2MH9A

Resonance assignment of rqc domain of human bloom syndrome protein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
127
structure length
127
Chain Sequence
CKTKDYKTRDVTDDVKSIVRFVQEHSSSQGMRNIKHVGPSGRFTMNMLVDIFLGSKSAKIQSGIFGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQAIAYVMLGNKAQTVLNGNLKVDFMETE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bloom syndrome protein
publication title Solution structure of the RecQ C-terminal domain of human Bloom syndrome protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 38
structure length 127
sequence length 127
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09382 RQC RQC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2mh9A00
2VN2A 4G6QA 2DTRA 2FMLA 3E6MA 3FM3A 1HQCA 2PQ8A 2IVMA 1D8KA 4Q48A 1IF1A 1GHCA 2P4WA 1R5HA 3D0SA 3HYIA 1Z6RA 1BIBA 3TKYA 1YFHA 3KP2A 2QWWA 2TDXA 4EGZA 1IZ1A 3WTTC 2GAUA 4MQ9F 4RAZA 2HGCA 2PG4A 2QVOA 4L5IA 2O8XA 2KIMA 5JR3A 3QPHA 1IXRC 4EMSA 5ICFA 1P6RA 1TBXA 2QBYA 1P4WA 4LG0B 2HTSA 1QNTA 3TQNA 2R7DA 4UV8A 2XUBA 4WXHA 2W24A 3SQNA 4MTDA 2ZXJA 5IT9K 3FZVA 4I09A 3ROUA 2G7UA 1F1ZA 2OQRA 4UV9A 2JZYA 5J8CA 2EFOA 1U2WA 4ON0A 3HRTA 3ZMDA 3P9CA 3ZP5A 1I1SA 4G7ZF 1T98A 4A0ZA 1W7PA 1XMAA 3WODF 4IHSA 4YFXF 2A5YB 3SHFA 3HRSA 1KU3A 5L3BA 2F5FA 1QZZA 3FM5A 5A2QZ 4N0BA 2KJCA 3SFZA 1OR7A 1I6XA 4I7HA 2F5DA 3GW2A 2HR3A 3KP3A 1UHMA 2AS5F 5DD4A 3T0YA 5CVVA 5DV5A 3WTWC 2FRHA 1IN6A 2OA4A 4LJZF 2BBYA 2FMYA 2UZKA 2RQPA 1WQ2A 2J5PA 4EM1A 3BWGA 3TDUC 1LEAA 2Z33A 1OKRA 4KIFA 1P92A 1MJAA 1KA8A 3CDHA 2DQLA 5BOXA 5LEKA 4L9TA 1O3SA 3IWFA 3CTAA 2EA2A 4HW0A 4R79A 4ASNA 3IWZA 1RUOA 1A04A 4CXFA 1U3EM 4HA8A 2Q2EA 1G4DA 1RIOH 4O5VA 2FNAA 4IRHA 3I53A 2HQRA 2CFXA 4PZJA 1BI1A 3HOSA 3EQLF 5E8IA 3KEQA 2EV0A 4G94A 5F1RA 2E1NA 1XB4A 1JHHA 3V8LA 4ZYHA 4RB3C 4U7DA 3I58A 2HEOA 5E17F 3DPTA 4EM0B 2IP2A 5E1XA 3ZQ7A 2Q8KA 2H6CA 1MJBA 5LGTA 1MD0A 1R5GA 4ETSA 4ENMA 4LG0A 2MLGA 1QBJA 4KN7X 3BOQA 4BHPA 3WTXC 2OZUA 3ERED 2ISYA 5FD6A 3HIFA 3RKWA 1DPRA 4GCVA 1BC7C 3PFIA 4JQFA 4CO8A 3IKTA 2ETHA 3DV8A 2F2EA 3ZPLA 2OD5A 1GXQA 2HKXA 1RUNA 3QP5A 1IXCA 5L3DA 3J81Z 2X0LA 3I0TA 1U8RA 4A12A 2B0LA 2EA4A 4PCQA 2RC4A 4P55A 1R1UA 1E2XA 1B9MA 1P4XA 1TNTA 2FNPA 1SD6A 1HKTA 2K86A 3T8RA 2GZWA 5ERIA 4UVBA 1L3LA 1S8NA 2IRFG 5E1ZB 2FF4A 4RGXA 3GO5A 3T5XA 2Y48A 1WKMA 1I1GA 1W5SA 2H6BA 2EJRA 3TGNA 1GXPA 3K69A 5CYVA 4OMZA 2YU3A 2HTJA 3RDIA 1Z9CA 4KN4X 4R8HA 4HF0A 1Z7UA 3KCCA 5D8KB 5DCMA 2ZCWA 3JTGA 1FP1D 5DDGA 4WXCA 1TNSA 3EUHA 3I4PA 2GWRA 1O7FA 1R1TA 1G3TA 1XGNA 1O3RA 3KP5A 3JSOA 2PI0A 3HRUA 1Z05A 1K7AA 2M87A 3QU6A 4KMUX 1HW5A 1KQ0A 1S7OA 3FXRA 5FB2A 3ISPA 3J80K 1CGPA 1BI2A 2EFQA 5CVIA 5DEQA 1AWCA 1BIAA 3K0LA 4HF1A 3WU0A 4A6DA 2HWVA 1ZARA 3COAC 4KT5C 1IUYA 3I59A 3WGIA 1WRJA 2ZBKA 5J8FA 4M72A 3KLNA 1LDKB 1W5TA 2JRTA 3BROA 2O3FA 2LF8A 2UWMA 3ZN1A 4E70A 1D8JA 3H92A 2XKPA 2XAHA 2KIUA 3KEOA 2HS5A 5E1WA 2FEZA 1EH7A 3DFGA 5HDKA 3KP7A 3GEZA 4OMYA 2HZTA 2OQGA 2VC0A 1W4MA 4FX4A 5LHHA 2ELHA 2YX4A 5BPDA 3FHZA 5ILSA 2O6GE 5ED4A 4IF4A 3RKYA 3LQQA 1ZRDA 2CWEA 2P5VA 4UUVA 2P6SA 3OOPA 5JHUA 1H0MA 2BV6A 1JXSA 5LGUA 1WWXA 5JI6A 2QBYB 2H27A 2P5KA 4I01A 2VONA 2ESNA 2H09A 2OU2A 4EJWA 4HOBA 4S05A 3WTSC 3E5XA 1B4AA 3H3UA 3IHUA 2W57A 5L3EA 4FHTA 3TO7A 2VC1A 1LVAA 2VT2A 5FD5A 4KMFA 1UHWA 2W25A 2RKHA 2QQAA 1W7PB 4Y15A 3VOEA 3P7NA 4MEXF 2DQRA 1YW7A 4EV0A 4M9ZA 2A69F 1KU2A 2HYFA 4RGUA 1J5YA 1XCVA 2EB7A 2NYXA 3WTZA 4I98B 1FC3A 3CLOA 4YG2F 3RYRA 4KNYA 2QZ8A 1RI7A 4EJTA 3VFZA 2XKOA 1KYWA 1HKQA 5BPIA 5LHIA 3GZ5A 2OBPA 2LKPA 1ZG3A 3CUQA 5AIQA 3O6BB 4P9FA 4A0YA 3FF5A 4XLNF 4RB2C 5DD8A 1LNWA 3HHGA 3DKWA 1IN8A 4MHGA 3F23A 2CW0F 2DK8A 2L3DA 4EVIA 2XGXA 4M74A 4IVNA 1G3WA 1SD5A 1I5ZA 2CGPA 4RS8A 1ZLKA 1LEBA 3TOAA 5FLXK 3HSEA 3S2WA 4KICA 1ZRCA 1DPUA 2D45A 3FXQA 3GLXA 3C1DA 4IRIA 3HSRA 4ZYGA 3FXUA 2HOEA 2DO7A 5J6XA 4ENNA 4IHTA 1YYVA 3GWZA 4LB5A 2GA1A 3B02A 2QENA 3P9KA 2KRFA 5E8GA 3GZ6A 4R1HA 2GXGA 2LDUA 4ZYDA 4HX8A 3V7RA 1IW7F 4FT8A 4OIQF 4WCGA 5ILVA 2FU4A 1NHAA 1BI0A 1CF7A 4RB0A 2Z3YA 2FXAA 2CQKA 1L0OC 3CUOA 4PGHA 4Q5SF 2DT5A 2FA5A 1XDSA 1YIOA 2YR2A 3QP6A 2VBWA 1TW2A 3BJAA 1FP2A 2FQ3A 2ZFWA 5F64A 5CVJA 1R00A 2EFWA 3FMRA 5LLQA 3DPLC 4HQMA 4YFKF 2XIGA 4M6YA 2JTVA 3J7AO 5K1YA 3FX3A 2O0YA 4A2UA 1JE8A 4HQEA 2ZNZA 1XSXA 2JSCA 3MCZA 1SAXA 3K2ZA 2A07F 3RPUA 4QWQA 1OMIA 1ON1A 4ESJA 3IKVA 2R7FA 2UXNA 5HLIA 4CYDA 4OIOF 5DCMB 4OIPF 3EYYA 5HS8A 3LA7A 4HYEA 1TQMA 1YLFA 5D5WB 5KVRA 2K7LA 1MKMA 2DLLA 1BBYA 4MNUA 4K2EA 4EJOA 4ENKA 2M45A 2E7XA 4WF2A 4M9SA 4ENJA 1HSTA 1E17A 3K1NA 1TLHB 4Q47A 1MGTA 2E1CA 2HKOA 4WX9A 1FZPB 1J59A 3I59B 3MZYA 4LD5A 5A2QK 2CG4A 1YW9A 1ZG1A 1I27A 2HFHA 2V1UA 4RGSA 4XSXF 3BY6A 2W84A 3JTHA 4HDUA 3SZTA 3KP6A 3R0AA 3EYIA 2D2WA 5HOOA 4AD9A 1QO0D 2KKOA 4M73A 1MJ9A 4M9XA 5E20A 4KA4A 3HSFA 4G7OF 2IA0A 3DQVC 3DP7A 3CJNA 2W85A 3RJPA 1H9GA 5D5VB 2M30A 2XAJA 2D1VA 4WWCA 4UHTA 1ZREA 1U5TA 4JBAA 2BEOA 2DU9A 5HS9A 3V8JA 4GO1A 1ZG5A 4LFUA 4M71A 1KQ8A 2WC2A 1PP8F 3WE3A 3EDPA 4QLCU 1LJ9A 4UNOA 5HS7A 3ABUA 4YFNF 1RZ4A 3K9TA 2STWA 1K78A 2XASA 4L9NA 4RAYA 5HLGA 5DUIA 3M7GA 3MEXA 3ULQB 4BYYA 2C6YA 1ZLJA 3TOBA 2BE5F 2DK5A 2M5WA 3WGGA 4IJAA 3MQ0A 4KYWA 1FY7A 3MZHA 3HRMA 2PN6A 4IPAA 2PEXA 3KZYA 1HXDA 3HHHA 3L00A 1YO5C 2VBZA 1J7KA 1IN5A 2O03A 2RDPA 2QLZA 2NRAC 6PAXA 1LB2A 1UFMA 1HKSA 2G7HA 1XCBA 4RB1A 5JFRA 2ZMEA 2K4BA 3T1BA 2F5CA 4UXNA 1K79A 1KU9A 3J81K 4M6XA 3SXYA 5K5RA 2STTA 2ZO4A 5EEGA 3CUQC 3CUQB 3RTRA 1QZYA 1AOYA 2RNJA 1ZHFA 1Z1DA 5ICCA 4Z2YA 3M1EA 3NRVA 1BI3A 4XSZF 1WI9A 1RNLA 1J9IA 5CJ9A 4L18B 2XVCA 2ZNYA 1FYLA 3F8BA 3LA3A 1C0WA 1IAWA 1OYIA 1R36A 1IN7A 4G9YA 4BNCA 3GFMA 1LDDA 2F5EA 4HX7A 1USSA 2CSOA 2ESHA 5LHGA 2KJBA 2YPRA 4ZYEA 1W7PD 2E7WA 3L2CA 2IPQX 3B73A 4LGWA 3HOTA 3RYPA 2OAZA 4BAYA 3EETA 4Y17A 1QGPA 1JHFA 3F3XA 4DNCA 1R1VA 2A6HF 4IRGA 1S7AA 4CGZA 3WTYC 2X4HA 3WTVC 5EEHA 5H20A 1YTYA 3C7JA 2PFBA 3NEUA 2WTEA 4S04A 2WWYA 3GUDA 1D5VA 1MDMA 1VTNC 1R22A 4O3MA 2Y75A 3BJ6A 1PDNC 3JSPA 5FFZA 4AWXB 1P2FA 5F6FA 1CF7B 3F8MA 5K5OA 1YS6A 2VODA 4BH9A 1DDNA 2PMHA 3DF8A 3ECHA 3SZPA 1BN5A 2QQBA 1DP7P 1USTA 4JK1X 4HLYA 3H3ZA 1PP7U 2FE3A 3G3ZA 2ZKZA 4A6EA 2VT3A 4MEYF 2Q0OA 2K02A 1UCRA 2XRNA 1EH8A 2MLKA 3REOA 3GX4X 5HDGA 3VODA 3DXJF 3L9FA 5LBQA 4LLGF 4KUMA 5TRDA 2YSRA 3KZZA 1IRGA 1K6OA 2V1DA 3HTSB 1QPMA 5D5UB 2V79A 3LQRA 3F8NA 4LB6B 4I02A 4G7HF 3RI4A 2QYOA 4XRFA 1Q1HA 4NB5A 3WG9A 1J75A 1S29A 2XV4S 5FO5A 1XGSA 2IT0A 3F8CA 3M8FA 5H6QA 4MQVA 5AIPA 1Z6TA 4H0EA 3VEPA 1F4KA 3W6JB 4U88A 2GQQA 4L0YB 1SD4A 2NNNA 3ABTA 2VBXA 5CLSA 3E6CC 5IT9Z 1S3JA 3IC7A 4A0XA 5LEJA 2RN7A 3I54A 3QPTA 1TQPA 3KE2A 4AIKA 1STZA 4U7BA 2QQ9A 1F9NA 4HX4A 4B8XA 1U78A 3R6SA 2VOOA 4BHBA 2DPDA 1ONVA 3RPQA 1F5TA 2IA2A 4TV7A 4N9IA 3E6BA 3ELKA 4Q4ZF 2EFNA 2FBIA 1YS7A 3VB2A 4OOIA 4RGRA 5LRRA 3G73A 5DCFA 2VE8A 4GXOA 2XAQA 3R61A 4I2OA 3FWEA 2UXXA 4I0AA 1MZBA 1SFUA 4Y13A 1LDJA 2BYVE 2M8EA 1YQAA 3M9AA 3WGHA 3NQOA 1OYYA 2OZ6A 2Z5UA 4L0ZB 2V1XA 2ISZA 3K1PA 3QU3A 4G6DA 1U5TC 1U5TB 5L3CA 4AIHA 1ZH5A 4KIBA 2A68F 4IXAA 4MGRA 1B1BA 1KGSA 4BXUA 4A5NA 4CDGA 1GVJA 3BPVA 2V6CA 1T6SA 4ZZDA 1D3YA 3FMSA 1ZRFA 3KLOA 3TO9A 1K78B 5D6EA 3F21A 5E18F 3V7SA 4KIGA 2HYGD 1O3TA 1R7JA 2BGCA 1KU7A 4U0VA 5HLHA 4ESBA 2ADUA 1SMTA 1X3UA 3BDDA 4L9JA 1FYKA 2EV5A 2IJLA 1O3QA 1XGOA 1T39A 2MC3A 3QAHA 4MTEA 3WU1B 4GYIA 1FWZA 1XDUA 1ZAOA 1ON2A 2A61A 1R23A 2G9WA 1XMKA 2ZMEB 3E5UA 4N9HA 2D1HA 3K1MA 3Q9VA 2MBFA 4DQ2A 1HW1A 1UB9A 2XAGA 5CVRA 1BM9A 3BPXA 3QOPA 4O6JA 3TO6A 2FSWA 3TDZC 3F6VA 3N97A 4ESFA 5ILUA 2IA1A 1QQIA 5DUKA 3MFKA 3F6OA 5JVTA 4HV5A 1FSHA 4PGGA 1H9TA 5BS6A 2YX7A 2O61A 5ICEA 3PQJA 3E97A 3MWMA 4P5OA 5LGNA 4U0YA 2P6TA 1FYMA 1REPC 1ZGAA 1XSVA 2DW4A 4L9VA 2NNYA 3FMQA 1IRFA 1WSUA 2XROA 4OINF 3P9IA 1DUXC 1TW3A 2P8TA 2FBHA 4L5JA 5DYMA 4EJUA 4HLXA 3ZN0A 4OIRF 2Z9OA 2L02A 3V4GA 3E6DA 3GVAA 4A5MA 2PJPA 3HTUA 3AAFA 1HW2A 2DAOA 3ZMVA 1FLIA 4HV6A 1ZYRF 1FX7A 3QRFF 1T38A 2FBKA 1OPCA 3LAJA 5H6RA 2DI3A 5KK1A 1MDMB 1V3FA 3GF2A 2GIVA 2K27A 2CYYA 1YW8A 3ZMSA 2A6EF 2Z99A 1EV7A 4FX0A 1J2XA 4YIFA 2M1BA 3LAPA 1IXSB 2GA2A 3F72A 2WV0A 3IRRA 3J80Z 1U6GA 3R0JA 2MA3A 3WTUC 2R3SA 1TTYA 2PLYA 3L09A 5L3FA 3M8EA 5L3GA 3LFKA 4EQQA 3DEUA 2V9VA 3R60A 4UVCA 3JAMZ 2AXLA 4CICA 3KP4A 2MH9A 2EK5A 2IW5A 1FOKA 2DBBA 4EJVA 3GFJA 1SMYF 2QUFA 1S6LA 1V4RA 4D0PA 1IN4A 3IL2A 1FBQA 3O2PE 3Q9SA 1XD7A 1HBXG 1FBSA 2Y0MA 1BOAA 4GGGA 2QM3A 4EM2A 1G6NA 1HSJA 5CVUA 2GXBA 2RGVA 5D4RA 1J0RA 2CO5A 3ZMZA 1ODDA 1R58A 3D5LA 3HUGA 3KFWX 1B59A 5D5XB 1P4AA 2EV6A 5FGMA 4BHCA 3T8TA 3E3VA 4WXDA 4UVAA 1G3SA 3IRQA 5HDNA 2RVCA 3RKXA 1OYWA 2L01A 2K4JA 3F22A 2MD5A 4WK8F 1XN7A 1SFEA 3BZ6A 3JAMK 2JPBA 3C18A 1KQ9A 2DFIA 3Q5FA 4U0WA 4G8XA 1LQ1A 2HDCA 3PQKA 4HBLA 1SFXA 2P7VB 4HDVA 3GFIA 1T0FA 4HZFA 4ZH4F 2H94A 3U2RA 2EFPA 4F7ZA 4P9UA 2P5LC 2PBIA 3BP8A 2A3SA 3WE2A 2MH2A 1FBUA 4AVPA 3U9GA 3ZMTA 4KDPA 2L4MA 3OV8A 2LNBA 2DPUA 1JGSA 3MAJA 3C3WA 3LSTA 1O7LA 1EH6A 1T2KA 3BJOA 4CHUA 4LLNA 2PMUA 5TJJA 5D8LB 3ECOA 2J5OA 3I64A 3O3KA 4NHJA 1FNNA 2EWNA 4LMYA 1B6AA 2NAZA 3N4MA 1FSEA 3I71A 2L54A 3GFLA 3V8KA 1Z91A 1ZN2A 3L7WA 4AIJA 1PUEE 4OU0A 2FOKA 3GYHX 2XHKA 1ULYA 1ZGJA 3GXOA 3ML6A 2VBYA 3CO7C 3CO6C 2COMA 1KYZA 2HQNA 1SD7A 4EGYA 5FLXZ 4PDKA 3E5QA 1BJAA 2JPCA 3RIRA 1G3YA 2RV8A 3ZMUA 2XAFA 2LSOA 2LF7A 4XBFA 1TQIA 5BQTA 4KFCA 5HVQC 2JT1A 4B09A 4NQWA 4CZZA 4XLPF 5K5QA 2VOPA 4LK1F 4YIIA 5LRSA 3KETA 1O57A 1B9NA 5D6FA 1Y0UA 1FPQA 2VE9A 5D4SA 3F8FA 3LA2A 1FT9A 3W6KB 1XGMA 2ACJA 4I0BA 1YG2A 4LLLA 2VXZA 5FFXA 1XSDA 5IT3A 2ZJ2A 4P96A 3V7CA 4LK0F 3LWFA 4ZZLA 2KIFA 5ICGA 4HAMA 4GYGA 1BC8C 5BMZA 2L4AA 5AONA 4HF2A 3U1DA 3R4KA 4BQAA 2NS0A 3I5UA 3JW4A 2P7CB
chains in the Genus database with same CATH superfamily
