2ZMEC

Integrated structural and functional model of the human escrt-ii complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
SFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar-sorting protein SNF8
publication title Integrated structural model and membrane targeting mechanism of the human ESCRT-II complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 30
structure length 99
sequence length 99
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.570 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A "Winged helix" DNA-binding domain. Chain C. Domain 1 2zmeC00
3CUQC 1U5TC 1XB4A 2ZMEC 1W7PB
chains in the Genus database with same CATH superfamily
2XAQA 3MD2A 2DMQA 3OYLA 1J2XA 4DGWB 4YEJA 1XN7A 4MEYF 5D8KB 1SMYF 4QIWN 2XASA 3O8HA 4BE0A 3L1PA 3AL0B 3SJMA 2XSJC 2QBYB 1P7JA 4YIRX 2E35A 1BC8C 1KU2A 3OOUA 3U1KA 1NG7A 2CW7A 2WV1A 4G6DA 4RS8A 3HEFA 4IL6C 5CYVA 3ABMH 4BAYA 1AHDP 4BBRJ 4HAMA 2VXZA 1T8IA 4XKCA 4AUXA 1MDMA 5L3DA 3Q5FA 2W48A 2CH0A 5HDNA 4Z6YA 2Y2ZA 2JSCA 5K1YA 1N75A 2W82A 4XM3A 3Q9VA 1WJDA 1H0MA 2Y0SN 2OC6A 3BTLA 3KX2A 1SAXA 3WTUC 2BY3A 3V7RA 4DBRA 2R7ZJ 2HDWA 4PSWA 4ZDOA 3CCJI 1ETKA 5B1BH 2QWWA 3H3VK 4HQEA 4X1EA 4CH7A 3HOWJ 3Q0WA 1S72I 1R00A 5HNFA 2DOAA 2FEZA 4Y17A 4ENKA 2NNYA 1YOVB 4Y52J 1DU6A 2VKVA 1MDMB 1YRNA 3ASOH 3BR5A 2CG4A 6PAXA 2LTPA 3FXUA 4FE4A 4XORA 4IRHA 4XBFA 2EZIA 5IP6A 2MABA 4C9YA 1EJ9A 4U0YA 1TT0A 2FQ3A 1VQ9I 1FBSA 2LKXA 3QQAA 4I09A 4RGUA 3HKZA 5L3EA 3FDYA 2KZGA 4Q5SF 3S93A 3VB2A 1FIAA 2F5CA 1YG2A 2B63J 1JKRC 4L9TA 2M87A 3H1CA 5FO5A 4Y4RA 2X1DA 2KP6A 3JRHA 4OAYA 2JPCA 3BY6A 2CRGA 3SZGA 1D1BA 2X1EA 4ZDLA 3WTSC 2K40A 3MQ0A 1P92A 2QGUA 2OV7A 1YRNB 5ILUA 2I8DA 2P5LC 4AM3A 2OZUA 3RI4A 3R0JA 5E3LA 2L7KA 4XRFA 1W7PD 3J80K 2MA3A 3GXOA 2XHKA 5ILSA 1RUOA 3BPVA 1MGTA 4KITB 1LE8A 2IA2A 1TWHJ 3C1DA 2CUZA 4HX8A 3KCCA 3DEWA 4KFCA 2BVLA 2HYGD 2XB0X 3FXMA 4UB6C 4D7NA 3IRRA 2H6CA 1BR2A 3TL4X 3LFKA 4H4KC 3K1PA 1TC3C 4ZH4F 1FTTA 2XF6A 1RI7A 2W57A 4S05A 3KP7A 3KP5A 1D1CA 1X2MA 3HG9A 4L5IA 4RAZA 1X4PA 5LGNA 4BGDA 2IBDA 2P0WA 1XC5A 3QOPA 2EV6A 3J7YJ 2HKOA 2LMDA 2HI3A 1WJCA 2GWRA 1RNLA 4GCVA 1W4MA 3BJAA 4WK8F 5IP7J 1LE8B 1CGPA 1FMWA 2P6TA 2QVOA 3WTTC 1VI0A 2B7EA 4A0XA 3ABKH 1A04A 3ZQQA 2D2WA 5FFXA 1OPCA 1DP3A 3E97A 1Z3XA 2F2EA 5FKMA 3C7JA 2XROA 1XS9A 3QOEA 4KICA 5J3LA 4CCMA 3FMSA 5EJCA 1XTAA 3DQVC 3GFLA 3SFZA 2HVSA 2FMLA 1O57A 3E6MA 4CYDA 1A36A 5DM7F 1Y0UA 2R7WA 3LSJA 1Z7LA 2CQXA 3NWTA 5IOYA 2EIMH 4ENNA 1C0WA 1EH8A 2VLAA 2WAEA 1D8KA 1UG0A 3F8NA 1U3EM 3VWBA 3M3YJ 3FMRA 1Z77A 5EYRA 1E0EA 3F6OA 1VQ7I 3BTCA 2JUGA 3OYDA 3CMEI 3LSGA 3KLNA 3JSOA 3FHNA 9ANTA 4WXCA 1B9MA 3E6BA 1J0RA 1WCMJ 1IUFA 1KYWA 1R4MB 4NDLA 4XKVA 5CVVA 5GP9A 4F91B 2ELKA 3PIOF 4OIPF 4B09A 1Z6RA 1FSEA 5DEQA 1WJBA 3EQLF 3ECHA 2IGOA 2F4OB 1IRGA 3C2GA 1I3QJ 1FIPA 3LMMA 1O4XA 1Y8QB 1EV7A 3RYRA 4EMSA 1PUFA 1U5TC 2ZFUA 3HRTA 2ZJ2A 4BHCA 3JRAA 2IJLA 1TP4A 2ELJA 4IPAA 5KHDA 3KE2A 3WHCA 2K9SA 3C2BA 4U87A 2E1MC 4MEXF 2R7UA 2FF4A 2L4AA 2MLKA 1BOAA 3J7ZI 2NVQJ 2DW4A 2BW3A 5HLHA 2X6WA 2EJRA 1R1TA 1SD5A 1LQ1A 1V3FA 5HODA 3T0YA 1YJWI 2BYVE 4IEJA 4DZPA 2E19A 2UXNA 4E7LA 1IGNA 1ZH5A 3E7LA 2FXAA 2JQ7A 4F93B 1YS7A 1IN6A 3KLOA 2L7MP 1U78A 1LUJB 2FSWA 1AKHA 1PUFB 3SZPA 2OF7A 4BQNA 4B47A 2FU4A 3ISPA 2X51A 4LB6B 1T0FC 3BJ6A 4RB0A 2M45A 4S04A 2BV6A 3OV8A 1SD4A 3DU5A 2GOXB 2BW3B 2JA5J 4XLCA 4HBLA 1I1SA 3GZ5A 1I50J 2KIQA 1P4AA 2GZWA 4A0ZA 1LDKB 2CQKA 4M6VA 4ZTJA 5CQGA 1S5LC 3UKGA 2TCTA 5LRRA 4M72A 4KMFA 4AIKA 1ODDA 2CFOA 4BS9A 1U8BA 4A2UA 2IPQX 4IHXA 2QUFA 4NNJA 5L3CA 1AKHB 2HGCA 3HGYA 4J01A 3S16J 3ZR8X 3JRIA 5CJ9A 3BQYA 3LNQA 3CO7C 1K79A 3FBIB 2EV5A 3PNVA 5GADJ 2JUCA 1B4AA 2EK5A 4GGGA 5KVRA 3R6SA 2EFPA 1FOWA 4NBQA 4DNCA 2JA2A 2P5VA 2CGPA 1JTXA 3FKJA 2DYRH 3DKXA 1P6RA 5H6QA 2EFWA 4AU7A 4CO8A 1UELB 2VE8A 2ZFWA 3FX3A 2KIFA 1A6QA 1ETYA 2XGCA 3V42A 4GYGA 2GXAA 2MGQA 1T56A 1F1ZA 3CJQB 4I98B 5KCMA 4BQOA 3BWGA 3SEZA 1P4WA 4HX4A 4KYWA 2FRHA 4FASD 4ITVA 1ZQ3P 3M1CA 5J1UA 5E1WA 4A6DA 4L0ZB 2LKSA 3LA2A 1OLTA 4N4NB 3HKZN 1O7FA 3F8BA 2LFBA 1R7JA 2QQBA 4UVAA 2GQQA 4D5FA 1BW6A 2OCEA 2IGKA 3L9FA 3BG5A 3IH3A 4A69C 3CMMA 3FXOA 4M71A 1GT0C 4OINF 1HLVA 4BY1J 2OA4A 1WJFA 4L9JA 4W97A 1SVOA 3WU2C 2FA5A 4PGHA 2V26A 2VE9A 2BY2A 4P96A 4V2GA 2E2IJ 1G4DA 5HLTA 2Z33A 3R60A 4QPQA 2E36A 1TNSA 1KQ8A 2VN2A 3F6VA 4RGRA 3ZQCA 5LLQA 2ZBKA 1JT0A 4U0WA 2XRNA 2IAIA 2ME6A 3CO6C 3ZCOA 4G94A 5J1YA 3BOQA 3R4KA 2R7FA 3CDHA 1I1GA 1Z67A 3WODF 3GUDA 1I3AA 1RETA 5F1JA 3F0CA 1OMIA 2GXGA 1UFMA 1LEAA 1BI3A 4Y3OA 3T1BA 4A3EJ 2DN0A 3IWFA 1OQYA 5BQTA 4CYCA 4E7ZA 2W00A 1F36A 1T6SA 1R22A 1BJZA 1XGOA 4GYIA 2KRFA 3I55I 4HNTA 1ZARA 3HOTA 3G73A 3CC4I 4IHSA 4ZYGA 1G3TA 1DPRA 2VONA 4ZC3A 3JRBA 2QEXI 2NVYJ 2FOWA 3KPHA 2H8WA 2QA4I 2GIVA 4UXNA 1IN7A 5M5XJ 1FP2A 1SANA 2DJIA 2JTVA 2K7LA 5TJJA 2K27A 5HDGA 3MZHA 1R36A 2VBWA 2X6YA 5E1ZB 3FISA 4PSXA 1XGSA 1KZHA 2EZHA 4HPQA 4HDVA 4FX4A 2TRTA 4CDGA 2RN7A 1YIOA 2PFBA 4CYCB 4NC6A 4Y13A 1Y1WJ 3CC2I 2VJJA 1OCZH 2MBFA 3HXLA 5DCMA 4HEA2 2A68F 4G7ZF 1WPKA 2MH2A 5M3MJ 1E3PA 1XB4A 2L9NA 4QPOA 2DI3A 3FK6A 1F4KA 1IXRC 1E3OC 1YJNI 1TBXA 5M5WJ 3DFGA 4F55A 4V2FA 2IS2A 5C4XJ 4A3LJ 2KKOA 3H92A 3OYEA 1STZA 1OCTC 1R71A 1QZZA 3Q0UA 2H1LA 5L3BA 3GTQJ 3RKYA 3GWZA 5HLIA 5CVIA 1G8XA 2IS6A 1KYZA 1LNWA 2M5WA 3F9KA 1YIJI 2KDOA 1EF4A 5EF6A 2ZJPF 1QO0D 1DGRM 2B9SA 2L4MA 2XAHA 4LLLA 2XKOA 3QPLA 2W24A 5J6XA 2KT0A 3H5AA 3ZMZA 3VDXA 3MVPA 4LIVA 4G6QA 4YFKF 1S7EA 4RMNA 1OYIA 2V1UA 5GTIC 4HNUA 5L3GA 2EV0A 2MD5A 2OU2A 5LFAA 1KU7A 5JVTA 1H88C 3AG2H 1WJAA 3LFUA 5F27A 2X6XA 1OISA 2R93J 1GVDA 4UB8C 3UNGC 1IN8A 3L2WA 3DBHB 3NRVA 2VKDA 4HZFA 2DK5A 2DPUA 3GTMJ 2F5EA 4IRGA 3BTIA 2COMA 2RREA 5D5WB 3DBRB 1MNEA 5JVGF 2FBHA 3L7WA 3LAPA 2DTZA 2E2JJ 1LFUP 3F21A 2NVXJ 1OKRA 2F4IA 2MH9A 2EIJH 4Z2YA 2WWYA 5H6RA 3ZN0A 3S2HJ 1AOYA 3Q0VA 3EDPA 3T8TA 4E6KG 3J80Z 4KUMA 1QHGA 1G59A 1UAAA 1V5GA 4MFEA 2ZXHA 2K86A 3LA7A 4JX6A 4CZCA 1ETVA 2LNBA 2M34A 3DCFA 3E5UA 2W25A 4O6JA 5DS9A 3MZ8A 2MFZA 3DBLB 1SFKA 5LHGA 2K02A 2HXOA 2G0EA 3OYGA 5FLMJ 3VEPA 2PI0A 3WE3A 4XN0A 2DJNA 1D5YA 2E7XA 2OTLI 2NYXA 2X1CA 