4ESJA

Restriction endonuclease dpni in complex with target dna
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
256
structure length
246
Chain Sequence
PHMELHFNLELVETYKSNSQKARILTEDWVYRQSYCPNCGNNPLNHFPVADFYCNHCSEEFELKSKKGNFSSTINDGAYATMMKRVQADNNPNFFFLTYTKNFEVNNFLVLPKQFVTPKSIIQRKPLAGWIGCNIDLSQVPSKGRIFLVQDGQVRDPEKVTKEFKQGLFLRKSSLSSRGWTIEILNCIDKIEGSEFTLEDMYRFESDLKNIFVKNNHIKEKIRQQLQILRDKEIIEFKGRGKYRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Type-2 restriction enzyme DpnI
publication title Crystal structure and mechanism of action of the N6-methyladenine-dependent type IIM restriction endonuclease R.DpnI.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 76
structure length 246
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.1.21.4: Type II site-specific deoxyribonuclease.
pdb deposition date 2012-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06044 DpnI Dam-replacing family
A PF17726 DpnI_C Dam-replacing HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4esjA02
3.40.210.30 Alpha Beta 3-Layer(aba) Sandwich PvuII Endonuclease; Chain A PvuII Endonuclease; Chain A 4esjA01
2LSOA 2E1CA 5H20A 1CF7B 3BJ6A 5LGUA 1P4AA 3ZMZA 1K78A 1EV7A 2G7UA 5E8IA 2QM3A 2OU2A 2HZTA 1IRGA 1G3TA 1S7OA 2YX7A 5J8CA 1GHCA 2XVCA 3KE2A 3EUHA 3TDUC 1FY7A 3C18A 1I5ZA 2ADUA 2IP2A 4XRFA 2ISYA 5J8FA 3V7CA 1WSUA 4HF1A 3F8CA 4DNCA 2RV8A 3WTXC 3FM5A 5HLGA 3IRRA 4RB1A 2FOKA 4ZYDA 4MTEA 1O3TA 2DLLA 1B59A 2L4MA 3IKVA 3W6KB 4A5MA 2GWRA 2IVMA 4ENMA 1BC7C 4RGSA 1U5TC 1JE8A 1WWXA 5ICGA 3EQLF 2EFPA 4FX0A 2BE5F 2PLYA 4L9VA 2O3FA 1SFEA 1U6GA 2KJBA 2DK8A 3LSTA 4Y17A 4BAYA 2CFXA 2R3SA 2GQQA 4P5OA 3HTUA 3R60A 4MTDA 2EK5A 4BQAA 5J6XA 1JHHA 1CGPA 2J5PA 4O5VA 1KQ9A 4KIBA 4KT5C 3REOA 2FQ3A 1TNTA 1B4AA 3LA3A 3JTHA 5L3CA 2HS5A 4YFKF 3WGGA 1ODDA 3B02A 4LG0B 3V7SA 1BBYA 3K1MA 5DCMA 4BYYA 3BDDA 4I09A 1EH7A 2ZBKA 2IA0A 4PGGA 2FE3A 2O8XA 3RTRA 2VN2A 3WG9A 2EWNA 4U0YA 2RGVA 4UXNA 3DF8A 3WE2A 2V6CA 2HTJA 5E20A 2STTA 1G3SA 1HKTA 2A07F 2A5YB 4EJVA 3RJPA 2PMUA 1FLIA 2LKPA 3FMRA 1XSDA 3CTAA 3HSEA 2OQRA 3CJNA 4U88A 3R6SA 4A6EA 2HEOA 2G7HA 2YU3A 2ZKZA 4L9TA 4ASNA 3GO5A 2QUFA 3ZQ7A 2X4HA 3KZYA 1A04A 2DO7A 2ELHA 2XIGA 1ZRFA 4L18B 2DBBA 4XSXF 2BEOA 4IRIA 3SXYA 3N97A 2P8TA 1JGSA 3QPHA 2Y48A 1XDSA 3HOSA 3GZ5A 3HHGA 1EH8A 2BYVE 3IWFA 2IA1A 3VFZA 3IWZA 2A61A 3F6VA 2F5CA 1P4XA 1BI2A 1F5TA 3MZYA 5D4RA 4P96A 4HBLA 2ZO4A 4U0VA 4IPAA 2EB7A 2PEXA 2LDUA 4ENNA 3T5XA 4IRHA 1Z6TA 3E3VA 3F8BA 1J0RA 4S04A 1U5TB 2KIFA 4MHGA 1AWCA 1SFXA 1KU7A 4LLGF 1BC8C 5DD4A 1MDMB 2H94A 2KIMA 2ZFWA 1OMIA 3MCZA 4Q48A 4ZH4F 4XLNF 1IAWA 4EJTA 2FXAA 1XGNA 4CHUA 4M9XA 3H92A 4EM2A 2VE9A 3V7RA 1YYVA 2VC1A 1HKSA 4LD5A 2O0YA 1FYMA 2VT2A 1LEAA 4IHTA 4MGRA 4ESFA 1HXDA 3KEOA 5DUKA 4L0ZB 3ZPLA 5BQTA 3K2ZA 3PFIA 1QNTA 2COMA 2PN6A 1IN6A 3SZTA 4WXCA 3LAJA 3DV8A 5ERIA 3FF5A 1WKMA 3F8FA 4LFUA 2FU4A 4PDKA 2F5FA 3E5XA 3I58A 4A6DA 2FBKA 3O2PE 4LK1F 5LHIA 1O3SA 4P9UA 1OYIA 3RYRA 4B09A 2HKXA 1SD4A 2K4JA 3WTUC 1UHWA 2EV5A 4G7ZF 1ZN2A 5FD5A 3H3UA 3HHHA 4AWXB 3BY6A 1HSJA 3F3XA 3ZMDA 2QLZA 4EM1A 5HS7A 4GYGA 4R1HA 2XRNA 3G3ZA 1IZ1A 1ZARA 2O03A 3TO6A 2EFQA 1YS7A 1K7AA 4CO8A 1IRFA 3QAHA 2P6TA 3P9CA 3L09A 4AIJA 1BI1A 1IXSB 2NNYA 4N9IA 1R1UA 5CVRA 3E97A 3WU0A 2F2EA 4F7ZA 4Q4ZF 4U7BA 1FPQA 2DT5A 5LBQA 1JXSA 4M71A 1RIOH 1DP7P 2QVOA 1MD0A 3ZMVA 3ZN0A 5E18F 2HQRA 2RNJA 3M7GA 4B8XA 4AVPA 4YG2F 1O57A 4PGHA 4N0BA 1Z6RA 1P92A 2D1HA 4KN7X 5IT3A 1RUOA 5HOOA 3WTTC 3AAFA 2V9VA 3C1DA 4XLPF 4BHBA 3O3KA 4H0EA 5ILUA 2EA2A 5BPIA 4GYIA 2IPQX 1RUNA 2H09A 3WE3A 1BI0A 5HDKA 3GVAA 2QQBA 4BH9A 2KJCA 1O3RA 2JPBA 3EYYA 4I01A 1YW9A 1UB9A 2GIVA 2JPCA 2RC4A 4I02A 3NQOA 1BJAA 3J80Z 1LDDA 4K2EA 1FBUA 2Q8KA 3RKYA 5D6FA 1OPCA 4EMSA 3PQKA 3DQVC 2HOEA 1R5GA 2V1UA 2M45A 4KNYA 2B0LA 2Z33A 1LVAA 3V8KA 2GXGA 5AIQA 3LWFA 4OIRF 3V8JA 1YQAA 3CUQA 1Q1HA 5FGMA 2VXZA 3O6BB 5FLXZ 1Z9CA 4L5IA 3U2RA 2QENA 2FMLA 3I59A 4OIPF 3JAMZ 3RKXA 2UXNA 3I64A 1D5VA 1I6XA 1MJBA 2YSRA 4IXAA 2Z9OA 2F5DA 1K78B 2ZCWA 2A6HF 1BIBA 3F8MA 4HYEA 3ISPA 4KIGA 3JSOA 4UVCA 5A2QZ 1YO5C 1B6AA 3BROA 3T1BA 2AS5F 5CVVA 2H27A 2YR2A 1QBJA 2MA3A 1LB2A 2EA4A 3JSPA 2M30A 2QYOA 2HWVA 4M73A 1IN5A 2FBIA 2ZMEA 3M8FA 1E17A 3RDIA 1DPRA 2F5EA 2D1VA 2DFIA 4I0AA 1ZLKA 2WV0A 3K69A 2A68F 3E6CC 1S6LA 1YTYA 1BOAA 2YPRA 4RB0A 3TOAA 2OZ6A 3HRMA 1IN8A 5IT9Z 2HYGD 3DPTA 5AONA 2NAZA 1FWZA 2GZWA 4HX4A 4KICA 3R0AA 5D5VB 2FMYA 3SHFA 2DPDA 4A5NA 3HRUA 5DCFA 3L7WA 3V8LA 1R22A 4KIFA 2R7FA 2V1DA 4WX9A 2AXLA 3M8EA 2V79A 3FMQA 3MWMA 3VODA 1ZGAA 2J5OA 2IT0A 3TO9A 3HTSB 1ZYRF 1HKQA 4ZYHA 1BN5A 1NHAA 3HOTA 4GXOA 4OOIA 2PQ8A 1ULYA 5DCMB 3HRTA 5LRSA 3HUGA 1RI7A 3GFLA 1S7AA 2E1NA 2NNNA 1O7LA 1IW7F 4MQ9F 1J7KA 3I4PA 4RS8A 2GA2A 1PP8F 2FBHA 2MLKA 3GLXA 4KYWA 3E6BA 2CW0F 4KMFA 2IRFG 5FLXK 1TTYA 5HVQC 1O3QA 1BI3A 1LJ9A 3FM3A 1F1ZA 4GO1A 4U0WA 3IC7A 4O3MA 1J2XA 1FT9A 4UNOA 3M9AA 3TGNA 3S2WA 4HX7A 2FNPA 2XKPA 4FT8A 1OKRA 2MH2A 1TQIA 5DUIA 1RZ4A 3GUDA 2PMHA 1J5YA 1FP1D 4A2UA 4KA4A 1FX7A 2X0LA 2VT3A 5LRRA 1BM9A 4IHSA 5E1ZB 1J9IA 1T39A 3Q9SA 5D8LB 5FD6A 1W5SA 3PQJA 3ULQB 3IKTA 1YS6A 1FYKA 1G6NA 2OD5A 2XROA 1R58A 2QQ9A 1FP2A 2FA5A 4G6DA 4Y15A 3BJAA 1MGTA 5L3FA 1W5TA 2ZJ2A 1B1BA 4M72A 3FX3A 4AIKA 1ON1A 4BNCA 1IF1A 4OIOF 2K02A 3ELKA 4KMUX 3KFWX 4LJZF 1IXCA 3CO7C 2JSCA 4NHJA 4LB5A 2RKHA 3IL2A 1XGOA 1XD7A 4HF0A 4PZJA 2VOOA 4R79A 3QPTA 4BHPA 2D45A 3TQNA 4R8HA 4HX8A 1KYZA 2D2WA 1R36A 2EFOA 2VE8A 4CYDA 1MJ9A 3U1DA 3R4KA 5DD8A 1IXRC 1FBSA 3E6MA 2FRHA 5F64A 3E6DA 3WTYC 4UVBA 2KKOA 2ZNYA 3MAJA 2JTVA 4UV8A 3IRQA 3GXOA 1TQMA 4E70A 3MZHA 2P5LC 4LLLA 2XAFA 4IF4A 1SD7A 5DEQA 1XMAA 4LK0F 1L3LA 4WXHA 1ONVA 2HFHA 4M6XA 5HS9A 2UXXA 3CUQC 2P4WA 2CSOA 2DK5A 3ERED 2XAJA 3ROUA 4JQFA 4ZYEA 1XSXA 3DFGA 5JR3A 2RQPA 4OMYA 4M6YA 1ZLJA 2BGCA 4G9YA 1MDMA 1ZRDA 3OV8A 2M1BA 2L4AA 1STZA 3CDHA 3QRFF 3FXQA 4EGZA 2FEZA 4HQEA 4WWCA 2DPUA 5HLIA 2JRTA 4UVAA 4EQQA 1K79A 2VODA 4HLXA 4AIHA 4HDUA 4S05A 1J75A 1TW2A 2MBFA 1T98A 1W4MA 4I0BA 5TJJA 1PDNC 1KQ8A 5JFRA 3B73A 1R7JA 2XAGA 1QZZA 1VTNC 4PCQA 1W7PA 3RIRA 4WF2A 3ECHA 3D5LA 4HA8A 2W85A 4L9JA 2DAOA 4EGYA 1ZAOA 1I27A 4AD9A 4RAYA 3COAC 1SFUA 1SAXA 2IJLA 1T38A 2JZYA 3GW2A 1EH6A 1Z05A 1LNWA 3BZ6A 1T6SA 5AIPA 2MD5A 1FNNA 5FB2A 1RNLA 3CUOA 4M74A 2Q0OA 1V4RA 3FHZA 1ZG1A 3F8NA 2QBYA 2K7LA 1DUXC 5ICFA 2DQLA 1ZG5A 2UZKA 1U8RA 1ZREA 4ON0A 3J81Z 4RAZA 4YIFA 1LDJA 1ON2A 3ABTA 1MKMA 3KLOA 4O6JA 2H6BA 4A0ZA 3KETA 5CJ9A 3MEXA 1R00A 5L3EA 1OR7A 5ILSA 2NRAC 3ECOA 1QPMA 4EJOA 5D8KB 1HSTA 5E8GA 3FZVA 2K27A 2GA1A 3CUQB 2P5VA 4YFXF 2QZ8A 4RGRA 4Q5SF 1H0MA 2DW4A 3HRSA 5DYMA 4MEYF 3FXRA 3I59B 3C7JA 4OINF 1REPC 2A6EF 2XHKA 2XV4S 2VOPA 1ZHFA 1HBXG 3I54A 2FSWA 1F9NA 4OU0A 2GAUA 4CGZA 3WGHA 1YG2A 2MH9A 3T8RA 2EFNA 1D8KA 2CQKA 4A0YA 2VBZA 4L0YB 1FBQA 3WTWC 5E17F 1D8JA 3CLOA 3BPVA 3KLNA 3QP5A 3LFKA 2G9WA 3IHUA 2RDPA 3KP3A 2XAQA 5ICEA 2PI0A 4ESBA 4KDPA 5K5OA 2XAHA 1G3WA 2DI3A 2ZMEB 1HW1A 1Z7UA 2L01A 5KVRA 2Z99A 4OIQF 3F21A 4LLNA 3F6OA 3QU6A 2TDXA 1G3YA 4HV6A 3TDZC 3BOQA 4IVNA 5BS6A 3J7AO 2OQGA 4M9ZA 4D0PA 2HDCA 1XN7A 2Y75A 3K1PA 2OAZA 3TO7A 3I5UA 1XGSA 3F22A 3ZMSA 3WTVC 1D3YA 2EJRA 2LF8A 1X3UA 2CWEA 3LQQA 1I1GA 2XKOA 1T0FA 4G94A 1KGSA 3L9FA 1TLHB 1AOYA 2QQAA 5D5UB 2XUBA 3GFJA 4HDVA 4ESJA 3J81K 2NYXA 4L5JA 5ILVA 5EEGA 2PBIA 1F4KA 5TRDA 1B9NA 3R61A 1QO0D 3EYIA 2HYFA 1CF7A 3E5QA 2KIUA 1UCRA 3GEZA 4HW0A 3BWGA 3WGIA 3ABUA 3FXUA 1QQIA 5F1RA 2EV6A 3LAPA 5DV5A 4M9SA 4G8XA 2EFWA 4MNUA 5K5RA 3KP4A 2VBYA 1XCVA 5HDNA 3J80K 5D4SA 4CZZA 1JHFA 4I2OA 3GZ6A 1LQ1A 3NEUA 2OBPA 2VC0A 3F72A 3DPLC 2RVCA 2Q2EA 1R23A 1P4WA 1Y0UA 4LB6B 4ETSA 5CVIA 4WCGA 1H9TA 3I0TA 4HAMA 4BXUA 2KRFA 5BOXA 5E1WA 4CICA 4KFCA 4JK1X 4YFNF 3RYPA 5DDGA 1R5HA 4QLCU 1WRJA 1XCBA 1USSA 3FMSA 1LEBA 5JI6A 2UWMA 1QZYA 4RGUA 2PFBA 3JAMK 2PG4A 4KN4X 2P5KA 1O7FA 4GCVA 2P7CB 4WK8F 1XDUA 6PAXA 3WTSC 1MZBA 4G7OF 2HQNA 4ZZDA 5BPDA 4UHTA 1S29A 2H6CA 3VOEA 5ED4A 3ZP5A 3RPUA 1R1TA 4P9FA 5FFZA 5A2QK 2HGCA 3KCCA 5K5QA 3FWEA 5HLHA 3F23A 3QOPA 1I1SA 5F6FA 4LG0A 5LGTA 1SD5A 2IA2A 4LMYA 5L3DA 3VEPA 4TV7A 2CO5A 2DU9A 4IRGA 1P2FA 4I98B 4BHCA 3C3WA 3VB2A 1J59A 1YIOA 4EM0B 1KU9A 4CXFA 4I7HA 3RPQA 3GX4X 2M87A 4XSZF 3HSRA 3WTZA 4A12A 2GXBA 4HOBA 2L54A 2R7DA 1Z91A 5IT9K 1U2WA 2K4BA 3CO6C 1DPUA 1FSEA 1IN7A 4YIIA 2CG4A 2RN7A 5JVTA 4CDGA 3LQRA 2ZXJA 2WTEA 2DQRA 4L9NA 5D6EA 1KQ0A 4ENJA 3L2CA 4ZZLA 3K1NA 3RKWA 1YFHA 1YLFA 1ZG3A 4JBAA 1FZPB 4DQ2A 3DEUA 2W84A 5LLQA 4EV0A 3ZMTA 3Q5FA 1XSVA 5CVUA 2PJPA 1ZGJA 1KYWA 3KP6A 5D5WB 3KP2A 1OYWA 3LA2A 1HW2A 1XB4A 2XASA 2W25A 3NRVA 4MEXF 1E2XA 1KA8A 2VBWA 4HLYA 2W57A 4G6QA 1IUYA 2E7XA 5CVJA 2V1XA 5FO5A 2STWA 3DP7A 2HTSA 2VBXA 4N9HA 3T0YA 2M5WA 2ESHA 3HYIA 5H6QA 1U5TA 2IW5A 3JW4A 4EVIA 3Q9VA 2C6YA 3WODF 1HQCA 3SQNA 1S3JA 3GFMA 3W6JB 3KEQA 1HW5A 3KP7A 4MQVA 5KK1A 4RGXA 5K1YA 5BMZA 1PUEE 3QU3A 4QWQA 3GYHX 2MC3A 2A69F 3BP8A 5LEKA 1W7PB 4NQWA 1TNSA 2OA4A 3R0JA 3KP5A 3SZPA 1UFMA 2FF4A 5CYVA 4EJWA 1W7PD 1FYLA 2HR3A 1FC3A 3OOPA 1TBXA 2NS0A 1ZH5A 1FSHA 4U7DA 1L0OC 5FFXA 1R1VA 4HF2A 4ZYGA 5LHHA 3U9GA 4LGWA 3P7NA 2A3SA 3K9TA 3GWZA 2QBYB 2WWYA 5L3BA 5EEHA 2M8EA 3TOBA 4FHTA 3L00A 3DKWA 2P7VB 4NB5A 3T8TA 3H3ZA 1IN4A 3KZZA 4ENKA 2LF7A 1GVJA 4Q47A 1TW3A 3BJOA 3ML6A 3SFZA 2W24A 2E7WA 2QWWA 1WQ2A 3M1EA 2YX4A 1FOKA 5H6RA 3GFIA 5LEJA 1P6RA 1KU3A 5D5XB 3G73A 1U78A 1H9GA 1TQPA 1YW8A 3P9IA 2OZUA 5LGNA 2XGXA 1DDNA 2Z3YA 3ZN1A 2FNAA 4UUVA 2P6SA 1MJAA 2HKOA 3HIFA 1S8NA 3E5UA 3JTGA 2BV6A 3GF2A 1OYYA 4HZFA 1USTA 3I53A 1PP7U 1XGMA 1YW7A 3LA7A 2VONA 5JHUA 2L3DA 1LDKB 3BPXA 3D0SA 2BBYA 2ZNZA 1ZRCA 1GXPA 2ACJA 4EJUA 1KU2A 2O61A 2ESNA 2K86A 1T2KA 3DXJF 3WU1B 2Z5UA 5L3GA 1G4DA 2LNBA 2ETHA 1SD6A 3P9KA 2WC2A 4HQMA 4GGGA 4OMZA 3I71A 1B9MA 2CGPA 4HV5A 1Z1DA 4KUMA 2CYYA 3MFKA 4UV9A 4A0XA 2MLGA 3HSFA 2O6GE 2JT1A 3RI4A 4IJAA 1BIAA 2Y0MA 1V3FA 4XBFA 1GXQA 4P55A 1UHMA 1SMYF 1XMKA 3MQ0A 1U3EM 3TKYA 3ZMUA 3N4MA 5E1XA 3QP6A 1K6OA 2L02A 4G7HF 4Y13A 3K0LA 5LHGA 1WI9A 4Z2YA 2EV0A 2DTRA 5ICCA 1SMTA 3EETA 2ISZA 5CLSA 1C0WA 4RB3C 4RB2C 5HDGA 3EDPA 4WXDA 4FX4A 5HS8A 3V4GA 1QGPA
chains in the Genus database with same CATH superfamily