2VN2A 4G6QA 1FOXA 1T95A 2DTRA 2FMLA 4YEJA 3E6MA 5IPAA 2MW8A 1HQCA 3FM3A 1W0TA 2PQ8A 2GLOA 3S16J 2IVMA 3JRAA 1D8KA 5FLVA 2DOFA 4PFOA 4Q48A 3G4SI 3QPSA 4CYCB 4BE2A 1IF1A 2ZC2A 5CQEA 4E7ZA 1GHCA 2KL4A 2P4WA 1R5HA 3D0SA 3HYIA 4A3FJ 2X6WA 4A3IJ 1Z6RA 1BIBA 3TKYA 3CLQA 4BBSJ 2Y0SN 1YFHA 1LE8B 3KP2A 2DA7A 1ZR2A 1SVLA 2VPRA 2QWWA 2TDXA 2QSGX 1ETWA 4EGZA 1IZ1A 2RQQA 4FCYA 2VASA 5F0HA 2R5YA 2KPMA 3WTTC 2GAUA 4MQ9F 4RAZA 4CH7A 1D0YA 2HGCA 2PG4A 4BXFA 2QVOA 1FOWA 4L5IA 2O8XA 3HPGA 2KIMA 1ZGWA 1XS9A 5JR3A 3QPHA 1IXRC 3HBLA 4EMSA 3K70C 4XORA 5ICFA 1P6RA 4IHVA 2RREA 1TBXA 4A3GJ 2OUMA 2QBYA 1P4WA 2VQLA 4LG0B 5GAEJ 2H8RA 2HTSA 1QNTA 3TQNA 2R7DA 2LMDA 2MSYA 4UV8A 2XUBA 4WXHA 1Z0XA 2W24A 3SQNA 1UELB 3L2QA 4MTDA 3FKJA 1AA7A 2ZXJA 5IT9K 4F55A 2DT7B 3FZVA 4I09A 3ROUA 2IS2A 2V1NA 2G7UA 3A01A 2ECCA 1F1ZA 2OQRA 4UV9A 3PUFA 1I3AA 3DTIA 2LKXA 4FQGA 2JZYA 5J8CA 2K40A 5F04A 2EFOA 1U2WA 4N4NB 4XNFA 2K3PA 2E19A 2BVLA 1YOVB 2K3FA 4ON0A 3HRTA 1PVEA 2AXTC 3ZMDA 3P9CA 3ZP5A 1I1SA 3LSPA 4G7ZF 1X3WB 2DMPA 1T98A 4A0ZA 3AL0B 1W7PA 1XMAA 3WODF 4IHSA 4YFXF 2A5YB 2K9NA 3SHFA 4AU7A 1MBGA 3HRSA 1KU3A 3SEQA 2V7FA 5B66C 5L3BA 2F5FA 2R7RA 3KIOA 1IDZA 1QZZA 3BCBA 3KYCB 3J7YJ 3FM5A 2VIXA 3CCMI 5A2QZ 2DJNA 4N0BA 1Z3XA 1FMWA 2KJCA 3SFZA 1IRZA 1OR7A 1I6XA 2L7FP 4IOAF 2EZHA 2F5DA 4I7HA 2VKVA 3GW2A 2HR3A 3KP3A 2K85A 1H88C 3I3LA 2E2HJ 1UHMA 2AS5F 1U0JA 5DD4A 4FETA 3T0YA 5CVVA 5DV5A 5E3OA 2DA5A 3WTWC 3OSGA 3CP2A 2FRHA 1IN6A 3S3OA 3ZR8X 5IP9J 1Y1WJ 2OA4A 4LJZF 2BBYA 2FMYA 2UZKA 3W2AA 2RQPA 2AQEA 1WQ2A 2J5PA 5EG0B 1QU3A 4EM1A 2JA6J 1R49A 3BWGA 2F48A 3P5JA 3E7LA 3TDUC 2IGMA 3GBGA 1Z77A 1LEAA 4ZTJA 2Z33A 1OKRA 1Z21A 4HPQA 4KIFA 1P92A 1VQLI 3SDBA 1FOYA 1MJAA 1KA8A 2L2OA 5HLTA 2A05A 3CDHA 2O8KA 2DQLA 3I9V2 1F43A 2JMWA 2KIQA 5BOXA 3OIOA 4PSXA 5LEKA 2HQAA 2HI3A 1UAAA 5TGTA 4L9TA 1O3SA 3HUGB 3IWFA 2LC2A 3CTAA 2MG4A 1RETA 2QKMB 2EA2A 2EZLA 4HW0A 4R79A 2MGQA 2WB1N 4ASNA 3IWZA 3JREA 1RUOA 1A04A 3HJEA 4CXFA 2K9QA 1U3EM 4HA8A 2Q2EA 5C44J 1GUUA 1G4DA 1SAUA 1RIOH 5DTDA 4O5VA 2FNAA 4IRHA 3I53A 1QHGA 5KHDA 2HQRA 2CFXA 1X3ZB 3K4MA 4PZJA 1BI1A 1LUJB 3HOSA 3EQLF 5E8IA 5HNFA 3KEQA 2BZTA 1Q1VA 2EV0A 2BY0A 1VF9A 4G94A 1MBKA 2CH0A 4A3LJ 4B43A 5F1RA 1LKXA 1XB4A 2E1NA 4YRVA 3LSHA 1JHHA 2CQQA 3V8LA 4ZYHA 3CCVI 4RB3C 4U7DA 2JA5J 1TWFJ 1VQ5I 2IBDA 3I58A 2HEOA 5E17F 3K4KA 3CMAI 3HB9A 3DPTA 4XRSG 4EM0B 3QODA 3M4OJ 2IP2A 5E1XA 3ZQ7A 1Y8QB 2PX9A 2YS9A 2Q8KA 2H6CA 3S32A 1MJBA 4CCJA 5LGTA 1MD0A 3CCQI 1XX5A 1ETXA 1MNEA 1R5GA 5GPAA 4ETSA 4ENMA 4LG0A 4IQ4A 2R7SA 2MLGA 1QBJA 5KCMA 4KN7X 1OCRH 3BOQA 4BHPA 3WTXC 2OZUA 1JI8A 1Z67A 3ERED 2LRDA 2ISYA 5FD6A 4II3A 4OAYA 3HIFA 3CCLI 3RKWA 1VQ4I 5F08A 1DPRA 4GCVA 3BLYA 5TISC 1BC7C 1YJWI 3PFIA 4JQFA 4CO8A 1ETOA 3IKTA 2FX0A 2ETHA 1VQOI 2DJIA 4QTRA 2GOXB 2CMPA 3DV8A 5FKOA 2F2EA 3ZPLA 1PYVA 2OD5A 2Y30A 3IAM2 1GXQA 2HKXA 3QQAA 1RUNA 1B72B 3QP5A 1IXCA 5L3DA 3J81Z 4B4CA 2X0LA 3I0TA 2CQXA 1JTXA 1U8RA 1QPIA 4A12A 2B0LA 1W36D 2EA4A 4PCQA 4EEFG 2RC4A 2W48A 1R1UA 4P55A 1E2XA 1B9MA 1P4XA 1FIAA 1TNTA 2FNPA 5GPCA 1YX3A 1SD6A 1HKTA 2K86A 3T8RA 2GXAA 2X6XA 3K6GA 2HXOA 2LREA 2O7OA 3H3VK 2GZWA 3DTKA 4OWRB 4XK4A 2Y9ZA 2OCCH 3F0CA 5ERIA 4UVBA 1L3LA 1S8NA 2IRFG 3G71I 2HDDA 5E1ZB 1X1DA 2FF4A 2R4GA 2DFHA 4XOTA 1WH5A 3KX2A 4RGXA 3GO5A 3T5XA 2DFFA 3OS2A 2Y48A 1WKMA 1Y1VJ 2JUGA 1I1GA 4A3BJ 1QZEA 1W5SA 2M8GX 2H6BA 2EJRA 1VQKI 1VQMI 3TGNA 1K4SA 1GXPA 3K69A 5CYVA 5IY5H 4OMZA 2V9KA 2YU3A 1M1EB 2HTJA 5GAHJ 2NS8A 3HXLA 3A1YA 4IOCF 2CV0A 3OYHA 3JCUC 4XIDA 3RDIA 1Z9CA 1OCCH 1WVRA 1IV6A 4KN4X 4R8HA 3ZQLA 4HF0A 1Z7UA 2KRHA 2ZB9A 1BR1A 1X1AA 2X6YA 3KCCA 2ZCWA 5DCMA 5D8KB 2XAUA 3JTGA 4PJNA 3OYMA 4QPQA 1FP1D 5IOYA 2LP0A 5DDGA 4M3FA 4WXCA 1ERDA 1TNSA 3EUHA 3I4PA 4QSHA 4NQWB 2GWRA 2CW7A 1O7FA 1R1TA 2VKHA 1G3TA 5E3LA 2HVSA 1XGNA 1O3RA 1Y8RB 3KP5A 3JSOA 2PI0A 2K5CA 3HRUA 1Z05A 1K7AA 2W4SA 5FKMA 3TW6A 1GT0C 2M87A 2QKLB 2DN0A 3VSLA 2V6EA 3EUKL 1IUFA 2K9SA 3QU6A 4KMUX 1HW5A 3S3NA 1D1AA 1KQ0A 1S7OA 3FXRA 5FB2A 5IYDJ 2HVRA 3ISPA 3J80K 3B6CA 4E4HA 1BI2A 2EFQA 5CVIA 5DEQA 1AWCA 1APLC 1CGPA 1BIAA 1UZCA 3S1MJ 3K0LA 4HF1A 3WU0A 1HLVA 2BXZA 2K9MA 4A6DA 5EDNA 4XLHA 2JA8J 3Q0WA 2HOTA 2P81A 2IGNA 2HWVA 1ZARA 3COAC 4KT5C 1AU7A 1IUYA 3BTCA 3I59A 3WGIA 1WRJA 1GDTA 2ZBKA 5J8FA 4M72A 3KLNA 1LDKB 1W5TA 2JRTA 3ERMA 3RKQA 3BROA 1TT0A 2O3FA 4Y52J 5EJCA 2LF8A 2UWMA 3ZN1A 4E70A 1D8JA 2ELKA 3HDDA 3H92A 4RMNA 3TL4X 2XKPA 4BQQA 2XAHA 1K4TA 3HOUJ 2KIUA 3TBIA 2L9RA 4KISA 3KEOA 1WFXA 4GRIA 2M0MA 2HS5A 5B5EC 2R7ZJ 5E1WA 2FEZA 1EH7A 4C9YA 4B44A 3DFGA 5HDKA 2R7OA 4NDLA 3KP7A 2XPWA 3GEZA 2F4OB 2NVXJ 2CUJA 3NARA 4OMYA 2HZTA 3PNYA 2HU9A 2OQGA 2VC0A 1W4MA 4FX4A 5LHHA 2ID3A 2LY1A 2ELHA 2YX4A 1OQYA 4HG2A 3CCRI 5BPDA 3FHZA 5ILSA 2O6GE 3RPUD 1NG6A 4IF4A 2KDOA 3RKYA 5ED4A 2HOAA 3LQQA 5IYCJ 1ZRDA 2CWEA 1VQNI 2P5VA 4BE0A 3DKYA 4UUVA 2P6SA 2NS7A 2UUZA 5EGOA 3OOPA 5JHUA 1S5LC 1H0MA 3AG3H 2BV6A 4M3BA 1JXSA 5LGUA 1SANA 1WWXA 4RM3A 3S1RJ 2KDZA 4J00A 1O4XA 2Y69H 4BU2A 2DA2A 5JI6A 1IJWC 2H27A 2QBYB 5C4JJ 3OOUA 1OFCX 3HG9A 2P5KA 4I01A 1MMDA 2JK3A 4C2UA 2DMUA 5BNGA 2VONA 2ESNA 1IRXA 3OYGA 3BR3A 2H09A 2Y2ZA 1JKOC 3VYSB 2KT0A 2OU2A 1X58A 4EJWA 4HOBA 4S05A 3A01B 4PJMA 3LSIA 3WTSC 3E5XA 5FRNA 2IGKA 2LKSA 1B4AA 3H3UA 3IHUA 5FJ8J 4JX4A 2W57A 5L3EA 3H0GJ 4FHTA 3TO7A 2VC1A 3CJTB 1LVAA 2VT2A 5FD5A 4JYKA 1DGWY 4KMFA 2IXSA 1UHWA 2W25A 3H9QA 2N8GA 1S9HA 3M07A 2R0QC 2RKHA 2UV1A 5EF6A 2QQAA 4RLQA 2W7NA 1W7PB 2L7MP 3G6EI 3UR3C 2XB0X 4Y15A 1UMQA 1R9TJ 3VOEA 3P7NA 1BA5A 4MEXF 2DQRA 2L9VA 1AHDP 1YW7A 2LFBA 2R92J 3LMMA 4DYQA 3H0DA 4EV0A 1FTTA 4M9ZA 2A69F 1ETVA 1KU2A 2HYFA 2R7TA 3IUOA 5IYBJ 3G1OA 4F93B 1WJAA 1V5FA 4RGUA 2O9LA 4XICA 1J5YA 1XCVA 2EB7A 2NYXA 3I4MJ 2F6CA 2WY8Q 4XKCA 1FMVA 1ZTRA 3WTZA 3PO2J 4I98B 2HOSA 3H9JA 1FC3A 1YJ9I 3CLOA 4YG2F 3G1LA 3K10A 1IC8A 3RYRA 3CQZJ 4KNYA 3BG7A 2QZ8A 1RI7A 1MSFC 4EJTA 5H2FC 3HKZA 1GV5A 3VFZA 2XKOA 1KYWA 3PUBA 2GOMA 1HKQA 5BPIA 1ZR4A 4BBRJ 5LHIA 3GZ5A 5K7FA 1D1CA 4D1QA 2OBPA 2LKPA 1ZG3A 3CUQA 1XC5A 5AIQA 3BQYA 2DXIA 1V55H 3O6BB 4P9FA 4A0YA 3FF5A 4XLNF 1YRNA 1TC3C 3CCYA 3GCMA 4RB2C 5DD8A 1LNWA 3HHGA 2OTJI 5B1BH 3HGGA 2VI6A 4X6AJ 3DKWA 4CSWA 2VXDA 1RR7A 1IN8A 4MHGA 5FROA 3F23A 2CW0F 2ZXHA 2DK8A 2L7KA 3GLLA 2L3DA 4EVIA 2CQNA 1OISA 3H5NA 5F1JA 2XGXA 1YJNI 3MKZA 4M74A 5GTHC 1GV2A 3CDIA 4IVNA 1G3WA 2NVUB 3W6VA 1SD5A 1I5ZA 2IS4A 2CGPA 5HODA 2Q2EB 3OIQA 1FJLA 4RS8A 3MZ8A 1ZLKA 1LEBA 4UB6C 3TOAA 5FLXK 3Q3SA 3BCAA 1A6QA 3JRBA 3HSEA 3S2WA 4KICA 4DZPA 1JJ8C 1ZRCA 1DPUA 2D45A 3FXQA 1B8IA 1LFPA 1R6RA 1PJRA 3GLXA 2HVQA 3C1DA 3ZQGA 1IGNA 4IRIA 3HSRA 3JRIA 4ZYGA 3FXUA 2HOEA 1V5GA 1MNDA 1K61A 2DO7A 1E3PA 3DTEA 5J6XA 3L1PA 4ENNA 4IHTA 1YYVA 1TWAJ 2KZGA 3GWZA 1DU6A 2K9LA 4LB5A 3J7AY 2GA1A 4IKFA 4CCOA 2XSJC 3B02A 1G59A 1MMNA 2E34A 2QENA 3P9KA 2KRFA 3BR5A 3I55I 5E8GA 2ECBA 3GZ6A 2M34A 2R7VA 1AKHA 4R1HA 2GXGA 3QYFA 4DZJA 5B1AH 2NOGA 2LDUA 4ZYDA 2M3AA 2R7WA 4HX8A 3V7RA 2LD5A 2V9PA 1IW7F 3S2HJ 3A03A 5M5YJ 4FT8A 2CUEA 1EJ9A 4OIQF 4WCGA 1RESA 5ILVA 3S1NJ 4D7MA 2FU4A 1NHAA 2BHZA 3S3MA 1BI0A 1EF4A 1CF7A 4RB0A 2CW8A 3M8JA 3ONQA 4ITVA 4PJLA 2Z3YA 2FXAA 1VQ8I 2CQKA 1L0OC 3CJQB 4BL0B 3CUOA 4PGHA 4E7HA 3NWTA 2HPIA 4Q5SF 2DT5A 2FA5A 2KRCA 4F92B 2LVSA 3CCUI 4JX5A 1ACIA 3OYLA 2BHYA 1XDSA 1YIOA 1JGGA 2YR2A 3QP6A 2X1EA 2VBWA 1Y6IA 1P7IA 4EATA 1TW2A 3S93A 4FASD 2L7ZA 1FP2A 3BJAA 3AL0C 2X1CA 2FQ3A 2VJ5A 2ZFWA 5F64A 4KITB 1IO2A 3RZDJ 3HEFA 5CVJA 2VJ4A 2CV2A 1R00A 5FKNA 2EFWA 1MMAA 1ORKA 3LSJA 2LY2A 1IV8A 1A31A 3FMRA 1BJZA 5LLQA 3V42A 3DPLC 4HQMA 3MMYB 4YFKF 2XIGA 1OCOH 4M6YA 4I6ZA 4A3CJ 2DDBA 2JTVA 3J7AO 3ZRGA 5B3SH 3A0BC 5K1YA 3FX3A 4CA0A 2R5ZA 2QSFX 2O0YA 2W82A 4M3GA 4A2UA 1JE8A 4HQEA 2ZNZA 3BR6A 1XSXA 2JSCA 2E1MC 3MCZA 3QOEA 5KAFC 2E1MB 1SAXA 1TT5B 3FBIB 3K2ZA 1OLTA 2A07F 3LL7A 4DIQA 3RPUA 3GTLJ 3C2HA 4QWQA 1OMIA 1ON1A 4ESJA 3IKVA 4IO9F 4DBQA 1BL0A 2R7FA 4C2TA 4XOPA 2UXNA 5K7ZA 2YU9J 1DQUA 2WAFA 3DBRB 5HLIA 4CYDA 5CPRB 5M5WJ 2FJ1A 4OIOF 2LK2A 2E1OA 4MFDA 2HXIA 5DCMB 4Y4RA 4OIPF 1MH4A 4AVZA 1U9NA 1YITI 2ICWG 3EYYA 3EPZA 4LG3A 3VYTB 3WHBA 4A3DJ 2L9NA 2EQRA 5HS8A 3VPRA 3LA7A 4HYEA 1TQMA 1TWGJ 1YLFA 5D5WB 2E60A 5KVRA 2K7LA 3HKZN 1JKPC 1MKMA 1X2MA 2DLLA 1NH3A 1BBYA 4MNUA 4K2EA 1YIJI 1WJBA 4EJOA 1ZKGA 4ENKA 2M45A 3S8PA 3SJMA 3LSMA 4II2A 3OIPA 4C2MJ 3W3CA 2E7XA 4AUXA 3ASNH 3ZQIA 3S2DJ 4WF2A 2FUG2 2KHMA 4ZDPA 4M9SA 4P1WA 4PK4A 4I76A 2DCEA 4ENJA 3GTGJ 1HSTA 3H35A 1E17A 3H9GA 3K1NA 1TLHB 4Q47A 3BR2A 1MGTA 2E1CA 2HKOA 4WX9A 1FZPB 1G2HA 1ENHA 1J59A 2PMZA 2XF5A 1I50J 4BDZA 3I59B 4CZCA 3MZYA 4LD5A 5A2QK 2CG4A 1YW9A 1ZG1A 4IHYA 2M7BA 1I6HJ 1I27A 3LFUA 3UNGC 1UHSA 2HFHA 2V1UA 4RGSA 4XSXF 2KQRA 3OR2C 5JLXA 3VYRB 3BY6A 2AHQA 2W84A 3JTHA 2LR8A 3AKZA 4HDUA 3SZTA 3TP3A 3KP6A 4ABZA 3JRHA 4E7KA 3R0AA 3EYIA 1VQ7I 4PJJA 4BGDA 2D2WA 4CCMA 3LSRA 1T0FC 5HOOA 3K4LA 4BACA 9ANTA 4AD9A 1QO0D 2KKOA 4M73A 1MJ9A 3K2AA 4L5EA 2X9DA 4M9XA 2HQ5A 5E20A 3OYDA 4KA4A 3HSFA 4G7OF 1SEUA 2IA0A 3DQVC 1MNMC 2B9SA 3BQZA 3DP7A 3DCFA 4AC0A 3CJNA 4C3JJ 2W85A 2MD0A 3B6AA 3RCOA 5C3EJ 3CMYA 3RJPA 5F27A 4BDYA 1A36A 2DDAA 3JR9A 3MKYB 1H9GA 3FDYA 1LFBA 3BR0A 1TWHJ 5D5VB 2M30A 3DPUA 4AM3A 2XAJA 3RZOJ 2HZDA 2D1VA 3FXJA 4UHTA 4HNTA 4WWCA 1XTAA 1ZREA 1MH3A 2CU7A 2OV7A 1U5TA 1K83J 4JBAA 4N4OB 5J1YA 5EGOB 4E7SA 2BEOA 3OYEA 2ME0A 2DU9A 5HS9A 3V8JA 2L5QA 4BJTA 4GO1A 1ZG5A 4LFUA 2EPFA 3OY9A 1BW6A 4M71A 3FXKA 2OCEA 1KQ8A 2CUZA 2WC2A 1PP8F 3WE3A 3EDPA 4QLCU 1LJ9A 4UNOA 5HS7A 5F0CA 1XPXA 3ABUA 4LIUA 4YFNF 2H1KA 1RZ4A 3WHCA 3K9TA 2LH9A 2M4GA 3VSKA 2STWA 2XPVA 1T33A 1K78A 3FKIJ 4B3XA 2XASA 4L9NA 2ZXIA 3F9KA 2Z16A 4RAYA 5HLGA 5DUIA 1HA8A 3M7GA 3L2WA 3MEXA 3ULQB 4BYYA 2C6YA 5JHFA 3HOVJ 3RQIA 1ZLJA 2Z1DA 3N05A 2X85A 1A6IA 2L9SA 2KZVA 3BZKA 5DM7F 1N77A 3DLAA 2BE5F 4XM3A 2DK5A 3TOBA 3IV5A 3TEDA 2M5WA 3WGGA 2JQ7A 4LITA 3OYKA 4ZTFA 2VQGA 4IJAA 3MQ0A 4KYWA 1FY7A 1MBHA 5E79C 3MZHA 3HRMA 5M5XJ 5J4VA 4RBOA 5LFAA 2PN6A 4IPAA 5J4YA 2PEXA 3KZYA 1HXDA 2MC4A 3SDGA 3HOZJ 4XLAA 3HHHA 3L00A 1S72I 1YO5C 2BW3A 2DMTA 2VBZA 4A93J 1J7KA 3BTJA 1IN5A 2O03A 2RDPA 3IH3A 2QLZA 2NRAC 6PAXA 2JVHA 4PSWA 1UFMA 1BR2A 2BY2A 4UUSA 1LB2A 1HKSA 2G7HA 1E3HA 1XCBA 4RB1A 2HDWA 5JFRA 1K6YA 2ZMEA 2K4BA 2R7QA 3T1BA 2F5CA 