2MH9A

Resonance assignment of rqc domain of human bloom syndrome protein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
127
structure length
127
Chain Sequence
CKTKDYKTRDVTDDVKSIVRFVQEHSSSQGMRNIKHVGPSGRFTMNMLVDIFLGSKSAKIQSGIFGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQAIAYVMLGNKAQTVLNGNLKVDFMETE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the RecQ C-terminal domain of human Bloom syndrome protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Bloom syndrome protein
total genus 38
structure length 127
sequence length 127
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09382 RQC RQC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2mh9A00
4Y17A 2LDUA 1XN7A 1SD5A 3GUDA 4UUVA 3I5UA 2MC3A 5K5RA 1I1SA 4CZZA 2P5KA 4AIKA 4HF1A 1XGOA 2ZNYA 3DPLC 4BYYA 3BPVA 2O3FA 3I4PA 1IXSB 5JHUA 4IJAA 5E18F 3HHGA 3HUGA 4Q47A 4L9VA 5JR3A 1BBYA 2PG4A 4N0BA 4DQ2A 2XKOA 1BIAA 3ZMVA 2FF4A 3ECHA 2Z99A 3V8KA 1KYZA 3H3ZA 1R00A 1ODDA 2XGXA 1ZGAA 5J6XA 5ICFA 1Y0UA 5LLQA 1Z6RA 5D4SA 3IKTA 4NQWA 2IA1A 2ISYA 4LJZF 1GXPA 3R0AA 2GZWA 3BROA 3DXJF 1TQPA 1IN7A 1V3FA 3F8MA 3K1MA 4MQ9F 3WU0A 4UV9A 2A61A 3BDDA 1O3TA 2IT0A 3BOQA 3ZN1A 3ISPA 2NNNA 5FD6A 1LVAA 4I09A 3JTGA 5DD8A 2EV6A 1W5TA 5FGMA 4G7ZF 1J5YA 3GO5A 4LMYA 2D2WA 4U0YA 3IWFA 1XDSA 1KQ8A 2OQRA 3N4MA 4HLYA 1TW2A 1Q1HA 1EH7A 1ONVA 5DV5A 1S8NA 3MZYA 1LEBA 5E8GA 1YS7A 4LK0F 3IC7A 3WGIA 2MD5A 3IRRA 2MBFA 5EEHA 2EV5A 2XVCA 5D8KB 1P92A 1LDJA 2FSWA 4EJTA 4A5MA 2XAFA 2VC0A 4BAYA 3RTRA 4MEXF 4IHSA 2L4AA 3B73A 3GW2A 2M45A 3SHFA 2KJCA 2Q0OA 3J7AO 4KDPA 2ZKZA 2FEZA 1OYIA 5L3BA 2MLGA 4Q5SF 3I58A 4M9SA 1ZN2A 4RAZA 4PZJA 5LEJA 3J80Z 3KP3A 3HSFA 4NB5A 2QQAA 3CO6C 3I0TA 2KIMA 4A6DA 5DUIA 4MGRA 3MEXA 2RC4A 2OQGA 3HTUA 2V1XA 2WC2A 4KNYA 2LNBA 3M1EA 1R1TA 1WWXA 3DF8A 4OIQF 5K5OA 4L9NA 5ILVA 4KN7X 2FU4A 5D6EA 1QPMA 4HX4A 3I71A 1CF7B 3R60A 3GLXA 3NEUA 3SZPA 3KEQA 4UVCA 3AAFA 1XMAA 3FM3A 3C1DA 2COMA 2VE9A 2WWYA 4PCQA 5TRDA 2A69F 5CVRA 5L3DA 4LLGF 2VBWA 4LFUA 2HR3A 2A07F 3E3VA 4RB2C 1F4KA 3F8CA 2DPDA 1XSVA 2O0YA 5AONA 1K79A 5AIQA 3FWEA 2PN6A 2F5FA 4EJOA 1YS6A 3DEUA 4O3MA 1O7LA 4PDKA 3DPTA 4GCVA 4UVAA 1ZRFA 5TJJA 2EJRA 2VOOA 1Z05A 2FBHA 5LHGA 3TOBA 1SMYF 1B9MA 2VONA 1B1BA 2WV0A 1TNSA 3E5XA 4EJVA 2ZO4A 3QU6A 1K6OA 4ASNA 3O2PE 2K7LA 1AOYA 5ILSA 1PP7U 2DI3A 1UHWA 4TV7A 2BEOA 2LKPA 2PLYA 4GGGA 1S3JA 5HDNA 5H20A 3E5QA 3N97A 4H0EA 4U7BA 4UV8A 3IRQA 3CUQA 3MCZA 5LEKA 3HTSB 2FXAA 2HKOA 3C7JA 2KJBA 5DCMA 2NNYA 1E2XA 3JSOA 1FYLA 1R7JA 2ZMEB 1TTYA 2F2EA 3ZN0A 1USTA 5LGUA 4IVNA 1HW2A 3WTSC 3R6SA 5FB2A 4R1HA 5CVIA 2GAUA 3RPUA 2ZBKA 3V7SA 4HZFA 5H6QA 2M5WA 4RAYA 2G7HA 4MNUA 1XDUA 2XASA 2EK5A 3MAJA 2GA2A 5DCFA 4FX0A 2M1BA 1YLFA 3EYIA 4I0AA 2EA2A 1OKRA 3Q9VA 3TO9A 3NQOA 1XGMA 3EYYA 1ZREA 5CVJA 3GFJA 3Q5FA 2DW4A 2CSOA 2ACJA 5D5UB 2E7XA 4AD9A 2EFQA 1LDDA 2WTEA 1Z91A 2OZ6A 5HS7A 3COAC 5BPIA 1RUNA 2CGPA 4ESJA 4I7HA 1MZBA 4A12A 3I54A 4S05A 2W25A 4RB1A 1L3LA 3KLNA 5A2QZ 5D5XB 4L18B 3WTUC 3GYHX 3C18A 3IL2A 2HYGD 2DQLA 3KETA 2L01A 3WTWC 2R7FA 1IRFA 3KZYA 2P6TA 5DEQA 2BE5F 4ESFA 4HDVA 1YQAA 3Q9SA 2V6CA 3HSRA 4OIRF 4UXNA 3K69A 4G6DA 1J7KA 3EETA 3WODF 3F72A 2X4HA 4HV6A 2FE3A 1XSXA 2JPBA 4KMUX 1ZLJA 1MJ9A 4PGGA 3TO6A 2CYYA 3ZMDA 1U5TC 4BQAA 2P8TA 3WGGA 4EJWA 3V4GA 1V4RA 3KEOA 1MKMA 1FWZA 4G9YA 4EM2A 2X0LA 4MTDA 2VBZA 1KYWA 5K5QA 5DCMB 2PEXA 4OIOF 1IN4A 2HQRA 1IRGA 5HLGA 1R1VA 5KVRA 4P96A 2VE8A 3WE2A 3ABTA 2XUBA 1RIOH 1FSHA 3E6MA 2HOEA 3ERED 2GWRA 4G7HF 4U0VA 4LB5A 2EFNA 5FFZA 1I6XA 3KLOA 1OPCA 4K2EA 4LG0B 2K02A 1G4DA 1FT9A 1QQIA 1HSJA 1FP2A 4P5OA 1I27A 4YFKF 3G73A 3T8RA 2YSRA 3PQKA 4BHPA 2DU9A 3ZMZA 1O3QA 1FX7A 5J8FA 4L0ZB 1DPRA 1CGPA 2OZUA 3JTHA 5IT9Z 5D4RA 3QP6A 4N9IA 4KN4X 2F5DA 4CXFA 1WI9A 2KIUA 3TKYA 1ON2A 1LNWA 5LGTA 2BV6A 4L9JA 2HZTA 5HLIA 4D0PA 5BOXA 4AVPA 3CUQB 3NRVA 4YFXF 4G6QA 1Z9CA 4L5JA 2EFOA 4HLXA 2HWVA 1LB2A 2H6CA 1I5ZA 2C6YA 3EUHA 1J75A 4CHUA 1R22A 3DKWA 2MH2A 2W85A 4FT8A 1BM9A 4EMSA 4MEYF 5J8CA 2PI0A 1XSDA 4BH9A 1JHHA 1P4AA 4HX8A 1CF7A 4M73A 3L2CA 3E6BA 3VFZA 2YX7A 3GFIA 4MQVA 4PGHA 2Y48A 5D8LB 2RVCA 3CUQC 1SFXA 1VTNC 5ED4A 3DP7A 1MJBA 2RN7A 1PDNC 3RYRA 3GZ5A 5BMZA 1FYKA 3HOTA 3HHHA 3JW4A 3M9AA 2RKHA 5IT9K 3L7WA 2HFHA 4LK1F 1ZGJA 1LEAA 3W6KB 5DUKA 4M9XA 1OYYA 3RKXA 4WCGA 4HAMA 4P9UA 4G8XA 4KIFA 1Z1DA 2J5OA 5CYVA 5E1WA 2PJPA 2LSOA 1T38A 4IRGA 2ETHA 1J59A 1R1UA 2K86A 5F6FA 5L3GA 1RNLA 1T0FA 5HVQC 4KFCA 3TGNA 2K4BA 2DQRA 2M30A 5L3EA 5JVTA 2OBPA 1FC3A 3P9IA 3QOPA 1MDMB 4HF2A 4KMFA 4ENMA 3KCCA 3W6JB 3WTTC 2ZFWA 1FBSA 2P6SA 3FMRA 1YW8A 1O3SA 1AWCA 4GO1A 2XAHA 3KE2A 3P9CA 1HKTA 3GZ6A 1ZYRF 3WTYC 2OD5A 5ICCA 2MA3A 1XCBA 3M7GA 1J0RA 1EH6A 5E17F 2D45A 1T98A 2H94A 5HS8A 3RDIA 1BOAA 1MD0A 2E1CA 2IA2A 4HOBA 3E5UA 1TNTA 2UWMA 1FNNA 3WTZA 3CTAA 1T6SA 3RPQA 3FXUA 2Q8KA 4ON0A 1R23A 2F5EA 2IRFG 4RB0A 2L4MA 1YO5C 2D1HA 1F5TA 1UFMA 4CDGA 2LF7A 3LQRA 2HTSA 4EGYA 2FQ3A 1J9IA 2PFBA 3T0YA 3K9TA 1GXQA 1SAXA 3V8JA 2L3DA 2XAJA 1HSTA 1STZA 1IUYA 1FP1D 5CLSA 3MFKA 2M8EA 2XKPA 4JBAA 2CWEA 4YIFA 3HRSA 1ZH5A 1LQ1A 4I0BA 4E70A 3DV8A 1W7PB 3E6DA 4OOIA 4UNOA 1UHMA 3K1PA 1MDMA 2OU2A 3RIRA 1H0MA 4G94A 3FXRA 2ESNA 4KUMA 5FLXZ 2M87A 1FZPB 5LRRA 4N9HA 2V79A 3GFLA 3F8NA 1I1GA 1D8KA 3F8BA 3VOEA 1ZAOA 3BZ6A 3GFMA 2EFWA 3GXOA 4GYIA 2VT3A 3BP8A 1IAWA 3ZMUA 4EJUA 2IW5A 2R3SA 1U8RA 3R4KA 4GXOA 4P9FA 6PAXA 3CDHA 4P55A 1A04A 1QZZA 2OAZA 1K78B 4BHCA 3V8LA 2XAGA 3PQJA 4IRIA 3K2ZA 5D6FA 3ZMSA 5JFRA 1O7FA 3U9GA 3T8TA 4ZYHA 5HOOA 3T5XA 1BI3A 4YIIA 3KP2A 3JAMK 3FHZA 1G3SA 1P2FA 3O3KA 3CJNA 1E17A 4ESBA 2P7CB 2D1VA 1F9NA 3R61A 1RZ4A 4KICA 4BXUA 2DFIA 1BC7C 1GHCA 1FLIA 2FOKA 2QQBA 3ROUA 1ULYA 2H6BA 2KKOA 2ADUA 3FXQA 4R8HA 4G7OF 1DPUA 4Z2YA 3HRMA 1G3TA 2Z3YA 2G7UA 3GWZA 5E1XA 1SD7A 2HGCA 4HYEA 1QZYA 3LA7A 4AIHA 1TBXA 4KT5C 3U1DA 3ABUA 4A6EA 2VBXA 2STWA 3ZQ7A 4DNCA 1QBJA 2Z5UA 1XGNA 2FMYA 2PMHA 4AWXB 3P7NA 4XRFA 1R36A 3D0SA 2YU3A 3JSPA 3KFWX 4U7DA 4JQFA 4Y13A 1FOKA 4WXHA 3J81K 1WRJA 3E6CC 3GEZA 1W7PA 1HKQA 2JSCA 5JI6A 3F22A 1U3EM 4M6YA 4KIBA 3KP5A 5DD4A 3WGHA 3U2RA 3KP4A 2RV8A 2MH9A 2PQ8A 1P4XA 3V7CA 4HA8A 3CO7C 1SFUA 1PUEE 3GVAA 4HF0A 1JHFA 2L02A 2XROA 1ZARA 1NHAA 1B4AA 3WU1B 4LD5A 3KP6A 2HYFA 1EV7A 2HKXA 1L0OC 3F21A 2QBYB 3BWGA 1TW3A 1KU3A 3RI4A 1KQ9A 1XCVA 5BS6A 2UZKA 2CG4A 3WG9A 2DK8A 2J5PA 4OINF 3HIFA 3MZHA 4QLCU 4YFNF 2XRNA 4ETSA 3LQQA 3HOSA 1U5TB 2JRTA 3WTXC 3F6VA 3I59A 4QWQA 1MGTA 1HKSA 1YTYA 1HQCA 1WKMA 5F1RA 2VC1A 1ZG1A 1R5GA 2JT1A 3IHUA 4Q48A 5ERIA 1R5HA 5ILUA 1C0WA 2AS5F 2B0LA 4LB6B 3ECOA 2EB7A 3HYIA 4L0YB 3RJPA 2ISZA 2EFPA 1YYVA 3I53A 4RGUA 1U2WA 2FMLA 4UVBA 2FNPA 1USSA 1P4WA 2DT5A 2GIVA 1KU7A 1S6LA 3IWZA 5LRSA 2ZNZA 2ZMEA 2RDPA 5H6RA 2CW0F 4HV5A 2XIGA 2P5LC 1DDNA 5HS9A 3MWMA 4WXDA 1R58A 2FA5A 4LLNA 1ZHFA 2TDXA 4HQMA 5K1YA 3KZZA 4WK8F 3TOAA 1IN8A 5CVUA 1JGSA 3J80K 5HDGA 1KU2A 3P9KA 2A5YB 1UCRA 5FD5A 3QU3A 2HS5A 1PP8F 2W84A 3BJ6A 2VN2A 2CQKA 1GVJA 5CJ9A 2VOPA 1U5TA 3H3UA 4RB3C 1WQ2A 2STTA 2QWWA 3RYPA 5ICEA 3QP5A 5ICGA 3L09A 3GF2A 4ZZLA 1OYWA 1EH8A 1D8JA 2PBIA 4RGXA 2IP2A 2Q2EA 3L9FA 2V1DA 2E1NA 1BI1A 3ULQB 3F23A 5HLHA 3VB2A 1SD6A 1T2KA 2O6GE 3M8FA 1ZRCA 3EQLF 2XAQA 3HRUA 3VEPA 3JAMZ 1G6NA 2O61A 1IXRC 2O8XA 2QUFA 3WE3A 4CYDA 4L5IA 2LF8A 4AIJA 2ZCWA 1ZLKA 3ZMTA 3FZVA 2DBBA 1XD7A 2P5VA 2H27A 1G3WA 4BNCA 4OU0A 4EM1A 4BHBA 1K78A 3BJOA 3GX4X 4GYGA 1HBXG 2RQPA 4A0XA 3PFIA 2RNJA 4A2UA 2OA4A 1S29A 1O3RA 3C3WA 3IKVA 3SQNA 1ZG3A 2GXGA 5E1ZB 4EV0A 1W7PD 2MLKA 4EQQA 5E8IA 2FNAA 2ESHA 1Z6TA 3LA2A 4LLLA 1IN6A 4A0ZA 3J81Z 4EVIA 1HW5A 2K27A 3SFZA 1SFEA 5L3FA 2IPQX 1ON1A 3FMQA 1X3UA 1YW7A 4LG0A 2L54A 2DPUA 5D5VB 2QZ8A 2KIFA 1O57A 2VBYA 1B9NA 3TDUC 2AXLA 1T39A 1XGSA 4WXCA 4KYWA 5DDGA 3BY6A 1BI2A 3K1NA 3ZP5A 3QAHA 1KA8A 1G3YA 4XLPF 2VODA 4XBFA 3B02A 2QENA 2A6HF 2QQ9A 1QO0D 1K7AA 2DO7A 1IZ1A 5FO5A 1H9GA 1MJAA 1SMTA 5BQTA 3F6OA 4R79A 5CVVA 3HRTA 1ZG5A 3QPTA 2V9VA 5EEGA 4MHGA 3TO7A 1FBUA 4IF4A 2F5CA 4LGWA 1YG2A 1QNTA 4MTEA 4I2OA 4S04A 1JE8A 5D5WB 1FYMA 3QRFF 2Z33A 3LFKA 4M9ZA 3M8EA 2K4JA 1S7AA 4HBLA 3S2WA 2IJLA 2NAZA 4EGZA 4RGRA 3R0JA 1KQ0A 1IXCA 3L00A 1SD4A 1BI0A 2DLLA 1B6AA 2DAOA 4M72A 2NYXA 1WSUA 3LWFA 4WX9A 4HDUA 1LJ9A 4U0WA 1D3YA 1XB4A 2QBYA 3H92A 2YR2A 1B59A 4KA4A 1FBQA 2A3SA 3ZPLA 4ENJA 3LAJA 3CUOA 4OMZA 4UHTA 3TQNA 2YPRA 3HSEA 5LHIA 3ML6A 2ZJ2A 5FLXK 1OR7A 4IPAA 2HTJA 1TLHB 3CLOA 3F3XA 2XHKA 5HDKA 1BJAA 3EDPA 3FMSA 1RUOA 2EA4A 2RGVA 4XSXF 3RKYA 4CO8A 2XV4S 3WTVC 4IXAA 5KK1A 3ELKA 1YFHA 2EWNA 2BYVE 4M74A 5A2QK 3DFGA 3MQ0A 2JTVA 3D5LA 4O6JA 2GA1A 1BN5A 2NRAC 1JXSA 1XMKA 3SXYA 4JK1X 1BC8C 4F7ZA 4HW0A 2CFXA 2YX4A 5DYMA 3REOA 2E7WA 1DP7P 3FX3A 1J2XA 3K0LA 2ELHA 1TQIA 2HQNA 4I01A 4FHTA 4HX7A 4WF2A 2HEOA 5F64A 1OMIA 4ZYEA 5LBQA 5L3CA 2IVMA 3KP7A 2W57A 5BPDA 2CO5A 4U88A 3RKWA 1IW7F 3SZTA 2FRHA 4A5NA 4RS8A 4IRHA 4ENKA 2VT2A 2P7VB 1HXDA 4KIGA 2QYOA 3G3ZA 3I59B 2A6EF 4M71A 2GXBA 2JZYA 2PMUA 4NHJA 2P4WA 2QLZA 1U6GA 2O03A 1BIBA 4ENNA 2DK5A 1IF1A 2FBIA 4A0YA 4WWCA 1RI7A 2UXXA 3E97A 4B09A 1LDKB 4EM0B 2A68F 2G9WA 3FM5A 1P6RA 1F1ZA 2H09A 1Z7UA 2KRFA 1ZRDA 2BBYA 5FFXA 3VODA 2Z9OA 5E20A 2GQQA 1QGPA 1FY7A 5IT3A 4Y15A 3OV8A 4I98B 2JPCA 3LSTA 1KU9A 4M6XA 3LAPA 2EV0A 2IA0A 1YW9A 4ZYGA 2QM3A 4CGZA 1H9TA 2R7DA 4I02A 1W4MA 2ZXJA 4XSZF 4L9TA 4IHTA 2BGCA 4XLNF 1HW1A 1U78A 2HDCA 2VXZA 3BPXA 4O5VA 3O6BB 5AIPA 3TDZC 3T1BA 2W24A 4B8XA 4ZZDA 3QPHA 3BJAA 2NS0A 4ZYDA 2V1UA 5LGNA 1W5SA 2FBKA 4CICA 1DUXC 1FSEA 3F8FA 2Y0MA 3OOPA 4ZH4F 3V7RA 4HQEA 1TQMA 3I64A 1D5VA 4FX4A 1UB9A 1IN5A 5LHHA 1S7OA 4OMYA 2UXNA 1KGSA 3DQVC 4Q4ZF 1FPQA 4OIPF 2DTRA 4RGSA 1YIOA 2QVOA 3LA3A 1REPC 4YG2F 2Y75A 3FF5A
chains in the Genus database with same CATH superfamily
4Y17A 1GVDA 2LDUA 3OIOA 2ZSIB 4ZTFA 2JVGA 1VF9A 1LUJB 1XN7A 3PUBA 3LSRA 1SD5A 3GUDA 1WFXA 4UUVA 3I5UA 3X2QH 2MC3A 4F92B 1DQUA 5K5RA 4CZCA 5DM7F 1I1SA 1BR2A 1OCOH 4CZZA 4XRSA 2P5KA 4AIKA 4HF1A 1XGOA 2BW3B 2ZNYA 3DPLC 1FOYA 4XR6A 4GRIA 4BYYA 2OF7A 3BPVA 2EQRA 2DOEA 2O3FA 4JP0A 4CCLA 4J01A 2E1MB 1IDYA 1UG0A 2HXIA 3I4PA 1S5LC 1IXSB 4IKFA 3BLYA 5JHUA 4IJAA 5E18F 1OLTA 3GMEA 3HHGA 1ORKA 4BEHB 3HUGA 4Q47A 3D5RC 1XTAA 4L9VA 3VYRB 2L9SA 3SYTA 1DU6A 5JR3A 4E7IA 1MNEA 2LFBA 1BBYA 2VIXA 3FDYA 3CF5F 2L9VA 1LFBA 2PG4A 3SEQA 4N0BA 4DQ2A 1GDTA 2XKOA 2HDDA 1BIAA 3W2VA 3ZMVA 4A3CJ 2EZKA 1KZHA 2FF4A 3ECHA 2Z99A 3V8KA 1KYZA 2NOGA 3H3ZA 1R00A 1ODDA 2XGXA 1ZGAA 3HKZA 5J6XA 5GPCA 1VQ5I 2VPRA 3E1SA 4F55A 4BQOA 3GTOJ 5ICFA 4LOCA 1Y0UA 2ME0A 3LMMA 4DYQA 5LLQA 1Z6RA 5D4SA 3IKTA 4NQWA 2IA1A 2ISYA 4LJZF 1Z3XA 1AHDP 3TBIA 4XQFA 1GXPA 2E1MC 3R0AA 4XOPA 2GZWA 3BROA 3DXJF 2ZXHA 2K9QA 3BZCA 1TQPA 2M7BA 2KQRA 1IN7A 1V3FA 4NBQA 9ANTA 3F8MA 3K1MA 4MQ9F 3WU0A 5KNLA 1MBGA 4UV9A 4BS9A 1B8IB 4LIVA 2A61A 1AKHA 3BDDA 1O3TA 2IT0A 3M8JA 1JJ6C 3BOQA 3ZN1A 2WAFA 3ISPA 4ZC3A 2NNNA 5FD6A 1LVAA 1V5FA 2F4MB 2V9KA 3ZR8X 4I09A 4ZDLA 3WU2C 3JTGA 5DD8A 2EV6A 4AU7A 1JUMA 1W5TA 1X1BA 5FGMA 4G7ZF 1J5YA 4BKXA 2R5YB 3GO5A 3HPGA 3LL7A 4LMYA 2D2WA 5FJ8J 2E1OA 4DJAA 4U0YA 1AU7A 1R4MB 3IWFA 1XDSA 5F27A 2MW8A 3HPHA 2AXTC 1KQ8A 1VQ9I 1FMWA 1WPKA 2Z16A 2EIJH 5J1YA 3OY9A 1T08B 2OQRA 4L5EA 1M1EB 4PJNA 3N4MA 4HLYA 3HEFA 1TW2A 2R7SA 1Q1HA 4NDLA 1EH7A 1ONVA 1RETA 2KFDA 2QCOA 3H5AA 5DV5A 2XF5A 1T8IA 1S8NA 3MZYA 1LEBA 2F4OB 2E34A 3A02A 5E8GA 1YS7A 3J7YJ 4LK0F 3IC7A 4RDUA 2EZLA 3WGIA 4M3BA 3A01B 2MD5A 3S1QJ 3KYCB 4A69C 3PUFA 2KHMA 3IRRA 3CESA 2FJ1A 3CMEI 1OCTC 2MBFA 3HGGA 5EEHA 5E3OA 1VQ4I 4FE4A 2EV5A 1VQMI 2XVCA 1XPXA 3DWLE 2I8DA 5D8KB 1P92A 1LDJA 4NC6A 1RPWA 3M07A 2FSWA 4EJTA 4A5MA 2EIMH 1ZK8A 2XAFA 2V4JC 4BQQA 1YITI 1UELB 2YUSA 2Y9ZA 2VC0A 3QODA 4BAYA 3RTRA 4MEXF 1Y8QB 4IHSA 2L4AA 2ZJQF 3CP8A 2RQQA 2DDBA 3CD6I 4D5CA 3B73A 