3OOUA

The structure of a protein with unkown function from listeria innocua
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
105
structure length
105
Chain Sequence
b'SPIIQNVLSYITEHFSEGMSLKTLGNDFHINAVYLGQLFQKEMGEHFTDYLNRYRVNYAKEELLQTKDNLTIIAGKSGYTDMAYFYRQFKKHTGETPNRYRKIHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lin2118 protein
molecule tags Structural genomics, unknown function
source organism Listeria innocua
publication title The structure of a protein with unkown function from Listeria innocua
rcsb
total genus 38
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12833 HTH_18 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3oouA01
1.10.10.2730 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oouA02
2OF7A 4A3IJ 3RQIA 3BG9A 5GPAA 4B1RA 5F1JA 2EZIA 1HDDC 5E3NA 1I50J 3HOZJ 4ABZA 1NK2P 2JWTA 3FISA 5K7HA 1O4XA 1ZK8A 2W48A 3HBLA 2CQQA 4JP0A 3HM5A 3M3YJ 3CDLA 4BKXA 4W97A 2VPRA 4I76A 1ZR2A 2XGEA 2HOAA 1A5JA 3GTKJ 3MVPA 3LSPA 1XS9A 3GTLJ 1AKHB 1JKPC 1QPIA 2JJ7A 1IJWC 4D5CA 1X2MA 1VI0A 2CUFA 2CU7A 2EZKA 3LNQA 2WB1N 4M3FA 4JX4A 3TEDA 2VI6A 3SJMA 2NS7A 1MBJA 2RAEA 4CYCB 2R0QC 4NDLA 2X9DA 1FJLA 3TP3A 2O9LA 3UKGA 1IV6A 1P7JA 1NK3P 4C2MJ 2WV1A 4W1UA 2DA3A 1WPKA 1ETQA 5FKLA 2YUSA 1UHSA 1BA5A 1G2HA 2FX0A 2EBIA 3LSJA 2H1KA 4A3DJ 4IEJA 3I4NJ 1MBKA 3MKLA 1ZKGA 1WH7A 2FD5A 3HOXJ 1SANA 5C3EJ 1QVTA 4G12A 2HXOA 2Y9ZA 3RZOJ 4MIMA 2DA1A 1MSFC 3SDGA 4XRSG 2N8GA 3HOWJ 2DN0A 2GM4A 2ECBA 2M8GX 1HDPA 1I3QJ 4IHXA 4UUSB 1D5YA 2LR8A 1YRNB 2EQRA 1SFOJ 1RETA 3FK6A 4A69C 2YU9J 4A3MJ 4A3KJ 1F36A 3IH2A 2IEKA 2VKEA 5IYDJ 3K7AJ 3S14J 1X2NA 1U9NA 2QCOA 5F04A 4B3AA 2AHQA 2K9QA 2Y9YA 3ZQLA 3PO2J 4IHWA 2B63J 1P7IA 2ID3A 5EG0A 1B72B 2EZLA 3GTMJ 1ETVA 3JRAA 1OCPA 2GBYA 1UG2A 2L7ZA 1JUSA 2DMNA 5M5WJ 1GVDA 3OSGA 5F27A 2FJ1A 3ZOBA 3HOVJ 2R5ZA 1U9OA 3BQYA 2Y2ZA 3PO3J 2JA5J 2MSYA 5IOYA 2X6OA 2DMPA 4BY7J 1ITYA 5EDNA 5F08A 1HCRA 5EGOB 5F0FA 3QPLA 2E2HJ 1IG7A 2XGDA 4M3BA 3A02A 3O8HA 1ETWA 2JN6A 1Z77A 1ZGWA 1JTYA 4FISA 5GP9A 1Q1VA 2IAIA 5FKNA 4BBSJ 5EZGA 1RKWA 4DYRA 2I10A 1QVUA 1WH5A 3CQZJ 4A3BJ 1JUPA 1JGGA 4A3CJ 1EF4A 2R5YB 4QSHA 1W0TA 4FE4A 3GTOJ 1FTTA 3BQZA 4UUSA 5E3LA 1TC3C 5E3MA 2XPUA 1H88C 1DU6A 3M4OJ 3S1RJ 4M3GA 2L9RA 1ETOA 5F0CA 4A3FJ 2D5VA 1VFCA 4RDUA 1LFBA 1IC8A 2P81A 3PM1A 3BR1A 2XB0X 5IOZA 2LVSA 1UMQA 1AKHA 1U8BA 3BR2A 1HF0A 4A3JJ 1OJLA 4BXXJ 2H8RA 5K7ZA 4A3LJ 1NTCA 1K61A 2VUMJ 3BR5A 3DEWA 2DMUA 2JMWA 2LFBA 3HB9A 4QIWN 4BBRJ 2M34A 1IRZA 2Y30A 3BR6A 3ZQGA 4IHYA 5C4JJ 3GTGJ 5JLXA 4A3GJ 4EEFG 3VPRA 1AHDP 5J1YA 5IP9J 5DTDA 1PUFA 3GBGA 1WI3A 2LD5A 4FCYA 1MSEC 1ETYA 2LY9A 5M3FJ 3JR9A 2DMQA 1E3OC 3H0GJ 3JRDA 5IPAA 5F0HA 4C3HJ 5M5YJ 1A6IA 2MGQA 2ZB9A 2K40A 2L7FP 2HXIA 4XK4A 5BNGA 3HEFA 1ZTRA 5HODA 1B8IB 1W0UA 2M9HA 1R9TJ 2QF7A 5M3MJ 4M3DA 2R93J 3S1MJ 1JKRC 2KT0A 2R5ZB 1MBFA 4MO7A 2L7MP 5FLVA 2EH3A 4RBOA 1TWCJ 2ME6A 1BJZA 3E7LA 1MBGA 1APLC 3G1OA 5J1UA 4A93J 4AUXA 3JRFA 3O8GA 3L1PA 1IUFA 3BTJA 4MLOA 4BY1J 3I4MJ 4A3EJ 3GTJJ 1JT0A 1GV5A 5EEAA 2ELKA 2ID6A 4DYCA 1F43A 2XGCA 2AO9A 5FKOA 3JRBA 3LSGA 1MNMC 2GLOA 3BTCA 4AYBN 2ECCA 2R7ZJ 4LOCA 1K83J 2FQ4A 3G1LA 1YRNA 1XG1A 2XPWA 2WAQN 3ZQCA 3NAUA 3FK7A 1HLVA 2MW8A 3Q0VA 3BTIA 3F0CA 1I6HJ 1BW6A 3H3VK 2DA2A 2TCTA 2XB5A 3CCYA 4GFBA 5EZHA 2JK3A 1VNDA 3HOYJ 4D7MA 4JX5A 1ZQ3P 2XRLA 2NVXJ 5EG0B 2YS9A 5J3LA 2XPVA 3GTQJ 2HI3A 4HNVA 1BW5A 3TW6A 5EYRA 2LK2A 1GDTA 1IDZA 2PMZN 3HKZN 2MG4A 4J19A 1FIAA 1MBHA 3ZQHA 2O8KA 2Y0SN 4C3IJ 2JA6J 3A01B 2HYJA 5JLWA 3IH3A 4DW6A 3RZDJ 9ANTA 1RR7A 3BTLA 3JREA 2XSDC 4AC0A 4UUTA 1DU0A 2E2JJ 3Q3SA 2R5YA 5IP7J 3HOUJ 4MFEA 1MH3A 2L0KA 1IDYA 1FTZA 2TRTA 3FKIJ 2E1OA 1RPWA 2EZHA 2HDDA 1H89C 2NS8A 3ZQIA 3S1QJ 1JT6A 1Y1VJ 3LSRA 1VF9A 5IYBJ 3ZQFA 4XIDA 3JRHA 5C4XJ 1FEXA 4Y7NJ 4XRSA 3S2HJ 1GUUA 1MH4A 4C3JJ 2JA7J 3BG5A 2HQ5A 2VKVA 2CJJA 1T33A 1JKOC 1TWAJ 4V2FA 4B4CA 1JJ6C 3S16J 4FE7A 3OIOA 3G1MA 5K7FA 1U78A 1IGNA 3WHCA 1Y1WJ 2LLKA 2OPTA 3A03A 3DCFA 1TWHJ 1Z0XA 3C2BA 2K9NA 2LTPA 3RKQA 4S0HB 2COBA 1AU7A 3K2AA 5FKMA 5EF6A 3QPSA 2R92J 3BT9A 3Q0UA 1QRYA 4D7NA 1GT0C 4XICA 3D1NI 3MN2A 4JYKA 5EGOA 1RESA 4DZPA 3IV5A 1JUMA 1S7EA 5IP6A 2DA5A 2DMTA 5E3OA 2NOGA 3BR3A 4FTHA 4L5EA 1MBEA 1JKQC 4JX6A 1ENHA 1OFCX 1ORKA 1RKTA 1ETKA 5J1RA 5C44J 1LE8A 5FLMJ 4X1EA 1GV2A 2DTZA 3NARA 3CMYA 1POGA 5DS9A 1OCTC 4QTRA 3B6AA 1XC5A 2Y31A 4M6VA 2NVQJ 3HGYA 1ZR4A 4MFDA 2E2IJ 2G0EA 3QQAA 3GTPJ 4M3EA 2DA7A 3B6CA 2CQXA 1WGXA 3FIWA 3Q0WA 3S1NJ 3SFIA 2E19A 5FKKA 1T56A 3JRIA 2ME0A 3OOUA 2CUEA 3A01A 4V2GA 1B8IA 5GPCA 1WCMJ 1X58A 2O7OA 4Y52J 1JJ8C 3BR0A 4D5FA 1TWGJ 4X6AJ 3S15J 2HOSA 3S2DJ 2X48A 4CYCA 2CRGA 2LP0A 1CQTA 1BL0A 1HOMA 4IHVA 5M5XJ 3TP0A 4DYQA 2LKXA 2IBDA 2M0CA 2DA6A 2DJNA 3IH4A 4I6ZA 3LOCA 2K9SA 4XRMA 1PUFB 3HGGA 3JRCA 1B72A 2JA8J 4DZJA 1ETXA 2NVTJ 3JRGA 1TWFJ 2M2EA 3BG3A 2KDZA 5IYCJ 3TW7A 3OSFA 5FJ8J 1FIPA 2HOTA 3WHBA 2DA4A 3W6VA 3S17J 2NVYJ 1H8AC 1JTXA 1LE8B 3HDDA 1LFUP
chains in the Genus database with same CATH superfamily
2OF7A 1GXPA 3T1BA 2EZIA 1HDDC 2O6GE 4NB5A 4XL9A 2YPRA 4LG0A 2EA2A 3AFHA 4CO8A 1TQMA 3MKYB 1NK2P 1ODDA 2PI0A 3PIOF 1J7KA 1SC7A 3FISA 1ZK8A 2W48A 3ZP5A 2LKSA 4JP0A 2JA2A 1J75A 3CCLI 4Y15A 2ELHA 2AQEA 3DP7A 2VPRA 2FUG2 2XIGA 4HOBA 5B5EC 3ZMZA 2XF7A 5LRSA 2LF8A 3LSPA 4IOAF 1Y56A 4TV7A 1JKPC 1IJWC 2DPDA 2IA1A 3OYMA 4P55A 5GAEJ 1YOVB 1TNSA 3SJMA 2MD5A 3W6KB 1OCCH 5F1RA 1Y8QB 4UVAA 4CYCB 3UKGA 1KU7A 1SMTA 1P7JA 3FXOA 2E7WA 4BDZA 2WV1A 1UAAA 4A0YA 2M7BA 3VSKA 3QOEA 1WPKA 2FE3A 2ZMEB 4CCKA 2DFIA 3Q9SA 3T8TA 1UHSA 4RAGA 3K6GA 1R4MB 5IT3A 2WY7Q 2WAFA 3IRRA 1QBJA 2FX0A 3LSJA 2A05A 3F8FA 3S3OA 1T39A 1P4WA 1YYVA 1DDNA 2H1KA 2QUFA 2ISYA 1OYIA 3GO5A 3I4NJ 2KFDA 3AG2H 3OYEA 1VQPI 1FBQA 1ZKGA 4QWQA 4C2UA 3HOXJ 5E79C 1UG0A 3TOBA 4E70A 3RPUA 4HF2A 2OZ6A 1MKMA 2E1MC 3KP4A 2Y9ZA 3RZOJ 4EV0A 3SDGA 2QBYB 4GCVA 4XRSG 4ENKA 2N8GA 5BS6A 1IRFA 2R4GA 2Q8KA 1W7PA 3QAHA 2D2WA 2DN0A 2G9WA 1I3QJ 4I7HA 4Y4RA 2R7DA 1R1VA 4I99C 4KMUX 4LJZF 1YRNB 2EB7A 3I59B 1SFOJ 5GADJ 3RPQA 4A69C 2V1XA 4A3MJ 1SVLA 4A3KJ 2CWEA 1F36A 1FMWA 5D5WB 3RSNA 2EPFA 3SEQA 3FMSA 2AHQA 2Y9YA 1E17A 3T5XA 4PCQA 1ETVA 3PL8A 5J6XA 3H9JA 5HS8A 1UG2A 2MC3A 2ESNA 2K9LA 5HS9A 1Z6RA 4ZYHA 5BMZA 2FJ1A 3ZOBA 1MMGA 1U9OA 2GXAA 1FT9A 4EMSA 6PAXA 1YLFA 3O3KA 4L9NA 3GVAA 2DMPA 3NEUA 4BY7J 3MMYB 4HYEA 3DKWA 3RKYA 1P4XA 1KYZA 3HOTA 4B43A 5EGOB 5F0FA 5H6RA 3MKZA 4M3BA 2R7FA 4MTEA 4PFPA 4BDYA 5JVTA 3BY6A 4LFUA 2VJIA 1ZGWA 3IC7A 2LKPA 4FISA 4CA0A 3QU3A 3BG7A 2GIVA 1Y0UA 1IAWA 5E8GA 1RI7A 4B09A 4PK4A 4BBSJ 3WU2C 1WSUA 1RKWA 2WB1A 4ZJZA 2DFEA 2I10A 2VQLA 5D6EA 1WH5A 3CQZJ 4FASD 5BQTA 3OIPA 2O5RA 3V7RA 3Q5FA 1FYKA 1EF4A 2HGCA 2ZJRF 3HJEA 4UUSA 1ONVA 1TC3C 2O3FA 4RMNA 1H88C 2XPUA 4KIGA 4HAMA 1BR2A 3M4OJ 1TLHB 4NHJA 1VFCA 3H5RA 1IC8A 4G94A 1X4OA 2ZKZA 2VJ4A 2B9SA 2KIFA 1SFXA 4O3MA 2EA4A 1AKHA 2Q2EA 2CQNA 1YFHA 1B1BA 3BR2A 2JPCA 3LA7A 4G8XA 5HLTA 3EUHA 2VUMJ 4ZYGA 4D0PA 4GYGA 2XUBA 2JMWA 5LD2C 2VXZA 3FKJA 1ZELA 2LC2A 1I39A 3DPLC 2K3PA 4PSXA 5C4JJ 3HSRA 5JLXA 3L2VA 3WU0A 4EEFG 2CV1A 3EETA 5BOXA 3UNGC 4FHTA 3T0YA 3VPRA 2HVQA 5L3GA 3BP8A 1W4MA 2KRCA 4KA4A 1WI3A 2KMUA 3GUDA 3P5JA 4RM2A 3ZGKA 1LKXA 4XNFA 1D0XA 1WWXA 3B02A 5HNHA 2LY9A 5M3FJ 4AWXB 2DMQA 4RGRA 2DJIA 5L3BA 4N0BA 2IW5A 3S2WA 2P5LC 1OYWA 4N4NB 3IWZA 3H35A 2K40A 2LOOA 4GXOA 2PN6A 2FNPA 4XK4A 4AIDA 4BYYA 5D5UB 4GDFA 2LH9A 4BU2A 3RDIA 5HODA 1K4SA 1JHFA 2M9HA 3WTSC 5LGTA 3S93A 1D3YA 1U5TA 2VE9A 4KIFA 5IY5H 2ZSIB 5GTHC 1JKRC 3S1MJ 2R5ZB 3H5AA 2IT0A 3SDBA 2NVUB 1BC8C 2NYXA 3BWGA 2ME6A 2JVHA 1MBGA 2RREA 3E7LA 1APLC 1FBSA 4A93J 4AUXA 3JRFA 3PFYA 2WAEA 3BTJA 3L1PA 4MLOA 4BY1J 1MMSA 2MYSA 1FOYA 1BIBA 3GTJJ 1S8NA 2D1VA 2XAFA 4EJTA 5EEAA 4LB6B 2F4OB 1SMYF 1IN5A 2HU9A 1WJDA 2HNHA 3LSGA 4G9YA 1MNMC 2DOAA 5B66C 2ECCA 2R7ZJ 3P7NA 4XLFA 4LOCA 1ZARA 4ASNA 2FQ4A 2AXLA 3CJQB 1XG1A 5DYMA 1B59A 3COAC 1WRJA 2NS0A 3M9AA 1STZA 2QQAA 4XQFA 5L3CA 3WTXC 1LDJA 1ZLJA 2TCTA 4I09A 3H0DA 1IXRC 1RR8C 1VNDA 2JSCA 1Y39A 3HOYJ 3I9V2 1VQ9I 4RB1A 1Z21A 4YG2F 4FT8A 3KLNA 3LFUA 4HNVA 2LREA 3FM5A 5E8IA 3RQ4A 3HKZN 3DQVC 3IAM2 2GZWA 3K1PA 2NOJB 2OD5A 2VQGA 4LD5A 3BPVA 1SVOA 2ICWG 2QA4I 2HYJA 3SXYA 5JLWA 4DW6A 3ZXSA 2QBYA 9ANTA 1HBXG 3JREA 2L9SA 2XSDC 3GLXA 3ASOH 2X6WA 4C30A 1A6QA 4M6YA 1DU0A 2E2JJ 2BXYA 3Q3SA 5GAHJ 1NG6A 2DOEA 3F3XA 5IP7J 3H36A 2D1HA 3G3ZA 5JHUA 2DU9A 1K6OA 2ESHA 4DJAA 1R7JA 1QZEA 3E1SA 2EZHA 2HDDA 1ZRCA 4AIHA 4BXUA 2M30A 2DT7B 4U7BA 4CDGA 1Y1VJ 3E97A 3LSRA 1VF9A 5IYBJ 3LSHA 2DK5A 1FEXA 4BJ6C 2ELJA 2JA7J 3BG5A 2P7CB 2CJJA 3E3VA 4P5OA 3D5LA 5F6FA 2XF6A 3I5UA 1FOKA 2O0YA 1JKOC 3CDIA 4UVBA 5E1WA 4V2FA 4B4CA 3EUHC 1JJ6C 1FNNA 2QQ8A 1UHWA 4F93B 1OYYA 1Y1WJ 1TWHJ 2UXXA 4XKVA 5FB2A 2JUCA 3BZ6A 5BPDA 1E3PA 3BC8A 1KZHA 4EQQA 3U21A 4UB6C 1BI0A 4KDPA 4PGHA 4JQFA 1LEAA 3C2HA 4M9XA 2FOKA 4A6EA 2O8XA 3M8JA 4AVZA 3MN2A 1TW3A 5EGOA 3FXJA 2GOMA 3IV5A 5TISC 4CCOA 3L2QA 4LK1F 2ZMEC 1S7EA 4P9UA 2FMLA 2DMTA 3M8EA 1E0EA 4E6KG 1BI3A 1MBEA 4EATA 4G7OF 1ENHA 1OFCX 1RKTA 1T98A 4BE0A 1P9QC 4DIQA 5FLMJ 4X1EA 3CO6C 1ZREA 2DTZA 1VQKI 4LITA 1RC9A 1MJAA 4Q47A 1W36D 3HUGA 1F5TA 2NVQJ 3LAJA 1ZR4A 4CXFA 4MFDA 2E2IJ 2ZNYA 4EM0B 2QVOA 1K7AA 1O3TA 3HRUA 4BEHB 3KP2A 1U3EM 2VQHA 2DQLA 4M3EA 1SD6A 1ZAOA 2E1MB 1YJNI 2KJCA 3KX2A 1O3SA 2CQXA 4F91B 3L00A 4IQJA 3SFIA 2E19A 2Z16A 2ME0A 1MMNA 5JR3A 3R0AA 3OS0A 2IA2A 1B8IA 4L5IA 5FRNA 1IN6A 1WCMJ 1JJ8C 2M3AA 3FMQA 1TWGJ 2PJPA 1SVMA 3J7YJ 2E1NA 2ZCWA 3OY9A 1IV8A 2V7FA 2XAGA 3FMRA 4CYCA 2F2EA 3P9IA 2LP0A 1HOMA 3OS1A 3TMOA 1J09A 3TP0A 5DUKA 3U1DA 4L9JA 5J8CA 3S8PA 1D1AA 1TT0A 2IBDA 4KT5C 3I0TA 4M74A 4HSTA 4AD9A 4I6ZA 3BROA 3LOCA 4XRMA 3N97A 1B72A 3CCVI 2KIMA 3I53A 3M07A 3FXQA 3JRGA 3KETA 2VN2A 1WJCA 3OSFA 1FIPA 2ZXJA 3WHBA 3I58A 2Z33A 2LY1A 4Q48A 2GA2A 5D8LB 2L3DA 3F8CA 3S17J 4RB0A 2FEZA 4ZTJA 3CCUI 1JTXA 1N25A 4YIIA 5HDKA 1LFUP 4KICA 3HDDA 2OQRA 3U2RA 2VJJA 2FBHA 1QPMA 1YTYA 2OZUA 1F4KA 3RQIA 5GPAA 1XCBA 2BZTA 1V4RA 3OIQA 1B4AA 1UB9A 4RGUA 4D1QA 3L7WA 4ABZA 1FZPB 2V1NA 3FXMA 2CW0F 3ABTA 3DKXA 3K2ZA 4E7HA 1O4XA 1OKRA 3HBLA 1TZLA 2CQQA 2CSOA 3K69A 