2VQLA

Crystal structure of porb from corynebacterium glutamicum (crystal form iii)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
76
structure length
76
Chain Sequence
LSPQYNWVACGILEGGLKAAGVLEEGQYNRELAEAIAAKGEGFWTTQFPQIGDWNEDQAAALADRAQTCGLVKADT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords UNCHARACTERIZED PROTEIN CGL0972
publication title A Putative Alpha-Helical Porin from Corynebacterium Glutamicum.
pubmed doi rcsb
source organism Corynebacterium glutamicum
total genus 26
structure length 76
sequence length 76
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11565 PorB Alpha helical Porin B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1280 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vqlA00
2VQHA 2VQLA 2VQGA
chains in the Genus database with same CATH superfamily
2VE8A 3TEDA 2H27A 3D0SA 3OYKA 2W84A 2R93J 1UZCA 2FOWA 1LVAA 2UXNA 3CP8A 3NRVA 5J1YA 3L2WA 3JW4A 3MKYB 4B1RA 2EA2A 3FXOA 4XLNF 1DGWY 1BC7C 2W82A 5IYDJ 1BR4A 5E8GA 2I8DA 2L01A 3KYCB 1F43A 3QPLA 2EFNA 4XMYA 4B4CA 2QSGX 1OCCH 4M74A 2HXIA 1IF1A 3TO6A 3H35A 4IOAF 4PSXA 2UXXA 4YELA 4IXAA 3AKZA 1H88C 3F8MA 4N9IA 5DEQA 3C7JA 1NTCA 2R5YA 2PJPA 3DQVC 2R7OA 2FJ1A 1O3QA 2Z2SB 2CYYA 2KRCA 4BBRJ 1T56A 3V8LA 4DBRA 4FX4A 1VQ5I 5E18F 2LY1A 4ASNA 3H0GJ 2V26A 1P4XA 3HOYJ 5KHDA 1YX5A 2Z16A 3G71I 4CGZA 3KP3A 2QSFX 2QF7A 3FMRA 2DCEA 4XLFA 1YI2I 5E17F 1Z21A 4F92B 2I5UA 4IRGA 4MHGA 1IN7A 1MBGA 3WG7H 4A3LJ 1TBXA 3HYIA 4BY1J 3W2WA 2BGCA 4L5EA 1X1DA 1L3LA 3PIPF 2DPDA 1FC3A 2EFPA 5LD2C 3BR3A 5K1YA 2JTVA 2DDAA 2JWTA 4I0AA 3SDGA 1RR8C 3V42A 2DT7B 3RJPA 5IPAA 2LY9A 3R61A 5EZGA 2B9SA 2ZFUA 2FQ4A 1G6NA 1PUEE 2VOOA 1QVTA 1TQPA 2JRMA 4I99C 4UV8A 1KQ8A 2DMNA 1GT0C 1U5TC 2E36A 4IEJA 1YW8A 3PQKA 3V7RA 2FQ3A 3V7CA 1SFOJ 4Y17A 4G94A 4NB5A 3AL0C 3FXUA 5TRDA 1VQOI 5K7FA 4G8XA 1V54H 3OL4A 3GTLJ 4LLLA 1Z3XA 3M8EA 1PP7U 4OIQF 2W00A 3RPUA 2K9LA 1UHSA 3JRDA 2IS2A 5GPAA 2M0CA 3Q0VA 2P0WA 3CLQA 1HW1A 4Y13A 1IC8A 2VONA 3EDPA 3S1RJ 2CW0F 1EV7A 3ZQHA 1I39A 3BQZA 2ZJQF 1D8KA 3WTSC 2X6OA 3NAUA 2HI3A 3OYHA 2DXIA 2KT0A 1FZPB 5EZHA 1XGSA 1NHAA 4NHJA 2COMA 5D4RA 3IAS2 5HLIA 3FXKA 5D8KB 4ZZDA 3S14J 4HDVA 4E7JA 3DEUA 2GM4A 1SD6A 4IF4A 2VE9A 2TDXA 1BW6A 2QBYB 1FBQA 2KJCA 2ELJA 3LOCA 3QQAA 1SAXA 2A6TA 2MC4A 1BM9A 3A03A 2VIXA 3U9GA 4JBAA 4LGWA 5H6RA 3A0BC 1B9MA 3WGGA 4BQNA 1L0OC 4RB0A 1MBKA 4UXNA 3HRMA 2CQNA 4BKXA 1SEUA 2A3SA 2M1BA 3TKYA 4B47A 3OOPA 3W2AA 3K70C 5M5YJ 4UUSB 3OYGA 4JQFA 4XRFA 1S29A 3FK7A 2D45A 4CCOA 1FBUA 1ONVA 2M0MA 5E20A 2M9HA 4UHTA 2GBYA 1R36A 4F55A 4XIDA 1TP4A 1WGXA 5DYMA 2F48A 1FMVA 4PK4A 1LFPA 2G0EA 4L5JA 1RNLA 2V4JC 2FNAA 4L9NA 2JVHA 3HRTA 5HDKA 2W25A 4BJ5C 3GTKJ 3BROA 4ZYAA 5HNFA 1JTYA 5FRNA 1YS6A 3BWGA 1JKQC 2EWNA 2ME0A 5LHGA 4WK8F 2VKVA 1PVEA 4JX5A 4L18B 5D5VB 2X85A 2OTLI 1USSA 3W2VA 3KE2A 4EM0B 1J75A 5GPCA 4KT6A 4IO9F 3BR2A 4NC6A 4UV9A 4CDGA 1D0YA 1ZG1A 2XGEA 2WTEA 1ITYA 1HOMA 3LL7A 1JHHA 2KRHA 2XRLA 5FKKA 1IGNA 3ZMDA 1OKRA 2CH0A 2K3PA 3UNGC 4I2OA 2DN0A 2UWMA 4CXFA 4BXFA 3BTJA 2WADA 2DK5A 3S2WA 2STWA 1U5TA 4BXXJ 4B3XA 3RQ4A 3KZZA 4ZC3A 1CF7A 2KIUA 1LPQA 3CLOA 1QO0D 4ENKA 3QYFA 4E70A 2IVMA 4XORA 2V1UA 3GBGA 1Y1VJ 4KN4X 3VFZA 4ZYGA 2HVQA 5JVGF 2X1CA 4Q47A 5JVTA 4CCMA 2KL4A 4BHCA 2WBMA 4I76A 4LIVA 3S1NJ 2X48A 4OINF 2GA1A 4CCLA 3HUGB 2AXTC 2MYSA 4ZDOA 3HOXJ 2JA6J 5EG0A 3CCJI 3WGHA 1DDNA 3GLXA 2R7VA 3A1YA 2R3SA 4E7KA 2LTPA 3AG3H 5FGMA 5DCMA 1YJWI 4BBSJ 5FLXK 1SVOA 1UHWA 1CGPA 3L2VA 2CS3A 3WHCA 1YLFA 2D2WA 2XASA 1OYIA 3PNVA 2IT0A 2V9KA 1MSEC 2LLKA 3TBIA 2H6BA 1R49A 4BGDA 1UB9A 2BEOA 2XRNA 2IEKA 5HDGA 4RM3A 3BPXA 2NVYJ 2JUGA 3TOBA 2HOAA 2YPRA 3QPTA 4LK1F 4XRMA 3LSGA 4C2UA 1WH7A 4BQOA 3IP4B 3K6GA 2IXSA 2XGCA 1UJ8A 2FOKA 3FXJA 3CUQC 1RZ4A 2TCTA 1LNWA 4IZZA 3ZPLA 4PJ0C 3WGIA 3T8TA 3WODF 2M8EA 2F5CA 4GFBA 2XB5A 3FK6A 3VYTB 5B5EC 1IW7F 5C4XJ 5K5RA 2HKOA 1YJNI 1S3JA 2NOGA 1VFCA 1USTA 3WTUC 2FD5A 5EEHA 2JK3A 2L7MP 4EGZA 4XONA 3D5RC 1ETQA 2GXBA 3QAHA 2PBIA 1JUMA 2KMUA 1ORKA 2L5QA 2VQCA 3TDZC 2UZKA 4RDUA 2RNJA 4A0XA 2XAGA 1DP3A 3K9TA 1B72A 3ZQ7A 3H0DA 3LSPA 2KZGA 1VQ7I 1LFBA 3TW6A 3F9KA 2DBBA 3L1PA 2F4OB 2NVUB 3ABUA 1MD0A 3CC4I 3F72A 3PQJA 2F5DA 2W7NA 1TT5B 4OU0A 5BPDA 4CCKA 3G2BA 3FM5A 4YIRX 1RR7A 5F27A 4FT8A 4LB6B 4DYCA 3OOUA 3BC8A 4BUPA 1JKRC 4I01A 1SD7A 2MW8A 3Q0UA 1X1PA 2GWRA 2MG4A 3BZ6A 5HODA 1HQCA 2ECBA 2L54A 1JXSA 2DU9A 1TWCJ 3VSLA 3RDIA 4N0BA 4EM1A 5FD5A 3HSRA 1GXPA 2QQ8A 4FQGA 3MMYB 1BW5A 2E7XA 3KIOA 1WHUA 1Z6RA 5A2QK 1X4PA 2VJIA 3TMOA 3S1QJ 3E3VA 1U8BA 4XL9A 4KN7X 2QGUA 1RUNA 1G8XA 2ESHA 1W4MA 3FBIB 3QU6A 1S5LC 3E1SA 3RYPA 2WV1A 1SMTA 1R1TA 1JTXA 3A02A 2EIJH 5M3FJ 1XTAA 1YX3A 4B48A 2V6EA 2HTJA 1P92A 3IV5A 4A3JJ 4UUVA 3BR0A 4ANJA 1FEXA 2X1DA 1MMGA 1JUSA 2CUZA 3PNTA 4NDLA 2AXLA 1ZTRA 3DU6A 4XLPF 1MNDA 2Y0MA 2V9PA 3K4MA 4RGRA 4AUXA 2PJRA 2ZJRF 3PUBA 2QENA 3AL0B 5DD8A 2JMWA 2OAZA 1KU3A 3G1MA 3Q0WA 2YX4A 3K4JA 4U7DA 3MKZA 3OS2A 4OIOF 2H1KA 1HCRA 3F6OA 2COBA 4FTHA 4HLXA 3GZ6A 2WAQA 5CVVA 4XKVA 2K40A 4L9TA 4XLEA 3RKWA 3CCQI 1B8IA 4KMFA 2OQRA 3GFMA 1X1AA 4IX7A 1T98A 3FXRA 3CJRB 1KYWA 2LBFB 3JR9A 1T39A 3I59A 5CKTA 2EBIA 3RYRA 1N78A 1OJLA 2DA1A 3CZ6A 4ZDLA 5D5WB 3F22A 1MBHA 1YRNA 3RKXA 2WAFA 4KMUX 1W7PD 1PDNC 5LLQA 2Z99A 2GQQA 1TWHJ 3G3ZA 1Z9CA 2HGCA 3PFIA 3Q3SA 4YRVA 4IVNA 3MZ8A 1E3HA 4G7HF 4RAGA 5IYBJ 1ETKA 5FKOA 2K7LA 3CQZJ 4DNCA 2HQAA 1W0TA 3EYIA 3BR6A 1F36A 2E60A 1Y39A 2FX0A 2QVOA 1E17A 2E5NA 4XLAA 1YQAA 3CCEI 3HBLA 5HLTA 4IL6C 1ZR2A 3KP7A 4C30A 4P96A 5HS9A 1LE8A 1JJ6C 3DLLF 3QP5A 2KDZA 2D1HA 1M1EB 2IGKA 1MJAA 5ICGA 4FE7A 4IHVA 4KICA 1MBEA 3GTJJ 3C2HA 4EMSA 1JT6A 2HPMA 4EJUA 3WTXC 4NUBA 3EYYA 2ELHA 1JUPA 4A5MA 1J7KA 2JN6A 3BOQA 2FU4A 3Q9VA 2BW3A 1XSXA 1ZN2A 1TWFJ 3KYDB 2GZWA 2H09A 2VLAA 3ZOBA 3E97A 4BEHA 2OV7A 3BJOA 1K6YA 3KP4A 5BPIA 3L00A 1UMQA 3OR1C 4AVPA 1YG2A 1T0FA 4F93B 1R4MB 5J6XA 1YIJI 1O3SA 4V2FA 5C44J 3I4NJ 2R7SA 3QODA 5LHHA 2MSYA 3TO9A 3VSKA 5B3SH 1R00A 4HF1A 1QRYA 2K27A 2Y2ZA 1I5ZA 2ZC2A 5B1AH 3FISA 3J7YJ 3J80Z 3DFGA 2HQNA 1UG2A 2CQ7A 2MBFA 2EIKH 3ZMVA 1RUOA 2LH9A 3ZP5A 5CVUA 1KQ9A 2JQ7A 2EIMH 4M72A 1X58A 2VBXA 4BE2A 3VWBA 3I9V2 3CO6C 1QU3A 4L5IA 3CCRI 1PUFB 1VI0A 2EFQA 1TQIA 1WQ2A 4EJVA 3J81Z 2ZJ2A 3DPLC 1LQ1A 4AC0A 2HKXA 4FCYA 3F6VA 2F4MB 5B66C 2VKHA 1V5GA 3BLYA 2ZXHA 3AFHA 3RTRA 3L9FA 1YHQI 1CQTA 4II2A 5KCMA 1K78B 1ZQ3P 1YITI 1EA3A 3U2RA 3GX4X 1WCMJ 4Z6YA 3H3VK 1YE9A 4LG3A 3A01B 2X51A 3S3OA 4JYKA 2DJIA 1SFEA 2DO7A 4B43A 4ZYHA 4RAFA 3L2UA 1XG1A 3HOVJ 2ISYA 2K5CA 1FSEA 1Y0UA 3FXMA 2IS6A 3S32A 2JPBA 3VEPA 3OR2C 2FBKA 1UELB 4J19A 1ETYA 4HAMA 2D5VA 4IKFA 2X9DA 2HVRA 3OS0A 3OMYA 1T8IA 2UUZA 3CUQB 1HXDA 3R4KA 5D4SA 5LGNA 1HDPA 1VQ9I 2HDWA 2V1NA 4R8HA 5ICCA 4Y15A 1KONA 2NVQJ 1SD5A 5ERIA 1JT0A 3CC2I 3DKWA 5J4VA 2R5ZB 4GYIA 5D5XB 3R60A 4V2GA 4IQJA 1AKHB 2E2JJ 1OCRH 3BJAA 5JR3A 3KPHA 3HHGA 1P4WA 2A6EF 2YU3A 5LRRA 2K4JA 3OYJA 5KAFC 2QSHX 2VT2A 3LSTA 1FOKA 4XLHA 4IRIA 3GTGJ 3K10A 2XV4S 2O0YA 2UV1A 5CJ9A 4XRSA 4ESJA 3HOUJ 3DLAA 1GXQA 3GF2A 3KP6A 2CSOA 4A5NA 4PGHA 2O3FA 4J00A 1X1BA 1R23A 1K4SA 3K7AJ 2JVGA 5FD6A 4PSWA 2QEXI 2IA0A 2Y0SA 3K4KA 4FX0A 4QPOA 4FHTA 4E7LA 2VJ5A 1FBSA 2P6TA 4NQWA 4EJOA 4BAYA 2CWEA 5ILVA 1T6SA 3ISPA 3JAMK 1IAWA 2HQRA 4M9SA 4B09A 5F1RA 2RC4A 2XROA 1H8AC 5L3BA 3DWLE 3OYIA 2L9SA 3KZIC 3C2BA 4EEFG 2E1NA 4MFEA 3W6VA 2RQPA 3ML6A 1P9QC 1U9NA 3ZMSA 3IRRA 2BVLA 3RCOA 4IHSA 3DPUA 4ESBA 4OIRF 2LFBA 3SZPA 4A3CJ 2M5WA 2AQFA 2WWYA 2ZSIB 5GAHJ 2KJBA 3I55I 3GFJA 