2LTPA 2XPUA 3GW2A 3H5NA 3HBLA 5C4JJ 4B1RA 2M45A 3SHFA 1GUUA 2KJCA 2Q0OA 3J7AO 4KDPA 3H35A 2ZKZA 3FXJA 4F3QA 2FEZA 2R7WA 2ZJPF 2B9SA 3ABMH 1VQKI 4UB6C 1OYIA 1HF0A 2A6TA 3CMMA 1LFPA 5J4VA 5L3BA 1IRZA 3WG7H 2MLGA 1PJRA 2BW3A 4Q5SF 3I58A 1LE8A 4M9SA 1ZN2A 4RAZA 4XLCA 4PZJA 3QWLA 3AG3H 3CP2A 5LEJA 3J80Z 3KP3A 3HSFA 2CUFA 4N4NB 4NB5A 2QQAA 3VSLA 3CO6C 1ZR4A 1T95A 3I0TA 1R71A 2JA7J 1G59A 3GLLA 2IS2A 4RAFA 4BDYA 3JRHA 2KIMA 4A6DA 2FOWA 4AUXA 1NG6A 5DUIA 4MGRA 3MEXA 4FQGA 2RC4A 3H9JA 1VQ7I 2OQGA 3HTUA 2V1XA 2WC2A 1H88C 2XB5A 2LNBA 3ZGKA 4F91B 4H4KC 4KNYA 3M1EA 3HL2A 3KPHA 3U1KA 1R1TA 1WWXA 2V1NA 5TISC 3ZXSA 2RAEA 3DF8A 2MC4A 2WB1N 4AYBN 4AYBA 3A1YA 4OIQF 5K5OA 2HQAA 2R7XA 4XKBA 1BR1A 4L9NA 5IOYA 3HOWJ 1ETVA 3TP3A 5ILVA 4RBOA 2LYCA 4KN7X 2FU4A 1N77A 3S1NJ 3RKQA 5D6EA 1QPMA 4HX4A 4UY8I 3I71A 1CF7B 3R60A 4A3MJ 3GLXA 3NEUA 2E71A 2O9LA 3SZPA 3KEQA 4EEFG 3DLLF 4UVCA 1QRYA 2MG4A 3AAFA 1XMAA 4C30A 3FM3A 3C1DA 2COMA 2VE9A 1VNDA 2WWYA 2LBFA 4PCQA 4I6ZA 5TRDA 2L9NA 2A69F 2BVMA 5CVRA 4HNUA 4XNFA 4Y3OA 1G8XA 1WVRA 5L3DA 5IPAA 1ACIA 1HCRA 1MBJA 4LLGF 2VBWA 4LFUA 2HR3A 1VQOI 2A07F 4LG3A 3E3VA 2HVSA 3S2HJ 1TP4A 5LFAA 4RB2C 1F4KA 2EZIA 3F8CA 2LMDA 2QA4I 2VKHA 2DPDA 1XSVA 2O0YA 1IJWC 2V6EA 4XKVA 5AONA 1K79A 5AIQA 3FWEA 4AIDA 2PN6A 3TW7A 2F5FA 3GZNB 2MD0A 4EJOA 2W82A 1YS6A 1W1WE 3PFYA 3DEUA 4O3MA 2LR8A 2DYSH 2XDVA 3JRAA 2R5YA 4FTHA 3J7AY 1O7LA 4PDKA 2R7VA 2A05A 3SDBA 3DPTA 4GCVA 4UVAA 4DIQA 1ZRFA 2B63J 3CCMI 5TJJA 2EJRA 5EG0A 2VOOA 3LSGA 2O5RA 3AL0C 2W00A 3A0HC 2XRLA 3PSIA 1Z05A 2FBHA 5LHGA 3HC7A 3TOBA 2AO9A 4II3A 4N4OB 1SMYF 4PK4A 3S93A 1B9MA 2VONA 1B1BA 2VJ4A 2WV0A 1TNSA 2Z2SB 3C2BA 2HOAA 1Z77A 2LY1A 3E5XA 4EJVA 3HGYA 2ZO4A 3QU6A 1K6OA 4ASNA 3C2GA 2BOLA 3PM1A 3O2PE 2K7LA 1AOYA 5ILSA 1PP7U 1H8AC 2DI3A 1UHWA 3LNQA 2CW7A 2R7UA 4TV7A 2BEOA 2LKPA 2PLYA 2CRGA 4GGGA 1S3JA 5HDNA 4B3XA 4D7NA 5HNFA 5H20A 3E5QA 4AVZA 3N97A 1FOWA 4H0EA 4U7BA 4UV8A 2DJIA 1OISA 4PUSA 3IRQA 3CUQA 3MCZA 5LEKA 3HTSB 2M3AA 2FXAA 5K7FA 2HKOA 3C7JA 2KJBA 5DCMA 2NNYA 4IZZA 3ZQQA 1E2XA 2JA8J 1IRXA 3JSOA 4C3JJ 1FYLA 3LSKA 3FXMA 2LBFB 1W36C 3GTPJ 2LRDA 1R7JA 4V2FA 3BR6A 2ZMEB 1TTYA 3K70D 3K7AJ 2ZSHB 1ERDA 2WAEA 3EPZA 2BHZA 4BEHA 2QEXI 1YIJI 2F2EA 2GOMA 3L1PA 1ETWA 3ZN0A 4BE0A 1TC3C 1USTA 5LGUA 4IVNA 1HW2A 3WTSC 3R6SA 1MMNA 5FB2A 1WJFA 4OAYA 4R1HA 5CVIA 2GAUA 3CLQA 2NOJB 3RPUA 2ZBKA 3V7SA 4HZFA 5H6QA 4XICA 1T0FC 2M5WA 4RAYA 3JRBA 2WB1A 4EATA 2G7HA 4MNUA 2VPLA 4A3EJ 2V9PA 1XDUA 3HKZN 2XASA 2EK5A 3ASNH 3DCFA 1U8BA 2KT0A 3MAJA 1GT0C 2GA2A 5DCFA 1RR7A 1V5GA 3HB9A 4FX0A 1I39A 2M1BA 1YLFA 3EYIA 5M5WJ 4I0AA 2EA2A 1OKRA 2JA2A 3Q9VA 3TO9A 1JTXA 3NQOA 1XGMA 3EYYA 1ZREA 2ICWG 2DYRH 5CVJA 3GFJA 2DCEA 2DW4A 5CQGA 2CSOA 3G71I 3Q5FA 3K4BA 4XLHA 2DJNA 2ACJA 4C3HJ 5D5UB 2E7XA 1K83J 4AD9A 2H8RA 1MMSA 1WCMJ 2IS1A 3I55I 3S1RJ 2EFQA 1LDDA 2WTEA 1TL8A 2GBYA 1G2HA 1Z91A 1S72I 2OZ6A 1K6YA 3PNYA 3HG9A 5HS7A 3COAC 5BPIA 1K4SA 4ESJA 1JKOC 4I7HA 3GTJJ 1RUNA 1MZBA 4PFOA 2L7FP 4YIRX 3NAUA 3G6EI 4A12A 3I54A 4S05A 3HOZJ 2W25A 1Z21A 1VZ0A 4DYRA 4RB1A 2DMQA 3PIPF 1L3LA 3KLNA 5A2QZ 5D5XB 1PUFA 5C3EJ 1LFUP 4L18B 3WTUC 3BCAA 2LC2A 3GYHX 3OL3A 1IGNA 3C18A 5JLWA 3IL2A 2KIQA 4ANJA 2HYGD 2DQLA 5HNHA 5IOZA 3KETA 1WZ2A 2L01A 3GBGA 3WTWC 3PO2J 2R7FA 4HNTA 4IO9F 2G0EA 3TL4X 1IRFA 2HYJA 4PJ0C 3KZYA 2P6TA 5DEQA 2BE5F 4ESFA 4HDVA 1YQAA 3Q9SA 2V6CA 3HSRA 3RSNA 4OIRF 4E7SA 4UXNA 1T56A 2JWTA 2WBMA 3A03A 3K69A 4G6DA 1J7KA 3EETA 1D1AA 3WODF 3F72A 2X4HA 4HV6A 4IX7A 2FE3A 1XSXA 3F0CA 2JPBA 2P81A 4KMUX 1ZLJA 1MJ9A 2KZGA 3Q0VA 4PGGA 4M3DA 3TO6A 2CYYA 1MMDA 1ZTRA 1WJCA 3ZMDA 1U5TC 4BQAA 3M4OJ 3OWTA 2NVQJ 2P8TA 3WGGA 4EJWA 3O8HA 3V4GA 4HNVA 3VYTB 3N05A 3CCUI 2GM4A 3BCBA 3DBHB 3I3LA 1V4RA 3KEOA 2ME6A 3W3CA 4M3EA 2HQ5A 1MKMA 3DKYA 1FWZA 5B1BH 4FETA 4G9YA 2DA7A 4EM2A 2X0LA 4MTDA 3QQAA 2VBZA 5J1RA 2E19A 2DXIA 2QSHX 1KYWA 5K5QA 5DCMB 2PEXA 4NC8A 4OIOF 4LIUA 1IN4A 2HQRA 1IRGA 4FISA 1R6RA 3DEEA 5HLGA 1R1VA 3RQ4A 5KVRA 4P96A 2VE8A 2E5NA 5FKKA 1NK3P 1BW5A 3WE2A 3ABTA 2XUBA 1NH3A 1RIOH 1FSHA 3E6MA 2HOEA 3ERED 2GWRA 2XSJC 4U0VA 4G7HF 4LB5A 2VUMJ 2EFNA 5FFZA 1I6XA 4HEA2 3LSMA 2BY1A 3KLOA 1A35A 5B66C 1OPCA 2XC7A 3FK6A 4K2EA 4F93B 4E7KA 2JMWA 4ABZA 5EDNA 4LG0B 1UZCA 2DN0A 1X3ZB 2K02A 2UV1A 1G4DA 1FT9A 4B44A 1QQIA 1HSJA 4XMYA 4MLOA 1IUFA 1FP2A 4P5OA 1I27A 3SDGA 1X4PA 3D5SC 4U87A 4YFKF 3G73A 3T8RA 2YSRA 4CYCB 3PQKA 4BHPA 4YEJA 2DU9A 2E2JJ 3ZMZA 1O3QA 1FX7A 4BJTA 5J8FA 4AC0A 4L0ZB 1DPRA 1I50J 3BTIA 4KJZA 4QSHA 3QPLA 2K3FA 3Q3SA 1CGPA 2OZUA 3QPSA 3JTHA 2K9LA 4IQ4A 5D4RA 5IT9Z 2JK3A 3QP6A 4N9IA 4KN4X 1JT0A 3S3OA 1Z0XA 2F5DA 4CXFA 3OYLA 5J40A 1WI9A 4DW6A 2KIUA 5J3LA 3TKYA 2DA6A 1ON2A 1LNWA 5LGTA 3OYKA 2BV6A 4L9JA 2HZTA 5F0CA 2DFHA 2CH0A 5TGTA 2A5WA 2IGOA 3MMYB 5HLIA 4D0PA 5BOXA 3GTKJ 4AVPA 3CUQB 4A3KJ 3NRVA 4G6QA 4YFXF 1Z9CA 4L5JA 2EFOA 4HLXA 2HWVA 1YHQI 1LB2A 2H6CA 2DDAA 3OYGA 3OS0A 3H1CA 1UJ8A 1I5ZA 1I3QJ 2C6YA 2Z1DA 5FKNA 4OAZA 1FOXA 3BQYA 1TWHJ 3HUGB 3EUHA 5M5XJ 1J75A 1GLNA 2IXSA 4HSTA 3PNTA 4CHUA 3LSIA 1R22A 3DKWA 2MH2A 4PSXA 2W85A 1WHUA 5FRNA 4FT8A 2EINH 1BM9A 4EMSA 4A3GJ 5HODA 1UMQA 2HNHA 4MEYF 5J8CA 2PI0A 1XSDA 2JUCA 4BH9A 1JHHA 1P4AA 1SVLA 1U9OA 5IP6A 4HX8A 1CF7A 1MW7A 4M73A 2R5ZB 4HG2A 4B48A 3L2CA 4BXXJ 2JJ7A 3ZQCA 3K10A 3E6BA 3I4NJ 5FLVA 3RCOA 2LOOA 3VFZA 2YX7A 3GFIA 4MQVA 4PGHA 1ITYA 2Y48A 5D8LB 1P9QC 1ZR2A 2WY7Q 2X6OA 2RVCA 3CUQC 4HPQA 1SFXA 1VTNC 5DM6F 3S8PA 3IH4A 4RM2A 1TWAJ 3BTLA 5ED4A 4MO7A 3H36A 5C44J 3DP7A 4ZJZA 1MJBA 2RN7A 1EKEA 3DKXA 5IYBJ 1PDNC 4M3GA 3RYRA 1DGRM 3PJRA 3GZ5A 1XG1A 5BMZA 1FYKA 3LSHA 4D1QA 4E7JA 3HOTA 3HHHA 3H0GJ 3MVPA 1DU0A 3JW4A 1ETQA 3M9AA 2RKHA 5IT9K 2GXAA 3FBNB 3L7WA 2HFHA 4LK1F 1ZGJA 2X1DA 4E7ZA 1Y1WJ 1LEAA 2ELJA 2KDOA 3OS2A 3PNVA 4A3FJ 3L2UA 1WI3A 3W6KB 5DUKA 4M9XA 2WV1A 3BG3A 2EZHA 3H9QA 1OYYA 4XONA 3CCLI 3Q0UA 3RKXA 3BG7A 2ZB9A 4D7MA 4WCGA 4HAMA 4BBRJ 4P9UA 2I10A 4G8XA 3HXLA 4KIFA 1Z1DA 2J5OA 3DTEA 3AG1H 5CYVA 3TP0A 5E1WA 1YE9A 3OYNA 2PJPA 2LSOA 1T38A 2QSFX 4IRGA 2ETHA 3KX2A 4DBQA 1QPIA 1J59A 3AFHA 1R1UA 2DA4A 2ZMEC 2K86A 1WGXA 5F6FA 4ZTJA 5L3GA 1RNLA 1T0FA 2DTZA 1UG2A 4E6KG 5HVQC 2E2HJ 4KFCA 5F1JA 1MBHA 3TGNA 2HPMA 2K4BA 1OCRH 2DQRA 2M30A 5L3EA 5JVTA 2Y30A 5GP9A 2OBPA 1FC3A 3P9IA 3QOPA 1MDMB 4HF2A 4KMFA 4ENMA 3E7LA 4XORA 1WH7A 3KCCA 4XKWA 3W6JB 3EUAA 2ZFWA 3WTTC 2TRTA 1FBSA 2P6SA 1X2MA 3FMRA 1YW8A 1SEUA 1F36A 2Y9YA 5C4XJ 2CW8A 3OIQA 1O3SA 1AWCA 3I9V2 2DMUA 4GO1A 2XAHA 3KE2A 3P9CA 4D5FA 1HKTA 2PMZA 3GZ6A 1ZYRF 3WTYC 2OD5A 5KCMA 1QA6A 2LREA 5ICCA 2MA3A 2EPFA 2OCEA 1XCBA 3M7GA 1J0RA 1EH6A 2TCTA 5E17F 5F08A 2D45A 1T98A 2H94A 5HS8A 2LY9A 3RDIA 2M4GA 1BOAA 3PL8A 1MD0A 2E1CA 2GLOA 2IA2A 4HOBA 3E5UA 2COBA 1TNTA 3DU5A 4XLAA 2FD5A 2UWMA 1FNNA 1N75A 3WTZA 5JHFA 3CTAA 1T6SA 3DTIA 2KRCA 3RPQA 3FXUA 1HDPA 2Q8KA 4CCNA 1QHHD 2R7TA 1D1BA 4ON0A 1R23A 2KRHA 3H5RA 2L0KA 4D9JA 2F5EA 2IRFG 4RB0A 2L4MA 1YO5C 1WJEA 2D1HA 2L7KA 3UNGC 1Y56A 1F5TA 3OMYA 1UFMA 4CDGA 2LF7A 1JTYA 1TWGJ 3WHBA 1QVUA 3LQRA 2HTSA 4EGYA 2R7OA 1FIAA 2FQ3A 3ZOBA 1J9IA 2PFBA 2ZXIA 4BJ6C 3T0YA 3K9TA 3A4CA 1GXQA 5J47A 1VQNI 1X4OA 4IOCF 3V8JA 1SAXA 2L3DA 2XAJA 4ITVA 3TMOA 2HOSA 1HSTA 1STZA 3CDIA 1IUYA 1FP1D 5CLSA 3MFKA 2M8EA 3MZ8A 3BTJA 1BW6A 2XKPA 2VASA 3WHCA 2DFEA 3LOCA 3ZCOA 4JBAA 2CWEA 2KL4A 2IS6A 3F9KA 3QYFA 4YIFA 1R5ID 3HRSA 4C9YA 1ZH5A 1LQ1A 4I0BA 4DBRA 3CCRI 3DEWA 4E70A 1OQYA 4UUSA 3DV8A 3E0JB 1W7PB 3E6DA 5CKTA 4OOIA 5CPRB 5B5EC 4HRIA 5BNGA 3CCJI 4UNOA 3S16J 3ONQA 3OYEA 5LD2C 1UHMA 3K1PA 3SFIA 1MDMA 1I6HJ 1ZKGA 2OU2A 2VKEA 4G94A 4BY7J 3RIRA 3FXRA 1H0MA 2ESNA 4KUMA 5FLXZ 2M87A 1FZPB 5LRRA 2RNGA 2DODA 2L7ZA 4N9HA 2V79A 3GFLA 3F8NA 1I1GA 1D8KA 1OR7C 3F8BA 3VOEA 3JRFA 1ZAOA 2LG4A 3BZ6A 4IHYA 2M34A 3CCYA 5KHDA 1CQTA 2R92J 3JCUC 3GFMA 2EFWA 3BR0A 1HA8A 5JVGF 3GXOA 4GYIA 2VT3A 3W2WA 3BP8A 2Y31A 1I3AA 2IBDA 3OYHA 5DS9A 2ECBA 2LKSA 2IS4A 4BL0B 3EUHC 2AQEA 1IAWA 4CA0A 3ZMUA 3FKJA 4EJUA 2IW5A 2R3SA 4DZJA 1U8RA 2ID3A 3R4KA 4GXOA 4P9FA 6PAXA 3BT9A 3CDHA 4P55A 1A04A 1QZZA 2OAZA 1K78B 3ZQIA 2N8GA 5EGOB 3G1LA 4BHCA 1ZELA 2QQ8A 3V8LA 1RKWA 2XAGA 3FISA 1BOBA 2KDZA 3PQJA 2R0QC 1TWFJ 5EJCA 5EZGA 4IRIA 1W0TA 3K2ZA 1UHSA 3IAM2 5D6FA 3ZMSA 5JFRA 1O7FA 4BY1J 3U9GA 3T8TA 2KP6A 1K4TA 4ZYHA 3VSKA 2PJRB 2CV0A 1FTTA 1GV2A 3IH2A 5HOOA 4IHVA 3T5XA 4IOAF 2Q2EB 2CV2A 3IUOA 1BI3A 2W7NA 4YIIA 3KP2A 3KYDB 3JAMK 5F04A 3FHZA 1G3SA 3ASOH 4UUTA 1P2FA 3O3KA 4XK4A 5HLTA 3CJNA 1E17A 4ESBA 2P7CB 1S9HA 1OFCX 2D1VA 1XX5A 1F9NA 3R61A 4ZYAA 3PIOF 1RZ4A 2KLOA 2WAQA 2XPWA 3BR3A 4Y7NJ 2EH3A 3KYLA 4KICA 1NTCA 3JRGA 4BXUA 2DFIA 1A36A 2VJJA 1BR4A 1BC7C 2WADA 1MSEC 5M3MJ 1GHCA 1FLIA 4JX5A 2FOKA 3GTGJ 2QQBA 3ROUA 1ULYA 2H6BA 2Y0SA 2KKOA 2ADUA 4IL6C 4CYCA 1KONA 3FXQA 4R8HA 2LK2A 2ELKA 4G7OF 1DPUA 3CCVI 4E7LA 4Z2YA 2XSDC 3HRMA 3CZ6A 1G3TA 2Z3YA 4B43A 2DT7B 2G7UA 3GWZA 3CJRB 1R4NB 5E1XA 5FKLA 1SD7A 2HGCA 4HYEA 1QZYA 3LA7A 4AIHA 1YJNI 5GAEJ 1TBXA 2E60A 4KT5C 2HXOA 3U1DA 3IH3A 3ABUA 1JJ8C 2F6CA 3PO3J 5E3LA 4B3AA 4A6EA 3TEDA 2VBXA 3AG4H 2JA6J 2HZDA 1BL0A 2VQGA 3OR2C 3CMYA 1Z7LA 3CC4I 2LKXA 3VDXA 2STWA 4I99C 3ZQ7A 3OS1A 4ZDOA 4DNCA 3I56I 4OWRB 3LSJA 3ZQHA 1ENHA 2H1LA 3V42A 2Z5UA 1QBJA 1XGNA 2FMYA 5EYRA 2W48A 3IP4B 2Q1ZB 2PMHA 5FROA 4AWXB 3P7NA 4XRFA 1A5JA 1R36A 3D0SA 2YU3A 3JSPA 3KFWX 4KISA 4RA2A 2NXNB 1F43A 1PYVA 1D0XA 3A0BC 2NVUB 3GCMA 1IC8A 1JUSA 4U7DA 4JQFA 2L5QA 4Y13A 1MSFC 3OOUA 1Z3YA 3S14J 1B72A 1FOKA 4WXHA 1TT0A 4RMNA 1EJ9A 3J81K 1WRJA 3E6CC 2VLAA 4JOMA 3GEZA 1W7PA 1HKQA 2JSCA 5JI6A 1EA3A 3F22A 1P7IA 3BR5A 2QSGX 1U3EM 4M6YA 4NUBA 1VFCA 1NK2P 3D1NI 2CFOA 3U21A 3HOVJ 4KIBA 3KP5A 5DD4A 3WGHA 5M5YJ 5K7HA 3U2RA 2V7FA 1QVTA 3C2HA 2JN6A 3KP4A 2K9SA 2RV8A 2MH9A 1VI0A 2PQ8A 3K70C 1P4XA 4FCYA 1W36D 3V7CA 4HA8A 3CO7C 1SFUA 1MBKA 1PUEE 2KZVA 4NNJA 3RZDJ 5IYDJ 3GVAA 4HF0A 1SFKA 1JHFA 4UUSB 2L02A 2R5ZA 2XROA 2XGDA 1ZARA 1NHAA 5IP7J 2MFZA 4X1EA 1JKPC 2K3PA 3HOXJ 2AQFA 4BE1A 2JVHA 1B4AA 3O8GA 3WU1B 2R7QA 3HM5A 3OSGA 4LD5A 3KP6A 2HVQA 1MMGA 2HYFA 1EV7A 1QZEA 2HKXA 1L0OC 3F21A 4JX6A 3BWGA 2QBYB 1TW3A 1KU3A 3W2AA 3ABKH 3RI4A 5M3FJ 1KQ9A 1XCVA 5BS6A 2UZKA 4G12A 4XRSG 3OYFA 2CG4A 5B3SH 3WG9A 2DK8A 2J5PA 3K4KA 1Y8RB 3HZJA 4PJLA 1W0UA 4OINF 4CUGA 3HIFA 4UB8C 1FMVA 1E3OC 3MZHA 4QLCU 4YFNF 2XRNA 1SANA 2GIZA 4BBSJ 4JX4A 4ETSA 3LQQA 3S3NA 3HOSA 2F48A 2OC6A 1U5TB 2CQQA 3CQZJ 1SFOJ 2X9DA 3TW6A 2JRTA 2YS9A 2DA1A 3WTXC 3J7ZI 3F6VA 4XRMA 3I59A 2VKDA 4QWQA 5FKOA 1MGTA 2DA3A 1HKSA 4P1WA 1HQCA 1YTYA 2PJRA 1WKMA 5F1RA 2VC1A 1ZG1A 1R5GA 1MH3A 2X1EA 1X19A 1QU3A 2JT1A 3IHUA 2JUGA 4Q48A 5ERIA 5F0FA 1R5HA 5ILUA 1C0WA 2AS5F 2B0LA 3OL4A 3BG9A 4LB6B 3ECOA 2EB7A 3M3YJ 2VXDA 4PFPA 3CF2A 3HYIA 4L0YB 1ZQ3P 3RJPA 3BR1A 2ISZA 2EFPA 1YYVA 3I53A 4E4HA 5IY5H 4M6VA 4RGUA 1U2WA 2FMLA 3OR1C 3BZKA 2JQ7A 1U0JA 4UVBA 1RRJA 3S15J 5EEAA 5E79C 3KIOA 2FQ4A 2FNPA 1MNMC 1USSA 2VL8A 1P4WA 2DT5A 1X1CA 2GIVA 1OCZH 2K9NA 3S32A 4X0GA 3L2WA 1KU7A 3SZGA 1S6LA 3IWZA 4M3FA 2ZNZA 5LRSA 2ZMEA 2I5UA 3CDLA 2RDPA 1ETXA 5H6RA 1E3PA 1E3HA 2CW0F 4HV5A 4V2GA 2XIGA 3HDDA 2P5LC 1PUFB 1DDNA 4IQJA 5HS9A 1D5YA 3MWMA 1A6IA 4WXDA 4B47A 3OYAA 2XF6A 1MMAA 3K4MA 1R58A 2FA5A 4LLNA 1ZHFA 2TDXA 4HQMA 3I4MJ 5K1YA 3ZRGA 2JA5J 4C3IJ 4CCOA 3BG6A 3KZZA 5FKMA 4WK8F 3TOAA 1IN8A 5CVUA 2V26A 1JGSA 3MD2A 3K4LA 3J80K 4C2MJ 5HDGA 1ZGWA 4A3IJ 1Y39A 1KU2A 3OYMA 3P9KA 2A5YB 2KMUA 5GADJ 1UCRA 5FD5A 1ETKA 2E35A 2OJED 3SJMA 3QU3A 2HS5A 1PP8F 2W84A 3S3MA 3BJ6A 2VN2A 1X2NA 5IYCJ 1HDDC 2B7EA 1OCCH 2XGEA 1WH5A 1T33A 2CQKA 2BXYA 3VYSB 4IHWA 4II2A 1GVJA 1S7EA 5CJ9A 4FE7A 4XIDA 1APLC 2VOPA 1U5TA 4XOTA 2K40A 3AL0B 3H3UA 2D5VA 1X1AA 2WA0A 2ID6A 2Y69H 3AG2H 2VQHA 2AHQA 5E3NA 4XM3A 4RB3C 1WQ2A 2DT6A 2STTA 1DP3A 4W97A 2QWWA 