3OOUA

The structure of a protein with unkown function from listeria innocua
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
105
structure length
105
Chain Sequence
SPIIQNVLSYITEHFSEGMSLKTLGNDFHINAVYLGQLFQKEMGEHFTDYLNRYRVNYAKEELLQTKDNLTIIAGKSGYTDMAYFYRQFKKHTGETPNRYRKIHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Lin2118 protein
publication title The structure of a protein with unkown function from Listeria innocua
rcsb
source organism Listeria innocua
total genus 38
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12833 HTH_18 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3oouA01
1.10.10.2730 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oouA02
3W6VA 1LFBA 3OSFA 1Q1VA 3I4NJ 1Y1VJ 4BY7J 1HDDC 1JT0A 2L0KA 2JK3A 2XB0X 5DS9A 1ETXA 5EZHA 1ZKGA 1ZQ3P 1JKRC 3JRIA 2NVXJ 1IRZA 1E3OC 1P7IA 5IOYA 2QF7A 3S1NJ 2KT0A 1MBJA 3PM1A 2H8RA 1F36A 1GVDA 1LE8A 4LOCA 2HYJA 4C3JJ 1NK3P 1TWAJ 1WPKA 5IYCJ 2XPVA 1JGGA 1TWHJ 2ZB9A 2HI3A 4A3LJ 2MW8A 4X1EA 1SANA 1WGXA 2LFBA 2DA1A 3ZQFA 3Q0UA 4D7MA 1ZGWA 2LP0A 4B3AA 5F0CA 3SJMA 1IUFA 1ZR2A 1BL0A 1QVUA 2XPUA 4Y52J 5E3MA 5IOZA 4G12A 3Q0WA 3HOWJ 2VPRA 1RESA 2QCOA 5IP9J 1JUPA 2GM4A 3RZOJ 1PUFB 2CJJA 2DJNA 3FISA 4FISA 1FTZA 3HKZN 3OOUA 1JKQC 5EEAA 1AKHB 1F43A 5IPAA 1GV5A 1EF4A 3GTLJ 4X6AJ 5J3LA 3LSJA 5K7HA 4M3DA 3QPSA 2JN6A 2I10A 3BQZA 5GP9A 2E2IJ 4M3GA 2NOGA 1MH3A 3MN2A 1G2HA 3ZQLA 1WI3A 3HBLA 1WH7A 4HNVA 3HOZJ 3RZDJ 3MKLA 3ZQCA 3PO3J 1OJLA 4QSHA 2ME0A 2HOSA 4JX6A 1GUUA 1A5JA 1MBHA 1U9NA 2JWTA 4D7NA 2CU7A 2IAIA 2FQ4A 2M34A 1B72B 4XRMA 1OCPA 4UUSB 2PMZN 3TEDA 3BG9A 3BG5A 2NVQJ 2AHQA 1AHDP 4XRSG 1JT6A 2HXIA 2X6OA 1TC3C 2DMTA 1X2NA 4V2GA 2XB5A 3S1QJ 5IP6A 2XRLA 2LKXA 5FLVA 3GTGJ 1NTCA 5F0HA 2XSDC 1A6IA 5F08A 4JYKA 3A01A 3LNQA 3HGGA 3K2AA 2XPWA 2LK2A 4A3FJ 1FJLA 5C4XJ 2K40A 5EDNA 3G1MA 3UKGA 3O8GA 5F04A 1SFOJ 2NVYJ 1VF9A 3NARA 3JRCA 4A3JJ 4BXXJ 3FIWA 3H0GJ 2MG4A 2M0CA 2N8GA 1S7EA 3F0CA 1MBFA 4D5FA 5E3NA 4A3EJ 5FKOA 1DU0A 2ID3A 3JRFA 5HODA 4XK4A 1CQTA 2M9HA 4A3DJ 1X58A 2LVSA 4A3CJ 2TRTA 2VI6A 3CDLA 2ECCA 3TW6A 2JA6J 3JRAA 4B1RA 1NK2P 3ZOBA 4DZPA 5EG0A 1ETVA 3BQYA 3DEWA 2MSYA 4A3MJ 1IGNA 3ZQIA 2JA5J 3S16J 2EBIA 4CYCB 2KDZA 3VPRA 1ETQA 4W97A 3K7AJ 3O8HA 5FLMJ 2ID6A 3Q0VA 2EQRA 2GBYA 2VUMJ 2DA4A 1FTTA 3MVPA 3HM5A 3LSRA 1H88C 4JX5A 2R5ZA 1ZR4A 3I4MJ 2CUFA 1W0UA 3SDGA 4JX4A 1LE8B 3HOUJ 4C2MJ 1QVTA 5GPCA 2WB1N 1MBEA 3TP0A 4EEFG 3S1RJ 1JJ6C 1Y1WJ 4BBSJ 2YUSA 3M4OJ 2DA6A 2EZIA 3JRDA 3CMYA 4M3BA 3FK6A 3BR1A 1B8IB 4W1UA 1I3QJ 5M5YJ 3GTOJ 1ETOA 3GTPJ 3LOCA 2EZHA 1DU6A 3GTJJ 1RPWA 2CQQA 2DTZA 4AC0A 1ORKA 5FKLA 2LD5A 1JKPC 3JR9A 1AKHA 1K61A 5EZGA 2LR8A 4S0HB 2R92J 5C4JJ 4QTRA 3G1OA 1VFCA 1FEXA 1UG2A 2Y2ZA 3IV5A 3E7LA 5J1YA 2Y9ZA 2JA8J 2HDDA 1MH4A 4B4CA 4FE7A 5JLXA 4A93J 1U8BA 1P7JA 3ZQGA 3S17J 2IBDA 1JTXA 4DYCA 2K9NA 5C44J 5EGOA 1H89C 2M8GX 2R5YB 1R9TJ 3H3VK 1QRYA 2R93J 4UUSA 2OPTA 1GV2A 5F1JA 1POGA 3IH4A 3JRBA 1RR7A 1X2MA 4V2FA 1T33A 2DMQA 2K9SA 1OFCX 3A03A 3JREA 1IDZA 1BW6A 2E2HJ 3QQAA 4ABZA 4I76A 4QIWN 2O9LA 3S14J 3S15J 2HOAA 4MFEA 3BR2A 1GDTA 1T56A 1I6HJ 1MNMC 3M3YJ 3RQIA 2XGEA 4I6ZA 3A01B 3BTJA 1ITYA 2OF7A 4FCYA 3NAUA 4DW6A 1UHSA 2O8KA 2L7MP 2H1KA 1AU7A 4IHWA 1JTYA 2L7ZA 1YRNB 5M5WJ 1IG7A 4C3IJ 1TWCJ 3CCYA 1U9OA 1TWGJ 3WHCA 3IH2A 2EH3A 2DA7A 4M3FA 3JRHA 4XRSA 4M3EA 1IJWC 4FTHA 2LLKA 2E19A 4M6VA 4MFDA 2DA2A 1JKOC 4MLOA 4AYBN 2X9DA 1ZTRA 5DTDA 1HDPA 4AUXA 1BW5A 2E2JJ 5M5XJ 2P81A 5FKNA 4CYCA 3S2HJ 1ZK8A 1RETA 2HXOA 2K9QA 3GTMJ 5EG0B 5M3FJ 3BTLA 3G1LA 1HF0A 3JRGA 1HOMA 3BG3A 4XICA 2W48A 2VKEA 1UMQA 3A02A 2VKVA 2CQXA 4NDLA 3RKQA 3HOYJ 1K83J 3HB9A 1LFUP 1IV6A 2R5ZB 1ETKA 2DA5A 4RDUA 2D5VA 3S2DJ 1APLC 1XC5A 2FJ1A 5BNGA 2Y9YA 1HCRA 4IHVA 1MBKA 1PUFA 5E3LA 2EZLA 1ENHA 1RKWA 2ECBA 2M2EA 4IHXA 1B8IA 2JA7J 2IEKA 1ETYA 3LSGA 4Y7NJ 1TWFJ 1ETWA 2EZKA 3ZQHA 4A3GJ 2Y30A 3C2BA 2YS9A 4UUTA 1I50J 2WV1A 1MSEC 5FKKA 4A3KJ 4J19A 2O7OA 3QPLA 4A69C 2R0QC 2ME6A 3CQZJ 3DCFA 3D1NI 3BT9A 4DYQA 1FIPA 2MGQA 5FKMA 1MBGA 3PO2J 2L9RA 3GTQJ 2DN0A 3IH3A 1Z77A 1JUSA 5F0FA 4A3BJ 3HOVJ 2FX0A 1OCTC 3BR0A 1O4XA 1JUMA 2LY9A 3HOXJ 2COBA 1MSFC 4MO7A 5J1RA 2LTPA 5IP7J 2JJ7A 1BA5A 3Q3SA 4RBOA 2XGDA 2DMUA 2E1OA 1B72A 2Y0SN 3L1PA 2NVTJ 1VI0A 2JMWA 3FK7A 2R5YA 5IYDJ 1Z0XA 5EF6A 3OSGA 5K7FA 1H8AC 3B6AA 1W0TA 1XG1A 4BKXA 2YU9J 4BY1J 5GPAA 5F27A 4DYRA 3GBGA 5JLWA 2L7FP 9ANTA 5FJ8J 4L5EA 2NS7A 3BR5A 5EGOB 4A3IJ 4IEJA 2HQ5A 3FKIJ 2XGCA 2HOTA 1VNDA 3BR3A 3BTCA 4JP0A 3GTKJ 1WH5A 1FIAA 2CRGA 2G0EA 2GLOA 1WCMJ 1U78A 2TCTA 4C3HJ 1IDYA 1GT0C 2X48A 5M3MJ 2DMPA 2Y31A 4MIMA 4IHYA 1D5YA 5EYRA 3HEFA 3HGYA 3BR6A 4DZJA 3BTIA 3SFIA 1QPIA 1RKTA 4BBRJ 1HLVA 1IC8A 4XIDA 3WHBA 5K7ZA 4D5CA 5J1UA 5IYBJ 2FD5A 3OIOA 5C3EJ 2R7ZJ 5E3OA 1JJ8C 2RAEA 3S1MJ 1XS9A 2CUEA 2ELKA 3TP3A 1BJZA 3TW7A 1YRNA 4GFBA 2DA3A 3LSPA 2AO9A 4FE4A 3HDDA 2B63J 2NS8A 3B6CA 2WAQN 2DMNA
chains in the Genus database with same CATH superfamily
3W6VA 3I58A 3KZYA 2VB6A 1S72I 2VJ4A 3NRVA 1DGWY 3MMYB 1Y1VJ 3OYCA 1RUNA 3WG9A 4WXCA 1JT0A 1EKEA 4PSXA 4DIQA 2XB0X 5EZHA 1JKRC 1WI9A 3DLAA 2NVXJ 1M1EB 1ZELA 3QU3A 4BUPA 1P7IA 5IOYA 2QF7A 4U88A 5L3DA 2AQEA 5K5OA 1QZEA 1R00A 3P5JA 4N9HA 4BE1A 2H8RA 3Q9SA 3VYSB 1PYVA 3VYTB 5D8LB 4C3JJ 4N4NB 2VE8A 2QSFX 1WPKA 1BI1A 3CUQC 4E70A 5IYCJ 3BY6A 1YITI 1O3QA 4KMFA 1QZYA 2V6CA 1W7PA 2DK5A 5E1XA 3T8RA 1ZG5A 2HR3A 2DA1A 4CCNA 1ZGWA 2LP0A 3FDYA 5F0CA 3SJMA 1IUFA 1IF1A 2FE3A 5J47A 2R7UA 2HVQA 2BHYA 4L9NA 3E5QA 3LA2A 4E7IA 1J09A 3PNTA 1JI8A 1I1GA 4BE2A 3Q0WA 2R7XA 2QCOA 3QP6A 3K4NA 3FISA 1BR2A 3RYPA 1MW7A 4FISA 1LDJA 3ERMA 2DAOA 2G7UA 1JHFA 4N4OB 5EEAA 5H2FC 1H9TA 3QRFF 5HLGA 4U0YA 3K70C 1UFMA 1UB9A 5J3LA 1N77A 2KHMA 4BU2A 3MFKA 3VSKA 2HDCA 3QPSA 3HUGB 3CO7C 3MCZA 3TDZC 4RAGA 4CSWA 4A0ZA 4IQJA 2ZSIB 1QO0D 1EA3A 3OYNA 1F4KA 2Z2SB 3BOQA 3H5NA 4HNVA 1C0WA 2IS6A 1D8JA 3RZDJ 3SHFA 4C2UA 3H1CA 3MKLA 1RZ4A 1BR1A 4QSHA 1DUXC 1A35A 1WZ2A 1U9NA 4HYEA 4GGGA 1N75A 1MD0A 1LUJB 3SYTA 1B72B 4XRMA 2IPQX 5J6XA 2UWMA 3SEQA 3CCEI 4DBRA 4I99C 3AKZA 3DPTA 1G3SA 4UUSB 4XOPA 3TMOA 3TEDA 2NVQJ 1AHDP 2ZCWA 5HDGA 2Q8KA 1BIAA 4ANJA 2DMTA 1X2NA 1OISA 2FA5A 2P4WA 5FLVA 2XRLA 3LNQA 4ZC3A 3A01A 2KPMA 2M30A 4ITVA 2EWNA 2XPWA 1USSA 1SMYF 3N4MA 2K40A 1IZ1A 2JSCA 1YFHA 1T2KA 2AXLA 4BQQA 3AL0C 1VQ7I 5H20A 2PX9A 1TNTA 4A3JJ 1IRFA 2ZMEC 3FIWA 3H0GJ 5TGTA 1YJNI 1G3YA 2VKHA 1KQ0A 4ESBA 4Y3OA 1S29A 3M8EA 2Y75A 2UXNA 4NBQA 1ZARA 4BXFA 3WTYC 3N05A 2XV4S 2WADA 1GLNA 1X58A 2E60A 2HQAA 3KP3A 1IW7F 3CF2A 4HF0A 2V26A 5IY5H 1Y39A 1Y0NA 3BG6A 3TW6A 3H9JA 5TISC 2QVOA 4CHUA 5GTIC 2WY8Q 1ETVA 5EG0A 1FPQA 1HXDA 2CW7A 2EB7A 3K4LA 2P7CB 2DBBA 2DOAA 3DEWA 2DT7B 3TO9A 1D0ZA 2EBIA 1ETQA 1MIJA 4NHJA 4NNJA 1T6SA 2ID6A 5FLMJ 3KIOA 3Q0VA 2VUMJ 2DA4A 2X51A 4FETA 1GXPA 2WC2A 2KLOA 4JX5A 1KU9A 1ZHFA 3RIRA 2QQBA 4LG0B 2NRAC 3FXMA 5AIPA 2Z1DA 5KAIC 2ICWG 2DTRA 2L9NA 4JX4A 3JSOA 1LE8B 4HLXA 3HOUJ 1G4DA 3AG4H 1QVTA 2IGNA 2NS0A 4Z6YA 1X1AA 2L54A 5DM7F 1KYWA 1QQIA 2D1HA 1IN8A 3TP0A 3V7CA 4EEFG 1ZH5A 4A6DA 4PSWA 2KQRA 3CZ6A 2E1MC 3DF8A 2BBYA 1WQ2A 3M4OJ 3CMYA 2OD5A 1ZYRF 4I09A 1RIOH 1EJ9A 2OCCH 4M9XA 3N97A 1T0FA 1W7PD 4XOTA 3WTUC 2PLYA 1I3QJ 1OYYA 1Z3XA 3C2GA 3HSEA 4RGXA 3GTOJ 3KE2A 1DU6A 3GYHX 3GTJJ 1X1CA 2K86A 4QWQA 3IWZA 3OYIA 1ORKA 2KDOA 1JKPC 1XGSA 3QOEA 5F1RA 4WXDA 1RNLA 2LYCA 5B1AH 1RR8C 5HLHA 2NYXA 2KRCA 1O7LA 3FM5A 1DP7P 2EJRA 4S05A 3W6JB 2WAEA 3GF2A 1FEXA 1WJAA 1RUOA 2Y2ZA 1U5TB 1E17A 3E7LA 3A1YA 5E8IA 4CH7A 1USTA 5CVUA 1W36C 2IRFG 4M9ZA 4C9YA 3ERED 3FM3A 2R7OA 3ZQGA 2AQFA 1V54H 3VEPA 1QHGA 2VBXA 5C44J 4N0BA 1I27A 2QQ8A 3MEXA 2R7TA 3CJNA 2D1VA 3QP5A 4F7ZA 3KETA 2NOJB 2ZJPF 2Q1ZB 1TLHB 2K9MA 2P0WA 1FYMA 3ZN0A 5F1JA 2F5EA 3RPQA 3EUKL 3IH4A 1S3JA 2DMQA 2K9SA 4LB5A 5LEKA 4B47A 1IDZA 4E7KA 3LQRA 2V1NA 3RSNA 3D5RC 3QQAA 1U2WA 4I0BA 4HW0A 4ABZA 2FBIA 4B09A 3CUQA 1B6AA 1OCRH 4MFEA 4PFOA 2KL4A 4PFPA 5FRNA 2OQGA 1LDKB 4I0AA 1DP3A 1MNMC 1BI0A 4CCMA 4I6ZA 4E7LA 3OYLA 3G3ZA 3J7ZI 3HRUA 4DW6A 4PCQA 4IL6C 2XAJA 2QLZA 5DUIA 3PIOF 5LD2C 4LG3A 4IHWA 2XAHA 3GZNB 4PGHA 5ICFA 1YRNB 1Z67A 2E7XA 1UZCA 3E5UA 3BCBA 2DODA 1HW2A 4XKVA 2OCEA 3CJTB 1IJWC 1YS7A 2VQLA 4FTHA 2LLKA 2E19A 4MFDA 3AFHA 2LDUA 4MLOA 1OCCH 1ZTRA 2B7EA 5HS7A 3L2VA 2E2JJ 5DEQA 5B3SH 1GHCA 2P81A 4NC7A 4CYCA 4G8XA 1RETA 1Z9CA 2HXOA 2K9QA 2FOWA 3GTMJ 4CCJA 3BTLA 4EJVA 2VE9A 1HOMA 5CVIA 4KN4X 2R7DA 3I9V2 2FOKA 2O61A 1N78A 4LGWA 1V3FA 4LIVA 1S5LC 3HOYJ 1S9HA 4OWRB 4B43A 2EA2A 1T8IA 2R5ZB 3CCSI 3K1PA 5D4SA 3DBLB 1XMAA 3BLYA 4A6EA 1UJ8A 3CCJI 5IT9K 3ROUA 3MZYA 3TBIA 3V8KA 1HCRA 2HKOA 2X85A 2H1LA 2KISA 2Y69H 1ENHA 1BJAA 3M8JA 4HV6A 3FXOA 1WSUA 2WTEA 2XSJC 1TWFJ 2DQRA 1ETWA 2RKHA 2Y30A 3C2BA 2YS9A 2CQ7A 1I50J 1P6RA 3K6GA 1JXSA 2O3FA 1LNWA 1LKXA 4CCOA 3ZR8X 4A69C 2R0QC 1IXCA 3CQZJ 3HUGA 4DYQA 4AD9A 1I39A 2L5QA 4XKCA 3OS0A 1FIPA 4F91B 3IL2A 3TQNA 1KU3A 3TDUC 3GTQJ 2ZMEA 1JUSA 5F0FA 3HXLA 4R79A 2GOXB 4ZYAA 2LRDA 3BR0A 3OS2A 4RAFA 1O4XA 1TT0A 2COBA 1MSFC 2VT2A 1K4TA 1Y0UA 4YG2F 2LBFB 1ZN2A 2ZJ2A 3ZMTA 2E1OA 1SD6A 1B72A 1BOBA 3L1PA 1VI0A 2Q2EB 2V7FA 3FK7A 1Z0XA 5EF6A 3OSGA 2HVRA 1IXSB 3B6AA 4BKXA 2BXYA 3QAHA 4UVCA 5JVTA 1BI3A 5L3EA 4ZYDA 2R4GA 5GPAA 4BY1J 3SFZA 2FQ3A 5FJ8J 4L5EA 1XPXA 1OKRA 2M7AA 2XF5A 5EGOB 2DJIA 2HQ5A 4MQVA 3FXQA 5HDKA 4Q5SF 4JP0A 3GTKJ 3ULQB 5FB2A 2WBMA 4RB3C 3CP8A 1UAAA 2M1BA 1W1WE 4C3HJ 2VBYA 4XQFA 1SAXA 3V7SA 2DMPA 4MIMA 1PVEA 4IQ4A 2XGXA 3HEFA 1QPIA 3BR6A 3SFIA 1ZGJA 3E6BA 1RKTA 2CUJA 2DPUA 2E7WA 1R23A 4L9JA 1TZLA 1T39A 2FD5A 3OIOA 5ICCA 1XSXA 4HA8A 1JJ8C 3S1MJ 3I59B 2O03A 3GLXA 2KZGA 4GFBA 1OYIA 1Z6TA 2JVHA 4U87A 1V4RA 3LSPA 3EUHC 2DFFA 1FLIA 4WK8F 1R71A 1O3SA 3WTZA 4UHTA 2DMNA 3M1CA 4IOAF 4XL9A 4XLPF 3K9TA 2CGPA 1P4AA 4NC8A 2HEOA 2JUGA 4KITB 4BACA 1HDDC 1J7KA 2L9SA 4KICA 1HC8A 2JK3A 4A2UA 2BYVE 4Y17A 1B4AA 2VT3A 5BS6A 1VQOI 1IRZA 1E3OC 2OTJI 3S1NJ 1UG0A 5D5XB 2CQKA 2QKLB 3Q9VA 3PM1A 4BGDA 1OR7A 3HRTA 1GVDA 3I53A 5FLXK 2IP2A 3VB2A 1LE8A 2MD0A 4LOCA 1TWAJ 4XN3A 2GXGA 4P9UA 2KIMA 5L3BA 4RAYA 1JGGA 3HRMA 3SQNA 1FZPB 3ZQ7A 4V19K 2JA2A 3IAM2 2BY2A 2HNHA 3MKYB 1YJ9I 