3FZVA 2NS7A 3F23A 1DU6A 2MH9A 4BU2A 1FLIA 4BEHB 1GVDA 1V3FA 2VC1A 4H4KC 2DDBA 4M3DA 2GXAA 2DFIA 2KPMA 3DBLB 4CA0A 2Y0SN 1WWXA 1RETA 3DEWA 3IWFA 2GOMA 2VXDA 2NAZA 4XOPA 2HOTA 2ZXWH 1VQ8I 1LJ9A 2R7FA 2ECCA 5M3MJ 5CLSA 3HIFA 1TL8A 3H9QA 4LG0A 2K02A 2MFZA 3ZRGA 4ZJZA 2E7WA 2M30A 1R5ID 3C2GA 2BHZA 4UY8I 3CJNA 2MC3A 3MCZA 5E3OA 4BE1A 3BZKA 1P7JA 2HR3A 3M8JA 1QQIA 2KQRA 4P1WA 5L3EA 4HOBA 2LKXA 3VODA 1D0XA 4KT5C 1BC8C 4V19K 1Z77A 3RKYA 5J8CA 1G3WA 4BH9A 1YW9A 3HOSA 2ZBKA 3KP5A 4RB2C 1KU2A 4FETA 2MLGA 2P6SA 1FP1D 4BL0B 5LBQA 1U8RA 4UVBA 3KEQA 3T0YA 3I58A 1ETXA 1WJBA 1IUFA 3K4LA 2E1OA 5BMZA 3CMMA 1XC5A 1ZYRF 4XKWA 2RNGA 3CCYA 4HW0A 4M6XA 2MGQA 2OTJI 2Q2EB 2P4WA 3FIWA 2PMZN 2ZMEA 3F8FA 2QZ8A 5H6QA 3SZTA 1JGSA 4HLYA 2KIQA 1I50J 1ZG5A 1S7OA 4BNCA 3WTTC 3DTIA 2AHQA 3FM3A 1X3WB 2L2OA 1FNNA 1VQ4I 1TNSA 4MTEA 2F5FA 2OCCH 2ZFWA 5J47A 1OQYA 2ID3A 2V7FA 2H1LA 2NXNB 5HOOA 1N25A 2WAEA 2W85A 4MO7A 4XOTA 4LJZF 3K0LA 4ZTJA 5JHUA 2DMTA 1B9NA 3CF5F 2MA3A 3G73A 4S0HB 2WC2A 1I1SA 2VKEA 1BBYA 2HFHA 3ZMTA 3W3CA 1R71A 3GTPJ 5EEGA 2IS1A 2F2EA 1V4RA 2GAUA 3LAJA 2VASA 2L02A 2W1OA 5E3NA 4E7IA 1IRZA 3ZR8X 3BQYA 2CGPA 4RS8A 3SFIA 4B8XA 3JRIA 4UVCA 3MZHA 2QQ9A 3DXJF 3ECOA 5DM6F 3Q9SA 4RM2A 2E2HJ 5JI6A 2CFXA 3HPHA 2K86A 3CC7I 3IHUA 1TQMA 2CU7A 3BCAA 4DGWB 2P8TA 2EFWA 1AU7A 1XGOA 2XSDC 3TL4X 1OFCX 3KP2A 3S8PA 1WKMA 4I0BA 3V8JA 2N8GA 2K85A 5HNHA 3M1EA 3F21A 1QPIA 3H36A 9ANTA 2A68F 2NOJB 1KU7A 4MNUA 4D7NA 3GFIA 2OBPA 2LOOA 5CVIA 2LF8A 5TGTA 4JX4A 3QYEA 2JA5J 3G4SI 3FMQA 4M9XA 2Y75A 1KZHA 2R5YB 3E6BA 4F3QA 3D5SC 2V1XA 1QPMA 5KVRA 5CYVA 3BCBA 1RESA 1VQMI 1JJ8C 2ZXIA 1H0MA 2BY1A 4KA4A 2CV1A 4BHPA 3AG1H 2V79A 3EUKL 1HLVA 2PMHA 4HF0A 3LWFA 3IC7A 2QLZA 4AYBA 2HDCA 3RI4A 4FASD 1IV6A 2XHKA 4CICA 4B3AA 5IT9K 2XPVA 2FA5A 4HYEA 2XUBA 3P9CA 3WU1B 2DODA 3GCMA 1DP7P 1J5YA 4RB3C 2XAHA 2P5KA 3CESA 1ZR4A 3H3UA 4N4NB 4QSHA 1ZLKA 3BPVA 3PUFA 4DZPA 2QYOA 3NWSA 1ZG3A 2JT1A 4S05A 3WE3A 4E4HA 1FWZA 3ERED 4DQ2A 5LRSA 1R4NB 1TT0A 2PEXA 1BIBA 2IGMA 1HBXG 4EVIA 3WTZA 2P7CB 2E5ZA 2VXZA 2LF7A 2P7VB 3KZYA 3DKYA 3SYTA 1O3RA 4W97A 1MGTA 1OMIA 2W24A 2XKOA 3CMEI 2ACJA 3M8FA 5IYCJ 1AA7A 5DCFA 5J4YA 1MH4A 3K69A 1OCPA 3FF5A 4QIWN 1LDKB 4QPQA 1VZ0A 4CCNA 3ZN1A 1SC7A 1T2KA 3K2ZA 2MD0A 2VJJA 3N97A 1MBFA 1Z3YA 1QVUA 1LUJB 4KUMA 2RDPA 4AYBN 4P9UA 3BR5A 1S9HA 3GYHX 4C2MJ 4EGYA 3OV8A 1WJ5A 3GTMJ 4A0YA 2B0LA 5HVQC 2Y69H 1T33A 2NVTJ 1STZA 4IHTA 1R1UA 3JCUC 4XN0A 4AIHA 5F6FA 5J1RA 1DPRA 3FBNB 3ULQB 5LHIA 1ZHFA 3ASOH 1F5TA 3GZ5A 5DUKA 2HYJA 1FY7A 3ASNH 2JA2A 1GDTA 3BTIA 3IL2A 3H9GA 1J2XA 3RIRA 1NK3P 1BIAA 1U9OA 2XSJC 1IRXA 3BTLA 2HS5A 5J3LA 5C4JJ 2LK2A 2ZO4A 2M3AA 4OMZA 1W5TA 1ZGAA 2DYSH 3BG6A 3MD2A 2D1VA 3OYLA 1X3UA 4R1HA 4U0VA 4IHYA 3TP3A 2DLLA 4D1QA 2EA4A 5IP6A 4KNYA 3TDUC 5L3FA 1BJAA 2CO5A 2V6CA 3CJTB 2Z5UA 3VPRA 1VQLI 5IP9J 2F5EA 5K7HA 2IJLA 2YS9A 3LA7A 1WI3A 1XS9A 2K9SA 1A6IA 1ZK8A 4ENMA 1Z6TA 3S3NA 3HOWJ 3MWMA 3CCLI 5AIQA 4Y7NJ 1A6QA 1SAUA 2KISA 3EUAA 3SXYA 2LG4A 3HSEA 1QHGA 2ZNYA 1I1GA 3E6DA 2QKMB 6PAXA 3F3XA 4YG2F 2HXOA 3B73A 3ZN0A 2A69F 3VYSB 4HPQA 4KIFA 5HLGA 3HB9A 1S8NA 4OOIA 1A31A 5E79C 3ERMA 4Q48A 5FKLA 2P5VA 4E7ZA 2YU9J 3N05A 5LEJA 2OUMA 1EH8A 2AO9A 4KIGA 2A6HF 3FMSA 1G59A 4P5OA 3UKGA 1FTZA 1ZLJA 3BP8A 4BJTA 4CO8A 3WTWC 3GZNB 3K4CA 4MEYF 1MIJA 4LITA 2HPIA 2HVSA 2EPFA 4HZFA 2XGDA 4CYCA 1XMKA 1T0FC 3QU3A 4IOCF 2CV0A 2ELKA 2FSWA 1S7EA 3SDBA 1D1AA 1U5TB 4U0YA 1A35A 3HTUA 5F1JA 1ETOA 2H6CA 1CF7B 1FT9A 5GADJ 1LEAA 1D5YA 3L2CA 1WJFA 3K1MA 1B59A 2QUFA 5KNLA 4WXDA 3O8HA 1AWCA 3JRCA 1OISA 2YUSA 5FLVA 2VODA 2OCEA 3BDDA 1FMWA 3SQNA 4PCQA 1UAAA 5EJCA 2E35A 4Q4ZF 2RAEA 2PG4A 5EG0B 4RGSA 4L9JA 5DDGA 4G6TB 3WTYC 1B1BA 2O8KA 3NQOA 5IT3A 2BXYA 4L0YB 4PGGA 1MDMA 1MMAA 4FE4A 5DCMB 4LK0F 3PSIA 1MSFC 1T38A 3OIQA 1FOWA 4YIFA 4QTRA 4EJTA 1LFUP 1FYMA 3AG4H 1JHFA 5EGOA 1ZAOA 1POGA 2QWWA 4PDKA 2DFFA 1FP2A 3H9JA 1BI0A 2HDDA 2VQGA 4BS9A 5EF6A 1W7PA 3HEFA 2JUCA 3VYRB 5KK1A 2OPTA 1I6HJ 1VQNI 3GLLA 3DBRB 4HRIA 3OYMA 2DQLA 4D5CA 1FJLA 4OAYA 3CCVI 4HQMA 3S16J 2VN2A 4ITVA 3P5JA 4ENNA 2EINH 4HEA2 1WZ2A 1OYWA 3LAPA 1UHMA 5M5WJ 3J7AY 2QCOA 4YFXF 3HKZA 5LGUA 5D6EA 4LOCA 4IHWA 4H0EA 1N77A 1VQ6I 4HSTA 1UFMA 4XKCA 1MNEA 3CCMI 2X1EA 2ZKZA 2LDUA 5FO5A 3F8CA 4U88A 2FBHA 1V5FA 3IUOA 2LY2A 3A2KA 2CUEA 1WJCA 3HGYA 1IN6A 5LFAA 4WF2A 4RGXA 4A3KJ 2XAFA 4GO1A 1A5JA 1HKTA 2O7OA 2KRFA 2LSOA 5FRMA 2DOAA 2TRTA 1HF0A 3DU5A 3OYAA 3S2DJ 1FYKA 3U1DA 3LSMA 4G6QA 4M9ZA 3HRSA 2DT6A 1IRFA 3GXOA 3FX3A 4P9FA 1FOYA 1B72B 3I3LA 3CDHA 4M71A 3I64A 3ZQQA 2DK8A 3O8GA 5FROA 4A3FJ 1BR1A 5K5QA 2HQ5A 2XF5A 4AVZA 1W36D 2VBYA 4BJ6C 1E3OC 3HKZN 3E6MA 3JSPA 5EDNA 2DI3A 1R9TJ 4X1EA 4YFNF 4A6DA 3S3MA 3V8KA 2BBYA 1TZLA 4MQ9F 1OYYA 4MIMA 1K4TA 3M7GA 2BE5F 4O6JA 3HSFA 1QZZA 5LGTA 2DTRA 2LC2A 5E1WA 2VI6A 5F0CA 2IW5A 4LLGF 1O3TA 3MAJA 3ABKH 5ICFA 3CDIA 4D7MA 4MFDA 3S1MJ 1JI8A 1TNTA 4WXHA 2V1DA 4M73A 4U7BA 2EK5A 2GXGA 3IKVA 1F9NA 1NG7A 1REPC 3L2QA 1WVRA 1OPCA 2ADUA 3JRAA 4WXCA 3QRFF 1LEBA 1X1CA 2CQQA 1ZGJA 4Z2YA 2I10A 4UB6C 3W6KB 1XCVA 3OYDA 1DQUA 4HNTA 4U0WA 4PJJA 5L3GA 3RPQA 1IDZA 3LFKA 1ETVA 3HXLA 4A69C 1MMSA 2LREA 4DJAA 4I7HA 3KYLA 3FXLA 3G6EI 1Z91A 3B02A 3PO2J 4Y52J 2VL8A 3TOAA 2PJRB 3DP7A 2W4SA 4JK1X 1SVMA 1SVLA 1F1ZA 1W0UA 4ABZA 4RGUA 3QP6A 4HX4A 2FNPA 3JRHA 2XIGA 1D0ZA 2PQ8A 2R7ZJ 2J5OA 2NRAC 1UCRA 2L7ZA 1BJZA 1R22A 3OYEA 3KCCA 4YIIA 1B8IB 2KFDA 3BY6A 3M9AA 3PNYA 3I54A 3CP2A 2FEZA 2OZ6A 3I59B 5A2QZ 4RBOA 1QHHD 2ZXJA 5LEKA 3R6SA 3LA3A 3TQNA 3ZMZA 1AHDP 5TISC 2IS4A 2H8WA 5J1UA 3I0TA 2M4KA 3DPTA 2VPRA 1R1VA 2L9VA 2BOLA 3HTSB 1YRNB 3LQQA 2JSPA 1KGSA 3LSKA 1K6OA 4QLCU 2QBYA 1S6LA 2L4AA 2AS5F 5ILSA 2FMLA 4HQEA 3RKQA 2LRDA 2QM3A 1J0RA 2HYGD 3LFUA 5B1BH 4KYWA 2FBIA 2L4MA 4ZYDA 3FKIJ 2IGOA 2P81A 1WI9A 3GEZA 3IH2A 1VNDA 2ZMEC 1EF4A 2ID6A 1SFUA 3E0JB 1PJRA 4OWRB 5EEAA 4HSRA 4UB8C 2X6WA 1IV8A 1Y8QB 4PZJA 1JKOC 4JOMA 1I6XA 2WY7Q 2VQLA 3A0HC 3KLNA 4XICA 1RRJA 2CMPA 2DQRA 2XKPA 3H5RA 3HPGA 2WB1N 4XNFA 4UUSA 4DZJA 4CYDA 1XGMA 1XSVA 1TC3C 2EILH 1HA8A 5C3EJ 1NH3A 1LE8B 4RA2A 1H9TA 3QYBA 4ZTFA 4CZCA 3PFYA 3AG2H 3RQIA 2JA7J 2KIFA 2KZVA 2MLKA 2WV0A 4Y33A 4J01A 3CD6I 2XVCA 3GFLA 3KFWX 4XM3A 4C9YA 4GDFA 3O2PE 1A36A 4KDPA 2NNNA 4BE0A 4M6YA 1OR7C 2F4IA 4KISA 4GCVA 2BW3B 2XF7A 1GV5A 1X2MA 3RZDJ 1ZARA 2WA0A 2V9VA 2RKHA 1FOXA 3O6BB 4EATA 1PYVA 4XK4A 4C3HJ 3OSGA 1SANA 3CTAA 3L7WA 2L7FP 2A5WA 2QA4I 2EH3A 1X4OA 1FIAA 4I09A 5ICEA 2VUMJ 3NEUA 1E2XA 2EV6A 4HDUA 4G6DA 2CQKA 2CG4A 5BQTA 1MH3A 3DEEA 1JGGA 1XN7A 1HW2A 4A6EA 2VJ4A 5BNGA 3MEXA 1QNTA 2A05A 2PMZA 3ABLH 4C2TA 3I53A 1RKWA 2G7UA 4C3JJ 4DW6A 3QPHA 3PM1A 2HZTA 1X19A 3SHFA 2XDVA 1KYZA 2YSRA 3K1NA 4A3MJ 4OMYA 2CFOA 4G7OF 1TWAJ 2IBDA 3VDXA 3QPSA 2VBZA 2BY0A 4MLOA 1TWGJ 2JSCA 4BQQA 2A07F 3HUGA 3K4BA 2DFHA 1VF9A 5K5OA 4RLQA 2E19A 1FPQA 3FWEA 2X6YA 3F8BA 1I3AA 2IA1A 4XR6A 4BACA 4LD5A 3LSRA 2STTA 2A5YB 2KP6A 5FLMJ 3CMAI 3HHHA 1X2NA 2FXAA 4BDYA 2NS0A 3M07A 1A04A 2BZTA 3R0AA 2PN6A 3COAC 1Y8RB 4L0ZB 5E1ZB 1MJBA 1O7FA 1GUUA 2L9RA 4I6ZA 1JKPC 2IP2A 1HC8A 1FX7A 4YEJA 1WFXA 4ZH4F 3OL3A 2LNBA 4CZZA 1SMYF 1IDYA 3ZMUA 3V7SA 1RKTA 2Y31A 1KQ0A 3RPUD 5E3LA 3AAFA 2E34A 2L7KA 3H1CA 2JZYA 1HSTA 2CJJA 3G1LA 3WTVC 1K7AA 1YOVB 1BI2A 1IXCA 3ZQCA 2PX9A 1ERDA 3M3YJ 1TW3A 1QZYA 1R58A 3EPZA 2NS8A 1FYLA 5DD4A 2JA8J 2CW7A 4R79A 4D5FA 2Y9ZA 3DF8A 1B6AA 5GAEJ 4F52A 2BXZA 3KEYA 4NBQA 3WG9A 3REOA 3FXQA 3H3ZA 5JFRA 4D9JA 4DOZA 2DAOA 5F0HA 2XPWA 4QWQA 4RLFA 3U1KA 4EM2A 2R4GA 1BL0A 4PJMA 2OQGA 