3OOUA

The structure of a protein with unkown function from listeria innocua
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
105
structure length
105
Chain Sequence
SPIIQNVLSYITEHFSEGMSLKTLGNDFHINAVYLGQLFQKEMGEHFTDYLNRYRVNYAKEELLQTKDNLTIIAGKSGYTDMAYFYRQFKKHTGETPNRYRKIHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a protein with unkown function from Listeria innocua
rcsb
source organism Listeria innocua
molecule tags Structural genomics, unknown function
molecule keywords Lin2118 protein
total genus 38
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12833 HTH_18 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3oouA01
1.10.10.2730 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oouA02
2D5VA 4UUSA 5FLMJ 2ZB9A 3S1RJ 3SDGA 2RAEA 3CMYA 3CCYA 2LK2A 2JMWA 1A5JA 4IHWA 3G1MA 3ZQHA 3ZQFA 2NVTJ 5EZHA 2WB1N 3SJMA 4DZJA 1JTXA 1WCMJ 2DA5A 3BG5A 3OOUA 3MN2A 4CYCB 3GTKJ 4V2FA 2VKVA 2GM4A 2HQ5A 3E7LA 1JGGA 1YRNB 5JLXA 1PUFB 5IOYA 4A69C 3C2BA 2EBIA 3BR2A 3A01A 1LFBA 3Q0UA 1MBGA 3IH2A 2LFBA 2FX0A 2ID3A 2K9SA 2CRGA 2NVXJ 2VKEA 3LNQA 1IGNA 2E2JJ 3NAUA 2DMQA 1ENHA 2NS8A 4MO7A 2E19A 1K61A 1X2MA 2HOTA 4UUSB 3S16J 3JRDA 2JA8J 5C4JJ 1WPKA 4BY7J 1MSEC 1JKPC 5C3EJ 4M3GA 2K9NA 1IJWC 1QRYA 3S1NJ 4W1UA 1TWGJ 1MSFC 1VNDA 2ECBA 2H8RA 2M2EA 3GTOJ 1MBFA 2WAQN 2Y9ZA 1ZQ3P 4G12A 3SFIA 3HOXJ 4X1EA 4A3LJ 2LTPA 3I4NJ 1JUMA 3BTCA 1IUFA 3OIOA 1TWAJ 2X48A 2XB0X 3S15J 4XICA 1R9TJ 2DA6A 4XRSG 2DA4A 5IYDJ 4JX4A 2GLOA 1SANA 5FKOA 1F43A 2ECCA 2HOAA 1AHDP 1FTTA 2R5YB 1X2NA 3G1OA 5DS9A 3PO2J 2GBYA 4M3FA 1NK2P 1BA5A 2R0QC 1LE8A 5M5XJ 1XS9A 1SFOJ 4D5FA 3NARA 5C4XJ 1RETA 4AUXA 2IEKA 2R5YA 5FKNA 3GTQJ 5F0FA 3BR0A 3JREA 1OFCX 4UUTA 2M34A 3MKLA 2L7MP 2EZKA 3IV5A 4W97A 1F36A 2WV1A 3GTMJ 2CU7A 3HOWJ 2LKXA 3O8GA 1HCRA 5F0CA 1B8IB 3S1MJ 2OF7A 2W48A 2ME6A 5EGOB 3BTLA 3TEDA 2E2HJ 3LSJA 1FEXA 2AO9A 5E3OA 3HKZN 1TWFJ 1GV2A 2EH3A 2K9QA 3HGYA 5C44J 2TRTA 4L5EA 4B4CA 1ZTRA 2OPTA 1MBKA 1U9NA 4HNVA 1IDZA 2XPVA 4AYBN 1ORKA 2LP0A 1HOMA 1ETKA 2VPRA 2Y9YA 4MFDA 1IC8A 3PM1A 4A3FJ 2QCOA 2LR8A 4A3KJ 5FLVA 2VI6A 4QTRA 5IOZA 4QSHA 2FJ1A 2XGCA 2O8KA 2JWTA 2DMPA 2DTZA 2NS7A 3VPRA 1IRZA 2EZHA 2KDZA 2PMZN 1A6IA 2YU9J 3D1NI 1K83J 3MVPA 1W0UA 2LY9A 1CQTA 2LVSA 2M9HA 4A3BJ 4X6AJ 3B6AA 2QF7A 4B1RA 4A93J 2KT0A 1OCPA 1ZGWA 4FE4A 1JKQC 2O9LA 2NOGA 3G1LA 2CUFA 2JA5J 1XG1A 1NTCA 1ETYA 4JYKA 1P7JA 3ZQIA 5JLWA 5F04A 5E3MA 3DEWA 5IP6A 2XPWA 2YS9A 1ETQA 4C3HJ 4A3DJ 4MFEA 1WH5A 2G0EA 4C2MJ 1FTZA 2L7FP 1ZR2A 1JT6A 5F08A 2HYJA 1MBEA 2DA3A 4BKXA 2ID6A 1GV5A 3ZQCA 4J19A 1JJ8C 1VFCA 4BBSJ 3GBGA 1RR7A 3ZOBA 1Z0XA 2R5ZB 4Y52J 2MW8A 3K2AA 3LSRA 1YRNA 1B8IA 4I6ZA 2DJNA 3F0CA 1Y1WJ 1OCTC 5GPCA 2DMTA 4DW6A 1U78A 2XRLA 1AU7A 1E3OC 5GP9A 1IG7A 4Y7NJ 5DTDA 4MLOA 3HBLA 5EDNA 3ZQLA 4DZPA 2Y0SN 1D5YA 4A3GJ 2L7ZA 4A3EJ 1B72A 3H0GJ 2X6OA 1NK3P 2CJJA 1IDYA 1MBHA 2E1OA 2COBA 3GTLJ 1MBJA 3QPSA 1T56A 1TWHJ 1UHSA 2XGEA 3UKGA 5M3MJ 1GUUA 2XGDA 3PO3J 5K7ZA 4FISA 3HM5A 2DA2A 1EF4A 2XPUA 4B3AA 5M5YJ 1I3QJ 2ELKA 5K7FA 2YUSA 2DA7A 1FIPA 5IYBJ 3ZQGA 3BR1A 4XRMA 1QPIA 3LSGA 1HDDC 4D5CA 5EZGA 3M4OJ 3Q3SA 2M0CA 3HOYJ 3TP0A 3CQZJ 4QIWN 3BG3A 3HOZJ 3JRFA 4IHVA 4D7MA 2XB5A 3BTIA 1GVDA 1S7EA 4C3JJ 4BBRJ 2B63J 4DYCA 1ZR4A 5F27A 1BW5A 1B72B 3HDDA 3W6VA 1UG2A 1T33A 1ETWA 3DCFA 1H8AC 3BQZA 1LE8B 1WH7A 1BJZA 5EF6A 4FTHA 2P81A 3S14J 1QVUA 3FISA 1JTYA 3JRGA 5M5WJ 3BT9A 4A3JJ 3JRHA 4BY1J 2IAIA 2MGQA 1FIAA 4GFBA 3S1QJ 4BXXJ 4NDLA 5F1JA 4MIMA 3K7AJ 3RZDJ 4XK4A 1XC5A 3HGGA 2JJ7A 4DYRA 2MSYA 4S0HB 2IBDA 2ME0A 4XRSA 1JKOC 2HXIA 5IPAA 4D7NA 1RPWA 3BQYA 1Q1VA 4I76A 1DU0A 2JA6J 1APLC 5HODA 1POGA 1JUPA 1JT0A 2O7OA 5EG0B 3LSPA 1Y1VJ 5BNGA 3B6CA 4AC0A 1U8BA 3GTGJ 4M3DA 3IH4A 2FD5A 2H1KA 1VI0A 1MNMC 3JRAA 4EEFG 2I10A 3WHBA 1BW6A 1I50J 4ABZA 4FCYA 5EEAA 4M6VA 2HDDA 1RESA 3TW6A 3CDLA 1ETOA 3RKQA 5J1YA 4IEJA 3S17J 2R5ZA 4A3CJ 5J3LA 4IHXA 2EZIA 3A02A 1TWCJ 2FQ4A 3QQAA 1FJLA 2R7ZJ 1WI3A 3HB9A 3JRBA 1JJ6C 4CYCA 2X9DA 1ZK8A 4RDUA 2DMNA 1OJLA 2M8GX 5E3NA 1HLVA 2VUMJ 3BG9A 5EGOA 1X58A 3HOUJ 1HF0A 4A3MJ 1RKWA 1WGXA 2Y30A 4IHYA 4JX6A 2DN0A 5F0HA 2JK3A 2Y2ZA 2XSDC 1AKHB 1DU6A 3WHCA 2K40A 1VF9A 1MH4A 1ETXA 4LOCA 3TW7A 2HXOA 2DMUA 4M3EA 1TC3C 5FJ8J 2DA1A 2R92J 1W0TA 3I4MJ 3M3YJ 1AKHA 1UMQA 1HDPA 1Z77A 2CQQA 5GPAA 2HI3A 3A03A 1ZKGA 4FE7A 3S2DJ 3Q0WA 1GDTA 3FK6A 3BR6A 5IYCJ 4A3IJ 3LOCA 2N8GA 1IV6A 3GTPJ 3HEFA 1ITYA 3OSGA 3FKIJ 4RBOA 3RQIA 1O4XA 1MH3A 5IP7J 5M3FJ 2R93J 5EYRA 3BTJA 5J1RA 1GT0C 1LFUP 5FKLA 2LD5A 3FK7A 4JX5A 5E3LA 2MG4A 3Q0VA 1I6HJ 2JN6A 3GTJJ 3OSFA 2JA7J 1H89C 3BR3A 2EQRA 3O8HA 1JUSA 1BL0A 5FKKA 2L0KA 3HOVJ 4JP0A 2NVYJ 5IP9J 4DYQA 2LLKA 3RZOJ 2HOSA 3IH3A 1ETVA 2CUEA 1JKRC 5FKMA 2EZLA 2Y31A 3TP3A 3JRCA 2CQXA 1PUFA 4V2GA 3A01B 3S2HJ 3JR9A 3FIWA 1G2HA 4XIDA 4M3BA 2L9RA 2NVQJ 3H3VK 1P7IA 5K7HA 3JRIA 2AHQA 1QVTA 5EG0A 3BR5A 2E2IJ 4C3IJ 9ANTA 1H88C 1U9OA 3QPLA 1RKTA 2TCTA 3L1PA 5J1UA
chains in the Genus database with same CATH superfamily
3HHHA 4ESFA 2FUG2 1LUJB 4RAFA 3CESA 4ENMA 2JUCA 1WHUA 4A2UA 3S1RJ 3PIOF 3CMYA 5GAHJ 3FF5A 2LK2A 1A5JA 1OR7C 2VKHA 3WGIA 4YEJA 2Y75A 3ZQFA 1U0JA 2VJ4A 3KEOA 5KVRA 5LHGA 3I71A 1K7AA 3F8FA 4PGHA 4V2FA 2VJ5A 4Y13A 3GWZA 3MKWB 2GM4A 2VJJA 3KP2A 4XKCA 4D0PA 1YRNB 5JLXA 2IA0A 2P5KA 3A4CA 4RAGA 2P6SA 2EBIA 2RGVA 1O7FA 3BR2A 3EUHC 5FROA 4LFUA 2RC4A 2CUZA 3Q0UA 1QHGA 2L3DA 1XSVA 3IH2A 3L2WA 2ID3A 3C18A 1G3TA 1Z3YA 3E3VA 3LNQA 2E2JJ 3DKYA 4CO8A 5CQEA 2BYVE 1RIOH 1OLTA 4MQVA 4MO7A 4E4HA 3SYTA 2HOTA 3ABKH 2EV6A 4GYIA 4UUSB 3S16J 4MEXF 1VQ6I 3FMQA 4I7HA 3J81K 2JA8J 1R58A 1WPKA 4BY7J 2OAZA 1D3YA 1NG7A 1JKPC 1SVMA 3OOPA 5HLGA 2Z9OA 1IJWC 2OTLI 2VC0A 1ZELA 1T95A 3G4SI 3T0YA 2FMYA 5EEGA 1G6NA 2M2EA 1V5GA 3HOXJ 1G3WA 5CVJA 3CO6C 2H27A 4C2TA 4XM3A 3KFWX 4KITB 4A3LJ 2WAEA 1RRJA 4G7OF 2IA2A 4KDPA 1IF1A 1FYLA 1VZ0A 1Z21A 3ZQ7A 1TLHB 3ZPLA 5ICCA 3QP5A 5LEKA 4XICA 4EGZA 2QGUA 5ICGA 2HZDA 1TP4A 2IJLA 3V8JA 4JX4A 4S04A 2I5UA 3QODA 3FXKA 3OL4A 3MZHA 3W6KB 4KN7X 2Q8KA 3B02A 3M1CA 2KRFA 3K4BA 2R7WA 4J00A 3G1OA 3NWSA 5BPDA 4UVBA 2PFBA 2V1NA 3SZTA 1XS9A 3A0HC 5C4XJ 5E17F 1MDMA 2IEKA 2X6YA 5E20A 2KHMA 2R5YA 3IKVA 5FKNA 3JREA 2NAZA 2XSJC 1S72I 2M34A 3MKLA 2K02A 1Z9CA 1U5TA 1SD5A 1F36A 4HX8A 1K6YA 5F6FA 2GXAA 3S3OA 1S7AA 1Y39A 3DQVC 3HOWJ 1MIJA 4L5IA 3Q5FA 3O8GA 4PZJA 4IRIA 3BZCA 3OWTA 1HCRA 4DQ2A 2ME6A 1PUEE 5J40A 5EGOB 4CCOA 5GTHC 3LSJA 1W5TA 1Z67A 1TWFJ 1W36D 4IOAF 2WWYA 1AWCA 2OQGA 3ELKA 2R7UA 2TRTA 2W25A 2OPTA 1T38A 3LFKA 5AONA 2MABA 3I55I 2QSGX 4RGUA 2DCEA 3BOQA 5J8FA 2PJPA 2UV1A 3D5RC 4IQJA 1XGOA 4EMSA 2DT6A 4MFDA 2LR8A 1ZARA 2HKXA 2BGCA 4HF1A 2JVGA 2UUZA 3R6SA 5K5RA 4N0BA 3V42A 3CUQA 2P6TA 3RPUA 3I9V2 2FJ1A 2O8KA 3TOAA 4BQQA 1AOYA 1W36C 2LY2A 4UB6C 2NS7A 3CTAA 4HLYA 3O6BB 2KDZA 1UHWA 3D1NI 2DK8A 1QPMA 3MVPA 3IAM2 2DODA 3KP7A 1EJ9A 1IAWA 3QOPA 5J4YA 4X6AJ 3GFJA 4E7LA 2EILH 4B1RA 5E79C 2ZKZA 4A93J 3L7WA 2KT0A 4HZFA 1OKRA 3B73A 3K1PA 1FZPB 1JKQC 4PK4A 2CUFA 4IO9F 2JA5J 5HLIA 2A6HF 1HW1A 3DTIA 3MFKA 2M4GA 2D1HA 4Y3OA 1P6RA 2HKOA 3ZQIA 1IV8A 5JLWA 3CCRI 2E60A 2COMA 2OCCH 2BW3B 1YOVB 3OR1C 4RS8A 2XPWA 5GTIC 2V9KA 3IWZA 3RI4A 4BS9A 4B43A 1WH5A 2LF7A 4L9NA 4ZTFA 1HW5A 4C2MJ 4OIQF 2GXBA 4HX4A 5TGTA 1Y6IA 3A2KA 5F08A 5ICEA 1LJ9A 1PP7U 3WTTC 1XDSA 3ZQCA 5AIQA 2E1NA 1JJ8C 2F5DA 3GUDA 5JFRA 1YO5C 3DU6A 2KL4A 2FOKA 1Z0XA 2R5ZB 3K1NA 3LA3A 1IN8A 1CF7B 2UXNA 1W1WE 2G9WA 2FBKA 2JSPA 3HYIA 2PMZA 4DW6A 4Z6YA 2ZCWA 4GO1A 4UNOA 2L9VA 5GP9A 1IG7A 1SMTA 2FE3A 2CQ7A 3FMSA 2CV2A 3A1YA 5DTDA 4Y7NJ 2HVRA 3N05A 4BDZA 2A3SA 5KAFC 2V9VA 2R7SA 3JCUC 5ERIA 2AQFA 3A0BC 2E5NA 5D5XB 4XQFA 2NVUB 1D5YA 4A3GJ 3RJPA 1B72A 2X6OA 3V4GA 2PJRB 1XB4A 4XLHA 3IL2A 1O57A 2WBMA 3CJTB 1E17A 5L3EA 1R4MB 2KZGA 3GTLJ 2BY0A 1T56A 1TWHJ 3C1DA 4YIFA 4I09A 1YFHA 2MLGA 3H9JA 5BQTA 2HVQA 3PO3J 1NH3A 2Q0OA 5DCMA 1RUNA 3ZN1A 3BY6A 4B3AA 5M5YJ 2DOFA 1FX7A 2E71A 2QWWA 3FKJA 4G7ZF 2X1EA 3CCVI 3KETA 4LLNA 3P9KA 2K5CA 3BP8A 1MMGA 2GZWA 5IYBJ 2KQRA 1R5HA 3DLLF 4XRMA 2R7QA 2LNBA 4DNCA 4D5CA 5EZGA 4HX7A 3Q3SA 4PJ0C 3CQZJ 3BPVA 3Q9VA 2VQHA 3TGNA 1AA7A 2HWVA 2CFXA 4PJNA 1DUXC 2XF6A 3PQJA 1Z6RA 1BW5A 1XSDA 3W6VA 2EIMH 3DCFA 4KIGA 2K4JA 3BQZA 3CCLI 4IZZA 3DTEA 2OZUA 3LL7A 4UVAA 2V7FA 2IGKA 1M1EB 3F22A 5ILVA 2P81A 1MGTA 1MMDA 1QVUA 3JRGA 5M5WJ 3ZRGA 4PJLA 4BY1J 2IAIA 1QHHD 1V5FA 1FIAA 3S1QJ 2MLKA 1IXCA 2VJIA 3FXRA 5E18F 4KJZA 3L2VA 3K7AJ 3RZDJ 1TTYA 2F4IA 1ZRFA 1HKQA 5DCMB 1X4OA 2HXIA 1G59A 5IPAA 4ZZLA 3BQYA 1Q1VA 4DBQA 1IRFA 2OBPA 2VE9A 1POGA 4M3DA 2VOOA 4LMYA 1SVLA 2JPCA 4AIDA 2KIUA 2P7CB 3JAMK 3JRAA 2I10A 3KP6A 1QZZA 3WHBA 4KFCA 5IT9Z 2XAJA 4Q47A 5D6EA 1OCZH 1PDNC 2O0YA 4M6VA 3RKQA 2IS2A 1R00A 3I3LA 2EZIA 2R7VA 2R7ZJ 1FJLA 3HB9A 2LH9A 1VQMI 2HGCA 3I59B 4I99C 5LHIA 2A6EF 1X4PA 1VQPI 2M8GX 2W1OA 2PG4A 2HZTA 5CQGA 3SEQA 2EWNA 1XMKA 3FXOA 1TW3A 2ZFUA 4XOTA 3HOUJ 1HF0A 4B48A 2FNAA 1V4RA 4A3MJ 1RKWA 1XTAA 1FMVA 4JX6A 2DN0A 4EVIA 4IKFA 3FWEA 1DU6A 4Y4RA 2K40A 4EJWA 1MH4A 2ZSIB 3BJ6A 3J7ZI 2ZXIA 2ISZA 2HDCA 4M6YA 1MNEA 4O6JA 4AM3A 2CW8A 3GZ5A 1W0TA 1RNLA 1B4AA 2VASA 1UMQA 4XLFA 1Z77A 3M3YJ 1QQIA 1YLFA 2EV5A 4BAYA 4R8HA 1L3LA 3DWLE 3Q0WA 3WE2A 3OYMA 2JQ7A 5H2FC 1FPQA 5LRSA 1YW7A 1JGSA 5IYCJ 3K4CA 3GZNB 5LRRA 4E70A 4PSWA 2HVSA 1EH7A 3M9AA 4GDFA 2AS5F 1HA8A 1S9HA 4NB5A 5B1BH 3GTPJ 3HEFA 2GIVA 1H9GA 2F5VA 2EA4A 2X1DA 3FKIJ 5GAGJ 4GXOA 3VEPA 5A2QK 1E3HA 2R93J 2VC1A 3BTJA 5DUIA 2X0LA 1LFUP 5FKLA 2V1DA 3FK7A 4I0AA 1TL8A 2K27A 5E3LA 2DBBA 2MG4A 2JN6A 1VQ5I 4Q4ZF 2VB6A 2OC6A 4I02A 1H89C 3BR3A 3HOVJ 1BL0A 3BWGA 3KPHA 3ABUA 4DYQA 3GLXA 4BQOA 2HOSA 2PJRA 3RZOJ 5LFAA 2CUEA 4LJZF 1JKRC 3BLYA 5E1ZB 1BBYA 1W5SA 4AU7A 5CJ9A 4NQWA 2CQXA 3E6BA 3A01B 1X19A 1Z7LA 5DCFA 3JR9A 1FOXA 1G2HA 3KCCA 3OYJA 1KU7A 2ZJ2A 1J2XA 3K4JA 1P7IA 2DW4A 3JRIA 1JE8A 1FLIA 1QVTA 4BU2A 5EG0A 1YJWI 2E2IJ 3R60A 4C3IJ 9ANTA 3VSLA 2IGNA 5LLQA 1BR4A 2TCTA 3M8EA 3L1PA 4HSRA 3N97A 1UAAA 2BVLA 1I3AA 4KIBA 2R3SA 3OL3A 2BW3A 1JHFA 3BCBA 2RAEA 1XX5A 4MTDA 3PFIA 2ELHA 4LB5A 2JMWA 2JZYA 4N4NB 2V26A 2Z16A 2NVTJ 1F1ZA 1MD0A 3S32A 5J47A 5HS8A 2ZXWH 3KP3A 4EJTA 1P92A 