4ESJA

Restriction endonuclease dpni in complex with target dna
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
256
structure length
246
Chain Sequence
b'PHMELHFNLELVETYKSNSQKARILTEDWVYRQSYCPNCGNNPLNHFPVADFYCNHCSEEFELKSKKGNFSSTINDGAYATMMKRVQADNNPNFFFLTYTKNFEVNNFLVLPKQFVTPKSIIQRKPLAGWIGCNIDLSQVPSKGRIFLVQDGQVRDPEKVTKEFKQGLFLRKSSLSSRGWTIEILNCIDKIEGSEFTLEDMYRFESDLKNIFVKNNHIKEKIRQQLQILRDKEIIEFKGRGKYRKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type-2 restriction enzyme DpnI
publication title Crystal structure and mechanism of action of the N6-methyladenine-dependent type IIM restriction endonuclease R.DpnI.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase/dna
total genus 76
structure length 246
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.1.21.4: Type II site-specific deoxyribonuclease.
pdb deposition date 2012-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06044 DpnI Dam-replacing family
A PF17726 DpnI_C Dam-replacing HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4esjA02
3.40.210.30 Alpha Beta 3-Layer(aba) Sandwich PvuII Endonuclease; Chain A PvuII Endonuclease; Chain A 4esjA01
2MH2A 3IC7A 3I0TA 2QZ8A 3I5UA 3PQKA 2M5WA 2Z3YA 5ILSA 1IN8A 5L3CA 4OIQF 2HTSA 3P9CA 3HOSA 5AIQA 1J5YA 3SZPA 1S29A 3EETA 2D1HA 2FBKA 3IWFA 3HOTA 1J75A 2ZNYA 4E70A 1G3WA 3FZVA 2JPCA 2HTJA 3HUGA 1IN5A 5ILUA 1XGNA 4KMFA 4G7HF 3ZP5A 1W7PA 3FM3A 1TTYA 3CUQB 4UXNA 3I59B 5E1ZB 2F2EA 1XGMA 2QVOA 1U78A 5CVVA 5DD4A 3RKWA 1R00A 3H3ZA 3J80Z 2HFHA 1J59A 3W6JB 1EH7A 3SQNA 5JVTA 5E1XA 1PDNC 5CJ9A 1K6OA 1B9NA 3R0AA 3C3WA 4Y15A 1KQ8A 2JPBA 4P9FA 1DDNA 4HLXA 4WCGA 4HX7A 4MGRA 4LMYA 1BC7C 1BI3A 2FRHA 3L09A 3JAMK 3LSTA 2PEXA 2A61A 1QPMA 2F5FA 4GCVA 4M71A 5HVQC 3TKYA 3T8TA 5DD8A 2YX4A 4XBFA 4ESJA 3T5XA 2VONA 1FBQA 2O3FA 1W7PB 4A6DA 4Y13A 5FO5A 5E17F 2CW0F 4I02A 4UVBA 3ZMZA 4WF2A 3RPUA 1FYKA 2UZKA 1KU7A 4BXUA 4CDGA 2XASA 2PBIA 3MQ0A 3BPXA 4AIKA 3TOAA 1OPCA 3R61A 2GXBA 2HDCA 2X0LA 5DCFA 1IRGA 3FX3A 3ZMDA 4N9HA 1R1UA 4LB5A 2YX7A 5ED4A 4JBAA 4A5NA 1RZ4A 4HQEA 2DLLA 3RI4A 2D45A 2J5OA 1X3UA 5FLXK 2DU9A 1KQ0A 3BJOA 4CYDA 4GYGA 3COAC 3IHUA 2HYGD 3FF5A 4ESFA 1IXRC 2F5EA 4HLYA 2XV4S 4JK1X 2EFNA 4A12A 3JTHA 1IXCA 2A6HF 4PCQA 1ODDA 4RAYA 3EUHA 1RUNA 4EVIA 4M73A 1ZLJA 3WE2A 5HDKA 2DQRA 1DPUA 2Q0OA 5FFZA 2NYXA 3M8FA 4R79A 1HSJA 3CDHA 4RB1A 2VOPA 4FT8A 2IP2A 4Q4ZF 2ZBKA 3CO7C 6PAXA 1FYMA 5ICGA 1PUEE 4NHJA 3HTUA 2EA2A 2R7FA 2K7LA 1S7AA 1D5VA 1SMTA 1YQAA 2OZUA 4HX8A 2M45A 4EM2A 1LEAA 1AWCA 5JR3A 2Z33A 4IHTA 4HQMA 1GXPA 1T6SA 2DTRA 4ESBA 1O57A 2CO5A 4U7DA 4L0ZB 2M87A 1W5TA 4LK0F 2L4MA 2VT3A 4R8HA 2G7UA 1SFUA 3ISPA 5BOXA 1LDKB 3M1EA 3V8JA 2H09A 2UXNA 3EDPA 3FXUA 3V8KA 3MEXA 2LSOA 4HAMA 2A07F 2O61A 3E6BA 5DDGA 1KYZA 2DAOA 2CG4A 4KIGA 1XCBA 2GZWA 3PQJA 3BROA 2H6BA 1FBSA 1H0MA 4P96A 2ETHA 2P4WA 2Z99A 4EGYA 2FMYA 2VC0A 3KLNA 4MQVA 1WKMA 1R23A 3HHHA 4U0YA 2KJBA 2WV0A 3K69A 4RGRA 3WTTC 1JE8A 4CZZA 2EK5A 4S04A 4ASNA 5LRRA 1A04A 4HDUA 1B9MA 1S7OA 1MGTA 4IRHA 2P5VA 1KU9A 5D5UB 4G6QA 1JHFA 2LNBA 4BH9A 3WTUC 4H0EA 4Q5SF 3NEUA 1P4WA 2HOEA 4ZZLA 3FMRA 1BI0A 2VE8A 4KN4X 4OMZA 2IVMA 1K78A 3GFLA 3CUQC 3GO5A 4YFKF 1HKSA 4U88A 4MEXF 4ZZDA 4YFXF 2QQ9A 2V79A 2ZCWA 1MKMA 5CVJA 2IA0A 1JHHA 2KIUA 3GEZA 2O03A 1BI2A 4FHTA 3O2PE 1TQMA 4IRGA 1EH6A 1O3QA 3WE3A 5KVRA 1BBYA 4BHCA 1IXSB 3C1DA 3F22A 3MCZA 1MZBA 3GF2A 1IUYA 4IF4A 3ECHA 3H92A 1EV7A 2NAZA 2UWMA 1ZLKA 4G8XA 1DUXC 4B8XA 2QBYA 2K4BA 4A6EA 1J2XA 2V9VA 1Z1DA 2K4JA 3ZQ7A 3F72A 2E7WA 1IN7A 3K1NA 2C6YA 3E3VA 1YYVA 5K1YA 4L5IA 4GO1A 5KK1A 3HSRA 3L9FA 2XAGA 2P7CB 1K78B 4ENKA 3CO6C 1ZAOA 3ZMUA 4WWCA 2GA2A 2Z9OA 1T38A 3FHZA 3RIRA 2O0YA 3M9AA 3V8LA 2FE3A 3DV8A 4XSZF 3E5QA 1FP1D 1W5SA 3KP4A 1HW1A 2HZTA 1OYYA 3HIFA 1O3TA 2FMLA 3HSEA 1H9GA 2IW5A 4AWXB 2RV8A 4ZYEA 1U6GA 4L9VA 2WTEA 2FXAA 5JFRA 3F6VA 3U2RA 3WU1B 1MJBA 2EFQA 2QBYB 3VOEA 2VOOA 4LGWA 1ZRFA 1FPQA 3E6CC 2LDUA 1D8JA 1XD7A 4U7BA 5E20A 3WTSC 1S8NA 1OKRA 2KJCA 2PG4A 2L54A 3CTAA 3T8RA 1YO5C 3GVAA 2E1CA 1XDSA 4FX0A 5LEJA 2DPUA 2DQLA 1CGPA 2HGCA 5HLGA 5LEKA 1FC3A 3L7WA 3ZMTA 1LJ9A 2HYFA 1U8RA 1Z05A 3C7JA 2NNYA 4ZYHA 1ZHFA 5IT3A 3IKVA 1LQ1A 1GXQA 1C0WA 5DYMA 5L3EA 3RPQA 3GFIA 1I1SA 5D6EA 3IRRA 3R60A 2ZNZA 1BC8C 4BYYA 1R22A 3RJPA 4KA4A 2AS5F 1H9TA 4YG2F 3O3KA 3BOQA 3WTYC 1I5ZA 3WGIA 2L01A 2P5LC 4AD9A 5IT9Z 5LLQA 3F6OA 4M9SA 1G3TA 2K02A 3EYIA 4HA8A 3TQNA 4P55A 3WTVC 1MJ9A 3I4PA 1FSEA 3ABTA 4KNYA 3H3UA 1BI1A 3LWFA 1MDMA 4DQ2A 2RDPA 1XSXA 5BPIA 2F5DA 5A2QK 3ABUA 4ENNA 2EA4A 2M8EA 3V7CA 3I53A 4EJOA 2H27A 2ZKZA 4U0VA 3IKTA 2K27A 1HKQA 1T2KA 3J81K 5K5OA 3WTXC 3I71A 3HYIA 1BJAA 3NQOA 1P4XA 5EEGA 2PN6A 5K5RA 1F5TA 2ZO4A 4L9TA 2V1UA 3P9IA 5J8CA 2STWA 3DPTA 1IRFA 5DUIA 1LDJA 3KZYA 2L02A 1B4AA 1YS6A 4L5JA 3P9KA 5AIPA 5FB2A 3D5LA 4LLNA 2EJRA 4KN7X 3WGGA 3OOPA 4DNCA 5D8KB 3FXQA 1ONVA 4I2OA 2MA3A 3DP7A 4O5VA 2PI0A 4LG0A 1MDMB 4WXCA 4P9UA 2FA5A 2HEOA 2QLZA 1YIOA 2MLKA 5DV5A 1VTNC 4G6DA 4BHBA 3LA2A 3GWZA 3KFWX 4IJAA 2STTA 4XLPF 3ULQB 4A0YA 2OQGA 2OU2A 1XMKA 4L18B 2A3SA 4Z2YA 1XDUA 4G7OF 2DT5A 3K2ZA 3DEUA 1USSA 2W84A 1I27A 2EV0A 2DK8A 1U3EM 2YPRA 5HS8A 2KRFA 3RYRA 4AVPA 3WTZA 1FYLA 1R5GA 4LJZF 3R6SA 1E17A 1ZREA 4G9YA 2VBYA 3KE2A 3LQQA 1Z9CA 3OV8A 3WTWC 5D8LB 3KEQA 1ZRDA 1OMIA 3QU6A 5TJJA 1QNTA 2XIGA 1HSTA 1XCVA 2KIMA 3V7RA 1V4RA 2A69F 2VBZA 3J80K 3SHFA 1W4MA 4LG0B 2ESHA 5FFXA 2QQBA 1DP7P 3GUDA 2TDXA 2VODA 1IN4A 2M1BA 4EQQA 1BN5A 4YIIA 2YSRA 4TV7A 5CLSA 3K1MA 1QZZA 3VFZA 4YIFA 4IHSA 4UHTA 1FLIA 3DF8A 1ZYRF 3GFJA 4OIOF 5CVUA 3B02A 4M74A 4BNCA 3R4KA 3IWZA 1U5TA 3F3XA 4MTEA 2V6CA 2DW4A 3F8MA 2EFWA 5EEHA 2RVCA 2D2WA 1RIOH 3O6BB 4LK1F 1RI7A 4HYEA 2PJPA 2XUBA 3DFGA 4M72A 4WK8F 5JHUA 1HW2A 2GIVA 4S05A 5F64A 1XGOA 4PDKA 3SXYA 1TQPA 3G73A 3JTGA 4I7HA 5BS6A 1O3SA 3BZ6A 4A2UA 4MQ9F 2XVCA 1TW3A 1ZG5A 2FF4A 3HSFA 1FNNA 1F1ZA 2JSCA 3IRQA 2RNJA 4HDVA 3HRSA 4PGGA 1Q1HA 2G9WA 3KZZA 3S2WA 4HZFA 4JQFA 1DPRA 3TO9A 4CICA 1U5TB 4OINF 1YW8A 3MWMA 5FD6A 4CXFA 4ON0A 3REOA 3U9GA 5HS7A 2FSWA 5D5VB 1YFHA 4WXDA 2XRNA 3MAJA 4RB0A 1KA8A 1TNTA 1ZARA 3D0SA 2P7VB 4KDPA 2OBPA 3HHGA 2UXXA 1IF1A 4UV9A 2CYYA 4L9NA 3ELKA 1KYWA 3TOBA 4I0BA 1UCRA 5H6RA 2XAHA 4XSXF 4EJUA 3HRMA 4PGHA 2LKPA 2FQ3A 1FP2A 3SZTA 3KCCA 3TGNA 3ZN0A 4AIJA 1FY7A 2R7DA 3F21A 3BWGA 3Q9SA 4RB2C 1ULYA 2WC2A 1REPC 2ZJ2A 1G3YA 5BPDA 2ACJA 1IZ1A 2W85A 1YTYA 2FNAA 1J7KA 3I58A 3LA7A 1QBJA 2CGPA 3E97A 3DPLC 1QZYA 4EJTA 2FEZA 2ISYA 4L0YB 4A5MA 4P5OA 3JSOA 1P92A 4GYIA 5CYVA 1XN7A 1Z7UA 3QPHA 4LLGF 3WG9A 1LVAA 4M9XA 4D0PA 2L4AA 1UHMA 3WGHA 1HXDA 2YU3A 3F8CA 2CFXA 1ZG1A 2CSOA 3QOPA 1U2WA 2DI3A 4EMSA 3RTRA 2XROA 2FNPA 2HS5A 4RGSA 3GX4X 2Y75A 3JW4A 1KGSA 5J6XA 2JRTA 5K5QA 5CVRA 2MD5A 2XAQA 3M7GA 1XGSA 2FU4A 2XKPA 3JAMZ 4U0WA 1NHAA 1BOAA 5HS9A 1T39A 2DO7A 2QQAA 5JI6A 3CJNA 1SAXA 4Y17A 2OD5A 2COMA 3GW2A 3RKYA 4AIHA 2PQ8A 3WODF 5F1RA 3KEOA 3K9TA 3B73A 5FGMA 5E8IA 1FT9A 4YFNF 5L3GA 4G7ZF 2K86A 4R1HA 2BBYA 2P8TA 4Q48A 2JTVA 3FMQA 4KICA 3I59A 2YR2A 1LDDA 1FOKA 2HQNA 1XSDA 4A0XA 1EH8A 2VN2A 3F8BA 3N4MA 1CF7A 1AOYA 1UHWA 3R0JA 5ICEA 4HBLA 4I98B 3ZPLA 3PFIA 3KP3A 2DBBA 2MC3A 2VBWA 5FLXZ 2JT1A 1L0OC 1B59A 4EJWA 3NRVA 2AXLA 3ZMSA 5L3BA 1YLFA 2LF8A 1TBXA 3K1PA 5LBQA 4KIBA 4B09A 2MLGA 1WWXA 3DQVC 2W57A 3ZN1A 1BIBA 3BDDA 5ICCA 2O6GE 4ZYDA 4QLCU 1P4AA 3U1DA 3LAJA 2GAUA 2ESNA 4HF1A 1K79A 2ZMEA 4ZYGA 2CWEA 2ZFWA 3GLXA 1Z6RA 2NS0A 1Y0UA 4I0AA 1W7PD 3MZHA 1G6NA 4EM1A 1E2XA 2MH9A 1QQIA 1QO0D 1PP8F 3E6DA 5E18F 1CF7B 3BP8A 3BJAA 5D4SA 5HLHA 2HWVA 3CLOA 5D4RA 3RDIA 1R1TA 2OQRA 4ENMA 2EV5A 3LFKA 2IRFG 1G3SA 3RYPA 1ON1A 2BV6A 5F6FA 1D8KA 2JZYA 4ZH4F 1UB9A 2PLYA 4HF2A 4WX9A 5J8FA 4GXOA 1O7LA 1ZGAA 2OZ6A 2GQQA 3E5XA 1S3JA 4Q47A 2OAZA 1MJAA 2M30A 1PP7U 2OA4A 2Q8KA 4IXAA 1O7FA 1T0FA 4RGXA 4GGGA 3FM5A 3ZMVA 2FBHA 4N9IA 1FZPB 2ZMEB 3JSPA 3TO7A 1YS7A 3SFZA 4NQWA 3BPVA 4OOIA 4RAZA 5DEQA 4RB3C 1L3LA 2ADUA 1YW9A 3GYHX 3AAFA 3N97A 3V7SA 4HV5A 4K2EA 2GWRA 5E8GA 4CO8A 2V1DA 1P2FA 3LQRA 1U5TC 2V1XA 4MNUA 4EGZA 2KIFA 3FMSA 3KP7A 3HRUA 4ENJA 1O3RA 2H6CA 5LHIA 5TRDA 4M6XA 1ON2A 1OR7A 1R1VA 2QYOA 2PMUA 3BJ6A 2O8XA 1LB2A 2QM3A 4HV6A 2XAJA 2PFBA 2ISZA 5ERIA 3EYYA 2VT2A 3RKXA 2NNNA 1STZA 4LD5A 1LEBA 2LF7A 2RC4A 1ZG3A 4M6YA 1HKTA 1XSVA 4WXHA 3QAHA 4XRFA 1TW2A 1R58A 1SFXA 2P6TA 4O3MA 2RGVA 3EQLF 2BE5F 2F5CA 4OIPF 3I54A 3DXJF 4UUVA 5IT9K 2HQRA 1JGSA 3ERED 3HRTA 3GZ5A 3VEPA 2FBIA 2HKXA 3LAPA 2W24A 3QP6A 1XB4A 2RKHA 1B6AA 1ZH5A 5L3FA 2Y48A 2W25A 1HQCA 4OMYA 2BGCA 1WRJA 1FWZA 1FSHA 3ROUA 3E6MA 3TO6A 1ZGJA 4IPAA 2DK5A 2MBFA 2QENA 5LGUA 1FX7A 2EV6A 1F4KA 4NB5A 3G3ZA 5FD5A 3E5UA 5HLIA 4FX4A 4I01A 3F23A 1KU3A 2XHKA 2RQPA 1IAWA 1SFEA 2VXZA 2EFPA 2VC1A 2ZXJA 1G4DA 2HKOA 4KIFA 2FOKA 2QUFA 4PZJA 1QGPA 4A0ZA 3KETA 5D6FA 1ZRCA 3T1BA 4F7ZA 2X4HA 4I09A 4HX4A 3ECOA 5ICFA 3GXOA 2IPQX 3MZYA 1RUOA 4RGUA 1GVJA 3HTSB 1SD7A 3C18A 2HR3A 3F8NA 2P5KA 2XAFA 4L9JA 1KQ9A 4UVCA 5CVIA 1UFMA 4CHUA 2IT0A 4RS8A 1KU2A 3VODA 3VB2A 5DUKA 4IRIA 1WQ2A 2R3SA 5ILVA 5LRSA 2QWWA 3LA3A 2GA1A 1R5HA 1HBXG 5H20A 1I1GA 3V4GA 4LFUA 3I64A 4KFCA 2Z5UA 2DFIA 2XKOA 2WWYA 1WI9A 1I6XA 3TDZC 3GFMA 1SD5A 3QU3A 2PMHA 3L2CA 3T0YA 4MEYF 5DCMA 2E7XA 2P6SA 2EWNA 4OU0A 3ML6A 2A68F 5HOOA 3BY6A 1SMYF 1Z6TA 4CGZA 1MD0A 3Q5FA 3K0LA 1ZN2A 4EV0A 1TQIA 1Z91A 4MTDA 2G7HA 1J0RA 1OYIA 4O6JA 1TNSA 2H94A 2KKOA 1B1BA 1S6LA 1D3YA 3KP2A 5BMZA 2XGXA 5D5XB 1V3FA 4UV8A 3CUOA 4LLLA 4ETSA 2L3DA 3F8FA 4OIRF 3TDUC 3QPTA 1T98A 1RNLA 2VE9A 2A5YB 2VBXA 3IL2A 4MHGA 4EJVA 1TLHB 3FWEA 4KT5C 3QRFF 5E1WA 2CQKA 4UVAA 5H6QA 3MFKA 5D5WB 2BYVE 5LGTA 4HOBA 4BQAA 5DCMB 1IW7F 3Q9VA 3W6KB 3WU0A 2EB7A 3DKWA 4KMUX 3FXRA 3P7NA 4KUMA 1YW7A 4LB6B 3KP5A 1YG2A 2A6EF 4G94A 2IA1A 5A2QZ 5AONA 4HW0A 1R7JA 2ELHA 1BM9A 3J7AO 2DPDA 1P6RA 1BIAA 1XMAA 2Y0MA 5HDNA 4EM0B 3J81Z 1SD6A 4KYWA 1LNWA 5HDGA 1IN6A 1SD4A 3QP5A 5LHGA 1JXSA 1USTA 2RN7A 5LHHA 2J5PA 1R36A 4BHPA 5BQTA 2NRAC 2D1VA 2IJLA 1WSUA 1OYWA 3KLOA 4XLNF 2BEOA 2GXGA 3CUQA 4HF0A 4QWQA 3M8EA 1GHCA 3L00A 1K7AA 4M9ZA 2IA2A 2EFOA 2B0LA 1F9NA 5L3DA 4IVNA 2Q2EA 2E1NA 4BAYA 4UNOA 3GZ6A 4N0BA 5LGNA 1HW5A 3KP6A 1FBUA 1J9IA
chains in the Genus database with same CATH superfamily
