2VQLA

Crystal structure of porb from corynebacterium glutamicum (crystal form iii)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
76
structure length
76
Chain Sequence
LSPQYNWVACGILEGGLKAAGVLEEGQYNRELAEAIAAKGEGFWTTQFPQIGDWNEDQAAALADRAQTCGLVKADT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Putative Alpha-Helical Porin from Corynebacterium Glutamicum.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Membrane protein
molecule keywords UNCHARACTERIZED PROTEIN CGL0972
total genus 26
structure length 76
sequence length 76
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11565 PorB Alpha helical Porin B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1280 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vqlA00
2VQHA 2VQGA 2VQLA
chains in the Genus database with same CATH superfamily
1I1GA 1V3FA 2Y75A 5H20A 1HKQA 4BQNA 4OIRF 4FX4A 2OPTA 2DMPA 2VJ5A 3OY9A 2JVHA 1EJ9A 2VIXA 3ZXSA 2F5FA 3C18A 1WJBA 1Y8RB 3S8PA 1IRGA 2NOGA 5JR3A 4P55A 4XRMA 3ASOH 4Q5SF 2D2WA 2P7VB 2WAEA 4RB2C 2ME0A 1KGSA 3K9TA 2BY3A 1X2MA 1Z05A 4LK1F 4QWQA 2QA4I 4LLLA 3DKWA 4LFUA 4GFBA 2R92J 2XAFA 4IZZA 5J40A 1T8IA 5E3OA 3OS1A 4M9ZA 3OWTA 3L2RA 2A6TA 3BWGA 1JT6A 4ON0A 2X9DA 3KP3A 1X1PA 2ZJQF 3QPTA 4BQOA 2DA1A 2JMWA 2M7AA 4A93J 1Z3XA 2OD5A 3GWZA 3GX4X 4BXXJ 4C2UA 4AIJA 3VYTB 2H09A 2ZMEB 4PJJA 3BR2A 3G3ZA 5GAGJ 3I58A 2DYSH 1VI0A 5CYVA 4IEJA 3PUFA 3HRUA 5F0FA 3HOZJ 2Z2SB 5EZHA 1YJ9I 5M5XJ 1EF4A 4Y7NJ 2FUG2 3BQZA 4IHYA 2ME6A 2X6XA 2VC0A 3I59A 2BY0A 4EJVA 1BC8C 4ZDOA 1HCRA 3Q9SA 1G3YA 2EH3A 5IYCJ 3OSFA 1ZARA 1O57A 1D3YA 5L3GA 1XTAA 3JRIA 3GLXA 2NVYJ 1YX3A 3KYCB 1RZ4A 3F6OA 4P9UA 4AD9A 3L2WA 2BYVE 1NK3P 4KMFA 3FBIB 5EF6A 2EFPA 1VQ9I 1WSUA 4HF0A 5CKTA 3AG3H 1XMKA 2CQNA 1KU3A 2A05A 5GTIC 4F92B 1P2FA 3PM1A 5B3SH 5HVQC 4YRVA 1B72A 4R79A 3CF5F 2RAEA 2DCEA 4II2A 3BPVA 4CCNA 2V1UA 1Z7LA 3RKQA 2Z99A 1R7JA 2RC4A 2X1EA 3TBIA 5E3NA 1MDMB 1QZEA 3FX3A 3WGIA 3QP6A 3ZOBA 5K5RA 1IDYA 1XPXA 2K9MA 2YU3A 1OKRA 4RGRA 5B1BH 5ILSA 5FRMA 2IA2A 3W2VA 5DCMA 4ZDLA 1X1AA 1U8BA 1ODDA 3GTJJ 1FBUA 2XPWA 1ONVA 1TW3A 1MBEA 2HQNA 1K79A 2XUBA 2R5YB 1CGPA 2JWTA 1YITI 1TZLA 3FWEA 3V8KA 2P0WA 3GO5A 3EPZA 2ICWG 5HS7A 2E60A 1GDTA 4EGYA 4NC7A 3CMYA 1T08B 3MEXA 2XRNA 5ICEA 4AYBN 1VQOI 2H6CA 1JKOC 1R49A 2KPMA 2ZSIB 3ZCOA 1XN7A 3SZTA 3DCFA 1ZELA 2JQ7A 2PJRA 4HPQA 3I54A 1WI9A 3DBHB 3GZ6A 1K6OA 2DFIA 2J5OA 2A5YB 2ZJ2A 3CCQI 2PJPA 5IYBJ 4EQQA 5FKNA 3JRGA 1D0YA 3HL2A 4F93B 2DMQA 3OSGA 1VQ4I 1WJCA 3BQYA 4C3HJ 3QPHA 5K5QA 3DU5A 4N9IA 4I7HA 5F6FA 5DYMA 4E7LA 1CF7B 4I6ZA 2EIKH 4XOTA 3SXYA 2DOAA 2E36A 2KRHA 3BJOA 1QVUA 1ULYA 4MLOA 4OU0A 4KT6A 3IRRA 3SQNA 1YO5C 1IRFA 2W00A 3KP7A 1JKRC 5F0CA 1DDNA 4OIQF 1SD7A 1WI3A 2LREA 2DU9A 1S7OA 4HSTA 4M6VA 1IUYA 4ABZA 3E6CC 1JT0A 2GM4A 1MMNA 4ZJZA 4II3A 5C4JJ 4XRSA 4MGRA 4M3FA 2VOPA 3FHZA 3PO3J 1R4MB 3LA2A 4M72A 3C3WA 3BTCA 4CDGA 1USSA 4YIRX 3NWTA 1BR1A 1MMGA 1OISA 1RPWA 2DPUA 4IQJA 1FBSA 2OF7A 4MHGA 5E1XA 3CCEI 2QKMB 1OCTC 2RQQA 1UMQA 1Z7UA 4PFOA 3PIOF 4BE2A 2R7XA 5D5VB 5FFZA 3K4LA 4D0PA 3JW4A 2Y69H 2A69F 4C2MJ 5DUKA 1MBHA 2E1MB 1XCBA 1OLTA 5E18F 5TRDA 4I02A 3OYJA 3P9KA 2QLZA 3HUGA 1EH7A 2F5EA 3RPUD 4ENKA 1AKHB 4HV6A 2O0YA 2ZNZA 3LL7A 4UB6C 4QIWN 1FC3A 3K4CA 3TO7A 2IGMA 1JTXA 2A07F 1WWXA 3JR9A 3F9KA 2ZFWA 3AKZA 3F8BA 1A35A 1W5SA 2XGCA 2IPQX 3EUHC 1H8AC 3RZDJ 4MQVA 1OYWA 1R58A 5GAHJ 3J7ZI 4EV0A 4HW0A 5LEJA 4XIDA 1N77A 2V79A 4RAGA 3OIPA 4W1UA 4XICA 3H5NA 2LTPA 3H1CA 3MZ8A 4OOIA 3DPTA 4U7DA 3BR1A 3KP4A 1IRZA 3B02A 4RLQA 1FZPB 2MH9A 3DEWA 1MD0A 4U0VA 1S72I 2PG4A 4U88A 4C2TA 1QPMA 2K3FA 3PFIA 3DTIA 2LF7A 3K4NA 1YLFA 2BZTA 2VT3A 2IGNA 3R0AA 3ABMH 4CZZA 4ZH4F 1BJAA 1V5FA 3JAMK 1WH5A 2YX7A 1QPIA 4R8HA 5FLXZ 1R71A 2HQAA 2GA2A 1FTTA 5JI6A 4LG0B 2HQ5A 2IP2A 4PDKA 4IO9F 1BW6A 5KVRA 4LG0A 2X4HA 3FXUA 2FXAA 5DM6F 2ISYA 2F5DA 3S1RJ 2OA4A 2VB6A 1A5JA 3ZQCA 5CLSA 2ZXWH 3K6GA 4B3XA 4ZZDA 4N9HA 1U9OA 4C3IJ 2ZJRF 4G7ZF 4LJZF 1X19A 1WFXA 4KT5C 2P7CB 3VDXA 1ZK8A 3FK6A 4F55A 5CVRA 2A6EF 2ZO4A 4NC8A 2R7RA 4LOCA 2HR3A 3PSIA 1BIAA 1E17A 2V1XA 5JLWA 4G8XA 2KDZA 1XCVA 2R7DA 1F1ZA 4IHTA 1T0FC 1X1DA 3QWLA 4HYEA 3K0LA 4B4CA 3VPRA 4HRIA 3LSMA 5DTDA 2O61A 2W7NA 2K9QA 5J47A 4G7OF 1IV8A 4ZYGA 3F8CA 5LBQA 3QYBA 4RGXA 3P9CA 1PVEA 4CCJA 2OZUA 3OYFA 3D5RC 5HS8A 1SVOA 1D1BA 1LFUP 1MNDA 2ZMEA 2KL4A 2QBYB 1U5TA 2IS6A 3SZPA 1HDPA 3FMRA 1VQ8I 2VL8A 3QYEA 3C2HA 1TBXA 1MBJA 2K4BA 3PL8A 5IP7J 1Y56A 2VJ4A 4J19A 4YIFA 4ZC3A 2LVSA 3CCMI 4ESJA 4L9VA 3M8JA 3SFZA 1P4XA 3S2DJ 3QODA 1PYVA 4ZYHA 1R6RA 3SEZA 2O7OA 4Q4ZF 3F8MA 3LSPA 3DFGA 2QSFX 4WCGA 4W97A 3DLLF 2DA3A 4CSWA 1YTYA 1IC8A 4L18B 1FOXA 1VQLI 3K10A 5A2QK 2AXLA 3BP8A 3FISA 4D9JA 1WH7A 4M73A 3BCBA 5K7FA 2JUCA 2EFNA 4DJAA 1C0WA 2BHZA 2VBWA 3P5JA 5J4VA 2R0QC 1P9QC 3ABLH 2L9NA 2I8DA 1TQIA 2EZHA 3ERED 1F4KA 3NEUA 4CHUA 2XGEA 3IC7A 2EA4A 4OINF 2AQEA 4S04A 3KYDB 2DODA 2OTJI 3SHFA 2E5NA 3HZJA 1O7LA 4ZTJA 2LC2A 2ZBKA 4BAYA 2D45A 2Y0MA 4GYIA 4Q48A 5CVVA 3DU6A 2ELHA 3BG9A 2PMZA 1I3QJ 3WTXC 4XKVA 1ZLJA 2ESNA 5GPCA 2MA3A 1R5GA 5DEQA 4EJWA 4GYGA 4B48A 1U78A 3WTSC 2Z33A 2BE5F 4WXCA 2KLOA 4HDVA 2K9SA 2DBBA 4DYCA 4QSHA 2DK8A 1YOVB 2HU9A 1VFCA 2OTLI 3CUOA 1OQYA 3CCUI 4BL0B 2W1OA 4BDYA 1Z77A 2IGKA 1W36D 2F4MB 2BY1A 5DDGA 2QSGX 3K69A 1IXCA 2PQ8A 2JA6J 3P7NA 2K7LA 5J4YA 3RIRA 4DZJA 1G59A 2DFFA 2JJ7A 2FA5A 1YS7A 4ZYEA 3JRBA 3WHBA 4B3AA 3S14J 1ZG3A 4PFPA 2VBZA 4HNVA 3A01B 2P5LC 3GYHX 4V2GA 3ULQB 1W36C 1G2HA 1U0JA 4KA4A 4XLAA 4IVNA 2L9VA 3R4KA 4A6DA 1OR7C 3CJTB 3CO6C 2XPVA 4ETSA 3UKGA 2J5PA 1MDMA 3GFMA 5FLXK 4HF2A 2COBA 5F04A 2KRFA 4JOMA 3MFKA 2EZKA 2VXZA 2ZMEC 3GEZA 4UUSB 3OL3A 1GHCA 4IL6C 1MMDA 3KLNA 2QQAA 3FMQA 2Y2ZA 3T8RA 4HQEA 1GXQA 4EM0B 2CRGA 4LMYA 2XPUA 4WXHA 1YIOA 1VQKI 4NQWB 1SEUA 2IS4A 5J1UA 3AL0B 2NYXA 4CCOA 3M1EA 4FETA 3CJRB 3I4PA 3PNYA 4RBOA 5J3LA 3J7AO 2QUFA 2AXTC 2CUZA 1APLC 5H2FC 2R7QA 1Z1DA 2F4IA 5FRNA 2MLGA 1Y8QB 3GFJA 4XSZF 2E2JJ 1EKEA 4BJTA 3EUKL 3ZMTA 3ELKA 1ENHA 1T95A 2DAOA 1FT9A 2ZKZA 1OCRH 3LA7A 5CQGA 4E4HA 1W0UA 3BR6A 3S1MJ 2H94A 3IRQA 3HB9A 1ON2A 4XN3A 3COAC 3SZGA 3TO6A 2L54A 1QHGA 2FQ4A 3LFUA 3OYGA 3HRMA 1B6AA 3G1OA 3OOPA 4E7ZA 5FLMJ 5H6RA 2CYYA 1ORKA 3E7LA 1P7JA 3FXMA 4IHWA 2W82A 2X48A 2FBKA 2M1BA 4J00A 3G6EI 3P9IA 3SDGA 3JTGA 2F6CA 3HSRA 2JSPA 2HZTA 1HSJA 2CFXA 2ZNYA 1U9NA 3X2QH 1L3LA 1SFXA 3DTEA 1ZN2A 1KQ0A 3I53A 3B6AA 5JFRA 3AG1H 2NVXJ 2H1KA 3HOYJ 2DT5A 5JHUA 4U0YA 3I3LA 2CQ7A 2GBYA 3QPLA 3H0DA 1W4MA 1Q1HA 3CDHA 3S3NA 3M3YJ 4DW6A 5ERIA 3OS0A 3JRAA 1MBGA 2M7BA 4DYRA 2KMUA 5FGMA 2BXZA 1NHAA 1MBKA 1OFCX 1P6RA 4AVZA 3LMMA 2UV1A 2BVLA 3BCAA 3H3UA 4XMYA 2FMLA 3GW2A 4HNUA 5B1AH 4I76A 3GFLA 3GTLJ 1BJZA 2FRHA 1BIBA 2RV8A 2XDVA 5IT3A 1J0RA 2DTRA 4CGZA 2Y0SN 1VQNI 2JSCA 4PJNA 2UXXA 4XLEA 1QZYA 4LGWA 3IAM2 4OMYA 3WTYC 2CW8A 1W1WE 3OOUA 3BLYA 5K5OA 5FKOA 1TP4A 3DKXA 1VQPI 1FJLA 1WQ2A 2XGDA 2DQRA 4C9YA 3L09A 1AHDP 1JI8A 5FB2A 4YELA 3SYTA 3I5UA 3ZQIA 5LFAA 3J7YJ 3HKZN 3H5AA 4YFKF 4EJTA 2VQHA 4E7IA 3E6DA 2XVCA 4MO7A 3HSEA 3CO7C 4HBLA 1ZQ3P 3M07A 2HDCA 3PO2J 2XROA 4BYYA 2E71A 4DBQA 1KYWA 1IZ1A 1R22A 4HX4A 4BE0A 5L3CA 4A3FJ 3CZ6A 4I98B 4LB6B 3HXLA 3I55I 1ETXA 3JRDA 2GLOA 3GLLA 5EEHA 1SMYF 1XS9A 5B5EC 3V42A 4LLNA 2EV0A 3VODA 1FY7A 1WJ5A 5GADJ 1TNTA 2DMTA 3V7CA 4ZTFA 4XOPA 2YU9J 3S3MA 1HW2A 2V1NA 1KU9A 2E1NA 3AAFA 1MZBA 3KPHA 1K83J 3W2WA 4G6QA 2QBYA 2R7FA 5D4SA 1JKPC 2KIUA 2BOLA 3EDPA 4BEHB 9ANTA 1TW2A 5EEAA 4ZZLA 2JA8J 4BEHA 3CCLI 3TW6A 4RB0A 4L5EA 4XLNF 2WY7Q 2XRLA 