2H8WA 3EUAA 4XONA 4MFEA 1RKTA 3FXLA 1QRYA 3O8HA 4UXNA 5DS9A 3DEEA 1K79A 1KU9A 3E0JB 3J81K 4M6XA 2F4MB 3SXYA 4BE1A 5K5RA 1W5CC 2STTA 2ZO4A 5EEGA 3CUQC 3CUQB 3DEWA 3OS1A 2EZKA 3RTRA 3K7AJ 1W0UA 3GTMJ 4B1RA 1YRNB 1QZYA 1AOYA 2XB5A 2RNJA 1ZHFA 3CZ6A 3PFYA 1Z1DA 5ICCA 4BJ6C 4Z2YA 3M1EA 3NRVA 1BI3A 1ZELA 5FRMA 4XSZF 1WI9A 4RA2A 4BEHA 2COBA 2VQHA 1RNLA 2I5UA 1J9IA 5CJ9A 4V2FA 4L18B 2DFEA 2XVCA 2ZNYA 3QYBA 1FYLA 3F8BA 3LA3A 1C0WA 1MBFA 1IAWA 1OYIA 1R36A 1IN7A 2OF7A 3S14J 3H1CA 4G9YA 4BNCA 3DU5A 3GFMA 1LDDA 4BY7J 4OAZA 3W2VA 4X1EA 2F5EA 4HX7A 1USSA 2CSOA 2QEXI 2ESHA 5LHGA 3LNQA 1HF0A 4A3MJ 2KJBA 1RPWA 2YPRA 4ZYEA 3HOWJ 5JVGF 1W7PD 2PMZN 1OCZH 1EKEA 1TWCJ 2E7WA 3L2CA 3D5RC 2IPQX 3B73A 1B8IB 3ZCOA 4LGWA 4Y33A 3HOTA 3WU2C 3RYPA 2OAZA 4BAYA 2IEKA 2JVGA 2LBFA 3EETA 4Y17A 1QGPA 1JHFA 3U1KA 3F3XA 4DNCA 2GBYA 1R1VA 2A6HF 4IRGA 4GDFA 1S7AA 4CGZA 1WJFA 1N75A 1X4PA 3WTYC 2X4HA 5CKTA 3WTVC 5EEHA 5H20A 1YTYA 3C7JA 2PFBA 3NEUA 1PUFB 2WTEA 4S04A 2Y31A 5J3LA 2NVYJ 2WWYA 1AKHB 1ETYA 5EZHA 3GUDA 1D5VA 1MDMA 4C3IJ 1VTNC 1UG0A 4Y7NJ 3AFHA 5DM6F 5KNLA 4XLEA 3BG6A 1D1BA 1R22A 4O3MA 4RM2A 4BQOA 4BQNA 2Y75A 3BJ6A 1PDNC 1XMXA 3JSPA 2EIMH 4UUTA 5FFZA 3ZQFA 1H89C 1Z3YA 4AWXB 2F4IA 1P2FA 2OTLI 1ETQA 2M0CA 5F6FA 5FKKA 1CF7B 3I4NJ 3CC7I 2CV1A 1R4MB 3CDLA 4HSTA 4A3EJ 3F8MA 5K5OA 5FLMJ 1YS6A 1F36A 4H4KC 4DBRA 1D0ZA 3CF5F 4QPOA 2VODA 1WZ2A 1QVUA 2L0KA 4BJ5C 2XPUA 4BH9A 1DDNA 2VKDA 2PMHA 3DF8A 3ECHA 3GTPJ 3SZPA 5IOZA 1YHQI 1BN5A 2QQBA 1ETKA 1DP7P 2VB6A 1USTA 4JK1X 3GTOJ 4HLYA 3H3ZA 1PP7U 2FE3A 3GTJJ 1X1CA 3G3ZA 2ZKZA 4A6EA 2DA1A 3QPLA 2VT3A 4MEYF 2Q0OA 2K02A 1VI0A 4XKWA 3KZIC 1UCRA 4DOZA 1ZK8A 2XRNA 1EH8A 2MLKA 2YUSA 3REOA 3GX4X 1OR7C 5HDGA 4ZYAA 3VODA 2OJED 2FD5A 3BG5A 3DXJF 3L9FA 5LBQA 1E3OC 4LLGF 2BY1A 2R5ZB 4KUMA 4RAGA 5TRDA 2WADA 1BR4A 3HOYJ 2YSRA 3KZZA 4BS9A 1IRGA 2E2IJ 1K6OA 2V1DA 3HTSB 1JUMA 1QPMA 1E0EA 4CCLA 1QVTA 5D5UB 4DYRA 2LYCA 2R93J 2V79A 3LQRA 1RKWA 4BKXA 3F8NA 1RR8C 4LB6B 1JT6A 1G8XA 4U87A 4DJAA 4HSRA 3K70D 2CS3A 4I02A 2W1OA 3GMEA 2P0WA 4G7HF 3RI4A 4UB8C 1X1BA 2I10A 2QYOA 4XRFA 4A69C 4MLOA 1QA6A 1Q1HA 4D5CA 3PM1A 2LG4A 1JUPA 3A0HC 4NB5A 3WG9A 4AIDA 2VKEA 1J75A 3A2KA 1S29A 2X1DA 2XV4S 2WAEA 5HNHA 5FO5A 1XGSA 2IT0A 3F8CA 2ZFUA 3M8FA 4MQVA 3H5RA 4XKVA 1Z6TA 3K4JA 5AIPA 5H6QA 3VEPA 3W6JB 4H0EA 4V19K 4U88A 4KT6A 2GQQA 2IS1A 2WB1A 3ABMH 4L0YB 1LFUP 3OYCA 1SD4A 2XDVA 2NNNA 3AG1H 3ABTA 3SZGA 1VZ0A 2CUFA 2B7EA 2VBXA 5J1RA 5CLSA 3ESWB 4XRSA 3E6CC 5IT9Z 1S3JA 3PO3J 3IC7A 2JN6A 4A0XA 4B47A 5LEJA 3CC4I 2RN7A 2CRGA 3I54A 3QPTA 3VYUB 3L2UA 3FBNB 1JTYA 1TQPA 3CF2A 3KE2A 4AIKA 4X0GA 1STZA 3D1NI 2WBMA 4U7BA 3SEZA 2QQ9A 4CUGA 1SC7A 1F9NA 2E5NA 4HX4A 2NXNB 4B8XA 4NNJA 1U78A 4F52A 3R6SA 2VOOA 3FK7A 1UJ8A 3KYDB 4BHBA 1D5YA 2DPDA 1ONVA 3RPQA 1F5TA 5J40A 2DYSH 2IA2A 4TV7A 4N9IA 3E6BA 3ELKA 4Q4ZF 2EFNA 4FISA 2FBIA 1YS7A 3HM5A 3OWTA 3VB2A 5EEAA 4OOIA 4RGRA 5LRRA 4FE7A 1DP3A 3G73A 2I8DA 1WGXA 1WHUA 4CCKA 4C3HJ 2BY3A 3LSKA 5CQGA 5DCFA 1PUFA 1V5EA 2VE8A 1MBJA 2EINH 1KONA 4GXOA 2E2JJ 2XAQA 1X2NA 3R61A 3TMOA 4I2OA 3S15J 1WI3A 3FWEA 2UXXA 4I0AA 1MZBA 1SFUA 2R7UA 4Y13A 1LDJA 2BYVE 2M8EA 3QWLA 4LOCA 4E7JA 1YQAA 3M9AA 3WGHA 2CQ7A 4RDUA 4NC7A 3NQOA 1OYYA 2X51A 3SYTA 5M3MJ 4ANJA 2OZ6A 2Z5UA 4L0ZB 2M4KA 2V1XA 1NK3P 2BXYA 2ISZA 2NVQJ 3K1PA 1VFCA 2O5RA 2X6OA 1N78A 3QU3A 4G6DA 1U5TC 2QSHX 1U5TB 3DWLE 2R7XA 5L3CA 3BR1A 4AIHA 2AO9A 1ZH5A 1P7JA 5GAGJ 3ZOBA 5JLWA 4KIBA 4PUSA 2HYJA 2A68F 4IXAA 4MGRA 3IH4A 1B1BA 1KGSA 4BXUA 4A5NA 4E7LA 4E7IA 2LY9A 2E36A 4CDGA 1T56A 1GVJA 3BPVA 3DKXA 2V6CA 3G2BA 3DBHB 3LSGA 1UG2A 1WJDA 1T6SA 4NC8A 4RAFA 4XR6A 4ZZDA 1D3YA 3FMSA 4FTHA 1ZRFA 3KLOA 2WAQA 3TO9A 1K78B 5D6EA 3F21A 3ZQHA 2EBIA 2VL8A 4PFPA 5E18F 4F91B 3S17J 1BOBA 1NTCA 2EH3A 3V7SA 4KIGA 2VJJA 2HYGD 4ZDLA 3BTLA 2V26A 1O3TA 2VLAA 1R7JA 1H8AC 3OYAA 3OS0A 3HGYA 2BGCA 3IAS2 1KU7A 4D5FA 4U0VA 3CD6I 5HLHA 4S0HB 4ESBA 2ADUA 5GP9A 3WG7H 1SMTA 4XN0A 1X3UA 3TP0A 3BDDA 4L9JA 1FYKA 1T08B 3E1SA 2EV5A 4XLFA 3FK6A 2IJLA 1O3QA 2JSPA 2BW3B 1XGOA 4IL6C 1T39A 3GTQJ 2MC3A 3EUHC 3QAHA 4MTEA 4HRIA 3WU1B 4GYIA 2VUMJ 1IG7A 4UUSB 2XF6A 1FWZA 1XDUA 1ZAOA 1ON2A 2VQCA 5E3MA 2A61A 1R23A 3OL3A 2ZMEC 2G9WA 1XMKA 3U21A 2ZMEB 4I99C 3E5UA 4N9HA 2D1HA 2DT6A 3K1MA 2DYRH 3Q9VA 2MBFA 4DQ2A 2AQFA 1HW1A 1UB9A 3CCJI 3FXOA 2XAGA 5CVRA 4DYCA 1BM9A 2XF7A 2JA7J 3BPXA 2RAEA 4FE4A 2ELJA 3QOPA 4O6JA 1W1WE 3TO6A 2FSWA 2DMNA 3K4NA 3TDZC 3F6VA 4MIMA 3N97A 4ESFA 5ILUA 2IA1A 1QQIA 1POGA 5DUKA 1I3QJ 1HCRA 3MFKA 3F6OA 1WJCA 5JVTA 4HV5A 1RRJA 3NWSA 3ABLH 1FSHA 4PGGA 4YIRX 1H9TA 2KP6A 5BS6A 2YX7A 3JRDA 2O61A 5ICEA 3PQJA 2Q1ZB 3E97A 3MWMA 4BEHB 3DBLB 2ID6A 4P5OA 5LGNA 2HNHA 4U0YA 1Z7LA 2ZSHB 2P6TA 1FYMA 1REPC 1ZGAA 3Q0VA 1FEXA 3QYEA 1XSVA 2DW4A 3BG9A 4LIVA 4L9VA 2DOAA 1WJ5A 4CYCA 2ME6A 2NNYA 5M3FJ 3FMQA 4CCNA 1HOMA 1IRFA 1JUSA 1WSUA 1ITYA 2D5VA 4W97A 1LE8A 2XROA 4OINF 3P9IA 1DUXC 1X1PA 1FTZA 4IQJA 4M3EA 3L2RA 1P9QC 1TW3A 1NK2P 1XG1A 1TZLA 2P8TA 2DMQA 2FBHA 3L2VA 4L5JA 5DYMA 3MKWB 4EJUA 2Y9YA 4HLXA 2EILH 3ZN0A 4OIRF 4ZJZA 2Z9OA 2L02A 3V4GA 2JWTA 4C30A 2LOOA 3E6DA 5EZGA 3GVAA 2LBFB 4A5MA 2JA2A 2PJPA 3HTUA 3ABKH 2ZJQF 3AAFA 1HW2A 4G6TB 1GLNA 2DAOA 3ZMVA 1FLIA 4HV6A 1X19A 1MBEA 1YE9A 1ZYRF 1FX7A 2KLOA 3QRFF 1T38A 2FBKA 1V54H 3KPHA 2LLKA 3AG2H 4B48A 4MO7A 1OJLA 1VQ6I 2NVTJ 1OPCA 3LAJA 4Z6YA 1YI2I 1SVOA 4HNUA 5H6RA 2DI3A 5J1UA 4BXXJ 4JX6A 1EA3A 5KK1A 2PJRB 4E6KG 1F4KA 1MDMB 1V3FA 3GF2A 2GIVA 3CMMA 2K27A 2CYYA 1YW8A 1WCMJ 3ZMSA 2A6EF 1MIJA 4XKBA 2IGOA 2KFDA 2Z99A 1EV7A 4FX0A 4J01A 1J2XA 1U9OA 4YIFA 2M1BA 3I56I 1MSEC 3LAPA 1IXSB 1WH7A 1YX5A 2GA2A 3F72A 1U8BA 4BUPA 1MMGA 2WV0A 3IRRA 3OYJA 2FOWA 3J80Z 2W00A 4IZZA 2OPTA 1MMSA 2XRLA 3DLLF 1U6GA 3R0JA 2MA3A 3C2GA 4XMYA 3WTUC 2R3SA 1TTYA 2PLYA 5KAIC 3CP8A 4AYBA 4GFBA 3L09A 5L3FA 3M8EA 5L3GA 2ZXWH 3LFKA 3CMEI 3PL8A 2XC7A 4IHXA 4EQQA 3J7ZI 1JKRC 3DEUA 2V9VA 3ZXSA 2JUCA 3R60A 2E5ZA 4UVCA 3JAMZ 2AXLA 4CICA 3KP4A 2B63J 2MH9A 2EK5A 2IW5A 1FOKA 2DBBA 5E3NA 2WAQN 4EJVA 2CJJA 3GFJA 3MN2A 1SMYF 4NUBA 2GIZA 2QUFA 4JOMA 1S6LA 1V4RA 4JP0A 3FHNA 4D0PA 1IN4A 2DTZA 2QF7A 3CCEI 3NAUA 3IL2A 1FBQA 4UY8I 3O2PE 3Q9SA 3ZQCA 3M3YJ 4QIWN 1XD7A 5EG0A 1HBXG 1FBSA 2Y0MA 3MKLA 3SFIA 1BOAA 1VNDA 2EIJH 1N25A 4GGGA 2QM3A 4EM2A 2F5VA 1CQTA 1G6NA 3PSIA 5LD2C 1HSJA 1Y0NA 2XGCA 3OR1C 5CVUA 2KISA 2GXBA 2RGVA 1OCPA 2A5WA 5D4RA 2QCOA 1J0RA 2CO5A 3PJRA 3ZMZA 2LTPA 1ODDA 1R58A 1R71A 1ZQ3P 3D5LA 3HUGA 3KFWX 2XSDC 1B59A 5D5XB 1P4AA 2EV6A 5FGMA 3C2BA 2XGDA 4BHCA 1W36C 2GM4A 3T8TA 3S1QJ 1SVMA 2VPLA 3RQ4A 3HL2A 3E3VA 3Q0UA 4WXDA 4UVAA 4J19A 2WV1A 4M3DA 1G3SA 3IRQA 5FKLA 2RVCA 5HDNA 3W2WA 3RKXA 1OYWA 3MVPA 4D7NA 2L01A 1DU0A 2K4JA 3KEYA 3PNTA 3F22A 2MD5A 3IH2A 2QA4I 4DW6A 4WK8F 2E71A 3GTKJ 2M7AA 1XN7A 1SFEA 2IS6A 4ZDOA 1QHHD 3BZ6A 3LOCA 1R4NB 2Y0SA 2X48A 5GTIC 4V2GA 3AG4H 3BG3A 3JAMK 2JPBA 5J47A 3C18A 1KQ9A 2DFIA 1SFOJ 3Q5FA 4U0WA 4G8XA 2EIKH 1LQ1A 1LPQA 3PQKA 2HDCA 4RLFA 4A3KJ 4HBLA 1SFXA 3ZQQA 5GADJ 2P7VB 4HDVA 3GFIA 3OMYA 1T0FA 4HZFA 2DODA 4ZH4F 1A5JA 2ZJRF 1D0XA 2E35A 2H94A 3DU6A 1MW7A 3TW7A 3U2RA 2EFPA 1HC8A 3OL4A 3OYNA 2JRMA 4F7ZA 1TL8A 4W1UA 4P9UA 1SFKA 2P5LC 2KMUA 5F0FA 2PBIA 3BP8A 3M1CA 2A3SA 1S7EA 1X4OA 3WE2A 2MH2A 1FBUA 2Z2SB 2PJRA 2R5YB 4AVPA 3U9GA 4HEA2 4F3QA 3ZMTA 4KDPA 2L4MA 3OV8A 3PIPF 2LNBA 2DPUA 1JGSA 4ZC3A 3MAJA 3C3WA 3LSTA 3G1MA 1O7LA 3H36A 2TCTA 1B72A 5C4XJ 1EH6A 3K4CA 1T2KA 3CC2I 3BJOA 4CHUA 4LLNA 2PMUA 5TJJA 5D8LB 2DOEA 3PNVA 3ECOA 1KZHA 3ZGKA 2J5OA 4NC6A 3I64A 3O3KA 4NHJA 2DA3A 1FNNA 2OC6A 2EWNA 4LMYA 1B6AA 3RSNA 2NAZA 2QGUA 2VJIA 3A4CA 3N4MA 5IP7J 1FSEA 3I71A 3GZNB 2L54A 3GFLA 3UKGA 1LVKA 3OYFA 3V8KA 1Z91A 1ZN2A 3BT9A 3L7WA 3KYLA 1Y56A 4AIJA 1PUEE 5EYRA 2EZIA 4OU0A 2FOKA 1VQPI 3JRFA 3GYHX 2XHKA 1WPKA 1A35A 1ULYA 2WY7Q 1T8IA 4G12A 3FIWA 1ZGJA 3MD2A 2IAIA 3FXMA 3GXOA 3IP4B 3ML6A 2VBYA 1HDPA 3CO7C 3A02A 3CO6C 2BVMA 3JRCA 2COMA 1KYZA 1J09A 3OSFA 4AYBN 2HQNA 4YELA 4XRMA 3HOXJ 1SD7A 4A3JJ 2HPMA 4EGYA 2MYSA 5FLXZ 2NOJB 4PDKA 3E5QA 3H5AA 2DA4A 1BJAA 3HZJA 2JPCA 2G0EA 3HPHA 1G3YA 4KJZA 1DGRM 2MFZA 2RV8A 3RIRA 4HNVA 3ZMUA 2V4JC 2XAFA 2LSOA 2LF7A 4XBFA 1TQIA 1FIPA 1WJEA 5BQTA 3PIOF 3CJRB 4KFCA 3O8GA 5HVQC 2JT1A 1R5ID 2TRTA 4B09A 4NQWA 2A6TA 4CZZA 4XLPF 3BC8A 3HC7A 4DGWB 5K5QA 3JRGA 2VOPA 4LK1F 2WA0A 4YIIA 5LRSA 4XN3A 2M2EA 1I39A 3KETA 4IEJA 1O57A 1B9NA 3OYIA 5D6FA 1Y0UA 1FPQA 4Y3OA 2VE9A 5D4SA 4BY1J 1GVDA 3BZCA 4M6VA 3F8FA 3LA2A 1TP4A 2QQ8A 1FT9A 3W6KB 5IP6A 1XGMA 3PSFA 4PJ0C 4XLCA 2ACJA 4I0BA 1YG2A 1IDYA 1VQ9I 4XL9A 4LLLA 2VXZA 5K7HA 1Y39A 2JJ7A 5FFXA 1XSDA 5IT3A 2ZJ2A 4P96A 3V7CA 1HDDC 4IHWA 2ZJPF 4LK0F 4B3AA 3CESA 3LWFA 4ZZLA 3K4BA 1JKQC 2RNGA 4D9JA 2KIFA 3CCSI 5ICGA 2MABA 4HAMA 4GYGA 1RC9A 2BOLA 1NG7A 1BC8C 2FQ4A 2ZSIB 5BMZA 3BTIA 2CFOA 2L4AA 3VWBA 1BW5A 2M9HA 5AONA 4HF2A 4IX7A 2DA6A 2H1LA 3OYBA 3VDXA 3FISA 3X2QH 3U1DA 3ASOH 3R4KA 4NBQA 4BQAA 2XGEA 1JT0A 1OCTC 2NS0A 3I5UA 3D5SC 3JW4A 1JJ6C 4XQFA 2P7CB
chains in the Genus database with same CATH topology
