VYTB 2DO7A 3BP8A 3WTZA 4CH7A 3JAMZ 4DIQA 4IKFA 3H9GA 4HX8A 1FP1D 1I39A 4B8XA 3ASNH 4M71A 4IHTA 3GFLA 2OTJI 3QU6A 4EJTA 2FA5A 3BR0A 2KDZA 4A0XA 4M3EA 1MDMA 1P4XA 2A6TA 2A05A 3BR5A 1ORKA 2BGCA 5CQGA 4BGDA 4LB5A 2DFEA 1IF1A 2VBYA 3PIOF 3LAJA 1I1GA 4XKCA 2VKDA 2Q2EA 5ILUA 1U3EM 1V3FA 3FF5A 3CLOA 2VJJA 5L3DA 5GP9A 2M7BA 5F6FA 3CCUI 2KZVA 1E3OC 1IUFA 2HQNA 4OMZA 2DA3A 1SVLA 4AIJA 1G3YA 1ONVA 2BXYA 1RRJA 1YW7A 1UG2A 4RGXA 3V7RA 2NVXJ 1MMSA 2X51A 2L3DA 2IXSA 4IRGA 2DYRH 2QUFA 2QEXI 3EYYA 2L7FP 1E2XA 2IS1A 4XQFA 3IKTA 3LSIA 5JVTA 3BZCA 2Y0SA 3OSFA 3N97A 2DPDA 3OYGA 5LLQA 3MKWB 4OAZA 2YSRA 2HKOA 4CO8A 3JR9A 3GFJA 3ONQA 3QYBA 2GXAA 3KETA 1B72B 5FROA 2XGXA 1SD7A 1KQ9A 3R0JA 4I02A 3JRBA 4C2UA 4LFUA 2MA3A 4DGWB 3R0AA 3HYIA 2K9LA 1FBQA 2I5UA 5DCMB 3W2WA 1APLC 3GTPJ 3S1NJ 5EYRA 2KT0A 3EDPA 1J5YA 1SD4A 3G1LA 5FKMA 2DOFA 1A31A 3C18A 3GYHX 2R5ZB 2ECCA 2R7SA 1Z67A 1IZ1A
chains in the Genus database with same CATH topology
3D5LA 3ZGKA 4XLAA 4XOPA 2OUMA 4HPQA 1D0XA 4RLQA 3RQ4A 3CJQB 4E6KG 4ZDOA 4B3XA 3QYFA 1MNEA 3BG6A 2UWMA 2LYCA 4NC7A 4CCLA 2E5NA 3BG7A 3H35A 3OS2A 2WY8Q 2JVHA 2KHMA 2VB6A 4DOZA 1AA7A 2VIXA 3AFHA 2LREA 3DWLE 3IAS2 4FETA 4RM3A 4XKVA 4CA0A 3HKZA 3OYDA 1WJFA 1G8XA 3EUHC 4MLOA 5LD2C 3W2VA 4XKBA 1BR1A 5KCMA 1X4PA 2M3AA 2ZXIA 3OYJA 4II2A 4BJ5C 4PJMA 3HPGA 4CCKA 2BVMA 2R7WA 1Y56A 2HQAA 2Z2SB 3CZ6A 4FASD 2KP6A 3A2KA 1N78A 4NC8A 1MW7A 2RQQA 2IS2A 2VJ5A 1S9HA 3FKJA 4BE2A 2HVSA 5FRMA 3E0JB 3RTRA 1V5GA 3BCAA 3AKZA 4IQJA 4BXFA 2PJRA 4B43A 3OL4A 4C9YA 1GLNA 2AQFA 2XDVA 2CW8A 1J09A 1WJEA 3EUKL 2X1DA 4PJJA 3H9QA 1MMAA 1TZLA 4BJTA 1Z3XA 1LKXA 1LVKA 2V26A 2W4SA 4E7KA 1DGWY 1NG7A 3F9KA 3TMOA 3OY9A 2CV0A 3DPLC 4CCOA 1G59A 3S3OA 2L9NA 3TBIA 4BEHA 1OLTA 3H5NA 3K4KA 5HNFA 4NUBA 2WB1A 2R7UA 3K4LA 1OR7C 2XAUA 3OMYA 3IAM2 2WAEA 2XF5A 3DPTA 3BCBA 2W7NA 2F6CA 2DCEA 3SDBA 4PJNA 3PL8A 4YRVA 2CMPA 4D9JA 3FBIB 4B47A 1ZELA 3OR2C 1X4OA 4XR6A 4DJAA 5HNHA 1MNDA 4P1WA 4XKWA 4F91B 3OYNA 2ZSHB 4OAYA 4E7JA 3VSKA 4HNUA 2X6WA 3HG9A 2Z16A 3OYFA 2CFOA 3IUOA 1Z21A 4RM2A 2OC6A 3K4CA 3HPHA 3K70D 3LSGA 2W1OA 1W36C 4PSXA 4HSRA 2X1CA 4IQ4A 4XORA 3PNTA 1TT0A 1QU3A 3EUAA 4XL9A 1MMNA 1PJRA 2HDWA 3PJRA 4XM3A 3DKYA 2WY7Q 1Y6IA 3OYHA 3SYTA 4U7BA 3OYBA 2ELJA 3PSIA 4F92B 3K4BA 3LSMA 4RMNA 4ANJA 4BS9A 3OYMA 2L9SA 3DPUA 4ZTFA 2KPMA 2OV7A 3ZRGA 3OR1C 3CP2A 4CCJA 1UAAA 4ZDPA 3DLAA 3HOSA 2KL4A 4NQWB 1D0YA 4CUGA 2KRCA 3VYUB 1QHHD 3RPUD 2UV1A 2M7AA 3I3LA 2HPMA 2K5CA 2BW3B 2ZXHA 5HOOA 4N4OB 4F93B 3QODA 3S8PA 2R7RA 3H5RA 2VJ4A 3K4JA 3AL0B 3FBNB 2V1NA 4CSWA 4B48A 3VYSB 4X0GA 4PFPA 3J7AY 2R7VA 3IP4B 3EPZA 5HVQC 4P5OA 3HOTA 4XLCA 3N05A 2DOAA 4ZTJA 3OYKA 3VDXA 1D1AA 3D5RC 4BDYA 5CKTA 2F5VA 2W00A 4OWRB 1WJDA 4C30A 1X1DA 2V9KA 2LBFB 4QPOA 2KMUA 1SFKA 4LIUA 2GOXB 1N75A 4YELA 2JUGA 2V4JC 1P9QC 4GRIA 1BOBA 3PSFA 3LFUA 4KITB 4G6TB 3BLYA 4XMYA 4XNFA 2IS4A 2L7KA 4KISA 1HA8A 3NWSA 2BVLA 1N77A 2LY1A 4C2TA 3MKYB 2DT6A 3K10A 3H0DA 2NOJB 2KDOA 1U0JA 2KRHA 3OIPA 4AU7A 3UNGC 1VZ0A 4BE0A 2DT7B 2E5ZA 2FUG2 2LOOA 3ZXSA 2IGMA 4BQNA 3L2QA 2Q1ZB 1WFXA 4R79A 1X1BA 3M1CA 3KX2A 4E7HA 4BQQA 4HEA2 3RSNA 1V5EA 2Q2EB 3L2WA 4RLFA 4XN3A 2KLOA 2BOLA 2GOMA 4PK4A 2K9MA 1LFPA 1WJ5A 1UG0A 3BC8A 3OWTA 4PUSA 1Z7LA 3CMMA 3W2AA 4DBRA 4HSTA 2CV1A 3DTKA 1JI8A 2VASA 3SEQA 4EATA 5JHFA 2E1MB 3KYLA 4BUPA 2I8DA 2IGNA 2ZSIB 3VWBA 4IZZA 3OIQA 4ITVA 4DBQA 3L2RA 2IGOA 3HXLA 1FMWA 3S93A 1X1AA 2ZFUA 2JVGA 2HNHA 4LG3A 2MABA 2V7FA 2HU9A 3A4CA 3CP8A 4YEJA 3HUGB 3OYEA 4HRIA 3TL4X 5KHDA 3L2UA 3LSHA 4J00A 3K4MA 2JSPA 3DTEA 4E7SA 4XONA 3LMMA 2QKMB 2VQGA 4BL0B 4JQFA 3H5AA 1DGRM 2R7TA 4H4KC 4BDZA 1NG6A 3OYIA 2R7QA 2X6YA 2X1EA 3DKXA 1SAUA 3KEYA 2LC2A 4ZYAA 2F4IA 4Y3OA 3CESA 3RCOA 3DU5A 4HG2A 3G2BA 3GBGA 1YE9A 4PFOA 4JOMA 2V6EA 4F55A 2LH9A 2XF7A 4LITA 2VLAA 4QPQA 3HC7A 1ERDA 2PMZA 1WJBA 2WA0A 2Z1DA 4AVZA 1Z3YA 4BU2A 2R7OA 4Y4RA 4J01A 3LL7A 2LG4A 2DJIA 1QHGA 1T95A 1UELB 4II3A 3UR3C 4KT6A 4B44A 4PJLA 3DU6A 2R7XA 1BR4A 3OYLA 4E4HA 2XSJC 4N4NB 4E7IA 1YX3A 2VQHA 4XLHA 3DEEA 3OOUA 4AYBA 2WAQA 3CF2A 2M4GA 4E7ZA 3PFYA 3A1YA 3OYCA 3M8JA 2BW3A 1DP3A 2VPLA 2VQLA 3L2VA 4BE1A 2HVQA 5KNLA 4CCMA 2WAFA 2L5QA 3OS1A 4XLEA 3QOEA 2KQRA 4Y33A 3OS0A 4U87A 2PJRB 4ZJZA 1EA3A 1PYVA 4F3QA 2M4KA 1MMDA 3PUBA 1FMVA 3FHNA 2CUZA 2VXZA 4F52A 2VL8A 2LY2A 3K6GA 4XLFA 2P0WA 5TGTA 3V42A 3DTIA 2LBFA 2IGKA 1D1BA 1YX5A 4ZC3A 2MC4A 3K4NA 5FRNA 2R4GA 3C2GA 3LSKA 2HPIA 2CS3A 5CPRB 2VQCA 3E1SA 1D0ZA 1LDKB 2DXIA 3NWTA 3OL3A 3AL0C 1WJAA 4BEHB 2M0MA 3FDYA 2CH0A 4IX7A 4E7LA 2L2OA 2O5RA 2XF6A 2JA2A 3S32A 3VYTB 1WJCA 2MYSA 1T0FC 4NNJA 5LFAA 4KJZA 4BACA 4CH7A 2HZDA 4DIQA 2A5WA 4BJ6C 4IKFA 3H9GA 1R6RA 1K6YA 3CJRB 3ZCOA 2UUZA 1D1CA 2X6XA 3DQVC 4ZDLA 4CZCA 1BR2A 2LRDA 2VKHA 2A6TA 4XOTA 3D5SC 5CQGA 3SEZA 2MD0A 1IRXA 4BQOA 4BGDA 1X19A 2RREA 3QYEA 4XKCA 2VKDA 1W36D 2IS6A 3PNVA 1V5FA 3H9JA 2XC7A 3S3MA 2VJJA 2E60A 2M7BA 2KZVA 3MKZA 1MMGA 3C2HA 3S3NA 2WBMA 4D1QA 2VJIA 4LIVA 2HVRA 2WADA 2X51A 2VXDA 4HNTA 2IXSA 2K3PA 3PNYA 1X1CA 2CV2A 5HLTA 2IS1A 4XQFA 3LSIA 2Y0SA 4CCNA 3OYGA 3HL2A 3SZGA 3MKWB 2CUJA 4OAZA 3MMYB 5CQEA 3ONQA 3QYBA 2QKLB 2AQEA 1KONA 3ZR8X 5FROA 3ZQQA 2MFZA 4XN0A 4C2UA 3W3CA 4PSWA 4DGWB 2K9LA 2X85A 3W2WA 2RNGA 2CW7A 3MD2A 3K70C 3OYAA 3U21A 3VYRB 3VSLA 2R7SA 1E0EA 1DQUA 2E1MC 2W82A 3I9V2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQH A;  2VQG A;  2VQL A; 
