3WTSC

Crystal structure of the complex comprised of ets1, runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
118
structure length
118
Chain Sequence
PVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
total genus 40
structure length 118
sequence length 118
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wtsC00
3C3WA 3ABUA 3KP6A 4UHTA 4O5VA 1YLFA 3LQQA 2RNJA 3IRQA 2D2WA 2GWRA 1TQMA 3JAMZ 1K78B 2MH2A 4XSXF 3DPLC 2DK8A 2K86A 2QBYA 2L54A 1SD6A 1T0FA 3P9KA 3EYIA 2JPBA 3C1DA 2XAJA 2KIUA 1XGNA 2Z9OA 4HDUA 5E17F 4U88A 2ISYA 3Q9VA 3TOAA 1J75A 1IN5A 5HDNA 4A6DA 4KUMA 4XLPF 2XHKA 3GUDA 2EFPA 4G7HF 3KCCA 3OOPA 1TW2A 1ZG1A 1O7LA 4E70A 5BMZA 5EEGA 1WRJA 5JI6A 5LGTA 3JSOA 2VXZA 1ON2A 1MKMA 4M73A 2OAZA 2L02A 2DW4A 1EH6A 4HQEA 1R1TA 4I2OA 1YYVA 3GO5A 3GX4X 3ELKA 4P55A 2EV6A 3WE3A 4KMFA 2G9WA 3FX3A 1FT9A 4IXAA 1SD7A 1R1VA 1O3TA 1JHFA 4H0EA 3JAMK 1R1UA 1USSA 5IT9K 1JGSA 4L0YB 1OR7A 2FEZA 2P5KA 1GXQA 3KP4A 3WGHA 1U5TA 4G94A 3M9AA 2OU2A 1B1BA 3D0SA 1V3FA 2FU4A 2X0LA 1WKMA 2PFBA 3F21A 1W7PD 2KKOA 1YQAA 3V4GA 1YFHA 1IRGA 4BYYA 1G3TA 3MFKA 2QBYB 3R0AA 2YSRA 4MEXF 1J0RA 1ODDA 3T8RA 5ICCA 2ACJA 4GGGA 1HKTA 5DCMA 2A61A 5FO5A 3P7NA 5HDGA 4UV8A 2K4BA 1JHHA 1H9GA 3F8CA 2DPDA 2EWNA 3O6BB 2VT3A 2DQRA 3BPVA 1YG2A 4AD9A 1FSHA 4P5OA 5E1ZB 5L3FA 3ZMTA 2H09A 1LVAA 4LB6B 2IA0A 2P4WA 5J8CA 3KZYA 1U8RA 4HF1A 1QO0D 1YIOA 4I98B 4KT5C 4MGRA 1S6LA 2QENA 3HHHA 4U0WA 2H94A 3WE2A 3GF2A 1QQIA 2IVMA 3F72A 3QP6A 3SZPA 2UXXA 3P9CA 1CF7A 5DD4A 3GW2A 1MJ9A 5ICFA 3Q5FA 4EM1A 2R3SA 3R61A 1RI7A 4LK1F 5LGUA 5LEJA 1S7OA 2OQRA 1B9NA 4M9XA 3DQVC 4MEYF 3H92A 1E17A 4OMZA 1FP2A 2DU9A 2O03A 5KVRA 2L4AA 2EJRA 1IF1A 4RS8A 2V1DA 2Z5UA 1I1SA 1Y0UA 2XUBA 5HLHA 4RGSA 3G73A 2MLKA 2CQKA 1J9IA 3QAHA 4UXNA 2IP2A 3RKYA 2LNBA 4AIJA 2XAFA 5DCMB 1DUXC 1FYMA 1H9TA 2WTEA 2E1NA 2DTRA 2XKOA 1KYWA 2XKPA 3HRSA 1E2XA 1ZLKA 2CGPA 1T98A 4R8HA 2TDXA 4HBLA 1HQCA 2HGCA 4U7BA 3CUQC 1GVJA 2W25A 2HYGD 2QQAA 2EFNA 3GYHX 1BN5A 1H0MA 1Z6RA 1SMTA 2QWWA 1VTNC 4UUVA 2OZUA 3L2CA 4Z2YA 2MH9A 4L9VA 3REOA 2QM3A 3FZVA 4HYEA 5CVUA 3D5LA 5JVTA 2ZMEA 4HAMA 4HV6A 4EJTA 4I01A 4WK8F 5ERIA 4P9UA 3I5UA 3W6JB 5CLSA 3ABTA 4ON0A 3N97A 2PMHA 4G7OF 2E1CA 2XVCA 4D0PA 1CF7B 4WCGA 3MZYA 4OU0A 1B4AA 2P5LC 2XIGA 4OMYA 2MLGA 2CW0F 2BGCA 1XD7A 2O6GE 5CVJA 4CYDA 2IPQX 4IRHA 1I5ZA 1G4DA 3TO6A 4EJOA 2HFHA 1DP7P 1F5TA 2PJPA 2HZTA 1HW1A 3QPTA 4EQQA 3FMSA 3DF8A 5LLQA 3BPXA 1ZREA 5DUKA 5LHGA 2ESHA 4CGZA 1G3WA 5D4SA 3KP7A 3IWFA 3W6KB 1HXDA 3QP5A 1IXSB 4GYIA 5BS6A 3E6MA 2IW5A 4R79A 4HDVA 2IA2A 4HV5A 1RNLA 1I1GA 3VODA 5HS8A 1FX7A 3F6OA 4Q5SF 2KRFA 1O7FA 5E18F 3RIRA 4XBFA 4RGRA 2COMA 1LQ1A 4MTDA 2V9VA 2DO7A 2PLYA 1HW5A 1QZYA 2FMLA 3COAC 2EB7A 1RUNA 2VBZA 4LMYA 1PUEE 5HLIA 4ESBA 2ZFWA 4KA4A 4KFCA 5KK1A 1C0WA 3F6VA 4YIIA 3L9FA 3LWFA 2FMYA 5DV5A 3I0TA 1WI9A 1FBSA 3J80K 3C7JA 1KYZA 2ZMEB 1W5TA 4CZZA 3I71A 3WTXC 1D8JA 1L3LA 1XGSA 4I0AA 1P4WA 2OD5A 4CO8A 5TRDA 4LG0A 1ZGAA 1FC3A 3ML6A 1TQIA 3KEQA 5LHIA 3GEZA 3CLOA 3WTSC 3VFZA 4Y15A 3RTRA 4L5IA 1BI3A 3WTUC 2ZO4A 2DT5A 1EH8A 1JXSA 3LAPA 2FF4A 2XAGA 2W57A 1R58A 3Q9SA 4IF4A 5H6QA 3ECOA 3LA2A 2L01A 2OA4A 1CGPA 2FSWA 2BBYA 1O57A 3CUQA 4GXOA 1R23A 5ILSA 4HX4A 5D6FA 3BJOA 2XGXA 5K1YA 2GA2A 3KZZA 2VC0A 3B73A 1I6XA 5IT9Z 1ONVA 3TDUC 2RKHA 2FRHA 1ZYRF 3IWZA 3DPTA 1ZRDA 3R4KA 5FD5A 3EDPA 2EA4A 1HKSA 2DK5A 1KU7A 1XDSA 2O8XA 2K27A 3FXUA 5JR3A 3RKWA 3NQOA 4ETSA 3SXYA 4HLXA 2EFWA 4IVNA 5FGMA 5IT3A 1XSVA 2R7DA 3WTVC 3KP3A 3F8MA 3BP8A 3WG9A 5DCFA 1DPUA 3T8TA 2VN2A 2MD5A 2EA2A 4GO1A 1MDMA 1BIAA 4JQFA 5H20A 5CJ9A 1FZPB 2YR2A 2FA5A 2E7WA 1RZ4A 4A5MA 3QPHA 4AIKA 3J81K 4Q4ZF 3HTSB 4IJAA 3QOPA 4M9SA 2ZNZA 1TTYA 2FBKA 3KE2A 5DEQA 5LGNA 3F3XA 3SQNA 2QQ9A 4BAYA 3GXOA 2JPCA 3ZMSA 1BIBA 4G9YA 4LG0B 4EVIA 4RB0A 1ZG5A 2NNYA 2RN7A 4QLCU 1XSXA 1IN6A 1KGSA 2QLZA 5HDKA 1MGTA 1U78A 4M74A 2P5VA 1TBXA 1YS7A 3HOSA 2MC3A 3EETA 3RDIA 2JZYA 3K1MA 4LLGF 2VBXA 2Y48A 1SFEA 4JBAA 2PBIA 1HW2A 1J7KA 2P8TA 3BOQA 3HRTA 1REPC 4ENJA 4I09A 4M6XA 5BOXA 1TQPA 2JRTA 2VBYA 1LJ9A 2STTA 1TNSA 3CUQB 1IUYA 2HS5A 4LLNA 4HX7A 2XAHA 4M9ZA 2RGVA 2ESNA 3LAJA 3L00A 3FWEA 4ESFA 5FLXK 3GWZA 3K1NA 1JE8A 2Q0OA 1X3UA 2QYOA 4HQMA 5F1RA 3SZTA 3LQRA 1MJBA 3FM5A 5LEKA 4HX8A 4XSZF 3GFMA 5D8KB 3GZ6A 2HR3A 1T38A 1YW7A 1LB2A 3K69A 2FXAA 3ZMZA 1R5HA 4M72A 3VOEA 2FE3A 4WXDA 3HIFA 2A6EF 3R6SA 4QWQA 4WF2A 1UB9A 4UVAA 2M8EA 1R7JA 3I64A 4HW0A 4KICA 4EJUA 1Q1HA 4G8XA 2H6BA 5D5XB 1MDMB 3ZP5A 2HYFA 5L3CA 2HKXA 3ZMVA 1KU2A 2PQ8A 1B59A 3ZN0A 3V8KA 5E8IA 5CVRA 1LDDA 4A0ZA 1K7AA 3KEOA 2DLLA 6PAXA 2R7FA 3JTHA 2CO5A 1D3YA 4IRIA 1K6OA 3L09A 1R5GA 2DFIA 4WWCA 4PGHA 4ZZDA 4S04A 4ZZLA 1S8NA 4U7DA 5BPDA 4PGGA 2D45A 2F5CA 3ZN1A 1FYLA 3LSTA 3EUHA 1EV7A 1BI0A 1UCRA 1XGOA 1IN8A 1YW8A 3FM3A 2Z33A 2L4MA 1G6NA 2F5EA 1BI1A 1ON1A 4RAZA 4ZYGA 4G6DA 3FXRA 5DD8A 1OYYA 2J5OA 3K9TA 1ZRCA 4L0ZB 2CYYA 1U5TB 3HSRA 2KIMA 5CVIA 4RB3C 2DBBA 4I02A 2VBWA 4OINF 1IXCA 3U1DA 4BQAA 4M71A 1LDJA 2Q2EA 3RKXA 3TO9A 5LBQA 1BI2A 2RDPA 2ZNYA 1STZA 1BM9A 3T5XA 1Z91A 3MAJA 3S2WA 2EFOA 3ECHA 3V7RA 1ZN2A 5BQTA 3O2PE 4DNCA 1IN7A 1DDNA 1MJAA 5EEHA 2HEOA 2M5WA 1ZLJA 2HOEA 1WSUA 5L3EA 2NS0A 1XSDA 4LFUA 1SMYF 2D1VA 1U2WA 4Q47A 2K7LA 1IN4A 2P6TA 3BDDA 3VB2A 2Q8KA 3V7CA 1XGMA 1IZ1A 4GCVA 2BE5F 2VOPA 2RC4A 4LJZF 2O0YA 4ZYHA 1KU3A 1SAXA 4L18B 3FXQA 1I27A 1KQ9A 3MQ0A 3MCZA 5BPIA 4PCQA 1T6SA 4EV0A 2P7CB 3RYPA 1HSTA 3G3ZA 4Q48A 4OIQF 5K5QA 1UHMA 2F5FA 2ELHA 2FOKA 5E1WA 4FX4A 2UWMA 5LHHA 2YX7A 3E6DA 1P2FA 2W24A 1YW9A 3BJ6A 5HOOA 3E6BA 3IL2A 1T2KA 2VONA 2OBPA 3E97A 1ZRFA 4XLNF 2K4JA 2UXNA 3I54A 3J80Z 2H6CA 3EYYA 5D6EA 2WC2A 1WWXA 5AIPA 1P4AA 2L3DA 2DQLA 2YX4A 4EGYA 1J59A 1O3SA 4RB2C 4LD5A 3WU1B 1D8KA 3I58A 3WTYC 3TKYA 4LLLA 3V8JA 2FNPA 4L9TA 1YO5C 4IRGA 2FNAA 1ZARA 2GXGA 1FBQA 3TOBA 1EH7A 1XB4A 3DP7A 2ZXJA 1XN7A 3DFGA 2BYVE 4UV9A 1T39A 1W4MA 2HQRA 4P9FA 5CVVA 1U3EM 1HKQA 4HLYA 1AOYA 4KYWA 4B09A 2LKPA 3WGGA 1KA8A 2OZ6A 3U2RA 5A2QK 2EFQA 3F8NA 4UNOA 1Z6TA 3WGIA 3BROA 5K5OA 2RV8A 2D1HA 5D5WB 3OV8A 3WODF 5AIQA 1ZAOA 5L3GA 1G3SA 3HUGA 1KU9A 5F64A 4NHJA 2QUFA 1FOKA 3H3ZA 1FLIA 4L9NA 4ASNA 2M45A 3BZ6A 2CG4A 2MBFA 5HLGA 1XCVA 2ADUA 4WX9A 3QRFF 1BC7C 5D5UB 3QU6A 1YTYA 2IT0A 4CHUA 3J81Z 2HTSA 3V8LA 3TDZC 2O61A 2ZJ2A 3MWMA 4BH9A 1OPCA 3CTAA 1F4KA 4YIFA 4G7ZF 1PP7U 4I7HA 3GFLA 2CWEA 5E8GA 3E5UA 2Y75A 1BC8C 3ISPA 4KN7X 2VT2A 3QU3A 3PFIA 1QPMA 1ZGJA 3MEXA 2ZBKA 3L7WA 3ZQ7A 4RGUA 4IHTA 1XMKA 3H3UA 3K1PA 1XCBA 3HOTA 1USTA 3EQLF 2UZKA 4L9JA 3KFWX 1B6AA 2PG4A 1F9NA 4N9IA 2PN6A 2NNNA 1Z7UA 2F2EA 4TV7A 1GXPA 2XAQA 2LF8A 3TQNA 4BXUA 5ILVA 3AAFA 4OIRF 1WQ2A 5FLXZ 2V1UA 4YG2F 1DPRA 1Z9CA 4HOBA 4N9HA 4KNYA 5LRRA 4ZYEA 1SFUA 3M1EA 1SFXA 4M6YA 5F6FA 4EJVA 2J5PA 2KJCA 2K02A 3JW4A 3LA3A 2GZWA 1TW3A 4AWXB 5FD6A 4NB5A 4O6JA 2BV6A 4KN4X 1MZBA 2V6CA 4ENNA 3IKTA 3CO6C 3RJPA 2QQBA 2ZKZA 5E1XA 5L3BA 3U9GA 4OOIA 3TGNA 3F22A 2GIVA 2V79A 4ZYDA 2B0LA 3PQJA 4A0YA 4DQ2A 1OKRA 3FMQA 4HA8A 4PZJA 2NAZA 1QGPA 5LRSA 4RGXA 2EV0A 4PDKA 4U0YA 3ZPLA 1FWZA 3WTWC 3FF5A 5H6RA 5E20A 5ED4A 3F23A 1W5SA 2W85A 3M7GA 2VE8A 2P6SA 4P96A 3BJAA 1BOAA 1SD5A 2GXBA 4L5JA 3DV8A 4ESJA 1R22A 2GAUA 1U6GA 4HF0A 4YFKF 4GYGA 1ULYA 1OYIA 3RI4A 4ZH4F 2VOOA 5DYMA 1TLHB 2A5YB 4CDGA 2C6YA 4OIOF 3SFZA 3ERED 1IAWA 3HTUA 4R1HA 4S05A 5HS7A 1QZZA 3IRRA 1FBUA 2VC1A 5DUIA 1ZHFA 2MA3A 1O3QA 2Z3YA 4BHPA 2JSCA 3LA7A 3JSPA 2EK5A 2HKOA 4N0BA 4KIGA 4BHCA 1FP1D 3NEUA 1QNTA 2CSOA 5J6XA 4WXHA 1D5VA 1K79A 3CO7C 4FHTA 2A69F 1Z1DA 5HS9A 3E3VA 4K2EA 4EM0B 1S3JA 3ZMUA 3BY6A 2W84A 1FYKA 5JFRA 1NHAA 4HZFA 3HYIA 2YPRA 1HSJA 2EV5A 1YS6A 1FNNA 2IRFG 2CFXA 1ZH5A 2P7VB 4NQWA 3NRVA 3IKVA 3IHUA 2GQQA 1IRFA 3KLNA 2G7HA 4IPAA 1P6RA 1G3YA 3VEPA 2A68F 1UHWA 5JHUA 1B9MA 3WTTC 2WV0A 2DPUA 3GZ5A 2AS5F 2FQ3A 2A6HF 4RAYA 3FHZA 2H27A 2F5DA 1XMAA 1OYWA 3KP2A 3HRMA 4MQVA 3E5QA 2XROA 2XASA 4CXFA 2G7UA 1P4XA 1LNWA 5HVQC 2Y0MA 4FT8A 3RPQA 2PI0A 4KMUX 1L0OC 3CUOA 3K0LA 3K2ZA 2HDCA 3E5XA 1KQ0A 5FFZA 2M30A 1IW7F 2HWVA 3E6CC 3T0YA 2PMUA 2YU3A 3FMRA 4Y17A 3J7AO 2HTJA 3DEUA 1J5YA 3I53A 1F1ZA 2LSOA 3ROUA 3I59A 5ICGA 1A04A 4F7ZA 4Y13A 3KLOA 1MD0A 3TO7A 3CDHA 4LB5A 3HSEA 2ZCWA 2DAOA 4EJWA 2JT1A 5J8FA 1LEAA 3RPUA 4O3MA 2ETHA 3GFJA 4AIHA 4I0BA 5A2QZ 4LGWA 2HQNA 3HRUA 1S29A 3ZMDA 3DXJF 2DI3A 3WTZA 3I4PA 1OMIA 3CJNA 2BEOA 1Z05A 5FFXA 3P9IA 1FY7A 4OIPF 1W7PA 2IA1A 1HBXG 3LFKA 4BNCA 2A3SA 3IC7A 5D5VB 1RUOA 4YFNF 5CYVA 5DDGA 4RB1A 2NYXA 3HHGA 1TNTA 2FBHA 4CICA 3F8FA 1R00A 2GA1A 1RIOH 1IXRC 1KQ8A 4UVCA 3B02A 2M87A 2FBIA 2LF7A 2RQPA 5ICEA 3R60A 4MTEA 4UVBA 1FPQA 4AVPA 2VE9A 3RYRA 3T1BA 2XRNA 3GLXA 3HSFA 4A6EA 4A5NA 1LDKB 1K78A 2RVCA 2STWA 4MQ9F 2VODA 5TJJA 3GVAA 1V4RA 4A12A 1UFMA 2IJLA 3F8BA 3I59B 4HF2A 4WXCA 4U0VA 3KETA 2Z99A 2KJBA 5L3DA 2NRAC 2O3FA 2X4HA 2ISZA 2XV4S 1PP8F 3JTGA 1SD4A 1J2XA 1ZG3A 1GHCA 1U5TC 2QVOA 2PEXA 3R0JA 2JTVA 4B8XA 4IHSA 3O3KA 4A2UA 3MZHA 3V7SA 2KIFA 4FX0A 4KIFA 5ILUA 1O3RA 5D4RA 4JK1X 1BBYA 5K5RA 3DKWA 3M8EA 1AWCA 2E7XA 4G6QA 3SHFA 4XRFA 5D8LB 4BHBA 4KIBA 1W7PB 4KDPA 2AXLA 1PDNC 4MNUA 2A07F 3GFIA 3WU0A 2WWYA 3M8FA 3PQKA 1LEBA 2QZ8A 1XDUA 1FSEA 4LK0F 4ENKA 2M1BA 1R36A 4EM2A 1P92A 1S7AA 4EGZA 3BWGA 4MHGA 4A0XA 1QBJA 3ULQB 4EMSA 3KP5A 3N4MA 1BJAA 4ENMA 2LDUA 5AONA 2OQGA 4YFXF 2V1XA 3C18A 5FB2A
chains in the Genus database with same CATH superfamily
1FOWA 3ABUA 2DJIA 2WAQA 3C3WA 3KP6A 4UHTA 4M3GA 2I8DA 2LP0A 3HC7A 4O5VA 1YLFA 2M0MA 3LQQA 3TEDA 1YX5A 2RNJA 4XL9A 4BS9A 3IRQA 2D2WA 2GWRA 3BQZA 1TQMA 1JGGA 3CF2A 3JAMZ 1K78B 1ZR2A 2DT7B 2MH2A 2F48A 4XSXF 1LVKA 3DPLC 1ZGWA 2HVRA 2DK8A 2K86A 2R4GA 2QBYA 3Q3SA 2L54A 1G2HA 2LYCA 1QHGA 4HSRA 5E3OA 1SD6A 3GTLJ 2R7TA 1T0FA 3P9KA 3EYIA 3PO2J 5GAHJ 5C3EJ 3ZQFA 2JPBA 5DS9A 3C1DA 1ETVA 2COBA 2JSPA 2XAJA 3BR5A 2JA7J 2KIUA 2VB6A 4MFEA 1XGNA 2QCOA 4PFPA 1QHHD 2Z9OA 4DBRA 4HDUA 4P1WA 1JKQC 4ZYAA 3JRFA 5E17F 4D5FA 2KZVA 4U88A 3GBGA 1BJZA 2ISYA 3Q9VA 3TOAA 1J75A 1FTTA 4G6TB 1IN5A 5HDNA 5IOYA 5H2FC 2ELKA 2W82A 4A6DA 3QPSA 4KUMA 4XLPF 2XHKA 3GUDA 1LPQA 1E3PA 4XN3A 3H36A 4XRSA 2EFPA 4RDUA 4G7HF 3KCCA 3OOPA 4AUXA 1TW2A 1ZG1A 2EZKA 1O7LA 4E70A 2IGKA 5BMZA 5EEGA 2OTLI 3ASNH 3PUBA 4ANJA 1JUMA 1OCCH 3K10A 1WRJA 2WADA 1ORKA 3K4MA 1X19A 5JI6A 3E1SA 3JRGA 5LGTA 3JSOA 3OS0A 3BR6A 3OYBA 2VXZA 1YIJI 1V5FA 2E5NA 2FD5A 2GIZA 1ON2A 1MKMA 4M73A 2OAZA 2L02A 2DW4A 2DDAA 4BQOA 2V4JC 1EH6A 4HQEA 1R1TA 3HEFA 4I2OA 1Y1VJ 1YYVA 3GO5A 4S0HB 3GX4X 3UKGA 3ELKA 4BACA 3M8JA 4P55A 2EV6A 3WE3A 2FUG2 3MKWB 4KMFA 2L5QA 2G9WA 4C2UA 4OAYA 3FX3A 1FT9A 4IXAA 3LSJA 1SD7A 3M3YJ 1R1VA 2HNHA 1O3TA 1JHFA 4H0EA 4XKBA 3JAMK 1Z67A 1R1UA 3TW7A 2DTZA 4RAFA 1USSA 1I6HJ 5IT9K 1JGSA 4L0YB 1OR7A 2EIKH 1X1BA 2FEZA 2MG4A 2H1KA 1UAAA 2P5KA 3CMYA 1GXQA 3KP4A 3WGHA 4BJ6C 1U5TA 4G94A 5EJCA 3M9AA 4B43A 3OYAA 5B1BH 5KAIC 3OYFA 2OU2A 2VL8A 1B1BA 3D0SA 2LLKA 5EYRA 1V3FA 2ZMEC 2FU4A 2X0LA 1WKMA 2PFBA 3F21A 5M3MJ 1W7PD 3I4NJ 3HPHA 2KKOA 1BR2A 1DGRM 2OCEA 1YQAA 2BW3A 3V4GA 1YFHA 1N75A 1D0YA 2ZB9A 1IRGA 2PJRA 4BYYA 2H8WA 3PSFA 3LSRA 3S1RJ 4AU7A 1G3TA 3MFKA 2QBYB 3R0AA 2QKMB 4XN0A 4ZDPA 2RAEA 2YSRA 4MEXF 3CP8A 1J0RA 1ODDA 2BHYA 3T8RA 4II3A 3A0HC 5C4JJ 5ICCA 2ACJA 3FISA 3HL2A 4GGGA 3FXMA 1HKTA 3I3LA 3RQ4A 1R6RA 5DCMA 4A3EJ 1T8IA 2Y30A 2A61A 2K9QA 5FO5A 3H9QA 3P7NA 5HDGA 4BJTA 4PJNA 4UV8A 2DMPA 2K4BA 1JHHA 1H9GA 3F8CA 2HDWA 1GV2A 2XSDC 1YITI 2DPDA 2EWNA 3O6BB 3BR2A 2CW8A 2VT3A 3BCAA 2K85A 3K2AA 2DQRA 3BPVA 1VQ5I 5F1JA 4XLCA 1YG2A 4AD9A 3OY9A 1FSHA 4P5OA 5E1ZB 2DJNA 5L3FA 3ZMTA 2H09A 1LVAA 4LB6B 3S8PA 2IA0A 2P4WA 5B5EC 5J8CA 4A3JJ 1SEUA 2CUEA 3KZYA 3KYLA 1YI2I 2HOSA 3G6EI 2NOGA 2WB1A 3BG3A 3QODA 1U8RA 4HF1A 1QO0D 3H0DA 1KONA 3S2DJ 1S7EA 