3OOUA

The structure of a protein with unkown function from listeria innocua
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
105
structure length
105
Chain Sequence
SPIIQNVLSYITEHFSEGMSLKTLGNDFHINAVYLGQLFQKEMGEHFTDYLNRYRVNYAKEELLQTKDNLTIIAGKSGYTDMAYFYRQFKKHTGETPNRYRKIHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a protein with unkown function from Listeria innocua
rcsb
source organism Listeria innocua
molecule tags Structural genomics, unknown function
molecule keywords Lin2118 protein
total genus 38
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12833 HTH_18 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3oouA01
1.10.10.2730 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oouA02
2XB0X 3RZDJ 2H1KA 2XGDA 1FTTA 1QVTA 3S2HJ 5F04A 4UUTA 4Y7NJ 1FIAA 3IH3A 1TWHJ 1ORKA 2DMUA 1WPKA 1ZK8A 3HOZJ 1U9NA 3A02A 3M3YJ 3Q0VA 1ENHA 5IYBJ 1GDTA 5E3NA 3GTLJ 2FQ4A 1XG1A 1OCTC 1ETVA 5M3FJ 2EZIA 3BTJA 2NVTJ 1YRNA 3B6CA 2ME6A 1AKHA 3SDGA 4XRSG 1FEXA 4M3BA 3QPLA 3M4OJ 2DMTA 5EF6A 2LLKA 2DA5A 5C44J 5DS9A 2H8RA 2R92J 2GBYA 5F08A 4A93J 2NVXJ 1AKHB 1QPIA 2I10A 4B3AA 5E3LA 4RBOA 4NDLA 3WHCA 3L1PA 1SFOJ 2YS9A 4JX5A 4I76A 1TWGJ 1W0TA 4XICA 1MBFA 2EBIA 1LFUP 2TCTA 4MFDA 1S7EA 4W1UA 2HOAA 1QVUA 3CMYA 1HLVA 3BQYA 2LTPA 4C3JJ 3HOUJ 2DTZA 3K7AJ 5IYCJ 5M5WJ 2NVYJ 1MBJA 4M3DA 5EGOA 1VI0A 1D5YA 3RZOJ 2YUSA 1VF9A 3QQAA 3D1NI 3HDDA 3Q0WA 1Y1VJ 4UUSA 2D5VA 4HNVA 1ZGWA 3GTMJ 2W48A 2MGQA 2O7OA 1P7IA 3CDLA 1O4XA 2CQQA 1AU7A 4QIWN 3BT9A 2JMWA 1P7JA 3JREA 1EF4A 4I6ZA 2CU7A 2HQ5A 1ETXA 4C3HJ 4DYQA 1Z0XA 1A6IA 3G1MA 4B4CA 4XIDA 4GFBA 3S2DJ 2E2IJ 3LOCA 1JGGA 3CCYA 2EZLA 4A3DJ 2KT0A 1T33A 2JA8J 3E7LA 1U9OA 2XB5A 1WI3A 3K2AA 4L5EA 4AUXA 1I50J 1VNDA 3BG9A 1MBHA 2NVQJ 5IOYA 4DZPA 1CQTA 3OSGA 1RPWA 3S1QJ 2FJ1A 1K83J 4FE4A 1BA5A 2HXOA 1B72B 3A03A 2GLOA 2HDDA 1MBGA 3QPSA 4G12A 4A3KJ 3ZQGA 2N8GA 4C3IJ 2R5ZA 2DMNA 3JR9A 3IH4A 1RETA 1MNMC 3NAUA 3LSGA 3LNQA 4DYRA 1BW5A 2Y9YA 1TC3C 3OOUA 4M3GA 1NTCA 1JKQC 1IDZA 1DU0A 3GTPJ 2EZHA 2LR8A 1JKPC 1HOMA 2R5ZB 5JLXA 1HDDC 1FJLA 2XPUA 5GPCA 2LVSA 2WB1N 4IHYA 5EZGA 4BY1J 2VI6A 5IYDJ 1OJLA 5JLWA 5DTDA 1W0UA 2JA6J 2DMPA 4BY7J 2LFBA 2O8KA 5K7FA 2MSYA 3B6AA 1APLC 5EZHA 5F0HA 2HYJA 3HKZN 5IP6A 1ZR4A 2FX0A 2NOGA 4D5CA 3GTOJ 2JK3A 3GBGA 2AHQA 2DA3A 2VPRA 1FTZA 3Q0UA 1ITYA 3BG3A 5BNGA 4QTRA 3RQIA 3ZQIA 5F0CA 3BR3A 3MVPA 4FCYA 3S16J 5J3LA 3GTKJ 3LSRA 2EQRA 2Y30A 5J1RA 3JRGA 4A3EJ 1I3QJ 1Z77A 1YRNB 1IC8A 1RR7A 1MSFC 2CUEA 4M3EA 2CRGA 3BQZA 1GV5A 1JKRC 3JRDA 4A3MJ 5F27A 2HOSA 3S1NJ 2E2JJ 4A3CJ 1JTXA 1JKOC 1IDYA 1Q1VA 3S1MJ 2DA7A 5HODA 3SFIA 2Y0SN 5K7HA 2WAQN 3BR0A 1TWCJ 3ZQHA 1JUSA 1DU6A 1UMQA 1BL0A 3DEWA 4S0HB 3OIOA 3S14J 4IHVA 1JJ6C 5FKLA 2EZKA 2MW8A 2DMQA 3O8GA 1ZTRA 5IP7J 1WH5A 3S17J 1F43A 5EEAA 2XRLA 2RAEA 1POGA 3Q3SA 4JX4A 4DYCA 4AYBN 3HOVJ 1WGXA 4BKXA 2MG4A 1F36A 1U8BA 4IHWA 1RESA 1WH7A 1NK2P 1AHDP 1H89C 1BW6A 4ABZA 1BJZA 2JA5J 4UUSB 3BTCA 1HF0A 1JUMA 3H3VK 3TW7A 2M8GX 2IEKA 2HOTA 1JT6A 1H88C 2GM4A 1TWFJ 1I6HJ 2B63J 3TP0A 2FD5A 2LD5A 3LSJA 2M0CA 3HGGA 2ID3A 1XC5A 3CQZJ 1JUPA 5C3EJ 1GUUA 3HBLA 5GPAA 1GVDA 4A3LJ 3IH2A 2R7ZJ 2ECCA 4B1RA 1ZR2A 2AO9A 4FE7A 3GTQJ 5EG0B 3FKIJ 3MN2A 4DZJA 1ETKA 1ETQA 1ZQ3P 3MKLA 4IHXA 3BTIA 3JRFA 5FJ8J 3HM5A 4MFEA 1U78A 2Y2ZA 1UHSA 4J19A 1IUFA 3TP3A 1B8IB 2L7MP 3NARA 3A01B 2CJJA 4M6VA 1UG2A 5F1JA 2M34A 1QRYA 2L7FP 1WCMJ 5M3MJ 5FKOA 2TRTA 1B8IA 1LE8A 3A01A 3FK6A 5J1YA 1VFCA 1MSEC 4FISA 4JP0A 1ETYA 3FK7A 1IGNA 1OCPA 2DJNA 4XK4A 3JRCA 4BBRJ 2DA1A 4EEFG 2L9RA 2XGEA 1GT0C 5FLMJ 5C4XJ 2LY9A 2QF7A 1SANA 3PM1A 2ECBA 2K40A 3IV5A 1XS9A 2QCOA 4A3IJ 2P81A 2L0KA 3ZQLA 2EH3A 2DA6A 5EG0A 1K61A 4IEJA 2JJ7A 4CYCA 4QSHA 4BBSJ 4Y52J 2R0QC 5E3OA 3HOYJ 5E3MA 4A3FJ 4A3GJ 2X48A 3UKGA 3F0CA 4MO7A 4A3JJ 4V2GA 3BR1A 4CYCB 2O9LA 1HCRA 5C4JJ 2DA4A 3PO3J 4MIMA 4BXXJ 2VKVA 3JRHA 3BR2A 2LKXA 4D7NA 4X6AJ 1LE8B 1FIPA 1JT0A 3LSPA 3HEFA 4V2FA 1HDPA 2WV1A 1JJ8C 2X6OA 5J1UA 1MBKA 2XGCA 1T56A 1G2HA 2M9HA 4MLOA 1JTYA 4A69C 4XRSA 5FLVA 3HGYA 1Y1WJ 3H0GJ 5FKNA 3TW6A 2XSDC 2XPWA 4D7MA 2E1OA 2HI3A 2OF7A 3TEDA 3SJMA 1H8AC 4DW6A 1NK3P 1IV6A 4D5FA 2DA2A 4C2MJ 5M5YJ 3I4NJ 2XPVA 1PUFB 3HOXJ 3BTLA 3S15J 2R5YB 5IOZA 2ELKA 2JN6A 2K9NA 2OPTA 3BR5A 1IRZA 3GTGJ 2YU9J 2CUFA 1ZKGA 3GTJJ 5IPAA 3ZQCA 3FIWA 4FTHA 2R5YA 2ZB9A 5K7ZA 2K9QA 4A3BJ 2VUMJ 5FKMA 2KDZA 3DCFA 2IBDA 3ZOBA 1MBEA 2PMZN 3OSFA 1IJWC 1X2MA 5M5XJ 4X1EA 2X9DA 4LOCA 5EGOB 5FKKA 2HXIA 5EYRA 1E3OC 4RDUA 5F0FA 4JYKA 4XRMA 3C2BA 1X2NA 2COBA 3S1RJ 3G1OA 3VPRA 1A5JA 2NS8A 1ETOA 2Y9ZA 3I4MJ 5EDNA 1RKTA 2Y31A 3W6VA 2CQXA 3O8HA 2LK2A 1GV2A 2K9SA 2ID6A 2LP0A 2E2HJ 4M3FA 3BR6A 1X58A 1RKWA 2VKEA 3FISA 1OFCX 2JA7J 4W97A 9ANTA 5GP9A 1IG7A 1PUFA 2E19A 2JWTA 1MH4A 1MH3A 5IP9J 3HOWJ 2L7ZA 2NS7A 1ETWA 3HB9A 3JRIA 2IAIA 2ME0A 1TWAJ 1LFBA 3JRAA 2M2EA 3RKQA 2R93J 2DN0A 1R9TJ 3WHBA 3ZQFA 4JX6A 3JRBA 3G1LA 3BG5A 2G0EA 3PO2J 4AC0A 1B72A
chains in the Genus database with same CATH superfamily
3R4KA 3SYTA 2RN7A 3HZJA 3TDUC 2WTEA 4G6TB 2MD0A 3IH3A 4HSTA 1UHMA 4OAZA 4M9ZA 1KQ8A 4XR6A 4MTDA 2CMPA 3CJQB 1M1EB 2OU2A 3BTJA 3B6CA 2ME6A 2CUJA 4A0YA 5DM6F 3LA2A 3GFIA 4E7JA 2DFEA 1TTYA 4KIGA 3MD2A 2DA5A 3K6GA 2GBYA 4A93J 4LJZF 2NVXJ 1Z9CA 2VT3A 4RGXA 2KISA 2OA4A 4NDLA 1SFOJ 4BNCA 4I76A 2HKXA 4Y15A 2MABA 4P5OA 1PP8F 3T8TA 1GLNA 1I6XA 1YW7A 1R36A 3QPHA 2Z16A 4II3A 4NC8A 5JVGF 4G7HF 4ZZDA 1J75A 4OIPF 2EBIA 3I58A 2TCTA 1W7PD 4YRVA 3CMYA 2KL4A 3BQYA 2QKMB 1FY7A 1T38A 4HF1A 4BEHB 1W36C 2YUSA 4IHSA 1VF9A 1MIJA 3HDDA 1RC9A 1MNEA 4N9IA 4G9YA 4HNVA 1TL8A 2E7XA 4PZJA 1ZGWA 2W48A 2MGQA 5HVQC 3WTXC 3GTMJ 1CF7B 2W24A 1K4SA 4LB6B 3J7AO 4PJLA 3WTZA 4A5NA 2OCCH 1EV7A 4MTEA 2PEXA 3GZNB 4NQWA 4OU0A 1P7JA 4FHTA 3KZZA 1FBUA 1BR1A 2HQ5A 2LNBA 1A6IA 4IKFA 2CQ7A 2JUCA 3M9AA 1WJDA 3HJEA 4XIDA 3LOCA 3F8FA 4BACA 3WE3A 4MHGA 4HLYA 1O3QA 4B09A 3K4LA 2EZLA 2KT0A 1T33A 5ILVA 1I5ZA 3E7LA 1U9OA 2EFQA 3GMEA 4RB3C 2XB5A 1WI3A 3K2AA 1CGPA 1NG6A 1MGTA 3ZXSA 4A0XA 3H3UA 5CPRB 2IA0A 2R4GA 1YX3A 1VNDA 3BG9A 1MBHA 1OMIA 1R4NB 1KONA 4AYBA 2IT0A 2STWA 3E3VA 2OTJI 3K1MA 4IRGA 1P92A 4BXFA 4RA2A 2Y0MA 4P9FA 3B73A 2X4HA 5B5EC 4NHJA 2HXOA 1OCZH 3TMOA 3R0AA 1IO2A 3COAC 4Y33A 2HKOA 4EJUA 3JAMK 1FZPB 2KDOA 4C3IJ 2R7FA 4I7HA 3UR3C 4IRIA 4ANJA 1FSEA 3J80Z 2DMNA 1T0FA 2HOEA 2ZJPF 1MNMC 3NAUA 2LKPA 1O3SA 3HUGA 2EV5A 4A2UA 1SFEA 3OOUA 1DU0A 2QLZA 3H36A 3TGNA 2LR8A 3E1SA 2AXTC 5F64A 1EA3A 1KYWA 3VYSB 5GPCA 3IAM2 3Q9SA 1E0EA 3RKXA 5IT9Z 1R23A 4M9XA 1WVRA 2VC0A 2WB1N 3V7SA 2YSRA 3IP4B 4IHYA 1OJLA 2P4WA 1S7OA 5ILSA 2ZFUA 2M5WA 2CW7A 4HV5A 2LFBA 5K7FA 5KVRA 4XNFA 3FXUA 2OZUA 1APLC 2ZMEC 5IP6A 5EEHA 1W4MA 2PMZA 1AA7A 2BV6A 2FRHA 2P0WA 3DPTA 1YS7A 1YG2A 4PGHA 4BQNA 1ITYA 3ZMSA 2F5FA 3RQIA 5LGNA 3ZQIA 3TKYA 1HBXG 3C3WA 3CDHA 4FCYA 2IVMA 3GTKJ 1WHUA 3KP2A 2EV0A 2VJIA 3LSRA 2JVHA 4C2UA 3AG1H 2XGXA 4U7BA 1IC8A 1ZH5A 5A2QK 1MSFC 4CCLA 4XKBA 4MGRA 2VONA 4EQQA 2D1VA 3MFKA 1FOKA 3H0DA 5K5RA 1JKRC 3JRDA 3E6BA 2DT6A 5BPIA 3S1NJ 2E2JJ 1JTXA 1JKOC 1DUXC 2Z99A 2DA7A 3CC7I 3HC7A 3KLOA 3SFIA 3SEZA 2VLAA 1O3RA 2XAFA 1TWCJ 2KIMA 4ENNA 1UMQA 3DEWA 3GZ5A 3V4GA 3IRRA 4M71A 2DLLA 3S14J 1ZRFA 1B59A 3CUQA 1JJ6C 2MW8A 2WY8Q 1UHWA 2L4MA 2HQNA 4M72A 4B47A 5IP7J 1X19A 4P55A 2XRLA 2K02A 4RM3A 3J80K 1KQ9A 1R6RA 4BQOA 2VQCA 3D5LA 3S3NA 1YITI 1WGXA 1F36A 2R7DA 1U8BA 1RESA 5D6FA 2ZJ2A 3FMQA 3GW2A 3LSIA 1NK2P 2O6GE 1BW6A 4ABZA 1BJZA 4P96A 2KIUA 2QQBA 2ACJA 2O5RA 3RYRA 1GXPA 2M8GX 2HOTA 1JT6A 1Z3YA 1TWFJ 2R7SA 4ZYEA 1U0JA 1X3UA 5D5WB 2FBKA 3LSJA 5D4SA 2LD5A 2LYCA 3L09A 3L2CA 3DFGA 2DPDA 1IN4A 1OLTA 1GVDA 3ESWB 5FLXK 1UJ8A 4A3LJ 2WAFA 3O3KA 1S3JA 4FE7A 3OYIA 1Y6IA 5E1WA 1ETKA 5ICGA 3DQVC 4BJTA 1TW2A 1FNNA 3BTIA 4ZZLA 4M73A 3ONQA 1GHCA 4FT8A 2LF7A 3HRMA 2GQQA 1H9TA 1A6QA 2K85A 3S93A 3A01B 1ZLKA 4A0ZA 4JQFA 2PJRA 2O8XA 4XKWA 2KZVA 4HW0A 5FKOA 1K6OA 2MFZA 2BGCA 5HDKA 1DP7P 2GWRA 2K3PA 1MJ9A 1MSEC 2UXXA 2L9SA 3NQOA 1JGSA 1VTNC 3QWLA 2DYSH 4DOZA 1IGNA 1RR8C 1HKQA 4XK4A 3GWZA 3OL3A 4BHBA 2L9RA 3KLNA 3HOTA 1Y56A 2NXNB 2LY9A 2VE8A 4GYGA 1IUYA 1SANA 1IXCA 4II2A 2FSWA 4HNUA 2XAGA 4L9NA 3TQNA 4A3IJ 2P81A 2OC6A 3MMYB 3H9QA 4LK0F 4BHPA 2LREA 3MZYA 2JJ7A 1OPCA 4BBSJ 1SFKA 3NWTA 4A3FJ 3N97A 2KLOA 3V7CA 2LDUA 2STTA 2EINH 4MO7A 4CHUA 3I9V2 2OBPA 2P8TA 2XROA 1FYLA 2O9LA 5JI6A 3NEUA 2DA4A 4HF0A 4BXXJ 2F6CA 4LIVA 2K5CA 3F8CA 2WAEA 1QZEA 1BIBA 1XGOA 4D7NA 1KU9A 5B3SH 3L2WA 1FIPA 3FBIB 3ECOA 1OYIA 2L54A 3F8BA 1G4DA 2NOJB 1SC7A 4R8HA 3P5JA 3U21A 4A6DA 4R79A 3F23A 2M9HA 5FLVA 1FP2A 2PG4A 3H0GJ 2XPWA 2E36A 4BGDA 2XIGA 3TOAA 2ZNYA 1NK3P 2L9VA 3GX4X 4F55A 1HSTA 2YX7A 3FX3A 2XPVA 1D1AA 1YQAA 4ESBA 2K4BA 3BTLA 2BW3A 4UV9A 2KHMA 3ELKA 2JN6A 2XRNA 2RKHA 3M8JA 4EM1A 2HDWA 3LL7A 3NWSA 4GCVA 4BE1A 5LGTA 5KAFC 3GTGJ 2M4KA 4Y4RA 2M3AA 3GUDA 5FFZA 2LSOA 2CUFA 1XGNA 4KICA 3WGGA 5HNHA 2ZXIA 3ZR8X 3FIWA 1ULYA 1MMDA 3JTGA 2R5YA 4NB5A 3FXLA 2DAOA 3ZP5A 1TQMA 3EUHC 3GXOA 2EWNA 3HKZA 2VE9A 1BOAA 1SEUA 4N0BA 3OYMA 2EK5A 1ON2A 2X9DA 2P6SA 4IF4A 1SFXA 1VZ0A 5K5QA 4G7OF 5EGOB 1T0FC 5FKKA 5D5VB 5EYRA 1K78A 2UZKA 3TO7A 5LHHA 4RDUA 5F0FA 4YFKF 4JYKA 1AOYA 2F5CA 1WJAA 4O5VA 1V4RA 2NS8A 2Y9ZA 4CXFA 4HRIA 1UAAA 3WGHA 2EJRA 3T0YA 3OYDA 3W3CA 3QPTA 3LSKA 1FBQA 2MLGA 3PNTA 1BJAA 2XF7A 1GV2A 2K9SA 2V1UA 2PFBA 3BR6A 3U1DA 3FISA 2VKEA 4BH9A 9ANTA 3SZGA 4CA0A 2K86A 2PBIA 3ISPA 1D3YA 3PUFA 3HG9A 3HUGB 2H94A 5IP9J 5FRMA 2X6YA 3HB9A 2KQRA 4ZYDA 4E6KG 3U1KA 1I3AA 1C0WA 1PUEE 2HNHA 3WTVC 3JRAA 2M2EA 1QGPA 2KKOA 2F2EA 5CYVA 1F5TA 3ZQFA 1KGSA 1XSVA 2CQNA 3JRBA 3G1LA 2COMA 3CP2A 2QUFA 4I99C 1MMGA 1K78B 5HNFA 1R4MB 4AVPA 1B72A 2W57A 4CCKA 4ASNA 4IPAA 3IWZA 2H1KA 2JSCA 2XGDA 2MH2A 4UUTA 4Y7NJ 1FYMA 2XAJA 2L4AA 3AAFA 5D4RA 1WPKA 1ZK8A 5J4VA 3HOZJ 2FNAA 1U9NA 3Q0VA 1ENHA 5IYBJ 2BZTA 3GTLJ 1TNSA 3F6OA 5D5XB 3GFMA 1ETVA 4CYDA 1HSJA 3K4KA 3MKWB 2X0LA 3M07A 3ZN1A 1YFHA 5AONA 1AKHA 3HSFA 5HDGA 4M3BA 2XC7A 2DMTA 4X0GA 1EKEA 1ONVA 2LLKA 1SMTA 4HX7A 3IL2A 1MKMA 4B43A 1A04A 5DS9A 5F08A 2M7BA 4RB0A 2EFPA 2ZFWA 3HIFA 1TT0A 2JZYA 4B3AA 5E3LA 1G59A 3VOEA 3PUBA 4MQ9F 4JX5A 1XTAA 3K0LA 