1T0FC 2CUFA 1JKOC 2MH2A 1QZEA 5EJCA 2VIXA 2DA6A 3IC7A 3I0TA 2QZ8A 3I5UA 3PQKA 3MKZA 2M5WA 4II2A 1X1PA 2Z3YA 5ILSA 1IN8A 3ABMH 4OAZA 5L3CA 2ODHA 4OIQF 4BQQA 2HTSA 3P9CA 4BXFA 4M3GA 3HOSA 1JKRC 5AIQA 1J5YA 3SZPA 3X2QH 2G0EA 1S29A 2LY2A 3EETA 5EG0A 4PK4A 3S15J 2D1HA 2FBKA 3S8PA 3IWFA 1YRNA 2GOMA 1OCCH 3HOTA 4N4NB 3CMMA 1J75A 2BY2A 3L2WA 2R7VA 2DOFA 5GADJ 2ZNYA 3K7AJ 4E70A 1G3WA 3FZVA 2HU9A 3DBHB 2JPCA 3J7AY 3IH4A 2HTJA 2R7WA 3HUGA 4CYCA 3CCMI 2LBFA 1YX5A 1IN5A 5ILUA 5HNHA 1OJLA 1XGNA 4CA0A 4KMFA 5KNLA 4G7HF 5J4YA 3ZP5A 3G1LA 1W7PA 3FM3A 1OR7C 1TTYA 3CUQB 3Q0VA 2X6XA 4UXNA 3I59B 1BR4A 2DOEA 3K4MA 4LIUA 5E1ZB 2WAEA 2F2EA 1M1EB 3KYDB 2CFOA 5F0FA 1XGMA 1XC5A 1BW6A 2QVOA 1U78A 5CVVA 1D1AA 5DD4A 3RKWA 4HG2A 1R00A 3H3ZA 3J80Z 2HFHA 3D5RC 3W6JB 1J59A 1DGWY 1EH7A 2Q2EB 3RZOJ 4XLEA 1Z0XA 3SQNA 5JVTA 2IGOA 2WAQA 3NAUA 5E1XA 2ID3A 5GTIC 2BZTA 2IS6A 1X4PA 4XKWA 1MBJA 1UELB 1PDNC 5CJ9A 1K6OA 3HZJA 1B9NA 2LREA 2NOGA 3R0AA 3C3WA 2KDZA 4Y15A 1KQ8A 2JPBA 4P9FA 4H4KC 2V9PA 1JUMA 1DDNA 4HLXA 1U8BA 2E1MB 4WCGA 4QTRA 4HX7A 4MGRA 2DA7A 4IHYA 4LMYA 1BC7C 3K4LA 1BI3A 2FRHA 2KRCA 2JMWA 3L09A 5EG0B 3JAMK 3LSTA 2PEXA 2A61A 2L9SA 3CF5F 3PFYA 5IYDJ 2ZXHA 1QPMA 1YRNB 2F5FA 4RAFA 4P1WA 4GCVA 2RAEA 2HXOA 2V4JC 4M71A 5HVQC 3TKYA 4E7IA 3T8TA 5DD8A 3MKWB 2YX4A 4XBFA 2Y0SN 3HUGB 4CYCB 3DEEA 2LBFB 1MMGA 1EYUA 4ESJA 3T5XA 1FMWA 2CUEA 1X1AA 2VONA 1IV8A 3LL7A 3CCYA 3OIQA 1FBQA 2O3FA 3VWBA 2DFEA 4YRVA 1W7PB 4IHVA 4A6DA 1MBKA 2ZSHB 4Y13A 5FO5A 5E17F 2CW0F 4I02A 4UVBA 3ZMZA 1MNDA 4WF2A 3RPUA 1EF4A 3ASOH 4CCMA 3RPUD 1FYKA 4AU7A 2UZKA 1KU7A 2MG4A 1NK2P 3TW6A 3SJMA 2BY3A 4BXUA 4CDGA 2XASA 3E7LA 1H8AC 3OS1A 2PBIA 3MQ0A 5M3MJ 3PNYA 3BPXA 4AIKA 4HNTA 2R7XA 2IS2A 1WH7A 2CQNA 2WAFA 1ZR2A 3W6VA 3TOAA 3BZCA 1JGGA 1IRZA 1I3AA 3O8HA 1A6QA 1OPCA 3BC8A 3R61A 2GXBA 2LTPA 2X0LA 2HDCA 2WA0A 5DCFA 2L7KA 1IRGA 2H8RA 3FX3A 3ZMDA 4N9HA 3ZGKA 1R1UA 5GPAA 4LB5A 4ZC3A 2YX7A 5ED4A 4JBAA 3HPGA 1QRYA 4A5NA 2K5CA 5F04A 2A05A 2H1KA 3EPZA 1WI3A 1RZ4A 2ELJA 4HQEA 1QPIA 2DLLA 1BW5A 2V6EA 3RI4A 5B5EC 2D45A 5CKTA 2J5OA 1X3WB 1X3UA 2R7SA 2EQRA 3GTJJ 2IS4A 5FLXK 2VLAA 2DU9A 2CV1A 3TEDA 1KQ0A 2OAAA 4XKBA 3OYHA 3BJOA 4CYDA 2PVIA 4GYGA 3COAC 3IHUA 2HYGD 3FF5A 4ESFA 1IXRC 2F5EA 1Z3YA 4HLYA 3K70C 1LPQA 1YX3A 2XV4S 4JK1X 3BQYA 1F0OA 3PUFA 1A35A 4MFDA 1JUPA 3JRDA 3WHBA 2EFNA 4A12A 3JTHA 1F43A 1IXCA 1CQTA 1RKTA 2A6HF 1U9OA 4PCQA 1ODDA 1WVRA 4RAYA 4GDFA 3EUHA 1RUNA 5J1YA 4EVIA 3CCRI 2MFZA 4M73A 2KFDA 3RQIA 1ZLJA 1FOWA 3WE2A 2EIMH 5FKMA 3QPSA 2HOSA 2VKVA 2DQRA 5HDKA 2Q0OA 4D1QA 4BXXJ 3H9QA 2CUZA 2VPRA 5FFZA 1DPUA 2NYXA 3M8FA 1H89C 4R79A 1HSJA 3CDHA 2RREA 3PNTA 4RB1A 5IOYA 2VPLA 2VOPA 2KHMA 2HQAA 3IH3A 4FT8A 4HEA2 2IP2A 4Q4ZF 2ZBKA 3CO7C 6PAXA 1FTTA 3OOUA 3PSIA 3UKGA 1FYMA 1ETOA 5ICGA 3GTKJ 2AQFA 2HDDA 1PUEE 4NHJA 3LSKA 3HTUA 3KYLA 2EA2A 2R7FA 1MBEA 3FXKA 4BDYA 2E35A 3H35A 2K7LA 1H56A 1S7AA 4S0HB 1BA5A 1D5VA 2OF7A 1XG1A 1GLNA 1SMTA 1YQAA 4IQ4A 4B44A 2OZUA 1N77A 2EILH 3DKXA 4HX8A 2M45A 2XSDC 1VQOI 2JVHA 2L9NA 2AQEA 4FQGA 4EM2A 1LEAA 1AWCA 5JR3A 2Z33A 4IHTA 4HQMA 1Z21A 2BOLA 2QF7A 3PM1A 1ETKA 3JRCA 1GXPA 1T6SA 2DTRA 4ESBA 1O57A 1UJ8A 4E4HA 4B43A 3DLAA 1NI0A 2CO5A 3CQZJ 4AYBN 4U7DA 4L0ZB 3DLLF 2M87A 2R7OA 1W5TA 4LOCA 5GAGJ 4LK0F 2L4MA 2VT3A 3S2HJ 4R8HA 1IRXA 2G7UA 1SFUA 3ISPA 2WBMA 5BOXA 1LDKB 3M1EA 3PSFA 3V8JA 2H09A 1AA7A 1R4MB 2UXNA 3EDPA 2KISA 2KLOA 3FXUA 5M3FJ 1BOBA 3MEXA 3V8KA 2LSOA 2CQQA 4CSWA 1V5GA 3P5JA 2E2JJ 4HAMA 2A07F 2O61A 3E6BA 5DDGA 1KYZA 5K7FA 4JYKA 3F9KA 2W82A 2DAOA 2CG4A 4KIGA 1KZHA 3BR0A 3JR9A 1XCBA 2GZWA 3PQJA 3S1NJ 3BROA 2H6BA 1VF9A 1FBSA 3OIOA 1H0MA 1SAUA 4P96A 5M5YJ 2EPFA 3AG3H 2ETHA 2P4WA 2Z99A 3DU6A 3UR3C 4UY8I 4UB6C 3J7YJ 4EGYA 2FMYA 1X3ZB 2VC0A 3KLNA 2K40A 4MQVA 1WKMA 2E60A 3ZRGA 1R23A 2DDBA 2LC2A 3HHHA 1ZK8A 3JRHA 3LSIA 2KJBA 4U0YA 4XR6A 1FEXA 2WV0A 3K69A 4IHWA 2WAQN 4RGRA 3WTTC 1JE8A 1IDYA 1ITYA 4FISA 4ABZA 2F4IA 1X4OA 4CZZA 2EK5A 3ERMA 3K10A 4S04A 4XL9A 3A2KA 4ASNA 1PJRA 1A04A 5LRRA 4HDUA 2LK2A 1B9MA 2XF7A 1LFBA 4XLFA 3L1PA 1W36D 3OYEA 2VQGA 1S7OA 1MGTA 4IRHA 2P5VA 1MMSA 1KU9A 5D5UB 4G6QA 5J47A 1QHGA 1UHSA 3ZQQA 1JHFA 3S2DJ 2LNBA 4BH9A 4I99C 3BR5A 4B48A 1WCMJ 1WJBA 3QWLA 3VYRB 3WTUC 4H0EA 4Q5SF 3NEUA 1ZR4A 4A3IJ 5JHFA 3OYLA 2CU7A 2E36A 3J7ZI 5CQEA 1XS9A 1Y1WJ 2JUCA 1P4WA 2HOEA 1TZLA 2OTJI 3RQ4A 4ZZLA 2EZKA 3FMRA 3S3NA 3TL4X 1BI0A 2VE8A 4IKFA 4KN4X 2ZB9A 1A5JA 4OMZA 3PVIA 2IVMA 1K78A 3GFLA 2R7QA 2QSHX 4ITVA 1E3OC 3CUQC 3GO5A 1HKSA 4U88A 4YFKF 3OY9A 4ZZDA 4YFXF 2MABA 4MEXF 5FLVA 2QQ9A 2V79A 1NK3P 2ZCWA 3RZDJ 1MKMA 5CVJA 3OL3A 2IA0A 1F36A 3L2RA 1JHHA 2KIUA 2L7FP 4PSWA 3ZQIA 3GEZA 2M7AA 2O03A 1BI2A 4Y4RA 4FHTA 3O2PE 1TQMA 2LFBA 4BQOA 1AHDP 3A03A 4IRGA 1EH6A 1O3QA 3WE3A 1FMVA 5HLTA 3CCQI 5KVRA 1BBYA 3OYFA 4BHCA 3AG4H 1IXSB 1T33A 1EKEA 4DGWB 3C1DA 1RC9A 3F22A 3MCZA 1MZBA 3GF2A 1SFOJ 4IF4A 2YU9J 1IUYA 3ZXSA 3ECHA 3H92A 1EV7A 1BJZA 2NAZA 3M4OJ 2UWMA 4XQFA 2A6TA 2E1MC 3BR3A 4G8XA 1ZLKA 4DZJA 1DUXC 4B8XA 1WHUA 2XPWA 1AKHA 2QBYA 4HSTA 2K4BA 4A6EA 1J2XA 3CZ6A 2XSJC 3CP8A 2E2HJ 2V9VA 1Z1DA 2K4JA 3ZQ7A 3FXMA 4BY7J 3F72A 2E7WA 1VFCA 3AL0B 1IN7A 3K1NA 3KX2A 2C6YA 3CC7I 3S17J 3E3VA 1K0ZA 1YYVA 4A3JJ 5K1YA 4ZDPA 4L5IA 4E7KA 4GO1A 5KK1A 3HSRA 1K4SA 1UAAA 2OJED 3OWTA 3L9FA 2XAGA 2P7CB 1K78B 2W00A 2L9RA 4ENKA 3ONQA 3CO6C 2E1OA 1ZAOA 3K4NA 1HOMA 3ZMUA 3GTQJ 4WWCA 2GA2A 2V1NA 3A01A 2Z9OA 2JN6A 4BJTA 2K3PA 1T38A 4DBQA 3FHZA 4ZYAA 3RIRA 1R71A 1VQ5I 1OCOH 4NNJA 1YITI 2O0YA 3HPHA 3M9AA 1DP3A 1X1CA 3V8LA 2CH0A 2FE3A 5EZGA 3TW7A 1WJAA 3DV8A 2X51A 4XSZF 3S1RJ 4BEHB 1FIAA 4KISA 3E5QA 1FP1D 1W5SA 5HNFA 1IV6A 4QSHA 1TL8A 4PJLA 3KP4A 3CMYA 3M1CA 4XORA 1HW1A 2HZTA 3SYTA 1OYYA 3HIFA 1B8IA 1O3TA 2JA5J 2FMLA 3HSEA 4A3GJ 1H9GA 1YOVB 2IW5A 4AWXB 2RV8A 4ZYEA 1U6GA 4L9VA 1UMQA 4A3BJ 2WTEA 1V54H 2FXAA 4BKXA 5JFRA 2V9KA 4IX7A 3F6VA 2QEXI 3U2RA 3WU1B 4NUBA 3AKZA 1MJBA 2EFQA 2QBYB 1UZCA 3VOEA 2EINH 3ABLH 4IZZA 4ZTJA 4LGWA 4GFBA 1ZRFA 2VOOA 1FPQA 3E6CC 5FKNA 2L0KA 2LDUA 5IY5H 1D8JA 1XD7A 1JJ6C 4U7BA 5E20A 4FTHA 3WTSC 1S8NA 1HF0A 3HM5A 1OKRA 2KJCA 4B47A 4Y52J 4DIQA 2PG4A 2L54A 3CTAA 3T8RA 1YO5C 3M8JA 3GVAA 1IC8A 3SDBA 2LKSA 2E1CA 1I39A 1B72A 3RSNA 1POGA 1E3HA 4IEJA 1XDSA 4FX0A 4PSXA 5LEJA 2DPUA 2DQLA 3G71I 1CGPA 2HGCA 3IUOA 3DBRB 5HLGA 5LEKA 4I6ZA 2FUG2 4RBOA 4DJAA 1FC3A 1Y8RB 2VI6A 3L7WA 3ZMTA 1LJ9A 2HYFA 1W0UA 1U8RA 1Z05A 1P7IA 2DDAA 2L9VA 1U0JA 3A01B 2ODIA 3GLLA 3C7JA 2DTZA 3DTKA 2NNYA 3FDYA 1ZHFA 4ZYHA 3FISA 4ZDOA 5IT3A 2NVYJ 2XRLA 3IKVA 1LQ1A 1GXQA 2PMZA 1C0WA 5DYMA 5JLWA 5L3EA 4XLAA 3RPQA 3LSHA 3G4SI 3GFIA 1I1SA 5D6EA 1A36A 1ETYA 4F52A 1FOXA 3CDIA 2XPUA 2K85A 3IRRA 4AM3A 1Y1VJ 3R60A 2ZNZA 5GP9A 1B8IB 1BC8C 2HOAA 4BYYA 3C2HA 1GVDA 4BU2A 1R22A 2VQLA 3RJPA 4KA4A 2AS5F 4JX4A 2GXAA 1H9TA 3RKQA 4YG2F 4AVZA 3SFIA 3O3KA 3M07A 2JSPA 3BOQA 3WTYC 1I5ZA 2XF6A 3WGIA 4A3DJ 3DEWA 4B4CA 3ZR8X 2L01A 2HDWA 3HOXJ 4X6AJ 2P5LC 4AD9A 5IT9Z 5LLQA 3GBGA 3F6OA 4M9SA 1G3TA 4CCNA 3W2VA 1SANA 4ZJZA 2K02A 2Y31A 3EYIA 4W97A 4NC8A 4DYQA 2VJ4A 4HA8A 4P55A 1Z77A 3IAM2 3TQNA 4DZPA 5B66C 2ZJQF 3WTVC 1V55H 1MJ9A 1HC8A 1MH4A 2JK3A 2R5YA 2I10A 3I4PA 4N4OB 1FSEA 3Q3SA 3LNQA 3JRBA 4UUSA 3ABTA 4KNYA 5IP9J 4PFOA 3SEZA 3OYMA 2DJNA 2W1OA 3H3UA 3OYBA 1BI1A 3LWFA 1MDMA 4DQ2A 3GMEA 2RDPA 1XSXA 4MIMA 5BPIA 2VASA 2O8KA 2F5DA 1K83J 4D5FA 5A2QK 3ABUA 2B7EA 4ENNA 3QYEA 2LRDA 1XPXA 2EA4A 4BS9A 2M8EA 2VUMJ 1RR8C 3HOYJ 3EUHC 3DBLB 5E79C 1PVEA 3V7CA 2ID6A 4RAGA 1D0XA 4YEJA 1E0EA 3I53A 3LSJA 4RLFA 4EJOA 3TBIA 2ZKZA 2H27A 4U0VA 4XIDA 3IKTA 2K27A 1HKQA 1XTAA 3BR6A 3BTCA 3J81K 1T2KA 1FTZA 4ZTFA 5K5OA 3H5RA 3WTXC 3VYSB 3I71A 3HYIA 1BJAA 1TWFJ 3NQOA 4MO7A 1P4XA 2BW3A 2P81A 5EEGA 2PN6A 5K5RA 1T8IA 2VJ5A 1F5TA 5K7ZA 3BZKA 1I50J 2ZO4A 3WU2C 4L9TA 2AXTC 2V1UA 4HNVA 2DMUA 4ZDLA 3P9IA 3SZGA 5LD2C 5J8CA 3BG9A 1JI8A 2L5QA 3DPTA 3OYAA 2STWA 4U87A 5TISC 2R93J 1IRFA 5DUIA 3ZQCA 1LDJA 1YJNI 2DOAA 3KZYA 2E71A 5IPAA 1WZ2A 2L02A 1MIJA 1B4AA 1YS6A 2QGUA 4L5JA 3P9KA 3JRAA 2VJIA 4XN3A 5AIPA 4RA2A 5FB2A 1YJWI 3CDLA 3D5LA 4LLNA 2EJRA 2R5YB 1J09A 3FK7A 4KN7X 4YELA 3WGGA 3OOPA 4DNCA 3OYGA 3GTMJ 2OUMA 5D8KB 4UB8C 4UUSB 3FXQA 5C4JJ 1ONVA 2MW8A 1RESA 4I2OA 1VQLI 2EIKH 2MD0A 2MA3A 2Q10A 3DP7A 1WGXA 4O5VA 2Q1ZB 2PI0A 4LG0A 1MDMB 4WXCA 4C2MJ 4P9UA 2FA5A 5DM6F 2HEOA 2QLZA 1H88C 1YIOA 1IJWC 4BUPA 4NC7A 2KPMA 2MLKA 5DV5A 5GPCA 1VTNC 1S9HA 2KP6A 1TWAJ 4G6DA 4BHBA 3LA2A 4A3FJ 1OCPA 3GWZA 3KFWX 4L5EA 2DXIA 4IJAA 2STTA 1RKWA 4QIWN 3KZIC 1I3QJ 3CCUI 4XLPF 3U1KA 3ULQB 5EEAA 4A0YA 2OQGA 2OU2A 1XMKA 4L18B 3IH2A 2A3SA 4Z2YA 1XDUA 2JUGA 4G7OF 1AU7A 2DT5A 3K2ZA 3DEUA 1MBGA 1USSA 2IEKA 2W84A 1R49A 2HNHA 4FE7A 1I27A 2EV0A 2DK8A 1U3EM 2BW3B 4X0GA 3LOCA 2COBA 1VQ9I 4C2TA 2YPRA 5HS8A 2OCEA 2KRFA 3RYRA 2R4GA 4AVPA 3WTZA 1FYLA 1R5GA 4LJZF 2MGQA 4XK4A 2KT0A 3IAS2 2V7FA 3QODA 3R6SA 1JT0A 2NVTJ 1ETQA 3A0BC 4M3DA 3D1NI 5EGOA 1E17A 5KAIC 2IS1A 1ZREA 2EH3A 2LP0A 2WB1A 1R9TJ 2YS9A 4G9YA 2F4MB 2VBYA 3KE2A 3LQQA 1Z9CA 3OV8A 3WTWC 2GLOA 5D8LB 1JKQC 3KEQA 3QYBA 4BBRJ 3JRFA 1ZRDA 4RLQA 1OMIA 3QU6A 5TJJA 5KHDA 2MSYA 1QNTA 2LR8A 1WJCA 1ZELA 2KZVA 3AG2H 2XIGA 3PUBA 2H8WA 2JRMA 4BE2A 1HSTA 1XCVA 2KIMA 1OQYA 1D5YA 3I3LA 3V7RA 1V4RA 2M9HA 2A69F 3OL4A 4A3KJ 2VBZA 3J80K 2OCCH 1G8XA 3SHFA 1W4MA 2GIZA 1MNMC 4LG0B 1FIPA 2ESHA 2QKMB 5FFXA 5E3LA 2UUZA 2QQBA 2EBIA 1DP7P 3GUDA 2TDXA 2X48A 2NVQJ 2VODA 3TP3A 1IN4A 2M1BA 4EQQA 1BN5A 3H0GJ 4YIIA 2W7NA 4BBSJ 2IBDA 2YSRA 4TV7A 4BY1J 5CLSA 3H5NA 2VL8A 5FKLA 3K1MA 1QZZA 2FQ4A 3VFZA 3AL0C 4YIFA 1PUFA 3K4KA 3S1QJ 3W3CA 4IHSA 4UHTA 4Z6YA 1FLIA 3DF8A 1ZYRF 1APLC 2ICWG 3CCVI 3GFJA 4MFEA 3OYJA 3Q0UA 4OIOF 4XOTA 5CVUA 2OTLI 2R92J 3B02A 2TCTA 4M74A 4BNCA 3R4KA 3IWZA 5IP6A 4KITB 3CJQB 1U5TA 3F3XA 4JP0A 4MTEA 4IL6C 3VYTB 2V6CA 2DW4A 1Z67A 3F8MA 1ETWA 3AG1H 5B1BH 2EFWA 5EEHA 2RVCA 2D2WA 3K4JA 1RIOH 2WADA 3O6BB 4LK1F 1RI7A 1SVLA 5EGOB 4HYEA 3CMEI 2HOTA 3F0CA 2PJPA 2XUBA 3DFGA 4M72A 4WK8F 4NBQA 2NVXJ 4RDUA 3I56I 3S16J 5JHUA 2F6CA 1LE8A 1HW2A 2GIVA 2PMZN 4S05A 5F64A 2AHQA 4QPQA 1XGOA 3BT9A 4PDKA 1TQPA 3SXYA 3G73A 2OA9A 2M3AA 3JTGA 4I7HA 5BS6A 1O3SA 3BZ6A 3ZQHA 4I76A 4A2UA 3KEYA 4MQ9F 1MBHA 2XVCA 3AFHA 4HRIA 5K7HA 1X58A 1TW3A 1ZG5A 3HL2A 2FF4A 1LKXA 4M3BA 3HSFA 1FNNA 2XPVA 1VQ4I 4EEFG 2X6WA 2X1CA 3ZQGA 1F1ZA 2JSCA 3BG7A 3IRQA 3ESWB 4J19A 5EDNA 2RNJA 4HDVA 3HRSA 4PGGA 2DMTA 1Q1HA 3OYDA 1NH3A 2G9WA 2E2IJ 3KZZA 4C30A 1RPWA 2Y9YA 3S2WA 4HZFA 1IUFA 4JQFA 1LFUP 1DPRA 3TO9A 3VPRA 1Y0NA 4E7SA 1G2HA 3HOUJ 4CICA 1U5TB 4OINF 5JLXA 2WV1A 1YW8A 5J4VA 3MWMA 1Y56A 5FD6A 4CXFA 4ON0A 3REOA 3U9GA 4BACA 2XB0X 3MVPA 5HS7A 4CCLA 2FSWA 5D5VB 5JVGF 1YFHA 4WXDA 4XN0A 4PJNA 2XRNA 3GTGJ 3MAJA 4RB0A 3K6GA 1KA8A 4XKVA 3JCUC 2X9DA 1TNTA 1ZARA 3QYFA 3D0SA 4DYCA 3PO3J 2P7VB 2BHYA 4KDPA 3OR2C 2OBPA 3HHGA 5FRMA 2HZDA 2UXXA 1IF1A 4A3CJ 4UV9A 1VQPI 3S3OA 3A02A 2CYYA 3WG7H 1QVTA 1LE8B 2VJJA 4L9NA 4CCJA 3ELKA 1KYWA 3TOBA 4I0BA 1UCRA 2OV7A 1OISA 1ERDA 5H6RA 4GRIA 3GTOJ 2XAHA 4XSXF 4EJUA 3HRMA 4PGHA 2EZIA 2K3FA 2LKPA 2FQ3A 4C9YA 1FP2A 1OCRH 3SZTA 3KCCA 3TGNA 1BR2A 3ZN0A 4AIJA 1FY7A 2R7DA 2LH9A 2CQXA 1VI0A 3F21A 1GV5A 2QCOA 3BWGA 3Q9SA 3G2BA 4RB2C 1IGNA 2KRHA 1ULYA 3CJRB 2WC2A 3FKIJ 2DODA 4QPOA 1REPC 2ZJ2A 4XMYA 4M6VA 3HKZA 5CPRB 1G3YA 4IOAF 2Y2ZA 2EZLA 4BL0B 2LD5A 5BPDA 2PJRA 2K9MA 3BLYA 4FETA 2ACJA 2N8GA 1IZ1A 4JX6A 2W85A 1KONA 5LFAA 1YTYA 1IG7A 2FNAA 3BR1A 1J7KA 2HVQA 3I58A 3LA7A 3O8GA 1QBJA 2CGPA 4IOCF 3E97A 3DPLC 3HEFA 1QZYA 2DCEA 4EJTA 4MLOA 2ZSIB 3BCAA 1XMXA 2FEZA 2ISYA 5GAEJ 4IO9F 4L0YB 4A5MA 2LY9A 1MSEC 3HGGA 3B6AA 4P5OA 3JSOA 1P92A 4GYIA 3EUKL 5CYVA 3WHCA 1X1BA 1XN7A 1Z7UA 4F3QA 2Z1DA 3QPHA 4LLGF 3WG9A 1LVAA 4M9XA 5EF6A 2M0CA 4D0PA 3GCMA 2L4AA 1UHMA 2F5VA 3H0DA 3WGHA 1HXDA 1WJEA 2YU3A 3F8CA 2CFXA 1JUSA 1ZG1A 1WH5A 3CP2A 2CSOA 3I4NJ 1TP4A 3QOPA 1U2WA 3CCSI 2BXYA 2DI3A 1N75A 4DBRA 1ETXA 3K2AA 4EMSA 4BE0A 5DTDA 3DCFA 3RTRA 2XROA 1ORKA 2FNPA 1UG2A 2HS5A 4RGSA 3GX4X 2LVSA 2ZJRF 2Y75A 3JRGA 3MKYB 3JW4A 3OSGA 2DFFA 1KGSA 5J6XA 2JRTA 4PJJA 4KJZA 5K5QA 3CF2A 1A31A 3QQAA 2RNGA 5CVRA 3W2WA 2MD5A 2DA2A 1HCRA 3KPHA 2XAQA 3M7GA 1XGSA 1MH3A 1Y6IA 2FU4A 2XKPA 3JAMZ 2JA8J 1I6HJ 1D1BA 2HQ5A 4U0WA 1NHAA 1BOAA 5HS9A 2PJRB 4D5CA 2WB1N 2DA1A 5B3SH 3VDXA 3L2UA 1T39A 4Y33A 2DO7A 1X1DA 2QQAA 5JI6A 1TT0A 2Y30A 2M4KA 3CJNA 1SAXA 4Y17A 2H1LA 2COMA 2OD5A 3GW2A 3RKYA 4AIHA 1EJ9A 2PQ8A 3WODF 2IXSA 5F1RA 1PYVA 3KEOA 2NXNB 3FXLA 3K9TA 3B73A 5FGMA 5E8IA 4PJMA 3LFUA 2FD5A 1FT9A 4YFNF 1AKHB 2DYSH 3EUAA 5L3GA 5FROA 2HPMA 3SDGA 2BY0A 4G7ZF 3S1MJ 1N78A 2K86A 4R1HA 3BTLA 5IOZA 2BBYA 2YUSA 2LYCA 2P8TA 2IGKA 4Q48A 3MKLA 2JTVA 1VQMI 3FMQA 4KICA 3I59A 1VQNI 2YR2A 5E3NA 1LDDA 2FX0A 4A69C 4Y7NJ 1HDDC 1Z7LA 2TRTA 4RMNA 2HVSA 2ZXIA 1FOKA 1MBFA 2XF5A 2HQNA 1XSDA 3FK6A 3QPLA 2LLKA 4A0XA 1ZKGA 4LIVA 1EH8A 2VN2A 5KCMA 3F8BA 4CCOA 3ZQLA 3N4MA 1CF7A 1AOYA 1UHWA 3R0JA 5ICEA 1TWCJ 4HBLA 4I98B 3FXJA 3PIPF 3ZPLA 3PFIA 3KP3A 2DBBA 2MC3A 2VBWA 4BJ6C 1MMDA 5FLXZ 4AYBA 2JT1A 1L0OC 2X85A 1B59A 3ZQFA 4C3IJ 5KAFC 4C3JJ 4EJWA 3NRVA 4BE1A 2AXLA 3ZMSA 5L3BA 3HDDA 1YLFA 2LF8A 1TBXA 3K1PA 2IGMA 3HG9A 5LBQA 2BHZA 4KIBA 4B09A 2MLGA 1TC3C 1WWXA 5EZHA 3DQVC 1YI2I 2D5VA 2FOWA 2W57A 3CCLI 3HBLA 1BIBA 3BDDA 3ZN1A 5ICCA 2R7TA 4XRSG 1HLVA 2O6GE 3I4MJ 4ZYDA 4QLCU 5DM7F 1P4AA 3U1DA 3LAJA 2GAUA 3DU5A 2ME0A 1S7EA 1O4XA 5F08A 4NC6A 1SFKA 2ESNA 4HF1A 1A6IA 1K79A 2ZMEA 4ZYGA 3NWTA 2CWEA 2ZFWA 3GLXA 1Z6RA 2NS0A 4PFPA 