1EH6A 2B0LA 5A2QZ 1EV7A 2JPBA 3CDLA 3KEYA 1XGNA 5DCMA 5B3SH 1P92A 1FY7A 4IL6C 1A5JA 3GTKJ 3MVPA 4OMZA 1XS9A 3GTLJ 4HRIA 2Q2EB 1X2MA 3CCJI 2EZKA 4NNJA 2WB1N 3LNQA 3TEDA 3J7AO 3V8LA 4LIUA 2IVMA 3V7SA 2R0QC 4NDLA 4YIRX 4LLGF 1IV6A 4HZFA 3FHNA 2R7UA 4N9HA 3R60A 4W1UA 2V1DA 1ETQA 2K85A 4UNOA 1D8KA 2H8WA 1CF7A 4KYWA 3D5RC 1VQ4I 5KVRA 3K4KA 3TO6A 2EFQA 4MEYF 2XHKA 2VOPA 5A2QK 4IEJA 3RTRA 2RQPA 2K86A 3T8RA 1BOBA 1WH7A 4PJLA 1IN7A 1QU3A 1D0ZA 4XN3A 1SANA 5C3EJ 4I2OA 3A2KA 1O3RA 5CQEA 3MWMA 2ZJPF 3EYYA 4MIMA 2DA1A 4OOIA 4I0AA 2P6TA 3TL4X 1YJWI 4I02A 3F21A 1BN5A 1D1BA 1BC7C 4IHXA 3K4NA 2HQAA 3L9FA 4HBLA 2EQRA 3ZMDA 4WX9A 2VT2A 4KN7X 3IRQA 4ZDPA 1RETA 4MGRA 3N4MA 2BV6A 4CGZA 1VQ8I 3IH2A 2VKEA 4IPAA 1ZG3A 4DBRA 5IYDJ 4OU0A 3BJOA 3S14J 1X2NA 1U9NA 3GW2A 4B3AA 3TO7A 3PO2J 2DPUA 4IHWA 3GTMJ 1B72B 1E3HA 2H1LA 3ML6A 3FF5A 4XSXF 3R61A 3KYDB 3WG9A 4BJ5C 1OCPA 3H9GA 1JUSA 1X3ZB 4CCMA 1TBXA 3O2PE 3CP8A 5F27A 1TNTA 1PYVA 4BE2A 4CH7A 4B3XA 3SYTA 1ZGJA 2Y2ZA 3EQLF 3FZVA 2JA5J 3HHHA 3TDZC 5CJ9A 2IS1A 4LGWA 4XLPF 4A5MA 4ZH4F 1PVEA 2VC1A 1ITYA 3WTTC 5EDNA 1XDSA 1ZG5A 4XOPA 1MJBA 2EFWA 4GRIA 2E2HJ 1YW7A 1X1DA 2UXNA 3ABLH 5DUIA 3OYBA 1RUOA 3CESA 5E17F 3A02A 1G3YA 3I64A 4BS9A 3W6JB 1NH3A 3QODA 2HTSA 3S3NA 2PMZA 3Q9VA 2HWVA 3CC4I 5CLSA 5GP9A 2DI3A 5FKNA 3HL2A 1NHAA 1E2XA 2FBKA 3J80Z 4A3BJ 4L9TA 4YFKF 1JGGA 2Q1ZB 5KHDA 4QSHA 1W0TA 4FE4A 3GTOJ 2ZMEA 3BQZA 5E3LA 1XGMA 3ZMUA 4UUVA 2FA5A 1DU6A 1YIJI 4IVNA 2RVCA 4HDUA 3S1RJ 2UUZA 4MEXF 4M3GA 1KQ8A 2JRTA 4MNUA 4Z2YA 2Z2SB 4A3FJ 2GIZA 3CP2A 1U6GA 3HKZA 1FSHA 4EGYA 1LFBA 3AG1H 5JI6A 4HLYA 4E7LA 1D8JA 5IOZA 2GA1A 4E7ZA 2R7SA 1GXQA 3WE3A 4XLAA 2EFPA 3BG6A 2MH9A 1HF0A 4A3JJ 2NRAC 1O7LA 4BXXJ 1Z6TA 2H8RA 1G3WA 3K1MA 3F22A 1K61A 1JXSA 4ZDLA 2QLZA 5J8FA 5J4VA 4YIFA 4CCNA 1QQIA 2VBYA 4I98B 1UZCA 4XN0A 3BR6A 2W25A 2HQNA 1VQMI 1V55H 4IHYA 2BW3A 3JTGA 2NAZA 4V19K 3OR1C 3AG4H 4UV8A 1Q1HA 5IP9J 5DTDA 1PUFA 1LUJB 1U5TC 2LBFA 5ILUA 1R4NB 4FCYA 1F1ZA 1ETYA 1A31A 2IRFG 3NRVA 3MEXA 2HVRA 4L0YB 2MC4A 1WFXA 2VC0A 1XTAA 1R00A 3VYSB 3DTKA 5J4YA 2F48A 1J5YA 3SQNA 5F0HA 3JTHA 1K79A 4C3HJ 1A6IA 3IP4B 3PSFA 2IGKA 2R7XA 2WTEA 3ECHA 1X3WB 2DK8A 1B9MA 1ZTRA 3DEUA 1R9TJ 2KP6A 3HRSA 3ZQQA 4HSRA 2EJRA 1TT5B 1MBFA 4PJJA 1BM9A 1B9NA 1K78A 2L4MA 3TGNA 4HPQA 2DYRH 3K70C 4RBOA 5HNFA 3OYNA 1EH8A 2X6YA 1WJEA 3BLYA 1XSVA 5E1ZB 3G1OA 4CCLA 4QPOA 3E6CC 1VZ0A 1IUFA 1I27A 2ZXWH 3HG9A 3K4MA 4BE1A 4A3EJ 3I4MJ 1WQ2A 5ICEA 5K5OA 2BVMA 2ID6A 1YX3A 2XGCA 1YQAA 4LIVA 2DCEA 2GLOA 3FBIB 2X0LA 1QHHD 4M71A 4OIQF 1IXSB 3M1EA 1K83J 2KISA 3HPGA 3KP3A 5KNLA 1HKTA 2XPWA 2IS4A 1VQNI 3FK7A 2YX4A 4Q4ZF 5BPIA 4HG2A 3F0CA 4BEHA 1CGPA 2DA2A 2M5WA 5L3FA 2XF5A 3RKXA 2JK3A 2JQ7A 1EH7A 2JT1A 2NVXJ 4ENJA 2YS9A 2IS6A 3ZCOA 2XPVA 4BH9A 2XAHA 4U87A 3HHGA 2FXAA 4U7DA 1MNEA 2BBYA 1GDTA 4KNYA 1YI2I 4J19A 5FD5A 1FIAA 3WTZA 3J81Z 3MAJA 4BNCA 1MBHA 1R5ID 3VYUB 3ZQHA 3GZ6A 1XSDA 3DPTA 2JA6J 4F52A 5ERIA 4ANJA 1SAXA 2IGMA 3DV8A 3FXUA 4UUTA 2M87A 2R5YA 2XAUA 3HOUJ 1U5TB 1BR1A 2QKLB 3MCZA 3D5SC 1KA8A 4LG0B 1AWCA 2EIJH 3HRTA 1IDYA 4UHTA 1USTA 3SZPA 1RPWA 2V6EA 3PNVA 3REOA 2NS8A 1A04A 2JZYA 1Z3YA 3KP6A 2VKDA 4XIDA 3CO7C 1W5TA 5C4XJ 4BAYA 1QZZA 4XLEA 3W2VA 4Y7NJ 3S2HJ 2HOEA 1GUUA 4BHPA 3KP5A 2VKVA 3K10A 2L9VA 2K27A 2LF7A 5TJJA 1TW2A 3CMMA 1TWAJ 3SHFA 1T95A 1FP1D 3H5NA 1R22A 3OIOA 1IGNA 2QKMB 3VFZA 2OQGA 3DCFA 2GXGA 2KKOA 3A03A 5EEHA 3ZN0A 1K78B 5H6QA 3C2BA 4KFCA 3QWLA 4E7JA 2P5KA 1FOXA 2HKXA 3I54A 5GTIC 5EF6A 1JHHA 1WKMA 2G7UA 1W7PB 1LJ9A 3BZKA 1FYMA 5HVQC 4HX4A 5JVGF 2ZJQF 1TP4A 4LMYA 4XICA 3D1NI 1DPRA 3HPHA 1V54H 1JUMA 2K7LA 1RRJA 2HKOA 1R5HA 4XSZF 5IP6A 2NOGA 4FTHA 1ZH5A 4L5EA 5FFXA 4O5VA 2X1EA 4S05A 3WTYC 3K9TA 5HLHA 2VXDA 5J1RA 3OL3A 5C44J 4I01A 3CUOA 1GV2A 4AIKA 3WGGA 2P7VB 3OYJA 4OIPF 4EVIA 2IXSA 2PEXA 4QTRA 1XMKA 3B6AA 1XC5A 4E7SA 3F9KA 2X51A 1KU3A 5L3EA 2V79A 4M6VA 1YX5A 3ZQ7A 3DBLB 2GWRA 3HGYA 5LEKA 2HEOA 4IHSA 3GTPJ 2LRDA 2L7KA 4KMFA 3M7GA 1YG2A 3DU5A 2DA7A 3TKYA 1I3AA 4A2UA 3B6CA 3ERED 2FSWA 3FIWA 1SD4A 3CCEI 3Q0WA 4DQ2A 5H2FC 1BJAA 1TQIA 1FYLA 1UHMA 3OV8A 1T56A 5HOOA 4ZTFA 2STWA 3BCAA 3VB2A 3OYHA 2R7WA 2V1UA 1I5ZA 4JK1X 3H92A 1REPC 2PFBA 1ZYRF 2BHZA 1Z9CA 1YO5C 2DO7A 4Y17A 1Y6IA 4C2TA 3TBIA 2KRHA 4H4KC 3V8JA 4QPQA 3DXJF 2HTJA 3VYTB 3WU1B 1MZBA 2OTJI 3PIPF 3S2DJ 2X48A 3R4KA 2H6CA 1R71A 1OLTA 1Z3XA 2AXTC 1CQTA 1BL0A 3OYGA 4IHVA 5M5XJ 2EIMH 4DYQA 2XC7A 2COMA 4IRHA 2DA6A 1USSA 5LHGA 3FXLA 2M7AA 3IH4A 2F5VA 2DYSH 2W57A 2HPIA 2K9SA 3HGGA 3JRCA 1Z67A 1T38A 2JA8J 3OYLA 3I55I 2CMPA 4DZJA 5TGTA 2XAQA 2M2EA 3BG3A 4DGWB 2OCCH 3CJTB 5JFRA 2STTA 4XORA 3K4LA 2HOTA 2CG4A 2QYOA 4PJMA 2CUZA 2HZDA 3MFKA 3W6VA 4JBAA 2PMHA 4C9YA 1OCOH 1R5GA 3GFMA 1TTYA 1PUEE 3BG9A 4B1RA 5F1JA 2BHYA 5E3NA 1YE9A 2A3SA 1I50J 4WXDA 2QZ8A 4LLLA 2JWTA 4CYDA 4XR6A 2MLKA 3EDPA 4NQWB 1MDMA 5E1XA 3H3UA 3F8BA 1FP2A 1WI9A 5ICCA 2XGXA 4OAZA 4W97A 3EPZA 4I76A 2I8DA 2E7XA 2XGEA 2HOAA 2L54A 1W5CC 3AG3H 3LWFA 4CSWA 3FM3A 1AKHB 4L18B 1QPIA 2IGNA 3QP5A 2CW8A 4D5CA 2E5ZA 1Z7LA 1VI0A 2CUFA 2CU7A 3IUOA 4M3FA 3OL4A 4JX4A 4XKCA 4HLXA 1KQ9A 3RYPA 3QYBA 1QHGA 3CZ6A 2AS5F 1WJ5A 3IWFA 1MBJA 2RAEA 3MQ0A 2O9LA 2X9DA 3RIRA 3TP3A 1IRXA 2IP2A 3PUFA 3ONQA 2ZFUA 3WG7H 3KIOA 1IF1A 4ZYAA 1NK3P 2UZKA 2JRMA 1LPQA 2HYFA 5FKLA 5TRDA 5KK1A 1BA5A 3LFKA 2VQCA 5FRMA 1G2HA 3DLLF 5LLQA 2F5CA 2LG4A 2BY1A 4NC6A 4A3DJ 2MBFA 1MBKA 3DBHB 3KLOA 2WBMA 2CO5A 2RV8A 4BHCA 2P0WA 3PFIA 4UVCA 3VOEA 3KYCB 1SD5A 4NBQA 4A12A 1ZLKA 2EILH 2W82A 1QVTA 4Z6YA 5D5XB 1FSEA 1MSFC 4G7ZF 4HV6A 2ZSHB 2GM4A 2M8GX 2Z99A 1M1EB 1HDPA 3KZYA 1D5YA 3RKWA 3SZGA 2XASA 1Z1DA 4YEJA 3JAMK 1R49A 1FPQA 3ZPLA 3HRMA 4UB8C 2OV7A 4P1WA 3RJPA 4FETA 3RYRA 4HQMA 3IL2A 2YU9J 2IEKA 2EINH 2A6TA 3UR3C 1L3LA 3K7AJ 1VQ6I 2QCOA 5F04A 2YX7A 1SFKA 3QU6A 2P4WA 1QA6A 1P7IA 2ID3A 4IOCF 1AOYA 2EZLA 2KZGA 3EYIA 3CCMI 3CJRB 3JSPA 4BUPA 1ACIA 2M45A 4AU7A 4BHBA 2X85A 3BCBA 3KZZA 3CDHA 2DXIA 2L7ZA 5M5WJ 2DMNA 2K02A 2GXBA 1NG7A 2HS5A 5K5QA 4EJVA 3LA2A 3HOVJ 4BQOA 4DNCA 3HOSA 2R7QA 2MSYA 3FHZA 5IOYA 2X6OA 2XKPA 4CZZA 2MH2A 3E6DA 3A1YA 3E0JB 1QGPA 4BXFA 4PDKA 3GWZA 3OR2C 1MDMB 1IG7A 1RUNA 2XGDA 5FGMA 3E5UA 2QSHX 3O8HA 1Z77A 5LGUA 1O57A 3WGHA 1SFUA 4MQVA 1MD0A 1Q1VA 3DLAA 3LMMA 2IAIA 4BGDA 2A5WA 4KIBA 2NXNB 5EZGA 5FLXK 1IN4A 3FX3A 3CF5F 2D45A 2ADUA 4DYRA 2L2OA 1QVUA 4ZYEA 3HSEA 5LEJA 2MABA 4GO1A 3ZR8X 4IRIA 1FC3A 4MQ9F 1BI2A 1DP7P 2XV4S 3DFGA 5E3MA 3U1KA 3K1NA 3F8NA 3GZ5A 2A68F 5D6FA 4G6QA 3R0JA 2ZC2A 1OCZH 1ETOA 1P4AA 5JHFA 3L2WA 1OISA 2VPLA 1J9IA 4RDUA 1OPCA 4Y3OA 3ASNH 3I4PA 4RS8A 2WV0A 3VYRB 1ZG1A 2LVSA 2H27A 1BR4A 1OQYA 3C1DA 2EFNA 1YW9A 5AONA 2YR2A 1EJ9A 4E7IA 2EV5A 3NWSA 2VJ5A 2YSRA 4LK0F 5LGNA 1ZRFA 4QIWN 3RI4A 2M34A 1IN8A 3W2AA 4YFNF 1IRZA 2Y30A 3QP6A 2CFXA 1YJ9I 3BJ6A 1HW1A 2E36A 4RA2A 4HNTA 4A3GJ 3HTUA 1AHDP 1X19A 4ON0A 4AYBA 1W5SA 2LD5A 1MSEC 2O03A 5DCFA 2DFHA 5B1BH 3J7ZI 2EK5A 2FOWA 2IGOA 3M8FA 4KISA 1PP7U 3A0BC 3JRDA 3PSIA 3S32A 5D8KB 2H94A 1GLNA 3FDYA 2MGQA 4HA8A 3OMYA 2ZB9A 4RB2C 1P2FA 2HXIA 5J47A 3LSIA 4F3QA 2DDAA 4E7KA 1B8IB 1W0UA 4HX8A 2E71A 3F6OA 2FRHA 3JW4A 3ELKA 4M3DA 2P8TA 2R93J 3F8MA 2KT0A 4MO7A 1DP3A 2L7MP 2Y69H 1X4PA 4M9SA 3IKVA 2WADA 2FU4A 4ETSA 4WCGA 1HC8A 4IJAA 5E20A 2V4JC 1JT0A 3V7CA 1GV5A 3E5XA 1XGOA 2ELKA 4D9JA 4O6JA 2AO9A 5DV5A 3JRBA 2OU2A 4RLQA 2UWMA 4QLCU 3KE2A 3KEOA 2Z1DA 4CUGA 5LBQA 1FMVA 4ENNA 4IRGA 3W3CA 4DOZA 3NAUA 1F9NA 2MW8A 3Q0VA 3BTIA 2DTRA 5CVVA 2J5PA 3KPHA 1I6HJ 1BW6A 2X4HA 2M4KA 2HR3A 4BQQA 4GFBA 3RPUD 5EZHA 2V9KA 1TL8A 3KZIC 4HEA2 4D7MA 4B48A 5HLGA 5EG0B 3ABMH 1T0FC 5HDGA 2HI3A 4L0ZB 1BW5A 5D4SA 1S29A 3TW6A 4HNUA 4R8HA 3C3WA 5EYRA 1WVRA 3CCRI 2PMZN 3KP7A 3K4BA 1IDZA 3HXLA 1RNLA 1S3JA 1V3FA 3D0SA 2KJBA 5CVRA 5DM7F 3I56I 2F4MB 3TQNA 3K0LA 3B73A 3RZDJ 3IH3A 5KAFC 4U0VA 1JE8A 1RR7A 2VB6A 5AIPA 2RDPA 3BTLA 1UCRA 2Y75A 4RGSA 2VONA 1OR7A 3WTUC 3KCCA 4XLNF 2FNAA 4LB5A 2QM3A 1DQUA 3IHUA 1RIOH 2FQ3A 5AIQA 4R1HA 3QPHA 3J81K 2L0KA 1J2XA 4PJ0C 4EJUA 2VLAA 3GLLA 5ILSA 3CUQA 1FTZA 2DQRA 3JCUC 3V8KA 1ZRDA 2E1OA 1XDUA 3JAMZ 1ZHFA 3ZQIA 2A07F 3S1QJ 2ZBKA 3OYKA 3ERMA 1LDDA 3GEZA 2BY2A 4E4HA 3L09A 2DDBA 3ZQFA 4NUBA 3LSMA 1HKSA 3TO9A 1MH4A 4C3JJ 5DM6F 3DBRB 4OWRB 2HQ5A 1LDKB 1IXCA 4IHTA 1T33A 3S16J 4ZC3A 2M4GA 3G1MA 3OYIA 1U78A 3W2WA 2QQ9A 4J01A 1J59A 2X1CA 4OMYA 3CCQI 2PJRA 2PBIA 5EJCA 1FBUA 2LMDA 3LSTA 3RKQA 2DODA 1YITI 3ULQB 4HX7A 2I5UA 4PGGA 2CGPA 2LSOA 1CF7B 4UXNA 5K5RA 1QZYA 5HLIA 3QPSA 3J80K 1SEUA 2R92J 4EGZA 3CF2A 1K4TA 1MIJA 4CHUA 3G6EI 1PDNC 3KEQA 4RLFA 1QRYA 1JI8A 2L5QA 3ISPA 1GT0C 3FXRA 2RQQA 4JOMA 1X3UA 1HW2A 1RESA 2KHMA 4DZPA 3WTWC 2QEXI 5FO5A 2CQ7A 1HW5A 2F6CA 1YW8A 1Y8RB 4P9FA 4IXAA 2CW7A 2DA5A 4A0XA 1JKQC 2CYYA 4LG3A 3OS2A 1YIOA 2KRFA 2KL4A 1ON1A 2K9MA 3DTIA 3BPXA 2OCEA 1TQPA 2R7RA 1WJBA 1X1BA 2VBZA 5GAGJ 3NARA 3CMYA 5DS9A 1H0MA 2L4AA 1OCTC 1IZ1A 2Y31A 2V6CA 2IA0A 1G3TA 2G0EA 3HC7A 2VASA 3KFWX 2QQBA 3U9GA 3SEZA 2HQRA 3CLOA 3L2RA 1WGXA 1UELB 1U8RA 3S1NJ 3FXKA 4I0BA 2XKOA 5FKKA 2R3SA 3JRIA 4X0GA 1XMXA 2R7OA 2QWWA 3ECOA 1BI1A 1X58A 2BY3A 2O7OA 2YU3A 4GGGA 4II3A 3HSFA 4D5FA 1OMIA 4X6AJ 1SD7A 3WE2A 3I71A 1VQ5I 4ESFA 2E5NA 2HOSA 1OCRH 5DDGA 3ZMVA 2NNNA 3N05A 3KYLA 2O61A 4EM1A 1J0RA 2E34A 2BGCA 3ABUA 3E6BA 1N78A 2LKXA 4M9ZA 2DW4A 2WC2A 2M0CA 4B44A 4CICA 4XLCA 1XGSA 3LL7A 1MGTA 1XPXA 1IUYA 1PUFB 1D0YA 3VODA 2M0MA 2ZO4A 1ETXA 4U0YA 1TWFJ 2KDZA 3AL0C 1ERDA 3VSLA 1EKEA 2A6EF 2R7TA 2DA4A 2DOFA 1R23A 1LE8B 2QGUA 2W4SA 4CCJA 2Z9OA 3DU6A 4IF4A 4UY8I 4HF0A 4A3IJ 2XDVA 4J00A 2LDUA 2RN7A 5E18F 4WF2A 3HOZJ 2RGVA 2VODA 2OAZA 3CUQB 3ZMTA 1LVKA 5K7HA 5FLXZ 3PJRA 1MMAA 3HM5A 1W36C 3M3YJ 4BKXA 1ZR2A 2MLGA 2RC4A 4AVPA 4RAYA 4N4OB 2FMYA 2JJ7A 1X1CA 3CMAI 2OC6A 1R1UA 1LNWA 4DBQA 2GQQA 2W85A 4A0ZA 2ZXIA 2BY0A 2VI6A 4BJTA 2EV6A 3I59A 2NS7A 2FBIA 3HZJA 3PNTA 1MMDA 1FX7A 3P9CA 1FJLA 1FLIA 3P9KA 3DF8A 3BOQA 4C2MJ 4XOTA 1SAUA 2DA3A 2YUSA 2CUJA 1L0OC 1VQLI 1KU2A 2PMUA 2R7VA 1R6RA 1C0WA 2W24A 4P96A 4YELA 2EBIA 1FWZA 2EIKH 2CV0A 2QSGX 4GYIA 1S5LC 4ZZLA 3FWEA 1AA7A 3QYFA 2KZVA 4AIJA 2M1BA 3QYEA 4G6TB 1T6SA 3MKLA 2FD5A 