2ZMEC

Integrated structural and functional model of the human escrt-ii complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
b'SFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar-sorting protein SNF8
publication title Integrated structural model and membrane targeting mechanism of the human ESCRT-II complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 30
structure length 99
sequence length 99
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.570 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A "Winged helix" DNA-binding domain. Chain C. Domain 1 2zmeC00
3CUQC 1W7PB 1XB4A 1U5TC 2ZMEC
chains in the Genus database with same CATH superfamily
4M3GA 2AS5F 1OYYA 3AG3H 3L9FA 2RKHA 2GXGA 1SFXA 3JSOA 3BZKA 4G94A 3CCSI 1PUFA 3WE2A 2IGOA 2UZKA 3FMQA 1V5EA 3HGYA 2Z99A 3V42A 3BG3A 4BQOA 2E7XA 1SANA 2JTVA 4BQAA 1DU0A 1MMNA 1KU9A 1MDMB 4RA2A 5CVVA 4XK4A 3C2HA 1ETYA 1N75A 3MMYB 2NRAC 1VI0A 2M34A 2HU9A 2DODA 4HSRA 1VQ8I 2V1XA 2EFQA 2QM3A 1KGSA 1OISA 2BE5F 3KX2A 1TBXA 3GLLA 4HYEA 2VBXA 1J75A 5ILSA 2DFFA 4NQWB 2PMUA 4L9JA 1Z1DA 1P92A 4B3XA 3DCFA 2EBIA 1OCOH 4A3KJ 4HRIA 3AFHA 1MD0A 4ZYHA 2DA6A 2E34A 3ZQLA 5E3OA 3TBIA 3M8EA 3HRUA 3ZMSA 2JA7J 2KIQA 1D1CA 1W7PB 1XX5A 3E6BA 2KLOA 5FFZA 5JI6A 5KNLA 3F21A 2WV1A 4XLCA 1XG1A 2FNAA 3P7NA 5HDGA 1Q1HA 1X1PA 2KMUA 4RLQA 3HTUA 4BHCA 2E1NA 4TV7A 4YRVA 1GLNA 1I1GA 1TTYA 2GOXB 1ZGAA 3SZTA 1P2FA 3I9V2 1BN5A 2AO9A 2WAQA 4XLAA 5CLSA 2V1NA 3TEDA 2P81A 2V26A 3PM1A 4IJAA 3TP0A 4BYYA 4XNFA 4HX8A 2VE9A 1Z9CA 2QBYA 3CD6I 1P6RA 4F93B 1LNWA 5DS9A 1FY7A 1Y8RB 5IY5H 3ZPLA 1NK3P 2XGDA 2V1DA 2GIZA 5FKNA 2YS9A 5LGNA 2DJNA 2HDDA 2DLLA 3DPLC 1WGXA 2E19A 1ETQA 2Y69H 2YR2A 4ANJA 1HQCA 3FXQA 3BR6A 3ABLH 1PUFB 2VQGA 3OY9A 1D8KA 4XL9A 2JA2A 2Z16A 3RZDJ 2E35A 5K5QA 1WJFA 2R5YB 2JSCA 3BG5A 3LL7A 3CCLI 2XIGA 2IGNA 3SJMA 2NVQJ 2E1MB 4XLHA 2O8XA 3DV8A 3ROUA 3PQKA 1OKRA 2DA2A 3BC8A 2DT5A 3MQ0A 5CJ9A 5FRMA 1MGTA 2DTZA 2X6OA 4Q48A 1J2XA 4PFPA 3X2QH 4JOMA 1B1BA 3H3VK 5DUKA 2UWMA 2OQGA 2RREA 3GZNB 2OD5A 4LG0A 1RUNA 2VPLA 4G6QA 4UUVA 3DKWA 2CO5A 3HRMA 3K4JA 4N0BA 5FKMA 2CUEA 1GDTA 5GP9A 5TISC 1D1BA 3KZYA 1YLFA 4UB8C 4E4HA 4DNCA 2M0MA 3IRQA 2CW7A 1OJLA 3BR1A 5E3MA 3Q9VA 4WK8F 2LTPA 2XRNA 1QHHD 1BBYA 4ZDLA 5H6QA 4A69C 2Q8KA 2LSOA 1R00A 5B1AH 4WCGA 1TWFJ 1X2NA 2CUJA 2L4MA 5FGMA 2IS1A 2GBYA 1ETXA 1O7FA 1LE8B 5LFAA 1IXRC 3V8LA 4EATA 2VBWA 1AHDP 4IOCF 2K40A 1X3WB 4IRIA 2QBYB 1F4KA 3I59A 5IP9J 2R7UA 3K69A 4FETA 2BVLA 2HDCA 1FOWA 1U2WA 4BH9A 5IOYA 1SD5A 3WU2C 4PUSA 5DCFA 1T56A 1JUMA 3MCZA 2LDUA 3AL0C 3HIFA 1S9HA 1LEAA 1LJ9A 4KISA 4GDFA 1R22A 2KDOA 1YJ9I 3GEZA 5L3BA 4E7SA 3O8GA 4YFKF 3H0DA 4F92B 3ZMDA 3JW4A 3K4MA 4EGYA 3I0TA 3H3UA 4UXNA 1YO5C 4UUSB 2IW5A 2EFWA 2UXXA 3LSRA 4OOIA 2AHQA 3HEFA 4X0GA 1Z6TA 2KRCA 1XGNA 5DEQA 4EJVA 2DA1A 3L09A 4NBQA 3MD2A 5EYRA 3OYCA 1B72A 2Z9OA 2MLKA 5C4JJ 2M45A 4RDUA 4WX9A 4U7BA 1X58A 1OCCH 4BS9A 5GAHJ 3M7GA 2DMTA 2HI3A 1Y6IA 4DYQA 2A05A 4U87A 5E1XA 4LG0B 3I54A 1MBGA 1HDDC 2Y48A 3GO5A 1GXPA 4G6DA 2J5PA 2M4KA 1FBSA 1H9GA 5E79C 5H20A 5E1ZB 2BXZA 5DM6F 4IHSA 4BBSJ 1S6LA 2DMPA 2L7FP 3HB9A 3M3YJ 5EZGA 2G7UA 1G6NA 4OIPF 2L54A 2XGEA 4E7ZA 2D5VA 2OTJI 2HGCA 4X6AJ 1J59A 2NVUB 2GZWA 3PO2J 4K2EA 1BJAA 1K7AA 3I4NJ 1REPC 5FJ8J 3QOEA 2GM4A 1VNDA 1D0YA 5H2FC 3CMAI 4D9JA 3FXLA 3H5AA 4KT5C 4P5OA 2D45A 1W4MA 4QPQA 1XC5A 5E20A 1N25A 1KQ8A 5EG0A 1UJ8A 2OZUA 4A5NA 2PX9A 4AYBA 3FK6A 4KIFA 4V19K 2JUGA 4M9SA 4J01A 1WWXA 3O2PE 5IP6A 3P5JA 1BOAA 3GCMA 3C18A 1S7OA 2EIJH 3ZP5A 1I27A 2FOKA 4CCOA 4C2MJ 3I53A 3CUQC 2O03A 3I64A 1SD6A 2ESNA 2ZJPF 2NNYA 2ID6A 2R7QA 4LK1F 5L3CA 1P4WA 2V6EA 1K83J 4P9UA 1LFBA 3E5XA 2V9KA 3PUFA 3SQNA 4C3IJ 4BY1J 4L18B 5ED4A 1Z6RA 2VC1A 2PMHA 2XV4S 1QRYA 2Z5UA 2EPFA 1VQKI 2WV0A 2VASA 1A6QA 3KEOA 3JR9A 1WVRA 1MJBA 3F3XA 2GLOA 4W97A 4KA4A 3RTRA 3WHCA 1FOKA 4UVCA 4FISA 2OJED 2W85A 1ZG5A 1IUYA 4WXDA 1R1VA 2XB5A 3ABUA 2BOLA 1BJZA 2PJRA 3CF2A 3WODF 3DLLF 2R7WA 3H36A 1TW3A 3VSLA 2JVHA 1G3TA 1S7AA 4MIMA 1E2XA 2L7KA 3CJRB 3M4OJ 1ETVA 1X2MA 2HOSA 1SD7A 2KIFA 2DA3A 2WY8Q 4FE7A 1SAXA 4BY7J 1EH8A 3EYIA 3BLYA 4R8HA 4B8XA 1RIOH 3S17J 4I09A 4LLGF 2B7EA 2W4SA 3B6AA 4HW0A 5EG0B 4HF0A 2JN6A 1I39A 2RV8A 2JQ7A 4L5IA 3GTOJ 2OC6A 3FBNB 2WAFA 2W57A 2K3FA 1YI2I 2TCTA 3WGGA 5C3EJ 1WKMA 1R5HA 1N78A 2HZDA 2LF8A 5EJCA 5FD5A 1FYLA 3M8JA 4E7IA 3EUHC 2WADA 3PSIA 2RQQA 4E7LA 5CVUA 5JVTA 1VF9A 4BE1A 1FYKA 1IG7A 2R7OA 2WAQN 1VQ7I 2O61A 2I5UA 2LD5A 3A1YA 3RI4A 3C7JA 5F64A 4YG2F 4RB3C 4Y4RA 3ZGKA 1YRNB 4XONA 3S16J 1JI8A 4UV8A 4IL6C 1ONVA 3OWTA 3SZPA 1ODDA 5K1YA 4RB0A 1A35A 2KISA 4A3DJ 4DBRA 2XROA 1Z67A 3FK7A 1HCRA 4L0YB 2DW4A 4LD5A 5HS7A 3F8BA 1SFKA 3CCJI 3E7LA 2QEXI 3HRTA 4LMYA 4A3MJ 2OZ6A 2VC0A 5DV5A 2O3FA 1HKTA 3GTMJ 4Y13A 4LITA 4D7MA 3FKIJ 3H9QA 1C0WA 2ICWG 1ZAOA 4II3A 2H09A 3GFMA 3EQLF 2FD5A 2VT3A 2K02A 3C2BA 2L9RA 2RNGA 3QYFA 2FA5A 3QU6A 2KDZA 3ZMVA 1OMIA 4DGWB 3CCMI 4S04A 4A93J 5B3SH 1YOVB 1KA8A 1Q1VA 2ZCWA 1BC7C 3LSJA 1RPWA 2PQ8A 5CYVA 4BJTA 5EEGA 3K0LA 5B66C 2CFOA 2LYCA 3MZHA 5TJJA 5FKOA 1P4AA 4HV5A 4BBRJ 2XAQA 4PZJA 4XORA 3H92A 3E6DA 2K9LA 2MW8A 3CCEI 3WGHA 2LREA 3W6KB 4A3IJ 2LNBA 4MTDA 2LP0A 4M3FA 2VJ5A 4XM3A 2PMZA 2M4GA 1ZRCA 3DPUA 1XSDA 3TL4X 2GA2A 3G1LA 1QU3A 2CS3A 1TLHB 1AOYA 1OFCX 2Z3YA 2A69F 2DU9A 2R7RA 4F52A 3V4GA 1SC7A 4CA0A 2DAOA 1TQPA 3OIQA 2FEZA 4NC6A 4Y52J 4M73A 2IRFG 2RAEA 5CKTA 4QSHA 2V6CA 1BIBA 2RQPA 2JRMA 5LGUA 2F2EA 1JT0A 3CTAA 5FKLA 3S15J 3J7YJ 1E3HA 4MTEA 2PBIA 1ZGJA 2R7TA 1O4XA 1IO2A 4G9YA 2D1HA 3VEPA 3IP4B 4QIWN 4HX7A 2QQBA 2FBHA 3RIRA 4ZJZA 1T95A 4CCJA 1T39A 2ZJQF 4F3QA 4H4KC 4N9IA 3K10A 1LPQA 3S3OA 3PSFA 1ZN2A 3ASNH 4AIJA 1SMYF 1XGOA 2ZXJA 2M5WA 4BQNA 5M5YJ 2VT2A 2BY1A 4HQMA 3TMOA 2CV2A 1D5VA 2JMWA 5AIPA 4PJ0C 2M9HA 3WTVC 1HOMA 4RAFA 2YX4A 4GYGA 5AIQA 3L2QA 2HXOA 3TO7A 1O7LA 1FTZA 2CQNA 2ISZA 4CHUA 4EJOA 1O3TA 4M6YA 4XRSG 5C44J 5EEAA 1EV7A 1WRJA 4B48A 2CW0F 2BV6A 2BY2A 3LSIA 2L4AA 1BL0A 1I1SA 1FP1D 1JTYA 2XF6A 3FXRA 2L9NA 1W36D 2FQ4A 4F55A 4HDUA 4KNYA 1U6GA 4IX7A 2F5DA 1YX5A 3GFIA 1IRZA 2IS4A 1R4NB 1USTA 2MD0A 3WTSC 3DP7A 3QWLA 3ELKA 4CZZA 1YITI 