2ZMEC

Integrated structural and functional model of the human escrt-ii complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
SFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Vacuolar-sorting protein SNF8
publication title Integrated structural model and membrane targeting mechanism of the human ESCRT-II complex
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 99
sequence length 99
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.570 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A "Winged helix" DNA-binding domain. Chain C. Domain 1 2zmeC00
3CUQC 1U5TC 1W7PB 2ZMEC 1XB4A
chains in the Genus database with same CATH superfamily
1E0EA 3ZGKA 4ENMA 3GZ6A 1IZ1A 4LB6B 5F1JA 4ASNA 3KX2A 5TISC 3KETA 3P5JA 3WG9A 4IO9F 1T38A 1TC3C 4PJJA 3I4NJ 3FXMA 4P55A 5B1BH 2EZLA 2ZXIA 5A2QK 3I59A 1WJ5A 3OYBA 3BTLA 2W00A 3D0SA 3BTJA 5HLTA 3IKTA 4DQ2A 5LEJA 4OAYA 2XGDA 1MW7A 2DTZA 3DCFA 2PMHA 2VKEA 2R5YB 2VIXA 1JJ6C 5L3BA 2H27A 2DXIA 4IQ4A 1T8IA 2OCCH 3ML6A 1ZGJA 1RRJA 2R7WA 1MNDA 3OOUA 4G8XA 3ZQ7A 2ZB9A 1WJEA 3ZMSA 4N9IA 3FBIB 4BE2A 2F2EA 3HBLA 4HYEA 1VQPI 5LD2C 3ABKH 4TV7A 1B8IB 1YW9A 2DOAA 3S3NA 3DLLF 1S7AA 4OU0A 1ON1A 4PK4A 1HCRA 4GO1A 3G73A 2L0KA 1W36D 4CO8A 1XPXA 1ZKGA 2L9SA 1B1BA 1EV7A 1IG7A 2DDAA 2GIVA 4EATA 1G3WA 2LKSA 3RCOA 4DYCA 4RS8A 2HFHA 2VI6A 2PN6A 5HODA 1JHFA 3C1DA 2EIMH 4FT8A 3TQNA 2A5WA 1J09A 2E1MB 2LF8A 4AD9A 2ZFWA 3HUGA 1J7KA 1WGXA 3HGGA 4RAZA 3QAHA 1FYMA 4RGRA 2NVUB 2A05A 2HOAA 4Y17A 3D1NI 2HDDA 1FWZA 1B72B 3FIWA 2P5VA 3RPUD 3BP8A 4Q48A 4ON0A 1Z6RA 2OC6A 4RBOA 3J7AO 1R22A 3H3ZA 1PP7U 2DLLA 4HX8A 2Y30A 4YEJA 3K4LA 2B9SA 1ZLKA 2AO9A 1FTTA 2HKOA 3EPZA 2P5KA 3SHFA 3GTQJ 2WB1N 2OJED 2VJJA 1I1GA 2DN0A 1ULYA 4L9JA 3WTUC 3FX3A 4DZPA 5FKOA 1K6OA 4E7ZA 4YIFA 2TRTA 3TMOA 3Q0UA 5BPIA 1DQUA 3BCAA 3K10A 5FLVA 3IRRA 4XSXF 1SMTA 3S3MA 1FP1D 1QU3A 1T2KA 4BH9A 1QGPA 4JQFA 5F0HA 3PNVA 2ZFUA 2CYYA 1I39A 3TO7A 4I6ZA 1O57A 1V55H 2DDBA 2Y9ZA 1XDUA 1SEUA 1G59A 2V9KA 3H5NA 1O3RA 2ID6A 2NAZA 2ZMEC 1S72I 1HKTA 3ONQA 2LNBA 3ECHA 2IS2A 3JTGA 4B43A 2CQNA 4FE7A 1HW5A 3J80K 4DZJA 3WTXC 2OTJI 3OYCA 4A6EA 2L5QA 3ZMTA 4PJMA 1LDKB 1Y8QB 5J3LA 4UUTA 2IA2A 5D6EA 3HOSA 4KMFA 2X1DA 5FFZA 4FCYA 2CG4A 3JRDA 1TLHB 3ZOBA 3FMSA 2R5ZB 2F5DA 2RAEA 3DEUA 2EIKH 1FIAA 3S1RJ 1FSEA 1XGMA 4YRVA 3HG9A 3N4MA 1MBGA 1UZCA 3KLNA 3RPUA 1QPIA 4U0YA 1WH7A 2QQAA 4ZJZA 2EV6A 3BG3A 3W2VA 2WWYA 2WY8Q 4EM2A 4UV8A 5EDNA 3D5SC 2VBYA 2DU9A 3BG7A 1W1WE 4CGZA 3HOVJ 2BV6A 4G94A 2XUBA 1SAUA 2K86A 1ZHFA 5F6FA 3GTPJ 3BPXA 4BEHB 2R7VA 2H09A 3GCMA 2E19A 2DMTA 2JA2A 2OU2A 4D9JA 2LBFA 3CF5F 4F3QA 1D5VA 1G3YA 2HNHA 1R7JA 2CUFA 2OCEA 1WJBA 3LSMA 1O3TA 3KP2A 1MD0A 1HW1A 3P9KA 3MAJA 2JUCA 4XRSA 4HBLA 2Y0SN 1STZA 1YS7A 1T33A 2L4AA 5LRSA 1RUNA 3H3VK 2BXYA 1B9NA 3I4MJ 2M5WA 1JT0A 4RMNA 2CGPA 4V2FA 3G6EI 1Z3XA 4HG2A 1DPUA 3BZKA 1K61A 1ODDA 3GFIA 4UNOA 1H8AC 3EDPA 4F7ZA 2VQCA 4M6VA 3V42A 3IL2A 2FQ3A 4DNCA 4KA4A 2YSRA 2WC2A 1E3OC 2QENA 1G3TA 4MLOA 5K1YA 3ZP5A 1MSFC 5IY5H 2M4KA 3RKWA 2YUSA 2XGCA 3NEUA 1R5HA 1F43A 3TEDA 5LGUA 3LWFA 1VQ7I 1IAWA 5E1WA 1RR8C 3ZCOA 3H9GA 1V5EA 5L3DA 4HZFA 4ZDLA 2YPRA 2JZYA 5FROA 1J75A 3AAFA 3CCVI 1KQ9A 1OCRH 4Q47A 3IP4B 5DUKA 3S93A 2Z3YA 5IOZA 4KT5C 4Q4ZF 1SFOJ 2LRDA 1IXSB 1VQ4I 4BHCA 4WWCA 2MGQA 3JR9A 2V1XA 1IRFA 1T6SA 2BE5F 4YG2F 2HI3A 1IXRC 1VQ8I 4D5FA 4A3LJ 4IHYA 1UELB 4MTDA 1LE8B 1P7JA 1BN5A 1YLFA 3ZQIA 1QRYA 4MEYF 4IVNA 2BY1A 4XN0A 4MQ9F 4O6JA 1TNTA 2K40A 2EJRA 3ZMZA 1PYVA 2X0LA 5JFRA 1ZG3A 1KYWA 3E3VA 1M1EB 2HU9A 2X6YA 3PSFA 1B72A 1N78A 3M4OJ 5KAIC 2DI3A 3ECOA 5D8LB 2P7CB 4Y33A 4YFNF 4N4NB 4YELA 2L7FP 3R0AA 1T56A 2KKOA 1NHAA 1XDSA 2X6OA 4L0ZB 4ZDOA 3V7SA 2EFWA 2VBXA 3IC7A 4XKBA 2VBZA 3LFUA 4E7KA 2HKXA 1R9TJ 3KP5A 4ZTJA 1GVJA 1V54H 1FSHA 1A6IA 2M9HA 5F04A 2KP6A 1C0WA 3G2BA 4E7LA 3L2WA 3GLXA 1U5TB 3QP5A 4ZDPA 2GOMA 3QPTA 1PDNC 5EG0A 1IJWC 1FP2A 3U2RA 1U8BA 4RLFA 3U21A 2EZHA 2LTPA 1YJ9I 4E4HA 4C3IJ 3OYAA 1WQ2A 1VFCA 2CMPA 2O6GE 3HOXJ 3GWZA 1WVRA 2PEXA 4P9UA 2K9SA 3OYNA 5IPAA 2Y31A 3WHBA 2R0QC 3TW6A 1RIOH 2V9VA 2FJ1A 1UJ8A 2V26A 4KITB 2HTSA 2Z99A 4I7HA 1TW3A 5IYCJ 1X58A 3G1LA 3HTUA 2K9LA 1PUFB 3ABMH 2P0WA 2JA7J 3CUOA 3T8RA 3RDIA 3JW4A 3K4NA 3O3KA 3KZZA 5JLXA 1DDNA 4LG0A 5M5YJ 1AOYA 1KYZA 4CCNA 1NG7A 2GAUA 4KNYA 3ISPA 4IOCF 1HLVA 1R1TA 3OIOA 4BQOA 2R7DA 3HOTA 2ID3A 3WE3A 4CCMA 5LHHA 1YW8A 3L9FA 1ZGAA 3K1NA 2ETHA 2R5ZA 1RPWA 1QBJA 1T08B 4LK0F 4FETA 4HDUA 1D1AA 3CMMA 3MZYA 3KLOA 4A5NA 1SFUA 4CYDA 4QPQA 1B59A 5LEKA 3MN2A 2XRNA 4NC7A 5FD5A 2KL4A 2P6SA 1ZN2A 4E7SA 2AS5F 1X2MA 3G71I 3GTJJ 3SDBA 4BHBA 4A3KJ 2EK5A 2WB1A 1SVMA 2MLKA 1OMIA 3H5AA 4BL0B 4JYKA 3T0YA 5HNHA 4BEHA 3JRIA 2M7BA 3RZOJ 2NXNB 3DWLE 3HGYA 2M0MA 2E5ZA 3HSFA 2DAOA 3FK6A 4NC8A 5KCMA 1W36C 1VQNI 3SZPA 2PMUA 3F8FA 4BGDA 4FX4A 5E3OA 3SXYA 5LHIA 1FLIA 4C2UA 2LDUA 1I1SA 4CYCA 2R7XA 2V79A 2QQ8A 2ZXHA 1IRZA 2BGCA 3H0GJ 3H0DA 3F8NA 2EFQA 2DT6A 2O3FA 2VT2A 3K4MA 4IL6C 2LG4A 5J6XA 3TL4X 2IS4A 3RZDJ 4A3MJ 2DA6A 4QLCU 1LQ1A 4II2A 4IKFA 2E2JJ 2QQBA 1FOXA 1A31A 1HDDC 1BR4A 1N75A 1XCBA 5HS9A 4A93J 2Y0MA 3MEXA 1GXQA 2P6TA 2EPFA 2XC7A 3HTSB 2GXAA 3E5QA 5DCMA 3O8GA 3W6KB 2QWWA 1HA8A 3CESA 1BOBA 3VSLA 1RNLA 4ZYHA 1LPQA 1HW2A 1KQ8A 3HXLA 2CUJA 2NVYJ 4L5IA 2H8WA 2VKHA 3TDUC 4IHSA 3LA7A 1ON2A 2ISYA 1K83J 5LFAA 3G3ZA 5LHGA 4RB2C 3KYCB 4UVBA 1D0XA 1N77A 5CVRA 3F22A 1X4PA 2HPMA 3FWEA 3E6DA 2DK5A 1E2XA 4LFUA 3EYIA 3MWMA 4UXNA 5D4RA 3WTVC 3ZQGA 3RKQA 2ELHA 1DU6A 4QIWN 1H0MA 1FYKA 2QSGX 4KN7X 1LE8A 5L3FA 5DTDA 1H88C 4BS9A 2W25A 2E2IJ 1HBXG 3JRGA 4OINF 3M8EA 3MKLA 2MD0A 4UB6C 3MFKA 5CKTA 1FTZA 2IRFG 4F52A 1XMXA 3LSTA 2AQFA 3I58A 2Z9OA 3G4SI 4DJAA 1I27A 3K4JA 5H2FC 2FBHA 2HYGD 4ENJA 4UUVA 3PL8A 4ENKA 1XSXA 4KYWA 5TJJA 1XGSA 2DFFA 3K69A 2PQ8A 3T8TA 1XD7A 3Q0VA 2NS7A 4G7ZF 3LQRA 1FBUA 3WGIA 3RKXA 4JP0A 3KYLA 1HKSA 1B4AA 2PMZN 5E3LA 1O7FA 2RQQA 2DYRH 4ENNA 2X51A 4BU2A 1WJCA 3SEZA 4RB3C 2GLOA 1V5FA 4IHXA 1HKQA 4P1WA 3HJEA 1R5ID 2EA2A 4WCGA 5ILUA 5L3CA 1JGGA 3OIQA 5AIQA 1X4OA 3DU5A 1SFEA 1DGWY 1MBEA 2E1MC 2YU3A 2HQNA 3OS1A 2VJIA 4IQJA 2EIJH 3WODF 4M71A 3KIOA 1S7OA 1MKMA 1XTAA 