#chains in the Genus database with same CATH topology
 2Z3Y A;  3HEF A;  1A35 A;  1JTX A;  4XLA A;  2NXN B;  4XOP A;  2LVS A;  2OUM A;  3BZ6 A;  4OU0 A;  2DA7 A;  4BY1 J;  4FE4 A;  4XSZ F;  2CUE A;  3CJQ B;  1HBX G;  1Z91 A;  3LWF A;  4B3X A;  2FEZ A;  1MNE A;  1DPR A;  3BG6 A;  2LYC A;  4ZYH A;  3L9F A;  3OS2 A;  4MFD A;  2KHM A;  2VB6 A;  4U7D A;  1AA7 A;  2PG4 A;  3AFH A;  4QTR A;  4RM3 A;  4CA0 A;  5J4Y A;  1G8X A;  2HXO A;  4EQQ A;  2XRO A;  1HST A;  2A69 F;  1X4P A;  2M3A A;  2ZXI A;  3OYJ A;  4II2 A;  5JLX A;  1ZR2 A;  1U6G A;  2OZ6 A;  4CCK A;  2BVM A;  3LA2 A;  3HRM A;  3H3V K;  5GAH J;  4KDP A;  3A2K A;  1TLH B;  5E3N A;  2DMQ A;  1Z0X A;  3WTY C;  1K4T A;  4G12 A;  1S9H A;  3FKJ A;  4ON0 A;  3TQN A;  3CJN A;  4QSH A;  3F3X A;  3BCA A;  2NVU B;  2FJ1 A;  4DZP A;  4BXF A;  1WGX A;  3S1Q J;  1OR7 A;  3CCQ I;  2ZC2 A;  3ZMD A;  5HS8 A;  1NH3 A;  1GLN A;  3G3Z A;  2XDV A;  3B6A A;  3D0S A;  1K6O A;  1WJE A;  2YPR A;  2X1D A;  4I99 C;  2DU9 A;  1YOV B;  3PIP F;  2QSF X;  1DGW Y;  3F9K A;  2JMW A;  2F5F A;  1SFE A;  3TMO A;  3DLL F;  3OY9 A;  3DPL C;  1IN5 A;  1JKR C;  2MG4 A;  2EV0 A;  3KP5 A;  1MSF C;  2VUM J;  2FBH A;  2EFQ A;  1A04 A;  5DV5 A;  1SFO J;  1G59 A;  2TRT A;  3H5N A;  3QPH A;  4NUB A;  1MBJ A;  1BI1 A;  4IHV A;  4HV5 A;  2M34 A;  1GT0 C;  1ZQ3 P;  1OR7 C;  2XAU A;  3E97 A;  3TW6 A;  3IAM 2;  2WAE A;  1F5T A;  2E2H J;  5H6R A;  1I5Z A;  2W7N A;  4A3B J;  1O3T A;  2F6C A;  4A93 J;  1YTY A;  3PL8 A;  1WRJ A;  3FX3 A;  3RYP A;  4Y17 A;  5HNH A;  1EH6 A;  4XKW A;  4F91 B;  3WGH A;  3OYN A;  3HOY J;  3LFK A;  4RAG A;  4TV7 A;  1B9N A;  2X6W A;  1SD5 A;  1Z7U A;  4HNU A;  3FKI J;  3OYF A;  2L4M A;  3W6J B;  4MEY F;  3UKG A;  2GIZ A;  1P4A A;  5FJ8 J;  2VE8 A;  2IRF G;  3VB2 A;  4OIQ F;  3HIF A;  3GXO A;  3HJE A;  3S1M J;  4PSX A;  2X1C A;  2XAF A;  4L5J A;  1XB4 A;  3Q0V A;  2WV1 A;  3PFI A;  2CU7 A;  3PNT A;  3EUA A;  2O61 A;  1QU3 A;  1PJR A;  2MLG A;  2HXI A;  2IP2 A;  1IXR C;  2COM A;  4L0Y B;  3T1B A;  1Y6I A;  2H1L A;  3SYT A;  4U7B A;  3HRT A;  1RPW A;  4Y13 A;  3PSI A;  3F6O A;  3LSM A;  4RMN A;  3U9G A;  1VQ6 I;  3U1K A;  1HW1 A;  1B72 A;  2M0C A;  2DDB A;  2DA4 A;  1HLV A;  3OR1 C;  1TT5 B;  2X4H A;  5DCM A;  4Y52 J;  4A6D A;  5JR3 A;  3KE2 A;  1L0O C;  1YLF A;  2HI3 A;  1B8I B;  2R5Z A;  1T98 A;  4GXO A;  5F1R A;  1QHH D;  4CYC B;  2HDD A;  3HB9 A;  5LRR A;  3KP2 A;  1DDN A;  3I3L A;  1IXS B;  2E7X A;  2BW3 B;  2K5C A;  5HOO A;  1K61 A;  1FSH A;  2P5L C;  3T5X A;  1W7P B;  1FOX A;  2VJ4 A;  3P7N A;  3GF2 A;  5ILV A;  1VQP I;  3SQN A;  2V1N A;  3E3V A;  2L54 A;  4HA8 A;  4CSW A;  4E70 A;  1YG2 A;  2BY1 A;  2HOA A;  5IYB J;  1ZR4 A;  3RJP A;  3HOV J;  4IPA A;  2PLY A;  2XGE A;  2DFH A;  5JVG F;  4P5O A;  2FQ3 A;  2BHY A;  1XMX A;  3WTV C;  3N05 A;  3CO7 C;  4ZTJ A;  1TL8 A;  3JRF A;  3OYK A;  1WSU A;  1D1A A;  2LKS A;  4EEF G;  4W97 A;  5CKT A;  2F5V A;  2CQQ A;  2W00 A;  2HEO A;  1TQP A;  2FXA A;  1TW2 A;  5ERI A;  2FU4 A;  3BG3 A;  5B1B H;  2IJL A;  1KZH A;  4ASN A;  4G7Z F;  2E1C A;  5HDG A;  1XCV A;  2XKP A;  1TNT A;  2JUG A;  4GRI A;  2Y69 H;  4HX4 A;  1IO2 A;  4ZYD A;  4BXU A;  3T8R A;  1PUF B;  5HS7 A;  5LGU A;  3GTM J;  1ZYR F;  4ZH4 F;  2IS4 A;  4KIS A;  2JA7 J;  3NWS A;  1N77 A;  2K86 A;  2RGV A;  1FJL A;  4OMY A;  1FBS A;  2HOS A;  4AU7 A;  3M8F A;  3HOX J;  1HOM A;  2EIM H;  4BE0 A;  4UVA A;  2X6O A;  3ULQ B;  2EA4 A;  2EFW A;  2LOO A;  3S16 J;  2P7V B;  2D1V A;  2JRM A;  2IGM A;  4BQN A;  2VT2 A;  3L2Q A;  4ZYG A;  3M1C A;  4E7H A;  3E7L A;  5EG0 B;  4B3A A;  4G7O F;  1V5E A;  5J1R A;  3RDI A;  4AVP A;  5A2Q Z;  1G2H A;  2AXL A;  1ETK A;  4Q5S F;  2V1U A;  5BMZ A;  4XN3 A;  2BHZ A;  4LK1 F;  3FMR A;  1WJ5 A;  4PUS A;  5DTD A;  1Z7L A;  1W0U A;  3W2A A;  4HST A;  2XGD A;  2CV1 A;  4CHU A;  2FRH A;  2MC3 A;  2I8D A;  3VWB A;  2JTV A;  3AG3 H;  2P7C B;  2Y0M A;  1FMW A;  2CSO A;  4I0A A;  1X1A A;  4BXX J;  1KU9 A;  2ZFU A;  2DFI A;  2HNH A;  3RKQ A;  4LG0 B;  4MTD A;  4IXA A;  1BIB A;  4MFE A;  3HUG B;  3V4G A;  2R5Y B;  2G7H A;  5EEG A;  5KHD A;  3I58 A;  1OCC H;  2ACJ A;  1VQM I;  2IA2 A;  3DTE A;  1JUM A;  1O57 A;  2EK5 A;  2ELH A;  4KIC A;  4BBR J;  2VQG A;  3TOA A;  3WGG A;  2CJJ A;  4JQF A;  4MQV A;  4AID A;  2HQR A;  3FXO A;  2XAJ A;  2WAQ N;  4AYB N;  4ETS A;  2HS5 A;  4DZJ A;  2DLL A;  1DGR M;  5D5X B;  1QZE A;  4H4K C;  3OYI A;  1SFX A;  2DA2 A;  3LQQ A;  3F8N A;  2FX0 A;  1VI0 A;  3F23 A;  2F4I A;  4Y3O A;  3CES A;  1R4M B;  5CJ9 A;  2CW0 F;  4HG2 A;  3LSP A;  1CQT A;  1S3J A;  1MBF A;  2EZK A;  1S29 A;  2Y31 A;  3PM1 A;  3ROU A;  2OCE A;  2A6H F;  5E8G A;  1MBK A;  1WZ2 A;  1UZC A;  1W4M A;  2K7L A;  2NOG A;  