3OOUA

The structure of a protein with unkown function from listeria innocua
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
105
structure length
105
Chain Sequence
SPIIQNVLSYITEHFSEGMSLKTLGNDFHINAVYLGQLFQKEMGEHFTDYLNRYRVNYAKEELLQTKDNLTIIAGKSGYTDMAYFYRQFKKHTGETPNRYRKIHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lin2118 protein
publication title The structure of a protein with unkown function from Listeria innocua
rcsb
source organism Listeria innocua
molecule tags Structural genomics, unknown function
total genus 38
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12833 HTH_18 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3oouA01
1.10.10.2730 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oouA02
2OPTA 2MW8A 3BG5A 3Q0VA 3BTIA 2DN0A 3BG3A 4S0HB 4BY1J 1Z77A 5FLVA 1MH4A 2ME6A 2NVXJ 2JWTA 3IH2A 1ETWA 3M3YJ 1I6HJ 1ENHA 4DW6A 4I76A 1DU6A 2XRLA 1B8IA 2Y2ZA 4BY7J 3RZOJ 5EZGA 4UUTA 5FLMJ 1YRNB 5EF6A 3BT9A 4QTRA 3GTQJ 4XRMA 5M5WJ 2JJ7A 2LY9A 4LOCA 1U9NA 2DMTA 9ANTA 2O9LA 5C4JJ 2E2JJ 1WI3A 3BQYA 5F1JA 1IRZA 2HYJA 3LSJA 2MSYA 5EG0B 1JUSA 1IV6A 1ETOA 2DA5A 1QVUA 4A3BJ 1MSEC 4A3KJ 1XG1A 1Z0XA 5F0FA 5GPAA 5FKNA 3A01A 3G1OA 5EDNA 3FKIJ 4RBOA 1GUUA 4G12A 4DYQA 5IYCJ 5M3MJ 2LTPA 1HF0A 2NS8A 2ME0A 3H0GJ 4C3HJ 1X2NA 5EYRA 2DTZA 1LFUP 5GP9A 2VPRA 1ZTRA 1G2HA 3W6VA 1UHSA 3ZOBA 3S1RJ 3S15J 3FIWA 2ZB9A 5F27A 2JN6A 2LFBA 3ZQCA 1JKQC 1MSFC 3JRGA 1TWHJ 4AC0A 2HI3A 2O8KA 5M5XJ 4L5EA 2K40A 1P7JA 5FJ8J 3BTLA 3M4OJ 3O8GA 2XB5A 2X9DA 5FKOA 2ID6A 1BA5A 5IP6A 1TWFJ 1FJLA 1U9OA 1ETVA 3BR2A 1RKWA 2E19A 2E2IJ 4ABZA 2DMPA 1IDZA 1DU0A 2X48A 4A3DJ 1JUMA 1WCMJ 4M6VA 3HOZJ 3GTJJ 2CJJA 2XGEA 2AHQA 1W0UA 1AKHA 2CUFA 4QIWN 3HOUJ 2VKEA 4DZJA 3DEWA 4B4CA 5C4XJ 3CCYA 2LP0A 3A02A 2NVQJ 2NOGA 1RESA 5IPAA 1JTXA 5IYDJ 3JR9A 2L9RA 2XGDA 1ORKA 1ZK8A 4HNVA 1ETQA 2LVSA 1FEXA 4MO7A 1ZKGA 3QPLA 3E7LA 4FTHA 3WHBA 4UUSB 4BBSJ 4RDUA 2L7FP 3Q0UA 5HODA 2R5ZB 3GTGJ 4J19A 3I4MJ 3I4NJ 2D5VA 2RAEA 2DMUA 2M0CA 5K7HA 4FE7A 1ETXA 3GTMJ 2B63J 2R93J 4X1EA 2JK3A 1T33A 4FCYA 2R5YA 1BW6A 4JP0A 4MFEA 1JJ8C 1OCTC 2JMWA 4A3GJ 3G1LA 3HOVJ 4BXXJ 4IHVA 5M5YJ 3JRAA 5IP7J 1Q1VA 5FKLA 1BL0A 1TWAJ 1X2MA 5DTDA 2TRTA 3RZDJ 1HDDC 4C3IJ 1FIPA 1R9TJ 4CYCB 5EEAA 2WAQN 4A69C 2LLKA 5JLWA 2AO9A 1B8IB 3LSPA 5E3MA 1UMQA 2CRGA 4NDLA 3JREA 4A3EJ 3HEFA 5EGOB 4AUXA 5BNGA 3CQZJ 4B1RA 3BR6A 2IAIA 3ZQLA 2KT0A 5FKMA 2WB1N 3CMYA 1H8AC 4IHWA 3HM5A 3GTLJ 4A93J 2DA4A 1BJZA 3LSGA 3GTOJ 2CUEA 3CDLA 5J1RA 1T56A 2DA7A 1OCPA 2R0QC 4A3FJ 2I10A 5GPCA 5EG0A 1VI0A 1D5YA 5F0CA 2LR8A 1LFBA 2EZHA 3LOCA 2OF7A 1VF9A 2M8GX 3JRDA 3MKLA 1LE8B 2JA5J 2PMZN 3BG9A 1U8BA 3PO2J 3L1PA 1P7IA 1TWCJ 1WGXA 3K2AA 4C2MJ 2DMQA 5F08A 3S2DJ 3OOUA 2ECBA 5FKKA 5J1UA 2W48A 3S1NJ 2HOTA 3F0CA 5E3NA 3HOWJ 1NK2P 2Y9YA 2VUMJ 2IEKA 4XK4A 1B72B 4M3FA 1NK3P 3K7AJ 1IG7A 3RKQA 3GTPJ 2L7MP 3BTCA 2JA6J 3ZQFA 2R7ZJ 2P81A 4B3AA 1RETA 1FTTA 4M3DA 1HDPA 3GBGA 1GV2A 1XC5A 2XPUA 2CU7A 2WV1A 4GFBA 3ZQIA 2M34A 4XICA 3C2BA 5C44J 3FK7A 3OSGA 3DCFA 3BTJA 3PO3J 3WHCA 2DMNA 3S17J 3Q0WA 4D7NA 3VPRA 4IHYA 1X58A 2KDZA 4D5CA 3QPSA 1HLVA 4JX4A 3HDDA 1RKTA 3MN2A 3B6AA 1K61A 5F04A 1XS9A 2HQ5A 2O7OA 3SJMA 1WH5A 2ID3A 3LNQA 1JJ6C 2QCOA 4MFDA 1U78A 1JT0A 2K9NA 3TP0A 1H89C 3LSRA 2M9HA 1ZR2A 3JRCA 1OJLA 3NAUA 2H8RA 4JX5A 5E3LA 5K7FA 3SFIA 2CQQA 1JT6A 2EH3A 1Y1WJ 3HBLA 3Q3SA 1ZGWA 4UUSA 2K9SA 3FISA 4V2GA 5JLXA 1PUFB 3RQIA 2G0EA 2R5ZA 2XSDC 1TWGJ 1W0TA 4XRSA 2MGQA 2EZKA 1JKPC 4M3GA 4A3LJ 2GBYA 2Y9ZA 3H3VK 3S1QJ 2Y0SN 2NS7A 1A5JA 1A6IA 3D1NI 3S2HJ 4C3JJ 2HDDA 5EZHA 3TW7A 2IBDA 4I6ZA 4M3BA 3HOXJ 1VNDA 4Y7NJ 1JUPA 1OFCX 1IUFA 3JRBA 1RR7A 3IH4A 3BQZA 3TP3A 4BBRJ 1HOMA 4MLOA 1QPIA 1POGA 1MBJA 1MBKA 2FJ1A 3BR0A 2HOSA 1UG2A 1AHDP 4CYCA 1GT0C 4MIMA 1YRNA 1HCRA 1IDYA 5F0HA 2HXIA 1MBEA 4JX6A 1FTZA 3GTKJ 4JYKA 3ZQHA 2ELKA 1IC8A 1QVTA 2DJNA 5EGOA 2K9QA 1NTCA 4IHXA 4BKXA 1JKOC 1RPWA 2FQ4A 1APLC 4W97A 1GDTA 4IEJA 2EQRA 3S14J 3A01B 2TCTA 3ZQGA 3JRIA 1I50J 1SANA 1CQTA 3B6CA 3HGGA 5IOYA 4DYCA 4D7MA 1WH7A 1ZR4A 2YU9J 1ITYA 1GVDA 2XGCA 2Y30A 3A03A 3JRFA 1JKRC 2NVTJ 5IOZA 1LE8A 4EEFG 1Y1VJ 3IH3A 2FD5A 2XPWA 2FX0A 1F43A 4M3EA 1IGNA 3TEDA 2E1OA 3S16J 2N8GA 2DA2A 2GLOA 3PM1A 4W1UA 1K83J 3UKGA 4Y52J 5K7ZA 5IYBJ 1MBFA 2ECCA 3IV5A 4D5FA 5IP9J 2LKXA 3JRHA 4A3MJ 1MBHA 1B72A 3HB9A 1WPKA 2YUSA 4QSHA 3OSFA 1BW5A 1TC3C 3TW6A 5J1YA 1GV5A 3HOYJ 3S1MJ 4XRSG 3SDGA 1AKHB 1QRYA 5DS9A 3HGYA 1AU7A 1ZQ3P 2JA8J 2X6OA 2H1KA 3MVPA 2L0KA 4A3CJ 2LD5A 5M3FJ 2NVYJ 1E3OC 2VKVA 2R92J 2QF7A 5C3EJ 1I3QJ 2Y31A 2DA3A 2HOAA 2DA6A 3NARA 4AYBN 1VFCA 2MG4A 1SFOJ 1JGGA 3BR3A 1MBGA 3G1MA 1IJWC 4X6AJ 3OIOA 1O4XA 3BR5A 2DA1A 4FE4A 4A3JJ 1ETYA 2XB0X 2COBA 3BR1A 2CQXA 1MH3A 2EBIA 2YS9A 3FK6A 2HXOA 2E2HJ 2R5YB 4V2FA 4A3IJ 2GM4A 3O8HA 2L7ZA 4DYRA 2EZIA 1PUFA 2M2EA 1S7EA 2XPVA 1EF4A 1ETKA 2EZLA 5J3LA 4DZPA 1H88C 4XIDA 2VI6A 3QQAA 1F36A 4FISA 2LK2A 1FIAA 3HKZN 2JA7J 5E3OA 1JTYA 1MNMC
chains in the Genus database with same CATH superfamily
3Q0VA 3HPHA 4DJAA 2IGMA 2LH9A 4M6YA 2Y48A 4KITB 1D0ZA 3WODF 1SVOA 2FOKA 2NVXJ 3RKXA 1Y8QB 5B66C 5FRNA 2XRLA 3FXUA 2FRHA 2WV0A 4LIVA 5H6QA 1MDMA 1B8IA 2BXYA 1ZG5A 2P6TA 1XSXA 4BNCA 3RZOJ 3DBHB 5EZGA 1JXSA 1YRNB 3BT9A 4WXHA 2E7WA 3H9QA 3BZKA 2JJ7A 4L0ZB 4QLCU 4KIFA 3OS2A 2FA5A 2CQNA 4BYYA 2FU4A 4XKCA 1W5SA 2HYJA 2V1XA 5EG0B 4WX9A 4UNOA 1ETOA 4YIFA 1L3LA 3JAMZ 4GXOA 4XONA 1HW1A 1BC8C 3GUDA 2R7QA 3D5SC 4ASNA 1MMNA 4HAMA 2DDBA 4A6DA 5FKNA 3F8NA 1YX5A 3LMMA 3FKIJ 2W57A 4RBOA 4DYQA 3CCLI 2IW5A 2XAHA 3WGGA 2KIUA 3MWMA 2NS8A 2CSOA 2ME0A 3HIFA 2XAQA 3X2QH 4C3HJ 2RKHA 3SFZA 3S3OA 3H3UA 4A6EA 1NHAA 2ZXJA 3FXOA 3RI4A 3C2HA 3LSTA 2DODA 1G2HA 5DUKA 1XB4A 2RGVA 4EJTA 1ZAOA 4L5IA 3S1RJ 3S15J 3FIWA 3CC2I 2ZB9A 2DFFA 1R49A 2HPMA 2LFBA 1KU9A 2ZJQF 2AQEA 2FBHA 2HI3A 3OYJA 3LQRA 2WAFA 1T39A 2O8KA 2STTA 1VQ9I 2ZXWH 3E6MA 4E7JA 1ZRDA 3DQVC 2PJRA 3M4OJ 4NC8A 2X6XA 2IGKA 2ID6A 1BA5A 4OIOF 3L2UA 2K02A 2E2IJ 4OMYA 1IDZA 2E19A 4ABZA 1B6AA 1DU0A 4A3DJ 2P7CB 1JUMA 4M6VA 2F2EA 2KFDA 2K3FA 4LJZF 2MBFA 2QKLB 1IN4A 2LNBA 3AFHA 1W0UA 4PZJA 4Y4RA 2H6BA 2Q1ZB 3HOUJ 4OIRF 1IO2A 2ZNZA 4M9XA 2NVQJ 4BXFA 3ECOA 3EETA 1QGPA 5IPAA 3KP3A 1JTXA 2Y0MA 4EM2A 2R7TA 3FBNB 2HVSA 4EV0A 2XGDA 2RVCA 3QU3A 5IY5H 1MJBA 3QPLA 4HLYA 1TTYA 2EV5A 4RDUA 3ZGKA 3OV8A 3PSFA 1F4KA 3GTGJ 3I4MJ 3U9GA 1VQ7I 4FE7A 4OU0A 1ETXA 1YO5C 1ERDA 4ETSA 1X1DA 3PNVA 3SHFA 3SEQA 5D4RA 2PMZA 1BW6A 2WAEA 3J7AY 5K1YA 1YG2A 2HGCA 2KRCA 3Q9VA 1YS7A 5JR3A 2OTLI 3V42A 1HW5A 2EV6A 4Y3OA 1TW3A 5FKLA 1LDKB 2W24A 2TRTA 2DYRH 2IS1A 2KKOA 4L9NA 4AD9A 3I58A 4LD5A 4BQNA 2CV1A 2IGOA 2X6WA 1WZ2A 2EIKH 2Z1DA 2WAQN 2LLKA 5DUIA 4KNYA 4BACA 3GLXA 4I0BA 3FMSA 1TW2A 2F5EA 3PL8A 2DDAA 4XM3A 4RB3C 1UMQA 4NDLA 4A3EJ 1A6QA 1UHMA 3O3KA 2HWVA 1ZLKA 1XDSA 2DJIA 2PQ8A 3HTUA 1PJRA 3P9KA 3OS0A 3CMYA 1BOAA 3HM5A 1FYKA 4Q48A 3V4GA 4D0PA 1KU2A 1WHUA 3K70C 2DA4A 2XF6A 3LSGA 4BUPA 3ABLH 2CUEA 3AG2H 1I6XA 2JVGA 5FD6A 4BEHB 2HOEA 4WXDA 3P9IA 1W5CC 3CCEI 4CXFA 2LR8A 5F6FA 2RV8A 4WCGA 1USTA 4GCVA 5D5UB 1FBQA 2RQPA 3DTKA 1IN6A 1VF9A 3A0BC 2E71A 1LE8B 2JA5J 1LUJB 1G8XA 5FO5A 3BG9A 4MEYF 3V8LA 1SD5A 3S93A 1BC7C 4XQFA 1TWCJ 1WGXA 3GFJA 3HRUA 2X1EA 3L7WA 3OOUA 4F93B 4CCNA 4XLAA 2A61A 1DGWY 3DFGA 5HNHA 3I59A 2OC6A 3V8JA 3S1NJ 3F0CA 3E97A 5L3GA 4FQGA 4RAYA 1XCBA 3UNGC 2IEKA 4XK4A 3WTWC 2O0YA 4M3FA 1IG7A 2L7MP 1E3HA 2EFNA 3C18A 4MHGA 3ELKA 1FTTA 2A3SA 5L3FA 3V7RA 3S3NA 2WTEA 2XRNA 4CDGA 3PIOF 1HSTA 1XC5A 1OMIA 1V5GA 2QM3A 3K4KA 4Z2YA 2CU7A 3IAM2 4U7DA 4GFBA 2M34A 3ZXSA 3FK7A 2HYGD 3MD2A 3DCFA 4L0YB 3PO3J 3TMOA 5GAGJ 3WHCA 1KU3A 4D7NA 2QBYB 4BS9A 3P7NA 1FP2A 3LSIA 1TBXA 5HLHA 3MZHA 3T0YA 2M0MA 4KICA 4GYIA 3CP8A 1Y6IA 3DP7A 3B6AA 1XS9A 2PI0A 1JI8A 3LAJA 4KMUX 5HLIA 3J80K 5DCFA 3ISPA 3KYDB 5E1ZB 1OQYA 3ASNH 2A69F 1JT0A 4KYWA 1FYMA 1H89C 3LSRA 2V7FA 3K4CA 4LLNA 2JPCA 1ZR2A 2W82A 4KJZA 5D8KB 4FX4A 5J8CA 2CQQA 2QUFA 1JT6A 3TKYA 2UZKA 3Q3SA 1ZGWA 1O3SA 2P8TA 3FISA 1VZ0A 3WG7H 4IZZA 1BR2A 2XSDC 2R5ZA 1ZH5A 4L9JA 3BPVA 3TQNA 1MMDA 4BJ5C 2H27A 3PQKA 4M3GA 4A3LJ 1P6RA 3DLAA 3W2AA 2QEXI 3S2HJ 5E1XA 5EEHA 1O3RA 4RB1A 2IBDA 4CZCA 4RAGA 3QWLA 2OJED 2DU9A 4HV5A 4CHUA 5CKTA 1JUPA 4LLGF 1TP4A 3SYTA 3RSNA 3JRBA 3TP3A 4BBRJ 1TQMA 5J6XA 4UY8I 4MLOA 1QPIA 1HBXG 2XHKA 3OY9A 1RUNA 3PNTA 2LF7A 2VXZA 3EDPA 1OCRH 4HBLA 3F8CA 2FBIA 3GZ5A 2B0LA 2L9NA 5H20A 4F52A 1A04A 4NC6A 3E6DA 3R4KA 1KQ9A 1XX5A 2P6SA 1HCRA 2KJBA 2HXIA 3LA2A 3DWLE 5B1AH 2QQ9A 3H9GA 1QVTA 2QSGX 2ZCWA 3CCJI 4NQWA 1IXRC 1SFKA 3FKJA 4FASD 1R5GA 2PMHA 3CMMA 4PUSA 5HDNA 3OYIA 3KP2A 1D1CA 2P5VA 2MYSA 1APLC 4W97A 3VYSB 4A5MA 1GDTA 2EQRA 5H6RA 1ZGAA 1I50J 1SANA 5CVRA 1QHGA 1CQTA 4BH9A 2KIQA 1RIOH 3HGGA 5IOYA 4DYCA 2OU2A 4Q5SF 1KYZA 5DCMB 2NS0A 1DPUA 4ZYGA 1S72I 1JKRC 1X4OA 4BE2A 4GDFA 4JK1X 3G4SI 4HSTA 2W85A 1RRJA 2ZO4A 3KE2A 1P4AA 4IRHA 2FD5A 2XPWA 3K1PA 3GF2A 1A36A 3KCCA 3ZCOA 2Y69H 3E5XA 3F6OA 2O6GE 2IXSA 2ZFUA 3WE3A 1V54H 3E6BA 2VBZA 2G7HA 2DA2A 3LFKA 5FFZA 1R4MB 3PM1A 3UKGA 3NWSA 3AG1H 4Y52J 5K7ZA 3M7GA 5GTHC 1JHHA 2HZDA 2K9LA 5LGNA 2Z99A 4A3MJ 3JRHA 1MBHA 3L2RA 1B72A 4I09A 2Z2SB 2ADUA 4IPAA 2VBYA 1YIOA 3EUKL 2J5PA 4BQAA 1S7OA 4I2OA 1Z21A 1R5HA 1TC3C 1UB9A 5J1YA 1GV5A 3TO7A 5LHHA 1BR1A 5E1WA 2FNPA 1QRYA 1XGNA 5DS9A 3HGYA 3KP4A 1P4XA 1ZQ3P 3WU1B 2XIGA 1T95A 4LG3A 1YI2I 3FWEA 3S8PA 1SD7A 2H1KA 3MVPA 1KZHA 2LD5A 1YHQI 5C3EJ 1KQ8A 5IT9K 3H36A 1FBSA 3DEEA 3BY6A 2OD5A 2DA6A 3NARA 4HQEA 2ZXIA 4L9TA 2MG4A 1JGGA 1AA7A 3BG6A 3BR3A 4TV7A 4BHCA 1BI1A 2VBXA 4FX0A 4FE4A 2M8EA 4CICA 3HUGB 4IQJA 3WTTC 3BR1A 3F9KA 4RLQA 2KIMA 4V2FA 4A3IJ 4G9YA 2NVUB 3GEZA 4DYRA 3K4MA 4MNUA 1MMSA 3ZMVA 4UUVA 1QPMA 4U7BA 3WTYC 3LFUA 1G4DA 1FWZA 2VONA 2VI6A 5J8FA 1WFXA 1UHWA 2MH9A 4Y33A 3T8TA 1JTYA 2MW8A 2ISYA 2V6CA 3BTIA 4O6JA 3K4LA 4BY1J 1MMGA 5FLVA 4F7ZA 2DK5A 1EKEA 3IH2A 1I6HJ 3CCSI 3CO7C 1ENHA 2BEOA 4I76A 3FX3A 1DU6A 3QOPA 4Z6YA 1BJAA 4BY7J 4EJOA 4KUMA 1IN8A 4F91B 2VL8A 1TZLA 1ULYA 4QTRA 2DOEA 5M5WJ 2VQHA 3TO6A 4PDKA 2L54A 1U9NA 2E60A 9ANTA 2RN7A 3ABUA 4HQMA 4PJJA 5C4JJ 2E2JJ 2JRTA 1WI3A 2V26A 1WSUA 5F1JA 2IRFG 1VQNI 