3LSHA 2AQEA 2A6HF 3REOA 4BU2A 4JOMA 1GLNA 2KFDA 2EB7A 4NUBA 3OYKA 5D4RA 2HQNA 4WF2A 3MKWB 3PO2J 2L5QA 4BXUA 1RKTA 2DO7A 2HYFA 3M1EA 2XGEA 2G7UA 1B9NA 2FQ4A 2V9PA 3RKXA 2ZJQF 2RGVA 3HPHA 2O9LA 4HF0A 2QCOA 3ZQHA 1H89C 3TOBA 4A3KJ 1H9TA 5J40A 2BHYA 5EEAA 2I10A 1IN5A 1ZAOA 3DKWA 2HOEA 1ZELA 2DA5A 1MIJA 1D0YA 3CUQA 4BXXJ 5FGMA 1TWAJ 3F8MA 1N25A 5FJ8J 2HDDA 1L0OC 2ZO4A 5D5XB 5JHFA 4XSZF 1MBEA 1PJRA 2V9VA 2YUSA 2XF5A 3ZQ7A 2H27A 2YU9J 1IJWC 2VODA 5GTHC 3BLYA 1ZHFA 5ED4A 1IZ1A 2VI6A 5DV5A 4LITA 1GXPA 5F08A 3I71A 2R92J 4RAYA 1U9NA 2Z5UA 4HNVA 3WU1B 3IKTA 4JQFA 1LEBA 4AC0A 1R23A 1G3SA 2ZNYA 3FXQA 3OYFA 1BIAA 2AHQA 1BR4A 4JYKA 4HF2A 2G9WA 2ZMEC 3MEXA 4I02A 4YFNF 1OR7C 2L9RA 4UUVA 2X9DA 4XLEA 1U2WA 1WGXA 3CUQB 1K4SA 1O3RA 3LSIA 2DMNA 3KYLA 2VC1A 4M6XA 1JJ6C 2E1NA 2Z99A 5A2QZ 3L2RA 2BY1A 4I99C 1YX5A 3G1OA 1G3WA 5JHUA 4A3IJ 3MCZA 3VPRA 5LEKA 1D5VA 2HPMA 2XPVA 1FY7A 3RYPA 4RGSA 2HNHA 5AIQA 3SQNA 1GHCA 1E2XA 1UG2A 4PUSA 1QBJA 3ROUA 3TP0A 3K4CA 2FMYA 4B8XA 2VUMJ 3GTKJ 1WKMA 3NQOA 1AA7A 1ENHA 1PUEE 1GV2A 3AG4H 2DBBA 4WWCA 3F8FA 3T8RA 2WY7Q 4JBAA 2ADUA 4ENJA 3BZ6A 4FT8A 2L01A 4N9IA 4ZYDA 3BR3A 2MG4A 1Z0XA 2HPIA 4HV6A 2ID3A 2RKHA 3ERMA 3K6GA 1WH7A 4C3JJ 1U5TA 2JJ7A 2VXDA 2HYJA 2YPRA 1D1AA 4ABZA 3N05A 2A6TA 3QP6A 1WZ2A 1FMVA 2D5VA 1HDPA 1V4RA 2EINH 3L00A 4XQFA 3FM5A 2W1OA 2NAZA 1IW7F 3A0BC 1J59A 1BI1A 4C3HJ 2WB1A 3I4MJ 5E3NA 2XC7A 4A3MJ 2NXNB 3S8PA 1EKEA 2DFIA 3G1MA 1GVJA 4ENMA 2K9MA 1MSEC 4CCOA 1YTYA 3LL7A 1JGSA 1S6LA 2V1NA 1AWCA 5E20A 2R4GA 5BNGA 1O7LA 3KP3A 1BBYA 2OQGA 3ASNH 1POGA 2VOOA 1ORKA 2D1VA 4IRIA 1SFEA 1U5TB 2LY1A 3CZ6A 3HHHA 4NHJA 1X1DA 1WH5A 4D5CA 2XGDA 4A12A 1VFCA 1T0FA 1FX7A 3CCUI 2YR2A 3GYHX 5D5UB 2RDPA 1FSHA 2W85A 2FD5A 2IP2A 3ELKA 1BJAA 1WWXA 3H5NA 2R5ZA 4GFBA 1HQCA 3BT9A 2Z16A 1X1PA 4XK4A 1RUNA 4DQ2A 3QPTA 3BG9A 5DD4A 5F64A 5HS9A 5C3EJ 1LKXA 5HOOA 4II2A 3MKLA 4BH9A 4FISA 1ZG5A 3WG7H 1ZR2A 5IOZA 4ZYEA 1FWZA 1X3WB 1MBFA 2I5UA 3BG7A 5LHHA 2L54A 3KYCB 2Q8KA 3L2QA 1HF0A 5LRSA 2R7TA 1IRFA 2CU7A 1OYYA 4MQVA 2M2EA 1ON1A 1ZG3A 2AXTC 1ZTRA 4CCLA 2JSPA 2A6EF 1VQ8I 3ZMUA 2Y9ZA 1OFCX 3X2QH 5ICCA 1FP1D 2R5ZB 2K85A 3GTPJ 3HOYJ 1YI2I 3JSPA 1ITYA 1HA8A 3I64A 3WTVC 4CCNA 2R0QC 1F5TA 4P9FA 3K7AJ 4UHTA 1K83J 2KPMA 2CV2A 4YFXF 4MQ9F 3W6VA 3CMYA 4BJ5C 4OIQF 3GEZA 2M30A 2DFEA 3D5RC 2VIXA 2Y9YA 3K0LA 4XN3A 2OAZA 1MMDA 5H20A 2VBXA 3OOPA 2LD5A 1IV6A 2O3FA 2ELHA 4U7BA 3J81Z 3KZIC 4KT6A 3ZMSA 2Q1ZB 2Y0MA 4JX4A 1YFHA 1BN5A 4MHGA 2F5VA 4BHPA 1VQOI 2Q0OA 1I6HJ 3HYIA 4F92B 4KIGA 2CV0A 2VQHA 3I56I 2J5OA 1Z1DA 1MH4A 4XOTA 2PJPA 2EZKA 1T08B 3LAJA 3E1SA 3NAUA 4M9ZA 2BVMA 4LK1F 5K7HA 2BOLA 5TRDA 1DQUA 3VSKA 1JTYA 3C18A 4RA2A 1REPC 3AL0C 2A5YB 1RR8C 4LLGF 4IF4A 3SEQA 2Z2SB 1Q1VA 1FYMA 1O3SA 2DA4A 3EUHC 4DOZA 1T98A 1KQ0A 1X3UA 3G6EI 1FC3A 1NK2P 1HDDC 1W0UA 1S8NA 2HZDA 3PM1A 4UY8I 2M7BA 2DT7B 2WA0A 1XSVA 4CA0A 1TTYA 3CESA 3EETA 3JCUC 2UZKA 1MBGA 1XCBA 2J5PA 3RKWA 4J00A 5TISC 4TV7A 5A2QK 1TQMA 1NK3P 4GRIA 4WXHA 2NVUB 1D3YA 4ZJZA 2XPUA 2X48A 3PUFA 2IA0A 2O61A 1T33A 3SZTA 1E3HA 5D8LB 1I27A 3LQQA 4CUGA 4CHUA 4HQMA 1RR7A 2IA1A 2P5KA 3ECOA 3HRSA 1BL0A 3P7NA 3RJPA 2L9SA 3RPUA 1YW7A 2JRTA 1ZR4A 3HDDA 2BE5F 2QYOA 2DDBA 3H36A 2IRFG 3LWFA 1W36D 4ON0A 1IC8A 4EM0B 3OS2A 1J7KA 3P9CA 2DCEA 2V79A 4MIMA 4YRVA 3TMOA 1FTZA 1J9IA 1WI3A 3S3OA 3DF8A 2ZSIB 3RPQA 4UVBA 4D1QA 2EQRA 5FFZA 3QU3A 4G7HF 1X1BA 3HBLA 4EV0A 1JGGA 1DU0A 2XIGA 2ZSHB 5M3FJ 4YIFA 2F5FA 3K10A 1O3TA 1HKTA 3VYSB 2ZXWH 4RDUA 2VPLA 3LSPA 1M1EB 5AONA 2X0LA 3V8JA 4CZZA 3DU6A 4ESBA 1OJLA 2Y48A 2HS5A 2BXYA 3BZCA 2QSHX 1K4TA 4ZZDA 5BMZA 3S1RJ 2RQPA 4MTEA 4FE7A 3GFIA 2DAOA 4UNOA 3J7AO 1U0JA 3BP8A 3IAS2 4C3IJ 4H0EA 1G2HA 3G3ZA 4OU0A 2EBIA 1UJ8A 2P4WA 4YG2F 4UUTA 1BW5A 1MSFC 4B4CA 5CPRB 1L3LA 2TDXA 3ULQB 2STWA 1BM9A 4B48A 1IV8A 3LQRA 2VKEA 4ESJA 1W36C 1IF1A 1ZYRF 2VQGA 1I5ZA 2M1BA 3LOCA 3TDZC 1K6YA 5FKNA 5K5RA 2KJCA 1TZLA 2M9HA 2XSDC 1XCVA 5DTDA 4A3BJ 4J19A 3N97A 4WXDA 1X1AA 3H0GJ 2WB1N 1OCPA 3L09A 2PBIA 3MAJA 1J5YA 2Z9OA 4ZDPA 2X85A 2ZCWA 3JRCA 5HVQC 3SXYA 3OS1A 2AS5F 1FBQA 3AAFA 3PL8A 3QODA 1IO2A 3M7GA 4YELA 1TWFJ 1UZCA 2V1XA 2DU9A 1QNTA 2BHZA 2X6OA 2HVRA 3JRDA 3CUOA 1I6XA 4KMUX 2MYSA 1B8IA 3GZ6A 1U6GA 3A2KA 2BBYA 3JW4A 4XOPA 3A1YA 1HKQA 3F3XA 2EFQA 4LOCA 3CF5F 2P7CB 2MD0A 5GAHJ 4BUPA 3PNTA 5E3OA 3OYMA 2GA1A 1TW2A 4LD5A 4BEHA 4PJLA 3KIOA 4KDPA 1VQ5I 1FBUA 2DMUA 2GBYA 2HOAA 1ACIA 1ZGAA 2K5CA 4DIQA 2LR8A 4E7IA 4EJTA 3TDUC 2RNGA 4RLQA 4I2OA 4M6YA 1GUUA 5AIPA 2HZTA 3J81K 1VTNC 4P5OA 5D6FA 1MJ9A 3I4PA 4NQWA 3GTJJ 3AKZA 3OSFA 4I0BA 3DTKA 1LB2A 5D4SA 1P2FA 5IY5H 1R49A 3CP8A 3A4CA 1B8IB 2HQ5A 3RZDJ 3L2CA 3K9TA 2DT5A 5F1RA 2E34A 2IXSA 2WAFA 3VYRB 1KU3A 2MC4A 4F3QA 1F43A 1T39A 4XKBA 2DDAA 1JUMA 3TW6A 3PSIA 3K2AA 4CXFA 3RIRA 3M07A 3I4NJ 2EPFA 4BEHB 4BQQA 3ZQFA 1V54H 3DLAA 2E5NA 2HR3A 2JRMA 3PQJA 2R7RA 4BACA 4R1HA 3S3MA 3H3UA 1BC7C 3E3VA 4PDKA 2VQLA 3A02A 4R8HA 2EILH 2VC0A 5CVRA 1LFPA 4E7JA 2CSOA 3EPZA 4I0AA 5GPAA 3CJNA 2EWNA 2HQAA 3TO6A 1P7IA 4XLHA 3K70D 2VJ5A 4RB1A 1HW2A 1YE9A 1UCRA 5D6EA 1OR7A 3QYFA 2W84A 3KP4A 4II3A 4RAFA 4U88A 5LEJA 3LSRA 4IO9F 2FE3A 2JVHA 3TO9A 2JA8J 3JRGA 5E17F 5IT9Z 3DV8A 2ZNZA 4WCGA 3H5RA 4N0BA 3S15J 2VJIA 1QPMA 2IW5A 3EYYA 3JAMZ 4MGRA 2UWMA 1MJAA 1MNDA 3ONQA 5KAFC 3GTGJ 4UUSA 2IT0A 1R9TJ 2WAQN 1AU7A 3I58A 5J8CA 2XRLA 2PN6A 3T5XA 3KETA 3ZMDA 4ZZLA 2PLYA 2NS8A 1IAWA 2OJED 5IPAA 5F0CA 3LSKA 3GTLJ 2E71A 3I3LA 5JLWA 2CS3A 2ESHA 4HYEA 3SDGA 3GTOJ 3CDLA 2LY9A 3FIWA 2QQ9A 2K9QA 4IQ4A 1ZKGA 1I39A 4LG3A 1Z21A 3LSTA 3IUOA 5F0HA 1TWCJ 3BPXA 1O3QA 4AIHA 4EM1A 3PSFA 4UUSB 3ABUA 1FYLA 2YS9A 2UV1A 3VSLA 2YX7A 1SVMA 1PDNC 3BR0A 1LPQA 3W2VA 3HJEA 3MN2A 4XONA 1T38A 4XKWA 5DCMB 4L9NA 4IHYA 3K70C 1MBJA 1Y56A 5CVUA 5EEHA 5LHIA 2HEOA 4DJAA 1JXSA 4LG0A 2KRCA 3P5JA 3HOZJ 2Y69H 1IDYA 4KT5C 3V4GA 3GCMA 1ETOA 3TW7A 2CO5A 2NOJB 3ABLH 3RQ4A 5LGTA 1Y1VJ 3WE2A 3OIPA 2LH9A 5JFRA 4BE1A 1H8AC 2L0KA 3CTAA 3W3CA 2DPDA 3GBGA 3F22A 3N4MA 5ILVA 1VF9A 4BYYA 3WGIA 5IP9J 3PUBA 2RC4A 2KQRA 4OOIA 4Q4ZF 1ETQA 4Y15A 4HG2A 1G6NA 1A5JA 3IKVA 5K5QA 4FHTA 3GX4X 4KN7X 3K4JA 3FKIJ 1YS6A 3VYTB 1BI2A 1H9GA 4EEFG 