4CZCA 3LAJA 3CCYA 5F1JA 1WJEA 1LDDA 1XDSA 1YQAA 2ZMEB 2MC3A 2X0LA 3RQIA 4BKXA 5EGOA 3CZ6A 1MDMA 3KZIC 4KJZA 4X1EA 4KITB 2CWEA 4QPOA 2D2WA 2KRFA 2W48A 2QCOA 5IP7J 5FLXZ 3DWLE 2O5RA 2R7VA 3KLNA 2FU4A 1W5TA 2HYGD 2EJRA 3CP2A 2P5KA 1I5ZA 3CO7C 3ASOH 1ACIA 4AYBN 2BHYA 2DYSH 5JLWA 3MFKA 2LLKA 2VIXA 3JRBA 1Z7LA 2IS2A 1IN6A 3KETA 3HSEA 1J0RA 1VQOI 3QRFF 2JK3A 3GZ5A 1RESA 2MBFA 4IHVA 2CMPA 1W7PA 2COBA 2H8WA 4XMYA 3F0CA 4PJMA 2OQRA 1TNSA 2ZFWA 3FF5A 3H3ZA 4LIUA 4IHTA 1NH3A 4U88A 3Q9SA 4A0ZA 4UB6C 1I3AA 2V7FA 2BXYA 2WC2A 2Z33A 1FLIA 1UB9A 4MHGA 1LFPA 3OS1A 1H88C 3A0HC 2YSRA 4IZZA 2LF7A 1GT0C 1KONA 4P96A 1FBUA 2MGQA 4HX4A 1PVEA 3NWSA 1FSHA 3FXJA 2H6CA 4JYKA 3F6OA 2CGPA 2XGXA 3TKYA 4UVAA 2ISYA 2L3DA 3FHNA 3IC7A 3OIOA 1WH5A 5E3LA 3GBGA 3ZR8X 2HQNA 2XAGA 2A6EF 5HS9A 1KYZA 3IH3A 1RUOA 1U5TC 1FNNA 1OYIA 2HFHA 4G8XA 4YFXF 4C9YA 2ADUA 2LY2A 2DDBA 3KYLA 1YW8A 3MKYB 2VJJA 2R5YA 1POGA 4DZJA 3L1PA 1R36A 5EGOB 3QYEA 2OA4A 5LHIA 1JHHA 2XKPA 4AWXB 1HC8A 5ERIA 1R1UA 2EZLA 1WFXA 4YIRX 1RKTA 1OPCA 2W24A 2ZBKA 2VKDA 4UNOA 1W36C 3J7AY 4LB5A 1JKRC 1U9OA 3EDPA 2R5ZA 1K4TA 2R7SA 4ZTJA 1G8XA 3MVPA 4PGHA 2VKEA 2DOEA 4FASD 3KIOA 3A4CA 2CUZA 2F4OB 3LSMA 1WJ5A 2A6HF 5E1WA 4I02A 3S14J 3K4NA 1T38A 2NXNB 4PSWA 1FYMA 1SVLA 1LEBA 3H5RA 4PGGA 2O6GE 1ZH5A 1XGSA 2UUZA 4FCYA 1WCMJ 3HOZJ 3C2GA 2OU2A 4BDZA 3D5LA 2XB0X 5L3FA 1JE8A 1EH7A 2LKPA 3SDBA 1Z05A 3TQNA 1LE8A 2XUBA 1LDKB 5J1UA 3GTKJ 3F72A 3RPQA 3KP5A 2DJIA 1LQ1A 1VQ5I 2DDAA 3BPVA 3LQRA 3RPUA 4BXXJ 1DGWY 2X4HA 4DBQA 3LMMA 3JCUC 4EQQA 5CVIA 5LD2C 3RJPA 5TRDA 4IQ4A 1LB2A 4BE0A 5F27A 1QBJA 2NS8A 1WZ2A 3G1MA 4XKWA 5DDGA 3F8CA 2A61A 1B8IA 2GQQA 1Z77A 5E8GA 4XLPF 4P1WA 1T08B 1SD4A 4HA8A 4KN4X 3T1BA 3SZGA 3V7SA 3VOEA 2XPUA 3HZJA 4XSXF 2OPTA 4UUSA 5D4SA 4I99C 1P7JA 1B59A 4OWRB 2X1CA 1ZLKA 1ZQ3P 1QGPA 1MMAA 4CH7A 4Z2YA 4KN7X 4XOPA 3FHZA 1T0FA 3EYYA 5KAIC 2DI3A 2KQRA 4GXOA 5F6FA 2V1UA 2MH9A 5ICCA 1RC9A 2R5ZB 3IAS2 3MKZA 2QSGX 1RZ4A 2H94A 3TDZC 4HOBA 1IDZA 3K4LA 2PMZN 5D5UB 3TDUC 5IYBJ 2QENA 3NEUA 3Q0WA 2EFPA 3MWMA 4AM3A 3K6GA 2K3PA 4EJTA 2R3SA 1USSA 2F4MB 2VL8A 2IA0A 2PFBA 3I58A 1W0UA 5HLTA 3C3WA 3U21A 4KYWA 2ACJA 4C30A 4A5MA 1Y8QB 3VODA 4ZDOA 4ENKA 1U8BA 3AG1H 3WHBA 2BEOA 2DT6A 4IRGA 2IJLA 3HHHA 1MBKA 3HYIA 4KIGA 3RKXA 1ENHA 3MKWB 3K9TA 3VB2A 3CQZJ 3KYDB 3PO3J 1F5TA 5J8FA 2GOMA 1FZPB 2K86A 3FBIB 3W2WA 1K61A 5AONA 2BW3A 1XD7A 4HNTA 4PJLA 3QQAA 4ETSA 2VLAA 1A6IA 4LLLA 2H1KA 4AU7A 3R4KA 3OSGA 5LRSA 2E5NA 4A2UA 1QHGA 2ESHA 3FISA 5E8IA 4RS8A 2OCCH 5FLVA 1W5CC 3OV8A 1BOBA 2XC7A 1FMWA 3BQYA 1B8IB 5A2QK 3LA3A 1V3FA 2O9LA 4YIFA 3QAHA 1MNDA 3HSRA 5J47A 4P9FA 3D5RC 2VOOA 1QPMA 1GVDA 4RGUA 3BTIA 1ZR2A 4CYDA 2ME0A 3OOUA 4B44A 2ZKZA 3CLOA 4M74A 5IOZA 5BMZA 5DYMA 2JPBA 2STTA 1Z7UA 5LRRA 2J5OA 2OTLI 1JTXA 2ZJ2A 1RI7A 2KZGA 5GAGJ 1HW2A 1ERDA 2P5VA 1JHFA 3WTXC 4RB1A 1QVUA 1UAAA 2V9VA 3KP6A 4D5CA 4L0ZB 1GXQA 3O3KA 4F7ZA 4G7HF 1KU7A 5IT3A 3F23A 1RKWA 2EH3A 2K85A 2L2OA 2HXIA 3A0BC 2JA5J 3GTLJ 4A3LJ 4N4OB 2VB6A 1UHMA 5FKKA 4HDVA 1SAUA 4OIOF 1FP2A 3SHFA 1HBXG 1TW2A 5B5EC 1FIPA 1G3WA 4DYCA 1QA6A 1NG7A 2P7CB 4II2A 5EF6A 3NAUA 5J8CA 4CCNA 3CJTB 4MEYF 1W7PD 4DJAA 1BA5A 2JRTA 4OMZA 2FRHA 3ERMA 1YG2A 2MABA 2RN7A 3LSPA 4XKCA 2CQKA 3EUAA 3DU5A 1B9NA 3T8TA 2JWTA 2MLGA 1STZA 3BR3A 5K7ZA 3BOQA 4MFDA 4EM1A 2BW3B 5DD8A 2M3AA 6PAXA 3HPHA 2M30A 1VQNI 3DTIA 2VN2A 4XLFA 1UHWA 4LG3A 4XN3A 2ZXWH 4HSTA 3GWZA 2DCEA 3S1QJ 2FUG2 1Y0UA 1JT6A 3PQJA 2DBBA 2VXZA 2W00A 3RYRA 1YJWI 5F0HA 1M1EB 4G12A 1MIJA 1KQ0A 3L2WA 1HXDA 4PSXA 2OV7A 2F5EA 4EGZA 4L9NA 3DKXA 3OS0A 1HLVA 1ETOA 3JTHA 1YRNA 3E6MA 1K6YA 3U1DA 3QPHA 4C2UA 4MFEA 4ZYGA 4AC0A 2X6WA 4A3CJ 3WU1B 4ON0A 1T33A 3JTGA 2CQ7A 5HOOA 2O8KA 4HEA2 4RAGA 1SFOJ 2PEXA 1ZR4A 4ENMA 3DLAA 2WTEA 4A6EA 3O8HA 2R7ZJ 3CCRI 2O0YA 3CCQI 2E2HJ 2OBPA 1IN8A 1VQ4I 4JX6A 1NHAA 5J40A 2X9DA 4MQ9F 2FJ1A 3PJRA 3QODA 5M3MJ 3IL2A 4DYRA 3RDIA 2BHZA 3RCOA 1B4AA 1BR2A 3BPXA 2F5CA 2VI6A 3KLOA 3F6VA 2ELHA 1NG6A 1MJAA 2F6CA 2LY9A 4YELA 1CQTA 3HJEA 4HBLA 2XHKA 1J5YA 2E2IJ 2VOPA 4N9HA 1UMQA 1FPQA 4AVZA 1BI3A 1BR1A 3BJOA 2DQRA 2IBDA 3ZN0A 4WXHA 5IT9K 1AU7A 3BZ6A 3HOYJ 2CU7A 1XPXA 4DQ2A 1RETA 2CQQA 3K2AA 1XMKA 2DN0A 4MO7A 2IS6A 1LUJB 5GAEJ 3ZN1A 1TZLA 3GF2A 4HNUA 4HF2A 2KZVA 1F1ZA 1XCBA 2V79A 5F08A 1HSJA 2M1BA 2RGVA 1O57A 5FLXK 4B3AA 5A2QZ 3JSPA 3QPTA 3WU0A 1U78A 4BEHB 2F4IA 3CDIA 2GIVA 2VUMJ 3HUGB 3CMMA 3F8NA 5HNHA 1BM9A 2WY7Q 2ETHA 2FQ3A 3BT9A 2R0QC 5HODA 3QPLA 4ZC3A 4HV6A 4CO8A 2L9VA 4RGSA 1T98A 3EPZA 4EV0A 2COMA 1IN4A 3LSKA 3QU3A 3A02A 5TGTA 3VWBA 1J7KA 1Z0XA 3GLXA 1FMVA 3ZQHA 2R7DA 4B09A 1FBQA 4BACA 3HXLA 2ZC2A 2LKSA 1LKXA 4KMUX 1W1WE 4M6XA 1KZHA 1ON2A 1Y39A 1R9TJ 4L9TA 1K78A 2PJPA 1FX7A 1XTAA 2CH0A 1RR8C 2MA3A 2LY1A 3WTTC 4PFOA 3HBLA 4UHTA 1JKPC 4CYCA 3LAPA 3I4MJ 3ZMTA 3OOPA 3DEUA 5FROA 1E3PA 3E3VA 3FXOA 2XKOA 2ID3A 5E18F 1U3EM 3KP2A 3DBLB 4LLNA 3ZCOA 1IRFA 2E1MC 2L9SA 1IDYA 3FWEA 2XSJC 3WTZA 2V9PA 2E60A 4CCKA 2QQ8A 2DFIA 2GA1A 3ZQ7A 3CCUI 2KRHA 1UG2A 3OYJA 4RGXA 1VQPI 3DBRB 2XPWA 4QWQA 2DMQA 2E36A 2K5CA 1DQUA 2IA1A 3K1MA 5D8KB 3L2VA 3KE2A 2M87A 3BQZA 5CQGA 1X3UA 1BW5A 2NVXJ 4Y15A 2AQFA 1UG0A 2KJCA 3G73A 4OAYA 2VKHA 1QZYA 5LBQA 2B9SA 2IGMA 2X6YA 3MN2A 1XB4A 1H89C 2VXDA 2ZMEA 3HPGA 3ISPA 4GFBA 3TO6A 1PP7U 4CGZA 3W3CA 3I71A 3J81K 4C2TA 4BUPA 2QZ8A 3VYRB 4E7KA 2EV0A 1TWCJ 4NDLA 3K70D 2VKVA 3CMEI 3K4BA 1ETWA 2X1DA 2STWA 4HNVA 3D1NI 3R0JA 4B47A 3CC4I 1R5ID 4A3FJ 2G9WA 3I3LA 1IV8A 4FTHA 3BG6A 4H0EA 1D1AA 1A31A 1OCRH 1K79A 3BG7A 2HDWA 5K5RA 4OIRF 1G3YA 4DZPA 3OYDA 3DTKA 2CRGA 4CCMA 5BPIA 1K4SA 3OR2C 2Y30A 1DUXC 4B43A 2NOJB 4WXCA 2HTJA 1MNEA 3FXKA 2MFZA 4M3BA 1TT5B 3ECHA 1LDJA 4ZDPA 3OYIA 2FSWA 1FT9A 1JUSA 1LFUP 3U2RA 4GCVA 1DPRA 2F5VA 2CW8A 3M1CA 5HLGA 3LSHA 3FX3A 2FOWA 1EA3A 4UV9A 2DQLA 2HNHA 3Q5FA 3OL4A 1K6OA 1ZREA 3H9GA 2UXNA 4MGRA 1K78B 2JUCA 1QZZA 4L5JA 2HVQA 2CQXA 1Z91A 5JHUA 1MBJA 4CYCB 1X19A 3DBHB 1QQIA 2YPRA 4RAZA 2RNJA 2DPUA 3H35A 5HLHA 3AAFA 1WPKA 2ECBA 1WI9A 1IXSB 1SEUA 3AL0B 1E17A 1X1BA 2DT7B 3MEXA 4G6TB 4XRSA 1XCVA 3CUQA 5IYDJ 3H5NA 4LGWA 3RQ4A 1U0JA 2DO7A 1T0FC 3GTGJ 4I0BA 5L3DA 4HF1A 3H1CA 4XKVA 5C4XJ 5D8LB 1MNMC 4Q47A 3H0GJ 5IT9Z 2LFBA 4DIQA 1YTYA 2BY0A 5LLQA 1OCZH 3GX4X 1TWAJ 3R0AA 1GVJA 2AXLA 1TT0A 4M3EA 2HKXA 1OYWA 3LSGA 1MSEC 3N05A 2M8EA 2WA0A 1Y0NA 2P6SA 2VBZA 3PNYA 2VE8A 2QA4I 1JUPA 2DMNA 4LK0F 5FLMJ 4KT6A 4QLCU 2XAHA 3BR0A 4AD9A 2WBMA 3QPSA 3G1OA 2L7MP 3UR3C 2IP2A 4J00A 4F91B 2NAZA 3LQQA 4GO1A 1MJ9A 4FHTA 4J19A 5D6FA 2R4GA 3LWFA 3OYFA 3HDDA 2ZFUA 2Y9ZA 1SFEA 1X3ZB 1Y56A 3UKGA 2PLYA 1UHSA 4AIHA 3DXJF 3LOCA 2W25A 3IWZA 3TOBA 3K70C 3HOVJ 1G3SA 2ME6A 2HOTA 1AWCA 1OR7A 3BZCA 5J4YA 3FMSA 1WI3A 2QUFA 3HC7A 4BAYA 5ICGA 3DTEA 3R61A 3EUKL 2QKLB 2VPRA 3RYPA 5E17F 2P4WA 4PK4A 3ZQGA 5JHFA 4BDYA 4RM3A 4PJNA 1MBHA 3JRGA 1FJLA 3EUHA 3OMYA 2DYRH 2LG4A 1XMXA 3CUQB 4R1HA 2QQAA 5J6XA 4Y33A 1P9QC 5KHDA 2KL4A 4U0WA 4ZH4F 5BOXA 1BI2A 3G2BA 4ZYEA 3I56I 3CLQA 3HHGA 3IRRA 4RM2A 2ZXIA 1IF1A 1EJ9A 4PDKA 3RSNA 2CSOA 2LRDA 4V2GA 5FB2A 4L9VA 5JVGF 2L5QA 2W82A 1E3OC 5JLXA 1I3QJ 1XN7A 5DCMA 5B1BH 3J81Z 2BGCA 3L2RA 1J9IA 1TL8A 1SVMA 4L5EA 3KP4A 4ASNA 4GRIA 5GPAA 1KU2A 1RNLA 3REOA 2OAZA 2NVTJ 4GGGA 3S3NA 2EZKA 1S8NA 1ZKGA 4FQGA 2DA5A 2E1OA 2CJJA 2K27A 3RKYA 2LC2A 2EZIA 2LH9A 5CPRB 4XBFA 5L3GA 3CDHA 2ZJRF 2LOOA 4D0PA 2DXIA 4I98B 2KJBA 5KCMA 3FZVA 1XDUA 2VODA 2LKXA 3S2HJ 5ILVA 2VJ4A 1W0TA 3BCBA 2KFDA 4IXAA 1A04A 1X1DA 2KHMA 3ZMUA 3IKTA 1R58A 2EIKH 1HF0A 4CCLA 3G6EI 4KFCA 4JX5A 3GFLA 4ZZDA 2DOAA 2Y0SA 4KMFA 2HS5A 1IAWA 2GXAA 2EQRA 3ERED 2FBIA 3KEYA 4XIDA 4JK1X 3PFIA 3TOAA 3CO6C 2G0EA 1F36A 2VQLA 3TP3A 1TC3C 1ITYA 3DEWA 3SXYA 4A0YA 3VSKA 5LGTA 1EF4A 5K7HA 2W1OA 3HOTA 3L00A 1LVAA 2M7BA 2KIUA 4ABZA 4IHYA 3QYBA 3S3MA 3E5UA 3CDLA 4XLNF 3BTLA 4XRFA 3S8PA 1DDNA 1OCPA 4I01A 4XN0A 3QP6A 2VJIA 2MC4A 3GXOA 1MZBA 2H27A 1H8AC 4IF4A 5F0CA 3OS2A 2IXSA 4C3JJ 1B9MA 4OMYA 1BIAA 3GTJJ 1WJBA 2DK5A 1X4OA 2PI0A 2KP6A 4FX4A 4I0AA 2HOAA 2ZXHA 5CVRA 3VFZA 5ICFA 2DFEA 5DM7F 1VQ6I 1V4RA 3E0JB 5DCMB 5JR3A 2Y2ZA 5D4RA 4HQEA 1FOYA 2DOFA 3SDGA 3LFKA 2JA8J 3ONQA 2E5ZA 3BJAA 3OYLA 2KIMA 2AXTC 3FIWA 2DFHA 3OYBA 1T8IA 3A2KA 3N4MA 3G3ZA 4HLXA 2K7LA 3IHUA 3AG4H 4O5VA 3ZQQA 3HTSB 4D1QA 1S5LC 2WB1A 3IV5A 1KQ9A 3E97A 3NRVA 3VDXA 3BCAA 2QSFX 1XS9A 2OCEA 1WJDA 2JPCA 2B0LA 2IVMA 4N4NB 1X1CA 4BHBA 1VTNC 2K9MA 1Y1VJ 3M1EA 1FIAA 5HLIA 1UCRA 2X48A 3S1NJ 2L01A 1D0ZA 3GTPJ 1ETKA 2FE3A 3OIPA 2Q1ZB 1GV5A 1R5GA 1JJ8C 4C3HJ 1JKQC 2O7OA 1JGSA 4HG2A 2RDPA 2HQRA 1WQ2A 2XGCA 1YW9A 3OYEA 1ULYA 3MZ8A 4LFUA 5KK1A 3VYUB 3HKZA 4CXFA 3WTUC 1ON1A 4JBAA 4LB6B 4FT8A 2EFOA 3LNQA 2HR3A 2I10A 5IPAA 2TRTA 1UFMA 3TW6A 1JGGA 1NK2P 1QO0D 1G59A 3LFUA 4O3MA 2X51A 4M9ZA 4XKBA 4E7HA 3FXMA 4P55A 1VZ0A 3CC2I 3FDYA 4UY8I 2Y31A 4A0XA 2L0KA 1IUFA 1IN7A 2NOGA 1MW7A 4JX4A 3CC7I 2G7HA 4BU2A 1WJCA 4XOTA 2K4BA 9ANTA 4Z6YA 1IJWC 1MKMA 3JRDA 2K9SA 2KT0A 1ZRDA 2EA4A 3KP7A 3JRIA 1GV2A 1QZEA 2EZHA 1CF7A 4MLOA 1V55H 5HVQC 3WG7H 1U8RA 4HPQA 1YS7A 2EIMH 4RB2C 1HW5A 4IEJA 1E0EA 1Z3XA 5CVJA 4E70A 3OYGA 3IKVA 1MMSA 1YHQI 3DEEA 3PNTA 4W1UA 2FMLA 2IA2A 3HOWJ 1KU3A 5DUIA 3ABKH 4CICA 1U9NA 1FWZA 3BTJA 2Y75A 4PJJA 1I6XA 4M72A 1MH4A 1BW6A 2XVCA 5FD6A 3A01A 5M5WJ 3CCVI 3VYSB 1HW1A 1DPUA 1BI0A 5ILUA 1YE9A 3WGIA 1SFUA 4BXUA 3ABTA 3O6BB 1FEXA 2C6YA 2Q0OA 2ZMEC 2MG4A 3V7RA 2QF7A 2I8DA 5LEKA 1SVOA 3NWTA 3OYHA 1U5TA 3MAJA 3RZOJ 1A5JA 4FE4A 2HQAA 2HPMA 4V2FA 2M7AA 1F43A 5KAFC 1MBEA 2LR8A 1JJ6C 5K7FA 1OQYA 2FBKA 2W7NA 1DP3A 4ZYDA 3U1KA 3K4CA 5DTDA 4CSWA 3PIPF 3SFZA 2QVOA 3DKYA 5GADJ 2A6TA 4HZFA 3CJQB 1QNTA 2KKOA 1ZRFA 4MQVA 1MMDA 1XMAA 2IGKA 4XR6A 1DGRM 4XICA 1ZLJA 2YU9J 1UELB 4R79A 1JXSA 2WAEA 3D5SC 3IAM2 3I4PA 4EMSA 4IOAF 1QVTA 3BP8A 2LK2A 2EA2A 1YW7A 4BL0B 1PUEE 4Q5SF 5GTHC 2LBFA 1TQIA 3PNVA 3QP5A 3T0YA 1RR7A 2FF4A 3AKZA 3JAMK 3DU6A 4BEHA 1G4DA 3FXUA 1CF7B 2IAIA 3HUGA 3I59B 3S2DJ 4YIIA 3DF8A 2LMDA 1SMTA 3BR2A 2NYXA 4EM2A 2RVCA 1G2HA 2ECCA 3G71I 4D7NA 5GTIC 5M5XJ 1WJAA 4ESBA 3LA2A 3KYCB 1IGNA 4KIBA 3T8RA 2QYOA 1A36A 3CJNA 1O3SA 4KICA 1CGPA 2CUFA 4B4CA 1TNTA 3FMRA 1GUUA 3KCCA 3ZOBA 2ZO4A 3P9CA 3FM3A 3BROA 5D6EA 1BR4A 5EZHA 3KPHA 3A01B 5KVRA 3IWFA 3KP3A 5LHGA 2CFXA 3JRFA 4A3EJ 1YS6A 2OF7A 4ZTFA 4O6JA 4RAYA 3OSFA 1OLTA 2P6TA 1B72B 1VQ9I 4NC8A 4BGDA 4IHXA 3HRSA 4RGRA 1WH7A 1NTCA 4HLYA 1MMGA 2EINH 2QKMB 2K9QA 1U5TB 1XSVA 5M3FJ 2D1VA 3ZXSA 3SEZA 2NVYJ 3GYHX 3BY6A 4A3JJ 4S05A 3L2UA 3IUOA 1R6RA 3E5QA 3HL2A 4Y3OA 1HKSA 2R92J 2BYVE 3K1PA 4XSZF 4RMNA 4BQQA 1TP4A 1ZELA 1TWHJ 4I6ZA 1D8JA 2XAFA 2H8RA 1O3QA 2XF7A 1PYVA 1RRJA 3GFJA 4CDGA 4M9XA 4XLEA 3ZMZA 4YEJA 1IW7F 4NNJA 1Y1WJ 1FTTA 1P4XA 4MEXF 3GMEA 2EV5A 1IN5A 3PUBA 5H6RA 3RPUD 3C1DA 2Y0SN 1EKEA 1ZARA 1XSXA 4RBOA 1S29A 2LBFB 2YUSA 4IHWA 2K9NA 2IEKA 1HDPA 2X85A 4A12A 3VYTB 1OR7C 4BNCA 4A3GJ 1X1AA 3HG9A 2QWWA 1P7IA 4EM0B 3N97A 4B1RA 3M07A 1QPIA 1GHCA 2L7ZA 2K4JA 1FSEA 1BI1A 3K7AJ 3S2WA 5D5VB 1PJRA 2XAUA 4RLFA 1YJNI 4IPAA 2IT0A 5D5XB 2XDVA 2F5FA 3CP8A 3H9JA 3HGGA 4GYIA 1F9NA 5F1RA 4BXFA 1OCTC 2XASA 3OYNA 1ZYRF 4I7HA 2XRLA 1YX3A 3G4SI 4OIQF 1L3LA 2JT1A 2R7FA 4KUMA 3COAC 1WSUA 4LJZF 2DMUA 4OU0A 2XSDC 5J4VA 2E71A 2YX7A 3PFYA 2DTRA 1IRXA 5K5OA 1YYVA 3OL3A 3NARA 2FX0A 2V4JC 5JFRA 3JRCA 1N77A 2N8GA 5D5WB 1Z21A 2W84A 3P9IA 2EV6A 3DQVC 2QQ9A 1W5SA 3JRAA 3AG2H 1AA7A 1IC8A 2EFNA 2GXBA 2XF5A 2MSYA 1YFHA 2BY3A 5ICEA 3J80K 3W6VA 3I55I 2HZTA 1J09A 2L02A 2BBYA 3OR1C 3F8FA 3PL8A 4ENJA 2E1CA 3VPRA 2VBYA 2DK8A 2HYJA 4JQFA 1UZCA 1ZHFA 2OUMA 2WB1N 5F04A 1H0MA 4AIKA 1T6SA 2PJRB 1IZ1A 2JVGA 3GUDA 3BJ6A 3MZYA 2VQHA 3ABMH 3BG9A 5LEJA 2R93J 4OINF 2P0WA 4M3DA 2AQEA 2QSHX 4XQFA 5E3NA 2FNPA 2A5WA 4ESJA 3GW2A 4ITVA 3ZQCA 1KYWA 3B02A 3OYAA 3V7CA 1R23A 1TQMA 5BNGA 4NC7A 3LA7A 4E7JA 3QOPA 2ZNYA 3CF5F 1VQMI 3JAMZ 3HKZN 4EJWA 4U0VA 1HSTA 2Y0MA 3L2CA 3BWGA 2XAJA 4DOZA 1IXCA 2PN6A 3K2ZA 4IRHA 5L3EA 3D0SA 1S72I 2NS7A 3ECOA 4EJUA 2ZSHB 2CG4A 2WWYA 5HDKA 4UUTA 5HS8A 2MD5A 2A3SA 1AKHA 3RKWA 2PG4A 4M71A 5J3LA 2VQCA 2EB7A 1Z3YA 3MKLA 4CUGA 4XRMA 3W2AA 4Q4ZF 3SEQA 5FFXA 1ZK8A 3R60A 5EEHA 3W6JB 3U9GA 2HTSA 2YU3A 2A68F 3Q3SA 3B73A 4Y7NJ 4ESFA 2QLZA 1WHUA 2NS0A 4UVBA 2F48A 3IH2A 2P5LC 1FOXA 2ELJA 4DW6A 1S3JA 2HVSA 2P7VB 1V5FA 3Q0UA 3TW7A 2ELKA 1D3YA 1O3RA 2JJ7A 4NHJA 4AIDA 1B6AA 4IQJA 2X6XA 1BC8C 2R7XA 