2DA5A 2BHZA 1V3FA 3GXOA 2CV0A 1NG6A 4YIRX 1XG1A 4IVNA 4ZDOA 3N05A 3H35A 5ICEA 3WTVC 1Y39A 1HC8A 1J09A 1YX3A 3OR2C 4ZH4F 1GUUA 4G12A 5IYCJ 2V9PA 1HF0A 2QSHX 1TT5B 2BOLA 2XF7A 5EYRA 1I1GA 2DTZA 5LHGA 2H6CA 4I98B 1LB2A 2DPDA 5CQGA 3W6VA 1UHSA 3O2PE 3TOAA 4L5JA 2LG4A 4MQVA 2IVMA 2JUCA 4A0YA 2BY3A 5JVTA 1PUEE 1YW9A 4S05A 5J47A 2DT5A 4AC0A 4LG0B 2LKPA 2LREA 2EFOA 4RA2A 1X1PA 2GIVA 3CP2A 1FX7A 2YU3A 4BXUA 1ZRCA 2HTJA 3PUBA 5A2QK 3QP5A 3BC8A 1U9OA 2WY7Q 2X48A 2K9MA 3OYGA 3GWZA 1IZ1A 4P9FA 2B7EA 1PVEA 4KISA 2ZJRF 4F92B 2OA4A 1CF7A 2K85A 1OCZH 2GXBA 2CJJA 3FM5A 1S5LC 3KLNA 4N4NB 2AHQA 4R79A 1AOYA 1FSHA 1AKHA 2WAQA 5F1RA 3KETA 1YOVB 4G7ZF 1STZA 3QOEA 4DZJA 4B4CA 1IXSB 4HSRA 1XMAA 2LP0A 2R3SA 3A02A 4RGXA 2VBWA 1V4RA 2DQLA 3JW4A 4OWRB 4PFPA 5HS8A 3IKTA 4DNCA 3TBIA 1EH6A 2E34A 2L9RA 4RB2C 1FLIA 2GA1A 2M4GA 4HNVA 1ORKA 4NBQA 1QZEA 1X3ZB 4H4KC 4MO7A 1G3YA 1WRJA 2X4HA 3HHGA 1FOYA 3GZNB 3ROUA 4BBSJ 1BI0A 1FOWA 2KDOA 1GHCA 3I4NJ 3KX2A 1PP8F 2RAEA 4CSWA 5CVUA 1WJEA 3GTMJ 2R93J 4AIJA 2Z5UA 1I39A 2MLGA 4X1EA 3VWBA 1LKXA 2JK3A 2OZ6A 3IAS2 4FCYA 4UVCA 2MC4A 1OCTC 4A3GJ 3G1LA 3RKYA 2BVLA 2ACJA 1S6LA 5IP7J 3J7ZI 1BL0A 4A0XA 3SEZA 1XGOA 2AQFA 3F8MA 4F55A 1YTYA 3LA3A 3JTGA 3BG7A 1OYYA 1FIPA 1R9TJ 2LBFB 2DCEA 4CYCB 3KEOA 2B9SA 5JLWA 3V7CA 4XR6A 5DV5A 2VASA 4XIDA 1B8IB 2WA0A 2CRGA 3FDYA 4XLNF 1D1BA 2LOOA 5EGOB 3JAMK 1X1BA 5BNGA 4JOMA 2VC0A 4CUGA 2JTVA 3BR6A 2FXAA 5E8IA 2KT0A 2I5UA 3ZQLA 5FKMA 1LPQA 4IHWA 3ASOH 1KQ0A 2Y75A 4CCJA 5K5RA 1C0WA 3GTOJ 3BWGA 4LITA 5L3DA 2CYYA 2DA7A 4IL6C 4E7ZA 3AL0B 4IHSA 5EG0A 1D5YA 1LVKA 2RREA 5BMZA 3EQLF 4AVPA 1G6NA 4EJVA 3LOCA 4LK0F 2M8GX 3JRDA 2BBYA 2MABA 2EIJH 1DP7P 3ZMZA 3L1PA 4XN0A 2R7SA 3K2AA 1VQ8I 1ON2A 2OZUA 2VE8A 4Q4ZF 2HKXA 2ECBA 2ZSHB 4HX7A 2Q2EB 5FKKA 1TT0A 5J1UA 3PUFA 2W48A 4ZYEA 3NEUA 2CQKA 3HOWJ 3HRTA 2V9KA 2D1HA 4P1WA 2QWWA 5EJCA 1IW7F 5LRRA 3GTPJ 5B1BH 3I64A 3BTCA 2V1NA 2D1VA 1O7LA 1EJ9A 2FEZA 3BLYA 4LLLA 3OYHA 3KZZA 2D2WA 1HDPA 4OMZA 4F3QA 3CUQB 1X4PA 4A2UA 1T2KA 2E5ZA 2QA4I 5FLXK 2E35A 3FXKA 3ZQIA 4XICA 3C2BA 1HKQA 2JUGA 1P2FA 2FNAA 1E2XA 3BTJA 2DFIA 5H2FC 5IT3A 3VPRA 3CESA 1X58A 4M71A 3A0HC 2M4KA 4JX4A 3KZYA 4XLCA 1Z05A 2XAUA 1K61A 2HQ5A 2QVOA 3SJMA 3K4NA 2HZTA 3U2RA 3GMEA 3WTZA 4XOTA 1BIBA 2F6CA 2XASA 5K5QA 2W00A 2EFWA 1U0JA 2M9HA 2BY2A 1I1SA 2K3PA 5LEJA 1OJLA 3W2VA 4XBFA 4PGGA 5CVJA 3LSHA 1ONVA 1W36D 3RYRA 3HBLA 4NHJA 3M8FA 3Q9SA 3K0LA 1PUFB 3DTIA 2VPLA 2KRHA 3A2KA 5E20A 1FNNA 3BCAA 3S1QJ 2Y0SN 1MGTA 1ZRFA 2DFHA 2NAZA 2EA2A 2KPMA 3PFYA 5EZHA 1WJBA 3CCQI 1MZBA 2EWNA 3QPTA 2XC7A 1QQIA 1VNDA 4B09A 3DLLF 1OFCX 1IUFA 3BP8A 4E7HA 1RR7A 2WBMA 3IH4A 3R0AA 2A6TA 3U21A 1X1AA 2BV6A 2MLKA 1KA8A 1MBJA 1MBKA 2HQNA 5KK1A 2D45A 1UG2A 1AHDP 1BI3A 3TOBA 4B43A 2R7DA 1IRGA 5K5OA 1Z91A 4JX6A 2DI3A 3R6SA 1Z3XA 2A07F 3CJTB 2DJNA 1TLHB 3M8EA 2K9QA 4J00A 1JKOC 5LBQA 4PJNA 3KIOA 3OMYA 4S04A 1RPWA 1SC7A 1XMXA 4RLFA 4IEJA 1YQAA 2P7VB 3A1YA 1U2WA 3A01B 3G2BA 1O3TA 4YEJA 5DD4A 3K6GA 1OCCH 4BDZA 3JRIA 4B8XA 3AKZA 2KP6A 4BEHA 3GX4X 5LFAA 4LGWA 3B6CA 4D9JA 2ZMEB 1ZR4A 3HYIA 1MJ9A 1ITYA 1GVDA 2FQ3A 3A03A 3VYTB 3K69A 3QAHA 5IOZA 1VQPI 1R4NB 1GLNA 5JI6A 1LE8A 3OL3A 3IRQA 3CJNA 3CLOA 2CS3A 3AG3H 4P5OA 1WQ2A 2HR3A 5D6FA 3TEDA 2E1OA 3ABKH 4RM3A 2H09A 2QKMB 1D8KA 1Q1HA 3S16J 2F5FA 2N8GA 1O3QA 2JZYA 4RAZA 3SZTA 5IYBJ 2DBBA 2ECCA 2LKXA 3M8JA 3AG4H 1F1ZA 5FROA 1OPCA 3HPGA 1HKSA 2Z9OA 5DEQA 4B48A 3L2CA 1R71A 1BW5A 3TW6A 2M5WA 2OUMA 3K2ZA 4E70A 2UXXA 2LY2A 1R1TA 4OAZA 1AU7A 2QQ8A 2ELJA 2X6OA 4ESJA 5LLQA 2DYSH 2QBYA 4RGUA 1EV7A 2NNNA 2L0KA 4HNUA 2VKDA 3VYRB 4A3CJ 5KCMA 3OYMA 1P92A 3FZVA 2Y31A 3TL4X 4HW0A 3TGNA 4BHBA 2DA3A 2CW7A 4C2UA 4JBAA 4AYBN 4FHTA 3CCUI 2VC1A 1QA6A 4NB5A 1IJWC 3FF5A 3S2WA 3HSEA 4Y13A 2PLYA 2YS9A 2XAGA 2VKHA 3GCMA 2GXGA 3MKZA 2R5YB 2E2HJ 3REOA 3O8HA 3QODA 4IRIA 1V55H 3DKXA 2EZIA 5J4YA 5D4SA 4XKWA 2VJ4A 3KLOA 4HLXA 2BY1A 3M1CA 1IN5A 1EF4A 1SEUA 4OAYA 4P55A 2EZLA 1USSA 5J3LA 1H88C 5LGUA 5E8GA 4XORA 2DT7B 3QQAA 3R61A 3VFZA 1F36A 3ESWB 5KHDA 2VLAA 1LQ1A 4FISA 2LK2A 1FIAA 3LWFA 2XAFA 5GAEJ 5E3OA 2CO5A 3H92A 3DV8A 3DBRB 5ED4A 2DN0A 5ILSA 4S0HB 3U1KA 2EINH 3WGHA 3JSOA 2DQRA 2ME6A 2JWTA 3FMQA 1FMVA 3OIQA 1QHHD 2DW4A 1X1CA 2PG4A 2Y2ZA 1KONA 1N78A 3ZQ7A 3EPZA 4EATA 4UUTA 2BVMA 5FLMJ 1WI9A 1MMAA 1R1UA 4QWQA 3GTQJ 3J81Z 1ZG1A 4HX8A 4BDYA 2EFQA 4EGZA 1SD4A 2LY9A 1S3JA 2HDWA 1UELB 2Z3YA 2ISZA 2DMTA 2O9LA 2KLOA 1DPRA 2VQLA 1XPXA 3BQYA 3LSJA 2OQRA 1JUSA 2PX9A 3OYBA 1IV6A 2OCEA 2P5KA 4IQ4A 4XSXF 3T5XA 3LSKA 4A3KJ 4RM2A 3F3XA 2FOWA 1EH7A 2L01A 5F0FA 5F64A 1K78B 3H1CA 1YW7A 4Y15A 5EDNA 1W5TA 4N9IA 5M3MJ 2LTPA 2FBKA 3K70D 2XKOA 1K6OA 1X2NA 1O57A 3L9FA 3PQJA 4G8XA 3I71A 3L2QA 2CH0A 4PFOA 3OOPA 3QYBA 5DCMA 4HRIA 3FHNA 4CCMA 5HOOA 2QQBA 1FOKA 1PP7U 3ZOBA 1BN5A 3D5RC 1M1EB 5J40A 2EFPA 4QPQA 3F8FA 3O6BB 5F27A 1SFUA 1R36A 2UV1A 4EMSA 2KISA 5HS9A 4HEA2 1TWHJ 3JRGA 2VXDA 3BCBA 3VYUB 2CW8A 2JA2A 4M6XA 1X3UA 1G3WA 1Z1DA 2K27A 3OIPA 4L5EA 3MKYB 2K40A 4ON0A 3BTLA 2EJRA 4O5VA 4YFXF 1S9HA 3ZN0A 2XB5A 2X9DA 3G73A 2E1MB 2O03A 1FJLA 2VQGA 1Y0NA 3ECHA 1ETVA 2DMPA 2NNYA 4HV6A 1WCMJ 1XTAA 2W84A 3OS1A 2GAUA 3EYIA 2TDXA 3MEXA 3CF5F 6PAXA 1WJCA 3PIPF 2RNJA 1N25A 3I54A 2CUFA 3FM3A 4QIWN 2L9VA 3DEWA 3RJPA 4UVBA 3CCYA 3COAC 3WTSC 2NOGA 2YSRA 2XV4S 4BGDA 5D5VB 5HS7A 5IYDJ 1U6GA 4ESFA 3IHUA 2CFXA 4CH7A 1W7PA 1LFPA 3C2GA 3OYCA 4DQ2A 4BE0A 3E7LA 4FTHA 3QYEA 3KYCB 5LRSA 3ZP5A 2X51A 4UUSB 1WJ5A 1SAUA 3RKWA 1UZCA 3H0DA 2KMUA 4J19A 1FC3A 1OKRA 2D5VA 1FY7A 5K7HA 4ZYDA 2ZKZA 3HUGA 5E17F 1B4AA 2PJPA 5IT9Z 2B63J 1D0XA 3RQ4A 5TRDA 4JP0A 1JJ8C 1XGSA 4MFEA 4IHVA 3C3WA 2V1UA 5M5YJ 3DTEA 3FMRA 1I27A 3S3MA 1QZYA 4RAFA 1BOBA 3MKWB 1MKMA 1TWAJ 2UUZA 1X2MA 2BW3A 1SAXA 4AWXB 1IAWA 2ETHA 3RZDJ 5EEGA 3C7JA 1FPQA 2M87A 2MH2A 4BU2A 2VOPA 3OYLA 1YITI 2DOAA 3MMYB 5EEAA 3WU0A 2KHMA 4A69C 2MD5A 3H5AA 2VB6A 2XDVA 5L3BA 3LSPA 5E3MA 1WKMA 1GXPA 3HEFA 1TNTA 4AUXA 2QGUA 3CQZJ 1HA8A 2EB7A 3MCZA 5JFRA 2LMDA 4B1RA 3RYPA 4G6TB 3K4BA 1UJ8A 2QQAA 1V5EA 2VT3A 2WB1N 1H8AC 3GTLJ 4GO1A 1EH8A 4A93J 1J5YA 4M74A 5HDGA 1BJZA 3IC7A 3ERED 2HU9A 3D0SA 3AL0C 5J1RA 2I8DA 1T56A 2VIXA 3S32A 3H5RA 2R0QC 1L0OC 3K10A 3OYKA 2EZHA 1WJFA 3DF8A 3TDZC 2E36A 2L4MA 1E0EA 5TISC 4YFNF 1U3EM 3HSFA 4P96A 3JTHA 3HOTA 1P7IA 4CCOA 2DMQA 3I5UA 3RPUA 3S2DJ 4AVZA 2HVQA 4WK8F 3GYHX 5E3NA 1DDNA 4MTEA 1NK2P 2VUMJ 1WWXA 4KFCA 2K5CA 3E1SA 1SMTA 1SVLA 2EPFA 1NK3P 1BBYA 4EJUA 2IJLA 3K7AJ 4N0BA 4E7LA 1XGMA 2L9SA 4IO9F 3RKQA 3V8KA 2V6EA 2R7ZJ 3CUQC 2Y0SA 4LG0A 4M3DA 1T0FC 1HXDA 2BGCA 2O3FA 3G6EI 2W4SA 2XPUA 2WV1A 4RGSA 3HZJA 2R7XA 4MGRA 3F8BA 2DO7A 4UB8C 3S17J 3M07A 3HL2A 3ABMH 2JPBA 4XRFA 3L2VA 2R7RA 4CGZA 2KDZA 2HQAA 4PJMA 4A12A 1IRFA 1ZG3A 2JRMA 2UXNA 3DKYA 1DP3A 1HLVA 3HDDA 1YJ9I 2CUJA 5F04A 1RR8C 5LD2C 3F21A 2ID3A 3VDXA 3FHZA 3DPTA 2IA0A 2QCOA 4MFDA 1U78A 3L2WA 3TP0A 2ELHA 4G7HF 4AIKA 3RPQA 3VSKA 3N4MA 5JHFA 4XKVA 1HSJA 1WJAA 3JRCA 4JX5A 2HNHA 1YS6A 5K7FA 1X19A 4YG2F 2M45A 2EH3A 2M30A 1Y1WJ 2ZFWA 4AIHA 4XLFA 3GFMA 2H1LA 3H5NA 2K9SA 4V2GA 2F4IA 3RQIA 2G0EA 1TWGJ 1W0TA 4XRSA 1OLTA 1U5TB 1H9GA 1G3TA 1TQIA 3F22A 3H3VK 3OL4A 3PNYA 1H9TA 1PYVA 4C3JJ 1YIJI 2HDDA 3CC7I 3TW7A 2J5OA 4A5NA 4I6ZA 3MZ8A 1VQ5I 4M3BA 2WY8Q 3DBLB 4E7KA 1BR4A 3VSLA 2CMPA 3HXLA 4C30A 3ZQQA 5BS6A 2GOXB 2KJCA 3BQZA 3OYDA 2R4GA 2DTRA 1MDMB 2HS5A 3L00A 4PJLA 4E4HA 3I3LA 3MQ0A 1POGA 3E0JB 2FJ1A 2RDPA 5CQEA 2X6YA 2LBFA 4CZZA 5JHUA 4CYCA 2RNGA 1GT0C 2ZBKA 3LQQA 4MIMA 1B9MA 4HNTA 1YRNA 1IDYA 4OIQF 1FTZA 1SFEA 4JYKA 1QNTA 2ELKA 1QO0D 3CJRB 3ZQHA 4CYDA 2LYCA 5E18F 1B59A 1K4TA 5LEKA 3WGIA 2XVCA 3IWZA 5EGOA 4G6QA 2R7FA 1W1WE 4EGYA 4HA8A 3WTXC 3ERMA 1VQ6I 1YLFA 1R7JA 4NC7A 3OYFA 3IRRA 1T98A 1EA3A 3HC7A 2CV2A 3R0JA 4B47A 2GOMA 1YJWI 1U8RA 2F5CA 3SXYA 1RI7A 2P4WA 1VQOI 1YE9A 2ZMEC 1VQKI 1ZYRF 3F72A 1I3AA 2LDUA 2LF8A 4XOPA 2VE9A 2XGCA 2Y30A 2FE3A 2P0WA 3KZIC 4AYBA 2MA3A 5DYMA 2OV7A 1Y1VJ 1BIAA 2M3AA 2CG4A 4M3EA 1ZREA 1IGNA 2DOFA 3DKWA 3CF2A 1FOXA 2Q2EA 3F6VA 4IXAA 3FXMA 3D5LA 3BZCA 4W1UA 5CVIA 2PJRB 1K83J 2IS2A 2VJIA 1REPC 2PN6A 4N4OB 1MBFA 5DD8A 4D5FA 3CZ6A 2L02A 4M72A 3HSRA 4KIGA 3HB9A 3WU2C 3R60A 2KL4A 1TL8A 1S29A 1WPKA 2HQRA 2JSCA 2KIFA 5ERIA 4ANJA 4X0GA 1FP1D 4QSHA 4R1HA 4BHPA 3CUQA 1ZGJA 4KDPA 3HOYJ 3ABTA 5KVRA 4XRSG 5D5XB 1DQUA 1T0FA 4U87A 2HDCA 3MZYA 3T1BA 1LDJA 1T8IA 2JA8J 2JQ7A 1FT9A 3J7YJ 2BHYA 4DBRA 1FYLA 3TO9A 3CCMI 2E7XA 2VKVA 5FLXZ 2RC4A 4II3A 1I3QJ 2PFBA 4EJWA 4L18B 1ZHFA 5ILVA 1W4MA 3UR3C 1O7FA 2M7BA 1QZZA 4BQQA 1SFOJ 2DFEA 1XN7A 2CWEA 2LRDA 2AXTC 1GXQA 2K7LA 3G1MA 3K1NA 2IT0A 2K4BA 2VQCA 1O4XA 4A3JJ 2FMLA 3W6JB 2XB0X 2ESHA 1K79A 3FK6A 2L5QA 2GM4A 2L7ZA 4U0VA 1PUFA 2M2EA 2IGNA 3K1MA 1S7EA 1OISA 1ETKA 1OR7C 1GVJA 2BXZA 3E3VA 1Z7LA 2DAOA 5DM6F 2H94A 3CUOA 2FSWA 3FXRA 4DZPA 2OAZA 3OYNA 2BYVE 2F5DA 3P9CA 1J75A 5FRMA 1FBUA 3LSMA 3GVAA 3HKZN 2H8WA 2JA7J 2V4JC 3NWTA 3VODA 2OPTA 2PEXA 3BG5A 3BG3A 2HEOA 3RTRA 2X1CA 3T8RA 1Z77A 4E6KG 1VQMI 1MH4A 2ZSIB 2LC2A 1VQ4I 4I7HA 3M3YJ 1ETWA 4LK1F 3DEUA 1G59A 4DW6A 2PMUA 2BZTA 4HF1A 4WXCA 1MIJA 2ZJPF 1MW7A 2PBIA 5EF6A 1G3SA 2QSFX 4XRMA 2IS4A 3ZMUA 2C6YA 3GFIA 4BE1A 3E5UA 4LOCA 2MD0A 3HRSA 3WE2A 5KAFC 1XDUA 2ZXHA 1R6RA 3ONQA 4R8HA 3I56I 1IRZA 2K4JA 1Z6TA 1R5ID 2MSYA 1VQLI 4HDUA 2AS5F 1MNEA 1QVUA 2A5YB 4FT8A 4Y17A 4YIIA 3C1DA 4A3BJ 3KP5A 2W7NA 1MSEC 1BI2A 2XUBA 3IWFA 3CLQA 2KZGA 3I4PA 3W2WA 1Z0XA 3ZRGA 2KQRA 5GPAA 2KZVA 5B5EC 1IUYA 1LVAA 1T08B 2V9VA 3A01A 4I99C 2FF4A 3G1OA 3VOEA 3KEYA 1D5VA 3LAPA 3ZMTA 3H9JA 4QPOA 3H0GJ 3FXJA 1E17A 4I0AA 2ZMEA 3FXQA 1SVMA 1TQPA 3I59B 5ICFA 1LFUP 5GP9A 3SZGA 2VPRA 1ZTRA 2NXNB 3MAJA 1Z3YA 3L09A 4ITVA 4IX7A 1B9NA 1NH3A 1XCVA 3M1EA 2X0LA 2GXAA 2G9WA 2JN6A 3ZQCA 1JKQC 3FBIB 1MSFC 4BQOA 1RNLA 1YW8A 2M1BA 2YR2A 5M5XJ 2VODA 1HQCA 2L3DA 3J7AO 2VT2A 2E1MC 1P7JA 5FJ8J 4EM0B 3O8GA 1UG0A 4ZYHA 5FKOA 4IRGA 2YX7A 4MEXF 2XSJC 5IP6A 1TWFJ 1A35A 3RIRA 2A68F 2VN2A 3G71I 3BR2A 1RKWA 4HYEA 4RB0A 4UB6C 1R1VA 4ENKA 3IKVA 5AONA 2V79A 3E5QA 2F48A 2AXLA 2XAJA 2X85A 3CDIA 2HFHA 4FETA 3G3ZA 3HOZJ 3GTJJ 2NYXA 2XGEA 3GW2A 4H0EA 1NG7A 