2YUSA

Solution structure of the sant domain of human swi/snf-related matrix-associated actin-dependent regulator of chromatin subfamily c member 1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
79
structure length
79
Chain Sequence
GSSGSSGTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLENSDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords SWI/SNF-related matrix-associated actin-dependent regulator
publication title Solution structure of the SANT domain of human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1
rcsb
source organism Homo sapiens
total genus 9
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2yusA01
2JK3A 2CUEA 4JX4A 4M3BA 1RKTA 3IH2A 4V2FA 2JN6A 2R5ZA 1XS9A 4DYQA 2DMQA 4IHYA 2HOSA 3LSPA 4FE4A 1JKOC 5IYBJ 4M3DA 3HOVJ 1B8IA 1QVUA 2HOAA 2MSYA 2TCTA 2LVSA 2EBIA 1LFUP 1ETOA 3JRFA 1JTYA 2XB5A 1MBKA 4MLOA 4D5CA 5EGOA 2JJ7A 3A01A 1UMQA 5J1YA 2YS9A 2DA4A 4XRSG 1A6IA 4W97A 4A69C 4BXXJ 2DA3A 1MSEC 2K9QA 3D1NI 1Z77A 4M3GA 2X9DA 3HB9A 2M8GX 2TRTA 1ENHA 1IJWC 3O8GA 5FLVA 1ETQA 1GUUA 3S14J 2EQRA 1TWFJ 5DTDA 1VNDA 1DU6A 1ORKA 1IUFA 2FX0A 1Y1VJ 1MH4A 2R92J 1MBGA 3OSFA 3HGYA 1WH7A 3SJMA 5J1UA 5EYRA 2VKEA 5DS9A 5F04A 4FCYA 4BBSJ 3GTMJ 1ETYA 2HDDA 2GM4A 5E3LA 4UUSA 3A02A 3S15J 1OCTC 3BG9A 1X2MA 2JA5J 1O4XA 1WGXA 5IYCJ 1UG2A 2QCOA 1A5JA 4BY1J 1HCRA 3OIOA 3RKQA 2VI6A 3FK6A 5FKLA 3Q0VA 2EZHA 1WH5A 3JRBA 4BKXA 2M34A 3LSRA 4IHWA 4LOCA 5F0CA 2MW8A 2L0KA 1K83J 1ZGWA 3JRAA 1ZR2A 4X1EA 1RETA 2O8KA 2NVYJ 3HOUJ 1JKPC 4C3HJ 2XSDC 2R7ZJ 3S1RJ 2L9RA 3GTQJ 2LKXA 3UKGA 4DZJA 5EZHA 3TW7A 5C3EJ 1JKQC 5JLXA 4MFEA 3C2BA 3K2AA 2H8RA 1YRNB 5F0FA 1JKRC 3G1MA 1GT0C 5EF6A 1ETXA 2DN0A 1U9OA 3WHBA 2R5ZB 4A3KJ 4Y7NJ 3GTOJ 3JRHA 3RZOJ 1WPKA 1B8IB 1FEXA 3HOYJ 2XB0X 1FTTA 3SDGA 1HOMA 2EH3A 2KT0A 2LFBA 1E3OC 3RQIA 2O7OA 5IOZA 3LOCA 3I4MJ 2NS8A 2EZIA 4G12A 3ZOBA 4B4CA 1AKHA 3MN2A 1GV5A 1QRYA 1JT0A 4DZPA 2CQQA 2K40A 9ANTA 3IV5A 2DA2A 3VPRA 2DA5A 2E2IJ 3QQAA 2AHQA 1JJ6C 1MBEA 1RPWA 1K61A 2JA6J 4MFDA 3S1NJ 4NDLA 3ZQFA 3LNQA 3BQYA 1MBFA 2JWTA 3CDLA 4DYRA 3HBLA 1NK3P 5EG0A 3JRCA 1JUPA 2Y30A 4M6VA 5M3MJ 4A3IJ 3GTJJ 4FTHA 1IGNA 1SFOJ 3JRIA 2ID3A 2Y2ZA 5FKNA 2IEKA 2XGEA 1PUFB 3M3YJ 4XIDA 1SANA 1T33A 2N8GA 5FJ8J 4HNVA 1OJLA 3B6CA 5EEAA 2HXOA 3JR9A 4J19A 4A3BJ 4UUSB 2R5YA 1OFCX 1JGGA 2ZB9A 2M0CA 4QIWN 1RR7A 3DEWA 4FISA 2LR8A 4QTRA 1ZQ3P 5IYDJ 1X2NA 3BR6A 1U9NA 1JUMA 3PO2J 2E2HJ 3B6AA 3JRGA 5K7FA 2JMWA 4CYCA 1I6HJ 3Q0WA 4XRSA 4QSHA 2IAIA 2ID6A 2Y9YA 5HODA 1WCMJ 2VUMJ 5GPCA 5M5YJ 1JJ8C 3LSJA 3GTKJ 2LP0A 5M3FJ 3S1QJ 2MG4A 1BA5A 2O9LA 4B1RA 5EZGA 5GPAA 2OPTA 3HKZN 3G1OA 3HM5A 2K9SA 1H8AC 2K9NA 2L7MP 2XGCA 3QPSA 1XG1A 3ZQHA 5FKMA 3TW6A 2GBYA 5C44J 3MKLA 1JT6A 3A03A 3BQZA 4L5EA 3BR5A 3GBGA 1B72B 1GV2A 4Y52J 3HOXJ 3ZQGA 1ETKA 2AO9A 2LTPA 1POGA 4DYCA 5E3OA 1GDTA 2H1KA 5F1JA 2HXIA 3CQZJ 2HOTA 2EZKA 1IC8A 1Y1WJ 2B63J 5FKOA 5IP7J 3TP3A 3JREA 5K7ZA 1W0UA 4ABZA 2R93J 2CJJA 3HDDA 2JA8J 4JYKA 1UHSA 2LK2A 1U8BA 2WAQN 2JA7J 3PO3J 2G0EA 4XK4A 1AKHB 3DCFA 1BW5A 1X58A 4AC0A 2FJ1A 1XC5A 2P81A 2ME0A 2X48A 1CQTA 1HDDC 3BR0A 2W48A 3HGGA 1JUSA 2XPUA 4V2GA 4C2MJ 1ZTRA 5E3MA 3E7LA 1VI0A 2ELKA 2HYJA 2ECBA 5K7HA 3S1MJ 1TC3C 1D5YA 3F0CA 3GTPJ 1P7IA 1MBHA 1F36A 5EGOB 3OSGA 3H0GJ 3A01B 1I3QJ 3IH4A 4RBOA 2Y9ZA 3WHCA 1LE8A 2DA1A 5FKKA 5C4JJ 1GVDA 2R5YB 3BR1A 4D7MA 1IG7A 2X6OA 2LD5A 4MIMA 3ZQIA 1RKWA 1EF4A 2HQ5A 2M9HA 1FIAA 3S2HJ 5J1RA 2D5VA 1BL0A 1IRZA 1FIPA 3BR2A 1ZK8A 5GP9A 1NK2P 3Q0UA 2E1OA 4JP0A 1DU0A 1YRNA 1IDZA 1HLVA 4A93J 2E19A 1MBJA 3BG5A 4M3EA 3NAUA 3L1PA 5IOYA 4JX6A 1TWHJ 4FE7A 2CUFA 3S16J 5IPAA 1MNMC 3I4NJ 4BBRJ 1BW6A 2NS7A 3H3VK 1T56A 4GFBA 3BTLA 1AHDP 3HOZJ 1ZR4A 2M2EA 4IHXA 3BTJA 1MH3A 2ECCA 1VF9A 3JRDA 2IBDA 4I6ZA 1G2HA 4C3JJ 2FQ4A 2YUSA 1ETWA 5JLWA 3ZQLA 1TWGJ 2WB1N 3LSGA 4A3DJ 4A3LJ 4I76A 5E3NA 2OF7A 4A3MJ 3GTLJ 1ETVA 4BY7J 1I50J 4D7NA 3QPLA 2XRLA 3M4OJ 1IDYA 4AUXA 5F08A 1FTZA 5EDNA 2Y0SN 4B3AA 3NARA 2Y31A 3FISA 1Z0XA 3G1LA 2PMZN 1IV6A 2L7ZA 2E2JJ 4IHVA 2CQXA 3BTCA 1PUFA 4C3IJ 4A3EJ 2XPWA 5M5XJ 4MO7A 2FD5A 2DMUA 4EEFG 3SFIA 1TWAJ 1VFCA 2L7FP 2LY9A 2NVXJ 1U78A 2QF7A 5M5WJ 3CCYA 2EZLA 3HEFA 3K7AJ 3CMYA 1FJLA 2CU7A 1BJZA 1TWCJ 3W6VA 2I10A 1JTXA 3BR3A 3RZDJ 1LE8B 2DJNA 2WV1A 3GTGJ 4IEJA 2COBA 5C4XJ 2R0QC 1HF0A 4UUTA 5IP9J 1P7JA 1W0TA 1APLC 2MGQA 1H89C 2DMNA 3PM1A 3S17J 3S2DJ 4A3GJ 2LLKA 5FLMJ 2VPRA 2VKVA 5J3LA 4X6AJ 5EG0B 2DMPA 3FK7A 4JX5A 2KDZA 3FIWA 2ME6A 1QVTA 2RAEA 1AU7A 2DA7A 1Q1VA 4A3CJ 5IP6A 1MSFC 2GLOA 1HDPA 1B72A 3BG3A 3TEDA 1NTCA 3FKIJ 3IH3A 1RESA 2NVTJ 3MVPA 5F27A 4A3JJ 1OCPA 1WI3A 4D5FA 5BNGA 4RDUA 2DMTA 2XGDA 1ITYA 4S0HB 1H88C 3Q3SA 1F43A 5F0HA 4W1UA 1S7EA 4DW6A 1R9TJ 1LFBA 1ZKGA 2DTZA 3ZQCA 3BT9A 3TP0A 4A3FJ 1QPIA 2CRGA 2XPVA 2NOGA 4CYCB 3OOUA 3HOWJ 3BTIA 4M3FA 3O8HA 4XICA 2NVQJ 2YU9J 2DA6A 2HI3A 4AYBN 4XRMA
chains in the Genus database with same CATH superfamily
1ZLJA 5DCFA 4JX4A 3L09A 4M3BA 2BEOA 2W25A 1RKTA 2EWNA 4V2FA 3SFZA 3FXLA 3F21A 2DK5A 5L3BA 1X4PA 2HOSA 2RN7A 3UNGC 3LSPA 4FE4A 1Y0NA 5IYBJ 1GLNA 1QVUA 2MSYA 1P92A 2TCTA 2EBIA 3KIOA 1LFUP 5GAEJ 3JRFA 4G6DA 1JTYA 2VC1A 2F2EA 4ETSA 4D5CA 4E4HA 2VQGA 1UMQA 3ERMA 3I58A 2DA4A 4KN7X 3SXYA 2DA3A 3H35A 3CF2A 4PFOA 3DPLC 3CMAI 4AD9A 3SZTA 5HS7A 3WTXC 1YITI 1PP7U 1MNDA 3JSOA 3DEUA 5CYVA 4HF2A 3RYRA 1B6AA 3O8GA 1VNDA 3WG9A 1ORKA 1YX5A 2EIKH 4I0BA 4DQ2A 1U5TA 2FX0A 1N25A 2VOPA 1MH4A 3LA2A 5FFZA 3DU6A 5J1UA 3N05A 1IN4A 5EYRA 5F04A 2F5EA 3ZRGA 2XC7A 3M7GA 1ETYA 3S3NA 3A02A 2RQQA 3WTSC 1PUEE 4Y4RA 2CQKA 3I54A 3QPHA 2JA5J 1G3WA 1WGXA 5CVRA 3LSTA 3HIFA 2QCOA 3EYIA 2V1NA 4FQGA 5HS9A 3LWFA 3OIOA 3GCMA 1ZYRF 3RKQA 5FRNA 3D0SA 3RCOA 1Q1HA 4U0WA 5EJCA 1A6QA 3Q0VA 2EZHA 3OYIA 4RLQA 2XV4S 1QA6A 2DAOA 4BKXA 3T8RA 3H36A 5J40A 3KEYA 2HNHA 1TNSA 4F93B 1ZARA 4O5VA 4BJ6C 3MD2A 2HTSA 4LD5A 1K78A 2M4GA 2PLYA 2NVYJ 5DCMB 3BROA 3HOUJ 5JVTA 2L9RA 3GTQJ 3IRRA 3F8FA 2IGKA 3C2BA 3S3OA 2H8RA 1YRNB 2RNJA 3TDZC 2XDVA 3IL2A 2ZBKA 2HPIA 2M4KA 5K5QA 4PJ0C 2VT2A 1XCVA 5E1WA 4I98B 2XUBA 1WI9A 3OL3A 2UXNA 5JVGF 4QLCU 1VQ9I 2L01A 4Z2YA 1R5HA 4A3KJ 2DN0A 3JTHA 2HR3A 3U21A 1WKMA 2BGCA 4XMYA 1GVJA 1IN5A 3HRMA 1Y6IA 1SD7A 1VQOI 2DTRA 1NG6A 4NNJA 3S8PA 3HRTA 2QM3A 1FTTA 1LPQA 1ZGAA 2KT0A 3F8MA 2LFBA 3RQIA 2O7OA 2X1EA 2XRNA 1TBXA 2Q8KA 1FLIA 3LA7A 1AKHA 3MN2A 2EFOA 1QRYA 1BM9A 4DZPA 4EATA 2CQQA 4P9FA 1FSHA 1NG7A 1YE9A 3IV5A 3HTUA 4LB6B 2AHQA 1MBEA 2E34A 4XOTA 4HDVA 1ACIA 2ZJPF 1ULYA 4NBQA 2FOWA 1PJRA 2F5VA 1IW7F 3GLXA 3OYKA 2H94A 4WXCA 1R5ID 5EG0A 3MKZA 3G6EI 4M6VA 4AVZA 2Q0OA 1IGNA 2IA2A 3HTSB 2R7VA 4GO1A 2Y2ZA 5FKNA 2IEKA 2CV2A 1PUFB 5J4VA 2KL4A 3RJPA 3PQJA 1Z6RA 2N8GA 4RAFA 4HNVA 3IAS2 2XF7A 3J7ZI 2ZJQF 4J19A 4A3BJ 4UUSB 1JGGA 2JPCA 2DFIA 3SEQA 4PUSA 1VQMI 3ELKA 3FMSA 5IT3A 3VDXA 1R71A 1RR7A 3DEWA 1W7PA 4M74A 3DBRB 4QTRA 1ZQ3P 3FHZA 1TQPA 2X0LA 3BR6A 1JUMA 3PO2J 4HA8A 1ZGJA 2OQGA 2OZ6A 3LL7A 4GYIA 2JMWA 2JQ7A 2MYSA 4IQJA 2KZGA 1ZG5A 5HODA 1WCMJ 3AG4H 5DD4A 4D9JA 4QPQA 3S1QJ 3MZHA 1BA5A 2KZVA 3BCAA 3D5RC 3CMEI 2CWEA 3HKZN 5IT9Z 1TZLA 3KETA 3HM5A 3CP8A 2K9SA 3EETA 3V8JA 3CCJI 2LG4A 2XGCA 4MTEA 3HYIA 3QPSA 5FKMA 2GBYA 4Q47A 4LLGF 4WK8F 3MKLA 2DYRH 1K4SA 1JT6A 3H5AA 3A03A 3BQZA 3GBGA 4Y52J 2ETHA 5D5VB 1YOVB 3HKZA 2JUGA 2LTPA 4EVIA 2W85A 5E3OA 1XGOA 3D5LA 3FBIB 2H1KA 4IVNA 3ZPLA 1E3HA 3CQZJ 2HOTA 3LFUA 1IC8A 2WAFA 4ENJA 3FHNA 3ABKH 5K7ZA 1W0UA 2R93J 2CJJA 2QQ8A 2QZ8A 2HKXA 2BY2A 4RGUA 1FOXA 3VOEA 4OU0A 2JA7J 1XX5A 2H6BA 3NEUA 2QA4I 2IS2A 3PSIA 1YIOA 4ZZLA 1BW5A 2W82A 1MGTA 4UY8I 3GFIA 2DQRA 5J6XA 4EV0A 3E6CC 3WGGA 3IRQA 2EILH 2X48A 4YIFA 2MD0A 2XKOA 3ZMTA 4MGRA 2NS0A 2AXLA 3GMEA 4K2EA 1LKXA 3HGGA 1ZTRA 3SQNA 2OCCH 2KIFA 2QGUA 3N4MA 1C0WA 2R7DA 1WJ5A 3L9FA 5BPIA 1TC3C 1D5YA 1QNTA 3WTZA 5EGOB 3FX3A 3JSPA 2M7BA 3IWZA 3RKYA 2DA1A 3WTWC 3QOPA 5C4JJ 2CS3A 2HVRA 2CGPA 2R5YB 4D7MA 4X0GA 1P4XA 2O3FA 1G4DA 3TO6A 3ZQIA 2E5ZA 1EF4A 1WJDA 2QQBA 5AIPA 2DFEA 2WY7Q 2P5KA 3ASNH 2IXSA 1A35A 1X19A 5J1RA 5DCMA 4LK1F 4AU7A 3DTEA 3HRSA 4YIRX 4G6TB 1TW3A 4HF0A 2IA0A 3Q0UA 3KP6A 3S93A 1G6NA 1DU0A 3HZJA 3K4NA 1YRNA 2F48A 1H0MA 2E19A 4C2TA 3BG5A 2AXTC 4M3EA 3H5NA 3NAUA 5IOYA 4UHTA 2WTEA 4IRGA 1VQ8I 3GZNB 2AQEA 6PAXA 2V7FA 4KYWA 4L0YB 4OIRF 4ON0A 1T95A 5HNFA 1MNMC 2JRTA 3I4NJ 1IN7A 3ABUA 3G71I 1G8XA 3BJOA 2E5NA 1ZR4A 1SFXA 2FRHA 4IHXA 2O6GE 1SAXA 2ECCA 2DLLA 2H6CA 2K27A 3MMYB 4ZTFA 1VQKI 1G2HA 4C3JJ 4ESFA 3WGIA 3N97A 1B59A 4RB1A 2YUSA 1ETWA 2EA4A 3ZQLA 5KVRA 1LVKA 1D1AA 3EUHC 2OF7A 4XKVA 1FP2A 3ZN0A 2A6TA 3QPLA 3K4CA 1OYIA 3V7CA 4KIBA 3M4OJ 3CDHA 1IDYA 2BBYA 3PSFA 4AUXA 2IS6A 1IO2A 2LMDA 2Y0SN 1QZYA 5DEQA 3VYRB 3WE3A 5DM6F 2Y31A 3G73A 3F6VA 2F5FA 2HKOA 2PMZN 3ASOH 4CCNA 5J8FA 4CGZA 1VQ7I 2IRFG 3VWBA 2P6SA 