1IN7A 3MN2A 4CYCB 4N9IA 1K79A 4BHCA 1XPXA 4WXCA 1JGGA 4JBAA 4CH7A 1U5TB 1YX3A 2QKLB 4Y15A 3A01A 3FX3A 5CVIA 1MBGA 3BG7A 4AWXB 4BGDA 2JUGA 1FP2A 4L9VA 2NVXJ 2VKEA 1LFPA 4BE1A 2JRTA 4E7JA 2VPLA 2DMQA 3WTVC 4XNFA 1TT5B 6PAXA 3HOSA 1J5YA 1YS7A 3JRDA 1OR7A 2L2OA 2UZKA 3CLQA 4XN3A 4GYGA 4AIKA 3LSMA 3HC7A 2IRFG 1MSEC 1N75A 1UFMA 1D1AA 5CVVA 3OS1A 3CCEI 4B8XA 2QSHX 2KPMA 3S1NJ 1TWGJ 1VNDA 4BHBA 2NXNB 3DBHB 2ECBA 4P55A 2H8RA 2OTJI 3MWMA 5D4RA 3OYIA 2DFEA 4G12A 3GMEA 5HVQC 3EUHA 2DAOA 3R4KA 2B0LA 2ZXJA 2RQPA 1WJBA 3W3CA 2LTPA 3PSIA 2DK5A 3HRUA 1VQOI 1J7KA 3BTCA 3OIOA 1TWAJ 2W85A 4XKVA 2LREA 2VBZA 3JW4A 2VQCA 1ERDA 3MKZA 5E8IA 2DA6A 3TQNA 2A68F 3WGHA 5IYDJ 2B7EA 1VQ4I 4K2EA 2IS4A 1SANA 1F43A 4HNTA 2ECCA 1T08B 1C0WA 1OISA 1IN6A 4QPQA 1WSUA 2W57A 2GBYA 2R7DA 3W2VA 3F8MA 1NK2P 3M07A 2R7RA 4IQ4A 1LE8A 3OIPA 4D5FA 4ETSA 2X6XA 3EUKL 4AUXA 3BR0A 1OFCX 3ISPA 5CKTA 4X0GA 2L7MP 2EZKA 3IV5A 4W97A 4NHJA 1TT0A 5FLXK 3W6JB 1YE9A 2IS1A 2FBHA 5B5EC 2A05A 3I54A 5TISC 2VLAA 3GTMJ 2LKXA 4V19K 3LSTA 2W48A 1J09A 3K10A 4HDVA 3TEDA 1WQ2A 3S3NA 4RAYA 3HKZN 2EH3A 1SVOA 5LEJA 1BR1A 1IW7F 3PQKA 4N9HA 4BL0B 4L5EA 2CQKA 4B4CA 1U9NA 4ZDLA 3FHNA 2BY2A 2VXDA 1K6OA 1HKSA 3GXOA 1HOMA 2VPRA 3PNTA 3CC7I 2V1UA 2Y9YA 4WCGA 3PM1A 2M3AA 4A3FJ 2QCOA 1Z3XA 2O61A 3IAS2 3P9IA 4A3KJ 3U1KA 1OCOH 5FLVA 3AG2H 4LK1F 2F4MB 1OCRH 2XGCA 1PJRA 4IL6C 4C30A 2JWTA 2DMPA 3RQ4A 4BXUA 1JXSA 1U5TC 2BOLA 3LA7A 2DTZA 1FT9A 2PI0A 2C6YA 1BI3A 1IRZA 4BXFA 2VBWA 5D5WB 3KZYA 1QZEA 3IHUA 3CD6I 1K83J 3L9FA 4CZZA 1R5GA 4EJUA 2LY9A 4XLCA 1CQTA 2V79A 2M9HA 3RPQA 1QO0D 4A3BJ 3B6AA 1B9NA 5L3CA 2A61A 1HSJA 1OCPA 1ZGWA 3QWLA 4CCJA 3FHZA 5L3DA 2O9LA 1XG1A 5FLXZ 2KIFA 4JYKA 4RM3A 2HS5A 1LEAA 3CMMA 4J01A 1U3EM 3HSRA 3PNYA 2VIXA 5F04A 2DQLA 5E3MA 1T6SA 1FSHA 3H3UA 3DBRB 4ZYEA 2VKDA 1ETQA 4ZTJA 5K5OA 4LLGF 4A0YA 4MFEA 3IWFA 3DV8A 3TO9A 2L7FP 1IRXA 3VODA 1ZR2A 1DP3A 2E36A 1O3SA 2DA3A 3ROUA 3MKYB 2CMPA 2ID6A 4EJVA 3FBNB 1VQNI 4KT5C 2P0WA 1IXSB 2RNGA 4HEA2 4KUMA 3GBGA 4LG0A 1YTYA 2DXIA 4BBSJ 4Y52J 2VL8A 2DJNA 2HQAA 3PUFA 3FZVA 4O5VA 1Q1HA 2Y69H 3HHGA 2GOXB 1OCTC 2DMTA 1P9QC 1U78A 4CA0A 5FRNA 3V8KA 1E3OC 2M30A 4R79A 2CO5A 3DPUA 3LWFA 1JHHA 2GWRA 1GLNA 5F64A 3K4LA 1U2WA 1NHAA 1CF7A 5JHFA 2IXSA 1ZGAA 1X1BA 2EINH 1UZCA 4MLOA 4BEHB 4NUBA 2H09A 3GW2A 4DZPA 2Y0SN 4N4OB 3T8TA 1W7PA 1D0YA 2L7ZA 4A3EJ 2QQ8A 3HTUA 3E5UA 2VE8A 2HEOA 2CJJA 4M73A 3FM5A 2E1OA 2COBA 1EA3A 1L0OC 1MBJA 3EQLF 4II3A 1UHSA 1V54H 4IRGA 2BXYA 4OMZA 3ZMTA 2LMDA 2HR3A 5J8CA 2XGDA 3KLNA 4RB1A 1R6RA 4FT8A 4JOMA 4UB8C 3GFIA 2XAGA 4WXDA 3SEZA 3FXJA 3VOEA 2K85A 2PN6A 3ZMSA 3KX2A 2QENA 1ONVA 1I3QJ 4MNUA 4A0XA 1DPRA 4OIOF 2KJCA 2XAHA 4CCLA 3HRSA 3ZN0A 1QPIA 2X1CA 3L00A 1HDDC 2WV0A 3BZKA 1U8RA 2KKOA 2QA4I 4XORA 2ISYA 3LQRA 3BJAA 1LDKB 3K6GA 2I8DA 3WG9A 2KLOA 3FXUA 1VTNC 4IHVA 2QUFA 3PL8A 4C3JJ 2OV7A 3WODF 3CC2I 2F6CA 5F27A 3NEUA 4ON0A 4RB3C 3IUOA 1Y0NA 1D1BA 1ETWA 3RYPA 3FM3A 1MJBA 4Y33A 3CCQI 3BC8A 4YIRX 1LE8B 1BR2A 5EF6A 2A07F 1S5LC 2YU3A 2QM3A 3CLOA 1O3RA 3KYCB 1D8JA 2J5PA 3M8FA 3ULQB 2BZTA 1R49A 4AYBA 4XKWA 4S05A 2W4SA 2ZJRF 2EIJH 2LKSA 4E6KG 1IRGA 2XAFA 4IRHA 3N4MA 3K4NA 4S0HB 2IBDA 2ME0A 3V8LA 1B6AA 3NWTA 1JKOC 2STWA 2HOEA 3P7NA 1FYMA 2IT0A 4KT6A 2XGXA 1BN5A 1KZHA 4LB6B 1RPWA 4HW0A 4I76A 3QOEA 5FRMA 2JA6J 1Z91A 1FOKA 3WTZA 4MQ9F 3BCAA 2XHKA 3HUGA 5HODA 1JT0A 3ESWB 4HF2A 3LSPA 1U8BA 3RYRA 2P8TA 3CCUI 3ZMZA 2LBFB 2ETHA 2A69F 1RUOA 1VI0A 1MNMC 1TZLA 4EEFG 1BW6A 2Q1ZB 4ABZA 5EEAA 2XKPA 2L4AA 3OR2C 5BPIA 4CCKA 3HPGA 1RESA 3TW6A 3CDLA 1IN5A 1BIAA 1ETOA 1MKMA 2R5ZA 1MNDA 4QWQA 4F91B 1HBXG 4HYEA 5TJJA 4KMFA 1I5ZA 4AVZA 4XOPA 2X9DA 3ZR8X 2DMNA 1ZN2A 2HTJA 2WAFA 1OJLA 5DDGA 1HLVA 3ECOA 3HRMA 4HG2A 3BG9A 4ANJA 4ZYGA 3LAJA 2F48A 1R1VA 3GLLA 1FBSA 4BHPA 3HJEA 4II2A 3HSFA 3E97A 5CVRA 3K69A 1N77A 4CCMA 3WTYC 2Y30A 5FD6A 1E3PA 3AG1H 2XAUA 5DD4A 2F4OB 2JK3A 2Y2ZA 2XSDC 2IW5A 2JTVA 5DD8A 4ZC3A 1GXPA 1AKHB 5CVUA 1KQ8A 4LOCA 3TW7A 5KAIC 2HXOA 2ZO4A 4KISA 4P5OA 2EJRA 2VODA 4G6TB 2STTA 5FJ8J 1LVKA 2DA1A 5FFZA 2NRAC 2R92J 3I5UA 2MC3A 1AKHA 2HI3A 5GPAA 1KYWA 5E1WA 1EV7A 1ZKGA 1G3YA 1ON2A 2ZMEC 1GDTA 3KEYA 4OMYA 3I0TA 1SD4A 4M9SA 1WFXA 3IC7A 2CH0A 3HSEA 1J0RA 2W82A 3M8JA 5M3FJ 2QVOA 1R5ID 1GT0C 2WA0A 4BNCA 4C9YA 1QNTA 2L4MA 2NNNA 3I53A 4JX5A 2OD5A 3OS2A 2RNJA 1I6HJ 4PJJA 3F21A 2E7WA 2JA7J 3QPTA 3OIQA 2QBYB 2EQRA 2MFZA 5KCMA 5FKKA 4JP0A 5CYVA 1A31A 2P5LC 2FRHA 1UCRA 2LLKA 2E7XA 2CYYA 2X6WA 2XDVA 5FKMA 5H20A 5JHUA 3TP3A 4CCNA 2O8XA 4LG0B 5IT9K 4A0ZA 3S2HJ 3WU0A 3I59A 2FSWA 2QZ8A 3IKTA 4C2UA 1DDNA 1UELB 4AD9A 3H3VK 4EATA 4PFOA 3CC4I 1ULYA 4NC8A 4B44A 2MYSA 2AHQA 3S2WA 3CJRB 3HTSB 2KIQA 2WAQA 1RKTA 4A12A 4DOZA 2TDXA 4BEHA 4RMNA 3VDXA 4UUSA 5FLMJ 2ZB9A 3DKWA 1D8KA 1OCCH 3K2ZA 1Y56A 3SDGA 3CCYA 2ZC2A 2E1CA 1VQKI 1S3JA 4IHWA 2L7KA 4G6QA 3G1MA 1Y8RB 3ZQHA 1KU9A 3EYIA 4OU0A 4L9JA 4XSXF 3JTHA 1DGWY 4KIFA 2BHZA 1QA6A 1S29A 5FD5A 2KJBA 3GO5A 3E6CC 1F9NA 3IP4B 4U7BA 2HQ5A 3E7LA 4NC7A 3R0AA 2KDOA 1PUFB 1LDJA 4XBFA 3AL0C 3J80K 2IS6A 1ZG5A 3V7CA 3W2AA 1LFBA 3G73A 4EM2A 4KN4X 1DGRM 1XSXA 3E6DA 1KU2A 2LFBA 1X1DA 1U6GA 2JPBA 2MD5A 4U0YA 2ZNZA 2R7TA 4I01A 3WG7H 2BHYA 3FXMA 2NS8A 1K61A 2Y0MA 1X2MA 2KZVA 1WKMA 3F72A 3D5SC 3PFYA 1K78B 5HDKA 3HUGB 2BY1A 1K4TA 4M6XA 3WTWC 1WJAA 3ZP5A 2J5OA 2K9NA 3TKYA 3TL4X 2LOOA 3WTUC 4ZJZA 4E7SA 1W4MA 2NNYA 2V6CA 3GTOJ 2WAQN 2Y9ZA 1ZQ3P 1BI2A 3SFIA 2M8EA 2LSOA 5LGUA 2Z5UA 3H5AA 1BC8C 2P5VA 2X48A 3S15J 4HQMA 3DP7A 2Y0SA 1R9TJ 1GHCA 1XCBA 4OWRB 4DBRA 2PQ8A 2FOWA 2JA2A 3ABMH 3RSNA 2DT7B 2GLOA 4KYWA 5FKOA 3GFLA 2E1MB 2HOAA 3TDZC 1FTTA 5BS6A 1WJ5A 1X2NA 1DPUA 2QQ9A 2MD0A 1R7JA 1VQ8I 1MZBA 4O3MA 1X3WB 2R0QC 1S7OA 1TBXA 2FA5A 3BJOA 1DP7P 2P7VB 4U0WA 5LHHA 3WTSC 3NARA 1VQ9I 1RETA 2OA4A 2QQBA 4F52A 3PUBA 3GTQJ 5F0FA 1QGPA 2Z3YA 4Y17A 2Y48A 4G6DA 4MTEA 4BJ5C 2M87A 1O7LA 2IVMA 2HU9A 2CS3A 1R1TA 2CU7A 4HRIA 3P9CA 3GEZA 1USSA 2XRNA 1B8IB 3S1MJ 2AXLA 1MMSA 3BTLA 1P4WA 1ZG1A 1LVAA 3K70D 5DEQA 2JRMA 1GV2A 3H9GA 2CGPA 3RKWA 5C44J 2CUJA 1SC7A 3R61A 4FASD 2K3PA 3LSHA 3V7SA 1IDZA 1ZAOA 2M45A 3K4MA 4AYBN 2BVMA 2FNPA 1IZ1A 2ZSHB 2PMUA 5HDNA 3DXJF 2ESNA 3NRVA 4KMUX 4XL9A 5DM6F 2RREA 2V6EA 1XMAA 2KIMA 2UXXA 4LLLA 2D45A 4QTRA 4P9FA 5IOZA 4QSHA 3MAJA 1MDMB 1ZRCA 2ELJA 1WJFA 2Z99A 4U0VA 1LB2A 3EDPA 1D0XA 2BE5F 2HPMA 2ZXHA 2R7FA 2H94A 3J81Z 3VPRA 4HSTA 1WVRA 1A6IA 4FHTA 3CJQB 3VSKA 2YU9J 2ZJPF 1T0FA 3M7GA 1T39A 3WGGA 4OAYA 1W0UA 2Q2EB 2LVSA 3OMYA 3T5XA 2IP2A 4KICA 2H8WA 2YSRA 5L3FA 3E5QA 3WU1B 4OOIA 3G1LA 4IF4A 3SDBA 1W7PB 3QAHA 2Q2EA 1NTCA 4CZCA 2ADUA 2G7HA 1ETYA 2E5ZA 3U9GA 1P7JA 1GXQA 5EJCA 3RCOA 4B3XA 3PJRA 2MC4A 5HOOA 2YS9A 3ZMVA 1ZGJA 4C3HJ 5AIPA 1LQ1A 1K4SA 4A3DJ 3H5NA 3BDDA 4I2OA 2G0EA 2L54A 1FYKA 2G7UA 4CSWA 2HYJA 1MBEA 4LG3A 2JT1A 4UY8I 4DIQA 3OYNA 4J19A 4BACA 1VFCA 1RR7A 5LBQA 4NBQA 3OYKA 2MW8A 4F3QA 3LSRA 1XD7A 4EM1A 1EH6A 2A5YB 1X3ZB 2VT3A 2UWMA 1USTA 2HYFA 4JQFA 3QYFA 1SMYF 4YFKF 4XLNF 1A36A 2HNHA 2X51A 4M9ZA 1AU7A 3L2UA 3OYAA 2DDAA 1GVJA 2BXZA 3ASNH 1XDUA 3KP4A 3KLOA 4QLCU 2HQNA 1UJ8A 1FC3A 2GA1A 5A2QZ 3CUQB 3KZZA 3LSKA 3H0GJ 3ONQA 1VQ7I 4FETA 2CQNA 4G7HF 1IDYA 1MBHA 4ESJA 3LSIA 3QPSA 2DO7A 2VN2A 2M7AA 2L9NA 3QU3A 3DEEA 2XGEA 4F7ZA 5M3MJ 3UKGA 4Q48A 3VYRB 2F5EA 1W7PD 1PVEA 1I39A 4Z2YA 2FMLA 3CP2A 5K7ZA 1I27A 2XAQA 3LA2A 2EV0A 2DA2A 3HM5A 1EF4A 5D5UB 2RKHA 1N78A 2LG4A 4HF0A 3H35A 4ASNA 5K7FA 2DA7A 1FIPA 3ZQGA 5D4SA 4BE0A 1TW2A 1UB9A 1OPCA 3LSGA 1OYIA 4JK1X 2DPDA 2CW0F 3TMOA 4CUGA 3ECHA 3F8NA 3HOYJ 3F8BA 3CUOA 3TP0A 2BBYA 4QIWN 2QSFX 3BG3A 1H9TA 2R7OA 4UV9A 3D0SA 3VYTB 3JRFA 2XB5A 5HS9A 3BTIA 1GVDA 2VQGA 1S7EA 5D5VB 2QYOA 4XSZF 1ZR4A 2B63J 1B72B 2NOJB 3CCMI 1T33A 1V5EA 4NC6A 1H8AC 2KP6A 3T8RA 4KNYA 3ZMUA 1WH7A 3PSFA 1FNNA 2DPUA 4HBLA 5TRDA 5LGNA 1IO2A 4P1WA 3D5LA 3S14J 1JTYA 3BT9A 4HV5A 5D8LB 4A3JJ 3JRHA 3G2BA 3TBIA 1RI7A 3CCSI 2VT2A 1TQPA 2L02A 3JSPA 4GFBA 1RC9A 3TOBA 3MZ8A 4D1QA 1YQAA 4NDLA 5F1JA 4MIMA 2DFIA 1XC5A 3HGGA 2JJ7A 3WE3A 5DM7F 4UUVA 5FFXA 1N25A 4XRSA 1ZH5A 3ZQQA 1QU3A 4D7NA 1P4XA 2DT5A 3CZ6A 3O3KA 3Q9SA 5JVTA 1DU0A 1FY7A 1APLC 5HNFA 5EG0B 1Y1VJ 1ZYRF 3GTGJ 3U2RA 1I1GA 4LD5A 3I56I 3IH4A 2W00A 5ICFA 3K70C 2Z33A 4LGWA 2JSCA 2FQ3A 2NYXA 2A6TA 4WF2A 4YG2F 2PMHA 3SFZA 1FBUA 2LYCA 2FEZA 2HDDA 3AL0B 2W84A 3TO7A 1WJDA 2PEXA 2CW7A 3AG3H 1WI3A 4LIVA 1EKEA 3JRBA 1JJ6C 1X1CA 4OINF 1KQ0A 4RDUA 1ZK8A 4XRFA 2KRCA 5E3NA 2QKMB 2VUMJ 1I6XA 2V9PA 5EGOA 3EPZA 4HQEA 1X58A 1XGMA 2MH2A 2OUMA 4HOBA 2LF8A 2XIGA 3DPLC 1I1SA 1SAUA 2H1LA 3OYFA 5L3BA 2M5WA 4A5MA 3L09A 2HDWA 4L5JA 2QLZA 1B9MA 1SFXA 3QPHA 1ODDA 3OV8A 5FGMA 1J75A 1VF9A 1ETXA 1OYYA 3CO7C 3G6EI 2K9MA 3H3ZA 4M3EA 2FBIA 4PJMA 4ENJA 2GA2A 2ZFWA 3EUAA 3I4MJ 1ACIA 4HA8A 4PUSA 3A03A 4NQWB 3MEXA 5B66C 3GF2A 4FE7A 2HYGD 2XROA 3S2DJ 2QQAA 3FK6A 3U21A 3CDIA 1SD6A 2DFHA 4A3IJ 2N8GA 3DFGA 2IPQX 3GX4X 1SAXA 3ABTA 1ITYA 3OSGA 1YX5A 2IA1A 5HS7A 3O2PE 4E7KA 4RBOA 5D6FA 4B09A 1O4XA 3CDHA 3MD2A 1PYVA 3LFUA 2R7XA 3Q0VA 2RVCA 2KMUA 3V7RA 2HPIA 3OSFA 4H4KC 4BDYA 1W5CC 1E0EA 1BM9A 2RN7A 1R36A 1JUSA 3BZ6A 3FDYA 4QPOA 1K78A 2NVYJ 4WX9A 1YS6A 1UG0A 3J7AO 1ETVA 3X2QH 2K4BA 1HXDA 1BI0A 2K3FA 2V4JC 4PSXA 1ZHFA 2ZMEA 4EGYA 2QBYA 3DEUA 3JRCA 4V2GA 1RZ4A 3DBLB 1IN4A 2RV8A 3FIWA 4A5NA 3RDIA 3LMMA 4M3BA 5HDGA 2NVQJ 2VQLA 5DUKA 3FXQA 5HNHA 1V3FA 3H92A 3BR5A 3AFHA 2KISA 3M1EA 1U9OA 3QPLA 4PGGA 2VXZA 3CF5F 5J1UA 3DF8A 4IHTA 2D5VA 2E1MC 3I4PA 4ENKA 4LIUA 1SFEA 4IVNA 2VOPA 2HFHA 3DLAA 4G8XA 3OYDA 1D1CA 1Z1DA 5EZHA 2WB1N 4BYYA 4RGRA 1JTXA 1WCMJ 4DZJA 3SJMA 2DA5A 5BMZA 1IXRC 3BG5A 3OOUA 4FX4A 1FOYA 2EFNA 3GTKJ 2E34A 2VKVA 2EFPA 4NNJA 4F92B 4P96A 5IOYA 3SXYA 4A69C 3C2BA 3U1DA 2LY1A 2HQRA 1BJAA 1WRJA 1WJCA 2OJED 4CGZA 2H6CA 4BJ6C 2DYSH 4M71A 4EM0B 3L2RA 2FX0A 2K9LA 1REPC 2K9SA 4E7HA 4AIJA 2CRGA 3REOA 2OZ6A 4CXFA 1D0ZA 2F2EA 1IGNA 3NAUA 4IPAA 1ENHA 4MHGA 2E19A 4HPQA 2BEOA 4EV0A 4U88A 2LKPA 4CYDA 2JVHA 5C4JJ 2M7BA 1SFKA 2DLLA 5GADJ 4M74A 4IJAA 5HLHA 5C3EJ 4M3GA 4PFPA 4RLQA 4EJOA 3FBIB 5KK1A 1QRYA 3OYBA 2W24A 4CDGA 4W1UA 3OYHA 1MSFC 3OS0A 1KU3A 4YELA 3J80Z 1MBFA 2FF4A 