4RS8A 4D1QA 3B73A 3RCOA 1Y0UA 3CTAA 2VKEA 4YFKF 4P9UA 5C4XJ 1MNDA 1RESA 2EA4A 3CCVI 1I5ZA 1XD7A 4ZTJA 3JR9A 4HG2A 5ILUA 4UVAA 4DIQA 1K4SA 2XROA 2WB1A 1J9IA 1ZK8A 5TJJA 1ETQA 1MJAA 2LVSA 5ICGA 1N77A 1AWCA 1FEXA 1ACIA 4CO8A 1Z7UA 1ZKGA 5BPDA 2R7UA 3I53A 3WHBA 2XGXA 2L7FP 3Q0UA 2M7AA 4XNFA 5HODA 2QLZA 5BQTA 3JCUC 3J80Z 2R5ZB 2CUZA 3BJ6A 4Q47A 4O3MA 3EUHC 1ON1A 2DMUA 2A05A 2M0CA 4ENJA 5L3CA 2KRFA 4IHTA 1B1BA 2L4AA 4PK4A 1Z67A 1ZLJA 2A5WA 1T33A 5CPRB 2A6EF 2Q8KA 4AU7A 2Z33A 2G7UA 2GZWA 2R5YA 3BROA 2JMWA 4XN3A 4ENNA 3HOVJ 4BXXJ 4HPQA 3JRAA 1D1AA 4U88A 4ESBA 3WTUC 3CMAI 5JVGF 1Q1VA 4XL9A 5DTDA 5GTIC 5KAIC 4HDVA 2F5VA 1MD0A 3H3ZA 1OR7A 3CC4I 1HDDC 3J81K 4C3IJ 4KT6A 1R23A 2IP2A 3ZMDA 2RQQA 2EILH 4KMFA 2AO9A 2IPQX 5BOXA 2R7OA 1J2XA 5CJ9A 3DPUA 3JREA 4DOZA 4RGRA 4NQWB 1JE8A 4I02A 4IOCF 4BL0B 1R00A 1XMKA 2QENA 3DXJF 1PDNC 3GZ6A 2F4MB 2IA1A 2IAIA 1LJ9A 4HF2A 3IP4B 3M9AA 3SZPA 2CGPA 3WG9A 2VJJA 4G94A 3N97A 2HVRA 3BDDA 4LB6B 4GYGA 5L3EA 4YRVA 3CDLA 1YJNI 3HJEA 2UWMA 5D6EA 4PSWA 1OCPA 4A3FJ 2XKPA 2I10A 1Y8RB 2ZNYA 5GPCA 1VI0A 3I55I 3K4JA 5F0CA 1QBJA 1WJDA 1LFBA 1ZN2A 2OF7A 4ZZLA 3MKLA 4ZC3A 2HKOA 3JSPA 2PMZN 3BPXA 2A6HF 1K78A 1T6SA 3K9TA 4DGWB 1U8BA 3PJRA 2EV0A 4XLHA 1J59A 5HLGA 4OIPF 3PO2J 4C2MJ 1UAAA 5F08A 2NOJB 5AIQA 4NUBA 4OOIA 2CQ7A 2IS6A 2GWRA 2HOTA 2Y9YA 4UV9A 3QU6A 4CCLA 3ML6A 4K2EA 2V1DA 1B72B 4ZDPA 3ZPLA 2EIMH 1FZPB 2JA6J 3ZQFA 2P81A 2IA2A 4B3AA 1RETA 2R7VA 2JVHA 3KFWX 2O5RA 3CMEI 4GRIA 3V7SA 4BAYA 2ZJ2A 3GBGA 1GV2A 3IUOA 4ZTFA 2DK8A 3SQNA 5HDKA 5C44J 4XLPF 2WWYA 1OYIA 3OSGA 1K6YA 3ZMSA 4CA0A 2JSPA 2DMNA 5GADJ 1KGSA 3NQOA 2O61A 3VB2A 3Q0WA 1DUXC 4JQFA 3ZR8X 3EYYA 2ICWG 1BM9A 3HG9A 4L9VA 4IHYA 1FSEA 1RZ4A 4D5CA 1UCRA 3GLLA 1XSDA 3QPSA 1OYWA 4UHTA 2DLLA 2MFZA 2O8XA 3W3CA 1J7KA 1RKTA 1F5TA 3MN2A 1UFMA 5LHIA 1Z9CA 4HX4A 2ESNA 4E7SA 1IXCA 2O7OA 1QU3A 1WH5A 1R58A 3I9V2 3LNQA 4LFUA 1JJ6C 3OYAA 4UV8A 3BZ6A 2FUG2 5CYVA 4ZDLA 4KN7X 1W7PB 2K9NA 4MQ9F 4KN4X 1T38A 3CCRI 5AIPA 4PJ0C 1SD6A 3A4CA 4ENMA 5ICCA 1LEAA 1W7PD 2HTSA 3NAUA 1X3WB 1KU7A 2H8RA 5CVVA 5E3LA 3SFIA 4LMYA 3KEQA 3P5JA 2VOOA 4A0ZA 4UUSA 5TGTA 5JLXA 1U5TC 1V5FA 2YX4A 2MGQA 2EZKA 1JKPC 2QYOA 1FMWA 1ZELA 3Q5FA 2GBYA 2Y9ZA 2DXIA 3TDUC 2NS7A 3EUHA 1A6IA 2GA2A 3D1NI 1YFHA 1A5JA 5FB2A 3W6KB 3QP6A 2MC3A 5E79C 2OCCH 1KYWA 4MTDA 4V19K 2VJ5A 5HNFA 3ULQB 2K86A 3HOXJ 4CCKA 2QZ8A 4Y7NJ 2BW3B 4ZZDA 1IV8A 5J4VA 2L7KA 1HOMA 4RMNA 5HVQC 4LIUA 2Q0OA 4HF0A 1E3PA 2ZC2A 2HOSA 2E1CA 3BR0A 5HLTA 2WADA 1LEBA 1SFXA 4UXNA 5F0HA 1MBEA 4AM3A 3GTKJ 1IRXA 3OR1C 4YELA 3CDHA 4HOBA 4OINF 3OYEA 1IC8A 3GFLA 4IJAA 2JT1A 4GGGA 4XLEA 5BPIA 2E1NA 5KNLA 1NTCA 4IHXA 3KPHA 4BKXA 4J01A 1H0MA 4E7IA 1WVRA 3BJOA 4M9SA 2FQ4A 2DT6A 1VTNC 2WC2A 1S7AA 2X1DA 3LA7A 4EM1A 3S14J 4B3XA 1HW2A 2DPUA 4U0YA 1P9QC 2TCTA 2CFOA 3KP7A 3ZQGA 4II2A 3DU5A 3LL7A 3FXLA 4LB5A 4BJ6C 3QYFA 1D3YA 1YYVA 4D7MA 1WH7A 3IL2A 2YU9J 3HRMA 2HYFA 3HHHA 4BJTA 3JRFA 2NVTJ 3DPLC 5CLSA 4XSZF 1JHFA 2YPRA 4WF2A 2EK5A 1HKTA 3KP6A 4EEFG 4IOAF 1IF1A 2W25A 5GAHJ 3IH3A 4XKBA 3VEPA 2FX0A 5DM7F 1F43A 2LSOA 3KYLA 5D8LB 3RPUD 1J0RA 3PSIA 3QRFF 2LKSA 4IF4A 4G6DA 1S8NA 2GLOA 3NRVA 5FFXA 1K7AA 2NRAC 3U1DA 1LNWA 1TNSA 4U0WA 3IV5A 5IP9J 3PFIA 4PCQA 1N75A 1P4WA 3CJQB 4NNJA 4XMYA 2HPIA 4HZFA 2GIZA 2BE5F 1XSVA 3DU6A 1Y56A 1D8JA 1F9NA 3HTSB 4KT5C 4EQQA 2LY1A 5D5WB 2YUSA 1CF7B 4B44A 3GO5A 3OSFA 1ZARA 2CW0F 3ZN1A 5FD5A 3MFKA 3HKZA 3S1MJ 3SDGA 4ZJZA 1AKHB 4M73A 1RC9A 1CGPA 2F4OB 1ODDA 2BY0A 1LDDA 5A2QZ 2P5LC 2OQGA 2R7WA 4WWCA 4G7OF 4C9YA 1Z6RA 1DGRM 1OCOH 2L2OA 4I01A 1SMYF 5M3FJ 1W36C 2NVYJ 5B3SH 1E3OC 2R92J 2QF7A 3OWTA 4N9HA 3EUAA 2HOAA 4ZYAA 1VFCA 4C2TA 4KA4A 1MBGA 3AAFA 4X6AJ 3OIOA 4PGHA 5DDGA 3BR5A 2DA1A 3CO6C 1ETYA 2STWA 1IN7A 2COBA 1R22A 2CQXA 5LGTA 4AIDA 1MH3A 2EBIA 5FGMA 2XF5A 3BJAA 2HXOA 4DBQA 4KIBA 2FMYA 1A31A 3E6CC 2E5NA 2OTJI 3I0TA 3RDIA 2XPVA 1D0YA 1U5TA 4PSXA 1RUOA 1JGSA 3F23A 3QPHA 4IKFA 3B02A 3CD6I 2W1OA 4EVIA 3HOSA 2Z16A 3BOQA 4M9ZA 2OBPA 2COMA 3SDBA 2GQQA 1MNMC
chains in the Genus database with same CATH topology
3Q0VA 3HPHA 4DJAA 2IGMA 2LH9A 4KITB 1D0ZA 2NVXJ 5FRNA 2XRLA 4LIVA 1B8IA 3RZOJ 5EZGA 1YRNB 3BT9A 3H9QA 2JJ7A 3OS2A 4XKCA 2HYJA 5EG0B 1ETOA 4XONA 2R7QA 3D5SC 1MMNA 5FKNA 1YX5A 3LMMA 3FKIJ 4RBOA 4DYQA 2NS8A 2ME0A 4C3HJ 3S3OA 3C2HA 1G2HA 3S1RJ 3S15J 3FIWA 2ZB9A 2HPMA 2LFBA 2AQEA 2HI3A 3OYJA 2O8KA 2WAFA 4E7JA 3DQVC 3M4OJ 2PJRA 4NC8A 2X6XA 2IGKA 2ID6A 1BA5A 3L2UA 2E2IJ 1IDZA 2E19A 4ABZA 1DU0A 4A3DJ 1JUMA 4M6VA 2QKLB 3AFHA 1W0UA 4Y4RA 2Q1ZB 3HOUJ 2NVQJ 4BXFA 5IPAA 1JTXA 2R7TA 3FBNB 2HVSA 2XGDA 3QPLA 4RDUA 3ZGKA 3PSFA 3GTGJ 3I4MJ 4FE7A 1ETXA 1ERDA 1X1DA 3PNVA 3SEQA 2PMZA 1BW6A 2WAEA 3J7AY 2KRCA 3V42A 4Y3OA 5FKLA 1LDKB 2TRTA 2IS1A 2CV1A 4BQNA 2IGOA 2X6WA 2Z1DA 2WAQN 2LLKA 4BACA 3PL8A 4XM3A 1UMQA 4NDLA 4A3EJ 2DJIA 1PJRA 3OS0A 3CMYA 3HM5A 3K70C 2DA4A 2XF6A 3LSGA 4BUPA 2CUEA 2JVGA 4BEHB 2LR8A 3DTKA 1VF9A 1LE8B 2JA5J 1G8XA 3BG9A 3S93A 4XQFA 1TWCJ 1WGXA 2X1EA 3OOUA 4F93B 4CCNA 4XLAA 1DGWY 5HNHA 2OC6A 3S1NJ 3F0CA 3UNGC 2IEKA 4XK4A 4M3FA 1IG7A 2L7MP 1FTTA 3S3NA 3K4KA 1XC5A 1V5GA 2CU7A 4GFBA 3IAM2 2M34A 3ZXSA 3FK7A 3MD2A 3DCFA 3PO3J 3TMOA 3WHCA 4D7NA 4BS9A 3LSIA 2M0MA 3CP8A 1Y6IA 3B6AA 1XS9A 1JI8A 1JT0A 1H89C 3LSRA 2V7FA 3K4CA 1ZR2A 2W82A 4KJZA 2CQQA 1JT6A 3Q3SA 1ZGWA 3FISA 1VZ0A 4IZZA 2R5ZA 2XSDC 1BR2A 1MMDA 4BJ5C 4M3GA 4A3LJ 3DLAA 3S2HJ 3W2AA 2IBDA 4CZCA 5CKTA 1JUPA 3SYTA 3RSNA 3JRBA 3TP3A 4BBRJ 4MLOA 1QPIA 3OY9A 3PNTA 2VXZA 4F52A 2L9NA 1HCRA 2HXIA 3DWLE 3H9GA 1QVTA 1SFKA 3FKJA 4FASD 3CMMA 4PUSA 3OYIA 1D1CA 2MYSA 1APLC 4W97A 1GDTA 3VYSB 2EQRA 1I50J 1SANA 1CQTA 1QHGA 3HGGA 5IOYA 4DYCA 1JKRC 1X4OA 4BE2A 4HSTA 2FD5A 2XPWA 3ZCOA 2IXSA 2ZFUA 2DA2A 3PM1A 3UKGA 3NWSA 4Y52J 5K7ZA 2HZDA 2K9LA 4A3MJ 3JRHA 1MBHA 1B72A 3L2RA 2Z2SB 3EUKL 1Z21A 1TC3C 5J1YA 1GV5A 1BR1A 1QRYA 5DS9A 3HGYA 1ZQ3P 1T95A 4LG3A 3S8PA 2H1KA 3MVPA 2LD5A 5C3EJ 3DEEA 2DA6A 3NARA 2ZXIA 2MG4A 1JGGA 1AA7A 3BR3A 3BG6A 4FE4A 3HUGB 4IQJA 3BR1A 3F9KA 4RLQA 4V2FA 4A3IJ 4DYRA 3K4MA 4U7BA 3LFUA 2VI6A 1WFXA 4Y33A 1JTYA 2MW8A 3BTIA 4BY1J 5FLVA 1MMGA 3K4LA 3IH2A 1I6HJ 1ENHA 4I76A 1DU6A 4BY7J 4F91B 2VL8A 1TZLA 4QTRA 5M5WJ 2VQHA 1U9NA 2E60A 9ANTA 4PJJA 5C4JJ 2E2JJ 1WI3A 2V26A 5F1JA 2DA5A 2CV0A 1NG6A 1XG1A 4ZDOA 3N05A 3H35A 1J09A 1YX3A 3OR2C 1GUUA 4G12A 5IYCJ 1HF0A 2BOLA 5EYRA 2XF7A 2DTZA 5CQGA 3W6VA 1UHSA 2LG4A 4AC0A 2LREA 3CP2A 3PUBA 3BC8A 1U9OA 2WY7Q 2X48A 2K9MA 3OYGA 4KISA 4F92B 2CJJA 4N4NB 2AHQA 4R79A 1AKHA 2WAQA 4DZJA 3QOEA 4B4CA 4HSRA 2LP0A 3A02A 4OWRB 4PFPA 3TBIA 2L9RA 2M4GA 4HNVA 1ORKA 4MO7A 4H4KC 4BBSJ 2KDOA 3I4NJ 3KX2A 2RAEA 4CSWA 1WJEA 3GTMJ 2R93J 4X1EA 3VWBA 1LKXA 2JK3A 3IAS2 4FCYA 2MC4A 1OCTC 4A3GJ 3G1LA 2BVLA 5IP7J 1BL0A 3SEZA 2AQFA 4F55A 3BG7A 1FIPA 1R9TJ 2LBFB 2DCEA 4CYCB 5JLWA 4XR6A 2VASA 1B8IB 2WA0A 2CRGA 3FDYA 1D1BA 2LOOA 5EGOB 1X1BA 5BNGA 4JOMA 4CUGA 3BR6A 3ZQLA 2KT0A 5FKMA 4IHWA 4CCJA 3GTOJ 4LITA 4E7ZA 2DA7A 3AL0B 5EG0A 1D5YA 1LVKA 2RREA 3LOCA 2M8GX 3JRDA 2MABA 3L1PA 4XN0A 2R7SA 3K2AA 2ECBA 2ZSHB 2Q2EB 5FKKA 1TT0A 5J1UA 2W48A 3HOWJ 2V9KA 4P1WA 3GTPJ 3BTCA 2V1NA 3BLYA 3OYHA 1HDPA 4F3QA 1X4PA 2E5ZA 3ZQIA 4XICA 3C2BA 2JUGA 3BTJA 3VPRA 3CESA 1X58A 2M4KA 4JX4A 4XLCA 1K61A 2XAUA 2HQ5A 3SJMA 3K4NA 4XOTA 2F6CA 2W00A 1U0JA 2M9HA 2K3PA 1OJLA 3W2VA 3LSHA 1W36D 3HBLA 1PUFB 3DTIA 2VPLA 2KRHA 3A2KA 3BCAA 3S1QJ 2Y0SN 2KPMA 3PFYA 5EZHA 1WJBA 2XC7A 1VNDA 1OFCX 1IUFA 4E7HA 1RR7A 3IH4A 2WBMA 2A6TA 3U21A 1X1AA 1MBJA 1MBKA 1UG2A 1AHDP 4B43A 4JX6A 1Z3XA 2DJNA 2K9QA 4J00A 1JKOC 4PJNA 3OMYA 1RPWA 4RLFA 4IEJA 3A1YA 3A01B 3G2BA 4YEJA 4BDZA 3K6GA 3JRIA 3AKZA 2KP6A 4BEHA 5LFAA 3B6CA 4D9JA 1ZR4A 1ITYA 1GVDA 3A03A 3VYTB 5IOZA 1GLNA 1LE8A 3OL3A 2CS3A 4P5OA 3TEDA 2E1OA 4RM3A 2QKMB 3S16J 2N8GA 5IYBJ 2ECCA 2LKXA 3M8JA 5FROA 3HPGA 4B48A 1BW5A 3TW6A 2OUMA 2LY2A 4OAZA 1AU7A 2ELJA 2X6OA 2L0KA 4A3CJ 2VKDA 3VYRB 4HNUA 5KCMA 3OYMA 2Y31A 3TL4X 2DA3A 2CW7A 4C2UA 4AYBN 1IJWC 2YS9A 2VKHA 2E2HJ 3MKZA 2R5YB 3O8HA 3QODA 3DKXA 2EZIA 4XKWA 2VJ4A 3M1CA 1EF4A 4OAYA 2EZLA 5J3LA 1H88C 4XIDA 4XORA 3QQAA 2DT7B 5KHDA 1F36A 2VLAA 4FISA 2LK2A 1FIAA 5E3OA 2DN0A 4S0HB 2ME6A 2JWTA 1FMVA 3OIQA 1QHHD 1X1CA 2Y2ZA 1KONA 1N78A 3EPZA 4EATA 4UUTA 2BVMA 5FLMJ 1MMAA 3GTQJ 4BDYA 2LY9A 2HDWA 1UELB 2DMTA 2O9LA 2KLOA 2VQLA 3BQYA 3LSJA 1JUSA 3OYBA 1IV6A 4IQ4A 3LSKA 4A3KJ 4RM2A 5F0FA 5EDNA 5M3MJ 2LTPA 3K70D 1X2NA 3L2QA 2CH0A 4PFOA 3QYBA 4HRIA 3FHNA 4CCMA 5HOOA 3ZOBA 3D5RC 4QPQA 5F27A 2UV1A 3JRGA 1TWHJ 4HEA2 2VXDA 3BCBA 3VYUB 2CW8A 2JA2A 3OIPA 3MKYB 4L5EA 2K40A 3BTLA 1S9HA 2XB5A 2X9DA 2E1MB 1FJLA 2VQGA 1ETVA 2DMPA 1WCMJ 3OS1A 1WJCA 2CUFA 4QIWN 3DEWA 3CCYA 2NOGA 4BGDA 5IYDJ 4CH7A 1LFPA 3C2GA 3OYCA 4BE0A 3E7LA 4FTHA 3QYEA 4UUSB 2X51A 1WJ5A 1SAUA 3H0DA 2KMUA 4J19A 2D5VA 5K7HA 2B63J 1D0XA 3RQ4A 4JP0A 1JJ8C 4MFEA 4IHVA 5M5YJ 3DTEA 3S3MA 1BOBA 3MKWB 1TWAJ 2UUZA 1X2MA 2BW3A 3RZDJ 4BU2A 3OYLA 2DOAA 3MMYB 5EEAA 4A69C 2KHMA 3H5AA 2VB6A 2XDVA 3LSPA 5E3MA 3HEFA 4AUXA 3CQZJ 1HA8A 4B1RA 4G6TB 3K4BA 2WB1N 1H8AC 3GTLJ 1V5EA 4A93J 1BJZA 2HU9A 3AL0C 5J1RA 2I8DA 1T56A 2VIXA 3S32A 3H5RA 2R0QC 3K10A 3OYKA 2EZHA 1WJFA 1E0EA 3HOTA 1P7IA 4CCOA 2DMQA 3S2DJ 4AVZA 2HVQA 5E3NA 1NK2P 2VUMJ 2K5CA 3E1SA 1NK3P 3K7AJ 4E7LA 3RKQA 2V6EA 2R7ZJ 2Y0SA 4M3DA 1T0FC 2W4SA 2XPUA 2WV1A 2R7XA 3S17J 3HL2A 3L2VA 2R7RA 2KDZA 2HQAA 4PJMA 3DKYA 1DP3A 1HLVA 3HDDA 2CUJA 5F04A 5LD2C 2ID3A 3VDXA 3DPTA 2QCOA 4MFDA 1U78A 3L2WA 3TP0A 3VSKA 5JHFA 4XKVA 3JRCA 1WJAA 4JX5A 2HNHA 5K7FA 1X19A 2EH3A 1Y1WJ 4XLFA 3H5NA 2K9SA 4V2GA 2F4IA 3RQIA 2G0EA 1TWGJ 1W0TA 4XRSA 1OLTA 3H3VK 3OL4A 3PNYA 1PYVA 4C3JJ 2HDDA 3TW7A 4I6ZA 4M3BA 2WY8Q 4E7KA 3VSLA 1BR4A 2CMPA 3HXLA 4C30A 3ZQQA 3BQZA 2GOXB 3OYDA 2R4GA 4PJLA 4E4HA 3I3LA 1POGA 3E0JB 2FJ1A 5CQEA 2X6YA 2LBFA 4CYCA 2RNGA 1GT0C 4MIMA 4HNTA 1YRNA 1IDYA 1FTZA 4JYKA 3ZQHA 2ELKA 3CJRB 2LYCA 5EGOA 3OYFA 4NC7A 1EA3A 3HC7A 2CV2A 4B47A 2GOMA 1YE9A 4XOPA 2XGCA 2Y30A 2P0WA 4AYBA 2OV7A 1Y1VJ 2M3AA 4M3EA 1IGNA 3CF2A 3D5LA 4W1UA 2PJRB 2IS2A 1K83J 2VJIA 4N4OB 1MBFA 4D5FA 3CZ6A 3HB9A 2KL4A 1WPKA 4ANJA 4X0GA 4QSHA 