2CQXA 4IOAF 2XAFA 3KZZA 1PUFA 1PYVA 3E6DA 1RUOA 2H09A 5LRSA 3DBHB 2QYOA 3OYDA 2Y0SA 1D0YA 5JHFA 2L7FP 2K7LA 2M8EA 3CC2I 2QF7A 2ZSIB 3PIPF 5LLQA 2GAUA 2EZLA 1XD7A 2LDUA 3LFKA 3LSMA 1JE8A 4EGZA 1BJZA 2FMLA 3W6VA 2OQRA 1WHUA 2H27A 3GVAA 1JTXA 1ZH5A 2DFFA 1PP8F 2WV1A 1QHHD 4E7ZA 3QP6A 4XKWA 3AG2H 1HF0A 2OV7A 5GAHJ 1Z9CA 1K4TA 2VPLA 1QGPA 3FBNB 2KIMA 3W6JB 4DOZA 4O6JA 3H1CA 5CVJA 5E1ZB 4A5MA 2Y69H 2EA2A 1HA8A 2IVMA 4U88A 1LB2A 3I0TA 4PGGA 4WF2A 5L3DA 5J4YA 5FLMJ 2QBYB 1BI2A 2VPRA 4KICA 2ELHA 1ERDA 2K9MA 1L0OC 4XLCA 2A07F 5ILSA 2ME6A 4KT6A 1X1PA 1AU7A 3BZ6A 4M73A 2BVMA 4JQFA 5H6RA 1MSFC 3LMMA 2HYFA 2FNPA 2V1XA 3SEZA 3BG3A 4XLPF 1YS7A 3FKIJ 3IH3A 1RESA 2K3PA 1SAUA 2OU2A 5F27A 2E7XA 1F4KA 2LSOA 1WI3A 3H92A 2J5PA 2W24A 4C9YA 4R8HA 1Z3YA 2FQ3A 1WQ2A 1F43A 2V79A 1HXDA 1UZCA 1S7EA 1MZBA 3HUGB 4IHSA 4MNUA 3C18A 5HNHA 4HSRA 2HDCA 4LIUA 5JI6A 2P5VA 1ZKGA 2A69F 2RKHA 2HPMA 3TP0A 4CZCA 2XIGA 1OYYA 1QPIA 5DD8A 3MQ0A 5CPRB 2AS5F 3HOWJ 3K0LA 1BOBA 3OYLA 5BPDA 4PSWA 3OS0A 4EQQA 4KFCA 2PN6A 4AYBN 1Z91A 4LMYA 3FM5A 2JK3A 4F91B 1D0ZA 2CUEA 1OYWA 2F5CA 3K1MA 1RIOH 5FGMA 2R4GA 2R5ZA 4DYQA 2DMQA 4PGHA 1N78A 2KRHA 1B8IA 2XSJC 3DQVC 1S72I 1K6YA 2HOAA 5FLXK 3CCUI 2HOEA 3CCVI 4CH7A 3HRUA 4KUMA 3VYTB 5EEHA 1MBKA 3E5QA 3H5RA 3KCCA 5EGOA 2JJ7A 3Q9SA 5J1YA 3TMOA 2E71A 3HOTA 1IZ1A 1YI2I 2ZKZA 4AIJA 2A61A 2O8XA 2R7QA 5LGNA 3JAMK 1USTA 3TQNA 2K9QA 3D1NI 3QODA 1MW7A 4Q48A 3OYBA 5HLGA 4M3GA 3V8KA 2BYVE 2HVQA 1ENHA 3J81K 1X1BA 2EQRA 3S14J 2J5OA 4OMYA 1H9TA 1IUFA 5ICCA 2CV1A 1R1TA 1E3PA 2R92J 2CW7A 5BOXA 3FXOA 3ZN1A 4QPOA 3SJMA 3CP2A 5DS9A 4ZYHA 4FCYA 1OKRA 4HDUA 3GTMJ 5GTIC 1I39A 2GM4A 5E3LA 1O57A 1UHMA 3CUQC 3HPGA 4P5OA 2FBIA 2KFDA 2L54A 1O4XA 3RTRA 1UG2A 1ZG3A 1SVOA 1A5JA 1YJWI 3K70D 1MMNA 3TO7A 2IJLA 5D5UB 2Z3YA 2PG4A 1V4RA 3FK6A 5FKLA 1XSVA 1RZ4A 2HTJA 2OTLI 3D5SC 1TLHB 2PMHA 2P8TA 1HSTA 2EIMH 2HZTA 3SDBA 4E6KG 2QKMB 3JRBA 4KMFA 5F0CA 1KA8A 1Z7LA 4KISA 4KNYA 1K83J 3ZP5A 1FMWA 1FSEA 4I99C 4XN3A 1T39A 1ZR2A 2VOOA 1SFUA 2QUFA 1WWXA 2O8KA 1JKPC 4UVCA 4C3HJ 2A6HF 3S1RJ 4XKCA 2PX9A 4ZTJA 5EZHA 3TW7A 2XAUA 5C3EJ 2DQLA 4MFEA 5LEJA 2X1CA 2ZMEC 4Q5SF 3K10A 2DW4A 3OV8A 3OYEA 2XF6A 5F0FA 1JKRC 5EF6A 5E8IA 2VONA 2FNAA 2F4OB 3C7JA 4YFXF 3WTUC 3R4KA 3GTOJ 2QSFX 1G3SA 1W7PD 3DKYA 2EFWA 4BQAA 4L5IA 1OPCA 2EB7A 1HOMA 3PUBA 1FOKA 2EH3A 2STWA 3P9IA 1U3EM 3RPUA 1ZRCA 3PUFA 5KCMA 3LOCA 2LKSA 3ZOBA 2CG4A 4B4CA 1R7JA 1JT0A 2K40A 2LC2A 3DTKA 3KP4A 4XSXF 9ANTA 2ISZA 2HFHA 2OA4A 1AWCA 4FX4A 1LDDA 2E2IJ 2DA5A 4LITA 1FBQA 2DK8A 1RPWA 2K85A 5DUKA 1Y39A 4MFDA 3S1NJ 2FOKA 4NDLA 1SFKA 1VQ4I 1ZAOA 2EINH 1BR2A 2JWTA 2QBYA 4QWQA 4DYRA 3COAC 2UWMA 3HBLA 3I59B 4U7DA 1W1WE 3HC7A 5HLIA 3W3CA 4FTHA 5IY5H 4YEJA 1OR7A 2ID3A 4CCKA 5TGTA 1HSJA 1T33A 4U0YA 5BQTA 5FJ8J 2KHMA 4XLEA 1G59A 2NNNA 3A0BC 1OJLA 5EEAA 2ZXJA 3K1NA 3HHHA 1MMDA 4RB2C 4I2OA 4NB5A 1YJ9I 1WJAA 2VQLA 4M6XA 2M0CA 2AQFA 4QIWN 1HW2A 2LR8A 5TISC 2F4IA 3FXKA 5IYDJ 1X2NA 2HDWA 3GUDA 2LBFA 1Z21A 4PJLA 2V4JC 2VBXA 3KYCB 3B6AA 4RA2A 1R49A 1R22A 3F8BA 4TV7A 3OYCA 4WXDA 3GZ5A 2ID6A 4I7HA 1O3RA 2VUMJ 1REPC 1TT5B 1X1DA 4CDGA 2V9PA 1I6XA 3MKWB 3LSJA 3J80K 3GTKJ 1R00A 2L3DA 4B1RA 1SVLA 5EZGA 2ZXHA 2P6TA 2OPTA 3NRVA 1UJ8A 2RQPA 3OIQA 4L9VA 2LY1A 2K9NA 2L7MP 1I5ZA 1XG1A 4RB0A 4XSZF 1K6OA 2IGMA 1KU3A 3R60A 4I0AA 1MIJA 4L5EA 3BR5A 2NNYA 1VTNC 2B9SA 1ETKA 3OOPA 2RC4A 3X2QH 4C30A 3P9CA 4UXNA 2NYXA 1B4AA 2AO9A 4DYCA 1J2XA 4WCGA 1CF7A 2L9NA 4BYYA 5F1JA 5E20A 2EZKA 5L3EA 2NRAC 2TDXA 5D6EA 4HLYA 3BZCA 3AAFA 1DGRM 3BPXA 1BC8C 2GXGA 4HLXA 1WJEA 3A1YA 2MC4A 1Y0UA 5HDNA 2JT1A 1U8BA 2G7HA 1XGNA 2G0EA 2ZCWA 4XK4A 3DCFA 4FHTA 5KK1A 1LUJB 1IXCA 1X1AA 1MMSA 3MFKA 2FJ1A 1XC5A 2P81A 2ME0A 2KLOA 1CQTA 1TT0A 1HDDC 1FP1D 4KT5C 4BAYA 3CCEI 1FWZA 2NXNB 1KQ8A 2XPUA 4G94A 2EK5A 2MH9A 4LG3A 2ELKA 5H20A 2A3SA 2ECBA 2XAHA 3BY6A 1F9NA 1F5TA 3GTPJ 2H1LA 1MBHA 3GO5A 1F36A 3OSGA 3H0GJ 1I3QJ 4ENNA 1AA7A 2VODA 3TOBA 3DLLF 1MKMA 3PNYA 1GVDA 1J7KA 4RLFA 4RMNA 5B5EC 4HOBA 2VKHA 3FF5A 4A12A 1ZRFA 2DYSH 2QQ9A 2X6OA 3K4BA 4F3QA 2BY3A 2IP2A 4M71A 4MIMA 2LD5A 4PDKA 2DODA 1RKWA 1BIBA 3S2HJ 1FZPB 2D5VA 2D1VA 1JXSA 1W36D 3CESA 3BR2A 3KYDB 3OR1C 1MJAA 1I27A 1P4AA 2E1OA 4WX9A 4HRIA 1EKEA 1ZELA 1MBJA 2IS1A 1B9NA 5F64A 4YFKF 1P2FA 2BE5F 2FU4A 4BHPA 1YS6A 1D8JA 2CUZA 4FE7A 5IPAA 3S2WA 4BBRJ 1T56A 2K02A 2BZTA 3HOZJ 2W00A 2M2EA 5A2QK 4RGXA 3ZQQA 4BQNA 2IBDA 1IRGA 1IXSB 3AFHA 3F22A 3CC4I 5JLWA 2OTJI 3ISPA 4HEA2 3L00A 3LSGA 3OL4A 4XLNF 3GTLJ 1ETVA 3QYFA 4N9HA 4BY7J 3VB2A 5LFAA 1I50J 4GGGA 2EFPA 3MKYB 1F1ZA 3QRFF 5B3SH 5F08A 4UNOA 4B09A 2KQRA 4B3AA 4F92B 3NARA 4CCLA 4ZYAA 4Y33A 5ICFA 3G1LA 2L7ZA 4IHVA 1S29A 3H9JA 1YX3A 2MBFA 2UZKA 4L0ZB 4NHJA 2PI0A 4KMUX 4DIQA 2GA2A 1XDSA 2K4JA 3BPVA 5M5XJ 2QLZA 4BH9A 2R7XA 2FD5A 3CCMI 1U8RA 2KMUA 4BNCA 3OS2A 3IC7A 2LY9A 2NVXJ 1U78A 1TNTA 5L3GA 3JTGA 2WC2A 5GADJ 5M5WJ 3QOEA 1XPXA 2R7OA 3HEFA 3CMYA 2LF7A 3G3ZA 3HJEA 1S5LC 5B66C 1YLFA 3ERED 1I3AA 1T8IA 4XN0A 1LE8B 3RZDJ 5HDKA 1FC3A 3VYSB 2COBA 2VLAA 1DUXC 2PEXA 3B02A 1WJBA 1MJ9A 1IXRC 2M0MA 2MD5A 4UUTA 3K4JA 5IP9J 3GLLA 4XR6A 2MGQA 2DMNA 4FASD 1KQ9A 3CCRI 3S17J 3FXMA 3S2DJ 5LHIA 2D1HA 1Z1DA 3WGHA 2L4MA 4EJUA 2YU3A 4E7IA 1NHAA 2MFZA 2JUCA 4IF4A 3M07A 1XMKA 2VKVA 5J3LA 1H9GA 2P4WA 4LFUA 4RGRA 3BDDA 5BMZA 2LREA 3NQOA 3HG9A 4BQQA 3ULQB 2V6CA 4RAYA 1HDPA 4O3MA 3T8TA 4M9XA 4ZDPA 2XAGA 3TEDA 1NTCA 1HKTA 4IXAA 2P7VB 4KDPA 3PNVA 2NVTJ 2XROA 1DP3A 3MVPA 2QSGX 4BJTA 2DI3A 2XGDA 1ON1A 2DDAA 3E6MA 1YYVA 2YX4A 2Z9OA 4S0HB 1H88C 3Q3SA 3W2WA 3IHUA 4ZZDA 2E7WA 2KJBA 4W1UA 4D0PA 4I01A 4LLNA 2FEZA 3V7RA 2UV1A 2X6WA 2DTZA 1UHWA 3O3KA 3ZQCA 3ZQ7A 3JAMZ 3LSHA 2CRGA 2XPVA 2NOGA 3RI4A 3BTIA 4XICA 3GEZA 4XKBA 4EJWA 2YX7A 2WWYA 4M9SA 1X1CA 5D6FA 4IPAA 3O6BB 3TGNA 4A5NA 2PFBA 3C3WA 4YG2F 1D5VA 4IHYA 2LOOA 3TL4X 3TO9A 1JKOC 2A5WA 3HOVJ 2CFOA 3QYEA 2LVSA 3U1DA 3OS1A 4OIPF 3RYPA 4BHCA 5FD6A 3DV8A 3BWGA 4LGWA 3OY9A 1S8NA 3EDPA 1IUYA 4JOMA 1EV7A 4NUBA 4M9ZA 3OWTA 4XRSG 3E97A 1VQLI 1A6IA 4AIDA 1MNEA 4W97A 4A69C 3L2WA 4BXXJ 1RR8C 3CMMA 2VQHA 1Z77A 1BI1A 3ZMDA 2Q2EB 4OMZA 1ONVA 2X9DA 1T38A 2M8GX 2TRTA 4L18B 1FBSA 1GUUA 3CUQB 2VB6A 2EV6A 2WV0A 1TWFJ 1XN7A 4Y3OA 2VBZA 2KRFA 1TP4A 3WG7H 3AG3H 1WH7A 3FMQA 4GRIA 3K69A 1RUNA 1KGSA 2XAQA 4OINF 1T2KA 1YQAA 2HDDA 4DBRA 4UUSA 3S15J 1OCTC 3BG9A 3EUHA 3KZIC 3K6GA 3RPUD 1OCCH 5IYCJ 5ERIA 5E17F 1BBYA 1MMGA 3PQKA 3PL8A 4XLAA 1QZZA 5E18F 4N9IA 1T0FC 4A6EA 2CUJA 2OCEA 2L9SA 1Y8RB 1WH5A 3GXOA 2ZXIA 1KZHA 2WAEA 5DV5A 4E7LA 2W7NA 3GWZA 2M34A 2ZMEB 1SD4A 1G3YA 3DPTA 4LOCA 2Z5UA 2L0KA 2ZFUA 2BY1A 3ML6A 1ZGWA 4KIFA 4UVBA 2X4HA 4X1EA 4BU2A 3CUOA 2M30A 4BQOA 2L02A 3BP8A 4YRVA 3L7WA 1MMAA 2CW0F 1IV8A 1P6RA 4CUGA 3UKGA 5F6FA 4BXUA 5JLXA 3E1SA 1FPQA 2M3AA 3ONQA 3SYTA 4A6DA 1UAAA 3GZ6A 3OMYA 4G7HF 1DQUA 2MH2A 1WZ2A 1JHHA 5IT9K 2RVCA 3G1MA 1BR4A 2K9LA 1GT0C 3DPUA 3HHGA 3DLAA 1U9OA 3WHBA 3A2KA 1IRXA 3JRHA 2STTA 1WPKA 2QSHX 3EYYA 1E17A 2DO7A 1FEXA 3HOYJ 3VEPA 2IPQX 5E8GA 3H3UA 1E3OC 4ENMA 1XSXA 2QENA 3KP5A 4BS9A 4ZYDA 1M1EB 5IOZA 2HQRA 2MLKA 2PQ8A 2NS8A 2EZIA 3V8LA 3T0YA 4HQEA 4ANJA 3Q5FA 2OUMA 4F52A 1A04A 2DA2A 3VPRA 3QQAA 5K5RA 3WU1B 1K61A 2JA6J 2XKPA 3GF2A 3ZQFA 2PMUA 2OAZA 1MBFA 2Z33A 3CDLA 2RDPA 2VT3A 2BXZA 1MD0A 1TQMA 3JRCA 4HYEA 2Y30A 4DGWB 5M3MJ 1ODDA 4A3IJ 3GTJJ 1O3QA 1OQYA 2NAZA 4PCQA 5LGUA 1EH6A 2XGEA 4AWXB 4RAZA 2B0LA 4XIDA 5TRDA 1VQPI 2EPFA 2KIUA 5E1XA 1XGMA 3R6SA 1YO5C 3B6CA 2HXOA 4RM2A 2R7SA 2R5YA 5AONA 3M8EA 2ZB9A 1RNLA 2V6EA 2BW3B 2Z16A 2EV0A 3R0AA 4EM0B 1UCRA 4IJAA 4CXFA 3F9KA 5HS8A 3K4LA 4FISA 3KLNA 5CJ9A 5B1AH 1U9NA 2KP6A 2E2HJ 4CHUA 2GOXB 2A68F 2HEOA 3ESWB 3JRGA 1GHCA 2L5QA 3OYFA 1I6HJ 3Q0WA 4XRSA 5D5XB 2YSRA 2C6YA 3KE2A 4HV5A 2I5UA 2M5WA 1VQ5I 3FXJA 2LP0A 3KP7A 2O03A 2MG4A 3MEXA 2O9LA 3FZVA 4L9TA 2OD5A 2FE3A 3WU0A 1QO0D 2DT5A 2A6EF 2K86A 1H8AC 3CLOA 4G6QA 4KJZA 5DUIA 1JI8A 3CDIA 3TW6A 2XGXA 3H0DA 1FNNA 4XONA 1NH3A 4J01A 3PIOF 3IP4B 3HOXJ 2IT0A 2PBIA 3F72A 1V5FA 3IKTA 1GDTA 1KONA 5KNLA 2PJRB 3U9GA 2CYYA 1Y1WJ 4UB6C 2OBPA 2M7AA 1FT9A 1QPMA 3TP3A 3JREA 2IS4A 1N75A 4ABZA 3QWLA 3HDDA 2X85A 3NWTA 3L2VA 3ECHA 2Q2EA 4IL6C 2ACJA 2LH9A 3OYNA 4PJJA 4I02A 4B44A 3PO3J 4OAYA 3RKWA 1AKHB 4XORA 1J09A 4E7JA 2DCEA 4S05A 2CW8A 1X58A 2DOEA 3VSLA 3ZCOA 4AC0A 4D1QA 2FSWA 2JVGA 4YIIA 2G9WA 2JSPA 4YFNF 4EJTA 1LEAA 5JR3A 2A05A 3CJNA 3BR0A 2W48A 1SC7A 2E36A 4V2GA 4C2MJ 3C2GA 3E6BA 4UVAA 1VI0A 2HYJA 2ZFWA 1Z05A 1D3YA 1R4MB 2QWWA 3I3LA 3S1MJ 5ICGA 2GXBA 3F0CA 4OAZA 4Y15A 1P7IA 1WJFA 1S7AA 5LGTA 1J59A 2ELJA 1E2XA 3I5UA 3A01B 3V42A 5HDGA 4RBOA 3WHCA 2Y9ZA 2K3FA 2HWVA 1W5CC 5D4SA 4PFPA 2Z1DA 3L2QA 1LFPA 1HC8A 3I64A 3A0HC 3GFJA 4BDYA 2A5YB 1WJCA 4F55A 2ZMEA 3DTIA 3Q9VA 2COMA 3BOQA 