3WTSC

Crystal structure of the complex comprised of ets1, runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
118
structure length
118
Chain Sequence
PVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
total genus 40
structure length 118
sequence length 118
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wtsC00
5ICFA 3DXJF 2COMA 2HKOA 3E5UA 1I1GA 2XHKA 5LLQA 2NYXA 4PGHA 5FLXZ 2VE8A 2Q2EA 3T5XA 2PMUA 2X0LA 1E17A 2QVOA 2H6BA 3KEQA 3KP4A 2STTA 4L0ZB 2W85A 4HF0A 4PGGA 2JRTA 1FSEA 3BPVA 4I01A 3P9KA 5FGMA 3MAJA 3WTWC 2ESHA 3SHFA 1CF7B 2E7WA 1D5VA 1YS6A 2QBYA 2IRFG 2W24A 4L18B 3LWFA 4HQEA 1HSTA 5E1ZB 4GO1A 1K6OA 5ERIA 1BI1A 3DPTA 4PZJA 5L3FA 4EM1A 3J80K 1J2XA 2A69F 2RNJA 2E7XA 4AVPA 1J5YA 1R5HA 1S8NA 3F23A 4I7HA 4KUMA 4B09A 2DQLA 2ELHA 3B73A 3I54A 3TGNA 2VODA 4XBFA 2RN7A 4BNCA 3HSEA 2FBKA 2OD5A 3T1BA 2CO5A 4BHBA 3J81K 4CDGA 4DQ2A 5BPIA 3JAMZ 4OOIA 4IRHA 1SD7A 3CLOA 1LQ1A 1TQMA 2DW4A 1XMAA 2VBWA 5CLSA 1TNSA 3BJ6A 1TLHB 1WQ2A 1MDMB 3MFKA 3WTSC 4R1HA 2PEXA 4ENMA 2EB7A 5H20A 2F2EA 4ZYEA 1WKMA 3R6SA 2HTJA 4KN7X 2NNNA 3F8BA 2ACJA 3TO7A 2YPRA 2EV6A 3I5UA 1O7LA 3FXRA 2G7HA 5CVVA 2VBZA 3SZTA 3DPLC 4O6JA 1CGPA 4EV0A 3E5XA 1UCRA 5K1YA 4ENNA 2ZCWA 2OZUA 2VONA 5JVTA 5IT9Z 2RGVA 5HLGA 4U0WA 5BQTA 3I53A 3RPQA 3ABTA 3FM3A 3KP2A 1ZRDA 5E20A 1BIAA 3ZMZA 4ON0A 4A12A 2QQ9A 3F8NA 4OIQF 3GFIA 1RIOH 1PP8F 2RKHA 1S29A 1ZAOA 2M45A 2ZO4A 4A0ZA 2Q8KA 1QO0D 1ZG5A 5F6FA 5ILUA 3DKWA 1BC7C 4LG0B 3E6BA 2K86A 1PDNC 2XASA 1XSDA 3V8LA 5E1WA 4A2UA 5E1XA 3ULQB 1KYWA 1H9GA 5HS9A 3GF2A 2Z3YA 3L00A 5FB2A 2HFHA 4PDKA 3GX4X 4CYDA 1FPQA 3K2ZA 2YX7A 1MD0A 2IA2A 1FLIA 3E6MA 3U9GA 5FD6A 4HA8A 1P4AA 5HS7A 4FX0A 4A0XA 4CXFA 1FSHA 1B1BA 3RTRA 1HW1A 2WV0A 1JE8A 1CF7A 3E5QA 3WGHA 1OYWA 2UXNA 1L3LA 5D5XB 3BY6A 3I64A 3JTGA 3VEPA 2X4HA 2KJBA 1LEBA 4HAMA 1DPUA 1U5TB 3EETA 4MTEA 4NHJA 2PLYA 1YW7A 3TDZC 1XGSA 1FC3A 5D4SA 3JSOA 3E97A 1L0OC 2H09A 3RDIA 3QOPA 2QLZA 2P5LC 3ZMSA 3F22A 4I02A 3TQNA 5JHUA 3GVAA 3KETA 1G3YA 1F1ZA 3KCCA 3LAJA 1RUOA 3C1DA 2O61A 2NAZA 1MGTA 4G7HF 2P6TA 1R1VA 3QP5A 1KU2A 5D8KB 4ESFA 3ZPLA 3QRFF 1U5TC 1H9TA 2XIGA 1S6LA 2DPUA 1YS7A 3GFJA 4HLXA 1K78B 1MJAA 1LDJA 4HF2A 4WF2A 4A5NA 1R22A 3FWEA 3RKYA 2XRNA 4IVNA 4YIFA 3IC7A 3WU1B 1ZREA 2O8XA 3LSTA 3KP7A 3HSRA 4UVCA 2EA4A 2FBIA 4CGZA 2XVCA 4M6YA 3RKXA 5DEQA 2E1NA 2IJLA 5E17F 2RDPA 4A0YA 2W84A 2DBBA 3HOSA 1XMKA 2DK5A 1IRFA 2VT2A 2EFPA 3BP8A 1FYMA 1XSXA 2F5DA 1HQCA 1IW7F 1ZN2A 1KQ8A 3KE2A 3RIRA 1UB9A 4RAYA 4IHTA 3H3ZA 3N97A 5ILVA 5D5UB 3L9FA 3RYPA 1R36A 2CGPA 1LNWA 4L9VA 3Q9VA 4G9YA 4MQ9F 2HZTA 4M6XA 2FNPA 2IVMA 1RNLA 4ZH4F 4CICA 2L54A 2PQ8A 3BOQA 1FWZA 3QP6A 2MLGA 4HV5A 5L3BA 1W5SA 1YW8A 3BWGA 3WTTC 1BI2A 3KP3A 4KYWA 4BQAA 5CVIA 4CZZA 4HDVA 4HQMA 3C7JA 1EH6A 5J6XA 3KP5A 4NB5A 2H94A 4P55A 2XAHA 5K5QA 1I6XA 2F5CA 1LVAA 2KJCA 4ESBA 4M71A 5HLIA 5ILSA 3F3XA 2FEZA 4JK1X 4GGGA 1P92A 1JHFA 2MH9A 4HF1A 5LEKA 1ZG1A 3GWZA 4O5VA 1TQPA 4I09A 4KMUX 1LJ9A 4AIKA 5D5VB 4U7DA 2GIVA 3Q9SA 2DQRA 2G7UA 4S05A 5KVRA 1OYIA 2VT3A 2RC4A 3WG9A 3KP6A 2FQ3A 2E1CA 2UXXA 1ULYA 4LB5A 2WTEA 2Q0OA 3BZ6A 1S7OA 3ISPA 1XCBA 3E6CC 4KNYA 1C0WA 3FF5A 5E18F 1GXQA 3FHZA 5DDGA 4RS8A 4FHTA 1KQ0A 2BBYA 4S04A 2Y0MA 3ZMTA 2FMLA 2VN2A 3SZPA 4EM0B 3IKTA 3QPTA 4EMSA 4LB6B 5FFXA 1IRGA 1QPMA 4ETSA 5DUKA 1TW2A 2GA1A 1R23A 3QAHA 4RB3C 4EM2A 4Q5SF 4EJTA 4HZFA 4WXDA 3RI4A 1XD7A 3DV8A 4U0YA 3HHGA 3K1NA 3WTYC 2YX4A 3C18A 1I27A 1KYZA 2XROA 1JGSA 4AIJA 4Y13A 2GA2A 1P4WA 2PJPA 3MZHA 1KU7A 5ICEA 1ON1A 1AOYA 3QU6A 3F8CA 3LA2A 2LF8A 3M7GA 3ELKA 2DLLA 2HEOA 1YIOA 3CUQB 2EA2A 1K79A 3B02A 5F64A 1FP1D 4D0PA 1RZ4A 5AIQA 4HYEA 3DF8A 3V7SA 4AD9A 1XGOA 4KIFA 1UHWA 3IRRA 4IRGA 1Z05A 2V79A 3KFWX 2L02A 3JW4A 1WI9A 3EDPA 5D6FA 4HOBA 2DAOA 2FXAA 2O6GE 1DDNA 1MKMA 2EWNA 2HTSA 2OAZA 2TDXA 2YR2A 2XAQA 3R0JA 3KLOA 3MWMA 1D8JA 4O3MA 1TW3A 5CVUA 4GYIA 3CUQA 2L4MA 2HOEA 1HKSA 3P9IA 2ETHA 2BE5F 1Z6TA 4L9TA 2Z33A 1D3YA 2EFWA 2GAUA 5KK1A 2EFQA 3TDUC 2RQPA 3SQNA 2FMYA 3SFZA 1YTYA 4P9FA 1FZPB 1B9NA 2J5PA 3FMSA 3FZVA 3CDHA 2OBPA 4B8XA 3QPHA 1FX7A 4BXUA 1FP2A 4A6DA 2XKPA 1YG2A 3LAPA 1XSVA 1LB2A 3EQLF 4MEYF 4EGYA 3DFGA 1R5GA 3R61A 3AAFA 2OU2A 2G9WA 5DUIA 4U7BA 2HS5A 2A5YB 5E8GA 2DFIA 5LHIA 3WTVC 3G73A 1D8KA 1HW2A 3ECOA 4HV6A 4WXHA 1B9MA 3ERED 5LHGA 4EJVA 1DPRA 1QNTA 2V6CA 1F9NA 2D45A 3U1DA 2FNAA 2XGXA 2PI0A 2HQNA 4U0VA 3D5LA 2V9VA 5LRSA 3VOEA 4UVAA 5D8LB 3V7RA 2RVCA 4YFNF 2NRAC 4MHGA 2C6YA 1V4RA 1EH7A 2HYFA 1STZA 4HW0A 4IJAA 4IXAA 1W7PB 2GWRA 1FYKA 2B0LA 4OIPF 2VOOA 4BHPA 3RPUA 1ZHFA 3TOBA 3GYHX 1T39A 2VE9A 2ZNZA 2DTRA 3HRSA 5FO5A 5J8FA 3LA7A 1X3UA 3JAMK 5A2QK 1FT9A 4LMYA 2OQGA 3WE2A 3D0SA 4LLNA 3V8KA 1E2XA 3S2WA 3J80Z 3DP7A 4M74A 4G94A 1G4DA 2P7CB 1BIBA 2O03A 4LD5A 1SFUA 2P4WA 5H6QA 3I71A 2GQQA 1ZG3A 1RI7A 3PQJA 1JXSA 2K4JA 1R1UA 1O7FA 1R1TA 1ZGJA 4AWXB 3R60A 3L09A 1K7AA 3IWZA 2D2WA 2MH2A 1IN8A 2M5WA 4EVIA 4XLPF 2Z5UA 4ZYDA 3ZMVA 5LGNA 3I4PA 3GEZA 2HGCA 1AWCA 5CJ9A 1EV7A 4YIIA 1SFXA 2D1VA 1KQ9A 4PCQA 2WC2A 4EQQA 5D5WB 4G7OF 2R3SA 2DPDA 2P5KA 2HQRA 3TOAA 1FBSA 1IF1A 5K5RA 4JQFA 1O3QA 1XDUA 3DQVC 3OV8A 1F4KA 1Z1DA 3BROA 4GCVA 4MNUA 5LEJA 1U6GA 3WGIA 1ODDA 1LDDA 1OYYA 4M72A 1OR7A 1SFEA 2BGCA 2R7DA 1O57A 3T8TA 2STWA 4OMZA 2UZKA 4ESJA 1LDKB 1FOKA 2LSOA 2OQRA 3RJPA 4U88A 2VBYA 4UUVA 2V1XA 1SMYF 3I59B 5HLHA 5HOOA 1HKQA 2J5OA 3ZQ7A 5HDGA 4ASNA 2IA0A 1Q1HA 3IHUA 5L3DA 4RB0A 4UV9A 2L3DA 2M8EA 4MEXF 1S3JA 3L7WA 3M8EA 2MC3A 4UV8A 5IT3A 2EFOA 2ISZA 3ML6A 2PG4A 3MZYA 4Z2YA 4NQWA 4A5MA 2K4BA 1P2FA 3O3KA 2FA5A 4M9SA 5HDNA 4LLGF 5LHHA 4XLNF 3NEUA 3ZN0A 3FM5A 2A61A 5DV5A 4BHCA 5TRDA 5BPDA 5BS6A 4Q4ZF 4WWCA 1ZARA 2ZNYA 2P8TA 4Y17A 1H0MA 3HHHA 1R00A 4XRFA 3M1EA 2YSRA 3H3UA 3V8JA 1SD6A 1BOAA 2KIFA 4HBLA 2QYOA 2CWEA 2KIMA 5TJJA 1YYVA 5CVJA 4FT8A 3E6DA 1XGNA 3CTAA 4GYGA 1YW9A 2CG4A 3TKYA 3H92A 1J75A 1Z7UA 1IXCA 1BJAA 2EJRA 1MDMA 1GHCA 1T98A 2K27A 1UHMA 2DK8A 2IPQX 1J9IA 2R7FA 4P9UA 2VC1A 1BN5A 1FY7A 4HX4A 3HTUA 3FX3A 5ICCA 2LNBA 2XAFA 4EJOA 1W4MA 3LQQA 3J7AO 1XCVA 4IF4A 4TV7A 1KA8A 1KGSA 1RUNA 3EYIA 4HX7A 1XB4A 2QQBA 3GLXA 3WE3A 4G8XA 3GFLA 2ISYA 4EJUA 3CUOA 1R7JA 3IWFA 2ESNA 4H0EA 1T6SA 4EJWA 4L9JA 4YFKF 4UVBA 1V3FA 3O6BB 3IL2A 4LFUA 1W7PD 1DP7P 2XUBA 1XN7A 2VBXA 5H6RA 4ZYGA 2ZFWA 1YO5C 1USSA 1Z91A 1EH8A 3WU0A 3BDDA 4LG0A 2GXBA 1SD4A 3LFKA 3KEOA 3REOA 3BJOA 3Q5FA 4L5JA 3JTHA 4L9NA 1JHHA 5L3GA 1O3TA 3K1MA 2P7VB 2W25A 2PBIA 4DNCA 4XSXF 3EUHA 5DYMA 3ZN1A 2ZMEB 3RYRA 4Q48A 4IHSA 1IN7A 2PFBA 1BC8C 2AS5F 3T0YA 3OOPA 2K02A 3CO7C 5EEGA 3P9CA 2MD5A 1SD5A 4ENJA 3KZZA 5LGUA 2EV0A 2JTVA 4LK0F 4QWQA 5LGTA 3M8FA 1OPCA 2PN6A 4N9IA 3ZMDA 1QBJA 3ROUA 3F21A 3GZ6A 4G7ZF 3CO6C 2EV5A 4CO8A 4M73A 2AXLA 4OIOF 4I0AA 2VOPA 3PFIA 1HW5A 2DT5A 1R58A 1USTA 1J59A 4HX8A 3TO9A 3IKVA 4I98B 1SAXA 3K69A 2P6SA 1HSJA 1B6AA 1MJ9A 3TO6A 3G3ZA 3M9AA 2JT1A 1WRJA 4RGUA 2A68F 1G3SA 3SXYA 3QU3A 3HRTA 1A04A 2JSCA 2A3SA 1BM9A 2GXGA 4P5OA 1J7KA 3F72A 1PUEE 1ZH5A 5DCMB 1S7AA 1QZYA 1Z6RA 5D6EA 4RGRA 4WX9A 5CYVA 2H6CA 3F6VA 2XV4S 4OINF 3N4MA 2HYGD 4IPAA 4N9HA 4P96A 3KZYA 3LQRA 1REPC 4WCGA 4ENKA 2KRFA 2QZ8A 3FXQA 4KT5C 1DUXC 4F7ZA 4MGRA 4M9XA 2MBFA 3K9TA 2MLKA 1B59A 5F1RA 1PP7U 2UWMA 1BBYA 3V4GA 3HRUA 2KKOA 3U2RA 1HBXG 4WK8F 1Z9CA 2VC0A 4N0BA 1U8RA 5ICGA 4LJZF 5ED4A 4I2OA 1IXRC 2HR3A 1G6NA 2DU9A 4KIGA 1YLFA 2HWVA 4KN4X 1ON2A 1P6RA 3O2PE 2BEOA 2LF7A 1VTNC 1Y0UA 4UNOA 4IRIA 4A6EA 2ADUA 2JZYA 3CUQC 2ZKZA 1TTYA 2EFNA 3GUDA 4LK1F 6PAXA 4OU0A 1OKRA 1FBUA 1IUYA 2VXZA 1IN4A 2O3FA 1QQIA 3K0LA 2V1UA 5JI6A 2BYVE 3K1PA 2A07F 2Z99A 5AONA 1U5TA 3VFZA 1P4XA 2FSWA 3WODF 1YFHA 2M1BA 2ZMEA 3E3VA 1ZRCA 1NHAA 4KDPA 2FOKA 3GO5A 2MA3A 5AIPA 3W6JB 2A6EF 2ZJ2A 2BV6A 5DCFA 4I0BA 4R79A 4G6DA 5CVRA 1SMTA 2OA4A 2IW5A 1YQAA 4OMYA 2OZ6A 1I1SA 2M30A 3I58A 3DEUA 4RGSA 3W6KB 2QENA 2QBYB 5J8CA 3ECHA 1IN5A 4RGXA 4FX4A 1FBQA 5FLXK 1F5TA 1U2WA 2K7LA 4KA4A 4LLLA 3GXOA 4QLCU 3HIFA 5FD5A 2QQAA 4YFXF 2FBHA 2NNYA 3P7NA 1HKTA 3F8FA 1OMIA 3IRQA 5E8IA 2DO7A 1XDSA 3GFMA 3HOTA 1W5TA 3NQOA 3WTUC 1ONVA 1BI3A 1BI0A 4MQVA 3ZP5A 4BH9A 3WGGA 4KMFA 2IT0A 1I5ZA 4Q47A 1W7PA 1ZRFA 5FFZA 2GZWA 2CQKA 2M87A 3FMRA 4BYYA 3HYIA 4YG2F 2QWWA 4L0YB 4ZZDA 2XAGA 1UFMA 3PQKA 3VB2A 1O3SA 2Y75A 4RB1A 4L5IA 4WXCA 3J81Z 4G6QA 1GVJA 1IN6A 2W57A 2A6HF 5K5OA 3MQ0A 5HVQC 1G3WA 3NRVA 4HDUA 1KU9A 4HLYA 5D4RA 5LBQA 1ZGAA 4UXNA 5BOXA 2YU3A 3VODA 3WTZA 1TBXA 3HUGA 1IZ1A 2IA1A 1MJBA 1WWXA 3MEXA 3ABUA 3RKWA 4R8HA 3FXUA 2LDUA 1ZLJA 4LGWA 4GXOA 2P5VA 4JBAA 1WSUA 5IT9K 2XKOA 1T38A 3R0AA 4Y15A 1G3TA 4E70A 1GXPA 2CW0F 5L3EA 4OIRF 3COAC 3HSFA 1T2KA 2LKPA 1IXSB 3JSPA 5HDKA 3HRMA 2DI3A 2JPBA 2ZXJA 1FNNA 5JR3A 3I59A 4EGZA 2HDCA 3F8MA 1TQIA 4KICA 5L3CA 1T0FA 3C3WA 3L2CA 3KLNA 4RB2C 1MZBA 1QZZA 2F5FA 1FYLA 5DCMA 1LEAA 2D1HA 5DD8A 2FF4A 5BMZA 4KFCA 3GW2A 3MCZA 1TNTA 2L4AA 2CSOA 5LRRA 1IAWA 5DD4A 5HS8A 3ZMUA 1XGMA 3BPXA 2RV8A 2QUFA 1U3EM 2FU4A 3I0TA 2FRHA 1ZLKA 2ZBKA 1J0RA 2HKXA 2CFXA 3HTSB 3BJAA 2V1DA 3F6OA 2JPCA 3T8RA 2CYYA 4M9ZA 1U78A 3CJNA 5JFRA 4K2EA 2Z9OA 1ZYRF 2FE3A 2PMHA 2O0YA 5EEHA 2WWYA 2IP2A 4MTDA 2Y48A 3GZ5A 3R4KA 1KU3A 2F5EA 4XSZF 5A2QZ 4RAZA 1K78A 4ZYHA 2EK5A 4CHUA 2XAJA 4AIHA 4BAYA 3V7CA 3EYYA 4ZZLA 3FMQA 4UHTA 3WTXC 2L01A 1O3RA 1QGPA 2H27A 3LA3A 1B4AA 4KIBA 2QM3A 2NS0A 2KIUA 1HXDA
chains in the Genus database with same CATH superfamily
5ICFA 3L2WA 2VPLA 2DODA 2ZXHA 3DXJF 2COMA 2HKOA 3ABKH 5BNGA 3E5UA 1I1GA 2XHKA 5LLQA 2TRTA 2NYXA 4PGHA 5FLXZ 2VE8A 1MNDA 2RREA 2Q2EA 3BTCA 3T5XA 2NVUB 3QPLA 2PMUA 2X0LA 1E17A 2DJNA 2QVOA 3K70D 2H6BA 3KEQA 3I4NJ 3KP4A 2STTA 4L0ZB 2KT0A 2DXIA 1FTZA 3H9GA 2X6YA 2W85A 2JSPA 3CESA 3QWLA 4HF0A 4PGGA 2JRTA 4A3MJ 1FSEA 3BPVA 4I01A 3P9KA 5FGMA 1ZR2A 1N75A 3MAJA 3WTWC 2ESHA 3SHFA 1CF7B 3OIPA 2E7WA 1D5VA 1JKPC 1YS6A 2BY2A 2QBYA 4QPQA 3D5RC 3L2VA 4D7MA 3GTLJ 1HDDC 2IRFG 2W24A 4L18B 1WHUA 4E7ZA 3LWFA 4G6TB 2JVGA 3MKZA 3JRIA 4HQEA 1HSTA 3M8JA 5E1ZB 4GO1A 1K6OA 2ZXIA 5ERIA 1OCOH 1BI1A 2M7BA 2H8WA 3DPTA 4PZJA 4F52A 5L3FA 4EM1A 5J47A 1J2XA 3J80K 2A69F 2RNJA 3SEZA 3SDBA 4II2A 1FIAA 3FISA 2E7XA 4AVPA 1R49A 5GTHC 2HYJA 2F4MB 2V1NA 1J5YA 3HOUJ 1R5HA 4B43A 2OC6A 1S8NA 3PO3J 5K7ZA 2Z1DA 2OTJI 3F23A 3BCAA 1RC9A 1BL0A 2DA3A 1Y0NA 4I7HA 2HOAA 4KUMA 4B09A 3UKGA 2DQLA 2XRLA 3LSHA 2ELHA 3B73A 3I54A 1G59A 3TGNA 3W2AA 2VODA 4XBFA 2KLOA 1XC5A 3G1LA 2RN7A 2B9SA 4BNCA 1OCTC 2R93J 3HSEA 2FBKA 3AG2H 3H1CA 2OD5A 3BTJA 4LITA 4A3LJ 3T1BA 2CO5A 3FHNA 4XL9A 2I8DA 4BHBA 3J81K 1VQOI 4CDGA 4DQ2A 2GLOA 5GPAA 5BPIA 3BG7A 3JAMZ 4OOIA 3CJQB 4IRHA 1SD7A 1M1EB 3CLOA 1IV8A 5FKKA 1LQ1A 1TQMA 2ECCA 2R5YA 2DW4A 1XMAA 2VBWA 2ME0A 1TNSA 2N8GA 5CLSA 3BJ6A 3BQZA 1TLHB 1WQ2A 5KHDA 3C2BA 4V19K 3MFKA 1MDMB 4XN3A 3WTSC 4R1HA 2PEXA 4ENMA 2CV2A 3Q3SA 2MG4A 2EB7A 5H20A 4J01A 4ZTFA 3OS0A 2F2EA 4F92B 2R7OA 4ZYEA 3LMMA 1WKMA 3R6SA 2HTJA 4KN7X 4BQOA 3RCOA 1IJWC 2NNNA 2VI6A 4BBRJ 3F8BA 2ACJA 3WHCA 4NC8A 2YPRA 3TO7A 2EV6A 1BJZA 1O7LA 2Y30A 3I5UA 3KYLA 4ANJA 4F91B 3FXRA 2QA4I 3H0GJ 1JT0A 2G7HA 3OYLA 5CVVA 2VBZA 3SZTA 5B1BH 3HPHA 3VSLA 3DPLC 4O6JA 1CGPA 4EV0A 3E5XA 1UCRA 5K1YA 3MMYB 4ENNA 2ZCWA 2OZUA 2VONA 1BW5A 2DFEA 3H9JA 5JVTA 2IGKA 5IT9Z 2PJRB 1HC8A 2OCCH 2PMZN 3A0HC 2RGVA 5HLGA 1TWGJ 1MSEC 4U0WA 5BQTA 3KX2A 3Q0VA 1SEUA 3I53A 3ASNH 3RPQA 3ABTA 2F4OB 3FM3A 3K4LA 4PJJA 3KP2A 1ZRDA 5E20A 3K4JA 1BIAA 3ZMZA 3Q0UA 4RDUA 1BR1A 4ON0A 4A12A 2QQ9A 3F8NA 1Y8QB 3CJRB 4JX4A 4OIQF 3GFIA 1RIOH 4W97A 1PP8F 2X85A 2RKHA 4XORA 2LOOA 1S29A 2E2IJ 2Y0SA 1ZR4A 2KMUA 1ZAOA 3UR3C 2M45A 4F93B 1IO2A 1LVKA 2ZO4A 4A0ZA 2CQ7A 1QO0D 2Q8KA 2R0QC 1ZG5A 5F6FA 5J3LA 1PUFA 5ILUA 4FCYA 3OYIA 1X1CA 5GAHJ 3DKWA 1BC7C 4LG0B 3E6BA 1MBKA 3QODA 1MMSA 2K86A 1PDNC 