3RYPA 2NVYJ 5ICEA 3QP5A 1POGA 3B6AA 1MBFA 3FXOA 5ICGA 2IAIA 3L09A 1YJ9I 3GF2A 4ZZLA 3DTKA 1OYWA 2E2IJ 2BZTA 3S17J 1EH8A 3SEZA 3OIPA 2BHYA 2VI6A 4ZDPA 1D8JA 2PBIA 2BXZA 4RGXA 1ETYA 2IP2A 3DBRB 2Q2EA 3L9FA 2OCCH 2V1DA 2LVSA 2E1NA 1BI1A 3ULQB 4DOZA 3F23A 5HLHA 3VB2A 1SD6A 1T2KA 2O6GE 3M8FA 3W6VA 3MN2A 1YX5A 4F52A 2MSYA 1LPQA 1ZRCA 3EQLF 2XAQA 2X6XA 2H1KA 2IGNA 4BACA 5EGOA 3JR9A 5GAHJ 4A3JJ 1R49A 3HRUA 3VEPA 3JAMZ 1G6NA 3AKZA 3G2BA 2O61A 1OCPA 5J4YA 1IXRC 2O8XA 2MGQA 1WJDA 2QUFA 3WE3A 4CYDA 2HPIA 4L5IA 1P7JA 2JRMA 4GDFA 2VB6A 5IP9J 5K7ZA 2LF8A 4I76A 4AIJA 3HOUJ 2ZCWA 1ZLKA 2CUJA 3ZMTA 3FZVA 2DBBA 1XD7A 2P5VA 1X58A 2H27A 1G3WA 4BNCA 4NQWB 4OU0A 4X6AJ 2M9HA 4EM1A 3NWTA 4BHBA 3L2RA 1K78A 2LD5A 3BQZA 4G6TB 3BJOA 3GX4X 4PJJA 2R7RA 1FIPA 3G4SI 4NC7A 4Y4RA 4C2UA 1X1PA 4Z6YA 3S2DJ 4GYGA 1HBXG 2OTLI 2RQPA 4A0XA 2CQ7A 3PFIA 3OYCA 2RNJA 4A2UA 2OA4A 1S29A 4V19K 2M7AA 5JLXA 1O3RA 3C3WA 3IKVA 2VKVA 5GAGJ 3SQNA 1ZG3A 2GXGA 5E1ZB 4EV0A 1W7PD 2MLKA 4EQQA 1MBEA 3UKGA 5E8IA 2VQLA 2FNAA 2IEKA 2CU7A 1TZLA 2CUEA 2DMPA 2ESHA 3OYIA 3K6GA 1V54H 1YRNB 1Z6TA 2DFFA 3LA2A 4LLLA 1IN6A 4A0ZA 1U9NA 3J81Z 4LITA 4EVIA 3VPRA 1HW5A 3RZOJ 2K27A 3NARA 3ZQFA 1V55H 3SFZA 3MKLA 4RAGA 4J19A 1SFEA 5L3FA 1HOMA 2GOXB 1LE8B 4A3DJ 4Y33A 2CJJA 2PX9A 3G1MA 1A31A 1UAAA 4Y52J 2IPQX 1ON1A 3FMQA 3GTQJ 1D0YA 2L7MP 3Q0WA 1X3UA 1YW7A 2F5VA 3CCQI 4MFDA 4LG0A 2L54A 2DPUA 5D5VB 5B1AH 2E36A 2QZ8A 2KIFA 2QF7A 1O57A 2VBYA 2W4SA 3P5JA 1B9NA 2CGPA 3TDUC 2AXLA 5CQEA 1T39A 2KPMA 2X6YA 3FBIB 1RKTA 1XGSA 4WXCA 4KYWA 2H8WA 1FTZA 2K5CA 5DDGA 3M1CA 3BY6A 2MYSA 1BI2A 3K1NA 3ZP5A 3QAHA 2DA5A 1KA8A 1G3YA 2R4GA 2XGCA 3ESWB 4RLQA 4XLPF 4GFBA 2VODA 4XBFA 4FASD 3B02A 2M0MA 2QENA 2A6HF 2HVRA 2QQ9A 1QO0D 3LSPA 1K7AA 2DO7A 1IZ1A 5FO5A 1H9GA 1MJAA 1SMTA 5BQTA 3ZQLA 2JSPA 3F6OA 4R79A 5CVVA 2QGUA 3HRTA 1ZG5A 3QPTA 3QYBA 2V9VA 2Y0SN 5EEGA 4CH7A 1B8IA 2QKLB 4MHGA 3TO7A 1FBUA 2DA2A 4JYKA 4IF4A 2F5CA 4LGWA 1YG2A 2CQXA 2K85A 1QNTA 4MTEA 2P0WA 1VQPI 2LLKA 4I2OA 3PSFA 4MIMA 4S04A 1SAUA 1JE8A 5D5WB 5EG0B 1FYMA 3FK7A 2L9RA 2WAQN 3QRFF 1X3WB 2NS7A 2Z33A 3BG5A 3LFKA 2QKMB 4BE2A 1O4XA 2NVTJ 1J09A 4M9ZA 3M8EA 2K4JA 1S7AA 1AKHB 3JRCA 5DTDA 1A6QA 4HBLA 3G1OA 3S2WA 2IJLA 2NAZA 2Y2ZA 3FXLA 4RGRA 4EGZA 3R0JA 1KQ0A 4CCKA 1IXCA 3L00A 1SD4A 1BI0A 2DLLA 4W1UA 2BY0A 1B6AA 2M8GX 1SC7A 1TT5B 4IHXA 2DAOA 4J00A 4M72A 2NYXA 3RQIA 4DZPA 1WSUA 2VJIA 3LWFA 3ERMA 2X51A 4YELA 4WX9A 4HDUA 3S1MJ 1LJ9A 4HSRA 4U0WA 1YJWI 4PJMA 1D3YA 2ZJRF 2XF7A 3MKYB 1XB4A 2QBYA 4XL9A 2IGKA 1AA7A 3H92A 3H0DA 2HOTA 2YR2A 1B59A 4BGDA 4KA4A 1FBQA 1X1DA 1LVKA 2A3SA 2WY8Q 3ZPLA 2CMPA 3CJQB 4XLEA 4ENJA 1BJZA 3LAJA 1SVMA 3CUOA 4OMZA 4UHTA 3TQNA 2CV1A 2YPRA 3HSEA 3MKZA 3ZQGA 5LHIA 3GTMJ 2DOFA 3ML6A 2ZJ2A 5FLXK 1OR7A 4IPAA 1JKRC 2HTJA 4DYCA 2RREA 2OTJI 3DLAA 1N25A 4XLFA 1RR8C 1TLHB 3CLOA 2OV7A 3H9GA 3F3XA 2XHKA 5HDKA 1BJAA 3K4CA 3EDPA 2M4KA 3FMSA 4XN0A 4CSWA 3IAS2 4KITB 1RUOA 2RGVA 2EA4A 3L2QA 2XPVA 2E5ZA 4XSXF 3RKYA 4CO8A 3CCSI 3FHNA 2XV4S 3WTVC 4IXAA 3VWBA 5KK1A 3ELKA 5GPAA 3OSFA 1YFHA 2EWNA 2BYVE 1YX3A 1EF4A 1IV8A 4BUPA 4M74A 5A2QK 2KISA 2XB0X 1RC9A 3DFGA 5KAFC 1XC5A 4BU2A 3BR2A 2EBIA 2BVLA 3MQ0A 2JTVA 1JI8A 1W5CC 3D5LA 4O6JA 2GA1A 1BN5A 2NRAC 1R9TJ 3CMAI 1JXSA 1XMKA 1Z67A 3SXYA 4JK1X 2R93J 4S0HB 2LY2A 1NG7A 1BC8C 2ZXWH 4F7ZA 4HW0A 2CFXA 2YX4A 4PSWA 5DYMA 3REOA 2E7WA 1IDZA 3RPUD 1DP7P 3FX3A 1J2XA 1MNDA 2FUG2 2ELHA 1TQIA 2HQNA 3K0LA 4I01A 4E7HA 2VQCA 3FIWA 4RM3A 4FHTA 4HX7A 3OYJA 4WF2A 2F4IA 4IEJA 2X85A 1D1CA 2HEOA 5F64A 1OMIA 4ZYEA 2NVXJ 1YOVB 3B6CA 5LBQA 1XS9A 3BTCA 5L3CA 1Q1VA 5FLMJ 2IVMA 3KP7A 2W57A 3JREA 5BPDA 2CO5A 1QHGA 5H2FC 1WJBA 4U88A 5F0HA 3FKIJ 3RKWA 1BA5A 3JRDA 3HOYJ 1IW7F 3SZTA 2FRHA 4A5NA 4RS8A 4IRHA 4ENKA 1H89C 1PVEA 2VT2A 2P7VB 3EUKL 2O8KA 1HXDA 1JKQC 2YU9J 2HU9A 4KIGA 2QYOA 3G3ZA 2CUZA 1VQLI 3I59B 4C2TA 1VQ8I 3UR3C 2A6EF 4M71A 3JRIA 2GXBA 2JZYA 2PMUA 4NHJA 2P4WA 2QLZA 1JGGA 1U6GA 2O03A 1VQ6I 2HI3A 3CCEI 4A93J 4CCJA 3NWSA 2MABA 4QIWN 1BIBA 2BY3A 4ENNA 3K2AA 2DK5A 1N78A 2FBIA 3CJTB 4A0YA 4WWCA 1IF1A 3K4JA 3CC7I 1RI7A 2UXXA 1MIJA 2PMZN 1D0ZA 2BY2A 3E97A 4QPQA 4BJ5C 2ECCA 4B09A 1LDKB 3KEYA 4EM0B 2A68F 3FM5A 2G9WA 1P6RA 1F1ZA 1Z7UA 2H09A 2KRFA 1TWCJ 1ZRDA 3DU6A 2DMTA 2BBYA 5FFXA 3VODA 2M2EA 2Z9OA 2CQNA 5E20A 2CS3A 2GQQA 1SVOA 4BXFA 2M0CA 1QGPA 1FY7A 3BC8A 3QYEA 1FEXA 3IV5A 5GTIC 5IT3A 4Y15A 3OV8A 4I98B 3OYBA 2K9MA 2JPCA 2X48A 1JT6A 3LSTA 3QOEA 1KU9A 4M6XA 2NS8A 3LAPA 4QPOA 1IV6A 2EV0A 2IA0A 1YW9A 2IGMA 4ZYGA 2QM3A 2DOAA 4CGZA 1Y0NA 1H9TA 2O7OA 2XAUA 2OPTA 3KZIC 3DPUA 1V5EA 2R7DA 2VJ5A 4I02A 1W4MA 3CC2I 2ZXJA 4XSZF 2R7ZJ 4L9TA 4IHTA 4BDZA 2BGCA 1RESA 4XLNF 1HW1A 3A01A 5KAIC 1E0EA 1U78A 2HDCA 2VXZA 1FJLA 2X1CA 3BPXA 5EZHA 4O5VA 3FXKA 3O6BB 3OYDA 5AIPA 3TDZC 3T1BA 2W24A 2ZC2A 4B8XA 4ZZDA 1B72B 1Y1VJ 3QPHA 4A3LJ 2EILH 3BJAA 4YRVA 5E3MA 2NS0A 4ZYDA 4CCMA 2V1UA 5LGNA 1W5SA 2FBKA 2FX0A 4CICA 1DUXC 1FSEA 4B4CA 3F8FA 2Y0MA 3OOPA 4ZH4F 3V7RA 4BQNA 5GTHC 4HQEA 4MFEA 1TQMA 3LFUA 2LP0A 5J1UA 4XN3A 3I64A 1D5VA 1YI2I 4FX4A 1UB9A 3ABLH 3VYUB 1HLVA 1IN5A 3A2KA 1IO2A 5LHHA 2ZFUA 1WJAA 1S7OA 4OMYA 2UXNA 1YRNA 1KGSA 1HC8A 2LH9A 1ETOA 3DQVC 4AM3A 2X6WA 4Q4ZF 4QTRA 3MKWB 3K4NA 1FPQA 2W1OA 2UUZA 1K61A 2HDWA 3GTLJ 3DBLB 4OIPF 1JUPA 1DGWY 3H3VK 2DTRA 4RGSA 4DGWB 1MH4A 1Y6IA 1LKXA 3L2VA 1WJ5A 4KT6A 2EIKH 1YIOA 2QVOA 4A3BJ 1OJLA 3HJEA 5EF6A 1IG7A 2DMNA 2L2OA 3LA3A 4XKCA 1GV5A 2OUMA 1REPC 4RLFA 1XMXA 4YG2F 2Y75A 3FF5A 5FRMA
chains in the Genus database with same CATH topology
4Y17A 2LDUA 1XN7A 1SD5A 3GUDA 4UUVA 3I5UA 2MC3A 5K5RA 1I1SA 4CZZA 2P5KA 4AIKA 4HF1A 1XGOA 2ZNYA 3DPLC 4BYYA 3BPVA 2O3FA 3I4PA 1IXSB 5JHUA 4IJAA 5E18F 3HHGA 3HUGA 4Q47A 4L9VA 5JR3A 1BBYA 2PG4A 4N0BA 4DQ2A 2XKOA 1BIAA 3ZMVA 2FF4A 3ECHA 2Z99A 3V8KA 1KYZA 3H3ZA 1R00A 1ODDA 2XGXA 1ZGAA 5J6XA 5ICFA 1Y0UA 5LLQA 1Z6RA 5D4SA 3IKTA 4NQWA 2IA1A 2ISYA 4LJZF 1GXPA 3R0AA 2GZWA 3BROA 3DXJF 1TQPA 1IN7A 1V3FA 3F8MA 3K1MA 4MQ9F 3WU0A 4UV9A 2A61A 3BDDA 1O3TA 2IT0A 3BOQA 3ZN1A 3ISPA 2NNNA 5FD6A 1LVAA 4I09A 3JTGA 5DD8A 2EV6A 1W5TA 5FGMA 4G7ZF 1J5YA 3GO5A 4LMYA 2D2WA 4U0YA 3IWFA 1XDSA 1KQ8A 2OQRA 3N4MA 4HLYA 1TW2A 1Q1HA 1EH7A 1ONVA 5DV5A 1S8NA 3MZYA 1LEBA 5E8GA 1YS7A 4LK0F 3IC7A 3WGIA 2MD5A 3IRRA 2MBFA 5EEHA 2EV5A 2XVCA 5D8KB 1P92A 1LDJA 2FSWA 4EJTA 4A5MA 2XAFA 2VC0A 4BAYA 3RTRA 4MEXF 4IHSA 2L4AA 3B73A 3GW2A 2M45A 3SHFA 2KJCA 2Q0OA 3J7AO 4KDPA 2ZKZA 2FEZA 1OYIA 5L3BA 2MLGA 4Q5SF 3I58A 4M9SA 1ZN2A 4RAZA 4PZJA 5LEJA 3J80Z 3KP3A 3HSFA 4NB5A 2QQAA 3CO6C 3I0TA 2KIMA 4A6DA 5DUIA 4MGRA 3MEXA 2RC4A 2OQGA 3HTUA 2V1XA 2WC2A 4KNYA 2LNBA 3M1EA 1R1TA 1WWXA 3DF8A 4OIQF 5K5OA 4L9NA 5ILVA 4KN7X 2FU4A 5D6EA 1QPMA 4HX4A 3I71A 1CF7B 3R60A 3GLXA 3NEUA 3SZPA 3KEQA 4UVCA 3AAFA 1XMAA 3FM3A 3C1DA 2COMA 2VE9A 2WWYA 4PCQA 5TRDA 2A69F 5CVRA 5L3DA 4LLGF 2VBWA 4LFUA 2HR3A 2A07F 3E3VA 4RB2C 1F4KA 3F8CA 2DPDA 1XSVA 2O0YA 5AONA 1K79A 5AIQA 3FWEA 2PN6A 2F5FA 4EJOA 1YS6A 3DEUA 4O3MA 1O7LA 4PDKA 3DPTA 4GCVA 4UVAA 1ZRFA 5TJJA 2EJRA 2VOOA 1Z05A 2FBHA 5LHGA 3TOBA 1SMYF 1B9MA 2VONA 1B1BA 2WV0A 1TNSA 3E5XA 4EJVA 2ZO4A 3QU6A 1K6OA 4ASNA 3O2PE 2K7LA 1AOYA 5ILSA 1PP7U 2DI3A 1UHWA 4TV7A 2BEOA 2LKPA 2PLYA 4GGGA 1S3JA 5HDNA 5H20A 3E5QA 3N97A 4H0EA 4U7BA 4UV8A 3IRQA 3CUQA 3MCZA 5LEKA 3HTSB 2FXAA 2HKOA 3C7JA 2KJBA 5DCMA 2NNYA 1E2XA 3JSOA 1FYLA 1R7JA 2ZMEB 1TTYA 2F2EA 3ZN0A 1USTA 5LGUA 4IVNA 1HW2A 3WTSC 3R6SA 5FB2A 4R1HA 5CVIA 2GAUA 3RPUA 2ZBKA 3V7SA 4HZFA 5H6QA 2M5WA 4RAYA 2G7HA 4MNUA 1XDUA 2XASA 2EK5A 3MAJA 2GA2A 5DCFA 4FX0A 2M1BA 1YLFA 3EYIA 4I0AA 2EA2A 1OKRA 3Q9VA 3TO9A 3NQOA 1XGMA 3EYYA 1ZREA 5CVJA 3GFJA 3Q5FA 2DW4A 2CSOA 2ACJA 5D5UB 2E7XA 4AD9A 2EFQA 1LDDA 2WTEA 1Z91A 2OZ6A 5HS7A 3COAC 5BPIA 1RUNA 2CGPA 4ESJA 4I7HA 1MZBA 4A12A 3I54A 4S05A 2W25A 4RB1A 1L3LA 3KLNA 5A2QZ 5D5XB 4L18B 3WTUC 3GYHX 3C18A 3IL2A 2HYGD 2DQLA 3KETA 2L01A 3WTWC 2R7FA 1IRFA 3KZYA 2P6TA 5DEQA 2BE5F 4ESFA 4HDVA 1YQAA 3Q9SA 2V6CA 3HSRA 4OIRF 4UXNA 3K69A 4G6DA 1J7KA 3EETA 3WODF 3F72A 2X4HA 4HV6A 2FE3A 1XSXA 2JPBA 4KMUX 1ZLJA 1MJ9A 4PGGA 3TO6A 2CYYA 3ZMDA 1U5TC 4BQAA 2P8TA 3WGGA 4EJWA 3V4GA 1V4RA 3KEOA 1MKMA 1FWZA 4G9YA 4EM2A 2X0LA 4MTDA 2VBZA 1KYWA 5K5QA 5DCMB 2PEXA 4OIOF 1IN4A 2HQRA 1IRGA 5HLGA 1R1VA 5KVRA 4P96A 2VE8A 3WE2A 3ABTA 2XUBA 1RIOH 1FSHA 3E6MA 2HOEA 3ERED 2GWRA 4G7HF 4U0VA 4LB5A 2EFNA 5FFZA 1I6XA 3KLOA 1OPCA 4K2EA 4LG0B 2K02A 1G4DA 1FT9A 1QQIA 1HSJA 1FP2A 4P5OA 1I27A 4YFKF 3G73A 3T8RA 2YSRA 3PQKA 4BHPA 2DU9A 3ZMZA 1O3QA 1FX7A 5J8FA 4L0ZB 1DPRA 1CGPA 2OZUA 3JTHA 5IT9Z 5D4RA 3QP6A 4N9IA 4KN4X 2F5DA 4CXFA 1WI9A 2KIUA 3TKYA 1ON2A 1LNWA 5LGTA 2BV6A 4L9JA 2HZTA 5HLIA 4D0PA 5BOXA 4AVPA 3CUQB 3NRVA 4YFXF 4G6QA 1Z9CA 4L5JA 2EFOA 4HLXA 2HWVA 1LB2A 2H6CA 1I5ZA 2C6YA 3EUHA 1J75A 4CHUA 1R22A 3DKWA 2MH2A 2W85A 4FT8A 1BM9A 4EMSA 4MEYF 5J8CA 2PI0A 1XSDA 4BH9A 1JHHA 1P4AA 4HX8A 1CF7A 4M73A 3L2CA 3E6BA 3VFZA 2YX7A 3GFIA 4MQVA 4PGHA 2Y48A 5D8LB 2RVCA 3CUQC 1SFXA 1VTNC 5ED4A 3DP7A 1MJBA 2RN7A 1PDNC 3RYRA 3GZ5A 5BMZA 1FYKA 3HOTA 3HHHA 3JW4A 3M9AA 2RKHA 5IT9K 3L7WA 2HFHA 4LK1F 1ZGJA 1LEAA 3W6KB 5DUKA 4M9XA 1OYYA 3RKXA 4WCGA 4HAMA 4P9UA 4G8XA 4KIFA 1Z1DA 2J5OA 5CYVA 5E1WA 2PJPA 2LSOA 1T38A 4IRGA 2ETHA 1J59A 1R1UA 2K86A 5F6FA 5L3GA 1RNLA 1T0FA 5HVQC 4KFCA 3TGNA 2K4BA 2DQRA 2M30A 5L3EA 5JVTA 2OBPA 1FC3A 3P9IA 3QOPA 1MDMB 4HF2A 4KMFA 4ENMA 3KCCA 3W6JB 3WTTC 2ZFWA 1FBSA 2P6SA 3FMRA 1YW8A 1O3SA 1AWCA 4GO1A 2XAHA 3KE2A 3P9CA 1HKTA 3GZ6A 1ZYRF 3WTYC 2OD5A 5ICCA 2MA3A 1XCBA 3M7GA 1J0RA 1EH6A 5E17F 2D45A 1T98A 2H94A 5HS8A 3RDIA 1BOAA 1MD0A 2E1CA 2IA2A 4HOBA 3E5UA 1TNTA 2UWMA 1FNNA 3WTZA 3CTAA 1T6SA 3RPQA 3FXUA 2Q8KA 4ON0A 1R23A 2F5EA 2IRFG 4RB0A 2L4MA 1YO5C 2D1HA 1F5TA 1UFMA 4CDGA 2LF7A 3LQRA 2HTSA 4EGYA 2FQ3A 1J9IA 2PFBA 3T0YA 3K9TA 1GXQA 1SAXA 3V8JA 2L3DA 2XAJA 1HSTA 1STZA 1IUYA 1FP1D 5CLSA 3MFKA 2M8EA 2XKPA 4JBAA 2CWEA 4YIFA 3HRSA 1ZH5A 1LQ1A 4I0BA 4E70A 3DV8A 1W7PB 3E6DA 4OOIA 4UNOA 1UHMA 3K1PA 1MDMA 2OU2A 3RIRA 1H0MA 4G94A 3FXRA 2ESNA 4KUMA 5FLXZ 2M87A 1FZPB 5LRRA 4N9HA 2V79A 3GFLA 3F8NA 1I1GA 1D8KA 3F8BA 3VOEA 1ZAOA 3BZ6A 3GFMA 2EFWA 3GXOA 4GYIA 2VT3A 3BP8A 1IAWA 3ZMUA 4EJUA 2IW5A 2R3SA 1U8RA 3R4KA 4GXOA 4P9FA 6PAXA 3CDHA 4P55A 1A04A 1QZZA 2OAZA 1K78B 4BHCA 3V8LA 2XAGA 3PQJA 4IRIA 3K2ZA 5D6FA 3ZMSA 5JFRA 1O7FA 3U9GA 3T8TA 4ZYHA 5HOOA 3T5XA 1BI3A 4YIIA 3KP2A 3JAMK 3FHZA 1G3SA 1P2FA 3O3KA 3CJNA 1E17A 4ESBA 2P7CB 2D1VA 1F9NA 3R61A 1RZ4A 4KICA 4BXUA 2DFIA 1BC7C 1GHCA 1FLIA 2FOKA 2QQBA 3ROUA 1ULYA 2H6BA 2KKOA 2ADUA 3FXQA 4R8HA 4G7OF 1DPUA 4Z2YA 3HRMA 1G3TA 2Z3YA 2G7UA 3GWZA 5E1XA 1SD7A 2HGCA 4HYEA 1QZYA 3LA7A 4AIHA 1TBXA 4KT5C 3U1DA 3ABUA 4A6EA 2VBXA 2STWA 3ZQ7A 4DNCA 1QBJA 2Z5UA 1XGNA 2FMYA 2PMHA 4AWXB 3P7NA 4XRFA 1R36A 3D0SA 2YU3A 3JSPA 3KFWX 4U7DA 4JQFA 4Y13A 1FOKA 4WXHA 3J81K 1WRJA 3E6CC 3GEZA 1W7PA 1HKQA 2JSCA 5JI6A 3F22A 1U3EM 4M6YA 4KIBA 3KP5A 5DD4A 3WGHA 3U2RA 3KP4A 2RV8A 2MH9A 2PQ8A 1P4XA 3V7CA 4HA8A 3CO7C 1SFUA 1PUEE 3GVAA 4HF0A 1JHFA 2L02A 2XROA 1ZARA 1NHAA 1B4AA 3WU1B 4LD5A 3KP6A 2HYFA 1EV7A 2HKXA 1L0OC 3F21A 2QBYB 3BWGA 1TW3A 1KU3A 3RI4A 1KQ9A 1XCVA 5BS6A 2UZKA 2CG4A 3WG9A 2DK8A 2J5PA 4OINF 3HIFA 3MZHA 4QLCU 4YFNF 2XRNA 4ETSA 3LQQA 3HOSA 1U5TB 2JRTA 3WTXC 3F6VA 3I59A 4QWQA 1MGTA 1HKSA 1YTYA 1HQCA 1WKMA 5F1RA 2VC1A 1ZG1A 1R5GA 2JT1A 3IHUA 4Q48A 5ERIA 1R5HA 5ILUA 1C0WA 2AS5F 2B0LA 4LB6B 3ECOA 2EB7A 3HYIA 4L0YB 3RJPA 2ISZA 2EFPA 1YYVA 3I53A 4RGUA 1U2WA 2FMLA 4UVBA 2FNPA 1USSA 1P4WA 2DT5A 2GIVA 1KU7A 1S6LA 3IWZA 5LRSA 2ZNZA 2ZMEA 2RDPA 5H6RA 2CW0F 4HV5A 2XIGA 2P5LC 1DDNA 5HS9A 3MWMA 4WXDA 1R58A 2FA5A 4LLNA 1ZHFA 2TDXA 4HQMA 5K1YA 3KZZA 4WK8F 3TOAA 1IN8A 5CVUA 1JGSA 3J80K 5HDGA 1KU2A 3P9KA 2A5YB 1UCRA 