2HQAA 1W5SA 3GFMA 3W6KB 3I4PA 1W7PB 4IOCF 2HQ5A 1FIAA 3TKYA 5LBQA 1O3TA 1XMAA 5GP9A 1Y8QB 4JP0A 1TW2A 2HVSA 2O0YA 3FXQA 3LSKA 2DFHA 2XF5A 1HLVA 3I71A 5GAGJ 1X3ZB 2FBHA 4EJVA 3L1PA 4AM3A 4A0XA 3OIPA 3J7YJ 4JX6A 1TWHJ 4CZZA 2CUFA 2XASA 3S16J 4IX7A 2VJ4A 1BW6A 2NS7A 2Y75A 4HNTA 4KITB 4BXFA 4GFBA 3SZGA 2I8DA 3BTLA 3H9GA 3V4GA 1U5TC 2FBKA 3HUGA 4KN4X 1LJ9A 3BTJA 3J7AY 4PJMA 1VF9A 4I6ZA 2BHYA 2E60A 4U87A 4E7SA 2VJJA 3ZR8X 4E70A 5BS6A 3FXUA 2WB1N 2V9KA 2VJIA 4N4OB 2R7RA 4Y13A 2B7EA 1V3FA 4A3DJ 4A3LJ 4OWRB 1BR1A 3QAHA 3OYJA 3CO6C 3KX2A 4ESBA 5ED4A 1J9IA 4D7NA 5LEKA 3SHFA 4IZZA 1W4MA 2CSOA 1B9MA 1IN8A 2W4SA 2YPRA 4LB5A 2XRLA 4EJOA 4M6YA 3F8CA 2WB1A 4NQWB 2VC0A 3RQ4A 4BGDA 2E1CA 5ILVA 3FISA 1Z0XA 3CZ6A 2EFNA 1A31A 2E2JJ 3ZXSA 3CLQA 3BTCA 3KP2A 1HW5A 4CCJA 2LYCA 3CJTB 4A3EJ 2XPWA 3DEEA 1KU9A 2DMUA 4EEFG 3SFIA 1BI0A 3HPHA 4P9UA 1SMYF 3HSEA 1EH8A 5KAIC 2P0WA 3CCYA 2BW3A 3K7AJ 1FJLA 3RIRA 4XRFA 2CU7A 4ZYGA 1T08B 1R36A 3WODF 3CCQI 1QQIA 2I10A 2FUG2 5AIQA 1BI3A 1L3LA 2DJNA 5CLSA 2R0QC 1S9HA 2EJRA 1W0TA 3PNTA 2WBMA 4FT8A 1OMIA 2VXZA 3J7AO 4G8XA 1VQ6I 4HNUA 3PM1A 1OCZH 3OR2C 4L9NA 3ECOA 1BC7C 1N77A 2LLKA 1V5GA 3PFYA 3K70C 1ZHFA 1D1CA 1SFEA 3R61A 4NC6A 4DNCA 3FK7A 4JX5A 2XVCA 2KDZA 3FIWA 4P1WA 3I55I 2CH0A 4BEHB 1XMXA 5DYMA 2HU9A 4HAMA 2RAEA 4B3XA 1I1GA 4U7BA 3JCUC 2RNGA 1P4WA 4WWCA 4A3CJ 5IP6A 2GLOA 2ZNZA 1PVEA 2XAJA 3EPZA 1Y56A 1EA3A 3K2ZA 1TL8A 3L2RA 3QYBA 3DP7A 5DM7F 4BDZA 4D5FA 1S6LA 2FXAA 2DMTA 5BNGA 2PJRA 5H2FC 1ITYA 1KQ0A 3TDUC 2KISA 5F0HA 4DW6A 3CCSI 1S7OA 1R9TJ 1AOYA 2L9VA 1RI7A 1LFBA 2M45A 1YTYA 2EFQA 1Z67A 3K9TA 3QU3A 1ZG1A 4S04A 4CYCB 1LVAA 3OOUA 3OYMA 3IWFA 3KPHA 3S32A 3DWLE 2NVQJ 3REOA 2NOJB 3H9QA 2HI3A 1XB4A 4XRMA 3FXRA 2OZUA 2JTVA 2KIQA 5FO5A 1YIJI 3IH2A 2BY0A 2JN6A 3G4SI 2X6YA 1XS9A 4MEXF 2VIXA 1BIAA 2JRMA 4M3DA 3GFLA 1P9QC 1ETOA 1LNWA 1R5GA 1XDUA 4RGSA 3QPTA 4ASNA 2VKDA 2XB5A 4MLOA 4ZJZA 3JW4A 3WU2C 1QZEA 2LKPA 1W5TA 3BJAA 3A01A 4EM1A 1YW9A 2YS9A 2FMYA 2VL8A 5HVQC 1ZLKA 2CMPA 1VZ0A 3DKXA 3WE2A 1MSEC 1BN5A 3K4MA 4UV8A 3H3ZA 3IKVA 3E0JB 2V26A 1V5EA 4HV6A 1DPUA 3HB9A 2FA5A 5HOOA 3E3VA 4UB8C 1T6SA 5K1YA 1IJWC 5FLVA 2LRDA 1ETQA 3ZGKA 2EV5A 1USSA 3I59A 4PJNA 2ZNYA 5DTDA 2W84A 5D8LB 1DU6A 2ZXWH 5FD5A 1Y1VJ 3K4KA 1FX7A 1MBGA 3OSFA 3BG6A 3HGYA 4P96A 1J75A 1KU2A 2VKEA 3IUOA 3P7NA 1KU7A 4BBSJ 2OC6A 5HLTA 1K79A 5FFXA 3AKZA 2BVLA 1YHQI 3BG7A 3FDYA 4J00A 3VODA 1X2MA 5H6QA 2DU9A 2YR2A 2KPMA 4HQMA 3S3MA 1OISA 4EGYA 2DBBA 2EIJH 2H8WA 3LSIA 4BY1J 3KEQA 4KIGA 1WSUA 2IGNA 1HCRA 4BACA 4B47A 2VI6A 4XLFA 3T5XA 4G9YA 3MCZA 3W2VA 3M1EA 2JSCA 2XHKA 2DPUA 3VSKA 1O3SA 3LSRA 5CVVA 4IHWA 3WTTC 3HSFA 2MW8A 4L5JA 1IAWA 2ESNA 4UV9A 3F3XA 3JRAA 1FBUA 4HG2A 2DXIA 4AIKA 3LAPA 3KP3A 1RETA 3P5JA 3NWSA 1UFMA 1LEBA 2BXYA 2R7ZJ 1OCOH 2XSDC 3WTYC 4CO8A 2LKXA 4DZJA 4XBFA 2QVOA 4NQWA 3WTVC 1JKQC 4CSWA 3K2AA 2R7FA 1JGSA 5GTHC 2LY2A 4CCMA 5DDGA 3I56I 1ZN2A 2E1MB 3GX4X 2BHZA 2GXAA 1MJBA 3MWMA 2DT7B 2Z2SB 5FLXZ 1SMTA 2GQQA 2M1BA 4PK4A 1YJNI 1ETXA 1HQCA 2R5ZB 1BJAA 4Y7NJ 2GA1A 3RZOJ 3ZMVA 2E35A 4A0YA 1B8IB 4GDFA 1LDJA 5KAFC 2XB0X 3SDGA 3BC8A 2R7UA 4CA0A 2QQAA 1YG2A 3CO7C 1SEUA 5F1RA 3OYGA 3I4MJ 4G12A 5B1BH 1RRJA 1SD6A 1R6RA 3GW2A 5L3FA 1JHFA 1GV5A 1XGSA 2D45A 4A0ZA 3I9V2 2L4AA 3KZYA 3J81Z 4CYDA 3PJRA 2JVHA 2ADUA 1JJ6C 2MA3A 4F7ZA 1EH7A 1Z6TA 3LNQA 2UXXA 3I53A 3M8FA 4IHTA 1HKQA 3BQYA 3FMRA 4IRIA 1NK3P 4II3A 1JUPA 2ESHA 2HZDA 2HS5A 4ZDOA 1U2WA 4MEYF 1SFOJ 3JRIA 4BEHA 2L2OA 1ZREA 3M3YJ 1SANA 2VBYA 2ZJ2A 2ZO4A 4LLLA 2W1OA 3JR9A 3M1CA 1R4NB 4ZYEA 2WA0A 1OFCX 4BL0B 1HKSA 2DPDA 4DJAA 3AG1H 1GXQA 1ON2A 2D2WA 3EUKL 5HLHA 2VE8A 1W36C 3KFWX 5ILUA 3C1DA 1FYMA 4IRHA 4ZC3A 4MQ9F 1FOWA 3F6OA 5KHDA 5K7FA 4E7KA 1U0JA 4CYCA 4N0BA 2O5RA 5EEGA 3KYLA 4QSHA 2IAIA 2Y9YA 1IF1A 1MDMB 2GIZA 5GPCA 5M5YJ 1QBJA 2LNBA 3FWEA 4JK1X 1JJ8C 2CQ7A 2RV8A 1KYZA 1X3WB 3DKWA 2JZYA 4JBAA 5M3FJ 2K4BA 4H0EA 1LQ1A 5GPAA 5CQGA 2GWRA 3DFGA 2ZC2A 4Z6YA 3TBIA 2ISYA 2JA2A 3G1OA 3AL0B 2ZSHB 5CKTA 4LG0B 4IQ4A 3ZQHA 5K5OA 2CFXA 3HOSA 5LD2C 4BE0A 3SZPA 3VYUB 5C44J 1XSDA 1QHGA 2HQNA 3UR3C 5D5WB 1B72B 1GV2A 1R1UA 3ZQGA 2V1UA 4UUVA 2BV6A 4MHGA 4HPQA 4BJ5C 4RM3A 1POGA 2HXIA 5LRRA 4Y17A 4V19K 2B63J 5FKOA 5IP7J 2PMZA 1V55H 3KEOA 1VQNI 1WVRA 1Z3XA 2JA8J 3L2CA 4JYKA 1I1SA 1UHSA 3E5UA 2LK2A 3E5XA 2F5DA 2WAQN 5D4RA 4AIHA 5FB2A 2Y48A 4P55A 5FROA 1DPRA 4B48A 3TOAA 5J8CA 1YW7A 3DU5A 2DT6A 4AVPA 1QU3A 3RKXA 2R7TA 3LQQA 1T0FA 1UB9A 2WAQA 2KRCA 4RAGA 4OOIA 1JUSA 1XCBA 5E3MA 1D8KA 3HSRA 1FOYA 3E7LA 4GXOA 3ROUA 3ABMH 5K7HA 4CICA 2E1MC 3RDIA 1J0RA 4B43A 2VBWA 3MAJA 4A2UA 3IH4A 1LE8A 4PZJA 2P7CB 5FKKA 2VXDA 3B73A 3V7SA 3LAJA 3BR1A 5CVIA 1IG7A 4FX0A 4NC8A 4MQVA 5CQEA 3U2RA 1WFXA 1HW1A 2F4MB 2KKOA 4BE2A 2FF4A 2M9HA 1O7FA 3ZMUA 3BCBA 3QU6A 4HW0A 3OYHA 2LBFB 4OIOF 2IGOA 1BL0A 1UG0A 2LF8A 3J80Z 3CF5F 1IRZA 1FIPA 5LHGA 4XM3A 1YW8A 1NK2P 1ZK8A 4HBLA 4LJZF 4MTDA 1U5TB 2VJ5A 3P9KA 4M72A 1IDZA 2CV0A 4A93J 2GOMA 2DOFA 4KA4A 1OCRH 2R3SA 4XQFA 2KDOA 3CTAA 5L3CA 3CC7I 2UUZA 1BOAA 4R1HA 1XTAA 2BOLA 1R23A 2RGVA 3MZ8A 5D8KB 1X4OA 2E1NA 2VN2A 1SD5A 4HSTA 3H3VK 1R1VA 4ESJA 2PJPA 1AHDP 2X1DA 1DDNA 4C2UA 4AYBA 3LA3A 3CD6I 1MH3A 3JRDA 4BE1A 2MC3A 3FM3A 2V1DA 1TQIA 3EQLF 4N4NB 4HX4A 2GIVA 4ZH4F 4E7HA 1D0XA 2FQ4A 1A36A 1DP7P 1CF7B 4WXHA 2DDBA 4XOPA 4CCOA 1TWGJ 2CO5A 3PFIA 4LIVA 4I76A 2NVUB 4I09A 5E3NA 4A3MJ 3FKJA 3IAM2 4II2A 2MABA 3KLOA 2DJIA 1K78B 2R7WA 1FYKA 1UELB 4H4KC 2Z99A 2GZWA 2Y0MA 3MZYA 4B8XA 3CCLI 1FTZA 2G7UA 3BLYA 3DXJF 5EDNA 2CQNA 5LHHA 1DGWY 4U0VA 2X6XA 4IKFA 3RSNA 2QKLB 1IV6A 1CGPA 2P5LC 3DBLB 2ZJRF 1FMVA 4C3IJ 3BZKA 4MO7A 4ITVA 4HZFA 1O7LA 1VFCA 1IRFA 1TWAJ 3G2BA 3AL0C 3HXLA 4RB3C 3R0JA 3A4CA 2M87A 2KJCA 3DF8A 3VFZA 2VE9A 4XNFA 1J5YA 3K1PA 4IO9F 3EUAA 4ZDLA 3RPQA 5JFRA 1TWCJ 4OIQF 1Z7UA 4FETA 2L7KA 2X51A 3BR3A 5CVUA 5FRMA 4ENKA 2DOAA 4Q4ZF 1S3JA 4IEJA 3GTGJ 5C4XJ 3C2HA 4G7OF 3CUQA 4EMSA 1FY7A 1P7JA 1G3TA 2IW5A 3M9AA 4LK0F 4GYGA 3F8NA 2VASA 1APLC 1H89C 1LDKB 1RC9A 4G7ZF 2VQCA 3ABLH 1B1BA 3OYAA 1MDMA 1SVMA 4A3GJ 4L9JA 2W57A 2K5CA 1V54H 3L2UA 4YELA 3W2AA 4NC7A 1T98A 4X6AJ 2JPBA 2V9VA 5EG0B 2DMPA 2IA1A 1TTYA 4XL9A 4DBQA 2O61A 2HGCA 2WADA 4LG0A 3BJ6A 1K7AA 2RREA 1QVTA 1HBXG 2DA7A 1Q1VA 2QEXI 4HX8A 3HL2A 1R58A 3CJRB 4PSXA 1B72A 3ZMSA 1EJ9A 3F23A 4EM2A 1ZRDA 3ABTA 1WRJA 5A2QZ 4A3JJ 1OCPA 2OJED 1D1BA 3GYHX 4GCVA 4RDUA 1IN6A 2HYGD 5E79C 2F6CA 3T1BA 1PDNC 1STZA 4BUPA 1FYLA 1GXPA 1OR7C 1YFHA 3ZMZA 4XLHA 1E0EA 5J47A 3O2PE 5JHUA 2Q1ZB 2MLGA 3BT9A 3M8JA 4A3FJ 1U6GA 3QP5A 4HF1A 1KYWA 2WY8Q 4HX7A 2ICWG 5TJJA 1X3UA 4M3FA 3U1KA 3O8HA 4R79A 4RS8A 5ICEA 3LQRA 3CJQB 2YU9J 4BHBA 2DA6A 1OLTA
chains in the Genus database with same CATH topology
2JK3A 2CUEA 4JX4A 4M3BA 1RKTA 3IH2A 4V2FA 2JN6A 2R5ZA 1XS9A 4DYQA 2DMQA 4IHYA 2HOSA 3LSPA 4FE4A 1JKOC 5IYBJ 4M3DA 3HOVJ 1B8IA 1QVUA 2HOAA 2MSYA 2TCTA 2LVSA 2EBIA 1LFUP 1ETOA 3JRFA 1JTYA 2XB5A 1MBKA 4MLOA 4D5CA 5EGOA 2JJ7A 3A01A 1UMQA 5J1YA 2YS9A 2DA4A 4XRSG 1A6IA 4W97A 4A69C 4BXXJ 2DA3A 1MSEC 2K9QA 3D1NI 1Z77A 4M3GA 2X9DA 3HB9A 2M8GX 2TRTA 1ENHA 1IJWC 3O8GA 5FLVA 1ETQA 1GUUA 3S14J 2EQRA 1TWFJ 5DTDA 1VNDA 1DU6A 1ORKA 1IUFA 2FX0A 1Y1VJ 1MH4A 2R92J 1MBGA 3OSFA 3HGYA 1WH7A 3SJMA 5J1UA 5EYRA 2VKEA 5DS9A 5F04A 4FCYA 4BBSJ 3GTMJ 1ETYA 2HDDA 2GM4A 5E3LA 4UUSA 3A02A 3S15J 1OCTC 3BG9A 1X2MA 2JA5J 1O4XA 1WGXA 5IYCJ 1UG2A 2QCOA 1A5JA 4BY1J 1HCRA 3OIOA 3RKQA 2VI6A 3FK6A 5FKLA 3Q0VA 2EZHA 1WH5A 3JRBA 4BKXA 2M34A 3LSRA 4IHWA 4LOCA 5F0CA 2MW8A 2L0KA 1K83J 1ZGWA 3JRAA 1ZR2A 4X1EA 1RETA 2O8KA 2NVYJ 3HOUJ 1JKPC 4C3HJ 2XSDC 2R7ZJ 3S1RJ 2L9RA 3GTQJ 2LKXA 3UKGA 4DZJA 5EZHA 3TW7A 5C3EJ 1JKQC 5JLXA 4MFEA 3C2BA 3K2AA 2H8RA 1YRNB 5F0FA 1JKRC 3G1MA 1GT0C 5EF6A 1ETXA 2DN0A 1U9OA 3WHBA 2R5ZB 4A3KJ 4Y7NJ 3GTOJ 3JRHA 3RZOJ 1WPKA 1B8IB 1FEXA 3HOYJ 2XB0X 1FTTA 3SDGA 1HOMA 2EH3A 2KT0A 2LFBA 1E3OC 3RQIA 2O7OA 5IOZA 3LOCA 3I4MJ 2NS8A 2EZIA 4G12A 3ZOBA 4B4CA 1AKHA 3MN2A 1GV5A 1QRYA 1JT0A 4DZPA 2CQQA 2K40A 9ANTA 3IV5A 2DA2A 3VPRA 2DA5A 2E2IJ 3QQAA 2AHQA 1JJ6C 1MBEA 1RPWA 1K61A 2JA6J 4MFDA 3S1NJ 4NDLA 3ZQFA 3LNQA 3BQYA 1MBFA 2JWTA 3CDLA 4DYRA 3HBLA 1NK3P 5EG0A 3JRCA 1JUPA 2Y30A 4M6VA 5M3MJ 4A3IJ 3GTJJ 4FTHA 1IGNA 1SFOJ 3JRIA 2ID3A 2Y2ZA 5FKNA 2IEKA 2XGEA 1PUFB 3M3YJ 4XIDA 1SANA 1T33A 2N8GA 5FJ8J 4HNVA 1OJLA 3B6CA 5EEAA 2HXOA 3JR9A 4J19A 4A3BJ 4UUSB 2R5YA 1OFCX 1JGGA 2ZB9A 2M0CA 4QIWN 1RR7A 3DEWA 4FISA 2LR8A 4QTRA 1ZQ3P 5IYDJ 1X2NA 3BR6A 1U9NA 1JUMA 3PO2J 2E2HJ 3B6AA 3JRGA 5K7FA 2JMWA 4CYCA 1I6HJ 3Q0WA 4XRSA 4QSHA 2IAIA 2ID6A 2Y9YA 5HODA 1WCMJ 2VUMJ 5GPCA 5M5YJ 1JJ8C 3LSJA 3GTKJ 2LP0A 5M3FJ 3S1QJ 2MG4A 1BA5A 2O9LA 4B1RA 5EZGA 5GPAA 2OPTA 3HKZN 3G1OA 3HM5A 2K9SA 1H8AC 2K9NA 2L7MP 2XGCA 3QPSA 1XG1A 3ZQHA 5FKMA 