1WJAA 1YIOA 4I98B 4KT5C 2F4IA 3OOUA 4MGRA 1LFPA 2LRDA 4DBQA 3B6CA 4F52A 1S6LA 2QENA 3HHHA 1B72A 4U0WA 2H94A 5GTIC 4HSTA 3WE2A 3S32A 3GF2A 1QQIA 2IVMA 3F72A 3QP6A 3SZPA 1WH7A 2UXXA 2I5UA 3P9CA 3SDGA 2JRMA 1CF7A 1NG6A 5DD4A 3GW2A 4BGDA 1J09A 1XPXA 2DYRH 3HOUJ 2OF7A 1MJ9A 2E19A 2E2HJ 1UMQA 2OCCH 4XORA 5ICFA 3Q5FA 4EM1A 2R3SA 3R61A 3LNQA 3CMMA 4ZTJA 1RI7A 4LK1F 3H9JA 5LGUA 5B3SH 5LEJA 1BR4A 1S7OA 2OQRA 3CCRI 1B9NA 4M9XA 3DQVC 1Y56A 3ZQHA 1U8BA 4V2FA 4MEYF 3DU6A 3H92A 2JQ7A 2ZSHB 1T95A 3U21A 1E17A 4OMZA 2WV1A 1FP2A 2CV2A 1VQ6I 1WZ2A 5J1YA 4QIWN 2DU9A 2O03A 3BZKA 3HKZN 1TWAJ 5KVRA 5IY5H 4BJ5C 3BG6A 2L4AA 2EJRA 1IF1A 1UG0A 2CRGA 1RKWA 2ME0A 4NUBA 4RS8A 4AC0A 4IZZA 2V1DA 2Z5UA 1I1SA 1Y0UA 2BW3B 2XUBA 1JI8A 2CUFA 2DA5A 1W5CC 2L9SA 2PJRB 1U0JA 1SFOJ 5HLHA 1VFCA 1N25A 2XDVA 4RGSA 3G73A 2ME6A 2VQLA 5F0CA 4UUSA 2MLKA 2W7NA 2CQKA 1ZK8A 1KZHA 3QAHA 5FKOA 4J00A 1J9IA 3FDYA 4UXNA 2XGEA 5GADJ 2IP2A 2LH9A 4C2TA 3RKYA 2LNBA 4AIJA 2XAFA 2X6OA 3K7AJ 5DCMB 3SEZA 1DUXC 2NVXJ 3PM1A 1FYMA 3CC7I 4CYCA 1H9TA 2WTEA 2E1NA 2DTRA 4AYBN 2AQEA 1KYWA 2XKOA 4IQ4A 3N05A 1DQUA 3K70D 1X2NA 2JVHA 2XKPA 3LSMA 4A93J 3HRSA 4BY7J 1E2XA 1ZLKA 2Y0SA 2CGPA 1T98A 2F4OB 2KIQA 2TDXA 2MGQA 4HBLA 4R8HA 3CCVI 1HQCA 1BW5A 2HGCA 1TC3C 3A2KA 2F4MB 4U7BA 1WJBA 3TL4X 2BY2A 2RREA 3CUQC 3CESA 1GVJA 2W25A 2HYGD 2QQAA 2EFNA 3GYHX 2R92J 1BN5A 1MMGA 4DYQA 1H0MA 1Z6RA 1SMTA 2QWWA 1VTNC 5FRNA 3OYDA 2MSYA 2OZUA 4UUVA 3L2CA 2E1MC 4Z2YA 4YIRX 2MH9A 3OSGA 4L9VA 3REOA 1VQLI 2QM3A 3FZVA 4HYEA 5CVUA 4FQGA 3ZQIA 3D5LA 4C3JJ 3MKYB 5JVTA 2ZMEA 4HAMA 3I55I 4HV6A 4EJTA 4I01A 4WK8F 1B72B 2RQQA 5ERIA 4A3BJ 4P9UA 3I5UA 3AL0C 2GOXB 2K9NA 4IHVA 3W6JB 1WCMJ 5CLSA 1MMAA 3ABTA 1HC8A 1R5ID 3NWTA 1D5YA 4ON0A 4CZCA 2PMHA 3N97A 1JUPA 4DYRA 2XVCA 3HPGA 3KX2A 3OS2A 2E1CA 4G7OF 2L7KA 4D0PA 1YRNA 2DFFA 1CF7B 2JJ7A 4WCGA 3MZYA 2X48A 4OU0A 3DTKA 1B4AA 4CCJA 2E2JJ 2VXDA 2TCTA 3OWTA 2P5LC 2NVQJ 2XIGA 3L2RA 4XK4A 2MLGA 2CW0F 2BGCA 2L9RA 1XD7A 4JX5A 4OMYA 2CJJA 2DOAA 2O6GE 5CVJA 4B44A 1HCRA 4IKFA 4CYDA 1A5JA 1Z3XA 1H88C 2IPQX 2QF7A 1V5GA 4IRHA 1SC7A 3S2HJ 1I5ZA 1G4DA 3TO6A 4EJOA 2HFHA 3MKZA 1DP7P 1F5TA 2PJPA 2HZTA 2X1EA 4A3CJ 2V26A 1HW1A 3QPTA 4MFDA 4EQQA 3FMSA 1VQMI 4B4CA 2X1DA 5KNLA 4G12A 2CU7A 2OV7A 3PIOF 2KRHA 3DF8A 4M3DA 3JCUC 1FJLA 4ZJZA 5LLQA 3BPXA 1ZREA 5DUKA 5LHGA 2AQFA 2ESHA 3CCLI 4EEFG 4RM3A 4CGZA 1G3WA 5D4SA 3KP7A 4UUSB 4DZPA 3IWFA 1BL0A 1D1CA 3W6KB 3IV5A 1HXDA 3QP5A 1IXSB 4GYIA 2KQRA 5BS6A 2MD0A 3E6MA 1IUFA 2IW5A 4R79A 4HDVA 2IA2A 4HV5A 1RNLA 2X6WA 3L2VA 2A05A 1I1GA 3VODA 4CCLA 2EZHA 2LKXA 5HS8A 4CYCB 1FX7A 2CUJA 3F6OA 4Q5SF 2KRFA 1O7FA 5E18F 3RIRA 4XBFA 4RGRA 2COMA 1LQ1A 4MTDA 4OAZA 2V9VA 1RR7A 3G4SI 2DO7A 2M7BA 2PLYA 1HW5A 3SZGA 1QZYA 3KZIC 2FMLA 3COAC 2EB7A 2HQAA 3PNTA 2ZJPF 2VBZA 3BTCA 4LMYA 2R7WA 5EGOB 1PUEE 1RUNA 2YU9J 5HLIA 3BTIA 4XONA 4B1RA 4ESBA 2ZFWA 4KA4A 4KFCA 5KK1A 1C0WA 2Y31A 3F6VA 4YIIA 3L9FA 3LWFA 4IL6C 2HOTA 2FMYA 5DV5A 1CQTA 1I3AA 1WI9A 1ZELA 3I0TA 1RR8C 2E71A 2CFOA 1FBSA 3VYTB 4E6KG 4E7SA 4DJAA 4UUTA 4NNJA 5CKTA 3J80K 1JT6A 3C7JA 1KYZA 1YOVB 3DLAA 2ZMEB 2IGOA 2A6TA 3FBNB 2GXAA 1W5TA 2EZLA 1XS9A 4CZZA 1Y8QB 1WPKA 3I71A 3A1YA 3JRHA 3WTXC 3CJTB 1LFUP 1X1PA 2OC6A 4NC7A 4J01A 2VUMJ 2EPFA 1D8JA 5IP7J 4N4OB 3CMAI 1XGSA 1L3LA 4I0AA 1P4WA 2LD5A 1BR1A 2OD5A 4CO8A 1WJFA 1YRNB 1TWHJ 5TRDA 2HOAA 4LG0A 3S1MJ 1MIJA 1ZGAA 2M2EA 4RLQA 1FC3A 4QPOA 5JLWA 1D1AA 3ML6A 5FRMA 1TQIA 1R71A 1IG7A 3KEQA 5LHIA 3GEZA 3CLOA 3WTSC 3VFZA 1PVEA 4B3AA 4Y52J 4Y15A 3RTRA 2PMZN 3IAS2 4L5IA 1BI3A 3WTUC 2ZO4A 4A3FJ 2DT5A 2V6EA 1EH8A 2DCEA 1Y0NA 1JXSA 3LAPA 1F36A 2DA3A 1ETWA 2FF4A 3CP2A 4HRIA 2XAGA 2W57A 3IUOA 3W2VA 1S9HA 3X2QH 1R58A 1U9NA 3MKLA 2RNGA 3Q9SA 4IF4A 4X1EA 4B48A 5H6QA 1VF9A 3ECOA 3W6VA 3LA2A 4PSWA 2L01A 2Z16A 4FCYA 2HYJA 2OA4A 2VKHA 1CGPA 2DA2A 2CMPA 5FROA 1PUFA 2FSWA 2BBYA 1O57A 3S14J 3CUQA 2F5VA 2W48A 1R23A 4GXOA 5ILSA 4HX4A 5D6FA 5K7HA 5C44J 3CC4I 3VPRA 3BJOA 2BXYA 2XGXA 3IAM2 5K1YA 2GA2A 2KDOA 3KZZA 2VC0A 4IX7A 5FKKA 2BVMA 3B73A 5FKMA 3NWSA 1I6XA 3DPUA 5IT9Z 1ONVA 2VKVA 3EUHC 2WY8Q 3TDUC 2RKHA 2NVYJ 1GT0C 2VPRA 1X1CA 2FRHA 1ZYRF 4OWRB 4RLFA 2VASA 4DOZA 2IS2A 3IWZA 2N8GA 4CCMA 3DPTA 2R5ZA 5E79C 2ZSIB 1ZRDA 3R4KA 5FD5A 3EDPA 2EA4A 1HKSA 2YUSA 1MBEA 2DK5A 1XDSA 3OR1C 1KU7A 2XSJC 2X9DA 2O8XA 2K27A 3FXUA 2HPIA 5JR3A 1YJNI 3RKWA 3NQOA 4ETSA 3SXYA 4IOAF 4HLXA 2EFWA 4IVNA 1TP4A 3CF5F 5FGMA 5IT3A 1XSVA 2R7DA 3WTVC 3KP3A 3BQYA 3BP8A 3F8MA 5BNGA 1YHQI 1X3WB 3WG9A 5DCFA 1DPUA 3T8TA 1WGXA 5HLTA 2V7FA 1Q1VA 3KIOA 1EA3A 2VN2A 2MD5A 2EA2A 4GO1A 3QWLA 1MDMA 1A31A 4E7KA 1K4TA 1BIAA 4JQFA 2L9NA 5H20A 4KISA 5CJ9A 1FZPB 1A35A 2VKEA 2YR2A 2FA5A 2E7WA 5JHFA 1TT0A 1RZ4A 4A5MA 1RPWA 3QPHA 4D5CA 3J81K 4AIKA 4Q4ZF 4FE7A 3HTSB 4IJAA 3BG9A 3QOPA 2KZGA 3BTLA 4M9SA 1YE9A 2ZNZA 5EZGA 1TTYA 2FBKA 3KE2A 3QYEA 3CCQI 5DEQA 5LGNA 3F3XA 3SQNA 4NBQA 2QQ9A 4BAYA 3GXOA 1FEXA 4BKXA 2A5WA 2R7OA 2JPCA 3Q0UA 5F0HA 2LTPA 3NAUA 2WA0A 3ZMSA 5GPCA 2LREA 2W4SA 1BIBA 2UUZA 4G9YA 4LG0B 4EVIA 4RB0A 3F9KA 1ZKGA 1WHUA 1JUSA 1ZG5A 2NNYA 2RN7A 2X6XA 4C9YA 2ID3A 4QLCU 2M34A 3HOYJ 1XSXA 1IN6A 2HXOA 3ERMA 3GTPJ 1KGSA 2QLZA 5HDKA 1MGTA 1ZQ3P 1U78A 1ENHA 2Z2SB 4M74A 2P5VA 1A6QA 1TBXA 2KRCA 1SVOA 1YS7A 2KT0A 1ETYA 3FXKA 3AFHA 3RPUD 3ZXSA 3J7YJ 3HOSA 2MC3A 1QVTA 4EATA 3DKYA 3HOVJ 2G0EA 1NK3P 3EETA 3RDIA 3ZOBA 2IBDA 2JZYA 3K1MA 4LLGF 1MBJA 4M3FA 1JKOC 2VBXA 3PJRA 2Y48A 1SFEA 4JBAA 5IP6A 2TRTA 2PBIA 1ETKA 3ZCOA 4RBOA 1HW2A 1J7KA 1OCPA 2P8TA 3BOQA 3HRTA 1REPC 4PSXA 4ENJA 4I09A 4M6XA 3DLLF 5LD2C 5BOXA 1TQPA 2JRTA 2VBYA 1RESA 5M5YJ 2DA6A 2JA5J 2DOEA 4HEA2 3CCEI 1LJ9A 1PUFB 2KDZA 4M6VA 2STTA 2LFBA 1TNSA 3CUQB 1IUYA 2MFZA 2HS5A 4RAGA 4LLNA 4HX7A 2XAHA 2XAUA 4M9ZA 2RGVA 2ESNA 4QTRA 3LAJA 3VSLA 1XC5A 1BW6A 2E1MB 5IOZA 3L00A 3FWEA 4ESFA 3OL4A 1DU6A 5FLXK 3GWZA 3K1NA 1JE8A 2Q0OA 2QKLB 4Y33A 1RC9A 3VYSB 4ZC3A 2DA1A 4JOMA 1X3UA 2QYOA 4HQMA 5F1RA 3SZTA 3LQRA 1MJBA 4XLHA 2UV1A 2JUCA 2R5ZB 4IHXA 3K4JA 3FM5A 4Z6YA 1FMVA 5LEKA 4HX8A 1X2MA 4XSZF 3AL0B 3GFMA 5D8KB 3GZ6A 2IS1A 3HKZA 2HR3A 1T38A 1FOYA 1YW7A 1NG7A 1OQYA 1LB2A 3K69A 2FXAA 3ZMZA 1R5HA 4XR6A 2VLAA 1K61A 4M72A 3VOEA 2FE3A 4WXDA 3CC2I 3HIFA 2A6EF 3R6SA 1HDPA 4XLFA 1R4MB 5J4YA 4QWQA 3HDDA 4WF2A 1UB9A 4UVAA 2M8EA 3OIQA 3LSPA 1G59A 1ERDA 1R7JA 3SFIA 3I64A 4HW0A 4KICA 3RSNA 3S16J 4EJUA 1H8AC 2ZC2A 3TP0A 1Q1HA 2DODA 3DTIA 2MC4A 2H6BA 4G8XA 5D5XB 2ELJA 1MDMB 2QGUA 3ZP5A 2HYFA 3LL7A 2B7EA 1XX5A 2HKXA 5L3CA 5K7FA 3ZMVA 1KU2A 2PQ8A 3E7LA 1B59A 3ZN0A 4BE1A 3V8KA 5E8IA 4XLAA 2R7ZJ 5CVRA 4KT6A 1LDDA 4A0ZA 4AYBA 4ZTFA 4BXXJ 1K7AA 3KEOA 1MBFA 2DLLA 6PAXA 2R7FA 2DFEA 2K9LA 3JTHA 4MIMA 4CSWA 2CO5A 5IPAA 3QYBA 1D3YA 1WVRA 3JREA 4IRIA 1T08B 1K6OA 5GP9A 3L09A 2XF7A 1JKRC 2AO9A 2JN6A 1R5GA 2LC2A 5E3MA 2DFIA 4WWCA 4HNVA 2VJ5A 3WHCA 1FIPA 4PGHA 4C3IJ 4ZZDA 5F08A 4ZZLA 4S04A 2DXIA 1OISA 1S8NA 4U7DA 5BPDA 4PGGA 3GTKJ 2D45A 2F5CA 3ZN1A 1R49A 1FYLA 3LSTA 3EUHA 4D7MA 4CCKA 5C4XJ 1EF4A 4FTHA 1EV7A 2ZXHA 1BI0A 4LIVA 1UCRA 1NH3A 2GOMA 1JTYA 1XGOA 2V9KA 2DFHA 1IN8A 1YW8A 3FM3A 2Z33A 2L4MA 1G6NA 2F5EA 2V9PA 1BI1A 2WY7Q 1ON1A 2XF5A 4RAZA 4ZYGA 3NARA 2BHZA 2ECBA 2VQGA 4G6DA 3FXRA 2W00A 3KEYA 5DD8A 4DGWB 1OYYA 2J5OA 3K9TA 4E4HA 1ZRCA 4L0ZB 2KPMA 1AHDP 1VQKI 2CYYA 1U5TB 2LY1A 4F55A 2LMDA 3HSRA 2KIMA 5CVIA 1A36A 4E7IA 4F3QA 4RB3C 2DBBA 1UELB 4I02A 4GRIA 2CQNA 2VBWA 4OINF 1IXCA 3ZR8X 3U1DA 4BQAA 4M71A 1I3QJ 1LDJA 2DDBA 3U1KA 2Q2EA 3H1CA 3E0JB 3RKXA 1MNDA 3TO9A 2FJ1A 1BI2A 2RDPA 2ID6A 1EKEA 5GAEJ 5LBQA 2ZNYA 3TMOA 1STZA 1BM9A 3T5XA 1AKHA 1Z91A 3MAJA 1D1BA 3S2WA 1P7JA 1T56A 2EFOA 3ECHA 2PX9A 2IGNA 3V7RA 1ZN2A 5BQTA 3O2PE 3K4NA 4DNCA 1IN7A 2ECCA 1DDNA 1MJAA 5EEHA 3L1PA 3PFYA 2HEOA 2M5WA 1ZLJA 2EZIA 2HOEA 1WSUA 4A3IJ 1S5LC 2AHQA 2VQCA 5L3EA 4GFBA 2NS0A 1XSDA 4LFUA 1SMYF 2D1VA 5E3NA 3LSKA 2E5ZA 1U2WA 3ASOH 4Q47A 3SYTA 3K4CA 1ETOA 2K7LA 1IN4A 3OYHA 1E0EA 2P6TA 3BDDA 4E7HA 3VB2A 3OR2C 1IO2A 2Q8KA 3V7CA 1XGMA 1MMNA 2LY2A 1ITYA 1IZ1A 4GCVA 2BE5F 2HPMA 3H9GA 2VOPA 3OSFA 2RC4A 4LJZF 2NVUB 2O0YA 4ZYHA 1KU3A 2YS9A 1SAXA 4L18B 3FXQA 1I27A 1KQ9A 3MQ0A 3MCZA 4M3BA 5BPIA 4PCQA 3F0CA 1T6SA 4EV0A 2P7CB 3RYPA 1HSTA 2B9SA 3K70C 3G3ZA 2K5CA 2BXZA 3LSGA 4Q48A 4OIQF 3AG2H 3CZ6A 5K5QA 1TZLA 4AIDA 1UHMA 5F04A 2F5FA 2ELHA 4I76A 5J1RA 2FOKA 3QQAA 5E1WA 4FX4A 3PO3J 2UWMA 1R4NB 4I6ZA 5J47A 5LHHA 1OCRH 2QA4I 4IOCF 2YX7A 1QPIA 3E6DA 1P2FA 2FOWA 2W24A 3CCUI 3HOZJ 1G8XA 3RQIA 1YW9A 3BJ6A 5HOOA 3RKQA 3E6BA 3IL2A 1T2KA 2VONA 1HLVA 2OBPA 3E97A 5J4VA 5EG0A 4BQNA 1ZRFA 3HOWJ 4XLNF 1XTAA 1K4SA 1JT0A 4BEHA 3DBHB 4BL0B 2K4JA 2KL4A 4MO7A 1SVMA 2LKSA 1T0FC 3WU2C 2UXNA 3DBLB 3I54A 5CQEA 2R0QC 3VYUB 3J80Z 2Z1DA 2GLOA 1P9QC 1WI3A 2H6CA 2P0WA 1POGA 3EYYA 5D6EA 1SFKA 2WC2A 3LSIA 2AXTC 1F43A 3O8GA 1WWXA 5AIPA 1P4AA 2MABA 4W1UA 2L3DA 2DQLA 2YX4A 4D1QA 1GUUA 4PJJA 1IRXA 4EGYA 4BUPA 3FKIJ 4KJZA 3A02A 1J59A 2W1OA 3DEWA 3V42A 1O3SA 4RB2C 2F6CA 1FTZA 4LD5A 4B3XA 3A03A 1K83J 4ZDLA 3WU1B 3OMYA 3S1NJ 3G71I 2JUGA 1D8KA 2Q2EB 2DMQA 3I58A 1DGWY 4KITB 2PMZA 3WTYC 2L7ZA 3TKYA 3JR9A 1JTXA 4LLLA 3HB9A 3V8JA 2FNPA 2IEKA 4L9TA 5CQGA 4E7LA 1YO5C 4IRGA 2FNAA 3JRDA 3JRCA 1ZARA 3QPLA 2BZTA 2GXGA 1K6YA 1LKXA 1FBQA 4I99C 5M5WJ 3DKXA 3TOBA 5DM6F 3K4LA 2VJJA 4A3MJ 2CV0A 1EH7A 1W0TA 1XB4A 4XKWA 2LK2A 3DP7A 2ZXJA 1QVUA 1XN7A 3DFGA 4ITVA 3QYFA 2BYVE 4M3EA 1Y39A 4UV9A 2DT6A 2JA8J 1T39A 1W4MA 4W97A 2HQRA 3S15J 4PJ0C 1Y8RB 3AG4H 4P9FA 1OCTC 3G1LA 5CVVA 2ZJQF 1U3EM 1HKQA 2LOOA 5F27A 1QRYA 4HLYA 2M8GX 1QU3A 1AOYA 4KYWA 4B09A 2HDDA 2LKPA 4XOPA 3WGGA 1KA8A 2OZ6A 3U2RA 2LR8A 5A2QK 2EFQA 4JX6A 1OLTA 3F8NA 4UNOA 2X1CA 1Z6TA 3ZQCA 5EEAA 3BROA 5K5OA 3IH2A 3WGIA 2RV8A 2D1HA 5D5WB 1XG1A 3VSKA 3OV8A 4RM2A 5HNHA 3WODF 3S17J 4CA0A 1XMXA 3EUAA 1MH4A 1ZAOA 5AIQA 5L3GA 3H3VK 1G3SA 1M1EB 3CQZJ 1Z21A 3HUGA 1KU9A 5F64A 1JJ8C 4NHJA 2QUFA 1FOKA 3H3ZA 1RETA 1IC8A 1FLIA 4L9NA 4DZJA 1W36C 2CV1A 4ASNA 2M45A 1BA5A 3CJQB 4XRMA 1NTCA 3BZ6A 5TISC 5EG0B 3GTJJ 2CG4A 1OFCX 4U87A 2MBFA 4BEHB 5HLGA 1XCVA 2ADUA 4WX9A 4F93B 2KP6A 4IO9F 3QRFF 1BC7C 1D0ZA 2OUMA 4IEJA 5D5UB 3QU6A 4BXFA 1VQ8I 3PNYA 3PIPF 1YTYA 3J81Z 2IT0A 4CHUA 3OYEA 4JP0A 4NDLA 2HTSA 3GCMA 4FASD 3V8LA 1RRJA 3TDZC 2O61A 4QPQA 3CCYA 2ZJ2A 2DMUA 3BG7A 3MWMA 2EIMH 2DOFA 4BH9A 1DP3A 1OPCA 3GTMJ 4A69C 3CTAA 1F4KA 1EJ9A 4PK4A 4YIFA 3JRAA 4G7ZF 1PP7U 2V1NA 1WJEA 2BY0A 3BC8A 3GFLA 1SAUA 2CWEA 4I7HA 4XKVA 3KPHA 5E8GA 2ZXWH 3E5UA 2Y75A 4AVZA 1BC8C 3ISPA 3HBLA 2CQ7A 4KN7X 2VT2A 3QU3A 3PFIA 2P81A 4IHYA 3OYJA 1ETQA 3OIPA 3FK6A 5FLVA 1QPMA 1ZGJA 3MEXA 2XGDA 2KMUA 3C2BA 4BDZA 2ZBKA 3L7WA 1WH5A 4BQQA 3L2QA 3BR1A 3ZQ7A 4RGUA 4CH7A 1FIAA 4IHTA 1X1AA 1XMKA 3H3UA 3K1PA 5M3FJ 2L0KA 4UY8I 1XCBA 4XQFA 3HOTA 3PSIA 1VQ4I 2R7VA 1USTA 3ABLH 3EQLF 4D9JA 2DMNA 4LITA 4X0GA 2UZKA 4L9JA 1DU0A 9ANTA 2LG4A 3I9V2 3D5SC 1YJ9I 3KFWX 1T33A 1B6AA 2JA2A 2IXSA 2PG4A 2HVQA 3OL3A 1F9NA 2BY3A 4N9IA 3CLQA 1OCZH 2PN6A 2XPVA 4PUSA 2E2IJ 2NNNA 3Q0VA 5FKNA 1Z7UA 2F2EA 5F0FA 4TV7A 1GXPA 2XAQA 2EH3A 1E3OC 2LF8A 3G2BA 3TQNA 4BXUA 1O4XA 2ZJRF 3K6GA 5ILVA 1X3ZB 3AAFA 1WJ5A 4OIRF 1Z77A 1JKPC 1UHSA 1SVLA 4Y7NJ 1B8IA 1PJRA 1WQ2A 5FLXZ 2KLOA 2V1UA 3GTOJ 4YG2F 3TW6A 1DPRA 5B1AH 2R7SA 1Z9CA 1Y6IA 4HOBA 2HVSA 1VQNI 3A01A 4N9HA 4KNYA 5LRRA 4ZYEA 1X1DA 2XGCA 1Z3YA 5GAGJ 4Y4RA 1SFUA 3M1EA 1SFXA 3ZQGA 3OYCA 2VJIA 1TL8A 1ETXA 3D5RC 4M6YA 5F6FA 4EJVA 4BE0A 2J5PA 2KJCA 2K02A 3DBRB 3JW4A 3LA3A 3A0BC 1QZEA 2GZWA 3FXLA 1YJWI 1TT5B 3HUGB 3DCFA 1TW3A 4AWXB 3SEQA 5FD6A 3OS1A 4NB5A 1UJ8A 3PL8A 2X51A 4O6JA 2BV6A 3H35A 4KN4X 1WJDA 1MZBA 4FETA 4BDYA 2V6CA 4DYCA 2JVGA 2XC7A 4ENNA 3ZGKA 4AM3A 1I50J 3EPZA 4JX4A 3AG3H 3IKTA 3CO6C 3RJPA 2QQBA 