3BZCA 2VKHA 2LSOA 2L7MP 2E1CA 5H20A 3BG7A 1CF7B 2FUG2 3BJ6A 3K4BA 5LGUA 1UJ8A 4XMYA 4XORA 1P4AA 1YJ9I 4PJJA 3ZMZA 1K78A 1EV7A 1RRJA 3U1KA 3DBLB 2QSHX 2G7UA 5E8IA 2BZTA 4XM3A 3JRHA 2QM3A 2OU2A 3K70C 2HZTA 1IRGA 3PUFA 1G3TA 1S7OA 1PYVA 2FOWA 2YX7A 5J8CA 4HNVA 5JLXA 3CCJI 1GHCA 2XVCA 3KE2A 3EUHA 3NWSA 3TDUC 1FY7A 2W1OA 3C18A 4B1RA 4B47A 1I5ZA 2ADUA 2IP2A 2R7XA 4XRFA 3BCAA 2ISYA 5J8FA 3V7CA 3L2UA 2HNHA 1S9HA 1OJLA 3GBGA 4AUXA 1WSUA 4HF1A 3F8CA 1WJCA 2L0KA 3VYUB 4DNCA 3OYBA 2OAAA 2RV8A 3WTXC 3FM5A 4CCJA 5F08A 5HLGA 3OS0A 3IRRA 4RB1A 5F0CA 2FOKA 1W1WE 2WY7Q 4ZYDA 4XQFA 4MTEA 3LNQA 4RM3A 1O3TA 2DLLA 1B59A 4C2TA 2L4MA 4Z6YA 2CUFA 1A35A 3FKIJ 5CQEA 1A36A 4A3BJ 3IKVA 1ZELA 3W6KB 1Q1VA 2DTZA 4A5MA 2DDAA 2GWRA 2IVMA 4ENMA 1BC7C 4RGSA 4PUSA 1U5TC 3OY9A 3H9GA 3J7AY 2X48A 1WWXA 5ICGA 1JE8A 3ERMA 3EQLF 3H5RA 2EFPA 4FX0A 2BE5F 1W36C 3HGYA 2PLYA 2PX9A 4L9VA 1QHGA 3HEFA 1DGRM 3DU6A 2O3FA 1F43A 2VKEA 1SFEA 1U6GA 3CCYA 2KJBA 2EH3A 2DK8A 3H35A 3LSTA 4Y17A 2VUMJ 2V26A 4BAYA 3PSIA 4BXXJ 5F1JA 1QU3A 5FKKA 1TL8A 2CFXA 2X6WA 2R3SA 2GQQA 2ID3A 2MG4A 4P5OA 3I55I 3HTUA 4IKFA 3R60A 3S1NJ 3CLQA 4MTDA 3DLLF 4M6VA 2EK5A 2R92J 4BQAA 5J6XA 2WAQN 2H8RA 3M4OJ 5J1UA 1JHHA 1CGPA 5C4XJ 1ZR2A 3VYSB 2J5PA 4O5VA 1KQ9A 1Y8QB 4KIBA 4KT5C 3REOA 2ZB9A 4C30A 1N25A 5IYBJ 2FQ3A 1TNTA 5IOYA 1IV8A 2KQRA 1B4AA 3BTLA 3FXJA 3LA3A 3JTHA 1YITI 1MH3A 2GLOA 1HA8A 3PVIA 2CU7A 2EQRA 5L3CA 2HS5A 3OSFA 4YFKF 1MNEA 5J1YA 2V9PA 3WGGA 1ODDA 1H89C 3C2HA 1ETXA 3B02A 4LG0B 4D7MA 1ETYA 1F36A 3V7SA 1BBYA 3K1MA 3CMAI 5DCMA 3H5AA 4BYYA 2LFBA 3BDDA 1D0ZA 4I09A 2BY0A 1EH7A 1SEUA 2ZBKA 4UB8C 2KLOA 2IA0A 4PGGA 2CUZA 2FE3A 2DCEA 2O8XA 3RTRA 2R7VA 2VN2A 2QSFX 3WG9A 3GTPJ 3HXLA 2EWNA 4FE7A 1SVLA 4U0YA 2RGVA 4UXNA 3DF8A 3WE2A 4E7HA 2V6CA 2HTJA 5E20A 2KT0A 2QEXI 2STTA 1G3SA 3HC7A 1HKTA 2A07F 2A5YB 3TEDA 3RQIA 1YJWI 4EJVA 3RJPA 2PMUA 1FLIA 2LKPA 3FMRA 3OIPA 1XSDA 3CTAA 3HSEA 2OQRA 1WJ5A 3CJNA 4U88A 1V55H 3R6SA 4A6EA 2HEOA 1EF4A 2G7HA 2YU3A 2ZKZA 4L9TA 3MKZA 4ASNA 1XPXA 3GO5A 4BJ6C 1NH3A 4FQGA 3A2KA 1FJLA 2QUFA 3ZQ7A 1RPWA 2X4HA 1PUFA 2WBMA 3KZYA 3CCMI 3BG3A 4N4OB 1A04A 3DWLE 1JTXA 2DO7A 1T56A 2ELHA 2XIGA 3BR0A 2L7FP 5IP9J 3OYHA 1TC3C 1ZRFA 2HZDA 4XRSA 2DBBA 4XSXF 4L18B 2BEOA 2MW8A 2R7OA 3RZDJ 4IRIA 4E7ZA 2W00A 2R5ZB 1VQMI 3SXYA 1Z7LA 3N97A 5B3SH 2W4SA 4J00A 2P8TA 1R49A 1Z3XA 1FMWA 1JGSA 2IS6A 3QPHA 2LR8A 2Y48A 1K4TA 3G71I 1KONA 1XDSA 3HOZJ 3HOSA 2LRDA 3GZ5A 3HHGA 2BY2A 4DIQA 1EH8A 3L2QA 2BYVE 3IWFA 2IA1A 3VFZA 4IL6C 2DMPA 3IWZA 1Z0XA 3LSIA 1D0YA 3BLYA 3MN2A 1TP4A 2A61A 3K70D 1MMAA 3F6VA 3LSPA 1E3OC 2MFZA 5K7HA 4F52A 4A3GJ 1X19A 1RR7A 2F5CA 4ZJZA 1P4XA 5FKNA 1BI2A 5C44J 1F5TA 3MZYA 5D4RA 1MMDA 1QA6A 4OAYA 1SVOA 4P96A 3J7ZI 4HBLA 2ZO4A 3DEWA 4U0VA 4XL9A 4IPAA 2EB7A 3S93A 1TWAJ 2PEXA 2LDUA 3PSFA 4ENNA 3T5XA 3M1CA 4IRHA 2CV0A 2GBYA 5J1RA 2ZXWH 1Z6TA 4GRIA 3E3VA 2RQQA 2WV1A 3F8BA 1J0RA 4W97A 1U5TB 4S04A 2KIFA 1FOXA 4MHGA 1AWCA 1SFXA 1KU7A 4LLGF 1BC8C 5DD4A 1MDMB 1Z67A 2H94A 4C3IJ 3IH2A 2PJRA 3EUKL 2KIMA 4A3JJ 3BTIA 1IGNA 1I50J 1XTAA 2FD5A 2ZFWA 1OMIA 3BZKA 2CW7A 2CV2A 3MCZA 3QWLA 3MKWB 4Q48A 4ZH4F 4XLNF 4HRIA 3GLLA 1IRXA 1IAWA 1JJ6C 4IHXA 4EJTA 4RA2A 2DMUA 2FXAA 1XGNA 4CHUA 4M9XA 1W36D 2HXIA 3CESA 2CUEA 3H9JA 4DJAA 3H92A 4EM2A 3VDXA 3RZOJ 2VE9A 3LFUA 4RDUA 3JRGA 1BR2A 3V7RA 1YYVA 3K2AA 2VC1A 1HKSA 2Y9YA 1VZ0A 4XRMA 5K7FA 4LD5A 1T33A 2O0YA 1FYMA 2VT2A 2OJED 1LEAA 5EF6A 3PIOF 1WVRA 3F0CA 4IHTA 4MGRA 3AKZA 1R9TJ 4ESFA 2R7SA 3HOVJ 4V2GA 1HXDA 3KEOA 5DUKA 4L0ZB 3ZPLA 3SDBA 2I8DA 3X2QH 1JKPC 1W0UA 5BQTA 3K2ZA 3PFIA 1WI3A 4A3IJ 1QNTA 5GTIC 2COMA 2PN6A 1IN6A 2EILH 3SZTA 4WXCA 2BVLA 3LAJA 3DV8A 3OMYA 1H88C 1OCRH 5ERIA 4XLAA 3FF5A 3VSKA 1WKMA 3F8FA 4LFUA 3CF2A 3CCQI 2FU4A 2Y69H 4PDKA 3SEQA 3BC8A 3DBRB 3FHNA 1V54H 2F5FA 3CCRI 3E5XA 3I58A 4G12A 4A6DA 1EYUA 3DTIA 1UG0A 2KRCA 2FBKA 3AL0C 4RBOA 1NTCA 2H1LA 1BW6A 3O2PE 2IGKA 1R5ID 3LOCA 4LK1F 3I9V2 5LHIA 4FTHA 1EJ9A 2DJIA 2WB1A 1O3SA 2OC6A 1B72A 4P9UA 2JQ7A 3QYFA 1OYIA 3MZ8A 5E3MA 2A5WA 1T08B 4BACA 2IEKA 1BJZA 3RYRA 4B09A 2HKXA 1TWCJ 1TT5B 1SD4A 2VQHA 2RREA 2K4JA 1T0FC 3WTUC 1X1BA 3CCEI 1UHWA 2EV5A 4G7ZF 3H36A 1ZN2A 5FD5A 3H3UA 3HHHA 5GP9A 4AWXB 3BY6A 3CMMA 1JKRC 1HSJA 4DZPA 3F3XA 3ZMDA 2QLZA 5J4VA 4EM1A 2XAUA 5HS7A 3EUHC 4XLEA 4GYGA 4R1HA 1ZTRA 2XRNA 1U0JA 3G3ZA 1IZ1A 5HLTA 1BOBA 1ZARA 2O03A 3TO6A 2EFQA 1UAAA 1FTZA 1YS7A 4UUTA 4F92B 2V6EA 1QZEA 3KIOA 1K7AA 2AHQA 2X6XA 4CO8A 3ZOBA 1IRFA 1MSEC 3QAHA 2P6TA 2R0QC 3P9CA 2XF5A 3L09A 4BE0A 1S72I 4AIJA 1BI1A 1IXSB 2CUJA 4UB6C 2D5VA 2NNYA 3S2HJ 4XKVA 4N9IA 2ME6A 1R1UA 2ME0A 3E97A 1ETQA 2F2EA 5CVRA 2E34A 3WHCA 1YE9A 3WU0A 4F7ZA 3KYLA 4Q4ZF 4U7BA 1FPQA 2DT5A 3ZQGA 5LBQA 1JXSA 1WZ2A 4M71A 1RIOH 1DP7P 2QVOA 1MD0A 3ZMVA 3ZN0A 5E18F 2HQRA 2RNJA 3G4SI 3GTLJ 3M7GA 1V5FA 3HKZN 4B8XA 1I6HJ 2DA6A 4AVPA 4YG2F 2L5QA 5DS9A 4IX7A 1O57A 3NARA 1IDYA 2E2HJ 4PGHA 4XLFA 4N0BA 3PNYA 3TP0A 1JUSA 1Z6RA 5KAFC 1P92A 3CCVI 2RAEA 2D1HA 4KN7X 5IT3A 2ECBA 1RUOA 2HOSA 3JRAA 5HOOA 2XB5A 3WTTC 3AAFA 2V9VA 3CMYA 3C1DA 4RMNA 4M3EA 2R93J 1R6RA 4XLPF 4BHBA 4ITVA 3CQZJ 3O3KA 1POGA 2ZXIA 4H0EA 5ILUA 1AKHB 1WPKA 2EA2A 5BPIA 4GYIA 2IPQX 1RUNA 1G8XA 2H09A 2GOXB 4KJZA 3WE3A 1BI0A 5HDKA 4B3AA 1G2HA 3GVAA 3MKLA 2QQBA 5F04A 4BH9A 2KJCA 3SZGA 4KISA 1O3RA 2JPBA 5IP6A 3EYYA 2K9LA 4NDLA 4I01A 1YW9A 1UB9A 2GIVA 4XOPA 2JPCA 2RC4A 2EIKH 1ETWA 2Y0SN 4I02A 3NQOA 1JJ8C 1X4PA 3ABLH 1BJAA 3J80Z 1GV2A 1WJFA 1LDDA 2WADA 2Z1DA 4K2EA 1FBUA 4I76A 1BR1A 3OYJA 3CJRB 3OR2C 1J09A 2WAQA 2NVYJ 1IDZA 2Q8KA 3RKYA 1K4SA 5D6FA 2ICWG 1OPCA 4EMSA 2HOAA 4HG2A 3PQKA 2WAFA 3DQVC 2K5CA 2HOEA 4UUSA 1R5GA 1UG2A 5B66C 2V1UA 2M45A 4KNYA 2B0LA 1LVAA 2Z33A 3V8KA 1X1DA 5J47A 2GXGA 5AIQA 2L7ZA 4F93B 3DKYA 1K6YA 3LWFA 4YEJA 3SEZA 4IZZA 3PJRA 4OIRF 3V8JA 2R5YA 1YQAA 1LFPA 3CUQA 4V19K 1Q1HA 4ABZA 5FGMA 2DA7A 2VXZA 3OIOA 3A01B 2K3PA 3O6BB 3QQAA 2NVQJ 2QQ8A 5FLXZ 3I3LA 1Z9CA 4F91B 5J40A 3IH4A 1IG7A 3UNGC 3DTKA 1X3WB 5IYDJ 2ID6A 3AL0B 4L5IA 3U2RA 3OSGA 3D5SC 1TWHJ 4KITB 3JR9A 2QENA 3H1CA 2FMLA 4NUBA 3I59A 3AG4H 3P5JA 4OIPF 3JAMZ 2M2EA 3RKXA 2UXNA 3I64A 3Q0WA 1G59A 3IH3A 1D5VA 3CP8A 2XRLA 4BQQA 3Q0UA 1Y1WJ 3JRCA 1I6XA 1MJBA 3JRBA 2YSRA 4D9JA 4IXAA 2Z9OA 2F5DA 1K78B 2MD0A 2VB6A 3HBLA 4XN3A 2ZCWA 1NI0A 3IAM2 3HOYJ 4C2MJ 2A6HF 1BIBA 3OYLA 5F0FA 3F8MA 4HYEA 3ISPA 4KIGA 3JSOA 4UVCA 5A2QZ 4HPQA 1YO5C 4DW6A 3ASNH 1B6AA 2KFDA 3DCFA 3FK6A 4II3A 1FEXA 1A6QA 3BROA 3T1BA 5JLWA 3BR6A 4DZJA 2AS5F 1HLVA 5CVVA 1OLTA 5JVGF 2H27A 2YR2A 1QBJA 2MA3A 1LB2A 4PSXA 2EA4A 3S32A 3JSPA 2M30A 2QYOA 2HWVA 4XNFA 4M73A 1B8IB 4LIVA 1IN5A 3HB9A 1JT6A 3L1PA 3VWBA 2FBIA 2ZMEA 3M8FA 1N75A 1E17A 3RDIA 4IEJA 1DPRA 2UUZA 2F5EA 2D1VA 2CQNA 2DFIA 4I0AA 1ZLKA 2WV0A 3K69A 2A68F 4ANJA 1S6LA 3E6CC 1BOAA 3BG9A 1YTYA 3ONQA 4NNJA 1OCTC 4IOAF 2YPRA 4RB0A 3UKGA 3TOAA 1X1PA 2OZ6A 2WY8Q 3HRMA 4NC6A 5DTDA 3FISA 1ZGWA 2M0CA 1IN8A 5IT9Z 2HYGD 2OF7A 3DPTA 4ZDOA 1SFKA 2NAZA 5AONA 4CSWA 1DU0A 2LD5A 3K7AJ 2LOOA 2Q2EB 5IP7J 5H2FC 1FWZA 2E1MC 2GZWA 4HX4A 4KICA 3W2WA 3A0HC 2BHZA 1VQ7I 1WGXA 1NG6A 3R0AA 5D5VB 5GPAA 2PMZN 1ITYA 3D5RC 2FMYA 3OYNA 1X2NA 3S15J 1DP3A 2JA5J 3G1OA 4MIMA 5FKMA 4QTRA 1LKXA 2BY3A 2EZIA 4PJLA 3SHFA 2BOLA 2DPDA 3AG1H 4A5NA 3HRUA 3OYIA 2RNGA 2TRTA 5DCFA 3L2WA 2E71A 3L7WA 3V8LA 3RKQA 1R22A 4BE2A 3IAS2 3AG2H 2LLKA 3AG3H 4KIFA 2R7FA 2V1DA 4WX9A 4DYRA 3MVPA 1I3QJ 2AXLA 2ZFUA 1DGWY 3M8EA 4JOMA 2V79A 3FMQA 3MWMA 2IXSA 1MMSA 3VODA 4FISA 1ZGAA 2E5ZA 2J5OA 1M1EB 3HPHA 2IT0A 2XPVA 4M3BA 3TO9A 4BKXA 3HTSB 2DA5A 1TWFJ 1ZYRF 1HKQA 5GAGJ 4ZYHA 3BR3A 3MKYB 1BN5A 1NHAA 1ORKA 1JKOC 3HOTA 4GXOA 4OOIA 1BL0A 4D5FA 1R4MB 2PQ8A 4IHVA 1ULYA 5DCMB 3HRTA 3K10A 5LRSA 2NVXJ 2X6YA 3HUGA 1RI7A 2F6CA 3GFLA 2CS3A 1S7AA 1SAUA 2E1NA 2NNNA 3S17J 2LMDA 1O7LA 2QCOA 1IW7F 1QVUA 2B7EA 4MQ9F 1J7KA 2XGEA 3I4PA 4RS8A 2IGOA 2GA2A 4RAGA 1PP8F 2FBHA 3OS2A 2MLKA 3GLXA 3OS1A 4KYWA 3E6BA 3E1SA 2M7AA 2CW0F 4KMFA 2IRFG 5FLXK 1TTYA 5HVQC 1PJRA 4C9YA 1O3QA 1BI3A 1LJ9A 3FM3A 1F1ZA 4E7JA 4GO1A 4U0WA 3RPUD 3IC7A 2Q1ZB 3CDIA 2XPWA 5EJCA 3OYAA 4O3MA 1J2XA 2AQFA 3ZQHA 1FT9A 4UNOA 3M9AA 1V5EA 3TGNA 1PUFB 2X9DA 3S2WA 2Y2ZA 1F0OA 4HX7A 2FNPA 4M3GA 3CCLI 2XKPA 4FT8A 1MW7A 1OKRA 2MH2A 1R4NB 1TQIA 1MMNA 1RZ4A 3GUDA 5DUIA 3JRDA 1NG7A 4EATA 2PMHA 1XX5A 1J5YA 1APLC 2JUGA 1FP1D 2M7BA 4A2UA 4KA4A 2M4KA 1FX7A 2X0LA 2VT3A 1X1AA 3BTJA 5LRRA 1BM9A 3ZQIA 2KP6A 4IHSA 2LBFA 1YRNA 2KMUA 2ECCA 5E1ZB 1J9IA 1T39A 4IQ4A 1EA3A 3FXKA 3Q9SA 2MGQA 2R4GA 5D8LB 5FD6A 1CQTA 4ZTJA 2UV1A 4A69C 1W5SA 3PQJA 1RKTA 3ABKH 2KPMA 3ULQB 2VKDA 3IKTA 1OQYA 2LY9A 1YS6A 5J3LA 2E19A 1FYKA 3MD2A 4GFBA 1G6NA 3S1QJ 2OD5A 2XROA 1RKWA 2LG4A 1R58A 3QPSA 1VQ4I 4D5CA 1ETVA 2QQ9A 4A3CJ 2V1NA 1FP2A 2BXZA 2FA5A 4G6DA 4Y15A 4IHWA 3BJAA 1MGTA 4CH7A 1W5TA 5L3FA 2ZJ2A 2K9MA 1RESA 1B1BA 4M72A 3FX3A 3WG7H 1ON1A 3ZR8X 3OIQA 3DBHB 4AIKA 4BNCA 1IF1A 3FKJA 5LD2C 4OIOF 2K02A 3ELKA 1U8BA 4KMUX 4B48A 3KFWX 3OL4A 5E3NA 3PM1A 2VL8A 4LJZF 1IXCA 3GTMJ 5DM6F 3CO7C 2OV7A 2JSCA 2PJRB 2QA4I 4NHJA 1VFCA 2VQLA 2HQ5A 3HKZA 2RKHA 4LB5A 4Y7NJ 3IL2A 1XGOA 1XD7A 4HF0A 4PZJA 4AIDA 4N4NB 3S3OA 1YIJI 2VOOA 2DOAA 2G0EA 1WH5A 2HVSA 1PVEA 2E1MB 4R79A 1V5GA 3QPTA 3K4MA 3TMOA 4BHPA 4BBSJ 2D45A 3TQNA 4R8HA 1EKEA 4HX8A 2Y31A 3B6AA 1D0XA 3W2VA 1KYZA 5EG0A 2R7ZJ 1ZK8A 5HNFA 4BDZA 2D2WA 1R36A 2E60A 1D1AA 2VE8A 2EFOA 1WHUA 4CYDA 3PO2J 4BDYA 1MJ9A 3U1DA 3R4KA 2ZJRF 5DD8A 1OFCX 1IXRC 2VJJA 1FBSA 3E6MA 2FRHA 5F64A 3M8JA 3E6DA 4XLHA 1UHSA 2MABA 3WTYC 2COBA 4UVBA 2KKOA 4MFEA 5M5YJ 2ZNYA 3MAJA 2JTVA 4UV8A 3IRQA 2W48A 2NXNB 3GXOA 3S14J 3W3CA 1TQMA 1H56A 3KPHA 4E70A 3MZHA 3GTOJ 5FLVA 1Y8RB 2Y0SA 2ODHA 1HDDC 2Z16A 2P5LC 1RC9A 4NQWB 2X51A 4LLLA 2XAFA 4IF4A 4HEA2 1SD7A 2M9HA 2OCCH 2MYSA 5DEQA 5JHFA 1XMAA 4LK0F 4XK4A 1L3LA 1LUJB 3I56I 2CQ7A 4WXHA 2JMWA 1ONVA 2HFHA 2NS8A 5J4YA 4M6XA 5HS9A 2UXXA 3CUQC 1LE8A 1U9NA 2P4WA 2OCEA 2CSOA 2DK5A 3ERED 3KEYA 2XAJA 3ROUA 2JK3A 4JQFA 4ZYEA 1YI2I 1XSXA 3DFGA 5JR3A 3S1RJ 2M4GA 4MLOA 5M5XJ 2LP0A 2RQPA 2VKVA 4OMYA 4M6YA 1ZLJA 2BGCA 4G9YA 2EINH 1MDMA 1ZRDA 9ANTA 3I4MJ 3OV8A 2M1BA 2JUCA 2XPUA 3FBIB 2L4AA 4W1UA 1STZA 3CDHA 1B72B 3QRFF 3FXQA 4EGZA 2FEZA 2KRHA 3FXMA 1N77A 4HQEA 5GADJ 5CQGA 4WWCA 2WA0A 2DN0A 2ZXHA 2DPUA 2E5NA 3BCBA 1VQKI 3LSKA 5HLIA 2LC2A 2JRTA 2KL4A 4UVAA 3A1YA 4EQQA 1K79A 3CCUI 1Y6IA 2VODA 2K9NA 4HLXA 1ENHA 4AIHA 4HDUA 3A03A 4S05A 2X1EA 2VXDA 3ZCOA 3CZ6A 1J75A 5FRNA 1GT0C 1TW2A 2MBFA 4RLFA 1T98A 2EZLA 1W4MA 4PJNA 4I0BA 5FJ8J 3SJMA 5TJJA 4B4CA 1PDNC 3EPZA 2BXYA 1KQ8A 5JFRA 2EIJH 2V9KA 3B73A 4A3DJ 1R7JA 2XAGA 3A02A 4AVZA 1QZZA 1VTNC 4YIRX 2CV1A 4PCQA 1W7PA 2LY1A 3RIRA 2ZMEC 2VPLA 4WF2A 3ECHA 4A3KJ 3D5LA 2L7KA 4HA8A 4J01A 2W85A 4L9JA 3K4CA 4M3DA 2CQXA 2DAOA 1KZHA 1YX5A 1JUPA 4RAFA 1X58A 4EGYA 4KT6A 3PFYA 1MBJA 5E3OA 1ZAOA 5F27A 1I27A 2VQCA 4AD9A 1UMQA 1HCRA 4RAYA 1MNDA 3NAUA 3COAC 1SFUA 5HODA 4BEHA 3D1NI 2VJIA 1SAXA 2IJLA 1T38A 3KZIC 2JZYA 4IHYA 3GW2A 1EH6A 1Z05A 4II2A 1LNWA 4QSHA 3BZ6A 1T6SA 5AIPA 2VLAA 1BA5A 3S2DJ 2MD5A 2LYCA 2DT6A 1FNNA 1XC5A 3BG6A 5FB2A 2O7OA 1RNLA 3CUOA 4M74A 2Q0OA 2K40A 1V4RA 3FHZA 2V7FA 1ZG1A 2JVHA 3IMBA 3F8NA 3GZNB 5IYCJ 2QBYA 1E3PA 2K7LA 1DUXC 5ICFA 5C3EJ 2K9QA 2DQLA 1TWGJ 2QF7A 2PMZA 1ZG5A 1D5YA 2UZKA 2JJ7A 1U8RA 3ESWB 1ZREA 3VYRB 4ON0A 3J81Z 4RAZA 2L2OA 4BXFA 4L5EA 2IS4A 2GXAA 4YIFA 1LDJA 1ON2A 1JGGA 3ABTA 1MKMA 4CCMA 2W7NA 4ZYAA 4DYCA 3KLOA 3W2AA 4O6JA 3H5NA 2H6BA 2LY2A 4A0ZA 4ZDPA 2DA4A 4V2FA 1TT0A 1FMVA 5E3LA 5M5WJ 3KETA 3RQ4A 2E2IJ 3GCMA 5CJ9A 3MEXA 4UUSB 2EZHA 4XKBA 1R00A 4BJ5C 5L3EA 4NC7A 1OR7A 4CYCA 1W0TA 5ILSA 2XGDA 2NRAC 3GTQJ 3CJQB 4A3EJ 1VQ9I 3ECOA 3QPLA 3CC4I 2Q10A 2F4OB 1LFBA 1QPMA 1JKQC 4EJOA 5D8KB 1HSTA 4LG3A 5E8GA 3A0BC 3FZVA 2K27A 3PNVA 2R5YB 2GA1A 3CUQB 2P5VA 1P7IA 4YFXF 2ELKA 2QZ8A 4FETA 4RGRA 4Q5SF 1H0MA 2N8GA 3ZQCA 1ACIA 2LREA 3U21A 2DW4A 3BTCA 3HRSA 5DYMA 3HOXJ 4MEYF 4G6TB 3FXRA 3I59B 4CUGA 3JRFA 3KYDB 4P1WA 3C7JA 4OINF 1REPC 4E7LA 2A6EF 2XV4S 2XHKA 2IAIA 2VOPA 1ZHFA 1HBXG 3I54A 2FSWA 1F9NA 2E2JJ 2HDDA 2V4JC 4OU0A 3LL7A 2JWTA 2GAUA 2M3AA 4CGZA 3WGHA 2KDZA 2NOGA 1R71A 2IS2A 4DBQA 1YG2A 2MH9A 4GDFA 4B3XA 1GDTA 3T8RA 2EFNA 1D8KA 3DEEA 2CQKA 4A0YA 5B1AH 2VBZA 1T8IA 2ZSHB 1WFXA 3BT9A 1NK2P 2M8GX 1FBQA 1YJNI 3WTWC 4L0YB 5E17F 4OAZA 1D8JA 2ELJA 5IOZA 2XSDC 4FCYA 1MBKA 3CLOA 1RR8C 3BPVA 2BY1A 3KLNA 3QP5A 3LFKA 2G9WA 3IHUA 3KYCB 2RDPA 3KP3A 2XAQA 5ICEA 2O9LA 2PI0A 2BHYA 3S1MJ 4ESBA 2MC4A 5KCMA 4KDPA 2Y9ZA 3JREA 2LKXA 5EZGA 1I3AA 2YUSA 5K5OA 2XAHA 1G3WA 2JN6A 2DI3A 2VIXA 2NVTJ 2R7RA 2ZMEB 2KHMA 3ZQLA 1HW1A 1Z7UA 3Q3SA 3N05A 2BVMA 2JA6J 2L01A 5KVRA 2FX0A 1ETKA 2Z99A 2HDWA 1TZLA 2O5RA 4OIQF 3OYKA 2L9NA 3F21A 4D7NA 4PJMA 4LLNA 3QYEA 2HVRA 3F6OA 1UELB 3QU6A 1NK3P 2TDXA 1G3YA 4HV6A 1WJBA 3PNTA 3TDZC 3BOQA 3BQZA 4IVNA 3GTGJ 4AYBN 5BS6A 3JCUC 3J7AO 3HL2A 1IUFA 3AFHA 2OQGA 4M9ZA 2L9VA 5LFAA 4D0PA 1IRZA 2DFFA 2XSJC 4XICA 2HDCA 1XN7A 2Y75A 3HM5A 1OCCH 2L9SA 3ASOH 3K1PA 2FJ1A 2AQEA 4I99C 2OAZA 4A3FJ 3TO7A 3C2BA 4B43A 3I5UA 1QRYA 5GAHJ 1XGSA 3ZMSA 3F22A 1D3YA 3WTVC 2EJRA 2LF8A 4AU7A 1X3UA 2CWEA 4BS9A 1W5CC 4E7SA 1OISA 5BNGA 3LQQA 2H1KA 1ETOA 4J19A 1I1GA 5EEAA 2XKOA 1T0FA 3EUAA 2R7WA 1Z21A 1KGSA 3L9FA 4G94A 1QHHD 1TLHB 4EEFG 4IO9F 2HVQA 3MMYB 1AOYA 2QQAA 2LK2A 5CKTA 3TP3A 5D5UB 2XUBA 3GFJA 4HDVA 3K4NA 4ESJA 5KNLA 2BW3A 1MNMC 4CZCA 1E3HA 3J81K 2QSGX 2QKLB 2NYXA 4L5JA 5ILVA 5EEGA 4AC0A 5EGOA 1ZR4A 2PBIA 2HXOA 1F4KA 5TRDA 2F48A 1B9NA 3R61A 1QO0D 