5FD5A 3QU3A 2HS5A 1PP8F 2W84A 3BJ6A 2VN2A 2CQKA 1GVJA 5CJ9A 2VOPA 1U5TA 3H3UA 4RB3C 1WQ2A 2STTA 2QWWA 3RYPA 5ICEA 3QP5A 5ICGA 3L09A 3GF2A 4ZZLA 1OYWA 1EH8A 1D8JA 2PBIA 4RGXA 2IP2A 2Q2EA 3L9FA 2V1DA 2E1NA 1BI1A 3ULQB 3F23A 5HLHA 3VB2A 1SD6A 1T2KA 2O6GE 3M8FA 1ZRCA 3EQLF 2XAQA 3HRUA 3VEPA 3JAMZ 1G6NA 2O61A 1IXRC 2O8XA 2QUFA 3WE3A 4CYDA 4L5IA 2LF8A 4AIJA 2ZCWA 1ZLKA 3ZMTA 3FZVA 2DBBA 1XD7A 2P5VA 2H27A 1G3WA 4BNCA 4OU0A 4EM1A 4BHBA 1K78A 3BJOA 3GX4X 4GYGA 1HBXG 2RQPA 4A0XA 3PFIA 2RNJA 4A2UA 2OA4A 1S29A 1O3RA 3C3WA 3IKVA 3SQNA 1ZG3A 2GXGA 5E1ZB 4EV0A 1W7PD 2MLKA 4EQQA 5E8IA 2FNAA 2ESHA 1Z6TA 3LA2A 4LLLA 1IN6A 4A0ZA 3J81Z 4EVIA 1HW5A 2K27A 3SFZA 1SFEA 5L3FA 2IPQX 1ON1A 3FMQA 1X3UA 1YW7A 4LG0A 2L54A 2DPUA 5D5VB 2QZ8A 2KIFA 1O57A 2VBYA 1B9NA 3TDUC 2AXLA 1T39A 1XGSA 4WXCA 4KYWA 5DDGA 3BY6A 1BI2A 3K1NA 3ZP5A 3QAHA 1KA8A 1G3YA 4XLPF 2VODA 4XBFA 3B02A 2QENA 2A6HF 2QQ9A 1QO0D 1K7AA 2DO7A 1IZ1A 5FO5A 1H9GA 1MJAA 1SMTA 5BQTA 3F6OA 4R79A 5CVVA 3HRTA 1ZG5A 3QPTA 2V9VA 5EEGA 4MHGA 3TO7A 1FBUA 4IF4A 2F5CA 4LGWA 1YG2A 1QNTA 4MTEA 4I2OA 4S04A 1JE8A 5D5WB 1FYMA 3QRFF 2Z33A 3LFKA 4M9ZA 3M8EA 2K4JA 1S7AA 4HBLA 3S2WA 2IJLA 2NAZA 4EGZA 4RGRA 3R0JA 1KQ0A 1IXCA 3L00A 1SD4A 1BI0A 2DLLA 1B6AA 2DAOA 4M72A 2NYXA 1WSUA 3LWFA 4WX9A 4HDUA 1LJ9A 4U0WA 1D3YA 1XB4A 2QBYA 3H92A 2YR2A 1B59A 4KA4A 1FBQA 2A3SA 3ZPLA 4ENJA 3LAJA 3CUOA 4OMZA 4UHTA 3TQNA 2YPRA 3HSEA 5LHIA 3ML6A 2ZJ2A 5FLXK 1OR7A 4IPAA 2HTJA 1TLHB 3CLOA 3F3XA 2XHKA 5HDKA 1BJAA 3EDPA 3FMSA 1RUOA 2EA4A 2RGVA 4XSXF 3RKYA 4CO8A 2XV4S 3WTVC 4IXAA 5KK1A 3ELKA 1YFHA 2EWNA 2BYVE 4M74A 5A2QK 3DFGA 3MQ0A 2JTVA 3D5LA 4O6JA 2GA1A 1BN5A 2NRAC 1JXSA 1XMKA 3SXYA 4JK1X 1BC8C 4F7ZA 4HW0A 2CFXA 2YX4A 5DYMA 3REOA 2E7WA 1DP7P 3FX3A 1J2XA 3K0LA 2ELHA 1TQIA 2HQNA 4I01A 4FHTA 4HX7A 4WF2A 2HEOA 5F64A 1OMIA 4ZYEA 5LBQA 5L3CA 2IVMA 3KP7A 2W57A 5BPDA 2CO5A 4U88A 3RKWA 1IW7F 3SZTA 2FRHA 4A5NA 4RS8A 4IRHA 4ENKA 2VT2A 2P7VB 1HXDA 4KIGA 2QYOA 3G3ZA 3I59B 2A6EF 4M71A 2GXBA 2JZYA 2PMUA 4NHJA 2P4WA 2QLZA 1U6GA 2O03A 1BIBA 4ENNA 2DK5A 1IF1A 2FBIA 4A0YA 4WWCA 1RI7A 2UXXA 3E97A 4B09A 1LDKB 4EM0B 2A68F 2G9WA 3FM5A 1P6RA 1F1ZA 2H09A 1Z7UA 2KRFA 1ZRDA 2BBYA 5FFXA 3VODA 2Z9OA 5E20A 2GQQA 1QGPA 1FY7A 5IT3A 4Y15A 3OV8A 4I98B 2JPCA 3LSTA 1KU9A 4M6XA 3LAPA 2EV0A 2IA0A 1YW9A 4ZYGA 2QM3A 4CGZA 1H9TA 2R7DA 4I02A 1W4MA 2ZXJA 4XSZF 4L9TA 4IHTA 2BGCA 4XLNF 1HW1A 1U78A 2HDCA 2VXZA 3BPXA 4O5VA 3O6BB 5AIPA 3TDZC 3T1BA 2W24A 4B8XA 4ZZDA 3QPHA 3BJAA 2NS0A 4ZYDA 2V1UA 5LGNA 1W5SA 2FBKA 4CICA 1DUXC 1FSEA 3F8FA 2Y0MA 3OOPA 4ZH4F 3V7RA 4HQEA 1TQMA 3I64A 1D5VA 4FX4A 1UB9A 1IN5A 5LHHA 1S7OA 4OMYA 2UXNA 1KGSA 3DQVC 4Q4ZF 1FPQA 4OIPF 2DTRA 4RGSA 1YIOA 2QVOA 3LA3A 1REPC 4YG2F 2Y75A 3FF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y17 A;  2LDU A;  1XN7 A;  1SD5 A;  3GUD A;  4UUV A;  3I5U A;  2MC3 A;  5K5R A;  1I1S A;  4CZZ A;  2P5K A;  4AIK A;  4HF1 A;  1XGO A;  2ZNY A;  3DPL C;  4BYY A;  3BPV A;  2O3F A;  3I4P A;  1IXS B;  5JHU A;  4IJA A;  5E18 F;  3HHG A;  3HUG A;  4Q47 A;  4L9V A;  5JR3 A;  1BBY A;  2PG4 A;  4N0B A;  4DQ2 A;  2XKO A;  1BIA A;  3ZMV A;  2FF4 A;  3ECH A;  2Z99 A;  3V8K A;  1KYZ A;  3H3Z A;  1R00 A;  1ODD A;  2XGX A;  1ZGA A;  5J6X A;  5ICF A;  1Y0U A;  5LLQ A;  1Z6R A;  5D4S A;  3IKT A;  4NQW A;  2IA1 A;  2ISY A;  4LJZ F;  1GXP A;  3R0A A;  2GZW A;  3BRO A;  3DXJ F;  1TQP A;  1IN7 A;  1V3F A;  3F8M A;  3K1M A;  4MQ9 F;  3WU0 A;  4UV9 A;  2A61 A;  3BDD A;  1O3T A;  2IT0 A;  3BOQ A;  3ZN1 A;  3ISP A;  2NNN A;  5FD6 A;  1LVA A;  4I09 A;  3JTG A;  5DD8 A;  2EV6 A;  1W5T A;  5FGM A;  4G7Z F;  1J5Y A;  3GO5 A;  4LMY A;  2D2W A;  4U0Y A;  3IWF A;  1XDS A;  1KQ8 A;  2OQR A;  3N4M A;  4HLY A;  1TW2 A;  1Q1H A;  1EH7 A;  1ONV A;  5DV5 A;  1S8N A;  3MZY A;  1LEB A;  5E8G A;  1YS7 A;  4LK0 F;  3IC7 A;  3WGI A;  2MD5 A;  3IRR A;  2MBF A;  5EEH A;  2EV5 A;  2XVC A;  5D8K B;  1P92 A;  1LDJ A;  2FSW A;  4EJT A;  4A5M A;  2XAF A;  2VC0 A;  4BAY A;  3RTR A;  4MEX F;  4IHS A;  2L4A A;  3B73 A;  3GW2 A;  2M45 A;  3SHF A;  2KJC A;  2Q0O A;  3J7A O;  4KDP A;  2ZKZ A;  2FEZ A;  1OYI A;  5L3B A;  2MLG A;  4Q5S F;  3I58 A;  4M9S A;  1ZN2 A;  4RAZ A;  4PZJ A;  5LEJ A;  3J80 Z;  3KP3 A;  3HSF A;  4NB5 A;  2QQA A;  3CO6 C;  3I0T A;  2KIM A;  4A6D A;  5DUI A;  4MGR A;  3MEX A;  2RC4 A;  2OQG A;  3HTU A;  2V1X A;  2WC2 A;  4KNY A;  2LNB A;  3M1E A;  1R1T A;  1WWX A;  3DF8 A;  4OIQ F;  5K5O A;  4L9N A;  5ILV A;  4KN7 X;  2FU4 A;  5D6E A;  1QPM A;  4HX4 A;  3I71 A;  1CF7 B;  3R60 A;  3GLX A;  3NEU A;  3SZP A;  3KEQ A;  4UVC A;  3AAF A;  1XMA A;  3FM3 A;  3C1D A;  2COM A;  2VE9 A;  2WWY A;  4PCQ A;  5TRD A;  2A69 F;  5CVR A;  5L3D A;  4LLG F;  2VBW A;  4LFU A;  2HR3 A;  2A07 F;  3E3V A;  4RB2 C;  1F4K A;  3F8C A;  2DPD A;  1XSV A;  2O0Y A;  5AON A;  1K79 A;  5AIQ A;  3FWE A;  2PN6 A;  2F5F A;  4EJO A;  1YS6 A;  3DEU A;  4O3M A;  1O7L A;  4PDK A;  3DPT A;  4GCV A;  4UVA A;  1ZRF A;  5TJJ A;  2EJR A;  2VOO A;  1Z05 A;  2FBH A;  5LHG A;  3TOB A;  1SMY F;  1B9M A;  2VON A;  1B1B A;  2WV0 A;  1TNS A;  3E5X A;  4EJV A;  2ZO4 A;  3QU6 A;  1K6O A;  4ASN A;  3O2P E;  2K7L A;  1AOY A;  5ILS A;  1PP7 U;  2DI3 A;  1UHW A;  4TV7 A;  2BEO A;  2LKP A;  2PLY A;  4GGG A;  1S3J A;  5HDN A;  5H20 A;  3E5Q A;  3N97 A;  4H0E A;  4U7B A;  4UV8 A;  3IRQ A;  3CUQ A;  3MCZ A;  5LEK A;  3HTS B;  2FXA A;  2HKO A;  3C7J A;  2KJB A;  5DCM A;  2NNY A;  1E2X A;  3JSO A;  1FYL A;  1R7J A;  2ZME B;  1TTY A;  2F2E A;  3ZN0 A;  1UST A;  5LGU A;  4IVN A;  1HW2 A;  3WTS C;  3R6S A;  5FB2 A;  4R1H A;  5CVI A;  2GAU A;  3RPU A;  2ZBK A;  3V7S A;  4HZF A;  5H6Q A;  2M5W A;  4RAY A;  2G7H A;  4MNU A;  1XDU A;  2XAS A;  2EK5 A;  3MAJ A;  2GA2 A;  5DCF A;  4FX0 A;  2M1B A;  1YLF A;  3EYI A;  4I0A A;  2EA2 A;  1OKR A;  3Q9V A;  3TO9 A;  3NQO A;  1XGM A;  3EYY A;  1ZRE A;  5CVJ A;  3GFJ A;  3Q5F A;  2DW4 A;  2CSO A;  2ACJ A;  5D5U B;  2E7X A;  4AD9 A;  2EFQ A;  1LDD A;  2WTE A;  1Z91 A;  2OZ6 A;  5HS7 A;  3COA C;  5BPI A;  1RUN A;  2CGP A;  4ESJ A;  4I7H A;  1MZB A;  4A12 A;  3I54 A;  4S05 A;  2W25 A;  4RB1 A;  1L3L A;  3KLN A;  5A2Q Z;  5D5X B;  4L18 B;  3WTU C;  3GYH X;  3C18 A;  3IL2 A;  2HYG D;  2DQL A;  3KET A;  2L01 A;  3WTW C;  2R7F A;  1IRF A;  3KZY A;  2P6T A;  5DEQ A;  2BE5 F;  4ESF A;  4HDV A;  1YQA A;  3Q9S A;  2V6C A;  3HSR A;  4OIR F;  4UXN A;  3K69 A;  4G6D A;  1J7K A;  3EET A;  3WOD F;  3F72 A;  2X4H A;  4HV6 A;  2FE3 A;  1XSX A;  2JPB A;  4KMU X;  1ZLJ A;  1MJ9 A;  4PGG A;  3TO6 A;  2CYY A;  3ZMD A;  1U5T C;  4BQA A;  2P8T A;  3WGG A;  4EJW A;  3V4G A;  1V4R A;  3KEO A;  1MKM A;  1FWZ A;  4G9Y A;  4EM2 A;  2X0L A;  4MTD A;  2VBZ A;  1KYW A;  5K5Q A;  5DCM B;  2PEX A;  4OIO F;  1IN4 A;  2HQR A;  1IRG A;  5HLG A;  1R1V A;  5KVR A;  4P96 A;  2VE8 A;  3WE2 A;  3ABT A;  2XUB A;  1RIO H;  1FSH A;  3E6M A;  2HOE A;  3ERE D;  2GWR A;  4G7H F;  4U0V A;  4LB5 A;  2EFN A;  5FFZ A;  1I6X A;  3KLO A;  1OPC A;  4K2E A;  4LG0 B;  2K02 A;  1G4D A;  1FT9 A;  1QQI A;  1HSJ A;  1FP2 A;  4P5O A;  1I27 A;  4YFK F;  3G73 A;  3T8R A;  2YSR A;  3PQK A;  4BHP A;  2DU9 A;  3ZMZ A;  1O3Q A;  1FX7 A;  5J8F A;  4L0Z B;  1DPR A;  1CGP A;  2OZU A;  3JTH A;  5IT9 Z;  5D4R A;  3QP6 A;  4N9I A;  4KN4 X;  2F5D A;  4CXF A;  1WI9 A;  2KIU A;  3TKY A;  1ON2 A;  1LNW A;  5LGT A;  2BV6 A;  4L9J A;  2HZT A;  5HLI A;  4D0P A;  5BOX A;  4AVP A;  3CUQ B;  3NRV A;  4YFX F;  4G6Q A;  1Z9C A;  4L5J A;  2EFO A;  4HLX A;  2HWV A;  1LB2 A;  2H6C A;  1I5Z A;  2C6Y A;  3EUH A;  1J75 A;  4CHU A;  1R22 A;  3DKW A;  2MH2 A;  2W85 A;  4FT8 A;  1BM9 A;  4EMS A;  4MEY F;  5J8C A;  2PI0 A;  1XSD A;  4BH9 A;  1JHH A;  1P4A A;  4HX8 A;  1CF7 A;  4M73 A;  3L2C A;  3E6B A;  3VFZ A;  2YX7 A;  3GFI A;  4MQV A;  4PGH A;  2Y48 A;  5D8L B;  2RVC A;  3CUQ C;  1SFX A;  1VTN C;  5ED4 A;  3DP7 A;  1MJB A;  2RN7 A;  1PDN C;  3RYR A;  3GZ5 A;  5BMZ A;  1FYK A;  3HOT A;  3HHH A;  3JW4 A;  3M9A A;  2RKH A;  5IT9 K;  3L7W A;  2HFH A;  4LK1 F;  1ZGJ A;  1LEA A;  3W6K B;  5DUK A;  4M9X A;  1OYY A;  3RKX A;  4WCG A;  4HAM A;  4P9U A;  4G8X A;  4KIF A;  1Z1D A;  2J5O A;  5CYV A;  5E1W A;  2PJP A;  2LSO A;  1T38 A;  4IRG A;  2ETH A;  1J59 A;  1R1U A;  2K86 A;  5F6F A;  5L3G A;  1RNL A;  1T0F A;  5HVQ C;  4KFC A;  3TGN A;  2K4B A;  2DQR A;  2M30 A;  5L3E A;  5JVT A;  2OBP A;  1FC3 A;  3P9I A;  3QOP A;  1MDM B;  4HF2 A;  4KMF A;  4ENM A;  3KCC A;  3W6J B;  3WTT C;  2ZFW A;  1FBS A;  2P6S A;  3FMR A;  1YW8 A;  1O3S A;  1AWC A;  4GO1 A;  2XAH A;  3KE2 A;  3P9C A;  1HKT A;  3GZ6 A;  1ZYR F;  3WTY C;  2OD5 A;  5ICC A;  2MA3 A;  1XCB A;  3M7G A;  1J0R A;  1EH6 A;  5E17 F;  2D45 A;  1T98 A;  2H94 A;  5HS8 A;  3RDI A;  1BOA A;  1MD0 A;  2E1C A;  2IA2 A;  4HOB A;  3E5U A;  1TNT A;  2UWM A;  1FNN A;  3WTZ A;  3CTA A;  1T6S A;  3RPQ A;  3FXU A;  2Q8K A;  4ON0 A;  1R23 A;  2F5E A;  2IRF G;  4RB0 A;  2L4M A;  1YO5 C;  2D1H A;  1F5T A;  1UFM A;  4CDG A;  2LF7 A;  3LQR A;  2HTS A;  4EGY A;  2FQ3 A;  1J9I A;  2PFB A;  3T0Y A;  3K9T A;  1GXQ A;  1SAX A;  3V8J A;  2L3D A;  2XAJ A;  1HST A;  1STZ A;  1IUY A;  1FP1 D;  5CLS A;  3MFK A;  2M8E A;  2XKP A;  4JBA A;  2CWE A;  4YIF A;  3HRS A;  1ZH5 A;  1LQ1 A;  4I0B A;  4E70 A;  3DV8 A;  1W7P B;  3E6D A;  4OOI A;  4UNO A;  1UHM A;  3K1P A;  1MDM A;  2OU2 A;  3RIR A;  1H0M A;  4G94 A;  3FXR A;  2ESN A;  4KUM A;  5FLX Z;  2M87 A;  1FZP B;  5LRR A;  4N9H A;  2V79 A;  3GFL A;  3F8N A;  1I1G A;  1D8K A;  3F8B A;  3VOE A;  1ZAO A;  3BZ6 A;  3GFM A;  2EFW A;  3GXO A;  4GYI A;  2VT3 A;  3BP8 A;  1IAW A;  3ZMU A;  4EJU A;  2IW5 A;  2R3S A;  1U8R A;  3R4K A;  4GXO A;  4P9F A;  6PAX A;  3CDH A;  4P55 A;  1A04 A;  1QZZ A;  2OAZ A;  1K78 B;  4BHC A;  3V8L A;  2XAG A;  3PQJ A;  4IRI A;  3K2Z A;  5D6F A;  3ZMS A;  5JFR A;  1O7F A;  3U9G A;  3T8T A;  4ZYH A;  5HOO A;  3T5X A;  1BI3 A;  4YII A;  3KP2 A;  3JAM K;  3FHZ A;  1G3S A;  1P2F A;  3O3K A;  3CJN A;  1E17 A;  4ESB A;  2P7C B;  2D1V A;  1F9N A;  3R61 A;  1RZ4 A;  4KIC A;  4BXU A;  2DFI A;  1BC7 C;  1GHC A;  1FLI A;  2FOK A;  2QQB A;  3ROU A;  1ULY A;  2H6B A;  2KKO A;  2ADU A;  3FXQ A;  4R8H A;  4G7O F;  1DPU A;  4Z2Y A;  3HRM A;  1G3T A;  2Z3Y A;  2G7U A;  3GWZ A;  5E1X A;  1SD7 A;  2HGC A;  4HYE A;  1QZY A;  3LA7 A;  4AIH A;  1TBX A;  4KT5 C;  3U1D A;  3ABU A;  4A6E A;  2VBX A;  2STW A;  3ZQ7 A;  4DNC A;  1QBJ A;  2Z5U A;  1XGN A;  2FMY A;  2PMH A;  4AWX B;  3P7N A;  4XRF A;  1R36 A;  3D0S A;  2YU3 A;  3JSP A;  3KFW X;  4U7D A;  4JQF A;  4Y13 A;  1FOK A;  4WXH A;  3J81 K;  1WRJ A;  3E6C C;  3GEZ A;  1W7P A;  1HKQ A;  2JSC A;  5JI6 A;  3F22 A;  1U3E M;  4M6Y A;  4KIB A;  3KP5 A;  5DD4 A;  3WGH A;  3U2R A;  3KP4 A;  2RV8 A;  2MH9 A;  2PQ8 A;  1P4X A;  3V7C A;  4HA8 A;  3CO7 C;  1SFU A;  1PUE E;  3GVA A;  4HF0 A;  1JHF A;  2L02 A;  2XRO A;  1ZAR A;  1NHA A;  1B4A A;  3WU1 B;  4LD5 A;  3KP6 A;  2HYF A;  1EV7 A;  2HKX A;  1L0O C;  3F21 A;  2QBY B;  3BWG A;  1TW3 A;  1KU3 A;  3RI4 A;  1KQ9 A;  1XCV A;  5BS6 A;  2UZK A;  2CG4 A;  3WG9 A;  2DK8 A;  2J5P A;  4OIN F;  3HIF A;  3MZH A;  4QLC U;  4YFN F;  2XRN A;  4ETS A;  3LQQ A;  3HOS A;  1U5T B;  2JRT A;  3WTX C;  3F6V A;  3I59 A;  4QWQ A;  1MGT A;  1HKS A;  1YTY A;  1HQC A;  1WKM A;  5F1R A;  2VC1 A;  1ZG1 A;  1R5G A;  2JT1 A;  3IHU A;  4Q48 A;  5ERI A;  1R5H A;  5ILU A;  1C0W A;  2AS5 F;  2B0L A;  4LB6 B;  3ECO A;  2EB7 A;  3HYI A;  4L0Y B;  3RJP A;  2ISZ A;  2EFP A;  1YYV A;  3I53 A;  4RGU A;  1U2W A;  2FML A;  4UVB A;  2FNP A;  1USS A;  1P4W A;  