1SEUA 1LFPA 1Y0UA 4I0AA 1B72B 1W7PD 1V5FA 3MZHA 1G6NA 2VQHA 2X1EA 4B3XA 4EM1A 1E2XA 3CCJI 3BTIA 3KYCB 1RR7A 2MH9A 4G6TB 2XC7A 1QQIA 1QO0D 2QSFX 3CC2I 2DFHA 1PP8F 3SEQA 3E6DA 5E18F 3ZCOA 3NWSA 1CF7B 3BP8A 1OLTA 3BJAA 5D4SA 5HLHA 4HPQA 4V2FA 1QA6A 2HWVA 3CLOA 2Y69H 4D7MA 5D4RA 2K9QA 2K9SA 3H9JA 4E7HA 3RDIA 1R1TA 3LSPA 3UNGC 2OQRA 2L7MP 2GBYA 3M3YJ 4ENMA 2EV5A 3BG5A 4XKCA 1PVIA 4E7JA 3LFKA 2KQRA 1YJ9I 3L2QA 2IRFG 1G3SA 3RYPA 5FRNA 2QSGX 1X19A 2BXZA 4NDLA 1ON1A 2BV6A 5FLMJ 2CW8A 3PIOF 5F6FA 3HXLA 3ABKH 2XAUA 1D8KA 2JZYA 4ZH4F 1VZ0A 1UB9A 2PLYA 4HF2A 4WX9A 1VQKI 5J8FA 2ELKA 2OC6A 4GXOA 1EA3A 1O7LA 2CS3A 1ZGAA 2OZ6A 2GQQA 3E5XA 4XLCA 5F0CA 1DU6A 1S3JA 4Q47A 2KDOA 5C44J 1Z3XA 2OAZA 3BTJA 1MJAA 2M30A 1PP7U 3H36A 3N05A 5IYCJ 2OA4A 2Q8KA 4IXAA 3OYCA 1O7FA 1T0FA 4B3AA 4RGXA 2LG4A 3BR2A 4GGGA 3FM5A 1BL0A 4W1UA 3DTIA 3ZMVA 2FBHA 4N9IA 1W1WE 1FZPB 3BCBA 1D1CA 3K4BA 1W5CC 1MMNA 3ASNH 5E3OA 2ZMEB 3FXOA 3FBIB 3JSPA 4C3HJ 3HKZN 3TO7A 1YS7A 3OSFA 1JTXA 3JRIA 2FJ1A 3SFZA 4F55A 4NQWA 3BPVA 4OOIA 4RAZA 5DEQA 4RB3C 1L3LA 2NOJB 2ADUA 2HPIA 4JOMA 1YW9A 3GYHX 3AAFA 4RM2A 3HOWJ 3N97A 3V7SA 4HV5A 4K2EA 2HXIA 1HA8A 2GWRA 2JA2A 5E8GA 4CO8A 2V1DA 1P2FA 2DYRH 2O7OA 5CQGA 3LQRA 1U5TC 1RRJA 2V1XA 4MNUA 2XDVA 4EGZA 1DQUA 2EIJH 2OPTA 3HGYA 2BY1A 2KIFA 3FMSA 3KP7A 3HRUA 4CCKA 5FKOA 2VKHA 4ENJA 1O3RA 2DJIA 2K9LA 2O5RA 2H6CA 1OCTC 4FASD 5LHIA 1GUUA 3A1YA 5TRDA 4M6XA 1ON2A 1OR7A 1R1VA 4DW6A 1SVMA 2QYOA 1TWHJ 2PMUA 3BJ6A 2IGNA 2O8XA 1LB2A 2DMNA 2QM3A 1S72I 4HV6A 2XAJA 3S14J 2PFBA 2ISZA 2L2OA 4JX5A 5ERIA 4BDZA 3EYYA 4V19K 4XICA 2VT2A 3FBNB 3OIPA 3L2VA 3IP4B 2DA3A 4J00A 3RKXA 3I9V2 2NNNA 2I8DA 1STZA 4LD5A 4LITA 1LEBA 2LF7A 2RC4A 2B9SA 4UUTA 5C3EJ 2CW7A 3GZNB 1ZG3A 4M6YA 1MNEA 4AUXA 3OYKA 3LSRA 1XSVA 1HKTA 1DGRM 4WXHA 4RM3A 2AO9A 3H1CA 3QAHA 4XRFA 1TW2A 2DT7B 1R6RA 4M3FA 3CD6I 1R58A 2JJ7A 1SFXA 3A0HC 4DYRA 2P6TA 4O3MA 1MW7A 2RGVA 2ECBA 2BE5F 3EQLF 2F5CA 4E7ZA 4AIDA 1N25A 3GTPJ 4OIPF 1P7JA 1WJ5A 4NQWB 1YIJI 2XGEA 3I54A 3RCOA 3DXJF 5EYRA 4UUVA 5IT9K 2HQRA 4AC0A 1JGSA 1W0TA 2I5UA 2MYSA 2BVMA 3ERED 5J1UA 2VKEA 3HRTA 3GZ5A 3VEPA 1W36C 1ENHA 2NS8A 5H2FC 2FBIA 2HKXA 3LAPA 2W24A 3QP6A 3IV5A 1XB4A 1VQ7I 2M4GA 4HSRA 4YIRX 1ZQ3P 2RKHA 1B6AA 2A5WA 1ZH5A 4XOPA 5L3FA 2Y48A 4B1RA 2W25A 1HQCA 1JJ8C 2R7UA 1U9NA 4OMYA 2BGCA 1WRJA 3PNVA 5B1AH 3U21A 4CZCA 2XB5A 2ME6A 1FWZA 2VB6A 1FSHA 4F91B 3OMYA 3ROUA 1K6YA 3W2AA 4E6KG 1OFCX 3E6MA 2VKDA 2E5ZA 4OAYA 1TWGJ 3TO6A 1ZGJA 4IPAA 4LG3A 2DK5A 3HC7A 2MBFA 2QENA 2JWTA 4CH7A 1IDZA 4D7NA 5LGUA 2QQ8A 1FX7A 2EV6A 1F4KA 3CC4I 4G12A 3FHNA 3G3ZA 4NB5A 2RQQA 5F1JA 3CESA 3KIOA 5FD5A 3E5UA 1VQ6I 2JA6J 5HLIA 4FX4A 4I01A 1WJDA 4PUSA 3F23A 4FE4A 1KU3A 2XHKA 2CQ7A 2RQPA 2VXDA 1Y8QB 1IAWA 1GDTA 4J01A 4A93J 1SFEA 2DA4A 2VXZA 2EFPA 2VC1A 2ZXJA 2E34A 4EATA 2NS7A 3PJRA 4FCYA 1D0YA 2HKOA 1G4DA 4KIFA 2FOKA 1G59A 2QUFA 4PZJA 4PJ0C 1K61A 1QGPA 3CMAI 2M7BA 4A0ZA 1VNDA 1T56A 3KETA 5D6FA 1ZRCA 3T1BA 4F7ZA 3H5AA 2K9NA 2X4HA 1SC7A 4I09A 4HX4A 3OS2A 2CV2A 3ECOA 2DT6A 5ICFA 2CV0A 3GXOA 2IPQX 3MZYA 2KL4A 1WJFA 2DMQA 4RGUA 1T95A 1RUOA 1GVJA 3HTSB 2CMPA 4CUGA 3G1OA 1SD7A 3Q0WA 1HDPA 1VQ8I 1PVUA 1Y39A 2X1DA 3C18A 2CRGA 2HR3A 3F8NA 1T08B 2P5KA 2XAFA 4L9JA 1KQ9A 2Z2SB 4UVCA 5CVIA 1UFMA 4CHUA 1E3PA 3K70D 1QVUA 4BGDA 4F93B 1ZTRA 2X6OA 5GAHJ 1PUFB 2IT0A 2IAIA 3PL8A 5HODA 4RS8A 1KU2A 5M5WJ 3VODA 3VB2A 5DUKA 2E19A 4A3MJ 3B6CA 4IRIA 1WQ2A 1X2NA 3H9GA 5C4XJ 2R3SA 2O9LA 4A3LJ 5ILVA 5LRSA 2XGCA 2QWWA 3LA3A 2GA1A 1R5HA 2W4SA 1HBXG 3LMMA 2W48A 5H20A 1I1GA 3VSLA 3V4GA 2ECCA 4LFUA 3DTEA 3I64A 4KFCA 3OS0A 2LOOA 3I55I 2DMPA 2JVGA 2Z5UA 2DFIA 2M2EA 1ETVA 2XKOA 1S5LC 2WWYA 1WI9A 2F48A 1I6XA 3TDZC 3GFMA 1SD5A 3QU3A 2PMHA 4V2GA 4OWRB 3CLQA 3L2CA 5FJ8J 2F4OB 3T0YA 4MEYF 9ANTA 5DCMA 2E7XA 2P6SA 2EWNA 4BJ5C 4OU0A 5FKKA 3ML6A 2M34A 1NG6A 2R7ZJ 3DPUA 5DS9A 2A68F 3DWLE 5F27A 3S93A 5GTHC 5HOOA 3BY6A 1SMYF 2M0MA 2Y9ZA 3A4CA 3ZOBA 2LKXA 1Z6TA 2B63J 5TGTA 4CGZA 1FOYA 1MD0A 3Q5FA 2Y0SA 3CCEI 3K0LA 1ZN2A 4EV0A 1NG7A 2CJJA 5BNGA 1MSFC 1TQIA 1JTYA 1Z91A 3OR1C 4MTDA 2ZJPF 2G7HA 2R7RA 3BG3A 1J0RA 1OYIA 4O6JA 2JQ7A 1TNSA 2WY7Q 3V42A 3LSGA 2H94A 2KKOA 2QKLB 5J40A 1B1BA 2R0QC 3FIWA 4KT6A 1S6LA 2EZHA 1D3YA 1WPKA 5IYBJ 2UV1A 3KP2A 2KZGA 2HYJA 2XGXA 5D5XB 5BMZA 1V3FA 4UV8A 1R5ID 5F0HA 3TP0A 2DA5A 3CUOA 4LLLA 2PX9A 2HI3A 2L3DA 3F8FA 4ETSA 3HB9A 4DOZA 1MMAA 1Q1VA 2LY1A 4OIRF 3TDUC 3QPTA 4E7LA 1T98A 1RNLA 2JA7J 2GM4A 4BEHA 2VE9A 1YE9A 2A5YB 2VBXA 1ACIA 2HVRA 3C2BA 3E0JB 2V26A 1D0ZA 4XRSA 1OCZH 2NVUB 3H3VK 3G1MA 3IL2A 1DU0A 4MHGA 2E5NA 4EJVA 3JREA 1TLHB 3FWEA 4KT5C 3DKYA 1YHQI 3S3MA 3QRFF 5E1WA 2R5ZA 2CQKA 4UVAA 1GV2A 3HJEA 3S32A 2BVLA 1ZGWA 4IQJA 3PO2J 5H6QA 4XONA 3MFKA 3K4CA 2ZXWH 5D5WB 2BYVE 4Y3OA 4HOBA 5LGTA 4BQAA 3HOVJ 1RETA 4XNFA 5DCMB 3TMOA 1IW7F 3Q9VA 3W6KB 2GOXB 4XLHA 3WU0A 5J3LA 4D9JA 3OYNA 2EB7A 2QA4I 4BQNA 1LVKA 3DKWA 4KMUX 3G6EI 2MC4A 3CJTB 4II3A 1TT5B 3FXRA 4A3EJ 3P7NA 4KUMA 2L7ZA 1YW7A 4LB6B 1XX5A 3KP5A 1YG2A 2DN0A 4F92B 2A6EF 4G94A 5J1RA 2IA1A 2ZFUA 5A2QZ 1QU3A 5AONA 4HW0A 1R7JA 2ELHA 1JKPC 1QHHD 1BM9A 3J7AO 1R4NB 2DPDA 4HNUA 1P6RA 3VSKA 1K4TA 3IMBA 1FJLA 1BIAA 1XMAA 2CUJA 2WY8Q 2Y0MA 2ZMEC 4IHXA 2KMUA 2Z16A 5E3MA 5HDNA 4EM0B 2X6YA 3J81Z 3BQZA 1SD6A 2KIQA 4XRMA 1BR1A 1NTCA 4KYWA 1LNWA 5HDGA 1IN6A 1SD4A 3GTLJ 1LUJB 1IO2A 3QP5A 4XM3A 1UG0A 5LHGA 1JXSA 2RN7A 1USTA 5LHHA 4C2UA 1P9QC 2J5PA 2M8GX 1WFXA 3MD2A 3C2GA 2ZC2A 5IP7J 1R36A 4BHPA 5BQTA 2NRAC 1JT6A 2D1VA 3QOEA 3FKJA 2IJLA 3OYIA 1WSUA 1OYWA 3KLOA 4XLNF 2R5ZB 2BEOA 5M5XJ 2GXGA 3CUQA 2LMDA 4X1EA 4HF0A 4QWQA 1GT0C 3M8EA 3BG6A 1GHCA 3MZ8A 2VQCA 3L00A 1K7AA 2P0WA 4M9ZA 1V5EA 2IA2A 2EFOA 2B0LA 3MMYB 1F9NA 5L3DA 4IVNA 3HOZJ 3VYUB 3D5SC 2Q2EA 1SVOA 2E1NA 4BAYA 4ANJA 4UNOA 3GZ6A 3NARA 4N0BA 3LSMA 5LGNA 1HW5A 3MN2A 1X2MA 3KP6A 2XGDA 4M3EA 1FBUA 1J9IA 3E1SA
chains in the Genus database with same CATH topology
2MH2A 3IC7A 3I0TA 2QZ8A 3I5UA 3PQKA 2M5WA 2Z3YA 5ILSA 1IN8A 5L3CA 2ODHA 4OIQF 2HTSA 3P9CA 3HOSA 5AIQA 1J5YA 3SZPA 1S29A 3EETA 2D1HA 2FBKA 3IWFA 3HOTA 1J75A 2ZNYA 4E70A 1G3WA 3FZVA 2JPCA 2HTJA 3HUGA 1IN5A 5ILUA 1XGNA 4KMFA 4G7HF 3ZP5A 1W7PA 3FM3A 1TTYA 3CUQB 4UXNA 3I59B 5E1ZB 2F2EA 1XGMA 2QVOA 1U78A 5CVVA 5DD4A 3RKWA 1R00A 3H3ZA 3J80Z 2HFHA 1J59A 3W6JB 1EH7A 3SQNA 5JVTA 5E1XA 1PDNC 5CJ9A 1K6OA 1B9NA 3R0AA 3C3WA 4Y15A 1KQ8A 2JPBA 4P9FA 1DDNA 4HLXA 4WCGA 4HX7A 4MGRA 4LMYA 1BC7C 1BI3A 2FRHA 3L09A 3JAMK 3LSTA 2PEXA 2A61A 1QPMA 2F5FA 4GCVA 4M71A 5HVQC 3TKYA 3T8TA 5DD8A 2YX4A 4XBFA 4ESJA 3T5XA 2VONA 1FBQA 2O3FA 1W7PB 4A6DA 4Y13A 5FO5A 5E17F 2CW0F 4I02A 4UVBA 3ZMZA 4WF2A 3RPUA 1FYKA 2UZKA 1KU7A 4BXUA 4CDGA 2XASA 2PBIA 3MQ0A 3BPXA 4AIKA 3TOAA 1OPCA 3R61A 2GXBA 2HDCA 2X0LA 5DCFA 1IRGA 3FX3A 3ZMDA 4N9HA 1R1UA 4LB5A 2YX7A 5ED4A 4JBAA 4A5NA 1RZ4A 4HQEA 2DLLA 3RI4A 2D45A 2J5OA 1X3UA 5FLXK 2DU9A 1KQ0A 2OAAA 3BJOA 4CYDA 4GYGA 3COAC 3IHUA 2HYGD 3FF5A 4ESFA 1IXRC 2F5EA 4HLYA 2XV4S 4JK1X 2EFNA 4A12A 3JTHA 1IXCA 2A6HF 4PCQA 1ODDA 4RAYA 3EUHA 1RUNA 4EVIA 4M73A 1ZLJA 3WE2A 5HDKA 2DQRA 1DPUA 2Q0OA 5FFZA 2NYXA 3M8FA 4R79A 1HSJA 3CDHA 4RB1A 2VOPA 4FT8A 2IP2A 4Q4ZF 2ZBKA 3CO7C 6PAXA 1FYMA 5ICGA 1PUEE 4NHJA 3HTUA 2EA2A 2R7FA 2K7LA 1S7AA 1D5VA 1SMTA 1YQAA 2OZUA 4HX8A 2M45A 4EM2A 1LEAA 1AWCA 5JR3A 2Z33A 4IHTA 4HQMA 1GXPA 1T6SA 2DTRA 4ESBA 1O57A 2CO5A 4U7DA 4L0ZB 2M87A 1W5TA 4LK0F 2L4MA 2VT3A 4R8HA 2G7UA 1SFUA 3ISPA 5BOXA 1LDKB 3M1EA 3V8JA 2H09A 2UXNA 3EDPA 3FXUA 3V8KA 3MEXA 2LSOA 4HAMA 2A07F 2O61A 3E6BA 5DDGA 1KYZA 2DAOA 2CG4A 4KIGA 1XCBA 2GZWA 3PQJA 3BROA 2H6BA 1FBSA 1H0MA 4P96A 2ETHA 2P4WA 2Z99A 4EGYA 2FMYA 2VC0A 3KLNA 4MQVA 1WKMA 1R23A 3HHHA 4U0YA 2KJBA 2WV0A 3K69A 4RGRA 3WTTC 1JE8A 4CZZA 2EK5A 4S04A 4ASNA 5LRRA 1A04A 4HDUA 1B9MA 1S7OA 1MGTA 4IRHA 2P5VA 1KU9A 5D5UB 4G6QA 1JHFA 2LNBA 4BH9A 3WTUC 4H0EA 4Q5SF 3NEUA 1P4WA 2HOEA 4ZZLA 3FMRA 1BI0A 2VE8A 4KN4X 4OMZA 2IVMA 1K78A 3GFLA 3CUQC 3GO5A 4YFKF 1HKSA 4U88A 4MEXF 4ZZDA 4YFXF 2QQ9A 2V79A 2ZCWA 1MKMA 5CVJA 2IA0A 1JHHA 2KIUA 3GEZA 2O03A 1BI2A 4FHTA 3O2PE 1TQMA 4IRGA 1EH6A 1O3QA 3WE3A 5KVRA 1BBYA 4BHCA 1IXSB 3C1DA 3F22A 3MCZA 1MZBA 3GF2A 1IUYA 4IF4A 3ECHA 3H92A 1EV7A 2NAZA 2UWMA 1ZLKA 4G8XA 1DUXC 4B8XA 2QBYA 2K4BA 4A6EA 1J2XA 2V9VA 1Z1DA 2K4JA 3ZQ7A 3F72A 2E7WA 1IN7A 3K1NA 2C6YA 3E3VA 1YYVA 5K1YA 4L5IA 4GO1A 5KK1A 3HSRA 3L9FA 2XAGA 2P7CB 1K78B 4ENKA 3CO6C 1ZAOA 3ZMUA 4WWCA 2GA2A 2Z9OA 1T38A 3FHZA 3RIRA 2O0YA 3M9AA 3V8LA 2FE3A 3DV8A 4XSZF 3E5QA 1FP1D 1W5SA 3KP4A 1HW1A 2HZTA 1OYYA 3HIFA 1O3TA 2FMLA 3HSEA 1H9GA 2IW5A 4AWXB 2RV8A 4ZYEA 1U6GA 4L9VA 2WTEA 2FXAA 5JFRA 3F6VA 3U2RA 3WU1B 1MJBA 2EFQA 2QBYB 3VOEA 2VOOA 4LGWA 1ZRFA 1FPQA 3E6CC 2LDUA 1D8JA 1XD7A 4U7BA 5E20A 3WTSC 1S8NA 1OKRA 2KJCA 2PG4A 2L54A 3CTAA 3T8RA 1YO5C 3GVAA 2E1CA 1XDSA 4FX0A 5LEJA 2DPUA 2DQLA 1CGPA 2HGCA 5HLGA 5LEKA 1FC3A 3L7WA 3ZMTA 1LJ9A 2HYFA 1U8RA 1Z05A 2ODIA 3C7JA 2NNYA 4ZYHA 1ZHFA 5IT3A 3IKVA 1LQ1A 1GXQA 1C0WA 5DYMA 5L3EA 3RPQA 3GFIA 1I1SA 5D6EA 3IRRA 3R60A 2ZNZA 1BC8C 4BYYA 1R22A 3RJPA 4KA4A 2AS5F 1H9TA 4YG2F 3O3KA 3BOQA 3WTYC 1I5ZA 3WGIA 2L01A 2P5LC 4AD9A 5IT9Z 5LLQA 3F6OA 4M9SA 1G3TA 2K02A 3EYIA 4HA8A 3TQNA 4P55A 3WTVC 1MJ9A 3I4PA 1FSEA 3ABTA 4KNYA 3H3UA 1BI1A 3LWFA 1MDMA 4DQ2A 2RDPA 1XSXA 5BPIA 2F5DA 5A2QK 3ABUA 4ENNA 2EA4A 2M8EA 3V7CA 3I53A 4EJOA 2H27A 2ZKZA 4U0VA 3IKTA 2K27A 1HKQA 1T2KA 3J81K 5K5OA 3WTXC 3I71A 3HYIA 1BJAA 3NQOA 1P4XA 5EEGA 2PN6A 5K5RA 1F5TA 2ZO4A 4L9TA 2V1UA 3P9IA 5J8CA 2STWA 3DPTA 1IRFA 5DUIA 1LDJA 3KZYA 2L02A 1B4AA 1YS6A 4L5JA 3P9KA 5AIPA 5FB2A 3D5LA 4LLNA 2EJRA 4KN7X 3WGGA 3OOPA 4DNCA 5D8KB 3FXQA 1ONVA 4I2OA 2MA3A 2Q10A 3DP7A 4O5VA 2PI0A 4LG0A 1MDMB 4WXCA 4P9UA 2FA5A 2HEOA 2QLZA 1YIOA 2MLKA 5DV5A 1VTNC 4G6DA 4BHBA 3LA2A 3GWZA 3KFWX 4IJAA 2STTA 4XLPF 3ULQB 4A0YA 2OQGA 2OU2A 1XMKA 4L18B 2A3SA 4Z2YA 1XDUA 4G7OF 2DT5A 3K2ZA 3DEUA 1USSA 2W84A 1I27A 2EV0A 2DK8A 1U3EM 2YPRA 5HS8A 2KRFA 3RYRA 4AVPA 3WTZA 1FYLA 1R5GA 4LJZF 3R6SA 1E17A 1ZREA 4G9YA 2VBYA 3KE2A 3LQQA 1Z9CA 3OV8A 3WTWC 5D8LB 3KEQA 1ZRDA 1OMIA 3QU6A 5TJJA 1QNTA 2XIGA 1HSTA 1XCVA 2KIMA 3V7RA 1V4RA 2A69F 2VBZA 3J80K 3SHFA 1W4MA 4LG0B 2ESHA 5FFXA 2QQBA 1DP7P 3GUDA 2TDXA 2VODA 1IN4A 2M1BA 4EQQA 1BN5A 4YIIA 2YSRA 4TV7A 5CLSA 3K1MA 1QZZA 3VFZA 4YIFA 4IHSA 4UHTA 1FLIA 3DF8A 1ZYRF 3GFJA 4OIOF 5CVUA 3B02A 4M74A 4BNCA 3R4KA 3IWZA 1U5TA 3F3XA 4MTEA 2V6CA 2DW4A 3F8MA 2EFWA 5EEHA 2RVCA 2D2WA 1RIOH 3O6BB 4LK1F 1RI7A 4HYEA 2PJPA 2XUBA 3DFGA 4M72A 4WK8F 5JHUA 1HW2A 2GIVA 4S05A 5F64A 1XGOA 4PDKA 3SXYA 1TQPA 3G73A 2OA9A 3JTGA 4I7HA 5BS6A 1O3SA 3BZ6A 4A2UA 4MQ9F 2XVCA 1TW3A 1ZG5A 2FF4A 3HSFA 1FNNA 1F1ZA 2JSCA 3IRQA 2RNJA 4HDVA 3HRSA 4PGGA 1Q1HA 2G9WA 3KZZA 3S2WA 4HZFA 4JQFA 1DPRA 3TO9A 4CICA 1U5TB 4OINF 1YW8A 3MWMA 5FD6A 4CXFA 4ON0A 3REOA 3U9GA 5HS7A 2FSWA 5D5VB 1YFHA 4WXDA 2XRNA 3MAJA 4RB0A 1KA8A 1TNTA 1ZARA 3D0SA 2P7VB 4KDPA 2OBPA 3HHGA 2UXXA 1IF1A 4UV9A 2CYYA 4L9NA 3ELKA 1KYWA 3TOBA 4I0BA 1UCRA 5H6RA 2XAHA 4XSXF 4EJUA 3HRMA 4PGHA 2LKPA 2FQ3A 1FP2A 3SZTA 3KCCA 3TGNA 3ZN0A 4AIJA 1FY7A 2R7DA 3F21A 3BWGA 3Q9SA 4RB2C 1ULYA 2WC2A 1REPC 2ZJ2A 1G3YA 5BPDA 2ACJA 1IZ1A 2W85A 1YTYA 2FNAA 1J7KA 3I58A 3LA7A 1QBJA 2CGPA 3E97A 3DPLC 1QZYA 4EJTA 2FEZA 2ISYA 4L0YB 4A5MA 4P5OA 3JSOA 1P92A 4GYIA 5CYVA 1XN7A 1Z7UA 3QPHA 4LLGF 3WG9A 1LVAA 4M9XA 4D0PA 2L4AA 1UHMA 3WGHA 1HXDA 2YU3A 3F8CA 2CFXA 1ZG1A 2CSOA 3QOPA 1U2WA 2DI3A 4EMSA 3RTRA 2XROA 2FNPA 2HS5A 4RGSA 3GX4X 2Y75A 3JW4A 1KGSA 5J6XA 2JRTA 5K5QA 5CVRA 2MD5A 2XAQA 3M7GA 1XGSA 2FU4A 2XKPA 3JAMZ 4U0WA 1NHAA 1BOAA 5HS9A 1T39A 2DO7A 2QQAA 5JI6A 3CJNA 1SAXA 4Y17A 2OD5A 2COMA 3GW2A 3RKYA 4AIHA 2PQ8A 3WODF 5F1RA 3KEOA 3K9TA 3B73A 5FGMA 5E8IA 1FT9A 4YFNF 5L3GA 4G7ZF 2K86A 4R1HA 2BBYA 2P8TA 4Q48A 2JTVA 3FMQA 4KICA 3I59A 2YR2A 1LDDA 1FOKA 2HQNA 1XSDA 4A0XA 1EH8A 2VN2A 