4L5JA 2OUMA 2RQQA 2DA2A 1V5EA 2GAUA 2EH3A 2R3SA 1ONVA 2E7WA 3CLOA 5JLXA 4LG0B 1HKSA 1R58A 1QU3A 3DWLE 2YSRA 4LFUA 3U1DA 4KN4X 4JK1X 3KP2A 5FLVA 4RM2A 4PJMA 1ERDA 2G7HA 4IHTA 1YJ9I 2BXZA 1N78A 2ZJRF 1WRJA 3MMYB 2K9LA 1J09A 1EH7A 4BDYA 4RB2C 4B43A 2DOFA 5IYBJ 1MBKA 3COAC 3OYNA 1V55H 2ZXJA 3BJOA 4BY7J 2BZTA 2MC3A 4I01A 5HS8A 2CMPA 4AVPA 4EJOA 1J75A 5BS6A 1IG7A 1SFXA 3PFYA 5DCFA 1YO5C 3IHUA 3PNYA 3S2DJ 3QPHA 1X2NA 1K7AA 5ICFA 4XR6A 4XSXF 1K78A 1MMSA 1CQTA 2JVGA 4XLAA 1X58A 2XAJA 3NEUA 1QQIA 2LREA 2NS7A 5IYDJ 1ZGJA 5FKLA 4QWQA 1HBXG 5J4VA 3CCSI 1FOKA 2JT1A 3KP6A 2XGXA 5HDKA 5E8GA 2A61A 1TT5B 1EA3A 2LF8A 4PK4A 2VJ4A 1MJBA 1VQKI 2C6YA 1JJ8C 4I6ZA 1IRXA 4OWRB 3VOEA 3E5QA 3HGGA 3MWMA 5FB2A 2JPBA 1QA6A 3WG9A 3HUGA 1JHHA 3LA3A 2LKPA 2KHMA 3AG1H 4MTDA 2BEOA 5KK1A 1QVUA 4PCQA 2KLOA 2ZXIA 1B6AA 3CP2A 5BOXA 2X4HA 3DTIA 4PFOA 1Z6TA 3DTEA 2GM4A 4O5VA 2HU9A 2DT6A 3VFZA 3G71I 4AWXB 1K78B 1HXDA 4X0GA 4XMYA 2IS4A 3RZOJ 4HOBA 2ISYA 4GXOA 2LYCA 1W7PA 4B3XA 5F6FA 1X3ZB 2CFXA 1SD6A 2QQAA 1RRJA 3I53A 1X1CA 1VQLI 2KL4A 3E5XA 2HOSA 4XLNF 3GFMA 2JWTA 1Z05A 2HDCA 3HM5A 3EUHA 2XF7A 1KA8A 3G1LA 3ZGKA 3KFWX 3OY9A 1B1BA 1LVAA 2R7DA 4N9HA 1N77A 1DP7P 2AXLA 2CUEA 1XMKA 1P4XA 4WX9A 2YX4A 2ISZA 3H9JA 2FNPA 5IT9K 4A3CJ 3JAMK 1G3YA 5J8FA 4YIIA 1VQ4I 4PJJA 5FRNA 3O3KA 3OYAA 2DMTA 2DLLA 2LP0A 5FKKA 3FMQA 4NC7A 5J1RA 4EJVA 1A31A 1XX5A 1UHMA 1D0ZA 1W7PB 4EJUA 4A3DJ 2O7OA 3FF5A 3TGNA 3F8CA 4U0VA 2F5DA 3S17J 5JR3A 5C44J 3B02A 1R5ID 1QGPA 3IH4A 4DW6A 1BR1A 1FZPB 2BY0A 3K4BA 2DFHA 4UV8A 2A69F 4HSTA 2NS0A 3FWEA 1R6RA 3OYBA 4M3BA 2IGMA 1WJEA 5K7FA 1JT6A 3CCVI 5FD5A 1XGNA 2O5RA 2GA2A 4LJZF 4A6EA 5KNLA 3UR3C 3H0DA 4HF1A 2XAUA 2HOTA 2L02A 5E3MA 4CCJA 1WVRA 2OQRA 2R5YA 4DBQA 3K4MA 3HB9A 1KGSA 4E70A 3QP5A 3S1QJ 4KJZA 5KAIC 3WGGA 2ZB9A 1A6IA 5HLGA 3WGHA 3O6BB 1X19A 2QENA 3CC7I 4Q48A 2ME0A 3HTUA 4UV9A 2MW8A 4M9XA 2DYSH 4Y33A 4RAGA 4AYBN 2E1MB 1P9QC 3CCEI 3RQIA 3IV5A 2VBZA 4ZYHA 5TGTA 4IOCF 2N8GA 2K3FA 2HVQA 3JTHA 2VT2A 3OYIA 4MFDA 3ZXSA 2QZ8A 3W2AA 2R7VA 2OTJI 5EZGA 2R5YB 2F6CA 2P81A 4BXFA 3B6CA 3OMYA 3ZN1A 2OZ6A 1SD7A 3ZMVA 2FX0A 1NHAA 1WI9A 2AQFA 4KIBA 3DEUA 3RKQA 1MW7A 4A0YA 4F7ZA 5EGOA 4LGWA 2K3PA 2LBFA 2ETHA 3M9AA 2QLZA 2M7AA 4QTRA 2XKPA 1OCCH 2B0LA 2OD5A 4CGZA 4E4HA 1VQPI 3OS0A 5E18F 1XDSA 1ZN2A 3QYEA 3L2UA 4KIFA 2MSYA 2KZVA 4HDUA 3JR9A 4CCKA 3U9GA 4EGZA 1QHHD 2XDVA 4S0HB 1Y6IA 3K4KA 2DOEA 1S3JA 4HLXA 2HKXA 3ZQIA 5BPDA 2GXBA 4HW0A 4FX0A 3DPTA 1EH6A 1ZK8A 2CUFA 1U9OA 3HOVJ 4BE2A 4RLFA 4FCYA 1YITI 4BQAA 4W1UA 1UHWA 5EGOB 4NC8A 2LBFB 3CCYA 4M3GA 2E2HJ 1BOBA 2FBKA 1TQPA 2F4MB 4OMZA 1F9NA 2IS1A 1D0XA 2RVCA 3M8FA 3H3ZA 3V8LA 3CUQC 1NTCA 3KYDB 3FZVA 2L7FP 3FXRA 4IJAA 2WAQA 3ZRGA 2P7VB 2VKHA 3ZMTA 1DGWY 2CW0F 2OPTA 4G12A 4LK0F 3RTRA 4BDZA 2JA7J 2DK8A 4A5NA 1TW3A 2M0MA 4F52A 1ON2A 4B44A 3BG3A 3ZOBA 1ZRDA 3BG6A 2MLGA 2A5WA 2GIZA 3HTSB 3OYCA 2STTA 3ESWB 3BC8A 3CCQI 1USTA 1RESA 2ID6A 4CICA 3MKZA 2XVCA 3IRQA 4L5EA 3FXLA 3R0AA 4IXAA 2YU3A 1WJ5A 3OYHA 4P1WA 4GO1A 5C4JJ 3TP3A 1RZ4A 3V7CA 2D1HA 3W6KB 3S1MJ 2VQCA 3S32A 3HIFA 3HOXJ 3KZYA 1Z9CA 2E60A 3A0HC 3ZQGA 4A3FJ 3K69A 5J47A 2VPRA 5F04A 1KQ9A 3IL2A 3CF2A 3M8JA 4EVIA 1PYVA 3D5LA 3H35A 3DP7A 1YW9A 3EUAA 2VB6A 4E7KA 1XG1A 3OWTA 4R79A 4C2UA 1MMGA 2W4SA 3S14J 2EFNA 3JREA 2DODA 2XB5A 1USSA 1XD7A 2IGNA 2LLKA 3BROA 3E6CC 3HZJA 2O8KA 1RKWA 1ULYA 2KISA 4MO7A 5BPIA 2FNAA 5FRMA 1MH3A 3AFHA 3IP4B 4QSHA 4M74A 3I59A 4AIJA 3TEDA 1U8RA 3H9QA 3S3NA 1S7OA 2DA7A 3I9V2 4HX7A 3EYIA 3HPGA 4PJNA 5GAEJ 2PMHA 1XMAA 2R7QA 4AIDA 1HOMA 3W2WA 5ICEA 3A01A 4ZTFA 2GLOA 1IXCA 1YLFA 2UXXA 2H6BA 1R1UA 4XLFA 5K7ZA 3IWZA 4EATA 2CJJA 2DXIA 1Z3YA 1GXQA 2DA6A 4OIRF 4EQQA 4P9UA 1A35A 2A3SA 4I76A 2KIMA 3SHFA 3WTXC 2V9KA 2O6GE 1UHSA 3CD6I 2DMPA 1SC7A 2HFHA 2CW8A 2LRDA 3I59B 1YQAA 2PEXA 3OL3A 1RIOH 4BNCA 5E79C 1JKPC 1YHQI 2KDZA 5DYMA 2QSGX 1IRZA 1E17A 2IEKA 2JN6A 4Y7NJ 2UUZA 3GF2A 1R4NB 2PMZA 2QKLB 4IZZA 1BA5A 3GLLA 3A01B 1BIBA 2KJBA 2LOOA 5FD6A 1JHFA 4LB5A 1FNNA 1SEUA 1UB9A 5EZHA 3WHBA 2VASA 3AG3H 3PFIA 1ZGWA 4OMYA 1JUSA 4FETA 2KMUA 2ZKZA 3BR2A 3GW2A 1VQMI 3BQZA 4XL9A 5LD2C 2L3DA 3CCLI 1R5GA 2WC2A 3FBNB 2WBMA 2O03A 1WHUA 1YYVA 2CQ7A 4D0PA 4OAZA 4D9JA 4ZYAA 3QPSA 3SDBA 5DDGA 3K2ZA 3Q3SA 3GFJA 3E6DA 1K61A 2HXIA 4XRSA 2V6CA 3BTJA 5GAGJ 5B1AH 3JTGA 4IHVA 3WU0A 1HW1A 3LSMA 2ECBA 1MD0A 1SAUA 2QKMB 5L3FA 2V6EA 4IOAF 3OR1C 4ANJA 1HCRA 2QF7A 1NG6A 4XNFA 2NOGA 1IXSB 1JKQC 2O8XA 3S2WA 1GV5A 2M8GX 4C2TA 4IVNA 4XIDA 1QRYA 1Y39A 1R5HA 1Y0NA 5K5OA 3WTYC 2JZYA 2CYYA 1HSJA 2PX9A 4AVZA 1ZLKA 1APLC 3A03A 3CJRB 1SFOJ 4M3FA 5M5YJ 2VL8A 4BHBA 1FOXA 4M9SA 1RC9A 1SFUA 2LG4A 3G4SI 1LDDA 3P9IA 3Q9SA 3V7SA 2Y30A 2WY8Q 3SFIA 2FOKA 4GDFA 4ASNA 2E1OA 2LC2A 3TO7A 1Y8RB 3HRMA 1DUXC 4HLYA 3U2RA 2H8RA 4L0YB 2V7FA 3TOAA 1PVEA 1TNTA 1FJLA 4XRMA 3RPUD 1QPIA 3M8EA 4DYQA 4HV5A 3OR2C 1ZLJA 4BJTA 5B66C 1Z91A 5H2FC 1PP8F 1SMTA 1VZ0A 4D7MA 2FJ1A 4N4OB 1QZEA 3HC7A 2HTSA 4DYCA 1LVKA 1YW8A 1VQNI 3V8KA 2ESNA 1FLIA 2JMWA 2NRAC 4LMYA 4IKFA 4HSRA 2M8EA 1UMQA 5DM6F 3KEQA 4G9YA 3U21A 3GMEA 1JKOC 2OBPA 3I0TA 5FKOA 1XSDA 1D8JA 4EJWA 4RBOA 2XAFA 4NQWB 2ZC2A 1LFBA 5EDNA 1VNDA 1CF7A 1YX3A 2P8TA 4CSWA 4RB3C 4IX7A 3IC7A 4PGGA 2ZMEA 3M4OJ 2Y0SA 4ESFA 1WQ2A 2Z1DA 3DPUA 4C2MJ 1W0TA 5HS7A 5FLXZ 3FK7A 2WADA 5DUKA 2DFFA 2O0YA 2PQ8A 4LLNA 3QYBA 1NH3A 1R1VA 2NNNA 4A3JJ 2Z3YA 3SYTA 4RGXA 1JUPA 4AYBA 4BKXA 2GOMA 4JX5A 1B72A 1Z7UA 3OIQA 2PJRA 4BBSJ 1PP7U 3HHGA 2ECCA 2VOPA 3FM3A 3TQNA 3CDIA 3O2PE 4KNYA 4JP0A 3D1NI 3TBIA 1GDTA 2DA1A 3HOSA 3NWSA 1DDNA 2E5ZA 1HW5A 1ZRFA 3MFKA 1FT9A 1CF7B 1RPWA 1OYWA 1S9HA 2OCCH 1S29A 2L7ZA 2Y75A 2H1KA 3OYJA 3WTWC 3I5UA 2ACJA 2ZMEB 1XSXA 2HQRA 1BI0A 4ETSA 4A93J 2D45A 2EFOA 3D0SA 3HSEA 3DLLF 1TL8A 4IQJA 3F72A 2Y31A 3ZP5A 1KONA 1MNMC 2DQRA 4UVCA 4E7SA 2PMUA 3DEEA 2K4JA 5IT3A 4V19K 2RV8A 1MBHA 4FTHA 3CMAI 3K4LA 3QAHA 1MKMA 1T2KA 1B72B 4KISA 2M4GA 2PJRB 2EZLA 2H94A 3CCRI 3NARA 4B1RA 4MNUA 3B73A 3BCAA 4NB5A 3MKYB 1S7AA 3K1MA 2P6SA 1TQIA 2L2OA 2F48A 2R7OA 1ETWA 1ETXA 2BGCA 3S1NJ 3ML6A 3K4NA 1LJ9A 3C3WA 5ERIA 1JI8A 3CCMI 5HNHA 1OCRH 4DZJA 4AD9A 3GO5A 1TWGJ 2K4BA 3F23A 