3WTSC

Crystal structure of the complex comprised of ets1, runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
118
structure length
118
Chain Sequence
PVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
total genus 40
structure length 118
sequence length 118
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wtsC00
5LRSA 2FSWA 1LDJA 3WTZA 2NYXA 1MKMA 5LHHA 4M6YA 4RGUA 2Z5UA 1ZGJA 4A0XA 2DBBA 4LGWA 1OKRA 4XSZF 1E2XA 1K6OA 1L0OC 1MJAA 1MJ9A 1O7LA 1LEBA 2VT3A 4LJZF 3H92A 5BPDA 1Z6TA 2HKXA 4RAYA 4LD5A 2FMLA 2L02A 4ENJA 5J8CA 3EUHA 5TRDA 3L9FA 1Z05A 2JPBA 4FHTA 1YS6A 3KETA 3ZQ7A 4I02A 4FX0A 1KQ9A 1J5YA 2OBPA 1S6LA 1WWXA 2HQRA 3T0YA 1TW3A 1L3LA 1KQ0A 1Z91A 1YTYA 1IN7A 4L9TA 5CVJA 1J59A 2M87A 2DU9A 1IN5A 4A12A 3TO7A 3ZMVA 1WSUA 3R4KA 1F5TA 2K27A 2VE8A 3HHHA 4I7HA 2HGCA 2BV6A 4F7ZA 3O2PE 5LEJA 3HRTA 3WGGA 2K4BA 2L54A 4CO8A 3JAMZ 1DPUA 3RKYA 5ILVA 4LLNA 3GVAA 2YPRA 4NHJA 1HSJA 3MWMA 1H9TA 4H0EA 3C18A 5DD8A 3IRQA 4EM0B 1G4DA 2XIGA 5L3BA 5LBQA 1ON1A 4KA4A 1FC3A 3HIFA 2DQLA 2KJCA 1FLIA 1USTA 2VODA 2YX4A 4LLLA 5J8FA 2HOEA 4NQWA 3K9TA 2NNYA 1IN6A 3WTWC 2QVOA 3E3VA 4RB3C 3C7JA 2OU2A 2BGCA 2ZNZA 4RGSA 3HSEA 4WX9A 2HKOA 3D5LA 3I64A 4AWXB 2JT1A 1F4KA 1ZRCA 2P5VA 5DUIA 2NAZA 1QGPA 2HWVA 1UHWA 2M45A 1ZREA 2DQRA 4IXAA 3E6DA 1V4RA 2A6EF 3G3ZA 4WCGA 3RKWA 1UHMA 5E1XA 2HTSA 1D3YA 3WU1B 1SAXA 5L3EA 4OIPF 1R5HA 4LB5A 5EEGA 3CTAA 3I54A 5D6FA 1PUEE 3V7RA 1FP1D 4BHPA 3Q5FA 4IRHA 3VODA 4IHSA 2IJLA 3ELKA 2EFOA 1HQCA 2DPUA 2IA1A 2HYFA 4MEYF 5EEHA 2VC0A 2Q8KA 5FLXK 3K2ZA 3B73A 1U2WA 2O8XA 3GLXA 1SMYF 2QQAA 2F5CA 5CVVA 1CF7A 3F72A 3F8FA 4EGYA 2NRAC 1IUYA 3I59B 1OMIA 2MBFA 3T5XA 1SFEA 4KN7X 2P6TA 2OQRA 5LEKA 3CLOA 2W24A 4YIFA 4HZFA 3EYIA 3QP6A 1KU3A 1I6XA 4RAZA 4WWCA 4N0BA 2P5KA 1LDDA 4Z2YA 3HYIA 3FM5A 2LF7A 4BHCA 2PN6A 1B4AA 3WTSC 1SD4A 3K1NA 1PDNC 1BI3A 3ZN1A 3CUQC 1LQ1A 2Q0OA 4CXFA 1U5TA 2P8TA 3TO6A 3V8KA 2GQQA 4M73A 1I1GA 1YG2A 4EQQA 2D1VA 4YG2F 3I59A 4HDUA 3QRFF 1HW1A 1H9GA 3K1PA 3HSFA 1QZZA 5E18F 3WGHA 2FXAA 1J0RA 1FY7A 3T8RA 5BPIA 1DDNA 4PDKA 1TLHB 3ISPA 1R5GA 2HS5A 2UZKA 2VBYA 3GUDA 2MD5A 1T98A 3E5QA 2MC3A 4TV7A 2GWRA 4RS8A 2F2EA 2RV8A 3E5XA 1XSXA 3RIRA 3J7AO 3KP7A 4WXHA 5HDGA 4B8XA 1TNTA 2EFWA 2W84A 2JSCA 4A5NA 3F8MA 2GIVA 4G7HF 3BJ6A 3BJOA 4NB5A 4MGRA 4P9FA 1TTYA 4G6DA 1XCVA 4HX4A 4EMSA 3WTVC 2A69F 4KICA 4G8XA 2KIFA 4HF1A 3BY6A 5D4SA 2QBYB 5FB2A 3GFLA 2JRTA 4CDGA 1B59A 1B9NA 4ESBA 2EA2A 1XB4A 2YX7A 5HLGA 5HVQC 3DEUA 2EV5A 3L09A 1I27A 1MZBA 4RGRA 2JPCA 3ZMZA 4GXOA 1NHAA 3GXOA 2HFHA 4A6DA 3MZYA 5D6EA 2OQGA 4LK1F 2STWA 3R0AA 1DP7P 4FT8A 4L0YB 1OYWA 5A2QK 1KYWA 2FU4A 5ICEA 4G9YA 3SZTA 4AIHA 4A0YA 1ZLJA 3RPUA 1FX7A 3KFWX 3HOSA 3L00A 2H6BA 3NEUA 3PQJA 3M9AA 2O61A 5LHIA 4I01A 2XROA 1HXDA 4BYYA 4EGZA 3ABTA 3DFGA 2COMA 3LA7A 3MZHA 3BPVA 4Q48A 6PAXA 5DCMB 2O03A 3FWEA 4ZYEA 5AONA 1GXPA 3RPQA 3WTTC 1S7OA 1IW7F 5E8IA 2JZYA 4MHGA 4B09A 5HS9A 3FMRA 3WE2A 2DAOA 3BJAA 5CVUA 3KP3A 2EFNA 3M8FA 3NQOA 3TO9A 2OZUA 3D0SA 4M9SA 5JVTA 2M5WA 3HOTA 4HOBA 2WV0A 1ZYRF 2PFBA 5BOXA 1FOKA 3N97A 2O3FA 4M9ZA 4PCQA 4U0YA 1BI1A 3QOPA 1IZ1A 2FEZA 4JQFA 3HRMA 3L7WA 3CUQA 1IXRC 1TQIA 2CSOA 4MQ9F 5ICFA 2YU3A 2GZWA 5ILSA 4UNOA 3VB2A 3GX4X 4R1HA 2D45A 1P4WA 2ADUA 4L9VA 3IKVA 1R00A 5FFXA 5HLHA 1QNTA 3WU0A 1K78B 1B9MA 3M7GA 1G3YA 3W6KB 3RDIA 2E7XA 1RI7A 3KLOA 1FYLA 2ELHA 2QWWA 2P7CB 3KP4A 2LF8A 1YLFA 2O6GE 3BWGA 2UWMA 2XAJA 3T8TA 5H6RA 2XKPA 2E1CA 3GFMA 5F1RA 5L3DA 3ECHA 5D5VB 3ML6A 3HSRA 4HV6A 2ZMEB 4IPAA 3W6JB 1FYMA 3FXUA 3IKTA 3EYYA 1U5TC 3DPLC 3LAPA 1P2FA 4ETSA 1YQAA 4AIJA 4GCVA 2NNNA 2FQ3A 3IHUA 1U5TB 1XMKA 1W7PA 5LGUA 1USSA 3WODF 4HX7A 4P55A 3DKWA 4OIQF 1SFUA 2KRFA 4XSXF 1REPC 2K4JA 2W85A 3P9KA 1ZRDA 5HS8A 2ISZA 4ZYDA 2OZ6A 3S2WA 4E70A 2ZKZA 2XAQA 2WWYA 2Y0MA 1H0MA 2L3DA 1BN5A 1XDUA 3I58A 4DQ2A 3JTHA 4YFKF 2PEXA 1DPRA 5DV5A 2QENA 2UXXA 2LSOA 1J7KA 2YR2A 4EJVA 4G94A 4UXNA 2PLYA 5LLQA 1Z1DA 5TJJA 2H27A 1W5SA 3QP5A 2L4AA 2DK5A 3K69A 1XGOA 1XD7A 4BQAA 2QZ8A 2DW4A 4MEXF 3MQ0A 5ICGA 2Z3YA 2GXGA 3MFKA 4A2UA 1MJBA 5E1ZB 1SMTA 2F5FA 4HYEA 2HR3A 1HKQA 4R79A 3ZPLA 5K5RA 2VOOA 4LK0F 1RUOA 3I4PA 1QBJA 4EJOA 1MDMB 3P9CA 2EB7A 2W25A 3EETA 5K5QA 4HQMA 1BI0A 1UCRA 3HHGA 4BHBA 1YS7A 3TQNA 3KLNA 1G3WA 1FNNA 1T38A 5H20A 2J5OA 3TKYA 4L18B 1T0FA 5BQTA 3O3KA 2RGVA 1G3SA 5D5WB 1O3SA 2D2WA 5AIPA 2IT0A 2PJPA 3CDHA 5LRRA 3JSPA 4KYWA 5CYVA 5JR3A 4I98B 2MH2A 3WE3A 2RNJA 3K0LA 1QO0D 4O6JA 5HDKA 1XSVA 4MNUA 4CZZA 4YIIA 5D4RA 5JI6A 4QLCU 2GA1A 1ZG5A 3V4GA 3ZN0A 2KKOA 3GWZA 3AAFA 4G6QA 4XRFA 2FA5A 2C6YA 1FWZA 2OA4A 2Q2EA 4I0BA 4ENNA 2F5EA 5L3GA 3JAMK 3U2RA 1S29A 3MCZA 4CYDA 5K5OA 3U9GA 3WTUC 4HLXA 1E17A 2DLLA 3F21A 3E6CC 4IVNA 1FPQA 3C3WA 1OYIA 5FD5A 1T2KA 1R1VA 4A6EA 2CO5A 4OIOF 3IWFA 1XSDA 2EWNA 4ASNA 2M8EA 5HS7A 2FRHA 3NRVA 2G7UA 2EA4A 4BNCA 2E7WA 2Z99A 2PQ8A 5FD6A 3JW4A 3IC7A 3TDUC 1U78A 4L0ZB 2BYVE 3JTGA 1QPMA 4HV5A 3U1DA 2ETHA 1HKSA 1Z9CA 1JGSA 1ZHFA 2BBYA 2RDPA 1Z6RA 1HBXG 1OPCA 4KT5C 1I5ZA 1HW2A 5HDNA 2JTVA 1FZPB 1CF7B 2LNBA 2IP2A 3G73A 4GO1A 1S7AA 1AOYA 3R0JA 4EV0A 4UVBA 2DK8A 5ERIA 3VOEA 1S8NA 5ILUA 2ZJ2A 4AD9A 4JBAA 3I5UA 1ZG3A 2V6CA 5D8LB 4KIFA 4Y15A 1BOAA 3DQVC 3ROUA 4LFUA 2A61A 3V7SA 2FE3A 3JSOA 1HKTA 3KP2A 4ZZLA 1WRJA 1TQPA 2QUFA 3EDPA 2GAUA 1BC8C 2D1HA 3BZ6A 3Q9SA 2K7LA 1IRFA 4YFXF 4UUVA 1YW8A 2G7HA 4OINF 1W5TA 3CJNA 4HF0A 1O57A 4G7ZF 2ZO4A 3QPTA 4UVCA 4CICA 1JE8A 5E8GA 2VONA 2FBKA 3FXRA 1YIOA 4LG0A 2ZFWA 1IN8A 3DPTA 3F6VA 3QAHA 2J5PA 1EH8A 5CLSA 3DV8A 3TGNA 2P5LC 1TW2A 4HQEA 2BE5F 2XUBA 4L5JA 3LQQA 4PZJA 2IVMA 1BJAA 5BS6A 1XN7A 2R7DA 1FBUA 1FBSA 2XGXA 1X3UA 4OU0A 3F8BA 3GFIA 1IN4A 1O3TA 2ZCWA 4WXCA 2CG4A 2TDXA 3RYPA 3DXJF 1FYKA 4RB0A 5FO5A 3PQKA 2IA0A 3DF8A 5HOOA 1TBXA 4KDPA 3ABUA 5JHUA 4M9XA 4WK8F 2XRNA 1O3RA 4IRIA 2ESNA 4U88A 4M72A 2DO7A 4G7OF 2FBHA 2Z33A 3P9IA 3BP8A 2A5YB 1D8KA 3KEOA 2QQ9A 1JHFA 1GVJA 2DT5A 1Y0UA 1MD0A 3WTYC 3OV8A 1ZH5A 2A68F 3LWFA 3ULQB 4EM1A 1RIOH 1EH6A 4IJAA 2VBZA 4KN4X 1XGSA 1G3TA 4GYIA 3HRSA 1LEAA 4U0VA 4WF2A 1R36A 4L5IA 3I53A 2HQNA 5ICCA 2X0LA 4ON0A 2RC4A 3CO6C 3LA2A 3M8EA 1ONVA 3KP6A 4OMYA 2HZTA 3RKXA 4XLNF 4YFNF 4ZYHA 2FF4A 2K02A 3GEZA 4MTDA 1ON2A 3GFJA 1EV7A 1OYYA 5J6XA 1AWCA 3ZMSA 4PGGA 1BBYA 2DTRA 3SHFA 1UB9A 2XAFA 4LLGF 1U8RA 2WC2A 2H6CA 2RQPA 4BXUA 3P7NA 1STZA 3E6BA 3CUQB 1PP8F 1BIBA 1ZN2A 4N9HA 2L4MA 2EFQA 5CJ9A 4HBLA 2VBXA 1V3FA 4KIBA 3H3UA 1ZAOA 5LGNA 4IRGA 4HDVA 1F1ZA 1G6NA 4GGGA 3M1EA 4HX8A 5IT9Z 2GXBA 2XKOA 3OOPA 4Y13A 4ENMA 1T39A 4AIKA 2HYGD 1TQMA 3PFIA 3TOAA 1Q1HA 2IW5A 5F64A 4Q4ZF 2Z9OA 3F8NA 1T6SA 2FMYA 3GYHX 5HLIA 1QQIA 1ZLKA 1KYZA 3HRUA 4A0ZA 2MLKA 5D5UB 1WQ2A 4HAMA 3GZ6A 1RUNA 2ZMEA 2ACJA 4O3MA 4ESFA 2Y75A 1MGTA 3FZVA 4FX4A 4L9JA 5E1WA 4Y17A 4M6XA 2LKPA 1P6RA 2CGPA 3E5UA 1R58A 3SQNA 4S04A 3N4MA 2PBIA 2P4WA 4HLYA 1SD7A 1TNSA 2W57A 1FP2A 1ZRFA 2MLGA 4XLPF 1ULYA 1D8JA 1BIAA 3F22A 1P92A 5L3FA 3VEPA 5L3CA 2CFXA 1QZYA 1FBQA 2ZXJA 3J80Z 3KP5A 4MQVA 1JXSA 5D5XB 2CWEA 1IXSB 4HF2A 2QYOA 3V8JA 4BH9A 1FT9A 2B0LA 1P4XA 1IXCA 3RJPA 1KU7A 1R1UA 2KIUA 5F6FA 1K7AA 4KUMA 4P96A 4CHUA 2R3SA 3B02A 2V1UA 1JHHA 3KEQA 1I1SA 3ZMDA 5AIQA 1LDKB 2X4HA 4PGHA 2HEOA 3SZPA 1HW5A 1J9IA 4KMUX 1K78A 3SFZA 2P7VB 2V1DA 4OOIA 1IAWA 1XMAA 1R22A 2KIMA 5FGMA 3CUOA 1O3QA 2CYYA 1W7PD 2AS5F 1FSEA 4MTEA 2VC1A 3T1BA 1ZGAA 3FX3A 1S3JA 3K1MA 5DYMA 2MA3A 2DPDA 3E6MA 2DI3A 1YO5C 1YYVA 2M30A 1W7PB 2IRFG 5DDGA 1RZ4A 4UV9A 3HTUA 1UFMA 4QWQA 1B6AA 5IT3A 1GHCA 1DUXC 1ZG1A 1GXQA 3I0TA 2H94A 1U3EM 1KU2A 4D0PA 4GYGA 4O5VA 5K1YA 3SXYA 1J75A 2PMUA 3MEXA 2VBWA 3WTXC 5FLXZ 2ZBKA 3FM3A 2HTJA 2GA2A 2ISYA 3GW2A 3IL2A 5DD4A 1BC7C 3BPXA 1SD5A 3REOA 2A3SA 3FF5A 3FMSA 5A2QZ 1R23A 4RGXA 5LHGA 2M1BA 1ZARA 2FBIA 1WI9A 5DCFA 3E97A 2XASA 4DNCA 2RN7A 3J81K 3J80K 1KA8A 3HTSB 4IF4A 2VXZA 2MH9A 4I2OA 2AXLA 4ZYGA 2CQKA 2QBYA 1YW9A 5E20A 2CW0F 2RKHA 3R60A 4U7BA 4UHTA 2KJBA 1IRGA 3COAC 4KFCA 2RVCA 4EVIA 3ZMUA 2A07F 4KNYA 4I09A 1XGNA 3FXQA 2VT2A 2LDUA 2ZNYA 2EV0A 5CVIA 3RTRA 2A6HF 4HW0A 2VOPA 4UV8A 1R1TA 4L9NA 1A04A 2IA2A 1O7FA 3LA3A 1VTNC 3LAJA 4HA8A 1YW7A 2QQBA 1WKMA 3RYRA 4S05A 3FMQA 5FFZA 4EJUA 2QLZA 1ODDA 1IF1A 2UXNA 3CO7C 3V7CA 1F9NA 1KU9A 1J2XA 3J81Z 2Y48A 5IT9K 3H3ZA 2P6SA 2V1XA 2WTEA 3R6SA 3HUGA 3I71A 1XGMA 2FNPA 4M71A 2VN2A 5D8KB 2PG4A 3DP7A 1LVAA 2ESHA 3ZMTA 3R61A 4Q5SF 1BM9A 2XV4S 3GZ5A 2XAGA 5DUKA 2FNAA 2K86A 1EH7A 3BOQA 2PMHA 4U7DA 4A5MA 4UVAA 3ECOA 4KIGA 4WXDA 3KE2A 1FSHA 4N9IA 4P5OA 3KZYA 3Q9VA 1HSTA 2F5DA 1P4AA 2STTA 3BDDA 1U6GA 2G9WA 4EM2A 4I0AA 2R7FA 4LB6B 4ESJA 1PP7U 3F3XA 3KZZA 4U0WA 4RB1A 5ED4A 4KMFA 3V8LA 1MDMA 1K79A 1BI2A 3KCCA 4XBFA 1R7JA 3LFKA 3ERED 2BEOA 4K2EA 3GF2A 3FHZA 1XDSA 4M74A 2H09A 3EQLF 2NS0A 5LGTA 4BAYA 3GO5A 1YFHA 4EJWA 4ZH4F 5E17F 1Z7UA 2XVCA 3C1DA 1KGSA 3WGIA 2OD5A 1LJ9A 2YSRA 1OR7A 5CVRA 2VE9A 2PI0A 3QPHA 4LMYA 1D5VA 4AVPA 1RNLA 4RB2C 4OMZA 2XAHA 1SD6A 2DFIA 3F6OA 2L01A 4IHTA 2FOKA 5DEQA 3L2CA 4R8HA 1CGPA 2E1NA 4ENKA 1W4MA 3IWZA 4EJTA 3TDZC 1XCBA 1B1BA 2EFPA 1KQ8A 4OIRF 4CGZA 3TOBA 3VFZA 2XHKA 3MAJA 4Q47A 3ZP5A 2EV6A 3QU6A 2EJRA 1LB2A 3LSTA 4ZZDA 3O6BB 2OAZA 2EK5A 3WG9A 3QU3A 3RI4A 2QM3A 5BMZA 5JFRA 2V79A 1LNWA 4P9UA 2HDCA 5H6QA 4LG0B 2IPQX 2V9VA 5KVRA 3F23A 1SFXA 3IRRA 3BROA 2O0YA 3LQRA 3F8CA 1C0WA 4JK1X 5DCMA 5KK1A
chains in the Genus database with same CATH superfamily
5LRSA 2FSWA 1LDJA 3JRHA 1UHSA 2KPMA 2WBMA 3TL4X 3WTZA 3A02A 2NYXA 1MKMA 5LHHA 4M6YA 2NS7A 4D5CA 2M9HA 3HB9A 4RGUA 4BY7J 1POGA 2Z5UA 2WAQN 3VYRB 3H0GJ 1ZGJA 4A0XA 2DBBA 4LGWA 4BU2A 1OKRA 4ZC3A 1W36C 4D7MA 4XSZF 1E2XA 1K6OA 1L0OC 3DU5A 1MJAA 1MJ9A 3K70D 1O7LA 1LEBA 1BJZA 2VT3A 5HNFA 4XICA 3G1LA 5GADJ 3WG7H 1V55H 4LJZF 3F0CA 4JP0A 3H92A 5BPDA 1Z6TA 2HKXA 2DN0A 4LD5A 4RAYA 2FMLA 4BEHB 2L02A 4ENJA 5J8CA 3LSIA 1R6RA 3EUHA 5TRDA 3L9FA 1Z05A 2JPBA 1E3HA 3NWSA 4FHTA 1VQ8I 1OISA 1MBEA 1NG7A 1YS6A 3KETA 1K6YA 3ZQ7A 4I02A 5KK1A 4S0HB 1E3PA 4FX0A 3CC7I 1RR7A 1GV5A 1KQ9A 1J5YA 2OBPA 1S6LA 2M3AA 1WWXA 1QZEA 2K85A 2HDWA 9ANTA 2BZTA 2IEKA 1ZR2A 5KAIC 4ZYAA 2HQRA 3SYTA 3T0YA 1FOWA 1TW3A 1SVLA 1L3LA 1KQ0A 3GTJJ 5IOZA 1X4PA 3BG7A 1BR4A 1Z91A 2EINH 1WJBA 2X6OA 5GAGJ 4B48A 1YTYA 1IN7A 3MN2A 4L9TA 5CVJA 1J59A 3GTMJ 2DJNA 2M87A 2DU9A 1V5GA 1X4OA 4X1EA 2E1OA 4W1UA 3DTKA 2ZXWH 1IN5A 4A12A 3TO7A 1JJ6C 5EGOA 3ZMVA 4XLEA 1WSUA 1QPIA 1TWCJ 3R4KA 1F5TA 1ETOA 2CJJA 1E3OC 2NVYJ 2OCEA 3BCBA 2VQLA 2JRMA 2K27A 2VE8A 1V5EA 3JRAA 2IGOA 1IRZA 3HHHA 4A3MJ 2MFZA 2OUMA 2IAIA 4I7HA 3CDLA 1Y8RB 1Y6IA 2HGCA 1SVMA 2W4SA 2BV6A 4C9YA 1T08B 4F7ZA 3K70C 3O2PE 1APLC 4P1WA 2M0MA 3HRTA 5LEJA 3WGGA 3CCMI 4XK4A 1OCZH 4RAGA 4D5FA 2K4BA 2L54A 4CO8A 2NXNB 3FXKA 4YELA 3JAMZ 1DPUA 3RKYA 5ILVA 5IP6A 4LLNA 2BXZA 3GVAA 2YPRA 2HU9A 4NHJA 1A36A 4HG2A 2LY2A 1HSJA 2BW3B 3MWMA 1IUFA 1X1DA 3B6CA 5CPRB 1H9TA 4H0EA 3GCMA 1P7IA 3C18A 5DD8A 4B44A 3IRQA 2GOMA 4EM0B 1G4DA 2HZDA 1SFKA 1SANA 2W1OA 2R5ZB 3BG5A 2XIGA 1XC5A 1H8AC 5L3BA 5LBQA 1ON1A 4KA4A 1XTAA 1X58A 1FC3A 3HIFA 3GMEA 3K2AA 2DQLA 4W97A 5FKOA 5EEAA 2KJCA 4RAFA 4ZTFA 1JTXA 5KHDA 2F4MB 4IHXA 1FLIA 1USTA 2VODA 2HXIA 2YX4A 2VXDA 4LLLA 5J8FA 3DEEA 4J00A 3DWLE 2HOEA 4NQWA 3K9TA 2NNYA 1P9QC 3ZGKA 1IN6A 3H3VK 1MSEC 3WTWC 2BHZA 2QVOA 3WHBA 3E3VA 1IDZA 4XKVA 1XS9A 3ABMH 4RB3C 1S9HA 2MD0A 2VB6A 2OU2A 3C7JA 1ETKA 2R4GA 4KT6A 1QVTA 2BGCA 2ZNZA 4RGSA 3HSEA 4WX9A 2HKOA 3QPLA 3CP2A 5J1RA 2DOFA 3D5LA 3L2UA 4RMNA 3M1CA 2X9DA 3I64A 1HCRA 4AWXB 2JT1A 3OS1A 1MMAA 2KZGA 1F4KA 1ZRCA 2HVQA 2P5VA 4BE0A 2RNGA 5DUIA 2NAZA 5FKNA 2FJ1A 1SC7A 4ANJA 4MFEA 5IOYA 2JVHA 1ETVA 5J4VA 1QGPA 3K4JA 1OCRH 2HWVA 5B5EC 1QRYA 3OR1C 1UHWA 2M45A 2MGQA 4BACA 4LITA 1ZREA 2DQRA 4ZTJA 3S93A 4IXAA 3HZJA 3E6DA 2E5ZA 