2VN2A 4G6QA 2DTRA 2FMLA 3E6MA 3FM3A 1HQCA 2PQ8A 2IVMA 1D8KA 4Q48A 1IF1A 1GHCA 2P4WA 1R5HA 3D0SA 3HYIA 1Z6RA 1BIBA 3TKYA 1YFHA 3KP2A 2QWWA 2TDXA 4EGZA 1IZ1A 3WTTC 2GAUA 4MQ9F 4RAZA 2HGCA 2PG4A 2QVOA 4L5IA 2O8XA 2KIMA 5JR3A 3QPHA 1IXRC 4EMSA 5ICFA 1P6RA 1TBXA 2QBYA 1P4WA 4LG0B 2HTSA 1QNTA 3TQNA 2R7DA 4UV8A 2XUBA 4WXHA 2W24A 3SQNA 4MTDA 2ZXJA 5IT9K 3FZVA 4I09A 3ROUA 2G7UA 1F1ZA 2OQRA 4UV9A 2JZYA 5J8CA 2EFOA 1U2WA 4ON0A 3HRTA 3ZMDA 3P9CA 3ZP5A 1I1SA 4G7ZF 1T98A 4A0ZA 1W7PA 1XMAA 3WODF 4IHSA 4YFXF 2A5YB 3SHFA 3HRSA 1KU3A 5L3BA 2F5FA 1QZZA 3FM5A 5A2QZ 4N0BA 2KJCA 3SFZA 1OR7A 1I6XA 4I7HA 2F5DA 3GW2A 2HR3A 3KP3A 1UHMA 2AS5F 5DD4A 3T0YA 5CVVA 5DV5A 3WTWC 2FRHA 1IN6A 2OA4A 4LJZF 2BBYA 2FMYA 2UZKA 2RQPA 1WQ2A 2J5PA 4EM1A 3BWGA 3TDUC 1LEAA 2Z33A 1OKRA 4KIFA 1P92A 1MJAA 1KA8A 3CDHA 2DQLA 5BOXA 5LEKA 4L9TA 1O3SA 3IWFA 3CTAA 2EA2A 4HW0A 4R79A 4ASNA 3IWZA 1RUOA 1A04A 4CXFA 1U3EM 4HA8A 2Q2EA 1G4DA 1RIOH 4O5VA 2FNAA 4IRHA 3I53A 2HQRA 2CFXA 4PZJA 1BI1A 3HOSA 3EQLF 5E8IA 3KEQA 2EV0A 4G94A 5F1RA 2E1NA 1XB4A 1JHHA 3V8LA 4ZYHA 4RB3C 4U7DA 3I58A 2HEOA 5E17F 3DPTA 4EM0B 2IP2A 5E1XA 3ZQ7A 2Q8KA 2H6CA 1MJBA 5LGTA 1MD0A 1R5GA 4ETSA 4ENMA 4LG0A 2MLGA 1QBJA 4KN7X 3BOQA 4BHPA 3WTXC 2OZUA 3ERED 2ISYA 5FD6A 3HIFA 3RKWA 1DPRA 4GCVA 1BC7C 3PFIA 4JQFA 4CO8A 3IKTA 2ETHA 3DV8A 2F2EA 3ZPLA 2OD5A 1GXQA 2HKXA 1RUNA 3QP5A 1IXCA 5L3DA 3J81Z 2X0LA 3I0TA 1U8RA 4A12A 2B0LA 2EA4A 4PCQA 2RC4A 4P55A 1R1UA 1E2XA 1B9MA 1P4XA 1TNTA 2FNPA 1SD6A 1HKTA 2K86A 3T8RA 2GZWA 5ERIA 4UVBA 1L3LA 1S8NA 2IRFG 5E1ZB 2FF4A 4RGXA 3GO5A 3T5XA 2Y48A 1WKMA 1I1GA 1W5SA 2H6BA 2EJRA 3TGNA 1GXPA 3K69A 5CYVA 4OMZA 2YU3A 2HTJA 3RDIA 1Z9CA 4KN4X 4R8HA 4HF0A 1Z7UA 3KCCA 5D8KB 5DCMA 2ZCWA 3JTGA 1FP1D 5DDGA 4WXCA 1TNSA 3EUHA 3I4PA 2GWRA 1O7FA 1R1TA 1G3TA 1XGNA 1O3RA 3KP5A 3JSOA 2PI0A 3HRUA 1Z05A 1K7AA 2M87A 3QU6A 4KMUX 1HW5A 1KQ0A 1S7OA 3FXRA 5FB2A 3ISPA 3J80K 1CGPA 1BI2A 2EFQA 5CVIA 5DEQA 1AWCA 1BIAA 3K0LA 4HF1A 3WU0A 4A6DA 2HWVA 1ZARA 3COAC 4KT5C 1IUYA 3I59A 3WGIA 1WRJA 2ZBKA 5J8FA 4M72A 3KLNA 1LDKB 1W5TA 2JRTA 3BROA 2O3FA 2LF8A 2UWMA 3ZN1A 4E70A 1D8JA 3H92A 2XKPA 2XAHA 2KIUA 3KEOA 2HS5A 5E1WA 2FEZA 1EH7A 3DFGA 5HDKA 3KP7A 3GEZA 4OMYA 2HZTA 2OQGA 2VC0A 1W4MA 4FX4A 5LHHA 2ELHA 2YX4A 5BPDA 3FHZA 5ILSA 2O6GE 5ED4A 4IF4A 3RKYA 3LQQA 1ZRDA 2CWEA 2P5VA 4UUVA 2P6SA 3OOPA 5JHUA 1H0MA 2BV6A 1JXSA 5LGUA 1WWXA 5JI6A 2QBYB 2H27A 2P5KA 4I01A 2VONA 2ESNA 2H09A 2OU2A 4EJWA 4HOBA 4S05A 3WTSC 3E5XA 1B4AA 3H3UA 3IHUA 2W57A 5L3EA 4FHTA 3TO7A 2VC1A 1LVAA 2VT2A 5FD5A 4KMFA 1UHWA 2W25A 2RKHA 2QQAA 1W7PB 4Y15A 3VOEA 3P7NA 4MEXF 2DQRA 1YW7A 4EV0A 4M9ZA 2A69F 1KU2A 2HYFA 4RGUA 1J5YA 1XCVA 2EB7A 2NYXA 3WTZA 4I98B 1FC3A 3CLOA 4YG2F 3RYRA 4KNYA 2QZ8A 1RI7A 4EJTA 3VFZA 2XKOA 1KYWA 1HKQA 5BPIA 5LHIA 3GZ5A 2OBPA 2LKPA 1ZG3A 3CUQA 5AIQA 3O6BB 4P9FA 4A0YA 3FF5A 4XLNF 4RB2C 5DD8A 1LNWA 3HHGA 3DKWA 1IN8A 4MHGA 3F23A 2CW0F 2DK8A 2L3DA 4EVIA 2XGXA 4M74A 4IVNA 1G3WA 1SD5A 1I5ZA 2CGPA 4RS8A 1ZLKA 1LEBA 3TOAA 5FLXK 3HSEA 3S2WA 4KICA 1ZRCA 1DPUA 2D45A 3FXQA 3GLXA 3C1DA 4IRIA 3HSRA 4ZYGA 3FXUA 2HOEA 2DO7A 5J6XA 4ENNA 4IHTA 1YYVA 3GWZA 4LB5A 2GA1A 3B02A 2QENA 3P9KA 2KRFA 5E8GA 3GZ6A 4R1HA 2GXGA 2LDUA 4ZYDA 4HX8A 3V7RA 1IW7F 4FT8A 4OIQF 4WCGA 5ILVA 2FU4A 1NHAA 1BI0A 1CF7A 4RB0A 2Z3YA 2FXAA 2CQKA 1L0OC 3CUOA 4PGHA 4Q5SF 2DT5A 2FA5A 1XDSA 1YIOA 2YR2A 3QP6A 2VBWA 1TW2A 3BJAA 1FP2A 2FQ3A 2ZFWA 5F64A 5CVJA 1R00A 2EFWA 3FMRA 5LLQA 3DPLC 4HQMA 4YFKF 2XIGA 4M6YA 2JTVA 3J7AO 5K1YA 3FX3A 2O0YA 4A2UA 1JE8A 4HQEA 2ZNZA 1XSXA 2JSCA 3MCZA 1SAXA 3K2ZA 2A07F 3RPUA 4QWQA 1OMIA 1ON1A 4ESJA 3IKVA 2R7FA 2UXNA 5HLIA 4CYDA 4OIOF 5DCMB 4OIPF 3EYYA 5HS8A 3LA7A 4HYEA 1TQMA 1YLFA 5D5WB 5KVRA 2K7LA 1MKMA 2DLLA 1BBYA 4MNUA 4K2EA 4EJOA 4ENKA 2M45A 2E7XA 4WF2A 4M9SA 4ENJA 1HSTA 1E17A 3K1NA 1TLHB 4Q47A 1MGTA 2E1CA 2HKOA 4WX9A 1FZPB 1J59A 3I59B 3MZYA 4LD5A 5A2QK 2CG4A 1YW9A 1ZG1A 1I27A 2HFHA 2V1UA 4RGSA 4XSXF 3BY6A 2W84A 3JTHA 4HDUA 3SZTA 3KP6A 3R0AA 3EYIA 2D2WA 5HOOA 4AD9A 1QO0D 2KKOA 4M73A 1MJ9A 4M9XA 5E20A 4KA4A 3HSFA 4G7OF 2IA0A 3DQVC 3DP7A 3CJNA 2W85A 3RJPA 1H9GA 5D5VB 2M30A 2XAJA 2D1VA 4WWCA 4UHTA 1ZREA 1U5TA 4JBAA 2BEOA 2DU9A 5HS9A 3V8JA 4GO1A 1ZG5A 4LFUA 4M71A 1KQ8A 2WC2A 1PP8F 3WE3A 3EDPA 4QLCU 1LJ9A 4UNOA 5HS7A 3ABUA 4YFNF 1RZ4A 3K9TA 2STWA 1K78A 2XASA 4L9NA 4RAYA 5HLGA 5DUIA 3M7GA 3MEXA 3ULQB 4BYYA 2C6YA 1ZLJA 3TOBA 2BE5F 2DK5A 2M5WA 3WGGA 4IJAA 3MQ0A 4KYWA 1FY7A 3MZHA 3HRMA 2PN6A 4IPAA 2PEXA 3KZYA 1HXDA 3HHHA 3L00A 1YO5C 2VBZA 1J7KA 1IN5A 2O03A 2RDPA 2QLZA 2NRAC 6PAXA 1LB2A 1UFMA 1HKSA 2G7HA 1XCBA 4RB1A 5JFRA 2ZMEA 2K4BA 3T1BA 2F5CA 4UXNA 1K79A 1KU9A 3J81K 4M6XA 3SXYA 5K5RA 2STTA 2ZO4A 5EEGA 3CUQC 3CUQB 3RTRA 1QZYA 1AOYA 2RNJA 1ZHFA 1Z1DA 5ICCA 4Z2YA 3M1EA 3NRVA 1BI3A 4XSZF 1WI9A 1RNLA 1J9IA 5CJ9A 4L18B 2XVCA 2ZNYA 1FYLA 3F8BA 3LA3A 1C0WA 1IAWA 1OYIA 1R36A 1IN7A 4G9YA 4BNCA 3GFMA 1LDDA 2F5EA 4HX7A 1USSA 2CSOA 2ESHA 5LHGA 2KJBA 2YPRA 4ZYEA 1W7PD 2E7WA 3L2CA 2IPQX 3B73A 4LGWA 3HOTA 3RYPA 2OAZA 4BAYA 3EETA 4Y17A 1QGPA 1JHFA 3F3XA 4DNCA 1R1VA 2A6HF 4IRGA 1S7AA 4CGZA 3WTYC 2X4HA 3WTVC 5EEHA 5H20A 1YTYA 3C7JA 2PFBA 3NEUA 2WTEA 4S04A 2WWYA 3GUDA 1D5VA 1MDMA 1VTNC 1R22A 4O3MA 2Y75A 3BJ6A 1PDNC 3JSPA 5FFZA 4AWXB 1P2FA 5F6FA 1CF7B 3F8MA 5K5OA 1YS6A 2VODA 4BH9A 1DDNA 2PMHA 3DF8A 3ECHA 3SZPA 1BN5A 2QQBA 1DP7P 1USTA 4JK1X 4HLYA 3H3ZA 1PP7U 2FE3A 3G3ZA 2ZKZA 4A6EA 2VT3A 4MEYF 2Q0OA 2K02A 1UCRA 2XRNA 1EH8A 2MLKA 3REOA 3GX4X 5HDGA 3VODA 3DXJF 3L9FA 5LBQA 4LLGF 4KUMA 5TRDA 2YSRA 3KZZA 1IRGA 1K6OA 2V1DA 3HTSB 1QPMA 5D5UB 2V79A 3LQRA 3F8NA 4LB6B 4I02A 4G7HF 3RI4A 2QYOA 4XRFA 1Q1HA 4NB5A 3WG9A 1J75A 1S29A 2XV4S 5FO5A 1XGSA 2IT0A 3F8CA 3M8FA 5H6QA 4MQVA 5AIPA 1Z6TA 4H0EA 3VEPA 1F4KA 3W6JB 4U88A 2GQQA 4L0YB 1SD4A 2NNNA 3ABTA 2VBXA 5CLSA 3E6CC 5IT9Z 1S3JA 3IC7A 4A0XA 5LEJA 2RN7A 3I54A 3QPTA 1TQPA 3KE2A 4AIKA 1STZA 4U7BA 2QQ9A 1F9NA 4HX4A 4B8XA 1U78A 3R6SA 2VOOA 4BHBA 2DPDA 1ONVA 3RPQA 1F5TA 2IA2A 4TV7A 4N9IA 3E6BA 3ELKA 4Q4ZF 2EFNA 2FBIA 1YS7A 3VB2A 4OOIA 4RGRA 5LRRA 3G73A 5DCFA 2VE8A 4GXOA 2XAQA 3R61A 4I2OA 3FWEA 2UXXA 4I0AA 1MZBA 1SFUA 4Y13A 1LDJA 2BYVE 2M8EA 1YQAA 3M9AA 3WGHA 3NQOA 1OYYA 2OZ6A 2Z5UA 4L0ZB 2V1XA 2ISZA 3K1PA 3QU3A 4G6DA 1U5TC 1U5TB 5L3CA 4AIHA 1ZH5A 4KIBA 2A68F 4IXAA 4MGRA 1B1BA 1KGSA 4BXUA 4A5NA 4CDGA 1GVJA 3BPVA 2V6CA 1T6SA 4ZZDA 1D3YA 3FMSA 1ZRFA 3KLOA 3TO9A 1K78B 5D6EA 3F21A 5E18F 3V7SA 4KIGA 2HYGD 1O3TA 1R7JA 2BGCA 1KU7A 4U0VA 5HLHA 4ESBA 2ADUA 1SMTA 1X3UA 3BDDA 4L9JA 1FYKA 2EV5A 2IJLA 1O3QA 1XGOA 1T39A 2MC3A 3QAHA 4MTEA 3WU1B 4GYIA 1FWZA 1XDUA 1ZAOA 1ON2A 2A61A 1R23A 2G9WA 1XMKA 2ZMEB 3E5UA 4N9HA 2D1HA 3K1MA 3Q9VA 2MBFA 4DQ2A 1HW1A 1UB9A 2XAGA 5CVRA 1BM9A 3BPXA 3QOPA 4O6JA 3TO6A 2FSWA 3TDZC 3F6VA 3N97A 4ESFA 5ILUA 2IA1A 1QQIA 5DUKA 3MFKA 3F6OA 5JVTA 4HV5A 1FSHA 4PGGA 1H9TA 5BS6A 2YX7A 2O61A 5ICEA 3PQJA 3E97A 3MWMA 4P5OA 5LGNA 4U0YA 2P6TA 1FYMA 1REPC 1ZGAA 1XSVA 2DW4A 4L9VA 2NNYA 3FMQA 1IRFA 1WSUA 2XROA 4OINF 3P9IA 1DUXC 1TW3A 2P8TA 2FBHA 4L5JA 5DYMA 4EJUA 4HLXA 3ZN0A 4OIRF 2Z9OA 2L02A 3V4GA 3E6DA 3GVAA 4A5MA 2PJPA 3HTUA 3AAFA 1HW2A 2DAOA 3ZMVA 1FLIA 4HV6A 1ZYRF 1FX7A 3QRFF 1T38A 2FBKA 1OPCA 3LAJA 5H6RA 2DI3A 5KK1A 1MDMB 1V3FA 3GF2A 2GIVA 2K27A 2CYYA 1YW8A 3ZMSA 2A6EF 2Z99A 1EV7A 4FX0A 1J2XA 4YIFA 2M1BA 3LAPA 1IXSB 2GA2A 3F72A 2WV0A 3IRRA 3J80Z 1U6GA 3R0JA 2MA3A 3WTUC 2R3SA 1TTYA 2PLYA 3L09A 5L3FA 3M8EA 5L3GA 3LFKA 4EQQA 3DEUA 2V9VA 3R60A 4UVCA 3JAMZ 2AXLA 4CICA 3KP4A 2MH9A 2EK5A 2IW5A 1FOKA 2DBBA 4EJVA 3GFJA 1SMYF 2QUFA 1S6LA 1V4RA 4D0PA 1IN4A 3IL2A 1FBQA 3O2PE 3Q9SA 1XD7A 1HBXG 1FBSA 2Y0MA 1BOAA 4GGGA 2QM3A 4EM2A 1G6NA 1HSJA 5CVUA 2GXBA 2RGVA 5D4RA 1J0RA 2CO5A 3ZMZA 1ODDA 1R58A 3D5LA 3HUGA 3KFWX 1B59A 5D5XB 1P4AA 2EV6A 5FGMA 4BHCA 3T8TA 3E3VA 4WXDA 4UVAA 1G3SA 3IRQA 5HDNA 2RVCA 3RKXA 1OYWA 2L01A 2K4JA 3F22A 2MD5A 4WK8F 1XN7A 1SFEA 3BZ6A 3JAMK 2JPBA 3C18A 1KQ9A 2DFIA 3Q5FA 4U0WA 4G8XA 1LQ1A 2HDCA 3PQKA 4HBLA 1SFXA 2P7VB 4HDVA 3GFIA 1T0FA 4HZFA 4ZH4F 2H94A 3U2RA 2EFPA 4F7ZA 4P9UA 2P5LC 2PBIA 3BP8A 2A3SA 3WE2A 2MH2A 1FBUA 4AVPA 3U9GA 3ZMTA 4KDPA 2L4MA 3OV8A 2LNBA 2DPUA 1JGSA 3MAJA 3C3WA 3LSTA 1O7LA 1EH6A 1T2KA 3BJOA 4CHUA 4LLNA 2PMUA 5TJJA 5D8LB 3ECOA 2J5OA 3I64A 3O3KA 4NHJA 1FNNA 2EWNA 4LMYA 1B6AA 2NAZA 3N4MA 1FSEA 3I71A 2L54A 3GFLA 3V8KA 1Z91A 1ZN2A 3L7WA 4AIJA 1PUEE 4OU0A 2FOKA 3GYHX 2XHKA 1ULYA 1ZGJA 3GXOA 3ML6A 2VBYA 3CO7C 3CO6C 2COMA 1KYZA 2HQNA 1SD7A 4EGYA 5FLXZ 4PDKA 3E5QA 1BJAA 2JPCA 3RIRA 1G3YA 2RV8A 3ZMUA 2XAFA 2LSOA 2LF7A 4XBFA 1TQIA 5BQTA 4KFCA 5HVQC 2JT1A 4B09A 4NQWA 4CZZA 4XLPF 5K5QA 2VOPA 4LK1F 4YIIA 5LRSA 3KETA 1O57A 1B9NA 5D6FA 1Y0UA 1FPQA 2VE9A 5D4SA 3F8FA 3LA2A 1FT9A 3W6KB 1XGMA 2ACJA 4I0BA 1YG2A 4LLLA 2VXZA 5FFXA 1XSDA 5IT3A 2ZJ2A 4P96A 3V7CA 4LK0F 3LWFA 4ZZLA 2KIFA 5ICGA 4HAMA 4GYGA 1BC8C 5BMZA 2L4AA 5AONA 4HF2A 3U1DA 3R4KA 4BQAA 2NS0A 3I5UA 3JW4A 2P7CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VN2 A;  4G6Q A;  2DTR A;  2FML A;  3E6M A;  3FM3 A;  1HQC A;  2PQ8 A;  2IVM A;  1D8K A;  4Q48 A;  1IF1 A;  1GHC A;  2P4W A;  1R5H A;  3D0S A;  3HYI A;  1Z6R A;  1BIB A;  3TKY A;  1YFH A;  3KP2 A;  2QWW A;  2TDX A;  4EGZ A;  1IZ1 A;  3WTT C;  2GAU A;  4MQ9 F;  4RAZ A;  2HGC A;  2PG4 A;  2QVO A;  4L5I A;  2O8X A;  2KIM A;  5JR3 A;  3QPH A;  1IXR C;  4EMS A;  5ICF A;  1P6R A;  1TBX A;  2QBY A;  1P4W A;  4LG0 B;  2HTS A;  1QNT A;  3TQN A;  2R7D A;  4UV8 A;  2XUB A;  4WXH A;  2W24 A;  3SQN A;  4MTD A;  2ZXJ A;  5IT9 K;  3FZV A;  4I09 A;  3ROU A;  2G7U A;  1F1Z A;  2OQR A;  4UV9 A;  2JZY A;  5J8C A;  2EFO A;  1U2W A;  4ON0 A;  3HRT A;  3ZMD A;  3P9C A;  3ZP5 A;  1I1S A;  4G7Z F;  1T98 A;  4A0Z A;  1W7P A;  1XMA A;  3WOD F;  4IHS A;  4YFX F;  2A5Y B;  3SHF A;  3HRS A;  1KU3 A;  5L3B A;  2F5F A;  1QZZ A;  3FM5 A;  5A2Q Z;  4N0B A;  2KJC A;  3SFZ A;  1OR7 A;  1I6X A;  4I7H A;  2F5D A;  3GW2 A;  2HR3 A;  3KP3 A;  1UHM A;  2AS5 F;  5DD4 A;  3T0Y A;  5CVV A;  5DV5 A;  3WTW C;  2FRH A;  1IN6 A;  2OA4 A;  4LJZ F;  2BBY A;  2FMY A;  2UZK A;  2RQP A;  1WQ2 A;  2J5P A;  4EM1 A;  3BWG A;  3TDU C;  1LEA A;  2Z33 A;  1OKR A;  4KIF A;  1P92 A;  1MJA A;  1KA8 A;  3CDH A;  2DQL A;  5BOX A;  5LEK A;  4L9T A;  1O3S A;  3IWF A;  3CTA A;  2EA2 A;  4HW0 A;  4R79 A;  4ASN A;  3IWZ A;  1RUO A;  1A04 A;  4CXF A;  1U3E M;  4HA8 A;  2Q2E A;  1G4D A;  1RIO H;  4O5V A;  2FNA A;  4IRH A;  3I53 A;  2HQR A;  2CFX A;  4PZJ A;  1BI1 A;  3HOS A;  3EQL F;  5E8I A;  3KEQ A;  2EV0 A;  4G94 A;  5F1R A;  2E1N A;  1XB4 A;  1JHH A;  3V8L A;  4ZYH A;  4RB3 C;  4U7D A;  3I58 A;  2HEO A;  5E17 F;  3DPT A;  4EM0 B;  2IP2 A;  5E1X A;  3ZQ7 A;  2Q8K A;  2H6C A;  1MJB A;  5LGT A;  1MD0 A;  1R5G A;  4ETS A;  4ENM A;  4LG0 A;  2MLG A;  1QBJ A;  4KN7 X;  3BOQ A;  4BHP A;  3WTX C;  2OZU A;  3ERE D;  2ISY A;  5FD6 A;  3HIF A;  3RKW A;  1DPR A;  4GCV A;  1BC7 C;  3PFI A;  4JQF A;  4CO8 