3TW7A 4BE1A 3OYGA 3EYIA 2HYFA 1CF7A 3E5QA 4OWRB 3H0DA 4LIUA 4X1EA 2KIUA 4FE4A 2LH9A 4ZTFA 1UCRA 4E7IA 3GEZA 3HUGB 1VNDA 1B8IA 4HW0A 3BWGA 3HOUJ 3WGIA 4M3FA 3KX2A 3ABUA 3FXUA 1QQIA 4E6KG 5F1RA 1K83J 2EV6A 3LAPA 5DV5A 4M9SA 4G8XA 3SDGA 2EFWA 5M3FJ 2DMQA 4MNUA 5K5RA 3IUOA 2AXTC 3KP4A 4DGWB 2VBYA 5B5EC 1XCVA 3RSNA 3K6GA 5HDNA 2A05A 4I6ZA 3J80K 5D4SA 3ZQFA 4CZZA 4DOZA 2M34A 1JHFA 3OYEA 3DU5A 4I2OA 3GZ6A 1LQ1A 3NEUA 2EIMH 2OBPA 2VC0A 3F72A 2DDBA 1GUUA 3OYMA 3DPLC 3SFIA 2OUMA 3HG9A 1E0EA 1DU6A 2RVCA 2Q2EA 1R23A 1P4WA 1Y0UA 4XKWA 4DBRA 4LB6B 1GV5A 1Z77A 2YS9A 5CVIA 4ETSA 1XG1A 4WCGA 2F4MB 1A31A 2GM4A 1H9TA 5EDNA 4Y4RA 3I0TA 4HAMA 1VI0A 5DM7F 2MSYA 1VQ6I 2JA8J 4XR6A 4YRVA 4BXUA 2KRFA 5BOXA 4Y33A 1OCZH 5E1WA 4CICA 4KFCA 4JX5A 4JK1X 4BY7J 4LOCA 4YFNF 3RYPA 3LSJA 4XONA 2IGMA 2LBFB 1R5HA 4BQOA 5DDGA 4QLCU 1YRNB 1WRJA 1XCBA 1WCMJ 4QPQA 1USSA 2OTJI 3FMSA 3WU2C 1HC8A 1LEBA 1N78A 5FROA 1BR4A 5JI6A 4E7KA 2UWMA 1QZYA 4RGUA 2PFBA 1MH4A 4BJTA 3H3VK 4HSRA 3K4KA 4JX6A 2ZC2A 3FK7A 2LTPA 4H4KC 4RLQA 3JAMK 2PG4A 2DA1A 4KN4X 1UZCA 3LSMA 2P5KA 4C2UA 1D1BA 1HDPA 1O7FA 3FDYA 4X6AJ 4GCVA 2P7CB 1GVDA 2XF6A 3TBIA 4WK8F 1XDUA 6PAXA 3WTSC 3S16J 1MZBA 4G7OF 2HQNA 2KISA 4ZZDA 4PFPA 5BPDA 4UHTA 1MBHA 1S29A 3I4NJ 2H6CA 3FXLA 4JX4A 3VOEA 5ED4A 3ZP5A 2IGNA 3RPUA 5B1BH 1R1TA 2CRGA 1DQUA 4P9FA 3UR3C 5FFZA 5A2QK 2ODIA 4U87A 2K3FA 4Y3OA 3LSRA 3CCSI 4BBRJ 5EYRA 2HGCA 3KCCA 5K7ZA 2HI3A 5K5QA 1YX3A 3FWEA 5HLHA 2VASA 5FKLA 1VQ5I 3F23A 2B63J 2NS7A 3QOPA 2DODA 1I1SA 1OCOH 2DMNA 5F6FA 4LG0A 2W82A 5LGTA 1SD5A 2EBIA 1ZQ3P 4ZC3A 4A3MJ 2IA2A 4QPOA 1T95A 4LMYA 3RCOA 5L3DA 3VEPA 3CMEI 4TV7A 2CO5A 2K9SA 4PK4A 2DU9A 2F5VA 1P2FA 4I98B 4IRGA 5EG0B 3CC7I 3PUBA 4BHCA 1PVUA 3C3WA 2X1DA 3VB2A 1J59A 2VJ4A 3L2VA 1A5JA 1YIOA 4EM0B 1KU9A 4CXFA 1WJAA 3FBNB 4I7HA 5TGTA 3RPQA 3GX4X 2M87A 3LSGA 4XSZF 3L2RA 4AM3A 3HSRA 2AO9A 3WTZA 4A12A 2GXBA 4HOBA 2L54A 3ZRGA 2R7DA 2JSPA 1Z91A 3ZXSA 1U2WA 5IT9K 2K4BA 3CO6C 1LFUP 1DPUA 5GTHC 2VI6A 2B9SA 1SVMA 1FSEA 2E36A 1IN7A 4YIIA 2CG4A 1LVKA 2RN7A 2LKSA 5JVTA 4CDGA 3LQRA 2ZXJA 2NVUB 2WTEA 1OR7C 2DQRA 4L9NA 5D6EA 1KQ0A 4S0HB 2CQQA 4ENJA 3L2CA 4ZZLA 3TW6A 2EPFA 2P81A 5HNHA 3VSLA 3K1NA 2VQGA 3DKXA 3OYFA 3RKWA 1YFHA 1YLFA 1ZG3A 2CH0A 4JBAA 1LE8B 2R5ZA 4IOCF 1FZPB 3ZGKA 1HF0A 5E79C 4DQ2A 2DFEA 3DEUA 2W84A 3M3YJ 4E4HA 5LLQA 4EV0A 3ZMTA 2R7UA 1PVIA 3JRIA 3Q5FA 1XSVA 3HOWJ 5CVUA 2PJPA 3HGGA 3VPRA 2JA7J 1ZGJA 1KYWA 2LVSA 1WJDA 3KP6A 5D5WB 3KP2A 4CCLA 2VPRA 1FOWA 1OYWA 3LA2A 1HW2A 1XB4A 2JVGA 2XASA 2W25A 2ZJPF 3QODA 3NRVA 4MEXF 1FIPA 1E2XA 1KA8A 2VBWA 4HLYA 2W57A 4G6QA 1IUYA 2E7XA 5CVJA 4XLCA 4C3JJ 2V1XA 5FO5A 2DOEA 2EZKA 3DP7A 2STWA 3CC2I 2HTSA 2VBXA 1H8AC 1P7JA 1S7EA 3A4CA 4N9HA 4D1QA 3H9QA 3T0YA 2M5WA 2ESHA 3HYIA 2CMPA 5H6QA 4C3HJ 1U5TA 2DMTA 2IW5A 4IQJA 1FOYA 3CD6I 1LPQA 3JW4A 4EVIA 3ZQQA 3Q9VA 1VQOI 4XOTA 2C6YA 3WODF 1HQCA 3SQNA 1S3JA 3GFMA 1YHQI 2KIQA 3W6JB 3KEQA 1HW5A 3G1MA 3KP7A 3PIPF 4MQVA 5KK1A 4RGXA 1JUMA 3GMEA 5K1YA 5TISC 2HOTA 4QIWN 5BMZA 4CCNA 1PUEE 4BU2A 3QU3A 4QWQA 3GYHX 1JTYA 2MC3A 2A69F 3G1LA 3BP8A 5LEKA 4FASD 1W7PB 4NQWA 2X1CA 1TNSA 2OA4A 1Y0NA 3LMMA 3E7LA 5FLMJ 1X3ZB 3R0JA 3KP5A 3SZPA 1UFMA 2FF4A 5CYVA 2XF7A 3DPUA 4EJWA 2FQ4A 1K0ZA 1W7PD 1FYLA 2A6TA 3BG5A 1VQ8I 2HR3A 2Z2SB 1FC3A 3BR5A 4DYQA 3OOPA 5IPAA 1JT0A 2HPMA 3HDDA 3VYTB 1TBXA 2NS0A 1ZH5A 2DA2A 2X85A 2M0MA 4BEHB 1IJWC 2YU9J 1ZKGA 2F4IA 4PJ0C 3G6EI 1FSHA 4U7DA 4RM2A 2DYSH 1XS9A 1L0OC 5FFXA 1R1VA 4CCKA 4HF2A 4ZYGA 5LHHA 3U9GA 4LGWA 3TL4X 3P7NA 2KDOA 1QPIA 4ZDLA 2A3SA 3K4LA 3K9TA 4AYBA 4A3LJ 1RETA 3S3MA 3Q0VA 1VQLI 1P9QC 3GWZA 1AHDP 2QBYB 2WWYA 5L3BA 2XC7A 3NWTA 1FIAA 2GIZA 3CJTB 5EEHA 2DYRH 2M8EA 5KHDA 2HPIA 1X4OA 3TOBA 4CA0A 3FXOA 4FHTA 3L00A 3DKWA 2E35A 3C2GA 5GAEJ 2P7VB 4NB5A 3T8TA 2QKMB 3H3ZA 1I39A 1IN4A 3KZZA 3CF5F 4ENKA 2LF7A 1GVJA 1MSFC 4Q47A 1D1CA 1TW3A 3BJOA 3HZJA 3SYTA 3ML6A 1Z3YA 4HNTA 3OYCA 3O8HA 2L9RA 3SFZA 2W24A 2HU9A 2E7WA 2QWWA 4Y52J 4XN0A 1WQ2A 4CYCB 3M1EA 2YX4A 1FOKA 2KZVA 3CP2A 2TCTA 4PFOA 5H6RA 4CCOA 3DLAA 3OWTA 3F9KA 3GFIA 3HPGA 5GPCA 1X1CA 5LEJA 1P6RA 2P0WA 1KU3A 5D5XB 3G73A 1U78A 3OOUA 1WJEA 1MBFA 1SFOJ 2IS1A 1H9GA 1TQPA 2DT7B 1YW8A 1Y1VJ 2IBDA 3DTEA 4BUPA 3P9IA 5KAIC 1VQNI 1AU7A 2DXIA 2OZUA 2XDVA 5LGNA 2XGXA 1O4XA 4XRSG 3FIWA 5IY5H 3IV5A 1DDNA 2Z3YA 3ZN1A 2FNAA 4BQNA 4UUVA 2P6SA 3GTJJ 1MJAA 4A93J 2HKOA 3HIFA 1S5LC 2DA3A 1S8NA 3E5UA 4PSWA 1FTTA 3JTGA 2BV6A 1X2MA 3BR2A 5CPRB 4F3QA 2GOMA 3GF2A 1OYYA 3BR1A 3W6VA 4HZFA 4BGDA 4UY8I 1USTA 1MBGA 3I53A 1PP7U 3PO3J 3GTKJ 3E0JB 1XGMA 2XB0X 1YOVB 1YW7A 3LA7A 2VONA 5JHUA 2VJ5A 2L3DA 1LDKB 1OCPA 2CFOA 3BPXA 3D0SA 2BBYA 2OPTA 2OTLI 2ZNZA 1ZRCA 1GXPA 2ACJA 4EJUA 3WHBA 1KU2A 4XIDA 1IO2A 2O61A 2ESNA 3B6CA 3J7YJ 2K86A 1AA7A 1T2KA 3DXJF 3OYDA 4NBQA 2DFHA 1SANA 2I5UA 3G2BA 3WU1B 3S3NA 2Z5UA 1WH7A 5L3GA 2Y30A 4X0GA 1AKHA 2NOJB 2HYJA 3PL8A 1G4DA 3QOEA 3CDLA 4LITA 2E1OA 2HQAA 2LNBA 1QVTA 1MBEA 2CW8A 2ETHA 2OA9A 1SD6A 3P9KA 4XKCA 1K61A 3H0GJ 2WC2A 2XGCA 4HQMA 4JYKA 3OR1C 3HJEA 5F0HA 5EZHA 4GGGA 4OMZA 2R7QA 4MO7A 3I71A 1IC8A 1IV6A 1BW5A 1B9MA 2CGPA 4HSTA 4HV5A 2R7TA 1Z1DA 1SC7A 3V42A 4HNUA 5M3MJ 4KUMA 2CYYA 2CJJA 3M07A 1HOMA 4JP0A 2KZGA 3MFKA 1Y39A 4UV9A 1ERDA 5FKOA 2MLGA 3HSFA 4A0XA 2O6GE 2JT1A 3BQYA 4B44A 5C4JJ 2JRMA 3RI4A 2H8WA 4IJAA 4BY1J 1VF9A 1BIAA 2Y0MA 2JA2A 1V3FA 4XBFA 2I10A 1GXQA 3S8PA 1GLNA 1Y56A 4YELA 1XMXA 3OL3A 2ZSIB 4P55A 1U9OA 1UHMA 1SMYF 1XMKA 3MQ0A 4MFDA 1MMGA 3LSHA 1U3EM 2WAEA 3QYBA 3TKYA 3ZMUA 3N4MA 2DJNA 3O8GA 5E1XA 4NC8A 3QP6A 3ABMH 2O8KA 3IP4B 2X6OA 1K6OA 2WB1N 3A01A 2L02A 4G7HF 4Y13A 3K0LA 2QGUA 4BL0B 5LHGA 1WI9A 4Z2YA 2EV0A 4F55A 2ZJQF 1MIJA 2DTRA 5ICCA 1SMTA 2PVIA 3K4JA 1JI8A 3EETA 2ISZA 2K85A 2BW3B 5CLSA 1C0WA 4RB3C 5FRMA 4RB2C 5HDGA 3EDPA 4WXDA 1A6IA 1VQPI 5EGOB 2DOFA 4FX4A 5HS8A 3V4GA 1QGPA
chains in the Genus database with same CATH topology
2LSOA 2E1CA 5H20A 1CF7B 3BJ6A 5LGUA 1P4AA 3ZMZA 1K78A 1EV7A 2G7UA 5E8IA 2QM3A 2OU2A 2HZTA 1IRGA 1G3TA 1S7OA 2YX7A 5J8CA 1GHCA 2XVCA 3KE2A 3EUHA 3TDUC 1FY7A 3C18A 1I5ZA 2ADUA 2IP2A 4XRFA 2ISYA 5J8FA 3V7CA 1WSUA 4HF1A 3F8CA 2OAAA 4DNCA 2RV8A 3WTXC 3FM5A 5HLGA 3IRRA 4RB1A 2FOKA 4ZYDA 4MTEA 1O3TA 2DLLA 1B59A 2L4MA 3IKVA 3W6KB 4A5MA 2GWRA 2IVMA 4ENMA 1BC7C 4RGSA 1U5TC 1JE8A 1WWXA 5ICGA 3EQLF 2EFPA 4FX0A 2BE5F 2PLYA 4L9VA 2O3FA 1SFEA 1U6GA 2KJBA 2DK8A 3LSTA 4Y17A 4BAYA 2CFXA 2R3SA 2GQQA 4P5OA 3HTUA 3R60A 4MTDA 2EK5A 4BQAA 5J6XA 1JHHA 1CGPA 2J5PA 4O5VA 1KQ9A 4KIBA 4KT5C 3REOA 2FQ3A 1TNTA 1B4AA 3LA3A 3JTHA 5L3CA 2HS5A 4YFKF 3WGGA 1ODDA 3B02A 4LG0B 3V7SA 1BBYA 3K1MA 5DCMA 4BYYA 3BDDA 4I09A 1EH7A 2ZBKA 2IA0A 4PGGA 2FE3A 2O8XA 3RTRA 2VN2A 3WG9A 2EWNA 4U0YA 2RGVA 4UXNA 3DF8A 3WE2A 2V6CA 2HTJA 5E20A 2STTA 1G3SA 1HKTA 2A07F 2A5YB 4EJVA 3RJPA 2PMUA 1FLIA 2LKPA 3FMRA 1XSDA 3CTAA 3HSEA 2OQRA 3CJNA 4U88A 3R6SA 4A6EA 2HEOA 2G7HA 2YU3A 2ZKZA 4L9TA 4ASNA 3GO5A 2QUFA 3ZQ7A 2X4HA 3KZYA 1A04A 2DO7A 2ELHA 2XIGA 1ZRFA 4L18B 2DBBA 4XSXF 2BEOA 4IRIA 3SXYA 3N97A 2P8TA 1JGSA 3QPHA 2Y48A 1XDSA 3HOSA 3GZ5A 3HHGA 1EH8A 2BYVE 3IWFA 2IA1A 3VFZA 3IWZA 2A61A 3F6VA 2F5CA 1P4XA 1BI2A 1F5TA 3MZYA 5D4RA 4P96A 4HBLA 2ZO4A 4U0VA 4IPAA 2EB7A 2PEXA 2LDUA 4ENNA 3T5XA 4IRHA 1Z6TA 3E3VA 3F8BA 1J0RA 4S04A 1U5TB 2KIFA 4MHGA 1AWCA 1SFXA 1KU7A 4LLGF 1BC8C 5DD4A 1MDMB 2H94A 2KIMA 2ZFWA 1OMIA 3MCZA 4Q48A 4ZH4F 4XLNF 1IAWA 4EJTA 2FXAA 1XGNA 4CHUA 4M9XA 3H92A 4EM2A 2VE9A 3V7RA 1YYVA 2VC1A 1HKSA 4LD5A 2O0YA 1FYMA 2VT2A 1LEAA 4IHTA 4MGRA 4ESFA 1HXDA 3KEOA 5DUKA 4L0ZB 3ZPLA 5BQTA 3K2ZA 3PFIA 1QNTA 2COMA 2PN6A 1IN6A 3SZTA 4WXCA 3LAJA 3DV8A 5ERIA 3FF5A 1WKMA 3F8FA 4LFUA 2FU4A 4PDKA 2F5FA 3E5XA 3I58A 4A6DA 2FBKA 3O2PE 4LK1F 5LHIA 1O3SA 4P9UA 1OYIA 3RYRA 4B09A 2HKXA 1SD4A 2K4JA 3WTUC 1UHWA 2EV5A 4G7ZF 1ZN2A 5FD5A 3H3UA 3HHHA 4AWXB 3BY6A 1HSJA 3F3XA 3ZMDA 2QLZA 4EM1A 5HS7A 4GYGA 4R1HA 2XRNA 3G3ZA 1IZ1A 1ZARA 2O03A 3TO6A 2EFQA 1YS7A 1K7AA 4CO8A 1IRFA 3QAHA 2P6TA 3P9CA 3L09A 4AIJA 1BI1A 1IXSB 2NNYA 4N9IA 1R1UA 5CVRA 3E97A 3WU0A 2F2EA 4F7ZA 4Q4ZF 4U7BA 1FPQA 2DT5A 5LBQA 1JXSA 4M71A 1RIOH 1DP7P 2QVOA 1MD0A 3ZMVA 3ZN0A 5E18F 2HQRA 2RNJA 3M7GA 4B8XA 4AVPA 4YG2F 1O57A 4PGHA 4N0BA 1Z6RA 1P92A 2D1HA 4KN7X 5IT3A 1RUOA 5HOOA 3WTTC 3AAFA 2V9VA 3C1DA 4XLPF 4BHBA 3O3KA 4H0EA 5ILUA 2EA2A 5BPIA 4GYIA 2IPQX 1RUNA 2H09A 3WE3A 1BI0A 5HDKA 3GVAA 2QQBA 4BH9A 2KJCA 1O3RA 2JPBA 3EYYA 4I01A 1YW9A 1UB9A 2GIVA 2JPCA 2RC4A 4I02A 3NQOA 1BJAA 3J80Z 1LDDA 4K2EA 1FBUA 2Q8KA 3RKYA 5D6FA 1OPCA 4EMSA 3PQKA 3DQVC 2HOEA 1R5GA 2V1UA 2M45A 4KNYA 2B0LA 2Z33A 1LVAA 3V8KA 2GXGA 5AIQA 3LWFA 4OIRF 3V8JA 1YQAA 3CUQA 1Q1HA 5FGMA 2VXZA 3O6BB 5FLXZ 1Z9CA 4L5IA 3U2RA 2QENA 2FMLA 3I59A 4OIPF 3JAMZ 3RKXA 2UXNA 3I64A 1D5VA 1I6XA 1MJBA 2YSRA 4IXAA 2Z9OA 2F5DA 1K78B 2ZCWA 2A6HF 1BIBA 3F8MA 4HYEA 3ISPA 4KIGA 3JSOA 4UVCA 5A2QZ 1YO5C 1B6AA 3BROA 3T1BA 2AS5F 5CVVA 2H27A 2YR2A 1QBJA 2MA3A 1LB2A 2EA4A 3JSPA 2M30A 2QYOA 2HWVA 4M73A 1IN5A 2FBIA 2ZMEA 3M8FA 1E17A 3RDIA 1DPRA 2F5EA 2D1VA 2DFIA 4I0AA 1ZLKA 2WV0A 3K69A 2A68F 3E6CC 1S6LA 1YTYA 1BOAA 2YPRA 4RB0A 3TOAA 2OZ6A 3HRMA 1IN8A 5IT9Z 2HYGD 3DPTA 5AONA 2NAZA 1FWZA 2GZWA 4HX4A 4KICA 3R0AA 5D5VB 2FMYA 3SHFA 2DPDA 4A5NA 3HRUA 5DCFA 3L7WA 3V8LA 1R22A 4KIFA 2R7FA 2V1DA 4WX9A 2AXLA 3M8EA 2V79A 3FMQA 3MWMA 3VODA 1ZGAA 2J5OA 2IT0A 3TO9A 3HTSB 1ZYRF 1HKQA 4ZYHA 1BN5A 1NHAA 3HOTA 4GXOA 4OOIA 2PQ8A 1ULYA 5DCMB 3HRTA 5LRSA 3HUGA 1RI7A 3GFLA 1S7AA 2E1NA 2NNNA 1O7LA 1IW7F 4MQ9F 1J7KA 3I4PA 4RS8A 2GA2A 1PP8F 2FBHA 2MLKA 3GLXA 4KYWA 3E6BA 2CW0F 4KMFA 2IRFG 5FLXK 1TTYA 5HVQC 1O3QA 1BI3A 1LJ9A 3FM3A 1F1ZA 4GO1A 4U0WA 3IC7A 4O3MA 1J2XA 1FT9A 4UNOA 3M9AA 3TGNA 3S2WA 4HX7A 2FNPA 2XKPA 4FT8A 1OKRA 2MH2A 1TQIA 5DUIA 1RZ4A 3GUDA 2PMHA 1J5YA 1FP1D 4A2UA 4KA4A 1FX7A 2X0LA 2VT3A 5LRRA 1BM9A 4IHSA 5E1ZB 1J9IA 1T39A 3Q9SA 5D8LB 5FD6A 1W5SA 3PQJA 3ULQB 3IKTA 1YS6A 1FYKA 1G6NA 2OD5A 2XROA 1R58A 2QQ9A 1FP2A 2FA5A 4G6DA 4Y15A 3BJAA 1MGTA 5L3FA 1W5TA 2ZJ2A 1B1BA 4M72A 3FX3A 4AIKA 1ON1A 4BNCA 1IF1A 4OIOF 2K02A 3ELKA 4KMUX 3KFWX 4LJZF 1IXCA 3CO7C 2JSCA 4NHJA 4LB5A 2RKHA 3IL2A 1XGOA 1XD7A 4HF0A 4PZJA 2VOOA 4R79A 3QPTA 4BHPA 2D45A 3TQNA 4R8HA 4HX8A 1KYZA 2D2WA 1R36A 2EFOA 2VE8A 4CYDA 1MJ9A 3U1DA 3R4KA 5DD8A 1IXRC 1FBSA 3E6MA 2FRHA 5F64A 3E6DA 3WTYC 4UVBA 2KKOA 2ZNYA 3MAJA 2JTVA 4UV8A 3IRQA 3GXOA 1TQMA 4E70A 3MZHA 2ODHA 2P5LC 4LLLA 2XAFA 4IF4A 1SD7A 5DEQA 1XMAA 4LK0F 1L3LA 4WXHA 1ONVA 2HFHA 4M6XA 5HS9A 2UXXA 3CUQC 2P4WA 2CSOA 2DK5A 3ERED 2XAJA 3ROUA 4JQFA 4ZYEA 1XSXA 3DFGA 5JR3A 2RQPA 4OMYA 4M6YA 1ZLJA 2BGCA 4G9YA 1MDMA 1ZRDA 3OV8A 2M1BA 2L4AA 1STZA 3CDHA 3QRFF 3FXQA 4EGZA 2FEZA 4HQEA 4WWCA 2DPUA 5HLIA 2JRTA 4UVAA 4EQQA 1K79A 2VODA 4HLXA 4AIHA 4HDUA 4S05A 1J75A 1TW2A 2MBFA 1T98A 1W4MA 4I0BA 5TJJA 1PDNC 1KQ8A 5JFRA 3B73A 1R7JA 2XAGA 1QZZA 1VTNC 4PCQA 1W7PA 3RIRA 4WF2A 3ECHA 3D5LA 4HA8A 2W85A 4L9JA 2DAOA 4EGYA 1ZAOA 1I27A 4AD9A 4RAYA 3COAC 1SFUA 1SAXA 2IJLA 1T38A 2JZYA 3GW2A 1EH6A 1Z05A 1LNWA 3BZ6A 1T6SA 5AIPA 2MD5A 1FNNA 5FB2A 1RNLA 3CUOA 4M74A 2Q0OA 1V4RA 3FHZA 1ZG1A 3IMBA 3F8NA 2QBYA 2K7LA 1DUXC 5ICFA 2DQLA 1ZG5A 2UZKA 1U8RA 1ZREA 4ON0A 3J81Z 4RAZA 4YIFA 1LDJA 1ON2A 3ABTA 1MKMA 3KLOA 4O6JA 2H6BA 4A0ZA 3KETA 5CJ9A 3MEXA 1R00A 5L3EA 1OR7A 5ILSA 2NRAC 3ECOA 2Q10A 1QPMA 4EJOA 5D8KB 1HSTA 5E8GA 3FZVA 2K27A 2GA1A 3CUQB 2P5VA 4YFXF 2QZ8A 4RGRA 4Q5SF 1H0MA 2DW4A 3HRSA 5DYMA 4MEYF 3FXRA 3I59B 3C7JA 4OINF 1REPC 2A6EF 2XHKA 2XV4S 2VOPA 1ZHFA 1HBXG 3I54A 2FSWA 1F9NA 4OU0A 2GAUA 4CGZA 3WGHA 1YG2A 2MH9A 3T8RA 2EFNA 1D8KA 2CQKA 4A0YA 2VBZA 4L0YB 1FBQA 3WTWC 5E17F 1D8JA 3CLOA 3BPVA 3KLNA 3QP5A 3LFKA 2G9WA 3IHUA 2RDPA 3KP3A 2XAQA 5ICEA 2PI0A 4ESBA 4KDPA 5K5OA 2XAHA 1G3WA 2DI3A 2ZMEB 1HW1A 1Z7UA 2L01A 5KVRA 2Z99A 4OIQF 3F21A 4LLNA 3F6OA 3QU6A 2TDXA 1G3YA 4HV6A 3TDZC 3BOQA 4IVNA 