1Y0NA 4G12A 3MZ8A 4RGXA 2HXOA 4OINF 2LYCA 4BACA 1H9GA 2ZFWA 3ROUA 3OYAA 3HOWJ 3K4JA 4RAFA 3EUAA 2ECBA 1T0FA 1IW7F 1K6YA 4UUSB 3PQKA 2K4JA 4WK8F 4EM2A 2LR8A 1N77A 2LBFB 1JGSA 4L5JA 4PFOA 2KIQA 3DEEA 3FK6A 1Z05A 2MA3A 3E6MA 3AAFA 4F55A 1S9HA 2L01A 1S72I 1O3QA 1DPUA 4BL0B 2BE5F 2E35A 2VE8A 2HVSA 2K9QA 3OYFA 1KU9A 3ZQLA 2B63J 1S7AA 3LQRA 5EG0A 2J5OA 2Z3YA 3JRAA 4WWCA 2NNYA 4AM3A 3ESWB 3G4SI 2GBYA 4A5NA 4PUSA 1GVDA 2JSPA 3OSGA 1XX5A 1GVJA 4XMYA 1SFEA 1T8IA 2HZTA 2K4BA 2R5ZA 1R1TA 3WTVC 1WJFA 3BQYA 4XONA 3JSOA 3PO3J 1HXDA 4R79A 3K70D 1G8XA 1KONA 1UJ8A 3CC2I 2G7HA 1DGWY 1YS6A 4XRFA 5F08A 1V5EA 4KT6A 4H0EA 2L9NA 1HCRA 2F5FA 2CQKA 3QPLA 4N9IA 3GFIA 4M72A 2OJED 2DFFA 2XVCA 3PNYA 3QPTA 1ETWA 2B7EA 2JN6A 2HFHA 1ZN2A 1G6NA 1JTYA 2QSFX 5CVJA 1V5GA 1WHUA 1B6AA 3F23A 4B8XA 2MFZA 5DEQA 1JUPA 3V4GA 1X1AA 4G7HF 5EEGA 2R5YB 4A3CJ 1GHCA 1FTTA 1G59A 2F5EA 4FQGA 3A4CA 2ETHA 3SFZA 2PG4A 1VQOI 3C7JA 1FOWA 2L9RA 5IT9K 2V9VA 5F0CA 5KCMA 2D5VA 3GXOA 2VKHA 2W84A 3LSKA 3LA3A 3IKTA 2P81A 4ZYDA 3PUBA 3PM1A 3BR1A 5ILVA 2XB0X 2X6XA 4IO9F 1XN7A 1UMQA 2HPMA 1U8BA 4L9VA 2PX9A 1OJLA 4ESBA 3GFLA 1R36A 2W1OA 4Q5SF 2QENA 3K4CA 2BEOA 5CVUA 5K7ZA 1NTCA 2DAOA 4A3LJ 2BYVE 3BR5A 1O7FA 2E1CA 3QOPA 3DEWA 1H9TA 2DMUA 1D1CA 2LFBA 3HB9A 1MW7A 4BBRJ 2OTLI 2RNGA 3WODF 2MD0A 3QRFF 3ZQGA 3VWBA 3GTGJ 1I6XA 5J1YA 2XSJC 4HDVA 1T2KA 3GBGA 3V42A 2XROA 2EFOA 1OR7C 2L02A 4OIOF 3G2BA 3OOPA 4OIRF 3GCMA 4WXHA 3F72A 3AL0B 2VT3A 5IT9Z 2Q0OA 3JR9A 2ACJA 3MKWB 1LVAA 4ZDOA 1E3OC 3H0GJ 3J7AY 5CPRB 3A0HC 5LHHA 5IPAA 4ENMA 3CLQA 5M5YJ 2WA0A 4HF1A 4NC7A 1DUXC 2XAJA 1BOAA 4Y33A 5BNGA 2A69F 2L7FP 5D5VB 4A6DA 4WXCA 1HQCA 3BZCA 3HEFA 4M73A 1U2WA 5KAIC 2QF7A 3CTAA 5H20A 5M3MJ 4FX4A 2KIUA 3C18A 2P6SA 3L2UA 2Z5UA 3H9QA 5FLVA 2EH3A 4HV5A 1TWCJ 2DBBA 2X1DA 1BJZA 2LNBA 4EJOA 5FD6A 2A61A 1RZ4A 3ABKH 5J1UA 2C6YA 4PJNA 1UFMA 3O8GA 2V26A 4PSWA 4S04A 2EV0A 1XB4A 2ZXHA 4NQWA 1QO0D 3C2GA 4B47A 2Y0MA 4DYCA 2VOOA 1F43A 3LAPA 5FKOA 4F92B 3VEPA 2KQRA 3BTCA 5FROA 4AYBN 5ED4A 4EJWA 1W7PD 2KDOA 3BDDA 3HYIA 2OUMA 1S7OA 2BVLA 2K5CA 2K3FA 1Z7UA 3ZN1A 2CV2A 4Y13A 3G1LA 1YRNA 1D5VA 1ZGAA 3WGIA 2WAQN 3ZQCA 1HLVA 3NQOA 4CZCA 5K1YA 3H3VK 1KQ0A 2XB5A 1XD7A 3CCYA 4MTDA 2XRNA 3CJNA 1XSXA 4LLNA 4KJZA 4JX5A 1ZQ3P 2XRLA 3MD2A 5J40A 3R6SA 5J3LA 3ZRGA 1WZ2A 3SZTA 5LHIA 3GTQJ 1IO2A 3H3ZA 2LK2A 3E5QA 3IAS2 2MG4A 2Y48A 5CKTA 2BXZA 4G6DA 2O8KA 2Y0SN 4C3IJ 3A01B 3GZNB 1ON2A 1HSJA 2JTVA 2ZJ2A 1W1WE 5DCMB 5CVIA 3BJAA 2LY2A 5LRRA 3CC7I 2A5YB 3DTEA 1VQ7I 4AC0A 3MZHA 1V5FA 1MJ9A 2GAUA 2KPMA 5L3DA 4XBFA 4IKFA 3HUGB 4MFEA 1QNTA 2GOXB 3GYHX 3PQJA 1XMAA 2DLLA 2Y0SA 1PP8F 4PZJA 1MH3A 2M8EA 1ULYA 4ITVA 3FKIJ 2TRTA 1P6RA 2JVGA 1HKQA 2P5VA 1KYWA 1YS7A 4NC8A 4F7ZA 1H89C 4M6XA 2KLOA 2HDCA 2W7NA 2RNJA 1JT6A 5CQGA 4RAZA 4YRVA 3GF2A 2IJLA 4RB3C 3OYCA 4IQ4A 3JRHA 3VDXA 3CMEI 2OA4A 4XRSA 3HIFA 1HSTA 3GMEA 3CCSI 3M1CA 1HA8A 4U0WA 1BIAA 2WAQA 4BQNA 4FE7A 2PJRB 5K7FA 3WHCA 2LLKA 2OPTA 4U88A 3FBNB 3GX4X 1Z0XA 2K9NA 2BW3B 2LTPA 4K2EA 5FFZA 4S0HB 1I1GA 2COBA 1AU7A 3K2AA 1R58A 5FKMA 2A6HF 4FX0A 2ZNZA 1BBYA 2HDWA 3BT9A 4ESJA 1N75A 4IX7A 3Q0UA 1A36A 3G71I 2IPQX 4D7NA 3ZMSA 3F6VA 3TDUC 2E60A 1I1SA 1U0JA 4JYKA 4BQAA 3DPUA 3H1CA 5B1AH 2ISZA 1S6LA 1LB2A 2IS2A 5HDNA 5HS7A 3GFJA 5E3OA 5DD4A 5DD8A 3BR3A 4RM3A 4JX6A 1ORKA 4HW0A 4OAYA 3L2CA 1ETKA 1LE8A 2OBPA 2WWYA 2V9PA 1A35A 1POGA 1IRGA 1XCVA 3NWTA 2PQ8A 3G73A 4UV9A 5CYVA 1X1PA 2VIXA 3EUKL 3QQAA 3TOAA 2DT5A 1Z91A 2F4IA 4XLHA 2WY8Q 3I3LA 5ICGA 1WJAA 3CUQC 3OOUA 2CH0A 2CUEA 3A01A 2DT6A 2CFOA 1G3SA 4XKBA 3LQQA 2HYGD 1LQ1A 2VL8A 3RCOA 4V2GA 1DGRM 5GPCA 5ICFA 4HQEA 1VTNC 2RKHA 2VBWA 4Y52J 3BR0A 2VBXA 1T08B 4XKWA 4KITB 2H09A 1LEBA 3S15J 3DWLE 2TDXA 3CD6I 2F5DA 2CRGA 2EWNA 3HTSB 5LFAA 2FF4A 2JUGA 4II2A 5D4RA 3DKYA 3X2QH 1KGSA 2BOLA 2DJNA 1YHQI 2PLYA 1MNDA 4KUMA 2H6BA 3O6BB 2UV1A 4XM3A 1EA3A 4KN4X 5F64A 3OYDA 1G4DA 2NVTJ 2W00A 3AKZA 4ZZDA 4MHGA 3MZYA 5IYCJ 1PJRA 3TW7A 1LFPA 5FJ8J 3S3MA 2NVYJ 1H8AC 4YFXF 2AQFA 4IZZA 3OWTA 2CS3A
chains in the Genus database with same CATH topology
2VJJA 2OF7A 4A3IJ 3RQIA 3BG9A 2XDVA 5GPAA 4B1RA 5F1JA 2EZIA 1HDDC 4J00A 3OIQA 5E3NA 4XL9A 4F92B 1YE9A 4D1QA 1I50J 3HOZJ 3AFHA 4ABZA 3MKYB 1NK2P 2V1NA 1LVKA 2JWTA 4XR6A 3DKXA 3FISA 5K7HA 1O4XA 1ZK8A 4E7HA 2W48A 3HBLA 1TZLA 2CQQA 4NQWB 3PJRA 4JP0A 1MMAA 3HM5A 2JA2A 1W36C 3M3YJ 3CDLA 4BKXA 4OAZA 4W97A 2AQEA 3KEYA 2VPRA 4I76A 1ZR2A 2FUG2 2I8DA 3EPZA 2XGEA 2HOAA 2HVSA 1A5JA 3GTKJ 3MVPA 2XF7A 3LSPA 4CSWA 1Y56A 1XS9A 3GTLJ 1AKHB 4N4OB 2Q2EB 1JKPC 1QPIA 2JJ7A 1IJWC 1X1CA 2IGNA 4D5CA 2CW8A 1X2MA 2E5ZA 1Z7LA 2OC6A 4DBQA 1VI0A 2CUFA 2CU7A 2EZKA 3OYMA 3LNQA 2WB1N 4M3FA 4JX4A 3IUOA 3TEDA 3OL4A 4NNJA 4XKCA 2ZXIA 2VI6A 3SJMA 4LIUA 3QYBA 4BJTA 1QHGA 3CZ6A 2NS7A 1WJ5A 3PNTA 1MMDA 1MBJA 2RAEA 4CYCB 2R0QC 4NDLA 2X9DA 1FJLA 3TP3A 2O9LA 3UKGA 1IRXA 1IV6A 3ONQA 2ZFUA 1P7JA 1NK3P 2R7UA 4C2MJ 3FHNA 4ZYAA 2WV1A 4BDZA 4XOTA 1UAAA 2M7BA 4W1UA 2DA3A 1WPKA 1ETQA 5FKLA 1SAUA 3QOEA 2YUSA 3VSKA 2CUJA 1UHSA 1BA5A 3K6GA 2VQCA 5FRMA 2WY7Q 1R6RA 1G2HA 2WAFA 3D5RC 2R7VA 2FX0A 3K4KA 2EBIA 4YELA 3LSJA 3S3OA 2CV0A 2LG4A 2H1KA 4A3DJ 3QYFA 1AA7A 4IEJA 3RTRA 3I4NJ 2KZVA 1MBKA 3QYEA 4G6TB 4BJ6C 2WBMA 3MKLA 1BOBA 1ZKGA 1WH7A 2FD5A 2P0WA 3HOXJ 4PJLA 3OYEA 1UG0A 1QU3A 1D0ZA 4XN3A 1SANA 5C3EJ 3A2KA 4DIQA 2W82A 5CQEA 3K70C 1QVTA 4G12A 2E1MC 2HXOA 2Y9ZA 5FROA 3RZOJ 2LYCA 4MIMA 2DA1A 1MSFC 4BACA 3SDGA 4XRSG 2N8GA 3HOWJ 3OYAA 2R4GA 3K4JA 3TL4X 2ZSHB 2DN0A 2GM4A 2ECBA 2M8GX 3EUAA 1HDPA 1I3QJ 1D1BA 4IHXA 4UUSB 1D5YA 1K6YA 4Y4RA 3SZGA 3K4NA 4YEJA 2HQAA 1N77A 2LR8A 1YRNB 2EQRA 2LBFB 1SFOJ 4PFOA 4ZDPA 1RETA 2OV7A 3DEEA 4P1WA 3FK6A 4A69C 4FETA 4CCJA 2YU9J 4A3MJ 4A3KJ 4HRIA 1F36A 3IH2A 2IEKA 2VKEA 5IYDJ 1FMWA 2A6TA 1S9HA 3RSNA 3UR3C 4DBRA 4F55A 4BL0B 3K7AJ 3SEQA 3S14J 1X2NA 1U9NA 2QCOA 5F04A 4B3AA 2AHQA 2K9QA 2Y9YA 3ZQLA 3PO2J 4IHWA 2B63J 1P7IA 2ID3A 1SFKA 3OYFA 5EG0A 1B72B 2EZLA 3GTMJ 1ETVA 4BQNA 3JRAA 3PL8A 3CJRB 4BUPA 3H9JA 4AU7A 4BJ5C 1OCPA 2X85A 2GBYA 3BCBA 3H9GA 2DXIA 1UG2A 2L7ZA 1JUSA 2DMNA 5M5WJ 2K9LA 4PUSA 4CCMA 1GVDA 3OSGA 2JSPA 1NG7A 3CP8A 5F27A 1PYVA 4BE2A 4XMYA 2FJ1A 3ZOBA 4CH7A 4B3XA 3HOVJ 2R5ZA 1MMGA 1U9OA 4BQOA 3SYTA 3BQYA 1WJFA 4XONA 2Y2ZA 3HOSA 2R7QA 3PO3J 2JA5J 2MSYA 4R79A 5IOYA 2X6OA 3K70D 2IS1A 2DMPA 4CCKA 1G8XA 1KONA 4BY7J 3MMYB 1ITYA 1DGWY 5EDNA 5F08A 1V5EA 3A1YA 3E0JB 4KT6A 3HOTA 2L9NA 1HCRA 5EGOB 5F0FA 4B43A 4BXFA 3MKZA 4XOPA 3QPLA 2E2HJ 4GRIA 1X1DA 3OR2C 3OYBA 1IG7A 3CESA 2XGDA 4M3BA 3A02A 3PNYA 4PFPA 4BS9A 4BDYA 3O8HA 1ETWA 2JN6A 1Z77A 3QODA 2VJIA 1ZGWA 3S3NA 2PMZA 1JTYA 4FISA 4CA0A 5GP9A 1Q1VA 3BG7A 3DLAA 3LMMA 2IAIA 5FKNA 2A5WA 4BGDA 4PK4A 4BBSJ 1V5GA 3HL2A 5EZGA 1RKWA 2WB1A 4DYRA 4ZJZA 2I10A 2L2OA 1QVUA 1WH5A 3CQZJ 4A3BJ 2VQLA 2MFZA 4FASD 3OIPA 1JUPA 1JGGA 2Q1ZB 2MABA 2O5RA 1X1AA 4A3CJ 1EF4A 2R5YB 4ZC3A 3ZR8X 5KHDA 4QSHA 1W0TA 4FE4A 3GTOJ 1FTTA 3BQZA 4UUSA 5E3LA 1TC3C 1G59A 4RMNA 5E3MA 2XPUA 1H88C 3A4CA 1BR2A 1DU6A 3M4OJ 3S1RJ 2UUZA 4M3GA 2L9RA 1ETOA 5JHFA 5F0CA 4A3FJ 2Z2SB 5KCMA 3L2WA 2D5VA 2VPLA 2VKHA 3CP2A 1VFCA 3LSKA 4RDUA 3HKZA 3H5RA 1LFBA 1IC8A 2P81A 4Y3OA 3PUBA 3PM1A 3BR1A 1X4OA 2XB0X 2VJ4A 2X6XA 4E7LA 5IOZA 4E7ZA 3VYRB 2R7SA 2LVSA 4XLAA 1UMQA 2HPMA 1AKHA 1U8BA 1BR4A 3BG6A 3BR2A 1HF0A 4A3JJ 1OJLA 4BXXJ 2W1OA 2H8RA 5K7ZA 3K4CA 4A3LJ 1NTCA 5HLTA 1K61A 2VUMJ 3BR5A 4ZDLA 4E7IA 3NWSA 2VJ5A 3DEWA 2DMUA 2JMWA 1D1CA 2LFBA 4CCNA 5LD2C 3HB9A 4QIWN 4BBRJ 1MW7A 2VXZA 4XN0A 2M34A 2RNGA 2MD0A 3FKJA 1IRZA 2Y30A 3W2AA 3BR6A 3ZQGA 3VWBA 1ZELA 4IHYA 2LC2A 2K3PA 3DPLC 4PSXA 5C4JJ 3GTGJ 5JLXA 4A3GJ 2BW3A 4HNTA 3L2VA 4EEFG 2CV1A 3OR1C 3VPRA 1AHDP 1X19A 3UNGC 5J1YA 2HVQA 2XSJC 5IP9J 5DTDA 1PUFA 3GBGA 3V42A 2KRCA 1WI3A 2KMUA 1OR7C 2LBFA 4RM2A 4AYBA 4C2UA 3ZGKA 3G2BA 2LD5A 4FCYA 1LKXA 4XNFA 1D0XA 3AL0B 1MSEC 1ETYA 5HNHA 2LY9A 5M3FJ 3JR9A 2HVRA 2IGOA 2MC4A 3MKWB 1WFXA 4ZDOA 2DMQA 1E3OC 3H0GJ 4KISA 3J7AY 2DJIA 5CPRB 3VYSB 3JRDA 3DTKA 3PSIA 3S32A 5IPAA 5F0HA 4C3HJ 5M5YJ 2WA0A 1A6IA 1GLNA 3IP4B 2IGKA 3PSFA 4N4NB 3FDYA 2MGQA 4NC7A 2R7XA 3OMYA 4Y33A 2ZB9A 2K40A 2L7FP 2HXIA 4XK4A 5BNGA 2LOOA 3H35A 3LSIA 2PJRB 2LH9A 4F3QA 4BU2A 3HEFA 1ZTRA 5HODA 1B8IB 1W0UA 2M9HA 1R9TJ 4E7KA 3S93A 2KP6A 2QF7A 5M3MJ 3ZQQA 4M3DA 2R93J 4HSRA 3S1MJ 1JKRC 2ZSIB 2KT0A 2R5ZB 1MBFA 4PJJA 3L2UA 3H5AA 4MO7A 3SDBA 1DP3A 2L7MP 5FLVA 3H9QA 4HPQA 2EH3A 4RBOA 5HNFA 1X4PA 1TWCJ 2ME6A 3OYNA 2X1DA 2X6YA 1BJZA 1WJEA 3E7LA 1MBGA 2JVHA 2RREA 1APLC 3G1OA 5J1UA 3BLYA 4A93J 4CCLA 4AUXA 2WADA 3JRFA 3O8GA 4PJNA 3PFYA 4QPOA 3L1PA 1IUFA 3BTJA 4MLOA 4BY1J 1VZ0A 3I4MJ 4A3EJ 2MYSA 3GTJJ 2V26A 3K4MA 4PSWA 1JT0A 2V4JC 2ZXHA 1GV5A 5EEAA 2ELKA 2ID6A 2BVMA 3C2GA 1YX3A 4DYCA 1F43A 2XGCA 2AO9A 4B47A 5FKOA 3JRBA 4LIVA 4D9JA 2HU9A 3LSGA 1MNMC 1WJDA 2HNHA 2GLOA 3BTCA 2DCEA 4AYBN 2ECCA 2R7ZJ 1QHHD 2DOAA 2KQRA 3FBIB 4RLQA 4XLFA 2UWMA 4LOCA 2KDOA 1K83J 2OUMA 2FQ4A 2BVLA 2K5CA 2Z1DA 3CJQB 3HPGA 4CUGA 5KNLA 3G1LA 1YRNA 1XG1A 2CV2A 2XPWA 1FMVA 2WAQN 2IS4A 3ZQCA 3W3CA 4DOZA 3NAUA 3FK7A 1HLVA 2MW8A 3Q0VA 3BTIA 4HG2A 4XQFA 4CZCA 3F0CA 1I6HJ 1BW6A 3H3VK 4BEHA 2DA2A 2M4KA 2TCTA 2XB5A 3CCYA 4GFBA 3RPUD 5EZHA 2XF5A 2V9KA 2JK3A 1VNDA 4BQQA 3H0DA 3HOYJ 4D7MA 4HEA2 4JX5A 3I9V2 3OWTA 1ZQ3P 4KJZA 4B48A 2XRLA 2NVXJ 1Z21A 3MD2A 5EG0B 2YS9A 1T0FC 5J3LA 3ZCOA 3ZRGA 3LFUA 2XPVA 3GTQJ 4EATA 2HI3A 2IS6A 4HNVA 1BW5A 4U87A 2LREA 3TW6A 4HNUA 5EYRA 2LK2A 1GDTA 1IDZA 2PMZN 1MNEA 3IAS2 3K4BA 3RQ4A 3HKZN 2MG4A 3DQVC 3HXLA 4J19A 3IAM2 1FIAA 1MBHA 5CKTA 3VYUB 3ZQHA 2O8KA 2NOJB 2Y0SN 4C3IJ 2JA6J 3A01B 2VQGA 3DPTA 4F52A 4ANJA 2HYJA 5JLWA 3IH3A 4DW6A 3RZDJ 9ANTA 3ZXSA 1RR7A 2VB6A 2LY2A 3BTLA 3JREA 2L9SA 2XSDC 3DTEA 4AC0A 4UUTA 2IGMA 1V5FA 1DU0A 2E2JJ 2X6WA 4C30A 3Q3SA 2R5YA 1NG6A 2KPMA 2XAUA 5IP7J 3HOUJ 4MFEA 3HUGB 1BR1A 1DQUA 2GOXB 4IKFA 2QKLB 3D5SC 2Y0SA 4DJAA 1MH3A 2L0KA 1IDYA 2VLAA 1FTZA 4ITVA 2TRTA 3FKIJ 2E1OA 1RPWA 2JVGA 3E1SA 2V6EA 2EZHA 2HDDA 4NC8A 3PNVA 1H89C 2DT7B 2NS8A 3ZQIA 3S1QJ 2KLOA 4U7BA 2W7NA 1JT6A 5CQGA 3OYKA 4YRVA 4E4HA 1Y1VJ 1Z3YA 3LSRA 2VKDA 3OYCA 1VF9A 5IYBJ 3ZQFA 4XIDA 