A;  3IKT A;  2ETH A;  3DV8 A;  2F2E A;  3ZPL A;  2OD5 A;  1GXQ A;  2HKX A;  1RUN A;  3QP5 A;  1IXC A;  5L3D A;  3J81 Z;  2X0L A;  3I0T A;  1U8R A;  4A12 A;  2B0L A;  2EA4 A;  4PCQ A;  2RC4 A;  4P55 A;  1R1U A;  1E2X A;  1B9M A;  1P4X A;  1TNT A;  2FNP A;  1SD6 A;  1HKT A;  2K86 A;  3T8R A;  2GZW A;  5ERI A;  4UVB A;  1L3L A;  1S8N A;  2IRF G;  5E1Z B;  2FF4 A;  4RGX A;  3GO5 A;  3T5X A;  2Y48 A;  1WKM A;  1I1G A;  1W5S A;  2H6B A;  2EJR A;  3TGN A;  1GXP A;  3K69 A;  5CYV A;  4OMZ A;  2YU3 A;  2HTJ A;  3RDI A;  1Z9C A;  4KN4 X;  4R8H A;  4HF0 A;  1Z7U A;  3KCC A;  5D8K B;  5DCM A;  2ZCW A;  3JTG A;  1FP1 D;  5DDG A;  4WXC A;  1TNS A;  3EUH A;  3I4P A;  2GWR A;  1O7F A;  1R1T A;  1G3T A;  1XGN A;  1O3R A;  3KP5 A;  3JSO A;  2PI0 A;  3HRU A;  1Z05 A;  1K7A A;  2M87 A;  3QU6 A;  4KMU X;  1HW5 A;  1KQ0 A;  1S7O A;  3FXR A;  5FB2 A;  3ISP A;  3J80 K;  1CGP A;  1BI2 A;  2EFQ A;  5CVI A;  5DEQ A;  1AWC A;  1BIA A;  3K0L A;  4HF1 A;  3WU0 A;  4A6D A;  2HWV A;  1ZAR A;  3COA C;  4KT5 C;  1IUY A;  3I59 A;  3WGI A;  1WRJ A;  2ZBK A;  5J8F A;  4M72 A;  3KLN A;  1LDK B;  1W5T A;  2JRT A;  3BRO A;  2O3F A;  2LF8 A;  2UWM A;  3ZN1 A;  4E70 A;  1D8J A;  3H92 A;  2XKP A;  2XAH A;  2KIU A;  3KEO A;  2HS5 A;  5E1W A;  2FEZ A;  1EH7 A;  3DFG A;  5HDK A;  3KP7 A;  3GEZ A;  4OMY A;  2HZT A;  2OQG A;  2VC0 A;  1W4M A;  4FX4 A;  5LHH A;  2ELH A;  2YX4 A;  5BPD A;  3FHZ A;  5ILS A;  2O6G E;  5ED4 A;  4IF4 A;  3RKY A;  3LQQ A;  1ZRD A;  2CWE A;  2P5V A;  4UUV A;  2P6S A;  3OOP A;  5JHU A;  1H0M A;  2BV6 A;  1JXS A;  5LGU A;  1WWX A;  5JI6 A;  2QBY B;  2H27 A;  2P5K A;  4I01 A;  2VON A;  2ESN A;  2H09 A;  2OU2 A;  4EJW A;  4HOB A;  4S05 A;  3WTS C;  3E5X A;  1B4A A;  3H3U A;  3IHU A;  2W57 A;  5L3E A;  4FHT A;  3TO7 A;  2VC1 A;  1LVA A;  2VT2 A;  5FD5 A;  4KMF A;  1UHW A;  2W25 A;  2RKH A;  2QQA A;  1W7P B;  4Y15 A;  3VOE A;  3P7N A;  4MEX F;  2DQR A;  1YW7 A;  4EV0 A;  4M9Z A;  2A69 F;  1KU2 A;  2HYF A;  4RGU A;  1J5Y A;  1XCV A;  2EB7 A;  2NYX A;  3WTZ A;  4I98 B;  1FC3 A;  3CLO A;  4YG2 F;  3RYR A;  4KNY A;  2QZ8 A;  1RI7 A;  4EJT A;  3VFZ A;  2XKO A;  1KYW A;  1HKQ A;  5BPI A;  5LHI A;  3GZ5 A;  2OBP A;  2LKP A;  1ZG3 A;  3CUQ A;  5AIQ A;  3O6B B;  4P9F A;  4A0Y A;  3FF5 A;  4XLN F;  4RB2 C;  5DD8 A;  1LNW A;  3HHG A;  3DKW A;  1IN8 A;  4MHG A;  3F23 A;  2CW0 F;  2DK8 A;  2L3D A;  4EVI A;  2XGX A;  4M74 A;  4IVN A;  1G3W A;  1SD5 A;  1I5Z A;  2CGP A;  4RS8 A;  1ZLK A;  1LEB A;  3TOA A;  5FLX K;  3HSE A;  3S2W A;  4KIC A;  1ZRC A;  1DPU A;  2D45 A;  3FXQ A;  3GLX A;  3C1D A;  4IRI A;  3HSR A;  4ZYG A;  3FXU A;  2HOE A;  2DO7 A;  5J6X A;  4ENN A;  4IHT A;  1YYV A;  3GWZ A;  4LB5 A;  2GA1 A;  3B02 A;  2QEN A;  3P9K A;  2KRF A;  5E8G A;  3GZ6 A;  4R1H A;  2GXG A;  2LDU A;  4ZYD A;  4HX8 A;  3V7R A;  1IW7 F;  4FT8 A;  4OIQ F;  4WCG A;  5ILV A;  2FU4 A;  1NHA A;  1BI0 A;  1CF7 A;  4RB0 A;  2Z3Y A;  2FXA A;  2CQK A;  1L0O C;  3CUO A;  4PGH A;  4Q5S F;  2DT5 A;  2FA5 A;  1XDS A;  1YIO A;  2YR2 A;  3QP6 A;  2VBW A;  1TW2 A;  3BJA A;  1FP2 A;  2FQ3 A;  2ZFW A;  5F64 A;  5CVJ A;  1R00 A;  2EFW A;  3FMR A;  5LLQ A;  3DPL C;  4HQM A;  4YFK F;  2XIG A;  4M6Y A;  2JTV A;  3J7A O;  5K1Y A;  3FX3 A;  2O0Y A;  4A2U A;  1JE8 A;  4HQE A;  2ZNZ A;  1XSX A;  2JSC A;  3MCZ A;  1SAX A;  3K2Z A;  2A07 F;  3RPU A;  4QWQ A;  1OMI A;  1ON1 A;  4ESJ A;  3IKV A;  2R7F A;  2UXN A;  5HLI A;  4CYD A;  4OIO F;  5DCM B;  4OIP F;  3EYY A;  5HS8 A;  3LA7 A;  4HYE A;  1TQM A;  1YLF A;  5D5W B;  5KVR A;  2K7L A;  1MKM A;  2DLL A;  1BBY A;  4MNU A;  4K2E A;  4EJO A;  4ENK A;  2M45 A;  2E7X A;  4WF2 A;  4M9S A;  4ENJ A;  1HST A;  1E17 A;  3K1N A;  1TLH B;  4Q47 A;  1MGT A;  2E1C A;  2HKO A;  4WX9 A;  1FZP B;  1J59 A;  3I59 B;  3MZY A;  4LD5 A;  5A2Q K;  2CG4 A;  1YW9 A;  1ZG1 A;  1I27 A;  2HFH A;  2V1U A;  4RGS A;  4XSX F;  3BY6 A;  2W84 A;  3JTH A;  4HDU A;  3SZT A;  3KP6 A;  3R0A A;  3EYI A;  2D2W A;  5HOO A;  4AD9 A;  1QO0 D;  2KKO A;  4M73 A;  1MJ9 A;  4M9X A;  5E20 A;  4KA4 A;  3HSF A;  4G7O F;  2IA0 A;  3DQV C;  3DP7 A;  3CJN A;  2W85 A;  3RJP A;  1H9G A;  5D5V B;  2M30 A;  2XAJ A;  2D1V A;  4WWC A;  4UHT A;  1ZRE A;  1U5T A;  4JBA A;  2BEO A;  2DU9 A;  5HS9 A;  3V8J A;  4GO1 A;  1ZG5 A;  4LFU A;  4M71 A;  1KQ8 A;  2WC2 A;  1PP8 F;  3WE3 A;  3EDP A;  4QLC U;  1LJ9 A;  4UNO A;  5HS7 A;  3ABU A;  4YFN F;  1RZ4 A;  3K9T A;  2STW A;  1K78 A;  2XAS A;  4L9N A;  4RAY A;  5HLG A;  5DUI A;  3M7G A;  3MEX A;  3ULQ B;  4BYY A;  2C6Y A;  1ZLJ A;  3TOB A;  2BE5 F;  2DK5 A;  2M5W A;  3WGG A;  4IJA A;  3MQ0 A;  4KYW A;  1FY7 A;  3MZH A;  3HRM A;  2PN6 A;  4IPA A;  2PEX A;  3KZY A;  1HXD A;  3HHH A;  3L00 A;  1YO5 C;  2VBZ A;  1J7K A;  1IN5 A;  2O03 A;  2RDP A;  2QLZ A;  2NRA C;  6PAX A;  1LB2 A;  1UFM A;  1HKS A;  2G7H A;  1XCB A;  4RB1 A;  5JFR A;  2ZME A;  2K4B A;  3T1B A;  2F5C A;  4UXN A;  1K79 A;  1KU9 A;  3J81 K;  4M6X A;  3SXY A;  5K5R A;  2STT A;  2ZO4 A;  5EEG A;  3CUQ C;  3CUQ B;  3RTR A;  1QZY A;  1AOY A;  2RNJ A;  1ZHF A;  1Z1D A;  5ICC A;  4Z2Y A;  3M1E A;  3NRV A;  1BI3 A;  4XSZ F;  1WI9 A;  1RNL A;  1J9I A;  5CJ9 A;  4L18 B;  2XVC A;  2ZNY A;  1FYL A;  3F8B A;  3LA3 A;  1C0W A;  1IAW A;  1OYI A;  1R36 A;  1IN7 A;  4G9Y A;  4BNC A;  3GFM A;  1LDD A;  2F5E A;  4HX7 A;  1USS A;  2CSO A;  2ESH A;  5LHG A;  2KJB A;  2YPR A;  4ZYE A;  1W7P D;  2E7W A;  3L2C A;  2IPQ X;  3B73 A;  4LGW A;  3HOT A;  3RYP A;  2OAZ A;  4BAY A;  3EET A;  4Y17 A;  1QGP A;  1JHF A;  3F3X A;  4DNC A;  1R1V A;  2A6H F;  4IRG A;  1S7A A;  4CGZ A;  3WTY C;  2X4H A;  3WTV C;  5EEH A;  5H20 A;  1YTY A;  3C7J A;  2PFB A;  3NEU A;  2WTE A;  4S04 A;  2WWY A;  3GUD A;  1D5V A;  1MDM A;  1VTN C;  1R22 A;  4O3M A;  2Y75 A;  3BJ6 A;  1PDN C;  3JSP A;  5FFZ A;  4AWX B;  1P2F A;  5F6F A;  1CF7 B;  3F8M A;  5K5O A;  1YS6 A;  2VOD A;  4BH9 A;  1DDN A;  2PMH A;  3DF8 A;  3ECH A;  3SZP A;  1BN5 A;  2QQB A;  1DP7 P;  1UST A;  4JK1 X;  4HLY A;  3H3Z A;  1PP7 U;  2FE3 A;  3G3Z A;  2ZKZ A;  4A6E A;  2VT3 A;  4MEY F;  2Q0O A;  2K02 A;  1UCR A;  2XRN A;  1EH8 A;  2MLK A;  3REO A;  3GX4 X;  5HDG A;  3VOD A;  3DXJ F;  3L9F A;  5LBQ A;  4LLG F;  4KUM A;  5TRD A;  2YSR A;  3KZZ A;  1IRG A;  1K6O A;  2V1D A;  3HTS B;  1QPM A;  5D5U B;  2V79 A;  3LQR A;  3F8N A;  4LB6 B;  4I02 A;  4G7H F;  3RI4 A;  2QYO A;  4XRF A;  1Q1H A;  4NB5 A;  3WG9 A;  1J75 A;  1S29 A;  2XV4 S;  5FO5 A;  1XGS A;  2IT0 A;  3F8C A;  3M8F A;  5H6Q A;  4MQV A;  5AIP A;  1Z6T A;  4H0E A;  3VEP A;  1F4K A;  3W6J B;  4U88 A;  2GQQ A;  4L0Y B;  1SD4 A;  2NNN A;  3ABT A;  2VBX A;  5CLS A;  3E6C C;  5IT9 Z;  1S3J A;  3IC7 A;  4A0X A;  5LEJ A;  2RN7 A;  3I54 A;  3QPT A;  1TQP A;  3KE2 A;  4AIK A;  1STZ A;  4U7B A;  2QQ9 A;  1F9N A;  4HX4 A;  4B8X A;  1U78 A;  3R6S A;  2VOO A;  4BHB A;  2DPD A;  1ONV A;  3RPQ A;  1F5T A;  2IA2 A;  4TV7 A;  4N9I A;  3E6B A;  3ELK A;  4Q4Z F;  2EFN A;  2FBI A;  1YS7 A;  3VB2 A;  4OOI A;  4RGR A;  5LRR A;  3G73 A;  5DCF A;  2VE8 A;  4GXO A;  2XAQ A;  3R61 A;  4I2O A;  3FWE A;  2UXX A;  4I0A A;  1MZB A;  1SFU A;  4Y13 A;  1LDJ A;  2BYV E;  2M8E A;  1YQA A;  3M9A A;  3WGH A;  3NQO A;  1OYY A;  2OZ6 A;  2Z5U A;  4L0Z B;  2V1X A;  2ISZ A;  3K1P A;  3QU3 A;  4G6D A;  1U5T C;  1U5T B;  5L3C A;  4AIH A;  1ZH5 A;  4KIB A;  2A68 F;  4IXA A;  4MGR A;  1B1B A;  1KGS A;  4BXU A;  4A5N A;  4CDG A;  1GVJ A;  3BPV A;  2V6C A;  1T6S A;  4ZZD A;  1D3Y A;  3FMS A;  1ZRF A;  3KLO A;  3TO9 A;  1K78 B;  5D6E A;  3F21 A;  5E18 F;  3V7S A;  4KIG A;  2HYG D;  1O3T A;  1R7J A;  2BGC A;  1KU7 A;  4U0V A;  5HLH A;  4ESB A;  2ADU A;  1SMT A;  1X3U A;  3BDD A;  4L9J A;  1FYK A;  2EV5 A;  2IJL A;  1O3Q A;  1XGO A;  1T39 A;  2MC3 A;  3QAH A;  4MTE A;  3WU1 B;  4GYI A;  1FWZ A;  1XDU A;  1ZAO A;  1ON2 A;  2A61 A;  1R23 A;  2G9W A;  1XMK A;  2ZME B;  3E5U A;  4N9H A;  2D1H A;  3K1M A;  3Q9V A;  2MBF A;  4DQ2 A;  1HW1 A;  1UB9 A;  2XAG A;  5CVR A;  1BM9 A;  3BPX A;  3QOP A;  4O6J A;  3TO6 A;  2FSW A;  3TDZ C;  3F6V A;  3N97 A;  4ESF A;  5ILU A;  2IA1 A;  1QQI A;  5DUK A;  3MFK A;  3F6O A;  5JVT A;  4HV5 A;  1FSH A;  4PGG A;  1H9T A;  5BS6 A;  2YX7 A;  2O61 A;  5ICE A;  3PQJ A;  3E97 A;  3MWM A;  4P5O A;  5LGN A;  4U0Y A;  2P6T A;  1FYM A;  1REP C;  1ZGA A;  1XSV A;  2DW4 A;  4L9V A;  2NNY A;  3FMQ A;  1IRF A;  1WSU A;  2XRO A;  4OIN F;  3P9I A;  1DUX C;  1TW3 A;  2P8T A;  2FBH A;  4L5J A;  5DYM A;  4EJU A;  4HLX A;  3ZN0 A;  4OIR F;  2Z9O A;  2L02 A;  3V4G A;  3E6D A;  3GVA A;  4A5M A;  2PJP A;  3HTU A;  3AAF A;  1HW2 A;  2DAO A;  3ZMV A;  1FLI A;  4HV6 A;  1ZYR F;  1FX7 A;  3QRF F;  1T38 A;  2FBK A;  1OPC A;  3LAJ A;  5H6R A;  2DI3 A;  5KK1 A;  1MDM B;  1V3F A;  3GF2 A;  2GIV A;  2K27 A;  2CYY A;  1YW8 A;  3ZMS A;  2A6E F;  2Z99 A;  1EV7 A;  4FX0 A;  1J2X A;  4YIF A;  2M1B A;  3LAP A;  1IXS B;  2GA2 A;  3F72 A;  2WV0 A;  3IRR A;  3J80 Z;  1U6G A;  3R0J A;  2MA3 A;  3WTU C;  2R3S A;  1TTY A;  2PLY A;  3L09 A;  5L3F A;  3M8E A;  5L3G A;  3LFK A;  4EQQ A;  3DEU A;  2V9V A;  3R60 A;  4UVC A;  3JAM Z;  2AXL A;  4CIC A;  3KP4 A;  2MH9 A;  2EK5 A;  2IW5 A;  1FOK A;  2DBB A;  4EJV A;  3GFJ A;  1SMY F;  2QUF A;  1S6L A;  1V4R A;  4D0P A;  1IN4 A;  3IL2 A;  1FBQ A;  3O2P E;  3Q9S A;  1XD7 A;  1HBX G;  1FBS A;  2Y0M A;  1BOA A;  4GGG A;  2QM3 A;  4EM2 A;  1G6N A;  1HSJ A;  5CVU A;  2GXB A;  2RGV A;  5D4R A;  1J0R A;  2CO5 A;  3ZMZ A;  1ODD A;  1R58 A;  3D5L A;  3HUG A;  3KFW X;  1B59 A;  5D5X B;  1P4A A;  2EV6 A;  5FGM A;  4BHC A;  3T8T A;  3E3V A;  4WXD A;  4UVA A;  1G3S A;  3IRQ A;  5HDN A;  2RVC A;  3RKX A;  1OYW A;  2L01 A;  2K4J A;  3F22 A;  2MD5 A;  4WK8 F;  1XN7 A;  1SFE A;  3BZ6 A;  3JAM K;  2JPB A;  3C18 A;  1KQ9 A;  2DFI A;  3Q5F A;  4U0W A;  4G8X A;  1LQ1 A;  2HDC A;  3PQK A;  4HBL A;  1SFX A;  2P7V B;  4HDV A;  3GFI A;  1T0F A;  4HZF A;  4ZH4 F;  2H94 A;  3U2R A;  2EFP A;  4F7Z A;  4P9U A;  2P5L C;  2PBI A;  3BP8 A;  2A3S A;  3WE2 A;  2MH2 A;  1FBU A;  4AVP A;  3U9G A;  3ZMT A;  4KDP A;  2L4M A;  3OV8 A;  2LNB A;  2DPU A;  1JGS A;  3MAJ A;  3C3W A;  3LST A;  1O7L A;  1EH6 A;  1T2K A;  3BJO A;  4CHU A;  4LLN A;  2PMU A;  5TJJ A;  5D8L B;  3ECO A;  2J5O A;  3I64 A;  3O3K A;  4NHJ A;  1FNN A;  2EWN A;  4LMY A;  1B6A A;  2NAZ A;  3N4M A;  1FSE A;  3I71 A;  2L54 A;  3GFL A;  3V8K A;  1Z91 A;  1ZN2 A;  3L7W A;  4AIJ A;  1PUE E;  4OU0 A;  2FOK A;  3GYH X;  2XHK A;  1ULY A;  1ZGJ A;  3GXO A;  3ML6 A;  2VBY A;  3CO7 C;  3CO6 C;  2COM A;  1KYZ A;  2HQN A;  1SD7 A;  4EGY A;  5FLX Z;  4PDK A;  3E5Q A;  1BJA A;  2JPC A;  3RIR A;  1G3Y A;  2RV8 A;  3ZMU A;  2XAF A;  2LSO A;  2LF7 A;  4XBF A;  1TQI A;  5BQT A;  4KFC A;  5HVQ C;  2JT1 A;  4B09 A;  4NQW A;  4CZZ A;  4XLP F;  5K5Q A;  2VOP A;  4LK1 F;  4YII A;  5LRS A;  3KET A;  1O57 A;  1B9N A;  5D6F A;  1Y0U A;  1FPQ A;  2VE9 A;  5D4S A;  3F8F A;  3LA2 A;  1FT9 A;  3W6K B;  1XGM A;  2ACJ A;  4I0B A;  1YG2 A;  4LLL A;  2VXZ A;  5FFX A;  1XSD A;  5IT3 A;  2ZJ2 A;  4P96 A;  3V7C A;  4LK0 F;  3LWF A;  4ZZL A;  2KIF A;  5ICG A;  4HAM A;  4GYG A;  1BC8 C;  5BMZ A;  2L4A A;  5AON A;  4HF2 A;  3U1D A;  3R4K A;  4BQA A;  2NS0 A;  3I5U A;  3JW4 A;  2P7C B; 