1V4RA 1Z3XA 2HPIA 2A6EF 2V1NA 3G3ZA 1R4MB 4WCGA 3CC2I 3RKWA 4IZZA 1UHMA 3IV5A 5E1XA 2HTSA 5HLTA 1D3YA 1LFPA 3WU1B 2XPVA 1G2HA 2ECCA 5L3EA 1SAXA 1MMNA 2JUGA 4OIPF 1ITYA 1R5HA 4LB5A 5EEGA 3CTAA 3I54A 5D6FA 1YIJI 3J7ZI 1PUEE 3V7RA 1FP1D 4BHPA 2BY1A 1KZHA 3Q5FA 3I4MJ 4BBSJ 4IRHA 2CMPA 2LRDA 4HSTA 3VODA 4IHSA 2IJLA 3ELKA 2EFOA 1HQCA 2KFDA 2VI6A 2DPUA 3LOCA 4PFPA 2IA1A 2HYFA 4MEYF 5EEHA 1HA8A 4BE1A 2KHMA 3HDDA 2VC0A 5EJCA 2Q8KA 2DFHA 5FLXK 3K2ZA 2ZMEC 3HC7A 3B73A 2LTPA 1U2WA 2O8XA 3GLXA 3PJRA 2MSYA 3CDIA 1WJDA 2DYSH 3SFIA 1TWHJ 5TGTA 3SJMA 1SMYF 2QQAA 2F5CA 1TT0A 5CVVA 4D9JA 4ZDOA 1CF7A 3F72A 3L2QA 3F8FA 4EGYA 2NRAC 1IUYA 2WAQA 3I59B 2KISA 3BZCA 1OMIA 2MBFA 3T5XA 1SFEA 2R7UA 3W2WA 4BL0B 3GTKJ 1DU6A 4KN7X 2P6TA 3D5SC 1KONA 2OQRA 2ZFUA 3CLOA 5LEKA 2W24A 4YIFA 2I5UA 4HZFA 3GBGA 3OYBA 3EYIA 1PJRA 4ABZA 3QP6A 1KU3A 4AM3A 1I6XA 4RAZA 3K10A 4WWCA 1VQPI 3HG9A 4N0BA 2H8WA 2P5KA 1LDDA 4Z2YA 3HYIA 3FM5A 2Y69H 2LF7A 4BHCA 2PN6A 1B4AA 3WTSC 4QPQA 4XLFA 1SD4A 3K1NA 5K7FA 1PDNC 4KITB 1BI3A 3ZN1A 3CUQC 1LQ1A 2Q0OA 5C44J 4CXFA 1U5TA 2P8TA 3TO6A 3V8KA 1JT0A 2DTZA 2GQQA 4M73A 1I1GA 1YG2A 4EQQA 3VYSB 3TEDA 2K40A 1NG6A 2D1VA 4YG2F 4FTHA 3N05A 3DCFA 3I59A 2OV7A 2LH9A 4V19K 4HDUA 3DPUA 1R5ID 3QRFF 1HW1A 3TW6A 2IXSA 2P0WA 3C2GA 1H9GA 1D0ZA 3K1PA 3HSFA 1QZZA 4A3DJ 5E18F 3S14J 3OYIA 5FJ8J 3WGHA 2CS3A 2FXAA 1FMWA 3A2KA 1MBGA 2FOWA 1WZ2A 2ELJA 3AL0C 1UG0A 1J0RA 5CQEA 1FY7A 3MKLA 1ACIA 3CJTB 3T8RA 3H5RA 5BPIA 1DDNA 2KIQA 3CLQA 4PDKA 1TLHB 3FBIB 3ISPA 4B47A 2LD5A 1R5GA 2F4IA 2PMZN 2HS5A 2XB0X 1I50J 2UZKA 3AKZA 1OCCH 4DBQA 2VBYA 3GUDA 5FKKA 2ZJRF 2CQXA 2MD5A 3G1MA 1T98A 3E5QA 2MC3A 4TV7A 1T8IA 1UG2A 1QA6A 5FRNA 2GWRA 2M2EA 4II2A 4MO7A 1TT5B 4RS8A 4NC7A 2F2EA 2RV8A 3E5XA 1I39A 2E2JJ 1XSXA 3ZXSA 3JCUC 3RIRA 1WH5A 3J7AO 2H1LA 3KP7A 2DT7B 4WXHA 5HDGA 2AO9A 4FE7A 4B8XA 1TNTA 2EFWA 2K9SA 2W84A 2ZJQF 2JSCA 4A5NA 2VJIA 3F8MA 3A0HC 4AYBN 1N77A 4B43A 2NVQJ 3HOXJ 2GIVA 4G7HF 5E79C 3H36A 3BJ6A 2CUEA 2CQ7A 3BJOA 4NB5A 4MGRA 4P9FA 1IO2A 2KLOA 3S3MA 3OYKA 2CV1A 1AU7A 4A3IJ 5TISC 1TTYA 4M6VA 3PIPF 2AXTC 1DU0A 4G6DA 1XCVA 2MYSA 4HX4A 2HNHA 5CKTA 4EMSA 3WTVC 3W3CA 2A69F 4BQQA 2EQRA 5M5WJ 4KICA 4G8XA 2KIFA 4HF1A 1PUFA 1D1BA 3BTJA 1TL8A 2JMWA 3BY6A 3OYCA 5D4SA 2EZHA 2QBYB 5FB2A 3GFLA 2JRTA 2CUFA 4BQNA 4CDGA 1WFXA 1B59A 1B9NA 1I3QJ 3HJEA 3TMOA 4ESBA 2EA2A 3MVPA 1XB4A 2YX7A 5HVQC 5HLGA 3GTPJ 3DEUA 3S15J 2EV5A 3L09A 1P7JA 1I27A 1MZBA 4RGRA 3CF5F 2E5NA 1OLTA 4DGWB 2QQ8A 3RCOA 3KYLA 2JPCA 3ZMZA 2ME6A 2ZXHA 4GXOA 1NHAA 3GXOA 3IUOA 5J3LA 2JUCA 2HFHA 4A6DA 1WCMJ 2L2OA 4AVZA 5KAFC 3EPZA 3MZYA 4CH7A 2F4OB 3AG2H 3H9QA 5D6EA 5IP9J 1NK2P 2OQGA 4LK1F 2STWA 3R0AA 3OL3A 1DP7P 3BCAA 3KX2A 4FT8A 4L0YB 1X1BA 5FROA 1MBKA 3VSLA 5DS9A 1OYWA 5A2QK 2HPMA 1KYWA 2DJIA 1WVRA 2Q2EB 1NTCA 2FU4A 5ICEA 4G9YA 1D1AA 3SZTA 4AIHA 4A0YA 1OCTC 3DBHB 1ZLJA 3RPUA 1FX7A 1MH3A 3KFWX 2EIKH 1VQ7I 3HOSA 3L00A 2H6BA 3NEUA 3PQJA 4PJLA 4RLQA 3CCEI 5FKLA 2R7VA 3M9AA 4MIMA 2O61A 1RKWA 5LHIA 4I01A 1EA3A 2WADA 3PIOF 2XROA 5IPAA 3BTCA 2NOJB 1HXDA 4BYYA 4UB6C 4EGZA 2ZXIA 1W0TA 3ABTA 2ZSHB 3DFGA 2COMA 3LA7A 3PSFA 3MZHA 3BPVA 4Q48A 2XGEA 2WA0A 3DTEA 5DCMB 6PAXA 2O03A 5F04A 5M5YJ 3FWEA 3BC8A 2BXYA 2DXIA 4BDYA 4ZYEA 1TP4A 3ZR8X 5AONA 3NWTA 1GXPA 1OFCX 3RPQA 3WTTC 2Z16A 1S7OA 1ORKA 1IW7F 1G8XA 1YX3A 2XF5A 2XPWA 5E8IA 2JZYA 4MHGA 1PYVA 1NK3P 4B09A 4M3FA 5HS9A 4UY8I 3FMRA 3WE2A 2DAOA 3BJAA 5CVUA 3KP3A 5FRMA 2EFNA 5K7HA 3E0JB 3M8FA 3FXLA 3NQOA 2IBDA 3OMYA 3CJQB 3TO9A 4A3LJ 4A3BJ 2ECBA 2OZUA 3D0SA 1MNDA 4M9SA 3D5RC 1MW7A 5JVTA 5EG0B 2M5WA 3A03A 3OYAA 3OYHA 2GIZA 3HOTA 1FJLA 3X2QH 3SZGA 3IP4B 1LFUP 4HOBA 5JVGF 2WV0A 3TW7A 1ZYRF 4RDUA 2V9KA 2PFBA 1YJWI 5BOXA 1DGWY 3C2HA 2KRCA 2BY2A 2DFEA 3N97A 1FOKA 3G71I 2O3FA 4M9ZA 3S1NJ 4PCQA 3A01B 2OF7A 4U0YA 2DA5A 3U1KA 1BI1A 1I6HJ 3QOPA 3E7LA 3A4CA 1IZ1A 2FEZA 4JQFA 3HRMA 4IL6C 1LPQA 3L7WA 3CUQA 1IXRC 1TQIA 4QTRA 2CSOA 4MQ9F 5ICFA 4V2GA 3H5AA 1WGXA 2YU3A 2LY1A 1TC3C 2GZWA 3CCYA 2EIJH 3OR2C 5ILSA 4UNOA 2IS6A 4OAYA 3VB2A 1WJ5A 3GTGJ 4DZJA 3GX4X 4NBQA 4R1HA 2D45A 1P4WA 3JREA 2ADUA 2DMNA 4L9VA 2F48A 3IKVA 1A5JA 1R00A 2HI3A 5FFXA 3O8GA 5HLHA 1QNTA 3WU0A 1K78B 1B9MA 3M7GA 3CCRI 4UUSB 1G3YA 2DOAA 3RDIA 3W6KB 2DA1A 2E7XA 1RI7A 4ZDPA 3HPGA 3KLOA 2K3PA 4C3HJ 3MKWB 1W36D 1FYLA 2ELHA 2QWWA 2P7CB 3HOYJ 4BJ6C 3KP4A 2LF8A 1YLFA 2BOLA 2PJRB 2O6GE 2ELKA 3BWGA 2UWMA 4PJJA 4XR6A 5FLMJ 4BJ5C 2VJJA 2XAJA 3LNQA 3T8TA 5H6RA 1Z21A 3UKGA 2XKPA 4E7IA 2E1CA 3L2WA 1B72B 3GFMA 5F1RA 5L3DA 3ECHA 5D5VB 2K9MA 3ML6A 3HSRA 3PUBA 4CCNA 4HV6A 3FHNA 4II3A 2ZMEB 3KPHA 2L0KA 5GPCA 1IDYA 2IS2A 4IPAA 3W6JB 3CMMA 3ZQFA 1FYMA 1HF0A 2FD5A 1VNDA 1LKXA 3FXUA 3IKTA 2L7ZA 4IOCF 3EYYA 1U5TC 3DPLC 3LAPA 1P2FA 2LKSA 4XLAA 4ETSA 2XC7A 1EKEA 3BG9A 4EEFG 3S1MJ 3BR5A 3OYLA 1YQAA 5IP7J 4BQOA 4AIJA 3ERMA 4GCVA 3S32A 2L7FP 2NNNA 2FQ3A 2TCTA 3LSKA 3HGYA 3IHUA 1U5TB 3S2HJ 1XMKA 5LFAA 1W7PA 5LGUA 1USSA 3WODF 1BL0A 4HX7A 4P55A 3DKWA 3DLLF 2RQQA 4OIQF 2DDBA 1SFUA 2KRFA 4XSXF 2CFOA 4DOZA 1LVKA 5IYBJ 1REPC 2K4JA 4XMYA 2W85A 3P9KA 1VI0A 2W00A 1VQMI 1Y8QB 1ZRDA 4C30A 5HS8A 2ISZA 2M4GA 4ZYDA 2OZ6A 3S2WA 4E70A 5M3FJ 5EDNA 2ZKZA 2XAQA 5FLVA 2WWYA 2Y0MA 2JA6J 2NVTJ 1H0MA 2L3DA 1BN5A 1TWFJ 1XDUA 3I58A 3K4NA 4OAZA 2E36A 2XPUA 3JTHA 4DQ2A 4YFKF 1T56A 3P5JA 1WJAA 3FK7A 1U8BA 2PEXA 1DPRA 5DV5A 3EUHC 2QENA 2UXXA 3S16J 1O4XA 2GLOA 2CV0A 2LSOA 3S1QJ 4ITVA 1FOYA 1J7KA 2YR2A 4EJVA 4MFDA 3TP3A 4G94A 4UXNA 2PLYA 5IYDJ 1JGGA 5LLQA 3Q0VA 1Z1DA 3M3YJ 2B7EA 2IS1A 4HSRA 1R71A 5TJJA 4YIRX 1FTZA 3O8HA 4UB8C 2H27A 2TRTA 1MBFA 2QGUA 3HXLA 4DW6A 2H1KA 4I6ZA 1W5SA 1EF4A 3QP5A 2L4AA 2DK5A 4PJ0C 3FBNB 3K69A 3TBIA 1XGOA 3K4BA 2R7RA 2OTJI 1XD7A 4BQAA 1VFCA 2QZ8A 5J47A 3OIPA 4B1RA 2VKHA 2DW4A 4MEXF 2L9NA 3MQ0A 4PSXA 5ICGA 2Z3YA 2FUG2 4BGDA 4LOCA 1T0FC 4JX6A 2GXGA 3MFKA 4A2UA 1MJBA 3BLYA 5E1ZB 5JHFA 1SMTA 5IY5H 1ZTRA 4X6AJ 2F5VA 2F5FA 4HYEA 2QKLB 2A6TA 2HR3A 1HKQA 5GP9A 4R79A 3ZPLA 5K5RA 4RA2A 2VOOA 4LK0F 1RUOA 1GV2A 3I4PA 2DMUA 3CZ6A 1GDTA 2JWTA 2PX9A 4EJOA 1QBJA 1MDMB 3J7AY 2X6YA 3J7YJ 3P9CA 4HRIA 3VPRA 3NAUA 5J1UA 3DKXA 2H8RA 2EB7A 2W25A 1FOXA 1NH3A 3D1NI 1OCPA 3EETA 4M3EA 3FK6A 3BR6A 2JSPA 2OTLI 3BG6A 3MKZA 2R7QA 5K5QA 2ID6A 4BS9A 2UV1A 4HQMA 3OWTA 4AIDA 2BHYA 1BI0A 1UCRA 3HHGA 4XNFA 1MMGA 4BHBA 3MKYB 1YS7A 4HNUA 4D1QA 3TQNA 2KQRA 3KLNA 1G3WA 1FNNA 1T38A 2KRHA 5H20A 3SEZA 2CUZA 1AHDP 2J5OA 3TKYA 2DDAA 1T0FA 3H0DA 4L18B 5BQTA 3O3KA 2RGVA 1G3SA 5D5WB 3I4NJ 1J09A 3FKIJ 2Y0SA 3CCJI 2D2WA 1O3SA 5AIPA 1R9TJ 2IT0A 2PJPA 4JX4A 3CDHA 4M3GA 5LRRA 5CYVA 5JR3A 4I98B 3WE3A 3JSPA 2MH2A 4BE2A 4KYWA 2RNJA 2RAEA 3K0LA 1QO0D 4O6JA 5HDKA 2OCCH 4LG3A 1IC8A 1XSVA 3G1OA 1QVUA 4MNUA 3OYGA 4JYKA 1M1EB 4CZZA 4YIIA 1ZKGA 5D4RA 5JI6A 4QLCU 3IH3A 2GA1A 1ZG5A 3QYEA 3PL8A 3V4GA 3ZN0A 2KKOA 2KT0A 3GWZA 3AAFA 4HEA2 3QYFA 2KZVA 1YITI 5B66C 4RLFA 4G6QA 4I76A 4XRFA 2LG4A 2N8GA 2FA5A 3OL4A 2C6YA 3EUAA 2LC2A 3VYUB 3FXMA 1H88C 2AHQA 2BW3A 1FWZA 2OA4A 2Q2EA 3JR9A 1OQYA 4I0BA 4XM3A 4ENNA 1JI8A 2F5EA 5L3GA 3JAMK 3U2RA 4A3GJ 1S29A 1WJEA 3MD2A 3MCZA 2KDOA 4CYDA 5K5OA 3U9GA 2CRGA 1GUUA 1JUMA 3M07A 3WTUC 4HLXA 1E17A 2DLLA 3PM1A 3IH2A 3F21A 3E6CC 4IVNA 1FPQA 3C3WA 1OYIA 5FD5A 1T2KA 1R1VA 4A6EA 1YRNA 3CMAI 2CO5A 4BBRJ 3IWFA 4OIOF 2Y2ZA 1Z77A 2XF7A 3LSPA 2V9PA 2EWNA 4ASNA 1XSDA 1S72I 2E35A 1LUJB 3KZIC 2VKEA 4DZPA 1XG1A 1GLNA 3KIOA 2M8EA 5HS7A 5F0CA 2FRHA 4CZCA 3NRVA 2G7UA 5DTDA 3HOWJ 3IAS2 3FKJA 5E3OA 2EA4A 4BNCA 2E7WA 5EZHA 2X6XA 2JN6A 3ZRGA 2Z99A 1E0EA 2PQ8A 5FD6A 3JW4A 3IC7A 5FKMA 3TDUC 5JLWA 2EZIA 1U78A 4L0ZB 2BYVE 3JTGA 2W7NA 1IV6A 1QPMA 4HV5A 3U1DA 2Y0SN 2CUJA 2ETHA 1HKSA 1HDDC 1Z9CA 1JGSA 4XKBA 4XLHA 2QSFX 1ZHFA 2BBYA 2R7WA 3BQYA 2RDPA 1Z6RA 4XN0A 4F3QA 1HBXG 1OPCA 2Z2SB 4KT5C 1I5ZA 1HW2A 3VYTB 3OS0A 1QHGA 2X1EA 2JA7J 5HDNA 3ZOBA 3ZQQA 4CCKA 2JTVA 3H9JA 1FZPB 4IEJA 1CF7B 3IH4A 2LNBA 2BVLA 2P81A 2IP2A 3G73A 4GO1A 2DODA 2A5WA 3OY9A 3UR3C 2AQFA 1S7AA 1AOYA 2HXOA 1LE8B 3R0JA 4EV0A 1A31A 3G4SI 4Y7NJ 4UVBA 3NARA 5LD2C 1OJLA 4UUSA 2DK8A 5ERIA 2E34A 4FISA 3VOEA 1S8NA 1YHQI 1LFBA 1UMQA 5ILUA 2ZJ2A 4RM2A 3CQZJ 4AD9A 2HOSA 1Y1VJ 1XPXA 4JBAA 3I5UA 1ZG3A 2EPFA 2EZLA 2V6CA 5D8LB 2YS9A 3BZKA 4KIFA 4Y15A 4XKWA 1QU3A 4KISA 1IV8A 1BOAA 3DQVC 3ROUA 4LFUA 2A61A 4G12A 3V7SA 2FE3A 2LYCA 4CCMA 3JSOA 1HKTA 3MZ8A 3KP2A 4ZZLA 1WRJA 1TQPA 3LSMA 2QUFA 2BY3A 2LMDA 3EDPA 2GAUA 1BC8C 2D1HA 3BZ6A 3Q9SA 2K7LA 1IRFA 4YFXF 1R4NB 4UUVA 1YW8A 2G7HA 4OINF 2O5RA 4DBRA 1W5TA 3CJNA 4HF0A 1O57A 4G7ZF 1V5FA 2ZO4A 3QPTA 4UVCA 5F0FA 2CQNA 1VQ4I 4CICA 2R7XA 1JE8A 5E8GA 2I10A 2VONA 3JRDA 2FBKA 3ZQIA 1VQ5I 3FXRA 1YIOA 4LG0A 5B1AH 4A3JJ 2B63J 1UAAA 3OYDA 3DTIA 2ZFWA 1IN8A 2VLAA 3DPTA 2W48A 2WV1A 2XGDA 3F6VA 4IX7A 3W6VA 2NVXJ 1K4SA 3QAHA 2J5PA 1EH8A 5CLSA 3DV8A 3TGNA 2VPLA 2P5LC 1WHUA 2Y30A 1TW2A 1FEXA 5B3SH 1G59A 4HQEA 1IGNA 2BE5F 1X1CA 4XLCA 5GAEJ 1ZR4A 2NOGA 2XUBA 3CF2A 4L5JA 4F55A 3LQQA 4CCOA 4PZJA 2IVMA 1BJAA 4E7KA 5BS6A 1XN7A 2DOEA 3AG3H 2R7DA 1FBUA 1FBSA 2XGXA 2VL8A 1JTYA 1X3UA 2PMZA 3AL0B 1MNMC 1EJ9A 4OU0A 4QIWN 3F8BA 2XAUA 2R0QC 4N4NB 4E4HA 1K4TA 3QWLA 3K6GA 2R92J 3HGGA 5GPAA 3GFIA 2HDDA 2VQCA 2E2HJ 1IN4A 1O3TA 2ZCWA 4WXCA 2CG4A 2VKVA 2Y9YA 4PFOA 1RRJA 2TDXA 2E19A 3RYPA 3DXJF 3AG4H 4PUSA 1AKHB 1FYKA 3ASOH 4RB0A 4AUXA 5FO5A 4AYBA 3PQKA 4XONA 5BNGA 3HM5A 4XRSG 2IA0A 1UZCA 3DF8A 2ME0A 5HOOA 1HDPA 1TBXA 4KDPA 2EILH 2LFBA 3ABUA 3WHCA 5JHUA 4HNVA 4M9XA 4WK8F 2XRNA 1O3RA 4IRIA 3MMYB 2ESNA 4U88A 3CC4I 1VQ9I 4M72A 2DO7A 4G7OF 1D5YA 2FBHA 2Z33A 3P9IA 4Y33A 4F52A 3Q3SA 1MBJA 3BP8A 5F08A 2A5YB 2HYJA 2OPTA 2VIXA 3BTLA 1D8KA 3KEOA 4J01A 3LSGA 3VSKA 2QQ9A 1JHFA 4E7HA 1GVJA 1FIPA 2DT5A 1Y0UA 1MD0A 3WTYC 3TP0A 1S7EA 3OV8A 4OWRB 1ZH5A 2A68F 3BR2A 3LWFA 3ULQB 1IRXA 1JKPC 4EM1A 5K7ZA 1RIOH 1EH6A 3S2DJ 3LSRA 4IJAA 4IHVA 1JKQC 1ETYA 2VBZA 2ZB9A 4KN4X 3B6AA 4EATA 1XGSA 1G3TA 4GYIA 3G2BA 3QQAA 3HRSA 1LEAA 4U0VA 3ABKH 4WF2A 1R36A 4L5IA 3I53A 2Z1DA 2DT6A 2HQNA 5ICCA 2X0LA 4J19A 4ON0A 2RC4A 3CO6C 3LA2A 2LOOA 3M8EA 2DA7A 2L5QA 1ONVA 3KP6A 4OMYA 1Y39A 3PUFA 2HZTA 5HODA 3RKXA 4XLNF 3CCUI 4YFNF 2OC6A 4ZYHA 3LSHA 3OYFA 1HOMA 2FF4A 2K02A 2HVRA 3L2RA 3GEZA 4PJNA 3F9KA 2BY0A 4MTDA 1ON2A 3GFJA 1EV7A 1OR7C 3K4CA 1OYYA 5J6XA 1AWCA 4FQGA 3ZMSA 5E3MA 1BOBA 2K5CA 3BG3A 2LR8A 4PGGA 1BBYA 2CU7A 4E7SA 1U9NA 4GDFA 2DTRA 3SHFA 1UB9A 1X19A 2XAFA 4LLGF 1U8RA 3KYDB 2WC2A 2H6CA 3BR3A 3OYMA 2RQPA 2AQEA 4BXUA 3CESA 1DGRM 3P7NA 1STZA 1K61A 2M4KA 3E6BA 3CUQB 1X3ZB 1PP8F 2L7KA 1N25A 2X6WA 4AU7A 4DYCA 1YJ9I 1BIBA 1ZN2A 4ZJZA 4N9HA 2L4MA 4E7JA 1AA7A 2EFQA 5CJ9A 5HNHA 3CCLI 4HBLA 1HLVA 2VBXA 4QSHA 1U9OA 1PVEA 1V3FA 2LREA 2V7FA 3H3UA 3LL7A 4KIBA 1RESA 1ZAOA 5J4YA 4JOMA 1ZGWA 3OIQA 4X0GA 1FMVA 2X1CA 5LGNA 3PO3J 3IAM2 4IRGA 4HDVA 2LK2A 1F1ZA 1G6NA 4GGGA 3M1EA 4HX8A 4XOPA 5IT9Z 2GXBA 3I9V2 1YRNB 3GLLA 4C2MJ 2XKOA 1X2MA 5F0HA 3OOPA 3SDGA 4F92B 3K4LA 4Y13A 2EH3A 2LBFA 4ENMA 4A3KJ 2MG4A 1T39A 3TOAA 2HYGD 1TQMA 3HUGB 3PFIA 4AIKA 2K9LA 4FASD 2IGKA 1Q1HA 2IW5A 5F64A 4Q4ZF 3I55I 2XB5A 4C2TA 3HOVJ 2Z9OA 3F8NA 3OIOA 3BR0A 3E1SA 4F91B 1T6SA 2FMYA 1JUSA 4L5EA 3GYHX 5HLIA 3CMYA 3DLAA 1QQIA 1RETA 1JUPA 1ZLKA 1KYZA 3HRUA 5GTHC 2JK3A 3FISA 4A0ZA 2MLKA 5D5UB 1WQ2A 4HAMA 3GZ6A 1RUNA 4A93J 2DMPA 2ZMEA 2ACJA 4O3MA 1Z0XA 4Y4RA 4ESFA 2WB1A 2VJ4A 2Y75A 1MGTA 3FZVA 4FX4A 4L9JA 1RPWA 5E1WA 4Y17A 2VJ5A 4M6XA 3FXJA 2LKPA 3VWBA 5IYCJ 4NC8A 1SEUA 4XRSA 5M3MJ 5M5XJ 1P6RA 4BY1J 2CGPA 4CUGA 2LVSA 3E5UA 1R58A 3SQNA 2XGCA 4XKCA 4UUTA 3JRFA 4S04A 3N4MA 2PBIA 2P4WA 2R5YA 4DIQA 2R93J 2R7TA 4B3AA 1ETQA 1I3AA 4XQFA 4HLYA 1SD7A 2XF6A 5F27A 4E6KG 4C2UA 1TNSA 5KCMA 2W57A 2E1MC 1Z7LA 2R7OA 1FP2A 3RQ4A 4E7LA 1ZRFA 