3QOPA 1SANA 1WGXA 4EGZA 2D45A 2RREA 3ZQFA 2IA1A 3Q0UA 1FP2A 1Z21A 3B73A 3HZJA 2J5PA 3LSMA 3F3XA 5TRDA 3F9KA 1XMXA 2H09A 2UXXA 1P4XA 3P9KA 2L02A 1JUPA 1SAUA 3RZOJ 2ISYA 2YSRA 3AG2H 2DJNA 2BVMA 4OU0A 3CC2I 1OPCA 2W85A 1Z6RA 1VQNI 2VLAA 1X1DA 3OYMA 3OOUA 5HOOA 3L2QA 1REPC 2I5UA 5IPAA 1GV5A 3F72A 4G7ZF 3GTLJ 1R4NB 2HZTA 1FMVA 1ZAOA 2CSOA 1MJ9A 2QKMB 1MMAA 1Z05A 2PMUA 4M3DA 1ZRDA 2CO5A 4CYDA 1K79A 2CMPA 1MH3A 2XAGA 4EMSA 4A12A 1G2HA 1QZZA 2CW8A 3ZQLA 3I56I 1TTYA 3RKXA 1ON1A 2A6HF 2OV7A 4ENKA 4UY8I 2ELJA 2JVGA 4H4KC 2W25A 5AONA 4ZH4F 4E7SA 3VODA 3UNGC 3HHGA 1D1BA 3LSTA 3LWFA 2CWEA 3I0TA 2IAIA 4BYYA 4D7NA 3M1EA 3K4MA 2M34A 4XSZF 1F9NA 1OCPA 1MZBA 4R8HA 2YX7A 3BG9A 3BG5A 2ZSHB 1KQ8A 3NEUA 1SFKA 3ZCOA 1JT6A 2COMA 3U1KA 5KHDA 4EGYA 3P7NA 2OQRA 3HPHA 3S1QJ 1Y8RB 5IP6A 2LKXA 4U0VA 2BHZA 2XSDC 4XLNF 3HGGA 2V79A 3GFJA 1FJLA 3CUQB 4NC6A 2K27A 3KZZA 2ZXIA 5D5UB 4L9TA 4HAMA 1SFOJ 1R7JA 2M87A 2WB1A 3D5SC 1QA6A 3JRCA 1LVAA 4BXXJ 4M9SA 2IS1A 4BEHB 1S7EA 1MBFA 1S7AA 4A3EJ 2DYSH 5CVJA 3L7WA 5LGTA 3C3WA 1DU0A 3L09A 3JRFA 1U8RA 5DUKA 2IS2A 3WTTC 1CQTA 2M9HA 4A3DJ 3K4BA 2HWVA 2LVSA 1P2FA 3DU6A 2NVUB 3HOTA 5L3GA 5ERIA 4RS8A 2ECCA 4RLQA 3JRAA 1FNNA 1QBJA 1NK2P 1R5ID 2W7NA 4DZPA 5E17F 2JQ7A 3TO7A 3PQKA 4LK0F 4DJAA 3CJRB 1IGNA 4CYCB 2KDZA 3VPRA 2VXDA 2HGCA 1TBXA 3J7YJ 2LG4A 2EQRA 2GBYA 3SZPA 3MVPA 4ZYEA 2R5ZA 1QU3A 2E34A 1FWZA 2WAFA 3K4JA 4RM2A 2XF6A 1H0MA 3MAJA 1WRJA 2LNBA 4BL0B 1MMNA 3JAMK 4Q47A 5KCMA 3S93A 4M72A 3E3VA 3T5XA 2K7LA 1E3HA 4RM3A 4BJ6C 3I54A 4OINF 3BZKA 4BBSJ 3PUBA 5LHHA 2EZIA 2MH2A 4KMUX 3JRDA 2VBWA 3FK6A 4MEXF 1T08B 4W1UA 1ZLKA 3GFLA 3GTPJ 3F23A 5IT9Z 1RPWA 2L9VA 4P9FA 3NWSA 5CVVA 2DLLA 4ASNA 2VQGA 5ILVA 5HLIA 1AKHA 2P5VA 3CC4I 5J40A 1SMTA 1NHAA 1EH6A 2F5FA 2X1CA 3IP4B 5JI6A 5EZGA 3FBNB 3KP7A 3RYRA 3ECHA 1BI2A 1R22A 2GZWA 4ESJA 2LY1A 1X1BA 5C4JJ 1E0EA 4XKWA 3X2QH 3L2RA 3F21A 4BDZA 3FMQA 3DTKA 1W5CC 3AL0B 1MGTA 3OYFA 5H6RA 2LBFA 3I3LA 2ZMEB 1UG2A 4HSTA 5FO5A 2HQNA 5J1YA 2Y9ZA 2JA8J 3DXJF 2HDDA 4S04A 5JHFA 2Q2EA 3P9CA 2KMUA 2GIVA 2GXBA 3EUHA 3KP6A 1P7JA 3K4KA 2Z5UA 4YFXF 2OU2A 3R61A 4IRHA 5D8KB 4RB1A 1D5VA 4E7JA 2H27A 3CCRI 3QYBA 1JTXA 5LEJA 4DYCA 5EGOA 4G7OF 2M8GX 2KP6A 2OUMA 3QU6A 1TW2A 3K0LA 5JR3A 2R93J 1G3WA 2F4OB 2MH9A 4KDPA 1X4PA 2OPTA 2L7KA 4CXFA 4CZZA 3PNVA 5FFXA 3L2UA 1YW8A 1T33A 1OFCX 1D0YA 2FXAA 4HX8A 3JREA 1R36A 4G7HF 2OJED 3NQOA 3BPXA 3E97A 1V5GA 2IXSA 2HOAA 1P9QC 2CQNA 3C18A 3WU2C 2BW3B 1FBUA 2MLKA 1GDTA 1B9NA 1KQ9A 3I59A 3M3YJ 3RQIA 2KKOA 2XGEA 1LFPA 4N9IA 3GLLA 2QM3A 3C2HA 4G94A 3Q5FA 1ITYA 2OF7A 3NAUA 2DOEA 1TQMA 2UV1A 3PL8A 3WE3A 4KFCA 2O8KA 2PMHA 2V6EA 2O5RA 5FGMA 1R5HA 3QODA 2E1MB 2MYSA 3ABLH 1DDNA 1QPMA 1ZRFA 3W3CA 1IUYA 1IG7A 3CCUI 3CCYA 4WF2A 1K7AA 2V1UA 2BY3A 4G6TB 5D4RA 4M3FA 4XRSA 4F93B 3A4CA 3CCVI 2F6CA 3ABMH 2F2EA 4M6VA 2K3FA 2KZVA 2X9DA 3FXJA 4AUXA 5KNLA 3DKXA 5M5XJ 1VQPI 2OTLI 4ZYGA 4XLCA 1ZK8A 2IA0A 3GZ6A 2VQHA 2R7FA 4Y15A 2PJRA 4KJZA 4XICA 2W48A 5EEGA 2XVCA 1UMQA 5K1YA 2XKOA 2HYFA 3V8LA 2M7BA 5FLXZ 3ML6A 3WGGA 2IA2A 5FD5A 3PFIA 2V9KA 1ZREA 3AAFA 3GX4X 2DA5A 2M45A 4RB0A 2D5VA 5ED4A 3RTRA 2CV2A 1TP4A 1XC5A 2FJ1A 1I6XA 2HYGD 2Y9YA 4IHVA 4ENMA 4HNTA 5E3LA 3WE2A 1SEUA 1RKWA 4HG2A 1KYZA 1B8IA 2IEKA 5JFRA 2RVCA 3DQVC 1PP7U 4Y7NJ 4PJJA 2EZKA 2GWRA 3ZQHA 5CQGA 1V5EA 3OIQA 5BMZA 2VOOA 4IHSA 4HLYA 1XN7A 3EYYA 4J19A 1L3LA 2O7OA 3H9QA 3QPLA 5CYVA 3RDIA 3FHZA 4OIRF 2QA4I 2EILH 2P5KA 3DU5A 5CPRB 3D1NI 1R49A 3VWBA 4PUSA 3MZ8A 4KN7X 3ZGKA 5FKMA 2X1EA 5DYMA 3W2AA 2A5WA 4A3BJ 3HOVJ 4XMYA 4AIHA 1OCTC 3F8MA 1XX5A 3WTVC 1WJCA 1JGSA 2M5WA 3HOXJ 4RLFA 4YEJA 3F8FA 4MO7A 2ZXJA 4LD5A 3Q3SA 3H5RA 4RBOA 3DEEA 4PJ0C 2XHKA 1ACIA 2DMUA 3P9IA 3H35A 1FBSA 2LREA 4AYBA 4UXNA 2GA1A 4Y13A 2R5YA 2VQCA 5FROA 4XLAA 1FC3A 4MNUA 4RA2A 5CKTA 3IRQA 3A2KA 5F27A 4DYRA 3GBGA 5D5WB 2L7FP 3JW4A 3F8BA 4RGRA 1DGRM 2XGCA 4IPAA 4JQFA 2L2OA 1IN6A 1WH5A 1O3RA 2G0EA 3PQJA 4LK1F 2AXTC 1XCBA 2EFNA 3SDBA 2YR2A 4YRVA 4PK4A 2GLOA 1WCMJ 2TCTA 2GA2A 4AVPA 4L0YB 3SXYA 2BV6A 4EJWA 3ABTA 1QNTA 3OMYA 4BEHA 2M4KA 3NWTA 2WWYA 3W6KB 1HLVA 3U9GA 2VPLA 2OZUA 3ONQA 3W2VA 2DQLA 4D5CA 1X1PA 2RAEA 1I3AA 3RKWA 1Y56A 1WJEA 2ELKA 3TW7A 3GWZA 1BC8C 2EFOA 4BDYA 2EIMH 2VONA 3FMRA 2NS8A 3B6CA 1KU2A 2P7VB 4FQGA 2WAQN 3FXRA 2VC1A 2ACJA 3L2CA 1LFBA 3BCAA 3QWLA 3OSFA 4ESFA 2Z33A 4BY7J 4IHTA 2EIKH 2LY2A 3D5LA 1UHWA 2KJBA 2OAZA 2L0KA 4A0YA 1EH7A 1ETXA 2DT6A 3ASOH 3HC7A 5E79C 1OLTA 3WU0A 5DM6F 1VQ9I 1WHUA 3M7GA 3H92A 1OCZH 1X3UA 2F4MB 2QENA 1MBJA 1XGMA 3DPUA 5EJCA 4HDUA 3V7RA 2Y0SA 4U0WA 1NK3P 4O5VA 3TOAA 4I2OA 3CDHA 4IVNA 3VDXA 2XPVA 2HTJA 1MMDA 1TWHJ 2RGVA 3T1BA 2GXAA 2MW8A 1SFUA 1XGNA 2XUBA 2LFBA 4EM0B 4D7MA 4U7BA 1ZR2A 4L5JA 4RMNA 4FASD 1WKMA 3H3ZA 4PJNA 5A2QK 2L4AA 3IKVA 2M3AA 3JAMZ 4Y52J 2Z16A 1TNSA 1WJDA 4GYIA 2DU9A 4YIRX 3F22A 3GO5A 1A6QA 4G12A 3HOWJ 3BPVA 3FXLA 1RESA 3G6EI 3T0YA 2GM4A 2Y48A 2JZYA 1PUFB 3K1MA 1IRXA 4EV0A 2KRHA 2BGCA 2G7HA 1YO5C 2DOFA 2W82A 1YG2A 6PAXA 4OMZA 1AKHB 2H6CA 1G3TA 1F43A 2ZNYA 1UELB 3EPZA 4XNFA 1E2XA 5BOXA 1SFEA 2V9PA 2A69F 4OAZA 4KNYA 4X6AJ 1SD7A 3OYKA 3R60A 2LMDA 1IAWA 2Q0OA 1T95A 2I10A 2WA0A 3DBRB 2BOLA 5GP9A 4M3GA 1XTAA 2FBHA 1XSVA 1MMSA 1JHHA 2MD5A 3WG7H 4KIBA 4XSXF 1YE9A 3HBLA 1U3EM 1WH7A 3K10A 3IWFA 3HOZJ 1U6GA 1FSEA 4DOZA 2XROA 3MD2A 1TQIA 3PO3J 2AS5F 4NQWA 2HOSA 1Z7LA 4JX6A 1GUUA 1W5SA 4LLGF 3K2ZA 4D1QA 3LAPA 2JWTA 1U0JA 4UB8C 2XKPA 1TT5B 1XGOA 3WGHA 2IGKA 1K6OA 4CGZA 4XBFA 2VKDA 2IS4A 2D2WA 5LHGA 1SVMA 3KEYA 1FP1D 4ENNA 2XRNA 3CCMI 3DEUA 4AIKA 3KYCB 2E5ZA 2BW3A 4V2GA 4KIGA 4ON0A 3MWMA 4XM3A 1R5GA 5FRMA 4UNOA 1XMKA 3EETA 4L0ZB 4J00A 3S2WA 1NTCA 2JPCA 3GTGJ 1A6IA 3IC7A 1QGPA 4XRFA 3K2AA 4GXOA 2LK2A 5EDNA 1P92A 2W1OA 5E18F 1XD7A 3O8GA 2NVYJ 2FNAA 1PJRA 2DFHA 3NARA 2R7QA 4L18B 3AG1H 4AIJA 3FF5A 2PI0A 2IJLA 2W57A 3E1SA 2HFHA 2MG4A 4ZJZA 2M0CA 5D6EA 3F0CA 4D5FA 4KISA 5E3NA 3FXKA 1LDDA 2NAZA 3U2RA 3PIPF 2QWWA 3DKWA 2Z3YA 5F6FA 2LH9A 3S3OA 3HKZA 3K4CA 4XLFA 3U21A 3GXOA 4OAYA 4MHGA 4AU7A 1VQ8I 4A3CJ 3CESA 3CDLA 3PSIA 3OL4A 4HX7A 4LB6B 2GOMA 5L3FA 1FMWA 5GTHC 3REOA 1J59A 3ZOBA 4E7HA 2KRFA 3L00A 3OWTA 1LVKA 4IKFA 4II2A 1D1AA 1MJAA 3K1NA 3ABUA 3MKWB 3BQYA 2RNGA 2R7VA 3ZN1A 4I02A 2DPDA 3F8CA 4BHCA 3K70D 3TO6A 2JA5J 1Q1HA 3S16J 2P6SA 4Q48A 2C6YA 3O8HA 2PBIA 1R58A 3LSKA 1FTTA 3HM5A 3LSRA 2PJRB 2IGOA 2QSGX 5DD4A 4PGGA 4BJTA 3I4MJ 2CUFA 1AWCA 4YIIA 1N25A 3SDGA 1W0UA 3SEZA 4WCGA 2HQRA 3BROA 4PZJA 4A0XA 4BH9A 3I64A 3DLLF 4C2MJ 4H0EA 1FYKA 2PMZA 5GPCA 2XAUA 5ILSA 4IF4A 3ZPLA 5GAHJ 3S1RJ 1YHQI 5HVQC 4QLCU 3VOEA 1ON2A 2YUSA 1G8XA 1T98A 2DA6A 2H94A 4C30A 1O57A 2MC3A 2XF7A 2QZ8A 1B8IB 3CMEI 2JRTA 1ETOA 1SD5A 2YU3A 4XKBA 2EZHA 2E35A 1YX5A 3OYEA 1YS6A 2X6WA 2JRMA 2VXZA 1YW7A 3BZ6A 2CQQA 2X0LA 4IRGA 1HA8A 2G9WA 3WTSC 4RAZA 1SC7A 1YQAA 2RDPA 1J0RA 3HJEA 2VN2A 3GEZA 3PUFA 4S0HB 2K5CA 3S32A 2R92J 4IOCF 4P5OA 2EFWA 3MKZA 3J7AO 1QHHD 5K5RA 2R7WA 3C7JA 4LFUA 2ESNA 3DP7A 4QPQA 1YI2I 2RN7A 2PEXA 1VQ5I 1S8NA 2GIZA 4YELA 3SZTA 1MKMA 4BXUA 1MH4A 2DCEA 4B3XA 4B4CA 4FE7A 4A93J 2V4JC 3T8TA 3S8PA 1U8BA 3MZHA 2PQ8A 4LJZF 3WODF 2DI3A 3LFUA 2QQAA 2STTA 2IBDA 4HOBA 2OA4A 4FX0A 4Z2YA 5GAEJ 3FXUA 2R5YB 1R9TJ 2F48A 3TL4X 4OIPF 3H3VK 2ZBKA 2PN6A 1QRYA 1J5YA 1VQ4I 1GV2A 4BE0A 1F1ZA 1POGA 3JRBA 1L0OC 4YFNF 1X2MA 2XIGA 4V2FA 2WV0A 4HRIA 4IX7A 1AOYA 4UVBA 2M8EA 1NH3A 3IAS2 2FF4A 3OR2C 5LLQA 1V55H 2VOPA 1EH8A 4I76A 1FX7A 2E5NA 5E8GA 1DPUA 2HDWA 1IXRC 3BR2A 3R0AA 5F64A 4UUVA 1KONA 4HNUA 1I6HJ 1IRGA 1HW1A 4B48A 3HPGA 4BQOA 1J9IA 1MJBA 4KUMA 2DO7A 1UHSA 3R4KA 2L7MP 3RKYA 2IVMA 4YFKF 3PJRA 2P8TA 2BY0A 3G73A 2L7ZA 4IXAA 4NB5A 1STZA 5M5WJ 1NG6A 1OYWA 1HQCA 3OY9A 1K78A 1IO2A 4EJUA 1YIJI 3JTHA 4HV5A 1LEBA 2DA7A 3C1DA 4HQMA 4HDVA 4G9YA 4M3EA 3HTSB 4F55A 4HPQA 2DA2A 2LKSA 3DKYA 1X4OA 4AYBN 1BR4A 1ZG1A 2DFEA 4B8XA 3S2HJ 1WJBA 4M74A 4II3A 2CYYA 4KYWA 4PJLA 1D1CA 3G1LA 1HF0A 1FYLA 4UV8A 3O2PE 4HX4A 3M8FA 5BPIA 2MLGA 5HNHA 2F5CA 3ECOA 3RKQA 1FBQA 2O0YA 3HB9A 4XR6A 1LFUP 1PDNC 3CMAI 5J8CA 2NNYA 3FWEA 2CG4A 2ZFWA 3J81K 1W36D 1IV6A 1ETKA 3EDPA 4MQ9F 4RDUA 2K3PA 4G6DA 3OV8A 2YPRA 4CZCA 4O6JA 4WXHA 4M6XA 5BNGA 2QBYB 3IKTA 3TGNA 1MBKA 1PUFA 4L9VA 3OS1A 2OZ6A 2MA3A 2QSHX 2M2EA 3BJAA 4FX4A 4IHXA 5LHIA 3GUDA 2TDXA 2VC0A 1ETYA 3LSGA 1ULYA 1WWXA 5A2QZ 4UUTA 4CUGA 2HVSA 2LF8A 1MSEC 3BJOA 3GVAA 1SVOA 2MC4A 5B5EC 4A3KJ 2CV1A 2K02A 4GRIA 3LA3A 3HRSA 1LJ9A 2Y0MA 3FZVA 3BT9A 4XLEA 2MGQA 2XC7A 3ISPA 3PO2J 2GQQA 2BE5F 3DPLC 2L9RA 3HG9A 2UZKA 3IH3A 3GCMA 4XLHA 1Y6IA 2FX0A 3ESWB 4LIUA 1O3TA 1JUMA 2JUCA 2FUG2 3OYJA 2ZJQF 1ZG3A 5IP7J 2JJ7A 1BA5A 5HS8A 4M71A 3OYHA 2XGDA 3HL2A 2MFZA 1R1VA 2Y0SN 2NVTJ 2BXZA 2JMWA 5CVRA 5IYDJ 4NQWB 5K7FA 3DBHB 2WY7Q 1W0TA 1H8AC 1PUEE 2FSWA 1IN4A 1ZLJA 1AA7A 3DV8A 5JLWA 3ZMVA 4AM3A 9ANTA 4GCVA 2XASA 1MDMA 1ONVA 4UB6C 1VNDA 2W4SA 5B1BH 3BR3A 3BTCA 4ZDOA 1HSJA 4QPOA 1FIAA 2GAUA 1XCVA 2F5VA 5JHUA 1E3PA 2DK8A 4EM2A 2X6XA 2X48A 3FBIB 3QPTA 4J01A 3HIFA 4ZYHA 4BS9A 1J75A 3ZXSA 1V5FA 5EYRA 3CUOA 2ZJRF 1D5YA 4DZJA 3BTIA 5LGUA 4BBRJ 3KLNA 1IC8A 2EV5A 1VTNC 2EV6A 5E20A 3WHBA 1KZHA 5K7ZA 5K5QA 1HW5A 2FMYA 2JTVA 5IYBJ 4ZZDA 5E1ZB 2VJIA 2R7ZJ 2STWA 1ZGAA 4L5IA 1VQMI 2K85A 3DTEA 1BJZA 1W4MA 2DA3A 1RC9A 4AWXB 5CQEA 2AO9A 4FE4A 3KYLA 3HDDA 3B02A 2FRHA 2MBFA 4FHTA 4AC0A 5HLTA 2W24A 1Q1VA 3F6OA 3I4NJ 1Z7UA 4PDKA 2A6EF 5DS9A 1ZKGA 1ZQ3P 4RGSA 3JRIA 1YOVB 4HSRA 1CF7B 1IV8A 1TW3A 2KT0A 4X0GA 1F36A 3O3KA 3TKYA 3EUAA 2FNPA 3G2BA 2A05A 2HYJA 2KIUA 2X4HA 5DV5A 2HPMA 2EPFA 3CCLI 1SD4A 4D0PA 1DPRA 2ZB9A 2HI3A 4A3LJ 4X1EA 1HKTA 4MTDA 4ENJA 5CLSA 2FBKA 4ZDPA 5DCFA 5CJ9A 4B3AA 1UHMA 1LPQA 3BG7A 4E4HA 1BL0A 3GFMA 4EATA 1FOXA 1QVUA 4ZTFA 2ZXHA 2VJ5A 2XPUA 4B44A 3SZGA 5E3MA 2W84A 2QUFA 4OOIA 5IOZA 3BZCA 4PJMA 1MMGA 5ICEA 1R1TA 2VPRA 3CJQB 3LAJA 5IP9J 3H9GA 3E0JB 2CJJA 4R1HA 3KX2A 3RQ4A 4CICA 5GAGJ 1S7OA 1R4MB 2K9LA 4P55A 1FTZA 3HKZN 3VFZA 1JKQC 5DCMB 2LOOA 4DGWB 3CTAA 1ERDA 1EF4A 4Y4RA 3LSJA 3G71I 3E6CC 1W5TA 5K7HA 1YTYA 3OYBA 2JN6A 5ICGA 3BQZA 2KIFA 3COAC 2E2IJ 3BP8A 2NOGA 3MN2A 2A6TA 3VYUB 2H6BA 1WI3A 2EFQA 5J4VA 2HOEA 3ASNH 2NNNA 1OR7C 1PP8F 2CW0F 3ZQCA 1LQ1A 2W00A 1OJLA 2O8XA 2ME0A 2HU9A 1A5JA 1MBHA 4F92B 1G59A 4CDGA 2CU7A 3J80K 2FQ4A 2EA4A 1EV7A 4XONA 2QEXI 2PMZN 3OYAA 2AHQA 1J2XA 4XRSG 3KYDB 2HXIA 2X6OA 3K69A 1TC3C 3PNYA 2A07F 2XB5A 2QGUA 1MNDA 3CLOA 3CLQA 1HSTA 2HKXA 2IW5A 4IO9F 3CC7I 5F0HA 3GZ5A 4HF2A 5F08A 1HKQA 4JYKA 1D0XA 1I5ZA 3OOPA 4A3FJ 5C4XJ 3GW2A 2KIQA 3W2WA 3G1MA 3UKGA 2VBZA 4EJOA 5F04A 1YJWI 1VF9A 4EJTA 1BIBA 3I4PA 2EFPA 2P6TA 1YLFA 3HOSA 5J8FA 2N8GA 1U5TC 4OIOF 4KIFA 4G6QA 3OR1C 5FKOA 2ID3A 5LRSA 4EM1A 5HODA 4DQ2A 1VQKI 4XK4A 2HS5A 5HS9A 4BAYA 3KEOA 1XSDA 2RNJA 3H5AA 1I1SA 5KAFC 1Y8QB 2TRTA 2VIXA 2F5DA 2VI6A 1K78B 4MEYF 3VSLA 1LEAA 3CP2A 2JA6J 3LSHA 4B1RA 2XDVA 3DWLE 3CD6I 2F4IA 4EVIA 3PFYA 2MSYA 3QPHA 3ZMUA 4A3MJ 2H8WA 3ZQIA 3ZMZA 3BWGA 4W97A 3K7AJ 4D9JA 3L2WA 2BZTA 2KFDA 4MTEA 3VYRB 3CO6C 1H88C 3LQQA 1T38A 4C2TA 1O7FA 3F8NA 2LF7A 1ZR4A 2EK5A 1IN7A 2CFOA 4GYGA 4HZFA 1OCOH 2MABA 5EEHA 2LC2A 2EV0A 2IT0A 2QBYA 2CS3A 3WU1B 1BC7C 1OQYA 2FEZA 4M6YA 3H36A 5TJJA 2WB1N 1LB2A 1YW9A 3I71A 1MBEA 4BQNA 3BJ6A 1VQLI 4LMYA 1JJ6C 1W7PB 1Y1WJ 1D3YA 5KK1A 4HF1A 3BC8A 3J81Z 4GO1A 3RPUA 4KT5C 4M3BA 3O6BB 4NUBA 1JE8A 3BR1A 4EQQA 2CFXA 5M5YJ 1G6NA 3LOCA 1DQUA 3R0JA 4LLLA 2DTZA 2CH0A 2ADUA 3PSFA 1TQPA 5FKLA 2LD5A 3JR9A 1FOKA 1KGSA 2A68F 1K61A 2M4GA 4AIDA 2LR8A 5FD6A 4UVAA 4JOMA 2J5OA 2HTSA 2ZKZA 3RCOA 3JCUC 4WWCA 1RRJA 4QTRA 3G1OA 2ISZA 1S6LA 1VFCA 1IN5A 1GVJA 1TL8A 3IRRA 3M9AA 2YX4A 4CA0A 2JPBA 2RC4A 2DDAA 3IV5A 2V1DA 2XAQA 5H6QA 3EQLF 4I7HA 3OYDA 4BNCA 1OMIA 4IZZA 5JLXA 2R3SA 3S3NA 3S17J 2ZFUA 4DBQA 1FSHA 1FT9A 2Z9OA 2K9NA 1BN5A 1H89C 3KLOA 2RQPA 5L3CA 3V42A 4DNCA 4UUSA 3OL3A 5J4YA 3A0BC 3WTXC 1VQ6I 3ZQQA 1MDMB 4ZZLA 1RR7A 3WGIA 3I55I 3A03A 1Z91A 1FOWA 2UUZA 3RI4A 4IJAA 4BHPA 1X19A 2EINH 3CMMA 1BW6A 3F6VA 4I01A 4I98B 2E2HJ 3QYFA 2B9SA 1F5TA 2O9LA 1Z3YA 2L3DA 2A5YB 4TV7A 4QIWN 3S14J 2PFBA 3S15J 4AVZA 3HSRA 1FOYA 2B0LA 1P4WA 1T56A 2DFIA 3ABKH 3FMSA 3FHNA 3RJPA 4OMYA 3A01B 2OC6A 3BTJA 1WJFA 1BBYA 5DD8A 4FCYA 1UCRA 4BQAA 3ZRGA 1YX3A 2JT1A 3ELKA 4A5NA 3CF5F 3KCCA 4F3QA 4U7DA 4CO8A 3OYGA 1AU7A 2H1KA 1XDSA 2PJPA 4E6KG 4BJ5C 3ZP5A 1JTYA 3KEQA 3WTWC 1WJ5A 1HBXG 1B1BA 3IUOA 5BPDA 3KFWX 1A31A 2L01A 2VODA 1BOAA 4C3IJ 1TWCJ 1U9OA 3H0DA 1K6YA 1TWGJ 3WHCA 1A36A 3KZIC 5BQTA 2RV8A 3IH2A 2EH3A 3BDDA 4FT8A 3JRHA 3V4GA 1X3ZB 2ELHA 4P1WA 2R7SA 1CF7A 5IT3A 3MQ0A 3E5XA 1KA8A 3CCQI 2EIJH 1JKOC 1X3WB 1SVLA 5E1WA 2OBPA 2XAFA 3M07A 5DTDA 1HDPA 2DW4A 3L9FA 1BW5A 3OIPA 4XORA 4K2EA 4GDFA 5FKNA 4HEA2 1YYVA 2FU4A 1ZRCA 2VL8A 1XDUA 1R1UA 5EG0B 5M3FJ 4CCLA 2V9VA 3FX3A 3JRGA 3E6MA 1CGPA 2I8DA 2IGMA 2HZDA 4LG0A 5LBQA 5D5VB 3BG3A 2VASA 2Z99A 2VKEA 1ODDA 3A02A 2JSPA 2LSOA 2VKVA 2CQXA 4NDLA 4OIQF 1K83J 1MNEA 3FKJA 5B66C 2DYRH 3HYIA 2QYOA 2ZC2A 4Q4ZF 3S2DJ 1GXQA 1K4SA 1APLC 5DDGA 4WX9A 5D6FA 4F52A 3KPHA 3AG3H 2CUZA 3H3UA 2EZLA 5FFZA 1B9MA 1FY7A 2ECBA 2L4MA 3DTIA 3R6SA 4IRIA 4RB2C 2JA7J 1A04A 3G4SI 2E71A 5DCMA 5JVGF 3J7AY 4XN0A 3KP4A 1VZ0A 2VJJA 2ZXWH 4A3GJ 2PG4A 2FMLA 1SFXA 2E1NA 2WV1A 2X1DA 4LITA 2BEOA 2ZNZA 5FKKA 2R7RA 4JK1X 1D8KA 2QQ9A 2ME6A 3DCFA 3RPUD 2K4BA 4JBAA 1MBGA 3DFGA 4A5MA 3LMMA 4ZDLA 4LLNA 5ILUA 2DN0A 3I5UA 1Z77A 3HSFA 4ETSA 2E36A 4KT6A 1U5TA 5LFAA 2LY9A 3QYEA 4YIFA 2E1CA 3U1DA 4BHBA 5J1RA 2LTPA 3GFIA 3IHUA 1H9GA 4E7ZA 4CCKA 1BM9A 2WAQA 1HKSA 5LRRA 5GADJ 3TOBA 2LKPA 1YIOA 2BVLA 3ZMSA 1XG1A 2CV0A 4HQEA 5AIQA 2YU9J 3CDIA 1Z1DA 2KJCA 2ETHA 5KVRA 2RQQA 3S3MA 2NS7A 2HPIA 3BR5A 4UV9A 2P5LC 3LSIA 5HDNA 4HBLA 4IEJA 4A3IJ 2O6GE 3FKIJ 5HNFA 2HOTA 1T0FC 3ZMDA 3J80Z 2BY1A 2DDBA 2CRGA 3JTGA 3KP2A 1U78A 1GT0C 1IDYA 4MGRA 5M3MJ 1WVRA 4P96A 1NG7A 2M0MA 1KU7A 3KP5A 2Y31A 3D0SA 4IHYA 3HHHA 3LFKA 3HGYA 1WFXA 4ZTJA 4RGUA 2K4JA 2NXNB 3LA7A 1RI7A 4Y33A 4O3MA 3V8JA 4XIDA 3HTUA 5LGNA 3E6DA 1XB4A 5J1UA 2ESHA 5C3EJ 5E3OA 2A3SA 1R6RA 2A61A 2CUEA 1XS9A 3TP3A 1YRNA 2V1XA 3EYIA 2DXIA 4KA4A 3JSPA 2DT5A 2X6YA 3LL7A 3GMEA 2B63J 2ZO4A 3UR3C 4M73A 3A0HC 1B59A
chains in the Genus database with same CATH topology
3W6VA 2VB6A 2VJ4A 1DGWY 3MMYB 1Y1VJ 3OYCA 1JT0A 4PSXA 4DIQA 2XB0X 5EZHA 1JKRC 3DLAA 2NVXJ 1ZELA 4BUPA 1P7IA 5IOYA 2QF7A 2AQEA 2H8RA 4BE1A 3VYSB 1PYVA 3VYTB 4C3JJ 4N4NB 1WPKA 5IYCJ 2DA1A 4CCNA 1ZGWA 2LP0A 3FDYA 5F0CA 3SJMA 1IUFA 2R7UA 2HVQA 4E7IA 1J09A 3PNTA 1JI8A 4BE2A 3Q0WA 2R7XA 2QCOA 3K4NA 3FISA 1BR2A 4FISA 1MW7A 5EEAA 4N4OB 3K70C 5J3LA 1N77A 2KHMA 4BU2A 3VSKA 3QPSA 3HUGB 4CSWA 4IQJA 2ZSIB 1EA3A 3OYNA 2Z2SB 4HNVA 3H5NA 2IS6A 3RZDJ 4C2UA 3MKLA 1BR1A 4QSHA 1U9NA 1N75A 1B72B 3SYTA 4XRMA 2UWMA 3SEQA 4DBRA 3AKZA 3DPTA 4UUSB 3TEDA 2NVQJ 3TMOA 4XOPA 1AHDP 4ANJA 2DMTA 1X2NA 5FLVA 2XRLA 3LNQA 4ZC3A 3A01A 2KPMA 4ITVA 2XPWA 2K40A 4BQQA 3AL0C 4A3JJ 3FIWA 3H0GJ 5TGTA 2VKHA 4Y3OA 4BXFA 3N05A 2WADA 1GLNA 1X58A 2E60A 2HQAA 3CF2A 2V26A 3BG6A 3TW6A 3H9JA 5EG0A 1ETVA 2WY8Q 2CW7A 3K4LA 2DOAA 3DEWA 2DT7B 1D0ZA 2EBIA 1ETQA 4NNJA 5FLMJ 2ID6A 3Q0VA 2VUMJ 2DA4A 2X51A 4FETA 4JX5A 2KLOA 2Z1DA 2L9NA 4JX4A 1LE8B 3HOUJ 1QVTA 2IGNA 1X1AA 3TP0A 4EEFG 4PSWA 2KQRA 3CZ6A 2E1MC 3M4OJ 3CMYA 4XOTA 3GTOJ 1I3QJ 3C2GA 1Z3XA 1DU6A 3GTJJ 1X1CA 3OYIA 1ORKA 2KDOA 1JKPC 3QOEA 2LYCA 2KRCA 2WAEA 1FEXA 1WJAA 2Y2ZA 3E7LA 3A1YA 4CH7A 1W36C 4C9YA 2R7OA 3ZQGA 2AQFA 1QHGA 5C44J 2R7TA 2NOJB 2Q1ZB 2K9MA 2P0WA 5F1JA 3IH4A 3EUKL 2DMQA 2K9SA 4B47A 1IDZA 4E7KA 2V1NA 3RSNA 3D5RC 3QQAA 4ABZA 4MFEA 4PFOA 2KL4A 4PFPA 5FRNA 1LDKB 1DP3A 1MNMC 4I6ZA 4CCMA 4E7LA 3OYLA 4DW6A 5LD2C 4LG3A 4IHWA 1YRNB 3BCBA 4XKVA 1IJWC 4FTHA 2VQLA 2LLKA 2E19A 4MFDA 3AFHA 4MLOA 1ZTRA 3L2VA 2E2JJ 2P81A 4NC7A 4CYCA 1RETA 2HXOA 2K9QA 3GTMJ 4CCJA 3BTLA 1HOMA 3I9V2 1N78A 4LIVA 3HOYJ 1S9HA 4OWRB 4B43A 2R5ZB 3BLYA 3TBIA 1HCRA 2X85A 1ENHA 3M8JA 2XSJC 1TWFJ 1ETWA 2Y30A 3C2BA 2YS9A 1I50J 3K6GA 1LKXA 4CCOA 3ZR8X 4A69C 2R0QC 3CQZJ 4DYQA 4XKCA 2L5QA 3OS0A 1FIPA 4F91B 3GTQJ 1JUSA 5F0FA 3HXLA 4R79A 2GOXB 4ZYAA 2LRDA 3BR0A 3OS2A 1O4XA 1TT0A 2COBA 1MSFC 2LBFB 2E1OA 1B72A 1BOBA 3L1PA 1VI0A 3FK7A 2Q2EB 2V7FA 1Z0XA 5EF6A 3OSGA 2HVRA 3B6AA 4BKXA 4BY1J 5GPAA 2R4GA 5FJ8J 4L5EA 5EGOB 2M7AA 2XF5A 2DJIA 2HQ5A 4JP0A 3GTKJ 2WBMA 3CP8A 1UAAA 4C3HJ 4XQFA 2DMPA 4MIMA 4IQ4A 3HEFA 1QPIA 3BR6A 3SFIA 1RKTA 2CUJA 1TZLA 2FD5A 3OIOA 1JJ8C 3S1MJ 4GFBA 2JVHA 4U87A 3LSPA 3EUHC 2DMNA 3M1CA 4XL9A 4NC8A 2JUGA 4KITB 4BACA 1HDDC 2L9SA 2JK3A 1IRZA 1E3OC 3S1NJ 1UG0A 2QKLB 3PM1A 4BGDA 1GVDA 1LE8A 2MD0A 4LOCA 1TWAJ 4XN3A 1JGGA 2JA2A 3IAM2 2HNHA 3MKYB 1SANA 1WGXA 2RREA 3ZQFA 3Q0UA 1Z21A 3LSMA 3F9KA 1JUPA 3RZOJ 1SAUA 2DJNA 2BVMA 2VLAA 1X1DA 3OYMA 3OOUA 5HOOA 3L2QA 5IPAA 1GV5A 3GTLJ 1FMVA 2QKMB 4M3DA 1MMAA 2CMPA 1MH3A 1G2HA 2CW8A 3ZQLA 2OV7A 2ELJA 2JVGA 4H4KC 4E7SA 3UNGC 1D1BA 4D7NA 2IAIA 3K4MA 2M34A 1OCPA 3BG9A 3BG5A 2ZSHB 1SFKA 3ZCOA 1JT6A 5KHDA 3HPHA 3S1QJ 5IP6A 2LKXA 2XSDC 3HGGA 1FJLA 2ZXIA 1SFOJ 2WB1A 3D5SC 3JRCA 4BXXJ 2IS1A 4BEHB 1S7EA 1MBFA 4A3EJ 1DU0A 3JRFA 2IS2A 1CQTA 2M9HA 4A3DJ 3K4BA 2LVSA 3DU6A 3HOTA 2ECCA 4RLQA 3JRAA 1NK2P 2W7NA 4DZPA 4DJAA 1IGNA 3CJRB 4CYCB 2KDZA 3VPRA 2VXDA 2LG4A 2EQRA 2GBYA 3MVPA 2R5ZA 1QU3A 2WAFA 3K4JA 4RM2A 2XF6A 4BL0B 1MMNA 5KCMA 3S93A 4RM3A 4BJ6C 4BBSJ 3PUBA 2EZIA 3JRDA 3FK6A 4W1UA 3GTPJ 1RPWA 3NWSA 2VQGA 1AKHA 2X1CA 3IP4B 5EZGA 3FBNB 2LY1A 1X1BA 5C4JJ 1E0EA 4XKWA 3L2RA 4BDZA 3DTKA 3AL0B 3OYFA 2LBFA 3I3LA 1UG2A 4HSTA 5J1YA 2Y9ZA 2JA8J 2HDDA 5JHFA 2KMUA 1P7JA 3K4KA 4E7JA 3QYBA 1JTXA 4DYCA 5EGOA 2M8GX 2KP6A 2OUMA 2R93J 1X4PA 2OPTA 2L7KA 3PNVA 3L2UA 1T33A 1OFCX 1D0YA 3JREA 1V5GA 2IXSA 2HOAA 1P9QC 2BW3B 1GDTA 3M3YJ 3RQIA 2XGEA 1LFPA 3C2HA 1ITYA 2OF7A 3NAUA 2UV1A 3PL8A 2O8KA 2V6EA 2O5RA 3QODA 2E1MB 2MYSA 3W3CA 1IG7A 3CCYA 4G6TB 4M3FA 4XRSA 4F93B 3A4CA 2F6CA 4M6VA 2X9DA 2KZVA 4AUXA 5KNLA 3DKXA 5M5XJ 4XLCA 1ZK8A 2VQHA 2PJRA 4KJZA 4XICA 2W48A 1UMQA 2M7BA 2V9KA 2DA5A 2D5VA 3RTRA 2CV2A 1XC5A 2FJ1A 2Y9YA 4IHVA 4HNTA 5E3LA 1RKWA 4HG2A 1B8IA 2IEKA 3DQVC 4Y7NJ 4PJJA 2EZKA 3ZQHA 5CQGA 1V5EA 3OIQA 4J19A 2O7OA 3H9QA 3QPLA 5CPRB 3DU5A 3D1NI 3VWBA 4PUSA 3ZGKA 5FKMA 2X1EA 3W2AA 2A5WA 4A3BJ 3HOVJ 1OCTC 4XMYA 1WJCA 3HOXJ 4RLFA 4YEJA 4MO7A 3Q3SA 4RBOA 3H5RA 3DEEA 2DMUA 3H35A 2LREA 4AYBA 2R5YA 2VQCA 5FROA 4XLAA 5CKTA 3A2KA 5F27A 4DYRA 3GBGA 2L7FP 1DGRM 2XGCA 4JQFA 2L2OA 1WH5A 2G0EA 4YRVA 3SDBA 2GLOA 4PK4A 1WCMJ 2TCTA 4BEHA 3OMYA 2M4KA 3NWTA 1HLVA 2VPLA 3ONQA 3W2VA 4D5CA 2RAEA 1Y56A 1WJEA 2ELKA 3TW7A 4BDYA 2NS8A 3B6CA 2WAQN 1LFBA 3BCAA 3OSFA 4BY7J 2LY2A 3D5LA 2L0KA 1ETXA 2DT6A 3HC7A 1OLTA 1MBJA 3DPUA 2Y0SA 1NK3P 3VDXA 2XPVA 1TWHJ 1MMDA 2MW8A 2LFBA 4D7MA 4U7BA 1ZR2A 4RMNA 4FASD 4PJNA 2M3AA 4Y52J 2Z16A 1WJDA 4G12A 3HOWJ 1RESA 2GM4A 1PUFB 1IRXA 2KRHA 2W82A 1AKHB 1F43A 1UELB 3EPZA 4XNFA 4X6AJ 4OAZA 3OYKA 2I10A 1T95A 2WA0A 2BOLA 5GP9A 4M3GA 3HBLA 1YE9A 1WH7A 3K10A 3HOZJ 4DOZA 3MD2A 3PO3J 2HOSA 1Z7LA 4JX6A 1GUUA 4D1QA 2JWTA 1U0JA 2IGKA 2VKDA 2IS4A 3KEYA 2E5ZA 4V2GA 2BW3A 4XM3A 5FRMA 4J00A 3GTGJ 1NTCA 1A6IA 3K2AA 2LK2A 5EDNA 2W1OA 3O8GA 2NVYJ 1PJRA 3NARA 2R7QA 3E1SA 2MG4A 4ZJZA 2M0CA 3F0CA 4D5FA 4KISA 5E3NA 2LH9A 3S3OA 3HKZA 3K4CA 4XLFA 3U21A 4OAYA 4AU7A 4A3CJ 3CESA 3CDLA 3PSIA 3OL4A 2GOMA 1FMWA 3ZOBA 4E7HA 3OWTA 1LVKA 4IKFA 4II2A 1D1AA 3MKWB 2R7VA 3BQYA 2RNGA 3S16J 2JA5J 3K70D 3O8HA 3LSKA 1FTTA 3HM5A 3LSRA 2PJRB 2IGOA 4BJTA 3I4MJ 2CUFA 1W0UA 3SDGA 3SEZA 4C2MJ 2PMZA 5GPCA 2XAUA 3S1RJ 5HVQC 2YUSA 2DA6A 1G8XA 4C30A 2XF7A 1B8IB 1ETOA 4XKBA 2EZHA 3OYEA 1YX5A 2X6WA 1HA8A 2VXZA 2CQQA 4S0HB 2K5CA 3S32A 2R92J 4P5OA 3MKZA 1QHHD 2R7WA 4QPQA 4YELA 1MH4A 2DCEA 4B3XA 4B4CA 4FE7A 4A93J 2V4JC 1U8BA 3S8PA 3LFUA 2IBDA 2R5YB 1R9TJ 3H3VK 3TL4X 1QRYA 1GV2A 4BE0A 1POGA 3JRBA 1X2MA 4V2FA 4HRIA 4IX7A 3IAS2 3OR2C 4I76A 2E5NA 2HDWA 3BR2A 1KONA 1I6HJ 4HNUA 4B48A 3HPGA 4BQOA 1UHSA 2L7MP 3PJRA 2L7ZA 5M5WJ 1NG6A 3OY9A 2DA7A 4M3EA 4F55A 4HPQA 2DA2A 3DKYA 1X4OA 4AYBN 1BR4A 3S2HJ 1WJBA 4II3A 4PJLA 1HF0A 3G1LA 1D1CA 5HNHA 3RKQA 3HB9A 4XR6A 1LFUP 1W36D 1IV6A 1ETKA 4RDUA 2K3PA 4CZCA 5BNGA 1MBKA 1PUFA 3OS1A 2M2EA 4IHXA 1ETYA 3LSGA 4UUTA 4CUGA 2HVSA 1MSEC 2MC4A 2CV1A 4A3KJ 4GRIA 3BT9A 4XLEA 2MGQA 2XC7A 3PO2J 3DPLC 3HG9A 2L9RA 3IH3A 4XLHA 1Y6IA 2FX0A 