3H3UA 1KU3A 3S3OA 4F92B 1MDMB 2IJLA 3HC7A 2O9LA 1U0JA 1VQ9I 1SFKA 1ORKA 1TBXA 3I71A 3M7GA 1PUFA 3VWBA 5FRMA 3PQJA 3HSRA 4KT6A 3PQKA 2W48A 1GXPA 3B6AA 1ZLJA 2X6WA 2LP0A 2DFHA 1GHCA 4RAYA 4P5OA 5F1RA 4A3JJ 1IDZA 1X2NA 1Y0NA 3LL7A 1HF0A 2HQ5A 3HL2A 3CMEI 2OA4A 3MMYB 1V3FA 3F0CA 2IGOA 3AKZA 4NBQA 1OYYA 3BG9A 1GLNA 3LSJA 1BC7C 1SVOA 3FXJA 3GF2A 4O3MA 2QSFX 4QSHA 5FO5A 4BE1A 1JKPC 1X1CA 2XV4S 5HOOA 3F21A 3E6MA 4R79A 1ERDA 4I01A 4AIJA 4GGGA 2HXOA 3RQ4A 2WAEA 2NRAC 4XNFA 1ETWA 5EEHA 1JKOC 1MH4A 2VT3A 2LY1A 3DLAA 1ITYA 3CQZJ 1O3SA 2L9VA 3H5RA 1IW7F 1QPMA 2F4IA 1Z7UA 1XSVA 3CC4I 2XAGA 4CZCA 5F08A 4BACA 1IGNA 2DW4A 4UVAA 1W7PB 4EJOA 2PX9A 3ERMA 1K7AA 3M3YJ 4EJTA 2DJIA 1MZBA 2AHQA 5HS8A 3I3LA 1IN7A 2L7MP 3LFKA 4HV6A 4HF1A 3UNGC 1BBYA 2JSCA 1WFXA 1IDYA 3ZQCA 3G1MA 1P92A 4B47A 5GP9A 3DF8A 1UG2A 3PO2J 5E18F 3JAMK 5KNLA 2BVMA 3HB9A 4GYIA 3DTKA 3BOQA 3KEOA 4IF4A 1YJNI 3BWGA 3CP2A 3OS0A 2STTA 2HOTA 5TGTA 3DP7A 2Z16A 3CF2A 2BXZA 2L4MA 1R23A 3BQZA 4MNUA 3S14J 4XK4A 3F8CA 4A0ZA 2CSOA 2K4JA 3H92A 2XF6A 1YHQI 2PJRB 3I9V2 3K1MA 5CPRB 5FGMA 5K7FA 5JHUA 3OWTA 1Y56A 4HX7A 4IRGA 3JRAA 4A69C 2FMLA 3QQAA 2V4JC 1YW7A 2ESHA 3QOPA 3RPQA 3WTZA 4E7IA 4OOIA 5D5XB 1D0YA 5L3EA 3DPUA 3MKYB 4L0YB 4A3CJ 2K3FA 4XN3A 2HQAA 1MJ9A 2DJNA 4U0VA 3ABUA 4AYBN 4BJ5C 2R3SA 5EJCA 2LC2A 1FPQA 1ZREA 1MMGA 2BZTA 3MQ0A 2KRHA 2MH2A 1F5TA 2FBKA 2KHMA 1ZARA 2B0LA 4RGXA 2XHKA 4AWXB 1WSUA 2CWEA 2D45A 1F9NA 3Q5FA 3F8BA 3RTRA 3EYYA 3GTKJ 3I4PA 4CCLA 1OCPA 2IA1A 3GZ5A 2MD5A 4HEA2 3LSHA 3FHZA 2VUMJ 1TQMA 4I98B 2DYSH 3DEWA 3GFMA 1TWHJ 3LSIA 3S1MJ 1EJ9A 3FMQA 4XLCA 5E20A 2KDZA 4I02A 2KMUA 2R7SA 1G8XA 3HZJA 4L9NA 2E71A 1RUOA 1OQYA 1W7PD 1BR1A 3R4KA 2QYOA 4E7HA 1ZQ3P 3VOEA 2QM3A 4A2UA 2RNJA 2G7HA 3FM3A 2QGUA 2D5VA 1GDTA 1FEXA 4BDYA 1MMSA 4DOZA 4M9SA 4ANJA 2A61A 2ELKA 2EA4A 2IW5A 4D7NA 4CICA 4OWRB 2A68F 5EZGA 1ETVA 1SD6A 1YX3A 1P4WA 2ZSIB 3GX4X 2Z5UA 1TL8A 1MDMA 2KFDA 1OYWA 2DMPA 1LVAA 2JRTA 2Q2EA 1IXCA 5HLGA 3G1OA 4ZYAA 2JQ7A 3RYRA 5BQTA 1LNWA 5ERIA 3JRFA 2PI0A 3LNQA 2GM4A 2DA1A 3E5UA 2LKXA 3MCZA 4G6TB 3KPHA 4OIQF 3OYGA 3IRQA 2EV5A 2V6CA 2RGVA 3JAMZ 2E7XA 4IOAF 4XLFA 2BY2A 1U5TC 1BI0A 4KN4X 2W1OA 1Q1HA 2IGMA 2H8RA 1AA7A 2LH9A 2E36A 4PZJA 5E3MA 2PJPA 3UR3C 1EF4A 2MABA 3H35A 3ZQLA 3FF5A 2FOWA 3V7RA 1CQTA 1YS6A 1QA6A 3NWTA 1YTYA 2MLGA 2JA6J 1YI2I 3K70C 2IS1A 3WG7H 2CQXA 4KDPA 2HTJA 2ZJRF 2BW3A 1IUFA 4C2TA 5JI6A 2DA4A 5D5WB 2M8GX 1WHUA 3RI4A 2H6BA 4A3FJ 4A3IJ 2CV1A 4IHTA 2PMZA 2FF4A 5CQEA 1W7PA 1P4XA 1YQAA 3KCCA 1YO5C 1CF7B 5ILSA 1VI0A 1G4DA 4P9FA 1XMAA 1JHHA 4BBSJ 1MNMC 3GTGJ 2LSOA 3D5RC 4DYQA 4ZH4F 3L2VA 2DK8A 4PFPA 5J4VA 2MA3A 1JUMA 2GOXB 1MBKA 1F4KA 1J5YA 3F6VA 2GXGA 4GCVA 2RREA 3IKVA 4JX5A 4J01A 1PUEE 4HX4A 4XORA 3HOWJ 2DO7A 2XSDC 2GA2A 4HPQA 4MFDA 1Z21A 1VZ0A 3CCSI 2QSHX 3RKYA 3DFGA 1JT6A 2D2WA 4PGHA 5D5UB 4RDUA 2V1UA 3OYJA 2HZTA 5K7ZA 4II3A 1QZEA 2FQ4A 3CDHA 2CUEA 4EV0A 2CO5A 2E1CA 1S7EA 4NC6A 1ZAOA 1LKXA 2LY2A 4LOCA 1DPRA 3C7JA 2PJRA 2H1KA 5FKMA 2ZO4A 4XL9A 3SEQA 2GQQA 1FJLA 1G2HA 1TT5B 2KISA 3LSGA 3W2WA 3Q3SA 3TOAA 5M3FJ 3V8KA 5F64A 1WPKA 1VTNC 3H9JA 4ZC3A 3CLOA 3JREA 2QEXI 3I53A 3ZMVA 2E60A 3IUOA 4M6XA 1N25A 1W5TA 3GMEA 1U2WA 1HSTA 4M74A 5DYMA 4DIQA 2R93J 2ISZA 2UWMA 3HRTA 2L9NA 2R5YA 4A3GJ 3DU6A 3HOUJ 2IGKA 2HDWA 2HZDA 4XIDA 4IHVA 4LJZF 1IF1A 3WU1B 1OR7C 1MJAA 1TWAJ 5ICCA 2JSPA 4BE0A 1XGNA 2CW8A 4GRIA 4ESBA 3KP7A 4M3EA 2Z33A 5CJ9A 3OYEA 1UG0A 1B8IA 2XRLA 4AUXA 4XR6A 1X1AA 2IGNA 4EJWA 1BL0A 2EFPA 1QHGA 1WI9A 4C3JJ 4BXXJ 3BR3A 4CUGA 4HQMA 1IRGA 2G7UA 5HDGA 1RETA 2JPBA 2DQRA 5CVUA 2V1NA 2NVXJ 1IN6A 1GV2A 4PDKA 3A4CA 3RJPA 3L2RA 2XAQA 3FXKA 1T0FC 5IP7J 2AQEA 5EEGA 2I10A 1SVLA 4B48A 3MVPA 1FC3A 2R7ZJ 3KEQA 4QPOA 1H89C 1IUYA 2VPRA 3S2DJ 2DTRA 1TZLA 2M8EA 2VXZA 4S0HB 3IHUA 3VEPA 1T39A 2KRFA 4D1QA 3ZQQA 1R1UA 1J59A 3ERED 3K4KA 3CCRI 2KDOA 2O0YA 2P7VB 3NAUA 2HVRA 3R60A 3U1DA 1ZGWA 4PFOA 2A3SA 3FZVA 1OKRA 4IHWA 2V6EA 4PGGA 3SJMA 2FNPA 1R36A 1YRNB 1F1ZA 4ITVA 2IS6A 3R0JA 4AYBA 2L02A 2XROA 2IXSA 3KZIC 1RI7A 3RQIA 1S8NA 3QYFA 4XBFA 2CFOA 4XLHA 5GPCA 2IPQX 2WAQN 5D8KB 5BOXA 5FKKA 2KJBA 3LMMA 3IV5A 2NOGA 4UVCA 3B02A 1JI8A 2Q0OA 5J8CA 4MGRA 3A01B 3CO7C 3QU3A 2VQGA 1D0ZA 3OY9A 4ABZA 1MMDA 4ZYEA 2ELJA 1R4MB 2E1OA 4CZZA 3P9CA 4BXUA 2E7WA 2KIQA 2VBWA 3E1SA 3TBIA 3PIOF 3PIPF 2F48A 1WI3A 2W4SA 2Q1ZB 3RYPA 3CZ6A 4AIHA 4R1HA 2NVQJ 3HEFA 3ELKA 3AFHA 4G7HF 1NTCA 1FZPB 1XB4A 3M8JA 2EFNA 1XGOA 1REPC 1TP4A 1CF7A 5CVIA 2Y2ZA 2OD5A 2XSJC 3ZMDA 5JR3A 5HNFA 5JVTA 3J7YJ 2XDVA 1MSEC 1OLTA 4IZZA 4N0BA 4PJLA 4XKCA 3K6GA 2FA5A 4KMUX 3DPTA 3S1QJ 3EETA 2M4GA 2X48A 3Q9SA 3VYRB 2LKPA 4ZYGA 3L1PA 1JUSA 1MNEA 3F3XA 3FXLA 2D1VA 3AG2H 5IT3A 2K27A 4N4OB 3WTYC 2M1BA 2M3AA 3PM1A 3IAM2 2P5LC 4YIIA 2WV0A 1UHSA 2NS0A 1G6NA 3PO3J 3MZHA 1DGRM 1TWCJ 5J1RA 4HLXA 2W85A 1R5GA 2ZCWA 4LLLA 3VSKA 5HDKA 3K7AJ 5K7HA 3GZNB 1LDJA 3OYHA 3IH2A 2VE9A 2X6XA 2AXTC 9ANTA 1XG1A 2QZ8A 4JBAA 2JA8J 1NK3P 2DPUA 2VODA 4RB0A 3OS2A 1WCMJ 3S1NJ 2R4GA 1R4NB 4M9XA 1HQCA 2F5FA 3SQNA 4RM3A 3JRCA 2OPTA 4V19K 4X0GA 1VQOI 1X1DA 2CS3A 2OQGA 3HRMA 4U7DA 3CCEI 1SD7A 4KICA 1X3UA 3BDDA 2EH3A 3EUHC 4BJ6C 1BOAA 1UAAA 5EGOB 4EQQA 2XIGA 5ILVA 2QBYB 2NYXA 1RC9A 3GO5A 1EH8A 5DD4A 4BKXA 2JA5J 2XAFA 1V5GA 2EB7A 4BAYA 3ZQHA 3GFJA 3K70D 3OL4A 4EJVA 5CLSA 3A02A 1VQKI 1ACIA 1H9TA 4LGWA 4QWQA 3BQYA 2HOEA 1K4SA 3BG5A 3NQOA 1ZRFA 2HS5A 1FX7A 1RKTA 1XMKA 2E35A 4Y52J 1H9GA 2JMWA 1S6LA 3QYBA 4ZZDA 1Z1DA 2R7FA 5CVJA 3E5XA 3BROA 2YS9A 2M87A 4N9HA 3TKYA 2DOEA 3WHCA 4BJTA 5K5RA 5C3EJ 2A6TA 1YITI 1I6XA 2JUGA 1XSDA 2ZSHB 2BEOA 1ZRDA 1YOVB 4C30A 2OF7A 2YX7A 3VYSB 1WJAA 2VB6A 1U9NA 1SFXA 3LQQA 3ZN1A 2LOOA 5GAGJ 3T1BA 4S04A 2K9QA 1SC7A 3FBNB 2YR2A 4Y15A 4A0YA 2R7RA 2XGXA 1JXSA 2BOLA 1ONVA 4XLAA 2UXNA 3QRFF 3OYIA 3JTHA 2VJ4A 4MIMA 2HXIA 4A12A 2E5NA 1VF9A 2K9MA 1MMAA 3CCJI 4RA2A 2M2EA 3SDGA 1KONA 2X1CA 2EQRA 3U1KA 2ZJPF 1UFMA 4FISA 3ROUA 4ETSA 2OTLI 4I0BA 1W0UA 2VPLA 3HHHA 2VONA 4HRIA 3P9IA 4XRMA 2MBFA 3JSPA 5D5VB 4MQVA 2VOPA 4E7JA 3S8PA 4XOPA 4CXFA 1TQPA 1U5TA 1USTA 2K7LA 1Z67A 3CUQB 5E1XA 4I2OA 1Z3YA 1D8KA 3L09A 5E8IA 3A0HC 2H94A 2ADUA 2H6CA 