2CW8A 1V5GA 4HA8A 2AXLA 4XICA 3LFKA 3S2WA 1MBFA 3CDIA 3CMAI 2GIVA 4MFDA 4BXUA 4W1UA 4WCGA 1LPQA 2HQAA 1ZGJA 3J81Z 4C3JJ 3HOUJ 2X6XA 2DTZA 5FFXA 1XDSA 2DT5A 2E1MC 2V7FA 3AFHA 4HQMA 4M3DA 2VJ5A 1O3TA 3D1NI 5GAHJ 3QYEA 2IPQX 1LEBA 3H5NA 1B6AA 1IN5A 3KETA 3Q0WA 2ZBKA 2D5VA 2O3FA 2IGKA 4YFXF 4BEHA 3F6VA 4IQJA 2HU9A 3WTWC 2LKSA 1FOXA 1VQNI 1KZHA 2VBWA 4QPOA 5L3FA 5HLGA 4CDGA 2A68F 4O6JA 3M8FA 5J8CA 4XLCA 2ELJA 2RDPA 1L3LA 2L01A 2CU7A 1IRFA 3CCQI 4C3HJ 4DYQA 1D0ZA 1MNDA 3K4MA 5CLSA 4OWRB 3G1MA 4B4CA 3S2DJ 4GFBA 1ACIA 1U3EM 2E2IJ 3MKZA 2M4GA 3H5RA 3RQ4A 3M1EA 3RKYA 3OR1C 4BDYA 2LG4A 4L5EA 1LDDA 1I50J 4WX9A 1TP4A 2MH9A 2YPRA 3QAHA 3CD6I 4WXDA 4UVAA 1MW7A 3GFLA 2DBBA 4DZPA 3T8RA 2L02A 1RPWA 3S1QJ 2FJ1A 2BYVE 4FE4A 1P6RA 4OAYA 5CQEA 4ZDPA 5LEJA 3OS2A 4MNUA 3A03A 5HDNA 2HDDA 1SVLA 3Q9VA 4XL9A 1FOYA 3ABTA 3BPXA 2CO5A 4IJAA 4B44A 4DBQA 1V55H 5LEKA 2BOLA 2RQQA 1ZRDA 3IH4A 1RETA 5E20A 3HHGA 3EUHA 2Y9YA 4OMZA 2BHZA 4ZYHA 5H20A 1HC8A 4HQEA 1N75A 1JKPC 3CF2A 3OV8A 2ISYA 3H35A 1HDDC 1ZELA 2HS5A 2MBFA 3N4MA 4XBFA 5J47A 1WJ5A 2JVGA 1IXRC 4E7LA 5EZGA 4BY1J 2L2OA 2VI6A 3CMEI 3BC8A 2BHYA 5D6EA 2JA6J 3DKXA 2UUZA 5LFAA 1V5FA 4KFCA 2O8KA 3FWEA 3BDDA 4H4KC 5EZHA 5F0HA 4XOPA 2JPCA 2KFDA 2NOGA 2Q8KA 3GTOJ 1G3WA 4F92B 3WU0A 2DQLA 2AHQA 2BY0A 2DA3A 3KIOA 4K2EA 5DD8A 1RUNA 5BNGA 4U0WA 1QBJA 3DU5A 2K7LA 3OR2C 3ABMH 2F48A 1FX7A 5L3GA 2FOKA 1T08B 5J1RA 3BJAA 3WTSC 1W5TA 2IRFG 2GA2A 1RR7A 1R5ID 2BY1A 1LNWA 2PLYA 1QO0D 2QSGX 3DEEA 4M6YA 4M3EA 1VQKI 4PJJA 2HVRA 4LIUA 1GV5A 2V9VA 3DEUA 2JA2A 3W6JB 2HOSA 1S5LC 1IDYA 1Q1VA 2XUBA 5K7HA 2BE5F 1XB4A 4XLNF 4S0HB 4BL0B 5EJCA 2L3DA 3OIOA 5FKLA 2KJBA 1SAXA 3LQQA 2DW4A 1W5SA 2X1DA 3K4JA 3S17J 5EEAA 1F43A 3ZRGA 4TV7A 2Q0OA 1N77A 4MEYF 2RAEA 2VKDA 2RQPA 1T2KA 3LA3A 4AYBN 3L9FA 2A69F 3DXJF 1SAUA 4NC6A 2V1XA 1USTA 4EJTA 2BBYA 3VODA 1BI2A 1H89C 4UHTA 4UUSB 4QPQA 2V79A 3CCEI 2IGOA 2GAUA 3PSIA 1HF0A 4LLNA 3G73A 4N9HA 1QZZA 1XN7A 2IEKA 3CMMA 4HLXA 4KN4X 1USSA 1IAWA 3KP3A 2FD5A 2B63J 2QEXI 1D1BA 3IKTA 1YLFA 4I09A 2EA2A 3CQZJ 4XSZF 5C3EJ 2A61A 2C6YA 1GUUA 1K4TA 5CKTA 2EFOA 2ECCA 4AWXB 3CUOA 4B1RA 1ZR2A 2AO9A 2ETHA 2ZSIB 5EG0B 1P9QC 3SZPA 1XPXA 1ZQ3P 3MKLA 3ZPLA 3HM5A 3E6MA 1DGRM 1T8IA 2BEOA 3E97A 3LQRA 2RC4A 5FLXZ 3LAJA 2CW0F 3ABLH 3DBLB 2QGUA 4J19A 1FYKA 4U88A 4V19K 4KYWA 2L7MP 3NARA 4YEJA 1OCOH 4M6VA 4PFOA 5F1JA 1HXDA 1T98A 2FMLA 1RUOA 5M3MJ 1PYVA 3QU3A 2TRTA 1I1SA 1D0YA 2A6EF 1B8IA 3A01A 2XSJC 1WI9A 4KJZA 2P5VA 4BUPA 1U5TC 4JOMA 4JP0A 3ZMVA 5CVRA 1OCPA 2IXSA 2DK8A 1GVJA 1S8NA 1Z1DA 4GGGA 5J8FA 1G3TA 2KRCA 4BBRJ 2DA1A 5HLIA 2R3SA 1D8KA 4U0YA 3UNGC 3I55I 4I98B 3W2WA 3MCZA 3FKJA 5C4XJ 2QF7A 1X1DA 2EFNA 2BVMA 2ECBA 2VIXA 3KPHA 3IV5A 3K4CA 1XS9A 5DYMA 2QCOA 3QP6A 2P7VB 3DKWA 2KRFA 4Q4ZF 3F72A 4IEJA 1TQPA 3V8KA 4F3QA 2FUG2 1WZ2A 3R61A 4HAMA 4Y52J 2W1OA 3HXLA 3CLOA 4E70A 2O03A 3HOYJ 2VXZA 3W2AA 2DOAA 5E3MA 4EV0A 4G6QA 3N05A 1ZREA 2Z2SB 3AG4H 1QNTA 3DTIA 3VYTB 1OCRH 4CYCB 4RAYA 3H1CA 3E6CC 3JSPA 1D5VA 3DKYA 5C4JJ 5DDGA 2LF8A 1ON1A 3RSNA 2P7CB 2HWVA 2VKVA 2ICWG 4O3MA 4AIHA 3FMRA 1LE8B 1V54H 1MD0A 4UNOA 3K2ZA 4KT6A 1LEAA 4PDKA 4LFUA 5HOOA 2P5LC 1X4PA 1OYWA 4PK4A 2WV1A 1JJ8C 3PNVA 1MBKA 5CVIA 1T56A 5FGMA 4L0YB 4A69C 4XRSA 3TW6A 4XLAA 3BROA 3M8EA 2XSDC 1QU3A 1P2FA 2M0MA 1Z91A 2XAUA 5BS6A 2CV2A 2UV1A 3ZCOA 1IV6A 2R7WA 4D1QA 3M1CA 2VQGA 3CUQB 5M5YJ 4IO9F 1GXQA 2PX9A 3PL8A 1RRJA 5FRNA 1X3WB 2VBXA 3PNYA 3S15J 4B8XA 3EETA 2E5ZA 2ELKA 3F8MA 5HS9A 1IRZA 3BR5A 2D1HA 3OS0A 1G3YA 2B7EA 2E1CA 4KUMA 3ERMA 1P4AA 1ZKGA 5IPAA 1WJEA 3CP8A 4IZZA 2DDAA 2E34A 5FKMA 3DCFA 5DCFA 1Z7LA 3ZOBA 4YG2F 4GDFA 4OOIA 5L3EA 3QYFA 2FOWA 4GXOA 2FF4A 2QBYA 2LOOA 2RGVA 4GYIA 4ESFA 1DPUA 3ZMTA 4CZCA 3KP6A 1X2NA 5K1YA 3S1RJ 3SHFA 5B1AH 1XCBA 2FA5A 4PSXA 5L3BA 5EDNA 4MEXF 4FQGA 2Y31A 1ZAOA 1OYYA 3W6VA 2CQXA 3S32A 2JRMA 3O8HA 1SVMA 4M3FA 3PIOF 2HEOA 4OIQF 3PFYA 1RKWA 1OFCX 1YJ9I 4CCMA 2AS5F 1OQYA 2CH0A 1ZG3A 1NH3A 2JWTA 1REPC 4KA4A 2VQHA 3HOWJ 3A2KA 2L7ZA 4A12A 3E5UA 2MD5A 3M7GA 3I59A 2ME0A 5DD4A 3HRTA 2GOXB 1LFBA 3H3ZA 2F4OB 2CFXA 1IRGA 2R93J 4GRIA 5CVJA 4OINF 1EH8A 3REOA 1QQIA 3CCUI 1OR7A 2DTRA 3U9GA 3CJNA 4G8XA 4ZJZA 1STZA 4CCJA 3ZQQA 3FZVA 2G0EA 4RM2A 3T1BA 3WGIA 4J01A 3PO2J 1FC3A 2AQEA 3RZDJ 2LRDA 3ECHA 4BYYA 2A5WA 1QVTA 4EM0B 2WC2A 3S2HJ 3TO9A 2HYGD 1FTTA 1LDKB 2VOPA 2WWYA 4IXAA 1FIAA 2DMUA 1ORKA 4OMYA 3C2GA 1VQ6I 2ESNA 2DJIA 1B4AA 4BAYA 1F4KA 1R1VA 3K1PA 2FBHA 3M3YJ 2R7VA 4XM3A 5E3NA 2QZ8A 3KYDB 2RREA 1OCTC 1DQUA 5BPDA 2NVTJ 3L2VA 4S05A 2GA1A 3SDGA 4XRSG 1FEXA 2OQGA 3M4OJ 2IJLA 2TDXA 1RI7A 5EF6A 4ZC3A 4HPQA 5DUIA 1QPMA 3GVAA 2R92J 2H8RA 3J7AY 1AKHB 1QPIA 2I10A 4RBOA 1IV8A 2H6BA 2XDVA 3TBIA 3U2RA 3WHCA 2IS4A 3PQKA 2YS9A 2VJJA 2H8WA 4DBRA 4AIDA 4XLFA 3SEQA 5J6XA 3H92A 2HPMA 2OUMA 3ASNH 4CCOA 1DP3A 1EH6A 4E7HA 1LVAA 1FP1D 1H9GA 4PUSA 2LTPA 2Y69H 2JT1A 2NVYJ 1MBJA 1O57A 4ZYGA 1XX5A 4C30A 1D5YA 2ZMEA 6PAXA 3H5AA 2IW5A 1BOBA 4AM3A 1Y1VJ 4UUSA 3J81K 2O7OA 1O7LA 1P7IA 1IW7F 3IHUA 5KK1A 3WTYC 3BWGA 1UELB 4Q47A 1K7AA 1AU7A 4IL6C 2RNGA 3VYRB 3FF5A 5GADJ 4QIWN 3BT9A 2JMWA 3JREA 1EF4A 2NNYA 4XLEA 4I6ZA 3A0BC 4FX0A 1ETXA 3IRQA 2NYXA 2BVLA 4EMSA 4Y3OA 2KPMA 4DQ2A 3D5SC 4ZDOA 1WJCA 3CCYA 3RYPA 4C9YA 3HTUA 4F52A 3I71A 4AUXA 4LD5A 5TJJA 2EV6A 3G71I 1HKSA 5D8LB 1ZARA 2WV0A 3VDXA 3F3XA 3HOSA 2LBFA 1S6LA 5IOYA 5IT3A 4ESJA 2GXGA 4PCQA 3ZQ7A 5ERIA 3OSGA 1I1GA 1XSDA 1HKTA 3KCCA 2ZMEB 4UVBA 2GLOA 1ZG1A 1V5EA 1B9NA 1UZCA 4CICA 5IY5H 5D5UB 3QPSA 1J09A 5BQTA 4A3KJ 2N8GA 3GO5A 4I0AA 2WADA 2R5ZA 2R7OA 4N4OB 2H09A 1AWCA 3K9TA 1R1TA 3LSGA 4DYRA 1TW3A 3F22A 1BW5A 2Y75A 2ZXHA 1TC3C 4M3GA 1NTCA 2EIKH 2L7KA 1IDZA 2GXBA 4HSRA 3JSOA 1HOMA 2CWEA 2KZGA 5JLXA 1R22A 4I02A 2XPUA 2PQ8A 3DU6A 3F9KA 5L3CA 1RNLA 4UVCA 2WY7Q 3G2BA 5JLWA 3I5UA 5DTDA 1Y0NA 1W36D 3I64A 1UB9A 2DMPA 1IXSB 2MSYA 2GZWA 3RCOA 2P6TA 2ZC2A 2XVCA 3EQLF 5GAGJ 3HKZN 2DPUA 2JK3A 3SFZA 2V6EA 5TGTA 2VPRA 2E7WA 1WJBA 5JHFA 3Q0UA 2XAQA 4XORA 4BJ6C 4QTRA 3J7ZI 1Z3XA 5F0CA 1F1ZA 2PMHA 3BR3A 3MAJA 3MVPA 4HX4A 1Z6TA 1BR2A 4UB6C 5J3LA 4KIBA 1TNTA 2Y30A 1UCRA 4A3EJ 3BZ6A 1I3QJ 1R71A 1Z77A 4BE2A 1YRNB 2ELHA 3ASOH 2X1EA 4EGYA 5DCMB 5FROA 2IA1A 4BJ5C 3I54A 3OYNA 2Z5UA 2CUEA 3A1YA 3GYHX 3BP8A 3BQZA 3EDPA 5LRRA 4FX4A 5F27A 4A3MJ 4WXHA 4A3CJ 5HODA 1TBXA 4I01A 1Y8RB 2M87A 2IS1A 2KRHA 1VQOI 4RGSA 4XLPF 1A31A 2CYYA 1WSUA 2DOFA 1J2XA 2BXZA 4XRFA 2OQRA 4IHVA 1I27A 2EZKA 2DMQA 1WH5A 2LH9A 2XV4S 3L2UA 5GTHC 1FOWA 2KP6A 2VC1A 2OCEA 3HYIA 2A05A 2K9MA 3ZMUA 1A36A 3HOVJ 4LG0B 2A6HF 2E60A 4BKXA 2FMYA 2VBZA 4IHWA 5DM7F 1TLHB 2H6CA 1WH7A 3WU1B 1YW9A 2ZO4A 3LSHA 5BOXA 4JBAA 2MYSA 3BTCA 2O0YA 2QQ9A 5CVUA 4PJNA 3H3VK 4LLGF 2M45A 5F6FA 3TW7A 3AL0C 5IT9K 1E3PA 1HQCA 1YS6A 2EIMH 1I6HJ 2DO7A 4NBQA 1K6YA 1EH7A 5J4YA 1ZYRF 4ZTJA 4QWQA 3IWFA 3K1NA 4RLQA 3HGGA 3KP5A 1XC5A 3R0JA 4Z6YA 3CCSI 1UG0A 5LD2C 4I2OA 4IHTA 5GPAA 3HBLA 1YJNI 3TOBA 3IH2A 3CZ6A 3FXKA 3P9KA 2F5EA 2OAZA 4PJ0C 4DIQA 2OTLI 4L0ZB 2QQAA 3GTQJ 3FXRA 4ETSA 3FKIJ 3MN2A 4DZJA 1ETQA 3MZHA 5E79C 1X1AA 1JHFA 4L18B 1NHAA 1KU2A 4B3XA 4E4HA 2VKHA 2Y2ZA 4U7DA 1IUFA 3LA7A 1B8IB 1BI3A 5B66C 4UY8I 2CJJA 3IUOA 1VQ5I 1UG2A 4D0PA 2ISZA 1X3ZB 1QRYA 2L7FP 2QVOA 2PJPA 4R1HA 1SFUA 3BCBA 2VODA 1Q1HA 2W25A 1BR4A 4RAFA 4WK8F 1VQPI 3FK6A 2HDCA 5J1YA 2OZ6A 1VFCA 1KA8A 1YI2I 4EJWA 3L00A 4FISA 1ETYA 3C7JA 2DJNA 4KMFA 3A0HC 3GFJA 3P7NA 1VQMI 3JRCA 4WXCA 5E18F 2XAHA 4EEFG 2BY3A 3RKWA 5LGUA 4IOAF 5DCMA 2XASA 3H9JA 3VSKA 1KYZA 1U5TB 4EATA 3OY9A 3PM1A 5HLHA 2K40A 3OYBA 5E1XA 4UXNA 4G6DA 4FETA 2L0KA 5H6QA 3EYIA 1MDMA 2EH3A 2DA6A 2R7TA 1K61A 1LB2A 1LJ9A 2MA3A 4CYCA 1OKRA 2GOMA 1B1BA 4XQFA 1V3FA 5E3OA 2M7AA 1T6SA 2X48A 1Z6RA 1R1UA 2PMUA 3F0CA 4A3JJ 4A6EA 4V2GA 5B1BH 2YR2A 4UB8C 1HCRA 3QODA 3MKYB 3I0TA 4MIMA 3JRHA 2IS6A 3BR2A 3NRVA 2K3FA 1BI0A 2CQKA 1W5CC 4X6AJ 3G4SI 2RVCA 2VT2A 4XONA 2MC3A 5E8GA 3HEFA 1OCCH 1QZYA 3EUKL 2QENA 5ICCA 2CSOA 3CO6C 1HW2A 1IN6A 1G2HA 4MLOA 1FT9A 1JTYA 2DOEA 1MZBA 3HGYA 3CCLI 3VFZA 4D7MA 2E1OA 2HI3A 1IN8A 1PP7U 1H8AC 1LKXA 2KIQA 3E5QA 3KP7A 1FPQA 4U0VA 1DPRA 2DA2A 1KU3A 1R5GA 3CCMI 2QYOA 4AIJA 4AIKA 3QP5A 3VYUB 4C2MJ 3I4NJ 1WJFA 2EPFA 2J5PA 1IN7A 1O7FA 1KU7A 1CF7A 1Y8QB 5K5OA 3HOXJ 3HL2A 4B48A 5E1ZB 1XDUA 3SXYA 5IOZA 2O61A 2FE3A 4ZTFA 1BN5A 2E5NA 1J0RA 2A3SA 4NQWB 4S04A 3OS1A 1YTYA 2YU9J 2YU3A 5LHGA 1JE8A 2X6WA 3GTJJ 3S8PA 2XHKA 4L9VA 2DDBA 4AU7A 5ILUA 2ZB9A 2BXYA 5K7ZA 4HF2A 1E2XA 3GCMA 1R49A 2IBDA 1S9HA 2PMZN 2W85A 4NNJA 4DGWB 5BMZA 1IJWC 5M5XJ 4DNCA 2KMUA 2HZDA 3R60A 1VQ7I 5ED4A 4EM2A 3CCRI 3RI4A 4RS8A 2E1NA 4Q48A 5JVTA 4XRMA 2COBA 2QWWA 3G1OA 3I4MJ 5L3DA 1RKTA 3OYCA 1J7KA 3L2RA 2FXAA 1XMAA 2LK2A 5ICEA 3V42A 1D0XA 2ID6A 3LFUA 4CZZA 5LBQA 2Z3YA 2FU4A 2MC4A 2V9PA 3ULQB 1X58A 1XGMA 2JA7J 5GP9A 3TL4X 3SQNA 2NS0A 1IG7A 3PQJA 1BC8C 1TQIA 1MH4A 2BW3B 1PVEA 4L9JA 1X1CA 3MWMA 1IRXA 2HGCA 2NS7A 1YW8A 2DCEA 3P9CA 4CGZA 1FMVA 2R7RA 4IOCF 2K27A 2IAIA 2NVUB 3OL4A 3GLXA 1VQ8I 3RKQA 1PJRA 1RIOH 2FQ3A 3SDBA 3TO6A 1YHQI 4LG3A 3D5RC 5DV5A 3DPUA 1R9TJ 3WHBA 3WTUC 4JX6A 3IC7A 4ENMA 2OV7A 5DEQA 2R7UA 3CJTB 3CF5F 1ODDA 2HR3A 3E6DA 1P4XA 3C18A 5JR3A 3V7RA 4AC0A 3HHHA 2XB0X 2VOOA 3CCJI 3DLAA 2R7QA 2ZJRF 5F04A 3DWLE 3TDZC 3IAS2 3I3LA 2DODA 2DI3A 1TWHJ 2DFFA 3OYFA 1E17A 2W4SA 2J5OA 1BBYA 1FWZA 1BIAA 2HVSA 3A02A 1GDTA 3FXOA 4FASD 2FQ4A 2CFOA 1XG1A 3FMSA 3PIPF 5M3FJ 2E71A 1EJ9A 1VQLI 2EZIA 1N78A 2EB7A 3I4PA 4IQ4A 4CCNA 1YRNA 2DFIA 1LFPA 3WG9A 2V6CA 3QPLA 2F5DA 4MQVA 1FMWA 3WG7H 4WF2A 3VEPA 1HA8A 2M1BA 5C44J 1ZN2A 4EJVA 2VN2A 2YX4A 2JPBA 1E3HA 3RPQA 5J40A 2DQRA 2Y0SA 2WAQA 3PSFA 3L1PA 4Q5SF 1TWGJ 5HS7A 3GF2A 1W0TA 3KEQA 2ZXWH 4ON0A 1LFUP 5D8KB 3PJRA 1YX5A 3J7YJ 1S7EA 2JTVA 2W84A 2HOAA 1QVUA 1HLVA 2V9KA 2VL8A 3K7AJ 5IYCJ 2JSPA 5M5WJ 2GXAA 3EYYA 5EGOA 4HYEA 2IA2A 1VI0A 4RB2C 3RZOJ 2FEZA 3AKZA 3DF8A 3QQAA 4RGRA 2IS2A 2I5UA 4NC7A 2WBMA 3OIQA 3AG2H 1R00A 3OWTA 1D8JA 1YOVB 3QYBA 2OJED 1YIOA 2BY2A 5FB2A 2F5VA 5H2FC 3CDLA 1O4XA 3WODF 1FSHA 2CQQA 3AL0B 3KP4A 3O2PE 3BOQA 5GAEJ 1LVKA 2NNNA 2W7NA 1XGSA 3R6SA 2PI0A 1R5HA 2IP2A 2QSHX 3HSRA 1G8XA 2E1MB 1Z0XA 