3F8BA 3N4MA 1CF7A 1AOYA 1UHWA 3R0JA 5ICEA 4HBLA 4I98B 3ZPLA 3PFIA 3KP3A 2DBBA 2MC3A 2VBWA 5FLXZ 2JT1A 1L0OC 1B59A 4EJWA 3NRVA 2AXLA 3ZMSA 5L3BA 1YLFA 2LF8A 1TBXA 3K1PA 5LBQA 4KIBA 4B09A 2MLGA 1WWXA 3DQVC 2W57A 3ZN1A 1BIBA 3BDDA 5ICCA 2O6GE 4ZYDA 4QLCU 1P4AA 3U1DA 3LAJA 2GAUA 2ESNA 4HF1A 1K79A 2ZMEA 4ZYGA 2CWEA 2ZFWA 3GLXA 1Z6RA 2NS0A 1Y0UA 4I0AA 1W7PD 3MZHA 1G6NA 4EM1A 1E2XA 2MH9A 1QQIA 1QO0D 1PP8F 3E6DA 5E18F 1CF7B 3BP8A 3BJAA 5D4SA 5HLHA 2HWVA 3CLOA 5D4RA 3RDIA 1R1TA 2OQRA 4ENMA 2EV5A 3LFKA 2IRFG 1G3SA 3RYPA 1ON1A 2BV6A 5F6FA 1D8KA 2JZYA 4ZH4F 1UB9A 2PLYA 4HF2A 4WX9A 5J8FA 4GXOA 1O7LA 1ZGAA 2OZ6A 2GQQA 3E5XA 1S3JA 4Q47A 2OAZA 1MJAA 2M30A 1PP7U 2OA4A 2Q8KA 4IXAA 1O7FA 1T0FA 4RGXA 4GGGA 3FM5A 3ZMVA 2FBHA 4N9IA 1FZPB 2ZMEB 3JSPA 3TO7A 1YS7A 3SFZA 4NQWA 3BPVA 4OOIA 4RAZA 5DEQA 4RB3C 1L3LA 2ADUA 1YW9A 3GYHX 3AAFA 3N97A 3V7SA 4HV5A 4K2EA 2GWRA 5E8GA 4CO8A 2V1DA 1P2FA 3LQRA 1U5TC 2V1XA 4MNUA 4EGZA 2KIFA 3FMSA 3KP7A 3HRUA 4ENJA 1O3RA 2H6CA 5LHIA 5TRDA 4M6XA 1ON2A 1OR7A 1R1VA 2QYOA 2PMUA 3BJ6A 2O8XA 1LB2A 2QM3A 4HV6A 2XAJA 2PFBA 2ISZA 5ERIA 3EYYA 2VT2A 3RKXA 2NNNA 1STZA 4LD5A 1LEBA 2LF7A 2RC4A 1ZG3A 4M6YA 1HKTA 1XSVA 4WXHA 3QAHA 4XRFA 1TW2A 1R58A 1SFXA 2P6TA 4O3MA 2RGVA 3EQLF 2BE5F 2F5CA 4OIPF 3I54A 3DXJF 4UUVA 5IT9K 2HQRA 1JGSA 3ERED 3HRTA 3GZ5A 3VEPA 2FBIA 2HKXA 3LAPA 2W24A 3QP6A 1XB4A 2RKHA 1B6AA 1ZH5A 5L3FA 2Y48A 2W25A 1HQCA 4OMYA 2BGCA 1WRJA 1FWZA 1FSHA 3ROUA 3E6MA 3TO6A 1ZGJA 4IPAA 2DK5A 2MBFA 2QENA 5LGUA 1FX7A 2EV6A 1F4KA 4NB5A 3G3ZA 5FD5A 3E5UA 5HLIA 4FX4A 4I01A 3F23A 1KU3A 2XHKA 2RQPA 1IAWA 1SFEA 2VXZA 2EFPA 2VC1A 2ZXJA 1G4DA 2HKOA 4KIFA 2FOKA 2QUFA 4PZJA 1QGPA 4A0ZA 3KETA 5D6FA 1ZRCA 3T1BA 4F7ZA 2X4HA 4I09A 4HX4A 3ECOA 5ICFA 3GXOA 2IPQX 3MZYA 1RUOA 4RGUA 1GVJA 3HTSB 1SD7A 3C18A 2HR3A 3F8NA 2P5KA 2XAFA 4L9JA 1KQ9A 4UVCA 5CVIA 1UFMA 4CHUA 2IT0A 4RS8A 1KU2A 3VODA 3VB2A 5DUKA 4IRIA 1WQ2A 2R3SA 5ILVA 5LRSA 2QWWA 3LA3A 2GA1A 1R5HA 1HBXG 5H20A 1I1GA 3V4GA 4LFUA 3I64A 4KFCA 2Z5UA 2DFIA 2XKOA 2WWYA 1WI9A 1I6XA 3TDZC 3GFMA 1SD5A 3QU3A 2PMHA 3L2CA 3T0YA 4MEYF 5DCMA 2E7XA 2P6SA 2EWNA 4OU0A 3ML6A 2A68F 5HOOA 3BY6A 1SMYF 1Z6TA 4CGZA 1MD0A 3Q5FA 3K0LA 1ZN2A 4EV0A 1TQIA 1Z91A 4MTDA 2G7HA 1J0RA 1OYIA 4O6JA 1TNSA 2H94A 2KKOA 1B1BA 1S6LA 1D3YA 3KP2A 5BMZA 2XGXA 5D5XB 1V3FA 4UV8A 3CUOA 4LLLA 4ETSA 2L3DA 3F8FA 4OIRF 3TDUC 3QPTA 1T98A 1RNLA 2VE9A 2A5YB 2VBXA 3IL2A 4MHGA 4EJVA 1TLHB 3FWEA 4KT5C 3QRFF 5E1WA 2CQKA 4UVAA 5H6QA 3MFKA 5D5WB 2BYVE 5LGTA 4HOBA 4BQAA 5DCMB 1IW7F 3Q9VA 3W6KB 3WU0A 2EB7A 3DKWA 4KMUX 3FXRA 3P7NA 4KUMA 1YW7A 4LB6B 3KP5A 1YG2A 2A6EF 4G94A 2IA1A 5A2QZ 5AONA 4HW0A 1R7JA 2ELHA 1BM9A 3J7AO 2DPDA 1P6RA 3IMBA 1BIAA 1XMAA 2Y0MA 5HDNA 4EM0B 3J81Z 1SD6A 4KYWA 1LNWA 5HDGA 1IN6A 1SD4A 3QP5A 5LHGA 1JXSA 1USTA 2RN7A 5LHHA 2J5PA 1R36A 4BHPA 5BQTA 2NRAC 2D1VA 2IJLA 1WSUA 1OYWA 3KLOA 4XLNF 2BEOA 2GXGA 3CUQA 4HF0A 4QWQA 3M8EA 1GHCA 3L00A 1K7AA 4M9ZA 2IA2A 2EFOA 2B0LA 1F9NA 5L3DA 4IVNA 2Q2EA 2E1NA 4BAYA 4UNOA 3GZ6A 4N0BA 5LGNA 1HW5A 3KP6A 1FBUA 1J9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MH2 A;  3IC7 A;  3I0T A;  2QZ8 A;  3I5U A;  3PQK A;  2M5W A;  2Z3Y A;  5ILS A;  1IN8 A;  5L3C A;  4OIQ F;  2HTS A;  3P9C A;  3HOS A;  5AIQ A;  1J5Y A;  3SZP A;  1S29 A;  3EET A;  2D1H A;  2FBK A;  3IWF A;  3HOT A;  1J75 A;  2ZNY A;  4E70 A;  1G3W A;  3FZV A;  2JPC A;  2HTJ A;  3HUG A;  1IN5 A;  5ILU A;  1XGN A;  4KMF A;  4G7H F;  3ZP5 A;  1W7P A;  3FM3 A;  1TTY A;  3CUQ B;  4UXN A;  3I59 B;  5E1Z B;  2F2E A;  1XGM A;  2QVO A;  1U78 A;  5CVV A;  5DD4 A;  3RKW A;  1R00 A;  3H3Z A;  3J80 Z;  2HFH A;  1J59 A;  3W6J B;  1EH7 A;  3SQN A;  5JVT A;  5E1X A;  1PDN C;  5CJ9 A;  1K6O A;  1B9N A;  3R0A A;  3C3W A;  4Y15 A;  1KQ8 A;  2JPB A;  4P9F A;  1DDN A;  4HLX A;  4WCG A;  4HX7 A;  4MGR A;  4LMY A;  1BC7 C;  1BI3 A;  2FRH A;  3L09 A;  3JAM K;  3LST A;  2PEX A;  2A61 A;  1QPM A;  2F5F A;  4GCV A;  4M71 A;  5HVQ C;  3TKY A;  3T8T A;  5DD8 A;  2YX4 A;  4XBF A;  4ESJ A;  3T5X A;  2VON A;  1FBQ A;  2O3F A;  1W7P B;  4A6D A;  4Y13 A;  5FO5 A;  5E17 F;  2CW0 F;  4I02 A;  4UVB A;  3ZMZ A;  4WF2 A;  3RPU A;  1FYK A;  2UZK A;  1KU7 A;  4BXU A;  4CDG A;  2XAS A;  2PBI A;  3MQ0 A;  3BPX A;  4AIK A;  3TOA A;  1OPC A;  3R61 A;  2GXB A;  2HDC A;  2X0L A;  5DCF A;  1IRG A;  3FX3 A;  3ZMD A;  4N9H A;  1R1U A;  4LB5 A;  2YX7 A;  5ED4 A;  4JBA A;  4A5N A;  1RZ4 A;  4HQE A;  2DLL A;  3RI4 A;  2D45 A;  2J5O A;  1X3U A;  5FLX K;  2DU9 A;  1KQ0 A;  3BJO A;  4CYD A;  4GYG A;  3COA C;  3IHU A;  2HYG D;  3FF5 A;  4ESF A;  1IXR C;  2F5E A;  4HLY A;  2XV4 S;  4JK1 X;  2EFN A;  4A12 A;  3JTH A;  1IXC A;  2A6H F;  4PCQ A;  1ODD A;  4RAY A;  3EUH A;  1RUN A;  4EVI A;  4M73 A;  1ZLJ A;  3WE2 A;  5HDK A;  2DQR A;  1DPU A;  2Q0O A;  5FFZ A;  2NYX A;  3M8F A;  4R79 A;  1HSJ A;  3CDH A;  4RB1 A;  2VOP A;  4FT8 A;  2IP2 A;  4Q4Z F;  2ZBK A;  3CO7 C;  6PAX A;  1FYM A;  5ICG A;  1PUE E;  4NHJ A;  3HTU A;  2EA2 A;  2R7F A;  2K7L A;  1S7A A;  1D5V A;  1SMT A;  1YQA A;  2OZU A;  4HX8 A;  2M45 A;  4EM2 A;  1LEA A;  1AWC A;  5JR3 A;  2Z33 A;  4IHT A;  4HQM A;  1GXP A;  1T6S A;  2DTR A;  4ESB A;  1O57 A;  2CO5 A;  4U7D A;  4L0Z B;  2M87 A;  1W5T A;  4LK0 F;  2L4M A;  2VT3 A;  4R8H A;  2G7U A;  1SFU A;  3ISP A;  5BOX A;  1LDK B;  3M1E A;  3V8J A;  2H09 A;  2UXN A;  3EDP A;  3FXU A;  3V8K A;  3MEX A;  2LSO A;  4HAM A;  2A07 F;  2O61 A;  3E6B A;  5DDG A;  1KYZ A;  2DAO A;  2CG4 A;  4KIG A;  1XCB A;  2GZW A;  3PQJ A;  3BRO A;  2H6B A;  1FBS A;  1H0M A;  4P96 A;  2ETH A;  2P4W A;  2Z99 A;  4EGY A;  2FMY A;  2VC0 A;  3KLN A;  4MQV A;  1WKM A;  1R23 A;  3HHH A;  4U0Y A;  2KJB A;  2WV0 A;  3K69 A;  4RGR A;  3WTT C;  1JE8 A;  4CZZ A;  2EK5 A;  4S04 A;  4ASN A;  5LRR A;  1A04 A;  4HDU A;  1B9M A;  1S7O A;  1MGT A;  4IRH A;  2P5V A;  1KU9 A;  5D5U B;  4G6Q A;  1JHF A;  2LNB A;  4BH9 A;  3WTU C;  4H0E A;  4Q5S F;  3NEU A;  1P4W A;  2HOE A;  4ZZL A;  3FMR A;  1BI0 A;  2VE8 A;  4KN4 X;  4OMZ A;  2IVM A;  1K78 A;  3GFL A;  3CUQ C;  3GO5 A;  4YFK F;  1HKS A;  4U88 A;  4MEX F;  4ZZD A;  4YFX F;  2QQ9 A;  2V79 A;  2ZCW A;  1MKM A;  5CVJ A;  2IA0 A;  1JHH A;  2KIU A;  3GEZ A;  2O03 A;  1BI2 A;  4FHT A;  3O2P E;  1TQM A;  4IRG A;  1EH6 A;  1O3Q A;  3WE3 A;  5KVR A;  1BBY A;  4BHC A;  1IXS B;  3C1D A;  3F22 A;  3MCZ A;  1MZB A;  3GF2 A;  1IUY A;  4IF4 A;  3ECH A;  3H92 A;  1EV7 A;  2NAZ A;  2UWM A;  1ZLK A;  4G8X A;  1DUX C;  4B8X A;  2QBY A;  2K4B A;  4A6E A;  1J2X A;  2V9V A;  1Z1D A;  2K4J A;  3ZQ7 A;  3F72 A;  2E7W A;  1IN7 A;  3K1N A;  2C6Y A;  3E3V A;  1YYV A;  5K1Y A;  4L5I A;  4GO1 A;  5KK1 A;  3HSR A;  3L9F A;  2XAG A;  2P7C B;  1K78 B;  4ENK A;  3CO6 C;  1ZAO A;  3ZMU A;  4WWC A;  2GA2 A;  2Z9O A;  1T38 A;  3FHZ A;  3RIR A;  2O0Y A;  3M9A A;  3V8L A;  2FE3 A;  3DV8 A;  4XSZ F;  3E5Q A;  1FP1 D;  1W5S A;  3KP4 A;  1HW1 A;  2HZT A;  1OYY A;  3HIF A;  1O3T A;  2FML A;  3HSE A;  1H9G A;  2IW5 A;  4AWX B;  2RV8 A;  4ZYE A;  1U6G A;  4L9V A;  2WTE A;  2FXA A;  5JFR A;  3F6V A;  3U2R A;  3WU1 B;  1MJB A;  2EFQ A;  2QBY B;  3VOE A;  2VOO A;  4LGW A;  1ZRF A;  1FPQ A;  3E6C C;  2LDU A;  1D8J A;  1XD7 A;  4U7B A;  5E20 A;  3WTS C;  1S8N A;  1OKR A;  2KJC A;  2PG4 A;  2L54 A;  3CTA A;  3T8R A;  1YO5 C;  3GVA A;  2E1C A;  1XDS A;  4FX0 A;  5LEJ A;  2DPU A;  2DQL A;  1CGP A;  2HGC A;  5HLG A;  5LEK A;  1FC3 A;  3L7W A;  3ZMT A;  1LJ9 A;  2HYF A;  1U8R A;  1Z05 A;  3C7J A;  2NNY A;  4ZYH A;  1ZHF A;  5IT3 A;  3IKV A;  1LQ1 A;  1GXQ A;  1C0W A;  5DYM A;  5L3E A;  3RPQ A;  3GFI A;  1I1S A;  5D6E A;  3IRR A;  3R60 A;  2ZNZ A;  1BC8 C;  4BYY A;  1R22 A;  3RJP A;  4KA4 A;  2AS5 F;  1H9T A;  4YG2 F;  3O3K A;  3BOQ A;  3WTY C;  1I5Z A;  3WGI A;  2L01 A;  2P5L C;  4AD9 A;  5IT9 Z;  5LLQ A;  3F6O A;  4M9S A;  1G3T A;  2K02 A;  3EYI A;  4HA8 A;  3TQN A;  4P55 A;  3WTV C;  1MJ9 A;  3I4P A;  1FSE A;  3ABT A;  4KNY A;  3H3U A;  1BI1 A;  3LWF A;  1MDM A;  4DQ2 A;  2RDP A;  1XSX A;  5BPI A;  2F5D A;  5A2Q K;  3ABU A;  4ENN A;  2EA4 A;  2M8E A;  3V7C A;  3I53 A;  4EJO A;  2H27 A;  2ZKZ A;  4U0V A;  3IKT A;  2K27 A;  1HKQ A;  1T2K A;  3J81 K;  5K5O A;  3WTX C;  3I71 A;  3HYI A;  1BJA A;  3NQO A;  1P4X A;  5EEG A;  2PN6 A;  5K5R A;  1F5T A;  2ZO4 A;  4L9T A;  2V1U A;  3P9I A;  5J8C A;  2STW A;  3DPT A;  1IRF A;  5DUI A;  1LDJ A;  3KZY A;  2L02 A;  1B4A A;  1YS6 A;  4L5J A;  3P9K A;  5AIP A;  5FB2 A;  3D5L A;  4LLN A;  2EJR A;  4KN7 X;  3WGG A;  3OOP A;  4DNC A;  5D8K B;  3FXQ A;  1ONV A;  4I2O A;  2MA3 A;  3DP7 A;  4O5V A;  2PI0 A;  4LG0 A;  1MDM B;  4WXC A;  4P9U A;  2FA5 A;  2HEO A;  2QLZ A;  1YIO A;  2MLK A;  5DV5 A;  1VTN C;  4G6D A;  4BHB A;  3LA2 A;  3GWZ A;  3KFW X;  4IJA A;  2STT A;  4XLP F;  3ULQ B;  4A0Y A;  2OQG A;  2OU2 A;  1XMK A;  4L18 B;  2A3S A;  4Z2Y A;  1XDU A;  4G7O F;  2DT5 A;  3K2Z A;  3DEU A;  1USS A;  2W84 A;  1I27 A;  2EV0 A;  2DK8 A;  1U3E M;  2YPR A;  5HS8 A;  2KRF A;  3RYR A;  4AVP A;  3WTZ A;  1FYL A;  1R5G A;  4LJZ F;  3R6S A;  1E17 A;  1ZRE A;  4G9Y A;  2VBY A;  3KE2 A;  3LQQ A;  1Z9C A;  3OV8 A;  3WTW C;  5D8L B;  3KEQ A;  1ZRD A;  1OMI A;  3QU6 A;  5TJJ A;  1QNT A;  2XIG A;  1HST A;  1XCV A;  2KIM A;  3V7R A;  1V4R A;  2A69 F;  2VBZ A;  3J80 K;  3SHF A;  1W4M A;  4LG0 B;  2ESH A;  5FFX A;  2QQB A;  1DP7 P;  3GUD A;  2TDX A;  2VOD A;  1IN4 A;  2M1B A;  4EQQ A;  1BN5 A;  4YII A;  2YSR A;  4TV7 A;  5CLS A;  3K1M A;  1QZZ A;  3VFZ A;  4YIF A;  4IHS A;  4UHT A;  1FLI A;  3DF8 A;  1ZYR F;  3GFJ A;  4OIO F;  5CVU A;  3B02 A;  4M74 A;  4BNC A;  3R4K A;  3IWZ A;  1U5T A;  3F3X A;  4MTE A;  2V6C A;  2DW4 A;  3F8M A;  2EFW A;  5EEH A;  2RVC A;  2D2W A;  1RIO H;  3O6B B;  4LK1 F;  1RI7 A;  4HYE A;  2PJP A;  2XUB A;  3DFG A;  4M72 A;  4WK8 F;  5JHU A;  1HW2 A;  2GIV A;  4S05 A;  5F64 A;  1XGO A;  4PDK A;  3SXY A;  1TQP A;  3G73 A;  3JTG A;  4I7H A;  5BS6 A;  1O3S A;  3BZ6 A;  4A2U A;  4MQ9 F;  2XVC A;  1TW3 A;  1ZG5 A;  2FF4 A;  3HSF A;  1FNN A;  1F1Z A;  2JSC A;  3IRQ A;  2RNJ A;  4HDV A;  3HRS A;  4PGG A;  1Q1H A;  2G9W A;  3KZZ A;  3S2W A;  4HZF A;  4JQF A;  1DPR A;  3TO9 A;  4CIC A;  1U5T B;  4OIN F;  1YW8 A;  3MWM A;  5FD6 A;  4CXF A;  4ON0 A;  3REO A;  3U9G A;  5HS7 A;  2FSW A;  5D5V B;  1YFH A;  4WXD A;  2XRN A;  3MAJ A;  4RB0 A;  1KA8 A;  1TNT A;  1ZAR A;  3D0S A;  2P7V B;  4KDP A;  2OBP A;  3HHG A;  2UXX A;  1IF1 A;  4UV9 A;  2CYY A;  4L9N A;  3ELK A;  1KYW A;  3TOB A;  4I0B A;  1UCR A;  5H6R A;  2XAH A;  4XSX F;  4EJU A;  3HRM A;  4PGH A;  2LKP A;  2FQ3 A;  1FP2 A;  3SZT A;  3KCC A;  3TGN A;  3ZN0 A;  4AIJ A;  1FY7 A;  2R7D A;  3F21 A;  3BWG A;  3Q9S A;  4RB2 C;  1ULY A;  2WC2 A;  1REP C;  2ZJ2 A;  1G3Y A;  5BPD A;  2ACJ A;  1IZ1 A;  2W85 A;  1YTY A;  2FNA A;  1J7K A;  3I58 A;  3LA7 A;  1QBJ A;  2CGP A;  3E97 A;  3DPL C;  1QZY A;  4EJT A;  2FEZ A;  2ISY A;  4L0Y B;  4A5M A;  4P5O A;  3JSO A;  1P92 A;  4GYI A;  5CYV A;  1XN7 A;  1Z7U A;  3QPH A;  4LLG F;  3WG9 A;  1LVA A;  4M9X A;  4D0P A;  2L4A A;  1UHM A;  3WGH A;  1HXD A;  2YU3 A;  3F8C A;  2CFX A;  1ZG1 A;  2CSO A;  3QOP A;  1U2W A;  2DI3 A;  4EMS A;  3RTR A;  2XRO A;  2FNP A;  2HS5 A;  4RGS A;  3GX4 X;  2Y75 A;  3JW4 A;  1KGS A;  5J6X A;  2JRT A;  5K5Q A;  5CVR A;  2MD5 A;  2XAQ A;  3M7G A;  1XGS A;  2FU4 A;  2XKP A;  3JAM Z;  4U0W A;  1NHA A;  1BOA A;  5HS9 A;  1T39 A;  2DO7 A;  2QQA A;  5JI6 A;  3CJN A;  1SAX A;  4Y17 A;  2OD5 A;  2COM A;  3GW2 A;  3RKY A;  4AIH A;  2PQ8 A;  3WOD F;  5F1R A;  3KEO A;  3K9T A;  3B73 A;  5FGM A;  5E8I A;  1FT9 A;  4YFN F;  5L3G A;  4G7Z F;  2K86 A;  4R1H A;  2BBY A;  2P8T A;  4Q48 A;  2JTV A;  3FMQ A;  4KIC A;  3I59 A;  2YR2 A;  1LDD A;  1FOK A;  2HQN A;  1XSD A;  4A0X A;  1EH8 A;  2VN2 A;  3F8B A;  3N4M A;  1CF7 A;  1AOY A;  1UHW A;  3R0J A;  5ICE A;  4HBL A;  4I98 B;  3ZPL A;  3PFI A;  3KP3 A;  2DBB A;  2MC3 A;  2VBW A;  5FLX Z;  2JT1 A;  1L0O C;  1B59 A;  4EJW A;  3NRV A;  2AXL A;  3ZMS A;  5L3B A;  1YLF A;  2LF8 A;  1TBX A;  3K1P A;  5LBQ A;  4KIB A;  4B09 A;  2MLG A;  1WWX A;  3DQV C;  2W57 A;  3ZN1 A;  1BIB A;  3BDD A;  5ICC A;  2O6G E;  4ZYD A;  4QLC U;  1P4A A;  3U1D A;  3LAJ A;  2GAU A;  2ESN A;  4HF1 A;  1K79 A;  2ZME A;  4ZYG A;  2CWE A;  2ZFW A;  3GLX A;  1Z6R A;  2NS0 A;  1Y0U A;  4I0A A;  1W7P D;  3MZH A;  1G6N A;  4EM1 A;  1E2X A;  2MH9 A;  1QQI A;  1QO0 D;  1PP8 F;  3E6D A;  5E18 F;  1CF7 B;  3BP8 A;  3BJA A;  5D4S A;  5HLH A;  2HWV A;  3CLO A;  5D4R A;  3RDI A;  1R1T A;  2OQR A;  4ENM A;  2EV5 A;  3LFK A;  2IRF G;  1G3S A;  3RYP A;  1ON1 A;  2BV6 A;  5F6F A;  1D8K A;  2JZY A;  4ZH4 F;  1UB9 A;  2PLY A;  4HF2 A;  4WX9 A;  5J8F A;  4GXO A;  1O7L A;  1ZGA A;  2OZ6 A;  2GQQ A;  3E5X A;  1S3J A;  4Q47 A;  2OAZ A;  1MJA A;  2M30 A;  1PP7 U;  2OA4 A;  2Q8K A;  4IXA A;  1O7F A;  1T0F A;  4RGX A;  4GGG A;  3FM5 A;  3ZMV A;  2FBH A;  4N9I A;  1FZP B;  2ZME B;  3JSP A;  3TO7 A;  1YS7 A;  3SFZ A;  4NQW A;  3BPV A;  4OOI A;  4RAZ A;  5DEQ A;  4RB3 C;  1L3L A;  2ADU A;  1YW9 A;  3GYH X;  3AAF A;  3N97 A;  3V7S A;  4HV5 A;  4K2E A;  2GWR A;  5E8G A;  4CO8 A;  2V1D A;  1P2F A;  3LQR A;  1U5T C;  2V1X A;  4MNU A;  4EGZ A;  2KIF A;  3FMS A;  3KP7 A;  3HRU A;  4ENJ A;  1O3R A;  2H6C A;  5LHI A;  5TRD A;  4M6X A;  1ON2 A;  1OR7 A;  1R1V A;  2QYO A;  2PMU A;  3BJ6 A;  2O8X A;  1LB2 A;  2QM3 A;  4HV6 A;  2XAJ A;  2PFB A;  2ISZ A;  5ERI A;  3EYY A;  2VT2 A;  3RKX A;  2NNN A;  1STZ A;  4LD5 A;  1LEB A;  2LF7 A;  2RC4 A;  1ZG3 A;  4M6Y A;  1HKT A;  1XSV A;  4WXH A;  3QAH A;  4XRF A;  1TW2 A;  1R58 A;  1SFX A;  2P6T A;  4O3M A;  2RGV A;  3EQL F;  2BE5 F;  2F5C A;  4OIP F;  3I54 A;  3DXJ F;  4UUV A;  5IT9 K;  2HQR A;  1JGS A;  3ERE D;  3HRT A;  3GZ5 A;  3VEP A;  2FBI A;  2HKX A;  3LAP A;  2W24 A;  3QP6 A;  1XB4 A;  2RKH A;  1B6A A;  1ZH5 A;  5L3F A;  2Y48 A;  2W25 A;  1HQC A;  4OMY A;  2BGC A;  1WRJ A;  1FWZ A;  1FSH A;  3ROU A;  3E6M A;  3TO6 A;  1ZGJ A;  4IPA A;  2DK5 A;  2MBF A;  2QEN A;  5LGU A;  1FX7 A;  2EV6 A;  1F4K A;  4NB5 A;  3G3Z A;  5FD5 A;  3E5U A;  5HLI A;  4FX4 A;  4I01 A;  3F23 A;  1KU3 A;  2XHK A;  2RQP A;  1IAW A;  1SFE A;  2VXZ A;  2EFP A;  2VC1 A;  2ZXJ A;  1G4D A;  2HKO A;  4KIF A;  2FOK A;  2QUF A;  4PZJ A;  1QGP A;  4A0Z A;  3KET A;  5D6F A;  1ZRC A;  3T1B A;  4F7Z A;  2X4H A;  4I09 A;  4HX4 A;  3ECO A;  5ICF A;  3GXO A;  2IPQ X;  3MZY A;  1RUO A;  4RGU A;  1GVJ A;  3HTS B;  1SD7 A;  3C18 A;  2HR3 A;  3F8N A;  2P5K A;  2XAF A;  4L9J A;  1KQ9 A;  4UVC A;  5CVI A;  1UFM A;  4CHU A;  2IT0 A;  4RS8 A;  1KU2 A;  3VOD A;  3VB2 A;  5DUK A;  4IRI A;  1WQ2 A;  2R3S A;  5ILV A;  5LRS A;  2QWW A;  3LA3 A;  2GA1 A;  1R5H A;  1HBX G;  5H20 A;  1I1G A;  3V4G A;  4LFU A;  3I64 A;  4KFC A;  2Z5U A;  2DFI A;  2XKO A;  2WWY A;  1WI9 A;  1I6X A;  3TDZ C;  3GFM A;  1SD5 A;  3QU3 A;  2PMH A;  3L2C A;  3T0Y A;  4MEY F;  5DCM A;  2E7X A;  2P6S A;  2EWN A;  4OU0 A;  3ML6 A;  2A68 F;  5HOO A;  3BY6 A;  1SMY F;  1Z6T A;  4CGZ A;  1MD0 A;  3Q5F A;  3K0L A;  1ZN2 A;  4EV0 A;  1TQI A;  1Z91 A;  4MTD A;  2G7H A;  1J0R A;  1OYI A;  4O6J A;  1TNS A;  2H94 A;  2KKO A;  1B1B A;  1S6L A;  1D3Y A;  3KP2 A;  5BMZ A;  2XGX A;  5D5X B;  1V3F A;  4UV8 A;  3CUO A;  4LLL A;  4ETS A;  2L3D A;  3F8F A;  4OIR F;  3TDU C;  3QPT A;  1T98 A;  1RNL A;  2VE9 A;  2A5Y B;  2VBX A;  3IL2 A;  4MHG A;  4EJV A;  1TLH B;  3FWE A;  4KT5 C;  3QRF F;  5E1W A;  2CQK A;  4UVA A;  5H6Q A;  3MFK A;  5D5W B;  2BYV E;  5LGT A;  4HOB A;  4BQA A;  5DCM B;  1IW7 F;  3Q9V A;  3W6K B;  3WU0 A;  2EB7 A;  3DKW A;  4KMU X;  3FXR A;  3P7N A;  4KUM A;  1YW7 A;  4LB6 B;  3KP5 A;  1YG2 A;  2A6E F;  4G94 A;  2IA1 A;  5A2Q Z;  5AON A;  4HW0 A;  1R7J A;  2ELH A;  1BM9 A;  3J7A O;  2DPD A;  1P6R A;  1BIA A;  1XMA A;  2Y0M A;  5HDN A;  4EM0 B;  3J81 Z;  1SD6 A;  4KYW A;  1LNW A;  5HDG A;  1IN6 A;  1SD4 A;  3QP5 A;  5LHG A;  1JXS A;  1UST A;  2RN7 A;  5LHH A;  2J5P A;  1R36 A;  4BHP A;  5BQT A;  2NRA C;  2D1V A;  2IJL A;  1WSU A;  1OYW A;  3KLO A;  4XLN F;  2BEO A;  2GXG A;  3CUQ A;  4HF0 A;  4QWQ A;  3M8E A;  1GHC A;  3L00 A;  1K7A A;  4M9Z A;  2IA2 A;  2EFO A;  2B0L A;  1F9N A;  5L3D A;  4IVN A;  2Q2E A;  2E1N A;  4BAY A;  4UNO A;  3GZ6 A;  4N0B A;  5LGN A;  1HW5 A;  3KP6 A;  1FBU A;  1J9I A; 
#chains in the Genus database with same CATH topology
 1T0F C;  2CUF A;  1JKO C;  2MH2 A;  1QZE A;  5EJC A;  2VIX A;  2DA6 A;  3IC7 A;  3I0T A;  2QZ8 A;  3I5U A;  3PQK A;  3MKZ A;  2M5W A;  4II2 A;  1X1P A;  2Z3Y A;  5ILS A;  1IN8 A;  3ABM H;  4OAZ A;  5L3C A;  2ODH A;  4OIQ F;  4BQQ A;  2HTS A;  3P9C A;  4BXF A;  4M3G A;  3HOS A;  1JKR C;  5AIQ A;  1J5Y A;  3SZP A;  3X2Q H;  2G0E A;  1S29 A;  2LY2 A;  3EET A;  5EG0 A;  4PK4 A;  3S15 J;  2D1H A;  2FBK A;  3S8P A;  3IWF A;  1YRN A;  2GOM A;  1OCC H;  3HOT A;  4N4N B;  3CMM A;  1J75 A;  2BY2 A;  3L2W A;  2R7V A;  2DOF A;  5GAD J;  2ZNY A;  3K7A J;  4E70 A;  1G3W A;  3FZV A;  2HU9 A;  3DBH B;  2JPC A;  3J7A Y;  3IH4 A;  2HTJ A;  2R7W A;  3HUG A;  4CYC A;  3CCM I;  2LBF A;  1YX5 A;  1IN5 A;  5ILU A;  5HNH A;  1OJL A;  1XGN A;  4CA0 A;  4KMF A;  5KNL A;  4G7H F;  5J4Y A;  3ZP5 A;  3G1L A;  1W7P A;  3FM3 A;  1OR7 C;  1TTY A;  3CUQ B;  3Q0V A;  2X6X A;  4UXN A;  3I59 B;  1BR4 A;  2DOE A;  3K4M A;  4LIU A;  5E1Z B;  2WAE A;  2F2E A;  1M1E B;  3KYD B;  2CFO A;  5F0F A;  1XGM A;  1XC5 A;  1BW6 A;  2QVO A;  1U78 A;  5CVV A;  1D1A A;  5DD4 A;  3RKW A;  4HG2 A;  1R00 A;  3H3Z A;  3J80 Z;  2HFH A;  3D5R C;  3W6J B;  1J59 A;  1DGW Y;  1EH7 A;  2Q2E B;  3RZO J;  4XLE A;  1Z0X A;  3SQN A;  5JVT A;  2IGO A;  2WAQ A;  3NAU A;  5E1X A;  2ID3 A;  5GTI C;  2BZT A;  2IS6 A;  1X4P A;  4XKW A;  1MBJ A;  1UEL B;  1PDN C;  5CJ9 A;  1K6O A;  3HZJ A;  1B9N A;  2LRE A;  2NOG A;  3R0A A;  3C3W A;  2KDZ A;  4Y15 A;  1KQ8 A;  2JPB A;  4P9F A;  4H4K C;  2V9P A;  1JUM A;  1DDN A;  4HLX A;  1U8B A;  2E1M B;  4WCG A;  4QTR A;  4HX7 A;  4MGR A;  2DA7 A;  4IHY A;  4LMY A;  1BC7 C;  3K4L A;  1BI3 A;  2FRH A;  2KRC A;  2JMW A;  3L09 A;  5EG0 B;  3JAM K;  3LST A;  2PEX A;  2A61 A;  2L9S A;  3CF5 F;  3PFY A;  5IYD J;  2ZXH A;  1QPM A;  1YRN B;  2F5F A;  4RAF A;  4P1W A;  4GCV A;  2RAE A;  2HXO A;  2V4J C;  4M71 A;  5HVQ C;  3TKY A;  4E7I A;  3T8T A;  5DD8 A;  3MKW B;  2YX4 A;  4XBF A;  2Y0S N;  3HUG B;  4CYC B;  3DEE A;  2LBF B;  1MMG A;  1EYU A;  4ESJ A;  3T5X A;  1FMW A;  2CUE A;  1X1A A;  2VON A;  1IV8 A;  3LL7 A;  3CCY A;  3OIQ A;  1FBQ A;  2O3F A;  3VWB A;  2DFE A;  4YRV A;  1W7P B;  4IHV A;  4A6D A;  1MBK A;  2ZSH B;  4Y13 A;  5FO5 A;  5E17 F;  2CW0 F;  4I02 A;  4UVB A;  3ZMZ A;  1MND A;  4WF2 A;  3RPU A;  1EF4 A;  3ASO H;  4CCM A;  3RPU D;  1FYK A;  4AU7 A;  2UZK A;  1KU7 A;  2MG4 A;  1NK2 P;  3TW6 A;  3SJM A;  2BY3 A;  4BXU A;  4CDG A;  2XAS A;  3E7L A;  1H8A C;  3OS1 A;  2PBI A;  3MQ0 A;  5M3M J;  3PNY A;  3BPX A;  4AIK A;  4HNT A;  2R7X A;  2IS2 A;  1WH7 A;  2CQN A;  2WAF A;  1ZR2 A;  3W6V A;  3TOA A;  3BZC A;  1JGG A;  1IRZ A;  1I3A A;  3O8H A;  1A6Q A;  1OPC A;  3BC8 A;  3R61 A;  2GXB A;  2LTP A;  2X0L A;  2HDC A;  2WA0 A;  5DCF A;  2L7K A;  1IRG A;  2H8R A;  3FX3 A;  3ZMD A;  4N9H A;  3ZGK A;  1R1U A;  5GPA A;  4LB5 A;  4ZC3 A;  2YX7 A;  5ED4 A;  4JBA A;  3HPG A;  1QRY A;  4A5N A;  2K5C A;  5F04 A;  2A05 A;  2H1K A;  3EPZ A;  1WI3 A;  1RZ4 A;  2ELJ A;  4HQE A;  1QPI A;  2DLL A;  1BW5 A;  2V6E A;  3RI4 A;  5B5E C;  2D45 A;  5CKT A;  2J5O A;  1X3W B;  1X3U A;  2R7S A;  2EQR A;  3GTJ J;  2IS4 A;  5FLX K;  2VLA A;  2DU9 A;  2CV1 A;  3TED A;  1KQ0 A;  2OAA A;  4XKB A;  3OYH A;  3BJO A;  4CYD A;  2PVI A;  4GYG A;  3COA C;  3IHU A;  2HYG D;  3FF5 A;  4ESF A;  1IXR C;  2F5E A;  1Z3Y A;  4HLY A;  3K70 C;  1LPQ A;  1YX3 A;  2XV4 S;  4JK1 X;  3BQY A;  1F0O A;  3PUF A;  1A35 A;  4MFD A;  1JUP A;  3JRD A;  3WHB A;  2EFN A;  4A12 A;  3JTH A;  1F43 A;  1IXC A;  1CQT A;  1RKT A;  2A6H F;  1U9O A;  4PCQ A;  1ODD A;  1WVR A;  4RAY A;  4GDF A;  3EUH A;  1RUN A;  5J1Y A;  4EVI A;  3CCR I;  2MFZ A;  4M73 A;  2KFD A;  3RQI A;  1ZLJ A;  1FOW A;  3WE2 A;  2EIM H;  5FKM A;  3QPS A;  2HOS A;  2VKV A;  2DQR A;  5HDK A;  2Q0O A;  4D1Q A;  4BXX J;  3H9Q A;  2CUZ A;  2VPR A;  5FFZ A;  1DPU A;  2NYX A;  3M8F A;  1H89 C;  4R79 A;  1HSJ A;  3CDH A;  2RRE A;  3PNT A;  4RB1 A;  5IOY A;  2VPL A;  2VOP A;  2KHM A;  2HQA A;  3IH3 A;  4FT8 A;  4HEA 2;  2IP2 A;  4Q4Z F;  2ZBK A;  3CO7 C;  6PAX A;  1FTT A;  3OOU A;  3PSI A;  3UKG A;  1FYM A;  1ETO A;  5ICG A;  3GTK J;  2AQF A;  2HDD A;  1PUE E;  4NHJ A;  3LSK A;  3HTU A;  3KYL A;  2EA2 A;  2R7F A;  1MBE A;  3FXK A;  4BDY A;  2E35 A;  3H35 A;  2K7L A;  1H56 A;  1S7A A;  4S0H B;  1BA5 A;  1D5V A;  2OF7 A;  1XG1 A;  1GLN A;  1SMT A;  1YQA A;  4IQ4 A;  4B44 A;  2OZU A;  1N77 A;  2EIL H;  3DKX A;  4HX8 A;  2M45 A;  2XSD C;  1VQO I;  2JVH A;  2L9N A;  2AQE A;  4FQG A;  4EM2 A;  1LEA A;  1AWC A;  5JR3 A;  2Z33 A;  4IHT A;  4HQM A;  1Z21 A;  2BOL A;  2QF7 A;  3PM1 A;  1ETK A;  3JRC A;  1GXP A;  1T6S A;  2DTR A;  4ESB A;  1O57 A;  1UJ8 A;  4E4H A;  4B43 A;  3DLA A;  1NI0 A;  2CO5 A;  3CQZ J;  4AYB N;  4U7D A;  4L0Z B;  3DLL F;  2M87 A;  2R7O A;  1W5T A;  4LOC A;  5GAG J;  4LK0 F;  2L4M A;  2VT3 A;  3S2H J;  4R8H A;  1IRX A;  2G7U A;  1SFU A;  3ISP A;  2WBM A;  5BOX A;  1LDK B;  3M1E A;  3PSF A;  3V8J A;  2H09 A;  1AA7 A;  1R4M B;  2UXN A;  3EDP A;  2KIS A;  2KLO A;  3FXU A;  5M3F J;  1BOB A;  3MEX A;  3V8K A;  2LSO A;  2CQQ A;  4CSW A;  1V5G A;  3P5J A;  2E2J J;  4HAM A;  2A07 F;  2O61 A;  3E6B A;  5DDG A;  1KYZ A;  5K7F A;  4JYK A;  3F9K A;  2W82 A;  2DAO A;  2CG4 A;  4KIG A;  1KZH A;  3BR0 A;  3JR9 A;  1XCB A;  2GZW A;  3PQJ A;  3S1N J;  3BRO A;  2H6B A;  1VF9 A;  1FBS A;  3OIO A;  1H0M A;  1SAU A;  4P96 A;  5M5Y J;  2EPF A;  3AG3 H;  2ETH A;  2P4W A;  2Z99 A;  3DU6 A;  3UR3 C;  4UY8 I;  4UB6 C;  3J7Y J;  4EGY A;  2FMY A;  1X3Z B;  2VC0 A;  3KLN A;  2K40 A;  4MQV A;  1WKM A;  2E60 A;  3ZRG A;  1R23 A;  2DDB A;  2LC2 A;  3HHH A;  1ZK8 A;  3JRH A;  3LSI A;  2KJB A;  4U0Y A;  4XR6 A;  1FEX A;  2WV0 A;  3K69 A;  4IHW A;  2WAQ N;  4RGR A;  3WTT C;  1JE8 A;  1IDY A;  1ITY A;  4FIS A;  4ABZ A;  2F4I A;  1X4O A;  4CZZ A;  2EK5 A;  3ERM A;  3K10 A;  4S04 A;  4XL9 A;  3A2K A;  4ASN A;  1PJR A;  1A04 A;  5LRR A;  4HDU A;  2LK2 A;  1B9M A;  2XF7 A;  1LFB A;  4XLF A;  3L1P A;  1W36 D;  3OYE A;  2VQG A;  1S7O A;  1MGT A;  4IRH A;  2P5V A;  1MMS A;  1KU9 A;  5D5U B;  4G6Q A;  5J47 A;  1QHG A;  1UHS A;  3ZQQ A;  1JHF A;  3S2D J;  2LNB A;  4BH9 A;  4I99 C;  3BR5 A;  4B48 A;  1WCM J;  1WJB A;  3QWL A;  3VYR B;  3WTU C;  4H0E A;  4Q5S F;  3NEU A;  1ZR4 A;  4A3I J;  5JHF A;  3OYL A;  2CU7 A;  2E36 A;  3J7Z I;  5CQE A;  1XS9 A;  1Y1W J;  2JUC A;  1P4W A;  2HOE A;  1TZL A;  2OTJ I;  3RQ4 A;  4ZZL A;  2EZK A;  3FMR A;  3S3N A;  3TL4 X;  1BI0 A;  2VE8 A;  4IKF A;  4KN4 X;  2ZB9 A;  1A5J A;  4OMZ A;  3PVI A;  2IVM A;  1K78 A;  3GFL A;  2R7Q A;  2QSH X;  4ITV A;  1E3O C;  3CUQ C;  3GO5 A;  1HKS A;  4U88 A;  4YFK F;  3OY9 A;  4ZZD A;  4YFX F;  2MAB A;  4MEX F;  5FLV A;  2QQ9 A;  2V79 A;  1NK3 P;  2ZCW A;  3RZD J;  1MKM A;  5CVJ A;  3OL3 A;  2IA0 A;  1F36 A;  3L2R A;  1JHH A;  2KIU A;  2L7F P;  4PSW A;  3ZQI A;  3GEZ A;  2M7A A;  2O03 A;  1BI2 A;  4Y4R A;  4FHT A;  3O2P