2KFDA 3I64A 2Z1DA 1SFUA 3C2HA 4X1EA 1YIOA 3DTKA 3PNVA 1FP1D 1A6QA 3I4NJ 1JUMA 1IUFA 2WY7Q 4XR6A 1OQYA 3LAPA 1V55H 2XB0X 2EK5A 4UXNA 1F5TA 2GAUA 3DPTA 3JAMZ 1ZREA 1MMNA 2MBFA 3E6MA 3MMYB 4XRSG 5H6RA 2DA4A 4IOCF 3P5JA 2WTEA 1XCVA 3I58A 3TO6A 2Z2SB 1AHDP 1LEBA 2R5YB 4HAMA 5DS9A 1BOBA 1YITI 3PO2J 4MGRA 1CGPA 4M3FA 3RTRA 5F1RA 4ITVA 1BA5A 3ASOH 1LNWA 4ZH4F 3H0DA 1YG2A 5M5XJ 1SFOJ 3LQQA 1YYVA 2ZBKA 3KEQA 2LC2A 3C2GA 3CUQC 3CP8A 2K7LA 4UUTA 2DYRH 5B1AH 2CG4A 2YX7A 2CFOA 1XGSA 4OIRF 4WWCA 3WTXC 3WU2C 1J59A 1YW9A 3MZYA 2WV1A 1P2FA 1EH8A 3G71I 1MJ9A 1QZYA 2HTSA 5BOXA 5F0CA 3ZGKA 2OF7A 5IT3A 1VQLI 2E2HJ 1FSEA 3SHFA 1R4NB 1FEXA 2AO9A 5E3OA 2K9QA 1XMXA 3UR3C 3HGYA 3F23A 2FU4A 1ZTRA 4XLPF 1MBKA 3ERMA 3RPUD 4HNVA 5E8GA 1B59A 2XPVA 2EIKH 3FXLA 1ORKA 2LP0A 1ETKA 5DYMA 2WADA 1B1BA 1IC8A 3IRQA 3QRFF 5JR3A 1HC8A 4A6DA 4FQGA 3ABLH 5FB2A 4R1HA 4ZYDA 2O6GE 4BQAA 4E7ZA 3SZPA 4HLXA 5DV5A 2VI6A 3HL2A 2MA3A 3DKXA 5LD2C 3VYSB 1H0MA 4GGGA 1ZRDA 2M0MA 1E2XA 5ILSA 2W7NA 3MQ0A 4BQNA 2EZHA 2PMZN 1HKTA 1F4KA 2IGMA 2ACJA 3HKZA 2VONA 2EB7A 2CV1A 2O03A 5L3GA 3K0LA 4AVPA 2EFQA 4RAZA 1ON1A 3OYGA 4XKBA 4XLEA 3HXLA 2R4GA 2ZNYA 3W2WA 2QF7A 1KA8A 3RKYA 2F5CA 4KA4A 2XC7A 4FE4A 3MCZA 2NOGA 1YI2I 4F55A 3C3WA 5K5QA 2XKOA 1MMAA 2MH9A 2V1XA 3SZGA 1T2KA 2VBYA 2WY8Q 4I0BA 5KNLA 1Z7UA 4EQQA 1G3SA 2L01A 3DEWA 3RKXA 2DTRA 5IP6A 3SQNA 2M4KA 5B3SH 2LBFA 2XASA 3S3MA 5ILUA 1FTZA 2OCEA 1JT6A 1OMIA 2X4HA 2DI3A 4BKXA 4BE2A 2LDUA 3K9TA 1GV5A 4IHSA 1T0FC 1G8XA 1ZLKA 3ZOBA 4RA2A 1A04A 3K2AA 1YRNA 1B8IA 4I6ZA 3KZIC 1KQ9A 3F0CA 2WC2A 3J7YJ 3KIOA 1Y1WJ 3ZCOA 5GPCA 4ZDPA 4ESBA 2XRLA 3HPHA 4DGWB 2F5FA 2CWEA 2H6BA 3GCMA 4H0EA 2DOAA 5CLSA 1YHQI 3HBLA 1BI1A 5EDNA 3ZQLA 3E1SA 4ZDOA 2DFFA 4HV6A 3CJNA 3QP6A 1ZG3A 1YIJI 3GYHX 1NK3P 2LRDA 3G3ZA 3E5XA 2ZMEB 3GZ6A 4ENNA 3DU5A 3VFZA 1BOAA 3HOTA 1J9IA 1YJ9I 3OYCA 1A35A 1GUUA 1KGSA 1P4AA 2YR2A 2M1BA 2O5RA 4L18B 3QYEA 4B47A 3IRRA 3R0JA 3T1BA 3H9QA 4FISA 3ML6A 2XPUA 3QYBA 4FX0A 4XMYA 1LDDA 4OIPF 5D8KB 4BUPA 2ELKA 4G9YA 2YUSA 4YIIA 3BR1A 2XF7A 2XF5A 4HDUA 2DDBA 3M4OJ 1TNSA 2M0CA 4XN0A 3HOZJ 5JVGF 1YJNI 4D7MA 1S8NA 3BROA 4RB0A 2CSOA 4BBRJ 5K1YA 2A5WA 3VYUB 4DYCA 3AAFA 3ZMDA 1XN7A 3HDDA 1UG2A 4YFNF 2D1VA 3EETA 2PX9A 2B9SA 2NS0A 4XONA 1R1UA 4BJTA 1BJZA 2E35A 5IY5H 4FTHA 1FOWA 1HQCA 1TQIA 2EFOA 4ZYHA 2K86A 1KYZA 3FISA 2ICWG 3L2QA 3H5RA 4GCVA 2MGQA 3AKZA 2ESHA 3UNGC 1JI8A 4M72A 4BXXJ 3HIFA 5LGTA 2FXAA 5JI6A 1QBJA 4XK4A 4DYRA 5HLTA 1WI9A 2MSYA 1X3UA 1BC7C 2L9SA 1O3TA 4E7IA 1PP8F 2XUBA 1OYWA 3H36A 1WWXA 1JUPA 1FMWA 2O7OA 1SD7A 1T98A 2BY3A 2KRHA 3B6CA 3F8CA 5BNGA 4AC0A 3F6OA 3KYLA 4U7DA 2AQEA 2FD5A 2H1KA 1R23A 1RR8C 4YFXF 2YPRA 4UHTA 4RM2A 4YRVA 2AXTC 2GQQA 1I50J 3K4KA 4FCYA 4ZZDA 4DJAA 2ZJQF 4MEYF 1ZLJA 1BIBA 1S6LA 4L0ZB 3S17J 5J1YA 4IEJA 4A3CJ 4I98B 5J3LA 3VB2A 5J4VA 3COAC 3HG9A 3A02A 4IHXA 1TWCJ 2FQ4A 3QQAA 4CYCA 3OYLA 1X1PA 3HZJA 3L2CA 3FMRA 2VBXA 2BV6A 2GOMA 1Y0UA 1MJAA 2DOEA 1FBQA 2YX4A 4A6EA 2EPFA 2PLYA 1D5VA 1DQUA 2D2WA 1NG6A 5EEHA 1WGXA 3NQOA 3F3XA 3OY9A 4IHYA 5F0HA 4IXAA 4IX7A 4PCQA 1KONA 3WHCA 1Y8QB 3HRTA 3S93A 4D9JA 2RQQA 2CV0A 1WJEA 1Z6TA 3QU6A 4BH9A 2IGOA 2DMUA 5FO5A 2GIZA 1TC3C 2EFWA 1HW2A 2EA2A 2X85A 3F9KA 4Q5SF 1HDPA 2CQQA 3RIRA 5J6XA 3PIPF 3OYEA 1TNTA 5E1XA 2XV4S 1SEUA 4P9UA 4ZYAA 3BR6A 2GXGA 2O3FA 3F6VA 3GVAA 2RDPA 3LOCA 1X1AA 4XLAA 1XGNA 2P4WA 5H6QA 3CCJI 1IV6A 3BPXA 2XVCA 4WK8F 2PBIA 1FWZA 4HNUA 3H1CA 3KE2A 4CHUA 3RQIA 3CMEI 1MH3A 4TV7A 5IP7J 1LPQA 4RB2C 5EYRA 5J1RA 3J7AY 2DU9A 3BG6A 2LD5A 3CMAI 1WZ2A 3VWBA 1UHMA 3ERED 1Z05A 5ED4A 4UVCA 4GRIA 4CICA 3GTJJ 1LKXA 3EYYA 3KP5A 1G4DA 1TQMA 4U87A 1O3QA 3ZXSA 3O8HA 3KYDB 5GAEJ 2L0KA 2DJIA 4PDKA 4LITA 3CF2A 4F93B 2OU2A 1MW7A 5IP9J 1STZA 2WB1A 1IUYA 4RGXA 3IH3A 4L9TA 4M9XA 1HSTA 4AIHA 3S8PA 2EZLA 4L0YB 2Y31A 4OAZA 3C7JA 1PUFA 4RGSA 3E0JB 3K1MA 4XIDA 2L5QA 4UV8A 5KHDA 2L9RA 2QEXI 1R22A 2DQRA 5K7HA 3JSOA 1R71A 1YW8A 3AG4H 4WXHA 4G94A 3GFMA 4RLFA 1H88C 4LK0F 3TDUC 5CPRB 1T8IA 3JTGA 2OQRA
chains in the Genus database with same CATH topology
2BVLA 2D5VA 2FUG2 4UUSA 2E1MC 3OL3A 5FLMJ 3CESA 3VDXA 2BW3A 4LIUA 2ZB9A 3S1RJ 3BCBA 1Y56A 3SDGA 2RAEA 3CMYA 3CCYA 2LK2A 2JMWA 1A5JA 1OR7C 4IHWA 2VKHA 2L7KA 3DLAA 3G1MA 4N4NB 4YEJA 2V26A 2Z16A 3ZQHA 3ZQFA 2NVTJ 1U0JA 2VJ4A 3S32A 1D1CA 5EZHA 3OYDA 2WB1N 3SJMA 4DZJA 1JTXA 1WCMJ 1DGWY 2DA5A 3BG5A 3OOUA 3MN2A 4CYCB 3GTKJ 4V2FA 2VJ5A 3IP4B 2VKVA 3MKWB 2GM4A 2VJJA 4XKCA 4U7BA 2HQ5A 4NNJA 3E7LA 1JGGA 4NC7A 1YRNB 5JLXA 1PUFB 2KDOA 4F92B 5IOYA 3A4CA 4A69C 3C2BA 3AL0C 4CH7A 2EBIA 3BR2A 2LY1A 1YX3A 3EUHC 5FROA 2IS6A 2QKLB 3ZGKA 3A01A 2CUZA 3W2AA 1LFBA 3Q0UA 1WJCA 1MBGA 1DGRM 1QHGA 4BJ6C 3BG7A 3IH2A 3L2RA 2LFBA 3L2WA 1X1DA 2FX0A 4BGDA 2K9LA 2JUGA 2ID3A 2K9SA 4E7HA 2CRGA 2R7TA 2NVXJ 2VKEA 1LFPA 1Z3YA 4BE1A 1D0ZA 4E7JA 3LNQA 1IGNA 2E2JJ 3NAUA 3DKYA 2VPLA 5CQEA 2DMQA 1ENHA 2NS8A 4MO7A 2E19A 1K61A 1OLTA 1X2MA 4XNFA 2KZVA 4HPQA 2HOTA 3SYTA 3HOSA 3PFYA 4UUSB 3D5SC 3S16J 3JRDA 2JA8J 2L2OA 3HUGB 5C4JJ 2JVHA 2M7BA 1SFKA 4XN3A 3LSMA 1WPKA 4BY7J 3HC7A 1WJAA 1MSEC 1N75A 1JKPC 5C3EJ 4M3GA 2K9NA 1D1AA 1NG7A 4PFPA 4RLQA 1IJWC 3FBIB 3OS1A 1QRYA 3OYBA 3S1NJ 4W1UA 2KPMA 1ZELA 1T95A 1TWGJ 1MSFC 2LOOA 1VNDA 3TL4X 4ZJZA 3OS0A 4E7SA 2ECBA 2H8RA 4YELA 2M2EA 3GTOJ 1MBFA 2WAQN 3OYIA 2Y9ZA 1ZQ3P 2Z1DA 1V5GA 4G12A 3SFIA 3HOXJ 3C2HA 5HVQC 4C2TA 4XM3A 4X1EA 4KITB 4A3LJ 3H5AA 3DTKA 3PNVA 2WAEA 1WJBA 3W3CA 2LTPA 3PSIA 3I4NJ 1JUMA 3BTCA 1IUFA 3OIOA 1TWAJ 2WY7Q 4XKVA 2X48A 2XB0X 3S15J 1VZ0A 1Z21A 2LREA 2VQCA 1ERDA 3MKZA 4XICA 2Y0SA 1R9TJ 3DPTA 2DA6A 1MMNA 4XRSG 4OWRB 3MMYB 4DBRA 2HZDA 2DA4A 5IYDJ 4JX4A 2JA2A 3RSNA 2IS4A 2DT7B 2GLOA 3QODA 1SANA 5FKOA 1F43A 2ECCA 3OL4A 4HNTA 2Z2SB 2E1MB 2HOAA 1AHDP 1FTTA 3M1CA 2R5YB 3K4BA 2R7WA 4J00A 1X2NA 1WJ5A 3G1OA 5DS9A 1BOBA 3NWSA 3PO2J 4QPQA 2MD0A 2GBYA 3W2VA 4M3FA 1NK2P 3RTRA 1BA5A 2R0QC 4ITVA 2V1NA 2R7RA 4IQ4A 3H0DA 1LE8A 3OIPA 5M5XJ 1XS9A 1SFOJ 4D5FA 3NARA 5C4XJ 1RETA 2X6XA 4AUXA 2IEKA 3EUKL 2X6YA 4BACA 2R5YA 2KHMA 5FKNA 2LC2A 4F52A 3PUBA 3C2GA 3GTQJ 5F0FA 3BR0A 3JREA 3CP8A 1OFCX 5CKTA 4UUTA 2XSJC 4X0GA 2M34A 3MKLA 2L7MP 2EZKA 3IV5A 4W97A 1TT0A 2CFOA 1YE9A 1F36A 2IS1A 4BJ5C 1K6YA 2WV1A 3S3OA 2HU9A 3GTMJ 2CS3A 2VLAA 2CU7A 3HOWJ 3DQVC 4HRIA 2LKXA 3O8GA 1HCRA 5F0CA 1B8IB 3S1MJ 2OF7A 2W48A 2ME6A 5EGOB 3BTLA 3TEDA 1J09A 2E2HJ 3K10A 4CCOA 3S3NA 2HVRA 3LSJA 1FEXA 2AO9A 3K70D 5E3OA 3HKZN 1TWFJ 1GV2A 2EH3A 2K9QA 1W36D 1BR1A 3H9GA 3UR3C 3HGYA 2R7UA 5C44J 4BL0B 2TRTA 4L5EA 4B4CA 1ZTRA 2OPTA 2CUJA 1MBKA 1U9NA 4HNVA 2K3PA 3FHNA 1IDZA 3LSHA 4ZDLA 2MABA 3RPUD 2XPVA 4AYBN 3K4MA 2BVMA 2DCEA 1ORKA 2LP0A 2VXDA 1HOMA 2ZSHB 2UV1A 3D5RC 4IQJA 1ETKA 2VPRA 3PNTA 2Y9YA 4MFDA 2DT6A 1IC8A 2WADA 3PM1A 4A3FJ 2M3AA 2QCOA 1Z3XA 2LR8A 4XL9A 2RREA 3IAS2 4A3KJ 2V6EA 4E7ZA 2JVGA 2UUZA 3V42A 5FLVA 2VI6A 4QTRA 3HL2A 5IOZA 4QSHA 2FJ1A 2XGCA 2O8KA 1PJRA 3DKXA 3I9V2 3VYSB 5LD2C 2ELJA 4C30A 1WJFA 2JWTA 2DMPA 2M0MA 3RQ4A 1D0XA 4BQQA 2HPMA 1W36C 2W7NA 2LY2A 2BOLA 2ZXHA 2DTZA 4BQNA 2NS7A 3VPRA 1IRZA 4BXFA 4HSTA 2EZHA 2KDZA 2PMZN 1A6IA 2IGMA 2YU9J 3D1NI 3CJQB 3HKZA 3VSKA 1K83J 3MVPA 2CV1A 3IAM2 1W0UA 4OAYA 2LY9A 1CQTA 4XLCA 2Q2EB 2LVSA 2M9HA 3OYGA 3OMYA 4XKBA 4A3BJ 4XLEA 4X6AJ 3B6AA 2R4GA 3HXLA 2QF7A 3W2WA 4B1RA 4E7LA 4A93J 2KT0A 1OCPA 1ZGWA 2XC7A 4FE4A 4CCJA 1JKQC 4PK4A 2O9LA 2NOGA 3G1LA 2CUFA 2JA5J 3SDBA 1XG1A 3DTIA 4F55A 1NTCA 4CZCA 2M4GA 1ETYA 4JYKA 1MMAA 4RM3A 2E5ZA 3CMMA 4Y3OA 1P7JA 3ZQIA 4J01A 5JLWA 3SZGA 3PNYA 2WY8Q 5KNLA 2VIXA 2E60A 5F04A 5E3MA 3RCOA 3DEWA 2BW3B 4B3XA 3PJRA 2MC4A 3OR1C 5IP6A 5HOOA 2XPWA 2YS9A 2VKDA 1ETQA 4ZTJA 4C3HJ 2V9KA 2M4KA 4A3DJ 2LBFA 3H5NA 4BS9A 4MFEA 1WH5A 4B43A 4ZTFA 2G0EA 4C2MJ 3S3MA 1FTZA 2L7FP 1ZR2A 1IRXA 5TGTA 1JT6A 1Y6IA 3A2KA 5F08A 4CSWA 1DP3A 2HYJA 1MBEA 2DA3A 4LG3A 4BKXA 4BE2A 3MKYB 2ID6A 1GV5A 3ZQCA 2CMPA 4J19A 3FBNB 4DIQA 1JJ8C 3OYNA 1VFCA 1T0FC 4BBSJ 1G8XA 2P0WA 3GBGA 1RR7A 2RNGA 4HEA2 2DXIA 3ZOBA 2KL4A 3DU6A 3OYKA 1Z0XA 2R5ZB 4Y52J 2MW8A 3K2AA 3LSRA 1YRNA 4F3QA 1B8IA 4I6ZA 2DJNA 2HQAA 2VL8A 3F0CA 2UWMA 4JQFA 2JSPA 3QYFA 1Y1WJ 1OCTC 2GOXB 5GPCA 2DMTA 2PMZA 1P9QC 4ZDPA 3ZCOA 4DW6A 1U78A 4CA0A 2XRLA 2HNHA 2X51A 5FRNA 1AU7A 1E3OC 3HPHA 4R79A 4DGWB 3DPUA 3OYAA 3L2UA 5GP9A 1GLNA 1IG7A 3K4LA 2CV2A 5JHFA 4Y7NJ 5DTDA 4MLOA 3HBLA 1X1BA 2DOAA 2IXSA 3A1YA 3N05A 4BEHB 5EDNA 4BDZA 3ZQLA 3E1SA 4DZPA 4NUBA 4ZDOA 2R7SA 2Y0SN 2AQFA 4N4OB 1D5YA 2E5NA 4XQFA 4A3GJ 1D0YA 2L7ZA 4E4HA 3LSKA 4A3EJ 1B72A 3H0GJ 2X6OA 3ONQA 2PJRB 1NK3P 2LRDA 4FETA 4XLHA 2WBMA 2CJJA 1IDYA 1MBHA 2E1OA 2COBA 3GTLJ 1MBJA 3QPSA 1EA3A 3DU5A 3LSIA 1T56A 4II3A 2M7AA 1TWHJ 1UHSA 2L9NA 3HOTA 3DEEA 2XGEA 3UKGA 5M3MJ 3OYCA 1GUUA 3VYRB 3H9JA 2O5RA 4DOZA 2XGDA 3QYEA 1R6RA 2HVQA 4B47A 3CP2A 4JOMA 3PO3J 5K7ZA 4FASD 4FISA 3HM5A 2DA2A 1EF4A 3H9QA 3SEZA 2XPUA 4B3AA 5M5YJ 1N78A 2LG4A 3FKJA 3KX2A 3QYBA 4XMYA 2X1EA 1I3QJ 4BUPA 2ELKA 2K5CA 5K7FA 2YUSA 1MMGA 2DA7A 1FIPA 5IYBJ 3ZQGA 2KQRA 3H35A 4CCLA 3BR1A 4XRMA 2R7QA 1QPIA 4BE0A 2X1CA 2XF7A 3LSGA 1HDDC 4D5CA 5EZGA 2XF5A 3M4OJ 3TMOA 3Q3SA 4CUGA 2M0CA 4XN0A 3HOYJ 3TP0A 4XORA 1LDKB 3CQZJ 4QIWN 3BG3A 3HOZJ 3K6GA 2I8DA 2R7OA 3VYTB 3JRFA 4IHVA 4D7MA 2XB5A 2KLOA 3BTIA 1GVDA 2VQHA 1S7EA 4C3JJ 2VQGA 1AA7A 3PL8A 4BBRJ 2OV7A 4PJNA 2A5WA 3VYUB 2B63J 4DYCA 1ZR4A 2F6CA 2XF6A 5F27A 1BW5A 1B72B 2NOJB 3HDDA 3W6VA 1UG2A 3IUOA 1T33A 1ETWA 3DCFA 1D1BA 1H8AC 1V5EA 2KP6A 4Y33A 3BQZA 4XONA 3BC8A 4IZZA 3DTEA 1LE8B 1BR2A 1WH7A 3LL7A 1BJZA 3PSFA 5EF6A 4BJTA 2V7FA 4FTHA 2IGKA 2P81A 3S14J 4P1WA 1QVUA 3FISA 1JTYA 3JRGA 5M5WJ 1MMDA 3BT9A 3D5LA 3H5RA 3ZRGA 4A3JJ 3JRHA 4BY1J 4PJLA 3G2BA 3TBIA 2IAIA 2MGQA 3AKZA 1QHHD 4AYBA 1V5FA 4XKWA 1FIAA 4GFBA 3S1QJ 2W4SA 3OYHA 2VJIA 4E6KG 3UNGC 1JI8A 4BXXJ 4D1QA 4NDLA 5F1JA 4MIMA 3K7AJ 3RZDJ 4KJZA 3L2VA 2F4IA 4XK4A 1XC5A 3HGGA 2JJ7A 4DYRA 4BEHA 3K4NA 2MSYA 4S0HB 1X4OA 2IBDA 2ME0A 4XRSA 4RMNA 1JKOC 3NWTA 2L9SA 2HXIA 3ZQQA 4KT6A 5IPAA 1G59A 1QU3A 4D7NA 4E7IA 1RPWA 3CZ6A 3BQYA 1Q1VA 4I76A 4DBQA 1DU0A 3QOEA 2JA6J 5FRMA 1APLC 5HODA 1POGA 3BCAA 1JUPA 1JT0A 1FMWA 5HNFA 2O7OA 5EG0B 