2MLGA 3KEYA 4XLPF 2MW8A 3PNYA 4IOAF 1HC8A 1ULYA 2QCOA 5KNLA 1D8JA 2EIMH 1IG7A 3ABLH 4DYRA 1BIAA 3HKZN 3RSNA 1P92A 3F22A 5L3FA 1S5LC 3VEPA 1YOVB 5C4JJ 3OS2A 2V26A 3H5NA 2CFXA 5L3CA 2HVSA 3KYCB 3LMMA 1YJNI 1QZYA 5CQGA 1FBQA 3SEQA 4NDLA 3I3LA 3DBRB 3CP8A 2ZXJA 3J80Z 3QOEA 3BQZA 2DA4A 2DCEA 2CH0A 5C4XJ 3KP5A 4MQVA 1WH7A 3S17J 1JXSA 4BXXJ 5D5XB 2CWEA 2MABA 4BDZA 1IXSB 1LE8A 2WAEA 2DMQA 4A69C 4BUPA 4HF2A 4LIVA 2OJED 2QYOA 1UELB 3V8JA 4BH9A 4Z6YA 1Z67A 4Y52J 1FIAA 1FT9A 2B0LA 2K9QA 3K7AJ 1P4XA 1IXCA 1MBHA 3RJPA 3RPUD 1KU7A 1R1UA 2KIUA 2HQ5A 4KUMA 4P96A 5F6FA 1K7AA 2DYRH 4NNJA 4CHUA 2R3SA 1YX5A 3B02A 2V1UA 1JHHA 3KEQA 1I1SA 2FQ4A 3ZMDA 5AIQA 1LDKB 1Y0NA 2CQQA 2X4HA 4PGHA 3JRBA 2KMUA 1Q1VA 2HEOA 3GTQJ 3SZPA 1D0XA 3CD6I 3PO2J 1HW5A 1J9IA 4KMUX 1K78A 3SFZA 2P7VB 2V1DA 4IQJA 4OOIA 2A05A 1IAWA 1XMAA 1R22A 4CYCA 4QPOA 2NVUB 2KIMA 5FGMA 2M7BA 3CUOA 1O3QA 1RKTA 1W5CC 3HPHA 2CYYA 1W7PD 2VASA 4BEHA 4BJTA 3HEFA 1RC9A 3FXOA 3BTIA 4U87A 1FSEA 4CCJA 1RR8C 2AS5F 4MTEA 2VC1A 2ICWG 3T1BA 3ZCOA 1ZGAA 3ESWB 2O9LA 2ZSIB 3FX3A 1S3JA 3K1MA 2L9VA 1VZ0A 5DYMA 3HKZA 2R7ZJ 3L1PA 2MA3A 4RM3A 2DPDA 3E6MA 2Y9ZA 2DI3A 3HOUJ 1YO5C 1YYVA 2JQ7A 2M30A 1W7PB 2CW8A 2IRFG 5B1BH 5DDGA 5EF6A 3PNTA 3PSIA 1RZ4A 4UV9A 3HTUA 2LY9A 1UFMA 3Q0UA 4QWQA 1B6AA 4XN3A 5IT3A 2YU9J 1GHCA 3OYJA 4XOTA 2WAFA 1DUXC 2Q1ZB 3M4OJ 2L7MP 2M0CA 1MMSA 2V4JC 1GXQA 3I0TA 3S1RJ 1ZG1A 2H94A 3ZQLA 1U3EM 1KU2A 4AC0A 4D0PA 4GYGA 3RQIA 1D0YA 4O5VA 5K1YA 1GT0C 2DA3A 3SXYA 1J75A 2PMUA 1A35A 4NUBA 1Y56A 3MEXA 2VBWA 1X3WB 1B8IB 3WTXC 5FLXZ 2ZBKA 1TWAJ 3FM3A 4Y3OA 1ETWA 2HTJA 2GA2A 4CCLA 3CMEI 1ETXA 3QPSA 3ZQGA 2ISYA 1TWGJ 3M8JA 3GW2A 5DM7F 3IL2A 4XORA 5DD4A 1BC7C 2HOTA 3BPXA 4D7NA 1SD5A 1QHHD 2EZKA 3REOA 2A3SA 3FF5A 3FMSA 3I56I 4GFBA 5A2QZ 1R23A 1BR2A 1YI2I 4CYCB 4PSWA 3G6EI 1MH4A 4RGXA 1BW6A 1OCOH 1YE9A 2M1BA 4E7ZA 5LHGA 1Z3YA 2QSHX 2EBIA 2QEXI 4PK4A 1ZARA 2FBIA 2VKDA 5GTIC 1WI9A 3ZQCA 5DCFA 1SVOA 3E97A 2XASA 1PUFB 3H35A 4DNCA 2RN7A 2RREA 3J81K 3J80K 1KA8A 2BVMA 3GTLJ 1ZK8A 5E3LA 2GM4A 3HTSB 4IF4A 2VXZA 1MSFC 2MH9A 3OSGA 3CCSI 4I2OA 2ZJPF 2AXLA 4ZYGA 4IKFA 2CQKA 1WJCA 2QBYA 1YW9A 2XSDC 5E20A 2CW0F 4JX5A 3H9GA 1F36A 2DMTA 2IGNA 5J40A 2F6CA 2RKHA 2NS8A 3R60A 4U7BA 4LIUA 2VPRA 3CCQI 4UHTA 2KJBA 5J1YA 3JRCA 4HPQA 1IRGA 1ZELA 3COAC 1W1WE 4KFCA 3K4KA 2RVCA 4FETA 4EVIA 4IHWA 3PFYA 3PNVA 3ZMUA 2JA5J 2LLKA 4DYQA 1JKOC 2A07F 4KNYA 2VUMJ 3S3NA 4YEJA 3DEWA 4I09A 2COBA 1MIJA 1XGNA 3FXQA 3SDBA 1A6QA 1A6IA 2VT2A 1DP3A 1JKRC 1T95A 2LDUA 1F43A 1DQUA 4C3IJ 2ZNYA 1VQOI 2Y31A 2EV0A 1B8IA 1JJ8C 1H89C 2ZC2A 2E60A 5CVIA 3RTRA 2A6HF 4HW0A 2VOPA 4UV8A 1R1TA 2GXAA 4L9NA 1A04A 3RZOJ 2IA2A 1K83J 4XIDA 3VDXA 4A3EJ 4KJZA 1VQLI 4ZDLA 1IJWC 2M34A 2X51A 1O7FA 3LA3A 1VTNC 2R7SA 3LAJA 3QYBA 4HA8A 2MC4A 1YW7A 2QQBA 1WKMA 4IHYA 3RYRA 4S05A 2D5VA 3FMQA 1ENHA 5FFZA 3GTOJ 4EJUA 2CW7A 2QLZA 1X1AA 1ODDA 1Y1WJ 5H2FC 1IF1A 4I99C 2UXNA 4RBOA 3CO7C 3V7CA 3HOZJ 1F9NA 1KU9A 2LBFB 1J2XA 2K3FA 4FCYA 3J81Z 2QA4I 2Y48A 5IT9K 3H3ZA 2P6SA 2V1XA 2WTEA 2WY7Q 3JRIA 3R6SA 3HUGA 3I71A 2XDVA 1TZLA 2GBYA 3HL2A 1XGMA 4XRMA 2FNPA 3RKQA 1BR1A 2UUZA 2QKMB 3OYNA 4M71A 3V42A 2HOAA 2VN2A 5D8KB 3BR1A 2KL4A 2PG4A 2CV2A 3DP7A 1LVAA 2L9SA 2ESHA 3OSFA 2LKXA 3ZMTA 4YRVA 2K9NA 3R61A 4Q5SF 3LSJA 2JA2A 2W82A 4B3XA 1WI3A 1BM9A 5EG0A 2IGMA 2XV4S 1W0UA 3CJRB 4GRIA 3GZ5A 4A3CJ 4C3JJ 2XAGA 1JT6A 5DUKA 1SAUA 2R5ZA 2FNAA 2K86A 1EH7A 3BOQA 2M7AA 3CCVI 4HNTA 2PMHA 3S3OA 4U7DA 2YUSA 2M8GX 3LFUA 4UVAA 3UNGC 4A5MA 3ECOA 4KIGA 4WXDA 1GVDA 5F1JA 3KE2A 1WPKA 1FSHA 4N9IA 4P5OA 2QF7A 1T33A 1V54H 3KZYA 3Q9VA 3C2BA 1HSTA 2F5DA 1P4AA 1XX5A 2E71A 4NQWB 4A3FJ 2STTA 3BDDA 3EUKL 1U6GA 2L9RA 3HBLA 2G9WA 5GAHJ 4EM2A 4I0AA 2JVGA 2R7FA 2LP0A 2DFFA 4B4CA 1N75A 4LB6B 4ESJA 3H1CA 1X1PA 3DKYA 1PP7U 3F3XA 3KZZA 4U0WA 3Q0WA 4FE4A 4RB1A 4V2FA 1MNEA 3A0BC 5ED4A 2GOXB 3JRGA 1WJFA 4KMFA 3V8LA 3AFHA 4DJAA 1MDMA 1K79A 1BI2A 2DA6A 3KCCA 4XBFA 2IS4A 2KP6A 1X2NA 1R7JA 3LFKA 4N4OB 3ZQHA 1B72A 3ERED 2BEOA 3RZDJ 4K2EA 3GF2A 3FHZA 2HQAA 1CQTA 1XDSA 4M74A 1UJ8A 2H09A 3EQLF 2NS0A 2KDZA 3WU2C 5LGTA 4G6TB 3OYEA 4BAYA 2PJRA 3GO5A 1YFHA 4EJWA 4IQ4A 1MMDA 4ZH4F 1XMXA 5E17F 1Z7UA 2XVCA 3C1DA 1KGSA 3WGIA 4M3DA 1BA5A 2OD5A 1LJ9A 2YSRA 2E1MB 1OR7A 4NC6A 5CVRA 2VE9A 2PI0A 2WY8Q 3QPHA 4LMYA 1U0JA 1D5VA 3AG1H 3GZNB 2JJ7A 3QODA 4AVPA 2O8KA 1RNLA 3FDYA 1FTTA 1BW5A 4RB2C 4OMZA 3W2AA 2XAHA 1SD6A 2DFIA 3U21A 3DU6A 3F6OA 2XSJC 1ERDA 2L01A 2FOKA 4IHTA 1VQ6I 5DEQA 2XRLA 1AKHA 2VQHA 3L2CA 3A1YA 4R8HA 1CGPA 2E1NA 4ENKA 1W4MA 3K4MA 3W2VA 3BT9A 3IWZA 4EJTA 4F93B 2X1DA 3TDZC 1XCBA 1B1BA 2EFPA 4M3BA 1N78A 5E3NA 2I8DA 1R49A 1KQ8A 1VF9A 2E2IJ 4OIRF 3DBLB 4XL9A 1VQKI 1D1CA 4CGZA 5C3EJ 3TOBA 3VFZA 3A01A 3OOUA 2VQGA 2WB1N 2XHKA 3MAJA 4CSWA 4Q47A 3ZP5A 5EYRA 1SFOJ 2QSGX 2EV6A 4H4KC 3QU6A 2EJRA 2R5YB 1LB2A 3L2VA 3LSTA 4ZZDA 3O6BB 2OAZA 2O7OA 2EK5A 3WG9A 4PJMA 2X48A 1ZQ3P 2G0EA 3QU3A 2DA2A 2B9SA 2ID3A 3FIWA 3S8PA 3RI4A 2QM3A 3ONQA 5BMZA 5JFRA 2V79A 1LNWA 4P9UA 2X85A 2HDCA 5H6QA 2V6EA 4LG0B 2IPQX 2V9VA 5EZGA 4IO9F 5JLXA 5KVRA 1VQNI 3ASNH 2FX0A 3F23A 1SFXA 3BROA 4BKXA 3IRRA 2O0YA 3LQRA 3F8CA 1C0WA 4BXFA 5EGOB 5DM6F 4JK1X 2JA8J 4CA0A 5DCMA 4MLOA
chains in the Genus database with same CATH topology
5LRSA 2FSWA 1LDJA 3WTZA 2NYXA 1MKMA 5LHHA 4M6YA 4RGUA 2Z5UA 1ZGJA 4A0XA 2DBBA 4LGWA 1OKRA 4XSZF 1E2XA 1K6OA 1L0OC 1MJAA 1MJ9A 1O7LA 1LEBA 2VT3A 4LJZF 3H92A 5BPDA 1Z6TA 2HKXA 4RAYA 4LD5A 2FMLA 2L02A 4ENJA 5J8CA 3EUHA 5TRDA 3L9FA 1Z05A 2JPBA 4FHTA 1YS6A 3KETA 3ZQ7A 4I02A 4FX0A 1KQ9A 1J5YA 2OBPA 1S6LA 1WWXA 2HQRA 3T0YA 1TW3A 1L3LA 1KQ0A 1Z91A 1YTYA 1IN7A 4L9TA 5CVJA 1J59A 2M87A 2DU9A 1IN5A 4A12A 3TO7A 3ZMVA 1WSUA 3R4KA 1F5TA 2K27A 2VE8A 3HHHA 4I7HA 2HGCA 2BV6A 4F7ZA 3O2PE 5LEJA 3HRTA 3WGGA 2K4BA 2L54A 4CO8A 3JAMZ 1DPUA 3RKYA 5ILVA 4LLNA 3GVAA 2YPRA 4NHJA 1HSJA 3MWMA 1H9TA 4H0EA 3C18A 5DD8A 3IRQA 4EM0B 1G4DA 2XIGA 5L3BA 5LBQA 1ON1A 4KA4A 1FC3A 3HIFA 2DQLA 2KJCA 1FLIA 1USTA 2VODA 2YX4A 4LLLA 5J8FA 2HOEA 4NQWA 3K9TA 2NNYA 1IN6A 3WTWC 2QVOA 3E3VA 4RB3C 3C7JA 2OU2A 2BGCA 2ZNZA 4RGSA 3HSEA 4WX9A 2HKOA 3D5LA 3I64A 4AWXB 2JT1A 1F4KA 1ZRCA 2P5VA 5DUIA 2NAZA 1QGPA 2HWVA 1UHWA 2M45A 1ZREA 2DQRA 4IXAA 3E6DA 1V4RA 2A6EF 3G3ZA 4WCGA 3RKWA 1UHMA 5E1XA 2HTSA 1D3YA 3WU1B 1SAXA 5L3EA 4OIPF 1R5HA 4LB5A 5EEGA 3CTAA 3I54A 5D6FA 1PUEE 3V7RA 1FP1D 4BHPA 3Q5FA 4IRHA 3VODA 4IHSA 2IJLA 3ELKA 2EFOA 1HQCA 2DPUA 2IA1A 2HYFA 4MEYF 5EEHA 2VC0A 2Q8KA 5FLXK 3K2ZA 3B73A 1U2WA 2O8XA 3GLXA 1SMYF 2QQAA 2F5CA 5CVVA 1CF7A 3F72A 3F8FA 4EGYA 2NRAC 1IUYA 3I59B 1OMIA 2MBFA 3T5XA 1SFEA 4KN7X 2P6TA 2OQRA 5LEKA 3CLOA 2W24A 4YIFA 4HZFA 3EYIA 3QP6A 1KU3A 1I6XA 4RAZA 4WWCA 4N0BA 2P5KA 1LDDA 4Z2YA 3HYIA 3FM5A 2LF7A 4BHCA 2PN6A 1B4AA 3WTSC 1SD4A 3K1NA 1PDNC 1BI3A 3ZN1A 3CUQC 1LQ1A 2Q0OA 4CXFA 1U5TA 2P8TA 3TO6A 3V8KA 2GQQA 4M73A 1I1GA 1YG2A 4EQQA 2D1VA 4YG2F 3I59A 4HDUA 3QRFF 1HW1A 1H9GA 3K1PA 3HSFA 1QZZA 5E18F 3WGHA 2FXAA 1J0RA 1FY7A 3T8RA 5BPIA 1DDNA 4PDKA 1TLHB 3ISPA 1R5GA 2HS5A 2UZKA 2VBYA 3GUDA 2MD5A 1T98A 3E5QA 2MC3A 4TV7A 2GWRA 4RS8A 2F2EA 2RV8A 3E5XA 1XSXA 3RIRA 3J7AO 3KP7A 4WXHA 5HDGA 4B8XA 1TNTA 2EFWA 2W84A 2JSCA 4A5NA 3F8MA 2GIVA 4G7HF 3BJ6A 3BJOA 4NB5A 4MGRA 4P9FA 1TTYA 4G6DA 1XCVA 4HX4A 4EMSA 3WTVC 2A69F 4KICA 4G8XA 2KIFA 4HF1A 3BY6A 5D4SA 2QBYB 5FB2A 3GFLA 2JRTA 4CDGA 1B59A 1B9NA 4ESBA 2EA2A 1XB4A 2YX7A 5HLGA 5HVQC 3DEUA 2EV5A 3L09A 1I27A 1MZBA 4RGRA 2JPCA 3ZMZA 4GXOA 1NHAA 3GXOA 2HFHA 4A6DA 3MZYA 5D6EA 2OQGA 4LK1F 2STWA 3R0AA 1DP7P 4FT8A 4L0YB 1OYWA 5A2QK 1KYWA 2FU4A 5ICEA 4G9YA 3SZTA 4AIHA 4A0YA 1ZLJA 3RPUA 1FX7A 3KFWX 3HOSA 3L00A 2H6BA 3NEUA 3PQJA 3M9AA 2O61A 5LHIA 4I01A 2XROA 1HXDA 4BYYA 4EGZA 3ABTA 3DFGA 2COMA 3LA7A 3MZHA 3BPVA 4Q48A 6PAXA 5DCMB 2O03A 3FWEA 4ZYEA 5AONA 1GXPA 3RPQA 3WTTC 1S7OA 1IW7F 5E8IA 2JZYA 4MHGA 4B09A 5HS9A 3FMRA 3WE2A 2DAOA 3BJAA 5CVUA 3KP3A 2EFNA 3M8FA 3NQOA 3TO9A 2OZUA 3D0SA 4M9SA 5JVTA 2M5WA 3HOTA 4HOBA 2WV0A 1ZYRF 2PFBA 5BOXA 1FOKA 3N97A 2O3FA 4M9ZA 4PCQA 4U0YA 1BI1A 3QOPA 1IZ1A 2FEZA 4JQFA 3HRMA 3L7WA 3CUQA 1IXRC 1TQIA 2CSOA 4MQ9F 5ICFA 2YU3A 2GZWA 5ILSA 4UNOA 3VB2A 3GX4X 4R1HA 2D45A 1P4WA 2ADUA 4L9VA 3IKVA 1R00A 5FFXA 5HLHA 1QNTA 3WU0A 1K78B 1B9MA 3M7GA 1G3YA 3W6KB 3RDIA 2E7XA 1RI7A 3KLOA 1FYLA 2ELHA 2QWWA 2P7CB 3KP4A 2LF8A 1YLFA 2O6GE 3BWGA 2UWMA 2XAJA 3T8TA 5H6RA 2XKPA 2E1CA 3GFMA 5F1RA 5L3DA 3ECHA 5D5VB 3ML6A 3HSRA 4HV6A 2ZMEB 4IPAA 3W6JB 1FYMA 3FXUA 3IKTA 3EYYA 1U5TC 3DPLC 3LAPA 1P2FA 4ETSA 1YQAA 4AIJA 4GCVA 2NNNA 2FQ3A 3IHUA 1U5TB 1XMKA 1W7PA 5LGUA 1USSA 3WODF 4HX7A 4P55A 3DKWA 4OIQF 1SFUA 2KRFA 4XSXF 1REPC 2K4JA 2W85A 3P9KA 1ZRDA 5HS8A 2ISZA 4ZYDA 2OZ6A 3S2WA 4E70A 2ZKZA 2XAQA 2WWYA 2Y0MA 1H0MA 2L3DA 1BN5A 1XDUA 3I58A 4DQ2A 3JTHA 4YFKF 2PEXA 1DPRA 5DV5A 2QENA 2UXXA 2LSOA 1J7KA 2YR2A 4EJVA 4G94A 4UXNA 2PLYA 5LLQA 1Z1DA 5TJJA 2H27A 1W5SA 3QP5A 2L4AA 2DK5A 3K69A 1XGOA 1XD7A 4BQAA 2QZ8A 2DW4A 4MEXF 3MQ0A 5ICGA 2Z3YA 2GXGA 3MFKA 4A2UA 1MJBA 5E1ZB 1SMTA 2F5FA 4HYEA 2HR3A 1HKQA 4R79A 3ZPLA 5K5RA 2VOOA 4LK0F 1RUOA 3I4PA 1QBJA 4EJOA 1MDMB 3P9CA 2EB7A 2W25A 3EETA 5K5QA 4HQMA 1BI0A 1UCRA 3HHGA 4BHBA 1YS7A 3TQNA 3KLNA 1G3WA 1FNNA 1T38A 5H20A 2J5OA 3TKYA 4L18B 1T0FA 5BQTA 3O3KA 2RGVA 1G3SA 5D5WB 1O3SA 2D2WA 5AIPA 2IT0A 2PJPA 3CDHA 5LRRA 3JSPA 4KYWA 5CYVA 5JR3A 4I98B 2MH2A 3WE3A 2RNJA 3K0LA 1QO0D 4O6JA 5HDKA 1XSVA 4MNUA 4CZZA 4YIIA 5D4RA 5JI6A 4QLCU 2GA1A 1ZG5A 3V4GA 3ZN0A 2KKOA 3GWZA 3AAFA 4G6QA 4XRFA 2FA5A 2C6YA 1FWZA 2OA4A 2Q2EA 4I0BA 4ENNA 2F5EA 5L3GA 3JAMK 3U2RA 1S29A 3MCZA 4CYDA 5K5OA 3U9GA 3WTUC 4HLXA 1E17A 2DLLA 3F21A 3E6CC 4IVNA 1FPQA 3C3WA 1OYIA 5FD5A 1T2KA 1R1VA 4A6EA 2CO5A 4OIOF 3IWFA 1XSDA 2EWNA 4ASNA 2M8EA 5HS7A 2FRHA 3NRVA 2G7UA 2EA4A 4BNCA 2E7WA 2Z99A 2PQ8A 5FD6A 3JW4A 3IC7A 3TDUC 1U78A 4L0ZB 2BYVE 3JTGA 1QPMA 4HV5A 3U1DA 2ETHA 1HKSA 1Z9CA 1JGSA 1ZHFA 2BBYA 2RDPA 1Z6RA 1HBXG 1OPCA 4KT5C 1I5ZA 1HW2A 5HDNA 2JTVA 1FZPB 1CF7B 2LNBA 2IP2A 3G73A 4GO1A 1S7AA 1AOYA 3R0JA 4EV0A 4UVBA 2DK8A 5ERIA 3VOEA 1S8NA 5ILUA 2ZJ2A 4AD9A 4JBAA 3I5UA 1ZG3A 2V6CA 5D8LB 4KIFA 4Y15A 1BOAA 3DQVC 3ROUA 4LFUA 2A61A 3V7SA 2FE3A 3JSOA 1HKTA 3KP2A 4ZZLA 1WRJA 1TQPA 2QUFA 3EDPA 2GAUA 1BC8C 2D1HA 3BZ6A 3Q9SA 2K7LA 1IRFA 4YFXF 4UUVA 1YW8A 2G7HA 4OINF 1W5TA 3CJNA 4HF0A 1O57A 4G7ZF 2ZO4A 3QPTA 4UVCA 4CICA 1JE8A 5E8GA 2VONA 2FBKA 3FXRA 1YIOA 4LG0A 2ZFWA 1IN8A 3DPTA 3F6VA 3QAHA 2J5PA 1EH8A 5CLSA 3DV8A 3TGNA 2P5LC 1TW2A 4HQEA 2BE5F 2XUBA 4L5JA 3LQQA 4PZJA 2IVMA 1BJAA 5BS6A 1XN7A 2R7DA 1FBUA 1FBSA 2XGXA 1X3UA 4OU0A 3F8BA 3GFIA 1IN4A 1O3TA 2ZCWA 4WXCA 2CG4A 2TDXA 3RYPA 3DXJF 1FYKA 4RB0A 5FO5A 3PQKA 2IA0A 3DF8A 5HOOA 1TBXA 4KDPA 3ABUA 5JHUA 4M9XA 4WK8F 2XRNA 1O3RA 4IRIA 2ESNA 4U88A 4M72A 2DO7A 4G7OF 2FBHA 2Z33A 3P9IA 3BP8A 2A5YB 1D8KA 3KEOA 2QQ9A 1JHFA 1GVJA 2DT5A 1Y0UA 1MD0A 3WTYC 3OV8A 1ZH5A 2A68F 3LWFA 3ULQB 4EM1A 1RIOH 1EH6A 4IJAA 2VBZA 4KN4X 1XGSA 1G3TA 4GYIA 3HRSA 1LEAA 4U0VA 4WF2A 1R36A 4L5IA 3I53A 2HQNA 5ICCA 2X0LA 4ON0A 2RC4A 3CO6C 3LA2A 3M8EA 1ONVA 3KP6A 4OMYA 2HZTA 3RKXA 4XLNF 4YFNF 4ZYHA 2FF4A 2K02A 3GEZA 4MTDA 1ON2A 3GFJA 1EV7A 1OYYA 5J6XA 1AWCA 3ZMSA 4PGGA 1BBYA 2DTRA 3SHFA 1UB9A 2XAFA 4LLGF 1U8RA 2WC2A 2H6CA 2RQPA 4BXUA 3P7NA 1STZA 3E6BA 3CUQB 1PP8F 1BIBA 1ZN2A 4N9HA 2L4MA 2EFQA 5CJ9A 4HBLA 2VBXA 1V3FA 4KIBA 3H3UA 1ZAOA 5LGNA 4IRGA 4HDVA 1F1ZA 1G6NA 4GGGA 3M1EA 4HX8A 5IT9Z 2GXBA 2XKOA 3OOPA 4Y13A 4ENMA 1T39A 4AIKA 2HYGD 1TQMA 3PFIA 3TOAA 1Q1HA 2IW5A 5F64A 4Q4ZF 2Z9OA 3F8NA 1T6SA 2FMYA 3GYHX 5HLIA 1QQIA 1ZLKA 1KYZA 3HRUA 4A0ZA 2MLKA 5D5UB 1WQ2A 4HAMA 3GZ6A 1RUNA 2ZMEA 2ACJA 4O3MA 4ESFA 2Y75A 1MGTA 3FZVA 4FX4A 4L9JA 5E1WA 4Y17A 4M6XA 2LKPA 