3JRHA 3LSHA 5C4XJ 1FEXA 3LSMA 4IQ4A 4NUBA 3VDXA 4Y7NJ 4XRSA 2ELJA 3S2HJ 4XLEA 3W2VA 1GUUA 1MH4A 4C3JJ 2JA7J 4BE1A 3BG5A 4OWRB 2HQ5A 1LDKB 2VKVA 2CJJA 4P5OA 3K10A 3D5LA 3M1CA 1HA8A 2XF6A 1T33A 1JKOC 2WAQA 1TWAJ 3CMMA 1T95A 4V2FA 4B4CA 1JJ6C 3S16J 4FE7A 3EUHC 3H5NA 3OIOA 3G1MA 5K7FA 1U78A 1IGNA 2M4GA 3WHCA 1Y1WJ 2LLKA 2QKMB 2OPTA 3A03A 3DCFA 1TWHJ 2X1CA 3FBNB 4XKVA 4J01A 1Z0XA 3C2BA 2PJRA 2K9NA 2BW3B 2LTPA 4E7JA 3RKQA 3BC8A 4S0HB 2COBA 1AU7A 3U21A 3K2AA 5FKMA 5EF6A 4JQFA 3QPSA 2R92J 3BT9A 2HDWA 5HVQC 1N75A 3CF2A 4F93B 3C2HA 3Q0UA 4IX7A 4RLFA 1QRYA 4D7NA 2L5QA 3M8JA 1JI8A 1GT0C 4XICA 3D1NI 3MN2A 2E60A 2RQQA 1U0JA 4JYKA 4JOMA 4AVZA 5EGOA 3DPUA 3HPHA 1RESA 4DZPA 3IV5A 2GOMA 2KHMA 4CCOA 3L2QA 1JUMA 2F6CA 2IS2A 1S7EA 5IP6A 2DA5A 2DMTA 5E3OA 2CW7A 4E6KG 2NOGA 1E0EA 3BR3A 4FTHA 4L5EA 4RM3A 1MBEA 1JKQC 2X1EA 4JX6A 4LG3A 1ENHA 1OFCX 1ORKA 1RKTA 4OAYA 3OS2A 4BE0A 1ETKA 1P9QC 2KL4A 5J1RA 5C44J 2VXDA 2WAEA 3OL3A 1LE8A 5FLMJ 4X1EA 2K9MA 1GV2A 2DTZA 3DTIA 3OYJA 4LITA 2R7RA 1WJBA 1X1BA 3NARA 3CMYA 1POGA 5DS9A 1OCTC 2IXSA 4QTRA 3B6AA 1XC5A 2Y31A 3F9KA 3NWTA 2X51A 4E7SA 3OYIA 1W36D 4M6VA 2NVQJ 1YX5A 3HGYA 1ZR4A 4MFDA 2E2IJ 2VIXA 2G0EA 3QQAA 3EUKL 3GTPJ 2LRDA 3HC7A 2L7KA 4BEHB 2VASA 2VQHA 4M3EA 2E1MB 3DU5A 3SEZA 2DA7A 2F4IA 3KX2A 4XLHA 3B6CA 2CQXA 2WY8Q 3L2RA 3I3LA 4F91B 1WGXA 3FIWA 1UELB 4IQJA 3Q0WA 3S1NJ 3SFIA 2E19A 1WJAA 5FKKA 2Z16A 1T56A 3JRIA 2ME0A 5HOOA 1MMNA 4ZTFA 3OOUA 2CUEA 2CH0A 3A01A 2DT6A 2CFOA 3BCAA 4X0GA 3OYHA 4XKBA 2R7WA 2R7OA 3OS0A 2VL8A 3RCOA 4V2GA 1B8IA 5GPCA 1DGRM 5FRNA 1WCMJ 1X58A 2O7OA 4II3A 4Y52J 1Y6IA 1JJ8C 4C2TA 3BR0A 4D5FA 2M3AA 2KRHA 3TBIA 4H4KC 1TWGJ 4X6AJ 4XKWA 4KITB 4QPQA 3S15J 3DWLE 2E5NA 3VYTB 3OY9A 2HOSA 2V7FA 3S2DJ 2X48A 4CYCA 3N05A 3KYLA 2CRGA 2LP0A 1OLTA 1CQTA 1Z3XA 1BL0A 1HOMA 3TMOA 3OS1A 3OYGA 4IHVA 1J09A 5M5XJ 3TP0A 5LFAA 4DYQA 1N78A 2LKXA 2JUGA 3S8PA 2IBDA 1D1AA 1TT0A 2XC7A 2M0CA 4II2A 4B44A 2DA6A 3DKYA 4HSTA 4XLCA 2M7AA 2DJNA 3IH4A 2BOLA 4I6ZA 2F5VA 3LOCA 3LL7A 2HPIA 1MNDA 2K9SA 4XRMA 1PUFB 3HGGA 3JRCA 1D0YA 2UV1A 4XM3A 1B72A 2JA8J 3OYLA 1EA3A 2M0MA 2CMPA 4DZJA 3OYDA 1ETXA 2NVTJ 3JRGA 5TGTA 2W00A 4DGWB 1TWFJ 2M2EA 3BG3A 2KDZA 3AKZA 5IYCJ 3W2WA 1PJRA 1WJCA 3TW7A 3K4LA 4XORA 3AL0C 3OSFA 1LFPA 1ERDA 5FJ8J 3VSLA 1FIPA 2HOTA 3WHBA 3HG9A 2CUZA 2HZDA 4PJMA 2DA4A 2LY1A 3W6VA 3S3MA 2R7TA 3S17J 2NVYJ 1H8AC 4ZTJA 4C9YA 2AQFA 1JTXA 1LE8B 3HDDA 2W4SA 1LFUP 4IZZA 3DU6A 2CS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OF7 A;  4A3I J;  3RQI A;  3BG9 A;  5GPA A;  4B1R A;  5F1J A;  2EZI A;  1HDD C;  5E3N A;  1I50 J;  3HOZ J;  4ABZ A;  1NK2 P;  2JWT A;  3FIS A;  5K7H A;  1O4X A;  1ZK8 A;  2W48 A;  3HBL A;  2CQQ A;  4JP0 A;  3HM5 A;  3M3Y J;  3CDL A;  4BKX A;  4W97 A;  2VPR A;  4I76 A;  1ZR2 A;  2XGE A;  2HOA A;  1A5J A;  3GTK J;  3MVP A;  3LSP A;  1XS9 A;  3GTL J;  1AKH B;  1JKP C;  1QPI A;  2JJ7 A;  1IJW C;  4D5C A;  1X2M A;  1VI0 A;  2CUF A;  2CU7 A;  2EZK A;  3LNQ A;  2WB1 N;  4M3F A;  4JX4 A;  3TED A;  2VI6 A;  3SJM A;  2NS7 A;  1MBJ A;  2RAE A;  4CYC B;  2R0Q C;  4NDL A;  2X9D A;  1FJL A;  3TP3 A;  2O9L A;  3UKG A;  1IV6 A;  1P7J A;  1NK3 P;  4C2M J;  2WV1 A;  4W1U A;  2DA3 A;  1WPK A;  1ETQ A;  5FKL A;  2YUS A;  1UHS A;  1BA5 A;  1G2H A;  2FX0 A;  2EBI A;  3LSJ A;  2H1K A;  4A3D J;  4IEJ A;  3I4N J;  1MBK A;  3MKL A;  1ZKG A;  1WH7 A;  2FD5 A;  3HOX J;  1SAN A;  5C3E J;  1QVT A;  4G12 A;  2HXO A;  2Y9Z A;  3RZO J;  4MIM A;  2DA1 A;  1MSF C;  3SDG A;  4XRS G;  2N8G A;  3HOW J;  2DN0 A;  2GM4 A;  2ECB A;  2M8G X;  1HDP A;  1I3Q J;  4IHX A;  4UUS B;  1D5Y A;  2LR8 A;  1YRN B;  2EQR A;  1SFO J;  1RET A;  3FK6 A;  4A69 C;  2YU9 J;  4A3M J;  4A3K J;  1F36 A;  3IH2 A;  2IEK A;  2VKE A;  5IYD J;  3K7A J;  3S14 J;  1X2N A;  1U9N A;  2QCO A;  5F04 A;  4B3A A;  2AHQ A;  2K9Q A;  2Y9Y A;  3ZQL A;  3PO2 J;  4IHW A;  2B63 J;  1P7I A;  2ID3 A;  5EG0 A;  1B72 B;  2EZL A;  3GTM J;  1ETV A;  3JRA A;  1OCP A;  2GBY A;  1UG2 A;  2L7Z A;  1JUS A;  2DMN A;  5M5W J;  1GVD A;  3OSG A;  5F27 A;  2FJ1 A;  3ZOB A;  3HOV J;  2R5Z A;  1U9O A;  3BQY A;  2Y2Z A;  3PO3 J;  2JA5 J;  2MSY A;  5IOY A;  2X6O A;  2DMP A;  4BY7 J;  1ITY A;  5EDN A;  5F08 A;  1HCR A;  5EGO B;  5F0F A;  3QPL A;  2E2H J;  1IG7 A;  2XGD A;  4M3B A;  3A02 A;  3O8H A;  1ETW A;  2JN6 A;  1Z77 A;  1ZGW A;  1JTY A;  4FIS A;  5GP9 A;  1Q1V A;  2IAI A;  5FKN A;  4BBS J;  5EZG A;  1RKW A;  4DYR A;  2I10 A;  1QVU A;  1WH5 A;  3CQZ J;  4A3B J;  1JUP A;  1JGG A;  4A3C J;  1EF4 A;  2R5Y B;  4QSH A;  1W0T A;  4FE4 A;  3GTO J;  1FTT A;  3BQZ A;  4UUS A;  5E3L A;  1TC3 C;  5E3M A;  2XPU A;  1H88 C;  1DU6 A;  3M4O J;  3S1R J;  4M3G A;  2L9R A;  1ETO A;  5F0C A;  4A3F J;  2D5V A;  1VFC A;  4RDU A;  1LFB A;  1IC8 A;  2P81 A;  3PM1 A;  3BR1 A;  2XB0 X;  5IOZ A;  2LVS A;  1UMQ A;  1AKH A;  1U8B A;  3BR2 A;  1HF0 A;  4A3J J;  1OJL A;  4BXX J;  2H8R A;  5K7Z A;  4A3L J;  1NTC A;  1K61 A;  2VUM J;  3BR5 A;  3DEW A;  2DMU A;  2JMW A;  2LFB A;  3HB9 A;  4QIW N;  4BBR J;  2M34 A;  1IRZ A;  2Y30 A;  3BR6 A;  3ZQG A;  4IHY A;  5C4J J;  3GTG J;  5JLX A;  4A3G J;  4EEF G;  3VPR A;  1AHD P;  5J1Y A;  5IP9 J;  5DTD A;  1PUF A;  3GBG A;  1WI3 A;  2LD5 A;  4FCY A;  1MSE C;  1ETY A;  2LY9 A;  5M3F J;  3JR9 A;  2DMQ A;  1E3O C;  3H0G J;  3JRD A;  5IPA A;  5F0H A;  4C3H J;  5M5Y J;  1A6I A;  2MGQ A;  2ZB9 A;  2K40 A;  2L7F P;  2HXI A;  4XK4 A;  5BNG A;  3HEF A;  1ZTR A;  5HOD A;  1B8I B;  1W0U A;  2M9H A;  1R9T J;  2QF7 A;  5M3M J;  4M3D A;  2R93 J;  3S1M J;  1JKR C;  2KT0 A;  2R5Z B;  1MBF A;  4MO7 A;  2L7M P;  5FLV A;  2EH3 A;  4RBO A;  1TWC J;  2ME6 A;  1BJZ A;  3E7L A;  1MBG A;  1APL C;  3G1O A;  5J1U A;  4A93 J;  4AUX A;  3JRF A;  3O8G A;  3L1P A;  1IUF A;  3BTJ A;  4MLO A;  4BY1 J;  3I4M J;  4A3E J;  3GTJ J;  1JT0 A;  1GV5 A;  5EEA A;  2ELK A;  2ID6 A;  4DYC A;  1F43 A;  2XGC A;  2AO9 A;  5FKO A;  3JRB A;  3LSG A;  1MNM C;  2GLO A;  3BTC A;  4AYB N;  2ECC A;  2R7Z J;  4LOC A;  1K83 J;  2FQ4 A;  3G1L A;  1YRN A;  1XG1 A;  2XPW A;  2WAQ N;  3ZQC A;  3NAU A;  3FK7 A;  1HLV A;  2MW8 A;  3Q0V A;  3BTI A;  3F0C A;  1I6H J;  1BW6 A;  3H3V K;  2DA2 A;  2TCT A;  2XB5 A;  3CCY A;  4GFB A;  5EZH A;  2JK3 A;  1VND A;  3HOY J;  4D7M A;  4JX5 A;  1ZQ3 P;  2XRL A;  2NVX J;  5EG0 B;  2YS9 A;  5J3L A;  2XPV A;  3GTQ J;  2HI3 A;  4HNV A;  1BW5 A;  3TW6 A;  5EYR A;  2LK2 A;  1GDT A;  1IDZ A;  2PMZ N;  3HKZ N;  2MG4 A;  4J19 A;  1FIA A;  1MBH A;  3ZQH A;  2O8K A;  2Y0S N;  4C3I J;  2JA6 J;  3A01 B;  2HYJ A;  5JLW A;  3IH3 A;  4DW6 A;  3RZD J;  9ANT A;  1RR7 A;  3BTL A;  3JRE A;  2XSD C;  4AC0 A;  4UUT A;  1DU0 A;  2E2J J;  3Q3S A;  2R5Y A;  5IP7 J;  3HOU J;  4MFE A;  1MH3 A;  2L0K A;  1IDY A;  1FTZ A;  2TRT A;  3FKI J;  2E1O A;  1RPW A;  2EZH A;  2HDD A;  1H89 C;  2NS8 A;  3ZQI A;  3S1Q J;  1JT6 A;  1Y1V J;  3LSR A;  1VF9 A;  5IYB J;  3ZQF A;  4XID A;  3JRH A;  5C4X J;  1FEX A;  4Y7N J;  4XRS A;  3S2H J;  1GUU A;  1MH4 A;  4C3J J;  2JA7 J;  3BG5 A;  2HQ5 A;  2VKV A;  2CJJ A;  1T33 A;  1JKO C;  1TWA J;  4V2F A;  4B4C A;  1JJ6 C;  3S16 J;  4FE7 A;  3OIO A;  3G1M A;  5K7F A;  1U78 A;  1IGN A;  3WHC A;  1Y1W J;  2LLK A;  2OPT A;  3A03 A;  3DCF A;  1TWH J;  1Z0X A;  3C2B A;  2K9N A;  2LTP A;  3RKQ A;  4S0H B;  2COB A;  1AU7 A;  3K2A A;  5FKM A;  5EF6 A;  3QPS A;  2R92 J;  3BT9 A;  3Q0U A;  1QRY A;  4D7N A;  1GT0 C;  4XIC A;  3D1N I;  3MN2 A;  4JYK A;  5EGO A;  1RES A;  4DZP A;  3IV5 A;  1JUM A;  1S7E A;  5IP6 A;  2DA5 A;  2DMT A;  5E3O A;  2NOG A;  3BR3 A;  4FTH A;  4L5E A;  1MBE A;  1JKQ C;  4JX6 A;  1ENH A;  1OFC X;  1ORK A;  1RKT A;  1ETK A;  5J1R A;  5C44 J;  1LE8 A;  5FLM J;  4X1E A;  1GV2 A;  2DTZ A;  3NAR A;  3CMY A;  1POG A;  5DS9 A;  1OCT C;  4QTR A;  3B6A A;  1XC5 A;  2Y31 A;  4M6V A;  2NVQ J;  3HGY A;  1ZR4 A;  4MFD A;  2E2I J;  2G0E A;  3QQA A;  3GTP J;  4M3E A;  2DA7 A;  3B6C A;  2CQX A;  1WGX A;  3FIW A;  3Q0W A;  3S1N J;  3SFI A;  2E19 A;  5FKK A;  1T56 A;  3JRI A;  2ME0 A;  3OOU A;  2CUE A;  3A01 A;  4V2G A;  1B8I A;  5GPC A;  1WCM J;  1X58 A;  2O7O A;  4Y52 J;  1JJ8 C;  3BR0 A;  4D5F A;  1TWG J;  4X6A J;  3S15 J;  2HOS A;  3S2D J;  2X48 A;  4CYC A;  2CRG A;  2LP0 A;  1CQT A;  1BL0 A;  1HOM A;  4IHV A;  5M5X J;  3TP0 A;  4DYQ A;  2LKX A;  2IBD A;  2M0C A;  2DA6 A;  2DJN A;  3IH4 A;  4I6Z A;  3LOC A;  2K9S A;  4XRM A;  1PUF B;  3HGG A;  3JRC A;  1B72 A;  2JA8 J;  4DZJ A;  1ETX A;  2NVT J;  3JRG A;  1TWF J;  2M2E A;  3BG3 A;  2KDZ A;  5IYC J;  3TW7 A;  3OSF A;  5FJ8 J;  1FIP A;  2HOT A;  3WHB A;  2DA4 A;  3W6V A;  3S17 J;  2NVY J;  1H8A C;  1JTX A;  1LE8 B;  3HDD A;  1LFU P; 
#chains in the Genus database with same CATH topology