3HOYJ 4XRSG 1DQUA 4U87A 2JA8J 4DBRA 2VKVA 4II3A 1I3QJ 3UR3C 2M7BA 1SFOJ 4BQQA 2LRDA 3G1MA 2VQCA 1O4XA 4A3JJ 2XB0X 3FK6A 2L5QA 2GM4A 2L7ZA 1PUFA 2M2EA 2IGNA 1S7EA 1ETKA 1OR7C 1Z7LA 4DZPA 3OYNA 5FRMA 3LSMA 3HKZN 2JA7J 2V4JC 3NWTA 2OPTA 3BG5A 3BG3A 3RTRA 2X1CA 4E6KG 1Z77A 1MH4A 2ZSIB 2LC2A 3M3YJ 1ETWA 1G59A 4DW6A 1MW7A 5EF6A 2IS4A 4XRMA 4BE1A 4LOCA 2MD0A 2ZXHA 1R6RA 3ONQA 1IRZA 2MSYA 1MNEA 1QVUA 4A3BJ 2W7NA 1MSEC 3W2WA 1Z0XA 3ZRGA 2KQRA 5GPAA 2KZVA 3A01A 3G1OA 3KEYA 3H9JA 4QPOA 3H0GJ 1LFUP 5GP9A 3SZGA 2VPRA 1ZTRA 1Z3YA 4ITVA 4IX7A 2JN6A 3ZQCA 1JKQC 3FBIB 1MSFC 4BQOA 5M5XJ 2E1MC 1P7JA 5FJ8J 3O8GA 1UG0A 5FKOA 2XSJC 5IP6A 1TWFJ 3BR2A 1RKWA 2X85A 4FETA 3HOZJ 3GTJJ 2XGEA 1NG7A 4D1QA 3RCOA 2VKEA 5C4XJ 1RESA 1MNDA 4ZTJA 3JR9A 4HG2A 4DIQA 2WB1A 1ZK8A 1ETQA 1N77A 2LVSA 1FEXA 1ZKGA 2R7UA 3WHBA 2L7FP 3Q0UA 5HODA 2M7AA 4XNFA 2R5ZB 2CUZA 3EUHC 2DMUA 2M0CA 4PK4A 2A5WA 5CPRB 4AU7A 1T33A 2R5YA 2JMWA 4BXXJ 3HOVJ 4XN3A 4HPQA 3JRAA 1D1AA 1Q1VA 4XL9A 5DTDA 2F5VA 1HDDC 4C3IJ 4KT6A 2RQQA 2AO9A 2R7OA 3DPUA 3JREA 4DOZA 4NQWB 4BL0B 2IAIA 3IP4B 2VJJA 2HVRA 4YRVA 3CDLA 2UWMA 4PSWA 1OCPA 4A3FJ 2I10A 5GPCA 1VI0A 5F0CA 3K4JA 1WJDA 1LFBA 2OF7A 3MKLA 4ZC3A 2PMZN 4DGWB 1U8BA 3PJRA 4XLHA 3PO2J 4C2MJ 1UAAA 5F08A 2NOJB 4NUBA 2IS6A 2HOTA 2Y9YA 4CCLA 1B72B 4ZDPA 2JA6J 3ZQFA 2P81A 4B3AA 1RETA 2R7VA 2JVHA 2O5RA 4GRIA 3GBGA 1GV2A 3IUOA 4ZTFA 5C44J 3OSGA 1K6YA 4CA0A 2JSPA 2DMNA 3Q0WA 4JQFA 3ZR8X 4IHYA 3HG9A 4D5CA 3QPSA 2MFZA 3W3CA 1RKTA 3MN2A 4E7SA 2O7OA 1QU3A 1WH5A 3I9V2 3LNQA 1JJ6C 3OYAA 4ZDLA 2FUG2 2K9NA 3A4CA 3NAUA 2H8RA 5E3LA 3SFIA 4UUSA 5TGTA 5JLXA 1V5FA 2MGQA 2EZKA 1JKPC 1FMWA 1ZELA 2GBYA 2Y9ZA 2DXIA 2NS7A 1A5JA 1A6IA 3D1NI 2VJ5A 5HNFA 3HOXJ 4CCKA 4Y7NJ 2BW3B 2L7KA 1HOMA 4RMNA 5HVQC 4LIUA 2HOSA 3BR0A 5HLTA 2WADA 5F0HA 1MBEA 3GTKJ 1IRXA 3OR1C 4YELA 1IC8A 3OYEA 4XLEA 5KNLA 1NTCA 4IHXA 4BKXA 4J01A 4E7IA 2FQ4A 2DT6A 2X1DA 3S14J 4B3XA 1P9QC 2TCTA 2CFOA 3ZQGA 4II2A 3DU5A 3LL7A 4BJ6C 3QYFA 4D7MA 1WH7A 2YU9J 4BJTA 3JRFA 2NVTJ 3DPLC 4EEFG 3IH3A 4XKBA 2FX0A 1F43A 3KYLA 3RPUD 3PSIA 2GLOA 3IV5A 5IP9J 1N75A 4NNJA 3CJQB 4XMYA 2HPIA 3DU6A 1Y56A 2LY1A 2YUSA 4B44A 3OSFA 3HKZA 3S1MJ 3SDGA 4ZJZA 1AKHB 2R7WA 4C9YA 1DGRM 2L2OA 5M3FJ 1W36C 2NVYJ 1E3OC 2R92J 2QF7A 3OWTA 3EUAA 2HOAA 4ZYAA 1VFCA 4C2TA 1MBGA 4X6AJ 3OIOA 3BR5A 2DA1A 1ETYA 2COBA 2CQXA 1MH3A 2EBIA 2XF5A 2HXOA 4DBQA 2E5NA 2XPVA 1D0YA 4PSXA 4IKFA 2W1OA 3HOSA 2Z16A 3SDBA 2L9SA 1MNMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPT A;  2MW8 A;  3BG5 A;  3Q0V A;  3BTI A;  2DN0 A;  3BG3 A;  4S0H B;  4BY1 J;  1Z77 A;  5FLV A;  1MH4 A;  2ME6 A;  2NVX J;  2JWT A;  3IH2 A;  1ETW A;  3M3Y J;  1I6H J;  1ENH A;  4DW6 A;  4I76 A;  1DU6 A;  2XRL A;  1B8I A;  2Y2Z A;  4BY7 J;  3RZO J;  5EZG A;  4UUT A;  5FLM J;  1YRN B;  5EF6 A;  3BT9 A;  4QTR A;  3GTQ J;  4XRM A;  5M5W J;  2JJ7 A;  2LY9 A;  4LOC A;  1U9N A;  2DMT A;  9ANT A;  2O9L A;  5C4J J;  2E2J J;  1WI3 A;  3BQY A;  5F1J A;  1IRZ A;  2HYJ A;  3LSJ A;  2MSY A;  5EG0 B;  1JUS A;  1IV6 A;  1ETO A;  2DA5 A;  1QVU A;  4A3B J;  1MSE C;  4A3K J;  1XG1 A;  1Z0X A;  5F0F A;  5GPA A;  5FKN A;  3A01 A;  3G1O A;  5EDN A;  3FKI J;  4RBO A;  1GUU A;  4G12 A;  4DYQ A;  5IYC J;  5M3M J;  2LTP A;  1HF0 A;  2NS8 A;  2ME0 A;  3H0G J;  4C3H J;  1X2N A;  5EYR A;  2DTZ A;  1LFU P;  5GP9 A;  2VPR A;  1ZTR A;  1G2H A;  3W6V A;  1UHS A;  3ZOB A;  3S1R J;  3S15 J;  3FIW A;  2ZB9 A;  5F27 A;  2JN6 A;  2LFB A;  3ZQC A;  1JKQ C;  1MSF C;  3JRG A;  1TWH J;  4AC0 A;  2HI3 A;  2O8K A;  5M5X J;  4L5E A;  2K40 A;  1P7J A;  5FJ8 J;  3BTL A;  3M4O J;  3O8G A;  2XB5 A;  2X9D A;  5FKO A;  2ID6 A;  1BA5 A;  5IP6 A;  1TWF J;  1FJL A;  1U9O A;  1ETV A;  3BR2 A;  1RKW A;  2E19 A;  2E2I J;  4ABZ A;  2DMP A;  1IDZ A;  1DU0 A;  2X48 A;  4A3D J;  1JUM A;  1WCM J;  4M6V A;  3HOZ J;  3GTJ J;  2CJJ A;  2XGE A;  2AHQ A;  1W0U A;  1AKH A;  2CUF A;  4QIW N;  3HOU J;  2VKE A;  4DZJ A;  3DEW A;  4B4C A;  5C4X J;  3CCY A;  2LP0 A;  3A02 A;  2NVQ J;  2NOG A;  1RES A;  5IPA A;  1JTX A;  5IYD J;  3JR9 A;  2L9R A;  2XGD A;  1ORK A;  1ZK8 A;  4HNV A;  1ETQ A;  2LVS A;  1FEX A;  4MO7 A;  1ZKG A;  3QPL A;  3E7L A;  4FTH A;  3WHB A;  4UUS B;  4BBS J;  4RDU A;  2L7F P;  3Q0U A;  5HOD A;  2R5Z B;  3GTG J;  4J19 A;  3I4M J;  3I4N J;  2D5V A;  2RAE A;  2DMU A;  2M0C A;  5K7H A;  4FE7 A;  1ETX A;  3GTM J;  2B63 J;  2R93 J;  4X1E A;  2JK3 A;  1T33 A;  4FCY A;  2R5Y A;  1BW6 A;  4JP0 A;  4MFE A;  1JJ8 C;  1OCT C;  2JMW A;  4A3G J;  3G1L A;  3HOV J;  4BXX J;  4IHV A;  5M5Y J;  3JRA A;  5IP7 J;  1Q1V A;  5FKL A;  1BL0 A;  1TWA J;  1X2M A;  5DTD A;  2TRT A;  3RZD J;  1HDD C;  4C3I J;  1FIP A;  1R9T J;  4CYC B;  5EEA A;  2WAQ N;  4A69 C;  2LLK A;  5JLW A;  2AO9 A;  1B8I B;  3LSP A;  5E3M A;  1UMQ A;  2CRG A;  4NDL A;  3JRE A;  4A3E J;  3HEF A;  5EGO B;  4AUX A;  5BNG A;  3CQZ J;  4B1R A;  3BR6 A;  2IAI A;  3ZQL A;  2KT0 A;  5FKM A;  2WB1 N;  3CMY A;  1H8A C;  4IHW A;  3HM5 A;  3GTL J;  4A93 J;  2DA4 A;  1BJZ A;  3LSG A;  3GTO J;  2CUE A;  3CDL A;  5J1R A;  1T56 A;  2DA7 A;  1OCP A;  2R0Q C;  4A3F J;  2I10 A;  5GPC A;  5EG0 A;  1VI0 A;  1D5Y A;  5F0C A;  2LR8 A;  1LFB A;  2EZH A;  3LOC A;  2OF7 A;  1VF9 A;  2M8G X;  3JRD A;  3MKL A;  1LE8 B;  2JA5 J;  2PMZ N;  3BG9 A;  1U8B A;  3PO2 J;  3L1P A;  1P7I A;  1TWC J;  1WGX A;  3K2A A;  4C2M J;  2DMQ A;  5F08 A;  3S2D J;  3OOU A;  2ECB A;  5FKK A;  5J1U A;  2W48 A;  3S1N J;  2HOT A;  3F0C A;  5E3N A;  3HOW J;  1NK2 P;  2Y9Y A;  2VUM J;  2IEK A;  4XK4 A;  1B72 B;  4M3F A;  1NK3 P;  3K7A J;  1IG7 A;  3RKQ A;  3GTP J;  2L7M P;  3BTC A;  2JA6 J;  3ZQF A;  2R7Z J;  2P81 A;  4B3A A;  1RET A;  1FTT A;  4M3D A;  1HDP A;  3GBG A;  1GV2 A;  1XC5 A;  2XPU A;  2CU7 A;  2WV1 A;  4GFB A;  3ZQI A;  2M34 A;  4XIC A;  3C2B A;  5C44 J;  3FK7 A;  3OSG A;  3DCF A;  3BTJ A;  3PO3 J;  3WHC A;  2DMN A;  3S17 J;  3Q0W A;  4D7N A;  3VPR A;  4IHY A;  1X58 A;  2KDZ A;  4D5C A;  3QPS A;  1HLV A;  4JX4 A;  3HDD A;  1RKT A;  3MN2 A;  3B6A A;  1K61 A;  5F04 A;  1XS9 A;  2HQ5 A;  2O7O A;  3SJM A;  1WH5 A;  2ID3 A;  3LNQ A;  1JJ6 C;  2QCO A;  4MFD A;  1U78 A;  1JT0 A;  2K9N A;  3TP0 A;  1H89 C;  3LSR A;  2M9H A;  1ZR2 A;  3JRC A;  1OJL A;  3NAU A;  2H8R A;  4JX5 A;  5E3L A;  5K7F A;  3SFI A;  2CQQ A;  1JT6 A;  2EH3 A;  1Y1W J;  3HBL A;  3Q3S A;  1ZGW A;  4UUS A;  2K9S A;  3FIS A;  4V2G A;  5JLX A;  1PUF B;  3RQI A;  2G0E A;  2R5Z A;  2XSD C;  1TWG J;  1W0T A;  4XRS A;  2MGQ A;  2EZK A;  1JKP C;  4M3G A;  4A3L J;  2GBY A;  2Y9Z A;  3H3V K;  3S1Q J;  2Y0S N;  2NS7 A;  1A5J A;  1A6I A;  3D1N I;  3S2H J;  4C3J J;  2HDD A;  5EZH A;  3TW7 A;  2IBD A;  4I6Z A;  4M3B A;  3HOX J;  1VND A;  4Y7N J;  1JUP A;  1OFC X;  1IUF A;  3JRB A;  1RR7 A;  3IH4 A;  3BQZ A;  3TP3 A;  4BBR J;  1HOM A;  4MLO A;  1QPI A;  1POG A;  1MBJ A;  1MBK A;  2FJ1 A;  3BR0 A;  2HOS A;  1UG2 A;  1AHD P;  4CYC A;  1GT0 C;  4MIM A;  1YRN A;  1HCR A;  1IDY A;  5F0H A;  2HXI A;  1MBE A;  4JX6 A;  1FTZ A;  3GTK J;  4JYK A;  3ZQH A;  2ELK A;  1IC8 A;  1QVT A;  2DJN A;  5EGO A;  2K9Q A;  1NTC A;  4IHX A;  4BKX A;  1JKO C;  1RPW A;  2FQ4 A;  1APL C;  4W97 A;  1GDT A;  4IEJ A;  2EQR A;  3S14 J;  3A01 B;  2TCT A;  3ZQG A;  3JRI A;  1I50 J;  1SAN A;  1CQT A;  3B6C A;  3HGG A;  5IOY A;  4DYC A;  4D7M A;  1WH7 A;  1ZR4 A;  2YU9 J;  1ITY A;  1GVD A;  2XGC A;  2Y30 A;  3A03 A;  3JRF A;  1JKR C;  2NVT J;  5IOZ A;  1LE8 A;  4EEF G;  1Y1V J;  3IH3 A;  2FD5 A;  2XPW A;  2FX0 A;  1F43 A;  4M3E A;  1IGN A;  3TED A;  2E1O A;  3S16 J;  2N8G A;  2DA2 A;  2GLO A;  3PM1 A;  4W1U A;  1K83 J;  3UKG A;  4Y52 J;  5K7Z A;  5IYB J;  1MBF A;  2ECC A;  3IV5 A;  4D5F A;  5IP9 J;  2LKX A;  3JRH A;  4A3M J;  1MBH A;  1B72 A;  3HB9 A;  1WPK A;  2YUS A;  4QSH A;  3OSF A;  1BW5 A;  1TC3 C;  3TW6 A;  5J1Y A;  1GV5 A;  3HOY J;  3S1M J;  4XRS G;  3SDG A;  1AKH B;  1QRY A;  5DS9 A;  3HGY A;  1AU7 A;  1ZQ3 P;  2JA8 J;  2X6O A;  2H1K A;  3MVP A;  2L0K A;  4A3C J;  2LD5 A;  5M3F J;  2NVY J;  1E3O C;  2VKV A;  2R92 J;  2QF7 A;  5C3E J;  1I3Q J;  2Y31 A;  2DA3 A;  2HOA A;  2DA6 A;  3NAR A;  4AYB N;  1VFC A;  2MG4 A;  1SFO J;  1JGG A;  3BR3 A;  1MBG A;  3G1M A;  1IJW C;  4X6A J;  3OIO A;  1O4X A;  3BR5 A;  2DA1 A;  4FE4 A;  4A3J J;  1ETY A;  2XB0 X;  2COB A;  3BR1 A;  2CQX A;  1MH3 A;  2EBI A;  2YS9 A;  3FK6 A;  2HXO A;  2E2H J;  2R5Y B;  4V2F A;  4A3I J;  2GM4 A;  3O8H A;  2L7Z A;  4DYR A;  2EZI A;  1PUF A;  2M2E A;  1S7E A;  2XPV A;  1EF4 A;  1ETK A;  2EZL A;  5J3L A;  4DZP A;  1H88 C;  4XID A;  2VI6 A;  3QQA A;  1F36 A;  4FIS A;  2LK2 A;  1FIA A;  3HKZ N;  2JA7 J;  5E3O A;  1JTY A;  1MNM C; 
#chains in the Genus database with same CATH topology