3TW6A 2GBYA 5C44J 3MKLA 1JT6A 3A03A 3BQZA 4L5EA 3BR5A 3GBGA 1B72B 1GV2A 4Y52J 3HOXJ 3ZQGA 1ETKA 2AO9A 2LTPA 1POGA 4DYCA 5E3OA 1GDTA 2H1KA 5F1JA 2HXIA 3CQZJ 2HOTA 2EZKA 1IC8A 1Y1WJ 2B63J 5FKOA 5IP7J 3TP3A 3JREA 5K7ZA 1W0UA 4ABZA 2R93J 2CJJA 3HDDA 2JA8J 4JYKA 1UHSA 2LK2A 1U8BA 2WAQN 2JA7J 3PO3J 2G0EA 4XK4A 1AKHB 3DCFA 1BW5A 1X58A 4AC0A 2FJ1A 1XC5A 2P81A 2ME0A 2X48A 1CQTA 1HDDC 3BR0A 2W48A 3HGGA 1JUSA 2XPUA 4V2GA 4C2MJ 1ZTRA 5E3MA 3E7LA 1VI0A 2ELKA 2HYJA 2ECBA 5K7HA 3S1MJ 1TC3C 1D5YA 3F0CA 3GTPJ 1P7IA 1MBHA 1F36A 5EGOB 3OSGA 3H0GJ 3A01B 1I3QJ 3IH4A 4RBOA 2Y9ZA 3WHCA 1LE8A 2DA1A 5FKKA 5C4JJ 1GVDA 2R5YB 3BR1A 4D7MA 1IG7A 2X6OA 2LD5A 4MIMA 3ZQIA 1RKWA 1EF4A 2HQ5A 2M9HA 1FIAA 3S2HJ 5J1RA 2D5VA 1BL0A 1IRZA 1FIPA 3BR2A 1ZK8A 5GP9A 1NK2P 3Q0UA 2E1OA 4JP0A 1DU0A 1YRNA 1IDZA 1HLVA 4A93J 2E19A 1MBJA 3BG5A 4M3EA 3NAUA 3L1PA 5IOYA 4JX6A 1TWHJ 4FE7A 2CUFA 3S16J 5IPAA 1MNMC 3I4NJ 4BBRJ 1BW6A 2NS7A 3H3VK 1T56A 4GFBA 3BTLA 1AHDP 3HOZJ 1ZR4A 2M2EA 4IHXA 3BTJA 1MH3A 2ECCA 1VF9A 3JRDA 2IBDA 4I6ZA 1G2HA 4C3JJ 2FQ4A 2YUSA 1ETWA 5JLWA 3ZQLA 1TWGJ 2WB1N 3LSGA 4A3DJ 4A3LJ 4I76A 5E3NA 2OF7A 4A3MJ 3GTLJ 1ETVA 4BY7J 1I50J 4D7NA 3QPLA 2XRLA 3M4OJ 1IDYA 4AUXA 5F08A 1FTZA 5EDNA 2Y0SN 4B3AA 3NARA 2Y31A 3FISA 1Z0XA 3G1LA 2PMZN 1IV6A 2L7ZA 2E2JJ 4IHVA 2CQXA 3BTCA 1PUFA 4C3IJ 4A3EJ 2XPWA 5M5XJ 4MO7A 2FD5A 2DMUA 4EEFG 3SFIA 1TWAJ 1VFCA 2L7FP 2LY9A 2NVXJ 1U78A 2QF7A 5M5WJ 3CCYA 2EZLA 3HEFA 3K7AJ 3CMYA 1FJLA 2CU7A 1BJZA 1TWCJ 3W6VA 2I10A 1JTXA 3BR3A 3RZDJ 1LE8B 2DJNA 2WV1A 3GTGJ 4IEJA 2COBA 5C4XJ 2R0QC 1HF0A 4UUTA 5IP9J 1P7JA 1W0TA 1APLC 2MGQA 1H89C 2DMNA 3PM1A 3S17J 3S2DJ 4A3GJ 2LLKA 5FLMJ 2VPRA 2VKVA 5J3LA 4X6AJ 5EG0B 2DMPA 3FK7A 4JX5A 2KDZA 3FIWA 2ME6A 1QVTA 2RAEA 1AU7A 2DA7A 1Q1VA 4A3CJ 5IP6A 1MSFC 2GLOA 1HDPA 1B72A 3BG3A 3TEDA 1NTCA 3FKIJ 3IH3A 1RESA 2NVTJ 3MVPA 5F27A 4A3JJ 1OCPA 1WI3A 4D5FA 5BNGA 4RDUA 2DMTA 2XGDA 1ITYA 4S0HB 1H88C 3Q3SA 1F43A 5F0HA 4W1UA 1S7EA 4DW6A 1R9TJ 1LFBA 1ZKGA 2DTZA 3ZQCA 3BT9A 3TP0A 4A3FJ 1QPIA 2CRGA 2XPVA 2NOGA 4CYCB 3OOUA 3HOWJ 3BTIA 4M3FA 3O8HA 4XICA 2NVQJ 2YU9J 2DA6A 2HI3A 4AYBN 4XRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JK3 A;  2CUE A;  4JX4 A;  4M3B A;  1RKT A;  3IH2 A;  4V2F A;  2JN6 A;  2R5Z A;  1XS9 A;  4DYQ A;  2DMQ A;  4IHY A;  2HOS A;  3LSP A;  4FE4 A;  1JKO C;  5IYB J;  4M3D A;  3HOV J;  1B8I A;  1QVU A;  2HOA A;  2MSY A;  2TCT A;  2LVS A;  2EBI A;  1LFU P;  1ETO A;  3JRF A;  1JTY A;  2XB5 A;  1MBK A;  4MLO A;  4D5C A;  5EGO A;  2JJ7 A;  3A01 A;  1UMQ A;  5J1Y A;  2YS9 A;  2DA4 A;  4XRS G;  1A6I A;  4W97 A;  4A69 C;  4BXX J;  2DA3 A;  1MSE C;  2K9Q A;  3D1N I;  1Z77 A;  4M3G A;  2X9D A;  3HB9 A;  2M8G X;  2TRT A;  1ENH A;  1IJW C;  3O8G A;  5FLV A;  1ETQ A;  1GUU A;  3S14 J;  2EQR A;  1TWF J;  5DTD A;  1VND A;  1DU6 A;  1ORK A;  1IUF A;  2FX0 A;  1Y1V J;  1MH4 A;  2R92 J;  1MBG A;  3OSF A;  3HGY A;  1WH7 A;  3SJM A;  5J1U A;  5EYR A;  2VKE A;  5DS9 A;  5F04 A;  4FCY A;  4BBS J;  3GTM J;  1ETY A;  2HDD A;  2GM4 A;  5E3L A;  4UUS A;  3A02 A;  3S15 J;  1OCT C;  3BG9 A;  1X2M A;  2JA5 J;  1O4X A;  1WGX A;  5IYC J;  1UG2 A;  2QCO A;  1A5J A;  4BY1 J;  1HCR A;  3OIO A;  3RKQ A;  2VI6 A;  3FK6 A;  5FKL A;  3Q0V A;  2EZH A;  1WH5 A;  3JRB A;  4BKX A;  2M34 A;  3LSR A;  4IHW A;  4LOC A;  5F0C A;  2MW8 A;  2L0K A;  1K83 J;  1ZGW A;  3JRA A;  1ZR2 A;  4X1E A;  1RET A;  2O8K A;  2NVY J;  3HOU J;  1JKP C;  4C3H J;  2XSD C;  2R7Z J;  3S1R J;  2L9R A;  3GTQ J;  2LKX A;  3UKG A;  4DZJ A;  5EZH A;  3TW7 A;  5C3E J;  1JKQ C;  5JLX A;  4MFE A;  3C2B A;  3K2A A;  2H8R A;  1YRN B;  5F0F A;  1JKR C;  3G1M A;  1GT0 C;  5EF6 A;  1ETX A;  2DN0 A;  1U9O A;  3WHB A;  2R5Z B;  4A3K J;  4Y7N J;  3GTO J;  3JRH A;  3RZO J;  1WPK A;  1B8I B;  1FEX A;  3HOY J;  2XB0 X;  1FTT A;  3SDG A;  1HOM A;  2EH3 A;  2KT0 A;  2LFB A;  1E3O C;  3RQI A;  2O7O A;  5IOZ A;  3LOC A;  3I4M J;  2NS8 A;  2EZI A;  4G12 A;  3ZOB A;  4B4C A;  1AKH A;  3MN2 A;  1GV5 A;  1QRY A;  1JT0 A;  4DZP A;  2CQQ A;  2K40 A;  9ANT A;  3IV5 A;  2DA2 A;  3VPR A;  2DA5 A;  2E2I J;  3QQA A;  2AHQ A;  1JJ6 C;  1MBE A;  1RPW A;  1K61 A;  2JA6 J;  4MFD A;  3S1N J;  4NDL A;  3ZQF A;  3LNQ A;  3BQY A;  1MBF A;  2JWT A;  3CDL A;  4DYR A;  3HBL A;  1NK3 P;  5EG0 A;  3JRC A;  1JUP A;  2Y30 A;  4M6V A;  5M3M J;  4A3I J;  3GTJ J;  4FTH A;  1IGN A;  1SFO J;  3JRI A;  2ID3 A;  2Y2Z A;  5FKN A;  2IEK A;  2XGE A;  1PUF B;  3M3Y J;  4XID A;  1SAN A;  1T33 A;  2N8G A;  5FJ8 J;  4HNV A;  1OJL A;  3B6C A;  5EEA A;  2HXO A;  3JR9 A;  4J19 A;  4A3B J;  4UUS B;  2R5Y A;  1OFC X;  1JGG A;  2ZB9 A;  2M0C A;  4QIW N;  1RR7 A;  3DEW A;  4FIS A;  2LR8 A;  4QTR A;  1ZQ3 P;  5IYD J;  1X2N A;  3BR6 A;  1U9N A;  1JUM A;  3PO2 J;  2E2H J;  3B6A A;  3JRG A;  5K7F A;  2JMW A;  4CYC A;  1I6H J;  3Q0W A;  4XRS A;  4QSH A;  2IAI A;  2ID6 A;  2Y9Y A;  5HOD A;  1WCM J;  2VUM J;  5GPC A;  5M5Y J;  1JJ8 C;  3LSJ A;  3GTK J;  2LP0 A;  5M3F J;  3S1Q J;  2MG4 A;  1BA5 A;  2O9L A;  4B1R A;  5EZG A;  5GPA A;  2OPT A;  3HKZ N;  3G1O A;  3HM5 A;  2K9S A;  1H8A C;  2K9N A;  2L7M P;  2XGC A;  3QPS A;  1XG1 A;  3ZQH A;  5FKM A;  3TW6 A;  2GBY A;  5C44 J;  3MKL A;  1JT6 A;  3A03 A;  3BQZ A;  4L5E A;  3BR5 A;  3GBG A;  1B72 B;  1GV2 A;  4Y52 J;  3HOX J;  3ZQG A;  1ETK A;  2AO9 A;  2LTP A;  1POG A;  4DYC A;  5E3O A;  1GDT A;  2H1K A;  5F1J A;  2HXI A;  3CQZ J;  2HOT A;  2EZK A;  1IC8 A;  1Y1W J;  2B63 J;  5FKO A;  5IP7 J;  3TP3 A;  3JRE A;  5K7Z A;  1W0U A;  4ABZ A;  2R93 J;  2CJJ A;  3HDD A;  2JA8 J;  4JYK A;  1UHS A;  2LK2 A;  1U8B A;  2WAQ N;  2JA7 J;  3PO3 J;  2G0E A;  4XK4 A;  1AKH B;  3DCF A;  1BW5 A;  1X58 A;  4AC0 A;  2FJ1 A;  1XC5 A;  2P81 A;  2ME0 A;  2X48 A;  1CQT A;  1HDD C;  3BR0 A;  2W48 A;  3HGG A;  1JUS A;  2XPU A;  4V2G A;  4C2M J;  1ZTR A;  5E3M A;  3E7L A;  1VI0 A;  2ELK A;  2HYJ A;  2ECB A;  5K7H A;  3S1M J;  1TC3 C;  1D5Y A;  3F0C A;  3GTP J;  1P7I A;  1MBH A;  1F36 A;  5EGO B;  3OSG A;  3H0G J;  3A01 B;  1I3Q J;  3IH4 A;  4RBO A;  2Y9Z A;  3WHC A;  1LE8 A;  2DA1 A;  5FKK A;  5C4J J;  1GVD A;  2R5Y B;  3BR1 A;  4D7M A;  1IG7 A;  2X6O A;  2LD5 A;  4MIM A;  3ZQI A;  1RKW A;  1EF4 A;  2HQ5 A;  2M9H A;  1FIA A;  3S2H J;  5J1R A;  2D5V A;  1BL0 A;  1IRZ A;  1FIP A;  3BR2 A;  1ZK8 A;  5GP9 A;  1NK2 P;  3Q0U A;  2E1O A;  4JP0 A;  1DU0 A;  1YRN A;  1IDZ A;  1HLV A;  4A93 J;  2E19 A;  1MBJ A;  3BG5 A;  4M3E A;  3NAU A;  3L1P A;  5IOY A;  4JX6 A;  1TWH J;  4FE7 A;  2CUF A;  3S16 J;  5IPA A;  1MNM C;  3I4N J;  4BBR J;  1BW6 A;  2NS7 A;  3H3V K;  1T56 A;  4GFB A;  3BTL A;  1AHD P;  3HOZ J;  1ZR4 A;  2M2E A;  4IHX A;  3BTJ A;  1MH3 A;  2ECC A;  1VF9 A;  3JRD A;  2IBD A;  4I6Z A;  1G2H A;  4C3J J;  2FQ4 A;  2YUS A;  1ETW A;  5JLW A;  3ZQL A;  1TWG J;  2WB1 N;  3LSG A;  4A3D J;  4A3L J;  4I76 A;  5E3N A;  2OF7 A;  4A3M J;  3GTL J;  1ETV A;  4BY7 J;  1I50 J;  4D7N A;  3QPL A;  2XRL A;  3M4O J;  1IDY A;  4AUX A;  5F08 A;  1FTZ A;  5EDN A;  2Y0S N;  4B3A A;  3NAR A;  2Y31 A;  3FIS A;  1Z0X A;  3G1L A;  2PMZ N;  1IV6 A;  2L7Z A;  2E2J J;  4IHV A;  2CQX A;  3BTC A;  1PUF A;  4C3I J;  4A3E J;  2XPW A;  5M5X J;  4MO7 A;  2FD5 A;  2DMU A;  4EEF G;  3SFI A;  1TWA J;  1VFC A;  2L7F P;  2LY9 A;  2NVX J;  1U78 A;  2QF7 A;  5M5W J;  3CCY A;  2EZL A;  3HEF A;  3K7A J;  3CMY A;  1FJL A;  2CU7 A;  1BJZ A;  1TWC J;  3W6V A;  2I10 A;  1JTX A;  3BR3 A;  3RZD J;  1LE8 B;  2DJN A;  2WV1 A;  3GTG J;  4IEJ A;  2COB A;  5C4X J;  2R0Q C;  1HF0 A;  4UUT A;  5IP9 J;  1P7J A;  1W0T A;  1APL C;  2MGQ A;  1H89 C;  2DMN A;  3PM1 A;  3S17 J;  3S2D J;  4A3G J;  2LLK A;  5FLM J;  2VPR A;  2VKV A;  5J3L A;  4X6A J;  5EG0 B;  2DMP A;  3FK7 A;  4JX5 A;  2KDZ A;  3FIW A;  2ME6 A;  1QVT A;  2RAE A;  1AU7 A;  2DA7 A;  1Q1V A;  4A3C J;  5IP6 A;  1MSF C;  2GLO A;  1HDP A;  1B72 A;  3BG3 A;  3TED A;  1NTC A;  3FKI J;  3IH3 A;  1RES A;  2NVT J;  3MVP A;  5F27 A;  4A3J J;  1OCP A;  1WI3 A;  4D5F A;  5BNG A;  4RDU A;  2DMT A;  2XGD A;  1ITY A;  4S0H B;  1H88 C;  3Q3S A;  1F43 A;  5F0H A;  4W1U A;  1S7E A;  4DW6 A;  1R9T J;  1LFB A;  1ZKG A;  2DTZ A;  3ZQC A;  3BT9 A;  3TP0 A;  4A3F J;  1QPI A;  2CRG A;  2XPV A;  2NOG A;  4CYC B;  3OOU A;  3HOW J;  3BTI A;  4M3F A;  3O8H A;  4XIC A;  2NVQ J;  2YU9 J;  2DA6 A;  2HI3 A;  4AYB N;  4XRM A; 
#chains in the Genus database with same CATH topology