 2OF7 A;  1GXP A;  3T1B A;  2EZI A;  1HDD C;  2O6G E;  4NB5 A;  4XL9 A;  2YPR A;  4LG0 A;  2EA2 A;  3AFH A;  4CO8 A;  1TQM A;  3MKY B;  1NK2 P;  1ODD A;  2PI0 A;  3PIO F;  1J7K A;  1SC7 A;  3FIS A;  1ZK8 A;  2W48 A;  3ZP5 A;  2LKS A;  4JP0 A;  2JA2 A;  1J75 A;  3CCL I;  4Y15 A;  2ELH A;  2AQE A;  3DP7 A;  2VPR A;  2FUG 2;  2XIG A;  4HOB A;  5B5E C;  3ZMZ A;  2XF7 A;  5LRS A;  2LF8 A;  3LSP A;  4IOA F;  1Y56 A;  4TV7 A;  1JKP C;  1IJW C;  2DPD A;  2IA1 A;  3OYM A;  4P55 A;  5GAE J;  1YOV B;  1TNS A;  3SJM A;  2MD5 A;  3W6K B;  1OCC H;  5F1R A;  1Y8Q B;  4UVA A;  4CYC B;  3UKG A;  1KU7 A;  1SMT A;  1P7J A;  3FXO A;  2E7W A;  4BDZ A;  2WV1 A;  1UAA A;  4A0Y A;  2M7B A;  3VSK A;  3QOE A;  1WPK A;  2FE3 A;  2ZME B;  4CCK A;  2DFI A;  3Q9S A;  3T8T A;  1UHS A;  4RAG A;  3K6G A;  1R4M B;  5IT3 A;  2WY7 Q;  2WAF A;  3IRR A;  1QBJ A;  2FX0 A;  3LSJ A;  2A05 A;  3F8F A;  3S3O A;  1T39 A;  1P4W A;  1YYV A;  1DDN A;  2H1K A;  2QUF A;  2ISY A;  1OYI A;  3GO5 A;  3I4N J;  2KFD A;  3AG2 H;  3OYE A;  1VQP I;  1FBQ A;  1ZKG A;  4QWQ A;  4C2U A;  3HOX J;  5E79 C;  1UG0 A;  3TOB A;  4E70 A;  3RPU A;  4HF2 A;  2OZ6 A;  1MKM A;  2E1M C;  3KP4 A;  2Y9Z A;  3RZO J;  4EV0 A;  3SDG A;  2QBY B;  4GCV A;  4XRS G;  4ENK A;  2N8G A;  5BS6 A;  1IRF A;  2R4G A;  2Q8K A;  1W7P A;  3QAH A;  2D2W A;  2DN0 A;  2G9W A;  1I3Q J;  4I7H A;  4Y4R A;  2R7D A;  1R1V A;  4I99 C;  4KMU X;  4LJZ F;  1YRN B;  2EB7 A;  3I59 B;  1SFO J;  5GAD J;  3RPQ A;  4A69 C;  2V1X A;  4A3M J;  1SVL A;  4A3K J;  2CWE A;  1F36 A;  1FMW A;  5D5W B;  3RSN A;  2EPF A;  3SEQ A;  3FMS A;  2AHQ A;  2Y9Y A;  1E17 A;  3T5X A;  4PCQ A;  1ETV A;  3PL8 A;  5J6X A;  3H9J A;  5HS8 A;  1UG2 A;  2MC3 A;  2ESN A;  2K9L A;  5HS9 A;  1Z6R A;  4ZYH A;  5BMZ A;  2FJ1 A;  3ZOB A;  1MMG A;  1U9O A;  2GXA A;  1FT9 A;  4EMS A;  6PAX A;  1YLF A;  3O3K A;  4L9N A;  3GVA A;  2DMP A;  3NEU A;  4BY7 J;  3MMY B;  4HYE A;  3DKW A;  3RKY A;  1P4X A;  1KYZ A;  3HOT A;  4B43 A;  5EGO B;  5F0F A;  5H6R A;  3MKZ A;  4M3B A;  2R7F A;  4MTE A;  4PFP A;  4BDY A;  5JVT A;  3BY6 A;  4LFU A;  2VJI A;  1ZGW A;  3IC7 A;  2LKP A;  4FIS A;  4CA0 A;  3QU3 A;  3BG7 A;  2GIV A;  1Y0U A;  1IAW A;  5E8G A;  1RI7 A;  4B09 A;  4PK4 A;  4BBS J;  3WU2 C;  1WSU A;  1RKW A;  2WB1 A;  4ZJZ A;  2DFE A;  2I10 A;  2VQL A;  5D6E A;  1WH5 A;  3CQZ J;  4FAS D;  5BQT A;  3OIP A;  2O5R A;  3V7R A;  3Q5F A;  1FYK A;  1EF4 A;  2HGC A;  2ZJR F;  3HJE A;  4UUS A;  1ONV A;  1TC3 C;  2O3F A;  4RMN A;  1H88 C;  2XPU A;  4KIG A;  4HAM A;  1BR2 A;  3M4O J;  1TLH B;  4NHJ A;  1VFC A;  3H5R A;  1IC8 A;  4G94 A;  1X4O A;  2ZKZ A;  2VJ4 A;  2B9S A;  2KIF A;  1SFX A;  4O3M A;  2EA4 A;  1AKH A;  2Q2E A;  2CQN A;  1YFH A;  1B1B A;  3BR2 A;  2JPC A;  3LA7 A;  4G8X A;  5HLT A;  3EUH A;  2VUM J;  4ZYG A;  4D0P A;  4GYG A;  2XUB A;  2JMW A;  5LD2 C;  2VXZ A;  3FKJ A;  1ZEL A;  2LC2 A;  1I39 A;  3DPL C;  2K3P A;  4PSX A;  5C4J J;  3HSR A;  5JLX A;  3L2V A;  3WU0 A;  4EEF G;  2CV1 A;  3EET A;  5BOX A;  3UNG C;  4FHT A;  3T0Y A;  3VPR A;  2HVQ A;  5L3G A;  3BP8 A;  1W4M A;  2KRC A;  4KA4 A;  1WI3 A;  2KMU A;  3GUD A;  3P5J A;  4RM2 A;  3ZGK A;  1LKX A;  4XNF A;  1D0X A;  1WWX A;  3B02 A;  5HNH A;  2LY9 A;  5M3F J;  4AWX B;  2DMQ A;  4RGR A;  2DJI A;  5L3B A;  4N0B A;  2IW5 A;  3S2W A;  2P5L C;  1OYW A;  4N4N B;  3IWZ A;  3H35 A;  2K40 A;  2LOO A;  4GXO A;  2PN6 A;  2FNP A;  4XK4 A;  4AID A;  4BYY A;  5D5U B;  4GDF A;  2LH9 A;  4BU2 A;  3RDI A;  5HOD A;  1K4S A;  1JHF A;  2M9H A;  3WTS C;  5LGT A;  3S93 A;  1D3Y A;  1U5T A;  2VE9 A;  4KIF A;  5IY5 H;  2ZSI B;  5GTH C;  1JKR C;  3S1M J;  2R5Z B;  3H5A A;  2IT0 A;  3SDB A;  2NVU B;  1BC8 C;  2NYX A;  3BWG A;  2ME6 A;  2JVH A;  1MBG A;  2RRE A;  3E7L A;  1APL C;  1FBS A;  4A93 J;  4AUX A;  3JRF A;  3PFY A;  2WAE A;  3BTJ A;  3L1P A;  4MLO A;  4BY1 J;  1MMS A;  2MYS A;  1FOY A;  1BIB A;  3GTJ J;  1S8N A;  2D1V A;  2XAF A;  4EJT A;  5EEA A;  4LB6 B;  2F4O B;  1SMY F;  1IN5 A;  2HU9 A;  1WJD A;  2HNH A;  3LSG A;  4G9Y A;  1MNM C;  2DOA A;  5B66 C;  2ECC A;  2R7Z J;  3P7N A;  4XLF A;  4LOC A;  1ZAR A;  4ASN A;  2FQ4 A;  2AXL A;  3CJQ B;  1XG1 A;  5DYM A;  1B59 A;  3COA C;  1WRJ A;  2NS0 A;  3M9A A;  1STZ A;  2QQA A;  4XQF A;  5L3C A;  3WTX C;  1LDJ A;  1ZLJ A;  2TCT A;  4I09 A;  3H0D A;  1IXR C;  1RR8 C;  1VND A;  2JSC A;  1Y39 A;  3HOY J;  3I9V 2;  1VQ9 I;  4RB1 A;  1Z21 A;  4YG2 F;  4FT8 A;  3KLN A;  3LFU A;  4HNV A;  2LRE A;  3FM5 A;  5E8I A;  3RQ4 A;  3HKZ N;  3DQV C;  3IAM 2;  2GZW A;  3K1P A;  2NOJ B;  2OD5 A;  2VQG A;  4LD5 A;  3BPV A;  1SVO A;  2ICW G;  2QA4 I;  2HYJ A;  3SXY A;  5JLW A;  4DW6 A;  3ZXS A;  2QBY A;  9ANT A;  1HBX G;  3JRE A;  2L9S A;  2XSD C;  3GLX A;  3ASO H;  2X6W A;  4C30 A;  1A6Q A;  4M6Y A;  1DU0 A;  2E2J J;  2BXY A;  3Q3S A;  5GAH J;  1NG6 A;  2DOE A;  3F3X A;  5IP7 J;  3H36 A;  2D1H A;  3G3Z A;  5JHU A;  2DU9 A;  1K6O A;  2ESH A;  4DJA A;  1R7J A;  1QZE A;  3E1S A;  2EZH A;  2HDD A;  1ZRC A;  4AIH A;  4BXU A;  2M30 A;  2DT7 B;  4U7B A;  4CDG A;  1Y1V J;  3E97 A;  3LSR A;  1VF9 A;  5IYB J;  3LSH A;  2DK5 A;  1FEX A;  4BJ6 C;  2ELJ A;  2JA7 J;  3BG5 A;  2P7C B;  2CJJ A;  3E3V A;  4P5O A;  3D5L A;  5F6F A;  2XF6 A;  3I5U A;  1FOK A;  2O0Y A;  1JKO C;  3CDI A;  4UVB A;  5E1W A;  4V2F A;  4B4C A;  3EUH C;  1JJ6 C;  1FNN A;  2QQ8 A;  1UHW A;  4F93 B;  1OYY A;  1Y1W J;  1TWH J;  2UXX A;  4XKV A;  5FB2 A;  2JUC A;  3BZ6 A;  5BPD A;  1E3P A;  3BC8 A;  1KZH A;  4EQQ A;  3U21 A;  4UB6 C;  1BI0 A;  4KDP A;  4PGH A;  4JQF A;  1LEA A;  3C2H A;  4M9X A;  2FOK A;  4A6E A;  2O8X A;  3M8J A;  4AVZ A;  3MN2 A;  1TW3 A;  5EGO A;  3FXJ A;  2GOM A;  3IV5 A;  5TIS C;  4CCO A;  3L2Q A;  4LK1 F;  2ZME C;  1S7E A;  4P9U A;  2FML A;  2DMT A;  3M8E A;  1E0E A;  4E6K G;  1BI3 A;  1MBE A;  4EAT A;  4G7O F;  1ENH A;  1OFC X;  1RKT A;  1T98 A;  4BE0 A;  1P9Q C;  4DIQ A;  5FLM J;  4X1E A;  3CO6 C;  1ZRE A;  2DTZ A;  1VQK I;  4LIT A;  1RC9 A;  1MJA A;  4Q47 A;  1W36 D;  3HUG A;  1F5T A;  2NVQ J;  3LAJ A;  1ZR4 A;  4CXF A;  4MFD A;  2E2I J;  2ZNY A;  4EM0 B;  2QVO A;  1K7A A;  1O3T A;  3HRU A;  4BEH B;  3KP2 A;  1U3E M;  2VQH A;  2DQL A;  4M3E A;  1SD6 A;  1ZAO A;  2E1M B;  1YJN I;  2KJC A;  3KX2 A;  1O3S A;  2CQX A;  4F91 B;  3L00 A;  4IQJ A;  3SFI A;  2E19 A;  2Z16 A;  2ME0 A;  1MMN A;  5JR3 A;  3R0A A;  3OS0 A;  2IA2 A;  1B8I A;  4L5I A;  5FRN A;  1IN6 A;  1WCM J;  1JJ8 C;  2M3A A;  3FMQ A;  1TWG J;  2PJP A;  1SVM A;  3J7Y J;  2E1N A;  2ZCW A;  3OY9 A;  1IV8 A;  2V7F A;  2XAG A;  3FMR A;  4CYC A;  2F2E A;  3P9I A;  2LP0 A;  1HOM A;  3OS1 A;  3TMO A;  1J09 A;  3TP0 A;  5DUK A;  3U1D A;  4L9J A;  5J8C A;  3S8P A;  1D1A A;  1TT0 A;  2IBD A;  4KT5 C;  3I0T A;  4M74 A;  4HST A;  4AD9 A;  4I6Z A;  3BRO A;  3LOC A;  4XRM A;  3N97 A;  1B72 A;  3CCV I;  2KIM A;  3I53 A;  3M07 A;  3FXQ A;  3JRG A;  3KET A;  2VN2 A;  1WJC A;  3OSF A;  1FIP A;  2ZXJ A;  3WHB A;  3I58 A;  2Z33 A;  2LY1 A;  4Q48 A;  2GA2 A;  5D8L B;  2L3D A;  3F8C A;  3S17 J;  4RB0 A;  2FEZ A;  4ZTJ A;  3CCU I;  1JTX A;  1N25 A;  4YII A;  5HDK A;  1LFU P;  4KIC A;  3HDD A;  2OQR A;  3U2R A;  2VJJ A;  2FBH A;  1QPM A;  1YTY A;  2OZU A;  1F4K A;  3RQI A;  5GPA A;  1XCB A;  2BZT A;  1V4R A;  3OIQ A;  1B4A A;  1UB9 A;  4RGU A;  4D1Q A;  3L7W A;  4ABZ A;  1FZP B;  2V1N A;  3FXM A;  2CW0 F;  3ABT A;  3DKX A;  3K2Z A;  4E7H A;  1O4X A;  1OKR A;  3HBL A;  1TZL A;  2CQQ A;  2CSO A;  3K69 A;  1EH6 A;  2B0L A;  5A2Q Z;  1EV7 A;  2JPB A;  3CDL A;  3KEY A;  1XGN A;  5DCM A;  5B3S H;  1P92 A;  1FY7 A;  4IL6 C;  1A5J A;  3GTK J;  3MVP A;  4OMZ A;  1XS9 A;  3GTL J;  4HRI A;  2Q2E B;  1X2M A;  3CCJ I;  2EZK A;  4NNJ A;  2WB1 N;  3LNQ A;  3TED A;  3J7A O;  3V8L A;  4LIU A;  2IVM A;  3V7S A;  2R0Q C;  4NDL A;  4YIR X;  4LLG F;  1IV6 A;  4HZF A;  3FHN A;  2R7U A;  4N9H A;  3R60 A;  4W1U A;  2V1D A;  1ETQ A;  2K85 A;  4UNO A;  1D8K A;  2H8W A;  1CF7 A;  4KYW A;  3D5R C;  1VQ4 I;  5KVR A;  3K4K A;  3TO6 A;  2EFQ A;  4MEY F;  2XHK A;  2VOP A;  5A2Q K;  4IEJ A;  3RTR A;  2RQP A;  2K86 A;  3T8R A;  1BOB A;  1WH7 A;  4PJL A;  1IN7 A;  1QU3 A;  1D0Z A;  4XN3 A;  1SAN A;  5C3E J;  4I2O A;  3A2K A;  1O3R A;  5CQE A;  3MWM A;  2ZJP F;  3EYY A;  4MIM A;  2DA1 A;  4OOI A;  4I0A A;  2P6T A;  3TL4 X;  1YJW I;  4I02 A;  3F21 A;  1BN5 A;  1D1B A;  1BC7 C;  4IHX A;  3K4N A;  2HQA A;  3L9F A;  4HBL A;  2EQR A;  3ZMD A;  4WX9 A;  2VT2 A;  4KN7 X;  3IRQ A;  4ZDP A;  1RET A;  4MGR A;  3N4M A;  2BV6 A;  4CGZ A;  1VQ8 I;  3IH2 A;  2VKE A;  4IPA A;  1ZG3 A;  4DBR A;  5IYD J;  4OU0 A;  3BJO A;  3S14 J;  1X2N A;  1U9N A;  3GW2 A;  4B3A A;  3TO7 A;  3PO2 J;  2DPU A;  4IHW A;  3GTM J;  1B72 B;  1E3H A;  2H1L A;  3ML6 A;  3FF5 A;  4XSX F;  3R61 A;  3KYD B;  3WG9 A;  4BJ5 C;  1OCP A;  3H9G A;  1JUS A;  1X3Z B;  4CCM A;  1TBX A;  3O2P E;  3CP8 A;  5F27 A;  1TNT A;  1PYV A;  4BE2 A;  4CH7 A;  4B3X A;  3SYT A;  1ZGJ A;  2Y2Z A;  3EQL F;  3FZV A;  2JA5 J;  3HHH A;  3TDZ C;  5CJ9 A;  2IS1 A;  4LGW A;  4XLP F;  4A5M A;  4ZH4 F;  1PVE A;  2VC1 A;  1ITY A;  3WTT C;  5EDN A;  1XDS A;  1ZG5 A;  4XOP A;  1MJB A;  2EFW A;  4GRI A;  2E2H J;  1YW7 A;  1X1D A;  2UXN A;  3ABL H;  5DUI A;  3OYB A;  1RUO A;  3CES A;  5E17 F;  3A02 A;  1G3Y A;  3I64 A;  4BS9 A;  3W6J B;  1NH3 A;  3QOD A;  2HTS A;  3S3N A;  2PMZ A;  3Q9V A;  2HWV A;  3CC4 I;  5CLS A;  5GP9 A;  2DI3 A;  5FKN A;  3HL2 A;  1NHA A;  1E2X A;  2FBK A;  3J80 Z;  4A3B J;  4L9T A;  4YFK F;  1JGG A;  2Q1Z B;  5KHD A;  4QSH A;  1W0T A;  4FE4 A;  3GTO J;  2ZME A;  3BQZ A;  5E3L A;  1XGM A;  3ZMU A;  4UUV A;  2FA5 A;  1DU6 A;  1YIJ I;  4IVN A;  2RVC A;  4HDU A;  3S1R J;  2UUZ A;  4MEX F;  4M3G A;  1KQ8 A;  2JRT A;  4MNU A;  4Z2Y A;  2Z2S B;  4A3F J;  2GIZ A;  3CP2 A;  1U6G A;  3HKZ A;  1FSH A;  4EGY A;  1LFB A;  3AG1 H;  5JI6 A;  4HLY A;  4E7L A;  1D8J A;  5IOZ A;  2GA1 A;  4E7Z A;  2R7S A;  1GXQ A;  3WE3 A;  4XLA A;  2EFP A;  3BG6 A;  2MH9 A;  1HF0 A;  4A3J J;  2NRA C;  1O7L A;  4BXX J;  1Z6T A;  2H8R A;  1G3W A;  3K1M A;  3F22 A;  1K61 A;  1JXS A;  4ZDL A;  2QLZ A;  5J8F A;  5J4V A;  4YIF A;  4CCN A;  1QQI A;  2VBY A;  4I98 B;  1UZC A;  4XN0 A;  3BR6 A;  2W25 A;  2HQN A;  1VQM I;  1V55 H;  4IHY A;  2BW3 A;  3JTG A;  2NAZ A;  4V19 K;  3OR1 C;  3AG4 H;  4UV8 A;  1Q1H A;  5IP9 J;  5DTD A;  1PUF A;  1LUJ B;  1U5T C;  2LBF A;  5ILU A;  1R4N B;  4FCY A;  1F1Z A;  1ETY A;  1A31 A;  2IRF G;  3NRV A;  3MEX A;  2HVR A;  4L0Y B;  2MC4 A;  1WFX A;  2VC0 A;  1XTA A;  1R00 A;  3VYS B;  3DTK A;  5J4Y A;  2F48 A;  1J5Y A;  3SQN A;  5F0H A;  3JTH A;  1K79 A;  4C3H J;  1A6I A;  3IP4 B;  3PSF A;  2IGK A;  2R7X A;  2WTE A;  3ECH A;  1X3W B;  2DK8 A;  1B9M A;  1ZTR A;  3DEU A;  1R9T J;  2KP6 A;  3HRS A;  3ZQQ A;  4HSR A;  2EJR A;  1TT5 B;  1MBF A;  4PJJ A;  1BM9 A;  1B9N A;  1K78 A;  2L4M A;  3TGN A;  4HPQ A;  2DYR H;  3K70 C;  4RBO A;  5HNF A;  3OYN A;  1EH8 A;  2X6Y A;  1WJE A;  3BLY A;  1XSV A;  5E1Z B;  3G1O A;  4CCL A;  4QPO A;  3E6C C;  1VZ0 A;  1IUF A;  1I27 A;  2ZXW H;  3HG9 A;  3K4M A;  4BE1 A;  4A3E J;  3I4M J;  1WQ2 A;  5ICE A;  5K5O A;  2BVM A;  