3HM5A 1X3WB 4Z2YA 2BYVE 1KU2A 3I54A 1O3QA 4B44A 3GFLA 5BMZA 1RR7A 4U88A 2IAIA 1O7LA 2OBPA 5LLQA 2FE3A 3ASNH 1A35A 1FOYA 3VDXA 3ESWB 3QPLA 3CMYA 3IWZA 3JRHA 4XQFA 4LD5A 3FDYA 4HAMA 3PJRA 4LIUA 3MZ8A 4MEXF 4ESJA 4EGYA 3C2BA 3F23A 2M7AA 3K4BA 2AXLA 3VB2A 5J1YA 2R7QA 3PNYA 2CQKA 1MGTA 1GT0C 5GAEJ 2QUFA 3OIPA 2O61A 1LVKA 4I09A 3FMRA 4BQQA 3W6VA 3ZR8X 3OYKA 3NARA 4AIDA 2JVGA 1YIJI 4CH7A 3S16J 2HR3A 2DA3A 3MD2A 1Q1VA 5FJ8J 1DUXC 3EUAA 3JCUC 2E34A 1ZRCA 1JKRC 5E3NA 3I55I 2BBYA 2HWVA 3LA2A 1BJZA 3DV8A 3HYIA 4ESFA 5L3GA 1I50J 3TP3A 3BR1A 3M1CA 1WZ2A 2LYCA 3BZ6A 5FRNA 4F55A 2KIMA 1MMNA 5GTIC 5FFXA 2QVOA 3JRBA 2B7EA 4NB5A 5HLIA 1IV6A 2FNAA 3NRVA 4QTRA 4LLGF 2KZGA 1UCRA 2R92J 3C2HA 4L5JA 1FMWA 4HSRA 1Y0UA 1WJDA 2Y48A 4IRHA 3BT9A 5DEQA 1QVUA 4HW0A 5D6FA 3R61A 2WAQA 1BR2A 4BUPA 4C9YA 3F72A 1QZYA 2FUG2 4O5VA 4RAGA 3OYDA 4A3EJ 5CYVA 2F5CA 2MFZA 1YG2A 5AIPA 2FD5A 2NOJB 5KK1A 5LGTA 3CCUI 1GVDA 3C18A 1A36A 5IYDJ 2LY9A 3OSFA 2KIUA 3KYDB 5HDNA 4BYYA 4M72A 4CCKA 2TCTA 2QBYA 2WTEA 5JHFA 3L2UA 2DT7B 3KEYA 2W84A 3ZQFA 3GYHX 4BNCA 1OR7A 2HPIA 2EFOA 3HKZA 2IA0A 2JRMA 2V1DA 5DS9A 1A5JA 5HS7A 2GXBA 1LUJB 3O8HA 4KIFA 3ASOH 3KP4A 4IX7A 2XF5A 1DP3A 2W24A 4RGSA 2XF7A 5IOYA 2PLYA 2XAUA 1FBQA 2BY3A 4G12A 1AKHB 3GTMJ 3GBGA 4HDVA 1XCVA 5F0FA 1BI1A 3HPGA 1MBHA 1PJRA 3E6BA 1Z7LA 4WXHA 5EEAA 5DCFA 2LBFB 1HDPA 1T0FA 3CJRB 4F91B 2OAZA 4PJ0C 4LLNA 2WADA 1SD5A 1UB9A 3J7AY 2J5OA 4FE4A 1Z0XA 4XKWA 2W7NA 5FLMJ 1Z05A 4B1RA 5H6QA 3CC2I 3LA3A 4RB1A 2E2HJ 5F27A 2XPWA 4M3DA 2O8XA 1TT0A 2DBBA 2ZJ2A 2CRGA 3LOCA 3WTWC 3NWSA 2A69F 3I5UA 2WBMA 4LB5A 4RM2A 1L3LA 4FX0A 5DUIA 2P8TA 4BY7J 4GYGA 2XKPA 3V8LA 3K2ZA 2DA2A 3BCBA 2KPMA 3HOYJ 4FASD 2CFXA 1TWGJ 2HYFA 5LRRA 4KUMA 1YX5A 4IJAA 3H1CA 1VQLI 1TNSA 3KP3A 2YX4A 4R8HA 5EYRA 3CUQA 1BIBA 2X9DA 3DKWA 3K9TA 2LFBA 2ECCA 4D7MA 4RGUA 4JK1X 1B9MA 5D4SA 4XLPF 4M73A 2XVCA 2E1NA 3IH4A 1S5LC 3VYTB 3M9AA 3W2AA 3BR2A 4UUSB 1ENHA 2G9WA 1IV8A 2LLKA 2D1HA 4HF2A 2DPDA 1Y6IA 1R71A 1OCOH 2KLOA 4NHJA 4A3BJ 3AG1H 2C6YA 3TP0A 4BQAA 4WXDA 2QA4I 1Y8RB 1OFCX 3JSOA 3PSIA 1BA5A 3CJNA 5IT9K 2M34A 2FXAA 1U78A 4PSXA 1UHMA 5E1ZB 1LDDA 3GTOJ 2A07F 2FOKA 3QU6A 1Y1VJ 5C4JJ 1B6AA 2RDPA 5GADJ 1D3YA 1YE9A 4M9ZA 1MIJA 5ICGA 5J8FA 1W0TA 3DEEA 4RLQA 2VASA 2HOSA 3J81K 1Z9CA 1A04A 4DBQA 2DFIA 3A0BC 2B63J 4NQWB 4UB8C 2L7KA 3HIFA 3AG3H 2JVHA 2KZVA 2FEZA 2GWRA 2Q8KA 1OPCA 1RESA 3I64A 2K3PA 4M3BA 5GTHC 3LSPA 5J40A 4KJZA 4MO7A 2VQLA 2RC4A 3BTIA 5E79C 3OMYA 4LK1F 4G7OF 2DCEA 2RQPA 4XRSG 5EG0B 2ZC2A 3DQVC 5J47A 1WJFA 3WE2A 1S9HA 2JK3A 3M07A 3O6BB 2BHYA 5DV5A 4OMZA 2MC3A 2CV2A 3HPHA 4S05A 3FHNA 3QPHA 1LEAA 2L2OA 4M3FA 3D5LA 4P96A 4WX9A 3GEZA 5KHDA 1WWXA 4KFCA 3SFZA 2KRCA 3CC7I 2ESNA 5C4XJ 1D1CA 3TO9A 3EUHA 1LFUP 1SD4A 2F6CA 1IC8A 4NNJA 4WF2A 2HYJA 2FBIA 4DBRA 1X1BA 3SYTA 5TRDA 5CVVA 2HVSA 5CQGA 4LG0B 3CCMI 4IEJA 3TOBA 5EZHA 2VXDA 5DD8A 1VQMI 1VQ6I 3OYLA 5A2QZ 1P9QC 2MC4A 1Z91A 4G9YA 1BC8C 4DYRA 3SZGA 4D5CA 2IT0A 1FMVA 1T95A 2V7FA 3BZCA 3I0TA 3FXRA 3VFZA 2W82A 3HRUA 4BQNA 5E17F 4OIOF 5AONA 2VKDA 3DTEA 4WXCA 4NUBA 2K9NA 1QQIA 4B3XA 5DM7F 4HQEA 1QNTA 5BPDA 2N8GA 2VJ5A 5LGNA 4W1UA 1PVEA 3J7ZI 4CSWA 3AL0B 3E6CC 2RKHA 1AKHA 3X2QH 4CHUA 3S2HJ 3BJ6A 2OQRA 3V7CA 1E17A 1ETKA 1G3SA 3KP6A 2CH0A 1OCTC 2F5VA 3QWLA 1AU7A 3PUFA 1ZELA 2LVSA 3W6JB 3S2WA 3C3WA 5H6RA 2K85A 2DA7A 2ECBA 3Q9VA 4MFEA 2NNYA 3BY6A 1W5CC 1U8RA 1T98A 2LMDA 2CUZA 2RN7A 1IN5A 4GXOA 2EBIA 4XRFA 3VODA 4ZYDA 4CYCB 1ZR2A 3FKJA 4MHGA 5IT9Z 2XPVA 3ZPLA 3FISA 4RAFA 3H36A 3ZXSA 1RKWA 4IXAA 3B6CA 1GV5A 3BTCA 1JUPA 2XGEA 2K4BA 1I6HJ 3BG6A 2R7OA 2FU4A 3FXQA 1SANA 2UZKA 1HOMA 3CO6C 3TGNA 1YYVA 3J81Z 5DCMB 4U87A 4HSTA 4I76A 4K2EA 2MYSA 1IO2A 1SAXA 1JTYA 3V8JA 3MKWB 2OZ6A 3PFYA 3LSRA 2HDCA 4BDZA 3M1EA 5B5EC 3QPSA 3A2KA 4L5EA 3BR0A 4PSWA 1I3QJ 2VKVA 1EH6A 2M45A 3IH3A 1NK2P 5FD6A 2DODA 2O5RA 3FK7A 3F8MA 4W97A 4C3HJ 2DMNA 4AVZA 4XSZF 5FLXK 4M6YA 2QKLB 2FSWA 5ICEA 2XB0X 4Q5SF 1XN7A 4UUSA 3CLQA 3S32A 2COMA 4LMYA 2CJJA 1I5ZA 1KQ0A 2OV7A 3AG4H 4F93B 2K02A 4AIKA 1HC8A 3CDLA 1USSA 3I56I 1R6RA 2EILH 1I3AA 3J80Z 4BHPA 4JOMA 4B8XA 2CQ7A 2DA5A 4AM3A 2VN2A 4M3GA 4WK8F 4BXFA 5B1AH 1J2XA 2LR8A 3BJAA 1FYLA 1FY7A 1S3JA 2GBYA 1NG6A 1WRJA 4H0EA 1U3EM 3ULQB 2K5CA 2VL8A 3HDDA 2EZIA 1SMYF 4NQWA 4YIRX 2GZWA 3Q0WA 3CUQC 2R7UA 3BC8A 2L01A 3RSNA 3WTTC 2VC0A 4OIRF 3CCYA 4I99C 1Y39A 4Y7NJ 3TO6A 2KIFA 3E97A 3BJOA 4H4KC 2CV0A 2DMUA 2L54A 1OISA 2ZXWH 4A6DA 2EZKA 4EMSA 2ZXJA 3KZYA 3IWFA 3HKZN 2O7OA 1QO0D 5C44J 2QCOA 4EEFG 2ZMEB 1P7IA 1XC5A 5H20A 4Y4RA 2LD5A 4AC0A 1J9IA 1D8JA 4XMYA 4NDLA 4V2GA 1X3ZB 2WA0A 1FOWA 4JX4A 5IP9J 3S17J 2Z2SB 1HXDA 5B66C 4Y13A 2DQLA 2WY7Q 3CDIA 2IBDA 4GDFA 4U0WA 5E8GA 4EJUA 3TDZC 1AHDP 1EH7A 2A6HF 1LEBA 1EA3A 4LITA 3B73A 2XASA 1Z6TA 5J1UA 3L2CA 3LAJA 4XOTA 4X1EA 4FHTA 4KISA 3ZMUA 5DM6F 2A5YB 2LF7A 2CW7A 2RNGA 1BM9A 4YFXF 4OMYA 1K79A 4L18B 1ZTRA 1W5SA 4EM0B 3E7LA 1IN4A 2F5EA 3DKXA 2QLZA 4JX6A 4ZTFA 3DBRB 2EV0A 2JWTA 1JKQC 3FM5A 2FMYA 2QQ9A 5EF6A 1ZG5A 2ME0A 5K5QA 3WU0A 4CCJA 2KQRA 1YFHA 5F0CA 5GPAA 3CP8A 1FIPA 3PUBA 1JJ8C 2DMQA 4KIGA 3BR5A 3BLYA 3OV8A 4MTEA 1OCCH 3DKYA 5M5WJ 2W57A 4HA8A 2Z1DA 5IYBJ 1K78B 4BY1J 1X19A 4E6KG 5FLXZ 3EUKL 4J19A 3OYFA 2CQQA 1TTYA 3IAS2 3L2QA 3GTLJ 2TDXA 1TQIA 4A5MA 1J0RA 4DW6A 1ZK8A 3M8FA 4IPAA 4XLNF 3OR1C 2YU9J 1FOKA 1UMQA 5BNGA 3FXUA 3WU2C 2IP2A 5ED4A 1DU0A 3A03A 2WAFA 1KZHA 2DT5A 4HLYA 5FB2A 5KVRA 2XB5A 1YJWI 2H1LA 3OOPA 4XKVA 5ICFA 1U9OA 1S29A 2I8DA 4OAZA 1W4MA 4UHTA 1F36A 4C2MJ 5M5XJ 4XM3A 4J00A 1TW2A 1NH3A 2ACJA 2GIZA 3REOA 2LK2A 1ETOA 1V4RA 3K2AA 2KJCA 1UHWA 1LFPA 2Y75A 3CTAA 2VOOA 2ZKZA 2WV1A 1U6GA 1FBSA 4B4CA 4AU7A 1QVTA 3VYUB 4CA0A 4L9VA 4IRIA 2L9RA 2STWA 3A1YA 1KA8A 4HF0A 1X1PA 5J4YA 4A3DJ 1Y1WJ 1ZR4A 5KAFC 3QP6A 4CCOA 3I59B 3OYMA 3E0JB 2QKMB 4FTHA 3FKIJ 2BHZA 3CJTB 2I5UA 4AVPA 3COAC 4E70A 1O4XA 2CU7A 2XPUA 4LG3A 4HV5A 3HOZJ 2LREA 4DGWB 4HNUA 1D1BA 3N05A 2J5PA 2X4HA 3ZRGA 4D0PA 2GA1A 3SFIA 4BBRJ 4B3AA 1YRNA 5DDGA 4Z6YA 2PBIA 1BW6A 2X1EA 3GUDA 2JTVA 6PAXA 1MJBA 5HVQC 1E3PA 1LFBA 1ETQA 3HSEA 3DTIA 1KU7A 1A6QA 2XAHA 3BR6A 2Y0SA 1POGA 3QOEA 4XICA 3CJQB 3F9KA 