#chains in the Genus database with same CATH topology
 2VN2 A;  4G6Q A;  1FOX A;  1T95 A;  2DTR A;  2FML A;  4YEJ A;  3E6M A;  5IPA A;  2MW8 A;  1HQC A;  3FM3 A;  1W0T A;  2PQ8 A;  2GLO A;  3S16 J;  2IVM A;  3JRA A;  1D8K A;  5FLV A;  2DOF A;  4PFO A;  4Q48 A;  3G4S I;  3QPS A;  4CYC B;  4BE2 A;  1IF1 A;  2ZC2 A;  5CQE A;  4E7Z A;  1GHC A;  2KL4 A;  2P4W A;  1R5H A;  3D0S A;  3HYI A;  4A3F J;  2X6W A;  4A3I J;  1Z6R A;  1BIB A;  3TKY A;  3CLQ A;  4BBS J;  2Y0S N;  1YFH A;  1LE8 B;  3KP2 A;  2DA7 A;  1ZR2 A;  1SVL A;  2VPR A;  2QWW A;  2TDX A;  2QSG X;  1ETW A;  4EGZ A;  1IZ1 A;  2RQQ A;  4FCY A;  2VAS A;  5F0H A;  2R5Y A;  2KPM A;  3WTT C;  2GAU A;  4MQ9 F;  4RAZ A;  4CH7 A;  1D0Y A;  2HGC A;  2PG4 A;  4BXF A;  2QVO A;  1FOW A;  4L5I A;  2O8X A;  3HPG A;  2KIM A;  1ZGW A;  1XS9 A;  5JR3 A;  3QPH A;  1IXR C;  3HBL A;  4EMS A;  3K70 C;  4XOR A;  5ICF A;  1P6R A;  4IHV A;  2RRE A;  1TBX A;  4A3G J;  2OUM A;  2QBY A;  1P4W A;  2VQL A;  4LG0 B;  5GAE J;  2H8R A;  2HTS A;  1QNT A;  3TQN A;  2R7D A;  2LMD A;  2MSY A;  4UV8 A;  2XUB A;  4WXH A;  1Z0X A;  2W24 A;  3SQN A;  1UEL B;  3L2Q A;  4MTD A;  3FKJ A;  1AA7 A;  2ZXJ A;  5IT9 K;  4F55 A;  2DT7 B;  3FZV A;  4I09 A;  3ROU A;  2IS2 A;  2V1N A;  2G7U A;  3A01 A;  2ECC A;  1F1Z A;  2OQR A;  4UV9 A;  3PUF A;  1I3A A;  3DTI A;  2LKX A;  4FQG A;  2JZY A;  5J8C A;  2K40 A;  5F04 A;  2EFO A;  1U2W A;  4N4N B;  4XNF A;  2K3P A;  2E19 A;  2BVL A;  1YOV B;  2K3F A;  4ON0 A;  3HRT A;  1PVE A;  2AXT C;  3ZMD A;  3P9C A;  3ZP5 A;  1I1S A;  3LSP A;  4G7Z F;  1X3W B;  2DMP A;  1T98 A;  4A0Z A;  3AL0 B;  1W7P A;  1XMA A;  3WOD F;  4IHS A;  4YFX F;  2A5Y B;  2K9N A;  3SHF A;  4AU7 A;  1MBG A;  3HRS A;  1KU3 A;  3SEQ A;  2V7F A;  5B66 C;  5L3B A;  2F5F A;  2R7R A;  3KIO A;  1IDZ A;  1QZZ A;  3BCB A;  3KYC B;  3J7Y J;  3FM5 A;  2VIX A;  3CCM I;  5A2Q Z;  2DJN A;  4N0B A;  1Z3X A;  1FMW A;  2KJC A;  3SFZ A;  1IRZ A;  1OR7 A;  1I6X A;  2L7F P;  4IOA F;  2EZH A;  2F5D A;  4I7H A;  2VKV A;  3GW2 A;  2HR3 A;  3KP3 A;  2K85 A;  1H88 C;  3I3L A;  2E2H J;  1UHM A;  2AS5 F;  1U0J A;  5DD4 A;  4FET A;  3T0Y A;  5CVV A;  5DV5 A;  5E3O A;  2DA5 A;  3WTW C;  3OSG A;  3CP2 A;  2FRH A;  1IN6 A;  3S3O A;  3ZR8 X;  5IP9 J;  1Y1W J;  2OA4 A;  4LJZ F;  2BBY A;  2FMY A;  2UZK A;  3W2A A;  2RQP A;  2AQE A;  1WQ2 A;  2J5P A;  5EG0 B;  1QU3 A;  4EM1 A;  2JA6 J;  1R49 A;  3BWG A;  2F48 A;  3P5J A;  3E7L A;  3TDU C;  2IGM A;  3GBG A;  1Z77 A;  1LEA A;  4ZTJ A;  2Z33 A;  1OKR A;  1Z21 A;  4HPQ A;  4KIF A;  1P92 A;  1VQL I;  3SDB A;  1FOY A;  1MJA A;  1KA8 A;  2L2O A;  5HLT A;  2A05 A;  3CDH A;  2O8K A;  2DQL A;  3I9V 2;  1F43 A;  2JMW A;  2KIQ A;  5BOX A;  3OIO A;  4PSX A;  5LEK A;  2HQA A;  2HI3 A;  1UAA A;  5TGT A;  4L9T A;  1O3S A;  3HUG B;  3IWF A;  2LC2 A;  3CTA A;  2MG4 A;  1RET A;  2QKM B;  2EA2 A;  2EZL A;  4HW0 A;  4R79 A;  2MGQ A;  2WB1 N;  4ASN A;  3IWZ A;  3JRE A;  1RUO A;  1A04 A;  3HJE A;  4CXF A;  2K9Q A;  1U3E M;  4HA8 A;  2Q2E A;  5C44 J;  1GUU A;  1G4D A;  1SAU A;  1RIO H;  5DTD A;  4O5V A;  2FNA A;  4IRH A;  3I53 A;  1QHG A;  5KHD A;  2HQR A;  2CFX A;  1X3Z B;  3K4M A;  4PZJ A;  1BI1 A;  1LUJ B;  3HOS A;  3EQL F;  5E8I A;  5HNF A;  3KEQ A;  2BZT A;  1Q1V A;  2EV0 A;  2BY0 A;  1VF9 A;  4G94 A;  1MBK A;  2CH0 A;  4A3L J;  4B43 A;  5F1R A;  1LKX A;  1XB4 A;  2E1N A;  4YRV A;  3LSH A;  1JHH A;  2CQQ A;  3V8L A;  4ZYH A;  3CCV I;  4RB3 C;  4U7D A;  2JA5 J;  1TWF J;  1VQ5 I;  2IBD A;  3I58 A;  2HEO A;  5E17 F;  3K4K A;  3CMA I;  3HB9 A;  3DPT A;  4XRS G;  4EM0 B;  3QOD A;  3M4O J;  2IP2 A;  5E1X A;  3ZQ7 A;  1Y8Q B;  2PX9 A;  2YS9 A;  2Q8K A;  2H6C A;  3S32 A;  1MJB A;  4CCJ A;  5LGT A;  1MD0 A;  3CCQ I;  1XX5 A;  1ETX A;  1MNE A;  1R5G A;  5GPA A;  4ETS A;  4ENM A;  4LG0 A;  4IQ4 A;  2R7S A;  2MLG A;  1QBJ A;  5KCM A;  4KN7 X;  1OCR H;  3BOQ A;  4BHP A;  3WTX C;  2OZU A;  1JI8 A;  1Z67 A;  3ERE D;  2LRD A;  2ISY A;  5FD6 A;  4II3 A;  4OAY A;  3HIF A;  3CCL I;  3RKW A;  1VQ4 I;  5F08 A;  1DPR A;  4GCV A;  3BLY A;  5TIS C;  1BC7 C;  1YJW I;  3PFI A;  4JQF A;  4CO8 A;  1ETO A;  3IKT A;  2FX0 A;  2ETH A;  1VQO I;  2DJI A;  4QTR A;  2GOX B;  2CMP A;  3DV8 A;  5FKO A;  2F2E A;  3ZPL A;  1PYV A;  2OD5 A;  2Y30 A;  3IAM 2;  1GXQ A;  2HKX A;  3QQA A;  1RUN A;  1B72 B;  3QP5 A;  1IXC A;  5L3D A;  3J81 Z;  4B4C A;  2X0L A;  3I0T A;  2CQX A;  1JTX A;  1U8R A;  1QPI A;  4A12 A;  2B0L A;  1W36 D;  2EA4 A;  4PCQ A;  4EEF G;  2RC4 A;  2W48 A;  1R1U A;  4P55 A;  1E2X A;  1B9M A;  1P4X A;  1FIA A;  1TNT A;  2FNP A;  5GPC A;  1YX3 A;  1SD6 A;  1HKT A;  2K86 A;  3T8R A;  2GXA A;  2X6X A;  3K6G A;  2HXO A;  2LRE A;  2O7O A;  3H3V K;  2GZW A;  3DTK A;  4OWR B;  4XK4 A;  2Y9Z A;  2OCC H;  3F0C A;  5ERI A;  4UVB A;  1L3L A;  1S8N A;  2IRF G;  3G71 I;  2HDD A;  5E1Z B;  1X1D A;  2FF4 A;  2R4G A;  2DFH A;  4XOT A;  1WH5 A;  3KX2 A;  4RGX A;  3GO5 A;  3T5X A;  2DFF A;  3OS2 A;  2Y48 A;  1WKM A;  1Y1V J;  2JUG A;  1I1G A;  4A3B J;  1QZE A;  1W5S A;  2M8G X;  2H6B A;  2EJR A;  1VQK I;  1VQM I;  3TGN A;  1K4S A;  1GXP A;  3K69 A;  5CYV A;  5IY5 H;  4OMZ A;  2V9K A;  2YU3 A;  1M1E B;  2HTJ A;  5GAH J;  2NS8 A;  3HXL A;  3A1Y A;  4IOC F;  2CV0 A;  3OYH A;  3JCU C;  4XID A;  3RDI A;  1Z9C A;  1OCC H;  1WVR A;  1IV6 A;  4KN4 X;  4R8H A;  3ZQL A;  4HF0 A;  1Z7U A;  2KRH A;  2ZB9 A;  1BR1 A;  1X1A A;  2X6Y A;  3KCC A;  2ZCW A;  5DCM A;  5D8K B;  2XAU A;  3JTG A;  4PJN A;  3OYM A;  4QPQ A;  1FP1 D;  5IOY A;  2LP0 A;  5DDG A;  4M3F A;  4WXC A;  1ERD A;  1TNS A;  3EUH A;  3I4P A;  4QSH A;  4NQW B;  2GWR A;  2CW7 A;  1O7F A;  1R1T A;  2VKH A;  1G3T A;  5E3L A;  2HVS A;  1XGN A;  1O3R A;  1Y8R B;  3KP5 A;  3JSO A;  2PI0 A;  2K5C A;  3HRU A;  1Z05 A;  1K7A A;  2W4S A;  5FKM A;  3TW6 A;  1GT0 C;  2M87 A;  2QKL B;  2DN0 A;  3VSL A;  2V6E A;  3EUK L;  1IUF A;  2K9S A;  3QU6 A;  4KMU X;  1HW5 A;  3S3N A;  1D1A A;  1KQ0 A;  1S7O A;  3FXR A;  5FB2 A;  5IYD J;  2HVR A;  3ISP A;  3J80 K;  3B6C A;  4E4H A;  1BI2 A;  2EFQ A;  5CVI A;  5DEQ A;  1AWC A;  1APL C;  1CGP A;  1BIA A;  1UZC A;  3S1M J;  3K0L A;  4HF1 A;  3WU0 A;  1HLV A;  2BXZ A;  2K9M A;  4A6D A;  5EDN A;  4XLH A;  2JA8 J;  3Q0W A;  2HOT A;  2P81 A;  2IGN A;  2HWV A;  1ZAR A;  3COA C;  4KT5 C;  1AU7 A;  1IUY A;  3BTC A;  3I59 A;  3WGI A;  1WRJ A;  1GDT A;  2ZBK A;  5J8F A;  4M72 A;  3KLN A;  1LDK B;  1W5T A;  2JRT A;  3ERM A;  3RKQ A;  3BRO A;  1TT0 A;  2O3F A;  4Y52 J;  5EJC A;  2LF8 A;  2UWM A;  3ZN1 A;  4E70 A;  1D8J A;  2ELK A;  3HDD A;  3H92 A;  4RMN A;  3TL4 X;  2XKP A;  4BQQ A;  2XAH A;  1K4T A;  3HOU J;  2KIU A;  3TBI A;  2L9R A;  4KIS A;  3KEO A;  1WFX A;  4GRI A;  2M0M A;  2HS5 A;  5B5E C;  2R7Z J;  5E1W A;  2FEZ A;  1EH7 A;  4C9Y A;  4B44 A;  3DFG A;  5HDK A;  2R7O A;  4NDL A;  3KP7 A;  2XPW A;  3GEZ A;  2F4O B;  2NVX J;  2CUJ A;  3NAR A;  4OMY A;  2HZT A;  3PNY A;  2HU9 A;  2OQG A;  2VC0 A;  1W4M A;  4FX4 A;  5LHH A;  2ID3 A;  2LY1 A;  2ELH A;  2YX4 A;  1OQY A;  4HG2 A;  3CCR I;  5BPD A;  3FHZ A;  5ILS A;  2O6G E;  3RPU D;  1NG6 A;  4IF4 A;  2KDO A;  3RKY A;  5ED4 A;  2HOA A;  3LQQ A;  5IYC J;  1ZRD A;  2CWE A;  1VQN I;  2P5V A;  4BE0 A;  3DKY A;  4UUV A;  2P6S A;  2NS7 A;  2UUZ A;  5EGO A;  3OOP A;  5JHU A;  1S5L C;  1H0M A;  3AG3 H;  2BV6 A;  4M3B A;  1JXS A;  5LGU A;  1SAN A;  1WWX A;  4RM3 A;  3S1R J;  2KDZ A;  4J00 A;  1O4X A;  2Y69 H;  4BU2 A;  2DA2 A;  5JI6 A;  1IJW C;  2H27 A;  2QBY B;  5C4J J;  3OOU A;  1OFC X;  3HG9 A;  2P5K A;  4I01 A;  1MMD A;  2JK3 A;  4C2U A;  2DMU A;  5BNG A;  2VON A;  2ESN A;  1IRX A;  3OYG A;  3BR3 A;  2H09 A;  2Y2Z A;  1JKO C;  3VYS B;  2KT0 A;  2OU2 A;  1X58 A;  4EJW A;  4HOB A;  4S05 A;  3A01 B;  4PJM A;  3LSI A;  3WTS C;  3E5X A;  5FRN A;  2IGK A;  2LKS A;  1B4A A;  3H3U A;  3IHU A;  5FJ8 J;  4JX4 A;  2W57 A;  5L3E A;  3H0G J;  4FHT A;  3TO7 A;  2VC1 A;  3CJT B;  1LVA A;  2VT2 A;  5FD5 A;  4JYK A;  1DGW Y;  4KMF A;  2IXS A;  1UHW A;  2W25 A;  3H9Q A;  2N8G A;  1S9H A;  3M07 A;  2R0Q C;  2RKH A;  2UV1 A;  5EF6 A;  2QQA A;  4RLQ A;  2W7N A;  1W7P B;  2L7M P;  3G6E I;  3UR3 C;  2XB0 X;  4Y15 A;  1UMQ A;  1R9T J;  3VOE A;  3P7N A;  1BA5 A;  4MEX F;  2DQR A;  2L9V A;  1AHD P;  1YW7 A;  2LFB A;  2R92 J;  3LMM A;  4DYQ A;  3H0D A;  4EV0 A;  1FTT A;  4M9Z A;  2A69 F;  1ETV A;  1KU2 A;  2HYF A;  2R7T A;  3IUO A;  5IYB J;  3G1O A;  4F93 B;  