2YUSA

Solution structure of the sant domain of human swi/snf-related matrix-associated actin-dependent regulator of chromatin subfamily c member 1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
79
structure length
79
Chain Sequence
GSSGSSGTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLENSDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SWI/SNF-related matrix-associated actin-dependent regulator
publication title Solution structure of the SANT domain of human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 9
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2yusA01
3JRGA 2ECCA 4MIMA 3GTJJ 4X1EA 1H89C 2VUMJ 3GBGA 5DS9A 4JX6A 1MBGA 4BY7J 1ETQA 2JWTA 3BR1A 3O8HA 2DA7A 4A3JJ 3CCYA 2L7ZA 1OFCX 4M3BA 2Y9ZA 1ETVA 3HGYA 1PUFA 1AHDP 1QVTA 3S15J 3K7AJ 4A3BJ 1POGA 2IEKA 5FLMJ 4UUSB 1Q1VA 2XPVA 2DA5A 4A3FJ 2JA7J 1U9OA 2EQRA 2JA6J 1IC8A 3PM1A 1TWAJ 1MH3A 3HM5A 4FE7A 1T56A 2HDDA 4BBSJ 2CUEA 2VKVA 1BW5A 1Z0XA 3BT9A 4A3KJ 1RESA 1HLVA 5JLWA 1BJZA 4B4CA 5FKKA 1ZKGA 2FD5A 4D7MA 3GTQJ 3TEDA 2NS7A 4UUTA 1I3QJ 1LFUP 1MSFC 1BA5A 1ZTRA 2G0EA 1IRZA 3ZQIA 4Y52J 2R0QC 1B8IA 2COBA 4AC0A 2JK3A 4XICA 2KT0A 3GTMJ 3LSPA 2Y0SN 3Q0UA 1X2MA 1ORKA 1IV6A 2NVXJ 3A01B 3H0GJ 5J1UA 1Y1VJ 4D7NA 2M9HA 2DMQA 2M34A 3BTIA 5IYBJ 2LVSA 2E2HJ 1U9NA 3JRBA 1A5JA 1W0TA 5K7FA 2Y31A 3Q3SA 1AU7A 5F0FA 3TP0A 4W97A 1ENHA 1ITYA 4DZJA 2VKEA 1RETA 5M3FJ 3MKLA 2JN6A 3RKQA 9ANTA 3K2AA 2QCOA 1O4XA 5GPAA 5C4JJ 4Y7NJ 3TW7A 2M2EA 3FKIJ 3HOZJ 1HOMA 1WPKA 1IDZA 2R5ZA 4M6VA 1XS9A 4B1RA 4A3IJ 3BR5A 1Z77A 1FJLA 1FEXA 2HYJA 2D5VA 4M3GA 1U8BA 1JJ6C 1YRNB 3A02A 3S17J 5HODA 2FQ4A 2L9RA 2LP0A 5E3MA 1NK2P 3HGGA 1JKPC 3SJMA 2XPWA 1HDPA 1MBFA 3QPSA 3ZQGA 3IV5A 2DMPA 2GBYA 5M5WJ 2EZHA 1LFBA 2AO9A 1ZGWA 1TWFJ 3PO2J 5M5YJ 5C3EJ 2AHQA 3BTJA 4A3LJ 2O8KA 4BXXJ 2LR8A 1QVUA 1SFOJ 2CU7A 5IP7J 3CDLA 2JA5J 3S1RJ 2CQXA 2XB0X 3BR6A 1B72B 4A3EJ 3S2DJ 3BR3A 5EG0A 3A01A 3M4OJ 5J3LA 3B6CA 4IEJA 1VFCA 2JJ7A 1BL0A 3TW6A 2ELKA 2XRLA 2HI3A 2NVYJ 3C2BA 4QIWN 5JLXA 5K7HA 4IHXA 3NAUA 2O9LA 1JKQC 2M0CA 2DTZA 3HKZN 1ZK8A 3B6AA 2LD5A 2PMZN 3DCFA 3FK7A 1LE8B 4A3GJ 2X9DA 3ZQLA 4M3EA 4V2FA 1XC5A 1TWGJ 1GV5A 2E2IJ 3HOUJ 2Y2ZA 3HOYJ 3JREA 1IG7A 2R5ZB 3A03A 2IBDA 5IOZA 2GM4A 4J19A 5EZHA 2L0KA 4IHVA 2VI6A 3OSGA 2K9NA 4AYBN 1YRNA 1S7EA 2LFBA 5J1RA 1FIPA 4M3FA 4A3DJ 2KDZA 4DYCA 4FTHA 3MVPA 4XRMA 1I50J 1P7JA 3HBLA 4AUXA 5FJ8J 1F36A 2QF7A 2CJJA 3JRHA 1WGXA 1JTYA 1JKOC 4C3JJ 2MGQA 1ZQ3P 4MFDA 4D5CA 4MFEA 1UG2A 1JKRC 1FTZA 3MN2A 3S1MJ 1X2NA 2LKXA 4CYCB 5M5XJ 1IGNA 2P81A 1ZR4A 2XGEA 5F0CA 2TRTA 1G2HA 1B72A 4C3IJ 3LSJA 5EG0B 2K9QA 2H8RA 2RAEA 2TCTA 3RQIA 2ECBA 1HF0A 1VNDA 3QPLA 1JT0A 1RR7A 2CUFA 1MNMC 4FISA 1FTTA 2XB5A 2B63J 1UMQA 1ZR2A 1MH4A 3HOWJ 2MSYA 5EGOB 5F27A 1WH7A 1LE8A 1UHSA 2NS8A 4XIDA 4DYQA 3D1NI 2HOTA 2YS9A 4L5EA 3OOUA 2R7ZJ 3FIWA 1Y1WJ 4XK4A 3S2HJ 5FKOA 1HDDC 1TWHJ 3TP3A 3JR9A 2XGCA 5E3LA 1D5YA 3CMYA 1H8AC 1U78A 3E7LA 4JX4A 3LSRA 5F04A 1TC3C 4QSHA 4C2MJ 1K83J 5IP6A 1X58A 2LY9A 2WAQN 5EZGA 3ZOBA 2XPUA 2JA8J 5FLVA 1GVDA 2ID6A 2OF7A 4XRSG 5IYDJ 2EH3A 2K40A 4BY1J 4XRSA 3W6VA 3JRIA 1QRYA 5F0HA 1GUUA 2NVTJ 2ME6A 4IHYA 2O7OA 5E3NA 2R93J 4B3AA 1RKTA 3ZQCA 1SANA 4NDLA 3SFIA 5IYCJ 4CYCA 4I76A 1MBJA 3LSGA 2MG4A 2EZIA 1MBEA 3IH3A 3NARA 4FCYA 2LLKA 3JRFA 4S0HB 4BBRJ 5K7ZA 3M3YJ 5DTDA 5FKLA 1OJLA 1JUPA 3HEFA 5EGOA 1MBKA 3GTKJ 3WHBA 4DW6A 2W48A 1NTCA 1WH5A 3WHCA 4A69C 3BG9A 4EEFG 2M8GX 3BTCA 3LOCA 2X48A 2WB1N 3JRAA 5EDNA 4V2GA 2N8GA 2R92J 2HOAA 3GTOJ 2DA4A 3ZQHA 2E19A 2CQQA 1BW6A 2ZB9A 1ETOA 5F1JA 3DEWA 3G1OA 4FE4A 3OIOA 1RKWA 2ID3A 1ETXA 2EZKA 1AKHB 5E3OA 5GP9A 3BR2A 3I4NJ 4A93J 5GPCA 5J1YA 1W0UA 3UKGA 4HNVA 5IOYA 3F0CA 3BG5A 1APLC 4C3HJ 1JGGA 2HOSA 3H3VK 4QTRA 1JT6A 4MO7A 5EYRA 3IH4A 1TWCJ 2H1KA 1OCPA 2HXIA 1CQTA 1HCRA 2I10A 2DA3A 2YUSA 1H88C 1A6IA 2GLOA 1IDYA 1ETWA 2LK2A 2DA6A 2JMWA 2MW8A 4A3CJ 4RBOA 5EEAA 2DA2A 3JRDA 5C44J 2CRGA 1VI0A 1JTXA 2DMNA 2DJNA 5FKMA 3ZQFA 5IP9J 3Q0VA 4BKXA 2Y30A 1IUFA 1DU0A 3HDDA 2EBIA 2R5YB 3CQZJ 2ME0A 3FK6A 4IHWA 4LOCA 3PO3J 4G12A 2NVQJ 1IJWC 2E2JJ 1JUSA 1K61A 3SDGA 2YU9J 4W1UA 4MLOA 1VF9A 2X6OA 3LNQA 3HB9A 4X6AJ 4JP0A 1AKHA 3BR0A 1MBHA 1OCTC 4M3DA 5F08A 1MSEC 2WV1A 4JYKA 1XG1A 2OPTA 3G1MA 1WI3A 1ETKA 5EF6A 1GT0C 1FIAA 4DZPA 3JRCA 3BTLA 2VPRA 3BQZA 2DMTA 4D5FA 3GTLJ 1NK3P 2HXOA 2XGDA 2DA1A 1PUFB 1DU6A 1ETYA 4I6ZA 3RZDJ 4GFBA 3S16J 2L7MP 1RPWA 4UUSA 3QQAA 3I4MJ 4RDUA 1T33A 2XSDC 1P7IA 2FX0A 1R9TJ 3HOVJ 3HOXJ 3Q0WA 2E1OA 3VPRA 2IAIA 1I6HJ 3GTPJ 1GV2A 1E3OC 2FJ1A 1GDTA 1QPIA 2LTPA 3L1PA 4JX5A 5M3MJ 2EZLA 3S14J 3S1QJ 2L7FP 5BNGA 3OSFA 4DYRA 4A3MJ 1EF4A 1WCMJ 1F43A 3GTGJ 2HQ5A 3BG3A 3G1LA 1B8IB 2R5YA 2NOGA 3IH2A 3O8GA 2DMUA 1JJ8C 3BQYA 2Y9YA 5C4XJ 4ABZA 3FISA 2K9SA 5FKNA 3RZOJ 2DN0A 1JUMA 5IPAA 3S1NJ
chains in the Genus database with same CATH superfamily
4YFKF 4MIMA 1Y0NA 2VUMJ 2YPRA 4Y13A 4JX6A 6PAXA 3L9FA 2IS1A 3CO7C 4PJLA 2R4GA 3HUGB 1Z7UA 5DM6F 3RTRA 1S3JA 1ZELA 4HSTA 1BI3A 2XGXA 5FFZA 2WC2A 3CCYA 1HXDA 3KP3A 5CKTA 1ETVA 3OIQA 3V7CA 4NC8A 4DBQA 4ESJA 1F5TA 1AHDP 4XKWA 1XSDA 2FE3A 1UHWA 3TGNA 4UVBA 2CQNA 4A3BJ 2EFWA 2IEKA 1H9TA 3ECOA 4Y3OA 4A3FJ 2OQGA 5BPDA 2JA7J 2JA6J 1IC8A 4M6YA 4BQAA 3JAMZ 1G3SA 1R5GA 1T56A 2CUEA 2BXZA 4YIFA 2JSPA 2KZVA 2LDUA 4IPAA 5JLWA 5ERIA 4B4CA 1KGSA 5FKKA 3FXJA 5L3GA 3ZQQA 4GXOA 2NS7A 3QPHA 4UUTA 1I3QJ 4MEYF 3KCCA 4DIQA 3DTKA 3ZMZA 4Y52J 1B8IA 4RGXA 1SFKA 3J7YJ 1N25A 3EQLF 2IGOA 2JK3A 1JI8A 3LL7A 2WBMA 2Y0MA 4HBLA 4LIUA 1D1CA 1MNDA 3K69A 2V4JC 3A01B 4HNUA 3QYEA 4YIRX 5TISC 3UR3C 1QHGA 2M9HA 3RSNA 5GADJ 2I8DA 4LG0A 2DPDA 2E2HJ 3LSTA 2C6YA 3HOTA 1IO2A 3MCZA 3ZMSA 1A5JA 5K7FA 2L54A 4OOIA 2ZFWA 2KJBA 2VBWA 3VDXA 1YS6A 4QPOA 1F9NA 4EJOA 3I54A 4HQEA 3L09A 4BXFA 1YJ9I 5KK1A 1ZRDA 4CHUA 1RETA 2AQFA 3M9AA 5K5QA 9ANTA 1RRJA 4RAFA 3LAJA 3JW4A 2NRAC 2DYSH 3HOZJ 3U2RA 1IDZA 1CGPA 1LVAA 1B9MA 4S05A 5HNHA 1P92A 4XLCA 1FWZA 2D5VA 4M3GA 2BV6A 5E3MA 2V9VA 2CMPA 1NK2P 3L7WA 5ICCA 4F91B 2XPWA 2Y48A 4KMFA 2HQNA 3ZQGA 1QA6A 3ABLH 2GBYA 4PSWA 3IRQA 1K78B 2DTRA 2DQRA 2ZC2A 5C3EJ 2AHQA 2K86A 4JQFA 3R60A 3HIFA 3GFMA 1I1GA 4PJMA 3E6DA 5LD2C 2H8WA 1IW7F 5FRNA 1QVUA 3L2VA 2NYXA 4XLFA 1IXCA 4Z2YA 2R7QA 1GLNA 4ZDLA 1YW7A 4YG2F 4B3XA 4A3EJ 3FXLA 3U21A 2BEOA 2QGUA 4IEJA 2HTSA 3HSEA 1VFCA 1XCVA 4ZYAA 2ELKA 4YEJA 2NVYJ 2Z16A 1KU7A 4FX4A 5K7HA 2FBIA 2VIXA 3B6AA 3H3ZA 1K4SA 2H27A 2A6HF 4IX7A 3DCFA 3MKYB 3BJAA 2HFHA 2M30A 2X9DA 1SAXA 3SXYA 1XDSA 2M45A 4BHPA 1QU3A 4MGRA 4CYDA 1U6GA 1Z91A 1ZG5A 2KISA 5HLHA 2JRMA 3VYSB 1W5SA 3SYTA 2A68F 2O0YA 1B6AA 2GM4A 4OIQF 1ZYRF 5EZHA 3J80K 1O3QA 2R7OA 4WXHA 4KICA 2IA1A 3T1BA 1S7EA 2NAZA 5J1RA 4A3DJ 2GXAA 2QLZA 2Q2EB 4ENMA 3EPZA 1G6NA 1W4MA 2EV6A 2Z1DA 2XSJC 3OIPA 4RGRA 5FJ8J 3DEUA 4AUXA 4DGWB 4KISA 1CF7B 1F36A 1R1TA 2FMLA 4KIBA 1WGXA 1JKOC 4UY8I 4MFDA 1R5ID 1UG2A 3CESA 1IN5A 1X1CA 2GOMA 2X6YA 2LKXA 3VYRB 3RYPA 5M5XJ 1U8RA 2P81A 4XKVA 2LF8A 1BI1A 1ZR4A 3W6JB 5F0CA 3SQNA 5FRMA 1B72A 2V6CA 2UXNA 3LSJA 3KLOA 3ZMTA 5EG0B 1MMNA 3LAPA 1WRJA 2R7RA 1H0MA 1WJ5A 2K9QA 5E18F 2F4OB 2TCTA 4L9VA 3RQIA 2QKLB 3QPLA 2HYGD 3HKZA 2CUFA 4G6TB 3RKWA 3OYCA 3ESWB 1IF1A 2B63J 4G8XA 1ZR2A 1BOAA 2WY8Q 2FSWA 4LK0F 2MSYA 2EIMH 1WH7A 4R8HA 1IN7A 3CUOA 3DF8A 1QHHD 5LRSA 3ULQB 4DYQA 3D1NI 1OKRA 5D6EA 2R7ZJ 2TDXA 3CCRI 3GZ6A 1MMSA 3C7JA 1HW2A 2A3SA 1HKQA 1TWHJ 3TP3A 4OWRB 3JR9A 3MZHA 3E6BA 5E3LA 5GAHJ 3CMYA 3HSFA 3ZR8X 4HQMA 1WJAA 3E7LA 4XN3A 5GAEJ 4KN7X 2VKDA 2JPBA 4AYBA 4BS9A 3LSHA 1PDNC 5IP6A 4XLEA 3EETA 2Z9OA 4L18B 3AL0B 1QGPA 4XM3A 2XPUA 4P9FA 5FD6A 4C2UA 2E1MC 2M7BA 4NUBA 4XRSG 3PSFA 3TBIA 3N05A 1ERDA 3V8JA 3KZIC 4E7KA 2XKPA 1GUUA 3L2UA 2NVTJ 2ME6A 1SC7A 2R93J 2V9PA 2D45A 4EV0A 1RKTA 1D1AA 3S3NA 4CYCA 4I76A 5DYMA 1BM9A 5D6FA 3LSGA 2MG4A 2ISZA 2HS5A 1Q1HA 4ON0A 3NARA 4L5JA 4LB6B 1X1DA 3H92A 5CVRA 4EMSA 4I0BA 5GTIC 2O8XA 3K4JA 1HC8A 1NHAA 5HVQC 3M3YJ 3TDZC 2IPQX 2HOEA 2PEXA 1U5TA 2R7VA 5LEKA 5F1RA 3LSMA 1AOYA 3GTKJ 1TW3A 2L4AA 1OQYA 3WHBA 4CA0A 2CV2A 4BU2A 1X3WB 5CQGA 5FO5A 4Y33A 3OYNA 2V1DA 3U1KA 1WH5A 1G3TA 4EVIA 4BE2A 2M8GX 5EDNA 3KPHA 2N8GA 2R92J 3GTOJ 2E19A 2CQQA 4B43A 4L5IA 1X1BA 3ABMH 1FOKA 2LKSA 4AU7A 4IHSA 1FOXA 3BC8A 2ID3A 4Z6YA 3KP2A 3AAFA 3PJRA 2VE9A 2KKOA 4XORA 3IWFA 4I98B 1AWCA 4A93J 1XGSA 3GCMA 5GPCA 1HKTA 1I5ZA 3C2HA 5J1YA 1W0UA 4E70A 2D1HA 1P6RA 5IOYA 1APLC 3KYDB 4C3HJ 5F6FA 3BDDA 2P7CB 2K3PA 2HOSA 1W7PD 2M5WA 2P6SA 2KIFA 1KYWA 1KZHA 5HLGA 1FY7A 1TWCJ 3SHFA 1DP3A 1XN7A 1UFMA 3RPQA 2HXIA 4A0YA 2JT1A 4YRVA 2BY1A 1T0FA 3E3VA 4U0VA 2YUSA 1A31A 1VQ4I 4X0GA 2E71A 2OZUA 1IDYA 2UV1A 1ETWA 3D5LA 3QOPA 4M6XA 1YW9A 3KE2A 4HF2A 2JMWA 2E1NA 2EA4A 5EEAA 5J4VA 2DA2A 4RB0A 1D0YA 1VI0A 3OYHA 4IXAA 1T39A 1K6OA 3ZQFA 