1P6RA 2CGPA 3E5UA 1R58A 3SQNA 4S04A 3N4MA 2PBIA 2P4WA 4HLYA 1SD7A 1TNSA 2W57A 1FP2A 1ZRFA 2MLGA 4XLPF 1ULYA 1D8JA 1BIAA 3F22A 1P92A 5L3FA 3VEPA 5L3CA 2CFXA 1QZYA 1FBQA 2ZXJA 3J80Z 3KP5A 4MQVA 1JXSA 5D5XB 2CWEA 1IXSB 4HF2A 2QYOA 3V8JA 4BH9A 1FT9A 2B0LA 1P4XA 1IXCA 3RJPA 1KU7A 1R1UA 2KIUA 5F6FA 1K7AA 4KUMA 4P96A 4CHUA 2R3SA 3B02A 2V1UA 1JHHA 3KEQA 1I1SA 3ZMDA 5AIQA 1LDKB 2X4HA 4PGHA 2HEOA 3SZPA 1HW5A 1J9IA 4KMUX 1K78A 3SFZA 2P7VB 2V1DA 4OOIA 1IAWA 1XMAA 1R22A 2KIMA 5FGMA 3CUOA 1O3QA 2CYYA 1W7PD 2AS5F 1FSEA 4MTEA 2VC1A 3T1BA 1ZGAA 3FX3A 1S3JA 3K1MA 5DYMA 2MA3A 2DPDA 3E6MA 2DI3A 1YO5C 1YYVA 2M30A 1W7PB 2IRFG 5DDGA 1RZ4A 4UV9A 3HTUA 1UFMA 4QWQA 1B6AA 5IT3A 1GHCA 1DUXC 1ZG1A 1GXQA 3I0TA 2H94A 1U3EM 1KU2A 4D0PA 4GYGA 4O5VA 5K1YA 3SXYA 1J75A 2PMUA 3MEXA 2VBWA 3WTXC 5FLXZ 2ZBKA 3FM3A 2HTJA 2GA2A 2ISYA 3GW2A 3IL2A 5DD4A 1BC7C 3BPXA 1SD5A 3REOA 2A3SA 3FF5A 3FMSA 5A2QZ 1R23A 4RGXA 5LHGA 2M1BA 1ZARA 2FBIA 1WI9A 5DCFA 3E97A 2XASA 4DNCA 2RN7A 3J81K 3J80K 1KA8A 3HTSB 4IF4A 2VXZA 2MH9A 4I2OA 2AXLA 4ZYGA 2CQKA 2QBYA 1YW9A 5E20A 2CW0F 2RKHA 3R60A 4U7BA 4UHTA 2KJBA 1IRGA 3COAC 4KFCA 2RVCA 4EVIA 3ZMUA 2A07F 4KNYA 4I09A 1XGNA 3FXQA 2VT2A 2LDUA 2ZNYA 2EV0A 5CVIA 3RTRA 2A6HF 4HW0A 2VOPA 4UV8A 1R1TA 4L9NA 1A04A 2IA2A 1O7FA 3LA3A 1VTNC 3LAJA 4HA8A 1YW7A 2QQBA 1WKMA 3RYRA 4S05A 3FMQA 5FFZA 4EJUA 2QLZA 1ODDA 1IF1A 2UXNA 3CO7C 3V7CA 1F9NA 1KU9A 1J2XA 3J81Z 2Y48A 5IT9K 3H3ZA 2P6SA 2V1XA 2WTEA 3R6SA 3HUGA 3I71A 1XGMA 2FNPA 4M71A 2VN2A 5D8KB 2PG4A 3DP7A 1LVAA 2ESHA 3ZMTA 3R61A 4Q5SF 1BM9A 2XV4S 3GZ5A 2XAGA 5DUKA 2FNAA 2K86A 1EH7A 3BOQA 2PMHA 4U7DA 4A5MA 4UVAA 3ECOA 4KIGA 4WXDA 3KE2A 1FSHA 4N9IA 4P5OA 3KZYA 3Q9VA 1HSTA 2F5DA 1P4AA 2STTA 3BDDA 1U6GA 2G9WA 4EM2A 4I0AA 2R7FA 4LB6B 4ESJA 1PP7U 3F3XA 3KZZA 4U0WA 4RB1A 5ED4A 4KMFA 3V8LA 1MDMA 1K79A 1BI2A 3KCCA 4XBFA 1R7JA 3LFKA 3ERED 2BEOA 4K2EA 3GF2A 3FHZA 1XDSA 4M74A 2H09A 3EQLF 2NS0A 5LGTA 4BAYA 3GO5A 1YFHA 4EJWA 4ZH4F 5E17F 1Z7UA 2XVCA 3C1DA 1KGSA 3WGIA 2OD5A 1LJ9A 2YSRA 1OR7A 5CVRA 2VE9A 2PI0A 3QPHA 4LMYA 1D5VA 4AVPA 1RNLA 4RB2C 4OMZA 2XAHA 1SD6A 2DFIA 3F6OA 2L01A 4IHTA 2FOKA 5DEQA 3L2CA 4R8HA 1CGPA 2E1NA 4ENKA 1W4MA 3IWZA 4EJTA 3TDZC 1XCBA 1B1BA 2EFPA 1KQ8A 4OIRF 4CGZA 3TOBA 3VFZA 2XHKA 3MAJA 4Q47A 3ZP5A 2EV6A 3QU6A 2EJRA 1LB2A 3LSTA 4ZZDA 3O6BB 2OAZA 2EK5A 3WG9A 3QU3A 3RI4A 2QM3A 5BMZA 5JFRA 2V79A 1LNWA 4P9UA 2HDCA 5H6QA 4LG0B 2IPQX 2V9VA 5KVRA 3F23A 1SFXA 3IRRA 3BROA 2O0YA 3LQRA 3F8CA 1C0WA 4JK1X 5DCMA 5KK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LRS A;  2FSW A;  1LDJ A;  3WTZ A;  2NYX A;  1MKM A;  5LHH A;  4M6Y A;  4RGU A;  2Z5U A;  1ZGJ A;  4A0X A;  2DBB A;  4LGW A;  1OKR A;  4XSZ F;  1E2X A;  1K6O A;  1L0O C;  1MJA A;  1MJ9 A;  1O7L A;  1LEB A;  2VT3 A;  4LJZ F;  3H92 A;  5BPD A;  1Z6T A;  2HKX A;  4RAY A;  4LD5 A;  2FML A;  2L02 A;  4ENJ A;  5J8C A;  3EUH A;  5TRD A;  3L9F A;  1Z05 A;  2JPB A;  4FHT A;  1YS6 A;  3KET A;  3ZQ7 A;  4I02 A;  4FX0 A;  1KQ9 A;  1J5Y A;  2OBP A;  1S6L A;  1WWX A;  2HQR A;  3T0Y A;  1TW3 A;  1L3L A;  1KQ0 A;  1Z91 A;  1YTY A;  1IN7 A;  4L9T A;  5CVJ A;  1J59 A;  2M87 A;  2DU9 A;  1IN5 A;  4A12 A;  3TO7 A;  3ZMV A;  1WSU A;  3R4K A;  1F5T A;  2K27 A;  2VE8 A;  3HHH A;  4I7H A;  2HGC A;  2BV6 A;  4F7Z A;  3O2P E;  5LEJ A;  3HRT A;  3WGG A;  2K4B A;  2L54 A;  4CO8 A;  3JAM Z;  1DPU A;  3RKY A;  5ILV A;  4LLN A;  3GVA A;  2YPR A;  4NHJ A;  1HSJ A;  3MWM A;  1H9T A;  4H0E A;  3C18 A;  5DD8 A;  3IRQ A;  4EM0 B;  1G4D A;  2XIG A;  5L3B A;  5LBQ A;  1ON1 A;  4KA4 A;  1FC3 A;  3HIF A;  2DQL A;  2KJC A;  1FLI A;  1UST A;  2VOD A;  2YX4 A;  4LLL A;  5J8F A;  2HOE A;  4NQW A;  3K9T A;  2NNY A;  1IN6 A;  3WTW C;  2QVO A;  3E3V A;  4RB3 C;  3C7J A;  2OU2 A;  2BGC A;  2ZNZ A;  4RGS A;  3HSE A;  4WX9 A;  2HKO A;  3D5L A;  3I64 A;  4AWX B;  2JT1 A;  1F4K A;  1ZRC A;  2P5V A;  5DUI A;  2NAZ A;  1QGP A;  2HWV A;  1UHW A;  2M45 A;  1ZRE A;  2DQR A;  4IXA A;  3E6D A;  1V4R A;  2A6E F;  3G3Z A;  4WCG A;  3RKW A;  1UHM A;  5E1X A;  2HTS A;  1D3Y A;  3WU1 B;  1SAX A;  5L3E A;  4OIP F;  1R5H A;  4LB5 A;  5EEG A;  3CTA A;  3I54 A;  5D6F A;  1PUE E;  3V7R A;  1FP1 D;  4BHP A;  3Q5F A;  4IRH A;  3VOD A;  4IHS A;  2IJL A;  3ELK A;  2EFO A;  1HQC A;  2DPU A;  2IA1 A;  2HYF A;  4MEY F;  5EEH A;  2VC0 A;  2Q8K A;  5FLX K;  3K2Z A;  3B73 A;  1U2W A;  2O8X A;  3GLX A;  1SMY F;  2QQA A;  2F5C A;  5CVV A;  1CF7 A;  3F72 A;  3F8F A;  4EGY A;  2NRA C;  1IUY A;  3I59 B;  1OMI A;  2MBF A;  3T5X A;  1SFE A;  4KN7 X;  2P6T A;  2OQR A;  5LEK A;  3CLO A;  2W24 A;  4YIF A;  4HZF A;  3EYI A;  3QP6 A;  1KU3 A;  1I6X A;  4RAZ A;  4WWC A;  4N0B A;  2P5K A;  1LDD A;  4Z2Y A;  3HYI A;  3FM5 A;  2LF7 A;  4BHC A;  2PN6 A;  1B4A A;  3WTS C;  1SD4 A;  3K1N A;  1PDN C;  1BI3 A;  3ZN1 A;  3CUQ C;  1LQ1 A;  2Q0O A;  4CXF A;  1U5T A;  2P8T A;  3TO6 A;  3V8K A;  2GQQ A;  4M73 A;  1I1G A;  1YG2 A;  4EQQ A;  2D1V A;  4YG2 F;  3I59 A;  4HDU A;  3QRF F;  1HW1 A;  1H9G A;  3K1P A;  3HSF A;  1QZZ A;  5E18 F;  3WGH A;  2FXA A;  1J0R A;  1FY7 A;  3T8R A;  5BPI A;  1DDN A;  4PDK A;  1TLH B;  3ISP A;  1R5G A;  2HS5 A;  2UZK A;  2VBY A;  3GUD A;  2MD5 A;  1T98 A;  3E5Q A;  2MC3 A;  4TV7 A;  2GWR A;  4RS8 A;  2F2E A;  2RV8 A;  3E5X A;  1XSX A;  3RIR A;  3J7A O;  3KP7 A;  4WXH A;  5HDG A;  4B8X A;  1TNT A;  2EFW A;  2W84 A;  2JSC A;  4A5N A;  3F8M A;  2GIV A;  4G7H F;  3BJ6 A;  3BJO A;  4NB5 A;  4MGR A;  4P9F A;  1TTY A;  4G6D A;  1XCV A;  4HX4 A;  4EMS A;  3WTV C;  2A69 F;  4KIC A;  4G8X A;  2KIF A;  4HF1 A;  3BY6 A;  5D4S A;  2QBY B;  5FB2 A;  3GFL A;  2JRT A;  4CDG A;  1B59 A;  1B9N A;  4ESB A;  2EA2 A;  1XB4 A;  2YX7 A;  5HLG A;  5HVQ C;  3DEU A;  2EV5 A;  3L09 A;  1I27 A;  1MZB A;  4RGR A;  2JPC A;  3ZMZ A;  4GXO A;  1NHA A;  3GXO A;  2HFH A;  4A6D A;  3MZY A;  5D6E A;  2OQG A;  4LK1 F;  2STW A;  3R0A A;  1DP7 P;  4FT8 A;  4L0Y B;  1OYW A;  5A2Q K;  1KYW A;  2FU4 A;  5ICE A;  4G9Y A;  3SZT A;  4AIH A;  4A0Y A;  1ZLJ A;  3RPU A;  1FX7 A;  3KFW X;  3HOS A;  3L00 A;  2H6B A;  3NEU A;  3PQJ A;  3M9A A;  2O61 A;  5LHI A;  4I01 A;  2XRO A;  1HXD A;  4BYY A;  4EGZ A;  3ABT A;  3DFG A;  2COM A;  3LA7 A;  3MZH A;  3BPV A;  4Q48 A;  6PAX A;  5DCM B;  2O03 A;  3FWE A;  4ZYE A;  5AON A;  1GXP A;  3RPQ A;  3WTT C;  1S7O A;  1IW7 F;  5E8I A;  2JZY A;  4MHG A;  4B09 A;  5HS9 A;  3FMR A;  3WE2 A;  2DAO A;  3BJA A;  5CVU A;  3KP3 A;  2EFN A;  3M8F A;  3NQO A;  3TO9 A;  2OZU A;  3D0S A;  4M9S A;  5JVT A;  2M5W A;  3HOT A;  4HOB A;  2WV0 A;  1ZYR F;  2PFB A;  5BOX A;  1FOK A;  3N97 A;  2O3F A;  4M9Z A;  4PCQ A;  4U0Y A;  1BI1 A;  3QOP A;  1IZ1 A;  2FEZ A;  4JQF A;  3HRM A;  3L7W A;  3CUQ A;  1IXR C;  1TQI A;  2CSO A;  4MQ9 F;  5ICF A;  2YU3 A;  2GZW A;  5ILS A;  4UNO A;  3VB2 A;  3GX4 X;  4R1H A;  2D45 A;  1P4W A;  2ADU A;  4L9V A;  3IKV A;  1R00 A;  5FFX A;  5HLH A;  1QNT A;  3WU0 A;  1K78 B;  1B9M A;  3M7G A;  1G3Y A;  3W6K B;  3RDI A;  2E7X A;  1RI7 A;  3KLO A;  1FYL A;  2ELH A;  2QWW A;  2P7C B;  3KP4 A;  2LF8 A;  1YLF A;  2O6G E;  3BWG A;  2UWM A;  2XAJ A;  3T8T A;  5H6R A;  2XKP A;  2E1C A;  3GFM A;  5F1R A;  5L3D A;  3ECH A;  5D5V B;  3ML6 A;  3HSR A;  4HV6 A;  2ZME B;  4IPA A;  3W6J B;  1FYM A;  3FXU A;  3IKT A;  3EYY A;  1U5T C;  3DPL C;  3LAP A;  1P2F A;  4ETS A;  1YQA A;  4AIJ A;  4GCV A;  2NNN A;  2FQ3 A;  3IHU A;  1U5T B;  1XMK A;  1W7P A;  5LGU A;  1USS A;  3WOD F;  4HX7 A;  4P55 A;  3DKW A;  4OIQ F;  1SFU A;  2KRF A;  4XSX F;  1REP C;  2K4J A;  2W85 A;  3P9K A;  1ZRD A;  5HS8 A;  2ISZ A;  4ZYD A;  2OZ6 A;  3S2W A;  4E70 A;  2ZKZ A;  2XAQ A;  2WWY A;  2Y0M A;  1H0M A;  2L3D A;  1BN5 A;  1XDU A;  3I58 A;  4DQ2 A;  3JTH A;  4YFK F;  2PEX A;  1DPR A;  5DV5 A;  2QEN A;  2UXX A;  2LSO A;  1J7K A;  2YR2 A;  4EJV A;  4G94 A;  4UXN A;  2PLY A;  5LLQ A;  1Z1D A;  5TJJ A;  2H27 A;  1W5S A;  3QP5 A;  2L4A A;  2DK5 A;  3K69 A;  1XGO A;  1XD7 A;  4BQA A;  2QZ8 A;  2DW4 A;  4MEX F;  3MQ0 A;  5ICG A;  2Z3Y A;  2GXG A;  3MFK A;  4A2U A;  1MJB A;  5E1Z B;  1SMT A;  2F5F A;  4HYE A;  2HR3 A;  1HKQ A;  4R79 A;  3ZPL A;  5K5R A;  2VOO A;  4LK0 F;  1RUO A;  3I4P A;  1QBJ A;  4EJO A;  1MDM B;  3P9C A;  2EB7 A;  2W25 A;  3EET A;  5K5Q A;  4HQM A;  1BI0 A;  1UCR A;  3HHG A;  4BHB A;  1YS7 A;  3TQN A;  3KLN A;  1G3W A;  1FNN A;  1T38 A;  5H20 A;  2J5O A;  3TKY A;  4L18 B;  1T0F A;  5BQT A;  3O3K A;  2RGV A;  1G3S A;  5D5W B;  1O3S A;  2D2W A;  5AIP A;  2IT0 A;  2PJP A;  3CDH A;  5LRR A;  3JSP A;  4KYW A;  5CYV A;  5JR3 A;  4I98 B;  2MH2 A;  3WE3 A;  2RNJ A;  3K0L A;  1QO0 D;  4O6J A;  5HDK A;  1XSV A;  4MNU A;  4CZZ A;  4YII A;  5D4R A;  5JI6 A;  4QLC U;  2GA1 A;  1ZG5 A;  3V4G A;  3ZN0 A;  2KKO A;  3GWZ A;  3AAF A;  4G6Q A;  4XRF A;  2FA5 A;  2C6Y A;  1FWZ A;  2OA4 A;  2Q2E A;  4I0B A;  4ENN A;  2F5E A;  5L3G A;  3JAM K;  3U2R A;  1S29 A;  3MCZ A;  4CYD A;  5K5O A;  3U9G A;  3WTU C;  4HLX A;  1E17 A;  2DLL A;  3F21 A;  3E6C C;  4IVN A;  1FPQ A;  3C3W A;  1OYI A;  5FD5 A;  1T2K A;  1R1V A;  4A6E A;  2CO5 A;  4OIO F;  3IWF A;  1XSD A;  2EWN A;  4ASN A;  2M8E A;  5HS7 A;  2FRH A;  3NRV A;  2G7U A;  2EA4 A;  4BNC A;  2E7W A;  2Z99 A;  2PQ8 A;  5FD6 A;  3JW4 A;  3IC7 A;  3TDU C;  1U78 A;  4L0Z B;  2BYV E;  3JTG A;  1QPM A;  4HV5 A;  3U1D A;  2ETH A;  1HKS A;  1Z9C A;  1JGS A;  1ZHF A;  2BBY A;  2RDP A;  1Z6R A;  1HBX G;  1OPC A;  4KT5 C;  1I5Z A;  1HW2 A;  5HDN A;  2JTV A;  1FZP B;  1CF7 B;  2LNB A;  2IP2 A;  3G73 A;  4GO1 A;  1S7A A;  1AOY A;  3R0J A;  4EV0 A;  4UVB A;  2DK8 A;  5ERI A;  3VOE A;  1S8N A;  5ILU A;  2ZJ2 A;  4AD9 A;  4JBA A;  3I5U A;  1ZG3 A;  2V6C A;  5D8L B;  4KIF A;  4Y15 A;  1BOA A;  3DQV C;  3ROU A;  4LFU A;  2A61 A;  3V7S A;  2FE3 A;  3JSO A;  1HKT A;  3KP2 A;  4ZZL A;  1WRJ A;  1TQP A;  2QUF A;  3EDP A;  2GAU A;  1BC8 C;  2D1H A;  3BZ6 A;  3Q9S A;  2K7L A;  1IRF A;  4YFX F;  4UUV A;  1YW8 A;  2G7H A;  4OIN F;  1W5T A;  3CJN A;  4HF0 A;  1O57 A;  4G7Z F;  2ZO4 A;  3QPT A;  4UVC A;  4CIC A;  1JE8 A;  5E8G A;  2VON A;  2FBK A;  3FXR A;  1YIO A;  4LG0 A;  2ZFW A;  1IN8 A;  3DPT A;  3F6V A;  3QAH A;  2J5P A;  1EH8 A;  5CLS A;  3DV8 A;  3TGN A;  2P5L C;  1TW2 A;  4HQE A;  2BE5 F;  2XUB A;  4L5J A;  3LQQ A;  4PZJ A;  2IVM A;  1BJA A;  5BS6 A;  1XN7 A;  2R7D A;  1FBU A;  1FBS A;  2XGX A;  1X3U A;  4OU0 A;  3F8B A;  3GFI A;  1IN4 A;  1O3T A;  2ZCW A;  4WXC A;  2CG4 A;  2TDX A;  3RYP A;  3DXJ F;  1FYK A;  4RB0 A;  5FO5 A;  3PQK A;  2IA0 A;  3DF8 A;  5HOO A;  1TBX A;  4KDP A;  3ABU A;  5JHU A;  4M9X A;  4WK8 F;  2XRN A;  1O3R A;  4IRI A;  2ESN A;  4U88 A;  4M72 A;  2DO7 A;  4G7O F;  2FBH A;  2Z33 A;  3P9I A;  3BP8 A;  2A5Y B;  1D8K A;  3KEO A;  2QQ9 A;  1JHF A;  1GVJ A;  2DT5 A;  1Y0U A;  1MD0 A;  3WTY C;  3OV8 A;  1ZH5 A;  2A68 F;  3LWF A;  3ULQ B;  4EM1 A;  1RIO H;  1EH6 A;  4IJA A;  2VBZ A;  4KN4 X;  1XGS A;  1G3T A;  4GYI A;  3HRS A;  1LEA A;  4U0V A;  4WF2 A;  1R36 A;  4L5I A;  3I53 A;  2HQN A;  5ICC A;  2X0L A;  4ON0 A;  2RC4 A;  3CO6 C;  3LA2 A;  3M8E A;  1ONV A;  3KP6 A;  4OMY A;  2HZT A;  3RKX A;  4XLN F;  4YFN F;  4ZYH A;  2FF4 A;  2K02 A;  3GEZ A;  4MTD A;  1ON2 A;  3GFJ A;  1EV7 A;  1OYY A;  5J6X A;  1AWC A;  3ZMS A;  4PGG A;  1BBY A;  2DTR A;  3SHF A;  1UB9 A;  2XAF A;  4LLG F;  1U8R A;  2WC2 A;  2H6C A;  2RQP A;  4BXU A;  3P7N A;  1STZ A;  3E6B A;  3CUQ B;  1PP8 F;  1BIB A;  1ZN2 A;  4N9H A;  2L4M A;  2EFQ A;  5CJ9 A;  4HBL A;  2VBX A;  1V3F A;  4KIB A;  3H3U A;  1ZAO