5BS6A 3J7AO 2OQGA 4M9ZA 4D0PA 2HDCA 1XN7A 2Y75A 3K1PA 2OAZA 3TO7A 3I5UA 1XGSA 3F22A 3ZMSA 3WTVC 1D3YA 2EJRA 2LF8A 1X3UA 2CWEA 3LQQA 1I1GA 2XKOA 1T0FA 4G94A 1KGSA 3L9FA 1TLHB 1AOYA 2QQAA 5D5UB 2XUBA 3GFJA 4HDVA 4ESJA 3J81K 2NYXA 4L5JA 5ILVA 5EEGA 2PBIA 1F4KA 5TRDA 1B9NA 3R61A 1QO0D 3EYIA 2HYFA 1CF7A 3E5QA 2KIUA 1UCRA 3GEZA 4HW0A 3BWGA 3WGIA 3ABUA 3FXUA 1QQIA 5F1RA 2EV6A 3LAPA 5DV5A 4M9SA 4G8XA 2EFWA 4MNUA 5K5RA 3KP4A 2VBYA 1XCVA 5HDNA 3J80K 5D4SA 4CZZA 1JHFA 4I2OA 3GZ6A 1LQ1A 3NEUA 2OBPA 2VC0A 3F72A 3DPLC 2RVCA 2Q2EA 1R23A 1P4WA 1Y0UA 4LB6B 4ETSA 5CVIA 4WCGA 1H9TA 3I0TA 4HAMA 4BXUA 2KRFA 5BOXA 5E1WA 4CICA 4KFCA 4JK1X 4YFNF 3RYPA 5DDGA 1R5HA 4QLCU 1WRJA 1XCBA 1USSA 3FMSA 1LEBA 5JI6A 2UWMA 1QZYA 4RGUA 2PFBA 3JAMK 2PG4A 4KN4X 2P5KA 1O7FA 4GCVA 2P7CB 4WK8F 1XDUA 6PAXA 3WTSC 1MZBA 4G7OF 2HQNA 4ZZDA 5BPDA 4UHTA 1S29A 2H6CA 3VOEA 5ED4A 3ZP5A 3RPUA 1R1TA 4P9FA 5FFZA 5A2QK 2ODIA 2HGCA 3KCCA 5K5QA 3FWEA 5HLHA 3F23A 3QOPA 1I1SA 5F6FA 4LG0A 5LGTA 1SD5A 2IA2A 4LMYA 5L3DA 3VEPA 4TV7A 2CO5A 2DU9A 4IRGA 1P2FA 4I98B 4BHCA 3C3WA 3VB2A 1J59A 1YIOA 4EM0B 1KU9A 4CXFA 4I7HA 3RPQA 3GX4X 2M87A 4XSZF 3HSRA 3WTZA 4A12A 2GXBA 4HOBA 2L54A 2R7DA 1Z91A 5IT9K 1U2WA 2K4BA 3CO6C 1DPUA 1FSEA 1IN7A 4YIIA 2CG4A 2RN7A 5JVTA 4CDGA 3LQRA 2ZXJA 2WTEA 2DQRA 4L9NA 5D6EA 1KQ0A 4ENJA 3L2CA 4ZZLA 3K1NA 3RKWA 1YFHA 1YLFA 1ZG3A 4JBAA 1FZPB 4DQ2A 3DEUA 2W84A 5LLQA 4EV0A 3ZMTA 3Q5FA 1XSVA 5CVUA 2PJPA 1ZGJA 1KYWA 3KP6A 5D5WB 3KP2A 1OYWA 3LA2A 1HW2A 1XB4A 2XASA 2W25A 3NRVA 4MEXF 1E2XA 1KA8A 2VBWA 4HLYA 2W57A 4G6QA 1IUYA 2E7XA 5CVJA 2V1XA 5FO5A 2STWA 3DP7A 2HTSA 2VBXA 4N9HA 3T0YA 2M5WA 2ESHA 3HYIA 5H6QA 1U5TA 2IW5A 3JW4A 4EVIA 3Q9VA 2C6YA 3WODF 1HQCA 3SQNA 1S3JA 3GFMA 3W6JB 3KEQA 1HW5A 3KP7A 4MQVA 5KK1A 4RGXA 5K1YA 5BMZA 1PUEE 3QU3A 4QWQA 3GYHX 2MC3A 2A69F 3BP8A 5LEKA 1W7PB 4NQWA 1TNSA 2OA4A 3R0JA 3KP5A 3SZPA 1UFMA 2FF4A 5CYVA 4EJWA 1W7PD 1FYLA 2HR3A 1FC3A 3OOPA 1TBXA 2NS0A 1ZH5A 1FSHA 4U7DA 1L0OC 5FFXA 1R1VA 4HF2A 4ZYGA 5LHHA 3U9GA 4LGWA 3P7NA 2A3SA 3K9TA 3GWZA 2QBYB 2WWYA 5L3BA 5EEHA 2M8EA 3TOBA 4FHTA 3L00A 3DKWA 2P7VB 4NB5A 3T8TA 3H3ZA 1IN4A 3KZZA 4ENKA 2LF7A 1GVJA 4Q47A 1TW3A 3BJOA 3ML6A 3SFZA 2W24A 2E7WA 2QWWA 1WQ2A 3M1EA 2YX4A 1FOKA 5H6RA 3GFIA 5LEJA 1P6RA 1KU3A 5D5XB 3G73A 1U78A 1H9GA 1TQPA 1YW8A 3P9IA 2OZUA 5LGNA 2XGXA 1DDNA 2Z3YA 3ZN1A 2FNAA 4UUVA 2P6SA 1MJAA 2HKOA 3HIFA 1S8NA 3E5UA 3JTGA 2BV6A 3GF2A 1OYYA 4HZFA 1USTA 3I53A 1PP7U 1XGMA 1YW7A 3LA7A 2VONA 5JHUA 2L3DA 1LDKB 3BPXA 3D0SA 2BBYA 2ZNZA 1ZRCA 1GXPA 2ACJA 4EJUA 1KU2A 2O61A 2ESNA 2K86A 1T2KA 3DXJF 3WU1B 2Z5UA 5L3GA 1G4DA 2LNBA 2OA9A 2ETHA 1SD6A 3P9KA 2WC2A 4HQMA 4GGGA 4OMZA 3I71A 1B9MA 2CGPA 4HV5A 1Z1DA 4KUMA 2CYYA 3MFKA 4UV9A 4A0XA 2MLGA 3HSFA 2O6GE 2JT1A 3RI4A 4IJAA 1BIAA 2Y0MA 1V3FA 4XBFA 1GXQA 4P55A 1UHMA 1SMYF 1XMKA 3MQ0A 1U3EM 3TKYA 3ZMUA 3N4MA 5E1XA 3QP6A 1K6OA 2L02A 4G7HF 4Y13A 3K0LA 5LHGA 1WI9A 4Z2YA 2EV0A 2DTRA 5ICCA 1SMTA 3EETA 2ISZA 5CLSA 1C0WA 4RB3C 4RB2C 5HDGA 3EDPA 4WXDA 4FX4A 5HS8A 3V4GA 1QGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSO A;  2E1C A;  5H20 A;  1CF7 B;  3BJ6 A;  5LGU A;  1P4A A;  3ZMZ A;  1K78 A;  1EV7 A;  2G7U A;  5E8I A;  2QM3 A;  2OU2 A;  2HZT A;  1IRG A;  1G3T A;  1S7O A;  2YX7 A;  5J8C A;  1GHC A;  2XVC A;  3KE2 A;  3EUH A;  3TDU C;  1FY7 A;  3C18 A;  1I5Z A;  2ADU A;  2IP2 A;  4XRF A;  2ISY A;  5J8F A;  3V7C A;  1WSU A;  4HF1 A;  3F8C A;  4DNC A;  2RV8 A;  3WTX C;  3FM5 A;  5HLG A;  3IRR A;  4RB1 A;  2FOK A;  4ZYD A;  4MTE A;  1O3T A;  2DLL A;  1B59 A;  2L4M A;  3IKV A;  3W6K B;  4A5M A;  2GWR A;  2IVM A;  4ENM A;  1BC7 C;  4RGS A;  1U5T C;  1JE8 A;  1WWX A;  5ICG A;  3EQL F;  2EFP A;  4FX0 A;  2BE5 F;  2PLY A;  4L9V A;  2O3F A;  1SFE A;  1U6G A;  2KJB A;  2DK8 A;  3LST A;  4Y17 A;  4BAY A;  2CFX A;  2R3S A;  2GQQ A;  4P5O A;  3HTU A;  3R60 A;  4MTD A;  2EK5 A;  4BQA A;  5J6X A;  1JHH A;  1CGP A;  2J5P A;  4O5V A;  1KQ9 A;  4KIB A;  4KT5 C;  3REO A;  2FQ3 A;  1TNT A;  1B4A A;  3LA3 A;  3JTH A;  5L3C A;  2HS5 A;  4YFK F;  3WGG A;  1ODD A;  3B02 A;  4LG0 B;  3V7S A;  1BBY A;  3K1M A;  5DCM A;  4BYY A;  3BDD A;  4I09 A;  1EH7 A;  2ZBK A;  2IA0 A;  4PGG A;  2FE3 A;  2O8X A;  3RTR A;  2VN2 A;  3WG9 A;  2EWN A;  4U0Y A;  2RGV A;  4UXN A;  3DF8 A;  3WE2 A;  2V6C A;  2HTJ A;  5E20 A;  2STT A;  1G3S A;  1HKT A;  2A07 F;  2A5Y B;  4EJV A;  3RJP A;  2PMU A;  1FLI A;  2LKP A;  3FMR A;  1XSD A;  3CTA A;  3HSE A;  2OQR A;  3CJN A;  4U88 A;  3R6S A;  4A6E A;  2HEO A;  2G7H A;  2YU3 A;  2ZKZ A;  4L9T A;  4ASN A;  3GO5 A;  2QUF A;  3ZQ7 A;  2X4H A;  3KZY A;  1A04 A;  2DO7 A;  2ELH A;  2XIG A;  1ZRF A;  4L18 B;  2DBB A;  4XSX F;  2BEO A;  4IRI A;  3SXY A;  3N97 A;  2P8T A;  1JGS A;  3QPH A;  2Y48 A;  1XDS A;  3HOS A;  3GZ5 A;  3HHG A;  1EH8 A;  2BYV E;  3IWF A;  2IA1 A;  3VFZ A;  3IWZ A;  2A61 A;  3F6V A;  2F5C A;  1P4X A;  1BI2 A;  1F5T A;  3MZY A;  5D4R A;  4P96 A;  4HBL A;  2ZO4 A;  4U0V A;  4IPA A;  2EB7 A;  2PEX A;  2LDU A;  4ENN A;  3T5X A;  4IRH A;  1Z6T A;  3E3V A;  3F8B A;  1J0R A;  4S04 A;  1U5T B;  2KIF A;  4MHG A;  1AWC A;  1SFX A;  1KU7 A;  4LLG F;  1BC8 C;  5DD4 A;  1MDM B;  2H94 A;  2KIM A;  2ZFW A;  1OMI A;  3MCZ A;  4Q48 A;  4ZH4 F;  4XLN F;  1IAW A;  4EJT A;  2FXA A;  1XGN A;  4CHU A;  4M9X A;  3H92 A;  4EM2 A;  2VE9 A;  3V7R A;  1YYV A;  2VC1 A;  1HKS A;  4LD5 A;  2O0Y A;  1FYM A;  2VT2 A;  1LEA A;  4IHT A;  4MGR A;  4ESF A;  1HXD A;  3KEO A;  5DUK A;  4L0Z B;  3ZPL A;  5BQT A;  3K2Z A;  3PFI A;  1QNT A;  2COM A;  2PN6 A;  1IN6 A;  3SZT A;  4WXC A;  3LAJ A;  3DV8 A;  5ERI A;  3FF5 A;  1WKM A;  3F8F A;  4LFU A;  2FU4 A;  4PDK A;  2F5F A;  3E5X A;  3I58 A;  4A6D A;  2FBK A;  3O2P E;  4LK1 F;  5LHI A;  1O3S A;  4P9U A;  1OYI A;  3RYR A;  4B09 A;  2HKX A;  1SD4 A;  2K4J A;  3WTU C;  1UHW A;  2EV5 A;  4G7Z F;  1ZN2 A;  5FD5 A;  3H3U A;  3HHH A;  4AWX B;  3BY6 A;  1HSJ A;  3F3X A;  3ZMD A;  2QLZ A;  4EM1 A;  5HS7 A;  4GYG A;  4R1H A;  2XRN A;  3G3Z A;  1IZ1 A;  1ZAR A;  2O03 A;  3TO6 A;  2EFQ A;  1YS7 A;  1K7A A;  4CO8 A;  1IRF A;  3QAH A;  2P6T A;  3P9C A;  3L09 A;  4AIJ A;  1BI1 A;  1IXS B;  2NNY A;  4N9I A;  1R1U A;  5CVR A;  3E97 A;  3WU0 A;  2F2E A;  4F7Z A;  4Q4Z F;  4U7B A;  1FPQ A;  2DT5 A;  5LBQ A;  1JXS A;  4M71 A;  1RIO H;  1DP7 P;  2QVO A;  1MD0 A;  3ZMV A;  3ZN0 A;  5E18 F;  2HQR A;  2RNJ A;  3M7G A;  4B8X A;  4AVP A;  4YG2 F;  1O57 A;  4PGH A;  4N0B A;  1Z6R A;  1P92 A;  2D1H A;  4KN7 X;  5IT3 A;  1RUO A;  5HOO A;  3WTT C;  3AAF A;  2V9V A;  3C1D A;  4XLP F;  4BHB A;  3O3K A;  4H0E A;  5ILU A;  2EA2 A;  5BPI A;  4GYI A;  2IPQ X;  1RUN A;  2H09 A;  3WE3 A;  1BI0 A;  5HDK A;  3GVA A;  2QQB A;  4BH9 A;  2KJC A;  1O3R A;  2JPB A;  3EYY A;  4I01 A;  1YW9 A;  1UB9 A;  2GIV A;  2JPC A;  2RC4 A;  4I02 A;  3NQO A;  1BJA A;  3J80 Z;  1LDD A;  4K2E A;  1FBU A;  2Q8K A;  3RKY A;  5D6F A;  1OPC A;  4EMS A;  3PQK A;  3DQV C;  2HOE A;  1R5G A;  2V1U A;  2M45 A;  4KNY A;  2B0L A;  2Z33 A;  1LVA A;  3V8K A;  2GXG A;  5AIQ A;  3LWF A;  4OIR F;  3V8J A;  1YQA A;  3CUQ A;  1Q1H A;  5FGM A;  2VXZ A;  3O6B B;  5FLX Z;  1Z9C A;  4L5I A;  3U2R A;  2QEN A;  2FML A;  3I59 A;  4OIP F;  3JAM Z;  3RKX A;  2UXN A;  3I64 A;  1D5V A;  1I6X A;  1MJB A;  2YSR A;  4IXA A;  2Z9O A;  2F5D A;  1K78 B;  2ZCW A;  2A6H F;  1BIB A;  3F8M A;  4HYE A;  3ISP A;  4KIG A;  3JSO A;  4UVC A;  5A2Q Z;  1YO5 C;  1B6A A;  3BRO A;  3T1B A;  2AS5 F;  5CVV A;  2H27 A;  2YR2 A;  1QBJ A;  2MA3 A;  1LB2 A;  2EA4 A;  3JSP A;  2M30 A;  2QYO A;  2HWV A;  4M73 A;  1IN5 A;  2FBI A;  2ZME A;  3M8F A;  1E17 A;  3RDI A;  1DPR A;  2F5E A;  2D1V A;  2DFI A;  4I0A A;  1ZLK A;  2WV0 A;  3K69 A;  2A68 F;  3E6C C;  1S6L A;  1YTY A;  1BOA A;  2YPR A;  4RB0 A;  3TOA A;  2OZ6 A;  3HRM A;  1IN8 A;  5IT9 Z;  2HYG D;  3DPT A;  5AON A;  2NAZ A;  1FWZ A;  2GZW A;  4HX4 A;  4KIC A;  3R0A A;  5D5V B;  2FMY A;  3SHF A;  2DPD A;  4A5N A;  3HRU A;  5DCF A;  3L7W A;  3V8L A;  1R22 A;  4KIF A;  2R7F A;  2V1D A;  4WX9 A;  2AXL A;  3M8E A;  2V79 A;  3FMQ A;  3MWM A;  3VOD A;  1ZGA A;  2J5O A;  2IT0 A;  3TO9 A;  3HTS B;  1ZYR F;  1HKQ A;  4ZYH A;  1BN5 A;  1NHA A;  3HOT A;  4GXO A;  4OOI A;  2PQ8 A;  1ULY A;  5DCM B;  3HRT A;  5LRS A;  3HUG A;  1RI7 A;  3GFL A;  1S7A A;  2E1N A;  2NNN A;  1O7L A;  1IW7 F;  4MQ9 F;  1J7K A;  3I4P A;  4RS8 A;  2GA2 A;  1PP8 F;  2FBH A;  2MLK A;  3GLX A;  4KYW A;  3E6B A;  2CW0 F;  4KMF A;  2IRF G;  5FLX K;  1TTY A;  5HVQ C;  1O3Q A;  1BI3 A;  1LJ9 A;  3FM3 A;  1F1Z A;  4GO1 A;  4U0W A;  3IC7 A;  4O3M A;  1J2X A;  1FT9 A;  4UNO A;  3M9A A;  3TGN A;  3S2W A;  4HX7 A;  2FNP A;  2XKP A;  4FT8 A;  1OKR A;  2MH2 A;  1TQI A;  5DUI A;  1RZ4 A;  3GUD A;  2PMH A;  1J5Y A;  1FP1 D;  4A2U A;  4KA4 A;  1FX7 A;  2X0L A;  2VT3 A;  5LRR A;  1BM9 A;  4IHS A;  5E1Z B;  1J9I A;  1T39 A;  3Q9S A;  5D8L B;  5FD6 A;  1W5S A;  3PQJ A;  3ULQ B;  3IKT A;  1YS6 A;  1FYK A;  1G6N A;  2OD5 A;  2XRO A;  1R58 A;  2QQ9 A;  1FP2 A;  2FA5 A;  4G6D A;  4Y15 A;  3BJA A;  1MGT A;  5L3F A;  1W5T A;  2ZJ2 A;  1B1B A;  4M72 A;  3FX3 A;  4AIK A;  1ON1 A;  4BNC A;  1IF1 A;  4OIO F;  2K02 A;  3ELK A;  4KMU X;  3KFW X;  4LJZ F;  1IXC A;  3CO7 C;  2JSC A;  4NHJ A;  4LB5 A;  2RKH A;  3IL2 A;  1XGO A;  1XD7 A;  4HF0 A;  4PZJ A;  2VOO A;  4R79 A;  3QPT A;  4BHP A;  2D45 A;  3TQN A;  4R8H A;  4HX8 A;  1KYZ A;  2D2W A;  1R36 A;  2EFO A;  2VE8 A;  4CYD A;  1MJ9 A;  3U1D A;  3R4K A;  5DD8 A;  1IXR C;  1FBS A;  3E6M A;  2FRH A;  5F64 A;  3E6D A;  3WTY C;  4UVB A;  2KKO A;  2ZNY A;  3MAJ A;  2JTV A;  4UV8 A;  3IRQ A;  3GXO A;  1TQM A;  4E70 A;  3MZH A;  2P5L C;  4LLL A;  2XAF A;  4IF4 A;  1SD7 A;  5DEQ A;  1XMA A;  4LK0 F;  1L3L A;  4WXH A;  1ONV A;  2HFH A;  4M6X A;  5HS9 A;  2UXX A;  3CUQ C;  2P4W A;  2CSO A;  2DK5 A;  3ERE D;  2XAJ A;  3ROU A;  4JQF A;  4ZYE A;  1XSX A;  3DFG A;  5JR3 A;  2RQP A;  4OMY A;  4M6Y A;  1ZLJ A;  2BGC A;  4G9Y A;  1MDM A;  1ZRD A;  3OV8 A;  2M1B A;  2L4A A;  1STZ A;  3CDH A;  3QRF F;  3FXQ A;  4EGZ A;  2FEZ A;  4HQE A;  4WWC A;  2DPU A;  5HLI A;  2JRT A;  4UVA A;  4EQQ A;  1K79 A;  2VOD A;  4HLX A;  4AIH A;  4HDU A;  4S05 A;  1J75 A;  1TW2 A;  2MBF A;  1T98 A;  1W4M A;  4I0B A;  5TJJ A;  1PDN C;  1KQ8 A;  5JFR A;  3B73 A;  1R7J A;  2XAG A;  1QZZ A;  1VTN C;  4PCQ A;  1W7P A;  3RIR A;  4WF2 A;  3ECH A;  3D5L A;  4HA8 A;  2W85 A;  4L9J A;  2DAO A;  4EGY A;  1ZAO A;  1I27 A;  4AD9 A;  4RAY A;  3COA C;  1SFU A;  1SAX A;  2IJL A;  1T38 A;  2JZY A;  3GW2 A;  1EH6 A;  1Z05 A;  1LNW A;  3BZ6 A;  1T6S A;  5AIP A;  2MD5 A;  1FNN A;  5FB2 A;  1RNL A;  3CUO A;  4M74 A;  2Q0O A;  1V4R A;  3FHZ A;  1ZG1 A;  3F8N A;  2QBY A;  2K7L A;  1DUX C;  5ICF A;  2DQL A;  1ZG5 A;  2UZK A;  1U8R A;  1ZRE A;  4ON0 A;  3J81 Z;  4RAZ A;  4YIF A;  1LDJ A;  1ON2 A;  3ABT A;  1MKM A;  3KLO A;  4O6J A;  2H6B A;  4A0Z A;  3KET A;  5CJ9 A;  3MEX A;  1R00 A;  5L3E A;  1OR7 A;  5ILS A;  2NRA C;  3ECO A;  1QPM A;  4EJO A;  5D8K B;  1HST A;  5E8G A;  3FZV A;  2K27 A;  2GA1 A;  3CUQ B;  2P5V A;  4YFX F;  2QZ8 A;  4RGR A;  4Q5S F;  1H0M A;  2DW4 A;  3HRS A;  5DYM A;  4MEY F;  3FXR A;  3I59 B;  3C7J A;  4OIN F;  1REP C;  2A6E F;  2XHK A;  2XV4 S;  2VOP A;  1ZHF A;  1HBX G;  3I54 A;  2FSW A;  1F9N A;  4OU0 A;  2GAU A;  4CGZ A;  3WGH A;  1YG2 A;  2MH9 A;  3T8R A;  2EFN A;  1D8K A;  2CQK A;  4A0Y A;  2VBZ A;  4L0Y B;  1FBQ A;  3WTW C;  5E17 F;  1D8J A;  3CLO A;  3BPV A;  3KLN A;  3QP5 A;  3LFK A;  2G9W A;  3IHU A;  2RDP A;  3KP3 A;  2XAQ A;  5ICE A;  2PI0 A;  4ESB A;  4KDP A;  5K5O A;  2XAH A;  1G3W A;  2DI3 A;  2ZME B;  1HW1 A;  1Z7U A;  2L01 A;  5KVR