5GTHC 5FLMJ 3OYIA 4GDFA 3G1MA 2OPTA 2ZKZA 5E1XA 5L3BA 3FK7A 2X85A 2Y69H 3U9GA 2NOJB 4OOIA 2M3AA 3KYDB 3TGNA 3F22A 2GIVA 2V79A 3VYRB 4ZYDA 2B0LA 3PQJA 4A0YA 4DQ2A 1OKRA 3W2WA 4BE2A 3FMQA 4HA8A 2KHMA 3HZJA 4PZJA 4BY1J 2K3FA 2WAQN 4PFOA 1QA6A 2NAZA 1QGPA 2QQ8A 5LRSA 2IGMA 2M4GA 4RGXA 1X4PA 2EV0A 4PDKA 3M1CA 4U0YA 3ZPLA 2QSGX 2IS4A 1FWZA 3WTWC 1IRZA 3FF5A 5H6RA 5E20A 4YRVA 5ED4A 3IP4B 2KFDA 3F23A 1W5SA 2W85A 2M7AA 3M7GA 4A3LJ 2VE8A 1GV5A 4JYKA 2P6SA 4P96A 3BJAA 5J1UA 1BOAA 1SD5A 2GXBA 4L5JA 3DV8A 5KAFC 3PNVA 4ESJA 1R22A 2GAUA 2WBMA 3CCSI 2BOLA 1N78A 3GTQJ 4H4KC 1U6GA 4HF0A 4YFKF 4GYGA 1GLNA 1ULYA 1OYIA 3RI4A 4ZH4F 1UZCA 3HM5A 2VOOA 3TBIA 5K7ZA 1V54H 5DYMA 1IDZA 1TLHB 2A5YB 4CDGA 5JVGF 2IS6A 4HG2A 2C6YA 4OIOF 3SFZA 3ERED 1IAWA 3HTUA 4XICA 2GBYA 4R1HA 3OYNA 1VI0A 4S05A 5HS7A 1QZZA 1ACIA 2FQ4A 3IRRA 2H8RA 5LFAA 1FBUA 5M5XJ 2VC1A 4D7NA 5DUIA 2EBIA 3HG9A 3ESWB 1ZHFA 2MA3A 3FBIB 2L7FP 2LVSA 1JJ6C 4PJLA 1B8IB 2NS8A 1O3QA 4CCOA 2Z3YA 4BHPA 2B63J 2E34A 2JSCA 3LA7A 3I4MJ 3JSPA 2EK5A 2HKOA 2DN0A 3FXJA 4KIGA 4N0BA 3A01B 2VPLA 4BHCA 1FP1D 3NEUA 1QNTA 3MZ8A 2CSOA 5J6XA 3G1OA 4E7JA 4WXHA 1D5VA 1K79A 3CO7C 1MMSA 2EIJH 2A69F 4FHTA 1Z1DA 2CS3A 1APLC 5HS9A 3E3VA 4K2EA 4EM0B 1S3JA 3ZMUA 2JWTA 3BY6A 1TWCJ 2W84A 3OYMA 1FYKA 5JFRA 1NHAA 4XMYA 4HZFA 3W3CA 3OIOA 3HYIA 2YPRA 3BCBA 3OYKA 3ZRGA 4ZDOA 5B66C 3GTGJ 1HSJA 3GZNB 3DEEA 2EV5A 2BY1A 2XRLA 3SJMA 1YS6A 1FNNA 1N77A 2IRFG 2CFXA 1ZH5A 3Q0WA 2P7VB 4NQWA 3NRVA 4UB6C 2NVTJ 3IKVA 1MW7A 1AA7A 3IHUA 3C2HA 3HGYA 2GQQA 2M9HA 3O8HA 4YEJA 1IRFA 3KLNA 4A3DJ 2G7HA 2JMWA 4IPAA 1P6RA 2K9MA 2MW8A 1G3YA 3VEPA 2A68F 1UHWA 2K3PA 5CPRB 5JHUA 1B9MA 1YX3A 3WTTC 2WV0A 3FKJA 3ONQA 2DPUA 2VIXA 1IDYA 1MSFC 3GZ5A 1Y1WJ 2AS5F 2FQ3A 2L7MP 2A6HF 2CUZA 3CCMI 4RAYA 5DM7F 2R5YA 3FHZA 2H27A 2JK3A 2R7XA 1OCOH 3ABMH 2F5DA 2O7OA 2E36A 1XMAA 1OYWA 3L2WA 3KP2A 3QOEA 3HRMA 4MQVA 3E5QA 2XROA 3AG1H 2R7UA 1TWFJ 4XIDA 3OYLA 2XASA 4CXFA 2G7UA 1LUJB 2HI3A 4N4NB 1P4XA 3I56I 1LNWA 1VQ9I 2JA6J 2E35A 2L2OA 1H89C 5HVQC 4XKCA 2Y9YA 2Y0MA 4FT8A 3RPQA 3WG7H 2PI0A 4KMUX 1Z0XA 1L0OC 3CUOA 1AU7A 3K0LA 3CDIA 4IHWA 3K2ZA 2HDCA 3E5XA 2D5VA 4HNUA 1KQ0A 2WAEA 5FFZA 2M30A 2DA4A 1IW7F 2CW7A 2HWVA 3E6CC 3UNGC 4IQJA 5KCMA 4LIUA 3T0YA 1BOBA 1IV8A 2PMUA 2YU3A 3FIWA 4RMNA 3FMRA 2OTJI 3A4CA 4Y17A 3ZQLA 2IAIA 3J7AO 2LBFA 3LOCA 3LMMA 2HTJA 1VNDA 3SDBA 4UB8C 3BTJA 3DEUA 1J5YA 3I53A 1W0UA 1F1ZA 2LSOA 4DW6A 3S3OA 2K40A 3S1QJ 3ROUA 3S3MA 2EILH 4XLEA 3FHNA 3AKZA 3I59A 5FKLA 4PJMA 5ICGA 3BG5A 1A04A 4F7ZA 4Y13A 3MVPA 3K4KA 2HXIA 4XNFA 1IJWC 2MYSA 3K4BA 1VZ0A 2WB1N 3KLOA 2VJ4A 3IH4A 4II2A 4HPQA 1MD0A 3HOXJ 1MBHA 1WJCA 4XM3A 2E60A 1RKTA 4BBRJ 4CCNA 1R9TJ 2H1LA 5DTDA 3TO7A 3WHBA 3CDHA 5TGTA 2XPWA 4LB5A 3IH3A 3H5NA 1MMDA 5EGOA 3S93A 3HJEA 3HSEA 2QSFX 2ZCWA 3BR3A 2DAOA 4EJWA 1W1WE 5EDNA 2JT1A 3H5AA 5J8FA 5GPAA 1LEAA 1ZTRA 3RPUA 4O3MA 1PYVA 2ETHA 1Z7LA 1HA8A 4Y3OA 4J19A 3M4OJ 5EZHA 1X58A 3GFJA 4AIHA 4A3KJ 4I0BA 1VQPI 5A2QZ 4LGWA 4NQWB 4B47A 2R7RA 2HQNA 2BVLA 3HRUA 4MLOA 2HU9A 1S29A 3ZMDA 3CCJI 3D1NI 1X4OA 3DXJF 2DI3A 2VKDA 2VQHA 2CQXA 3B6AA 1WFXA 3WTZA 3I4PA 3CD6I 1LFBA 1OMIA 3CJNA 2BEOA 1Z05A 3FXOA 5FFXA 3P9IA 4C2MJ 1VQOI 1LE8A 1FY7A 4OIPF 1W7PA 5IYBJ 2IA1A 5HODA 2NS7A 1IV6A 1HBXG 4E7ZA 3GMEA 3LFKA 3TP3A 2CQQA 4BNCA 2A3SA 3IC7A 1IGNA 3BLYA 5D5VB 2WAFA 2R5YB 3VDXA 4NC6A 2EINH 1TWGJ 1RUOA 3W2AA 4DIQA 2OJED 3MN2A 1MH3A 4YFNF 1V5EA 5CYVA 5DDGA 4RB1A 1GVDA 2NYXA 3MMYB 1FOXA 2L9VA 3HHGA 2HZDA 3EUKL 2Q1ZB 1TNTA 2FBHA 3KYCB 4CICA 3F8FA 1R00A 5HNFA 1NK2P 2GA1A 1RIOH 1IXRC 1HF0A 1KQ8A 4UVCA 3B02A 5J40A 2R7QA 3JRIA 2M87A 4QSHA 5IYDJ 1AKHB 2E1OA 2FBIA 2LF7A 4V2GA 3M07A 4FISA 5IYCJ 2RQPA 2ZXIA 5FJ8J 5ICEA 4ABZA 4C3HJ 3R60A 1E3HA 4RA2A 4MTEA 5IP9J 2GM4A 4UVBA 1D0XA 3DU5A 1FPQA 3BT9A 4AVPA 2VE9A 5JLXA 3RYRA 4BBSJ 1MBGA 3T1BA 1MNEA 3RCOA 2XRNA 2XB0X 2Y9ZA 2Y0SN 3GLXA 3HSFA 3ZQQA 3P5JA 4A5NA 4A6EA 1HOMA 1LDKB 3C2GA 1K78A 5EF6A 3CDLA 3DWLE 2LBFB 2RVCA 1P7IA 1S72I 4A3GJ 2M0CA 2STWA 4MQ9F 4F92B 3DTEA 2VODA 5TJJA 3GVAA 1V4RA 2HQ5A 3LSHA 2LY9A 4A12A 1UFMA 1GDTA 2IJLA 3F8BA 1UG2A 4F91B 5J3LA 3I59B 4HF2A 2ZFUA 4LG3A 4WXCA 4U0VA 2KISA 2Z99A 3KETA 2KJBA 4HNTA 2NXNB 3RZDJ 3BR0A 5L3DA 2NRAC 1OR7C 2O3FA 2X4HA 2FX0A 2ISZA 2XV4S 1PP8F 3JTGA 1SD4A 1J2XA 1ZG3A 1GHCA 1U5TC 2QVOA 2R93J 2PEXA 3R0JA 1HDDC 2QSHX 4L5EA 1SANA 2JTVA 1W36D 4B8XA 3OYGA 3H0GJ 3UR3C 3J7AY 4IHSA 3O3KA 4A2UA 2CH0A 3MZHA 4X6AJ 2M4KA 3LFUA 3V7SA 2KIFA 3J7ZI 4FX0A 4KIFA 3CJRB 5ILUA 3JRBA 1ZR4A 1O3RA 5D4RA 1MSEC 2XB5A 4XOTA 3ABKH 4JK1X 4FE4A 2O8KA 1BBYA 2XPUA 2X6YA 5K5RA 2ICWG 3DKWA 2I10A 2O5RA 3M8EA 4LOCA 1AWCA 2E7XA 2DA7A 1VQ7I 3VWBA 3HGGA 4G6QA 4V19K 1OJLA 3SHFA 4XRFA 5KHDA 5D8LB 4BHBA 1LE8B 4KIBA 2XF6A 1W7PB 2DMTA 3PUFA 2K9SA 3CMEI 1V55H 4KDPA 2AXLA 1PDNC 4MNUA 1FMWA 4YELA 2A07F 2Y2ZA 3GFIA 3S3NA 3WU0A 3HXLA 2QEXI 2WWYA 4XRSG 3RZOJ 3GLLA 2EQRA 3M8FA 3PQKA 1LEBA 1MNMC 2QZ8A 1XDUA 1FSEA 4LK0F 4ENKA 2M1BA 1R36A 1U9OA 2DYSH 1P92A 3H5RA 3MD2A 4EM2A 1S7AA 4NC8A 2O9LA 3BZCA 4EGZA 3L2UA 3BWGA 4MHGA 4A0XA 1QBJA 3ULQB 4EMSA 3KP5A 1MBKA 3N4MA 5E3LA 4CUGA 1A6IA 1BJAA 4ENMA 4C30A 2LDUA 5AONA 2OQGA 4YFXF 2V1XA 3C18A 5FB2A 2VI6A 4BU2A 1I39A
chains in the Genus database with same CATH topology
3C3WA 3ABUA 3KP6A 4UHTA 4O5VA 1YLFA 3LQQA 2RNJA 3IRQA 2D2WA 2GWRA 1TQMA 3JAMZ 1K78B 2MH2A 4XSXF 3DPLC 2DK8A 2K86A 2QBYA 2L54A 1SD6A 1T0FA 3P9KA 3EYIA 2JPBA 3C1DA 2XAJA 2KIUA 1XGNA 2Z9OA 4HDUA 5E17F 4U88A 2ISYA 3Q9VA 3TOAA 1J75A 1IN5A 5HDNA 4A6DA 4KUMA 4XLPF 2XHKA 3GUDA 2EFPA 4G7HF 3KCCA 3OOPA 1TW2A 1ZG1A 1O7LA 4E70A 5BMZA 5EEGA 1WRJA 5JI6A 5LGTA 3JSOA 2VXZA 1ON2A 1MKMA 4M73A 2OAZA 2L02A 2DW4A 1EH6A 4HQEA 1R1TA 4I2OA 1YYVA 3GO5A 3GX4X 3ELKA 4P55A 2EV6A 3WE3A 4KMFA 2G9WA 3FX3A 1FT9A 4IXAA 1SD7A 1R1VA 1O3TA 1JHFA 4H0EA 3JAMK 1R1UA 1USSA 5IT9K 1JGSA 4L0YB 1OR7A 2FEZA 2P5KA 1GXQA 3KP4A 3WGHA 1U5TA 4G94A 3M9AA 2OU2A 1B1BA 3D0SA 1V3FA 2FU4A 2X0LA 1WKMA 2PFBA 3F21A 1W7PD 2KKOA 1YQAA 3V4GA 1YFHA 1IRGA 4BYYA 1G3TA 3MFKA 2QBYB 3R0AA 2YSRA 4MEXF 1J0RA 1ODDA 3T8RA 5ICCA 2ACJA 4GGGA 1HKTA 5DCMA 2A61A 5FO5A 3P7NA 5HDGA 4UV8A 2K4BA 1JHHA 1H9GA 3F8CA 2DPDA 2EWNA 3O6BB 2VT3A 2DQRA 3BPVA 1YG2A 4AD9A 1FSHA 4P5OA 5E1ZB 5L3FA 3ZMTA 2H09A 1LVAA 4LB6B 2IA0A 2P4WA 5J8CA 3KZYA 1U8RA 4HF1A 1QO0D 1YIOA 4I98B 4KT5C 4MGRA 1S6LA 2QENA 3HHHA 4U0WA 2H94A 3WE2A 3GF2A 1QQIA 2IVMA 3F72A 3QP6A 3SZPA 2UXXA 3P9CA 1CF7A 5DD4A 3GW2A 1MJ9A 5ICFA 3Q5FA 4EM1A 2R3SA 3R61A 1RI7A 4LK1F 5LGUA 5LEJA 1S7OA 2OQRA 1B9NA 4M9XA 3DQVC 4MEYF 3H92A 1E17A 4OMZA 1FP2A 2DU9A 2O03A 5KVRA 2L4AA 2EJRA 1IF1A 4RS8A 2V1DA 2Z5UA 1I1SA 1Y0UA 2XUBA 5HLHA 4RGSA 3G73A 2MLKA 2CQKA 1J9IA 3QAHA 4UXNA 2IP2A 3RKYA 2LNBA 4AIJA 2XAFA 5DCMB 1DUXC 1FYMA 1H9TA 2WTEA 2E1NA 2DTRA 2XKOA 1KYWA 2XKPA 3HRSA 1E2XA 1ZLKA 2CGPA 1T98A 4R8HA 2TDXA 4HBLA 1HQCA 2HGCA 4U7BA 3CUQC 1GVJA 2W25A 2HYGD 2QQAA 2EFNA 3GYHX 1BN5A 1H0MA 1Z6RA 1SMTA 2QWWA 1VTNC 4UUVA 2OZUA 3L2CA 4Z2YA 2MH9A 4L9VA 3REOA 2QM3A 3FZVA 4HYEA 5CVUA 3D5LA 5JVTA 2ZMEA 4HAMA 4HV6A 4EJTA 4I01A 4WK8F 5ERIA 4P9UA 3I5UA 3W6JB 5CLSA 3ABTA 4ON0A 3N97A 2PMHA 4G7OF 2E1CA 2XVCA 4D0PA 1CF7B 4WCGA 3MZYA 4OU0A 1B4AA 2P5LC 2XIGA 4OMYA 2MLGA 2CW0F 2BGCA 1XD7A 2O6GE 5CVJA 4CYDA 2IPQX 4IRHA 1I5ZA 1G4DA 3TO6A 4EJOA 2HFHA 1DP7P 1F5TA 2PJPA 2HZTA 1HW1A 3QPTA 4EQQA 3FMSA 3DF8A 5LLQA 3BPXA 1ZREA 5DUKA 5LHGA 2ESHA 4CGZA 1G3WA 5D4SA 3KP7A 3IWFA 3W6KB 1HXDA 3QP5A 1IXSB 4GYIA 5BS6A 3E6MA 2IW5A 4R79A 4HDVA 2IA2A 4HV5A 1RNLA 1I1GA 3VODA 5HS8A 1FX7A 3F6OA 4Q5SF 2KRFA 1O7FA 5E18F 3RIRA 4XBFA 4RGRA 2COMA 1LQ1A 4MTDA 2V9VA 2DO7A 2PLYA 1HW5A 1QZYA 2FMLA 3COAC 2EB7A 1RUNA 2VBZA 4LMYA 1PUEE 5HLIA 4ESBA 2ZFWA 4KA4A 4KFCA 5KK1A 1C0WA 3F6VA 4YIIA 3L9FA 3LWFA 2FMYA 5DV5A 3I0TA 1WI9A 1FBSA 3J80K 3C7JA 1KYZA 2ZMEB 1W5TA 4CZZA 3I71A 3WTXC 1D8JA 1L3LA 1XGSA 4I0AA 1P4WA 2OD5A 4CO8A 5TRDA 4LG0A 1ZGAA 1FC3A 3ML6A 1TQIA 3KEQA 5LHIA 3GEZA 3CLOA 3WTSC 3VFZA 4Y15A 3RTRA 4L5IA 1BI3A 3WTUC 2ZO4A 2DT5A 1EH8A 1JXSA 3LAPA 2FF4A 2XAGA 2W57A 1R58A 3Q9SA 4IF4A 5H6QA 3ECOA 3LA2A 2L01A 2OA4A 1CGPA 2FSWA 2BBYA 1O57A 3CUQA 4GXOA 1R23A 5ILSA 4HX4A 5D6FA 3BJOA 2XGXA 5K1YA 2GA2A 3KZZA 2VC0A 3B73A 1I6XA 5IT9Z 1ONVA 3TDUC 2RKHA 2FRHA 1ZYRF 3IWZA 3DPTA 1ZRDA 3R4KA 5FD5A 3EDPA 2EA4A 1HKSA 2DK5A 1KU7A 1XDSA 2O8XA 2K27A 3FXUA 5JR3A 3RKWA 3NQOA 4ETSA 3SXYA 4HLXA 2EFWA 4IVNA 5FGMA 5IT3A 1XSVA 2R7DA 3WTVC 3KP3A 3F8MA 3BP8A 3WG9A 5DCFA 1DPUA 3T8TA 2VN2A 2MD5A 2EA2A 4GO1A 1MDMA 1BIAA 4JQFA 5H20A 5CJ9A 1FZPB 2YR2A 2FA5A 2E7WA 1RZ4A 4A5MA 3QPHA 4AIKA 3J81K 4Q4ZF 3HTSB 4IJAA 3QOPA 4M9SA 2ZNZA 1TTYA 2FBKA 3KE2A 5DEQA 5LGNA 3F3XA 3SQNA 2QQ9A 4BAYA 3GXOA 2JPCA 3ZMSA 1BIBA 4G9YA 4LG0B 4EVIA 4RB0A 1ZG5A 2NNYA 2RN7A 4QLCU 1XSXA 1IN6A 1KGSA 2QLZA 5HDKA 1MGTA 1U78A 4M74A 2P5VA 1TBXA 1YS7A 3HOSA 2MC3A 3EETA 3RDIA 2JZYA 3K1MA 4LLGF 2VBXA 2Y48A 1SFEA 4JBAA 2PBIA 1HW2A 1J7KA 2P8TA 3BOQA 3HRTA 1REPC 4ENJA 4I09A 4M6XA 5BOXA 1TQPA 2JRTA 2VBYA 1LJ9A 2STTA 1TNSA 3CUQB 1IUYA 2HS5A 4LLNA 4HX7A 2XAHA 4M9ZA 2RGVA 2ESNA 3LAJA 3L00A 3FWEA 4ESFA 5FLXK 3GWZA 3K1NA 1JE8A 2Q0OA 1X3UA 2QYOA 4HQMA 5F1RA 3SZTA 3LQRA 1MJBA 3FM5A 5LEKA 4HX8A 4XSZF 3GFMA 5D8KB 3GZ6A 2HR3A 1T38A 1YW7A 1LB2A 3K69A 2FXAA 3ZMZA 1R5HA 4M72A 3VOEA 2FE3A 4WXDA 3HIFA 2A6EF 3R6SA 4QWQA 4WF2A 1UB9A 4UVAA 2M8EA 1R7JA 3I64A 4HW0A 4KICA 4EJUA 1Q1HA 4G8XA 2H6BA 5D5XB 1MDMB 3ZP5A 2HYFA 5L3CA 2HKXA 3ZMVA 1KU2A 2PQ8A 1B59A 3ZN0A 3V8KA 5E8IA 5CVRA 1LDDA 4A0ZA 1K7AA 3KEOA 2DLLA 6PAXA 2R7FA 3JTHA 2CO5A 1D3YA 4IRIA 1K6OA 3L09A 1R5GA 2DFIA 4WWCA 4PGHA 4ZZDA 4S04A 4ZZLA 1S8NA 4U7DA 5BPDA 4PGGA 2D45A 2F5CA 3ZN1A 1FYLA 3LSTA 3EUHA 1EV7A 1BI0A 1UCRA 1XGOA 1IN8A 1YW8A 3FM3A 2Z33A 2L4MA 1G6NA 2F5EA 1BI1A 1ON1A 4RAZA 4ZYGA 4G6DA 3FXRA 5DD8A 1OYYA 2J5OA 3K9TA 1ZRCA 4L0ZB 2CYYA 1U5TB 3HSRA 2KIMA 5CVIA 4RB3C 2DBBA 4I02A 2VBWA 4OINF 1IXCA 3U1DA 4BQAA 4M71A 1LDJA 2Q2EA 3RKXA 3TO9A 5LBQA 1BI2A 2RDPA 2ZNYA 1STZA 1BM9A 3T5XA 1Z91A 3MAJA 3S2WA 2EFOA 3ECHA 3V7RA 1ZN2A 5BQTA 3O2PE 4DNCA 1IN7A 1DDNA 1MJAA 5EEHA 2HEOA 2M5WA 1ZLJA 2HOEA 1WSUA 5L3EA 2NS0A 1XSDA 4LFUA 1SMYF 2D1VA 1U2WA 4Q47A 2K7LA 1IN4A 2P6TA 3BDDA 3VB2A 2Q8KA 3V7CA 1XGMA 1IZ1A 4GCVA 2BE5F 2VOPA 2RC4A 4LJZF 2O0YA 4ZYHA 1KU3A 1SAXA 4L18B 3FXQA 1I27A 1KQ9A 3MQ0A 3MCZA 5BPIA 4PCQA 1T6SA 4EV0A 2P7CB 3RYPA 1HSTA 3G3ZA 4Q48A 4OIQF 5K5QA 1UHMA 2F5FA 2ELHA 2FOKA 5E1WA 4FX4A 2UWMA 5LHHA 2YX7A 3E6DA 1P2FA 2W24A 1YW9A 3BJ6A 5HOOA 3E6BA 3IL2A 1T2KA 2VONA 2OBPA 3E97A 1ZRFA 4XLNF 2K4JA 2UXNA 3I54A 3J80Z 2H6CA 3EYYA 5D6EA 2WC2A 1WWXA 5AIPA 1P4AA 2L3DA 2DQLA 2YX4A 4EGYA 1J59A 1O3SA 4RB2C 4LD5A 3WU1B 1D8KA 3I58A 3WTYC 3TKYA 4LLLA 3V8JA 2FNPA 4L9TA 1YO5C 4IRGA 2FNAA 1ZARA 2GXGA 1FBQA 3TOBA 1EH7A 1XB4A 3DP7A 2ZXJA 1XN7A 3DFGA 2BYVE 4UV9A 1T39A 1W4MA 2HQRA 4P9FA 5CVVA 1U3EM 1HKQA 4HLYA 1AOYA 4KYWA 4B09A 2LKPA 3WGGA 1KA8A 2OZ6A 3U2RA 5A2QK 2EFQA 3F8NA 4UNOA 1Z6TA 3WGIA 3BROA 5K5OA 2RV8A 2D1HA 5D5WB 3OV8A 3WODF 5AIQA 1ZAOA 5L3GA 1G3SA 3HUGA 1KU9A 5F64A 4NHJA 2QUFA 1FOKA 3H3ZA 1FLIA 4L9NA 4ASNA 2M45A 3BZ6A 2CG4A 2MBFA 5HLGA 1XCVA 2ADUA 4WX9A 3QRFF 1BC7C 5D5UB 3QU6A 1YTYA 2IT0A 4CHUA 3J81Z 2HTSA 3V8LA 3TDZC 2O61A 2ZJ2A 3MWMA 4BH9A 1OPCA 3CTAA 1F4KA 4YIFA 4G7ZF 1PP7U 4I7HA 3GFLA 2CWEA 5E8GA 3E5UA 2Y75A 1BC8C 3ISPA 4KN7X 2VT2A 3QU3A 3PFIA 1QPMA 1ZGJA 3MEXA 2ZBKA 3L7WA 3ZQ7A 4RGUA 4IHTA 1XMKA 3H3UA 3K1PA 1XCBA 3HOTA 1USTA 3EQLF 2UZKA 4L9JA 3KFWX 1B6AA 2PG4A 1F9NA 4N9IA 2PN6A 2NNNA 1Z7UA 2F2EA 4TV7A 1GXPA 2XAQA 2LF8A 3TQNA 4BXUA 5ILVA 3AAFA 4OIRF 1WQ2A 5FLXZ 2V1UA 4YG2F 1DPRA 1Z9CA 4HOBA 4N9HA 4KNYA 5LRRA 4ZYEA 1SFUA 3M1EA 1SFXA 4M6YA 5F6FA 4EJVA 2J5PA 2KJCA 2K02A 3JW4A 