3AL0B 2XASA 3DLAA 3BG9A 1XSDA 3V8LA 2X6WA 2X1CA 5E1WA 3SJMA 3RZDJ 4A2UA 1PJRA 5E1XA 3E0JB 3A02A 3S3MA 3ULQB 1X1DA 3CDIA 1KYWA 1H9GA 5GP9A 1NG6A 2BW3A 5HS9A 3GF2A 2Z3YA 3L00A 1LKXA 5FB2A 2HFHA 4B44A 4PDKA 1T08B 3GX4X 4CYDA 1TWFJ 2Q2EB 1FPQA 3K2ZA 2YX7A 1HCRA 1MD0A 2IA2A 1FLIA 3E6MA 3G1MA 3CMMA 3U9GA 1ZKGA 5FD6A 2Y2ZA 2WV1A 4HA8A 1P4AA 2V9PA 5HS7A 4FX0A 3G71I 2KP6A 4RBOA 3BG3A 4A0XA 4CXFA 1FSHA 1RETA 1B1BA 3RTRA 3C2GA 1HW1A 1B72A 2WV0A 1JE8A 1CF7A 1WJ5A 3CCYA 3E5QA 2BXZA 3WGHA 2A6TA 2VL8A 4BACA 1OYWA 2UXNA 2XGDA 3UNGC 1L3LA 5D5XB 1PVEA 3OYHA 3BY6A 4GRIA 3I64A 3LSIA 3JTGA 3VEPA 3D1NI 2X4HA 3PSIA 2KJBA 1LEBA 4HAMA 3CP8A 3F9KA 3J7YJ 1DPUA 1U5TB 4XKCA 3EETA 5CQGA 4MTEA 1HA8A 3NAUA 4NHJA 1YW7A 2PLYA 3TDZC 5HODA 1XGSA 1FC3A 2DYRH 5D4SA 1XTAA 1H89C 2ZJQF 4BDZA 3JSOA 3BLYA 2LR8A 3BR0A 3E97A 1ETOA 1L0OC 2H09A 5EZGA 3RDIA 1D0ZA 3CC7I 2DMUA 3QOPA 2QLZA 3AFHA 1S7EA 2ZJRF 4D7NA 2HXIA 2P5LC 2OPTA 3ZMSA 3F22A 4I02A 1IRXA 5M3MJ 4JOMA 2F5VA 3TQNA 5JHUA 2Y31A 3K4MA 3CDLA 4RM3A 3GVAA 2VLAA 3KETA 1G3YA 2VQHA 1F1ZA 2W00A 3FIWA 3KCCA 3LAJA 1RUOA 3C1DA 2O61A 1AKHB 2NAZA 5CQEA 1MGTA 1R4MB 1D0XA 4G7HF 2P6TA 3HL2A 5F04A 1R1VA 3QP5A 4YIRX 1KU2A 5D8KB 2E71A 5B1AH 5IOZA 1AHDP 1IUFA 4ESFA 3ZPLA 3QRFF 1U5TC 1H9TA 1MW7A 2L5QA 1OCZH 2X1DA 2XIGA 1S6LA 2DPUA 1YS7A 3GFJA 5C4JJ 2GOMA 4XKBA 1VQNI 2V6EA 1EF4A 4HLXA 1X2MA 3ZQLA 3PFYA 1K78B 1MJAA 2KQRA 4BGDA 4IOAF 1LDJA 1A35A 4HF2A 1WH5A 4WF2A 4DW6A 1W0UA 4A5NA 1R22A 1ENHA 1V55H 3RQ4A 2WADA 1JUPA 5KCMA 3FWEA 3RKYA 2XRNA 4IVNA 1MBFA 4YIFA 3A1YA 3BZCA 3IC7A 3W2WA 4BKXA 3WU1B 4IZZA 1ZREA 2O8XA 2Y69H 3CCVI 3LSTA 3KP7A 2R5ZB 3HSRA 2JA6J 4UVCA 2EA4A 2FBIA 3FXJA 3BR1A 3OMYA 4CGZA 4RLFA 2ID3A 5M5XJ 2XVCA 2LRDA 4M6YA 3RKXA 5DEQA 2BHYA 2K9LA 4AYBA 2E1NA 2IJLA 2VUMJ 5E17F 3S2HJ 1UMQA 2RDPA 3OYCA 1XS9A 4OAYA 2IEKA 4A0YA 1AKHA 2W84A 2DBBA 5E3OA 3HOSA 3W6VA 2M34A 4UUSA 1XMKA 2RAEA 5FKNA 2DK5A 1IRFA 2VT2A 2ELJA 3CCSI 2EFPA 1RESA 1JI8A 3S15J 2WA0A 1V54H 3HC7A 3BP8A 4BE2A 1QZEA 1FYMA 1XSXA 2CFOA 4X0GA 2DA6A 2F5DA 4ZDLA 5DTDA 1HQCA 1IW7F 2DOEA 2LVSA 4M3FA 1ZN2A 4W1UA 1KQ8A 3HGGA 3KE2A 2NVQJ 3RIRA 4CH7A 2EIKH 3JRFA 2ZSIB 3GLLA 5IYDJ 3HKZN 1UB9A 1OCPA 3PNTA 4RAYA 4IHTA 3H3ZA 3N97A 5EEAA 2EH3A 5TGTA 5ILVA 5D5UB 1MBJA 3L9FA 2BW3B 4IOCF 3RYPA 1R36A 2CGPA 4XKVA 1A31A 2WAEA 3OIQA 3PM1A 3DLLF 1LNWA 4FQGA 4J00A 2P0WA 1PUFB 4XRSA 4L9VA 1D0YA 3K4CA 1AA7A 3Q9VA 3ZOBA 4G9YA 3BQYA 4IHYA 1TP4A 2MGQA 4I6ZA 5E3NA 4JP0A 4MQ9F 2HZTA 2FNPA 2LYCA 4M6XA 1W1WE 2IVMA 1WPKA 1RNLA 1JT6A 4ZH4F 1OISA 4CICA 2L54A 2PQ8A 3MZ8A 3SYTA 1WVRA 3CCRI 3BOQA 1FWZA 3QP6A 3PO2J 2MLGA 2Y9YA 3FKIJ 1APLC 1MH3A 4HV5A 5L3BA 1W5SA 4XICA 1YW8A 1A6IA 1V5GA 3DU6A 3BWGA 3WTTC 1BI2A 2XF5A 3KP3A 5LD2C 4KYWA 4RMNA 2CJJA 4BQAA 5CVIA 2EPFA 3CCQI 2VJIA 1TWHJ 4CZZA 4HDVA 4HQMA 3TBIA 4D5CA 4QSHA 3C7JA 1EH6A 1D1BA 5J6XA 3AKZA 3KP5A 1VNDA 1TT5B 2IGMA 2H94A 3HUGB 3LSMA 2Y0SN 4NB5A 4P55A 2XAHA 2AQFA 5K5QA 1I6XA 2F5CA 1LVAA 2KJCA 3AL0C 4ESBA 4M71A 2LP0A 5HLIA 3F3XA 5ILSA 3VYUB 2FEZA 4JK1X 4BL0B 4GGGA 1P92A 1JHFA 2MH9A 4ZTJA 2I10A 4HF1A 5LEKA 1ZG1A 3M3YJ 3GWZA 4O5VA 2W7NA 1TWAJ 1TQPA 4I09A 1VF9A 4KMUX 1LJ9A 1MBEA 2A5WA 4DZJA 4AIKA 1VFCA 4MIMA 5D5VB 4BEHB 1ZGWA 2XSDC 4U7DA 4FE7A 4BQNA 2HQ5A 2OTLI 2GIVA 3K6GA 2ID6A 2VXDA 5FLMJ 3Q9SA 2DQRA 2G7UA 4S05A 5KVRA 1Z3XA 3H3VK 4A3CJ 1OYIA 2JUGA 2B63J 1AU7A 2PJRA 3Q0WA 2VT3A 2RC4A 3WG9A 3KP6A 2ELKA 2FQ3A 2E1CA 2UXXA 2O5RA 3OYMA 1F36A 3CMAI 1ULYA 4LB5A 2WTEA 1IRZA 2ZMEC 2Q0OA 3BZ6A 2R4GA 4FETA 1S7OA 2WY8Q 1R6RA 1JTYA 3ISPA 3J7AY 1XCBA 4HG2A 1T95A 9ANTA 3E6CC 3OSGA 2QKLB 1C0WA 4KNYA 4HNUA 3FF5A 5E18F 1GXQA 1WZ2A 5TISC 4ZC3A 3FHZA 5DDGA 4CCLA 4RS8A 4FISA 4RA2A 4FHTA 1KQ0A 5GAEJ 2IAIA 2BBYA 2DMQA 4S04A 4HRIA 2BOLA 2IS2A 2CH0A 2Y0MA 3ZMTA 2FMLA 3IH3A 3BTLA 5CPRB 2VN2A 3SZPA 3CF5F 5C3EJ 5DM7F 2OV7A 4H4KC 2YUSA 1UG2A 4EM0B 3BG5A 3ZR8X 3IKTA 3QPTA 4EMSA 4Y3OA 4LB6B 3O8HA 5FFXA 1IRGA 1QPMA 4ETSA 2VKEA 5DUKA 4RM2A 3CMYA 1WJAA 1IC8A 1TW2A 2GA1A 1R23A 3IAS2 2EZHA 3QAHA 4RB3C 1MIJA 2UV1A 1U0JA 4EM2A 4Q5SF 4EJTA 2M0MA 3HZJA 2KIQA 2PX9A 4HZFA 4WXDA 3RI4A 1XD7A 3DV8A 4U0YA 2DA4A 3HHGA 3ERMA 4AM3A 3K1NA 4CA0A 3WTYC 2YX4A 2MABA 3C18A 3LSGA 1I27A 1KYZA 2XROA 1JGSA 4AIJA 2MD0A 4Y13A 2GA2A 1P4WA 4M6VA 2PJPA 3GTGJ 3MZHA 1KU7A 5ICEA 1SVMA 1ON1A 3P5JA 3QU6A 1AOYA 3F8CA 3LA2A 2LF8A 3DTEA 4D5FA 2JQ7A 3M7GA 4PJNA 1I6HJ 5B5EC 3LSPA 3ELKA 2DLLA 2HEOA 1YOVB 2DFHA 3S3OA 1YIOA 2DA1A 4ZDPA 3CUQB 5E79C 5J1UA 1Y6IA 2EA2A 1K79A 1FJLA 3B02A 5F64A 3S1QJ 1FP1D 4D0PA 1P9QC 1VQ7I 1RZ4A 3DKYA 2YU9J 5AIQA 4HYEA 4XIDA 1JTXA 3DF8A 3LSJA 2XF6A 3V7SA 4DBQA 4AD9A 3GZNB 4BUPA 3B6CA 1XGOA 2DN0A 4KIFA 1UHWA 3IRRA 4IRGA 1JUSA 1Z05A 2V79A 3KFWX 2R7RA 1IV6A 4A3BJ 2L02A 3JW4A 1WI9A 3JRBA 1A36A 3EDPA 2HVQA 5D6FA 4HOBA 2DAOA 3IV5A 3OIOA 2BY0A 2FXAA 2O6GE 2QGUA 4PK4A 1DDNA 1MKMA 2EWNA 1LFUP 4F55A 2HTSA 1FIPA 1YHQI 1YE9A 1MMAA 3JR9A 2OAZA 1WFXA 1WJEA 2EQRA 2TDXA 2LREA 2YR2A 2XAQA 3H0DA 3A01A 3R0JA 1N77A 3KLOA 3MWMA 1D8JA 2E19A 3BTIA 4O3MA 2ZFUA 1TW3A 4UY8I 1QA6A 5CVUA 2KZVA 4GYIA 1O4XA 2HQAA 1TZLA 2L9SA 4A93J 2KRCA 1R9TJ 3CUQA 1FTTA 3IH4A 2L4MA 2DTZA 1UAAA 2HOEA 1HKSA 2LMDA 1W0TA 4CCJA 2ZXWH 5EJCA 3P9IA 2CUEA 4XNFA 2H1KA 2ETHA 3H5AA 2BE5F 3QYBA 1Z6TA 4L9TA 2Z33A 1D3YA 2EFWA 2GAUA 5KK1A 2EFQA 3TDUC 2RQPA 3SQNA 1A5JA 2FMYA 1HOMA 3SFZA 1YTYA 4P9FA 1VQKI 1RKWA 1FZPB 1B9NA 2J5PA 5JHFA 2NOGA 3FMSA 1IDYA 1RPWA 3FZVA 1H8AC 3CDHA 2OBPA 4E7HA 1KZHA 4B8XA 3QPHA 1GVDA 3HKZA 4ZYAA 1FX7A 5EG0A 3G6EI 3FK7A 4BXUA 4F3QA 1FP2A 4A6DA 2XKPA 1YG2A 1X58A 2GOXB 3QYFA 3QPSA 2R5ZA 3LAPA 2R7XA 4NC6A 1XSVA 1Z77A 4RAGA 1LB2A 1YX3A 3I9V2 3EQLF 2UUZA 1U9NA 4MEYF 3BC8A 4EGYA 2FX0A 5M5WJ 2CQNA 2X6XA 5KAFC 2QSFX 3DFGA 3ABLH 1R5GA 3OYGA 4U87A 3FXOA 3R61A 3AAFA 4PSXA 2OU2A 2G9WA 4A3FJ 5DUIA 1K61A 1B72B 4U7BA 4AVZA 2CRGA 2PMZA 2QF7A 2IGOA 5F27A 3DTIA 2G0EA 3OWTA 2HS5A 2A5YB 3HGYA 5E8GA 1S72I 2DFIA 5LHIA 3WTVC 1QVUA 2ZC2A 3G73A 3DWLE 3PNVA 2XDVA 1DU6A 1MBGA 2F6CA 1D8KA 1WGXA 1HW2A 3ECOA 4HV6A 3K10A 2HPMA 4WXHA 1QU3A 2EINH 1B9MA 1Q1VA 3ERED 2XSJC 5LHGA 4EJVA 3KZIC 1DPRA 3DBRB 1QNTA 2V6CA 3L1PA 1F9NA 5IP9J 2M9HA 2D45A 4MFDA 3U1DA 2FNAA 2XGXA 3E1SA 3DU5A 2PI0A 4DZPA 3RKQA 1KONA 2HQNA 4U0VA 1WJFA 2DOAA 3NWSA 2EZLA 4Y7NJ 1UHSA 2ZSHB 4V2FA 3D5LA 2V9VA 2W4SA 4GDFA 5LRSA 2H1LA 1IGNA 1TWCJ 2M7AA 5IP6A 2KPMA 3VOEA 4UVAA 1EA3A 5F1JA 5D8LB 3V7RA 2RVCA 5DM6F 4YFNF 2NRAC 4XOPA 2BY1A 4MHGA 2C6YA 1V4RA 1EH7A 3H35A 2HYFA 3PUBA 1FEXA 3TEDA 3ZXSA 1S9HA 3A2KA 3HOYJ 1STZA 4HW0A 4IJAA 4IXAA 1W7PB 2GWRA 2K9MA 1FYKA 4D1QA 2DCEA 2B0LA 2VB6A 4OIPF 2VOOA 2VKDA 4BHPA 2VQGA 4XR6A 3RPUA 1Z21A 1ZHFA 1G8XA 2DA7A 4N4OB 4XQFA 3TOBA 1FOYA 3LNQA 3GYHX 1T39A 2VE9A 2ZNZA 2BVMA 2WY7Q 1MMNA 1E3OC 4E4HA 2DTRA 3HRSA 2JVHA 5FO5A 5J8FA 3LA7A 1X3UA 3JAMK 3PL8A 5A2QK 5C44J 2K40A 1FT9A 3AG1H 1UZCA 4LMYA 2OQGA 3WE2A 3D0SA 1JGGA 4LLNA 2L2OA 3G1OA 5FKOA 3V8KA 1E2XA 3S2WA 3J80Z 3GTQJ 2R92J 3DP7A 4M74A 2WB1A 4G94A 1X1PA 1G4DA 2P7CB 1BIBA 2XPWA 1ETWA 2O03A 4LD5A 1SFUA 2P4WA 4AC0A 2HZDA 1OCRH 3FBNB 5H6QA 3I71A 2GQQA 3RQIA 1ZG3A 4E6KG 1Y39A 1RI7A 3PQJA 1QPIA 2LY1A 1JXSA 3M07A 4M3DA 4BY7J 2K4JA 3NARA 1YRNA 1R1UA 1E3PA 1O7FA 1R1TA 2K85A 1ZGJA 4HSRA 4AWXB 3R60A 3L09A 1K7AA 3IWZA 3DBHB 2D2WA 3HB9A 2MH2A 3S93A 1IN8A 3OS1A 2M5WA 1VQ8I 2OJED 4EVIA 3HDDA 4XLPF 2Z5UA 1MBHA 1QVTA 4ZYDA 1WCMJ 2V4JC 2X1EA 3ZMVA 5LGNA 2JA2A 4BY1J 2F4IA 2CS3A 4DYQA 3HM5A 3I4PA 3GEZA 2HGCA 1H88C 3U1KA 5CJ9A 4D9JA 1AWCA 3OSFA 1EV7A 3K70C 2XF7A 4II3A 4YIIA 1SFXA 2D1VA 4ZJZA 1B8IB 2JA8J 5LFAA 1KQ9A 4PCQA 4CCKA 2WC2A 2FUG2 4EQQA 1W36C 5D5WB 4G7OF 2R3SA 3CMEI 3V42A 2DPDA 5FJ8J 1LPQA 4CZCA 2P5KA 5EGOB 2HQRA 3MVPA 3TOAA 1FBSA 1IF1A 4Y52J 5K5RA 1GLNA 1X4OA 4JQFA 1IDZA 1YITI 1O3QA 1XDUA 3DEEA 1HF0A 3PIPF 3DQVC 3OV8A 1F4KA 2MFZA 1Z1DA 3BROA 4J19A 3OYKA 1Y1VJ 2L7MP 3S1MJ 4GCVA 2KZGA 4JX5A 4MNUA 5LEJA 4OAZA 1U6GA 3VSKA 3WGIA 1ODDA 1LDDA 1NK2P 1OYYA 4M72A 1OR7A 2VQLA 1ETYA 4HEA2 1SFEA 2BGCA 5IY5H 2R7DA 1O57A 3T8TA 3S32A 2STWA 1V5EA 2CU7A 3GTMJ 4OMZA 1UJ8A 2UZKA 2ZJPF 4ESJA 1LFBA 1BR2A 1LDKB 1FOKA 2M8GX 2LKSA 1HDPA 2MW8A 2LSOA 2OQRA 3RJPA 5JLXA 1TT0A 4U88A 4XLHA 5JVGF 1QHGA 2VBYA 5HNFA 4UUVA 1WJBA 3KYCB 1FOWA 2V7FA 2V1XA 2LBFB 3OY9A 1SMYF 3HOWJ 3I59B 5HLHA 2DMTA 2E1MB 4PJMA 5HOOA 3CCMI 1HKQA 2ME6A 2J5OA 3ZQ7A 4PUSA 5HDGA 4XN0A 4UB6C 3F0CA 4PJLA 2VJ5A 4BXXJ 4ASNA 2IA0A 1BR4A 1Q1HA 3IHUA 5L3DA 4RB0A 4UV9A 4KISA 4YEJA 2L3DA 2ICWG 1MNEA 2M8EA 4MEXF 1S3JA 4KITB 3L7WA 3M8EA 3K4KA 1VQ9I 2MC3A 4AUXA 3D5SC 5C4XJ 3IUOA 4UV8A 3GTOJ 3BT9A 5IT3A 2X6OA 2EFOA 1VQ4I 2ISZA 3ML6A 3QQAA 2NS7A 1P7IA 2PG4A 3MZYA 4Z2YA 4NQWA 4A5MA 3H9QA 2K4BA 3OYDA 1P2FA 3O3KA 2FA5A 4M9SA 5HDNA 4LLGF 1DGWY 5LHHA 3DBLB 4XLNF 2R7WA 3NEUA 2E36A 2AHQA 4N4NB 1I39A 2EZKA 2LK2A 1WJCA 3ZN0A 3FM5A 2A61A 2FQ4A 3QYEA 5DV5A 4BHCA 4XMYA 4G12A 3FK6A 5TRDA 5BPDA 5BS6A 4Q4ZF 5EZHA 4WWCA 1ZARA 2ZNYA 2P8TA 3DCFA 2LY2A 4Y17A 1H0MA 1JJ6C 3HHHA 1BA5A 4UUSB 1R00A 3BG6A 4XRFA 3M1EA 2MC4A 2YSRA 3H3UA 4YRVA 3V8JA 1SD6A 1XG1A 1BOAA 2NVXJ 5J1RA 2KIFA 3CCLI 4DYRA 4HBLA 2QYOA 3JRDA 2CWEA 2KIMA 5TJJA 2W1OA 5F08A 5IOYA 1YYVA 1NH3A 1BOBA 5CVJA 2VQCA 4A3EJ 3KPHA 1X1AA 3EUAA 4FT8A 1ZTRA 4C2TA 3E6DA 1XGNA 3CTAA 4GYGA 1YW9A 4X1EA 1K6YA 4YELA 2CG4A 3TW7A 3TKYA 3H92A 2BY3A 1J75A 3JRHA 1X3WB 1Z7UA 1IXCA 1BJAA 1I3AA 2EJRA 3CF2A 1MDMA 1GHCA 1T98A 2K27A 1UHMA 1ZELA 2DK8A 4CCMA 1LE8A 4OWRB 4Y33A 3PIOF 5FLVA 2E34A 2IPQX 5IPAA 4XLCA 4B1RA 4JYKA 4A3JJ 2BZTA 1J9IA 2R7FA 4P9UA 2VC1A 1BN5A 4QPOA 3A03A 1FY7A 4HX4A 4BBSJ 5GPCA 3OYNA 3HTUA 3FX3A 4QIWN 4IHWA 2LNBA 4P1WA 4NNJA 5ICCA 2HI3A 2LFBA 2XAFA 4BE0A 3VYSB 1U8BA 4EJOA 1W4MA 1PYVA 3LQQA 1XCVA 3J7AO 4IF4A 4TV7A 1KA8A 1KGSA 1RUNA 3EYIA 2ZB9A 3BR3A 2JK3A 4HX7A 4XM3A 1XB4A 4C9YA 2QQBA 1SVOA 3LL7A 3GLXA 4HSTA 3WE3A 3JREA 1T0FC 1SFOJ 4G8XA 4RLQA 3GFLA 2K9NA 1OJLA 2ISYA 4B4CA 4EJUA 3E7LA 3S17J 3OYBA 3BR2A 3CUOA 3VWBA 1R7JA 4X6AJ 4IL6C 3IWFA 2ESNA 1WJDA 4H0EA 1T6SA 4EJWA 2EZIA 5FROA 4L9JA 4YFKF 1B8IA 3HOVJ 4UVBA 2JA7J 1V3FA 3O6BB 3IL2A 3ZQIA 1GDTA 2FOWA 3AG3H 4LFUA 3H36A 1W7PD 1DP7P 2XUBA 4LOCA 1XN7A 2EIJH 2CUJA 2VBXA 5H6RA 3CC2I 2KFDA 3RPUD 4ZYGA 2ZFWA 1YO5C 4DIQA 2H8RA 1USSA 1K4SA 1MMDA 1EH8A 1Z91A 2WAQN 2EBIA 3BDDA 4LG0A 2KL4A 3WU0A 4FTHA 1J09A 1TC3C 5K7HA 2GXBA 4B47A 2O7OA 5B3SH 1SD4A 4Y4RA 1DGRM 3LFKA 1D1AA 1RKTA 3KEOA 3S2DJ 3REOA 2OCEA 2FD5A 3HG9A 3BJOA 2M2EA 4NUBA 2GBYA 3Q5FA 4C30A 4L5JA 3JTHA 4L9NA 1JHHA 2L9NA 5L3GA 1O3TA 3K1MA 2P7VB 2W25A 3BR5A 3I56I 2PBIA 4DNCA 4XSXF 3EUHA 3GCMA 3MKYB 2XC7A 2HDDA 2NXNB 5DYMA 4UUTA 3ZN1A 2B7EA 2ZMEB 3RYRA 2DT6A 1ETXA 2VJ4A 3WHBA 4Q48A 3W2VA 4IHSA 1R5ID 1IN7A 2PFBA 1TL8A 4ZDOA 1BC8C 3IH2A 2AS5F 3K4BA 3T0YA 3OOPA 2K02A 5FKMA 1YX5A 3CO7C 5J4VA 5EEGA 4BU2A 2VPRA 4E7KA 3P9CA 2CW7A 2MD5A 3BCBA 1SD5A 5F0HA 3KZZA 2TCTA 5LGUA 4ENJA 2EV0A 3CC4I 3PJRA 3EPZA 2JTVA 3ZQCA 3SDGA 4LK0F 4QWQA 5LGTA 3M8FA 1OPCA 1GV5A 2PN6A 4N9IA 3ZMDA 1CQTA 3TP3A 1QBJA 2Z2SB 3L2QA 3ROUA 1SANA 2AO9A 3F21A 3GZ6A 5FRNA 4G7ZF 2WBMA 3S14J 1MH4A 4UB8C 3CO6C 1FOXA 1JKRC 2EV5A 1EJ9A 4NQWB 4CO8A 2JUCA 4M73A 5GTIC 2F48A 5KNLA 2AXLA 1W36D 3H5RA 4OIOF 3OR2C 4BE1A 2DMNA 4I0AA 2VOPA 2K9SA 3PFIA 1HW5A 2DT5A 1R58A 3CQZJ 1USTA 1J59A 5HLTA 3SFIA 4HX8A 3ONQA 1SVLA 3JCUC 3TO9A 3IKVA 1VQMI 1T8IA 4I98B 1SAXA 3W3CA 3K69A 2P81A 4XLAA 2P6SA 1HSJA 2L9VA 1B6AA 2XPUA 4E7SA 4PSWA 4IHVA 2EILH 4L5EA 2JWTA 1T56A 1E0EA 1MJ9A 3BR6A 3TO6A 3G3ZA 2DDAA 3M9AA 1UG0A 4GFBA 1K83J 2JT1A 1WRJA 4RGUA 3TW6A 2KISA 2A68F 5CKTA 2MYSA 1RR7A 1G3SA 3B6AA 3SXYA 1JKQC 1VQ5I 3QU3A 3HRTA 1A04A 2JSCA 2WB1N 4CCNA 2L9RA 2A3SA 1BM9A 2GXGA 2XGCA 4P5OA 1J7KA 3F72A 4XOTA 2XGEA 3FBIB 