3GLLA 3GW2A 1JGSA 5FKLA 5B3SH 4X6AJ 1MH3A 1XX5A 4XONA 3OR2C 2RV8A 2M0CA 2MG4A 2JJ7A 4G6DA 3CMAI 2ZNYA 4YFKF 2ZBKA 3PFIA 3A01A 3H9QA 5BS6A 3O2PE 1AWCA 1YIOA 3OSGA 1E3HA 2EWNA 3C2GA 1OJLA 2FX0A 3DBHB 2BVLA 2HQRA 1QHHD 3L00A 1BI3A 2L7ZA 1P2FA 4HNTA 2FRHA 4KIBA 1K6YA 1R1VA 1TWFJ 3HUGB 2UXXA 3VPRA 4GFBA 1WH5A 4EGZA 2ZMEA 2IEKA 3DPLC 1R49A 2COBA 5GAHJ 3P7NA 2NNNA 2RVCA 5FKNA 3F6OA 4Y3OA 5JVGF 2G0EA 2HVQA 3EQLF 1R00A 3OL3A 1XS9A 3FXOA 2O03A 3ABTA 2PFBA 3QYEA 2Q2EB 2VC1A 1L0OC 2F4MB 2OZUA 2HGCA 2X85A 4PUSA 3RIRA 3L7WA 1K4TA 5M3MJ 4LIVA 4U7BA 4EM1A 2IVMA 1ZG1A 4ZZLA 1EKEA 4OIPF 4PJNA 3GVAA 2O8KA 2ZJQF 2BY0A 4EVIA 2V9PA 4A0XA 4UY8I 2OUMA 1MBFA 3WGGA 3HRSA 2UV1A 1IN8A 3QODA 3K0LA 2R7TA 3K4CA 4HOBA 1LJ9A 2A6EF 1MBJA 2KT0A 2CW0F 2M30A 1FT9A 2XAJA 4UV9A 5HLHA 1RZ4A 3BPVA 3TW7A 2HEOA 2ME6A 3S15J 3UKGA 3R6SA 1CGPA 3MKZA 1ZH5A 4B09A 4HNVA 2MSYA 5LBQA 1DP7P 1OYIA 4PCQA 1ETYA 3ABLH 2NVTJ 1GUUA 1ZYRF 2P81A 2BW3B 3U9GA 1R58A 3K1PA 3DBLB 1JE8A 3LSKA 2Y9YA 1ETXA 1APLC 1P4AA 1KU9A 1WKMA 4L9TA 3V4GA 1KGSA 1VQ5I 1K78A 1HSJA 3KFWX 2JPCA 5EGOA 1BW5A 1Z77A 1QZZA 2F4OB 2MH9A 3HHGA 5JLWA 3N97A 2MW8A 3SZTA 1FNNA 3WTSC 1LB2A 3DXJF 2XKOA 4CDGA 4FQGA 2QF7A 3LAPA 2NS8A 4G6QA 2JT1A 2VLAA 1IRXA 3CCLI 2P4WA 2L3DA 3ZN0A 1VNDA 2DFEA 1BI2A 3CCQI 3CD6I 1BIAA 4I0AA 2PG4A 2VQHA 2ICWG 1P6RA 2EINH 1JTXA 2DOFA 2JN6A 2VE8A 4XLEA 2UUZA 3GXOA 3PNTA 3AL0C 1OCZH 1D5YA 3KE2A 3W3CA 2ZNZA 3T5XA 5IP6A 5K5OA 1PP8F 2Y69H 1BJAA 3WGHA
chains in the Genus database with same CATH topology
3CUQC 1U5TC 1W7PB 2ZMEC 1XB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CUQ C;  1U5T C;  1W7P B;  2ZME C;  1XB4 A; 
#chains in the Genus database with same CATH topology
 1E0E A;  3ZGK A;  4ENM A;  3GZ6 A;  1IZ1 A;  4LB6 B;  5F1J A;  4ASN A;  3KX2 A;  5TIS C;  3KET A;  3P5J A;  3WG9 A;  4IO9 F;  1T38 A;  1TC3 C;  4PJJ A;  3I4N J;  3FXM A;  4P55 A;  5B1B H;  2EZL A;  2ZXI A;  5A2Q K;  3I59 A;  1WJ5 A;  3OYB A;  3BTL A;  2W00 A;  3D0S A;  3BTJ A;  5HLT A;  3IKT A;  4DQ2 A;  5LEJ A;  4OAY A;  2XGD A;  1MW7 A;  2DTZ A;  3DCF A;  2PMH A;  2VKE A;  2R5Y B;  2VIX A;  1JJ6 C;  5L3B A;  2H27 A;  2DXI A;  4IQ4 A;  1T8I A;  2OCC H;  3ML6 A;  1ZGJ A;  1RRJ A;  2R7W A;  1MND A;  3OOU A;  4G8X A;  3ZQ7 A;  2ZB9 A;  1WJE A;  3ZMS A;  4N9I A;  3FBI B;  4BE2 A;  2F2E A;  3HBL A;  4HYE A;  1VQP I;  5LD2 C;  3ABK H;  4TV7 A;  1B8I B;  1YW9 A;  2DOA A;  3S3N A;  3DLL F;  1S7A A;  4OU0 A;  1ON1 A;  4PK4 A;  1HCR A;  4GO1 A;  3G73 A;  2L0K A;  1W36 D;  4CO8 A;  1XPX A;  1ZKG A;  2L9S A;  1B1B A;  1EV7 A;  1IG7 A;  2DDA A;  2GIV A;  4EAT A;  1G3W A;  2LKS A;  3RCO A;  4DYC A;  4RS8 A;  2HFH A;  2VI6 A;  2PN6 A;  5HOD A;  1JHF A;  3C1D A;  2EIM H;  4FT8 A;  3TQN A;  2A5W A;  1J09 A;  2E1M B;  2LF8 A;  4AD9 A;  2ZFW A;  3HUG A;  1J7K A;  1WGX A;  3HGG A;  4RAZ A;  3QAH A;  1FYM A;  4RGR A;  2NVU B;  2A05 A;  2HOA A;  4Y17 A;  3D1N I;  2HDD A;  1FWZ A;  1B72 B;  3FIW A;  2P5V A;  3RPU D;  3BP8 A;  4Q48 A;  4ON0 A;  1Z6R A;  2OC6 A;  4RBO A;  3J7A O;  1R22 A;  3H3Z A;  1PP7 U;  2DLL A;  4HX8 A;  2Y30 A;  4YEJ A;  3K4L A;  2B9S A;  1ZLK A;  2AO9 A;  1FTT A;  2HKO A;  3EPZ A;  2P5K A;  3SHF A;  3GTQ J;  2WB1 N;  2OJE D;  2VJJ A;  1I1G A;  2DN0 A;  1ULY A;  4L9J A;  3WTU C;  3FX3 A;  4DZP A;  5FKO A;  1K6O A;  4E7Z A;  4YIF A;  2TRT A;  3TMO A;  3Q0U A;  5BPI A;  1DQU A;  3BCA A;  3K10 A;  5FLV A;  3IRR A;  4XSX F;  1SMT A;  3S3M A;  1FP1 D;  1QU3 A;  1T2K A;  4BH9 A;  1QGP A;  4JQF A;  5F0H A;  3PNV A;  2ZFU A;  2CYY A;  1I39 A;  3TO7 A;  4I6Z A;  1O57 A;  1V55 H;  2DDB A;  2Y9Z A;  1XDU A;  1SEU A;  1G59 A;  2V9K A;  3H5N A;  1O3R A;  2ID6 A;  2NAZ A;  2ZME C;  1S72 I;  1HKT A;  3ONQ A;  2LNB A;  3ECH A;  2IS2 A;  3JTG A;  4B43 A;  2CQN A;  4FE7 A;  1HW5 A;  3J80 K;  4DZJ A;  3WTX C;  2OTJ I;  3OYC A;  4A6E A;  2L5Q A;  3ZMT A;  4PJM A;  1LDK B;  1Y8Q B;  5J3L A;  4UUT A;  2IA2 A;  5D6E A;  3HOS A;  4KMF A;  2X1D A;  5FFZ A;  4FCY A;  2CG4 A;  3JRD A;  1TLH B;  3ZOB A;  3FMS A;  2R5Z B;  2F5D A;  2RAE A;  3DEU A;  2EIK H;  1FIA A;  3S1R J;  1FSE A;  1XGM A;  4YRV A;  3HG9 A;  3N4M A;  1MBG A;  1UZC A;  3KLN A;  3RPU A;  1QPI A;  4U0Y A;  1WH7 A;  2QQA A;  4ZJZ A;  2EV6 A;  3BG3 A;  3W2V A;  2WWY A;  2WY8 Q;  4EM2 A;  4UV8 A;  5EDN A;  3D5S C;  2VBY A;  2DU9 A;  3BG7 A;  1W1W E;  4CGZ A;  3HOV J;  2BV6 A;  4G94 A;  2XUB A;  1SAU A;  2K86 A;  1ZHF A;  5F6F A;  3GTP J;  3BPX A;  4BEH B;  2R7V A;  2H09 A;  3GCM A;  2E19 A;  2DMT A;  2JA2 A;  2OU2 A;  4D9J A;  2LBF A;  3CF5 F;  4F3Q A;  1D5V A;  1G3Y A;  2HNH A;  1R7J A;  2CUF A;  2OCE A;  1WJB A;  3LSM A;  1O3T A;  3KP2 A;  1MD0 A;  1HW1 A;  3P9K A;  3MAJ A;  2JUC A;  4XRS A;  4HBL A;  2Y0S N;  1STZ A;  1YS7 A;  1T33 A;  2L4A A;  5LRS A;  1RUN A;  3H3V K;  2BXY A;  1B9N A;  3I4M J;  2M5W A;  1JT0 A;  4RMN A;  2CGP A;  4V2F A;  3G6E I;  1Z3X A;  4HG2 A;  1DPU A;  3BZK A;  1K61 A;  1ODD A;  3GFI A;  4UNO A;  1H8A C;  3EDP A;  4F7Z A;  2VQC A;  4M6V A;  3V42 A;  3IL2 A;  2FQ3 A;  4DNC A;  4KA4 A;  2YSR A;  2WC2 A;  1E3O C;  2QEN A;  1G3T A;  4MLO A;  5K1Y A;  3ZP5 A;  1MSF C;  5IY5 H;  2M4K A;  3RKW A;  2YUS A;  2XGC A;  3NEU A;  1R5H A;  1F43 A;  3TED A;  5LGU A;  3LWF A;  1VQ7 I;  1IAW A;  5E1W A;  1RR8 C;  3ZCO A;  3H9G A;  1V5E A;  5L3D A;  4HZF A;  4ZDL A;  2YPR A;  2JZY A;  5FRO A;  1J75 A;  3AAF A;  3CCV I;  1KQ9 A;  1OCR H;  4Q47 A;  3IP4 B;  5DUK A;  3S93 A;  2Z3Y A;  5IOZ A;  4KT5 C;  4Q4Z F;  1SFO J;  2LRD A;  1IXS B;  1VQ4 I;  4BHC A;  4WWC A;  2MGQ A;  3JR9 A;  2V1X A;  1IRF A;  1T6S A;  2BE5 F;  4YG2 F;  2HI3 A;  1IXR C;  1VQ8 I;  4D5F A;  4A3L J;  4IHY A;  1UEL B;  4MTD A;  1LE8 B;  1P7J A;  1BN5 A;  1YLF A;  3ZQI A;  1QRY A;  4MEY F;  4IVN A;  2BY1 A;  4XN0 A;  4MQ9 F;  4O6J A;  1TNT A;  2K40 A;  2EJR A;  3ZMZ A;  1PYV A;  2X0L A;  5JFR A;  1ZG3 A;  1KYW A;  3E3V A;  1M1E B;  2HU9 A;  2X6Y A;  3PSF A;  1B72 A;  1N78 A;  3M4O J;  5KAI C;  2DI3 A;  3ECO A;  5D8L B;  2P7C B;  4Y33 A;  4YFN F;  4N4N B;  