2DT5 A;  2GIV A;  1KU7 A;  1S6L A;  3IWZ A;  5LRS A;  2ZNZ A;  2ZME A;  2RDP A;  5H6R A;  2CW0 F;  4HV5 A;  2XIG A;  2P5L C;  1DDN A;  5HS9 A;  3MWM A;  4WXD A;  1R58 A;  2FA5 A;  4LLN A;  1ZHF A;  2TDX A;  4HQM A;  5K1Y A;  3KZZ A;  4WK8 F;  3TOA A;  1IN8 A;  5CVU A;  1JGS A;  3J80 K;  5HDG A;  1KU2 A;  3P9K A;  2A5Y B;  1UCR A;  5FD5 A;  3QU3 A;  2HS5 A;  1PP8 F;  2W84 A;  3BJ6 A;  2VN2 A;  2CQK A;  1GVJ A;  5CJ9 A;  2VOP A;  1U5T A;  3H3U A;  4RB3 C;  1WQ2 A;  2STT A;  2QWW A;  3RYP A;  5ICE A;  3QP5 A;  5ICG A;  3L09 A;  3GF2 A;  4ZZL A;  1OYW A;  1EH8 A;  1D8J A;  2PBI A;  4RGX A;  2IP2 A;  2Q2E A;  3L9F A;  2V1D A;  2E1N A;  1BI1 A;  3ULQ B;  3F23 A;  5HLH A;  3VB2 A;  1SD6 A;  1T2K A;  2O6G E;  3M8F A;  1ZRC A;  3EQL F;  2XAQ A;  3HRU A;  3VEP A;  3JAM Z;  1G6N A;  2O61 A;  1IXR C;  2O8X A;  2QUF A;  3WE3 A;  4CYD A;  4L5I A;  2LF8 A;  4AIJ A;  2ZCW A;  1ZLK A;  3ZMT A;  3FZV A;  2DBB A;  1XD7 A;  2P5V A;  2H27 A;  1G3W A;  4BNC A;  4OU0 A;  4EM1 A;  4BHB A;  1K78 A;  3BJO A;  3GX4 X;  4GYG A;  1HBX G;  2RQP A;  4A0X A;  3PFI A;  2RNJ A;  4A2U A;  2OA4 A;  1S29 A;  1O3R A;  3C3W A;  3IKV A;  3SQN A;  1ZG3 A;  2GXG A;  5E1Z B;  4EV0 A;  1W7P D;  2MLK A;  4EQQ A;  5E8I A;  2FNA A;  2ESH A;  1Z6T A;  3LA2 A;  4LLL A;  1IN6 A;  4A0Z A;  3J81 Z;  4EVI A;  1HW5 A;  2K27 A;  3SFZ A;  1SFE A;  5L3F A;  2IPQ X;  1ON1 A;  3FMQ A;  1X3U A;  1YW7 A;  4LG0 A;  2L54 A;  2DPU A;  5D5V B;  2QZ8 A;  2KIF A;  1O57 A;  2VBY A;  1B9N A;  3TDU C;  2AXL A;  1T39 A;  1XGS A;  4WXC A;  4KYW A;  5DDG A;  3BY6 A;  1BI2 A;  3K1N A;  3ZP5 A;  3QAH A;  1KA8 A;  1G3Y A;  4XLP F;  2VOD A;  4XBF A;  3B02 A;  2QEN A;  2A6H F;  2QQ9 A;  1QO0 D;  1K7A A;  2DO7 A;  1IZ1 A;  5FO5 A;  1H9G A;  1MJA A;  1SMT A;  5BQT A;  3F6O A;  4R79 A;  5CVV A;  3HRT A;  1ZG5 A;  3QPT A;  2V9V A;  5EEG A;  4MHG A;  3TO7 A;  1FBU A;  4IF4 A;  2F5C A;  4LGW A;  1YG2 A;  1QNT A;  4MTE A;  4I2O A;  4S04 A;  1JE8 A;  5D5W B;  1FYM A;  3QRF F;  2Z33 A;  3LFK A;  4M9Z A;  3M8E A;  2K4J A;  1S7A A;  4HBL A;  3S2W A;  2IJL A;  2NAZ A;  4EGZ A;  4RGR A;  3R0J A;  1KQ0 A;  1IXC A;  3L00 A;  1SD4 A;  1BI0 A;  2DLL A;  1B6A A;  2DAO A;  4M72 A;  2NYX A;  1WSU A;  3LWF A;  4WX9 A;  4HDU A;  1LJ9 A;  4U0W A;  1D3Y A;  1XB4 A;  2QBY A;  3H92 A;  2YR2 A;  1B59 A;  4KA4 A;  1FBQ A;  2A3S A;  3ZPL A;  4ENJ A;  3LAJ A;  3CUO A;  4OMZ A;  4UHT A;  3TQN A;  2YPR A;  3HSE A;  5LHI A;  3ML6 A;  2ZJ2 A;  5FLX K;  1OR7 A;  4IPA A;  2HTJ A;  1TLH B;  3CLO A;  3F3X A;  2XHK A;  5HDK A;  1BJA A;  3EDP A;  3FMS A;  1RUO A;  2EA4 A;  2RGV A;  4XSX F;  3RKY A;  4CO8 A;  2XV4 S;  3WTV C;  4IXA A;  5KK1 A;  3ELK A;  1YFH A;  2EWN A;  2BYV E;  4M74 A;  5A2Q K;  3DFG A;  3MQ0 A;  2JTV A;  3D5L A;  4O6J A;  2GA1 A;  1BN5 A;  2NRA C;  1JXS A;  1XMK A;  3SXY A;  4JK1 X;  1BC8 C;  4F7Z A;  4HW0 A;  2CFX A;  2YX4 A;  5DYM A;  3REO A;  2E7W A;  1DP7 P;  3FX3 A;  1J2X A;  3K0L A;  2ELH A;  1TQI A;  2HQN A;  4I01 A;  4FHT A;  4HX7 A;  4WF2 A;  2HEO A;  5F64 A;  1OMI A;  4ZYE A;  5LBQ A;  5L3C A;  2IVM A;  3KP7 A;  2W57 A;  5BPD A;  2CO5 A;  4U88 A;  3RKW A;  1IW7 F;  3SZT A;  2FRH A;  4A5N A;  4RS8 A;  4IRH A;  4ENK A;  2VT2 A;  2P7V B;  1HXD A;  4KIG A;  2QYO A;  3G3Z A;  3I59 B;  2A6E F;  4M71 A;  2GXB A;  2JZY A;  2PMU A;  4NHJ A;  2P4W A;  2QLZ A;  1U6G A;  2O03 A;  1BIB A;  4ENN A;  2DK5 A;  1IF1 A;  2FBI A;  4A0Y A;  4WWC A;  1RI7 A;  2UXX A;  3E97 A;  4B09 A;  1LDK B;  4EM0 B;  2A68 F;  2G9W A;  3FM5 A;  1P6R A;  1F1Z A;  2H09 A;  1Z7U A;  2KRF A;  1ZRD A;  2BBY A;  5FFX A;  3VOD A;  2Z9O A;  5E20 A;  2GQQ A;  1QGP A;  1FY7 A;  5IT3 A;  4Y15 A;  3OV8 A;  4I98 B;  2JPC A;  3LST A;  1KU9 A;  4M6X A;  3LAP A;  2EV0 A;  2IA0 A;  1YW9 A;  4ZYG A;  2QM3 A;  4CGZ A;  1H9T A;  2R7D A;  4I02 A;  1W4M A;  2ZXJ A;  4XSZ F;  4L9T A;  4IHT A;  2BGC A;  4XLN F;  1HW1 A;  1U78 A;  2HDC A;  2VXZ A;  3BPX A;  4O5V A;  3O6B B;  5AIP A;  3TDZ C;  3T1B A;  2W24 A;  4B8X A;  4ZZD A;  3QPH A;  3BJA A;  2NS0 A;  4ZYD A;  2V1U A;  5LGN A;  1W5S A;  2FBK A;  4CIC A;  1DUX C;  1FSE A;  3F8F A;  2Y0M A;  3OOP A;  4ZH4 F;  3V7R A;  4HQE A;  1TQM A;  3I64 A;  1D5V A;  4FX4 A;  1UB9 A;  1IN5 A;  5LHH A;  1S7O A;  4OMY A;  2UXN A;  1KGS A;  3DQV C;  4Q4Z F;  1FPQ A;  4OIP F;  2DTR A;  4RGS A;  1YIO A;  2QVO A;  3LA3 A;  1REP C;  4YG2 F;  2Y75 A;  3FF5 A; 
#chains in the Genus database with same CATH topology
 4Y17 A;  1GVD A;  2LDU A;  3OIO A;  2ZSI B;  4ZTF A;  2JVG A;  1VF9 A;  1LUJ B;  1XN7 A;  3PUB A;  3LSR A;  1SD5 A;  3GUD A;  1WFX A;  4UUV A;  3I5U A;  3X2Q H;  2MC3 A;  4F92 B;  1DQU A;  5K5R A;  4CZC A;  5DM7 F;  1I1S A;  1BR2 A;  1OCO H;  4CZZ A;  4XRS A;  2P5K A;  4AIK A;  4HF1 A;  1XGO A;  2BW3 B;  2ZNY A;  3DPL C;  1FOY A;  4XR6 A;  4GRI A;  4BYY A;  2OF7 A;  3BPV A;  2EQR A;  2DOE A;  2O3F A;  4JP0 A;  4CCL A;  4J01 A;  2E1M B;  1IDY A;  1UG0 A;  2HXI A;  3I4P A;  1S5L C;  1IXS B;  4IKF A;  3BLY A;  5JHU A;  4IJA A;  5E18 F;  1OLT A;  3GME A;  3HHG A;  1ORK A;  4BEH B;  3HUG A;  4Q47 A;  3D5R C;  1XTA A;  4L9V A;  3VYR B;  2L9S A;  3SYT A;  1DU6 A;  5JR3 A;  4E7I A;  1MNE A;  2LFB A;  1BBY A;  2VIX A;  3FDY A;  3CF5 F;  2L9V A;  1LFB A;  2PG4 A;  3SEQ A;  4N0B A;  4DQ2 A;  1GDT A;  2XKO A;  2HDD A;  1BIA A;  3W2V A;  3ZMV A;  4A3C J;  2EZK A;  1KZH A;  2FF4 A;  3ECH A;  2Z99 A;  3V8K A;  1KYZ A;  2NOG A;  3H3Z A;  1R00 A;  1ODD A;  2XGX A;  1ZGA A;  3HKZ A;  5J6X A;  5GPC A;  1VQ5 I;  2VPR A;  3E1S A;  4F55 A;  4BQO A;  3GTO J;  5ICF A;  4LOC A;  1Y0U A;  2ME0 A;  3LMM A;  4DYQ A;  5LLQ A;  1Z6R A;  5D4S A;  3IKT A;  4NQW A;  2IA1 A;  2ISY A;  4LJZ F;  1Z3X A;  1AHD P;  3TBI A;  4XQF A;  1GXP A;  2E1M C;  3R0A A;  4XOP A;  2GZW A;  3BRO A;  3DXJ F;  2ZXH A;  2K9Q A;  3BZC A;  1TQP A;  2M7B A;  2KQR A;  1IN7 A;  1V3F A;  4NBQ A;  9ANT A;  3F8M A;  3K1M A;  4MQ9 F;  3WU0 A;  5KNL A;  1MBG A;  4UV9 A;  4BS9 A;  1B8I B;  4LIV A;  2A61 A;  1AKH A;  3BDD A;  1O3T A;  2IT0 A;  3M8J A;  1JJ6 C;  3BOQ A;  3ZN1 A;  2WAF A;  3ISP A;  4ZC3 A;  2NNN A;  5FD6 A;  1LVA A;  1V5F A;  2F4M B;  2V9K A;  3ZR8 X;  4I09 A;  4ZDL A;  3WU2 C;  3JTG A;  5DD8 A;  2EV6 A;  4AU7 A;  1JUM A;  1W5T A;  1X1B A;  5FGM A;  4G7Z F;  1J5Y A;  4BKX A;  2R5Y B;  3GO5 A;  3HPG A;  3LL7 A;  4LMY A;  2D2W A;  5FJ8 J;  2E1O A;  4DJA A;  4U0Y A;  1AU7 A;  1R4M B;  3IWF A;  1XDS A;  5F27 A;  2MW8 A;  3HPH A;  2AXT C;  1KQ8 A;  1VQ9 I;  1FMW A;  1WPK A;  2Z16 A;  2EIJ H;  5J1Y A;  3OY9 A;  1T08 B;  2OQR A;  4L5E A;  1M1E B;  4PJN A;  3N4M A;  4HLY A;  3HEF A;  1TW2 A;  2R7S A;  1Q1H A;  4NDL A;  1EH7 A;  1ONV A;  1RET A;  2KFD A;  2QCO A;  3H5A A;  5DV5 A;  2XF5 A;  1T8I A;  1S8N A;  3MZY A;  1LEB A;  2F4O B;  2E34 A;  3A02 A;  5E8G A;  1YS7 A;  3J7Y J;  4LK0 F;  3IC7 A;  4RDU A;  2EZL A;  3WGI A;  4M3B A;  3A01 B;  2MD5 A;  3S1Q J;  3KYC B;  4A69 C;  3PUF A;  2KHM A;  3IRR A;  3CES A;  2FJ1 A;  3CME I;  1OCT C;  2MBF A;  3HGG A;  5EEH A;  5E3O A;  1VQ4 I;  4FE4 A;  2EV5 A;  1VQM I;  2XVC A;  1XPX A;  3DWL E;  2I8D A;  5D8K B;  1P92 A;  1LDJ A;  4NC6 A;  1RPW A;  3M07 A;  2FSW A;  4EJT A;  4A5M A;  2EIM H;  1ZK8 A;  2XAF A;  2V4J C;  4BQQ A;  1YIT I;  1UEL B;  2YUS A;  2Y9Z A;  2VC0 A;  3QOD A;  4BAY A;  3RTR A;  4MEX F;  1Y8Q B;  4IHS A;  2L4A A;  2ZJQ F;  3CP8 A;  2RQQ A;  2DDB A;  3CD6 I;  4D5C A;  3B73 A;  2LTP A;  2XPU A;  3GW2 A;  3H5N A;  3HBL A;  5C4J J;  4B1R A;  2M45 A;  3SHF A;  1GUU A;  2KJC A;  2Q0O A;  3J7A O;  4KDP A;  3H35 A;  2ZKZ A;  3FXJ A;  4F3Q A;  2FEZ A;  2R7W A;  2ZJP F;  2B9S A;  3ABM H;  1VQK I;  4UB6 C;  1OYI A;  1HF0 A;  2A6T A;  3CMM A;  1LFP A;  5J4V A;  5L3B A;  1IRZ A;  3WG7 H;  2MLG A;  1PJR A;  2BW3 A;  4Q5S F;  3I58 A;  1LE8 A;  4M9S A;  1ZN2 A;  4RAZ A;  4XLC A;  4PZJ A;  3QWL A;  3AG3 H;  3CP2 A;  5LEJ A;  3J80 Z;  3KP3 A;  3HSF A;  2CUF A;  4N4N B;  4NB5 A;  2QQA A;  3VSL A;  3CO6 C;  1ZR4 A;  1T95 A;  3I0T A;  1R71 A;  2JA7 J;  1G59 A;  3GLL A;  2IS2 A;  4RAF A;  4BDY A;  3JRH A;  2KIM A;  4A6D A;  2FOW A;  4AUX A;  1NG6 A;  5DUI A;  4MGR A;  3MEX A;  4FQG A;  2RC4 A;  3H9J A;  1VQ7 I;  2OQG A;  3HTU A;  2V1X A;  2WC2 A;  1H88 C;  2XB5 A;  2LNB A;  3ZGK A;  4F91 B;  4H4K C;  4KNY A;  3M1E A;  3HL2 A;  3KPH A;  3U1K A;  1R1T A;  1WWX A;  2V1N A;  5TIS C;  3ZXS A;  2RAE A;  3DF8 A;  2MC4 A;  2WB1 N;  4AYB N;  4AYB A;  3A1Y A;  4OIQ F;  5K5O A;  2HQA A;  2R7X A;  4XKB A;  1BR1 A;  4L9N A;  5IOY A;  3HOW J;  1ETV A;  3TP3 A;  5ILV A;  4RBO A;  2LYC A;  4KN7 X;  2FU4 A;  1N77 A;  3S1N J;  3RKQ A;  5D6E A;  1QPM A;  4HX4 A;  4UY8 I;  3I71 A;  1CF7 B;  3R60 A;  4A3M J;  3GLX A;  3NEU A;  2E71 A;  2O9L A;  3SZP A;  3KEQ A;  4EEF G;  3DLL F;  4UVC A;  1QRY A;  2MG4 A;  3AAF A;  1XMA A;  4C30 A;  3FM3 A;  3C1D A;  2COM A;  2VE9 A;  1VND A;  2WWY A;  2LBF A;  4PCQ A;  4I6Z A;  5TRD A;  2L9N A;  2A69 F;  2BVM A;  5CVR A;  4HNU A;  4XNF A;  4Y3O A;  1G8X A;  1WVR A;  5L3D A;  5IPA A;  1ACI A;  1HCR A;  1MBJ A;  4LLG F;  2VBW A;  4LFU A;  2HR3 A;  1VQO I;  2A07 F;  4LG3 A;  3E3V A;  2HVS A;  3S2H J;  1TP4 A;  5LFA A;  4RB2 C;  1F4K A;  2EZI A;  3F8C A;  2LMD A;  2QA4 I;  2VKH A;  2DPD A;  1XSV A;  2O0Y A;  1IJW C;  2V6E A;  4XKV A;  5AON A;  1K79 A;  5AIQ A;  3FWE A;  4AID A;  2PN6 A;  3TW7 A;  2F5F A;  3GZN B;  2MD0 A;  4EJO A;  2W82 A;  1YS6 A;  1W1W E;  3PFY A;  3DEU A;  4O3M A;  2LR8 A;  2DYS H;  2XDV A;  3JRA A;  2R5Y A;  4FTH A;  3J7A Y;  1O7L A;  4PDK A;  2R7V A;  2A05 A;  3SDB A;  3DPT A;  4GCV A;  4UVA A;  4DIQ A;  1ZRF A;  2B63 J;  3CCM I;  5TJJ A;  2EJR A;  5EG0 A;  2VOO A;  3LSG A;  2O5R A;  3AL0 C;  2W00 A;  3A0H C;  2XRL A;  3PSI A;  1Z05 A;  2FBH A;  5LHG A;  3HC7 A;  3TOB A;  2AO9 A;  4II3 A;  4N4O B;  1SMY F;  4PK4 A;  3S93 A;  1B9M A;  2VON A;  1B1B A;  2VJ4 A;  2WV0 A;  1TNS A;  2Z2S B;  3C2B A;  2HOA A;  1Z77 A;  2LY1 A;  3E5X A;  4EJV A;  3HGY A;  2ZO4 A;  3QU6 A;  1K6O A;  4ASN A;  3C2G A;  2BOL A;  3PM1 A;  3O2P E;  2K7L A;  1AOY A;  5ILS A;  1PP7 U;  1H8A C;  2DI3 A;  1UHW A;  3LNQ A;  2CW7 A;  2R7U A;  4TV7 A;  2BEO A;  2LKP A;  2PLY A;  2CRG A;  4GGG A;  1S3J A;  5HDN A;  4B3X A;  4D7N A;  5HNF A;  5H20 A;  3E5Q A;  4AVZ A;  3N97 A;  1FOW A;  4H0E A;  4U7B A;  4UV8 A;  2DJI A;  1OIS A;  4PUS A;  3IRQ A;  3CUQ A;  3MCZ A;  5LEK A;  3HTS B;  2M3A A;  2FXA A;  5K7F A;  2HKO A;  3C7J A;  2KJB A;  5DCM A;  2NNY A;  4IZZ A;  3ZQQ A;  1E2X A;  2JA8 J;  1IRX A;  3JSO A;  4C3J J;  1FYL A;  3LSK A;  3FXM A;  2LBF B;  1W36 C;  3GTP J;  2LRD A;  1R7J A;  4V2F A;  3BR6 A;  2ZME B;  1TTY A;  3K70 D;  3K7A J;  2ZSH B;  1ERD A;  2WAE A;  3EPZ A;  2BHZ A;  4BEH A;  2QEX I;  1YIJ I;  2F2E A;  2GOM A;  3L1P A;  1ETW A;  3ZN0 A;  4BE0 A;  1TC3 C;  1UST A;  5LGU A;  4IVN A;  1HW2 A;  3WTS C;  3R6S A;  1MMN A;  5FB2 A;  1WJF A;  4OAY A;  4R1H A;  5CVI A;  2GAU A;  3CLQ A;  2NOJ B;  3RPU A;  2ZBK A;  3V7S A;  4HZF A;  5H6Q A;  4XIC A;  1T0F C;  2M5W A;  4RAY A;  3JRB A;  2WB1 A;  4EAT A;  2G7H A;  4MNU A;  2VPL A;  4A3E J;  2V9P A;  1XDU A;  3HKZ N;  2XAS A;  2EK5 A;  3ASN H;  3DCF A;  1U8B A;  2KT0 A;  3MAJ A;  1GT0 C;  2GA2 A;  5DCF A;  1RR7 A;  1V5G A;  3HB9 A;  4FX0 A;  1I39 A;  2M1B A;  1YLF A;  3EYI A;  5M5W J;  4I0A A;  2EA2 A;  1OKR A;  2JA2 A;  3Q9V A;  3TO9 A;  1JTX A;  3NQO A;  1XGM A;  3EYY A;  1ZRE A;  2ICW G;  2DYR H;  5CVJ A;  3GFJ A;  2DCE A;  2DW4 A;  5CQG A;  2CSO A;  3G71 I;  3Q5F A;  3K4B A;  4XLH