1PUEE 2IBDA 1ZH5A 3PNYA 5DCMB 3FXLA 1S7AA 1QZYA 1I50J 1Z6RA 5EDNA 5D6EA 4RGRA 4WX9A 4CYCA 4BQQA 2VKHA 3I3LA 3LFUA 4IQJA 5JLWA 5CYVA 2H6CA 3HEFA 3F6VA 2XV4S 4OINF 4B3XA 3N4MA 2HYGD 4C2MJ 1NK3P 4IPAA 2HU9A 1Z0XA 4N9HA 4DGWB 4P96A 3KZYA 3LQRA 1E3HA 4WCGA 1REPC 4ENKA 1WI3A 1FMWA 2AQEA 1Z3YA 3JRGA 1OLTA 2KRFA 1V5FA 2QZ8A 3FXQA 4KT5C 3C2HA 1DUXC 1Z7LA 5EGOA 3A0BC 4F7ZA 2JJ7A 1LE8B 4MGRA 4M3GA 3K7AJ 2IGNA 4I99C 4M9XA 5M3FJ 3FXMA 2MBFA 3K9TA 2MLKA 1B59A 4NBQA 3A01B 1X2NA 5F1RA 1PP7U 2UWMA 1ERDA 4IX7A 2L7ZA 1BBYA 1ITYA 3V4GA 3HJEA 2QCOA 3HRUA 2KKOA 4HPQA 3U2RA 1HBXG 4WK8F 2COBA 2K3FA 2VC0A 3U21A 1Z9CA 1JKOC 4BXFA 4N0BA 1U8RA 1YJWI 2HOTA 5ICGA 4LJZF 5ED4A 4I2OA 1IXRC 2HR3A 1G6NA 2DU9A 2E35A 4BS9A 1D5YA 3GBGA 4KIGA 1MNMC 1SAUA 1YLFA 3S1NJ 1Y1WJ 1ORKA 2HWVA 4KN4X 2LD5A 1W5CC 1I3QJ 2R7QA 2IXSA 2L0KA 1ON2A 1P6RA 3O2PE 4IKFA 1POGA 2BEOA 2LF7A 2A05A 1VTNC 5H2FC 2HVSA 1Y0UA 3MKLA 4UNOA 1ETVA 1IG7A 4IRIA 1Z67A 2HNHA 4A6EA 2ADUA 2JZYA 3CUQC 2ZKZA 2K9QA 4B48A 4Z6YA 1TTYA 2VJJA 2EFNA 4AU7A 1QHHD 3GUDA 4LK1F 2DJIA 6PAXA 4OU0A 1OKRA 3DKXA 4A3DJ 1FBUA 1IUYA 2VXZA 1X19A 2DA2A 2M3AA 2W48A 1IN4A 2O3FA 3S8PA 4KJZA 4XONA 1QQIA 3K0LA 1SFKA 1D1CA 3ZRGA 2DDBA 2E2JJ 1ETQA 2V1UA 5JI6A 1MMGA 1WH7A 2BYVE 3K1PA 2A07F 2Z99A 3LSRA 2O9LA 5AONA 1U5TA 5M5YJ 5EYRA 5J40A 3TMOA 5DS9A 2E2HJ 3VFZA 1P4XA 2EIMH 3LSKA 4CCOA 3H5NA 4C2UA 4A69C 2FSWA 3WODF 1YFHA 5EG0B 2M1BA 1ZQ3P 3OL3A 1MSFC 2R7UA 3MD2A 2W82A 2ZMEA 3I55I 2XB0X 3ESWB 3E3VA 2DYSH 1NHAA 3VYTB 1ZRCA 4M3BA 4KDPA 2FOKA 3GO5A 4E7JA 1X4PA 2MA3A 1YJ9I 5AIPA 3W6JB 2A6EF 1RR8C 2ZJ2A 2BV6A 5DCFA 4I0BA 4R79A 1BW6A 2V9KA 4G6DA 5CVRA 1SMTA 1GT0C 2OA4A 2LTPA 2KRHA 2IW5A 1YQAA 4OMYA 2OZ6A 1I1SA 4XLEA 2CMPA 2QSHX 2M30A 3I58A 2M4KA 3DEUA 4RGSA 4XRSG 2GIZA 4MLOA 2HVRA 2E5NA 3W6KB 2QENA 2QBYB 5J8CA 3ECHA 3FDYA 2L7KA 3CP2A 1Y56A 4I76A 1IN5A 4PFOA 2QSGX 4RGXA 4BJTA 4FX4A 1FBQA 1GUUA 2HOSA 1RRJA 5FLXK 1F5TA 1U2WA 4ABZA 3VDXA 4FASD 2K7LA 4EEFG 4KA4A 4C3JJ 2YS9A 4LLLA 3GXOA 4QLCU 4BEHA 2JN6A 3HIFA 5FD5A 4HNVA 5HNHA 2QQAA 4YFXF 2AXTC 2E1MC 3PUFA 2FBHA 3L2UA 2NNYA 2V26A 3P7NA 3G2BA 1HKTA 3F8FA 1HLVA 1OMIA 3IRQA 5E8IA 4HNTA 2DO7A 3OR1C 1N25A 3HOXJ 3QOEA 1DQUA 1XDSA 3GFMA 1OR7C 3HOTA 1W5TA 3NQOA 3WTUC 4A3KJ 1ONVA 1BI3A 4CYCB 1BI0A 1SC7A 3K4NA 1LUJB 3OL4A 4MQVA 3ZP5A 4BH9A 4BJ5C 3WGGA 2CQXA 2HPIA 4KMFA 1VZ0A 2DT7B 3ASOH 3HPGA 2IT0A 1I5ZA 3ZQGA 2RNGA 5EF6A 4Q47A 3IP4B 3FXKA 3RZOJ 1W7PA 1ZRFA 2LC2A 3VYRB 5FFZA 4LG3A 2GZWA 2CQKA 2KHMA 2M87A 3FMRA 4BYYA 3HYIA 3HXLA 5K7FA 2R7TA 4YG2F 4DYCA 3TL4X 2QWWA 2R7VA 4DJAA 4L0YB 2OF7A 4ZZDA 3CCJI 2XAGA 1UFMA 1Y8RB 4ITVA 3PQKA 3VB2A 5J1YA 1O3SA 2Y75A 4RB1A 4L5IA 3I4MJ 4WXCA 5F0FA 5F0CA 1YI2I 3J81Z 4G6QA 1GVJA 1IN6A 2W57A 5KAIC 2A6HF 3NWTA 3ABMH 5K5OA 3K2AA 2DOFA 3EUKL 3SZGA 4C3HJ 5GADJ 3KIOA 2MSYA 3DPUA 3G4SI 4MO7A 2BXYA 2JMWA 3MQ0A 1P7JA 5E3LA 5HVQC 5B66C 1GV2A 1G3WA 5IYBJ 3NRVA 4HDUA 1KU9A 3J7ZI 3CCUI 4HLYA 5D4RA 4NC7A 3O8GA 5LBQA 1JUMA 2K5CA 1ZGAA 4UXNA 3AG4H 2RQQA 1F43A 5BOXA 4XKWA 2YU3A 1U9OA 4XK4A 5IYCJ 3VODA 4S0HB 3WTZA 1K4TA 2BHZA 2K3PA 3CJTB 1TBXA 1YRNB 2X48A 3DTKA 1ETKA 3HUGA 4BDYA 2CUFA 3ZCOA 2NVYJ 4DBRA 3PSFA 1IZ1A 2IA1A 1MJBA 1WWXA 3MN2A 3MEXA 1NG7A 3ABUA 4A3IJ 3RKWA 1G2HA 2R7ZJ 2DMPA 1FMVA 2FJ1A 4KT6A 4R8HA 4IHXA 3RSNA 3FXUA 4A3GJ 3GTKJ 2CUZA 2LDUA 3GTPJ 3KYDB 1A6QA 1ZLJA 4GXOA 4LGWA 2P5VA 4JBAA 1WSUA 5IT9K 2XKOA 3WU2C 1T38A 3R0AA 4Y15A 2VIXA 1G3TA 4PFPA 3M4OJ 3HOZJ 3CLQA 4E70A 2JA5J 1GXPA 4DOZA 2CW0F 4V2GA 2JRMA 2E1OA 5L3EA 4OIRF 4BJ6C 2Q1ZB 4RAFA 3N05A 3COAC 3JRCA 2WAFA 3HSFA 4QTRA 2D5VA 3CCEI 1T2KA 1ZK8A 2LKPA 1OCCH 1IXSB 4CSWA 4M3EA 5E3MA 2LLKA 3JSPA 3M1CA 1VI0A 3ZQQA 4E7IA 3SEQA 5HDKA 1N78A 2XB5A 3HRMA 4JX6A 4CUGA 2DI3A 1X3ZB 3OS2A 3TP0A 1VQPI 2JPBA 2ZXJA 2LY9A 3BZKA 3EUHC 1R71A 1FNNA 2CV0A 5JR3A 3I59A 4EGZA 1VQLI 3F8MA 2HDCA 1TQIA 2HXOA 2I5UA 4KICA 5L3CA 1EKEA 5IP7J 3S16J 1T0FA 2E5ZA 4IO9F 2KDZA 1VQ6I 2R5YB 3C3WA 4AYBN 3L2CA 3KLNA 3FKJA 2NS8A 2XAUA 2M4GA 2M0CA 4RB2C 3S1RJ 1MZBA 1QZZA 2F5FA 1FYLA 5DCMA 2QEXI 2ECBA 1LEAA 2QQ8A 2WAQA 2D1HA 5DD8A 2FF4A 2LH9A 5BMZA 3OYJA 4KFCA 2NOJB 1UELB 2LBFA 1T33A 3GW2A 3MCZA 1TNTA 3ZQFA 2L4AA 2CSOA 5LRRA 1IAWA 3A4CA 5DD4A 1NTCA 5HS8A 3X2QH 1X1BA 2Z16A 3DEWA 3ZMUA 1XGMA 3BPXA 4LIUA 2LKXA 2RV8A 2QUFA 1U3EM 2FU4A 3I0TA 2FRHA 1ZLKA 1YJNI 2ZBKA 1J0RA 2HKXA 2CFXA 2NVTJ 3HTSB 1R4NB 2LG4A 4EATA 2E60A 2VASA 3BJAA 5FKLA 3ZQHA 1S5LC 4XLFA 3CD6I 2V1DA 3F6OA 2VKVA 2JPCA 3T8RA 3LOCA 2CYYA 2L7FP 1DU0A 2IS4A 4MFEA 3WG7H 4AIDA 2X9DA 4M9ZA 3OYEA 1U78A 1DP3A 3CJNA 4LIVA 2CQQA 5JFRA 4B3AA 3KEYA 2HDWA 4K2EA 3ZGKA 1ACIA 2Z9OA 1ZYRF 1YIJI 2FE3A 2PMHA 1OQYA 3JRAA 2BVLA 2O0YA 2IS1A 5EEHA 2Y9ZA 2WWYA 1XPXA 3CZ6A 1QRYA 3GMEA 4E7LA 2IP2A 4NDLA 4MTDA 2Y48A 3HBLA 5GAGJ 4IQ4A 2DA5A 3GZ5A 3R4KA 3L2RA 5FRMA 1KU3A 2CV1A 3VPRA 2F5EA 2O8KA 4XSZF 2GM4A 1XX5A 2IS6A 3OOUA 5A2QZ 2OUMA 4RAZA 1JJ8C 1K78A 4FE4A 4C3IJ 4ZYHA 2EK5A 4CHUA 5J4YA 2DFFA 4XRMA 2CW8A 2XAJA 4AIHA 2QKMB 4BAYA 3OYFA 3V7CA 3MKWB 1OFCX 3EYYA 4ZZLA 2R7SA 4PJ0C 3FMQA 4UHTA 3WTXC 2L01A 1XMXA 1O3RA 3GTJJ 1QGPA 4IEJA 2H27A 3LA3A 1B4AA 3OYAA 3IAM2 2X51A 3S3NA 2GXAA 4KIBA 2XPVA 2QM3A 1LFPA 2NS0A 2KDOA 2KIUA 1HXDA
chains in the Genus database with same CATH topology
5ICFA 3DXJF 2COMA 2HKOA 3E5UA 1I1GA 2XHKA 5LLQA 2NYXA 4PGHA 5FLXZ 2VE8A 2Q2EA 3T5XA 2PMUA 2X0LA 1E17A 2QVOA 2H6BA 3KEQA 3KP4A 2STTA 4L0ZB 2W85A 4HF0A 4PGGA 2JRTA 1FSEA 3BPVA 4I01A 3P9KA 5FGMA 3MAJA 3WTWC 2ESHA 3SHFA 1CF7B 2E7WA 1D5VA 1YS6A 2QBYA 2IRFG 2W24A 4L18B 3LWFA 4HQEA 1HSTA 5E1ZB 4GO1A 1K6OA 5ERIA 1BI1A 3DPTA 4PZJA 5L3FA 4EM1A 3J80K 1J2XA 2A69F 2RNJA 2E7XA 4AVPA 1J5YA 1R5HA 1S8NA 3F23A 4I7HA 4KUMA 4B09A 2DQLA 2ELHA 3B73A 3I54A 3TGNA 2VODA 4XBFA 2RN7A 4BNCA 3HSEA 2FBKA 2OD5A 3T1BA 2CO5A 4BHBA 3J81K 4CDGA 4DQ2A 5BPIA 3JAMZ 4OOIA 4IRHA 1SD7A 3CLOA 1LQ1A 1TQMA 2DW4A 1XMAA 2VBWA 5CLSA 1TNSA 3BJ6A 1TLHB 1WQ2A 1MDMB 3MFKA 3WTSC 4R1HA 2PEXA 4ENMA 2EB7A 5H20A 2F2EA 4ZYEA 1WKMA 3R6SA 2HTJA 4KN7X 2NNNA 3F8BA 2ACJA 3TO7A 2YPRA 2EV6A 3I5UA 1O7LA 3FXRA 2G7HA 5CVVA 2VBZA 3SZTA 3DPLC 4O6JA 1CGPA 4EV0A 3E5XA 1UCRA 5K1YA 4ENNA 2ZCWA 2OZUA 2VONA 5JVTA 5IT9Z 2RGVA 5HLGA 4U0WA 5BQTA 3I53A 3RPQA 3ABTA 3FM3A 3KP2A 1ZRDA 5E20A 1BIAA 3ZMZA 4ON0A 4A12A 2QQ9A 3F8NA 4OIQF 3GFIA 1RIOH 1PP8F 2RKHA 1S29A 1ZAOA 2M45A 2ZO4A 4A0ZA 2Q8KA 1QO0D 1ZG5A 5F6FA 5ILUA 3DKWA 1BC7C 4LG0B 3E6BA 2K86A 1PDNC 2XASA 1XSDA 3V8LA 5E1WA 4A2UA 5E1XA 3ULQB 1KYWA 1H9GA 5HS9A 3GF2A 2Z3YA 3L00A 5FB2A 2HFHA 4PDKA 3GX4X 4CYDA 1FPQA 3K2ZA 2YX7A 1MD0A 2IA2A 1FLIA 3E6MA 3U9GA 5FD6A 4HA8A 1P4AA 5HS7A 4FX0A 4A0XA 4CXFA 1FSHA 1B1BA 3RTRA 1HW1A 2WV0A 1JE8A 1CF7A 3E5QA 3WGHA 1OYWA 2UXNA 1L3LA 5D5XB 3BY6A 3I64A 3JTGA 3VEPA 2X4HA 2KJBA 1LEBA 4HAMA 1DPUA 1U5TB 3EETA 4MTEA 4NHJA 2PLYA 1YW7A 3TDZC 1XGSA 1FC3A 5D4SA 3JSOA 3E97A 1L0OC 2H09A 3RDIA 3QOPA 2QLZA 2P5LC 3ZMSA 3F22A 4I02A 3TQNA 5JHUA 3GVAA 3KETA 1G3YA 1F1ZA 3KCCA 3LAJA 1RUOA 3C1DA 2O61A 2NAZA 1MGTA 4G7HF 2P6TA 1R1VA 3QP5A 1KU2A 5D8KB 4ESFA 3ZPLA 3QRFF 1U5TC 1H9TA 2XIGA 1S6LA 2DPUA 1YS7A 3GFJA 4HLXA 1K78B 1MJAA 1LDJA 4HF2A 4WF2A 4A5NA 1R22A 3FWEA 3RKYA 2XRNA 4IVNA 4YIFA 3IC7A 3WU1B 1ZREA 2O8XA 3LSTA 3KP7A 3HSRA 4UVCA 2EA4A 2FBIA 4CGZA 2XVCA 4M6YA 3RKXA 5DEQA 2E1NA 2IJLA 5E17F 2RDPA 4A0YA 2W84A 2DBBA 3HOSA 1XMKA 2DK5A 1IRFA 2VT2A 2EFPA 3BP8A 1FYMA 1XSXA 2F5DA 1HQCA 1IW7F 1ZN2A 1KQ8A 3KE2A 3RIRA 1UB9A 4RAYA 4IHTA 3H3ZA 3N97A 5ILVA 5D5UB 3L9FA 3RYPA 1R36A 2CGPA 1LNWA 4L9VA 3Q9VA 4G9YA 4MQ9F 2HZTA 4M6XA 2FNPA 2IVMA 1RNLA 4ZH4F 4CICA 2L54A 2PQ8A 3BOQA 1FWZA 3QP6A 2MLGA 4HV5A 5L3BA 1W5SA 1YW8A 3BWGA 3WTTC 1BI2A 3KP3A 4KYWA 4BQAA 5CVIA 4CZZA 4HDVA 4HQMA 3C7JA 1EH6A 5J6XA 3KP5A 4NB5A 2H94A 4P55A 2XAHA 5K5QA 1I6XA 2F5CA 1LVAA 2KJCA 4ESBA 4M71A 5HLIA 5ILSA 3F3XA 2FEZA 4JK1X 4GGGA 1P92A 1JHFA 2MH9A 4HF1A 5LEKA 1ZG1A 3GWZA 4O5VA 1TQPA 4I09A 4KMUX 1LJ9A 4AIKA 5D5VB 4U7DA 2GIVA 3Q9SA 2DQRA 2G7UA 4S05A 5KVRA 1OYIA 2VT3A 2RC4A 3WG9A 3KP6A 2FQ3A 2E1CA 2UXXA 1ULYA 4LB5A 2WTEA 2Q0OA 3BZ6A 1S7OA 3ISPA 1XCBA 3E6CC 4KNYA 1C0WA 3FF5A 5E18F 1GXQA 3FHZA 5DDGA 4RS8A 4FHTA 1KQ0A 2BBYA 4S04A 2Y0MA 3ZMTA 2FMLA 2VN2A 3SZPA 4EM0B 3IKTA 3QPTA 4EMSA 4LB6B 5FFXA 1IRGA 1QPMA 4ETSA 5DUKA 1TW2A 2GA1A 1R23A 3QAHA 4RB3C 4EM2A 4Q5SF 4EJTA 4HZFA 4WXDA 3RI4A 1XD7A 3DV8A 4U0YA 3HHGA 3K1NA 3WTYC 2YX4A 3C18A 1I27A 1KYZA 2XROA 1JGSA 4AIJA 4Y13A 2GA2A 1P4WA 2PJPA 3MZHA 1KU7A 5ICEA 1ON1A 1AOYA 3QU6A 3F8CA 3LA2A 2LF8A 3M7GA 3ELKA 2DLLA 2HEOA 1YIOA 3CUQB 2EA2A 1K79A 3B02A 5F64A 1FP1D 4D0PA 1RZ4A 5AIQA 4HYEA 3DF8A 3V7SA 4AD9A 1XGOA 4KIFA 1UHWA 3IRRA 4IRGA 1Z05A 2V79A 3KFWX 2L02A 3JW4A 1WI9A 3EDPA 5D6FA 4HOBA 2DAOA 2FXAA 2O6GE 1DDNA 1MKMA 2EWNA 2HTSA 2OAZA 2TDXA 2YR2A 2XAQA 3R0JA 3KLOA 3MWMA 1D8JA 4O3MA 1TW3A 5CVUA 4GYIA 3CUQA 2L4MA 2HOEA 1HKSA 3P9IA 2ETHA 2BE5F 1Z6TA 4L9TA 2Z33A 1D3YA 2EFWA 2GAUA 5KK1A 2EFQA 3TDUC 2RQPA 3SQNA 2FMYA 3SFZA 1YTYA 4P9FA 1FZPB 1B9NA 2J5PA 3FMSA 3FZVA 3CDHA 2OBPA 4B8XA 3QPHA 1FX7A 4BXUA 1FP2A 4A6DA 2XKPA 1YG2A 3LAPA 1XSVA 1LB2A 3EQLF 4MEYF 4EGYA 3DFGA 1R5GA 3R61A 3AAFA 2OU2A 2G9WA 5DUIA 4U7BA 2HS5A 2A5YB 5E8GA 2DFIA 5LHIA 3WTVC 3G73A 1D8KA 1HW2A 3ECOA 4HV6A 4WXHA 1B9MA 3ERED 5LHGA 4EJVA 1DPRA 1QNTA 2V6CA 1F9NA 2D45A 3U1DA 2FNAA 2XGXA 2PI0A 2HQNA 4U0VA 3D5LA 2V9VA 5LRSA 3VOEA 4UVAA 5D8LB 3V7RA 2RVCA 4YFNF 2NRAC 4MHGA 2C6YA 1V4RA 1EH7A 2HYFA 1STZA 4HW0A 4IJAA 4IXAA 1W7PB 2GWRA 1FYKA 2B0LA 4OIPF 2VOOA 4BHPA 3RPUA 1ZHFA 3TOBA 3GYHX 1T39A 2VE9A 2ZNZA 2DTRA 3HRSA 5FO5A 5J8FA 3LA7A 1X3UA 3JAMK 5A2QK 1FT9A 4LMYA 2OQGA 3WE2A 3D0SA 4LLNA 3V8KA 1E2XA 3S2WA 3J80Z 3DP7A 4M74A 4G94A 1G4DA 2P7CB 1BIBA 2O03A 4LD5A 1SFUA 2P4WA 5H6QA 3I71A 2GQQA 1ZG3A 1RI7A 3PQJA 1JXSA 2K4JA 1R1UA 1O7FA 1R1TA 1ZGJA 4AWXB 3R60A 3L09A 1K7AA 3IWZA 2D2WA 2MH2A 1IN8A 2M5WA 4EVIA 4XLPF 2Z5UA 4ZYDA 3ZMVA 5LGNA 3I4PA 3GEZA 2HGCA 1AWCA 5CJ9A 1EV7A 4YIIA 1SFXA 2D1VA 1KQ9A 4PCQA 2WC2A 4EQQA 5D5WB 4G7OF 2R3SA 2DPDA 2P5KA 2HQRA 3TOAA 1FBSA 1IF1A 5K5RA 4JQFA 1O3QA 1XDUA 3DQVC 3OV8A 1F4KA 1Z1DA 3BROA 4GCVA 4MNUA 5LEJA 1U6GA 3WGIA 1ODDA 1LDDA 1OYYA 4M72A 1OR7A 1SFEA 2BGCA 2R7DA 1O57A 3T8TA 2STWA 4OMZA 2UZKA 4ESJA 1LDKB 1FOKA 2LSOA 2OQRA 3RJPA 4U88A 2VBYA 4UUVA 2V1XA 1SMYF 3I59B 5HLHA 5HOOA 1HKQA 2J5OA 3ZQ7A 5HDGA 4ASNA 2IA0A 1Q1HA 3IHUA 5L3DA 4RB0A 4UV9A 2L3DA 2M8EA 4MEXF 1S3JA 3L7WA 3M8EA 2MC3A 4UV8A 5IT3A 2EFOA 2ISZA 3ML6A 2PG4A 3MZYA 4Z2YA 4NQWA 4A5MA 2K4BA 1P2FA 3O3KA 2FA5A 4M9SA 5HDNA 4LLGF 5LHHA 4XLNF 3NEUA 3ZN0A 3FM5A 2A61A 5DV5A 4BHCA 5TRDA 5BPDA 5BS6A 4Q4ZF 4WWCA 1ZARA 2ZNYA 2P8TA 4Y17A 1H0MA 3HHHA 1R00A 4XRFA 3M1EA 2YSRA 3H3UA 3V8JA 1SD6A 1BOAA 2KIFA 4HBLA 2QYOA 2CWEA 2KIMA 5TJJA 1YYVA 5CVJA 4FT8A 3E6DA 1XGNA 3CTAA 4GYGA 1YW9A 2CG4A 3TKYA 3H92A 1J75A 1Z7UA 1IXCA 1BJAA 2EJRA 1MDMA 1GHCA 1T98A 2K27A 1UHMA 2DK8A 2IPQX 1J9IA 2R7FA 4P9UA 2VC1A 1BN5A 1FY7A 4HX4A 3HTUA 3FX3A 5ICCA 2LNBA 2XAFA 4EJOA 1W4MA 3LQQA 3J7AO 1XCVA 4IF4A 4TV7A 1KA8A 1KGSA 1RUNA 3EYIA 4HX7A 1XB4A 2QQBA 3GLXA 3WE3A 4G8XA 3GFLA 2ISYA 4EJUA 3CUOA 1R7JA 3IWFA 2ESNA 4H0EA 1T6SA 4EJWA 4L9JA 4YFKF 4UVBA 1V3FA 3O6BB 3IL2A 4LFUA 1W7PD 1DP7P 2XUBA 1XN7A 2VBXA 5H6RA 4ZYGA 2ZFWA 1YO5C 1USSA 1Z91A 1EH8A 3WU0A 3BDDA 4LG0A 2GXBA 1SD4A 3LFKA 3KEOA 3REOA 3BJOA 3Q5FA 4L5JA 3JTHA 4L9NA 1JHHA 5L3GA 1O3TA 3K1MA 2P7VB 2W25A 2PBIA 4DNCA 4XSXF 3EUHA 5DYMA 3ZN1A 2ZMEB 3RYRA 4Q48A 4IHSA 1IN7A 2PFBA 1BC8C 2AS5F 3T0YA 3OOPA 2K02A 3CO7C 5EEGA 3P9CA 2MD5A 1SD5A 4ENJA 3KZZA 5LGUA 2EV0A 2JTVA 4LK0F 4QWQA 5LGTA 3M8FA 1OPCA 2PN6A 4N9IA 3ZMDA 1QBJA 3ROUA 3F21A 3GZ6A 4G7ZF 3CO6C 2EV5A 4CO8A 4M73A 2AXLA 4OIOF 4I0AA 2VOPA 3PFIA 1HW5A 2DT5A 1R58A 1USTA 