4YEL A;  2L7F P;  3R0A A;  1T56 A;  2KKO A;  1NHA A;  1XDS A;  2X6O A;  4L0Z B;  4ZDO A;  3V7S A;  2EFW A;  2VBX A;  3IC7 A;  4XKB A;  2VBZ A;  3LFU A;  4E7K A;  2HKX A;  1R9T J;  3KP5 A;  4ZTJ A;  1GVJ A;  1V54 H;  1FSH A;  1A6I A;  2M9H A;  5F04 A;  2KP6 A;  1C0W A;  3G2B A;  4E7L A;  3L2W A;  3GLX A;  1U5T B;  3QP5 A;  4ZDP A;  2GOM A;  3QPT A;  1PDN C;  5EG0 A;  1IJW C;  1FP2 A;  3U2R A;  1U8B A;  4RLF A;  3U21 A;  2EZH A;  2LTP A;  1YJ9 I;  4E4H A;  4C3I J;  3OYA A;  1WQ2 A;  1VFC A;  2CMP A;  2O6G E;  3HOX J;  3GWZ A;  1WVR A;  2PEX A;  4P9U A;  2K9S A;  3OYN A;  5IPA A;  2Y31 A;  3WHB A;  2R0Q C;  3TW6 A;  1RIO H;  2V9V A;  2FJ1 A;  1UJ8 A;  2V26 A;  4KIT B;  2HTS A;  2Z99 A;  4I7H A;  1TW3 A;  5IYC J;  1X58 A;  3G1L A;  3HTU A;  2K9L A;  1PUF B;  3ABM H;  2P0W A;  2JA7 J;  3CUO A;  3T8R A;  3RDI A;  3JW4 A;  3K4N A;  3O3K A;  3KZZ A;  5JLX A;  1DDN A;  4LG0 A;  5M5Y J;  1AOY A;  1KYZ A;  4CCN A;  1NG7 A;  2GAU A;  4KNY A;  3ISP A;  4IOC F;  1HLV A;  1R1T A;  3OIO A;  4BQO A;  2R7D A;  3HOT A;  2ID3 A;  3WE3 A;  4CCM A;  5LHH A;  1YW8 A;  3L9F A;  1ZGA A;  3K1N A;  2ETH A;  2R5Z A;  1RPW A;  1QBJ A;  1T08 B;  4LK0 F;  4FET A;  4HDU A;  1D1A A;  3CMM A;  3MZY A;  3KLO A;  4A5N A;  1SFU A;  4CYD A;  4QPQ A;  1B59 A;  5LEK A;  3MN2 A;  2XRN A;  4NC7 A;  5FD5 A;  2KL4 A;  2P6S A;  1ZN2 A;  4E7S A;  2AS5 F;  1X2M A;  3G71 I;  3GTJ J;  3SDB A;  4BHB A;  4A3K J;  2EK5 A;  2WB1 A;  1SVM A;  2MLK A;  1OMI A;  3H5A A;  4BL0 B;  4JYK A;  3T0Y A;  5HNH A;  4BEH A;  3JRI A;  2M7B A;  3RZO J;  2NXN B;  3DWL E;  3HGY A;  2M0M A;  2E5Z A;  3HSF A;  2DAO A;  3FK6 A;  4NC8 A;  5KCM A;  1W36 C;  1VQN I;  3SZP A;  2PMU A;  3F8F A;  4BGD A;  4FX4 A;  5E3O A;  3SXY A;  5LHI A;  1FLI A;  4C2U A;  2LDU A;  1I1S A;  4CYC A;  2R7X A;  2V79 A;  2QQ8 A;  2ZXH A;  1IRZ A;  2BGC A;  3H0G J;  3H0D A;  3F8N A;  2EFQ A;  2DT6 A;  2O3F A;  2VT2 A;  3K4M A;  4IL6 C;  2LG4 A;  5J6X A;  3TL4 X;  2IS4 A;  3RZD J;  4A3M J;  2DA6 A;  4QLC U;  1LQ1 A;  4II2 A;  4IKF A;  2E2J J;  2QQB A;  1FOX A;  1A31 A;  1HDD C;  1BR4 A;  1N75 A;  1XCB A;  5HS9 A;  4A93 J;  2Y0M A;  3MEX A;  1GXQ A;  2P6T A;  2EPF A;  2XC7 A;  3HTS B;  2GXA A;  3E5Q A;  5DCM A;  3O8G A;  3W6K B;  2QWW A;  1HA8 A;  3CES A;  1BOB A;  3VSL A;  1RNL A;  4ZYH A;  1LPQ A;  1HW2 A;  1KQ8 A;  3HXL A;  2CUJ A;  2NVY J;  4L5I A;  2H8W A;  2VKH A;  3TDU C;  4IHS A;  3LA7 A;  1ON2 A;  2ISY A;  1K83 J;  5LFA A;  3G3Z A;  5LHG A;  4RB2 C;  3KYC B;  4UVB A;  1D0X A;  1N77 A;  5CVR A;  3F22 A;  1X4P A;  2HPM A;  3FWE A;  3E6D A;  2DK5 A;  1E2X A;  4LFU A;  3EYI A;  3MWM A;  4UXN A;  5D4R A;  3WTV C;  3ZQG A;  3RKQ A;  2ELH A;  1DU6 A;  4QIW N;  1H0M A;  1FYK A;  2QSG X;  4KN7 X;  1LE8 A;  5L3F A;  5DTD A;  1H88 C;  4BS9 A;  2W25 A;  2E2I J;  1HBX G;  3JRG A;  4OIN F;  3M8E A;  3MKL A;  2MD0 A;  4UB6 C;  3MFK A;  5CKT A;  1FTZ A;  2IRF G;  4F52 A;  1XMX A;  3LST A;  2AQF A;  3I58 A;  2Z9O A;  3G4S I;  4DJA A;  1I27 A;  3K4J A;  5H2F C;  2FBH A;  2HYG D;  4ENJ A;  4UUV A;  3PL8 A;  4ENK A;  1XSX A;  4KYW A;  5TJJ A;  1XGS A;  2DFF A;  3K69 A;  2PQ8 A;  3T8T A;  1XD7 A;  3Q0V A;  2NS7 A;  4G7Z F;  3LQR A;  1FBU A;  3WGI A;  3RKX A;  4JP0 A;  3KYL A;  1HKS A;  1B4A A;  2PMZ N;  5E3L A;  1O7F A;  2RQQ A;  2DYR H;  4ENN A;  2X51 A;  4BU2 A;  1WJC A;  3SEZ A;  4RB3 C;  2GLO A;  1V5F A;  4IHX A;  1HKQ A;  4P1W A;  3HJE A;  1R5I D;  2EA2 A;  4WCG A;  5ILU A;  5L3C A;  1JGG A;  3OIQ A;  5AIQ A;  1X4O A;  3DU5 A;  1SFE A;  1DGW Y;  1MBE A;  2E1M C;  2YU3 A;  2HQN A;  3OS1 A;  2VJI A;  4IQJ A;  2EIJ H;  3WOD F;  4M71 A;  3KIO A;  1S7O A;  1MKM A;  1XTA A;  3H3U A;  1KU3 A;  3S3O A;  4F92 B;  1MDM B;  2IJL A;  3HC7 A;  2O9L A;  1U0J A;  1VQ9 I;  1SFK A;  1ORK A;  1TBX A;  3I71 A;  3M7G A;  1PUF A;  3VWB A;  5FRM A;  3PQJ A;  3HSR A;  4KT6 A;  3PQK A;  2W48 A;  1GXP A;  3B6A A;  1ZLJ A;  2X6W A;  2LP0 A;  2DFH A;  1GHC A;  4RAY A;  4P5O A;  5F1R A;  4A3J J;  1IDZ A;  1X2N A;  1Y0N A;  3LL7 A;  1HF0 A;  2HQ5 A;  3HL2 A;  3CME I;  2OA4 A;  3MMY B;  1V3F A;  3F0C A;  2IGO A;  3AKZ A;  4NBQ A;  1OYY A;  3BG9 A;  1GLN A;  3LSJ A;  1BC7 C;  1SVO A;  3FXJ A;  3GF2 A;  4O3M A;  2QSF X;  4QSH A;  5FO5 A;  4BE1 A;  1JKP C;  1X1C A;  2XV4 S;  5HOO A;  3F21 A;  3E6M A;  4R79 A;  1ERD A;  4I01 A;  4AIJ A;  4GGG A;  2HXO A;  3RQ4 A;  2WAE A;  2NRA C;  4XNF A;  1ETW A;  5EEH A;  1JKO C;  1MH4 A;  2VT3 A;  2LY1 A;  3DLA A;  1ITY A;  3CQZ J;  1O3S A;  2L9V A;  3H5R A;  1IW7 F;  1QPM A;  2F4I A;  1Z7U A;  1XSV A;  3CC4 I;  2XAG A;  4CZC A;  5F08 A;  4BAC A;  1IGN A;  2DW4 A;  4UVA A;  1W7P B;  4EJO A;  2PX9 A;  3ERM A;  1K7A A;  3M3Y J;  4EJT A;  2DJI A;  1MZB A;  2AHQ A;  5HS8 A;  3I3L A;  1IN7 A;  2L7M P;  3LFK A;  4HV6 A;  4HF1 A;  3UNG C;  1BBY A;  2JSC A;  1WFX A;  1IDY A;  3ZQC A;  3G1M A;  1P92 A;  4B47 A;  5GP9 A;  3DF8 A;  1UG2 A;  3PO2 J;  5E18 F;  3JAM K;  5KNL A;  2BVM A;  3HB9 A;  4GYI A;  3DTK A;  3BOQ A;  3KEO A;  4IF4 A;  1YJN I;  3BWG A;  3CP2 A;  3OS0 A;  2STT A;  2HOT A;  5TGT A;  3DP7 A;  2Z16 A;  3CF2 A;  2BXZ A;  2L4M A;  1R23 A;  3BQZ A;  4MNU A;  3S14 J;  4XK4 A;  3F8C A;  4A0Z A;  2CSO A;  2K4J A;  3H92 A;  2XF6 A;  1YHQ I;  2PJR B;  3I9V 2;  3K1M A;  5CPR B;  5FGM A;  5K7F A;  5JHU A;  3OWT A;  1Y56 A;  4HX7 A;  4IRG A;  3JRA A;  4A69 C;  2FML A;  3QQA A;  2V4J C;  1YW7 A;  2ESH A;  3QOP A;  3RPQ A;  3WTZ A;  4E7I A;  4OOI A;  5D5X B;  1D0Y A;  5L3E A;  3DPU A;  3MKY B;  4L0Y B;  4A3C J;  2K3F A;  4XN3 A;  2HQA A;  1MJ9 A;  2DJN A;  4U0V A;  3ABU A;  4AYB N;  4BJ5 C;  2R3S A;  5EJC A;  2LC2 A;  1FPQ A;  1ZRE A;  1MMG A;  2BZT A;  3MQ0 A;  2KRH A;  2MH2 A;  1F5T A;  2FBK A;  2KHM A;  1ZAR A;  2B0L A;  4RGX A;  2XHK A;  4AWX B;  1WSU A;  2CWE A;  2D45 A;  1F9N A;  3Q5F A;  3F8B A;  3RTR A;  3EYY A;  3GTK J;  3I4P A;  4CCL A;  1OCP A;  2IA1 A;  3GZ5 A;  2MD5 A;  4HEA 2;  3LSH A;  3FHZ A;  2VUM J;  1TQM A;  4I98 B;  2DYS H;  3DEW A;  3GFM A;  1TWH J;  3LSI