A;  2DJN A;  2ACJ A;  4C3H J;  5D5U B;  2E7X A;  1K83 J;  4AD9 A;  2H8R A;  1MMS A;  1WCM J;  2IS1 A;  3I55 I;  3S1R J;  2EFQ A;  1LDD A;  2WTE A;  1TL8 A;  2GBY A;  1G2H A;  1Z91 A;  1S72 I;  2OZ6 A;  1K6Y A;  3PNY A;  3HG9 A;  5HS7 A;  3COA C;  5BPI A;  1K4S A;  4ESJ A;  1JKO C;  4I7H A;  3GTJ J;  1RUN A;  1MZB A;  4PFO A;  2L7F P;  4YIR X;  3NAU A;  3G6E I;  4A12 A;  3I54 A;  4S05 A;  3HOZ J;  2W25 A;  1Z21 A;  1VZ0 A;  4DYR A;  4RB1 A;  2DMQ A;  3PIP F;  1L3L A;  3KLN A;  5A2Q Z;  5D5X B;  1PUF A;  5C3E J;  1LFU P;  4L18 B;  3WTU C;  3BCA A;  2LC2 A;  3GYH X;  3OL3 A;  1IGN A;  3C18 A;  5JLW A;  3IL2 A;  2KIQ A;  4ANJ A;  2HYG D;  2DQL A;  5HNH A;  5IOZ A;  3KET A;  1WZ2 A;  2L01 A;  3GBG A;  3WTW C;  3PO2 J;  2R7F A;  4HNT A;  4IO9 F;  2G0E A;  3TL4 X;  1IRF A;  2HYJ A;  4PJ0 C;  3KZY A;  2P6T A;  5DEQ A;  2BE5 F;  4ESF A;  4HDV A;  1YQA A;  3Q9S A;  2V6C A;  3HSR A;  3RSN A;  4OIR F;  4E7S A;  4UXN A;  1T56 A;  2JWT A;  2WBM A;  3A03 A;  3K69 A;  4G6D A;  1J7K A;  3EET A;  1D1A A;  3WOD F;  3F72 A;  2X4H A;  4HV6 A;  4IX7 A;  2FE3 A;  1XSX A;  3F0C A;  2JPB A;  2P81 A;  4KMU X;  1ZLJ A;  1MJ9 A;  2KZG A;  3Q0V A;  4PGG A;  4M3D A;  3TO6 A;  2CYY A;  1MMD A;  1ZTR A;  1WJC A;  3ZMD A;  1U5T C;  4BQA A;  3M4O J;  3OWT A;  2NVQ J;  2P8T A;  3WGG A;  4EJW A;  3O8H A;  3V4G A;  4HNV A;  3VYT B;  3N05 A;  3CCU I;  2GM4 A;  3BCB A;  3DBH B;  3I3L A;  1V4R A;  3KEO A;  2ME6 A;  3W3C A;  4M3E A;  2HQ5 A;  1MKM A;  3DKY A;  1FWZ A;  5B1B H;  4FET A;  4G9Y A;  2DA7 A;  4EM2 A;  2X0L A;  4MTD A;  3QQA A;  2VBZ A;  5J1R A;  2E19 A;  2DXI A;  2QSH X;  1KYW A;  5K5Q A;  5DCM B;  2PEX A;  4NC8 A;  4OIO F;  4LIU A;  1IN4 A;  2HQR A;  1IRG A;  4FIS A;  1R6R A;  3DEE A;  5HLG A;  1R1V A;  3RQ4 A;  5KVR A;  4P96 A;  2VE8 A;  2E5N A;  5FKK A;  1NK3 P;  1BW5 A;  3WE2 A;  3ABT A;  2XUB A;  1NH3 A;  1RIO H;  1FSH A;  3E6M A;  2HOE A;  3ERE D;  2GWR A;  2XSJ C;  4U0V A;  4G7H F;  4LB5 A;  2VUM J;  2EFN A;  5FFZ A;  1I6X A;  4HEA 2;  3LSM A;  2BY1 A;  3KLO A;  1A35 A;  5B66 C;  1OPC A;  2XC7 A;  3FK6 A;  4K2E A;  4F93 B;  4E7K A;  2JMW A;  4ABZ A;  5EDN A;  4LG0 B;  1UZC A;  2DN0 A;  1X3Z B;  2K02 A;  2UV1 A;  1G4D A;  1FT9 A;  4B44 A;  1QQI A;  1HSJ A;  4XMY A;  4MLO A;  1IUF A;  1FP2 A;  4P5O A;  1I27 A;  3SDG A;  1X4P A;  3D5S C;  4U87 A;  4YFK F;  3G73 A;  3T8R A;  2YSR A;  4CYC B;  3PQK A;  4BHP A;  4YEJ A;  2DU9 A;  2E2J J;  3ZMZ A;  1O3Q A;  1FX7 A;  4BJT A;  5J8F A;  4AC0 A;  4L0Z B;  1DPR A;  1I50 J;  3BTI A;  4KJZ A;  4QSH A;  3QPL A;  2K3F A;  3Q3S A;  1CGP A;  2OZU A;  3QPS A;  3JTH A;  2K9L A;  4IQ4 A;  5D4R A;  5IT9 Z;  2JK3 A;  3QP6 A;  4N9I A;  4KN4 X;  1JT0 A;  3S3O A;  1Z0X A;  2F5D A;  4CXF A;  3OYL A;  5J40 A;  1WI9 A;  4DW6 A;  2KIU A;  5J3L A;  3TKY A;  2DA6 A;  1ON2 A;  1LNW A;  5LGT A;  3OYK A;  2BV6 A;  4L9J A;  2HZT A;  5F0C A;  2DFH A;  2CH0 A;  5TGT A;  2A5W A;  2IGO A;  3MMY B;  5HLI A;  4D0P A;  5BOX A;  3GTK J;  4AVP A;  3CUQ B;  4A3K J;  3NRV A;  4G6Q A;  4YFX F;  1Z9C A;  4L5J A;  2EFO A;  4HLX A;  2HWV A;  1YHQ I;  1LB2 A;  2H6C A;  2DDA A;  3OYG A;  3OS0 A;  3H1C A;  1UJ8 A;  1I5Z A;  1I3Q J;  2C6Y A;  2Z1D A;  5FKN A;  4OAZ A;  1FOX A;  3BQY A;  1TWH J;  3HUG B;  3EUH A;  5M5X J;  1J75 A;  1GLN A;  2IXS A;  4HST A;  3PNT A;  4CHU A;  3LSI A;  1R22 A;  3DKW A;  2MH2 A;  4PSX A;  2W85 A;  1WHU A;  5FRN A;  4FT8 A;  2EIN H;  1BM9 A;  4EMS A;  4A3G J;  5HOD A;  1UMQ A;  2HNH A;  4MEY F;  5J8C A;  2PI0 A;  1XSD A;  2JUC A;  4BH9 A;  1JHH A;  1P4A A;  1SVL A;  1U9O A;  5IP6 A;  4HX8 A;  1CF7 A;  1MW7 A;  4M73 A;  2R5Z B;  4HG2 A;  4B48 A;  3L2C A;  4BXX J;  2JJ7 A;  3ZQC A;  3K10 A;  3E6B A;  3I4N J;  5FLV A;  3RCO A;  2LOO A;  3VFZ A;  2YX7 A;  3GFI A;  4MQV A;  4PGH A;  1ITY A;  2Y48 A;  5D8L B;  1P9Q C;  1ZR2 A;  2WY7 Q;  2X6O A;  2RVC A;  3CUQ C;  4HPQ A;  1SFX A;  1VTN C;  5DM6 F;  3S8P A;  3IH4 A;  4RM2 A;  1TWA J;  3BTL A;  5ED4 A;  4MO7 A;  3H36 A;  5C44 J;  3DP7 A;  4ZJZ A;  1MJB A;  2RN7 A;  1EKE A;  3DKX A;  5IYB J;  1PDN C;  4M3G A;  3RYR A;  1DGR M;  3PJR A;  3GZ5 A;  1XG1 A;  5BMZ A;  1FYK A;  3LSH A;  4D1Q A;  4E7J A;  3HOT A;  3HHH A;  3H0G J;  3MVP A;  1DU0 A;  3JW4 A;  1ETQ A;  3M9A A;  2RKH A;  5IT9 K;  2GXA A;  3FBN B;  3L7W A;  2HFH A;  4LK1 F;  1ZGJ A;  2X1D A;  4E7Z A;  1Y1W J;  1LEA A;  2ELJ A;  2KDO A;  3OS2 A;  3PNV A;  4A3F J;  3L2U A;  1WI3 A;  3W6K B;  5DUK A;  4M9X A;  2WV1 A;  3BG3 A;  2EZH A;  3H9Q A;  1OYY A;  4XON A;  3CCL I;  3Q0U A;  3RKX A;  3BG7 A;  2ZB9 A;  4D7M A;  4WCG A;  4HAM A;  4BBR J;  4P9U A;  2I10 A;  4G8X A;  3HXL A;  4KIF A;  1Z1D A;  2J5O A;  3DTE A;  3AG1 H;  5CYV A;  3TP0 A;  5E1W A;  1YE9 A;  3OYN A;  2PJP A;  2LSO A;  1T38 A;  2QSF X;  4IRG A;  2ETH A;  3KX2 A;  4DBQ A;  1QPI A;  1J59 A;  3AFH A;  1R1U A;  2DA4 A;  2ZME C;  2K86 A;  1WGX A;  5F6F A;  4ZTJ A;  5L3G A;  1RNL A;  1T0F A;  2DTZ A;  1UG2 A;  4E6K G;  5HVQ C;  2E2H J;  4KFC A;  5F1J A;  1MBH A;  3TGN A;  2HPM A;  2K4B A;  1OCR H;  2DQR A;  2M30 A;  5L3E A;  5JVT A;  2Y30 A;  5GP9 A;  2OBP A;  1FC3 A;  3P9I A;  3QOP A;  1MDM B;  4HF2 A;  4KMF A;  4ENM A;  3E7L A;  4XOR A;  1WH7 A;  3KCC A;  4XKW A;  3W6J B;  3EUA A;  2ZFW A;  3WTT C;  2TRT A;  1FBS A;  2P6S A;  1X2M A;  3FMR A;  1YW8 A;  1SEU A;  1F36 A;  2Y9Y A;  5C4X J;  2CW8 A;  3OIQ A;  1O3S A;  1AWC A;  3I9V 2;  2DMU A;  4GO1 A;  2XAH A;  3KE2 A;  3P9C A;  4D5F A;  1HKT A;  2PMZ A;  3GZ6 A;  1ZYR F;  3WTY C;  2OD5 A;  5KCM A;  1QA6 A;  2LRE A;  5ICC A;  2MA3 A;  2EPF A;  2OCE A;  1XCB A;  3M7G A;  1J0R A;  1EH6 A;  2TCT A;  5E17 F;  5F08 A;  2D45 A;  1T98 A;  2H94 A;  5HS8 A;  2LY9 A;  3RDI A;  2M4G A;  1BOA A;  3PL8 A;  1MD0 A;  2E1C A;  2GLO A;  2IA2 A;  4HOB A;  3E5U A;  2COB A;  1TNT A;  3DU5 A;  4XLA A;  2FD5 A;  2UWM A;  1FNN A;  1N75 A;  3WTZ A;  5JHF A;  3CTA A;  1T6S A;  3DTI A;  2KRC A;  3RPQ A;  3FXU A;  1HDP A;  2Q8K A;  4CCN A;  1QHH D;  2R7T A;  1D1B A;  4ON0 A;  1R23 A;  2KRH A;  3H5R A;  2L0K A;  4D9J A;  2F5E A;  2IRF G;  4RB0 A;  2L4M A;  1YO5 C;  1WJE A;  2D1H A;  2L7K A;  3UNG C;  1Y56 A;  1F5T A;  3OMY A;  1UFM A;  4CDG A;  2LF7 A;  1JTY A;  1TWG J;  3WHB A;  1QVU A;  3LQR A;  2HTS A;  4EGY A;  2R7O A;  1FIA A;  2FQ3 A;  3ZOB A;  1J9I A;  2PFB A;  2ZXI A;  4BJ6 C;  3T0Y A;  3K9T A;  3A4C A;  1GXQ A;  5J47 A;  1VQN I;  1X4O A;  4IOC F;  3V8J A;  1SAX A;  2L3D A;  2XAJ A;  4ITV A;  3TMO A;  2HOS A;  1HST A;  1STZ A;  3CDI A;  1IUY A;  1FP1 D;  5CLS A;  3MFK A;  2M8E A;  3MZ8 A;  3BTJ A;  1BW6 A;  2XKP A;  2VAS A;  3WHC A;  2DFE A;  3LOC A;  3ZCO A;  4JBA A;  2CWE A;  2KL4 A;  2IS6 A;  3F9K A;  3QYF A;  4YIF A;  1R5I D;  3HRS A;  4C9Y A;  1ZH5 A;  1LQ1 A;  4I0B A;  4DBR A;  3CCR I;  3DEW A;  4E70 A;  1OQY A;  4UUS A;  3DV8 A;  3E0J B;  1W7P B;  3E6D A;  5CKT A;  4OOI A;  5CPR B;  5B5E C;  4HRI A;  5BNG A;  3CCJ I;  4UNO A;  3S16 J;  3ONQ A;  3OYE A;  5LD2 C;  1UHM A;  3K1P A;  3SFI A;  1MDM A;  1I6H J;  1ZKG A;  2OU2 A;  2VKE A;  4G94 A;  4BY7 J;  3RIR A;  3FXR A;  1H0M A;  2ESN A;  4KUM A;  5FLX Z;  2M87 A;  1FZP B;  5LRR A;  2RNG A;  2DOD A;  2L7Z A;  4N9H A;  2V79 A;  3GFL A;  3F8N A;  1I1G A;  1D8K A;  1OR7 C;  3F8B A;  3VOE A;  3JRF A;  1ZAO A;  2LG4 A;  3BZ6 A;  4IHY A;  2M34 A;  3CCY A;  5KHD A;  1CQT A;  2R92 J;  3JCU C;  3GFM A;  2EFW A;  3BR0 A;  1HA8 A;  5JVG F;  3GXO A;  4GYI A;  2VT3 A;  3W2W A;  3BP8 A;  2Y31 A;  1I3A A;  2IBD A;  3OYH A;  5DS9 A;  2ECB A;  2LKS A;  2IS4 A;  4BL0 B;  3EUH C;  2AQE A;  1IAW A;  4CA0 A;  3ZMU A;  3FKJ A;  4EJU A;  2IW5 A;  2R3S A;  4DZJ A;  1U8R A;  2ID3 A;  3R4K A;  4GXO A;  4P9F A;  6PAX A;  3BT9 A;  3CDH A;  4P55 A;  1A04 A;  1QZZ A;  2OAZ A;  1K78 B;  3ZQI A;  2N8G A;  5EGO B;  3G1L A;  4BHC A;  1ZEL A;  2QQ8 A;  3V8L A;  1RKW A;  2XAG A;  3FIS A;  1BOB A;  2KDZ A;  3PQJ A;  2R0Q C;  1TWF J;  5EJC A;  5EZG A;  4IRI A;  1W0T A;  3K2Z A;  1UHS A;  3IAM 2;  5D6F A;  3ZMS A;  5JFR A;  1O7F A;  4BY1 J;  3U9G A;  3T8T A;  2KP6 A;  1K4T A;  4ZYH A;  3VSK A;  2PJR B;  2CV0 A;  1FTT A;  1GV2 A;  3IH2 A;  5HOO A;  4IHV A;  3T5X A;  4IOA F;  2Q2E B;  2CV2 A;  3IUO A;  1BI3 A;  2W7N A;  4YII A;  3KP2 A;  3KYD B;  3JAM K;  5F04 A;  3FHZ A;  1G3S A;  3ASO H;  4UUT A;  1P2F A;  3O3K A;  4XK4 A;  5HLT A;  3CJN A;  1E17 A;  4ESB A;  2P7C B;  1S9H A;  1OFC X;  2D1V A;  1XX5 A;  1F9N A;  3R61 A;  4ZYA A;  3PIO F;  1RZ4 A;  2KLO A;  2WAQ A;  2XPW A;  3BR3 A;  4Y7N J;  2EH3 A;  3KYL A;  4KIC A;  1NTC A;  3JRG A;  4BXU A;  2DFI A;  1A36 A;  2VJJ A;  1BR4 A;  1BC7 C;  2WAD A;  1MSE C;  5M3M J;  1GHC A;  1FLI A;  4JX5 A;  2FOK A;  3GTG J;  2QQB A;  3ROU A;  1ULY A;  2H6B A;  2Y0S A;  2KKO A;  2ADU A;  4IL6 C;  4CYC A;  1KON A;  3FXQ A;  4R8H A;  2LK2 A;  2ELK A;  4G7O F;  1DPU A;  3CCV I;  4E7L A;  4Z2Y A;  2XSD C;  3HRM A;  3CZ6 A;  1G3T A;  2Z3Y A;  4B43 A;  2DT7 B;  2G7U A;  3GWZ A;  3CJR B;  1R4N B;  5E1X A;  5FKL A;  1SD7 A;  2HGC A;  4HYE A;  1QZY A;  3LA7 A;  4AIH A;  1YJN I;  5GAE J;  1TBX A;  2E60 A;  4KT5 C;  2HXO A;  3U1D A;  3IH3 A;  3ABU A;  1JJ8 C;  2F6C A;  3PO3 J;  5E3L A;  4B3A A;  4A6E A;  3TED A;  2VBX A;  3AG4 H;  2JA6 J;  2HZD A;  1BL0 A;  2VQG A;  3OR2 C;  3CMY A;  1Z7L A;  3CC4 I;  2LKX A;  3VDX A;  2STW A;  4I99 C;  3ZQ7 A;  3OS1 A;  4ZDO A;  4DNC A;  3I56 I;  4OWR B;  3LSJ A;  3ZQH A;  1ENH A;  2H1L A;  3V42 A;  2Z5U A;  1QBJ A;  1XGN A;  2FMY A;  5EYR A;  2W48 A;  3IP4 B;  2Q1Z B;  2PMH A;  5FRO A;  4AWX B;  3P7N A;  4XRF A;  1A5J A;  1R36 A;  3D0S A;  2YU3 A;  3JSP A;  3KFW X;  4KIS A;  4RA2 A;  2NXN B;  1F43 A;  1PYV A;  1D0X A;  3A0B C;  2NVU B;  3GCM A;  1IC8 A;  1JUS A;  4U7D A;  4JQF A;  2L5Q A;  4Y13 A;  1MSF C;  3OOU A;  1Z3Y A;  3S14 J;  1B72 A;  1FOK A;  4WXH A;  1TT0 A;  4RMN A;  1EJ9 A;  3J81 K;  1WRJ A;  3E6C C;  2VLA A;  4JOM A;  3GEZ A;  1W7P A;  1HKQ A;  2JSC A;  5JI6 A;  1EA3 A;  3F22 A;  1P7I A;  3BR5 A;  2QSG X;  1U3E M;  4M6Y A;  4NUB A;  1VFC A;  1NK2 P;  3D1N I;  2CFO A;  3U21 A;  3HOV J;  4KIB A;  3KP5 A;  5DD4 A;  3WGH A;  5M5Y J;  5K7H A;  3U2R A;  2V7F A;  1QVT A;  3C2H A;  2JN6 A;  3KP4 A;  2K9S A;  2RV8 A;  2MH9 A;  1VI0 A;  2PQ8 A;  3K70 C;  1P4X A;  4FCY A;  1W36 D;  3V7C A;  4HA8 A;  3CO7 C;  1SFU A;  1MBK A;  1PUE E;  2KZV A;  4NNJ A;  3RZD J;  5IYD J;  3GVA A;  4HF0 A;  1SFK A;  1JHF A;  4UUS B;  2L02 A;  2R5Z A;  2XRO A;  2XGD A;  1ZAR A;  1NHA A;  5IP7 J;  2MFZ A;  4X1E A;  1JKP C;  2K3P A;  3HOX J;  2AQF A;  4BE1 A;  2JVH A;  1B4A A;  3O8G A;  3WU1 B;  2R7Q A;  3HM5 A;  3OSG A;  4LD5 A;  3KP6 A;  2HVQ A;  1MMG A;  2HYF A;  1EV7 A;  1QZE A;  2HKX A;  1L0O C;  3F21 A;  4JX6 A;  3BWG A;  2QBY B;  1TW3 A;  1KU3 A;  3W2A A;  3ABK H;  3RI4 A;  5M3F J;  1KQ9 A;  1XCV A;  5BS6 A;  2UZK A;  4G12 A;  4XRS G;  3OYF A;  2CG4 A;  5B3S H;  3WG9 A;  2DK8 A;  2J5P A;  3K4K A;  1Y8R B;  3HZJ A;  4PJL A;  1W0U A;  4OIN F;  4CUG A;  3HIF A;  4UB8 C;  1FMV A;  1E3O C;  3MZH A;  4QLC U;  4YFN F;  2XRN A;  1SAN A;  2GIZ A;  4BBS J;  4JX4 A;  4ETS A;  3LQQ A;  3S3N A;  3HOS A;  2F48 A;  2OC6 A;  1U5T B;  2CQQ A;  3CQZ J;  1SFO J;  2X9D A;  3TW6 A;  2JRT A;  2YS9 A;  2DA1 A;  3WTX C;  3J7Z I;  3F6V A;  4XRM A;  3I59 A;  2VKD A;  4QWQ A;  5FKO A;  1MGT A;  2DA3 A;  1HKS A;  4P1W A;  1HQC A;  1YTY A;  2PJR A;  1WKM A;  5F1R A;  2VC1 A;  1ZG1 A;  1R5G A;  1MH3 A;  2X1E A;  1X19 A;  1QU3 A;  2JT1 A;  3IHU A;  2JUG A;  4Q48 A;  5ERI A;  5F0F A;  1R5H