 1ZLJ A;  5DCF A;  4JX4 A;  3L09 A;  4M3B A;  2BEO A;  2W25 A;  1RKT A;  2EWN A;  4V2F A;  3SFZ A;  3FXL A;  3F21 A;  2DK5 A;  5L3B A;  1X4P A;  2HOS A;  2RN7 A;  3UNG C;  3LSP A;  4FE4 A;  1Y0N A;  5IYB J;  1GLN A;  1QVU A;  2MSY A;  1P92 A;  2TCT A;  2EBI A;  3KIO A;  1LFU P;  5GAE J;  3JRF A;  4G6D A;  1JTY A;  2VC1 A;  2F2E A;  4ETS A;  4D5C A;  4E4H A;  2VQG A;  1UMQ A;  3ERM A;  3I58 A;  2DA4 A;  4KN7 X;  3SXY A;  2DA3 A;  3H35 A;  3CF2 A;  4PFO A;  3DPL C;  3CMA I;  4AD9 A;  3SZT A;  5HS7 A;  3WTX C;  1YIT I;  1PP7 U;  1MND A;  3JSO A;  3DEU A;  5CYV A;  4HF2 A;  3RYR A;  1B6A A;  3O8G A;  1VND A;  3WG9 A;  1ORK A;  1YX5 A;  2EIK H;  4I0B A;  4DQ2 A;  1U5T A;  2FX0 A;  1N25 A;  2VOP A;  1MH4 A;  3LA2 A;  5FFZ A;  3DU6 A;  5J1U A;  3N05 A;  1IN4 A;  5EYR A;  5F04 A;  2F5E A;  3ZRG A;  2XC7 A;  3M7G A;  1ETY A;  3S3N A;  3A02 A;  2RQQ A;  3WTS C;  1PUE E;  4Y4R A;  2CQK A;  3I54 A;  3QPH A;  2JA5 J;  1G3W A;  1WGX A;  5CVR A;  3LST A;  3HIF A;  2QCO A;  3EYI A;  2V1N A;  4FQG A;  5HS9 A;  3LWF A;  3OIO A;  3GCM A;  1ZYR F;  3RKQ A;  5FRN A;  3D0S A;  3RCO A;  1Q1H A;  4U0W A;  5EJC A;  1A6Q A;  3Q0V A;  2EZH A;  3OYI A;  4RLQ A;  2XV4 S;  1QA6 A;  2DAO A;  4BKX A;  3T8R A;  3H36 A;  5J40 A;  3KEY A;  2HNH A;  1TNS A;  4F93 B;  1ZAR A;  4O5V A;  4BJ6 C;  3MD2 A;  2HTS A;  4LD5 A;  1K78 A;  2M4G A;  2PLY A;  2NVY J;  5DCM B;  3BRO A;  3HOU J;  5JVT A;  2L9R A;  3GTQ J;  3IRR A;  3F8F A;  2IGK A;  3C2B A;  3S3O A;  2H8R A;  1YRN B;  2RNJ A;  3TDZ C;  2XDV A;  3IL2 A;  2ZBK A;  2HPI A;  2M4K A;  5K5Q A;  4PJ0 C;  2VT2 A;  1XCV A;  5E1W A;  4I98 B;  2XUB A;  1WI9 A;  3OL3 A;  2UXN A;  5JVG F;  4QLC U;  1VQ9 I;  2L01 A;  4Z2Y A;  1R5H A;  4A3K J;  2DN0 A;  3JTH A;  2HR3 A;  3U21 A;  1WKM A;  2BGC A;  4XMY A;  1GVJ A;  1IN5 A;  3HRM A;  1Y6I A;  1SD7 A;  1VQO I;  2DTR A;  1NG6 A;  4NNJ A;  3S8P A;  3HRT A;  2QM3 A;  1FTT A;  1LPQ A;  1ZGA A;  2KT0 A;  3F8M A;  2LFB A;  3RQI A;  2O7O A;  2X1E A;  2XRN A;  1TBX A;  2Q8K A;  1FLI A;  3LA7 A;  1AKH A;  3MN2 A;  2EFO A;  1QRY A;  1BM9 A;  4DZP A;  4EAT A;  2CQQ A;  4P9F A;  1FSH A;  1NG7 A;  1YE9 A;  3IV5 A;  3HTU A;  4LB6 B;  2AHQ A;  1MBE A;  2E34 A;  4XOT A;  4HDV A;  1ACI A;  2ZJP F;  1ULY A;  4NBQ A;  2FOW A;  1PJR A;  2F5V A;  1IW7 F;  3GLX A;  3OYK A;  2H94 A;  4WXC A;  1R5I D;  5EG0 A;  3MKZ A;  3G6E I;  4M6V A;  4AVZ A;  2Q0O A;  1IGN A;  2IA2 A;  3HTS B;  2R7V A;  4GO1 A;  2Y2Z A;  5FKN A;  2IEK A;  2CV2 A;  1PUF B;  5J4V A;  2KL4 A;  3RJP A;  3PQJ A;  1Z6R A;  2N8G A;  4RAF A;  4HNV A;  3IAS 2;  2XF7 A;  3J7Z I;  2ZJQ F;  4J19 A;  4A3B J;  4UUS B;  1JGG A;  2JPC A;  2DFI A;  3SEQ A;  4PUS A;  1VQM I;  3ELK A;  3FMS A;  5IT3 A;  3VDX A;  1R71 A;  1RR7 A;  3DEW A;  1W7P A;  4M74 A;  3DBR B;  4QTR A;  1ZQ3 P;  3FHZ A;  1TQP A;  2X0L A;  3BR6 A;  1JUM A;  3PO2 J;  4HA8 A;  1ZGJ A;  2OQG A;  2OZ6 A;  3LL7 A;  4GYI A;  2JMW A;  2JQ7 A;  2MYS A;  4IQJ A;  2KZG A;  1ZG5 A;  5HOD A;  1WCM J;  3AG4 H;  5DD4 A;  4D9J A;  4QPQ A;  3S1Q J;  3MZH A;  1BA5 A;  2KZV A;  3BCA A;  3D5R C;  3CME I;  2CWE A;  3HKZ N;  5IT9 Z;  1TZL A;  3KET A;  3HM5 A;  3CP8 A;  2K9S A;  3EET A;  3V8J A;  3CCJ I;  2LG4 A;  2XGC A;  4MTE A;  3HYI A;  3QPS A;  5FKM A;  2GBY A;  4Q47 A;  4LLG F;  4WK8 F;  3MKL A;  2DYR H;  1K4S A;  1JT6 A;  3H5A A;  3A03 A;  3BQZ A;  3GBG A;  4Y52 J;  2ETH A;  5D5V B;  1YOV B;  3HKZ A;  2JUG A;  2LTP A;  4EVI A;  2W85 A;  5E3O A;  1XGO A;  3D5L A;  3FBI B;  2H1K A;  4IVN A;  3ZPL A;  1E3H A;  3CQZ J;  2HOT A;  3LFU A;  1IC8 A;  2WAF A;  4ENJ A;  3FHN A;  3ABK H;  5K7Z A;  1W0U A;  2R93 J;  2CJJ A;  2QQ8 A;  2QZ8 A;  2HKX A;  2BY2 A;  4RGU A;  1FOX A;  3VOE A;  4OU0 A;  2JA7 J;  1XX5 A;  2H6B A;  3NEU A;  2QA4 I;  2IS2 A;  3PSI A;  1YIO A;  4ZZL A;  1BW5 A;  2W82 A;  1MGT A;  4UY8 I;  3GFI A;  2DQR A;  5J6X A;  4EV0 A;  3E6C C;  3WGG A;  3IRQ A;  2EIL H;  2X48 A;  4YIF A;  2MD0 A;  2XKO A;  3ZMT A;  4MGR A;  2NS0 A;  2AXL A;  3GME A;  4K2E A;  1LKX A;  3HGG A;  1ZTR A;  3SQN A;  2OCC H;  2KIF A;  2QGU A;  3N4M A;  1C0W A;  2R7D A;  1WJ5 A;  3L9F A;  5BPI A;  1TC3 C;  1D5Y A;  1QNT A;  3WTZ A;  5EGO B;  3FX3 A;  3JSP A;  2M7B A;  3IWZ A;  3RKY A;  2DA1 A;  3WTW C;  3QOP A;  5C4J J;  2CS3 A;  2HVR A;  2CGP A;  2R5Y B;  4D7M A;  4X0G A;  1P4X A;  2O3F A;  1G4D A;  3TO6 A;  3ZQI A;  2E5Z A;  1EF4 A;  1WJD A;  2QQB A;  5AIP A;  2DFE A;  2WY7 Q;  2P5K A;  3ASN H;  2IXS A;  1A35 A;  1X19 A;  5J1R A;  5DCM A;  4LK1 F;  4AU7 A;  3DTE A;  3HRS A;  4YIR X;  4G6T B;  1TW3 A;  4HF0 A;  2IA0 A;  3Q0U A;  3KP6 A;  3S93 A;  1G6N A;  1DU0 A;  3HZJ A;  3K4N A;  1YRN A;  2F48 A;  1H0M A;  2E19 A;  4C2T A;  3BG5 A;  2AXT C;  4M3E A;  3H5N A;  3NAU A;  5IOY A;  4UHT A;  2WTE A;  4IRG A;  1VQ8 I;  3GZN B;  2AQE A;  6PAX A;  2V7F A;  4KYW A;  4L0Y B;  4OIR F;  4ON0 A;  1T95 A;  5HNF A;  1MNM C;  2JRT A;  3I4N J;  1IN7 A;  3ABU A;  3G71 I;  1G8X A;  3BJO A;  2E5N A;  1ZR4 A;  1SFX A;  2FRH A;  4IHX A;  2O6G E;  1SAX A;  2ECC A;  2DLL A;  2H6C A;  2K27 A;  3MMY B;  4ZTF A;  1VQK I;  1G2H A;  4C3J J;  4ESF A;  3WGI A;  3N97 A;  1B59 A;  4RB1 A;  2YUS A;  1ETW A;  2EA4 A;  3ZQL A;  5KVR A;  1LVK A;  1D1A A;  3EUH C;  2OF7 A;  4XKV A;  1FP2 A;  3ZN0 A;  2A6T A;  3QPL A;  3K4C A;  1OYI A;  3V7C A;  4KIB A;  3M4O J;  3CDH A;  1IDY A;  2BBY A;  3PSF A;  4AUX A;  2IS6 A;  1IO2 A;  2LMD A;  2Y0S N;  1QZY A;  5DEQ A;  3VYR B;  3WE3 A;  5DM6 F;  2Y31 A;  3G73 A;  3F6V A;  2F5F A;  2HKO A;  2PMZ N;  3ASO H;  4CCN A;  5J8F A;  4CGZ A;  1VQ7 I;  2IRF G;  3VWB A;  2P6S A;  2CQX A;  4IOA F;  2XAF A;  3KZZ A;  1PUF A;  1PYV A;  3E6D A;  1RUO A;  2H09 A;  5LRS A;  3DBH B;  2QYO A;  3OYD A;  2Y0S A;  1D0Y A;  5JHF A;  2L7F P;  2K7L A;  2M8E A;  3CC2 I;  2QF7 A;  2ZSI B;  3PIP F;  5LLQ A;  2GAU A;  2EZL A;  1XD7 A;  2LDU A;  3LFK A;  3LSM A;  1JE8 A;  4EGZ A;  1BJZ A;  2FML A;  3W6V A;  2OQR A;  1WHU A;  2H27 A;  3GVA A;  1JTX A;  1ZH5 A;  2DFF A;  1PP8 F;  2WV1 A;  1QHH D;  4E7Z A;  3QP6 A;  4XKW A;  3AG2 H;  1HF0 A;  2OV7 A;  5GAH J;  1Z9C A;  1K4T A;  2VPL A;  1QGP A;  3FBN B;  2KIM A;  3W6J B;  4DOZ A;  4O6J A;  3H1C A;  5CVJ A;  5E1Z B;  4A5M A;  2Y69 H;  2EA2 A;  1HA8 A;  2IVM A;  4U88 A;  1LB2 A;  3I0T A;  4PGG A;  4WF2 A;  5L3D A;  5J4Y A;  5FLM J;  2QBY B;  1BI2 A;  2VPR A;  4KIC A;  2ELH A;  1ERD A;  2K9M A;  1L0O C;  4XLC A;  2A07 F;  5ILS A;  2ME6 A;  4KT6 A;  1X1P A;  1AU7 A;  3BZ6 A;  4M73 A;  2BVM A;  4JQF A;  5H6R A;  1MSF C;  3LMM A;  2HYF A;  2FNP A;  2V1X A;  3SEZ A;  3BG3 A;  4XLP F;  1YS7 A;  3FKI J;  3IH3 A;  1RES A;  2K3P A;  1SAU A;  2OU2 A;  5F27 A;  2E7X A;  1F4K A;  2LSO A;  1WI3 A;  3H92 A;  2J5P A;  2W24 A;  4C9Y A;  4R8H A;  1Z3Y A;  2FQ3 A;  1WQ2 A;  1F43 A;  2V79 A;  1HXD A;  1UZC A;  1S7E A;  1MZB A;  3HUG B;  4IHS A;  4MNU A;  3C18 A;  5HNH A;  4HSR A;  2HDC A;  4LIU A;  5JI6 A;  2P5V A;  1ZKG A;  2A69 F;  2RKH A;  2HPM A;  3TP0 A;  4CZC A;  2XIG A;  1OYY A;  1QPI A;  5DD8 A;  3MQ0 A;  5CPR B;  2AS5 F;  3HOW J;  3K0L A;  1BOB A;  3OYL A;  5BPD A;  4PSW A;  3OS0 A;  4EQQ A;  4KFC A;  2PN6 A;  4AYB N;  1Z91 A;  4LMY A;  3FM5 A;  2JK3 A;  4F91 B;  1D0Z A;  2CUE A;  1OYW A;  2F5C A;  3K1M A;  1RIO H;  5FGM A;  2R4G A;  2R5Z A;  4DYQ A;  2DMQ A;  4PGH A;  1N78 A;  2KRH A;  1B8I A;  2XSJ C;  3DQV C;  1S72 I;  1K6Y A;  2HOA A;  5FLX K;  3CCU I;  2HOE A;  3CCV I;  4CH7 A;  3HRU A;  4KUM A;  3VYT B;  5EEH A;  1MBK A;  3E5Q A;  3H5R A;  3KCC A;  5EGO A;  2JJ7 A;  3Q9S A;  5J1Y A;  3TMO A;  2E71 A;  3HOT A;  1IZ1 A;  1YI2 I;  2ZKZ A;  4AIJ A;  2A61 A;  2O8X A;  2R7Q A;  5LGN A;  3JAM K;  1UST A;  3TQN A;  2K9Q A;  3D1N I;  3QOD A;  1MW7 A;  4Q48 A;  3OYB A;  5HLG A;  4M3G A;  3V8K A;  2BYV E;  2HVQ A;  1ENH A;  3J81 K;  1X1B A;  2EQR A;  3S14 J;  2J5O A;  4OMY A;  1H9T A;  1IUF A;  5ICC A;  2CV1 A;  1R1T A;  1E3P A;  2R92 J;  2CW7 A;  5BOX A;  3FXO A;  3ZN1 A;  4QPO A;  3SJM A;  3CP2 A;  5DS9 A;  4ZYH A;  4FCY A;  1OKR A;  4HDU A;  3GTM J;  5GTI C;  1I39 A;  2GM4 A;  5E3L A;  1O57 A;  1UHM A;  3CUQ C;  3HPG A;  4P5O A;  2FBI A;  2KFD A;  2L54 A;  1O4X A;  3RTR A;  1UG2 A;  1ZG3 A;  1SVO A;  1A5J A;  1YJW I;  3K70 D;  1MMN A;  3TO7 A;  2IJL A;  5D5U B;  2Z3Y A;  2PG4 A;  1V4R A;  3FK6 A;  5FKL A;  1XSV A;  1RZ4 A;  2HTJ A;  2OTL I;  3D5S C;  1TLH B;  2PMH A;  2P8T A;  1HST A;  2EIM H;  2HZT A;  3SDB A;  4E6K G;  2QKM B;  3JRB A;  4KMF A;  5F0C A;  1KA8 A;  1Z7L A;  4KIS A;  4KNY A;  1K83 J;  3ZP5 A;  1FMW A;  1FSE A;  4I99 C;  4XN3 A;  1T39 A;  1ZR2 A;  2VOO A;  1SFU A;  2QUF A;  1WWX A;  2O8K A;  1JKP C;  4UVC A;  4C3H J;  2A6H F;  3S1R J;  4XKC A;  2PX9 A;  4ZTJ A;  5EZH A;  3TW7 A;  2XAU A;  5C3E J;  2DQL A;  4MFE A;  5LEJ A;  2X1C A;  2ZME