3EUHA 2EA2A 3IKVA 1IUFA 1JHFA 3AFHA 2A07F 2R7SA 2DK5A 3NWSA 3M7GA 2R5YB 2WB1A 5KCMA 2M7AA 5L3FA 3CCEI 1N78A 4HX7A 4HX4A 4XONA 2HKOA 4E7HA 2VKHA 2HVSA 3LNQA 2A05A 4MLOA 1G4DA 2LRDA 2PX9A 1IAWA 3K1PA 5E1XA 2XC7A 3JCUC 4G6DA 5JFRA 4M3DA 5F08A 2ZMEB 1XPXA 2LH9A 2RVCA 4IF4A 2IJLA 2VXZA 4L0ZB 5F64A 1RIOH 2XRNA 5GTHC 1GT0C 2HPMA 1MIJA 1FIAA 4DZPA 3GYHX 2MA3A 2DMTA 3ZN0A 4J00A 4V19K 1SFXA 3GLXA 2P5KA 3PFIA 1H9GA 5LHHA 5K1YA 4PUSA 3OS0A 1IV8A 1UB9A 1XSXA 3OYKA 1YX5A 3F8NA 3FKJA 1LVKA 3F9KA 3QWLA 3L2CA 2XIGA 2E1OA 1SEUA 4BJ5C 1DPUA 2HQRA 5JR3A 1E3OC 2FJ1A 3PUFA 4ITVA 2X4HA 3FDYA 1O3TA 3DLLF 2XF6A 3IL2A 3LSIA 3COAC 3E0JB 3MZYA 2EZLA 2VODA 2L7FP 3NRVA 1K7AA 2DODA 5BNGA 5DCMB 1Z6TA 4UV9A 3GTGJ 5FGMA 4AIJA 3ZMUA 1HW1A 2Y9YA 5C4XJ 1TQIA 2RQPA 2PJPA 5FKNA 3FX3A 3RKXA 2KHMA 4PGGA 3RZOJ 1DP7P 4I09A 3J81K 4DQ2A 2RNGA 1S7AA 4P55A 3WODF 2KDOA 3VB2A 2IS6A 4RGSA 3DTIA 2HVQA 1SD4A 3GVAA 4G94A 4JK1X 5DS9A 1TNTA 1MMAA 2XAQA 4PDKA 4BY7J 2BY0A 1ETQA 4KUMA 2F5CA 4IQJA 2IXSA 1VQMI 2LY2A 4AIDA 5KNLA 3FWEA 3HRUA 1U5TC 4A3JJ 1LKXA 2X0LA 1QZEA 1OFCX 2VBYA 2XHKA 3F6VA 3CCSI 4GDFA 2Y69H 2Y9ZA 3Q9SA 1PUFA 2V1XA 5D5VB 1FOYA 3S15J 1XDUA 3K7AJ 4XQFA 2HNHA 4PJJA 1POGA 5FLMJ 3OYMA 1J0RA 4UUSB 1Q1VA 1ODDA 1U9OA 2MLGA 3CCLI 5KHDA 3BROA 4KT6A 2HEOA 4MQVA 3BP8A 1R4NB 5HDKA 2HDDA 3GO5A 1BW5A 4OIPF 1Z0XA 3BT9A 3G4SI 1VQ8I 1MDMA 4OMYA 1RESA 2ZXHA 3EYIA 1K78A 3CC7I 4PSXA 3H9GA 3R6SA 4FQGA 4D1QA 1ZG3A 3TEDA 4CDGA 2Z33A 2JTVA 2X1EA 1EV7A 1X3UA 3MEXA 5D8KB 1LFUP 1MSFC 4U87A 5H2FC 2R0QC 3DLAA 1SVOA 2COBA 1YG2A 2BBYA 5K5OA 3ZGKA 2KT0A 4E7IA 3Q0UA 3TO6A 1R7JA 1X2MA 1IV6A 4IHTA 2DOEA 3QAHA 1IN6A 1ON2A 3G6EI 1G3WA 2M3AA 5J6XA 4RAZA 1ACIA 1T0FC 5J1UA 1Y1VJ 4D7NA 1F1ZA 4K2EA 2D2WA 3HHGA 3QPTA 2LREA 2M34A 2IVMA 3BTIA 1LUJB 3FBIB 2PJRA 1OISA 3V7RA 1WJEA 4HDUA 1U9NA 3S3OA 4EGZA 2H1LA 5KVRA 3FHNA 5FLXK 2XUBA 3Q3SA 2DFEA 4KN4X 2BY2A 3F8BA 1VZ0A 1MZBA 4ZZLA 3HOSA 1RI7A 2EFNA 2W85A 2VKEA 1N75A 1R23A 3C1DA 4XOTA 5B66C 5M3FJ 1ZARA 3GFJA 3RKQA 3K2AA 2QCOA 2DT5A 5GPAA 4OU0A 5C4JJ 2GQQA 3FKIJ 1P2FA 1YITI 2VJJA 4B1RA 3I58A 2BZTA 2HYJA 2L9SA 1X4PA 4I01A 3A02A 1YRNB 2LP0A 3E6CC 1WI9A 5HS7A 1HSJA 2IGNA 5E79C 1HDPA 1MBFA 2GZWA 5B3SH 3WTZA 1CF7A 4HG2A 5E8IA 5M5WJ 2ZXIA 5HS9A 1LFBA 2AO9A 4AD9A 1XD7A 1P9QC 3BTJA 3DV8A 4A3LJ 2LR8A 2D1VA 3PFYA 3GXOA 1SFOJ 1WWXA 1O57A 2KQRA 2MBFA 4EM0B 2CQXA 2JSCA 1S72I 4RS8A 4U0WA 4I7HA 3QP6A 1WJFA 5DDGA 3B73A 1FSHA 5EG0A 5J3LA 5FROA 4E7SA 1BL0A 3T0YA 5BS6A 3TW6A 2ZCWA 1KQ8A 1B4AA 1MMGA 2LOOA 2P4WA 1SVLA 1JKQC 1V5FA 1ZK8A 3HKZN 2LD5A 3ABUA 4UHTA 4BEHA 3I64A 2PMZN 4L9NA 2P6TA 5TGTA 4L9TA 5H20A 2VOPA 2UUZA 4N4NB 5J47A 2QZ8A 4L9JA 2WAEA 1M1EB 2EB7A 4M3EA 3AG1H 4DBRA 4V2FA 1XC5A 1GV5A 2Y2ZA 1QNTA 3RIRA 2ZKZA 3HOYJ 3IAS2 2CGPA 2A6EF 4A2UA 3F21A 2DQLA 1TNSA 1ULYA 2R5ZB 1J7KA 3A03A 3HZJA 1W36D 1YTYA 1R71A 4A0XA 3VWBA 2LY1A 2P5LC 4AYBN 4AWXB 1F4KA 2O5RA 1G3YA 2A69F 2BOLA 2Q1ZB 2QVOA 2KDZA 1FLIA 4FTHA 2HR3A 4XRMA 2DCEA 1PP7U 4IOCF 5B5EC 4DNCA 2K7LA 4ZYEA 5LFAA 2CJJA 2ELHA 2FQ3A 1TQPA 4XLHA 2ZBKA 2YU3A 1ZQ3P 4MFEA 3LQQA 1IZ1A 4EGYA 3MN2A 3CMEI 3ELKA 2MFZA 5H6RA 3OYGA 1BI0A 4OMZA 3PSIA 2CFXA 2YX7A 2ADUA 2L3DA 2XAGA 2TRTA 1G2HA 3AKZA 4C3IJ 4BUPA 3BG7A 3KP7A 1G8XA 1XMKA 3VEPA 3KYLA 1VNDA 2MD0A 3BCBA 2NVUB 3RYRA 2PLYA 4FISA 3GW2A 2B9SA 1LPQA 3J7AY 3OYJA 3ASOH 2OCCH 3DPTA 1MH4A 1OPCA 2EV0A 5EGOB 5F27A 1LE8A 2NS8A 4XIDA 2HOTA 3OOUA 1Y8QB 3S2WA 2B0LA 1Y1WJ 2BHYA 4XK4A 2G7UA 4AVZA 1HDDC 2Z5UA 1MD0A 3A0BC 2UZKA 5HDGA 3FXKA 4F3QA 3M07A 1H8AC 1U78A 1I39A 2QBYB 3CUQA 3LSRA 5F04A 2V6EA 3B02A 1TC3C 4QSHA 2HZDA 4OIRF 4C2MJ 1X58A 1IXSB 1VQOI 2AS5F 3ZOBA 2OAZA 5CVJA 4ZTFA 2XF7A 2EJRA 2ID6A 2NNNA 3FMQA 4G9YA 2OF7A 4M9SA 1FPQA 2NXNB 5TRDA 2EIJH 3W3CA 2L5QA 3K0LA 1YYVA 4A6DA 4BE1A 3GWZA 2EFQA 5FB2A 3G2BA 2GOXB 5LRRA 1JE8A 3F8CA 3DKYA 2O7OA 3ZQ7A 5E3NA 4B3AA 4IHYA 4CCNA 4NDLA 3SFIA 3FXQA 5IYCJ 3G71I 2UXXA 3IAM2 3KEYA 1L3LA 3A1YA 1BI2A 2IA0A 2EZIA 4A6EA 2GWRA 1WZ2A 2ZJQF 1NG7A 4FCYA 4WXDA 4S0HB 5HDNA 3DPLC 2XAHA 4BBRJ 1HQCA 4ZC3A 3KP6A 2MC4A 2GXGA 1Y39A 3HEFA 1MBKA 4IRHA 2IA2A 1S6LA 3VSKA 1FYKA 4IQ4A 2K5CA 3ASNH 1NTCA 3WHCA 5LEJA 3BG9A 5DEQA 1VQKI 3BTCA 3K6GA 2A5YB 2WB1N 2MH2A 4CCOA 4P1WA 4V2GA 3RDIA 3ZP5A 2CW0F 2DA4A 2JVHA 4IL6C 3ZQHA 4E7ZA 1BW6A 1X3ZB 5CVUA 3VFZA 4C30A 3DEWA 3M1CA 1EA3A 3OL3A 1UZCA 2WAQA 4EJWA 2QQ9A 1ETXA 2EZKA 4I99C 3O2PE 2LSOA 2PMHA 1U0JA 2DXIA 1BR2A 4B8XA 2E7XA 3L2QA 3UKGA 1QZYA 2BVMA 2F2EA 3I71A 4KIFA 2HDCA 1A36A 2QM3A 1JGGA 1ZGAA 3H3VK 4PFOA 3ZN1A 1TP4A 1JT6A 2ESNA 4MO7A 4XLNF 2F5EA 4BHCA 4A12A 1W7PA 4Q4ZF 2JUGA 3DBLB 3IH4A 3JAMK 2Z3YA 2H1KA 4UVCA 4LJZF 1HBXG 5IY5H 1JXSA 1HCRA 5KAFC 4E7JA 2G7HA 1A6IA 1YX3A 2KFDA 3O6BB 2L9VA 2KIUA 4ZDOA 2W1OA 2LK2A 3OV8A 5B1BH 3OS1A 3JRDA 5C44J 1ZGJA 3HC7A 3DKXA 4AIKA 2PMZA 5HOOA 2JUCA 2VT2A 3QOEA 5FKMA 1QPMA 2VT3A 3HDDA 3KZYA 2PFBA 4EQQA 2EFOA 3BCAA 4LOCA 4IHWA 1FOWA 3MKZA 3T8RA 1JUSA 2O3FA 3KETA 3BZKA 3K4BA 3OYLA 2F4IA 3A4CA 4O3MA 2FXAA 4OIOF 4X6AJ 3H36A 4M9XA 4LB5A 1FX7A 2R7WA 3QRFF 1AKHA 1WJBA 4PJ0C 3NEUA 5D4RA 2RNJA 1MSEC 2DU9A 2F6CA 2WV1A 4JYKA 1XG1A 1YOVB 3KLNA 5LGTA 2VJIA 1FYMA 1HA8A 3QU6A 4RGUA 1AA7A 2M87A 3CF2A 4M71A 4BQQA 3OY9A 5D5WB 3CP8A 2E36A 3H5NA 2XGDA 4RB2C 1ETYA 1V3FA 4R79A 3N97A 1TT0A 3FMRA 2X6WA 4UUSA 4ZZDA 4WX9A 2RV8A 3F22A 2WA0A 2M4GA 4PZJA 5J8FA 1R9TJ 2JZYA 3HOVJ 3CUQC 4CZZA 4Y4RA 3PQJA 1MKMA 2PG4A 1Z9CA 3OL4A 3SEZA 1GV2A 1LFPA 3HRMA 5KAIC 2YX4A 4GYGA 2LTPA 3E5XA 2KRFA 4HDVA 2KRCA 3P7NA 4OAZA 3HJEA 4BHBA 3CCVI 2X6XA 3G3ZA 4WWCA 3FM5A 3LQRA 4QWQA 3RPUA 3HPGA 2HDWA 3WTUC 3PUBA 4YFXF 4F93B 4KDPA 3WU2C 2ESHA 4IJAA 1WCMJ 2BY3A 4BJ6C 1VQ5I 1B8IB 3WTXC 3IH2A 3P9KA 1B1BA 2QSFX 1SFUA 2FA5A 1A35A 2X51A 1OMIA 1YS7A 3DP7A 5IT3A 2E1MB 3MAJA 4CCMA 3TOAA 3JRGA 3IRRA 2K9MA 3KEOA 3BPVA 3F3XA 1R1UA 5J40A 3GBGA 3Q5FA 2VJ4A 5JHUA 5CVVA 5LLQA 2KP6A 2RC4A 5DM7F 5A2QZ 2VC1A 3BR1A 3W2VA 2RKHA 3EUAA 4ENKA 5D5UB 1L0OC 2L7ZA 5D5XB 1OYYA 3F8MA 3K4CA 3HGYA 4UVAA 3CCJI 1YI2I 1R36A 2XROA 3VYUB 2KIMA 4RB1A 2Q0OA 1VQPI 4G7ZF 2H6CA 2A61A 2OZ6A 1FT9A 1P4WA 2KLOA 2CWEA 3DQVC 4DOZA 4C2TA 1C0WA 2KPMA 2OCEA 3DU5A 3PM1A 1TWAJ 2W4SA 1REPC 4WXCA 3S3MA 2KL4A 3RJPA 5HLIA 1KQ0A 3SZGA 5HLTA 3CDIA 1ZKGA 2FD5A 3BJOA 4O5VA 3S32A 3WU0A 3GTQJ 4YELA 1J2XA 2UWMA 1BA5A 2G0EA 3ZQIA 1V5EA 2ZJ2A 3LA7A 4CSWA 2CS3A 3LA2A 4XICA 1Z3YA 1K79A 3GTMJ 1PJRA 2L4MA 2XAJA 1ORKA 1TTYA 2A5WA 5ILUA 2VJ5A 2QKMB 4UV8A 2LBFA 3OR2C 2DMQA 1A04A 4FETA 2V79A 3JRBA 2BW3B 2K85A 2Y31A 5ED4A 2DLLA 4W97A 4ZDPA 4IRGA 3CJNA 3HUGA 3BPXA 4HV5A 1ENHA 3WG9A 4DZJA 4IOAF 4M72A 5DD8A 4I0AA 3E6MA 1Z21A 3F6OA 1T6SA 2IP2A 3MKLA 2JN6A 4HV6A 3KP4A 1O4XA 3CMMA 2M2EA 1UCRA 3SEQA 2R5ZA 4AIHA 1LDJA 3SFZA 4M6VA 1PUEE 4A3IJ 2OU2A 3BR5A 1Z77A 2LKPA 2CV0A 2CV1A 1WKMA 2VOOA 4ZYDA 3SDBA 5JVGF 3E5QA 4MTDA 3S17J 1O7LA 3FM3A 2V1NA 2FQ4A 2L9RA 3OWTA 4L0YB 3HGGA 3T5XA 1JKPC 1T38A 2IGMA 1YE9A 2VQHA 3SJMA 3WGGA 1V4RA 3U1DA 3ONQA 1EH8A 3QPSA 3CCUI 2DMPA 4NB5A 4F55A 3ZRGA 4KT5C 2J5OA 2FNAA 3ERMA 2RREA 5B1AH 3PO2J 3H3UA 3RPUD 4EATA 2EILH 1PP8F 3HTUA 1T2KA 2ZSIB 1USTA 2O8KA 1EJ9A 5BOXA 1P4XA 2L02A 1LDDA 2Y0SA 4KITB 5BQTA 5IP7J 2JA5J 4A5MA 3S1RJ 1XSVA 2OV7A 2XB0X 3P5JA 3K4NA 3BR6A 1B72B 3BR3A 3I56I 2XAFA 3HG9A 2E34A 2H09A 3A01A 3B6CA 3M8FA 3I0TA 3DEEA 4MHGA 1SD5A 4XMYA 5E1WA 2JJ7A 2DPUA 4NQWB 1G59A 1ZLJA 4B44A 3C2BA 4QIWN 1X4OA 5L3CA 1PYVA 1FYLA 4IHXA 3K2ZA 3NAUA 2O9LA 2M0CA 2DTZA 4XL9A 1S9HA 4B09A 3P9CA 3V42A 4A3GJ 2GA1A 1RR8C 2F5DA 4CCKA 3ZQLA 2OC6A 4PGHA 4UXNA 4HAMA 4A5NA 1I6XA 2O03A 1TWGJ 5CQEA 1P4AA 3HOUJ 2L2OA 3OYIA 1IG7A 4BXUA 1UHMA 2FBKA 4BJTA 1A6QA 2IBDA 5IOZA 4XLPF 3Q9VA 3TMOA 3X2QH 3BZ6A 4Q48A 3OSGA 1TL8A 3CP2A 1UG0A 1FSEA 4XLAA 2LFBA 4LIVA 4RAGA 2MH9A 1O7FA 1I50J 5EJCA 3MMYB 1P7JA 1OYIA 3CZ6A 2QF7A 5AIQA 2RDPA 4HLXA 1YQAA 3JRHA 1IRGA 3RCOA 1JTYA 4IRIA 4M73A 4C3JJ 3R0JA 5E17F 4D5CA 1HKSA 1JKRC 1FTZA 4HX8A 4HOBA 4KMUX 5LHGA 4UB6C 1LB2A 1X2NA 4CYCB 4ASNA 4HW0A 5CYVA 1IGNA 2E60A 1UAAA 2LF7A 2XASA 3QYFA 2HPIA 1T8IA 3AG3H 1V54H 3C3WA 4UNOA 4ZJZA 1SAUA 2RAEA 2ECBA 2HYFA 2H6BA 2DI3A 4XR6A 1JT0A 3I53A 1MNMC 3IUOA 4D9JA 1FTTA 2Q8KA 4BDZA 1UMQA 1U5TB 3IHUA 5JHFA 1B9NA 3ABKH 4KJZA 1UHSA 1MJBA 2IW5A 2YS9A 2K02A 3GFIA 4L5EA 4F92B 1DPRA 3FIWA 1E3PA 2X1DA 3S2HJ 2EIKH 1V55H 4XNFA 3W2WA 1NH3A 4LLLA 2GAUA 3WE3A 4JX4A 1U2WA 3PIOF 1E17A 5H6QA 1K83J 2LY9A 2M8EA 2WAQN 4LFUA 5EZGA 1FBUA 2JA8J 4EJTA 1ZLKA 1FBQA 1GVDA 4MQ9F 2Q2EA 1YW8A 2EINH 1STZA 2K40A 2XAUA 2AXLA 1OYWA 4PFPA 3ZCOA 1QRYA 1UELB 3R4KA 4IVNA 5HS8A 1SANA 4C9YA 5JVTA 2P7VB 2HZTA 2EV5A 1MBJA 2F48A 1LEAA 2DDBA 3I59B 2FEZA 3ML6A 3H5RA 3IH3A 2RN7A 3WTSC 2LLKA 2VE8A 3DXJF 2WAFA 3IC7A 3KX2A 2CYYA 3WTWC 4G7OF 4DJAA 5K7ZA 2EFPA 