1ERD A;  4AVZ A;  4XSX F;  2JT1 A;  3HOW J;  1Z3Y A;  2JK3 A;  3CO6 C;  4J01 A;  2TCT A;  2LG4 A;  3CF5 F;  1FNN A;  3CUO A;  1N25 A;  5B3S H;  4HNV A;  1ZG1 A;  1UEL B;  5LRS A;  1WCM J;  4RB3 C;  5FLX Z;  3JTG A;  4PJL A;  3DU6 A;  3T8T A;  1BR4 A;  3ABL H;  1B8I A;  1Z05 A;  4X1E A;  1ETQ A;  4E4H A;  4N4N B;  2VQH A;  4A5N A;  3DEE A;  3OOU A;  5H6Q A;  4BHB A;  4CYC A;  1MGT A;  4AYB A;  2WAQ A;  3CF2 A;  3J80 K;  1RUN A;  1G3S A;  3HOU J;  3PFY A;  4L5I A;  1XCB A;  3LNQ A;  5HS9 A;  3OYC A;  2BW3 A;  3HOZ J;  2VBZ A;  1W7P A;  2ZJP F;  5KNL A;  5CVR A;  1JJ6 C;  4XLE A;  2HTS A;  2VBW A;  2GA2 A;  3F72 A;  2RDP A;  2KRF A;  3TGN A;  1U9O A;  2M4K A;  2NYX A;  3V8L A;  2A3S A;  1EJ9 A;  3NAR A;  4F52 A;  3FHN A;  2CUZ A;  1VQL I;  4A3F J;  3IH4 A;  3F6V A;  2LY2 A;  2MSY A;  3ESW B;  4XLF A;  2NVY J;  5F1J A;  3DTI A;  4FCY A;  3WTT C;  2QGU A;  2GIV A;  3AG1 H;  1D1B A;  1YX5 A;  4ZC3 A;  3M9A A;  3C2B A;  2HPI A;  4HF1 A;  2FNA A;  3BQZ A;  2VQC A;  1D0Z A;  4HLX A;  1X2M A;  1MBE A;  2M0M A;  1X58 A;  1X3Z B;  2L2O A;  4O6J A;  1UST A;  1PUF A;  2CO5 A;  1WJC A;  5KAI C;  5BPD A;  1H8A C;  1HDD C;  5LFA A;  3H0G J;  3H3U A;  9ANT A;  2V1D A;  1JHF A;  1R6R A;  3L09 A;  3L2C A;  1K6Y A;  3ZCO A;  4DW6 A;  3J81 K;  1HCR A;  1KQ0 A;  3J7Z I;  2X6X A;  1BR2 A;  4I98 B;  2FE3 A;  3VOD A;  2JZY A;  3K2A A;  4XOT A;  1YJ9 I;  1VQ5 I;  4M9Z A;  2RRE A;  3JRG A;  3QYE A;  5EG0 A;  2EZH A;  1W36 D;  4PGG A;  2JN6 A;  1V5F A;  1O3R A;  5HDK A;  2XC7 A;  3JRA A;  3S3M A;  5FO5 A;  4OIR F;  2F4M B;  3BG5 A;  1K78 B;  1Q1V A;  3BT9 A;  1MH3 A;  4A3G J;  3C2H A;  3PUF A;  2WBM A;  5DD8 A;  1VQ9 I;  3HHH A;  1ENH A;  4LIV A;  2WAD A;  1R58 A;  2P5K A;  2LTP A;  4DQ2 A;  4P96 A;  1X1C A;  2OQG A;  3M1E A;  3RIR A;  4BHP A;  1ZRD A;  4L9T A;  4KYW A;  1B1B A;  4RGR A;  3ERE D;  4EJW A;  5DYM A;  2VON A;  4LG0 A;  3HL2 A;  1TC3 C;  2VOP A;  4UHT A;  1U5T B;  5CQE A;  3HUG A;  4NB5 A;  1IN4 A;  2R5Y A;  5HLH A;  1V54 H;  2QKL B;  2VOD A;  1WH7 A;  2AQE A;  1KON A;  2GXB A;  3ZQQ A;  5J47 A;  2FD5 A;  4A3D J;  3W3C A;  5IY5 H;  1W5S A;  3H3Z A;  5C4J J;  3GLX A;  3TP3 A;  3WHC A;  5LEK A;  2CW7 A;  3MD2 A;  4A12 A;  3ZOB A;  1K4S A;  2DA6 A;  1YQA A;  4A0Z A;  2XPW A;  3EUH A;  2ELK A;  3VYR B;  3CCR I;  1A36 A;  4WX9 A;  1SVO A;  3RCO A;  2GAU A;  3D5L A;  1V55 H;  1UHM A;  2IEK A;  3ZGK A;  1XDS A;  1H9T A;  4PJ0 C;  3BOQ A;  1OKR A;  1D0X A;  2OTL I;  2C6Y A;  3RQ4 A;  5C4X J;  1U2W A;  2M30 A;  1BBY A;  1P2F A;  2KIF A;  2E34 A;  3VOE A;  4ZDO A;  5GPC A;  2EBI A;  4RGS A;  3QYF A;  1XTA A;  3TKY A;  4IHW A;  1WQ2 A;  2DMT A;  4HQE A;  4LLN A;  1ZLJ A;  5J4V A;  2JSC A;  2WY8 Q;  4WXD A;  5L3C A;  2YR2 A;  2VIX A;  2XAS A;  2K27 A;  3DWL E;  1D3Y A;  2V9P A;  4IHX A;  1WJF A;  3ECH A;  3EUH C;  2VBX A;  3QWL A;  4FT8 A;  5LD2 C;  2CFX A;  1ZKG A;  4XKB A;  3CQZ J;  1R23 A;  1Y0N A;  1Z9C A;  2EQR A;  3COA C;  4M74 A;  2L02 A;  4BJ5 C;  5L3B A;  2O8X A;  3CD6 I;  1FZP B;  1YW8 A;  2R7W A;  4YII A;  4NDL A;  4KMU X;  2MW8 A;  2XPV A;  4IO9 F;  4JP0 A;  1YI2 I;  5EEA A;  3ZQI A;  3TED A;  2I10 A;  5LHG A;  1W7P D;  3AKZ A;  4A2U A;  1MKM A;  4C9Y A;  3F22 A;  2F2E A;  2AQF A;  4I2O A;  2QBY B;  1F4K A;  4RGU A;  3IC7 A;  5EZG A;  3QU3 A;  3WU1 B;  1HKT A;  5GAD J;  2L0K A;  5DD4 A;  3FK7 A;  2CQK A;  3FXL A;  2Y75 A;  3WE2 A;  3IV5 A;  1WVR A;  1NG7 A;  4DNC A;  1DU6 A;  3WTS C;  5TRD A;  1OYY A;  1W1W E;  2CV0 A;  1D5Y A;  2EH3 A;  4CCO A;  5CVI A;  2HGC A;  3S3O A;  3K4K A;  1Z1D A;  5HNF A;  3C1D A;  1GVJ A;  4M6Y A;  2YUS A;  2R92 J;  3A01 B;  3HM5 A;  2MGQ A;  3OOP A;  3OMY A;  4S0H B;  1RUO A;  4D0P A;  1YO5 C;  2Q8K A;  2DCE A;  2Z5U A;  2VE9 A;  1ZLK A;  5H2F C;  3SDB A;  4PJN A;  1A6I A;  4YRV A;  2ZCW A;  1JE8 A;  1ETO A;  4QLC U;  3FBI B;  2NVQ J;  2E1O A;  2TDX A;  4B4C A;  3OR2 C;  1B6A A;  3VFZ A;  3I4M J;  3WU0 A;  2XRL A;  4DJA A;  2EFO A;  3OV8 A;  2EA2 A;  3IH3 A;  3IL2 A;  2H8R A;  4E7J A;  4OAY A;  3KZI C;  3AG2 H;  4KIF A;  3RI4 A;  2H27 A;  4UUS B;  3OSG A;  1Z21 A;  4RM2 A;  1K78 A;  1QA6 A;  2ID3 A;  2RAE A;  4XK4 A;  1SAX A;  1JKQ C;  3K4C A;  4PCQ A;  3LSG A;  5KAF C;  4IQ4 A;  1GXQ A;  1TWC J;  3V8J A;  1TT0 A;  1QVU A;  4D5C A;  5K5Q A;  2KIU A;  2DTZ A;  3PJR A;  1ZGJ A;  3K0L A;  2WY7 Q;  4FTH A;  2ELJ A;  3M07 A;  1HF0 A;  1U5T A;  2EFN A;  1L3L A;  2EZI A;  2DQR A;  2PMH A;  3GTG J;  4J19 A;  4N0B A;  3CC7 I;  1QZZ A;  5DS9 A;  2OV7 A;  3CP2 A;  3SZP A;  3N4M A;  4BKX A;  5DM7 F;  1QPM A;  4JBA A;  4CGZ A;  2R7F A;  4GCV A;  3DLA A;  2HTJ A;  3HOS A;  4NQW B;  5EF6 A;  4QIW N;  2K02 A;  2LD5 A;  2CWE A;  2P81 A;  3BPV A;  1O3S A;  2HPM A;  4LGW A;  1QRY A;  4AUX A;  4N4O B;  1Y0U A;  4KNY A;  1K83 J;  3CCS I;  2L4A A;  4ENK A;  3FBN B;  2MD5 A;  3KFW X;  2OJE D;  5CLS A;  1ZRF A;  3MAJ A;  1U5T C;  3MZ8 A;  4BY7 J;  4B48 A;  1AHD P;  4PFP A;  2R7V A;  3LSJ A;  5E1W A;  3R60 A;  3CMY A;  5IP9 