3LSPA 1Y1VJ 5BNGA 3B6CA 4AC0A 1U8BA 3GTGJ 2KRHA 4M3DA 3KYLA 3IH4A 2LBFB 4XR6A 2W00A 2AQEA 2FD5A 2H1KA 3K70C 1VI0A 1MNMC 1TZLA 3JRAA 4EEFG 2A6TA 2I10A 4RM2A 3WHBA 4YRVA 1BW6A 1I50J 2Q1ZB 4ABZA 3K4KA 4FCYA 5EEAA 4DJAA 2LYCA 3OR2C 4M6VA 2HDDA 1RESA 3TW6A 3CDLA 3HPGA 1ETOA 3RKQA 5J1YA 4IEJA 3S17J 2R5ZA 1MNDA 4A3CJ 3AL0B 2IS2A 5J3LA 4F91B 4IHXA 3I3LA 2EZIA 3A02A 3HG9A 1TWCJ 2FQ4A 4CCKA 1WJDA 3QQAA 1FJLA 2R7ZJ 2R7VA 2CW7A 1WI3A 3HB9A 3JRBA 1JJ6C 2LH9A 4LIVA 4CYCA 1X1CA 4AVZA 4XOPA 2X9DA 1ZK8A 4RDUA 2DMNA 1X4PA 2WAFA 3ZR8X 1OJLA 3OYLA 2KRCA 2M8GX 5E3NA 1HLVA 2QKMB 2W1OA 2VUMJ 3BG9A 4HG2A 4ANJA 2GOMA 5CQGA 5EGOA 3SEQA 3EPZA 1X58A 3HOUJ 4XOTA 2OUMA 2ZFUA 1HF0A 4II2A 4B48A 3DPLC 4A3MJ 1SAUA 1RKWA 1DQUA 3OYFA 1N77A 1FMVA 1NG6A 4CCMA 1WGXA 2Y30A 5KCMA 4IHYA 2HDWA 4JX6A 2DN0A 3OY9A 5F0HA 2XAUA 4IX7A 2JK3A 2Y2ZA 4IKFA 2XSDC 1AKHB 1DU6A 1KONA 3WHCA 2K40A 4Y4RA 4ZC3A 1VF9A 1MH4A 1ETXA 3S93A 4D9JA 2RQQA 2ZSIB 2CV0A 1WJEA 4LOCA 3TW7A 2ZXIA 2HXOA 2IGOA 2DMUA 2K9MA 1MNEA 4P5OA 4KISA 4M3EA 1TC3C 4G6TB 5FJ8J 2DA1A 2R92J 1W0TA 1LVKA 2CW8A 3FDYA 4PJMA 3I4MJ 3EUAA 2X85A 3M3YJ 1AKHA 2VASA 1UMQA 3F9KA 1HDPA 1Z77A 4PUSA 2CQQA 5GPAA 2HI3A 3A03A 4NQWB 3OYEA 1ZKGA 4FE7A 3S2DJ 3DWLE 3Q0WA 1GDTA 4ZYAA 3FK6A 3BR6A 3KEYA 3OYMA 3U21A 5IYCJ 3K4CA 4A3IJ 3LOCA 1X1AA 2N8GA 4PSWA 4XLAA 2HVSA 1HA8A 1IV6A 3GTPJ 1S9HA 1WFXA 2CH0A 3HEFA 1ITYA 3OSGA 1YX5A 3L2QA 5HLTA 2W82A 2F5VA 4HNUA 3M8JA 4E7KA 2X1DA 3FKIJ 4RBOA 3RQIA 1O4XA 1MH3A 5IP7J 5M3FJ 3MD2A 2R93J 5EYRA 3BTJA 5J1RA 1GT0C 3J7AY 2WA0A 1LFUP 5FKLA 1PYVA 3BG6A 2LD5A 3LFUA 3FK7A 4C9YA 3VWBA 4JX5A 5E3LA 3OS2A 2R7XA 2MG4A 3Q0VA 1I6HJ 2JN6A 4GRIA 2KMUA 4PJJA 3GTJJ 1LKXA 2HPIA 3OSFA 4H4KC 2JA7J 2VB6A 4U87A 4BDYA 1E0EA 2OC6A 3OIQA 1H89C 3ZXSA 3BR3A 2EQRA 3O8HA 1JUSA 1BL0A 5FKKA 2L0KA 3HOVJ 4JP0A 2DJIA 2MFZA 2NVYJ 3CF2A 4LITA 4QPOA 4F93B 1MW7A 5IP9J 4DYQA 1UG0A 2LLKA 2WB1A 3RZOJ 4BQOA 2HOSA 2PJRA 3IH3A 5LFAA 1ETVA 2CUEA 1JKRC 2V4JC 2X6WA 3BLYA 2XDVA 4PSXA 5FKMA 3S8PA 2EZLA 2Y31A 4AU7A 3TP3A 3JRCA 2CQXA 1PUFA 4V2GA 4OAZA 3A01B 4CCNA 1X19A 1Z7LA 4XLFA 3S2HJ 3E0JB 3JR9A 3FIWA 4C2UA 1G2HA 4XIDA 3LMMA 2L5QA 1UELB 3OYJA 4M3BA 5KHDA 2L9RA 2NVQJ 2VQLA 3H3VK 3K4JA 4EATA 1P7IA 3OWTA 4PFOA 5K7HA 4NC8A 4B44A 5HNHA 3JRIA 2MYSA 2AHQA 1QVTA 5EG0A 4BU2A 3BR5A 2E2IJ 3AFHA 3CJRB 4C3IJ 9ANTA 4RLFA 1H88C 2IGNA 3VSLA 1U9OA 1BR4A 3QPLA 2WAQA 5CPRB 1RKTA 2TCTA 3L1PA 2VXZA 4HSRA 5J1UA 1UAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D5V A;  4UUS A;  5FLM J;  2ZB9 A;  3S1R J;  3SDG A;  2RAE A;  3CMY A;  3CCY A;  2LK2 A;  2JMW A;  1A5J A;  4IHW A;  3G1M A;  3ZQH A;  3ZQF A;  2NVT J;  5EZH A;  2WB1 N;  3SJM A;  4DZJ A;  1JTX A;  1WCM J;  2DA5 A;  3BG5 A;  3OOU A;  3MN2 A;  4CYC B;  3GTK J;  4V2F A;  2VKV A;  2GM4 A;  2HQ5 A;  3E7L A;  1JGG A;  1YRN B;  5JLX A;  1PUF B;  5IOY A;  4A69 C;  3C2B A;  2EBI A;  3BR2 A;  3A01 A;  1LFB A;  3Q0U A;  1MBG A;  3IH2 A;  2LFB A;  2FX0 A;  2ID3 A;  2K9S A;  2CRG A;  2NVX J;  2VKE A;  3LNQ A;  1IGN A;  2E2J J;  3NAU A;  2DMQ A;  1ENH A;  2NS8 A;  4MO7 A;  2E19 A;  1K61 A;  1X2M A;  2HOT A;  4UUS B;  3S16 J;  3JRD A;  2JA8 J;  5C4J J;  1WPK A;  4BY7 J;  1MSE C;  1JKP C;  5C3E J;  4M3G A;  2K9N A;  1IJW C;  1QRY A;  3S1N J;  4W1U A;  1TWG J;  1MSF C;  1VND A;  2ECB A;  2H8R A;  2M2E A;  3GTO J;  1MBF A;  2WAQ N;  2Y9Z A;  1ZQ3 P;  4G12 A;  3SFI A;  3HOX J;  4X1E A;  4A3L J;  2LTP A;  3I4N J;  1JUM A;  3BTC A;  1IUF A;  3OIO A;  1TWA J;  2X48 A;  2XB0 X;  3S15 J;  4XIC A;  1R9T J;  2DA6 A;  4XRS G;  2DA4 A;  5IYD J;  4JX4 A;  2GLO A;  1SAN A;  5FKO A;  1F43 A;  2ECC A;  2HOA A;  1AHD P;  1FTT A;  2R5Y B;  1X2N A;  3G1O A;  5DS9 A;  3PO2 J;  2GBY A;  4M3F A;  1NK2 P;  1BA5 A;  2R0Q C;  1LE8 A;  5M5X J;  1XS9 A;  1SFO J;  4D5F A;  3NAR A;  5C4X J;  1RET A;  4AUX A;  2IEK A;  2R5Y A;  5FKN A;  3GTQ J;  5F0F A;  3BR0 A;  3JRE A;  1OFC X;  4UUT A;  2M34 A;  3MKL A;  2L7M P;  2EZK A;  3IV5 A;  4W97 A;  1F36 A;  2WV1 A;  3GTM J;  2CU7 A;  3HOW J;  2LKX A;  3O8G A;  1HCR A;  5F0C A;  1B8I B;  3S1M J;  2OF7 A;  2W48 A;  2ME6 A;  5EGO B;  3BTL A;  3TED A;  2E2H J;  3LSJ A;  1FEX A;  2AO9 A;  5E3O A;  3HKZ N;  1TWF J;  1GV2 A;  2EH3 A;  2K9Q A;  3HGY A;  5C44 J;  2TRT A;  4L5E A;  4B4C A;  1ZTR A;  2OPT A;  1MBK A;  1U9N A;  4HNV A;  1IDZ A;  2XPV A;  4AYB N;  1ORK A;  2LP0 A;  1HOM A;  1ETK A;  2VPR A;  2Y9Y A;  4MFD A;  1IC8 A;  3PM1 A;  4A3F J;  2QCO A;  2LR8 A;  4A3K J;  5FLV A;  2VI6 A;  4QTR A;  5IOZ A;  4QSH A;  2FJ1 A;  2XGC A;  2O8K A;  2JWT A;  2DMP A;  2DTZ A;  2NS7 A;  3VPR A;  1IRZ A;  2EZH A;  2KDZ A;  2PMZ N;  1A6I A;  2YU9 J;  3D1N I;  1K83 J;  3MVP A;  1W0U A;  2LY9 A;  1CQT A;  2LVS A;  2M9H A;  4A3B J;  4X6A J;  3B6A A;  2QF7 A;  4B1R A;  4A93 J;  2KT0 A;  1OCP A;  1ZGW A;  4FE4 A;  1JKQ C;  2O9L A;  2NOG A;  3G1L A;  2CUF A;  2JA5 J;  1XG1 A;  1NTC A;  1ETY A;  4JYK A;  1P7J A;  3ZQI A;  5JLW A;  5F04 A;  5E3M A;  3DEW A;  5IP6 A;  2XPW A;  2YS9 A;  1ETQ A;  4C3H J;  4A3D J;  4MFE A;  1WH5 A;  2G0E A;  4C2M J;  1FTZ A;  2L7F P;  1ZR2 A;  1JT6 A;  5F08 A;  2HYJ A;  1MBE A;  2DA3 A;  4BKX A;  2ID6 A;  1GV5 A;  3ZQC A;  4J19 A;  1JJ8 C;  1VFC A;  4BBS J;  3GBG A;  1RR7 A;  3ZOB A;  1Z0X A;  2R5Z B;  4Y52 J;  2MW8 A;  3K2A A;  3LSR A;  1YRN A;  1B8I A;  4I6Z A;  2DJN A;  3F0C A;  1Y1W J;  1OCT C;  5GPC A;  2DMT A;  4DW6 A;  1U78 A;  2XRL A;  1AU7 A;  1E3O C;  5GP9 A;  1IG7 A;  4Y7N J;  5DTD A;  4MLO A;  3HBL A;  5EDN A;  3ZQL A;  4DZP A;  2Y0S N;  1D5Y A;  4A3G J;  2L7Z A;  4A3E J;  1B72 A;  3H0G J;  2X6O A;  1NK3 P;  2CJJ A;  1IDY A;  1MBH A;  2E1O A;  2COB A;  3GTL J;  1MBJ A;  3QPS A;  1T56 A;  1TWH J;  1UHS A;  2XGE A;  3UKG A;  5M3M J;  1GUU A;  2XGD A;  3PO3 J;  5K7Z A;  4FIS A;  3HM5 A;  2DA2 A;  1EF4 A;  2XPU A;  4B3A A;  5M5Y J;  1I3Q J;  2ELK A;  5K7F A;  2YUS A;  2DA7 A;  1FIP A;  5IYB J;  3ZQG A;  3BR1 A;  4XRM A;  1QPI A;  3LSG A;  1HDD C;  4D5C A;  5EZG A;  3M4O J;  3Q3S A;  2M0C A;  3HOY J;  3TP0 A;  3CQZ J;  4QIW N;  3BG3 A;  3HOZ J;  3JRF A;  4IHV A;  4D7M A;  2XB5 A;  3BTI A;  1GVD A;  1S7E A;  4C3J J;  4BBR J;  2B63 J;  4DYC A;  1ZR4 A;  5F27 A;  1BW5 A;  1B72 B;  3HDD A;  3W6V A;  1UG2 A;  1T33 A;  1ETW A;  3DCF A;  1H8A C;  3BQZ A;  1LE8 B;  1WH7 A;  1BJZ A;  5EF6 A;  4FTH A;  2P81 A;  3S14 J;  1QVU A;  3FIS A;  1JTY A;  3JRG A;  5M5W J;  3BT9 A;  4A3J J;  3JRH A;  4BY1 J;  2IAI A;  2MGQ A;  1FIA A;  4GFB A;  3S1Q J;  4BXX J;  4NDL A;  5F1J A;  4MIM A;  3K7A J;  3RZD J;  4XK4 A;  1XC5 A;  3HGG A;  2JJ7 A;  4DYR A;  2MSY A;  4S0H B;  2IBD A;  2ME0 A;  4XRS A;  1JKO C;  2HXI A;  5IPA A;  4D7N A;  1RPW A;  3BQY A;  1Q1V A;  4I76 A;  1DU0 A;  2JA6 J;  1APL C;  5HOD A;  1POG A;  1JUP A;  1JT0 A;  2O7O A;  5EG0 B;  3LSP A;  1Y1V J;  5BNG A;  3B6C A;  4AC0 A;  1U8B A;  3GTG J;  4M3D A;  3IH4 A;  2FD5 A;  2H1K A;  1VI0 A;  1MNM C;  3JRA A;  4EEF G;  2I10 A;  3WHB A;  1BW6 A;  1I50 J;  4ABZ A;  4FCY A;  5EEA A;  4M6V A;  2HDD A;  1RES A;  3TW6 A;  3CDL A;  1ETO A;  3RKQ A;  5J1Y A;  4IEJ A;  3S17 J;  2R5Z A;  4A3C J;  5J3L A;  4IHX A;  2EZI A;  3A02 A;  1TWC J;  2FQ4 A;  3QQA A;  1FJL A;  2R7Z J;  1WI3 A;  3HB9 A;  3JRB A;  1JJ6 C;  4CYC A;  2X9D A;  1ZK8 A;  4RDU A;  2DMN A;  1OJL A;  2M8G X;  5E3N A;  1HLV A;  2VUM J;  3BG9 A;  5EGO A;  1X58 A;  3HOU J;  1HF0 A;  4A3M J;  1RKW A;  1WGX A;  2Y30 A;  4IHY A;  4JX6 A;  2DN0 A;  5F0H A;  2JK3 A;  2Y2Z A;  2XSD C;  1AKH B;  1DU6 A;  3WHC A;  2K40 A;  1VF9 A;  1MH4 A;  1ETX A;  4LOC A;  3TW7 A;  2HXO A;  2DMU A;  4M3E A;  1TC3 C;  5FJ8 J;  2DA1 A;  2R92 J;  1W0T A;  3I4M J;  3M3Y J;  1AKH A;  1UMQ A;  1HDP A;  1Z77 A;  2CQQ A;  5GPA A;  2HI3 A;  3A03 A;  1ZKG A;  4FE7 A;  3S2D J;  3Q0W A;  1GDT A;  3FK6 A;  3BR6 A;  5IYC J;  4A3I J;  3LOC A;  2N8G A;  1IV6 A;  3GTP J;  3HEF A;  1ITY A;  3OSG A;  3FKI J;  4RBO A;  3RQI A;  1O4X A;  1MH3 A;  5IP7 J;  5M3F J;  2R93 J;  5EYR A;  3BTJ A;  5J1R A;  1GT0 C;  1LFU P;  5FKL A;  2LD5 A;  3FK7 A;  4JX5 A;  5E3L A;  2MG4 A;  3Q0V A;  1I6H J;  2JN6 A;  3GTJ J;  3OSF A;  2JA7 J;  1H89 C;  3BR3 A;  2EQR A;  3O8H A;  1JUS A;  1BL0 A;  5FKK A;  2L0K A;  3HOV J;  4JP0 A;  2NVY J;  5IP9 J;  4DYQ A;  2LLK A;  3RZO J;  2HOS A;  3IH3 A;  1ETV A;  2CUE A;  1JKR C;  5FKM A;  2EZL A;  2Y31 A;  3TP3 A;  3JRC A;  2CQX A;  1PUF A;  4V2G A;  3A01 B;  3S2H J;  3JR9 A;  3FIW A;  1G2H A;  4XID A;  4M3B A;  2L9R A;  2NVQ J;  3H3V K;  1P7I A;  5K7H A;  3JRI A;  2AHQ A;  1QVT A;  5EG0 A;  3BR5 A;  2E2I J;  4C3I J;  9ANT A;  1H88 C;  1U9O A;  3QPL A;  1RKT A;  2TCT A;  3L1P A;  5J1U A; 
#chains in the Genus database with same CATH topology