2IT0A 3FHZA 5DTDA 2OJED 4U88A 4HEA2 1RUOA 5FKLA 5ICGA 1J75A 1UJ8A 3I9V2 1OCZH 3WTTC 1DUXC 3CLQA 3HXLA 3VODA 3HHHA 2DYRH 1BR4A 3TKYA 5DCFA 2ICWG 3V8KA 2IS4A 1WVRA 1R49A 2DK8A 1D8KA 4M9ZA 4EEFG 3LOCA 4BH9A 4GGGA 3BZCA 3JRAA 4GRIA 2VC0A 5DUIA 3JTHA 4N9HA 2QWWA 2HOAA 2F5FA 2L9NA 1LNWA 1RNLA 3GUDA 3HL2A 4XSXF 3CO6C 1D0ZA 4N9IA 3G1OA 4FE4A 4LK1F 3MKWB 5CLSA 2CFOA 2KRHA 4U7DA 1YJWI 1RKWA 3CC4I 4ETSA 4N0BA 3BOQA 2KMUA 1U3EM 1R5HA 4ESBA 2X1CA 4HPQA 1S29A 4I02A 1TQMA 3BR2A 5LBQA 2XKOA 4I2OA 4HNVA 3BG5A 3J80Z 3N4MA 3KZZA 3ABTA 2ZJRF 5IT9Z 5EYRA 1K6YA 4BNCA 4BYYA 1FMVA 3REOA 3AG4H 4D0PA 2IS2A 3H5AA 2FBHA 1OCPA 1IXRC 2OUMA 1SMYF 1FC3A 1TBXA 3NWTA 2HGCA 4II3A 2DA3A 3LWFA 3A2KA 2W24A 3HRSA 1LJ9A 2CQKA 3E1SA 2GLOA 1OLTA 4NC7A 1W36C 2V7FA 4S04A 2DA6A 2MW8A 4A3CJ 3PL8A 1FBSA 2OD5A 3KP5A 1YIJI 1D3YA 1R22A 4II2A 1JTXA 2ETHA 2R7XA 1KA8A 2DMNA 2M0MA 2ZXJA 4WK8F 3QU3A 3CCMI 5IP9J 2GA2A 2ELJA 1RZ4A 5CVIA 1ZH5A 4BAYA 3VYTB 1MNEA 3IKTA 3BY6A 2EBIA 1D8JA 3TO7A 4OINF 2ME0A 1YHQI 2DFHA 2HKXA 2E1CA 1Y56A 1IJWC 2ZNZA 4RA2A 2OA4A 2IRFG 3ZMVA 1K61A 3PNTA 3SDGA 2JPCA 2YU9J 4W1UA 1T95A 3OS2A 3HB9A 1WQ2A 3KFWX 3QODA 3OYFA 3ZMDA 1MGTA 3CLOA 4JP0A 3BR0A 3GEZA 2CSOA 1E2XA 1ZREA 2ZJPF 2R7UA 2PI0A 4RAYA 1KU3A 1WI3A 1ETKA 5EF6A 1GXPA 3MQ0A 1FP1D 3JRCA 3OYAA 3PNYA 1O3SA 2VPRA 4D5FA 1OCCH 3RKYA 2W57A 3H9QA 4EM1A 3OYEA 4IZZA 3BJ6A 2BGCA 1PUFB 4BQOA 1HW5A 4N4OB 4I6ZA 4GYIA 1DGRM 5FFXA 3RZDJ 2ZNYA 2L7MP 1RPWA 2ACJA 4RDUA 1T33A 2FX0A 2QA4I 1IRXA 5ICFA 3HOXJ 1FNNA 2GXBA 2VPLA 3HTSB 2IAIA 1I6HJ 2R7DA 4LD5A 1QQIA 2FUG2 3S93A 1BIBA 1Z05A 3K4MA 2FF4A 4H4KC 3EYYA 2VBXA 3IP4B 5E1ZB 3ROUA 1GDTA 1QPIA 3K9TA 1MDMB 2ZXWH 4B48A 2DO7A 5M3MJ 2V26A 3TQNA 3ZPLA 2KZGA 3A0HC 3EUKL 1XTAA 3OSFA 4DYRA 4ANJA 2CH0A 1EF4A 4EM2A 4HA8A 2JRTA 5FD5A 2BHZA 4HLYA 3G1LA 4RM2A 2PMUA 5CPRB 2R5YA 5JI6A 3O8GA 2DMUA 3DBRB 4ABZA 3FISA 4XKCA 3OYDA 5CJ9A 2VQCA 1TLHB 5J4YA 2YSRA 2DBBA 2K4JA 1BC8C 4LGWA 2ECCA 2PJRB 1Z6RA 2BW3A 3ECHA 4X1EA 3GTJJ 1R58A 1H89C 1SMTA 1NG6A 1MBGA 2DW4A 2NNYA 2W82A 2ZMEA 2QYOA 3F8FA 2JWTA 3OOPA 3UNGC 1KQ9A 2BE5F 4UB8C 1ZRFA 3CJTB 3O8HA 2DA7A 5D8LB 2QQ8A 1ZAOA 2XDVA 4M3BA 2Z2SB 2K3FA 4RLQA 4GCVA 2QUFA 1QVTA 3FMSA 4YIIA 3CC2I 4BACA 4CZCA 1EKEA 2L01A 2XPVA 1R4MB 2DA5A 4F52A 5IT9K 5L3EA 1SVMA 2EQRA 3QP5A 1QBJA 3K10A 3M8EA 4HNTA 4FX0A 2G9WA 1MH3A 3HM5A 3I3LA 4FE7A 4BBSJ 1B59A 2VKVA 3EDPA 3AL0C 4A3KJ 4P96A 1HLVA 1BJZA 1J09A 3E5UA 4NNJA 4D7MA 3DBHB 2VL8A 4CGZA 2W84A 1KONA 2NS0A 2RQQA 5HNFA 4NHJA 5DCMA 1MJAA 3RQ4A 1ZTRA 2VB6A 4ZYHA 1IRZA 2HQAA 1XB4A 5EEHA 4AC0A 3LSPA 2DDAA 2Y0SN 2VQGA 2NVXJ 3PQKA 5AONA 3WGHA 4IO9F 3LMMA 4LITA 5GAGJ 3H0GJ 4NQWA 1T08B 1EH6A 3GMEA 4XBFA 2R7TA 4QPQA 4A0ZA 2CW7A 5IYBJ 1I3AA 2LVSA 4Q47A 1KU9A 4ZTJA 4FT8A 1W0TA 1OR7A 3DTEA 1AU7A 5F0FA 3TP0A 1V5GA 2W00A 2VASA 2IGKA 4BEHB 1ITYA 1T98A 4HYEA 3DPUA 1W1WE 2QQBA 4OAYA 2J5PA 1S8NA 2I5UA 1VQ6I 2CUJA 3G73A 3CF5F 3L2RA 4Y7NJ 2DFIA 1BR1A 4XKBA 3TW7A 1K4TA 1HOMA 1WPKA 3CJQB 4ENNA 1FMWA 1XS9A 5AIPA 4RMNA 2RGVA 1VQ7I 1FEXA 3BLYA 3GZ5A 1FJLA 2HVRA 3MZ8A 2LC2A 2VN2A 1KYZA 1U8BA 4M74A 1FP2A 1JJ6C 5HODA 3H35A 3ERED 2AXTC 5EEGA 1J59A 1BC7C 2DT7B 2B7EA 2O6GE 4HF1A 3IV5A 1Z1DA 2DOFA 3VSLA 1GHCA 2EZHA 4LG3A 1ZGWA 1TWFJ 2P5VA 4ZYGA 5M5YJ 1R6RA 1N77A 2QSGX 4XRFA 4RB3C 1YO5C 2OQRA 1D1BA 2QSHX 4UUVA 3BWGA 4BXXJ 1OCRH 1USSA 2CU7A 3JSPA 3CDLA 3KYCB 3V8LA 4XN0A 5J8CA 4MNUA 3S2DJ 4RLFA 3M4OJ 2CG4A 2VLAA 3JTGA 2MYSA 2E7WA 2XRLA 2HI3A 4QLCU 2QEXI 2E5NA 3L00A 5JLXA 4LG0B 3S8PA 4Y15A 2K9LA 1IN4A 2FOWA 1ZHFA 3KIOA 3CMAI 3J81Z 1XCBA 3FK7A 1LE8B 4Q5SF 2HTJA 4WCGA 2OBPA 2JVGA 5ICEA 2R3SA 2LYCA 3GX4X 3FXRA 1E3HA 3V7SA 5LHIA 2E2IJ 1YIOA 3OR1C 3R0AA 5DUKA 3JREA 2E35A 3GF2A 4FASD 3CUQB 2E5ZA 4J19A 2HU9A 2L0KA 4J01A 4IHVA 2VI6A 3I55I 2K9NA 1YRNA 2W25A 4PCQA 1FIPA 2WWYA 4M3FA 5BPIA 2M4KA 4P5OA 1TZLA 4DYCA 1E0EA 1I27A 5E8GA 3MVPA 2DAOA 2FMYA 3HBLA 3MD2A 1ZRCA 2ZMEC 1VTNC 2VQLA 4XSZF 5TJJA 3K1MA 2ZSHB 2MGQA 2WADA 1J5YA 4CCLA 2FNPA 1W5TA 1R00A 3S1MJ 4B47A 2XGEA 3I59A 3L2WA 2FU4A 1PVEA 2LG4A 4HRIA 4CO8A 3IWZA 5L3BA 1YLFA 2OTJI 2H8RA 2A6TA 3D5SC 1HF0A 4GO1A 1RR7A 3RI4A 2KIQA 2XB5A 4E7LA 2W7NA 4ESFA 1GVJA 1S7OA 1BOBA 4KYWA 3HOWJ 1XGMA 3W6KB 1J9IA 1VQNI 3F72A 3C18A 3M1EA 3F23A 2F4MB 4F7ZA 5LGNA 5FLXZ 1KU2A 5FKOA 2O61A 2XGCA 3W2AA 1D5YA 1DDNA 2XVCA 4PK4A 1VQ9I 4G6QA 2WTEA 4LMYA 2Z99A 3R61A 4R1HA 4BGDA 4XOPA 3HPHA 1IRFA 1WHUA 2XF5A 4MEXF 1I1SA 5FLVA 2BVLA 2X85A 3WE2A 4CXFA 2FOKA 5IYDJ 2EH3A 4BY1J 4E4HA 1OR7C 4XRSA 1VQLI 1Y8RB 2WV0A 2CW8A 5DV5A 2NOJB 2ZFUA 3W6VA 3JRIA 2P8TA 5F0HA 5ILVA 4NBQA 1XX5A 2QENA 1W7PB 2VONA 3ZQCA 3H1CA 3K1NA 3T8TA 3NQOA 2R7FA 2DJIA 3CJRB 1QZZA 1MJ9A 2EPFA 2M1BA 1MBEA 3BG6A 1ZN2A 1ON1A 3GLLA 3JRFA 3K4LA 4BDYA 1BBYA 5E20A 2GIVA 2MD5A 3VOEA 1ZG1A 1IUYA 3DU6A 2CO5A 2K4BA 3SZTA 2L7KA 1OJLA 2VBZA 1JUPA 3SZPA 3ISPA 5EGOA 3K4KA 4BL0B 4DW6A 3OYBA 4JOMA 3MWMA 2W48A 3CD6I 4A69C 3I4PA 4CH7A 2EWNA 4KIGA 4KNYA 2CUZA 3DKWA 2X48A 3J7AO 3FXMA 4O6JA 2H94A 2ZB9A 4U0YA 5A2QK 1O3RA 2QBYA 1ETOA 1OCOH 1SFEA 5F1JA 2ZO4A 3OIOA 1YJNI 3HSRA 1SD7A 1SD6A 5ILSA 1W5CC 1DQUA 1AKHB 4CCJA 4U7BA 5E3OA 4E6KG 4CICA 4EJVA 3I5UA 1Y0UA 3LSKA 5GP9A 2OTLI 2QQAA 3I4NJ 3GZNB 3CTAA 4JBAA 1YFHA 4BE0A 2MC3A 3D0SA 1Z67A 3F0CA 1RUNA 3C2GA 1TT5B 4QTRA 1BJAA 3LFKA 3K70D 1ONVA 2JQ7A 3E97A 3ZXSA 3V4GA 3D5RC 3FZVA 5DD4A 1X1PA 1CQTA 3MFKA 2I10A 5D4SA 1D0XA 2V1UA 1H88C 2DFFA 1LDKB 1BIAA 4EJUA 3OMYA 2P0WA 1LEBA 3U9GA 1JHHA 4KA4A 4RBOA 2MLKA 2CRGA 3TL4X 3KEQA 2DJNA 5L3DA 2LNBA 4P9UA 1XGNA 1D5VA 3WTVC 2MABA 3Q0VA 4RM3A 1X19A 5BMZA 4BKXA 2Y30A 1WJCA 1DU0A 3HYIA 1IN8A 3CQZJ 1S5LC 1Z7LA 3FK6A 3PO3J 3K70C 4G12A 2NVQJ 1QO0D 5LGUA 2E2JJ 4PJNA 3TDUC 3TO9A 1Y6IA 2BXYA 3CCQI 1DGWY 1VF9A 2X6OA 2BYVE 2AQEA 2YR2A 3P9IA 2Y75A 2EK5A 1MBHA 2DOAA 1OCTC 4H0EA 3QYBA 2VXDA 2HWVA 3FF5A 4NC6A 4HZFA 3WU1B 2OPTA 4TV7A 1XMAA 3G1MA 4CUGA 1Z3XA 3EUHC 1JGSA 1XMXA 3BTLA 3BQZA 3FXUA 2KJCA 4HF0A 2COMA 1LQ1A 3GTLJ 1NK3P 2HXOA 3H0DA 1XGOA 2DA1A 4FHTA 1DU6A 1MW7A 4HSRA 2XV4S 3DWLE 4GFBA 4G7HF 2PBIA 2DT6A 1WSUA 3S16J 3QQAA 3I4MJ 4AVPA 4WF2A 4KFCA 1RC9A 1R1VA 2XSDC 1P7IA 2CQ7A 3FBNB 1BN5A 3M8JA 3CDHA 3O3KA 2WY7Q 3Q0WA 2STTA 4BQNA 3J7ZI 3VPRA 2ISYA 3LA3A 2F5VA 3GTPJ 2JA2A 2FRHA 4MTEA 4ENJA 2STWA 3LFUA 1HSTA 3L1PA 1MMDA 4JX5A 3PIPF 4LLNA 3TOBA 1X1AA 2PQ8A 3FXOA 4LLGF 3S14J 3S1QJ 1EH7A 2V9KA 4A3MJ 3GFLA 3JSOA 1F43A 2HQ5A 3HRTA 3BG3A 5K5RA 3WTYC 1FZPB 2NOGA 3DFGA 1JJ8C 3BQYA 2PN6A 3WGIA 1WFXA 3AG2H 2K9SA 3WG7H 3H9JA 4IKFA 4YFNF 2K27A 4Y17A 2DN0A 2GIZA 1JUMA 1WJDA 4ZH4F 5IPAA 2LMDA 3S1NJ 2LBFB 3PNVA 1GXQA 4AM3A 1TW2A
chains in the Genus database with same CATH topology
3JRGA 2ECCA 4MIMA 3GTJJ 4X1EA 1H89C 2VUMJ 3GBGA 5DS9A 4JX6A 1MBGA 4BY7J 1ETQA 2JWTA 3BR1A 3O8HA 2DA7A 4A3JJ 3CCYA 2L7ZA 1OFCX 4M3BA 2Y9ZA 1ETVA 3HGYA 1PUFA 1AHDP 1QVTA 3S15J 3K7AJ 4A3BJ 1POGA 2IEKA 5FLMJ 4UUSB 1Q1VA 2XPVA 2DA5A 4A3FJ 2JA7J 1U9OA 2EQRA 2JA6J 1IC8A 3PM1A 1TWAJ 1MH3A 3HM5A 4FE7A 1T56A 2HDDA 4BBSJ 2CUEA 2VKVA 1BW5A 1Z0XA 3BT9A 4A3KJ 1RESA 1HLVA 5JLWA 1BJZA 4B4CA 5FKKA 1ZKGA 2FD5A 4D7MA 3GTQJ 3TEDA 2NS7A 4UUTA 1I3QJ 1LFUP 1MSFC 1BA5A 1ZTRA 2G0EA 1IRZA 3ZQIA 4Y52J 2R0QC 1B8IA 2COBA 4AC0A 2JK3A 4XICA 2KT0A 3GTMJ 3LSPA 2Y0SN 3Q0UA 1X2MA 1ORKA 1IV6A 2NVXJ 3A01B 3H0GJ 5J1UA 1Y1VJ 4D7NA 2M9HA 2DMQA 2M34A 3BTIA 5IYBJ 2LVSA 2E2HJ 1U9NA 3JRBA 1A5JA 1W0TA 5K7FA 2Y31A 3Q3SA 1AU7A 5F0FA 3TP0A 4W97A 1ENHA 1ITYA 4DZJA 2VKEA 1RETA 5M3FJ 3MKLA 2JN6A 3RKQA 9ANTA 3K2AA 2QCOA 1O4XA 5GPAA 5C4JJ 4Y7NJ 3TW7A 2M2EA 3FKIJ 3HOZJ 1HOMA 1WPKA 1IDZA 2R5ZA 4M6VA 1XS9A 4B1RA 4A3IJ 3BR5A 1Z77A 1FJLA 1FEXA 2HYJA 2D5VA 4M3GA 1U8BA 1JJ6C 1YRNB 3A02A 3S17J 5HODA 2FQ4A 2L9RA 2LP0A 5E3MA 1NK2P 3HGGA 1JKPC 3SJMA 2XPWA 1HDPA 1MBFA 3QPSA 3ZQGA 3IV5A 2DMPA 2GBYA 5M5WJ 2EZHA 1LFBA 2AO9A 1ZGWA 1TWFJ 3PO2J 5M5YJ 5C3EJ 2AHQA 3BTJA 4A3LJ 2O8KA 4BXXJ 2LR8A 1QVUA 1SFOJ 2CU7A 5IP7J 3CDLA 2JA5J 3S1RJ 2CQXA 2XB0X 3BR6A 1B72B 4A3EJ 3S2DJ 3BR3A 5EG0A 3A01A 3M4OJ 5J3LA 3B6CA 4IEJA 1VFCA 2JJ7A 1BL0A 3TW6A 2ELKA 2XRLA 2HI3A 2NVYJ 3C2BA 4QIWN 5JLXA 5K7HA 4IHXA 3NAUA 2O9LA 1JKQC 2M0CA 2DTZA 3HKZN 1ZK8A 3B6AA 2LD5A 2PMZN 3DCFA 3FK7A 1LE8B 4A3GJ 2X9DA 3ZQLA 4M3EA 4V2FA 1XC5A 1TWGJ 1GV5A 2E2IJ 3HOUJ 2Y2ZA 3HOYJ 3JREA 1IG7A 2R5ZB 3A03A 2IBDA 5IOZA 2GM4A 4J19A 5EZHA 2L0KA 4IHVA 2VI6A 3OSGA 2K9NA 4AYBN 1YRNA 1S7EA 2LFBA 5J1RA 1FIPA 4M3FA 4A3DJ 2KDZA 4DYCA 4FTHA 3MVPA 4XRMA 1I50J 1P7JA 3HBLA 4AUXA 5FJ8J 1F36A 2QF7A 2CJJA 3JRHA 1WGXA 1JTYA 1JKOC 4C3JJ 2MGQA 1ZQ3P 4MFDA 4D5CA 4MFEA 1UG2A 1JKRC 1FTZA 3MN2A 3S1MJ 1X2NA 2LKXA 4CYCB 5M5XJ 1IGNA 2P81A 1ZR4A 2XGEA 5F0CA 2TRTA 1G2HA 1B72A 4C3IJ 3LSJA 5EG0B 2K9QA 2H8RA 2RAEA 2TCTA 3RQIA 2ECBA 1HF0A 1VNDA 3QPLA 1JT0A 