3HOVJ 3HGGA 3RQ4A 2DFEA 4Y13A 5LLQA 4BJ5C 2HPMA 2HEOA 4GO1A 1S5LC 1RKTA 3PQKA 5DV5A 2LFBA 3CCYA 1XGNA 4WXDA 2YSRA 3VFZA 3WU0A 2OCCH 4IF4A 2H6BA 5FROA 3HUGB 2IW5A 1XGOA 1MJBA 3HSFA 2VONA 3OYCA 3MKWB 3T1BA 1P92A 4OAYA 3ZQ7A 3ABKH 4CUGA 1K78A 3PNTA 2X1CA 1W5CC 3H36A 5E17F 4RLFA 5BPDA 1MKMA 2E34A 1JUMA 4EM1A 4A0XA 3J81K 1ACIA 2VN2A 4XQFA 1Z6TA 4AIDA 2XAJA 3MWMA 2H27A 4AVPA 2OQGA 2M87A 5EJCA 4NC6A 1Y6IA 3HPHA 5CVJA 3TL4X 1SFUA 5LGTA 1HOMA 4JQFA 4Y3OA 2VJIA 4P5OA 1TNSA 2XF7A 2HKOA 2L7ZA 1X4OA 1HF0A 1YHQI 4U7BA 1S9HA 2VBYA 1YRNA 3KIOA 4A5MA 4H0EA 2LP0A 1YJNI 4HA8A 4B09A 1SFEA 3DPUA 4HNTA 1HLVA 3S2HJ 2VKDA 4BS9A 3JRHA 2LD5A 2KIMA 1Z0XA 1QHHD 1NG6A 2OU2A 1QGPA 2EK5A 2LY9A 2R5ZB 1G4DA 4B44A 1CQTA 4IRIA 5ICCA 1Z3YA 1E3HA 3BG6A 3F72A 3I9V2 1MMAA 1XG1A 2CFOA 2HS5A 2P81A 5D5XB 2EPFA 3TO9A 2YS9A 4FT8A 1FNNA 2ZJPF 1HW1A 1Y1VJ 3FZVA 2W48A 1ETYA 1G8XA 2YR2A 5GAEJ 4L9NA 1QU3A 2LRDA 3BG7A 1W0TA 2FD5A 2MSYA 2QKLB 5IPAA 3CC2I 3TDZC 1FPQA 5DUIA 2GWRA 3DLAA 3T8TA 2LMDA 1FOYA 3K4MA 2V7FA 2I5UA 2V9VA 3VSKA 4F52A 3BG3A 4BHCA 2TDXA 3A1YA 4AUXA 5FKLA 2JA2A 1KZHA 1S29A 4LB5A 2LBFA 2EV5A 5DS9A 2E1CA 2ZXJA 3BZKA 3Q0VA 3BJAA 1STZA 1TWAJ 2FF4A 3TP0A 2RKHA 3C2BA 4X1EA 3LFKA 1R36A 2WA0A 4CYCA 2HTJA 3CDIA 4I99C 4IXAA 3HTSB 2CWEA 1A6QA 2VASA 2EIJH 2ID3A 1YW7A 4BHPA 4B8XA 5CJ9A 2QQ8A 4A3BJ 2M0CA 1AKHA 3SJMA 1KYZA 2HI3A 3IL2A 2RREA 3DQVC 3CCRI 4DYQA 1FIPA 3OYHA 2STWA 3PUBA 2PMUA 2CQKA 4A69C 2NRAC 3TDUC 1R5ID 2W25A 2FJ1A 1LE8B 3I64A 1WKMA 2QM3A 2VE8A 2DA7A 3J81Z 2B0LA 3TP3A 2CO5A 3JRFA 3WTWC 1DU0A 4BY1J 2RVCA 4M3BA 3OS2A 2LSOA 1J7KA 1V54H 4RB3C 3I56I 3N97A 3F8NA 2WB1A 2NVUB 5EEGA 2XIGA 1PP7U 1MSFC 1AA7A 4QLCU 5EG0A 5JVGF 2B63J 1GV5A 1JKQC 2QVOA 4NNJA 2XV4S 3QPSA 4BBRJ 2FMYA 4V2FA 1KQ8A 4FQGA 5E79C 4ITVA 5HOOA 1IF1A 2CMPA 1FIAA 3CUQA 2CUJA 4FHTA 3ZMSA 2JPBA 2W4SA 3L9FA 1S8NA 3MVPA 3N05A 3S2WA 4FASD 3QRFF 1F36A 1T39A 2GQQA 3ECHA 1ZRFA 1RNLA 3R60A 1Y39A 5L3EA 1QA6A 2EINH 2KIQA 1HQCA 2JUGA 3JSPA 2LYCA 2JA5J 4L0YB 5KAIC 4JX6A 1B1BA 2QSHX 2GOXB 2H1LA 5M3MJ 4IX7A 2LDUA 1TL8A 3RKWA 2JK3A 2KZGA 3TOBA 2G9WA 4XL9A 4FE4A 4ENNA 4BACA 2NS0A 4D5CA 5EZGA 2IT0A 1LVAA 2CUFA 5LRRA 4A3EJ 1R4NB 1FMWA 5JLXA 4FX0A 1T38A 1A36A 3W2AA 1RR7A 4PZJA 4UB8C 1D5YA 1H9GA 2O3FA 4B47A 3Q3SA 2IGOA 3FXOA 1T2KA 4ENMA 4Q47A 1SFKA 5IT9Z 1YG2A 3BDDA 2PLYA 1DP3A 4A3JJ 3OR2C 1TWFJ 1CF7A 1FTZA 2KISA 5EYRA 4P9FA 2YUSA 4PSXA 4Z6YA 2XASA 3IWZA 2Q2EA 3E5QA 5AIQA 2JRMA 4N0BA 3QYFA 1LPQA 4F3QA 3O8HA 2Z1DA 4EATA 3PNVA 1R9TJ 4A3KJ 1Z67A 3HGYA 3BG5A 1V55H 3HEFA 5ICFA 4IOCF 3S3OA 1WHUA 2P6SA 2EILH 3LQRA 3S16J 2DW4A 2D1VA 3O6BB 1HA8A 2CSOA 4CYCB 1ZR2A 1WCMJ 2LR8A 1NK2P 1K6YA 1AWCA 4A3DJ 4I0BA 2QYOA 3C1DA 1ETQA 4Y52J 1VF9A 3B6CA 5EGOB 1NH3A 5A2QZ 4DZPA 4QTRA 1BR2A 4HZFA 3L1PA 3CMAI 2VQLA 4CCKA 4HQMA 2HVRA 4HDUA 2LKPA 3H9JA 1V5EA 1LKXA 2K27A 3KP6A 4HSRA 2KZVA 3KZYA 2IVMA 5LHGA 3G2BA 1MJ9A 2ADUA 1LFBA 2M8GX 2MLKA 2PFBA 1RR8C 2LNBA 1E3OC 2ELJA 1SD6A 2ELKA 1PP8F 1LQ1A 1T56A 1I6XA 3TGNA 2BGCA 1BW5A 2PN6A 4A12A 1D5VA 4MTDA 4I01A 1JJ6C 2IA0A 4HAMA 4FE7A 1OCZH 4DNCA 1MJAA 1U6GA 2DMUA 1QNTA 4JX4A 5FKMA 5LGNA 2HXIA 3VYRB 5BS6A 3HPGA 2K9NA 2PI0A 5BPIA 2R7SA 5DM7F 3K4KA 1VQ6I 3DEUA 4BJ6C 4EJOA 4X6AJ 3OYEA 4U87A 4KJZA 3FKJA 2VPLA 4LIVA 4WF2A 4E70A 1E0EA 1J2XA 2EFQA 3VWBA 3OYLA 3ISPA 1GV2A 2ZSHB 4UV8A 2Y31A 1QZZA 4G94A 1YIJI 3F3XA 5F1RA 2XAHA 4NQWA 4BNCA 3FXQA 4KMUX 4BGDA 1HW5A 1BA5A 5LEKA 1LUJB 4BY7J 2C6YA 1B9NA 4Z2YA 4L9TA 3FBNB 3I4MJ 3U2RA 2CU7A 5LGUA 1O3SA 4IPAA 5FD6A 4UUSA 4AU7A 4MFEA 4BQQA 1DPRA 2XKOA 2LH9A 2L9RA 2JRTA 2CJJA 2M45A 5DCFA 1TWCJ 4AIHA 2Y48A 3LNQA 3ML6A 1G3WA 3ECOA 3FDYA 2HVSA 4GDFA 2BXYA 4A3LJ 2YX4A 4M3DA 2K86A 2V6CA 3K1PA 4CZCA 2IEKA 3JTHA 1ZAOA 1BI2A 1IUFA 4L9JA 2IJLA 5HLIA 2JA7J 4Y33A 5F08A 6PAXA 1FYKA 4NHJA 3QOEA 1MMSA 2ID6A 2Q0OA 2QWWA 3QU6A 1DQUA 5IT9K 1M1EB 2XF6A 3LQQA 5F27A 3OYIA 2HYFA 3PIPF 1D0XA 3H9GA 2VQGA 3M9AA 3CC4I 5HLHA 2XB5A 3OV8A 2W85A 3OYDA 4NUBA 3KP5A 3Q5FA 2DYRH 2CUEA 2EA2A 2QZ8A 5IP9J 2VLAA 1MGTA 1EV7A 1RUNA 2LF8A 4XLFA 3BR5A 2L9SA 2VE9A 1UZCA 2NAZA 1ETKA 2RGVA 3MZYA 5BNGA 1YRNB 2VOOA 4BE1A 1YW8A 3GVAA 1OPCA 1E2XA 2BVMA 2B9SA 2ISZA 4O3MA 3SDBA 4MIMA 3PFYA 4M3GA 2MD0A 2XHKA 1XSDA 2ZFUA 4PJLA 3MD2A 3EETA 2DDAA 2FQ3A 4CXFA 5HDNA 1IN8A 1LDJA 1LFPA 2M0MA 1X3WB 3RYPA 4YFNF 4LLGF 2W57A 3E6MA 3T0YA 4M6XA 3BR0A 3S15J 2Q1ZB 3M8FA 2LKSA 5IYDJ 2M34A 1ZGWA 2HGCA 4I09A 2PMHA 1W5TA 2DOFA 1HSTA 2G0EA 2P5KA 2LG4A 1JTYA 3JAMZ 4O6JA 3ZMUA 3CQZJ 1RI7A 1O7FA 2K40A 1BN5A 4KICA 1WJDA 3MCZA 4BH9A 3J80Z 2AS5F 1XGMA 1YW9A 3EUHA 5L3DA 2HTSA 4CH7A 2CV0A 2KQRA 1Z9CA 2EWNA 1I27A 3KCCA 3V7SA 3C2GA 3JCUC 2STTA 1ZG1A 3CLOA 1JGGA 4AC0A 2RN7A 2E35A 1IN6A 2GAUA 1A04A 1X4PA 1JUSA 4MFDA 1SMTA 1U8RA 3GTOJ 1D8JA 4E6KG 4RMNA 4BKXA 1R1VA 3BZ6A 4DOZA 2DN0A 2ACJA 3IH2A 1IN5A 3HRTA 5D6EA 2VJJA 1RKWA 2RNJA 2VT2A 5HLGA 1VZ0A 3FXLA 4DIQA 3KE2A 1XGSA 2O8XA 1IRXA 2A3SA 2DXIA 4QPOA 1IXSB 2QQBA 2X51A 1S3JA 2FNPA 4RB1A 2QCOA 3SFIA 2KJBA 3GBGA 3RDIA 1JGSA 2L4AA 5CVIA 4MTEA 3WGGA 3L2UA 3GTPJ 4PJMA 1IAWA 1ZH5A 1YFHA 1X1BA 4Y15A 4XNFA 4ANJA 2X0LA 2A61A 1XDUA 2OQRA 1OYYA 2K4JA 2K5CA 2W24A 3ZQGA 4L0ZB 1K4TA 2VI6A 1SD4A 5LHHA 1ZR4A 4G9YA 4XORA 3MAJA 4AIKA 2K02A 1J59A 2EQRA 4RGUA 4M74A 3E3VA 1J75A 3BROA 3MMYB 1VTNC 3EUAA 3S1NJ 4DGWB 3LOCA 4GRIA 2FSWA 3K7AJ 2JVGA 3TEDA 3LSRA 2JN6A 3OYBA 3IAS2 3QP5A 3ONQA 1BI1A 3ZQFA 5M5YJ 4IRHA 3CMMA 1IN4A 3H5RA 2ZXHA 2XAQA 2QEXI 5KK1A 2PX9A 3RYRA 1LB2A 1L0OC 2HDDA 4BHBA 3CF2A 4YFXF 4NBQA 2W84A 4KDPA 3RCOA 3O8GA 2Y30A 2O8KA 1W7PB 3OYKA 3LSJA 2Y9ZA 1WJEA 3T5XA 3WE3A 3DPLC 3GF2A 4YG2F 5D8LB 3UR3C 3V4GA 4A2UA 3FF5A 2JTVA 3MKZA 5DCMB 2DTZA 4IOAF 3A0BC 3JRCA 3CMEI 4G6TB 2NS8A 4FTHA 3KZIC 5J8CA 4G6DA 5KCMA 1WGXA 1FOKA 1ZKGA 1EH8A 5FO5A 4AWXB 4P96A 2E1MC 1XSVA 3EQLF 1UG2A 5E1ZB 2VKEA 3CJNA 4IQ4A 2EJRA 3OYMA 3GTGJ 1V5GA 2Z3YA 2E2HJ 5FJ8J 2EFOA 3AG4H 3M4OJ 2IXSA 1OCCH 2VXDA 4UVAA 4CCMA 2VODA 1UB9A 2ESHA 1X2NA 2GIZA 2V6EA 3IUOA 5IOZA 3CTAA 4RM3A 4C3JJ 2G7HA 4OAZA 5HDKA 4EGZA 2CV2A 1O4XA 1YX5A 3BPXA 3H92A 2DJIA 1X58A 4DQ2A 5ILVA 2CW7A 2RQPA 3FXKA 4PCQA 5GTHC 2L7FP 3RPUA 3BY6A 2E2IJ 1FOWA 1XSXA 1R00A 3G4SI 1IGNA 4XBFA 3CLQA 3WTZA 3ZP5A 3F21A 3N4MA 3LSGA 2MGQA 2V9PA 1QRYA 1J9IA 3B73A 2R3SA 2UXNA 1FMVA 1MNEA 2YPRA 4BXFA 2R7ZJ 1ZGAA 2A5WA 2NXNB 4EM2A 2PMZN 4RAZA 1ERDA 4XONA 3R0JA 2P4WA 2ZC2A 2AHQA 4BU2A 1I1SA 1O3QA 3ZQQA 3BC8A 3TKYA 1SVLA 2O03A 3D1NI 4S0HB 1KU7A 5HODA 3HYIA 2JZYA 3ASNH 2HVQA 1XMXA 4EVIA 2TCTA 2DT6A 1UCRA 1J09A 2V26A 1QQIA 4KIBA 3S93A 2V1DA 3L00A 2EFWA 1HC8A 3HRSA 3HOWJ 1NG7A 4K2EA 3RSNA 2WTEA 5C44J 4MQ9F 5HNHA 2NOJB 3IWFA 1MH4A 4C30A 4MEXF 1WJAA 5J1RA 3K1MA 2A68F 4A3GJ 3HOTA 1DGWY 2R4GA 1ZLKA 1XC5A 3K70C 1AOYA 2G7UA 4M6YA 4UVBA 3QQAA 2F5VA 5E8GA 2QENA 4D1QA 3FXJA 1IN7A 3K4BA 3FMSA 1HKTA 3FM3A 1ETWA 1PDNC 5BOXA 4E7KA 2WWYA 2HQRA 5E3LA 1MW7A 3WG9A 3LAPA 1FLIA 4WX9A 4I2OA 1YQAA 2BW3B 3M8EA 4L5IA 5BMZA 1ZRCA 3HIFA 3IH4A 3SEQA 4PSWA 2KHMA 1SAXA 2MW8A 5K1YA 4JK1X 2LY2A 2HYJA 4GCVA 2R7UA 4XKCA 1W7PA 1D1CA 3L7WA 4BQAA 5HDGA 5M5WJ 1TQPA 3VOEA 2CV1A 4ZYAA 2KRCA 2PBIA 3ABUA 2LK2A 2XB0X 5D5WB 3NAUA 4OIOF 1KONA 1J5YA 4MNUA 5JVTA 1D0ZA 1I3AA 5EDNA 1IV6A 2MD5A 3G1LA 1PUEE 3RZOJ 1H89C 5K7ZA 1V4RA 4LIUA 5J8FA 3GZNB 3BOQA 3DEEA 5IOYA 1TWGJ 3REOA 3WGHA 4JYKA 1GVJA 4KFCA 3OL4A 4QPQA 2WAQA 2HDWA 2IS1A 3HOXJ 2O5RA 3CUQB 1A31A 3AL0C 3D5SC 4A0ZA 2K85A 2XSDC 3J80K 1B4AA 2F48A 4FISA 2N8GA 3LWFA 4H4KC 4PGHA 3F6VA 3V7RA 1N78A 3JREA 3HBLA 2VQCA 