4KFCA 2F5VA 3ZGKA 2R0QC 2VBWA 1OR7A 4N4OB 4JP0A 4HF2A 5HS7A 4O5VA 2K9QA 1XMAA 4GGGA 3OYNA 2NYXA 3EUHC 4CH7A 4LB5A 2P5LC 1H89C 5E8IA 2HOSA 2L9NA 1XDUA 5AIPA 1Y56A 1Z7LA 4HNUA 1S72I 2YR2A 3KEOA 3GW2A 2RVCA 1IN4A 5ED4A 1XPXA 4KITB 5H2FC 1FTTA 3LNQA 2OJED 1D8JA 1NG6A 1WJEA 4NQWB 5ILUA 2DMQA 4KJZA 2HTSA 2ETHA 2BY2A 1HSJA 2VC0A 3M4OJ 3CJQB 1YJ9I 2LYCA 1LKXA 2K3FA 4Q5SF 2VT3A 2OZUA 4L9VA 2W57A 2DOFA 1XGNA 1O4XA 1MKMA 2M34A 4TV7A 4AU7A 4CUGA 1KA8A 2FE3A 3OYFA 2E2IJ 1U78A 5CQEA 4A0ZA 3ZQIA 1P7IA 2DTZA 2ISZA 2OU2A 1GV2A 3N4MA 1TW2A 4CSWA 2M8GX 1XX5A 3B6AA 1XDSA 4HX8A 2RV8A 5BOXA 2EB7A 3ABMH 4PFOA 2XB0X 3LSJA 2VOPA 3HRUA 1J09A 2MD5A 2ESNA 2XPUA 1TTYA 2NNYA 2ZJPF 2M2EA 3UR3C 3OIPA 4DYQA 2PI0A 1WJDA 2VB6A 4DBQA 2DT5A 3S17J 4LG0B 1EJ9A 3BTCA 3JSOA 4ZDPA 3HDDA 1MZBA 3MN2A 2BY3A 3PJRA 3ESWB 3OIOA 2EZLA 3I71A 1DUXC 3JAMZ 4GYGA 1K83J 3CCSI 1BA5A 5DV5A 5AONA 1YFHA 4B44A 2KIMA 2Q0OA 2O5RA 2R7WA 2Y48A 4AM3A 5DM7F 3RZOJ 1BI3A 4JX6A 2X0LA 4IQ4A 3DBHB 3LQRA 5K7ZA 4G7ZF 2Z1DA 3B6CA 4LIUA 4M3EA 4U87A 3WU0A 1SFXA 2EV0A 3HZJA 1FSHA 3J7AO 3Q5FA 4ETSA 3JREA 4BXUA 2HNHA 3J7ZI 2DA3A 4A3GJ 2LBFA 3O3KA 4M3GA 5FFXA 1W5SA 3MVPA 1YW7A 3CUOA 1UG0A 1IXRC 2IPQX 2XAQA 4OIPF 2FMYA 2G7HA 3DCFA 1LVKA 3JTHA 3W6JB 3F0CA 3MQ0A 5HS8A 1HKSA 3NWTA 2ZMEB 3DTEA 3EUHA 2JPCA 1RPWA 3V4GA 2LD5A 2DFEA 3GMEA 1IXSB 3OWTA 2EZIA 4LMYA 2F6CA 4M3BA 5IOYA 2M7BA 1V55H 2E1CA 4F91B 2R7TA 1ZH5A 1IJWC 1LDDA 1RC9A 1D1CA 2DA4A 1W1WE 3EETA 3FHZA 3BG3A 1ZGWA 3K70D 3J80K 1EKEA 4BHBA 1JE8A 1ZREA 2Q1ZB 4ON0A 3ECHA 4IRHA 4X0GA 1G2HA 1BR2A 2KDOA 1NK2P 3TGNA 1WRJA 2K9NA 4NC7A 4BY7J 3K2AA 2Y30A 1IO2A 1SD4A 4PFPA 3H5AA 5JHFA 1MW7A 2HEOA 2E1MC 3IH3A 3OS1A 1AOYA 3E5UA 3GWZA 4AIJA 1U6GA 4MEXF 1GLNA 4EV0A 3J81K 3CO7C 2H8RA 5DTDA 2XC7A 4IJAA 1VQPI 3SEQA 3ABTA 3D5LA 1DU0A 2XF6A 5D8LB 2Z3YA 3U21A 1WSUA 2DA2A 3OY9A 4A3BJ 3E6CC 1BOBA 1G4DA 3GVAA 2K9MA 5IY5H 1D5VA 2PFBA 1G3YA 1R5HA 3BJ6A 3M1CA 3P9KA 2EFOA 1QBJA 2HZDA 3EQLF 4MQVA 4AIKA 1OLTA 1B4AA 3FHNA 5J40A 3BR1A 3JRGA 2DPUA 4S04A 5IOZA 3OYCA 3IAM2 4EJWA 4XN3A 3ZQFA 1FIPA 2LKPA 2DYRH 4HX7A 1F4KA 5FB2A 5TJJA 1IZ1A 2ZSHB 1OCOH 4XSZF 1PP8F 4RAZA 3X2QH 3ZQLA 2NVXJ 2M7AA 1T95A 1ZRFA 3RSNA 1J59A 4AD9A 2ZNZA 3MFKA 4I98B 2XAJA 1LDJA 1P6RA 1HKQA 3H92A 4BQAA 3IRQA 2KKOA 3SFZA 1QA6A 3FKJA 3ROUA 1W36C 1R5GA 1YYVA 3QOEA 4HV5A 2Q8KA 1Z1DA 3HL2A 1PUFA 4ZYEA 1YO5C 1G3TA 2EJRA 3KLOA 4UNOA 3KETA 3T8RA 1K61A 3PO3J 3CMYA 1ON2A 2EZHA 5F08A 3T1BA 2C6YA 5KAIC 4BYYA 3CF2A 1LB2A 5BS6A 3K1PA 3HJEA 1W5CC 4HG2A 3HGGA 1BN5A 2XAUA 3D1NI 4NC8A 1K78A 3SJMA 2K4BA 4M3FA 5FJ8J 2VQHA 4PJLA 4RB1A 1R7JA 2R7UA 1I27A 5E3MA 2DW4A 5HLHA 3ZCOA 1Z05A 2HOEA 3A01A 2HYFA 3DV8A 3TW7A 1GHCA 1V5EA 3MKWB 3PSFA 2GIVA 5DS9A 2O9LA 2CRGA 2R7QA 3C18A 3I5UA 4XKBA 3PL8A 1T08B 2M45A 3LMMA 2Z9OA 2GOXB 5L3DA 1C0WA 4EQQA 1QZEA 4PUSA 2B7EA 1VQKI 4UUTA 5F04A 3CUQA 2CUFA 1R6RA 1VTNC 1MMNA 4UVAA 3I4MJ 1Z7UA 1XMXA 1XB4A 1IN8A 4O3MA 4A3EJ 2HWVA 1ETWA 3OSFA 4DIQA 2LKSA 2KLOA 2R5ZA 3KX2A 5GTIC 2BVMA 4IPAA 4XRSG 3WHBA 3FDYA 2O61A 4FISA 3BZCA 1H9GA 1AKHA 3R0JA 3HC7A 4RMNA 2IGNA 2QQAA 4A3IJ 2BYVE 2OF7A 4GXOA 3BG9A 2LMDA 3CCUI 5GP9A 2L3DA 4LLNA 2M4GA 2DMPA 4G9YA 5CVRA 5L3CA 4GRIA 5IT9Z 4E7HA 4RAYA 1OCTC 3T5XA 4M6VA 1DPUA 1ENHA 2LR8A 2IRFG 1XCBA 1SFKA 5JLXA 4ZZLA 2H94A 3C3WA 3L09A 3MZYA 2R7DA 1XD7A 3JRBA 5M5XJ 1HDDC 3JRFA 1J9IA 2W48A 4II3A 3DTKA 4LFUA 3HG9A 2ZCWA 1WJAA 2AQEA 3P7NA 3ONQA 2BHYA 5FLXZ 1EH7A 1ZRDA 3TO7A 3IKTA 2WAQN 3L2RA 5J8FA 5D5UB 2CUJA 4MGRA 1G3SA 5CVJA 2E71A 4I02A 4NNJA 3F8NA 1Y0NA 3S2HJ 1Q1HA 1YIOA 3LSIA 4DYRA 1OCZH 1MBJA 5F0FA 1ACIA 1MMDA 1EH6A 1Q1VA 3MKLA 1Y1WJ 2GLOA 3WE2A 3PIOF 4A93J 2EZKA 4WX9A 3K4NA 5EYRA 4XQFA 2B63J 4Y4RA 2FRHA 1XSDA 3QOPA 2X4HA 5F64A 3WU2C 1Y6IA 3JTGA 1U2WA 4PJNA 4XBFA 1YTYA 4AWXB 3BG7A 2R92J 3E7LA 5D6FA 4KIBA 4XLCA 2A61A 1BI1A 1U0JA 2DMUA 2PMUA 2R7XA 3SEZA 1APLC 3E5QA 1Z0XA 3CDLA 5GTHC 3QWLA 1D1BA 1HW5A 5HDNA 5JLWA 2Z33A 5FKNA 4E7SA 4W1UA 2JJ7A 5H20A 2IA2A 1TLHB 5IP7J 2DOEA 2ME6A 2QKLB 4YFKF 3I56I 1IRGA 2OD5A 2WY8Q 4BDZA 2PLYA 2ZB9A 4WWCA 2FF4A 4A12A 1ON1A 2OC6A 4ESFA 3H5NA 4CYCB 1BOAA 5E1XA 2YX7A 2J5PA 2M87A 4F7ZA 4HNVA 3VB2A 2DA5A 2Y9YA 1N75A 1IN5A 2O6GE 4C3IJ 3OYBA 1Z67A 4P55A 3C1DA 4MTDA 4ENJA 1ZRCA 2GA2A 3S15J 5CQGA 2KHMA 4IHXA 4K2EA 2XGXA 4OAZA 3ZQGA 4XSXF 1ZELA 1ZKGA 5GAGJ 4HA8A 1IG7A 2RN7A 4WCGA 2ICWG 3A4CA 2WB1A 1ULYA 3NARA 1DGRM 2RQQA 3TP0A 4N9HA 4E6KG 3HOTA 3BG5A 2CV2A 3GUDA 2GIZA 2Q2EA 2DJNA 2DA6A 2DA7A 3GTQJ 1MDMB 2VPLA 1K79A 3BT9A 2QQBA 2EV5A 1QGPA 5CPRB 3SZGA 2JRTA 2IAIA 3LA2A 1IUYA 4CCJA 1E0EA 3HM5A 2EQRA 4HBLA 4A2UA 2CQXA 1GVJA 2R7RA 1ODDA 3GO5A 4D0PA 2HU9A 1S7AA 1WH5A 3E5XA 5EGOB 1I3QJ 2O03A 1YS7A 2FUG2 4AIDA 2CW8A 5DUIA 3IH4A 1W7PB 1KU9A 3I4PA 4HV6A 1P2FA 3G1OA 3IWZA 4CHUA 2BV6A 2E1MB 1MJ9A 2OA4A 3GTOJ 1P4AA 1RI7A 3S93A 2MABA 1E3PA 3LSHA 2LP0A 4A3DJ 1U3EM 2LVSA 1O57A 1RIOH 1O7LA 3DKXA 4G12A 2O8XA 2L0KA 2RGVA 4X6AJ 3ELKA 3P9IA 3ZXSA 1X3ZB 5FFZA 1MNMC 2G9WA 2MH2A 3VYUB 2RREA 4Y3OA 5FKMA 1WPKA 2X6XA 1D3YA 3HOZJ 2VKDA 3VOEA
chains in the Genus database with same CATH topology
3EUHC 4CH7A 2IGKA 4D1QA 2L9NA 3OYKA 4HNUA 1Y56A 1Z7LA 3CP8A 3C2HA 3L2WA 2HPMA 3MKYB 4NUBA 4KITB 1NG6A 1DGWY 1WJEA 4NQWB 4KJZA 2W82A 3S3NA 1BR4A 2I8DA 3CJQB 2LYCA 1LKXA 2BW3A 1SAUA 4XMYA 3EUAA 2VLAA 3H35A 2LG4A 4PSXA 4BEHA 4YELA 3AKZA 1QHGA 2OV7A 1K6YA 2QKMB 4AU7A 3OR1C 4CUGA 4F93B 3VYSB 4HPQA 3DQVC 3OYFA 2R7OA 2R7SA 3QODA 2Z2SB 2KRCA 5CQEA 3VSKA 4E7ZA 4DBRA 3N05A 2LY1A 2OUMA 2V26A 4CSWA 1G59A 4P5OA 5KHDA 4BJTA 1YX5A 2Z16A 3K4CA 4XLFA 2DCEA 4PFOA 2LH9A 1Z21A 4LITA 4F92B 2HPIA 2HVSA 1T0FC 1J09A 4BE2A 2CV0A 3VWBA 3I9V2 1QU3A 3W2WA 3SDBA 3UR3C 1D1AA 1X1DA 3DPLC 3OIPA 1WJDA 2VB6A 2VKHA 4DBQA 1V5GA 3BLYA 5LD2C 1WJFA 4ZDPA 2ZXHA 3AFHA 3PJRA 3RTRA 5KNLA 4II2A 5KCMA 3V42A 1EA3A 2DT7B 4B44A 2O5RA 2R7WA 1YE9A 1FMWA 2ZFUA 4LG3A 2X51A 3S3OA 2DJIA 1UAAA 4B43A 3L2UA 4IQ4A 2Z1DA 2K5CA 4LIUA 4U87A 2IS6A 4G6TB 3S32A 3OR2C 1MMAA 2HNHA 1UELB 3AL0C 2LBFA 3PSIA 3OL4A 4IKFA 1Z3XA 3OIQA 2HVRA 2W00A 3OS0A 3OMYA 1UG0A 2K9LA 2UUZA 2IS2A 2HDWA 2P0WA 2V1NA 1KONA 1LVKA 3H9JA 2VQGA 4BS9A 3VYRB 3NWTA 3DTEA 3OYHA 4C30A 2DXIA 3OWTA 4HRIA 3OYMA 4IQJA 4OAYA 2F6CA 4ITVA 3IAS2 2M7BA 4HEA2 2R7TA 4F91B 4E7JA 3OYJA 1D1CA 3J7AY 3HKZA 3K70D 2Q1ZB 4XLHA 1N77A 4X0GA 4HSTA 1BR2A 2KDOA 2ELJA 2UV1A 3K10A 4NC7A 3DLAA 2A6TA 2MC4A 4PFPA 3H5AA 2VIXA 5JHFA 1MW7A 2E1MC 1MNEA 4XKCA 3OS1A 1X1BA 4J00A 2X1EA 4BQNA 1GLNA 2JVGA 4PSWA 1V5FA 3IUOA 2LY2A 3A2KA 2Y0SA 3K4KA 2XC7A 1WJCA 4QPOA 3SEQA 5LFAA 3D5LA 4E7LA 2VJ5A 2XF6A 3U21A 5FRMA 2DOAA 4B47A 3OY9A 3DU5A 1BOBA 3OYAA 3K70C 3W2AA 3OYGA 4JQFA 3LSMA 2K9MA 2DT6A 4CCOA 3M1CA 2M0MA 3DWLE 3OYIA 2L9SA 2HZDA 4F55A 1OLTA 3I3LA 1FMVA 4PK4A 1LFPA 3FHNA 3ZQQA 1P9QC 5FROA 1BR1A 2BVLA 2V4JC 2XF5A 3RCOA 2JVHA 4AVZA 3DPUA 1W36D 3OYCA 3IAM2 4BJ5C 4XN3A 4ZYAA 5HNFA 5FRNA 2AQFA 4BJ6C 2ZSIB 3S3MA 2ZSHB 1TZLA 2M7AA 1T95A 2X85A 3RSNA 3W2VA 4KT6A 4BU2A 4BEHB 1D0YA 4H4KC 2LC2A 3LL7A 2KRHA 2KPMA 4CA0A 2CH0A 3UNGC 2K3PA 3FKJA 1W36C 1JI8A 3QOEA 2UWMA 2GOMA 2VXDA 4BXFA 3HL2A 4XOPA 4U7BA 2WADA 1NG7A 4B3XA 3RQ4A 4ZC3A 3L2QA 3CF2A 3H9QA 2MFZA 3ZRGA 4ZJZA 1X1CA 4HG2A 3QYFA 3C2GA 4XORA 2XAUA 4NC8A 3GBGA 2VQHA 4PJLA 3OYDA 2R7UA 1DQUA 2HVQA 4HNTA 2X1CA 4PJJA 3ZCOA 4BE1A 4CCMA 2KL4A 2WBMA 4LIVA 3HXLA 1V5EA 3M8JA 3HUGB 2KQRA 2LREA 2MYSA 3PSFA 4P1WA 4CCLA 4DJAA 3MKWB 3KYLA 4ZDOA 2VL8A 1D0XA 2R7QA 2PJRB 4XKBA 3PL8A 2W4SA 2R7VA 3A1YA 3LMMA 3HOSA 2GOXB 