1J59A 4HX8A 3TO9A 3IKVA 4I98B 1SAXA 3K69A 2P6SA 1HSJA 1B6AA 1MJ9A 3TO6A 3G3ZA 3M9AA 2JT1A 1WRJA 4RGUA 2A68F 1G3SA 3SXYA 3QU3A 3HRTA 1A04A 2JSCA 2A3SA 1BM9A 2GXGA 4P5OA 1J7KA 3F72A 1PUEE 1ZH5A 5DCMB 1S7AA 1QZYA 1Z6RA 5D6EA 4RGRA 4WX9A 5CYVA 2H6CA 3F6VA 2XV4S 4OINF 3N4MA 2HYGD 4IPAA 4N9HA 4P96A 3KZYA 3LQRA 1REPC 4WCGA 4ENKA 2KRFA 2QZ8A 3FXQA 4KT5C 1DUXC 4F7ZA 4MGRA 4M9XA 2MBFA 3K9TA 2MLKA 1B59A 5F1RA 1PP7U 2UWMA 1BBYA 3V4GA 3HRUA 2KKOA 3U2RA 1HBXG 4WK8F 1Z9CA 2VC0A 4N0BA 1U8RA 5ICGA 4LJZF 5ED4A 4I2OA 1IXRC 2HR3A 1G6NA 2DU9A 4KIGA 1YLFA 2HWVA 4KN4X 1ON2A 1P6RA 3O2PE 2BEOA 2LF7A 1VTNC 1Y0UA 4UNOA 4IRIA 4A6EA 2ADUA 2JZYA 3CUQC 2ZKZA 1TTYA 2EFNA 3GUDA 4LK1F 6PAXA 4OU0A 1OKRA 1FBUA 1IUYA 2VXZA 1IN4A 2O3FA 1QQIA 3K0LA 2V1UA 5JI6A 2BYVE 3K1PA 2A07F 2Z99A 5AONA 1U5TA 3VFZA 1P4XA 2FSWA 3WODF 1YFHA 2M1BA 2ZMEA 3E3VA 1ZRCA 1NHAA 4KDPA 2FOKA 3GO5A 2MA3A 5AIPA 3W6JB 2A6EF 2ZJ2A 2BV6A 5DCFA 4I0BA 4R79A 4G6DA 5CVRA 1SMTA 2OA4A 2IW5A 1YQAA 4OMYA 2OZ6A 1I1SA 2M30A 3I58A 3DEUA 4RGSA 3W6KB 2QENA 2QBYB 5J8CA 3ECHA 1IN5A 4RGXA 4FX4A 1FBQA 5FLXK 1F5TA 1U2WA 2K7LA 4KA4A 4LLLA 3GXOA 4QLCU 3HIFA 5FD5A 2QQAA 4YFXF 2FBHA 2NNYA 3P7NA 1HKTA 3F8FA 1OMIA 3IRQA 5E8IA 2DO7A 1XDSA 3GFMA 3HOTA 1W5TA 3NQOA 3WTUC 1ONVA 1BI3A 1BI0A 4MQVA 3ZP5A 4BH9A 3WGGA 4KMFA 2IT0A 1I5ZA 4Q47A 1W7PA 1ZRFA 5FFZA 2GZWA 2CQKA 2M87A 3FMRA 4BYYA 3HYIA 4YG2F 2QWWA 4L0YB 4ZZDA 2XAGA 1UFMA 3PQKA 3VB2A 1O3SA 2Y75A 4RB1A 4L5IA 4WXCA 3J81Z 4G6QA 1GVJA 1IN6A 2W57A 2A6HF 5K5OA 3MQ0A 5HVQC 1G3WA 3NRVA 4HDUA 1KU9A 4HLYA 5D4RA 5LBQA 1ZGAA 4UXNA 5BOXA 2YU3A 3VODA 3WTZA 1TBXA 3HUGA 1IZ1A 2IA1A 1MJBA 1WWXA 3MEXA 3ABUA 3RKWA 4R8HA 3FXUA 2LDUA 1ZLJA 4LGWA 4GXOA 2P5VA 4JBAA 1WSUA 5IT9K 2XKOA 1T38A 3R0AA 4Y15A 1G3TA 4E70A 1GXPA 2CW0F 5L3EA 4OIRF 3COAC 3HSFA 1T2KA 2LKPA 1IXSB 3JSPA 5HDKA 3HRMA 2DI3A 2JPBA 2ZXJA 1FNNA 5JR3A 3I59A 4EGZA 2HDCA 3F8MA 1TQIA 4KICA 5L3CA 1T0FA 3C3WA 3L2CA 3KLNA 4RB2C 1MZBA 1QZZA 2F5FA 1FYLA 5DCMA 1LEAA 2D1HA 5DD8A 2FF4A 5BMZA 4KFCA 3GW2A 3MCZA 1TNTA 2L4AA 2CSOA 5LRRA 1IAWA 5DD4A 5HS8A 3ZMUA 1XGMA 3BPXA 2RV8A 2QUFA 1U3EM 2FU4A 3I0TA 2FRHA 1ZLKA 2ZBKA 1J0RA 2HKXA 2CFXA 3HTSB 3BJAA 2V1DA 3F6OA 2JPCA 3T8RA 2CYYA 4M9ZA 1U78A 3CJNA 5JFRA 4K2EA 2Z9OA 1ZYRF 2FE3A 2PMHA 2O0YA 5EEHA 2WWYA 2IP2A 4MTDA 2Y48A 3GZ5A 3R4KA 1KU3A 2F5EA 4XSZF 5A2QZ 4RAZA 1K78A 4ZYHA 2EK5A 4CHUA 2XAJA 4AIHA 4BAYA 3V7CA 3EYYA 4ZZLA 3FMQA 4UHTA 3WTXC 2L01A 1O3RA 1QGPA 2H27A 3LA3A 1B4AA 4KIBA 2QM3A 2NS0A 2KIUA 1HXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ICF A;  3DXJ F;  2COM A;  2HKO A;  3E5U A;  1I1G A;  2XHK A;  5LLQ A;  2NYX A;  4PGH A;  5FLX Z;  2VE8 A;  2Q2E A;  3T5X A;  2PMU A;  2X0L A;  1E17 A;  2QVO A;  2H6B A;  3KEQ A;  3KP4 A;  2STT A;  4L0Z B;  2W85 A;  4HF0 A;  4PGG A;  2JRT A;  1FSE A;  3BPV A;  4I01 A;  3P9K A;  5FGM A;  3MAJ A;  3WTW C;  2ESH A;  3SHF A;  1CF7 B;  2E7W A;  1D5V A;  1YS6 A;  2QBY A;  2IRF G;  2W24 A;  4L18 B;  3LWF A;  4HQE A;  1HST A;  5E1Z B;  4GO1 A;  1K6O A;  5ERI A;  1BI1 A;  3DPT A;  4PZJ A;  5L3F A;  4EM1 A;  3J80 K;  1J2X A;  2A69 F;  2RNJ A;  2E7X A;  4AVP A;  1J5Y A;  1R5H A;  1S8N A;  3F23 A;  4I7H A;  4KUM A;  4B09 A;  2DQL A;  2ELH A;  3B73 A;  3I54 A;  3TGN A;  2VOD A;  4XBF A;  2RN7 A;  4BNC A;  3HSE A;  2FBK A;  2OD5 A;  3T1B A;  2CO5 A;  4BHB A;  3J81 K;  4CDG A;  4DQ2 A;  5BPI A;  3JAM Z;  4OOI A;  4IRH A;  1SD7 A;  3CLO A;  1LQ1 A;  1TQM A;  2DW4 A;  1XMA A;  2VBW A;  5CLS A;  1TNS A;  3BJ6 A;  1TLH B;  1WQ2 A;  1MDM B;  3MFK A;  3WTS C;  4R1H A;  2PEX A;  4ENM A;  2EB7 A;  5H20 A;  2F2E A;  4ZYE A;  1WKM A;  3R6S A;  2HTJ A;  4KN7 X;  2NNN A;  3F8B A;  2ACJ A;  3TO7 A;  2YPR A;  2EV6 A;  3I5U A;  1O7L A;  3FXR A;  2G7H A;  5CVV A;  2VBZ A;  3SZT A;  3DPL C;  4O6J A;  1CGP A;  4EV0 A;  3E5X A;  1UCR A;  5K1Y A;  4ENN A;  2ZCW A;  2OZU A;  2VON A;  5JVT A;  5IT9 Z;  2RGV A;  5HLG A;  4U0W A;  5BQT A;  3I53 A;  3RPQ A;  3ABT A;  3FM3 A;  3KP2 A;  1ZRD A;  5E20 A;  1BIA A;  3ZMZ A;  4ON0 A;  4A12 A;  2QQ9 A;  3F8N A;  4OIQ F;  3GFI A;  1RIO H;  1PP8 F;  2RKH A;  1S29 A;  1ZAO A;  2M45 A;  2ZO4 A;  4A0Z A;  2Q8K A;  1QO0 D;  1ZG5 A;  5F6F A;  5ILU A;  3DKW A;  1BC7 C;  4LG0 B;  3E6B A;  2K86 A;  1PDN C;  2XAS A;  1XSD A;  3V8L A;  5E1W A;  4A2U A;  5E1X A;  3ULQ B;  1KYW A;  1H9G A;  5HS9 A;  3GF2 A;  2Z3Y A;  3L00 A;  5FB2 A;  2HFH A;  4PDK A;  3GX4 X;  4CYD A;  1FPQ A;  3K2Z A;  2YX7 A;  1MD0 A;  2IA2 A;  1FLI A;  3E6M A;  3U9G A;  5FD6 A;  4HA8 A;  1P4A A;  5HS7 A;  4FX0 A;  4A0X A;  4CXF A;  1FSH A;  1B1B A;  3RTR A;  1HW1 A;  2WV0 A;  1JE8 A;  1CF7 A;  3E5Q A;  3WGH A;  1OYW A;  2UXN A;  1L3L A;  5D5X B;  3BY6 A;  3I64 A;  3JTG A;  3VEP A;  2X4H A;  2KJB A;  1LEB A;  4HAM A;  1DPU A;  1U5T B;  3EET A;  4MTE A;  4NHJ A;  2PLY A;  1YW7 A;  3TDZ C;  1XGS A;  1FC3 A;  5D4S A;  3JSO A;  3E97 A;  1L0O C;  2H09 A;  3RDI A;  3QOP A;  2QLZ A;  2P5L C;  3ZMS A;  3F22 A;  4I02 A;  3TQN A;  5JHU A;  3GVA A;  3KET A;  1G3Y A;  1F1Z A;  3KCC A;  3LAJ A;  1RUO A;  3C1D A;  2O61 A;  2NAZ A;  1MGT A;  4G7H F;  2P6T A;  1R1V A;  3QP5 A;  1KU2 A;  5D8K B;  4ESF A;  3ZPL A;  3QRF F;  1U5T C;  1H9T A;  2XIG A;  1S6L A;  2DPU A;  1YS7 A;  3GFJ A;  4HLX A;  1K78 B;  1MJA A;  1LDJ A;  4HF2 A;  4WF2 A;  4A5N A;  1R22 A;  3FWE A;  3RKY A;  2XRN A;  4IVN A;  4YIF A;  3IC7 A;  3WU1 B;  1ZRE A;  2O8X A;  3LST A;  3KP7 A;  3HSR A;  4UVC A;  2EA4 A;  2FBI A;  4CGZ A;  2XVC A;  4M6Y A;  3RKX A;  5DEQ A;  2E1N A;  2IJL A;  5E17 F;  2RDP A;  4A0Y A;  2W84 A;  2DBB A;  3HOS A;  1XMK A;  2DK5 A;  1IRF A;  2VT2 A;  2EFP A;  3BP8 A;  1FYM A;  1XSX A;  2F5D A;  1HQC A;  1IW7 F;  1ZN2 A;  1KQ8 A;  3KE2 A;  3RIR A;  1UB9 A;  4RAY A;  4IHT A;  3H3Z A;  3N97 A;  5ILV A;  5D5U B;  3L9F A;  3RYP A;  1R36 A;  2CGP A;  1LNW A;  4L9V A;  3Q9V A;  4G9Y A;  4MQ9 F;  2HZT A;  4M6X A;  2FNP A;  2IVM A;  1RNL A;  4ZH4 F;  4CIC A;  2L54 A;  2PQ8 A;  3BOQ A;  1FWZ A;  3QP6 A;  2MLG A;  4HV5 A;  5L3B A;  1W5S A;  1YW8 A;  3BWG A;  3WTT C;  1BI2 A;  3KP3 A;  4KYW A;  4BQA A;  5CVI A;  4CZZ A;  4HDV A;  4HQM A;  3C7J A;  1EH6 A;  5J6X A;  3KP5 A;  4NB5 A;  2H94 A;  4P55 A;  2XAH A;  5K5Q A;  1I6X A;  2F5C A;  1LVA A;  2KJC A;  4ESB A;  4M71 A;  5HLI A;  5ILS A;  3F3X A;  2FEZ A;  4JK1 X;  4GGG A;  1P92 A;  1JHF A;  2MH9 A;  4HF1 A;  5LEK A;  1ZG1 A;  3GWZ A;  4O5V A;  1TQP A;  4I09 A;  4KMU X;  1LJ9 A;  4AIK A;  5D5V B;  4U7D A;  2GIV A;  3Q9S A;  2DQR A;  2G7U A;  4S05 A;  5KVR A;  1OYI A;  2VT3 A;  2RC4 A;  3WG9 A;  3KP6 A;  2FQ3 A;  2E1C A;  2UXX A;  1ULY A;  4LB5 A;  2WTE A;  2Q0O A;  3BZ6 A;  1S7O A;  3ISP A;  1XCB A;  3E6C C;  4KNY A;  1C0W A;  3FF5 A;  5E18 F;  1GXQ A;  3FHZ A;  5DDG A;  4RS8 A;  4FHT A;  1KQ0 A;  2BBY A;  4S04 A;  2Y0M A;  3ZMT A;  2FML A;  2VN2 A;  3SZP A;  4EM0 B;  3IKT A;  3QPT A;  4EMS A;  4LB6 B;  5FFX A;  1IRG A;  1QPM A;  4ETS A;  5DUK A;  1TW2 A;  2GA1 A;  1R23 A;  3QAH A;  4RB3 C;  4EM2 A;  4Q5S F;  4EJT A;  4HZF A;  4WXD A;  3RI4 A;  1XD7 A;  3DV8 A;  4U0Y A;  3HHG A;  3K1N A;  3WTY C;  2YX4 A;  3C18 A;  1I27 A;  1KYZ A;  2XRO A;  1JGS A;  4AIJ A;  4Y13 A;  2GA2 A;  1P4W A;  2PJP A;  3MZH A;  1KU7 A;  5ICE A;  1ON1 A;  1AOY A;  3QU6 A;  3F8C A;  3LA2 A;  2LF8 A;  3M7G A;  3ELK A;  2DLL A;  2HEO A;  1YIO A;  3CUQ B;  2EA2 A;  1K79 A;  3B02 A;  5F64 A;  1FP1 D;  4D0P A;  1RZ4 A;  5AIQ A;  4HYE A;  3DF8 A;  3V7S A;  4AD9 A;  1XGO A;  4KIF A;  1UHW A;  3IRR A;  4IRG A;  1Z05 A;  2V79 A;  3KFW X;  2L02 A;  3JW4 A;  1WI9 A;  3EDP A;  5D6F A;  4HOB A;  2DAO A;  2FXA A;  2O6G E;  1DDN A;  1MKM A;  2EWN A;  2HTS A;  2OAZ A;  2TDX A;  2YR2 A;  2XAQ A;  3R0J A;  3KLO A;  3MWM A;  1D8J A;  4O3M A;  1TW3 A;  5CVU A;  4GYI A;  3CUQ A;  2L4M A;  2HOE A;  1HKS A;  3P9I A;  2ETH A;  2BE5 F;  1Z6T A;  4L9T A;  2Z33 A;  1D3Y A;  2EFW A;  2GAU A;  5KK1 A;  2EFQ A;  3TDU C;  2RQP A;  3SQN A;  2FMY A;  3SFZ A;  1YTY A;  4P9F A;  1FZP B;  1B9N A;  2J5P A;  3FMS A;  3FZV A;  3CDH A;  2OBP A;  4B8X A;  3QPH A;  1FX7 A;  4BXU A;  1FP2 A;  4A6D A;  2XKP A;  1YG2 A;  3LAP A;  1XSV A;  1LB2 A;  3EQL F;  4MEY F;  4EGY A;  3DFG A;  1R5G A;  3R61 A;  3AAF A;  2OU2 A;  2G9W A;  5DUI A;  4U7B A;  2HS5 A;  2A5Y B;  5E8G A;  2DFI A;  5LHI A;  3WTV C;  3G73 A;  1D8K A;  1HW2 A;  3ECO A;  4HV6 A;  4WXH A;  1B9M A;  3ERE D;  5LHG A;  4EJV A;  1DPR A;  1QNT A;  2V6C A;  1F9N A;  2D45 A;  3U1D A;  2FNA A;  2XGX A;  2PI0 A;  2HQN A;  4U0V A;  3D5L A;  2V9V A;  5LRS A;  3VOE A;  4UVA A;  5D8L B;  3V7R A;  2RVC A;  4YFN F;  2NRA C;  4MHG A;  2C6Y A;  1V4R A;  1EH7 A;  2HYF A;  1STZ A;  4HW0 A;  4IJA A;  4IXA A;  1W7P B;  2GWR A;  1FYK A;  2B0L A;  4OIP F;  2VOO A;  4BHP A;  3RPU A;  1ZHF A;  3TOB A;  3GYH X;  1T39 A;  2VE9 A;  2ZNZ A;  2DTR A;  3HRS A;  5FO5 A;  5J8F A;  3LA7 A;  1X3U A;  3JAM K;  5A2Q K;  1FT9 A;  4LMY A;  2OQG A;  3WE2 A;  3D0S A;  4LLN A;  3V8K A;  1E2X A;  3S2W A;  3J80 Z;  3DP7 A;  4M74 A;  4G94 A;  1G4D A;  2P7C B;  1BIB A;  2O03 A;  4LD5 A;  1SFU A;  2P4W A;  5H6Q A;  3I71 A;  2GQQ A;  1ZG3 A;  1RI7 A;  3PQJ A;  1JXS A;  2K4J A;  1R1U A;  1O7F A;  1R1T A;  1ZGJ A;  4AWX B;  3R60 A;  3L09 A;  1K7A A;  3IWZ A;  2D2W A;  2MH2 A;  1IN8 A;  2M5W A;  4EVI A;  4XLP F;  2Z5U A;  4ZYD A;  3ZMV A;  5LGN A;  3I4P A;  3GEZ A;  2HGC A;  1AWC A;  5CJ9 A;  1EV7 A;  4YII A;  1SFX A;  2D1V A;  1KQ9 A;  4PCQ A;  2WC2 A;  4EQQ A;  5D5W B;  4G7O F;  2R3S A;  2DPD A;  2P5K A;  2HQR A;  3TOA A;  1FBS A;  1IF1 A;  5K5R A;  4JQF A;  1O3Q A;  1XDU A;  3DQV C;  3OV8 A;  1F4K A;  1Z1D A;  3BRO A;  4GCV A;  4MNU A;  5LEJ A;  1U6G A;  3WGI A;  1ODD A;  1LDD A;  1OYY A;  4M72 A;  1OR7 A;  1SFE A;  2BGC A;  2R7D A;  1O57 A;  3T8T A;  2STW A;  4OMZ A;  2UZK A;  4ESJ A;  1LDK B;  1FOK A;  2LSO A;  2OQR A;  3RJP A;  4U88 A;  2VBY A;  4UUV A;  2V1X A;  1SMY F;  3I59 B;  5HLH A;  5HOO A;  1HKQ A;  2J5O A;  3ZQ7 A;  5HDG A;  4ASN A;  2IA0 A;  1Q1H A;  3IHU A;  5L3D A;  4RB0 A;  4UV9 A;  2L3D A;  2M8E A;  4MEX F;  1S3J A;  3L7W A;  3M8E A;  2MC3 A;  4UV8 A;  5IT3 A;  2EFO A;  2ISZ A;  3ML6 A;  2PG4 A;  3MZY A;  4Z2Y A;  4NQW A;  4A5M A;  2K4B A;  1P2F A;  3O3K A;  2FA5 A;  4M9S A;  5HDN A;  4LLG F;  5LHH A;  4XLN F;  3NEU A;  3ZN0 A;  3FM5 A;  2A61 A;  5DV5 A;  4BHC A;  5TRD A;  5BPD A;  5BS6 A;  4Q4Z F;  4WWC A;  1ZAR A;  2ZNY A;  2P8T A;  4Y17 A;  1H0M A;  3HHH A;  1R00 A;  4XRF A;  3M1E A;  2YSR A;  3H3U A;  3V8J A;  1SD6 A;  1BOA A;  2KIF A;  4HBL A;  2QYO A;  2CWE A;  2KIM A;  5TJJ A;  1YYV A;  5CVJ A;  4FT8 A;  3E6D A;  1XGN A;  3CTA A;  4GYG A;  1YW9 A;  2CG4 A;  3TKY A;  3H92 A;  1J75 A;  1Z7U A;  1IXC A;  1BJA A;  2EJR A;  1MDM A;  1GHC A;  1T98 A;  2K27 A;  1UHM A;  2DK8 A;  2IPQ X;  1J9I A;  2R7F A;  4P9U A;  2VC1 A;  1BN5 A;  1FY7 A;  4HX4 A;  3HTU A;  3FX3 A;  5ICC A;  2LNB A;  2XAF A;  4EJO A;  1W4M A;  3LQQ A;  3J7A O;  1XCV A;  4IF4 A;  4TV7 A;  1KA8 A;  1KGS A;  1RUN A;  3EYI A;  4HX7 A;  1XB4 A;  2QQB A;  3GLX A;  3WE3 A;  4G8X A;  3GFL A;  2ISY A;  4EJU A;  3CUO A;  1R7J A;  3IWF A;  2ESN A;  4H0E A;  1T6S A;  4EJW A;  4L9J A;  4YFK F;  4UVB A;  1V3F A;  3O6B B;  3IL2 A;  4LFU A;  1W7P D;  1DP7 P;  2XUB A;  1XN7 A;  2VBX A;  5H6R A;  4ZYG A;  2ZFW A;  1YO5 C;  1USS A;  1Z91 A;  1EH8 A;  3WU0 A;  3BDD A;  4LG0 A;  2GXB A;  1SD4 A;  3LFK A;  3KEO A;  3REO A;  3BJO A;  3Q5F A;  4L5J A;  3JTH A;  4L9N A;  1JHH A;  5L3G A;  1O3T A;  3K1M A;  2P7V