A;  3S1M J;  1EJ9 A;  3FMQ A;  4XLC A;  5E20 A;  2KDZ A;  4I02 A;  2KMU A;  2R7S A;  1G8X A;  3HZJ A;  4L9N A;  2E71 A;  1RUO A;  1OQY A;  1W7P D;  1BR1 A;  3R4K A;  2QYO A;  4E7H A;  1ZQ3 P;  3VOE A;  2QM3 A;  4A2U A;  2RNJ A;  2G7H A;  3FM3 A;  2QGU A;  2D5V A;  1GDT A;  1FEX A;  4BDY A;  1MMS A;  4DOZ A;  4M9S A;  4ANJ A;  2A61 A;  2ELK A;  2EA4 A;  2IW5 A;  4D7N A;  4CIC A;  4OWR B;  2A68 F;  5EZG A;  1ETV A;  1SD6 A;  1YX3 A;  1P4W A;  2ZSI B;  3GX4 X;  2Z5U A;  1TL8 A;  1MDM A;  2KFD A;  1OYW A;  2DMP A;  1LVA A;  2JRT A;  2Q2E A;  1IXC A;  5HLG A;  3G1O A;  4ZYA A;  2JQ7 A;  3RYR A;  5BQT A;  1LNW A;  5ERI A;  3JRF A;  2PI0 A;  3LNQ A;  2GM4 A;  2DA1 A;  3E5U A;  2LKX A;  3MCZ A;  4G6T B;  3KPH A;  4OIQ F;  3OYG A;  3IRQ A;  2EV5 A;  2V6C A;  2RGV A;  3JAM Z;  2E7X A;  4IOA F;  4XLF A;  2BY2 A;  1U5T C;  1BI0 A;  4KN4 X;  2W1O A;  1Q1H A;  2IGM A;  2H8R A;  1AA7 A;  2LH9 A;  2E36 A;  4PZJ A;  5E3M A;  2PJP A;  3UR3 C;  1EF4 A;  2MAB A;  3H35 A;  3ZQL A;  3FF5 A;  2FOW A;  3V7R A;  1CQT A;  1YS6 A;  1QA6 A;  3NWT A;  1YTY A;  2MLG A;  2JA6 J;  1YI2 I;  3K70 C;  2IS1 A;  3WG7 H;  2CQX A;  4KDP A;  2HTJ A;  2ZJR F;  2BW3 A;  1IUF A;  4C2T A;  5JI6 A;  2DA4 A;  5D5W B;  2M8G X;  1WHU A;  3RI4 A;  2H6B A;  4A3F J;  4A3I J;  2CV1 A;  4IHT A;  2PMZ A;  2FF4 A;  5CQE A;  1W7P A;  1P4X A;  1YQA A;  3KCC A;  1YO5 C;  1CF7 B;  5ILS A;  1VI0 A;  1G4D A;  4P9F A;  1XMA A;  1JHH A;  4BBS J;  1MNM C;  3GTG J;  2LSO A;  3D5R C;  4DYQ A;  4ZH4 F;  3L2V A;  2DK8 A;  4PFP A;  5J4V A;  2MA3 A;  1JUM A;  2GOX B;  1MBK A;  1F4K A;  1J5Y A;  3F6V A;  2GXG A;  4GCV A;  2RRE A;  3IKV A;  4JX5 A;  4J01 A;  1PUE E;  4HX4 A;  4XOR A;  3HOW J;  2DO7 A;  2XSD C;  2GA2 A;  4HPQ A;  4MFD A;  1Z21 A;  1VZ0 A;  3CCS I;  2QSH X;  3RKY A;  3DFG A;  1JT6 A;  2D2W A;  4PGH A;  5D5U B;  4RDU A;  2V1U A;  3OYJ A;  2HZT A;  5K7Z A;  4II3 A;  1QZE A;  2FQ4 A;  3CDH A;  2CUE A;  4EV0 A;  2CO5 A;  2E1C A;  1S7E A;  4NC6 A;  1ZAO A;  1LKX A;  2LY2 A;  4LOC A;  1DPR A;  3C7J A;  2PJR A;  2H1K A;  5FKM A;  2ZO4 A;  4XL9 A;  3SEQ A;  2GQQ A;  1FJL A;  1G2H A;  1TT5 B;  2KIS A;  3LSG A;  3W2W A;  3Q3S A;  3TOA A;  5M3F J;  3V8K A;  5F64 A;  1WPK A;  1VTN C;  3H9J A;  4ZC3 A;  3CLO A;  3JRE A;  2QEX I;  3I53 A;  3ZMV A;  2E60 A;  3IUO A;  4M6X A;  1N25 A;  1W5T A;  3GME A;  1U2W A;  1HST A;  4M74 A;  5DYM A;  4DIQ A;  2R93 J;  2ISZ A;  2UWM A;  3HRT A;  2L9N A;  2R5Y A;  4A3G J;  3DU6 A;  3HOU J;  2IGK A;  2HDW A;  2HZD A;  4XID A;  4IHV A;  4LJZ F;  1IF1 A;  3WU1 B;  1OR7 C;  1MJA A;  1TWA J;  5ICC A;  2JSP A;  4BE0 A;  1XGN A;  2CW8 A;  4GRI A;  4ESB A;  3KP7 A;  4M3E A;  2Z33 A;  5CJ9 A;  3OYE A;  1UG0 A;  1B8I A;  2XRL A;  4AUX A;  4XR6 A;  1X1A A;  2IGN A;  4EJW A;  1BL0 A;  2EFP A;  1QHG A;  1WI9 A;  4C3J J;  4BXX J;  3BR3 A;  4CUG A;  4HQM A;  1IRG A;  2G7U A;  5HDG A;  1RET A;  2JPB A;  2DQR A;  5CVU A;  2V1N A;  2NVX J;  1IN6 A;  1GV2 A;  4PDK A;  3A4C A;  3RJP A;  3L2R A;  2XAQ A;  3FXK A;  1T0F C;  5IP7 J;  2AQE A;  5EEG A;  2I10 A;  1SVL A;  4B48 A;  3MVP A;  1FC3 A;  2R7Z J;  3KEQ A;  4QPO A;  1H89 C;  1IUY A;  2VPR A;  3S2D J;  2DTR A;  1TZL A;  2M8E A;  2VXZ A;  4S0H B;  3IHU A;  3VEP A;  1T39 A;  2KRF A;  4D1Q A;  3ZQQ A;  1R1U A;  1J59 A;  3ERE D;  3K4K A;  3CCR I;  2KDO A;  2O0Y A;  2P7V B;  3NAU A;  2HVR A;  3R60 A;  3U1D A;  1ZGW A;  4PFO A;  2A3S A;  3FZV A;  1OKR A;  4IHW A;  2V6E A;  4PGG A;  3SJM A;  2FNP A;  1R36 A;  1YRN B;  1F1Z A;  4ITV A;  2IS6 A;  3R0J A;  4AYB A;  2L02 A;  2XRO A;  2IXS A;  3KZI C;  1RI7 A;  3RQI A;  1S8N A;  3QYF A;  4XBF A;  2CFO A;  4XLH A;  5GPC A;  2IPQ X;  2WAQ N;  5D8K B;  5BOX A;  5FKK A;  2KJB A;  3LMM A;  3IV5 A;  2NOG A;  4UVC A;  3B02 A;  1JI8 A;  2Q0O A;  5J8C A;  4MGR A;  3A01 B;  3CO7 C;  3QU3 A;  2VQG A;  1D0Z A;  3OY9 A;  4ABZ A;  1MMD A;  4ZYE A;  2ELJ A;  1R4M B;  2E1O A;  4CZZ A;  3P9C A;  4BXU A;  2E7W A;  2KIQ A;  2VBW A;  3E1S A;  3TBI A;  3PIO F;  3PIP F;  2F48 A;  1WI3 A;  2W4S A;  2Q1Z B;  3RYP A;  3CZ6 A;  4AIH A;  4R1H A;  2NVQ J;  3HEF A;  3ELK A;  3AFH A;  4G7H F;  1NTC A;  1FZP B;  1XB4 A;  3M8J A;  2EFN A;  1XGO A;  1REP C;  1TP4 A;  1CF7 A;  5CVI A;  2Y2Z A;  2OD5 A;  2XSJ C;  3ZMD A;  5JR3 A;  5HNF A;  5JVT A;  3J7Y J;  2XDV A;  1MSE C;  1OLT A;  4IZZ A;  4N0B A;  4PJL A;  4XKC A;  3K6G A;  2FA5 A;  4KMU X;  3DPT A;  3S1Q J;  3EET A;  2M4G A;  2X48 A;  3Q9S A;  3VYR B;  2LKP A;  4ZYG A;  3L1P A;  1JUS A;  1MNE A;  3F3X A;  3FXL A;  2D1V A;  3AG2 H;  5IT3 A;  2K27 A;  4N4O B;  3WTY C;  2M1B A;  2M3A A;  3PM1 A;  3IAM 2;  2P5L C;  4YII A;  2WV0 A;  1UHS A;  2NS0 A;  1G6N A;  3PO3 J;  3MZH A;  1DGR M;  1TWC J;  5J1R A;  4HLX A;  2W85 A;  1R5G A;  2ZCW A;  4LLL A;  3VSK A;  5HDK A;  3K7A J;  5K7H A;  3GZN B;  1LDJ A;  3OYH A;  3IH2 A;  2VE9 A;  2X6X A;  2AXT C;  9ANT A;  1XG1 A;  2QZ8 A;  4JBA A;  2JA8 J;  1NK3 P;  2DPU A;  2VOD A;  4RB0 A;  3OS2 A;  1WCM J;  3S1N J;  2R4G A;  1R4N B;  4M9X A;  1HQC A;  2F5F A;  3SQN A;  4RM3 A;  3JRC A;  2OPT A;  4V19 K;  4X0G A;  1VQO I;  1X1D A;  2CS3 A;  2OQG A;  3HRM A;  4U7D A;  3CCE I;  1SD7 A;  4KIC A;  1X3U A;  3BDD A;  2EH3 A;  3EUH C;  4BJ6 C;  1BOA A;  1UAA A;  5EGO B;  4EQQ A;  2XIG A;  5ILV A;  2QBY B;  2NYX A;  1RC9 A;  3GO5 A;  1EH8 A;  5DD4 A;  4BKX A;  2JA5 J;  2XAF A;  1V5G A;  2EB7 A;  4BAY A;  3ZQH A;  3GFJ A;  3K70 D;  3OL4 A;  4EJV A;  5CLS A;  3A02 A;  1VQK I;  1ACI A;  1H9T A;  4LGW A;  4QWQ A;  3BQY A;  2HOE A;  1K4S A;  3BG5 A;  3NQO A;  1ZRF A;  2HS5 A;  1FX7 A;  1RKT A;  1XMK A;  2E35 A;  4Y52 J;  1H9G A;  2JMW A;  1S6L A;  3QYB A;  4ZZD A;  1Z1D A;  2R7F A;  5CVJ A;  3E5X A;  3BRO A;  2YS9 A;  2M87 A;  4N9H A;  3TKY A;  2DOE A;  3WHC A;  4BJT A;  5K5R A;  5C3E J;  2A6T A;  1YIT I;  1I6X A;  2JUG A;  1XSD A;  2ZSH B;  2BEO A;  1ZRD A;  1YOV B;  4C30 A;  2OF7 A;  2YX7 A;  3VYS B;  1WJA A;  2VB6 A;  1U9N A;  1SFX A;  3LQQ A;  3ZN1 A;  2LOO A;  5GAG J;  3T1B A;  4S04 A;  