C;  4Q5S F;  3K10 A;  2DW4 A;  3OV8 A;  3OYE A;  2XF6 A;  5F0F A;  1JKR C;  5EF6 A;  5E8I A;  2VON A;  2FNA A;  2F4O B;  3C7J A;  4YFX F;  3WTU C;  3R4K A;  3GTO J;  2QSF X;  1G3S A;  1W7P D;  3DKY A;  2EFW A;  4BQA A;  4L5I A;  1OPC A;  2EB7 A;  1HOM A;  3PUB A;  1FOK A;  2EH3 A;  2STW A;  3P9I A;  1U3E M;  3RPU A;  1ZRC A;  3PUF A;  5KCM A;  3LOC A;  2LKS A;  3ZOB A;  2CG4 A;  4B4C A;  1R7J A;  1JT0 A;  2K40 A;  2LC2 A;  3DTK A;  3KP4 A;  4XSX F;  9ANT A;  2ISZ A;  2HFH A;  2OA4 A;  1AWC A;  4FX4 A;  1LDD A;  2E2I J;  2DA5 A;  4LIT A;  1FBQ A;  2DK8 A;  1RPW A;  2K85 A;  5DUK A;  1Y39 A;  4MFD A;  3S1N J;  2FOK A;  4NDL A;  1SFK A;  1VQ4 I;  1ZAO A;  2EIN H;  1BR2 A;  2JWT A;  2QBY A;  4QWQ A;  4DYR A;  3COA C;  2UWM A;  3HBL A;  3I59 B;  4U7D A;  1W1W E;  3HC7 A;  5HLI A;  3W3C A;  4FTH A;  5IY5 H;  4YEJ A;  1OR7 A;  2ID3 A;  4CCK A;  5TGT A;  1HSJ A;  1T33 A;  4U0Y A;  5BQT A;  5FJ8 J;  2KHM A;  4XLE A;  1G59 A;  2NNN A;  3A0B C;  1OJL A;  5EEA A;  2ZXJ A;  3K1N A;  3HHH A;  1MMD A;  4RB2 C;  4I2O A;  4NB5 A;  1YJ9 I;  1WJA A;  2VQL A;  4M6X A;  2M0C A;  2AQF A;  4QIW N;  1HW2 A;  2LR8 A;  5TIS C;  2F4I A;  3FXK A;  5IYD J;  1X2N A;  2HDW A;  3GUD A;  2LBF A;  1Z21 A;  4PJL A;  2V4J C;  2VBX A;  3KYC B;  3B6A A;  4RA2 A;  1R49 A;  1R22 A;  3F8B A;  4TV7 A;  3OYC A;  4WXD A;  3GZ5 A;  2ID6 A;  4I7H A;  1O3R A;  2VUM J;  1REP C;  1TT5 B;  1X1D A;  4CDG A;  2V9P A;  1I6X A;  3MKW B;  3LSJ A;  3J80 K;  3GTK J;  1R00 A;  2L3D A;  4B1R A;  1SVL A;  5EZG A;  2ZXH A;  2P6T A;  2OPT A;  3NRV A;  1UJ8 A;  2RQP A;  3OIQ A;  4L9V A;  2LY1 A;  2K9N A;  2L7M P;  1I5Z A;  1XG1 A;  4RB0 A;  4XSZ F;  1K6O A;  2IGM A;  1KU3 A;  3R60 A;  4I0A A;  1MIJ A;  4L5E A;  3BR5 A;  2NNY A;  1VTN C;  2B9S A;  1ETK A;  3OOP A;  2RC4 A;  3X2Q H;  4C30 A;  3P9C A;  4UXN A;  2NYX A;  1B4A A;  2AO9 A;  4DYC A;  1J2X A;  4WCG A;  1CF7 A;  2L9N A;  4BYY A;  5F1J A;  5E20 A;  2EZK A;  5L3E A;  2NRA C;  2TDX A;  5D6E A;  4HLY A;  3BZC A;  3AAF A;  1DGR M;  3BPX A;  1BC8 C;  2GXG A;  4HLX A;  1WJE A;  3A1Y A;  2MC4 A;  1Y0U A;  5HDN A;  2JT1 A;  1U8B A;  2G7H A;  1XGN A;  2G0E A;  2ZCW A;  4XK4 A;  3DCF A;  4FHT A;  5KK1 A;  1LUJ B;  1IXC A;  1X1A A;  1MMS A;  3MFK A;  2FJ1 A;  1XC5 A;  2P81 A;  2ME0 A;  2KLO A;  1CQT A;  1TT0 A;  1HDD C;  1FP1 D;  4KT5 C;  4BAY A;  3CCE I;  1FWZ A;  2NXN B;  1KQ8 A;  2XPU A;  4G94 A;  2EK5 A;  2MH9 A;  4LG3 A;  2ELK A;  5H20 A;  2A3S A;  2ECB A;  2XAH A;  3BY6 A;  1F9N A;  1F5T A;  3GTP J;  2H1L A;  1MBH A;  3GO5 A;  1F36 A;  3OSG A;  3H0G J;  1I3Q J;  4ENN A;  1AA7 A;  2VOD A;  3TOB A;  3DLL F;  1MKM A;  3PNY A;  1GVD A;  1J7K A;  4RLF A;  4RMN A;  5B5E C;  4HOB A;  2VKH A;  3FF5 A;  4A12 A;  1ZRF A;  2DYS H;  2QQ9 A;  2X6O A;  3K4B A;  4F3Q A;  2BY3 A;  2IP2 A;  4M71 A;  4MIM A;  2LD5 A;  4PDK A;  2DOD A;  1RKW A;  1BIB A;  3S2H J;  1FZP B;  2D5V A;  2D1V A;  1JXS A;  1W36 D;  3CES A;  3BR2 A;  3KYD B;  3OR1 C;  1MJA A;  1I27 A;  1P4A A;  2E1O A;  4WX9 A;  4HRI A;  1EKE A;  1ZEL A;  1MBJ A;  2IS1 A;  1B9N A;  5F64 A;  4YFK F;  1P2F A;  2BE5 F;  2FU4 A;  4BHP A;  1YS6 A;  1D8J A;  2CUZ A;  4FE7 A;  5IPA A;  3S2W A;  4BBR J;  1T56 A;  2K02 A;  2BZT A;  3HOZ J;  2W00 A;  2M2E A;  5A2Q K;  4RGX A;  3ZQQ A;  4BQN A;  2IBD A;  1IRG A;  1IXS B;  3AFH A;  3F22 A;  3CC4 I;  5JLW A;  2OTJ I;  3ISP A;  4HEA 2;  3L00 A;  3LSG A;  3OL4 A;  4XLN F;  3GTL J;  1ETV A;  3QYF A;  4N9H A;  4BY7 J;  3VB2 A;  5LFA A;  1I50 J;  4GGG A;  2EFP A;  3MKY B;  1F1Z A;  3QRF F;  5B3S H;  5F08 A;  4UNO A;  4B09 A;  2KQR A;  4B3A A;  4F92 B;  3NAR A;  4CCL A;  4ZYA A;  4Y33 A;  5ICF A;  3G1L A;  2L7Z A;  4IHV A;  1S29 A;  3H9J A;  1YX3 A;  2MBF A;  2UZK A;  4L0Z B;  4NHJ A;  2PI0 A;  4KMU X;  4DIQ A;  2GA2 A;  1XDS A;  2K4J A;  3BPV A;  5M5X J;  2QLZ A;  4BH9 A;  2R7X A;  2FD5 A;  3CCM I;  1U8R A;  2KMU A;  4BNC A;  3OS2 A;  3IC7 A;  2LY9 A;  2NVX J;  1U78 A;  1TNT A;  5L3G A;  3JTG A;  2WC2 A;  5GAD J;  5M5W J;  3QOE A;  1XPX A;  2R7O A;  3HEF A;  3CMY A;  2LF7 A;  3G3Z A;  3HJE A;  1S5L C;  5B66 C;  1YLF A;  3ERE D;  1I3A A;  1T8I A;  4XN0 A;  1LE8 B;  3RZD J;  5HDK A;  1FC3 A;  3VYS B;  2COB A;  2VLA A;  1DUX C;  2PEX A;  3B02 A;  1WJB A;  1MJ9 A;  1IXR C;  2M0M A;  2MD5 A;  4UUT A;  3K4J A;  5IP9 J;  3GLL A;  4XR6 A;  2MGQ A;  2DMN A;  4FAS D;  1KQ9 A;  3CCR I;  3S17 J;  3FXM A;  3S2D J;  5LHI A;  2D1H A;  1Z1D A;  3WGH A;  2L4M A;  4EJU A;  2YU3 A;  4E7I A;  1NHA A;  2MFZ A;  2JUC A;  4IF4 A;  3M07 A;  1XMK A;  2VKV A;  5J3L A;  1H9G A;  2P4W A;  4LFU A;  4RGR A;  3BDD A;  5BMZ A;  2LRE A;  3NQO A;  3HG9 A;  4BQQ A;  3ULQ B;  2V6C A;  4RAY A;  1HDP A;  4O3M A;  3T8T A;  4M9X A;  4ZDP A;  2XAG A;  3TED A;  1NTC A;  1HKT A;  4IXA A;  2P7V B;  4KDP A;  3PNV A;  2NVT J;  2XRO A;  1DP3 A;  3MVP A;  2QSG X;  4BJT A;  2DI3 A;  2XGD A;  1ON1 A;  2DDA A;  3E6M A;  1YYV A;  2YX4 A;  2Z9O A;  4S0H B;  1H88 C;  3Q3S A;  3W2W A;  3IHU A;  4ZZD A;  2E7W A;  2KJB A;  4W1U A;  4D0P A;  4I01 A;  4LLN A;  2FEZ A;  3V7R A;  2UV1 A;  2X6W A;  2DTZ A;  1UHW A;  3O3K A;  3ZQC A;  3ZQ7 A;  3JAM Z;  3LSH A;  2CRG A;  2XPV A;  2NOG A;  3RI4 A;  3BTI A;  4XIC A;  3GEZ A;  4XKB A;  4EJW A;  2YX7 A;  2WWY A;  4M9S A;  1X1C A;  5D6F A;  4IPA A;  3O6B B;  3TGN A;  4A5N A;  2PFB A;  3C3W A;  4YG2 F;  1D5V A;  4IHY A;  2LOO A;  3TL4 X;  3TO9 A;  1JKO C;  2A5W A;  3HOV J;  2CFO A;  3QYE A;  2LVS A;  3U1D A;  3OS1 A;  4OIP F;  3RYP A;  4BHC A;  5FD6 A;  3DV8 A;  3BWG A;  4LGW A;  3OY9 A;  1S8N A;  3EDP A;  1IUY A;  4JOM A;  1EV7 A;  4NUB A;  4M9Z A;  3OWT A;  4XRS G;  3E97 A;  1VQL I;  1A6I A;  4AID A;  1MNE A;  4W97 A;  4A69 C;  3L2W A;  4BXX J;  1RR8 C;  3CMM A;  2VQH A;  1Z77 A;  1BI1 A;  3ZMD A;  2Q2E B;  4OMZ A;  1ONV A;  2X9D A;  1T38 A;  2M8G X;  2TRT A;  4L18 B;  1FBS A;  1GUU A;  3CUQ B;  2VB6 A;  2EV6 A;  2WV0 A;  1TWF J;  1XN7 A;  4Y3O A;  2VBZ A;  2KRF A;  1TP4 A;  3WG7 H;  3AG3 H;  1WH7 A;  3FMQ A;  4GRI A;  3K69 A;  1RUN A;  1KGS A;  2XAQ A;  4OIN F;  1T2K A;  1YQA A;  2HDD A;  4DBR A;  4UUS A;  3S15 J;  1OCT C;  3BG9 A;  3EUH A;  3KZI C;  3K6G A;  3RPU D;  1OCC H;  5IYC J;  5ERI A;  5E17 F;  1BBY A;  1MMG A;  3PQK A;  3PL8 A;  4XLA A;  1QZZ A;  5E18 F;  4N9I A;  1T0F C;  4A6E A;  2CUJ A;  2OCE A;  2L9S A;  1Y8R B;  1WH5 A;  3GXO A;  2ZXI A;  1KZH A;  2WAE A;  5DV5 A;  4E7L A;  2W7N A;  3GWZ A;  2M34 A;  2ZME B;  1SD4 A;  1G3Y A;  3DPT A;  4LOC A;  2Z5U A;  2L0K A;  2ZFU A;  2BY1 A;  3ML6 A;  1ZGW A;  4KIF A;  4UVB A;  2X4H A;  4X1E A;  4BU2 A;  3CUO A;  2M30 A;  4BQO A;  2L02 A;  3BP8 A;  4YRV A;  3L7W A;  1MMA A;  2CW0 F;  1IV8 A;  1P6R A;  4CUG A;  3UKG A;  5F6F A;  4BXU A;  5JLX A;  3E1S A;  1FPQ A;  2M3A A;  3ONQ A;  3SYT A;  4A6D A;  1UAA A;  3GZ6 A;  3OMY A;  4G7H F;  1DQU A;  2MH2 A;  1WZ2 A;  1JHH A;  5IT9 K;  2RVC A;  3G1M A;  1BR4 A;  2K9L A;  1GT0 C;  3DPU A;  3HHG A;  3DLA A;  1U9O A;  3WHB A;  3A2K A;  1IRX A;  3JRH A;  2STT A;  1WPK A;  2QSH X;  3EYY A;  1E17 A;  2DO7 A;  1FEX A;  3HOY J;  3VEP A;  2IPQ X;  5E8G A;  3H3U A;  1E3O C;  4ENM A;  1XSX A;  2QEN A;  3KP5 A;  4BS9 A;  4ZYD A;  1M1E B;  5IOZ A;  2HQR A;  2MLK A;  2PQ8 A;  2NS8 A;  2EZI A;  3V8L A;  3T0Y A;  4HQE A;  4ANJ A;  3Q5F A;  2OUM A;  4F52 A;  1A04 A;  2DA2 A;  3VPR A;  3QQA A;  5K5R A;  3WU1 B;  1K61 A;  2JA6 J;  2XKP A;  3GF2 A;  3ZQF A;  2PMU A;  2OAZ A;  1MBF A;  2Z33 A;  3CDL A;  2RDP A;  2VT3 A;  2BXZ A;  1MD0 A;  1TQM A;  3JRC A;  4HYE A;  2Y30 A;  4DGW B;  5M3M J;  1ODD A;  4A3I J;  3GTJ J;  1O3Q A;  1OQY A;  2NAZ A;  4PCQ A;  5LGU A;  1EH6 A;  2XGE A;  4AWX B;  4RAZ A;  2B0L A;  4XID A;  5TRD A;  1VQP I;  2EPF A;  2KIU A;  5E1X A;  1XGM A;  3R6S A;  1YO5 C;  3B6C A;  2HXO A;  4RM2 A;  2R7S A;  2R5Y A;  5AON A;  3M8E A;  2ZB9 A;  1RNL A;  2V6E A;  2BW3 B;  2Z16 A;  2EV0 A;  3R0A A;  4EM0 B;  1UCR A;  4IJA A;  4CXF A;  3F9K A;  5HS8 A;  3K4L A;  4FIS A;  3KLN A;  5CJ9 A;  5B1A H;  1U9N A;  2KP6 A;  2E2H J;  4CHU A;  2GOX B;  2A68 F;  2HEO A;  3ESW B;  3JRG A;  1GHC A;  2L5Q A;  3OYF A;  1I6H J;  3Q0W A;  4XRS A;  5D5X B;  2YSR A;  2C6Y A;  3KE2 A;  4HV5 A;  2I5U A;  2M5W A;  1VQ5 I;  3FXJ A;  2LP0 A;  3KP7 A;  2O03 A;  2MG4 A;  3MEX A;  2O9L A;  3FZV A;  4L9T A;  2OD5 A;  2FE3 A;  3WU0 A;  1QO0 D;  2DT5 A;  2A6E F;  2K86 A;  1H8A C;  3CLO A;  4G6Q A;  4KJZ A;  5DUI A;  1JI8 A;  3CDI A;  3TW6 A;  2XGX A;  3H0D A;  1FNN A;  4XON A;  1NH3 A;  4J01 A;  3PIO F;  3IP4 B;  3HOX J;  2IT0 A;  2PBI A;  3F72 A;  1V5F A;  