A;  2Z99 A;  4OIQ F;  3F21 A;  4LLN A;  3F6O A;  3QU6 A;  2TDX A;  1G3Y A;  4HV6 A;  3TDZ C;  3BOQ A;  4IVN A;  5BS6 A;  3J7A O;  2OQG A;  4M9Z A;  4D0P A;  2HDC A;  1XN7 A;  2Y75 A;  3K1P A;  2OAZ A;  3TO7 A;  3I5U A;  1XGS A;  3F22 A;  3ZMS A;  3WTV C;  1D3Y A;  2EJR A;  2LF8 A;  1X3U A;  2CWE A;  3LQQ A;  1I1G A;  2XKO A;  1T0F A;  4G94 A;  1KGS A;  3L9F A;  1TLH B;  1AOY A;  2QQA A;  5D5U B;  2XUB A;  3GFJ A;  4HDV A;  4ESJ A;  3J81 K;  2NYX A;  4L5J A;  5ILV A;  5EEG A;  2PBI A;  1F4K A;  5TRD A;  1B9N A;  3R61 A;  1QO0 D;  3EYI A;  2HYF A;  1CF7 A;  3E5Q A;  2KIU A;  1UCR A;  3GEZ A;  4HW0 A;  3BWG A;  3WGI A;  3ABU A;  3FXU A;  1QQI A;  5F1R A;  2EV6 A;  3LAP A;  5DV5 A;  4M9S A;  4G8X A;  2EFW A;  4MNU A;  5K5R A;  3KP4 A;  2VBY A;  1XCV A;  5HDN A;  3J80 K;  5D4S A;  4CZZ A;  1JHF A;  4I2O A;  3GZ6 A;  1LQ1 A;  3NEU A;  2OBP A;  2VC0 A;  3F72 A;  3DPL C;  2RVC A;  2Q2E A;  1R23 A;  1P4W A;  1Y0U A;  4LB6 B;  4ETS A;  5CVI A;  4WCG A;  1H9T A;  3I0T A;  4HAM A;  4BXU A;  2KRF A;  5BOX A;  5E1W A;  4CIC A;  4KFC A;  4JK1 X;  4YFN F;  3RYP A;  5DDG A;  1R5H A;  4QLC U;  1WRJ A;  1XCB A;  1USS A;  3FMS A;  1LEB A;  5JI6 A;  2UWM A;  1QZY A;  4RGU A;  2PFB A;  3JAM K;  2PG4 A;  4KN4 X;  2P5K A;  1O7F A;  4GCV A;  2P7C B;  4WK8 F;  1XDU A;  6PAX A;  3WTS C;  1MZB A;  4G7O F;  2HQN A;  4ZZD A;  5BPD A;  4UHT A;  1S29 A;  2H6C A;  3VOE A;  5ED4 A;  3ZP5 A;  3RPU A;  1R1T A;  4P9F A;  5FFZ A;  5A2Q K;  2HGC A;  3KCC A;  5K5Q A;  3FWE A;  5HLH A;  3F23 A;  3QOP A;  1I1S A;  5F6F A;  4LG0 A;  5LGT A;  1SD5 A;  2IA2 A;  4LMY A;  5L3D A;  3VEP A;  4TV7 A;  2CO5 A;  2DU9 A;  4IRG A;  1P2F A;  4I98 B;  4BHC A;  3C3W A;  3VB2 A;  1J59 A;  1YIO A;  4EM0 B;  1KU9 A;  4CXF A;  4I7H A;  3RPQ A;  3GX4 X;  2M87 A;  4XSZ F;  3HSR A;  3WTZ A;  4A12 A;  2GXB A;  4HOB A;  2L54 A;  2R7D A;  1Z91 A;  5IT9 K;  1U2W A;  2K4B A;  3CO6 C;  1DPU A;  1FSE A;  1IN7 A;  4YII A;  2CG4 A;  2RN7 A;  5JVT A;  4CDG A;  3LQR A;  2ZXJ A;  2WTE A;  2DQR A;  4L9N A;  5D6E A;  1KQ0 A;  4ENJ A;  3L2C A;  4ZZL A;  3K1N A;  3RKW A;  1YFH A;  1YLF A;  1ZG3 A;  4JBA A;  1FZP B;  4DQ2 A;  3DEU A;  2W84 A;  5LLQ A;  4EV0 A;  3ZMT A;  3Q5F A;  1XSV A;  5CVU A;  2PJP A;  1ZGJ A;  1KYW A;  3KP6 A;  5D5W B;  3KP2 A;  1OYW A;  3LA2 A;  1HW2 A;  1XB4 A;  2XAS A;  2W25 A;  3NRV A;  4MEX F;  1E2X A;  1KA8 A;  2VBW A;  4HLY A;  2W57 A;  4G6Q A;  1IUY A;  2E7X A;  5CVJ A;  2V1X A;  5FO5 A;  2STW A;  3DP7 A;  2HTS A;  2VBX A;  4N9H A;  3T0Y A;  2M5W A;  2ESH A;  3HYI A;  5H6Q A;  1U5T A;  2IW5 A;  3JW4 A;  4EVI A;  3Q9V A;  2C6Y A;  3WOD F;  1HQC A;  3SQN A;  1S3J A;  3GFM A;  3W6J B;  3KEQ A;  1HW5 A;  3KP7 A;  4MQV A;  5KK1 A;  4RGX A;  5K1Y A;  5BMZ A;  1PUE E;  3QU3 A;  4QWQ A;  3GYH X;  2MC3 A;  2A69 F;  3BP8 A;  5LEK A;  1W7P B;  4NQW A;  1TNS A;  2OA4 A;  3R0J A;  3KP5 A;  3SZP A;  1UFM A;  2FF4 A;  5CYV A;  4EJW A;  1W7P D;  1FYL A;  2HR3 A;  1FC3 A;  3OOP A;  1TBX A;  2NS0 A;  1ZH5 A;  1FSH A;  4U7D A;  1L0O C;  5FFX A;  1R1V A;  4HF2 A;  4ZYG A;  5LHH A;  3U9G A;  4LGW A;  3P7N A;  2A3S A;  3K9T A;  3GWZ A;  2QBY B;  2WWY A;  5L3B A;  5EEH A;  2M8E A;  3TOB A;  4FHT A;  3L00 A;  3DKW A;  2P7V B;  4NB5 A;  3T8T A;  3H3Z A;  1IN4 A;  3KZZ A;  4ENK A;  2LF7 A;  1GVJ A;  4Q47 A;  1TW3 A;  3BJO A;  3ML6 A;  3SFZ A;  2W24 A;  2E7W A;  2QWW A;  1WQ2 A;  3M1E A;  2YX4 A;  1FOK A;  5H6R A;  3GFI A;  5LEJ A;  1P6R A;  1KU3 A;  5D5X B;  3G73 A;  1U78 A;  1H9G A;  1TQP A;  1YW8 A;  3P9I A;  2OZU A;  5LGN A;  2XGX A;  1DDN A;  2Z3Y A;  3ZN1 A;  2FNA A;  4UUV A;  2P6S A;  1MJA A;  2HKO A;  3HIF A;  1S8N A;  3E5U A;  3JTG A;  2BV6 A;  3GF2 A;  1OYY A;  4HZF A;  1UST A;  3I53 A;  1PP7 U;  1XGM A;  1YW7 A;  3LA7 A;  2VON A;  5JHU A;  2L3D A;  1LDK B;  3BPX A;  3D0S A;  2BBY A;  2ZNZ A;  1ZRC A;  1GXP A;  2ACJ A;  4EJU A;  1KU2 A;  2O61 A;  2ESN A;  2K86 A;  1T2K A;  3DXJ F;  3WU1 B;  2Z5U A;  5L3G A;  1G4D A;  2LNB A;  2ETH A;  1SD6 A;  3P9K A;  2WC2 A;  4HQM A;  4GGG A;  4OMZ A;  3I71 A;  1B9M A;  2CGP A;  4HV5 A;  1Z1D A;  4KUM A;  2CYY A;  3MFK A;  4UV9 A;  4A0X A;  2MLG A;  3HSF A;  2O6G E;  2JT1 A;  3RI4 A;  4IJA A;  1BIA A;  2Y0M A;  1V3F A;  4XBF A;  1GXQ A;  4P55 A;  1UHM A;  1SMY F;  1XMK A;  3MQ0 A;  1U3E M;  3TKY A;  3ZMU A;  3N4M A;  5E1X A;  3QP6 A;  1K6O A;  2L02 A;  4G7H F;  4Y13 A;  3K0L A;  5LHG A;  1WI9 A;  4Z2Y A;  2EV0 A;  2DTR A;  5ICC A;  1SMT A;  3EET A;  2ISZ A;  5CLS A;  1C0W A;  4RB3 C;  4RB2 C;  5HDG A;  3EDP A;  4WXD A;  4FX4 A;  5HS8 A;  3V4G A;  1QGP A; 
#chains in the Genus database with same CATH topology
 3BZC A;  2VKH A;  2LSO A;  2L7M P;  2E1C A;  5H20 A;  3BG7 A;  1CF7 B;  2FUG 2;  3BJ6 A;  3K4B A;  5LGU A;  1UJ8 A;  4XMY A;  4XOR A;  1P4A A;  1YJ9 I;  4PJJ A;  3ZMZ A;  1K78 A;  1EV7 A;  1RRJ A;  3U1K A;  3DBL B;  2QSH X;  2G7U A;  5E8I A;  2BZT A;  4XM3 A;  3JRH A;  2QM3 A;  2OU2 A;  3K70 C;  2HZT A;  1IRG A;  3PUF A;  1G3T A;  1S7O A;  1PYV A;  2FOW A;  2YX7 A;  5J8C A;  4HNV A;  5JLX A;  3CCJ I;  1GHC A;  2XVC A;  3KE2 A;  3EUH A;  3NWS A;  3TDU C;  1FY7 A;  2W1O A;  3C18 A;  4B1R A;  4B47 A;  1I5Z A;  2ADU A;  2IP2 A;  2R7X A;  4XRF A;  3BCA A;  2ISY A;  5J8F A;  3V7C A;  3L2U A;  2HNH A;  1S9H A;  1OJL A;  3GBG A;  4AUX A;  1WSU A;  4HF1 A;  3F8C A;  1WJC A;  2L0K A;  3VYU B;  4DNC A;  3OYB A;  2OAA A;  2RV8 A;  3WTX C;  3FM5 A;  4CCJ A;  5F08 A;  5HLG A;  3OS0 A;  3IRR A;  4RB1 A;  5F0C A;  2FOK A;  1W1W E;  2WY7 Q;  4ZYD A;  4XQF A;  4MTE A;  3LNQ A;  4RM3 A;  1O3T A;  2DLL A;  1B59 A;  4C2T A;  2L4M A;  4Z6Y A;  2CUF A;  1A35 A;  3FKI J;  5CQE A;  1A36 A;  4A3B J;  3IKV A;  1ZEL A;  3W6K B;  1Q1V A;  2DTZ A;  4A5M A;  2DDA A;  2GWR A;  2IVM A;  4ENM A;  1BC7 C;  4RGS A;  4PUS A;  1U5T C;  3OY9 A;  3H9G A;  3J7A Y;  2X48 A;  1WWX A;  5ICG A;  1JE8 A;  3ERM A;  3EQL F;  3H5R A;  2EFP A;  4FX0 A;  2BE5 F;  1W36 C;  3HGY A;  2PLY A;  2PX9 A;  4L9V A;  1QHG A;  3HEF A;  1DGR M;  3DU6 A;  2O3F A;  1F43 A;  2VKE A;  1SFE A;  1U6G A;  3CCY A;  2KJB A;  2EH3 A;  2DK8 A;  3H35 A;  3LST A;  4Y17 A;  2VUM J;  2V26 A;  4BAY A;  3PSI A;  4BXX J;  5F1J A;  1QU3 A;  5FKK A;  1TL8 A;  2CFX A;  2X6W A;  2R3S A;  2GQQ A;  2ID3 A;  2MG4 A;  4P5O A;  3I55 I;  3HTU A;  4IKF A;  3R60 A;  3S1N J;  3CLQ A;  4MTD A;  3DLL F;  4M6V A;  2EK5 A;  2R92 J;  4BQA A;  5J6X A;  2WAQ N;  2H8R A;  3M4O J;  5J1U A;  1JHH A;  1CGP A;  5C4X J;  1ZR2 A;  3VYS B;  2J5P A;  4O5V A;  1KQ9 A;  1Y8Q B;  4KIB A;  4KT5 C;  3REO A;  2ZB9 A;  4C30 A;  1N25 A;  5IYB J;  2FQ3 A;  1TNT A;  5IOY A;  1IV8 A;  2KQR A;  1B4A A;  3BTL A;  3FXJ A;  3LA3 A;  3JTH A;  1YIT I;  1MH3 A;  2GLO A;  1HA8 A;  3PVI A;  2CU7 A;  2EQR A;  5L3C A;  2HS5 A;  3OSF A;  4YFK F;  1MNE A;  5J1Y A;  2V9P A;  3WGG A;  1ODD A;  1H89 C;  3C2H A;  1ETX A;  3B02 A;  4LG0 B;  4D7M A;  1ETY A;  1F36 A;  3V7S A;  1BBY A;  3K1M A;  3CMA I;  5DCM A;  3H5A A;  4BYY A;  2LFB A;  3BDD A;  1D0Z A;  4I09 A;  2BY0 A;  1EH7 A;  1SEU A;  2ZBK A;  4UB8 C;  2KLO A;  2IA0 A;  4PGG A;  2CUZ A;  2FE3 A;  2DCE A;  2O8X A;  3RTR A;  2R7V A;  2VN2 A;  2QSF X;  3WG9 A;  3GTP J;  3HXL A;  2EWN A;  4FE7 A;  1SVL A;  4U0Y A;  2RGV A;  4UXN A;  3DF8 A;  3WE2 A;  4E7H A;  2V6C A;  2HTJ A;  5E20 A;  2KT0 A;  2QEX I;  2STT A;  1G3S A;  3HC7 A;  1HKT A;  2A07 F;  2A5Y B;  3TED A;  3RQI A;  1YJW I;  4EJV A;  3RJP A;  2PMU A;  1FLI A;  2LKP A;  3FMR A;  3OIP A;  1XSD A;  3CTA A;  3HSE A;  2OQR A;  1WJ5 A;  3CJN A;  4U88 A;  1V55 H;  3R6S A;  4A6E A;  2HEO A;  1EF4 A;  2G7H A;  2YU3 A;  2ZKZ A;  4L9T A;  3MKZ A;  4ASN A;  1XPX A;  3GO5 A;  4BJ6 C;  1NH3 A;  4FQG A;  3A2K A;  1FJL A;  2QUF A;  3ZQ7 A;  1RPW A;  2X4H A;  1PUF A;  2WBM A;  3KZY A;  3CCM I;  3BG3 A;  4N4O B;  1A04 A;  3DWL E;  1JTX A;  2DO7 A;  1T56 A;  2ELH A;  2XIG A;  3BR0 A;  2L7F P;  5IP9 J;  3OYH A;  1TC3 C;  1ZRF A;  2HZD A;  4XRS A;  2DBB A;  4XSX F;  4L18 B;  2BEO A;  2MW8 A;  2R7O A;  3RZD J;  4IRI A;  4E7Z A;  2W00 A;  2R5Z B;  1VQM I;  3SXY A;  1Z7L A;  3N97 A;  5B3S H;  2W4S A;  4J00 A;  2P8T A;  1R49 A;  1Z3X A;  1FMW A;  1JGS A;  2IS6 A;  3QPH A;  2LR8 A;  2Y48 A;  1K4T A;  3G71 I;  1KON A;  1XDS A;  3HOZ J;  3HOS A;  2LRD A;  3GZ5 A;  3HHG A;  2BY2 A;  4DIQ A;  1EH8 A;  3L2Q A;  2BYV E;  3IWF A;  2IA1 A;  3VFZ A;  4IL6 C;  2DMP A;  3IWZ A;  1Z0X A;  3LSI A;  1D0Y A;  3BLY A;  3MN2 A;  1TP4 A;  2A61 A;  3K70 D;  1MMA A;  3F6V A;  3LSP A;  1E3O C;  2MFZ A;  5K7H A;  4F52 A;  4A3G J;  1X19 A;  1RR7 A;  2F5C A;  4ZJZ A;  1P4X A;  5FKN A;  1BI2 A;  5C44 J;  1F5T A;  3MZY A;  5D4R A;  1MMD A;  1QA6 A;  4OAY A;  1SVO A;  4P96 A;  3J7Z I;  4HBL A;  2ZO4 A;  3DEW A;  4U0V A;  4XL9 A;  4IPA A;  2EB7 A;  3S93 A;  1TWA J;  2PEX A;  2LDU A;  3PSF A;  4ENN A;  3T5X A;  3M1C A;  4IRH A;  2CV0 A;  2GBY A;  5J1R A;  2ZXW H;  1Z6T A;  4GRI A;  3E3V A;  2RQQ A;  2WV1 A;  3F8B A;  1J0R A;  4W97 A;  1U5T B;  4S04 A;  2KIF A;  1FOX A;  4MHG A;  1AWC A;  1SFX A;  1KU7 A;  4LLG F;  1BC8 C;  5DD4 A;  1MDM B;  1Z67 A;  2H94 A;  4C3I J;  3IH2 A;  2PJR A;  3EUK L;  2KIM A;  4A3J J;  3BTI A;  1IGN A;  1I50 J;  1XTA A;  2FD5 A;  2ZFW A;  1OMI A;  3BZK A;  2CW7 A;  2CV2 A;  3MCZ A;  3QWL A;  3MKW B;  4Q48 A;  4ZH4 F;  4XLN F;  4HRI A;  3GLL A;  1IRX A;  1IAW A;  1JJ6 C;  4IHX A;  4EJT A;  4RA2 A;  2DMU A;  2FXA A;  1XGN A;  4CHU A;  4M9X A;  1W36 D;  2HXI A;  3CES A;  2CUE A;  3H9J A;  4DJA A;  3H92 A;  4EM2 A;  3VDX A;  3RZO J;  2VE9 A;  3LFU A;  4RDU A;  3JRG A;  1BR2 A;  3V7R A;  1YYV A;  3K2A A;  2VC1 A;  1HKS A;  2Y9Y A;  1VZ0 A;  4XRM A;  5K7F A;  4LD5 A;  1T33 A;  2O0Y A;  1FYM A;  2VT2 A;  2OJE D;  1LEA A;  5EF6 A;  3PIO F;  1WVR A;  3F0C A;  4IHT A;  4MGR A;  3AKZ A;  1R9T J;  4ESF A;  2R7S A;  3HOV J;  4V2G A;  1HXD A;  3KEO A;  5DUK A;  4L0Z B;  3ZPL A;  3SDB A;  2I8D A;  3X2Q H;  1JKP C;  1W0U A;  5BQT A;  3K2Z A;  3PFI A;  1WI3 A;  4A3I J;  1QNT A;  5GTI C;  2COM A;  2PN6 A;  1IN6 A;  2EIL H;  3SZT A;  4WXC A;  2BVL A;  3LAJ A;  3DV8 A;  3OMY A;  1H88 C;  1OCR H;  5ERI A;  4XLA A;  3FF5 A;  3VSK A;  1WKM A;  3F8F A;  4LFU A;  3CF2 A;  3CCQ I;  2FU4 A;  2Y69 H;  4PDK A;  3SEQ A;  3BC8 A;  3DBR B;  3FHN A;  1V54 H;  2F5F A;  3CCR I;  3E5X A;  3I58 A;  4G12 A;  4A6D A;  1EYU A;  3DTI A;  1UG0 A;  2KRC A;  2FBK A;  3AL0 C;  4RBO A;  1NTC A;  2H1L A;  1BW6 A;  3O2P E;  2IGK A;  1R5I D;  3LOC A;  4LK1 F;  3I9V 2;  5LHI A;  4FTH A;  1EJ9 A;  2DJI A;  2WB1 A;  1O3S A;  2OC6 A;  1B72 A;  4P9U A;  2JQ7 A;  3QYF A;  1OYI A;  3MZ8 A;  5E3M A;  2A5W A;  1T08 B;  4BAC A;  2IEK A;  1BJZ A;  3RYR A;  4B09 A;  2HKX A;  1TWC J;  1TT5 B;  1SD4 A;  2VQH A;  2RRE A;  2K4J A;  1T0F C;  3WTU C;  1X1B A;  3CCE I;  1UHW A;  2EV5 A;  4G7Z F;  3H36 A;  1ZN2 A;  5FD5 A;  3H3U A;  3HHH A;  5GP9 A;  4AWX B;  3BY6 A;  3CMM A;  1JKR C;  1HSJ A;  4DZP A;  3F3X A;  3ZMD A;  2QLZ A;  5J4V A;  4EM1 A;  2XAU A;  5HS7 A;  3EUH C;  4XLE A;  4GYG A;  4R1H A;  1ZTR A;  2XRN A;  1U0J A;  3G3Z A;  1IZ1 A;  5HLT A;  1BOB A;  1ZAR A;  2O03 A;  3TO6 A;  2EFQ A;  1UAA A;  1FTZ A;  1YS7 A;  4UUT A;  4F92 B;  2V6E A;  1QZE A;  3KIO A;  1K7A A;  2AHQ A;  2X6X A;  4CO8 A;  3ZOB A;  1IRF A;  1MSE C;  3QAH A;  2P6T A;  2R0Q C;  3P9C A;  2XF5 A;  3L09 A;  4BE0 A;  1S72 I;  4AIJ A;  1BI1 A;  1IXS B;  2CUJ A;  4UB6 C;  2D5V A;  2NNY A;  3S2H J;  4XKV A;  4N9I A;  2ME6 A;  1R1U A;  2ME0 A;  3E97 A;  1ETQ A;  2F2E A;  5CVR A;  2E34 A;  3WHC A;  1YE9 A;  3WU0 A;  4F7Z A;  3KYL A;  4Q4Z F;  4U7B A;  1FPQ A;  2DT5 A;  3ZQG