1RR7A 2CUFA 1MNMC 4FISA 1FTTA 2XB5A 2B63J 1UMQA 1ZR2A 1MH4A 3HOWJ 2MSYA 5EGOB 5F27A 1WH7A 1LE8A 1UHSA 2NS8A 4XIDA 4DYQA 3D1NI 2HOTA 2YS9A 4L5EA 3OOUA 2R7ZJ 3FIWA 1Y1WJ 4XK4A 3S2HJ 5FKOA 1HDDC 1TWHJ 3TP3A 3JR9A 2XGCA 5E3LA 1D5YA 3CMYA 1H8AC 1U78A 3E7LA 4JX4A 3LSRA 5F04A 1TC3C 4QSHA 4C2MJ 1K83J 5IP6A 1X58A 2LY9A 2WAQN 5EZGA 3ZOBA 2XPUA 2JA8J 5FLVA 1GVDA 2ID6A 2OF7A 4XRSG 5IYDJ 2EH3A 2K40A 4BY1J 4XRSA 3W6VA 3JRIA 1QRYA 5F0HA 1GUUA 2NVTJ 2ME6A 4IHYA 2O7OA 5E3NA 2R93J 4B3AA 1RKTA 3ZQCA 1SANA 4NDLA 3SFIA 5IYCJ 4CYCA 4I76A 1MBJA 3LSGA 2MG4A 2EZIA 1MBEA 3IH3A 3NARA 4FCYA 2LLKA 3JRFA 4S0HB 4BBRJ 5K7ZA 3M3YJ 5DTDA 5FKLA 1OJLA 1JUPA 3HEFA 5EGOA 1MBKA 3GTKJ 3WHBA 4DW6A 2W48A 1NTCA 1WH5A 3WHCA 4A69C 3BG9A 4EEFG 2M8GX 3BTCA 3LOCA 2X48A 2WB1N 3JRAA 5EDNA 4V2GA 2N8GA 2R92J 2HOAA 3GTOJ 2DA4A 3ZQHA 2E19A 2CQQA 1BW6A 2ZB9A 1ETOA 5F1JA 3DEWA 3G1OA 4FE4A 3OIOA 1RKWA 2ID3A 1ETXA 2EZKA 1AKHB 5E3OA 5GP9A 3BR2A 3I4NJ 4A93J 5GPCA 5J1YA 1W0UA 3UKGA 4HNVA 5IOYA 3F0CA 3BG5A 1APLC 4C3HJ 1JGGA 2HOSA 3H3VK 4QTRA 1JT6A 4MO7A 5EYRA 3IH4A 1TWCJ 2H1KA 1OCPA 2HXIA 1CQTA 1HCRA 2I10A 2DA3A 2YUSA 1H88C 1A6IA 2GLOA 1IDYA 1ETWA 2LK2A 2DA6A 2JMWA 2MW8A 4A3CJ 4RBOA 5EEAA 2DA2A 3JRDA 5C44J 2CRGA 1VI0A 1JTXA 2DMNA 2DJNA 5FKMA 3ZQFA 5IP9J 3Q0VA 4BKXA 2Y30A 1IUFA 1DU0A 3HDDA 2EBIA 2R5YB 3CQZJ 2ME0A 3FK6A 4IHWA 4LOCA 3PO3J 4G12A 2NVQJ 1IJWC 2E2JJ 1JUSA 1K61A 3SDGA 2YU9J 4W1UA 4MLOA 1VF9A 2X6OA 3LNQA 3HB9A 4X6AJ 4JP0A 1AKHA 3BR0A 1MBHA 1OCTC 4M3DA 5F08A 1MSEC 2WV1A 4JYKA 1XG1A 2OPTA 3G1MA 1WI3A 1ETKA 5EF6A 1GT0C 1FIAA 4DZPA 3JRCA 3BTLA 2VPRA 3BQZA 2DMTA 4D5FA 3GTLJ 1NK3P 2HXOA 2XGDA 2DA1A 1PUFB 1DU6A 1ETYA 4I6ZA 3RZDJ 4GFBA 3S16J 2L7MP 1RPWA 4UUSA 3QQAA 3I4MJ 4RDUA 1T33A 2XSDC 1P7IA 2FX0A 1R9TJ 3HOVJ 3HOXJ 3Q0WA 2E1OA 3VPRA 2IAIA 1I6HJ 3GTPJ 1GV2A 1E3OC 2FJ1A 1GDTA 1QPIA 2LTPA 3L1PA 4JX5A 5M3MJ 2EZLA 3S14J 3S1QJ 2L7FP 5BNGA 3OSFA 4DYRA 4A3MJ 1EF4A 1WCMJ 1F43A 3GTGJ 2HQ5A 3BG3A 3G1LA 1B8IB 2R5YA 2NOGA 3IH2A 3O8GA 2DMUA 1JJ8C 3BQYA 2Y9YA 5C4XJ 4ABZA 3FISA 2K9SA 5FKNA 3RZOJ 2DN0A 1JUMA 5IPAA 3S1NJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JRG A;  2ECC A;  4MIM A;  3GTJ J;  4X1E A;  1H89 C;  2VUM J;  3GBG A;  5DS9 A;  4JX6 A;  1MBG A;  4BY7 J;  1ETQ A;  2JWT A;  3BR1 A;  3O8H A;  2DA7 A;  4A3J J;  3CCY A;  2L7Z A;  1OFC X;  4M3B A;  2Y9Z A;  1ETV A;  3HGY A;  1PUF A;  1AHD P;  1QVT A;  3S15 J;  3K7A J;  4A3B J;  1POG A;  2IEK A;  5FLM J;  4UUS B;  1Q1V A;  2XPV A;  2DA5 A;  4A3F J;  2JA7 J;  1U9O A;  2EQR A;  2JA6 J;  1IC8 A;  3PM1 A;  1TWA J;  1MH3 A;  3HM5 A;  4FE7 A;  1T56 A;  2HDD A;  4BBS J;  2CUE A;  2VKV A;  1BW5 A;  1Z0X A;  3BT9 A;  4A3K J;  1RES A;  1HLV A;  5JLW A;  1BJZ A;  4B4C A;  5FKK A;  1ZKG A;  2FD5 A;  4D7M A;  3GTQ J;  3TED A;  2NS7 A;  4UUT A;  1I3Q J;  1LFU P;  1MSF C;  1BA5 A;  1ZTR A;  2G0E A;  1IRZ A;  3ZQI A;  4Y52 J;  2R0Q C;  1B8I A;  2COB A;  4AC0 A;  2JK3 A;  4XIC A;  2KT0 A;  3GTM J;  3LSP A;  2Y0S N;  3Q0U A;  1X2M A;  1ORK A;  1IV6 A;  2NVX J;  3A01 B;  3H0G J;  5J1U A;  1Y1V J;  4D7N A;  2M9H A;  2DMQ A;  2M34 A;  3BTI A;  5IYB J;  2LVS A;  2E2H J;  1U9N A;  3JRB A;  1A5J A;  1W0T A;  5K7F A;  2Y31 A;  3Q3S A;  1AU7 A;  5F0F A;  3TP0 A;  4W97 A;  1ENH A;  1ITY A;  4DZJ A;  2VKE A;  1RET A;  5M3F J;  3MKL A;  2JN6 A;  3RKQ A;  9ANT A;  3K2A A;  2QCO A;  1O4X A;  5GPA A;  5C4J J;  4Y7N J;  3TW7 A;  2M2E A;  3FKI J;  3HOZ J;  1HOM A;  1WPK A;  1IDZ A;  2R5Z A;  4M6V A;  1XS9 A;  4B1R A;  4A3I J;  3BR5 A;  1Z77 A;  1FJL A;  1FEX A;  2HYJ A;  2D5V A;  4M3G A;  1U8B A;  1JJ6 C;  1YRN B;  3A02 A;  3S17 J;  5HOD A;  2FQ4 A;  2L9R A;  2LP0 A;  5E3M A;  1NK2 P;  3HGG A;  1JKP C;  3SJM A;  2XPW A;  1HDP A;  1MBF A;  3QPS A;  3ZQG A;  3IV5 A;  2DMP A;  2GBY A;  5M5W J;  2EZH A;  1LFB A;  2AO9 A;  1ZGW A;  1TWF J;  3PO2 J;  5M5Y J;  5C3E J;  2AHQ A;  3BTJ A;  4A3L J;  2O8K A;  4BXX J;  2LR8 A;  1QVU A;  1SFO J;  2CU7 A;  5IP7 J;  3CDL A;  2JA5 J;  3S1R J;  2CQX A;  2XB0 X;  3BR6 A;  1B72 B;  4A3E J;  3S2D J;  3BR3 A;  5EG0 A;  3A01 A;  3M4O J;  5J3L A;  3B6C A;  4IEJ A;  1VFC A;  2JJ7 A;  1BL0 A;  3TW6 A;  2ELK A;  2XRL A;  2HI3 A;  2NVY J;  3C2B A;  4QIW N;  5JLX A;  5K7H A;  4IHX A;  3NAU A;  2O9L A;  1JKQ C;  2M0C A;  2DTZ A;  3HKZ N;  1ZK8 A;  3B6A A;  2LD5 A;  2PMZ N;  3DCF A;  3FK7 A;  1LE8 B;  4A3G J;  2X9D A;  3ZQL A;  4M3E A;  4V2F A;  1XC5 A;  1TWG J;  1GV5 A;  2E2I J;  3HOU J;  2Y2Z A;  3HOY J;  3JRE A;  1IG7 A;  2R5Z B;  3A03 A;  2IBD A;  5IOZ A;  2GM4 A;  4J19 A;  5EZH A;  2L0K A;  4IHV A;  2VI6 A;  3OSG A;  2K9N A;  4AYB N;  1YRN A;  1S7E A;  2LFB A;  5J1R A;  1FIP A;  4M3F A;  4A3D J;  2KDZ A;  4DYC A;  4FTH A;  3MVP A;  4XRM A;  1I50 J;  1P7J A;  3HBL A;  4AUX A;  5FJ8 J;  1F36 A;  2QF7 A;  2CJJ A;  3JRH A;  1WGX A;  1JTY A;  1JKO C;  4C3J J;  2MGQ A;  1ZQ3 P;  4MFD A;  4D5C A;  4MFE A;  1UG2 A;  1JKR C;  1FTZ A;  3MN2 A;  3S1M J;  1X2N A;  2LKX A;  4CYC B;  5M5X J;  1IGN A;  2P81 A;  1ZR4 A;  2XGE A;  5F0C A;  2TRT A;  1G2H A;  1B72 A;  4C3I J;  3LSJ A;  5EG0 B;  2K9Q A;  2H8R A;  2RAE A;  2TCT A;  3RQI A;  2ECB A;  1HF0 A;  1VND A;  3QPL A;  1JT0 A;  1RR7 A;  2CUF A;  1MNM C;  4FIS A;  1FTT A;  2XB5 A;  2B63 J;  1UMQ A;  1ZR2 A;  1MH4 A;  3HOW J;  2MSY A;  5EGO B;  5F27 A;  1WH7 A;  1LE8 A;  1UHS A;  2NS8 A;  4XID A;  4DYQ A;  3D1N I;  2HOT A;  2YS9 A;  4L5E A;  3OOU A;  2R7Z J;  3FIW A;  1Y1W J;  4XK4 A;  3S2H J;  5FKO A;  1HDD C;  1TWH J;  3TP3 A;  3JR9 A;  2XGC A;  5E3L A;  1D5Y A;  3CMY A;  1H8A C;  1U78 A;  3E7L A;  4JX4 A;  3LSR A;  5F04 A;  1TC3 C;  4QSH A;  4C2M J;  1K83 J;  5IP6 A;  1X58 A;  2LY9 A;  2WAQ N;  5EZG A;  3ZOB A;  2XPU A;  2JA8 J;  5FLV A;  1GVD A;  2ID6 A;  2OF7 A;  4XRS G;  5IYD J;  2EH3 A;  2K40 A;  4BY1 J;  4XRS A;  3W6V A;  3JRI A;  1QRY A;  5F0H A;  1GUU A;  2NVT J;  2ME6 A;  4IHY A;  2O7O A;  5E3N A;  2R93 J;  4B3A A;  1RKT A;  3ZQC A;  1SAN A;  4NDL A;  3SFI A;  5IYC J;  4CYC A;  4I76 A;  1MBJ A;  3LSG A;  2MG4 A;  2EZI A;  1MBE A;  3IH3 A;  3NAR A;  4FCY A;  2LLK A;  3JRF A;  4S0H B;  4BBR J;  5K7Z A;  3M3Y J;  5DTD A;  5FKL A;  1OJL A;  1JUP A;  3HEF A;  5EGO A;  1MBK A;  3GTK J;  3WHB A;  4DW6 A;  2W48 A;  1NTC A;  1WH5 A;  3WHC A;  4A69 C;  3BG9 A;  4EEF G;  2M8G X;  3BTC A;  3LOC A;  2X48 A;  2WB1 N;  3JRA A;  5EDN A;  4V2G A;  2N8G A;  2R92 J;  2HOA A;  3GTO J;  2DA4 A;  3ZQH A;  2E19 A;  2CQQ A;  1BW6 A;  2ZB9 A;  1ETO A;  5F1J A;  3DEW A;  3G1O A;  4FE4 A;  3OIO A;  1RKW A;  2ID3 A;  1ETX A;  2EZK A;  1AKH B;  5E3O A;  5GP9 A;  3BR2 A;  3I4N J;  4A93 J;  5GPC A;  5J1Y A;  1W0U A;  3UKG A;  4HNV A;  5IOY A;  3F0C A;  3BG5 A;  1APL C;  4C3H J;  1JGG A;  2HOS A;  3H3V K;  4QTR A;  1JT6 A;  4MO7 A;  5EYR A;  3IH4 A;  1TWC J;  2H1K A;  1OCP A;  2HXI A;  1CQT A;  1HCR A;  2I10 A;  2DA3 A;  2YUS A;  1H88 C;  1A6I A;  2GLO A;  1IDY A;  1ETW A;  2LK2 A;  2DA6 A;  2JMW A;  2MW8 A;  4A3C J;  4RBO A;  5EEA A;  2DA2 A;  3JRD A;  5C44 J;  2CRG A;  1VI0 A;  1JTX A;  2DMN A;  2DJN A;  5FKM A;  3ZQF A;  5IP9 J;  3Q0V A;  4BKX A;  2Y30 A;  1IUF A;  1DU0 A;  3HDD A;  2EBI A;  2R5Y B;  3CQZ J;  2ME0 A;  3FK6 A;  4IHW A;  4LOC A;  3PO3 J;  4G12 A;  2NVQ J;  1IJW C;  2E2J J;  1JUS A;  1K61 A;  3SDG A;  2YU9 J;  4W1U A;  4MLO A;  1VF9 A;  2X6O A;  3LNQ A;  3HB9 A;  4X6A J;  4JP0 A;  1AKH A;  3BR0 A;  1MBH A;  1OCT C;  4M3D A;  5F08 A;  1MSE C;  2WV1 A;  4JYK A;  1XG1 A;  2OPT A;  3G1M A;  1WI3 A;  1ETK A;  5EF6 A;  1GT0 C;  1FIA A;  4DZP A;  3JRC A;  3BTL A;  2VPR A;  3BQZ A;  2DMT A;  4D5F A;  3GTL J;  1NK3 P;  2HXO A;  2XGD A;  2DA1 A;  1PUF B;  1DU6 A;  1ETY A;  4I6Z A;  3RZD J;  4GFB A;  3S16 J;  2L7M P;  1RPW A;  4UUS A;  3QQA A;  3I4M J;  4RDU A;  1T33 A;  2XSD C;  1P7I A;  2FX0 A;  1R9T J;  3HOV J;  3HOX J;  3Q0W A;  2E1O A;  3VPR A;  2IAI A;  1I6H J;  3GTP J;  1GV2 A;  1E3O C;  2FJ1 A;  1GDT A;  1QPI A;  2LTP A;  3L1P A;  4JX5 A;  5M3M J;  2EZL A;  3S14 J;  3S1Q J;  2L7F P;  5BNG A;  3OSF A;  4DYR A;  4A3M J;  1EF4 A;  1WCM J;  1F43 A;  3GTG J;  2HQ5 A;  3BG3 A;  3G1L A;  1B8I B;  2R5Y A;  2NOG A;  3IH2 A;  3O8G A;  2DMU A;  1JJ8 C;  3BQY A;  2Y9Y A;  5C4X J;  4ABZ A;  3FIS A;  2K9S A;  5FKN A;  3RZO J;  2DN0 A;  1JUM A;  5IPA A;  3S1N J; 
#chains in the Genus database with same CATH topology