A;  5LGN A;  4IRG A;  4HDV A;  1F1Z A;  1G6N A;  4GGG A;  3M1E A;  4HX8 A;  5IT9 Z;  2GXB A;  2XKO A;  3OOP A;  4Y13 A;  4ENM A;  1T39 A;  4AIK A;  2HYG D;  1TQM A;  3PFI A;  3TOA A;  1Q1H A;  2IW5 A;  5F64 A;  4Q4Z F;  2Z9O A;  3F8N A;  1T6S A;  2FMY A;  3GYH X;  5HLI A;  1QQI A;  1ZLK A;  1KYZ A;  3HRU A;  4A0Z A;  2MLK A;  5D5U B;  1WQ2 A;  4HAM A;  3GZ6 A;  1RUN A;  2ZME A;  2ACJ A;  4O3M A;  4ESF A;  2Y75 A;  1MGT A;  3FZV A;  4FX4 A;  4L9J A;  5E1W A;  4Y17 A;  4M6X A;  2LKP A;  1P6R A;  2CGP A;  3E5U A;  1R58 A;  3SQN A;  4S04 A;  3N4M A;  2PBI A;  2P4W A;  4HLY A;  1SD7 A;  1TNS A;  2W57 A;  1FP2 A;  1ZRF A;  2MLG A;  4XLP F;  1ULY A;  1D8J A;  1BIA A;  3F22 A;  1P92 A;  5L3F A;  3VEP A;  5L3C A;  2CFX A;  1QZY A;  1FBQ A;  2ZXJ A;  3J80 Z;  3KP5 A;  4MQV A;  1JXS A;  5D5X B;  2CWE A;  1IXS B;  4HF2 A;  2QYO A;  3V8J A;  4BH9 A;  1FT9 A;  2B0L A;  1P4X A;  1IXC A;  3RJP A;  1KU7 A;  1R1U A;  2KIU A;  5F6F A;  1K7A A;  4KUM A;  4P96 A;  4CHU A;  2R3S A;  3B02 A;  2V1U A;  1JHH A;  3KEQ A;  1I1S A;  3ZMD A;  5AIQ A;  1LDK B;  2X4H A;  4PGH A;  2HEO A;  3SZP A;  1HW5 A;  1J9I A;  4KMU X;  1K78 A;  3SFZ A;  2P7V B;  2V1D A;  4OOI A;  1IAW A;  1XMA A;  1R22 A;  2KIM A;  5FGM A;  3CUO A;  1O3Q A;  2CYY A;  1W7P D;  2AS5 F;  1FSE A;  4MTE A;  2VC1 A;  3T1B A;  1ZGA A;  3FX3 A;  1S3J A;  3K1M A;  5DYM A;  2MA3 A;  2DPD A;  3E6M A;  2DI3 A;  1YO5 C;  1YYV A;  2M30 A;  1W7P B;  2IRF G;  5DDG A;  1RZ4 A;  4UV9 A;  3HTU A;  1UFM A;  4QWQ A;  1B6A A;  5IT3 A;  1GHC A;  1DUX C;  1ZG1 A;  1GXQ A;  3I0T A;  2H94 A;  1U3E M;  1KU2 A;  4D0P A;  4GYG A;  4O5V A;  5K1Y A;  3SXY A;  1J75 A;  2PMU A;  3MEX A;  2VBW A;  3WTX C;  5FLX Z;  2ZBK A;  3FM3 A;  2HTJ A;  2GA2 A;  2ISY A;  3GW2 A;  3IL2 A;  5DD4 A;  1BC7 C;  3BPX A;  1SD5 A;  3REO A;  2A3S A;  3FF5 A;  3FMS A;  5A2Q Z;  1R23 A;  4RGX A;  5LHG A;  2M1B A;  1ZAR A;  2FBI A;  1WI9 A;  5DCF A;  3E97 A;  2XAS A;  4DNC A;  2RN7 A;  3J81 K;  3J80 K;  1KA8 A;  3HTS B;  4IF4 A;  2VXZ A;  2MH9 A;  4I2O A;  2AXL A;  4ZYG A;  2CQK A;  2QBY A;  1YW9 A;  5E20 A;  2CW0 F;  2RKH A;  3R60 A;  4U7B A;  4UHT A;  2KJB A;  1IRG A;  3COA C;  4KFC A;  2RVC A;  4EVI A;  3ZMU A;  2A07 F;  4KNY A;  4I09 A;  1XGN A;  3FXQ A;  2VT2 A;  2LDU A;  2ZNY A;  2EV0 A;  5CVI A;  3RTR A;  2A6H F;  4HW0 A;  2VOP A;  4UV8 A;  1R1T A;  4L9N A;  1A04 A;  2IA2 A;  1O7F A;  3LA3 A;  1VTN C;  3LAJ A;  4HA8 A;  1YW7 A;  2QQB A;  1WKM A;  3RYR A;  4S05 A;  3FMQ A;  5FFZ A;  4EJU A;  2QLZ A;  1ODD A;  1IF1 A;  2UXN A;  3CO7 C;  3V7C A;  1F9N A;  1KU9 A;  1J2X A;  3J81 Z;  2Y48 A;  5IT9 K;  3H3Z A;  2P6S A;  2V1X A;  2WTE A;  3R6S A;  3HUG A;  3I71 A;  1XGM A;  2FNP A;  4M71 A;  2VN2 A;  5D8K B;  2PG4 A;  3DP7 A;  1LVA A;  2ESH A;  3ZMT A;  3R61 A;  4Q5S F;  1BM9 A;  2XV4 S;  3GZ5 A;  2XAG A;  5DUK A;  2FNA A;  2K86 A;  1EH7 A;  3BOQ A;  2PMH A;  4U7D A;  4A5M A;  4UVA A;  3ECO A;  4KIG A;  4WXD A;  3KE2 A;  1FSH A;  4N9I A;  4P5O A;  3KZY A;  3Q9V A;  1HST A;  2F5D A;  1P4A A;  2STT A;  3BDD A;  1U6G A;  2G9W A;  4EM2 A;  4I0A A;  2R7F A;  4LB6 B;  4ESJ A;  1PP7 U;  3F3X A;  3KZZ A;  4U0W A;  4RB1 A;  5ED4 A;  4KMF A;  3V8L A;  1MDM A;  1K79 A;  1BI2 A;  3KCC A;  4XBF A;  1R7J A;  3LFK A;  3ERE D;  2BEO A;  4K2E A;  3GF2 A;  3FHZ A;  1XDS A;  4M74 A;  2H09 A;  3EQL F;  2NS0 A;  5LGT A;  4BAY A;  3GO5 A;  1YFH A;  4EJW A;  4ZH4 F;  5E17 F;  1Z7U A;  2XVC A;  3C1D A;  1KGS A;  3WGI A;  2OD5 A;  1LJ9 A;  2YSR A;  1OR7 A;  5CVR A;  2VE9 A;  2PI0 A;  3QPH A;  4LMY A;  1D5V A;  4AVP A;  1RNL A;  4RB2 C;  4OMZ A;  2XAH A;  1SD6 A;  2DFI A;  3F6O A;  2L01 A;  4IHT A;  2FOK A;  5DEQ A;  3L2C A;  4R8H A;  1CGP A;  2E1N A;  4ENK A;  1W4M A;  3IWZ A;  4EJT A;  3TDZ C;  1XCB A;  1B1B A;  2EFP A;  1KQ8 A;  4OIR F;  4CGZ A;  3TOB A;  3VFZ A;  2XHK A;  3MAJ A;  4Q47 A;  3ZP5 A;  2EV6 A;  3QU6 A;  2EJR A;  1LB2 A;  3LST A;  4ZZD A;  3O6B B;  2OAZ A;  2EK5 A;  3WG9 A;  3QU3 A;  3RI4 A;  2QM3 A;  5BMZ A;  5JFR A;  2V79 A;  1LNW A;  4P9U A;  2HDC A;  5H6Q A;  4LG0 B;  2IPQ X;  2V9V A;  5KVR A;  3F23 A;  1SFX A;  3IRR A;  3BRO A;  2O0Y A;  3LQR A;  3F8C A;  1C0W A;  4JK1 X;  5DCM A;  5KK1 A; 
#chains in the Genus database with same CATH topology
 5LRS A;  2FSW A;  1LDJ A;  3JRH A;  1UHS A;  2KPM A;  2WBM A;  3TL4 X;  3WTZ A;  3A02 A;  2NYX A;  1MKM A;  5LHH A;  4M6Y A;  2NS7 A;  4D5C A;  2M9H A;  3HB9 A;  4RGU A;  4BY7 J;  1POG A;  2Z5U A;  2WAQ N;  3VYR B;  3H0G J;  1ZGJ A;  4A0X A;  2DBB A;  4LGW A;  4BU2 A;  1OKR A;  4ZC3 A;  1W36 C;  4D7M A;  4XSZ F;  1E2X A;  1K6O A;  1L0O C;  3DU5 A;  1MJA A;  1MJ9 A;  3K70 D;  1O7L A;  1LEB A;  1BJZ A;  2VT3 A;  5HNF A;  4XIC A;  3G1L A;  5GAD J;  3WG7 H;  1V55 H;  4LJZ F;  3F0C A;  4JP0 A;  3H92 A;  5BPD A;  1Z6T A;  2HKX A;  2DN0 A;  4LD5 A;  4RAY A;  2FML A;  4BEH B;  2L02 A;  4ENJ A;  5J8C A;  3LSI A;  1R6R A;  3EUH A;  5TRD A;  3L9F A;  1Z05 A;  2JPB A;  1E3H A;  3NWS A;  4FHT A;  1VQ8 I;  1OIS A;  1MBE A;  1NG7 A;  1YS6 A;  3KET A;  1K6Y A;  3ZQ7 A;  4I02 A;  5KK1 A;  4S0H B;  1E3P A;  4FX0 A;  3CC7 I;  1RR7 A;  1GV5 A;  1KQ9 A;  1J5Y A;  2OBP A;  1S6L A;  2M3A A;  1WWX A;  1QZE A;  2K85 A;  2HDW A;  9ANT A;  2BZT A;  2IEK A;  1ZR2 A;  5KAI C;  4ZYA A;  2HQR A;  3SYT A;  3T0Y A;  1FOW A;  1TW3 A;  1SVL A;  1L3L A;  1KQ0 A;  3GTJ J;  5IOZ A;  1X4P A;  3BG7 A;  1BR4 A;  1Z91 A;  2EIN H;  1WJB A;  2X6O A;  5GAG J;  4B48 A;  1YTY A;  1IN7 A;  3MN2 A;  4L9T A;  5CVJ A;  1J59 A;  3GTM J;  2DJN A;  2M87 A;  2DU9 A;  1V5G A;  1X4O A;  4X1E A;  2E1O A;  4W1U A;  3DTK A;  2ZXW H;  1IN5 A;  4A12 A;  3TO7 A;  1JJ6 C;  5EGO A;  3ZMV A;  4XLE A;  1WSU A;  1QPI A;  1TWC J;  3R4K A;  1F5T A;  1ETO A;  2CJJ A;  1E3O C;  2NVY J;  2OCE A;  3BCB A;  2VQL A;  2JRM A;  2K27 A;  2VE8 A;  1V5E A;  3JRA A;  2IGO A;  1IRZ A;  3HHH A;  4A3M J;  2MFZ A;  2OUM A;  2IAI A;  4I7H A;  3CDL A;  1Y8R B;  1Y6I A;  2HGC A;  1SVM A;  2W4S A;  2BV6 A;  4C9Y A;  1T08 B;  4F7Z A;  3K70 C;  3O2P E;  1APL C;  4P1W A;  2M0M A;  3HRT A;  5LEJ A;  3WGG A;  3CCM I;  4XK4 A;  1OCZ H;  4RAG A;  4D5F A;  2K4B A;  2L54 A;  4CO8 A;  2NXN B;  3FXK A;  4YEL A;  3JAM Z;  1DPU A;  3RKY A;  5ILV A;  5IP6 A;  4LLN A;  2BXZ A;  3GVA A;  2YPR A;  2HU9 A;  4NHJ A;  1A36 A;  4HG2 A;  2LY2 A;  1HSJ A;  2BW3 B;  3MWM A;  1IUF A;  1X1D A;  3B6C A;  5CPR B;  1H9T A;  4H0E A;  3GCM A;  1P7I A;  3C18 A;  5DD8 A;  4B44 A;  3IRQ A;  2GOM A;  4EM0 B;  1G4D A;  2HZD A;  1SFK A;  1SAN A;  2W1O A;  2R5Z B;  3BG5 A;  2XIG A;  1XC5 A;  1H8A C;  5L3B A;  5LBQ A;  1ON1 A;  4KA4 A;  1XTA A;  1X58 A;  1FC3 A;  3HIF A;  3GME A;  3K2A A;  2DQL A;  4W97 A;  5FKO A;  5EEA A;  2KJC A;  4RAF A;  4ZTF A;  1JTX A;  5KHD A;  2F4M B;  4IHX A;  1FLI A;  1UST A;  2VOD A;  2HXI A;  2YX4 A;  2VXD A;  4LLL A;  5J8F A;  3DEE A;  4J00 A;  3DWL E;  2HOE A;  4NQW A;  3K9T A;  2NNY A;  1P9Q C;  3ZGK A;  1IN6 A;  3H3V K;  1MSE C;  3WTW C;  2BHZ A;  2QVO A;  3WHB A;  3E3V A;  1IDZ A;  4XKV A;  1XS9 A;  3ABM H;  4RB3 C;  1S9H A;  2MD0 A;  2VB6 A;  2OU2 A;  3C7J A;  1ETK A;  2R4G A;  4KT6 A;  1QVT A;  2BGC A;  2ZNZ A;  4RGS A;  3HSE A;  4WX9 A;  2HKO A;  3QPL A;  3CP2 A;  5J1R A;  2DOF A;  3D5L A;  3L2U A;  4RMN A;  3M1C A;  2X9D A;  3I64 A;  1HCR A;  4AWX B;  2JT1 A;  3OS1 A;  1MMA A;  2KZG A;  1F4K A;  1ZRC A;  2HVQ A;  2P5V A;  4BE0 A;  2RNG A;  5DUI A;  2NAZ A;  5FKN A;  2FJ1 A;  1SC7 A;  4ANJ A;  4MFE A;  5IOY A;  2JVH A;  1ETV A;  5J4V A;  1QGP A;  3K4J A;  1OCR H;  2HWV A;  5B5E C;  1QRY A;  3OR1 C;  1UHW A;  2M45 A;  2MGQ A;  4BAC A;  4LIT A;  1ZRE A;  2DQR A;  4ZTJ A;  3S93 A;  4IXA A;  3HZJ A;  3E6D A;  2E5Z A;  1V4R A;  1Z3X A;  2HPI A;  2A6E F;  2V1N A;  3G3Z A;  1R4M B;  4WCG A;  3CC2 I;  3RKW A;  4IZZ A;  1UHM A;  3IV5 A;  5E1X A;  2HTS A;  5HLT A;  1D3Y A;  1LFP A;  3WU1 B;  2XPV A;  1G2H A;  2ECC A;  5L3E A;  1SAX A;  1MMN A;  2JUG A;  4OIP F;  1ITY A;  1R5H A;  4LB5 A;  5EEG A;  3CTA A;  3I54 A;  5D6F A;  1YIJ I;  3J7Z I;  1PUE E;  3V7R A;  1FP1 D;  4BHP A;  2BY1 A;  1KZH A;  3Q5F A;  3I4M J;  4BBS J;  4IRH A;  2CMP A;  2LRD A;  4HST A;  3VOD A;  4IHS A;  2IJL A;  3ELK A;  2EFO A;  1HQC A;  2KFD A;  2VI6 A;  2DPU A;  3LOC A;  4PFP A;  2IA1 A;  2HYF A;  4MEY F;  5EEH A;  1HA8 A;  4BE1 A;  2KHM A;  3HDD A;  2VC0 A;  5EJC A;  2Q8K A;  2DFH A;  5FLX K;  3K2Z A;  2ZME C;  3HC7 A;  3B73 A;  2LTP A;  1U2W A;  2O8X A;  3GLX A;  3PJR A;  2MSY A;  3CDI A;  1WJD A;  2DYS H;  3SFI A;  1TWH J;  5TGT A;  3SJM A;  1SMY F;  2QQA A;  2F5C A;  1TT0 A;  5CVV A;  4D9J A;  4ZDO A;  1CF7 A;  3F72 A;  3L2Q A;  3F8F A;  4EGY A;  2NRA C;  1IUY A;  2WAQ A;  3I59 B;  2KIS A;  3BZC A;  1OMI A;  2MBF A;  3T5X A;  1SFE A;  2R7U A;  3W2W A;  4BL0 B;  3GTK J;  1DU6 A;  4KN7 X;  2P6T A;  3D5S C;  1KON A;  2OQR A;  2ZFU A;  3CLO A;  5LEK A;  2W24 A;  4YIF A;  2I5U A;  4HZF A;  3GBG A;  3OYB A;  3EYI A;  1PJR A;  4ABZ A;  3QP6 A;  1KU3 A;  4AM3 A;  1I6X A;  4RAZ A;  3K10 A;  4WWC A;  1VQP I;  3HG9 A;  4N0B A;  2H8W A;  2P5K A;  1LDD A;  4Z2Y A;  3HYI A;  3FM5 A;  2Y69 H;  2LF7 A;  4BHC A;  2PN6 A;  1B4A A;  3WTS C;  4QPQ A;  4XLF A;  1SD4 A;  3K1N A;  5K7F A;  1PDN C;  4KIT B;  1BI3 A;  3ZN1 A;  3CUQ C;  1LQ1 A;  2Q0O A;  5C44 J;  4CXF A;  1U5T A;  2P8T A;  3TO6 A;  3V8K A;  1JT0 A;  2DTZ A;  2GQQ A;  4M73 A;  1I1G A;  1YG2 A;  4EQQ A;  3VYS B;  3TED A;  2K40 A;  1NG6 A;  2D1V A;  4YG2 F;  4FTH A;  3N05 A;  3DCF A;  3I59 A;  2OV7 A;  2LH9 A;  4V19 K;  4HDU A;  3DPU A;  1R5I D;  3QRF F;  1HW1 A;  3TW6 A;  2IXS A;  2P0W A;  3C2G A;  1H9G A;  1D0Z A;  3K1P A;  3HSF A;  1QZZ A;  4A3D J;  5E18 F;  3S14 J;  3OYI A;  5FJ8 J;  3WGH A;  2CS3 A;  2FXA A;  1FMW A;  3A2K A;  1MBG A;  2FOW A;  1WZ2 A;  2ELJ A;  3AL0 C;  1UG0 A;  1J0R A;  5CQE A;  1FY7 A;  3MKL A;  1ACI A;  3CJT B;  3T8R A;  3H5R A;  5BPI A;  1DDN A;  2KIQ A;  3CLQ A;  4PDK A;  1TLH B;  3FBI B;  3ISP A;  4B47 A;  2LD5 A;  1R5G A;  2F4I A;  2PMZ N;  2HS5 A;  2XB0 X;  1I50 J;  2UZK A;  3AKZ A;  1OCC H;  4DBQ A;  2VBY A;  3GUD A;  5FKK A;  2ZJR F;  2CQX A;  2MD5 A;  3G1M A;  1T98 A;  3E5Q A;  2MC3 A;  4TV7 A;  1T8I A;  1UG2 A;  1QA6 A;  5FRN A;  2GWR A;  2M2E A;  4II2 A;  4MO7 A;  1TT5 B;  4RS8 A;  4NC7 A;  2F2E A;  2RV8 A;  3E5X A;  1I39 A;  2E2J J;  1XSX A;  3ZXS A;  3JCU C;  3RIR A;  1WH5 A;  3J7A O;  2H1L A;  3KP7 A;  2DT7 B;  4WXH A;  5HDG A;  2AO9 A;  4FE7 A;  4B8X A;  1TNT A;  2EFW A;  2K9S A;  2W84 A;  2ZJQ F;  2JSC A;  4A5N A;  2VJI A;  3F8M A;  3A0H C;  4AYB N;  1N77 A;  4B43 A;  2NVQ J;  3HOX J;  2GIV A;  4G7H F;  5E79 C;  3H36 A;  3BJ6 A;  2CUE A;  2CQ7 A;  3BJO A;  4NB5 A;  4MGR A;  4P9F A;  1IO2 A;  2KLO A;  3S3M A;  3OYK A;  2CV1 A;  1AU7 A;  4A3I J;  5TIS C;  1TTY A;  4M6V A;  3PIP F;  2AXT C;  1DU0 A;  4G6D A;  1XCV A;  2MYS A;  4HX4 A;  2HNH A;  5CKT A;  4EMS A;  3WTV C;  3W3C A;  2A69 F;  4BQQ A;  2EQR A;  5M5W J;  4KIC A;  4G8X A;  2KIF A;  4HF1 A;  1PUF A;  1D1B A;  3BTJ A;  1TL8 A;  2JMW A;  3BY6 A;  3OYC A;  5D4S A;  2EZH A;  2QBY B;  5FB2 A;  3GFL A;  2JRT A;  2CUF A;  4BQN A;  4CDG A;  1WFX A;  1B59 A;  1B9N A;  1I3Q J;  3HJE A;  3TMO A;  4ESB A;  2EA2 A;  3MVP A;  1XB4 A;  2YX7 A;  5HVQ C;  5HLG A;  3GTP J;  3DEU A;  3S15 J;  2EV5 A;  3L09 A;  1P7J A;  1I27 A;  1MZB A;  4RGR A;  3CF5 F;  2E5N A;  1OLT A;  4DGW B;  2QQ8 A;  3RCO A;  3KYL A;  2JPC A;  3ZMZ A;  2ME6 A;  2ZXH A;  4GXO