2ID6 A;  1YX3 A;  2XGC A;  1YQA A;  4LIV A;  2DCE A;  2GLO A;  3FBI B;  2X0L A;  1QHH D;  4M71 A;  4OIQ F;  1IXS B;  3M1E A;  1K83 J;  2KIS A;  3HPG A;  3KP3 A;  5KNL A;  1HKT A;  2XPW A;  2IS4 A;  1VQN I;  3FK7 A;  2YX4 A;  4Q4Z F;  5BPI A;  4HG2 A;  3F0C A;  4BEH A;  1CGP A;  2DA2 A;  2M5W A;  5L3F A;  2XF5 A;  3RKX A;  2JK3 A;  2JQ7 A;  1EH7 A;  2JT1 A;  2NVX J;  4ENJ A;  2YS9 A;  2IS6 A;  3ZCO A;  2XPV A;  4BH9 A;  2XAH A;  4U87 A;  3HHG A;  2FXA A;  4U7D A;  1MNE A;  2BBY A;  1GDT A;  4KNY A;  1YI2 I;  4J19 A;  5FD5 A;  1FIA A;  3WTZ A;  3J81 Z;  3MAJ A;  4BNC A;  1MBH A;  1R5I D;  3VYU B;  3ZQH A;  3GZ6 A;  1XSD A;  3DPT A;  2JA6 J;  4F52 A;  5ERI A;  4ANJ A;  1SAX A;  2IGM A;  3DV8 A;  3FXU A;  4UUT A;  2M87 A;  2R5Y A;  2XAU A;  3HOU J;  1U5T B;  1BR1 A;  2QKL B;  3MCZ A;  3D5S C;  1KA8 A;  4LG0 B;  1AWC A;  2EIJ H;  3HRT A;  1IDY A;  4UHT A;  1UST A;  3SZP A;  1RPW A;  2V6E A;  3PNV A;  3REO A;  2NS8 A;  1A04 A;  2JZY A;  1Z3Y A;  3KP6 A;  2VKD A;  4XID A;  3CO7 C;  1W5T A;  5C4X J;  4BAY A;  1QZZ A;  4XLE A;  3W2V A;  4Y7N J;  3S2H J;  2HOE A;  1GUU A;  4BHP A;  3KP5 A;  2VKV A;  3K10 A;  2L9V A;  2K27 A;  2LF7 A;  5TJJ A;  1TW2 A;  3CMM A;  1TWA J;  3SHF A;  1T95 A;  1FP1 D;  3H5N A;  1R22 A;  3OIO A;  1IGN A;  2QKM B;  3VFZ A;  2OQG A;  3DCF A;  2GXG A;  2KKO A;  3A03 A;  5EEH A;  3ZN0 A;  1K78 B;  5H6Q A;  3C2B A;  4KFC A;  3QWL A;  4E7J A;  2P5K A;  1FOX A;  2HKX A;  3I54 A;  5GTI C;  5EF6 A;  1JHH A;  1WKM A;  2G7U A;  1W7P B;  1LJ9 A;  3BZK A;  1FYM A;  5HVQ C;  4HX4 A;  5JVG F;  2ZJQ F;  1TP4 A;  4LMY A;  4XIC A;  3D1N I;  1DPR A;  3HPH A;  1V54 H;  1JUM A;  2K7L A;  1RRJ A;  2HKO A;  1R5H A;  4XSZ F;  5IP6 A;  2NOG A;  4FTH A;  1ZH5 A;  4L5E A;  5FFX A;  4O5V A;  2X1E A;  4S05 A;  3WTY C;  3K9T A;  5HLH A;  2VXD A;  5J1R A;  3OL3 A;  5C44 J;  4I01 A;  3CUO A;  1GV2 A;  4AIK A;  3WGG A;  2P7V B;  3OYJ A;  4OIP F;  4EVI A;  2IXS A;  2PEX A;  4QTR A;  1XMK A;  3B6A A;  1XC5 A;  4E7S A;  3F9K A;  2X51 A;  1KU3 A;  5L3E A;  2V79 A;  4M6V A;  1YX5 A;  3ZQ7 A;  3DBL B;  2GWR A;  3HGY A;  5LEK A;  2HEO A;  4IHS A;  3GTP J;  2LRD A;  2L7K A;  4KMF A;  3M7G A;  1YG2 A;  3DU5 A;  2DA7 A;  3TKY A;  1I3A A;  4A2U A;  3B6C A;  3ERE D;  2FSW A;  3FIW A;  1SD4 A;  3CCE I;  3Q0W A;  4DQ2 A;  5H2F C;  1BJA A;  1TQI A;  1FYL A;  1UHM A;  3OV8 A;  1T56 A;  5HOO A;  4ZTF A;  2STW A;  3BCA A;  3VB2 A;  3OYH A;  2R7W A;  2V1U A;  1I5Z A;  4JK1 X;  3H92 A;  1REP C;  2PFB A;  1ZYR F;  2BHZ A;  1Z9C A;  1YO5 C;  2DO7 A;  4Y17 A;  1Y6I A;  4C2T A;  3TBI A;  2KRH A;  4H4K C;  3V8J A;  4QPQ A;  3DXJ F;  2HTJ A;  3VYT B;  3WU1 B;  1MZB A;  2OTJ I;  3PIP F;  3S2D J;  2X48 A;  3R4K A;  2H6C A;  1R71 A;  1OLT A;  1Z3X A;  2AXT C;  1CQT A;  1BL0 A;  3OYG A;  4IHV A;  5M5X J;  2EIM H;  4DYQ A;  2XC7 A;  2COM A;  4IRH A;  2DA6 A;  1USS A;  5LHG A;  3FXL A;  2M7A A;  3IH4 A;  2F5V A;  2DYS H;  2W57 A;  2HPI A;  2K9S A;  3HGG A;  3JRC A;  1Z67 A;  1T38 A;  2JA8 J;  3OYL A;  3I55 I;  2CMP A;  4DZJ A;  5TGT A;  2XAQ A;  2M2E A;  3BG3 A;  4DGW B;  2OCC H;  3CJT B;  5JFR A;  2STT A;  4XOR A;  3K4L A;  2HOT A;  2CG4 A;  2QYO A;  4PJM A;  2CUZ A;  2HZD A;  3MFK A;  3W6V A;  4JBA A;  2PMH A;  4C9Y A;  1OCO H;  1R5G A;  3GFM A;  1TTY A;  1PUE E;  3BG9 A;  4B1R A;  5F1J A;  2BHY A;  5E3N A;  1YE9 A;  2A3S A;  1I50 J;  4WXD A;  2QZ8 A;  4LLL A;  2JWT A;  4CYD A;  4XR6 A;  2MLK A;  3EDP A;  4NQW B;  1MDM A;  5E1X A;  3H3U A;  3F8B A;  1FP2 A;  1WI9 A;  5ICC A;  2XGX A;  4OAZ A;  4W97 A;  3EPZ A;  4I76 A;  2I8D A;  2E7X A;  2XGE A;  2HOA A;  2L54 A;  1W5C C;  3AG3 H;  3LWF A;  4CSW A;  3FM3 A;  1AKH B;  4L18 B;  1QPI A;  2IGN A;  3QP5 A;  2CW8 A;  4D5C A;  2E5Z A;  1Z7L A;  1VI0 A;  2CUF A;  2CU7 A;  3IUO A;  4M3F A;  3OL4 A;  4JX4 A;  4XKC A;  4HLX A;  1KQ9 A;  3RYP A;  3QYB A;  1QHG A;  3CZ6 A;  2AS5 F;  1WJ5 A;  3IWF A;  1MBJ A;  2RAE A;  3MQ0 A;  2O9L A;  2X9D A;  3RIR A;  3TP3 A;  1IRX A;  2IP2 A;  3PUF A;  3ONQ A;  2ZFU A;  3WG7 H;  3KIO A;  1IF1 A;  4ZYA A;  1NK3 P;  2UZK A;  2JRM A;  1LPQ A;  2HYF A;  5FKL A;  5TRD A;  5KK1 A;  1BA5 A;  3LFK A;  2VQC A;  5FRM A;  1G2H A;  3DLL F;  5LLQ A;  2F5C A;  2LG4 A;  2BY1 A;  4NC6 A;  4A3D J;  2MBF A;  1MBK A;  3DBH B;  3KLO A;  2WBM A;  2CO5 A;  2RV8 A;  4BHC A;  2P0W A;  3PFI A;  4UVC A;  3VOE A;  3KYC B;  1SD5 A;  4NBQ A;  4A12 A;  1ZLK A;  2EIL H;  2W82 A;  1QVT A;  4Z6Y A;  5D5X B;  1FSE A;  1MSF C;  4G7Z F;  4HV6 A;  2ZSH B;  2GM4 A;  2M8G X;  2Z99 A;  1M1E B;  1HDP A;  3KZY A;  1D5Y A;  3RKW A;  3SZG A;  2XAS A;  1Z1D A;  4YEJ A;  3JAM K;  1R49 A;  1FPQ A;  3ZPL A;  3HRM A;  4UB8 C;  2OV7 A;  4P1W A;  3RJP A;  4FET A;  3RYR A;  4HQM A;  3IL2 A;  2YU9 J;  2IEK A;  2EIN H;  2A6T A;  3UR3 C;  1L3L A;  3K7A J;  1VQ6 I;  2QCO A;  5F04 A;  2YX7 A;  1SFK A;  3QU6 A;  2P4W A;  1QA6 A;  1P7I A;  2ID3 A;  4IOC F;  1AOY A;  2EZL A;  2KZG A;  3EYI A;  3CCM I;  3CJR B;  3JSP A;  4BUP A;  1ACI A;  2M45 A;  4AU7 A;  4BHB A;  2X85 A;  3BCB A;  3KZZ A;  3CDH A;  2DXI A;  2L7Z A;  5M5W J;  2DMN A;  2K02 A;  2GXB A;  1NG7 A;  2HS5 A;  5K5Q A;  4EJV A;  3LA2 A;  3HOV J;  4BQO A;  4DNC A;  3HOS A;  2R7Q A;  2MSY A;  3FHZ A;  5IOY A;  2X6O A;  2XKP A;  4CZZ A;  2MH2 A;  3E6D A;  3A1Y A;  3E0J B;  1QGP A;  4BXF A;  4PDK A;  3GWZ A;  3OR2 C;  1MDM B;  1IG7 A;  1RUN A;  2XGD A;  5FGM A;  3E5U A;  2QSH X;  3O8H A;  1Z77 A;  5LGU A;  1O57 A;  3WGH A;  1SFU A;  4MQV A;  1MD0 A;  1Q1V A;  3DLA A;  3LMM A;  2IAI A;  4BGD A;  2A5W A;  4KIB A;  2NXN B;  5EZG A;  5FLX K;  1IN4 A;  3FX3 A;  3CF5 F;  2D45 A;  2ADU A;  4DYR A;  2L2O A;  1QVU A;  4ZYE A;  3HSE A;  5LEJ A;  2MAB A;  4GO1 A;  3ZR8 X;  4IRI A;  1FC3 A;  4MQ9 F;  1BI2 A;  1DP7 P;  2XV4 S;  3DFG A;  5E3M A;  3U1K A;  3K1N A;  3F8N A;  3GZ5 A;  2A68 F;  5D6F A;  4G6Q A;  3R0J A;  2ZC2 A;  1OCZ H;  1ETO A;  1P4A A;  5JHF A;  3L2W A;  1OIS A;  2VPL A;  1J9I A;  4RDU A;  1OPC A;  4Y3O A;  3ASN H;  3I4P A;  4RS8 A;  2WV0 A;  3VYR B;  1ZG1 A;  2LVS A;  2H27 A;  1BR4 A;  1OQY A;  3C1D A;  2EFN A;  1YW9 A;  5AON A;  2YR2 A;  1EJ9 A;  4E7I A;  2EV5 A;  3NWS A;  2VJ5 A;  2YSR A;  4LK0 F;  5LGN A;  1ZRF A;  4QIW N;  3RI4 A;  2M34 A;  1IN8 A;  3W2A A;  4YFN F;  1IRZ A;  2Y30 A;  3QP6 A;  2CFX A;  1YJ9 I;  3BJ6 A;  1HW1 A;  2E36 A;  4RA2 A;  4HNT A;  4A3G J;  3HTU A;  1AHD P;  1X19 A;  4ON0 A;  4AYB A;  1W5S A;  2LD5 A;  1MSE C;  2O03 A;  5DCF A;  2DFH A;  5B1B H;  3J7Z I;  2EK5 A;  2FOW A;  2IGO A;  3M8F A;  4KIS A;  1PP7 U;  3A0B C;  3JRD A;  3PSI A;  3S32 A;  5D8K B;  2H94 A;  1GLN A;  3FDY A;  2MGQ A;  4HA8 A;  3OMY A;  2ZB9 A;  4RB2 C;  1P2F A;  2HXI A;  5J47 A;  3LSI A;  4F3Q A;  2DDA A;  4E7K A;  1B8I B;  1W0U A;  4HX8 A;  2E71 A;  3F6O A;  2FRH A;  3JW4 A;  3ELK A;  4M3D A;  2P8T A;  2R93 J;  3F8M A;  2KT0 A;  4MO7 A;  1DP3 A;  2L7M P;  2Y69 H;  1X4P A;  4M9S A;  3IKV A;  2WAD A;  2FU4 A;  4ETS A;  4WCG A;  1HC8 A;  4IJA A;  5E20 A;  2V4J C;  1JT0 A;  3V7C A;  1GV5 A;  3E5X A;  1XGO A;  2ELK A;  4D9J A;  4O6J A;  2AO9 A;  5DV5 A;  3JRB A;  2OU2 A;  4RLQ A;  2UWM A;  4QLC U;  3KE2 A;  3KEO A;  2Z1D A;  4CUG A;  5LBQ A;  1FMV A;  4ENN A;  4IRG A;  3W3C A;  4DOZ A;  3NAU A;  1F9N A;  2MW8 A;  3Q0V A;  3BTI A;  2DTR A;  5CVV A;  2J5P A;  3KPH A;  1I6H J;  1BW6 A;  2X4H A;  2M4K A;  2HR3 A;  4BQQ A;  4GFB A;  3RPU D;  5EZH A;  2V9K A;  1TL8 A;  3KZI C;  4HEA 2;  4D7M A;  4B48 A;  5HLG A;  5EG0 B;  3ABM H;  1T0F C;  5HDG A;  2HI3 A;  4L0Z B;  1BW5 A;  5D4S A;  1S29 A;  3TW6 A;  4HNU A;  4R8H A;  3C3W A;  5EYR A;  1WVR A;  3CCR I;  2PMZ N;  3KP7 A;  3K4B A;  1IDZ A;  3HXL A;  1RNL A;  1S3J A;  1V3F A;  3D0S A;  2KJB A;  5CVR A;  5DM7 F;  3I56 I;  2F4M B;  3TQN A;  3K0L A;  3B73 A;  3RZD J;  3IH3 A;  5KAF C;  4U0V A;  1JE8 A;  1RR7 A;  2VB6 A;  5AIP A;  2RDP A;  3BTL A;  1UCR A;  2Y75 A;  4RGS A;  2VON A;  1OR7 A;  3WTU C;  3KCC A;  4XLN F;  2FNA A;  4LB5 A;  2QM3 A;  1DQU A;  3IHU A;  1RIO H;  2FQ3 A;  5AIQ A;  4R1H A;  3QPH A;  3J81 K;  2L0K A;  1J2X A;  4PJ0 C;  4EJU A;  2VLA A;  3GLL A;  5ILS A;  3CUQ A;  1FTZ A;  2DQR A;  3JCU C;  3V8K A;  1ZRD A;  2E1O A;  1XDU A;  3JAM Z;  1ZHF A;  3ZQI A;  2A07 F;  3S1Q J;  2ZBK A;  3OYK A;  3ERM A;  1LDD A;  3GEZ A;  2BY2 A;  4E4H A;  3L09 A;  2DDB A;  3ZQF A;  4NUB A;  3LSM A;  1HKS A;  3TO9 A;  1MH4 A;  4C3J J;  5DM6 F;  3DBR B;  4OWR B;  2HQ5 A;  1LDK B;  1IXC A;  4IHT A;  1T33 A;  3S16 J;  4ZC3 A;  2M4G A;  3G1M A;  3OYI A;  1U78 A;  3W2W A;  2QQ9 A;  4J01 A;  1J59 A;  2X1C A;  4OMY A;  3CCQ I;  2PJR A;  2PBI A;  5EJC A;  1FBU A;  2LMD A;  3LST A;  3RKQ A;  2DOD A;  1YIT I;  3ULQ B;  4HX7 A;  2I5U A;  4PGG A;  2CGP A;  2LSO A;  1CF7 B;  4UXN A;  5K5R A;  1QZY A;  5HLI A;  3QPS A;  3J80 K;  1SEU A;  2R92 J;  4EGZ A;  3CF2 A;  1K4T A;  1MIJ A;  4CHU A;  3G6E I;  1PDN C;  3KEQ A;  4RLF A;  1QRY A;  1JI8 A;  2L5Q A;  3ISP A;  1GT0 C;  3FXR A;  2RQQ A;  4JOM A;  1X3U A;  1HW2 A;  1RES A;  2KHM A;  4DZP A;  3WTW C;  2QEX I;  5FO5 A;  2CQ7 A;  1HW5 A;  2F6C A;  1YW8 A;  1Y8R B;  4P9F A;  4IXA A;  2CW7 A;  2DA5 A;  4A0X A;  1JKQ C;  2CYY A;  4LG3 A;  3OS2 A;  1YIO A;  2KRF A;  2KL4 A;  1ON1 A;  2K9M A;  3DTI A;  3BPX A;  2OCE A;  1TQP A;  2R7R A;  1WJB A;  1X1B A;  2VBZ A;  5GAG J;  3NAR A;  3CMY A;  5DS9 A;  1H0M A;  2L4A A;  1OCT C;  1IZ1 A;  2Y31 A;  2V6C A;  2IA0 A;  1G3T A;  2G0E A;  3HC7 A;  2VAS A;  3KFW X;  2QQB A;  3U9G A;  3SEZ A;  2HQR A;  3CLO A;  3L2R A;  1WGX A;  1UEL B;  1U8R A;  3S1N J;  3FXK A;  4I0B A;  2XKO A;  5FKK A;  2R3S A;  3JRI A;  4X0G A;  1XMX A;  2R7O A;  2QWW A;  3ECO A;  1BI1 A;  1X58 A;  2BY3 A;  2O7O A;  2YU3 A;  4GGG A;  4II3 A;  3HSF A;  4D5F A;  1OMI A;  4X6A J;  1SD7 A;  3WE2 A;  3I71 A;  1VQ5 I;  4ESF A;  2E5N A;  2HOS A;  1OCR H;  5DDG A;  3ZMV A;  2NNN A;  3N05 A;  3KYL A;  2O61 A;  4EM1 A;  1J0R