E;  1TQM A;  2LFB A;  4BQO A;  1AHD P;  3A03 A;  4IRG A;  1EH6 A;  1O3Q A;  3WE3 A;  1FMV A;  5HLT A;  3CCQ I;  5KVR A;  1BBY A;  3OYF A;  4BHC A;  3AG4 H;  1IXS B;  1T33 A;  1EKE A;  4DGW B;  3C1D A;  1RC9 A;  3F22 A;  3MCZ A;  1MZB A;  3GF2 A;  1SFO J;  4IF4 A;  2YU9 J;  1IUY A;  3ZXS A;  3ECH A;  3H92 A;  1EV7 A;  1BJZ A;  2NAZ A;  3M4O J;  2UWM A;  4XQF A;  2A6T A;  2E1M C;  3BR3 A;  4G8X A;  1ZLK A;  4DZJ A;  1DUX C;  4B8X A;  1WHU A;  2XPW A;  1AKH A;  2QBY A;  4HST A;  2K4B A;  4A6E A;  1J2X A;  3CZ6 A;  2XSJ C;  3CP8 A;  2E2H J;  2V9V A;  1Z1D A;  2K4J A;  3ZQ7 A;  3FXM A;  4BY7 J;  3F72 A;  2E7W A;  1VFC A;  3AL0 B;  1IN7 A;  3K1N A;  3KX2 A;  2C6Y A;  3CC7 I;  3S17 J;  3E3V A;  1K0Z A;  1YYV A;  4A3J J;  5K1Y A;  4ZDP A;  4L5I A;  4E7K A;  4GO1 A;  5KK1 A;  3HSR A;  1K4S A;  1UAA A;  2OJE D;  3OWT A;  3L9F A;  2XAG A;  2P7C B;  1K78 B;  2W00 A;  2L9R A;  4ENK A;  3ONQ A;  3CO6 C;  2E1O A;  1ZAO A;  3K4N A;  1HOM A;  3ZMU A;  3GTQ J;  4WWC A;  2GA2 A;  2V1N A;  3A01 A;  2Z9O A;  2JN6 A;  4BJT A;  2K3P A;  1T38 A;  4DBQ A;  3FHZ A;  4ZYA A;  3RIR A;  1R71 A;  1VQ5 I;  1OCO H;  4NNJ A;  1YIT I;  2O0Y A;  3HPH A;  3M9A A;  1DP3 A;  1X1C A;  3V8L A;  2CH0 A;  2FE3 A;  5EZG A;  3TW7 A;  1WJA A;  3DV8 A;  2X51 A;  4XSZ F;  3S1R J;  4BEH B;  1FIA A;  4KIS A;  3E5Q A;  1FP1 D;  1W5S A;  5HNF A;  1IV6 A;  4QSH A;  1TL8 A;  4PJL A;  3KP4 A;  3CMY A;  3M1C A;  4XOR A;  1HW1 A;  2HZT A;  3SYT A;  1OYY A;  3HIF A;  1B8I A;  1O3T A;  2JA5 J;  2FML A;  3HSE A;  4A3G J;  1H9G A;  1YOV B;  2IW5 A;  4AWX B;  2RV8 A;  4ZYE A;  1U6G A;  4L9V A;  1UMQ A;  4A3B J;  2WTE A;  1V54 H;  2FXA A;  4BKX A;  5JFR A;  2V9K A;  4IX7 A;  3F6V A;  2QEX I;  3U2R A;  3WU1 B;  4NUB A;  3AKZ A;  1MJB A;  2EFQ A;  2QBY B;  1UZC A;  3VOE A;  2EIN H;  3ABL H;  4IZZ A;  4ZTJ A;  4LGW A;  4GFB A;  1ZRF A;  2VOO A;  1FPQ A;  3E6C C;  5FKN A;  2L0K A;  2LDU A;  5IY5 H;  1D8J A;  1XD7 A;  1JJ6 C;  4U7B A;  5E20 A;  4FTH A;  3WTS C;  1S8N A;  1HF0 A;  3HM5 A;  1OKR A;  2KJC A;  4B47 A;  4Y52 J;  4DIQ A;  2PG4 A;  2L54 A;  3CTA A;  3T8R A;  1YO5 C;  3M8J A;  3GVA A;  1IC8 A;  3SDB A;  2LKS A;  2E1C A;  1I39 A;  1B72 A;  3RSN A;  1POG A;  1E3H A;  4IEJ A;  1XDS A;  4FX0 A;  4PSX A;  5LEJ A;  2DPU A;  2DQL A;  3G71 I;  1CGP A;  2HGC A;  3IUO A;  3DBR B;  5HLG A;  5LEK A;  4I6Z A;  2FUG 2;  4RBO A;  4DJA A;  1FC3 A;  1Y8R B;  2VI6 A;  3L7W A;  3ZMT A;  1LJ9 A;  2HYF A;  1W0U A;  1U8R A;  1Z05 A;  1P7I A;  2DDA A;  2L9V A;  1U0J A;  3A01 B;  2ODI A;  3GLL A;  3C7J A;  2DTZ A;  3DTK A;  2NNY A;  3FDY A;  1ZHF A;  4ZYH A;  3FIS A;  4ZDO A;  5IT3 A;  2NVY J;  2XRL A;  3IKV A;  1LQ1 A;  1GXQ A;  2PMZ A;  1C0W A;  5DYM A;  5JLW A;  5L3E A;  4XLA A;  3RPQ A;  3LSH A;  3G4S I;  3GFI A;  1I1S A;  5D6E A;  1A36 A;  1ETY A;  4F52 A;  1FOX A;  3CDI A;  2XPU A;  2K85 A;  3IRR A;  4AM3 A;  1Y1V J;  3R60 A;  2ZNZ A;  5GP9 A;  1B8I B;  1BC8 C;  2HOA A;  4BYY A;  3C2H A;  1GVD A;  4BU2 A;  1R22 A;  2VQL A;  3RJP A;  4KA4 A;  2AS5 F;  4JX4 A;  2GXA A;  1H9T A;  3RKQ A;  4YG2 F;  4AVZ A;  3SFI A;  3O3K A;  3M07 A;  2JSP A;  3BOQ A;  3WTY C;  1I5Z A;  2XF6 A;  3WGI A;  4A3D J;  3DEW A;  4B4C A;  3ZR8 X;  2L01 A;  2HDW A;  3HOX J;  4X6A J;  2P5L C;  4AD9 A;  5IT9 Z;  5LLQ A;  3GBG A;  3F6O A;  4M9S A;  1G3T A;  4CCN A;  3W2V A;  1SAN A;  4ZJZ A;  2K02 A;  2Y31 A;  3EYI A;  4W97 A;  4NC8 A;  4DYQ A;  2VJ4 A;  4HA8 A;  4P55 A;  1Z77 A;  3IAM 2;  3TQN A;  4DZP A;  5B66 C;  2ZJQ F;  3WTV C;  1V55 H;  1MJ9 A;  1HC8 A;  1MH4 A;  2JK3 A;  2R5Y A;  2I10 A;  3I4P A;  4N4O B;  1FSE A;  3Q3S A;  3LNQ A;  3JRB A;  4UUS A;  3ABT A;  4KNY A;  5IP9 J;  4PFO A;  3SEZ A;  3OYM A;  2DJN A;  2W1O A;  3H3U A;  3OYB A;  1BI1 A;  3LWF A;  1MDM A;  4DQ2 A;  3GME A;  2RDP A;  1XSX A;  4MIM A;  5BPI A;  2VAS A;  2O8K A;  2F5D A;  1K83 J;  4D5F A;  5A2Q K;  3ABU A;  2B7E A;  4ENN A;  3QYE A;  2LRD A;  1XPX A;  2EA4 A;  4BS9 A;  2M8E A;  2VUM J;  1RR8 C;  3HOY J;  3EUH C;  3DBL B;  5E79 C;  1PVE A;  3V7C A;  2ID6 A;  4RAG A;  1D0X A;  4YEJ A;  1E0E A;  3I53 A;  3LSJ A;  4RLF A;  4EJO A;  3TBI A;  2ZKZ A;  2H27 A;  4U0V A;  4XID A;  3IKT A;  2K27 A;  1HKQ A;  1XTA A;  3BR6 A;  3BTC A;  3J81 K;  1T2K A;  1FTZ A;  4ZTF A;  5K5O A;  3H5R A;  3WTX C;  3VYS B;  3I71 A;  3HYI A;  1BJA A;  1TWF J;  3NQO A;  4MO7 A;  1P4X A;  2BW3 A;  2P81 A;  5EEG A;  2PN6 A;  5K5R A;  1T8I A;  2VJ5 A;  1F5T A;  5K7Z A;  3BZK A;  1I50 J;  2ZO4 A;  3WU2 C;  4L9T A;  2AXT C;  2V1U A;  4HNV A;  2DMU A;  4ZDL A;  3P9I A;  3SZG A;  5LD2 C;  5J8C A;  3BG9 A;  1JI8 A;  2L5Q A;  3DPT A;  3OYA A;  2STW A;  4U87 A;  5TIS C;  2R93 J;  1IRF A;  5DUI A;  3ZQC A;  1LDJ A;  1YJN I;  2DOA A;  3KZY A;  2E71 A;  5IPA A;  1WZ2 A;  2L02 A;  1MIJ A;  1B4A A;  1YS6 A;  2QGU A;  4L5J A;  3P9K A;  3JRA A;  2VJI A;  4XN3 A;  5AIP A;  4RA2 A;  5FB2 A;  1YJW I;  3CDL A;  3D5L A;  4LLN A;  2EJR A;  2R5Y B;  1J09 A;  3FK7 A;  4KN7 X;  4YEL A;  3WGG A;  3OOP A;  4DNC A;  3OYG A;  3GTM J;  2OUM A;  5D8K B;  4UB8 C;  4UUS B;  3FXQ A;  5C4J J;  1ONV A;  2MW8 A;  1RES A;  4I2O A;  1VQL I;  2EIK H;  2MD0 A;  2MA3 A;  2Q10 A;  3DP7 A;  1WGX A;  4O5V A;  2Q1Z B;  2PI0 A;  4LG0 A;  1MDM B;  4WXC A;  4C2M J;  4P9U A;  2FA5 A;  5DM6 F;  2HEO A;  2QLZ A;  1H88 C;  1YIO A;  1IJW C;  4BUP A;  4NC7 A;  2KPM A;  2MLK A;  5DV5 A;  5GPC A;  1VTN C;  1S9H A;  2KP6 A;  1TWA J;  4G6D A;  4BHB A;  3LA2 A;  4A3F J;  1OCP A;  3GWZ A;  3KFW X;  4L5E A;  2DXI A;  4IJA A;  2STT A;  1RKW A;  4QIW N;  3KZI C;  1I3Q J;  3CCU I;  4XLP F;  3U1K A;  3ULQ B;  5EEA A;  4A0Y A;  2OQG A;  2OU2 A;  1XMK A;  4L18 B;  3IH2 A;  2A3S A;  4Z2Y A;  1XDU A;  2JUG A;  4G7O F;  1AU7 A;  2DT5 A;  3K2Z A;  3DEU A;  1MBG A;  1USS A;  2IEK A;  2W84 A;  1R49 A;  2HNH A;  4FE7 A;  1I27 A;  2EV0 A;  2DK8 A;  1U3E M;  2BW3 B;  4X0G A;  3LOC A;  2COB A;  1VQ9 I;  4C2T A;  2YPR A;  5HS8 A;  2OCE A;  2KRF A;  3RYR A;  2R4G A;  4AVP A;  3WTZ A;  1FYL A;  1R5G A;  4LJZ F;  2MGQ A;  4XK4 A;  2KT0 A;  3IAS 2;  2V7F A;  3QOD A;  3R6S A;  1JT0 A;  2NVT J;  1ETQ A;  3A0B C;  4M3D A;  3D1N I;  5EGO A;  1E17 A;  5KAI C;  2IS1 A;  1ZRE A;  2EH3 A;  2LP0 A;  2WB1 A;  1R9T J;  2YS9 A;  4G9Y A;  2F4M B;  2VBY A;  3KE2 A;  3LQQ A;  1Z9C A;  3OV8 A;  3WTW C;  2GLO A;  5D8L B;  1JKQ C;  3KEQ A;  3QYB A;  4BBR J;  3JRF A;  1ZRD A;  4RLQ A;  1OMI A;  3QU6 A;  5TJJ A;  5KHD A;  2MSY A;  1QNT A;  2LR8 A;  1WJC A;  1ZEL A;  2KZV A;  3AG2 H;  2XIG A;  3PUB A;  2H8W A;  2JRM A;  4BE2 A;  1HST A;  1XCV A;  2KIM A;  1OQY A;  1D5Y A;  3I3L A;  3V7R A;  1V4R A;  2M9H A;  2A69 F;  3OL4 A;  4A3K J;  2VBZ A;  3J80 K;  2OCC H;  1G8X A;  3SHF A;  1W4M A;  2GIZ A;  1MNM C;  4LG0 B;  1FIP A;  2ESH A;  2QKM B;  5FFX A;  5E3L A;  2UUZ A;  2QQB A;  2EBI A;  1DP7 P;  3GUD A;  2TDX A;  2X48 A;  2NVQ J;  2VOD A;  3TP3 A;  1IN4 A;  2M1B A;  4EQQ A;  1BN5 A;  3H0G J;  4YII A;  2W7N A;  4BBS J;  2IBD A;  2YSR A;  4TV7 A;  4BY1 J;  5CLS A;  3H5N A;  2VL8 A;  5FKL A;  3K1M A;  1QZZ A;  2FQ4 A;  3VFZ A;  3AL0 C;  4YIF A;  1PUF A;  3K4K A;  3S1Q J;  3W3C A;  4IHS A;  4UHT A;  4Z6Y A;  1FLI A;  3DF8 A;  1ZYR F;  1APL C;  2ICW G;  3CCV I;  3GFJ A;  4MFE A;  3OYJ A;  3Q0U A;  4OIO F;  4XOT A;  5CVU A;  2OTL I;  2R92 J;  3B02 A;  2TCT A;  4M74 A;  4BNC A;  3R4K A;  3IWZ A;  5IP6 A;  4KIT B;  3CJQ B;  1U5T A;  3F3X A;  4JP0 A;  4MTE A;  4IL6 C;  3VYT B;  2V6C A;  2DW4 A;  1Z67 A;  3F8M A;  1ETW A;  3AG1 H;  5B1B H;  2EFW A;  5EEH A;  2RVC A;  2D2W A;  3K4J A;  1RIO H;  2WAD A;  3O6B B;  4LK1 F;  1RI7 A;  1SVL A;  5EGO B;  4HYE A;  3CME I;  2HOT A;  3F0C A;  2PJP A;  2XUB A;  3DFG A;  4M72 A;  4WK8 F;  4NBQ A;  2NVX J;  4RDU A;  3I56 I;  3S16 J;  5JHU A;  2F6C A;  1LE8 A;  1HW2 A;  2GIV A;  2PMZ N;  4S05 A;  5F64 A;  2AHQ A;  4QPQ A;  1XGO A;  3BT9 A;  4PDK A;  1TQP A;  3SXY A;  3G73 A;  2OA9 A;  2M3A A;  3JTG A;  4I7H A;  5BS6 A;  1O3S A;  3BZ6 A;  3ZQH A;  4I76 A;  4A2U A;  3KEY A;  4MQ9 F;  1MBH A;  2XVC A;  3AFH A;  4HRI A;  5K7H A;  1X58 A;  1TW3 A;  1ZG5 A;  3HL2 A;  2FF4 A;  1LKX A;  4M3B A;  3HSF A;  1FNN A;  2XPV A;  1VQ4 I;  4EEF G;  2X6W A;  2X1C A;  3ZQG A;  1F1Z A;  2JSC A;  3BG7 A;  3IRQ A;  3ESW B;  4J19 A;  5EDN A;  2RNJ A;  4HDV A;  3HRS A;  4PGG A;  2DMT A;  1Q1H A;  3OYD A;  1NH3 A;  2G9W A;  2E2I J;  3KZZ A;  4C30 A;  1RPW A;  2Y9Y A;  3S2W A;  4HZF A;  1IUF A;  4JQF A;  1LFU P;  1DPR A;  3TO9 A;  3VPR A;  1Y0N A;  4E7S A;  1G2H A;  3HOU J;  4CIC A;  1U5T B;  4OIN F;  5JLX A;  2WV1 A;  1YW8 A;  5J4V A;  3MWM A;  1Y56 A;  5FD6 A;  4CXF A;  4ON0 A;  3REO A;  3U9G A;  4BAC A;  2XB0 X;  3MVP A;  5HS7 A;  4CCL A;  2FSW A;  5D5V B;  5JVG F;  1YFH A;  4WXD A;  4XN0 A;  4PJN A;  2XRN A;  3GTG J;  3MAJ A;  4RB0 A;  3K6G A;  1KA8 A;  4XKV A;  3JCU C;  2X9D A;  1TNT A;  1ZAR A;  3QYF A;  3D0S A;  4DYC A;  3PO3 J;  2P7V B;  2BHY A;  4KDP A;  3OR2 C;  2OBP A;  3HHG A;  5FRM A;  2HZD A;  2UXX A;  1IF1 A;  4A3C J;  4UV9 A;  1VQP I;  3S3O A;  3A02 A;  2CYY A;  3WG7 H;  1QVT A;  1LE8 B;  2VJJ A;  4L9N A;  4CCJ A;  3ELK A;  1KYW A;  3TOB A;  4I0B A;  1UCR A;  2OV7 A;  1OIS A;  1ERD A;  5H6R A;  4GRI A;  3GTO J;  2XAH A;  4XSX F;  4EJU A;  3HRM A;  4PGH A;  2EZI A;  2K3F A;  2LKP A;  2FQ3 A;  4C9Y A;  1FP2 A;  1OCR H;  3SZT A;  3KCC A;  3TGN A;  1BR2 A;  3ZN0 A;  4AIJ A;  1FY7 A;  2R7D A;  2LH9 A;  2CQX A;  1VI0 A;  3F21 A;  1GV5 A;  2QCO A;  3BWG A;  3Q9S A;  3G2B A;  4RB2 C;  1IGN A;  2KRH A;  1ULY A;  3CJR B;  2WC2 A;  3FKI J;  2DOD A;  4QPO A;  1REP C;  2ZJ2 A;  4XMY A;  4M6V A;  3HKZ A;  5CPR B;  1G3Y A;  4IOA F;  2Y2Z A;  2EZL A;  4BL0 B;  2LD5 A;  5BPD A;  2PJR A;  2K9M A;  3BLY A;  4FET A;  2ACJ A;  2N8G A;  1IZ1 A;  4JX6 A;  2W85 A;  1KON A;  5LFA A;  1YTY A;  1IG7 A;  2FNA A;  3BR1 A;  1J7K A;  2HVQ A;  3I58 A;  3LA7 A;  3O8G A;  1QBJ A;  2CGP A;  4IOC F;  3E97 A;  3DPL C;  3HEF A;  1QZY A;  2DCE A;  4EJT A;  4MLO A;  2ZSI B;  3BCA A;  1XMX A;  2FEZ A;  2ISY A;  5GAE J;  4IO9 F;  4L0Y B;  4A5M A;  2LY9 A;  1MSE C;  3HGG A;  3B6A A;  4P5O A;  3JSO A;  1P92 A;  4GYI A;  3EUK L;  5CYV A;  3WHC A;  1X1B A;  1XN7 A;  1Z7U A;  4F3Q A;  2Z1D A;  3QPH A;  4LLG F;  3WG9 A;  1LVA A;  4M9X A;  5EF6 A;  2M0C A;  4D0P A;  3GCM A;  2L4A A;  1UHM A;  2F5V A;  3H0D A;  3WGH A;  1HXD A;  1WJE A;  2YU3 A;  3F8C A;  2CFX A;  1JUS A;  1ZG1 A;  1WH5 A;  3CP2 A;  2CSO A;  3I4N J;  1TP4 A;  3QOP A;  1U2W A;  3CCS I;  2BXY A;  2DI3 A;  1N75 A;  4DBR A;  1ETX A;  3K2A A;  4EMS A;  4BE0 A;  5DTD A;  3DCF A;  3RTR A;  2XRO A;  1ORK A;  2FNP A;  1UG2 A;  2HS5 A;  4RGS A;  3GX4 X;  2LVS A;  2ZJR F;  2Y75 A;  3JRG A;  3MKY B;  3JW4 A;  3OSG A;  2DFF A;  1KGS A;  5J6X A;  2JRT A;  4PJJ A;  4KJZ A;  5K5Q A;  3CF2 A;  1A31 A;  3QQA A;  2RNG A;  5CVR A;  3W2W A;  2MD5 A;  2DA2 A;  1HCR A;  3KPH A;  2XAQ A;  3M7G A;  1XGS A;  1MH3 A;  1Y6I A;  2FU4 A;  2XKP A;  3JAM Z;  2JA8 J;  1I6H J;  1D1B A;  2HQ5 A;  4U0W A;  1NHA A;  1BOA A;  5HS9 A;  2PJR B;  4D5C A;  2WB1 N;  2DA1 A;  5B3S H;  3VDX A;  3L2U A;  1T39 A;  4Y33 A;  2DO7 A;  1X1D A;  2QQA A;  5JI6 A;  1TT0 A;  2Y30 A;  2M4K A;  3CJN A;  1SAX A;  4Y17 A;  2H1L A;  2COM A;  2OD5 A;  3GW2 A;  3RKY A;  4AIH A;  1EJ9 A;  2PQ8 A;  3WOD F;  2IXS A;  5F1R A;  1PYV A;  3KEO A;  2NXN B;  3FXL A;  3K9T A;  3B73 A;  5FGM A;  5E8I A;  4PJM A;  3LFU A;  2FD5 A;  1FT9 A;  4YFN F;  1AKH B;  2DYS H;  3EUA A;  5L3G A;  5FRO A;  2HPM A;  3SDG A;  2BY0 A;  4G7Z F;  3S1M J;  1N78 A;  2K86 A;  4R1H A;  3BTL A;  5IOZ A;  2BBY A;  2YUS A;  