3WTSC

Crystal structure of the complex comprised of ets1, runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
118
structure length
118
Chain Sequence
PVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 40
structure length 118
sequence length 118
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wtsC00
3WODF 5ED4A 2LF8A 3E6DA 4NB5A 4A6DA 4YFXF 2A07F 1FY7A 5DCMA 5D5WB 4LK0F 3FHZA 4IHTA 4YG2F 1RI7A 4GXOA 4G8XA 4HF0A 3JTHA 5CVUA 1U5TA 3GZ5A 4EJVA 3ROUA 2YPRA 1ODDA 1I6XA 5ICEA 2EB7A 3JAMK 3KETA 4O6JA 2XKOA 1K6OA 1ZYRF 3W6KB 3LA2A 2V1UA 3WTYC 2JTVA 3BPVA 3GYHX 1ULYA 4P5OA 4L0ZB 3DV8A 4FX4A 1REPC 5DEQA 1SFUA 3DP7A 4LMYA 1XDSA 4EM1A 3MFKA 3HSRA 2DAOA 3T8TA 2J5PA 5HDKA 3DPLC 4OMZA 3TO7A 3FX3A 3JAMZ 1S8NA 4YFNF 2YSRA 1KGSA 2L01A 4RB0A 3BJ6A 4IRIA 5CYVA 4LD5A 4ENMA 5ICGA 4U0VA 3I0TA 4WWCA 4EQQA 2CW0F 1XSVA 4XRFA 2L4MA 1HW5A 2PI0A 3RJPA 2VBWA 5BS6A 3T0YA 4RGSA 2IA1A 5JFRA 2M5WA 1S29A 3DKWA 3KLOA 4Q48A 3FMRA 2V9VA 1OR7A 2PEXA 3KCCA 2E1NA 3F22A 2VBYA 3MZYA 1ZARA 1P92A 3V8LA 1ONVA 5K5QA 3OV8A 3IKVA 2KJBA 5F6FA 2IRFG 4LGWA 4BHPA 1OYWA 5IT3A 5LRSA 3HRSA 3I53A 2RQPA 2HGCA 1RZ4A 2OZUA 2W24A 2ZO4A 1LQ1A 3KZZA 3NEUA 4G94A 2PN6A 4LG0B 5BPIA 4KMFA 3Q9SA 3GLXA 4ZYHA 1QQIA 1K79A 4I01A 1IN6A 2MA3A 4KNYA 5CVRA 5CVVA 2VN2A 2MLKA 3Q5FA 1G4DA 2PMUA 1FT9A 3AAFA 1MZBA 1MGTA 2JRTA 3I58A 5A2QK 1G3TA 1S7AA 2CWEA 3N4MA 3RKWA 2NAZA 1UHMA 1XSXA 3LQQA 2ZBKA 1AOYA 2YX7A 1F5TA 1TQPA 3QRFF 4JQFA 1VTNC 2W85A 2OZ6A 4RAYA 5LGNA 4GYIA 4AIHA 2W84A 4FX0A 4UNOA 2ACJA 4IVNA 3H3ZA 5A2QZ 1T2KA 4HDUA 1YIOA 4I2OA 3TOAA 1IXCA 2ISYA 4AD9A 3K69A 3TO9A 1E17A 1G3YA 1K7AA 1TW3A 1IRGA 2VE9A 1PP8F 2W57A 1SD7A 3CLOA 4L0YB 1LDKB 3QPTA 3BOQA 5LGTA 2GWRA 2QBYA 3E5UA 4OIPF 2FSWA 3KEQA 1YG2A 3U2RA 1V3FA 1R7JA 2XUBA 3GXOA 3COAC 2A6EF 1J0RA 5HS7A 1IRFA 1ON2A 3GZ6A 1R36A 3FMQA 3CUQB 4L5IA 4CXFA 2VBXA 2X0LA 3R6SA 4GO1A 3ABUA 5FB2A 3J7AO 4Z2YA 4LLLA 4ENJA 1LVAA 3MZHA 5FO5A 1SD4A 4M6YA 4OIRF 3L00A 5D8LB 2P5KA 1TW2A 1UCRA 3GWZA 2O8XA 2HQNA 2EA2A 3I4PA 2JSCA 3R4KA 4BH9A 4M71A 2HDCA 5LLQA 1T6SA 1XB4A 3QP5A 3SQNA 3QP6A 3H3UA 3ZMZA 2IA2A 3SZTA 3P9KA 2HKOA 3D5LA 4WXCA 2PFBA 4IRGA 3TGNA 2FRHA 2FMYA 4QWQA 1FNNA 3TDZC 4LLGF 3VOEA 3WE3A 1AWCA 5E1WA 5L3CA 1I1GA 2VODA 3RI4A 4HBLA 1YW8A 3BDDA 4R79A 2X4HA 2YU3A 4A6EA 4BHBA 1ZRDA 2XVCA 1EV7A 3TOBA 1I1SA 4A5NA 2PLYA 2FXAA 3HUGA 2R3SA 4UV8A 3WU0A 2VT3A 1B59A 2H6CA 1K78A 2R7FA 2XRNA 2UWMA 4PZJA 2IA0A 1P4XA 4EJUA 4A2UA 1Y0UA 1XSDA 1SMTA 1OYIA 1B1BA 1IN8A 3ISPA 3R60A 2Q2EA 4HX4A 1U3EM 4RAZA 1T0FA 2G9WA 3ULQB 1BBYA 2P7VB 5J6XA 1J2XA 5H6QA 5D5VB 2MD5A 3EUHA 2RN7A 3EYYA 1O3TA 5ILVA 2NNYA 1RIOH 3ZN1A 4I7HA 2BBYA 1BC8C 3KLNA 4IPAA 3GFIA 1P4WA 3KP2A 3RTRA 2HYFA 2O61A 2UXXA 3V8KA 1EH6A 3MCZA 1GHCA 2D1HA 6PAXA 5JHUA 3HSFA 5AIQA 2J5OA 5E1XA 5TJJA 3QPHA 4IF4A 4M6XA 4OIOF 4ESBA 1XD7A 2PG4A 2ZKZA 3LSTA 3W6JB 4PDKA 1KQ9A 4BHCA 4OU0A 2OAZA 3WGIA 1FWZA 4LJZF 2L3DA 1Z6RA 1R1TA 2XAJA 3RIRA 4KFCA 2DK8A 5EEGA 3HYIA 4U0WA 4A0XA 5F1RA 4KICA 5BQTA 1FLIA 4XBFA 2P4WA 5L3GA 3H92A 3U9GA 3NQOA 5E8GA 3ZN0A 4O5VA 2Q8KA 2OA4A 5DUIA 2JPCA 3G73A 1CF7A 5D8KB 1DUXC 2P8TA 3CTAA 4R1HA 3L2CA 3T1BA 1R1VA 3CDHA 1TQMA 5LHGA 5D5UB 4N0BA 3KEOA 2XAQA 2O03A 1WQ2A 1XMKA 3HRTA 1O3QA 1IXRC 3F8NA 1KU9A 2HQRA 1IUYA 3ECHA 1QBJA 4B8XA 3BY6A 3KZYA 3HTSB 5ILUA 1F1ZA 1SFXA 2UZKA 4G7OF 1U2WA 1OMIA 1B9NA 4KDPA 5D4RA 5E18F 2XHKA 4FHTA 1ON1A 1O57A 3GX4X 5D6FA 5LEJA 2HTJA 2M30A 2O3FA 5LHHA 4HX7A 4ASNA 1TLHB 1J7KA 4OMYA 3WTWC 3QU3A 4IRHA 1R5GA 2BV6A 4U88A 4BAYA 3GUDA 1C0WA 2BGCA 5KVRA 5FD6A 3HHGA 1LDJA 2FEZA 5K5OA 2CSOA 4NQWA 1J5YA 4MEXF 3RYRA 3GFJA 1LEBA 1MJBA 4RS8A 4G7HF 4MTDA 5HDGA 1ZG5A 2ZFWA 2XROA 3SXYA 4MEYF 2FQ3A 2FMLA 1R23A 4RB1A 2H6BA 5H20A 4A12A 3WTZA 4U7DA 3WTVC 4P96A 1TNTA 1U6GA 2EV6A 2F2EA 2MH9A 2K27A 1CGPA 1W7PA 1P6RA 5CVJA 2XASA 3TO6A 3LWFA 2Z3YA 3O3KA 3CJNA 4RGRA 1BI3A 2Y0MA 2DPUA 3F8BA 2LDUA 3ZMVA 5CJ9A 3I59A 2TDXA 1MDMB 3J80K 4HW0A 1JHHA 2Z5UA 5HLHA 1BM9A 4G9YA 5LEKA 1OYYA 3RKYA 5AIPA 1XDUA 2YR2A 1B9MA 2OBPA 2AS5F 3FXUA 4DNCA 3O2PE 3FXQA 1FBSA 4CYDA 1IN4A 4KN4X 4HAMA 2A61A 3GW2A 2QUFA 3VFZA 2WC2A 1ZN2A 3E6MA 3PQKA 3HRMA 3KP6A 4Y17A 1QGPA 2OU2A 1XGMA 3J80Z 2FBKA 4G6DA 3REOA 1NHAA 1HKQA 2CGPA 2RV8A 4CHUA 4HLXA 2HFHA 4GCVA 4L5JA 2L02A 3D0SA 3E5QA 1A04A 1ZLJA 2OQRA 3M7GA 5FFXA 1U8RA 5L3EA 1G6NA 2K4JA 3RDIA 4BXUA 3F3XA 1S7OA 1ZGJA 1G3WA 3JSOA 2Z99A 3SFZA 4GYGA 1Z1DA 1R1UA 5F64A 2F5FA 3JTGA 5DCMB 3IRQA 3DEUA 3P9CA 4LLNA 1TBXA 1QO0D 3KE2A 4Q4ZF 2IP2A 2LSOA 1U5TB 1KA8A 1Q1HA 1SMYF 2STWA 3CO7C 4EGZA 2IVMA 2MH2A 1OKRA 2ESHA 2HR3A 4ZZLA 3GFLA 2FNAA 1FYKA 3IC7A 4HOBA 1HW2A 2MLGA 4HV5A 2F5CA 2HYGD 1E2XA 4R8HA 1F9NA 4BYYA 5ILSA 2EFNA 4CO8A 1XGSA 4ENNA 2DTRA 3R0AA 3V7SA 4S04A 1T98A 2GAUA 2ZMEA 5E17F 1S3JA 5E1ZB 4AIJA 1P2FA 1WRJA 2FOKA 2XAFA 2QQ9A 2XV4S 3BJOA 2R7DA 1RNLA 3VODA 4HQMA 4Q47A 1ZG1A 3OOPA 2HEOA 1H9TA 1G3SA 4EV0A 5LBQA 5HLIA 3F6OA 4LB6B 2EV0A 4MTEA 5E8IA 5BPDA 1HXDA 2QZ8A 1KQ8A 2ZXJA 2K7LA 1ZLKA 3ECOA 2P5VA 3R0JA 1FP1D 2DI3A 2EFPA 3E3VA 1ZG3A 3BZ6A 3V8JA 2HKXA 3KP7A 3IL2A 2STTA 2XGXA 2DK5A 4HYEA 1SAXA 1YO5C 1FPQA 4ON0A 1XGNA 1HQCA 2M8EA 3IHUA 4ESFA 4WF2A 2KIFA 4LK1F 3C1DA 4RGXA 2A5YB 2EFQA 2W25A 2Z9OA 1FYLA 4G6QA 2PJPA 3I59B 1FYMA 2RVCA 2Z33A 1MJAA 3KP5A 5CVIA 4FT8A 4UUVA 2VOPA 1B6AA 5TRDA 1L0OC 2WWYA 4DQ2A 2JZYA 4WX9A 3CO6C 3J81K 4M72A 2ELHA 3LA7A 4U0YA 1I27A 4L9TA 4ESJA 2KIMA 2FF4A 5K5RA 1ZAOA 3K2ZA 5J8CA 3B02A 5HLGA 3CUQC 2QYOA 2FE3A 3I54A 1LNWA 2DO7A 1LJ9A 3TQNA 2FA5A 2WV0A 3RPQA 3WTSC 3J81Z 3ERED 1DP7P 3F8FA 1KU3A 3DFGA 2QQAA 2V1XA 1T39A 2LNBA 3S2WA 4H0EA 4WXHA 2FBIA 2Y75A 1ZH5A 2RKHA 2GA1A 1YLFA 2BEOA 4P9UA 1SD6A 1T38A 1ZRFA 2IJLA 1ZGAA 3FM3A 2RC4A 3MQ0A 1TTYA 4F7ZA 4A0YA 5DDGA 3EDPA 1D3YA 3GFMA 2P6SA 2KJCA 2QBYB 3HOTA 4I0AA 1IW7F 2GQQA 1YW7A 3GVAA 3WTXC 1BI2A 2GA2A 3F8CA 1WSUA 3BJAA 2A69F 1W7PD 2ZJ2A 2RNJA 2HS5A 2KKOA 4HLYA 4ENKA 4LFUA 1O3SA 4XSZF 5BOXA 2F5DA 4O3MA 4CDGA 1IZ1A 5H6RA 2L54A 2H94A 1D8KA 3V7CA 4M73A 1I5ZA 2IW5A 5EEHA 4EJTA 1GVJA 1X3UA 1W5TA 2YX4A 3RPUA 3WGHA 4P9FA 5D4SA 1YS6A 1XMAA 1IAWA 1FSHA 3IWFA 1P4AA 3VEPA 3K9TA 2A6HF 4M9XA 2PBIA 3M8FA 3K1NA 3QOPA 1RUNA 4WXDA 2CO5A 3FMSA 1FBQA 1JXSA 3F23A 4L9JA 2RGVA 2HOEA 4YIIA 3T5XA 1BC7C 3ZP5A 2V1DA 1TNSA 5FFZA 1FSEA 4EM2A 1MJ9A 1HSJA 1LDDA 1UB9A 3JSPA 4Y13A 1PUEE 5JR3A 3BROA 2MBFA 4N9IA 1YYVA 3HHHA 3DXJF 5E20A 1W4MA 1Z9CA 3V4GA 4HF1A 5J8FA 3F8MA 3ZMSA 3E97A 1KU2A 2DBBA 3CUQA 2E1CA 1K78B 1ZHFA 2D2WA 1BIAA 2OQGA 2VC0A 3I64A 4AWXB 3I71A 4CZZA 3HRUA 4PGHA 1R00A 3BPXA 3I5UA 1KYZA 2O6GE 2EWNA 1BI0A 2CFXA 2QLZA 4KIGA 5HS8A 4ZYDA 2C6YA 3WE2A 1ZREA 5ICFA 5FLXK 2G7UA 1WI9A 4EM0B 4MNUA 1RUOA 5K1YA 4WK8F 4KIBA 1H9GA 4HQEA 4KUMA 1EH7A 1HSTA 5LRRA 1QPMA 2XAHA 3F72A 1J59A 4RB2C 2F5EA 5L3DA 2DQRA 2H09A 2P5LC 4K2EA 1SD5A 4MHGA 1JE8A 4HV6A 1IF1A 3BWGA 2GXGA 3L7WA 2B0LA 2G7HA 5DD8A 2NS0A 1GXQA 4UVBA 4BQAA 5FLXZ 1IN7A 1BN5A 4I02A 3L9FA 5JVTA 5DD4A 1R5HA 3MAJA 2FNPA 2DU9A 3P7NA 1B4AA 1FC3A 1DPRA 4EJWA 2P6TA 2DQLA 2M87A 3ZMUA 2JPBA 5DCFA 3LAPA 1QZYA 1YS7A 2VE8A 3R61A 4S05A 4KT5C 2FBHA 3FXRA 5ICCA 5HOOA 3RKXA 2A3SA 3LA3A 2EFWA 1MD0A 1D5VA 2COMA 5DYMA 1W5SA 1KQ0A 4ZH4F 2D1VA 5D5XB 3N97A 2E7WA 3Q9VA 1STZA 4EJOA 4L9VA 4Y15A 4LB5A 3C7JA 5L3BA 1UFMA 4EVIA 4MGRA 1LB2A 3M9AA 4M74A 3LQRA 1HKTA 4WCGA 3PFIA 2HWVA 1HW1A 1PDNC 2EFOA 2EJRA 2A68F 1USSA 2LF7A 3K0LA 2MC3A 5L3FA 1Z7UA 1CF7B 2CG4A 3DF8A 1BIBA 5D6EA 2JT1A 2BE5F 2VONA 4HZFA 1Z91A 1FBUA 1L3LA 5LGUA 2QQBA 2ZNZA 4MQ9F 1J9IA 4NHJA 3U1DA 3FZVA 3VB2A 2V6CA 2DPDA 4XLPF 4M9SA 3IRRA 1FP2A 3K1PA 2M1BA 3K1MA 1KU7A 4L18B 2V79A 1FOKA 3QU6A 4UVAA 3SZPA 3IKTA 2CYYA 3GO5A 4CICA 4EGYA 1PP7U 3DQVC 2K4BA 4YIFA 2KIUA 2ISZA 4I0BA 1D8JA 2WTEA 3GEZA 3L09A 2ZCWA 2ETHA 2K86A 2IT0A 3E5XA 3SHFA 5IT9K 1H0MA 2VT2A 5JI6A 2NYXA 1O7LA 3WGGA 4UVCA 2D45A 3DPTA 3WG9A 5CLSA 2GZWA 2Y48A 4HA8A 2OD5A 2XIGA 1TQIA 2EV5A 4HX8A 3QAHA 4KIFA 1BI1A 1IXSB 2QENA 5IT9Z 2QWWA 3KP3A 4IJAA 2BYVE 1GXPA 1XN7A 4UHTA 1YTYA 4YFKF 1J75A 3LFKA 2DW4A 4KMUX 2XAGA 5FGMA 1V4RA 4TV7A 4MQVA 3ML6A 4AVPA 3E6BA 1MKMA 3HIFA 5ERIA 4L9NA 3M1EA 3EETA 1FZPB 3HSEA 3ZMDA 4N9HA 1YW9A 3JW4A 1W7PB 3RYPA 4ETSA 5BMZA 4JBAA 4BNCA 1R22A 4XSXF 1FX7A 3IWZA 1QNTA 3F21A 4HF2A 2DT5A 1S6LA 4E70A 4A0ZA 1QZZA 3E6CC 2KRFA 4RGUA 3MEXA 5DUKA 4ZZDA 2DLLA 5HVQC 4I09A 1LEAA 2CQKA 3LAJA 4EMSA 4OOIA 4ZYGA 1U5TC 1Z6TA 1XCVA 1UHWA 3C3WA 1YQAA 2QM3A 3V7RA 2PMHA 2IPQX 4KN7X 4KYWA 2P7CB 3KP4A 2HTSA 2VC1A 3M8EA 2VXZA 1Z05A 4RB3C 4AIKA 1KYWA 4A5MA 1ZRCA 3KFWX 2H27A 3WTTC 2UXNA 1BOAA 2ADUA 2LKPA 3F6VA 3B73A 4IHSA 2FU4A 4U7BA 2ZNYA 2NNNA 2QVOA 4I98B 1XCBA 3FF5A 4KA4A 1O3RA 2Q0OA 3ELKA 4Q5SF 1WKMA 3HTUA 3MWMA 4GGGA 3ABTA 4OINF 2VBZA 4JK1X 3C18A 3EYIA 4PCQA 3TKYA 2GXBA 3BP8A 3WU1B 2EK5A 3P9IA 3O6BB 4D0PA 3FM5A 4UXNA 2VOOA 3T8RA 4UV9A 4OIQF 3GF2A 1F4KA 3G3ZA 1BJAA 5DV5A 4PGGA 4LG0A 1DPUA 1MDMA 5FD5A 5AONA 1HBXG 3NRVA 2L4AA 2O0YA 2ZMEB 4XLNF 2AXLA 3PQJA 2NRAC 4G7ZF 5HDNA 4ZYEA 1SFEA 3CUOA 2ESNA 4CGZA 2K02A 1JGSA 4P55A 1EH8A 1DDNA 5KK1A 5LHIA 3ZQ7A 5HS9A 1USTA 1OPCA 3FWEA 3HOSA 2M45A 2PQ8A 1YFHA 1O7FA 3WTUC 3ZPLA 1JHFA 2EA4A 1IN5A 2RDPA 1R58A 1HKSA 2GIVA 3TDUC 1U78A 1XGOA 4HDVA 1WWXA 3ZMTA 4QLCU 2E7XA 2HZTA 3EQLF 2DFIA 2XKPA 4M9ZA 4B09A 4IXAA
chains in the Genus database with same CATH superfamily
3WODF 5ED4A 2LF8A 3E6DA 4B3XA 4NB5A 3EPZA 4A6DA 4IHYA 4YFXF 1DU6A 2KIQA 2MFZA 2A07F 1FY7A 5DCMA 5B5EC 2CQNA 5D5WB 1BOBA 4LK0F 1JUMA 3FHZA 4IHTA 2ID6A 4YG2F 1RI7A 1MMSA 4GXOA 3WG7H 4G8XA 4HF0A 3D1NI 3JTHA 5CVUA 1U5TA 3GZ5A 4EJVA 2L9RA 2V26A 2YPRA 3ROUA 4A3BJ 1ODDA 1I6XA 5ICEA 1R49A 2CMPA 2EB7A 3JAMK 3AG2H 2XSDC 3KETA 4O6JA 2XKOA 1K6OA 4A3GJ 1ZYRF 2VQLA 1VQ9I 5B3SH 4II3A 2ZB9A 3W6KB 1AU7A 1BR2A 3LA2A 3ASNH 1XTAA 4PSWA 2NVXJ 5CQGA 2V1UA 3WTYC 2JTVA 3BPVA 3GYHX 1ULYA 4P5OA 3S17J 4L0ZB 3DV8A 4B4CA 2E5ZA 4E4HA 4FX4A 3CLQA 3OYBA 1ERDA 1REPC 5DEQA 1SFUA 2IEKA 2O8KA 4XK4A 2I10A 3DP7A 4LMYA 1XDSA 4EM1A 4XICA 3MFKA 2H8RA 3HSRA 2DAOA 4XRMA 3T8TA 2J5PA 5IPAA 5HDKA 3DPLC 4OMZA 3TO7A 1DP3A 3FX3A 3JAMZ 3S1NJ 1S8NA 2W1OA 4YFNF 2YSRA 1KGSA 2L01A 4RB0A 1R9TJ 2E1OA 1X4OA 3BJ6A 4IRIA 3BTLA 5CYVA 1K4TA 4IZZA 1YX5A 4LD5A 4ENMA 5ICGA 4U0VA 3I0TA 4WWCA 2B9SA 4C9YA 1X1AA 1Z3XA 1WH5A 5GAHJ 4FTHA 1WJCA 4EQQA 2X1DA 2KFDA 3AFHA 2CW0F 5K7FA 3G1MA 4RMNA 3RQ4A 1HF0A 2K9MA 1XSVA 4XRFA 1ZELA 5IYDJ 2L4MA 1HW5A 2M3AA 3BC8A 3HL2A 1TWAJ 2PI0A 3RJPA 2VBWA 1VZ0A 5BS6A 2O9LA 3T0YA 4A3MJ 4RGSA 2LY2A 4A3JJ 2IA1A 5JFRA 1IC8A 2M5WA 3JRAA 5KAFC 1S29A 2V1NA 3AG3H 3DKWA 3H36A 3ASOH 3KLOA 4Q48A 3FMRA 2E71A 5E79C 2L5QA 2V9VA 1G59A 1OR7A 2PEXA 2E34A 3KCCA 2E1NA 4KT6A 3F22A 2VBYA 3MZYA 1ZARA 1P92A 1XG1A 3DTKA 3V8LA 1ONVA 3LSHA 4D1QA 2VJ5A 5K5QA 3OV8A 3IKVA 2KJBA 1V5GA 5F6FA 1P7JA 4D5CA 2IRFG 3CJRB 5EZGA 4LGWA 2QA4I 4BHPA 1OYWA 5IT3A 5LRSA 3HRSA 3H5RA 3I53A 2QF7A 2YU9J 2DA5A 2R7OA 4ZC3A 2RQPA 2HGCA 1RZ4A 3B6AA 5E3MA 2OZUA 2W24A 2ZO4A 1LQ1A 3KZZA 3NEUA 2BVMA 4L5EA 1XPXA 1NK2P 4G94A 2PN6A 4F55A 2VLAA 4LG0B 3E1SA 1YIJI 1UG0A 1M1EB 5BPIA 4KMFA 3Q9SA 3GLXA 3NARA 4ZYHA 1QQIA 2M8GX 1K79A 4ZJZA 2ZSHB 4NDLA 3JRBA 4I01A 2FJ1A 2XGCA 1IN6A 2MA3A 4KNYA 2X6YA 5CVRA 5CVVA 2VN2A 1VQ4I 2MLKA 3A0BC 3Q5FA 2K3FA 4G12A 2PJRA 2RAEA 1G4DA 3BQZA 2PMUA 5M3MJ 1RETA 1FT9A 2L2OA 3AAFA 1MZBA 2K9LA 2TRTA 1MGTA 2JRTA 2COBA 2KRHA 2EZLA 1NH3A 3I58A 1V55H 5A2QK 1G3TA 1S7AA 2LY9A 1FOXA 1ITYA 3VDXA 2CWEA 1MMAA 3N4MA 3RKWA 2BVLA 2NAZA 1UHMA 2Z16A 5IOZA 5J47A 1XSXA 3LQQA 4RAFA 2ZBKA 3D5SC 1AOYA 2YX7A 2X9DA 3LSGA 1F5TA 1LFPA 2VQGA 1TQPA 3QRFF 4JQFA 4NUBA 3F9KA 2H1LA 1E3HA 1VTNC 2CUZA 2W85A 4E7IA 3TW7A 3L2WA 4MIMA 2OZ6A 4NNJA 1YI2I 2QSFX 3E7LA 3K6GA 4RAYA 