2DPDA 1I50J 3DFGA 1MH3A 3BDDA 3ML6A 1PP8F 5GPCA 1X4PA 3KFWX 3FKJA 3WG9A 1PDNC 5J1RA 3P9KA 2FMYA 3NQOA 1DU6A 3EETA 3OYMA 2Q2EA 3T5XA 1DP7P 4OAZA 3UNGC 2E2JJ 3JRHA 4IKFA 2ZNZA 5CQEA 5FO5A 4EVIA 4I2OA 3F9KA 4IO9F 3IH4A 4EEFG 2GAUA 3HM5A 3R6SA 4PCQA 3BR5A 3KZZA 1ZG3A 5BPDA 3WE3A 4M6VA 2EK5A 2JZYA 1APLC 1VQLI 3HSFA 3HOSA 4JP0A 2M2EA 4NB5A 4ZZLA 3OYKA 4IVNA 3PIOF 3DPTA 3RKQA 2DA7A 3E6CC 3CUOA 1R7JA 3GTQJ 4BE2A 4FX0A 2B63J 4BJ5C 2ZB9A 3S1MJ 2HQ5A 2H1LA 1R1TA 3B6CA 2HKOA 2CV0A 2GWRA 3TO9A 4LOCA 3Q0VA 1R71A 4NUBA 1H9TA 3WTWC 3LSTA 1R49A 3F22A 2HOEA 3HOUJ 4Y17A 3ESWB 3M8FA 3M9AA 3WTYC 2LVSA 4HAMA 1D0XA 2TDXA 4KDPA 4QTRA 3S93A 1AKHB 2FXAA 3I5UA 3KEQA 2P8TA 5J1YA 4G7ZF 1ZTRA 3FM5A 5LHHA 1HA8A 5BS6A 2MYSA 2CYYA 4ZYAA 4U0YA 5FRNA 4G7OF 3F8MA 1MSFC 1YIJI 3L7WA 4U7DA 3SFIA 3JREA 3J7AO 4D5FA 4ENNA 2VONA 1I6HJ 3CESA 2M0CA 3W2VA 4NQWA 3GZ6A 3K1NA 5EDNA 2DA4A 2HVRA 1V5GA 1XGMA 2M8GX 3SYTA 1R4MB 5BQTA 1T2KA 2EWNA 4MNUA 1FC3A 2BVMA 2Y9YA 2X1EA 2ZSIB 4WWCA 3J7ZI 2BZTA 2A5YB 3TGNA 3BTCA 3V8KA 2HYFA 1L0OC 3E1SA 4E6KG 2XPVA 3J80Z 1ZGWA 1VFCA 1YIOA 2Z2SB 2Z1DA 1IRGA 1HKQA 1ORKA 4YFNF 2CV1A 2JA6J 4S0HB 1IV6A 2Q2EB 4AVPA 1JKOC 5HNFA 5IYCJ 1D5YA 4I76A 1MBFA 2E7WA 3V8JA 2A07F 3GVAA 4AUXA 3A03A 1S7EA 2KPMA 3ZQIA 1LVKA 5DD4A 2QGUA 3S1RJ 2JSPA 2HEOA 3ZRGA 2IPQX 2EILH 1V54H 2RC4A 3HOXJ 1EH6A 3K4KA 5F0FA 3ZQFA 1ZG1A 4BHPA 5HDNA 4WF2A 4A6DA 2MH2A 2HWVA 4BJ6C 3CMYA 4LIVA 2UV1A 1TWGJ 4A3BJ 2HPIA 3S32A 2NNNA 2H6BA 3ULQB
chains in the Genus database with same CATH topology
3CUQC 1W7PB 1XB4A 1U5TC 2ZMEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CUQ C;  1W7P B;  1XB4 A;  1U5T C;  2ZME C; 
#chains in the Genus database with same CATH topology
 4M3G A;  2AS5 F;  1OYY A;  3AG3 H;  3L9F A;  2RKH A;  2GXG A;  1SFX A;  3JSO A;  3BZK A;  4G94 A;  3CCS I;  1PUF A;  3WE2 A;  2IGO A;  2UZK A;  3FMQ A;  1V5E A;  3HGY A;  2Z99 A;  3V42 A;  3BG3 A;  4BQO A;  2E7X A;  1SAN A;  2JTV A;  4BQA A;  1DU0 A;  1MMN A;  1KU9 A;  1MDM B;  4RA2 A;  5CVV A;  4XK4 A;  3C2H A;  1ETY A;  1N75 A;  3MMY B;  2NRA C;  1VI0 A;  2M34 A;  2HU9 A;  2DOD A;  4HSR A;  1VQ8 I;  2V1X A;  2EFQ A;  2QM3 A;  1KGS A;  1OIS A;  2BE5 F;  3KX2 A;  1TBX A;  3GLL A;  4HYE A;  2VBX A;  1J75 A;  5ILS A;  2DFF A;  4NQW B;  2PMU A;  4L9J A;  1Z1D A;  1P92 A;  4B3X A;  3DCF A;  2EBI A;  1OCO H;  4A3K J;  4HRI A;  3AFH A;  1MD0 A;  4ZYH A;  2DA6 A;  2E34 A;  3ZQL A;  5E3O A;  3TBI A;  3M8E A;  3HRU A;  3ZMS A;  2JA7 J;  2KIQ A;  1D1C A;  1W7P B;  1XX5 A;  3E6B A;  2KLO A;  5FFZ A;  5JI6 A;  5KNL A;  3F21 A;  2WV1 A;  4XLC A;  1XG1 A;  2FNA A;  3P7N A;  5HDG A;  1Q1H A;  1X1P A;  2KMU A;  4RLQ A;  3HTU A;  4BHC A;  2E1N A;  4TV7 A;  4YRV A;  1GLN A;  1I1G A;  1TTY A;  2GOX B;  1ZGA A;  3SZT A;  1P2F A;  3I9V 2;  1BN5 A;  2AO9 A;  2WAQ A;  4XLA A;  5CLS A;  2V1N A;  3TED A;  2P81 A;  2V26 A;  3PM1 A;  4IJA A;  3TP0 A;  4BYY A;  4XNF A;  4HX8 A;  2VE9 A;  1Z9C A;  2QBY A;  3CD6 I;  1P6R A;  4F93 B;  1LNW A;  5DS9 A;  1FY7 A;  1Y8R B;  5IY5 H;  3ZPL A;  1NK3 P;  2XGD A;  2V1D A;  2GIZ A;  5FKN A;  2YS9 A;  5LGN A;  2DJN A;  2HDD A;  2DLL A;  3DPL C;  1WGX A;  2E19 A;  1ETQ A;  2Y69 H;  2YR2 A;  4ANJ A;  1HQC A;  3FXQ A;  3BR6 A;  3ABL H;  1PUF B;  2VQG A;  3OY9 A;  1D8K A;  4XL9 A;  2JA2 A;  2Z16 A;  3RZD J;  2E35 A;  5K5Q A;  1WJF A;  2R5Y B;  2JSC A;  3BG5 A;  3LL7 A;  3CCL I;  2XIG A;  2IGN A;  3SJM A;  2NVQ J;  2E1M B;  4XLH A;  2O8X A;  3DV8 A;  3ROU A;  3PQK A;  1OKR A;  2DA2 A;  3BC8 A;  2DT5 A;  3MQ0 A;  5CJ9 A;  5FRM A;  1MGT A;  2DTZ A;  2X6O A;  4Q48 A;  1J2X A;  4PFP A;  3X2Q H;  4JOM A;  1B1B A;  3H3V K;  5DUK A;  2UWM A;  2OQG A;  2RRE A;  3GZN B;  2OD5 A;  4LG0 A;  1RUN A;  2VPL A;  4G6Q A;  4UUV A;  3DKW A;  2CO5 A;  3HRM A;  3K4J A;  4N0B A;  5FKM A;  2CUE A;  1GDT A;  5GP9 A;  5TIS C;  1D1B A;  3KZY A;  1YLF A;  4UB8 C;  4E4H A;  4DNC A;  2M0M A;  3IRQ A;  2CW7 A;  1OJL A;  3BR1 A;  5E3M A;  3Q9V A;  4WK8 F;  2LTP A;  2XRN A;  1QHH D;  1BBY A;  4ZDL A;  5H6Q A;  4A69 C;  2Q8K A;  2LSO A;  1R00 A;  5B1A H;  4WCG A;  1TWF J;  1X2N A;  2CUJ A;  2L4M A;  5FGM A;  2IS1 A;  2GBY A;  1ETX A;  1O7F A;  1LE8 B;  5LFA A;  1IXR C;  3V8L A;  4EAT A;  2VBW A;  1AHD P;  4IOC F;  2K40 A;  1X3W B;  4IRI A;  2QBY B;  1F4K A;  3I59 A;  5IP9 J;  2R7U A;  3K69 A;  4FET A;  2BVL A;  2HDC A;  1FOW A;  1U2W A;  4BH9 A;  5IOY A;  1SD5 A;  3WU2 C;  4PUS A;  5DCF A;  1T56 A;  1JUM A;  3MCZ A;  2LDU A;  3AL0 C;  3HIF A;  1S9H A;  1LEA A;  1LJ9 A;  4KIS A;  4GDF A;  1R22 A;  2KDO A;  1YJ9 I;  3GEZ A;  5L3B A;  4E7S A;  3O8G A;  4YFK F;  3H0D A;  4F92 B;  3ZMD A;  3JW4 A;  3K4M A;  4EGY A;  3I0T A;  3H3U A;  4UXN A;  1YO5 C;  4UUS B;  2IW5 A;  2EFW A;  2UXX A;  3LSR A;  4OOI A;  2AHQ A;  3HEF A;  4X0G A;  1Z6T A;  2KRC A;  1XGN A;  5DEQ A;  4EJV A;  2DA1 A;  3L09 A;  4NBQ A;  3MD2 A;  5EYR A;  3OYC A;  1B72 A;  2Z9O A;  2MLK A;  5C4J J;  2M45 A;  4RDU A;  4WX9 A;  4U7B A;  1X58 A;  1OCC H;  4BS9 A;  5GAH J;  3M7G A;  2DMT A;  2HI3 A;  1Y6I A;  4DYQ A;  2A05 A;  4U87 A;  5E1X A;  4LG0 B;  3I54 A;  1MBG A;  1HDD C;  2Y48 A;  3GO5 A;  1GXP A;  4G6D A;  2J5P A;  2M4K A;  1FBS A;  1H9G A;  5E79 C;  5H20 A;  5E1Z B;  2BXZ A;  5DM6 F;  4IHS A;  4BBS J;  1S6L A;  2DMP A;  2L7F P;  3HB9 A;  3M3Y J;  5EZG A;  2G7U A;  1G6N A;  4OIP F;  2L54 A;  2XGE A;  4E7Z A;  2D5V A;  2OTJ I;  2HGC A;  4X6A J;  1J59 A;  2NVU B;  2GZW A;  3PO2 J;  4K2E A;  1BJA A;  1K7A A;  3I4N J;  1REP C;  5FJ8 J;  3QOE A;  2GM4 A;  1VND A;  1D0Y A;  5H2F C;  3CMA I;  4D9J A;  3FXL A;  3H5A A;  4KT5 C;  4P5O A;  2D45 A;  1W4M A;  4QPQ A;  1XC5 A;  5E20 A;  1N25 A;  1KQ8 A;  5EG0 A;  1UJ8 A;  2OZU A;  4A5N A;  2PX9 A;  4AYB A;  3FK6 A;  4KIF A;  4V19 K;  2JUG A;  4M9S A;  4J01 A;  1WWX A;  3O2P E;  5IP6 A;  3P5J A;  1BOA A;  3GCM A;  3C18 A;  1S7O A;  2EIJ H;  3ZP5 A;  1I27 A;  2FOK A;  4CCO A;  4C2M J;  3I53 A;  3CUQ C;  2O03 A;  3I64 A;  1SD6 A;  2ESN A;  2ZJP F;  2NNY A;  2ID6 A;  2R7Q A;  4LK1 F;  5L3C