4LIUA 1JUMA 2FUG2 3OYJA 5IP7J 2JJ7A 1BA5A 3OYHA 3HL2A 2XGDA 2MFZA 2Y0SN 2NVTJ 2JMWA 5IYDJ 4NQWB 5K7FA 1H8AC 1W0TA 2WY7Q 1AA7A 5JLWA 9ANTA 1VNDA 2W4SA 3BR3A 3BTCA 4ZDOA 4QPOA 1FIAA 2F5VA 2X6XA 2X48A 3FBIB 4J01A 4BS9A 1D5YA 3ZXSA 1V5FA 5EYRA 4DZJA 3BTIA 4BBRJ 1IC8A 3WHBA 5K7ZA 5IYBJ 2VJIA 2R7ZJ 3DTEA 1BJZA 2DA3A 5CQEA 2AO9A 4FE4A 3KYLA 3HDDA 4AC0A 5HLTA 1Q1VA 3I4NJ 5DS9A 1ZKGA 1ZQ3P 3JRIA 4HSRA 2KT0A 4X0GA 1F36A 3EUAA 3G2BA 2HYJA 2HPMA 2ZB9A 2HI3A 4A3LJ 4X1EA 4ZDPA 4B3AA 3BG7A 4E4HA 1BL0A 4EATA 1QVUA 4ZTFA 2ZXHA 2XPUA 2VJ5A 4B44A 3SZGA 5E3MA 5IOZA 4PJMA 1MMGA 2VPRA 3CJQB 5IP9J 3H9GA 3E0JB 2CJJA 3RQ4A 3KX2A 2K9LA 1FTZA 3HKZN 1JKQC 2LOOA 4DGWB 1ERDA 1EF4A 4Y4RA 3LSJA 5K7HA 3OYBA 2JN6A 3BQZA 2E2IJ 2NOGA 3MN2A 2A6TA 3VYUB 1WI3A 1OR7C 3ZQCA 2W00A 1OJLA 2ME0A 2HU9A 1A5JA 1MBHA 4F92B 1G59A 2CU7A 2FQ4A 4XONA 2PMZN 3OYAA 2AHQA 4XRSG 2HXIA 2X6OA 1TC3C 3PNYA 2XB5A 1MNDA 5F0HA 5F08A 4JYKA 1D0XA 4A3FJ 5C4XJ 3W2WA 3G1MA 3UKGA 5F04A 1VF9A 3HOSA 2N8GA 3OR1C 5FKOA 2ID3A 5HODA 4XK4A 3H5AA 2TRTA 2VIXA 2VI6A 3VSLA 3CP2A 2JA6J 4B1RA 3LSHA 2XDVA 3DWLE 2F4IA 3PFYA 2MSYA 4A3MJ 3ZQIA 4W97A 3K7AJ 4D9JA 3L2WA 3VYRB 1H88C 4C2TA 1ZR4A 2CFOA 2MABA 2LC2A 2CS3A 2WB1N 1MBEA 4BQNA 1JJ6C 1Y1WJ 3BC8A 4M3BA 4NUBA 3BR1A 5M5YJ 3LOCA 1DQUA 2DTZA 2CH0A 3PSFA 5FKLA 2LD5A 3JR9A 1K61A 2M4GA 2LR8A 4JOMA 3RCOA 4QTRA 3G1OA 1VFCA 4CA0A 3IV5A 3OYDA 4IZZA 5JLXA 3S17J 3S3NA 2ZFUA 4DBQA 2K9NA 1H89C 3V42A 4UUSA 3OL3A 3ZQQA 1RR7A 3A03A 2UUZA 1X19A 3CMMA 1BW6A 2E2HJ 3QYFA 2O9LA 3S14J 4QIWN 1Z3YA 3S15J 4AVZA 1T56A 3FHNA 3A01B 3BTJA 2OC6A 1WJFA 4FCYA 3ZRGA 1YX3A 4F3QA 2H1KA 3OYGA 1AU7A 4E6KG 4BJ5C 1JTYA 1WJ5A 3IUOA 4C3IJ 1TWCJ 1U9OA 3H0DA 1TWGJ 1K6YA 3WHCA 3IH2A 2EH3A 3JRHA 4P1WA 2R7SA 1JKOC 5DTDA 1HDPA 1BW5A 3OIPA 4XORA 5FKNA 4HEA2 2VL8A 5EG0B 5M3FJ 4CCLA 3JRGA 2I8DA 2IGMA 2HZDA 3BG3A 2VASA 2VKEA 3A02A 2JSPA 2VKVA 2CQXA 4NDLA 1K83J 1MNEA 3FKJA 3S2DJ 1APLC 4F52A 2CUZA 2EZLA 2ECBA 3DTIA 2JA7J 3J7AY 4XN0A 1VZ0A 4A3GJ 2VJJA 2WV1A 2X1DA 4LITA 5FKKA 2R7RA 2ME6A 3DCFA 3RPUD 1MBGA 3LMMA 4ZDLA 2DN0A 1Z77A 4KT6A 5LFAA 2LY9A 3QYEA 5J1RA 2LTPA 4E7ZA 4CCKA 2WAQA 2BVLA 1XG1A 2CV0A 2YU9J 2RQQA 3S3MA 2NS7A 2HPIA 3BR5A 3LSIA 4A3IJ 4IEJA 3FKIJ 5HNFA 2HOTA 1T0FC 2CRGA 1U78A 1GT0C 1IDYA 5M3MJ 1NG7A 2M0MA 2Y31A 4IHYA 3HGYA 1WFXA 4ZTJA 4Y33A 4XIDA 5J1UA 5C3EJ 5E3OA 1R6RA 1XS9A 2CUEA 3TP3A 1YRNA 2DXIA 2X6YA 3LL7A 2B63J 3UR3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W6V A;  1LFB A;  3OSF A;  1Q1V A;  3I4N J;  1Y1V J;  4BY7 J;  1HDD C;  1JT0 A;  2L0K A;  2JK3 A;  2XB0 X;  5DS9 A;  1ETX A;  5EZH A;  1ZKG A;  1ZQ3 P;  1JKR C;  3JRI A;  2NVX J;  1IRZ A;  1E3O C;  1P7I A;  5IOY A;  2QF7 A;  3S1N J;  2KT0 A;  1MBJ A;  3PM1 A;  2H8R A;  1F36 A;  1GVD A;  1LE8 A;  4LOC A;  2HYJ A;  4C3J J;  1NK3 P;  1TWA J;  1WPK A;  5IYC J;  2XPV A;  1JGG A;  1TWH J;  2ZB9 A;  2HI3 A;  4A3L J;  2MW8 A;  4X1E A;  1SAN A;  1WGX A;  2LFB A;  2DA1 A;  3ZQF A;  3Q0U A;  4D7M A;  1ZGW A;  2LP0 A;  4B3A A;  5F0C A;  3SJM A;  1IUF A;  1ZR2 A;  1BL0 A;  1QVU A;  2XPU A;  4Y52 J;  5E3M A;  5IOZ A;  4G12 A;  3Q0W A;  3HOW J;  2VPR A;  1RES A;  2QCO A;  5IP9 J;  1JUP A;  2GM4 A;  3RZO J;  1PUF B;  2CJJ A;  2DJN A;  3FIS A;  4FIS A;  1FTZ A;  3HKZ N;  3OOU A;  1JKQ C;  5EEA A;  1AKH B;  1F43 A;  5IPA A;  1GV5 A;  1EF4 A;  3GTL J;  4X6A J;  5J3L A;  3LSJ A;  5K7H A;  4M3D A;  3QPS A;  2JN6 A;  2I10 A;  3BQZ A;  5GP9 A;  2E2I J;  4M3G A;  2NOG A;  1MH3 A;  3MN2 A;  1G2H A;  3ZQL A;  1WI3 A;  3HBL A;  1WH7 A;  4HNV A;  3HOZ J;  3RZD J;  3MKL A;  3ZQC A;  3PO3 J;  1OJL A;  4QSH A;  2ME0 A;  2HOS A;  4JX6 A;  1GUU A;  1A5J A;  1MBH A;  1U9N A;  2JWT A;  4D7N A;  2CU7 A;  2IAI A;  2FQ4 A;  2M34 A;  1B72 B;  4XRM A;  1OCP A;  4UUS B;  2PMZ N;  3TED A;  3BG9 A;  3BG5 A;  2NVQ J;  2AHQ A;  1AHD P;  4XRS G;  1JT6 A;  2HXI A;  2X6O A;  1TC3 C;  2DMT A;  1X2N A;  4V2G A;  2XB5 A;  3S1Q J;  5IP6 A;  2XRL A;  2LKX A;  5FLV A;  3GTG J;  1NTC A;  5F0H A;  2XSD C;  1A6I A;  5F08 A;  4JYK A;  3A01 A;  3LNQ A;  3HGG A;  3K2A A;  2XPW A;  2LK2 A;  4A3F J;  1FJL A;  5C4X J;  2K40 A;  5EDN A;  3G1M A;  3UKG A;  3O8G A;  5F04 A;  1SFO J;  2NVY J;  1VF9 A;  3NAR A;  3JRC A;  4A3J J;  4BXX J;  3FIW A;  3H0G J;  2MG4 A;  2M0C A;  2N8G A;  1S7E A;  3F0C A;  1MBF A;  4D5F A;  5E3N A;  4A3E J;  5FKO A;  1DU0 A;  2ID3 A;  3JRF A;  5HOD A;  4XK4 A;  1CQT A;  2M9H A;  4A3D J;  1X58 A;  2LVS A;  4A3C J;  2TRT A;  2VI6 A;  3CDL A;  2ECC A;  3TW6 A;  2JA6 J;  3JRA A;  4B1R A;  1NK2 P;  3ZOB A;  4DZP A;  5EG0 A;  1ETV A;  3BQY A;  3DEW A;  2MSY A;  4A3M J;  1IGN A;  3ZQI A;  2JA5 J;  3S16 J;  2EBI A;  4CYC B;  2KDZ A;  3VPR A;  1ETQ A;  4W97 A;  3K7A J;  3O8H A;  5FLM J;  2ID6 A;  3Q0V A;  2EQR A;  2GBY A;  2VUM J;  2DA4 A;  1FTT A;  3MVP A;  3HM5 A;  3LSR A;  1H88 C;  4JX5 A;  2R5Z A;  1ZR4 A;  3I4M J;  2CUF A;  1W0U A;  3SDG A;  4JX4 A;  1LE8 B;  3HOU J;  4C2M J;  1QVT A;  5GPC A;  2WB1 N;  1MBE A;  3TP0 A;  4EEF G;  3S1R J;  1JJ6 C;  1Y1W J;  4BBS J;  2YUS A;  3M4O J;  2DA6 A;  2EZI A;  3JRD A;  3CMY A;  4M3B A;  3FK6 A;  3BR1 A;  1B8I B;  4W1U A;  1I3Q J;  5M5Y J;  3GTO J;  1ETO A;  3GTP J;  3LOC A;  2EZH A;  1DU6 A;  3GTJ J;  1RPW A;  2CQQ A;  2DTZ A;  4AC0 A;  1ORK A;  5FKL A;  2LD5 A;  1JKP C;  3JR9 A;  1AKH A;  1K61 A;  5EZG A;  2LR8 A;  4S0H B;  2R92 J;  5C4J J;  4QTR A;  3G1O A;  1VFC A;  1FEX A;  1UG2 A;  2Y2Z A;  3IV5 A;  3E7L A;  5J1Y A;  2Y9Z A;  2JA8 J;  2HDD A;  1MH4 A;  4B4C A;  4FE7 A;  5JLX A;  4A93 J;  1U8B A;  1P7J A;  3ZQG A;  3S17 J;  2IBD A;  1JTX A;  4DYC A;  2K9N A;  5C44 J;  5EGO A;  1H89 C;  2M8G X;  2R5Y B;  1R9T J;  3H3V K;  1QRY A;  2R93 J;  4UUS A;  2OPT A;  1GV2 A;  5F1J A;  1POG A;  3IH4 A;  3JRB A;  1RR7 A;  1X2M A;  4V2F A;  1T33 A;  2DMQ A;  2K9S A;  1OFC X;  3A03 A;  3JRE A;  1IDZ A;  1BW6 A;  2E2H J;  3QQA A;  4ABZ A;  4I76 A;  4QIW N;  2O9L A;  3S14 J;  3S15 J;  2HOA A;  4MFE A;  3BR2 A;  1GDT A;  1T56 A;  1I6H J;  1MNM C;  3M3Y J;  3RQI A;  2XGE A;  4I6Z A;  3A01 B;  3BTJ A;  1ITY A;  2OF7 A;  4FCY A;  3NAU A;  4DW6 A;  1UHS A;  2O8K A;  2L7M P;  2H1K A;  1AU7 A;  4IHW A;  1JTY A;  2L7Z A;  1YRN B;  5M5W J;  1IG7 A;  4C3I J;  1TWC J;  3CCY A;  1U9O A;  1TWG J;  3WHC A;  3IH2 A;  2EH3 A;  2DA7 A;  4M3F A;  3JRH A;  4XRS A;  4M3E A;  1IJW C;  4FTH A;  2LLK A;  2E19 A;  4M6V A;  4MFD A;  2DA2 A;  1JKO C;  4MLO A;  4AYB N;  2X9D A;  1ZTR A;  5DTD A;  1HDP A;  4AUX A;  1BW5 A;  2E2J J;  5M5X J;  2P81 A;  5FKN A;  4CYC A;  3S2H J;  1ZK8 A;  1RET A;  2HXO A;  2K9Q A;  3GTM J;  5EG0 B;  5M3F J;  3BTL A;  3G1L A;  1HF0 A;  3JRG A;  1HOM A;  3BG3 A;  4XIC A;  2W48 A;  2VKE A;  1UMQ A;  3A02 A;  2VKV A;  2CQX A;  4NDL A;  3RKQ A;  3HOY J;  1K83 J;  3HB9 A;  1LFU P;  1IV6 A;  2R5Z B;  1ETK A;  2DA5 A;  4RDU A;  2D5V A;  3S2D J;  1APL C;  1XC5 A;  2FJ1 A;  5BNG A;  2Y9Y A;  1HCR A;  4IHV A;  1MBK A;  1PUF A;  5E3L A;  2EZL A;  1ENH A;  1RKW A;  2ECB A;  2M2E A;  4IHX A;  1B8I A;  2JA7 J;  2IEK A;  1ETY A;  3LSG A;  4Y7N J;  1TWF J;  1ETW A;  2EZK A;  3ZQH A;  4A3G J;  2Y30 A;  3C2B A;  2YS9 A;  4UUT A;  1I50 J;  2WV1 A;  1MSE C;  5FKK A;  4A3K J;  4J19 A;  2O7O A;  3QPL A;  4A69 C;  2R0Q C;  2ME6 A;  3CQZ J;  3DCF A;  3D1N I;  3BT9 A;  4DYQ A;  1FIP A;  2MGQ A;  5FKM A;  1MBG A;  3PO2 J;  2L9R A;  3GTQ J;  2DN0 A;  3IH3 A;  1Z77 A;  1JUS A;  5F0F A;  4A3B J;  3HOV J;  2FX0 A;  1OCT C;  3BR0 A;  1O4X A;  1JUM A;  2LY9 A;  3HOX J;  2COB A;  1MSF C;  4MO7 A;  5J1R A;  2LTP A;  5IP7 J;  2JJ7 A;  1BA5 A;  3Q3S A;  4RBO A;  2XGD A;  2DMU A;  2E1O A;  1B72 A;  2Y0S N;  3L1P A;  2NVT J;  1VI0 A;  2JMW A;  3FK7 A;  2R5Y A;  5IYD J;  1Z0X A;  5EF6 A;  3OSG A;  5K7F A;  1H8A C;  3B6A A;  1W0T A;  1XG1 A;  4BKX A;  2YU9 J;  4BY1 J;  5GPA A;  5F27 A;  4DYR A;  3GBG A;  5JLW A;  2L7F P;  9ANT A;  5FJ8 J;  4L5E A;  2NS7 A;  3BR5 A;  5EGO B;  4A3I J;  4IEJ A;  2HQ5 A;  3FKI J;  2XGC A;  2HOT A;  1VND A;  3BR3 A;  3BTC A;  4JP0 A;  3GTK J;  1WH5 A;  1FIA A;  2CRG A;  2G0E A;  2GLO A;  1WCM J;  1U78 A;  2TCT A;  4C3H J;  1IDY A;  1GT0 C;  2X48 A;  5M3M J;  2DMP A;  2Y31 A;  4MIM A;  4IHY A;  1D5Y A;  5EYR A;  3HEF A;  3HGY A;  3BR6 A;  4DZJ A;  3BTI A;  3SFI A;  1QPI A;  1RKT A;  4BBR J;  1HLV A;  1IC8 A;  4XID A;  3WHB A;  5K7Z A;  4D5C A;  5J1U A;  5IYB J;  2FD5 A;  3OIO A;  5C3E J;  2R7Z J;  5E3O A;  1JJ8 C;  2RAE A;  3S1M J;  1XS9 A;  2CUE A;  2ELK A;  3TP3 A;  1BJZ A;  3TW7 A;  1YRN A;  4GFB A;  2DA3 A;  3LSP A;  2AO9 A;  4FE4 A;  3HDD A;  2B63 J;  2NS8 A;  3B6C A;  2WAQ N;  2DMN A; 
#chains in the Genus database with same CATH topology