5M5XJ 5LGNA 4XL9A 4GYIA 4AIHA 2W84A 4FX0A 4J01A 4UNOA 2ACJA 4IVNA 1YRNB 3H3ZA 5A2QZ 1T2KA 2A5WA 2HQ5A 1YIOA 2W82A 4HDUA 4I2OA 4FCYA 1T0FC 3TOAA 1IXCA 1WGXA 2ISYA 3CP2A 3PFYA 3MD2A 4AD9A 4A69C 3K69A 1RKWA 3OYMA 2FD5A 3EUHC 3TO9A 5KNLA 1T8IA 4F91B 1MMGA 1E17A 1G3YA 1K7AA 1TW3A 1IRGA 1GV5A 2DFFA 2VE9A 1PP8F 2W57A 1SD7A 3CLOA 4L0YB 2EIMH 1LDKB 1SC7A 1MBHA 3QPTA 3FXKA 3BOQA 1VF9A 5LGTA 2GWRA 4II2A 5F0CA 5HLTA 2QBYA 3OYLA 3E5UA 4OIPF 5J1YA 2FSWA 3KEQA 1YG2A 3U2RA 1V3FA 1V5FA 3CCYA 1R7JA 2XUBA 3GXOA 3COAC 2A6EF 1J0RA 5HS7A 2G0EA 3MN2A 1IRFA 1ON2A 4AVZA 1R36A 3FMQA 3GZ6A 3GTPJ 3CUQB 4L5IA 3HKZA 3HPHA 4EATA 4CXFA 2VBXA 5FKNA 2X0LA 3HC7A 3R6SA 4GO1A 3ZQGA 2EBIA 2AHQA 3ABUA 5FB2A 3J7AO 4Z2YA 4LLLA 4ENJA 4IXAA 1LVAA 3S2DJ 3CCUI 1MIJA 3CCRI 3MZHA 5FO5A 1SD4A 1RR8C 4M6YA 4ZDPA 3ZXSA 4OIRF 4A3FJ 3ZOBA 3L00A 4BJ6C 4F3QA 5C4XJ 3CZ6A 5D8LB 2P5KA 4LOCA 1TW2A 1UCRA 2VI6A 1QVUA 3CP8A 1D0YA 3GWZA 2OTLI 2O8XA 1TZLA 2HQNA 3OYKA 4M3DA 4A93J 2EA2A 3I4PA 2HOAA 2JSCA 3R4KA 3LSJA 4RM2A 4B44A 1HC8A 2NVUB 4BH9A 5IP6A 3MMYB 4M71A 3OYJA 2PX9A 1ACIA 2HDCA 3FXOA 1TP4A 5LLQA 1T6SA 2XPWA 1XB4A 5CPRB 4E6KG 3K4LA 1Z67A 3IH3A 2A6TA 3QP5A 3SQNA 3QP6A 4N4OB 3H3UA 2LP0A 3H9QA 3ZMZA 3RZOJ 2IA2A 3SZTA 4HEA2 3P9KA 2HKOA 3D5LA 4WXCA 2PFBA 2L0KA 4CYCA 4XKVA 4IRGA 1XX5A 2LLKA 3TGNA 2CQ7A 2FRHA 3OYHA 1JI8A 2CQXA 3BTCA 2FMYA 3OOUA 4QWQA 1FNNA 3TDZC 1BW5A 4LLGF 4IOCF 3VOEA 3PSFA 2V4JC 2CRGA 3BR1A 2KZGA 3WE3A 1FMWA 3CF2A 3DTEA 3FBIB 1AWCA 2XF7A 1X58A 2WAQA 5E1WA 4FE7A 3OYDA 1VFCA 2L9VA 3BR0A 2V6EA 5L3CA 4XLEA 1W0TA 1I1GA 1JKPC 2VODA 3RI4A 4HBLA 1YW8A 4E7HA 3BDDA 2JA2A 4HG2A 5E3NA 5FLVA 4R79A 2JMWA 1WVRA 2X4HA 3JRIA 2YU3A 4A6EA 2M7AA 4BHBA 2NS8A 2DJNA 1ZRDA 2XVCA 5M3FJ 3SFIA 1Y1WJ 1EV7A 3J7AY 3TOBA 1GDTA 1I1SA 4XKCA 3S14J 1P9QC 4A5NA 1JKRC 1W36D 2PLYA 2FXAA 2BOLA 3HUGA 2R3SA 1JKOC 1WHUA 4UV8A 2NS7A 3WU0A 2VT3A 1MMNA 1B59A 4DW6A 4PJNA 5C3EJ 4C30A 1JTXA 2H6CA 2QSHX 3QQAA 1K78A 2M4KA 3F0CA 2R7FA 2XRNA 4UB6C 2UWMA 3KIOA 4HSTA 4BBSJ 3AL0C 4PZJA 3HXLA 2Q1ZB 2IA0A 1P4XA 1BR1A 4EJUA 1BW6A 1IDYA 1LE8A 4A2UA 1Y0UA 1XSDA 1SMTA 1SAUA 1UELB 2QKLB 1OYIA 4M3EA 4F92B 1B1BA 1IN8A 3ISPA 2QQ8A 3R60A 2MC4A 2Q2EA 2ZC2A 4HX4A 1OFCX 2CUEA 1Y0NA 2ELKA 2WADA 2EIKH 1U3EM 4RAZA 1T0FA 2G9WA 3ULQB 1BBYA 3JRFA 4X1EA 2P7VB 5J6XA 1J2XA 5BNGA 2NVYJ 3OIPA 1TT0A 2K9SA 5H6QA 3WU2C 5D5VB 2LK2A 2MD5A 2VJIA 2X1EA 2RN7A 3EUHA 5FKLA 3A01B 1MNMC 3EYYA 5TGTA 1O3TA 5ILVA 4XRSG 2NNYA 1YITI 1NK3P 1Z7LA 1RIOH 2V9PA 2OPTA 3ZN1A 4I7HA 2BBYA 1BC8C 1JGGA 3ABKH 3KLNA 4ANJA 3OMYA 4IPAA 3GFIA 3DKXA 1P4WA 3IAM2 1OLTA 2GLOA 2VJ4A 3S2HJ 1XMXA 2Z1DA 3SDBA 2JVHA 4BEHA 3KP2A 3TMOA 3K4MA 2JK3A 3RTRA 1N78A 2HYFA 2O61A 3PM1A 2GOMA 1V5EA 2UXXA 3V8KA 1EH6A 2LY1A 3MCZA 2VXDA 1GHCA 2K40A 3TBIA 3FXLA 4JX5A 2D1HA 4LIUA 1A6IA 6PAXA 3DBHB 2QSGX 2R92J 5JHUA 1R6RA 3HSFA 5AIQA 3EUAA 1WH7A 2J5OA 2JWTA 5E1XA 5TJJA 3I4MJ 3QPHA 4IF4A 1UG2A 4M6XA 4OIOF 3I3LA 2Y69H 4ESBA 3CCEI 1QPIA 4BQQA 1XD7A 2PG4A 4RBOA 2ZKZA 1U9OA 3LSKA 1ENHA 4D7MA 3LSTA 3W6JB 4PDKA 2HVQA 1KQ9A 4BHCA 3HGGA 4OU0A 2OAZA 5IP7J 3WGIA 1FWZA 1X3ZB 3VPRA 2A05A 2KT0A 3I4NJ 4LJZF 2L3DA 3P5JA 1Z6RA 1LFUP 2HI3A 4GRIA 2NVQJ 1R1TA 2UUZA 2XAJA 3RIRA 4KFCA 5DM7F 2CV2A 2DK8A 4CUGA 3HB9A 1AA7A 3L2QA 1Q1VA 5EEGA 2QEXI 3HYIA 5CQEA 4U0WA 5B1BH 4AC0A 1DGRM 1N75A 4A0XA 5F1RA 1IDZA 1IJWC 3BCAA 4KICA 4N4NB 3H3VK 1JJ8C 1HCRA 5BQTA 2DA1A 4CCLA 1FLIA 2HDDA 4XBFA 4E7SA 2X51A 1TT5B 4BBRJ 3A02A 2P4WA 5L3GA 1GVDA 1TC3C 3H92A 2E1MB 5JLXA 3E0JB 3FDYA 3NQOA 3U9GA 2KDZA 1WJ5A 5E8GA 3ZN0A 1FEXA 4CH7A 4M3FA 4O5VA 2Q8KA 2KDOA 2OA4A 4J00A 5TISC 5EGOB 5DUIA 2JPCA 2HVSA 3SDGA 3G73A 5F1JA 1IG7A 2ECBA 3OY9A 1CF7A 1JUPA 5D8KB 4C2UA 1PUFA 1DUXC 1ZQ3P 1I6HJ 4B1RA 2P8TA 2M4GA 3CTAA 4R1HA 3GCMA 3T1BA 3L2CA 1R1VA 3CDHA 1HOMA 1TQMA 2L7MP 4B48A 4DYQA 5LHGA 5D5UB 4N0BA 2BW3B 3KEOA 2XAQA 2O03A 1WQ2A 1XMKA 4PUSA 3HRTA 3BTJA 4AYBN 5EYRA 1O3QA 3BG3A 1IXRC 2KISA 4MFDA 1F43A 2YS9A 3F8NA 1KU9A 2HQRA 3O8GA 1IUYA 3ZQCA 3ECHA 1KZHA 4DYRA 2DYRH 3DBLB 3VYUB 1QBJA 4XM3A 4B8XA 3BY6A 3KZYA 3VYRB 1EJ9A 3HTSB 3CCVI 1A31A 5ILUA 5KCMA 1F1ZA 1SFXA 2V7FA 3ZQIA 2ZXWH 5B66C 2UZKA 2GIZA 4G7OF 3BLYA 1K61A 2DA4A 3OS0A 1U2WA 3FXJA 5FJ8J 3KX2A 1OMIA 1B9NA 4KDPA 5D4RA 2EIJH 2X85A 2DN0A 3RCOA 5E18F 2XHKA 1U0JA 4FHTA 1ON1A 3JR9A 1O57A 3GX4X 3S1QJ 5D6FA 5LEJA 2HTJA 3FXMA 1WJAA 1DGWY 2M30A 1D5YA 3HUGB 2O3FA 5LHHA 3GTJJ 1FOYA 4HX7A 4ASNA 3OR2C 1TLHB 2WAEA 3OL4A 4AM3A 2E2HJ 1J7KA 1GT0C 4OMYA 2PMZA 3WTWC 1ETWA 3ZQHA 1JT6A 3QU3A 2JRMA 4IRHA 1R5GA 2BV6A 4U88A 4BAYA 3GUDA 2LMDA 3GTGJ 2KHMA 4HPQA 2HOTA 1C0WA 2BGCA 2AO9A 4E7LA 1LE8B 5KVRA 3I55I 3A03A 1D0XA 5FD6A 3HHGA 1LDJA 4LITA 2JUCA 2FEZA 2M2EA 3W6VA 2CJJA 1YX3A 5J4YA 1MH4A 5K5OA 1MBFA 2CSOA 2MD0A 4LG3A 4NQWA 5HNFA 1J5YA 4MEXF 3RQIA 3RYRA 2HDWA 3GFJA 1J09A 2JUGA 1LEBA 4V2GA 3SEZA 1OCCH 4OAYA 1MJBA 2ZMEC 3S93A 2RQQA 4RS8A 1H8AC 1Z21A 2MG4A 4G7HF 4MTDA 5C44J 2Y31A 5HDGA 3Q3SA 2VUMJ 3QPSA 1ZG5A 2ZFWA 2XROA 1SFKA 3SXYA 4MEYF 2FQ3A 2FMLA 1Y39A 2E2IJ 3CCJI 1R23A 5EG0A 2R5YB 3BG6A 3H9GA 2NOJB 4RB1A 2H6BA 5FRMA 2F6CA 1FTZA 4OWRB 5H20A 3WTZA 4A12A 4U7DA 3WTVC 4BEHB 4P96A 1E3OC 2FX0A 2XC7A 1I50J 1TNTA 1U6GA 2EV6A 2F2EA 4XMYA 1ZR4A 2MH9A 2K27A 1POGA 4UB8C 1CGPA 1W7PA 2JQ7A 2R4GA 3PJRA 3TP0A 1P6RA 5F04A 3QWLA 5CVJA 3S3MA 1G8XA 1W0UA 2XASA 3TO6A 3LWFA 2Z3YA 3O3KA 1VQLI 2HXOA 3CJNA 2NXNB 4RGRA 1BI3A 2Y0MA 1U8BA 2DPUA 2UV1A 2DYSH 3F8BA 2CV1A 4X0GA 2LDUA 4LIVA 5CJ9A 3ZMVA 3I59A 2HNHA 1VQ8I 2TDXA 4XOTA 4BXFA 2OTJI 1A35A 1MDMB 4B43A 1PYVA 4E7JA 1ORKA 1X4PA 4BKXA 3OYNA 3J80K 4HW0A 1JHHA 2Z5UA 5HLHA 1BM9A 1D0ZA 4G9YA 1OYYA 3RKYA 5LEKA 5AIPA 1XDUA 2L7KA 2YR2A 1B9MA 2OBPA 2AS5F 3FXUA 2X48A 3ZCOA 4DNCA 3O2PE 2LR8A 1QVTA 3FXQA 1FBSA 2XSJC 4CYDA 1IN4A 2E60A 4A3EJ 4KN4X 4DBRA 1B72A 4HAMA 2DJIA 1AHDP 2A61A 2B63J 3LSMA 3GW2A 1T33A 1BJZA 2ICWG 2QUFA 3VFZA 2W7NA 3DBRB 3S1RJ 2WC2A 1QRYA 1ZN2A 4RLFA 3LNQA 3FKJA 2CUJA 4XKBA 3E6MA 3PQKA 3K70C 2EPFA 3HRMA 3KP6A 4Y17A 3CCLI 1BR4A 1QGPA 2OU2A 3ZGKA 5K7ZA 1XGMA 2KQRA 3GZNB 3J80Z 2FBKA 4BY7J 4G6DA 4NC6A 3REOA 1NHAA 1DQUA 1HKQA 2DA2A 2CGPA 1W1WE 2M0CA 2RV8A 4CA0A 1EF4A 3L1PA 4CHUA 3PNYA 3DEEA 4HLXA 2HFHA 3U21A 3JRDA 3G1OA 4GCVA 1R5ID 4U87A 4C3HJ 3EUKL 4L5JA 3S15J 2RNGA 2XGDA 2L02A 3DLAA 3OSFA 4PFPA 3PIPF 3D0SA 3E5QA 3MKWB 1A04A 2DA6A 2F4IA 4BDYA 1ZLJA 2OQRA 2QCOA 1VQOI 3M7GA 2GOXB 5FFXA 4CCOA 1U8RA 1PUFB 2Z2SB 5L3EA 1G6NA 2K4JA 3ZR8X 2CS3A 2YUSA 3RDIA 4BXUA 1FOWA 1D1CA 3F3XA 1S7OA 3KEYA 1ZGJA 1G3WA 2MW8A 2X6WA 3JSOA 3CD6I 1ETYA 2Z99A 3SFZA 1JTYA 4JYKA 1I3AA 2HVRA 4GYGA 2IGMA 4DYCA 1JJ6C 2BHZA 1Z1DA 1R1UA 1FJLA 4NBQA 5F64A 2F5FA 1FMVA 4QPQA 3JTGA 3CCMI 4BU2A 5DCMB 3JRCA 3IRQA 3DEUA 3MKLA 3K2AA 3P9CA 4LLNA 1RPWA 1TBXA 1QO0D 2LC2A 3KE2A 5F08A 5IYBJ 4Q4ZF 2L7FP 2IP2A 2LSOA 1VNDA 1U5TB 3ZQFA 1KA8A 1Q1HA 1SMYF 3JRGA 2STWA 3CO7C 3HOVJ 4EGZA 2IVMA 5DM6F 3HG9A 2MH2A 4M3GA 4DJAA 3KZIC 1OKRA 2ESHA 1X2MA 2HR3A 2BY1A 4ZZLA 3GFLA 1WPKA 2FNAA 3AG1H 3S1MJ 2Y0SA 1FYKA 3IC7A 5EZHA 2P81A 4KISA 4HOBA 1HW2A 2MLGA 4HV5A 4D7NA 1RESA 2F5CA 4YEJA 5F0HA 2HYGD 3FBNB 3OS2A 2ELJA 2HYJA 1E2XA 4R8HA 1F9NA 3G6EI 3V42A 4BYYA 5ILSA 1VQ7I 2EFNA 2WB1A 4CO8A 5EF6A 1E0EA 5J4VA 1LPQA 1XGSA 4ENNA 2DTRA 2VASA 3R0AA 3NAUA 3V7SA 1T08B 4S04A 1T98A 2GAUA 2ZMEA 3I9V2 5GAEJ 5E17F 1S3JA 5E1ZB 2M7BA 4UUSA 3SYTA 2WA0A 4AIJA 1P2FA 4UUTA 1CQTA 1WRJA 4BQNA 2FOKA 2XAFA 1QHGA 2QQ9A 2H8WA 2XV4S 3BJOA 2R7DA 1RNLA 3VODA 1YJWI 4A3LJ 4HQMA 3LOCA 4Q47A 1ZG1A 1GLNA 3OOPA 2GBYA 4NQWB 3DLLF 4MO7A 5CKTA 2HEOA 1H9TA 1G3SA 4EV0A 3JREA 2LFBA 2XF6A 5LBQA 5HLIA 3F6OA 4LB6B 4BS9A 1TL8A 2DOFA 2EV0A 4MTEA 2BY0A 3RPUD 1OISA 5E8IA 1HXDA 2QZ8A 1SVOA 5BPDA 3FHNA 1IRXA 2WY8Q 2IGNA 2ZXJA 2K7LA 1ZLKA 3KYDB 4RM3A 3ECOA 2P5VA 2R5ZA 3R0JA 1A36A 1FP1D 2DI3A 3BR6A 2CW8A 3W2AA 2EFPA 5JLWA 1XC5A 3E3VA 2K9QA 1ZG3A 2BZTA 5EG0B 3BZ6A 2O7OA 3V8JA 1YJNI 3PO3J 2HKXA 4PJLA 3KP7A 3IL2A 3MKZA 3OIQA 2STTA 4IQJA 3QYEA 2XGXA 2W48A 2DK5A 4HYEA 1SAXA 2IXSA 1FPQA 1WFXA 4M6VA 1YO5C 3VSKA 2AQFA 4ON0A 1XGNA 1HQCA 3HDDA 1ZKGA 3ESWB 2MYSA 2R7UA 2JA6J 3U1KA 2M8EA 3IHUA 3M07A 3S16J 3K4NA 4ESFA 3OYAA 2R7RA 4WF2A 4YELA 2KIFA 4LK1F 4DZPA 3C1DA 4RGXA 2A5YB 3HOXJ 4CCKA 1ETQA 3X2QH 2EFQA 2W25A 4PJ0C 2Z9OA 4XRSA 1FYLA 4G6QA 2PJPA 3I59B 1FYMA 2DODA 2HQAA 2RVCA 4ZDLA 2R7QA 2Z33A 1NG6A 1MJAA 2XF5A 3KP5A 5CVIA 3KYLA 1UAAA 4FT8A 4UUVA 2VOPA 1B6AA 5TRDA 2KP6A 1L0OC 2WWYA 4DQ2A 4D5FA 2JZYA 2PJRB 2IGKA 1LUJB 4WX9A 3CO6C 3J81K 4M72A 2ELHA 1JUSA 3MVPA 3LA7A 4U0YA 4PSXA 1I27A 4L9TA 2VB6A 4ESJA 2KIMA 2FF4A 5K5RA 1FIAA 4IO9F 1ZAOA 4QTRA 4H4KC 2I8DA 3K2ZA 2VL8A 5J8CA 3B02A 5HLGA 3CUQC 2QYOA 2FE3A 3I54A 1LNWA 2DO7A 1LJ9A 3TQNA 3GTOJ 3RZDJ 1RKTA 2FA5A 2WV0A 5GPAA 3RPQA 1WJDA 4KITB 3WTSC 3J81Z 1FIPA 3ERED 1DP7P 4XLCA 3F8FA 1GV2A 1KU3A 1Y8QB 3DFGA 4W97A 2QQAA 2V1XA 1T39A 2LNBA 4XORA 3S2WA 4H0EA 2Y2ZA 2FBIA 3C2GA 3BQYA 4WXHA 2LKXA 3CF5F 3M4OJ 2Y75A 3DWLE 1ZH5A 3W2VA 2DFEA 2RKHA 2GA1A 1Z3YA 2DOAA 3H0DA 1YLFA 2BEOA 2HPMA 2QKMB 4P9UA 2XRLA 3HOYJ 2R7XA 1SD6A 3IH2A 2L9SA 1T38A 1DU0A 4JX6A 1ZRFA 3QOEA 2DA3A 2IJLA 2RREA 1ZGAA 3FM3A 2RC4A 2V9KA 4JOMA 3GTMJ 1JKQC 4DOZA 2CQQA 3MQ0A 3B6CA 1TTYA 2NOGA 2CUFA 4Y33A 3UR3C 4F7ZA 4A0YA 1GUUA 4IOAF 5DDGA 3EDPA 1D3YA 3GFMA 2P6SA 2KJCA 2QBYB 2R7WA 2EZKA 3GLLA 1Z77A 2R93J 3Q0VA 3HOTA 2NVTJ 3PSIA 4FISA 1QHHD 4I0AA 1IW7F 2GQQA 1YW7A 3GVAA 3JCUC 3WTXC 1OCOH 1BI2A 3PNTA 3Q0UA 2GA2A 2EZHA 3F8CA 2BY2A 1WSUA 3BJAA 2A69F 1W7PD 2ZJ2A 4C2MJ 3ZQLA 2RNJA 1WCMJ 2HS5A 1MSEC 2KKOA 5J3LA 9ANTA 1K4SA 1U9NA 3Q0WA 4HSRA 1VQ5I 4C3JJ 4HLYA 2OV7A 1OCTC 4ENKA 2JA8J 3BR5A 5IOYA 1ETVA 3FKIJ 4LFUA 4NC7A 5M5YJ 1OR7C 1O3SA 4XSZF 5BOXA 2F5DA 5LFAA 4O3MA 4CDGA 1IZ1A 2DXIA 2ZSIB 5H6RA 2L54A 2ZXIA 1APLC 1S9HA 2H94A 1D8KA 4JX4A 5JHFA 3TEDA 3DPUA 3V7CA 2HZDA 4M73A 2OUMA 4PFOA 1I5ZA 2IW5A 3K7AJ 1T95A 4UUSB 2DDAA 3G71I 5EEHA 4EJTA 2ID3A 4BDZA 3G2BA 1GVJA 1X3UA 1WI3A 2OJED 4ABZA 1W5TA 2YX4A 3RPUA 3VSLA 5DS9A 3WGHA 4P9FA 3OWTA 3FK6A 2XB5A 5D4SA 5FROA 1YS6A 3W2WA 1XMAA 3NWSA 3ONQA 4F93B 1IAWA 1FSHA 3IWFA 1P4AA 1SVMA 3VEPA 1QU3A 3K9TA 1TWFJ 2A6HF 4M9XA 3IAS2 2PBIA 5K7HA 1X19A 3M8FA 4HNVA 3LL7A 3K1NA 4B3AA 2LH9A 3QOPA 1RUNA 4WXDA 2CO5A 1TWGJ 2ZFUA 4BQOA 3FMSA 1FBQA 2DCEA 2N8GA 4CYCB 3DKYA 3O8HA 3ZQQA 2XPVA 1JXSA 3F23A 3L2VA 3HKZN 4GFBA 3PUBA 5FKOA 2MSYA 4HRIA 2VQHA 4L9JA 2LG4A 2RGVA 3BG5A 3CC4I 2HOEA 2WBMA 2JN6A 4YIIA 1VQMI 1JT0A 3T5XA 1BC7C 3K10A 3ZP5A 3HJEA 3TP3A 1YRNA 1EA3A 2V1DA 5IY5H 3UKGA 1TNSA 1K6YA 3CMMA 1FSEA 5FFZA 4EM2A 1QA6A 1MJ9A 3BZCA 3BTIA 1HSJA 3HEFA 3VYSB 2VIXA 1LDDA 1UB9A 3CQZJ 1MBKA 3JSPA 4Y13A 1PUEE 5JR3A 3BROA 2MBFA 4N9IA 3BCBA 2WB1N 4BJTA 4CCJA 1YYVA 3HHHA 3BG7A 2ZJQF 5E3OA 3DXJF 2VPRA 5E20A 1W4MA 3HGYA 1Z9CA 3V4GA 3LSRA 1T56A 3OS1A 2E19A 4A3DJ 2LREA 2WV1A 2HOSA 3VWBA 4HF1A 5J8FA 5E3LA 2XAUA 1IV8A 1IRZA 4RDUA 3F8MA 2JA7J 3S8PA 3ZMSA 3CMAI 3E97A 1KU2A 2XGEA 2DBBA 1MNEA 2FOWA 3CUQA 2E1CA 3ABMH 1IO2A 1ZHFA 2D2WA 1BIAA 2OCEA 1K78B 2Y30A 2OQGA 1VQNI 2VC0A 3I64A 4AWXB 3I71A 1X1DA 2Y9ZA 4CZZA 2W4SA 3HRUA 3H0GJ 4PGHA 1R00A 2IGOA 3BPXA 3I5UA 1KYZA 1N77A 2O6GE 3DEWA 3OL3A 2EWNA 4Y52J 1BI0A 3OYEA 2CFXA 2QLZA 3ABLH 4KIGA 5HS8A 4ZYDA 2KRCA 2LTPA 2C6YA 4CZCA 3WE2A 3FIWA 1ZREA 2Q2EB 5IP9J 3MKYB 2KPMA 5ICFA 5FLXK 2G7UA 1WI9A 4EM0B 4MNUA 1S72I 1RUOA 4PJJA 5K1YA 4WK8F 4E7KA 4BUPA 4KIBA 1H9GA 1Y8RB 4G6TB 4HQEA 4KUMA 1XS9A 1EH7A 1HSTA 5LRRA 1QPMA 1RC9A 3LSIA 2XAHA 3F72A 1OCZH 3IH4A 3M3YJ 3HZJA 1J59A 2WAQN 4RB2C 2F5EA 5L3DA 2DQRA 5FRNA 2H09A 2P5LC 4K2EA 2IBDA 1SD5A 4MHGA 3CDLA 4DBQA 1JE8A 1Y56A 2IS4A 4HV6A 1IF1A 3BWGA 5GTHC 2GXGA 4XR6A 1KONA 3L7WA 2B0LA 2G7HA 5DD8A 1EKEA 2NS0A 3CDIA 1GXQA 