1WJA A;  1V5F A;  4RGU A;  2O9L A;  4XIC A;  1J5Y A;  1XCV A;  2EB7 A;  2NYX A;  3I4M J;  2F6C A;  2WY8 Q;  4XKC A;  1FMV A;  1ZTR A;  3WTZ A;  3PO2 J;  4I98 B;  2HOS A;  3H9J A;  1FC3 A;  1YJ9 I;  3CLO A;  4YG2 F;  3G1L A;  3K10 A;  1IC8 A;  3RYR A;  3CQZ J;  4KNY A;  3BG7 A;  2QZ8 A;  1RI7 A;  1MSF C;  4EJT A;  5H2F C;  3HKZ A;  1GV5 A;  3VFZ A;  2XKO A;  1KYW A;  3PUB A;  2GOM A;  1HKQ A;  5BPI A;  1ZR4 A;  4BBR J;  5LHI A;  3GZ5 A;  5K7F A;  1D1C A;  4D1Q A;  2OBP A;  2LKP A;  1ZG3 A;  3CUQ A;  1XC5 A;  5AIQ A;  3BQY A;  2DXI A;  1V55 H;  3O6B B;  4P9F A;  4A0Y A;  3FF5 A;  4XLN F;  1YRN A;  1TC3 C;  3CCY A;  3GCM A;  4RB2 C;  5DD8 A;  1LNW A;  3HHG A;  2OTJ I;  5B1B H;  3HGG A;  2VI6 A;  4X6A J;  3DKW A;  4CSW A;  2VXD A;  1RR7 A;  1IN8 A;  4MHG A;  5FRO A;  3F23 A;  2CW0 F;  2ZXH A;  2DK8 A;  2L7K A;  3GLL A;  2L3D A;  4EVI A;  2CQN A;  1OIS A;  3H5N A;  5F1J A;  2XGX A;  1YJN I;  3MKZ A;  4M74 A;  5GTH C;  1GV2 A;  3CDI A;  4IVN A;  1G3W A;  2NVU B;  3W6V A;  1SD5 A;  1I5Z A;  2IS4 A;  2CGP A;  5HOD A;  2Q2E B;  3OIQ A;  1FJL A;  4RS8 A;  3MZ8 A;  1ZLK A;  1LEB A;  4UB6 C;  3TOA A;  5FLX K;  3Q3S A;  3BCA A;  1A6Q A;  3JRB A;  3HSE A;  3S2W A;  4KIC A;  4DZP A;  1JJ8 C;  1ZRC A;  1DPU A;  2D45 A;  3FXQ A;  1B8I A;  1LFP A;  1R6R A;  1PJR A;  3GLX A;  2HVQ A;  3C1D A;  3ZQG A;  1IGN A;  4IRI A;  3HSR A;  3JRI A;  4ZYG A;  3FXU A;  2HOE A;  1V5G A;  1MND A;  1K61 A;  2DO7 A;  1E3P A;  3DTE A;  5J6X A;  3L1P A;  4ENN A;  4IHT A;  1YYV A;  1TWA J;  2KZG A;  3GWZ A;  1DU6 A;  2K9L A;  4LB5 A;  3J7A Y;  2GA1 A;  4IKF A;  4CCO A;  2XSJ C;  3B02 A;  1G59 A;  1MMN A;  2E34 A;  2QEN A;  3P9K A;  2KRF A;  3BR5 A;  3I55 I;  5E8G A;  2ECB A;  3GZ6 A;  2M34 A;  2R7V A;  1AKH A;  4R1H A;  2GXG A;  3QYF A;  4DZJ A;  5B1A H;  2NOG A;  2LDU A;  4ZYD A;  2M3A A;  2R7W A;  4HX8 A;  3V7R A;  2LD5 A;  2V9P A;  1IW7 F;  3S2H J;  3A03 A;  5M5Y J;  4FT8 A;  2CUE A;  1EJ9 A;  4OIQ F;  4WCG A;  1RES A;  5ILV A;  3S1N J;  4D7M A;  2FU4 A;  1NHA A;  2BHZ A;  3S3M A;  1BI0 A;  1EF4 A;  1CF7 A;  4RB0 A;  2CW8 A;  3M8J A;  3ONQ A;  4ITV A;  4PJL A;  2Z3Y A;  2FXA A;  1VQ8 I;  2CQK A;  1L0O C;  3CJQ B;  4BL0 B;  3CUO A;  4PGH A;  4E7H A;  3NWT A;  2HPI A;  4Q5S F;  2DT5 A;  2FA5 A;  2KRC A;  4F92 B;  2LVS A;  3CCU I;  4JX5 A;  1ACI A;  3OYL A;  2BHY A;  1XDS A;  1YIO A;  1JGG A;  2YR2 A;  3QP6 A;  2X1E A;  2VBW A;  1Y6I A;  1P7I A;  4EAT A;  1TW2 A;  3S93 A;  4FAS D;  2L7Z A;  1FP2 A;  3BJA A;  3AL0 C;  2X1C A;  2FQ3 A;  2VJ5 A;  2ZFW A;  5F64 A;  4KIT B;  1IO2 A;  3RZD J;  3HEF A;  5CVJ A;  2VJ4 A;  2CV2 A;  1R00 A;  5FKN A;  2EFW A;  1MMA A;  1ORK A;  3LSJ A;  2LY2 A;  1IV8 A;  1A31 A;  3FMR A;  1BJZ A;  5LLQ A;  3V42 A;  3DPL C;  4HQM A;  3MMY B;  4YFK F;  2XIG A;  1OCO H;  4M6Y A;  4I6Z A;  4A3C J;  2DDB A;  2JTV A;  3J7A O;  3ZRG A;  5B3S H;  3A0B C;  5K1Y A;  3FX3 A;  4CA0 A;  2R5Z A;  2QSF X;  2O0Y A;  2W82 A;  4M3G A;  4A2U A;  1JE8 A;  4HQE A;  2ZNZ A;  3BR6 A;  1XSX A;  2JSC A;  2E1M C;  3MCZ A;  3QOE A;  5KAF C;  2E1M B;  1SAX A;  1TT5 B;  3FBI B;  3K2Z A;  1OLT A;  2A07 F;  3LL7 A;  4DIQ A;  3RPU A;  3GTL J;  3C2H A;  4QWQ A;  1OMI A;  1ON1 A;  4ESJ A;  3IKV A;  4IO9 F;  4DBQ A;  1BL0 A;  2R7F A;  4C2T A;  4XOP A;  2UXN A;  5K7Z A;  2YU9 J;  1DQU A;  2WAF A;  3DBR B;  5HLI A;  4CYD A;  5CPR B;  5M5W J;  2FJ1 A;  4OIO F;  2LK2 A;  2E1O A;  4MFD A;  2HXI A;  5DCM B;  4Y4R A;  4OIP F;  1MH4 A;  4AVZ A;  1U9N A;  1YIT I;  2ICW G;  3EYY A;  3EPZ A;  4LG3 A;  3VYT B;  3WHB A;  4A3D J;  2L9N A;  2EQR A;  5HS8 A;  3VPR A;  3LA7 A;  4HYE A;  1TQM A;  1TWG J;  1YLF A;  5D5W B;  2E60 A;  5KVR A;  2K7L A;  3HKZ N;  1JKP C;  1MKM A;  1X2M A;  2DLL A;  1NH3 A;  1BBY A;  4MNU A;  4K2E A;  1YIJ I;  1WJB A;  4EJO A;  1ZKG A;  4ENK A;  2M45 A;  3S8P A;  3SJM A;  3LSM A;  4II2 A;  3OIP A;  4C2M J;  3W3C A;  2E7X A;  4AUX A;  3ASN H;  3ZQI A;  3S2D J;  4WF2 A;  2FUG 2;  2KHM A;  4ZDP A;  4M9S A;  4P1W A;  4PK4 A;  4I76 A;  2DCE A;  4ENJ A;  3GTG J;  1HST A;  3H35 A;  1E17 A;  3H9G A;  3K1N A;  1TLH B;  4Q47 A;  3BR2 A;  1MGT A;  2E1C A;  2HKO A;  4WX9 A;  1FZP B;  1G2H A;  1ENH A;  1J59 A;  2PMZ A;  2XF5 A;  1I50 J;  4BDZ A;  3I59 B;  4CZC A;  3MZY A;  4LD5 A;  5A2Q K;  2CG4 A;  1YW9 A;  1ZG1 A;  4IHY A;  2M7B A;  1I6H J;  1I27 A;  3LFU A;  3UNG C;  1UHS A;  2HFH A;  2V1U A;  4RGS A;  4XSX F;  2KQR A;  3OR2 C;  5JLX A;  3VYR B;  3BY6 A;  2AHQ A;  2W84 A;  3JTH A;  2LR8 A;  3AKZ A;  4HDU A;  3SZT A;  3TP3 A;  3KP6 A;  4ABZ A;  3JRH A;  4E7K A;  3R0A A;  3EYI A;  1VQ7 I;  4PJJ A;  4BGD A;  2D2W A;  4CCM A;  3LSR A;  1T0F C;  5HOO A;  3K4L A;  4BAC A;  9ANT A;  4AD9 A;  1QO0 D;  2KKO A;  4M73 A;  1MJ9 A;  3K2A A;  4L5E A;  2X9D A;  4M9X A;  2HQ5 A;  5E20 A;  3OYD A;  4KA4 A;  3HSF A;  4G7O F;  1SEU A;  2IA0 A;  3DQV C;  1MNM C;  2B9S A;  3BQZ A;  3DP7 A;  3DCF A;  4AC0 A;  3CJN A;  4C3J J;  2W85 A;  2MD0 A;  3B6A A;  3RCO A;  5C3E J;  3CMY A;  3RJP A;  5F27 A;  4BDY A;  1A36 A;  2DDA A;  3JR9 A;  3MKY B;  1H9G A;  3FDY A;  1LFB A;  3BR0 A;  1TWH J;  5D5V B;  2M30 A;  3DPU A;  4AM3 A;  2XAJ A;  3RZO J;  2HZD A;  2D1V A;  3FXJ A;  4UHT A;  4HNT A;  4WWC A;  1XTA A;  1ZRE A;  1MH3 A;  2CU7 A;  2OV7 A;  1U5T A;  1K83 J;  4JBA A;  4N4O B;  5J1Y A;  5EGO B;  4E7S A;  2BEO A;  3OYE A;  2ME0 A;  2DU9 A;  5HS9 A;  3V8J A;  2L5Q A;  4BJT A;  4GO1 A;  1ZG5 A;  4LFU A;  2EPF A;  3OY9 A;  1BW6 A;  4M71 A;  3FXK A;  2OCE A;  1KQ8 A;  2CUZ A;  2WC2 A;  1PP8 F;  3WE3 A;  3EDP A;  4QLC U;  1LJ9 A;  4UNO A;  5HS7 A;  5F0C A;  1XPX A;  3ABU A;  4LIU A;  4YFN F;  2H1K A;  1RZ4 A;  3WHC A;  3K9T A;  2LH9 A;  2M4G A;  3VSK A;  2STW A;  2XPV A;  1T33 A;  1K78 A;  3FKI J;  4B3X A;  2XAS A;  4L9N A;  2ZXI A;  3F9K A;  2Z16 A;  4RAY A;  5HLG A;  5DUI A;  1HA8 A;  3M7G A;  3L2W A;  3MEX A;  3ULQ B;  4BYY A;  2C6Y A;  5JHF A;  3HOV J;  3RQI A;  1ZLJ A;  2Z1D A;  3N05 A;  2X85 A;  1A6I A;  2L9S A;  2KZV A;  3BZK A;  5DM7 F;  1N77 A;  3DLA A;  2BE5 F;  4XM3 A;  2DK5 A;  3TOB A;  3IV5 A;  3TED A;  2M5W A;  3WGG A;  2JQ7 A;  4LIT A;  3OYK A;  4ZTF A;  2VQG A;  4IJA A;  3MQ0 A;  4KYW A;  1FY7 A;  1MBH A;  5E79 C;  3MZH A;  3HRM A;  5M5X J;  5J4V A;  4RBO A;  5LFA A;  2PN6 A;  4IPA A;  5J4Y A;  2PEX A;  3KZY A;  1HXD A;  2MC4 A;  3SDG A;  3HOZ J;  4XLA A;  3HHH A;  3L00 A;  1S72 I;  1YO5 C;  2BW3 A;  2DMT A;  2VBZ A;  4A93 J;  1J7K A;  3BTJ A;  1IN5 A;  2O03 A;  2RDP A;  3IH3 A;  2QLZ A;  2NRA C;  6PAX A;  2JVH A;  4PSW A;  1UFM A;  1BR2 A;  2BY2 A;  4UUS A;  1LB2 A;  1HKS A;  2G7H A;  1E3H A;  1XCB A;  4RB1 A;  2HDW A;  5JFR A;  1K6Y A;  2ZME A;  2K4B A;  2R7Q A;  3T1B A;  2F5C A;  2H8W A;  3EUA A;  4XON A;  4MFE A;  1RKT A;  3FXL A;  1QRY A;  3O8H A;  4UXN A;  5DS9 A;  3DEE A;  1K79 A;  1KU9 A;  3E0J B;  3J81 K;  4M6X A;  2F4M B;  3SXY A;  4BE1 A;  5K5R A;  1W5C C;  2STT A;  2ZO4 A;  5EEG A;  3CUQ C;  3CUQ B;  3DEW A;  3OS1 A;  2EZK A;  3RTR A;  3K7A J;  1W0U A;  3GTM J;  4B1R A;  1YRN B;  1QZY A;  1AOY A;  2XB5 A;  2RNJ A;  1ZHF A;  3CZ6 A;  3PFY A;  1Z1D A;  5ICC A;  4BJ6 C;  4Z2Y A;  3M1E A;  3NRV A;  1BI3 A;  1ZEL A;  5FRM A;  4XSZ F;  1WI9 A;  4RA2 A;  4BEH A;  2COB A;  2VQH A;  1RNL A;  2I5U A;  1J9I A;  5CJ9 A;  4V2F A;  4L18 B;  2DFE A;  2XVC A;  2ZNY A;  3QYB A;  1FYL A;  3F8B A;  3LA3 A;  1C0W A;  1MBF A;  1IAW A;  1OYI A;  1R36 A;  1IN7 A;  2OF7 A;  3S14 J;  3H1C A;  4G9Y A;  4BNC A;  3DU5 A;  3GFM A;  1LDD A;  4BY7 J;  4OAZ A;  3W2V A;  4X1E A;  2F5E A;  4HX7 A;  1USS A;  2CSO A;  2QEX I;  2ESH A;  5LHG A;  3LNQ A;  1HF0 A;  4A3M J;  2KJB A;  1RPW A;  2YPR A;  4ZYE A;  3HOW J;  5JVG F;  1W7P D;  2PMZ N;  1OCZ H;  1EKE A;  1TWC J;  2E7W A;  3L2C A;  3D5R C;  2IPQ X;  3B73 A;  1B8I B;  3ZCO A;  4LGW A;  4Y33 A;  3HOT A;  3WU2 C;  3RYP A;  2OAZ A;  4BAY A;  2IEK A;  2JVG A;  2LBF A;  3EET A;  4Y17 A;  1QGP A;  1JHF A;  3U1K A;  3F3X A;  4DNC A;  2GBY A;  1R1V A;  2A6H F;  4IRG A;  4GDF A;  1S7A A;  4CGZ A;  1WJF A;  1N75 A;  1X4P A;  3WTY C;  2X4H A;  5CKT A;  3WTV C;  5EEH A;  5H20 A;  1YTY A;  3C7J A;  2PFB A;  3NEU A;  1PUF B;  2WTE A;  4S04 A;  2Y31 A;  5J3L A;  2NVY J;  2WWY A;  1AKH B;  1ETY A;  5EZH A;  3GUD A;  1D5V A;  1MDM A;  4C3I J;  1VTN C;  1UG0 A;  4Y7N J;  3AFH A;  5DM6 F;  5KNL A;  4XLE A;  3BG6 A;  1D1B A;  1R22 A;  4O3M A;  4RM2 A;  4BQO A;  4BQN A;  2Y75 A;  3BJ6 A;  1PDN C;  1XMX A;  3JSP A;  2EIM H;  4UUT A;  5FFZ A;  3ZQF A;  1H89 C;  1Z3Y A;  4AWX B;  2F4I A;  1P2F A;  2OTL I;  1ETQ A;  2M0C A;  5F6F A;  5FKK A;  1CF7 B;  3I4N J;  3CC7 I;  2CV1 A;  1R4M B;  3CDL A;  4HST A;  4A3E J;  3F8M A;  5K5O A;  5FLM J;  1YS6 A;  1F36 A;  4H4K C;  4DBR A;  1D0Z A;  3CF5 F;  4QPO A;  2VOD A;  1WZ2 A;  1QVU A;  2L0K A;  4BJ5 C;  2XPU A;  4BH9 A;  1DDN A;  2VKD A;  2PMH A;  3DF8 A;  3ECH A;  3GTP J;  3SZP A;  5IOZ A;  1YHQ I;  1BN5 A;  2QQB A;  1ETK A;  1DP7 P;  2VB6 A;  1UST A;  4JK1 X;  3GTO J;  4HLY A;  3H3Z A;  1PP7 U;  2FE3 A;  3GTJ J;  1X1C A;  3G3Z A;  2ZKZ A;  4A6E A;  2DA1 A;  3QPL A;  2VT3 A;  4MEY F;  2Q0O A;  2K02 A;  1VI0 A;  4XKW A;  3KZI C;  1UCR A;  4DOZ A;  1ZK8 A;  2XRN A;  1EH8 A;  2MLK A;  2YUS A;  3REO A;  3GX4 X;  1OR7 C;  5HDG A;  4ZYA A;  3VOD A;  2OJE D;  2FD5 A;  3BG5 A;  3DXJ F;  3L9F A;  5LBQ A;  1E3O C;  4LLG F;  2BY1 A;  2R5Z B;  4KUM A;  4RAG A;  5TRD A;  2WAD A;  1BR4 A;  3HOY J;  2YSR A;  3KZZ A;  4BS9 A;  1IRG A;  2E2I J;  1K6O A;  2V1D A;  3HTS B;  1JUM A;  1QPM A;  1E0E A;  4CCL A;  1QVT A;  5D5U B;  4DYR A;  2LYC A;  2R93 J;  2V79 A;  3LQR A;  1RKW A;  4BKX A;  3F8N A;  1RR8 C;  4LB6 B;  1JT6 A;  1G8X A;  4U87 A;  4DJA A;  4HSR A;  3K70 D;  2CS3 A;  4I02 A;  2W1O A;  3GME A;  2P0W A;  4G7H F;  3RI4 A;  4UB8 C;  1X1B A;  2I10 