J;  2LFB A;  2V1X A;  4HF0 A;  1STZ A;  4XLC A;  2ISZ A;  1FTZ A;  4MHG A;  2ME0 A;  3WU2 C;  4OWR B;  4C30 A;  1WJD A;  1LFB A;  1JT6 A;  1X1D A;  2LBF B;  4QPO A;  2XIG A;  1G6N A;  1JGG A;  2DA1 A;  4LIU A;  1OPC A;  1TQM A;  2VPR A;  2QF7 A;  2BBY A;  1N75 A;  2W25 A;  1VQ4 I;  2V4J C;  2E71 A;  3WE3 A;  1R1U A;  4EM0 B;  2D5V A;  2F48 A;  5HOD A;  1YJN I;  2LY9 A;  4KIT B;  2A07 F;  4G6T B;  4C3H J;  5DM6 F;  4A3M J;  3FXQ A;  3BRO A;  3WG9 A;  3DFG A;  1XPX A;  3NRV A;  1HA8 A;  3J7Y J;  1XSX A;  2Y9Z A;  4C2T A;  4Y15 A;  3MKY B;  2QBY A;  1ZTR A;  3H0D A;  4KMF A;  2NOJ B;  1U0J A;  4JYK A;  3UNG C;  1OCP A;  1XGO A;  1LEA A;  3GW2 A;  4WWC A;  3MEX A;  5ILS A;  2GLO A;  1R7J A;  3ZXS A;  1ZHF A;  3I4N J;  1WFX A;  4EJU A;  2G9W A;  2W84 A;  3KX2 A;  4HYE A;  1QZY A;  5TJJ A;  5DDG A;  2K9N A;  5BQT A;  2FML A;  3JRI A;  3P5J A;  3K1N A;  3QOP A;  1GDT A;  2VN2 A;  2GOM A;  3JW4 A;  3BC8 A;  1LFP A;  1RES A;  1OCR H;  2CUF A;  2COB A;  3DTK A;  1J0R A;  1R36 A;  3SEQ A;  3A01 A;  1T2K A;  1JI8 A;  2E1M B;  5IOY A;  4LJZ F;  5JFR A;  1OQY A;  3P9C A;  5DCF A;  5J6X A;  3ASO H;  1BI2 A;  3HXL A;  2O03 A;  3LAP A;  3S93 A;  2JVG A;  4KT5 C;  4M9X A;  3M7G A;  4D7N A;  5D4S A;  4YEJ A;  3BR2 A;  3K4M A;  2XAQ A;  1KU2 A;  4XON A;  3IRQ A;  3TP0 A;  3H5A A;  4UUS A;  4NBQ A;  4ESJ A;  2R7T A;  5CVU A;  1QPI A;  4XRM A;  2Z99 A;  1SAU A;  2KJB A;  2P5V A;  3AG4 H;  4HW0 A;  1BW6 A;  5FFZ A;  4ZYA A;  1ETV A;  2M87 A;  4YFX F;  3DU5 A;  1NK3 P;  3GVA A;  3RPQ A;  2QWW A;  3WTX C;  5IT3 A;  1YE9 A;  1ZAR A;  2H09 A;  3U1D A;  1V4R A;  2W85 A;  4WK8 F;  2K4J A;  1OYW A;  2A68 F;  4JOM A;  2V6E A;  4IEJ A;  4K2E A;  1XX5 A;  4F55 A;  2QSG X;  1GV2 A;  4XBF A;  3LQR A;  2VLA A;  3HC7 A;  4BU2 A;  4Y4R A;  4B1R A;  4UUV A;  4XLN F;  3HRS A;  1IRG A;  3LL7 A;  2D1H A;  3BTJ A;  3P9I A;  4XRS G;  5K7H A;  3S2H J;  1R4N B;  2EFP A;  1YYV A;  4DYQ A;  1T95 A;  2W24 A;  4II3 A;  4KN4 X;  3UR3 C;  3NQO A;  4B44 A;  3X2Q H;  4LMY A;  1XSV A;  3JRD A;  3E6C C;  3CC4 I;  1S8N A;  2O6G E;  3JRE A;  3BJO A;  5DUI A;  1UB9 A;  4NQW A;  2XSJ C;  1RI7 A;  2RKH A;  4HDU A;  3KZY A;  1OCZ H;  2ZNZ A;  3BZK A;  1T38 A;  3BTL A;  4EVI A;  4MIM A;  2OA4 A;  2VPL A;  4HBL A;  3F8C A;  5LBQ A;  2P4W A;  1HKQ A;  4OIN F;  1KU3 A;  2KQR A;  5IOZ A;  3ZMU A;  3PO3 J;  4U87 A;  2PJR B;  2PI0 A;  1ETY A;  2UXN A;  5L3E A;  5FKN A;  1I3A A;  2VL8 A;  1D8K A;  4YIR X;  4IOA F;  3R4K A;  4G6Q A;  1ZK8 A;  3E5U A;  2P0W A;  1GXP A;  2Y9Y A;  2STT A;  1RR8 C;  2LBF A;  3HTS B;  1HW2 A;  4RAZ A;  1TQI A;  2J5P A;  2O7O A;  4PGH A;  1SFU A;  1IXC A;  1S7E A;  3GTO J;  3K4N A;  3ZQG A;  1KYW A;  1YIO A;  5DUK A;  2V79 A;  1OMI A;  3R61 A;  3O8G A;  1FOW A;  4A5M A;  1QNT A;  2CH0 A;  4IX7 A;  2KJC A;  1C0W A;  2XF6 A;  4A3K J;  3Q3S A;  4YFN F;  1S5L C;  2MYS A;  1I6H J;  1NHA A;  3AAF A;  3ZMS A;  1X2N A;  4LLG F;  2GQQ A;  3I64 A;  4BAC A;  2NNY A;  1R5H A;  2A5W A;  2VKE A;  3ML6 A;  3CJR B;  1JT0 A;  1MH4 A;  1REP C;  1D1C A;  1RIO H;  2VKH A;  1HSJ A;  5E79 C;  4MGR A;  2HOE A;  2IA0 A;  3D5S C;  5LEJ A;  3SEZ A;  1IRX A;  4BQO A;  1X19 A;  3G1M A;  1TBX A;  4U0W A;  3S1R J;  5J1U A;  3PNV A;  1J9I A;  1ZG5 A;  2OF7 A;  2H6C A;  4M6X A;  2E60 A;  2J5O A;  1BJZ A;  1B59 A;  2X9D A;  3MKZ A;  4A3J J;  2HFH A;  1BI3 A;  3S3N A;  4D1Q A;  4A6E A;  3S17 J;  2H6B A;  1WPK A;  2YU3 A;  5BNG A;  2ZBK A;  5K5O A;  2VXD A;  2ME6 A;  4I09 A;  4UB6 C;  2K3P A;  4Q47 A;  1IN8 A;  2ID6 A;  1LE8 B;  1YS6 A;  4YFK F;  5HDN A;  3IWZ A;  1T8I A;  4Z2Y A;  4L0Z B;  4CCN A;  3RZO J;  3SZG A;  2CUJ A;  3MMY B;  3DKW A;  3HKZ N;  4XRF A;  3Q9S A;  1MBH A;  1BIA A;  1RNL A;  4EJV A;  2MFZ A;  1XMA A;  2YX4 A;  4XN0 A;  1HC8 A;  4PSW A;  5LGN A;  1PUE E;  2X85 A;  4PZJ A;  3HZJ A;  2RNG A;  1JKP C;  2CGP A;  1FYM A;  2UXX A;  3RKY A;  2D45 A;  3GTQ J;  4ENM A;  3RPU A;  1TWH J;  2E1M C;  4XM3 A;  5JHU A;  1LFU P;  2FNP A;  1FIP A;  3IKV A;  1R1T A;  3L1P A;  4L9J A;  4RB1 A;  3ECO A;  3DCF A;  2DJN A;  2JPC A;  4RLQ A;  2EB7 A;  3ZN1 A;  4ESB A;  2GWR A;  4E6K G;  3TDU C;  2PJP A;  3G6E I;  1F1Z A;  4G8X A;  1E3H A;  2IA1 A;  1LUJ B;  1ZN2 A;  2OQR A;  3FWE A;  5IPA A;  4ENJ A;  4NC7 A;  4CCL A;  2KIS A;  3H35 A;  2XVC A;  2JVH A;  2M2E A;  2R3S A;  3SFZ A;  4DOZ A;  1FY7 A;  2RQP A;  4ABZ A;  5J3L A;  3JSP A;  4FET A;  3G1O A;  2X48 A;  3HKZ A;  4BQA A;  1JKO C;  4MLO A;  1YFH A;  3DV8 A;  3W2V A;  2E2I J;  3HRU A;  1BR1 A;  1KGS A;  3O3K A;  1S6L A;  5IP7 J;  1T39 A;  2ZJR F;  3CCM I;  4FE7 A;  2QQB A;  3CLQ A;  3HPG A;  1NTC A;  2WB1 N;  3KPH A;  5HLI A;  1DU0 A;  3SDG A;  3GEZ A;  2WWY A;  1Y56 A;  4U0Y A;  1LVA A;  4FAS D;  3DXJ F;  1N78 A;  4WXC A;  4Q4Z F;  4LK0 F;  2RQQ A;  2WV0 A;  5FRM A;  4BE2 A;  4U0V A;  2DBB A;  2GA1 A;  1V5G A;  4IQJ A;  4RS8 A;  3ZQL A;  2PJR A;  4B43 A;  3S15 J;  3CCV I;  2OU2 A;  4F7Z A;  2PEX A;  5AIP A;  5ICG A;  4LD5 A;  2CW8 A;  2DT5 