3GTKJ 4UVBA 5LD2C 3RKQA 4BQAA 5FLXZ 5GTIC 1IN7A 1BN5A 4XLAA 3N05A 4IHXA 4XQFA 4I02A 1I39A 3L9FA 5JVTA 3CJQB 1R5HA 5DD4A 3MAJA 2FNPA 2IAIA 2DU9A 3P7NA 1LVKA 1SANA 2E1MC 1B8IA 2IS1A 3C2HA 1B4AA 1FC3A 1DPRA 3H1CA 2R7VA 4EJWA 4QSHA 2P6TA 2DQLA 2M87A 3CCSI 3KPHA 3ZMUA 5GAGJ 2DA7A 3AG4H 2JPBA 5DCFA 3L2UA 3LAPA 1ETOA 4IKFA 1QZYA 1YS7A 3DCFA 3GMEA 2VE8A 3R61A 5EJCA 3CMEI 4S05A 4KT5C 1NG7A 2FBHA 2E2JJ 3FXRA 2VQCA 5ICCA 5HOOA 3LSPA 3RKXA 2A3SA 1S5LC 3FISA 3LA3A 1A6QA 2EFWA 1MD0A 2CU7A 4FE4A 1D5VA 4CCNA 1YHQI 2COMA 5DYMA 2E35A 1N25A 1W5SA 1VQ6I 1KQ0A 4AU7A 4BE1A 5JVGF 4ZH4F 1PJRA 2D1VA 5GPCA 4V19K 4NC8A 3FK7A 1IGNA 4A3KJ 5D5XB 3K70D 3N97A 1X1BA 1K83J 2E7WA 5F27A 3Q9VA 3A0HC 1STZA 5IYCJ 1Z0XA 4EJOA 5KHDA 4L9VA 4XKWA 4Y15A 4LB5A 2VKVA 2BXZA 2K85A 3C7JA 4S0HB 5L3BA 2MGQA 4FASD 4CSWA 3OSGA 1UFMA 4EVIA 3PNVA 4MGRA 1LB2A 3M9AA 4QPOA 4M74A 2DMUA 3LQRA 1HKTA 2E5NA 4WCGA 3PFIA 2HWVA 1A5JA 1HW1A 1F36A 1PDNC 2FQ4A 1IUFA 2EFOA 1S7EA 1YE9A 4BXXJ 3A1YA 2EJRA 2LOOA 2ZJPF 2A68F 1USSA 2WAFA 1LKXA 2LF7A 2DMNA 3K0LA 1H88C 1BA5A 2MC3A 5L3FA 1Z7UA 2VPLA 1CF7B 5FKMA 2LRDA 2CG4A 3DF8A 1BIBA 5D6EA 2ZJRF 1D1BA 5C4JJ 2JT1A 2IS2A 2BE5F 2VONA 4HZFA 4RLQA 5F0FA 3UNGC 4F52A 5H2FC 4ZDOA 1Z91A 3J7YJ 3HBLA 2GM4A 1FBUA 4IEJA 1RR7A 1L3LA 5LGUA 3A01A 1VQKI 2QQBA 2E36A 1MBGA 2ZNZA 3S3NA 3OYCA 1WZ2A 4MQ9F 4EEFG 1J9IA 4NHJA 3CC7I 2JJ7A 3U1DA 3DTIA 3FZVA 1MW7A 3VB2A 4AUXA 2V6CA 2DPDA 4XLPF 1NTCA 4XN0A 2Y9YA 3PIOF 4M9SA 3IRRA 2KZVA 4XONA 2BY3A 1Y1VJ 1FP2A 2DMTA 3K1PA 1YJ9I 4C3IJ 3TW6A 2M1BA 1R71A 3HOZJ 3L2RA 3K1MA 3AL0B 4X6AJ 1KU7A 4L18B 2WY7Q 2BXYA 3CESA 2V79A 1WJEA 3W3CA 3OYIA 1FOKA 3QU6A 2QGUA 4UVAA 3SZPA 3BT9A 3IKTA 1P7IA 2CYYA 3GO5A 4CICA 4EGYA 2CFOA 3K4JA 1PP7U 2LBFA 3OR1C 3SZGA 3DQVC 2X6OA 2K4BA 4YIFA 1AKHA 2KIUA 2ISZA 2OC6A 2EZIA 4I0BA 5GP9A 1D8JA 3C2BA 2WTEA 3GEZA 2ZXHA 2ZCWA 3L09A 2ETHA 2EQRA 2K86A 4AYBA 4E7ZA 2AXTC 2D5VA 3I56I 2IT0A 3E5XA 3SHFA 5IT9K 1H0MA 2VT2A 4MFEA 3CMYA 4DIQA 5JI6A 2K3PA 2NYXA 2DOEA 1O7LA 4BE2A 3WGGA 1SEUA 4UVCA 2D45A 1FTTA 4HNUA 2TCTA 3NWTA 4I76A 3DPTA 3WG9A 4J19A 3A4CA 1OJLA 5CLSA 2GZWA 4XLHA 2Y48A 1UMQA 2CV0A 1SVLA 4FQGA 4HA8A 1WJBA 2L9NA 2H1KA 2OD5A 3BR3A 2OCCH 1TWCJ 2XIGA 1TQIA 1OQYA 2EV5A 4HX8A 3QAHA 4KIFA 1X1CA 3JRHA 1BI1A 1IXSB 3QODA 2QENA 5IT9Z 2QWWA 5M5WJ 3KP3A 4IJAA 2XPUA 2ME0A 4PJMA 3QYFA 2BYVE 1GXPA 3CJTB 1XN7A 4UHTA 1OCPA 1YTYA 4YFKF 1X3WB 3BZKA 1SFOJ 2L7ZA 2DT7B 5EGOA 2EILH 1J75A 3LFKA 2DW4A 5GADJ 4IHVA 5FKKA 4KMUX 2XAGA 2HXIA 5FGMA 3IP4B 1V4RA 4TV7A 4MQVA 4GDFA 3ML6A 3CCQI 2JSPA 4AVPA 2CW7A 4MLOA 5J1UA 1Y6IA 3D5RC 3E6BA 1MKMA 2DTZA 3HIFA 4W1UA 4ZTFA 3OIOA 5ERIA 4DZJA 4IQ4A 4L9NA 3M1EA 1HDDC 3EETA 4FETA 4IL6C 1FZPB 1B8IB 1ZTRA 2PMZN 3HSEA 4N9HA 3ZMDA 2BW3A 1YW9A 3JW4A 3MZ8A 3QYBA 1W7PB 3RYPA 4ETSA 1ETXA 4XOPA 3BG9A 1KQ8A 1MBEA 5BMZA 4JBAA 1VI0A 4BACA 2AQEA 4BNCA 3OYFA 2VKHA 5FLMJ 1R22A 4XSXF 1FX7A 3IWZA 3SEQA 2VKDA 3WHBA 3K4CA 1QNTA 4ITVA 4Y7NJ 3F21A 4HF2A 3LFUA 2DT5A 2KLOA 1S6LA 4E70A 1O4XA 3LMMA 4XNFA 2HPIA 3G1LA 4A0ZA 4BL0B 1QZEA 1QZZA 2DMPA 3GTQJ 3E6CC 3HOWJ 2F48A 5HODA 2KRFA 3J7ZI 4PK4A 4RGUA 3MEXA 5DUKA 4ZZDA 2KL4A 2XB0X 2DLLA 1D1AA 4RA2A 5HVQC 4I09A 1B72B 2CH0A 1LEAA 3SJMA 5J40A 2CQKA 4IHWA 2O5RA 5J1RA 4I99C 1MSFC 2F4MB 3LAJA 4EMSA 4KJZA 4OOIA 4ZYGA 3M1CA 1U5TC 2EH3A 4B47A 1W36C 1Z6TA 2B7EA 1YOVB 1XCVA 1W5CC 1UHWA 3C3WA 1YQAA 2QM3A 3V7RA 2PMHA 3OYGA 3PL8A 3GBGA 3AKZA 2IPQX 2VJJA 4KN7X 3S3OA 2P7CB 4KYWA 3KP4A 2HTSA 2VC1A 1OCRH 3WHCA 3M8EA 2VXZA 1Z05A 4RB3C 4AIKA 3IUOA 3HOUJ 1KYWA 3TL4X 4A3CJ 2FUG2 4A5MA 1ZRCA 3KFWX 2H27A 2W00A 1MH3A 1HLVA 5DTDA 3WTTC 2UXNA 1BOAA 2ADUA 2LKPA 3F6VA 4OAZA 3B73A 4IHSA 2FU4A 3IV5A 4U7BA 2ZNYA 1HA8A 2LKSA 2R7ZJ 2NNNA 1RRJA 1ZK8A 2QVOA 4I98B 1XCBA 2M0MA 3KYCB 4BY1J 3FF5A 4KA4A 2DT6A 1O3RA 2Q0OA 3ELKA 1G2HA 4Q5SF 2KMUA 1HDPA 2OF7A 1WKMA 1X1PA 3HTUA 4YRVA 2R5YA 4ZYAA 3MWMA 4GGGA 3ABTA 4OINF 5KAIC 2DDBA 4YIRX 2VBZA 4JK1X 4M3BA 2K5CA 3C18A 1E3PA 3EYIA 4PCQA 3TKYA 2GXBA 1ETKA 3A2KA 1LFBA 3BP8A 3WU1B 4AIDA 2EK5A 1MBJA 3P9IA 2EINH 3O6BB 3BR2A 4V2FA 4D0PA 3FM5A 3GTLJ 4UXNA 2VOOA 1MNDA 3T8RA 4A3IJ 1IV6A 2LYCA 2F5VA 2M9HA 1UHSA 2VKEA 4BE0A 4C2TA 3HPGA 2IS6A 4RAGA 4UV9A 4OIQF 3GF2A 2I5UA 4XLFA 1F4KA 3G3ZA 3QPLA 2DMQA 2LBFB 1BJAA 1AKHB 5DV5A 2LD5A 4DGWB 4PGGA 1I3QJ 4LG0A 1DPUA 4QIWN 1MDMA 4BGDA 5FD5A 3PO2J 1WJFA 5AONA 1HBXG 4D9JA 2MABA 3NRVA 2L4AA 2O0YA 2ZMEB 4XLNF 1R4MB 2AXLA 3PQJA 3RSNA 2NRAC 4G7ZF 3G4SI 1UZCA 4UY8I 3HM5A 3M8JA 2ECCA 1TWHJ 4P1WA 2R0QC 5HDNA 4I6ZA 1BL0A 4ZYEA 1SFEA 3CUOA 2ESNA 4Y4RA 4CGZA 1V54H 3H9JA 2K02A 1JGSA 4Y3OA 2ME6A 4P55A 2R7SA 1EH8A 1X2NA 3DU5A 1DDNA 2M34A 5KK1A 2XDVA 4HNTA 2DFHA 5LHIA 3ZQ7A 2HU9A 1VQPI 2F4OB 2R7TA 5HS9A 1PVEA 1USTA 2GXAA 2K9NA 5EDNA 3DU6A 4Z6YA 1OPCA 3FWEA 4JP0A 3HOSA 2R5ZB 2M45A 2X6XA 4BJ5C 3PUFA 2JVGA 3CC2I 2PQ8A 1YFHA 1O7FA 4XIDA 3WTUC 3ZPLA 2X1CA 1JHFA 3K4KA 1IN5A 1MMDA 2EA4A 4XN3A 1R4NB 2Y0SN 2RDPA 4IX7A 3H5AA 1R58A 1HKSA 2GIVA 1ZR2A 5HNHA 3TDUC 5EEAA 1XGOA 1U78A 2BHYA 1UJ8A 3ZRGA 2JA5J 3VYTB 2P0WA 4HDVA 5B1AH 4ZTJA 4CCMA 1WWXA 3S32A 3H5NA 3ZMTA 4QLCU 2E7XA 1ZGWA 2HZTA 3H35A 3K4BA 3EQLF 2DFIA 2XKPA 4M9ZA 4B09A 1H89C 3ERMA 2LVSA
chains in the Genus database with same CATH topology
3WODF 5ED4A 2LF8A 3E6DA 4NB5A 4A6DA 4YFXF 2A07F 1FY7A 5DCMA 5D5WB 4LK0F 3FHZA 4IHTA 4YG2F 1RI7A 4GXOA 4G8XA 4HF0A 3JTHA 5CVUA 1U5TA 3GZ5A 4EJVA 3ROUA 2YPRA 1ODDA 1I6XA 5ICEA 2EB7A 3JAMK 3KETA 4O6JA 2XKOA 1K6OA 1ZYRF 3W6KB 3LA2A 2V1UA 3WTYC 2JTVA 3BPVA 3GYHX 1ULYA 4P5OA 4L0ZB 3DV8A 4FX4A 1REPC 5DEQA 1SFUA 3DP7A 4LMYA 1XDSA 4EM1A 3MFKA 3HSRA 2DAOA 3T8TA 2J5PA 5HDKA 3DPLC 4OMZA 3TO7A 3FX3A 3JAMZ 1S8NA 4YFNF 2YSRA 1KGSA 2L01A 4RB0A 3BJ6A 4IRIA 5CYVA 4LD5A 4ENMA 5ICGA 4U0VA 3I0TA 4WWCA 4EQQA 2CW0F 1XSVA 4XRFA 2L4MA 1HW5A 2PI0A 3RJPA 2VBWA 5BS6A 3T0YA 4RGSA 2IA1A 5JFRA 2M5WA 1S29A 3DKWA 3KLOA 4Q48A 3FMRA 2V9VA 1OR7A 2PEXA 3KCCA 2E1NA 3F22A 2VBYA 3MZYA 1ZARA 1P92A 3V8LA 1ONVA 5K5QA 3OV8A 3IKVA 2KJBA 5F6FA 2IRFG 4LGWA 4BHPA 1OYWA 5IT3A 5LRSA 3HRSA 3I53A 2RQPA 2HGCA 1RZ4A 2OZUA 2W24A 2ZO4A 1LQ1A 3KZZA 3NEUA 4G94A 2PN6A 4LG0B 5BPIA 4KMFA 3Q9SA 3GLXA 4ZYHA 1QQIA 1K79A 4I01A 1IN6A 2MA3A 4KNYA 5CVRA 5CVVA 2VN2A 2MLKA 3Q5FA 1G4DA 2PMUA 1FT9A 3AAFA 1MZBA 1MGTA 2JRTA 3I58A 5A2QK 1G3TA 1S7AA 2CWEA 3N4MA 3RKWA 2NAZA 1UHMA 1XSXA 3LQQA 2ZBKA 1AOYA 2YX7A 1F5TA 1TQPA 3QRFF 4JQFA 1VTNC 2W85A 2OZ6A 4RAYA 5LGNA 4GYIA 4AIHA 2W84A 4FX0A 4UNOA 2ACJA 4IVNA 3H3ZA 5A2QZ 1T2KA 4HDUA 1YIOA 4I2OA 3TOAA 1IXCA 2ISYA 4AD9A 3K69A 3TO9A 1E17A 1G3YA 1K7AA 1TW3A 1IRGA 2VE9A 1PP8F 2W57A 1SD7A 3CLOA 4L0YB 1LDKB 3QPTA 3BOQA 5LGTA 2GWRA 2QBYA 3E5UA 4OIPF 2FSWA 3KEQA 1YG2A 3U2RA 1V3FA 1R7JA 2XUBA 3GXOA 3COAC 2A6EF 1J0RA 5HS7A 1IRFA 1ON2A 3GZ6A 1R36A 3FMQA 3CUQB 4L5IA 4CXFA 2VBXA 2X0LA 3R6SA 4GO1A 3ABUA 5FB2A 3J7AO 4Z2YA 4LLLA 4ENJA 1LVAA 3MZHA 5FO5A 1SD4A 4M6YA 4OIRF 3L00A 5D8LB 2P5KA 1TW2A 1UCRA 3GWZA 2O8XA 2HQNA 2EA2A 3I4PA 2JSCA 3R4KA 4BH9A 4M71A 2HDCA 5LLQA 1T6SA 1XB4A 3QP5A 3SQNA 3QP6A 3H3UA 3ZMZA 2IA2A 3SZTA 3P9KA 2HKOA 3D5LA 4WXCA 2PFBA 4IRGA 3TGNA 2FRHA 2FMYA 4QWQA 1FNNA 3TDZC 4LLGF 3VOEA 3WE3A 1AWCA 5E1WA 5L3CA 1I1GA 2VODA 3RI4A 4HBLA 1YW8A 3BDDA 4R79A 2X4HA 2YU3A 4A6EA 4BHBA 1ZRDA 2XVCA 1EV7A 3TOBA 1I1SA 4A5NA 2PLYA 2FXAA 3HUGA 2R3SA 4UV8A 3WU0A 2VT3A 1B59A 2H6CA 1K78A 2R7FA 2XRNA 2UWMA 4PZJA 2IA0A 1P4XA 4EJUA 4A2UA 1Y0UA 1XSDA 1SMTA 1OYIA 1B1BA 1IN8A 3ISPA 3R60A 2Q2EA 4HX4A 1U3EM 4RAZA 1T0FA 2G9WA 3ULQB 1BBYA 2P7VB 5J6XA 1J2XA 5H6QA 5D5VB 2MD5A 3EUHA 2RN7A 3EYYA 1O3TA 5ILVA 2NNYA 1RIOH 3ZN1A 4I7HA 2BBYA 1BC8C 3KLNA 4IPAA 3GFIA 1P4WA 3KP2A 3RTRA 2HYFA 2O61A 2UXXA 3V8KA 1EH6A 3MCZA 1GHCA 2D1HA 6PAXA 5JHUA 3HSFA 5AIQA 2J5OA 5E1XA 5TJJA 3QPHA 4IF4A 4M6XA 4OIOF 4ESBA 1XD7A 2PG4A 2ZKZA 3LSTA 3W6JB 4PDKA 1KQ9A 4BHCA 4OU0A 2OAZA 3WGIA 1FWZA 4LJZF 2L3DA 1Z6RA 1R1TA 2XAJA 3RIRA 4KFCA 2DK8A 5EEGA 3HYIA 4U0WA 4A0XA 5F1RA 4KICA 5BQTA 1FLIA 4XBFA 2P4WA 5L3GA 3H92A 3U9GA 3NQOA 5E8GA 3ZN0A 4O5VA 2Q8KA 2OA4A 5DUIA 2JPCA 3G73A 1CF7A 5D8KB 1DUXC 2P8TA 3CTAA 4R1HA 3L2CA 3T1BA 1R1VA 3CDHA 1TQMA 5LHGA 5D5UB 4N0BA 3KEOA 2XAQA 2O03A 1WQ2A 1XMKA 3HRTA 1O3QA 1IXRC 3F8NA 1KU9A 2HQRA 1IUYA 3ECHA 1QBJA 4B8XA 3BY6A 3KZYA 3HTSB 5ILUA 1F1ZA 1SFXA 2UZKA 4G7OF 1U2WA 1OMIA 1B9NA 4KDPA 5D4RA 5E18F 2XHKA 4FHTA 1ON1A 1O57A 3GX4X 5D6FA 5LEJA 2HTJA 2M30A 2O3FA 5LHHA 4HX7A 4ASNA 1TLHB 1J7KA 4OMYA 3WTWC 3QU3A 4IRHA 1R5GA 2BV6A 4U88A 4BAYA 3GUDA 1C0WA 2BGCA 5KVRA 5FD6A 3HHGA 1LDJA 2FEZA 5K5OA 2CSOA 4NQWA 1J5YA 4MEXF 3RYRA 3GFJA 1LEBA 1MJBA 4RS8A 4G7HF 4MTDA 5HDGA 1ZG5A 2ZFWA 2XROA 3SXYA 4MEYF 2FQ3A 2FMLA 1R23A 4RB1A 2H6BA 5H20A 4A12A 3WTZA 4U7DA 3WTVC 4P96A 1TNTA 1U6GA 2EV6A 2F2EA 2MH9A 2K27A 1CGPA 1W7PA 1P6RA 5CVJA 2XASA 3TO6A 3LWFA 2Z3YA 3O3KA 3CJNA 4RGRA 1BI3A 2Y0MA 2DPUA 3F8BA 2LDUA 3ZMVA 5CJ9A 3I59A 2TDXA 1MDMB 3J80K 4HW0A 1JHHA 2Z5UA 5HLHA 1BM9A 4G9YA 5LEKA 1OYYA 3RKYA 5AIPA 1XDUA 2YR2A 1B9MA 2OBPA 2AS5F 3FXUA 4DNCA 3O2PE 3FXQA 1FBSA 4CYDA 1IN4A 4KN4X 4HAMA 2A61A 3GW2A 2QUFA 3VFZA 2WC2A 1ZN2A 3E6MA 3PQKA 3HRMA 3KP6A 4Y17A 1QGPA 2OU2A 1XGMA 3J80Z 2FBKA 4G6DA 3REOA 1NHAA 1HKQA 2CGPA 2RV8A 4CHUA 4HLXA 2HFHA 4GCVA 4L5JA 2L02A 3D0SA 3E5QA 1A04A 1ZLJA 2OQRA 3M7GA 5FFXA 1U8RA 5L3EA 1G6NA 2K4JA 3RDIA 4BXUA 3F3XA 1S7OA 1ZGJA 1G3WA 3JSOA 2Z99A 3SFZA 4GYGA 1Z1DA 1R1UA 5F64A 2F5FA 3JTGA 5DCMB 3IRQA 3DEUA 3P9CA 4LLNA 1TBXA 1QO0D 3KE2A 4Q4ZF 2IP2A 2LSOA 1U5TB 1KA8A 1Q1HA 1SMYF 2STWA 3CO7C 4EGZA 2IVMA 2MH2A 1OKRA 2ESHA 2HR3A 4ZZLA 3GFLA 2FNAA 1FYKA 3IC7A 4HOBA 1HW2A 2MLGA 4HV5A 2F5CA 2HYGD 1E2XA 4R8HA 1F9NA 4BYYA 5ILSA 2EFNA 4CO8A 1XGSA 4ENNA 2DTRA 3R0AA 3V7SA 4S04A 1T98A 2GAUA 2ZMEA 5E17F 1S3JA 5E1ZB 4AIJA 1P2FA 1WRJA 2FOKA 2XAFA 2QQ9A 2XV4S 3BJOA 2R7DA 1RNLA 3VODA 4HQMA 4Q47A 1ZG1A 3OOPA 2HEOA 1H9TA 1G3SA 4EV0A 5LBQA 5HLIA 3F6OA 4LB6B 2EV0A 4MTEA 5E8IA 5BPDA 1HXDA 2QZ8A 1KQ8A 2ZXJA 2K7LA 1ZLKA 3ECOA 2P5VA 3R0JA 1FP1D 2DI3A 2EFPA 3E3VA 1ZG3A 3BZ6A 3V8JA 2HKXA 3KP7A 3IL2A 2STTA 2XGXA 2DK5A 4HYEA 1SAXA 1YO5C 1FPQA 4ON0A 1XGNA 1HQCA 2M8EA 3IHUA 4ESFA 4WF2A 2KIFA 4LK1F 3C1DA 4RGXA 2A5YB 2EFQA 2W25A 2Z9OA 1FYLA 4G6QA 2PJPA 3I59B 1FYMA 2RVCA 2Z33A 1MJAA 3KP5A 5CVIA 4FT8A 4UUVA 2VOPA 1B6AA 5TRDA 1L0OC 2WWYA 4DQ2A 2JZYA 4WX9A 3CO6C 3J81K 4M72A 2ELHA 3LA7A 4U0YA 1I27A 4L9TA 4ESJA 2KIMA 2FF4A 5K5RA 1ZAOA 3K2ZA 5J8CA 3B02A 5HLGA 3CUQC 2QYOA 2FE3A 3I54A 1LNWA 2DO7A 1LJ9A 3TQNA 2FA5A 2WV0A 3RPQA 3WTSC 3J81Z 3ERED 1DP7P 3F8FA 1KU3A 3DFGA 2QQAA 2V1XA 1T39A 2LNBA 3S2WA 4H0EA 4WXHA 2FBIA 2Y75A 1ZH5A 2RKHA 2GA1A 1YLFA 2BEOA 4P9UA 1SD6A 1T38A 1ZRFA 2IJLA 1ZGAA 3FM3A 2RC4A 3MQ0A 1TTYA 4F7ZA 4A0YA 5DDGA 3EDPA 1D3YA 3GFMA 2P6SA 2KJCA 2QBYB 3HOTA 4I0AA 1IW7F 2GQQA 1YW7A 3GVAA 3WTXC 1BI2A 2GA2A 3F8CA 1WSUA 3BJAA 2A69F 1W7PD 2ZJ2A 2RNJA 2HS5A 2KKOA 4HLYA 4ENKA 4LFUA 1O3SA 4XSZF 5BOXA 2F5DA 4O3MA 4CDGA 1IZ1A 5H6RA 2L54A 2H94A 1D8KA 3V7CA 4M73A 1I5ZA 2IW5A 5EEHA 4EJTA 1GVJA 1X3UA 1W5TA 2YX4A 3RPUA 3WGHA 4P9FA 5D4SA 1YS6A 1XMAA 1IAWA 1FSHA 3IWFA 1P4AA 3VEPA 3K9TA 2A6HF 4M9XA 2PBIA 3M8FA 3K1NA 3QOPA 1RUNA 4WXDA 2CO5A 3FMSA 1FBQA 1JXSA 3F23A 4L9JA 2RGVA 2HOEA 4YIIA 3T5XA 1BC7C 3ZP5A 2V1DA 1TNSA 5FFZA 1FSEA 4EM2A 1MJ9A 1HSJA 1LDDA 1UB9A 3JSPA 4Y13A 1PUEE 5JR3A 3BROA 2MBFA 4N9IA 1YYVA 3HHHA 3DXJF 5E20A 1W4MA 1Z9CA 3V4GA 4HF1A 5J8FA 3F8MA 3ZMSA 3E97A 1KU2A 2DBBA 3CUQA 2E1CA 1K78B 1ZHFA 2D2WA 1BIAA 2OQGA 2VC0A 3I64A 4AWXB 3I71A 4CZZA 3HRUA 4PGHA 1R00A 3BPXA 3I5UA 1KYZA 2O6GE 2EWNA 1BI0A 2CFXA 2QLZA 4KIGA 5HS8A 4ZYDA 2C6YA 3WE2A 1ZREA 5ICFA 5FLXK 2G7UA 1WI9A 4EM0B 4MNUA 1RUOA 5K1YA 4WK8F 4KIBA 1H9GA 4HQEA 4KUMA 1EH7A 1HSTA 5LRRA 1QPMA 