3WG7H 3ZMVA 2KP6A 2HNHA 1F5TA 2FE3A 3VYSB 1T33A 5HS9A 4RA2A 3CP8A 2R5YA 1RESA 4Y4RA 1DPUA 1Z6RA 2O9LA 1UELB 3BJ6A 3A4CA 3WTTC 3CUQC 2L3DA 3F23A 1HKSA 3FIWA 1TTYA 2M4KA 3ROUA 3U1KA 2MC3A 3DBLB 1FP2A 1X3ZB 3KFWX 2V4JC 1JXSA 2NNNA 3DF8A 1WVRA 1G3TA 1VNDA 4JX5A 3S32A 2R7WA 2FU4A 4E7SA 3KP2A 4YIIA 3IH3A 2EZLA 5FD5A 3VEPA 2DPDA 2WADA 3K2ZA 1BR4A 2HFHA 3QAHA 4KITB 1FWZA 1YJWI 1FP1D 4D7NA 2A6HF 3PJRA 3MKYB 3ZN1A 3FK7A 3BZCA 4UV9A 2EB7A 1K61A 4G7HF 1EH6A 4ASNA 2GXBA 4S05A 1BI3A 3W6VA 3ZMDA 1MNMC 5JHFA 3CCJI 1ITYA 2HOTA 1Y0NA 1VQ7I 3HG9A 3IHUA 3O3KA 1WRJA 2DA6A 2VPRA 4NB5A 2R7TA 3NARA 1MBFA 2MH2A 1X1CA 2L02A 2VBXA 1RUOA 3TQNA 2VUMJ 1SAUA 2ZCWA 2DA5A 2OCEA 2DJNA 2OAZA 5F0HA 2BY2A 3JSOA 1ZRDA 1AU7A 1OMIA 4DBRA 3BT9A 4ESBA 3W6KB 3ZRGA 2L2OA 2X1DA 2Y0SA 3RKXA 4XKWA 1B72B 2X6YA 3WHCA 1S7EA 5KHDA 3ZR8X 3FKIJ 3RJPA 2DA2A 2D1HA 4U0WA 3E6BA 2KDOA 2OBPA 3AFHA 3WU1B 2CS3A 5CQEA 3K2AA 3GTQJ 1T0FA 3WE2A 1WJFA 1BL0A 4A3MJ 2GA1A 4A3IJ 2L4MA 2CG4A 3CD6I 4PGGA 1REPC 4M71A 5E8IA 2X6WA 1GT0C 4D7MA 2IAIA 4LITA 5CPRB 4UY8I 2E5ZA 1BC7C 3HTUA 3GFIA 2M2EA 2CH0A 3DTKA 2OC6A 1ZYRF 3DV8A 4FCYA 4UUVA 1DGRM 4P1WA 2FNAA 4A0YA 3A2KA 1U5TB 1WPKA 3W6JB 1I5ZA 4RDUA 1FYLA 4PJ0C 1JHFA 2M9HA 5F64A 3TMOA 4UXNA 3U9GA 4XLCA 2HXOA 4CICA 2GIVA 4ESFA 4ZYDA 3TOAA 5GPAA 1DP7P 2OV7A 2WAQN 4J01A 1E3PA 1UAAA 4BDZA 3Q0UA 2FBIA 1VQ5I 2IRFG 3BTLA 4KN7X 4F7ZA 1F43A 4XLPF 3CCSI 4X0GA 4E7JA 3A03A 4IHXA 3GTMJ 1EA3A 4Y17A 2IA1A 4M9XA 4B43A 5E20A 3WTVC 1SANA 1G3SA 1LDDA 1TWHJ 3G1MA 2XC7A 3R6SA 5HLTA 1X3UA 5H6QA 3WU2C 3LAJA 4BXUA 4R1HA 1SD5A 2R7OA 2NVTJ 3LA3A 3KEOA 3IKTA 3ZMZA 5E1WA 3BR3A 3OYAA 2BV6A 5HNFA 4WWCA 3Q9VA 3OYNA 1A6IA 1LDKB 4CYDA 3MKLA 4TV7A 2LBFB 2M30A 3CJQB 1YS6A 2V9KA 3S17J 3MN2A 3ZGKA 2MFZA 3NQOA 4JBAA 3E1SA 3H35A 2JT1A 2EZIA 2WV0A 3E97A 2KFDA 2L0KA 2HPIA 3LSKA 3HHGA 3HC7A 2DOEA 3HDDA 5FLVA 4GXOA 2NVQJ 3QOPA 4YEJA 3I71A 1LJ9A 1U5TC 1R1UA 3KZZA 4IRGA 1ZHFA 4XN0A 4IHSA 3A0HC 1Q1VA 2DT7B 2MBFA 4LK0F 1T6SA 2M3AA 4ZDPA 2BHYA 3A02A 4IKFA 2BEOA 3GMEA 1U2WA 2R7VA 3F22A 3RTRA 3FXRA 3K70D 4I0AA 2E7XA 4WK8F 2HWVA 3KX2A 2K9LA 3VSLA 3K4JA 1TQMA 2L7KA 1Y1WJ 3L2VA 2M4GA 3DWLE 2VC1A 4HEA2 3W3CA 1MIJA 1D8KA 3E5UA 5LHIA 3G73A 4NDLA 4KNYA 3S1QJ 3LSTA 3KETA 2LOOA 3WODF 2QGUA 4KISA 2CQQA 1UJ8A 1ZREA 2FX0A 2Q8KA 2COMA 1UHSA 2WAFA 3NWSA 4HF1A 1RC9A 2O6GE 1NTCA 1JUPA 3VB2A 2MC4A 3F0CA 5TISC 4E7HA 2LY1A 1HBXG 3GZ5A 2Y9YA 1ON1A 3OR1C 1WZ2A 1FEXA 3KYLA 3CCVI 3D0SA 5AIPA 3E5XA 3IP4B 5J6XA 2E7WA 3OIOA 3GXOA 2Z16A 1LE8A 3QU3A 2L7MP 3DKYA 3H9QA 5L3BA 4XK4A 3K1NA 2GXAA 3HKZA 4IHVA 3TW7A 3M1CA 5LRSA 4BUPA 2R93J 5FKKA 3IV5A 2Z5UA 4M3EA 1ZTRA 1O3TA 1XX5A 4RAFA 4EEFG 4D5FA 3J7AY 1BI0A 3NRVA 1RIOH 3HHHA 1XDSA 1IW7F 2IS2A 4KUMA 1YE9A 2KKOA 4MEYF 3HJEA 1FYMA 4HLYA 5C4XJ 2UWMA 3A01A 1B59A 2XAGA 4GGGA 2ZXIA 5EGOA 1U3EM 3HOUJ 1MH3A 4A5NA 5C3EJ 3LSHA 2DI3A 2WB1N 1USTA 4O5VA 4HG2A 4EMSA 1Y0UA 4F91B 2XGXA 2UUZA 3EYYA 4CO8A 4A6EA 1T98A 2ECCA 2EBIA 3KEQA 2EV6A 1ZG5A 3DBRB 4KIFA 2P8TA 4HOBA 1OCPA 1N75A 1SC7A 1DU6A 2H8WA 1HXDA 2IBDA 4PUSA 3V8LA 1IDZA 2XSJC 1R1TA 5E3MA 2X85A 1H9TA 3C7JA 3ZPLA 5M3FJ 1OR7A 2JPCA 1XD7A 4BBSJ 3F8FA 2RDPA 3H3ZA 1P4WA 2FBHA 2WC2A 3RI4A 1R5HA 3L2CA 2OJED 2OZ6A 1FSEA 1PUFB 2PJRB 2MYSA 1G6NA 1UG0A 3I0TA 1PUFA 2DDBA 5DD8A 2ECBA 2DO7A 5D5UB 1H88C 1TT0A 2DA4A 1O3RA 1FSHA 2Z9OA 2BBYA 1YYVA 1BOBA 4AYBA 4KIGA 3CP2A 1KU2A 5D8KB 1BBYA 2MG4A 3FHNA 4HX8A 4UVCA 2XAUA 1GLNA 1UHWA 2R5ZA 1ETVA 3O2PE 4XKBA 3U21A 4ENJA 1XB4A 3RKYA 3MZHA 2AO9A 3L2QA 1I50J 3PSFA 1GXPA 1JJ8C 3VYUB 2F2EA 1S6LA 2Q2EB 2HOSA 3BTJA 2GOMA 2GXGA 2DMNA 3RPQA 4A3CJ 2DK5A 2E19A 2HYGD 2M8EA 1TT5B 1K7AA 2ZB9A 1F9NA 3EYIA 2KJCA 2L5QA 1QBJA 4V19K 4HLXA 4UHTA 5IP6A 4CCLA 5ICGA 2LLKA 5D6FA 3RQIA 3ZQLA 5B66C 3ZQHA 2DQLA 1OYIA 3M7GA 1KQ9A 1PJRA 1P4AA 5D4RA 4RS8A 1P7IA 4RM2A 1OJLA 2FOWA 1OCOH 4JP0A 4XSXF 3I4NJ 1BM9A 1LEAA 5FFXA 2HKXA 4KN4X 1MSEC 3U1DA 4HV5A 5TGTA 2BW3A 2VKVA 3CC7I 1TC3C 3PQJA 3ZN0A 1JE8A 1IO2A 1B9MA 5L3FA 4N4NB 1I6HJ 3I59B 2EIMH 5GP9A 4XRSG 2K3PA 2H8RA 5BQTA 3LSIA 2HOAA 3CESA 5ILUA 3WTUC 3MQ0A 5DD4A 3R61A 3V8JA 1K4SA 4LD5A 1N25A 5F1JA 5LD2C 2ETHA 4HX7A 2CGPA 5ED4A 1KA8A 3BTIA 2RNGA 3D5LA 3GUDA 4XR6A 1BOAA 4M9SA 1VQMI 1B8IA 2DFHA 4G12A 3ERMA 3ESWB 3FM5A 1B8IB 1GVDA 2NNYA 1H0MA 1JHHA 1DUXC 4L5JA 2WV1A 3GCMA 1TLHB 2QQ9A 1I39A 1RETA 2FOKA 3H0GJ 2WY8Q 1UFMA 2D5VA 1YI2I 2LKXA 3ABTA 1ETOA 3E0JB 5CVUA 5IY5H 2P5VA 4XM3A 1HDDC 1LEBA 1Z21A 2AQFA 1XMAA 2HZDA 2B7EA 5TJJA 1R23A 2P6TA 3DP7A 4LG3A 5KAFC 3G71I 1S7AA 1SVMA 1LNWA 3H3VK 2NS7A 1GUUA 2CW0F 4OIPF 2M5WA 2KIFA 2HOEA 4XLHA 3GTKJ 4RAYA 1FBQA 2UZKA 1W7PD 4UUTA 1IXRC 2VKHA 1QVTA 3CDLA 3KLOA 4CA0A 1IJWC 2L01A 2CQXA 4OWRB 3HOSA 4XRFA 2QF7A 2X6OA 5K7HA 1D1AA 3AG2H 2XF5A 4UNOA 4N4OB 4PK4A 3UNGC 2GZWA 4IJAA 5EG0B 1Z91A 1RRJA 4KYWA 1ZGJA 3OMYA 1UHMA 4OMZA 2F5CA 2DLLA 3IKVA 1K78B 1LVKA 4AM3A 4EJUA 2I10A 2TRTA 5KNLA 3OIQA 1QO0D 2FEZA 1SFOJ 3KEYA 5AONA 4B1RA 2PEXA 3HM5A 4RGSA 1IG7A 2KT0A 1FX7A 2OUMA 1POGA 3Q0WA 5J1YA 3DXJF 2WBMA 2XKPA 2F4OB 2E1OA 2MABA
chains in the Genus database with same CATH topology
2V4JC 4CCKA 1OR7C 2HVRA 3H9JA 1V5EA 1LKXA 4HSRA 3S32A 4BQNA 2KZVA 2R7WA 4JOMA 4E7SA 2VXZA 2VJ5A 3G2BA 3OY9A 2JVHA 2WADA 2VIXA 3OL3A 3ZXSA 4KITB 1BR4A 1MMDA 1WJBA 3S8PA 2ELJA 3PJRA 3MKYB 4NQWB 2WAEA 2IS4A 3AL0B 5JHFA 4CCOA 4FETA 3CJRB 3VYRB 3HG9A 3PNYA 3HPGA 2CUZA 2R7TA 4IZZA 2R7QA 3OS1A 2F4IA 5FRNA 3OWTA 3L2RA 1X1CA 2A6TA 2R7SA 4BJTA 3EUKL 3K4KA 1SAUA 1T95A 5CQGA 4E4HA 4BQOA 2M7AA 4BJ6C 1Z3XA 4XN3A 3OYEA 4C2UA 3SZGA 4DBRA 4U87A 3VYTB 4KJZA 1QHGA 3LFUA 3OYGA 3FKJA 3ZRGA 4PJJA 2VPLA 4LIVA 2L2OA 4E7ZA 2X1DA 1E0EA 2Y0SA 3VWBA 3OYLA 4XKWA 2X6YA 2ZSHB 2W82A 5KHDA 3ZR8X 2Z2SB 4J00A 4BGDA 2KDOA 3AFHA 2FUG2 2F6CA 2JSPA 3FBNB 2CS3A 2X6XA 5CQEA 1WJFA 3DTEA 4ZDOA 4AU7A 4BQQA 2LH9A 2X6WA 3I3LA 4LITA 5CPRB 2E5ZA 3H0DA 3FDYA 2HVSA 2CH0A 3S3NA 1YX3A 2OC6A 3DTKA 4CZCA 3OS0A 3L2WA 1DGRM 2M7BA 4P1WA 3FBIB 3A2KA 4Y33A 2KMUA 3QOEA 3TMOA 5CKTA 4XLCA 1DQUA 4AVZA 3LMMA 2UV1A 5HVQC 2BVLA 2XF6A 3BCAA 4XMYA 4F92B 3OYIA 4HNUA 4YRVA 4R79A 1D0XA 2DCEA 2OV7A 3H9GA 4II2A 2VQGA 4CCNA 4J01A 1UAAA 4BDZA 1Z7LA 2X1EA 3TBIA 4X0GA 4E7JA 3OYDA 2XDVA 4NUBA 1EA3A 4B43A 4PJNA 4XLEA 2VLAA 3IAM2 2XC7A 4XLFA 2CW8A 3OOUA 5HLTA 2L9SA 3BLYA 2K9MA 5FRMA 3DKXA 3W2VA 4ZDLA 1X1AA 4BE1A 4C9YA 2BVMA 1JI8A 2R7OA 4YELA 3SDBA 3SYTA 5LFAA 3PFYA 3H5AA 2MD0A 3OYAA 2VQHA 4E7IA 2ZFUA 4PJLA 5HNFA 1TZLA 3MD2A 2P0WA 3OYNA 3EPZA 1LDKB 2LBFB 4DBQA 2E60A 3CJQB 4NC7A 2V9KA 4BE0A 1LFPA 3ZGKA 2M0MA 2MFZA 3CZ6A 2KPMA 3E1SA 3H35A 3HXLA 2ZSIB 3ZCOA 1ZELA 2HPIA 2PJRA 3LSKA 4HPQA 3HC7A 2Q1ZB 3V42A 4YEJA 2LG4A 1D0YA 1WJ5A 3HL2A 4F93B 4XN0A 4ZTFA 4XOPA 1WJDA 3S3MA 2DT7B 2V1NA 1WJCA 2M3AA 4ZDPA 3DU5A 3W2WA 4E7LA 4IKFA 4CH7A 2CV0A 4XOTA 2KQRA 2R7VA 2DOAA 3C2GA 3RTRA 3K70D 2BOLA 2KRHA 4BEHB 3KX2A 2K9LA 3VSLA 3K4JA 2L7KA 1X4PA 4BEHA 3L2VA 4E6KG 4RMNA 4MLOA 4DOZA 4KT6A 2W00A 2WY7Q 2M4GA 3DWLE 4HEA2 2VJJA 3RQ4A 3W3CA 2LREA 4BJ5C 2HPMA 1VZ0A 4HSTA 4DIQA 2LOOA 4KISA 1MMNA 1IRXA 4ZJZA 4II3A 2DXIA 4QPOA 5FROA 3HUGB 2WAFA 3NWSA 2X51A 4E7HA 2MC4A 3OYCA 3GBGA 2LY1A 3MKWB 3OR1C 4OAYA 3L2UA 4CUGA 4PJMA 3NWTA 3KYLA 1BR1A 1MMGA 3PNTA 2X1CA 4IQJA 1X1BA 4XNFA 4ANJA 4RLFA 3IP4B 4XQFA 2K5CA 2Z16A 2QKMB 2RQQA 4PFOA 2R7XA 3DKYA 4BE2A 3H9QA 3K4LA 1Y6IA 3HPHA 3HKZA 3TL4X 2E1MB 3M1CA 4XORA 4BUPA 1OLTA 4JQFA 4Y3OA 2VJIA 4P5OA 2XF7A 1X4OA 3MMYB 4U7BA 3OYJA 1S9HA 3EUAA 3J7AY 4DGWB 3RPUD 4GRIA 3LL7A 2IS2A 2JVGA 