A;  5LBQ A;  1JXS A;  1WZ2 A;  4M71 A;  1RIO H;  1DP7 P;  2QVO A;  1MD0 A;  3ZMV A;  3ZN0 A;  5E18 F;  2HQR A;  2RNJ A;  3G4S I;  3GTL J;  3M7G A;  1V5F A;  3HKZ N;  4B8X A;  1I6H J;  2DA6 A;  4AVP A;  4YG2 F;  2L5Q A;  5DS9 A;  4IX7 A;  1O57 A;  3NAR A;  1IDY A;  2E2H J;  4PGH A;  4XLF A;  4N0B A;  3PNY A;  3TP0 A;  1JUS A;  1Z6R A;  5KAF C;  1P92 A;  3CCV I;  2RAE A;  2D1H A;  4KN7 X;  5IT3 A;  2ECB A;  1RUO A;  2HOS A;  3JRA A;  5HOO A;  2XB5 A;  3WTT C;  3AAF A;  2V9V A;  3CMY A;  3C1D A;  4RMN A;  4M3E A;  2R93 J;  1R6R A;  4XLP F;  4BHB A;  4ITV A;  3CQZ J;  3O3K A;  1POG A;  2ZXI A;  4H0E A;  5ILU A;  1AKH B;  1WPK A;  2EA2 A;  5BPI A;  4GYI A;  2IPQ X;  1RUN A;  1G8X A;  2H09 A;  2GOX B;  4KJZ A;  3WE3 A;  1BI0 A;  5HDK A;  4B3A A;  1G2H A;  3GVA A;  3MKL A;  2QQB A;  5F04 A;  4BH9 A;  2KJC A;  3SZG A;  4KIS A;  1O3R A;  2JPB A;  5IP6 A;  3EYY A;  2K9L A;  4NDL A;  4I01 A;  1YW9 A;  1UB9 A;  2GIV A;  4XOP A;  2JPC A;  2RC4 A;  2EIK H;  1ETW A;  2Y0S N;  4I02 A;  3NQO A;  1JJ8 C;  1X4P A;  3ABL H;  1BJA A;  3J80 Z;  1GV2 A;  1WJF A;  1LDD A;  2WAD A;  2Z1D A;  4K2E A;  1FBU A;  4I76 A;  1BR1 A;  3OYJ A;  3CJR B;  3OR2 C;  1J09 A;  2WAQ A;  2NVY J;  1IDZ A;  2Q8K A;  3RKY A;  1K4S A;  5D6F A;  2ICW G;  1OPC A;  4EMS A;  2HOA A;  4HG2 A;  3PQK A;  2WAF A;  3DQV C;  2K5C A;  2HOE A;  4UUS A;  1R5G A;  1UG2 A;  5B66 C;  2V1U A;  2M45 A;  4KNY A;  2B0L A;  1LVA A;  2Z33 A;  3V8K A;  1X1D A;  5J47 A;  2GXG A;  5AIQ A;  2L7Z A;  4F93 B;  3DKY A;  1K6Y A;  3LWF A;  4YEJ A;  3SEZ A;  4IZZ A;  3PJR A;  4OIR F;  3V8J A;  2R5Y A;  1YQA A;  1LFP A;  3CUQ A;  4V19 K;  1Q1H A;  4ABZ A;  5FGM A;  2DA7 A;  2VXZ A;  3OIO A;  3A01 B;  2K3P A;  3O6B B;  3QQA A;  2NVQ J;  2QQ8 A;  5FLX Z;  3I3L A;  1Z9C A;  4F91 B;  5J40 A;  3IH4 A;  1IG7 A;  3UNG C;  3DTK A;  1X3W B;  5IYD J;  2ID6 A;  3AL0 B;  4L5I A;  3U2R A;  3OSG A;  3D5S C;  1TWH J;  4KIT B;  3JR9 A;  2QEN A;  3H1C A;  2FML A;  4NUB A;  3I59 A;  3AG4 H;  3P5J A;  4OIP F;  3JAM Z;  2M2E A;  3RKX A;  2UXN A;  3I64 A;  3Q0W A;  1G59 A;  3IH3 A;  1D5V A;  3CP8 A;  2XRL A;  4BQQ A;  3Q0U A;  1Y1W J;  3JRC A;  1I6X A;  1MJB A;  3JRB A;  2YSR A;  4D9J A;  4IXA A;  2Z9O A;  2F5D A;  1K78 B;  2MD0 A;  2VB6 A;  3HBL A;  4XN3 A;  2ZCW A;  1NI0 A;  3IAM 2;  3HOY J;  4C2M J;  2A6H F;  1BIB A;  3OYL A;  5F0F A;  3F8M A;  4HYE A;  3ISP A;  4KIG A;  3JSO A;  4UVC A;  5A2Q Z;  4HPQ A;  1YO5 C;  4DW6 A;  3ASN H;  1B6A A;  2KFD A;  3DCF A;  3FK6 A;  4II3 A;  1FEX A;  1A6Q A;  3BRO A;  3T1B A;  5JLW A;  3BR6 A;  4DZJ A;  2AS5 F;  1HLV A;  5CVV A;  1OLT A;  5JVG F;  2H27 A;  2YR2 A;  1QBJ A;  2MA3 A;  1LB2 A;  4PSX A;  2EA4 A;  3S32 A;  3JSP A;  2M30 A;  2QYO A;  2HWV A;  4XNF A;  4M73 A;  1B8I B;  4LIV A;  1IN5 A;  3HB9 A;  1JT6 A;  3L1P A;  3VWB A;  2FBI A;  2ZME A;  3M8F A;  1N75 A;  1E17 A;  3RDI A;  4IEJ A;  1DPR A;  2UUZ A;  2F5E A;  2D1V A;  2CQN A;  2DFI A;  4I0A A;  1ZLK A;  2WV0 A;  3K69 A;  2A68 F;  4ANJ A;  1S6L A;  3E6C C;  1BOA A;  3BG9 A;  1YTY A;  3ONQ A;  4NNJ A;  1OCT C;  4IOA F;  2YPR A;  4RB0 A;  3UKG A;  3TOA A;  1X1P A;  2OZ6 A;  2WY8 Q;  3HRM A;  4NC6 A;  5DTD A;  3FIS A;  1ZGW A;  2M0C A;  1IN8 A;  5IT9 Z;  2HYG D;  2OF7 A;  3DPT A;  4ZDO A;  1SFK A;  2NAZ A;  5AON A;  4CSW A;  1DU0 A;  2LD5 A;  3K7A J;  2LOO A;  2Q2E B;  5IP7 J;  5H2F C;  1FWZ A;  2E1M C;  2GZW A;  4HX4 A;  4KIC A;  3W2W A;  3A0H C;  2BHZ A;  1VQ7 I;  1WGX A;  1NG6 A;  3R0A A;  5D5V B;  5GPA A;  2PMZ N;  1ITY A;  3D5R C;  2FMY A;  3OYN A;  1X2N A;  3S15 J;  1DP3 A;  2JA5 J;  3G1O A;  4MIM A;  5FKM A;  4QTR A;  1LKX A;  2BY3 A;  2EZI A;  4PJL A;  3SHF A;  2BOL A;  2DPD A;  3AG1 H;  4A5N A;  3HRU A;  3OYI A;  2RNG A;  2TRT A;  5DCF A;  3L2W A;  2E71 A;  3L7W A;  3V8L A;  3RKQ A;  1R22 A;  4BE2 A;  3IAS 2;  3AG2 H;  2LLK A;  3AG3 H;  4KIF A;  2R7F A;  2V1D A;  4WX9 A;  4DYR A;  3MVP A;  1I3Q J;  2AXL A;  2ZFU A;  1DGW Y;  3M8E A;  4JOM A;  2V79 A;  3FMQ A;  3MWM A;  2IXS A;  1MMS A;  3VOD A;  4FIS A;  1ZGA A;  2E5Z A;  2J5O A;  1M1E B;  3HPH A;  2IT0 A;  2XPV A;  4M3B A;  3TO9 A;  4BKX A;  3HTS B;  2DA5 A;  1TWF J;  1ZYR F;  1HKQ A;  5GAG J;  4ZYH A;  3BR3 A;  3MKY B;  1BN5 A;  1NHA A;  1ORK A;  1JKO C;  3HOT A;  4GXO A;  4OOI A;  1BL0 A;  4D5F A;  1R4M B;  2PQ8 A;  4IHV A;  1ULY A;  5DCM B;  3HRT A;  3K10 A;  5LRS A;  2NVX J;  2X6Y A;  3HUG A;  1RI7 A;  2F6C A;  3GFL A;  2CS3 A;  1S7A A;  1SAU A;  2E1N A;  2NNN A;  3S17 J;  2LMD A;  1O7L A;  2QCO A;  1IW7 F;  1QVU A;  2B7E A;  4MQ9 F;  1J7K A;  2XGE A;  3I4P A;  4RS8 A;  2IGO A;  2GA2 A;  4RAG A;  1PP8 F;  2FBH A;  3OS2 A;  2MLK A;  3GLX A;  3OS1 A;  4KYW A;  3E6B A;  3E1S A;  2M7A A;  2CW0 F;  4KMF A;  2IRF G;  5FLX K;  1TTY A;  5HVQ C;  1PJR A;  4C9Y A;  1O3Q A;  1BI3 A;  1LJ9 A;  3FM3 A;  1F1Z A;  4E7J A;  4GO1 A;  4U0W A;  3RPU D;  3IC7 A;  2Q1Z B;  3CDI A;  2XPW A;  5EJC A;  3OYA A;  4O3M A;  1J2X A;  2AQF A;  3ZQH A;  1FT9 A;  4UNO A;  3M9A A;  1V5E A;  3TGN A;  1PUF B;  2X9D A;  3S2W A;  2Y2Z A;  1F0O A;  4HX7 A;  2FNP A;  4M3G A;  3CCL I;  2XKP A;  4FT8 A;  1MW7 A;  1OKR A;  2MH2 A;  1R4N B;  1TQI A;  1MMN A;  1RZ4 A;  3GUD A;  5DUI A;  3JRD A;  1NG7 A;  4EAT A;  2PMH A;  1XX5 A;  1J5Y A;  1APL C;  2JUG A;  1FP1 D;  2M7B A;  4A2U A;  4KA4 A;  2M4K A;  1FX7 A;  2X0L A;  2VT3 A;  1X1A A;  3BTJ A;  5LRR A;  1BM9 A;  3ZQI A;  2KP6 A;  4IHS A;  2LBF A;  1YRN A;  2KMU A;  2ECC A;  5E1Z B;  1J9I A;  1T39 A;  4IQ4 A;  1EA3 A;  3FXK A;  3Q9S A;  2MGQ A;  2R4G A;  5D8L B;  5FD6 A;  1CQT A;  4ZTJ A;  2UV1 A;  4A69 C;  1W5S A;  3PQJ A;  1RKT A;  3ABK H;  2KPM A;  3ULQ B;  2VKD A;  3IKT A;  1OQY A;  2LY9 A;  1YS6 A;  5J3L A;  2E19 A;  1FYK A;  3MD2 A;  4GFB A;  1G6N A;  3S1Q J;  2OD5 A;  2XRO A;  1RKW A;  2LG4 A;  1R58 A;  3QPS A;  1VQ4 I;  4D5C A;  1ETV A;  2QQ9 A;  4A3C J;  2V1N A;  1FP2 A;  2BXZ A;  2FA5 A;  4G6D A;  4Y15 A;  4IHW A;  3BJA A;  1MGT A;  4CH7 A;  1W5T A;  5L3F A;  2ZJ2 A;  2K9M A;  1RES A;  1B1B A;  4M72 A;  3FX3 A;  3WG7 H;  1ON1 A;  3ZR8 X;  3OIQ A;  3DBH B;  4AIK A;  4BNC A;  1IF1 A;  3FKJ A;  5LD2 C;  4OIO F;  2K02 A;  3ELK A;  1U8B A;  4KMU X;  4B48 A;  3KFW X;  3OL4 A;  5E3N A;  3PM1 A;  2VL8 A;  4LJZ F;  1IXC A;  3GTM J;  5DM6 F;  3CO7 C;  2OV7 A;  2JSC A;  2PJR B;  2QA4 I;  4NHJ A;  1VFC A;  2VQL A;  2HQ5 A;  3HKZ A;  2RKH A;  4LB5 A;  4Y7N J;  3IL2 A;  1XGO A;  1XD7 A;  4HF0 A;  4PZJ A;  4AID A;  4N4N B;  3S3O A;  1YIJ I;  2VOO A;  2DOA A;  2G0E A;  1WH5 A;  2HVS A;  1PVE A;  2E1M B;  4R79 A;  1V5G A;  3QPT A;  3K4M A;  3TMO A;  4BHP A;  4BBS J;  2D45 A;  3TQN A;  4R8H A;  1EKE A;  4HX8 A;  2Y31 A;  3B6A A;  1D0X A;  3W2V A;  1KYZ A;  5EG0 A;  2R7Z J;  1ZK8 A;  5HNF A;  4BDZ A;  2D2W A;  1R36 A;  2E60 A;  1D1A A;  2VE8 A;  2EFO A;  1WHU A;  4CYD A;  3PO2 J;  4BDY A;  1MJ9 A;  3U1D A;  3R4K A;  2ZJR F;  5DD8 A;  1OFC X;  1IXR C;  2VJJ A;  1FBS A;  3E6M A;  2FRH A;  5F64 A;  3M8J A;  3E6D A;  4XLH A;  1UHS A;  2MAB A;  3WTY C;  2COB A;  4UVB A;  2KKO A;  4MFE A;  5M5Y J;  2ZNY A;  3MAJ A;  2JTV A;  4UV8 A;  3IRQ A;  2W48 A;  2NXN B;  3GXO A;  3S14 J;  3W3C A;  1TQM A;  1H56 A;  3KPH A;  4E70 A;  3MZH A;  3GTO J;  5FLV A;  1Y8R B;  2Y0S A;  2ODH A;  1HDD C;  2Z16 A;  2P5L C;  1RC9 A;  4NQW B;  2X51 A;  4LLL A;  2XAF A;  4IF4 A;  4HEA 2;  1SD7 A;  2M9H A;  2OCC H;  2MYS A;  5DEQ A;  5JHF A;  1XMA A;  4LK0 F;  4XK4 A;  1L3L A;  1LUJ B;  3I56 I;  2CQ7 A;  4WXH A;  2JMW A;  1ONV A;  2HFH A;  2NS8 A;  5J4Y A;  4M6X A;  5HS9 A;  2UXX A;  3CUQ C;  1LE8 A;  1U9N A;  2P4W A;  2OCE A;  2CSO A;  2DK5 A;  3ERE D;  3KEY A;  2XAJ A;  3ROU A;  2JK3 A;  4JQF A;  4ZYE A;  1YI2 I;  1XSX A;  3DFG A;  5JR3 A;  3S1R J;  2M4G A;  4MLO A;  5M5X J;  2LP0 A;  2RQP A;  2VKV A;  4OMY A;  4M6Y A;  1ZLJ A;  2BGC A;  4G9Y A;  2EIN H;  1MDM A;  1ZRD A;  9ANT A;  3I4M J;  3OV8 A;  2M1B A;  2JUC A;  2XPU A;  3FBI B;  2L4A A;  4W1U A;  1STZ A;  3CDH A;  1B72 B;  3QRF F;  3FXQ A;  4EGZ A;  2FEZ A;  2KRH A;  3FXM A;  1N77 A;  4HQE A;  5GAD J;  5CQG A;  4WWC A;  2WA0 A;  2DN0 A;  2ZXH A;  2DPU A;  2E5N A;  3BCB A;  1VQK I;  3LSK A;  5HLI A;  2LC2 A;  2JRT A;  2KL4 A;  4UVA A;  3A1Y A;  4EQQ A;  1K79 A;  3CCU I;  1Y6I A;  2VOD A;  2K9N A;  4HLX A;  1ENH A;  4AIH A;  4HDU A;  3A03 A;  4S05 A;  2X1E A;  2VXD A;  3ZCO A;  3CZ6 A;  1J75 A;  5FRN A;  1GT0 C;  1TW2 A;  2MBF A;  4RLF A;  1T98 A;  2EZL A;  1W4M A;  4PJN A;  4I0B A;  5FJ8 J;  3SJM A;  5TJJ A;  4B4C A;  1PDN C;  3EPZ A;  2BXY A;  1KQ8 A;  5JFR A;  2EIJ H;  2V9K A;  3B73 A;  4A3D J;  1R7J A;  2XAG A;  3A02 A;  4AVZ A;  1QZZ A;  1VTN C;  4YIR X;  2CV1 A;  4PCQ A;  1W7P A;  2LY1 A;  3RIR A;  2ZME C;  2VPL A;  4WF2 A;  3ECH A;  4A3K J;  3D5L A;  2L7K A;  4HA8 A;  4J01 A;  2W85 A;  4L9J A;  3K4C A;  4M3D A;  2CQX A;  2DAO A;  1KZH A;  1YX5 A;  1JUP A;  4RAF A;  1X58 A;  4EGY A;  4KT6 A;  3PFY A;  1MBJ A;  5E3O A;  1ZAO A;  5F27 A;  1I27 A;  2VQC A;  4AD9 A;  1UMQ A;  1HCR A;  4RAY A;  1MND A;  3NAU A;  3COA C;  1SFU A;  5HOD A;  4BEH A;  3D1N I;  2VJI A;  1SAX A;  2IJL A;  1T38 A;  3KZI C;  2JZY A;  4IHY A;  3GW2 A;  1EH6 A;  1Z05 A;  4II2 A;  1LNW A;  4QSH A;  3BZ6 A;  1T6S A;  5AIP A;  2VLA A;  1BA5 A;  3S2D J;  2MD5 A;  2LYC A;  2DT6 A;  1FNN A;  1XC5 A;  3BG6 A;  5FB2 A;  2O7O A;  1RNL A;  3CUO A;  4M74 A;  2Q0O A;  2K40 A;  1V4R A;  3FHZ A;  2V7F A;  1ZG1 A;  2JVH A;  3IMB A;  3F8N A;  3GZN B;  5IYC J;  2QBY A;  1E3P A;  2K7L A;  1DUX C;  5ICF A;  5C3E J;  2K9Q A;  2DQL A;  1TWG J;  2QF7 A;  2PMZ A;  1ZG5 A;  1D5Y A;  2UZK A;  2JJ7 A;  1U8R A;  3ESW B;  1ZRE A;  3VYR B;  4ON0 A;  3J81 Z;  4RAZ A;  2L2O A;  4BXF A;  4L5E A;  2IS4 A;  2GXA A;  4YIF A;  1LDJ A;  1ON2 A;  1JGG A;  3ABT A;  1MKM A;  4CCM A;  2W7N A;  4ZYA A;  4DYC A;  3KLO A;  3W2A A;  4O6J A;  3H5N A;  2H6B A;  2LY2 A;  4A0Z A;  4ZDP A;  2DA4 A;  4V2F A;  1TT0 A;  1FMV A;  5E3L A;  5M5W J;  3KET A;  3RQ4 A;  2E2I J;  3GCM A;  5CJ9 A;  3MEX A;  4UUS B;  2EZH A;  4XKB A;  1R00 A;  4BJ5 C;  5L3E A;  4NC7 A;  1OR7 A;  4CYC A;  1W0T A;  5ILS A;  2XGD A;  2NRA C;  3GTQ J;  3CJQ B;  4A3E J;  1VQ9 I;  3ECO A;  3QPL A;  3CC4 I;  2Q10 A;  2F4O B;  1LFB A;  1QPM A;  1JKQ C;  4EJO A;  5D8K B;  1HST A;  4LG3 A;  5E8G A;  3A0B C;  3FZV A;  2K27 A;  3PNV A;  2R5Y B;  2GA1 A;  3CUQ B;  2P5V A;  1P7I A;  4YFX F;  2ELK A;  2QZ8 A;  4FET A;  4RGR A;  4Q5S F;  1H0M A;  2N8G A;  3ZQC A;  1ACI A;  2LRE A;  3U21 A;  2DW4 A;  3BTC A;  3HRS A;  5DYM A;  3HOX J;  4MEY F;  4G6T B;  3FXR A;  3I59 B;  4CUG A;  3JRF A;  3KYD B;  4P1W A;  3C7J A;  4OIN F;  1REP C;  4E7L A;  2A6E F;  2XV4 S;  2XHK A;  2IAI A;  2VOP A;  1ZHF A;  1HBX G;  3I54 A;  2FSW A;  1F9N A;  2E2J J;  2HDD A;  2V4J C;  4OU0 A;  3LL7 A;  2JWT A;  2GAU A;  2M3A A;  4CGZ A;  3WGH A;  2KDZ A;  2NOG A;  1R71 A;  2IS2 A;  4DBQ A;  1YG2 A;  2MH9 A;  4GDF A;  4B3X A;  1GDT A;  3T8R A;  2EFN A;  1D8K A;  3DEE A;  2CQK A;  4A0Y A;  5B1A H;  2VBZ A;  1T8I A;  2ZSH B;  1WFX A;  3BT9 A;  1NK2 P;  2M8G X;  1FBQ A;  1YJN I;  3WTW C;  4L0Y B;  5E17 F;  4OAZ A;  1D8J A;  2ELJ A;  5IOZ A;  2XSD C;  4FCY A;  1MBK A;  3CLO A;  1RR8 C;  3BPV A;  2BY1 A;  3KLN A;  3QP5 A;  3LFK A;  2G9W A;  3IHU A;  3KYC B;  2RDP A;  3KP3 A;  2XAQ A;  5ICE A;  2O9L A;  2PI0 A;  2BHY A;  3S1M J;  4ESB A;  2MC4 A;  5KCM A;  4KDP A;  2Y9Z A;  3JRE A;  2LKX A;  5EZG A;  1I3A A;  2YUS A;  5K5O A;  2XAH A;  1G3W A;  2JN6 A;  2DI3 A;  2VIX A;  2NVT J;  2R7R A;  2ZME B;  2KHM A;  3ZQL A;  1HW1 A;  1Z7U A;  3Q3S A;  3N05 A;  2BVM A;  2JA6 