3LA3A 2GZWA 1TW3A 4AWXB 5FD6A 4NB5A 4O6JA 2BV6A 4KN4X 1MZBA 2V6CA 4ENNA 3IKTA 3CO6C 3RJPA 2QQBA 2ZKZA 5E1XA 5L3BA 3U9GA 4OOIA 3TGNA 3F22A 2GIVA 2V79A 4ZYDA 2B0LA 3PQJA 4A0YA 4DQ2A 1OKRA 3FMQA 4HA8A 4PZJA 2NAZA 1QGPA 5LRSA 4RGXA 2EV0A 4PDKA 4U0YA 3ZPLA 1FWZA 3WTWC 3FF5A 5H6RA 5E20A 5ED4A 3F23A 1W5SA 2W85A 3M7GA 2VE8A 2P6SA 4P96A 3BJAA 1BOAA 1SD5A 2GXBA 4L5JA 3DV8A 4ESJA 1R22A 2GAUA 1U6GA 4HF0A 4YFKF 4GYGA 1ULYA 1OYIA 3RI4A 4ZH4F 2VOOA 5DYMA 1TLHB 2A5YB 4CDGA 2C6YA 4OIOF 3SFZA 3ERED 1IAWA 3HTUA 4R1HA 4S05A 5HS7A 1QZZA 3IRRA 1FBUA 2VC1A 5DUIA 1ZHFA 2MA3A 1O3QA 2Z3YA 4BHPA 2JSCA 3LA7A 3JSPA 2EK5A 2HKOA 4N0BA 4KIGA 4BHCA 1FP1D 3NEUA 1QNTA 2CSOA 5J6XA 4WXHA 1D5VA 1K79A 3CO7C 4FHTA 2A69F 1Z1DA 5HS9A 3E3VA 4K2EA 4EM0B 1S3JA 3ZMUA 3BY6A 2W84A 1FYKA 5JFRA 1NHAA 4HZFA 3HYIA 2YPRA 1HSJA 2EV5A 1YS6A 1FNNA 2IRFG 2CFXA 1ZH5A 2P7VB 4NQWA 3NRVA 3IKVA 3IHUA 2GQQA 1IRFA 3KLNA 2G7HA 4IPAA 1P6RA 1G3YA 3VEPA 2A68F 1UHWA 5JHUA 1B9MA 3WTTC 2WV0A 2DPUA 3GZ5A 2AS5F 2FQ3A 2A6HF 4RAYA 3FHZA 2H27A 2F5DA 1XMAA 1OYWA 3KP2A 3HRMA 4MQVA 3E5QA 2XROA 2XASA 4CXFA 2G7UA 1P4XA 1LNWA 5HVQC 2Y0MA 4FT8A 3RPQA 2PI0A 4KMUX 1L0OC 3CUOA 3K0LA 3K2ZA 2HDCA 3E5XA 1KQ0A 5FFZA 2M30A 1IW7F 2HWVA 3E6CC 3T0YA 2PMUA 2YU3A 3FMRA 4Y17A 3J7AO 2HTJA 3DEUA 1J5YA 3I53A 1F1ZA 2LSOA 3ROUA 3I59A 5ICGA 1A04A 4F7ZA 4Y13A 3KLOA 1MD0A 3TO7A 3CDHA 4LB5A 3HSEA 2ZCWA 2DAOA 4EJWA 2JT1A 5J8FA 1LEAA 3RPUA 4O3MA 2ETHA 3GFJA 4AIHA 4I0BA 5A2QZ 4LGWA 2HQNA 3HRUA 1S29A 3ZMDA 3DXJF 2DI3A 3WTZA 3I4PA 1OMIA 3CJNA 2BEOA 1Z05A 5FFXA 3P9IA 1FY7A 4OIPF 1W7PA 2IA1A 1HBXG 3LFKA 4BNCA 2A3SA 3IC7A 5D5VB 1RUOA 4YFNF 5CYVA 5DDGA 4RB1A 2NYXA 3HHGA 1TNTA 2FBHA 4CICA 3F8FA 1R00A 2GA1A 1RIOH 1IXRC 1KQ8A 4UVCA 3B02A 2M87A 2FBIA 2LF7A 2RQPA 5ICEA 3R60A 4MTEA 4UVBA 1FPQA 4AVPA 2VE9A 3RYRA 3T1BA 2XRNA 3GLXA 3HSFA 4A6EA 4A5NA 1LDKB 1K78A 2RVCA 2STWA 4MQ9F 2VODA 5TJJA 3GVAA 1V4RA 4A12A 1UFMA 2IJLA 3F8BA 3I59B 4HF2A 4WXCA 4U0VA 3KETA 2Z99A 2KJBA 5L3DA 2NRAC 2O3FA 2X4HA 2ISZA 2XV4S 1PP8F 3JTGA 1SD4A 1J2XA 1ZG3A 1GHCA 1U5TC 2QVOA 2PEXA 3R0JA 2JTVA 4B8XA 4IHSA 3O3KA 4A2UA 3MZHA 3V7SA 2KIFA 4FX0A 4KIFA 5ILUA 1O3RA 5D4RA 4JK1X 1BBYA 5K5RA 3DKWA 3M8EA 1AWCA 2E7XA 4G6QA 3SHFA 4XRFA 5D8LB 4BHBA 4KIBA 1W7PB 4KDPA 2AXLA 1PDNC 4MNUA 2A07F 3GFIA 3WU0A 2WWYA 3M8FA 3PQKA 1LEBA 2QZ8A 1XDUA 1FSEA 4LK0F 4ENKA 2M1BA 1R36A 4EM2A 1P92A 1S7AA 4EGZA 3BWGA 4MHGA 4A0XA 1QBJA 3ULQB 4EMSA 3KP5A 3N4MA 1BJAA 4ENMA 2LDUA 5AONA 2OQGA 4YFXF 2V1XA 3C18A 5FB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C3W A;  3ABU A;  3KP6 A;  4UHT A;  4O5V A;  1YLF A;  3LQQ A;  2RNJ A;  3IRQ A;  2D2W A;  2GWR A;  1TQM A;  3JAM Z;  1K78 B;  2MH2 A;  4XSX F;  3DPL C;  2DK8 A;  2K86 A;  2QBY A;  2L54 A;  1SD6 A;  1T0F A;  3P9K A;  3EYI A;  2JPB A;  3C1D A;  2XAJ A;  2KIU A;  1XGN A;  2Z9O A;  4HDU A;  5E17 F;  4U88 A;  2ISY A;  3Q9V A;  3TOA A;  1J75 A;  1IN5 A;  5HDN A;  4A6D A;  4KUM A;  4XLP F;  2XHK A;  3GUD A;  2EFP A;  4G7H F;  3KCC A;  3OOP A;  1TW2 A;  1ZG1 A;  1O7L A;  4E70 A;  5BMZ A;  5EEG A;  1WRJ A;  5JI6 A;  5LGT A;  3JSO A;  2VXZ A;  1ON2 A;  1MKM A;  4M73 A;  2OAZ A;  2L02 A;  2DW4 A;  1EH6 A;  4HQE A;  1R1T A;  4I2O A;  1YYV A;  3GO5 A;  3GX4 X;  3ELK A;  4P55 A;  2EV6 A;  3WE3 A;  4KMF A;  2G9W A;  3FX3 A;  1FT9 A;  4IXA A;  1SD7 A;  1R1V A;  1O3T A;  1JHF A;  4H0E A;  3JAM K;  1R1U A;  1USS A;  5IT9 K;  1JGS A;  4L0Y B;  1OR7 A;  2FEZ A;  2P5K A;  1GXQ A;  3KP4 A;  3WGH A;  1U5T A;  4G94 A;  3M9A A;  2OU2 A;  1B1B A;  3D0S A;  1V3F A;  2FU4 A;  2X0L A;  1WKM A;  2PFB A;  3F21 A;  1W7P D;  2KKO A;  1YQA A;  3V4G A;  1YFH A;  1IRG A;  4BYY A;  1G3T A;  3MFK A;  2QBY B;  3R0A A;  2YSR A;  4MEX F;  1J0R A;  1ODD A;  3T8R A;  5ICC A;  2ACJ A;  4GGG A;  1HKT A;  5DCM A;  2A61 A;  5FO5 A;  3P7N A;  5HDG A;  4UV8 A;  2K4B A;  1JHH A;  1H9G A;  3F8C A;  2DPD A;  2EWN A;  3O6B B;  2VT3 A;  2DQR A;  3BPV A;  1YG2 A;  4AD9 A;  1FSH A;  4P5O A;  5E1Z B;  5L3F A;  3ZMT A;  2H09 A;  1LVA A;  4LB6 B;  2IA0 A;  2P4W A;  5J8C A;  3KZY A;  1U8R A;  4HF1 A;  1QO0 D;  1YIO A;  4I98 B;  4KT5 C;  4MGR A;  1S6L A;  2QEN A;  3HHH A;  4U0W A;  2H94 A;  3WE2 A;  3GF2 A;  1QQI A;  2IVM A;  3F72 A;  3QP6 A;  3SZP A;  2UXX A;  3P9C A;  1CF7 A;  5DD4 A;  3GW2 A;  1MJ9 A;  5ICF A;  3Q5F A;  4EM1 A;  2R3S A;  3R61 A;  1RI7 A;  4LK1 F;  5LGU A;  5LEJ A;  1S7O A;  2OQR A;  1B9N A;  4M9X A;  3DQV C;  4MEY F;  3H92 A;  1E17 A;  4OMZ A;  1FP2 A;  2DU9 A;  2O03 A;  5KVR A;  2L4A A;  2EJR A;  1IF1 A;  4RS8 A;  2V1D A;  2Z5U A;  1I1S A;  1Y0U A;  2XUB A;  5HLH A;  4RGS A;  3G73 A;  2MLK A;  2CQK A;  1J9I A;  3QAH A;  4UXN A;  2IP2 A;  3RKY A;  2LNB A;  4AIJ A;  2XAF A;  5DCM B;  1DUX C;  1FYM A;  1H9T A;  2WTE A;  2E1N A;  2DTR A;  2XKO A;  1KYW A;  2XKP A;  3HRS A;  1E2X A;  1ZLK A;  2CGP A;  1T98 A;  4R8H A;  2TDX A;  4HBL A;  1HQC A;  2HGC A;  4U7B A;  3CUQ C;  1GVJ A;  2W25 A;  2HYG D;  2QQA A;  2EFN A;  3GYH X;  1BN5 A;  1H0M A;  1Z6R A;  1SMT A;  2QWW A;  1VTN C;  4UUV A;  2OZU A;  3L2C A;  4Z2Y A;  2MH9 A;  4L9V A;  3REO A;  2QM3 A;  3FZV A;  4HYE A;  5CVU A;  3D5L A;  5JVT A;  2ZME A;  4HAM A;  4HV6 A;  4EJT A;  4I01 A;  4WK8 F;  5ERI A;  4P9U A;  3I5U A;  3W6J B;  5CLS A;  3ABT A;  4ON0 A;  3N97 A;  2PMH A;  4G7O F;  2E1C A;  2XVC A;  4D0P A;  1CF7 B;  4WCG A;  3MZY A;  4OU0 A;  1B4A A;  2P5L C;  2XIG A;  4OMY A;  2MLG A;  2CW0 F;  2BGC A;  1XD7 A;  2O6G E;  5CVJ A;  4CYD A;  2IPQ X;  4IRH A;  1I5Z A;  1G4D A;  3TO6 A;  4EJO A;  2HFH A;  1DP7 P;  1F5T A;  2PJP A;  2HZT A;  1HW1 A;  3QPT A;  4EQQ A;  3FMS A;  3DF8 A;  5LLQ A;  3BPX A;  1ZRE A;  5DUK A;  5LHG A;  2ESH A;  4CGZ A;  1G3W A;  5D4S A;  3KP7 A;  3IWF A;  3W6K B;  1HXD A;  3QP5 A;  1IXS B;  4GYI A;  5BS6 A;  3E6M A;  2IW5 A;  4R79 A;  4HDV A;  2IA2 A;  4HV5 A;  1RNL A;  1I1G A;  3VOD A;  5HS8 A;  1FX7 A;  3F6O A;  4Q5S F;  2KRF A;  1O7F A;  5E18 F;  3RIR A;  4XBF A;  4RGR A;  2COM A;  1LQ1 A;  4MTD A;  2V9V A;  2DO7 A;  2PLY A;  1HW5 A;  1QZY A;  2FML A;  3COA C;  2EB7 A;  1RUN A;  2VBZ A;  4LMY A;  1PUE E;  5HLI A;  4ESB A;  2ZFW A;  4KA4 A;  4KFC A;  5KK1 A;  1C0W A;  3F6V A;  4YII A;  3L9F A;  3LWF A;  2FMY A;  5DV5 A;  3I0T A;  1WI9 A;  1FBS A;  3J80 K;  3C7J A;  1KYZ A;  2ZME B;  1W5T A;  4CZZ A;  3I71 A;  3WTX C;  1D8J A;  1L3L A;  1XGS A;  4I0A A;  1P4W A;  2OD5 A;  4CO8 A;  5TRD A;  4LG0 A;  1ZGA A;  1FC3 A;  3ML6 A;  1TQI A;  3KEQ A;  5LHI A;  3GEZ A;  3CLO A;  3WTS C;  3VFZ A;  4Y15 A;  3RTR A;  4L5I A;  1BI3 A;  3WTU C;  2ZO4 A;  2DT5 A;  1EH8 A;  1JXS A;  3LAP A;  2FF4 A;  2XAG A;  2W57 A;  1R58 A;  3Q9S A;  4IF4 A;  5H6Q A;  3ECO A;  3LA2 A;  2L01 A;  2OA4 A;  1CGP A;  2FSW A;  2BBY A;  1O57 A;  3CUQ A;  4GXO A;  1R23 A;  5ILS A;  4HX4 A;  5D6F A;  3BJO A;  2XGX A;  5K1Y A;  2GA2 A;  3KZZ A;  2VC0 A;  3B73 A;  1I6X A;  5IT9 Z;  1ONV A;  3TDU C;  2RKH A;  2FRH A;  1ZYR F;  3IWZ A;  3DPT A;  1ZRD A;  3R4K A;  5FD5 A;  3EDP A;  2EA4 A;  1HKS A;  2DK5 A;  1KU7 A;  1XDS A;  2O8X A;  2K27 A;  3FXU A;  5JR3 A;  3RKW A;  3NQO A;  4ETS A;  3SXY A;  4HLX A;  2EFW A;  4IVN A;  5FGM A;  5IT3 A;  1XSV A;  2R7D A;  3WTV C;  3KP3 A;  3F8M A;  3BP8 A;  3WG9 A;  5DCF A;  1DPU A;  3T8T A;  2VN2 A;  2MD5 A;  2EA2 A;  4GO1 A;  1MDM A;  1BIA A;  4JQF A;  5H20 A;  5CJ9 A;  1FZP B;  2YR2 A;  2FA5 A;  2E7W A;  1RZ4 A;  4A5M A;  3QPH A;  4AIK A;  3J81 K;  4Q4Z F;  3HTS B;  4IJA A;  3QOP A;  4M9S A;  2ZNZ A;  1TTY A;  2FBK A;  3KE2 A;  5DEQ A;  5LGN A;  3F3X A;  3SQN A;  2QQ9 A;  4BAY A;  3GXO A;  2JPC A;  3ZMS A;  1BIB A;  4G9Y A;  4LG0 B;  4EVI A;  4RB0 A;  1ZG5 A;  2NNY A;  2RN7 A;  4QLC U;  1XSX A;  1IN6 A;  1KGS A;  2QLZ A;  5HDK A;  1MGT A;  1U78 A;  4M74 A;  2P5V A;  1TBX A;  1YS7 A;  3HOS A;  2MC3 A;  3EET A;  3RDI A;  2JZY A;  3K1M A;  4LLG F;  2VBX A;  2Y48 A;  1SFE A;  4JBA A;  2PBI A;  1HW2 A;  1J7K A;  2P8T A;  3BOQ A;  3HRT A;  1REP C;  4ENJ A;  4I09 A;  4M6X A;  5BOX A;  1TQP A;  2JRT A;  2VBY A;  1LJ9 A;  2STT A;  1TNS A;  3CUQ B;  1IUY A;  2HS5 A;  4LLN A;  4HX7 A;  2XAH A;  4M9Z A;  2RGV A;  2ESN A;  3LAJ A;  3L00 A;  3FWE A;  4ESF A;  5FLX K;  3GWZ A;  3K1N A;  1JE8 A;  2Q0O A;  1X3U A;  2QYO A;  4HQM A;  5F1R A;  3SZT A;  3LQR A;  1MJB A;  3FM5 A;  5LEK A;  4HX8 A;  4XSZ F;  3GFM A;  5D8K B;  3GZ6 A;  2HR3 A;  1T38 A;  1YW7 A;  1LB2 A;  3K69 A;  2FXA A;  3ZMZ A;  1R5H A;  4M72 A;  3VOE A;  2FE3 A;  4WXD A;  3HIF A;  2A6E F;  3R6S A;  4QWQ A;  4WF2 A;  1UB9 A;  4UVA A;  2M8E A;  1R7J A;  3I64 A;  4HW0 A;  4KIC A;  4EJU A;  1Q1H A;  4G8X A;  2H6B A;  5D5X B;  1MDM B;  3ZP5 A;  2HYF A;  5L3C A;  2HKX A;  3ZMV A;  1KU2 A;  2PQ8 A;  1B59 A;  3ZN0 A;  3V8K A;  5E8I A;  5CVR A;  1LDD A;  4A0Z A;  1K7A A;  3KEO A;  2DLL A;  6PAX A;  2R7F A;  3JTH A;  2CO5 A;  1D3Y A;  4IRI A;  1K6O A;  3L09 A;  1R5G A;  2DFI A;  4WWC A;  4PGH A;  4ZZD A;  4S04 A;  4ZZL A;  1S8N A;  4U7D A;  5BPD A;  4PGG A;  2D45 A;  2F5C A;  3ZN1 A;  1FYL A;  3LST A;  3EUH A;  1EV7 A;  1BI0 A;  1UCR A;  1XGO A;  1IN8 A;  1YW8 A;  3FM3 A;  2Z33 A;  2L4M A;  1G6N A;  2F5E A;  1BI1 A;  1ON1 A;  4RAZ A;  4ZYG A;  4G6D A;  3FXR A;  5DD8 A;  1OYY A;  2J5O A;  3K9T A;  1ZRC A;  4L0Z B;  2CYY A;  1U5T B;  3HSR A;  2KIM A;  5CVI A;  4RB3 C;  2DBB A;  4I02 A;  2VBW A;  4OIN F;  1IXC A;  3U1D A;  4BQA A;  4M71 A;  1LDJ A;  2Q2E A;  3RKX A;  3TO9 A;  5LBQ A;  1BI2 A;  2RDP A;  2ZNY A;  1STZ A;  1BM9 A;  3T5X A;  1Z91 A;  3MAJ A;  3S2W A;  2EFO A;  3ECH A;  3V7R A;  1ZN2 A;  5BQT A;  3O2P E;  4DNC A;  1IN7 A;  1DDN A;  1MJA A;  5EEH A;  2HEO A;  2M5W A;  1ZLJ A;  2HOE A;  1WSU A;  5L3E A;  2NS0 A;  1XSD A;  4LFU A;  1SMY F;  2D1V A;  1U2W A;  4Q47 A;  2K7L A;  1IN4 A;  2P6T A;  3BDD A;  3VB2 A;  2Q8K A;  3V7C A;  1XGM A;  1IZ1 A;  4GCV A;  2BE5 F;  2VOP A;  2RC4 A;  4LJZ F;  2O0Y A;  4ZYH A;  1KU3 A;  1SAX A;  4L18 B;  3FXQ A;  1I27 A;  1KQ9 A;  3MQ0 A;  3MCZ A;  5BPI A;  4PCQ A;  1T6S A;  4EV0 A;  2P7C B;  3RYP A;  1HST A;  3G3Z A;  4Q48 A;  4OIQ F;  5K5Q A;  1UHM A;  2F5F A;  2ELH A;  2FOK A;  5E1W A;  4FX4 A;  2UWM A;  5LHH A;  2YX7 A;  3E6D A;  1P2F A;  2W24 A;  1YW9 A;  3BJ6 A;  5HOO A;  3E6B A;  3IL2 A;  1T2K A;  2VON A;  2OBP A;  3E97 A;  1ZRF A;  4XLN F;  2K4J A;  2UXN A;  3I54 A;  3J80 Z;  2H6C A;  3EYY A;  5D6E A;  2WC2 A;  1WWX A;  5AIP A;  1P4A A;  2L3D A;  2DQL A;  2YX4 A;  4EGY A;  1J59 A;  1O3S A;  4RB2 C;  4LD5 A;  3WU1 B;  1D8K A;  3I58 A;  3WTY C;  3TKY A;  4LLL A;  3V8J A;  2FNP A;  4L9T A;  1YO5 C;  4IRG A;  2FNA A;  1ZAR A;  2GXG A;  1FBQ A;  3TOB A;  1EH7 A;  1XB4 A;  3DP7 A;  2ZXJ A;  1XN7 A;  3DFG A;  2BYV E;  4UV9 A;  1T39 A;  1W4M A;  2HQR A;  4P9F A;  5CVV A;  1U3E M;  1HKQ A;  4HLY A;  1AOY A;  4KYW A;  4B09 A;  2LKP A;  3WGG A;  1KA8 A;  2OZ6 A;  3U2R A;  5A2Q K;  2EFQ A;  3F8N A;  4UNO A;  1Z6T A;  3WGI A;  3BRO A;  5K5O A;  2RV8 A;  2D1H A;  5D5W B;  3OV8 A;  3WOD F;  5AIQ A;  1ZAO A;  5L3G A;  1G3S A;  3HUG A;  1KU9 A;  5F64 A;  4NHJ A;  2QUF A;  1FOK A;  3H3Z A;  1FLI A;  4L9N A;  4ASN A;  2M45 A;  3BZ6 A;  2CG4 A;  2MBF A;  5HLG A;  1XCV A;  2ADU A;  4WX9 A;  3QRF F;  1BC7 C;  5D5U B;  3QU6 A;  1YTY A;  2IT0 A;  4CHU A;  3J81 Z;  2HTS A;  3V8L A;  3TDZ C;  2O61 A;  2ZJ2 A;  3MWM A;  4BH9 A;  1OPC A;  3CTA A;  1F4K A;  4YIF A;  4G7Z F;  1PP7 U;  4I7H A;  3GFL A;  2CWE A;  5E8G A;  3E5U A;  2Y75 A;  1BC8 C;  3ISP A;  4KN7 X;  2VT2 A;  3QU3 A;  3PFI A;  1QPM A;  1ZGJ A;  3MEX A;  2ZBK A;  3L7W A;  3ZQ7 A;  4RGU A;  4IHT A;  1XMK A;  3H3U A;  3K1P A;  1XCB A;  3HOT A;  1UST A;  3EQL F;  2UZK A;  4L9J A;  3KFW X;  1B6A A;  2PG4 A;  1F9N A;  4N9I A;  2PN6 A;  2NNN A;  1Z7U A;  2F2E A;  4TV7 A;  1GXP A;  2XAQ A;  2LF8 A;  3TQN A;  4BXU A;  5ILV A;  3AAF A;  4OIR F;  1WQ2 A;  5FLX Z;  2V1U A;  4YG2 F;  1DPR A;  1Z9C A;  4HOB A;  4N9H A;  4KNY A;  5LRR A;  4ZYE A;  1SFU A;  3M1E A;  1SFX A;  4M6Y A;  5F6F A;  4EJV A;  2J5P A;  2KJC A;  2K02 A;  3JW4 A;  3LA3 A;  2GZW A;  1TW3 A;  4AWX B;  5FD6 A;  4NB5 A;  4O6J A;  2BV6 A;  4KN4 X;  1MZB A;  2V6C A;  4ENN A;  3IKT A;  3CO6 C;  3RJP A;  2QQB A;  2ZKZ A;  5E1X A;  5L3B A;  3U9G A;  4OOI A;  3TGN A;  3F22 A;  2GIV A;  2V79 A;  4ZYD A;  2B0L A;  3PQJ A;  4A0Y A;  4DQ2 A;  1OKR A;  3FMQ A;  4HA8 A;  4PZJ A;  2NAZ A;  1QGP A;  5LRS A;  4RGX A;  2EV0 A;  4PDK A;  4U0Y A;  3ZPL A;  1FWZ A;  3WTW C;  3FF5 A;  5H6R A;  5E20 A;  5ED4 A;  3F23 A;  1W5S A;  2W85 A;  3M7G A;  2VE8 A;  2P6S A;  4P96 A;  3BJA A;  1BOA A;  1SD5 A;  2GXB A;  4L5J A;  3DV8 A;  4ESJ A;  1R22 A;  2GAU A;  1U6G A;  4HF0 A;  4YFK F;  4GYG A;  1ULY A;  1OYI A;  3RI4 A;  4ZH4 F;  2VOO A;  5DYM A;  1TLH B;  2A5Y B;  4CDG A;  2C6Y A;  4OIO F;  3SFZ A;  3ERE D;  1IAW A;  3HTU A;  4R1H A;  4S05 A;  5HS7 A;  1QZZ A;  3IRR A;  1FBU A;  2VC1 A;  5DUI A;  1ZHF A;  2MA3 A;  1O3Q A;  2Z3Y A;  4BHP A;  2JSC A;  3LA7 A;  3JSP A;  2EK5 A;  2HKO A;  4N0B A;  4KIG A;  4BHC A;  1FP1 D;  3NEU A;  1QNT A;  2CSO A;  5J6X A;  4WXH A;  1D5V A;  1K79 A;  3CO7 C;  4FHT A;  2A69 F;  1Z1D A;  5HS9 A;  3E3V A;  4K2E A;  4EM0 B;  1S3J A;  3ZMU A;  3BY6 A;  2W84 A;  1FYK A;  5JFR A;  1NHA A;  4HZF A;  3HYI A;  2YPR A;  1HSJ A;  2EV5 A;  1YS6 A;  1FNN A;  2IRF G;  2CFX A;  1ZH5 A;  2P7V B;  4NQW A;  3NRV A;  3IKV A;  3IHU A;  2GQQ A;  1IRF A;  3KLN A;  2G7H A;  4IPA A;  1P6R A;  1G3Y A;  3VEP A;  2A68 F;  1UHW A;  5JHU A;  1B9M A;  3WTT C;  2WV0 A;  2DPU A;  3GZ5 A;  2AS5 F;  2FQ3 A;  2A6H F;  4RAY A;  3FHZ A;  2H27 A;  2F5D A;  1XMA A;  1OYW A;  3KP2 A;  3HRM A;  4MQV A;  3E5Q A;  2XRO A;  2XAS A;  4CXF A;  2G7U A;  1P4X A;  1LNW A;  5HVQ C;  2Y0M A;  4FT8 A;  3RPQ A;  2PI0 A;  4KMU X;  1L0O C;  3CUO A;  3K0L A;  3K2Z A;  2HDC A;  3E5X A;  1KQ0 A;  5FFZ A;  2M30 A;  1IW7 F;  2HWV A;  3E6C C;  3T0Y A;  2PMU A;  2YU3 A;  3FMR A;  4Y17 A;  3J7A O;  2HTJ A;  3DEU A;  1J5Y A;  3I53 A;  1F1Z A;  2LSO A;  3ROU A;  3I59 A;  5ICG A;  1A04 A;  4F7Z A;  4Y13 A;  3KLO A;  1MD0 A;  3TO7 A;  3CDH A;  4LB5 A;  3HSE A;  2ZCW A;  2DAO A;  4EJW A;  2JT1 A;  5J8F A;  1LEA A;  3RPU A;  4O3M A;  2ETH A;  3GFJ A;  4AIH A;  4I0B A;  5A2Q Z;  4LGW A;  2HQN A;  3HRU A;  1S29 A;  3ZMD A;  3DXJ F;  2DI3 A;  3WTZ A;  3I4P A;  1OMI A;  3CJN A;  2BEO A;  1Z05 A;  5FFX A;  3P9I A;  1FY7 A;  4OIP F;  1W7P A;  2IA1 A;  1HBX G;  3LFK A;  4BNC A;  2A3S A;  3IC7 A;  5D5V B;  1RUO A;  4YFN F;  5CYV A;  5DDG A;  4RB1 A;  2NYX A;  3HHG A;  1TNT A;  2FBH A;  4CIC A;  3F8F A;  1R00 A;  2GA1 A;  1RIO H;  1IXR C;  1KQ8 A;  4UVC A;  3B02 A;  2M87 A;  2FBI A;  2LF7 A;  2RQP A;  5ICE A;  3R60 A;  4MTE A;  4UVB A;  1FPQ A;  4AVP A;  2VE9 A;  3RYR A;  3T1B A;  2XRN A;  3GLX A;  3HSF A;  4A6E A;  4A5N A;  1LDK B;  1K78 A;  2RVC A;  2STW A;  4MQ9 F;  2VOD A;  5TJJ A;  3GVA A;  1V4R A;  4A12 A;  1UFM A;  2IJL A;  3F8B A;  3I59 B;  4HF2 A;  4WXC A;  4U0V A;  3KET A;  2Z99 A;  2KJB A;  5L3D A;  2NRA C;  2O3F A;  2X4H A;  2ISZ A;  2XV4 S;  1PP8 F;  3JTG A;  1SD4 A;  1J2X A;  1ZG3 A;  1GHC A;  1U5T C;  2QVO A;  2PEX A;  3R0J A;  2JTV A;  4B8X A;  4IHS A;  3O3K A;  4A2U A;  3MZH A;  3V7S A;  2KIF A;  4FX0 A;  4KIF A;  5ILU A;  1O3R A;  5D4R A;  4JK1 X;  1BBY A;  5K5R A;  3DKW A;  3M8E A;  1AWC A;  2E7X A;  4G6Q A;  3SHF A;  4XRF A;  5D8L B;  4BHB A;  4KIB A;  1W7P B;  4KDP A;  2AXL A;  1PDN C;  4MNU A;  2A07 F;  3GFI A;  3WU0 A;  2WWY A;  3M8F A;  3PQK A;  1LEB A;  2QZ8 A;  1XDU A;  1FSE A;  4LK0 F;  4ENK A;  2M1B A;  1R36 A;  4EM2 A;  1P92 A;  1S7A A;  4EGZ A;  3BWG A;  4MHG A;  4A0X A;  1QBJ A;  3ULQ B;  4EMS A;  3KP5 A;  3N4M A;  1BJA A;  4ENM A;  2LDU A;  5AON A;  2OQG A;  4YFX F;  2V1X A;  3C18 A;  5FB2 A; 
#chains in the Genus database with same CATH topology
 1FOW A;  3ABU A;  2DJI A;  2WAQ A;  3C3W A;  3KP6 A;  4UHT A;  4M3G A;  2I8D A;  2LP0 A;  3HC7 A;  4O5V A;  1YLF A;  2M0M A;  3LQQ A;  3TED A;  1YX5 A;  2RNJ A;  4XL9 A;  4BS9 A;  3IRQ A;  2D2W A;  2GWR A;  3BQZ A;  1TQM A;  1JGG A;  3CF2 A;  3JAM Z;  1K78 B;  1ZR2 A;  2DT7 B;  2MH2 A;  2F48 A;  4XSX F;  1LVK A;  3DPL C;  1ZGW A;  2HVR A;  2DK8 A;  2K86 A;  2R4G A;  2QBY A;  3Q3S A;  2L54 A;  1G2H A;  2LYC A;  1QHG A;  4HSR A;  5E3O A;  1SD6 A;  3GTL J;  2R7T A;  1T0F A;  3P9K A;  3EYI A;  3PO2 J;  5GAH J;  5C3E J;  3ZQF A;  2JPB A;  5DS9 A;  3C1D A;  1ETV A;  2COB A;  2JSP A;  2XAJ A;  3BR5 A;  2JA7 J;  2KIU A;  2VB6 A;  4MFE A;  1XGN A;  2QCO A;  4PFP A;  1QHH D;  2Z9O A;  4DBR A;  4HDU A;  4P1W A;  1JKQ C;  4ZYA A;  3JRF A;  5E17 F;  4D5F A;  2KZV A;  4U88 A;  3GBG A;  1BJZ A;  2ISY A;  3Q9V A;  3TOA A;  1J75 A;  1FTT A;  4G6T B;  1IN5 A;  5HDN A;  5IOY A;  5H2F C;  2ELK A;  2W82 A;  4A6D A;  3QPS A;  4KUM A;  4XLP F;  2XHK A;  3GUD A;  1LPQ A;  1E3P A;  4XN3 A;  3H36 A;  4XRS A;  2EFP A;  4RDU A;  4G7H F;  3KCC A;  3OOP A;  4AUX A;  1TW2 A;  1ZG1 A;  2EZK A;  1O7L A;  4E70 A;  2IGK A;  5BMZ A;  5EEG A;  2OTL I;  3ASN H;  3PUB A;  4ANJ A;  1JUM A;  1OCC H;  3K10 A;  1WRJ A;  2WAD A;  1ORK A;  3K4M A;  1X19 A;  5JI6 A;  3E1S A;  3JRG A;  5LGT A;  3JSO A;  3OS0 A;  3BR6 A;  3OYB A;  2VXZ A;  1YIJ I;  1V5F A;  2E5N A;  2FD5 A;  2GIZ A;  1ON2 A;  1MKM A;  4M73 A;  2OAZ A;  2L02 A;  2DW4 A;  2DDA A;  4BQO A;  2V4J C;  1EH6 A;  4HQE A;  1R1T A;  3HEF A;  4I2O A;  1Y1V J;  1YYV A;  3GO5 A;  4S0H B;  3GX4 X;  3UKG A;  3ELK A;  4BAC A;  3M8J A;  4P55 A;  2EV6 A;  3WE3 A;  2FUG 2;  3MKW B;  4KMF A;  2L5Q A;  2G9W A;  4C2U A;  4OAY A;  3FX3 A;  1FT9 A;  4IXA A;  3LSJ A;  1SD7 A;  3M3Y J;  1R1V A;  2HNH A;  1O3T A;  1JHF A;  4H0E A;  4XKB A;  3JAM K;  1Z67 A;  1R1U A;  3TW7 A;  2DTZ A;  4RAF A;  1USS A;  1I6H J;  5IT9 K;  1JGS A;  4L0Y B;  1OR7 A;  2EIK H;  1X1B A;  2FEZ A;  2MG4 A;  2H1K A;  1UAA A;  2P5K A;  3CMY A;  1GXQ A;  3KP4 A;  3WGH A;  4BJ6 C;  1U5T A;  4G94 A;  5EJC A;  3M9A A;  4B43 A;  3OYA A;  5B1B H;  5KAI C;  3OYF A;  2OU2 A;  2VL8 A;  1B1B A;  3D0S A;  2LLK A;  5EYR A;  1V3F A;  2ZME C;  2FU4 A;  2X0L A;  1WKM A;  2PFB A;  3F21 A;  5M3M J;  1W7P D;  3I4N J;  3HPH A;  2KKO A;  1BR2 A;  1DGR M;  2OCE A;  1YQA A;  2BW3 A;  3V4G A;  1YFH A;  1N75 A;  1D0Y A;  2ZB9 A;  1IRG A;  2PJR A;  4BYY A;  2H8W A;  3PSF A;  3LSR A;  3S1R J;  4AU7 A;  1G3T A;  3MFK A;  2QBY B;  3R0A A;  2QKM B;  4XN0 A;  4ZDP A;  2RAE A;  2YSR A;  4MEX F;  3CP8 A;  1J0R A;  1ODD A;  2BHY A;  3T8R A;  4II3 A;  3A0H C;  5C4J J;  5ICC A;  2ACJ A;  3FIS A;  3HL2 A;  4GGG A;  3FXM A;  1HKT A;  3I3L A;  3RQ4 A;  1R6R A;  5DCM A;  4A3E J;  1T8I A;  2Y30 A;  2A61 A;  2K9Q A;  5FO5 A;  3H9Q A;  3P7N A;  5HDG A;  4BJT A;  4PJN A;  4UV8 A;  2DMP A;  2K4B A;  1JHH A;  1H9G A;  3F8C A;  2HDW A;  1GV2 A;  2XSD C;  1YIT I;  2DPD A;  2EWN A;  3O6B B;  3BR2 A;  2CW8 A;  2VT3 A;  3BCA A;  2K85 A;  3K2A A;  2DQR A;  3BPV A;  1VQ5 I;  5F1J A;  4XLC A;  1YG2 A;  4AD9 A;  3OY9 A;  1FSH A;  4P5O A;  5E1Z B;  2DJN A;  5L3F A;  3ZMT A;  2H09 A;  1LVA A;  4LB6 B;  3S8P A;  2IA0 A;  2P4W A;  5B5E C;  5J8C A;  4A3J J;  1SEU A;  2CUE A;  3KZY A;  3KYL A;  1YI2 I;  2HOS A;  3G6E I;  2NOG A;  2WB1 A;  3BG3 A;  3QOD A;  1U8R A;  4HF1 A;  1QO0 D;  3H0D A;  1KON A;  3S2D J;  1S7E A;  1WJA A;  1YIO A;  4I98 B;  4KT5 C;  2F4I A;  3OOU A;  4MGR A;  1LFP A;  2LRD A;  4DBQ A;  3B6C A;  4F52 A;  1S6L A;  2QEN A;  3HHH A;  1B72 A;  4U0W A;  2H94 A;  5GTI C;  4HST A;  3WE2 A;  3S32 A;  3GF2 A;  1QQI A;  2IVM A;  3F72 A;  3QP6 A;  3SZP A;  1WH7 A;  2UXX A;  2I5U A;  3P9C A;  3SDG A;  2JRM A;  1CF7 A;  1NG6 A;  5DD4 A;  3GW2 A;  4BGD A;  1J09 A;  1XPX A;  2DYR H;  3HOU J;  2OF7 A;  1MJ9 A;  2E19 A;  2E2H J;  1UMQ A;  2OCC H;  4XOR A;  5ICF A;  3Q5F A;  4EM1 A;  2R3S A;  3R61 A;  3LNQ A;  3CMM A;  4ZTJ A;  1RI7 A;  4LK1 F;  3H9J A;  5LGU A;  5B3S H;  5LEJ A;  1BR4 A;  1S7O A;  2OQR A;  3CCR I;  1B9N A;  4M9X A;  3DQV C;  1Y56 A;  3ZQH A;  1U8B A;  4V2F A;  4MEY F;  3DU6 A;  3H92 A;  2JQ7 A;  2ZSH B;  1T95 A;  3U21 A;  1E17 A;  4OMZ A;  2WV1 A;  1FP2 A;  2CV2 A;  1VQ6 I;  1WZ2 A;  5J1Y A;  4QIW N;  2DU9 A;  2O03 A;  3BZK A;  3HKZ N;  1TWA J;  5KVR A;  5IY5 H;  4BJ5 C;  3BG6 A;  2L4A A;  2EJR A;  1IF1 A;  1UG0 A;  2CRG A;  1RKW A;  2ME0 A;  4NUB A;  4RS8 A;  4AC0 A;  4IZZ A;  2V1D A;  2Z5U A;  1I1S A;  1Y0U A;  2BW3 B;  2XUB A;  1JI8 A;  2CUF A;  2DA5 A;  1W5C C;  2L9S A;  2PJR B;  1U0J A;  1SFO J;  5HLH A;  1VFC A;  1N25 A;  2XDV A;  4RGS A;  3G73 A;  2ME6 A;  2VQL A;  5F0C A;  4UUS A;  2MLK A;  2W7N A;  2CQK A;  1ZK8 A;  1KZH A;  3QAH A;  5FKO A;  4J00 A;  1J9I A;  3FDY A;  4UXN A;  2XGE A;  5GAD J;  2IP2 A;  2LH9 A;  4C2T A;  3RKY A;  2LNB A;  4AIJ A;  2XAF A;  2X6O A;  3K7A J;  5DCM B;  3SEZ A;  1DUX C;  2NVX J;  3PM1 A;  1FYM A;  3CC7 I;  4CYC A;  1H9T A;  2WTE A;  2E1N A;  2DTR A;  4AYB N;  2AQE A;  1KYW A;  2XKO A;  4IQ4 A;  3N05 A;  1DQU A;  3K70 D;  1X2N A;  2JVH A;  2XKP A;  3LSM A;  4A93 J;  3HRS A;  4BY7 J;  1E2X A;  1ZLK A;  2Y0S A;  2CGP A;  1T98 A;  2F4O B;  2KIQ A;  2TDX A;  2MGQ A;  4HBL A;  4R8H A;  3CCV I;  1HQC A;  1BW5 A;  2HGC A;  1TC3 C;  3A2K A;  2F4M B;  4U7B A;  1WJB A;  3TL4 X;  2BY2 A;  2RRE A;  3CUQ C;  3CES A;  1GVJ A;  2W25 A;  2HYG D;  2QQA A;  2EFN A;  3GYH X;  2R92 J;  1BN5 A;  1MMG A;  4DYQ A;  1H0M A;  1Z6R A;  1SMT A;  2QWW A;  1VTN C;  5FRN A;  3OYD A;  2MSY A;  2OZU A;  4UUV A;  3L2C A;  2E1M C;  4Z2Y A;  4YIR X;  2MH9 A;  3OSG A;  4L9V A;  3REO A;  1VQL I;  2QM3 A;  3FZV A;  4HYE A;  5CVU A;  4FQG A;  3ZQI A;  3D5L A;  4C3J J;  3MKY B;  5JVT A;  2ZME A;  4HAM A;  3I55 I;  4HV6 A;  4EJT A;  4I01 A;  4WK8 F;  1B72 B;  2RQQ A;  5ERI A;  4A3B J;  4P9U A;  3I5U A;  3AL0 C;  2GOX B;  2K9N A;  4IHV A;  3W6J B;  1WCM J;  5CLS A;  1MMA A;  3ABT A;  1HC8 A;  1R5I D;  3NWT A;  1D5Y A;  4ON0 A;  4CZC A;  2PMH A;  3N97 A;  1JUP A;  4DYR A;  2XVC A;  3HPG A;  3KX2 A;  3OS2 A;  2E1C A;  4G7O F;  2L7K A;  4D0P A;  1YRN A;  2DFF A;  1CF7 B;  2JJ7 A;  4WCG A;  3MZY A;  2X48 A;  4OU0 A;  3DTK A;  1B4A A;  4CCJ A;  2E2J J;  2VXD A;  2TCT A;  3OWT A;  2P5L C;  2NVQ J;  2XIG A;  3L2R A;  4XK4 A;  2MLG A;  2CW0 F;  2BGC A;  2L9R A;  1XD7 A;  4JX5 A;  4OMY A;  2CJJ A;  2DOA A;  2O6G E;  5CVJ A;  4B44 A;  1HCR A;  4IKF A;  4CYD A;  1A5J A;  1Z3X A;  1H88 C;  2IPQ X;  2QF7 A;  1V5G A;  4IRH A;  1SC7 A;  3S2H J;  1I5Z A;  1G4D A;  3TO6 A;  4EJO A;  2HFH A;  3MKZ A;  1DP7 P;  1F5T A;  2PJP A;  2HZT A;  2X1E A;  4A3C J;  2V26 A;  1HW1 A;  3QPT A;  4MFD A;  4EQQ A;  3FMS A;  1VQM I;  4B4C A;  2X1D A;  5KNL A;  4G12 A;  2CU7 A;  2OV7 A;  3PIO F;  2KRH A;  3DF8 A;  4M3D A;  3JCU C;  1FJL A;  4ZJZ A;  5LLQ A;  3BPX A;  1ZRE A;  5DUK A;  5LHG A;  2AQF A;  2ESH A;  3CCL I;  4EEF G;  4RM3 A;  4CGZ A;  1G3W A;  5D4S A;  3KP7 A;  4UUS B;  4DZP A;  3IWF A;  1BL0 A;  1D1C A;  3W6K B;  3IV5 A;  1HXD A;  3QP5 A;  1IXS B;  4GYI A;  2KQR A;  5BS6 A;  2MD0 A;  3E6M A;  1IUF A;  2IW5 A;  4R79 A;  4HDV A;  2IA2 A;  4HV5 