A;  1P4W A;  2V6E A;  1K83 J;  4P9U A;  1LFB A;  3E5X A;  2V9K A;  3PUF A;  3SQN A;  4C3I J;  4BY1 J;  4L18 B;  5ED4 A;  1Z6R A;  2VC1 A;  2PMH A;  2XV4 S;  1QRY A;  2Z5U A;  2EPF A;  1VQK I;  2WV0 A;  2VAS A;  1A6Q A;  3KEO A;  3JR9 A;  1WVR A;  1MJB A;  3F3X A;  2GLO A;  4W97 A;  4KA4 A;  3RTR A;  3WHC A;  1FOK A;  4UVC A;  4FIS A;  2OJE D;  2W85 A;  1ZG5 A;  1IUY A;  4WXD A;  1R1V A;  2XB5 A;  3ABU A;  2BOL A;  1BJZ A;  2PJR A;  3CF2 A;  3WOD F;  3DLL F;  2R7W A;  3H36 A;  1TW3 A;  3VSL A;  2JVH A;  1G3T A;  1S7A A;  4MIM A;  1E2X A;  2L7K A;  3CJR B;  3M4O J;  1ETV A;  1X2M A;  2HOS A;  1SD7 A;  2KIF A;  2DA3 A;  2WY8 Q;  4FE7 A;  1SAX A;  4BY7 J;  1EH8 A;  3EYI A;  3BLY A;  4R8H A;  4B8X A;  1RIO H;  3S17 J;  4I09 A;  4LLG F;  2B7E A;  2W4S A;  3B6A A;  4HW0 A;  5EG0 B;  4HF0 A;  2JN6 A;  1I39 A;  2RV8 A;  2JQ7 A;  4L5I A;  3GTO J;  2OC6 A;  3FBN B;  2WAF A;  2W57 A;  2K3F A;  1YI2 I;  2TCT A;  3WGG A;  5C3E J;  1WKM A;  1R5H A;  1N78 A;  2HZD A;  2LF8 A;  5EJC A;  5FD5 A;  1FYL A;  3M8J A;  4E7I A;  3EUH C;  2WAD A;  3PSI A;  2RQQ A;  4E7L A;  5CVU A;  5JVT A;  1VF9 A;  4BE1 A;  1FYK A;  1IG7 A;  2R7O A;  2WAQ N;  1VQ7 I;  2O61 A;  2I5U A;  2LD5 A;  3A1Y A;  3RI4 A;  3C7J A;  5F64 A;  4YG2 F;  4RB3 C;  4Y4R A;  3ZGK A;  1YRN B;  4XON A;  3S16 J;  1JI8 A;  4UV8 A;  4IL6 C;  1ONV A;  3OWT A;  3SZP A;  1ODD A;  5K1Y A;  4RB0 A;  1A35 A;  2KIS A;  4A3D J;  4DBR A;  2XRO A;  1Z67 A;  3FK7 A;  1HCR A;  4L0Y B;  2DW4 A;  4LD5 A;  5HS7 A;  3F8B A;  1SFK A;  3CCJ I;  3E7L A;  2QEX I;  3HRT A;  4LMY A;  4A3M J;  2OZ6 A;  2VC0 A;  5DV5 A;  2O3F A;  1HKT A;  3GTM J;  4Y13 A;  4LIT A;  4D7M A;  3FKI J;  3H9Q A;  1C0W A;  2ICW G;  1ZAO A;  4II3 A;  2H09 A;  3GFM A;  3EQL F;  2FD5 A;  2VT3 A;  2K02 A;  3C2B A;  2L9R A;  2RNG A;  3QYF A;  2FA5 A;  3QU6 A;  2KDZ A;  3ZMV A;  1OMI A;  4DGW B;  3CCM I;  4S04 A;  4A93 J;  5B3S H;  1YOV B;  1KA8 A;  1Q1V A;  2ZCW A;  1BC7 C;  3LSJ A;  1RPW A;  2PQ8 A;  5CYV A;  4BJT A;  5EEG A;  3K0L A;  5B66 C;  2CFO A;  2LYC A;  3MZH A;  5TJJ A;  5FKO A;  1P4A A;  4HV5 A;  4BBR J;  2XAQ A;  4PZJ A;  4XOR A;  3H92 A;  3E6D A;  2K9L A;  2MW8 A;  3CCE I;  3WGH A;  2LRE A;  3W6K B;  4A3I J;  2LNB A;  4MTD A;  2LP0 A;  4M3F A;  2VJ5 A;  4XM3 A;  2PMZ A;  2M4G A;  1ZRC A;  3DPU A;  1XSD A;  3TL4 X;  2GA2 A;  3G1L A;  1QU3 A;  2CS3 A;  1TLH B;  1AOY A;  1OFC X;  2Z3Y A;  2A69 F;  2DU9 A;  2R7R A;  4F52 A;  3V4G A;  1SC7 A;  4CA0 A;  2DAO A;  1TQP A;  3OIQ A;  2FEZ A;  4NC6 A;  4Y52 J;  4M73 A;  2IRF G;  2RAE A;  5CKT A;  4QSH A;  2V6C A;  1BIB A;  2RQP A;  2JRM A;  5LGU A;  2F2E A;  1JT0 A;  3CTA A;  5FKL A;  3S15 J;  3J7Y J;  1E3H A;  4MTE A;  2PBI A;  1ZGJ A;  2R7T A;  1O4X A;  1IO2 A;  4G9Y A;  2D1H A;  3VEP A;  3IP4 B;  4QIW N;  4HX7 A;  2QQB A;  2FBH A;  3RIR A;  4ZJZ A;  1T95 A;  4CCJ A;  1T39 A;  2ZJQ F;  4F3Q A;  4H4K C;  4N9I A;  3K10 A;  1LPQ A;  3S3O A;  3PSF A;  1ZN2 A;  3ASN H;  4AIJ A;  1SMY F;  1XGO A;  2ZXJ A;  2M5W A;  4BQN A;  5M5Y J;  2VT2 A;  2BY1 A;  4HQM A;  3TMO A;  2CV2 A;  1D5V A;  2JMW A;  5AIP A;  4PJ0 C;  2M9H A;  3WTV C;  1HOM A;  4RAF A;  2YX4 A;  4GYG A;  5AIQ A;  3L2Q A;  2HXO A;  3TO7 A;  1O7L A;  1FTZ A;  2CQN A;  2ISZ A;  4CHU A;  4EJO A;  1O3T A;  4M6Y A;  4XRS G;  5C44 J;  5EEA A;  1EV7 A;  1WRJ A;  4B48 A;  2CW0 F;  2BV6 A;  2BY2 A;  3LSI A;  2L4A A;  1BL0 A;  1I1S A;  1FP1 D;  1JTY A;  2XF6 A;  3FXR A;  2L9N A;  1W36 D;  2FQ4 A;  4F55 A;  4HDU A;  4KNY A;  1U6G A;  4IX7 A;  2F5D A;  1YX5 A;  3GFI A;  1IRZ A;  2IS4 A;  1R4N B;  1UST A;  2MD0 A;  3WTS C;  3DP7 A;  3QWL A;  3ELK A;  4CZZ A;  1YIT I;  4CZC A;  3LAJ A;  3CCY A;  5F1J A;  1WJE A;  1LDD A;  1XDS A;  1YQA A;  2ZME B;  2MC3 A;  2X0L A;  3RQI A;  4BKX A;  5EGO A;  3CZ6 A;  1MDM A;  3KZI C;  4KJZ A;  4X1E A;  4KIT B;  2CWE A;  4QPO A;  2D2W A;  2KRF A;  2W48 A;  2QCO A;  5IP7 J;  5FLX Z;  3DWL E;  2O5R A;  2R7V A;  3KLN A;  2FU4 A;  1W5T A;  2HYG D;  2EJR A;  3CP2 A;  2P5K A;  1I5Z A;  3CO7 C;  3ASO H;  1ACI A;  4AYB N;  2BHY A;  2DYS H;  5JLW A;  3MFK A;  2LLK A;  2VIX A;  3JRB A;  1Z7L A;  2IS2 A;  1IN6 A;  3KET A;  3HSE A;  1J0R A;  1VQO I;  3QRF F;  2JK3 A;  3GZ5 A;  1RES A;  2MBF A;  4IHV A;  2CMP A;  1W7P A;  2COB A;  2H8W A;  4XMY A;  3F0C A;  4PJM A;  2OQR A;  1TNS A;  2ZFW A;  3FF5 A;  3H3Z A;  4LIU A;  4IHT A;  1NH3 A;  4U88 A;  3Q9S A;  4A0Z A;  4UB6 C;  1I3A A;  2V7F A;  2BXY A;  2WC2 A;  2Z33 A;  1FLI A;  1UB9 A;  4MHG A;  1LFP A;  3OS1 A;  1H88 C;  3A0H C;  2YSR A;  4IZZ A;  2LF7 A;  1GT0 C;  1KON A;  4P96 A;  1FBU A;  2MGQ A;  4HX4 A;  1PVE A;  3NWS A;  1FSH A;  3FXJ A;  2H6C A;  4JYK A;  3F6O A;  2CGP A;  2XGX A;  3TKY A;  4UVA A;  2ISY A;  2L3D A;  3FHN A;  3IC7 A;  3OIO A;  1WH5 A;  5E3L A;  3GBG A;  3ZR8 X;  2HQN A;  2XAG A;  2A6E F;  5HS9 A;  1KYZ A;  3IH3 A;  1RUO A;  1U5T C;  1FNN A;  1OYI A;  2HFH A;  4G8X A;  4YFX F;  4C9Y A;  2ADU A;  2LY2 A;  2DDB A;  3KYL A;  1YW8 A;  3MKY B;  2VJJ A;  2R5Y A;  1POG A;  4DZJ A;  3L1P A;  1R36 A;  5EGO B;  3QYE A;  2OA4 A;  5LHI A;  1JHH A;  2XKP A;  4AWX B;  1HC8 A;  5ERI A;  1R1U A;  2EZL A;  1WFX A;  4YIR X;  1RKT A;  1OPC A;  2W24 A;  2ZBK A;  2VKD A;  4UNO A;  1W36 C;  3J7A Y;  4LB5 A;  1JKR C;  1U9O A;  3EDP A;  2R5Z A;  1K4T A;  2R7S A;  4ZTJ A;  1G8X A;  3MVP A;  4PGH A;  2VKE A;  2DOE A;  4FAS D;  3KIO A;  3A4C A;  2CUZ A;  2F4O B;  3LSM A;  1WJ5 A;  2A6H F;  5E1W A;  4I02 A;  3S14 J;  3K4N A;  1T38 A;  2NXN B;  4PSW A;  1FYM A;  1SVL A;  1LEB A;  3H5R A;  4PGG A;  2O6G E;  1ZH5 A;  1XGS A;  2UUZ A;  4FCY A;  1WCM J;  3HOZ J;  3C2G A;  2OU2 A;  4BDZ A;  3D5L A;  2XB0 X;  5L3F A;  1JE8 A;  1EH7 A;  2LKP A;  3SDB A;  1Z05 A;  3TQN A;  1LE8 A;  2XUB A;  1LDK B;  5J1U A;  3GTK J;  3F72 A;  3RPQ A;  3KP5 A;  2DJI A;  1LQ1 A;  1VQ5 I;  2DDA A;  3BPV A;  3LQR A;  3RPU A;  4BXX J;  1DGW Y;  2X4H A;  4DBQ A;  3LMM A;  3JCU C;  4EQQ A;  5CVI A;  5LD2 C;  3RJP A;  5TRD A;  4IQ4 A;  1LB2 A;  4BE0 A;  