J;  2L01 A;  5KVR A;  2FX0 A;  1ETK A;  2Z99 A;  2HDW A;  1TZL A;  2O5R A;  4OIQ F;  3OYK A;  2L9N A;  3F21 A;  4D7N A;  4PJM A;  4LLN A;  3QYE A;  2HVR A;  3F6O A;  1UEL B;  3QU6 A;  1NK3 P;  2TDX A;  1G3Y A;  4HV6 A;  1WJB A;  3PNT A;  3TDZ C;  3BOQ A;  3BQZ A;  4IVN A;  3GTG J;  4AYB N;  5BS6 A;  3JCU C;  3J7A O;  3HL2 A;  1IUF A;  3AFH A;  2OQG A;  4M9Z A;  2L9V A;  5LFA A;  4D0P A;  1IRZ A;  2DFF A;  2XSJ C;  4XIC A;  2HDC A;  1XN7 A;  2Y75 A;  3HM5 A;  1OCC H;  2L9S A;  3ASO H;  3K1P A;  2FJ1 A;  2AQE A;  4I99 C;  2OAZ A;  4A3F J;  3TO7 A;  3C2B A;  4B43 A;  3I5U A;  1QRY A;  5GAH J;  1XGS A;  3ZMS A;  3F22 A;  1D3Y A;  3WTV C;  2EJR A;  2LF8 A;  4AU7 A;  1X3U A;  2CWE A;  4BS9 A;  1W5C C;  4E7S A;  1OIS A;  5BNG A;  3LQQ A;  2H1K A;  1ETO A;  4J19 A;  1I1G A;  5EEA A;  2XKO A;  1T0F A;  3EUA A;  2R7W A;  1Z21 A;  1KGS A;  3L9F A;  4G94 A;  1QHH D;  1TLH B;  4EEF G;  4IO9 F;  2HVQ A;  3MMY B;  1AOY A;  2QQA A;  2LK2 A;  5CKT A;  3TP3 A;  5D5U B;  2XUB A;  3GFJ A;  4HDV A;  3K4N A;  4ESJ A;  5KNL A;  2BW3 A;  1MNM C;  4CZC A;  1E3H A;  3J81 K;  2QSG X;  2QKL B;  2NYX A;  4L5J A;  5ILV A;  5EEG A;  4AC0 A;  5EGO A;  1ZR4 A;  2PBI A;  2HXO A;  1F4K A;  5TRD A;  2F48 A;  1B9N A;  3R61 A;  1QO0 D;  3TW7 A;  4BE1 A;  3OYG A;  3EYI A;  2HYF A;  1CF7 A;  3E5Q A;  4OWR B;  3H0D A;  4LIU A;  4X1E A;  2KIU A;  4FE4 A;  2LH9 A;  4ZTF A;  1UCR A;  4E7I A;  3GEZ A;  3HUG B;  1VND A;  1B8I A;  4HW0 A;  3BWG A;  3HOU J;  3WGI A;  4M3F A;  3KX2 A;  3ABU A;  3FXU A;  1QQI A;  4E6K G;  5F1R A;  1K83 J;  2EV6 A;  3LAP A;  5DV5 A;  4M9S A;  4G8X A;  3SDG A;  2EFW A;  5M3F J;  2DMQ A;  4MNU A;  5K5R A;  3IUO A;  2AXT C;  3KP4 A;  4DGW B;  2VBY A;  5B5E C;  1XCV A;  3RSN A;  3K6G A;  5HDN A;  2A05 A;  4I6Z A;  3J80 K;  5D4S A;  3ZQF A;  4CZZ A;  4DOZ A;  2M34 A;  1JHF A;  3OYE A;  3DU5 A;  4I2O A;  3GZ6 A;  1LQ1 A;  3NEU A;  2EIM H;  2OBP A;  2VC0 A;  3F72 A;  2DDB A;  1GUU A;  3OYM A;  3DPL C;  3SFI A;  2OUM A;  3HG9 A;  1E0E A;  1DU6 A;  2RVC A;  2Q2E A;  1R23 A;  1P4W A;  1Y0U A;  4XKW A;  4DBR A;  4LB6 B;  1GV5 A;  1Z77 A;  2YS9 A;  5CVI A;  4ETS A;  1XG1 A;  4WCG A;  2F4M B;  1A31 A;  2GM4 A;  1H9T A;  5EDN A;  4Y4R A;  3I0T A;  4HAM A;  1VI0 A;  5DM7 F;  2MSY A;  1VQ6 I;  2JA8 J;  4XR6 A;  4YRV A;  4BXU A;  2KRF A;  5BOX A;  4Y33 A;  1OCZ H;  5E1W A;  4CIC A;  4KFC A;  4JX5 A;  4JK1 X;  4BY7 J;  4LOC A;  4YFN F;  3RYP A;  3LSJ A;  4XON A;  2IGM A;  2LBF B;  1R5H A;  4BQO A;  5DDG A;  4QLC U;  1YRN B;  1WRJ A;  1XCB A;  1WCM J;  4QPQ A;  1USS A;  2OTJ I;  3FMS A;  3WU2 C;  1HC8 A;  1LEB A;  1N78 A;  5FRO A;  1BR4 A;  5JI6 A;  4E7K A;  2UWM A;  1QZY A;  4RGU A;  2PFB A;  1MH4 A;  4BJT A;  3H3V K;  4HSR A;  3K4K A;  4JX6 A;  2ZC2 A;  3FK7 A;  2LTP A;  4H4K C;  4RLQ A;  3JAM K;  2PG4 A;  2DA1 A;  4KN4 X;  1UZC A;  3LSM A;  2P5K A;  4C2U A;  1D1B A;  1HDP A;  1O7F A;  3FDY A;  4X6A J;  4GCV A;  2P7C B;  1GVD A;  2XF6 A;  3TBI A;  4WK8 F;  1XDU A;  6PAX A;  3WTS C;  3S16 J;  1MZB A;  4G7O F;  2HQN A;  2KIS A;  4ZZD A;  4PFP A;  5BPD A;  4UHT A;  1MBH A;  1S29 A;  3I4N J;  2H6C A;  3FXL A;  4JX4 A;  3VOE A;  5ED4 A;  3ZP5 A;  2IGN A;  3RPU A;  5B1B H;  1R1T A;  2CRG A;  1DQU A;  4P9F A;  3UR3 C;  5FFZ A;  5A2Q K;  2ODI A;  4U87 A;  2K3F A;  4Y3O A;  3LSR A;  3CCS I;  4BBR J;  5EYR A;  2HGC A;  3KCC A;  5K7Z A;  2HI3 A;  5K5Q A;  1YX3 A;  3FWE A;  5HLH A;  2VAS A;  5FKL A;  1VQ5 I;  3F23 A;  2B63 J;  2NS7 A;  3QOP A;  2DOD A;  1I1S A;  1OCO H;  2DMN A;  5F6F A;  4LG0 A;  2W82 A;  5LGT A;  1SD5 A;  2EBI A;  1ZQ3 P;  4ZC3 A;  4A3M J;  2IA2 A;  4QPO A;  1T95 A;  4LMY A;  3RCO A;  5L3D A;  3VEP A;  3CME I;  4TV7 A;  2CO5 A;  2K9S A;  4PK4 A;  2DU9 A;  2F5V A;  1P2F A;  4I98 B;  4IRG A;  5EG0 B;  3CC7 I;  3PUB A;  4BHC A;  1PVU A;  3C3W A;  2X1D A;  3VB2 A;  1J59 A;  2VJ4 A;  3L2V A;  1A5J A;  1YIO A;  4EM0 B;  1KU9 A;  4CXF A;  1WJA A;  3FBN B;  4I7H A;  5TGT A;  3RPQ A;  3GX4 X;  2M87 A;  3LSG A;  4XSZ F;  3L2R A;  4AM3 A;  3HSR A;  2AO9 A;  3WTZ A;  4A12 A;  2GXB A;  4HOB A;  2L54 A;  3ZRG A;  2R7D A;  2JSP A;  1Z91 A;  3ZXS A;  1U2W A;  5IT9 K;  2K4B A;  3CO6 C;  1LFU P;  1DPU A;  5GTH C;  2VI6 A;  2B9S A;  1SVM A;  1FSE A;  2E36 A;  1IN7 A;  4YII A;  2CG4 A;  1LVK A;  2RN7 A;  2LKS A;  5JVT A;  4CDG A;  3LQR A;  2ZXJ A;  2NVU B;  2WTE A;  1OR7 C;  2DQR A;  4L9N A;  5D6E A;  1KQ0 A;  4S0H B;  2CQQ A;  4ENJ A;  3L2C A;  4ZZL A;  3TW6 A;  2EPF A;  2P81 A;  5HNH A;  3VSL A;  3K1N A;  2VQG A;  3DKX A;  3OYF A;  3RKW A;  1YFH A;  1YLF A;  1ZG3 A;  2CH0 A;  4JBA A;  1LE8 B;  2R5Z A;  4IOC F;  1FZP B;  3ZGK A;  1HF0 A;  5E79 C;  4DQ2 A;  2DFE A;  3DEU A;  2W84 A;  3M3Y J;  4E4H A;  5LLQ A;  4EV0 A;  3ZMT A;  2R7U A;  1PVI A;  3JRI A;  3Q5F A;  1XSV A;  3HOW J;  5CVU A;  2PJP A;  3HGG A;  3VPR A;  2JA7 J;  1ZGJ A;  1KYW A;  2LVS A;  1WJD A;  3KP6 A;  5D5W B;  3KP2 A;  4CCL A;  2VPR A;  1FOW A;  1OYW A;  3LA2 A;  1HW2 A;  1XB4 A;  2JVG A;  2XAS A;  2W25 A;  2ZJP F;  3QOD A;  3NRV A;  4MEX F;  1FIP A;  1E2X A;  1KA8 A;  2VBW A;  4HLY A;  2W57 A;  4G6Q A;  1IUY A;  2E7X A;  5CVJ A;  4XLC A;  4C3J J;  2V1X A;  5FO5 A;  2DOE A;  2EZK A;  3DP7 A;  2STW A;  3CC2 I;  2HTS A;  2VBX A;  1H8A C;  1P7J A;  1S7E A;  3A4C A;  4N9H A;  4D1Q A;  3H9Q A;  3T0Y A;  2M5W A;  2ESH A;  3HYI A;  2CMP A;  5H6Q A;  4C3H J;  1U5T A;  2DMT A;  2IW5 A;  4IQJ A;  1FOY A;  3CD6 I;  1LPQ A;  3JW4 A;  4EVI A;  3ZQQ A;  3Q9V A;  1VQO I;  4XOT A;  2C6Y A;  3WOD F;  1HQC A;  3SQN A;  1S3J A;  3GFM A;  1YHQ I;  2KIQ A;  3W6J B;  3KEQ A;  1HW5 A;  3G1M A;  3KP7 A;  3PIP F;  4MQV A;  5KK1 A;  4RGX A;  1JUM A;  3GME A;  5K1Y A;  5TIS C;  2HOT A;  4QIW N;  5BMZ A;  4CCN A;  1PUE E;  4BU2 A;  3QU3 A;  4QWQ A;  3GYH X;  1JTY A;  2MC3 A;  2A69 F;  3G1L A;  3BP8 A;  5LEK A;  4FAS D;  1W7P B;  4NQW A;  2X1C A;  1TNS A;  2OA4 A;  1Y0N A;  3LMM A;  3E7L A;  5FLM J;  1X3Z B;  3R0J A;  3KP5 A;  3SZP A;  1UFM A;  2FF4 A;  5CYV A;  2XF7 A;  3DPU A;  4EJW A;  2FQ4 A;  1K0Z A;  1W7P D;  1FYL A;  2A6T A;  3BG5 A;  1VQ8 I;  2HR3 A;  2Z2S B;  1FC3 A;  3BR5 A;  4DYQ A;  3OOP A;  5IPA A;  1JT0 A;  2HPM A;  3HDD A;  3VYT B;  1TBX A;  2NS0 A;  1ZH5 A;  2DA2 A;  2X85 A;  2M0M A;  4BEH B;  1IJW C;  2YU9 J;  1ZKG A;  2F4I A;  4PJ0 C;  3G6E I;  1FSH A;  4U7D A;  4RM2 A;  2DYS H;  1XS9 A;  1L0O C;  5FFX A;  1R1V A;  4CCK A;  4HF2 A;  4ZYG A;  5LHH A;  3U9G A;  4LGW A;  3TL4 X;  3P7N A;  2KDO A;  1QPI A;  4ZDL A;  2A3S A;  3K4L A;  3K9T A;  4AYB A;  4A3L J;  1RET A;  3S3M A;  3Q0V A;  1VQL I;  1P9Q C;  3GWZ A;  1AHD P;  2QBY B;  2WWY A;  5L3B A;  2XC7 A;  3NWT A;  1FIA A;  2GIZ A;  3CJT B;  5EEH A;  2DYR H;  2M8E A;  5KHD A;  2HPI A;  1X4O A;  3TOB A;  4CA0 A;  3FXO A;  4FHT A;  3L00 A;  3DKW A;  2E35 A;  3C2G A;  5GAE J;  2P7V B;  4NB5 A;  3T8T A;  2QKM B;  3H3Z A;  1I39 A;  1IN4 A;  3KZZ A;  3CF5 F;  4ENK A;  2LF7 A;  1GVJ A;  1MSF C;  4Q47 A;  1D1C A;  1TW3 A;  3BJO A;  3HZJ A;  3SYT A;  3ML6 A;  1Z3Y A;  4HNT A;  3OYC A;  3O8H A;  2L9R A;  3SFZ A;  2W24 A;  2HU9 A;  2E7W A;  2QWW A;  4Y52 J;  4XN0 A;  1WQ2 A;  4CYC B;  3M1E A;  2YX4 A;  1FOK A;  2KZV A;  3CP2 A;  2TCT A;  4PFO A;  5H6R A;  4CCO A;  3DLA A;  3OWT A;  3F9K A;  3GFI A;  3HPG A;  5GPC A;  1X1C A;  5LEJ A;  1P6R A;  2P0W A;  1KU3 A;  5D5X B;  3G73 A;  1U78 A;  3OOU A;  1WJE A;  1MBF A;  1SFO J;  2IS1 A;  1H9G A;  1TQP A;  2DT7 B;  1YW8 A;  1Y1V J;  2IBD A;  3DTE A;  4BUP A;  3P9I A;  5KAI C;  1VQN I;  1AU7 A;  2DXI A;  2OZU A;  2XDV A;  5LGN A;  2XGX A;  1O4X A;  4XRS G;  3FIW A;  5IY5 H;  3IV5 A;  1DDN A;  2Z3Y A;  3ZN1 A;  2FNA A;  4BQN A;  4UUV A;  2P6S A;  3GTJ J;  1MJA A;  4A93 J;  2HKO A;  3HIF A;  1S5L C;  2DA3 A;  1S8N A;  3E5U A;  4PSW A;  1FTT A;  3JTG A;  2BV6 A;  1X2M A;  3BR2 A;  5CPR B;  4F3Q A;  2GOM A;  3GF2 A;  1OYY A;  3BR1 A;  3W6V A;  4HZF A;  4BGD A;  4UY8 I;  1UST A;  1MBG A;  3I53 A;  1PP7 U;  3PO3 J;  3GTK J;  3E0J B;  1XGM A;  2XB0 X;  1YOV B;  1YW7 A;  3LA7 A;  2VON A;  5JHU A;  2VJ5 A;  2L3D A;  1LDK B;  1OCP A;  2CFO A;  3BPX A;  3D0S A;  2BBY A;  2OPT A;  2OTL I;  2ZNZ A;  1ZRC A;  1GXP A;  2ACJ A;  4EJU A;  3WHB A;  1KU2 A;  4XID A;  1IO2 A;  2O61 A;  2ESN A;  3B6C A;  3J7Y J;  2K86 A;  1AA7 A;  1T2K A;  3DXJ F;  3OYD A;  4NBQ A;  2DFH A;  1SAN A;  2I5U A;  3G2B A;  3WU1 B;  3S3N A;  2Z5U A;  1WH7 A;  5L3G A;  2Y30 A;  4X0G A;  1AKH A;  2NOJ B;  2HYJ A;  3PL8 A;  1G4D A;  3QOE A;  3CDL A;  4LIT A;  2E1O A;  2HQA A;  2LNB A;  1QVT A;  1MBE A;  2CW8 A;  2ETH A;  2OA9 A;  1SD6 A;  3P9K A;  4XKC A;  1K61 A;  3H0G J;  2WC2 A;  2XGC A;  4HQM A;  4JYK A;  3OR1 C;  3HJE A;  5F0H A;  5EZH A;  4GGG A;  4OMZ A;  2R7Q A;  4MO7 A;  3I71 A;  1IC8 A;  1IV6 A;  1BW5 A;  1B9M A;  2CGP A;  4HST A;  4HV5 A;  2R7T A;  1Z1D A;  1SC7 A;  3V42 A;  4HNU A;  5M3M J;  4KUM A;  2CYY A;  2CJJ A;  3M07 A;  1HOM A;  4JP0 A;  2KZG A;  3MFK A;  1Y39 A;  4UV9 A;  1ERD A;  5FKO A;  2MLG A;  3HSF A;  4A0X A;  2O6G E;  2JT1 A;  3BQY A;  4B44 A;  5C4J J;  2JRM A;  3RI4 A;  2H8W A;  4IJA A;  4BY1 J;  1VF9 A;  1BIA A;  2Y0M A;  2JA2 A;  1V3F A;  4XBF A;  2I10 A;  1GXQ A;  3S8P A;  1GLN A;  1Y56 A;  4YEL A;  1XMX A;  3OL3 A;  2ZSI B;  4P55 A;  1U9O A;  1UHM A;  1SMY F;  1XMK A;  3MQ0 A;  4MFD A;  1MMG A;  3LSH A;  1U3E M;  2WAE A;  3QYB A;  3TKY A;  3ZMU A;  3N4M A;  2DJN A;  3O8G A;  5E1X A;  4NC8 A;  3QP6 A;  3ABM H;  2O8K A;  3IP4 B;  2X6O A;  1K6O A;  2WB1 N;  3A01 A;  2L02 A;  4G7H F;  4Y13 A;  3K0L A;  2QGU A;  4BL0 B;  5LHG A;  1WI9 A;  4Z2Y A;  2EV0 A;  4F55 A;  2ZJQ F;  1MIJ A;  2DTR A;  5ICC A;  1SMT A;  2PVI A;  3K4J A;  1JI8 A;  3EET A;  2ISZ A;  2K85 A;  2BW3 B;  5CLS A;  1C0W A;  4RB3 C;  5FRM A;  4RB2 C;  5HDG A;  3EDP A;  4WXD A;  1A6I A;  1VQP I;  5EGO B;  2DOF A;  4FX4 A;  5HS8 A;  3V4G A;  1QGP A; 
#chains in the Genus database with same CATH homology