1IZ1A 2G9WA 3B02A 1PDNC 3EUAA 4Y17A 1SVOA 3K4BA 3HPGA 4G94A 1JGGA 4LB5A 4A3DJ 2JQ7A 3K70D 2VPLA 2LBFB 2ZJQF 2VJ4A 3CC2I 4BQQA 2DFHA 2JA8J 3MEXA 3FHNA 3GEZA 4KIFA 4NUBA 2EA4A 2M30A 4EGZA 1VQ9I 4D9JA 1LQ1A 1HW5A 2X51A 3FDYA 4IX7A 3ZGKA 2H27A 5CQGA 4XLHA 2NVQJ 3DBHB 1CQTA 3LAPA 5KAIC 3QU6A 1K83J 2V4JC 1BA5A 5FD6A 4UUVA 1B72B 3X2QH 2PJRB 3OYLA 5LRSA 4YIIA 1DDNA 1MBGA 4G12A 3ZQGA 2FBIA 3GLLA 1KQ0A 3JR9A 3LNQA 2GIZA 3ABUA 2MLKA 1JKQC 3ERED 3GTPJ 2EZHA 4ENKA 2R5ZB 5CJ9A 3I59B 1J5YA 3JAMZ 4CUGA 3KZIC 3PFIA 1FJLA 2PN6A 2CG4A 2B0LA 3FM3A 4P1WA 2EIJH 2K9LA 2LVSA 3ROUA 4WWCA 3A4CA 4KMUX 5HS8A 3DBRB 1I39A 4N4NB 5IYDJ 5KHDA 4ITVA 5FD5A 1SD5A 3KEYA 3O6BB 1T95A 2QM3A 2I8DA 1W0UA 4OIOF 4BY7J 2QSFX 1SD7A 4XN3A 1LUJB 1S29A 3B6AA 5KCMA 4HDUA 2E35A 5TRDA 2HYJA 4CSWA 1ZR4A 2FX0A 2KJCA 2F4MB 4D5CA 3GBGA 1W7PA 3BPVA 2CV1A 2HTJA 4L9TA 3HRSA 3OOPA 5EEGA 1FTZA 3BG6A 1YO5C 3BG3A 4BE0A 1J59A 5GTIC 2CGPA 3BY6A 2LY2A 3S16J 3BCAA 3I53A 4PSWA 3JW4A 2Z9OA 2EQRA 3HPHA 5DUKA 3JRGA 3EPZA 4HBLA 1MMSA 2HZTA 4ZYAA 4KN7X 2JRTA 2DU9A 3RIRA 5LLQA 2ZSHB 2DXIA 4HDVA 2G7UA 3ML6A 2CRGA 3BJOA 3W2VA 5LHIA 5AIQA 1QHGA 4RAZA 1ZHFA 4PJMA 3S1MJ 3FHZA 2Z1DA 1YIJI 3V8JA 4AD9A 2ZNZA 2Y0SN 2H1LA 2W82A 2WAQN 3LSMA 3BR0A 4RGUA 3K10A 4OIRF 3ZQHA 4RB1A 1JUSA 1WWXA 4E7IA 1DU6A 1XMKA 4HOBA 5A2QZ 1BL0A 2RV8A 3LWFA 3CO7C 3VWBA 1JI8A 4P9UA 4F93B 3O8GA 1ZTRA 2XKOA 4ZDLA 5FO5A 1HW1A 3GZ6A 3KZYA 1RZ4A 3Q5FA 3OIPA 2B9SA 1POGA 1U2WA 1WRJA 3Q3SA 4JX4A 3FM5A 3OYKA 3E5XA 4M6XA 4DYCA 2UXNA 4ENJA 1W7PB 2MG4A 2V26A 1AHDP 1XMXA 2JA5J 4KDPA 2NRAC 1ZLJA 4YIFA 1JUMA 4LG0A 2V1NA 3DTEA 4C2TA 1H88C 2GM4A 1TZLA 5E8IA 1WFXA 3RPUD 3FXJA 2DT7B 3TP0A 2JUGA 2D2WA 4F7ZA 1K79A 4IRHA 2M0CA 5JFRA 3IKVA 2ID3A 2IGNA 3MQ0A 1JUPA 2CS3A 2OD5A 4LK1F 5F1RA 3OYEA 4L5JA 1XCVA 4RLFA 1UFMA 3RDIA 2R7ZJ 2VQLA 1YJWI 2D45A 4XKVA 1P4WA 2P5KA 3C2HA 4HV6A 2LMDA 4IHXA 1YYVA 3W6KB 3JRFA 5FJ8J 2ZCWA 4E7KA 3JCUC 1N25A 4MFEA 1X1BA 1U78A 4BHCA 5H6RA 1UHSA 1FBSA 4KITB 3E0JB 1R7JA 4YELA 3TP3A 5TISC 3VSLA 1WQ2A 4GO1A 3K69A 4LMYA 3KYLA 4QLCU 2L9NA 4RAGA 2M34A 3ZMZA 1WCMJ 3OYGA 3K4NA 2QBYB 1LE8A 1S72I 2QA4I 3OYJA 4DJAA 1TT5B 3FK7A 4J00A 3DPLC 1T39A 2VBYA 2ZKZA 2QKLB 4HX8A 3OYHA 1U8RA 1U6GA 2XGEA 1GT0C 5FLMJ 3QOEA 2HVQA 4YFNF 2XF6A 3V8LA 4PGGA 5JHUA 1XSXA 4BQAA 3T5XA 3LSTA 4JK1X 3K70C 3L2QA 4LLLA 1IF1A 2Q2EA 3BZKA 3ZQLA 5EG0A 2A5YB 1Z7UA 3DV8A 4QSHA 1U5TA 3G6EI 1OISA 4LITA 1G3SA 2R0QC 3WE2A 3CC4I 3MZ8A 4XKCA 4A3GJ 1OR7C 3CESA 3S3OA 1MDMB 3UKGA 4XOTA 1B9MA 3SZTA 1G6NA 1LDJA 1YE9A 3OYAA 4BDZA 3BR1A 3L7WA 4RMNA 4U87A 3ABKH 1JHHA 1SD4A 2CUZA 1Z21A 1MJAA 2X85A 1MMNA 2Y48A 3OMYA 3PO3J 2HYFA 2VB6A 2K4JA 4BS9A 4L5IA 4A5MA 2LKXA 5ICFA 3FXQA 1S7AA 3DP7A 4E7SA 4PFPA 2EFWA 1DGWY 3CUQC 4LGWA 3CLQA 1L0OC 1JT0A 3LSPA 2LC2A 4EJOA 3KYCB 4V2FA 4CO8A 1R58A 1HDPA 2KIFA 5CVVA 3F21A 3LMMA 2FNPA 2X6OA 4XN0A 2M8EA 5J1UA 1VQ4I 2XGCA 2A07F 1QA6A 5AIPA 4G7ZF 1H0MA 1JXSA 2A6TA 2RNJA 4HG2A 4I0BA 1Y1WJ 5FKNA 3QRFF 2OF7A 3TEDA 2UWMA 2G7HA 3SJMA 2WA0A 4DW6A 3HSEA 4D5FA 1BC7C 1FLIA 2ESHA 2Q2EB 2HTSA 3RTRA 3JTHA 1Y39A 2ADUA 1WKMA 4KT5C 3VB2A 4IVNA 2F4IA 1PUFB 4CH7A 3FXMA 3RJPA 3HRUA 2R5YB 3BZCA 1F9NA 3CJRB 4YIRX 2K9NA 2OPTA 2WB1A 1J9IA 4XSXF 2Q1ZB 3FBNB 3P9IA 3CCVI 3ZQCA 2W00A 4FTHA 1Z67A 5E17F 4F91B 2K9QA 4A3BJ 4KNYA 1Y0UA 4Z2YA 2VUMJ 2KDZA 3OSFA 1MBEA 2HPIA 2QQ8A 1X2MA 4H0EA 1ZRCA 1ERDA 3BLYA 4X1EA 3KX2A 1A35A 3ZMDA 2DYRH 4LOCA 2HXIA 3KEOA 2Z33A 4HEA2 4M9SA 2HFHA 1E3OC 1ZGAA 1NG7A 3S3MA 2XF5A 2EILH 3BJ6A 3C2BA 4AVZA 2HQRA 3HTSB 1A5JA 3VPRA 1ETOA 1X4OA 2IGMA 2L5QA 3AG3H 3KFWX 4XMYA 1D1CA 2LP0A 3I56I 2E2HJ 4KISA 2VASA 4W97A 1XD7A 4ZH4F 1PUFA 4M74A 2E19A 4E7ZA 3BG7A 5KNLA 2CV0A 1SD6A 1BI1A 1MJBA 1MH3A 4EVIA 2R7XA 1BM9A 3D0SA 2XKPA 3DLLF 3DTKA 3CTAA 1ETWA 2AQFA 2NAZA 3RPUA 3JRIA 1Z05A 3ZN0A 4Y13A 1TWAJ 4HZFA 4UV8A 5HLTA 2X1CA 3QOPA 4HNTA 1X1PA 1SMYF 3C1DA 3WU2C 2DK5A 1ZG5A 2VXDA 1QHHD 2DN0A 3F8NA 1W1WE 2LY1A 1MMAA 3KE2A 2V1DA 2ZXJA 3H9GA 3BG5A 4BU2A 3G3ZA 3WTTC
chains in the Genus database with same CATH topology
4CCKA 2XB0X 3RZDJ 2AQEA 2LRDA 3SYTA 2H1KA 4G6TB 3IP4B 2MD0A 2XGDA 1FTTA 1QVTA 3S2HJ 2A5WA 2R7QA 3DLAA 5F04A 4UUTA 4Y7NJ 1LDKB 3DWLE 1MMGA 3I3LA 1FIAA 3IAS2 3IH3A 1TWHJ 1ORKA 2DMUA 3OYFA 2W4SA 3C2GA 4HSTA 1WPKA 1ZK8A 4OAZA 3HOZJ 2HVSA 1U9NA 3A02A 2DJIA 3M3YJ 3Q0VA 1ENHA 4XR6A 5IYBJ 2R7VA 1GDTA 4XM3A 5E3NA 3GTLJ 2FQ4A 2CFOA 4FASD 1XG1A 2RREA 2CMPA 1OCTC 1ETVA 5M3FJ 1DQUA 3CJQB 3K4KA 2EZIA 3BTJA 3RQ4A 3MKWB 2NVTJ 1N78A 1YRNA 4IQ4A 3B6CA 2ME6A 1AKHA 2CUJA 4CCNA 3L2VA 3SDGA 4XRSG 1FEXA 4M3BA 1LFPA 3QPLA 4E7JA 2XC7A 3M4OJ 2DMTA 1FMWA 4X0GA 5EF6A 4ZC3A 1HA8A 4HPQA 2LLKA 3MD2A 2DA5A 5C44J 3K6GA 4B43A 5DS9A 2H8RA 2R92J 2GBYA 5F08A 2M7BA 3J7AY 4A93J 2NVXJ 1AKHB 1QPIA 1TT0A 2I10A 4B3AA 5E3LA 1G59A 4RBOA 2XDVA 2Y0SA 3PUBA 4NDLA 3WHCA 3L1PA 1SFOJ 2WAQA 3PSFA 3TBIA 2YS9A 4JX5A 4I76A 2VJJA 2CW8A 1TWGJ 1V5GA 2MABA 4P5OA 4DBRA 1W0TA 1GLNA 4XLFA 3SEQA 2HPMA 4NC8A 4XICA 2Z16A 4II3A 2OUMA 1MBFA 4CCOA 1DP3A 2EBIA 1LFUP 3PJRA 1YX5A 2TCTA 4MFDA 4E7HA 1S7EA 4BU2A 4W1UA 2HOAA 1QVUA 3CMYA 2HQAA 2KL4A 1HLVA 3BQYA 2LTPA 4C3JJ 3HOUJ 2DTZA 2V9KA 3K7AJ 2QKMB 2VL8A 5IYCJ 5M5WJ 2JSPA 2NVYJ 1MBJA 4M3DA 2E1MC 2V7FA 3AFHA 5EGOA 1VI0A 4BEHB 4C30A 1D5YA 3RZOJ 2VJ5A 1W36C 2YUSA 3AKZA 1VF9A 3QQAA 3D1NI 3QYEA 3H5NA 3HDDA 3H5AA 2IS2A 1BOBA 1MNEA 3Q0WA 4NC7A 1Y1VJ 4UUSA 2D5VA 4HNVA 2WBMA 1ZGWA 3GTMJ 2W48A 2MGQA 5HVQC 3OIQA 2O7OA 1P7IA 2IGKA 3OWTA 3QYBA 4BEHA 2F5VA 4IQJA 3CDLA 1O4XA 1UELB 2HU9A 4PJLA 2CQQA 1AU7A 2RNGA 3VYRB 3AL0B 4QPOA 4RM2A 4QIWN 1LVKA 2W7NA 3BT9A 2JMWA 1P7JA 3JREA 1EF4A 4I6ZA 2ELJA 2CU7A 4XLEA 4XLCA 1BR1A 2HQ5A 1ETXA 4C3HJ 4DYQA 1D0ZA 1G8XA 1Z0XA 1MNDA 2E1MB 3K4MA 1A6IA 4OWRB 4IKFA 3G1MA 4B4CA 4XIDA 4GFBA 3S2DJ 1WJDA 2BVLA 3EUAA 2E2IJ 3LOCA 4YRVA 4BACA 4Y3OA 2KPMA 3MKZA 3D5SC 4ZDOA 1WJCA 1JGGA 3CCYA 2M4GA 3H5RA 3HPGA 3K4BA 2EZLA 4A3DJ 2KT0A 3K4LA 4C9YA 1T33A 2LBFB 2JA8J 2VJ4A 3E7LA 1U9OA 4BQQA 4F52A 3K70D 2XB5A 3OR1C 3FHNA 1WI3A 3K2AA 4L5EA 4AUXA 1NG6A 2LG4A 3ZXSA 4BDYA 4NUBA 5CPRB 1I50J 2R4GA 2VPLA 1YX3A 1VNDA 4D9JA 3BG9A 1MBHA 3VDXA 4AYBA 1KONA 2X51A 3HOSA 2LBFA 3FDYA 2NVQJ 1MW7A 3ZGKA 5IOYA 4XLHA 5CQGA 4DZPA 4IX7A 4BXFA 1CQTA 3OSGA 1RPWA 3S1QJ 2FJ1A 1K83J 4FE4A 2V4JC 1BA5A 5CQEA 4OAYA 4ZDPA 2HXOA 1B72B 3OS2A 2PJRB 3TMOA 3A03A 2GLOA 3OYLA 1V5EA 2HDDA 4PUSA 4XL9A 1MBGA 4Y33A 3QPSA 1J09A 4G12A 4A3KJ 3ZQGA 2KDOA 2N8GA 4C3IJ 4B44A 4DBQA 3UR3C 2R5ZA 2WADA 2BOLA 4ANJA 3MKYB 2DMNA 2RQQA 2R7OA 4N4OB 3JR9A 3IH4A 1RETA 1MNMC 3NAUA 3LSGA 3LNQA 4DYRA 1BW5A 2Y9YA 1TC3C 2ZXHA 3OOUA 4M3GA 1NTCA 1JKQC 1IDZA 1DU0A 2L7KA 3GTPJ 4HSRA 2EZHA 2LR8A 1JKPC 1N75A 3CF2A 3E1SA 1HOMA 2R5ZB 5JLXA 4CUGA 3H35A 1HDDC 1FJLA 1ZELA 1EA3A 2XPUA 5GPCA 3IAM2 4P1WA 3VYSB 3DU6A 2K9LA 2LVSA 3F9KA 1E0EA 1WJ5A 2JVGA 3A4CA 2WB1N 4IHYA 4N4NB 5EZGA 4BY1J 2VI6A 5IYDJ 2L2OA 2WY7Q 1OJLA 5JLWA 3BC8A 5DTDA 3G2BA 4ITVA 5KHDA 2ZFUA 3KEYA 1W36D 1W0UA 2JA6J 1T95A 2DMPA 2CW7A 2I8DA 4BY7J 2UUZA 1V5FA 2LFBA 3DKXA 5LFAA 2O8KA 5K7FA 2MSYA 3RCOA 4XN3A 3B6AA 4XNFA 5KCMA 1APLC 5EZHA 5F0HA 2HYJA 3HKZN 5IP6A 1ZR4A 2FX0A 4H4KC 4XOPA 2NOGA 4D5CA 1AA7A 3GTOJ 2JK3A 2PMZA 3GBGA 4F92B 2P0WA 3DPTA 2CV1A 2V6EA 2AHQA 2DA3A 5TGTA 2VPRA 1FTZA 3BG6A 1WJBA 5JHFA 4BQNA 3Q0UA 1ITYA 3BG3A 5BNGA 4XORA 4BJ6C 4QTRA 3RQIA 4BE0A 3ZQIA 5F0CA 1Z3XA 3DU5A 3OR2C 3BR3A 3MVPA 4FCYA 2LY2A 3S16J 1BR2A 3BCAA 4PSWA 5J3LA 3GTKJ 3LSRA 2EQRA 2VJIA 2Y30A 3HPHA 2JVHA 5J1RA 3JRGA 4A3EJ 3EPZA 4C2UA 1I3QJ 4ZYAA 1Z77A 1YRNB 4U7BA 1IC8A 1RR7A 2X1EA 4BE2A 2ZSHB 5FROA 4BJ5C 1MSFC 3DEEA 3OYNA 2DXIA 2VLAA 2CUEA 4M3EA 4XKBA 4CCLA 3A1YA 4PJJA 4E7LA 2CRGA 2HVRA 3BQZA 1GV5A 4LIUA 3W2VA 1JKRC 3H0DA 3JRDA 1QHGA 2DT6A 4A3MJ 5F27A 2HOSA 3S1NJ 2E2JJ 4A3CJ 1JTXA 2JA2A 1JKOC 1IDYA 1Q1VA 3S1MJ 2DA7A 5HODA 2Z1DA 4PJMA 3HC7A 3SFIA 3SEZA 2Y0SN 5K7HA 2WAQN 2W82A 3LSMA 3BR0A 1TWCJ 3ZQHA 2KRHA 3K10A 4E7IA 1JUSA 2IS1A 1DU6A 1UMQA 1BL0A 3DEWA 4S0HB 4BL0B 3VWBA 1JI8A 3OIOA 3S14J 4IHVA 4F93B 1JJ6C 5FKLA 2EZKA 2MW8A 2DMQA 3O8GA 2WY8Q 1ZTRA 5IP7J 2X1DA 4B47A 4ZDLA 1X19A 1WH5A 2LH9A 3S17J 1F43A 5EEAA 2XRLA 3K4JA 3OIPA 3ZRGA 3L2UA 1N77A 2RAEA 1POGA 3Q3SA 2VKDA 4RM3A 2KP6A 4JX4A 3OYKA 1R6RA 4BQOA 4DYCA 2K9MA 4AYBN 3HOVJ 2VQCA 3D5LA 2E60A 1WGXA 4BKXA 3S3NA 2MG4A 1F36A 1U8BA 4IHWA 1SAUA 1RESA 1WH7A 3LSIA 1NK2P 2V26A 1AHDP 3LSHA 1H89C 1BW6A 4ABZA 1BJZA 2JA5J 4UUSB 2MYSA 4QPQA 3BTCA 4PJNA 1HF0A 1JUMA 3H3VK 2IGOA 2O5RA 2V1NA 3DTEA 3TW7A 2M8GX 3PSIA 4C2TA 2IEKA 2HOTA 3CMMA 3AL0C 1JT6A 1H88C 2GM4A 1TZLA 1Z3YA 1TWFJ 1WFXA 3RPUD 1I6HJ 2B63J 2DT7B 3TP0A 2FD5A 1U0JA 1K6YA 2JUGA 2R7SA 4ZTJA 1D1BA 2LD5A 3LSJA 2LYCA 2M0CA 4RLQA 3HGGA 2ID3A 1XC5A 3CQZJ 2IGNA 5LD2C 1UG0A 1JUPA 2CS3A 3OYEA 5C3EJ 1GUUA 3HBLA 5GPAA 1OLTA 1GVDA 5CKTA 4A3LJ 2WAFA 3IH2A 3CZ6A 4RLFA 2R7ZJ 2ECCA 4B1RA 1ZR2A 2VQLA 4DIQA 2AO9A 2ZSIB 4FE7A 3GTQJ 5EG0B 1Y6IA 3OYIA 3FKIJ 3MN2A 4DZJA 1P9QC 4XKVA 1ETKA 1ETQA 1ZQ3P 1X1AA 3MKLA 3C2HA 3DQVC 4IHXA 3BTIA 4BJTA 3JRFA 5FJ8J 3HM5A 4E7KA 1DGRM 3ONQA 4MFEA 4B3XA 1X1BA 1U78A 2VKHA 4E4HA 2Y2ZA 1UHSA 4J19A 4KITB 3E0JB 1IUFA 4YELA 3TP3A 1B8IB 2L7MP 3NARA 3A01B 4YEJA 3S93A 3VSLA 2CJJA 4M6VA 3IUOA 1UG2A 4PFOA 3KYLA 5F1JA 2L9NA 2M34A 1QRYA 2L7FP 1WCMJ 4JQFA 2PJRA 4CSWA 4XKWA 3OYGA 5M3MJ 1PYVA 5FKOA 2TRTA 2KZVA 1D0YA 3BCBA 2MFZA 1BR4A 3K4NA 1B8IA 1LE8A 3A01A 2XSJC 4KJZA 3FK6A 4BUPA 5J1YA 2K3PA 1VFCA 3OYJA 1MSEC 4DJAA 2L9SA 4JOMA 4FISA 4JP0A 1ETYA 3FK7A 1IGNA 1OCPA 2DJNA 2IXSA 4DOZA 4J00A 3DPLC 2KRCA 4XK4A 3JRCA 4BBRJ 2DA1A 2QKLB 3OL3A 3OYHA 4EEFG 2L9RA 3HOTA 1Y56A 3UNGC 2XGEA 1GT0C 5FLMJ 3W2WA 5C4XJ 3FKJA 3H9JA 2LY9A 3VSKA 2QF7A 1X1DA 3QOEA 1SANA 4EATA 2HVQA 3OY9A 3PM1A 2ECBA 2BVMA 2VIXA 2K40A 4II2A 2XF6A 3IV5A 3K4CA 4HNUA 3OYBA 1XS9A 3K70C 2QCOA 4A3IJ 4FETA 2P81A 2OC6A 2L0KA 3MMYB 3H9QA 3L2QA 3ZQLA 2EH3A 2DA6A 5EG0A 1K61A 4IEJA 2LREA 4F3QA 2R7TA 2FUG2 2JJ7A 4AVZA 4CYCA 4QSHA 2GOMA 4XQFA 4BBSJ 4Y52J 4LITA 2W1OA 3HXLA 2R0QC 5E3OA 3HOYJ 2M7AA 1SFKA 2VXZA 3NWTA 4XKCA 3W2AA 2DOAA 5E3MA 4A3FJ 4A3GJ 1OR7C 3CESA 2X48A 2KLOA 3S3OA 3UKGA 