 3Q0V A;  3HPH A;  4DJA A;  2IGM A;  2LH9 A;  4M6Y A;  2Y48 A;  4KIT B;  1D0Z A;  3WOD F;  1SVO A;  2FOK A;  2NVX J;  3RKX A;  1Y8Q B;  5B66 C;  5FRN A;  2XRL A;  3FXU A;  2FRH A;  2WV0 A;  4LIV A;  5H6Q A;  1MDM A;  1B8I A;  2BXY A;  1ZG5 A;  2P6T A;  1XSX A;  4BNC A;  3RZO J;  3DBH B;  5EZG A;  1JXS A;  1YRN B;  3BT9 A;  4WXH A;  2E7W A;  3H9Q A;  3BZK A;  2JJ7 A;  4L0Z B;  4QLC U;  4KIF A;  3OS2 A;  2FA5 A;  2CQN A;  4BYY A;  2FU4 A;  4XKC A;  1W5S A;  2HYJ A;  2V1X A;  5EG0 B;  4WX9 A;  4UNO A;  1ETO A;  4YIF A;  1L3L A;  3JAM Z;  4GXO A;  4XON A;  1HW1 A;  1BC8 C;  3GUD A;  2R7Q A;  3D5S C;  4ASN A;  1MMN A;  4HAM A;  2DDB A;  4A6D A;  5FKN A;  3F8N A;  1YX5 A;  3LMM A;  3FKI J;  2W57 A;  4RBO A;  4DYQ A;  3CCL I;  2IW5 A;  2XAH A;  3WGG A;  2KIU A;  3MWM A;  2NS8 A;  2CSO A;  2ME0 A;  3HIF A;  2XAQ A;  3X2Q H;  4C3H J;  2RKH A;  3SFZ A;  3S3O A;  3H3U A;  4A6E A;  1NHA A;  2ZXJ A;  3FXO A;  3RI4 A;  3C2H A;  3LST A;  2DOD A;  1G2H A;  5DUK A;  1XB4 A;  2RGV A;  4EJT A;  1ZAO A;  4L5I A;  3S1R J;  3S15 J;  3FIW A;  3CC2 I;  2ZB9 A;  2DFF A;  1R49 A;  2HPM A;  2LFB A;  1KU9 A;  2ZJQ F;  2AQE A;  2FBH A;  2HI3 A;  3OYJ A;  3LQR A;  2WAF A;  1T39 A;  2O8K A;  2STT A;  1VQ9 I;  2ZXW H;  3E6M A;  4E7J A;  1ZRD A;  3DQV C;  2PJR A;  3M4O J;  4NC8 A;  2X6X A;  2IGK A;  2ID6 A;  1BA5 A;  4OIO F;  3L2U A;  2K02 A;  2E2I J;  4OMY A;  1IDZ A;  2E19 A;  4ABZ A;  1B6A A;  1DU0 A;  4A3D J;  2P7C B;  1JUM A;  4M6V A;  2F2E A;  2KFD A;  2K3F A;  4LJZ F;  2MBF A;  2QKL B;  1IN4 A;  2LNB A;  3AFH A;  1W0U A;  4PZJ A;  4Y4R A;  2H6B A;  2Q1Z B;  3HOU J;  4OIR F;  1IO2 A;  2ZNZ A;  4M9X A;  2NVQ J;  4BXF A;  3ECO A;  3EET A;  1QGP A;  5IPA A;  3KP3 A;  1JTX A;  2Y0M A;  4EM2 A;  2R7T A;  3FBN B;  2HVS A;  4EV0 A;  2XGD A;  2RVC A;  3QU3 A;  5IY5 H;  1MJB A;  3QPL A;  4HLY A;  1TTY A;  2EV5 A;  4RDU A;  3ZGK A;  3OV8 A;  3PSF A;  1F4K A;  3GTG J;  3I4M J;  3U9G A;  1VQ7 I;  4FE7 A;  4OU0 A;  1ETX A;  1YO5 C;  1ERD A;  4ETS A;  1X1D A;  3PNV A;  3SHF A;  3SEQ A;  5D4R A;  2PMZ A;  1BW6 A;  2WAE A;  3J7A Y;  5K1Y A;  1YG2 A;  2HGC A;  2KRC A;  3Q9V A;  1YS7 A;  5JR3 A;  2OTL I;  3V42 A;  1HW5 A;  2EV6 A;  4Y3O A;  1TW3 A;  5FKL A;  1LDK B;  2W24 A;  2TRT A;  2DYR H;  2IS1 A;  2KKO A;  4L9N A;  4AD9 A;  3I58 A;  4LD5 A;  4BQN A;  2CV1 A;  2IGO A;  2X6W A;  1WZ2 A;  2EIK H;  2Z1D A;  2WAQ N;  2LLK A;  5DUI A;  4KNY A;  4BAC A;  3GLX A;  4I0B A;  3FMS A;  1TW2 A;  2F5E A;  3PL8 A;  2DDA A;  4XM3 A;  4RB3 C;  1UMQ A;  4NDL A;  4A3E J;  1A6Q A;  1UHM A;  3O3K A;  2HWV A;  1ZLK A;  1XDS A;  2DJI A;  2PQ8 A;  3HTU A;  1PJR A;  3P9K A;  3OS0 A;  3CMY A;  1BOA A;  3HM5 A;  1FYK A;  4Q48 A;  3V4G A;  4D0P A;  1KU2 A;  1WHU A;  3K70 C;  2DA4 A;  2XF6 A;  3LSG A;  4BUP A;  3ABL H;  2CUE A;  3AG2 H;  1I6X A;  2JVG A;  5FD6 A;  4BEH B;  2HOE A;  4WXD A;  3P9I A;  1W5C C;  3CCE I;  4CXF A;  2LR8 A;  5F6F A;  2RV8 A;  4WCG A;  1UST A;  4GCV A;  5D5U B;  1FBQ A;  2RQP A;  3DTK A;  1IN6 A;  1VF9 A;  3A0B C;  2E71 A;  1LE8 B;  2JA5 J;  1LUJ B;  1G8X A;  5FO5 A;  3BG9 A;  4MEY F;  3V8L A;  1SD5 A;  3S93 A;  1BC7 C;  4XQF A;  1TWC J;  1WGX A;  3GFJ A;  3HRU A;  2X1E A;  3L7W A;  3OOU A;  4F93 B;  4CCN A;  4XLA A;  2A61 A;  1DGW Y;  3DFG A;  5HNH A;  3I59 A;  2OC6 A;  3V8J A;  3S1N J;  3F0C A;  3E97 A;  5L3G A;  4FQG A;  4RAY A;  1XCB A;  3UNG C;  2IEK A;  4XK4 A;  3WTW C;  2O0Y A;  4M3F A;  1IG7 A;  2L7M P;  1E3H A;  2EFN A;  3C18 A;  4MHG A;  3ELK A;  1FTT A;  2A3S A;  5L3F A;  3V7R A;  3S3N A;  2WTE A;  2XRN A;  4CDG A;  3PIO F;  1HST A;  1XC5 A;  1OMI A;  1V5G A;  2QM3 A;  3K4K A;  4Z2Y A;  2CU7 A;  3IAM 2;  4U7D A;  4GFB A;  2M34 A;  3ZXS A;  3FK7 A;  2HYG D;  3MD2 A;  3DCF A;  4L0Y B;  3PO3 J;  3TMO A;  5GAG J;  3WHC A;  1KU3 A;  4D7N A;  2QBY B;  4BS9 A;  3P7N A;  1FP2 A;  3LSI A;  1TBX A;  5HLH A;  3MZH A;  3T0Y A;  2M0M A;  4KIC A;  4GYI A;  3CP8 A;  1Y6I A;  3DP7 A;  3B6A A;  1XS9 A;  2PI0 A;  1JI8 A;  3LAJ A;  4KMU X;  5HLI A;  3J80 K;  5DCF A;  3ISP A;  3KYD B;  5E1Z B;  1OQY A;  3ASN H;  2A69 F;  1JT0 A;  4KYW A;  1FYM A;  1H89 C;  3LSR A;  2V7F A;  3K4C A;  4LLN A;  2JPC A;  1ZR2 A;  2W82 A;  4KJZ A;  5D8K B;  4FX4 A;  5J8C A;  2CQQ A;  2QUF A;  1JT6 A;  3TKY A;  2UZK A;  3Q3S A;  1ZGW A;  1O3S A;  2P8T A;  3FIS A;  1VZ0 A;  3WG7 H;  4IZZ A;  1BR2 A;  2XSD C;  2R5Z A;  1ZH5 A;  4L9J A;  3BPV A;  3TQN A;  1MMD A;  4BJ5 C;  2H27 A;  3PQK A;  4M3G A;  4A3L J;  1P6R A;  3DLA A;  3W2A A;  2QEX I;  3S2H J;  5E1X A;  5EEH A;  1O3R A;  4RB1 A;  2IBD A;  4CZC A;  4RAG A;  3QWL A;  2OJE D;  2DU9 A;  4HV5 A;  4CHU A;  5CKT A;  1JUP A;  4LLG F;  1TP4 A;  3SYT A;  3RSN A;  3JRB A;  3TP3 A;  4BBR J;  1TQM A;  5J6X A;  4UY8 I;  4MLO A;  1QPI A;  1HBX G;  2XHK A;  3OY9 A;  1RUN A;  3PNT A;  2LF7 A;  2VXZ A;  3EDP A;  1OCR H;  4HBL A;  3F8C A;  2FBI A;  3GZ5 A;  2B0L A;  2L9N A;  5H20 A;  4F52 A;  1A04 A;  4NC6 A;  3E6D A;  3R4K A;  1KQ9 A;  1XX5 A;  2P6S A;  1HCR A;  2KJB A;  2HXI A;  3LA2 A;  3DWL E;  5B1A H;  2QQ9 A;  3H9G A;  1QVT A;  2QSG X;  2ZCW A;  3CCJ I;  4NQW A;  1IXR C;  1SFK A;  3FKJ A;  4FAS D;  1R5G A;  2PMH A;  3CMM A;  4PUS A;  5HDN A;  3OYI A;  3KP2 A;  1D1C A;  2P5V A;  2MYS A;  1APL C;  4W97 A;  3VYS B;  4A5M A;  1GDT A;  2EQR A;  5H6R A;  1ZGA A;  1I50 J;  1SAN A;  5CVR A;  1QHG A;  1CQT A;  4BH9 A;  2KIQ A;  1RIO H;  3HGG A;  5IOY A;  4DYC A;  2OU2 A;  4Q5S F;  1KYZ A;  5DCM B;  2NS0 A;  1DPU A;  4ZYG A;  1S72 I;  1JKR C;  1X4O A;  4BE2 A;  4GDF A;  4JK1 X;  3G4S I;  4HST A;  2W85 A;  1RRJ A;  2ZO4 A;  3KE2 A;  1P4A A;  4IRH A;  2FD5 A;  2XPW A;  3K1P A;  3GF2 A;  1A36 A;  3KCC A;  3ZCO A;  2Y69 H;  3E5X A;  3F6O A;  2O6G E;  2IXS A;  2ZFU A;  3WE3 A;  1V54 H;  3E6B A;  2VBZ A;  2G7H A;  2DA2 A;  3LFK A;  5FFZ A;  1R4M B;  3PM1 A;  3UKG A;  3NWS A;  3AG1 H;  4Y52 J;  5K7Z A;  3M7G A;  5GTH C;  1JHH A;  2HZD A;  2K9L A;  5LGN A;  2Z99 A;  4A3M J;  3JRH A;  1MBH A;  3L2R A;  1B72 A;  4I09 A;  2Z2S B;  2ADU A;  4IPA A;  2VBY A;  1YIO A;  3EUK L;  2J5P A;  4BQA A;  1S7O A;  4I2O A;  1Z21 A;  1R5H A;  1TC3 C;  1UB9 A;  5J1Y A;  1GV5 A;  3TO7 A;  5LHH A;  1BR1 A;  5E1W A;  2FNP A;  1QRY A;  1XGN A;  5DS9 A;  3HGY A;  3KP4 A;  1P4X A;  1ZQ3 P;  3WU1 B;  2XIG A;  1T95 A;  4LG3 A;  1YI2 I;  3FWE A;  3S8P A;  1SD7 A;  2H1K A;  3MVP A;  1KZH A;  2LD5 A;  1YHQ I;  5C3E J;  1KQ8 A;  5IT9 K;  3H36 A;  1FBS A;  3DEE A;  3BY6 A;  2OD5 A;  2DA6 A;  3NAR A;  4HQE A;  2ZXI A;  4L9T A;  2MG4 A;  1JGG A;  1AA7 A;  3BG6 A;  3BR3 A;  4TV7 A;  4BHC A;  1BI1 A;  2VBX A;  4FX0 A;  4FE4 A;  2M8E A;  4CIC A;  3HUG B;  4IQJ A;  3WTT C;  3BR1 A;  3F9K A;  4RLQ A;  2KIM A;  4V2F A;  4A3I J;  4G9Y A;  2NVU B;  3GEZ A;  4DYR A;  3K4M A;  4MNU A;  1MMS A;  3ZMV A;  4UUV A;  1QPM A;  4U7B A;  3WTY C;  3LFU A;  1G4D A;  1FWZ A;  2VON A;  2VI6 A;  5J8F A;  1WFX A;  1UHW A;  2MH9 A;  4Y33 A;  3T8T A;  1JTY A;  2MW8 A;  2ISY A;  2V6C A;  3BTI A;  4O6J A;  3K4L A;  4BY1 J;  1MMG A;  5FLV A;  4F7Z A;  2DK5 A;  1EKE A;  3IH2 A;  1I6H J;  3CCS I;  3CO7 C;  1ENH A;  2BEO A;  4I76 A;  3FX3 A;  1DU6 A;  3QOP A;  4Z6Y A;  1BJA A;  4BY7 J;  4EJO A;  4KUM A;  1IN8 A;  4F91 B;  2VL8 A;  1TZL A;  1ULY A;  4QTR A;  2DOE A;  5M5W J;  2VQH A;  3TO6 A;  4PDK A;  2L54 A;  1U9N A;  2E60 A;  9ANT A;  2RN7 A;  3ABU A;  4HQM A;  4PJJ A;  5C4J J;  2E2J J;  2JRT A;  1WI3 A;  2V26 A;  1WSU A;  5F1J A;  2IRF G;  1VQN I;  2DA5 A;  2BHZ A;  1V3F A;  3GXO A;  2CV0 A;  1NG6 A;  4YIR X;  1XG1 A;  4IVN A;  4ZDO A;  3N05 A;  3H35 A;  5ICE A;  3WTV C;  1Y39 A;  1HC8 A;  1J09 A;  1YX3 A;  3OR2 C;  4ZH4 F;  1GUU A;  4G12 A;  5IYC J;  2V9P A;  1HF0 A;  2QSH X;  1TT5 B;  2BOL A;  2XF7 A;  5EYR A;  1I1G A;  2DTZ A;  5LHG A;  2H6C A;  4I98 B;  1LB2 A;  2DPD A;  5CQG A;  3W6V A;  1UHS A;  3O2P E;  3TOA A;  4L5J A;  2LG4 A;  4MQV A;  2IVM A;  2JUC A;  4A0Y A;  2BY3 A;  5JVT A;  1PUE E;  1YW9 A;  4S05 A;  5J47 A;  2DT5 A;  4AC0 A;  4LG0 B;  2LKP A;  2LRE A;  2EFO A;  4RA2 A;  1X1P A;  2GIV A;  3CP2 A;  1FX7 A;  2YU3 A;  4BXU A;  1ZRC A;  2HTJ A;  3PUB A;  5A2Q K;  3QP5 A;  3BC8 A;  1U9O A;  2WY7 Q;  2X48 A;  2K9M A;  3OYG A;  3GWZ A;  1IZ1 A;  4P9F A;  2B7E A;  1PVE A;  4KIS A;  2ZJR F;  4F92 B;  2OA4 A;  1CF7 A;  2K85 A;  1OCZ H;  2GXB A;  2CJJ A;  3FM5 A;  1S5L C;  3KLN A;  4N4N B;  2AHQ A;  4R79 A;  1AOY A;  1FSH A;  1AKH A;  2WAQ A;  5F1R A;  3KET A;  1YOV B;  4G7Z F;  1STZ A;  3QOE A;  4DZJ A;  4B4C A;  1IXS B;  4HSR A;  1XMA A;  2LP0 A;  2R3S A;  3A02 A;  4RGX A;  2VBW A;  1V4R A;  2DQL A;  3JW4 A;  4OWR B;  4PFP A;  5HS8 A;  3IKT A;  4DNC A;  3TBI A;  1EH6 A;  2E34 A;  2L9R A;  4RB2 C;  1FLI A;  2GA1 A;  2M4G A;  4HNV A;  1ORK A;  4NBQ A;  1QZE A;  1X3Z B;  4H4K C;  4MO7 A;  1G3Y A;  1WRJ A;  2X4H A;  3HHG A;  1FOY A;  3GZN B;  3ROU A;  4BBS J;  1BI0 A;  1FOW A;  2KDO A;  1GHC A;  3I4N J;  3KX2 A;  1PP8 F;  2RAE A;  4CSW A;  5CVU A;  1WJE A;  3GTM J;  2R93 J;  4AIJ A;  2Z5U A;  1I39 A;  2MLG A;  4X1E A;  3VWB A;  1LKX A;  2JK3 A;  2OZ6 A;  3IAS 2;  4FCY A;  4UVC A;  2MC4 A;  1OCT C;  4A3G J;  3G1L A;  3RKY A;  2BVL A;  2ACJ A;  1S6L A;  5IP7 J;  3J7Z I;  1BL0 A;  4A0X A;  3SEZ A;  1XGO A;  2AQF A;  3F8M A;  4F55 A;  1YTY A;  3LA3 A;  3JTG A;  3BG7 A;  1OYY A;  1FIP A;  1R9T J;  2LBF B;  2DCE A;  4CYC B;  3KEO A;  2B9S A;  5JLW A;  3V7C A;  4XR6 A;  5DV5 A;  2VAS A;  4XID A;  1B8I B;  2WA0 A;  2CRG A;  3FDY A;  4XLN F;  1D1B A;  2LOO A;  5EGO B;  3JAM K;  1X1B A;  5BNG A;  4JOM A;  2VC0 A;  4CUG A;  2JTV A;  3BR6 A;  2FXA A;  5E8I A;  2KT0 A;  2I5U A;  3ZQL A;  5FKM A;  1LPQ A;  4IHW A;  3ASO H;  1KQ0 A;  2Y75 A;  4CCJ A;  5K5R A;  1C0W A;  3GTO J;  3BWG A;  4LIT A;  5L3D A;  2CYY A;  2DA7 A;  4IL6 C;  4E7Z A;  3AL0 B;  4IHS A;  5EG0 A;  1D5Y A;  1LVK A;  2RRE A;  5BMZ A;  3EQL F;  4AVP A;  1G6N A;  4EJV A;  3LOC A;  4LK0 F;  2M8G X;  3JRD A;  2BBY A;  2MAB A;  2EIJ H;  1DP7 P;  3ZMZ A;  3L1P A;  4XN0 A;  2R7S A;  3K2A A;  1VQ8 I;  1ON2 A;  2OZU A;  2VE8 A;  4Q4Z F;  2HKX A;  2ECB A;  2ZSH B;  4HX7 A;  2Q2E B;  5FKK A;  1TT0 A;  5J1U A;  3PUF A;  2W48 A;  4ZYE A;  3NEU A;  2CQK A;  3HOW J;  3HRT A;  2V9K A;  2D1H A;  4P1W A;  2QWW A;  5EJC A;  1IW7 F;  5LRR A;  3GTP J;  5B1B H;  3I64 A;  3BTC A;  2V1N A;  2D1V A;  1O7L A;  1EJ9 A;  2FEZ A;  3BLY A;  4LLL A;  3OYH A;  3KZZ A;  2D2W A;  1HDP A;  4OMZ A;  4F3Q A;  3CUQ B;  1X4P A;  4A2U A;  1T2K A;  2E5Z A;  2QA4 I;  5FLX K;  2E35 A;  3FXK A;  3ZQI A;  4XIC A;  3C2B A;  1HKQ A;  2JUG A;  1P2F A;  2FNA A;  1E2X A;  3BTJ A;  2DFI A;  5H2F C;  5IT3 A;  3VPR A;  3CES A;  1X58 A;  4M71 A;  3A0H C;  2M4K A;  4JX4 A;  3KZY A;  4XLC A;  1Z05 A;  2XAU A;  1K61 A;  2HQ5 A;  2QVO A;  3SJM A;  3K4N A;  2HZT A;  3U2R A;  3GME A;  3WTZ A;  4XOT A;  1BIB A;  2F6C A;  2XAS A;  5K5Q A;  2W00 A;  2EFW A;  1U0J A;  2M9H A;  2BY2 A;  1I1S A;  2K3P A;  5LEJ A;  1OJL A;  3W2V A;  4XBF A;  4PGG A;  5CVJ A;  3LSH A;  1ONV A;  1W36 D;  3RYR A;  3HBL A;  4NHJ A;  3M8F A;  3Q9S A;  3K0L A;  1PUF B;  3DTI A;  2VPL A;  2KRH A;  3A2K A;  5E20 A;  1FNN