 3HHH A;  4ESF A;  2FUG 2;  1LUJ B;  4RAF A;  3CES A;  4ENM A;  2JUC A;  1WHU A;  4A2U A;  3S1R J;  3PIO F;  3CMY A;  5GAH J;  3FF5 A;  2LK2 A;  1A5J A;  1OR7 C;  2VKH A;  3WGI A;  4YEJ A;  2Y75 A;  3ZQF A;  1U0J A;  2VJ4 A;  3KEO A;  5KVR A;  5LHG A;  3I71 A;  1K7A A;  3F8F A;  4PGH A;  4V2F A;  2VJ5 A;  4Y13 A;  3GWZ A;  3MKW B;  2GM4 A;  2VJJ A;  3KP2 A;  4XKC A;  4D0P A;  1YRN B;  5JLX A;  2IA0 A;  2P5K A;  3A4C A;  4RAG A;  2P6S A;  2EBI A;  2RGV A;  1O7F A;  3BR2 A;  3EUH C;  5FRO A;  4LFU A;  2RC4 A;  2CUZ A;  3Q0U A;  1QHG A;  2L3D A;  1XSV A;  3IH2 A;  3L2W A;  2ID3 A;  3C18 A;  1G3T A;  1Z3Y A;  3E3V A;  3LNQ A;  2E2J J;  3DKY A;  4CO8 A;  5CQE A;  2BYV E;  1RIO H;  1OLT A;  4MQV A;  4MO7 A;  4E4H A;  3SYT A;  2HOT A;  3ABK H;  2EV6 A;  4GYI A;  4UUS B;  3S16 J;  4MEX F;  1VQ6 I;  3FMQ A;  4I7H A;  3J81 K;  2JA8 J;  1R58 A;  1WPK A;  4BY7 J;  2OAZ A;  1D3Y A;  1NG7 A;  1JKP C;  1SVM A;  3OOP A;  5HLG A;  2Z9O A;  1IJW C;  2OTL I;  2VC0 A;  1ZEL A;  1T95 A;  3G4S I;  3T0Y A;  2FMY A;  5EEG A;  1G6N A;  2M2E A;  1V5G A;  3HOX J;  1G3W A;  5CVJ A;  3CO6 C;  2H27 A;  4C2T A;  4XM3 A;  3KFW X;  4KIT B;  4A3L J;  2WAE A;  1RRJ A;  4G7O F;  2IA2 A;  4KDP A;  1IF1 A;  1FYL A;  1VZ0 A;  1Z21 A;  3ZQ7 A;  1TLH B;  3ZPL A;  5ICC A;  3QP5 A;  5LEK A;  4XIC A;  4EGZ A;  2QGU A;  5ICG A;  2HZD A;  1TP4 A;  2IJL A;  3V8J A;  4JX4 A;  4S04 A;  2I5U A;  3QOD A;  3FXK A;  3OL4 A;  3MZH A;  3W6K B;  4KN7 X;  2Q8K A;  3B02 A;  3M1C A;  2KRF A;  3K4B A;  2R7W A;  4J00 A;  3G1O A;  3NWS A;  5BPD A;  4UVB A;  2PFB A;  2V1N A;  3SZT A;  1XS9 A;  3A0H C;  5C4X J;  5E17 F;  1MDM A;  2IEK A;  2X6Y A;  5E20 A;  2KHM A;  2R5Y A;  3IKV A;  5FKN A;  3JRE A;  2NAZ A;  2XSJ C;  1S72 I;  2M34 A;  3MKL A;  2K02 A;  1Z9C A;  1U5T A;  1SD5 A;  1F36 A;  4HX8 A;  1K6Y A;  5F6F A;  2GXA A;  3S3O A;  1S7A A;  1Y39 A;  3DQV C;  3HOW J;  1MIJ A;  4L5I A;  3Q5F A;  3O8G A;  4PZJ A;  4IRI A;  3BZC A;  3OWT A;  1HCR A;  4DQ2 A;  2ME6 A;  1PUE E;  5J40 A;  5EGO B;  4CCO A;  5GTH C;  3LSJ A;  1W5T A;  1Z67 A;  1TWF J;  1W36 D;  4IOA F;  2WWY A;  1AWC A;  2OQG A;  3ELK A;  2R7U A;  2TRT A;  2W25 A;  2OPT A;  1T38 A;  3LFK A;  5AON A;  2MAB A;  3I55 I;  2QSG X;  4RGU A;  2DCE A;  3BOQ A;  5J8F A;  2PJP A;  2UV1 A;  3D5R C;  4IQJ A;  1XGO A;  4EMS A;  2DT6 A;  4MFD A;  2LR8 A;  1ZAR A;  2HKX A;  2BGC A;  4HF1 A;  2JVG A;  2UUZ A;  3R6S A;  5K5R A;  4N0B A;  3V42 A;  3CUQ A;  2P6T A;  3RPU A;  3I9V 2;  2FJ1 A;  2O8K A;  3TOA A;  4BQQ A;  1AOY A;  1W36 C;  2LY2 A;  4UB6 C;  2NS7 A;  3CTA A;  4HLY A;  3O6B B;  2KDZ A;  1UHW A;  3D1N I;  2DK8 A;  1QPM A;  3MVP A;  3IAM 2;  2DOD A;  3KP7 A;  1EJ9 A;  1IAW A;  3QOP A;  5J4Y A;  4X6A J;  3GFJ A;  4E7L A;  2EIL H;  4B1R A;  5E79 C;  2ZKZ A;  4A93 J;  3L7W A;  2KT0 A;  4HZF A;  1OKR A;  3B73 A;  3K1P A;  1FZP B;  1JKQ C;  4PK4 A;  2CUF A;  4IO9 F;  2JA5 J;  5HLI A;  2A6H F;  1HW1 A;  3DTI A;  3MFK A;  2M4G A;  2D1H A;  4Y3O A;  1P6R A;  2HKO A;  3ZQI A;  1IV8 A;  5JLW A;  3CCR I;  2E60 A;  2COM A;  2OCC H;  2BW3 B;  1YOV B;  3OR1 C;  4RS8 A;  2XPW A;  5GTI C;  2V9K A;  3IWZ A;  3RI4 A;  4BS9 A;  4B43 A;  1WH5 A;  2LF7 A;  4L9N A;  4ZTF A;  1HW5 A;  4C2M J;  4OIQ F;  2GXB A;  4HX4 A;  5TGT A;  1Y6I A;  3A2K A;  5F08 A;  5ICE A;  1LJ9 A;  1PP7 U;  3WTT C;  1XDS A;  3ZQC A;  5AIQ A;  2E1N A;  1JJ8 C;  2F5D A;  3GUD A;  5JFR A;  1YO5 C;  3DU6 A;  2KL4 A;  2FOK A;  1Z0X A;  2R5Z B;  3K1N A;  3LA3 A;  1IN8 A;  1CF7 B;  2UXN A;  1W1W E;  2G9W A;  2FBK A;  2JSP A;  3HYI A;  2PMZ A;  4DW6 A;  4Z6Y A;  2ZCW A;  4GO1 A;  4UNO A;  2L9V A;  5GP9 A;  1IG7 A;  1SMT A;  2FE3 A;  2CQ7 A;  3FMS A;  2CV2 A;  3A1Y A;  5DTD A;  4Y7N J;  2HVR A;  3N05 A;  4BDZ A;  2A3S A;  5KAF C;  2V9V A;  2R7S A;  3JCU C;  5ERI A;  2AQF A;  3A0B C;  2E5N A;  5D5X B;  4XQF A;  2NVU B;  1D5Y A;  4A3G J;  3RJP A;  1B72 A;  2X6O A;  3V4G A;  2PJR B;  1XB4 A;  4XLH A;  3IL2 A;  1O57 A;  2WBM A;  3CJT B;  1E17 A;  5L3E A;  1R4M B;  2KZG A;  3GTL J;  2BY0 A;  1T56 A;  1TWH J;  3C1D A;  4YIF A;  4I09 A;  1YFH A;  2MLG A;  3H9J A;  5BQT A;  2HVQ A;  3PO3 J;  1NH3 A;  2Q0O A;  5DCM A;  1RUN A;  3ZN1 A;  3BY6 A;  4B3A A;  5M5Y J;  2DOF A;  1FX7 A;  2E71 A;  2QWW A;  3FKJ A;  4G7Z F;  2X1E A;  3CCV I;  3KET A;  4LLN A;  3P9K A;  2K5C A;  3BP8 A;  1MMG A;  2GZW A;  5IYB J;  2KQR A;  1R5H A;  3DLL F;  4XRM A;  2R7Q A;  2LNB A;  4DNC A;  4D5C A;  5EZG A;  4HX7 A;  3Q3S A;  4PJ0 C;  3CQZ J;  3BPV A;  3Q9V A;  2VQH A;  3TGN A;  1AA7 A;  2HWV A;  2CFX A;  4PJN A;  1DUX C;  2XF6 A;  3PQJ A;  1Z6R A;  1BW5 A;  1XSD A;  3W6V A;  2EIM H;  3DCF A;  4KIG A;  2K4J A;  3BQZ A;  3CCL I;  4IZZ A;  3DTE A;  2OZU A;  3LL7 A;  4UVA A;  2V7F A;  2IGK A;  1M1E B;  3F22 A;  5ILV A;  2P81 A;  1MGT A;  1MMD A;  1QVU A;  3JRG A;  5M5W J;  3ZRG A;  4PJL A;  4BY1 J;  2IAI A;  1QHH D;  1V5F A;  1FIA A;  3S1Q J;  2MLK A;  1IXC A;  2VJI A;  3FXR A;  5E18 F;  4KJZ A;  3L2V A;  3K7A J;  3RZD J;  1TTY A;  2F4I A;  1ZRF A;  1HKQ A;  5DCM B;  1X4O A;  2HXI A;  1G59 A;  5IPA A;  4ZZL A;  3BQY A;  1Q1V A;  4DBQ A;  1IRF A;  2OBP A;  2VE9 A;  1POG A;  4M3D A;  2VOO A;  4LMY A;  1SVL A;  2JPC A;  4AID A;  2KIU A;  2P7C B;  3JAM K;  3JRA A;  2I10 A;  3KP6 A;  1QZZ A;  3WHB A;  4KFC A;  5IT9 Z;  2XAJ A;  4Q47 A;  5D6E A;  1OCZ H;  1PDN C;  2O0Y A;  4M6V A;  3RKQ A;  2IS2 A;  1R00 A;  3I3L A;  2EZI A;  2R7V A;  2R7Z J;  1FJL A;  3HB9 A;  2LH9 A;  1VQM I;  2HGC A;  3I59 B;  4I99 C;  5LHI A;  2A6E F;  1X4P A;  1VQP I;  2M8G X;  2W1O A;  2PG4 A;  2HZT A;  5CQG A;  3SEQ A;  2EWN A;  1XMK A;  3FXO A;  1TW3 A;  2ZFU A;  4XOT A;  3HOU J;  1HF0 A;  4B48 A;  2FNA A;  1V4R A;  4A3M J;  1RKW A;  1XTA A;  1FMV A;  4JX6 A;  2DN0 A;  4EVI A;  4IKF A;  3FWE A;  1DU6 A;  4Y4R A;  2K40 A;  4EJW A;  1MH4 A;  2ZSI B;  3BJ6 A;  3J7Z I;  2ZXI A;  2ISZ A;  2HDC A;  4M6Y A;  1MNE A;  4O6J A;  4AM3 A;  2CW8 A;  3GZ5 A;  1W0T A;  1RNL A;  1B4A A;  2VAS A;  1UMQ A;  4XLF A;  1Z77 A;  3M3Y J;  1QQI A;  1YLF A;  2EV5 A;  4BAY A;  4R8H A;  1L3L A;  3DWL E;  3Q0W A;  3WE2 A;  3OYM A;  2JQ7 A;  5H2F C;  1FPQ A;  5LRS A;  1YW7 A;  1JGS A;  5IYC J;  3K4C A;  3GZN B;  5LRR A;  4E70 A;  4PSW A;  2HVS A;  1EH7 A;  3M9A A;  4GDF A;  2AS5 F;  1HA8 A;  1S9H A;  4NB5 A;  5B1B H;  3GTP J;  3HEF A;  2GIV A;  1H9G A;  2F5V A;  2EA4 A;  2X1D A;  3FKI J;  5GAG J;  4GXO A;  3VEP A;  5A2Q K;  1E3H A;  2R93 J;  2VC1 A;  3BTJ A;  5DUI A;  2X0L A;  1LFU P;  5FKL A;  2V1D A;  3FK7 A;  4I0A A;  1TL8 A;  2K27 A;  5E3L A;  2DBB A;  2MG4 A;  2JN6 A;  1VQ5 I;  4Q4Z F;  2VB6 A;  2OC6 A;  4I02 A;  1H89 C;  3BR3 A;  3HOV J;  1BL0 A;  3BWG A;  3KPH A;  3ABU A;  4DYQ A;  3GLX A;  4BQO A;  2HOS A;  2PJR A;  3RZO J;  5LFA A;  2CUE A;  4LJZ F;  1JKR C;  3BLY A;  5E1Z B;  1BBY A;  1W5S A;  4AU7 A;  5CJ9 A;  4NQW A;  2CQX A;  3E6B A;  3A01 B;  1X19 A;  1Z7L A;  5DCF A;  3JR9 A;  1FOX A;  1G2H A;  3KCC A;  3OYJ A;  1KU7 A;  2ZJ2 A;  1J2X A;  3K4J A;  1P7I A;  2DW4 A;  3JRI A;  1JE8 A;  1FLI A;  1QVT A;  4BU2 A;  5EG0 A;  1YJW I;  2E2I J;  3R60 A;  4C3I J;  9ANT A;  3VSL A;  2IGN A;  5LLQ A;  1BR4 A;  2TCT A;  3M8E A;  3L1P A;  4HSR A;  3N97 A;  1UAA A;  2BVL A;  1I3A A;  4KIB A;  2R3S A;  3OL3 A;  2BW3 A;  1JHF A;  3BCB A;  2RAE A;  1XX5 A;  4MTD A;  3PFI A;  2ELH A;  4LB5 A;  2JMW A;  2JZY A;  4N4N B;  2V26 A;  2Z16 A;  2NVT J;  1F1Z A;  1MD0 A;  3S32 A;  5J47 A;  5HS8 A;  2ZXW H;  3KP3 A;  4EJT A;  1P92 A;  1IN7 A;  3MN2 A;  4CYC B;  4N9I A;  1K79 A;  4BHC A;  1XPX A;  4WXC A;  1JGG A;  4JBA A;  4CH7 A;  1U5T B;  1YX3 A;  2QKL B;  4Y15 A;  3A01 A;  3FX3 A;  5CVI A;  1MBG A;  3BG7 A;  4AWX B;  4BGD A;  2JUG A;  1FP2 A;  4L9V A;  2NVX J;  2VKE A;  1LFP A;  4BE1 A;  2JRT A;  4E7J A;  2VPL A;  2DMQ A;  3WTV C;  4XNF A;  1TT5 B;  6PAX A;  3HOS A;  1J5Y A;  1YS7 A;  3JRD A;  1OR7 A;  2L2O A;  2UZK A;  3CLQ A;  4XN3 A;  4GYG A;  4AIK A;  3LSM A;  3HC7 A;  2IRF G;  1MSE C;  1N75 A;  1UFM A;  1D1A A;  5CVV A;  3OS1 A;  3CCE I;  4B8X A;  2QSH X;  2KPM A;  3S1N J;  1TWG J;  1VND A;  4BHB A;  2NXN B;  3DBH B;  2ECB A;  4P55 A;  2H8R A;  2OTJ I;  3MWM A;  5D4R A;  3OYI A;  2DFE A;  4G12 A;  3GME A;  5HVQ C;  3EUH A;  2DAO A;  3R4K A;  2B0L A;  2ZXJ A;  2RQP A;  1WJB A;  3W3C A;  2LTP A;  3PSI A;  2DK5 A;  3HRU A;  1VQO I;  1J7K A;  3BTC A;  3OIO A;  1TWA J;  2W85 A;  4XKV A;  2LRE A;  2VBZ A;  3JW4 A;  2VQC A;  1ERD A;  3MKZ A;  5E8I A;  2DA6 A;  3TQN A;  2A68 F;  3WGH A;  5IYD J;  2B7E A;  1VQ4 I;  4K2E A;  2IS4 A;  1SAN A;  1F43 A;  4HNT A;  2ECC A;  1T08 B;  1C0W A;  1OIS A;  1IN6 A;  4QPQ A;  1WSU A;  2W57 A;  2GBY A;  2R7D A;  3W2V A;  3F8M A;  1NK2 P;  3M07 A;  2R7R A;  4IQ4 A;  1LE8 A;  3OIP A;  4D5F A;  4ETS A;  2X6X A;  3EUK L;  4AUX A;  3BR0 A;  1OFC X;  3ISP A;  5CKT A;  4X0G A;  2L7M P;  2EZK A;  3IV5 A;  4W97 A;  4NHJ A;  1TT0 A;  5FLX K;  3W6J B;  1YE9 A;  2IS1 A;  2FBH A;  5B5E C;  2A05 A;  3I54 A;  5TIS C;  2VLA A;  3GTM J;  2LKX A;  4V19 K;  3LST A;  2W48 A;  1J09 A;  3K10 A;  4HDV A;  3TED A;  1WQ2 A;  3S3N A;  4RAY A;  3HKZ N;  2EH3 A;  1SVO A;  5LEJ A;  1BR1 A;  1IW7 F;  3PQK A;  4N9H A;  4BL0 B;  4L5E A;  2CQK A;  4B4C A;  1U9N A;  4ZDL A;  3FHN A;  2BY2 A;  2VXD A;  1K6O A;  1HKS A;  3GXO A;  1HOM A;  2VPR A;  3PNT A;  3CC7 I;  2V1U A;  2Y9Y A;  4WCG A;  3PM1 A;  2M3A A;  4A3F J;  2QCO A;  1Z3X A;  2O61 A;  3IAS 2;  3P9I A;  4A3K J;  3U1K A;  1OCO H;  5FLV A;  3AG2 H;  4LK1 F;  2F4M B;  1OCR H;  2XGC A;  1PJR A;  4IL6 C;  4C30 A;  2JWT A;  2DMP A;  3RQ4 A;  4BXU A;  1JXS A;  1U5T C;  2BOL A;  3LA7 A;  2DTZ A;  1FT9 A;  2PI0 A;  2C6Y A;  1BI3 A;  1IRZ A;  4BXF A;  2VBW A;  5D5W B;  3KZY A;  1QZE A;  3IHU A;  3CD6 I;  1K83 J;  3L9F A;  4CZZ A;  1R5G A;  4EJU A;  2LY9 A;  4XLC A;  1CQT A;  2V79 A;  2M9H A;  3RPQ A;  1QO0 D;  4A3B J;  3B6A A;  1B9N A;  5L3C A;  2A61 A;  1HSJ A;  1OCP A;  1ZGW A;  3QWL A;  4CCJ A;  3FHZ A;  5L3D A;  2O9L A;  1XG1 A;  5FLX Z;  2KIF A;  4JYK A;  4RM3 A;  2HS5 A;  1LEA A;  3CMM A;  4J01 A;  1U3E M;  3HSR A;  3PNY A;  2VIX A;  5F04 A;  2DQL A;  5E3M A;  1T6S A;  1FSH A;  3H3U A;  3DBR B;  4ZYE A;  2VKD A;  1ETQ A;  4ZTJ A;  5K5O A;  4LLG F;  4A0Y A;  4MFE A;  3IWF A;  3DV8 A;  3TO9 A;  2L7F P;  1IRX A;  3VOD A;  1ZR2 A;  1DP3 A;  2E36 A;  1O3S A;  2DA3 A;  3ROU A;  3MKY B;  2CMP A;  2ID6 A;  4EJV A;  3FBN B;  1VQN I;  4KT5 C;  2P0W A;  1IXS B;  2RNG A;  4HEA 2;  4KUM A;  3GBG A;  4LG0 A;  1YTY A;  2DXI A;  4BBS J;  4Y52 J;  2VL8 A;  2DJN A;  2HQA A;  3PUF A;  3FZV A;  4O5V A;  1Q1H A;  2Y69 H;  3HHG A;  2GOX B;  1OCT C;  2DMT A;  1P9Q C;  1U78 A;  4CA0 A;  5FRN A;  3V8K A;  1E3O C;  2M30 A;  4R79 A;  2CO5 A;  3DPU A;  3LWF A;  1JHH A;  2GWR A;  1GLN A;  5F64 A;  3K4L A;  1U2W A;  1NHA A;  1CF7 A;  5JHF A;  2IXS A;  1ZGA A;  1X1B A;  2EIN H;  1UZC A;  4MLO A;  4BEH B;  4NUB A;  2H09 A;  3GW2 A;  4DZP A;  2Y0S N;  4N4O B;  3T8T A;  1W7P A;  1D0Y A;  2L7Z A;  4A3E J;  2QQ8 A;  3HTU A;  3E5U A;  2VE8 A;  2HEO A;  2CJJ A;  4M73 A;  3FM5 A;  2E1O A;  2COB A;  1EA3 A;  1L0O C;  1MBJ A;  3EQL F;  4II3 A;  