5F27 A;  1QBJ A;  2NS8 A;  1WZ2 A;  3G1M A;  4XKW A;  5DDG A;  3F8C A;  2A61 A;  1B8I A;  2GQQ A;  1Z77 A;  5E8G A;  4XLP F;  4P1W A;  1T08 B;  1SD4 A;  4HA8 A;  4KN4 X;  3T1B A;  3SZG A;  3V7S A;  3VOE A;  2XPU A;  3HZJ A;  4XSX F;  2OPT A;  4UUS A;  5D4S A;  4I99 C;  1P7J A;  1B59 A;  4OWR B;  2X1C A;  1ZLK A;  1ZQ3 P;  1QGP A;  1MMA A;  4CH7 A;  4Z2Y A;  4KN7 X;  4XOP A;  3FHZ A;  1T0F A;  3EYY A;  5KAI C;  2DI3 A;  2KQR A;  4GXO A;  5F6F A;  2V1U A;  2MH9 A;  5ICC A;  1RC9 A;  2R5Z B;  3IAS 2;  3MKZ A;  2QSG X;  1RZ4 A;  2H94 A;  3TDZ C;  4HOB A;  1IDZ A;  3K4L A;  2PMZ N;  5D5U B;  3TDU C;  5IYB J;  2QEN A;  3NEU A;  3Q0W A;  2EFP A;  3MWM A;  4AM3 A;  3K6G A;  2K3P A;  4EJT A;  2R3S A;  1USS A;  2F4M B;  2VL8 A;  2IA0 A;  2PFB A;  3I58 A;  1W0U A;  5HLT A;  3C3W A;  3U21 A;  4KYW A;  2ACJ A;  4C30 A;  4A5M A;  1Y8Q B;  3VOD A;  4ZDO A;  4ENK A;  1U8B A;  3AG1 H;  3WHB A;  2BEO A;  2DT6 A;  4IRG A;  2IJL A;  3HHH A;  1MBK A;  3HYI A;  4KIG A;  3RKX A;  1ENH A;  3MKW B;  3K9T A;  3VB2 A;  3CQZ J;  3KYD B;  3PO3 J;  1F5T A;  5J8F A;  2GOM A;  1FZP B;  2K86 A;  3FBI B;  3W2W A;  1K61 A;  5AON A;  2BW3 A;  1XD7 A;  4HNT A;  4PJL A;  3QQA A;  4ETS A;  2VLA A;  1A6I A;  4LLL A;  2H1K A;  4AU7 A;  3R4K A;  3OSG A;  5LRS A;  2E5N A;  4A2U A;  1QHG A;  2ESH A;  3FIS A;  5E8I A;  4RS8 A;  2OCC H;  5FLV A;  1W5C C;  3OV8 A;  1BOB A;  2XC7 A;  1FMW A;  3BQY A;  1B8I B;  5A2Q K;  3LA3 A;  1V3F A;  2O9L A;  4YIF A;  3QAH A;  1MND A;  3HSR A;  5J47 A;  4P9F A;  3D5R C;  2VOO A;  1QPM A;  1GVD A;  4RGU A;  3BTI A;  1ZR2 A;  4CYD A;  2ME0 A;  3OOU A;  4B44 A;  2ZKZ A;  3CLO A;  4M74 A;  5IOZ A;  5BMZ A;  5DYM A;  2JPB A;  2STT A;  1Z7U A;  5LRR A;  2J5O A;  2OTL I;  1JTX A;  2ZJ2 A;  1RI7 A;  2KZG A;  5GAG J;  1HW2 A;  1ERD A;  2P5V A;  1JHF A;  3WTX C;  4RB1 A;  1QVU A;  1UAA A;  2V9V A;  3KP6 A;  4D5C A;  4L0Z B;  1GXQ A;  3O3K A;  4F7Z A;  4G7H F;  1KU7 A;  5IT3 A;  3F23 A;  1RKW A;  2EH3 A;  2K85 A;  2L2O A;  2HXI A;  3A0B C;  2JA5 J;  3GTL J;  4A3L J;  4N4O B;  2VB6 A;  1UHM A;  5FKK A;  4HDV A;  1SAU A;  4OIO F;  1FP2 A;  3SHF A;  1HBX G;  1TW2 A;  5B5E C;  1FIP A;  1G3W A;  4DYC A;  1QA6 A;  1NG7 A;  2P7C B;  4II2 A;  5EF6 A;  3NAU A;  5J8C A;  4CCN A;  3CJT B;  4MEY F;  1W7P D;  4DJA A;  1BA5 A;  2JRT A;  4OMZ A;  2FRH A;  3ERM A;  1YG2 A;  2MAB A;  2RN7 A;  3LSP A;  4XKC A;  2CQK A;  3EUA A;  3DU5 A;  1B9N A;  3T8T A;  2JWT A;  2MLG A;  1STZ A;  3BR3 A;  5K7Z A;  3BOQ A;  4MFD A;  4EM1 A;  2BW3 B;  5DD8 A;  2M3A A;  6PAX A;  3HPH A;  2M30 A;  1VQN I;  3DTI A;  2VN2 A;  4XLF A;  1UHW A;  4LG3 A;  4XN3 A;  2ZXW H;  4HST A;  3GWZ A;  2DCE A;  3S1Q J;  2FUG 2;  1Y0U A;  1JT6 A;  3PQJ A;  2DBB A;  2VXZ A;  2W00 A;  3RYR A;  1YJW I;  5F0H A;  1M1E B;  4G12 A;  1MIJ A;  1KQ0 A;  3L2W A;  1HXD A;  4PSX A;  2OV7 A;  2F5E A;  4EGZ A;  4L9N A;  3DKX A;  3OS0 A;  1HLV A;  1ETO A;  3JTH A;  1YRN A;  3E6M A;  1K6Y A;  3U1D A;  3QPH A;  4C2U A;  4MFE A;  4ZYG A;  4AC0 A;  2X6W A;  4A3C J;  3WU1 B;  4ON0 A;  1T33 A;  3JTG A;  2CQ7 A;  5HOO A;  2O8K A;  4HEA 2;  4RAG A;  1SFO J;  2PEX A;  1ZR4 A;  4ENM A;  3DLA A;  2WTE A;  4A6E A;  3O8H A;  2R7Z J;  3CCR I;  2O0Y A;  3CCQ I;  2E2H J;  2OBP A;  1IN8 A;  1VQ4 I;  4JX6 A;  1NHA A;  5J40 A;  2X9D A;  4MQ9 F;  2FJ1 A;  3PJR A;  3QOD A;  5M3M J;  3IL2 A;  4DYR A;  3RDI A;  2BHZ A;  3RCO A;  1B4A A;  1BR2 A;  3BPX A;  2F5C A;  2VI6 A;  3KLO A;  3F6V A;  2ELH A;  1NG6 A;  1MJA A;  2F6C A;  2LY9 A;  4YEL A;  1CQT A;  3HJE A;  4HBL A;  2XHK A;  1J5Y A;  2E2I J;  2VOP A;  4N9H A;  1UMQ A;  1FPQ A;  4AVZ A;  1BI3 A;  1BR1 A;  3BJO A;  2DQR A;  2IBD A;  3ZN0 A;  4WXH A;  5IT9 K;  1AU7 A;  3BZ6 A;  3HOY J;  2CU7 A;  1XPX A;  4DQ2 A;  1RET A;  2CQQ A;  3K2A A;  1XMK A;  2DN0 A;  4MO7 A;  2IS6 A;  1LUJ B;  5GAE J;  3ZN1 A;  1TZL A;  3GF2 A;  4HNU A;  4HF2 A;  2KZV A;  1F1Z A;  1XCB A;  2V79 A;  5F08 A;  1HSJ A;  2M1B A;  2RGV A;  1O57 A;  5FLX K;  4B3A A;  5A2Q Z;  3JSP A;  3QPT A;  3WU0 A;  1U78 A;  4BEH B;  2F4I A;  3CDI A;  2GIV A;  2VUM J;  3HUG B;  3CMM A;  3F8N A;  5HNH A;  1BM9 A;  2WY7 Q;  2ETH A;  2FQ3 A;  3BT9 A;  2R0Q C;  5HOD A;  3QPL A;  4ZC3 A;  4HV6 A;  4CO8 A;  2L9V A;  4RGS A;  1T98 A;  3EPZ A;  4EV0 A;  2COM A;  1IN4 A;  3LSK A;  3QU3 A;  3A02 A;  5TGT A;  3VWB A;  1J7K A;  1Z0X A;  3GLX A;  1FMV A;  3ZQH A;  2R7D A;  4B09 A;  1FBQ A;  4BAC A;  3HXL A;  2ZC2 A;  2LKS A;  1LKX A;  4KMU X;  1W1W E;  4M6X A;  1KZH A;  1ON2 A;  1Y39 A;  1R9T J;  4L9T A;  1K78 A;  2PJP A;  1FX7 A;  1XTA A;  2CH0 A;  1RR8 C;  2MA3 A;  2LY1 A;  3WTT C;  4PFO A;  3HBL A;  4UHT A;  1JKP C;  4CYC A;  3LAP A;  3I4M J;  3ZMT A;  3OOP A;  3DEU A;  5FRO A;  1E3P A;  3E3V A;  3FXO A;  2XKO A;  2ID3 A;  5E18 F;  1U3E M;  3KP2 A;  3DBL B;  4LLN A;  3ZCO A;  1IRF A;  2E1M C;  2L9S A;  1IDY A;  3FWE A;  2XSJ C;  3WTZ A;  2V9P A;  2E60 A;  4CCK A;  2QQ8 A;  2DFI A;  2GA1 A;  3ZQ7 A;  3CCU I;  2KRH A;  1UG2 A;  3OYJ A;  4RGX A;  1VQP I;  3DBR B;  2XPW A;  4QWQ A;  2DMQ A;  2E36 A;  2K5C A;  1DQU A;  2IA1 A;  3K1M A;  5D8K B;  3L2V A;  3KE2 A;  2M87 A;  3BQZ A;  5CQG A;  1X3U A;  1BW5 A;  2NVX J;  4Y15 A;  2AQF A;  1UG0 A;  2KJC A;  3G73 A;  4OAY A;  2VKH A;  1QZY A;  5LBQ A;  2B9S A;  2IGM A;  2X6Y A;  3MN2 A;  1XB4 A;  1H89 C;  2VXD A;  2ZME A;  3HPG A;  3ISP A;  4GFB A;  3TO6 A;  1PP7 U;  4CGZ A;  3W3C A;  3I71 A;  3J81 K;  4C2T A;  4BUP A;  2QZ8 A;  3VYR B;  4E7K A;  2EV0 A;  1TWC J;  4NDL A;  3K70 D;  2VKV A;  3CME I;  3K4B A;  1ETW A;  2X1D A;  2STW A;  4HNV A;  3D1N I;  3R0J A;  4B47 A;  3CC4 I;  1R5I D;  4A3F J;  2G9W A;  3I3L A;  1IV8 A;  4FTH A;  3BG6 A;  4H0E A;  1D1A A;  1A31 A;  1OCR H;  1K79 A;  3BG7 A;  2HDW A;  5K5R A;  4OIR F;  1G3Y A;  4DZP A;  3OYD A;  3DTK A;  2CRG A;  4CCM A;  5BPI A;  1K4S A;  3OR2 C;  2Y30 A;  1DUX C;  4B43 A;  2NOJ B;  4WXC A;  2HTJ A;  1MNE A;  3FXK A;  2MFZ A;  4M3B A;  1TT5 B;  3ECH A;  1LDJ A;  4ZDP A;  3OYI A;  2FSW A;  1FT9 A;  