4IHWA 5D5VB 3GLXA 2RAEA 2JA6J 2H09A 1JE8A 1MMAA 1ZREA 2LK2A 3OIOA 2R7XA 5DUIA 1B59A 4XICA 5LBQA 2LVSA 2CWEA 3EUKL 2V1DA 1XPXA 3FXKA 4M3EA 3HSFA 2HWVA 5EG0A 1MMNA 5LGUA 3DPLC 2VT3A 5IYCJ 4M73A 3VODA 4PZJA 3OL4A 4HRIA 2FUG2 3D5SC 4OIOF 4G7OF 1IDZA 1MZBA 3PJRA 4RM3A 3H9GA 2LY2A 4E7HA 3DXJF 3RSNA 2R7SA 4PFPA 2CQQA 2LF7A 2FBIA 3L2VA 5B3SH 3CJTB 2IVMA 2M4KA 1HSTA 3HRUA 3R61A 2CUJA 2JK3A 2Q2EA 3QU6A 2QM3A 3MZYA 4BL0B 3BZKA 1XGMA 4A3GJ 1WFXA 2XV4S 3BR6A 1X4OA 1V5FA 2A05A 2XUBA 4L9VA 5EG0B 2K9NA 5CVJA 2ICWG 4XRSG 3FXJA 3KZZA 2CV1A 2PMZN 1Q1HA 4X6AJ 5CQEA 1IN4A 1QVTA 3IAM2 3K1NA 3PO3J 3ABTA 4EM2A 1WSUA 3J7AY 3QRFF 2RNJA 2QQ8A 3CLQA 5B5EC 3KEYA 3BR1A 4FQGA 2M0CA 5J4YA 2WV0A 1OCOH 3CQZJ 5E8IA 1XDUA 3WTZA 4L18B 4O3MA 5FROA 2KIUA 3DKYA 3QWLA 2A07F 2NVTJ 1DPUA 2AO9A 3GVAA 2LSOA 1LDJA 1W1WE 1W5SA 2Q2EB 2E1CA 1QZYA 3RCOA 1FEXA 2QSFX 3RDIA 3BCBA 1W5TA 1FYKA 1XMXA 4KA4A 2XAGA 5JI6A 4A5MA 1T95A 2VBYA 4DYRA 3HL2A 3O8GA 3ZQLA 3GZNB 3B6AA 4BJ6C 2CQNA 1ZRCA 1FOYA 2KRHA 1KU9A 4HA8A 1FPQA 3PIPF 4G8XA 2COBA 2V4JC 3HOUJ 2LDUA 4Q47A 4U7DA 1IUYA 3E0JB 3VYUB 4G6TB 2DTRA 4P55A 2XPWA 4PJ0C 3P9KA 2EIKH 2EA4A 2HTJA 5EEGA 4B3AA 5E1XA 3ZPLA 5CLSA 2L9VA 5F0FA 3ERED 3HSRA 2QBYA 3C2HA 1SVLA 1VQ6I 3I54A 5CKTA 1ZG1A 3HUGB 1TLHB 2DQLA 4LIUA 2EA2A 5ICGA 3FHZA 3G2BA 2W7NA 4K2EA 1K6OA 3KEOA 3W6JB 4MLOA 4QLCU 4XLPF 3PQKA 4C30A 4EGYA 1HC8A 2PG4A 4I7HA 2M3AA 5FLXK 5DD8A 5GPCA 2DA3A 3JRFA 3OSGA 3TKYA 4M3DA 3BDDA 3IH2A 2WTEA 1W5CC
chains in the Genus database with same CATH topology
3CUQC 1U5TC 1XB4A 2ZMEC 1W7PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CUQ C;  1U5T C;  1XB4 A;  2ZME C;  1W7P B; 
#chains in the Genus database with same CATH topology
 2XAQ A;  3MD2 A;  2DMQ A;  3OYL A;  1J2X A;  4DGW B;  4YEJ A;  1XN7 A;  4MEY F;  5D8K B;  1SMY F;  4QIW N;  2XAS A;  3O8H A;  4BE0 A;  3L1P A;  3AL0 B;  3SJM A;  2XSJ C;  2QBY B;  1P7J A;  4YIR X;  2E35 A;  1BC8 C;  1KU2 A;  3OOU A;  3U1K A;  1NG7 A;  2CW7 A;  2WV1 A;  4G6D A;  4RS8 A;  3HEF A;  4IL6 C;  5CYV A;  3ABM H;  4BAY A;  1AHD P;  4BBR J;  4HAM A;  2VXZ A;  1T8I A;  4XKC A;  4AUX A;  1MDM A;  5L3D A;  3Q5F A;  2W48 A;  2CH0 A;  5HDN A;  4Z6Y A;  2Y2Z A;  2JSC A;  5K1Y A;  1N75 A;  2W82 A;  4XM3 A;  3Q9V A;  1WJD A;  1H0M A;  2Y0S N;  2OC6 A;  3BTL A;  3KX2 A;  1SAX A;  3WTU C;  2BY3 A;  3V7R A;  4DBR A;  2R7Z J;  2HDW A;  4PSW A;  4ZDO A;  3CCJ I;  1ETK A;  5B1B H;  2QWW A;  3H3V K;  4HQE A;  4X1E A;  4CH7 A;  3HOW J;  3Q0W A;  1S72 I;  1R00 A;  5HNF A;  2DOA A;  2FEZ A;  4Y17 A;  4ENK A;  2NNY A;  1YOV B;  4Y52 J;  1DU6 A;  2VKV A;  1MDM B;  1YRN A;  3ASO H;  3BR5 A;  2CG4 A;  6PAX A;  2LTP A;  3FXU A;  4FE4 A;  4XOR A;  4IRH A;  4XBF A;  2EZI A;  5IP6 A;  2MAB A;  4C9Y A;  1EJ9 A;  4U0Y A;  1TT0 A;  2FQ3 A;  1VQ9 I;  1FBS A;  2LKX A;  3QQA A;  4I09 A;  4RGU A;  3HKZ A;  5L3E A;  3FDY A;  2KZG A;  4Q5S F;  3S93 A;  3VB2 A;  1FIA A;  2F5C A;  1YG2 A;  2B63 J;  1JKR C;  4L9T A;  2M87 A;  3H1C A;  5FO5 A;  4Y4R A;  2X1D A;  2KP6 A;  3JRH A;  4OAY A;  2JPC A;  3BY6 A;  2CRG A;  3SZG A;  1D1B A;  2X1E A;  4ZDL A;  3WTS C;  2K40 A;  3MQ0 A;  1P92 A;  2QGU A;  2OV7 A;  1YRN B;  5ILU A;  2I8D A;  2P5L C;  4AM3 A;  2OZU A;  3RI4 A;  3R0J A;  5E3L A;  2L7K A;  4XRF A;  1W7P D;  3J80 K;  2MA3 A;  3GXO A;  2XHK A;  5ILS A;  1RUO A;  3BPV A;  1MGT A;  4KIT B;  1LE8 A;  2IA2 A;  1TWH J;  3C1D A;  2CUZ A;  4HX8 A;  3KCC A;  3DEW A;  4KFC A;  2BVL A;  2HYG D;  2XB0 X;  3FXM A;  4UB6 C;  4D7N A;  3IRR A;  2H6C A;  1BR2 A;  3TL4 X;  3LFK A;  4H4K C;  3K1P A;  1TC3 C;  4ZH4 F;  1FTT A;  2XF6 A;  1RI7 A;  2W57 A;  4S05 A;  3KP7 A;  3KP5 A;  1D1C A;  1X2M A;  3HG9 A;  4L5I A;  4RAZ A;  1X4P A;  5LGN A;  4BGD A;  2IBD A;  2P0W A;  1XC5 A;  3QOP A;  2EV6 A;  3J7Y J;  2HKO A;  2LMD A;  2HI3 A;  1WJC A;  2GWR A;  1RNL A;  4GCV A;  1W4M A;  3BJA A;  4WK8 F;  5IP7 J;  1LE8 B;  1CGP A;  1FMW A;  2P6T A;  2QVO A;  3WTT C;  1VI0 A;  2B7E A;  4A0X A;  3ABK H;  1A04 A;  3ZQQ A;  2D2W A;  5FFX A;  1OPC A;  1DP3 A;  3E97 A;  1Z3X A;  2F2E A;  5FKM A;  3C7J A;  2XRO A;  1XS9 A;  3QOE A;  4KIC A;  5J3L A;  4CCM A;  3FMS A;  5EJC A;  1XTA A;  3DQV C;  3GFL A;  3SFZ A;  2HVS A;  2FML A;  1O57 A;  3E6M A;  4CYD A;  1A36 A;  5DM7 F;  1Y0U A;  2R7W A;  3LSJ A;  1Z7L A;  2CQX A;  3NWT A;  5IOY A;  2EIM H;  4ENN A;  1C0W A;  1EH8 A;  2VLA A;  2WAE A;  1D8K A;  1UG0 A;  3F8N A;  1U3E M;  3VWB A;  3M3Y J;  3FMR A;  1Z77 A;  5EYR A;  1E0E A;  3F6O A;  1VQ7 I;  3BTC A;  2JUG A;  3OYD A;  3CME I;  3LSG A;  3KLN A;  3JSO A;  3FHN A;  9ANT A;  4WXC A;  1B9M A;  3E6B A;  1J0R A;  1WCM J;  1IUF A;  1KYW A;  1R4M B;  4NDL A;  4XKV A;  5CVV A;  5GP9 A;  4F91 B;  2ELK A;  3PIO F;  4OIP F;  4B09 A;  1Z6R A;  1FSE A;  5DEQ A;  1WJB A;  3EQL F;  3ECH A;  2IGO A;  2F4O B;  1IRG A;  3C2G A;  1I3Q J;  1FIP A;  3LMM A;  1O4X A;  1Y8Q B;  1EV7 A;  3RYR A;  4EMS A;  1PUF A;  1U5T C;  2ZFU A;  3HRT A;  2ZJ2 A;  4BHC A;  3JRA A;  2IJL A;  1TP4 A;  2ELJ A;  4IPA A;  5KHD A;  3KE2 A;  3WHC A;  2K9S A;  3C2B A;  4U87 A;  2E1M C;  4MEX F;  2R7U A;  2FF4 A;  2L4A A;  2MLK A;  1BOA A;  3J7Z I;  2NVQ J;  2DW4 A;  2BW3 A;  5HLH A;  2X6W A;  2EJR A;  1R1T A;  1SD5 A;  1LQ1 A;  1V3F A;  5HOD A;  3T0Y A;  1YJW I;  2BYV E;  4IEJ A;  4DZP A;  2E19 A;  2UXN A;  4E7L A;  1IGN A;  1ZH5 A;  3E7L A;  2FXA A;  2JQ7 A;  4F93 B;  1YS7 A;  1IN6 A;  3KLO A;  2L7M P;  1U78 A;  1LUJ B;  2FSW A;  1AKH A;  1PUF B;  3SZP A;  2OF7 A;  4BQN A;  4B47 A;  2FU4 A;  3ISP A;  2X51 A;  4LB6 B;  1T0F C;  3BJ6 A;  4RB0 A;  2M45 A;  4S04 A;  2BV6 A;  3OV8 A;  1SD4 A;  3DU5 A;  2GOX B;  2BW3 B;  2JA5 J;  4XLC A;  4HBL A;  1I1S A;  3GZ5 A;  1I50 J;  2KIQ A;  1P4A A;  2GZW A;  4A0Z A;  1LDK B;  2CQK A;  4M6V A;  4ZTJ A;  5CQG A;  1S5L C;  3UKG A;  2TCT A;  5LRR A;  4M72 A;  4KMF A;  4AIK A;  1ODD A;  2CFO A;  4BS9 A;  1U8B A;  4A2U A;  2IPQ X;  4IHX A;  2QUF A;  4NNJ A;  5L3C A;  1AKH B;  2HGC A;  3HGY A;  4J01 A;  3S16 J;  3ZR8 X;  3JRI A;  5CJ9 A;  3BQY