A;  3BCA A;  3S1Q J;  2Y0S N;  1MGT A;  1ZRF A;  2DFH A;  2NAZ A;  2EA2 A;  2KPM A;  3PFY A;  5EZH A;  1WJB A;  3CCQ I;  1MZB A;  2EWN A;  3QPT A;  2XC7 A;  1QQI A;  1VND A;  4B09 A;  3DLL F;  1OFC X;  1IUF A;  3BP8 A;  4E7H A;  1RR7 A;  2WBM A;  3IH4 A;  3R0A A;  2A6T A;  3U21 A;  1X1A A;  2BV6 A;  2MLK A;  1KA8 A;  1MBJ A;  1MBK A;  2HQN A;  5KK1 A;  2D45 A;  1UG2 A;  1AHD P;  1BI3 A;  3TOB A;  4B43 A;  2R7D A;  1IRG A;  5K5O A;  1Z91 A;  4JX6 A;  2DI3 A;  3R6S A;  1Z3X A;  2A07 F;  3CJT B;  2DJN A;  1TLH B;  3M8E A;  2K9Q A;  4J00 A;  1JKO C;  5LBQ A;  4PJN A;  3KIO A;  3OMY A;  4S04 A;  1RPW A;  1SC7 A;  1XMX A;  4RLF A;  4IEJ A;  1YQA A;  2P7V B;  3A1Y A;  1U2W A;  3A01 B;  3G2B A;  1O3T A;  4YEJ A;  5DD4 A;  3K6G A;  1OCC H;  4BDZ A;  3JRI A;  4B8X A;  3AKZ A;  2KP6 A;  4BEH A;  3GX4 X;  5LFA A;  4LGW A;  3B6C A;  4D9J A;  2ZME B;  1ZR4 A;  3HYI A;  1MJ9 A;  1ITY A;  1GVD A;  2FQ3 A;  3A03 A;  3VYT B;  3K69 A;  3QAH A;  5IOZ A;  1VQP I;  1R4N B;  1GLN A;  5JI6 A;  1LE8 A;  3OL3 A;  3IRQ A;  3CJN A;  3CLO A;  2CS3 A;  3AG3 H;  4P5O A;  1WQ2 A;  2HR3 A;  5D6F A;  3TED A;  2E1O A;  3ABK H;  4RM3 A;  2H09 A;  2QKM B;  1D8K A;  1Q1H A;  3S16 J;  2F5F A;  2N8G A;  1O3Q A;  2JZY A;  4RAZ A;  3SZT A;  5IYB J;  2DBB A;  2ECC A;  2LKX A;  3M8J A;  3AG4 H;  1F1Z A;  5FRO A;  1OPC A;  3HPG A;  1HKS A;  2Z9O A;  5DEQ A;  4B48 A;  3L2C A;  1R71 A;  1BW5 A;  3TW6 A;  2M5W A;  2OUM A;  3K2Z A;  4E70 A;  2UXX A;  2LY2 A;  1R1T A;  4OAZ A;  1AU7 A;  2QQ8 A;  2ELJ A;  2X6O A;  4ESJ A;  5LLQ A;  2DYS H;  2QBY A;  4RGU A;  1EV7 A;  2NNN A;  2L0K A;  4HNU A;  2VKD A;  3VYR B;  4A3C J;  5KCM A;  3OYM A;  1P92 A;  3FZV A;  2Y31 A;  3TL4 X;  4HW0 A;  3TGN A;  4BHB A;  2DA3 A;  2CW7 A;  4C2U A;  4JBA A;  4AYB N;  4FHT A;  3CCU I;  2VC1 A;  1QA6 A;  4NB5 A;  1IJW C;  3FF5 A;  3S2W A;  3HSE A;  4Y13 A;  2PLY A;  2YS9 A;  2XAG A;  2VKH A;  3GCM A;  2GXG A;  3MKZ A;  2R5Y B;  2E2H J;  3REO A;  3O8H A;  3QOD A;  4IRI A;  1V55 H;  3DKX A;  2EZI A;  5J4Y A;  5D4S A;  4XKW A;  2VJ4 A;  3KLO A;  4HLX A;  2BY1 A;  3M1C A;  1IN5 A;  1EF4 A;  1SEU A;  4OAY A;  4P55 A;  2EZL A;  1USS A;  5J3L A;  1H88 C;  5LGU A;  5E8G A;  4XOR A;  2DT7 B;  3QQA A;  3R61 A;  3VFZ A;  1F36 A;  3ESW B;  5KHD A;  2VLA A;  1LQ1 A;  4FIS A;  2LK2 A;  1FIA A;  3LWF A;  2XAF A;  5GAE J;  5E3O A;  2CO5 A;  3H92 A;  3DV8 A;  3DBR B;  5ED4 A;  2DN0 A;  5ILS A;  4S0H B;  3U1K A;  2EIN H;  3WGH A;  3JSO A;  2DQR A;  2ME6 A;  2JWT A;  3FMQ A;  1FMV A;  3OIQ A;  1QHH D;  2DW4 A;  1X1C A;  2PG4 A;  2Y2Z A;  1KON A;  1N78 A;  3ZQ7 A;  3EPZ A;  4EAT A;  4UUT A;  2BVM A;  5FLM J;  1WI9 A;  1MMA A;  1R1U A;  4QWQ A;  3GTQ J;  3J81 Z;  1ZG1 A;  4HX8 A;  4BDY A;  2EFQ A;  4EGZ A;  1SD4 A;  2LY9 A;  1S3J A;  2HDW A;  1UEL B;  2Z3Y A;  2ISZ A;  2DMT A;  2O9L A;  2KLO A;  1DPR A;  2VQL A;  1XPX A;  3BQY A;  3LSJ A;  2OQR A;  1JUS A;  2PX9 A;  3OYB A;  1IV6 A;  2OCE A;  2P5K A;  4IQ4 A;  4XSX F;  3T5X A;  3LSK A;  4A3K J;  4RM2 A;  3F3X A;  2FOW A;  1EH7 A;  2L01 A;  5F0F A;  5F64 A;  1K78 B;  3H1C A;  1YW7 A;  4Y15 A;  5EDN A;  1W5T A;  4N9I A;  5M3M J;  2LTP A;  2FBK A;  3K70 D;  2XKO A;  1K6O A;  1X2N A;  1O57 A;  3L9F A;  3PQJ A;  4G8X A;  3I71 A;  3L2Q A;  2CH0 A;  4PFO A;  3OOP A;  3QYB A;  5DCM A;  4HRI A;  3FHN A;  4CCM A;  5HOO A;  2QQB A;  1FOK A;  1PP7 U;  3ZOB A;  1BN5 A;  3D5R C;  1M1E B;  5J40 A;  2EFP A;  4QPQ A;  3F8F A;  3O6B B;  5F27 A;  1SFU A;  1R36 A;  2UV1 A;  4EMS A;  2KIS A;  5HS9 A;  4HEA 2;  1TWH J;  3JRG A;  2VXD A;  3BCB A;  3VYU B;  2CW8 A;  2JA2 A;  4M6X A;  1X3U A;  1G3W A;  1Z1D A;  2K27 A;  3OIP A;  4L5E A;  3MKY B;  2K40 A;  4ON0 A;  3BTL A;  2EJR A;  4O5V A;  4YFX F;  1S9H A;  3ZN0 A;  2XB5 A;  2X9D A;  3G73 A;  2E1M B;  2O03 A;  1FJL A;  2VQG A;  1Y0N A;  3ECH A;  1ETV A;  2DMP A;  2NNY A;  4HV6 A;  1WCM J;  1XTA A;  2W84 A;  3OS1 A;  2GAU A;  3EYI A;  2TDX A;  3MEX A;  3CF5 F;  6PAX A;  1WJC A;  3PIP F;  2RNJ A;  1N25 A;  3I54 A;  2CUF A;  3FM3 A;  4QIW N;  2L9V A;  3DEW A;  3RJP A;  4UVB A;  3CCY A;  3COA C;  3WTS C;  2NOG A;  2YSR A;  2XV4 S;  4BGD A;  5D5V B;  5HS7 A;  5IYD J;  1U6G A;  4ESF A;  3IHU A;  2CFX A;  4CH7 A;  1W7P A;  1LFP A;  3C2G A;  3OYC A;  4DQ2 A;  4BE0 A;  3E7L A;  4FTH A;  3QYE A;  3KYC B;  5LRS A;  3ZP5 A;  2X51 A;  4UUS B;  1WJ5 A;  1SAU A;  3RKW A;  1UZC A;  3H0D A;  2KMU A;  4J19 A;  1FC3 A;  1OKR A;  2D5V A;  1FY7 A;  5K7H A;  4ZYD A;  2ZKZ A;  3HUG A;  5E17 F;  1B4A A;  2PJP A;  5IT9 Z;  2B63 J;  1D0X A;  3RQ4 A;  5TRD A;  4JP0 A;  1JJ8 C;  1XGS A;  4MFE A;  4IHV A;  3C3W A;  2V1U A;  5M5Y J;  3DTE A;  3FMR A;  1I27 A;  3S3M A;  1QZY A;  4RAF A;  1BOB A;  3MKW B;  1MKM A;  1TWA J;  2UUZ A;  1X2M A;  2BW3 A;  1SAX A;  4AWX B;  1IAW A;  2ETH A;  3RZD J;  5EEG A;  3C7J A;  1FPQ A;  2M87 A;  2MH2 A;  4BU2 A;  2VOP A;  3OYL A;  1YIT I;  2DOA A;  3MMY B;  5EEA A;  3WU0 A;  2KHM A;  4A69 C;  2MD5 A;  3H5A A;  2VB6 A;  2XDV A;  5L3B A;  3LSP A;  5E3M A;  1WKM A;  1GXP A;  3HEF A;  1TNT A;  4AUX A;  2QGU A;  3CQZ J;  1HA8 A;  2EB7 A;  3MCZ A;  5JFR A;  2LMD A;  4B1R A;  3RYP A;  4G6T B;  3K4B A;  1UJ8 A;  2QQA A;  1V5E A;  2VT3 A;  2WB1 N;  1H8A C;  3GTL J;  4GO1 A;  1EH8 A;  4A93 J;  1J5Y A;  4M74 A;  5HDG A;  1BJZ A;  3IC7 A;  3ERE D;  2HU9 A;  3D0S A;  3AL0 C;  5J1R A;  2I8D A;  1T56 A;  2VIX A;  3S32 A;  3H5R A;  2R0Q C;  1L0O C;  3K10 A;  3OYK A;  2EZH A;  1WJF A;  3DF8 A;  3TDZ C;  2E36 A;  2L4M A;  1E0E A;  5TIS C;  4YFN F;  1U3E M;  3HSF A;  4P96 A;  3JTH A;  3HOT A;  1P7I A;  4CCO A;  2DMQ A;  3I5U A;  3RPU A;  3S2D J;  4AVZ A;  2HVQ A;  4WK8 F;  3GYH X;  5E3N A;  1DDN A;  4MTE A;  1NK2 P;  2VUM J;  1WWX A;  4KFC A;  2K5C A;  3E1S A;  1SMT A;  1SVL A;  2EPF A;  1NK3 P;  1BBY A;  4EJU A;  2IJL A;  3K7A J;  4N0B A;  4E7L A;  1XGM A;  2L9S A;  4IO9 F;  3RKQ A;  3V8K A;  2V6E A;  2R7Z J;  3CUQ C;  2Y0S A;  4LG0 A;  4M3D A;  1T0F C;  1HXD A;  2BGC A;  2O3F A;  3G6E I;  2W4S A;  2XPU A;  2WV1 A;  4RGS A;  3HZJ A;  2R7X A;  4MGR A;  3F8B A;  2DO7 A;  4UB8 C;  3S17 J;  3M07 A;  3HL2 A;  3ABM H;  2JPB A;  4XRF A;  3L2V A;  2R7R A;  4CGZ A;  2KDZ A;  2HQA A;  4PJM A;  4A12 A;  1IRF A;  1ZG3 A;  2JRM A;  2UXN A;  3DKY A;  1DP3 A;  1HLV A;  3HDD A;  1YJ9 I;  2CUJ A;  5F04 A;  1RR8 C;  5LD2 C;  3F21 A;  2ID3 A;  3VDX A;  3FHZ A;  3DPT A;  2IA0 A;  2QCO A;  4MFD A;  1U78 A;  3L2W A;  3TP0 A;  2ELH A;  4G7H F;  4AIK A;  3RPQ A;  3VSK A;  3N4M A;  5JHF A;  4XKV A;  1HSJ A;  1WJA A;  3JRC A;  4JX5 A;  2HNH A;  1YS6 A;  5K7F A;  1X19 A;  4YG2 F;  2M45 A;  2EH3 A;  2M30 A;  1Y1W J;  2ZFW A;  4AIH A;  4XLF A;  3GFM A;  2H1L A;  3H5N A;  2K9S A;  4V2G A;  2F4I A;  3RQI A;  2G0E A;  1TWG J;  1W0T A;  4XRS A;  1OLT A;  1U5T B;  1H9G A;  1G3T A;  1TQI A;  3F22 A;  3H3V K;  3OL4 A;  3PNY A;  1H9T A;  1PYV A;  4C3J J;  1YIJ I;  2HDD A;  3CC7 I;  3TW7 A;  2J5O A;  4A5N A;  4I6Z A;  3MZ8 A;  1VQ5 I;  4M3B A;  2WY8 Q;  3DBL B;  4E7K A;  1BR4 A;  3VSL A;  2CMP A;  3HXL A;  4C30 A;  3ZQQ A;  5BS6 A;  2GOX B;  2KJC A;  3BQZ A;  3OYD A;  2R4G A;  2DTR A;  1MDM B;  2HS5 A;  3L00 A;  4PJL A;  4E4H A;  3I3L A;  3MQ0 A;  1POG A;  3E0J B;  2FJ1 A;  2RDP A;  5CQE A;  2X6Y A;  2LBF A;  4CZZ A;  5JHU A;  4CYC A;  2RNG A;  1GT0 C;  2ZBK A;  3LQQ A;  4MIM A;  1B9M A;  4HNT A;  1YRN A;  1IDY A;  4OIQ F;  1FTZ A;  1SFE A;  4JYK A;  1QNT A;  2ELK A;  1QO0 D;  3CJR B;  3ZQH A;  4CYD A;  2LYC A;  5E18 F;  1B59 A;  1K4T A;  5LEK A;  3WGI A;  2XVC A;  3IWZ A;  5EGO A;  4G6Q A;  2R7F A;  1W1W E;  4EGY A;  4HA8 A;  3WTX C;  3ERM A;  1VQ6 I;  1YLF A;  1R7J A;  4NC7 A;  3OYF A;  3IRR A;  1T98 A;  1EA3 A;  3HC7 A;  2CV2 A;  3R0J A;  4B47 A;  2GOM A;  1YJW I;  1U8R A;  2F5C A;  3SXY A;  1RI7 A;  2P4W A;  1VQO I;  1YE9 A;  2ZME C;  1VQK I;  1ZYR F;  3F72 A;  1I3A A;  2LDU A;  2LF8 A;  4XOP A;  2VE9 A;  2XGC A;  2Y30 A;  2FE3 A;  2P0W A;  3KZI C;  4AYB A;  2MA3 A;  5DYM A;  2OV7 A;  1Y1V J;  1BIA A;  2M3A A;  2CG4 A;  4M3E A;  1ZRE A;  1IGN A;  2DOF A;  3DKW A;  3CF2 A;  1FOX A;  2Q2E A;  3F6V A;  4IXA A;  3FXM A;  3D5L A;  3BZC A;  4W1U A;  5CVI A;  2PJR B;  1K83 J;  2IS2 A;  2VJI A;  1REP C;  2PN6 A;  4N4O B;  1MBF A;  5DD8 A;  4D5F A;  3CZ6 A;  2L02 A;  4M72 A;  3HSR A;  4KIG A;  3HB9 A;  3WU2 C;  3R60 A;  2KL4 A;  1TL8 A;  1S29 A;  1WPK A;  2HQR A;  2JSC A;  2KIF A;  5ERI A;  4ANJ A;  4X0G A;  1FP1 D;  4QSH A;  4R1H A;  4BHP A;  3CUQ A;  1ZGJ A;  4KDP A;  3HOY J;  3ABT A;  5KVR A;  4XRS G;  5D5X B;  1DQU A;  1T0F A;  4U87 A;  2HDC A;  3MZY A;  3T1B A;  1LDJ A;  1T8I A;  2JA8 J;  2JQ7 A;  1FT9 A;  3J7Y J;  2BHY A;  4DBR A;  1FYL A;  3TO9 A;  3CCM I;  2E7X A;  2VKV A;  5FLX Z;  2RC4 A;  4II3 A;  1I3Q J;  2PFB A;  4EJW A;  4L18 B;  1ZHF A;  5ILV A;  1W4M A;  3UR3 C;  1O7F A;  2M7B A;  1QZZ A;  4BQQ A;  1SFO J;  2DFE A;  1XN7 A;  2CWE A;  2LRD A;  2AXT C;  1GXQ A;  2K7L A;  3G1M A;  3K1N A;  2IT0 A;  2K4B A;  2VQC A;  1O4X A;  4A3J J;  2FML A;  3W6J B;  2XB0 X;  2ESH A;  1K79 A;  3FK6 A;  2L5Q A;  2GM4 A;  2L7Z A;  4U0V A;  1PUF A;  2M2E A;  2IGN A;  3K1M A;  1S7E A;  1OIS A;  1ETK A;  1OR7 C;  1GVJ A;  2BXZ A;  3E3V A;  1Z7L A;  2DAO A;  5DM6 F;  2H94 A;  3CUO A;  2FSW A;  3FXR A;  4DZP A;  2OAZ A;  3OYN A;  2BYV E;  2F5D A;  3P9C A;  1J75 A;  5FRM A;  1FBU A;  3LSM A;  3GVA A;  3HKZ N;  2H8W A;  2JA7 J;  2V4J C;  3NWT A;  3VOD A;  2OPT A;  2PEX A;  3BG5 A;  3BG3 A;  2HEO A;  3RTR A;  2X1C A;  3T8R A;  1Z77 A;  4E6K G;  1VQM I;  1MH4 A;  2ZSI B;  2LC2 A;  1VQ4 I;  4I7H A;  3M3Y J;  1ETW A;  4LK1 F;  3DEU A;  1G59 A;  4DW6 A;  2PMU A;  2BZT A;  4HF1 A;  4WXC A;  1MIJ A;  2ZJP F;  1MW7 A;  2PBI A;  5EF6 A;  1G3S A;  2QSF X;  4XRM A;  2IS4 A;  3ZMU A;  2C6Y A;  3GFI A;  4BE1 A;  3E5U A;  4LOC A;  2MD0 A;  3HRS A;  3WE2 A;  5KAF C;  1XDU A;  2ZXH A;  1R6R A;  3ONQ A;  4R8H A;  