2XAHA 3F72A 1J59A 4RB2C 2F5EA 5L3DA 2DQRA 2H09A 2P5LC 4K2EA 1SD5A 4MHGA 1JE8A 4HV6A 1IF1A 3BWGA 2GXGA 3L7WA 2B0LA 2G7HA 5DD8A 2NS0A 1GXQA 4UVBA 4BQAA 5FLXZ 1IN7A 1BN5A 4I02A 3L9FA 5JVTA 5DD4A 1R5HA 3MAJA 2FNPA 2DU9A 3P7NA 1B4AA 1FC3A 1DPRA 4EJWA 2P6TA 2DQLA 2M87A 3ZMUA 2JPBA 5DCFA 3LAPA 1QZYA 1YS7A 2VE8A 3R61A 4S05A 4KT5C 2FBHA 3FXRA 5ICCA 5HOOA 3RKXA 2A3SA 3LA3A 2EFWA 1MD0A 1D5VA 2COMA 5DYMA 1W5SA 1KQ0A 4ZH4F 2D1VA 5D5XB 3N97A 2E7WA 3Q9VA 1STZA 4EJOA 4L9VA 4Y15A 4LB5A 3C7JA 5L3BA 1UFMA 4EVIA 4MGRA 1LB2A 3M9AA 4M74A 3LQRA 1HKTA 4WCGA 3PFIA 2HWVA 1HW1A 1PDNC 2EFOA 2EJRA 2A68F 1USSA 2LF7A 3K0LA 2MC3A 5L3FA 1Z7UA 1CF7B 2CG4A 3DF8A 1BIBA 5D6EA 2JT1A 2BE5F 2VONA 4HZFA 1Z91A 1FBUA 1L3LA 5LGUA 2QQBA 2ZNZA 4MQ9F 1J9IA 4NHJA 3U1DA 3FZVA 3VB2A 2V6CA 2DPDA 4XLPF 4M9SA 3IRRA 1FP2A 3K1PA 2M1BA 3K1MA 1KU7A 4L18B 2V79A 1FOKA 3QU6A 4UVAA 3SZPA 3IKTA 2CYYA 3GO5A 4CICA 4EGYA 1PP7U 3DQVC 2K4BA 4YIFA 2KIUA 2ISZA 4I0BA 1D8JA 2WTEA 3GEZA 3L09A 2ZCWA 2ETHA 2K86A 2IT0A 3E5XA 3SHFA 5IT9K 1H0MA 2VT2A 5JI6A 2NYXA 1O7LA 3WGGA 4UVCA 2D45A 3DPTA 3WG9A 5CLSA 2GZWA 2Y48A 4HA8A 2OD5A 2XIGA 1TQIA 2EV5A 4HX8A 3QAHA 4KIFA 1BI1A 1IXSB 2QENA 5IT9Z 2QWWA 3KP3A 4IJAA 2BYVE 1GXPA 1XN7A 4UHTA 1YTYA 4YFKF 1J75A 3LFKA 2DW4A 4KMUX 2XAGA 5FGMA 1V4RA 4TV7A 4MQVA 3ML6A 4AVPA 3E6BA 1MKMA 3HIFA 5ERIA 4L9NA 3M1EA 3EETA 1FZPB 3HSEA 3ZMDA 4N9HA 1YW9A 3JW4A 1W7PB 3RYPA 4ETSA 5BMZA 4JBAA 4BNCA 1R22A 4XSXF 1FX7A 3IWZA 1QNTA 3F21A 4HF2A 2DT5A 1S6LA 4E70A 4A0ZA 1QZZA 3E6CC 2KRFA 4RGUA 3MEXA 5DUKA 4ZZDA 2DLLA 5HVQC 4I09A 1LEAA 2CQKA 3LAJA 4EMSA 4OOIA 4ZYGA 1U5TC 1Z6TA 1XCVA 1UHWA 3C3WA 1YQAA 2QM3A 3V7RA 2PMHA 2IPQX 4KN7X 4KYWA 2P7CB 3KP4A 2HTSA 2VC1A 3M8EA 2VXZA 1Z05A 4RB3C 4AIKA 1KYWA 4A5MA 1ZRCA 3KFWX 2H27A 3WTTC 2UXNA 1BOAA 2ADUA 2LKPA 3F6VA 3B73A 4IHSA 2FU4A 4U7BA 2ZNYA 2NNNA 2QVOA 4I98B 1XCBA 3FF5A 4KA4A 1O3RA 2Q0OA 3ELKA 4Q5SF 1WKMA 3HTUA 3MWMA 4GGGA 3ABTA 4OINF 2VBZA 4JK1X 3C18A 3EYIA 4PCQA 3TKYA 2GXBA 3BP8A 3WU1B 2EK5A 3P9IA 3O6BB 4D0PA 3FM5A 4UXNA 2VOOA 3T8RA 4UV9A 4OIQF 3GF2A 1F4KA 3G3ZA 1BJAA 5DV5A 4PGGA 4LG0A 1DPUA 1MDMA 5FD5A 5AONA 1HBXG 3NRVA 2L4AA 2O0YA 2ZMEB 4XLNF 2AXLA 3PQJA 2NRAC 4G7ZF 5HDNA 4ZYEA 1SFEA 3CUOA 2ESNA 4CGZA 2K02A 1JGSA 4P55A 1EH8A 1DDNA 5KK1A 5LHIA 3ZQ7A 5HS9A 1USTA 1OPCA 3FWEA 3HOSA 2M45A 2PQ8A 1YFHA 1O7FA 3WTUC 3ZPLA 1JHFA 2EA4A 1IN5A 2RDPA 1R58A 1HKSA 2GIVA 3TDUC 1U78A 1XGOA 4HDVA 1WWXA 3ZMTA 4QLCU 2E7XA 2HZTA 3EQLF 2DFIA 2XKPA 4M9ZA 4B09A 4IXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WOD F;  5ED4 A;  2LF8 A;  3E6D A;  4NB5 A;  4A6D A;  4YFX F;  2A07 F;  1FY7 A;  5DCM A;  5D5W B;  4LK0 F;  3FHZ A;  4IHT A;  4YG2 F;  1RI7 A;  4GXO A;  4G8X A;  4HF0 A;  3JTH A;  5CVU A;  1U5T A;  3GZ5 A;  4EJV A;  3ROU A;  2YPR A;  1ODD A;  1I6X A;  5ICE A;  2EB7 A;  3JAM K;  3KET A;  4O6J A;  2XKO A;  1K6O A;  1ZYR F;  3W6K B;  3LA2 A;  2V1U A;  3WTY C;  2JTV A;  3BPV A;  3GYH X;  1ULY A;  4P5O A;  4L0Z B;  3DV8 A;  4FX4 A;  1REP C;  5DEQ A;  1SFU A;  3DP7 A;  4LMY A;  1XDS A;  4EM1 A;  3MFK A;  3HSR A;  2DAO A;  3T8T A;  2J5P A;  5HDK A;  3DPL C;  4OMZ A;  3TO7 A;  3FX3 A;  3JAM Z;  1S8N A;  4YFN F;  2YSR A;  1KGS A;  2L01 A;  4RB0 A;  3BJ6 A;  4IRI A;  5CYV A;  4LD5 A;  4ENM A;  5ICG A;  4U0V A;  3I0T A;  4WWC A;  4EQQ A;  2CW0 F;  1XSV A;  4XRF A;  2L4M A;  1HW5 A;  2PI0 A;  3RJP A;  2VBW A;  5BS6 A;  3T0Y A;  4RGS A;  2IA1 A;  5JFR A;  2M5W A;  1S29 A;  3DKW A;  3KLO A;  4Q48 A;  3FMR A;  2V9V A;  1OR7 A;  2PEX A;  3KCC A;  2E1N A;  3F22 A;  2VBY A;  3MZY A;  1ZAR A;  1P92 A;  3V8L A;  1ONV A;  5K5Q A;  3OV8 A;  3IKV A;  2KJB A;  5F6F A;  2IRF G;  4LGW A;  4BHP A;  1OYW A;  5IT3 A;  5LRS A;  3HRS A;  3I53 A;  2RQP A;  2HGC A;  1RZ4 A;  2OZU A;  2W24 A;  2ZO4 A;  1LQ1 A;  3KZZ A;  3NEU A;  4G94 A;  2PN6 A;  4LG0 B;  5BPI A;  4KMF A;  3Q9S A;  3GLX A;  4ZYH A;  1QQI A;  1K79 A;  4I01 A;  1IN6 A;  2MA3 A;  4KNY A;  5CVR A;  5CVV A;  2VN2 A;  2MLK A;  3Q5F A;  1G4D A;  2PMU A;  1FT9 A;  3AAF A;  1MZB A;  1MGT A;  2JRT A;  3I58 A;  5A2Q K;  1G3T A;  1S7A A;  2CWE A;  3N4M A;  3RKW A;  2NAZ A;  1UHM A;  1XSX A;  3LQQ A;  2ZBK A;  1AOY A;  2YX7 A;  1F5T A;  1TQP A;  3QRF F;  4JQF A;  1VTN C;  2W85 A;  2OZ6 A;  4RAY A;  5LGN A;  4GYI A;  4AIH A;  2W84 A;  4FX0 A;  4UNO A;  2ACJ A;  4IVN A;  3H3Z A;  5A2Q Z;  1T2K A;  4HDU A;  1YIO A;  4I2O A;  3TOA A;  1IXC A;  2ISY A;  4AD9 A;  3K69 A;  3TO9 A;  1E17 A;  1G3Y A;  1K7A A;  1TW3 A;  1IRG A;  2VE9 A;  1PP8 F;  2W57 A;  1SD7 A;  3CLO A;  4L0Y B;  1LDK B;  3QPT A;  3BOQ A;  5LGT A;  2GWR A;  2QBY A;  3E5U A;  4OIP F;  2FSW A;  3KEQ A;  1YG2 A;  3U2R A;  1V3F A;  1R7J A;  2XUB A;  3GXO A;  3COA C;  2A6E F;  1J0R A;  5HS7 A;  1IRF A;  1ON2 A;  3GZ6 A;  1R36 A;  3FMQ A;  3CUQ B;  4L5I A;  4CXF A;  2VBX A;  2X0L A;  3R6S A;  4GO1 A;  3ABU A;  5FB2 A;  3J7A O;  4Z2Y A;  4LLL A;  4ENJ A;  1LVA A;  3MZH A;  5FO5 A;  1SD4 A;  4M6Y A;  4OIR F;  3L00 A;  5D8L B;  2P5K A;  1TW2 A;  1UCR A;  3GWZ A;  2O8X A;  2HQN A;  2EA2 A;  3I4P A;  2JSC A;  3R4K A;  4BH9 A;  4M71 A;  2HDC A;  5LLQ A;  1T6S A;  1XB4 A;  3QP5 A;  3SQN A;  3QP6 A;  3H3U A;  3ZMZ A;  2IA2 A;  3SZT A;  3P9K A;  2HKO A;  3D5L A;  4WXC A;  2PFB A;  4IRG A;  3TGN A;  2FRH A;  2FMY A;  4QWQ A;  1FNN A;  3TDZ C;  4LLG F;  3VOE A;  3WE3 A;  1AWC A;  5E1W A;  5L3C A;  1I1G A;  2VOD A;  3RI4 A;  4HBL A;  1YW8 A;  3BDD A;  4R79 A;  2X4H A;  2YU3 A;  4A6E A;  4BHB A;  1ZRD A;  2XVC A;  1EV7 A;  3TOB A;  1I1S A;  4A5N A;  2PLY A;  2FXA A;  3HUG A;  2R3S A;  4UV8 A;  3WU0 A;  2VT3 A;  1B59 A;  2H6C A;  1K78 A;  2R7F A;  2XRN A;  2UWM A;  4PZJ A;  2IA0 A;  1P4X A;  4EJU A;  4A2U A;  1Y0U A;  1XSD A;  1SMT A;  1OYI A;  1B1B A;  1IN8 A;  3ISP A;  3R60 A;  2Q2E A;  4HX4 A;  1U3E M;  4RAZ A;  1T0F A;  2G9W A;  3ULQ B;  1BBY A;  2P7V B;  5J6X A;  1J2X A;  5H6Q A;  5D5V B;  2MD5 A;  3EUH A;  2RN7 A;  3EYY A;  1O3T A;  5ILV A;  2NNY A;  1RIO H;  3ZN1 A;  4I7H A;  2BBY A;  1BC8 C;  3KLN A;  4IPA A;  3GFI A;  1P4W A;  3KP2 A;  3RTR A;  2HYF A;  2O61 A;  2UXX A;  3V8K A;  1EH6 A;  3MCZ A;  1GHC A;  2D1H A;  6PAX A;  5JHU A;  3HSF A;  5AIQ A;  2J5O A;  5E1X A;  5TJJ A;  3QPH A;  4IF4 A;  4M6X A;  4OIO F;  4ESB A;  1XD7 A;  2PG4 A;  2ZKZ A;  3LST A;  3W6J B;  4PDK A;  1KQ9 A;  4BHC A;  4OU0 A;  2OAZ A;  3WGI A;  1FWZ A;  4LJZ F;  2L3D A;  1Z6R A;  1R1T A;  2XAJ A;  3RIR A;  4KFC A;  2DK8 A;  5EEG A;  3HYI A;  4U0W A;  4A0X A;  5F1R A;  4KIC A;  5BQT A;  1FLI A;  4XBF A;  2P4W A;  5L3G A;  3H92 A;  3U9G A;  3NQO A;  5E8G A;  3ZN0 A;  4O5V A;  2Q8K A;  2OA4 A;  5DUI A;  2JPC A;  3G73 A;  1CF7 A;  5D8K B;  1DUX C;  2P8T A;  3CTA A;  4R1H A;  3L2C A;  3T1B A;  1R1V A;  3CDH A;  1TQM A;  5LHG A;  5D5U B;  4N0B A;  3KEO A;  2XAQ A;  2O03 A;  1WQ2 A;  1XMK A;  3HRT A;  1O3Q A;  1IXR C;  3F8N A;  1KU9 A;  2HQR A;  1IUY A;  3ECH A;  1QBJ A;  4B8X A;  3BY6 A;  3KZY A;  3HTS B;  5ILU A;  1F1Z A;  1SFX A;  2UZK A;  4G7O F;  1U2W A;  1OMI A;  1B9N A;  4KDP A;  5D4R A;  5E18 F;  2XHK A;  4FHT A;  1ON1 A;  1O57 A;  3GX4 X;  5D6F A;  5LEJ A;  2HTJ A;  2M30 A;  2O3F A;  5LHH A;  4HX7 A;  4ASN A;  1TLH B;  1J7K A;  4OMY A;  3WTW C;  3QU3 A;  4IRH A;  1R5G A;  2BV6 A;  4U88 A;  4BAY A;  3GUD A;  1C0W A;  2BGC A;  5KVR A;  5FD6 A;  3HHG A;  1LDJ A;  2FEZ A;  5K5O A;  2CSO A;  4NQW A;  1J5Y A;  4MEX F;  3RYR A;  3GFJ A;  1LEB A;  1MJB A;  4RS8 A;  4G7H F;  4MTD A;  5HDG A;  1ZG5 A;  2ZFW A;  2XRO A;  3SXY A;  4MEY F;  2FQ3 A;  2FML A;  1R23 A;  4RB1 A;  2H6B A;  5H20 A;  4A12 A;  3WTZ A;  4U7D A;  3WTV C;  4P96 A;  1TNT A;  1U6G A;  2EV6 A;  2F2E A;  2MH9 A;  2K27 A;  1CGP A;  1W7P A;  1P6R A;  5CVJ A;  2XAS A;  3TO6 A;  3LWF A;  2Z3Y A;  3O3K A;  3CJN A;  4RGR A;  1BI3 A;  2Y0M A;  2DPU A;  3F8B A;  2LDU A;  3ZMV A;  5CJ9 A;  3I59 A;  2TDX A;  1MDM B;  3J80 K;  4HW0 A;  1JHH A;  2Z5U A;  5HLH A;  1BM9 A;  4G9Y A;  5LEK A;  1OYY A;  3RKY A;  5AIP A;  1XDU A;  2YR2 A;  1B9M A;  2OBP A;  2AS5 F;  3FXU A;  4DNC A;  3O2P E;  3FXQ A;  1FBS A;  4CYD A;  1IN4 A;  4KN4 X;  4HAM A;  2A61 A;  3GW2 A;  2QUF A;  3VFZ A;  2WC2 A;  1ZN2 A;  3E6M A;  3PQK A;  3HRM A;  3KP6 A;  4Y17 A;  1QGP A;  2OU2 A;  1XGM A;  3J80 Z;  2FBK A;  4G6D A;  3REO A;  1NHA A;  1HKQ A;  2CGP A;  2RV8 A;  4CHU A;  4HLX A;  2HFH A;  4GCV A;  4L5J A;  2L02 A;  3D0S A;  3E5Q A;  1A04 A;  1ZLJ A;  2OQR A;  3M7G A;  5FFX A;  1U8R A;  5L3E A;  1G6N A;  2K4J A;  3RDI A;  4BXU A;  3F3X A;  1S7O A;  1ZGJ A;  1G3W A;  3JSO A;  2Z99 A;  3SFZ A;  4GYG A;  1Z1D A;  1R1U A;  5F64 A;  2F5F A;  3JTG A;  5DCM B;  3IRQ A;  3DEU A;  3P9C A;  4LLN A;  1TBX A;  1QO0 D;  3KE2 A;  4Q4Z F;  2IP2 A;  2LSO A;  1U5T B;  1KA8 A;  1Q1H A;  1SMY F;  2STW A;  3CO7 C;  4EGZ A;  2IVM A;  2MH2 A;  1OKR A;  2ESH A;  2HR3 A;  4ZZL A;  3GFL A;  2FNA A;  1FYK A;  3IC7 A;  4HOB A;  1HW2 A;  2MLG A;  4HV5 A;  2F5C A;  2HYG D;  1E2X A;  4R8H A;  1F9N A;  4BYY A;  5ILS A;  2EFN A;  4CO8 A;  1XGS A;  4ENN A;  2DTR A;  3R0A A;  3V7S A;  4S04 A;  1T98 A;  2GAU A;  2ZME A;  5E17 F;  1S3J A;  5E1Z B;  4AIJ A;  1P2F A;  1WRJ A;  2FOK A;  2XAF A;  2QQ9 A;  2XV4 S;  3BJO A;  2R7D A;  1RNL A;  3VOD A;  4HQM A;  4Q47 A;  1ZG1 A;  3OOP A;  2HEO A;  1H9T A;  1G3S A;  4EV0 A;  5LBQ A;  5HLI A;  3F6O A;  4LB6 B;  2EV0 A;  4MTE A;  5E8I A;  5BPD A;  1HXD A;  2QZ8 A;  1KQ8 A;  2ZXJ A;  2K7L A;  1ZLK A;  3ECO A;  2P5V A;  3R0J A;  1FP1 D;  2DI3 A;  2EFP A;  3E3V A;  1ZG3 A;  3BZ6 A;  3V8J A;  2HKX A;  3KP7 A;  3IL2 A;  2STT A;  2XGX A;  2DK5 A;  4HYE A;  1SAX A;  1YO5 C;  1FPQ A;  4ON0 A;  1XGN A;  1HQC A;  2M8E A;  3IHU A;  4ESF A;  4WF2 A;  2KIF A;  4LK1 F;  3C1D A;  4RGX A;  2A5Y B;  2EFQ A;  2W25 A;  2Z9O A;  1FYL A;  4G6Q A;  2PJP A;  3I59 B;  1FYM A;  2RVC A;  2Z33 A;  1MJA A;  3KP5 A;  5CVI A;  4FT8 A;  4UUV A;  2VOP A;  1B6A A;  5TRD A;  1L0O C;  2WWY A;  4DQ2 A;  2JZY A;  4WX9 A;  3CO6 C;  3J81 K;  4M72 A;  2ELH A;  3LA7 A;  4U0Y A;  1I27 A;  4L9T A;  4ESJ A;  2KIM A;  2FF4 A;  5K5R A;  1ZAO A;  3K2Z A;  5J8C A;  3B02 A;  5HLG A;  3CUQ C;  2QYO A;  2FE3 A;  3I54 A;  1LNW A;  2DO7 A;  1LJ9 A;  3TQN A;  2FA5 A;  2WV0 A;  3RPQ A;  3WTS C;  3J81 Z;  3ERE D;  1DP7 P;  3F8F A;  1KU3 A;  3DFG A;  2QQA A;  2V1X A;  1T39 A;  2LNB A;  3S2W A;  4H0E A;  4WXH A;  2FBI A;  2Y75 A;  1ZH5 A;  2RKH A;  2GA1 A;  1YLF A;  2BEO A;  4P9U A;  1SD6 A;  1T38 A;  1ZRF A;  2IJL A;  1ZGA A;  3FM3 A;  2RC4 A;  3MQ0 A;  1TTY A;  4F7Z A;  4A0Y A;  5DDG A;  3EDP A;  1D3Y A;  3GFM A;  2P6S A;  2KJC A;  2QBY B;  3HOT A;  4I0A A;  1IW7 F;  2GQQ A;  1YW7 A;  3GVA A;  3WTX C;  1BI2 A;  2GA2 A;  3F8C A;  1WSU A;  3BJA A;  2A69 F;  1W7P D;  2ZJ2 A;  2RNJ A;  2HS5 A;  2KKO A;  4HLY A;  4ENK A;  4LFU A;  1O3S A;  4XSZ F;  5BOX A;  2F5D A;  4O3M A;  4CDG A;  1IZ1 A;  5H6R A;  2L54 A;  2H94 A;  1D8K A;  3V7C A;  4M73 A;  1I5Z A;  2IW5 A;  5EEH A;  4EJT A;  1GVJ A;  1X3U A;  1W5T A;  2YX4 A;  3RPU A;  3WGH A;  4P9F A;  5D4S A;  1YS6 A;  1XMA A;  1IAW A;  1FSH A;  3IWF A;  1P4A A;  3VEP A;  3K9T A;  2A6H F;  4M9X A;  2PBI A;  3M8F A;  3K1N A;  3QOP A;  1RUN A;  4WXD A;  2CO5 A;  3FMS A;  1FBQ A;  1JXS A;  3F23 A;  4L9J A;  2RGV A;  2HOE A;  4YII A;  3T5X A;  1BC7 C;  3ZP5 A;  2V1D A;  1TNS A;  5FFZ A;  1FSE A;  4EM2 A;  1MJ9 A;  1HSJ A;  1LDD A;  1UB9 A;  3JSP A;  4Y13 A;  1PUE E;  5JR3 A;  3BRO A;  2MBF A;  4N9I A;  1YYV A;  3HHH A;  3DXJ F;  5E20 A;  1W4M A;  1Z9C