4E7KA 4FETA 4PUSA 3L2VA 2CS3A 4BL0B 1D0ZA 3PNVA 2V9KA 1R6RA 1WJBA 3TBIA 3K4LA 3CMMA 4BGDA 1MMNA 3OYEA 4XKWA 2RNGA 4RM3A 3PNYA 2Q2EB 4DIQA 2KLOA 3KX2A 3CP2A 2BVMA 2JUGA 4C2UA 1QHHD 3LSGA 3FDYA 4BQOA 3IP4B 2IS4A 3HC7A 4RMNA 2IGNA 3K6GA 3DTIA 2IXSA 2M4KA 3DPTA 2L2OA 2BOLA 2M4GA 4IZZA 2JSPA 3LSKA 2V7FA 4GRIA 5HOOA 2WAEA 2LRDA 3VYTB 4E7HA 3LFUA 4XOTA 4ZTJA 2IGOA 1SFKA 3E0JB 1PJRA 4OWRB 4HSRA 2X6WA 4II3A 4XONA 3D5RC 3DTKA 3HG9A 3W3CA 1WJAA 2IS1A 2AQEA 4JOMA 2WY7Q 2VQLA 2VASA 2W1OA 3ONQA 2KMUA 2VQCA 2L5QA 2CMPA 4E7IA 3H5RA 3ZR8X 3HPGA 4XNFA 3L2RA 2CUJA 1HA8A 1DP3A 3QYBA 3H0DA 4ZTFA 4NNJA 4RM2A 4CZCA 3F9KA 3PFYA 3HPHA 3LSIA 3BCAA 4DGWB 2KZVA 2W7NA 4Y33A 4J01A 1MMDA 3TL4X 4XM3A 3S8PA 4CCKA 3G2BA 4C9YA 5HNHA 4BE0A 3K4NA 4XQFA 4Y4RA 2NOJB 1OR7C 2F4IA 4KISA 2BW3B 2XF7A 2LOOA 3OOUA 1Y6IA 2WA0A 3BC8A 5TGTA 4BUPA 4PJNA 3QYEA 3BG7A 1PYVA 4EATA 4XLCA 2A5WA 1U0JA 1X4OA 4F3QA 2R7XA 3SEZA 3VSLA 3D5SC 3MMYB 1D1BA 3BCBA 1X4PA 2VJIA 3DEEA 3TMOA 4E7SA 4XL9A 2VJ4A 2ZXIA 2CV1A 2PMZA 2QKLB 1G8XA 3EUKL 4C2TA 3FBIB 2WY8Q 3E1SA 4BDZA 4AYBA 1X19A 1YX3A 2XDVA 4FASD 4B48A 2V6EA 2OC6A 3H5NA 2CFOA 3VDXA 4ANJA 4MLOA 2X1DA 1MMGA 2CUZA 4BQQA 3PNTA 3CESA 4N4NB 3K4BA 1N75A 3DU6A 3NWSA 3OYBA 1MNDA 3K4MA 2PJRA 4E4HA 4RLQA 3PUBA 3AL0B 2X6YA 1TT0A 4XR6A 4BACA 2IGMA 5CQGA 2E5ZA 2KHMA 2VXZA 3K4JA 3DKYA 2KP6A 4OAZA 3SYTA 3OS2A 3MKZA 1ZELA 4BDYA 1AA7A 3A4CA 2WB1A 2WAQA 1DGRM 2RQQA 4XKVA 4E6KG 1LDKB 4XLEA 3HOTA 2CV2A 4QPQA 1VZ0A 1X1AA 4CCNA 4IX7A 2VPLA 2MD0A 3CJRB 4YEJA 2VJJA 2LBFB 1Z3YA 1WFXA 5CKTA 5CPRB 3OL3A 3SZGA 4CCJA 1N78A 3CZ6A 3RPUD 1E0EA 4ZDLA 1S9HA 2L7KA 2R7RA 1WJ5A 2HU9A 5HVQC 1ERDA 2WAFA 2FUG2 2CW8A 4XN0A 3EPZA 3FBNB 2CW7A 4R79A 2E1MB 4YRVA 4F52A 3S93A 2MABA 3LSHA 3KEYA 4D9JA 4DOZA 2JA2A 4RLFA 3DKXA 2R4GA 3H9GA 2HQAA 4PJMA 3ZXSA 2F5VA 2E60A 3ZGKA 2XSJC 1IRXA 2E5NA 4XLAA 3VYUB 2RREA 4Y3OA 2M3AA 4N4OB 5HLTA 3BG6A 3MD2A 3OYLA 2X6XA 2VKDA 3OYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQH A;  2VQL A;  2VQG A; 
#chains in the Genus database with same CATH topology
 2VE8 A;  3TED A;  2H27 A;  3D0S A;  3OYK A;  2W84 A;  2R93 J;  1UZC A;  2FOW A;  1LVA A;  2UXN A;  3CP8 A;  3NRV A;  5J1Y A;  3L2W A;  3JW4 A;  3MKY B;  4B1R A;  2EA2 A;  3FXO A;  4XLN F;  1DGW Y;  1BC7 C;  2W82 A;  5IYD J;  1BR4 A;  5E8G A;  2I8D A;  2L01 A;  3KYC B;  1F43 A;  3QPL A;  2EFN A;  4XMY A;  4B4C A;  2QSG X;  1OCC H;  4M74 A;  2HXI A;  1IF1 A;  3TO6 A;  3H35 A;  4IOA F;  4PSX A;  2UXX A;  4YEL A;  4IXA A;  3AKZ A;  1H88 C;  3F8M A;  4N9I A;  5DEQ A;  3C7J A;  1NTC A;  2R5Y A;  2PJP A;  3DQV C;  2R7O A;  2FJ1 A;  1O3Q A;  2Z2S B;  2CYY A;  2KRC A;  4BBR J;  1T56 A;  3V8L A;  4DBR A;  4FX4 A;  1VQ5 I;  5E18 F;  2LY1 A;  4ASN A;  3H0G J;  2V26 A;  1P4X A;  3HOY J;  5KHD A;  1YX5 A;  2Z16 A;  3G71 I;  4CGZ A;  3KP3 A;  2QSF X;  2QF7 A;  3FMR A;  2DCE A;  4XLF A;  1YI2 I;  5E17 F;  1Z21 A;  4F92 B;  2I5U A;  4IRG A;  4MHG A;  1IN7 A;  1MBG A;  3WG7 H;  4A3L J;  1TBX A;  3HYI A;  4BY1 J;  3W2W A;  2BGC A;  4L5E A;  1X1D A;  1L3L A;  3PIP F;  2DPD A;  1FC3 A;  2EFP A;  5LD2 C;  3BR3 A;  5K1Y A;  2JTV A;  2DDA A;  2JWT A;  4I0A A;  3SDG A;  1RR8 C;  3V42 A;  2DT7 B;  3RJP A;  5IPA A;  2LY9 A;  3R61 A;  5EZG A;  2B9S A;  2ZFU A;  2FQ4 A;  1G6N A;  1PUE E;  2VOO A;  1QVT A;  1TQP A;  2JRM A;  4I99 C;  4UV8 A;  1KQ8 A;  2DMN A;  1GT0 C;  1U5T C;  2E36 A;  4IEJ A;  1YW8 A;  3PQK A;  3V7R A;  2FQ3 A;  3V7C A;  1SFO J;  4Y17 A;  4G94 A;  4NB5 A;  3AL0 C;  3FXU A;  5TRD A;  1VQO I;  5K7F A;  4G8X A;  1V54 H;  3OL4 A;  3GTL J;  4LLL A;  1Z3X A;  3M8E A;  1PP7 U;  4OIQ F;  2W00 A;  3RPU A;  2K9L A;  1UHS A;  3JRD A;  2IS2 A;  5GPA A;  2M0C A;  3Q0V A;  2P0W A;  3CLQ A;  1HW1 A;  4Y13 A;  1IC8 A;  2VON A;  3EDP A;  3S1R J;  2CW0 F;  1EV7 A;  3ZQH A;  1I39 A;  3BQZ A;  2ZJQ F;  1D8K A;  3WTS C;  2X6O A;  3NAU A;  2HI3 A;  3OYH A;  2DXI A;  2KT0 A;  1FZP B;  5EZH A;  1XGS A;  1NHA A;  4NHJ A;  2COM A;  5D4R A;  3IAS 2;  5HLI A;  3FXK A;  5D8K B;  4ZZD A;  3S14 J;  4HDV A;  4E7J A;  3DEU A;  2GM4 A;  1SD6 A;  4IF4 A;  2VE9 A;  2TDX A;  1BW6 A;  2QBY B;  1FBQ A;  2KJC A;  2ELJ A;  3LOC A;  3QQA A;  1SAX A;  2A6T A;  2MC4 A;  1BM9 A;  3A03 A;  2VIX A;  3U9G A;  4JBA A;  4LGW A;  5H6R A;  3A0B C;  1B9M A;  3WGG A;  4BQN A;  1L0O C;  4RB0 A;  1MBK A;  4UXN A;  3HRM A;  2CQN A;  4BKX A;  1SEU A;  2A3S A;  2M1B A;  3TKY A;  4B47 A;  3OOP A;  3W2A A;  3K70 C;  5M5Y J;  4UUS B;  3OYG A;  4JQF A;  4XRF A;  1S29 A;  3FK7 A;  2D45 A;  4CCO A;  1FBU A;  1ONV A;  2M0M A;  5E20 A;  2M9H A;  4UHT A;  2GBY A;  1R36 A;  4F55 A;  4XID A;  1TP4 A;  1WGX A;  5DYM A;  2F48 A;  1FMV A;  4PK4 A;  1LFP A;  2G0E A;  4L5J A;  1RNL A;  2V4J C;  2FNA A;  4L9N A;  2JVH A;  3HRT A;  5HDK A;  2W25 A;  4BJ5 C;  3GTK J;  3BRO A;  4ZYA A;  5HNF A;  1JTY A;  5FRN A;  1YS6 A;  3BWG A;  1JKQ C;  2EWN A;  2ME0 A;  5LHG A;  4WK8 F;  2VKV A;  1PVE A;  4JX5 A;  4L18 B;  5D5V B;  2X85 A;  2OTL I;  1USS A;  3W2V A;  3KE2 A;  4EM0 B;  1J75 A;  5GPC A;  4KT6 A;  4IO9 F;  3BR2 A;  4NC6 A;  4UV9 A;  4CDG A;  1D0Y A;  1ZG1 A;  2XGE A;  2WTE A;  1ITY A;  1HOM A;  3LL7 A;  1JHH A;  2KRH A;  2XRL A;  5FKK A;  1IGN A;  3ZMD A;  1OKR A;  2CH0 A;  2K3P A;  3UNG C;  4I2O A;  2DN0 A;  2UWM A;  4CXF A;  4BXF A;  3BTJ A;  2WAD A;  2DK5 A;  3S2W A;  2STW A;  1U5T A;  4BXX J;  4B3X A;  3RQ4 A;  3KZZ A;  4ZC3 A;  1CF7 A;  2KIU A;  1LPQ A;  3CLO A;  1QO0 D;  4ENK A;  3QYF A;  4E70 A;  2IVM A;  4XOR A;  2V1U A;  3GBG A;  1Y1V J;  4KN4 X;  3VFZ A;  4ZYG A;  2HVQ A;  5JVG F;  2X1C A;  4Q47 A;  5JVT A;  4CCM A;  2KL4 A;  4BHC A;  2WBM A;  4I76 A;  4LIV A;  3S1N J;  2X48 A;  4OIN F;  2GA1 A;  4CCL A;  3HUG B;  2AXT C;  2MYS A;  4ZDO A;  3HOX J;  2JA6 J;  5EG0 A;  3CCJ I;  3WGH A;  1DDN A;  3GLX A;  2R7V A;  3A1Y A;  2R3S A;  4E7K A;  2LTP A;  3AG3 H;  5FGM A;  5DCM A;  1YJW I;  4BBS J;  5FLX K;  1SVO A;  1UHW A;  1CGP A;  3L2V A;  2CS3 A;  3WHC A;  1YLF A;  2D2W A;  2XAS A;  1OYI A;  3PNV A;  2IT0 A;  2V9K A;  1MSE C;  2LLK A;  3TBI A;  2H6B A;  1R49 A;  4BGD A;  1UB9 A;  2BEO A;  2XRN A;  2IEK A;  5HDG A;  4RM3 A;  3BPX A;  2NVY J;  2JUG A;  3TOB A;  2HOA A;  2YPR A;  3QPT A;  4LK1 F;  4XRM A;  3LSG A;  4C2U A;  1WH7 A;  4BQO A;  3IP4 B;  3K6G A;  2IXS A;  2XGC A;  1UJ8 A;  2FOK A;  3FXJ A;  3CUQ C;  1RZ4 A;  2TCT A;  1LNW A;  4IZZ A;  3ZPL A;  4PJ0 C;  3WGI A;  3T8T A;  3WOD F;  2M8E A;  2F5C A;  4GFB A;  2XB5 A;  3FK6 A;  3VYT B;  5B5E C;  1IW7 F;  5C4X J;  5K5R A;  2HKO A;  1YJN I;  1S3J A;  2NOG A;  1VFC A;  1UST A;  3WTU C;  2FD5 A;  5EEH A;  2JK3 A;  2L7M P;  4EGZ A;  4XON A;  3D5R C;  1ETQ A;  2GXB A;  3QAH A;  2PBI A;  1JUM A;  2KMU A;  1ORK A;  2L5Q A;  2VQC A;  3TDZ C;  2UZK A;  4RDU A;  2RNJ A;  4A0X A;  2XAG A;  1DP3 A;  3K9T A;  1B72 A;  3ZQ7 A;  3H0D A;  3LSP A;  2KZG A;  1VQ7 I;  1LFB A;  3TW6 A;  3F9K A;  2DBB A;  3L1P A;  2F4O B;  2NVU B;  3ABU A;  1MD0 A;  3CC4 I;  3F72 A;  3PQJ A;  2F5D A;  2W7N A;  1TT5 B;  4OU0 A;  5BPD A;  4CCK A;  3G2B A;  3FM5 A;  4YIR X;  1RR7 A;  5F27 A;  4FT8 A;  4LB6 B;  4DYC A;  3OOU A;  3BC8 A;  4BUP A;  1JKR C;  4I01 A;  1SD7 A;  2MW8 A;  3Q0U A;  1X1P A;  2GWR A;  2MG4 A;  3BZ6 A;  5HOD A;  1HQC A;  2ECB A;  2L54 A;  1JXS A;  2DU9 A;  1TWC J;  3VSL A;  3RDI A;  4N0B A;  4EM1 A;  5FD5 A;  3HSR A;  1GXP A;  2QQ8 A;  4FQG