A;  3LNQ A;  3CO7 C;  1K79 A;  3FBI B;  2EV5 A;  3PNV A;  5GAD J;  2JUC A;  1B4A A;  2EK5 A;  4GGG A;  5KVR A;  3R6S A;  2EFP A;  1FOW A;  4NBQ A;  4DNC A;  2JA2 A;  2P5V A;  2CGP A;  1JTX A;  3FKJ A;  2DYR H;  3DKX A;  1P6R A;  5H6Q A;  2EFW A;  4AU7 A;  4CO8 A;  1UEL B;  2VE8 A;  2ZFW A;  3FX3 A;  2KIF A;  1A6Q A;  1ETY A;  2XGC A;  3V42 A;  4GYG A;  2GXA A;  2MGQ A;  1T56 A;  1F1Z A;  3CJQ B;  4I98 B;  5KCM A;  4BQO A;  3BWG A;  3SEZ A;  1P4W A;  4HX4 A;  4KYW A;  2FRH A;  4FAS D;  4ITV A;  1ZQ3 P;  3M1C A;  5J1U A;  5E1W A;  4A6D A;  4L0Z B;  2LKS A;  3LA2 A;  1OLT A;  4N4N B;  3HKZ N;  1O7F A;  3F8B A;  2LFB A;  1R7J A;  2QQB A;  4UVA A;  2GQQ A;  4D5F A;  1BW6 A;  2OCE A;  2IGK A;  3L9F A;  3BG5 A;  3IH3 A;  4A69 C;  3CMM A;  3FXO A;  4M71 A;  1GT0 C;  4OIN F;  1HLV A;  4BY1 J;  2OA4 A;  1WJF A;  4L9J A;  4W97 A;  1SVO A;  3WU2 C;  2FA5 A;  4PGH A;  2V26 A;  2VE9 A;  2BY2 A;  4P96 A;  4V2G A;  2E2I J;  1G4D A;  5HLT A;  2Z33 A;  3R60 A;  4QPQ A;  2E36 A;  1TNS A;  1KQ8 A;  2VN2 A;  3F6V A;  4RGR A;  3ZQC A;  5LLQ A;  2ZBK A;  1JT0 A;  4U0W A;  2XRN A;  2IAI A;  2ME6 A;  3CO6 C;  3ZCO A;  4G94 A;  5J1Y A;  3BOQ A;  3R4K A;  2R7F A;  3CDH A;  1I1G A;  1Z67 A;  3WOD F;  3GUD A;  1I3A A;  1RET A;  5F1J A;  3F0C A;  1OMI A;  2GXG A;  1UFM A;  1LEA A;  1BI3 A;  4Y3O A;  3T1B A;  4A3E J;  2DN0 A;  3IWF A;  1OQY A;  5BQT A;  4CYC A;  4E7Z A;  2W00 A;  1F36 A;  1T6S A;  1R22 A;  1BJZ A;  1XGO A;  4GYI A;  2KRF A;  3I55 I;  4HNT A;  1ZAR A;  3HOT A;  3G73 A;  3CC4 I;  4IHS A;  4ZYG A;  1G3T A;  1DPR A;  2VON A;  4ZC3 A;  3JRB A;  2QEX I;  2NVY J;  2FOW A;  3KPH A;  2H8W A;  2QA4 I;  2GIV A;  4UXN A;  1IN7 A;  5M5X J;  1FP2 A;  1SAN A;  2DJI A;  2JTV A;  2K7L A;  5TJJ A;  2K27 A;  5HDG A;  3MZH A;  1R36 A;  2VBW A;  2X6Y A;  5E1Z B;  3FIS A;  4PSX A;  1XGS A;  1KZH A;  2EZH A;  4HPQ A;  4HDV A;  4FX4 A;  2TRT A;  4CDG A;  2RN7 A;  1YIO A;  2PFB A;  4CYC B;  4NC6 A;  4Y13 A;  1Y1W J;  3CC2 I;  2VJJ A;  1OCZ H;  2MBF A;  3HXL A;  5DCM A;  4HEA 2;  2A68 F;  4G7Z F;  1WPK A;  2MH2 A;  5M3M J;  1E3P A;  1XB4 A;  2L9N A;  4QPO A;  2DI3 A;  3FK6 A;  1F4K A;  1IXR C;  1E3O C;  1YJN I;  1TBX A;  5M5W J;  3DFG A;  4F55 A;  4V2F A;  2IS2 A;  5C4X J;  4A3L J;  2KKO A;  3H92 A;  3OYE A;  1STZ A;  1OCT C;  1R71 A;  1QZZ A;  3Q0U A;  2H1L A;  5L3B A;  3GTQ J;  3RKY A;  3GWZ A;  5HLI A;  5CVI A;  1G8X A;  2IS6 A;  1KYZ A;  1LNW A;  2M5W A;  3F9K A;  1YIJ I;  2KDO A;  1EF4 A;  5EF6 A;  2ZJP F;  1QO0 D;  1DGR M;  2B9S A;  2L4M A;  2XAH A;  4LLL A;  2XKO A;  3QPL A;  2W24 A;  5J6X A;  2KT0 A;  3H5A A;  3ZMZ A;  3VDX A;  3MVP A;  4LIV A;  4G6Q A;  4YFK F;  1S7E A;  4RMN A;  1OYI A;  2V1U A;  5GTI C;  4HNU A;  5L3G A;  2EV0 A;  2MD5 A;  2OU2 A;  5LFA A;  1KU7 A;  5JVT A;  1H88 C;  3AG2 H;  1WJA A;  3LFU A;  5F27 A;  2X6X A;  1OIS A;  2R93 J;  1GVD A;  4UB8 C;  3UNG C;  1IN8 A;  3L2W A;  3DBH B;  3NRV A;  2VKD A;  4HZF A;  2DK5 A;  2DPU A;  3GTM J;  2F5E A;  4IRG A;  3BTI A;  2COM A;  2RRE A;  5D5W B;  3DBR B;  1MNE A;  5JVG F;  2FBH A;  3L7W A;  3LAP A;  2DTZ A;  2E2J J;  1LFU P;  3F21 A;  2NVX J;  1OKR A;  2F4I A;  2MH9 A;  2EIJ H;  4Z2Y A;  2WWY A;  5H6R A;  3ZN0 A;  3S2H J;  1AOY A;  3Q0V A;  3EDP A;  3T8T A;  4E6K G;  3J80 Z;  4KUM A;  1QHG A;  1G59 A;  1UAA A;  1V5G A;  4MFE A;  2ZXH A;  2K86 A;  3LA7 A;  4JX6 A;  4CZC A;  1ETV A;  2LNB A;  2M34 A;  3DCF A;  3E5U A;  2W25 A;  4O6J A;  5DS9 A;  3MZ8 A;  2MFZ A;  3DBL B;  1SFK A;  5LHG A;  2K02 A;  2HXO A;  2G0E A;  3OYG A;  5FLM J;  3VEP A;  2PI0 A;  3WE3 A;  4XN0 A;  2DJN A;  1D5Y A;  2E7X A;  2OTL I;  2NYX A;  2X1C A;  3LSH A;  2AQE A;  2A6H F;  3REO A;  4BU2 A;  4JOM A;  1GLN A;  2KFD A;  2EB7 A;  4NUB A;  3OYK A;  5D4R A;  2HQN A;  4WF2 A;  3MKW B;  3PO2 J;  2L5Q A;  4BXU A;  1RKT A;  2DO7 A;  2HYF A;  3M1E A;  2XGE A;  2G7U A;  1B9N A;  2FQ4 A;  2V9P A;  3RKX A;  2ZJQ F;  2RGV A;  3HPH A;  2O9L A;  4HF0 A;  2QCO A;  3ZQH A;  1H89 C;  3TOB A;  4A3K J;  1H9T A;  5J40 A;  2BHY A;  5EEA A;  2I10 A;  1IN5 A;  1ZAO A;  3DKW A;  2HOE A;  1ZEL A;  2DA5 A;  1MIJ A;  1D0Y A;  3CUQ A;  4BXX J;  5FGM A;  1TWA J;  3F8M A;  1N25 A;  5FJ8 J;  2HDD A;  1L0O C;  2ZO4 A;  5D5X B;  5JHF A;  4XSZ F;  1MBE A;  1PJR A;  2V9V A;  2YUS A;  2XF5 A;  3ZQ7 A;  2H27 A;  2YU9 J;  1IJW C;  2VOD A;  5GTH C;  3BLY A;  1ZHF A;  5ED4 A;  1IZ1 A;  2VI6 A;  5DV5 A;  4LIT A;  1GXP A;  5F08 A;  3I71 A;  2R92 J;  4RAY A;  1U9N A;  2Z5U A;  4HNV A;  3WU1 B;  3IKT A;  4JQF A;  1LEB A;  4AC0 A;  1R23 A;  1G3S A;  2ZNY A;  3FXQ A;  3OYF A;  1BIA A;  2AHQ A;  1BR4 A;  4JYK A;  4HF2 A;  2G9W A;  2ZME C;  3MEX A;  4I02 A;  4YFN F;  1OR7 C;  2L9R A;  4UUV A;  2X9D A;  4XLE A;  1U2W A;  1WGX A;  3CUQ B;  1K4S A;  1O3R A;  3LSI A;  2DMN A;  3KYL A;  2VC1 A;  4M6X A;  1JJ6 C;  2E1N A;  2Z99 A;  5A2Q Z;  3L2R A;  2BY1 A;  4I99 C;  1YX5 A;  3G1O A;  1G3W A;  5JHU A;  4A3I J;  3MCZ A;  3VPR A;  5LEK A;  1D5V A;  2HPM A;  2XPV A;  1FY7 A;  3RYP A;  4RGS A;  2HNH A;  5AIQ A;  3SQN A;  1GHC A;  1E2X A;  1UG2 A;  4PUS A;  1QBJ A;  3ROU A;  3TP0 A;  3K4C A;  2FMY A;  4B8X A;  2VUM J;  3GTK J;  1WKM A;  3NQO A;  1AA7 A;  1ENH A;  1PUE E;  1GV2 A;  3AG4 H;  2DBB A;  4WWC A;  3F8F A;  3T8R A;  2WY7 Q;  4JBA A;  2ADU A;  4ENJ A;  3BZ6 A;  4FT8 A;  2L01 A;  4N9I A;  4ZYD A;  3BR3 A;  2MG4 A;  1Z0X A;  2HPI A;  4HV6 A;  2ID3 A;  2RKH A;  3ERM A;  3K6G A;  1WH7 A;  4C3J J;  1U5T A;  2JJ7 A;  2VXD A;  2HYJ A;  2YPR A;  1D1A A;  4ABZ A;  3N05 A;  2A6T A;  3QP6 A;  1WZ2 A;  1FMV A;  2D5V A;  1HDP A;  1V4R A;  2EIN H;  3L00 A;  4XQF A;  3FM5 A;  2W1O A;  2NAZ A;  1IW7 F;  3A0B C;  1J59 A;  1BI1 A;  4C3H J;  2WB1 A;  3I4M J;  5E3N A;  2XC7 A;  4A3M J;  2NXN B;  3S8P A;  1EKE A;  2DFI A;  3G1M A;  1GVJ A;  4ENM A;  2K9M A;  1MSE C;  4CCO A;  1YTY A;  3LL7 A;  1JGS A;  1S6L A;  2V1N A;  1AWC A;  5E20 A;  2R4G A;  5BNG A;  1O7L A;  3KP3 A;  1BBY A;  2OQG A;  3ASN H;  1POG A;  2VOO A;  1ORK A;  2D1V A;  