A;  1JXS A;  4R8H A;  4OIP F;  4PJJ A;  5EJC A;  4M72 A;  1AU7 A;  1MD0 A;  1T33 A;  2HQ5 A;  1ZH5 A;  3CUQ B;  1TZL A;  1WWX A;  1XDU A;  2G7U A;  2ESH A;  1QO0 D;  5F27 A;  1LKX A;  2V26 A;  2ZKZ A;  3MZY A;  1ON1 A;  4S04 A;  1FTT A;  1IRZ A;  1MSE C;  2ZME B;  1LEB A;  2BZT A;  3MWM A;  1B9M A;  1T6S A;  4UVC A;  1EH7 A;  1WHU A;  2XAH A;  5IT9 K;  4YG2 F;  3GLL A;  2WB1 A;  2R7U A;  3K4L A;  1OYI A;  5J8F A;  3GME A;  3LOC A;  1EKE A;  5D8K B;  4M9S A;  5CYV A;  4JX4 A;  1UMQ A;  3V8K A;  3WTW C;  3CCY A;  2A61 A;  3SZT A;  1FBU A;  3I54 A;  4IJA A;  4D9J A;  5TIS C;  1Z6R A;  4BYY A;  1O4X A;  5EDN A;  4I01 A;  4MEX F;  1X4O A;  3FXJ A;  4XR6 A;  5IYC J;  2BXZ A;  5B1A H;  4P1W A;  2ZXJ A;  1O7L A;  2K3F A;  1AKH B;  1PP8 F;  3VSK A;  2E1N A;  2HKX A;  6PAX A;  1MIJ A;  4IHS A;  3RZD J;  2G0E A;  3KP3 A;  4G7H F;  3J7A O;  4CDG A;  3IUO A;  1R22 A;  5B66 C;  3JAM K;  3D1N I;  1I3Q J;  2IW5 A;  1FYK A;  2P6T A;  5K5R A;  3FMS A;  4RB2 C;  3HPH A;  2W1O A;  2M1B A;  3U2R A;  3ZQ7 A;  4HSR A;  4GGG A;  3I56 I;  2CRG A;  1TWA J;  4XOR A;  3FIS A;  1I1S A;  1MMN A;  5BOX A;  1MZB A;  5E18 F;  2QSH X;  3E6B A;  4HQM A;  3ZP5 A;  1LE8 A;  2EIK H;  3J80 Z;  3F8F A;  2EZL A;  1W5C C;  2BV6 A;  1ZGA A;  3K1P A;  4F92 B;  3O2P E;  2DI3 A;  2M9H A;  3K4B A;  4ANJ A;  1BOA A;  3I5U A;  3WTU C;  4O3M A;  2KPM A;  2HYJ A;  3ZRG A;  2DK5 A;  4C3J J;  1K7A A;  2EJR A;  4CCJ A;  4KA4 A;  1UAA A;  2IBD A;  2BY3 A;  1FWZ A;  4ZDP A;  3HGG A;  1QGP A;  5KK1 A;  4CYD A;  4EGZ A;  2FBK A;  4GFB A;  4UB8 C;  3WGI A;  3RQI A;  2KL4 A;  1D0Y A;  2NS8 A;  3K69 A;  1ZGW A;  4EGY A;  3ABU A;  2K9S A;  3RPU D;  2UV1 A;  2FMY A;  2KFD A;  2M7A A;  5L3G A;  4EJO A;  1SMT A;  1F43 A;  3QP5 A;  3QOD A;  3S8P A;  2DK8 A;  3H5R A;  3O6B B;  3K4J A;  3AL0 B;  3BG9 A;  5J1Y A;  1FLI A;  3QPT A;  3J7A Y;  3CDL A;  2L7Z A;  3IH2 A;  2YX7 A;  4IRI A;  4HZF A;  2EIL H;  5J40 A;  5HVQ C;  1USS A;  3W6V A;  3HOT A;  1H0M A;  1A6Q A;  3Q0W A;  1OFC X;  2DOA A;  3VDX A;  3BR1 A;  3D5R C;  2IPQ X;  4UUT A;  3ZMZ A;  4DYC A;  1MJA A;  2V9K A;  2OCC H;  1RKT A;  5GPA A;  3ZQC A;  3M4O J;  2WC2 A;  2W57 A;  2KMU A;  3FM3 A;  1SFK A;  3E6M A;  2AHQ A;  4FX4 A;  3BJA A;  3WOD F;  4D7M A;  3R6S A;  3J81 Z;  3ZMT A;  3C7J A;  2OZU A;  5LGT A;  4YEL A;  3M3Y J;  4NHJ A;  2XKO A;  3VPR A;  3BR3 A;  3PSF A;  4LB6 B;  1FYL A;  1Y1W J;  4IVN A;  3BLY A;  4P55 A;  4XMY A;  4XNF A;  4M6V A;  2CQX A;  4IHY A;  1Q1H A;  2ZXW H;  2L7K A;  2BVL A;  2LY1 A;  1LB2 A;  5AIQ A;  2DT6 A;  3K2Z A;  1I50 J;  2KIQ A;  2KDO A;  3A0B C;  3OIP A;  4EM1 A;  1VFC A;  3CUQ A;  1MNM C;  2E5Z A;  1ON2 A;  4FX0 A;  2VI6 A;  2B9S A;  1JHH A;  1GVD A;  1FSE A;  4YIF A;  2Y0S N;  5GAE J;  1X1B A;  2PX9 A;  4BNC A;  4BQQ A;  4HEA 2;  3CJT B;  3NEU A;  1W0T A;  2ZME A;  3L2W A;  2M8E A;  2KLO A;  3KP6 A;  1LNW A;  4PK4 A;  4G9Y A;  2B63 J;  1UG0 A;  3I4P A;  5F0C A;  3CMM A;  2NNN A;  2Y30 A;  3BTC A;  2QQ8 A;  2VAS A;  4EAT A;  5JHF A;  1SEU A;  1KU7 A;  5D6E A;  1IDZ A;  2D2W A;  2IGN A;  4HAM A;  4IZZ A;  3PO2 J;  2PMZ N;  3OIQ A;  2IGO A;  3GZN B;  4A3E J;  4L9N A;  3O8H A;  4HOB A;  3L00 A;  4MTE A;  5B5E C;  3CUQ C;  2R7D A;  3EET A;  3F21 A;  2E2J J;  2HU9 A;  3CP8 A;  3IRR A;  4HRI A;  1ZG3 A;  3TL4 X;  1M1E B;  2FQ4 A;  3T0Y A;  5FLM J;  3LSH A;  3RKX A;  4M3D A;  4E7S A;  1AKH A;  1YRN B;  3LMM A;  3H1C A;  3TDZ C;  3LST A;  2E7W A;  4KN7 X;  5D6F A;  4BL0 B;  5F0H A;  1ITY A;  2ZME C;  2QQ9 A;  3H36 A;  5K1Y A;  2JJ7 A;  2IAI A;  2ADU A;  2ZJ2 A;  1HQC A;  2W48 A;  4BDZ A;  5M3F J;  2X6Y A;  3DKX A;  1H88 C;  2HYF A;  3KEY A;  4OOI A;  2LC2 A;  1WI9 A;  1R49 A;  1X1P A;  4I7H A;  3G2B A;  5E3M A;  4RBO A;  2DMN A;  1R5G A;  4PFO A;  4V19 K;  2M5W A;  3ERM A;  3Q9V A;  2K4B A;  2CQN A;  2PFB A;  2LH9 A;  2XF7 A;  3P9K A;  2Q0O A;  4L5E A;  3FXR A;  5FD5 A;  1PP7 U;  4LIT A;  1IV8 A;  1U78 A;  2WTE A;  2OPT A;  1WJB A;  1XD7 A;  2PMZ A;  3TO7 A;  4HF2 A;  4BBS J;  5D5W B;  5D4R A;  2R7O A;  1RET A;  2JWT A;  2B7E A;  3REO A;  2O9L A;  2DJI A;  3RKW A;  1LJ9 A;  2JUC A;  2ZFW A;  4KT6 A;  3HSF A;  3GCM A;  3HHG A;  1XGN A;  2EIJ H;  4BH9 A;  5C44 J;  3OYL A;  2L01 A;  1R1V A;  1QBJ A;  4E7I A;  4MNU A;  2XPU A;  4Y7N J;  2FOW A;  4B09 A;  1G3W A;  1UHS A;  2FSW A;  4E7Z A;  4I0B A;  1Y39 A;  1NK2 P;  5C3E J;  4BAY A;  2QLZ A;  3M8J A;  3K7A J;  1IDY A;  2XV4 S;  2VQL A;  4A3C J;  2EWN A;  2M45 A;  3BPX A;  1BA5 A;  4CCM A;  3BQY A;  5LHH A;  1VQO I;  2L5Q A;  3CME I;  1LPQ A;  3QOE A;  4R1H A;  2KKO A;  4N9H A;  4UNO A;  4Y33 A;  2OAZ A;  1T0F A;  4C3I J;  2ISY A;  3I71 A;  3MCZ A;  4UV8 A;  5IYD J;  1FMV A;  2OBP A;  2AO9 A;  2VXZ A;  2BYV E;  3EYI A;  1GHC A;  3H92 A;  4IOC F;  5F0F A;  3GFI A;  1WH5 A;  2NS7 A;  1R9T J;  3SXY A;  3S14 J;  3MN2 A;  3I55 I;  1HKS A;  2F5C A;  2GM4 A;  2QCO A;  4CIC A;  2MC4 A;  3C2G A;  3LSK A;  5E17 F;  2OD5 A;  1H89 C;  3GX4 X;  2CS3 A;  1LDK B;  3NWT