2LYC A;  2P8T A;  2IGK A;  4Q48 A;  3MKL A;  2JTV A;  1VQM I;  3FMQ A;  4KIC A;  3I59 A;  1VQN I;  2YR2 A;  5E3N A;  1LDD A;  2FX0 A;  4A69 C;  4Y7N J;  1HDD C;  1Z7L A;  2TRT A;  4RMN A;  2HVS A;  2ZXI A;  1FOK A;  1MBF A;  2XF5 A;  2HQN A;  1XSD A;  3FK6 A;  3QPL A;  2LLK A;  4A0X A;  1ZKG A;  4LIV A;  1EH8 A;  2VN2 A;  5KCM A;  3F8B A;  4CCO A;  3ZQL A;  3N4M A;  1CF7 A;  1AOY A;  1UHW A;  3R0J A;  5ICE A;  1TWC J;  4HBL A;  4I98 B;  3FXJ A;  3PIP F;  3ZPL A;  3PFI A;  3KP3 A;  2DBB A;  2MC3 A;  2VBW A;  4BJ6 C;  1MMD A;  5FLX Z;  4AYB A;  2JT1 A;  1L0O C;  2X85 A;  1B59 A;  3ZQF A;  4C3I J;  5KAF C;  4C3J J;  4EJW A;  3NRV A;  4BE1 A;  2AXL A;  3ZMS A;  5L3B A;  3HDD A;  1YLF A;  2LF8 A;  1TBX A;  3K1P A;  2IGM A;  3HG9 A;  5LBQ A;  2BHZ A;  4KIB A;  4B09 A;  2MLG A;  1TC3 C;  1WWX A;  5EZH A;  3DQV C;  1YI2 I;  2D5V A;  2FOW A;  2W57 A;  3CCL I;  3HBL A;  1BIB A;  3BDD A;  3ZN1 A;  5ICC A;  2R7T A;  4XRS G;  1HLV A;  2O6G E;  3I4M J;  4ZYD A;  4QLC U;  5DM7 F;  1P4A A;  3U1D A;  3LAJ A;  2GAU A;  3DU5 A;  2ME0 A;  1S7E A;  1O4X A;  5F08 A;  4NC6 A;  1SFK A;  2ESN A;  4HF1 A;  1A6I A;  1K79 A;  2ZME A;  4ZYG A;  3NWT A;  2CWE A;  2ZFW A;  3GLX A;  1Z6R A;  2NS0 A;  4PFP A;  1SEU A;  1LFP A;  1Y0U A;  4I0A A;  1B72 B;  1W7P D;  1V5F A;  3MZH A;  1G6N A;  2VQH A;  2X1E A;  4B3X A;  4EM1 A;  1E2X A;  3CCJ I;  3BTI A;  3KYC B;  1RR7 A;  2MH9 A;  4G6T B;  2XC7 A;  1QQI A;  1QO0 D;  2QSF X;  3CC2 I;  2DFH A;  1PP8 F;  3SEQ A;  3E6D A;  5E18 F;  3ZCO A;  3NWS A;  1CF7 B;  3BP8 A;  1OLT A;  3BJA A;  5D4S A;  5HLH A;  4HPQ A;  4V2F A;  1QA6 A;  2HWV A;  3CLO A;  2Y69 H;  4D7M A;  5D4R A;  2K9Q A;  2K9S A;  3H9J A;  4E7H A;  3RDI A;  1R1T A;  3LSP A;  3UNG C;  2OQR A;  2L7M P;  2GBY A;  3M3Y J;  4ENM A;  2EV5 A;  3BG5 A;  4XKC A;  1PVI A;  4E7J A;  3LFK A;  2KQR A;  1YJ9 I;  3L2Q A;  2IRF G;  1G3S A;  3RYP A;  5FRN A;  2QSG X;  1X19 A;  2BXZ A;  4NDL A;  1ON1 A;  2BV6 A;  5FLM J;  2CW8 A;  3PIO F;  5F6F A;  3HXL A;  3ABK H;  2XAU A;  1D8K A;  2JZY A;  4ZH4 F;  1VZ0 A;  1UB9 A;  2PLY A;  4HF2 A;  4WX9 A;  1VQK I;  5J8F A;  2ELK A;  2OC6 A;  4GXO A;  1EA3 A;  1O7L A;  2CS3 A;  1ZGA A;  2OZ6 A;  2GQQ A;  3E5X A;  4XLC A;  5F0C A;  1DU6 A;  1S3J A;  4Q47 A;  2KDO A;  5C44 J;  1Z3X A;  2OAZ A;  3BTJ A;  1MJA A;  2M30 A;  1PP7 U;  3H36 A;  3N05 A;  5IYC J;  2OA4 A;  2Q8K A;  4IXA A;  3OYC A;  1O7F A;  1T0F A;  4B3A A;  4RGX A;  2LG4 A;  3BR2 A;  4GGG A;  3FM5 A;  1BL0 A;  4W1U A;  3DTI A;  3ZMV A;  2FBH A;  4N9I A;  1W1W E;  1FZP B;  3BCB A;  1D1C A;  3K4B A;  1W5C C;  1MMN A;  3ASN H;  5E3O A;  2ZME B;  3FXO A;  3FBI B;  3JSP A;  4C3H J;  3HKZ N;  3TO7 A;  1YS7 A;  3OSF A;  1JTX A;  3JRI A;  2FJ1 A;  3SFZ A;  4F55 A;  4NQW A;  3BPV A;  4OOI A;  4RAZ A;  5DEQ A;  4RB3 C;  1L3L A;  2NOJ B;  2ADU A;  2HPI A;  4JOM A;  1YW9 A;  3GYH X;  3AAF A;  4RM2 A;  3HOW J;  3N97 A;  3V7S A;  4HV5 A;  4K2E A;  2HXI A;  1HA8 A;  2GWR A;  2JA2 A;  5E8G A;  4CO8 A;  2V1D A;  1P2F A;  2DYR H;  2O7O A;  5CQG A;  3LQR A;  1U5T C;  1RRJ A;  2V1X A;  4MNU A;  2XDV A;  4EGZ A;  1DQU A;  2EIJ H;  2OPT A;  3HGY A;  2BY1 A;  2KIF A;  3FMS A;  3KP7 A;  3HRU A;  4CCK A;  5FKO A;  2VKH A;  4ENJ A;  1O3R A;  2DJI A;  2K9L A;  2O5R A;  2H6C A;  1OCT C;  4FAS D;  5LHI A;  1GUU A;  3A1Y A;  5TRD A;  4M6X A;  1ON2 A;  1OR7 A;  1R1V A;  4DW6 A;  1SVM A;  2QYO A;  1TWH J;  2PMU A;  3BJ6 A;  2IGN A;  2O8X A;  1LB2 A;  2DMN A;  2QM3 A;  1S72 I;  4HV6 A;  2XAJ A;  3S14 J;  2PFB A;  2ISZ A;  2L2O A;  4JX5 A;  5ERI A;  4BDZ A;  3EYY A;  4V19 K;  4XIC A;  2VT2 A;  3FBN B;  3OIP A;  3L2V A;  3IP4 B;  2DA3 A;  4J00 A;  3RKX A;  3I9V 2;  2NNN A;  2I8D A;  1STZ A;  4LD5 A;  4LIT A;  1LEB A;  2LF7 A;  2RC4 A;  2B9S A;  4UUT A;  5C3E J;  2CW7 A;  3GZN B;  1ZG3 A;  4M6Y A;  1MNE A;  4AUX A;  3OYK A;  3LSR A;  1XSV A;  1HKT A;  1DGR M;  4WXH A;  4RM3 A;  2AO9 A;  3H1C A;  3QAH A;  4XRF A;  1TW2 A;  2DT7 B;  1R6R A;  4M3F A;  3CD6 I;  1R58 A;  2JJ7 A;  1SFX A;  3A0H C;  4DYR A;  2P6T A;  4O3M A;  1MW7 A;  2RGV A;  2ECB A;  2BE5 F;  3EQL F;  2F5C A;  4E7Z A;  4AID A;  1N25 A;  3GTP J;  4OIP F;  1P7J A;  1WJ5 A;  4NQW B;  1YIJ I;  2XGE A;  3I54 A;  3RCO A;  3DXJ F;  5EYR A;  4UUV A;  5IT9 K;  2HQR A;  4AC0 A;  1JGS A;  1W0T A;  2I5U A;  2MYS A;  2BVM A;  3ERE D;  5J1U A;  2VKE A;  3HRT A;  3GZ5 A;  3VEP A;  1W36 C;  1ENH A;  2NS8 A;  5H2F C;  2FBI A;  2HKX A;  3LAP A;  2W24 A;  3QP6 A;  3IV5 A;  1XB4 A;  1VQ7 I;  2M4G A;  4HSR A;  4YIR X;  1ZQ3 P;  2RKH A;  1B6A A;  2A5W A;  1ZH5 A;  4XOP A;  5L3F A;  2Y48 A;  4B1R A;  2W25 A;  1HQC A;  1JJ8 C;  2R7U A;  1U9N A;  4OMY A;  2BGC A;  1WRJ A;  3PNV A;  5B1A H;  3U21 A;  4CZC A;  2XB5 A;  2ME6 A;  1FWZ A;  2VB6 A;  1FSH A;  4F91 B;  3OMY A;  3ROU A;  1K6Y A;  3W2A A;  4E6K G;  1OFC X;  3E6M A;  2VKD A;  2E5Z A;  4OAY A;  1TWG J;  3TO6 A;  1ZGJ A;  4IPA A;  4LG3 A;  2DK5 A;  3HC7 A;  2MBF A;  2QEN A;  2JWT A;  4CH7 A;  1IDZ A;  4D7N A;  5LGU A;  2QQ8 A;  1FX7 A;  2EV6 A;  1F4K A;  3CC4 I;  4G12 A;  3FHN A;  3G3Z A;  4NB5 A;  2RQQ A;  5F1J A;  3CES A;  3KIO A;  5FD5 A;  3E5U A;  1VQ6 I;  2JA6 J;  5HLI A;  4FX4 A;  4I01 A;  1WJD A;  4PUS A;  3F23 A;  4FE4 A;  1KU3 A;  2XHK A;  2CQ7 A;  2RQP A;  2VXD A;  1Y8Q B;  1IAW A;  1GDT A;  4J01 A;  4A93 J;  1SFE A;  2DA4 A;  2VXZ A;  2EFP A;  2VC1 A;  2ZXJ A;  2E34 A;  4EAT A;  2NS7 A;  3PJR A;  4FCY A;  1D0Y A;  2HKO A;  1G4D A;  4KIF A;  2FOK A;  1G59 A;  2QUF A;  4PZJ A;  4PJ0 C;  1K61 A;  1QGP A;  3CMA I;  2M7B A;  4A0Z A;  1VND A;  1T56 A;  3KET A;  5D6F A;  1ZRC A;  3T1B A;  4F7Z A;  3H5A A;  2K9N A;  2X4H A;  1SC7 A;  4I09 A;  4HX4 A;  3OS2 A;  2CV2 A;  3ECO A;  2DT6 A;  5ICF A;  2CV0 A;  3GXO A;  2IPQ X;  3MZY A;  2KL4 A;  1WJF A;  2DMQ A;  4RGU A;  1T95 A;  1RUO A;  1GVJ A;  3HTS B;  2CMP A;  4CUG A;  3G1O A;  1SD7 A;  3Q0W A;  1HDP A;  1VQ8 I;  1PVU A;  1Y39 A;  2X1D A;  3C18 A;  2CRG A;  2HR3 A;  3F8N A;  1T08 B;  2P5K A;  2XAF A;  4L9J A;  1KQ9 A;  2Z2S B;  4UVC A;  5CVI A;  1UFM A;  4CHU A;  1E3P A;  3K70 D;  1QVU A;  4BGD A;  4F93 B;  1ZTR A;  2X6O A;  5GAH J;  1PUF B;  2IT0 A;  2IAI A;  3PL8 A;  5HOD A;  4RS8 A;  1KU2 A;  5M5W J;  3VOD A;  3VB2 A;  5DUK A;  2E19 A;  4A3M J;  3B6C A;  4IRI A;  1WQ2 A;  1X2N A;  3H9G A;  5C4X J;  2R3S A;  2O9L A;  4A3L J;  5ILV A;  5LRS A;  2XGC A;  2QWW A;  3LA3 A;  2GA1 A;  1R5H A;  2W4S A;  1HBX G;  3LMM A;  2W48 A;  5H20 A;  1I1G A;  3VSL A;  3V4G A;  2ECC A;  4LFU A;  3DTE A;  3I64 A;  4KFC A;  3OS0 A;  2LOO A;  3I55 I;  2DMP A;  2JVG A;  2Z5U A;  2DFI A;  2M2E A;  1ETV A;  2XKO A;  1S5L C;  2WWY A;  1WI9 A;  2F48 A;  1I6X A;  3TDZ C;  3GFM A;  1SD5 A;  3QU3 A;  2PMH A;  4V2G A;  4OWR B;  3CLQ A;  3L2C A;  5FJ8 J;  2F4O B;  3T0Y A;  4MEY F;  9ANT A;  5DCM A;  2E7X A;  2P6S A;  2EWN A;  4BJ5 C;  4OU0 A;  5FKK A;  3ML6 A;  2M34 A;  1NG6 A;  2R7Z J;  3DPU A;  5DS9 A;  2A68 F;  3DWL E;  5F27 A;  3S93 A;  5GTH C;  5HOO A;  3BY6 A;  1SMY F;  2M0M A;  2Y9Z A;  3A4C A;  3ZOB A;  2LKX A;  1Z6T A;  2B63 J;  5TGT A;  4CGZ A;  1FOY A;  1MD0 A;  3Q5F A;  2Y0S A;  3CCE I;  3K0L A;  1ZN2 A;  4EV0 A;  1NG7 A;  2CJJ A;  5BNG A;  1MSF C;  1TQI A;  1JTY A;  1Z91 A;  3OR1 C;  4MTD A;  2ZJP F;  2G7H A;  2R7R A;  3BG3 A;  1J0R A;  1OYI A;  4O6J A;  2JQ7 A;  1TNS A;  2WY7 Q;  3V42 A;  3LSG A;  2H94 A;  2KKO A;  2QKL B;  5J40 A;  1B1B A;  2R0Q C;  3FIW A;  4KT6 A;  1S6L A;  2EZH A;  1D3Y A;  1WPK A;  5IYB J;  2UV1 A;  3KP2 A;  2KZG A;  2HYJ A;  2XGX A;  5D5X B;  5BMZ A;  1V3F A;  4UV8 A;  1R5I D;  5F0H A;  3TP0 A;  2DA5 A;  3CUO A;  4LLL A;  2PX9 A;  2HI3 A;  2L3D A;  3F8F A;  4ETS A;  3HB9 A;  4DOZ A;  1MMA A;  1Q1V A;  2LY1 A;  4OIR F;  3TDU C;  3QPT A;  4E7L A;  1T98 A;  1RNL A;  2JA7 J;  2GM4 A;  4BEH A;  2VE9 A;  1YE9 A;  2A5Y B;  2VBX A;  1ACI A;  2HVR A;  3C2B A;  3E0J B;  2V26 A;  1D0Z A;  4XRS A;  1OCZ H;  2NVU B;  3H3V K;  3G1M A;  3IL2 A;  1DU0 A;  4MHG A;  2E5N A;  4EJV A;  3JRE A;  1TLH B;  3FWE A;  4KT5 C;  3DKY A;  1YHQ I;  3S3M A;  3QRF F;  5E1W A;  2R5Z A;  2CQK A;  4UVA A;  1GV2 A;  3HJE A;  3S32 A;  2BVL A;  1ZGW A;  4IQJ A;  3PO2 J;  5H6Q A;  4XON A;  3MFK A;  3K4C A;  2ZXW H;  5D5W B;  2BYV E;  4Y3O A;  4HOB A;  5LGT A;  4BQA A;  3HOV J;  1RET A;  4XNF A;  5DCM B;  3TMO A;  1IW7 F;  3Q9V A;  3W6K B;  2GOX B;  4XLH A;  3WU0 A;  5J3L A;  4D9J A;  3OYN A;  2EB7 A;  2QA4 I;  4BQN A;  1LVK A;  3DKW A;  4KMU X;  3G6E I;  2MC4 A;  3CJT B;  4II3 A;  1TT5 B;  3FXR A;  4A3E J;  3P7N A;  4KUM A;  2L7Z A;  1YW7 A;  4LB6 B;  1XX5 A;  3KP5 A;  1YG2 A;  2DN0 A;  4F92 B;  2A6E F;  4G94 A;  5J1R A;  2IA1 A;  2ZFU A;  5A2Q Z;  1QU3 A;  5AON A;  4HW0 A;  1R7J A;  2ELH A;  1JKP C;  1QHH D;  1BM9 A;  3J7A O;  1R4N B;  2DPD A;  4HNU A;  1P6R A;  3VSK A;  1K4T A;  3IMB A;  1FJL A;  1BIA A;  1XMA A;  2CUJ A;  2WY8 Q;  2Y0M A;  2ZME C;  4IHX A;  2KMU A;  2Z16 A;  5E3M A;  5HDN A;  4EM0 B;  2X6Y A;  3J81 Z;  3BQZ A;  1SD6 A;  2KIQ A;  4XRM A;  1BR1 A;  1NTC A;  4KYW A;  1LNW A;  5HDG A;  1IN6 A;  1SD4 A;  3GTL J;  1LUJ B;  1IO2 A;  3QP5 A;  4XM3 A;  1UG0 A;  5LHG A;  1JXS A;  2RN7 A;  1UST A;  5LHH A;  4C2U A;  1P9Q C;  2J5P A;  2M8G X;  1WFX A;  3MD2 A;  3C2G A;  2ZC2 A;  5IP7 J;  1R36 A;  4BHP A;  5BQT A;  2NRA C;  1JT6 A;  2D1V A;  3QOE A;  3FKJ A;  2IJL A;  3OYI A;  1WSU A;  1OYW A;  3KLO A;  4XLN F;  2R5Z B;  2BEO A;  5M5X J;  2GXG A;  3CUQ A;  2LMD A;  4X1E A;  4HF0 A;  4QWQ A;  1GT0 C;  3M8E A;  3BG6 A;  1GHC A;  3MZ8 A;  2VQC A;  3L00 A;  1K7A A;  2P0W A;  4M9Z A;  1V5E A;  2IA2 A;  2EFO A;  2B0L A;  3MMY B;  1F9N A;  5L3D A;  4IVN A;  3HOZ J;  3VYU B;  3D5S C;  2Q2E A;  1SVO A;  2E1N A;  4BAY A;  4ANJ A;  4UNO A;  3GZ6 A;  3NAR A;  4N0B A;  3LSM A;  5LGN A;  1HW5 A;  3MN2 A;  1X2M A;  3KP6 A;  2XGD A;  4M3E A;  1FBU A;  1J9I A;  3E1S A; 
#chains in the Genus database with same CATH homology