A;  1RNL A;  2X6W A;  3L2V A;  2A05 A;  1I1G A;  3VOD A;  4CCL A;  2EZH A;  2LKX A;  5HS8 A;  4CYC B;  1FX7 A;  2CUJ A;  3F6O A;  4Q5S F;  2KRF A;  1O7F A;  5E18 F;  3RIR A;  4XBF A;  4RGR A;  2COM A;  1LQ1 A;  4MTD A;  4OAZ A;  2V9V A;  1RR7 A;  3G4S I;  2DO7 A;  2M7B A;  2PLY A;  1HW5 A;  3SZG A;  1QZY A;  3KZI C;  2FML A;  3COA C;  2EB7 A;  2HQA A;  3PNT A;  2ZJP F;  2VBZ A;  3BTC A;  4LMY A;  2R7W A;  5EGO B;  1PUE E;  1RUN A;  2YU9 J;  5HLI A;  3BTI A;  4XON A;  4B1R A;  4ESB A;  2ZFW A;  4KA4 A;  4KFC A;  5KK1 A;  1C0W A;  2Y31 A;  3F6V A;  4YII A;  3L9F A;  3LWF A;  4IL6 C;  2HOT A;  2FMY A;  5DV5 A;  1CQT A;  1I3A A;  1WI9 A;  1ZEL A;  3I0T A;  1RR8 C;  2E71 A;  2CFO A;  1FBS A;  3VYT B;  4E6K G;  4E7S A;  4DJA A;  4UUT A;  4NNJ A;  5CKT A;  3J80 K;  1JT6 A;  3C7J A;  1KYZ A;  1YOV B;  3DLA A;  2ZME B;  2IGO A;  2A6T A;  3FBN B;  2GXA A;  1W5T A;  2EZL A;  1XS9 A;  4CZZ A;  1Y8Q B;  1WPK A;  3I71 A;  3A1Y A;  3JRH A;  3WTX C;  3CJT B;  1LFU P;  1X1P A;  2OC6 A;  4NC7 A;  4J01 A;  2VUM J;  2EPF A;  1D8J A;  5IP7 J;  4N4O B;  3CMA I;  1XGS A;  1L3L A;  4I0A A;  1P4W A;  2LD5 A;  1BR1 A;  2OD5 A;  4CO8 A;  1WJF A;  1YRN B;  1TWH J;  5TRD A;  2HOA A;  4LG0 A;  3S1M J;  1MIJ A;  1ZGA A;  2M2E A;  4RLQ A;  1FC3 A;  4QPO A;  5JLW A;  1D1A A;  3ML6 A;  5FRM A;  1TQI A;  1R71 A;  1IG7 A;  3KEQ A;  5LHI A;  3GEZ A;  3CLO A;  3WTS C;  3VFZ A;  1PVE A;  4B3A A;  4Y52 J;  4Y15 A;  3RTR A;  2PMZ N;  3IAS 2;  4L5I A;  1BI3 A;  3WTU C;  2ZO4 A;  4A3F J;  2DT5 A;  2V6E A;  1EH8 A;  2DCE A;  1Y0N A;  1JXS A;  3LAP A;  1F36 A;  2DA3 A;  1ETW A;  2FF4 A;  3CP2 A;  4HRI A;  2XAG A;  2W57 A;  3IUO A;  3W2V A;  1S9H A;  3X2Q H;  1R58 A;  1U9N A;  3MKL A;  2RNG A;  3Q9S A;  4IF4 A;  4X1E A;  4B48 A;  5H6Q A;  1VF9 A;  3ECO A;  3W6V A;  3LA2 A;  4PSW A;  2L01 A;  2Z16 A;  4FCY A;  2HYJ A;  2OA4 A;  2VKH A;  1CGP A;  2DA2 A;  2CMP A;  5FRO A;  1PUF A;  2FSW A;  2BBY A;  1O57 A;  3S14 J;  3CUQ A;  2F5V A;  2W48 A;  1R23 A;  4GXO A;  5ILS A;  4HX4 A;  5D6F A;  5K7H A;  5C44 J;  3CC4 I;  3VPR A;  3BJO A;  2BXY A;  2XGX A;  3IAM 2;  5K1Y A;  2GA2 A;  2KDO A;  3KZZ A;  2VC0 A;  4IX7 A;  5FKK A;  2BVM A;  3B73 A;  5FKM A;  3NWS A;  1I6X A;  3DPU A;  5IT9 Z;  1ONV A;  2VKV A;  3EUH C;  2WY8 Q;  3TDU C;  2RKH A;  2NVY J;  1GT0 C;  2VPR A;  1X1C A;  2FRH A;  1ZYR F;  4OWR B;  4RLF A;  2VAS A;  4DOZ A;  2IS2 A;  3IWZ A;  2N8G A;  4CCM A;  3DPT A;  2R5Z A;  5E79 C;  2ZSI B;  1ZRD A;  3R4K A;  5FD5 A;  3EDP A;  2EA4 A;  1HKS A;  2YUS A;  1MBE A;  2DK5 A;  1XDS A;  3OR1 C;  1KU7 A;  2XSJ C;  2X9D A;  2O8X A;  2K27 A;  3FXU A;  2HPI A;  5JR3 A;  1YJN I;  3RKW A;  3NQO A;  4ETS A;  3SXY A;  4IOA F;  4HLX A;  2EFW A;  4IVN A;  1TP4 A;  3CF5 F;  5FGM A;  5IT3 A;  1XSV A;  2R7D A;  3WTV C;  3KP3 A;  3BQY A;  3BP8 A;  3F8M A;  5BNG A;  1YHQ I;  1X3W B;  3WG9 A;  5DCF A;  1DPU A;  3T8T A;  1WGX A;  5HLT A;  2V7F A;  1Q1V A;  3KIO A;  1EA3 A;  2VN2 A;  2MD5 A;  2EA2 A;  4GO1 A;  3QWL A;  1MDM A;  1A31 A;  4E7K A;  1K4T A;  1BIA A;  4JQF A;  2L9N A;  5H20 A;  4KIS A;  5CJ9 A;  1FZP B;  1A35 A;  2VKE A;  2YR2 A;  2FA5 A;  2E7W A;  5JHF A;  1TT0 A;  1RZ4 A;  4A5M A;  1RPW A;  3QPH A;  4D5C A;  3J81 K;  4AIK A;  4Q4Z F;  4FE7 A;  3HTS B;  4IJA A;  3BG9 A;  3QOP A;  2KZG A;  3BTL A;  4M9S A;  1YE9 A;  2ZNZ A;  5EZG A;  1TTY A;  2FBK A;  3KE2 A;  3QYE A;  3CCQ I;  5DEQ A;  5LGN A;  3F3X A;  3SQN A;  4NBQ A;  2QQ9 A;  4BAY A;  3GXO A;  1FEX A;  4BKX A;  2A5W A;  2R7O A;  2JPC A;  3Q0U A;  5F0H A;  2LTP A;  3NAU A;  2WA0 A;  3ZMS A;  5GPC A;  2LRE A;  2W4S A;  1BIB A;  2UUZ A;  4G9Y A;  4LG0 B;  4EVI A;  4RB0 A;  3F9K A;  1ZKG A;  1WHU A;  1JUS A;  1ZG5 A;  2NNY A;  2RN7 A;  2X6X A;  4C9Y A;  2ID3 A;  4QLC U;  2M34 A;  3HOY J;  1XSX A;  1IN6 A;  2HXO A;  3ERM A;  3GTP J;  1KGS A;  2QLZ A;  5HDK A;  1MGT A;  1ZQ3 P;  1U78 A;  1ENH A;  2Z2S B;  4M74 A;  2P5V A;  1A6Q A;  1TBX A;  2KRC A;  1SVO A;  1YS7 A;  2KT0 A;  1ETY A;  3FXK A;  3AFH A;  3RPU D;  3ZXS A;  3J7Y J;  3HOS A;  2MC3 A;  1QVT A;  4EAT A;  3DKY A;  3HOV J;  2G0E A;  1NK3 P;  3EET A;  3RDI A;  3ZOB A;  2IBD A;  2JZY A;  3K1M A;  4LLG F;  1MBJ A;  4M3F A;  1JKO C;  2VBX A;  3PJR A;  2Y48 A;  1SFE A;  4JBA A;  5IP6 A;  2TRT A;  2PBI A;  1ETK A;  3ZCO A;  4RBO A;  1HW2 A;  1J7K A;  1OCP A;  2P8T A;  3BOQ A;  3HRT A;  1REP C;  4PSX A;  4ENJ A;  4I09 A;  4M6X A;  3DLL F;  5LD2 C;  5BOX A;  1TQP A;  2JRT A;  2VBY A;  1RES A;  5M5Y J;  2DA6 A;  2JA5 J;  2DOE A;  4HEA 2;  3CCE I;  1LJ9 A;  1PUF B;  2KDZ A;  4M6V A;  2STT A;  2LFB A;  1TNS A;  3CUQ B;  1IUY A;  2MFZ A;  2HS5 A;  4RAG A;  4LLN A;  4HX7 A;  2XAH A;  2XAU A;  4M9Z A;  2RGV A;  2ESN A;  4QTR A;  3LAJ A;  3VSL A;  1XC5 A;  1BW6 A;  2E1M B;  5IOZ A;  3L00 A;  3FWE A;  4ESF A;  3OL4 A;  1DU6 A;  5FLX K;  3GWZ A;  3K1N A;  1JE8 A;  2Q0O A;  2QKL B;  4Y33 A;  1RC9 A;  3VYS B;  4ZC3 A;  2DA1 A;  4JOM A;  1X3U A;  2QYO A;  4HQM A;  5F1R A;  3SZT A;  3LQR A;  1MJB A;  4XLH A;  2UV1 A;  2JUC A;  2R5Z B;  4IHX A;  3K4J A;  3FM5 A;  4Z6Y A;  1FMV A;  5LEK A;  4HX8 A;  1X2M A;  4XSZ F;  3AL0 B;  3GFM A;  5D8K B;  3GZ6 A;  2IS1 A;  3HKZ A;  2HR3 A;  1T38 A;  1FOY A;  1YW7 A;  1NG7 A;  1OQY A;  1LB2 A;  3K69 A;  2FXA A;  3ZMZ A;  1R5H A;  4XR6 A;  2VLA A;  1K61 A;  4M72 A;  3VOE A;  2FE3 A;  4WXD A;  3CC2 I;  3HIF A;  2A6E F;  3R6S A;  1HDP A;  4XLF A;  1R4M B;  5J4Y A;  4QWQ A;  3HDD A;  4WF2 A;  1UB9 A;  4UVA A;  2M8E A;  3OIQ A;  3LSP A;  1G59 A;  1ERD A;  1R7J A;  3SFI A;  3I64 A;  4HW0 A;  4KIC A;  3RSN A;  3S16 J;  4EJU A;  1H8A C;  2ZC2 A;  3TP0 A;  1Q1H A;  2DOD A;  3DTI A;  2MC4 A;  2H6B A;  4G8X A;  5D5X B;  2ELJ A;  1MDM B;  2QGU A;  3ZP5 A;  2HYF A;  3LL7 A;  2B7E A;  1XX5 A;  2HKX A;  5L3C A;  5K7F A;  3ZMV A;  1KU2 A;  2PQ8 A;  3E7L A;  1B59 A;  3ZN0 A;  4BE1 A;  3V8K A;  5E8I A;  4XLA A;  2R7Z J;  5CVR A;  4KT6 A;  1LDD A;  4A0Z A;  4AYB A;  4ZTF A;  4BXX J;  1K7A A;  3KEO A;  1MBF A;  2DLL A;  6PAX A;  2R7F A;  2DFE A;  2K9L A;  3JTH A;  4MIM A;  4CSW A;  2CO5 A;  5IPA A;  3QYB A;  1D3Y A;  1WVR A;  3JRE A;  4IRI A;  1T08 B;  1K6O A;  5GP9 A;  3L09 A;  2XF7 A;  1JKR C;  2AO9 A;  2JN6 A;  1R5G A;  2LC2 A;  5E3M A;  2DFI A;  4WWC A;  4HNV A;  2VJ5 A;  3WHC A;  1FIP A;  4PGH A;  4C3I J;  4ZZD A;  5F08 A;  4ZZL A;  4S04 A;  2DXI A;  1OIS A;  1S8N A;  4U7D A;  5BPD A;  4PGG A;  3GTK J;  2D45 A;  2F5C A;  3ZN1 A;  1R49 A;  1FYL A;  3LST A;  3EUH A;  4D7M A;  4CCK A;  5C4X J;  1EF4 A;  4FTH A;  1EV7 A;  2ZXH A;  1BI0 A;  4LIV A;  1UCR A;  1NH3 A;  2GOM A;  1JTY A;  1XGO A;  2V9K A;  2DFH A;  1IN8 A;  1YW8 A;  3FM3 A;  2Z33 A;  2L4M A;  1G6N A;  2F5E A;  2V9P A;  1BI1 A;  2WY7 Q;  1ON1 A;  2XF5 A;  4RAZ A;  4ZYG A;  3NAR A;  2BHZ A;  2ECB A;  2VQG A;  4G6D A;  3FXR A;  2W00 A;  3KEY A;  5DD8 A;  4DGW B;  1OYY A;  2J5O A;  3K9T A;  4E4H A;  1ZRC A;  4L0Z B;  2KPM A;  1AHD P;  1VQK I;  2CYY A;  1U5T B;  2LY1 A;  4F55 A;  2LMD A;  3HSR A;  2KIM A;  5CVI A;  1A36 A;  4E7I A;  4F3Q A;  4RB3 C;  2DBB A;  1UEL B;  4I02 A;  4GRI A;  2CQN A;  2VBW A;  4OIN F;  1IXC A;  3ZR8 X;  3U1D A;  4BQA A;  4M71 A;  1I3Q J;  1LDJ A;  2DDB A;  3U1K A;  2Q2E A;  3H1C A;  3E0J B;  3RKX A;  1MND A;  3TO9 A;  2FJ1 A;  1BI2 A;  2RDP A;  2ID6 A;  1EKE A;  5GAE J;  5LBQ A;  2ZNY A;  3TMO A;  1STZ A;  1BM9 A;  3T5X A;  1AKH A;  1Z91 A;  3MAJ A;  1D1B A;  3S2W A;  1P7J A;  1T56 A;  2EFO A;  3ECH A;  2PX9 A;  2IGN A;  3V7R A;  1ZN2 A;  5BQT A;  3O2P E;  3K4N A;  4DNC A;  1IN7 A;  2ECC A;  1DDN A;  1MJA A;  5EEH A;  3L1P A;  3PFY A;  2HEO A;  2M5W A;  1ZLJ A;  2EZI A;  2HOE A;  1WSU A;  4A3I J;  1S5L C;  2AHQ A;  2VQC A;  5L3E A;  4GFB A;  2NS0 A;  1XSD A;  4LFU A;  1SMY F;  2D1V A;  5E3N A;  3LSK A;  2E5Z A;  1U2W A;  3ASO H;  4Q47 A;  3SYT A;  3K4C A;  1ETO A;  2K7L A;  1IN4 A;  3OYH A;  1E0E A;  2P6T A;  3BDD A;  4E7H A;  3VB2 A;  3OR2 C;  1IO2 A;  2Q8K A;  3V7C A;  1XGM A;  1MMN A;  2LY2 A;  1ITY A;  1IZ1 A;  4GCV A;  2BE5 F;  2HPM A;  3H9G A;  2VOP A;  3OSF A;  2RC4 A;  4LJZ F;  2NVU B;  2O0Y A;  4ZYH A;  1KU3 A;  2YS9 A;  1SAX A;  4L18 B;  3FXQ A;  1I27 A;  1KQ9 A;  3MQ0 A;  3MCZ A;  4M3B A;  5BPI A;  4PCQ A;  3F0C A;  1T6S A;  4EV0 A;  2P7C B;  3RYP A;  1HST A;  2B9S A;  3K70 C;  3G3Z A;  2K5C A;  2BXZ A;  3LSG A;  4Q48 A;  4OIQ F;  3AG2 H;  3CZ6 A;  5K5Q A;  1TZL A;  4AID A;  1UHM A;  5F04 A;  2F5F A;  2ELH A;  4I76 A;  5J1R A;  2FOK A;  3QQA A;  5E1W A;  4FX4 A;  3PO3 J;  2UWM A;  1R4N B;  4I6Z A;  5J47 A;  5LHH A;  1OCR H;  2QA4 I;  4IOC F;  2YX7 A;  1QPI A;  3E6D A;  1P2F A;  2FOW A;  2W24 A;  3CCU I;  3HOZ J;  1G8X A;  3RQI A;  1YW9 A;  3BJ6 A;  5HOO A;  3RKQ A;  3E6B A;  3IL2 A;  1T2K A;  2VON A;  1HLV A;  2OBP A;  3E97 A;  5J4V A;  5EG0 A;  4BQN A;  1ZRF A;  3HOW J;  4XLN F;  1XTA A;  1K4S A;  1JT0 A;  4BEH A;  3DBH B;  4BL0 B;  2K4J A;  2KL4 A;  4MO7 A;  1SVM A;  2LKS A;  1T0F C;  3WU2 C;  2UXN A;  3DBL B;  3I54 A;  5CQE A;  2R0Q C;  3VYU B;  3J80 Z;  2Z1D A;  2GLO A;  1P9Q C;  1WI3 A;  2H6C A;  2P0W A;  1POG A;  3EYY A;  5D6E A;  1SFK A;  2WC2 A;  3LSI A;  2AXT C;  1F43 A;  3O8G A;  1WWX A;  5AIP A;  1P4A A;  2MAB A;  4W1U A;  2L3D A;  2DQL A;  2YX4 A;  4D1Q A;  1GUU A;  4PJJ A;  1IRX A;  4EGY A;  4BUP A;  3FKI J;  4KJZ A;  3A02 A;  1J59 A;  2W1O A;  3DEW A;  3V42 A;  1O3S A;  4RB2 C;  2F6C A;  1FTZ A;  4LD5 A;  4B3X A;  3A03 A;  1K83 J;  4ZDL A;  3WU1 B;  3OMY A;  3S1N J;  3G71 I;  2JUG A;  1D8K A;  2Q2E B;  2DMQ A;  3I58 A;  1DGW Y;  4KIT B;  2PMZ A;  3WTY C;  2L7Z A;  3TKY A;  3JR9 A;  1JTX A;  4LLL A;  3HB9 A;  3V8J A;  2FNP A;  2IEK A;  4L9T A;  5CQG A;  4E7L A;  1YO5 C;  4IRG A;  2FNA A;  3JRD A;  3JRC A;  1ZAR A;  3QPL A;  2BZT A;  2GXG A;  1K6Y A;  1LKX A;  1FBQ A;  4I99 C;  5M5W J;  3DKX A;  3TOB A;  5DM6 F;  3K4L A;  2VJJ A;  4A3M J;  2CV0 A;  1EH7 A;  1W0T A;  1XB4 A;  4XKW A;  2LK2 A;  3DP7 A;  2ZXJ A;  1QVU A;  1XN7 A;  3DFG A;  4ITV A;  3QYF A;  2BYV E;  4M3E A;  1Y39 A;  4UV9 A;  2DT6 A;  2JA8 J;  1T39 A;  1W4M A;  4W97 A;  2HQR A;  3S15 J;  4PJ0 C;  1Y8R B;  3AG4 H;  4P9F A;  1OCT C;  3G1L A;  5CVV A;  2ZJQ F;  1U3E M;  1HKQ A;  2LOO A;  5F27 A;  1QRY A;  4HLY A;  2M8G X;  1QU3 A;  1AOY A;  4KYW A;  4B09 A;  2HDD A;  2LKP A;  4XOP A;  3WGG A;  1KA8 A;  2OZ6 A;  3U2R A;  2LR8 A;  5A2Q K;  2EFQ A;  4JX6 A;  1OLT A;  3F8N A;  4UNO A;  2X1C A;  1Z6T A;  3ZQC A;  5EEA A;  3BRO A;  5K5O A;  3IH2 A;  3WGI A;  2RV8 A;  2D1H A;  5D5W B;  1XG1 A;  3VSK A;  3OV8 A;  4RM2 A;  5HNH A;  3WOD F;  3S17 J;  4CA0 A;  1XMX A;  3EUA A;  1MH4 A;  1ZAO A;  5AIQ A;  5L3G A;  3H3V K;  1G3S A;  1M1E B;  3CQZ J;  1Z21 A;  3HUG A;  1KU9 A;  5F64 A;  1JJ8 C;  4NHJ A;  2QUF A;  1FOK A;  3H3Z A;  1RET A;  1IC8 A;  1FLI A;  4L9N A;  4DZJ A;  1W36 C;  2CV1 A;  4ASN A;  2M45 A;  1BA5 A;  3CJQ B;  4XRM A;  1NTC A;  3BZ6 A;  5TIS C;  5EG0 B;  3GTJ J;  2CG4 A;  1OFC X;  4U87 A;  2MBF A;  4BEH B;  5HLG A;  1XCV A;  2ADU A;  4WX9 A;  4F93 B;  2KP6 A;  4IO9 F;  3QRF F;  1BC7 C;  1D0Z A;  2OUM A;  4IEJ A;  5D5U B;  3QU6 A;  4BXF A;  1VQ8 I;  3PNY A;  3PIP F;  1YTY A;  3J81 Z;  2IT0 A;  4CHU A;  3OYE A;  4JP0 A;  4NDL A;  2HTS A;  3GCM A;  4FAS D;  3V8L A;  1RRJ A;  3TDZ C;  2O61 A;  4QPQ A;  3CCY A;  2ZJ2 A;  2DMU A;  3BG7 A;  3MWM A;  2EIM H;  2DOF A;  4BH9 A;  1DP3 A;  1OPC A;  3GTM J;  4A69 C;  3CTA A;  1F4K A;  1EJ9 A;  4PK4 A;  