1JUS A;  1LFU P;  3U2R A;  4GCV A;  1DPR A;  2F5V A;  2CW8 A;  3M1C A;  5HLG A;  3LSH A;  3FX3 A;  2FOW A;  1EA3 A;  4UV9 A;  2DQL A;  2HNH A;  3Q5F A;  3OL4 A;  1K6O A;  1ZRE A;  3H9G A;  2UXN A;  4MGR A;  1K78 B;  2JUC A;  1QZZ A;  4L5J A;  2HVQ A;  2CQX A;  1Z91 A;  5JHU A;  1MBJ A;  4CYC B;  1X19 A;  3DBH B;  1QQI A;  2YPR A;  4RAZ A;  2RNJ A;  2DPU A;  3H35 A;  5HLH A;  3AAF A;  1WPK A;  2ECB A;  1WI9 A;  1IXS B;  1SEU A;  3AL0 B;  1E17 A;  1X1B A;  2DT7 B;  3MEX A;  4G6T B;  4XRS A;  1XCV A;  3CUQ A;  5IYD J;  3H5N A;  4LGW A;  3RQ4 A;  1U0J A;  2DO7 A;  1T0F C;  3GTG J;  4I0B A;  5L3D A;  4HF1 A;  3H1C A;  4XKV A;  5C4X J;  5D8L B;  1MNM C;  4Q47 A;  3H0G J;  5IT9 Z;  2LFB A;  4DIQ A;  1YTY A;  2BY0 A;  5LLQ A;  1OCZ H;  3GX4 X;  1TWA J;  3R0A A;  1GVJ A;  2AXL A;  1TT0 A;  4M3E A;  2HKX A;  1OYW A;  3LSG A;  1MSE C;  3N05 A;  2M8E A;  2WA0 A;  1Y0N A;  2P6S A;  2VBZ A;  3PNY A;  2VE8 A;  2QA4 I;  1JUP A;  2DMN A;  4LK0 F;  5FLM J;  4KT6 A;  4QLC U;  2XAH A;  3BR0 A;  4AD9 A;  2WBM A;  3QPS A;  3G1O A;  2L7M P;  3UR3 C;  2IP2 A;  4J00 A;  4F91 B;  2NAZ A;  3LQQ A;  4GO1 A;  1MJ9 A;  4FHT A;  4J19 A;  5D6F A;  2R4G A;  3LWF A;  3OYF A;  3HDD A;  2ZFU A;  2Y9Z A;  1SFE A;  1X3Z B;  1Y56 A;  3UKG A;  2PLY A;  1UHS A;  4AIH A;  3DXJ F;  3LOC A;  2W25 A;  3IWZ A;  3TOB A;  3K70 C;  3HOV J;  1G3S A;  2ME6 A;  2HOT A;  1AWC A;  1OR7 A;  3BZC A;  5J4Y A;  3FMS A;  1WI3 A;  2QUF A;  3HC7 A;  4BAY A;  5ICG A;  3DTE A;  3R61 A;  3EUK L;  2QKL B;  2VPR A;  3RYP A;  5E17 F;  2P4W A;  4PK4 A;  3ZQG A;  5JHF A;  4BDY A;  4RM3 A;  4PJN A;  1MBH A;  3JRG A;  1FJL A;  3EUH A;  3OMY A;  2DYR H;  2LG4 A;  1XMX A;  3CUQ B;  4R1H A;  2QQA A;  5J6X A;  4Y33 A;  1P9Q C;  5KHD A;  2KL4 A;  4U0W A;  4ZH4 F;  5BOX A;  1BI2 A;  3G2B A;  4ZYE A;  3I56 I;  3CLQ A;  3HHG A;  3IRR A;  4RM2 A;  2ZXI A;  1IF1 A;  1EJ9 A;  4PDK A;  3RSN A;  2CSO A;  2LRD A;  4V2G A;  5FB2 A;  4L9V A;  5JVG F;  2L5Q A;  2W82 A;  1E3O C;  5JLX A;  1I3Q J;  1XN7 A;  5DCM A;  5B1B H;  3J81 Z;  2BGC A;  3L2R A;  1J9I A;  1TL8 A;  1SVM A;  4L5E A;  3KP4 A;  4ASN A;  4GRI A;  5GPA A;  1KU2 A;  1RNL A;  3REO A;  2OAZ A;  2NVT J;  4GGG A;  3S3N A;  2EZK A;  1S8N A;  1ZKG A;  4FQG A;  2DA5 A;  2E1O A;  2CJJ A;  2K27 A;  3RKY A;  2LC2 A;  2EZI A;  2LH9 A;  5CPR B;  4XBF A;  5L3G A;  3CDH A;  2ZJR F;  2LOO A;  4D0P A;  2DXI A;  4I98 B;  2KJB A;  5KCM A;  3FZV A;  1XDU A;  2VOD A;  2LKX A;  3S2H J;  5ILV A;  2VJ4 A;  1W0T A;  3BCB A;  2KFD A;  4IXA A;  1A04 A;  1X1D A;  2KHM A;  3ZMU A;  3IKT A;  1R58 A;  2EIK H;  1HF0 A;  4CCL A;  3G6E I;  4KFC A;  4JX5 A;  3GFL A;  4ZZD A;  2DOA A;  2Y0S A;  4KMF A;  2HS5 A;  1IAW A;  2GXA A;  2EQR A;  3ERE D;  2FBI A;  3KEY A;  4XID A;  4JK1 X;  3PFI A;  3TOA A;  3CO6 C;  2G0E A;  1F36 A;  2VQL A;  3TP3 A;  1TC3 C;  1ITY A;  3DEW A;  3SXY A;  4A0Y A;  3VSK A;  5LGT A;  1EF4 A;  5K7H A;  2W1O A;  3HOT A;  3L00 A;  1LVA A;  2M7B A;  2KIU A;  4ABZ A;  4IHY A;  3QYB A;  3S3M A;  3E5U A;  3CDL A;  4XLN F;  3BTL A;  4XRF A;  3S8P A;  1DDN A;  1OCP A;  4I01 A;  4XN0 A;  3QP6 A;  2VJI A;  2MC4 A;  3GXO A;  1MZB A;  2H27 A;  1H8A C;  4IF4 A;  5F0C A;  3OS2 A;  2IXS A;  4C3J J;  1B9M A;  4OMY A;  1BIA A;  3GTJ J;  1WJB A;  2DK5 A;  1X4O A;  2PI0 A;  2KP6 A;  4FX4 A;  4I0A A;  2HOA A;  2ZXH A;  5CVR A;  3VFZ A;  5ICF A;  2DFE A;  5DM7 F;  1VQ6 I;  1V4R A;  3E0J B;  5DCM B;  5JR3 A;  2Y2Z A;  5D4R A;  4HQE A;  1FOY A;  2DOF A;  3SDG A;  3LFK A;  2JA8 J;  3ONQ A;  2E5Z A;  3BJA A;  3OYL A;  2KIM A;  2AXT C;  3FIW A;  2DFH A;  3OYB A;  1T8I A;  3A2K A;  3N4M A;  3G3Z A;  4HLX A;  2K7L A;  3IHU A;  3AG4 H;  4O5V A;  3ZQQ A;  3HTS B;  4D1Q A;  1S5L C;  2WB1 A;  3IV5 A;  1KQ9 A;  3E97 A;  3NRV A;  3VDX A;  3BCA A;  2QSF X;  1XS9 A;  2OCE A;  1WJD A;  2JPC A;  2B0L A;  2IVM A;  4N4N B;  1X1C A;  4BHB A;  1VTN C;  2K9M A;  1Y1V J;  3M1E A;  1FIA A;  5HLI A;  1UCR A;  2X48 A;  3S1N J;  2L01 A;  1D0Z A;  3GTP J;  1ETK A;  2FE3 A;  3OIP A;  2Q1Z B;  1GV5 A;  1R5G A;  1JJ8 C;  4C3H J;  1JKQ C;  2O7O A;  1JGS A;  4HG2 A;  2RDP A;  2HQR A;  1WQ2 A;  2XGC A;  1YW9 A;  3OYE A;  1ULY A;  3MZ8 A;  4LFU A;  5KK1 A;  3VYU B;  3HKZ A;  4CXF A;  3WTU C;  1ON1 A;  4JBA A;  4LB6 B;  4FT8 A;  2EFO A;  3LNQ A;  2HR3 A;  2I10 A;  5IPA A;  2TRT A;  1UFM A;  3TW6 A;  1JGG A;  1NK2 P;  1QO0 D;  1G59 A;  3LFU A;  4O3M A;  2X51 A;  4M9Z A;  4XKB A;  4E7H A;  3FXM A;  4P55 A;  1VZ0 A;  3CC2 I;  3FDY A;  4UY8 I;  2Y31 A;  4A0X A;  2L0K A;  1IUF A;  1IN7 A;  2NOG A;  1MW7 A;  4JX4 A;  3CC7 I;  2G7H A;  4BU2 A;  1WJC A;  4XOT A;  2K4B A;  9ANT A;  4Z6Y A;  1IJW C;  1MKM A;  3JRD A;  2K9S A;  2KT0 A;  1ZRD A;  2EA4 A;  3KP7 A;  3JRI A;  1GV2 A;  1QZE A;  2EZH A;  1CF7 A;  4MLO A;  1V55 H;  5HVQ C;  3WG7 H;  1U8R A;  4HPQ A;  1YS7 A;  2EIM H;  4RB2 C;  1HW5 A;  4IEJ A;  1E0E A;  1Z3X A;  5CVJ A;  4E70 A;  3OYG A;  3IKV A;  1MMS A;  1YHQ I;  3DEE A;  3PNT A;  4W1U A;  2FML A;  2IA2 A;  3HOW J;  1KU3 A;  5DUI A;  3ABK H;  4CIC A;  1U9N A;  1FWZ A;  3BTJ A;  2Y75 A;  4PJJ A;  1I6X A;  4M72 A;  1MH4 A;  1BW6 A;  2XVC A;  5FD6 A;  3A01 A;  5M5W J;  3CCV I;  3VYS B;  1HW1 A;  1DPU A;  1BI0 A;  5ILU A;  1YE9 A;  3WGI A;  1SFU A;  4BXU A;  3ABT A;  3O6B B;  1FEX A;  2C6Y A;  2Q0O A;  2ZME C;  2MG4 A;  3V7R A;  2QF7 A;  2I8D A;  5LEK A;  1SVO A;  3NWT A;  3OYH A;  1U5T A;  3MAJ A;  3RZO J;  1A5J A;  4FE4 A;  2HQA A;  2HPM A;  4V2F A;  2M7A A;  1F43 A;  5KAF C;  1MBE A;  2LR8 A;  1JJ6 C;  5K7F A;  1OQY A;  2FBK A;  2W7N A;  1DP3 A;  4ZYD A;  3U1K A;  3K4C A;  5DTD A;  4CSW A;  3PIP F;  3SFZ A;  2QVO A;  3DKY A;  5GAD J;  2A6T A;  4HZF A;  3CJQ B;  1QNT A;  2KKO A;  1ZRF A;  4MQV A;  1MMD A;  1XMA A;  2IGK A;  4XR6 A;  1DGR M;  4XIC A;  1ZLJ A;  2YU9 J;  1UEL B;  4R79 A;  1JXS A;  2WAE A;  3D5S C;  3IAM 2;  3I4P A;  4EMS A;  4IOA F;  1QVT A;  3BP8 A;  2LK2 A;  2EA2 A;  1YW7 A;  4BL0 B;  1PUE E;  4Q5S F;  5GTH C;  2LBF A;  1TQI A;  3PNV A;  3QP5 