B;  2W25 A;  2PBI A;  4DNC A;  4XSX F;  3EUH A;  5DYM A;  3ZN1 A;  2ZME B;  3RYR A;  4Q48 A;  4IHS A;  1IN7 A;  2PFB A;  1BC8 C;  2AS5 F;  3T0Y A;  3OOP A;  2K02 A;  3CO7 C;  5EEG A;  3P9C A;  2MD5 A;  1SD5 A;  4ENJ A;  3KZZ A;  5LGU A;  2EV0 A;  2JTV A;  4LK0 F;  4QWQ A;  5LGT A;  3M8F A;  1OPC A;  2PN6 A;  4N9I A;  3ZMD A;  1QBJ A;  3ROU A;  3F21 A;  3GZ6 A;  4G7Z F;  3CO6 C;  2EV5 A;  4CO8 A;  4M73 A;  2AXL A;  4OIO F;  4I0A A;  2VOP A;  3PFI A;  1HW5 A;  2DT5 A;  1R58 A;  1UST A;  1J59 A;  4HX8 A;  3TO9 A;  3IKV A;  4I98 B;  1SAX A;  3K69 A;  2P6S A;  1HSJ A;  1B6A A;  1MJ9 A;  3TO6 A;  3G3Z A;  3M9A A;  2JT1 A;  1WRJ A;  4RGU A;  2A68 F;  1G3S A;  3SXY A;  3QU3 A;  3HRT A;  1A04 A;  2JSC A;  2A3S A;  1BM9 A;  2GXG A;  4P5O A;  1J7K A;  3F72 A;  1PUE E;  1ZH5 A;  5DCM B;  1S7A A;  1QZY A;  1Z6R A;  5D6E A;  4RGR A;  4WX9 A;  5CYV A;  2H6C A;  3F6V A;  2XV4 S;  4OIN F;  3N4M A;  2HYG D;  4IPA A;  4N9H A;  4P96 A;  3KZY A;  3LQR A;  1REP C;  4WCG A;  4ENK A;  2KRF A;  2QZ8 A;  3FXQ A;  4KT5 C;  1DUX C;  4F7Z A;  4MGR A;  4M9X A;  2MBF A;  3K9T A;  2MLK A;  1B59 A;  5F1R A;  1PP7 U;  2UWM A;  1BBY A;  3V4G A;  3HRU A;  2KKO A;  3U2R A;  1HBX G;  4WK8 F;  1Z9C A;  2VC0 A;  4N0B A;  1U8R A;  5ICG A;  4LJZ F;  5ED4 A;  4I2O A;  1IXR C;  2HR3 A;  1G6N A;  2DU9 A;  4KIG A;  1YLF A;  2HWV A;  4KN4 X;  1ON2 A;  1P6R A;  3O2P E;  2BEO A;  2LF7 A;  1VTN C;  1Y0U A;  4UNO A;  4IRI A;  4A6E A;  2ADU A;  2JZY A;  3CUQ C;  2ZKZ A;  1TTY A;  2EFN A;  3GUD A;  4LK1 F;  6PAX A;  4OU0 A;  1OKR A;  1FBU A;  1IUY A;  2VXZ A;  1IN4 A;  2O3F A;  1QQI A;  3K0L A;  2V1U A;  5JI6 A;  2BYV E;  3K1P A;  2A07 F;  2Z99 A;  5AON A;  1U5T A;  3VFZ A;  1P4X A;  2FSW A;  3WOD F;  1YFH A;  2M1B A;  2ZME A;  3E3V A;  1ZRC A;  1NHA A;  4KDP A;  2FOK A;  3GO5 A;  2MA3 A;  5AIP A;  3W6J B;  2A6E F;  2ZJ2 A;  2BV6 A;  5DCF A;  4I0B A;  4R79 A;  4G6D A;  5CVR A;  1SMT A;  2OA4 A;  2IW5 A;  1YQA A;  4OMY A;  2OZ6 A;  1I1S A;  2M30 A;  3I58 A;  3DEU A;  4RGS A;  3W6K B;  2QEN A;  2QBY B;  5J8C A;  3ECH A;  1IN5 A;  4RGX A;  4FX4 A;  1FBQ A;  5FLX K;  1F5T A;  1U2W A;  2K7L A;  4KA4 A;  4LLL A;  3GXO A;  4QLC U;  3HIF A;  5FD5 A;  2QQA A;  4YFX F;  2FBH A;  2NNY A;  3P7N A;  1HKT A;  3F8F A;  1OMI A;  3IRQ A;  5E8I A;  2DO7 A;  1XDS A;  3GFM A;  3HOT A;  1W5T A;  3NQO A;  3WTU C;  1ONV A;  1BI3 A;  1BI0 A;  4MQV A;  3ZP5 A;  4BH9 A;  3WGG A;  4KMF A;  2IT0 A;  1I5Z A;  4Q47 A;  1W7P A;  1ZRF A;  5FFZ A;  2GZW A;  2CQK A;  2M87 A;  3FMR A;  4BYY A;  3HYI A;  4YG2 F;  2QWW A;  4L0Y B;  4ZZD A;  2XAG A;  1UFM A;  3PQK A;  3VB2 A;  1O3S A;  2Y75 A;  4RB1 A;  4L5I A;  4WXC A;  3J81 Z;  4G6Q A;  1GVJ A;  1IN6 A;  2W57 A;  2A6H F;  5K5O A;  3MQ0 A;  5HVQ C;  1G3W A;  3NRV A;  4HDU A;  1KU9 A;  4HLY A;  5D4R A;  5LBQ A;  1ZGA A;  4UXN A;  5BOX A;  2YU3 A;  3VOD A;  3WTZ A;  1TBX A;  3HUG A;  1IZ1 A;  2IA1 A;  1MJB A;  1WWX A;  3MEX A;  3ABU A;  3RKW A;  4R8H A;  3FXU A;  2LDU A;  1ZLJ A;  4LGW A;  4GXO A;  2P5V A;  4JBA A;  1WSU A;  5IT9 K;  2XKO A;  1T38 A;  3R0A A;  4Y15 A;  1G3T A;  4E70 A;  1GXP A;  2CW0 F;  5L3E A;  4OIR F;  3COA C;  3HSF A;  1T2K A;  2LKP A;  1IXS B;  3JSP A;  5HDK A;  3HRM A;  2DI3 A;  2JPB A;  2ZXJ A;  1FNN A;  5JR3 A;  3I59 A;  4EGZ A;  2HDC A;  3F8M A;  1TQI A;  4KIC A;  5L3C A;  1T0F A;  3C3W A;  3L2C A;  3KLN A;  4RB2 C;  1MZB A;  1QZZ A;  2F5F A;  1FYL A;  5DCM A;  1LEA A;  2D1H A;  5DD8 A;  2FF4 A;  5BMZ A;  4KFC A;  3GW2 A;  3MCZ A;  1TNT A;  2L4A A;  2CSO A;  5LRR A;  1IAW A;  5DD4 A;  5HS8 A;  3ZMU A;  1XGM A;  3BPX A;  2RV8 A;  2QUF A;  1U3E M;  2FU4 A;  3I0T A;  2FRH A;  1ZLK A;  2ZBK A;  1J0R A;  2HKX A;  2CFX A;  3HTS B;  3BJA A;  2V1D A;  3F6O A;  2JPC A;  3T8R A;  2CYY A;  4M9Z A;  1U78 A;  3CJN A;  5JFR A;  4K2E A;  2Z9O A;  1ZYR F;  2FE3 A;  2PMH A;  2O0Y A;  5EEH A;  2WWY A;  2IP2 A;  4MTD A;  2Y48 A;  3GZ5 A;  3R4K A;  1KU3 A;  2F5E A;  4XSZ F;  5A2Q Z;  4RAZ A;  1K78 A;  4ZYH A;  2EK5 A;  4CHU A;  2XAJ A;  4AIH A;  4BAY A;  3V7C A;  3EYY A;  4ZZL A;  3FMQ A;  4UHT A;  3WTX C;  2L01 A;  1O3R A;  1QGP A;  2H27 A;  3LA3 A;  1B4A A;  4KIB A;  2QM3 A;  2NS0 A;  2KIU A;  1HXD A; 
#chains in the Genus database with same CATH topology
 5ICF A;  3L2W A;  2VPL A;  2DOD A;  2ZXH A;  3DXJ F;  2COM A;  2HKO A;  3ABK H;  5BNG A;  3E5U A;  1I1G A;  2XHK A;  5LLQ A;  2TRT A;  2NYX A;  4PGH A;  5FLX Z;  2VE8 A;  1MND A;  2RRE A;  2Q2E A;  3BTC A;  3T5X A;  2NVU B;  3QPL A;  2PMU A;  2X0L A;  1E17 A;  2DJN A;  2QVO A;  3K70 D;  2H6B A;  3KEQ A;  3I4N J;  3KP4 A;  2STT A;  4L0Z B;  2KT0 A;  2DXI A;  1FTZ A;  3H9G A;  2X6Y A;  2W85 A;  2JSP A;  3CES A;  3QWL A;  4HF0 A;  4PGG A;  2JRT A;  4A3M J;  1FSE A;  3BPV A;  4I01 A;  3P9K A;  5FGM A;  1ZR2 A;  1N75 A;  3MAJ A;  3WTW C;  2ESH A;  3SHF A;  1CF7 B;  3OIP A;  2E7W A;  1D5V A;  1JKP C;  1YS6 A;  2BY2 A;  2QBY A;  4QPQ A;  3D5R C;  3L2V A;  4D7M A;  3GTL J;  1HDD C;  2IRF G;  2W24 A;  4L18 B;  1WHU A;  4E7Z A;  3LWF A;  4G6T B;  2JVG A;  3MKZ A;  3JRI A;  4HQE A;  1HST A;  3M8J A;  5E1Z B;  4GO1 A;  1K6O A;  2ZXI A;  5ERI A;  1OCO H;  1BI1 A;  2M7B A;  2H8W A;  3DPT A;  4PZJ A;  4F52 A;  5L3F A;  4EM1 A;  5J47 A;  1J2X A;  3J80 K;  2A69 F;  2RNJ A;  3SEZ A;  3SDB A;  4II2 A;  1FIA A;  3FIS A;  2E7X A;  4AVP A;  1R49 A;  5GTH C;  2HYJ A;  2F4M B;  2V1N A;  1J5Y A;  3HOU J;  1R5H A;  4B43 A;  2OC6 A;  1S8N A;  3PO3 J;  5K7Z A;  2Z1D A;  2OTJ I;  3F23 A;  3BCA A;  1RC9 A;  1BL0 A;  2DA3 A;  1Y0N A;  4I7H A;  2HOA A;  4KUM A;  4B09 A;  3UKG A;  2DQL A;  2XRL A;  3LSH A;  2ELH A;  3B73 A;  3I54 A;  1G59 A;  3TGN A;  3W2A A;  2VOD A;  4XBF A;  2KLO A;  1XC5 A;  3G1L A;  2RN7 A;  2B9S A;  4BNC A;  1OCT C;  2R93 J;  3HSE A;  2FBK A;  3AG2 H;  3H1C A;  2OD5 A;  3BTJ A;  4LIT A;  4A3L J;  3T1B A;  2CO5 A;  3FHN A;  4XL9 A;  2I8D A;  4BHB A;  3J81 K;  1VQO I;  4CDG A;  4DQ2 A;  2GLO A;  5GPA A;  5BPI A;  3BG7 A;  3JAM Z;  4OOI A;  3CJQ B;  4IRH A;  1SD7 A;  1M1E B;  3CLO A;  1IV8 A;  5FKK A;  1LQ1 A;  1TQM A;  2ECC A;  2R5Y A;  2DW4 A;  1XMA A;  2VBW A;  2ME0 A;  1TNS A;  2N8G A;  5CLS A;  3BJ6 A;  3BQZ A;  1TLH B;  1WQ2 A;  5KHD A;  3C2B A;  4V19 K;  3MFK A;  1MDM B;  4XN3 A;  3WTS C;  4R1H A;  2PEX A;  4ENM A;  2CV2 A;  3Q3S A;  2MG4 A;  2EB7 A;  5H20 A;  4J01 A;  4ZTF A;  3OS0 A;  2F2E A;  4F92 B;  2R7O A;  4ZYE A;  3LMM A;  1WKM A;  3R6S A;  2HTJ A;  4KN7 X;  4BQO A;  3RCO A;  1IJW C;  2NNN A;  2VI6 A;  4BBR J;  3F8B A;  2ACJ A;  3WHC A;  4NC8 A;  2YPR A;  3TO7 A;  2EV6 A;  1BJZ A;  1O7L A;  2Y30 A;  3I5U A;  3KYL A;  4ANJ A;  4F91 B;  3FXR A;  2QA4 I;  3H0G J;  1JT0 A;  2G7H A;  3OYL A;  5CVV A;  2VBZ A;  3SZT A;  5B1B H;  3HPH A;  3VSL A;  3DPL C;  4O6J A;  1CGP A;  4EV0 A;  3E5X A;  1UCR A;  5K1Y A;  3MMY B;  4ENN A;  2ZCW A;  2OZU A;  2VON A;  1BW5 A;  2DFE A;  3H9J A;  5JVT A;  2IGK A;  5IT9 Z;  2PJR B;  1HC8 A;  2OCC H;  2PMZ N;  3A0H C;  2RGV A;  5HLG A;  1TWG J;  1MSE C;  4U0W A;  5BQT A;  3KX2 A;  3Q0V A;  1SEU A;  3I53 A;  3ASN H;  3RPQ A;  3ABT A;  2F4O B;  3FM3 A;  3K4L A;  4PJJ A;  3KP2 A;  1ZRD A;  5E20 A;  3K4J A;  1BIA A;  3ZMZ A;  3Q0U A;  4RDU A;  1BR1 A;  4ON0 A;  4A12 A;  2QQ9 A;  3F8N A;  1Y8Q B;  3CJR B;  4JX4 A;  4OIQ F;  3GFI A;  1RIO H;  4W97 A;  1PP8 F;  2X85 A;  2RKH A;  4XOR A;  2LOO A;  1S29 A;  2E2I J;  2Y0S A;  1ZR4 A;  2KMU A;  1ZAO A;  3UR3 C;  2M45 A;  4F93 B;  1IO2 A;  1LVK A;  2ZO4 A;  4A0Z A;  2CQ7 A;  1QO0 D;  2Q8K A;  2R0Q C;  1ZG5 A;  5F6F A;  5J3L A;  1PUF A;  5ILU A;  4FCY A;  3OYI A;  1X1C A;  5GAH J;  3DKW A;  1BC7 C;  4LG0 B;  3E6B A;  1MBK A;  3QOD A;  1MMS A;  2K86 A;  1PDN C;  3AL0 B;  2XAS A;  3DLA A;  3BG9 A;  1XSD A;  3V8L A;  2X6W A;  2X1C A;  5E1W A;  3SJM A;  3RZD J;  4A2U A;  1PJR A;  5E1X A;  3E0J B;  3A02 A;  3S3M A;  3ULQ B;  1X1D A;  3CDI A;  1KYW A;  1H9G A;  5GP9 A;  1NG6 A;  2BW3 A;  5HS9 A;  3GF2 A;  2Z3Y A;  3L00 A;  1LKX A;  5FB2 A;  2HFH A;  4B44 A;  4PDK A;  1T08 B;  3GX4 X;  4CYD A;  1TWF J;  2Q2E B;  1FPQ A;  3K2Z A;  2YX7 A;  1HCR A;  1MD0 A;  2IA2 A;  1FLI A;  3E6M A;  3G1M A;  3CMM A;  3U9G A;  1ZKG A;  5FD6 A;  2Y2Z A;  2WV1 A;  4HA8 A;  1P4A A;  2V9P A;  5HS7 A;  4FX0 A;  3G71 I;  2KP6 A;  4RBO A;  3BG3 A;  4A0X A;  4CXF A;  1FSH A;  1RET A;  1B1B A;  3RTR A;  3C2G A;  1HW1 A;  1B72 A;  2WV0 A;  1JE8 A;  1CF7 A;  1WJ5 A;  3CCY A;  3E5Q A;  2BXZ A;  3WGH A;  2A6T A;  2VL8 A;  4BAC A;  1OYW A;  2UXN A;  2XGD A;  3UNG C;  1L3L A;  5D5X B;  1PVE A;  3OYH A;  3BY6 A;  4GRI A;  3I64 A;  3LSI A;  3JTG A;  3VEP A;  3D1N I;  2X4H A;  3PSI A;  2KJB A;  1LEB A;  4HAM A;  3CP8 A;  3F9K A;  3J7Y J;  1DPU A;  1U5T B;  4XKC A;  3EET A;  5CQG A;  4MTE A;  1HA8 A;  3NAU A;  4NHJ A;  1YW7 A;  2PLY A;  3TDZ C;  5HOD A;  1XGS A;  1FC3 A;  2DYR H;  5D4S A;  1XTA A;  1H89 C;  2ZJQ F;  4BDZ A;  3JSO A;  3BLY A;  2LR8 A;  3BR0 A;  3E97 A;  1ETO A;  1L0O C;  2H09 A;  5EZG A;  3RDI A;  1D0Z A;  3CC7 I;  2DMU A;  3QOP A;  2QLZ A;  3AFH A;  1S7E A;  2ZJR F;  4D7N A;  2HXI A;  2P5L C;  2OPT A;  3ZMS A;  3F22 A;  4I02 A;  1IRX A;  5M3M J;  4JOM A;  2F5V A;  3TQN A;  5JHU A;  2Y31 A;  3K4M A;  3CDL A;  4RM3 A;  3GVA A;  2VLA A;  3KET A;  1G3Y A;  2VQH A;  1F1Z A;  2W00 A;  3FIW A;  3KCC A;  3LAJ A;  1RUO A;  3C1D A;  2O61 A;  1AKH B;  2NAZ A;  5CQE A;  1MGT A;  1R4M B;  1D0X A;  4G7H F;  2P6T A;  3HL2 A;  5F04 A;  1R1V A;  3QP5 A;  4YIR X;  1KU2 A;  5D8K B;  2E71 A;  5B1A H;  5IOZ A;  1AHD P;  1IUF A;  4ESF A;  3ZPL A;  3QRF F;  1U5T C;  1H9T A;  1MW7 A;  2L5Q A;  1OCZ H;  2X1D A;  2XIG A;  1S6L A;  2DPU A;  1YS7 A;  3GFJ A;  5C4J J;  2GOM A;  4XKB A;  1VQN I;  2V6E A;  1EF4 A;  4HLX A;  1X2M A;  3ZQL A;  3PFY A;  1K78 B;  1MJA A;  2KQR A;  4BGD A;  4IOA F;  1LDJ A;  1A35 A;  4HF2 A;  1WH5 A;  4WF2 A;  4DW6 A;  1W0U A;  4A5N A;  1R22 A;  1ENH A;  1V55 H;  3RQ4 A;  2WAD A;  1JUP A;  5KCM A;  3FWE A;  3RKY A;  2XRN A;  4IVN A;  1MBF A;  4YIF A;  3A1Y A;  3BZC A;  3IC7 A;  3W2W A;  4BKX A;  3WU1 B;  4IZZ A;  1ZRE A;  2O8X A;  2Y69 H;  3CCV I;  3LST A;  3KP7 A;  2R5Z B;  3HSR A;  2JA6 J;  4UVC A;  2EA4 A;  2FBI A;  3FXJ A;  3BR1 A;  3OMY A;  4CGZ A;  4RLF A;  2ID3 A;  5M5X J;  2XVC A;  2LRD A;  4M6Y A;  3RKX A;  5DEQ A;  2BHY A;  2K9L A;  4AYB A;  2E1N A;  2IJL A;  2VUM J;  5E17 F;  3S2H J;  1UMQ A;  2RDP A;  3OYC A;  1XS9 A;  4OAY A;  2IEK A;  4A0Y A;  1AKH A;  2W84 A;  2DBB A;  5E3O A;  3HOS A;  3W6V A;  2M34 A;  4UUS A;  1XMK A;  2RAE A;  5FKN A;  2DK5 A;  1IRF A;  2VT2 A;  2ELJ A;  3CCS I;  2EFP A;  1RES A;  1JI8 A;  3S15 J;  2WA0 A;  1V54 H;  3HC7 A;  3BP8 A;  4BE2 A;  1QZE A;  1FYM A;  1XSX A;  2CFO A;  4X0G A;  2DA6 A;  2F5D A;  4ZDL A;  5DTD A;  1HQC A;  1IW7 F;  2DOE A;  2LVS A;  4M3F A;  1ZN2 A;  4W1U A;  1KQ8 A;  3HGG A;  3KE2 A;  2NVQ J;  3RIR A;  4CH7 A;  2EIK H;  3JRF A;  2ZSI B;  3GLL A;  5IYD J;  3HKZ N;  1UB9 A;  1OCP A;  3PNT A;  4RAY A;  4IHT A;  3H3Z A;  3N97 A;  5EEA A;  2EH3 A;  5TGT A;  5ILV A;  5D5U B;  1MBJ A;  3L9F A;  2BW3 B;  4IOC F;  3RYP A;  1R36 A;  2CGP A;  4XKV A;  1A31 A;  2WAE A;  3OIQ A;  3PM1 A;  3DLL F;  1LNW A;  4FQG A;  4J00 A;  2P0W A;  1PUF B;  4XRS A;  4L9V A;  1D0Y A;  3K4C A;  1AA7 A;  3Q9V A;  3ZOB A;  4G9Y A;  3BQY A;  4IHY A;  1TP4 A;  2MGQ A;  4I6Z A;  5E3N A;  4JP0 A;  4MQ9 F;  2HZT A;  2FNP A;  2LYC A;  4M6X A;  1W1W E;  2IVM A;  1WPK A;  1RNL A;  1JT6 