4YIF A;  3JRA A;  4G7Z F;  1PP7 U;  2V1N A;  1WJE A;  2BY0 A;  3BC8 A;  3GFL A;  1SAU A;  2CWE A;  4I7H A;  4XKV A;  3KPH A;  5E8G A;  2ZXW H;  3E5U A;  2Y75 A;  4AVZ A;  1BC8 C;  3ISP A;  3HBL A;  2CQ7 A;  4KN7 X;  2VT2 A;  3QU3 A;  3PFI A;  2P81 A;  4IHY A;  3OYJ A;  1ETQ A;  3OIP A;  3FK6 A;  5FLV A;  1QPM A;  1ZGJ A;  3MEX A;  2XGD A;  2KMU A;  3C2B A;  4BDZ A;  2ZBK A;  3L7W A;  1WH5 A;  4BQQ A;  3L2Q A;  3BR1 A;  3ZQ7 A;  4RGU A;  4CH7 A;  1FIA A;  4IHT A;  1X1A A;  1XMK A;  3H3U A;  3K1P A;  5M3F J;  2L0K A;  4UY8 I;  1XCB A;  4XQF A;  3HOT A;  3PSI A;  1VQ4 I;  2R7V A;  1UST A;  3ABL H;  3EQL F;  4D9J A;  2DMN A;  4LIT A;  4X0G A;  2UZK A;  4L9J A;  1DU0 A;  9ANT A;  2LG4 A;  3I9V 2;  3D5S C;  1YJ9 I;  3KFW X;  1T33 A;  1B6A A;  2JA2 A;  2IXS A;  2PG4 A;  2HVQ A;  3OL3 A;  1F9N A;  2BY3 A;  4N9I A;  3CLQ A;  1OCZ H;  2PN6 A;  2XPV A;  4PUS A;  2E2I J;  2NNN A;  3Q0V A;  5FKN A;  1Z7U A;  2F2E A;  5F0F A;  4TV7 A;  1GXP A;  2XAQ A;  2EH3 A;  1E3O C;  2LF8 A;  3G2B A;  3TQN A;  4BXU A;  1O4X A;  2ZJR F;  3K6G A;  5ILV A;  1X3Z B;  3AAF A;  1WJ5 A;  4OIR F;  1Z77 A;  1JKP C;  1UHS A;  1SVL A;  4Y7N J;  1B8I A;  1PJR A;  1WQ2 A;  5FLX Z;  2KLO A;  2V1U A;  3GTO J;  4YG2 F;  3TW6 A;  1DPR A;  5B1A H;  2R7S A;  1Z9C A;  1Y6I A;  4HOB A;  2HVS A;  1VQN I;  3A01 A;  4N9H A;  4KNY A;  5LRR A;  4ZYE A;  1X1D A;  2XGC A;  1Z3Y A;  5GAG J;  4Y4R A;  1SFU A;  3M1E A;  1SFX A;  3ZQG A;  3OYC A;  2VJI A;  1TL8 A;  1ETX A;  3D5R C;  4M6Y A;  5F6F A;  4EJV A;  4BE0 A;  2J5P A;  2KJC A;  2K02 A;  3DBR B;  3JW4 A;  3LA3 A;  3A0B C;  1QZE A;  2GZW A;  3FXL A;  1YJW I;  1TT5 B;  3HUG B;  3DCF A;  1TW3 A;  4AWX B;  3SEQ A;  5FD6 A;  3OS1 A;  4NB5 A;  1UJ8 A;  3PL8 A;  2X51 A;  4O6J A;  2BV6 A;  3H35 A;  4KN4 X;  1WJD A;  1MZB A;  4FET A;  4BDY A;  2V6C A;  4DYC A;  2JVG A;  2XC7 A;  4ENN A;  3ZGK A;  4AM3 A;  1I50 J;  3EPZ A;  4JX4 A;  3AG3 H;  3IKT A;  3CO6 C;  3RJP A;  2QQB A;  5GTH C;  5FLM J;  3OYI A;  4GDF A;  3G1M A;  2OPT A;  2ZKZ A;  5E1X A;  5L3B A;  3FK7 A;  2X85 A;  2Y69 H;  3U9G A;  2NOJ B;  4OOI A;  2M3A A;  3KYD B;  3TGN A;  3F22 A;  2GIV A;  2V79 A;  3VYR B;  4ZYD A;  2B0L A;  3PQJ A;  4A0Y A;  4DQ2 A;  1OKR A;  3W2W A;  4BE2 A;  3FMQ A;  4HA8 A;  2KHM A;  3HZJ A;  4PZJ A;  4BY1 J;  2K3F A;  2WAQ N;  4PFO A;  1QA6 A;  2NAZ A;  1QGP A;  2QQ8 A;  5LRS A;  2IGM A;  2M4G A;  4RGX A;  1X4P A;  2EV0 A;  4PDK A;  3M1C A;  4U0Y A;  3ZPL A;  2QSG X;  2IS4 A;  1FWZ A;  3WTW C;  1IRZ A;  3FF5 A;  5H6R A;  5E20 A;  4YRV A;  5ED4 A;  3IP4 B;  2KFD A;  3F23 A;  1W5S A;  2W85 A;  2M7A A;  3M7G A;  4A3L J;  2VE8 A;  1GV5 A;  4JYK A;  2P6S A;  4P96 A;  3BJA A;  5J1U A;  1BOA A;  1SD5 A;  2GXB A;  4L5J A;  3DV8 A;  5KAF C;  3PNV A;  4ESJ A;  1R22 A;  2GAU A;  2WBM A;  3CCS I;  2BOL A;  1N78 A;  3GTQ J;  4H4K C;  1U6G A;  4HF0 A;  4YFK F;  4GYG A;  1GLN A;  1ULY A;  1OYI A;  3RI4 A;  4ZH4 F;  1UZC A;  3HM5 A;  2VOO A;  3TBI A;  5K7Z A;  1V54 H;  5DYM A;  1IDZ A;  1TLH B;  2A5Y B;  4CDG A;  5JVG F;  2IS6 A;  4HG2 A;  2C6Y A;  4OIO F;  3SFZ A;  3ERE D;  1IAW A;  3HTU A;  4XIC A;  2GBY A;  4R1H A;  3OYN A;  1VI0 A;  4S05 A;  5HS7 A;  1QZZ A;  1ACI A;  2FQ4 A;  3IRR A;  2H8R A;  5LFA A;  1FBU A;  5M5X J;  2VC1 A;  4D7N A;  5DUI A;  2EBI A;  3HG9 A;  3ESW B;  1ZHF A;  2MA3 A;  3FBI B;  2L7F P;  2LVS A;  1JJ6 C;  4PJL A;  1B8I B;  2NS8 A;  1O3Q A;  4CCO A;  2Z3Y A;  4BHP A;  2B63 J;  2E34 A;  2JSC A;  3LA7 A;  3I4M J;  3JSP A;  2EK5 A;  2HKO A;  2DN0 A;  3FXJ A;  4KIG A;  4N0B A;  3A01 B;  2VPL A;  4BHC A;  1FP1 D;  3NEU A;  1QNT A;  3MZ8 A;  2CSO A;  5J6X A;  3G1O A;  4E7J A;  4WXH A;  1D5V A;  1K79 A;  3CO7 C;  1MMS A;  2EIJ H;  2A69 F;  4FHT A;  1Z1D A;  2CS3 A;  1APL C;  5HS9 A;  3E3V A;  4K2E A;  4EM0 B;  1S3J A;  3ZMU A;  2JWT A;  3BY6 A;  1TWC J;  2W84 A;  3OYM A;  1FYK A;  5JFR A;  1NHA A;  4XMY A;  4HZF A;  3W3C A;  3OIO A;  3HYI A;  2YPR A;  3BCB A;  3OYK A;  3ZRG A;  4ZDO A;  5B66 C;  3GTG J;  1HSJ A;  3GZN B;  3DEE A;  2EV5 A;  2BY1 A;  2XRL A;  3SJM A;  1YS6 A;  1FNN A;  1N77 A;  2IRF G;  2CFX A;  1ZH5 A;  3Q0W A;  2P7V B;  4NQW A;  3NRV A;  4UB6 C;  2NVT J;  3IKV A;  1MW7 A;  1AA7 A;  3IHU A;  3C2H A;  3HGY A;  2GQQ A;  2M9H A;  3O8H A;  4YEJ A;  1IRF A;  3KLN A;  4A3D J;  2G7H A;  2JMW A;  4IPA A;  1P6R A;  2K9M A;  2MW8 A;  1G3Y A;  3VEP A;  2A68 F;  1UHW A;  2K3P A;  5CPR B;  5JHU A;  1B9M A;  1YX3 A;  3WTT C;  2WV0 A;  3FKJ A;  3ONQ A;  2DPU A;  2VIX A;  1IDY A;  1MSF C;  3GZ5 A;  1Y1W J;  2AS5 F;  2FQ3 A;  2L7M P;  2A6H F;  2CUZ A;  3CCM I;  4RAY A;  5DM7 F;  2R5Y A;  3FHZ A;  2H27 A;  2JK3 A;  2R7X A;  1OCO H;  3ABM H;  2F5D A;  2O7O A;  2E36 A;  1XMA A;  1OYW A;  3L2W A;  3KP2 A;  3QOE A;  3HRM A;  4MQV A;  3E5Q A;  2XRO A;  3AG1 H;  2R7U A;  1TWF J;  4XID A;  3OYL A;  2XAS A;  4CXF A;  2G7U A;  1LUJ B;  2HI3 A;  4N4N B;  1P4X A;  3I56 I;  1LNW A;  1VQ9 I;  2JA6 J;  2E35 A;  2L2O A;  1H89 C;  5HVQ C;  4XKC A;  2Y9Y A;  2Y0M A;  4FT8 A;  3RPQ A;  3WG7 H;  2PI0 A;  4KMU X;  1Z0X A;  1L0O C;  3CUO A;  1AU7 A;  3K0L A;  3CDI A;  4IHW A;  3K2Z A;  2HDC A;  3E5X A;  2D5V A;  4HNU A;  1KQ0 A;  2WAE A;  5FFZ A;  2M30 A;  2DA4 A;  1IW7 F;  2CW7 A;  2HWV A;  3E6C C;  3UNG C;  4IQJ A;  5KCM A;  4LIU A;  3T0Y A;  1BOB A;  1IV8 A;  2PMU A;  2YU3 A;  3FIW A;  4RMN A;  3FMR A;  2OTJ I;  3A4C A;  4Y17 A;  3ZQL A;  2IAI A;  3J7A O;  2LBF A;  3LOC A;  3LMM A;  2HTJ A;  1VND A;  3SDB A;  4UB8 C;  3BTJ A;  3DEU A;  1J5Y A;  3I53 A;  1W0U A;  1F1Z A;  2LSO A;  4DW6 A;  3S3O A;  2K40 A;  3S1Q J;  3ROU A;  3S3M A;  2EIL H;  4XLE A;  3FHN A;  3AKZ A;  3I59 A;  5FKL A;  4PJM A;  5ICG A;  3BG5 A;  1A04 A;  4F7Z A;  4Y13 A;  3MVP A;  3K4K A;  2HXI A;  4XNF A;  1IJW C;  2MYS A;  3K4B A;  1VZ0 A;  2WB1 N;  3KLO A;  2VJ4 A;  3IH4 A;  4II2 A;  4HPQ A;  1MD0 A;  3HOX J;  1MBH A;  1WJC A;  4XM3 A;  2E60 A;  1RKT A;  4BBR J;  4CCN A;  1R9T J;  2H1L A;  5DTD A;  3TO7 A;  3WHB A;  3CDH A;  5TGT A;  2XPW A;  4LB5 A;  3IH3 A;  3H5N A;  1MMD A;  5EGO A;  3S93 A;  3HJE A;  3HSE A;  2QSF X;  2ZCW A;  3BR3 A;  2DAO A;  4EJW A;  1W1W E;  5EDN A;  2JT1 A;  3H5A A;  5J8F A;  5GPA A;  1LEA A;  1ZTR A;  3RPU A;  4O3M A;  1PYV A;  2ETH A;  1Z7L A;  1HA8 A;  4Y3O A;  4J19 A;  3M4O J;  5EZH A;  1X58 A;  3GFJ A;  4AIH A;  4A3K J;  4I0B A;  1VQP I;  5A2Q Z;  4LGW A;  4NQW B;  4B47 A;  2R7R A;  2HQN A;  2BVL A;  3HRU A;  4MLO A;  2HU9 A;  1S29 A;  3ZMD A;  3CCJ I;  3D1N I;  1X4O A;  3DXJ F;  2DI3 A;  2VKD A;  2VQH A;  2CQX A;  3B6A A;  1WFX A;  3WTZ A;  3I4P A;  3CD6 I;  1LFB A;  1OMI A;  3CJN A;  2BEO A;  1Z05 A;  3FXO A;  5FFX A;  3P9I A;  4C2M J;  1VQO I;  1LE8 A;  1FY7 A;  4OIP F;  1W7P A;  5IYB J;  2IA1 A;  5HOD A;  2NS7 A;  1IV6 A;  1HBX G;  4E7Z A;  3GME A;  3LFK A;  3TP3 A;  2CQQ A;  4BNC A;  2A3S A;  3IC7 A;  1IGN A;  3BLY A;  5D5V B;  2WAF A;  2R5Y B;  3VDX A;  4NC6 A;  2EIN H;  1TWG J;  1RUO A;  3W2A A;  4DIQ A;  2OJE D;  3MN2 A;  1MH3 A;  4YFN F;  1V5E A;  5CYV A;  5DDG A;  4RB1 A;  1GVD A;  2NYX A;  3MMY B;  1FOX A;  2L9V A;  3HHG A;  2HZD A;  3EUK L;  2Q1Z B;  1TNT A;  2FBH A;  3KYC B;  4CIC A;  3F8F A;  1R00 A;  5HNF A;  1NK2 P;  2GA1 A;  1RIO H;  1IXR C;  1HF0 A;  1KQ8 A;  4UVC A;  3B02 A;  5J40 A;  2R7Q A;  3JRI A;  2M87 A;  4QSH A;  5IYD J;  1AKH B;  2E1O A;  2FBI A;  2LF7 A;  4V2G A;  3M07 A;  4FIS A;  5IYC J;  2RQP A;  2ZXI A;  5FJ8 J;  5ICE A;  4ABZ A;  4C3H J;  3R60 A;  1E3H A;  4RA2 A;  4MTE A;  5IP9 J;  2GM4 A;  4UVB A;  1D0X A;  3DU5 A;  1FPQ A;  3BT9 A;  4AVP A;  2VE9 A;  5JLX A;  3RYR A;  4BBS J;  1MBG A;  3T1B A;  1MNE A;  3RCO A;  2XRN A;  2XB0 X;  2Y9Z A;  2Y0S N;  3GLX A;  3HSF A;  3ZQQ A;  3P5J A;  4A5N A;  4A6E A;  1HOM A;  1LDK B;  3C2G A;  1K78 A;  5EF6 A;  3CDL A;  3DWL E;  2LBF B;  2RVC A;  1P7I A;  1S72 I;  4A3G J;  2M0C A;  2STW A;  4MQ9 F;  4F92 B;  3DTE A;  2VOD A;  5TJJ A;  3GVA A;  1V4R A;  2HQ5 A;  3LSH A;  2LY9 A;  4A12 A;  1UFM A;  1GDT A;  2IJL A;  3F8B A;  1UG2 A;  4F91 B;  5J3L A;  3I59 B;  4HF2 A;  2ZFU A;  4LG3 A;  4WXC A;  4U0V A;  2KIS A;  2Z99 A;  3KET A;  2KJB A;  4HNT A;  2NXN B;  3RZD J;  3BR0 A;  5L3D A;  2NRA C;  1OR7 C;  2O3F A;  2X4H A;  2FX0 A;  2ISZ A;  2XV4 S;  1PP8 F;  3JTG A;  1SD4 A;  1J2X A;  1ZG3 A;  1GHC A;  1U5T C;  2QVO A;  2R93 J;  2PEX A;  3R0J A;  1HDD C;  2QSH X;  4L5E A;  1SAN A;  2JTV A;  1W36 D;  4B8X A;  3OYG A;  3H0G J;  3UR3 C;  3J7A Y;  4IHS A;  3O3K A;  4A2U A;  2CH0 A;  3MZH A;  4X6A J;  2M4K A;  3LFU A;  3V7S A;  2KIF A;  3J7Z I;  4FX0 A;  4KIF A;  3CJR B;  5ILU A;  3JRB A;  1ZR4 A;  1O3R A;  5D4R A;  1MSE C;  2XB5 A;  4XOT A;  3ABK H;  4JK1 X;  4FE4 A;  2O8K A;  1BBY A;  2XPU A;  2X6Y A;  5K5R A;  2ICW G;  3DKW A;  2I10 A;  2O5R A;  3M8E A;  4LOC A;  1AWC A;  2E7X A;  2DA7 A;  1VQ7 I;  3VWB A;  3HGG A;  4G6Q A;  4V19 K;  1OJL A;  3SHF A;  4XRF A;  5KHD A;  5D8L B;  4BHB A;  1LE8 B;  4KIB A;  2XF6 A;  1W7P B;  2DMT A;  3PUF A;  2K9S A;  3CME I;  1V55 H;  4KDP A;  2AXL A;  1PDN C;  4MNU A;  1FMW A;  4YEL A;  2A07 F;  2Y2Z A;  3GFI A;  3S3N A;  3WU0 A;  3HXL A;  2QEX I;  2WWY A;  4XRS G;  3RZO J;  3GLL A;  2EQR A;  3M8F A;  3PQK A;  1LEB A;  1MNM C;  2QZ8 A;  1XDU A;  1FSE A;  4LK0 F;  4ENK A;  2M1B A;  1R36 A;  1U9O A;  2DYS H;  1P92 A;  3H5R A;  3MD2 A;  4EM2 A;  1S7A A;  4NC8 A;  2O9L A;  3BZC A;  4EGZ A;  3L2U A;  3BWG A;  4MHG A;  4A0X A;  1QBJ A;  3ULQ B;  4EMS A;  3KP5 A;  1MBK A;  3N4M A;  5E3L A;  4CUG A;  1A6I A;  1BJA A;  4ENM A;  4C30 A;  2LDU A;  5AON A;  2OQG A;  4YFX F;  2V1X A;  3C18 A;  5FB2 A;  2VI6 A;  4BU2 A;  1I39 A; 
#chains in the Genus database with same CATH homology
 3C3W A;  3ABU A;  3KP6 A;  4UHT A;  4O5V A;  1YLF A;  3LQQ A;  2RNJ A;  3IRQ A;  2D2W A;  2GWR A;  1TQM A;  3JAM Z;  1K78 B;  2MH2 A;  4XSX F;  3DPL C;  2DK8 A;  2K86 A;  2QBY A;  2L54 A;  1SD6 A;  1T0F A;  3P9K A;  3EYI A;  2JPB A;  3C1D A;  2XAJ A;  2KIU A;  1XGN A;  2Z9O A;  4HDU A;  5E17 F;  4U88 A;  2ISY A;  3Q9V A;  3TOA A;  1J75 A;  1IN5 A;  5HDN A;  4A6D A;  4KUM A;  4XLP F;  2XHK A;  3GUD A;  2EFP A;  4G7H F;  3KCC A;  3OOP A;  1TW2 A;  1ZG1 A;  1O7L A;  4E70 A;  5BMZ A;  5EEG A;  1WRJ A;  5JI6 A;  5LGT A;  3JSO A;  2VXZ A;  1ON2 A;  1MKM A;  4M73 A;  2OAZ A;  2L02 A;  2DW4 A;  1EH6 A;  4HQE A;  1R1T A;  4I2O A;  1YYV A;  3GO5 A;  3GX4 X;  3ELK A;  4P55 A;  2EV6 A;  3WE3 A;  4KMF A;  2G9W A;  3FX3 A;  1FT9 A;  4IXA A;  1SD7 A;  1R1V A;  1O3T A;  1JHF A;  4H0E A;  3JAM K;  1R1U A;  1USS A;  5IT9 K;  1JGS A;  4L0Y B;  1OR7 A;  2FEZ A;  2P5K A;  1GXQ A;  3KP4 A;  3WGH A;  1U5T A;  4G94 A;  3M9A A;  2OU2 A;  1B1B A;  3D0S A;  1V3F A;  2FU4 A;  2X0L A;  1WKM A;  2PFB A;  3F21 A;  1W7P D;  2KKO A;  1YQA A;  3V4G A;  1YFH A;  1IRG A;  4BYY A;  1G3T A;  3MFK A;  2QBY B;  3R0A A;  2YSR A;  4MEX F;  1J0R A;  1ODD A;  3T8R A;  5ICC A;  2ACJ A;  4GGG A;  1HKT A;  5DCM A;  2A61 A;  5FO5 A;  3P7N A;  5HDG A;  4UV8 A;  2K4B A;  1JHH A;  1H9G A;  3F8C A;  2DPD A;  2EWN A;  3O6B B;  2VT3 A;  2DQR A;  3BPV A;  1YG2 A;  4AD9 A;  1FSH A;  4P5O A;  5E1Z B;  5L3F A;  3ZMT A;  2H09 A;  1LVA A;  4LB6 B;  2IA0 A;  2P4W A;  5J8C A;  3KZY A;  1U8R A;  4HF1 A;  1QO0 D;  1YIO A;  4I98 B;  4KT5 C;  4MGR A;  1S6L A;  2QEN A;  3HHH A;  4U0W A;  2H94 A;  3WE2 A;  3GF2 A;  1QQI A;  2IVM A;  3F72 A;  3QP6 A;  3SZP A;  2UXX A;  3P9C A;  1CF7 A;  5DD4 A;  3GW2 A;  1MJ9 A;  