3DPUA 4HNTA 3K4CA 2VKDA 1YE9A 4BS9A 2IGMA 3OYBA 3IAS2 3ONQA 1QHHD 3F9KA 1NG6A 3AKZA 3CMMA 2UWMA 3H5RA 2ZXIA 2ZXHA 4B44A 3EUHC 1Z3YA 3BG6A 3I9V2 1MMAA 2CFOA 3LSHA 3CF2A 4HG2A 3RCOA 4F91B 2UUZA 1N77A 3OIPA 3OYKA 3H5NA 1WJEA 1G8XA 3DPTA 1QU3A 2LRDA 3BG7A 3DPLC 4RLQA 1N75A 2QKLB 3UR3C 4C2TA 4PUSA 3DLAA 3MKZA 2XSJC 3DTIA 2X85A 3K4MA 4G6TB 2V7FA 3VSKA 3K4NA 2IGNA 4F52A 1V5FA 5KCMA 3A1YA 2E1MC 2JA2A 4IQ4A 3OYMA 2LBFA 1V5GA 2HQAA 2PJRB 2MYSA 2IXSA 2VXDA 4CCMA 1UG0A 2V6EA 3IUOA 4RM3A 2VB6A 1TT0A 2WA0A 3K6GA 4B3XA 4OAZA 2CV2A 1YX5A 2DJIA 1BOBA 2VASA 4AYBA 3CP2A 1X19A 1WFXA 2CW7A 3VDXA 3FHNA 4F55A 2XAUA 4NC8A 2R7RA 1GLNA 2RREA 3PSIA 3U21A 4XKBA 3DQVC 3OYHA 3L2QA 3PSFA 3VYUB 3LSGA 3PUBA 2Q2EB 1T0FC 1X1DA 2GOMA 1FMVA 1MNEA 4BXFA 4HRIA 2A5WA 3LSMA 2W7NA 1ERDA 4XONA 2L5QA 4BU2A 3ZQQA 3QYBA 4CCLA 3OS2A 4CCJA 3BC8A 3OYFA 2WB1A 3D5RC 1D1BA 1AA7A 1MNDA 1PJRA 2HVQA 2KL4A 2DT6A 2IS6A 1J09A 2V26A 4RM2A 3S93A 4NNJA 2VL8A 3QYEA 3C2HA 1NG7A 3RSNA 3PL8A 5TGTA 4ITVA 5HOOA 2BW3A 2CMPA 5HNHA 2CUJA 2NOJB 4C30A 1Y56A 1WJAA 2W4SA 2VJ4A 4ZC3A 4N4NB 1DGWY 2R4GA 3M8JA 3N05A 4FASD 3HOTA 2K3PA 3QODA 1PYVA 3K70C 2F5VA 1R6RA 3SEZA 4D1QA 3LSIA 3CESA 3K4BA 4CSWA 2JUGA 5LD2C 2LYCA 3K10A 4E7KA 2RNGA 2GOXB 3D5LA 4D9JA 4IX7A 4XR6A 3BCBA 4DJAA 1MW7A 4XL9A 2BW3B 4BACA 1P9QC 2L9NA 2I8DA 3SEQA 4PSWA 2KHMA 1FMWA 2WY8Q 2LY2A 2R7UA 3W2AA 4XKCA 2AQEA 1D1CA 3E0JB 4B47A 4XM3A 2E5NA 2CV1A 4ZYAA 4ZTJA 2KRCA 2IGOA 2LC2A 1Z21A 1KONA 2AQFA 2HZDA 1D0ZA 4LG3A 3DU6A 1SFKA 1DP3A 2PMZA 3OR2C 4XKVA 4LIUA 3DEEA 4PSXA 4XLHA 3OL4A 4B48A 3QYFA 4QPQA 4F3QA 2Z1DA 4EATA 2KLOA 2HDWA 2WAQA 3PNVA 2IS1A 2O5RA 2VKHA 3AL0C 2HU9A 3D5SC 4CA0A 3HOSA 4BL0B 4OWRB 3S3OA 2W1OA 4BDYA 2IGKA 1W36D 4H4KC 1D1AA 1N78A 2XF5A 1HA8A 4N4OB 2VQCA 4PK4A 3UNGC 2KP6A 2HNHA 3OMYA 1G59A 1K6YA 3VYSB 3CP8A 1LVKA 4Y4RA 5KNLA 3OIQA 3KEYA 1UELB 3A4CA 4PFPA 2OUMA 2M4KA 1BR2A 1W36C 2WBMA 1U0JA 4XLAA 2VQLA 2MABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQH A;  2VQG A;  2VQL A; 
#chains in the Genus database with same CATH topology
 1I1G A;  1V3F A;  2Y75 A;  5H20 A;  1HKQ A;  4BQN A;  4OIR F;  4FX4 A;  2OPT A;  2DMP A;  2VJ5 A;  3OY9 A;  2JVH A;  1EJ9 A;  2VIX A;  3ZXS A;  2F5F A;  3C18 A;  1WJB A;  1Y8R B;  3S8P A;  1IRG A;  2NOG A;  5JR3 A;  4P55 A;  4XRM A;  3ASO H;  4Q5S F;  2D2W A;  2P7V B;  2WAE A;  4RB2 C;  2ME0 A;  1KGS A;  3K9T A;  2BY3 A;  1X2M A;  1Z05 A;  4LK1 F;  4QWQ A;  2QA4 I;  4LLL A;  3DKW A;  4LFU A;  4GFB A;  2R92 J;  2XAF A;  4IZZ A;  5J40 A;  1T8I A;  5E3O A;  3OS1 A;  4M9Z A;  3OWT A;  3L2R A;  2A6T A;  3BWG A;  1JT6 A;  4ON0 A;  2X9D A;  3KP3 A;  1X1P A;  2ZJQ F;  3QPT A;  4BQO A;  2DA1 A;  2JMW A;  2M7A A;  4A93 J;  1Z3X A;  2OD5 A;  3GWZ A;  3GX4 X;  4BXX J;  4C2U A;  4AIJ A;  3VYT B;  2H09 A;  2ZME B;  4PJJ A;  3BR2 A;  3G3Z A;  5GAG J;  3I58 A;  2DYS H;  1VI0 A;  5CYV A;  4IEJ A;  3PUF A;  3HRU A;  5F0F A;  3HOZ J;  2Z2S B;  5EZH A;  1YJ9 I;  5M5X J;  1EF4 A;  4Y7N J;  2FUG 2;  3BQZ A;  4IHY A;  2ME6 A;  2X6X A;  2VC0 A;  3I59 A;  2BY0 A;  4EJV A;  1BC8 C;  4ZDO A;  1HCR A;  3Q9S A;  1G3Y A;  2EH3 A;  5IYC J;  3OSF A;  1ZAR A;  1O57 A;  1D3Y A;  5L3G A;  1XTA A;  3JRI A;  3GLX A;  2NVY J;  1YX3 A;  3KYC B;  1RZ4 A;  3F6O A;  4P9U A;  4AD9 A;  3L2W A;  2BYV E;  1NK3 P;  4KMF A;  3FBI B;  5EF6 A;  2EFP A;  1VQ9 I;  1WSU A;  4HF0 A;  5CKT A;  3AG3 H;  1XMK A;  2CQN A;  1KU3 A;  2A05 A;  5GTI C;  4F92 B;  1P2F A;  3PM1 A;  5B3S H;  5HVQ C;  4YRV A;  1B72 A;  4R79 A;  3CF5 F;  2RAE A;  2DCE A;  4II2 A;  3BPV A;  4CCN A;  2V1U A;  1Z7L A;  3RKQ A;  2Z99 A;  1R7J A;  2RC4 A;  2X1E A;  3TBI A;  5E3N A;  1MDM B;  1QZE A;  3FX3 A;  3WGI A;  3QP6 A;  3ZOB A;  5K5R A;  1IDY A;  1XPX A;  2K9M A;  2YU3 A;  1OKR A;  4RGR A;  5B1B H;  5ILS A;  5FRM A;  2IA2 A;  3W2V A;  5DCM A;  4ZDL A;  1X1A A;  1U8B A;  1ODD A;  3GTJ J;  1FBU A;  2XPW A;  1ONV A;  1TW3 A;  1MBE A;  2HQN A;  1K79 A;  2XUB A;  2R5Y B;  1CGP A;  2JWT A;  1YIT I;  1TZL A;  3FWE A;  3V8K A;  2P0W A;  3GO5 A;  3EPZ A;  2ICW G;  5HS7 A;  2E60 A;  1GDT A;  4EGY A;  4NC7 A;  3CMY A;  1T08 B;  3MEX A;  2XRN A;  5ICE A;  4AYB N;  1VQO I;  2H6C A;  1JKO C;  1R49 A;  2KPM A;  2ZSI B;  3ZCO A;  1XN7 A;  3SZT A;  3DCF A;  1ZEL A;  2JQ7 A;  2PJR A;  4HPQ A;  3I54 A;  1WI9 A;  3DBH B;  3GZ6 A;  1K6O A;  2DFI A;  2J5O A;  2A5Y B;  2ZJ2 A;  3CCQ I;  2PJP A;  5IYB J;  4EQQ A;  5FKN A;  3JRG A;  1D0Y A;  3HL2 A;  4F93 B;  2DMQ A;  3OSG A;  1VQ4 I;  1WJC A;  3BQY A;  4C3H J;  3QPH A;  5K5Q A;  3DU5 A;  4N9I A;  4I7H A;  5F6F A;  5DYM A;  4E7L A;  1CF7 B;  4I6Z A;  2EIK H;  4XOT A;  3SXY A;  2DOA A;  2E36 A;  2KRH A;  3BJO A;  1QVU A;  1ULY A;  4MLO A;  4OU0 A;  4KT6 A;  3IRR A;  3SQN A;  1YO5 C;  1IRF A;  2W00 A;  3KP7 A;  1JKR C;  5F0C A;  1DDN A;  4OIQ F;  1SD7 A;  1WI3 A;  2LRE A;  2DU9 A;  1S7O A;  4HST A;  4M6V A;  1IUY A;  4ABZ A;  3E6C C;  1JT0 A;  2GM4 A;  1MMN A;  4ZJZ A;  4II3 A;  5C4J J;  4XRS A;  4MGR A;  4M3F A;  2VOP A;  3FHZ A;  3PO3 J;  1R4M B;  3LA2 A;  4M72 A;  3C3W A;  3BTC A;  4CDG A;  1USS A;  4YIR X;  3NWT A;  1BR1 A;  1MMG A;  1OIS A;  1RPW A;  2DPU A;  4IQJ A;  1FBS A;  2OF7 A;  4MHG A;  5E1X A;  3CCE I;  2QKM B;  1OCT C;  2RQQ A;  1UMQ A;  1Z7U A;  4PFO A;  3PIO F;  4BE2 A;  2R7X A;  5D5V B;  5FFZ A;  3K4L A;  4D0P A;  3JW4 A;  2Y69 H;  2A69 F;  4C2M J;  5DUK A;  1MBH A;  2E1M B;  1XCB A;  1OLT A;  5E18 F;  5TRD A;  4I02 A;  3OYJ A;  3P9K A;  2QLZ A;  3HUG A;  1EH7 A;  2F5E A;  3RPU D;  4ENK A;  1AKH B;  4HV6 A;  2O0Y A;  2ZNZ A;  3LL7 A;  4UB6 C;  4QIW N;  1FC3 A;  3K4C A;  3TO7 A;  2IGM A;  1JTX A;  2A07 F;  1WWX A;  3JR9 A;  3F9K A;  2ZFW A;  3AKZ A;  3F8B A;  1A35 A;  1W5S A;  2XGC A;  2IPQ X;  3EUH C;  1H8A C;  3RZD J;  4MQV A;  1OYW A;  1R58 A;  5GAH J;  3J7Z I;  4EV0 A;  4HW0 A;  5LEJ A;  4XID A;  1N77 A;  2V79 A;  4RAG A;  3OIP A;  4W1U A;  4XIC A;  3H5N A;  2LTP A;  3H1C A;  3MZ8 A;  4OOI A;  3DPT A;  4U7D A;  3BR1 A;  3KP4 A;  1IRZ A;  3B02 A;  4RLQ A;  1FZP B;  2MH9 A;  3DEW A;  1MD0 A;  4U0V A;  1S72 I;  2PG4 A;  4U88 A;  4C2T A;  1QPM A;  2K3F A;  3PFI A;  3DTI A;  2LF7 A;  3K4N A;  1YLF A;  2BZT A;  2VT3 A;  2IGN A;  3R0A A;  3ABM H;  4CZZ A;  4ZH4 F;  1BJA A;  1V5F A;  3JAM K;  1WH5 A;  2YX7 A;  1QPI A;  4R8H A;  5FLX Z;  1R71 A;  2HQA A;  2GA2 A;  1FTT A;  5JI6 A;  4LG0 B;  2HQ5 A;  2IP2 A;  4PDK A;  4IO9 F;  1BW6 A;  5KVR A;  4LG0 A;  2X4H A;  3FXU A;  2FXA A;  5DM6 F;  2ISY A;  2F5D A;  3S1R J;  2OA4 A;  2VB6 A;  1A5J A;  3ZQC A;  5CLS A;  2ZXW H;  3K6G A;  4B3X A;  4ZZD A;  4N9H A;  1U9O A;  4C3I J;  2ZJR F;  4G7Z F;  4LJZ F;  1X19 A;  1WFX A;  4KT5 C;  2P7C B;  3VDX A;  1ZK8 A;  3FK6 A;  4F55 A;  5CVR A;  2A6E F;  2ZO4 A;  4NC8 A;  2R7R A;  4LOC A;  2HR3 A;  3PSI A;  1BIA A;  1E17 A;  2V1X A;  5JLW A;  4G8X A;  2KDZ A;  1XCV A;  2R7D A;  1F1Z A;  4IHT A;  1T0F C;  1X1D A;  3QWL A;  4HYE A;  3K0L A;  4B4C A;  3VPR A;  4HRI A;  3LSM A;  5DTD A;  2O61 A;  2W7N A;  2K9Q A;  5J47 A;  4G7O F;  1IV8 A;  4ZYG A;  3F8C A;  5LBQ A;  3QYB A;  4RGX A;  3P9C A;  1PVE A;  4CCJ A;  2OZU A;  3OYF A;  3D5R C;  5HS8 A;  1SVO A;  1D1B A;  1LFU P;  1MND A;  2ZME A;  2KL4 A;  2QBY B;  1U5T A;  2IS6 A;  3SZP A;  1HDP A;  3FMR A;  1VQ8 I;  2VL8 A;  3QYE A;  3C2H A;  1TBX A;  1MBJ A;  2K4B A;  3PL8 A;  5IP7 J;  1Y56 A;  2VJ4 A;  4J19 A;  