3N05A 4XOTA 2Z2SB 3F0CA 4MO7A 4A3JJ 3I9V2 3DTIA 1YE9A 4V2GA 3VYTB 3BR1A 4CYCB 2O9LA 4RMNA 3OYAA 4BDZA 4U87A 1HCRA 3QODA 3OMYA 5C4JJ 2CUZA 2DA4A 1Z21A 2X85A 3DKYA 3PO3J 4MIMA 1MMNA 3RSNA 4BXXJ 2F6CA 4LIVA 2VB6A 2VKVA 2K5CA 3JRHA 2WAEA 3BR2A 4BS9A 2LKXA 2IS6A 4D7NA 4E7SA 4X6AJ 4PFPA 1LE8B 1DGWY 3L2WA 1FIPA 2X6XA 4XONA 1JT0A 3FBIB 3LSPA 2LC2A 4KT6A 2NOJB 3HEFA 5HOOA 4V2FA 1X4PA 3EUKL 1HDPA 3U21A 4PK4A 2WV1A 4R79A 1JJ8C 2X6OA 3LMMA 5J1UA 3PNVA 1MBKA 4XN0A 2XGCA 1T56A 1G2HA 2M9HA 4MLOA 1JTYA 4A69C 2A6TA 4XRSA 4HG2A 5FLVA 3HGYA 1Y1WJ 3H0GJ 5FKNA 3TW6A 4XLAA 2XSDC 2XPWA 4D7MA 2E1OA 2HI3A 2OF7A 3TEDA 1QU3A 2UWMA 4BGDA 2M0MA 3SJMA 1H8AC 2WA0A 1LKXA 2XAUA 4DW6A 1NK3P 2CV2A 2UV1A 1IV6A 4D5FA 3ZCOA 2DA2A 2R7WA 4D1QA 2Q2EB 4C2MJ 3M1CA 3RTRA 3VYUB 4F55A 2VQGA 5M5YJ 3I4NJ 1WJFA 2XPVA 4J01A 3PL8A 1PUFB 2F4IA 4CH7A 1D1AA 5FRNA 3PNYA 3HOXJ 3HL2A 4B48A 3BTLA 3S15J 2BW3A 2R5YB 5IOZA 2E5ZA 2ELKA 3CJRB 2KHMA 2JN6A 2K9NA 2OPTA 3BR5A 1IRZA 3M8JA 2WB1A 2HDWA 4ZTFA 2E5NA 3LL7A 3NWSA 3OS0A 4NQWB 4BE1A 3OS1A 3GTGJ 2YU9J 2M4KA 4Y4RA 2M3AA 2Q1ZB 2CUFA 3FBNB 5HNHA 2X6WA 1ZKGA 3GTJJ 2ZXIA 3S8PA 3ZR8X 5IPAA 3ZQCA 1WJEA 3FIWA 3CP8A 1MMDA 2W00A 4FTHA 2R5YA 4AU7A 4IZZA 2ZB9A 4F91B 5K7ZA 2K9QA 4A3BJ 3EUHC 2VUMJ 5FKMA 2KDZA 3DCFA 3HKZA 1Z7LA 2IBDA 3ZOBA 1MBEA 2PMZN 3OSFA 1S9HA 1IJWC 1X2MA 2HPIA 3QYFA 4NNJA 4DGWB 5M5XJ 3OYMA 1ERDA 3BLYA 4X1EA 3KX2A 2X9DA 1VZ0A 2KMUA 2HZDA 2LOOA 4LOCA 5EGOB 5FKKA 1T0FC 2HXIA 5EYRA 4HEA2 1E3OC 3S3MA 1NG7A 4RDUA 5F0FA 2XF5A 4CZCA 4JYKA 4XRMA 3C2BA 1WJAA 1X2NA 2COBA 3S1RJ 3G1OA 3VPRA 1A5JA 2NS8A 1ETOA 2Y9ZA 3I4MJ 1X4OA 4PSXA 4HRIA 1UAAA 5EDNA 1RKTA 3OYCA 2Y31A 2IGMA 3W6VA 2L5QA 2CQXA 3S32A 3OYDA 3W3CA 3L2RA 3O8HA 3LSKA 2LK2A 1D1CA 2XF7A 3PNTA 4XMYA 1GV2A 3V42A 2K9SA 1D0XA 2ID6A 3LFUA 2LP0A 2E2HJ 4M3FA 4KISA 3BR6A 2MC4A 2VASA 1X58A 1RKWA 2VKEA 3FISA 1OFCX 2JA7J 3PFYA 4W97A 9ANTA 5GP9A 3SZGA 3TL4X 4CCMA 1IG7A 1PUFA 4CA0A 4E7ZA 2E19A 2CH0A 3BG7A 5KNLA 2CV0A 2JWTA 1MH4A 2BW3B 2R7XA 1MH3A 1X1CA 3HG9A 3HUGB 5IP9J 3HOWJ 1IRXA 2VQHA 3DTKA 2L7ZA 2NS7A 2X6YA 5FRMA 1ETWA 3A2KA 2DCEA 2AQFA 1FMVA 2R7RA 3HB9A 2KQRA 3JRIA 2IAIA 4E6KG 2ME0A 1TWAJ 2GOXB 3OL4A 5HLTA 1LFBA 2X1CA 2HNHA 4HNTA 3JRAA 2M2EA 3RKQA 1PJRA 2R93J 2VXDA 2DN0A 1QHHD 3SDBA 4LG3A 1R9TJ 3D5RC 3DPUA 4GRIA 3WHBA 3ZQFA 4JX6A 1MMAA 2LY1A 2OV7A 2R7UA 3JRBA 3G1LA 3CP2A 4ZJZA 2IS4A 3H9GA 4CCJA 3BG5A 3ZQQA 2G0EA 3PO2J 5HNFA 4AC0A 1B72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XB0 X;  3RZD J;  2H1K A;  2XGD A;  1FTT A;  1QVT A;  3S2H J;  5F04 A;  4UUT A;  4Y7N J;  1FIA A;  3IH3 A;  1TWH J;  1ORK A;  2DMU A;  1WPK A;  1ZK8 A;  3HOZ J;  1U9N A;  3A02 A;  3M3Y J;  3Q0V A;  1ENH A;  5IYB J;  1GDT A;  5E3N A;  3GTL J;  2FQ4 A;  1XG1 A;  1OCT C;  1ETV A;  5M3F J;  2EZI A;  3BTJ A;  2NVT J;  1YRN A;  3B6C A;  2ME6 A;  1AKH A;  3SDG A;  4XRS G;  1FEX A;  4M3B A;  3QPL A;  3M4O J;  2DMT A;  5EF6 A;  2LLK A;  2DA5 A;  5C44 J;  5DS9 A;  2H8R A;  2R92 J;  2GBY A;  5F08 A;  4A93 J;  2NVX J;  1AKH B;  1QPI A;  2I10 A;  4B3A A;  5E3L A;  4RBO A;  4NDL A;  3WHC A;  3L1P A;  1SFO J;  2YS9 A;  4JX5 A;  4I76 A;  1TWG J;  1W0T A;  4XIC A;  1MBF A;  2EBI A;  1LFU P;  2TCT A;  4MFD A;  1S7E A;  4W1U A;  2HOA A;  1QVU A;  3CMY A;  1HLV A;  3BQY A;  2LTP A;  4C3J J;  3HOU J;  2DTZ A;  3K7A J;  5IYC J;  5M5W J;  2NVY J;  1MBJ A;  4M3D A;  5EGO A;  1VI0 A;  1D5Y A;  3RZO J;  2YUS A;  1VF9 A;  3QQA A;  3D1N I;  3HDD A;  3Q0W A;  1Y1V J;  4UUS A;  2D5V A;  4HNV A;  1ZGW A;  3GTM J;  2W48 A;  2MGQ A;  2O7O A;  1P7I A;  3CDL A;  1O4X A;  2CQQ A;  1AU7 A;  4QIW N;  3BT9 A;  2JMW A;  1P7J A;  3JRE A;  1EF4 A;  4I6Z A;  2CU7 A;  2HQ5 A;  1ETX A;  4C3H J;  4DYQ A;  1Z0X A;  1A6I A;  3G1M A;  4B4C A;  4XID A;  4GFB A;  3S2D J;  2E2I J;  3LOC A;  1JGG A;  3CCY A;  2EZL A;  4A3D J;  2KT0 A;  1T33 A;  2JA8 J;  3E7L A;  1U9O A;  2XB5 A;  1WI3 A;  3K2A A;  4L5E A;  4AUX A;  1I50 J;  1VND A;  3BG9 A;  1MBH A;  2NVQ J;  5IOY A;  4DZP A;  1CQT A;  3OSG A;  1RPW A;  3S1Q J;  2FJ1 A;  1K83 J;  4FE4 A;  1BA5 A;  2HXO A;  1B72 B;  3A03 A;  2GLO A;  2HDD A;  1MBG A;  3QPS A;  4G12 A;  4A3K J;  3ZQG A;  2N8G A;  4C3I J;  2R5Z A;  2DMN A;  3JR9 A;  3IH4 A;  1RET A;  1MNM C;  3NAU A;  3LSG A;  3LNQ A;  4DYR A;  1BW5 A;  2Y9Y A;  1TC3 C;  3OOU A;  4M3G A;  1NTC A;  1JKQ C;  1IDZ A;  1DU0 A;  3GTP J;  2EZH A;  2LR8 A;  1JKP C;  1HOM A;  2R5Z B;  5JLX A;  1HDD C;  1FJL A;  2XPU A;  5GPC A;  2LVS A;  2WB1 N;  4IHY A;  5EZG A;  4BY1 J;  2VI6 A;  5IYD J;  1OJL A;  5JLW A;  5DTD A;  1W0U A;  2JA6 J;  2DMP A;  4BY7 J;  2LFB A;  2O8K A;  5K7F A;  2MSY A;  3B6A A;  1APL C;  5EZH A;  5F0H A;  2HYJ A;  3HKZ N;  5IP6 A;  1ZR4 A;  2FX0 A;  2NOG A;  4D5C A;  3GTO J;  2JK3 A;  3GBG A;  2AHQ A;  2DA3 A;  2VPR A;  1FTZ A;  3Q0U A;  1ITY A;  3BG3 A;  5BNG A;  4QTR A;  3RQI A;  3ZQI A;  5F0C A;  3BR3 A;  3MVP A;  4FCY A;  3S16 J;  5J3L A;  3GTK J;  3LSR A;  2EQR A;  2Y30 A;  5J1R A;  3JRG A;  4A3E J;  1I3Q J;  1Z77 A;  1YRN B;  1IC8 A;  1RR7 A;  1MSF C;  2CUE A;  4M3E A;  2CRG A;  3BQZ A;  1GV5 A;  1JKR C;  3JRD A;  4A3M J;  5F27 A;  2HOS A;  3S1N J;  2E2J J;  4A3C J;  1JTX A;  1JKO C;  1IDY A;  1Q1V A;  3S1M J;  2DA7 A;  5HOD A;  3SFI A;  2Y0S N;  5K7H A;  2WAQ N;  3BR0 A;  1TWC J;  3ZQH A;  1JUS A;  1DU6 A;  1UMQ A;  1BL0 A;  3DEW A;  4S0H B;  3OIO A;  3S14 J;  4IHV A;  1JJ6 C;  5FKL A;  2EZK A;  2MW8 A;  2DMQ A;  3O8G A;  1ZTR A;  5IP7 J;  1WH5 A;  3S17 J;  1F43 A;  5EEA A;  2XRL A;  2RAE A;  1POG A;  3Q3S A;  4JX4 A;  4DYC A;  4AYB N;  3HOV J;  1WGX A;  4BKX A;  2MG4 A;  1F36 A;  1U8B A;  4IHW A;  1RES A;  1WH7 A;  1NK2 P;  1AHD P;  1H89 C;  1BW6 A;  4ABZ A;  1BJZ A;  2JA5 J;  4UUS B;  3BTC A;  1HF0 A;  1JUM A;  3H3V K;  3TW7 A;  2M8G X;  2IEK A;  2HOT A;  1JT6 A;  1H88 C;  2GM4 A;  1TWF J;  1I6H J;  2B63 J;  3TP0 A;  2FD5 A;  2LD5 A;  3LSJ A;  2M0C A;  3HGG A;  2ID3 A;  1XC5 A;  3CQZ J;  1JUP A;  5C3E J;  1GUU A;  3HBL A;  5GPA A;  1GVD A;  4A3L J;  3IH2 A;  2R7Z J;  2ECC A;  4B1R A;  1ZR2 A;  2AO9 A;  4FE7 A;  3GTQ J;  5EG0 B;  3FKI J;  3MN2 A;  4DZJ A;  1ETK A;  1ETQ A;  1ZQ3 P;  3MKL A;  4IHX A;  3BTI A;  3JRF A;  5FJ8 J;  3HM5 A;  4MFE A;  1U78 A;  2Y2Z A;  1UHS A;  4J19 A;  1IUF A;  3TP3 A;  1B8I B;  2L7M P;  3NAR A;  3A01 B;  2CJJ A;  4M6V A;  1UG2 A;  5F1J A;  2M34 A;  1QRY A;  2L7F P;  1WCM J;  5M3M J;  5FKO A;  2TRT A;  1B8I A;  1LE8 A;  3A01 A;  3FK6 A;  5J1Y A;  1VFC A;  1MSE C;  4FIS A;  4JP0 A;  1ETY A;  3FK7 A;  1IGN A;  1OCP A;  2DJN A;  4XK4 A;  3JRC A;  4BBR J;  2DA1 A;  4EEF G;  2L9R A;  2XGE A;  1GT0 C;  5FLM J;  5C4X J;  2LY9 A;  2QF7 A;  1SAN A;  3PM1 A;  2ECB A;  2K40 A;  3IV5 A;  1XS9 A;  2QCO A;  4A3I J;  2P81 A;  2L0K A;  3ZQL A;  2EH3 A;  2DA6 A;  5EG0 A;  1K61 A;  4IEJ A;  2JJ7 A;  4CYC A;  4QSH A;  4BBS J;  4Y52 J;  2R0Q C;  5E3O A;  3HOY J;  5E3M A;  4A3F J;  4A3G J;  2X48 A;  3UKG A;  3F0C A;  4MO7 A;  4A3J J;  4V2G A;  3BR1 A;  4CYC B;  2O9L A;  1HCR A;  5C4J J;  2DA4 A;  3PO3 J;  4MIM A;  4BXX J;  2VKV A;  3JRH A;  3BR2 A;  2LKX A;  4D7N A;  4X6A J;  1LE8 B;  1FIP A;  1JT0 A;  3LSP A;  3HEF A;  4V2F A;  1HDP A;  2WV1 A;  1JJ8 C;  2X6O A;  5J1U A;  1MBK A;  2XGC A;  1T56 A;  1G2H A;  2M9H A;  4MLO A;  1JTY A;  4A69 C;  4XRS A;  5FLV A;  3HGY A;  1Y1W J;  3H0G J;  5FKN A;  3TW6 A;  2XSD C;  2XPW A;  4D7M A;  2E1O A;  2HI3 A;  2OF7 A;  3TED A;  3SJM A;  1H8A C;  4DW6 A;  1NK3 P;  1IV6 A;  4D5F A;  2DA2 A;  4C2M J;  5M5Y J;  3I4N J;  2XPV A;  1PUF B;  3HOX J;  3BTL A;  3S15 J;  2R5Y B;  5IOZ A;  2ELK A;  2JN6 A;  2K9N A;  2OPT A;  3BR5 A;  1IRZ A;  3GTG J;  2YU9 J;  2CUF A;  1ZKG A;  3GTJ J;  5IPA A;  3ZQC A;  3FIW A;  4FTH A;  2R5Y A;  2ZB9 A;  5K7Z A;  2K9Q A;  4A3B J;  2VUM J;  5FKM A;  2KDZ A;  3DCF A;  2IBD A;  3ZOB A;  1MBE A;  2PMZ N;  3OSF A;  1IJW C;  1X2M A;  5M5X J;  4X1E A;  2X9D A;  4LOC A;  5EGO B;  5FKK A;  2HXI A;  5EYR A;  1E3O C;  4RDU A;  5F0F A;  4JYK A;  4XRM A;  3C2B A;  1X2N A;  2COB A;  3S1R J;  3G1O A;  3VPR A;  1A5J A;  2NS8 A;  1ETO A;  2Y9Z A;  3I4M J;  5EDN A;  1RKT A;  2Y31 A;  3W6V A;  2CQX A;  3O8H A;  2LK2 A;  1GV2 A;  2K9S A;  2ID6 A;  2LP0 A;  2E2H J;  4M3F A;  3BR6 A;  1X58 A;  1RKW A;  2VKE A;  3FIS A;  1OFC X;  2JA7 J;  4W97 A;  9ANT A;  5GP9 A;  1IG7 A;  1PUF A;  2E19 A;  2JWT A;  1MH4 A;  1MH3 A;  5IP9 J;  3HOW J;  2L7Z A;  2NS7 A;  1ETW A;  3HB9 A;  3JRI A;  2IAI A;  2ME0 A;  1TWA J;  1LFB A;  3JRA A;  2M2E A;  3RKQ A;  2R93 J;  2DN0 A;  1R9T J;  3WHB A;  3ZQF A;  4JX6 A;  3JRB A;  3G1L A;  3BG5 A;  2G0E A;  3PO2 J;  4AC0 A;  1B72 A; 
#chains in the Genus database with same CATH topology