A;  5ILU A;  1C0W A;  2AS5 F;  2B0L A;  3OL4 A;  3BG9 A;  4LB6 B;  3ECO A;  2EB7 A;  3M3Y J;  2VXD A;  4PFP A;  3CF2 A;  3HYI A;  4L0Y B;  1ZQ3 P;  3RJP A;  3BR1 A;  2ISZ A;  2EFP A;  1YYV A;  3I53 A;  4E4H A;  5IY5 H;  4M6V A;  4RGU A;  1U2W A;  2FML A;  3OR1 C;  3BZK A;  2JQ7 A;  1U0J A;  4UVB A;  1RRJ A;  3S15 J;  5EEA A;  5E79 C;  3KIO A;  2FQ4 A;  2FNP A;  1MNM C;  1USS A;  2VL8 A;  1P4W A;  2DT5 A;  1X1C A;  2GIV A;  1OCZ H;  2K9N A;  3S32 A;  4X0G A;  3L2W A;  1KU7 A;  3SZG A;  1S6L A;  3IWZ A;  4M3F A;  2ZNZ A;  5LRS A;  2ZME A;  2I5U A;  3CDL A;  2RDP A;  1ETX A;  5H6R A;  1E3P A;  1E3H A;  2CW0 F;  4HV5 A;  4V2G A;  2XIG A;  3HDD A;  2P5L C;  1PUF B;  1DDN A;  4IQJ A;  5HS9 A;  1D5Y A;  3MWM A;  1A6I A;  4WXD A;  4B47 A;  3OYA A;  2XF6 A;  1MMA A;  3K4M A;  1R58 A;  2FA5 A;  4LLN A;  1ZHF A;  2TDX A;  4HQM A;  3I4M J;  5K1Y A;  3ZRG A;  2JA5 J;  4C3I J;  4CCO A;  3BG6 A;  3KZZ A;  5FKM A;  4WK8 F;  3TOA A;  1IN8 A;  5CVU A;  2V26 A;  1JGS A;  3MD2 A;  3K4L A;  3J80 K;  4C2M J;  5HDG A;  1ZGW A;  4A3I J;  1Y39 A;  1KU2 A;  3OYM A;  3P9K A;  2A5Y B;  2KMU A;  5GAD J;  1UCR A;  5FD5 A;  1ETK A;  2E35 A;  2OJE D;  3SJM A;  3QU3 A;  2HS5 A;  1PP8 F;  2W84 A;  3S3M A;  3BJ6 A;  2VN2 A;  1X2N A;  5IYC J;  1HDD C;  2B7E A;  1OCC H;  2XGE A;  1WH5 A;  1T33 A;  2CQK A;  2BXY A;  3VYS B;  4IHW A;  4II2 A;  1GVJ A;  1S7E A;  5CJ9 A;  4FE7 A;  4XID A;  1APL C;  2VOP A;  1U5T A;  4XOT A;  2K40 A;  3AL0 B;  3H3U A;  2D5V A;  1X1A A;  2WA0 A;  2ID6 A;  2Y69 H;  3AG2 H;  2VQH A;  2AHQ A;  5E3N A;  4XM3 A;  4RB3 C;  1WQ2 A;  2DT6 A;  2STT A;  1DP3 A;  4W97 A;  2QWW A;  3RYP A;  2NVY J;  5ICE A;  3QP5 A;  1POG A;  3B6A A;  1MBF A;  3FXO A;  5ICG A;  2IAI A;  3L09 A;  1YJ9 I;  3GF2 A;  4ZZL A;  3DTK A;  1OYW A;  2E2I J;  2BZT A;  3S17 J;  1EH8 A;  3SEZ A;  3OIP A;  2BHY A;  2VI6 A;  4ZDP A;  1D8J A;  2PBI A;  2BXZ A;  4RGX A;  1ETY A;  2IP2 A;  3DBR B;  2Q2E A;  3L9F A;  2OCC H;  2V1D A;  2LVS A;  2E1N A;  1BI1 A;  3ULQ B;  4DOZ A;  3F23 A;  5HLH A;  3VB2 A;  1SD6 A;  1T2K A;  2O6G E;  3M8F A;  3W6V A;  3MN2 A;  1YX5 A;  4F52 A;  2MSY A;  1LPQ A;  1ZRC A;  3EQL F;  2XAQ A;  2X6X A;  2H1K A;  2IGN A;  4BAC A;  5EGO A;  3JR9 A;  5GAH J;  4A3J J;  1R49 A;  3HRU A;  3VEP A;  3JAM Z;  1G6N A;  3AKZ A;  3G2B A;  2O61 A;  1OCP A;  5J4Y A;  1IXR C;  2O8X A;  2MGQ A;  1WJD A;  2QUF A;  3WE3 A;  4CYD A;  2HPI A;  4L5I A;  1P7J A;  2JRM A;  4GDF A;  2VB6 A;  5IP9 J;  5K7Z A;  2LF8 A;  4I76 A;  4AIJ A;  3HOU J;  2ZCW A;  1ZLK A;  2CUJ A;  3ZMT A;  3FZV A;  2DBB A;  1XD7 A;  2P5V A;  1X58 A;  2H27 A;  1G3W A;  4BNC A;  4NQW B;  4OU0 A;  4X6A J;  2M9H A;  4EM1 A;  3NWT A;  4BHB A;  3L2R A;  1K78 A;  2LD5 A;  3BQZ A;  4G6T B;  3BJO A;  3GX4 X;  4PJJ A;  2R7R A;  1FIP A;  3G4S I;  4NC7 A;  4Y4R A;  4C2U A;  1X1P A;  4Z6Y A;  3S2D J;  4GYG A;  1HBX G;  2OTL I;  2RQP A;  4A0X A;  2CQ7 A;  3PFI A;  3OYC A;  2RNJ A;  4A2U A;  2OA4 A;  1S29 A;  4V19 K;  2M7A A;  5JLX A;  1O3R A;  3C3W A;  3IKV A;  2VKV A;  5GAG J;  3SQN A;  1ZG3 A;  2GXG A;  5E1Z B;  4EV0 A;  1W7P D;  2MLK A;  4EQQ A;  1MBE A;  3UKG A;  5E8I A;  2VQL A;  2FNA A;  2IEK A;  2CU7 A;  1TZL A;  2CUE A;  2DMP A;  2ESH A;  3OYI A;  3K6G A;  1V54 H;  1YRN B;  1Z6T A;  2DFF A;  3LA2 A;  4LLL A;  1IN6 A;  4A0Z A;  1U9N A;  3J81 Z;  4LIT A;  4EVI A;  3VPR A;  1HW5 A;  3RZO J;  2K27 A;  3NAR A;  3ZQF A;  1V55 H;  3SFZ A;  3MKL A;  4RAG A;  4J19 A;  1SFE A;  5L3F A;  1HOM A;  2GOX B;  1LE8 B;  4A3D J;  4Y33 A;  2CJJ A;  2PX9 A;  3G1M A;  1A31 A;  1UAA A;  4Y52 J;  2IPQ X;  1ON1 A;  3FMQ A;  3GTQ J;  1D0Y A;  2L7M P;  3Q0W A;  1X3U A;  1YW7 A;  2F5V A;  3CCQ I;  4MFD A;  4LG0 A;  2L54 A;  2DPU A;  5D5V B;  5B1A H;  2E36 A;  2QZ8 A;  2KIF A;  2QF7 A;  1O57 A;  2VBY A;  2W4S A;  3P5J A;  1B9N A;  2CGP A;  3TDU C;  2AXL A;  5CQE A;  1T39 A;  2KPM A;  2X6Y A;  3FBI B;  1RKT A;  1XGS A;  4WXC A;  4KYW A;  2H8W A;  1FTZ A;  2K5C A;  5DDG A;  3M1C A;  3BY6 A;  2MYS A;  1BI2 A;  3K1N A;  3ZP5 A;  3QAH A;  2DA5 A;  1KA8 A;  1G3Y A;  2R4G A;  2XGC A;  3ESW B;  4RLQ A;  4XLP F;  4GFB A;  2VOD A;  4XBF A;  4FAS D;  3B02 A;  2M0M A;  2QEN A;  2A6H F;  2HVR A;  2QQ9 A;  1QO0 D;  3LSP A;  1K7A A;  2DO7 A;  1IZ1 A;  5FO5 A;  1H9G A;  1MJA A;  1SMT A;  5BQT A;  3ZQL A;  2JSP A;  3F6O A;  4R79 A;  5CVV A;  2QGU A;  3HRT A;  1ZG5 A;  3QPT A;  3QYB A;  2V9V A;  2Y0S N;  5EEG A;  4CH7 A;  1B8I A;  2QKL B;  4MHG A;  3TO7 A;  1FBU A;  2DA2 A;  4JYK A;  4IF4 A;  2F5C A;  4LGW A;  1YG2 A;  2CQX A;  2K85 A;  1QNT A;  4MTE A;  2P0W A;  1VQP I;  2LLK A;  4I2O A;  3PSF A;  4MIM A;  4S04 A;  1SAU A;  1JE8 A;  5D5W B;  5EG0 B;  1FYM A;  3FK7 A;  2L9R A;  2WAQ N;  3QRF F;  1X3W B;  2NS7 A;  2Z33 A;  3BG5 A;  3LFK A;  2QKM B;  4BE2 A;  1O4X A;  2NVT J;  1J09 A;  4M9Z A;  3M8E A;  2K4J A;  1S7A A;  1AKH B;  3JRC A;  5DTD A;  1A6Q A;  4HBL A;  3G1O A;  3S2W A;  2IJL A;  2NAZ A;  2Y2Z A;  3FXL A;  4RGR A;  4EGZ A;  3R0J A;  1KQ0 A;  4CCK A;  1IXC A;  3L00 A;  1SD4 A;  1BI0 A;  2DLL A;  4W1U A;  2BY0 A;  1B6A A;  2M8G X;  1SC7 A;  1TT5 B;  4IHX A;  2DAO A;  4J00 A;  4M72 A;  2NYX A;  3RQI A;  4DZP A;  1WSU A;  2VJI A;  3LWF A;  3ERM A;  2X51 A;  4YEL A;  4WX9 A;  4HDU A;  3S1M J;  1LJ9 A;  4HSR A;  4U0W A;  1YJW I;  4PJM A;  1D3Y A;  2ZJR F;  2XF7 A;  3MKY B;  1XB4 A;  2QBY A;  4XL9 A;  2IGK A;  1AA7 A;  3H92 A;  3H0D A;  2HOT A;  2YR2 A;  1B59 A;  4BGD A;  4KA4 A;  1FBQ A;  1X1D A;  1LVK A;  2A3S A;  2WY8 Q;  3ZPL A;  2CMP A;  3CJQ B;  4XLE A;  4ENJ A;  1BJZ A;  3LAJ A;  1SVM A;  3CUO A;  4OMZ A;  4UHT A;  3TQN A;  2CV1 A;  2YPR A;  3HSE A;  3MKZ A;  3ZQG A;  5LHI A;  3GTM J;  2DOF A;  3ML6 A;  2ZJ2 A;  5FLX K;  1OR7 A;  4IPA A;  1JKR C;  2HTJ A;  4DYC A;  2RRE A;  2OTJ I;  3DLA A;  1N25 A;  4XLF A;  1RR8 C;  1TLH B;  3CLO A;  2OV7 A;  3H9G A;  3F3X A;  2XHK A;  5HDK A;  1BJA A;  3K4C A;  3EDP A;  2M4K A;  3FMS A;  4XN0 A;  4CSW A;  3IAS 2;  4KIT B;  1RUO A;  2RGV A;  2EA4 A;  3L2Q A;  2XPV A;  2E5Z A;  4XSX F;  3RKY A;  4CO8 A;  3CCS I;  3FHN A;  2XV4 S;  3WTV C;  4IXA A;  3VWB A;  5KK1 A;  3ELK A;  5GPA A;  3OSF A;  1YFH A;  2EWN A;  2BYV E;  1YX3 A;  1EF4 A;  1IV8 A;  4BUP A;  4M74 A;  5A2Q K;  2KIS A;  2XB0 X;  1RC9 A;  3DFG A;  5KAF C;  1XC5 A;  4BU2 A;  3BR2 A;  2EBI A;  2BVL A;  3MQ0 A;  2JTV A;  1JI8 A;  1W5C C;  3D5L A;  4O6J A;  2GA1 A;  1BN5 A;  2NRA C;  1R9T J;  3CMA I;  1JXS A;  1XMK A;  1Z67 A;  3SXY A;  4JK1 X;  2R93 J;  4S0H B;  2LY2 A;  1NG7 A;  1BC8 C;  2ZXW H;  4F7Z A;  4HW0 A;  2CFX A;  2YX4 A;  4PSW A;  5DYM A;  3REO A;  2E7W A;  1IDZ A;  3RPU D;  1DP7 P;  3FX3 A;  1J2X A;  1MND A;  2FUG 2;  2ELH A;  1TQI A;  2HQN A;  3K0L A;  4I01 A;  4E7H A;  2VQC A;  3FIW A;  4RM3 A;  4FHT A;  4HX7 A;  3OYJ A;  4WF2 A;  2F4I A;  4IEJ A;  2X85 A;  1D1C A;  2HEO A;  5F64 A;  1OMI A;  4ZYE A;  2NVX J;  1YOV B;  3B6C A;  5LBQ A;  1XS9 A;  3BTC A;  5L3C A;  1Q1V A;  5FLM J;  2IVM A;  3KP7 A;  2W57 A;  3JRE A;  5BPD A;  2CO5 A;  1QHG A;  5H2F C;  1WJB A;  4U88 A;  5F0H A;  3FKI J;  3RKW A;  1BA5 A;  3JRD A;  3HOY J;  1IW7 F;  3SZT A;  2FRH A;  4A5N A;  4RS8 A;  4IRH A;  4ENK A;  1H89 C;  1PVE A;  2VT2 A;  2P7V B;  3EUK L;  2O8K A;  1HXD A;  1JKQ C;  2YU9 J;  2HU9 A;  4KIG A;  2QYO A;  3G3Z A;  2CUZ A;  1VQL I;  3I59 B;  4C2T A;  1VQ8 I;  3UR3 C;  2A6E F;  4M71 A;  3JRI A;  2GXB A;  2JZY A;  2PMU A;  4NHJ A;  2P4W A;  2QLZ A;  1JGG A;  1U6G A;  2O03 A;  1VQ6 I;  2HI3 A;  3CCE I;  4A93 J;  4CCJ A;  3NWS A;  2MAB A;  4QIW N;  1BIB A;  2BY3 A;  4ENN A;  3K2A A;  2DK5 A;  1N78 A;  2FBI A;  3CJT B;  4A0Y A;  4WWC A;  1IF1 A;  3K4J A;  3CC7 I;  1RI7 A;  2UXX A;  1MIJ A;  2PMZ N;  1D0Z A;  2BY2 A;  3E97 A;  4QPQ A;  4BJ5 C;  2ECC A;  4B09 A;  1LDK B;  3KEY A;  4EM0 B;  2A68 F;  3FM5 A;  2G9W A;  1P6R A;  1F1Z A;  1Z7U A;  2H09 A;  2KRF A;  1TWC J;  1ZRD A;  3DU6 A;  2DMT A;  2BBY A;  5FFX A;  3VOD A;  2M2E A;  2Z9O A;  2CQN A;  5E20 A;  2CS3 A;  2GQQ A;  1SVO A;  4BXF A;  2M0C A;  1QGP A;  1FY7 A;  3BC8 A;  3QYE A;  1FEX A;  3IV5 A;  5GTI C;  5IT3 A;  4Y15 A;  3OV8 A;  4I98 B;  3OYB A;  2K9M A;  2JPC A;  2X48 A;  1JT6 A;  3LST A;  3QOE A;  1KU9 A;  4M6X A;  2NS8 A;  3LAP A;  4QPO A;  1IV6 A;  2EV0 A;  2IA0 A;  1YW9 A;  2IGM A;  4ZYG A;  2QM3 A;  2DOA A;  4CGZ A;  1Y0N A;  1H9T A;  2O7O A;  2XAU A;  2OPT A;  3KZI C;  3DPU A;  1V5E A;  2R7D A;  2VJ5 A;  4I02 A;  1W4M A;  3CC2 I;  2ZXJ A;  4XSZ F;  2R7Z J;  4L9T A;  4IHT A;  4BDZ A;  2BGC A;  1RES A;  4XLN F;  1HW1 A;  3A01 A;  5KAI C;  1E0E A;  1U78 A;  2HDC A;  2VXZ A;  1FJL A;  2X1C A;  3BPX A;  5EZH A;  4O5V A;  3FXK A;  3O6B B;  3OYD A;  5AIP A;  3TDZ C;  3T1B A;  2W24 A;  2ZC2 A;  4B8X A;  4ZZD A;  1B72 B;  1Y1V J;  3QPH A;  4A3L J;  2EIL H;  3BJA A;  4YRV A;  5E3M A;  2NS0 A;  4ZYD A;  4CCM A;  2V1U A;  5LGN A;  1W5S A;  2FBK A;  2FX0 A;  4CIC A;  1DUX C;  1FSE A;  4B4C A;  3F8F A;  2Y0M A;  3OOP A;  4ZH4 F;  3V7R A;  4BQN A;  5GTH C;  4HQE A;  4MFE A;  1TQM A;  3LFU A;  2LP0 A;  5J1U A;  4XN3 A;  3I64 A;  1D5V A;  1YI2 I;  4FX4 A;  1UB9 A;  3ABL H;  3VYU B;  1HLV A;  1IN5 A;  3A2K A;  1IO2 A;  5LHH A;  2ZFU A;  1WJA A;  1S7O A;  4OMY A;  2UXN A;  1YRN A;  1KGS A;  1HC8 A;  2LH9 A;  1ETO A;  3DQV C;  4AM3 A;  2X6W A;  4Q4Z F;  4QTR A;  3MKW B;  3K4N A;  1FPQ A;  2W1O A;  2UUZ A;  1K61 A;  2HDW A;  3GTL J;  3DBL B;  4OIP F;  1JUP A;  1DGW Y;  3H3V K;  2DTR A;  4RGS A;  4DGW B;  1MH4 A;  1Y6I A;  1LKX A;  3L2V A;  1WJ5 A;  4KT6 A;  2EIK H;  1YIO A;  2QVO A;  4A3B J;  1OJL A;  3HJE A;  5EF6 A;  1IG7 A;  2DMN A;  2L2O A;  3LA3 A;  4XKC A;  1GV5 A;  2OUM A;  1REP C;  4RLF A;  1XMX A;  4YG2 F;  2Y75 A;  3FF5 A;  5FRM A; 
#chains in the Genus database with same CATH homology