A;  1NHA A;  3GXO A;  3IUO A;  5J3L A;  2JUC A;  2HFH A;  4A6D A;  1WCM J;  2L2O A;  4AVZ A;  5KAF C;  3EPZ A;  3MZY A;  4CH7 A;  2F4O B;  3AG2 H;  3H9Q A;  5D6E A;  5IP9 J;  1NK2 P;  2OQG A;  4LK1 F;  2STW A;  3R0A A;  3OL3 A;  1DP7 P;  3BCA A;  3KX2 A;  4FT8 A;  4L0Y B;  1X1B A;  5FRO A;  1MBK A;  3VSL A;  5DS9 A;  1OYW A;  5A2Q K;  2HPM A;  1KYW A;  2DJI A;  1WVR A;  2Q2E B;  1NTC A;  2FU4 A;  5ICE A;  4G9Y A;  1D1A A;  3SZT A;  4AIH A;  4A0Y A;  1OCT C;  3DBH B;  1ZLJ A;  3RPU A;  1FX7 A;  1MH3 A;  3KFW X;  2EIK H;  1VQ7 I;  3HOS A;  3L00 A;  2H6B A;  3NEU A;  3PQJ A;  4PJL A;  4RLQ A;  3CCE I;  5FKL A;  2R7V A;  3M9A A;  4MIM A;  2O61 A;  1RKW A;  5LHI A;  4I01 A;  1EA3 A;  2WAD A;  3PIO F;  2XRO A;  5IPA A;  3BTC A;  2NOJ B;  1HXD A;  4BYY A;  4UB6 C;  4EGZ A;  2ZXI A;  1W0T A;  3ABT A;  2ZSH B;  3DFG A;  2COM A;  3LA7 A;  3PSF A;  3MZH A;  3BPV A;  4Q48 A;  2XGE A;  2WA0 A;  3DTE A;  5DCM B;  6PAX A;  2O03 A;  5F04 A;  5M5Y J;  3FWE A;  3BC8 A;  2BXY A;  2DXI A;  4BDY A;  4ZYE A;  1TP4 A;  3ZR8 X;  5AON A;  3NWT A;  1GXP A;  1OFC X;  3RPQ A;  3WTT C;  2Z16 A;  1S7O A;  1ORK A;  1IW7 F;  1G8X A;  1YX3 A;  2XF5 A;  2XPW A;  5E8I A;  2JZY A;  4MHG A;  1PYV A;  1NK3 P;  4B09 A;  4M3F A;  5HS9 A;  4UY8 I;  3FMR A;  3WE2 A;  2DAO A;  3BJA A;  5CVU A;  3KP3 A;  5FRM A;  2EFN A;  5K7H A;  3E0J B;  3M8F A;  3FXL A;  3NQO A;  2IBD A;  3OMY A;  3CJQ B;  3TO9 A;  4A3L J;  4A3B J;  2ECB A;  2OZU A;  3D0S A;  1MND A;  4M9S A;  3D5R C;  1MW7 A;  5JVT A;  5EG0 B;  2M5W A;  3A03 A;  3OYA A;  3OYH A;  2GIZ A;  3HOT A;  1FJL A;  3X2Q H;  3SZG A;  3IP4 B;  1LFU P;  4HOB A;  5JVG F;  2WV0 A;  3TW7 A;  1ZYR F;  4RDU A;  2V9K A;  2PFB A;  1YJW I;  5BOX A;  1DGW Y;  3C2H A;  2KRC A;  2BY2 A;  2DFE A;  3N97 A;  1FOK A;  3G71 I;  2O3F A;  4M9Z A;  3S1N J;  4PCQ A;  3A01 B;  2OF7 A;  4U0Y A;  2DA5 A;  3U1K A;  1BI1 A;  1I6H J;  3QOP A;  3E7L A;  3A4C A;  1IZ1 A;  2FEZ A;  4JQF A;  3HRM A;  4IL6 C;  1LPQ A;  3L7W A;  3CUQ A;  1IXR C;  1TQI A;  4QTR A;  2CSO A;  4MQ9 F;  5ICF A;  4V2G A;  3H5A A;  1WGX A;  2YU3 A;  2LY1 A;  1TC3 C;  2GZW A;  3CCY A;  2EIJ H;  3OR2 C;  5ILS A;  4UNO A;  2IS6 A;  4OAY A;  3VB2 A;  1WJ5 A;  3GTG J;  4DZJ A;  3GX4 X;  4NBQ A;  4R1H A;  2D45 A;  1P4W A;  3JRE A;  2ADU A;  2DMN A;  4L9V A;  2F48 A;  3IKV A;  1A5J A;  1R00 A;  2HI3 A;  5FFX A;  3O8G A;  5HLH A;  1QNT A;  3WU0 A;  1K78 B;  1B9M A;  3M7G A;  3CCR I;  4UUS B;  1G3Y A;  2DOA A;  3RDI A;  3W6K B;  2DA1 A;  2E7X A;  1RI7 A;  4ZDP A;  3HPG A;  3KLO A;  2K3P A;  4C3H J;  3MKW B;  1W36 D;  1FYL A;  2ELH A;  2QWW A;  2P7C B;  3HOY J;  4BJ6 C;  3KP4 A;  2LF8 A;  1YLF A;  2BOL A;  2PJR B;  2O6G E;  2ELK A;  3BWG A;  2UWM A;  4PJJ A;  4XR6 A;  5FLM J;  4BJ5 C;  2VJJ A;  2XAJ A;  3LNQ A;  3T8T A;  5H6R A;  1Z21 A;  3UKG A;  2XKP A;  4E7I A;  2E1C A;  3L2W A;  1B72 B;  3GFM A;  5F1R A;  5L3D A;  3ECH A;  5D5V B;  2K9M A;  3ML6 A;  3HSR A;  3PUB A;  4CCN A;  4HV6 A;  3FHN A;  4II3 A;  2ZME B;  3KPH A;  2L0K A;  5GPC A;  1IDY A;  2IS2 A;  4IPA A;  3W6J B;  3CMM A;  3ZQF A;  1FYM A;  1HF0 A;  2FD5 A;  1VND A;  1LKX A;  3FXU A;  3IKT A;  2L7Z A;  4IOC F;  3EYY A;  1U5T C;  3DPL C;  3LAP A;  1P2F A;  2LKS A;  4XLA A;  4ETS A;  2XC7 A;  1EKE A;  3BG9 A;  4EEF G;  3S1M J;  3BR5 A;  3OYL A;  1YQA A;  5IP7 J;  4BQO A;  4AIJ A;  3ERM A;  4GCV A;  3S32 A;  2L7F P;  2NNN A;  2FQ3 A;  2TCT A;  3LSK A;  3HGY A;  3IHU A;  1U5T B;  3S2H J;  1XMK A;  5LFA A;  1W7P A;  5LGU A;  1USS A;  3WOD F;  1BL0 A;  4HX7 A;  4P55 A;  3DKW A;  3DLL F;  2RQQ A;  4OIQ F;  2DDB A;  1SFU A;  2KRF A;  4XSX F;  2CFO A;  4DOZ A;  1LVK A;  5IYB J;  1REP C;  2K4J A;  4XMY A;  2W85 A;  3P9K A;  1VI0 A;  2W00 A;  1VQM I;  1Y8Q B;  1ZRD A;  4C30 A;  5HS8 A;  2ISZ A;  2M4G A;  4ZYD A;  2OZ6 A;  3S2W A;  4E70 A;  5M3F J;  5EDN A;  2ZKZ A;  2XAQ A;  5FLV A;  2WWY A;  2Y0M A;  2JA6 J;  2NVT J;  1H0M A;  2L3D A;  1BN5 A;  1TWF J;  1XDU A;  3I58 A;  3K4N A;  4OAZ A;  2E36 A;  2XPU A;  3JTH A;  4DQ2 A;  4YFK F;  1T56 A;  3P5J A;  1WJA A;  3FK7 A;  1U8B A;  2PEX A;  1DPR A;  5DV5 A;  3EUH C;  2QEN A;  2UXX A;  3S16 J;  1O4X A;  2GLO A;  2CV0 A;  2LSO A;  3S1Q J;  4ITV A;  1FOY A;  1J7K A;  2YR2 A;  4EJV A;  4MFD A;  3TP3 A;  4G94 A;  4UXN A;  2PLY A;  5IYD J;  1JGG A;  5LLQ A;  3Q0V A;  1Z1D A;  3M3Y J;  2B7E A;  2IS1 A;  4HSR A;  1R71 A;  5TJJ A;  4YIR X;  1FTZ A;  3O8H A;  4UB8 C;  2H27 A;  2TRT A;  1MBF A;  2QGU A;  3HXL A;  4DW6 A;  2H1K A;  4I6Z A;  1W5S A;  1EF4 A;  3QP5 A;  2L4A A;  2DK5 A;  4PJ0 C;  3FBN B;  3K69 A;  3TBI A;  1XGO A;  3K4B A;  2R7R A;  2OTJ I;  1XD7 A;  4BQA A;  1VFC A;  2QZ8 A;  5J47 A;  3OIP A;  4B1R A;  2VKH A;  2DW4 A;  4MEX F;  2L9N A;  3MQ0 A;  4PSX A;  5ICG A;  2Z3Y A;  2FUG 2;  4BGD A;  4LOC A;  1T0F C;  4JX6 A;  2GXG A;  3MFK A;  4A2U A;  1MJB A;  3BLY A;  5E1Z B;  5JHF A;  1SMT A;  5IY5 H;  1ZTR A;  4X6A J;  2F5V A;  2F5F A;  4HYE A;  2QKL B;  2A6T A;  2HR3 A;  1HKQ A;  5GP9 A;  4R79 A;  3ZPL A;  5K5R A;  4RA2 A;  2VOO A;  4LK0 F;  1RUO A;  1GV2 A;  3I4P A;  2DMU A;  3CZ6 A;  1GDT A;  2JWT A;  2PX9 A;  4EJO A;  1QBJ A;  1MDM B;  3J7A Y;  2X6Y A;  3J7Y J;  3P9C A;  4HRI A;  3VPR A;  3NAU A;  5J1U A;  3DKX A;  2H8R A;  2EB7 A;  2W25 A;  1FOX A;  1NH3 A;  3D1N I;  1OCP A;  3EET A;  4M3E A;  3FK6 A;  3BR6 A;  2JSP A;  2OTL I;  3BG6 A;  3MKZ A;  2R7Q A;  5K5Q A;  2ID6 A;  4BS9 A;  2UV1 A;  4HQM A;  3OWT A;  4AID A;  2BHY A;  1BI0 A;  1UCR A;  3HHG A;  4XNF A;  1MMG A;  4BHB A;  3MKY B;  1YS7 A;  4HNU A;  4D1Q A;  3TQN A;  2KQR A;  3KLN A;  1G3W A;  1FNN A;  1T38 A;  2KRH A;  5H20 A;  3SEZ A;  2CUZ A;  1AHD P;  2J5O A;  3TKY A;  2DDA A;  1T0F A;  3H0D A;  4L18 B;  5BQT A;  3O3K A;  2RGV A;  1G3S A;  5D5W B;  3I4N J;  1J09 A;  3FKI J;  2Y0S A;  3CCJ I;  2D2W A;  1O3S A;  5AIP A;  1R9T J;  2IT0 A;  2PJP A;  4JX4 A;  3CDH A;  4M3G A;  5LRR A;  5CYV A;  5JR3 A;  4I98 B;  3WE3 A;  3JSP A;  2MH2 A;  4BE2 A;  4KYW A;  2RNJ A;  2RAE A;  3K0L A;  1QO0 D;  4O6J A;  5HDK A;  2OCC H;  4LG3 A;  1IC8 A;  1XSV A;  3G1O A;  1QVU A;  4MNU A;  3OYG A;  4JYK A;  1M1E B;  4CZZ A;  4YII A;  1ZKG A;  5D4R A;  5JI6 A;  4QLC U;  3IH3 A;  2GA1 A;  1ZG5 A;  3QYE A;  3PL8 A;  3V4G A;  3ZN0 A;  2KKO A;  2KT0 A;  3GWZ A;  3AAF A;  4HEA 2;  3QYF A;  2KZV A;  1YIT I;  5B66 C;  4RLF A;  4G6Q A;  4I76 A;  4XRF A;  2LG4 A;  2N8G A;  2FA5 A;  3OL4 A;  2C6Y A;  3EUA A;  2LC2 A;  3VYU B;  3FXM A;  1H88 C;  2AHQ A;  2BW3 A;  1FWZ A;  2OA4 A;  2Q2E A;  3JR9 A;  1OQY A;  4I0B A;  4XM3 A;  4ENN A;  1JI8 A;  2F5E A;  5L3G A;  3JAM K;  3U2R A;  4A3G J;  1S29 A;  1WJE A;  3MD2 A;  3MCZ A;  2KDO A;  4CYD A;  5K5O A;  3U9G A;  2CRG A;  1GUU A;  1JUM A;  3M07 A;  3WTU C;  4HLX A;  1E17 A;  2DLL A;  3PM1 A;  3IH2 A;  3F21 A;  3E6C C;  4IVN A;  1FPQ A;  3C3W A;  1OYI A;  5FD5 A;  1T2K A;  1R1V A;  4A6E A;  1YRN A;  3CMA I;  2CO5 A;  4BBR J;  3IWF A;  4OIO F;  2Y2Z A;  1Z77 A;  2XF7 A;  3LSP A;  2V9P A;  2EWN A;  4ASN A;  1XSD A;  1S72 I;  2E35 A;  1LUJ B;  3KZI C;  2VKE A;  4DZP A;  1XG1 A;  1GLN A;  3KIO A;  2M8E A;  5HS7 A;  5F0C A;  2FRH A;  4CZC A;  3NRV A;  2G7U A;  5DTD A;  3HOW J;  3IAS 2;  3FKJ A;  5E3O A;  2EA4 A;  4BNC A;  2E7W A;  5EZH A;  2X6X A;  2JN6 A;  3ZRG A;  2Z99 A;  1E0E A;  2PQ8 A;  5FD6 A;  3JW4 A;  3IC7 A;  5FKM A;  3TDU C;  5JLW A;  2EZI A;  1U78 A;  4L0Z B;  2BYV E;  3JTG A;  2W7N A;  1IV6 A;  1QPM A;  4HV5 A;  3U1D A;  2Y0S N;  2CUJ A;  2ETH A;  1HKS A;  1HDD C;  1Z9C A;  1JGS A;  4XKB A;  4XLH A;  2QSF X;  1ZHF A;  2BBY A;  2R7W A;  3BQY A;  2RDP A;  1Z6R A;  4XN0 A;  4F3Q A;  1HBX G;  1OPC A;  2Z2S B;  4KT5 C;  1I5Z A;  1HW2 A;  3VYT B;  3OS0 A;  1QHG A;  2X1E A;  2JA7 J;  5HDN A;  3ZOB A;  3ZQQ A;  4CCK A;  2JTV A;  3H9J A;  1FZP B;  4IEJ A;  1CF7 B;  3IH4 A;  2LNB A;  2BVL A;  2P81 A;  2IP2 A;  3G73 A;  4GO1 A;  2DOD A;  2A5W A;  3OY9 A;  3UR3 C;  2AQF A;  1S7A A;  1AOY A;  2HXO A;  1LE8 B;  3R0J A;  4EV0 A;  1A31 A;  3G4S I;  4Y7N J;  4UVB A;  3NAR A;  5LD2 C;  1OJL A;  4UUS A;  2DK8 A;  5ERI A;  2E34 A;  4FIS A;  3VOE A;  1S8N A;  1YHQ I;  1LFB A;  1UMQ A;  5ILU A;  2ZJ2 A;  4RM2 A;  3CQZ J;  4AD9 A;  2HOS A;  1Y1V J;  1XPX A;  4JBA A;  3I5U A;  1ZG3 A;  2EPF A;  2EZL A;  2V6C A;  5D8L B;  2YS9 A;  3BZK A;  4KIF A;  4Y15 A;  4XKW A;  1QU3 A;  4KIS A;  1IV8 A;  1BOA A;  3DQV C;  3ROU A;  4LFU A;  2A61 A;  4G12 A;  3V7S A;  2FE3 A;  2LYC A;  4CCM A;  3JSO A;  1HKT A;  3MZ8 A;  3KP2 A;  4ZZL A;  1WRJ A;  1TQP A;  3LSM A;  2QUF A;  2BY3 A;  2LMD A;  3EDP A;  2GAU A;  1BC8 C;  2D1H A;  3BZ6 A;  3Q9S A;  2K7L A;  1IRF A;  4YFX F;  1R4N B;  4UUV A;  1YW8 A;  2G7H A;  4OIN F;  2O5R A;  4DBR A;  1W5T A;  3CJN A;  4HF0 A;  1O57 A;  4G7Z F;  1V5F A;  2ZO4 A;  3QPT A;  4UVC A;  5F0F A;  2CQN A;  1VQ4 I;  4CIC A;  2R7X A;  1JE8 A;  5E8G A;  2I10 A;  2VON A;  3JRD A;  2FBK A;  3ZQI A;  1VQ5 I;  3FXR A;  1YIO A;  4LG0 A;  5B1A H;  4A3J J;  2B63 J;  1UAA A;  3OYD A;  3DTI A;  2ZFW A;  1IN8 A;  2VLA A;  3DPT A;  2W48 A;  2WV1 A;  2XGD A;  3F6V A;  4IX7 A;  3W6V A;  2NVX J;  1K4S A;  3QAH A;  2J5P A;  1EH8 A;  5CLS A;  3DV8 A;  3TGN A;  2VPL A;  2P5L C;  1WHU A;  2Y30 A;  1TW2 A;  1FEX A;  5B3S H;  1G59 A;  4HQE A;  1IGN A;  2BE5 F;  1X1C A;  4XLC A;  5GAE J;  1ZR4 A;  2NOG A;  2XUB A;  3CF2 A;  4L5J A;  4F55 A;  3LQQ A;  4CCO A;  4PZJ A;  2IVM A;  1BJA A;  4E7K A;  5BS6 A;  1XN7 A;  2DOE A;  3AG3 H;  2R7D A;  1FBU A;  1FBS A;  2XGX A;  2VL8 A;  1JTY A;  1X3U A;  2PMZ A;  3AL0 B;  1MNM C;  1EJ9 A;  4OU0 A;  4QIW N;  3F8B A;  2XAU A;  2R0Q C;  4N4N B;  4E4H A;  1K4T A;  3QWL A;  3K6G A;  2R92 J;  3HGG A;  5GPA A;  3GFI A;  2HDD A;  2VQC A;  2E2H J;  1IN4 A;  1O3T A;  2ZCW A;  4WXC A;  2CG4 A;  2VKV A;  2Y9Y A;  4PFO A;  1RRJ A;  2TDX A;  2E19 A;  3RYP A;  3DXJ F;  3AG4 H;  4PUS A;  1AKH B;  1FYK A;  3ASO H;  4RB0 A;  4AUX A;  5FO5 A;  4AYB A;  3PQK A;  4XON A;  5BNG A;  3HM5 A;  4XRS G;  2IA0 A;  1UZC A;  3DF8 A;  2ME0 A;  5HOO A;  1HDP A;  1TBX A;  4KDP A;  2EIL H;  2LFB A;  3ABU A;  3WHC A;  5JHU A;  4HNV A;  4M9X A;  4WK8 F;  2XRN A;  1O3R A;  4IRI A;  3MMY B;  2ESN A;  4U88 A;  3CC4 I;  1VQ9 I;  4M72 A;  2DO7 A;  4G7O F;  1D5Y A;  2FBH A;  2Z33 A;  3P9I A;  4Y33 A;  4F52 A;  3Q3S A;  1MBJ A;  3BP8 A;  5F08 A;  2A5Y B;  2HYJ A;  2OPT A;  2VIX A;  3BTL A;  1D8K A;  3KEO A;  4J01 A;  3LSG A;  3VSK A;  2QQ9 A;  1JHF A;  4E7H A;  1GVJ A;  1FIP A;  2DT5 A;  1Y0U A;  1MD0 A;  3WTY C;  3TP0 A;  1S7E A;  3OV8 A;  4OWR B;  1ZH5 A;  2A68 F;  3BR2 A;  3LWF A;  3ULQ B;  1IRX A;  1JKP C;  4EM1 A;  5K7Z A;  1RIO H;  1EH6 A;  3S2D J;  3LSR A;  4IJA A;  4IHV A;  1JKQ C;  1ETY A;  2VBZ A;  2ZB9 A;  4KN4 X;  3B6A A;  4EAT A;  1XGS A;  1G3T A;  4GYI A;  3G2B A;  3QQA A;  3HRS A;  1LEA A;  4U0V A;  3ABK H;  4WF2 A;  1R36 A;  4L5I A;  3I53 A;  2Z1D A;  2DT6 A;  2HQN A;  5ICC A;  2X0L A;  4J19 A;  4ON0 A;  2RC4 A;  3CO6 C;  3LA2 A;  2LOO A;  3M8E A;  2DA7 A;  2L5Q A;  1ONV A;  3KP6 A;  4OMY A;  1Y39 A;  3PUF A;  2HZT A;  5HOD A;  3RKX A;  4XLN F;  3CCU I;  4YFN F;  2OC6 A;  4ZYH A;  3LSH A;  3OYF A;  1HOM A;  2FF4 A;  2K02 A;  2HVR A;  3L2R A;  3GEZ A;  4PJN A;  3F9K A;  2BY0 A;  4MTD A;  1ON2 A;  3GFJ A;  1EV7 A;  1OR7 C;  3K4C A;  1OYY A;  5J6X A;  1AWC A;  4FQG A;  3ZMS A;  5E3M A;  1BOB A;  2K5C A;  3BG3 A;  2LR8 A;  4PGG A;  1BBY A;  2CU7 A;  4E7S A;  1U9N A;  4GDF A;  