 3R4K A;  3SYT A;  2RN7 A;  3HZJ A;  3TDU C;  2WTE A;  4G6T B;  2MD0 A;  3IH3 A;  4HST A;  1UHM A;  4OAZ A;  4M9Z A;  1KQ8 A;  4XR6 A;  4MTD A;  2CMP A;  3CJQ B;  1M1E B;  2OU2 A;  3BTJ A;  3B6C A;  2ME6 A;  2CUJ A;  4A0Y A;  5DM6 F;  3LA2 A;  3GFI A;  4E7J A;  2DFE A;  1TTY A;  4KIG A;  3MD2 A;  2DA5 A;  3K6G A;  2GBY A;  4A93 J;  4LJZ F;  2NVX J;  1Z9C A;  2VT3 A;  4RGX A;  2KIS A;  2OA4 A;  4NDL A;  1SFO J;  4BNC A;  4I76 A;  2HKX A;  4Y15 A;  2MAB A;  4P5O A;  1PP8 F;  3T8T A;  1GLN A;  1I6X A;  1YW7 A;  1R36 A;  3QPH A;  2Z16 A;  4II3 A;  4NC8 A;  5JVG F;  4G7H F;  4ZZD A;  1J75 A;  4OIP F;  2EBI A;  3I58 A;  2TCT A;  1W7P D;  4YRV A;  3CMY A;  2KL4 A;  3BQY A;  2QKM B;  1FY7 A;  1T38 A;  4HF1 A;  4BEH B;  1W36 C;  2YUS A;  4IHS A;  1VF9 A;  1MIJ A;  3HDD A;  1RC9 A;  1MNE A;  4N9I A;  4G9Y A;  4HNV A;  1TL8 A;  2E7X A;  4PZJ A;  1ZGW A;  2W48 A;  2MGQ A;  5HVQ C;  3WTX C;  3GTM J;  1CF7 B;  2W24 A;  1K4S A;  4LB6 B;  3J7A O;  4PJL A;  3WTZ A;  4A5N A;  2OCC H;  1EV7 A;  4MTE A;  2PEX A;  3GZN B;  4NQW A;  4OU0 A;  1P7J A;  4FHT A;  3KZZ A;  1FBU A;  1BR1 A;  2HQ5 A;  2LNB A;  1A6I A;  4IKF A;  2CQ7 A;  2JUC A;  3M9A A;  1WJD A;  3HJE A;  4XID A;  3LOC A;  3F8F A;  4BAC A;  3WE3 A;  4MHG A;  4HLY A;  1O3Q A;  4B09 A;  3K4L A;  2EZL A;  2KT0 A;  1T33 A;  5ILV A;  1I5Z A;  3E7L A;  1U9O A;  2EFQ A;  3GME A;  4RB3 C;  2XB5 A;  1WI3 A;  3K2A A;  1CGP A;  1NG6 A;  1MGT A;  3ZXS A;  4A0X A;  3H3U A;  5CPR B;  2IA0 A;  2R4G A;  1YX3 A;  1VND A;  3BG9 A;  1MBH A;  1OMI A;  1R4N B;  1KON A;  4AYB A;  2IT0 A;  2STW A;  3E3V A;  2OTJ I;  3K1M A;  4IRG A;  1P92 A;  4BXF A;  4RA2 A;  2Y0M A;  4P9F A;  3B73 A;  2X4H A;  5B5E C;  4NHJ A;  2HXO A;  1OCZ H;  3TMO A;  3R0A A;  1IO2 A;  3COA C;  4Y33 A;  2HKO A;  4EJU A;  3JAM K;  1FZP B;  2KDO A;  4C3I J;  2R7F A;  4I7H A;  3UR3 C;  4IRI A;  4ANJ A;  1FSE A;  3J80 Z;  2DMN A;  1T0F A;  2HOE A;  2ZJP F;  1MNM C;  3NAU A;  2LKP A;  1O3S A;  3HUG A;  2EV5 A;  4A2U A;  1SFE A;  3OOU A;  1DU0 A;  2QLZ A;  3H36 A;  3TGN A;  2LR8 A;  3E1S A;  2AXT C;  5F64 A;  1EA3 A;  1KYW A;  3VYS B;  5GPC A;  3IAM 2;  3Q9S A;  1E0E A;  3RKX A;  5IT9 Z;  1R23 A;  4M9X A;  1WVR A;  2VC0 A;  2WB1 N;  3V7S A;  2YSR A;  3IP4 B;  4IHY A;  1OJL A;  2P4W A;  1S7O A;  5ILS A;  2ZFU A;  2M5W A;  2CW7 A;  4HV5 A;  2LFB A;  5K7F A;  5KVR A;  4XNF A;  3FXU A;  2OZU A;  1APL C;  2ZME C;  5IP6 A;  5EEH A;  1W4M A;  2PMZ A;  1AA7 A;  2BV6 A;  2FRH A;  2P0W A;  3DPT A;  1YS7 A;  1YG2 A;  4PGH A;  4BQN A;  1ITY A;  3ZMS A;  2F5F A;  3RQI A;  5LGN A;  3ZQI A;  3TKY A;  1HBX G;  3C3W A;  3CDH A;  4FCY A;  2IVM A;  3GTK J;  1WHU A;  3KP2 A;  2EV0 A;  2VJI A;  3LSR A;  2JVH A;  4C2U A;  3AG1 H;  2XGX A;  4U7B A;  1IC8 A;  1ZH5 A;  5A2Q K;  1MSF C;  4CCL A;  4XKB A;  4MGR A;  2VON A;  4EQQ A;  2D1V A;  3MFK A;  1FOK A;  3H0D A;  5K5R A;  1JKR C;  3JRD A;  3E6B A;  2DT6 A;  5BPI A;  3S1N J;  2E2J J;  1JTX A;  1JKO C;  1DUX C;  2Z99 A;  2DA7 A;  3CC7 I;  3HC7 A;  3KLO A;  3SFI A;  3SEZ A;  2VLA A;  1O3R A;  2XAF A;  1TWC J;  2KIM A;  4ENN A;  1UMQ A;  3DEW A;  3GZ5 A;  3V4G A;  3IRR A;  4M71 A;  2DLL A;  3S14 J;  1ZRF A;  1B59 A;  3CUQ A;  1JJ6 C;  2MW8 A;  2WY8 Q;  1UHW A;  2L4M A;  2HQN A;  4M72 A;  4B47 A;  5IP7 J;  1X19 A;  4P55 A;  2XRL A;  2K02 A;  4RM3 A;  3J80 K;  1KQ9 A;  1R6R A;  4BQO A;  2VQC A;  3D5L A;  3S3N A;  1YIT I;  1WGX A;  1F36 A;  2R7D A;  1U8B A;  1RES A;  5D6F A;  2ZJ2 A;  3FMQ A;  3GW2 A;  3LSI A;  1NK2 P;  2O6G E;  1BW6 A;  4ABZ A;  1BJZ A;  4P96 A;  2KIU A;  2QQB A;  2ACJ A;  2O5R A;  3RYR A;  1GXP A;  2M8G X;  2HOT A;  1JT6 A;  1Z3Y A;  1TWF J;  2R7S A;  4ZYE A;  1U0J A;  1X3U A;  5D5W B;  2FBK A;  3LSJ A;  5D4S A;  2LD5 A;  2LYC A;  3L09 A;  3L2C A;  3DFG A;  2DPD A;  1IN4 A;  1OLT A;  1GVD A;  3ESW B;  5FLX K;  1UJ8 A;  4A3L J;  2WAF A;  3O3K A;  1S3J A;  4FE7 A;  3OYI A;  1Y6I A;  5E1W A;  1ETK A;  5ICG A;  3DQV C;  4BJT A;  1TW2 A;  1FNN A;  3BTI A;  4ZZL A;  4M73 A;  3ONQ A;  1GHC A;  4FT8 A;  2LF7 A;  3HRM A;  2GQQ A;  1H9T A;  1A6Q A;  2K85 A;  3S93 A;  3A01 B;  1ZLK A;  4A0Z A;  4JQF A;  2PJR A;  2O8X A;  4XKW A;  2KZV A;  4HW0 A;  5FKO A;  1K6O A;  2MFZ A;  2BGC A;  5HDK A;  1DP7 P;  2GWR A;  2K3P A;  1MJ9 A;  1MSE C;  2UXX A;  2L9S A;  3NQO A;  1JGS A;  1VTN C;  3QWL A;  2DYS H;  4DOZ A;  1IGN A;  1RR8 C;  1HKQ A;  4XK4 A;  3GWZ A;  3OL3 A;  4BHB A;  2L9R A;  3KLN A;  3HOT A;  1Y56 A;  2NXN B;  2LY9 A;  2VE8 A;  4GYG A;  1IUY A;  1SAN A;  1IXC A;  4II2 A;  2FSW A;  4HNU A;  2XAG A;  4L9N A;  3TQN A;  4A3I J;  2P81 A;  2OC6 A;  3MMY B;  3H9Q A;  4LK0 F;  4BHP A;  2LRE A;  3MZY A;  2JJ7 A;  1OPC A;  4BBS J;  1SFK A;  3NWT A;  4A3F J;  3N97 A;  2KLO A;  3V7C A;  2LDU A;  2STT A;  2EIN H;  4MO7 A;  4CHU A;  3I9V 2;  2OBP A;  2P8T A;  2XRO A;  1FYL A;  2O9L A;  5JI6 A;  3NEU A;  2DA4 A;  4HF0 A;  4BXX J;  2F6C A;  4LIV A;  2K5C A;  3F8C A;  2WAE A;  1QZE A;  1BIB A;  1XGO A;  4D7N A;  1KU9 A;  5B3S H;  3L2W A;  1FIP A;  3FBI B;  3ECO A;  1OYI A;  2L54 A;  3F8B A;  1G4D A;  2NOJ B;  1SC7 A;  4R8H A;  3P5J A;  3U21 A;  4A6D A;  4R79 A;  3F23 A;  2M9H A;  5FLV A;  1FP2 A;  2PG4 A;  3H0G J;  2XPW A;  2E36 A;  4BGD A;  2XIG A;  3TOA A;  2ZNY A;  1NK3 P;  2L9V A;  3GX4 X;  4F55 A;  1HST A;  2YX7 A;  3FX3 A;  2XPV A;  1D1A A;  1YQA A;  4ESB A;  2K4B A;  3BTL A;  2BW3 A;  4UV9 A;  2KHM A;  3ELK A;  2JN6 A;  2XRN A;  2RKH A;  3M8J A;  4EM1 A;  2HDW A;  3LL7 A;  3NWS A;  4GCV A;  4BE1 A;  5LGT A;  5KAF C;  3GTG J;  2M4K A;  4Y4R A;  2M3A A;  3GUD A;  5FFZ A;  2LSO A;  2CUF A;  1XGN A;  4KIC A;  3WGG A;  5HNH A;  2ZXI A;  3ZR8 X;  3FIW A;  1ULY A;  1MMD A;  3JTG A;  2R5Y A;  4NB5 A;  3FXL A;  2DAO A;  3ZP5 A;  1TQM A;  3EUH C;  3GXO A;  2EWN A;  3HKZ A;  2VE9 A;  1BOA A;  1SEU A;  4N0B A;  3OYM A;  2EK5 A;  1ON2 A;  2X9D A;  2P6S A;  4IF4 A;  1SFX A;  1VZ0 A;  5K5Q A;  4G7O F;  5EGO B;  1T0F C;  5FKK A;  5D5V B;  5EYR A;  1K78 A;  2UZK A;  3TO7 A;  5LHH A;  4RDU A;  5F0F A;  4YFK F;  4JYK A;  1AOY A;  2F5C A;  1WJA A;  4O5V A;  1V4R A;  2NS8 A;  2Y9Z A;  4CXF A;  4HRI A;  1UAA A;  3WGH A;  2EJR A;  3T0Y A;  3OYD A;  3W3C A;  3QPT A;  3LSK A;  1FBQ A;  2MLG A;  3PNT A;  1BJA A;  2XF7 A;  1GV2 A;  2K9S A;  2V1U A;  2PFB A;  3BR6 A;  3U1D A;  3FIS A;  2VKE A;  4BH9 A;  9ANT A;  3SZG A;  4CA0 A;  2K86 A;  2PBI A;  3ISP A;  1D3Y A;  3PUF A;  3HG9 A;  3HUG B;  2H94 A;  5IP9 J;  5FRM A;  2X6Y A;  3HB9 A;  2KQR A;  4ZYD A;  4E6K G;  3U1K A;  1I3A A;  1C0W A;  1PUE E;  2HNH A;  3WTV C;  3JRA A;  2M2E A;  1QGP A;  2KKO A;  2F2E A;  5CYV A;  1F5T A;  3ZQF A;  1KGS A;  1XSV A;  2CQN A;  3JRB A;  3G1L A;  2COM A;  3CP2 A;  2QUF A;  4I99 C;  1MMG A;  1K78 B;  5HNF A;  1R4M B;  4AVP A;  1B72 A;  2W57 A;  4CCK A;  4ASN A;  4IPA A;  3IWZ A;  2H1K A;  2JSC A;  2XGD A;  2MH2 A;  4UUT A;  4Y7N J;  1FYM A;  2XAJ A;  2L4A A;  3AAF A;  5D4R A;  1WPK A;  1ZK8 A;  5J4V A;  3HOZ J;  2FNA A;  1U9N A;  3Q0V A;  1ENH A;  5IYB J;  2BZT A;  3GTL J;  1TNS A;  3F6O A;  5D5X B;  3GFM A;  1ETV A;  4CYD A;  1HSJ A;  3K4K A;  3MKW B;  2X0L A;  3M07 A;  3ZN1 A;  1YFH A;  5AON A;  1AKH A;  3HSF A;  5HDG A;  4M3B A;  2XC7 A;  2DMT A;  4X0G A;  1EKE A;  1ONV A;  2LLK A;  1SMT A;  4HX7 A;  3IL2 A;  1MKM A;  4B43 A;  1A04 A;  5DS9 A;  5F08 A;  2M7B A;  4RB0 A;  2EFP A;  2ZFW A;  3HIF A;  1TT0 A;  2JZY A;  4B3A A;  5E3L A;  1G59 A;  3VOE A;  3PUB A;  4MQ9 F;  4JX5 A;  1XTA A;  3K0L A;  2CW8 A;  1V5G A;  4HA8 A;  2AXL A;  4XIC A;  3LFK A;  3S2W A;  1MBF A;  3CDI A;  3CMA I;  2GIV A;  4MFD A;  4BXU A;  4W1U A;  4WCG A;  1LPQ A;  2HQA A;  1ZGJ A;  3J81 Z;  4C3J J;  3HOU J;  2X6X A;  2DTZ A;  5FFX A;  1XDS A;  2DT5 A;  2E1M C;  2V7F A;  3AFH A;  4HQM A;  4M3D A;  2VJ5 A;  1O3T A;  3D1N I;  5GAH J;  3QYE A;  2IPQ X;  1LEB A;  3H5N A;  1B6A A;  1IN5 A;  3KET A;  3Q0W A;  2ZBK A;  2D5V A;  2O3F A;  2IGK A;  4YFX F;  4BEH A;  3F6V A;  4IQJ A;  2HU9 A;  3WTW C;  2LKS A;  1FOX A;  1VQN I;  1KZH A;  2VBW A;  4QPO A;  5L3F A;  5HLG A;  4CDG A;  2A68 F;  4O6J A;  3M8F A;  5J8C A;  4XLC A;  2ELJ A;  2RDP A;  1L3L A;  2L01 A;  2CU7 A;  1IRF A;  3CCQ I;  4C3H J;  4DYQ A;  1D0Z A;  1MND A;  3K4M A;  5CLS A;  4OWR B;  3G1M A;  4B4C A;  3S2D J;  4GFB A;  1ACI A;  1U3E M;  2E2I J;  3MKZ A;  2M4G A;  3H5R A;  3RQ4 A;  3M1E A;  3RKY A;  3OR1 C;  4BDY A;  2LG4 A;  4L5E A;  1LDD A;  1I50 J;  4WX9 A;  1TP4 A;  2MH9 A;  2YPR A;  3QAH A;  3CD6 I;  4WXD A;  4UVA A;  1MW7 A;  3GFL A;  2DBB A;  4DZP A;  3T8R A;  2L02 A;  1RPW A;  3S1Q J;  2FJ1 A;  2BYV E;  4FE4 A;  1P6R A;  4OAY A;  5CQE A;  4ZDP A;  5LEJ A;  3OS2 A;  4MNU A;  3A03 A;  5HDN A;  2HDD A;  1SVL A;  3Q9V A;  4XL9 A;  1FOY A;  3ABT A;  3BPX A;  2CO5 A;  4IJA A;  4B44 A;  4DBQ A;  1V55 H;  5LEK A;  2BOL A;  2RQQ A;  1ZRD A;  3IH4 A;  1RET A;  5E20 A;  3HHG A;  3EUH A;  2Y9Y A;  4OMZ A;  2BHZ A;  4ZYH A;  5H20 A;  1HC8 A;  4HQE A;  1N75 A;  1JKP C;  3CF2 A;  3OV8 A;  2ISY A;  3H35 A;  1HDD C;  1ZEL A;  2HS5 A;  2MBF A;  3N4M A;  4XBF A;  5J47 A;  1WJ5 A;  2JVG A;  1IXR C;  4E7L A;  5EZG A;  4BY1 J;  2L2O A;  2VI6 A;  3CME I;  3BC8 A;  2BHY A;  5D6E A;  2JA6 J;  3DKX A;  2UUZ A;  5LFA A;  1V5F A;  4KFC A;  2O8K A;  3FWE A;  3BDD A;  4H4K C;  5EZH A;  5F0H A;  4XOP A;  2JPC A;  2KFD A;  2NOG A;  2Q8K A;  3GTO J;  1G3W A;  4F92 B;  3WU0 A;  2DQL A;  2AHQ A;  2BY0 A;  2DA3 A;  3KIO A;  4K2E A;  5DD8 A;  1RUN A;  5BNG A;  4U0W A;  1QBJ A;  3DU5 A;  2K7L A;  3OR2 C;  3ABM H;  2F48 A;  1FX7 A;  5L3G A;  2FOK A;  1T08 B;  5J1R A;  3BJA A;  3WTS C;  1W5T A;  2IRF G;  2GA2 A;  1RR7 A;  1R5I D;  2BY1 A;  1LNW A;  2PLY A;  1QO0 D;  2QSG X;  3DEE A;  4M6Y A;  4M3E A;  1VQK I;  4PJJ A;  2HVR A;  4LIU A;  1GV5 A;  2V9V A;  3DEU A;  2JA2 A;  3W6J B;  2HOS A;  1S5L C;  1IDY A;  1Q1V A;  2XUB A;  5K7H A;  2BE5 F;  1XB4 A;  4XLN F;  4S0H B;  4BL0 B;  5EJC A;  2L3D A;  3OIO A;  5FKL A;  2KJB A;  1SAX A;  3LQQ A;  2DW4 A;  1W5S A;  2X1D A;  3K4J A;  3S17 J;  5EEA A;  1F43 A;  3ZRG A;  4TV7 A;  2Q0O A;  1N77 A;  4MEY F;  2RAE A;  2VKD A;  2RQP A;  1T2K A;  3LA3 A;  4AYB N;  3L9F A;  2A69 F;  3DXJ F;  1SAU A;  4NC6 A;  2V1X A;  1UST A;  4EJT A;  2BBY A;  3VOD A;  1BI2 A;  1H89 C;  4UHT A;  4UUS B;  4QPQ A;  2V79 A;  3CCE I;  2IGO A;  2GAU A;  3PSI A;  1HF0 A;  4LLN A;  3G73 A;  4N9H A;  1QZZ A;  1XN7 A;  2IEK A;  3CMM A;  4HLX A;  4KN4 X;  1USS A;  1IAW A;  3KP3 A;  2FD5 A;  2B63 J;  2QEX I;  1D1B A;  3IKT A;  1YLF A;  4I09 A;  2EA2 A;  3CQZ J;  4XSZ F;  5C3E J;  2A61 A;  2C6Y A;  1GUU A;  1K4T A;  5CKT A;  2EFO A;  2ECC A;  4AWX B;  3CUO A;  4B1R A;  1ZR2 A;  2AO9 A;  2ETH A;  2ZSI B;  5EG0 B;  1P9Q C;  3SZP A;  1XPX A;  1ZQ3 P;  3MKL A;  3ZPL A;  3HM5 A;  3E6M A;  1DGR M;  1T8I A;  2BEO A;  3E97 A;  3LQR A;  2RC4 A;  5FLX Z;  3LAJ A;  2CW0 F;  3ABL H;  3DBL B;  2QGU A;  4J19 A;  1FYK A;  4U88 A;  4V19 K;  4KYW A;  2L7M P;  3NAR A;  4YEJ A;  1OCO H;  4M6V A;  4PFO A;  5F1J A;  1HXD A;  1T98 A;  2FML A;  1RUO A;  5M3M J;  1PYV A;  3QU3 A;  2TRT A;  1I1S A;  1D0Y A;  2A6E F;  1B8I A;  3A01 A;  2XSJ C;  