4IRI A;  1SFE A;  1U5T B;  2LY1 A;  3CZ6 A;  3HHH A;  4NHJ A;  1X1D A;  1WH5 A;  4D5C A;  2XGD A;  4A12 A;  1VFC A;  1T0F A;  1FX7 A;  3CCU I;  2YR2 A;  3GYH X;  5D5U B;  2RDP A;  1FSH A;  2W85 A;  2FD5 A;  2IP2 A;  3ELK A;  1BJA A;  1WWX A;  3H5N A;  2R5Z A;  4GFB A;  1HQC A;  3BT9 A;  2Z16 A;  1X1P A;  4XK4 A;  1RUN A;  4DQ2 A;  3QPT A;  3BG9 A;  5DD4 A;  5F64 A;  5HS9 A;  5C3E J;  1LKX A;  5HOO A;  4II2 A;  3MKL A;  4BH9 A;  4FIS A;  1ZG5 A;  3WG7 H;  1ZR2 A;  5IOZ A;  4ZYE A;  1FWZ A;  1X3W B;  1MBF A;  2I5U A;  3BG7 A;  5LHH A;  2L54 A;  3KYC B;  2Q8K A;  3L2Q A;  1HF0 A;  5LRS A;  2R7T A;  1IRF A;  2CU7 A;  1OYY A;  4MQV A;  2M2E A;  1ON1 A;  1ZG3 A;  2AXT C;  1ZTR A;  4CCL A;  2JSP A;  2A6E F;  1VQ8 I;  3ZMU A;  2Y9Z A;  1OFC X;  3X2Q H;  5ICC A;  1FP1 D;  2R5Z B;  2K85 A;  3GTP J;  3HOY J;  1YI2 I;  3JSP A;  1ITY A;  1HA8 A;  3I64 A;  3WTV C;  4CCN A;  2R0Q C;  1F5T A;  4P9F A;  3K7A J;  4UHT A;  1K83 J;  2KPM A;  2CV2 A;  4YFX F;  4MQ9 F;  3W6V A;  3CMY A;  4BJ5 C;  4OIQ F;  3GEZ A;  2M30 A;  2DFE A;  3D5R C;  2VIX A;  2Y9Y A;  3K0L A;  4XN3 A;  2OAZ A;  1MMD A;  5H20 A;  2VBX A;  3OOP A;  2LD5 A;  1IV6 A;  2O3F A;  2ELH A;  4U7B A;  3J81 Z;  3KZI C;  4KT6 A;  3ZMS A;  2Q1Z B;  2Y0M A;  4JX4 A;  1YFH A;  1BN5 A;  4MHG A;  2F5V A;  4BHP A;  1VQO I;  2Q0O A;  1I6H J;  3HYI A;  4F92 B;  4KIG A;  2CV0 A;  2VQH A;  3I56 I;  2J5O A;  1Z1D A;  1MH4 A;  4XOT A;  2PJP A;  2EZK A;  1T08 B;  3LAJ A;  3E1S A;  3NAU A;  4M9Z A;  2BVM A;  4LK1 F;  5K7H A;  2BOL A;  5TRD A;  1DQU A;  3VSK A;  1JTY A;  3C18 A;  4RA2 A;  1REP C;  3AL0 C;  2A5Y B;  1RR8 C;  4LLG F;  4IF4 A;  3SEQ A;  2Z2S B;  1Q1V A;  1FYM A;  1O3S A;  2DA4 A;  3EUH C;  4DOZ A;  1T98 A;  1KQ0 A;  1X3U A;  3G6E I;  1FC3 A;  1NK2 P;  1HDD C;  1W0U A;  1S8N A;  2HZD A;  3PM1 A;  4UY8 I;  2M7B A;  2DT7 B;  2WA0 A;  1XSV A;  4CA0 A;  1TTY A;  3CES A;  3EET A;  3JCU C;  2UZK A;  1MBG A;  1XCB A;  2J5P A;  3RKW A;  4J00 A;  5TIS C;  4TV7 A;  5A2Q K;  1TQM A;  1NK3 P;  4GRI A;  4WXH A;  2NVU B;  1D3Y A;  4ZJZ A;  2XPU A;  2X48 A;  3PUF A;  2IA0 A;  2O61 A;  1T33 A;  3SZT A;  1E3H A;  5D8L B;  1I27 A;  3LQQ A;  4CUG A;  4CHU A;  4HQM A;  1RR7 A;  2IA1 A;  2P5K A;  3ECO A;  3HRS A;  1BL0 A;  3P7N A;  3RJP A;  2L9S A;  3RPU A;  1YW7 A;  2JRT A;  1ZR4 A;  3HDD A;  2BE5 F;  2QYO A;  2DDB A;  3H36 A;  2IRF G;  3LWF A;  1W36 D;  4ON0 A;  1IC8 A;  4EM0 B;  3OS2 A;  1J7K A;  3P9C A;  2DCE A;  2V79 A;  4MIM A;  4YRV A;  3TMO A;  1FTZ A;  1J9I A;  1WI3 A;  3S3O A;  3DF8 A;  2ZSI B;  3RPQ A;  4UVB A;  4D1Q A;  2EQR A;  5FFZ A;  3QU3 A;  4G7H F;  1X1B A;  3HBL A;  4EV0 A;  1JGG A;  1DU0 A;  2XIG A;  2ZSH B;  5M3F J;  4YIF A;  2F5F A;  3K10 A;  1O3T A;  1HKT A;  3VYS B;  2ZXW H;  4RDU A;  2VPL A;  3LSP A;  1M1E B;  5AON A;  2X0L A;  3V8J A;  4CZZ A;  3DU6 A;  4ESB A;  1OJL A;  2Y48 A;  2HS5 A;  2BXY A;  3BZC A;  2QSH X;  1K4T A;  4ZZD A;  5BMZ A;  3S1R J;  2RQP A;  4MTE A;  4FE7 A;  3GFI A;  2DAO A;  4UNO A;  3J7A O;  1U0J A;  3BP8 A;  3IAS 2;  4C3I J;  4H0E A;  1G2H A;  3G3Z A;  4OU0 A;  2EBI A;  1UJ8 A;  2P4W A;  4YG2 F;  4UUT A;  1BW5 A;  1MSF C;  4B4C A;  5CPR B;  1L3L A;  2TDX A;  3ULQ B;  2STW A;  1BM9 A;  4B48 A;  1IV8 A;  3LQR A;  2VKE A;  4ESJ A;  1W36 C;  1IF1 A;  1ZYR F;  2VQG A;  1I5Z A;  2M1B A;  3LOC A;  3TDZ C;  1K6Y A;  5FKN A;  5K5R A;  2KJC A;  1TZL A;  2M9H A;  2XSD C;  1XCV A;  5DTD A;  4A3B J;  4J19 A;  3N97 A;  4WXD A;  1X1A A;  3H0G J;  2WB1 N;  1OCP A;  3L09 A;  2PBI A;  3MAJ A;  1J5Y A;  2Z9O A;  4ZDP A;  2X85 A;  2ZCW A;  3JRC A;  5HVQ C;  3SXY A;  3OS1 A;  2AS5 F;  1FBQ A;  3AAF A;  3PL8 A;  3QOD A;  1IO2 A;  3M7G A;  4YEL A;  1TWF J;  1UZC A;  2V1X A;  2DU9 A;  1QNT A;  2BHZ A;  2X6O A;  2HVR A;  3JRD A;  3CUO A;  1I6X A;  4KMU X;  2MYS A;  1B8I A;  3GZ6 A;  1U6G A;  3A2K A;  2BBY A;  3JW4 A;  4XOP A;  3A1Y A;  1HKQ A;  3F3X A;  2EFQ A;  4LOC A;  3CF5 F;  2P7C B;  2MD0 A;  5GAH J;  4BUP A;  3PNT A;  5E3O A;  3OYM A;  2GA1 A;  1TW2 A;  4LD5 A;  4BEH A;  4PJL A;  3KIO A;  4KDP A;  1VQ5 I;  1FBU A;  2DMU A;  2GBY A;  2HOA A;  1ACI A;  1ZGA A;  2K5C A;  4DIQ A;  2LR8 A;  4E7I A;  4EJT A;  3TDU C;  2RNG A;  4RLQ A;  4I2O A;  4M6Y A;  1GUU A;  5AIP A;  2HZT A;  3J81 K;  1VTN C;  4P5O A;  5D6F A;  1MJ9 A;  3I4P A;  4NQW A;  3GTJ J;  3AKZ A;  3OSF A;  4I0B A;  3DTK A;  1LB2 A;  5D4S A;  1P2F A;  5IY5 H;  1R49 A;  3CP8 A;  3A4C A;  1B8I B;  2HQ5 A;  3RZD J;  3L2C A;  3K9T A;  2DT5 A;  5F1R A;  2E34 A;  2IXS A;  2WAF A;  3VYR B;  1KU3 A;  2MC4 A;  4F3Q A;  1F43 A;  1T39 A;  4XKB A;  2DDA A;  1JUM A;  3TW6 A;  3PSI A;  3K2A A;  4CXF A;  3RIR A;  3M07 A;  3I4N J;  2EPF A;  4BEH B;  4BQQ A;  3ZQF A;  1V54 H;  3DLA A;  2E5N A;  2HR3 A;  2JRM A;  3PQJ A;  2R7R A;  4BAC A;  4R1H A;  3S3M A;  3H3U A;  1BC7 C;  3E3V A;  4PDK A;  2VQL A;  3A02 A;  4R8H A;  2EIL H;  2VC0 A;  5CVR A;  1LFP A;  4E7J A;  2CSO A;  3EPZ A;  4I0A A;  5GPA A;  3CJN A;  2EWN A;  2HQA A;  3TO6 A;  1P7I A;  4XLH A;  3K70 D;  2VJ5 A;  4RB1 A;  1HW2 A;  1YE9 A;  1UCR A;  5D6E A;  1OR7 A;  3QYF A;  2W84 A;  3KP4 A;  4II3 A;  4RAF A;  4U88 A;  5LEJ A;  3LSR A;  4IO9 F;  2FE3 A;  2JVH A;  3TO9 A;  2JA8 J;  3JRG A;  5E17 F;  5IT9 Z;  3DV8 A;  2ZNZ A;  4WCG A;  3H5R A;  4N0B A;  3S15 J;  2VJI A;  1QPM A;  2IW5 A;  3EYY A;  3JAM Z;  4MGR A;  2UWM A;  1MJA A;  1MND A;  3ONQ A;  5KAF C;  3GTG J;  4UUS A;  2IT0 A;  1R9T J;  2WAQ N;  1AU7 A;  3I58 A;  5J8C A;  2XRL A;  2PN6 A;  3T5X A;  3KET A;  3ZMD A;  4ZZL A;  2PLY A;  2NS8 A;  1IAW A;  2OJE D;  5IPA A;  5F0C A;  3LSK A;  3GTL J;  2E71 A;  3I3L A;  5JLW A;  2CS3 A;  2ESH A;  4HYE A;  3SDG A;  3GTO J;  3CDL A;  2LY9 A;  3FIW A;  2QQ9 A;  2K9Q A;  4IQ4 A;  1ZKG A;  1I39 A;  4LG3 A;  1Z21 A;  3LST A;  3IUO A;  5F0H A;  1TWC J;  3BPX A;  1O3Q A;  4AIH A;  4EM1 A;  3PSF A;  4UUS B;  3ABU A;  1FYL A;  2YS9 A;  2UV1 A;  3VSL A;  2YX7 A;  1SVM A;  1PDN C;  3BR0 A;  1LPQ A;  3W2V A;  3HJE A;  3MN2 A;  4XON A;  1T38 