A;  3MMY B;  1BW5 A;  2E7X A;  3KIO A;  1WHU A;  1Z6R A;  5A2Q K;  1X4P A;  2VJI A;  3TMO A;  3S1Q J;  3E3V A;  1U8B A;  4XL9 A;  4KN7 X;  2QGU A;  1RUN A;  1G8X A;  2ESH A;  1W4M A;  3FBI B;  3QU6 A;  1S5L C;  3E1S A;  3RYP A;  2WV1 A;  1SMT A;  1R1T A;  1JTX A;  3A02 A;  2EIJ H;  5M3F J;  1XTA A;  1YX3 A;  4B48 A;  2V6E A;  2HTJ A;  1P92 A;  3IV5 A;  4A3J J;  4UUV A;  3BR0 A;  4ANJ A;  1FEX A;  2X1D A;  1MMG A;  1JUS A;  2CUZ A;  3PNT A;  4NDL A;  2AXL A;  1ZTR A;  3DU6 A;  4XLP F;  1MND A;  2Y0M A;  2V9P A;  3K4M A;  4RGR A;  4AUX A;  2PJR A;  2ZJR F;  3PUB A;  2QEN A;  3AL0 B;  5DD8 A;  2JMW A;  2OAZ A;  1KU3 A;  3G1M A;  3Q0W A;  2YX4 A;  3K4J A;  4U7D A;  3MKZ A;  3OS2 A;  4OIO F;  2H1K A;  1HCR A;  3F6O A;  2COB A;  4FTH A;  4HLX A;  3GZ6 A;  2WAQ A;  5CVV A;  4XKV A;  2K40 A;  4L9T A;  4XLE A;  3RKW A;  3CCQ I;  1B8I A;  4KMF A;  2OQR A;  3GFM A;  1X1A A;  4IX7 A;  1T98 A;  3FXR A;  3CJR B;  1KYW A;  2LBF B;  3JR9 A;  1T39 A;  3I59 A;  5CKT A;  2EBI A;  3RYR A;  1N78 A;  1OJL A;  2DA1 A;  3CZ6 A;  4ZDL A;  5D5W B;  3F22 A;  1MBH A;  1YRN A;  3RKX A;  2WAF A;  4KMU X;  1W7P D;  1PDN C;  5LLQ A;  2Z99 A;  2GQQ A;  1TWH J;  3G3Z A;  1Z9C A;  2HGC A;  3PFI A;  3Q3S A;  4YRV A;  4IVN A;  3MZ8 A;  1E3H A;  4G7H F;  4RAG A;  5IYB J;  1ETK A;  5FKO A;  2K7L A;  3CQZ J;  4DNC A;  2HQA A;  1W0T A;  3EYI A;  3BR6 A;  1F36 A;  2E60 A;  1Y39 A;  2FX0 A;  2QVO A;  1E17 A;  2E5N A;  4XLA A;  1YQA A;  3CCE I;  3HBL A;  5HLT A;  4IL6 C;  1ZR2 A;  3KP7 A;  4C30 A;  4P96 A;  5HS9 A;  1LE8 A;  1JJ6 C;  3DLL F;  3QP5 A;  2KDZ A;  2D1H A;  1M1E B;  2IGK A;  1MJA A;  5ICG A;  4FE7 A;  4IHV A;  4KIC A;  1MBE A;  3GTJ J;  3C2H A;  4EMS A;  1JT6 A;  2HPM A;  4EJU A;  3WTX C;  4NUB A;  3EYY A;  2ELH A;  1JUP A;  4A5M A;  1J7K A;  2JN6 A;  3BOQ A;  2FU4 A;  3Q9V A;  2BW3 A;  1XSX A;  1ZN2 A;  1TWF J;  3KYD B;  2GZW A;  2H09 A;  2VLA A;  3ZOB A;  3E97 A;  4BEH A;  2OV7 A;  3BJO A;  1K6Y A;  3KP4 A;  5BPI A;  3L00 A;  1UMQ A;  3OR1 C;  4AVP A;  1YG2 A;  1T0F A;  4F93 B;  1R4M B;  5J6X A;  1YIJ I;  1O3S A;  4V2F A;  5C44 J;  3I4N J;  2R7S A;  3QOD A;  5LHH A;  2MSY A;  3TO9 A;  3VSK A;  5B3S H;  1R00 A;  4HF1 A;  1QRY A;  2K27 A;  2Y2Z A;  1I5Z A;  2ZC2 A;  5B1A H;  3FIS A;  3J7Y J;  3J80 Z;  3DFG A;  2HQN A;  1UG2 A;  2CQ7 A;  2MBF A;  2EIK H;  3ZMV A;  1RUO A;  2LH9 A;  3ZP5 A;  5CVU A;  1KQ9 A;  2JQ7 A;  2EIM H;  4M72 A;  1X58 A;  2VBX A;  4BE2 A;  3VWB A;  3I9V 2;  3CO6 C;  1QU3 A;  4L5I A;  3CCR I;  1PUF B;  1VI0 A;  2EFQ A;  1TQI A;  1WQ2 A;  4EJV A;  3J81 Z;  2ZJ2 A;  3DPL C;  1LQ1 A;  4AC0 A;  2HKX A;  4FCY A;  3F6V A;  2F4M B;  5B66 C;  2VKH A;  1V5G A;  3BLY A;  2ZXH A;  3AFH A;  3RTR A;  3L9F A;  1YHQ I;  1CQT A;  4II2 A;  5KCM A;  1K78 B;  1ZQ3 P;  1YIT I;  1EA3 A;  3U2R A;  3GX4 X;  1WCM J;  4Z6Y A;  3H3V K;  1YE9 A;  4LG3 A;  3A01 B;  2X51 A;  3S3O A;  4JYK A;  2DJI A;  1SFE A;  2DO7 A;  4B43 A;  4ZYH A;  4RAF A;  3L2U A;  1XG1 A;  3HOV J;  2ISY A;  2K5C A;  1FSE A;  1Y0U A;  3FXM A;  2IS6 A;  3S32 A;  2JPB A;  3VEP A;  3OR2 C;  2FBK A;  1UEL B;  4J19 A;  1ETY A;  4HAM A;  2D5V A;  4IKF A;  2X9D A;  2HVR A;  3OS0 A;  3OMY A;  1T8I A;  2UUZ A;  3CUQ B;  1HXD A;  3R4K A;  5D4S A;  5LGN A;  1HDP A;  1VQ9 I;  2HDW A;  2V1N A;  4R8H A;  5ICC A;  4Y15 A;  1KON A;  2NVQ J;  1SD5 A;  5ERI A;  1JT0 A;  3CC2 I;  3DKW A;  5J4V A;  2R5Z B;  4GYI A;  5D5X B;  3R60 A;  4V2G A;  4IQJ A;  1AKH B;  2E2J J;  1OCR H;  3BJA A;  5JR3 A;  3KPH A;  3HHG A;  1P4W A;  2A6E F;  2YU3 A;  5LRR A;  2K4J A;  3OYJ A;  5KAF C;  2QSH X;  2VT2 A;  3LST A;  1FOK A;  4XLH A;  4IRI A;  3GTG J;  3K10 A;  2XV4 S;  2O0Y A;  2UV1 A;  5CJ9 A;  4XRS A;  4ESJ A;  3HOU J;  3DLA A;  1GXQ A;  3GF2 A;  3KP6 A;  2CSO A;  4A5N A;  4PGH A;  2O3F A;  4J00 A;  1X1B A;  1R23 A;  1K4S A;  3K7A J;  2JVG A;  5FD6 A;  4PSW A;  2QEX I;  2IA0 A;  2Y0S A;  3K4K A;  4FX0 A;  4QPO A;  4FHT A;  4E7L A;  2VJ5 A;  1FBS A;  2P6T A;  4NQW A;  4EJO A;  4BAY A;  2CWE A;  5ILV A;  1T6S A;  3ISP A;  3JAM K;  1IAW A;  2HQR A;  4M9S A;  4B09 A;  5F1R A;  2RC4 A;  2XRO A;  1H8A C;  5L3B A;  3DWL E;  3OYI A;  2L9S A;  3KZI C;  3C2B A;  4EEF G;  2E1N A;  4MFE A;  3W6V A;  2RQP A;  3ML6 A;  1P9Q C;  1U9N A;  3ZMS A;  3IRR A;  2BVL A;  3RCO A;  4IHS A;  3DPU A;  4ESB A;  4OIR F;  2LFB A;  3SZP A;  4A3C J;  2M5W A;  2AQF A;  2WWY A;  2ZSI B;  5GAH J;  2KJB A;  3I55 I;  3GFJ A;  3FZV A;  2NS7 A;  3F23 A;  1DU6 A;  2MH9 A;  4BU2 A;  1FLI A;  4BEH B;  1GVD A;  1V3F A;  2VC1 A;  4H4K C;  2DDB A;  4M3D A;  2GXA A;  2DFI A;  2KPM A;  3DBL B;  4CA0 A;  2Y0S N;  1WWX A;  1RET A;  3DEW A;  3IWF A;  2GOM A;  2VXD A;  2NAZ A;  4XOP A;  2HOT A;  2ZXW H;  1VQ8 I;  1LJ9 A;  2R7F A;  2ECC A;  5M3M J;  5CLS A;  3HIF A;  1TL8 A;  3H9Q A;  4LG0 A;  2K02 A;  2MFZ A;  3ZRG A;  4ZJZ A;  2E7W A;  2M30 A;  1R5I D;  3C2G A;  2BHZ A;  4UY8 I;  3CJN A;  2MC3 A;  3MCZ A;  5E3O A;  4BE1 A;  3BZK A;  1P7J A;  2HR3 A;  3M8J A;  1QQI A;  2KQR A;  4P1W A;  5L3E A;  4HOB A;  2LKX A;  3VOD A;  1D0X A;  4KT5 C;  1BC8 C;  4V19 K;  1Z77 A;  3RKY A;  5J8C A;  1G3W A;  4BH9 A;  1YW9 A;  3HOS A;  2ZBK A;  3KP5 A;  4RB2 C;  1KU2 A;  4FET A;  2MLG A;  2P6S A;  1FP1 D;  4BL0 B;  5LBQ A;  1U8R A;  4UVB A;  3KEQ A;  3T0Y A;  3I58 A;  1ETX A;  1WJB A;  1IUF A;  3K4L A;  2E1O A;  5BMZ A;  3CMM A;  1XC5 A;  1ZYR F;  4XKW A;  2RNG A;  3CCY A;  4HW0 A;  4M6X A;  2MGQ A;  2OTJ I;  2Q2E B;  2P4W A;  3FIW A;  2PMZ N;  2ZME A;  3F8F A;  2QZ8 A;  5H6Q A;  3SZT A;  1JGS A;  4HLY A;  2KIQ A;  1I50 J;  1ZG5 A;  1S7O A;  4BNC A;  3WTT C;  3DTI A;  2AHQ A;  3FM3 A;  1X3W B;  2L2O A;  1FNN A;  1VQ4 I;  1TNS A;  4MTE A;  2F5F A;  2OCC H;  2ZFW A;  5J47 A;  1OQY A;  2ID3 A;  2V7F A;  2H1L A;  2NXN B;  5HOO A;  1N25 A;  2WAE A;  2W85 A;  4MO7 A;  4XOT A;  4LJZ F;  3K0L A;  4ZTJ A;  5JHU A;  2DMT A;  1B9N A;  3CF5 F;  2MA3 A;  3G73 A;  4S0H B;  2WC2 A;  1I1S A;  2VKE A;  1BBY A;  2HFH A;  3ZMT A;  3W3C A;  1R71 A;  3GTP J;  5EEG A;  2IS1 A;  2F2E A;  1V4R A;  2GAU A;  3LAJ A;  2VAS A;  2L02 A;  2W1O A;  5E3N A;  4E7I A;  1IRZ A;  3ZR8 X;  3BQY A;  2CGP A;  4RS8 A;  3SFI A;  4B8X A;  3JRI A;  4UVC A;  3MZH A;  2QQ9 A;  3DXJ F;  3ECO A;  5DM6 F;  3Q9S A;  4RM2 A;  2E2H J;  5JI6 A;  2CFX A;  3HPH A;  2K86 A;  3CC7 I;  3IHU A;  1TQM A;  2CU7 A;  3BCA A;  4DGW B;  2P8T A;  2EFW A;  1AU7 A;  1XGO A;  2XSD C;  3TL4 X;  1OFC X;  3KP2 A;  3S8P A;  1WKM A;  4I0B A;  3V8J A;  2N8G A;  2K85 A;  5HNH A;  3M1E A;  3F21 A;  1QPI A;  3H36 A;  9ANT A;  2A68 F;  2NOJ B;  1KU7 A;  4MNU A;  4D7N A;  3GFI A;  2OBP A;  2LOO A;  5CVI A;  2LF8 A;  5TGT A;  4JX4 A;  3QYE A;  2JA5 J;  3G4S I;  3FMQ A;  4M9X A;  2Y75 A;  1KZH A;  2R5Y B;  3E6B A;  4F3Q A;  3D5S C;  2V1X A;  1QPM A;  5KVR A;  5CYV A;  3BCB A;  1RES A;  1VQM I;  1JJ8 C;  2ZXI A;  1H0M A;  2BY1 A;  4KA4 A;  2CV1 A;  4BHP A;  3AG1 H;  2V79 A;  3EUK L;  1HLV A;  2PMH A;  4HF0 A;  3LWF A;  3IC7 A;  2QLZ A;  4AYB A;  2HDC A;  3RI4 A;  4FAS D;  1IV6 A;  2XHK A;  4CIC A;  4B3A A;  5IT9 K;  2XPV A;  2FA5 A;  4HYE A;  2XUB A;  3P9C A;  3WU1 B;  2DOD A;  3GCM A;  1DP7 P;  1J5Y A;  4RB3 C;  2XAH A;  2P5K A;  3CES A;  1ZR4 A;  3H3U A;  4N4N B;  4QSH A;  1ZLK A;  3BPV A;  3PUF A;  4DZP A;  2QYO A;  3NWS A;  1ZG3 A;  2JT1 A;  4S05 A;  3WE3 A;  