5ICF A;  3Q5F A;  4EM1 A;  2R3S A;  3R61 A;  1RI7 A;  4LK1 F;  5LGU A;  5LEJ A;  1S7O A;  2OQR A;  1B9N A;  4M9X A;  3DQV C;  4MEY F;  3H92 A;  1E17 A;  4OMZ A;  1FP2 A;  2DU9 A;  2O03 A;  5KVR A;  2L4A A;  2EJR A;  1IF1 A;  4RS8 A;  2V1D A;  2Z5U A;  1I1S A;  1Y0U A;  2XUB A;  5HLH A;  4RGS A;  3G73 A;  2MLK A;  2CQK A;  1J9I A;  3QAH A;  4UXN A;  2IP2 A;  3RKY A;  2LNB A;  4AIJ A;  2XAF A;  5DCM B;  1DUX C;  1FYM A;  1H9T A;  2WTE A;  2E1N A;  2DTR A;  2XKO A;  1KYW A;  2XKP A;  3HRS A;  1E2X A;  1ZLK A;  2CGP A;  1T98 A;  4R8H A;  2TDX A;  4HBL A;  1HQC A;  2HGC A;  4U7B A;  3CUQ C;  1GVJ A;  2W25 A;  2HYG D;  2QQA A;  2EFN A;  3GYH X;  1BN5 A;  1H0M A;  1Z6R A;  1SMT A;  2QWW A;  1VTN C;  4UUV A;  2OZU A;  3L2C A;  4Z2Y A;  2MH9 A;  4L9V A;  3REO A;  2QM3 A;  3FZV A;  4HYE A;  5CVU A;  3D5L A;  5JVT A;  2ZME A;  4HAM A;  4HV6 A;  4EJT A;  4I01 A;  4WK8 F;  5ERI A;  4P9U A;  3I5U A;  3W6J B;  5CLS A;  3ABT A;  4ON0 A;  3N97 A;  2PMH A;  4G7O F;  2E1C A;  2XVC A;  4D0P A;  1CF7 B;  4WCG A;  3MZY A;  4OU0 A;  1B4A A;  2P5L C;  2XIG A;  4OMY A;  2MLG A;  2CW0 F;  2BGC A;  1XD7 A;  2O6G E;  5CVJ A;  4CYD A;  2IPQ X;  4IRH A;  1I5Z A;  1G4D A;  3TO6 A;  4EJO A;  2HFH A;  1DP7 P;  1F5T A;  2PJP A;  2HZT A;  1HW1 A;  3QPT A;  4EQQ A;  3FMS A;  3DF8 A;  5LLQ A;  3BPX A;  1ZRE A;  5DUK A;  5LHG A;  2ESH A;  4CGZ A;  1G3W A;  5D4S A;  3KP7 A;  3IWF A;  3W6K B;  1HXD A;  3QP5 A;  1IXS B;  4GYI A;  5BS6 A;  3E6M A;  2IW5 A;  4R79 A;  4HDV A;  2IA2 A;  4HV5 A;  1RNL A;  1I1G A;  3VOD A;  5HS8 A;  1FX7 A;  3F6O A;  4Q5S F;  2KRF A;  1O7F A;  5E18 F;  3RIR A;  4XBF A;  4RGR A;  2COM A;  1LQ1 A;  4MTD A;  2V9V A;  2DO7 A;  2PLY A;  1HW5 A;  1QZY A;  2FML A;  3COA C;  2EB7 A;  1RUN A;  2VBZ A;  4LMY A;  1PUE E;  5HLI A;  4ESB A;  2ZFW A;  4KA4 A;  4KFC A;  5KK1 A;  1C0W A;  3F6V A;  4YII A;  3L9F A;  3LWF A;  2FMY A;  5DV5 A;  3I0T A;  1WI9 A;  1FBS A;  3J80 K;  3C7J A;  1KYZ A;  2ZME B;  1W5T A;  4CZZ A;  3I71 A;  3WTX C;  1D8J A;  1L3L A;  1XGS A;  4I0A A;  1P4W A;  2OD5 A;  4CO8 A;  5TRD A;  4LG0 A;  1ZGA A;  1FC3 A;  3ML6 A;  1TQI A;  3KEQ A;  5LHI A;  3GEZ A;  3CLO A;  3WTS C;  3VFZ A;  4Y15 A;  3RTR A;  4L5I A;  1BI3 A;  3WTU C;  2ZO4 A;  2DT5 A;  1EH8 A;  1JXS A;  3LAP A;  2FF4 A;  2XAG A;  2W57 A;  1R58 A;  3Q9S A;  4IF4 A;  5H6Q A;  3ECO A;  3LA2 A;  2L01 A;  2OA4 A;  1CGP A;  2FSW A;  2BBY A;  1O57 A;  3CUQ A;  4GXO A;  1R23 A;  5ILS A;  4HX4 A;  5D6F A;  3BJO A;  2XGX A;  5K1Y A;  2GA2 A;  3KZZ A;  2VC0 A;  3B73 A;  1I6X A;  5IT9 Z;  1ONV A;  3TDU C;  2RKH A;  2FRH A;  1ZYR F;  3IWZ A;  3DPT A;  1ZRD A;  3R4K A;  5FD5 A;  3EDP A;  2EA4 A;  1HKS A;  2DK5 A;  1KU7 A;  1XDS A;  2O8X A;  2K27 A;  3FXU A;  5JR3 A;  3RKW A;  3NQO A;  4ETS A;  3SXY A;  4HLX A;  2EFW A;  4IVN A;  5FGM A;  5IT3 A;  1XSV A;  2R7D A;  3WTV C;  3KP3 A;  3F8M A;  3BP8 A;  3WG9 A;  5DCF A;  1DPU A;  3T8T A;  2VN2 A;  2MD5 A;  2EA2 A;  4GO1 A;  1MDM A;  1BIA A;  4JQF A;  5H20 A;  5CJ9 A;  1FZP B;  2YR2 A;  2FA5 A;  2E7W A;  1RZ4 A;  4A5M A;  3QPH A;  4AIK A;  3J81 K;  4Q4Z F;  3HTS B;  4IJA A;  3QOP A;  4M9S A;  2ZNZ A;  1TTY A;  2FBK A;  3KE2 A;  5DEQ A;  5LGN A;  3F3X A;  3SQN A;  2QQ9 A;  4BAY A;  3GXO A;  2JPC A;  3ZMS A;  1BIB A;  4G9Y A;  4LG0 B;  4EVI A;  4RB0 A;  1ZG5 A;  2NNY A;  2RN7 A;  4QLC U;  1XSX A;  1IN6 A;  1KGS A;  2QLZ A;  5HDK A;  1MGT A;  1U78 A;  4M74 A;  2P5V A;  1TBX A;  1YS7 A;  3HOS A;  2MC3 A;  3EET A;  3RDI A;  2JZY A;  3K1M A;  4LLG F;  2VBX A;  2Y48 A;  1SFE A;  4JBA A;  2PBI A;  1HW2 A;  1J7K A;  2P8T A;  3BOQ A;  3HRT A;  1REP C;  4ENJ A;  4I09 A;  4M6X A;  5BOX A;  1TQP A;  2JRT A;  2VBY A;  1LJ9 A;  2STT A;  1TNS A;  3CUQ B;  1IUY A;  2HS5 A;  4LLN A;  4HX7 A;  2XAH A;  4M9Z A;  2RGV A;  2ESN A;  3LAJ A;  3L00 A;  3FWE A;  4ESF A;  5FLX K;  3GWZ A;  3K1N A;  1JE8 A;  2Q0O A;  1X3U A;  2QYO A;  4HQM A;  5F1R A;  3SZT A;  3LQR A;  1MJB A;  3FM5 A;  5LEK A;  4HX8 A;  4XSZ F;  3GFM A;  5D8K B;  3GZ6 A;  2HR3 A;  1T38 A;  1YW7 A;  1LB2 A;  3K69 A;  2FXA A;  3ZMZ A;  1R5H A;  4M72 A;  3VOE A;  2FE3 A;  4WXD A;  3HIF A;  2A6E F;  3R6S A;  4QWQ A;  4WF2 A;  1UB9 A;  4UVA A;  2M8E A;  1R7J A;  3I64 A;  4HW0 A;  4KIC A;  4EJU A;  1Q1H A;  4G8X A;  2H6B A;  5D5X B;  1MDM B;  3ZP5 A;  2HYF A;  5L3C A;  2HKX A;  3ZMV A;  1KU2 A;  2PQ8 A;  1B59 A;  3ZN0 A;  3V8K A;  5E8I A;  5CVR A;  1LDD A;  4A0Z A;  1K7A A;  3KEO A;  2DLL A;  6PAX A;  2R7F A;  3JTH A;  2CO5 A;  1D3Y A;  4IRI A;  1K6O A;  3L09 A;  1R5G A;  2DFI A;  4WWC A;  4PGH A;  4ZZD A;  4S04 A;  4ZZL A;  1S8N A;  4U7D A;  5BPD A;  4PGG A;  2D45 A;  2F5C A;  3ZN1 A;  1FYL A;  3LST A;  3EUH A;  1EV7 A;  1BI0 A;  1UCR A;  1XGO A;  1IN8 A;  1YW8 A;  3FM3 A;  2Z33 A;  2L4M A;  1G6N A;  2F5E A;  1BI1 A;  1ON1 A;  4RAZ A;  4ZYG A;  4G6D A;  3FXR A;  5DD8 A;  1OYY A;  2J5O A;  3K9T A;  1ZRC A;  4L0Z B;  2CYY A;  1U5T B;  3HSR A;  2KIM A;  5CVI A;  4RB3 C;  2DBB A;  4I02 A;  2VBW A;  4OIN F;  1IXC A;  3U1D A;  4BQA A;  4M71 A;  1LDJ A;  2Q2E A;  3RKX A;  3TO9 A;  5LBQ A;  1BI2 A;  2RDP A;  2ZNY A;  1STZ A;  1BM9 A;  3T5X A;  1Z91 A;  3MAJ A;  3S2W A;  2EFO A;  3ECH A;  3V7R A;  1ZN2 A;  5BQT A;  3O2P E;  4DNC A;  1IN7 A;  1DDN A;  1MJA A;  5EEH A;  2HEO A;  2M5W A;  1ZLJ A;  2HOE A;  1WSU A;  5L3E A;  2NS0 A;  1XSD A;  4LFU A;  1SMY F;  2D1V A;  1U2W A;  4Q47 A;  2K7L A;  1IN4 A;  2P6T A;  3BDD A;  3VB2 A;  2Q8K A;  3V7C A;  1XGM A;  1IZ1 A;  4GCV A;  2BE5 F;  2VOP A;  2RC4 A;  4LJZ F;  2O0Y A;  4ZYH A;  1KU3 A;  1SAX A;  4L18 B;  3FXQ A;  1I27 A;  1KQ9 A;  3MQ0 A;  3MCZ A;  5BPI A;  4PCQ A;  1T6S A;  4EV0 A;  2P7C B;  3RYP A;  1HST A;  3G3Z A;  4Q48 A;  4OIQ F;  5K5Q A;  1UHM A;  2F5F A;  2ELH A;  2FOK A;  5E1W A;  4FX4 A;  2UWM A;  5LHH A;  2YX7 A;  3E6D A;  1P2F A;  2W24 A;  1YW9 A;  3BJ6 A;  5HOO A;  3E6B A;  3IL2 A;  1T2K A;  2VON A;  2OBP A;  3E97 A;  1ZRF A;  4XLN F;  2K4J A;  2UXN A;  3I54 A;  3J80 Z;  2H6C A;  3EYY A;  5D6E A;  2WC2 A;  1WWX A;  5AIP A;  1P4A A;  2L3D A;  2DQL A;  2YX4 A;  4EGY A;  1J59 A;  1O3S A;  4RB2 C;  4LD5 A;  3WU1 B;  1D8K A;  3I58 A;  3WTY C;  3TKY A;  4LLL A;  3V8J A;  2FNP A;  4L9T A;  1YO5 C;  4IRG A;  2FNA A;  1ZAR A;  2GXG A;  1FBQ A;  3TOB A;  1EH7 A;  1XB4 A;  3DP7 A;  2ZXJ A;  1XN7 A;  3DFG A;  2BYV E;  4UV9 A;  1T39 A;  1W4M A;  2HQR A;  4P9F A;  5CVV A;  1U3E M;  1HKQ A;  4HLY A;  1AOY A;  4KYW A;  4B09 A;  2LKP A;  3WGG A;  1KA8 A;  2OZ6 A;  3U2R A;  5A2Q K;  2EFQ A;  3F8N A;  4UNO A;  1Z6T A;  3WGI A;  3BRO A;  5K5O A;  2RV8 A;  2D1H A;  5D5W B;  3OV8 A;  3WOD F;  5AIQ A;  1ZAO A;  5L3G A;  1G3S A;  3HUG A;  1KU9 A;  5F64 A;  4NHJ A;  2QUF A;  1FOK A;  3H3Z A;  1FLI A;  4L9N A;  4ASN A;  2M45 A;  3BZ6 A;  2CG4 A;  2MBF A;  5HLG A;  1XCV A;  2ADU A;  4WX9 A;  3QRF F;  1BC7 C;  5D5U B;  3QU6 A;  1YTY A;  2IT0 A;  4CHU A;  3J81 Z;  2HTS A;  3V8L A;  3TDZ C;  2O61 A;  2ZJ2 A;  3MWM A;  4BH9 A;  1OPC A;  3CTA A;  1F4K A;  4YIF A;  4G7Z F;  1PP7 U;  4I7H A;  3GFL A;  2CWE A;  5E8G A;  3E5U A;  2Y75 A;  1BC8 C;  3ISP A;  4KN7 X;  2VT2 A;  3QU3 A;  3PFI A;  1QPM A;  1ZGJ A;  3MEX A;  2ZBK A;  3L7W A;  3ZQ7 A;  4RGU A;  4IHT A;  1XMK A;  3H3U A;  3K1P A;  1XCB A;  3HOT A;  1UST A;  3EQL F;  2UZK A;  4L9J A;  3KFW X;  1B6A A;  2PG4 A;  1F9N A;  4N9I A;  2PN6 A;  2NNN A;  1Z7U A;  2F2E A;  4TV7 A;  1GXP A;  2XAQ A;  2LF8 A;  3TQN A;  4BXU A;  5ILV A;  3AAF A;  4OIR F;  1WQ2 A;  5FLX Z;  2V1U A;  4YG2 F;  1DPR A;  1Z9C A;  4HOB A;  4N9H A;  4KNY A;  5LRR A;  4ZYE A;  1SFU A;  3M1E A;  1SFX A;  4M6Y A;  5F6F A;  4EJV A;  2J5P A;  2KJC A;  2K02 A;  3JW4 A;  3LA3 A;  2GZW A;  1TW3 A;  4AWX B;  5FD6 A;  4NB5 A;  4O6J A;  2BV6 A;  4KN4 X;  1MZB A;  2V6C A;  4ENN A;  3IKT A;  3CO6 C;  3RJP A;  2QQB A;  2ZKZ A;  5E1X A;  5L3B A;  3U9G A;  4OOI A;  3TGN A;  3F22 A;  2GIV A;  2V79 A;  4ZYD A;  2B0L A;  3PQJ A;  4A0Y A;  4DQ2 A;  1OKR A;  3FMQ A;  4HA8 A;  4PZJ A;  2NAZ A;  1QGP A;  5LRS A;  4RGX A;  2EV0 A;  4PDK A;  4U0Y A;  3ZPL A;  1FWZ A;  3WTW C;  3FF5 A;  5H6R A;  5E20 A;  5ED4 A;  3F23 A;  1W5S A;  2W85 A;  3M7G A;  2VE8 A;  2P6S A;  4P96 A;  3BJA A;  1BOA A;  1SD5 A;  2GXB A;  4L5J A;  3DV8 A;  4ESJ A;  1R22 A;  2GAU A;  1U6G A;  4HF0 A;  4YFK F;  4GYG A;  1ULY A;  1OYI A;  3RI4 A;  4ZH4 F;  2VOO A;  5DYM A;  1TLH B;  2A5Y B;  4CDG A;  2C6Y A;  4OIO F;  3SFZ A;  3ERE D;  1IAW A;  3HTU A;  4R1H A;  4S05 A;  5HS7 A;  1QZZ A;  3IRR A;  1FBU A;  2VC1 A;  5DUI A;  1ZHF A;  2MA3 A;  1O3Q A;  2Z3Y A;  4BHP A;  2JSC A;  3LA7 A;  3JSP A;  2EK5 A;  2HKO A;  4N0B A;  4KIG A;  4BHC A;  1FP1 D;  3NEU A;  1QNT A;  2CSO A;  5J6X A;  4WXH A;  1D5V A;  1K79 A;  3CO7 C;  4FHT A;  2A69 F;  1Z1D A;  5HS9 A;  3E3V A;  4K2E A;  4EM0 B;  1S3J A;  3ZMU A;  3BY6 A;  2W84 A;  1FYK A;  5JFR A;  1NHA A;  4HZF A;  3HYI A;  2YPR A;  1HSJ A;  2EV5 A;  1YS6 A;  1FNN A;  2IRF G;  2CFX A;  1ZH5 A;  2P7V B;  4NQW A;  3NRV A;  3IKV A;  3IHU A;  2GQQ A;  1IRF A;  3KLN A;  2G7H A;  4IPA A;  1P6R A;  1G3Y A;  3VEP A;  2A68 F;  1UHW A;  5JHU A;  1B9M A;  3WTT C;  2WV0 A;  2DPU A;  3GZ5 A;  2AS5 F;  2FQ3 A;  2A6H F;  4RAY A;  3FHZ A;  2H27 A;  2F5D A;  1XMA A;  1OYW A;  3KP2 A;  3HRM A;  4MQV A;  3E5Q A;  2XRO A;  2XAS A;  4CXF A;  2G7U A;  1P4X A;  1LNW A;  5HVQ C;  2Y0M A;  4FT8 A;  3RPQ A;  2PI0 A;  4KMU X;  1L0O C;  3CUO A;  3K0L A;  3K2Z A;  2HDC A;  3E5X A;  1KQ0 A;  5FFZ A;  2M30 A;  1IW7 F;  2HWV A;  3E6C C;  3T0Y A;  2PMU A;  2YU3 A;  3FMR A;  4Y17 A;  3J7A O;  2HTJ A;  3DEU A;  1J5Y A;  3I53 A;  1F1Z A;  2LSO A;  3ROU A;  3I59 A;  5ICG A;  1A04 A;  4F7Z A;  4Y13 A;  3KLO A;  1MD0 A;  3TO7 A;  3CDH A;  4LB5 A;  3HSE A;  2ZCW A;  2DAO A;  4EJW A;  2JT1 A;  5J8F A;  1LEA A;  3RPU A;  4O3M A;  2ETH A;  3GFJ A;  4AIH A;  4I0B A;  5A2Q Z;  4LGW A;  2HQN A;  3HRU A;  1S29 A;  3ZMD A;  3DXJ F;  2DI3 A;  3WTZ A;  3I4P A;  1OMI A;  3CJN A;  2BEO A;  1Z05 A;  5FFX A;  3P9I A;  1FY7 A;  4OIP F;  1W7P A;  2IA1 A;  1HBX G;  3LFK A;  4BNC A;  2A3S A;  3IC7 A;  5D5V B;  1RUO A;  4YFN F;  5CYV A;  5DDG A;  4RB1 A;  2NYX A;  3HHG A;  1TNT A;  2FBH A;  4CIC A;  3F8F A;  1R00 A;  2GA1 A;  1RIO H;  1IXR C;  1KQ8 A;  4UVC A;  3B02 A;  2M87 A;  2FBI A;  2LF7 A;  2RQP A;  5ICE A;  3R60 A;  4MTE A;  4UVB A;  1FPQ A;  4AVP A;  2VE9 A;  3RYR A;  3T1B A;  2XRN A;  3GLX A;  3HSF A;  4A6E A;  4A5N A;  1LDK B;  1K78 A;  2RVC A;  2STW A;  4MQ9 F;  2VOD A;  5TJJ A;  3GVA A;  1V4R A;  4A12 A;  1UFM A;  2IJL A;  3F8B A;  3I59 B;  4HF2 A;  4WXC A;  4U0V A;  3KET A;  2Z99 A;  2KJB A;  5L3D A;  2NRA C;  2O3F A;  2X4H A;  2ISZ A;  2XV4 S;  1PP8 F;  3JTG A;  1SD4 A;  1J2X A;  1ZG3 A;  1GHC A;  1U5T C;  2QVO A;  2PEX A;  3R0J A;  2JTV A;  4B8X A;  4IHS A;  3O3K A;  4A2U A;  3MZH A;  3V7S A;  2KIF A;  4FX0 A;  4KIF A;  5ILU A;  1O3R A;  5D4R A;  4JK1 X;  1BBY A;  5K5R A;  3DKW A;  3M8E A;  1AWC A;  2E7X A;  4G6Q A;  3SHF A;  4XRF A;  5D8L B;  4BHB A;  4KIB A;  1W7P B;  4KDP A;  2AXL A;  1PDN C;  4MNU A;  2A07 F;  3GFI A;  3WU0 A;  2WWY A;  3M8F A;  3PQK A;  1LEB A;  2QZ8 A;  1XDU A;  1FSE A;  4LK0 F;  4ENK A;  2M1B A;  1R36 A;  4EM2 A;  1P92 A;  1S7A A;  4EGZ A;  3BWG A;  4MHG A;  4A0X A;  1QBJ A;  3ULQ B;  4EMS A;  3KP5 A;  3N4M A;  1BJA A;  4ENM A;  2LDU A;  5AON A;  2OQG A;  4YFX F;  2V1X A;  3C18 A;  5FB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...