3IKT A;  1GDT A;  1KON A;  5KNL A;  2PJR B;  3U9G A;  2CYY A;  1Y1W J;  4UB6 C;  2OBP A;  2M7A A;  1FT9 A;  1QPM A;  3TP3 A;  3JRE A;  2IS4 A;  1N75 A;  4ABZ A;  3QWL A;  3HDD A;  2X85 A;  3NWT A;  3L2V A;  3ECH A;  2Q2E A;  4IL6 C;  2ACJ A;  2LH9 A;  3OYN A;  4PJJ A;  4I02 A;  4B44 A;  3PO3 J;  4OAY A;  3RKW A;  1AKH B;  4XOR A;  1J09 A;  4E7J A;  2DCE A;  4S05 A;  2CW8 A;  1X58 A;  2DOE A;  3VSL A;  3ZCO A;  4AC0 A;  4D1Q A;  2FSW A;  2JVG A;  4YII A;  2G9W A;  2JSP A;  4YFN F;  4EJT A;  1LEA A;  5JR3 A;  2A05 A;  3CJN A;  3BR0 A;  2W48 A;  1SC7 A;  2E36 A;  4V2G A;  4C2M J;  3C2G A;  3E6B A;  4UVA A;  1VI0 A;  2HYJ A;  2ZFW A;  1Z05 A;  1D3Y A;  1R4M B;  2QWW A;  3I3L A;  3S1M J;  5ICG A;  2GXB A;  3F0C A;  4OAZ A;  4Y15 A;  1P7I A;  1WJF A;  1S7A A;  5LGT A;  1J59 A;  2ELJ A;  1E2X A;  3I5U A;  3A01 B;  3V42 A;  5HDG A;  4RBO A;  3WHC A;  2Y9Z A;  2K3F A;  2HWV A;  1W5C C;  5D4S A;  4PFP A;  2Z1D A;  3L2Q A;  1LFP A;  1HC8 A;  3I64 A;  3A0H C;  3GFJ A;  4BDY A;  2A5Y B;  1WJC A;  4F55 A;  2ZME A;  3DTI A;  3Q9V A;  2COM A;  3BOQ A;  2HQA A;  1W5S A;  3GFM A;  3W6K B;  3I4P A;  1W7P B;  4IOC F;  2HQ5 A;  1FIA A;  3TKY A;  5LBQ A;  1O3T A;  1XMA A;  5GP9 A;  1Y8Q B;  4JP0 A;  1TW2 A;  2HVS A;  2O0Y A;  3FXQ A;  3LSK A;  2DFH A;  2XF5 A;  1HLV A;  3I71 A;  5GAG J;  1X3Z B;  2FBH A;  4EJV A;  3L1P A;  4AM3 A;  4A0X A;  3OIP A;  3J7Y J;  4JX6 A;  1TWH J;  4CZZ A;  2CUF A;  2XAS A;  3S16 J;  4IX7 A;  2VJ4 A;  1BW6 A;  2NS7 A;  2Y75 A;  4HNT A;  4KIT B;  4BXF A;  4GFB A;  3SZG A;  2I8D A;  3BTL A;  3H9G A;  3V4G A;  1U5T C;  2FBK A;  3HUG A;  4KN4 X;  1LJ9 A;  3BTJ A;  3J7A Y;  4PJM A;  1VF9 A;  4I6Z A;  2BHY A;  2E60 A;  4U87 A;  4E7S A;  2VJJ A;  3ZR8 X;  4E70 A;  5BS6 A;  3FXU A;  2WB1 N;  2V9K A;  2VJI A;  4N4O B;  2R7R A;  4Y13 A;  2B7E A;  1V3F A;  4A3D J;  4A3L J;  4OWR B;  1BR1 A;  3QAH A;  3OYJ A;  3CO6 C;  3KX2 A;  4ESB A;  5ED4 A;  1J9I A;  4D7N A;  5LEK A;  3SHF A;  4IZZ A;  1W4M A;  2CSO A;  1B9M A;  1IN8 A;  2W4S A;  2YPR A;  4LB5 A;  2XRL A;  4EJO A;  4M6Y A;  3F8C A;  2WB1 A;  4NQW B;  2VC0 A;  3RQ4 A;  4BGD A;  2E1C A;  5ILV A;  3FIS A;  1Z0X A;  3CZ6 A;  2EFN A;  1A31 A;  2E2J J;  3ZXS A;  3CLQ A;  3BTC A;  3KP2 A;  1HW5 A;  4CCJ A;  2LYC A;  3CJT B;  4A3E J;  2XPW A;  3DEE A;  1KU9 A;  2DMU A;  4EEF G;  3SFI A;  1BI0 A;  3HPH A;  4P9U A;  1SMY F;  3HSE A;  1EH8 A;  5KAI C;  2P0W A;  3CCY A;  2BW3 A;  3K7A J;  1FJL A;  3RIR A;  4XRF A;  2CU7 A;  4ZYG A;  1T08 B;  1R36 A;  3WOD F;  3CCQ I;  1QQI A;  2I10 A;  2FUG 2;  5AIQ A;  1BI3 A;  1L3L A;  2DJN A;  5CLS A;  2R0Q C;  1S9H A;  2EJR A;  1W0T A;  3PNT A;  2WBM A;  4FT8 A;  1OMI A;  2VXZ A;  3J7A O;  4G8X A;  1VQ6 I;  4HNU A;  3PM1 A;  1OCZ H;  3OR2 C;  4L9N A;  3ECO A;  1BC7 C;  1N77 A;  2LLK A;  1V5G A;  3PFY A;  3K70 C;  1ZHF A;  1D1C A;  1SFE A;  3R61 A;  4NC6 A;  4DNC A;  3FK7 A;  4JX5 A;  2XVC A;  2KDZ A;  3FIW A;  4P1W A;  3I55 I;  2CH0 A;  4BEH B;  1XMX A;  5DYM A;  2HU9 A;  4HAM A;  2RAE A;  4B3X A;  1I1G A;  4U7B A;  3JCU C;  2RNG A;  1P4W A;  4WWC A;  4A3C J;  5IP6 A;  2GLO A;  2ZNZ A;  1PVE A;  2XAJ A;  3EPZ A;  1Y56 A;  1EA3 A;  3K2Z A;  1TL8 A;  3L2R A;  3QYB A;  3DP7 A;  5DM7 F;  4BDZ A;  4D5F A;  1S6L A;  2FXA A;  2DMT A;  5BNG A;  2PJR A;  5H2F C;  1ITY A;  1KQ0 A;  3TDU C;  2KIS A;  5F0H A;  4DW6 A;  3CCS I;  1S7O A;  1R9T J;  1AOY A;  2L9V A;  1RI7 A;  1LFB A;  2M45 A;  1YTY A;  2EFQ A;  1Z67 A;  3K9T A;  3QU3 A;  1ZG1 A;  4S04 A;  4CYC B;  1LVA A;  3OOU A;  3OYM A;  3IWF A;  3KPH A;  3S32 A;  3DWL E;  2NVQ J;  3REO A;  2NOJ B;  3H9Q A;  2HI3 A;  1XB4 A;  4XRM A;  3FXR A;  2OZU A;  2JTV A;  2KIQ A;  5FO5 A;  1YIJ I;  3IH2 A;  2BY0 A;  2JN6 A;  3G4S I;  2X6Y A;  1XS9 A;  4MEX F;  2VIX A;  1BIA A;  2JRM A;  4M3D A;  3GFL A;  1P9Q C;  1ETO A;  1LNW A;  1R5G A;  1XDU A;  4RGS A;  3QPT A;  4ASN A;  2VKD A;  2XB5 A;  4MLO A;  4ZJZ A;  3JW4 A;  3WU2 C;  1QZE A;  2LKP A;  1W5T A;  3BJA A;  3A01 A;  4EM1 A;  1YW9 A;  2YS9 A;  2FMY A;  2VL8 A;  5HVQ C;  1ZLK A;  2CMP A;  1VZ0 A;  3DKX A;  3WE2 A;  1MSE C;  1BN5 A;  3K4M A;  4UV8 A;  3H3Z A;  3IKV A;  3E0J B;  2V26 A;  1V5E A;  4HV6 A;  1DPU A;  3HB9 A;  2FA5 A;  5HOO A;  3E3V A;  4UB8 C;  1T6S A;  5K1Y A;  1IJW C;  5FLV A;  2LRD A;  1ETQ A;  3ZGK A;  2EV5 A;  1USS A;  3I59 A;  4PJN A;  2ZNY A;  5DTD A;  2W84 A;  5D8L B;  1DU6 A;  2ZXW H;  5FD5 A;  1Y1V J;  3K4K A;  1FX7 A;  1MBG A;  3OSF A;  3BG6 A;  3HGY A;  4P96 A;  1J75 A;  1KU2 A;  2VKE A;  3IUO A;  3P7N A;  1KU7 A;  4BBS J;  2OC6 A;  5HLT A;  1K79 A;  5FFX A;  3AKZ A;  2BVL A;  1YHQ I;  3BG7 A;  3FDY A;  4J00 A;  3VOD A;  1X2M A;  5H6Q A;  2DU9 A;  2YR2 A;  2KPM A;  4HQM A;  3S3M A;  1OIS A;  4EGY A;  2DBB A;  2EIJ H;  2H8W A;  3LSI A;  4BY1 J;  3KEQ A;  4KIG A;  1WSU A;  2IGN A;  1HCR A;  4BAC A;  4B47 A;  2VI6 A;  4XLF A;  3T5X A;  4G9Y A;  3MCZ A;  3W2V A;  3M1E A;  2JSC A;  2XHK A;  2DPU A;  3VSK A;  1O3S A;  3LSR A;  5CVV A;  4IHW A;  3WTT C;  3HSF A;  2MW8 A;  4L5J A;  1IAW A;  2ESN A;  4UV9 A;  3F3X A;  3JRA A;  1FBU A;  4HG2 A;  2DXI A;  4AIK A;  3LAP A;  3KP3 A;  1RET A;  3P5J A;  3NWS A;  1UFM A;  1LEB A;  2BXY A;  2R7Z J;  1OCO H;  2XSD C;  3WTY C;  4CO8 A;  2LKX A;  4DZJ A;  4XBF A;  2QVO A;  4NQW A;  3WTV C;  1JKQ C;  4CSW A;  3K2A A;  2R7F A;  1JGS A;  5GTH C;  2LY2 A;  4CCM A;  5DDG A;  3I56 I;  1ZN2 A;  2E1M B;  3GX4 X;  2BHZ A;  2GXA A;  1MJB A;  3MWM A;  2DT7 B;  2Z2S B;  5FLX Z;  1SMT A;  2GQQ A;  2M1B A;  4PK4 A;  1YJN I;  1ETX A;  1HQC A;  2R5Z B;  1BJA A;  4Y7N J;  2GA1 A;  3RZO J;  3ZMV A;  2E35 A;  4A0Y A;  1B8I B;  4GDF A;  1LDJ A;  5KAF C;  2XB0 X;  3SDG A;  3BC8 A;  2R7U A;  4CA0 A;  2QQA A;  1YG2 A;  3CO7 C;  1SEU A;  5F1R A;  3OYG A;  3I4M J;  4G12 A;  5B1B H;  1RRJ A;  1SD6 A;  1R6R A;  3GW2 A;  5L3F A;  1JHF A;  1GV5 A;  1XGS A;  2D45 A;  4A0Z A;  3I9V 2;  2L4A A;  3KZY A;  3J81 Z;  4CYD A;  3PJR A;  2JVH A;  2ADU A;  1JJ6 C;  2MA3 A;  4F7Z A;  1EH7 A;  1Z6T A;  3LNQ A;  2UXX A;  3I53 A;  3M8F A;  4IHT A;  1HKQ A;  3BQY A;  3FMR A;  4IRI A;  1NK3 P;  4II3 A;  1JUP A;  2ESH A;  2HZD A;  2HS5 A;  4ZDO A;  1U2W A;  4MEY F;  1SFO J;  3JRI A;  4BEH A;  2L2O A;  1ZRE A;  3M3Y J;  1SAN A;  2VBY A;  2ZJ2 A;  2ZO4 A;  4LLL A;  2W1O A;  3JR9 A;  3M1C A;  1R4N B;  4ZYE A;  2WA0 A;  1OFC X;  4BL0 B;  1HKS A;  2DPD A;  4DJA A;  3AG1 H;  1GXQ A;  1ON2 A;  2D2W A;  3EUK L;  5HLH A;  2VE8 A;  1W36 C;  3KFW X;  5ILU A;  3C1D A;  1FYM A;  4IRH A;  4ZC3 A;  4MQ9 F;  1FOW A;  3F6O A;  5KHD A;  5K7F A;  4E7K A;  1U0J A;  4CYC A;  4N0B A;  2O5R A;  5EEG A;  3KYL A;  4QSH A;  2IAI A;  2Y9Y A;  1IF1 A;  1MDM B;  2GIZ A;  5GPC A;  5M5Y J;  1QBJ A;  2LNB A;  3FWE A;  4JK1 X;  1JJ8 C;  2CQ7 A;  2RV8 A;  1KYZ A;  1X3W B;  3DKW A;  2JZY A;  4JBA A;  5M3F J;  2K4B A;  4H0E A;  1LQ1 A;  5GPA A;  5CQG A;  2GWR A;  3DFG A;  2ZC2 A;  4Z6Y A;  3TBI A;  2ISY A;  2JA2 A;  3G1O A;  3AL0 B;  2ZSH B;  5CKT A;  4LG0 B;  4IQ4 A;  3ZQH A;  5K5O A;  2CFX A;  3HOS A;  5LD2 C;  4BE0 A;  3SZP A;  3VYU B;  5C44 J;  1XSD A;  1QHG A;  2HQN A;  3UR3 C;  5D5W B;  1B72 B;  1GV2 A;  1R1U A;  3ZQG A;  2V1U A;  4UUV A;  2BV6 A;  4MHG A;  4HPQ A;  4BJ5 C;  4RM3 A;  1POG A;  2HXI A;  5LRR A;  4Y17 A;  4V19 K;  2B63 J;  5FKO A;  5IP7 J;  2PMZ A;  1V55 H;  3KEO A;  1VQN I;  1WVR A;  1Z3X A;  2JA8 J;  3L2C A;  4JYK A;  1I1S A;  1UHS A;  3E5U A;  2LK2 A;  3E5X A;  2F5D A;  2WAQ N;  5D4R A;  4AIH A;  5FB2 A;  2Y48 A;  4P55 A;  5FRO A;  1DPR A;  4B48 A;  3TOA A;  5J8C A;  1YW7 A;  3DU5 A;  2DT6 A;  4AVP A;  1QU3 A;  3RKX A;  2R7T A;  3LQQ A;  1T0F A;  1UB9 A;  2WAQ A;  2KRC A;  4RAG A;  4OOI A;  1JUS A;  1XCB A;  5E3M A;  1D8K A;  3HSR A;  1FOY A;  3E7L A;  4GXO A;  3ROU A;  3ABM H;  5K7H A;  4CIC A;  2E1M C;  3RDI A;  1J0R A;  4B43 A;  2VBW A;  3MAJ A;  4A2U A;  3IH4 A;  1LE8 A;  4PZJ A;  2P7C B;  5FKK A;  2VXD A;  3B73 A;  3V7S A;  3LAJ A;  3BR1 A;  5CVI A;  1IG7 A;  4FX0 A;  4NC8 A;  4MQV A;  5CQE A;  3U2R A;  1WFX A;  1HW1 A;  2F4M B;  2KKO A;  4BE2 A;  2FF4 A;  2M9H A;  1O7F A;  3ZMU A;  3BCB A;  3QU6 A;  4HW0 A;  3OYH A;  2LBF B;  4OIO F;  2IGO A;  1BL0 A;  1UG0 A;  2LF8 A;  3J80 Z;  3CF5 F;  1IRZ A;  1FIP A;  5LHG A;  4XM3 A;  1YW8 A;  1NK2 P;  1ZK8 A;  4HBL A;  4LJZ F;  4MTD A;  1U5T B;  2VJ5 A;  3P9K A;  4M72 A;  1IDZ A;  2CV0 A;  4A93 J;  2GOM A;  2DOF A;  4KA4 A;  1OCR H;  2R3S A;  4XQF A;  2KDO A;  3CTA A;  5L3C A;  3CC7 I;  2UUZ A;  1BOA A;  4R1H A;  1XTA A;  2BOL A;  1R23 A;  2RGV A;  3MZ8 A;  