A;  3V4G A;  4HF1 A;  5J8F A;  3F8M A;  3ZMS A;  3E97 A;  1KU2 A;  2DBB A;  3CUQ A;  2E1C A;  1K78 B;  1ZHF A;  2D2W A;  1BIA A;  2OQG A;  2VC0 A;  3I64 A;  4AWX B;  3I71 A;  4CZZ A;  3HRU A;  4PGH A;  1R00 A;  3BPX A;  3I5U A;  1KYZ A;  2O6G E;  2EWN A;  1BI0 A;  2CFX A;  2QLZ A;  4KIG A;  5HS8 A;  4ZYD A;  2C6Y A;  3WE2 A;  1ZRE A;  5ICF A;  5FLX K;  2G7U A;  1WI9 A;  4EM0 B;  4MNU A;  1RUO A;  5K1Y A;  4WK8 F;  4KIB A;  1H9G A;  4HQE A;  4KUM A;  1EH7 A;  1HST A;  5LRR A;  1QPM A;  2XAH A;  3F72 A;  1J59 A;  4RB2 C;  2F5E A;  5L3D A;  2DQR A;  2H09 A;  2P5L C;  4K2E A;  1SD5 A;  4MHG A;  1JE8 A;  4HV6 A;  1IF1 A;  3BWG A;  2GXG A;  3L7W A;  2B0L A;  2G7H A;  5DD8 A;  2NS0 A;  1GXQ A;  4UVB A;  4BQA A;  5FLX Z;  1IN7 A;  1BN5 A;  4I02 A;  3L9F A;  5JVT A;  5DD4 A;  1R5H A;  3MAJ A;  2FNP A;  2DU9 A;  3P7N A;  1B4A A;  1FC3 A;  1DPR A;  4EJW A;  2P6T A;  2DQL A;  2M87 A;  3ZMU A;  2JPB A;  5DCF A;  3LAP A;  1QZY A;  1YS7 A;  2VE8 A;  3R61 A;  4S05 A;  4KT5 C;  2FBH A;  3FXR A;  5ICC A;  5HOO A;  3RKX A;  2A3S A;  3LA3 A;  2EFW A;  1MD0 A;  1D5V A;  2COM A;  5DYM A;  1W5S A;  1KQ0 A;  4ZH4 F;  2D1V A;  5D5X B;  3N97 A;  2E7W A;  3Q9V A;  1STZ A;  4EJO A;  4L9V A;  4Y15 A;  4LB5 A;  3C7J A;  5L3B A;  1UFM A;  4EVI A;  4MGR A;  1LB2 A;  3M9A A;  4M74 A;  3LQR A;  1HKT A;  4WCG A;  3PFI A;  2HWV A;  1HW1 A;  1PDN C;  2EFO A;  2EJR A;  2A68 F;  1USS A;  2LF7 A;  3K0L A;  2MC3 A;  5L3F A;  1Z7U A;  1CF7 B;  2CG4 A;  3DF8 A;  1BIB A;  5D6E A;  2JT1 A;  2BE5 F;  2VON A;  4HZF A;  1Z91 A;  1FBU A;  1L3L A;  5LGU A;  2QQB A;  2ZNZ A;  4MQ9 F;  1J9I A;  4NHJ A;  3U1D A;  3FZV A;  3VB2 A;  2V6C A;  2DPD A;  4XLP F;  4M9S A;  3IRR A;  1FP2 A;  3K1P A;  2M1B A;  3K1M A;  1KU7 A;  4L18 B;  2V79 A;  1FOK A;  3QU6 A;  4UVA A;  3SZP A;  3IKT A;  2CYY A;  3GO5 A;  4CIC A;  4EGY A;  1PP7 U;  3DQV C;  2K4B A;  4YIF A;  2KIU A;  2ISZ A;  4I0B A;  1D8J A;  2WTE A;  3GEZ A;  3L09 A;  2ZCW A;  2ETH A;  2K86 A;  2IT0 A;  3E5X A;  3SHF A;  5IT9 K;  1H0M A;  2VT2 A;  5JI6 A;  2NYX A;  1O7L A;  3WGG A;  4UVC A;  2D45 A;  3DPT A;  3WG9 A;  5CLS A;  2GZW A;  2Y48 A;  4HA8 A;  2OD5 A;  2XIG A;  1TQI A;  2EV5 A;  4HX8 A;  3QAH A;  4KIF A;  1BI1 A;  1IXS B;  2QEN A;  5IT9 Z;  2QWW A;  3KP3 A;  4IJA A;  2BYV E;  1GXP A;  1XN7 A;  4UHT A;  1YTY A;  4YFK F;  1J75 A;  3LFK A;  2DW4 A;  4KMU X;  2XAG A;  5FGM A;  1V4R A;  4TV7 A;  4MQV A;  3ML6 A;  4AVP A;  3E6B A;  1MKM A;  3HIF A;  5ERI A;  4L9N A;  3M1E A;  3EET A;  1FZP B;  3HSE A;  3ZMD A;  4N9H A;  1YW9 A;  3JW4 A;  1W7P B;  3RYP A;  4ETS A;  5BMZ A;  4JBA A;  4BNC A;  1R22 A;  4XSX F;  1FX7 A;  3IWZ A;  1QNT A;  3F21 A;  4HF2 A;  2DT5 A;  1S6L A;  4E70 A;  4A0Z A;  1QZZ A;  3E6C C;  2KRF A;  4RGU A;  3MEX A;  5DUK A;  4ZZD A;  2DLL A;  5HVQ C;  4I09 A;  1LEA A;  2CQK A;  3LAJ A;  4EMS A;  4OOI A;  4ZYG A;  1U5T C;  1Z6T A;  1XCV A;  1UHW A;  3C3W A;  1YQA A;  2QM3 A;  3V7R A;  2PMH A;  2IPQ X;  4KN7 X;  4KYW A;  2P7C B;  3KP4 A;  2HTS A;  2VC1 A;  3M8E A;  2VXZ A;  1Z05 A;  4RB3 C;  4AIK A;  1KYW A;  4A5M A;  1ZRC A;  3KFW X;  2H27 A;  3WTT C;  2UXN A;  1BOA A;  2ADU A;  2LKP A;  3F6V A;  3B73 A;  4IHS A;  2FU4 A;  4U7B A;  2ZNY A;  2NNN A;  2QVO A;  4I98 B;  1XCB A;  3FF5 A;  4KA4 A;  1O3R A;  2Q0O A;  3ELK A;  4Q5S F;  1WKM A;  3HTU A;  3MWM A;  4GGG A;  3ABT A;  4OIN F;  2VBZ A;  4JK1 X;  3C18 A;  3EYI A;  4PCQ A;  3TKY A;  2GXB A;  3BP8 A;  3WU1 B;  2EK5 A;  3P9I A;  3O6B B;  4D0P A;  3FM5 A;  4UXN A;  2VOO A;  3T8R A;  4UV9 A;  4OIQ F;  3GF2 A;  1F4K A;  3G3Z A;  1BJA A;  5DV5 A;  4PGG A;  4LG0 A;  1DPU A;  1MDM A;  5FD5 A;  5AON A;  1HBX G;  3NRV A;  2L4A A;  2O0Y A;  2ZME B;  4XLN F;  2AXL A;  3PQJ A;  2NRA C;  4G7Z F;  5HDN A;  4ZYE A;  1SFE A;  3CUO A;  2ESN A;  4CGZ A;  2K02 A;  1JGS A;  4P55 A;  1EH8 A;  1DDN A;  5KK1 A;  5LHI A;  3ZQ7 A;  5HS9 A;  1UST A;  1OPC A;  3FWE A;  3HOS A;  2M45 A;  2PQ8 A;  1YFH A;  1O7F A;  3WTU C;  3ZPL A;  1JHF A;  2EA4 A;  1IN5 A;  2RDP A;  1R58 A;  1HKS A;  2GIV A;  3TDU C;  1U78 A;  1XGO A;  4HDV A;  1WWX A;  3ZMT A;  4QLC U;  2E7X A;  2HZT A;  3EQL F;  2DFI A;  2XKP A;  4M9Z A;  4B09 A;  4IXA A; 
#chains in the Genus database with same CATH topology
 3WOD F;  5ED4 A;  2LF8 A;  3E6D A;  4B3X A;  4NB5 A;  3EPZ A;  4A6D A;  4IHY A;  4YFX F;  1DU6 A;  2KIQ A;  2MFZ A;  2A07 F;  1FY7 A;  5DCM A;  5B5E C;  2CQN A;  5D5W B;  1BOB A;  4LK0 F;  1JUM A;  3FHZ A;  4IHT A;  2ID6 A;  4YG2 F;  1RI7 A;  1MMS A;  4GXO A;  3WG7 H;  4G8X A;  4HF0 A;  3D1N I;  3JTH A;  5CVU A;  1U5T A;  3GZ5 A;  4EJV A;  2L9R A;  2V26 A;  2YPR A;  3ROU A;  4A3B J;  1ODD A;  1I6X A;  5ICE A;  1R49 A;  2CMP A;  2EB7 A;  3JAM K;  3AG2 H;  2XSD C;  3KET A;  4O6J A;  2XKO A;  1K6O A;  4A3G J;  1ZYR F;  2VQL A;  1VQ9 I;  5B3S H;  4II3 A;  2ZB9 A;  3W6K B;  1AU7 A;  1BR2 A;  3LA2 A;  3ASN H;  1XTA A;  4PSW A;  2NVX J;  5CQG A;  2V1U A;  3WTY C;  2JTV A;  3BPV A;  3GYH X;  1ULY A;  4P5O A;  3S17 J;  4L0Z B;  3DV8 A;  4B4C A;  2E5Z A;  4E4H A;  4FX4 A;  3CLQ A;  3OYB A;  1ERD A;  1REP C;  5DEQ A;  1SFU A;  2IEK A;  2O8K A;  4XK4 A;  2I10 A;  3DP7 A;  4LMY A;  1XDS A;  4EM1 A;  4XIC A;  3MFK A;  2H8R A;  3HSR A;  2DAO A;  4XRM A;  3T8T A;  2J5P A;  5IPA A;  5HDK A;  3DPL C;  4OMZ A;  3TO7 A;  1DP3 A;  3FX3 A;  3JAM Z;  3S1N J;  1S8N A;  2W1O A;  4YFN F;  2YSR A;  1KGS A;  2L01 A;  4RB0 A;  1R9T J;  2E1O A;  1X4O A;  3BJ6 A;  4IRI A;  3BTL A;  5CYV A;  1K4T A;  4IZZ A;  1YX5 A;  4LD5 A;  4ENM A;  5ICG A;  4U0V A;  3I0T A;  4WWC A;  2B9S A;  4C9Y A;  1X1A A;  1Z3X A;  1WH5 A;  5GAH J;  4FTH A;  1WJC A;  4EQQ A;  2X1D A;  2KFD A;  3AFH A;  2CW0 F;  5K7F A;  3G1M A;  4RMN A;  3RQ4 A;  1HF0 A;  2K9M A;  1XSV A;  4XRF A;  1ZEL A;  5IYD J;  2L4M A;  1HW5 A;  2M3A A;  3BC8 A;  3HL2 A;  1TWA J;  2PI0 A;  3RJP A;  2VBW A;  1VZ0 A;  5BS6 A;  2O9L A;  3T0Y A;  4A3M J;  4RGS A;  2LY2 A;  4A3J J;  2IA1 A;  5JFR A;  1IC8 A;  2M5W A;  3JRA A;  5KAF C;  1S29 A;  2V1N A;  3AG3 H;  3DKW A;  3H36 A;  3ASO H;  3KLO A;  4Q48 A;  3FMR A;  2E71 A;  5E79 C;  2L5Q A;  2V9V A;  1G59 A;  1OR7 A;  2PEX A;  2E34 A;  3KCC A;  2E1N A;  4KT6 A;  3F22 A;  2VBY A;  3MZY A;  1ZAR A;  1P92 A;  1XG1 A;  3DTK A;  3V8L A;  1ONV A;  3LSH A;  4D1Q A;  2VJ5 A;  5K5Q A;  3OV8 A;  3IKV A;  2KJB A;  1V5G A;  5F6F A;  1P7J A;  4D5C A;  2IRF G;  3CJR B;  5EZG A;  4LGW A;  2QA4 I;  4BHP A;  1OYW A;  5IT3 A;  5LRS A;  3HRS A;  3H5R A;  3I53 A;  2QF7 A;  2YU9 J;  2DA5 A;  2R7O A;  4ZC3 A;  2RQP A;  2HGC A;  1RZ4 A;  3B6A A;  5E3M A;  2OZU A;  2W24 A;  2ZO4 A;  1LQ1 A;  3KZZ A;  3NEU A;  2BVM A;  4L5E A;  1XPX A;  1NK2 P;  4G94 A;  2PN6 A;  4F55 A;  2VLA A;  4LG0 B;  3E1S A;  1YIJ I;  1UG0 A;  1M1E B;  5BPI A;  4KMF A;  3Q9S A;  3GLX A;  3NAR A;  4ZYH A;  1QQI A;  2M8G X;  1K79 A;  4ZJZ A;  2ZSH B;  4NDL A;  3JRB A;  4I01 A;  2FJ1 A;  2XGC A;  1IN6 A;  2MA3 A;  4KNY A;  2X6Y A;  5CVR A;  5CVV A;  2VN2 A;  1VQ4 I;  2MLK A;  3A0B C;  3Q5F A;  2K3F A;  4G12 A;  2PJR A;  2RAE A;  1G4D A;  3BQZ A;  2PMU A;  5M3M J;  1RET A;  1FT9 A;  2L2O A;  3AAF A;  1MZB A;  2K9L A;  2TRT A;  1MGT A;  2JRT A;  2COB A;  2KRH A;  2EZL A;  1NH3 A;  3I58 A;  1V55 H;  5A2Q K;  1G3T A;  1S7A A;  2LY9 A;  1FOX A;  1ITY A;  3VDX A;  2CWE A;  1MMA A;  3N4M A;  3RKW A;  2BVL A;  2NAZ A;  1UHM A;  2Z16 A;  5IOZ A;  5J47 A;  1XSX A;  3LQQ A;  4RAF A;  2ZBK A;  3D5S C;  1AOY A;  2YX7 A;  2X9D A;  3LSG A;  1F5T A;  1LFP A;  2VQG A;  1TQP A;  3QRF F;  4JQF A;  4NUB A;  3F9K A;  2H1L A;  1E3H A;  1VTN C;  2CUZ A;  2W85 A;  4E7I A;  3TW7 A;  3L2W A;  4MIM A;  2OZ6 A;  4NNJ A;  1YI2 I;  2QSF X;  3E7L A;  3K6G A;  4RAY A;  5M5X J;  5LGN A;  4XL9 A;  4GYI A;  4AIH A;  2W84 A;  4FX0 A;  4J01 A;  4UNO A;  2ACJ A;  4IVN A;  1YRN B;  3H3Z A;  5A2Q Z;  1T2K A;  2A5W A;  2HQ5 A;  1YIO A;  2W82 A;  4HDU A;  4I2O A;  4FCY A;  1T0F C;  3TOA A;  1IXC A;  1WGX A;  2ISY A;  3CP2 A;  3PFY A;  3MD2 A;  4AD9 A;  4A69 C;  3K69 A;  1RKW A;  3OYM A;  2FD5 A;  3EUH C;  3TO9 A;  5KNL A;  1T8I A;  4F91 B;  1MMG A;  1E17 A;  1G3Y A;  1K7A A;  1TW3 A;  1IRG A;  1GV5 A;  2DFF A;  2VE9 A;  1PP8 F;  2W57 A;  1SD7 A;  3CLO A;  4L0Y B;  2EIM H;  1LDK B;  1SC7 A;  1MBH A;  3QPT A;  3FXK A;  3BOQ A;  1VF9 A;  5LGT A;  2GWR A;  4II2 A;  5F0C A;  5HLT A;  2QBY A;  3OYL A;  3E5U A;  4OIP F;  5J1Y A;  2FSW A;  3KEQ A;  1YG2 A;  3U2R A;  1V3F A;  1V5F A;  3CCY A;  1R7J A;  2XUB A;  3GXO A;  3COA C;  2A6E F;  1J0R A;  5HS7 A;  2G0E A;  3MN2 A;  1IRF A;  1ON2 A;  4AVZ A;  1R36 A;  3FMQ A;  3GZ6 A;  3GTP J;  3CUQ B;  4L5I A;  3HKZ A;  3HPH A;  4EAT A;  4CXF A;  2VBX A;  5FKN A;  2X0L A;  3HC7 A;  3R6S A;  4GO1 A;  3ZQG A;  2EBI A;  2AHQ A;  3ABU A;  5FB2 A;  3J7A O;  4Z2Y A;  4LLL A;  4ENJ A;  4IXA A;  1LVA A;  3S2D J;  3CCU I;  1MIJ A;  3CCR I;  3MZH A;  5FO5 A;  1SD4 A;  1RR8 C;  4M6Y A;  4ZDP A;  3ZXS A;  4OIR F;  4A3F J;  3ZOB A;  3L00 A;  4BJ6 C;  4F3Q A;  5C4X J;  3CZ6 A;  5D8L B;  2P5K A;  4LOC A;  1TW2 A;  1UCR A;  2VI6 A;  1QVU A;  3CP8 A;  1D0Y A;  3GWZ A;  2OTL I;  2O8X A;  1TZL A;  2HQN A;  3OYK A;  4M3D A;  4A93 J;  2EA2 A;  3I4P A;  2HOA A;  2JSC A;  3R4K A;  3LSJ A;  4RM2 A;  4B44 A;  1HC8 A;  2NVU B;  4BH9 A;  5IP6 A;  3MMY B;  4M71 A;  3OYJ A;  2PX9 A;  1ACI A;  2HDC A;  3FXO A;  1TP4 A;  5LLQ A;  1T6S A;  2XPW A;  1XB4 A;  5CPR B;  4E6K G;  3K4L A;  1Z67 A;  3IH3 A;  2A6T A;  3QP5 A;  3SQN A;  3QP6 A;  4N4O B;  3H3U A;  2LP0 A;  3H9Q A;  3ZMZ A;  3RZO J;  2IA2 A;  3SZT A;  4HEA 2;  3P9K A;  2HKO A;  3D5L A;  4WXC A;  2PFB A;  2L0K A;  4CYC A;  4XKV A;  4IRG A;  1XX5 A;  2LLK A;  3TGN A;  2CQ7 A;  2FRH A;  3OYH A;  1JI8 A;  2CQX A;  3BTC A;  2FMY A;  3OOU A;  4QWQ A;  1FNN A;  3TDZ C;  1BW5 A;  4LLG F;  4IOC F;  3VOE A;  3PSF A;  2V4J C;  2CRG A;  3BR1 A;  2KZG A;  3WE3 A;  1FMW A;  3CF2 A;  3DTE A;  3FBI B;  1AWC A;  2XF7 A;  1X58 A;  2WAQ A;  5E1W A;  4FE7 A;  3OYD A;  1VFC A;  2L9V A;  3BR0 A;  2V6E A;  5L3C A;  4XLE A;  1W0T A;  1I1G A;  1JKP C;  2VOD A;  3RI4 A;  4HBL A;  1YW8 A;  4E7H A;  3BDD A;  2JA2 A;  4HG2 A;  5E3N A;  5FLV A;  4R79 A;  2JMW A;  1WVR A;  2X4H A;  3JRI A;  2YU3 A;  4A6E A;  2M7A A;  4BHB A;  2NS8 A;  2DJN A;  1ZRD A;  2XVC A;  5M3F J;  3SFI A;  1Y1W J;  1EV7 A;  3J7A Y;  3TOB A;  1GDT A;  1I1S A;  4XKC A;  3S14 J;  1P9Q C;  4A5N A;  1JKR C;  1W36 D;  2PLY A;  2FXA A;  2BOL A;  3HUG A;  2R3S A;  1JKO C;  1WHU A;  4UV8 A;  2NS7 A;  3WU0 A;  2VT3 A;  1MMN A;  1B59 A;  4DW6 A;  4PJN A;  5C3E J;  4C30 A;  1JTX A;  2H6C A;  2QSH X;  3QQA A;  1K78 A;  2M4K A;  3F0C A;  2R7F A;  2XRN A;  4UB6 C;  2UWM A;  3KIO A;  4HST A;  4BBS J;  3AL0 C;  4PZJ A;  3HXL A;  2Q1Z B;  2IA0 A;  1P4X A;  1BR1 A;  4EJU A;  1BW6 A;  1IDY A;  1LE8 A;  4A2U A;  1Y0U A;  1XSD A;  1SMT A;  1SAU A;  1UEL B;  2QKL B;  1OYI A;  4M3E A;  4F92 B;  1B1B A;  1IN8 A;  3ISP A;  2QQ8 A;  3R60 A;  2MC4 A;  2Q2E A;  2ZC2 A;  4HX4 A;  1OFC X;  2CUE A;  1Y0N A;  2ELK A;  2WAD A;  2EIK H;  1U3E M;  4RAZ A;  1T0F A;  2G9W A;  3ULQ B;  1BBY A;  3JRF A;  4X1E A;  2P7V B;  5J6X A;  1J2X A;  5BNG A;  2NVY J;  3OIP A;  1TT0 A;  2K9S A;  5H6Q A;  3WU2 C;  5D5V B;  2LK2 A;  2MD5 A;  2VJI A;  2X1E A;  2RN7 A;  3EUH A;  5FKL A;  3A01 B;  1MNM C;  3EYY A;  5TGT A;  1O3T A;  5ILV A;  4XRS G;  2NNY A;  1YIT I;  1NK3 P;  1Z7L A;  1RIO H;  2V9P A;  2OPT A;  3ZN1 A;  4I7H A;  2BBY A;  