 4YFK F;  4MIM A;  1Y0N A;  2VUM J;  2YPR A;  4Y13 A;  4JX6 A;  6PAX A;  3L9F A;  2IS1 A;  3CO7 C;  4PJL A;  2R4G A;  3HUG B;  1Z7U A;  5DM6 F;  3RTR A;  1S3J A;  1ZEL A;  4HST A;  1BI3 A;  2XGX A;  5FFZ A;  2WC2 A;  3CCY A;  1HXD A;  3KP3 A;  5CKT A;  1ETV A;  3OIQ A;  3V7C A;  4NC8 A;  4DBQ A;  4ESJ A;  1F5T A;  1AHD P;  4XKW A;  1XSD A;  2FE3 A;  1UHW A;  3TGN A;  4UVB A;  2CQN A;  4A3B J;  2EFW A;  2IEK A;  1H9T A;  3ECO A;  4Y3O A;  4A3F J;  2OQG A;  5BPD A;  2JA7 J;  2JA6 J;  1IC8 A;  4M6Y A;  4BQA A;  3JAM Z;  1G3S A;  1R5G A;  1T56 A;  2CUE A;  2BXZ A;  4YIF A;  2JSP A;  2KZV A;  2LDU A;  4IPA A;  5JLW A;  5ERI A;  4B4C A;  1KGS A;  5FKK A;  3FXJ A;  5L3G A;  3ZQQ A;  4GXO A;  2NS7 A;  3QPH A;  4UUT A;  1I3Q J;  4MEY F;  3KCC A;  4DIQ A;  3DTK A;  3ZMZ A;  4Y52 J;  1B8I A;  4RGX A;  1SFK A;  3J7Y J;  1N25 A;  3EQL F;  2IGO A;  2JK3 A;  1JI8 A;  3LL7 A;  2WBM A;  2Y0M A;  4HBL A;  4LIU A;  1D1C A;  1MND A;  3K69 A;  2V4J C;  3A01 B;  4HNU A;  3QYE A;  4YIR X;  5TIS C;  3UR3 C;  1QHG A;  2M9H A;  3RSN A;  5GAD J;  2I8D A;  4LG0 A;  2DPD A;  2E2H J;  3LST A;  2C6Y A;  3HOT A;  1IO2 A;  3MCZ A;  3ZMS A;  1A5J A;  5K7F A;  2L54 A;  4OOI A;  2ZFW A;  2KJB A;  2VBW A;  3VDX A;  1YS6 A;  4QPO A;  1F9N A;  4EJO A;  3I54 A;  4HQE A;  3L09 A;  4BXF A;  1YJ9 I;  5KK1 A;  1ZRD A;  4CHU A;  1RET A;  2AQF A;  3M9A A;  5K5Q A;  9ANT A;  1RRJ A;  4RAF A;  3LAJ A;  3JW4 A;  2NRA C;  2DYS H;  3HOZ J;  3U2R A;  1IDZ A;  1CGP A;  1LVA A;  1B9M A;  4S05 A;  5HNH A;  1P92 A;  4XLC A;  1FWZ A;  2D5V A;  4M3G A;  2BV6 A;  5E3M A;  2V9V A;  2CMP A;  1NK2 P;  3L7W A;  5ICC A;  4F91 B;  2XPW A;  2Y48 A;  4KMF A;  2HQN A;  3ZQG A;  1QA6 A;  3ABL H;  2GBY A;  4PSW A;  3IRQ A;  1K78 B;  2DTR A;  2DQR A;  2ZC2 A;  5C3E J;  2AHQ A;  2K86 A;  4JQF A;  3R60 A;  3HIF A;  3GFM A;  1I1G A;  4PJM A;  3E6D A;  5LD2 C;  2H8W A;  1IW7 F;  5FRN A;  1QVU A;  3L2V A;  2NYX A;  4XLF A;  1IXC A;  4Z2Y A;  2R7Q A;  1GLN A;  4ZDL A;  1YW7 A;  4YG2 F;  4B3X A;  4A3E J;  3FXL A;  3U21 A;  2BEO A;  2QGU A;  4IEJ A;  2HTS A;  3HSE A;  1VFC A;  1XCV A;  4ZYA A;  2ELK A;  4YEJ A;  2NVY J;  2Z16 A;  1KU7 A;  4FX4 A;  5K7H A;  2FBI A;  2VIX A;  3B6A A;  3H3Z A;  1K4S A;  2H27 A;  2A6H F;  4IX7 A;  3DCF A;  3MKY B;  3BJA A;  2HFH A;  2M30 A;  2X9D A;  1SAX A;  3SXY A;  1XDS A;  2M45 A;  4BHP A;  1QU3 A;  4MGR A;  4CYD A;  1U6G A;  1Z91 A;  1ZG5 A;  2KIS A;  5HLH A;  2JRM A;  3VYS B;  1W5S A;  3SYT A;  2A68 F;  2O0Y A;  1B6A A;  2GM4 A;  4OIQ F;  1ZYR F;  5EZH A;  3J80 K;  1O3Q A;  2R7O A;  4WXH A;  4KIC A;  2IA1 A;  3T1B A;  1S7E A;  2NAZ A;  5J1R A;  4A3D J;  2GXA A;  2QLZ A;  2Q2E B;  4ENM A;  3EPZ A;  1G6N A;  1W4M A;  2EV6 A;  2Z1D A;  2XSJ C;  3OIP A;  4RGR A;  5FJ8 J;  3DEU A;  4AUX A;  4DGW B;  4KIS A;  1CF7 B;  1F36 A;  1R1T A;  2FML A;  4KIB A;  1WGX A;  1JKO C;  4UY8 I;  4MFD A;  1R5I D;  1UG2 A;  3CES A;  1IN5 A;  1X1C A;  2GOM A;  2X6Y A;  2LKX A;  3VYR B;  3RYP A;  5M5X J;  1U8R A;  2P81 A;  4XKV A;  2LF8 A;  1BI1 A;  1ZR4 A;  3W6J B;  5F0C A;  3SQN A;  5FRM A;  1B72 A;  2V6C A;  2UXN A;  3LSJ A;  3KLO A;  3ZMT A;  5EG0 B;  1MMN A;  3LAP A;  1WRJ A;  2R7R A;  1H0M A;  1WJ5 A;  2K9Q A;  5E18 F;  2F4O B;  2TCT A;  4L9V A;  3RQI A;  2QKL B;  3QPL A;  2HYG D;  3HKZ A;  2CUF A;  4G6T B;  3RKW A;  3OYC A;  3ESW B;  1IF1 A;  2B63 J;  4G8X A;  1ZR2 A;  1BOA A;  2WY8 Q;  2FSW A;  4LK0 F;  2MSY A;  2EIM H;  1WH7 A;  4R8H A;  1IN7 A;  3CUO A;  3DF8 A;  1QHH D;  5LRS A;  3ULQ B;  4DYQ A;  3D1N I;  1OKR A;  5D6E A;  2R7Z J;  2TDX A;  3CCR I;  3GZ6 A;  1MMS A;  3C7J A;  1HW2 A;  2A3S A;  1HKQ A;  1TWH J;  3TP3 A;  4OWR B;  3JR9 A;  3MZH A;  3E6B A;  5E3L A;  5GAH J;  3CMY A;  3HSF A;  3ZR8 X;  4HQM A;  1WJA A;  3E7L A;  4XN3 A;  5GAE J;  4KN7 X;  2VKD A;  2JPB A;  4AYB A;  4BS9 A;  3LSH A;  1PDN C;  5IP6 A;  4XLE A;  3EET A;  2Z9O A;  4L18 B;  3AL0 B;  1QGP A;  4XM3 A;  2XPU A;  4P9F A;  5FD6 A;  4C2U A;  2E1M C;  2M7B A;  4NUB A;  4XRS G;  3PSF A;  3TBI A;  3N05 A;  1ERD A;  3V8J A;  3KZI C;  4E7K A;  2XKP A;  1GUU A;  3L2U A;  2NVT J;  2ME6 A;  1SC7 A;  2R93 J;  2V9P A;  2D45 A;  4EV0 A;  1RKT A;  1D1A A;  3S3N A;  4CYC A;  4I76 A;  5DYM A;  1BM9 A;  5D6F A;  3LSG A;  2MG4 A;  2ISZ A;  2HS5 A;  1Q1H A;  4ON0 A;  3NAR A;  4L5J A;  4LB6 B;  1X1D A;  3H92 A;  5CVR A;  4EMS A;  4I0B A;  5GTI C;  2O8X A;  3K4J A;  1HC8 A;  1NHA A;  5HVQ C;  3M3Y J;  3TDZ C;  2IPQ X;  2HOE A;  2PEX A;  1U5T A;  2R7V A;  5LEK A;  5F1R A;  3LSM A;  1AOY A;  3GTK J;  1TW3 A;  2L4A A;  1OQY A;  3WHB A;  4CA0 A;  2CV2 A;  4BU2 A;  1X3W B;  5CQG A;  5FO5 A;  4Y33 A;  3OYN A;  2V1D A;  3U1K A;  1WH5 A;  1G3T A;  4EVI A;  4BE2 A;  2M8G X;  5EDN A;  3KPH A;  2N8G A;  2R92 J;  3GTO J;  2E19 A;  2CQQ A;  4B43 A;  4L5I A;  1X1B A;  3ABM H;  1FOK A;  2LKS A;  4AU7 A;  4IHS A;  1FOX A;  3BC8 A;  2ID3 A;  4Z6Y A;  3KP2 A;  3AAF A;  3PJR A;  2VE9 A;  2KKO A;  4XOR A;  3IWF A;  4I98 B;  1AWC A;  4A93 J;  1XGS A;  3GCM A;  5GPC A;  1HKT A;  1I5Z A;  3C2H A;  5J1Y A;  1W0U A;  4E70 A;  2D1H A;  1P6R A;  5IOY A;  1APL C;  3KYD B;  4C3H J;  5F6F A;  3BDD A;  2P7C B;  2K3P A;  2HOS A;  1W7P D;  2M5W A;  2P6S A;  2KIF A;  1KYW A;  1KZH A;  5HLG A;  1FY7 A;  1TWC J;  3SHF A;  1DP3 A;  1XN7 A;  1UFM A;  3RPQ A;  2HXI A;  4A0Y A;  2JT1 A;  4YRV A;  2BY1 A;  1T0F A;  3E3V A;  4U0V A;  2YUS A;  1A31 A;  1VQ4 I;  4X0G A;  2E71 A;  2OZU A;  1IDY A;  2UV1 A;  1ETW A;  3D5L A;  3QOP A;  4M6X A;  1YW9 A;  3KE2 A;  4HF2 A;  2JMW A;  2E1N A;  2EA4 A;  5EEA A;  5J4V A;  2DA2 A;  4RB0 A;  1D0Y A;  1VI0 A;  3OYH A;  4IXA A;  1T39 A;  1K6O A;  3ZQF A;  3EUH A;  2EA2 A;  3IKV A;  1IUF A;  1JHF A;  3AFH A;  2A07 F;  2R7S A;  2DK5 A;  3NWS A;  3M7G A;  2R5Y B;  2WB1 A;  5KCM A;  2M7A A;  5L3F A;  3CCE I;  1N78 A;  4HX7 A;  4HX4 A;  4XON A;  2HKO A;  4E7H A;  2VKH A;  2HVS A;  3LNQ A;  2A05 A;  4MLO A;  1G4D A;  2LRD A;  2PX9 A;  1IAW A;  3K1P A;  5E1X A;  2XC7 A;  3JCU C;  4G6D A;  5JFR A;  4M3D A;  5F08 A;  2ZME B;  1XPX A;  2LH9 A;  2RVC A;  4IF4 A;  2IJL A;  2VXZ A;  4L0Z B;  5F64 A;  1RIO H;  2XRN A;  5GTH C;  1GT0 C;  2HPM A;  1MIJ A;  1FIA A;  4DZP A;  3GYH X;  2MA3 A;  2DMT A;  3ZN0 A;  4J00 A;  4V19 K;  1SFX A;  3GLX A;  2P5K A;  3PFI A;  1H9G A;  5LHH A;  5K1Y A;  4PUS A;  3OS0 A;  1IV8 A;  1UB9 A;  1XSX A;  3OYK A;  1YX5 A;  3F8N A;  3FKJ A;  1LVK A;  3F9K A;  3QWL A;  3L2C A;  2XIG A;  2E1O A;  1SEU A;  4BJ5 C;  1DPU A;  2HQR A;  5JR3 A;  1E3O C;  2FJ1 A;  3PUF A;  4ITV A;  2X4H A;  3FDY A;  1O3T A;  3DLL F;  2XF6 A;  3IL2 A;  3LSI A;  3COA C;  3E0J B;  3MZY A;  2EZL A;  2VOD A;  2L7F P;  3NRV A;  1K7A A;  2DOD A;  5BNG A;  5DCM B;  1Z6T A;  4UV9 A;  3GTG J;  5FGM A;  4AIJ A;  3ZMU A;  1HW1 A;  2Y9Y A;  5C4X J;  1TQI A;  2RQP A;  2PJP A;  5FKN A;  3FX3 A;  3RKX A;  2KHM A;  4PGG A;  3RZO J;  1DP7 P;  4I09 A;  3J81 K;  4DQ2 A;  2RNG A;  1S7A A;  4P55 A;  3WOD F;  2KDO A;  3VB2 A;  2IS6 A;  4RGS A;  3DTI A;  2HVQ A;  1SD4 A;  3GVA A;  4G94 A;  4JK1 X;  5DS9 A;  1TNT A;  1MMA A;  2XAQ A;  4PDK A;  4BY7 J;  2BY0 A;  1ETQ A;  4KUM A;  2F5C A;  4IQJ A;  2IXS A;  1VQM I;  2LY2 A;  4AID A;  5KNL A;  3FWE A;  3HRU A;  1U5T C;  4A3J J;  1LKX A;  2X0L A;  1QZE A;  1OFC X;  2VBY A;  2XHK A;  3F6V A;  3CCS I;  4GDF A;  2Y69 H;  2Y9Z A;  3Q9S A;  1PUF A;  2V1X A;  5D5V B;  1FOY A;  3S15 J;  1XDU A;  3K7A J;  4XQF A;  2HNH A;  4PJJ A;  1POG A;  5FLM J;  3OYM A;  1J0R A;  4UUS B;  1Q1V A;  1ODD A;  1U9O A;  2MLG A;  3CCL I;  5KHD A;  3BRO A;  4KT6 A;  2HEO A;  4MQV A;  3BP8 A;  1R4N B;  5HDK A;  2HDD A;  3GO5 A;  1BW5 A;  4OIP F;  1Z0X A;  3BT9 A;  3G4S I;  1VQ8 I;  1MDM A;  4OMY A;  1RES A;  2ZXH A;  3EYI A;  1K78 A;  3CC7 I;  4PSX A;  3H9G A;  3R6S A;  4FQG A;  4D1Q A;  1ZG3 A;  3TED A;  4CDG A;  2Z33 A;  2JTV A;  2X1E A;  1EV7 A;  1X3U A;  3MEX A;  5D8K B;  1LFU P;  1MSF C;  4U87 A;  5H2F C;  2R0Q C;  3DLA A;  1SVO A;  2COB A;  1YG2 A;  2BBY A;  5K5O A;  3ZGK A;  2KT0 A;  4E7I A;  3Q0U A;  3TO6 A;  1R7J A;  1X2M A;  1IV6 A;  4IHT A;  2DOE A;  3QAH A;  1IN6 A;  1ON2 A;  3G6E I;  1G3W A;  2M3A A;  5J6X A;  4RAZ A;  1ACI A;  1T0F C;  5J1U A;  1Y1V J;  4D7N A;  1F1Z A;  4K2E A;  2D2W A;  3HHG A;  3QPT A;  2LRE A;  2M34 A;  2IVM A;  3BTI A;  1LUJ B;  3FBI B;  2PJR A;  1OIS A;  3V7R A;  1WJE A;  4HDU A;  1U9N A;  3S3O A;  4EGZ A;  2H1L A;  5KVR A;  3FHN A;  5FLX K;  2XUB A;  3Q3S A;  2DFE A;  4KN4 X;  2BY2 A;  3F8B A;  1VZ0 A;  1MZB A;  4ZZL A;  3HOS A;  1RI7 A;  2EFN A;  2W85 A;  2VKE A;  1N75 A;  1R23 A;  3C1D A;  4XOT A;  5B66 C;  5M3F J;  1ZAR A;  3GFJ A;  3RKQ A;  3K2A A;  2QCO A;  2DT5 A;  5GPA A;  4OU0 A;  5C4J J;  2GQQ A;  3FKI J;  1P2F A;  1YIT I;  2VJJ A;  4B1R A;  3I58 A;  2BZT A;  2HYJ A;  2L9S