2DTR A;  3SHF A;  1UB9 A;  1X19 A;  2XAF A;  4LLG F;  1U8R A;  3KYD B;  2WC2 A;  2H6C A;  3BR3 A;  3OYM A;  2RQP A;  2AQE A;  4BXU A;  3CES A;  1DGR M;  3P7N A;  1STZ A;  1K61 A;  2M4K A;  3E6B A;  3CUQ B;  1X3Z B;  1PP8 F;  2L7K A;  1N25 A;  2X6W A;  4AU7 A;  4DYC A;  1YJ9 I;  1BIB A;  1ZN2 A;  4ZJZ A;  4N9H A;  2L4M A;  4E7J A;  1AA7 A;  2EFQ A;  5CJ9 A;  5HNH A;  3CCL I;  4HBL A;  1HLV A;  2VBX A;  4QSH A;  1U9O A;  1PVE A;  1V3F A;  2LRE A;  2V7F A;  3H3U A;  3LL7 A;  4KIB A;  1RES A;  1ZAO A;  5J4Y A;  4JOM A;  1ZGW A;  3OIQ A;  4X0G A;  1FMV A;  2X1C A;  5LGN A;  3PO3 J;  3IAM 2;  4IRG A;  4HDV A;  2LK2 A;  1F1Z A;  1G6N A;  4GGG A;  3M1E A;  4HX8 A;  4XOP A;  5IT9 Z;  2GXB A;  3I9V 2;  1YRN B;  3GLL A;  4C2M J;  2XKO A;  1X2M A;  5F0H A;  3OOP A;  3SDG A;  4F92 B;  3K4L A;  4Y13 A;  2EH3 A;  2LBF A;  4ENM A;  4A3K J;  2MG4 A;  1T39 A;  3TOA A;  2HYG D;  1TQM A;  3HUG B;  3PFI A;  4AIK A;  2K9L A;  4FAS D;  2IGK A;  1Q1H A;  2IW5 A;  5F64 A;  4Q4Z F;  3I55 I;  2XB5 A;  4C2T A;  3HOV J;  2Z9O A;  3F8N A;  3OIO A;  3BR0 A;  3E1S A;  4F91 B;  1T6S A;  2FMY A;  1JUS A;  4L5E A;  3GYH X;  5HLI A;  3CMY A;  3DLA A;  1QQI A;  1RET A;  1JUP A;  1ZLK A;  1KYZ A;  3HRU A;  5GTH C;  2JK3 A;  3FIS A;  4A0Z A;  2MLK A;  5D5U B;  1WQ2 A;  4HAM A;  3GZ6 A;  1RUN A;  4A93 J;  2DMP A;  2ZME A;  2ACJ A;  4O3M A;  1Z0X A;  4Y4R A;  4ESF A;  2WB1 A;  2VJ4 A;  2Y75 A;  1MGT A;  3FZV A;  4FX4 A;  4L9J A;  1RPW A;  5E1W A;  4Y17 A;  2VJ5 A;  4M6X A;  3FXJ A;  2LKP A;  3VWB A;  5IYC J;  4NC8 A;  1SEU A;  4XRS A;  5M3M J;  5M5X J;  1P6R A;  4BY1 J;  2CGP A;  4CUG A;  2LVS A;  3E5U A;  1R58 A;  3SQN A;  2XGC A;  4XKC A;  4UUT A;  3JRF A;  4S04 A;  3N4M A;  2PBI A;  2P4W A;  2R5Y A;  4DIQ A;  2R93 J;  2R7T A;  4B3A A;  1ETQ A;  1I3A A;  4XQF A;  4HLY A;  1SD7 A;  2XF6 A;  5F27 A;  4E6K G;  4C2U A;  1TNS A;  5KCM A;  2W57 A;  2E1M C;  1Z7L A;  2R7O A;  1FP2 A;  3RQ4 A;  4E7L A;  1ZRF A;  2MLG A;  3KEY A;  4XLP F;  2MW8 A;  3PNY A;  4IOA F;  1HC8 A;  1ULY A;  2QCO A;  5KNL A;  1D8J A;  2EIM H;  1IG7 A;  3ABL H;  4DYR A;  1BIA A;  3HKZ N;  3RSN A;  1P92 A;  3F22 A;  5L3F A;  1S5L C;  3VEP A;  1YOV B;  5C4J J;  3OS2 A;  2V26 A;  3H5N A;  2CFX A;  5L3C A;  2HVS A;  3KYC B;  3LMM A;  1YJN I;  1QZY A;  5CQG A;  1FBQ A;  3SEQ A;  4NDL A;  3I3L A;  3DBR B;  3CP8 A;  2ZXJ A;  3J80 Z;  3QOE A;  3BQZ A;  2DA4 A;  2DCE A;  2CH0 A;  5C4X J;  3KP5 A;  4MQV A;  1WH7 A;  3S17 J;  1JXS A;  4BXX J;  5D5X B;  2CWE A;  2MAB A;  4BDZ A;  1IXS B;  1LE8 A;  2WAE A;  2DMQ A;  4A69 C;  4BUP A;  4HF2 A;  4LIV A;  2OJE D;  2QYO A;  1UEL B;  3V8J A;  4BH9 A;  4Z6Y A;  1Z67 A;  4Y52 J;  1FIA A;  1FT9 A;  2B0L A;  2K9Q A;  3K7A J;  1P4X A;  1IXC A;  1MBH A;  3RJP A;  3RPU D;  1KU7 A;  1R1U A;  2KIU A;  2HQ5 A;  4KUM A;  4P96 A;  5F6F A;  1K7A A;  2DYR H;  4NNJ A;  4CHU A;  2R3S A;  1YX5 A;  3B02 A;  2V1U A;  1JHH A;  3KEQ A;  1I1S A;  2FQ4 A;  3ZMD A;  5AIQ A;  1LDK B;  1Y0N A;  2CQQ A;  2X4H A;  4PGH A;  3JRB A;  2KMU A;  1Q1V A;  2HEO A;  3GTQ J;  3SZP A;  1D0X A;  3CD6 I;  3PO2 J;  1HW5 A;  1J9I A;  4KMU X;  1K78 A;  3SFZ A;  2P7V B;  2V1D A;  4IQJ A;  4OOI A;  2A05 A;  1IAW A;  1XMA A;  1R22 A;  4CYC A;  4QPO A;  2NVU B;  2KIM A;  5FGM A;  2M7B A;  3CUO A;  1O3Q A;  1RKT A;  1W5C C;  3HPH A;  2CYY A;  1W7P D;  2VAS A;  4BEH A;  4BJT A;  3HEF A;  1RC9 A;  3FXO A;  3BTI A;  4U87 A;  1FSE A;  4CCJ A;  1RR8 C;  2AS5 F;  4MTE A;  2VC1 A;  2ICW G;  3T1B A;  3ZCO A;  1ZGA A;  3ESW B;  2O9L A;  2ZSI B;  3FX3 A;  1S3J A;  3K1M A;  2L9V A;  1VZ0 A;  5DYM A;  3HKZ A;  2R7Z J;  3L1P A;  2MA3 A;  4RM3 A;  2DPD A;  3E6M A;  2Y9Z A;  2DI3 A;  3HOU J;  1YO5 C;  1YYV A;  2JQ7 A;  2M30 A;  1W7P B;  2CW8 A;  2IRF G;  5B1B H;  5DDG A;  5EF6 A;  3PNT A;  3PSI A;  1RZ4 A;  4UV9 A;  3HTU A;  2LY9 A;  1UFM A;  3Q0U A;  4QWQ A;  1B6A A;  4XN3 A;  5IT3 A;  2YU9 J;  1GHC A;  3OYJ A;  4XOT A;  2WAF A;  1DUX C;  2Q1Z B;  3M4O J;  2L7M P;  2M0C A;  1MMS A;  2V4J C;  1GXQ A;  3I0T A;  3S1R J;  1ZG1 A;  2H94 A;  3ZQL A;  1U3E M;  1KU2 A;  4AC0 A;  4D0P A;  4GYG A;  3RQI A;  1D0Y A;  4O5V A;  5K1Y A;  1GT0 C;  2DA3 A;  3SXY A;  1J75 A;  2PMU A;  1A35 A;  4NUB A;  1Y56 A;  3MEX A;  2VBW A;  1X3W B;  1B8I B;  3WTX C;  5FLX Z;  2ZBK A;  1TWA J;  3FM3 A;  4Y3O A;  1ETW A;  2HTJ A;  2GA2 A;  4CCL A;  3CME I;  1ETX A;  3QPS A;  3ZQG A;  2ISY A;  1TWG J;  3M8J A;  3GW2 A;  5DM7 F;  3IL2 A;  4XOR A;  5DD4 A;  1BC7 C;  2HOT A;  3BPX A;  4D7N A;  1SD5 A;  1QHH D;  2EZK A;  3REO A;  2A3S A;  3FF5 A;  3FMS A;  3I56 I;  4GFB A;  5A2Q Z;  1R23 A;  1BR2 A;  1YI2 I;  4CYC B;  4PSW A;  3G6E I;  1MH4 A;  4RGX A;  1BW6 A;  1OCO H;  1YE9 A;  2M1B A;  4E7Z A;  5LHG A;  1Z3Y A;  2QSH X;  2EBI A;  2QEX I;  4PK4 A;  1ZAR A;  2FBI A;  2VKD A;  5GTI C;  1WI9 A;  3ZQC A;  5DCF A;  1SVO A;  3E97 A;  2XAS A;  1PUF B;  3H35 A;  4DNC A;  2RN7 A;  2RRE A;  3J81 K;  3J80 K;  1KA8 A;  2BVM A;  3GTL J;  1ZK8 A;  5E3L A;  2GM4 A;  3HTS B;  4IF4 A;  2VXZ A;  1MSF C;  2MH9 A;  3OSG A;  3CCS I;  4I2O A;  2ZJP F;  2AXL A;  4ZYG A;  4IKF A;  2CQK A;  1WJC A;  2QBY A;  1YW9 A;  2XSD C;  5E20 A;  2CW0 F;  4JX5 A;  3H9G A;  1F36 A;  2DMT A;  2IGN A;  5J40 A;  2F6C A;  2RKH A;  2NS8 A;  3R60 A;  4U7B A;  4LIU A;  2VPR A;  3CCQ I;  4UHT A;  2KJB A;  5J1Y A;  3JRC A;  4HPQ A;  1IRG A;  1ZEL A;  3COA C;  1W1W E;  4KFC A;  3K4K A;  2RVC A;  4FET A;  4EVI A;  4IHW A;  3PFY A;  3PNV A;  3ZMU A;  2JA5 J;  2LLK A;  4DYQ A;  1JKO C;  2A07 F;  4KNY A;  2VUM J;  3S3N A;  4YEJ A;  3DEW A;  4I09 A;  2COB A;  1MIJ A;  1XGN A;  3FXQ A;  3SDB A;  1A6Q A;  1A6I A;  2VT2 A;  1DP3 A;  1JKR C;  1T95 A;  2LDU A;  1F43 A;  1DQU A;  4C3I J;  2ZNY A;  1VQO I;  2Y31 A;  2EV0 A;  1B8I A;  1JJ8 C;  1H89 C;  2ZC2 A;  2E60 A;  5CVI A;  3RTR A;  2A6H F;  4HW0 A;  2VOP A;  4UV8 A;  1R1T A;  2GXA A;  4L9N A;  1A04 A;  3RZO J;  2IA2 A;  1K83 J;  4XID A;  3VDX A;  4A3E J;  4KJZ A;  1VQL I;  4ZDL A;  1IJW C;  2M34 A;  2X51 A;  1O7F A;  3LA3 A;  1VTN C;  2R7S A;  3LAJ A;  3QYB A;  4HA8 A;  2MC4 A;  1YW7 A;  2QQB A;  1WKM A;  4IHY A;  3RYR A;  4S05 A;  2D5V A;  3FMQ A;  1ENH A;  5FFZ A;  3GTO J;  4EJU A;  2CW7 A;  2QLZ A;  1X1A A;  1ODD A;  1Y1W J;  5H2F C;  1IF1 A;  4I99 C;  2UXN A;  4RBO A;  3CO7 C;  3V7C A;  3HOZ J;  1F9N A;  1KU9 A;  2LBF B;  1J2X A;  2K3F A;  4FCY A;  3J81 Z;  2QA4 I;  2Y48 A;  5IT9 K;  3H3Z A;  2P6S A;  2V1X A;  2WTE A;  2WY7 Q;  3JRI A;  3R6S A;  3HUG A;  3I71 A;  2XDV A;  1TZL A;  2GBY A;  3HL2 A;  1XGM A;  4XRM A;  2FNP A;  3RKQ A;  1BR1 A;  2UUZ A;  2QKM B;  3OYN A;  4M71 A;  3V42 A;  2HOA A;  2VN2 A;  5D8K B;  3BR1 A;  2KL4 A;  2PG4 A;  2CV2 A;  3DP7 A;  1LVA A;  2L9S A;  2ESH A;  3OSF A;  2LKX A;  3ZMT A;  4YRV A;  2K9N A;  3R61 A;  4Q5S F;  3LSJ A;  2JA2 A;  2W82 A;  4B3X A;  1WI3 A;  1BM9 A;  5EG0 A;  2IGM A;  2XV4 S;  1W0U A;  3CJR B;  4GRI A;  3GZ5 A;  4A3C J;  4C3J J;  2XAG A;  1JT6 A;  5DUK A;  1SAU A;  2R5Z A;  2FNA A;  2K86 A;  1EH7 A;  3BOQ A;  2M7A A;  3CCV I;  4HNT A;  2PMH A;  3S3O A;  4U7D A;  2YUS A;  2M8G X;  3LFU A;  4UVA A;  3UNG C;  4A5M A;  3ECO A;  4KIG A;  4WXD A;  1GVD A;  5F1J A;  3KE2 A;  1WPK A;  1FSH A;  4N9I A;  4P5O A;  2QF7 A;  1T33 A;  1V54 H;  3KZY A;  3Q9V A;  3C2B A;  1HST A;  2F5D A;  1P4A A;  1XX5 A;  2E71 A;  4NQW B;  4A3F J;  2STT A;  3BDD A;  3EUK L;  1U6G A;  2L9R A;  3HBL A;  2G9W A;  5GAH J;  4EM2 A;  4I0A A;  2JVG A;  2R7F A;  2LP0 A;  2DFF A;  4B4C A;  1N75 A;  4LB6 B;  4ESJ A;  3H1C A;  1X1P A;  3DKY A;  1PP7 U;  3F3X A;  3KZZ A;  4U0W A;  3Q0W A;  4FE4 A;  4RB1 A;  4V2F A;  1MNE A;  3A0B C;  5ED4 A;  2GOX B;  3JRG A;  1WJF A;  4KMF A;  3V8L A;  3AFH A;  4DJA A;  1MDM A;  1K79 A;  1BI2 A;  2DA6 A;  3KCC A;  4XBF A;  2IS4 A;  2KP6 A;  1X2N A;  1R7J A;  3LFK A;  4N4O B;  3ZQH A;  1B72 A;  3ERE D;  2BEO A;  3RZD J;  4K2E A;  3GF2 A;  3FHZ A;  2HQA A;  1CQT A;  1XDS A;  4M74 A;  1UJ8 A;  2H09 A;  3EQL F;  2NS0 A;  2KDZ A;  3WU2 C;  5LGT A;  4G6T B;  3OYE A;  4BAY A;  2PJR A;  3GO5 A;  1YFH A;  4EJW A;  4IQ4 A;  1MMD A;  4ZH4 F;  1XMX A;  5E17 F;  1Z7U A;  2XVC A;  3C1D A;  1KGS A;  3WGI A;  4M3D A;  1BA5 A;  2OD5 A;  1LJ9 A;  2YSR A;  2E1M B;  1OR7 A;  4NC6 A;  5CVR A;  2VE9 A;  2PI0 A;  2WY8 Q;  3QPH A;  4LMY A;  1U0J A;  1D5V A;  3AG1 H;  3GZN B;  2JJ7 A;  3QOD A;  4AVP A;  2O8K A;  1RNL A;  3FDY A;  1FTT A;  1BW5 A;  4RB2 C;  4OMZ A;  3W2A A;  2XAH A;  1SD6 A;  2DFI A;  3U21 A;  3DU6 A;  3F6O A;  2XSJ C;  1ERD A;  2L01 A;  2FOK A;  4IHT A;  1VQ6 I;  5DEQ A;  2XRL A;  1AKH A;  2VQH A;  3L2C A;  3A1Y A;  4R8H A;  1CGP A;  2E1N A;  4ENK A;  1W4M A;  3K4M A;  3W2V A;  3BT9 A;  3IWZ A;  4EJT A;  4F93 B;  2X1D A;  3TDZ C;  1XCB A;  1B1B A;  2EFP A;  4M3B A;  1N78 A;  5E3N A;  2I8D A;  1R49 A;  1KQ8 A;  1VF9 A;  2E2I J;  4OIR F;  3DBL B;  4XL9 A;  1VQK I;  1D1C A;  4CGZ A;  5C3E J;  3TOB A;  3VFZ A;  3A01 A;  3OOU A;  2VQG A;  2WB1 N;  2XHK A;  3MAJ A;  4CSW A;  4Q47 A;  3ZP5 A;  5EYR A;  1SFO J;  2QSG X;  2EV6 A;  4H4K C;  3QU6 A;  2EJR A;  2R5Y B;  1LB2 A;  3L2V A;  3LST A;  4ZZD A;  3O6B B;  2OAZ A;  2O7O A;  2EK5 A;  3WG9 A;  4PJM A;  2X48 A;  1ZQ3 P;  2G0E A;  3QU3 A;  2DA2 A;  2B9S A;  2ID3 A;  3FIW A;  3S8P A;  3RI4 A;  2QM3 A;  3ONQ A;  5BMZ A;  5JFR A;  2V79 A;  1LNW A;  4P9U A;  2X85 A;  2HDC A;  5H6Q A;  2V6E A;  4LG0 B;  2IPQ X;  2V9V A;  5EZG A;  4IO9 F;  5JLX A;  5KVR A;  1VQN I;  3ASN H;  2FX0 A;  3F23 A;  1SFX A;  3BRO A;  4BKX A;  3IRR A;  2O0Y A;  3LQR A;  3F8C A;  1C0W A;  4BXF A;  5EGO B;  5DM6 F;  4JK1 X;  2JA8 J;  4CA0 A;  5DCM A;  4MLO A; 
#chains in the Genus database with same CATH homology
 5LRS A;  2FSW A;  1LDJ A;  3WTZ A;  2NYX A;  1MKM A;  5LHH A;  4M6Y A;  4RGU A;  2Z5U A;  1ZGJ A;  4A0X A;  2DBB A;  4LGW A;  1OKR A;  4XSZ F;  1E2X A;  1K6O A;  1L0O C;  1MJA A;  1MJ9 A;  1O7L A;  1LEB A;  2VT3 A;  4LJZ F;  3H92 A;  5BPD A;  1Z6T A;  2HKX A;  4RAY A;  4LD5 A;  2FML A;  2L02 A;  4ENJ A;  5J8C A;  3EUH A;  5TRD A;  3L9F A;  1Z05 A;  2JPB A;  4FHT A;  1YS6 A;  3KET A;  3ZQ7 A;  4I02 A;  4FX0 A;  1KQ9 A;  1J5Y A;  2OBP A;  1S6L A;  1WWX A;  2HQR A;  3T0Y A;  1TW3 A;  1L3L A;  1KQ0 A;  1Z91 A;  1YTY A;  1IN7 A;  4L9T A;  5CVJ A;  1J59 A;  2M87 A;  2DU9 A;  1IN5 A;  4A12 A;  3TO7 A;  3ZMV A;  1WSU A;  3R4K A;  1F5T A;  2K27 A;  2VE8 A;  3HHH A;  4I7H A;  2HGC A;  2BV6 A;  4F7Z A;  3O2P E;  5LEJ A;  3HRT A;  3WGG A;  2K4B A;  2L54 A;  4CO8 A;  3JAM Z;  1DPU A;  3RKY A;  5ILV A;  4LLN A;  3GVA A;  2YPR A;  4NHJ A;  1HSJ A;  3MWM A;  1H9T A;  4H0E A;  3C18 A;  5DD8 A;  3IRQ A;  4EM0 B;  1G4D A;  2XIG A;  5L3B A;  5LBQ A;  1ON1 A;  4KA4 A;  1FC3 A;  3HIF A;  2DQL A;  2KJC A;  1FLI A;  1UST A;  2VOD A;  2YX4 A;  4LLL A;  5J8F A;  2HOE A;  4NQW A;  3K9T A;  2NNY A;  1IN6 A;  3WTW C;  2QVO A;  3E3V A;  4RB3 C;  3C7J A;  2OU2 A;  2BGC A;  2ZNZ A;  4RGS A;  3HSE A;  4WX9 A;  2HKO A;  3D5L A;  3I64 A;  4AWX B;  2JT1 A;  1F4K A;  1ZRC A;  2P5V A;  5DUI A;  2NAZ A;  1QGP A;  2HWV A;  1UHW A;  2M45 A;  1ZRE A;  2DQR A;  4IXA A;  3E6D A;  1V4R A;  2A6E F;  3G3Z A;  4WCG A;  3RKW A;  1UHM A;  5E1X A;  2HTS A;  1D3Y A;  3WU1 B;  1SAX A;  5L3E A;  4OIP F;  1R5H A;  4LB5 A;  5EEG A;  3CTA A;  3I54 A;  5D6F A;  1PUE E;  3V7R A;  1FP1 D;  4BHP A;  3Q5F A;  4IRH A;  3VOD A;  4IHS A;  2IJL A;  3ELK A;  2EFO A;  1HQC A;  2DPU A;  2IA1 A;  2HYF A;  4MEY F;  