 2MH2 A;  3IC7 A;  3I0T A;  2QZ8 A;  3I5U A;  3PQK A;  2M5W A;  2Z3Y A;  5ILS A;  1IN8 A;  5L3C A;  2ODH A;  4OIQ F;  2HTS A;  3P9C A;  3HOS A;  5AIQ A;  1J5Y A;  3SZP A;  1S29 A;  3EET A;  2D1H A;  2FBK A;  3IWF A;  3HOT A;  1J75 A;  2ZNY A;  4E70 A;  1G3W A;  3FZV A;  2JPC A;  2HTJ A;  3HUG A;  1IN5 A;  5ILU A;  1XGN A;  4KMF A;  4G7H F;  3ZP5 A;  1W7P A;  3FM3 A;  1TTY A;  3CUQ B;  4UXN A;  3I59 B;  5E1Z B;  2F2E A;  1XGM A;  2QVO A;  1U78 A;  5CVV A;  5DD4 A;  3RKW A;  1R00 A;  3H3Z A;  3J80 Z;  2HFH A;  1J59 A;  3W6J B;  1EH7 A;  3SQN A;  5JVT A;  5E1X A;  1PDN C;  5CJ9 A;  1K6O A;  1B9N A;  3R0A A;  3C3W A;  4Y15 A;  1KQ8 A;  2JPB A;  4P9F A;  1DDN A;  4HLX A;  4WCG A;  4HX7 A;  4MGR A;  4LMY A;  1BC7 C;  1BI3 A;  2FRH A;  3L09 A;  3JAM K;  3LST A;  2PEX A;  2A61 A;  1QPM A;  2F5F A;  4GCV A;  4M71 A;  5HVQ C;  3TKY A;  3T8T A;  5DD8 A;  2YX4 A;  4XBF A;  4ESJ A;  3T5X A;  2VON A;  1FBQ A;  2O3F A;  1W7P B;  4A6D A;  4Y13 A;  5FO5 A;  5E17 F;  2CW0 F;  4I02 A;  4UVB A;  3ZMZ A;  4WF2 A;  3RPU A;  1FYK A;  2UZK A;  1KU7 A;  4BXU A;  4CDG A;  2XAS A;  2PBI A;  3MQ0 A;  3BPX A;  4AIK A;  3TOA A;  1OPC A;  3R61 A;  2GXB A;  2HDC A;  2X0L A;  5DCF A;  1IRG A;  3FX3 A;  3ZMD A;  4N9H A;  1R1U A;  4LB5 A;  2YX7 A;  5ED4 A;  4JBA A;  4A5N A;  1RZ4 A;  4HQE A;  2DLL A;  3RI4 A;  2D45 A;  2J5O A;  1X3U A;  5FLX K;  2DU9 A;  1KQ0 A;  2OAA A;  3BJO A;  4CYD A;  4GYG A;  3COA C;  3IHU A;  2HYG D;  3FF5 A;  4ESF A;  1IXR C;  2F5E A;  4HLY A;  2XV4 S;  4JK1 X;  2EFN A;  4A12 A;  3JTH A;  1IXC A;  2A6H F;  4PCQ A;  1ODD A;  4RAY A;  3EUH A;  1RUN A;  4EVI A;  4M73 A;  1ZLJ A;  3WE2 A;  5HDK A;  2DQR A;  1DPU A;  2Q0O A;  5FFZ A;  2NYX A;  3M8F A;  4R79 A;  1HSJ A;  3CDH A;  4RB1 A;  2VOP A;  4FT8 A;  2IP2 A;  4Q4Z F;  2ZBK A;  3CO7 C;  6PAX A;  1FYM A;  5ICG A;  1PUE E;  4NHJ A;  3HTU A;  2EA2 A;  2R7F A;  2K7L A;  1S7A A;  1D5V A;  1SMT A;  1YQA A;  2OZU A;  4HX8 A;  2M45 A;  4EM2 A;  1LEA A;  1AWC A;  5JR3 A;  2Z33 A;  4IHT A;  4HQM A;  1GXP A;  1T6S A;  2DTR A;  4ESB A;  1O57 A;  2CO5 A;  4U7D A;  4L0Z B;  2M87 A;  1W5T A;  4LK0 F;  2L4M A;  2VT3 A;  4R8H A;  2G7U A;  1SFU A;  3ISP A;  5BOX A;  1LDK B;  3M1E A;  3V8J A;  2H09 A;  2UXN A;  3EDP A;  3FXU A;  3V8K A;  3MEX A;  2LSO A;  4HAM A;  2A07 F;  2O61 A;  3E6B A;  5DDG A;  1KYZ A;  2DAO A;  2CG4 A;  4KIG A;  1XCB A;  2GZW A;  3PQJ A;  3BRO A;  2H6B A;  1FBS A;  1H0M A;  4P96 A;  2ETH A;  2P4W A;  2Z99 A;  4EGY A;  2FMY A;  2VC0 A;  3KLN A;  4MQV A;  1WKM A;  1R23 A;  3HHH A;  4U0Y A;  2KJB A;  2WV0 A;  3K69 A;  4RGR A;  3WTT C;  1JE8 A;  4CZZ A;  2EK5 A;  4S04 A;  4ASN A;  5LRR A;  1A04 A;  4HDU A;  1B9M A;  1S7O A;  1MGT A;  4IRH A;  2P5V A;  1KU9 A;  5D5U B;  4G6Q A;  1JHF A;  2LNB A;  4BH9 A;  3WTU C;  4H0E A;  4Q5S F;  3NEU A;  1P4W A;  2HOE A;  4ZZL A;  3FMR A;  1BI0 A;  2VE8 A;  4KN4 X;  4OMZ A;  2IVM A;  1K78 A;  3GFL A;  3CUQ C;  3GO5 A;  4YFK F;  1HKS A;  4U88 A;  4MEX F;  4ZZD A;  4YFX F;  2QQ9 A;  2V79 A;  2ZCW A;  1MKM A;  5CVJ A;  2IA0 A;  1JHH A;  2KIU A;  3GEZ A;  2O03 A;  1BI2 A;  4FHT A;  3O2P E;  1TQM A;  4IRG A;  1EH6 A;  1O3Q A;  3WE3 A;  5KVR A;  1BBY A;  4BHC A;  1IXS B;  3C1D A;  3F22 A;  3MCZ A;  1MZB A;  3GF2 A;  1IUY A;  4IF4 A;  3ECH A;  3H92 A;  1EV7 A;  2NAZ A;  2UWM A;  1ZLK A;  4G8X A;  1DUX C;  4B8X A;  2QBY A;  2K4B A;  4A6E A;  1J2X A;  2V9V A;  1Z1D A;  2K4J A;  3ZQ7 A;  3F72 A;  2E7W A;  1IN7 A;  3K1N A;  2C6Y A;  3E3V A;  1YYV A;  5K1Y A;  4L5I A;  4GO1 A;  5KK1 A;  3HSR A;  3L9F A;  2XAG A;  2P7C B;  1K78 B;  4ENK A;  3CO6 C;  1ZAO A;  3ZMU A;  4WWC A;  2GA2 A;  2Z9O A;  1T38 A;  3FHZ A;  3RIR A;  2O0Y A;  3M9A A;  3V8L A;  2FE3 A;  3DV8 A;  4XSZ F;  3E5Q A;  1FP1 D;  1W5S A;  3KP4 A;  1HW1 A;  2HZT A;  1OYY A;  3HIF A;  1O3T A;  2FML A;  3HSE A;  1H9G A;  2IW5 A;  4AWX B;  2RV8 A;  4ZYE A;  1U6G A;  4L9V A;  2WTE A;  2FXA A;  5JFR A;  3F6V A;  3U2R A;  3WU1 B;  1MJB A;  2EFQ A;  2QBY B;  3VOE A;  2VOO A;  4LGW A;  1ZRF A;  1FPQ A;  3E6C C;  2LDU A;  1D8J A;  1XD7 A;  4U7B A;  5E20 A;  3WTS C;  1S8N A;  1OKR A;  2KJC A;  2PG4 A;  2L54 A;  3CTA A;  3T8R A;  1YO5 C;  3GVA A;  2E1C A;  1XDS A;  4FX0 A;  5LEJ A;  2DPU A;  2DQL A;  1CGP A;  2HGC A;  5HLG A;  5LEK A;  1FC3 A;  3L7W A;  3ZMT A;  1LJ9 A;  2HYF A;  1U8R A;  1Z05 A;  2ODI A;  3C7J A;  2NNY A;  4ZYH A;  1ZHF A;  5IT3 A;  3IKV A;  1LQ1 A;  1GXQ A;  1C0W A;  5DYM A;  5L3E A;  3RPQ A;  3GFI A;  1I1S A;  5D6E A;  3IRR A;  3R60 A;  2ZNZ A;  1BC8 C;  4BYY A;  1R22 A;  3RJP A;  4KA4 A;  2AS5 F;  1H9T A;  4YG2 F;  3O3K A;  3BOQ A;  3WTY C;  1I5Z A;  3WGI A;  2L01 A;  2P5L C;  4AD9 A;  5IT9 Z;  5LLQ A;  3F6O A;  4M9S A;  1G3T A;  2K02 A;  3EYI A;  4HA8 A;  3TQN A;  4P55 A;  3WTV C;  1MJ9 A;  3I4P A;  1FSE A;  3ABT A;  4KNY A;  3H3U A;  1BI1 A;  3LWF A;  1MDM A;  4DQ2 A;  2RDP A;  1XSX A;  5BPI A;  2F5D A;  5A2Q K;  3ABU A;  4ENN A;  2EA4 A;  2M8E A;  3V7C A;  3I53 A;  4EJO A;  2H27 A;  2ZKZ A;  4U0V A;  3IKT A;  2K27 A;  1HKQ A;  1T2K A;  3J81 K;  5K5O A;  3WTX C;  3I71 A;  3HYI A;  1BJA A;  3NQO A;  1P4X A;  5EEG A;  2PN6 A;  5K5R A;  1F5T A;  2ZO4 A;  4L9T A;  2V1U A;  3P9I A;  5J8C A;  2STW A;  3DPT A;  1IRF A;  5DUI A;  1LDJ A;  3KZY A;  2L02 A;  1B4A A;  1YS6 A;  4L5J A;  3P9K A;  5AIP A;  5FB2 A;  3D5L A;  4LLN A;  2EJR A;  4KN7 X;  3WGG A;  3OOP A;  4DNC A;  5D8K B;  3FXQ A;  1ONV A;  4I2O A;  2MA3 A;  2Q10 A;  3DP7 A;  4O5V A;  2PI0 A;  4LG0 A;  1MDM B;  4WXC A;  4P9U A;  2FA5 A;  2HEO A;  2QLZ A;  1YIO A;  2MLK A;  5DV5 A;  1VTN C;  4G6D A;  4BHB A;  3LA2 A;  3GWZ A;  3KFW X;  4IJA A;  2STT A;  4XLP F;  3ULQ B;  4A0Y A;  2OQG A;  2OU2 A;  1XMK A;  4L18 B;  2A3S A;  4Z2Y A;  1XDU A;  4G7O F;  2DT5 A;  3K2Z A;  3DEU A;  1USS A;  2W84 A;  1I27 A;  2EV0 A;  2DK8 A;  1U3E M;  2YPR A;  5HS8 A;  2KRF A;  3RYR A;  4AVP A;  3WTZ A;  1FYL A;  1R5G A;  4LJZ F;  3R6S A;  1E17 A;  1ZRE A;  4G9Y A;  2VBY A;  3KE2 A;  3LQQ A;  1Z9C A;  3OV8 A;  3WTW C;  5D8L B;  3KEQ A;  1ZRD A;  1OMI A;  3QU6 A;  5TJJ A;  1QNT A;  2XIG A;  1HST A;  1XCV A;  2KIM A;  3V7R A;  1V4R A;  2A69 F;  2VBZ A;  3J80 K;  3SHF A;  1W4M A;  4LG0 B;  2ESH A;  5FFX A;  2QQB A;  1DP7 P;  3GUD A;  2TDX A;  2VOD A;  1IN4 A;  2M1B A;  4EQQ A;  1BN5 A;  4YII A;  2YSR A;  4TV7 A;  5CLS A;  3K1M A;  1QZZ A;  3VFZ A;  4YIF A;  4IHS A;  4UHT A;  1FLI A;  3DF8 A;  1ZYR F;  3GFJ A;  4OIO F;  5CVU A;  3B02 A;  4M74 A;  4BNC A;  3R4K A;  3IWZ A;  1U5T A;  3F3X A;  4MTE A;  2V6C A;  2DW4 A;  3F8M A;  2EFW A;  5EEH A;  2RVC A;  2D2W A;  1RIO H;  3O6B B;  4LK1 F;  1RI7 A;  4HYE A;  2PJP A;  2XUB A;  3DFG A;  4M72 A;  4WK8 F;  5JHU A;  1HW2 A;  2GIV A;  4S05 A;  5F64 A;  1XGO A;  4PDK A;  3SXY A;  1TQP A;  3G73 A;  2OA9 A;  3JTG A;  4I7H A;  5BS6 A;  1O3S A;  3BZ6 A;  4A2U A;  4MQ9 F;  2XVC A;  1TW3 A;  1ZG5 A;  2FF4 A;  3HSF A;  1FNN A;  1F1Z A;  2JSC A;  3IRQ A;  2RNJ A;  4HDV A;  3HRS A;  4PGG A;  1Q1H A;  2G9W A;  3KZZ A;  3S2W A;  4HZF A;  4JQF A;  1DPR A;  3TO9 A;  4CIC A;  1U5T B;  4OIN F;  1YW8 A;  3MWM A;  5FD6 A;  4CXF A;  4ON0 A;  3REO A;  3U9G A;  5HS7 A;  2FSW A;  5D5V B;  1YFH A;  4WXD A;  2XRN A;  3MAJ A;  4RB0 A;  1KA8 A;  1TNT A;  1ZAR A;  3D0S A;  2P7V B;  4KDP A;  2OBP A;  3HHG A;  2UXX A;  1IF1 A;  4UV9 A;  2CYY A;  4L9N A;  3ELK A;  1KYW A;  3TOB A;  4I0B A;  1UCR A;  5H6R A;  2XAH A;  4XSX F;  4EJU A;  3HRM A;  4PGH A;  2LKP A;  2FQ3 A;  1FP2 A;  3SZT A;  3KCC A;  3TGN A;  3ZN0 A;  4AIJ A;  1FY7 A;  2R7D A;  3F21 A;  3BWG A;  3Q9S A;  4RB2 C;  1ULY A;  2WC2 A;  1REP C;  2ZJ2 A;  1G3Y A;  5BPD A;  2ACJ A;  1IZ1 A;  2W85 A;  1YTY A;  2FNA A;  1J7K A;  3I58 A;  3LA7 A;  1QBJ A;  2CGP A;  3E97 A;  3DPL C;  1QZY A;  4EJT A;  2FEZ A;  2ISY A;  4L0Y B;  4A5M A;  4P5O A;  3JSO A;  1P92 A;  4GYI A;  5CYV A;  1XN7 A;  1Z7U A;  3QPH A;  4LLG F;  3WG9 A;  1LVA A;  4M9X A;  4D0P A;  2L4A A;  1UHM A;  3WGH A;  1HXD A;  2YU3 A;  3F8C A;  2CFX A;  1ZG1 A;  2CSO A;  3QOP A;  1U2W A;  2DI3 A;  4EMS A;  3RTR A;  2XRO A;  2FNP A;  2HS5 A;  4RGS A;  3GX4 X;  2Y75 A;  3JW4 A;  1KGS A;  5J6X A;  2JRT A;  5K5Q A;  5CVR A;  2MD5 A;  2XAQ A;  3M7G A;  1XGS A;  2FU4 A;  2XKP A;  3JAM Z;  4U0W A;  1NHA A;  1BOA A;  5HS9 A;  1T39 A;  2DO7 A;  2QQA A;  5JI6 A;  3CJN A;  1SAX A;  4Y17 A;  2OD5 A;  2COM A;  3GW2 A;  3RKY A;  4AIH A;  2PQ8 A;  3WOD F;  5F1R A;  3KEO A;  3K9T A;  3B73 A;  5FGM A;  5E8I A;  1FT9 A;  4YFN F;  5L3G A;  4G7Z F;  2K86 A;  4R1H A;  2BBY A;  2P8T A;  4Q48 A;  2JTV A;  3FMQ A;  4KIC A;  3I59 A;  2YR2 A;  1LDD A;  1FOK A;  2HQN A;  1XSD A;  4A0X A;  1EH8 A;  2VN2 A;  3F8B A;  3N4M A;  1CF7 A;  1AOY A;  1UHW A;  3R0J A;  5ICE A;  4HBL A;  4I98 B;  3ZPL A;  3PFI A;  3KP3 A;  2DBB A;  2MC3 A;  2VBW A;  5FLX Z;  2JT1 A;  1L0O C;  1B59 A;  4EJW A;  3NRV A;  2AXL A;  3ZMS A;  5L3B A;  1YLF A;  2LF8 A;  1TBX A;  3K1P A;  5LBQ A;  4KIB A;  4B09 A;  2MLG A;  1WWX A;  3DQV C;  2W57 A;  3ZN1 A;  1BIB A;  3BDD A;  5ICC A;  2O6G E;  4ZYD A;  4QLC U;  1P4A A;  3U1D A;  3LAJ A;  2GAU A;  2ESN A;  4HF1 A;  1K79 A;  2ZME A;  4ZYG A;  2CWE A;  2ZFW A;  3GLX A;  1Z6R A;  2NS0 A;  1Y0U A;  4I0A A;  1W7P D;  3MZH A;  1G6N A;  4EM1 A;  1E2X A;  2MH9 A;  1QQI A;  1QO0 D;  1PP8 F;  3E6D A;  5E18 F;  1CF7 B;  3BP8 A;  3BJA A;  5D4S A;  5HLH A;  2HWV A;  3CLO A;  5D4R A;  3RDI A;  1R1T A;  2OQR A;  4ENM A;  2EV5 A;  3LFK A;  2IRF G;  1G3S A;  3RYP A;  1ON1 A;  2BV6 A;  5F6F A;  1D8K A;  2JZY A;  4ZH4 F;  1UB9 A;  2PLY A;  4HF2 A;  4WX9 A;  5J8F A;  4GXO A;  1O7L A;  1ZGA A;  2OZ6 A;  2GQQ A;  3E5X A;  1S3J A;  4Q47 A;  2OAZ A;  1MJA A;  2M30 A;  1PP7 U;  2OA4 A;  2Q8K A;  4IXA A;  1O7F A;  1T0F A;  4RGX A;  4GGG A;  3FM5 A;  3ZMV A;  2FBH A;  4N9I A;  1FZP B;  2ZME B;  3JSP A;  3TO7 A;  1YS7 A;  3SFZ A;  4NQW A;  3BPV A;  4OOI A;  4RAZ A;  5DEQ A;  4RB3 C;  1L3L A;  2ADU A;  1YW9 A;  3GYH X;  3AAF A;  3N97 A;  3V7S A;  4HV5 A;  4K2E A;  2GWR A;  5E8G A;  4CO8 A;  2V1D A;  1P2F A;  3LQR A;  1U5T C;  2V1X A;  4MNU A;  4EGZ A;  2KIF A;  3FMS A;  3KP7 A;  3HRU A;  4ENJ A;  1O3R A;  2H6C A;  5LHI A;  5TRD A;  4M6X A;  1ON2 A;  1OR7 A;  1R1V A;  2QYO A;  2PMU A;  3BJ6 A;  2O8X A;  1LB2 A;  2QM3 A;  4HV6 A;  2XAJ A;  2PFB A;  2ISZ A;  5ERI A;  3EYY A;  2VT2 A;  3RKX A;  2NNN A;  1STZ A;  4LD5 A;  1LEB A;  2LF7 A;  2RC4 A;  1ZG3 A;  4M6Y A;  1HKT A;  1XSV A;  4WXH A;  3QAH A;  4XRF A;  1TW2 A;  1R58 A;  1SFX A;  2P6T A;  4O3M A;  2RGV A;  3EQL F;  2BE5 F;  2F5C A;  4OIP F;  3I54 A;  3DXJ F;  4UUV A;  5IT9 K;  2HQR A;  1JGS A;  3ERE D;  3HRT A;  3GZ5 A;  3VEP A;  2FBI A;  2HKX A;  3LAP A;  2W24 A;  3QP6 A;  1XB4 A;  2RKH A;  1B6A A;  1ZH5 A;  5L3F A;  2Y48 A;  2W25 A;  1HQC A;  4OMY A;  2BGC A;  1WRJ A;  1FWZ A;  1FSH A;  3ROU A;  3E6M A;  3TO6 A;  1ZGJ A;  4IPA A;  2DK5 A;  2MBF A;  2QEN A;  5LGU A;  1FX7 A;  2EV6 A;  1F4K A;  4NB5 A;  3G3Z A;  5FD5 A;  3E5U A;  5HLI A;  4FX4 A;  4I01 A;  3F23 A;  1KU3 A;  2XHK A;  2RQP A;  1IAW A;  1SFE A;  2VXZ A;  2EFP A;  2VC1 A;  2ZXJ A;  1G4D A;  2HKO A;  4KIF A;  2FOK A;  2QUF A;  4PZJ A;  1QGP A;  4A0Z A;  3KET A;  5D6F A;  1ZRC A;  3T1B A;  4F7Z A;  2X4H A;  4I09 A;  4HX4 A;  3ECO A;  5ICF A;  3GXO A;  2IPQ X;  3MZY A;  1RUO A;  4RGU A;  1GVJ A;  3HTS B;  1SD7 A;  3C18 A;  2HR3 A;  3F8N A;  2P5K A;  2XAF A;  4L9J A;  1KQ9 A;  4UVC A;  5CVI A;  1UFM A;  4CHU A;  2IT0 A;  4RS8 A;  1KU2 A;  3VOD A;  3VB2 A;  5DUK A;  4IRI A;  1WQ2 A;  2R3S A;  5ILV A;  5LRS A;  2QWW A;  3LA3 A;  2GA1 A;  1R5H A;  1HBX G;  5H20 A;  1I1G A;  3V4G A;  4LFU A;  3I64 A;  4KFC A;  2Z5U A;  2DFI A;  2XKO A;  2WWY A;  1WI9 A;  1I6X A;  3TDZ C;  3GFM A;  1SD5 A;  3QU3 A;  2PMH A;  3L2C A;  3T0Y A;  4MEY F;  5DCM A;  2E7X A;  2P6S A;  2EWN A;  4OU0 A;  3ML6 A;  2A68 F;  5HOO A;  3BY6 A;  1SMY F;  1Z6T A;  4CGZ A;  1MD0 A;  3Q5F A;  3K0L A;  1ZN2 A;  4EV0 A;  1TQI A;  1Z91 A;  4MTD A;  2G7H A;  1J0R A;  1OYI A;  4O6J A;  1TNS A;  2H94 A;  2KKO A;  1B1B A;  1S6L A;  1D3Y A;  3KP2 A;  5BMZ A;  2XGX A;  5D5X B;  1V3F A;  4UV8 A;  3CUO A;  4LLL A;  4ETS A;  2L3D A;  3F8F A;  4OIR F;  3TDU C;  3QPT A;  1T98 A;  1RNL A;  2VE9 A;  2A5Y B;  2VBX A;  3IL2 A;  4MHG A;  4EJV A;  1TLH B;  3FWE A;  4KT5 C;  3QRF F;  5E1W A;  2CQK A;  4UVA A;  5H6Q A;  3MFK A;  5D5W B;  2BYV E;  5LGT A;  4HOB A;  4BQA A;  5DCM B;  1IW7 F;  3Q9V A;  3W6K B;  3WU0 A;  2EB7 A;  3DKW A;  4KMU X;  3FXR A;  3P7N A;  4KUM A;  1YW7 A;  4LB6 B;  3KP5 A;  1YG2 A;  2A6E F;  4G94 A;  2IA1 A;  5A2Q Z;  5AON A;  4HW0 A;  1R7J A;  2ELH A;  1BM9 A;  3J7A O;  2DPD A;  1P6R A;  3IMB A;  1BIA A;  1XMA A;  2Y0M A;  5HDN A;  4EM0 B;  3J81 Z;  1SD6 A;  4KYW A;  1LNW A;  5HDG A;  1IN6 A;  1SD4 A;  3QP5 A;  5LHG A;  1JXS A;  1UST A;  2RN7 A;  5LHH A;  2J5P A;  1R36 A;  4BHP A;  5BQT A;  2NRA C;  2D1V A;  2IJL A;  1WSU A;  1OYW A;  3KLO A;  4XLN F;  2BEO A;  2GXG A;  3CUQ A;  4HF0 A;  4QWQ A;  3M8E A;  1GHC A;  3L00 A;  1K7A A;  4M9Z A;  2IA2 A;  2EFO A;  2B0L A;  1F9N A;  5L3D A;  4IVN A;  2Q2E A;  2E1N A;  4BAY A;  4UNO A;  3GZ6 A;  4N0B A;  5LGN A;  1HW5 A;  3KP6 A;  1FBU A;  1J9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...