3I56 I;  1IRZ A;  2K4J A;  1Z6T A;  1R5I D;  2MSY A;  1VQL I;  4HDU A;  2AS5 F;  1MNE A;  1QVU A;  2A5Y B;  4FT8 A;  4Y17 A;  4YII A;  3C1D A;  4A3B J;  3KP5 A;  2W7N A;  1MSE C;  1BI2 A;  2XUB A;  3IWF A;  3CLQ A;  2KZG A;  3I4P A;  3W2W A;  1Z0X A;  3ZRG A;  2KQR A;  5GPA A;  2KZV A;  5B5E C;  1IUY A;  1LVA A;  1T08 B;  2V9V A;  3A01 A;  4I99 C;  2FF4 A;  3G1O A;  3VOE A;  3KEY A;  1D5V A;  3LAP A;  3ZMT A;  3H9J A;  4QPO A;  3H0G J;  3FXJ A;  1E17 A;  4I0A A;  2ZME A;  3FXQ A;  1SVM A;  1TQP A;  3I59 B;  5ICF A;  1LFU P;  5GP9 A;  3SZG A;  2VPR A;  1ZTR A;  2NXN B;  3MAJ A;  1Z3Y A;  3L09 A;  4ITV A;  4IX7 A;  1B9N A;  1NH3 A;  1XCV A;  3M1E A;  2X0L A;  2GXA A;  2G9W A;  2JN6 A;  3ZQC A;  1JKQ C;  3FBI B;  1MSF C;  4BQO A;  1RNL A;  1YW8 A;  2M1B A;  2YR2 A;  5M5X J;  2VOD A;  1HQC A;  2L3D A;  3J7A O;  2VT2 A;  2E1M C;  1P7J A;  5FJ8 J;  4EM0 B;  3O8G A;  1UG0 A;  4ZYH A;  5FKO A;  4IRG A;  2YX7 A;  4MEX F;  2XSJ C;  5IP6 A;  1TWF J;  1A35 A;  3RIR A;  2A68 F;  2VN2 A;  3G71 I;  3BR2 A;  1RKW A;  4HYE A;  4RB0 A;  4UB6 C;  1R1V A;  4ENK A;  3IKV A;  5AON A;  2V79 A;  3E5Q A;  2F48 A;  2AXL A;  2XAJ A;  2X85 A;  3CDI A;  2HFH A;  4FET A;  3G3Z A;  3HOZ J;  3GTJ J;  2NYX A;  2XGE A;  3GW2 A;  4H0E A;  1NG7 A;  4RS8 A;  4D1Q A;  3B73 A;  3RCO A;  1Y0U A;  3CTA A;  2VKE A;  4YFK F;  4P9U A;  5C4X J;  1MND A;  1RES A;  2EA4 A;  3CCV I;  1I5Z A;  1XD7 A;  4ZTJ A;  3JR9 A;  4HG2 A;  5ILU A;  4UVA A;  4DIQ A;  1K4S A;  2XRO A;  2WB1 A;  1J9I A;  1ZK8 A;  5TJJ A;  1ETQ A;  1MJA A;  2LVS A;  5ICG A;  1N77 A;  1AWC A;  1FEX A;  1ACI A;  4CO8 A;  1Z7U A;  1ZKG A;  5BPD A;  2R7U A;  3I53 A;  3WHB A;  2XGX A;  2L7F P;  3Q0U A;  2M7A A;  4XNF A;  5HOD A;  2QLZ A;  5BQT A;  3JCU C;  3J80 Z;  2R5Z B;  2CUZ A;  3BJ6 A;  4Q47 A;  4O3M A;  3EUH C;  1ON1 A;  2DMU A;  2A05 A;  2M0C A;  4ENJ A;  5L3C A;  2KRF A;  4IHT A;  1B1B A;  2L4A A;  4PK4 A;  1Z67 A;  1ZLJ A;  2A5W A;  1T33 A;  5CPR B;  2A6E F;  2Q8K A;  4AU7 A;  2Z33 A;  2G7U A;  2GZW A;  2R5Y A;  3BRO A;  2JMW A;  4XN3 A;  4ENN A;  3HOV J;  4BXX J;  4HPQ A;  3JRA A;  1D1A A;  4U88 A;  4ESB A;  3WTU C;  3CMA I;  5JVG F;  1Q1V A;  4XL9 A;  5DTD A;  5GTI C;  5KAI C;  4HDV A;  2F5V A;  1MD0 A;  3H3Z A;  1OR7 A;  3CC4 I;  1HDD C;  3J81 K;  4C3I J;  4KT6 A;  1R23 A;  2IP2 A;  3ZMD A;  2RQQ A;  2EIL H;  4KMF A;  2AO9 A;  2IPQ X;  5BOX A;  2R7O A;  1J2X A;  5CJ9 A;  3DPU A;  3JRE A;  4DOZ A;  4RGR A;  4NQW B;  1JE8 A;  4I02 A;  4IOC F;  4BL0 B;  1R00 A;  1XMK A;  2QEN A;  3DXJ F;  1PDN C;  3GZ6 A;  2F4M B;  2IA1 A;  2IAI A;  1LJ9 A;  4HF2 A;  3IP4 B;  3M9A A;  3SZP A;  2CGP A;  3WG9 A;  2VJJ A;  4G94 A;  3N97 A;  2HVR A;  3BDD A;  4LB6 B;  4GYG A;  5L3E A;  4YRV A;  3CDL A;  1YJN I;  3HJE A;  2UWM A;  5D6E A;  4PSW A;  1OCP A;  4A3F J;  2XKP A;  2I10 A;  1Y8R B;  2ZNY A;  5GPC A;  1VI0 A;  3I55 I;  3K4J A;  5F0C A;  1QBJ A;  1WJD A;  1LFB A;  1ZN2 A;  2OF7 A;  4ZZL A;  3MKL A;  4ZC3 A;  2HKO A;  3JSP A;  2PMZ N;  3BPX A;  2A6H F;  1K78 A;  1T6S A;  3K9T A;  4DGW B;  1U8B A;  3PJR A;  2EV0 A;  4XLH A;  1J59 A;  5HLG A;  4OIP F;  3PO2 J;  4C2M J;  1UAA A;  5F08 A;  2NOJ B;  5AIQ A;  4NUB A;  4OOI A;  2CQ7 A;  2IS6 A;  2GWR A;  2HOT A;  2Y9Y A;  4UV9 A;  3QU6 A;  4CCL A;  3ML6 A;  4K2E A;  2V1D A;  1B72 B;  4ZDP A;  3ZPL A;  2EIM H;  1FZP B;  2JA6 J;  3ZQF A;  2P81 A;  2IA2 A;  4B3A A;  1RET A;  2R7V A;  2JVH A;  3KFW X;  2O5R A;  3CME I;  4GRI A;  3V7S A;  4BAY A;  2ZJ2 A;  3GBG A;  1GV2 A;  3IUO A;  4ZTF A;  2DK8 A;  3SQN A;  5HDK A;  5C44 J;  4XLP F;  2WWY A;  1OYI A;  3OSG A;  1K6Y A;  3ZMS A;  4CA0 A;  2JSP A;  2DMN A;  5GAD J;  1KGS A;  3NQO A;  2O61 A;  3VB2 A;  3Q0W A;  1DUX C;  4JQF A;  3ZR8 X;  3EYY A;  2ICW G;  1BM9 A;  3HG9 A;  4L9V A;  4IHY A;  1FSE A;  1RZ4 A;  4D5C A;  1UCR A;  3GLL A;  1XSD A;  3QPS A;  1OYW A;  4UHT A;  2DLL A;  2MFZ A;  2O8X A;  3W3C A;  1J7K A;  1RKT A;  1F5T A;  3MN2 A;  1UFM A;  5LHI A;  1Z9C A;  4HX4 A;  2ESN A;  4E7S A;  1IXC A;  2O7O A;  1QU3 A;  1WH5 A;  1R58 A;  3I9V 2;  3LNQ A;  4LFU A;  1JJ6 C;  3OYA A;  4UV8 A;  3BZ6 A;  2FUG 2;  5CYV A;  4ZDL A;  4KN7 X;  1W7P B;  2K9N A;  4MQ9 F;  4KN4 X;  1T38 A;  3CCR I;  5AIP A;  4PJ0 C;  1SD6 A;  3A4C A;  4ENM A;  5ICC A;  1LEA A;  1W7P D;  2HTS A;  3NAU A;  1X3W B;  1KU7 A;  2H8R A;  5CVV A;  5E3L A;  3SFI A;  4LMY A;  3KEQ A;  3P5J A;  2VOO A;  4A0Z A;  4UUS A;  5TGT A;  5JLX A;  1U5T C;  1V5F A;  2YX4 A;  2MGQ A;  2EZK A;  1JKP C;  2QYO A;  1FMW A;  1ZEL A;  3Q5F A;  2GBY A;  2Y9Z A;  2DXI A;  3TDU C;  2NS7 A;  3EUH A;  1A6I A;  2GA2 A;  3D1N I;  1YFH A;  1A5J A;  5FB2 A;  3W6K B;  3QP6 A;  2MC3 A;  5E79 C;  2OCC H;  1KYW A;  4MTD A;  4V19 K;  2VJ5 A;  5HNF A;  3ULQ B;  2K86 A;  3HOX J;  4CCK A;  2QZ8 A;  4Y7N J;  2BW3 B;  4ZZD A;  1IV8 A;  5J4V A;  2L7K A;  1HOM A;  4RMN A;  5HVQ C;  4LIU A;  2Q0O A;  4HF0 A;  1E3P A;  2ZC2 A;  2HOS A;  2E1C A;  3BR0 A;  5HLT A;  2WAD A;  1LEB A;  1SFX A;  4UXN A;  5F0H A;  1MBE A;  4AM3 A;  3GTK J;  1IRX A;  3OR1 C;  4YEL A;  3CDH A;  4HOB A;  4OIN F;  3OYE A;  1IC8 A;  3GFL A;  4IJA A;  2JT1 A;  4GGG A;  4XLE A;  5BPI A;  2E1N A;  5KNL A;  1NTC A;  4IHX A;  3KPH A;  4BKX A;  4J01 A;  1H0M A;  4E7I A;  1WVR A;  3BJO A;  4M9S A;  2FQ4 A;  2DT6 A;  1VTN C;  2WC2 A;  1S7A A;  2X1D A;  3LA7 A;  4EM1 A;  3S14 J;  4B3X A;  1HW2 A;  2DPU A;  4U0Y A;  1P9Q C;  2TCT A;  2CFO A;  3KP7 A;  3ZQG A;  4II2 A;  3DU5 A;  3LL7 A;  3FXL A;  4LB5 A;  4BJ6 C;  3QYF A;  1D3Y A;  1YYV A;  4D7M A;  1WH7 A;  3IL2 A;  2YU9 J;  3HRM A;  2HYF A;  3HHH A;  4BJT A;  3JRF A;  2NVT J;  3DPL C;  5CLS A;  4XSZ F;  1JHF A;  2YPR A;  4WF2 A;  2EK5 A;  1HKT A;  3KP6 A;  4EEF G;  4IOA F;  1IF1 A;  2W25 A;  5GAH J;  3IH3 A;  4XKB A;  3VEP A;  2FX0 A;  5DM7 F;  1F43 A;  2LSO A;  3KYL A;  5D8L B;  3RPU D;  1J0R A;  3PSI A;  3QRF F;  2LKS A;  4IF4 A;  4G6D A;  1S8N A;  2GLO A;  3NRV A;  5FFX A;  1K7A A;  2NRA C;  3U1D A;  1LNW A;  1TNS A;  4U0W A;  3IV5 A;  5IP9 J;  3PFI A;  4PCQ A;  1N75 A;  1P4W A;  3CJQ B;  4NNJ A;  4XMY A;  2HPI A;  4HZF A;  2GIZ A;  2BE5 F;  1XSV A;  3DU6 A;  1Y56 A;  1D8J A;  1F9N A;  3HTS B;  4KT5 C;  4EQQ A;  2LY1 A;  5D5W B;  2YUS A;  1CF7 B;  4B44 A;  3GO5 A;  3OSF A;  1ZAR A;  2CW0 F;  3ZN1 A;  5FD5 A;  3MFK A;  3HKZ A;  3S1M J;  3SDG A;  4ZJZ A;  1AKH B;  4M73 A;  1RC9 A;  1CGP A;  2F4O B;  1ODD A;  2BY0 A;  1LDD A;  5A2Q Z;  2P5L C;  2OQG A;  2R7W A;  4WWC A;  4G7O F;  4C9Y A;  1Z6R A;  1DGR M;  1OCO H;  2L2O A;  4I01 A;  1SMY F;  5M3F J;  1W36 C;  2NVY J;  5B3S H;  1E3O C;  2R92 J;  2QF7 A;  3OWT A;  4N9H A;  3EUA A;  2HOA A;  4ZYA A;  1VFC A;  4C2T A;  4KA4 A;  1MBG A;  3AAF A;  4X6A J;  3OIO A;  4PGH A;  5DDG A;  3BR5 A;  2DA1 A;  3CO6 C;  1ETY A;  2STW A;  1IN7 A;  2COB A;  1R22 A;  2CQX A;  5LGT A;  4AID A;  1MH3 A;  2EBI A;  5FGM A;  2XF5 A;  3BJA A;  2HXO A;  4DBQ A;  4KIB A;  2FMY A;  1A31 A;  3E6C C;  2E5N A;  2OTJ I;  3I0T A;  3RDI A;  2XPV A;  1D0Y A;  1U5T A;  4PSX A;  1RUO A;  1JGS A;  3F23 A;  3QPH A;  4IKF A;  3B02 A;  3CD6 I;  2W1O A;  4EVI A;  3HOS A;  2Z16 A;  3BOQ A;  4M9Z A;  2OBP A;  2COM A;  3SDB A;  2GQQ A;  1MNM C; 
#chains in the Genus database with same CATH homology
 3Q0V A;  3HPH A;  4DJA A;  2IGM A;  2LH9 A;  4KIT B;  1D0Z A;  2NVX J;  5FRN A;  2XRL A;  4LIV A;  1B8I A;  3RZO J;  5EZG A;  1YRN B;  3BT9 A;  3H9Q A;  2JJ7 A;  3OS2 A;  4XKC A;  2HYJ A;  5EG0 B;  1ETO A;  4XON A;  2R7Q A;  3D5S C;  1MMN A;  5FKN A;  1YX5 A;  3LMM A;  3FKI J;  4RBO A;  4DYQ A;  2NS8 A;  2ME0 A;  4C3H J;  3S3O A;  3C2H A;  1G2H A;  3S1R J;  3S15 J;  3FIW A;  2ZB9 A;  2HPM A;  2LFB A;  2AQE A;  2HI3 A;  3OYJ A;  2O8K A;  2WAF A;  4E7J A;  3DQV C;  3M4O J;  2PJR A;  4NC8 A;  2X6X A;  2IGK A;  2ID6 A;  1BA5 A;  3L2U A;  2E2I J;  1IDZ A;  2E19 A;  4ABZ A;  1DU0 A;  4A3D J;  1JUM A;  4M6V A;  2QKL B;  3AFH A;  1W0U A;  4Y4R A;  2Q1Z B;  3HOU J;  2NVQ J;  4BXF A;  5IPA A;  1JTX A;  2R7T A;  3FBN B;  2HVS A;  2XGD A;  3QPL A;  4RDU A;  3ZGK A;  3PSF A;  3GTG J;  3I4M J;  4FE7 A;  1ETX A;  1ERD A;  1X1D A;  3PNV A;  3SEQ A;  2PMZ A;  1BW6 A;  2WAE A;  3J7A Y;  2KRC A;  3V42 A;  4Y3O A;  5FKL A;  1LDK B;  2TRT A;  2IS1 A;  2CV1 A;  4BQN A;  2IGO A;  2X6W A;  2Z1D A;  2WAQ N;  2LLK A;  4BAC A;  3PL8 A;  4XM3 A;  1UMQ A;  4NDL A;  4A3E J;  2DJI A;  1PJR A;  3OS0 A;  3CMY A;  3HM5 A;  3K70 C;  2DA4 A;  2XF6 A;  3LSG A;  4BUP A;  2CUE A;  2JVG A;  4BEH B;  2LR8 A;  3DTK A;  1VF9 A;  1LE8 B;  2JA5 J;  1G8X A;  3BG9 A;  3S93 A;  4XQF A;  1TWC J;  1WGX A;  2X1E A;  3OOU A;  4F93 B;  4CCN A;  4XLA A;  1DGW Y;  5HNH A;  2OC6 A;  3S1N J;  3F0C A;  3UNG C;  2IEK A;  4XK4 A;  4M3F A;  1IG7 A;  2L7M P;  1FTT A;  3S3N A;  3K4K A;  1XC5 A;  1V5G A;  2CU7 A;  4GFB A;  3IAM 2;  2M34 A;  3ZXS A;  3FK7 A;  3MD2 A;  3DCF A;  3PO3 J;  3TMO A;  3WHC A;  4D7N A;  4BS9 A;  3LSI A;  2M0M A;  3CP8 A;  1Y6I A;  3B6A A;  1XS9 A;  1JI8 A;  1JT0 A;  1H89 C;  3LSR A;  2V7F A;  3K4C A;  1ZR2 A;  2W82 A;  4KJZ A;  2CQQ A;  1JT6 A;  3Q3S A;  1ZGW A;  3FIS A;  1VZ0 A;  4IZZ A;  2R5Z A;  2XSD C;  1BR2 A;  1MMD A;  4BJ5 C;  4M3G A;  4A3L J;  3DLA A;  3S2H J;  3W2A A;  2IBD A;  4CZC A;  5CKT A;  1JUP A;  3SYT A;  3RSN A;  3JRB A;  3TP3 A;  4BBR J;  4MLO A;  1QPI A;  3OY9 A;  3PNT A;  2VXZ A;  4F52 A;  2L9N A;  1HCR A;  2HXI A;  3DWL E;  3H9G A;  1QVT A;  1SFK A;  3FKJ A;  4FAS D;  3CMM A;  4PUS A;  3OYI A;  1D1C A;  2MYS A;  1APL C;  4W97 A;  1GDT A;  3VYS B;  2EQR A;  1I50 J;  1SAN A;  1CQT A;  1QHG A;  3HGG A;  5IOY A;  4DYC A;  1JKR C;  1X4O A;  4BE2 A;  4HST A;  2FD5 A;  2XPW A;  3ZCO A;  2IXS A;  2ZFU A;  2DA2 A;  3PM1 A;  3UKG A;  3NWS A;  4Y52 J;  5K7Z A;  2HZD A;  2K9L A;  4A3M J;  3JRH A;  1MBH A;  1B72 A;  3L2R A;  2Z2S B;  3EUK L;  1Z21 A;  1TC3 C;  5J1Y A;  1GV5 A;  1BR1 A;  1QRY A;  5DS9 A;  