2K9Q A;  1SC7 A;  3FBN B;  2YR2 A;  4Y15 A;  4A0Y A;  2R7R A;  2XGX A;  1JXS A;  2BOL A;  1ONV A;  4XLA A;  2UXN A;  3QRF F;  3OYI A;  3JTH A;  2VJ4 A;  4MIM A;  2HXI A;  4A12 A;  2E5N A;  1VF9 A;  2K9M A;  1MMA A;  3CCJ I;  4RA2 A;  2M2E A;  3SDG A;  1KON A;  2X1C A;  2EQR A;  3U1K A;  2ZJP F;  1UFM A;  4FIS A;  3ROU A;  4ETS A;  2OTL I;  4I0B A;  1W0U A;  2VPL A;  3HHH A;  2VON A;  4HRI A;  3P9I A;  4XRM A;  2MBF A;  3JSP A;  5D5V B;  4MQV A;  2VOP A;  4E7J A;  3S8P A;  4XOP A;  4CXF A;  1TQP A;  1U5T A;  1UST A;  2K7L A;  1Z67 A;  3CUQ B;  5E1X A;  4I2O A;  1Z3Y A;  1D8K A;  3L09 A;  5E8I A;  3A0H C;  2H94 A;  2ADU A;  2H6C A;  3HM5 A;  1X3W B;  4Z2Y A;  2BYV E;  1KU2 A;  3I54 A;  1O3Q A;  4B44 A;  3GFL A;  5BMZ A;  1RR7 A;  4U88 A;  2IAI A;  1O7L A;  2OBP A;  5LLQ A;  2FE3 A;  3ASN H;  1A35 A;  1FOY A;  3VDX A;  3ESW B;  3QPL A;  3CMY A;  3IWZ A;  3JRH A;  4XQF A;  4LD5 A;  3FDY A;  4HAM A;  3PJR A;  4LIU A;  3MZ8 A;  4MEX F;  4ESJ A;  4EGY A;  3C2B A;  3F23 A;  2M7A A;  3K4B A;  2AXL A;  3VB2 A;  5J1Y A;  2R7Q A;  3PNY A;  2CQK A;  1MGT A;  1GT0 C;  5GAE J;  2QUF A;  3OIP A;  2O61 A;  1LVK A;  4I09 A;  3FMR A;  4BQQ A;  3W6V A;  3ZR8 X;  3OYK A;  3NAR A;  4AID A;  2JVG A;  1YIJ I;  4CH7 A;  3S16 J;  2HR3 A;  2DA3 A;  3MD2 A;  1Q1V A;  5FJ8 J;  1DUX C;  3EUA A;  3JCU C;  2E34 A;  1ZRC A;  1JKR C;  5E3N A;  3I55 I;  2BBY A;  2HWV A;  3LA2 A;  1BJZ A;  3DV8 A;  3HYI A;  4ESF A;  5L3G A;  1I50 J;  3TP3 A;  3BR1 A;  3M1C A;  1WZ2 A;  2LYC A;  3BZ6 A;  5FRN A;  4F55 A;  2KIM A;  1MMN A;  5GTI C;  5FFX A;  2QVO A;  3JRB A;  2B7E A;  4NB5 A;  5HLI A;  1IV6 A;  2FNA A;  3NRV A;  4QTR A;  4LLG F;  2KZG A;  1UCR A;  2R92 J;  3C2H A;  4L5J A;  1FMW A;  4HSR A;  1Y0U A;  1WJD A;  2Y48 A;  4IRH A;  3BT9 A;  5DEQ A;  1QVU A;  4HW0 A;  5D6F A;  3R61 A;  2WAQ A;  1BR2 A;  4BUP A;  4C9Y A;  3F72 A;  1QZY A;  2FUG 2;  4O5V A;  4RAG A;  3OYD A;  4A3E J;  5CYV A;  2F5C A;  2MFZ A;  1YG2 A;  5AIP A;  2FD5 A;  2NOJ B;  5KK1 A;  5LGT A;  3CCU I;  1GVD A;  3C18 A;  1A36 A;  5IYD J;  2LY9 A;  3OSF A;  2KIU A;  3KYD B;  5HDN A;  4BYY A;  4M72 A;  4CCK A;  2TCT A;  2QBY A;  2WTE A;  5JHF A;  3L2U A;  2DT7 B;  3KEY A;  2W84 A;  3ZQF A;  3GYH X;  4BNC A;  1OR7 A;  2HPI A;  2EFO A;  3HKZ A;  2IA0 A;  2JRM A;  2V1D A;  5DS9 A;  1A5J A;  5HS7 A;  2GXB A;  1LUJ B;  3O8H A;  4KIF A;  3ASO H;  3KP4 A;  4IX7 A;  2XF5 A;  1DP3 A;  2W24 A;  4RGS A;  2XF7 A;  5IOY A;  2PLY A;  2XAU A;  1FBQ A;  2BY3 A;  4G12 A;  1AKH B;  3GTM J;  3GBG A;  4HDV A;  1XCV A;  5F0F A;  1BI1 A;  3HPG A;  1MBH A;  1PJR A;  3E6B A;  1Z7L A;  4WXH A;  5EEA A;  5DCF A;  2LBF B;  1HDP A;  1T0F A;  3CJR B;  4F91 B;  2OAZ A;  4PJ0 C;  4LLN A;  2WAD A;  1SD5 A;  1UB9 A;  3J7A Y;  2J5O A;  4FE4 A;  1Z0X A;  4XKW A;  2W7N A;  5FLM J;  1Z05 A;  4B1R A;  5H6Q A;  3CC2 I;  3LA3 A;  4RB1 A;  2E2H J;  5F27 A;  2XPW A;  4M3D A;  2O8X A;  1TT0 A;  2DBB A;  2ZJ2 A;  2CRG A;  3LOC A;  3WTW C;  3NWS A;  2A69 F;  3I5U A;  2WBM A;  4LB5 A;  4RM2 A;  1L3L A;  4FX0 A;  5DUI A;  2P8T A;  4BY7 J;  4GYG A;  2XKP A;  3V8L A;  3K2Z A;  2DA2 A;  3BCB A;  2KPM A;  3HOY J;  4FAS D;  2CFX A;  1TWG J;  2HYF A;  5LRR A;  4KUM A;  1YX5 A;  4IJA A;  3H1C A;  1VQL I;  1TNS A;  3KP3 A;  2YX4 A;  4R8H A;  5EYR A;  3CUQ A;  1BIB A;  2X9D A;  3DKW A;  3K9T A;  2LFB A;  2ECC A;  4D7M A;  4RGU A;  4JK1 X;  1B9M A;  5D4S A;  4XLP F;  4M73 A;  2XVC A;  2E1N A;  3IH4 A;  1S5L C;  3VYT B;  3M9A A;  3W2A A;  3BR2 A;  4UUS B;  1ENH A;  2G9W A;  1IV8 A;  2LLK A;  2D1H A;  4HF2 A;  2DPD A;  1Y6I A;  1R71 A;  1OCO H;  2KLO A;  4NHJ A;  4A3B J;  3AG1 H;  2C6Y A;  3TP0 A;  4BQA A;  4WXD A;  2QA4 I;  1Y8R B;  1OFC X;  3JSO A;  3PSI A;  1BA5 A;  3CJN A;  5IT9 K;  2M34 A;  2FXA A;  1U78 A;  4PSX A;  1UHM A;  5E1Z B;  1LDD A;  3GTO J;  2A07 F;  2FOK A;  3QU6 A;  1Y1V J;  5C4J J;  1B6A A;  2RDP A;  5GAD J;  1D3Y A;  1YE9 A;  4M9Z A;  1MIJ A;  5ICG A;  5J8F A;  1W0T A;  3DEE A;  4RLQ A;  2VAS A;  2HOS A;  3J81 K;  1Z9C A;  1A04 A;  4DBQ A;  2DFI A;  3A0B C;  2B63 J;  4NQW B;  4UB8 C;  2L7K A;  3HIF A;  3AG3 H;  2JVH A;  2KZV A;  2FEZ A;  2GWR A;  2Q8K A;  1OPC A;  1RES A;  3I64 A;  2K3P A;  4M3B A;  5GTH C;  3LSP A;  5J40 A;  4KJZ A;  4MO7 A;  2VQL A;  2RC4 A;  3BTI A;  5E79 C;  3OMY A;  4LK1 F;  4G7O F;  2DCE A;  2RQP A;  4XRS G;  5EG0 B;  2ZC2 A;  3DQV C;  5J47 A;  1WJF A;  3WE2 A;  1S9H A;  2JK3 A;  3M07 A;  3O6B B;  2BHY A;  5DV5 A;  4OMZ A;  2MC3 A;  2CV2 A;  3HPH A;  4S05 A;  3FHN A;  3QPH A;  1LEA A;  2L2O A;  4M3F A;  3D5L A;  4P96 A;  4WX9 A;  3GEZ A;  5KHD A;  1WWX A;  4KFC A;  3SFZ A;  2KRC A;  3CC7 I;  2ESN A;  5C4X J;  1D1C A;  3TO9 A;  3EUH A;  1LFU P;  1SD4 A;  2F6C A;  1IC8 A;  4NNJ A;  4WF2 A;  2HYJ A;  2FBI A;  4DBR A;  1X1B A;  3SYT A;  5TRD A;  5CVV A;  2HVS A;  5CQG A;  4LG0 B;  3CCM I;  4IEJ A;  3TOB A;  5EZH A;  2VXD A;  5DD8 A;  1VQM I;  1VQ6 I;  3OYL A;  5A2Q Z;  1P9Q C;  2MC4 A;  1Z91 A;  4G9Y A;  1BC8 C;  4DYR A;  3SZG A;  4D5C A;  2IT0 A;  1FMV A;  1T95 A;  2V7F A;  3BZC A;  3I0T A;  3FXR A;  3VFZ A;  2W82 A;  3HRU A;  4BQN A;  5E17 F;  4OIO F;  5AON A;  2VKD A;  3DTE A;  4WXC A;  4NUB A;  2K9N A;  1QQI A;  4B3X A;  5DM7 F;  4HQE A;  1QNT A;  5BPD A;  2N8G A;  2VJ5 A;  5LGN A;  4W1U A;  1PVE A;  3J7Z I;  4CSW A;  3AL0 B;  3E6C C;  2RKH A;  1AKH A;  3X2Q H;  4CHU A;  3S2H J;  3BJ6 A;  2OQR A;  3V7C A;  1E17 A;  1ETK A;  1G3S A;  3KP6 A;  2CH0 A;  1OCT C;  2F5V A;  3QWL A;  1AU7 A;  3PUF A;  1ZEL A;  2LVS A;  3W6J B;  3S2W A;  3C3W A;  5H6R A;  2K85 A;  2DA7 A;  2ECB A;  3Q9V A;  4MFE A;  2NNY A;  3BY6 A;  1W5C C;  1U8R A;  1T98 A;  2LMD A;  2CUZ A;  2RN7 A;  1IN5 A;  4GXO A;  2EBI A;  4XRF A;  3VOD A;  4ZYD A;  4CYC B;  1ZR2 A;  3FKJ A;  4MHG A;  5IT9 Z;  2XPV A;  3ZPL A;  3FIS A;  4RAF A;  3H36 A;  3ZXS A;  1RKW A;  4IXA A;  3B6C A;  1GV5 A;  3BTC A;  1JUP A;  2XGE A;  2K4B A;  1I6H J;  3BG6 A;  2R7O A;  2FU4 A;  3FXQ A;  1SAN A;  2UZK A;  1HOM A;  3CO6 