4E4H A;  1FWZ A;  3ERE D;  4DQ2 A;  5LRS A;  1R4N B;  1TT0 A;  2PEX A;  1BIB A;  2IGM A;  1HBX G;  4EVI A;  3WTZ A;  2P7C B;  2E5Z A;  2VXZ A;  2LF7 A;  2P7V B;  3KZY A;  3DKY A;  3SYT A;  1O3R A;  4W97 A;  1MGT A;  1OMI A;  2W24 A;  2XKO A;  3CME I;  2ACJ A;  3M8F A;  5IYC J;  1AA7 A;  5DCF A;  5J4Y A;  1MH4 A;  3K69 A;  1OCP A;  3FF5 A;  4QIW N;  1LDK B;  4QPQ A;  1VZ0 A;  4CCN A;  3ZN1 A;  1SC7 A;  1T2K A;  3K2Z A;  2MD0 A;  2VJJ A;  3N97 A;  1MBF A;  1Z3Y A;  1QVU A;  1LUJ B;  4KUM A;  2RDP A;  4AYB N;  4P9U A;  3BR5 A;  1S9H A;  3GYH X;  4C2M J;  4EGY A;  3OV8 A;  1WJ5 A;  3GTM J;  4A0Y A;  2B0L A;  5HVQ C;  2Y69 H;  1T33 A;  2NVT J;  1STZ A;  4IHT A;  1R1U A;  3JCU C;  4XN0 A;  4AIH A;  5F6F A;  5J1R A;  1DPR A;  3FBN B;  3ULQ B;  5LHI A;  1ZHF A;  3ASO H;  1F5T A;  3GZ5 A;  5DUK A;  2HYJ A;  1FY7 A;  3ASN H;  2JA2 A;  1GDT A;  3BTI A;  3IL2 A;  3H9G A;  1J2X A;  3RIR A;  1NK3 P;  1BIA A;  1U9O A;  2XSJ C;  1IRX A;  3BTL A;  2HS5 A;  5J3L A;  5C4J J;  2LK2 A;  2ZO4 A;  2M3A A;  4OMZ A;  1W5T A;  1ZGA A;  2DYS H;  3BG6 A;  3MD2 A;  2D1V A;  3OYL A;  1X3U A;  4R1H A;  4U0V A;  4IHY A;  3TP3 A;  2DLL A;  4D1Q A;  2EA4 A;  5IP6 A;  4KNY A;  3TDU C;  5L3F A;  1BJA A;  2CO5 A;  2V6C A;  3CJT B;  2Z5U A;  3VPR A;  1VQL I;  5IP9 J;  2F5E A;  5K7H A;  2IJL A;  2YS9 A;  3LA7 A;  1WI3 A;  1XS9 A;  2K9S A;  1A6I A;  1ZK8 A;  4ENM A;  1Z6T A;  3S3N A;  3HOW J;  3MWM A;  3CCL I;  5AIQ A;  4Y7N J;  1A6Q A;  1SAU A;  2KIS A;  3EUA A;  3SXY A;  2LG4 A;  3HSE A;  1QHG A;  2ZNY A;  1I1G A;  3E6D A;  2QKM B;  6PAX A;  3F3X A;  4YG2 F;  2HXO A;  3B73 A;  3ZN0 A;  2A69 F;  3VYS B;  4HPQ A;  4KIF A;  5HLG A;  3HB9 A;  1S8N A;  4OOI A;  1A31 A;  5E79 C;  3ERM A;  4Q48 A;  5FKL A;  2P5V A;  4E7Z A;  2YU9 J;  3N05 A;  5LEJ A;  2OUM A;  1EH8 A;  2AO9 A;  4KIG A;  2A6H F;  3FMS A;  1G59 A;  4P5O A;  3UKG A;  1FTZ A;  1ZLJ A;  3BP8 A;  4BJT A;  4CO8 A;  3WTW C;  3GZN B;  3K4C A;  4MEY F;  1MIJ A;  4LIT A;  2HPI A;  2HVS A;  2EPF A;  4HZF A;  2XGD A;  4CYC A;  1XMK A;  1T0F C;  3QU3 A;  4IOC F;  2CV0 A;  2ELK A;  2FSW A;  1S7E A;  3SDB A;  1D1A A;  1U5T B;  4U0Y A;  1A35 A;  3HTU A;  5F1J A;  1ETO A;  2H6C A;  1CF7 B;  1FT9 A;  5GAD J;  1LEA A;  1D5Y A;  3L2C A;  1WJF A;  3K1M A;  1B59 A;  2QUF A;  5KNL A;  4WXD A;  3O8H A;  1AWC A;  3JRC A;  1OIS A;  2YUS A;  5FLV A;  2VOD A;  2OCE A;  3BDD A;  1FMW A;  3SQN A;  4PCQ A;  1UAA A;  5EJC A;  2E35 A;  4Q4Z F;  2RAE A;  2PG4 A;  5EG0 B;  4RGS A;  4L9J A;  5DDG A;  4G6T B;  3WTY C;  1B1B A;  2O8K A;  3NQO A;  5IT3 A;  2BXY A;  4L0Y B;  4PGG A;  1MDM A;  1MMA A;  4FE4 A;  5DCM B;  4LK0 F;  3PSI A;  1MSF C;  1T38 A;  3OIQ A;  1FOW A;  4YIF A;  4QTR A;  4EJT A;  1LFU P;  1FYM A;  3AG4 H;  1JHF A;  5EGO A;  1ZAO A;  1POG A;  2QWW A;  4PDK A;  2DFF A;  1FP2 A;  3H9J A;  1BI0 A;  2HDD A;  2VQG A;  4BS9 A;  5EF6 A;  1W7P A;  3HEF A;  2JUC A;  3VYR B;  5KK1 A;  2OPT A;  1I6H J;  1VQN I;  3GLL A;  3DBR B;  4HRI A;  3OYM A;  2DQL A;  4D5C A;  1FJL A;  4OAY A;  3CCV I;  4HQM A;  3S16 J;  2VN2 A;  4ITV A;  3P5J A;  4ENN A;  2EIN H;  4HEA 2;  1WZ2 A;  1OYW A;  3LAP A;  1UHM A;  5M5W J;  3J7A Y;  2QCO A;  4YFX F;  3HKZ A;  5LGU A;  5D6E A;  4LOC A;  4IHW A;  4H0E A;  1N77 A;  1VQ6 I;  4HST A;  1UFM A;  4XKC A;  1MNE A;  3CCM I;  2X1E A;  2ZKZ A;  2LDU A;  5FO5 A;  3F8C A;  4U88 A;  2FBH A;  1V5F A;  3IUO A;  2LY2 A;  3A2K A;  2CUE A;  1WJC A;  3HGY A;  1IN6 A;  5LFA A;  4WF2 A;  4RGX A;  4A3K J;  2XAF A;  4GO1 A;  1A5J A;  1HKT A;  2O7O A;  2KRF A;  2LSO A;  5FRM A;  2DOA A;  2TRT A;  1HF0 A;  3DU5 A;  3OYA A;  3S2D J;  1FYK A;  3U1D A;  3LSM A;  4G6Q A;  4M9Z A;  3HRS A;  2DT6 A;  1IRF A;  3GXO A;  3FX3 A;  4P9F A;  1FOY A;  1B72 B;  3I3L A;  3CDH A;  4M71 A;  3I64 A;  3ZQQ A;  2DK8 A;  3O8G A;  5FRO A;  4A3F J;  1BR1 A;  5K5Q A;  2HQ5 A;  2XF5 A;  4AVZ A;  1W36 D;  2VBY A;  4BJ6 C;  1E3O C;  3HKZ N;  3E6M A;  3JSP A;  5EDN A;  2DI3 A;  1R9T J;  4X1E A;  4YFN F;  4A6D A;  3S3M A;  3V8K A;  2BBY A;  1TZL A;  4MQ9 F;  1OYY A;  4MIM A;  1K4T A;  3M7G A;  2BE5 F;  4O6J A;  3HSF A;  1QZZ A;  5LGT A;  2DTR A;  2LC2 A;  5E1W A;  2VI6 A;  5F0C A;  2IW5 A;  4LLG F;  1O3T A;  3MAJ A;  3ABK H;  5ICF A;  3CDI A;  4D7M A;  4MFD A;  3S1M J;  1JI8 A;  1TNT A;  4WXH A;  2V1D A;  4M73 A;  4U7B A;  2EK5 A;  2GXG A;  3IKV A;  1F9N A;  1NG7 A;  1REP C;  3L2Q A;  1WVR A;  1OPC A;  2ADU A;  3JRA A;  4WXC A;  3QRF F;  1LEB A;  1X1C A;  2CQQ A;  1ZGJ A;  4Z2Y A;  2I10 A;  4UB6 C;  3W6K B;  1XCV A;  3OYD A;  1DQU A;  4HNT A;  4U0W A;  4PJJ A;  5L3G A;  3RPQ A;  1IDZ A;  3LFK A;  1ETV A;  3HXL A;  4A69 C;  1MMS A;  2LRE A;  4DJA A;  4I7H A;  3KYL A;  3FXL A;  3G6E I;  1Z91 A;  3B02 A;  3PO2 J;  4Y52 J;  2VL8 A;  3TOA A;  2PJR B;  3DP7 A;  2W4S A;  4JK1 X;  1SVM A;  1SVL A;  1F1Z A;  1W0U A;  4ABZ A;  4RGU A;  3QP6 A;  4HX4 A;  2FNP A;  3JRH A;  2XIG A;  1D0Z A;  2PQ8 A;  2R7Z J;  2J5O A;  2NRA C;  1UCR A;  2L7Z A;  1BJZ A;  1R22 A;  3OYE A;  3KCC A;  4YII A;  1B8I B;  2KFD A;  3BY6 A;  3M9A A;  3PNY A;  3I54 A;  3CP2 A;  2FEZ A;  2OZ6 A;  3I59 B;  5A2Q Z;  4RBO A;  1QHH D;  2ZXJ A;  5LEK A;  3R6S A;  3LA3 A;  3TQN A;  3ZMZ A;  1AHD P;  5TIS C;  2IS4 A;  2H8W A;  5J1U A;  3I0T A;  2M4K A;  3DPT A;  2VPR A;  1R1V A;  2L9V A;  2BOL A;  3HTS B;  1YRN B;  3LQQ A;  2JSP A;  1KGS A;  3LSK A;  1K6O A;  4QLC U;  2QBY A;  1S6L A;  2L4A A;  2AS5 F;  5ILS A;  2FML A;  4HQE A;  3RKQ A;  2LRD A;  2QM3 A;  1J0R A;  2HYG D;  3LFU A;  5B1B H;  4KYW A;  2FBI A;  2L4M A;  4ZYD A;  3FKI J;  2IGO A;  2P81 A;  1WI9 A;  3GEZ A;  3IH2 A;  1VND A;  2ZME C;  1EF4 A;  2ID6 A;  1SFU A;  3E0J B;  1PJR A;  4OWR B;  5EEA A;  4HSR A;  4UB8 C;  2X6W A;  1IV8 A;  1Y8Q B;  4PZJ A;  1JKO C;  4JOM A;  1I6X A;  2WY7 Q;  2VQL A;  3A0H C;  3KLN A;  4XIC A;  1RRJ A;  2CMP A;  2DQR A;  2XKP A;  3H5R A;  3HPG A;  2WB1 N;  4XNF A;  4UUS A;  4DZJ A;  4CYD A;  1XGM A;  1XSV A;  1TC3 C;  2EIL H;  1HA8 A;  5C3E J;  1NH3 A;  1LE8 B;  4RA2 A;  1H9T A;  3QYB A;  4ZTF A;  4CZC A;  3PFY A;  3AG2 H;  3RQI A;  2JA7 J;  2KIF A;  2KZV A;  2MLK A;  2WV0 A;  4Y33 A;  4J01 A;  3CD6 I;  2XVC A;  3GFL A;  3KFW X;  4XM3 A;  4C9Y A;  4GDF A;  3O2P E;  1A36 A;  4KDP A;  2NNN A;  4BE0 A;  4M6Y A;  1OR7 C;  2F4I A;  4KIS A;  4GCV A;  2BW3 B;  2XF7 A;  1GV5 A;  1X2M A;  3RZD J;  1ZAR A;  2WA0 A;  2V9V A;  2RKH A;  1FOX A;  3O6B B;  4EAT A;  1PYV A;  4XK4 A;  4C3H J;  3OSG A;  1SAN A;  3CTA A;  3L7W A;  2L7F P;  2A5W A;  2QA4 I;  2EH3 A;  1X4O A;  1FIA A;  4I09 A;  5ICE A;  2VUM J;  3NEU A;  1E2X A;  2EV6 A;  4HDU A;  4G6D A;  2CQK A;  2CG4 A;  5BQT A;  1MH3 A;  3DEE A;  1JGG A;  1XN7 A;  1HW2 A;  4A6E A;  2VJ4 A;  5BNG A;  3MEX A;  1QNT A;  2A05 A;  2PMZ A;  3ABL H;  4C2T A;  3I53 A;  1RKW A;  2G7U A;  4C3J J;  4DW6 A;  3QPH A;  3PM1 A;  2HZT A;  1X19 A;  3SHF A;  2XDV A;  1KYZ A;  2YSR A;  3K1N A;  4A3M J;  4OMY A;  2CFO A;  4G7O F;  1TWA J;  2IBD A;  3VDX A;  3QPS A;  2VBZ A;  2BY0 A;  4MLO A;  1TWG J;  2JSC A;  4BQQ A;  2A07 F;  3HUG A;  3K4B A;  2DFH A;  1VF9 A;  5K5O A;  4RLQ A;  2E19 A;  1FPQ A;  3FWE A;  2X6Y A;  3F8B A;  1I3A A;  2IA1 A;  4XR6 A;  4BAC A;  4LD5 A;  3LSR A;  2STT A;  2A5Y B;  2KP6 A;  5FLM J;  3CMA I;  3HHH A;  1X2N A;  2FXA A;  4BDY A;  2NS0 A;  3M07 A;  1A04 A;  2BZT A;  3R0A A;  