A;  1X4P A;  4I01 A;  3A02 A;  1YRN B;  2LP0 A;  3E6C C;  1WI9 A;  5HS7 A;  1HSJ A;  2IGN A;  5E79 C;  1HDP A;  1MBF A;  2GZW A;  5B3S H;  3WTZ A;  1CF7 A;  4HG2 A;  5E8I A;  5M5W J;  2ZXI A;  5HS9 A;  1LFB A;  2AO9 A;  4AD9 A;  1XD7 A;  1P9Q C;  3BTJ A;  3DV8 A;  4A3L J;  2LR8 A;  2D1V A;  3PFY A;  3GXO A;  1SFO J;  1WWX A;  1O57 A;  2KQR A;  2MBF A;  4EM0 B;  2CQX A;  2JSC A;  1S72 I;  4RS8 A;  4U0W A;  4I7H A;  3QP6 A;  1WJF A;  5DDG A;  3B73 A;  1FSH A;  5EG0 A;  5J3L A;  5FRO A;  4E7S A;  1BL0 A;  3T0Y A;  5BS6 A;  3TW6 A;  2ZCW A;  1KQ8 A;  1B4A A;  1MMG A;  2LOO A;  2P4W A;  1SVL A;  1JKQ C;  1V5F A;  1ZK8 A;  3HKZ N;  2LD5 A;  3ABU A;  4UHT A;  4BEH A;  3I64 A;  2PMZ N;  4L9N A;  2P6T A;  5TGT A;  4L9T A;  5H20 A;  2VOP A;  2UUZ A;  4N4N B;  5J47 A;  2QZ8 A;  4L9J A;  2WAE A;  1M1E B;  2EB7 A;  4M3E A;  3AG1 H;  4DBR A;  4V2F A;  1XC5 A;  1GV5 A;  2Y2Z A;  1QNT A;  3RIR A;  2ZKZ A;  3HOY J;  3IAS 2;  2CGP A;  2A6E F;  4A2U A;  3F21 A;  2DQL A;  1TNS A;  1ULY A;  2R5Z B;  1J7K A;  3A03 A;  3HZJ A;  1W36 D;  1YTY A;  1R71 A;  4A0X A;  3VWB A;  2LY1 A;  2P5L C;  4AYB N;  4AWX B;  1F4K A;  2O5R A;  1G3Y A;  2A69 F;  2BOL A;  2Q1Z B;  2QVO A;  2KDZ A;  1FLI A;  4FTH A;  2HR3 A;  4XRM A;  2DCE A;  1PP7 U;  4IOC F;  5B5E C;  4DNC A;  2K7L A;  4ZYE A;  5LFA A;  2CJJ A;  2ELH A;  2FQ3 A;  1TQP A;  4XLH A;  2ZBK A;  2YU3 A;  1ZQ3 P;  4MFE A;  3LQQ A;  1IZ1 A;  4EGY A;  3MN2 A;  3CME I;  3ELK A;  2MFZ A;  5H6R A;  3OYG A;  1BI0 A;  4OMZ A;  3PSI A;  2CFX A;  2YX7 A;  2ADU A;  2L3D A;  2XAG A;  2TRT A;  1G2H A;  3AKZ A;  4C3I J;  4BUP A;  3BG7 A;  3KP7 A;  1G8X A;  1XMK A;  3VEP A;  3KYL A;  1VND A;  2MD0 A;  3BCB A;  2NVU B;  3RYR A;  2PLY A;  4FIS A;  3GW2 A;  2B9S A;  1LPQ A;  3J7A Y;  3OYJ A;  3ASO H;  2OCC H;  3DPT A;  1MH4 A;  1OPC A;  2EV0 A;  5EGO B;  5F27 A;  1LE8 A;  2NS8 A;  4XID A;  2HOT A;  3OOU A;  1Y8Q B;  3S2W A;  2B0L A;  1Y1W J;  2BHY A;  4XK4 A;  2G7U A;  4AVZ A;  1HDD C;  2Z5U A;  1MD0 A;  3A0B C;  2UZK A;  5HDG A;  3FXK A;  4F3Q A;  3M07 A;  1H8A C;  1U78 A;  1I39 A;  2QBY B;  3CUQ A;  3LSR A;  5F04 A;  2V6E A;  3B02 A;  1TC3 C;  4QSH A;  2HZD A;  4OIR F;  4C2M J;  1X58 A;  1IXS B;  1VQO I;  2AS5 F;  3ZOB A;  2OAZ A;  5CVJ A;  4ZTF A;  2XF7 A;  2EJR A;  2ID6 A;  2NNN A;  3FMQ A;  4G9Y A;  2OF7 A;  4M9S A;  1FPQ A;  2NXN B;  5TRD A;  2EIJ H;  3W3C A;  2L5Q A;  3K0L A;  1YYV A;  4A6D A;  4BE1 A;  3GWZ A;  2EFQ A;  5FB2 A;  3G2B A;  2GOX B;  5LRR A;  1JE8 A;  3F8C A;  3DKY A;  2O7O A;  3ZQ7 A;  5E3N A;  4B3A A;  4IHY A;  4CCN A;  4NDL A;  3SFI A;  3FXQ A;  5IYC J;  3G71 I;  2UXX A;  3IAM 2;  3KEY A;  1L3L A;  3A1Y A;  1BI2 A;  2IA0 A;  2EZI A;  4A6E A;  2GWR A;  1WZ2 A;  2ZJQ F;  1NG7 A;  4FCY A;  4WXD A;  4S0H B;  5HDN A;  3DPL C;  2XAH A;  4BBR J;  1HQC A;  4ZC3 A;  3KP6 A;  2MC4 A;  2GXG A;  1Y39 A;  3HEF A;  1MBK A;  4IRH A;  2IA2 A;  1S6L A;  3VSK A;  1FYK A;  4IQ4 A;  2K5C A;  3ASN H;  1NTC A;  3WHC A;  5LEJ A;  3BG9 A;  5DEQ A;  1VQK I;  3BTC A;  3K6G A;  2A5Y B;  2WB1 N;  2MH2 A;  4CCO A;  4P1W A;  4V2G A;  3RDI A;  3ZP5 A;  2CW0 F;  2DA4 A;  2JVH A;  4IL6 C;  3ZQH A;  4E7Z A;  1BW6 A;  1X3Z B;  5CVU A;  3VFZ A;  4C30 A;  3DEW A;  3M1C A;  1EA3 A;  3OL3 A;  1UZC A;  2WAQ A;  4EJW A;  2QQ9 A;  1ETX A;  2EZK A;  4I99 C;  3O2P E;  2LSO A;  2PMH A;  1U0J A;  2DXI A;  1BR2 A;  4B8X A;  2E7X A;  3L2Q A;  3UKG A;  1QZY A;  2BVM A;  2F2E A;  3I71 A;  4KIF A;  2HDC A;  1A36 A;  2QM3 A;  1JGG A;  1ZGA A;  3H3V K;  4PFO A;  3ZN1 A;  1TP4 A;  1JT6 A;  2ESN A;  4MO7 A;  4XLN F;  2F5E A;  4BHC A;  4A12 A;  1W7P A;  4Q4Z F;  2JUG A;  3DBL B;  3IH4 A;  3JAM K;  2Z3Y A;  2H1K A;  4UVC A;  4LJZ F;  1HBX G;  5IY5 H;  1JXS A;  1HCR A;  5KAF C;  4E7J A;  2G7H A;  1A6I A;  1YX3 A;  2KFD A;  3O6B B;  2L9V A;  2KIU A;  4ZDO A;  2W1O A;  2LK2 A;  3OV8 A;  5B1B H;  3OS1 A;  3JRD A;  5C44 J;  1ZGJ A;  3HC7 A;  3DKX A;  4AIK A;  2PMZ A;  5HOO A;  2JUC A;  2VT2 A;  3QOE A;  5FKM A;  1QPM A;  2VT3 A;  3HDD A;  3KZY A;  2PFB A;  4EQQ A;  2EFO A;  3BCA A;  4LOC A;  4IHW A;  1FOW A;  3MKZ A;  3T8R A;  1JUS A;  2O3F A;  3KET A;  3BZK A;  3K4B A;  3OYL A;  2F4I A;  3A4C A;  4O3M A;  2FXA A;  4OIO F;  4X6A J;  3H36 A;  4M9X A;  4LB5 A;  1FX7 A;  2R7W A;  3QRF F;  1AKH A;  1WJB A;  4PJ0 C;  3NEU A;  5D4R A;  2RNJ A;  1MSE C;  2DU9 A;  2F6C A;  2WV1 A;  4JYK A;  1XG1 A;  1YOV B;  3KLN A;  5LGT A;  2VJI A;  1FYM A;  1HA8 A;  3QU6 A;  4RGU A;  1AA7 A;  2M87 A;  3CF2 A;  4M71 A;  4BQQ A;  3OY9 A;  5D5W B;  3CP8 A;  2E36 A;  3H5N A;  2XGD A;  4RB2 C;  1ETY A;  1V3F A;  4R79 A;  3N97 A;  1TT0 A;  3FMR A;  2X6W A;  4UUS A;  4ZZD A;  4WX9 A;  2RV8 A;  3F22 A;  2WA0 A;  2M4G A;  4PZJ A;  5J8F A;  1R9T J;  2JZY A;  3HOV J;  3CUQ C;  4CZZ A;  4Y4R A;  3PQJ A;  1MKM A;  2PG4 A;  1Z9C A;  3OL4 A;  3SEZ A;  1GV2 A;  1LFP A;  3HRM A;  5KAI C;  2YX4 A;  4GYG A;  2LTP A;  3E5X A;  2KRF A;  4HDV A;  2KRC A;  3P7N A;  4OAZ A;  3HJE A;  4BHB A;  3CCV I;  2X6X A;  3G3Z A;  4WWC A;  3FM5 A;  3LQR A;  4QWQ A;  3RPU A;  3HPG A;  2HDW A;  3WTU C;  3PUB A;  4YFX F;  4F93 B;  4KDP A;  3WU2 C;  2ESH A;  4IJA A;  1WCM J;  2BY3 A;  4BJ6 C;  1VQ5 I;  1B8I B;  3WTX C;  3IH2 A;  3P9K A;  1B1B A;  2QSF X;  1SFU A;  2FA5 A;  1A35 A;  2X51 A;  1OMI A;  1YS7 A;  3DP7 A;  5IT3 A;  2E1M B;  3MAJ A;  4CCM A;  3TOA A;  3JRG A;  3IRR A;  2K9M A;  3KEO A;  3BPV A;  3F3X A;  1R1U A;  5J40 A;  3GBG A;  3Q5F A;  2VJ4 A;  5JHU A;  5CVV A;  5LLQ A;  2KP6 A;  2RC4 A;  5DM7 F;  5A2Q Z;  2VC1 A;  3BR1 A;  3W2V A;  2RKH A;  3EUA A;  4ENK A;  5D5U B;  1L0O C;  2L7Z A;  5D5X B;  1OYY A;  3F8M A;  3K4C A;  3HGY A;  4UVA A;  3CCJ I;  1YI2 I;  1R36 A;  2XRO A;  3VYU B;  2KIM A;  4RB1 A;  2Q0O A;  1VQP I;  4G7Z F;  2H6C A;  2A61 A;  2OZ6 A;  1FT9 A;  1P4W A;  2KLO A;  2CWE A;  3DQV C;  4DOZ A;  4C2T A;  1C0W A;  2KPM A;  2OCE A;  3DU5 A;  3PM1 A;  1TWA J;  2W4S A;  1REP C;  4WXC A;  3S3M A;  2KL4 A;  3RJP A;  5HLI A;  1KQ0 A;  3SZG A;  5HLT A;  3CDI A;  1ZKG A;  2FD5 A;  3BJO A;  4O5V A;  3S32 A;  3WU0 A;  3GTQ J;  4YEL A;  1J2X A;  2UWM A;  1BA5 A;  2G0E A;  3ZQI A;  1V5E A;  2ZJ2 A;  3LA7 A;  4CSW A;  2CS3 A;  3LA2 A;  4XIC A;  1Z3Y A;  1K79 A;  3GTM J;  1PJR A;  2L4M A;  2XAJ A;  1ORK A;  1TTY A;  2A5W A;  5ILU A;  2VJ5 A;  2QKM B;  4UV8 A;  2LBF A;  3OR2 C;  2DMQ A;  1A04 A;  4FET A;  2V79 A;  3JRB A;  2BW3 B;  2K85 A;  2Y31 A;  5ED4 A;  2DLL A;  4W97 A;  4ZDP A;  4IRG A;  3CJN A;  3HUG A;  3BPX A;  4HV5 A;  1ENH A;  3WG9 A;  4DZJ A;  4IOA F;  4M72 A;  5DD8 A;  4I0A A;  3E6M A;  1Z21 A;  3F6O A;  1T6S A;  2IP2 A;  3MKL A;  2JN6 A;  4HV6 A;  3KP4 A;  1O4X A;  3CMM A;  2M2E A;  1UCR A;  3SEQ A;  2R5Z A;  4AIH A;  1LDJ A;  3SFZ A;  4M6V A;  1PUE E;  4A3I J;  2OU2 A;  3BR5 A;  1Z77 A;  2LKP A;  2CV0 A;  2CV1 A;  1WKM A;  2VOO A;  4ZYD A;  3SDB A;  5JVG F;  3E5Q A;  4MTD A;  3S17 J;  1O7L A;  3FM3 A;  2V1N A;  2FQ4 A;  2L9R A;  3OWT A;  4L0Y B;  3HGG A;  3T5X A;  1JKP C;  1T38 A;  2IGM A;  1YE9 A;  2VQH A;  3SJM A;  3WGG A;  1V4R A;  3U1D A;  3ONQ A;  1EH8 A;  3QPS A;  3CCU I;  2DMP A;  4NB5 A;  4F55 A;  3ZRG A;  4KT5 C;  2J5O A;  2FNA A;  3ERM A;  2RRE A;  5B1A H;  3PO2 J;  3H3U A;  3RPU D;  4EAT A;  2EIL H;  1PP8 F;  3HTU A;  1T2K A;  2ZSI B;  1UST A;  2O8K A;  1EJ9 A;  5BOX A;  1P4X A;  2L02 A;  1LDD A;  2Y0S A;  4KIT B;  5BQT A;  5IP7 J;  2JA5 J;  4A5M A;  3S1R J;  1XSV A;  2OV7 A;  2XB0 X;  3P5J A;  3K4N A;  3BR6 A;  1B72 B;  3BR3 A;  3I56 I;  2XAF A;  3HG9 A;  2E34 A;  2H09 A;  3A01 A;  3B6C A;  3M8F A;  3I0T A;  3DEE A;  4MHG A;  1SD5 A;  4XMY A;  5E1W A;  2JJ7 A;  2DPU A;  4NQW B;  1G59 A;  1ZLJ A;  4B44 A;  3C2B A;  4QIW N;  1X4O A;  5L3C A;  1PYV A;  1FYL A;  4IHX A;  3K2Z A;  3NAU A;  2O9L A;  2M0C A;  2DTZ A;  4XL9 A;  1S9H A;  4B09 A;  3P9C A;  3V42 A;  4A3G J;  2GA1 A;  1RR8 C;  2F5D A;  4CCK A;  3ZQL A;  2OC6 A;  4PGH A;  4UXN A;  4HAM A;  4A5N A;  1I6X A;  2O03 A;  1TWG J;  5CQE A;  1P4A A;  3HOU J;  2L2O A;  3OYI A;  1IG7 A;  4BXU A;  1UHM A;  2FBK A;  4BJT A;  1A6Q A;  2IBD A;  5IOZ A;  4XLP F;  3Q9V A;  3TMO A;  3X2Q H;  3BZ6 A;  4Q48 A;  3OSG A;  1TL8 A;  3CP2 A;  1UG0 A;  1FSE A;  4XLA A;  2LFB A;  4LIV A;  4RAG A;  2MH9 A;  1O7F A;  1I50 J;  5EJC A;  3MMY B;  1P7J A;  1OYI A;  3CZ6 A;  2QF7 A;  5AIQ A;  2RDP A;  4HLX A;  1YQA A;  3JRH A;  1IRG A;  3RCO A;  1JTY A;  4IRI A;  4M73 A;  4C3J J;  3R0J A;  5E17 F;  4D5C A;  1HKS A;  1JKR C;  1FTZ A;  4HX8 A;  4HOB A;  4KMU X;  5LHG A;  4UB6 C;  1LB2 A;  1X2N