5D8K B;  1X4O A;  2E1N A;  2VN2 A;  1SD5 A;  4HST A;  3H3V K;  1R1V A;  4ESJ A;  2PJP A;  1AHD P;  2X1D A;  1DDN A;  4C2U A;  4AYB A;  3LA3 A;  3CD6 I;  1MH3 A;  3JRD A;  4BE1 A;  2MC3 A;  3FM3 A;  2V1D A;  1TQI A;  3EQL F;  4N4N B;  4HX4 A;  2GIV A;  4ZH4 F;  4E7H A;  1D0X A;  2FQ4 A;  1A36 A;  1DP7 P;  1CF7 B;  4WXH A;  2DDB A;  4XOP A;  4CCO A;  1TWG J;  2CO5 A;  3PFI A;  4LIV A;  4I76 A;  2NVU B;  4I09 A;  5E3N A;  4A3M J;  3FKJ A;  3IAM 2;  4II2 A;  2MAB A;  3KLO A;  2DJI A;  1K78 B;  2R7W A;  1FYK A;  1UEL B;  4H4K C;  2Z99 A;  2GZW A;  2Y0M A;  3MZY A;  4B8X A;  3CCL I;  1FTZ A;  2G7U A;  3BLY A;  3DXJ F;  5EDN A;  2CQN A;  5LHH A;  1DGW Y;  4U0V A;  2X6X A;  4IKF A;  3RSN A;  2QKL B;  1IV6 A;  1CGP A;  2P5L C;  3DBL B;  2ZJR F;  1FMV A;  4C3I J;  3BZK A;  4MO7 A;  4ITV A;  4HZF A;  1O7L A;  1VFC A;  1IRF A;  1TWA J;  3G2B A;  3AL0 C;  3HXL A;  4RB3 C;  3R0J A;  3A4C A;  2M87 A;  2KJC A;  3DF8 A;  3VFZ A;  2VE9 A;  4XNF A;  1J5Y A;  3K1P A;  4IO9 F;  3EUA A;  4ZDL A;  3RPQ A;  5JFR A;  1TWC J;  4OIQ F;  1Z7U A;  4FET A;  2L7K A;  2X51 A;  3BR3 A;  5CVU A;  5FRM A;  4ENK A;  2DOA A;  4Q4Z F;  1S3J A;  4IEJ A;  3GTG J;  5C4X J;  3C2H A;  4G7O F;  3CUQ A;  4EMS A;  1FY7 A;  1P7J A;  1G3T A;  2IW5 A;  3M9A A;  4LK0 F;  4GYG A;  3F8N A;  2VAS A;  1APL C;  1H89 C;  1LDK B;  1RC9 A;  4G7Z F;  2VQC A;  3ABL H;  1B1B A;  3OYA A;  1MDM A;  1SVM A;  4A3G J;  4L9J A;  2W57 A;  2K5C A;  1V54 H;  3L2U A;  4YEL A;  3W2A A;  4NC7 A;  1T98 A;  4X6A J;  2JPB A;  2V9V A;  5EG0 B;  2DMP A;  2IA1 A;  1TTY A;  4XL9 A;  4DBQ A;  2O61 A;  2HGC A;  2WAD A;  4LG0 A;  3BJ6 A;  1K7A A;  2RRE A;  1QVT A;  1HBX G;  2DA7 A;  1Q1V A;  2QEX I;  4HX8 A;  3HL2 A;  1R58 A;  3CJR B;  4PSX A;  1B72 A;  3ZMS A;  1EJ9 A;  3F23 A;  4EM2 A;  1ZRD A;  3ABT A;  1WRJ A;  5A2Q Z;  4A3J J;  1OCP A;  2OJE D;  1D1B A;  3GYH X;  4GCV A;  4RDU A;  1IN6 A;  2HYG D;  5E79 C;  2F6C A;  3T1B A;  1PDN C;  1STZ A;  4BUP A;  1FYL A;  1GXP A;  1OR7 C;  1YFH A;  3ZMZ A;  4XLH A;  1E0E A;  5J47 A;  3O2P E;  5JHU A;  2Q1Z B;  2MLG A;  3BT9 A;  3M8J A;  4A3F J;  1U6G A;  3QP5 A;  4HF1 A;  1KYW A;  2WY8 Q;  4HX7 A;  2ICW G;  5TJJ A;  1X3U A;  4M3F A;  3U1K A;  3O8H A;  4R79 A;  4RS8 A;  5ICE A;  3LQR A;  3CJQ B;  2YU9 J;  4BHB A;  2DA6 A;  1OLT A; 
#chains in the Genus database with same CATH homology
 2JK3 A;  2CUE A;  4JX4 A;  4M3B A;  1RKT A;  3IH2 A;  4V2F A;  2JN6 A;  2R5Z A;  1XS9 A;  4DYQ A;  2DMQ A;  4IHY A;  2HOS A;  3LSP A;  4FE4 A;  1JKO C;  5IYB J;  4M3D A;  3HOV J;  1B8I A;  1QVU A;  2HOA A;  2MSY A;  2TCT A;  2LVS A;  2EBI A;  1LFU P;  1ETO A;  3JRF A;  1JTY A;  2XB5 A;  1MBK A;  4MLO A;  4D5C A;  5EGO A;  2JJ7 A;  3A01 A;  1UMQ A;  5J1Y A;  2YS9 A;  2DA4 A;  4XRS G;  1A6I A;  4W97 A;  4A69 C;  4BXX J;  2DA3 A;  1MSE C;  2K9Q A;  3D1N I;  1Z77 A;  4M3G A;  2X9D A;  3HB9 A;  2M8G X;  2TRT A;  1ENH A;  1IJW C;  3O8G A;  5FLV A;  1ETQ A;  1GUU A;  3S14 J;  2EQR A;  1TWF J;  5DTD A;  1VND A;  1DU6 A;  1ORK A;  1IUF A;  2FX0 A;  1Y1V J;  1MH4 A;  2R92 J;  1MBG A;  3OSF A;  3HGY A;  1WH7 A;  3SJM A;  5J1U A;  5EYR A;  2VKE A;  5DS9 A;  5F04 A;  4FCY A;  4BBS J;  3GTM J;  1ETY A;  2HDD A;  2GM4 A;  5E3L A;  4UUS A;  3A02 A;  3S15 J;  1OCT C;  3BG9 A;  1X2M A;  2JA5 J;  1O4X A;  1WGX A;  5IYC J;  1UG2 A;  2QCO A;  1A5J A;  4BY1 J;  1HCR A;  3OIO A;  3RKQ A;  2VI6 A;  3FK6 A;  5FKL A;  3Q0V A;  2EZH A;  1WH5 A;  3JRB A;  4BKX A;  2M34 A;  3LSR A;  4IHW A;  4LOC A;  5F0C A;  2MW8 A;  2L0K A;  1K83 J;  1ZGW A;  3JRA A;  1ZR2 A;  4X1E A;  1RET A;  2O8K A;  2NVY J;  3HOU J;  1JKP C;  4C3H J;  2XSD C;  2R7Z J;  3S1R J;  2L9R A;  3GTQ J;  2LKX A;  3UKG A;  4DZJ A;  5EZH A;  3TW7 A;  5C3E J;  1JKQ C;  5JLX A;  4MFE A;  3C2B A;  3K2A A;  2H8R A;  1YRN B;  5F0F A;  1JKR C;  3G1M A;  1GT0 C;  5EF6 A;  1ETX A;  2DN0 A;  1U9O A;  3WHB A;  2R5Z B;  4A3K J;  4Y7N J;  3GTO J;  3JRH A;  3RZO J;  1WPK A;  1B8I B;  1FEX A;  3HOY J;  2XB0 X;  1FTT A;  3SDG A;  1HOM A;  2EH3 A;  2KT0 A;  2LFB A;  1E3O C;  3RQI A;  2O7O A;  5IOZ A;  3LOC A;  3I4M J;  2NS8 A;  2EZI A;  4G12 A;  3ZOB A;  4B4C A;  1AKH A;  3MN2 A;  1GV5 A;  1QRY A;  1JT0 A;  4DZP A;  2CQQ A;  2K40 A;  9ANT A;  3IV5 A;  2DA2 A;  3VPR A;  2DA5 A;  2E2I J;  3QQA A;  2AHQ A;  1JJ6 C;  1MBE A;  1RPW A;  1K61 A;  2JA6 J;  4MFD A;  3S1N J;  4NDL A;  3ZQF A;  3LNQ A;  3BQY A;  1MBF A;  2JWT A;  3CDL A;  4DYR A;  3HBL A;  1NK3 P;  5EG0 A;  3JRC A;  1JUP A;  2Y30 A;  4M6V A;  5M3M J;  4A3I J;  3GTJ J;  4FTH A;  1IGN A;  1SFO J;  3JRI A;  2ID3 A;  2Y2Z A;  5FKN A;  2IEK A;  2XGE A;  1PUF B;  3M3Y J;  4XID A;  1SAN A;  1T33 A;  2N8G A;  5FJ8 J;  4HNV A;  1OJL A;  3B6C A;  5EEA A;  2HXO A;  3JR9 A;  4J19 A;  4A3B J;  4UUS B;  2R5Y A;  1OFC X;  1JGG A;  2ZB9 A;  2M0C A;  4QIW N;  1RR7 A;  3DEW A;  4FIS A;  2LR8 A;  4QTR A;  1ZQ3 P;  5IYD J;  1X2N A;  3BR6 A;  1U9N A;  1JUM A;  3PO2 J;  2E2H J;  3B6A A;  3JRG A;  5K7F A;  2JMW A;  4CYC A;  1I6H J;  3Q0W A;  4XRS A;  4QSH A;  2IAI A;  2ID6 A;  2Y9Y A;  5HOD A;  1WCM J;  2VUM J;  5GPC A;  5M5Y J;  1JJ8 C;  3LSJ A;  3GTK J;  2LP0 A;  5M3F J;  3S1Q J;  2MG4 A;  1BA5 A;  2O9L A;  4B1R A;  5EZG A;  5GPA A;  2OPT A;  3HKZ N;  3G1O A;  3HM5 A;  2K9S A;  1H8A C;  2K9N A;  2L7M P;  2XGC A;  3QPS A;  1XG1 A;  3ZQH A;  5FKM A;  3TW6 A;  2GBY A;  5C44 J;  3MKL A;  1JT6 A;  3A03 A;  3BQZ A;  4L5E A;  3BR5 A;  3GBG A;  1B72 B;  1GV2 A;  4Y52 J;  3HOX J;  3ZQG A;  1ETK A;  2AO9 A;  2LTP A;  1POG A;  4DYC A;  5E3O A;  1GDT A;  2H1K A;  5F1J A;  2HXI A;  3CQZ J;  2HOT A;  2EZK A;  1IC8 A;  1Y1W J;  2B63 J;  5FKO A;  5IP7 J;  3TP3 A;  3JRE A;  5K7Z A;  1W0U A;  4ABZ A;  2R93 J;  2CJJ A;  3HDD A;  2JA8 J;  4JYK A;  1UHS A;  2LK2 A;  1U8B A;  2WAQ N;  2JA7 J;  3PO3 J;  2G0E A;  4XK4 A;  1AKH B;  3DCF A;  1BW5 A;  1X58 A;  4AC0 A;  2FJ1 A;  1XC5 A;  2P81 A;  2ME0 A;  2X48 A;  1CQT A;  1HDD C;  3BR0 A;  2W48 A;  3HGG A;  1JUS A;  2XPU A;  4V2G A;  4C2M J;  1ZTR A;  5E3M A;  3E7L A;  1VI0 A;  2ELK A;  2HYJ A;  2ECB A;  5K7H A;  3S1M J;  1TC3 C;  1D5Y A;  3F0C A;  3GTP J;  1P7I A;  1MBH A;  1F36 A;  5EGO B;  3OSG A;  3H0G J;  3A01 B;  1I3Q J;  3IH4 A;  4RBO A;  2Y9Z A;  3WHC A;  1LE8 A;  2DA1 A;  5FKK A;  5C4J J;  1GVD A;  2R5Y B;  3BR1 A;  4D7M A;  1IG7 A;  2X6O A;  2LD5 A;  4MIM A;  3ZQI A;  1RKW A;  1EF4 A;  2HQ5 A;  2M9H A;  1FIA A;  3S2H J;  5J1R A;  2D5V A;  1BL0 A;  1IRZ A;  1FIP A;  3BR2 A;  1ZK8 A;  5GP9 A;  1NK2 P;  3Q0U A;  2E1O A;  4JP0 A;  1DU0 A;  1YRN A;  1IDZ A;  1HLV A;  4A93 J;  2E19 A;  1MBJ A;  3BG5 A;  4M3E A;  3NAU A;  3L1P A;  5IOY A;  4JX6 A;  1TWH J;  4FE7 A;  2CUF A;  3S16 J;  5IPA A;  1MNM C;  3I4N J;  4BBR J;  1BW6 A;  2NS7 A;  3H3V K;  1T56 A;  4GFB A;  3BTL A;  1AHD P;  3HOZ J;  1ZR4 A;  2M2E A;  4IHX A;  3BTJ A;  1MH3 A;  2ECC A;  1VF9 A;  3JRD A;  2IBD A;  4I6Z A;  1G2H A;  4C3J J;  2FQ4 A;  2YUS A;  1ETW A;  5JLW A;  3ZQL A;  1TWG J;  2WB1 N;  3LSG A;  4A3D J;  4A3L J;  4I76 A;  5E3N A;  2OF7 A;  4A3M J;  3GTL J;  1ETV A;  4BY7 J;  1I50 J;  4D7N A;  3QPL A;  2XRL A;  3M4O J;  1IDY A;  4AUX A;  5F08 A;  1FTZ A;  5EDN A;  2Y0S N;  4B3A A;  3NAR A;  2Y31 A;  3FIS A;  1Z0X A;  3G1L A;  2PMZ N;  1IV6 A;  2L7Z A;  2E2J J;  4IHV A;  2CQX A;  3BTC A;  1PUF A;  4C3I J;  4A3E J;  2XPW A;  5M5X J;  4MO7 A;  2FD5 A;  2DMU A;  4EEF G;  3SFI A;  1TWA J;  1VFC A;  2L7F P;  2LY9 A;  2NVX J;  1U78 A;  2QF7 A;  5M5W J;  3CCY A;  2EZL A;  3HEF A;  3K7A J;  3CMY A;  1FJL A;  2CU7 A;  1BJZ A;  1TWC J;  3W6V A;  2I10 A;  1JTX A;  3BR3 A;  3RZD J;  1LE8 B;  2DJN A;  2WV1 A;  3GTG J;  4IEJ A;  2COB A;  5C4X J;  2R0Q C;  1HF0 A;  4UUT A;  5IP9 J;  1P7J A;  1W0T A;  1APL C;  2MGQ A;  1H89 C;  2DMN A;  3PM1 A;  3S17 J;  3S2D J;  4A3G J;  2LLK A;  5FLM J;  2VPR A;  2VKV A;  5J3L A;  4X6A J;  5EG0 B;  2DMP A;  3FK7 A;  4JX5 A;  2KDZ A;  3FIW A;  2ME6 A;  1QVT A;  2RAE A;  1AU7 A;  2DA7 A;  1Q1V A;  4A3C J;  5IP6 A;  1MSF C;  2GLO A;  1HDP A;  1B72 A;  3BG3 A;  3TED A;  1NTC A;  3FKI J;  3IH3 A;  1RES A;  2NVT J;  3MVP A;  5F27 A;  4A3J J;  1OCP A;  1WI3 A;  4D5F A;  5BNG A;  4RDU A;  2DMT A;  2XGD A;  1ITY A;  4S0H B;  1H88 C;  3Q3S A;  1F43 A;  5F0H A;  4W1U A;  1S7E A;  4DW6 A;  1R9T J;  1LFB A;  1ZKG A;  2DTZ A;  3ZQC A;  3BT9 A;  3TP0 A;  4A3F J;  1QPI A;  2CRG A;  2XPV A;  2NOG A;  4CYC B;  3OOU A;  3HOW J;  3BTI A;  4M3F A;  3O8H A;  4XIC A;  2NVQ J;  2YU9 J;  2DA6 A;  2HI3 A;  4AYB N;  4XRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...