 3W6V A;  3I58 A;  3KZY A;  2VB6 A;  1S72 I;  2VJ4 A;  3NRV A;  1DGW Y;  3MMY B;  1Y1V J;  3OYC A;  1RUN A;  3WG9 A;  4WXC A;  1JT0 A;  1EKE A;  4PSX A;  4DIQ A;  2XB0 X;  5EZH A;  1JKR C;  1WI9 A;  3DLA A;  2NVX J;  1M1E B;  1ZEL A;  3QU3 A;  4BUP A;  1P7I A;  5IOY A;  2QF7 A;  4U88 A;  5L3D A;  2AQE A;  5K5O A;  1QZE A;  1R00 A;  3P5J A;  4N9H A;  4BE1 A;  2H8R A;  3Q9S A;  3VYS B;  1PYV A;  3VYT B;  5D8L B;  4C3J J;  4N4N B;  2VE8 A;  2QSF X;  1WPK A;  1BI1 A;  3CUQ C;  4E70 A;  5IYC J;  3BY6 A;  1YIT I;  1O3Q A;  4KMF A;  1QZY A;  2V6C A;  1W7P A;  2DK5 A;  5E1X A;  3T8R A;  1ZG5 A;  2HR3 A;  2DA1 A;  4CCN A;  1ZGW A;  2LP0 A;  3FDY A;  5F0C A;  3SJM A;  1IUF A;  1IF1 A;  2FE3 A;  5J47 A;  2R7U A;  2HVQ A;  2BHY A;  4L9N A;  3E5Q A;  3LA2 A;  4E7I A;  1J09 A;  3PNT A;  1JI8 A;  1I1G A;  4BE2 A;  3Q0W A;  2R7X A;  2QCO A;  3QP6 A;  3K4N A;  3FIS A;  1BR2 A;  3RYP A;  1MW7 A;  4FIS A;  1LDJ A;  3ERM A;  2DAO A;  2G7U A;  1JHF A;  4N4O B;  5EEA A;  5H2F C;  1H9T A;  3QRF F;  5HLG A;  4U0Y A;  3K70 C;  1UFM A;  1UB9 A;  5J3L A;  1N77 A;  2KHM A;  4BU2 A;  3MFK A;  3VSK A;  2HDC A;  3QPS A;  3HUG B;  3CO7 C;  3MCZ A;  3TDZ C;  4RAG A;  4CSW A;  4A0Z A;  4IQJ A;  2ZSI B;  1QO0 D;  1EA3 A;  3OYN A;  1F4K A;  2Z2S B;  3BOQ A;  3H5N A;  4HNV A;  1C0W A;  2IS6 A;  1D8J A;  3RZD J;  3SHF A;  4C2U A;  3H1C A;  3MKL A;  1RZ4 A;  1BR1 A;  4QSH A;  1DUX C;  1A35 A;  1WZ2 A;  1U9N A;  4HYE A;  4GGG A;  1N75 A;  1MD0 A;  1LUJ B;  3SYT A;  1B72 B;  4XRM A;  2IPQ X;  5J6X A;  2UWM A;  3SEQ A;  3CCE I;  4DBR A;  4I99 C;  3AKZ A;  3DPT A;  1G3S A;  4UUS B;  4XOP A;  3TMO A;  3TED A;  2NVQ J;  1AHD P;  2ZCW A;  5HDG A;  2Q8K A;  1BIA A;  4ANJ A;  2DMT A;  1X2N A;  1OIS A;  2FA5 A;  2P4W A;  5FLV A;  2XRL A;  3LNQ A;  4ZC3 A;  3A01 A;  2KPM A;  2M30 A;  4ITV A;  2EWN A;  2XPW A;  1USS A;  1SMY F;  3N4M A;  2K40 A;  1IZ1 A;  2JSC A;  1YFH A;  1T2K A;  2AXL A;  4BQQ A;  3AL0 C;  1VQ7 I;  5H20 A;  2PX9 A;  1TNT A;  4A3J J;  1IRF A;  2ZME C;  3FIW A;  3H0G J;  5TGT A;  1YJN I;  1G3Y A;  2VKH A;  1KQ0 A;  4ESB A;  4Y3O A;  1S29 A;  3M8E A;  2Y75 A;  2UXN A;  4NBQ A;  1ZAR A;  4BXF A;  3WTY C;  3N05 A;  2XV4 S;  2WAD A;  1GLN A;  1X58 A;  2E60 A;  2HQA A;  3KP3 A;  1IW7 F;  3CF2 A;  4HF0 A;  2V26 A;  5IY5 H;  1Y39 A;  1Y0N A;  3BG6 A;  3TW6 A;  3H9J A;  5TIS C;  2QVO A;  4CHU A;  5GTI C;  2WY8 Q;  1ETV A;  5EG0 A;  1FPQ A;  1HXD A;  2CW7 A;  2EB7 A;  3K4L A;  2P7C B;  2DBB A;  2DOA A;  3DEW A;  2DT7 B;  3TO9 A;  1D0Z A;  2EBI A;  1ETQ A;  1MIJ A;  4NHJ A;  4NNJ A;  1T6S A;  2ID6 A;  5FLM J;  3KIO A;  3Q0V A;  2VUM J;  2DA4 A;  2X51 A;  4FET A;  1GXP A;  2WC2 A;  2KLO A;  4JX5 A;  1KU9 A;  1ZHF A;  3RIR A;  2QQB A;  4LG0 B;  2NRA C;  3FXM A;  5AIP A;  2Z1D A;  5KAI C;  2ICW G;  2DTR A;  2L9N A;  4JX4 A;  3JSO A;  1LE8 B;  4HLX A;  3HOU J;  1G4D A;  3AG4 H;  1QVT A;  2IGN A;  2NS0 A;  4Z6Y A;  1X1A A;  2L54 A;  5DM7 F;  1KYW A;  1QQI A;  2D1H A;  1IN8 A;  3TP0 A;  3V7C A;  4EEF G;  1ZH5 A;  4A6D A;  4PSW A;  2KQR A;  3CZ6 A;  2E1M C;  3DF8 A;  2BBY A;  1WQ2 A;  3M4O J;  3CMY A;  2OD5 A;  1ZYR F;  4I09 A;  1RIO H;  1EJ9 A;  2OCC H;  4M9X A;  3N97 A;  1T0F A;  1W7P D;  4XOT A;  3WTU C;  2PLY A;  1I3Q J;  1OYY A;  1Z3X A;  3C2G A;  3HSE A;  4RGX A;  3GTO J;  3KE2 A;  1DU6 A;  3GYH X;  3GTJ J;  1X1C A;  2K86 A;  4QWQ A;  3IWZ A;  3OYI A;  1ORK A;  2KDO A;  1JKP C;  1XGS A;  3QOE A;  5F1R A;  4WXD A;  1RNL A;  2LYC A;  5B1A H;  1RR8 C;  5HLH A;  2NYX A;  2KRC A;  1O7L A;  3FM5 A;  1DP7 P;  2EJR A;  4S05 A;  3W6J B;  2WAE A;  3GF2 A;  1FEX A;  1WJA A;  1RUO A;  2Y2Z A;  1U5T B;  1E17 A;  3E7L A;  3A1Y A;  5E8I A;  4CH7 A;  1UST A;  5CVU A;  1W36 C;  2IRF G;  4M9Z A;  4C9Y A;  3ERE D;  3FM3 A;  2R7O A;  3ZQG A;  2AQF A;  1V54 H;  3VEP A;  1QHG A;  2VBX A;  5C44 J;  4N0B A;  1I27 A;  2QQ8 A;  3MEX A;  2R7T A;  3CJN A;  2D1V A;  3QP5 A;  4F7Z A;  3KET A;  2NOJ B;  2ZJP F;  2Q1Z B;  1TLH B;  2K9M A;  2P0W A;  1FYM A;  3ZN0 A;  5F1J A;  2F5E A;  3RPQ A;  3EUK L;  3IH4 A;  1S3J A;  2DMQ A;  2K9S A;  4LB5 A;  5LEK A;  4B47 A;  1IDZ A;  4E7K A;  3LQR A;  2V1N A;  3RSN A;  3D5R C;  3QQA A;  1U2W A;  4I0B A;  4HW0 A;  4ABZ A;  2FBI A;  4B09 A;  3CUQ A;  1B6A A;  1OCR H;  4MFE A;  4PFO A;  2KL4 A;  4PFP A;  5FRN A;  2OQG A;  1LDK B;  4I0A A;  1DP3 A;  1MNM C;  1BI0 A;  4CCM A;  4I6Z A;  4E7L A;  3OYL A;  3G3Z A;  3J7Z I;  3HRU A;  4DW6 A;  4PCQ A;  4IL6 C;  2XAJ A;  2QLZ A;  5DUI A;  3PIO F;  5LD2 C;  4LG3 A;  4IHW A;  2XAH A;  3GZN B;  4PGH A;  5ICF A;  1YRN B;  1Z67 A;  2E7X A;  1UZC A;  3E5U A;  3BCB A;  2DOD A;  1HW2 A;  4XKV A;  2OCE A;  3CJT B;  1IJW C;  1YS7 A;  2VQL A;  4FTH A;  2LLK A;  2E19 A;  4MFD A;  3AFH A;  2LDU A;  4MLO A;  1OCC H;  1ZTR A;  2B7E A;  5HS7 A;  3L2V A;  2E2J J;  5DEQ A;  5B3S H;  1GHC A;  2P81 A;  4NC7 A;  4CYC A;  4G8X A;  1RET A;  1Z9C A;  2HXO A;  2K9Q A;  2FOW A;  3GTM J;  4CCJ A;  3BTL A;  4EJV A;  2VE9 A;  1HOM A;  5CVI A;  4KN4 X;  2R7D A;  3I9V 2;  2FOK A;  2O61 A;  1N78 A;  4LGW A;  1V3F A;  4LIV A;  1S5L C;  3HOY J;  1S9H A;  4OWR B;  4B43 A;  2EA2 A;  1T8I A;  2R5Z B;  3CCS I;  3K1P A;  5D4S A;  3DBL B;  1XMA A;  3BLY A;  4A6E A;  1UJ8 A;  3CCJ I;  5IT9 K;  3ROU A;  3MZY A;  3TBI A;  3V8K A;  1HCR A;  2HKO A;  2X85 A;  2H1L A;  2KIS A;  2Y69 H;  1ENH A;  1BJA A;  3M8J A;  4HV6 A;  3FXO A;  1WSU A;  2WTE A;  2XSJ C;  1TWF J;  2DQR A;  1ETW A;  2RKH A;  2Y30 A;  3C2B A;  2YS9 A;  2CQ7 A;  1I50 J;  1P6R A;  3K6G A;  1JXS A;  2O3F A;  1LNW A;  1LKX A;  4CCO A;  3ZR8 X;  4A69 C;  2R0Q C;  1IXC A;  3CQZ J;  3HUG A;  4DYQ A;  4AD9 A;  1I39 A;  2L5Q A;  4XKC A;  3OS0 A;  1FIP A;  4F91 B;  3IL2 A;  3TQN A;  1KU3 A;  3TDU C;  3GTQ J;  2ZME A;  1JUS A;  5F0F A;  3HXL A;  4R79 A;  2GOX B;  4ZYA A;  2LRD A;  3BR0 A;  3OS2 A;  4RAF A;  1O4X A;  1TT0 A;  2COB A;  1MSF C;  2VT2 A;  1K4T A;  1Y0U A;  4YG2 F;  2LBF B;  1ZN2 A;  2ZJ2 A;  3ZMT A;  2E1O A;  1SD6 A;  1B72 A;  1BOB A;  3L1P A;  1VI0 A;  2Q2E B;  2V7F A;  3FK7 A;  1Z0X A;  5EF6 A;  3OSG A;  2HVR A;  1IXS B;  3B6A A;  4BKX A;  2BXY A;  3QAH A;  4UVC A;  5JVT A;  1BI3 A;  5L3E A;  4ZYD A;  2R4G A;  5GPA A;  4BY1 J;  3SFZ A;  2FQ3 A;  5FJ8 J;  4L5E A;  1XPX A;  1OKR A;  2M7A A;  2XF5 A;  5EGO B;  2DJI A;  2HQ5 A;  4MQV A;  3FXQ A;  5HDK A;  4Q5S F;  4JP0 A;  3GTK J;  3ULQ B;  5FB2 A;  2WBM A;  4RB3 C;  3CP8 A;  1UAA A;  2M1B A;  1W1W E;  4C3H J;  2VBY A;  4XQF A;  1SAX A;  3V7S A;  2DMP A;  4MIM A;  1PVE A;  4IQ4 A;  2XGX A;  3HEF A;  1QPI A;  3BR6 A;  3SFI A;  1ZGJ A;  3E6B A;  1RKT A;  2CUJ A;  2DPU A;  2E7W A;  1R23 A;  4L9J A;  1TZL A;  1T39 A;  2FD5 A;  3OIO A;  5ICC A;  1XSX A;  4HA8 A;  1JJ8 C;  3S1M J;  3I59 B;  2O03 A;  3GLX A;  2KZG A;  4GFB A;  1OYI A;  1Z6T A;  2JVH A;  4U87 A;  1V4R A;  3LSP A;  3EUH C;  2DFF A;  1FLI A;  4WK8 F;  1R71 A;  1O3S A;  3WTZ A;  4UHT A;  2DMN A;  3M1C A;  4IOA F;  4XL9 A;  4XLP F;  3K9T A;  2CGP A;  1P4A A;  4NC8 A;  2HEO A;  2JUG A;  4KIT B;  4BAC A;  1HDD C;  1J7K A;  2L9S A;  4KIC A;  1HC8 A;  2JK3 A;  4A2U A;  2BYV E;  4Y17 A;  1B4A A;  2VT3 A;  5BS6 A;  1VQO I;  1IRZ A;  1E3O C;  2OTJ I;  3S1N J;  1UG0 A;  5D5X B;  2CQK A;  2QKL B;  3Q9V A;  3PM1 A;  4BGD A;  1OR7 A;  3HRT A;  1GVD A;  3I53 A;  5FLX K;  2IP2 A;  3VB2 A;  1LE8 A;  2MD0 A;  4LOC A;  1TWA J;  4XN3 A;  2GXG A;  4P9U A;  2KIM A;  5L3B A;  4RAY A;  1JGG A;  3HRM A;  3SQN A;  1FZP B;  3ZQ7 A;  4V19 K;  2JA2 A;  3IAM 2;  2BY2 A;  2HNH A;  3MKY B;  1YJ9 I;  3QOP A;  1SAN A;  1WGX A;  4EGZ A;  2D45 A;  2RRE A;  3ZQF A;  2IA1 A;  3Q0U A;  1FP2 A;  1Z21 A;  3B73 A;  3HZJ A;  2J5P A;  3LSM A;  3F3X A;  5TRD A;  3F9K A;  1XMX A;  2H09 A;  2UXX A;  1P4X A;  3P9K A;  2L02 A;  1JUP A;  1SAU A;  3RZO J;  2ISY A;  2YSR A;  3AG2 H;  2DJN A;  2BVM A;  4OU0 A;  3CC2 I;  1OPC A;  2W85 A;  1Z6R A;  1VQN I;  2VLA A;  1X1D A;  3OYM A;  3OOU A;  5HOO A;  3L2Q A;  1REP C;  2I5U A;  5IPA A;  1GV5 A;  3F72 A;  4G7Z F;  3GTL J;  1R4N B;  2HZT A;  1FMV A;  1ZAO A;  2CSO A;  1MJ9 A;  2QKM B;  1MMA A;  1Z05 A;  2PMU A;  4M3D A;  1ZRD A;  2CO5 A;  4CYD A;  1K79 A;  2CMP A;  1MH3 A;  2XAG A;  4EMS A;  4A12 A;  1G2H A;  1QZZ A;  2CW8 A;  3ZQL A;  3I56 I;  1TTY A;  3RKX A;  1ON1 A;  2A6H F;  2OV7 A;  4ENK A;  4UY8 I;  2ELJ A;  2JVG A;  4H4K C;  2W25 A;  5AON A;  4ZH4 F;  4E7S A;  3VOD A;  3UNG C;  3HHG A;  1D1B A;  3LST A;  3LWF A;  2CWE A;  3I0T A;  2IAI A;  4BYY A;  4D7N A;  3M1E A;  3K4M A;  2M34 A;  4XSZ F;  1F9N A;  1OCP A;  1MZB A;  4R8H A;  2YX7 A;  3BG9 A;  3BG5 A;  2ZSH B;  1KQ8 A;  3NEU A;  1SFK A;  3ZCO A;  1JT6 A;  2COM A;  3U1K A;  5KHD A;  4EGY A;  3P7N A;  2OQR A;  3HPH A;  3S1Q J;  1Y8R B;  5IP6 A;  2LKX A;  4U0V A;  2BHZ A;  2XSD C;  4XLN F;  3HGG A;  2V79 A;  3GFJ A;  1FJL A;  3CUQ B;  4NC6 A;  2K27 A;  3KZZ A;  2ZXI A;  5D5U B;  4L9T A;  4HAM A;  1SFO J;  1R7J A;  2M87 A;  2WB1 A;  3D5S C;  1QA6 A;  3JRC A;  1LVA A;  4BXX J;  4M9S A;  2IS1 A;  4BEH B;  1S7E A;  1MBF A;  1S7A A;  4A3E J;  2DYS H;  5CVJ A;  3L7W A;  5LGT A;  3C3W A;  1DU0 A;  3L09 A;  3JRF A;  1U8R A;  5DUK A;  2IS2 A;  3WTT C;  1CQT A;  2M9H A;  4A3D J;  3K4B A;  2HWV A;  2LVS A;  1P2F A;  3DU6 A;  2NVU B;  3HOT A;  5L3G A;  5ERI A;  4RS8 A;  2ECC A;  4RLQ A;  3JRA A;  1FNN A;  1QBJ A;  1NK2 P;  1R5I D;  2W7N A;  4DZP A;  5E17 F;  2JQ7 A;  3TO7 A;  3PQK A;  4LK0 F;  4DJA A;  3CJR B;  1IGN A;  4CYC B;  2KDZ A;  3VPR A;  2VXD A;  2HGC A;  1TBX A;  3J7Y J;  2LG4 A;  2EQR A;  2GBY A;  3SZP A;  3MVP A;  4ZYE A;  2R5Z A;  1QU3 A;  2E34 A;  1FWZ A;  2WAF A;  3K4J A;  4RM2 A;  2XF6 A;  1H0M A;  3MAJ A;  1WRJ A;  2LNB A;  4BL0 B;  1MMN A;  3JAM K;  4Q47 A;  5KCM A;  3S93 A;  4M72 A;  3E3V A;  3T5X A;  2K7L A;  1E3H A;  4RM3 A;  4BJ6 C;  3I54 A;  4OIN F;  3BZK A;  4BBS J;  3PUB A;  5LHH A;  2EZI A;  2MH2 A;  4KMU X;  3JRD A;  2VBW A;  3FK6 A;  4MEX F;  1T08 B;  4W1U A;  1ZLK A;  3GFL A;  3GTP J;  3F23 A;  5IT9 Z;  1RPW A;  2L9V A;  4P9F A;  3NWS A;  5CVV A;  2DLL A;  4ASN A;  2VQG A;  5ILV A;  5HLI A;  1AKH A;  2P5V A;  3CC4 I;  5J40 A;  1SMT A;  1NHA A;  1EH6 A;  2F5F A;  2X1C A;  3IP4 B;  5JI6 A;  5EZG A;  3FBN B;  3KP7 A;  3RYR A;  3ECH A;  1BI2 A;  1R22 A;  2GZW A;  4ESJ A;  2LY1 A;  1X1B A;  5C4J J;  1E0E A;  4XKW A;  3X2Q H;  3L2R A;  3F21 A;  4BDZ A;  3FMQ A;  3DTK A;  1W5C C;  3AL0 B;  1MGT A;  3OYF A;  5H6R A;  2LBF A;  3I3L A;  2ZME B;  1UG2 A;  4HST A;  5FO5 A;  2HQN A;  5J1Y A;  2Y9Z A;  2JA8 J;  3DXJ F;  2HDD A;  4S04 A;  5JHF A;  2Q2E A;  3P9C A;  2KMU A;  2GIV A;  2GXB A;  3EUH A;  3KP6 A;  1P7J A;  3K4K A;  2Z5U A;  4YFX F;  2OU2 A;  3R61 A;  4IRH A;  5D8K B;  4RB1 A;  1D5V A;  4E7J A;  2H27 A;  3CCR I;  3QYB A;  1JTX A;  5LEJ A;  4DYC A;  5EGO A;  4G7O F;  2M8G X;  2KP6 A;  2OUM A;  3QU6 A;  1TW2 A;  3K0L A;  5JR3 A;  2R93 J;  1G3W A;  2F4O B;  2MH9 A;  4KDP A;  1X4P A;  2OPT A;  2L7K A;  4CXF A;  4CZZ A;  3PNV A;  5FFX A;  3L2U A;  1YW8 A;  1T33 A;  1OFC X;  1D0Y A;  2FXA A;  4HX8 A;  3JRE A;  1R36 A;  4G7H F;  2OJE D;  3NQO A;  3BPX A;  3E97 A;  1V5G A;  2IXS A;  2HOA A;  1P9Q C;  2CQN