A;  4CYC B;  4ASN A;  4HW0 A;  5CYV A;  1IGN A;  2E60 A;  1UAA A;  2LF7 A;  2XAS A;  3QYF A;  2HPI A;  1T8I A;  3AG3 H;  1V54 H;  3C3W A;  4UNO A;  4ZJZ A;  1SAU A;  2RAE A;  2ECB A;  2HYF A;  2H6B A;  2DI3 A;  4XR6 A;  1JT0 A;  3I53 A;  1MNM C;  3IUO A;  4D9J A;  1FTT A;  2Q8K A;  4BDZ A;  1UMQ A;  1U5T B;  3IHU A;  5JHF A;  1B9N A;  3ABK H;  4KJZ A;  1UHS A;  1MJB A;  2IW5 A;  2YS9 A;  2K02 A;  3GFI A;  4L5E A;  4F92 B;  1DPR A;  3FIW A;  1E3P A;  2X1D A;  3S2H J;  2EIK H;  1V55 H;  4XNF A;  3W2W A;  1NH3 A;  4LLL A;  2GAU A;  3WE3 A;  4JX4 A;  1U2W A;  3PIO F;  1E17 A;  5H6Q A;  1K83 J;  2LY9 A;  2M8E A;  2WAQ N;  4LFU A;  5EZG A;  1FBU A;  2JA8 J;  4EJT A;  1ZLK A;  1FBQ A;  1GVD A;  4MQ9 F;  2Q2E A;  1YW8 A;  2EIN H;  1STZ A;  2K40 A;  2XAU A;  2AXL A;  1OYW A;  4PFP A;  3ZCO A;  1QRY A;  1UEL B;  3R4K A;  4IVN A;  5HS8 A;  1SAN A;  4C9Y A;  5JVT A;  2P7V B;  2HZT A;  2EV5 A;  1MBJ A;  2F48 A;  1LEA A;  2DDB A;  3I59 B;  2FEZ A;  3ML6 A;  3H5R A;  3IH3 A;  2RN7 A;  3WTS C;  2LLK A;  2VE8 A;  3DXJ F;  2WAF A;  3IC7 A;  3KX2 A;  2CYY A;  3WTW C;  4G7O F;  4DJA A;  5K7Z A;  2EFP A;  2IT0 A;  3FHZ A;  5DTD A;  2OJE D;  4U88 A;  4HEA 2;  1RUO A;  5FKL A;  5ICG A;  1J75 A;  1UJ8 A;  3I9V 2;  1OCZ H;  3WTT C;  1DUX C;  3CLQ A;  3HXL A;  3VOD A;  3HHH A;  2DYR H;  1BR4 A;  3TKY A;  5DCF A;  2ICW G;  3V8K A;  2IS4 A;  1WVR A;  1R49 A;  2DK8 A;  1D8K A;  4M9Z A;  4EEF G;  3LOC A;  4BH9 A;  4GGG A;  3BZC A;  3JRA A;  4GRI A;  2VC0 A;  5DUI A;  3JTH A;  4N9H A;  2QWW A;  2HOA A;  2F5F A;  2L9N A;  1LNW A;  1RNL A;  3GUD A;  3HL2 A;  4XSX F;  3CO6 C;  1D0Z A;  4N9I A;  3G1O A;  4FE4 A;  4LK1 F;  3MKW B;  5CLS A;  2CFO A;  2KRH A;  4U7D A;  1YJW I;  1RKW A;  3CC4 I;  4ETS A;  4N0B A;  3BOQ A;  2KMU A;  1U3E M;  1R5H A;  4ESB A;  2X1C A;  4HPQ A;  1S29 A;  4I02 A;  1TQM A;  3BR2 A;  5LBQ A;  2XKO A;  4I2O A;  4HNV A;  3BG5 A;  3J80 Z;  3N4M A;  3KZZ A;  3ABT A;  2ZJR F;  5IT9 Z;  5EYR A;  1K6Y A;  4BNC A;  4BYY A;  1FMV A;  3REO A;  3AG4 H;  4D0P A;  2IS2 A;  3H5A A;  2FBH A;  1OCP A;  1IXR C;  2OUM A;  1SMY F;  1FC3 A;  1TBX A;  3NWT A;  2HGC A;  4II3 A;  2DA3 A;  3LWF A;  3A2K A;  2W24 A;  3HRS A;  1LJ9 A;  2CQK A;  3E1S A;  2GLO A;  1OLT A;  4NC7 A;  1W36 C;  2V7F A;  4S04 A;  2DA6 A;  2MW8 A;  4A3C J;  3PL8 A;  1FBS A;  2OD5 A;  3KP5 A;  1YIJ I;  1D3Y A;  1R22 A;  4II2 A;  1JTX A;  2ETH A;  2R7X A;  1KA8 A;  2DMN A;  2M0M A;  2ZXJ A;  4WK8 F;  3QU3 A;  3CCM I;  5IP9 J;  2GA2 A;  2ELJ A;  1RZ4 A;  5CVI A;  1ZH5 A;  4BAY A;  3VYT B;  1MNE A;  3IKT A;  3BY6 A;  2EBI A;  1D8J A;  3TO7 A;  4OIN F;  2ME0 A;  1YHQ I;  2DFH A;  2HKX A;  2E1C A;  1Y56 A;  1IJW C;  2ZNZ A;  4RA2 A;  2OA4 A;  2IRF G;  3ZMV A;  1K61 A;  3PNT A;  3SDG A;  2JPC A;  2YU9 J;  4W1U A;  1T95 A;  3OS2 A;  3HB9 A;  1WQ2 A;  3KFW X;  3QOD A;  3OYF A;  3ZMD A;  1MGT A;  3CLO A;  4JP0 A;  3BR0 A;  3GEZ A;  2CSO A;  1E2X A;  1ZRE A;  2ZJP F;  2R7U A;  2PI0 A;  4RAY A;  1KU3 A;  1WI3 A;  1ETK A;  5EF6 A;  1GXP A;  3MQ0 A;  1FP1 D;  3JRC A;  3OYA A;  3PNY A;  1O3S A;  2VPR A;  4D5F A;  1OCC H;  3RKY A;  2W57 A;  3H9Q A;  4EM1 A;  3OYE A;  4IZZ A;  3BJ6 A;  2BGC A;  1PUF B;  4BQO A;  1HW5 A;  4N4O B;  4I6Z A;  4GYI A;  1DGR M;  5FFX A;  3RZD J;  2ZNY A;  2L7M P;  1RPW A;  2ACJ A;  4RDU A;  1T33 A;  2FX0 A;  2QA4 I;  1IRX A;  5ICF A;  3HOX J;  1FNN A;  2GXB A;  2VPL A;  3HTS B;  2IAI A;  1I6H J;  2R7D A;  4LD5 A;  1QQI A;  2FUG 2;  3S93 A;  1BIB A;  1Z05 A;  3K4M A;  2FF4 A;  4H4K C;  3EYY A;  2VBX A;  3IP4 B;  5E1Z B;  3ROU A;  1GDT A;  1QPI A;  3K9T A;  1MDM B;  2ZXW H;  4B48 A;  2DO7 A;  5M3M J;  2V26 A;  3TQN A;  3ZPL A;  2KZG A;  3A0H C;  3EUK L;  1XTA A;  3OSF A;  4DYR A;  4ANJ A;  2CH0 A;  1EF4 A;  4EM2 A;  4HA8 A;  2JRT A;  5FD5 A;  2BHZ A;  4HLY A;  3G1L A;  4RM2 A;  2PMU A;  5CPR B;  2R5Y A;  5JI6 A;  3O8G A;  2DMU A;  3DBR B;  4ABZ A;  3FIS A;  4XKC A;  3OYD A;  5CJ9 A;  2VQC A;  1TLH B;  5J4Y A;  2YSR A;  2DBB A;  2K4J A;  1BC8 C;  4LGW A;  2ECC A;  2PJR B;  1Z6R A;  2BW3 A;  3ECH A;  4X1E A;  3GTJ J;  1R58 A;  1H89 C;  1SMT A;  1NG6 A;  1MBG A;  2DW4 A;  2NNY A;  2W82 A;  2ZME A;  2QYO A;  3F8F A;  2JWT A;  3OOP A;  3UNG C;  1KQ9 A;  2BE5 F;  4UB8 C;  1ZRF A;  3CJT B;  3O8H A;  2DA7 A;  5D8L B;  2QQ8 A;  1ZAO A;  2XDV A;  4M3B A;  2Z2S B;  2K3F A;  4RLQ A;  4GCV A;  2QUF A;  1QVT A;  3FMS A;  4YII A;  3CC2 I;  4BAC A;  4CZC A;  1EKE A;  2L01 A;  2XPV A;  1R4M B;  2DA5 A;  4F52 A;  5IT9 K;  5L3E A;  1SVM A;  2EQR A;  3QP5 A;  1QBJ A;  3K10 A;  3M8E A;  4HNT A;  4FX0 A;  2G9W A;  1MH3 A;  3HM5 A;  3I3L A;  4FE7 A;  4BBS J;  1B59 A;  2VKV A;  3EDP A;  3AL0 C;  4A3K J;  4P96 A;  1HLV A;  1BJZ A;  1J09 A;  3E5U A;  4NNJ A;  4D7M A;  3DBH B;  2VL8 A;  4CGZ A;  2W84 A;  1KON A;  2NS0 A;  2RQQ A;  5HNF A;  4NHJ A;  5DCM A;  1MJA A;  3RQ4 A;  1ZTR A;  2VB6 A;  4ZYH A;  1IRZ A;  2HQA A;  1XB4 A;  5EEH A;  4AC0 A;  3LSP A;  2DDA A;  2Y0S N;  2VQG A;  2NVX J;  3PQK A;  5AON A;  3WGH A;  4IO9 F;  3LMM A;  4LIT A;  5GAG J;  3H0G J;  4NQW A;  1T08 B;  1EH6 A;  3GME A;  4XBF A;  2R7T A;  4QPQ A;  4A0Z A;  2CW7 A;  5IYB J;  1I3A A;  2LVS A;  4Q47 A;  1KU9 A;  4ZTJ A;  4FT8 A;  1W0T A;  1OR7 A;  3DTE A;  1AU7 A;  5F0F A;  3TP0 A;  1V5G A;  2W00 A;  2VAS A;  2IGK A;  4BEH B;  1ITY A;  1T98 A;  4HYE A;  3DPU A;  1W1W E;  2QQB A;  4OAY A;  2J5P A;  1S8N A;  2I5U A;  1VQ6 I;  2CUJ A;  3G73 A;  3CF5 F;  3L2R A;  4Y7N J;  2DFI A;  1BR1 A;  4XKB A;  3TW7 A;  1K4T A;  1HOM A;  1WPK A;  3CJQ B;  4ENN A;  1FMW A;  1XS9 A;  5AIP A;  4RMN A;  2RGV A;  1VQ7 I;  1FEX A;  3BLY A;  3GZ5 A;  1FJL A;  2HVR A;  3MZ8 A;  2LC2 A;  2VN2 A;  1KYZ A;  1U8B A;  4M74 A;  1FP2 A;  1JJ6 C;  5HOD A;  3H35 A;  3ERE D;  2AXT C;  5EEG A;  1J59 A;  1BC7 C;  2DT7 B;  2B7E A;  2O6G E;  4HF1 A;  3IV5 A;  1Z1D A;  2DOF A;  3VSL A;  1GHC A;  2EZH A;  4LG3 A;  1ZGW A;  1TWF J;  2P5V A;  4ZYG A;  5M5Y J;  1R6R A;  1N77 A;  2QSG X;  4XRF A;  4RB3 C;  1YO5 C;  2OQR A;  1D1B A;  2QSH X;  4UUV A;  3BWG A;  4BXX J;  1OCR H;  1USS A;  2CU7 A;  3JSP A;  3CDL A;  3KYC B;  3V8L A;  4XN0 A;  5J8C A;  4MNU A;  3S2D J;  4RLF A;  3M4O J;  2CG4 A;  2VLA A;  3JTG A;  2MYS A;  2E7W A;  2XRL A;  2HI3 A;  4QLC U;  2QEX I;  2E5N A;  3L00 A;  5JLX A;  4LG0 B;  3S8P A;  4Y15 A;  2K9L A;  1IN4 A;  2FOW A;  1ZHF A;  3KIO A;  3CMA I;  3J81 Z;  1XCB A;  3FK7 A;  1LE8 B;  4Q5S F;  2HTJ A;  4WCG A;  2OBP A;  2JVG A;  5ICE A;  2R3S A;  2LYC A;  3GX4 X;  3FXR A;  1E3H A;  3V7S A;  5LHI A;  2E2I J;  1YIO A;  3OR1 C;  3R0A A;  5DUK A;  3JRE A;  2E35 A;  3GF2 A;  4FAS D;  3CUQ B;  2E5Z A;  4J19 A;  2HU9 A;  2L0K A;  4J01 A;  4IHV A;  2VI6 A;  3I55 I;  2K9N A;  1YRN A;  2W25 A;  4PCQ A;  1FIP A;  2WWY A;  4M3F A;  5BPI A;  2M4K A;  4P5O A;  1TZL A;  4DYC A;  1E0E A;  1I27 A;  5E8G A;  3MVP A;  2DAO A;  2FMY A;  3HBL A;  3MD2 A;  1ZRC A;  2ZME C;  1VTN C;  2VQL A;  4XSZ F;  5TJJ A;  3K1M A;  2ZSH B;  2MGQ A;  2WAD A;  1J5Y A;  4CCL A;  2FNP A;  1W5T A;  1R00 A;  3S1M J;  4B47 A;  2XGE A;  3I59 A;  3L2W A;  2FU4 A;  1PVE A;  2LG4 A;  4HRI A;  4CO8 A;  3IWZ A;  5L3B A;  1YLF A;  2OTJ I;  2H8R A;  2A6T A;  3D5S C;  1HF0 A;  4GO1 A;  1RR7 A;  3RI4 A;  2KIQ A;  2XB5 A;  4E7L A;  2W7N A;  4ESF A;  1GVJ A;  1S7O A;  1BOB A;  4KYW A;  3HOW J;  1XGM A;  3W6K B;  1J9I A;  1VQN I;  3F72 A;  3C18 A;  3M1E A;  3F23 A;  2F4M B;  4F7Z A;  5LGN A;  5FLX Z;  1KU2 A;  5FKO A;  2O61 A;  2XGC A;  3W2A A;  1D5Y A;  1DDN A;  2XVC A;  4PK4 A;  1VQ9 I;  4G6Q A;  2WTE A;  4LMY A;  2Z99 A;  3R61 A;  4R1H A;  4BGD A;  4XOP A;  3HPH A;  1IRF A;  1WHU A;  2XF5 A;  4MEX F;  1I1S A;  5FLV A;  2BVL A;  2X85 A;  3WE2 A;  4CXF A;  2FOK A;  5IYD J;  2EH3 A;  4BY1 J;  4E4H A;  1OR7 C;  4XRS A;  1VQL I;  1Y8R B;  2WV0 A;  2CW8 A;  5DV5 A;  2NOJ B;  2ZFU A;  3W6V A;  3JRI A;  2P8T A;  5F0H A;  5ILV A;  4NBQ A;  1XX5 A;  2QEN A;  1W7P B;  2VON A;  3ZQC A;  3H1C A;  3K1N A;  3T8T A;  3NQO A;  2R7F A;  2DJI A;  3CJR B;  1QZZ A;  1MJ9 A;  2EPF A;  2M1B A;  1MBE A;  3BG6 A;  1ZN2 A;  1ON1 A;  3GLL A;  3JRF A;  3K4L A;  4BDY A;  1BBY A;  5E20 A;  2GIV A;  2MD5 A;  3VOE A;  1ZG1 A;  1IUY A;  3DU6 A;  2CO5 A;  2K4B A;  3SZT A;  2L7K A;  1OJL A;  2VBZ A;  1JUP A;  3SZP A;  3ISP A;  5EGO A;  3K4K A;  4BL0 B;  4DW6 A;  3OYB A;  4JOM A;  3MWM A;  2W48 A;  3CD6 I;  4A69 C;  3I4P A;  4CH7 A;  2EWN A;  4KIG A;  4KNY A;  2CUZ A;  3DKW A;  2X48 A;  3J7A O;  3FXM A;  4O6J A;  2H94 A;  2ZB9 A;  4U0Y A;  5A2Q K;  1O3R A;  2QBY A;  