1WI9 A;  4KJZ A;  2P5V A;  4BUP A;  1U5T C;  4JOM A;  4JP0 A;  3ZMV A;  5CVR A;  1OCP A;  2IXS A;  2DK8 A;  1GVJ A;  1S8N A;  1Z1D A;  4GGG A;  5J8F A;  1G3T A;  2KRC A;  4BBR J;  2DA1 A;  5HLI A;  2R3S A;  1D8K A;  4U0Y A;  3UNG C;  3I55 I;  4I98 B;  3W2W A;  3MCZ A;  3FKJ A;  5C4X J;  2QF7 A;  1X1D A;  2EFN A;  2BVM A;  2ECB A;  2VIX A;  3KPH A;  3IV5 A;  3K4C A;  1XS9 A;  5DYM A;  2QCO A;  3QP6 A;  2P7V B;  3DKW A;  2KRF A;  4Q4Z F;  3F72 A;  4IEJ A;  1TQP A;  3V8K A;  4F3Q A;  2FUG 2;  1WZ2 A;  3R61 A;  4HAM A;  4Y52 J;  2W1O A;  3HXL A;  3CLO A;  4E70 A;  2O03 A;  3HOY J;  2VXZ A;  3W2A A;  2DOA A;  5E3M A;  4EV0 A;  4G6Q A;  3N05 A;  1ZRE A;  2Z2S B;  3AG4 H;  1QNT A;  3DTI A;  3VYT B;  1OCR H;  4CYC B;  4RAY A;  3H1C A;  3E6C C;  3JSP A;  1D5V A;  3DKY A;  5C4J J;  5DDG A;  2LF8 A;  1ON1 A;  3RSN A;  2P7C B;  2HWV A;  2VKV A;  2ICW G;  4O3M A;  4AIH A;  3FMR A;  1LE8 B;  1V54 H;  1MD0 A;  4UNO A;  3K2Z A;  4KT6 A;  1LEA A;  4PDK A;  4LFU A;  5HOO A;  2P5L C;  1X4P A;  1OYW A;  4PK4 A;  2WV1 A;  1JJ8 C;  3PNV A;  1MBK A;  5CVI A;  1T56 A;  5FGM A;  4L0Y B;  4A69 C;  4XRS A;  3TW6 A;  4XLA A;  3BRO A;  3M8E A;  2XSD C;  1QU3 A;  1P2F A;  2M0M A;  1Z91 A;  2XAU A;  5BS6 A;  2CV2 A;  2UV1 A;  3ZCO A;  1IV6 A;  2R7W A;  4D1Q A;  3M1C A;  2VQG A;  3CUQ B;  5M5Y J;  4IO9 F;  1GXQ A;  2PX9 A;  3PL8 A;  1RRJ A;  5FRN A;  1X3W B;  2VBX A;  3PNY A;  3S15 J;  4B8X A;  3EET A;  2E5Z A;  2ELK A;  3F8M A;  5HS9 A;  1IRZ A;  3BR5 A;  2D1H A;  3OS0 A;  1G3Y A;  2B7E A;  2E1C A;  4KUM A;  3ERM A;  1P4A A;  1ZKG A;  5IPA A;  1WJE A;  3CP8 A;  4IZZ A;  2DDA A;  2E34 A;  5FKM A;  3DCF A;  5DCF A;  1Z7L A;  3ZOB A;  4YG2 F;  4GDF A;  4OOI A;  5L3E A;  3QYF A;  2FOW A;  4GXO A;  2FF4 A;  2QBY A;  2LOO A;  2RGV A;  4GYI A;  4ESF A;  1DPU A;  3ZMT A;  4CZC A;  3KP6 A;  1X2N A;  5K1Y A;  3S1R J;  3SHF A;  5B1A H;  1XCB A;  2FA5 A;  4PSX A;  5L3B A;  5EDN A;  4MEX F;  4FQG A;  2Y31 A;  1ZAO A;  1OYY A;  3W6V A;  2CQX A;  3S32 A;  2JRM A;  3O8H A;  1SVM A;  4M3F A;  3PIO F;  2HEO A;  4OIQ F;  3PFY A;  1RKW A;  1OFC X;  1YJ9 I;  4CCM A;  2AS5 F;  1OQY A;  2CH0 A;  1ZG3 A;  1NH3 A;  2JWT A;  1REP C;  4KA4 A;  2VQH A;  3HOW J;  3A2K A;  2L7Z A;  4A12 A;  3E5U A;  2MD5 A;  3M7G A;  3I59 A;  2ME0 A;  5DD4 A;  3HRT A;  2GOX B;  1LFB A;  3H3Z A;  2F4O B;  2CFX A;  1IRG A;  2R93 J;  4GRI A;  5CVJ A;  4OIN F;  1EH8 A;  3REO A;  1QQI A;  3CCU I;  1OR7 A;  2DTR A;  3U9G A;  3CJN A;  4G8X A;  4ZJZ A;  1STZ A;  4CCJ A;  3ZQQ A;  3FZV A;  2G0E A;  4RM2 A;  3T1B A;  3WGI A;  4J01 A;  3PO2 J;  1FC3 A;  2AQE A;  3RZD J;  2LRD A;  3ECH A;  4BYY A;  2A5W A;  1QVT A;  4EM0 B;  2WC2 A;  3S2H J;  3TO9 A;  2HYG D;  1FTT A;  1LDK B;  2VOP A;  2WWY A;  4IXA A;  1FIA A;  2DMU A;  1ORK A;  4OMY A;  3C2G A;  1VQ6 I;  2ESN A;  2DJI A;  1B4A A;  4BAY A;  1F4K A;  1R1V A;  3K1P A;  2FBH A;  3M3Y J;  2R7V A;  4XM3 A;  5E3N A;  2QZ8 A;  3KYD B;  2RRE A;  1OCT C;  1DQU A;  5BPD A;  2NVT J;  3L2V A;  4S05 A;  2GA1 A;  3SDG A;  4XRS G;  1FEX A;  2OQG A;  3M4O J;  2IJL A;  2TDX A;  1RI7 A;  5EF6 A;  4ZC3 A;  4HPQ A;  5DUI A;  1QPM A;  3GVA A;  2R92 J;  2H8R A;  3J7A Y;  1AKH B;  1QPI A;  2I10 A;  4RBO A;  1IV8 A;  2H6B A;  2XDV A;  3TBI A;  3U2R A;  3WHC A;  2IS4 A;  3PQK A;  2YS9 A;  2VJJ A;  2H8W A;  4DBR A;  4AID A;  4XLF A;  3SEQ A;  5J6X A;  3H92 A;  2HPM A;  2OUM A;  3ASN H;  4CCO A;  1DP3 A;  1EH6 A;  4E7H A;  1LVA A;  1FP1 D;  1H9G A;  4PUS A;  2LTP A;  2Y69 H;  2JT1 A;  2NVY J;  1MBJ A;  1O57 A;  4ZYG A;  1XX5 A;  4C30 A;  1D5Y A;  2ZME A;  6PAX A;  3H5A A;  2IW5 A;  1BOB A;  4AM3 A;  1Y1V J;  4UUS A;  3J81 K;  2O7O A;  1O7L A;  1P7I A;  1IW7 F;  3IHU A;  5KK1 A;  3WTY C;  3BWG A;  1UEL B;  4Q47 A;  1K7A A;  1AU7 A;  4IL6 C;  2RNG A;  3VYR B;  3FF5 A;  5GAD J;  4QIW N;  3BT9 A;  2JMW A;  3JRE A;  1EF4 A;  2NNY A;  4XLE A;  4I6Z A;  3A0B C;  4FX0 A;  1ETX A;  3IRQ A;  2NYX A;  2BVL A;  4EMS A;  4Y3O A;  2KPM A;  4DQ2 A;  3D5S C;  4ZDO A;  1WJC A;  3CCY A;  3RYP A;  4C9Y A;  3HTU A;  4F52 A;  3I71 A;  4AUX A;  4LD5 A;  5TJJ A;  2EV6 A;  3G71 I;  1HKS A;  5D8L B;  1ZAR A;  2WV0 A;  3VDX A;  3F3X A;  3HOS A;  2LBF A;  1S6L A;  5IOY A;  5IT3 A;  4ESJ A;  2GXG A;  4PCQ A;  3ZQ7 A;  5ERI A;  3OSG A;  1I1G A;  1XSD A;  1HKT A;  3KCC A;  2ZME B;  4UVB A;  2GLO A;  1ZG1 A;  1V5E A;  1B9N A;  1UZC A;  4CIC A;  5IY5 H;  5D5U B;  3QPS A;  1J09 A;  5BQT A;  4A3K J;  2N8G A;  3GO5 A;  4I0A A;  2WAD A;  2R5Z A;  2R7O A;  4N4O B;  2H09 A;  1AWC A;  3K9T A;  1R1T A;  3LSG A;  4DYR A;  1TW3 A;  3F22 A;  1BW5 A;  2Y75 A;  2ZXH A;  1TC3 C;  4M3G A;  1NTC A;  2EIK H;  2L7K A;  1IDZ A;  2GXB A;  4HSR A;  3JSO A;  1HOM A;  2CWE A;  2KZG A;  5JLX A;  1R22 A;  4I02 A;  2XPU A;  2PQ8 A;  3DU6 A;  3F9K A;  5L3C A;  1RNL A;  4UVC A;  2WY7 Q;  3G2B A;  5JLW A;  3I5U A;  5DTD A;  1Y0N A;  1W36 D;  3I64 A;  1UB9 A;  2DMP A;  1IXS B;  2MSY A;  2GZW A;  3RCO A;  2P6T A;  2ZC2 A;  2XVC A;  3EQL F;  5GAG J;  3HKZ N;  2DPU A;  2JK3 A;  3SFZ A;  2V6E A;  5TGT A;  2VPR A;  2E7W A;  1WJB A;  5JHF A;  3Q0U A;  2XAQ A;  4XOR A;  4BJ6 C;  4QTR A;  3J7Z I;  1Z3X A;  5F0C A;  1F1Z A;  2PMH A;  3BR3 A;  3MAJ A;  3MVP A;  4HX4 A;  1Z6T A;  1BR2 A;  4UB6 C;  5J3L A;  4KIB A;  1TNT A;  2Y30 A;  1UCR A;  4A3E J;  3BZ6 A;  1I3Q J;  1R71 A;  1Z77 A;  4BE2 A;  1YRN B;  2ELH A;  3ASO H;  2X1E A;  4EGY A;  5DCM B;  5FRO A;  2IA1 A;  4BJ5 C;  3I54 A;  3OYN A;  2Z5U A;  2CUE A;  3A1Y A;  3GYH X;  3BP8 A;  3BQZ A;  3EDP A;  5LRR A;  4FX4 A;  5F27 A;  4A3M J;  4WXH A;  4A3C J;  5HOD A;  1TBX A;  4I01 A;  1Y8R B;  2M87 A;  2IS1 A;  2KRH A;  1VQO I;  4RGS A;  4XLP F;  1A31 A;  2CYY A;  1WSU A;  2DOF A;  1J2X A;  2BXZ A;  4XRF A;  2OQR A;  4IHV A;  1I27 A;  2EZK A;  2DMQ A;  1WH5 A;  2LH9 A;  2XV4 S;  3L2U A;  5GTH C;  1FOW A;  2KP6 A;  2VC1 A;  2OCE A;  3HYI A;  2A05 A;  2K9M A;  3ZMU A;  1A36 A;  3HOV J;  4LG0 B;  2A6H F;  2E60 A;  4BKX A;  2FMY A;  2VBZ A;  4IHW A;  5DM7 F;  1TLH B;  2H6C A;  1WH7 A;  3WU1 B;  1YW9 A;  2ZO4 A;  3LSH A;  5BOX A;  4JBA A;  2MYS A;  3BTC A;  2O0Y A;  2QQ9 A;  5CVU A;  4PJN A;  3H3V K;  4LLG F;  2M45 A;  5F6F A;  3TW7 A;  3AL0 C;  5IT9 K;  1E3P A;  1HQC A;  1YS6 A;  2EIM H;  1I6H J;  2DO7 A;  4NBQ A;  1K6Y A;  1EH7 A;  5J4Y A;  1ZYR F;  4ZTJ A;  4QWQ A;  3IWF A;  3K1N A;  4RLQ A;  3HGG A;  3KP5 A;  1XC5 A;  3R0J A;  4Z6Y A;  3CCS I;  1UG0 A;  5LD2 C;  4I2O A;  4IHT A;  5GPA A;  3HBL A;  1YJN I;  3TOB A;  3IH2 A;  3CZ6 A;  3FXK A;  3P9K A;  2F5E A;  2OAZ A;  4PJ0 C;  4DIQ A;  2OTL I;  4L0Z B;  2QQA A;  3GTQ J;  3FXR A;  4ETS A;  3FKI J;  3MN2 A;  4DZJ A;  1ETQ A;  3MZH A;  5E79 C;  1X1A A;  1JHF A;  4L18 B;  1NHA A;  1KU2 A;  4B3X A;  4E4H A;  2VKH A;  2Y2Z A;  4U7D A;  1IUF A;  3LA7 A;  1B8I B;  1BI3 A;  5B66 C;  4UY8 I;  2CJJ A;  3IUO A;  1VQ5 I;  1UG2 A;  4D0P A;  2ISZ A;  1X3Z B;  1QRY A;  2L7F P;  2QVO A;  2PJP A;  4R1H A;  1SFU A;  3BCB A;  2VOD A;  1Q1H A;  2W25 A;  1BR4 A;  4RAF A;  4WK8 F;  1VQP I;  3FK6 A;  2HDC A;  5J1Y A;  2OZ6 A;  1VFC A;  1KA8 A;  1YI2 I;  4EJW A;  3L00 A;  4FIS A;  1ETY A;  3C7J A;  2DJN A;  4KMF A;  3A0H C;  3GFJ A;  3P7N A;  1VQM I;  3JRC A;  4WXC A;  5E18 F;  2XAH A;  4EEF G;  2BY3 A;  3RKW A;  5LGU A;  4IOA F;  5DCM A;  2XAS A;  3H9J A;  3VSK A;  1KYZ A;  1U5T B;  4EAT A;  3OY9 A;  3PM1 A;  5HLH A;  2K40 A;  3OYB A;  5E1X A;  4UXN A;  4G6D A;  4FET A;  2L0K A;  5H6Q A;  3EYI A;  1MDM A;  2EH3 A;  2DA6 A;  2R7T A;  1K61 A;  1LB2 A;  1LJ9 A;  2MA3 A;  4CYC A;  1OKR A;  2GOM A;  1B1B A;  4XQF A;  1V3F A;  5E3O A;  2M7A A;  1T6S A;  2X48 A;  1Z6R A;  1R1U A;  2PMU A;  3F0C A;  4A3J J;  4A6E A;  4V2G A;  5B1B H;  2YR2 A;  4UB8 C;  1HCR A;  3QOD A;  3MKY B;  3I0T A;  4MIM A;  3JRH A;  2IS6 A;  3BR2 A;  3NRV A;  2K3F A;  1BI0 A;  2CQK A;  1W5C C;  4X6A J;  3G4S I;  2RVC A;  2VT2 A;  4XON A;  2MC3 A;  5E8G A;  3HEF A;  1OCC H;  1QZY A;  3EUK L;  2QEN A;  5ICC A;  2CSO A;  3CO6 C;  1HW2 A;  1IN6 A;  1G2H A;  4MLO A;  1FT9 A;  1JTY A;  2DOE A;  1MZB A;  3HGY A;  3CCL I;  3VFZ A;  4D7M A;  2E1O A;  2HI3 A;  1IN8 A;  1PP7 U;  1H8A C;  1LKX A;  2KIQ A;  3E5Q A;  3KP7 A;  1FPQ A;  4U0V A;  1DPR A;  2DA2 A;  1KU3 A;  1R5G A;  3CCM I;  2QYO A;  4AIJ A;  4AIK A;  3QP5 A;  3VYU B;  4C2M J;  3I4N J;  1WJF A;  2EPF A;  2J5P A;  1IN7 A;  1O7F A;  1KU7 A;  1CF7 A;  1Y8Q B;  5K5O A;  3HOX J;  3HL2 A;  4B48 A;  5E1Z B;  1XDU A;  3SXY A;  5IOZ A;  2O61 A;  2FE3 A;  4ZTF A;  1BN5 A;  2E5N A;  1J0R A;  2A3S A;  4NQW B;  4S04 A;  3OS1 A;  1YTY A;  2YU9 J;  2YU3 A;  5LHG A;  1JE8 A;  2X6W A;  3GTJ J;  3S8P A;  2XHK A;  4L9V A;  2DDB A;  4AU7 A;  5ILU A;  2ZB9 A;  2BXY A;  5K7Z A;  4HF2 A;  1E2X A;  3GCM A;  1R49 A;  2IBD A;  1S9H A;  2PMZ N;  2W85 A;  4NNJ A;  4DGW B;  5BMZ A;  1IJW C;  5M5X J;  4DNC A;  2KMU A;  2HZD A;  3R60 A;  1VQ7 I;  5ED4 A;  4EM2 A;  3CCR I;  3RI4 A;  4RS8 A;  2E1N A;  4Q48 A;  5JVT A;  4XRM A;  2COB A;  2QWW A;  3G1O A;  3I4M J;  5L3D A;  1RKT A;  3OYC A;  1J7K A;  3L2R A;  2FXA A;  1XMA A;  2LK2 A;  5ICE A;  3V42 A;  1D0X A;  2ID6 A;  3LFU A;  4CZZ A;  5LBQ A;  2Z3Y A;  2FU4 A;  2MC4 A;  2V9P A;  3ULQ B;  1X58 A;  1XGM A;  2JA7 J;  5GP9 A;  3TL4 X;  3SQN A;  2NS0 A;  1IG7 A;  3PQJ A;  1BC8 C;  1TQI A;  1MH4 A;  2BW3 B;  1PVE A;  4L9J A;  1X1C A;  3MWM A;  1IRX A;  2HGC A;  2NS7 A;  1YW8 A;  2DCE A;  3P9C A;  4CGZ A;  1FMV A;  2R7R A;  4IOC F;  2K27 A;  2IAI A;  2NVU B;  3OL4 A;  3GLX A;  1VQ8 I;  3RKQ A;  1PJR A;  1RIO H;  2FQ3 A;  3SDB A;  3TO6 A;  1YHQ I;  4LG3 A;  3D5R C;  5DV5 A;  3DPU A;  1R9T J;  3WHB A;  3WTU C;  4JX6 A;  3IC7 A;  4ENM A;  2OV7 A;  5DEQ A;  2R7U A;  3CJT B;  3CF5 F;  1ODD A;  2HR3 A;  3E6D A;  1P4X A;  3C18 A;  5JR3 A;  3V7R A;  4AC0 A;  3HHH A;  2XB0 X;  2VOO A;  3CCJ I;  3DLA A;  2R7Q A;  2ZJR F;  5F04 A;  3DWL E;  3TDZ C;  3IAS 