1BC8 C;  1JGG A;  3ABK H;  3KLN A;  4ANJ A;  3OMY A;  4IPA A;  3GFI A;  3DKX A;  1P4W A;  3IAM 2;  1OLT A;  2GLO A;  2VJ4 A;  3S2H J;  1XMX A;  2Z1D A;  3SDB A;  2JVH A;  4BEH A;  3KP2 A;  3TMO A;  3K4M A;  2JK3 A;  3RTR A;  1N78 A;  2HYF A;  2O61 A;  3PM1 A;  2GOM A;  1V5E A;  2UXX A;  3V8K A;  1EH6 A;  2LY1 A;  3MCZ A;  2VXD A;  1GHC A;  2K40 A;  3TBI A;  3FXL A;  4JX5 A;  2D1H A;  4LIU A;  1A6I A;  6PAX A;  3DBH B;  2QSG X;  2R92 J;  5JHU A;  1R6R A;  3HSF A;  5AIQ A;  3EUA A;  1WH7 A;  2J5O A;  2JWT A;  5E1X A;  5TJJ A;  3I4M J;  3QPH A;  4IF4 A;  1UG2 A;  4M6X A;  4OIO F;  3I3L A;  2Y69 H;  4ESB A;  3CCE I;  1QPI A;  4BQQ A;  1XD7 A;  2PG4 A;  4RBO A;  2ZKZ A;  1U9O A;  3LSK A;  1ENH A;  4D7M A;  3LST A;  3W6J B;  4PDK A;  2HVQ A;  1KQ9 A;  4BHC A;  3HGG A;  4OU0 A;  2OAZ A;  5IP7 J;  3WGI A;  1FWZ A;  1X3Z B;  3VPR A;  2A05 A;  2KT0 A;  3I4N J;  4LJZ F;  2L3D A;  3P5J A;  1Z6R A;  1LFU P;  2HI3 A;  4GRI A;  2NVQ J;  1R1T A;  2UUZ A;  2XAJ A;  3RIR A;  4KFC A;  5DM7 F;  2CV2 A;  2DK8 A;  4CUG A;  3HB9 A;  1AA7 A;  3L2Q A;  1Q1V A;  5EEG A;  2QEX I;  3HYI A;  5CQE A;  4U0W A;  5B1B H;  4AC0 A;  1DGR M;  1N75 A;  4A0X A;  5F1R A;  1IDZ A;  1IJW C;  3BCA A;  4KIC A;  4N4N B;  3H3V K;  1JJ8 C;  1HCR A;  5BQT A;  2DA1 A;  4CCL A;  1FLI A;  2HDD A;  4XBF A;  4E7S A;  2X51 A;  1TT5 B;  4BBR J;  3A02 A;  2P4W A;  5L3G A;  1GVD A;  1TC3 C;  3H92 A;  2E1M B;  5JLX A;  3E0J B;  3FDY A;  3NQO A;  3U9G A;  2KDZ A;  1WJ5 A;  5E8G A;  3ZN0 A;  1FEX A;  4CH7 A;  4M3F A;  4O5V A;  2Q8K A;  2KDO A;  2OA4 A;  4J00 A;  5TIS C;  5EGO B;  5DUI A;  2JPC A;  2HVS A;  3SDG A;  3G73 A;  5F1J A;  1IG7 A;  2ECB A;  3OY9 A;  1CF7 A;  1JUP A;  5D8K B;  4C2U A;  1PUF A;  1DUX C;  1ZQ3 P;  1I6H J;  4B1R A;  2P8T A;  2M4G A;  3CTA A;  4R1H A;  3GCM A;  3T1B A;  3L2C A;  1R1V A;  3CDH A;  1HOM A;  1TQM A;  2L7M P;  4B48 A;  4DYQ A;  5LHG A;  5D5U B;  4N0B A;  2BW3 B;  3KEO A;  2XAQ A;  2O03 A;  1WQ2 A;  1XMK A;  4PUS A;  3HRT A;  3BTJ A;  4AYB N;  5EYR A;  1O3Q A;  3BG3 A;  1IXR C;  2KIS A;  4MFD A;  1F43 A;  2YS9 A;  3F8N A;  1KU9 A;  2HQR A;  3O8G A;  1IUY A;  3ZQC A;  3ECH A;  1KZH A;  4DYR A;  2DYR H;  3DBL B;  3VYU B;  1QBJ A;  4XM3 A;  4B8X A;  3BY6 A;  3KZY A;  3VYR B;  1EJ9 A;  3HTS B;  3CCV I;  1A31 A;  5ILU A;  5KCM A;  1F1Z A;  1SFX A;  2V7F A;  3ZQI A;  2ZXW H;  5B66 C;  2UZK A;  2GIZ A;  4G7O F;  3BLY A;  1K61 A;  2DA4 A;  3OS0 A;  1U2W A;  3FXJ A;  5FJ8 J;  3KX2 A;  1OMI A;  1B9N A;  4KDP A;  5D4R A;  2EIJ H;  2X85 A;  2DN0 A;  3RCO A;  5E18 F;  2XHK A;  1U0J A;  4FHT A;  1ON1 A;  3JR9 A;  1O57 A;  3GX4 X;  3S1Q J;  5D6F A;  5LEJ A;  2HTJ A;  3FXM A;  1WJA A;  1DGW Y;  2M30 A;  1D5Y A;  3HUG B;  2O3F A;  5LHH A;  3GTJ J;  1FOY A;  4HX7 A;  4ASN A;  3OR2 C;  1TLH B;  2WAE A;  3OL4 A;  4AM3 A;  2E2H J;  1J7K A;  1GT0 C;  4OMY A;  2PMZ A;  3WTW C;  1ETW A;  3ZQH A;  1JT6 A;  3QU3 A;  2JRM A;  4IRH A;  1R5G A;  2BV6 A;  4U88 A;  4BAY A;  3GUD A;  2LMD A;  3GTG J;  2KHM A;  4HPQ A;  2HOT A;  1C0W A;  2BGC A;  2AO9 A;  4E7L A;  1LE8 B;  5KVR A;  3I55 I;  3A03 A;  1D0X A;  5FD6 A;  3HHG A;  1LDJ A;  4LIT A;  2JUC A;  2FEZ A;  2M2E A;  3W6V A;  2CJJ A;  1YX3 A;  5J4Y A;  1MH4 A;  5K5O A;  1MBF A;  2CSO A;  2MD0 A;  4LG3 A;  4NQW A;  5HNF A;  1J5Y A;  4MEX F;  3RQI A;  3RYR A;  2HDW A;  3GFJ A;  1J09 A;  2JUG A;  1LEB A;  4V2G A;  3SEZ A;  1OCC H;  4OAY A;  1MJB A;  2ZME C;  3S93 A;  2RQQ A;  4RS8 A;  1H8A C;  1Z21 A;  2MG4 A;  4G7H F;  4MTD A;  5C44 J;  2Y31 A;  5HDG A;  3Q3S A;  2VUM J;  3QPS A;  1ZG5 A;  2ZFW A;  2XRO A;  1SFK A;  3SXY A;  4MEY F;  2FQ3 A;  2FML A;  1Y39 A;  2E2I J;  3CCJ I;  1R23 A;  5EG0 A;  2R5Y B;  3BG6 A;  3H9G A;  2NOJ B;  4RB1 A;  2H6B A;  5FRM A;  2F6C A;  1FTZ A;  4OWR B;  5H20 A;  3WTZ A;  4A12 A;  4U7D A;  3WTV C;  4BEH B;  4P96 A;  1E3O C;  2FX0 A;  2XC7 A;  1I50 J;  1TNT A;  1U6G A;  2EV6 A;  2F2E A;  4XMY A;  1ZR4 A;  2MH9 A;  2K27 A;  1POG A;  4UB8 C;  1CGP A;  1W7P A;  2JQ7 A;  2R4G A;  3PJR A;  3TP0 A;  1P6R A;  5F04 A;  3QWL A;  5CVJ A;  3S3M A;  1G8X A;  1W0U A;  2XAS A;  3TO6 A;  3LWF A;  2Z3Y A;  3O3K A;  1VQL I;  2HXO A;  3CJN A;  2NXN B;  4RGR A;  1BI3 A;  2Y0M A;  1U8B A;  2DPU A;  2UV1 A;  2DYS H;  3F8B A;  2CV1 A;  4X0G A;  2LDU A;  4LIV A;  5CJ9 A;  3ZMV A;  3I59 A;  2HNH A;  1VQ8 I;  2TDX A;  4XOT A;  4BXF A;  2OTJ I;  1A35 A;  1MDM B;  4B43 A;  1PYV A;  4E7J A;  1ORK A;  1X4P A;  4BKX A;  3OYN A;  3J80 K;  4HW0 A;  1JHH A;  2Z5U A;  5HLH A;  1BM9 A;  1D0Z A;  4G9Y A;  1OYY A;  3RKY A;  5LEK A;  5AIP A;  1XDU A;  2L7K A;  2YR2 A;  1B9M A;  2OBP A;  2AS5 F;  3FXU A;  2X48 A;  3ZCO A;  4DNC A;  3O2P E;  2LR8 A;  1QVT A;  3FXQ A;  1FBS A;  2XSJ C;  4CYD A;  1IN4 A;  2E60 A;  4A3E J;  4KN4 X;  4DBR A;  1B72 A;  4HAM A;  2DJI A;  1AHD P;  2A61 A;  2B63 J;  3LSM A;  3GW2 A;  1T33 A;  1BJZ A;  2ICW G;  2QUF A;  3VFZ A;  2W7N A;  3DBR B;  3S1R J;  2WC2 A;  1QRY A;  1ZN2 A;  4RLF A;  3LNQ A;  3FKJ A;  2CUJ A;  4XKB A;  3E6M A;  3PQK A;  3K70 C;  2EPF A;  3HRM A;  3KP6 A;  4Y17 A;  3CCL I;  1BR4 A;  1QGP A;  2OU2 A;  3ZGK A;  5K7Z A;  1XGM A;  2KQR A;  3GZN B;  3J80 Z;  2FBK A;  4BY7 J;  4G6D A;  4NC6 A;  3REO A;  1NHA A;  1DQU A;  1HKQ A;  2DA2 A;  2CGP A;  1W1W E;  2M0C A;  2RV8 A;  4CA0 A;  1EF4 A;  3L1P A;  4CHU A;  3PNY A;  3DEE A;  4HLX A;  2HFH A;  3U21 A;  3JRD A;  3G1O A;  4GCV A;  1R5I D;  4U87 A;  4C3H J;  3EUK L;  4L5J A;  3S15 J;  2RNG A;  2XGD A;  2L02 A;  3DLA A;  3OSF A;  4PFP A;  3PIP F;  3D0S A;  3E5Q A;  3MKW B;  1A04 A;  2DA6 A;  2F4I A;  4BDY A;  1ZLJ A;  2OQR A;  2QCO A;  1VQO I;  3M7G A;  2GOX B;  5FFX A;  4CCO A;  1U8R A;  1PUF B;  2Z2S B;  5L3E A;  1G6N A;  2K4J A;  3ZR8 X;  2CS3 A;  2YUS A;  3RDI A;  4BXU A;  1FOW A;  1D1C A;  3F3X A;  1S7O A;  3KEY A;  1ZGJ A;  1G3W A;  2MW8 A;  2X6W A;  3JSO A;  3CD6 I;  1ETY A;  2Z99 A;  3SFZ A;  1JTY A;  4JYK A;  1I3A A;  2HVR A;  4GYG A;  2IGM A;  4DYC A;  1JJ6 C;  2BHZ A;  1Z1D A;  1R1U A;  1FJL A;  4NBQ A;  5F64 A;  2F5F A;  1FMV A;  4QPQ A;  3JTG A;  3CCM I;  4BU2 A;  5DCM B;  3JRC A;  3IRQ A;  3DEU A;  3MKL A;  3K2A A;  3P9C A;  4LLN A;  1RPW A;  1TBX A;  1QO0 D;  2LC2 A;  3KE2 A;  5F08 A;  5IYB J;  4Q4Z F;  2L7F P;  2IP2 A;  2LSO A;  1VND A;  1U5T B;  3ZQF A;  1KA8 A;  1Q1H A;  1SMY F;  3JRG A;  2STW A;  3CO7 C;  3HOV J;  4EGZ A;  2IVM A;  5DM6 F;  3HG9 A;  2MH2 A;  4M3G A;  4DJA A;  3KZI C;  1OKR A;  2ESH A;  1X2M A;  2HR3 A;  2BY1 A;  4ZZL A;  3GFL A;  1WPK A;  2FNA A;  3AG1 H;  3S1M J;  2Y0S A;  1FYK A;  3IC7 A;  5EZH A;  2P81 A;  4KIS A;  4HOB A;  1HW2 A;  2MLG A;  4HV5 A;  4D7N A;  1RES A;  2F5C A;  4YEJ A;  5F0H A;  2HYG D;  3FBN B;  3OS2 A;  2ELJ A;  2HYJ A;  1E2X A;  4R8H A;  1F9N A;  3G6E I;  3V42 A;  4BYY A;  5ILS A;  1VQ7 I;  2EFN A;  2WB1 A;  4CO8 A;  5EF6 A;  1E0E A;  5J4V A;  1LPQ A;  1XGS A;  4ENN A;  2DTR A;  2VAS A;  3R0A A;  3NAU A;  3V7S A;  1T08 B;  4S04 A;  1T98 A;  2GAU A;  2ZME A;  3I9V 2;  5GAE J;  5E17 F;  1S3J A;  5E1Z B;  2M7B A;  4UUS A;  3SYT A;  2WA0 A;  4AIJ A;  1P2F A;  4UUT A;  1CQT A;  1WRJ A;  4BQN A;  2FOK A;  2XAF A;  1QHG A;  2QQ9 A;  2H8W A;  2XV4 S;  3BJO A;  2R7D A;  1RNL A;  3VOD A;  1YJW I;  4A3L J;  4HQM A;  3LOC A;  4Q47 A;  1ZG1 A;  1GLN A;  3OOP A;  2GBY A;  4NQW B;  3DLL F;  4MO7 A;  5CKT A;  2HEO A;  1H9T A;  1G3S A;  4EV0 A;  3JRE A;  2LFB A;  2XF6 A;  5LBQ A;  5HLI A;  3F6O A;  4LB6 B;  4BS9 A;  1TL8 A;  2DOF A;  2EV0 A;  4MTE A;  2BY0 A;  3RPU D;  1OIS A;  5E8I A;  1HXD A;  2QZ8 A;  1SVO A;  5BPD A;  3FHN A;  1IRX A;  2WY8 Q;  2IGN A;  2ZXJ A;  2K7L A;  1ZLK A;  3KYD B;  4RM3 A;  3ECO A;  2P5V A;  2R5Z A;  3R0J A;  1A36 A;  1FP1 D;  2DI3 A;  3BR6 A;  2CW8 A;  3W2A A;  2EFP A;  5JLW A;  1XC5 A;  3E3V A;  2K9Q A;  1ZG3 A;  2BZT A;  5EG0 B;  3BZ6 A;  2O7O A;  3V8J A;  1YJN I;  3PO3 J;  2HKX A;  4PJL A;  3KP7 A;  3IL2 A;  3MKZ A;  3OIQ A;  2STT A;  4IQJ A;  3QYE A;  2XGX A;  2W48 A;  2DK5 A;  4HYE A;  1SAX A;  2IXS A;  1FPQ A;  1WFX A;  4M6V A;  1YO5 C;  3VSK A;  2AQF A;  4ON0 A;  1XGN A;  1HQC A;  3HDD A;  1ZKG A;  3ESW B;  2MYS A;  2R7U A;  2JA6 J;  3U1K A;  2M8E A;  3IHU A;  3M07 A;  3S16 J;  3K4N A;  4ESF A;  3OYA A;  2R7R A;  4WF2 A;  4YEL A;  2KIF A;  4LK1 F;  4DZP A;  3C1D A;  4RGX A;  2A5Y B;  3HOX J;  4CCK A;  1ETQ A;  3X2Q H;  2EFQ A;  2W25 A;  4PJ0 C;  2Z9O A;  4XRS A;  1FYL A;  4G6Q A;  2PJP A;  3I59 B;  1FYM A;  2DOD A;  2HQA A;  2RVC A;  4ZDL A;  2R7Q A;  2Z33 A;  1NG6 A;  1MJA A;  2XF5 A;  3KP5 A;  5CVI A;  3KYL A;  1UAA A;  4FT8 A;  4UUV A;  2VOP A;  1B6A A;  5TRD A;  2KP6 A;  1L0O C;  2WWY A;  4DQ2 A;  4D5F A;  2JZY A;  2PJR B;  2IGK A;  1LUJ B;  4WX9 A;  3CO6 C;  3J81 K;  4M72 A;  2ELH A;  1JUS A;  3MVP A;  3LA7 A;  4U0Y A;  4PSX A;  1I27 A;  4L9T A;  2VB6 A;  4ESJ A;  2KIM A;  2FF4 A;  5K5R A;  1FIA A;  4IO9 F;  1ZAO A;  4QTR A;  4H4K C;  2I8D A;  3K2Z A;  2VL8 A;  5J8C A;  3B02 A;  5HLG A;  3CUQ C;  2QYO A;  2FE3 A;  3I54 A;  1LNW A;  2DO7 A;  1LJ9 A;  3TQN A;  3GTO J;  3RZD J;  1RKT A;  2FA5 A;  2WV0 A;  5GPA A;  3RPQ A;  1WJD A;  4KIT B;  3WTS C;  3J81 Z;  1FIP A;  3ERE D;  1DP7 P;  4XLC A;  3F8F A;  1GV2 A;  1KU3 A;  1Y8Q B;  3DFG A;  4W97 A;  2QQA A;  2V1X A;  1T39 A;  2LNB A;  4XOR A;  3S2W A;  4H0E A;  2Y2Z A;  2FBI A;  3C2G A;  3BQY A;  4WXH A;  2LKX A;  3CF5 F;  3M4O J;  2Y75 A;  3DWL E;  1ZH5 A;  3W2V A;  2DFE A;  2RKH A;  2GA1 A;  1Z3Y A;  2DOA A;  3H0D A;  1YLF A;  2BEO A;  2HPM A;  2QKM B;  4P9U A;  2XRL A;  3HOY J;  2R7X A;  1SD6 A;  3IH2 A;  2L9S A;  1T38 A;  1DU0 A;  4JX6 A;  1ZRF A;  3QOE A;  2DA3 A;  2IJL A;  2RRE A;  1ZGA A;  3FM3 A;  2RC4 A;  2V9K A;  4JOM A;  3GTM J;  1JKQ C;  4DOZ A;  2CQQ A;  3MQ0 A;  3B6C A;  1TTY A;  2NOG A;  2CUF A;  4Y33 A;  3UR3 C;  4F7Z A;  4A0Y A;  1GUU A;  4IOA F;  5DDG A;  3EDP A;  1D3Y A;  3GFM A;  2P6S A;  2KJC A;  2QBY B;  2R7W A;  2EZK A;  3GLL A;  1Z77 A;  2R93 J;  3Q0V A;  3HOT A;  2NVT J;  3PSI A;  4FIS A;  1QHH D;  4I0A A;  1IW7 F;  2GQQ A;  1YW7 A;  3GVA A;  3JCU C;  3WTX C;  1OCO H;  1BI2 A;  3PNT A;  3Q0U A;  2GA2 A;  2EZH A;  3F8C A;  2BY2 A;  1WSU A;  3BJA A;  2A69 F;  1W7P D;  2ZJ2 A;  4C2M J;  3ZQL A;  2RNJ A;  1WCM J;  2HS5 A;  1MSE C;  2KKO A;  5J3L A;  9ANT A;  1K4S A;  1U9N A;  3Q0W A;  4HSR A;  1VQ5 I;  4C3J J;  4HLY A;  2OV7 A;  1OCT C;  4ENK A;  2JA8 J;  3BR5 A;  5IOY A;  1ETV A;  3FKI J;  4LFU A;  4NC7 A;  5M5Y J;  1OR7 C;  1O3S A;  4XSZ F;  5BOX A;  2F5D A;  5LFA A;  4O3M A;  4CDG A;  1IZ1 A;  2DXI A;  2ZSI B;  5H6R A;  2L54 A;  2ZXI A;  1APL C;  1S9H A;  2H94 A;  1D8K A;  4JX4 A;  5JHF A;  3TED A;  3DPU A;  3V7C A;  2HZD A;  4M73 A;  2OUM A;  4PFO A;  1I5Z A;  2IW5 A;  3K7A J;  1T95 A;  4UUS B;  2DDA A;  3G71 I;  5EEH A;  4EJT A;  2ID3 A;  4BDZ A;  3G2B A;  1GVJ A;  1X3U A;  1WI3 A;  2OJE D;  4ABZ A;  1W5T A;  2YX4 A;  3RPU A;  3VSL A;  5DS9 A;  3WGH A;  4P9F A;  3OWT A;  3FK6 A;  2XB5 A;  5D4S A;  5FRO A;  1YS6 A;  3W2W A;  1XMA A;  3NWS A;  3ONQ A;  4F93 B;  1IAW A;  1FSH A;  3IWF A;  1P4A A;  1SVM A;  3VEP A;  1QU3 A;  3K9T A;  1TWF J;  2A6H F;  4M9X A;  3IAS 2;  2PBI A;  5K7H A;  1X19 A;  3M8F A;  4HNV A;  3LL7 A;  3K1N A;  4B3A A;  2LH9 A;  3QOP A;  1RUN A;  4WXD A;  2CO5 A;  1TWG J;  2ZFU A;  4BQO A;  3FMS A;  1FBQ A;  2DCE A;  2N8G A;  4CYC B;  3DKY A;  3O8H A;  3ZQQ A;  2XPV A;  1JXS A;  3F23 A;  3L2V A;  3HKZ N;  4GFB A;  3PUB