4YIF A;  4ZC3 A;  2LVS A;  3CCM I;  4ESJ A;  4L9V A;  3M8J A;  3SFZ A;  1P4X A;  3S2D J;  3QOD A;  1PYV A;  4ZYH A;  1R6R A;  3SEZ A;  2O7O A;  4Q4Z F;  3F8M A;  3LSP A;  3DFG A;  2QSF X;  4WCG A;  4W97 A;  3DLL F;  2DA3 A;  4CSW A;  1YTY A;  1IC8 A;  4L18 B;  1FOX A;  1VQL I;  3K10 A;  5A2Q K;  2AXL A;  3BP8 A;  3FIS A;  4D9J A;  1WH7 A;  4M73 A;  3BCB A;  5K7F A;  2JUC A;  2EFN A;  4DJA A;  1C0W A;  2BHZ A;  2VBW A;  3P5J A;  5J4V A;  2R0Q C;  1P9Q C;  3ABL H;  2L9N A;  2I8D A;  1TQI A;  2EZH A;  3ERE D;  1F4K A;  3NEU A;  4CHU A;  2XGE A;  3IC7 A;  2EA4 A;  4OIN F;  2AQE A;  4S04 A;  3KYD B;  2DOD A;  2OTJ I;  3SHF A;  2E5N A;  3HZJ A;  1O7L A;  4ZTJ A;  2LC2 A;  2ZBK A;  4BAY A;  2D45 A;  2Y0M A;  4GYI A;  4Q48 A;  5CVV A;  3DU6 A;  2ELH A;  3BG9 A;  2PMZ A;  1I3Q J;  3WTX C;  4XKV A;  1ZLJ A;  2ESN A;  5GPC A;  2MA3 A;  1R5G A;  5DEQ A;  4EJW A;  4GYG A;  4B48 A;  1U78 A;  3WTS C;  2Z33 A;  2BE5 F;  4WXC A;  2KLO A;  4HDV A;  2K9S A;  2DBB A;  4DYC A;  4QSH A;  2DK8 A;  1YOV B;  2HU9 A;  1VFC A;  2OTL I;  3CUO A;  1OQY A;  3CCU I;  4BL0 B;  2W1O A;  4BDY A;  1Z77 A;  2IGK A;  1W36 D;  2F4M B;  2BY1 A;  5DDG A;  2QSG X;  3K69 A;  1IXC A;  2PQ8 A;  2JA6 J;  3P7N A;  2K7L A;  5J4Y A;  3RIR A;  4DZJ A;  1G59 A;  2DFF A;  2JJ7 A;  2FA5 A;  1YS7 A;  4ZYE A;  3JRB A;  3WHB A;  4B3A A;  3S14 J;  1ZG3 A;  4PFP A;  2VBZ A;  4HNV A;  3A01 B;  2P5L C;  3GYH X;  4V2G A;  3ULQ B;  1W36 C;  1G2H A;  1U0J A;  4KA4 A;  4XLA A;  4IVN A;  2L9V A;  3R4K A;  4A6D A;  1OR7 C;  3CJT B;  3CO6 C;  2XPV A;  4ETS A;  3UKG A;  2J5P A;  1MDM A;  3GFM A;  5FLX K;  4HF2 A;  2COB A;  5F04 A;  2KRF A;  4JOM A;  3MFK A;  2EZK A;  2VXZ A;  2ZME C;  3GEZ A;  4UUS B;  3OL3 A;  1GHC A;  4IL6 C;  1MMD A;  3KLN A;  2QQA A;  3FMQ A;  2Y2Z A;  3T8R A;  4HQE A;  1GXQ A;  4EM0 B;  2CRG A;  4LMY A;  2XPU A;  4WXH A;  1YIO A;  1VQK I;  4NQW B;  1SEU A;  2IS4 A;  5J1U A;  3AL0 B;  2NYX A;  4CCO A;  3M1E A;  4FET A;  3CJR B;  3I4P A;  3PNY A;  4RBO A;  5J3L A;  3J7A O;  2QUF A;  2AXT C;  2CUZ A;  1APL C;  5H2F C;  2R7Q A;  1Z1D A;  2F4I A;  5FRN A;  2MLG A;  1Y8Q B;  3GFJ A;  4XSZ F;  2E2J J;  1EKE A;  4BJT A;  3EUK L;  3ZMT A;  3ELK A;  1ENH A;  1T95 A;  2DAO A;  1FT9 A;  2ZKZ A;  1OCR H;  3LA7 A;  5CQG A;  4E4H A;  1W0U A;  3BR6 A;  3S1M J;  2H94 A;  3IRQ A;  3HB9 A;  1ON2 A;  4XN3 A;  3COA C;  3SZG A;  3TO6 A;  2L54 A;  1QHG A;  2FQ4 A;  3LFU A;  3OYG A;  3HRM A;  1B6A A;  3G1O A;  3OOP A;  4E7Z A;  5FLM J;  5H6R A;  2CYY A;  1ORK A;  3E7L A;  1P7J A;  3FXM A;  4IHW A;  2W82 A;  2X48 A;  2FBK A;  2M1B A;  4J00 A;  3G6E I;  3P9I A;  3SDG A;  3JTG A;  2F6C A;  3HSR A;  2JSP A;  2HZT A;  1HSJ A;  2CFX A;  2ZNY A;  1U9N A;  3X2Q H;  1L3L A;  1SFX A;  3DTE A;  1ZN2 A;  1KQ0 A;  3I53 A;  3B6A A;  5JFR A;  3AG1 H;  2NVX J;  2H1K A;  3HOY J;  2DT5 A;  5JHU A;  4U0Y A;  3I3L A;  2CQ7 A;  2GBY A;  3QPL A;  3H0D A;  1W4M A;  1Q1H A;  3CDH A;  3S3N A;  3M3Y J;  4DW6 A;  5ERI A;  3OS0 A;  3JRA A;  1MBG A;  2M7B A;  4DYR A;  2KMU A;  5FGM A;  2BXZ A;  1NHA A;  1MBK A;  1OFC X;  1P6R A;  4AVZ A;  3LMM A;  2UV1 A;  2BVL A;  3BCA A;  3H3U A;  4XMY A;  2FML A;  3GW2 A;  4HNU A;  5B1A H;  4I76 A;  3GFL A;  3GTL J;  1BJZ A;  2FRH A;  1BIB A;  2RV8 A;  2XDV A;  5IT3 A;  1J0R A;  2DTR A;  4CGZ A;  2Y0S N;  1VQN I;  2JSC A;  4PJN A;  2UXX A;  4XLE A;  1QZY A;  4LGW A;  3IAM 2;  4OMY A;  3WTY C;  2CW8 A;  1W1W E;  3OOU A;  3BLY A;  5K5O A;  5FKO A;  1TP4 A;  3DKX A;  1VQP I;  1FJL A;  1WQ2 A;  2XGD A;  2DQR A;  4C9Y A;  3L09 A;  1AHD P;  1JI8 A;  5FB2 A;  4YEL A;  3SYT A;  3I5U A;  3ZQI A;  5LFA A;  3J7Y J;  3HKZ N;  3H5A A;  4YFK F;  4EJT A;  2VQH A;  4E7I A;  3E6D A;  2XVC A;  4MO7 A;  3HSE A;  3CO7 C;  4HBL A;  1ZQ3 P;  3M07 A;  2HDC A;  3PO2 J;  2XRO A;  4BYY A;  2E71 A;  4DBQ A;  1KYW A;  1IZ1 A;  1R22 A;  4HX4 A;  4BE0 A;  5L3C A;  4A3F J;  3CZ6 A;  4I98 B;  4LB6 B;  3HXL A;  3I55 I;  1ETX A;  3JRD A;  2GLO A;  3GLL A;  5EEH A;  1SMY F;  1XS9 A;  5B5E C;  3V42 A;  4LLN A;  2EV0 A;  3VOD A;  1FY7 A;  1WJ5 A;  5GAD J;  1TNT A;  2DMT A;  3V7C A;  4ZTF A;  4XOP A;  2YU9 J;  3S3M A;  1HW2 A;  2V1N A;  1KU9 A;  2E1N A;  3AAF A;  1MZB A;  3KPH A;  1K83 J;  3W2W A;  4G6Q A;  2QBY A;  2R7F A;  5D4S A;  1JKP C;  2KIU A;  2BOL A;  3EDP A;  4BEH B;  9ANT A;  1TW2 A;  5EEA A;  4ZZL A;  2JA8 J;  4BEH A;  3CCL I;  3TW6 A;  4RB0 A;  4L5E A;  4XLN F;  2WY7 Q;  2XRL A;  3HOV J;  3HGG A;  3RQ4 A;  2DFE A;  4Y13 A;  5LLQ A;  4BJ5 C;  2HPM A;  2HEO A;  4GO1 A;  1S5L C;  1RKT A;  3PQK A;  5DV5 A;  2LFB A;  3CCY A;  1XGN A;  4WXD A;  2YSR A;  3VFZ A;  3WU0 A;  2OCC H;  4IF4 A;  2H6B A;  5FRO A;  3HUG B;  2IW5 A;  1XGO A;  1MJB A;  3HSF A;  2VON A;  3OYC A;  3MKW B;  3T1B A;  1P92 A;  4OAY A;  3ZQ7 A;  3ABK H;  4CUG A;  1K78 A;  3PNT A;  2X1C A;  1W5C C;  3H36 A;  5E17 F;  4RLF A;  5BPD A;  1MKM A;  2E34 A;  1JUM A;  4EM1 A;  4A0X A;  3J81 K;  1ACI A;  2VN2 A;  4XQF A;  1Z6T A;  4AID A;  2XAJ A;  3MWM A;  2H27 A;  4AVP A;  2OQG A;  2M87 A;  5EJC A;  4NC6 A;  1Y6I A;  3HPH A;  5CVJ A;  3TL4 X;  1SFU A;  5LGT A;  1HOM A;  4JQF A;  4Y3O A;  2VJI A;  4P5O A;  1TNS A;  2XF7 A;  2HKO A;  2L7Z A;  1X4O A;  1HF0 A;  1YHQ I;  4U7B A;  1S9H A;  2VBY A;  1YRN A;  3KIO A;  4A5M A;  4H0E A;  2LP0 A;  1YJN I;  4HA8 A;  4B09 A;  1SFE A;  3DPU A;  4HNT A;  1HLV A;  3S2H J;  2VKD A;  4BS9 A;  3JRH A;  2LD5 A;  2KIM A;  1Z0X A;  1QHH D;  1NG6 A;  2OU2 A;  1QGP A;  2EK5 A;  2LY9 A;  2R5Z B;  1G4D A;  4B44 A;  1CQT A;  4IRI A;  5ICC A;  1Z3Y A;  1E3H A;  3BG6 A;  3F72 A;  3I9V 2;  1MMA A;  1XG1 A;  2CFO A;  2HS5 A;  2P81 A;  5D5X B;  2EPF A;  3TO9 A;  2YS9 A;  4FT8 A;  1FNN A;  2ZJP F;  1HW1 A;  1Y1V J;  3FZV A;  2W48 A;  1ETY A;  1G8X A;  2YR2 A;  5GAE J;  4L9N A;  1QU3 A;  2LRD A;  3BG7 A;  1W0T A;  2FD5 A;  2MSY A;  2QKL B;  5IPA A;  3CC2 I;  3TDZ C;  1FPQ A;  5DUI A;  2GWR A;  3DLA A;  3T8T A;  2LMD A;  1FOY A;  3K4M A;  2V7F A;  2I5U A;  2V9V A;  3VSK A;  4F52 A;  3BG3 A;  4BHC A;  2TDX A;  3A1Y A;  4AUX A;  5FKL A;  2JA2 A;  1KZH A;  1S29 A;  4LB5 A;  2LBF A;  2EV5 A;  5DS9 A;  2E1C A;  2ZXJ A;  3BZK A;  3Q0V A;  3BJA A;  1STZ A;  1TWA J;  2FF4 A;  3TP0 A;  2RKH A;  3C2B A;  4X1E A;  3LFK A;  1R36 A;  2WA0 A;  4CYC A;  2HTJ A;  3CDI A;  4I99 C;  4IXA A;  3HTS B;  2CWE A;  1A6Q A;  2VAS A;  2EIJ H;  2ID3 A;  1YW7 A;  4BHP A;  4B8X A;  5CJ9 A;  2QQ8 A;  4A3B J;  2M0C A;  1AKH A;  3SJM A;  1KYZ A;  2HI3 A;  3IL2 A;  2RRE A;  3DQV C;  3CCR I;  4DYQ A;  1FIP A;  3OYH A;  2STW A;  3PUB A;  2PMU A;  2CQK A;  4A69 C;  2NRA C;  3TDU C;  1R5I D;  2W25 A;  2FJ1 A;  1LE8 B;  3I64 A;  1WKM A;  2QM3 A;  2VE8 A;  2DA7 A;  3J81 Z;  2B0L A;  3TP3 A;  2CO5 A;  3JRF A;  3WTW C;  1DU0 A;  4BY1 J;  2RVC A;  4M3B A;  3OS2 A;  2LSO A;  1J7K A;  1V54 H;  4RB3 C;  3I56 I;  3N97 A;  3F8N A;  2WB1 A;  2NVU B;  5EEG A;  2XIG A;  1PP7 U;  1MSF C;  1AA7 A;  4QLC U;  5EG0 A;  5JVG F;  2B63 J;  1GV5 A;  1JKQ C;  2QVO A;  4NNJ A;  2XV4 S;  3QPS A;  4BBR J;  2FMY A;  4V2F A;  1KQ8 A;  4FQG A;  5E79 C;  4ITV A;  5HOO A;  1IF1 A;  2CMP A;  1FIA A;  3CUQ A;  2CUJ A;  4FHT A;  3ZMS A;  2JPB A;  2W4S A;  3L9F A;  1S8N A;  3MVP A;  3N05 A;  3S2W A;  4FAS D;  3QRF F;  1F36 A;  1T39 A;  2GQQ A;  3ECH A;  1ZRF A;  1RNL A;  3R60 A;  1Y39 A;  5L3E A;  1QA6 A;  