1UHS A;  1V54 H;  4IRG A;  2BXY A;  4OMZ A;  3ZMT A;  2LMD A;  2HR3 A;  5J8C A;  2XGD A;  3KLN A;  4RB1 A;  1R6R A;  4FT8 A;  4JOM A;  4UB8 C;  3GFI A;  2XAG A;  4WXD A;  3SEZ A;  3FXJ A;  3VOE A;  2K85 A;  2PN6 A;  3ZMS A;  3KX2 A;  2QEN A;  1ONV A;  1I3Q J;  4MNU A;  4A0X A;  1DPR A;  4OIO F;  2KJC A;  2XAH A;  4CCL A;  3HRS A;  3ZN0 A;  1QPI A;  2X1C A;  3L00 A;  1HDD C;  2WV0 A;  3BZK A;  1U8R A;  2KKO A;  2QA4 I;  4XOR A;  2ISY A;  3LQR A;  3BJA A;  1LDK B;  3K6G A;  2I8D A;  3WG9 A;  2KLO A;  3FXU A;  1VTN C;  4IHV A;  2QUF A;  3PL8 A;  4C3J J;  2OV7 A;  3WOD F;  3CC2 I;  2F6C A;  5F27 A;  3NEU A;  4ON0 A;  4RB3 C;  3IUO A;  1Y0N A;  1D1B A;  1ETW A;  3RYP A;  3FM3 A;  1MJB A;  4Y33 A;  3CCQ I;  3BC8 A;  4YIR X;  1LE8 B;  1BR2 A;  5EF6 A;  2A07 F;  1S5L C;  2YU3 A;  2QM3 A;  3CLO A;  1O3R A;  3KYC B;  1D8J A;  2J5P A;  3M8F A;  3ULQ B;  2BZT A;  1R49 A;  4AYB A;  4XKW A;  4S05 A;  2W4S A;  2ZJR F;  2EIJ H;  2LKS A;  4E6K G;  1IRG A;  2XAF A;  4IRH A;  3N4M A;  3K4N A;  4S0H B;  2IBD A;  2ME0 A;  3V8L A;  1B6A A;  3NWT A;  1JKO C;  2STW A;  2HOE A;  3P7N A;  1FYM A;  2IT0 A;  4KT6 A;  2XGX A;  1BN5 A;  1KZH A;  4LB6 B;  1RPW A;  4HW0 A;  4I76 A;  3QOE A;  5FRM A;  2JA6 J;  1Z91 A;  1FOK A;  3WTZ A;  4MQ9 F;  3BCA A;  2XHK A;  3HUG A;  5HOD A;  1JT0 A;  3ESW B;  4HF2 A;  3LSP A;  1U8B A;  3RYR A;  2P8T A;  3CCU I;  3ZMZ A;  2LBF B;  2ETH A;  2A69 F;  1RUO A;  1VI0 A;  1MNM C;  1TZL A;  4EEF G;  1BW6 A;  2Q1Z B;  4ABZ A;  5EEA A;  2XKP A;  2L4A A;  3OR2 C;  5BPI A;  4CCK A;  3HPG A;  1RES A;  3TW6 A;  3CDL A;  1IN5 A;  1BIA A;  1ETO A;  1MKM A;  2R5Z A;  1MND A;  4QWQ A;  4F91 B;  1HBX G;  4HYE A;  5TJJ A;  4KMF A;  1I5Z A;  4AVZ A;  4XOP A;  2X9D A;  3ZR8 X;  2DMN A;  1ZN2 A;  2HTJ A;  2WAF A;  1OJL A;  5DDG A;  1HLV A;  3ECO A;  3HRM A;  4HG2 A;  3BG9 A;  4ANJ A;  4ZYG A;  3LAJ A;  2F48 A;  1R1V A;  3GLL A;  1FBS A;  4BHP A;  3HJE A;  4II2 A;  3HSF A;  3E97 A;  5CVR A;  3K69 A;  1N77 A;  4CCM A;  3WTY C;  2Y30 A;  5FD6 A;  1E3P A;  3AG1 H;  2XAU A;  5DD4 A;  2F4O B;  2JK3 A;  2Y2Z A;  2XSD C;  2IW5 A;  2JTV A;  5DD8 A;  4ZC3 A;  1GXP A;  1AKH B;  5CVU A;  1KQ8 A;  4LOC A;  3TW7 A;  5KAI C;  2HXO A;  2ZO4 A;  4KIS A;  4P5O A;  2EJR A;  2VOD A;  4G6T B;  2STT A;  5FJ8 J;  1LVK A;  2DA1 A;  5FFZ A;  2NRA C;  2R92 J;  3I5U A;  2MC3 A;  1AKH A;  2HI3 A;  5GPA A;  1KYW A;  5E1W A;  1EV7 A;  1ZKG A;  1G3Y A;  1ON2 A;  2ZME C;  1GDT A;  3KEY A;  4OMY A;  3I0T A;  1SD4 A;  4M9S A;  1WFX A;  3IC7 A;  2CH0 A;  3HSE A;  1J0R A;  2W82 A;  3M8J A;  5M3F J;  2QVO A;  1R5I D;  1GT0 C;  2WA0 A;  4BNC A;  4C9Y A;  1QNT A;  2L4M A;  2NNN A;  3I53 A;  4JX5 A;  2OD5 A;  3OS2 A;  2RNJ A;  1I6H J;  4PJJ A;  3F21 A;  2E7W A;  2JA7 J;  3QPT A;  3OIQ A;  2QBY B;  2EQR A;  2MFZ A;  5KCM A;  5FKK A;  4JP0 A;  5CYV A;  1A31 A;  2P5L C;  2FRH A;  1UCR A;  2LLK A;  2E7X A;  2CYY A;  2X6W A;  2XDV A;  5FKM A;  5H20 A;  5JHU A;  3TP3 A;  4CCN A;  2O8X A;  4LG0 B;  5IT9 K;  4A0Z A;  3S2H J;  3WU0 A;  3I59 A;  2FSW A;  2QZ8 A;  3IKT A;  4C2U A;  1DDN A;  1UEL B;  4AD9 A;  3H3V K;  4EAT A;  4PFO A;  3CC4 I;  1ULY A;  4NC8 A;  4B44 A;  2MYS A;  2AHQ A;  3S2W A;  3CJR B;  3HTS B;  2KIQ A;  2WAQ A;  1RKT A;  4A12 A;  4DOZ A;  2TDX A;  4BEH A;  4RMN A;  3VDX A;  4UUS A;  5FLM J;  2ZB9 A;  3DKW A;  1D8K A;  1OCC H;  3K2Z A;  1Y56 A;  3SDG A;  3CCY A;  2ZC2 A;  2E1C A;  1VQK I;  1S3J A;  4IHW A;  2L7K A;  4G6Q A;  3G1M A;  1Y8R B;  3ZQH A;  1KU9 A;  3EYI A;  4OU0 A;  4L9J A;  4XSX F;  3JTH A;  1DGW Y;  4KIF A;  2BHZ A;  1QA6 A;  1S29 A;  5FD5 A;  2KJB A;  3GO5 A;  3E6C C;  1F9N A;  3IP4 B;  4U7B A;  2HQ5 A;  3E7L A;  4NC7 A;  3R0A A;  2KDO A;  1PUF B;  1LDJ A;  4XBF A;  3AL0 C;  3J80 K;  2IS6 A;  1ZG5 A;  3V7C A;  3W2A A;  1LFB A;  3G73 A;  4EM2 A;  4KN4 X;  1DGR M;  1XSX A;  3E6D A;  1KU2 A;  2LFB A;  1X1D A;  1U6G A;  2JPB A;  2MD5 A;  4U0Y A;  2ZNZ A;  2R7T A;  4I01 A;  3WG7 H;  2BHY A;  3FXM A;  2NS8 A;  1K61 A;  2Y0M A;  1X2M A;  2KZV A;  1WKM A;  3F72 A;  3D5S C;  3PFY A;  1K78 B;  5HDK A;  3HUG B;  2BY1 A;  1K4T A;  4M6X A;  3WTW C;  1WJA A;  3ZP5 A;  2J5O A;  2K9N A;  3TKY A;  3TL4 X;  2LOO A;  3WTU C;  4ZJZ A;  4E7S A;  1W4M A;  2NNY A;  2V6C A;  3GTO J;  2WAQ N;  2Y9Z A;  1ZQ3 P;  1BI2 A;  3SFI A;  2M8E A;  2LSO A;  5LGU A;  2Z5U A;  3H5A A;  1BC8 C;  2P5V A;  2X48 A;  3S15 J;  4HQM A;  3DP7 A;  2Y0S A;  1R9T J;  1GHC A;  1XCB A;  4OWR B;  4DBR A;  2PQ8 A;  2FOW A;  2JA2 A;  3ABM H;  3RSN A;  2DT7 B;  2GLO A;  4KYW A;  5FKO A;  3GFL A;  2E1M B;  2HOA A;  3TDZ C;  1FTT A;  5BS6 A;  1WJ5 A;  1X2N A;  1DPU A;  2QQ9 A;  2MD0 A;  1R7J A;  1VQ8 I;  1MZB A;  4O3M A;  1X3W B;  2R0Q C;  1S7O A;  1TBX A;  2FA5 A;  3BJO A;  1DP7 P;  2P7V B;  4U0W A;  5LHH A;  3WTS C;  3NAR A;  1VQ9 I;  1RET A;  2OA4 A;  2QQB A;  4F52 A;  3PUB A;  3GTQ J;  5F0F A;  1QGP A;  2Z3Y A;  4Y17 A;  2Y48 A;  4G6D A;  4MTE A;  4BJ5 C;  2M87 A;  1O7L A;  2IVM A;  2HU9 A;  2CS3 A;  1R1T A;  2CU7 A;  4HRI A;  3P9C A;  3GEZ A;  1USS A;  2XRN A;  1B8I B;  3S1M J;  2AXL A;  1MMS A;  3BTL A;  1P4W A;  1ZG1 A;  1LVA A;  3K70 D;  5DEQ A;  2JRM A;  1GV2 A;  3H9G A;  2CGP A;  3RKW A;  5C44 J;  2CUJ A;  1SC7 A;  3R61 A;  4FAS D;  2K3P A;  3LSH A;  3V7S A;  1IDZ A;  1ZAO A;  2M45 A;  3K4M A;  4AYB N;  2BVM A;  2FNP A;  1IZ1 A;  2ZSH B;  2PMU A;  5HDN A;  3DXJ F;  2ESN A;  3NRV A;  4KMU X;  4XL9 A;  5DM6 F;  2RRE A;  2V6E A;  1XMA A;  2KIM A;  2UXX A;  4LLL A;  2D45 A;  4QTR A;  4P9F A;  5IOZ A;  4QSH A;  3MAJ A;  1MDM B;  1ZRC A;  2ELJ A;  1WJF A;  2Z99 A;  4U0V A;  1LB2 A;  3EDP A;  1D0X A;  2BE5 F;  2HPM A;  2ZXH A;  2R7F A;  2H94 A;  3J81 Z;  3VPR A;  4HST A;  1WVR A;  1A6I A;  4FHT A;  3CJQ B;  3VSK A;  2YU9 J;  2ZJP F;  1T0F A;  3M7G A;  1T39 A;  3WGG A;  4OAY A;  1W0U A;  2Q2E B;  2LVS A;  3OMY A;  3T5X A;  2IP2 A;  4KIC A;  2H8W A;  2YSR A;  5L3F A;  3E5Q A;  3WU1 B;  4OOI A;  3G1L A;  4IF4 A;  3SDB A;  1W7P B;  3QAH A;  2Q2E A;  1NTC A;  4CZC A;  2ADU A;  2G7H A;  1ETY A;  2E5Z A;  3U9G A;  1P7J A;  1GXQ A;  5EJC A;  3RCO A;  4B3X A;  3PJR A;  2MC4 A;  5HOO A;  2YS9 A;  3ZMV A;  1ZGJ A;  4C3H J;  5AIP A;  1LQ1 A;  1K4S A;  4A3D J;  3H5N A;  3BDD A;  4I2O A;  2G0E A;  2L54 A;  1FYK A;  2G7U A;  4CSW A;  2HYJ A;  1MBE A;  4LG3 A;  2JT1 A;  4UY8 I;  4DIQ A;  3OYN A;  4J19 A;  4BAC A;  1VFC A;  1RR7 A;  5LBQ A;  4NBQ A;  3OYK A;  2MW8 A;  4F3Q A;  3LSR A;  1XD7 A;  4EM1 A;  1EH6 A;  2A5Y B;  1X3Z B;  2VT3 A;  2UWM A;  1UST A;  2HYF A;  4JQF A;  3QYF A;  1SMY F;  4YFK F;  4XLN F;  1A36 A;  2HNH A;  2X51 A;  4M9Z A;  1AU7 A;  3L2U A;  3OYA A;  2DDA A;  1GVJ A;  2BXZ A;  3ASN H;  1XDU A;  3KP4 A;  3KLO A;  4QLC U;  2HQN A;  1UJ8 A;  1FC3 A;  2GA1 A;  5A2Q Z;  3CUQ B;  3KZZ A;  3LSK A;  3H0G J;  3ONQ A;  1VQ7 I;  4FET A;  2CQN A;  4G7H F;  1IDY A;  1MBH A;  4ESJ A;  3LSI A;  3QPS A;  2DO7 A;  2VN2 A;  2M7A A;  2L9N A;  3QU3 A;  3DEE A;  2XGE A;  4F7Z A;  5M3M J;  3UKG A;  4Q48 A;  3VYR B;  2F5E A;  1W7P D;  1PVE A;  1I39 A;  4Z2Y A;  2FML A;  3CP2 A;  5K7Z A;  1I27 A;  2XAQ A;  3LA2 A;  2EV0 A;  2DA2 A;  3HM5 A;  1EF4 A;  5D5U B;  2RKH A;  1N78 A;  2LG4 A;  4HF0 A;  3H35 A;  4ASN A;  5K7F A;  2DA7 A;  1FIP A;  3ZQG A;  5D4S A;  4BE0 A;  1TW2 A;  1UB9 A;  1OPC A;  3LSG A;  1OYI A;  4JK1 X;  2DPD A;  2CW0 F;  3TMO A;  4CUG A;  3ECH A;  3F8N A;  3HOY J;  3F8B A;  3CUO A;  3TP0 A;  2BBY A;  4QIW N;  2QSF X;  3BG3 A;  1H9T A;  2R7O A;  4UV9 A;  3D0S A;  3VYT B;  3JRF A;  2XB5 A;  5HS9 A;  3BTI A;  1GVD A;  2VQG A;  1S7E A;  5D5V B;  2QYO A;  4XSZ F;  1ZR4 A;  2B63 J;  1B72 B;  2NOJ B;  3CCM I;  1T33 A;  1V5E A;  4NC6 A;  1H8A C;  2KP6 A;  3T8R A;  4KNY A;  3ZMU A;  1WH7 A;  3PSF A;  1FNN A;  2DPU A;  4HBL A;  5TRD A;  5LGN A;  1IO2 A;  4P1W A;  3D5L A;  3S14 J;  1JTY A;  3BT9 A;  4HV5 A;  5D8L B;  4A3J J;  3JRH A;  3G2B A;  3TBI A;  1RI7 A;  3CCS I;  2VT2 A;  1TQP A;  2L02 A;  3JSP A;  4GFB A;  1RC9 A;  3TOB A;  3MZ8 A;  4D1Q A;  1YQA A;  4NDL A;  5F1J A;  4MIM A;  2DFI A;  1XC5 A;  3HGG A;  2JJ7 A;  3WE3 A;  5DM7 F;  4UUV A;  5FFX A;  1N25 A;  4XRS A;  1ZH5 A;  3ZQQ A;  1QU3 A;  4D7N A;  1P4X A;  2DT5 A;  3CZ6 A;  3O3K A;  3Q9S A;  5JVT A;  1DU0 A;  1FY7 A;  1APL C;  5HNF A;  5EG0 B;  1Y1V J;  1ZYR F;  3GTG J;  3U2R A;  1I1G A;  4LD5 A;  3I56 I;  3IH4 A;  2W00 A;  5ICF A;  3K70 C;  2Z33 A;  4LGW A;  2JSC A;  2FQ3 A;  2NYX A;  2A6T A;  4WF2 A;  4YG2 F;  2PMH A;  3SFZ A;  1FBU A;  2LYC A;  2FEZ A;  2HDD A;  3AL0 B;  2W84 A;  3TO7 A;  1WJD A;  2PEX A;  2CW7 A;  3AG3 H;  1WI3 A;  4LIV A;  1EKE A;  3JRB A;  1JJ6 C;  1X1C A;  4OIN F;  1KQ0 A;  4RDU A;  1ZK8 A;  4XRF A;  2KRC A;  5E3N A;  2QKM B;  2VUM J;  1I6X A;  2V9P A;  5EGO A;  3EPZ A;  4HQE A;  1X58 A;  1XGM A;  2MH2 A;  2OUM A;  4HOB A;  2LF8 A;  2XIG A;  3DPL C;  1I1S A;  1SAU A;  2H1L A;  3OYF A;  5L3B A;  2M5W A;  4A5M A;  3L09 A;  2HDW A;  4L5J A;  2QLZ A;  1B9M A;  1SFX A;  3QPH A;  1ODD A;  3OV8 A;  5FGM A;  1J75 A;  1VF9 A;  1ETX A;  1OYY A;  3CO7 C;  3G6E I;  2K9M A;  3H3Z A;  4M3E A;  2FBI A;  4PJM A;  4ENJ A;  2GA2 A;  2ZFW A;  3EUA A;  3I4M J;  1ACI A;  4HA8 A;  4PUS A;  3A03 A;  4NQW B;  3MEX A;  5B66 C;  3GF2 A;  4FE7 A;  2HYG D;  2XRO A;  3S2D J;  2QQA A;  3FK6 A;  3U21 A;  3CDI A;  1SD6 A;  2DFH A;  4A3I J;  2N8G A;  3DFG A;  2IPQ X;  3GX4 X;  1SAX A;  3ABT A;  1ITY A;  3OSG A;  1YX5 A;  2IA1 A;  5HS7 A;  3O2P E;  4E7K A;  4RBO A;  5D6F A;  4B09 A;  1O4X A;  3CDH A;  3MD2 A;  1PYV A;  3LFU A;  2R7X A;  3Q0V A;  2RVC A;  2KMU A;  3V7R A;  2HPI A;  3OSF A;  4H4K C;  4BDY A;  1W5C C;  1E0E A;  1BM9 A;  2RN7 A;  1R36 A;  1JUS A;  3BZ6 A;  3FDY A;  4QPO A;  1K78 A;  2NVY J;  4WX9 A;  1YS6 A;  1UG0 A;  3J7A O;  1ETV A;  3X2Q H;  2K4B A;  1HXD A;  1BI0 A;  2K3F A;  2V4J C;  4PSX A;  1ZHF A;  2ZME A;  4EGY A;  2QBY A;  3DEU A;  