A;  4ZH4 F;  1OIS A;  4CIC A;  2L54 A;  2PQ8 A;  3MZ8 A;  3SYT A;  1WVR A;  3CCR I;  3BOQ A;  1FWZ A;  3QP6 A;  3PO2 J;  2MLG A;  2Y9Y A;  3FKI J;  1APL C;  1MH3 A;  4HV5 A;  5L3B A;  1W5S A;  4XIC A;  1YW8 A;  1A6I A;  1V5G A;  3DU6 A;  3BWG A;  3WTT C;  1BI2 A;  2XF5 A;  3KP3 A;  5LD2 C;  4KYW A;  4RMN A;  2CJJ A;  4BQA A;  5CVI A;  2EPF A;  3CCQ I;  2VJI A;  1TWH J;  4CZZ A;  4HDV A;  4HQM A;  3TBI A;  4D5C A;  4QSH A;  3C7J A;  1EH6 A;  1D1B A;  5J6X A;  3AKZ A;  3KP5 A;  1VND A;  1TT5 B;  2IGM A;  2H94 A;  3HUG B;  3LSM A;  2Y0S N;  4NB5 A;  4P55 A;  2XAH A;  2AQF A;  5K5Q A;  1I6X A;  2F5C A;  1LVA A;  2KJC A;  3AL0 C;  4ESB A;  4M71 A;  2LP0 A;  5HLI A;  3F3X A;  5ILS A;  3VYU B;  2FEZ A;  4JK1 X;  4BL0 B;  4GGG A;  1P92 A;  1JHF A;  2MH9 A;  4ZTJ A;  2I10 A;  4HF1 A;  5LEK A;  1ZG1 A;  3M3Y J;  3GWZ A;  4O5V A;  2W7N A;  1TWA J;  1TQP A;  4I09 A;  1VF9 A;  4KMU X;  1LJ9 A;  1MBE A;  2A5W A;  4DZJ A;  4AIK A;  1VFC A;  4MIM A;  5D5V B;  4BEH B;  1ZGW A;  2XSD C;  4U7D A;  4FE7 A;  4BQN A;  2HQ5 A;  2OTL I;  2GIV A;  3K6G A;  2ID6 A;  2VXD A;  5FLM J;  3Q9S A;  2DQR A;  2G7U A;  4S05 A;  5KVR A;  1Z3X A;  3H3V K;  4A3C J;  1OYI A;  2JUG A;  2B63 J;  1AU7 A;  2PJR A;  3Q0W A;  2VT3 A;  2RC4 A;  3WG9 A;  3KP6 A;  2ELK A;  2FQ3 A;  2E1C A;  2UXX A;  2O5R A;  3OYM A;  1F36 A;  3CMA I;  1ULY A;  4LB5 A;  2WTE A;  1IRZ A;  2ZME C;  2Q0O A;  3BZ6 A;  2R4G A;  4FET A;  1S7O A;  2WY8 Q;  1R6R A;  1JTY A;  3ISP A;  3J7A Y;  1XCB A;  4HG2 A;  1T95 A;  9ANT A;  3E6C C;  3OSG A;  2QKL B;  1C0W A;  4KNY A;  4HNU A;  3FF5 A;  5E18 F;  1GXQ A;  1WZ2 A;  5TIS C;  4ZC3 A;  3FHZ A;  5DDG A;  4CCL A;  4RS8 A;  4FIS A;  4RA2 A;  4FHT A;  1KQ0 A;  5GAE J;  2IAI A;  2BBY A;  2DMQ A;  4S04 A;  4HRI A;  2BOL A;  2IS2 A;  2CH0 A;  2Y0M A;  3ZMT A;  2FML A;  3IH3 A;  3BTL A;  5CPR B;  2VN2 A;  3SZP A;  3CF5 F;  5C3E J;  5DM7 F;  2OV7 A;  4H4K C;  2YUS A;  1UG2 A;  4EM0 B;  3BG5 A;  3ZR8 X;  3IKT A;  3QPT A;  4EMS A;  4Y3O A;  4LB6 B;  3O8H A;  5FFX A;  1IRG A;  1QPM A;  4ETS A;  2VKE A;  5DUK A;  4RM2 A;  3CMY A;  1WJA A;  1IC8 A;  1TW2 A;  2GA1 A;  1R23 A;  3IAS 2;  2EZH A;  3QAH A;  4RB3 C;  1MIJ A;  2UV1 A;  1U0J A;  4EM2 A;  4Q5S F;  4EJT A;  2M0M A;  3HZJ A;  2KIQ A;  2PX9 A;  4HZF A;  4WXD A;  3RI4 A;  1XD7 A;  3DV8 A;  4U0Y A;  2DA4 A;  3HHG A;  3ERM A;  4AM3 A;  3K1N A;  4CA0 A;  3WTY C;  2YX4 A;  2MAB A;  3C18 A;  3LSG A;  1I27 A;  1KYZ A;  2XRO A;  1JGS A;  4AIJ A;  2MD0 A;  4Y13 A;  2GA2 A;  1P4W A;  4M6V A;  2PJP A;  3GTG J;  3MZH A;  1KU7 A;  5ICE A;  1SVM A;  1ON1 A;  3P5J A;  3QU6 A;  1AOY A;  3F8C A;  3LA2 A;  2LF8 A;  3DTE A;  4D5F A;  2JQ7 A;  3M7G A;  4PJN A;  1I6H J;  5B5E C;  3LSP A;  3ELK A;  2DLL A;  2HEO A;  1YOV B;  2DFH A;  3S3O A;  1YIO A;  2DA1 A;  4ZDP A;  3CUQ B;  5E79 C;  5J1U A;  1Y6I A;  2EA2 A;  1K79 A;  1FJL A;  3B02 A;  5F64 A;  3S1Q J;  1FP1 D;  4D0P A;  1P9Q C;  1VQ7 I;  1RZ4 A;  3DKY A;  2YU9 J;  5AIQ A;  4HYE A;  4XID A;  1JTX A;  3DF8 A;  3LSJ A;  2XF6 A;  3V7S A;  4DBQ A;  4AD9 A;  3GZN B;  4BUP A;  3B6C A;  1XGO A;  2DN0 A;  4KIF A;  1UHW A;  3IRR A;  4IRG A;  1JUS A;  1Z05 A;  2V79 A;  3KFW X;  2R7R A;  1IV6 A;  4A3B J;  2L02 A;  3JW4 A;  1WI9 A;  3JRB A;  1A36 A;  3EDP A;  2HVQ A;  5D6F A;  4HOB A;  2DAO A;  3IV5 A;  3OIO A;  2BY0 A;  2FXA A;  2O6G E;  2QGU A;  4PK4 A;  1DDN A;  1MKM A;  2EWN A;  1LFU P;  4F55 A;  2HTS A;  1FIP A;  1YHQ I;  1YE9 A;  1MMA A;  3JR9 A;  2OAZ A;  1WFX A;  1WJE A;  2EQR A;  2TDX A;  2LRE A;  2YR2 A;  2XAQ A;  3H0D A;  3A01 A;  3R0J A;  1N77 A;  3KLO A;  3MWM A;  1D8J A;  2E19 A;  3BTI A;  4O3M A;  2ZFU A;  1TW3 A;  4UY8 I;  1QA6 A;  5CVU A;  2KZV A;  4GYI A;  1O4X A;  2HQA A;  1TZL A;  2L9S A;  4A93 J;  2KRC A;  1R9T J;  3CUQ A;  1FTT A;  3IH4 A;  2L4M A;  2DTZ A;  1UAA A;  2HOE A;  1HKS A;  2LMD A;  1W0T A;  4CCJ A;  2ZXW H;  5EJC A;  3P9I A;  2CUE A;  4XNF A;  2H1K A;  2ETH A;  3H5A A;  2BE5 F;  3QYB A;  1Z6T A;  4L9T A;  2Z33 A;  1D3Y A;  2EFW A;  2GAU A;  5KK1 A;  2EFQ A;  3TDU C;  2RQP A;  3SQN A;  1A5J A;  2FMY A;  1HOM A;  3SFZ A;  1YTY A;  4P9F A;  1VQK I;  1RKW A;  1FZP B;  1B9N A;  2J5P A;  5JHF A;  2NOG A;  3FMS A;  1IDY A;  1RPW A;  3FZV A;  1H8A C;  3CDH A;  2OBP A;  4E7H A;  1KZH A;  4B8X A;  3QPH A;  1GVD A;  3HKZ A;  4ZYA A;  1FX7 A;  5EG0 A;  3G6E I;  3FK7 A;  4BXU A;  4F3Q A;  1FP2 A;  4A6D A;  2XKP A;  1YG2 A;  1X58 A;  2GOX B;  3QYF A;  3QPS A;  2R5Z A;  3LAP A;  2R7X A;  4NC6 A;  1XSV A;  1Z77 A;  4RAG A;  1LB2 A;  1YX3 A;  3I9V 2;  3EQL F;  2UUZ A;  1U9N A;  4MEY F;  3BC8 A;  4EGY A;  2FX0 A;  5M5W J;  2CQN A;  2X6X A;  5KAF C;  2QSF X;  3DFG A;  3ABL H;  1R5G A;  3OYG A;  4U87 A;  3FXO A;  3R61 A;  3AAF A;  4PSX A;  2OU2 A;  2G9W A;  4A3F J;  5DUI A;  1K61 A;  1B72 B;  4U7B A;  4AVZ A;  2CRG A;  2PMZ A;  2QF7 A;  2IGO A;  5F27 A;  3DTI A;  2G0E A;  3OWT A;  2HS5 A;  2A5Y B;  3HGY A;  5E8G A;  1S72 I;  2DFI A;  5LHI A;  3WTV C;  1QVU A;  2ZC2 A;  3G73 A;  3DWL E;  3PNV A;  2XDV A;  1DU6 A;  1MBG A;  2F6C A;  1D8K A;  1WGX A;  1HW2 A;  3ECO A;  4HV6 A;  3K10 A;  2HPM A;  4WXH A;  1QU3 A;  2EIN H;  1B9M A;  1Q1V A;  3ERE D;  2XSJ C;  5LHG A;  4EJV A;  3KZI C;  1DPR A;  3DBR B;  1QNT A;  2V6C A;  3L1P A;  1F9N A;  5IP9 J;  2M9H A;  2D45 A;  4MFD A;  3U1D A;  2FNA A;  2XGX A;  3E1S A;  3DU5 A;  2PI0 A;  4DZP A;  3RKQ A;  1KON A;  2HQN A;  4U0V A;  1WJF A;  2DOA A;  3NWS A;  2EZL A;  4Y7N J;  1UHS A;  2ZSH B;  4V2F A;  3D5L A;  2V9V A;  2W4S A;  4GDF A;  5LRS A;  2H1L A;  1IGN A;  1TWC J;  2M7A A;  5IP6 A;  2KPM A;  3VOE A;  4UVA A;  1EA3 A;  5F1J A;  5D8L B;  3V7R A;  2RVC A;  5DM6 F;  4YFN F;  2NRA C;  4XOP A;  2BY1 A;  4MHG A;  2C6Y A;  1V4R A;  1EH7 A;  3H35 A;  2HYF A;  3PUB A;  1FEX A;  3TED A;  3ZXS A;  1S9H A;  3A2K A;  3HOY J;  1STZ A;  4HW0 A;  4IJA A;  4IXA A;  1W7P B;  2GWR A;  2K9M A;  1FYK A;  4D1Q A;  2DCE A;  2B0L A;  2VB6 A;  4OIP F;  2VOO A;  2VKD A;  4BHP A;  2VQG A;  4XR6 A;  3RPU A;  1Z21 A;  1ZHF A;  1G8X A;  2DA7 A;  4N4O B;  4XQF A;  3TOB A;  1FOY A;  3LNQ A;  3GYH X;  1T39 A;  2VE9 A;  2ZNZ A;  2BVM A;  2WY7 Q;  1MMN A;  1E3O C;  4E4H A;  2DTR A;  3HRS A;  2JVH A;  5FO5 A;  5J8F A;  3LA7 A;  1X3U A;  3JAM K;  3PL8 A;  5A2Q K;  5C44 J;  2K40 A;  1FT9 A;  3AG1 H;  1UZC A;  4LMY A;  2OQG A;  3WE2 A;  3D0S A;  1JGG A;  4LLN A;  2L2O A;  3G1O A;  5FKO A;  3V8K A;  1E2X A;  3S2W A;  3J80 Z;  3GTQ J;  2R92 J;  3DP7 A;  4M74 A;  2WB1 A;  4G94 A;  1X1P A;  1G4D A;  2P7C B;  1BIB A;  2XPW A;  1ETW A;  2O03 A;  4LD5 A;  1SFU A;  2P4W A;  4AC0 A;  2HZD A;  1OCR H;  3FBN B;  5H6Q A;  3I71 A;  2GQQ A;  3RQI A;  1ZG3 A;  4E6K G;  1Y39 A;  1RI7 A;  3PQJ A;  1QPI A;  2LY1 A;  1JXS A;  3M07 A;  4M3D A;  4BY7 J;  2K4J A;  3NAR A;  1YRN A;  1R1U A;  1E3P A;  1O7F A;  1R1T A;  2K85 A;  1ZGJ A;  4HSR A;  4AWX B;  3R60 A;  3L09 A;  1K7A A;  3IWZ A;  3DBH B;  2D2W A;  3HB9 A;  2MH2 A;  3S93 A;  1IN8 A;  3OS1 A;  2M5W A;  1VQ8 I;  2OJE D;  4EVI A;  3HDD A;  4XLP F;  2Z5U A;  1MBH A;  1QVT A;  4ZYD A;  1WCM J;  2V4J C;  2X1E A;  3ZMV A;  5LGN A;  2JA2 A;  4BY1 J;  2F4I A;  2CS3 A;  4DYQ A;  3HM5 A;  3I4P A;  3GEZ A;  2HGC A;  1H88 C;  3U1K A;  5CJ9 A;  4D9J A;  1AWC A;  3OSF A;  1EV7 A;  3K70 C;  2XF7 A;  4II3 A;  4YII A;  1SFX A;  2D1V A;  4ZJZ A;  1B8I B;  2JA8 J;  5LFA A;  1KQ9 A;  4PCQ A;  4CCK A;  2WC2 A;  2FUG 2;  4EQQ A;  1W36 C;  5D5W B;  4G7O F;  2R3S A;  3CME I;  3V42 A;  2DPD A;  5FJ8 J;  1LPQ A;  4CZC A;  2P5K A;  5EGO B;  2HQR A;  3MVP A;  3TOA A;  1FBS A;  1IF1 A;  4Y52 J;  5K5R A;  1GLN A;  1X4O A;  4JQF A;  1IDZ A;  1YIT I;  1O3Q A;  1XDU A;  3DEE A;  1HF0 A;  3PIP F;  3DQV C;  3OV8 A;  1F4K A;  2MFZ A;  1Z1D A;  3BRO A;  4J19 A;  3OYK A;  1Y1V J;  2L7M P;  3S1M J;  4GCV A;  2KZG A;  4JX5 A;  4MNU A;  5LEJ A;  4OAZ A;  1U6G A;  3VSK A;  3WGI A;  1ODD A;  1LDD A;  1NK2 P;  1OYY A;  4M72 A;  1OR7 A;  2VQL A;  1ETY A;  4HEA 2;  1SFE A;  2BGC A;  5IY5 H;  2R7D A;  1O57 A;  3T8T A;  3S32 A;  2STW A;  1V5E A;  2CU7 A;  3GTM J;  4OMZ A;  1UJ8 A;  2UZK A;  2ZJP F;  4ESJ A;  1LFB A;  1BR2 A;  1LDK B;  1FOK A;  2M8G X;  2LKS A;  1HDP A;  2MW8 A;  2LSO A;  2OQR A;  3RJP A;  5JLX A;  1TT0 A;  4U88 A;  4XLH A;  5JVG F;  1QHG A;  2VBY A;  5HNF A;  4UUV A;  1WJB A;  3KYC B;  1FOW A;  2V7F A;  2V1X A;  2LBF B;  3OY9 A;  1SMY F;  3HOW J;  3I59 B;  5HLH A;  2DMT A;  2E1M B;  4PJM A;  5HOO A;  3CCM I;  1HKQ A;  2ME6 A;  2J5O A;  3ZQ7 A;  4PUS A;  5HDG A;  4XN0 A;  4UB6 C;  3F0C A;  4PJL A;  2VJ5 A;  4BXX J;  4ASN A;  2IA0 A;  1BR4 A;  1Q1H A;  3IHU A;  5L3D A;  4RB0 A;  4UV9 A;  4KIS A;  4YEJ A;  2L3D A;  2ICW G;  1MNE A;  2M8E A;  4MEX F;  1S3J A;  4KIT B;  3L7W A;  3M8E A;  3K4K A;  1VQ9 I;  2MC3 A;  4AUX A;  3D5S C;  5C4X J;  3IUO A;  4UV8 A;  3GTO J;  3BT9 A;  5IT3 A;  2X6O A;  2EFO A;  1VQ4 I;  2ISZ A;  3ML6 A;  3QQA A;  2NS7 A;  1P7I A;  2PG4 A;  3MZY A;  4Z2Y A;  4NQW A;  4A5M A;  3H9Q A;  2K4B A;  3OYD A;  1P2F A;  3O3K A;  2FA5 A;  4M9S A;  5HDN A;  4LLG F;  1DGW Y;  5LHH A;  3DBL B;  4XLN F;  2R7W A;  3NEU A;  2E36 A;  2AHQ A;  4N4N B;  1I39 A;  2EZK A;  2LK2 A;  1WJC A;  3ZN0 A;  3FM5 A;  2A61 A;  2FQ4 A;  3QYE A;  5DV5 A;  4BHC A;  4XMY A;  4G12 A;  3FK6 A;  5TRD A;  5BPD A;  5BS6 A;  4Q4Z F;  5EZH A;  4WWC A;  1ZAR A;  2ZNY A;  2P8T A;  3DCF A;  2LY2 A;  4Y17 A;  1H0M A;  1JJ6 C;  3HHH A;  1BA5 A;  4UUS B;  1R00 A;  3BG6 A;  4XRF A;  3M1E A;  2MC4 A;  2YSR A;  3H3U A;  4YRV A;  3V8J A;  1SD6 A;  1XG1 A;  1BOA A;  2NVX J;  5J1R A;  2KIF A;  3CCL I;  4DYR A;  4HBL A;  2QYO A;  3JRD A;  2CWE A;  2KIM A;  5TJJ A;  2W1O A;  5F08 A;  5IOY A;  1YYV A;  1NH3 A;  1BOB A;  5CVJ A;  2VQC A;  4A3E J;  3KPH A;  1X1A A;  3EUA A;  4FT8 A;  1ZTR A;  4C2T A;  3E6D A;  1XGN A;  3CTA A;  4GYG A;  1YW9 A;  4X1E A;  1K6Y A;  4YEL A;  2CG4 A;  3TW7 A;  3TKY A;  3H92 A;  2BY3 A;  1J75 A;  3JRH A;  1X3W B;  1Z7U A;  1IXC A;  1BJA A;  1I3A A;  2EJR A;  3CF2 A;  1MDM A;  1GHC A;  1T98 A;  2K27 A;  1UHM A;  1ZEL A;  2DK8 A;  4CCM A;  1LE8 A;  4OWR B;  4Y33 A;  3PIO F;  5FLV A;  2E34 A;  2IPQ X;  5IPA A;  4XLC A;  4B1R A;  4JYK A;  4A3J J;  2BZT A;  1J9I A;  2R7F A;  4P9U A;  2VC1 A;  1BN5 A;  4QPO A;  3A03 A;  1FY7 A;  4HX4 A;  4BBS J;  5GPC A;  3OYN A;  3HTU A;  3FX3 A;  4QIW N;  4IHW A;  2LNB A;  4P1W A;  4NNJ A;  5ICC A;  2HI3 A;  2LFB A;  2XAF A;  4BE0 A;  3VYS B;  1U8B A;  4EJO A;  1W4M A;  1PYV A;  3LQQ A;  1XCV A;  3J7A O;  4IF4 A;  4TV7 A;  1KA8 A;  1KGS A;  1RUN A;  3EYI A;  2ZB9 A;  3BR3 A;  2JK3 A;  4HX7 A;  4XM3 A;  1XB4 A;  4C9Y A;  2QQB A;  1SVO A;  3LL7 A;  3GLX A;  4HST A;  3WE3 A;  3JRE A;  1T0F C;  1SFO J;  4G8X A;  4RLQ A;  3GFL A;  2K9N A;  1OJL A;  2ISY A;  4B4C A;  4EJU A;  3E7L A;  3S17 J;  3OYB A;  3BR2 A;  3CUO A;  3VWB A;  1R7J A;  4X6A J;  4IL6 C;  3IWF A;  2ESN A;  1WJD A;  4H0E A;  1T6S A;  4EJW A;  2EZI A;  5FRO A;  4L9J A;  4YFK F;  1B8I A;  3HOV J;  4UVB A;  2JA7 J;  1V3F A;  3O6B B;  3IL2 A;  3ZQI A;  1GDT A;  2FOW A;  3AG3 H;  4LFU A;  3H36 A;  1W7P D;  1DP7 P;  2XUB A;  4LOC A;  1XN7 A;  2EIJ H;  2CUJ A;  2VBX A;  5H6R A;  3CC2 I;  2KFD A;  3RPU D;  4ZYG A;  2ZFW A;  1YO5 C;  4DIQ A;  2H8R A;  1USS A;  1K4S A;  1MMD A;  1EH8 A;  1Z91 A;  2WAQ N;  2EBI A;  3BDD A;  4LG0 A;  2KL4 A;  3WU0 A;  4FTH A;  1J09 A;  1TC3 C;  5K7H A;  2GXB A;  4B47 A;  2O7O A;  5B3S H;  1SD4 A;  