2EIN H;  2KIQ A;  1HQC A;  2JUG A;  3JSP A;  2LYC A;  2JA5 J;  4L0Y B;  5KAI C;  4JX6 A;  1B1B A;  2QSH X;  2GOX B;  2H1L A;  5M3M J;  4IX7 A;  2LDU A;  1TL8 A;  3RKW A;  2JK3 A;  2KZG A;  3TOB A;  2G9W A;  4XL9 A;  4FE4 A;  4ENN A;  4BAC A;  2NS0 A;  4D5C A;  5EZG A;  2IT0 A;  1LVA A;  2CUF A;  5LRR A;  4A3E J;  1R4N B;  1FMW A;  5JLX A;  4FX0 A;  1T38 A;  1A36 A;  3W2A A;  1RR7 A;  4PZJ A;  4UB8 C;  1D5Y A;  1H9G A;  2O3F A;  4B47 A;  3Q3S A;  2IGO A;  3FXO A;  1T2K A;  4ENM A;  4Q47 A;  1SFK A;  5IT9 Z;  1YG2 A;  3BDD A;  2PLY A;  1DP3 A;  4A3J J;  3OR2 C;  1TWF J;  1CF7 A;  1FTZ A;  2KIS A;  5EYR A;  4P9F A;  2YUS A;  4PSX A;  4Z6Y A;  2XAS A;  3IWZ A;  2Q2E A;  3E5Q A;  5AIQ A;  2JRM A;  4N0B A;  3QYF A;  1LPQ A;  4F3Q A;  3O8H A;  2Z1D A;  4EAT A;  3PNV A;  1R9T J;  4A3K J;  1Z67 A;  3HGY A;  3BG5 A;  1V55 H;  3HEF A;  5ICF A;  4IOC F;  3S3O A;  1WHU A;  2P6S A;  2EIL H;  3LQR A;  3S16 J;  2DW4 A;  2D1V A;  3O6B B;  1HA8 A;  2CSO A;  4CYC B;  1ZR2 A;  1WCM J;  2LR8 A;  1NK2 P;  1K6Y A;  1AWC A;  4A3D J;  4I0B A;  2QYO A;  3C1D A;  1ETQ A;  4Y52 J;  1VF9 A;  3B6C A;  5EGO B;  1NH3 A;  5A2Q Z;  4DZP A;  4QTR A;  1BR2 A;  4HZF A;  3L1P A;  3CMA I;  2VQL A;  4CCK A;  4HQM A;  2HVR A;  4HDU A;  2LKP A;  3H9J A;  1V5E A;  1LKX A;  2K27 A;  3KP6 A;  4HSR A;  2KZV A;  3KZY A;  2IVM A;  5LHG A;  3G2B A;  1MJ9 A;  2ADU A;  1LFB A;  2M8G X;  2MLK A;  2PFB A;  1RR8 C;  2LNB A;  1E3O C;  2ELJ A;  1SD6 A;  2ELK A;  1PP8 F;  1LQ1 A;  1T56 A;  1I6X A;  3TGN A;  2BGC A;  1BW5 A;  2PN6 A;  4A12 A;  1D5V A;  4MTD A;  4I01 A;  1JJ6 C;  2IA0 A;  4HAM A;  4FE7 A;  1OCZ H;  4DNC A;  1MJA A;  1U6G A;  2DMU A;  1QNT A;  4JX4 A;  5FKM A;  5LGN A;  2HXI A;  3VYR B;  5BS6 A;  3HPG A;  2K9N A;  2PI0 A;  5BPI A;  2R7S A;  5DM7 F;  3K4K A;  1VQ6 I;  3DEU A;  4BJ6 C;  4EJO A;  4X6A J;  3OYE A;  4U87 A;  4KJZ A;  3FKJ A;  2VPL A;  4LIV A;  4WF2 A;  4E70 A;  1E0E A;  1J2X A;  2EFQ A;  3VWB A;  3OYL A;  3ISP A;  1GV2 A;  2ZSH B;  4UV8 A;  2Y31 A;  1QZZ A;  4G94 A;  1YIJ I;  3F3X A;  5F1R A;  2XAH A;  4NQW A;  4BNC A;  3FXQ A;  4KMU X;  4BGD A;  1HW5 A;  1BA5 A;  5LEK A;  1LUJ B;  4BY7 J;  2C6Y A;  1B9N A;  4Z2Y A;  4L9T A;  3FBN B;  3I4M J;  3U2R A;  2CU7 A;  5LGU A;  1O3S A;  4IPA A;  5FD6 A;  4UUS A;  4AU7 A;  4MFE A;  4BQQ A;  1DPR A;  2XKO A;  2LH9 A;  2L9R A;  2JRT A;  2CJJ A;  2M45 A;  5DCF A;  1TWC J;  4AIH A;  2Y48 A;  3LNQ A;  3ML6 A;  1G3W A;  3ECO A;  3FDY A;  2HVS A;  4GDF A;  2BXY A;  4A3L J;  2YX4 A;  4M3D A;  2K86 A;  2V6C A;  3K1P A;  4CZC A;  2IEK A;  3JTH A;  1ZAO A;  1BI2 A;  1IUF A;  4L9J A;  2IJL A;  5HLI A;  2JA7 J;  4Y33 A;  5F08 A;  6PAX A;  1FYK A;  4NHJ A;  3QOE A;  1MMS A;  2ID6 A;  2Q0O A;  2QWW A;  3QU6 A;  1DQU A;  5IT9 K;  1M1E B;  2XF6 A;  3LQQ A;  5F27 A;  3OYI A;  2HYF A;  3PIP F;  1D0X A;  3H9G A;  2VQG A;  3M9A A;  3CC4 I;  5HLH A;  2XB5 A;  3OV8 A;  2W85 A;  3OYD A;  4NUB A;  3KP5 A;  3Q5F A;  2DYR H;  2CUE A;  2EA2 A;  2QZ8 A;  5IP9 J;  2VLA A;  1MGT A;  1EV7 A;  1RUN A;  2LF8 A;  4XLF A;  3BR5 A;  2L9S A;  2VE9 A;  1UZC A;  2NAZ A;  1ETK A;  2RGV A;  3MZY A;  5BNG A;  1YRN B;  2VOO A;  4BE1 A;  1YW8 A;  3GVA A;  1OPC A;  1E2X A;  2BVM A;  2B9S A;  2ISZ A;  4O3M A;  3SDB A;  4MIM A;  3PFY A;  4M3G A;  2MD0 A;  2XHK A;  1XSD A;  2ZFU A;  4PJL A;  3MD2 A;  3EET A;  2DDA A;  2FQ3 A;  4CXF A;  5HDN A;  1IN8 A;  1LDJ A;  1LFP A;  2M0M A;  1X3W B;  3RYP A;  4YFN F;  4LLG F;  2W57 A;  3E6M A;  3T0Y A;  4M6X A;  3BR0 A;  3S15 J;  2Q1Z B;  3M8F A;  2LKS A;  5IYD J;  2M34 A;  1ZGW A;  2HGC A;  4I09 A;  2PMH A;  1W5T A;  2DOF A;  1HST A;  2G0E A;  2P5K A;  2LG4 A;  1JTY A;  3JAM Z;  4O6J A;  3ZMU A;  3CQZ J;  1RI7 A;  1O7F A;  2K40 A;  1BN5 A;  4KIC A;  1WJD A;  3MCZ A;  4BH9 A;  3J80 Z;  2AS5 F;  1XGM A;  1YW9 A;  3EUH A;  5L3D A;  2HTS A;  4CH7 A;  2CV0 A;  2KQR A;  1Z9C A;  2EWN A;  1I27 A;  3KCC A;  3V7S A;  3C2G A;  3JCU C;  2STT A;  1ZG1 A;  3CLO A;  1JGG A;  4AC0 A;  2RN7 A;  2E35 A;  1IN6 A;  2GAU A;  1A04 A;  1X4P A;  1JUS A;  4MFD A;  1SMT A;  1U8R A;  3GTO J;  1D8J A;  4E6K G;  4RMN A;  4BKX A;  1R1V A;  3BZ6 A;  4DOZ A;  2DN0 A;  2ACJ A;  3IH2 A;  1IN5 A;  3HRT A;  5D6E A;  2VJJ A;  1RKW A;  2RNJ A;  2VT2 A;  5HLG A;  1VZ0 A;  3FXL A;  4DIQ A;  3KE2 A;  1XGS A;  2O8X A;  1IRX A;  2A3S A;  2DXI A;  4QPO A;  1IXS B;  2QQB A;  2X51 A;  1S3J A;  2FNP A;  4RB1 A;  2QCO A;  3SFI A;  2KJB A;  3GBG A;  3RDI A;  1JGS A;  2L4A A;  5CVI A;  4MTE A;  3WGG A;  3L2U A;  3GTP J;  4PJM A;  1IAW A;  1ZH5 A;  1YFH A;  1X1B A;  4Y15 A;  4XNF A;  4ANJ A;  2X0L A;  2A61 A;  1XDU A;  2OQR A;  1OYY A;  2K4J A;  2K5C A;  2W24 A;  3ZQG A;  4L0Z B;  1K4T A;  2VI6 A;  1SD4 A;  5LHH A;  1ZR4 A;  4G9Y A;  4XOR A;  3MAJ A;  4AIK A;  2K02 A;  1J59 A;  2EQR A;  4RGU A;  4M74 A;  3E3V A;  1J75 A;  3BRO A;  3MMY B;  1VTN C;  3EUA A;  3S1N J;  4DGW B;  3LOC A;  4GRI A;  2FSW A;  3K7A J;  2JVG A;  3TED A;  3LSR A;  2JN6 A;  3OYB A;  3IAS 2;  3QP5 A;  3ONQ A;  1BI1 A;  3ZQF A;  5M5Y J;  4IRH A;  3CMM A;  1IN4 A;  3H5R A;  2ZXH A;  2XAQ A;  2QEX I;  5KK1 A;  2PX9 A;  3RYR A;  1LB2 A;  1L0O C;  2HDD A;  4BHB A;  3CF2 A;  4YFX F;  4NBQ A;  2W84 A;  4KDP A;  3RCO A;  3O8G A;  2Y30 A;  2O8K A;  1W7P B;  3OYK A;  3LSJ A;  2Y9Z A;  1WJE A;  3T5X A;  3WE3 A;  3DPL C;  3GF2 A;  4YG2 F;  5D8L B;  3UR3 C;  3V4G A;  4A2U A;  3FF5 A;  2JTV A;  3MKZ A;  5DCM B;  2DTZ A;  4IOA F;  3A0B C;  3JRC A;  3CME I;  4G6T B;  2NS8 A;  4FTH A;  3KZI C;  5J8C A;  4G6D A;  5KCM A;  1WGX A;  1FOK A;  1ZKG A;  1EH8 A;  5FO5 A;  4AWX B;  4P96 A;  2E1M C;  1XSV A;  3EQL F;  1UG2 A;  5E1Z B;  2VKE A;  3CJN A;  4IQ4 A;  2EJR A;  3OYM A;  3GTG J;  1V5G A;  2Z3Y A;  2E2H J;  5FJ8 J;  2EFO A;  3AG4 H;  3M4O J;  2IXS A;  1OCC H;  2VXD A;  4UVA A;  4CCM A;  2VOD A;  1UB9 A;  2ESH A;  1X2N A;  2GIZ A;  2V6E A;  3IUO A;  5IOZ A;  3CTA A;  4RM3 A;  4C3J J;  2G7H A;  4OAZ A;  5HDK A;  4EGZ A;  2CV2 A;  1O4X A;  1YX5 A;  3BPX A;  3H92 A;  2DJI A;  1X58 A;  4DQ2 A;  5ILV A;  2CW7 A;  2RQP A;  3FXK A;  4PCQ A;  5GTH C;  2L7F P;  3RPU A;  3BY6 A;  2E2I J;  1FOW A;  1XSX A;  1R00 A;  3G4S I;  1IGN A;  4XBF A;  3CLQ A;  3WTZ A;  3ZP5 A;  3F21 A;  3N4M A;  3LSG A;  2MGQ A;  2V9P A;  1QRY A;  1J9I A;  3B73 A;  2R3S A;  2UXN A;  1FMV A;  1MNE A;  2YPR A;  4BXF A;  2R7Z J;  1ZGA A;  2A5W A;  2NXN B;  4EM2 A;  2PMZ N;  4RAZ A;  1ERD A;  4XON A;  3R0J A;  2P4W A;  2ZC2 A;  2AHQ A;  4BU2 A;  1I1S A;  1O3Q A;  3ZQQ A;  3BC8 A;  3TKY A;  1SVL A;  2O03 A;  3D1N I;  4S0H B;  1KU7 A;  5HOD A;  3HYI A;  2JZY A;  3ASN H;  2HVQ A;  1XMX A;  4EVI A;  2TCT A;  2DT6 A;  1UCR A;  1J09 A;  2V26 A;  1QQI A;  4KIB A;  3S93 A;  2V1D A;  3L00 A;  2EFW A;  1HC8 A;  3HRS A;  3HOW J;  1NG7 A;  4K2E A;  3RSN A;  2WTE A;  5C44 J;  4MQ9 F;  5HNH A;  2NOJ B;  3IWF A;  1MH4 A;  4C30 A;  4MEX F;  1WJA A;  5J1R A;  3K1M A;  2A68 F;  4A3G J;  3HOT A;  1DGW Y;  2R4G A;  1ZLK A;  1XC5 A;  3K70 C;  1AOY A;  2G7U A;  4M6Y A;  4UVB A;  3QQA A;  2F5V A;  5E8G A;  2QEN A;  4D1Q A;  3FXJ A;  1IN7 A;  3K4B A;  3FMS A;  1HKT A;  3FM3 A;  1ETW A;  1PDN C;  5BOX A;  4E7K A;  2WWY A;  2HQR A;  5E3L A;  1MW7 A;  3WG9 A;  3LAP A;  1FLI A;  4WX9 A;  4I2O A;  1YQA A;  2BW3 B;  3M8E A;  4L5I A;  5BMZ A;  1ZRC A;  3HIF A;  3IH4 A;  3SEQ A;  4PSW A;  