A;  2CG4 A;  3AL0 C;  1PDN C;  1RKW A;  1WJA A;  1E17 A;  4BEH B;  3FDY A;  2KIM A;  2PBI A;  4MQ9 F;  2JA2 A;  2F5D A;  5BS6 A;  4M3F A;  3JRH A;  2Y2Z A;  2H8W A;  1J2X A;  1YIT I;  1T0F C;  1JJ8 C;  4NNJ A;  1IW7 F;  1BJA A;  1GV5 A;  4KJZ A;  5FKL A;  4EV0 A;  3G71 I;  1A5J A;  2HZD A;  3KYD B;  2K9Q A;  4BJ6 C;  3FK6 A;  3KP7 A;  4O5V A;  4MO7 A;  2LMD A;  3CMA I;  1ZRC A;  2ZB9 A;  3F8B A;  3QPL A;  2FF4 A;  2UUZ A;  3CCE I;  3DQV C;  1BI0 A;  4ZDL A;  4CZC A;  2VOO A;  1JTY A;  2LRD A;  1FPQ A;  3B6C A;  5CVV A;  2R7Z J;  3FXU A;  3ZMV A;  2X0L A;  2MD0 A;  3GZ6 A;  1Y1V J;  1MJB A;  1MBG A;  4EM2 A;  4V2G A;  2O0Y A;  2Y48 A;  2L9R A;  3MVP A;  3LSR A;  3ABM H;  2IS6 A;  1IV6 A;  3H9J A;  3I59 B;  5AON A;  5HLG A;  3JTH A;  1K79 A;  3WHB A;  3GUD A;  2QZ8 A;  4XRS A;  1MMG A;  1YW9 A;  3HSR A;  2VJI A;  3NAU A;  5K7F A;  1ETW A;  5KVR A;  2HVR A;  4AIK A;  2NVT J;  4HNT A;  4W1U A;  1UJ8 A;  1XC5 A;  3PNY A;  3SJM A;  3SHF A;  2CV2 A;  1VQK I;  1R00 A;  5HLT A;  3CCJ I;  4I76 A;  2KZG A;  3BY6 A;  2FOK A;  3KCC A;  4AD9 A;  5A2Q K;  2BE5 F;  2ZNY A;  1P6R A;  2YU9 J;  3GTJ J;  4HLY A;  3ZR8 X;  2ZJQ F;  3ISP A;  3KYC B;  1GUU A;  1XG1 A;  3TO6 A;  1YRN A;  3CDI A;  3DF8 A;  2HWV A;  5F08 A;  1FEX A;  3K70 C;  2NS0 A;  3OYA A;  2QVO A;  3QPS A;  1YHQ I;  3U21 A;  4C2M J;  3MZH A;  2E19 A;  3VSL A;  1ETX A;  1E0E A;  1DQU A;  2W82 A;  2H94 A;  3I9V 2;  4KFC A;  2DA5 A;  1X3U A;  1ZRE A;  4KUM A;  2P8T A;  5M3M J;  4HPQ A;  3TOB A;  3OIO A;  4WF2 A;  2Z33 A;  3HBL A;  5E3L A;  1FC3 A;  4FIS A;  3E5X A;  1MJ9 A;  4FQG A;  1XSD A;  2B0L A;  2UWM A;  1D8J A;  3ZN0 A;  2HOT A;  1ZAO A;  2E5N A;  3BG7 A;  1KA8 A;  1LDJ A;  2LKP A;  2DPU A;  3JRC A;  4P9U A;  2DTR A;  2LRE A;  3IAS 2;  1W5T A;  1BC8 C;  1J7K A;  1H9G A;  4XKV A;  3OYD A;  2DDA A;  1HDP A;  2LR8 A;  5M5Y J;  3CC2 I;  1OIS A;  1FT9 A;  1P92 A;  5KCM A;  4UV9 A;  4HX7 A;  1XGM A;  3FIW A;  4PJM A;  2K85 A;  4GO1 A;  3DEW A;  2RVC A;  2QA4 I;  2PQ8 A;  2Z2S B;  2HQA A;  3CZ6 A;  4UVB A;  5EGO B;  1VQ7 I;  2KP6 A;  3FXK A;  1G4D A;  4NC8 A;  1MW7 A;  2PN6 A;  2IS2 A;  2VJ5 A;  2LF8 A;  2HVS A;  3E0J B;  4WXH A;  3RTR A;  3GO5 A;  5CVJ A;  1TWG J;  5FLX K;  1XGS A;  3OL4 A;  2GBY A;  3I0T A;  4HV6 A;  2ZO4 A;  2L9V A;  1BC7 C;  1J09 A;  3EUK L;  3H9Q A;  1MMA A;  5D8L B;  3ABT A;  2MH2 A;  4IRH A;  3Q0U A;  3RYR A;  4CXF A;  4FHT A;  5GTI C;  4BJT A;  5J8C A;  1Z3X A;  4RAF A;  4E7K A;  1LVK A;  2AS5 F;  2W4S A;  3GZ5 A;  1EV7 A;  3BJ6 A;  1T56 A;  1UCR A;  3F8M A;  2XAG A;  3K1M A;  1IC8 A;  3GWZ A;  3A02 A;  2JA8 J;  4A0Y A;  2L9N A;  3TBI A;  4BEH A;  4ZZD A;  1OLT A;  1U8R A;  1B4A A;  3CTA A;  5F64 A;  4GYI A;  1S7O A;  2UZK A;  3MFK A;  1VQ8 I;  4X6A J;  3I53 A;  4UY8 I;  1OCO H;  3KLO A;  5ICF A;  2BY0 A;  2XF5 A;  3DPT A;  3BCB A;  1IJW C;  4GDF A;  1IN7 A;  5JI6 A;  3G73 A;  1IRF A;  3ZQF A;  2CMP A;  2DFF A;  4RA2 A;  4RB0 A;  3M8E A;  4B47 A;  1ZEL A;  2R0Q C;  3IWF A;  2DMP A;  5FFX A;  4AM3 A;  1MND A;  1J59 A;  2L7M P;  3E6D A;  2ZSH B;  4AWX B;  2JPB A;  5E20 A;  3HG9 A;  2Z16 A;  1TW3 A;  5JLW A;  3I59 A;  2CFO A;  2F5E A;  2BEO A;  4M3B A;  3FHZ A;  1OCT C;  3GTL J;  4OIO F;  2OC6 A;  2MH9 A;  4Z6Y A;  2RV8 A;  1Y8R B;  3B02 A;  3K70 D;  5H20 A;  1W36 C;  3A03 A;  1U9N A;  5LHI A;  1VQN I;  3LA7 A;  4XL9 A;  2CQ7 A;  2HDW A;  2EPF A;  3QQA A;  1E3P A;  3DKY A;  1Z6T A;  1JUP A;  2E35 A;  2N8G A;  4L9V A;  3OYH A;  3FMQ A;  3OYB A;  2M8G X;  4XLP F;  4GYG A;  4IF4 A;  3BWG A;  4DYR A;  3QRF F;  2EV5 A;  1DPU A;  3OYM A;  4BS9 A;  2PMU A;  3ZPL A;  2L9S A;  3TW7 A;  1DUX C;  4ZYE A;  1QQI A;  2JA6 J;  3DPU A;  4ZTF A;  2LF7 A;  5K7Z A;  2LLK A;  1FP2 A;  5ICC A;  4L18 B;  2DOD A;  3HDD A;  1P7J A;  5FKK A;  2DW4 A;  3B73 A;  2GZW A;  1KQ8 A;  4CUG A;  3GTK J;  1I6X A;  2KRC A;  2LP0 A;  3E5Q A;  3VYU B;  5M5X J;  3V7C A;  3JSO A;  4ENN A;  1TTY A;  2ZXH A;  1ACI A;  4F93 B;  2R7R A;  1RR7 A;  3SFI A;  1F36 A;  3G4S I;  4JX6 A;  3VYS B;  4X0G A;  2V6C A;  3IHU A;  4QWQ A;  3DBH B;  3IP4 B;  4IL6 C;  5EZH A;  4JX5 A;  2GXG A;  3EPZ A;  1R5I D;  1VND A;  1IUY A;  4ZZL A;  2O3F A;  2IT0 A;  2VC1 A;  2MBF A;  4BDY A;  1BN5 A;  2ICW G;  1TWF J;  4PDK A;  2F4O B;  3ELK A;  5FGM A;  3HSE A;  1JUS A;  3CCL I;  5M5W J;  1CGP A;  1R71 A;  2GOX B;  3EQL F;  3V7S A;  2LSO A;  2DYS H;  1P9Q C;  5EGO A;  4I6Z A;  1BOB A;  2XUB A;  3LFU A;  4U88 A;  4AC0 A;  2IVM A;  2VKV A;  5E8I A;  2Z9O A;  1CF7 B;  1TP4 A;  3W6K B;  1YJW I;  1F9N A;  3KEO A;  5D5U B;  2QQA A;  1P4W A;  1HXD A;  1ULY A;  1Z77 A;  5GTH C;  3K10 A;  2VT3 A;  1VTN C;  2HZT A;  5BPI A;  1IG7 A;  2KRH A;  5L3F A;  3PQJ A;  4M3G A;  1VZ0 A;  1AWC A;  3BR6 A;  2DT7 B;  1MDM B;  1IAW A;  2FUG 2;  1XMK A;  2DMU A;  2BY2 A;  1T08 B;  2HYG D;  2Q1Z B;  2H1K A;  3F0C A;  4R79 A;  2EV6 A;  1EF4 A;  4JK1 X;  3S2W A;  3RSN A;  2Q2E B;  1LDD A;  2DQL A;  2LK2 A;  3KIO A;  4RLF A;  2O8K A;  2BOL A;  