1ETO A;  1OCO H;  1SFE A;  5F1J A;  2ZO4 A;  3OIO A;  1YJN I;  3HSR A;  1SD7 A;  1SD6 A;  5ILS A;  1W5C C;  1DQU A;  1AKH B;  4CCJ A;  4U7B A;  5E3O A;  4E6K G;  4CIC A;  4EJV A;  3I5U A;  1Y0U A;  3LSK A;  5GP9 A;  2OTL I;  2QQA A;  3I4N J;  3GZN B;  3CTA A;  4JBA A;  1YFH A;  4BE0 A;  2MC3 A;  3D0S A;  1Z67 A;  3F0C A;  1RUN A;  3C2G A;  1TT5 B;  4QTR A;  1BJA A;  3LFK A;  3K70 D;  1ONV A;  2JQ7 A;  3E97 A;  3ZXS A;  3V4G A;  3D5R C;  3FZV A;  5DD4 A;  1X1P A;  1CQT A;  3MFK A;  2I10 A;  5D4S A;  1D0X A;  2V1U A;  1H88 C;  2DFF A;  1LDK B;  1BIA A;  4EJU A;  3OMY A;  2P0W A;  1LEB A;  3U9G A;  1JHH A;  4KA4 A;  4RBO A;  2MLK A;  2CRG A;  3TL4 X;  3KEQ A;  2DJN A;  5L3D A;  2LNB A;  4P9U A;  1XGN A;  1D5V A;  3WTV C;  2MAB A;  3Q0V A;  4RM3 A;  1X19 A;  5BMZ A;  4BKX A;  2Y30 A;  1WJC A;  1DU0 A;  3HYI A;  1IN8 A;  3CQZ J;  1S5L C;  1Z7L A;  3FK6 A;  3PO3 J;  3K70 C;  4G12 A;  2NVQ J;  1QO0 D;  5LGU A;  2E2J J;  4PJN A;  3TDU C;  3TO9 A;  1Y6I A;  2BXY A;  3CCQ I;  1DGW Y;  1VF9 A;  2X6O A;  2BYV E;  2AQE A;  2YR2 A;  3P9I A;  2Y75 A;  2EK5 A;  1MBH A;  2DOA A;  1OCT C;  4H0E A;  3QYB A;  2VXD A;  2HWV A;  3FF5 A;  4NC6 A;  4HZF A;  3WU1 B;  2OPT A;  4TV7 A;  1XMA A;  3G1M A;  4CUG A;  1Z3X A;  3EUH C;  1JGS A;  1XMX A;  3BTL A;  3BQZ A;  3FXU A;  2KJC A;  4HF0 A;  2COM A;  1LQ1 A;  3GTL J;  1NK3 P;  2HXO A;  3H0D A;  1XGO A;  2DA1 A;  4FHT A;  1DU6 A;  1MW7 A;  4HSR A;  2XV4 S;  3DWL E;  4GFB A;  4G7H F;  2PBI A;  2DT6 A;  1WSU A;  3S16 J;  3QQA A;  3I4M J;  4AVP A;  4WF2 A;  4KFC A;  1RC9 A;  1R1V A;  2XSD C;  1P7I A;  2CQ7 A;  3FBN B;  1BN5 A;  3M8J A;  3CDH A;  3O3K A;  2WY7 Q;  3Q0W A;  2STT A;  4BQN A;  3J7Z I;  3VPR A;  2ISY A;  3LA3 A;  2F5V A;  3GTP J;  2JA2 A;  2FRH A;  4MTE A;  4ENJ A;  2STW A;  3LFU A;  1HST A;  3L1P A;  1MMD A;  4JX5 A;  3PIP F;  4LLN A;  3TOB A;  1X1A A;  2PQ8 A;  3FXO A;  4LLG F;  3S14 J;  3S1Q J;  1EH7 A;  2V9K A;  4A3M J;  3GFL A;  3JSO A;  1F43 A;  2HQ5 A;  3HRT A;  3BG3 A;  5K5R A;  3WTY C;  1FZP B;  2NOG A;  3DFG A;  1JJ8 C;  3BQY A;  2PN6 A;  3WGI A;  1WFX A;  3AG2 H;  2K9S A;  3WG7 H;  3H9J A;  4IKF A;  4YFN F;  2K27 A;  4Y17 A;  2DN0 A;  2GIZ A;  1JUM A;  1WJD A;  4ZH4 F;  5IPA A;  2LMD A;  3S1N J;  2LBF B;  3PNV A;  1GXQ A;  4AM3 A;  1TW2 A; 
#chains in the Genus database with same CATH homology
 3JRG A;  2ECC A;  4MIM A;  3GTJ J;  4X1E A;  1H89 C;  2VUM J;  3GBG A;  5DS9 A;  4JX6 A;  1MBG A;  4BY7 J;  1ETQ A;  2JWT A;  3BR1 A;  3O8H A;  2DA7 A;  4A3J J;  3CCY A;  2L7Z A;  1OFC X;  4M3B A;  2Y9Z A;  1ETV A;  3HGY A;  1PUF A;  1AHD P;  1QVT A;  3S15 J;  3K7A J;  4A3B J;  1POG A;  2IEK A;  5FLM J;  4UUS B;  1Q1V A;  2XPV A;  2DA5 A;  4A3F J;  2JA7 J;  1U9O A;  2EQR A;  2JA6 J;  1IC8 A;  3PM1 A;  1TWA J;  1MH3 A;  3HM5 A;  4FE7 A;  1T56 A;  2HDD A;  4BBS J;  2CUE A;  2VKV A;  1BW5 A;  1Z0X A;  3BT9 A;  4A3K J;  1RES A;  1HLV A;  5JLW A;  1BJZ A;  4B4C A;  5FKK A;  1ZKG A;  2FD5 A;  4D7M A;  3GTQ J;  3TED A;  2NS7 A;  4UUT A;  1I3Q J;  1LFU P;  1MSF C;  1BA5 A;  1ZTR A;  2G0E A;  1IRZ A;  3ZQI A;  4Y52 J;  2R0Q C;  1B8I A;  2COB A;  4AC0 A;  2JK3 A;  4XIC A;  2KT0 A;  3GTM J;  3LSP A;  2Y0S N;  3Q0U A;  1X2M A;  1ORK A;  1IV6 A;  2NVX J;  3A01 B;  3H0G J;  5J1U A;  1Y1V J;  4D7N A;  2M9H A;  2DMQ A;  2M34 A;  3BTI A;  5IYB J;  2LVS A;  2E2H J;  1U9N A;  3JRB A;  1A5J A;  1W0T A;  5K7F A;  2Y31 A;  3Q3S A;  1AU7 A;  5F0F A;  3TP0 A;  4W97 A;  1ENH A;  1ITY A;  4DZJ A;  2VKE A;  1RET A;  5M3F J;  3MKL A;  2JN6 A;  3RKQ A;  9ANT A;  3K2A A;  2QCO A;  1O4X A;  5GPA A;  5C4J J;  4Y7N J;  3TW7 A;  2M2E A;  3FKI J;  3HOZ J;  1HOM A;  1WPK A;  1IDZ A;  2R5Z A;  4M6V A;  1XS9 A;  4B1R A;  4A3I J;  3BR5 A;  1Z77 A;  1FJL A;  1FEX A;  2HYJ A;  2D5V A;  4M3G A;  1U8B A;  1JJ6 C;  1YRN B;  3A02 A;  3S17 J;  5HOD A;  2FQ4 A;  2L9R A;  2LP0 A;  5E3M A;  1NK2 P;  3HGG A;  1JKP C;  3SJM A;  2XPW A;  1HDP A;  1MBF A;  3QPS A;  3ZQG A;  3IV5 A;  2DMP A;  2GBY A;  5M5W J;  2EZH A;  1LFB A;  2AO9 A;  1ZGW A;  1TWF J;  3PO2 J;  5M5Y J;  5C3E J;  2AHQ A;  3BTJ A;  4A3L J;  2O8K A;  4BXX J;  2LR8 A;  1QVU A;  1SFO J;  2CU7 A;  5IP7 J;  3CDL A;  2JA5 J;  3S1R J;  2CQX A;  2XB0 X;  3BR6 A;  1B72 B;  4A3E J;  3S2D J;  3BR3 A;  5EG0 A;  3A01 A;  3M4O J;  5J3L A;  3B6C A;  4IEJ A;  1VFC A;  2JJ7 A;  1BL0 A;  3TW6 A;  2ELK A;  2XRL A;  2HI3 A;  2NVY J;  3C2B A;  4QIW N;  5JLX A;  5K7H A;  4IHX A;  3NAU A;  2O9L A;  1JKQ C;  2M0C A;  2DTZ A;  3HKZ N;  1ZK8 A;  3B6A A;  2LD5 A;  2PMZ N;  3DCF A;  3FK7 A;  1LE8 B;  4A3G J;  2X9D A;  3ZQL A;  4M3E A;  4V2F A;  1XC5 A;  1TWG J;  1GV5 A;  2E2I J;  3HOU J;  2Y2Z A;  3HOY J;  3JRE A;  1IG7 A;  2R5Z B;  3A03 A;  2IBD A;  5IOZ A;  2GM4 A;  4J19 A;  5EZH A;  2L0K A;  4IHV A;  2VI6 A;  3OSG A;  2K9N A;  4AYB N;  1YRN A;  1S7E A;  2LFB A;  5J1R A;  1FIP A;  4M3F A;  4A3D J;  2KDZ A;  4DYC A;  4FTH A;  3MVP A;  4XRM A;  1I50 J;  1P7J A;  3HBL A;  4AUX A;  5FJ8 J;  1F36 A;  2QF7 A;  2CJJ A;  3JRH A;  1WGX A;  1JTY A;  1JKO C;  4C3J J;  2MGQ A;  1ZQ3 P;  4MFD A;  4D5C A;  4MFE A;  1UG2 A;  1JKR C;  1FTZ A;  3MN2 A;  3S1M J;  1X2N A;  2LKX A;  4CYC B;  5M5X J;  1IGN A;  2P81 A;  1ZR4 A;  2XGE A;  5F0C A;  2TRT A;  1G2H A;  1B72 A;  4C3I J;  3LSJ A;  5EG0 B;  2K9Q A;  2H8R A;  2RAE A;  2TCT A;  3RQI A;  2ECB A;  1HF0 A;  1VND A;  3QPL A;  1JT0 A;  1RR7 A;  2CUF A;  1MNM C;  4FIS A;  1FTT A;  2XB5 A;  2B63 J;  1UMQ A;  1ZR2 A;  1MH4 A;  3HOW J;  2MSY A;  5EGO B;  5F27 A;  1WH7 A;  1LE8 A;  1UHS A;  2NS8 A;  4XID A;  4DYQ A;  3D1N I;  2HOT A;  2YS9 A;  4L5E A;  3OOU A;  2R7Z J;  3FIW A;  1Y1W J;  4XK4 A;  3S2H J;  5FKO A;  1HDD C;  1TWH J;  3TP3 A;  3JR9 A;  2XGC A;  5E3L A;  1D5Y A;  3CMY A;  1H8A C;  1U78 A;  3E7L A;  4JX4 A;  3LSR A;  5F04 A;  1TC3 C;  4QSH A;  4C2M J;  1K83 J;  5IP6 A;  1X58 A;  2LY9 A;  2WAQ N;  5EZG A;  3ZOB A;  2XPU A;  2JA8 J;  5FLV A;  1GVD A;  2ID6 A;  2OF7 A;  4XRS G;  5IYD J;  2EH3 A;  2K40 A;  4BY1 J;  4XRS A;  3W6V A;  3JRI A;  1QRY A;  5F0H A;  1GUU A;  2NVT J;  2ME6 A;  4IHY A;  2O7O A;  5E3N A;  2R93 J;  4B3A A;  1RKT A;  3ZQC A;  1SAN A;  4NDL A;  3SFI A;  5IYC J;  4CYC A;  4I76 A;  1MBJ A;  3LSG A;  2MG4 A;  2EZI A;  1MBE A;  3IH3 A;  3NAR A;  4FCY A;  2LLK A;  3JRF A;  4S0H B;  4BBR J;  5K7Z A;  3M3Y J;  5DTD A;  5FKL A;  1OJL A;  1JUP A;  3HEF A;  5EGO A;  1MBK A;  3GTK J;  3WHB A;  4DW6 A;  2W48 A;  1NTC A;  1WH5 A;  3WHC A;  4A69 C;  3BG9 A;  4EEF G;  2M8G X;  3BTC A;  3LOC A;  2X48 A;  2WB1 N;  3JRA A;  5EDN A;  4V2G A;  2N8G A;  2R92 J;  2HOA A;  3GTO J;  2DA4 A;  3ZQH A;  2E19 A;  2CQQ A;  1BW6 A;  2ZB9 A;  1ETO A;  5F1J A;  3DEW A;  3G1O A;  4FE4 A;  3OIO A;  1RKW A;  2ID3 A;  1ETX A;  2EZK A;  1AKH B;  5E3O A;  5GP9 A;  3BR2 A;  3I4N J;  4A93 J;  5GPC A;  5J1Y A;  1W0U A;  3UKG A;  4HNV A;  5IOY A;  3F0C A;  3BG5 A;  1APL C;  4C3H J;  1JGG A;  2HOS A;  3H3V K;  4QTR A;  1JT6 A;  4MO7 A;  5EYR A;  3IH4 A;  1TWC J;  2H1K A;  1OCP A;  2HXI A;  1CQT A;  1HCR A;  2I10 A;  2DA3 A;  2YUS A;  1H88 C;  1A6I A;  2GLO A;  1IDY A;  1ETW A;  2LK2 A;  2DA6 A;  2JMW A;  2MW8 A;  4A3C J;  4RBO A;  5EEA A;  2DA2 A;  3JRD A;  5C44 J;  2CRG A;  1VI0 A;  1JTX A;  2DMN A;  2DJN A;  5FKM A;  3ZQF A;  5IP9 J;  3Q0V A;  4BKX A;  2Y30 A;  1IUF A;  1DU0 A;  3HDD A;  2EBI A;  2R5Y B;  3CQZ J;  2ME0 A;  3FK6 A;  4IHW A;  4LOC A;  3PO3 J;  4G12 A;  2NVQ J;  1IJW C;  2E2J J;  1JUS A;  1K61 A;  3SDG A;  2YU9 J;  4W1U A;  4MLO A;  1VF9 A;  2X6O A;  3LNQ A;  3HB9 A;  4X6A J;  4JP0 A;  1AKH A;  3BR0 A;  1MBH A;  1OCT C;  4M3D A;  5F08 A;  1MSE C;  2WV1 A;  4JYK A;  1XG1 A;  2OPT A;  3G1M A;  1WI3 A;  1ETK A;  5EF6 A;  1GT0 C;  1FIA A;  4DZP A;  3JRC A;  3BTL A;  2VPR A;  3BQZ A;  2DMT A;  4D5F A;  3GTL J;  1NK3 P;  2HXO A;  2XGD A;  2DA1 A;  1PUF B;  1DU6 A;  1ETY A;  4I6Z A;  3RZD J;  4GFB A;  3S16 J;  2L7M P;  1RPW A;  4UUS A;  3QQA A;  3I4M J;  4RDU A;  1T33 A;  2XSD C;  1P7I A;  2FX0 A;  1R9T J;  3HOV J;  3HOX J;  3Q0W A;  2E1O A;  3VPR A;  2IAI A;  1I6H J;  3GTP J;  1GV2 A;  1E3O C;  2FJ1 A;  1GDT A;  1QPI A;  2LTP A;  3L1P A;  4JX5 A;  5M3M J;  2EZL A;  3S14 J;  3S1Q J;  2L7F P;  5BNG A;  3OSF A;  4DYR A;  4A3M J;  1EF4 A;  1WCM J;  1F43 A;  3GTG J;  2HQ5 A;  3BG3 A;  3G1L A;  1B8I B;  2R5Y A;  2NOG A;  3IH2 A;  3O8G A;  2DMU A;  1JJ8 C;  3BQY A;  2Y9Y A;  5C4X J;  4ABZ A;  3FIS A;  2K9S A;  5FKN A;  3RZO J;  2DN0 A;  1JUM A;  5IPA A;  3S1N J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...