A;  5FKO A;  2MSY A;  4HRI A;  2VQH A;  4L9J A;  2LG4 A;  2RGV A;  3BG5 A;  3CC4 I;  2HOE A;  2WBM A;  2JN6 A;  4YII A;  1VQM I;  1JT0 A;  3T5X A;  1BC7 C;  3K10 A;  3ZP5 A;  3HJE A;  3TP3 A;  1YRN A;  1EA3 A;  2V1D A;  5IY5 H;  3UKG A;  1TNS A;  1K6Y A;  3CMM A;  1FSE A;  5FFZ A;  4EM2 A;  1QA6 A;  1MJ9 A;  3BZC A;  3BTI A;  1HSJ A;  3HEF A;  3VYS B;  2VIX A;  1LDD A;  1UB9 A;  3CQZ J;  1MBK A;  3JSP A;  4Y13 A;  1PUE E;  5JR3 A;  3BRO A;  2MBF A;  4N9I A;  3BCB A;  2WB1 N;  4BJT A;  4CCJ A;  1YYV A;  3HHH A;  3BG7 A;  2ZJQ F;  5E3O A;  3DXJ F;  2VPR A;  5E20 A;  1W4M A;  3HGY A;  1Z9C A;  3V4G A;  3LSR A;  1T56 A;  3OS1 A;  2E19 A;  4A3D J;  2LRE A;  2WV1 A;  2HOS A;  3VWB A;  4HF1 A;  5J8F A;  5E3L A;  2XAU A;  1IV8 A;  1IRZ A;  4RDU A;  3F8M A;  2JA7 J;  3S8P A;  3ZMS A;  3CMA I;  3E97 A;  1KU2 A;  2XGE A;  2DBB A;  1MNE A;  2FOW A;  3CUQ A;  2E1C A;  3ABM H;  1IO2 A;  1ZHF A;  2D2W A;  1BIA A;  2OCE A;  1K78 B;  2Y30 A;  2OQG A;  1VQN I;  2VC0 A;  3I64 A;  4AWX B;  3I71 A;  1X1D A;  2Y9Z A;  4CZZ A;  2W4S A;  3HRU A;  3H0G J;  4PGH A;  1R00 A;  2IGO A;  3BPX A;  3I5U A;  1KYZ A;  1N77 A;  2O6G E;  3DEW A;  3OL3 A;  2EWN A;  4Y52 J;  1BI0 A;  3OYE A;  2CFX A;  2QLZ A;  3ABL H;  4KIG A;  5HS8 A;  4ZYD A;  2KRC A;  2LTP A;  2C6Y A;  4CZC A;  3WE2 A;  3FIW A;  1ZRE A;  2Q2E B;  5IP9 J;  3MKY B;  2KPM A;  5ICF A;  5FLX K;  2G7U A;  1WI9 A;  4EM0 B;  4MNU A;  1S72 I;  1RUO A;  4PJJ A;  5K1Y A;  4WK8 F;  4E7K A;  4BUP A;  4KIB A;  1H9G A;  1Y8R B;  4G6T B;  4HQE A;  4KUM A;  1XS9 A;  1EH7 A;  1HST A;  5LRR A;  1QPM A;  1RC9 A;  3LSI A;  2XAH A;  3F72 A;  1OCZ H;  3IH4 A;  3M3Y J;  3HZJ A;  1J59 A;  2WAQ N;  4RB2 C;  2F5E A;  5L3D A;  2DQR A;  5FRN A;  2H09 A;  2P5L C;  4K2E A;  2IBD A;  1SD5 A;  4MHG A;  3CDL A;  4DBQ A;  1JE8 A;  1Y56 A;  2IS4 A;  4HV6 A;  1IF1 A;  3BWG A;  5GTH C;  2GXG A;  4XR6 A;  1KON A;  3L7W A;  2B0L A;  2G7H A;  5DD8 A;  1EKE A;  2NS0 A;  3CDI A;  1GXQ A;  3GTK J;  4UVB A;  5LD2 C;  3RKQ A;  4BQA A;  5FLX Z;  5GTI C;  1IN7 A;  1BN5 A;  4XLA A;  3N05 A;  4IHX A;  4XQF A;  4I02 A;  1I39 A;  3L9F A;  5JVT A;  3CJQ B;  1R5H A;  5DD4 A;  3MAJ A;  2FNP A;  2IAI A;  2DU9 A;  3P7N A;  1LVK A;  1SAN A;  2E1M C;  1B8I A;  2IS1 A;  3C2H A;  1B4A A;  1FC3 A;  1DPR A;  3H1C A;  2R7V A;  4EJW A;  4QSH A;  2P6T A;  2DQL A;  2M87 A;  3CCS I;  3KPH A;  3ZMU A;  5GAG J;  2DA7 A;  3AG4 H;  2JPB A;  5DCF A;  3L2U A;  3LAP A;  1ETO A;  4IKF A;  1QZY A;  1YS7 A;  3DCF A;  3GME A;  2VE8 A;  3R61 A;  5EJC A;  3CME I;  4S05 A;  4KT5 C;  1NG7 A;  2FBH A;  2E2J J;  3FXR A;  2VQC A;  5ICC A;  5HOO A;  3LSP A;  3RKX A;  2A3S A;  1S5L C;  3FIS A;  3LA3 A;  1A6Q A;  2EFW A;  1MD0 A;  2CU7 A;  4FE4 A;  1D5V A;  4CCN A;  1YHQ I;  2COM A;  5DYM A;  2E35 A;  1N25 A;  1W5S A;  1VQ6 I;  1KQ0 A;  4AU7 A;  4BE1 A;  5JVG F;  4ZH4 F;  1PJR A;  2D1V A;  5GPC A;  4V19 K;  4NC8 A;  3FK7 A;  1IGN A;  4A3K J;  5D5X B;  3K70 D;  3N97 A;  1X1B A;  1K83 J;  2E7W A;  5F27 A;  3Q9V A;  3A0H C;  1STZ A;  5IYC J;  1Z0X A;  4EJO A;  5KHD A;  4L9V A;  4XKW A;  4Y15 A;  4LB5 A;  2VKV A;  2BXZ A;  2K85 A;  3C7J A;  4S0H B;  5L3B A;  2MGQ A;  4FAS D;  4CSW A;  3OSG A;  1UFM A;  4EVI A;  3PNV A;  4MGR A;  1LB2 A;  3M9A A;  4QPO A;  4M74 A;  2DMU A;  3LQR A;  1HKT A;  2E5N A;  4WCG A;  3PFI A;  2HWV A;  1A5J A;  1HW1 A;  1F36 A;  1PDN C;  2FQ4 A;  1IUF A;  2EFO A;  1S7E A;  1YE9 A;  4BXX J;  3A1Y A;  2EJR A;  2LOO A;  2ZJP F;  2A68 F;  1USS A;  2WAF A;  1LKX A;  2LF7 A;  2DMN A;  3K0L A;  1H88 C;  1BA5 A;  2MC3 A;  5L3F A;  1Z7U A;  2VPL A;  1CF7 B;  5FKM A;  2LRD A;  2CG4 A;  3DF8 A;  1BIB A;  5D6E A;  2ZJR F;  1D1B A;  5C4J J;  2JT1 A;  2IS2 A;  2BE5 F;  2VON A;  4HZF A;  4RLQ A;  5F0F A;  3UNG C;  4F52 A;  5H2F C;  4ZDO A;  1Z91 A;  3J7Y J;  3HBL A;  2GM4 A;  1FBU A;  4IEJ A;  1RR7 A;  1L3L A;  5LGU A;  3A01 A;  1VQK I;  2QQB A;  2E36 A;  1MBG A;  2ZNZ A;  3S3N A;  3OYC A;  1WZ2 A;  4MQ9 F;  4EEF G;  1J9I A;  4NHJ A;  3CC7 I;  2JJ7 A;  3U1D A;  3DTI A;  3FZV A;  1MW7 A;  3VB2 A;  4AUX A;  2V6C A;  2DPD A;  4XLP F;  1NTC A;  4XN0 A;  2Y9Y A;  3PIO F;  4M9S A;  3IRR A;  2KZV A;  4XON A;  2BY3 A;  1Y1V J;  1FP2 A;  2DMT A;  3K1P A;  1YJ9 I;  4C3I J;  3TW6 A;  2M1B A;  1R71 A;  3HOZ J;  3L2R A;  3K1M A;  3AL0 B;  4X6A J;  1KU7 A;  4L18 B;  2WY7 Q;  2BXY A;  3CES A;  2V79 A;  1WJE A;  3W3C A;  3OYI A;  1FOK A;  3QU6 A;  2QGU A;  4UVA A;  3SZP A;  3BT9 A;  3IKT A;  1P7I A;  2CYY A;  3GO5 A;  4CIC A;  4EGY A;  2CFO A;  3K4J A;  1PP7 U;  2LBF A;  3OR1 C;  3SZG A;  3DQV C;  2X6O A;  2K4B A;  4YIF A;  1AKH A;  2KIU A;  2ISZ A;  2OC6 A;  2EZI A;  4I0B A;  5GP9 A;  1D8J A;  3C2B A;  2WTE A;  3GEZ A;  2ZXH A;  2ZCW A;  3L09 A;  2ETH A;  2EQR A;  2K86 A;  4AYB A;  4E7Z A;  2AXT C;  2D5V A;  3I56 I;  2IT0 A;  3E5X A;  3SHF A;  5IT9 K;  1H0M A;  2VT2 A;  4MFE A;  3CMY A;  4DIQ A;  5JI6 A;  2K3P A;  2NYX A;  2DOE A;  1O7L A;  4BE2 A;  3WGG A;  1SEU A;  4UVC A;  2D45 A;  1FTT A;  4HNU A;  2TCT A;  3NWT A;  4I76 A;  3DPT A;  3WG9 A;  4J19 A;  3A4C A;  1OJL A;  5CLS A;  2GZW A;  4XLH A;  2Y48 A;  1UMQ A;  2CV0 A;  1SVL A;  4FQG A;  4HA8 A;  1WJB A;  2L9N A;  2H1K A;  2OD5 A;  3BR3 A;  2OCC H;  1TWC J;  2XIG A;  1TQI A;  1OQY A;  2EV5 A;  4HX8 A;  3QAH A;  4KIF A;  1X1C A;  3JRH A;  1BI1 A;  1IXS B;  3QOD A;  2QEN A;  5IT9 Z;  2QWW A;  5M5W J;  3KP3 A;  4IJA A;  2XPU A;  2ME0 A;  4PJM A;  3QYF A;  2BYV E;  1GXP A;  3CJT B;  1XN7 A;  4UHT A;  1OCP A;  1YTY A;  4YFK F;  1X3W B;  3BZK A;  1SFO J;  2L7Z A;  2DT7 B;  5EGO A;  2EIL H;  1J75 A;  3LFK A;  2DW4 A;  5GAD J;  4IHV A;  5FKK A;  4KMU X;  2XAG A;  2HXI A;  5FGM A;  3IP4 B;  1V4R A;  4TV7 A;  4MQV A;  4GDF A;  3ML6 A;  3CCQ I;  2JSP A;  4AVP A;  2CW7 A;  4MLO A;  5J1U A;  1Y6I A;  3D5R C;  3E6B A;  1MKM A;  2DTZ A;  3HIF A;  4W1U A;  4ZTF A;  3OIO A;  5ERI A;  4DZJ A;  4IQ4 A;  4L9N A;  3M1E A;  1HDD C;  3EET A;  4FET A;  4IL6 C;  1FZP B;  1B8I B;  1ZTR A;  2PMZ N;  3HSE A;  4N9H A;  3ZMD A;  2BW3 A;  1YW9 A;  3JW4 A;  3MZ8 A;  3QYB A;  1W7P B;  3RYP A;  4ETS A;  1ETX A;  4XOP A;  3BG9 A;  1KQ8 A;  1MBE A;  5BMZ A;  4JBA A;  1VI0 A;  4BAC A;  2AQE A;  4BNC A;  3OYF A;  2VKH A;  5FLM J;  1R22 A;  4XSX F;  1FX7 A;  3IWZ A;  3SEQ A;  2VKD A;  3WHB A;  3K4C A;  1QNT A;  4ITV A;  4Y7N J;  3F21 A;  4HF2 A;  3LFU A;  2DT5 A;  2KLO A;  1S6L A;  4E70 A;  1O4X A;  3LMM A;  4XNF A;  2HPI A;  3G1L A;  4A0Z A;  4BL0 B;  1QZE A;  1QZZ A;  2DMP A;  3GTQ J;  3E6C C;  3HOW J;  2F48 A;  5HOD A;  2KRF A;  3J7Z I;  4PK4 A;  4RGU A;  3MEX A;  5DUK A;  4ZZD A;  2KL4 A;  2XB0 X;  2DLL A;  1D1A A;  4RA2 A;  5HVQ C;  4I09 A;  1B72 B;  2CH0 A;  1LEA A;  3SJM A;  5J40 A;  2CQK A;  4IHW A;  2O5R A;  5J1R A;  4I99 C;  1MSF C;  2F4M B;  3LAJ A;  4EMS A;  4KJZ A;  4OOI A;  4ZYG A;  3M1C A;  1U5T C;  2EH3 A;  4B47 A;  1W36 C;  1Z6T A;  2B7E A;  1YOV B;  1XCV A;  1W5C C;  1UHW A;  3C3W A;  1YQA A;  2QM3 A;  3V7R A;  2PMH A;  3OYG A;  3PL8 A;  3GBG A;  3AKZ A;  2IPQ X;  2VJJ A;  4KN7 X;  3S3O A;  2P7C B;  4KYW A;  3KP4 A;  2HTS A;  2VC1 A;  1OCR H;  3WHC A;  3M8E A;  2VXZ A;  1Z05 A;  4RB3 C;  4AIK A;  3IUO A;  3HOU J;  1KYW A;  3TL4 X;  4A3C J;  2FUG 2;  4A5M A;  1ZRC A;  3KFW X;  2H27 A;  2W00 A;  1MH3 A;  1HLV A;  5DTD A;  3WTT C;  2UXN A;  1BOA A;  2ADU A;  2LKP A;  3F6V A;  4OAZ A;  3B73 A;  4IHS A;  2FU4 A;  3IV5 A;  4U7B A;  2ZNY A;  1HA8 A;  2LKS A;  2R7Z J;  2NNN A;  1RRJ A;  1ZK8 A;  2QVO A;  4I98 B;  1XCB A;  2M0M A;  3KYC B;  4BY1 J;  3FF5 A;  4KA4 A;  2DT6 A;  1O3R A;  2Q0O A;  3ELK A;  1G2H A;  4Q5S F;  2KMU A;  1HDP A;  2OF7 A;  1WKM A;  1X1P A;  3HTU A;  4YRV A;  2R5Y A;  4ZYA A;  3MWM A;  4GGG A;  3ABT A;  4OIN F;  5KAI C;  2DDB A;  4YIR X;  2VBZ A;  4JK1 X;  4M3B A;  2K5C A;  3C18 A;  1E3P A;  3EYI A;  4PCQ A;  3TKY A;  2GXB A;  1ETK A;  3A2K A;  1LFB A;  3BP8 A;  3WU1 B;  4AID A;  2EK5 A;  1MBJ A;  3P9I A;  2EIN H;  3O6B B;  3BR2 A;  4V2F A;  4D0P A;  3FM5 A;  3GTL J;  4UXN A;  2VOO A;  1MND A;  3T8R A;  4A3I J;  1IV6 A;  2LYC A;  2F5V A;  2M9H A;  1UHS A;  2VKE A;  4BE0 A;  4C2T A;  3HPG A;  2IS6 A;  4RAG A;  4UV9 A;  4OIQ F;  3GF2 A;  2I5U A;  4XLF A;  1F4K A;  3G3Z A;  3QPL A;  2DMQ A;  2LBF B;  1BJA A;  1AKH B;  5DV5 A;  2LD5 A;  4DGW B;  4PGG A;  1I3Q J;  4LG0 A;  1DPU A;  4QIW N;  1MDM A;  4BGD A;  5FD5 A;  3PO2 J;  1WJF A;  5AON A;  1HBX G;  4D9J A;  2MAB A;  3NRV A;  2L4A A;  2O0Y A;  2ZME B;  4XLN F;  1R4M B;  2AXL A;  3PQJ A;  3RSN A;  2NRA C;  4G7Z F;  3G4S I;  1UZC A;  4UY8 I;  3HM5 A;  3M8J A;  2ECC A;  1TWH J;  4P1W A;  2R0Q C;  5HDN A;  4I6Z A;  1BL0 A;  4ZYE A;  1SFE A;  3CUO A;  2ESN A;  4Y4R A;  4CGZ A;  1V54 H;  3H9J A;  2K02 A;  1JGS A;  4Y3O A;  2ME6 A;  4P55 A;  2R7S A;  1EH8 A;  1X2N A;  3DU5 A;  1DDN A;  2M34 A;  5KK1 A;  2XDV A;  4HNT A;  2DFH A;  5LHI A;  3ZQ7 A;  2HU9 A;  1VQP I;  2F4O B;  2R7T A;  5HS9 A;  1PVE A;  1UST A;  2GXA A;  2K9N A;  5EDN A;  3DU6 A;  4Z6Y A;  1OPC A;  3FWE A;  4JP0 A;  3HOS A;  2R5Z B;  2M45 A;  2X6X A;  4BJ5 C;  3PUF A;  2JVG A;  3CC2 I;  2PQ8 A;  1YFH A;  1O7F A;  4XID A;  3WTU C;  3ZPL A;  2X1C A;  1JHF A;  3K4K A;  1IN5 A;  1MMD A;  2EA4 A;  4XN3 A;  1R4N B;  2Y0S N;  2RDP A;  4IX7 A;  3H5A A;  1R58 A;  1HKS A;  2GIV A;  1ZR2 A;  5HNH A;  3TDU C;  5EEA A;  1XGO A;  1U78 A;  2BHY A;  1UJ8 A;  3ZRG A;  2JA5 J;  3VYT B;  2P0W A;  4HDV A;  5B1A H;  4ZTJ A;  4CCM A;  1WWX A;  3S32 A;  3H5N A;  3ZMT A;  4QLC U;  2E7X A;  1ZGW A;  2HZT A;  3H35 A;  3K4B A;  3EQL F;  2DFI A;  2XKP A;  4M9Z A;  4B09 A;  1H89 C;  3ERM A;  2LVS A; 
#chains in the Genus database with same CATH homology
 3WOD F;  5ED4 A;  2LF8 A;  3E6D A;  4NB5 A;  4A6D A;  4YFX F;  2A07 F;  1FY7 A;  5DCM A;  5D5W B;  4LK0 F;  3FHZ A;  4IHT A;  4YG2 F;  1RI7 A;  4GXO A;  4G8X A;  4HF0 A;  3JTH A;  5CVU A;  1U5T A;  3GZ5 A;  4EJV A;  3ROU A;  2YPR A;  1ODD A;  1I6X A;  5ICE A;  2EB7 A;  3JAM K;  3KET A;  4O6J A;  2XKO A;  1K6O A;  1ZYR F;  3W6K B;  3LA2 A;  2V1U A;  3WTY C;  2JTV A;  3BPV A;  3GYH X;  1ULY A;  4P5O A;  4L0Z B;  3DV8 A;  4FX4 A;  1REP C;  5DEQ A;  1SFU A;  3DP7 A;  4LMY A;  1XDS A;  4EM1 A;  3MFK A;  3HSR A;  2DAO A;  3T8T A;  2J5P A;  5HDK A;  3DPL C;  4OMZ A;  3TO7 A;  3FX3 A;  3JAM Z;  1S8N A;  4YFN F;  2YSR A;  1KGS A;  2L01 A;  4RB0 A;  3BJ6 A;  4IRI A;  5CYV A;  4LD5 A;  4ENM A;  5ICG A;  4U0V A;  3I0T A;  4WWC A;  4EQQ A;  2CW0 F;  1XSV A;  4XRF A;  2L4M A;  1HW5 A;  2PI0 A;  3RJP A;  2VBW A;  5BS6 A;  3T0Y A;  4RGS A;  2IA1 A;  5JFR A;  2M5W A;  1S29 A;  3DKW A;  3KLO A;  4Q48 A;  3FMR A;  2V9V A;  1OR7 A;  2PEX A;  3KCC A;  2E1N A;  3F22 A;  2VBY A;  3MZY A;  1ZAR A;  1P92 A;  3V8L A;  1ONV A;  5K5Q A;  3OV8 A;  3IKV A;  2KJB A;  5F6F A;  2IRF G;  4LGW A;  4BHP A;  1OYW A;  5IT3 A;  5LRS A;  3HRS A;  3I53 A;  2RQP A;  2HGC A;  1RZ4 A;  2OZU A;  2W24 A;  2ZO4 A;  1LQ1 A;  3KZZ A;  3NEU A;  4G94 A;  2PN6 A;  4LG0 B;  5BPI A;  4KMF A;  3Q9S A;  3GLX A;  4ZYH A;  1QQI A;  1K79 A;  4I01 A;  1IN6 A;  2MA3 A;  4KNY A;  5CVR A;  5CVV A;  2VN2 A;  2MLK A;  3Q5F A;  1G4D A;  2PMU A;  1FT9 A;  3AAF A;  1MZB A;  1MGT A;  2JRT A;  3I58 A;  5A2Q K;  1G3T A;  1S7A A;  2CWE A;  3N4M A;  3RKW A;  2NAZ A;  1UHM A;  1XSX A;  3LQQ A;  2ZBK A;  1AOY A;  2YX7 A;  1F5T A;  1TQP A;  3QRF F;  4JQF A;  1VTN C;  2W85 A;  2OZ6 A;  4RAY A;  5LGN A;  4GYI A;  4AIH A;  