A;  3C18 A;  3WU2 C;  2BW3 B;  1FBU A;  2MLK A;  1GDT A;  1B9N A;  1KQ9 A;  3I59 A;  3M3Y J;  3RQI A;  2KKO A;  2XGE A;  1LFP A;  4N9I A;  3GLL A;  2QM3 A;  3C2H A;  4G94 A;  3Q5F A;  1ITY A;  2OF7 A;  3NAU A;  2DOE A;  1TQM A;  2UV1 A;  3PL8 A;  3WE3 A;  4KFC A;  2O8K A;  2PMH A;  2V6E A;  2O5R A;  5FGM A;  1R5H A;  3QOD A;  2E1M B;  2MYS A;  3ABL H;  1DDN A;  1QPM A;  1ZRF A;  3W3C A;  1IUY A;  1IG7 A;  3CCU I;  3CCY A;  4WF2 A;  1K7A A;  2V1U A;  2BY3 A;  4G6T B;  5D4R A;  4M3F A;  4XRS A;  4F93 B;  3A4C A;  3CCV I;  2F6C A;  3ABM H;  2F2E A;  4M6V A;  2K3F A;  2KZV A;  2X9D A;  3FXJ A;  4AUX A;  5KNL A;  3DKX A;  5M5X J;  1VQP I;  2OTL I;  4ZYG A;  4XLC A;  1ZK8 A;  2IA0 A;  3GZ6 A;  2VQH A;  2R7F A;  4Y15 A;  2PJR A;  4KJZ A;  4XIC A;  2W48 A;  5EEG A;  2XVC A;  1UMQ A;  5K1Y A;  2XKO A;  2HYF A;  3V8L A;  2M7B A;  5FLX Z;  3ML6 A;  3WGG A;  2IA2 A;  5FD5 A;  3PFI A;  2V9K A;  1ZRE A;  3AAF A;  3GX4 X;  2DA5 A;  2M45 A;  4RB0 A;  2D5V A;  5ED4 A;  3RTR A;  2CV2 A;  1TP4 A;  1XC5 A;  2FJ1 A;  1I6X A;  2HYG D;  2Y9Y A;  4IHV A;  4ENM A;  4HNT A;  5E3L A;  3WE2 A;  1SEU A;  1RKW A;  4HG2 A;  1KYZ A;  1B8I A;  2IEK A;  5JFR A;  2RVC A;  3DQV C;  1PP7 U;  4Y7N J;  4PJJ A;  2EZK A;  2GWR A;  3ZQH A;  5CQG A;  1V5E A;  3OIQ A;  5BMZ A;  2VOO A;  4IHS A;  4HLY A;  1XN7 A;  3EYY A;  4J19 A;  1L3L A;  2O7O A;  3H9Q A;  3QPL A;  5CYV A;  3RDI A;  3FHZ A;  4OIR F;  2QA4 I;  2EIL H;  2P5K A;  3DU5 A;  5CPR B;  3D1N I;  1R49 A;  3VWB A;  4PUS A;  3MZ8 A;  4KN7 X;  3ZGK A;  5FKM A;  2X1E A;  5DYM A;  3W2A A;  2A5W A;  4A3B J;  3HOV J;  4XMY A;  4AIH A;  1OCT C;  3F8M A;  1XX5 A;  3WTV C;  1WJC A;  1JGS A;  2M5W A;  3HOX J;  4RLF A;  4YEJ A;  3F8F A;  4MO7 A;  2ZXJ A;  4LD5 A;  3Q3S A;  3H5R A;  4RBO A;  3DEE A;  4PJ0 C;  2XHK A;  1ACI A;  2DMU A;  3P9I A;  3H35 A;  1FBS A;  2LRE A;  4AYB A;  4UXN A;  2GA1 A;  4Y13 A;  2R5Y A;  2VQC A;  5FRO A;  4XLA A;  1FC3 A;  4MNU A;  4RA2 A;  5CKT A;  3IRQ A;  3A2K A;  5F27 A;  4DYR A;  3GBG A;  5D5W B;  2L7F P;  3JW4 A;  3F8B A;  4RGR A;  1DGR M;  2XGC A;  4IPA A;  4JQF A;  2L2O A;  1IN6 A;  1WH5 A;  1O3R A;  2G0E A;  3PQJ A;  4LK1 F;  2AXT C;  1XCB A;  2EFN A;  3SDB A;  2YR2 A;  4YRV A;  4PK4 A;  2GLO A;  1WCM J;  2TCT A;  2GA2 A;  4AVP A;  4L0Y B;  3SXY A;  2BV6 A;  4EJW A;  3ABT A;  1QNT A;  3OMY A;  4BEH A;  2M4K A;  3NWT A;  2WWY A;  3W6K B;  1HLV A;  3U9G A;  2VPL A;  2OZU A;  3ONQ A;  3W2V A;  2DQL A;  4D5C A;  1X1P A;  2RAE A;  1I3A A;  3RKW A;  1Y56 A;  1WJE A;  2ELK A;  3TW7 A;  3GWZ A;  1BC8 C;  2EFO A;  4BDY A;  2EIM H;  2VON A;  3FMR A;  2NS8 A;  3B6C A;  1KU2 A;  2P7V B;  4FQG A;  2WAQ N;  3FXR A;  2VC1 A;  2ACJ A;  3L2C A;  1LFB A;  3BCA A;  3QWL A;  3OSF A;  4ESF A;  2Z33 A;  4BY7 J;  4IHT A;  2EIK H;  2LY2 A;  3D5L A;  1UHW A;  2KJB A;  2OAZ A;  2L0K A;  4A0Y A;  1EH7 A;  1ETX A;  2DT6 A;  3ASO H;  3HC7 A;  5E79 C;  1OLT A;  3WU0 A;  5DM6 F;  1VQ9 I;  1WHU A;  3M7G A;  3H92 A;  1OCZ H;  1X3U A;  2F4M B;  2QEN A;  1MBJ A;  1XGM A;  3DPU A;  5EJC A;  4HDU A;  3V7R A;  2Y0S A;  4U0W A;  1NK3 P;  4O5V A;  3TOA A;  4I2O A;  3CDH A;  4IVN A;  3VDX A;  2XPV A;  2HTJ A;  1MMD A;  1TWH J;  2RGV A;  3T1B A;  2GXA A;  2MW8 A;  1SFU A;  1XGN A;  2XUB A;  2LFB A;  4EM0 B;  4D7M A;  4U7B A;  1ZR2 A;  4L5J A;  4RMN A;  4FAS D;  1WKM A;  3H3Z A;  4PJN A;  5A2Q K;  2L4A A;  3IKV A;  2M3A A;  3JAM Z;  4Y52 J;  2Z16 A;  1TNS A;  1WJD A;  4GYI A;  2DU9 A;  4YIR X;  3F22 A;  3GO5 A;  1A6Q A;  4G12 A;  3HOW J;  3BPV A;  3FXL A;  1RES A;  3G6E I;  3T0Y A;  2GM4 A;  2Y48 A;  2JZY A;  1PUF B;  3K1M A;  1IRX A;  4EV0 A;  2KRH A;  2BGC A;  2G7H A;  1YO5 C;  2DOF A;  2W82 A;  1YG2 A;  6PAX A;  4OMZ A;  1AKH B;  2H6C A;  1G3T A;  1F43 A;  2ZNY A;  1UEL B;  3EPZ A;  4XNF A;  1E2X A;  5BOX A;  1SFE A;  2V9P A;  2A69 F;  4OAZ A;  4KNY A;  4X6A J;  1SD7 A;  3OYK A;  3R60 A;  2LMD A;  1IAW A;  2Q0O A;  1T95 A;  2I10 A;  2WA0 A;  3DBR B;  2BOL A;  5GP9 A;  4M3G A;  1XTA A;  2FBH A;  1XSV A;  1MMS A;  1JHH A;  2MD5 A;  3WG7 H;  4KIB A;  4XSX F;  1YE9 A;  3HBL A;  1U3E M;  1WH7 A;  3K10 A;  3IWF A;  3HOZ J;  1U6G A;  1FSE A;  4DOZ A;  2XRO A;  3MD2 A;  1TQI A;  3PO3 J;  2AS5 F;  4NQW A;  2HOS A;  1Z7L A;  4JX6 A;  1GUU A;  1W5S A;  4LLG F;  3K2Z A;  4D1Q A;  3LAP A;  2JWT A;  1U0J A;  4UB8 C;  2XKP A;  1TT5 B;  1XGO A;  3WGH A;  2IGK A;  1K6O A;  4CGZ A;  4XBF A;  2VKD A;  2IS4 A;  2D2W A;  5LHG A;  1SVM A;  3KEY A;  1FP1 D;  4ENN A;  2XRN A;  3CCM I;  3DEU A;  4AIK A;  3KYC B;  2E5Z A;  2BW3 A;  4V2G A;  4KIG A;  4ON0 A;  3MWM A;  4XM3 A;  1R5G A;  5FRM A;  4UNO A;  1XMK A;  3EET A;  4L0Z B;  4J00 A;  3S2W A;  1NTC A;  2JPC A;  3GTG J;  1A6I A;  3IC7 A;  1QGP A;  4XRF A;  3K2A A;  4GXO A;  2LK2 A;  5EDN A;  1P92 A;  2W1O A;  5E18 F;  1XD7 A;  3O8G A;  2NVY J;  2FNA A;  1PJR A;  2DFH A;  3NAR A;  2R7Q A;  4L18 B;  3AG1 H;  4AIJ A;  3FF5 A;  2PI0 A;  2IJL A;  2W57 A;  3E1S A;  2HFH A;  2MG4 A;  4ZJZ A;  2M0C A;  5D6E A;  3F0C A;  4D5F A;  4KIS A;  5E3N A;  3FXK A;  1LDD A;  2NAZ A;  3U2R A;  3PIP F;  2QWW A;  3DKW A;  2Z3Y A;  5F6F A;  2LH9 A;  3S3O A;  3HKZ A;  3K4C A;  4XLF A;  3U21 A;  3GXO A;  4OAY A;  4MHG A;  4AU7 A;  1VQ8 I;  4A3C J;  3CES A;  3CDL A;  3PSI A;  3OL4 A;  4HX7 A;  4LB6 B;  2GOM A;  5L3F A;  1FMW A;  5GTH C;  3REO A;  1J59 A;  3ZOB A;  4E7H A;  2KRF A;  3L00 A;  3OWT A;  1LVK A;  4IKF A;  4II2 A;  1D1A A;  1MJA A;  3K1N A;  3ABU A;  3MKW B;  3BQY A;  2RNG A;  2R7V A;  3ZN1 A;  4I02 A;  2DPD A;  3F8C A;  4BHC A;  3K70 D;  3TO6 A;  2JA5 J;  1Q1H A;  3S16 J;  2P6S A;  4Q48 A;  2C6Y A;  3O8H A;  2PBI A;  1R58 A;  3LSK A;  1FTT A;  3HM5 A;  3LSR A;  2PJR B;  2IGO A;  2QSG X;  5DD4 A;  4PGG A;  4BJT A;  3I4M J;  2CUF A;  1AWC A;  4YII A;  1N25 A;  3SDG A;  1W0U A;  3SEZ A;  4WCG A;  2HQR A;  3BRO A;  4PZJ A;  4A0X A;  4BH9 A;  3I64 A;  3DLL F;  4C2M J;  4H0E A;  1FYK A;  2PMZ A;  5GPC A;  2XAU A;  5ILS A;  4IF4 A;  3ZPL A;  5GAH J;  3S1R J;  1YHQ I;  5HVQ C;  4QLC U;  3VOE A;  1ON2 A;  2YUS A;  1G8X A;  1T98 A;  2DA6 A;  2H94 A;  4C30 A;  1O57 A;  2MC3 A;  2XF7 A;  2QZ8 A;  1B8I B;  3CME I;  2JRT A;  1ETO A;  1SD5 A;  2YU3 A;  4XKB A;  2EZH A;  2E35 A;  1YX5 A;  3OYE A;  1YS6 A;  2X6W A;  2JRM A;  2VXZ A;  1YW7 A;  3BZ6 A;  2CQQ A;  2X0L A;  4IRG A;  1HA8 A;  2G9W A;  3WTS C;  4RAZ A;  1SC7 A;  1YQA A;  2RDP A;  1J0R A;  3HJE A;  2VN2 A;  3GEZ A;  3PUF A;  4S0H B;  2K5C A;  3S32 A;  2R92 J;  4IOC F;  4P5O A;  2EFW A;  3MKZ A;  3J7A O;  1QHH D;  5K5R A;  2R7W A;  3C7J A;  4LFU A;  2ESN A;  3DP7 A;  4QPQ A;  1YI2 I;  2RN7 A;  2PEX A;  1VQ5 I;  1S8N A;  2GIZ A;  4YEL A;  3SZT A;  1MKM A;  4BXU A;  1MH4 A;  2DCE A;  4B3X A;  4B4C A;  4FE7 A;  4A93 J;  2V4J C;  3T8T A;  3S8P A;  1U8B A;  3MZH A;  2PQ8 A;  4LJZ F;  3WOD F;  2DI3 A;  3LFU A;  2QQA A;  2STT A;  2IBD A;  4HOB A;  2OA4 A;  4FX0 A;  4Z2Y A;  5GAE J;  3FXU A;  2R5Y B;  1R9T J;  2F48 A;  3TL4 X;  4OIP F;  3H3V K;  2ZBK A;  2PN6 A;  1QRY A;  1J5Y A;  1VQ4 I;  1GV2 A;  4BE0 A;  1F1Z A;  1POG A;  3JRB A;  1L0O C;  4YFN F;  1X2M A;  2XIG A;  4V2F A;  2WV0 A;  4HRI A;  4IX7 A;  1AOY A;  4UVB A;  2M8E A;  1NH3 A;  3IAS 2;  2FF4 A;  3OR2 C;  5LLQ A;  1V55 H;  2VOP A;  1EH8 A;  4I76 A;  1FX7 A;  2E5N A;  5E8G A;  1DPU A;  2HDW A;  1IXR C;  3BR2 A;  3R0A A;  5F64 A;  4UUV A;  1KON A;  4HNU A;  1I6H J;  1IRG A;  1HW1 A;  4B48 A;  3HPG A;  4BQO A;  1J9I A;  1MJB A;  4KUM A;  2DO7 A;  1UHS A;  3R4K A;  2L7M P;  3RKY A;  2IVM A;  4YFK F;  3PJR A;  2P8T A;  2BY0 A;  3G73 A;  2L7Z A;  4IXA A;  4NB5 A;  1STZ A;  5M5W J;  1NG6 A;  1OYW A;  1HQC A;  3OY9 A;  1K78 A;  1IO2 A;  4EJU A;  1YIJ I;  3JTH A;  4HV5 A;  1LEB A;  2DA7 A;  3C1D A;  4HQM A;  4HDV A;  4G9Y A;  4M3E A;  3HTS B;  4F55 A;  4HPQ A;  2DA2 A;  2LKS A;  3DKY A;  1X4O A;  4AYB N;  1BR4 A;  1ZG1 A;  2DFE A;  4B8X A;  3S2H J;  1WJB A;  4M74 A;  4II3 A;  2CYY A;  4KYW A;  4PJL A;  1D1C A;  3G1L A;  1HF0 A;  1FYL A;  4UV8 A;  3O2P E;  4HX4 A;  3M8F A;  5BPI A;  2MLG A;  5HNH A;  2F5C A;  3ECO A;  3RKQ A;  1FBQ A;  2O0Y A;  3HB9 A;  4XR6 A;  1LFU P;  1PDN C;  3CMA I;  5J8C A;  2NNY A;  3FWE A;  2CG4 A;  2ZFW A;  3J81 K;  1W36 D;  1IV6 A;  1ETK A;  3EDP A;  4MQ9 F;  4RDU A;  2K3P A;  4G6D A;  3OV8 A;  2YPR A;  4CZC A;  4O6J A;  4WXH A;  4M6X A;  5BNG A;  2QBY B;  3IKT A;  3TGN A;  1MBK A;  1PUF A;  4L9V A;  3OS1 A;  2OZ6 A;  2MA3 A;  2QSH X;  2M2E A;  3BJA A;  4FX4 A;  4IHX A;  5LHI A;  3GUD A;  2TDX A;  2VC0 A;  1ETY A;  3LSG A;  1ULY A;  1WWX A;  5A2Q Z;  4UUT A;  4CUG A;  2HVS A;  2LF8 A;  1MSE C;  3BJO A;  3GVA A;  1SVO A;  2MC4 A;  5B5E C;  4A3K J;  2CV1 A;  2K02 A;  4GRI A;  3LA3 A;  3HRS A;  1LJ9 A;  2Y0M A;  3FZV A;  3BT9 A;  4XLE A;  2MGQ A;  2XC7 A;  3ISP A;  3PO2 J;  2GQQ A;  2BE5 F;  3DPL C;  2L9R A;  3HG9 A;  2UZK A;  3IH3 A;  3GCM A;  4XLH A;  1Y6I A;  2FX0 A;  3ESW B;  4LIU A;  1O3T A;  1JUM A;  2JUC A;  2FUG 2;  3OYJ A;  2ZJQ F;  1ZG3 A;  5IP7 J;  2JJ7 A;  1BA5 A;  5HS8 A;  4M71 A;  3OYH A;  2XGD A;  3HL2 A;  2MFZ A;  1R1V A;  2Y0S N;  2NVT J;  2BXZ A;  2JMW A;  5CVR A;  5IYD J;  4NQW B;  5K7F A;  3DBH B;  2WY7 Q;  1W0T A;  1H8A C;  1PUE E;  2FSW A;  1IN4 A;  1ZLJ A;  1AA7 A;  3DV8 A;  5JLW A;  3ZMV A;  4AM3 A;  9ANT A;  4GCV A;  2XAS A;  1MDM A;  1ONV A;  4UB6 C;  1VND A;  2W4S A;  5B1B H;  3BR3 A;  3BTC A;  4ZDO A;  1HSJ A;  4QPO A;  1FIA A;  2GAU A;  1XCV A;  2F5V A;  5JHU A;  1E3P A;  2DK8 A;  4EM2 A;  2X6X A;  2X48 A;  3FBI B;  3QPT A;  4J01 A;  3HIF A;  4ZYH A;  4BS9 A;  1J75 A;  3ZXS A;  1V5F A;  5EYR A;  3CUO A;  2ZJR F;  1D5Y A;  4DZJ A;  3BTI A;  5LGU A;  4BBR J;  3KLN A;  1IC8 A;  2EV5 A;  1VTN C;  2EV6 A;  5E20 A;  3WHB A;  1KZH A;  5K7Z A;  5K5Q A;  1HW5 A;  2FMY A;  2JTV A;  5IYB J;  4ZZD A;  5E1Z B;  2VJI A;  2R7Z J;  2STW A;  1ZGA A;  4L5I A;  1VQM I;  