5EEH A;  2VC0 A;  2Q8K A;  5FLX K;  3K2Z A;  3B73 A;  1U2W A;  2O8X A;  3GLX A;  1SMY F;  2QQA A;  2F5C A;  5CVV A;  1CF7 A;  3F72 A;  3F8F A;  4EGY A;  2NRA C;  1IUY A;  3I59 B;  1OMI A;  2MBF A;  3T5X A;  1SFE A;  4KN7 X;  2P6T A;  2OQR A;  5LEK A;  3CLO A;  2W24 A;  4YIF A;  4HZF A;  3EYI A;  3QP6 A;  1KU3 A;  1I6X A;  4RAZ A;  4WWC A;  4N0B A;  2P5K A;  1LDD A;  4Z2Y A;  3HYI A;  3FM5 A;  2LF7 A;  4BHC A;  2PN6 A;  1B4A A;  3WTS C;  1SD4 A;  3K1N A;  1PDN C;  1BI3 A;  3ZN1 A;  3CUQ C;  1LQ1 A;  2Q0O A;  4CXF A;  1U5T A;  2P8T A;  3TO6 A;  3V8K A;  2GQQ A;  4M73 A;  1I1G A;  1YG2 A;  4EQQ A;  2D1V A;  4YG2 F;  3I59 A;  4HDU A;  3QRF F;  1HW1 A;  1H9G A;  3K1P A;  3HSF A;  1QZZ A;  5E18 F;  3WGH A;  2FXA A;  1J0R A;  1FY7 A;  3T8R A;  5BPI A;  1DDN A;  4PDK A;  1TLH B;  3ISP A;  1R5G A;  2HS5 A;  2UZK A;  2VBY A;  3GUD A;  2MD5 A;  1T98 A;  3E5Q A;  2MC3 A;  4TV7 A;  2GWR A;  4RS8 A;  2F2E A;  2RV8 A;  3E5X A;  1XSX A;  3RIR A;  3J7A O;  3KP7 A;  4WXH A;  5HDG A;  4B8X A;  1TNT A;  2EFW A;  2W84 A;  2JSC A;  4A5N A;  3F8M A;  2GIV A;  4G7H F;  3BJ6 A;  3BJO A;  4NB5 A;  4MGR A;  4P9F A;  1TTY A;  4G6D A;  1XCV A;  4HX4 A;  4EMS A;  3WTV C;  2A69 F;  4KIC A;  4G8X A;  2KIF A;  4HF1 A;  3BY6 A;  5D4S A;  2QBY B;  5FB2 A;  3GFL A;  2JRT A;  4CDG A;  1B59 A;  1B9N A;  4ESB A;  2EA2 A;  1XB4 A;  2YX7 A;  5HLG A;  5HVQ C;  3DEU A;  2EV5 A;  3L09 A;  1I27 A;  1MZB A;  4RGR A;  2JPC A;  3ZMZ A;  4GXO A;  1NHA A;  3GXO A;  2HFH A;  4A6D A;  3MZY A;  5D6E A;  2OQG A;  4LK1 F;  2STW A;  3R0A A;  1DP7 P;  4FT8 A;  4L0Y B;  1OYW A;  5A2Q K;  1KYW A;  2FU4 A;  5ICE A;  4G9Y A;  3SZT A;  4AIH A;  4A0Y A;  1ZLJ A;  3RPU A;  1FX7 A;  3KFW X;  3HOS A;  3L00 A;  2H6B A;  3NEU A;  3PQJ A;  3M9A A;  2O61 A;  5LHI A;  4I01 A;  2XRO A;  1HXD A;  4BYY A;  4EGZ A;  3ABT A;  3DFG A;  2COM A;  3LA7 A;  3MZH A;  3BPV A;  4Q48 A;  6PAX A;  5DCM B;  2O03 A;  3FWE A;  4ZYE A;  5AON A;  1GXP A;  3RPQ A;  3WTT C;  1S7O A;  1IW7 F;  5E8I A;  2JZY A;  4MHG A;  4B09 A;  5HS9 A;  3FMR A;  3WE2 A;  2DAO A;  3BJA A;  5CVU A;  3KP3 A;  2EFN A;  3M8F A;  3NQO A;  3TO9 A;  2OZU A;  3D0S A;  4M9S A;  5JVT A;  2M5W A;  3HOT A;  4HOB A;  2WV0 A;  1ZYR F;  2PFB A;  5BOX A;  1FOK A;  3N97 A;  2O3F A;  4M9Z A;  4PCQ A;  4U0Y A;  1BI1 A;  3QOP A;  1IZ1 A;  2FEZ A;  4JQF A;  3HRM A;  3L7W A;  3CUQ A;  1IXR C;  1TQI A;  2CSO A;  4MQ9 F;  5ICF A;  2YU3 A;  2GZW A;  5ILS A;  4UNO A;  3VB2 A;  3GX4 X;  4R1H A;  2D45 A;  1P4W A;  2ADU A;  4L9V A;  3IKV A;  1R00 A;  5FFX A;  5HLH A;  1QNT A;  3WU0 A;  1K78 B;  1B9M A;  3M7G A;  1G3Y A;  3W6K B;  3RDI A;  2E7X A;  1RI7 A;  3KLO A;  1FYL A;  2ELH A;  2QWW A;  2P7C B;  3KP4 A;  2LF8 A;  1YLF A;  2O6G E;  3BWG A;  2UWM A;  2XAJ A;  3T8T A;  5H6R A;  2XKP A;  2E1C A;  3GFM A;  5F1R A;  5L3D A;  3ECH A;  5D5V B;  3ML6 A;  3HSR A;  4HV6 A;  2ZME B;  4IPA A;  3W6J B;  1FYM A;  3FXU A;  3IKT A;  3EYY A;  1U5T C;  3DPL C;  3LAP A;  1P2F A;  4ETS A;  1YQA A;  4AIJ A;  4GCV A;  2NNN A;  2FQ3 A;  3IHU A;  1U5T B;  1XMK A;  1W7P A;  5LGU A;  1USS A;  3WOD F;  4HX7 A;  4P55 A;  3DKW A;  4OIQ F;  1SFU A;  2KRF A;  4XSX F;  1REP C;  2K4J A;  2W85 A;  3P9K A;  1ZRD A;  5HS8 A;  2ISZ A;  4ZYD A;  2OZ6 A;  3S2W A;  4E70 A;  2ZKZ A;  2XAQ A;  2WWY A;  2Y0M A;  1H0M A;  2L3D A;  1BN5 A;  1XDU A;  3I58 A;  4DQ2 A;  3JTH A;  4YFK F;  2PEX A;  1DPR A;  5DV5 A;  2QEN A;  2UXX A;  2LSO A;  1J7K A;  2YR2 A;  4EJV A;  4G94 A;  4UXN A;  2PLY A;  5LLQ A;  1Z1D A;  5TJJ A;  2H27 A;  1W5S A;  3QP5 A;  2L4A A;  2DK5 A;  3K69 A;  1XGO A;  1XD7 A;  4BQA A;  2QZ8 A;  2DW4 A;  4MEX F;  3MQ0 A;  5ICG A;  2Z3Y A;  2GXG A;  3MFK A;  4A2U A;  1MJB A;  5E1Z B;  1SMT A;  2F5F A;  4HYE A;  2HR3 A;  1HKQ A;  4R79 A;  3ZPL A;  5K5R A;  2VOO A;  4LK0 F;  1RUO A;  3I4P A;  1QBJ A;  4EJO A;  1MDM B;  3P9C A;  2EB7 A;  2W25 A;  3EET A;  5K5Q A;  4HQM A;  1BI0 A;  1UCR A;  3HHG A;  4BHB A;  1YS7 A;  3TQN A;  3KLN A;  1G3W A;  1FNN A;  1T38 A;  5H20 A;  2J5O A;  3TKY A;  4L18 B;  1T0F A;  5BQT A;  3O3K A;  2RGV A;  1G3S A;  5D5W B;  1O3S A;  2D2W A;  5AIP A;  2IT0 A;  2PJP A;  3CDH A;  5LRR A;  3JSP A;  4KYW A;  5CYV A;  5JR3 A;  4I98 B;  2MH2 A;  3WE3 A;  2RNJ A;  3K0L A;  1QO0 D;  4O6J A;  5HDK A;  1XSV A;  4MNU A;  4CZZ A;  4YII A;  5D4R A;  5JI6 A;  4QLC U;  2GA1 A;  1ZG5 A;  3V4G A;  3ZN0 A;  2KKO A;  3GWZ A;  3AAF A;  4G6Q A;  4XRF A;  2FA5 A;  2C6Y A;  1FWZ A;  2OA4 A;  2Q2E A;  4I0B A;  4ENN A;  2F5E A;  5L3G A;  3JAM K;  3U2R A;  1S29 A;  3MCZ A;  4CYD A;  5K5O A;  3U9G A;  3WTU C;  4HLX A;  1E17 A;  2DLL A;  3F21 A;  3E6C C;  4IVN A;  1FPQ A;  3C3W A;  1OYI A;  5FD5 A;  1T2K A;  1R1V A;  4A6E A;  2CO5 A;  4OIO F;  3IWF A;  1XSD A;  2EWN A;  4ASN A;  2M8E A;  5HS7 A;  2FRH A;  3NRV A;  2G7U A;  2EA4 A;  4BNC A;  2E7W A;  2Z99 A;  2PQ8 A;  5FD6 A;  3JW4 A;  3IC7 A;  3TDU C;  1U78 A;  4L0Z B;  2BYV E;  3JTG A;  1QPM A;  4HV5 A;  3U1D A;  2ETH A;  1HKS A;  1Z9C A;  1JGS A;  1ZHF A;  2BBY A;  2RDP A;  1Z6R A;  1HBX G;  1OPC A;  4KT5 C;  1I5Z A;  1HW2 A;  5HDN A;  2JTV A;  1FZP B;  1CF7 B;  2LNB A;  2IP2 A;  3G73 A;  4GO1 A;  1S7A A;  1AOY A;  3R0J A;  4EV0 A;  4UVB A;  2DK8 A;  5ERI A;  3VOE A;  1S8N A;  5ILU A;  2ZJ2 A;  4AD9 A;  4JBA A;  3I5U A;  1ZG3 A;  2V6C A;  5D8L B;  4KIF A;  4Y15 A;  1BOA A;  3DQV C;  3ROU A;  4LFU A;  2A61 A;  3V7S A;  2FE3 A;  3JSO A;  1HKT A;  3KP2 A;  4ZZL A;  1WRJ A;  1TQP A;  2QUF A;  3EDP A;  2GAU A;  1BC8 C;  2D1H A;  3BZ6 A;  3Q9S A;  2K7L A;  1IRF A;  4YFX F;  4UUV A;  1YW8 A;  2G7H A;  4OIN F;  1W5T A;  3CJN A;  4HF0 A;  1O57 A;  4G7Z F;  2ZO4 A;  3QPT A;  4UVC A;  4CIC A;  1JE8 A;  5E8G A;  2VON A;  2FBK A;  3FXR A;  1YIO A;  4LG0 A;  2ZFW A;  1IN8 A;  3DPT A;  3F6V A;  3QAH A;  2J5P A;  1EH8 A;  5CLS A;  3DV8 A;  3TGN A;  2P5L C;  1TW2 A;  4HQE A;  2BE5 F;  2XUB A;  4L5J A;  3LQQ A;  4PZJ A;  2IVM A;  1BJA A;  5BS6 A;  1XN7 A;  2R7D A;  1FBU A;  1FBS A;  2XGX A;  1X3U A;  4OU0 A;  3F8B A;  3GFI A;  1IN4 A;  1O3T A;  2ZCW A;  4WXC A;  2CG4 A;  2TDX A;  3RYP A;  3DXJ F;  1FYK A;  4RB0 A;  5FO5 A;  3PQK A;  2IA0 A;  3DF8 A;  5HOO A;  1TBX A;  4KDP A;  3ABU A;  5JHU A;  4M9X A;  4WK8 F;  2XRN A;  1O3R A;  4IRI A;  2ESN A;  4U88 A;  4M72 A;  2DO7 A;  4G7O F;  2FBH A;  2Z33 A;  3P9I A;  3BP8 A;  2A5Y B;  1D8K A;  3KEO A;  2QQ9 A;  1JHF A;  1GVJ A;  2DT5 A;  1Y0U A;  1MD0 A;  3WTY C;  3OV8 A;  1ZH5 A;  2A68 F;  3LWF A;  3ULQ B;  4EM1 A;  1RIO H;  1EH6 A;  4IJA A;  2VBZ A;  4KN4 X;  1XGS A;  1G3T A;  4GYI A;  3HRS A;  1LEA A;  4U0V A;  4WF2 A;  1R36 A;  4L5I A;  3I53 A;  2HQN A;  5ICC A;  2X0L A;  4ON0 A;  2RC4 A;  3CO6 C;  3LA2 A;  3M8E A;  1ONV A;  3KP6 A;  4OMY A;  2HZT A;  3RKX A;  4XLN F;  4YFN F;  4ZYH A;  2FF4 A;  2K02 A;  3GEZ A;  4MTD A;  1ON2 A;  3GFJ A;  1EV7 A;  1OYY A;  5J6X A;  1AWC A;  3ZMS A;  4PGG A;  1BBY A;  2DTR A;  3SHF A;  1UB9 A;  2XAF A;  4LLG F;  1U8R A;  2WC2 A;  2H6C A;  2RQP A;  4BXU A;  3P7N A;  1STZ A;  3E6B A;  3CUQ B;  1PP8 F;  1BIB A;  1ZN2 A;  4N9H A;  2L4M A;  2EFQ A;  5CJ9 A;  4HBL A;  2VBX A;  1V3F A;  4KIB A;  3H3U A;  1ZAO A;  5LGN A;  4IRG A;  4HDV A;  1F1Z A;  1G6N A;  4GGG A;  3M1E A;  4HX8 A;  5IT9 Z;  2GXB A;  2XKO A;  3OOP A;  4Y13 A;  4ENM A;  1T39 A;  4AIK A;  2HYG D;  1TQM A;  3PFI A;  3TOA A;  1Q1H A;  2IW5 A;  5F64 A;  4Q4Z F;  2Z9O A;  3F8N A;  1T6S A;  2FMY A;  3GYH X;  5HLI A;  1QQI A;  1ZLK A;  1KYZ A;  3HRU A;  4A0Z A;  2MLK A;  5D5U B;  1WQ2 A;  4HAM A;  3GZ6 A;  1RUN A;  2ZME A;  2ACJ A;  4O3M A;  4ESF A;  2Y75 A;  1MGT A;  3FZV A;  4FX4 A;  4L9J A;  5E1W A;  4Y17 A;  4M6X A;  2LKP A;  1P6R A;  2CGP A;  3E5U A;  1R58 A;  3SQN A;  4S04 A;  3N4M A;  2PBI A;  2P4W A;  4HLY A;  1SD7 A;  1TNS A;  2W57 A;  1FP2 A;  1ZRF A;  2MLG A;  4XLP F;  1ULY A;  1D8J A;  1BIA A;  3F22 A;  1P92 A;  5L3F A;  3VEP A;  5L3C A;  2CFX A;  1QZY A;  1FBQ A;  2ZXJ A;  3J80 Z;  3KP5 A;  4MQV A;  1JXS A;  5D5X B;  2CWE A;  1IXS B;  4HF2 A;  2QYO A;  3V8J A;  4BH9 A;  1FT9 A;  2B0L A;  1P4X A;  1IXC A;  3RJP A;  1KU7 A;  1R1U A;  2KIU A;  5F6F A;  1K7A A;  4KUM A;  4P96 A;  4CHU A;  2R3S A;  3B02 A;  2V1U A;  1JHH A;  3KEQ A;  1I1S A;  3ZMD A;  5AIQ A;  1LDK B;  2X4H A;  4PGH A;  2HEO A;  3SZP A;  1HW5 A;  1J9I A;  4KMU X;  1K78 A;  3SFZ A;  2P7V B;  2V1D A;  4OOI A;  1IAW A;  1XMA A;  1R22 A;  2KIM A;  5FGM A;  3CUO A;  1O3Q A;  2CYY A;  1W7P D;  2AS5 F;  1FSE A;  4MTE A;  2VC1 A;  3T1B A;  1ZGA A;  3FX3 A;  1S3J A;  3K1M A;  5DYM A;  2MA3 A;  2DPD A;  3E6M A;  2DI3 A;  1YO5 C;  1YYV A;  2M30 A;  1W7P B;  2IRF G;  5DDG A;  1RZ4 A;  4UV9 A;  3HTU A;  1UFM A;  4QWQ A;  1B6A A;  5IT3 A;  1GHC A;  1DUX C;  1ZG1 A;  1GXQ A;  3I0T A;  2H94 A;  1U3E M;  1KU2 A;  4D0P A;  4GYG A;  4O5V A;  5K1Y A;  3SXY A;  1J75 A;  2PMU A;  3MEX A;  2VBW A;  3WTX C;  5FLX Z;  2ZBK A;  3FM3 A;  2HTJ A;  2GA2 A;  2ISY A;  3GW2 A;  3IL2 A;  5DD4 A;  1BC7 C;  3BPX A;  1SD5 A;  3REO A;  2A3S A;  3FF5 A;  3FMS A;  5A2Q Z;  1R23 A;  4RGX A;  5LHG A;  2M1B A;  1ZAR A;  2FBI A;  1WI9 A;  5DCF A;  3E97 A;  2XAS A;  4DNC A;  2RN7 A;  3J81 K;  3J80 K;  1KA8 A;  3HTS B;  4IF4 A;  2VXZ A;  2MH9 A;  4I2O A;  2AXL A;  4ZYG A;  2CQK A;  2QBY A;  1YW9 A;  5E20 A;  2CW0 F;  2RKH A;  3R60 A;  4U7B A;  4UHT A;  2KJB A;  1IRG A;  3COA C;  4KFC A;  2RVC A;  4EVI A;  3ZMU A;  2A07 F;  4KNY A;  4I09 A;  1XGN A;  3FXQ A;  2VT2 A;  2LDU A;  2ZNY A;  2EV0 A;  5CVI A;  3RTR A;  2A6H F;  4HW0 A;  2VOP A;  4UV8 A;  1R1T A;  4L9N A;  1A04 A;  2IA2 A;  1O7F A;  3LA3 A;  1VTN C;  3LAJ A;  4HA8 A;  1YW7 A;  2QQB A;  1WKM A;  3RYR A;  4S05 A;  3FMQ A;  5FFZ A;  4EJU A;  2QLZ A;  1ODD A;  1IF1 A;  2UXN A;  3CO7 C;  3V7C A;  1F9N A;  1KU9 A;  1J2X A;  3J81 Z;  2Y48 A;  5IT9 K;  3H3Z A;  2P6S A;  2V1X A;  2WTE A;  3R6S A;  3HUG A;  3I71 A;  1XGM A;  2FNP A;  4M71 A;  2VN2 A;  5D8K B;  2PG4 A;  3DP7 A;  1LVA A;  2ESH A;  3ZMT A;  3R61 A;  4Q5S F;  1BM9 A;  2XV4 S;  3GZ5 A;  2XAG A;  5DUK A;  2FNA A;  2K86 A;  1EH7 A;  3BOQ A;  2PMH A;  4U7D A;  4A5M A;  4UVA A;  3ECO A;  4KIG A;  4WXD A;  3KE2 A;  1FSH A;  4N9I A;  4P5O A;  3KZY A;  3Q9V A;  1HST A;  2F5D A;  1P4A A;  2STT A;  3BDD A;  1U6G A;  2G9W A;  4EM2 A;  4I0A A;  2R7F A;  4LB6 B;  4ESJ A;  1PP7 U;  3F3X A;  3KZZ A;  4U0W A;  4RB1 A;  5ED4 A;  4KMF A;  3V8L A;  1MDM A;  1K79 A;  1BI2 A;  3KCC A;  4XBF A;  1R7J A;  3LFK A;  3ERE D;  2BEO A;  4K2E A;  3GF2 A;  3FHZ A;  1XDS A;  4M74 A;  2H09 A;  3EQL F;  2NS0 A;  5LGT A;  4BAY A;  3GO5 A;  1YFH A;  4EJW A;  4ZH4 F;  5E17 F;  1Z7U A;  2XVC A;  3C1D A;  1KGS A;  3WGI A;  2OD5 A;  1LJ9 A;  2YSR A;  1OR7 A;  5CVR A;  2VE9 A;  2PI0 A;  3QPH A;  4LMY A;  1D5V A;  4AVP A;  1RNL A;  4RB2 C;  4OMZ A;  2XAH A;  1SD6 A;  2DFI A;  3F6O A;  2L01 A;  4IHT A;  2FOK A;  5DEQ A;  3L2C A;  4R8H A;  1CGP A;  2E1N A;  4ENK A;  1W4M A;  3IWZ A;  4EJT A;  3TDZ C;  1XCB A;  1B1B A;  2EFP A;  1KQ8 A;  4OIR F;  4CGZ A;  3TOB A;  3VFZ A;  2XHK A;  3MAJ A;  4Q47 A;  3ZP5 A;  2EV6 A;  3QU6 A;  2EJR A;  1LB2 A;  3LST A;  4ZZD A;  3O6B B;  2OAZ A;  2EK5 A;  3WG9 A;  3QU3 A;  3RI4 A;  2QM3 A;  5BMZ A;  5JFR A;  2V79 A;  1LNW A;  4P9U A;  2HDC A;  5H6Q A;  4LG0 B;  2IPQ X;  2V9V A;  5KVR A;  3F23 A;  1SFX A;  3IRR A;  3BRO A;  2O0Y A;  3LQR A;  3F8C A;  1C0W A;  4JK1 X;  5DCM A;  5KK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...