A;  2E34 A;  2BGC A;  3ABU A;  3E6B A;  1N78 A;  2LKX A;  4M9Z A;  2DW4 A;  2WC2 A;  2M0C A;  4B44 A;  4CIC A;  4XLC A;  1XGS A;  3LL7 A;  1MGT A;  1XPX A;  1IUY A;  1PUF B;  1D0Y A;  3VOD A;  2M0M A;  2ZO4 A;  1ETX A;  4U0Y A;  1TWF J;  2KDZ A;  3AL0 C;  1ERD A;  3VSL A;  1EKE A;  2A6E F;  2R7T A;  2DA4 A;  2DOF A;  1R23 A;  1LE8 B;  2QGU A;  2W4S A;  4CCJ A;  2Z9O A;  3DU6 A;  4IF4 A;  4UY8 I;  4HF0 A;  4A3I J;  2XDV A;  4J00 A;  2LDU A;  2RN7 A;  5E18 F;  4WF2 A;  3HOZ J;  2RGV A;  2VOD A;  2OAZ A;  3CUQ B;  3ZMT A;  1LVK A;  5K7H A;  5FLX Z;  3PJR A;  1MMA A;  3HM5 A;  1W36 C;  3M3Y J;  4BKX A;  1ZR2 A;  2MLG A;  2RC4 A;  4AVP A;  4RAY A;  4N4O B;  2FMY A;  2JJ7 A;  1X1C A;  3CMA I;  2OC6 A;  1R1U A;  1LNW A;  4DBQ A;  2GQQ A;  2W85 A;  4A0Z A;  2ZXI A;  2BY0 A;  2VI6 A;  4BJT A;  2EV6 A;  3I59 A;  2NS7 A;  2FBI A;  3HZJ A;  3PNT A;  1MMD A;  1FX7 A;  3P9C A;  1FJL A;  1FLI A;  3P9K A;  3DF8 A;  3BOQ A;  4C2M J;  4XOT A;  1SAU A;  2DA3 A;  2YUS A;  2CUJ A;  1L0O C;  1VQL I;  1KU2 A;  2PMU A;  2R7V A;  1R6R A;  1C0W A;  2W24 A;  4P96 A;  4YEL A;  2EBI A;  1FWZ A;  2EIK H;  2CV0 A;  2QSG X;  4GYI A;  1S5L C;  4ZZL A;  3FWE A;  1AA7 A;  3QYF A;  2KZV A;  4AIJ A;  2M1B A;  3QYE A;  4G6T B;  1T6S A;  3MKL A;  2FD5 A;  1Y0N A;  4G12 A;  3MZ8 A;  4RGX A;  2HXO A;  4OIN F;  2LYC A;  4BAC A;  1H9G A;  2ZFW A;  3ROU A;  3OYA A;  3HOW J;  3K4J A;  4RAF A;  3EUA A;  2ECB A;  1T0F A;  1IW7 F;  1K6Y A;  4UUS B;  3PQK A;  2K4J A;  4WK8 F;  4EM2 A;  2LR8 A;  1N77 A;  2LBF B;  1JGS A;  4L5J A;  4PFO A;  2KIQ A;  3DEE A;  3FK6 A;  1Z05 A;  2MA3 A;  3E6M A;  3AAF A;  4F55 A;  1S9H A;  2L01 A;  1S72 I;  1O3Q A;  1DPU A;  4BL0 B;  2BE5 F;  2E35 A;  2VE8 A;  2HVS A;  2K9Q A;  3OYF A;  1KU9 A;  3ZQL A;  2B63 J;  1S7A A;  3LQR A;  5EG0 A;  2J5O A;  2Z3Y A;  3JRA A;  4WWC A;  2NNY A;  4AM3 A;  3ESW B;  3G4S I;  2GBY A;  4A5N A;  4PUS A;  1GVD A;  2JSP A;  3OSG A;  1XX5 A;  1GVJ A;  4XMY A;  1SFE A;  1T8I A;  2HZT A;  2K4B A;  2R5Z A;  1R1T A;  3WTV C;  1WJF A;  3BQY A;  4XON A;  3JSO A;  3PO3 J;  1HXD A;  4R79 A;  3K70 D;  1G8X A;  1KON A;  1UJ8 A;  3CC2 I;  2G7H A;  1DGW Y;  1YS6 A;  4XRF A;  5F08 A;  1V5E A;  4KT6 A;  4H0E A;  2L9N A;  1HCR A;  2F5F A;  2CQK A;  3QPL A;  4N9I A;  3GFI A;  4M72 A;  2OJE D;  2DFF A;  2XVC A;  3PNY A;  3QPT A;  1ETW A;  2B7E A;  2JN6 A;  2HFH A;  1ZN2 A;  1G6N A;  1JTY A;  2QSF X;  5CVJ A;  1V5G A;  1WHU A;  1B6A A;  3F23 A;  4B8X A;  2MFZ A;  5DEQ A;  1JUP A;  3V4G A;  1X1A A;  4G7H F;  5EEG A;  2R5Y B;  4A3C J;  1GHC A;  1FTT A;  1G59 A;  2F5E A;  4FQG A;  3A4C A;  2ETH A;  3SFZ A;  2PG4 A;  1VQO I;  3C7J A;  1FOW A;  2L9R A;  5IT9 K;  2V9V A;  5F0C A;  5KCM A;  2D5V A;  3GXO A;  2VKH A;  2W84 A;  3LSK A;  3LA3 A;  3IKT A;  2P81 A;  4ZYD A;  3PUB A;  3PM1 A;  3BR1 A;  5ILV A;  2XB0 X;  2X6X A;  4IO9 F;  1XN7 A;  1UMQ A;  2HPM A;  1U8B A;  4L9V A;  2PX9 A;  1OJL A;  4ESB A;  3GFL A;  1R36 A;  2W1O A;  4Q5S F;  2QEN A;  3K4C A;  2BEO A;  5CVU A;  5K7Z A;  1NTC A;  2DAO A;  4A3L J;  2BYV E;  3BR5 A;  1O7F A;  2E1C A;  3QOP A;  3DEW A;  1H9T A;  2DMU A;  1D1C A;  2LFB A;  3HB9 A;  1MW7 A;  4BBR J;  2OTL I;  2RNG A;  3WOD F;  2MD0 A;  3QRF F;  3ZQG A;  3VWB A;  3GTG J;  1I6X A;  5J1Y A;  2XSJ C;  4HDV A;  1T2K A;  3GBG A;  3V42 A;  2XRO A;  2EFO A;  1OR7 C;  2L02 A;  4OIO F;  3G2B A;  3OOP A;  4OIR F;  3GCM A;  4WXH A;  3F72 A;  3AL0 B;  2VT3 A;  5IT9 Z;  2Q0O A;  3JR9 A;  2ACJ A;  3MKW B;  1LVA A;  4ZDO A;  1E3O C;  3H0G J;  3J7A Y;  5CPR B;  3A0H C;  5LHH A;  5IPA A;  4ENM A;  3CLQ A;  5M5Y J;  2WA0 A;  4HF1 A;  4NC7 A;  1DUX C;  2XAJ A;  1BOA A;  4Y33 A;  5BNG A;  2A69 F;  2L7F P;  5D5V B;  4A6D A;  4WXC A;  1HQC A;  3BZC A;  3HEF A;  4M73 A;  1U2W A;  5KAI C;  2QF7 A;  3CTA A;  5H20 A;  5M3M J;  4FX4 A;  2KIU A;  3C18 A;  2P6S A;  3L2U A;  2Z5U A;  3H9Q A;  5FLV A;  2EH3 A;  4HV5 A;  1TWC J;  2DBB A;  2X1D A;  1BJZ A;  2LNB A;  4EJO A;  5FD6 A;  2A61 A;  1RZ4 A;  3ABK H;  5J1U A;  2C6Y A;  4PJN A;  1UFM A;  3O8G A;  2V26 A;  4PSW A;  4S04 A;  2EV0 A;  1XB4 A;  2ZXH A;  4NQW A;  1QO0 D;  3C2G A;  4B47 A;  2Y0M A;  4DYC A;  2VOO A;  1F43 A;  3LAP A;  5FKO A;  4F92 B;  3VEP A;  2KQR A;  3BTC A;  5FRO A;  4AYB N;  5ED4 A;  4EJW A;  1W7P D;  2KDO A;  3BDD A;  3HYI A;  2OUM A;  1S7O A;  2BVL A;  2K5C A;  2K3F A;  1Z7U A;  3ZN1 A;  2CV2 A;  4Y13 A;  3G1L A;  1YRN A;  1D5V A;  1ZGA A;  3WGI A;  2WAQ N;  3ZQC A;  1HLV A;  3NQO A;  4CZC A;  5K1Y A;  3H3V K;  1KQ0 A;  2XB5 A;  1XD7 A;  3CCY A;  4MTD A;  2XRN A;  3CJN A;  1XSX A;  4LLN A;  4KJZ A;  4JX5 A;  1ZQ3 P;  2XRL A;  3MD2 A;  5J40 A;  3R6S A;  5J3L A;  3ZRG A;  1WZ2 A;  3SZT A;  5LHI A;  3GTQ J;  1IO2 A;  3H3Z A;  2LK2 A;  3E5Q A;  3IAS 2;  2MG4 A;  2Y48 A;  5CKT A;  2BXZ A;  4G6D A;  2O8K A;  2Y0S N;  4C3I J;  3A01 B;  3GZN B;  1ON2 A;  1HSJ A;  2JTV A;  2ZJ2 A;  1W1W E;  5DCM B;  5CVI A;  3BJA A;  2LY2 A;  5LRR A;  3CC7 I;  2A5Y B;  3DTE A;  1VQ7 I;  4AC0 A;  3MZH A;  1V5F A;  1MJ9 A;  2GAU A;  2KPM A;  5L3D A;  4XBF A;  4IKF A;  3HUG B;  4MFE A;  1QNT A;  2GOX B;  3GYH X;  3PQJ A;  1XMA A;  2DLL A;  2Y0S A;  1PP8 F;  4PZJ A;  1MH3 A;  2M8E A;  1ULY A;  4ITV A;  3FKI J;  2TRT A;  1P6R A;  2JVG A;  1HKQ A;  2P5V A;  1KYW A;  1YS7 A;  4NC8 A;  4F7Z A;  1H89 C;  4M6X A;  2KLO A;  2HDC A;  2W7N A;  2RNJ A;  1JT6 A;  5CQG A;  4RAZ A;  4YRV A;  3GF2 A;  2IJL A;  4RB3 C;  3OYC A;  4IQ4 A;  3JRH A;  3VDX A;  3CME I;  2OA4 A;  4XRS A;  3HIF A;  1HST A;  3GME A;  3CCS I;  3M1C A;  1HA8 A;  4U0W A;  1BIA A;  2WAQ A;  4BQN A;  4FE7 A;  2PJR B;  5K7F A;  3WHC A;  2LLK A;  2OPT A;  4U88 A;  3FBN B;  3GX4 X;  1Z0X A;  2K9N A;  2BW3 B;  2LTP A;  4K2E A;  5FFZ A;  4S0H B;  1I1G A;  2COB A;  1AU7 A;  3K2A A;  1R58 A;  5FKM A;  2A6H F;  4FX0 A;  2ZNZ A;  1BBY A;  2HDW A;  3BT9 A;  4ESJ A;  1N75 A;  4IX7 A;  3Q0U A;  1A36 A;  3G71 I;  2IPQ X;  4D7N A;  3ZMS A;  3F6V A;  3TDU C;  2E60 A;  1I1S A;  1U0J A;  4JYK A;  4BQA A;  3DPU A;  3H1C A;  5B1A H;  2ISZ A;  1S6L A;  1LB2 A;  2IS2 A;  5HDN A;  5HS7 A;  3GFJ A;  5E3O A;  5DD4 A;  5DD8 A;  3BR3 A;  4RM3 A;  4JX6 A;  1ORK A;  4HW0 A;  4OAY A;  3L2C A;  1ETK A;  1LE8 A;  2OBP A;  2WWY A;  2V9P A;  1A35 A;  1POG A;  1IRG A;  1XCV A;  3NWT A;  2PQ8 A;  3G73 A;  4UV9 A;  5CYV A;  1X1P A;  2VIX A;  3EUK L;  3QQA A;  3TOA A;  2DT5 A;  1Z91 A;  2F4I A;  4XLH A;  2WY8 Q;  3I3L A;  5ICG A;  1WJA A;  3CUQ C;  3OOU A;  2CH0 A;  2CUE A;  3A01 A;  2DT6 A;  2CFO A;  1G3S A;  4XKB A;  3LQQ A;  2HYG D;  1LQ1 A;  2VL8 A;  3RCO A;  4V2G A;  1DGR M;  5GPC A;  5ICF A;  4HQE A;  1VTN C;  2RKH A;  2VBW A;  4Y52 J;  3BR0 A;  2VBX A;  1T08 B;  4XKW A;  4KIT B;  2H09 A;  1LEB A;  3S15 J;  3DWL E;  2TDX A;  3CD6 I;  2F5D A;  2CRG A;  2EWN A;  3HTS B;  5LFA A;  2FF4 A;  2JUG A;  4II2 A;  5D4R A;  3DKY A;  3X2Q H;  1KGS A;  2BOL A;  2DJN A;  1YHQ I;  2PLY A;  1MND A;  4KUM A;  2H6B A;  3O6B B;  2UV1 A;  4XM3 A;  1EA3 A;  4KN4 X;  5F64 A;  3OYD A;  1G4D A;  2NVT J;  2W00 A;  3AKZ A;  4ZZD A;  4MHG A;  3MZY A;  5IYC J;  1PJR A;  3TW7 A;  1LFP A;  5FJ8 J;  3S3M A;  2NVY J;  1H8A C;  4YFX F;  2AQF A;  4IZZ A;  3OWT A;  2CS3 A; 
#chains in the Genus database with same CATH homology
 2VJJ A;  2OF7 A;  4A3I J;  3RQI A;  3BG9 A;  2XDV A;  5GPA A;  4B1R A;  5F1J A;  2EZI A;  1HDD C;  4J00 A;  3OIQ A;  5E3N A;  4XL9 A;  4F92 B;  1YE9 A;  4D1Q A;  1I50 J;  3HOZ J;  3AFH A;  4ABZ A;  3MKY B;  1NK2 P;  2V1N A;  1LVK A;  2JWT A;  4XR6 A;  3DKX A;  3FIS A;  5K7H A;  1O4X A;  1ZK8 A;  4E7H A;  2W48 A;  3HBL A;  1TZL A;  2CQQ A;  4NQW B;  3PJR A;  4JP0 A;  1MMA A;  3HM5 A;  2JA2 A;  1W36 C;  3M3Y J;  3CDL A;  4BKX A;  4OAZ A;  4W97 A;  2AQE A;  3KEY A;  2VPR A;  4I76 A;  1ZR2 A;  2FUG 2;  2I8D A;  3EPZ A;  2XGE A;  2HOA A;  2HVS A;  1A5J A;  3GTK J;  3MVP A;  2XF7 A;  3LSP A;  4CSW A;  1Y56 A;  1XS9 A;  3GTL J;  1AKH B;  4N4O B;  2Q2E B;  1JKP C;  1QPI A;  2JJ7 A;  1IJW C;  1X1C A;  2IGN A;  4D5C A;  2CW8 A;  1X2M A;  2E5Z A;  1Z7L A;  2OC6 A;  4DBQ A;  1VI0 A;  2CUF A;  2CU7 A;  2EZK A;  3OYM A;  3LNQ A;  2WB1 N;  4M3F A;  4JX4 A;  3IUO A;  3TED A;  3OL4 A;  4NNJ A;  4XKC A;  2ZXI A;  2VI6 A;  3SJM A;  4LIU A;  3QYB A;  4BJT A;  1QHG A;  3CZ6 A;  2NS7 A;  1WJ5 A;  3PNT A;  1MMD A;  1MBJ A;  2RAE A;  4CYC B;  2R0Q C;  4NDL A;  2X9D A;  1FJL A;  3TP3 A;  2O9L A;  3UKG A;  1IRX A;  1IV6 A;  3ONQ A;  2ZFU A;  1P7J A;  1NK3 P;  2R7U A;  4C2M J;  3FHN A;  4ZYA A;  2WV1 A;  4BDZ A;  4XOT A;  1UAA A;  2M7B A;  4W1U A;  2DA3 A;  1WPK A;  1ETQ A;  5FKL A;  1SAU A;  3QOE A;  2YUS A;  3VSK A;  2CUJ A;  1UHS A;  1BA5 A;  3K6G A;  2VQC A;  5FRM A;  2WY7 Q;  1R6R A;  1G2H A;  2WAF A;  3D5R C;  2R7V A;  2FX0 A;  3K4K A;  2EBI A;  4YEL A;  3LSJ A;  3S3O A;  2CV0 A;  2LG4 A;  2H1K A;  4A3D J;  3QYF A;  1AA7 A;  4IEJ A;  3RTR A;  3I4N J;  2KZV A;  1MBK A;  3QYE A;  4G6T B;  4BJ6 C;  2WBM A;  3MKL A;  1BOB A;  1ZKG A;  1WH7 A;  2FD5 A;  2P0W A;  3HOX J;  4PJL A;  3OYE A;  1UG0 A;  1QU3 A;  1D0Z A;  4XN3 A;  1SAN A;  5C3E J;  3A2K A;  4DIQ A;  2W82 A;  5CQE A;  3K70 C;  1QVT A;  4G12 A;  2E1M C;  2HXO A;  2Y9Z A;  5FRO A;  3RZO J;  2LYC A;  4MIM A;  2DA1 A;  1MSF C;  4BAC A;  3SDG A;  4XRS G;  2N8G A;  3HOW J;  3OYA A;  2R4G A;  3K4J A;  3TL4 X;  2ZSH B;  2DN0 A;  2GM4 A;  2ECB A;  2M8G X;  3EUA A;  1HDP A;  1I3Q J;  1D1B A;  4IHX A;  4UUS B;  1D5Y A;  1K6Y A;  4Y4R A;  3SZG A;  3K4N A;  4YEJ A;  2HQA A;  1N77 A;  2LR8 A;  1YRN B;  2EQR A;  2LBF B;  1SFO J;  4PFO A;  4ZDP A;  1RET A;  2OV7 A;  3DEE A;  4P1W A;  3FK6 A;  4A69 C;  4FET A;  4CCJ A;  2YU9 J;  4A3M J;  4A3K J;  4HRI A;  1F36 A;  3IH2 A;  2IEK A;  2VKE A;  5IYD J;  1FMW A;  2A6T A;  1S9H A;  3RSN A;  3UR3 C;  4DBR A;  4F55 A;  4BL0 B;  3K7A J;  3SEQ A;  3S14 J;  1X2N A;  1U9N A;  2QCO A;  5F04 A;  4B3A A;  2AHQ A;  2K9Q A;  