3HGY A;  1ZQ3 P;  1T95 A;  4LG3 A;  3S8P A;  2H1K A;  3MVP A;  2LD5 A;  5C3E J;  3DEE A;  2DA6 A;  3NAR A;  2ZXI A;  2MG4 A;  1JGG A;  1AA7 A;  3BR3 A;  3BG6 A;  4FE4 A;  3HUG B;  4IQJ A;  3BR1 A;  3F9K A;  4RLQ A;  4V2F A;  4A3I J;  4DYR A;  3K4M A;  4U7B A;  3LFU A;  2VI6 A;  1WFX A;  4Y33 A;  1JTY A;  2MW8 A;  3BTI A;  4BY1 J;  5FLV A;  1MMG A;  3K4L A;  3IH2 A;  1I6H J;  1ENH A;  4I76 A;  1DU6 A;  4BY7 J;  4F91 B;  2VL8 A;  1TZL A;  4QTR A;  5M5W J;  2VQH A;  1U9N A;  2E60 A;  9ANT A;  4PJJ A;  5C4J J;  2E2J J;  1WI3 A;  2V26 A;  5F1J A;  2DA5 A;  2CV0 A;  1NG6 A;  1XG1 A;  4ZDO A;  3N05 A;  3H35 A;  1J09 A;  1YX3 A;  3OR2 C;  1GUU A;  4G12 A;  5IYC J;  1HF0 A;  2BOL A;  5EYR A;  2XF7 A;  2DTZ A;  5CQG A;  3W6V A;  1UHS A;  2LG4 A;  4AC0 A;  2LRE A;  3CP2 A;  3PUB A;  3BC8 A;  1U9O A;  2WY7 Q;  2X48 A;  2K9M A;  3OYG A;  4KIS A;  4F92 B;  2CJJ A;  4N4N B;  2AHQ A;  4R79 A;  1AKH A;  2WAQ A;  4DZJ A;  3QOE A;  4B4C A;  4HSR A;  2LP0 A;  3A02 A;  4OWR B;  4PFP A;  3TBI A;  2L9R A;  2M4G A;  4HNV A;  1ORK A;  4MO7 A;  4H4K C;  4BBS J;  2KDO A;  3I4N J;  3KX2 A;  2RAE A;  4CSW A;  1WJE A;  3GTM J;  2R93 J;  4X1E A;  3VWB A;  1LKX A;  2JK3 A;  3IAS 2;  4FCY A;  2MC4 A;  1OCT C;  4A3G J;  3G1L A;  2BVL A;  5IP7 J;  1BL0 A;  3SEZ A;  2AQF A;  4F55 A;  3BG7 A;  1FIP A;  1R9T J;  2LBF B;  2DCE A;  4CYC B;  5JLW A;  4XR6 A;  2VAS A;  1B8I B;  2WA0 A;  2CRG A;  3FDY A;  1D1B A;  2LOO A;  5EGO B;  1X1B A;  5BNG A;  4JOM A;  4CUG A;  3BR6 A;  3ZQL A;  2KT0 A;  5FKM A;  4IHW A;  4CCJ A;  3GTO J;  4LIT A;  4E7Z A;  2DA7 A;  3AL0 B;  5EG0 A;  1D5Y A;  1LVK A;  2RRE A;  3LOC A;  2M8G X;  3JRD A;  2MAB A;  3L1P A;  4XN0 A;  2R7S A;  3K2A A;  2ECB A;  2ZSH B;  2Q2E B;  5FKK A;  1TT0 A;  5J1U A;  2W48 A;  3HOW J;  2V9K A;  4P1W A;  3GTP J;  3BTC A;  2V1N A;  3BLY A;  3OYH A;  1HDP A;  4F3Q A;  1X4P A;  2E5Z A;  3ZQI A;  4XIC A;  3C2B A;  2JUG A;  3BTJ A;  3VPR A;  3CES A;  1X58 A;  2M4K A;  4JX4 A;  4XLC A;  1K61 A;  2XAU A;  2HQ5 A;  3SJM A;  3K4N A;  4XOT A;  2F6C A;  2W00 A;  1U0J A;  2M9H A;  2K3P A;  1OJL A;  3W2V A;  3LSH A;  1W36 D;  3HBL A;  1PUF B;  3DTI A;  2VPL A;  2KRH A;  3A2K A;  3BCA A;  3S1Q J;  2Y0S N;  2KPM A;  3PFY A;  5EZH A;  1WJB A;  2XC7 A;  1VND A;  1OFC X;  1IUF A;  4E7H A;  1RR7 A;  3IH4 A;  2WBM A;  2A6T A;  3U21 A;  1X1A A;  1MBJ A;  1MBK A;  1UG2 A;  1AHD P;  4B43 A;  4JX6 A;  1Z3X A;  2DJN A;  2K9Q A;  4J00 A;  1JKO C;  4PJN A;  3OMY A;  1RPW A;  4RLF A;  4IEJ A;  3A1Y A;  3A01 B;  3G2B A;  4YEJ A;  4BDZ A;  3K6G A;  3JRI A;  3AKZ A;  2KP6 A;  4BEH A;  5LFA A;  3B6C A;  4D9J A;  1ZR4 A;  1ITY A;  1GVD A;  3A03 A;  3VYT B;  5IOZ A;  1GLN A;  1LE8 A;  3OL3 A;  2CS3 A;  4P5O A;  3TED A;  2E1O A;  4RM3 A;  2QKM B;  3S16 J;  2N8G A;  5IYB J;  2ECC A;  2LKX A;  3M8J A;  5FRO A;  3HPG A;  4B48 A;  1BW5 A;  3TW6 A;  2OUM A;  2LY2 A;  4OAZ A;  1AU7 A;  2ELJ A;  2X6O A;  2L0K A;  4A3C J;  2VKD A;  3VYR B;  4HNU A;  5KCM A;  3OYM A;  2Y31 A;  3TL4 X;  2DA3 A;  2CW7 A;  4C2U A;  4AYB N;  1IJW C;  2YS9 A;  2VKH A;  2E2H J;  3MKZ A;  2R5Y B;  3O8H A;  3QOD A;  3DKX A;  2EZI A;  4XKW A;  2VJ4 A;  3M1C A;  1EF4 A;  4OAY A;  2EZL A;  5J3L A;  1H88 C;  4XID A;  4XOR A;  3QQA A;  2DT7 B;  5KHD A;  1F36 A;  2VLA A;  4FIS A;  2LK2 A;  1FIA A;  5E3O A;  2DN0 A;  4S0H B;  2ME6 A;  2JWT A;  1FMV A;  3OIQ A;  1QHH D;  1X1C A;  2Y2Z A;  1KON A;  1N78 A;  3EPZ A;  4EAT A;  4UUT A;  2BVM A;  5FLM J;  1MMA A;  3GTQ J;  4BDY A;  2LY9 A;  2HDW A;  1UEL B;  2DMT A;  2O9L A;  2KLO A;  2VQL A;  3BQY A;  3LSJ A;  1JUS A;  3OYB A;  1IV6 A;  4IQ4 A;  3LSK A;  4A3K J;  4RM2 A;  5F0F A;  5EDN A;  5M3M J;  2LTP A;  3K70 D;  1X2N A;  3L2Q A;  2CH0 A;  4PFO A;  3QYB A;  4HRI A;  3FHN A;  4CCM A;  5HOO A;  3ZOB A;  3D5R C;  4QPQ A;  5F27 A;  2UV1 A;  3JRG A;  1TWH J;  4HEA 2;  2VXD A;  3BCB A;  3VYU B;  2CW8 A;  2JA2 A;  3OIP A;  3MKY B;  4L5E A;  2K40 A;  3BTL A;  1S9H A;  2XB5 A;  2X9D A;  2E1M B;  1FJL A;  2VQG A;  1ETV A;  2DMP A;  1WCM J;  3OS1 A;  1WJC A;  2CUF A;  4QIW N;  3DEW A;  3CCY A;  2NOG A;  4BGD A;  5IYD J;  4CH7 A;  1LFP A;  3C2G A;  3OYC A;  4BE0 A;  3E7L A;  4FTH A;  3QYE A;  4UUS B;  2X51 A;  1WJ5 A;  1SAU A;  3H0D A;  2KMU A;  4J19 A;  2D5V A;  5K7H A;  2B63 J;  1D0X A;  3RQ4 A;  4JP0 A;  1JJ8 C;  4MFE A;  4IHV A;  5M5Y J;  3DTE A;  3S3M A;  1BOB A;  3MKW B;  1TWA J;  2UUZ A;  1X2M A;  2BW3 A;  3RZD J;  4BU2 A;  3OYL A;  2DOA A;  3MMY B;  5EEA A;  4A69 C;  2KHM A;  3H5A A;  2VB6 A;  2XDV A;  3LSP A;  5E3M A;  3HEF A;  4AUX A;  3CQZ J;  1HA8 A;  4B1R A;  4G6T B;  3K4B A;  2WB1 N;  1H8A C;  3GTL J;  1V5E A;  4A93 J;  1BJZ A;  2HU9 A;  3AL0 C;  5J1R A;  2I8D A;  1T56 A;  2VIX A;  3S32 A;  3H5R A;  2R0Q C;  3K10 A;  3OYK A;  2EZH A;  1WJF A;  1E0E A;  3HOT A;  1P7I A;  4CCO A;  2DMQ A;  3S2D J;  4AVZ A;  2HVQ A;  5E3N A;  1NK2 P;  2VUM J;  2K5C A;  3E1S A;  1NK3 P;  3K7A J;  4E7L A;  3RKQ A;  2V6E A;  2R7Z J;  2Y0S A;  4M3D A;  1T0F C;  2W4S A;  2XPU A;  2WV1 A;  2R7X A;  3S17 J;  3HL2 A;  3L2V A;  2R7R A;  2KDZ A;  2HQA A;  4PJM A;  3DKY A;  1DP3 A;  1HLV A;  3HDD A;  2CUJ A;  5F04 A;  5LD2 C;  2ID3 A;  3VDX A;  3DPT A;  2QCO A;  4MFD A;  1U78 A;  3L2W A;  3TP0 A;  3VSK A;  5JHF A;  4XKV A;  3JRC A;  1WJA A;  4JX5 A;  2HNH A;  5K7F A;  1X19 A;  2EH3 A;  1Y1W J;  4XLF A;  3H5N A;  2K9S A;  4V2G A;  2F4I A;  3RQI A;  2G0E A;  1TWG J;  1W0T A;  4XRS A;  1OLT A;  3H3V K;  3OL4 A;  3PNY A;  1PYV A;  4C3J J;  2HDD A;  3TW7 A;  4I6Z A;  4M3B A;  2WY8 Q;  4E7K A;  3VSL A;  1BR4 A;  2CMP A;  3HXL A;  4C30 A;  3ZQQ A;  3BQZ A;  2GOX B;  3OYD A;  2R4G A;  4PJL A;  4E4H A;  3I3L A;  1POG A;  3E0J B;  2FJ1 A;  5CQE A;  2X6Y A;  2LBF A;  4CYC A;  2RNG A;  1GT0 C;  4MIM A;  4HNT A;  1YRN A;  1IDY A;  1FTZ A;  4JYK A;  3ZQH A;  2ELK A;  3CJR B;  2LYC A;  5EGO A;  3OYF A;  4NC7 A;  1EA3 A;  3HC7 A;  2CV2 A;  4B47 A;  2GOM A;  1YE9 A;  4XOP A;  2XGC A;  2Y30 A;  2P0W A;  4AYB A;  2OV7 A;  1Y1V J;  2M3A A;  4M3E A;  1IGN A;  3CF2 A;  3D5L A;  4W1U A;  2PJR B;  2IS2 A;  1K83 J;  2VJI A;  4N4O B;  1MBF A;  4D5F A;  3CZ6 A;  3HB9 A;  2KL4 A;  1WPK A;  4ANJ A;  4X0G A;  4QSH A;  3HOY J;  4XRS G;  1DQU A;  4U87 A;  2JA8 J;  4DBR A;  2VKV A;  4II3 A;  1I3Q J;  3UR3 C;  2M7B A;  1SFO J;  4BQQ A;  2LRD A;  3G1M A;  2VQC A;  1O4X A;  4A3J J;  2XB0 X;  3FK6 A;  2L5Q A;  2GM4 A;  2L7Z A;  1PUF A;  2M2E A;  2IGN A;  1S7E A;  1ETK A;  1OR7 C;  1Z7L A;  4DZP A;  3OYN A;  5FRM A;  3LSM A;  3HKZ N;  2JA7 J;  2V4J C;  3NWT A;  2OPT A;  3BG5 A;  3BG3 A;  3RTR A;  2X1C A;  4E6K G;  1Z77 A;  1MH4 A;  2ZSI B;  2LC2 A;  3M3Y J;  1ETW A;  1G59 A;  4DW6 A;  1MW7 A;  5EF6 A;  2IS4 A;  4XRM A;  4BE1 A;  4LOC A;  2MD0 A;  2ZXH A;  1R6R A;  3ONQ A;  1IRZ A;  2MSY A;  1MNE A;  1QVU A;  4A3B J;  2W7N A;  1MSE C;  3W2W A;  1Z0X A;  3ZRG A;  2KQR A;  5GPA A;  2KZV A;  3A01 A;  3G1O A;  3KEY A;  3H9J A;  4QPO A;  3H0G J;  1LFU P;  5GP9 A;  3SZG A;  2VPR A;  1ZTR A;  1Z3Y A;  4ITV A;  4IX7 A;  2JN6 A;  3ZQC A;  1JKQ C;  3FBI B;  1MSF C;  4BQO A;  5M5X J;  2E1M C;  1P7J A;  5FJ8 J;  3O8G A;  1UG0 A;  5FKO A;  2XSJ C;  5IP6 A;  1TWF J;  3BR2 A;  1RKW A;  2X85 A;  4FET A;  3HOZ J;  3GTJ J;  2XGE A;  1NG7 A;  4D1Q A;  3RCO A;  2VKE A;  5C4X J;  1RES A;  1MND A;  4ZTJ A;  3JR9 A;  4HG2 A;  4DIQ A;  2WB1 A;  1ZK8 A;  1ETQ A;  1N77 A;  2LVS A;  1FEX A;  1ZKG A;  2R7U A;  3WHB A;  2L7F P;  3Q0U A;  5HOD A;  2M7A A;  4XNF A;  2R5Z B;  2CUZ A;  3EUH C;  2DMU A;  2M0C A;  4PK4 A;  2A5W A;  5CPR B;  4AU7 A;  1T33 A;  2R5Y A;  2JMW A;  4BXX J;  3HOV J;  4XN3 A;  4HPQ A;  3JRA A;  1D1A A;  1Q1V A;  4XL9 A;  5DTD A;  2F5V A;  1HDD C;  4C3I J;  4KT6 A;  2RQQ A;  2AO9 A;  2R7O A;  3DPU A;  3JRE A;  4DOZ A;  4NQW B;  4BL0 B;  2IAI A;  3IP4 B;  2VJJ A;  2HVR A;  4YRV A;  3CDL A;  2UWM A;  4PSW A;  1OCP A;  4A3F J;  2I10 A;  5GPC A;  1VI0 A;  5F0C A;  3K4J A;  1WJD A;  1LFB A;  2OF7 A;  3MKL A;  4ZC3 A;  2PMZ N;  4DGW B;  1U8B A;  3PJR A;  4XLH A;  3PO2 J;  4C2M J;  1UAA A;  5F08 A;  2NOJ B;  4NUB A;  2IS6 A;  2HOT A;  2Y9Y A;  4CCL A;  1B72 B;  4ZDP A;  2JA6 J;  3ZQF A;  2P81 A;  4B3A A;  1RET A;  2R7V A;  2JVH A;  2O5R A;  4GRI A;  3GBG A;  1GV2 A;  3IUO A;  4ZTF A;  5C44 J;  3OSG A;  1K6Y A;  4CA0 A;  2JSP A;  2DMN A;  3Q0W A;  4JQF A;  3ZR8 X;  4IHY A;  3HG9 A;  4D5C A;  3QPS A;  2MFZ A;  3W3C A;  1RKT A;  3MN2 A;  4E7S A;  2O7O A;  1QU3 A;  1WH5 A;  3I9V 2;  3LNQ A;  1JJ6 C;  3OYA A;  4ZDL A;  2FUG 2;  2K9N A;  3A4C A;  3NAU A;  2H8R A;  5E3L A;  3SFI A;  4UUS A;  5TGT A;  5JLX A;  1V5F A;  2MGQ A;  2EZK A;  1JKP C;  1FMW A;  1ZEL A;  2GBY A;  2Y9Z A;  2DXI A;  2NS7 A;  1A5J A;  1A6I A;  3D1N I;  2VJ5 A;  5HNF A;  3HOX J;  4CCK A;  4Y7N J;  2BW3 B;  2L7K A;  1HOM A;  4RMN A;  5HVQ C;  4LIU A;  2HOS A;  3BR0 A;  5HLT A;  2WAD A;  5F0H A;  1MBE A;  3GTK J;  1IRX A;  3OR1 C;  4YEL A;  1IC8 A;  3OYE A;  4XLE A;  5KNL A;  1NTC A;  4IHX A;  4BKX A;  4J01 A;  4E7I A;  2FQ4 A;  2DT6 A;  2X1D A;  3S14 J;  4B3X A;  1P9Q C;  2TCT A;  2CFO A;  3ZQG A;  4II2 A;  3DU5 A;  3LL7 A;  4BJ6 C;  3QYF A;  4D7M A;  1WH7 A;  2YU9 J;  4BJT A;  3JRF A;  2NVT J;  3DPL C;  4EEF G;  3IH3 A;  4XKB A;  2FX0 A;  1F43 A;  3KYL A;  3RPU D;  3PSI A;  2GLO A;  3IV5 A;  5IP9 J;  1N75 A;  4NNJ A;  3CJQ B;  4XMY A;  2HPI A;  3DU6 A;  1Y56 A;  2LY1 A;  2YUS A;  4B44 A;  3OSF A;  3HKZ A;  3S1M J;  3SDG A;  4ZJZ A;  1AKH B;  2R7W A;  4C9Y A;  1DGR M;  2L2O A;  5M3F J;  1W36 C;  2NVY J;  1E3O C;  2R92 J;  2QF7 A;  3OWT A;  3EUA A;  2HOA A;  4ZYA A;  1VFC A;  4C2T A;  1MBG A;  4X6A J;  3OIO A;  3BR5 A;  2DA1 A;  1ETY A;  2COB A;  2CQX A;  1MH3 A;  2EBI A;  2XF5 A;  2HXO A;  4DBQ A;  2E5N A;  2XPV A;  1D0Y A;  4PSX A;  4IKF A;  2W1O A;  3HOS A;  2Z16 A;  3SDB A;  2L9S A;  1MNM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...