 4Y17 A;  2LDU A;  1XN7 A;  1SD5 A;  3GUD A;  4UUV A;  3I5U A;  2MC3 A;  5K5R A;  1I1S A;  4CZZ A;  2P5K A;  4AIK A;  4HF1 A;  1XGO A;  2ZNY A;  3DPL C;  4BYY A;  3BPV A;  2O3F A;  3I4P A;  1IXS B;  5JHU A;  4IJA A;  5E18 F;  3HHG A;  3HUG A;  4Q47 A;  4L9V A;  5JR3 A;  1BBY A;  2PG4 A;  4N0B A;  4DQ2 A;  2XKO A;  1BIA A;  3ZMV A;  2FF4 A;  3ECH A;  2Z99 A;  3V8K A;  1KYZ A;  3H3Z A;  1R00 A;  1ODD A;  2XGX A;  1ZGA A;  5J6X A;  5ICF A;  1Y0U A;  5LLQ A;  1Z6R A;  5D4S A;  3IKT A;  4NQW A;  2IA1 A;  2ISY A;  4LJZ F;  1GXP A;  3R0A A;  2GZW A;  3BRO A;  3DXJ F;  1TQP A;  1IN7 A;  1V3F A;  3F8M A;  3K1M A;  4MQ9 F;  3WU0 A;  4UV9 A;  2A61 A;  3BDD A;  1O3T A;  2IT0 A;  3BOQ A;  3ZN1 A;  3ISP A;  2NNN A;  5FD6 A;  1LVA A;  4I09 A;  3JTG A;  5DD8 A;  2EV6 A;  1W5T A;  5FGM A;  4G7Z F;  1J5Y A;  3GO5 A;  4LMY A;  2D2W A;  4U0Y A;  3IWF A;  1XDS A;  1KQ8 A;  2OQR A;  3N4M A;  4HLY A;  1TW2 A;  1Q1H A;  1EH7 A;  1ONV A;  5DV5 A;  1S8N A;  3MZY A;  1LEB A;  5E8G A;  1YS7 A;  4LK0 F;  3IC7 A;  3WGI A;  2MD5 A;  3IRR A;  2MBF A;  5EEH A;  2EV5 A;  2XVC A;  5D8K B;  1P92 A;  1LDJ A;  2FSW A;  4EJT A;  4A5M A;  2XAF A;  2VC0 A;  4BAY A;  3RTR A;  4MEX F;  4IHS A;  2L4A A;  3B73 A;  3GW2 A;  2M45 A;  3SHF A;  2KJC A;  2Q0O A;  3J7A O;  4KDP A;  2ZKZ A;  2FEZ A;  1OYI A;  5L3B A;  2MLG A;  4Q5S F;  3I58 A;  4M9S A;  1ZN2 A;  4RAZ A;  4PZJ A;  5LEJ A;  3J80 Z;  3KP3 A;  3HSF A;  4NB5 A;  2QQA A;  3CO6 C;  3I0T A;  2KIM A;  4A6D A;  5DUI A;  4MGR A;  3MEX A;  2RC4 A;  2OQG A;  3HTU A;  2V1X A;  2WC2 A;  4KNY A;  2LNB A;  3M1E A;  1R1T A;  1WWX A;  3DF8 A;  4OIQ F;  5K5O A;  4L9N A;  5ILV A;  4KN7 X;  2FU4 A;  5D6E A;  1QPM A;  4HX4 A;  3I71 A;  1CF7 B;  3R60 A;  3GLX A;  3NEU A;  3SZP A;  3KEQ A;  4UVC A;  3AAF A;  1XMA A;  3FM3 A;  3C1D A;  2COM A;  2VE9 A;  2WWY A;  4PCQ A;  5TRD A;  2A69 F;  5CVR A;  5L3D A;  4LLG F;  2VBW A;  4LFU A;  2HR3 A;  2A07 F;  3E3V A;  4RB2 C;  1F4K A;  3F8C A;  2DPD A;  1XSV A;  2O0Y A;  5AON A;  1K79 A;  5AIQ A;  3FWE A;  2PN6 A;  2F5F A;  4EJO A;  1YS6 A;  3DEU A;  4O3M A;  1O7L A;  4PDK A;  3DPT A;  4GCV A;  4UVA A;  1ZRF A;  5TJJ A;  2EJR A;  2VOO A;  1Z05 A;  2FBH A;  5LHG A;  3TOB A;  1SMY F;  1B9M A;  2VON A;  1B1B A;  2WV0 A;  1TNS A;  3E5X A;  4EJV A;  2ZO4 A;  3QU6 A;  1K6O A;  4ASN A;  3O2P E;  2K7L A;  1AOY A;  5ILS A;  1PP7 U;  2DI3 A;  1UHW A;  4TV7 A;  2BEO A;  2LKP A;  2PLY A;  4GGG A;  1S3J A;  5HDN A;  5H20 A;  3E5Q A;  3N97 A;  4H0E A;  4U7B A;  4UV8 A;  3IRQ A;  3CUQ A;  3MCZ A;  5LEK A;  3HTS B;  2FXA A;  2HKO A;  3C7J A;  2KJB A;  5DCM A;  2NNY A;  1E2X A;  3JSO A;  1FYL A;  1R7J A;  2ZME B;  1TTY A;  2F2E A;  3ZN0 A;  1UST A;  5LGU A;  4IVN A;  1HW2 A;  3WTS C;  3R6S A;  5FB2 A;  4R1H A;  5CVI A;  2GAU A;  3RPU A;  2ZBK A;  3V7S A;  4HZF A;  5H6Q A;  2M5W A;  4RAY A;  2G7H A;  4MNU A;  1XDU A;  2XAS A;  2EK5 A;  3MAJ A;  2GA2 A;  5DCF A;  4FX0 A;  2M1B A;  1YLF A;  3EYI A;  4I0A A;  2EA2 A;  1OKR A;  3Q9V A;  3TO9 A;  3NQO A;  1XGM A;  3EYY A;  1ZRE A;  5CVJ A;  3GFJ A;  3Q5F A;  2DW4 A;  2CSO A;  2ACJ A;  5D5U B;  2E7X A;  4AD9 A;  2EFQ A;  1LDD A;  2WTE A;  1Z91 A;  2OZ6 A;  5HS7 A;  3COA C;  5BPI A;  1RUN A;  2CGP A;  4ESJ A;  4I7H A;  1MZB A;  4A12 A;  3I54 A;  4S05 A;  2W25 A;  4RB1 A;  1L3L A;  3KLN A;  5A2Q Z;  5D5X B;  4L18 B;  3WTU C;  3GYH X;  3C18 A;  3IL2 A;  2HYG D;  2DQL A;  3KET A;  2L01 A;  3WTW C;  2R7F A;  1IRF A;  3KZY A;  2P6T A;  5DEQ A;  2BE5 F;  4ESF A;  4HDV A;  1YQA A;  3Q9S A;  2V6C A;  3HSR A;  4OIR F;  4UXN A;  3K69 A;  4G6D A;  1J7K A;  3EET A;  3WOD F;  3F72 A;  2X4H A;  4HV6 A;  2FE3 A;  1XSX A;  2JPB A;  4KMU X;  1ZLJ A;  1MJ9 A;  4PGG A;  3TO6 A;  2CYY A;  3ZMD A;  1U5T C;  4BQA A;  2P8T A;  3WGG A;  4EJW A;  3V4G A;  1V4R A;  3KEO A;  1MKM A;  1FWZ A;  4G9Y A;  4EM2 A;  2X0L A;  4MTD A;  2VBZ A;  1KYW A;  5K5Q A;  5DCM B;  2PEX A;  4OIO F;  1IN4 A;  2HQR A;  1IRG A;  5HLG A;  1R1V A;  5KVR A;  4P96 A;  2VE8 A;  3WE2 A;  3ABT A;  2XUB A;  1RIO H;  1FSH A;  3E6M A;  2HOE A;  3ERE D;  2GWR A;  4G7H F;  4U0V A;  4LB5 A;  2EFN A;  5FFZ A;  1I6X A;  3KLO A;  1OPC A;  4K2E A;  4LG0 B;  2K02 A;  1G4D A;  1FT9 A;  1QQI A;  1HSJ A;  1FP2 A;  4P5O A;  1I27 A;  4YFK F;  3G73 A;  3T8R A;  2YSR A;  3PQK A;  4BHP A;  2DU9 A;  3ZMZ A;  1O3Q A;  1FX7 A;  5J8F A;  4L0Z B;  1DPR A;  1CGP A;  2OZU A;  3JTH A;  5IT9 Z;  5D4R A;  3QP6 A;  4N9I A;  4KN4 X;  2F5D A;  4CXF A;  1WI9 A;  2KIU A;  3TKY A;  1ON2 A;  1LNW A;  5LGT A;  2BV6 A;  4L9J A;  2HZT A;  5HLI A;  4D0P A;  5BOX A;  4AVP A;  3CUQ B;  3NRV A;  4YFX F;  4G6Q A;  1Z9C A;  4L5J A;  2EFO A;  4HLX A;  2HWV A;  1LB2 A;  2H6C A;  1I5Z A;  2C6Y A;  3EUH A;  1J75 A;  4CHU A;  1R22 A;  3DKW A;  2MH2 A;  2W85 A;  4FT8 A;  1BM9 A;  4EMS A;  4MEY F;  5J8C A;  2PI0 A;  1XSD A;  4BH9 A;  1JHH A;  1P4A A;  4HX8 A;  1CF7 A;  4M73 A;  3L2C A;  3E6B A;  3VFZ A;  2YX7 A;  3GFI A;  4MQV A;  4PGH A;  2Y48 A;  5D8L B;  2RVC A;  3CUQ C;  1SFX A;  1VTN C;  5ED4 A;  3DP7 A;  1MJB A;  2RN7 A;  1PDN C;  3RYR A;  3GZ5 A;  5BMZ A;  1FYK A;  3HOT A;  3HHH A;  3JW4 A;  3M9A A;  2RKH A;  5IT9 K;  3L7W A;  2HFH A;  4LK1 F;  1ZGJ A;  1LEA A;  3W6K B;  5DUK A;  4M9X A;  1OYY A;  3RKX A;  4WCG A;  4HAM A;  4P9U A;  4G8X A;  4KIF A;  1Z1D A;  2J5O A;  5CYV A;  5E1W A;  2PJP A;  2LSO A;  1T38 A;  4IRG A;  2ETH A;  1J59 A;  1R1U A;  2K86 A;  5F6F A;  5L3G A;  1RNL A;  1T0F A;  5HVQ C;  4KFC A;  3TGN A;  2K4B A;  2DQR A;  2M30 A;  5L3E A;  5JVT A;  2OBP A;  1FC3 A;  3P9I A;  3QOP A;  1MDM B;  4HF2 A;  4KMF A;  4ENM A;  3KCC A;  3W6J B;  3WTT C;  2ZFW A;  1FBS A;  2P6S A;  3FMR A;  1YW8 A;  1O3S A;  1AWC A;  4GO1 A;  2XAH A;  3KE2 A;  3P9C A;  1HKT A;  3GZ6 A;  1ZYR F;  3WTY C;  2OD5 A;  5ICC A;  2MA3 A;  1XCB A;  3M7G A;  1J0R A;  1EH6 A;  5E17 F;  2D45 A;  1T98 A;  2H94 A;  5HS8 A;  3RDI A;  1BOA A;  1MD0 A;  2E1C A;  2IA2 A;  4HOB A;  3E5U A;  1TNT A;  2UWM A;  1FNN A;  3WTZ A;  3CTA A;  1T6S A;  3RPQ A;  3FXU A;  2Q8K A;  4ON0 A;  1R23 A;  2F5E A;  2IRF G;  4RB0 A;  2L4M A;  1YO5 C;  2D1H A;  1F5T A;  1UFM A;  4CDG A;  2LF7 A;  3LQR A;  2HTS A;  4EGY A;  2FQ3 A;  1J9I A;  2PFB A;  3T0Y A;  3K9T A;  1GXQ A;  1SAX A;  3V8J A;  2L3D A;  2XAJ A;  1HST A;  1STZ A;  1IUY A;  1FP1 D;  5CLS A;  3MFK A;  2M8E A;  2XKP A;  4JBA A;  2CWE A;  4YIF A;  3HRS A;  1ZH5 A;  1LQ1 A;  4I0B A;  4E70 A;  3DV8 A;  1W7P B;  3E6D A;  4OOI A;  4UNO A;  1UHM A;  3K1P A;  1MDM A;  2OU2 A;  3RIR A;  1H0M A;  4G94 A;  3FXR A;  2ESN A;  4KUM A;  5FLX Z;  2M87 A;  1FZP B;  5LRR A;  4N9H A;  2V79 A;  3GFL A;  3F8N A;  1I1G A;  1D8K A;  3F8B A;  3VOE A;  1ZAO A;  3BZ6 A;  3GFM A;  2EFW A;  3GXO A;  4GYI A;  2VT3 A;  3BP8 A;  1IAW A;  3ZMU A;  4EJU A;  2IW5 A;  2R3S A;  1U8R A;  3R4K A;  4GXO A;  4P9F A;  6PAX A;  3CDH A;  4P55 A;  1A04 A;  1QZZ A;  2OAZ A;  1K78 B;  4BHC A;  3V8L A;  2XAG A;  3PQJ A;  4IRI A;  3K2Z A;  5D6F A;  3ZMS A;  5JFR A;  1O7F A;  3U9G A;  3T8T A;  4ZYH A;  5HOO A;  3T5X A;  1BI3 A;  4YII A;  3KP2 A;  3JAM K;  3FHZ A;  1G3S A;  1P2F A;  3O3K A;  3CJN A;  1E17 A;  4ESB A;  2P7C B;  2D1V A;  1F9N A;  3R61 A;  1RZ4 A;  4KIC A;  4BXU A;  2DFI A;  1BC7 C;  1GHC A;  1FLI A;  2FOK A;  2QQB A;  3ROU A;  1ULY A;  2H6B A;  2KKO A;  2ADU A;  3FXQ A;  4R8H A;  4G7O F;  1DPU A;  4Z2Y A;  3HRM A;  1G3T A;  2Z3Y A;  2G7U A;  3GWZ A;  5E1X A;  1SD7 A;  2HGC A;  4HYE A;  1QZY A;  3LA7 A;  4AIH A;  1TBX A;  4KT5 C;  3U1D A;  3ABU A;  4A6E A;  2VBX A;  2STW A;  3ZQ7 A;  4DNC A;  1QBJ A;  2Z5U A;  1XGN A;  2FMY A;  2PMH A;  4AWX B;  3P7N A;  4XRF A;  1R36 A;  3D0S A;  2YU3 A;  3JSP A;  3KFW X;  4U7D A;  4JQF A;  4Y13 A;  1FOK A;  4WXH A;  3J81 K;  1WRJ A;  3E6C C;  3GEZ A;  1W7P A;  1HKQ A;  2JSC A;  5JI6 A;  3F22 A;  1U3E M;  4M6Y A;  4KIB A;  3KP5 A;  5DD4 A;  3WGH A;  3U2R A;  3KP4 A;  2RV8 A;  2MH9 A;  2PQ8 A;  1P4X A;  3V7C A;  4HA8 A;  3CO7 C;  1SFU A;  1PUE E;  3GVA A;  4HF0 A;  1JHF A;  2L02 A;  2XRO A;  1ZAR A;  1NHA A;  1B4A A;  3WU1 B;  4LD5 A;  3KP6 A;  2HYF A;  1EV7 A;  2HKX A;  1L0O C;  3F21 A;  2QBY B;  3BWG A;  1TW3 A;  1KU3 A;  3RI4 A;  1KQ9 A;  1XCV A;  5BS6 A;  2UZK A;  2CG4 A;  3WG9 A;  2DK8 A;  2J5P A;  4OIN F;  3HIF A;  3MZH A;  4QLC U;  4YFN F;  2XRN A;  4ETS A;  3LQQ A;  3HOS A;  1U5T B;  2JRT A;  3WTX C;  3F6V A;  3I59 A;  4QWQ A;  1MGT A;  1HKS A;  1YTY A;  1HQC A;  1WKM A;  5F1R A;  2VC1 A;  1ZG1 A;  1R5G A;  2JT1 A;  3IHU A;  4Q48 A;  5ERI A;  1R5H A;  5ILU A;  1C0W A;  2AS5 F;  2B0L A;  4LB6 B;  3ECO A;  2EB7 A;  3HYI A;  4L0Y B;  3RJP A;  2ISZ A;  2EFP A;  1YYV A;  3I53 A;  4RGU A;  1U2W A;  2FML A;  4UVB A;  2FNP A;  1USS A;  1P4W A;  2DT5 A;  2GIV A;  1KU7 A;  1S6L A;  3IWZ A;  5LRS A;  2ZNZ A;  2ZME A;  2RDP A;  5H6R A;  2CW0 F;  4HV5 A;  2XIG A;  2P5L C;  1DDN A;  5HS9 A;  3MWM A;  4WXD A;  1R58 A;  2FA5 A;  4LLN A;  1ZHF A;  2TDX A;  4HQM A;  5K1Y A;  3KZZ A;  4WK8 F;  3TOA A;  1IN8 A;  5CVU A;  1JGS A;  3J80 K;  5HDG A;  1KU2 A;  3P9K A;  2A5Y B;  1UCR A;  5FD5 A;  3QU3 A;  2HS5 A;  1PP8 F;  2W84 A;  3BJ6 A;  2VN2 A;  2CQK A;  1GVJ A;  5CJ9 A;  2VOP A;  1U5T A;  3H3U A;  4RB3 C;  1WQ2 A;  2STT A;  2QWW A;  3RYP A;  5ICE A;  3QP5 A;  5ICG A;  3L09 A;  3GF2 A;  4ZZL A;  1OYW A;  1EH8 A;  1D8J A;  2PBI A;  4RGX A;  2IP2 A;  2Q2E A;  3L9F A;  2V1D A;  2E1N A;  1BI1 A;  3ULQ B;  3F23 A;  5HLH A;  3VB2 A;  1SD6 A;  1T2K A;  2O6G E;  3M8F A;  1ZRC A;  3EQL F;  2XAQ A;  3HRU A;  3VEP A;  3JAM Z;  1G6N A;  2O61 A;  1IXR C;  2O8X A;  2QUF A;  3WE3 A;  4CYD A;  4L5I A;  2LF8 A;  4AIJ A;  2ZCW A;  1ZLK A;  3ZMT A;  3FZV A;  2DBB A;  1XD7 A;  2P5V A;  2H27 A;  1G3W A;  4BNC A;  4OU0 A;  4EM1 A;  4BHB A;  1K78 A;  3BJO A;  3GX4 X;  4GYG A;  1HBX G;  2RQP A;  4A0X A;  3PFI A;  2RNJ A;  4A2U A;  2OA4 A;  1S29 A;  1O3R A;  3C3W A;  3IKV A;  3SQN A;  1ZG3 A;  2GXG A;  5E1Z B;  4EV0 A;  1W7P D;  2MLK A;  4EQQ A;  5E8I A;  2FNA A;  2ESH A;  1Z6T A;  3LA2 A;  4LLL A;  1IN6 A;  4A0Z A;  3J81 Z;  4EVI A;  1HW5 A;  2K27 A;  3SFZ A;  1SFE A;  5L3F A;  2IPQ X;  1ON1 A;  3FMQ A;  1X3U A;  1YW7 A;  4LG0 A;  2L54 A;  2DPU A;  5D5V B;  2QZ8 A;  2KIF A;  1O57 A;  2VBY A;  1B9N A;  3TDU C;  2AXL A;  1T39 A;  1XGS A;  4WXC A;  4KYW A;  5DDG A;  3BY6 A;  1BI2 A;  3K1N A;  3ZP5 A;  3QAH A;  1KA8 A;  1G3Y A;  4XLP F;  2VOD A;  4XBF A;  3B02 A;  2QEN A;  2A6H F;  2QQ9 A;  1QO0 D;  1K7A A;  2DO7 A;  1IZ1 A;  5FO5 A;  1H9G A;  1MJA A;  1SMT A;  5BQT A;  3F6O A;  4R79 A;  5CVV A;  3HRT A;  1ZG5 A;  3QPT A;  2V9V A;  5EEG A;  4MHG A;  3TO7 A;  1FBU A;  4IF4 A;  2F5C A;  4LGW A;  1YG2 A;  1QNT A;  4MTE A;  4I2O A;  4S04 A;  1JE8 A;  5D5W B;  1FYM A;  3QRF F;  2Z33 A;  3LFK A;  4M9Z A;  3M8E A;  2K4J A;  1S7A A;  4HBL A;  3S2W A;  2IJL A;  2NAZ A;  4EGZ A;  4RGR A;  3R0J A;  1KQ0 A;  1IXC A;  3L00 A;  1SD4 A;  1BI0 A;  2DLL A;  1B6A A;  2DAO A;  4M72 A;  2NYX A;  1WSU A;  3LWF A;  4WX9 A;  4HDU A;  1LJ9 A;  4U0W A;  1D3Y A;  1XB4 A;  2QBY A;  3H92 A;  2YR2 A;  1B59 A;  4KA4 A;  1FBQ A;  2A3S A;  3ZPL A;  4ENJ A;  3LAJ A;  3CUO A;  4OMZ A;  4UHT A;  3TQN A;  2YPR A;  3HSE A;  5LHI A;  3ML6 A;  2ZJ2 A;  5FLX K;  1OR7 A;  4IPA A;  2HTJ A;  1TLH B;  3CLO A;  3F3X A;  2XHK A;  5HDK A;  1BJA A;  3EDP A;  3FMS A;  1RUO A;  2EA4 A;  2RGV A;  4XSX F;  3RKY A;  4CO8 A;  2XV4 S;  3WTV C;  4IXA A;  5KK1 A;  3ELK A;  1YFH A;  2EWN A;  2BYV E;  4M74 A;  5A2Q K;  3DFG A;  3MQ0 A;  2JTV A;  3D5L A;  4O6J A;  2GA1 A;  1BN5 A;  2NRA C;  1JXS A;  1XMK A;  3SXY A;  4JK1 X;  1BC8 C;  4F7Z A;  4HW0 A;  2CFX A;  2YX4 A;  5DYM A;  3REO A;  2E7W A;  1DP7 P;  3FX3 A;  1J2X A;  3K0L A;  2ELH A;  1TQI A;  2HQN A;  4I01 A;  4FHT A;  4HX7 A;  4WF2 A;  2HEO A;  5F64 A;  1OMI A;  4ZYE A;  5LBQ A;  5L3C A;  2IVM A;  3KP7 A;  2W57 A;  5BPD A;  2CO5 A;  4U88 A;  3RKW A;  1IW7 F;  3SZT A;  2FRH A;  4A5N A;  4RS8 A;  4IRH A;  4ENK A;  2VT2 A;  2P7V B;  1HXD A;  4KIG A;  2QYO A;  3G3Z A;  3I59 B;  2A6E F;  4M71 A;  2GXB A;  2JZY A;  2PMU A;  4NHJ A;  2P4W A;  2QLZ A;  1U6G A;  2O03 A;  1BIB A;  4ENN A;  2DK5 A;  1IF1 A;  2FBI A;  4A0Y A;  4WWC A;  1RI7 A;  2UXX A;  3E97 A;  4B09 A;  1LDK B;  4EM0 B;  2A68 F;  2G9W A;  3FM5 A;  1P6R A;  1F1Z A;  2H09 A;  1Z7U A;  2KRF A;  1ZRD A;  2BBY A;  5FFX A;  3VOD A;  2Z9O A;  5E20 A;  2GQQ A;  1QGP A;  1FY7 A;  5IT3 A;  4Y15 A;  3OV8 A;  4I98 B;  2JPC A;  3LST A;  1KU9 A;  4M6X A;  3LAP A;  2EV0 A;  2IA0 A;  1YW9 A;  4ZYG A;  2QM3 A;  4CGZ A;  1H9T A;  2R7D A;  4I02 A;  1W4M A;  2ZXJ A;  4XSZ F;  4L9T A;  4IHT A;  2BGC A;  4XLN F;  1HW1 A;  1U78 A;  2HDC A;  2VXZ A;  3BPX A;  4O5V A;  3O6B B;  5AIP A;  3TDZ C;  3T1B A;  2W24 A;  4B8X A;  4ZZD A;  3QPH A;  3BJA A;  2NS0 A;  4ZYD A;  2V1U A;  5LGN A;  1W5S A;  2FBK A;  4CIC A;  1DUX C;  1FSE A;  3F8F A;  2Y0M A;  3OOP A;  4ZH4 F;  3V7R A;  4HQE A;  1TQM A;  3I64 A;  1D5V A;  4FX4 A;  1UB9 A;  1IN5 A;  5LHH A;  1S7O A;  4OMY A;  2UXN A;  1KGS A;  3DQV C;  4Q4Z F;  1FPQ A;  4OIP F;  2DTR A;  4RGS A;  1YIO A;  2QVO A;  3LA3 A;  1REP C;  4YG2 F;  2Y75 A;  3FF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...