2W84 A;  4FX0 A;  4UNO A;  2ACJ A;  4IVN A;  3H3Z A;  5A2Q Z;  1T2K A;  4HDU A;  1YIO A;  4I2O A;  3TOA A;  1IXC A;  2ISY A;  4AD9 A;  3K69 A;  3TO9 A;  1E17 A;  1G3Y A;  1K7A A;  1TW3 A;  1IRG A;  2VE9 A;  1PP8 F;  2W57 A;  1SD7 A;  3CLO A;  4L0Y B;  1LDK B;  3QPT A;  3BOQ A;  5LGT A;  2GWR A;  2QBY A;  3E5U A;  4OIP F;  2FSW A;  3KEQ A;  1YG2 A;  3U2R A;  1V3F A;  1R7J A;  2XUB A;  3GXO A;  3COA C;  2A6E F;  1J0R A;  5HS7 A;  1IRF A;  1ON2 A;  3GZ6 A;  1R36 A;  3FMQ A;  3CUQ B;  4L5I A;  4CXF A;  2VBX A;  2X0L A;  3R6S A;  4GO1 A;  3ABU A;  5FB2 A;  3J7A O;  4Z2Y A;  4LLL A;  4ENJ A;  1LVA A;  3MZH A;  5FO5 A;  1SD4 A;  4M6Y A;  4OIR F;  3L00 A;  5D8L B;  2P5K A;  1TW2 A;  1UCR A;  3GWZ A;  2O8X A;  2HQN A;  2EA2 A;  3I4P A;  2JSC A;  3R4K A;  4BH9 A;  4M71 A;  2HDC A;  5LLQ A;  1T6S A;  1XB4 A;  3QP5 A;  3SQN A;  3QP6 A;  3H3U A;  3ZMZ A;  2IA2 A;  3SZT A;  3P9K A;  2HKO A;  3D5L A;  4WXC A;  2PFB A;  4IRG A;  3TGN A;  2FRH A;  2FMY A;  4QWQ A;  1FNN A;  3TDZ C;  4LLG F;  3VOE A;  3WE3 A;  1AWC A;  5E1W A;  5L3C A;  1I1G A;  2VOD A;  3RI4 A;  4HBL A;  1YW8 A;  3BDD A;  4R79 A;  2X4H A;  2YU3 A;  4A6E A;  4BHB A;  1ZRD A;  2XVC A;  1EV7 A;  3TOB A;  1I1S A;  4A5N A;  2PLY A;  2FXA A;  3HUG A;  2R3S A;  4UV8 A;  3WU0 A;  2VT3 A;  1B59 A;  2H6C A;  1K78 A;  2R7F A;  2XRN A;  2UWM A;  4PZJ A;  2IA0 A;  1P4X A;  4EJU A;  4A2U A;  1Y0U A;  1XSD A;  1SMT A;  1OYI A;  1B1B A;  1IN8 A;  3ISP A;  3R60 A;  2Q2E A;  4HX4 A;  1U3E M;  4RAZ A;  1T0F A;  2G9W A;  3ULQ B;  1BBY A;  2P7V B;  5J6X A;  1J2X A;  5H6Q A;  5D5V B;  2MD5 A;  3EUH A;  2RN7 A;  3EYY A;  1O3T A;  5ILV A;  2NNY A;  1RIO H;  3ZN1 A;  4I7H A;  2BBY A;  1BC8 C;  3KLN A;  4IPA A;  3GFI A;  1P4W A;  3KP2 A;  3RTR A;  2HYF A;  2O61 A;  2UXX A;  3V8K A;  1EH6 A;  3MCZ A;  1GHC A;  2D1H A;  6PAX A;  5JHU A;  3HSF A;  5AIQ A;  2J5O A;  5E1X A;  5TJJ A;  3QPH A;  4IF4 A;  4M6X A;  4OIO F;  4ESB A;  1XD7 A;  2PG4 A;  2ZKZ A;  3LST A;  3W6J B;  4PDK A;  1KQ9 A;  4BHC A;  4OU0 A;  2OAZ A;  3WGI A;  1FWZ A;  4LJZ F;  2L3D A;  1Z6R A;  1R1T A;  2XAJ A;  3RIR A;  4KFC A;  2DK8 A;  5EEG A;  3HYI A;  4U0W A;  4A0X A;  5F1R A;  4KIC A;  5BQT A;  1FLI A;  4XBF A;  2P4W A;  5L3G A;  3H92 A;  3U9G A;  3NQO A;  5E8G A;  3ZN0 A;  4O5V A;  2Q8K A;  2OA4 A;  5DUI A;  2JPC A;  3G73 A;  1CF7 A;  5D8K B;  1DUX C;  2P8T A;  3CTA A;  4R1H A;  3L2C A;  3T1B A;  1R1V A;  3CDH A;  1TQM A;  5LHG A;  5D5U B;  4N0B A;  3KEO A;  2XAQ A;  2O03 A;  1WQ2 A;  1XMK A;  3HRT A;  1O3Q A;  1IXR C;  3F8N A;  1KU9 A;  2HQR A;  1IUY A;  3ECH A;  1QBJ A;  4B8X A;  3BY6 A;  3KZY A;  3HTS B;  5ILU A;  1F1Z A;  1SFX A;  2UZK A;  4G7O F;  1U2W A;  1OMI A;  1B9N A;  4KDP A;  5D4R A;  5E18 F;  2XHK A;  4FHT A;  1ON1 A;  1O57 A;  3GX4 X;  5D6F A;  5LEJ A;  2HTJ A;  2M30 A;  2O3F A;  5LHH A;  4HX7 A;  4ASN A;  1TLH B;  1J7K A;  4OMY A;  3WTW C;  3QU3 A;  4IRH A;  1R5G A;  2BV6 A;  4U88 A;  4BAY A;  3GUD A;  1C0W A;  2BGC A;  5KVR A;  5FD6 A;  3HHG A;  1LDJ A;  2FEZ A;  5K5O A;  2CSO A;  4NQW A;  1J5Y A;  4MEX F;  3RYR A;  3GFJ A;  1LEB A;  1MJB A;  4RS8 A;  4G7H F;  4MTD A;  5HDG A;  1ZG5 A;  2ZFW A;  2XRO A;  3SXY A;  4MEY F;  2FQ3 A;  2FML A;  1R23 A;  4RB1 A;  2H6B A;  5H20 A;  4A12 A;  3WTZ A;  4U7D A;  3WTV C;  4P96 A;  1TNT A;  1U6G A;  2EV6 A;  2F2E A;  2MH9 A;  2K27 A;  1CGP A;  1W7P A;  1P6R A;  5CVJ A;  2XAS A;  3TO6 A;  3LWF A;  2Z3Y A;  3O3K A;  3CJN A;  4RGR A;  1BI3 A;  2Y0M A;  2DPU A;  3F8B A;  2LDU A;  3ZMV A;  5CJ9 A;  3I59 A;  2TDX A;  1MDM B;  3J80 K;  4HW0 A;  1JHH A;  2Z5U A;  5HLH A;  1BM9 A;  4G9Y A;  5LEK A;  1OYY A;  3RKY A;  5AIP A;  1XDU A;  2YR2 A;  1B9M A;  2OBP A;  2AS5 F;  3FXU A;  4DNC A;  3O2P E;  3FXQ A;  1FBS A;  4CYD A;  1IN4 A;  4KN4 X;  4HAM A;  2A61 A;  3GW2 A;  2QUF A;  3VFZ A;  2WC2 A;  1ZN2 A;  3E6M A;  3PQK A;  3HRM A;  3KP6 A;  4Y17 A;  1QGP A;  2OU2 A;  1XGM A;  3J80 Z;  2FBK A;  4G6D A;  3REO A;  1NHA A;  1HKQ A;  2CGP A;  2RV8 A;  4CHU A;  4HLX A;  2HFH A;  4GCV A;  4L5J A;  2L02 A;  3D0S A;  3E5Q A;  1A04 A;  1ZLJ A;  2OQR A;  3M7G A;  5FFX A;  1U8R A;  5L3E A;  1G6N A;  2K4J A;  3RDI A;  4BXU A;  3F3X A;  1S7O A;  1ZGJ A;  1G3W A;  3JSO A;  2Z99 A;  3SFZ A;  4GYG A;  1Z1D A;  1R1U A;  5F64 A;  2F5F A;  3JTG A;  5DCM B;  3IRQ A;  3DEU A;  3P9C A;  4LLN A;  1TBX A;  1QO0 D;  3KE2 A;  4Q4Z F;  2IP2 A;  2LSO A;  1U5T B;  1KA8 A;  1Q1H A;  1SMY F;  2STW A;  3CO7 C;  4EGZ A;  2IVM A;  2MH2 A;  1OKR A;  2ESH A;  2HR3 A;  4ZZL A;  3GFL A;  2FNA A;  1FYK A;  3IC7 A;  4HOB A;  1HW2 A;  2MLG A;  4HV5 A;  2F5C A;  2HYG D;  1E2X A;  4R8H A;  1F9N A;  4BYY A;  5ILS A;  2EFN A;  4CO8 A;  1XGS A;  4ENN A;  2DTR A;  3R0A A;  3V7S A;  4S04 A;  1T98 A;  2GAU A;  2ZME A;  5E17 F;  1S3J A;  5E1Z B;  4AIJ A;  1P2F A;  1WRJ A;  2FOK A;  2XAF A;  2QQ9 A;  2XV4 S;  3BJO A;  2R7D A;  1RNL A;  3VOD A;  4HQM A;  4Q47 A;  1ZG1 A;  3OOP A;  2HEO A;  1H9T A;  1G3S A;  4EV0 A;  5LBQ A;  5HLI A;  3F6O A;  4LB6 B;  2EV0 A;  4MTE A;  5E8I A;  5BPD A;  1HXD A;  2QZ8 A;  1KQ8 A;  2ZXJ A;  2K7L A;  1ZLK A;  3ECO A;  2P5V A;  3R0J A;  1FP1 D;  2DI3 A;  2EFP A;  3E3V A;  1ZG3 A;  3BZ6 A;  3V8J A;  2HKX A;  3KP7 A;  3IL2 A;  2STT A;  2XGX A;  2DK5 A;  4HYE A;  1SAX A;  1YO5 C;  1FPQ A;  4ON0 A;  1XGN A;  1HQC A;  2M8E A;  3IHU A;  4ESF A;  4WF2 A;  2KIF A;  4LK1 F;  3C1D A;  4RGX A;  2A5Y B;  2EFQ A;  2W25 A;  2Z9O A;  1FYL A;  4G6Q A;  2PJP A;  3I59 B;  1FYM A;  2RVC A;  2Z33 A;  1MJA A;  3KP5 A;  5CVI A;  4FT8 A;  4UUV A;  2VOP A;  1B6A A;  5TRD A;  1L0O C;  2WWY A;  4DQ2 A;  2JZY A;  4WX9 A;  3CO6 C;  3J81 K;  4M72 A;  2ELH A;  3LA7 A;  4U0Y A;  1I27 A;  4L9T A;  4ESJ A;  2KIM A;  2FF4 A;  5K5R A;  1ZAO A;  3K2Z A;  5J8C A;  3B02 A;  5HLG A;  3CUQ C;  2QYO A;  2FE3 A;  3I54 A;  1LNW A;  2DO7 A;  1LJ9 A;  3TQN A;  2FA5 A;  2WV0 A;  3RPQ A;  3WTS C;  3J81 Z;  3ERE D;  1DP7 P;  3F8F A;  1KU3 A;  3DFG A;  2QQA A;  2V1X A;  1T39 A;  2LNB A;  3S2W A;  4H0E A;  4WXH A;  2FBI A;  2Y75 A;  1ZH5 A;  2RKH A;  2GA1 A;  1YLF A;  2BEO A;  4P9U A;  1SD6 A;  1T38 A;  1ZRF A;  2IJL A;  1ZGA A;  3FM3 A;  2RC4 A;  3MQ0 A;  1TTY A;  4F7Z A;  4A0Y A;  5DDG A;  3EDP A;  1D3Y A;  3GFM A;  2P6S A;  2KJC A;  2QBY B;  3HOT A;  4I0A A;  1IW7 F;  2GQQ A;  1YW7 A;  3GVA A;  3WTX C;  1BI2 A;  2GA2 A;  3F8C A;  1WSU A;  3BJA A;  2A69 F;  1W7P D;  2ZJ2 A;  2RNJ A;  2HS5 A;  2KKO A;  4HLY A;  4ENK A;  4LFU A;  1O3S A;  4XSZ F;  5BOX A;  2F5D A;  4O3M A;  4CDG A;  1IZ1 A;  5H6R A;  2L54 A;  2H94 A;  1D8K A;  3V7C A;  4M73 A;  1I5Z A;  2IW5 A;  5EEH A;  4EJT A;  1GVJ A;  1X3U A;  1W5T A;  2YX4 A;  3RPU A;  3WGH A;  4P9F A;  5D4S A;  1YS6 A;  1XMA A;  1IAW A;  1FSH A;  3IWF A;  1P4A A;  3VEP A;  3K9T A;  2A6H F;  4M9X A;  2PBI A;  3M8F A;  3K1N A;  3QOP A;  1RUN A;  4WXD A;  2CO5 A;  3FMS A;  1FBQ A;  1JXS A;  3F23 A;  4L9J A;  2RGV A;  2HOE A;  4YII A;  3T5X A;  1BC7 C;  3ZP5 A;  2V1D A;  1TNS A;  5FFZ A;  1FSE A;  4EM2 A;  1MJ9 A;  1HSJ A;  1LDD A;  1UB9 A;  3JSP A;  4Y13 A;  1PUE E;  5JR3 A;  3BRO A;  2MBF A;  4N9I A;  1YYV A;  3HHH A;  3DXJ F;  5E20 A;  1W4M A;  1Z9C A;  3V4G A;  4HF1 A;  5J8F A;  3F8M A;  3ZMS A;  3E97 A;  1KU2 A;  2DBB A;  3CUQ A;  2E1C A;  1K78 B;  1ZHF A;  2D2W A;  1BIA A;  2OQG A;  2VC0 A;  3I64 A;  4AWX B;  3I71 A;  4CZZ A;  3HRU A;  4PGH A;  1R00 A;  3BPX A;  3I5U A;  1KYZ A;  2O6G E;  2EWN A;  1BI0 A;  2CFX A;  2QLZ A;  4KIG A;  5HS8 A;  4ZYD A;  2C6Y A;  3WE2 A;  1ZRE A;  5ICF A;  5FLX K;  2G7U A;  1WI9 A;  4EM0 B;  4MNU A;  1RUO A;  5K1Y A;  4WK8 F;  4KIB A;  1H9G A;  4HQE A;  4KUM A;  1EH7 A;  1HST A;  5LRR A;  1QPM A;  2XAH A;  3F72 A;  1J59 A;  4RB2 C;  2F5E A;  5L3D A;  2DQR A;  2H09 A;  2P5L C;  4K2E A;  1SD5 A;  4MHG A;  1JE8 A;  4HV6 A;  1IF1 A;  3BWG A;  2GXG A;  3L7W A;  2B0L A;  2G7H A;  5DD8 A;  2NS0 A;  1GXQ A;  4UVB A;  4BQA A;  5FLX Z;  1IN7 A;  1BN5 A;  4I02 A;  3L9F A;  5JVT A;  5DD4 A;  1R5H A;  3MAJ A;  2FNP A;  2DU9 A;  3P7N A;  1B4A A;  1FC3 A;  1DPR A;  4EJW A;  2P6T A;  2DQL A;  2M87 A;  3ZMU A;  2JPB A;  5DCF A;  3LAP A;  1QZY A;  1YS7 A;  2VE8 A;  3R61 A;  4S05 A;  4KT5 C;  2FBH A;  3FXR A;  5ICC A;  5HOO A;  3RKX A;  2A3S A;  3LA3 A;  2EFW A;  1MD0 A;  1D5V A;  2COM A;  5DYM A;  1W5S A;  1KQ0 A;  4ZH4 F;  2D1V A;  5D5X B;  3N97 A;  2E7W A;  3Q9V A;  1STZ A;  4EJO A;  4L9V A;  4Y15 A;  4LB5 A;  3C7J A;  5L3B A;  1UFM A;  4EVI A;  4MGR A;  1LB2 A;  3M9A A;  4M74 A;  3LQR A;  1HKT A;  4WCG A;  3PFI A;  2HWV A;  1HW1 A;  1PDN C;  2EFO A;  2EJR A;  2A68 F;  1USS A;  2LF7 A;  3K0L A;  2MC3 A;  5L3F A;  1Z7U A;  1CF7 B;  2CG4 A;  3DF8 A;  1BIB A;  5D6E A;  2JT1 A;  2BE5 F;  2VON A;  4HZF A;  1Z91 A;  1FBU A;  1L3L A;  5LGU A;  2QQB A;  2ZNZ A;  4MQ9 F;  1J9I A;  4NHJ A;  3U1D A;  3FZV A;  3VB2 A;  2V6C A;  2DPD A;  4XLP F;  4M9S A;  3IRR A;  1FP2 A;  3K1P A;  2M1B A;  3K1M A;  1KU7 A;  4L18 B;  2V79 A;  1FOK A;  3QU6 A;  4UVA A;  3SZP A;  3IKT A;  2CYY A;  3GO5 A;  4CIC A;  4EGY A;  1PP7 U;  3DQV C;  2K4B A;  4YIF A;  2KIU A;  2ISZ A;  4I0B A;  1D8J A;  2WTE A;  3GEZ A;  3L09 A;  2ZCW A;  2ETH A;  2K86 A;  2IT0 A;  3E5X A;  3SHF A;  5IT9 K;  1H0M A;  2VT2 A;  5JI6 A;  2NYX A;  1O7L A;  3WGG A;  4UVC A;  2D45 A;  3DPT A;  3WG9 A;  5CLS A;  2GZW A;  2Y48 A;  4HA8 A;  2OD5 A;  2XIG A;  1TQI A;  2EV5 A;  4HX8 A;  3QAH A;  4KIF A;  1BI1 A;  1IXS B;  2QEN A;  5IT9 Z;  2QWW A;  3KP3 A;  4IJA A;  2BYV E;  1GXP A;  1XN7 A;  4UHT A;  1YTY A;  4YFK F;  1J75 A;  3LFK A;  2DW4 A;  4KMU X;  2XAG A;  5FGM A;  1V4R A;  4TV7 A;  4MQV A;  3ML6 A;  4AVP A;  3E6B A;  1MKM A;  3HIF A;  5ERI A;  4L9N A;  3M1E A;  3EET A;  1FZP B;  3HSE A;  3ZMD A;  4N9H A;  1YW9 A;  3JW4 A;  1W7P B;  3RYP A;  4ETS A;  5BMZ A;  4JBA A;  4BNC A;  1R22 A;  4XSX F;  1FX7 A;  3IWZ A;  1QNT A;  3F21 A;  4HF2 A;  2DT5 A;  1S6L A;  4E70 A;  4A0Z A;  1QZZ A;  3E6C C;  2KRF A;  4RGU A;  3MEX A;  5DUK A;  4ZZD A;  2DLL A;  5HVQ C;  4I09 A;  1LEA A;  2CQK A;  3LAJ A;  4EMS A;  4OOI A;  4ZYG A;  1U5T C;  1Z6T A;  1XCV A;  1UHW A;  3C3W A;  1YQA A;  2QM3 A;  3V7R A;  2PMH A;  2IPQ X;  4KN7 X;  4KYW A;  2P7C B;  3KP4 A;  2HTS A;  2VC1 A;  3M8E A;  2VXZ A;  1Z05 A;  4RB3 C;  4AIK A;  1KYW A;  4A5M A;  1ZRC A;  3KFW X;  2H27 A;  3WTT C;  2UXN A;  1BOA A;  2ADU A;  2LKP A;  3F6V A;  3B73 A;  4IHS A;  2FU4 A;  4U7B A;  2ZNY A;  2NNN A;  2QVO A;  4I98 B;  1XCB A;  3FF5 A;  4KA4 A;  1O3R A;  2Q0O A;  3ELK A;  4Q5S F;  1WKM A;  3HTU A;  3MWM A;  4GGG A;  3ABT A;  4OIN F;  2VBZ A;  4JK1 X;  3C18 A;  3EYI A;  4PCQ A;  3TKY A;  2GXB A;  3BP8 A;  3WU1 B;  2EK5 A;  3P9I A;  3O6B B;  4D0P A;  3FM5 A;  4UXN A;  2VOO A;  3T8R A;  4UV9 A;  4OIQ F;  3GF2 A;  1F4K A;  3G3Z A;  1BJA A;  5DV5 A;  4PGG A;  4LG0 A;  1DPU A;  1MDM A;  5FD5 A;  5AON A;  1HBX G;  3NRV A;  2L4A A;  2O0Y A;  2ZME B;  4XLN F;  2AXL A;  3PQJ A;  2NRA C;  4G7Z F;  5HDN A;  4ZYE A;  1SFE A;  3CUO A;  2ESN A;  4CGZ A;  2K02 A;  1JGS A;  4P55 A;  1EH8 A;  1DDN A;  5KK1 A;  5LHI A;  3ZQ7 A;  5HS9 A;  1UST A;  1OPC A;  3FWE A;  3HOS A;  2M45 A;  2PQ8 A;  1YFH A;  1O7F A;  3WTU C;  3ZPL A;  1JHF A;  2EA4 A;  1IN5 A;  2RDP A;  1R58 A;  1HKS A;  2GIV A;  3TDU C;  1U78 A;  1XGO A;  4HDV A;  1WWX A;  3ZMT A;  4QLC U;  2E7X A;  2HZT A;  3EQL F;  2DFI A;  2XKP A;  4M9Z A;  4B09 A;  4IXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...