A;  4XKW A;  5DCM B;  4L9N A;  4IHY A;  3K70 C;  1MBJ A;  1Y56 A;  5CVU A;  5EEH A;  5LHI A;  2HEO A;  4DJA A;  1JXS A;  4LG0 A;  2KRC A;  3P5J A;  3HOZ J;  2Y69 H;  1IDY A;  4KT5 C;  3V4G A;  3GCM A;  1ETO A;  3TW7 A;  2CO5 A;  2NOJ B;  3ABL H;  3RQ4 A;  5LGT A;  1Y1V J;  3WE2 A;  3OIP A;  2LH9 A;  5JFR A;  4BE1 A;  1H8A C;  2L0K A;  3CTA A;  3W3C A;  2DPD A;  3GBG A;  3F22 A;  3N4M A;  5ILV A;  1VF9 A;  4BYY A;  3WGI A;  5IP9 J;  3PUB A;  2RC4 A;  2KQR A;  4OOI A;  4Q4Z F;  1ETQ A;  4Y15 A;  4HG2 A;  1G6N A;  1A5J A;  3IKV A;  5K5Q A;  4FHT A;  3GX4 X;  4KN7 X;  3K4J A;  3FKI J;  1YS6 A;  3VYT B;  1BI2 A;  1H9G A;  4EEF G;  4L5J A;  2OUM A;  2RQQ A;  2DA2 A;  1V5E A;  2GAU A;  2EH3 A;  2R3S A;  1ONV A;  2E7W A;  3CLO A;  5JLX A;  4LG0 B;  1HKS A;  1R58 A;  1QU3 A;  3DWL E;  2YSR A;  4LFU A;  3U1D A;  4KN4 X;  4JK1 X;  3KP2 A;  5FLV A;  4RM2 A;  4PJM A;  1ERD A;  2G7H A;  4IHT A;  1YJ9 I;  2BXZ A;  1N78 A;  2ZJR F;  1WRJ A;  3MMY B;  2K9L A;  1J09 A;  1EH7 A;  4BDY A;  4RB2 C;  4B43 A;  2DOF A;  5IYB J;  1MBK A;  3COA C;  3OYN A;  1V55 H;  2ZXJ A;  3BJO A;  4BY7 J;  2BZT A;  2MC3 A;  4I01 A;  5HS8 A;  2CMP A;  4AVP A;  4EJO A;  1J75 A;  5BS6 A;  1IG7 A;  1SFX A;  3PFY A;  5DCF A;  1YO5 C;  3IHU A;  3PNY A;  3S2D J;  3QPH A;  1X2N A;  1K7A A;  5ICF A;  4XR6 A;  4XSX F;  1K78 A;  1MMS A;  1CQT A;  2JVG A;  4XLA A;  1X58 A;  2XAJ A;  3NEU A;  1QQI A;  2LRE A;  2NS7 A;  5IYD J;  1ZGJ A;  5FKL A;  4QWQ A;  1HBX G;  5J4V A;  3CCS I;  1FOK A;  2JT1 A;  3KP6 A;  2XGX A;  5HDK A;  5E8G A;  2A61 A;  1TT5 B;  1EA3 A;  2LF8 A;  4PK4 A;  2VJ4 A;  1MJB A;  1VQK I;  2C6Y A;  1JJ8 C;  4I6Z A;  1IRX A;  4OWR B;  3VOE A;  3E5Q A;  3HGG A;  3MWM A;  5FB2 A;  2JPB A;  1QA6 A;  3WG9 A;  3HUG A;  1JHH A;  3LA3 A;  2LKP A;  2KHM A;  3AG1 H;  4MTD A;  2BEO A;  5KK1 A;  1QVU A;  4PCQ A;  2KLO A;  2ZXI A;  1B6A A;  3CP2 A;  5BOX A;  2X4H A;  3DTI A;  4PFO A;  1Z6T A;  3DTE A;  2GM4 A;  4O5V A;  2HU9 A;  2DT6 A;  3VFZ A;  3G71 I;  4AWX B;  1K78 B;  1HXD A;  4X0G A;  4XMY A;  2IS4 A;  3RZO J;  4HOB A;  2ISY A;  4GXO A;  2LYC A;  1W7P A;  4B3X A;  5F6F A;  1X3Z B;  2CFX A;  1SD6 A;  2QQA A;  1RRJ A;  3I53 A;  1X1C A;  1VQL I;  2KL4 A;  3E5X A;  2HOS A;  4XLN F;  3GFM A;  2JWT A;  1Z05 A;  2HDC A;  3HM5 A;  3EUH A;  2XF7 A;  1KA8 A;  3G1L A;  3ZGK A;  3KFW X;  3OY9 A;  1B1B A;  1LVA A;  2R7D A;  4N9H A;  1N77 A;  1DP7 P;  2AXL A;  2CUE A;  1XMK A;  1P4X A;  4WX9 A;  2YX4 A;  2ISZ A;  3H9J A;  2FNP A;  5IT9 K;  4A3C J;  3JAM K;  1G3Y A;  5J8F A;  4YII A;  1VQ4 I;  4PJJ A;  5FRN A;  3O3K A;  3OYA A;  2DMT A;  2DLL A;  2LP0 A;  5FKK A;  3FMQ A;  4NC7 A;  5J1R A;  4EJV A;  1A31 A;  1XX5 A;  1UHM A;  1D0Z A;  1W7P B;  4EJU A;  4A3D J;  2O7O A;  3FF5 A;  3TGN A;  3F8C A;  4U0V A;  2F5D A;  3S17 J;  5JR3 A;  5C44 J;  3B02 A;  1R5I D;  1QGP A;  3IH4 A;  4DW6 A;  1BR1 A;  1FZP B;  2BY0 A;  3K4B A;  2DFH A;  4UV8 A;  2A69 F;  4HST A;  2NS0 A;  3FWE A;  1R6R A;  3OYB A;  4M3B A;  2IGM A;  1WJE A;  5K7F A;  1JT6 A;  3CCV I;  5FD5 A;  1XGN A;  2O5R A;  2GA2 A;  4LJZ F;  4A6E A;  5KNL A;  3UR3 C;  3H0D A;  4HF1 A;  2XAU A;  2HOT A;  2L02 A;  5E3M A;  4CCJ A;  1WVR A;  2OQR A;  2R5Y A;  4DBQ A;  3K4M A;  3HB9 A;  1KGS A;  4E70 A;  3QP5 A;  3S1Q J;  4KJZ A;  5KAI C;  3WGG A;  2ZB9 A;  1A6I A;  5HLG A;  3WGH A;  3O6B B;  1X19 A;  2QEN A;  3CC7 I;  4Q48 A;  2ME0 A;  3HTU A;  4UV9 A;  2MW8 A;  4M9X A;  2DYS H;  4Y33 A;  4RAG A;  4AYB N;  2E1M B;  1P9Q C;  3CCE I;  3RQI A;  3IV5 A;  2VBZ A;  4ZYH A;  5TGT A;  4IOC F;  2N8G A;  2K3F A;  2HVQ A;  3JTH A;  2VT2 A;  3OYI A;  4MFD A;  3ZXS A;  2QZ8 A;  3W2A A;  2R7V A;  2OTJ I;  5EZG A;  2R5Y B;  2F6C A;  2P81 A;  4BXF A;  3B6C A;  3OMY A;  3ZN1 A;  2OZ6 A;  1SD7 A;  3ZMV A;  2FX0 A;  1NHA A;  1WI9 A;  2AQF A;  4KIB A;  3DEU A;  3RKQ A;  1MW7 A;  4A0Y A;  4F7Z A;  5EGO A;  4LGW A;  2K3P A;  2LBF A;  2ETH A;  3M9A A;  2QLZ A;  2M7A A;  4QTR A;  2XKP A;  1OCC H;  2B0L A;  2OD5 A;  4CGZ A;  4E4H A;  1VQP I;  3OS0 A;  5E18 F;  1XDS A;  1ZN2 A;  3QYE A;  3L2U A;  4KIF A;  2MSY A;  2KZV A;  4HDU A;  3JR9 A;  4CCK A;  3U9G A;  4EGZ A;  1QHH D;  2XDV A;  4S0H B;  1Y6I A;  3K4K A;  2DOE A;  1S3J A;  4HLX A;  2HKX A;  3ZQI A;  5BPD A;  2GXB A;  4HW0 A;  4FX0 A;  3DPT A;  1EH6 A;  1ZK8 A;  2CUF A;  1U9O A;  3HOV J;  4BE2 A;  4RLF A;  4FCY A;  1YIT I;  4BQA A;  4W1U A;  1UHW A;  5EGO B;  4NC8 A;  2LBF B;  3CCY A;  4M3G A;  2E2H J;  1BOB A;  2FBK A;  1TQP A;  2F4M B;  4OMZ A;  1F9N A;  2IS1 A;  1D0X A;  2RVC A;  3M8F A;  3H3Z A;  3V8L A;  3CUQ C;  1NTC A;  3KYD B;  3FZV A;  2L7F P;  3FXR A;  4IJA A;  2WAQ A;  3ZRG A;  2P7V B;  2VKH A;  3ZMT A;  1DGW Y;  2CW0 F;  2OPT A;  4G12 A;  4LK0 F;  3RTR A;  4BDZ A;  2JA7 J;  2DK8 A;  4A5N A;  1TW3 A;  2M0M A;  4F52 A;  1ON2 A;  4B44 A;  3BG3 A;  3ZOB A;  1ZRD A;  3BG6 A;  2MLG A;  2A5W A;  2GIZ A;  3HTS B;  3OYC A;  2STT A;  3ESW B;  3BC8 A;  3CCQ I;  1UST A;  1RES A;  2ID6 A;  4CIC A;  3MKZ A;  2XVC A;  3IRQ A;  4L5E A;  3FXL A;  3R0A A;  4IXA A;  2YU3 A;  1WJ5 A;  3OYH A;  4P1W A;  4GO1 A;  5C4J J;  3TP3 A;  1RZ4 A;  3V7C A;  2D1H A;  3W6K B;  3S1M J;  2VQC A;  3S32 A;  3HIF A;  3HOX J;  3KZY A;  1Z9C A;  2E60 A;  3A0H C;  3ZQG A;  4A3F J;  3K69 A;  5J47 A;  2VPR A;  5F04 A;  1KQ9 A;  3IL2 A;  3CF2 A;  3M8J A;  4EVI A;  1PYV A;  3D5L A;  3H35 A;  3DP7 A;  1YW9 A;  3EUA A;  2VB6 A;  4E7K A;  1XG1 A;  3OWT A;  4R79 A;  4C2U A;  1MMG A;  2W4S A;  3S14 J;  2EFN A;  3JRE A;  2DOD A;  2XB5 A;  1USS A;  1XD7 A;  2IGN A;  2LLK A;  3BRO A;  3E6C C;  3HZJ A;  2O8K A;  1RKW A;  1ULY A;  2KIS A;  4MO7 A;  5BPI A;  2FNA A;  5FRM A;  1MH3 A;  3AFH A;  3IP4 B;  4QSH A;  4M74 A;  3I59 A;  4AIJ A;  3TED A;  1U8R A;  3H9Q A;  3S3N A;  1S7O A;  2DA7 A;  3I9V 2;  4HX7 A;  3EYI A;  3HPG A;  4PJN A;  5GAE J;  2PMH A;  1XMA A;  2R7Q A;  4AID A;  1HOM A;  3W2W A;  5ICE A;  3A01 A;  4ZTF A;  2GLO A;  1IXC A;  1YLF A;  2UXX A;  2H6B A;  1R1U A;  4XLF A;  5K7Z A;  