2PN6 A;  3COA C;  1Y8R B;  4L0Z B;  5E1Z B;  1MJB A;  1O7F A;  1GUU A;  2L9R A;  4I6Z A;  1JKP C;  2IP2 A;  1HC8 A;  1FX7 A;  4YEJ A;  1WFX A;  4ZH4 F;  3OL3 A;  2LNB A;  4CZZ A;  1SMY F;  1IDY A;  3ZMU A;  3V7S A;  1RKT A;  2Y31 A;  1KQ0 A;  3RPU D;  5E3L A;  3AAF A;  2E34 A;  2L7K A;  3H1C A;  2JZY A;  1HST A;  2CJJ A;  3G1L A;  3WTV C;  1K7A A;  1YOV B;  1BI2 A;  1IXC A;  3ZQC A;  2PX9 A;  1ERD A;  3M3Y J;  1TW3 A;  1QZY A;  1R58 A;  3EPZ A;  2NS8 A;  1FYL A;  5DD4 A;  2JA8 J;  2CW7 A;  4R79 A;  4D5F A;  2Y9Z A;  3DF8 A;  1B6A A;  5GAE J;  4F52 A;  2BXZ A;  3KEY A;  4NBQ A;  3WG9 A;  3REO A;  3FXQ A;  3H3Z A;  5JFR A;  4D9J A;  4DOZ A;  2DAO A;  5F0H A;  2XPW A;  4QWQ A;  4RLF A;  3U1K A;  4EM2 A;  2R4G A;  1BL0 A;  4PJM A;  2OQG A;  4KFC A;  2F5V A;  3ZGK A;  2R0Q C;  2VBW A;  1OR7 A;  4N4O B;  4JP0 A;  4HF2 A;  5HS7 A;  4O5V A;  2K9Q A;  1XMA A;  4GGG A;  3OYN A;  2NYX A;  3EUH C;  4CH7 A;  4LB5 A;  2P5L C;  1H89 C;  5E8I A;  2HOS A;  2L9N A;  1XDU A;  5AIP A;  1Y56 A;  1Z7L A;  4HNU A;  1S72 I;  2YR2 A;  3KEO A;  3GW2 A;  2RVC A;  1IN4 A;  5ED4 A;  1XPX A;  4KIT B;  5H2F C;  1FTT A;  3LNQ A;  2OJE D;  1D8J A;  1NG6 A;  1WJE A;  4NQW B;  5ILU A;  2DMQ A;  4KJZ A;  2HTS A;  2ETH A;  2BY2 A;  1HSJ A;  2VC0 A;  3M4O J;  3CJQ B;  1YJ9 I;  2LYC A;  1LKX A;  2K3F A;  4Q5S F;  2VT3 A;  2OZU A;  4L9V A;  2W57 A;  2DOF A;  1XGN A;  1O4X A;  1MKM A;  2M34 A;  4TV7 A;  4AU7 A;  4CUG A;  1KA8 A;  2FE3 A;  3OYF A;  2E2I J;  1U78 A;  5CQE A;  4A0Z A;  3ZQI A;  1P7I A;  2DTZ A;  2ISZ A;  2OU2 A;  1GV2 A;  3N4M A;  1TW2 A;  4CSW A;  2M8G X;  1XX5 A;  3B6A A;  1XDS A;  4HX8 A;  2RV8 A;  5BOX A;  2EB7 A;  3ABM H;  4PFO A;  2XB0 X;  3LSJ A;  2VOP A;  3HRU A;  1J09 A;  2MD5 A;  2ESN A;  2XPU A;  1TTY A;  2NNY A;  2ZJP F;  2M2E A;  3UR3 C;  3OIP A;  4DYQ A;  2PI0 A;  1WJD A;  2VB6 A;  4DBQ A;  2DT5 A;  3S17 J;  4LG0 B;  1EJ9 A;  3BTC A;  3JSO A;  4ZDP A;  3HDD A;  1MZB A;  3MN2 A;  2BY3 A;  3PJR A;  3ESW B;  3OIO A;  2EZL A;  3I71 A;  1DUX C;  3JAM Z;  4GYG A;  1K83 J;  3CCS I;  1BA5 A;  5DV5 A;  5AON A;  1YFH A;  4B44 A;  2KIM A;  2Q0O A;  2O5R A;  2R7W A;  2Y48 A;  4AM3 A;  5DM7 F;  3RZO J;  1BI3 A;  4JX6 A;  2X0L A;  4IQ4 A;  3DBH B;  3LQR A;  5K7Z A;  4G7Z F;  2Z1D A;  3B6C A;  4LIU A;  4M3E A;  4U87 A;  3WU0 A;  1SFX A;  2EV0 A;  3HZJ A;  1FSH A;  3J7A O;  3Q5F A;  4ETS A;  3JRE A;  4BXU A;  2HNH A;  3J7Z I;  2DA3 A;  4A3G J;  2LBF A;  3O3K A;  4M3G A;  5FFX A;  1W5S A;  3MVP A;  1YW7 A;  3CUO A;  1UG0 A;  1IXR C;  2IPQ X;  2XAQ A;  4OIP F;  2FMY A;  2G7H A;  3DCF A;  1LVK A;  3JTH A;  3W6J B;  3F0C A;  3MQ0 A;  5HS8 A;  1HKS A;  3NWT A;  2ZME B;  3DTE A;  3EUH A;  2JPC A;  1RPW A;  3V4G A;  2LD5 A;  2DFE A;  3GME A;  1IXS B;  3OWT A;  2EZI A;  4LMY A;  2F6C A;  4M3B A;  5IOY A;  2M7B A;  1V55 H;  2E1C A;  4F91 B;  2R7T A;  1ZH5 A;  1IJW C;  1LDD A;  1RC9 A;  1D1C A;  2DA4 A;  1W1W E;  3EET A;  3FHZ A;  3BG3 A;  1ZGW A;  3K70 D;  3J80 K;  1EKE A;  4BHB A;  1JE8 A;  1ZRE A;  2Q1Z B;  4ON0 A;  3ECH A;  4IRH A;  4X0G A;  1G2H A;  1BR2 A;  2KDO A;  1NK2 P;  3TGN A;  1WRJ A;  2K9N A;  4NC7 A;  4BY7 J;  3K2A A;  2Y30 A;  1IO2 A;  1SD4 A;  4PFP A;  3H5A A;  5JHF A;  1MW7 A;  2HEO A;  2E1M C;  3IH3 A;  3OS1 A;  1AOY A;  3E5U A;  3GWZ A;  4AIJ A;  1U6G A;  4MEX F;  1GLN A;  4EV0 A;  3J81 K;  3CO7 C;  2H8R A;  5DTD A;  2XC7 A;  4IJA A;  1VQP I;  3SEQ A;  3ABT A;  3D5L A;  1DU0 A;  2XF6 A;  5D8L B;  2Z3Y A;  3U21 A;  1WSU A;  2DA2 A;  3OY9 A;  4A3B J;  3E6C C;  1BOB A;  1G4D A;  3GVA A;  2K9M A;  5IY5 H;  1D5V A;  2PFB A;  1G3Y A;  1R5H A;  3BJ6 A;  3M1C A;  3P9K A;  2EFO A;  1QBJ A;  2HZD A;  3EQL F;  4MQV A;  4AIK A;  1OLT A;  1B4A A;  3FHN A;  5J40 A;  3BR1 A;  3JRG A;  2DPU A;  4S04 A;  5IOZ A;  3OYC A;  3IAM 2;  4EJW A;  4XN3 A;  3ZQF A;  1FIP A;  2LKP A;  2DYR H;  4HX7 A;  1F4K A;  5FB2 A;  5TJJ A;  1IZ1 A;  2ZSH B;  1OCO H;  4XSZ F;  1PP8 F;  4RAZ A;  3X2Q H;  3ZQL A;  2NVX J;  2M7A A;  1T95 A;  1ZRF A;  3RSN A;  1J59 A;  4AD9 A;  2ZNZ A;  3MFK A;  4I98 B;  2XAJ A;  1LDJ A;  1P6R A;  1HKQ A;  3H92 A;  4BQA A;  3IRQ A;  2KKO A;  3SFZ A;  1QA6 A;  3FKJ A;  3ROU A;  1W36 C;  1R5G A;  1YYV A;  3QOE A;  4HV5 A;  2Q8K A;  1Z1D A;  3HL2 A;  1PUF A;  4ZYE A;  1YO5 C;  1G3T A;  2EJR A;  3KLO A;  4UNO A;  3KET A;  3T8R A;  1K61 A;  3PO3 J;  3CMY A;  1ON2 A;  2EZH A;  5F08 A;  3T1B A;  2C6Y A;  5KAI C;  4BYY A;  3CF2 A;  1LB2 A;  5BS6 A;  3K1P A;  3HJE A;  1W5C C;  4HG2 A;  3HGG A;  1BN5 A;  2XAU A;  3D1N I;  4NC8 A;  1K78 A;  3SJM A;  2K4B A;  4M3F A;  5FJ8 J;  2VQH A;  4PJL A;  4RB1 A;  1R7J A;  2R7U A;  1I27 A;  5E3M A;  2DW4 A;  5HLH A;  3ZCO A;  1Z05 A;  2HOE A;  3A01 A;  2HYF A;  3DV8 A;  3TW7 A;  1GHC A;  1V5E A;  3MKW B;  3PSF A;  2GIV A;  5DS9 A;  2O9L A;  2CRG A;  2R7Q A;  3C18 A;  3I5U A;  4XKB A;  3PL8 A;  1T08 B;  2M45 A;  3LMM A;  2Z9O A;  2GOX B;  5L3D A;  1C0W A;  4EQQ A;  1QZE A;  4PUS A;  2B7E A;  1VQK I;  4UUT A;  5F04 A;  3CUQ A;  2CUF A;  1R6R A;  1VTN C;  1MMN A;  4UVA A;  3I4M J;  1Z7U A;  1XMX A;  1XB4 A;  1IN8 A;  4O3M A;  4A3E J;  2HWV A;  1ETW A;  3OSF A;  4DIQ A;  2LKS A;  2KLO A;  2R5Z A;  3KX2 A;  5GTI C;  2BVM A;  4IPA A;  4XRS G;  3WHB A;  3FDY A;  2O61 A;  4FIS A;  3BZC A;  1H9G A;  1AKH A;  3R0J A;  3HC7 A;  4RMN A;  2IGN A;  2QQA A;  4A3I J;  2BYV E;  2OF7 A;  4GXO A;  3BG9 A;  2LMD A;  3CCU I;  5GP9 A;  2L3D A;  4LLN A;  2M4G A;  2DMP A;  4G9Y A;  5CVR A;  5L3C A;  4GRI A;  5IT9 Z;  4E7H A;  4RAY A;  1OCT C;  3T5X A;  4M6V A;  1DPU A;  1ENH A;  2LR8 A;  2IRF G;  1XCB A;  1SFK A;  5JLX A;  4ZZL A;  2H94 A;  3C3W A;  3L09 A;  3MZY A;  2R7D A;  1XD7 A;  3JRB A;  5M5X J;  1HDD C;  3JRF A;  1J9I A;  2W48 A;  4II3 A;  3DTK A;  4LFU A;  3HG9 A;  2ZCW A;  1WJA A;  2AQE A;  3P7N A;  3ONQ A;  2BHY A;  5FLX Z;  1EH7 A;  1ZRD A;  3TO7 A;  3IKT A;  2WAQ N;  3L2R A;  5J8F A;  5D5U B;  2CUJ A;  4MGR A;  1G3S A;  5CVJ A;  2E71 A;  4I02 A;  4NNJ A;  3F8N A;  1Y0N A;  3S2H J;  1Q1H A;  1YIO A;  3LSI A;  4DYR A;  1OCZ H;  1MBJ A;  5F0F A;  1ACI A;  1MMD A;  1EH6 A;  1Q1V A;  3MKL A;  1Y1W J;  2GLO A;  3WE2 A;  3PIO F;  4A93 J;  2EZK A;  4WX9 A;  3K4N A;  5EYR A;  4XQF A;  2B63 J;  4Y4R A;  2FRH A;  1XSD A;  3QOP A;  2X4H A;  5F64 A;  3WU2 C;  1Y6I A;  3JTG A;  1U2W A;  4PJN A;  4XBF A;  1YTY A;  4AWX B;  3BG7 A;  2R92 J;  3E7L A;  5D6F A;  4KIB A;  4XLC A;  2A61 A;  1BI1 A;  1U0J A;  2DMU A;  2PMU A;  2R7X A;  3SEZ A;  1APL C;  3E5Q A;  1Z0X A;  3CDL A;  5GTH C;  3QWL A;  1D1B A;  1HW5 A;  5HDN A;  5JLW A;  2Z33 A;  5FKN A;  4E7S A;  4W1U A;  2JJ7 A;  5H20 A;  2IA2 A;  1TLH B;  5IP7 J;  2DOE A;  2ME6 A;  2QKL B;  4YFK F;  3I56 I;  1IRG A;  2OD5 A;  2WY8 Q;  4BDZ A;  2PLY A;  2ZB9 A;  4WWC A;  2FF4 A;  4A12 A;  1ON1 A;  2OC6 A;  4ESF A;  3H5N A;  4CYC B;  1BOA A;  5E1X A;  2YX7 A;  2J5P A;  2M87 A;  4F7Z A;  4HNV A;  3VB2 A;  2DA5 A;  2Y9Y A;  1N75 A;  1IN5 A;  2O6G E;  4C3I J;  3OYB A;  1Z67 A;  4P55 A;  3C1D A;  4MTD A;  4ENJ A;  1ZRC A;  2GA2 A;  3S15 J;  5CQG A;  2KHM A;  4IHX A;  4K2E A;  2XGX A;  4OAZ A;  3ZQG A;  4XSX F;  1ZEL A;  1ZKG A;  5GAG J;  4HA8 A;  1IG7 A;  2RN7 A;  4WCG A;  2ICW G;  3A4C A;  2WB1 A;  1ULY A;  3NAR A;  1DGR M;  2RQQ A;  3TP0 A;  4N9H A;  4E6K G;  3HOT A;  3BG5 A;  2CV2 A;  3GUD A;  2GIZ A;  2Q2E A;  2DJN A;  2DA6 A;  2DA7 A;  3GTQ J;  1MDM B;  2VPL A;  1K79 A;  3BT9 A;  2QQB A;  2EV5 A;  1QGP A;  5CPR B;  3SZG A;  2JRT A;  2IAI A;  3LA2 A;  1IUY A;  4CCJ A;  1E0E A;  3HM5 A;  2EQR A;  4HBL A;  4A2U A;  2CQX A;  1GVJ A;  2R7R A;  1ODD A;  3GO5 A;  4D0P A;  2HU9 A;  1S7A A;  1WH5 A;  3E5X A;  5EGO B;  1I3Q J;  2O03 A;  1YS7 A;  2FUG 2;  4AID A;  2CW8 A;  5DUI A;  3IH4 A;  1W7P B;  1KU9 A;  3I4P A;  4HV6 A;  1P2F A;  3G1O A;  3IWZ A;  4CHU A;  2BV6 A;  2E1M B;  1MJ9 A;  2OA4 A;  3GTO J;  1P4A A;  1RI7 A;  3S93 A;  2MAB A;  1E3P A;  3LSH A;  2LP0 A;  4A3D J;  1U3E M;  2LVS A;  1O57 A;  1RIO H;  1O7L A;  3DKX A;  4G12 A;  2O8X A;  2L0K A;  2RGV A;  4X6A J;  3ELK A;  3P9I A;  3ZXS A;  1X3Z B;  5FFZ A;  1MNM C;  2G9W A;  2MH2 A;  3VYU B;  2RRE A;  4Y3O A;  5FKM A;  1WPK A;  2X6X A;  1D3Y A;  3HOZ J;  2VKD A;  3VOE A; 