2K85 A;  3DTE A;  1BJZ A;  1W4M A;  2DA3 A;  1RC9 A;  4AWX B;  5CQE A;  2AO9 A;  4FE4 A;  3KYL A;  3HDD A;  3B02 A;  2FRH A;  2MBF A;  4FHT A;  4AC0 A;  5HLT A;  2W24 A;  1Q1V A;  3F6O A;  3I4N J;  1Z7U A;  4PDK A;  2A6E F;  5DS9 A;  1ZKG A;  1ZQ3 P;  4RGS A;  3JRI A;  1YOV B;  4HSR A;  1CF7 B;  1IV8 A;  1TW3 A;  2KT0 A;  4X0G A;  1F36 A;  3O3K A;  3TKY A;  3EUA A;  2FNP A;  3G2B A;  2A05 A;  2HYJ A;  2KIU A;  2X4H A;  5DV5 A;  2HPM A;  2EPF A;  3CCL I;  1SD4 A;  4D0P A;  1DPR A;  2ZB9 A;  2HI3 A;  4A3L J;  4X1E A;  1HKT A;  4MTD A;  4ENJ A;  5CLS A;  2FBK A;  4ZDP A;  5DCF A;  5CJ9 A;  4B3A A;  1UHM A;  1LPQ A;  3BG7 A;  4E4H A;  1BL0 A;  3GFM A;  4EAT A;  1FOX A;  1QVU A;  4ZTF A;  2ZXH A;  2VJ5 A;  2XPU A;  4B44 A;  3SZG A;  5E3M A;  2W84 A;  2QUF A;  4OOI A;  5IOZ A;  3BZC A;  4PJM A;  1MMG A;  5ICE A;  1R1T A;  2VPR A;  3CJQ B;  3LAJ A;  5IP9 J;  3H9G A;  3E0J B;  2CJJ A;  4R1H A;  3KX2 A;  3RQ4 A;  4CIC A;  5GAG J;  1S7O A;  1R4M B;  2K9L A;  4P55 A;  1FTZ A;  3HKZ N;  3VFZ A;  1JKQ C;  5DCM B;  2LOO A;  4DGW B;  3CTA A;  1ERD A;  1EF4 A;  4Y4R A;  3LSJ A;  3G71 I;  3E6C C;  1W5T A;  5K7H A;  1YTY A;  3OYB A;  2JN6 A;  5ICG A;  3BQZ A;  2KIF A;  3COA C;  2E2I J;  3BP8 A;  2NOG A;  3MN2 A;  2A6T A;  3VYU B;  2H6B A;  1WI3 A;  2EFQ A;  5J4V A;  2HOE A;  3ASN H;  2NNN A;  1OR7 C;  1PP8 F;  2CW0 F;  3ZQC A;  1LQ1 A;  2W00 A;  1OJL A;  2O8X A;  2ME0 A;  2HU9 A;  1A5J A;  1MBH A;  4F92 B;  1G59 A;  4CDG A;  2CU7 A;  3J80 K;  2FQ4 A;  2EA4 A;  1EV7 A;  4XON A;  2QEX I;  2PMZ N;  3OYA A;  2AHQ A;  1J2X A;  4XRS G;  3KYD B;  2HXI A;  2X6O A;  3K69 A;  1TC3 C;  3PNY A;  2A07 F;  2XB5 A;  2QGU A;  1MND A;  3CLO A;  3CLQ A;  1HST A;  2HKX A;  2IW5 A;  4IO9 F;  3CC7 I;  5F0H A;  3GZ5 A;  4HF2 A;  5F08 A;  1HKQ A;  4JYK A;  1D0X A;  1I5Z A;  3OOP A;  4A3F J;  5C4X J;  3GW2 A;  2KIQ A;  3W2W A;  3G1M A;  3UKG A;  2VBZ A;  4EJO A;  5F04 A;  1YJW I;  1VF9 A;  4EJT A;  1BIB A;  3I4P A;  2EFP A;  2P6T A;  1YLF A;  3HOS A;  5J8F A;  2N8G A;  1U5T C;  4OIO F;  4KIF A;  4G6Q A;  3OR1 C;  5FKO A;  2ID3 A;  5LRS A;  4EM1 A;  5HOD A;  4DQ2 A;  1VQK I;  4XK4 A;  2HS5 A;  5HS9 A;  4BAY A;  3KEO A;  1XSD A;  2RNJ A;  3H5A A;  1I1S A;  5KAF C;  1Y8Q B;  2TRT A;  2VIX A;  2F5D A;  2VI6 A;  1K78 B;  4MEY F;  3VSL A;  1LEA A;  3CP2 A;  2JA6 J;  3LSH A;  4B1R A;  2XDV A;  3DWL E;  3CD6 I;  2F4I A;  4EVI A;  3PFY A;  2MSY A;  3QPH A;  3ZMU A;  4A3M J;  2H8W A;  3ZQI A;  3ZMZ A;  3BWG A;  4W97 A;  3K7A J;  4D9J A;  3L2W A;  2BZT A;  2KFD A;  4MTE A;  3VYR B;  3CO6 C;  1H88 C;  3LQQ A;  1T38 A;  4C2T A;  1O7F A;  3F8N A;  2LF7 A;  1ZR4 A;  2EK5 A;  1IN7 A;  2CFO A;  4GYG A;  4HZF A;  1OCO H;  2MAB A;  5EEH A;  2LC2 A;  2EV0 A;  2IT0 A;  2QBY A;  2CS3 A;  3WU1 B;  1BC7 C;  1OQY A;  2FEZ A;  4M6Y A;  3H36 A;  5TJJ A;  2WB1 N;  1LB2 A;  1YW9 A;  3I71 A;  1MBE A;  4BQN A;  3BJ6 A;  1VQL I;  4LMY A;  1JJ6 C;  1W7P B;  1Y1W J;  1D3Y A;  5KK1 A;  4HF1 A;  3BC8 A;  3J81 Z;  4GO1 A;  3RPU A;  4KT5 C;  4M3B A;  3O6B B;  4NUB A;  1JE8 A;  3BR1 A;  4EQQ A;  2CFX A;  5M5Y J;  1G6N A;  3LOC A;  1DQU A;  3R0J A;  4LLL A;  2DTZ A;  2CH0 A;  2ADU A;  3PSF A;  1TQP A;  5FKL A;  2LD5 A;  3JR9 A;  1FOK A;  1KGS A;  2A68 F;  1K61 A;  2M4G A;  4AID A;  2LR8 A;  5FD6 A;  4UVA A;  4JOM A;  2J5O A;  2HTS A;  2ZKZ A;  3RCO A;  3JCU C;  4WWC A;  1RRJ A;  4QTR A;  3G1O A;  2ISZ A;  1S6L A;  1VFC A;  1IN5 A;  1GVJ A;  1TL8 A;  3IRR A;  3M9A A;  2YX4 A;  4CA0 A;  2JPB A;  2RC4 A;  2DDA A;  3IV5 A;  2V1D A;  2XAQ A;  5H6Q A;  3EQL F;  4I7H A;  3OYD A;  4BNC A;  1OMI A;  4IZZ A;  5JLX A;  2R3S A;  3S3N A;  3S17 J;  2ZFU A;  4DBQ A;  1FSH A;  1FT9 A;  2Z9O A;  2K9N A;  1BN5 A;  1H89 C;  3KLO A;  2RQP A;  5L3C A;  3V42 A;  4DNC A;  4UUS A;  3OL3 A;  5J4Y A;  3A0B C;  3WTX C;  1VQ6 I;  3ZQQ A;  1MDM B;  4ZZL A;  1RR7 A;  3WGI A;  3I55 I;  3A03 A;  1Z91 A;  1FOW A;  2UUZ A;  3RI4 A;  4IJA A;  4BHP A;  1X19 A;  2EIN H;  3CMM A;  1BW6 A;  3F6V A;  4I01 A;  4I98 B;  2E2H J;  3QYF A;  2B9S A;  1F5T A;  2O9L A;  1Z3Y A;  2L3D A;  2A5Y B;  4TV7 A;  4QIW N;  3S14 J;  2PFB A;  3S15 J;  4AVZ A;  3HSR A;  1FOY A;  2B0L A;  1P4W A;  1T56 A;  2DFI A;  3ABK H;  3FMS A;  3FHN A;  3RJP A;  4OMY A;  3A01 B;  2OC6 A;  3BTJ A;  1WJF A;  1BBY A;  5DD8 A;  4FCY A;  1UCR A;  4BQA A;  3ZRG A;  1YX3 A;  2JT1 A;  3ELK A;  4A5N A;  3CF5 F;  3KCC A;  4F3Q A;  4U7D A;  4CO8 A;  3OYG A;  1AU7 A;  2H1K A;  1XDS A;  2PJP A;  4E6K G;  4BJ5 C;  3ZP5 A;  1JTY A;  3KEQ A;  3WTW C;  1WJ5 A;  1HBX G;  1B1B A;  3IUO A;  5BPD A;  3KFW X;  1A31 A;  2L01 A;  2VOD A;  1BOA A;  4C3I J;  1TWC J;  1U9O A;  3H0D A;  1K6Y A;  1TWG J;  3WHC A;  1A36 A;  3KZI C;  5BQT A;  2RV8 A;  3IH2 A;  2EH3 A;  3BDD A;  4FT8 A;  3JRH A;  3V4G A;  1X3Z B;  2ELH A;  4P1W A;  2R7S A;  1CF7 A;  5IT3 A;  3MQ0 A;  3E5X A;  1KA8 A;  3CCQ I;  2EIJ H;  1JKO C;  1X3W B;  1SVL A;  5E1W A;  2OBP A;  2XAF A;  3M07 A;  5DTD A;  1HDP A;  2DW4 A;  3L9F A;  1BW5 A;  3OIP A;  4XOR A;  4K2E A;  4GDF A;  5FKN A;  4HEA 2;  1YYV A;  2FU4 A;  1ZRC A;  2VL8 A;  1XDU A;  1R1U A;  5EG0 B;  5M3F J;  4CCL A;  2V9V A;  3FX3 A;  3JRG A;  3E6M A;  1CGP A;  2I8D A;  2IGM A;  2HZD A;  4LG0 A;  5LBQ A;  5D5V B;  3BG3 A;  2VAS A;  2Z99 A;  2VKE A;  1ODD A;  3A02 A;  2JSP A;  2LSO A;  2VKV A;  2CQX A;  4NDL A;  4OIQ F;  1K83 J;  1MNE A;  3FKJ A;  5B66 C;  2DYR H;  3HYI A;  2QYO A;  2ZC2 A;  4Q4Z F;  3S2D J;  1GXQ A;  1K4S A;  1APL C;  5DDG A;  4WX9 A;  5D6F A;  4F52 A;  3KPH A;  3AG3 H;  2CUZ A;  3H3U A;  2EZL A;  5FFZ A;  1B9M A;  1FY7 A;  2ECB A;  2L4M A;  3DTI A;  3R6S A;  4IRI A;  4RB2 C;  2JA7 J;  1A04 A;  3G4S I;  2E71 A;  5DCM A;  5JVG F;  3J7A Y;  4XN0 A;  3KP4 A;  1VZ0 A;  2VJJ A;  2ZXW H;  4A3G J;  2PG4 A;  2FML A;  1SFX A;  2E1N A;  2WV1 A;  2X1D A;  4LIT A;  2BEO A;  2ZNZ A;  5FKK A;  2R7R A;  4JK1 X;  1D8K A;  2QQ9 A;  2ME6 A;  3DCF A;  3RPU D;  2K4B A;  4JBA A;  1MBG A;  3DFG A;  4A5M A;  3LMM A;  4ZDL A;  4LLN A;  5ILU A;  2DN0 A;  3I5U A;  1Z77 A;  3HSF A;  4ETS A;  2E36 A;  4KT6 A;  1U5T A;  5LFA A;  2LY9 A;  3QYE A;  4YIF A;  2E1C A;  3U1D A;  4BHB A;  5J1R A;  2LTP A;  3GFI A;  3IHU A;  1H9G A;  4E7Z A;  4CCK A;  1BM9 A;  2WAQ A;  1HKS A;  5LRR A;  5GAD J;  3TOB A;  2LKP A;  1YIO A;  2BVL A;  3ZMS A;  1XG1 A;  2CV0 A;  4HQE A;  5AIQ A;  2YU9 J;  3CDI A;  1Z1D A;  2KJC A;  2ETH A;  5KVR A;  2RQQ A;  3S3M A;  2NS7 A;  2HPI A;  3BR5 A;  4UV9 A;  2P5L C;  3LSI A;  5HDN A;  4HBL A;  4IEJ A;  4A3I J;  2O6G E;  3FKI J;  5HNF A;  2HOT A;  1T0F C;  3ZMD A;  3J80 Z;  2BY1 A;  2DDB A;  2CRG A;  3JTG A;  3KP2 A;  1U78 A;  1GT0 C;  1IDY A;  4MGR A;  5M3M J;  1WVR A;  4P96 A;  1NG7 A;  2M0M A;  1KU7 A;  3KP5 A;  2Y31 A;  3D0S A;  4IHY A;  3HHH A;  3LFK A;  3HGY A;  1WFX A;  4ZTJ A;  4RGU A;  2K4J A;  2NXN B;  3LA7 A;  1RI7 A;  4Y33 A;  4O3M A;  3V8J A;  4XID A;  3HTU A;  5LGN A;  3E6D A;  1XB4 A;  5J1U A;  2ESH A;  5C3E J;  5E3O A;  2A3S A;  1R6R A;  2A61 A;  2CUE A;  1XS9 A;  3TP3 A;  1YRN A;  2V1X A;  3EYI A;  2DXI A;  4KA4 A;  3JSP A;  2DT5 A;  2X6Y A;  3LL7 A;  3GME A;  2B63 J;  2ZO4 A;  3UR3 C;  4M73 A;  3A0H C;  1B59 A; 
#chains in the Genus database with same CATH homology
 3W6V A;  2VB6 A;  2VJ4 A;  1DGW Y;  3MMY B;  1Y1V J;  3OYC A;  1JT0 A;  4PSX A;  4DIQ A;  2XB0 X;  5EZH A;  1JKR C;  3DLA A;  2NVX J;  1ZEL A;  4BUP A;  1P7I A;  5IOY A;  2QF7 A;  2AQE A;  2H8R A;  4BE1 A;  3VYS B;  1PYV A;  3VYT B;  4C3J J;  4N4N B;  1WPK A;  5IYC J;  2DA1 A;  4CCN A;  1ZGW A;  2LP0 A;  3FDY A;  5F0C A;  3SJM A;  1IUF A;  2R7U A;  2HVQ A;  4E7I A;  1J09 A;  3PNT A;  1JI8 A;  4BE2 A;  3Q0W A;  2R7X A;  2QCO A;  3K4N A;  3FIS A;  1BR2 A;  4FIS A;  1MW7 A;  5EEA A;  4N4O B;  3K70 C;  5J3L A;  1N77 A;  2KHM A;  4BU2 A;  3VSK A;  3QPS A;  3HUG B;  4CSW A;  4IQJ A;  2ZSI B;  1EA3 A;  3OYN A;  2Z2S B;  4HNV A;  3H5N A;  2IS6 A;  3RZD J;  4C2U A;  3MKL A;  1BR1 A;  4QSH A;  1U9N A;  1N75 A;  1B72 B;  3SYT A;  4XRM A;  2UWM A;  3SEQ A;  4DBR A;  3AKZ A;  3DPT A;  4UUS B;  3TED A;  2NVQ J;  3TMO A;  4XOP A;  1AHD P;  4ANJ A;  2DMT A;  1X2N A;  5FLV A;  2XRL A;  3LNQ A;  4ZC3 A;  3A01 A;  2KPM A;  4ITV A;  2XPW A;  2K40 A;  4BQQ A;  3AL0 C;  4A3J J;  3FIW A;  3H0G J;  5TGT A;  2VKH A;  4Y3O A;  4BXF A;  3N05 A;  2WAD A;  1GLN A;  1X58 A;  2E60 A;  2HQA A;  3CF2 A;  2V26 A;  3BG6 A;  3TW6 A;  3H9J A;  5EG0 A;  1ETV A;  2WY8 Q;  2CW7 A;  3K4L A;  2DOA A;  3DEW A;  2DT7 B;  1D0Z A;  2EBI A;  1ETQ A;  4NNJ A;  5FLM J;  2ID6 A;  3Q0V A;  2VUM J;  2DA4 A;  2X51 A;  4FET A;  4JX5 A;  2KLO A;  2Z1D A;  2L9N A;  4JX4 A;  1LE8 B;  3HOU J;  1QVT A;  2IGN A;  1X1A A;  3TP0 A;  4EEF G;  4PSW A;  2KQR A;  3CZ6 A;  2E1M C;  3M4O J;  3CMY A;  4XOT A;  3GTO J;  1I3Q J;  3C2G A;  1Z3X A;  1DU6 A;  3GTJ J;  1X1C A;  3OYI A;  1ORK A;  2KDO A;  1JKP C;  3QOE A;  2LYC A;  2KRC A;  2WAE A;  1FEX A;  1WJA A;  2Y2Z A;  3E7L A;  3A1Y A;  4CH7 A;  1W36 C;  4C9Y A;  2R7O A;  3ZQG A;  2AQF A;  1QHG A;  5C44 J;  2R7T A;  2NOJ B;  2Q1Z B;  2K9M A;  2P0W A;  5F1J A;  3IH4 A;  3EUK L;  2DMQ A;  2K9S A;  4B47 A;  1IDZ A;  4E7K A;  2V1N A;  3RSN A;  3D5R C;  3QQA A;  4ABZ A;  4MFE A;  4PFO A;  2KL4 A;  4PFP A;  5FRN A;  1LDK B;  1DP3 A;  1MNM C;  4I6Z A;  4CCM A;  4E7L A;  3OYL A;  4DW6 A;  5LD2 C;  4LG3 A;  4IHW A;  1YRN B;  3BCB A;  4XKV A;  1IJW C;  4FTH A;  2VQL A;  2LLK A;  2E19 A;  4MFD A;  3AFH A;  4MLO A;  1ZTR A;  3L2V A;  2E2J J;  2P81 A;  4NC7 A;  4CYC A;  1RET A;  2HXO A;  2K9Q A;  3GTM J;  4CCJ A;  3BTL A;  1HOM A;  3I9V 2;  1N78 A;  4LIV A;  3HOY J;  1S9H A;  4OWR B;  4B43 A;  2R5Z B;  3BLY A;  3TBI A;  1HCR A;  2X85 A;  1ENH A;  3M8J A;  2XSJ C;  1TWF J;  1ETW A;  2Y30 A;  3C2B A;  2YS9 A;  1I50 J;  3K6G A;  1LKX A;  4CCO A;  3ZR8 X;  4A69 C;  2R0Q C;  3CQZ J;  4DYQ A;  4XKC A;  2L5Q A;  3OS0 A;  