4Y4R A;  1DGR M;  3LFK A;  1D1A A;  1RKT A;  3KEO A;  3S2D J;  3REO A;  2OCE A;  2FD5 A;  3HG9 A;  3BJO A;  2M2E A;  4NUB A;  2GBY A;  3Q5F A;  4C30 A;  4L5J A;  3JTH A;  4L9N A;  1JHH A;  2L9N A;  5L3G A;  1O3T A;  3K1M A;  2P7V B;  2W25 A;  3BR5 A;  3I56 I;  2PBI A;  4DNC A;  4XSX F;  3EUH A;  3GCM A;  3MKY B;  2XC7 A;  2HDD A;  2NXN B;  5DYM A;  4UUT A;  3ZN1 A;  2B7E A;  2ZME B;  3RYR A;  2DT6 A;  1ETX A;  2VJ4 A;  3WHB A;  4Q48 A;  3W2V A;  4IHS A;  1R5I D;  1IN7 A;  2PFB A;  1TL8 A;  4ZDO A;  1BC8 C;  3IH2 A;  2AS5 F;  3K4B A;  3T0Y A;  3OOP A;  2K02 A;  5FKM A;  1YX5 A;  3CO7 C;  5J4V A;  5EEG A;  4BU2 A;  2VPR A;  4E7K A;  3P9C A;  2CW7 A;  2MD5 A;  3BCB A;  1SD5 A;  5F0H A;  3KZZ A;  2TCT A;  5LGU A;  4ENJ A;  2EV0 A;  3CC4 I;  3PJR A;  3EPZ A;  2JTV A;  3ZQC A;  3SDG A;  4LK0 F;  4QWQ A;  5LGT A;  3M8F A;  1OPC A;  1GV5 A;  2PN6 A;  4N9I A;  3ZMD A;  1CQT A;  3TP3 A;  1QBJ A;  2Z2S B;  3L2Q A;  3ROU A;  1SAN A;  2AO9 A;  3F21 A;  3GZ6 A;  5FRN A;  4G7Z F;  2WBM A;  3S14 J;  1MH4 A;  4UB8 C;  3CO6 C;  1FOX A;  1JKR C;  2EV5 A;  1EJ9 A;  4NQW B;  4CO8 A;  2JUC A;  4M73 A;  5GTI C;  2F48 A;  5KNL A;  2AXL A;  1W36 D;  3H5R A;  4OIO F;  3OR2 C;  4BE1 A;  2DMN A;  4I0A A;  2VOP A;  2K9S A;  3PFI A;  1HW5 A;  2DT5 A;  1R58 A;  3CQZ J;  1UST A;  1J59 A;  5HLT A;  3SFI A;  4HX8 A;  3ONQ A;  1SVL A;  3JCU C;  3TO9 A;  3IKV A;  1VQM I;  1T8I A;  4I98 B;  1SAX A;  3W3C A;  3K69 A;  2P81 A;  4XLA A;  2P6S A;  1HSJ A;  2L9V A;  1B6A A;  2XPU A;  4E7S A;  4PSW A;  4IHV A;  2EIL H;  4L5E A;  2JWT A;  1T56 A;  1E0E A;  1MJ9 A;  3BR6 A;  3TO6 A;  3G3Z A;  2DDA A;  3M9A A;  1UG0 A;  4GFB A;  1K83 J;  2JT1 A;  1WRJ A;  4RGU A;  3TW6 A;  2KIS A;  2A68 F;  5CKT A;  2MYS A;  1RR7 A;  1G3S A;  3B6A A;  3SXY A;  1JKQ C;  1VQ5 I;  3QU3 A;  3HRT A;  1A04 A;  2JSC A;  2WB1 N;  4CCN A;  2L9R A;  2A3S A;  1BM9 A;  2GXG A;  2XGC A;  4P5O A;  1J7K A;  3F72 A;  4XOT A;  2XGE A;  3FBI B;  1PUE E;  2IBD A;  1ZH5 A;  3PNY A;  5DCM B;  3FXL A;  1S7A A;  1QZY A;  1I50 J;  1Z6R A;  5EDN A;  5D6E A;  4RGR A;  4WX9 A;  4CYC A;  4BQQ A;  2VKH A;  3I3L A;  3LFU A;  4IQJ A;  5JLW A;  5CYV A;  2H6C A;  3HEF A;  3F6V A;  2XV4 S;  4OIN F;  4B3X A;  3N4M A;  2HYG D;  4C2M J;  1NK3 P;  4IPA A;  2HU9 A;  1Z0X A;  4N9H A;  4DGW B;  4P96 A;  3KZY A;  3LQR A;  1E3H A;  4WCG A;  1REP C;  4ENK A;  1WI3 A;  1FMW A;  2AQE A;  1Z3Y A;  3JRG A;  1OLT A;  2KRF A;  1V5F A;  2QZ8 A;  3FXQ A;  4KT5 C;  3C2H A;  1DUX C;  1Z7L A;  5EGO A;  3A0B C;  4F7Z A;  2JJ7 A;  1LE8 B;  4MGR A;  4M3G A;  3K7A J;  2IGN A;  4I99 C;  4M9X A;  5M3F J;  3FXM A;  2MBF A;  3K9T A;  2MLK A;  1B59 A;  4NBQ A;  3A01 B;  1X2N A;  5F1R A;  1PP7 U;  2UWM A;  1ERD A;  4IX7 A;  2L7Z A;  1BBY A;  1ITY A;  3V4G A;  3HJE A;  2QCO A;  3HRU A;  2KKO A;  4HPQ A;  3U2R A;  1HBX G;  4WK8 F;  2COB A;  2K3F A;  2VC0 A;  3U21 A;  1Z9C A;  1JKO C;  4BXF A;  4N0B A;  1U8R A;  1YJW I;  2HOT A;  5ICG A;  4LJZ F;  5ED4 A;  4I2O A;  1IXR C;  2HR3 A;  1G6N A;  2DU9 A;  2E35 A;  4BS9 A;  1D5Y A;  3GBG A;  4KIG A;  1MNM C;  1SAU A;  1YLF A;  3S1N J;  1Y1W J;  1ORK A;  2HWV A;  4KN4 X;  2LD5 A;  1W5C C;  1I3Q J;  2R7Q A;  2IXS A;  2L0K A;  1ON2 A;  1P6R A;  3O2P E;  4IKF A;  1POG A;  2BEO A;  2LF7 A;  2A05 A;  1VTN C;  5H2F C;  2HVS A;  1Y0U A;  3MKL A;  4UNO A;  1ETV A;  1IG7 A;  4IRI A;  1Z67 A;  2HNH A;  4A6E A;  2ADU A;  2JZY A;  3CUQ C;  2ZKZ A;  2K9Q A;  4B48 A;  4Z6Y A;  1TTY A;  2VJJ A;  2EFN A;  4AU7 A;  1QHH D;  3GUD A;  4LK1 F;  2DJI A;  6PAX A;  4OU0 A;  1OKR A;  3DKX A;  4A3D J;  1FBU A;  1IUY A;  2VXZ A;  1X19 A;  2DA2 A;  2M3A A;  2W48 A;  1IN4 A;  2O3F A;  3S8P A;  4KJZ A;  4XON A;  1QQI A;  3K0L A;  1SFK A;  1D1C A;  3ZRG A;  2DDB A;  2E2J J;  1ETQ A;  2V1U A;  5JI6 A;  1MMG A;  1WH7 A;  2BYV E;  3K1P A;  2A07 F;  2Z99 A;  3LSR A;  2O9L A;  5AON A;  1U5T A;  5M5Y J;  5EYR A;  5J40 A;  3TMO A;  5DS9 A;  2E2H J;  3VFZ A;  1P4X A;  2EIM H;  3LSK A;  4CCO A;  3H5N A;  4C2U A;  4A69 C;  2FSW A;  3WOD F;  1YFH A;  5EG0 B;  2M1B A;  1ZQ3 P;  3OL3 A;  1MSF C;  2R7U A;  3MD2 A;  2W82 A;  2ZME A;  3I55 I;  2XB0 X;  3ESW B;  3E3V A;  2DYS H;  1NHA A;  3VYT B;  1ZRC A;  4M3B A;  4KDP A;  2FOK A;  3GO5 A;  4E7J A;  1X4P A;  2MA3 A;  1YJ9 I;  5AIP A;  3W6J B;  2A6E F;  1RR8 C;  2ZJ2 A;  2BV6 A;  5DCF A;  4I0B A;  4R79 A;  1BW6 A;  2V9K A;  4G6D A;  5CVR A;  1SMT A;  1GT0 C;  2OA4 A;  2LTP A;  2KRH A;  2IW5 A;  1YQA A;  4OMY A;  2OZ6 A;  1I1S A;  4XLE A;  2CMP A;  2QSH X;  2M30 A;  3I58 A;  2M4K A;  3DEU A;  4RGS A;  4XRS G;  2GIZ A;  4MLO A;  2HVR A;  2E5N A;  3W6K B;  2QEN A;  2QBY B;  5J8C A;  3ECH A;  3FDY A;  2L7K A;  3CP2 A;  1Y56 A;  4I76 A;  1IN5 A;  4PFO A;  2QSG X;  4RGX A;  4BJT A;  4FX4 A;  1FBQ A;  1GUU A;  2HOS A;  1RRJ A;  5FLX K;  1F5T A;  1U2W A;  4ABZ A;  3VDX A;  4FAS D;  2K7L A;  4EEF G;  4KA4 A;  4C3J J;  2YS9 A;  4LLL A;  3GXO A;  4QLC U;  4BEH A;  2JN6 A;  3HIF A;  5FD5 A;  4HNV A;  5HNH A;  2QQA A;  4YFX F;  2AXT C;  2E1M C;  3PUF A;  2FBH A;  3L2U A;  2NNY A;  2V26 A;  3P7N A;  3G2B A;  1HKT A;  3F8F A;  1HLV A;  1OMI A;  3IRQ A;  5E8I A;  4HNT A;  2DO7 A;  3OR1 C;  1N25 A;  3HOX J;  3QOE A;  1DQU A;  1XDS A;  3GFM A;  1OR7 C;  3HOT A;  1W5T A;  3NQO A;  3WTU C;  4A3K J;  1ONV A;  1BI3 A;  4CYC B;  1BI0 A;  1SC7 A;  3K4N A;  1LUJ B;  3OL4 A;  4MQV A;  3ZP5 A;  4BH9 A;  4BJ5 C;  3WGG A;  2CQX A;  2HPI A;  4KMF A;  1VZ0 A;  2DT7 B;  3ASO H;  3HPG A;  2IT0 A;  1I5Z A;  3ZQG A;  2RNG A;  5EF6 A;  4Q47 A;  3IP4 B;  3FXK A;  3RZO J;  1W7P A;  1ZRF A;  2LC2 A;  3VYR B;  5FFZ A;  4LG3 A;  2GZW A;  2CQK A;  2KHM A;  2M87 A;  3FMR A;  4BYY A;  3HYI A;  3HXL A;  5K7F A;  2R7T A;  4YG2 F;  4DYC A;  3TL4 X;  2QWW A;  2R7V A;  4DJA A;  4L0Y B;  2OF7 A;  4ZZD A;  3CCJ I;  2XAG A;  1UFM A;  1Y8R B;  4ITV A;  3PQK A;  3VB2 A;  5J1Y A;  1O3S A;  2Y75 A;  4RB1 A;  4L5I A;  3I4M J;  4WXC A;  5F0F A;  5F0C A;  1YI2 I;  3J81 Z;  4G6Q A;  1GVJ A;  1IN6 A;  2W57 A;  5KAI C;  2A6H F;  3NWT A;  3ABM H;  5K5O A;  3K2A A;  2DOF A;  3EUK L;  3SZG A;  4C3H J;  5GAD J;  3KIO A;  2MSY A;  3DPU A;  3G4S I;  4MO7 A;  2BXY A;  2JMW A;  3MQ0 A;  1P7J A;  5E3L A;  5HVQ C;  5B66 C;  1GV2 A;  1G3W A;  5IYB J;  3NRV A;  4HDU A;  1KU9 A;  3J7Z I;  3CCU I;  4HLY A;  5D4R A;  4NC7 A;  3O8G A;  5LBQ A;  1JUM A;  2K5C A;  1ZGA A;  4UXN A;  3AG4 H;  2RQQ A;  1F43 A;  5BOX A;  4XKW A;  2YU3 A;  1U9O A;  4XK4 A;  5IYC J;  3VOD A;  4S0H B;  3WTZ A;  1K4T A;  2BHZ A;  2K3P A;  3CJT B;  1TBX A;  1YRN B;  2X48 A;  3DTK A;  1ETK A;  3HUG A;  4BDY A;  2CUF A;  3ZCO A;  2NVY J;  4DBR A;  3PSF A;  1IZ1 A;  2IA1 A;  1MJB A;  1WWX A;  3MN2 A;  3MEX A;  1NG7 A;  3ABU A;  4A3I J;  3RKW A;  1G2H A;  2R7Z J;  2DMP A;  1FMV A;  2FJ1 A;  4KT6 A;  4R8H A;  4IHX A;  3RSN A;  3FXU A;  4A3G J;  3GTK J;  2CUZ A;  2LDU A;  3GTP J;  3KYD B;  1A6Q A;  1ZLJ A;  4GXO A;  4LGW A;  2P5V A;  4JBA A;  1WSU A;  5IT9 K;  2XKO A;  3WU2 C;  1T38 A;  3R0A A;  4Y15 A;  2VIX A;  1G3T A;  4PFP A;  3M4O J;  3HOZ J;  3CLQ A;  4E70 A;  2JA5 J;  1GXP A;  4DOZ A;  2CW0 F;  4V2G A;  2JRM A;  2E1O A;  5L3E A;  4OIR F;  4BJ6 C;  2Q1Z B;  4RAF A;  3N05 A;  3COA C;  3JRC A;  2WAF A;  3HSF A;  4QTR A;  2D5V A;  3CCE I;  1T2K A;  1ZK8 A;  2LKP A;  1OCC H;  1IXS B;  4CSW A;  4M3E A;  5E3M A;  2LLK A;  3JSP A;  3M1C A;  1VI0 A;  3ZQQ A;  4E7I A;  3SEQ A;  5HDK A;  1N78 A;  2XB5 A;  3HRM A;  4JX6 A;  4CUG A;  2DI3 A;  1X3Z B;  3OS2 A;  3TP0 A;  1VQP I;  2JPB A;  2ZXJ A;  2LY9 A;  3BZK A;  3EUH C;  1R71 A;  1FNN A;  2CV0 A;  5JR3 A;  3I59 A;  4EGZ A;  1VQL I;  3F8M A;  2HDC A;  1TQI A;  2HXO A;  2I5U A;  4KIC A;  5L3C A;  1EKE A;  5IP7 J;  3S16 J;  1T0F A;  2E5Z A;  4IO9 F;  2KDZ A;  1VQ6 I;  2R5Y B;  3C3W A;  4AYB N;  3L2C A;  3KLN A;  3FKJ A;  2NS8 A;  2XAU A;  2M4G A;  2M0C A;  4RB2 C;  3S1R J;  1MZB A;  1QZZ A;  2F5F A;  1FYL A;  5DCM A;  2QEX I;  2ECB A;  1LEA A;  2QQ8 A;  2WAQ A;  2D1H A;  5DD8 A;  2FF4 A;  2LH9 A;  5BMZ A;  3OYJ A;  4KFC A;  2NOJ B;  1UEL B;  2LBF A;  1T33 A;  3GW2 A;  3MCZ A;  1TNT A;  3ZQF A;  2L4A A;  2CSO A;  5LRR A;  1IAW A;  3A4C A;  5DD4 A;  1NTC A;  5HS8 A;  3X2Q H;  1X1B A;  2Z16 A;  3DEW A;  3ZMU A;  1XGM A;  3BPX A;  4LIU A;  2LKX A;  2RV8 A;  2QUF A;  1U3E M;  2FU4 A;  3I0T A;  2FRH A;  1ZLK A;  1YJN I;  2ZBK A;  1J0R A;  2HKX A;  2CFX A;  2NVT J;  3HTS B;  1R4N B;  2LG4 A;  4EAT A;  2E60 A;  2VAS A;  3BJA A;  5FKL A;  3ZQH A;  1S5L C;  4XLF A;  3CD6 I;  2V1D A;  3F6O A;  2VKV A;  2JPC A;  3T8R A;  3LOC A;  2CYY A;  2L7F P;  1DU0 A;  2IS4 A;  4MFE A;  3WG7 H;  4AID A;  2X9D A;  4M9Z A;  3OYE A;  1U78 A;  1DP3 A;  3CJN A;  4LIV A;  2CQQ A;  5JFR A;  4B3A A;  3KEY A;  2HDW A;  4K2E A;  3ZGK A;  1ACI A;  2Z9O A;  1ZYR F;  1YIJ I;  2FE3 A;  2PMH A;  1OQY A;  3JRA A;  2BVL A;  2O0Y A;  2IS1 A;  5EEH A;  2Y9Z A;  2WWY A;  1XPX A;  3CZ6 A;  1QRY A;  3GME A;  4E7L A;  2IP2 A;  4NDL A;  4MTD A;  2Y48 A;  3HBL A;  5GAG J;  4IQ4 A;  2DA5 A;  3GZ5 A;  3R4K A;  3L2R A;  5FRM A;  1KU3 A;  2CV1 A;  3VPR A;  2F5E A;  2O8K A;  4XSZ F;  2GM4 A;  1XX5 A;  2IS6 A;  3OOU A;  5A2Q Z;  2OUM A;  4RAZ A;  1JJ8 C;  1K78 A;  4FE4 A;  4C3I J;  4ZYH A;  2EK5 A;  4CHU A;  5J4Y A;  2DFF A;  4XRM A;  2CW8 A;  2XAJ A;  4AIH A;  2QKM B;  4BAY A;  3OYF A;  3V7C A;  3MKW B;  1OFC X;  3EYY A;  4ZZL A;  2R7S A;  4PJ0 C;  3FMQ A;  4UHT A;  3WTX C;  2L01 A;  1XMX A;  1O3R A;  3GTJ J;  1QGP A;  4IEJ A;  2H27 A;  3LA3 A;  1B4A A;  3OYA A;  3IAM 2;  2X51 A;  3S3N A;  2GXA A;  4KIB A;  2XPV A;  2QM3 A;  1LFP A;  2NS0 A;  2KDO A;  2KIU A;  1HXD A; 
#chains in the Genus database with same CATH homology
 5ICF A;  3DXJ F;  2COM A;  2HKO A;  3E5U A;  1I1G A;  2XHK A;  5LLQ A;  2NYX A;  4PGH A;  5FLX Z;  2VE8 A;  2Q2E A;  3T5X A;  2PMU A;  2X0L A;  1E17 A;  2QVO A;  2H6B A;  3KEQ A;  3KP4 A;  2STT A;  4L0Z B;  2W85 A;  4HF0 A;  4PGG A;  2JRT A;  1FSE A;  3BPV A;  4I01 A;  3P9K A;  5FGM A;  3MAJ A;  3WTW C;  2ESH A;  3SHF A;  1CF7 B;  2E7W A;  1D5V A;  1YS6 A;  2QBY A;  2IRF G;  2W24 A;  4L18 B;  3LWF A;  4HQE A;  1HST A;  5E1Z B;  4GO1 A;  1K6O A;  5ERI A;  1BI1 A;  3DPT A;  4PZJ A;  5L3F A;  4EM1 A;  3J80 K;  1J2X A;  2A69 F;  2RNJ A;  2E7X A;  4AVP A;  1J5Y A;  1R5H A;  1S8N A;  3F23 A;  4I7H A;  4KUM A;  4B09 A;  2DQL A;  2ELH A;  3B73 A;  3I54 A;  3TGN A;  2VOD A;  4XBF A;  2RN7 A;  4BNC A;  3HSE A;  2FBK A;  2OD5 A;  3T1B A;  2CO5 A;  4BHB A;  3J81 K;  4CDG A;  4DQ2 A;  5BPI A;  3JAM Z;  4OOI A;  4IRH A;  1SD7 A;  3CLO A;  1LQ1 A;  1TQM A;  2DW4 A;  1XMA A;  2VBW A;  5CLS A;  1TNS A;  3BJ6 A;  1TLH B;  1WQ2 A;  1MDM B;  3MFK A;  3WTS C;  4R1H A;  2PEX A;  4ENM A;  2EB7 A;  5H20 A;  2F2E A;  4ZYE A;  1WKM A;  3R6S A;  2HTJ A;  4KN7 X;  2NNN A;  3F8B A;  2ACJ A;  3TO7 A;  2YPR A;  2EV6 A;  3I5U A;  1O7L A;  3FXR A;  2G7H A;  5CVV A;  2VBZ A;  3SZT A;  3DPL C;  4O6J A;  1CGP A;  4EV0 A;  3E5X A;  1UCR A;  5K1Y A;  4ENN A;  2ZCW A;  2OZU A;  2VON A;  5JVT A;  5IT9 Z;  2RGV A;  5HLG A;  4U0W A;  5BQT A;  3I53 A;  3RPQ A;  3ABT A;  3FM3 A;  3KP2 A;  1ZRD A;  5E20 A;  1BIA A;  3ZMZ A;  4ON0 A;  4A12 A;  2QQ9 A;  3F8N A;  4OIQ F;  3GFI A;  1RIO H;  1PP8 F;  2RKH A;  1S29 A;  1ZAO A;  2M45 A;  2ZO4 A;  4A0Z A;  2Q8K A;  1QO0 D;  1ZG5 A;  5F6F A;  5ILU A;  3DKW A;  1BC7 C;  4LG0 B;  3E6B A;  2K86 A;  1PDN C;  2XAS A;  1XSD A;  3V8L A;  5E1W A;  4A2U A;  