1SD6 A;  2K9M A;  3OWT A;  4DBR A;  5GAG J;  2JA5 J;  5D5V B;  1LQ1 A;  2K40 A;  3JCU C;  3ZQH A;  3KYL A;  4BUP A;  3FZV A;  4AIH A;  3BDD A;  2ZSI B;  2YS9 A;  4S05 A;  4ITV A;  4DBQ A;  3L2R A;  2XGC A;  4ESF A;  3DBL B;  4KIB A;  4LG3 A;  3MKL A;  3KZZ A;  2HDC A;  2MAB A;  1ODD A;  2V7F A;  3A4C A;  3OYE A;  1RC9 A;  4EMS A;  1U8B A;  1FIA A;  2NRA C;  1IN6 A;  3BTI A;  3L2U A;  4J00 A;  1WI3 A;  1UHW A;  2JSP A;  1QVT A;  4XID A;  2JQ7 A;  2XRN A;  2DOE A;  2LNB A;  2QKM B;  2XB0 X;  2MLK A;  2DAO A;  2RN7 A;  3QP6 A;  3FXM A;  3Q5F A;  1O7F A;  2AXT C;  2NAZ A;  1D5V A;  1NG6 A;  1WKM A;  5F04 A;  2R7Q A;  2V9V A;  2X1E A;  2LKX A;  3A0H C;  3KEQ A;  1BL0 A;  3S2D J;  5E3O A;  1JGS A;  1FOY A;  3TO9 A;  2XSD C;  2XHK A;  1FX7 A;  5FD6 A;  5ED4 A;  4A3I J;  3GBG A;  1S72 I;  5ICE A;  5FB2 A;  2R93 J;  1XN7 A;  1FOK A;  5FLV A;  5E1X A;  4H0E A;  2RC4 A;  2ESN A;  4G94 A;  1SMY F;  2A6E F;  2P6S A;  2CYY A;  4QPQ A;  1S7A A;  2Z1D A;  2WA0 A;  4LLL A;  1PVE A;  1POG A;  2FBI A;  2JRT A;  2VC0 A;  1P7I A;  1QHG A;  4A3L J;  1G3T A;  2STW A;  1Y8Q B;  5EEH A;  1OJL A;  2R7X A;  3PQK A;  3DP7 A;  1YX3 A;  2LDU A;  1YS7 A;  3LA3 A;  4XLH A;  5FKO A;  2M4G A;  4G6D A;  5DEQ A;  1AOY A;  3A1Y A;  1HW5 A;  2RNJ A;  4NC6 A;  1DP3 A;  1SC7 A;  2QEN A;  1RZ4 A;  3L2V A;  4BE1 A;  2HVQ A;  4RDU A;  2QYO A;  2WAF A;  2A5Y B;  3L7W A;  4UXN A;  3OS1 A;  4N9I A;  1SVM A;  4XIC A;  1O3Q A;  3OS0 A;  4Q48 A;  1IGN A;  4KIG A;  1EA3 A;  4ZJZ A;  3GFM A;  4HDV A;  1PYV A;  2EIN H;  1UFM A;  3QAH A;  4F3Q A;  4RAY A;  1MMD A;  2XB5 A;  1TNS A;  3PUB A;  4WCG A;  5IT9 Z;  1X3W B;  3VEP A;  4M73 A;  1BM9 A;  3FM5 A;  3K6G A;  5TGT A;  1J75 A;  4V2F A;  2HR3 A;  3WG7 H;  3V42 A;  1DP7 P;  4CZZ A;  5E1Z B;  3MQ0 A;  2IGK A;  2QM3 A;  1BW5 A;  2ETH A;  2E36 A;  2DN0 A;  3C3W A;  3HTU A;  4P9F A;  5FRN A;  2R4G A;  4BHC A;  3ABK H;  3KLN A;  1SAN A;  3DBR B;  1EH8 A;  3HGY A;  4D5F A;  1KYZ A;  5CPR B;  5IP6 A;  1I27 A;  1VF9 A;  3DEU A;  3E1S A;  2DXI A;  3OL3 A;  3K9T A;  2ECB A;  4LOC A;  1XS9 A;  3KP4 A;  4E7L A;  4A69 C;  2O5R A;  1YIJ I;  3CDH A;  3S32 A;  1CF7 A;  3VYT B;  2DO7 A;  3BP8 A;  3WTZ A;  4CH7 A;  3JAM Z;  4DIQ A;  4IKF A;  3H9G A;  4HX8 A;  1FP1 D;  1I39 A;  4B8X A;  3ASN H;  4M71 A;  4IHT A;  3GFL A;  2OTJ I;  3QU6 A;  4EJT A;  2FA5 A;  3BR0 A;  2KDZ A;  4A0X A;  4M3E A;  1MDM A;  1P4X A;  2A6T A;  2A05 A;  3BR5 A;  1ORK A;  2BGC A;  5CQG A;  4BGD A;  4LB5 A;  2DFE A;  1IF1 A;  2VBY A;  3PIO F;  3LAJ A;  1I1G A;  4XKC A;  2VKD A;  2Q2E A;  5ILU A;  1U3E M;  1V3F A;  3FF5 A;  3CLO A;  2VJJ A;  5L3D A;  5GP9 A;  2M7B A;  5F6F A;  3CCU I;  2KZV A;  1E3O C;  1IUF A;  2HQN A;  4OMZ A;  2DA3 A;  1SVL A;  4AIJ A;  1G3Y A;  1ONV A;  2BXY A;  1RRJ A;  1YW7 A;  1UG2 A;  4RGX A;  3V7R A;  2NVX J;  1MMS A;  2X51 A;  2L3D A;  2IXS A;  4IRG A;  2DYR H;  2QUF A;  2QEX I;  3EYY A;  2L7F P;  1E2X A;  2IS1 A;  4XQF A;  3IKT A;  3LSI A;  5JVT A;  3BZC A;  2Y0S A;  3OSF A;  3N97 A;  2DPD A;  3OYG A;  5LLQ A;  3MKW B;  4OAZ A;  2YSR A;  2HKO A;  4CO8 A;  3JR9 A;  3GFJ A;  3ONQ A;  3QYB A;  2GXA A;  3KET A;  1B72 B;  5FRO A;  2XGX A;  1SD7 A;  1KQ9 A;  3R0J A;  4I02 A;  3JRB A;  4C2U A;  4LFU A;  2MA3 A;  4DGW B;  3R0A A;  3HYI A;  2K9L A;  1FBQ A;  2I5U A;  5DCM B;  3W2W A;  1APL C;  3GTP J;  3S1N J;  5EYR A;  2KT0 A;  3EDP A;  1J5Y A;  1SD4 A;  3G1L A;  5FKM A;  2DOF A;  1A31 A;  3C18 A;  3GYH X;  2R5Z B;  2ECC A;  2R7S A;  1Z67 A;  1IZ1 A; 
#chains in the Genus database with same CATH homology
 3D5L A;  3ZGK A;  4XLA A;  4XOP A;  2OUM A;  4HPQ A;  1D0X A;  4RLQ A;  3RQ4 A;  3CJQ B;  4E6K G;  4ZDO A;  4B3X A;  3QYF A;  1MNE A;  3BG6 A;  2UWM A;  2LYC A;  4NC7 A;  4CCL A;  2E5N A;  3BG7 A;  3H35 A;  3OS2 A;  2WY8 Q;  2JVH A;  2KHM A;  2VB6 A;  4DOZ A;  1AA7 A;  2VIX A;  3AFH A;  2LRE A;  3DWL E;  3IAS 2;  4FET A;  4RM3 A;  4XKV A;  4CA0 A;  3HKZ A;  3OYD A;  1WJF A;  1G8X A;  3EUH C;  4MLO A;  5LD2 C;  3W2V A;  4XKB A;  1BR1 A;  5KCM A;  1X4P A;  2M3A A;  2ZXI A;  3OYJ A;  4II2 A;  4BJ5 C;  4PJM A;  3HPG A;  4CCK A;  2BVM A;  2R7W A;  1Y56 A;  2HQA A;  2Z2S B;  3CZ6 A;  4FAS D;  2KP6 A;  3A2K A;  1N78 A;  4NC8 A;  1MW7 A;  2RQQ A;  2IS2 A;  2VJ5 A;  1S9H A;  3FKJ A;  4BE2 A;  2HVS A;  5FRM A;  3E0J B;  3RTR A;  1V5G A;  3BCA A;  3AKZ A;  4IQJ A;  4BXF A;  2PJR A;  4B43 A;  3OL4 A;  4C9Y A;  1GLN A;  2AQF A;  2XDV A;  2CW8 A;  1J09 A;  1WJE A;  3EUK L;  2X1D A;  4PJJ A;  3H9Q A;  1MMA A;  1TZL A;  4BJT A;  1Z3X A;  1LKX A;  1LVK A;  2V26 A;  2W4S A;  4E7K A;  1DGW Y;  1NG7 A;  3F9K A;  3TMO A;  3OY9 A;  2CV0 A;  3DPL C;  4CCO A;  1G59 A;  3S3O A;  2L9N A;  3TBI A;  4BEH A;  1OLT A;  3H5N A;  3K4K A;  5HNF A;  4NUB A;  2WB1 A;  2R7U A;  3K4L A;  1OR7 C;  2XAU A;  3OMY A;  3IAM 2;  2WAE A;  2XF5 A;  3DPT A;  3BCB A;  2W7N A;  2F6C A;  2DCE A;  3SDB A;  4PJN A;  3PL8 A;  4YRV A;  2CMP A;  4D9J A;  3FBI B;  4B47 A;  1ZEL A;  3OR2 C;  1X4O A;  