1FIP A;  4F91 B;  3GTQ J;  1JUS A;  5F0F A;  3HXL A;  4R79 A;  2GOX B;  4ZYA A;  2LRD A;  3BR0 A;  3OS2 A;  1O4X A;  1TT0 A;  2COB A;  1MSF C;  2LBF B;  2E1O A;  1B72 A;  1BOB A;  3L1P A;  1VI0 A;  3FK7 A;  2Q2E B;  2V7F A;  1Z0X A;  5EF6 A;  3OSG A;  2HVR A;  3B6A A;  4BKX A;  4BY1 J;  5GPA A;  2R4G A;  5FJ8 J;  4L5E A;  5EGO B;  2M7A A;  2XF5 A;  2DJI A;  2HQ5 A;  4JP0 A;  3GTK J;  2WBM A;  3CP8 A;  1UAA A;  4C3H J;  4XQF A;  2DMP A;  4MIM A;  4IQ4 A;  3HEF A;  1QPI A;  3BR6 A;  3SFI A;  1RKT A;  2CUJ A;  1TZL A;  2FD5 A;  3OIO A;  1JJ8 C;  3S1M J;  4GFB A;  2JVH A;  4U87 A;  3LSP A;  3EUH C;  2DMN A;  3M1C A;  4XL9 A;  4NC8 A;  2JUG A;  4KIT B;  4BAC A;  1HDD C;  2L9S A;  2JK3 A;  1IRZ A;  1E3O C;  3S1N J;  1UG0 A;  2QKL B;  3PM1 A;  4BGD A;  1GVD A;  1LE8 A;  2MD0 A;  4LOC A;  1TWA J;  4XN3 A;  1JGG A;  2JA2 A;  3IAM 2;  2HNH A;  3MKY B;  1SAN A;  1WGX A;  2RRE A;  3ZQF A;  3Q0U A;  1Z21 A;  3LSM A;  3F9K A;  1JUP A;  3RZO J;  1SAU A;  2DJN A;  2BVM A;  2VLA A;  1X1D A;  3OYM A;  3OOU A;  5HOO A;  3L2Q A;  5IPA A;  1GV5 A;  3GTL J;  1FMV A;  2QKM B;  4M3D A;  1MMA A;  2CMP A;  1MH3 A;  1G2H A;  2CW8 A;  3ZQL A;  2OV7 A;  2ELJ A;  2JVG A;  4H4K C;  4E7S A;  3UNG C;  1D1B A;  4D7N A;  2IAI A;  3K4M A;  2M34 A;  1OCP A;  3BG9 A;  3BG5 A;  2ZSH B;  1SFK A;  3ZCO A;  1JT6 A;  5KHD A;  3HPH A;  3S1Q J;  5IP6 A;  2LKX A;  2XSD C;  3HGG A;  1FJL A;  2ZXI A;  1SFO J;  2WB1 A;  3D5S C;  3JRC A;  4BXX J;  2IS1 A;  4BEH B;  1S7E A;  1MBF A;  4A3E J;  1DU0 A;  3JRF A;  2IS2 A;  1CQT A;  2M9H A;  4A3D J;  3K4B A;  2LVS A;  3DU6 A;  3HOT A;  2ECC A;  4RLQ A;  3JRA A;  1NK2 P;  2W7N A;  4DZP A;  4DJA A;  1IGN A;  3CJR B;  4CYC B;  2KDZ A;  3VPR A;  2VXD A;  2LG4 A;  2EQR A;  2GBY A;  3MVP A;  2R5Z A;  1QU3 A;  2WAF A;  3K4J A;  4RM2 A;  2XF6 A;  4BL0 B;  1MMN A;  5KCM A;  3S93 A;  4RM3 A;  4BJ6 C;  4BBS J;  3PUB A;  2EZI A;  3JRD A;  3FK6 A;  4W1U A;  3GTP J;  1RPW A;  3NWS A;  2VQG A;  1AKH A;  2X1C A;  3IP4 B;  5EZG A;  3FBN B;  2LY1 A;  1X1B A;  5C4J J;  1E0E A;  4XKW A;  3L2R A;  4BDZ A;  3DTK A;  3AL0 B;  3OYF A;  2LBF A;  3I3L A;  1UG2 A;  4HST A;  5J1Y A;  2Y9Z A;  2JA8 J;  2HDD A;  5JHF A;  2KMU A;  1P7J A;  3K4K A;  4E7J A;  3QYB A;  1JTX A;  4DYC A;  5EGO A;  2M8G X;  2KP6 A;  2OUM A;  2R93 J;  1X4P A;  2OPT A;  2L7K A;  3PNV A;  3L2U A;  1T33 A;  1OFC X;  1D0Y A;  3JRE A;  1V5G A;  2IXS A;  2HOA A;  1P9Q C;  2BW3 B;  1GDT A;  3M3Y J;  3RQI A;  2XGE A;  1LFP A;  3C2H A;  1ITY A;  2OF7 A;  3NAU A;  2UV1 A;  3PL8 A;  2O8K A;  2V6E A;  2O5R A;  3QOD A;  2E1M B;  2MYS A;  3W3C A;  1IG7 A;  3CCY A;  4G6T B;  4M3F A;  4XRS A;  4F93 B;  3A4C A;  2F6C A;  4M6V A;  2X9D A;  2KZV A;  4AUX A;  5KNL A;  3DKX A;  5M5X J;  4XLC A;  1ZK8 A;  2VQH A;  2PJR A;  4KJZ A;  4XIC A;  2W48 A;  1UMQ A;  2M7B A;  2V9K A;  2DA5 A;  2D5V A;  3RTR A;  2CV2 A;  1XC5 A;  2FJ1 A;  2Y9Y A;  4IHV A;  4HNT A;  5E3L A;  1RKW A;  4HG2 A;  1B8I A;  2IEK A;  3DQV C;  4Y7N J;  4PJJ A;  2EZK A;  3ZQH A;  5CQG A;  1V5E A;  3OIQ A;  4J19 A;  2O7O A;  3H9Q A;  3QPL A;  5CPR B;  3DU5 A;  3D1N I;  3VWB A;  4PUS A;  3ZGK A;  5FKM A;  2X1E A;  3W2A A;  2A5W A;  4A3B J;  3HOV J;  1OCT C;  4XMY A;  1WJC A;  3HOX J;  4RLF A;  4YEJ A;  4MO7 A;  3Q3S A;  4RBO A;  3H5R A;  3DEE A;  2DMU A;  3H35 A;  2LRE A;  4AYB A;  2R5Y A;  2VQC A;  5FRO A;  4XLA A;  5CKT A;  3A2K A;  5F27 A;  4DYR A;  3GBG A;  2L7F P;  1DGR M;  2XGC A;  4JQF A;  2L2O A;  1WH5 A;  2G0E A;  4YRV A;  3SDB A;  2GLO A;  4PK4 A;  1WCM J;  2TCT A;  4BEH A;  3OMY A;  2M4K A;  3NWT A;  1HLV A;  2VPL A;  3ONQ A;  3W2V A;  4D5C A;  2RAE A;  1Y56 A;  1WJE A;  2ELK A;  3TW7 A;  4BDY A;  2NS8 A;  3B6C A;  2WAQ N;  1LFB A;  3BCA A;  3OSF A;  4BY7 J;  2LY2 A;  3D5L A;  2L0K A;  1ETX A;  2DT6 A;  3HC7 A;  1OLT A;  1MBJ A;  3DPU A;  2Y0S A;  1NK3 P;  3VDX A;  2XPV A;  1TWH J;  1MMD A;  2MW8 A;  2LFB A;  4D7M A;  4U7B A;  1ZR2 A;  4RMN A;  4FAS D;  4PJN A;  2M3A A;  4Y52 J;  2Z16 A;  1WJD A;  4G12 A;  3HOW J;  1RES A;  2GM4 A;  1PUF B;  1IRX A;  2KRH A;  2W82 A;  1AKH B;  1F43 A;  1UEL B;  3EPZ A;  4XNF A;  4X6A J;  4OAZ A;  3OYK A;  2I10 A;  1T95 A;  2WA0 A;  2BOL A;  5GP9 A;  4M3G A;  3HBL A;  1YE9 A;  1WH7 A;  3K10 A;  3HOZ J;  4DOZ A;  3MD2 A;  3PO3 J;  2HOS A;  1Z7L A;  4JX6 A;  1GUU A;  4D1Q A;  2JWT A;  1U0J A;  2IGK A;  2VKD A;  2IS4 A;  3KEY A;  2E5Z A;  4V2G A;  2BW3 A;  4XM3 A;  5FRM A;  4J00 A;  3GTG J;  1NTC A;  1A6I A;  3K2A A;  2LK2 A;  5EDN A;  2W1O A;  3O8G A;  2NVY J;  1PJR A;  3NAR A;  2R7Q A;  3E1S A;  2MG4 A;  4ZJZ A;  2M0C A;  3F0C A;  4D5F A;  4KIS A;  5E3N A;  2LH9 A;  3S3O A;  3HKZ A;  3K4C A;  4XLF A;  3U21 A;  4OAY A;  4AU7 A;  4A3C J;  3CES A;  3CDL A;  3PSI A;  3OL4 A;  2GOM A;  1FMW A;  3ZOB A;  4E7H A;  3OWT A;  1LVK A;  4IKF A;  4II2 A;  1D1A A;  3MKW B;  2R7V A;  3BQY A;  2RNG A;  3S16 J;  2JA5 J;  3K70 D;  3O8H A;  3LSK A;  1FTT A;  3HM5 A;  3LSR A;  2PJR B;  2IGO A;  4BJT A;  3I4M J;  2CUF A;  1W0U A;  3SDG A;  3SEZ A;  4C2M J;  2PMZ A;  5GPC A;  2XAU A;  3S1R J;  5HVQ C;  2YUS A;  2DA6 A;  1G8X A;  4C30 A;  2XF7 A;  1B8I B;  1ETO A;  4XKB A;  2EZH A;  3OYE A;  1YX5 A;  2X6W A;  1HA8 A;  2VXZ A;  2CQQ A;  4S0H B;  2K5C A;  3S32 A;  2R92 J;  4P5O A;  3MKZ A;  1QHH D;  2R7W A;  4QPQ A;  4YEL A;  1MH4 A;  2DCE A;  4B3X A;  4B4C A;  4FE7 A;  4A93 J;  2V4J C;  1U8B A;  3S8P A;  3LFU A;  2IBD A;  2R5Y B;  1R9T J;  3H3V K;  3TL4 X;  1QRY A;  1GV2 A;  4BE0 A;  1POG A;  3JRB A;  1X2M A;  4V2F A;  4HRI A;  4IX7 A;  3IAS 2;  3OR2 C;  4I76 A;  2E5N A;  2HDW A;  3BR2 A;  1KON A;  1I6H J;  4HNU A;  4B48 A;  3HPG A;  4BQO A;  1UHS A;  2L7M P;  3PJR A;  2L7Z A;  5M5W J;  1NG6 A;  3OY9 A;  2DA7 A;  4M3E A;  4F55 A;  4HPQ A;  2DA2 A;  3DKY A;  1X4O A;  4AYB N;  1BR4 A;  3S2H J;  1WJB A;  4II3 A;  4PJL A;  1HF0 A;  3G1L A;  1D1C A;  5HNH A;  3RKQ A;  3HB9 A;  4XR6 A;  1LFU P;  1W36 D;  1IV6 A;  1ETK A;  4RDU A;  2K3P A;  4CZC A;  5BNG A;  1MBK A;  1PUF A;  3OS1 A;  2M2E A;  4IHX A;  1ETY A;  3LSG A;  4UUT A;  4CUG A;  2HVS A;  1MSE C;  2MC4 A;  2CV1 A;  4A3K J;  4GRI A;  3BT9 A;  4XLE A;  2MGQ A;  2XC7 A;  3PO2 J;  3DPL C;  3HG9 A;  2L9R A;  3IH3 A;  4XLH A;  1Y6I A;  2FX0 A;  4LIU A;  1JUM A;  2FUG 2;  3OYJ A;  5IP7 J;  2JJ7 A;  1BA5 A;  3OYH A;  3HL2 A;  2XGD A;  2MFZ A;  2Y0S N;  2NVT J;  2JMW A;  5IYD J;  4NQW B;  5K7F A;  1H8A C;  1W0T A;  2WY7 Q;  1AA7 A;  5JLW A;  9ANT A;  1VND A;  2W4S A;  3BR3 A;  3BTC A;  4ZDO A;  4QPO A;  1FIA A;  2F5V A;  2X6X A;  2X48 A;  3FBI B;  4J01 A;  4BS9 A;  1D5Y A;  3ZXS A;  1V5F A;  5EYR A;  4DZJ A;  3BTI A;  4BBR J;  1IC8 A;  3WHB A;  5K7Z A;  5IYB J;  2VJI A;  2R7Z J;  3DTE A;  1BJZ A;  2DA3 A;  5CQE A;  2AO9 A;  4FE4 A;  3KYL A;  3HDD A;  4AC0 A;  5HLT A;  1Q1V A;  3I4N J;  5DS9 A;  1ZKG A;  1ZQ3 P;  3JRI A;  4HSR A;  2KT0 A;  4X0G A;  1F36 A;  3EUA A;  3G2B A;  2HYJ A;  2HPM A;  2ZB9 A;  2HI3 A;  4A3L J;  4X1E A;  4ZDP A;  4B3A A;  3BG7 A;  4E4H A;  1BL0 A;  4EAT A;  1QVU A;  4ZTF A;  2ZXH A;  2XPU A;  2VJ5 A;  4B44 A;  3SZG A;  5E3M A;  5IOZ A;  4PJM A;  1MMG A;  2VPR A;  3CJQ B;  5IP9 J;  3H9G A;  3E0J B;  2CJJ A;  3RQ4 A;  3KX2 A;  2K9L A;  1FTZ A;  3HKZ N;  1JKQ C;  2LOO A;  4DGW B;  1ERD A;  1EF4 A;  4Y4R A;  3LSJ A;  5K7H A;  3OYB A;  2JN6 A;  3BQZ A;  2E2I J;  2NOG A;  3MN2 A;  2A6T A;  3VYU B;  1WI3 A;  1OR7 C;  3ZQC A;  2W00 A;  1OJL A;  2ME0 A;  2HU9 A;  1A5J A;  1MBH A;  4F92 B;  1G59 A;  2CU7 A;  2FQ4 A;  4XON A;  2PMZ N;  3OYA A;  2AHQ A;  4XRS G;  2HXI A;  2X6O A;  1TC3 C;  3PNY A;  2XB5 A;  1MND A;  5F0H A;  5F08 A;  4JYK A;  1D0X A;  4A3F J;  5C4X J;  3W2W A;  3G1M A;  3UKG A;  5F04 A;  1VF9 A;  3HOS A;  2N8G A;  3OR1 C;  5FKO A;  2ID3 A;  5HOD A;  4XK4 A;  3H5A A;  2TRT A;  2VIX A;  2VI6 A;  3VSL A;  3CP2 A;  2JA6 J;  4B1R A;  3LSH A;  2XDV A;  3DWL E;  2F4I A;  3PFY A;  2MSY A;  4A3M J;  3ZQI A;  4W97 A;  3K7A J;  4D9J A;  3L2W A;  3VYR B;  1H88 C;  4C2T A;  1ZR4 A;  2CFO A;  2MAB A;  2LC2 A;  2CS3 A;  2WB1 N;  1MBE A;  4BQN A;  1JJ6 C;  1Y1W J;  3BC8 A;  4M3B A;  4NUB A;  3BR1 A;  5M5Y J;  3LOC A;  1DQU A;  2DTZ A;  2CH0 A;  3PSF A;  5FKL A;  2LD5 A;  3JR9 A;  1K61 A;  2M4G A;  2LR8 A;  4JOM A;  3RCO A;  4QTR A;  3G1O A;  1VFC A;  4CA0 A;  3IV5 A;  3OYD A;  4IZZ A;  5JLX A;  3S17 J;  3S3N A;  2ZFU A;  4DBQ A;  2K9N A;  1H89 C;  3V42 A;  4UUS A;  3OL3 A;  3ZQQ A;  1RR7 A;  3A03 A;  2UUZ A;  1X19 A;  3CMM A;  1BW6 A;  2E2H J;  3QYF A;  2O9L A;  3S14 J;  4QIW N;  1Z3Y A;  3S15 J;  4AVZ A;  1T56 A;  3FHN A;  3A01 B;  3BTJ A;  2OC6 A;  1WJF A;  4FCY A;  3ZRG A;  1YX3 A;  4F3Q A;  2H1K A;  3OYG A;  1AU7 A;  4E6K G;  4BJ5 C;  1JTY A;  1WJ5 A;  3IUO A;  4C3I J;  1TWC J;  1U9O A;  3H0D A;  1TWG J;  1K6Y A;  3WHC A;  3IH2 A;  2EH3 A;  3JRH A;  4P1W A;  2R7S A;  1JKO C;  5DTD A;  1HDP A;  1BW5 A;  3OIP A;  4XOR A;  5FKN A;  4HEA 2;  2VL8 A;  5EG0 B;  5M3F J;  4CCL A;  3JRG A;  2I8D A;  2IGM A;  2HZD A;  3BG3 A;  2VAS A;  2VKE A;  3A02 A;  2JSP A;  2VKV A;  2CQX A;  4NDL A;  1K83 J;  1MNE A;  3FKJ A;  3S2D J;  1APL C;  4F52 A;  2CUZ A;  2EZL A;  2ECB A;  3DTI A;  2JA7 J;  3J7A Y;  4XN0 A;  1VZ0 A;  4A3G J;  2VJJ A;  2WV1 A;  2X1D A;  4LIT A;  5FKK A;  2R7R A;  2ME6 A;  3DCF A;  3RPU D;  1MBG A;  3LMM A;  4ZDL A;  2DN0 A;  1Z77 A;  4KT6 A;  5LFA A;  2LY9 A;  3QYE A;  5J1R A;  2LTP A;  4E7Z A;  4CCK A;  2WAQ A;  2BVL A;  1XG1 A;  2CV0 A;  2YU9 J;  2RQQ A;  3S3M A;  2NS7 A;  2HPI A;  3BR5 A;  3LSI A;  4A3I J;  4IEJ A;  3FKI J;  5HNF A;  2HOT A;  1T0F C;  2CRG A;  1U78 A;  1GT0 C;  1IDY A;  5M3M J;  1NG7 A;  2M0M A;  2Y31 A;  4IHY A;  3HGY A;  1WFX A;  4ZTJ A;  4Y33 A;  4XID A;  5J1U A;  5C3E J;  5E3O A;  1R6R A;  1XS9 A;  2CUE A;  3TP3 A;  1YRN A;  2DXI A;  2X6Y A;  3LL7 A;  2B63 J;  3UR3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...