2KHM A;  1SAX A;  2MW8 A;  5K1Y A;  4JK1 X;  2LY2 A;  2HYJ A;  4GCV A;  2R7U A;  4XKC A;  1W7P A;  1D1C A;  3L7W A;  4BQA A;  5HDG A;  5M5W J;  1TQP A;  3VOE A;  2CV1 A;  4ZYA A;  2KRC A;  2PBI A;  3ABU A;  2LK2 A;  2XB0 X;  5D5W B;  3NAU A;  4OIO F;  1KON A;  1J5Y A;  4MNU A;  5JVT A;  1D0Z A;  1I3A A;  5EDN A;  1IV6 A;  2MD5 A;  3G1L A;  1PUE E;  3RZO J;  1H89 C;  5K7Z A;  1V4R A;  4LIU A;  5J8F A;  3GZN B;  3BOQ A;  3DEE A;  5IOY A;  1TWG J;  3REO A;  3WGH A;  4JYK A;  1GVJ A;  4KFC A;  3OL4 A;  4QPQ A;  2WAQ A;  2HDW A;  2IS1 A;  3HOX J;  2O5R A;  3CUQ B;  1A31 A;  3AL0 C;  3D5S C;  4A0Z A;  2K85 A;  2XSD C;  3J80 K;  1B4A A;  2F48 A;  4FIS A;  2N8G A;  3LWF A;  4H4K C;  4PGH A;  3F6V A;  3V7R A;  1N78 A;  3JRE A;  3HBL A;  2VQC A;  3WG7 H;  3ZMV A;  2KP6 A;  2HNH A;  1F5T A;  2FE3 A;  3VYS B;  1T33 A;  5HS9 A;  4RA2 A;  3CP8 A;  2R5Y A;  1RES A;  4Y4R A;  1DPU A;  1Z6R A;  2O9L A;  1UEL B;  3BJ6 A;  3A4C A;  3WTT C;  3CUQ C;  2L3D A;  3F23 A;  1HKS A;  3FIW A;  1TTY A;  2M4K A;  3ROU A;  3U1K A;  2MC3 A;  3DBL B;  1FP2 A;  1X3Z B;  3KFW X;  2V4J C;  1JXS A;  2NNN A;  3DF8 A;  1WVR A;  1G3T A;  1VND A;  4JX5 A;  3S32 A;  2R7W A;  2FU4 A;  4E7S A;  3KP2 A;  4YII A;  3IH3 A;  2EZL A;  5FD5 A;  3VEP A;  2DPD A;  2WAD A;  3K2Z A;  1BR4 A;  2HFH A;  3QAH A;  4KIT B;  1FWZ A;  1YJW I;  1FP1 D;  4D7N A;  2A6H F;  3PJR A;  3MKY B;  3ZN1 A;  3FK7 A;  3BZC A;  4UV9 A;  2EB7 A;  1K61 A;  4G7H F;  1EH6 A;  4ASN A;  2GXB A;  4S05 A;  1BI3 A;  3W6V A;  3ZMD A;  1MNM C;  5JHF A;  3CCJ I;  1ITY A;  2HOT A;  1Y0N A;  1VQ7 I;  3HG9 A;  3IHU A;  3O3K A;  1WRJ A;  2DA6 A;  2VPR A;  4NB5 A;  2R7T A;  3NAR A;  1MBF A;  2MH2 A;  1X1C A;  2L02 A;  2VBX A;  1RUO A;  3TQN A;  2VUM J;  1SAU A;  2ZCW A;  2DA5 A;  2OCE A;  2DJN A;  2OAZ A;  5F0H A;  2BY2 A;  3JSO A;  1ZRD A;  1AU7 A;  1OMI A;  4DBR A;  3BT9 A;  4ESB A;  3W6K B;  3ZRG A;  2L2O A;  2X1D A;  2Y0S A;  3RKX A;  4XKW A;  1B72 B;  2X6Y A;  3WHC A;  1S7E A;  5KHD A;  3ZR8 X;  3FKI J;  3RJP A;  2DA2 A;  2D1H A;  4U0W A;  3E6B A;  2KDO A;  2OBP A;  3AFH A;  3WU1 B;  2CS3 A;  5CQE A;  3K2A A;  3GTQ J;  1T0F A;  3WE2 A;  1WJF A;  1BL0 A;  4A3M J;  2GA1 A;  4A3I J;  2L4M A;  2CG4 A;  3CD6 I;  4PGG A;  1REP C;  4M71 A;  5E8I A;  2X6W A;  1GT0 C;  4D7M A;  2IAI A;  4LIT A;  5CPR B;  4UY8 I;  2E5Z A;  1BC7 C;  3HTU A;  3GFI A;  2M2E A;  2CH0 A;  3DTK A;  2OC6 A;  1ZYR F;  3DV8 A;  4FCY A;  4UUV A;  1DGR M;  4P1W A;  2FNA A;  4A0Y A;  3A2K A;  1U5T B;  1WPK A;  3W6J B;  1I5Z A;  4RDU A;  1FYL A;  4PJ0 C;  1JHF A;  2M9H A;  5F64 A;  3TMO A;  4UXN A;  3U9G A;  4XLC A;  2HXO A;  4CIC A;  2GIV A;  4ESF A;  4ZYD A;  3TOA A;  5GPA A;  1DP7 P;  2OV7 A;  2WAQ N;  4J01 A;  1E3P A;  1UAA A;  4BDZ A;  3Q0U A;  2FBI A;  1VQ5 I;  2IRF G;  3BTL A;  4KN7 X;  4F7Z A;  1F43 A;  4XLP F;  3CCS I;  4X0G A;  4E7J A;  3A03 A;  4IHX A;  3GTM J;  1EA3 A;  4Y17 A;  2IA1 A;  4M9X A;  4B43 A;  5E20 A;  3WTV C;  1SAN A;  1G3S A;  1LDD A;  1TWH J;  3G1M A;  2XC7 A;  3R6S A;  5HLT A;  1X3U A;  5H6Q A;  3WU2 C;  3LAJ A;  4BXU A;  4R1H A;  1SD5 A;  2R7O A;  2NVT J;  3LA3 A;  3KEO A;  3IKT A;  3ZMZ A;  5E1W A;  3BR3 A;  3OYA A;  2BV6 A;  5HNF A;  4WWC A;  3Q9V A;  3OYN A;  1A6I A;  1LDK B;  4CYD A;  3MKL A;  4TV7 A;  2LBF B;  2M30 A;  3CJQ B;  1YS6 A;  2V9K A;  3S17 J;  3MN2 A;  3ZGK A;  2MFZ A;  3NQO A;  4JBA A;  3E1S A;  3H35 A;  2JT1 A;  2EZI A;  2WV0 A;  3E97 A;  2KFD A;  2L0K A;  2HPI A;  3LSK A;  3HHG A;  3HC7 A;  2DOE A;  3HDD A;  5FLV A;  4GXO A;  2NVQ J;  3QOP A;  4YEJ A;  3I71 A;  1LJ9 A;  1U5T C;  1R1U A;  3KZZ A;  4IRG A;  1ZHF A;  4XN0 A;  4IHS A;  3A0H C;  1Q1V A;  2DT7 B;  2MBF A;  4LK0 F;  1T6S A;  2M3A A;  4ZDP A;  2BHY A;  3A02 A;  4IKF A;  2BEO A;  3GME A;  1U2W A;  2R7V A;  3F22 A;  3RTR A;  3FXR A;  3K70 D;  4I0A A;  2E7X A;  4WK8 F;  2HWV A;  3KX2 A;  2K9L A;  3VSL A;  3K4J A;  1TQM A;  2L7K A;  1Y1W J;  3L2V A;  2M4G A;  3DWL E;  2VC1 A;  4HEA 2;  3W3C A;  1MIJ A;  1D8K A;  3E5U A;  5LHI A;  3G73 A;  4NDL A;  4KNY A;  3S1Q J;  3LST A;  3KET A;  2LOO A;  3WOD F;  2QGU A;  4KIS A;  2CQQ A;  1UJ8 A;  1ZRE A;  2FX0 A;  2Q8K A;  2COM A;  1UHS A;  2WAF A;  3NWS A;  4HF1 A;  1RC9 A;  2O6G E;  1NTC A;  1JUP A;  3VB2 A;  2MC4 A;  3F0C A;  5TIS C;  4E7H A;  2LY1 A;  1HBX G;  3GZ5 A;  2Y9Y A;  1ON1 A;  3OR1 C;  1WZ2 A;  1FEX A;  3KYL A;  3CCV I;  3D0S A;  5AIP A;  3E5X A;  3IP4 B;  5J6X A;  2E7W A;  3OIO A;  3GXO A;  2Z16 A;  1LE8 A;  3QU3 A;  2L7M P;  3DKY A;  3H9Q A;  5L3B A;  4XK4 A;  3K1N A;  2GXA A;  3HKZ A;  4IHV A;  3TW7 A;  3M1C A;  5LRS A;  4BUP A;  2R93 J;  5FKK A;  3IV5 A;  2Z5U A;  4M3E A;  1ZTR A;  1O3T A;  1XX5 A;  4RAF A;  4EEF G;  4D5F A;  3J7A Y;  1BI0 A;  3NRV A;  1RIO H;  3HHH A;  1XDS A;  1IW7 F;  2IS2 A;  4KUM A;  1YE9 A;  2KKO A;  4MEY F;  3HJE A;  1FYM A;  4HLY A;  5C4X J;  2UWM A;  3A01 A;  1B59 A;  2XAG A;  4GGG A;  2ZXI A;  5EGO A;  1U3E M;  3HOU J;  1MH3 A;  4A5N A;  5C3E J;  3LSH A;  2DI3 A;  2WB1 N;  1UST A;  4O5V A;  4HG2 A;  4EMS A;  1Y0U A;  4F91 B;  2XGX A;  2UUZ A;  3EYY A;  4CO8 A;  4A6E A;  1T98 A;  2ECC A;  2EBI A;  3KEQ A;  2EV6 A;  1ZG5 A;  3DBR B;  4KIF A;  2P8T A;  4HOB A;  1OCP A;  1N75 A;  1SC7 A;  1DU6 A;  2H8W A;  1HXD A;  2IBD A;  4PUS A;  3V8L A;  1IDZ A;  2XSJ C;  1R1T A;  5E3M A;  2X85 A;  1H9T A;  3C7J A;  3ZPL A;  5M3F J;  1OR7 A;  2JPC A;  1XD7 A;  4BBS J;  3F8F A;  2RDP A;  3H3Z A;  1P4W A;  2FBH A;  2WC2 A;  3RI4 A;  1R5H A;  3L2C A;  2OJE D;  2OZ6 A;  1FSE A;  1PUF B;  2PJR B;  2MYS A;  1G6N A;  1UG0 A;  3I0T A;  1PUF A;  2DDB A;  5DD8 A;  2ECB A;  2DO7 A;  5D5U B;  1H88 C;  1TT0 A;  2DA4 A;  1O3R A;  1FSH A;  2Z9O A;  2BBY A;  1YYV A;  1BOB A;  4AYB A;  4KIG A;  3CP2 A;  1KU2 A;  5D8K B;  1BBY A;  2MG4 A;  3FHN A;  4HX8 A;  4UVC A;  2XAU A;  1GLN A;  1UHW A;  2R5Z A;  1ETV A;  3O2P E;  4XKB A;  3U21 A;  4ENJ A;  1XB4 A;  3RKY A;  3MZH A;  2AO9 A;  3L2Q A;  1I50 J;  3PSF A;  1GXP A;  1JJ8 C;  3VYU B;  2F2E A;  1S6L A;  2Q2E B;  2HOS A;  3BTJ A;  2GOM A;  2GXG A;  2DMN A;  3RPQ A;  4A3C J;  2DK5 A;  2E19 A;  2HYG D;  2M8E A;  1TT5 B;  1K7A A;  2ZB9 A;  1F9N A;  3EYI A;  2KJC A;  2L5Q A;  1QBJ A;  4V19 K;  4HLX A;  4UHT A;  5IP6 A;  4CCL A;  5ICG A;  2LLK A;  5D6F A;  3RQI A;  3ZQL A;  5B66 C;  3ZQH A;  2DQL A;  1OYI A;  3M7G A;  1KQ9 A;  1PJR A;  1P4A A;  5D4R A;  4RS8 A;  1P7I A;  4RM2 A;  1OJL A;  2FOW A;  1OCO H;  4JP0 A;  4XSX F;  3I4N J;  1BM9 A;  1LEA A;  5FFX A;  2HKX A;  4KN4 X;  1MSE C;  3U1D A;  4HV5 A;  5TGT A;  2BW3 A;  2VKV A;  3CC7 I;  1TC3 C;  3PQJ A;  3ZN0 A;  1JE8 A;  1IO2 A;  1B9M A;  5L3F A;  4N4N B;  1I6H J;  3I59 B;  2EIM H;  5GP9 A;  4XRS G;  2K3P A;  2H8R A;  5BQT A;  3LSI A;  2HOA A;  3CES A;  5ILU A;  3WTU C;  3MQ0 A;  5DD4 A;  3R61 A;  3V8J A;  1K4S A;  4LD5 A;  1N25 A;  5F1J A;  5LD2 C;  2ETH A;  4HX7 A;  2CGP A;  5ED4 A;  1KA8 A;  3BTI A;  2RNG A;  3D5L A;  3GUD A;  4XR6 A;  1BOA A;  4M9S A;  1VQM I;  1B8I A;  2DFH A;  4G12 A;  3ERM A;  3ESW B;  3FM5 A;  1B8I B;  1GVD A;  2NNY A;  1H0M A;  1JHH A;  1DUX C;  4L5J A;  2WV1 A;  3GCM A;  1TLH B;  2QQ9 A;  1I39 A;  1RET A;  2FOK A;  3H0G J;  2WY8 Q;  1UFM A;  2D5V A;  1YI2 I;  2LKX A;  3ABT A;  1ETO A;  3E0J B;  5CVU A;  5IY5 H;  2P5V A;  4XM3 A;  1HDD C;  1LEB A;  1Z21 A;  2AQF A;  1XMA A;  2HZD A;  2B7E A;  5TJJ A;  1R23 A;  2P6T A;  3DP7 A;  4LG3 A;  5KAF C;  3G71 I;  1S7A A;  1SVM A;  1LNW A;  3H3V K;  2NS7 A;  1GUU A;  2CW0 F;  4OIP F;  2M5W A;  2KIF A;  2HOE A;  4XLH A;  3GTK J;  4RAY A;  1FBQ A;  2UZK A;  1W7P D;  4UUT A;  1IXR C;  2VKH A;  1QVT A;  3CDL A;  3KLO A;  4CA0 A;  1IJW C;  2L01 A;  2CQX A;  4OWR B;  3HOS A;  4XRF A;  2QF7 A;  2X6O A;  5K7H A;  1D1A A;  3AG2 H;  2XF5 A;  4UNO A;  4N4O B;  4PK4 A;  3UNG C;  2GZW A;  4IJA A;  5EG0 B;  1Z91 A;  1RRJ A;  4KYW A;  1ZGJ A;  3OMY A;  1UHM A;  4OMZ A;  2F5C A;  2DLL A;  3IKV A;  1K78 B;  1LVK A;  4AM3 A;  4EJU A;  2I10 A;  2TRT A;  5KNL A;  3OIQ A;  1QO0 D;  2FEZ A;  1SFO J;  3KEY A;  5AON A;  4B1R A;  2PEX A;  3HM5 A;  4RGS A;  1IG7 A;  2KT0 A;  1FX7 A;  2OUM A;  1POG A;  3Q0W A;  5J1Y A;  3DXJ F;  2WBM A;  2XKP A;  2F4O B;  2E1O A;  2MAB A; 