5E1X A;  3ULQ B;  1KYW A;  1H9G A;  5HS9 A;  3GF2 A;  2Z3Y A;  3L00 A;  5FB2 A;  2HFH A;  4PDK A;  3GX4 X;  4CYD A;  1FPQ A;  3K2Z A;  2YX7 A;  1MD0 A;  2IA2 A;  1FLI A;  3E6M A;  3U9G A;  5FD6 A;  4HA8 A;  1P4A A;  5HS7 A;  4FX0 A;  4A0X A;  4CXF A;  1FSH A;  1B1B A;  3RTR A;  1HW1 A;  2WV0 A;  1JE8 A;  1CF7 A;  3E5Q A;  3WGH A;  1OYW A;  2UXN A;  1L3L A;  5D5X B;  3BY6 A;  3I64 A;  3JTG A;  3VEP A;  2X4H A;  2KJB A;  1LEB A;  4HAM A;  1DPU A;  1U5T B;  3EET A;  4MTE A;  4NHJ A;  2PLY A;  1YW7 A;  3TDZ C;  1XGS A;  1FC3 A;  5D4S A;  3JSO A;  3E97 A;  1L0O C;  2H09 A;  3RDI A;  3QOP A;  2QLZ A;  2P5L C;  3ZMS A;  3F22 A;  4I02 A;  3TQN A;  5JHU A;  3GVA A;  3KET A;  1G3Y A;  1F1Z A;  3KCC A;  3LAJ A;  1RUO A;  3C1D A;  2O61 A;  2NAZ A;  1MGT A;  4G7H F;  2P6T A;  1R1V A;  3QP5 A;  1KU2 A;  5D8K B;  4ESF A;  3ZPL A;  3QRF F;  1U5T C;  1H9T A;  2XIG A;  1S6L A;  2DPU A;  1YS7 A;  3GFJ A;  4HLX A;  1K78 B;  1MJA A;  1LDJ A;  4HF2 A;  4WF2 A;  4A5N A;  1R22 A;  3FWE A;  3RKY A;  2XRN A;  4IVN A;  4YIF A;  3IC7 A;  3WU1 B;  1ZRE A;  2O8X A;  3LST A;  3KP7 A;  3HSR A;  4UVC A;  2EA4 A;  2FBI A;  4CGZ A;  2XVC A;  4M6Y A;  3RKX A;  5DEQ A;  2E1N A;  2IJL A;  5E17 F;  2RDP A;  4A0Y A;  2W84 A;  2DBB A;  3HOS A;  1XMK A;  2DK5 A;  1IRF A;  2VT2 A;  2EFP A;  3BP8 A;  1FYM A;  1XSX A;  2F5D A;  1HQC A;  1IW7 F;  1ZN2 A;  1KQ8 A;  3KE2 A;  3RIR A;  1UB9 A;  4RAY A;  4IHT A;  3H3Z A;  3N97 A;  5ILV A;  5D5U B;  3L9F A;  3RYP A;  1R36 A;  2CGP A;  1LNW A;  4L9V A;  3Q9V A;  4G9Y A;  4MQ9 F;  2HZT A;  4M6X A;  2FNP A;  2IVM A;  1RNL A;  4ZH4 F;  4CIC A;  2L54 A;  2PQ8 A;  3BOQ A;  1FWZ A;  3QP6 A;  2MLG A;  4HV5 A;  5L3B A;  1W5S A;  1YW8 A;  3BWG A;  3WTT C;  1BI2 A;  3KP3 A;  4KYW A;  4BQA A;  5CVI A;  4CZZ A;  4HDV A;  4HQM A;  3C7J A;  1EH6 A;  5J6X A;  3KP5 A;  4NB5 A;  2H94 A;  4P55 A;  2XAH A;  5K5Q A;  1I6X A;  2F5C A;  1LVA A;  2KJC A;  4ESB A;  4M71 A;  5HLI A;  5ILS A;  3F3X A;  2FEZ A;  4JK1 X;  4GGG A;  1P92 A;  1JHF A;  2MH9 A;  4HF1 A;  5LEK A;  1ZG1 A;  3GWZ A;  4O5V A;  1TQP A;  4I09 A;  4KMU X;  1LJ9 A;  4AIK A;  5D5V B;  4U7D A;  2GIV A;  3Q9S A;  2DQR A;  2G7U A;  4S05 A;  5KVR A;  1OYI A;  2VT3 A;  2RC4 A;  3WG9 A;  3KP6 A;  2FQ3 A;  2E1C A;  2UXX A;  1ULY A;  4LB5 A;  2WTE A;  2Q0O A;  3BZ6 A;  1S7O A;  3ISP A;  1XCB A;  3E6C C;  4KNY A;  1C0W A;  3FF5 A;  5E18 F;  1GXQ A;  3FHZ A;  5DDG A;  4RS8 A;  4FHT A;  1KQ0 A;  2BBY A;  4S04 A;  2Y0M A;  3ZMT A;  2FML A;  2VN2 A;  3SZP A;  4EM0 B;  3IKT A;  3QPT A;  4EMS A;  4LB6 B;  5FFX A;  1IRG A;  1QPM A;  4ETS A;  5DUK A;  1TW2 A;  2GA1 A;  1R23 A;  3QAH A;  4RB3 C;  4EM2 A;  4Q5S F;  4EJT A;  4HZF A;  4WXD A;  3RI4 A;  1XD7 A;  3DV8 A;  4U0Y A;  3HHG A;  3K1N A;  3WTY C;  2YX4 A;  3C18 A;  1I27 A;  1KYZ A;  2XRO A;  1JGS A;  4AIJ A;  4Y13 A;  2GA2 A;  1P4W A;  2PJP A;  3MZH A;  1KU7 A;  5ICE A;  1ON1 A;  1AOY A;  3QU6 A;  3F8C A;  3LA2 A;  2LF8 A;  3M7G A;  3ELK A;  2DLL A;  2HEO A;  1YIO A;  3CUQ B;  2EA2 A;  1K79 A;  3B02 A;  5F64 A;  1FP1 D;  4D0P A;  1RZ4 A;  5AIQ A;  4HYE A;  3DF8 A;  3V7S A;  4AD9 A;  1XGO A;  4KIF A;  1UHW A;  3IRR A;  4IRG A;  1Z05 A;  2V79 A;  3KFW X;  2L02 A;  3JW4 A;  1WI9 A;  3EDP A;  5D6F A;  4HOB A;  2DAO A;  2FXA A;  2O6G E;  1DDN A;  1MKM A;  2EWN A;  2HTS A;  2OAZ A;  2TDX A;  2YR2 A;  2XAQ A;  3R0J A;  3KLO A;  3MWM A;  1D8J A;  4O3M A;  1TW3 A;  5CVU A;  4GYI A;  3CUQ A;  2L4M A;  2HOE A;  1HKS A;  3P9I A;  2ETH A;  2BE5 F;  1Z6T A;  4L9T A;  2Z33 A;  1D3Y A;  2EFW A;  2GAU A;  5KK1 A;  2EFQ A;  3TDU C;  2RQP A;  3SQN A;  2FMY A;  3SFZ A;  1YTY A;  4P9F A;  1FZP B;  1B9N A;  2J5P A;  3FMS A;  3FZV A;  3CDH A;  2OBP A;  4B8X A;  3QPH A;  1FX7 A;  4BXU A;  1FP2 A;  4A6D A;  2XKP A;  1YG2 A;  3LAP A;  1XSV A;  1LB2 A;  3EQL F;  4MEY F;  4EGY A;  3DFG A;  1R5G A;  3R61 A;  3AAF A;  2OU2 A;  2G9W A;  5DUI A;  4U7B A;  2HS5 A;  2A5Y B;  5E8G A;  2DFI A;  5LHI A;  3WTV C;  3G73 A;  1D8K A;  1HW2 A;  3ECO A;  4HV6 A;  4WXH A;  1B9M A;  3ERE D;  5LHG A;  4EJV A;  1DPR A;  1QNT A;  2V6C A;  1F9N A;  2D45 A;  3U1D A;  2FNA A;  2XGX A;  2PI0 A;  2HQN A;  4U0V A;  3D5L A;  2V9V A;  5LRS A;  3VOE A;  4UVA A;  5D8L B;  3V7R A;  2RVC A;  4YFN F;  2NRA C;  4MHG A;  2C6Y A;  1V4R A;  1EH7 A;  2HYF A;  1STZ A;  4HW0 A;  4IJA A;  4IXA A;  1W7P B;  2GWR A;  1FYK A;  2B0L A;  4OIP F;  2VOO A;  4BHP A;  3RPU A;  1ZHF A;  3TOB A;  3GYH X;  1T39 A;  2VE9 A;  2ZNZ A;  2DTR A;  3HRS A;  5FO5 A;  5J8F A;  3LA7 A;  1X3U A;  3JAM K;  5A2Q K;  1FT9 A;  4LMY A;  2OQG A;  3WE2 A;  3D0S A;  4LLN A;  3V8K A;  1E2X A;  3S2W A;  3J80 Z;  3DP7 A;  4M74 A;  4G94 A;  1G4D A;  2P7C B;  1BIB A;  2O03 A;  4LD5 A;  1SFU A;  2P4W A;  5H6Q A;  3I71 A;  2GQQ A;  1ZG3 A;  1RI7 A;  3PQJ A;  1JXS A;  2K4J A;  1R1U A;  1O7F A;  1R1T A;  1ZGJ A;  4AWX B;  3R60 A;  3L09 A;  1K7A A;  3IWZ A;  2D2W A;  2MH2 A;  1IN8 A;  2M5W A;  4EVI A;  4XLP F;  2Z5U A;  4ZYD A;  3ZMV A;  5LGN A;  3I4P A;  3GEZ A;  2HGC A;  1AWC A;  5CJ9 A;  1EV7 A;  4YII A;  1SFX A;  2D1V A;  1KQ9 A;  4PCQ A;  2WC2 A;  4EQQ A;  5D5W B;  4G7O F;  2R3S A;  2DPD A;  2P5K A;  2HQR A;  3TOA A;  1FBS A;  1IF1 A;  5K5R A;  4JQF A;  1O3Q A;  1XDU A;  3DQV C;  3OV8 A;  1F4K A;  1Z1D A;  3BRO A;  4GCV A;  4MNU A;  5LEJ A;  1U6G A;  3WGI A;  1ODD A;  1LDD A;  1OYY A;  4M72 A;  1OR7 A;  1SFE A;  2BGC A;  2R7D A;  1O57 A;  3T8T A;  2STW A;  4OMZ A;  2UZK A;  4ESJ A;  1LDK B;  1FOK A;  2LSO A;  2OQR A;  3RJP A;  4U88 A;  2VBY A;  4UUV A;  2V1X A;  1SMY F;  3I59 B;  5HLH A;  5HOO A;  1HKQ A;  2J5O A;  3ZQ7 A;  5HDG A;  4ASN A;  2IA0 A;  1Q1H A;  3IHU A;  5L3D A;  4RB0 A;  4UV9 A;  2L3D A;  2M8E A;  4MEX F;  1S3J A;  3L7W A;  3M8E A;  2MC3 A;  4UV8 A;  5IT3 A;  2EFO A;  2ISZ A;  3ML6 A;  2PG4 A;  3MZY A;  4Z2Y A;  4NQW A;  4A5M A;  2K4B A;  1P2F A;  3O3K A;  2FA5 A;  4M9S A;  5HDN A;  4LLG F;  5LHH A;  4XLN F;  3NEU A;  3ZN0 A;  3FM5 A;  2A61 A;  5DV5 A;  4BHC A;  5TRD A;  5BPD A;  5BS6 A;  4Q4Z F;  4WWC A;  1ZAR A;  2ZNY A;  2P8T A;  4Y17 A;  1H0M A;  3HHH A;  1R00 A;  4XRF A;  3M1E A;  2YSR A;  3H3U A;  3V8J A;  1SD6 A;  1BOA A;  2KIF A;  4HBL A;  2QYO A;  2CWE A;  2KIM A;  5TJJ A;  1YYV A;  5CVJ A;  4FT8 A;  3E6D A;  1XGN A;  3CTA A;  4GYG A;  1YW9 A;  2CG4 A;  3TKY A;  3H92 A;  1J75 A;  1Z7U A;  1IXC A;  1BJA A;  2EJR A;  1MDM A;  1GHC A;  1T98 A;  2K27 A;  1UHM A;  2DK8 A;  2IPQ X;  1J9I A;  2R7F A;  4P9U A;  2VC1 A;  1BN5 A;  1FY7 A;  4HX4 A;  3HTU A;  3FX3 A;  5ICC A;  2LNB A;  2XAF A;  4EJO A;  1W4M A;  3LQQ A;  3J7A O;  1XCV A;  4IF4 A;  4TV7 A;  1KA8 A;  1KGS A;  1RUN A;  3EYI A;  4HX7 A;  1XB4 A;  2QQB A;  3GLX A;  3WE3 A;  4G8X A;  3GFL A;  2ISY A;  4EJU A;  3CUO A;  1R7J A;  3IWF A;  2ESN A;  4H0E A;  1T6S A;  4EJW A;  4L9J A;  4YFK F;  4UVB A;  1V3F A;  3O6B B;  3IL2 A;  4LFU A;  1W7P D;  1DP7 P;  2XUB A;  1XN7 A;  2VBX A;  5H6R A;  4ZYG A;  2ZFW A;  1YO5 C;  1USS A;  1Z91 A;  1EH8 A;  3WU0 A;  3BDD A;  4LG0 A;  2GXB A;  1SD4 A;  3LFK A;  3KEO A;  3REO A;  3BJO A;  3Q5F A;  4L5J A;  3JTH A;  4L9N A;  1JHH A;  5L3G A;  1O3T A;  3K1M A;  2P7V B;  2W25 A;  2PBI A;  4DNC A;  4XSX F;  3EUH A;  5DYM A;  3ZN1 A;  2ZME B;  3RYR A;  4Q48 A;  4IHS A;  1IN7 A;  2PFB A;  1BC8 C;  2AS5 F;  3T0Y A;  3OOP A;  2K02 A;  3CO7 C;  5EEG A;  3P9C A;  2MD5 A;  1SD5 A;  4ENJ A;  3KZZ A;  5LGU A;  2EV0 A;  2JTV A;  4LK0 F;  4QWQ A;  5LGT A;  3M8F A;  1OPC A;  2PN6 A;  4N9I A;  3ZMD A;  1QBJ A;  3ROU A;  3F21 A;  3GZ6 A;  4G7Z F;  3CO6 C;  2EV5 A;  4CO8 A;  4M73 A;  2AXL A;  4OIO F;  4I0A A;  2VOP A;  3PFI A;  1HW5 A;  2DT5 A;  1R58 A;  1UST A;  1J59 A;  4HX8 A;  3TO9 A;  3IKV A;  4I98 B;  1SAX A;  3K69 A;  2P6S A;  1HSJ A;  1B6A A;  1MJ9 A;  3TO6 A;  3G3Z A;  3M9A A;  2JT1 A;  1WRJ A;  4RGU A;  2A68 F;  1G3S A;  3SXY A;  3QU3 A;  3HRT A;  1A04 A;  2JSC A;  2A3S A;  1BM9 A;  2GXG A;  4P5O A;  1J7K A;  3F72 A;  1PUE E;  1ZH5 A;  5DCM B;  1S7A A;  1QZY A;  1Z6R A;  5D6E A;  4RGR A;  4WX9 A;  5CYV A;  2H6C A;  3F6V A;  2XV4 S;  4OIN F;  3N4M A;  2HYG D;  4IPA A;  4N9H A;  4P96 A;  3KZY A;  3LQR A;  1REP C;  4WCG A;  4ENK A;  2KRF A;  2QZ8 A;  3FXQ A;  4KT5 C;  1DUX C;  4F7Z A;  4MGR A;  4M9X A;  2MBF A;  3K9T A;  2MLK A;  1B59 A;  5F1R A;  1PP7 U;  2UWM A;  1BBY A;  3V4G A;  3HRU A;  2KKO A;  3U2R A;  1HBX G;  4WK8 F;  1Z9C A;  2VC0 A;  4N0B A;  1U8R A;  5ICG A;  4LJZ F;  5ED4 A;  4I2O A;  1IXR C;  2HR3 A;  1G6N A;  2DU9 A;  4KIG A;  1YLF A;  2HWV A;  4KN4 X;  1ON2 A;  1P6R A;  3O2P E;  2BEO A;  2LF7 A;  1VTN C;  1Y0U A;  4UNO A;  4IRI A;  4A6E A;  2ADU A;  2JZY A;  3CUQ C;  2ZKZ A;  1TTY A;  2EFN A;  3GUD A;  4LK1 F;  6PAX A;  4OU0 A;  1OKR A;  1FBU A;  1IUY A;  2VXZ A;  1IN4 A;  2O3F A;  1QQI A;  3K0L A;  2V1U A;  5JI6 A;  2BYV E;  3K1P A;  2A07 F;  2Z99 A;  5AON A;  1U5T A;  3VFZ A;  1P4X A;  2FSW A;  3WOD F;  1YFH A;  2M1B A;  2ZME A;  3E3V A;  1ZRC A;  1NHA A;  4KDP A;  2FOK A;  3GO5 A;  2MA3 A;  5AIP A;  3W6J B;  2A6E F;  2ZJ2 A;  2BV6 A;  5DCF A;  4I0B A;  4R79 A;  4G6D A;  5CVR A;  1SMT A;  2OA4 A;  2IW5 A;  1YQA A;  4OMY A;  2OZ6 A;  1I1S A;  2M30 A;  3I58 A;  3DEU A;  4RGS A;  3W6K B;  2QEN A;  2QBY B;  5J8C A;  3ECH A;  1IN5 A;  4RGX A;  4FX4 A;  1FBQ A;  5FLX K;  1F5T A;  1U2W A;  2K7L A;  4KA4 A;  4LLL A;  3GXO A;  4QLC U;  3HIF A;  5FD5 A;  2QQA A;  4YFX F;  2FBH A;  2NNY A;  3P7N A;  1HKT A;  3F8F A;  1OMI A;  3IRQ A;  5E8I A;  2DO7 A;  1XDS A;  3GFM A;  3HOT A;  1W5T A;  3NQO A;  3WTU C;  1ONV A;  1BI3 A;  1BI0 A;  4MQV A;  3ZP5 A;  4BH9 A;  3WGG A;  4KMF A;  2IT0 A;  1I5Z A;  4Q47 A;  1W7P A;  1ZRF A;  5FFZ A;  2GZW A;  2CQK A;  2M87 A;  3FMR A;  4BYY A;  3HYI A;  4YG2 F;  2QWW A;  4L0Y B;  4ZZD A;  2XAG A;  1UFM A;  3PQK A;  3VB2 A;  1O3S A;  2Y75 A;  4RB1 A;  4L5I A;  4WXC A;  3J81 Z;  4G6Q A;  1GVJ A;  1IN6 A;  2W57 A;  2A6H F;  5K5O A;  3MQ0 A;  5HVQ C;  1G3W A;  3NRV A;  4HDU A;  1KU9 A;  4HLY A;  5D4R A;  5LBQ A;  1ZGA A;  4UXN A;  5BOX A;  2YU3 A;  3VOD A;  3WTZ A;  1TBX A;  3HUG A;  1IZ1 A;  2IA1 A;  1MJB A;  1WWX A;  3MEX A;  3ABU A;  3RKW A;  4R8H A;  3FXU A;  2LDU A;  1ZLJ A;  4LGW A;  4GXO A;  2P5V A;  4JBA A;  1WSU A;  5IT9 K;  2XKO A;  1T38 A;  3R0A A;  4Y15 A;  1G3T A;  4E70 A;  1GXP A;  2CW0 F;  5L3E A;  4OIR F;  3COA C;  3HSF A;  1T2K A;  2LKP A;  1IXS B;  3JSP A;  5HDK A;  3HRM A;  2DI3 A;  2JPB A;  2ZXJ A;  1FNN A;  5JR3 A;  3I59 A;  4EGZ A;  2HDC A;  3F8M A;  1TQI A;  4KIC A;  5L3C A;  1T0F A;  3C3W A;  3L2C A;  3KLN A;  4RB2 C;  1MZB A;  1QZZ A;  2F5F A;  1FYL A;  5DCM A;  1LEA A;  2D1H A;  5DD8 A;  2FF4 A;  5BMZ A;  4KFC A;  3GW2 A;  3MCZ A;  1TNT A;  2L4A A;  2CSO A;  5LRR A;  1IAW A;  5DD4 A;  5HS8 A;  3ZMU A;  1XGM A;  3BPX A;  2RV8 A;  2QUF A;  1U3E M;  2FU4 A;  3I0T A;  2FRH A;  1ZLK A;  2ZBK A;  1J0R A;  2HKX A;  2CFX A;  3HTS B;  3BJA A;  2V1D A;  3F6O A;  2JPC A;  3T8R A;  2CYY A;  4M9Z A;  1U78 A;  3CJN A;  5JFR A;  4K2E A;  2Z9O A;  1ZYR F;  2FE3 A;  2PMH A;  2O0Y A;  5EEH A;  2WWY A;  2IP2 A;  4MTD A;  2Y48 A;  3GZ5 A;  3R4K A;  1KU3 A;  2F5E A;  4XSZ F;  5A2Q Z;  4RAZ A;  1K78 A;  4ZYH A;  2EK5 A;  4CHU A;  2XAJ A;  4AIH A;  4BAY A;  3V7C A;  3EYY A;  4ZZL A;  3FMQ A;  4UHT A;  3WTX C;  2L01 A;  1O3R A;  1QGP A;  2H27 A;  3LA3 A;  1B4A A;  4KIB A;  2QM3 A;  2NS0 A;  2KIU A;  1HXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...