2Y9Y A;  3ZQL A;  3PO2 J;  4IHW A;  2B63 J;  1P7I A;  2ID3 A;  1SFK A;  3OYF A;  5EG0 A;  1B72 B;  2EZL A;  3GTM J;  1ETV A;  4BQN A;  3JRA A;  3PL8 A;  3CJR B;  4BUP A;  3H9J A;  4AU7 A;  4BJ5 C;  1OCP A;  2X85 A;  2GBY A;  3BCB A;  3H9G A;  2DXI A;  1UG2 A;  2L7Z A;  1JUS A;  2DMN A;  5M5W J;  2K9L A;  4PUS A;  4CCM A;  1GVD A;  3OSG A;  2JSP A;  1NG7 A;  3CP8 A;  5F27 A;  1PYV A;  4BE2 A;  4XMY A;  2FJ1 A;  3ZOB A;  4CH7 A;  4B3X A;  3HOV J;  2R5Z A;  1MMG A;  1U9O A;  4BQO A;  3SYT A;  3BQY A;  1WJF A;  4XON A;  2Y2Z A;  3HOS A;  2R7Q A;  3PO3 J;  2JA5 J;  2MSY A;  4R79 A;  5IOY A;  2X6O A;  3K70 D;  2IS1 A;  2DMP A;  4CCK A;  1G8X A;  1KON A;  4BY7 J;  3MMY B;  1ITY A;  1DGW Y;  5EDN A;  5F08 A;  1V5E A;  3A1Y A;  3E0J B;  4KT6 A;  3HOT A;  2L9N A;  1HCR A;  5EGO B;  5F0F A;  4B43 A;  4BXF A;  3MKZ A;  4XOP A;  3QPL A;  2E2H J;  4GRI A;  1X1D A;  3OR2 C;  3OYB A;  1IG7 A;  3CES A;  2XGD A;  4M3B A;  3A02 A;  3PNY A;  4PFP A;  4BS9 A;  4BDY A;  3O8H A;  1ETW A;  2JN6 A;  1Z77 A;  3QOD A;  2VJI A;  1ZGW A;  3S3N A;  2PMZ A;  1JTY A;  4FIS A;  4CA0 A;  5GP9 A;  1Q1V A;  3BG7 A;  3DLA A;  3LMM A;  2IAI A;  5FKN A;  2A5W A;  4BGD A;  4PK4 A;  4BBS J;  1V5G A;  3HL2 A;  5EZG A;  1RKW A;  2WB1 A;  4DYR A;  4ZJZ A;  2I10 A;  2L2O A;  1QVU A;  1WH5 A;  3CQZ J;  4A3B J;  2VQL A;  2MFZ A;  4FAS D;  3OIP A;  1JUP A;  1JGG A;  2Q1Z B;  2MAB A;  2O5R A;  1X1A A;  4A3C J;  1EF4 A;  2R5Y B;  4ZC3 A;  3ZR8 X;  5KHD A;  4QSH A;  1W0T A;  4FE4 A;  3GTO J;  1FTT A;  3BQZ A;  4UUS A;  5E3L A;  1TC3 C;  1G59 A;  4RMN A;  5E3M A;  2XPU A;  1H88 C;  3A4C A;  1BR2 A;  1DU6 A;  3M4O J;  3S1R J;  2UUZ A;  4M3G A;  2L9R A;  1ETO A;  5JHF A;  5F0C A;  4A3F J;  2Z2S B;  5KCM A;  3L2W A;  2D5V A;  2VPL A;  2VKH A;  3CP2 A;  1VFC A;  3LSK A;  4RDU A;  3HKZ A;  3H5R A;  1LFB A;  1IC8 A;  2P81 A;  4Y3O A;  3PUB A;  3PM1 A;  3BR1 A;  1X4O A;  2XB0 X;  2VJ4 A;  2X6X A;  4E7L A;  5IOZ A;  4E7Z A;  3VYR B;  2R7S A;  2LVS A;  4XLA A;  1UMQ A;  2HPM A;  1AKH A;  1U8B A;  1BR4 A;  3BG6 A;  3BR2 A;  1HF0 A;  4A3J J;  1OJL A;  4BXX J;  2W1O A;  2H8R A;  5K7Z A;  3K4C A;  4A3L J;  1NTC A;  5HLT A;  1K61 A;  2VUM J;  3BR5 A;  4ZDL A;  4E7I A;  3NWS A;  2VJ5 A;  3DEW A;  2DMU A;  2JMW A;  1D1C A;  2LFB A;  4CCN A;  5LD2 C;  3HB9 A;  4QIW N;  4BBR J;  1MW7 A;  2VXZ A;  4XN0 A;  2M34 A;  2RNG A;  2MD0 A;  3FKJ A;  1IRZ A;  2Y30 A;  3W2A A;  3BR6 A;  3ZQG A;  3VWB A;  1ZEL A;  4IHY A;  2LC2 A;  2K3P A;  3DPL C;  4PSX A;  5C4J J;  3GTG J;  5JLX A;  4A3G J;  2BW3 A;  4HNT A;  3L2V A;  4EEF G;  2CV1 A;  3OR1 C;  3VPR A;  1AHD P;  1X19 A;  3UNG C;  5J1Y A;  2HVQ A;  2XSJ C;  5IP9 J;  5DTD A;  1PUF A;  3GBG A;  3V42 A;  2KRC A;  1WI3 A;  2KMU A;  1OR7 C;  2LBF A;  4RM2 A;  4AYB A;  4C2U A;  3ZGK A;  3G2B A;  2LD5 A;  4FCY A;  1LKX A;  4XNF A;  1D0X A;  3AL0 B;  1MSE C;  1ETY A;  5HNH A;  2LY9 A;  5M3F J;  3JR9 A;  2HVR A;  2IGO A;  2MC4 A;  3MKW B;  1WFX A;  4ZDO A;  2DMQ A;  1E3O C;  3H0G J;  4KIS A;  3J7A Y;  2DJI A;  5CPR B;  3VYS B;  3JRD A;  3DTK A;  3PSI A;  3S32 A;  5IPA A;  5F0H A;  4C3H J;  5M5Y J;  2WA0 A;  1A6I A;  1GLN A;  3IP4 B;  2IGK A;  3PSF A;  4N4N B;  3FDY A;  2MGQ A;  4NC7 A;  2R7X A;  3OMY A;  4Y33 A;  2ZB9 A;  2K40 A;  2L7F P;  2HXI A;  4XK4 A;  5BNG A;  2LOO A;  3H35 A;  3LSI A;  2PJR B;  2LH9 A;  4F3Q A;  4BU2 A;  3HEF A;  1ZTR A;  5HOD A;  1B8I B;  1W0U A;  2M9H A;  1R9T J;  4E7K A;  3S93 A;  2KP6 A;  2QF7 A;  5M3M J;  3ZQQ A;  4M3D A;  2R93 J;  4HSR A;  3S1M J;  1JKR C;  2ZSI B;  2KT0 A;  2R5Z B;  1MBF A;  4PJJ A;  3L2U A;  3H5A A;  4MO7 A;  3SDB A;  1DP3 A;  2L7M P;  5FLV A;  3H9Q A;  4HPQ A;  2EH3 A;  4RBO A;  5HNF A;  1X4P A;  1TWC J;  2ME6 A;  3OYN A;  2X1D A;  2X6Y A;  1BJZ A;  1WJE A;  3E7L A;  1MBG A;  2JVH A;  2RRE A;  1APL C;  3G1O A;  5J1U A;  3BLY A;  4A93 J;  4CCL A;  4AUX A;  2WAD A;  3JRF A;  3O8G A;  4PJN A;  3PFY A;  4QPO A;  3L1P A;  1IUF A;  3BTJ A;  4MLO A;  4BY1 J;  1VZ0 A;  3I4M J;  4A3E J;  2MYS A;  3GTJ J;  2V26 A;  3K4M A;  4PSW A;  1JT0 A;  2V4J C;  2ZXH A;  1GV5 A;  5EEA A;  2ELK A;  2ID6 A;  2BVM A;  3C2G A;  1YX3 A;  4DYC A;  1F43 A;  2XGC A;  2AO9 A;  4B47 A;  5FKO A;  3JRB A;  4LIV A;  4D9J A;  2HU9 A;  3LSG A;  1MNM C;  1WJD A;  2HNH A;  2GLO A;  3BTC A;  2DCE A;  4AYB N;  2ECC A;  2R7Z J;  1QHH D;  2DOA A;  2KQR A;  3FBI B;  4RLQ A;  4XLF A;  2UWM A;  4LOC A;  2KDO A;  1K83 J;  2OUM A;  2FQ4 A;  2BVL A;  2K5C A;  2Z1D A;  3CJQ B;  3HPG A;  4CUG A;  5KNL A;  3G1L A;  1YRN A;  1XG1 A;  2CV2 A;  2XPW A;  1FMV A;  2WAQ N;  2IS4 A;  3ZQC A;  3W3C A;  4DOZ A;  3NAU A;  3FK7 A;  1HLV A;  2MW8 A;  3Q0V A;  3BTI A;  4HG2 A;  4XQF A;  4CZC A;  3F0C A;  1I6H J;  1BW6 A;  3H3V K;  4BEH A;  2DA2 A;  2M4K A;  2TCT A;  2XB5 A;  3CCY A;  4GFB A;  3RPU D;  5EZH A;  2XF5 A;  2V9K A;  2JK3 A;  1VND A;  4BQQ A;  3H0D A;  3HOY J;  4D7M A;  4HEA 2;  4JX5 A;  3I9V 2;  3OWT A;  1ZQ3 P;  4KJZ A;  4B48 A;  2XRL A;  2NVX J;  1Z21 A;  3MD2 A;  5EG0 B;  2YS9 A;  1T0F C;  5J3L A;  3ZCO A;  3ZRG A;  3LFU A;  2XPV A;  3GTQ J;  4EAT A;  2HI3 A;  2IS6 A;  4HNV A;  1BW5 A;  4U87 A;  2LRE A;  3TW6 A;  4HNU A;  5EYR A;  2LK2 A;  1GDT A;  1IDZ A;  2PMZ N;  1MNE A;  3IAS 2;  3K4B A;  3RQ4 A;  3HKZ N;  2MG4 A;  3DQV C;  3HXL A;  4J19 A;  3IAM 2;  1FIA A;  1MBH A;  5CKT A;  3VYU B;  3ZQH A;  2O8K A;  2NOJ B;  2Y0S N;  4C3I J;  2JA6 J;  3A01 B;  2VQG A;  3DPT A;  4F52 A;  4ANJ A;  2HYJ A;  5JLW A;  3IH3 A;  4DW6 A;  3RZD J;  9ANT A;  3ZXS A;  1RR7 A;  2VB6 A;  2LY2 A;  3BTL A;  3JRE A;  2L9S A;  2XSD C;  3DTE A;  4AC0 A;  4UUT A;  2IGM A;  1V5F A;  1DU0 A;  2E2J J;  2X6W A;  4C30 A;  3Q3S A;  2R5Y A;  1NG6 A;  2KPM A;  2XAU A;  5IP7 J;  3HOU J;  4MFE A;  3HUG B;  1BR1 A;  1DQU A;  2GOX B;  4IKF A;  2QKL B;  3D5S C;  2Y0S A;  4DJA A;  1MH3 A;  2L0K A;  1IDY A;  2VLA A;  1FTZ A;  4ITV A;  2TRT A;  3FKI J;  2E1O A;  1RPW A;  2JVG A;  3E1S A;  2V6E A;  2EZH A;  2HDD A;  4NC8 A;  3PNV A;  1H89 C;  2DT7 B;  2NS8 A;  3ZQI A;  3S1Q J;  2KLO A;  4U7B A;  2W7N A;  1JT6 A;  5CQG A;  3OYK A;  4YRV A;  4E4H A;  1Y1V J;  1Z3Y A;  3LSR A;  2VKD A;  3OYC A;  1VF9 A;  5IYB J;  3ZQF A;  4XID A;  3JRH A;  3LSH A;  5C4X J;  1FEX A;  3LSM A;  4IQ4 A;  4NUB A;  3VDX A;  4Y7N J;  4XRS A;  2ELJ A;  3S2H J;  4XLE A;  3W2V A;  1GUU A;  1MH4 A;  4C3J J;  2JA7 J;  4BE1 A;  3BG5 A;  4OWR B;  2HQ5 A;  1LDK B;  2VKV A;  2CJJ A;  4P5O A;  3K10 A;  3D5L A;  3M1C A;  1HA8 A;  2XF6 A;  1T33 A;  1JKO C;  2WAQ A;  1TWA J;  3CMM A;  1T95 A;  4V2F A;  4B4C A;  1JJ6 C;  3S16 J;  4FE7 A;  3EUH C;  3H5N A;  3OIO A;  3G1M A;  5K7F A;  1U78 A;  1IGN A;  2M4G A;  3WHC A;  1Y1W J;  2LLK A;  2QKM B;  2OPT A;  3A03 A;  3DCF A;  1TWH J;  2X1C A;  3FBN B;  4XKV A;  4J01 A;  1Z0X A;  3C2B A;  2PJR A;  2K9N A;  2BW3 B;  2LTP A;  4E7J A;  3RKQ A;  3BC8 A;  4S0H B;  2COB A;  1AU7 A;  3U21 A;  3K2A A;  5FKM A;  5EF6 A;  4JQF A;  3QPS A;  2R92 J;  3BT9 A;  2HDW A;  5HVQ C;  1N75 A;  3CF2 A;  4F93 B;  3C2H A;  3Q0U A;  4IX7 A;  4RLF A;  1QRY A;  4D7N A;  2L5Q A;  3M8J A;  1JI8 A;  1GT0 C;  4XIC A;  3D1N I;  3MN2 A;  2E60 A;  2RQQ A;  1U0J A;  4JYK A;  4JOM A;  4AVZ A;  5EGO A;  3DPU A;  3HPH A;  1RES A;  4DZP A;  3IV5 A;  2GOM A;  2KHM A;  4CCO A;  3L2Q A;  1JUM A;  2F6C A;  2IS2 A;  1S7E A;  5IP6 A;  2DA5 A;  2DMT A;  5E3O A;  2CW7 A;  4E6K G;  2NOG A;  1E0E A;  3BR3 A;  4FTH A;  4L5E A;  4RM3 A;  1MBE A;  1JKQ C;  2X1E A;  4JX6 A;  4LG3 A;  1ENH A;  1OFC X;  1ORK A;  1RKT A;  4OAY A;  3OS2 A;  4BE0 A;  1ETK A;  1P9Q C;  2KL4 A;  5J1R A;  5C44 J;  2VXD A;  2WAE A;  3OL3 A;  1LE8 A;  5FLM J;  4X1E A;  2K9M A;  1GV2 A;  2DTZ A;  3DTI A;  3OYJ A;  4LIT A;  2R7R A;  1WJB A;  1X1B A;  3NAR A;  3CMY A;  1POG A;  5DS9 A;  1OCT C;  2IXS A;  4QTR A;  3B6A A;  1XC5 A;  2Y31 A;  3F9K A;  3NWT A;  2X51 A;  4E7S A;  3OYI A;  1W36 D;  4M6V A;  2NVQ J;  1YX5 A;  3HGY A;  1ZR4 A;  4MFD A;  2E2I J;  2VIX A;  2G0E A;  3QQA A;  3EUK L;  3GTP J;  2LRD A;  3HC7 A;  2L7K A;  4BEH B;  2VAS A;  2VQH A;  4M3E A;  2E1M B;  3DU5 A;  3SEZ A;  2DA7 A;  2F4I A;  3KX2 A;  4XLH A;  3B6C A;  2CQX A;  2WY8 Q;  3L2R A;  3I3L A;  4F91 B;  1WGX A;  3FIW A;  1UEL B;  4IQJ A;  3Q0W A;  3S1N J;  3SFI A;  2E19 A;  1WJA A;  5FKK A;  2Z16 A;  1T56 A;  3JRI A;  2ME0 A;  5HOO A;  1MMN A;  4ZTF A;  3OOU A;  2CUE A;  2CH0 A;  3A01 A;  2DT6 A;  2CFO A;  3BCA A;  4X0G A;  3OYH A;  4XKB A;  2R7W A;  2R7O A;  3OS0 A;  2VL8 A;  3RCO A;  4V2G A;  1B8I A;  5GPC A;  1DGR M;  5FRN A;  1WCM J;  1X58 A;  2O7O A;  4II3 A;  4Y52 J;  1Y6I A;  1JJ8 C;  4C2T A;  3BR0 A;  4D5F A;  2M3A A;  2KRH A;  3TBI A;  4H4K C;  1TWG J;  4X6A J;  4XKW A;  4KIT B;  4QPQ A;  3S15 J;  3DWL E;  2E5N A;  3VYT B;  3OY9 A;  2HOS A;  2V7F A;  3S2D J;  2X48 A;  4CYC A;  3N05 A;  3KYL A;  2CRG A;  2LP0 A;  1OLT A;  1CQT A;  1Z3X A;  1BL0 A;  1HOM A;  3TMO A;  3OS1 A;  3OYG A;  4IHV A;  1J09 A;  5M5X J;  3TP0 A;  5LFA A;  4DYQ A;  1N78 A;  2LKX A;  2JUG A;  3S8P A;  2IBD A;  1D1A A;  1TT0 A;  2XC7 A;  2M0C A;  4II2 A;  4B44 A;  2DA6 A;  3DKY A;  4HST A;  4XLC A;  2M7A A;  2DJN A;  3IH4 A;  2BOL A;  4I6Z A;  2F5V A;  3LOC A;  3LL7 A;  2HPI A;  1MND A;  2K9S A;  4XRM A;  1PUF B;  3HGG A;  3JRC A;  1D0Y A;  2UV1 A;  4XM3 A;  1B72 A;  2JA8 J;  3OYL A;  1EA3 A;  2M0M A;  2CMP A;  4DZJ A;  3OYD A;  1ETX A;  2NVT J;  3JRG A;  5TGT A;  2W00 A;  4DGW B;  1TWF J;  2M2E A;  3BG3 A;  2KDZ A;  3AKZ A;  5IYC J;  3W2W A;  1PJR A;  1WJC A;  3TW7 A;  3K4L A;  4XOR A;  3AL0 C;  3OSF A;  1LFP A;  1ERD A;  5FJ8 J;  3VSL A;  1FIP A;  2HOT A;  3WHB A;  3HG9 A;  2CUZ A;  2HZD A;  4PJM A;  2DA4 A;  2LY1 A;  3W6V A;  3S3M A;  2R7T A;  3S17 J;  2NVY J;  1H8A C;  4ZTJ A;  4C9Y A;  2AQF A;  1JTX A;  1LE8 B;  3HDD A;  2W4S A;  1LFU P;  4IZZ A;  3DU6 A;  2CS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...