 2LSO A;  2E1C A;  5H20 A;  1CF7 B;  3BJ6 A;  5LGU A;  1P4A A;  3ZMZ A;  1K78 A;  1EV7 A;  2G7U A;  5E8I A;  2QM3 A;  2OU2 A;  2HZT A;  1IRG A;  1G3T A;  1S7O A;  2YX7 A;  5J8C A;  1GHC A;  2XVC A;  3KE2 A;  3EUH A;  3TDU C;  1FY7 A;  3C18 A;  1I5Z A;  2ADU A;  2IP2 A;  4XRF A;  2ISY A;  5J8F A;  3V7C A;  1WSU A;  4HF1 A;  3F8C A;  2OAA A;  4DNC A;  2RV8 A;  3WTX C;  3FM5 A;  5HLG A;  3IRR A;  4RB1 A;  2FOK A;  4ZYD A;  4MTE A;  1O3T A;  2DLL A;  1B59 A;  2L4M A;  3IKV A;  3W6K B;  4A5M A;  2GWR A;  2IVM A;  4ENM A;  1BC7 C;  4RGS A;  1U5T C;  1JE8 A;  1WWX A;  5ICG A;  3EQL F;  2EFP A;  4FX0 A;  2BE5 F;  2PLY A;  4L9V A;  2O3F A;  1SFE A;  1U6G A;  2KJB A;  2DK8 A;  3LST A;  4Y17 A;  4BAY A;  2CFX A;  2R3S A;  2GQQ A;  4P5O A;  3HTU A;  3R60 A;  4MTD A;  2EK5 A;  4BQA A;  5J6X A;  1JHH A;  1CGP A;  2J5P A;  4O5V A;  1KQ9 A;  4KIB A;  4KT5 C;  3REO A;  2FQ3 A;  1TNT A;  1B4A A;  3LA3 A;  3JTH A;  5L3C A;  2HS5 A;  4YFK F;  3WGG A;  1ODD A;  3B02 A;  4LG0 B;  3V7S A;  1BBY A;  3K1M A;  5DCM A;  4BYY A;  3BDD A;  4I09 A;  1EH7 A;  2ZBK A;  2IA0 A;  4PGG A;  2FE3 A;  2O8X A;  3RTR A;  2VN2 A;  3WG9 A;  2EWN A;  4U0Y A;  2RGV A;  4UXN A;  3DF8 A;  3WE2 A;  2V6C A;  2HTJ A;  5E20 A;  2STT A;  1G3S A;  1HKT A;  2A07 F;  2A5Y B;  4EJV A;  3RJP A;  2PMU A;  1FLI A;  2LKP A;  3FMR A;  1XSD A;  3CTA A;  3HSE A;  2OQR A;  3CJN A;  4U88 A;  3R6S A;  4A6E A;  2HEO A;  2G7H A;  2YU3 A;  2ZKZ A;  4L9T A;  4ASN A;  3GO5 A;  2QUF A;  3ZQ7 A;  2X4H A;  3KZY A;  1A04 A;  2DO7 A;  2ELH A;  2XIG A;  1ZRF A;  4L18 B;  2DBB A;  4XSX F;  2BEO A;  4IRI A;  3SXY A;  3N97 A;  2P8T A;  1JGS A;  3QPH A;  2Y48 A;  1XDS A;  3HOS A;  3GZ5 A;  3HHG A;  1EH8 A;  2BYV E;  3IWF A;  2IA1 A;  3VFZ A;  3IWZ A;  2A61 A;  3F6V A;  2F5C A;  1P4X A;  1BI2 A;  1F5T A;  3MZY A;  5D4R A;  4P96 A;  4HBL A;  2ZO4 A;  4U0V A;  4IPA A;  2EB7 A;  2PEX A;  2LDU A;  4ENN A;  3T5X A;  4IRH A;  1Z6T A;  3E3V A;  3F8B A;  1J0R A;  4S04 A;  1U5T B;  2KIF A;  4MHG A;  1AWC A;  1SFX A;  1KU7 A;  4LLG F;  1BC8 C;  5DD4 A;  1MDM B;  2H94 A;  2KIM A;  2ZFW A;  1OMI A;  3MCZ A;  4Q48 A;  4ZH4 F;  4XLN F;  1IAW A;  4EJT A;  2FXA A;  1XGN A;  4CHU A;  4M9X A;  3H92 A;  4EM2 A;  2VE9 A;  3V7R A;  1YYV A;  2VC1 A;  1HKS A;  4LD5 A;  2O0Y A;  1FYM A;  2VT2 A;  1LEA A;  4IHT A;  4MGR A;  4ESF A;  1HXD A;  3KEO A;  5DUK A;  4L0Z B;  3ZPL A;  5BQT A;  3K2Z A;  3PFI A;  1QNT A;  2COM A;  2PN6 A;  1IN6 A;  3SZT A;  4WXC A;  3LAJ A;  3DV8 A;  5ERI A;  3FF5 A;  1WKM A;  3F8F A;  4LFU A;  2FU4 A;  4PDK A;  2F5F A;  3E5X A;  3I58 A;  4A6D A;  2FBK A;  3O2P E;  4LK1 F;  5LHI A;  1O3S A;  4P9U A;  1OYI A;  3RYR A;  4B09 A;  2HKX A;  1SD4 A;  2K4J A;  3WTU C;  1UHW A;  2EV5 A;  4G7Z F;  1ZN2 A;  5FD5 A;  3H3U A;  3HHH A;  4AWX B;  3BY6 A;  1HSJ A;  3F3X A;  3ZMD A;  2QLZ A;  4EM1 A;  5HS7 A;  4GYG A;  4R1H A;  2XRN A;  3G3Z A;  1IZ1 A;  1ZAR A;  2O03 A;  3TO6 A;  2EFQ A;  1YS7 A;  1K7A A;  4CO8 A;  1IRF A;  3QAH A;  2P6T A;  3P9C A;  3L09 A;  4AIJ A;  1BI1 A;  1IXS B;  2NNY A;  4N9I A;  1R1U A;  5CVR A;  3E97 A;  3WU0 A;  2F2E A;  4F7Z A;  4Q4Z F;  4U7B A;  1FPQ A;  2DT5 A;  5LBQ A;  1JXS A;  4M71 A;  1RIO H;  1DP7 P;  2QVO A;  1MD0 A;  3ZMV A;  3ZN0 A;  5E18 F;  2HQR A;  2RNJ A;  3M7G A;  4B8X A;  4AVP A;  4YG2 F;  1O57 A;  4PGH A;  4N0B A;  1Z6R A;  1P92 A;  2D1H A;  4KN7 X;  5IT3 A;  1RUO A;  5HOO A;  3WTT C;  3AAF A;  2V9V A;  3C1D A;  4XLP F;  4BHB A;  3O3K A;  4H0E A;  5ILU A;  2EA2 A;  5BPI A;  4GYI A;  2IPQ X;  1RUN A;  2H09 A;  3WE3 A;  1BI0 A;  5HDK A;  3GVA A;  2QQB A;  4BH9 A;  2KJC A;  1O3R A;  2JPB A;  3EYY A;  4I01 A;  1YW9 A;  1UB9 A;  2GIV A;  2JPC A;  2RC4 A;  4I02 A;  3NQO A;  1BJA A;  3J80 Z;  1LDD A;  4K2E A;  1FBU A;  2Q8K A;  3RKY A;  5D6F A;  1OPC A;  4EMS A;  3PQK A;  3DQV C;  2HOE A;  1R5G A;  2V1U A;  2M45 A;  4KNY A;  2B0L A;  2Z33 A;  1LVA A;  3V8K A;  2GXG A;  5AIQ A;  3LWF A;  4OIR F;  3V8J A;  1YQA A;  3CUQ A;  1Q1H A;  5FGM A;  2VXZ A;  3O6B B;  5FLX Z;  1Z9C A;  4L5I A;  3U2R A;  2QEN A;  2FML A;  3I59 A;  4OIP F;  3JAM Z;  3RKX A;  2UXN A;  3I64 A;  1D5V A;  1I6X A;  1MJB A;  2YSR A;  4IXA A;  2Z9O A;  2F5D A;  1K78 B;  2ZCW A;  2A6H F;  1BIB A;  3F8M A;  4HYE A;  3ISP A;  4KIG A;  3JSO A;  4UVC A;  5A2Q Z;  1YO5 C;  1B6A A;  3BRO A;  3T1B A;  2AS5 F;  5CVV A;  2H27 A;  2YR2 A;  1QBJ A;  2MA3 A;  1LB2 A;  2EA4 A;  3JSP A;  2M30 A;  2QYO A;  2HWV A;  4M73 A;  1IN5 A;  2FBI A;  2ZME A;  3M8F A;  1E17 A;  3RDI A;  1DPR A;  2F5E A;  2D1V A;  2DFI A;  4I0A A;  1ZLK A;  2WV0 A;  3K69 A;  2A68 F;  3E6C C;  1S6L A;  1YTY A;  1BOA A;  2YPR A;  4RB0 A;  3TOA A;  2OZ6 A;  3HRM A;  1IN8 A;  5IT9 Z;  2HYG D;  3DPT A;  5AON A;  2NAZ A;  1FWZ A;  2GZW A;  4HX4 A;  4KIC A;  3R0A A;  5D5V B;  2FMY A;  3SHF A;  2DPD A;  4A5N A;  3HRU A;  5DCF A;  3L7W A;  3V8L A;  1R22 A;  4KIF A;  2R7F A;  2V1D A;  4WX9 A;  2AXL A;  3M8E A;  2V79 A;  3FMQ A;  3MWM A;  3VOD A;  1ZGA A;  2J5O A;  2IT0 A;  3TO9 A;  3HTS B;  1ZYR F;  1HKQ A;  4ZYH A;  1BN5 A;  1NHA A;  3HOT A;  4GXO A;  4OOI A;  2PQ8 A;  1ULY A;  5DCM B;  3HRT A;  5LRS A;  3HUG A;  1RI7 A;  3GFL A;  1S7A A;  2E1N A;  2NNN A;  1O7L A;  1IW7 F;  4MQ9 F;  1J7K A;  3I4P A;  4RS8 A;  2GA2 A;  1PP8 F;  2FBH A;  2MLK A;  3GLX A;  4KYW A;  3E6B A;  2CW0 F;  4KMF A;  2IRF G;  5FLX K;  1TTY A;  5HVQ C;  1O3Q A;  1BI3 A;  1LJ9 A;  3FM3 A;  1F1Z A;  4GO1 A;  4U0W A;  3IC7 A;  4O3M A;  1J2X A;  1FT9 A;  4UNO A;  3M9A A;  3TGN A;  3S2W A;  4HX7 A;  2FNP A;  2XKP A;  4FT8 A;  1OKR A;  2MH2 A;  1TQI A;  5DUI A;  1RZ4 A;  3GUD A;  2PMH A;  1J5Y A;  1FP1 D;  4A2U A;  4KA4 A;  1FX7 A;  2X0L A;  2VT3 A;  5LRR A;  1BM9 A;  4IHS A;  5E1Z B;  1J9I A;  1T39 A;  3Q9S A;  5D8L B;  5FD6 A;  1W5S A;  3PQJ A;  3ULQ B;  3IKT A;  1YS6 A;  1FYK A;  1G6N A;  2OD5 A;  2XRO A;  1R58 A;  2QQ9 A;  1FP2 A;  2FA5 A;  4G6D A;  4Y15 A;  3BJA A;  1MGT A;  5L3F A;  1W5T A;  2ZJ2 A;  1B1B A;  4M72 A;  3FX3 A;  4AIK A;  1ON1 A;  4BNC A;  1IF1 A;  4OIO F;  2K02 A;  3ELK A;  4KMU X;  3KFW X;  4LJZ F;  1IXC A;  3CO7 C;  2JSC A;  4NHJ A;  4LB5 A;  2RKH A;  3IL2 A;  1XGO A;  1XD7 A;  4HF0 A;  4PZJ A;  2VOO A;  4R79 A;  3QPT A;  4BHP A;  2D45 A;  3TQN A;  4R8H A;  4HX8 A;  1KYZ A;  2D2W A;  1R36 A;  2EFO A;  2VE8 A;  4CYD A;  1MJ9 A;  3U1D A;  3R4K A;  5DD8 A;  1IXR C;  1FBS A;  3E6M A;  2FRH A;  5F64 A;  3E6D A;  3WTY C;  4UVB A;  2KKO A;  2ZNY A;  3MAJ A;  2JTV A;  4UV8 A;  3IRQ A;  3GXO A;  1TQM A;  4E70 A;  3MZH A;  2ODH A;  2P5L C;  4LLL A;  2XAF A;  4IF4 A;  1SD7 A;  5DEQ A;  1XMA A;  4LK0 F;  1L3L A;  4WXH A;  1ONV A;  2HFH A;  4M6X A;  5HS9 A;  2UXX A;  3CUQ C;  2P4W A;  2CSO A;  2DK5 A;  3ERE D;  2XAJ A;  3ROU A;  4JQF A;  4ZYE A;  1XSX A;  3DFG A;  5JR3 A;  2RQP A;  4OMY A;  4M6Y A;  1ZLJ A;  2BGC A;  4G9Y A;  1MDM A;  1ZRD A;  3OV8 A;  2M1B A;  2L4A A;  1STZ A;  3CDH A;  3QRF F;  3FXQ A;  4EGZ A;  2FEZ A;  4HQE A;  4WWC A;  2DPU A;  5HLI A;  2JRT A;  4UVA A;  4EQQ A;  1K79 A;  2VOD A;  4HLX A;  4AIH A;  4HDU A;  4S05 A;  1J75 A;  1TW2 A;  2MBF A;  1T98 A;  1W4M A;  4I0B A;  5TJJ A;  1PDN C;  1KQ8 A;  5JFR A;  3B73 A;  1R7J A;  2XAG A;  1QZZ A;  1VTN C;  4PCQ A;  1W7P A;  3RIR A;  4WF2 A;  3ECH A;  3D5L A;  4HA8 A;  2W85 A;  4L9J A;  2DAO A;  4EGY A;  1ZAO A;  1I27 A;  4AD9 A;  4RAY A;  3COA C;  1SFU A;  1SAX A;  2IJL A;  1T38 A;  2JZY A;  3GW2 A;  1EH6 A;  1Z05 A;  1LNW A;  3BZ6 A;  1T6S A;  5AIP A;  2MD5 A;  1FNN A;  5FB2 A;  1RNL A;  3CUO A;  4M74 A;  2Q0O A;  1V4R A;  3FHZ A;  1ZG1 A;  3IMB A;  3F8N A;  2QBY A;  2K7L A;  1DUX C;  5ICF A;  2DQL A;  1ZG5 A;  2UZK A;  1U8R A;  1ZRE A;  4ON0 A;  3J81 Z;  4RAZ A;  4YIF A;  1LDJ A;  1ON2 A;  3ABT A;  1MKM A;  3KLO A;  4O6J A;  2H6B A;  4A0Z A;  3KET A;  5CJ9 A;  3MEX A;  1R00 A;  5L3E A;  1OR7 A;  5ILS A;  2NRA C;  3ECO A;  2Q10 A;  1QPM A;  4EJO A;  5D8K B;  1HST A;  5E8G A;  3FZV A;  2K27 A;  2GA1 A;  3CUQ B;  2P5V A;  4YFX F;  2QZ8 A;  4RGR A;  4Q5S F;  1H0M A;  2DW4 A;  3HRS A;  5DYM A;  4MEY F;  3FXR A;  3I59 B;  3C7J A;  4OIN F;  1REP C;  2A6E F;  2XHK A;  2XV4 S;  2VOP A;  1ZHF A;  1HBX G;  3I54 A;  2FSW A;  1F9N A;  4OU0 A;  2GAU A;  4CGZ A;  3WGH A;  1YG2 A;  2MH9 A;  3T8R A;  2EFN A;  1D8K A;  2CQK A;  4A0Y A;  2VBZ A;  4L0Y B;  1FBQ A;  3WTW C;  5E17 F;  1D8J A;  3CLO A;  3BPV A;  3KLN A;  3QP5 A;  3LFK A;  2G9W A;  3IHU A;  2RDP A;  3KP3 A;  2XAQ A;  5ICE A;  2PI0 A;  4ESB A;  4KDP A;  5K5O A;  2XAH A;  1G3W A;  2DI3 A;  2ZME B;  1HW1 A;  1Z7U A;  2L01 A;  5KVR A;  2Z99 A;  4OIQ F;  3F21 A;  4LLN A;  3F6O A;  3QU6 A;  2TDX A;  1G3Y A;  4HV6 A;  3TDZ C;  3BOQ A;  4IVN A;  5BS6 A;  3J7A O;  2OQG A;  4M9Z A;  4D0P A;  2HDC A;  1XN7 A;  2Y75 A;  3K1P A;  2OAZ A;  3TO7 A;  3I5U A;  1XGS A;  3F22 A;  3ZMS A;  3WTV C;  1D3Y A;  2EJR A;  2LF8 A;  1X3U A;  2CWE A;  3LQQ A;  1I1G A;  2XKO A;  1T0F A;  4G94 A;  1KGS A;  3L9F A;  1TLH B;  1AOY A;  2QQA A;  5D5U B;  2XUB A;  3GFJ A;  4HDV A;  4ESJ A;  3J81 K;  2NYX A;  4L5J A;  5ILV A;  5EEG A;  2PBI A;  1F4K A;  5TRD A;  1B9N A;  3R61 A;  1QO0 D;  3EYI A;  2HYF A;  1CF7 A;  3E5Q A;  2KIU A;  1UCR A;  3GEZ A;  4HW0 A;  3BWG A;  3WGI A;  3ABU A;  3FXU A;  1QQI A;  5F1R A;  2EV6 A;  3LAP A;  5DV5 A;  4M9S A;  4G8X A;  2EFW A;  4MNU A;  5K5R A;  3KP4 A;  2VBY A;  1XCV A;  5HDN A;  3J80 K;  5D4S A;  4CZZ A;  1JHF A;  4I2O A;  3GZ6 A;  1LQ1 A;  3NEU A;  2OBP A;  2VC0 A;  3F72 A;  3DPL C;  2RVC A;  2Q2E A;  1R23 A;  1P4W A;  1Y0U A;  4LB6 B;  4ETS A;  5CVI A;  4WCG A;  1H9T A;  3I0T A;  4HAM A;  4BXU A;  2KRF A;  5BOX A;  5E1W A;  4CIC A;  4KFC A;  4JK1 X;  4YFN F;  3RYP A;  5DDG A;  1R5H A;  4QLC U;  1WRJ A;  1XCB A;  1USS A;  3FMS A;  1LEB A;  5JI6 A;  2UWM A;  1QZY A;  4RGU A;  2PFB A;  3JAM K;  2PG4 A;  4KN4 X;  2P5K A;  1O7F A;  4GCV A;  2P7C B;  4WK8 F;  1XDU A;  6PAX A;  3WTS C;  1MZB A;  4G7O F;  2HQN A;  4ZZD A;  5BPD A;  4UHT A;  1S29 A;  2H6C A;  3VOE A;  5ED4 A;  3ZP5 A;  3RPU A;  1R1T A;  4P9F A;  5FFZ A;  5A2Q K;  2ODI A;  2HGC A;  3KCC A;  5K5Q A;  3FWE A;  5HLH A;  3F23 A;  3QOP A;  1I1S A;  5F6F A;  4LG0 A;  5LGT A;  1SD5 A;  2IA2 A;  4LMY A;  5L3D A;  3VEP A;  4TV7 A;  2CO5 A;  2DU9 A;  4IRG A;  1P2F A;  4I98 B;  4BHC A;  3C3W A;  3VB2 A;  1J59 A;  1YIO A;  4EM0 B;  1KU9 A;  4CXF A;  4I7H A;  3RPQ A;  3GX4 X;  2M87 A;  4XSZ F;  3HSR A;  3WTZ A;  4A12 A;  2GXB A;  4HOB A;  2L54 A;  2R7D A;  1Z91 A;  5IT9 K;  1U2W A;  2K4B A;  3CO6 C;  1DPU A;  1FSE A;  1IN7 A;  4YII A;  2CG4 A;  2RN7 A;  5JVT A;  4CDG A;  3LQR A;  2ZXJ A;  2WTE A;  2DQR A;  4L9N A;  5D6E A;  1KQ0 A;  4ENJ A;  3L2C A;  4ZZL A;  3K1N A;  3RKW A;  1YFH A;  1YLF A;  1ZG3 A;  4JBA A;  1FZP B;  4DQ2 A;  3DEU A;  2W84 A;  5LLQ A;  4EV0 A;  3ZMT A;  3Q5F A;  1XSV A;  5CVU A;  2PJP A;  1ZGJ A;  1KYW A;  3KP6 A;  5D5W B;  3KP2 A;  1OYW A;  3LA2 A;  1HW2 A;  1XB4 A;  2XAS A;  2W25 A;  3NRV A;  4MEX F;  1E2X A;  1KA8 A;  2VBW A;  4HLY A;  2W57 A;  4G6Q A;  1IUY A;  2E7X A;  5CVJ A;  2V1X A;  5FO5 A;  2STW A;  3DP7 A;  2HTS A;  2VBX A;  4N9H A;  3T0Y A;  2M5W A;  2ESH A;  3HYI A;  5H6Q A;  1U5T A;  2IW5 A;  3JW4 A;  4EVI A;  3Q9V A;  2C6Y A;  3WOD F;  1HQC A;  3SQN A;  1S3J A;  3GFM A;  3W6J B;  3KEQ A;  1HW5 A;  3KP7 A;  4MQV A;  5KK1 A;  4RGX A;  5K1Y A;  5BMZ A;  1PUE E;  3QU3 A;  4QWQ A;  3GYH X;  2MC3 A;  2A69 F;  3BP8 A;  5LEK A;  1W7P B;  4NQW A;  1TNS A;  2OA4 A;  3R0J A;  3KP5 A;  3SZP A;  1UFM A;  2FF4 A;  5CYV A;  4EJW A;  1W7P D;  1FYL A;  2HR3 A;  1FC3 A;  3OOP A;  1TBX A;  2NS0 A;  1ZH5 A;  1FSH A;  4U7D A;  1L0O C;  5FFX A;  1R1V A;  4HF2 A;  4ZYG A;  5LHH A;  3U9G A;  4LGW A;  3P7N A;  2A3S A;  3K9T A;  3GWZ A;  2QBY B;  2WWY A;  5L3B A;  5EEH A;  2M8E A;  3TOB A;  4FHT A;  3L00 A;  3DKW A;  2P7V B;  4NB5 A;  3T8T A;  3H3Z A;  1IN4 A;  3KZZ A;  4ENK A;  2LF7 A;  1GVJ A;  4Q47 A;  1TW3 A;  3BJO A;  3ML6 A;  3SFZ A;  2W24 A;  2E7W A;  2QWW A;  1WQ2 A;  3M1E A;  2YX4 A;  1FOK A;  5H6R A;  3GFI A;  5LEJ A;  1P6R A;  1KU3 A;  5D5X B;  3G73 A;  1U78 A;  1H9G A;  1TQP A;  1YW8 A;  3P9I A;  2OZU A;  5LGN A;  2XGX A;  1DDN A;  2Z3Y A;  3ZN1 A;  2FNA A;  4UUV A;  2P6S A;  1MJA A;  2HKO A;  3HIF A;  1S8N A;  3E5U A;  3JTG A;  2BV6 A;  3GF2 A;  1OYY A;  4HZF A;  1UST A;  3I53 A;  1PP7 U;  1XGM A;  1YW7 A;  3LA7 A;  2VON A;  5JHU A;  2L3D A;  1LDK B;  3BPX A;  3D0S A;  2BBY A;  2ZNZ A;  1ZRC A;  1GXP A;  2ACJ A;  4EJU A;  1KU2 A;  2O61 A;  2ESN A;  2K86 A;  1T2K A;  3DXJ F;  3WU1 B;  2Z5U A;  5L3G A;  1G4D A;  2LNB A;  2OA9 A;  2ETH A;  1SD6 A;  3P9K A;  2WC2 A;  4HQM A;  4GGG A;  4OMZ A;  3I71 A;  1B9M A;  2CGP A;  4HV5 A;  1Z1D A;  4KUM A;  2CYY A;  3MFK A;  4UV9 A;  4A0X A;  2MLG A;  3HSF A;  2O6G E;  2JT1 A;  3RI4 A;  4IJA A;  1BIA A;  2Y0M A;  1V3F A;  4XBF A;  1GXQ A;  4P55 A;  1UHM A;  1SMY F;  1XMK A;  3MQ0 A;  1U3E M;  3TKY A;  3ZMU A;  3N4M A;  5E1X A;  3QP6 A;  1K6O A;  2L02 A;  4G7H F;  4Y13 A;  3K0L A;  5LHG A;  1WI9 A;  4Z2Y A;  2EV0 A;  2DTR A;  5ICC A;  1SMT A;  3EET A;  2ISZ A;  5CLS A;  1C0W A;  4RB3 C;  4RB2 C;  5HDG A;  3EDP A;  4WXD A;  4FX4 A;  5HS8 A;  3V4G A;  1QGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...