A;  3T0Y A;  1RR7 A;  2FF4 A;  3AKZ A;  3JAM K;  3DU6 A;  4BEH A;  1G4D A;  3FXU A;  1CF7 B;  2IAI A;  3HUG A;  3I59 B;  3S2D J;  4YII A;  3DF8 A;  2LMD A;  1SMT A;  3BR2 A;  2NYX A;  4EM2 A;  2RVC A;  1G2H A;  2ECC A;  3G71 I;  4D7N A;  5GTI C;  5M5X J;  1WJA A;  4ESB A;  3LA2 A;  3KYC B;  1IGN A;  4KIB A;  3T8R A;  2QYO A;  1A36 A;  3CJN A;  1O3S A;  4KIC A;  1CGP A;  2CUF A;  4B4C A;  1TNT A;  3FMR A;  1GUU A;  3KCC A;  3ZOB A;  2ZO4 A;  3P9C A;  3FM3 A;  3BRO A;  5D6E A;  1BR4 A;  5EZH A;  3KPH A;  3A01 B;  5KVR A;  3IWF A;  3KP3 A;  5LHG A;  2CFX A;  3JRF A;  4A3E J;  1YS6 A;  2OF7 A;  4ZTF A;  4O6J A;  4RAY A;  3OSF A;  1OLT A;  2P6T A;  1B72 B;  1VQ9 I;  4NC8 A;  4BGD A;  4IHX A;  3HRS A;  4RGR A;  1WH7 A;  1NTC A;  4HLY A;  1MMG A;  2EIN H;  2QKM B;  2K9Q A;  1U5T B;  1XSV A;  5M3F J;  2D1V A;  3ZXS A;  3SEZ A;  2NVY J;  3GYH X;  3BY6 A;  4A3J J;  4S05 A;  3L2U A;  3IUO A;  1R6R A;  3E5Q A;  3HL2 A;  4Y3O A;  1HKS A;  2R92 J;  2BYV E;  3K1P A;  4XSZ F;  4RMN A;  4BQQ A;  1TP4 A;  1ZEL A;  1TWH J;  4I6Z A;  1D8J A;  2XAF A;  2H8R A;  1O3Q A;  2XF7 A;  1PYV A;  1RRJ A;  3GFJ A;  4CDG A;  4M9X A;  4XLE A;  3ZMZ A;  4YEJ A;  1IW7 F;  4NNJ A;  1Y1W J;  1FTT A;  1P4X A;  4MEX F;  3GME A;  2EV5 A;  1IN5 A;  3PUB A;  5H6R A;  3RPU D;  3C1D A;  2Y0S N;  1EKE A;  1ZAR A;  1XSX A;  4RBO A;  1S29 A;  2LBF B;  2YUS A;  4IHW A;  2K9N A;  2IEK A;  1HDP A;  2X85 A;  4A12 A;  3VYT B;  1OR7 C;  4BNC A;  4A3G J;  1X1A A;  3HG9 A;  2QWW A;  1P7I A;  4EM0 B;  3N97 A;  4B1R A;  3M07 A;  1QPI A;  1GHC A;  2L7Z A;  2K4J A;  1FSE A;  1BI1 A;  3K7A J;  3S2W A;  5D5V B;  1PJR A;  2XAU A;  4RLF A;  1YJN I;  4IPA A;  2IT0 A;  5D5X B;  2XDV A;  2F5F A;  3CP8 A;  3H9J A;  3HGG A;  4GYI A;  1F9N A;  5F1R A;  4BXF A;  1OCT C;  2XAS A;  3OYN A;  1ZYR F;  4I7H A;  2XRL A;  1YX3 A;  3G4S I;  4OIQ F;  1L3L A;  2JT1 A;  2R7F A;  4KUM A;  3COA C;  1WSU A;  4LJZ F;  2DMU A;  4OU0 A;  2XSD C;  5J4V A;  2E71 A;  2YX7 A;  3PFY A;  2DTR A;  1IRX A;  5K5O A;  1YYV A;  3OL3 A;  3NAR A;  2FX0 A;  2V4J C;  5JFR A;  3JRC A;  1N77 A;  2N8G A;  5D5W B;  1Z21 A;  2W84 A;  3P9I A;  2EV6 A;  3DQV C;  2QQ9 A;  1W5S A;  3JRA A;  3AG2 H;  1AA7 A;  1IC8 A;  2EFN A;  2GXB A;  2XF5 A;  2MSY A;  1YFH A;  2BY3 A;  5ICE A;  3J80 K;  3W6V A;  3I55 I;  2HZT A;  1J09 A;  2L02 A;  2BBY A;  3OR1 C;  3F8F A;  3PL8 A;  4ENJ A;  2E1C A;  3VPR A;  2VBY A;  2DK8 A;  2HYJ A;  4JQF A;  1UZC A;  1ZHF A;  2OUM A;  2WB1 N;  5F04 A;  1H0M A;  4AIK A;  1T6S A;  2PJR B;  1IZ1 A;  2JVG A;  3GUD A;  3BJ6 A;  3MZY A;  2VQH A;  3ABM H;  3BG9 A;  5LEJ A;  2R93 J;  4OIN F;  2P0W A;  4M3D A;  2AQE A;  2QSH X;  4XQF A;  5E3N A;  2FNP A;  2A5W A;  4ESJ A;  3GW2 A;  4ITV A;  3ZQC A;  1KYW A;  3B02 A;  3OYA A;  3V7C A;  1R23 A;  1TQM A;  5BNG A;  4NC7 A;  3LA7 A;  4E7J A;  3QOP A;  2ZNY A;  3CF5 F;  1VQM I;  3JAM Z;  3HKZ N;  4EJW A;  4U0V A;  1HST A;  2Y0M A;  3L2C A;  3BWG A;  2XAJ A;  4DOZ A;  1IXC A;  2PN6 A;  3K2Z A;  4IRH A;  5L3E A;  3D0S A;  1S72 I;  2NS7 A;  3ECO A;  4EJU A;  2ZSH B;  2CG4 A;  2WWY A;  5HDK A;  4UUT A;  5HS8 A;  2MD5 A;  2A3S A;  1AKH A;  3RKW A;  2PG4 A;  4M71 A;  5J3L A;  2VQC A;  2EB7 A;  1Z3Y A;  3MKL A;  4CUG A;  4XRM A;  3W2A A;  4Q4Z F;  3SEQ A;  5FFX A;  1ZK8 A;  3R60 A;  5EEH A;  3W6J B;  3U9G A;  2HTS A;  2YU3 A;  2A68 F;  3Q3S A;  3B73 A;  4Y7N J;  4ESF A;  2QLZ A;  1WHU A;  2NS0 A;  4UVB A;  2F48 A;  3IH2 A;  2P5L C;  1FOX A;  2ELJ A;  4DW6 A;  1S3J A;  2HVS A;  2P7V B;  1V5F A;  3Q0U A;  3TW7 A;  2ELK A;  1D3Y A;  1O3R A;  2JJ7 A;  4NHJ A;  4AID A;  1B6A A;  4IQJ A;  2X6X A;  1BC8 C;  2R7X A;  2DPD A;  1I50 J;  3DFG A;  1MH3 A;  3BDD A;  3ML6 A;  1PP8 F;  5GPC A;  1X4P A;  3KFW X;  3FKJ A;  3WG9 A;  1PDN C;  5J1R A;  3P9K A;  2FMY A;  3NQO A;  1DU6 A;  3EET A;  3OYM A;  2Q2E A;  3T5X A;  1DP7 P;  4OAZ A;  3UNG C;  2E2J J;  3JRH A;  4IKF A;  2ZNZ A;  5CQE A;  5FO5 A;  4EVI A;  4I2O A;  3F9K A;  4IO9 F;  3IH4 A;  4EEF G;  2GAU A;  3HM5 A;  3R6S A;  4PCQ A;  3BR5 A;  3KZZ A;  1ZG3 A;  5BPD A;  3WE3 A;  4M6V A;  2EK5 A;  2JZY A;  1APL C;  1VQL I;  3HSF A;  3HOS A;  4JP0 A;  2M2E A;  4NB5 A;  4ZZL A;  3OYK A;  4IVN A;  3PIO F;  3DPT A;  3RKQ A;  2DA7 A;  3E6C C;  3CUO A;  1R7J A;  3GTQ J;  4BE2 A;  4FX0 A;  2B63 J;  4BJ5 C;  2ZB9 A;  3S1M J;  2HQ5 A;  2H1L A;  1R1T A;  3B6C A;  2HKO A;  2CV0 A;  2GWR A;  3TO9 A;  4LOC A;  3Q0V A;  1R71 A;  4NUB A;  1H9T A;  3WTW C;  3LST A;  1R49 A;  3F22 A;  2HOE A;  3HOU J;  4Y17 A;  3ESW B;  3M8F A;  3M9A A;  3WTY C;  2LVS A;  4HAM A;  1D0X A;  2TDX A;  4KDP A;  4QTR A;  3S93 A;  1AKH B;  2FXA A;  3I5U A;  3KEQ A;  2P8T A;  5J1Y A;  4G7Z F;  1ZTR A;  3FM5 A;  5LHH A;  1HA8 A;  5BS6 A;  2MYS A;  2CYY A;  4ZYA A;  4U0Y A;  5FRN A;  4G7O F;  3F8M A;  1MSF C;  1YIJ I;  3L7W A;  4U7D A;  3SFI A;  3JRE A;  3J7A O;  4D5F A;  4ENN A;  2VON A;  1I6H J;  3CES A;  2M0C A;  3W2V A;  4NQW A;  3GZ6 A;  3K1N A;  5EDN A;  2DA4 A;  2HVR A;  1V5G A;  1XGM A;  2M8G X;  3SYT A;  1R4M B;  5BQT A;  1T2K A;  2EWN A;  4MNU A;  1FC3 A;  2BVM A;  2Y9Y A;  2X1E A;  2ZSI B;  4WWC A;  3J7Z I;  2BZT A;  2A5Y B;  3TGN A;  3BTC A;  3V8K A;  2HYF A;  1L0O C;  3E1S A;  4E6K G;  2XPV A;  3J80 Z;  1ZGW A;  1VFC A;  1YIO A;  2Z2S B;  2Z1D A;  1IRG A;  1HKQ A;  1ORK A;  4YFN F;  2CV1 A;  2JA6 J;  4S0H B;  1IV6 A;  2Q2E B;  4AVP A;  1JKO C;  5HNF A;  5IYC J;  1D5Y A;  4I76 A;  1MBF A;  2E7W A;  3V8J A;  2A07 F;  3GVA A;  4AUX A;  3A03 A;  1S7E A;  2KPM A;  3ZQI A;  1LVK A;  5DD4 A;  2QGU A;  3S1R J;  2JSP A;  2HEO A;  3ZRG A;  2IPQ X;  2EIL H;  1V54 H;  2RC4 A;  3HOX J;  1EH6 A;  3K4K A;  5F0F A;  3ZQF A;  1ZG1 A;  4BHP A;  5HDN A;  4WF2 A;  4A6D A;  2MH2 A;  2HWV A;  4BJ6 C;  3CMY A;  4LIV A;  2UV1 A;  1TWG J;  4A3B J;  2HPI A;  3S32 A;  2NNN A;  2H6B A;  3ULQ B; 
#chains in the Genus database with same CATH homology
 3CUQ C;  1W7P B;  1XB4 A;  1U5T C;  2ZME C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...