4XR6 A;  4DJA A;  5HNH A;  1MND A;  4P1W A;  4XKW A;  4F91 B;  3OYN A;  2ZSH B;  4OAY A;  4E7J A;  3VSK A;  4HNU A;  2X6W A;  3HG9 A;  2Z16 A;  3OYF A;  2CFO A;  3IUO A;  1Z21 A;  4RM2 A;  2OC6 A;  3K4C A;  3HPH A;  3K70 D;  3LSG A;  2W1O A;  1W36 C;  4PSX A;  4HSR A;  2X1C A;  4IQ4 A;  4XOR A;  3PNT A;  1TT0 A;  1QU3 A;  3EUA A;  4XL9 A;  1MMN A;  1PJR A;  2HDW A;  3PJR A;  4XM3 A;  3DKY A;  2WY7 Q;  1Y6I A;  3OYH A;  3SYT A;  4U7B A;  3OYB A;  2ELJ A;  3PSI A;  4F92 B;  3K4B A;  3LSM A;  4RMN A;  4ANJ A;  4BS9 A;  3OYM A;  2L9S A;  3DPU A;  4ZTF A;  2KPM A;  2OV7 A;  3ZRG A;  3OR1 C;  3CP2 A;  4CCJ A;  1UAA A;  4ZDP A;  3DLA A;  3HOS A;  2KL4 A;  4NQW B;  1D0Y A;  4CUG A;  2KRC A;  3VYU B;  1QHH D;  3RPU D;  2UV1 A;  2M7A A;  3I3L A;  2HPM A;  2K5C A;  2BW3 B;  2ZXH A;  5HOO A;  4N4O B;  4F93 B;  3QOD A;  3S8P A;  2R7R A;  3H5R A;  2VJ4 A;  3K4J A;  3AL0 B;  3FBN B;  2V1N A;  4CSW A;  4B48 A;  3VYS B;  4X0G A;  4PFP A;  3J7A Y;  2R7V A;  3IP4 B;  3EPZ A;  5HVQ C;  4P5O A;  3HOT A;  4XLC A;  3N05 A;  2DOA A;  4ZTJ A;  3OYK A;  3VDX A;  1D1A A;  3D5R C;  4BDY A;  5CKT A;  2F5V A;  2W00 A;  4OWR B;  1WJD A;  4C30 A;  1X1D A;  2V9K A;  2LBF B;  4QPO A;  2KMU A;  1SFK A;  4LIU A;  2GOX B;  1N75 A;  4YEL A;  2JUG A;  2V4J C;  1P9Q C;  4GRI A;  1BOB A;  3PSF A;  3LFU A;  4KIT B;  4G6T B;  3BLY A;  4XMY A;  4XNF A;  2IS4 A;  2L7K A;  4KIS A;  1HA8 A;  3NWS A;  2BVL A;  1N77 A;  2LY1 A;  4C2T A;  3MKY B;  2DT6 A;  3K10 A;  3H0D A;  2NOJ B;  2KDO A;  1U0J A;  2KRH A;  3OIP A;  4AU7 A;  3UNG C;  1VZ0 A;  4BE0 A;  2DT7 B;  2E5Z A;  2FUG 2;  2LOO A;  3ZXS A;  2IGM A;  4BQN A;  3L2Q A;  2Q1Z B;  1WFX A;  4R79 A;  1X1B A;  3M1C A;  3KX2 A;  4E7H A;  4BQQ A;  4HEA 2;  3RSN A;  1V5E A;  2Q2E B;  3L2W A;  4RLF A;  4XN3 A;  2KLO A;  2BOL A;  2GOM A;  4PK4 A;  2K9M A;  1LFP A;  1WJ5 A;  1UG0 A;  3BC8 A;  3OWT A;  4PUS A;  1Z7L A;  3CMM A;  3W2A A;  4DBR A;  4HST A;  2CV1 A;  3DTK A;  1JI8 A;  2VAS A;  3SEQ A;  4EAT A;  5JHF A;  2E1M B;  3KYL A;  4BUP A;  2I8D A;  2IGN A;  2ZSI B;  3VWB A;  4IZZ A;  3OIQ A;  4ITV A;  4DBQ A;  3L2R A;  2IGO A;  3HXL A;  1FMW A;  3S93 A;  1X1A A;  2ZFU A;  2JVG A;  2HNH A;  4LG3 A;  2MAB A;  2V7F A;  2HU9 A;  3A4C A;  3CP8 A;  4YEJ A;  3HUG B;  3OYE A;  4HRI A;  3TL4 X;  5KHD A;  3L2U A;  3LSH A;  4J00 A;  3K4M A;  2JSP A;  3DTE A;  4E7S A;  4XON A;  3LMM A;  2QKM B;  2VQG A;  4BL0 B;  4JQF A;  3H5A A;  1DGR M;  2R7T A;  4H4K C;  4BDZ A;  1NG6 A;  3OYI A;  2R7Q A;  2X6Y A;  2X1E A;  3DKX A;  1SAU A;  3KEY A;  2LC2 A;  4ZYA A;  2F4I A;  4Y3O A;  3CES A;  3RCO A;  3DU5 A;  4HG2 A;  3G2B A;  3GBG A;  1YE9 A;  4PFO A;  4JOM A;  2V6E A;  4F55 A;  2LH9 A;  2XF7 A;  4LIT A;  2VLA A;  4QPQ A;  3HC7 A;  1ERD A;  2PMZ A;  1WJB A;  2WA0 A;  2Z1D A;  4AVZ A;  1Z3Y A;  4BU2 A;  2R7O A;  4Y4R A;  4J01 A;  3LL7 A;  2LG4 A;  2DJI A;  1QHG A;  1T95 A;  1UEL B;  4II3 A;  3UR3 C;  4KT6 A;  4B44 A;  4PJL A;  3DU6 A;  2R7X A;  1BR4 A;  3OYL A;  4E4H A;  2XSJ C;  4N4N B;  4E7I A;  1YX3 A;  2VQH A;  4XLH A;  3DEE A;  3OOU A;  4AYB A;  2WAQ A;  3CF2 A;  2M4G A;  4E7Z A;  3PFY A;  3A1Y A;  3OYC A;  3M8J A;  2BW3 A;  1DP3 A;  2VPL A;  2VQL A;  3L2V A;  4BE1 A;  2HVQ A;  5KNL A;  4CCM A;  2WAF A;  2L5Q A;  3OS1 A;  4XLE A;  3QOE A;  2KQR A;  4Y33 A;  3OS0 A;  4U87 A;  2PJR B;  4ZJZ A;  1EA3 A;  1PYV A;  4F3Q A;  2M4K A;  1MMD A;  3PUB A;  1FMV A;  3FHN A;  2CUZ A;  2VXZ A;  4F52 A;  2VL8 A;  2LY2 A;  3K6G A;  4XLF A;  2P0W A;  5TGT A;  3V42 A;  3DTI A;  2LBF A;  2IGK A;  1D1B A;  1YX5 A;  4ZC3 A;  2MC4 A;  3K4N A;  5FRN A;  2R4G A;  3C2G A;  3LSK A;  2HPI A;  2CS3 A;  5CPR B;  2VQC A;  3E1S A;  1D0Z A;  1LDK B;  2DXI A;  3NWT A;  3OL3 A;  3AL0 C;  1WJA A;  4BEH B;  2M0M A;  3FDY A;  2CH0 A;  4IX7 A;  4E7L A;  2L2O A;  2O5R A;  2XF6 A;  2JA2 A;  3S32 A;  3VYT B;  1WJC A;  2MYS A;  1T0F C;  4NNJ A;  5LFA A;  4KJZ A;  4BAC A;  4CH7 A;  2HZD A;  4DIQ A;  2A5W A;  4BJ6 C;  4IKF A;  3H9G A;  1R6R A;  1K6Y A;  3CJR B;  3ZCO A;  2UUZ A;  1D1C A;  2X6X A;  3DQV C;  4ZDL A;  4CZC A;  1BR2 A;  2LRD A;  2VKH A;  2A6T A;  4XOT A;  3D5S C;  5CQG A;  3SEZ A;  2MD0 A;  1IRX A;  4BQO A;  4BGD A;  1X19 A;  2RRE A;  3QYE A;  4XKC A;  2VKD A;  1W36 D;  2IS6 A;  3PNV A;  1V5F A;  3H9J A;  2XC7 A;  3S3M A;  2VJJ A;  2E60 A;  2M7B A;  2KZV A;  3MKZ A;  1MMG A;  3C2H A;  3S3N A;  2WBM A;  4D1Q A;  2VJI A;  4LIV A;  2HVR A;  2WAD A;  2X51 A;  2VXD A;  4HNT A;  2IXS A;  2K3P A;  3PNY A;  1X1C A;  2CV2 A;  5HLT A;  2IS1 A;  4XQF A;  3LSI A;  2Y0S A;  4CCN A;  3OYG A;  3HL2 A;  3SZG A;  3MKW B;  2CUJ A;  4OAZ A;  3MMY B;  5CQE A;  3ONQ A;  3QYB A;  2QKL B;  2AQE A;  1KON A;  3ZR8 X;  5FRO A;  3ZQQ A;  2MFZ A;  4XN0 A;  4C2U A;  3W3C A;  4PSW A;  4DGW B;  2K9L A;  2X85 A;  3W2W A;  2RNG A;  2CW7 A;  3MD2 A;  3K70 C;  3OYA A;  3U21 A;  3VYR B;  3VSL A;  2R7S A;  1E0E A;  1DQU A;  2E1M C;  2W82 A;  3I9V 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...