2;  3I3L A;  2DOD A;  2DI3 A;  1TWH J;  2DFF A;  3OYF A;  1E17 A;  2W4S A;  2J5O A;  1BBY A;  1FWZ A;  1BIA A;  2HVS A;  3A02 A;  1GDT A;  3FXO A;  4FAS D;  2FQ4 A;  2CFO A;  1XG1 A;  3FMS A;  3PIP F;  5M3F J;  2E71 A;  1EJ9 A;  1VQL I;  2EZI A;  1N78 A;  2EB7 A;  3I4P A;  4IQ4 A;  4CCN A;  1YRN A;  2DFI A;  1LFP A;  3WG9 A;  2V6C A;  3QPL A;  2F5D A;  4MQV A;  1FMW A;  3WG7 H;  4WF2 A;  3VEP A;  1HA8 A;  2M1B A;  5C44 J;  1ZN2 A;  4EJV A;  2VN2 A;  2YX4 A;  2JPB A;  1E3H A;  3RPQ A;  5J40 A;  2DQR A;  2Y0S A;  2WAQ A;  3PSF A;  3L1P A;  4Q5S F;  1TWG J;  5HS7 A;  3GF2 A;  1W0T A;  3KEQ A;  2ZXW H;  4ON0 A;  1LFU P;  5D8K B;  3PJR A;  1YX5 A;  3J7Y J;  1S7E A;  2JTV A;  2W84 A;  2HOA A;  1QVU A;  1HLV A;  2V9K A;  2VL8 A;  3K7A J;  5IYC J;  2JSP A;  5M5W J;  2GXA A;  3EYY A;  5EGO A;  4HYE A;  2IA2 A;  1VI0 A;  4RB2 C;  3RZO J;  2FEZ A;  3AKZ A;  3DF8 A;  3QQA A;  4RGR A;  2IS2 A;  2I5U A;  4NC7 A;  2WBM A;  3OIQ A;  3AG2 H;  1R00 A;  3OWT A;  1D8J A;  1YOV B;  3QYB A;  2OJE D;  1YIO A;  2BY2 A;  5FB2 A;  2F5V A;  5H2F C;  3CDL A;  1O4X A;  3WOD F;  1FSH A;  2CQQ A;  3AL0 B;  3KP4 A;  3O2P E;  3BOQ A;  5GAE J;  1LVK A;  2NNN A;  2W7N A;  1XGS A;  3R6S A;  2PI0 A;  1R5H A;  2IP2 A;  2QSH X;  3HSR A;  1G8X A;  2E1M B;  1Z0X A;  1IZ1 A;  2G9W A;  3B02 A;  1PDN C;  3EUA A;  4Y17 A;  1SVO A;  3K4B A;  3HPG A;  4G94 A;  1JGG A;  4LB5 A;  4A3D J;  2JQ7 A;  3K70 D;  2VPL A;  2LBF B;  2ZJQ F;  2VJ4 A;  3CC2 I;  4BQQ A;  2DFH A;  2JA8 J;  3MEX A;  3FHN A;  3GEZ A;  4KIF A;  4NUB A;  2EA4 A;  2M30 A;  4EGZ A;  1VQ9 I;  4D9J A;  1LQ1 A;  1HW5 A;  2X51 A;  3FDY A;  4IX7 A;  3ZGK A;  2H27 A;  5CQG A;  4XLH A;  2NVQ J;  3DBH B;  1CQT A;  3LAP A;  5KAI C;  3QU6 A;  1K83 J;  2V4J C;  1BA5 A;  5FD6 A;  4UUV A;  1B72 B;  3X2Q H;  2PJR B;  3OYL A;  5LRS A;  4YII A;  1DDN A;  1MBG A;  4G12 A;  3ZQG A;  2FBI A;  3GLL A;  1KQ0 A;  3JR9 A;  3LNQ A;  2GIZ A;  3ABU A;  2MLK A;  1JKQ C;  3ERE D;  3GTP J;  2EZH A;  4ENK A;  2R5Z B;  5CJ9 A;  3I59 B;  1J5Y A;  3JAM Z;  4CUG A;  3KZI C;  3PFI A;  1FJL A;  2PN6 A;  2CG4 A;  2B0L A;  3FM3 A;  4P1W A;  2EIJ H;  2K9L A;  2LVS A;  3ROU A;  4WWC A;  3A4C A;  4KMU X;  5HS8 A;  3DBR B;  1I39 A;  4N4N B;  5IYD J;  5KHD A;  4ITV A;  5FD5 A;  1SD5 A;  3KEY A;  3O6B B;  1T95 A;  2QM3 A;  2I8D A;  1W0U A;  4OIO F;  4BY7 J;  2QSF X;  1SD7 A;  4XN3 A;  1LUJ B;  1S29 A;  3B6A A;  5KCM A;  4HDU A;  2E35 A;  5TRD A;  2HYJ A;  4CSW A;  1ZR4 A;  2FX0 A;  2KJC A;  2F4M B;  4D5C A;  3GBG A;  1W7P A;  3BPV A;  2CV1 A;  2HTJ A;  4L9T A;  3HRS A;  3OOP A;  5EEG A;  1FTZ A;  3BG6 A;  1YO5 C;  3BG3 A;  4BE0 A;  1J59 A;  5GTI C;  2CGP A;  3BY6 A;  2LY2 A;  3S16 J;  3BCA A;  3I53 A;  4PSW A;  3JW4 A;  2Z9O A;  2EQR A;  3HPH A;  5DUK A;  3JRG A;  3EPZ A;  4HBL A;  1MMS A;  2HZT A;  4ZYA A;  4KN7 X;  2JRT A;  2DU9 A;  3RIR A;  5LLQ A;  2ZSH B;  2DXI A;  4HDV A;  2G7U A;  3ML6 A;  2CRG A;  3BJO A;  3W2V A;  5LHI A;  5AIQ A;  1QHG A;  4RAZ A;  1ZHF A;  4PJM A;  3S1M J;  3FHZ A;  2Z1D A;  1YIJ I;  3V8J A;  4AD9 A;  2ZNZ A;  2Y0S N;  2H1L A;  2W82 A;  2WAQ N;  3LSM A;  3BR0 A;  4RGU A;  3K10 A;  4OIR F;  3ZQH A;  4RB1 A;  1JUS A;  1WWX A;  4E7I A;  1DU6 A;  1XMK A;  4HOB A;  5A2Q Z;  1BL0 A;  2RV8 A;  3LWF A;  3CO7 C;  3VWB A;  1JI8 A;  4P9U A;  4F93 B;  3O8G A;  1ZTR A;  2XKO A;  4ZDL A;  5FO5 A;  1HW1 A;  3GZ6 A;  3KZY A;  1RZ4 A;  3Q5F A;  3OIP A;  2B9S A;  1POG A;  1U2W A;  1WRJ A;  3Q3S A;  4JX4 A;  3FM5 A;  3OYK A;  3E5X A;  4M6X A;  4DYC A;  2UXN A;  4ENJ A;  1W7P B;  2MG4 A;  2V26 A;  1AHD P;  1XMX A;  2JA5 J;  4KDP A;  2NRA C;  1ZLJ A;  4YIF A;  1JUM A;  4LG0 A;  2V1N A;  3DTE A;  4C2T A;  1H88 C;  2GM4 A;  1TZL A;  5E8I A;  1WFX A;  3RPU D;  3FXJ A;  2DT7 B;  3TP0 A;  2JUG A;  2D2W A;  4F7Z A;  1K79 A;  4IRH A;  2M0C A;  5JFR A;  3IKV A;  2ID3 A;  2IGN A;  3MQ0 A;  1JUP A;  2CS3 A;  2OD5 A;  4LK1 F;  5F1R A;  3OYE A;  4L5J A;  1XCV A;  4RLF A;  1UFM A;  3RDI A;  2R7Z J;  2VQL A;  1YJW I;  2D45 A;  4XKV A;  1P4W A;  2P5K A;  3C2H A;  4HV6 A;  2LMD A;  4IHX A;  1YYV A;  3W6K B;  3JRF A;  5FJ8 J;  2ZCW A;  4E7K A;  3JCU C;  1N25 A;  4MFE A;  1X1B A;  1U78 A;  4BHC A;  5H6R A;  1UHS A;  1FBS A;  4KIT B;  3E0J B;  1R7J A;  4YEL A;  3TP3 A;  5TIS C;  3VSL A;  1WQ2 A;  4GO1 A;  3K69 A;  4LMY A;  3KYL A;  4QLC U;  2L9N A;  4RAG A;  2M34 A;  3ZMZ A;  1WCM J;  3OYG A;  3K4N A;  2QBY B;  1LE8 A;  1S72 I;  2QA4 I;  3OYJ A;  4DJA A;  1TT5 B;  3FK7 A;  4J00 A;  3DPL C;  1T39 A;  2VBY A;  2ZKZ A;  2QKL B;  4HX8 A;  3OYH A;  1U8R A;  1U6G A;  2XGE A;  1GT0 C;  5FLM J;  3QOE A;  2HVQ A;  4YFN F;  2XF6 A;  3V8L A;  4PGG A;  5JHU A;  1XSX A;  4BQA A;  3T5X A;  3LST A;  4JK1 X;  3K70 C;  3L2Q A;  4LLL A;  1IF1 A;  2Q2E A;  3BZK A;  3ZQL A;  5EG0 A;  2A5Y B;  1Z7U A;  3DV8 A;  4QSH A;  1U5T A;  3G6E I;  1OIS A;  4LIT A;  1G3S A;  2R0Q C;  3WE2 A;  3CC4 I;  3MZ8 A;  4XKC A;  4A3G J;  1OR7 C;  3CES A;  3S3O A;  1MDM B;  3UKG A;  4XOT A;  1B9M A;  3SZT A;  1G6N A;  1LDJ A;  1YE9 A;  3OYA A;  4BDZ A;  3BR1 A;  3L7W A;  4RMN A;  4U87 A;  3ABK H;  1JHH A;  1SD4 A;  2CUZ A;  1Z21 A;  1MJA A;  2X85 A;  1MMN A;  2Y48 A;  3OMY A;  3PO3 J;  2HYF A;  2VB6 A;  2K4J A;  4BS9 A;  4L5I A;  4A5M A;  2LKX A;  5ICF A;  3FXQ A;  1S7A A;  3DP7 A;  4E7S A;  4PFP A;  2EFW A;  1DGW Y;  3CUQ C;  4LGW A;  3CLQ A;  1L0O C;  1JT0 A;  3LSP A;  2LC2 A;  4EJO A;  3KYC B;  4V2F A;  4CO8 A;  1R58 A;  1HDP A;  2KIF A;  5CVV A;  3F21 A;  3LMM A;  2FNP A;  2X6O A;  4XN0 A;  2M8E A;  5J1U A;  1VQ4 I;  2XGC A;  2A07 F;  1QA6 A;  5AIP A;  4G7Z F;  1H0M A;  1JXS A;  2A6T A;  2RNJ A;  4HG2 A;  4I0B A;  1Y1W J;  5FKN A;  3QRF F;  2OF7 A;  3TED A;  2UWM A;  2G7H A;  3SJM A;  2WA0 A;  4DW6 A;  3HSE A;  4D5F A;  1BC7 C;  1FLI A;  2ESH A;  2Q2E B;  2HTS A;  3RTR A;  3JTH A;  1Y39 A;  2ADU A;  1WKM A;  4KT5 C;  3VB2 A;  4IVN A;  2F4I A;  1PUF B;  4CH7 A;  3FXM A;  3RJP A;  3HRU A;  2R5Y B;  3BZC A;  1F9N A;  3CJR B;  4YIR X;  2K9N A;  2OPT A;  2WB1 A;  1J9I A;  4XSX F;  2Q1Z B;  3FBN B;  3P9I A;  3CCV I;  3ZQC A;  2W00 A;  4FTH A;  1Z67 A;  5E17 F;  4F91 B;  2K9Q A;  4A3B J;  4KNY A;  1Y0U A;  4Z2Y A;  2VUM J;  2KDZ A;  3OSF A;  1MBE A;  2HPI A;  2QQ8 A;  1X2M A;  4H0E A;  1ZRC A;  1ERD A;  3BLY A;  4X1E A;  3KX2 A;  1A35 A;  3ZMD A;  2DYR H;  4LOC A;  2HXI A;  3KEO A;  2Z33 A;  4HEA 2;  4M9S A;  2HFH A;  1E3O C;  1ZGA A;  1NG7 A;  3S3M A;  2XF5 A;  2EIL H;  3BJ6 A;  3C2B A;  4AVZ A;  2HQR A;  3HTS B;  1A5J A;  3VPR A;  1ETO A;  1X4O A;  2IGM A;  2L5Q A;  3AG3 H;  3KFW X;  4XMY A;  1D1C A;  2LP0 A;  3I56 I;  2E2H J;  4KIS A;  2VAS A;  4W97 A;  1XD7 A;  4ZH4 F;  1PUF A;  4M74 A;  2E19 A;  4E7Z A;  3BG7 A;  5KNL A;  2CV0 A;  1SD6 A;  1BI1 A;  1MJB A;  1MH3 A;  4EVI A;  2R7X A;  1BM9 A;  3D0S A;  2XKP A;  3DLL F;  3DTK A;  3CTA A;  1ETW A;  2AQF A;  2NAZ A;  3RPU A;  3JRI A;  1Z05 A;  3ZN0 A;  4Y13 A;  1TWA J;  4HZF A;  4UV8 A;  5HLT A;  2X1C A;  3QOP A;  4HNT A;  1X1P A;  1SMY F;  3C1D A;  3WU2 C;  2DK5 A;  1ZG5 A;  2VXD A;  1QHH D;  2DN0 A;  3F8N A;  1W1W E;  2LY1 A;  1MMA A;  3KE2 A;  2V1D A;  2ZXJ A;  3H9G A;  3BG5 A;  4BU2 A;  3G3Z A;  3WTT C; 
#chains in the Genus database with same CATH homology
 4CCK A;  2XB0 X;  3RZD J;  2AQE A;  2LRD A;  3SYT A;  2H1K A;  4G6T B;  3IP4 B;  2MD0 A;  2XGD A;  1FTT A;  1QVT A;  3S2H J;  2A5W A;  2R7Q A;  3DLA A;  5F04 A;  4UUT A;  4Y7N J;  1LDK B;  3DWL E;  1MMG A;  3I3L A;  1FIA A;  3IAS 2;  3IH3 A;  1TWH J;  1ORK A;  2DMU A;  3OYF A;  2W4S A;  3C2G A;  4HST A;  1WPK A;  1ZK8 A;  4OAZ A;  3HOZ J;  2HVS A;  1U9N A;  3A02 A;  2DJI A;  3M3Y J;  3Q0V A;  1ENH A;  4XR6 A;  5IYB J;  2R7V A;  1GDT A;  4XM3 A;  5E3N A;  3GTL J;  2FQ4 A;  2CFO A;  4FAS D;  1XG1 A;  2RRE A;  2CMP A;  1OCT C;  1ETV A;  5M3F J;  1DQU A;  3CJQ B;  3K4K A;  2EZI A;  3BTJ A;  3RQ4 A;  3MKW B;  2NVT J;  1N78 A;  1YRN A;  4IQ4 A;  3B6C A;  2ME6 A;  1AKH A;  2CUJ A;  4CCN A;  3L2V A;  3SDG A;  4XRS G;  1FEX A;  4M3B A;  1LFP A;  3QPL A;  4E7J A;  2XC7 A;  3M4O J;  2DMT A;  1FMW A;  4X0G A;  5EF6 A;  4ZC3 A;  1HA8 A;  4HPQ A;  2LLK A;  3MD2 A;  2DA5 A;  5C44 J;  3K6G A;  4B43 A;  5DS9 A;  2H8R A;  2R92 J;  2GBY A;  5F08 A;  2M7B A;  3J7A Y;  4A93 J;  2NVX J;  1AKH B;  1QPI A;  1TT0 A;  2I10 A;  4B3A A;  5E3L A;  1G59 A;  4RBO A;  2XDV A;  2Y0S A;  3PUB A;  4NDL A;  3WHC A;  3L1P A;  1SFO J;  2WAQ A;  3PSF A;  3TBI A;  2YS9 A;  4JX5 A;  4I76 A;  2VJJ A;  2CW8 A;  1TWG J;  1V5G A;  2MAB A;  4P5O A;  4DBR A;  1W0T A;  1GLN A;  4XLF A;  3SEQ A;  2HPM A;  4NC8 A;  4XIC A;  2Z16 A;  4II3 A;  2OUM A;  1MBF A;  4CCO A;  1DP3 A;  2EBI A;  1LFU P;  3PJR A;  1YX5 A;  2TCT A;  4MFD A;  4E7H A;  1S7E A;  4BU2 A;  4W1U A;  2HOA A;  1QVU A;  3CMY A;  2HQA A;  2KL4 A;  1HLV A;  3BQY A;  2LTP A;  4C3J J;  3HOU J;  2DTZ A;  2V9K A;  3K7A J;  2QKM B;  2VL8 A;  5IYC J;  5M5W J;  2JSP A;  2NVY J;  1MBJ A;  4M3D A;  2E1M C;  2V7F A;  3AFH A;  5EGO A;  1VI0 A;  4BEH B;  4C30 A;  1D5Y A;  3RZO J;  2VJ5 A;  1W36 C;  2YUS A;  3AKZ A;  1VF9 A;  3QQA A;  3D1N I;  3QYE A;  3H5N A;  3HDD A;  3H5A A;  2IS2 A;  1BOB A;  1MNE A;  3Q0W A;  4NC7 A;  1Y1V J;  4UUS A;  2D5V A;  4HNV A;  2WBM A;  1ZGW A;  3GTM J;  2W48 A;  2MGQ A;  5HVQ C;  3OIQ A;  2O7O A;  1P7I A;  2IGK A;  3OWT A;  3QYB A;  4BEH A;  2F5V A;  4IQJ A;  3CDL A;  1O4X A;  1UEL B;  2HU9 A;  4PJL A;  2CQQ A;  1AU7 A;  2RNG A;  3VYR B;  3AL0 B;  4QPO A;  4RM2 A;  4QIW N;  1LVK A;  2W7N A;  3BT9 A;  2JMW A;  1P7J A;  3JRE A;  1EF4 A;  4I6Z A;  2ELJ A;  2CU7 A;  4XLE A;  4XLC A;  1BR1 A;  2HQ5 A;  1ETX A;  4C3H J;  4DYQ A;  1D0Z A;  1G8X A;  1Z0X A;  1MND A;  2E1M B;  3K4M A;  1A6I A;  4OWR B;  4IKF A;  3G1M A;  4B4C A;  4XID A;  4GFB A;  3S2D J;  1WJD A;  2BVL A;  3EUA A;  2E2I J;  3LOC A;  4YRV A;  4BAC A;  4Y3O A;  2KPM A;  3MKZ A;  3D5S C;  4ZDO