3IWZ A;  4EAT A;  2CJJ A;  2DXI A;  1Z3Y A;  1GXQ A;  2DA6 A;  4OIR F;  4EQQ A;  4P9U A;  1A35 A;  2A3S A;  4I76 A;  2KIM A;  3SHF A;  3WTX C;  2V9K A;  2O6G E;  1UHS A;  3CD6 I;  2DMP A;  1SC7 A;  2HFH A;  2CW8 A;  2LRD A;  3I59 B;  1YQA A;  2PEX A;  3OL3 A;  1RIO H;  4BNC A;  5E79 C;  1JKP C;  1YHQ I;  2KDZ A;  5DYM A;  2QSG X;  1IRZ A;  1E17 A;  2IEK A;  2JN6 A;  4Y7N J;  2UUZ A;  3GF2 A;  1R4N B;  2PMZ A;  2QKL B;  4IZZ A;  1BA5 A;  3GLL A;  3A01 B;  1BIB A;  2KJB A;  2LOO A;  5FD6 A;  1JHF A;  4LB5 A;  1FNN A;  1SEU A;  1UB9 A;  5EZH A;  3WHB A;  2VAS A;  3AG3 H;  3PFI A;  1ZGW A;  4OMY A;  1JUS A;  4FET A;  2KMU A;  2ZKZ A;  3BR2 A;  3GW2 A;  1VQM I;  3BQZ A;  4XL9 A;  5LD2 C;  2L3D A;  3CCL I;  1R5G A;  2WC2 A;  3FBN B;  2WBM A;  2O03 A;  1WHU A;  1YYV A;  2CQ7 A;  4D0P A;  4OAZ A;  4D9J A;  4ZYA A;  3QPS A;  3SDB A;  5DDG A;  3K2Z A;  3Q3S A;  3GFJ A;  3E6D A;  1K61 A;  2HXI A;  4XRS A;  2V6C A;  3BTJ A;  5GAG J;  5B1A H;  3JTG A;  4IHV A;  3WU0 A;  1HW1 A;  3LSM A;  2ECB A;  1MD0 A;  1SAU A;  2QKM B;  5L3F A;  2V6E A;  4IOA F;  3OR1 C;  4ANJ A;  1HCR A;  2QF7 A;  1NG6 A;  4XNF A;  2NOG A;  1IXS B;  1JKQ C;  2O8X A;  3S2W A;  1GV5 A;  2M8G X;  4C2T A;  4IVN A;  4XID A;  1QRY A;  1Y39 A;  1R5H A;  1Y0N A;  5K5O A;  3WTY C;  2JZY A;  2CYY A;  1HSJ A;  2PX9 A;  4AVZ A;  1ZLK A;  1APL C;  3A03 A;  3CJR B;  1SFO J;  4M3F A;  5M5Y J;  2VL8 A;  4BHB A;  1FOX A;  4M9S A;  1RC9 A;  1SFU A;  2LG4 A;  3G4S I;  1LDD A;  3P9I A;  3Q9S A;  3V7S A;  2Y30 A;  2WY8 Q;  3SFI A;  2FOK A;  4GDF A;  4ASN A;  2E1O A;  2LC2 A;  3TO7 A;  1Y8R B;  3HRM A;  1DUX C;  4HLY A;  3U2R A;  2H8R A;  4L0Y B;  2V7F A;  3TOA A;  1PVE A;  1TNT A;  1FJL A;  4XRM A;  3RPU D;  1QPI A;  3M8E A;  4DYQ A;  4HV5 A;  3OR2 C;  1ZLJ A;  4BJT A;  5B66 C;  1Z91 A;  5H2F C;  1PP8 F;  1SMT A;  1VZ0 A;  4D7M A;  2FJ1 A;  4N4O B;  1QZE A;  3HC7 A;  2HTS A;  4DYC A;  1LVK A;  1YW8 A;  1VQN I;  3V8K A;  2ESN A;  1FLI A;  2JMW A;  2NRA C;  4LMY A;  4IKF A;  4HSR A;  2M8E A;  1UMQ A;  5DM6 F;  3KEQ A;  4G9Y A;  3U21 A;  3GME A;  1JKO C;  2OBP A;  3I0T A;  5FKO A;  1XSD A;  1D8J A;  4EJW A;  4RBO A;  2XAF A;  4NQW B;  2ZC2 A;  1LFB A;  5EDN A;  1VND A;  1CF7 A;  1YX3 A;  2P8T A;  4CSW A;  4RB3 C;  4IX7 A;  3IC7 A;  4PGG A;  2ZME A;  3M4O J;  2Y0S A;  4ESF A;  1WQ2 A;  2Z1D A;  3DPU A;  4C2M J;  1W0T A;  5HS7 A;  5FLX Z;  3FK7 A;  2WAD A;  5DUK A;  2DFF A;  2O0Y A;  2PQ8 A;  4LLN A;  3QYB A;  1NH3 A;  1R1V A;  2NNN A;  4A3J J;  2Z3Y A;  3SYT A;  4RGX A;  1JUP A;  4AYB A;  4BKX A;  2GOM A;  4JX5 A;  1B72 A;  1Z7U A;  3OIQ A;  2PJR A;  4BBS J;  1PP7 U;  3HHG A;  2ECC A;  2VOP A;  3FM3 A;  3TQN A;  3CDI A;  3O2P E;  4KNY A;  4JP0 A;  3D1N I;  3TBI A;  1GDT A;  2DA1 A;  3HOS A;  3NWS A;  1DDN A;  2E5Z A;  1HW5 A;  1ZRF A;  3MFK A;  1FT9 A;  1CF7 B;  1RPW A;  1OYW A;  1S9H A;  2OCC H;  1S29 A;  2L7Z A;  2Y75 A;  2H1K A;  3OYJ A;  3WTW C;  3I5U A;  2ACJ A;  2ZME B;  1XSX A;  2HQR A;  1BI0 A;  4ETS A;  4A93 J;  2D45 A;  2EFO A;  3D0S A;  3HSE A;  3DLL F;  1TL8 A;  4IQJ A;  3F72 A;  2Y31 A;  3ZP5 A;  1KON A;  1MNM C;  2DQR A;  4UVC A;  4E7S A;  2PMU A;  3DEE A;  2K4J A;  5IT3 A;  4V19 K;  2RV8 A;  1MBH A;  4FTH A;  3CMA I;  3K4L A;  3QAH A;  1MKM A;  1T2K A;  1B72 B;  4KIS A;  2M4G A;  2PJR B;  2EZL A;  2H94 A;  3CCR I;  3NAR A;  4B1R A;  4MNU A;  3B73 A;  3BCA A;  4NB5 A;  3MKY B;  1S7A A;  3K1M A;  2P6S A;  1TQI A;  2L2O A;  2F48 A;  2R7O A;  1ETW A;  1ETX A;  2BGC A;  3S1N J;  3ML6 A;  3K4N A;  1LJ9 A;  3C3W A;  5ERI A;  1JI8 A;  3CCM I;  5HNH A;  1OCR H;  4DZJ A;  4AD9 A;  3GO5 A;  1TWG J;  2K4B A;  3F23 A;  4IHW A;  5D5V B;  3GLX A;  2RAE A;  2JA6 J;  2H09 A;  1JE8 A;  1MMA A;  1ZRE A;  2LK2 A;  3OIO A;  2R7X A;  5DUI A;  1B59 A;  4XIC A;  5LBQ A;  2LVS A;  2CWE A;  3EUK L;  2V1D A;  1XPX A;  3FXK A;  4M3E A;  3HSF A;  2HWV A;  5EG0 A;  1MMN A;  5LGU A;  3DPL C;  2VT3 A;  5IYC J;  4M73 A;  3VOD A;  4PZJ A;  3OL4 A;  4HRI A;  2FUG 2;  3D5S C;  4OIO F;  4G7O F;  1IDZ A;  1MZB A;  3PJR A;  4RM3 A;  3H9G A;  2LY2 A;  4E7H A;  3DXJ F;  3RSN A;  2R7S A;  4PFP A;  2CQQ A;  2LF7 A;  2FBI A;  3L2V A;  5B3S H;  3CJT B;  2IVM A;  2M4K A;  1HST A;  3HRU A;  3R61 A;  2CUJ A;  2JK3 A;  2Q2E A;  3QU6 A;  2QM3 A;  3MZY A;  4BL0 B;  3BZK A;  1XGM A;  4A3G J;  1WFX A;  2XV4 S;  3BR6 A;  1X4O A;  1V5F A;  2A05 A;  2XUB A;  4L9V A;  5EG0 B;  2K9N A;  5CVJ A;  2ICW G;  4XRS G;  3FXJ A;  3KZZ A;  2CV1 A;  2PMZ N;  1Q1H A;  4X6A J;  5CQE A;  1IN4 A;  1QVT A;  3IAM 2;  3K1N A;  3PO3 J;  3ABT A;  4EM2 A;  1WSU A;  3J7A Y;  3QRF F;  2RNJ A;  2QQ8 A;  3CLQ A;  5B5E C;  3KEY A;  3BR1 A;  4FQG A;  2M0C A;  5J4Y A;  2WV0 A;  1OCO H;  3CQZ J;  5E8I A;  1XDU A;  3WTZ A;  4L18 B;  4O3M A;  5FRO A;  2KIU A;  3DKY A;  3QWL A;  2A07 F;  2NVT J;  1DPU A;  2AO9 A;  3GVA A;  2LSO A;  1LDJ A;  1W1W E;  1W5S A;  2Q2E B;  2E1C A;  1QZY A;  3RCO A;  1FEX A;  2QSF X;  3RDI A;  3BCB A;  1W5T A;  1FYK A;  1XMX A;  4KA4 A;  2XAG A;  5JI6 A;  4A5M A;  1T95 A;  2VBY A;  4DYR A;  3HL2 A;  3O8G A;  3ZQL A;  3GZN B;  3B6A A;  4BJ6 C;  2CQN A;  1ZRC A;  1FOY A;  2KRH A;  1KU9 A;  4HA8 A;  1FPQ A;  3PIP F;  4G8X A;  2COB A;  2V4J C;  3HOU J;  2LDU A;  4Q47 A;  4U7D A;  1IUY A;  3E0J B;  3VYU B;  4G6T B;  2DTR A;  4P55 A;  2XPW A;  4PJ0 C;  3P9K A;  2EIK H;  2EA4 A;  2HTJ A;  5EEG A;  4B3A A;  5E1X A;  3ZPL A;  5CLS A;  2L9V A;  5F0F A;  3ERE D;  3HSR A;  2QBY A;  3C2H A;  1SVL A;  1VQ6 I;  3I54 A;  5CKT A;  1ZG1 A;  3HUG B;  1TLH B;  2DQL A;  4LIU A;  2EA2 A;  5ICG A;  3FHZ A;  3G2B A;  2W7N A;  4K2E A;  1K6O A;  3KEO A;  3W6J B;  4MLO A;  4QLC U;  4XLP F;  3PQK A;  4C30 A;  4EGY A;  1HC8 A;  2PG4 A;  4I7H A;  2M3A A;  5FLX K;  5DD8 A;  5GPC A;  2DA3 A;  3JRF A;  3OSG A;  3TKY A;  4M3D A;  3BDD A;  3IH2 A;  2WTE A;  1W5C C; 
#chains in the Genus database with same CATH homology
 3CUQ C;  1U5T C;  1XB4 A;  2ZME C;  1W7P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...