3JRC A;  4V2G A;  1RZ4 A;  3DBL B;  1IN4 A;  2RV8 A;  3FIW A;  4A5N A;  3RDI A;  3LMM A;  4M3B A;  5HDG A;  2NVQ J;  2VQL A;  5DUK A;  3FXQ A;  5HNH A;  1V3F A;  3H92 A;  3BR5 A;  3AFH A;  2KIS A;  3M1E A;  1U9O A;  3QPL A;  4PGG A;  2VXZ A;  3CF5 F;  5J1U A;  3DF8 A;  4IHT A;  2D5V A;  2E1M C;  3I4P A;  4ENK A;  4LIU A;  1SFE A;  4IVN A;  2VOP A;  2HFH A;  3DLA A;  4G8X A;  3OYD A;  1D1C A;  1Z1D A;  5EZH A;  2WB1 N;  4BYY A;  4RGR A;  1JTX A;  1WCM J;  4DZJ A;  3SJM A;  2DA5 A;  5BMZ A;  1IXR C;  3BG5 A;  3OOU A;  4FX4 A;  1FOY A;  2EFN A;  3GTK J;  2E34 A;  2VKV A;  2EFP A;  4NNJ A;  4F92 B;  4P96 A;  5IOY A;  3SXY A;  4A69 C;  3C2B A;  3U1D A;  2LY1 A;  2HQR A;  1BJA A;  1WRJ A;  1WJC A;  2OJE D;  4CGZ A;  2H6C A;  4BJ6 C;  2DYS H;  4M71 A;  4EM0 B;  3L2R A;  2FX0 A;  2K9L A;  1REP C;  2K9S A;  4E7H A;  4AIJ A;  2CRG A;  3REO A;  2OZ6 A;  4CXF A;  1D0Z A;  2F2E A;  1IGN A;  3NAU A;  4IPA A;  1ENH A;  4MHG A;  2E19 A;  4HPQ A;  2BEO A;  4EV0 A;  4U88 A;  2LKP A;  4CYD A;  2JVH A;  5C4J J;  2M7B A;  1SFK A;  2DLL A;  5GAD J;  4M74 A;  4IJA A;  5HLH A;  5C3E J;  4M3G A;  4PFP A;  4RLQ A;  4EJO A;  3FBI B;  5KK1 A;  1QRY A;  3OYB A;  2W24 A;  4CDG A;  4W1U A;  3OYH A;  1MSF C;  3OS0 A;  1KU3 A;  4YEL A;  3J80 Z;  1MBF A;  2FF4 A;  2KFD A;  3I64 A;  2Z1D A;  1SFU A;  3C2H A;  4X1E A;  1YIO A;  3DTK A;  3PNV A;  1FP1 D;  1A6Q A;  3I4N J;  1JUM A;  1IUF A;  2WY7 Q;  4XR6 A;  1OQY A;  3LAP A;  1V55 H;  2XB0 X;  2EK5 A;  4UXN A;  1F5T A;  2GAU A;  3DPT A;  3JAM Z;  1ZRE A;  1MMN A;  2MBF A;  3E6M A;  3MMY B;  4XRS G;  5H6R A;  2DA4 A;  4IOC F;  3P5J A;  2WTE A;  1XCV A;  3I58 A;  3TO6 A;  2Z2S B;  1AHD P;  1LEB A;  2R5Y B;  4HAM A;  5DS9 A;  1BOB A;  1YIT I;  3PO2 J;  4MGR A;  1CGP A;  4M3F A;  3RTR A;  5F1R A;  4ITV A;  1BA5 A;  3ASO H;  1LNW A;  4ZH4 F;  3H0D A;  1YG2 A;  5M5X J;  1SFO J;  3LQQ A;  1YYV A;  2ZBK A;  3KEQ A;  2LC2 A;  3C2G A;  3CUQ C;  3CP8 A;  2K7L A;  4UUT A;  2DYR H;  5B1A H;  2CG4 A;  2YX7 A;  2CFO A;  1XGS A;  4OIR F;  4WWC A;  3WTX C;  3WU2 C;  1J59 A;  1YW9 A;  3MZY A;  2WV1 A;  1P2F A;  1EH8 A;  3G71 I;  1MJ9 A;  1QZY A;  2HTS A;  5BOX A;  5F0C A;  3ZGK A;  2OF7 A;  5IT3 A;  1VQL I;  2E2H J;  1FSE A;  3SHF A;  1R4N B;  1FEX A;  2AO9 A;  5E3O A;  2K9Q A;  1XMX A;  3UR3 C;  3HGY A;  3F23 A;  2FU4 A;  1ZTR A;  4XLP F;  1MBK A;  3ERM A;  3RPU D;  4HNV A;  5E8G A;  1B59 A;  2XPV A;  2EIK H;  3FXL A;  1ORK A;  2LP0 A;  1ETK A;  5DYM A;  2WAD A;  1B1B A;  1IC8 A;  3IRQ A;  3QRF F;  5JR3 A;  1HC8 A;  4A6D A;  4FQG A;  3ABL H;  5FB2 A;  4R1H A;  4ZYD A;  2O6G E;  4BQA A;  4E7Z A;  3SZP A;  4HLX A;  5DV5 A;  2VI6 A;  3HL2 A;  2MA3 A;  3DKX A;  5LD2 C;  3VYS B;  1H0M A;  4GGG A;  1ZRD A;  2M0M A;  1E2X A;  5ILS A;  2W7N A;  3MQ0 A;  4BQN A;  2EZH A;  2PMZ N;  1HKT A;  1F4K A;  2IGM A;  2ACJ A;  3HKZ A;  2VON A;  2EB7 A;  2CV1 A;  2O03 A;  5L3G A;  3K0L A;  4AVP A;  2EFQ A;  4RAZ A;  1ON1 A;  3OYG A;  4XKB A;  4XLE A;  3HXL A;  2R4G A;  2ZNY A;  3W2W A;  2QF7 A;  1KA8 A;  3RKY A;  2F5C A;  4KA4 A;  2XC7 A;  4FE4 A;  3MCZ A;  2NOG A;  1YI2 I;  4F55 A;  3C3W A;  5K5Q A;  2XKO A;  1MMA A;  2MH9 A;  2V1X A;  3SZG A;  1T2K A;  2VBY A;  2WY8 Q;  4I0B A;  5KNL A;  1Z7U A;  4EQQ A;  1G3S A;  2L01 A;  3DEW A;  3RKX A;  2DTR A;  5IP6 A;  3SQN A;  2M4K A;  5B3S H;  2LBF A;  2XAS A;  3S3M A;  5ILU A;  1FTZ A;  2OCE A;  1JT6 A;  1OMI A;  2X4H A;  2DI3 A;  4BKX A;  4BE2 A;  2LDU A;  3K9T A;  1GV5 A;  4IHS A;  1T0F C;  1G8X A;  1ZLK A;  3ZOB A;  4RA2 A;  1A04 A;  3K2A A;  1YRN A;  1B8I A;  4I6Z A;  3KZI C;  1KQ9 A;  3F0C A;  2WC2 A;  3J7Y J;  3KIO A;  1Y1W J;  3ZCO A;  5GPC A;  4ZDP A;  4ESB A;  2XRL A;  3HPH A;  4DGW B;  2F5F A;  2CWE A;  2H6B A;  3GCM A;  4H0E A;  2DOA A;  5CLS A;  1YHQ I;  3HBL A;  1BI1 A;  5EDN A;  3ZQL A;  3E1S A;  4ZDO A;  2DFF A;  4HV6 A;  3CJN A;  3QP6 A;  1ZG3 A;  1YIJ I;  3GYH X;  1NK3 P;  2LRD A;  3G3Z A;  3E5X A;  2ZME B;  3GZ6 A;  4ENN A;  3DU5 A;  3VFZ A;  1BOA A;  3HOT A;  1J9I A;  1YJ9 I;  3OYC A;  1A35 A;  1GUU A;  1KGS A;  1P4A A;  2YR2 A;  2M1B A;  2O5R A;  4L18 B;  3QYE A;  4B47 A;  3IRR A;  3R0J A;  3T1B A;  3H9Q A;  4FIS A;  3ML6 A;  2XPU A;  3QYB A;  4FX0 A;  4XMY A;  1LDD A;  4OIP F;  5D8K B;  4BUP A;  2ELK A;  4G9Y A;  2YUS A;  4YII A;  3BR1 A;  2XF7 A;  2XF5 A;  4HDU A;  2DDB A;  3M4O J;  1TNS A;  2M0C A;  4XN0 A;  3HOZ J;  5JVG F;  1YJN I;  4D7M A;  1S8N A;  3BRO A;  4RB0 A;  2CSO A;  4BBR J;  5K1Y A;  2A5W A;  3VYU B;  4DYC A;  3AAF A;  3ZMD A;  1XN7 A;  3HDD A;  1UG2 A;  4YFN F;  2D1V A;  3EET A;  2PX9 A;  2B9S A;  2NS0 A;  4XON A;  1R1U A;  4BJT A;  1BJZ A;  2E35 A;  5IY5 H;  4FTH A;  1FOW A;  1HQC A;  1TQI A;  2EFO A;  4ZYH A;  2K86 A;  1KYZ A;  3FIS A;  2ICW G;  3L2Q A;  3H5R A;  4GCV A;  2MGQ A;  3AKZ A;  2ESH A;  3UNG C;  1JI8 A;  4M72 A;  4BXX J;  3HIF A;  5LGT A;  2FXA A;  5JI6 A;  1QBJ A;  4XK4 A;  4DYR A;  5HLT A;  1WI9 A;  2MSY A;  1X3U A;  1BC7 C;  2L9S A;  1O3T A;  4E7I A;  1PP8 F;  2XUB A;  1OYW A;  3H36 A;  1WWX A;  1JUP A;  1FMW A;  2O7O A;  1SD7 A;  1T98 A;  2BY3 A;  2KRH A;  3B6C A;  3F8C A;  5BNG A;  4AC0 A;  3F6O A;  3KYL A;  4U7D A;  2AQE A;  2FD5 A;  2H1K A;  1R23 A;  1RR8 C;  4YFX F;  2YPR A;  4UHT A;  4RM2 A;  4YRV A;  2AXT C;  2GQQ A;  1I50 J;  3K4K A;  4FCY A;  4ZZD A;  4DJA A;  2ZJQ F;  4MEY F;  1ZLJ A;  1BIB A;  1S6L A;  4L0Z B;  3S17 J;  5J1Y A;  4IEJ A;  4A3C J;  4I98 B;  5J3L A;  3VB2 A;  5J4V A;  3COA C;  3HG9 A;  3A02 A;  4IHX A;  1TWC J;  2FQ4 A;  3QQA A;  4CYC A;  3OYL A;  1X1P A;  3HZJ A;  3L2C A;  3FMR A;  2VBX A;  2BV6 A;  2GOM A;  1Y0U A;  1MJA A;  2DOE A;  1FBQ A;  2YX4 A;  4A6E A;  2EPF A;  2PLY A;  1D5V A;  1DQU A;  2D2W A;  1NG6 A;  5EEH A;  1WGX A;  3NQO A;  3F3X A;  3OY9 A;  4IHY A;  5F0H A;  4IXA A;  4IX7 A;  4PCQ A;  1KON A;  3WHC A;  1Y8Q B;  3HRT A;  3S93 A;  4D9J A;  2RQQ A;  2CV0 A;  1WJE A;  1Z6T A;  3QU6 A;  4BH9 A;  2IGO A;  2DMU A;  5FO5 A;  2GIZ A;  1TC3 C;  2EFW A;  1HW2 A;  2EA2 A;  2X85 A;  3F9K A;  4Q5S F;  1HDP A;  2CQQ A;  3RIR A;  5J6X A;  3PIP F;  3OYE A;  1TNT A;  5E1X A;  2XV4 S;  1SEU A;  4P9U A;  4ZYA A;  3BR6 A;  2GXG A;  2O3F A;  3F6V A;  3GVA A;  2RDP A;  3LOC A;  1X1A A;  4XLA A;  1XGN A;  2P4W A;  5H6Q A;  3CCJ I;  1IV6 A;  3BPX A;  2XVC A;  4WK8 F;  2PBI A;  1FWZ A;  4HNU A;  3H1C A;  3KE2 A;  4CHU A;  3RQI A;  3CME I;  1MH3 A;  4TV7 A;  5IP7 J;  1LPQ A;  4RB2 C;  5EYR A;  5J1R A;  3J7A Y;  2DU9 A;  3BG6 A;  2LD5 A;  3CMA I;  1WZ2 A;  3VWB A;  1UHM A;  3ERE D;  1Z05 A;  5ED4 A;  4UVC A;  4GRI A;  4CIC A;  3GTJ J;  1LKX A;  3EYY A;  3KP5 A;  1G4D A;  1TQM A;  4U87 A;  1O3Q A;  3ZXS A;  3O8H A;  3KYD B;  5GAE J;  2L0K A;  2DJI A;  4PDK A;  4LIT A;  3CF2 A;  4F93 B;  2OU2 A;  1MW7 A;  5IP9 J;  1STZ A;  2WB1 A;  1IUY A;  4RGX A;  3IH3 A;  4L9T A;  4M9X A;  1HST A;  4AIH A;  3S8P A;  2EZL A;  4L0Y B;  2Y31 A;  4OAZ A;  3C7J A;  1PUF A;  4RGS A;  3E0J B;  3K1M A;  4XID A;  2L5Q A;  4UV8 A;  5KHD A;  2L9R A;  2QEX I;  1R22 A;  2DQR A;  5K7H A;  3JSO A;  1R71 A;  1YW8 A;  3AG4 H;  4WXH A;  4G94 A;  3GFM A;  4RLF A;  1H88 C;  4LK0 F;  3TDU C;  5CPR B;  1T8I A;  3JTG A;  2OQR A; 
#chains in the Genus database with same CATH homology
 2BVL A;  2D5V A;  2FUG 2;  4UUS A;  2E1M C;  3OL3 A;  5FLM J;  3CES A;  3VDX A;  2BW3 A;  4LIU A;  2ZB9 A;  3S1R J;  3BCB A;  1Y56 A;  3SDG A;  2RAE A;  3CMY A;  3CCY A;  2LK2 A;  2JMW A;  1A5J A;  1OR7 C;  4IHW A;  2VKH A;  2L7K A;  3DLA A;  3G1M A;  4N4N B;  4YEJ A;  2V26 A;  2Z16 A;  3ZQH A;  3ZQF A;  2NVT J;  1U0J A;  2VJ4 A;  3S32 A;  1D1C A;  5EZH A;  3OYD A;  2WB1 N;  3SJM A;  4DZJ A;  1JTX A;  1WCM J;  1DGW Y;  2DA5 A;  3BG5 A;  3OOU A;  3MN2 A;  4CYC B;  3GTK J;  4V2F A;  2VJ5 A;  3IP4 B;  2VKV A;  3MKW B;  2GM4 A;  2VJJ A;  4XKC A;  4U7B A;  2HQ5 A;  4NNJ A;  3E7L A;  1JGG A;  4NC7 A;  1YRN B;  5JLX A;  1PUF B;  2KDO A;  4F92 B;  5IOY A;  3A4C A;  4A69 C;  3C2B A;  3AL0 C;  4CH7 A;  2EBI A;  3BR2 A;  2LY1 A;  1YX3 A;  3EUH C;  5FRO A;  2IS6 A;  2QKL B;  3ZGK A;  3A01 A;  2CUZ A;  3W2A A;  1LFB A;  3Q0U A;  1WJC A;  1MBG A;  1DGR M;  1QHG A;  4BJ6 C;  3BG7 A;  3IH2 A;  3L2R A;  2LFB A;  3L2W A;  1X1D A;  2FX0 A;  4BGD A;  2K9L A;  2JUG A;  2ID3 A;  2K9S A;  4E7H A;  2CRG A;  2R7T A;  2NVX J;  2VKE A;  1LFP A;  1Z3Y A;  4BE1 A;  1D0Z A;  4E7J A;  3LNQ A;  1IGN A;  2E2J J;  3NAU A;  3DKY A;  2VPL A;  5CQE A;  2DMQ A;  1ENH A;  2NS8 A;  4MO7 A;  2E19 A;  1K61 A;  1OLT A;  1X2M A;  4XNF A;  2KZV A;  4HPQ A;  2HOT A;  3SYT A;  3HOS A;  3PFY A;  4UUS B;  3D5S C;  3S16 J;  3JRD A;  2JA8 J;  2L2O A;  3HUG B;  5C4J J;  2JVH A;  2M7B A;  1SFK A;  4XN3 A;  3LSM A;  1WPK A;  4BY7 J;  3HC7 A;  1WJA A;  1MSE C;  1N75 A;  1JKP C;  5C3E J;  4M3G A;  2K9N A;  1D1A A;  1NG7 A;  4PFP A;  4RLQ A;  1IJW C;  3FBI B;  3OS1 A;  1QRY A;  3OYB A;  3S1N J;  4W1U A;  2KPM A;  1ZEL A;  1T95 A;  1TWG J;  1MSF C;  2LOO A;  1VND A;  3TL4 X;  4ZJZ A;  3OS0 A;  4E7S A;  2ECB A;  2H8R A;  4YEL A;  2M2E A;  3GTO J;  1MBF A;  2WAQ N;  3OYI A;  2Y9Z A;  1ZQ3 P;  2Z1D A;  1V5G A;  4G12 A;  3SFI A;  3HOX J;  3C2H A;  5HVQ C;  4C2T A;  4XM3 A;  4X1E A;  4KIT B;  4A3L J;  3H5A A;  3DTK A;  3PNV A;  2WAE A;  1WJB A;  3W3C A;  2LTP A;  3PSI A;  3I4N J;  1JUM A;  3BTC A;  1IUF A;  3OIO A;  1TWA J;  2WY7 Q;  4XKV A;  2X48 A;  2XB0 X;  3S15 J;  1VZ0 A;  1Z21 A;  2LRE A;  2VQC A;  1ERD A;  3MKZ A;  4XIC A;  2Y0S A;  1R9T J;  3DPT A;  2DA6 A;  1MMN A;  4XRS G;  4OWR B;  3MMY B;  4DBR A;  2HZD A;  2DA4 A;  5IYD J;  4JX4 A;  2JA2 A;  3RSN A;  2IS4 A;  2DT7 B;  2GLO A;  3QOD A;  1SAN A;  5FKO A;  1F43 A;  2ECC A;  3OL4 A;  4HNT A;  2Z2S B;  2E1M B;  2HOA A;  1AHD P;  1FTT A;  3M1C A;  2R5Y B;  3K4B A;  2R7W A;  4J00 A;  1X2N A;  1WJ5 A;  3G1O A;  5DS9 A;  1BOB A;  3NWS A;  3PO2 J;  4QPQ A;  2MD0 A;  2GBY A;  3W2V A;  4M3F