#chains in the Genus database with same CATH homology
 2V4J C;  4CCK A;  1OR7 C;  2HVR A;  3H9J A;  1V5E A;  1LKX A;  4HSR A;  3S32 A;  4BQN A;  2KZV A;  2R7W A;  4JOM A;  4E7S A;  2VXZ A;  2VJ5 A;  3G2B A;  3OY9 A;  2JVH A;  2WAD A;  2VIX A;  3OL3 A;  3ZXS A;  4KIT B;  1BR4 A;  1MMD A;  1WJB A;  3S8P A;  2ELJ A;  3PJR A;  3MKY B;  4NQW B;  2WAE A;  2IS4 A;  3AL0 B;  5JHF A;  4CCO A;  4FET A;  3CJR B;  3VYR B;  3HG9 A;  3PNY A;  3HPG A;  2CUZ A;  2R7T A;  4IZZ A;  2R7Q A;  3OS1 A;  2F4I A;  5FRN A;  3OWT A;  3L2R A;  1X1C A;  2A6T A;  2R7S A;  4BJT A;  3EUK L;  3K4K A;  1SAU A;  1T95 A;  5CQG A;  4E4H A;  4BQO A;  2M7A A;  4BJ6 C;  1Z3X A;  4XN3 A;  3OYE A;  4C2U A;  3SZG A;  4DBR A;  4U87 A;  3VYT B;  4KJZ A;  1QHG A;  3LFU A;  3OYG A;  3FKJ A;  3ZRG A;  4PJJ A;  2VPL A;  4LIV A;  2L2O A;  4E7Z A;  2X1D A;  1E0E A;  2Y0S A;  3VWB A;  3OYL A;  4XKW A;  2X6Y A;  2ZSH B;  2W82 A;  5KHD A;  3ZR8 X;  2Z2S B;  4J00 A;  4BGD A;  2KDO A;  3AFH A;  2FUG 2;  2F6C A;  2JSP A;  3FBN B;  2CS3 A;  2X6X A;  5CQE A;  1WJF A;  3DTE A;  4ZDO A;  4AU7 A;  4BQQ A;  2LH9 A;  2X6W A;  3I3L A;  4LIT A;  5CPR B;  2E5Z A;  3H0D A;  3FDY A;  2HVS A;  2CH0 A;  3S3N A;  1YX3 A;  2OC6 A;  3DTK A;  4CZC A;  3OS0 A;  3L2W A;  1DGR M;  2M7B A;  4P1W A;  3FBI B;  3A2K A;  4Y33 A;  2KMU A;  3QOE A;  3TMO A;  5CKT A;  4XLC A;  1DQU A;  4AVZ A;  3LMM A;  2UV1 A;  5HVQ C;  2BVL A;  2XF6 A;  3BCA A;  4XMY A;  4F92 B;  3OYI A;  4HNU A;  4YRV A;  4R79 A;  1D0X A;  2DCE A;  2OV7 A;  3H9G A;  4II2 A;  2VQG A;  4CCN A;  4J01 A;  1UAA A;  4BDZ A;  1Z7L A;  2X1E A;  3TBI A;  4X0G A;  4E7J A;  3OYD A;  2XDV A;  4NUB A;  1EA3 A;  4B43 A;  4PJN A;  4XLE A;  2VLA A;  3IAM 2;  2XC7 A;  4XLF A;  2CW8 A;  3OOU A;  5HLT A;  2L9S A;  3BLY A;  2K9M A;  5FRM A;  3DKX A;  3W2V A;  4ZDL A;  1X1A A;  4BE1 A;  4C9Y A;  2BVM A;  1JI8 A;  2R7O A;  4YEL A;  3SDB A;  3SYT A;  5LFA A;  3PFY A;  3H5A A;  2MD0 A;  3OYA A;  2VQH A;  4E7I A;  2ZFU A;  4PJL A;  5HNF A;  1TZL A;  3MD2 A;  2P0W A;  3OYN A;  3EPZ A;  1LDK B;  2LBF B;  4DBQ A;  2E60 A;  3CJQ B;  4NC7 A;  2V9K A;  4BE0 A;  1LFP A;  3ZGK A;  2M0M A;  2MFZ A;  3CZ6 A;  2KPM A;  3E1S A;  3H35 A;  3HXL A;  2ZSI B;  3ZCO A;  1ZEL A;  2HPI A;  2PJR A;  3LSK A;  4HPQ A;  3HC7 A;  2Q1Z B;  3V42 A;  4YEJ A;  2LG4 A;  1D0Y A;  1WJ5 A;  3HL2 A;  4F93 B;  4XN0 A;  4ZTF A;  4XOP A;  1WJD A;  3S3M A;  2DT7 B;  2V1N A;  1WJC A;  2M3A A;  4ZDP A;  3DU5 A;  3W2W A;  4E7L A;  4IKF A;  4CH7 A;  2CV0 A;  4XOT A;  2KQR A;  2R7V A;  2DOA A;  3C2G A;  3RTR A;  3K70 D;  2BOL A;  2KRH A;  4BEH B;  3KX2 A;  2K9L A;  3VSL A;  3K4J A;  2L7K A;  1X4P A;  4BEH A;  3L2V A;  4E6K G;  4RMN A;  4MLO A;  4DOZ A;  4KT6 A;  2W00 A;  2WY7 Q;  2M4G A;  3DWL E;  4HEA 2;  2VJJ A;  3RQ4 A;  3W3C A;  2LRE A;  4BJ5 C;  2HPM A;  1VZ0 A;  4HST A;  4DIQ A;  2LOO A;  4KIS A;  1MMN A;  1IRX A;  4ZJZ A;  4II3 A;  2DXI A;  4QPO A;  5FRO A;  3HUG B;  2WAF A;  3NWS A;  2X51 A;  4E7H A;  2MC4 A;  3OYC A;  3GBG A;  2LY1 A;  3MKW B;  3OR1 C;  4OAY A;  3L2U A;  4CUG A;  4PJM A;  3NWT A;  3KYL A;  1BR1 A;  1MMG A;  3PNT A;  2X1C A;  4IQJ A;  1X1B A;  4XNF A;  4ANJ A;  4RLF A;  3IP4 B;  4XQF A;  2K5C A;  2Z16 A;  2QKM B;  2RQQ A;  4PFO A;  2R7X A;  3DKY A;  4BE2 A;  3H9Q A;  3K4L A;  1Y6I A;  3HPH A;  3HKZ A;  3TL4 X;  2E1M B;  3M1C A;  4XOR A;  4BUP A;  1OLT A;  4JQF A;  4Y3O A;  2VJI A;  4P5O A;  2XF7 A;  1X4O A;  3MMY B;  4U7B A;  3OYJ A;  1S9H A;  3EUA A;  3J7A Y;  4DGW B;  3RPU D;  4GRI A;  3LL7 A;  2IS2 A;  2JVG A;  3DPU A;  4HNT A;  3K4C A;  2VKD A;  1YE9 A;  4BS9 A;  2IGM A;  3OYB A;  3IAS 2;  3ONQ A;  1QHH D;  3F9K A;  1NG6 A;  3AKZ A;  3CMM A;  2UWM A;  3H5R A;  2ZXI A;  2ZXH A;  4B44 A;  3EUH C;  1Z3Y A;  3BG6 A;  3I9V 2;  1MMA A;  2CFO A;  3LSH A;  3CF2 A;  4HG2 A;  3RCO A;  4F91 B;  2UUZ A;  1N77 A;  3OIP A;  3OYK A;  3H5N A;  1WJE A;  1G8X A;  3DPT A;  1QU3 A;  2LRD A;  3BG7 A;  3DPL C;  4RLQ A;  1N75 A;  2QKL B;  3UR3 C;  4C2T A;  4PUS A;  3DLA A;  3MKZ A;  2XSJ C;  3DTI A;  2X85 A;  3K4M A;  4G6T B;  2V7F A;  3VSK A;  3K4N A;  2IGN A;  4F52 A;  1V5F A;  5KCM A;  3A1Y A;  2E1M C;  2JA2 A;  4IQ4 A;  3OYM A;  2LBF A;  1V5G A;  2HQA A;  2PJR B;  2MYS A;  2IXS A;  2VXD A;  4CCM A;  1UG0 A;  2V6E A;  3IUO A;  4RM3 A;  2VB6 A;  1TT0 A;  2WA0 A;  3K6G A;  4B3X A;  4OAZ A;  2CV2 A;  1YX5 A;  2DJI A;  1BOB A;  2VAS A;  4AYB A;  3CP2 A;  1X19 A;  1WFX A;  2CW7 A;  3VDX A;  3FHN A;  4F55 A;  2XAU A;  4NC8 A;  2R7R A;  1GLN A;  2RRE A;  3PSI A;  3U21 A;  4XKB A;  3DQV C;  3OYH A;  3L2Q A;  3PSF A;  3VYU B;  3LSG A;  3PUB A;  2Q2E B;  1T0F C;  1X1D A;  2GOM A;  1FMV A;  1MNE A;  4BXF A;  4HRI A;  2A5W A;  3LSM A;  2W7N A;  1ERD A;  4XON A;  2L5Q A;  4BU2 A;  3ZQQ A;  3QYB A;  4CCL A;  3OS2 A;  4CCJ A;  3BC8 A;  3OYF A;  2WB1 A;  3D5R C;  1D1B A;  1AA7 A;  1MND A;  1PJR A;  2HVQ A;  2KL4 A;  2DT6 A;  2IS6 A;  1J09 A;  2V26 A;  4RM2 A;  3S93 A;  4NNJ A;  2VL8 A;  3QYE A;  3C2H A;  1NG7 A;  3RSN A;  3PL8 A;  5TGT A;  4ITV A;  5HOO A;  2BW3 A;  2CMP A;  5HNH A;  2CUJ A;  2NOJ B;  4C30 A;  1Y56 A;  1WJA A;  2W4S A;  2VJ4 A;  4ZC3 A;  4N4N B;  1DGW Y;  2R4G A;  3M8J A;  3N05 A;  4FAS D;  3HOT A;  2K3P A;  3QOD A;  1PYV A;  3K70 C;  2F5V A;  1R6R A;  3SEZ A;  4D1Q A;  3LSI A;  3CES A;  3K4B A;  4CSW A;  2JUG A;  5LD2 C;  2LYC A;  3K10 A;  4E7K A;  2RNG A;  2GOX B;  3D5L A;  4D9J A;  4IX7 A;  4XR6 A;  3BCB A;  4DJA A;  1MW7 A;  4XL9 A;  2BW3 B;  4BAC A;  1P9Q C;  2L9N A;  2I8D A;  3SEQ A;  4PSW A;  2KHM A;  1FMW A;  2WY8 Q;  2LY2 A;  2R7U A;  3W2A A;  4XKC A;  2AQE A;  1D1C A;  3E0J B;  4B47 A;  4XM3 A;  2E5N A;  2CV1 A;  4ZYA A;  4ZTJ A;  2KRC A;  2IGO A;  2LC2 A;  1Z21 A;  1KON A;  2AQF A;  2HZD A;  1D0Z A;  4LG3 A;  3DU6 A;  1SFK A;  1DP3 A;  2PMZ A;  3OR2 C;  4XKV A;  4LIU A;  3DEE A;  4PSX A;  4XLH A;  3OL4 A;  4B48 A;  3QYF A;  4QPQ A;  4F3Q A;  2Z1D A;  4EAT A;  2KLO A;  2HDW A;  2WAQ A;  3PNV A;  2IS1 A;  2O5R A;  2VKH A;  3AL0 C;  2HU9 A;  3D5S C;  4CA0 A;  3HOS A;  4BL0 B;  4OWR B;  3S3O A;  2W1O A;  4BDY A;  2IGK A;  1W36 D;  4H4K C;  1D1A A;  1N78 A;  2XF5 A;  1HA8 A;  4N4O B;  2VQC A;  4PK4 A;  3UNG C;  2KP6 A;  2HNH A;  3OMY A;  1G59 A;  1K6Y A;  3VYS B;  3CP8 A;  1LVK A;  4Y4R A;  5KNL A;  3OIQ A;  3KEY A;  1UEL B;  3A4C A;  4PFP A;  2OUM A;  2M4K A;  1BR2 A;  1W36 C;  2WBM A;  1U0J A;  4XLA A;  2VQL A;  2MAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...