#chains in the Genus database with same CATH homology
 3EUH C;  4CH7 A;  2IGK A;  4D1Q A;  2L9N A;  3OYK A;  4HNU A;  1Y56 A;  1Z7L A;  3CP8 A;  3C2H A;  3L2W A;  2HPM A;  3MKY B;  4NUB A;  4KIT B;  1NG6 A;  1DGW Y;  1WJE A;  4NQW B;  4KJZ A;  2W82 A;  3S3N A;  1BR4 A;  2I8D A;  3CJQ B;  2LYC A;  1LKX A;  2BW3 A;  1SAU A;  4XMY A;  3EUA A;  2VLA A;  3H35 A;  2LG4 A;  4PSX A;  4BEH A;  4YEL A;  3AKZ A;  1QHG A;  2OV7 A;  1K6Y A;  2QKM B;  4AU7 A;  3OR1 C;  4CUG A;  4F93 B;  3VYS B;  4HPQ A;  3DQV C;  3OYF A;  2R7O A;  2R7S A;  3QOD A;  2Z2S B;  2KRC A;  5CQE A;  3VSK A;  4E7Z A;  4DBR A;  3N05 A;  2LY1 A;  2OUM A;  2V26 A;  4CSW A;  1G59 A;  4P5O A;  5KHD A;  4BJT A;  1YX5 A;  2Z16 A;  3K4C A;  4XLF A;  2DCE A;  4PFO A;  2LH9 A;  1Z21 A;  4LIT A;  4F92 B;  2HPI A;  2HVS A;  1T0F C;  1J09 A;  4BE2 A;  2CV0 A;  3VWB A;  3I9V 2;  1QU3 A;  3W2W A;  3SDB A;  3UR3 C;  1D1A A;  1X1D A;  3DPL C;  3OIP A;  1WJD A;  2VB6 A;  2VKH A;  4DBQ A;  1V5G A;  3BLY A;  5LD2 C;  1WJF A;  4ZDP A;  2ZXH A;  3AFH A;  3PJR A;  3RTR A;  5KNL A;  4II2 A;  5KCM A;  3V42 A;  1EA3 A;  2DT7 B;  4B44 A;  2O5R A;  2R7W A;  1YE9 A;  1FMW A;  2ZFU A;  4LG3 A;  2X51 A;  3S3O A;  2DJI A;  1UAA A;  4B43 A;  3L2U A;  4IQ4 A;  2Z1D A;  2K5C A;  4LIU A;  4U87 A;  2IS6 A;  4G6T B;  3S32 A;  3OR2 C;  1MMA A;  2HNH A;  1UEL B;  3AL0 C;  2LBF A;  3PSI A;  3OL4 A;  4IKF A;  1Z3X A;  3OIQ A;  2HVR A;  2W00 A;  3OS0 A;  3OMY A;  1UG0 A;  2K9L A;  2UUZ A;  2IS2 A;  2HDW A;  2P0W A;  2V1N A;  1KON A;  1LVK A;  3H9J A;  2VQG A;  4BS9 A;  3VYR B;  3NWT A;  3DTE A;  3OYH A;  4C30 A;  2DXI A;  3OWT A;  4HRI A;  3OYM A;  4IQJ A;  4OAY A;  2F6C A;  4ITV A;  3IAS 2;  2M7B A;  4HEA 2;  2R7T A;  4F91 B;  4E7J A;  3OYJ A;  1D1C A;  3J7A Y;  3HKZ A;  3K70 D;  2Q1Z B;  4XLH A;  1N77 A;  4X0G A;  4HST A;  1BR2 A;  2KDO A;  2ELJ A;  2UV1 A;  3K10 A;  4NC7 A;  3DLA A;  2A6T A;  2MC4 A;  4PFP A;  3H5A A;  2VIX A;  5JHF A;  1MW7 A;  2E1M C;  1MNE A;  4XKC A;  3OS1 A;  1X1B A;  4J00 A;  2X1E A;  4BQN A;  1GLN A;  2JVG A;  4PSW A;  1V5F A;  3IUO A;  2LY2 A;  3A2K A;  2Y0S A;  3K4K A;  2XC7 A;  1WJC A;  4QPO A;  3SEQ A;  5LFA A;  3D5L A;  4E7L A;  2VJ5 A;  2XF6 A;  3U21 A;  5FRM A;  2DOA A;  4B47 A;  3OY9 A;  3DU5 A;  1BOB A;  3OYA A;  3K70 C;  3W2A A;  3OYG A;  4JQF A;  3LSM A;  2K9M A;  2DT6 A;  4CCO A;  3M1C A;  2M0M A;  3DWL E;  3OYI A;  2L9S A;  2HZD A;  4F55 A;  1OLT A;  3I3L A;  1FMV A;  4PK4 A;  1LFP A;  3FHN A;  3ZQQ A;  1P9Q C;  5FRO A;  1BR1 A;  2BVL A;  2V4J C;  2XF5 A;  3RCO A;  2JVH A;  4AVZ A;  3DPU A;  1W36 D;  3OYC A;  3IAM 2;  4BJ5 C;  4XN3 A;  4ZYA A;  5HNF A;  5FRN A;  2AQF A;  4BJ6 C;  2ZSI B;  3S3M A;  2ZSH B;  1TZL A;  2M7A A;  1T95 A;  2X85 A;  3RSN A;  3W2V A;  4KT6 A;  4BU2 A;  4BEH B;  1D0Y A;  4H4K C;  2LC2 A;  3LL7 A;  2KRH A;  2KPM A;  4CA0 A;  2CH0 A;  3UNG C;  2K3P A;  3FKJ A;  1W36 C;  1JI8 A;  3QOE A;  2UWM A;  2GOM A;  2VXD A;  4BXF A;  3HL2 A;  4XOP A;  4U7B A;  2WAD A;  1NG7 A;  4B3X A;  3RQ4 A;  4ZC3 A;  3L2Q A;  3CF2 A;  3H9Q A;  2MFZ A;  3ZRG A;  4ZJZ A;  1X1C A;  4HG2 A;  3QYF A;  3C2G A;  4XOR A;  2XAU A;  4NC8 A;  3GBG A;  2VQH A;  4PJL A;  3OYD A;  2R7U A;  1DQU A;  2HVQ A;  4HNT A;  2X1C A;  4PJJ A;  3ZCO A;  4BE1 A;  4CCM A;  2KL4 A;  2WBM A;  4LIV A;  3HXL A;  1V5E A;  3M8J A;  3HUG B;  2KQR A;  2LRE A;  2MYS A;  3PSF A;  4P1W A;  4CCL A;  4DJA A;  3MKW B;  3KYL A;  4ZDO A;  2VL8 A;  1D0X A;  2R7Q A;  2PJR B;  4XKB A;  3PL8 A;  2W4S A;  2R7V A;  3A1Y A;  3LMM A;  3HOS A;  2GOX B;  4E7K A;  4FET A;  4PUS A;  3L2V A;  2CS3 A;  4BL0 B;  1D0Z A;  3PNV A;  2V9K A;  1R6R A;  1WJB A;  3TBI A;  3K4L A;  3CMM A;  4BGD A;  1MMN A;  3OYE A;  4XKW A;  2RNG A;  4RM3 A;  3PNY A;  2Q2E B;  4DIQ A;  2KLO A;  3KX2 A;  3CP2 A;  2BVM A;  2JUG A;  4C2U A;  1QHH D;  3LSG A;  3FDY A;  4BQO A;  3IP4 B;  2IS4 A;  3HC7 A;  4RMN A;  2IGN A;  3K6G A;  3DTI A;  2IXS A;  2M4K A;  3DPT A;  2L2O A;  2BOL A;  2M4G A;  4IZZ A;  2JSP A;  3LSK A;  2V7F A;  4GRI A;  5HOO A;  2WAE A;  2LRD A;  3VYT B;  4E7H A;  3LFU A;  4XOT A;  4ZTJ A;  2IGO A;  1SFK A;  3E0J B;  1PJR A;  4OWR B;  4HSR A;  2X6W A;  4II3 A;  4XON A;  3D5R C;  3DTK A;  3HG9 A;  3W3C A;  1WJA A;  2IS1 A;  2AQE A;  4JOM A;  2WY7 Q;  2VQL A;  2VAS A;  2W1O A;  3ONQ A;  2KMU A;  2VQC A;  2L5Q A;  2CMP A;  4E7I A;  3H5R A;  3ZR8 X;  3HPG A;  4XNF A;  3L2R A;  2CUJ A;  1HA8 A;  1DP3 A;  3QYB A;  3H0D A;  4ZTF A;  4NNJ A;  4RM2 A;  4CZC A;  3F9K A;  3PFY A;  3HPH A;  3LSI A;  3BCA A;  4DGW B;  2KZV A;  2W7N A;  4Y33 A;  4J01 A;  1MMD A;  3TL4 X;  4XM3 A;  3S8P A;  4CCK A;  3G2B A;  4C9Y A;  5HNH A;  4BE0 A;  3K4N A;  4XQF A;  4Y4R A;  2NOJ B;  1OR7 C;  2F4I A;  4KIS A;  2BW3 B;  2XF7 A;  2LOO A;  3OOU A;  1Y6I A;  2WA0 A;  3BC8 A;  5TGT A;  4BUP A;  4PJN A;  3QYE A;  3BG7 A;  1PYV A;  4EAT A;  4XLC A;  2A5W A;  1U0J A;  1X4O A;  4F3Q A;  2R7X A;  3SEZ A;  3VSL A;  3D5S C;  3MMY B;  1D1B A;  3BCB A;  1X4P A;  2VJI A;  3DEE A;  3TMO A;  4E7S A;  4XL9 A;  2VJ4 A;  2ZXI A;  2CV1 A;  2PMZ A;  2QKL B;  1G8X A;  3EUK L;  4C2T A;  3FBI B;  2WY8 Q;  3E1S A;  4BDZ A;  4AYB A;  1X19 A;  1YX3 A;  2XDV A;  4FAS D;  4B48 A;  2V6E A;  2OC6 A;  3H5N A;  2CFO A;  3VDX A;  4ANJ A;  4MLO A;  2X1D A;  1MMG A;  2CUZ A;  4BQQ A;  3PNT A;  3CES A;  4N4N B;  3K4B A;  1N75 A;  3DU6 A;  3NWS A;  3OYB A;  1MND A;  3K4M A;  2PJR A;  4E4H A;  4RLQ A;  3PUB A;  3AL0 B;  2X6Y A;  1TT0 A;  4XR6 A;  4BAC A;  2IGM A;  5CQG A;  2E5Z A;  2KHM A;  2VXZ A;  3K4J A;  3DKY A;  2KP6 A;  4OAZ A;  3SYT A;  3OS2 A;  3MKZ A;  1ZEL A;  4BDY A;  1AA7 A;  3A4C A;  2WB1 A;  2WAQ A;  1DGR M;  2RQQ A;  4XKV A;  4E6K G;  1LDK B;  4XLE A;  3HOT A;  2CV2 A;  4QPQ A;  1VZ0 A;  1X1A A;  4CCN A;  4IX7 A;  2VPL A;  2MD0 A;  3CJR B;  4YEJ A;  2VJJ A;  2LBF B;  1Z3Y A;  1WFX A;  5CKT A;  5CPR B;  3OL3 A;  3SZG A;  4CCJ A;  1N78 A;  3CZ6 A;  3RPU D;  1E0E A;  4ZDL A;  1S9H A;  2L7K A;  2R7R A;  1WJ5 A;  2HU9 A;  5HVQ C;  1ERD A;  2WAF A;  2FUG 2;  2CW8 A;  4XN0 A;  3EPZ A;  3FBN B;  2CW7 A;  4R79 A;  2E1M B;  4YRV A;  4F52 A;  3S93 A;  2MAB A;  3LSH A;  3KEY A;  4D9J A;  4DOZ A;  2JA2 A;  4RLF A;  3DKX A;  2R4G A;  3H9G A;  2HQA A;  4PJM A;  3ZXS A;  2F5V A;  2E60 A;  3ZGK A;  2XSJ C;  1IRX A;  2E5N A;  4XLA A;  3VYU B;  2RRE A;  4Y3O A;  2M3A A;  4N4O B;  5HLT A;  3BG6 A;  3MD2 A;  3OYL A;  2X6X A;  2VKD A;  3OYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...