A;  1WJC A;  1JGG A;  3CCY A;  2M4G A;  3H5R A;  3HPG A;  3K4B A;  2EZL A;  4A3D J;  2KT0 A;  3K4L A;  4C9Y A;  1T33 A;  2LBF B;  2JA8 J;  2VJ4 A;  3E7L A;  1U9O A;  4BQQ A;  4F52 A;  3K70 D;  2XB5 A;  3OR1 C;  3FHN A;  1WI3 A;  3K2A A;  4L5E A;  4AUX A;  1NG6 A;  2LG4 A;  3ZXS A;  4BDY A;  4NUB A;  5CPR B;  1I50 J;  2R4G A;  2VPL A;  1YX3 A;  1VND A;  4D9J A;  3BG9 A;  1MBH A;  3VDX A;  4AYB A;  1KON A;  2X51 A;  3HOS A;  2LBF A;  3FDY A;  2NVQ J;  1MW7 A;  3ZGK A;  5IOY A;  4XLH A;  5CQG A;  4DZP A;  4IX7 A;  4BXF A;  1CQT A;  3OSG A;  1RPW A;  3S1Q J;  2FJ1 A;  1K83 J;  4FE4 A;  2V4J C;  1BA5 A;  5CQE A;  4OAY A;  4ZDP A;  2HXO A;  1B72 B;  3OS2 A;  2PJR B;  3TMO A;  3A03 A;  2GLO A;  3OYL A;  1V5E A;  2HDD A;  4PUS A;  4XL9 A;  1MBG A;  4Y33 A;  3QPS A;  1J09 A;  4G12 A;  4A3K J;  3ZQG A;  2KDO A;  2N8G A;  4C3I J;  4B44 A;  4DBQ A;  3UR3 C;  2R5Z A;  2WAD A;  2BOL A;  4ANJ A;  3MKY B;  2DMN A;  2RQQ A;  2R7O A;  4N4O B;  3JR9 A;  3IH4 A;  1RET A;  1MNM C;  3NAU A;  3LSG A;  3LNQ A;  4DYR A;  1BW5 A;  2Y9Y A;  1TC3 C;  2ZXH A;  3OOU A;  4M3G A;  1NTC A;  1JKQ C;  1IDZ A;  1DU0 A;  2L7K A;  3GTP J;  4HSR A;  2EZH A;  2LR8 A;  1JKP C;  1N75 A;  3CF2 A;  3E1S A;  1HOM A;  2R5Z B;  5JLX A;  4CUG A;  3H35 A;  1HDD C;  1FJL A;  1ZEL A;  1EA3 A;  2XPU A;  5GPC A;  3IAM 2;  4P1W A;  3VYS B;  3DU6 A;  2K9L A;  2LVS A;  3F9K A;  1E0E A;  1WJ5 A;  2JVG A;  3A4C A;  2WB1 N;  4IHY A;  4N4N B;  5EZG A;  4BY1 J;  2VI6 A;  5IYD J;  2L2O A;  2WY7 Q;  1OJL A;  5JLW A;  3BC8 A;  5DTD A;  3G2B A;  4ITV A;  5KHD A;  2ZFU A;  3KEY A;  1W36 D;  1W0U A;  2JA6 J;  1T95 A;  2DMP A;  2CW7 A;  2I8D A;  4BY7 J;  2UUZ A;  1V5F A;  2LFB A;  3DKX A;  5LFA A;  2O8K A;  5K7F A;  2MSY A;  3RCO A;  4XN3 A;  3B6A A;  4XNF A;  5KCM A;  1APL C;  5EZH A;  5F0H A;  2HYJ A;  3HKZ N;  5IP6 A;  1ZR4 A;  2FX0 A;  4H4K C;  4XOP A;  2NOG A;  4D5C A;  1AA7 A;  3GTO J;  2JK3 A;  2PMZ A;  3GBG A;  4F92 B;  2P0W A;  3DPT A;  2CV1 A;  2V6E A;  2AHQ A;  2DA3 A;  5TGT A;  2VPR A;  1FTZ A;  3BG6 A;  1WJB A;  5JHF A;  4BQN A;  3Q0U A;  1ITY A;  3BG3 A;  5BNG A;  4XOR A;  4BJ6 C;  4QTR A;  3RQI A;  4BE0 A;  3ZQI A;  5F0C A;  1Z3X A;  3DU5 A;  3OR2 C;  3BR3 A;  3MVP A;  4FCY A;  2LY2 A;  3S16 J;  1BR2 A;  3BCA A;  4PSW A;  5J3L A;  3GTK J;  3LSR A;  2EQR A;  2VJI A;  2Y30 A;  3HPH A;  2JVH A;  5J1R A;  3JRG A;  4A3E J;  3EPZ A;  4C2U A;  1I3Q J;  4ZYA A;  1Z77 A;  1YRN B;  4U7B A;  1IC8 A;  1RR7 A;  2X1E A;  4BE2 A;  2ZSH B;  5FRO A;  4BJ5 C;  1MSF C;  3DEE A;  3OYN A;  2DXI A;  2VLA A;  2CUE A;  4M3E A;  4XKB A;  4CCL A;  3A1Y A;  4PJJ A;  4E7L A;  2CRG A;  2HVR A;  3BQZ A;  1GV5 A;  4LIU A;  3W2V A;  1JKR C;  3H0D A;  3JRD A;  1QHG A;  2DT6 A;  4A3M J;  5F27 A;  2HOS A;  3S1N J;  2E2J J;  4A3C J;  1JTX A;  2JA2 A;  1JKO C;  1IDY A;  1Q1V A;  3S1M J;  2DA7 A;  5HOD A;  2Z1D A;  4PJM A;  3HC7 A;  3SFI A;  3SEZ A;  2Y0S N;  5K7H A;  2WAQ N;  2W82 A;  3LSM A;  3BR0 A;  1TWC J;  3ZQH A;  2KRH A;  3K10 A;  4E7I A;  1JUS A;  2IS1 A;  1DU6 A;  1UMQ A;  1BL0 A;  3DEW A;  4S0H B;  4BL0 B;  3VWB A;  1JI8 A;  3OIO A;  3S14 J;  4IHV A;  4F93 B;  1JJ6 C;  5FKL A;  2EZK A;  2MW8 A;  2DMQ A;  3O8G A;  2WY8 Q;  1ZTR A;  5IP7 J;  2X1D A;  4B47 A;  4ZDL A;  1X19 A;  1WH5 A;  2LH9 A;  3S17 J;  1F43 A;  5EEA A;  2XRL A;  3K4J A;  3OIP A;  3ZRG A;  3L2U A;  1N77 A;  2RAE A;  1POG A;  3Q3S A;  2VKD A;  4RM3 A;  2KP6 A;  4JX4 A;  3OYK A;  1R6R A;  4BQO A;  4DYC A;  2K9M A;  4AYB N;  3HOV J;  2VQC A;  3D5L A;  2E60 A;  1WGX A;  4BKX A;  3S3N A;  2MG4 A;  1F36 A;  1U8B A;  4IHW A;  1SAU A;  1RES A;  1WH7 A;  3LSI A;  1NK2 P;  2V26 A;  1AHD P;  3LSH A;  1H89 C;  1BW6 A;  4ABZ A;  1BJZ A;  2JA5 J;  4UUS B;  2MYS A;  4QPQ A;  3BTC A;  4PJN A;  1HF0 A;  1JUM A;  3H3V K;  2IGO A;  2O5R A;  2V1N A;  3DTE A;  3TW7 A;  2M8G X;  3PSI A;  4C2T A;  2IEK A;  2HOT A;  3CMM A;  3AL0 C;  1JT6 A;  1H88 C;  2GM4 A;  1TZL A;  1Z3Y A;  1TWF J;  1WFX A;  3RPU D;  1I6H J;  2B63 J;  2DT7 B;  3TP0 A;  2FD5 A;  1U0J A;  1K6Y A;  2JUG A;  2R7S A;  4ZTJ A;  1D1B A;  2LD5 A;  3LSJ A;  2LYC A;  2M0C A;  4RLQ A;  3HGG A;  2ID3 A;  1XC5 A;  3CQZ J;  2IGN A;  5LD2 C;  1UG0 A;  1JUP A;  2CS3 A;  3OYE A;  5C3E J;  1GUU A;  3HBL A;  5GPA A;  1OLT A;  1GVD A;  5CKT A;  4A3L J;  2WAF A;  3IH2 A;  3CZ6 A;  4RLF A;  2R7Z J;  2ECC A;  4B1R A;  1ZR2 A;  2VQL A;  4DIQ A;  2AO9 A;  2ZSI B;  4FE7 A;  3GTQ J;  5EG0 B;  1Y6I A;  3OYI A;  3FKI J;  3MN2 A;  4DZJ A;  1P9Q C;  4XKV A;  1ETK A;  1ETQ A;  1ZQ3 P;  1X1A A;  3MKL A;  3C2H A;  3DQV C;  4IHX A;  3BTI A;  4BJT A;  3JRF A;  5FJ8 J;  3HM5 A;  4E7K A;  1DGR M;  3ONQ A;  4MFE A;  4B3X A;  1X1B A;  1U78 A;  2VKH A;  4E4H A;  2Y2Z A;  1UHS A;  4J19 A;  4KIT B;  3E0J B;  1IUF A;  4YEL A;  3TP3 A;  1B8I B;  2L7M P;  3NAR A;  3A01 B;  4YEJ A;  3S93 A;  3VSL A;  2CJJ A;  4M6V A;  3IUO A;  1UG2 A;  4PFO A;  3KYL A;  5F1J A;  2L9N A;  2M34 A;  1QRY A;  2L7F P;  1WCM J;  4JQF A;  2PJR A;  4CSW A;  4XKW A;  3OYG A;  5M3M J;  1PYV A;  5FKO A;  2TRT A;  2KZV A;  1D0Y A;  3BCB A;  2MFZ A;  1BR4 A;  3K4N A;  1B8I A;  1LE8 A;  3A01 A;  2XSJ C;  4KJZ A;  3FK6 A;  4BUP A;  5J1Y A;  2K3P A;  1VFC A;  3OYJ A;  1MSE C;  4DJA A;  2L9S A;  4JOM A;  4FIS A;  4JP0 A;  1ETY A;  3FK7 A;  1IGN A;  1OCP A;  2DJN A;  2IXS A;  4DOZ A;  4J00 A;  3DPL C;  2KRC A;  4XK4 A;  3JRC A;  4BBR J;  2DA1 A;  2QKL B;  3OL3 A;  3OYH A;  4EEF G;  2L9R A;  3HOT A;  1Y56 A;  3UNG C;  2XGE A;  1GT0 C;  5FLM J;  3W2W A;  5C4X J;  3FKJ A;  3H9J A;  2LY9 A;  3VSK A;  2QF7 A;  1X1D A;  3QOE A;  1SAN A;  4EAT A;  2HVQ A;  3OY9 A;  3PM1 A;  2ECB A;  2BVM A;  2VIX A;  2K40 A;  4II2 A;  2XF6 A;  3IV5 A;  3K4C A;  4HNU A;  3OYB A;  1XS9 A;  3K70 C;  2QCO A;  4A3I J;  4FET A;  2P81 A;  2OC6 A;  2L0K A;  3MMY B;  3H9Q A;  3L2Q A;  3ZQL A;  2EH3 A;  2DA6 A;  5EG0 A;  1K61 A;  4IEJ A;  2LRE A;  4F3Q A;  2R7T A;  2FUG 2;  2JJ7 A;  4AVZ A;  4CYC A;  4QSH A;  2GOM A;  4XQF A;  4BBS J;  4Y52 J;  4LIT A;  2W1O A;  3HXL A;  2R0Q C;  5E3O A;  3HOY J;  2M7A A;  1SFK A;  2VXZ A;  3NWT A;  4XKC A;  3W2A A;  2DOA A;  5E3M A;  4A3F J;  4A3G J;  1OR7 C;  3CES A;  2X48 A;  2KLO A;  3S3O A;  3UKG A;  3N05 A;  4XOT A;  2Z2S B;  3F0C A;  4MO7 A;  4A3J J;  3I9V 2;  3DTI A;  1YE9 A;  4V2G A;  3VYT B;  3BR1 A;  4CYC B;  2O9L A;  4RMN A;  3OYA A;  4BDZ A;  4U87 A;  1HCR A;  3QOD A;  3OMY A;  5C4J J;  2CUZ A;  2DA4 A;  1Z21 A;  2X85 A;  3DKY A;  3PO3 J;  4MIM A;  1MMN A;  3RSN A;  4BXX J;  2F6C A;  4LIV A;  2VB6 A;  2VKV A;  2K5C A;  3JRH A;  2WAE A;  3BR2 A;  4BS9 A;  2LKX A;  2IS6 A;  4D7N A;  4E7S A;  4X6A J;  4PFP A;  1LE8 B;  1DGW Y;  3L2W A;  1FIP A;  2X6X A;  4XON A;  1JT0 A;  3FBI B;  3LSP A;  2LC2 A;  4KT6 A;  2NOJ B;  3HEF A;  5HOO A;  4V2F A;  1X4P A;  3EUK L;  1HDP A;  3U21 A;  4PK4 A;  2WV1 A;  4R79 A;  1JJ8 C;  2X6O A;  3LMM A;  5J1U A;  3PNV A;  1MBK A;  4XN0 A;  2XGC A;  1T56 A;  1G2H A;  2M9H A;  4MLO A;  1JTY A;  4A69 C;  2A6T A;  4XRS A;  4HG2 A;  5FLV A;  3HGY A;  1Y1W J;  3H0G J;  5FKN A;  3TW6 A;  4XLA A;  2XSD C;  2XPW A;  4D7M A;  2E1O A;  2HI3 A;  2OF7 A;  3TED A;  1QU3 A;  2UWM A;  4BGD A;  2M0M A;  3SJM A;  1H8A C;  2WA0 A;  1LKX A;  2XAU A;  4DW6 A;  1NK3 P;  2CV2 A;  2UV1 A;  1IV6 A;  4D5F A;  3ZCO A;  2DA2 A;  2R7W A;  4D1Q A;  2Q2E B;  4C2M J;  3M1C A;  3RTR A;  3VYU B;  4F55 A;  2VQG A;  5M5Y J;  3I4N J;  1WJF A;  2XPV A;  4J01 A;  3PL8 A;  1PUF B;  2F4I A;  4CH7 A;  1D1A A;  5FRN A;  3PNY A;  3HOX J;  3HL2 A;  4B48 A;  3BTL A;  3S15 J;  2BW3 A;  2R5Y B;  5IOZ A;  2E5Z A;  2ELK A;  3CJR B;  2KHM A;  2JN6 A;  2K9N A;  2OPT A;  3BR5 A;  1IRZ A;  3M8J A;  2WB1 A;  2HDW A;  4ZTF A;  2E5N A;  3LL7 A;  3NWS A;  3OS0 A;  4NQW B;  4BE1 A;  3OS1 A;  3GTG J;  2YU9 J;  2M4K A;  4Y4R A;  2M3A A;  2Q1Z B;  2CUF A;  3FBN B;  5HNH A;  2X6W A;  1ZKG A;  3GTJ J;  2ZXI A;  3S8P A;  3ZR8 X;  5IPA A;  3ZQC A;  1WJE A;  3FIW A;  3CP8 A;  1MMD A;  2W00 A;  4FTH A;  2R5Y A;  4AU7 A;  4IZZ A;  2ZB9 A;  4F91 B;  5K7Z A;  2K9Q A;  4A3B J;  3EUH C;  2VUM J;  5FKM A;  2KDZ A;  3DCF A;  3HKZ A;  1Z7L A;  2IBD A;  3ZOB A;  1MBE A;  2PMZ N;  3OSF A;  1S9H A;  1IJW C;  1X2M A;  2HPI A;  3QYF A;  4NNJ A;  4DGW B;  5M5X J;  3OYM A;  1ERD A;  3BLY A;  4X1E A;  3KX2 A;  2X9D A;  1VZ0 A;  2KMU A;  2HZD A;  2LOO A;  4LOC A;  5EGO B;  5FKK A;  1T0F C;  2HXI A;  5EYR A;  4HEA 2;  1E3O C;  3S3M A;  1NG7 A;  4RDU A;  5F0F A;  2XF5 A;  4CZC A;  4JYK A;  4XRM A;  3C2B A;  1WJA A;  1X2N A;  2COB A;  3S1R J;  3G1O A;  3VPR A;  1A5J A;  2NS8 A;  1ETO A;  2Y9Z A;  3I4M J;  1X4O A;  4PSX A;  4HRI A;  1UAA A;  5EDN A;  1RKT A;  3OYC A;  2Y31 A;  2IGM A;  3W6V A;  2L5Q A;  2CQX A;  3S32 A;  3OYD A;  3W3C A;  3L2R A;  3O8H A;  3LSK A;  2LK2 A;  1D1C A;  2XF7 A;  3PNT A;  4XMY A;  1GV2 A;  3V42 A;  2K9S A;  1D0X A;  2ID6 A;  3LFU A;  2LP0 A;  2E2H J;  4M3F A;  4KIS A;  3BR6 A;  2MC4 A;  2VAS A;  1X58 A;  1RKW A;  2VKE A;  3FIS A;  1OFC X;  2JA7 J;  3PFY A;  4W97 A;  9ANT A;  5GP9 A;  3SZG A;  3TL4 X;  4CCM A;  1IG7 A;  1PUF A;  4CA0 A;  4E7Z A;  2E19 A;  2CH0 A;  3BG7 A;  5KNL A;  2CV0 A;  2JWT A;  1MH4 A;  2BW3 B;  2R7X A;  1MH3 A;  1X1C A;  3HG9 A;  3HUG B;  5IP9 J;  3HOW J;  1IRX A;  2VQH A;  3DTK A;  2L7Z A;  2NS7 A;  2X6Y A;  5FRM A;  1ETW A;  3A2K A;  2DCE A;  2AQF A;  1FMV A;  2R7R A;  3HB9 A;  2KQR A;  3JRI A;  2IAI A;  4E6K G;  2ME0 A;  1TWA J;  2GOX B;  3OL4 A;  5HLT A;  1LFB A;  2X1C A;  2HNH A;  4HNT A;  3JRA A;  2M2E A;  3RKQ A;  1PJR A;  2R93 J;  2VXD A;  2DN0 A;  1QHH D;  3SDB A;  4LG3 A;  1R9T J;  3D5R C;  3DPU A;  4GRI A;  3WHB A;  3ZQF A;  4JX6 A;  1MMA A;  2LY1 A;  2OV7 A;  2R7U A;  3JRB A;  3G1L A;  3CP2 A;  4ZJZ A;  2IS4 A;  3H9G A;  4CCJ A;  3BG5 A;  3ZQQ A;  2G0E A;  3PO2 J;  5HNF A;  4AC0 A;  1B72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...