A;  1NK2 P;  3RTR A;  1BA5 A;  2R0Q C;  4ITV A;  2V1N A;  2R7R A;  4IQ4 A;  3H0D A;  1LE8 A;  3OIP A;  5M5X J;  1XS9 A;  1SFO J;  4D5F A;  3NAR A;  5C4X J;  1RET A;  2X6X A;  4AUX A;  2IEK A;  3EUK L;  2X6Y A;  4BAC A;  2R5Y A;  2KHM A;  5FKN A;  2LC2 A;  4F52 A;  3PUB A;  3C2G A;  3GTQ J;  5F0F A;  3BR0 A;  3JRE A;  3CP8 A;  1OFC X;  5CKT A;  4UUT A;  2XSJ C;  4X0G A;  2M34 A;  3MKL A;  2L7M P;  2EZK A;  3IV5 A;  4W97 A;  1TT0 A;  2CFO A;  1YE9 A;  1F36 A;  2IS1 A;  4BJ5 C;  1K6Y A;  2WV1 A;  3S3O A;  2HU9 A;  3GTM J;  2CS3 A;  2VLA A;  2CU7 A;  3HOW J;  3DQV C;  4HRI A;  2LKX A;  3O8G A;  1HCR A;  5F0C A;  1B8I B;  3S1M J;  2OF7 A;  2W48 A;  2ME6 A;  5EGO B;  3BTL A;  3TED A;  1J09 A;  2E2H J;  3K10 A;  4CCO A;  3S3N A;  2HVR A;  3LSJ A;  1FEX A;  2AO9 A;  3K70 D;  5E3O A;  3HKZ N;  1TWF J;  1GV2 A;  2EH3 A;  2K9Q A;  1W36 D;  1BR1 A;  3H9G A;  3UR3 C;  3HGY A;  2R7U A;  5C44 J;  4BL0 B;  2TRT A;  4L5E A;  4B4C A;  1ZTR A;  2OPT A;  2CUJ A;  1MBK A;  1U9N A;  4HNV A;  2K3P A;  3FHN A;  1IDZ A;  3LSH A;  4ZDL A;  2MAB A;  3RPU D;  2XPV A;  4AYB N;  3K4M A;  2BVM A;  2DCE A;  1ORK A;  2LP0 A;  2VXD A;  1HOM A;  2ZSH B;  2UV1 A;  3D5R C;  4IQJ A;  1ETK A;  2VPR A;  3PNT A;  2Y9Y A;  4MFD A;  2DT6 A;  1IC8 A;  2WAD A;  3PM1 A;  4A3F J;  2M3A A;  2QCO A;  1Z3X A;  2LR8 A;  4XL9 A;  2RRE A;  3IAS 2;  4A3K J;  2V6E A;  4E7Z A;  2JVG A;  2UUZ A;  3V42 A;  5FLV A;  2VI6 A;  4QTR A;  3HL2 A;  5IOZ A;  4QSH A;  2FJ1 A;  2XGC A;  2O8K A;  1PJR A;  3DKX A;  3I9V 2;  3VYS B;  5LD2 C;  2ELJ A;  4C30 A;  1WJF A;  2JWT A;  2DMP A;  2M0M A;  3RQ4 A;  1D0X A;  4BQQ A;  2HPM A;  1W36 C;  2W7N A;  2LY2 A;  2BOL A;  2ZXH A;  2DTZ A;  4BQN A;  2NS7 A;  3VPR A;  1IRZ A;  4BXF A;  4HST A;  2EZH A;  2KDZ A;  2PMZ N;  1A6I A;  2IGM A;  2YU9 J;  3D1N I;  3CJQ B;  3HKZ A;  3VSK A;  1K83 J;  3MVP A;  2CV1 A;  3IAM 2;  1W0U A;  4OAY A;  2LY9 A;  1CQT A;  4XLC A;  2Q2E B;  2LVS A;  2M9H A;  3OYG A;  3OMY A;  4XKB A;  4A3B J;  4XLE A;  4X6A J;  3B6A A;  2R4G A;  3HXL A;  2QF7 A;  3W2W A;  4B1R A;  4E7L A;  4A93 J;  2KT0 A;  1OCP A;  1ZGW A;  2XC7 A;  4FE4 A;  4CCJ A;  1JKQ C;  4PK4 A;  2O9L A;  2NOG A;  3G1L A;  2CUF A;  2JA5 J;  3SDB A;  1XG1 A;  3DTI A;  4F55 A;  1NTC A;  4CZC A;  2M4G A;  1ETY A;  4JYK A;  1MMA A;  4RM3 A;  2E5Z A;  3CMM A;  4Y3O A;  1P7J A;  3ZQI A;  4J01 A;  5JLW A;  3SZG A;  3PNY A;  2WY8 Q;  5KNL A;  2VIX A;  2E60 A;  5F04 A;  5E3M A;  3RCO A;  3DEW A;  2BW3 B;  4B3X A;  3PJR A;  2MC4 A;  3OR1 C;  5IP6 A;  5HOO A;  2XPW A;  2YS9 A;  2VKD A;  1ETQ A;  4ZTJ A;  4C3H J;  2V9K A;  2M4K A;  4A3D J;  2LBF A;  3H5N A;  4BS9 A;  4MFE A;  1WH5 A;  4B43 A;  4ZTF A;  2G0E A;  4C2M J;  3S3M A;  1FTZ A;  2L7F P;  1ZR2 A;  1IRX A;  5TGT A;  1JT6 A;  1Y6I A;  3A2K A;  5F08 A;  4CSW A;  1DP3 A;  2HYJ A;  1MBE A;  2DA3 A;  4LG3 A;  4BKX A;  4BE2 A;  3MKY B;  2ID6 A;  1GV5 A;  3ZQC A;  2CMP A;  4J19 A;  3FBN B;  4DIQ A;  1JJ8 C;  3OYN A;  1VFC A;  1T0F C;  4BBS J;  1G8X A;  2P0W A;  3GBG A;  1RR7 A;  2RNG A;  4HEA 2;  2DXI A;  3ZOB A;  2KL4 A;  3DU6 A;  3OYK A;  1Z0X A;  2R5Z B;  4Y52 J;  2MW8 A;  3K2A A;  3LSR A;  1YRN A;  4F3Q A;  1B8I A;  4I6Z A;  2DJN A;  2HQA A;  2VL8 A;  3F0C A;  2UWM A;  4JQF A;  2JSP A;  3QYF A;  1Y1W J;  1OCT C;  2GOX B;  5GPC A;  2DMT A;  2PMZ A;  1P9Q C;  4ZDP A;  3ZCO A;  4DW6 A;  1U78 A;  4CA0 A;  2XRL A;  2HNH A;  2X51 A;  5FRN A;  1AU7 A;  1E3O C;  3HPH A;  4R79 A;  4DGW B;  3DPU A;  3OYA A;  3L2U A;  5GP9 A;  1GLN A;  1IG7 A;  3K4L A;  2CV2 A;  5JHF A;  4Y7N J;  5DTD A;  4MLO A;  3HBL A;  1X1B A;  2DOA A;  2IXS A;  3A1Y A;  3N05 A;  4BEH B;  5EDN A;  4BDZ A;  3ZQL A;  3E1S A;  4DZP A;  4NUB A;  4ZDO A;  2R7S A;  2Y0S N;  2AQF A;  4N4O B;  1D5Y A;  2E5N A;  4XQF A;  4A3G J;  1D0Y A;  2L7Z A;  4E4H A;  3LSK A;  4A3E J;  1B72 A;  3H0G J;  2X6O A;  3ONQ A;  2PJR B;  1NK3 P;  2LRD A;  4FET A;  4XLH A;  2WBM A;  2CJJ A;  1IDY A;  1MBH A;  2E1O A;  2COB A;  3GTL J;  1MBJ A;  3QPS A;  1EA3 A;  3DU5 A;  3LSI A;  1T56 A;  4II3 A;  2M7A A;  1TWH J;  1UHS A;  2L9N A;  3HOT A;  3DEE A;  2XGE A;  3UKG A;  5M3M J;  3OYC A;  1GUU A;  3VYR B;  3H9J A;  2O5R A;  4DOZ A;  2XGD A;  3QYE A;  1R6R A;  2HVQ A;  4B47 A;  3CP2 A;  4JOM A;  3PO3 J;  5K7Z A;  4FAS D;  4FIS A;  3HM5 A;  2DA2 A;  1EF4 A;  3H9Q A;  3SEZ A;  2XPU A;  4B3A A;  5M5Y J;  1N78 A;  2LG4 A;  3FKJ A;  3KX2 A;  3QYB A;  4XMY A;  2X1E A;  1I3Q J;  4BUP A;  2ELK A;  2K5C A;  5K7F A;  2YUS A;  1MMG A;  2DA7 A;  1FIP A;  5IYB J;  3ZQG A;  2KQR A;  3H35 A;  4CCL A;  3BR1 A;  4XRM A;  2R7Q A;  1QPI A;  4BE0 A;  2X1C A;  2XF7 A;  3LSG A;  1HDD C;  4D5C A;  5EZG A;  2XF5 A;  3M4O J;  3TMO A;  3Q3S A;  4CUG A;  2M0C A;  4XN0 A;  3HOY J;  3TP0 A;  4XOR A;  1LDK B;  3CQZ J;  4QIW N;  3BG3 A;  3HOZ J;  3K6G A;  2I8D A;  2R7O A;  3VYT B;  3JRF A;  4IHV A;  4D7M A;  2XB5 A;  2KLO A;  3BTI A;  1GVD A;  2VQH A;  1S7E A;  4C3J J;  2VQG A;  1AA7 A;  3PL8 A;  4BBR J;  2OV7 A;  4PJN A;  2A5W A;  3VYU B;  2B63 J;  4DYC A;  1ZR4 A;  2F6C A;  2XF6 A;  5F27 A;  1BW5 A;  1B72 B;  2NOJ B;  3HDD A;  3W6V A;  1UG2 A;  3IUO A;  1T33 A;  1ETW A;  3DCF A;  1D1B A;  1H8A C;  1V5E A;  2KP6 A;  4Y33 A;  3BQZ A;  4XON A;  3BC8 A;  4IZZ A;  3DTE A;  1LE8 B;  1BR2 A;  1WH7 A;  3LL7 A;  1BJZ A;  3PSF A;  5EF6 A;  4BJT A;  2V7F A;  4FTH A;  2IGK A;  2P81 A;  3S14 J;  4P1W A;  1QVU A;  3FIS A;  1JTY A;  3JRG A;  5M5W J;  1MMD A;  3BT9 A;  3D5L A;  3H5R A;  3ZRG A;  4A3J J;  3JRH A;  4BY1 J;  4PJL A;  3G2B A;  3TBI A;  2IAI A;  2MGQ A;  3AKZ A;  1QHH D;  4AYB A;  1V5F A;  4XKW A;  1FIA A;  4GFB A;  3S1Q J;  2W4S A;  3OYH A;  2VJI A;  4E6K G;  3UNG C;  1JI8 A;  4BXX J;  4D1Q A;  4NDL A;  5F1J A;  4MIM A;  3K7A J;  3RZD J;  4KJZ A;  3L2V A;  2F4I A;  4XK4 A;  1XC5 A;  3HGG A;  2JJ7 A;  4DYR A;  4BEH A;  3K4N A;  2MSY A;  4S0H B;  1X4O A;  2IBD A;  2ME0 A;  4XRS A;  4RMN A;  1JKO C;  3NWT A;  2L9S A;  2HXI A;  3ZQQ A;  4KT6 A;  5IPA A;  1G59 A;  1QU3 A;  4D7N A;  4E7I A;  1RPW A;  3CZ6 A;  3BQY A;  1Q1V A;  4I76 A;  4DBQ A;  1DU0 A;  3QOE A;  2JA6 J;  5FRM A;  1APL C;  5HOD A;  1POG A;  3BCA A;  1JUP A;  1JT0 A;  1FMW A;  5HNF A;  2O7O A;  5EG0 B;  3LSP A;  1Y1V J;  5BNG A;  3B6C A;  4AC0 A;  1U8B A;  3GTG J;  2KRH A;  4M3D A;  3KYL A;  3IH4 A;  2LBF B;  4XR6 A;  2W00 A;  2AQE A;  2FD5 A;  2H1K A;  3K70 C;  1VI0 A;  1MNM C;  1TZL A;  3JRA A;  4EEF G;  2A6T A;  2I10 A;  4RM2 A;  3WHB A;  4YRV A;  1BW6 A;  1I50 J;  2Q1Z B;  4ABZ A;  3K4K A;  4FCY A;  5EEA A;  4DJA A;  2LYC A;  3OR2 C;  4M6V A;  2HDD A;  1RES A;  3TW6 A;  3CDL A;  3HPG A;  1ETO A;  3RKQ A;  5J1Y A;  4IEJ A;  3S17 J;  2R5Z A;  1MND A;  4A3C J;  3AL0 B;  2IS2 A;  5J3L A;  4F91 B;  4IHX A;  3I3L A;  2EZI A;  3A02 A;  3HG9 A;  1TWC J;  2FQ4 A;  4CCK A;  1WJD A;  3QQA A;  1FJL A;  2R7Z J;  2R7V A;  2CW7 A;  1WI3 A;  3HB9 A;  3JRB A;  1JJ6 C;  2LH9 A;  4LIV A;  4CYC A;  1X1C A;  4AVZ A;  4XOP A;  2X9D A;  1ZK8 A;  4RDU A;  2DMN A;  1X4P A;  2WAF A;  3ZR8 X;  1OJL A;  3OYL A;  2KRC A;  2M8G X;  5E3N A;  1HLV A;  2QKM B;  2W1O A;  2VUM J;  3BG9 A;  4HG2 A;  4ANJ A;  2GOM A;  5CQG A;  5EGO A;  3SEQ A;  3EPZ A;  1X58 A;  3HOU J;  4XOT A;  2OUM A;  2ZFU A;  1HF0 A;  4II2 A;  4B48 A;  3DPL C;  4A3M J;  1SAU A;  1RKW A;  1DQU A;  3OYF A;  1N77 A;  1FMV A;  1NG6 A;  4CCM A;  1WGX A;  2Y30 A;  5KCM A;  4IHY A;  2HDW A;  4JX6 A;  2DN0 A;  3OY9 A;  5F0H A;  2XAU A;  4IX7 A;  2JK3 A;  2Y2Z A;  4IKF A;  2XSD C;  1AKH B;  1DU6 A;  1KON A;  3WHC A;  2K40 A;  4Y4R A;  4ZC3 A;  1VF9 A;  1MH4 A;  1ETX A;  3S93 A;  4D9J A;  2RQQ A;  2ZSI B;  2CV0 A;  1WJE A;  4LOC A;  3TW7 A;  2ZXI A;  2HXO A;  2IGO A;  2DMU A;  2K9M A;  1MNE A;  4P5O A;  4KIS A;  4M3E A;  1TC3 C;  4G6T B;  5FJ8 J;  2DA1 A;  2R92 J;  1W0T A;  1LVK A;  2CW8 A;  3FDY A;  4PJM A;  3I4M J;  3EUA A;  2X85 A;  3M3Y J;  1AKH A;  2VAS A;  1UMQ A;  3F9K A;  1HDP A;  1Z77 A;  4PUS A;  2CQQ A;  5GPA A;  2HI3 A;  3A03 A;  4NQW B;  3OYE A;  1ZKG A;  4FE7 A;  3S2D J;  3DWL E;  3Q0W A;  1GDT A;  4ZYA A;  3FK6 A;  3BR6 A;  3KEY A;  3OYM A;  3U21 A;  5IYC J;  3K4C A;  4A3I J;  3LOC A;  1X1A A;  2N8G A;  4PSW A;  4XLA A;  2HVS A;  1HA8 A;  1IV6 A;  3GTP J;  1S9H A;  1WFX A;  2CH0 A;  3HEF A;  1ITY A;  3OSG A;  1YX5 A;  3L2Q A;  5HLT A;  2W82 A;  2F5V A;  4HNU A;  3M8J A;  4E7K A;  2X1D A;  3FKI J;  4RBO A;  3RQI A;  1O4X A;  1MH3 A;  5IP7 J;  5M3F J;  3MD2 A;  2R93 J;  5EYR A;  3BTJ A;  5J1R A;  1GT0 C;  3J7A Y;  2WA0 A;  1LFU P;  5FKL A;  1PYV A;  3BG6 A;  2LD5 A;  3LFU A;  3FK7 A;  4C9Y A;  3VWB A;  4JX5 A;  5E3L A;  3OS2 A;  2R7X A;  2MG4 A;  3Q0V A;  1I6H J;  2JN6 A;  4GRI A;  2KMU A;  4PJJ A;  3GTJ J;  1LKX A;  2HPI A;  3OSF A;  4H4K C;  2JA7 J;  2VB6 A;  4U87 A;  4BDY A;  1E0E A;  2OC6 A;  3OIQ A;  1H89 C;  3ZXS A;  3BR3 A;  2EQR A;  3O8H A;  1JUS A;  1BL0 A;  5FKK A;  2L0K A;  3HOV J;  4JP0 A;  2DJI A;  2MFZ A;  2NVY J;  3CF2 A;  4LIT A;  4QPO A;  4F93 B;  1MW7 A;  5IP9 J;  4DYQ A;  1UG0 A;  2LLK A;  2WB1 A;  3RZO J;  4BQO A;  2HOS A;  2PJR A;  3IH3 A;  5LFA A;  1ETV A;  2CUE A;  1JKR C;  2V4J C;  2X6W A;  3BLY A;  2XDV A;  4PSX A;  5FKM A;  3S8P A;  2EZL A;  2Y31 A;  4AU7 A;  3TP3 A;  3JRC A;  2CQX A;  1PUF A;  4V2G A;  4OAZ A;  3A01 B;  4CCN A;  1X19 A;  1Z7L A;  4XLF A;  3S2H J;  3E0J B;  3JR9 A;  3FIW A;  4C2U A;  1G2H A;  4XID A;  3LMM A;  2L5Q A;  1UEL B;  3OYJ A;  4M3B A;  5KHD A;  2L9R A;  2NVQ J;  2VQL A;  3H3V K;  3K4J A;  4EAT A;  1P7I A;  3OWT A;  4PFO A;  5K7H A;  4NC8 A;  4B44 A;  5HNH A;  3JRI A;  2MYS A;  2AHQ A;  1QVT A;  5EG0 A;  4BU2 A;  3BR5 A;  2E2I J;  3AFH A;  3CJR B;  4C3I J;  9ANT A;  4RLF A;  1H88 C;  2IGN A;  3VSL A;  1U9O A;  1BR4 A;  3QPL A;  2WAQ A;  5CPR B;  1RKT A;  2TCT A;  3L1P A;  2VXZ A;  4HSR A;  5J1U A;  1UAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...