C;  3TGN A;  1YYV A;  3J81 Z;  5DCM B;  4U87 A;  4HST A;  4I76 A;  4K2E A;  2MYS A;  1IO2 A;  1SAX A;  1JTY A;  3V8J A;  3MKW B;  2OZ6 A;  3PFY A;  3LSR A;  2HDC A;  4BDZ A;  3M1E A;  5B5E C;  3QPS A;  3A2K A;  4L5E A;  3BR0 A;  4PSW A;  1I3Q J;  2VKV A;  1EH6 A;  2M45 A;  3IH3 A;  1NK2 P;  5FD6 A;  2DOD A;  2O5R A;  3FK7 A;  3F8M A;  4W97 A;  4C3H J;  2DMN A;  4AVZ A;  4XSZ F;  5FLX K;  4M6Y A;  2QKL B;  2FSW A;  5ICE A;  2XB0 X;  4Q5S F;  1XN7 A;  4UUS A;  3CLQ A;  3S32 A;  2COM A;  4LMY A;  2CJJ A;  1I5Z A;  1KQ0 A;  2OV7 A;  3AG4 H;  4F93 B;  2K02 A;  4AIK A;  1HC8 A;  3CDL A;  1USS A;  3I56 I;  1R6R A;  2EIL H;  1I3A A;  3J80 Z;  4BHP A;  4JOM A;  4B8X A;  2CQ7 A;  2DA5 A;  4AM3 A;  2VN2 A;  4M3G A;  4WK8 F;  4BXF A;  5B1A H;  1J2X A;  2LR8 A;  3BJA A;  1FYL A;  1FY7 A;  1S3J A;  2GBY A;  1NG6 A;  1WRJ A;  4H0E A;  1U3E M;  3ULQ B;  2K5C A;  2VL8 A;  3HDD A;  2EZI A;  1SMY F;  4NQW A;  4YIR X;  2GZW A;  3Q0W A;  3CUQ C;  2R7U A;  3BC8 A;  2L01 A;  3RSN A;  3WTT C;  2VC0 A;  4OIR F;  3CCY A;  4I99 C;  1Y39 A;  4Y7N J;  3TO6 A;  2KIF A;  3E97 A;  3BJO A;  4H4K C;  2CV0 A;  2DMU A;  2L54 A;  1OIS A;  2ZXW H;  4A6D A;  2EZK A;  4EMS A;  2ZXJ A;  3KZY A;  3IWF A;  3HKZ N;  2O7O A;  1QO0 D;  5C44 J;  2QCO A;  4EEF G;  2ZME B;  1P7I A;  1XC5 A;  5H20 A;  4Y4R A;  2LD5 A;  4AC0 A;  1J9I A;  1D8J A;  4XMY A;  4NDL A;  4V2G A;  1X3Z B;  2WA0 A;  1FOW A;  4JX4 A;  5IP9 J;  3S17 J;  2Z2S B;  1HXD A;  5B66 C;  4Y13 A;  2DQL A;  2WY7 Q;  3CDI A;  2IBD A;  4GDF A;  4U0W A;  5E8G A;  4EJU A;  3TDZ C;  1AHD P;  1EH7 A;  2A6H F;  1LEB A;  1EA3 A;  4LIT A;  3B73 A;  2XAS A;  1Z6T A;  5J1U A;  3L2C A;  3LAJ A;  4XOT A;  4X1E A;  4FHT A;  4KIS A;  3ZMU A;  5DM6 F;  2A5Y B;  2LF7 A;  2CW7 A;  2RNG A;  1BM9 A;  4YFX F;  4OMY A;  1K79 A;  4L18 B;  1ZTR A;  1W5S A;  4EM0 B;  3E7L A;  1IN4 A;  2F5E A;  3DKX A;  2QLZ A;  4JX6 A;  4ZTF A;  3DBR B;  2EV0 A;  2JWT A;  1JKQ C;  3FM5 A;  2FMY A;  2QQ9 A;  5EF6 A;  1ZG5 A;  2ME0 A;  5K5Q A;  3WU0 A;  4CCJ A;  2KQR A;  1YFH A;  5F0C A;  5GPA A;  3CP8 A;  1FIP A;  3PUB A;  1JJ8 C;  2DMQ A;  4KIG A;  3BR5 A;  3BLY A;  3OV8 A;  4MTE A;  1OCC H;  3DKY A;  5M5W J;  2W57 A;  4HA8 A;  2Z1D A;  5IYB J;  1K78 B;  4BY1 J;  1X19 A;  4E6K G;  5FLX Z;  3EUK L;  4J19 A;  3OYF A;  2CQQ A;  1TTY A;  3IAS 2;  3L2Q A;  3GTL J;  2TDX A;  1TQI A;  4A5M A;  1J0R A;  4DW6 A;  1ZK8 A;  3M8F A;  4IPA A;  4XLN F;  3OR1 C;  2YU9 J;  1FOK A;  1UMQ A;  5BNG A;  3FXU A;  3WU2 C;  2IP2 A;  5ED4 A;  1DU0 A;  3A03 A;  2WAF A;  1KZH A;  2DT5 A;  4HLY A;  5FB2 A;  5KVR A;  2XB5 A;  1YJW I;  2H1L A;  3OOP A;  4XKV A;  5ICF A;  1U9O A;  1S29 A;  2I8D A;  4OAZ A;  1W4M A;  4UHT A;  1F36 A;  4C2M J;  5M5X J;  4XM3 A;  4J00 A;  1TW2 A;  1NH3 A;  2ACJ A;  2GIZ A;  3REO A;  2LK2 A;  1ETO A;  1V4R A;  3K2A A;  2KJC A;  1UHW A;  1LFP A;  2Y75 A;  3CTA A;  2VOO A;  2ZKZ A;  2WV1 A;  1U6G A;  1FBS A;  4B4C A;  4AU7 A;  1QVT A;  3VYU B;  4CA0 A;  4L9V A;  4IRI A;  2L9R A;  2STW A;  3A1Y A;  1KA8 A;  4HF0 A;  1X1P A;  5J4Y A;  4A3D J;  1Y1W J;  1ZR4 A;  5KAF C;  3QP6 A;  4CCO A;  3I59 B;  3OYM A;  3E0J B;  2QKM B;  4FTH A;  3FKI J;  2BHZ A;  3CJT B;  2I5U A;  4AVP A;  3COA C;  4E70 A;  1O4X A;  2CU7 A;  2XPU A;  4LG3 A;  4HV5 A;  3HOZ J;  2LRE A;  4DGW B;  4HNU A;  1D1B A;  3N05 A;  2J5P A;  2X4H A;  3ZRG A;  4D0P A;  2GA1 A;  3SFI A;  4BBR J;  4B3A A;  1YRN A;  5DDG A;  4Z6Y A;  2PBI A;  1BW6 A;  2X1E A;  3GUD A;  2JTV A;  6PAX A;  1MJB A;  5HVQ C;  1E3P A;  1LFB A;  1ETQ A;  3HSE A;  3DTI A;  1KU7 A;  1A6Q A;  2XAH A;  3BR6 A;  2Y0S A;  1POG A;  3QOE A;  4XIC A;  3CJQ B;  3F9K A;  3GLL A;  3GW2 A;  1JGS A;  5FKL A;  5B3S H;  4X6A J;  1MH3 A;  1XX5 A;  4XON A;  3OR2 C;  2RV8 A;  2M0C A;  2MG4 A;  2JJ7 A;  4G6D A;  3CMA I;  2ZNY A;  4YFK F;  2ZBK A;  3PFI A;  3A01 A;  3H9Q A;  5BS6 A;  3O2P E;  1AWC A;  1YIO A;  3OSG A;  1E3H A;  2EWN A;  3C2G A;  1OJL A;  2FX0 A;  3DBH B;  2BVL A;  2HQR A;  1QHH D;  3L00 A;  1BI3 A;  2L7Z A;  1P2F A;  4HNT A;  2FRH A;  4KIB A;  1K6Y A;  1R1V A;  1TWF J;  3HUG B;  2UXX A;  3VPR A;  4GFB A;  1WH5 A;  4EGZ A;  2ZME A;  2IEK A;  3DPL C;  1R49 A;  2COB A;  5GAH J;  3P7N A;  2NNN A;  2RVC A;  5FKN A;  3F6O A;  4Y3O A;  5JVG F;  2G0E A;  2HVQ A;  3EQL F;  1R00 A;  3OL3 A;  1XS9 A;  3FXO A;  2O03 A;  3ABT A;  2PFB A;  3QYE A;  2Q2E B;  2VC1 A;  1L0O C;  2F4M B;  2OZU A;  2HGC A;  2X85 A;  4PUS A;  3RIR A;  3L7W A;  1K4T A;  5M3M J;  4LIV A;  4U7B A;  4EM1 A;  2IVM A;  1ZG1 A;  4ZZL A;  1EKE A;  4OIP F;  4PJN A;  3GVA A;  2O8K A;  2ZJQ F;  2BY0 A;  4EVI A;  2V9P A;  4A0X A;  4UY8 I;  2OUM A;  1MBF A;  3WGG A;  3HRS A;  2UV1 A;  1IN8 A;  3QOD A;  3K0L A;  2R7T A;  3K4C A;  4HOB A;  1LJ9 A;  2A6E F;  1MBJ A;  2KT0 A;  2CW0 F;  2M30 A;  1FT9 A;  2XAJ A;  4UV9 A;  5HLH A;  1RZ4 A;  3BPV A;  3TW7 A;  2HEO A;  2ME6 A;  3S15 J;  3UKG A;  3R6S A;  1CGP A;  3MKZ A;  1ZH5 A;  4B09 A;  4HNV A;  2MSY A;  5LBQ A;  1DP7 P;  1OYI A;  4PCQ A;  1ETY A;  3ABL H;  2NVT J;  1GUU A;  1ZYR F;  2P81 A;  2BW3 B;  3U9G A;  1R58 A;  3K1P A;  3DBL B;  1JE8 A;  3LSK A;  2Y9Y A;  1ETX A;  1APL C;  1P4A A;  1KU9 A;  1WKM A;  4L9T A;  3V4G A;  1KGS A;  1VQ5 I;  1K78 A;  1HSJ A;  3KFW X;  2JPC A;  5EGO A;  1BW5 A;  1Z77 A;  1QZZ A;  2F4O B;  2MH9 A;  3HHG A;  5JLW A;  3N97 A;  2MW8 A;  3SZT A;  1FNN A;  3WTS C;  1LB2 A;  3DXJ F;  2XKO A;  4CDG A;  4FQG A;  2QF7 A;  3LAP A;  2NS8 A;  4G6Q A;  2JT1 A;  2VLA A;  1IRX A;  3CCL I;  2P4W A;  2L3D A;  3ZN0 A;  1VND A;  2DFE A;  1BI2 A;  3CCQ I;  3CD6 I;  1BIA A;  4I0A A;  2PG4 A;  2VQH A;  2ICW G;  1P6R A;  2EIN H;  1JTX A;  2DOF A;  2JN6 A;  2VE8 A;  4XLE A;  2UUZ A;  3GXO A;  3PNT A;  3AL0 C;  1OCZ H;  1D5Y A;  3KE2 A;  3W3C A;  2ZNZ A;  3T5X A;  5IP6 A;  5K5O A;  1PP8 F;  2Y69 H;  1BJA A;  3WGH A; 
#chains in the Genus database with same CATH homology
 3CUQ C;  1U5T C;  1W7P B;  2ZME C;  1XB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...