A;  2QYO A;  4XRF A;  4A69 C;  4MLO A;  1QA6 A;  1Q1H A;  4D5C A;  3PM1 A;  2LG4 A;  1JUP A;  3A0H C;  4NB5 A;  3WG9 A;  4AID A;  2VKE A;  1J75 A;  3A2K A;  1S29 A;  2X1D A;  2XV4 S;  2WAE A;  5HNH A;  5FO5 A;  1XGS A;  2IT0 A;  3F8C A;  2ZFU A;  3M8F A;  4MQV A;  3H5R A;  4XKV A;  1Z6T A;  3K4J A;  5AIP A;  5H6Q A;  3VEP A;  3W6J B;  4H0E A;  4V19 K;  4U88 A;  4KT6 A;  2GQQ A;  2IS1 A;  2WB1 A;  3ABM H;  4L0Y B;  1LFU P;  3OYC A;  1SD4 A;  2XDV A;  2NNN A;  3AG1 H;  3ABT A;  3SZG A;  1VZ0 A;  2CUF A;  2B7E A;  2VBX A;  5J1R A;  5CLS A;  3ESW B;  4XRS A;  3E6C C;  5IT9 Z;  1S3J A;  3PO3 J;  3IC7 A;  2JN6 A;  4A0X A;  4B47 A;  5LEJ A;  3CC4 I;  2RN7 A;  2CRG A;  3I54 A;  3QPT A;  3VYU B;  3L2U A;  3FBN B;  1JTY A;  1TQP A;  3CF2 A;  3KE2 A;  4AIK A;  4X0G A;  1STZ A;  3D1N I;  2WBM A;  4U7B A;  3SEZ A;  2QQ9 A;  4CUG A;  1SC7 A;  1F9N A;  2E5N A;  4HX4 A;  2NXN B;  4B8X A;  4NNJ A;  1U78 A;  4F52 A;  3R6S A;  2VOO A;  3FK7 A;  1UJ8 A;  3KYD B;  4BHB A;  1D5Y A;  2DPD A;  1ONV A;  3RPQ A;  1F5T A;  5J40 A;  2DYS H;  2IA2 A;  4TV7 A;  4N9I A;  3E6B A;  3ELK A;  4Q4Z F;  2EFN A;  4FIS A;  2FBI A;  1YS7 A;  3HM5 A;  3OWT A;  3VB2 A;  5EEA A;  4OOI A;  4RGR A;  5LRR A;  4FE7 A;  1DP3 A;  3G73 A;  2I8D A;  1WGX A;  1WHU A;  4CCK A;  4C3H J;  2BY3 A;  3LSK A;  5CQG A;  5DCF A;  1PUF A;  1V5E A;  2VE8 A;  1MBJ A;  2EIN H;  1KON A;  4GXO A;  2E2J J;  2XAQ A;  1X2N A;  3R61 A;  3TMO A;  4I2O A;  3S15 J;  1WI3 A;  3FWE A;  2UXX A;  4I0A A;  1MZB A;  1SFU A;  2R7U A;  4Y13 A;  1LDJ A;  2BYV E;  2M8E A;  3QWL A;  4LOC A;  4E7J A;  1YQA A;  3M9A A;  3WGH A;  2CQ7 A;  4RDU A;  4NC7 A;  3NQO A;  1OYY A;  2X51 A;  3SYT A;  5M3M J;  4ANJ A;  2OZ6 A;  2Z5U A;  4L0Z B;  2M4K A;  2V1X A;  1NK3 P;  2BXY A;  2ISZ A;  2NVQ J;  3K1P A;  1VFC A;  2O5R A;  2X6O A;  1N78 A;  3QU3 A;  4G6D A;  1U5T C;  2QSH X;  1U5T B;  3DWL E;  2R7X A;  5L3C A;  3BR1 A;  4AIH A;  2AO9 A;  1ZH5 A;  1P7J A;  5GAG J;  3ZOB A;  5JLW A;  4KIB A;  4PUS A;  2HYJ A;  2A68 F;  4IXA A;  4MGR A;  3IH4 A;  1B1B A;  1KGS A;  4BXU A;  4A5N A;  4E7L A;  4E7I A;  2LY9 A;  2E36 A;  4CDG A;  1T56 A;  1GVJ A;  3BPV A;  3DKX A;  2V6C A;  3G2B A;  3DBH B;  3LSG A;  1UG2 A;  1WJD A;  1T6S A;  4NC8 A;  4RAF A;  4XR6 A;  4ZZD A;  1D3Y A;  3FMS A;  4FTH A;  1ZRF A;  3KLO A;  2WAQ A;  3TO9 A;  1K78 B;  5D6E A;  3F21 A;  3ZQH A;  2EBI A;  2VL8 A;  4PFP A;  5E18 F;  4F91 B;  3S17 J;  1BOB A;  1NTC A;  2EH3 A;  3V7S A;  4KIG A;  2VJJ A;  2HYG D;  4ZDL A;  3BTL A;  2V26 A;  1O3T A;  2VLA A;  1R7J A;  1H8A C;  3OYA A;  3OS0 A;  3HGY A;  2BGC A;  3IAS 2;  1KU7 A;  4D5F A;  4U0V A;  3CD6 I;  5HLH A;  4S0H B;  4ESB A;  2ADU A;  5GP9 A;  3WG7 H;  1SMT A;  4XN0 A;  1X3U A;  3TP0 A;  3BDD A;  4L9J A;  1FYK A;  1T08 B;  3E1S A;  2EV5 A;  4XLF A;  3FK6 A;  2IJL A;  1O3Q A;  2JSP A;  2BW3 B;  1XGO A;  4IL6 C;  1T39 A;  3GTQ J;  2MC3 A;  3EUH C;  3QAH A;  4MTE A;  4HRI A;  3WU1 B;  4GYI A;  2VUM J;  1IG7 A;  4UUS B;  2XF6 A;  1FWZ A;  1XDU A;  1ZAO A;  1ON2 A;  2VQC A;  5E3M A;  2A61 A;  1R23 A;  3OL3 A;  2ZME C;  2G9W A;  1XMK A;  3U21 A;  2ZME B;  4I99 C;  3E5U A;  4N9H A;  2D1H A;  2DT6 A;  3K1M A;  2DYR H;  3Q9V A;  2MBF A;  4DQ2 A;  2AQF A;  1HW1 A;  1UB9 A;  3CCJ I;  3FXO A;  2XAG A;  5CVR A;  4DYC A;  1BM9 A;  2XF7 A;  2JA7 J;  3BPX A;  2RAE A;  4FE4 A;  2ELJ A;  3QOP A;  4O6J A;  1W1W E;  3TO6 A;  2FSW A;  2DMN A;  3K4N A;  3TDZ C;  3F6V A;  4MIM A;  3N97 A;  4ESF A;  5ILU A;  2IA1 A;  1QQI A;  1POG A;  5DUK A;  1I3Q J;  1HCR A;  3MFK A;  3F6O A;  1WJC A;  5JVT A;  4HV5 A;  1RRJ A;  3NWS A;  3ABL H;  1FSH A;  4PGG A;  4YIR X;  1H9T A;  2KP6 A;  5BS6 A;  2YX7 A;  3JRD A;  2O61 A;  5ICE A;  3PQJ A;  2Q1Z B;  3E97 A;  3MWM A;  4BEH B;  3DBL B;  2ID6 A;  4P5O A;  5LGN A;  2HNH A;  4U0Y A;  1Z7L A;  2ZSH B;  2P6T A;  1FYM A;  1REP C;  1ZGA A;  3Q0V A;  1FEX A;  3QYE A;  1XSV A;  2DW4 A;  3BG9 A;  4LIV A;  4L9V A;  2DOA A;  1WJ5 A;  4CYC A;  2ME6 A;  2NNY A;  5M3F J;  3FMQ A;  4CCN A;  1HOM A;  1IRF A;  1JUS A;  1WSU A;  1ITY A;  2D5V A;  4W97 A;  1LE8 A;  2XRO A;  4OIN F;  3P9I A;  1DUX C;  1X1P A;  1FTZ A;  4IQJ A;  4M3E A;  3L2R A;  1P9Q C;  1TW3 A;  1NK2 P;  1XG1 A;  1TZL A;  2P8T A;  2DMQ A;  2FBH A;  3L2V A;  4L5J A;  5DYM A;  3MKW B;  4EJU A;  2Y9Y A;  4HLX A;  2EIL H;  3ZN0 A;  4OIR F;  4ZJZ A;  2Z9O A;  2L02 A;  3V4G A;  2JWT A;  4C30 A;  2LOO A;  3E6D A;  5EZG A;  3GVA A;  2LBF B;  4A5M A;  2JA2 A;  2PJP A;  3HTU A;  3ABK H;  2ZJQ F;  3AAF A;  1HW2 A;  4G6T B;  1GLN A;  2DAO A;  3ZMV A;  1FLI A;  4HV6 A;  1X19 A;  1MBE A;  1YE9 A;  1ZYR F;  1FX7 A;  2KLO A;  3QRF F;  1T38 A;  2FBK A;  1V54 H;  3KPH A;  2LLK A;  3AG2 H;  4B48 A;  4MO7 A;  1OJL A;  1VQ6 I;  2NVT J;  1OPC A;  3LAJ A;  4Z6Y A;  1YI2 I;  1SVO A;  4HNU A;  5H6R A;  2DI3 A;  5J1U A;  4BXX J;  4JX6 A;  1EA3 A;  5KK1 A;  2PJR B;  4E6K G;  1F4K A;  1MDM B;  1V3F A;  3GF2 A;  2GIV A;  3CMM A;  2K27 A;  2CYY A;  1YW8 A;  1WCM J;  3ZMS A;  2A6E F;  1MIJ A;  4XKB A;  2IGO A;  2KFD A;  2Z99 A;  1EV7 A;  4FX0 A;  4J01 A;  1J2X A;  1U9O A;  4YIF A;  2M1B A;  3I56 I;  1MSE C;  3LAP A;  1IXS B;  1WH7 A;  1YX5 A;  2GA2 A;  3F72 A;  1U8B A;  4BUP A;  1MMG A;  2WV0 A;  3IRR A;  3OYJ A;  2FOW A;  3J80 Z;  2W00 A;  4IZZ A;  2OPT A;  1MMS A;  2XRL A;  3DLL F;  1U6G A;  3R0J A;  2MA3 A;  3C2G A;  4XMY A;  3WTU C;  2R3S A;  1TTY A;  2PLY A;  5KAI C;  3CP8 A;  4AYB A;  4GFB A;  3L09 A;  5L3F A;  3M8E A;  5L3G A;  2ZXW H;  3LFK A;  3CME I;  3PL8 A;  2XC7 A;  4IHX A;  4EQQ A;  3J7Z I;  1JKR C;  3DEU A;  2V9V A;  3ZXS A;  2JUC A;  3R60 A;  2E5Z A;  4UVC A;  3JAM Z;  2AXL A;  4CIC A;  3KP4 A;  2B63 J;  2MH9 A;  2EK5 A;  2IW5 A;  1FOK A;  2DBB A;  5E3N A;  2WAQ N;  4EJV A;  2CJJ A;  3GFJ A;  3MN2 A;  1SMY F;  4NUB A;  2GIZ A;  2QUF A;  4JOM A;  1S6L A;  1V4R A;  4JP0 A;  3FHN A;  4D0P A;  1IN4 A;  2DTZ A;  2QF7 A;  3CCE I;  3NAU A;  3IL2 A;  1FBQ A;  4UY8 I;  3O2P E;  3Q9S A;  3ZQC A;  3M3Y J;  4QIW N;  1XD7 A;  5EG0 A;  1HBX G;  1FBS A;  2Y0M A;  3MKL A;  3SFI A;  1BOA A;  1VND A;  2EIJ H;  1N25 A;  4GGG A;  2QM3 A;  4EM2 A;  2F5V A;  1CQT A;  1G6N A;  3PSI A;  5LD2 C;  1HSJ A;  1Y0N A;  2XGC A;  3OR1 C;  5CVU A;  2KIS A;  2GXB A;  2RGV A;  1OCP A;  2A5W A;  5D4R A;  2QCO A;  1J0R A;  2CO5 A;  3PJR A;  3ZMZ A;  2LTP A;  1ODD A;  1R58 A;  1R71 A;  1ZQ3 P;  3D5L A;  3HUG A;  3KFW X;  2XSD C;  1B59 A;  5D5X B;  1P4A A;  2EV6 A;  5FGM A;  3C2B A;  2XGD A;  4BHC A;  1W36 C;  2GM4 A;  3T8T A;  3S1Q J;  1SVM A;  2VPL A;  3RQ4 A;  3HL2 A;  3E3V A;  3Q0U A;  4WXD A;  4UVA A;  4J19 A;  2WV1 A;  4M3D A;  1G3S A;  3IRQ A;  5FKL A;  2RVC A;  5HDN A;  3W2W A;  3RKX A;  1OYW A;  3MVP A;  4D7N A;  2L01 A;  1DU0 A;  2K4J A;  3KEY A;  3PNT A;  3F22 A;  2MD5 A;  3IH2 A;  2QA4 I;  4DW6 A;  4WK8 F;  2E71 A;  3GTK J;  2M7A A;  1XN7 A;  1SFE A;  2IS6 A;  4ZDO A;  1QHH D;  3BZ6 A;  3LOC A;  1R4N B;  2Y0S A;  2X48 A;  5GTI C;  4V2G A;  3AG4 H;  3BG3 A;  3JAM K;  2JPB A;  5J47 A;  3C18 A;  1KQ9 A;  2DFI A;  1SFO J;  3Q5F A;  4U0W A;  4G8X A;  2EIK H;  1LQ1 A;  1LPQ A;  3PQK A;  2HDC A;  4RLF A;  4A3K J;  4HBL A;  1SFX A;  3ZQQ A;  5GAD J;  2P7V B;  4HDV A;  3GFI A;  3OMY A;  1T0F A;  4HZF A;  2DOD A;  4ZH4 F;  1A5J A;  2ZJR F;  1D0X A;  2E35 A;  2H94 A;  3DU6 A;  1MW7 A;  3TW7 A;  3U2R A;  2EFP A;  1HC8 A;  3OL4 A;  3OYN A;  2JRM A;  4F7Z A;  1TL8 A;  4W1U A;  4P9U A;  1SFK A;  2P5L C;  2KMU A;  5F0F A;  2PBI A;  3BP8 A;  3M1C A;  2A3S A;  1S7E A;  1X4O A;  3WE2 A;  2MH2 A;  1FBU A;  2Z2S B;  2PJR A;  2R5Y B;  4AVP A;  3U9G A;  4HEA 2;  4F3Q A;  3ZMT A;  4KDP A;  2L4M A;  3OV8 A;  3PIP F;  2LNB A;  2DPU A;  1JGS A;  4ZC3 A;  3MAJ A;  3C3W A;  3LST A;  3G1M A;  1O7L A;  3H36 A;  2TCT A;  1B72 A;  5C4X J;  1EH6 A;  3K4C A;  1T2K A;  3CC2 I;  3BJO A;  4CHU A;  4LLN A;  2PMU A;  5TJJ A;  5D8L B;  2DOE A;  3PNV A;  3ECO A;  1KZH A;  3ZGK A;  2J5O A;  4NC6 A;  3I64 A;  3O3K A;  4NHJ A;  2DA3 A;  1FNN A;  2OC6 A;  2EWN A;  4LMY A;  1B6A A;  3RSN A;  2NAZ A;  2QGU A;  2VJI A;  3A4C A;  3N4M A;  5IP7 J;  1FSE A;  3I71 A;  3GZN B;  2L54 A;  3GFL A;  3UKG A;  1LVK A;  3OYF A;  3V8K A;  1Z91 A;  1ZN2 A;  3BT9 A;  3L7W A;  3KYL A;  1Y56 A;  4AIJ A;  1PUE E;  5EYR A;  2EZI A;  4OU0 A;  2FOK A;  1VQP I;  3JRF A;  3GYH X;  2XHK A;  1WPK A;  1A35 A;  1ULY A;  2WY7 Q;  1T8I A;  4G12 A;  3FIW A;  1ZGJ A;  3MD2 A;  2IAI A;  3FXM A;  3GXO A;  3IP4 B;  3ML6 A;  2VBY A;  1HDP A;  3CO7 C;  3A02 A;  3CO6 C;  2BVM A;  3JRC A;  2COM A;  1KYZ A;  1J09 A;  3OSF A;  4AYB N;  2HQN A;  4YEL A;  4XRM A;  3HOX J;  1SD7 A;  4A3J J;  2HPM A;  4EGY A;  2MYS A;  5FLX Z;  2NOJ B;  4PDK A;  3E5Q A;  3H5A A;  2DA4 A;  1BJA A;  3HZJ A;  2JPC A;  2G0E A;  3HPH A;  1G3Y A;  4KJZ A;  1DGR M;  2MFZ A;  2RV8 A;  3RIR A;  4HNV A;  3ZMU A;  2V4J C;  2XAF A;  2LSO A;  2LF7 A;  4XBF A;  1TQI A;  1FIP A;  1WJE A;  5BQT A;  3PIO F;  3CJR B;  4KFC A;  3O8G A;  5HVQ C;  2JT1 A;  1R5I D;  2TRT A;  4B09 A;  4NQW A;  2A6T A;  4CZZ A;  4XLP F;  3BC8 A;  3HC7 A;  4DGW B;  5K5Q A;  3JRG A;  2VOP A;  4LK1 F;  2WA0 A;  4YII A;  5LRS A;  4XN3 A;  2M2E A;  1I39 A;  3KET A;  4IEJ A;  1O57 A;  1B9N A;  3OYI A;  5D6F A;  1Y0U A;  1FPQ A;  4Y3O A;  2VE9 A;  5D4S A;  4BY1 J;  1GVD A;  3BZC A;  4M6V A;  3F8F A;  3LA2 A;  1TP4 A;  2QQ8 A;  1FT9 A;  3W6K B;  5IP6 A;  1XGM A;  3PSF A;  4PJ0 C;  4XLC A;  2ACJ A;  4I0B A;  1YG2 A;  1IDY A;  1VQ9 I;  4XL9 A;  4LLL A;  2VXZ A;  5K7H A;  1Y39 A;  2JJ7 A;  5FFX A;  1XSD A;  5IT3 A;  2ZJ2 A;  4P96 A;  3V7C A;  1HDD C;  4IHW A;  2ZJP F;  4LK0 F;  4B3A A;  3CES A;  3LWF A;  4ZZL A;  3K4B A;  1JKQ C;  2RNG A;  4D9J A;  2KIF A;  3CCS I;  5ICG A;  2MAB A;  4HAM A;  4GYG A;  1RC9 A;  2BOL A;  1NG7 A;  1BC8 C;  2FQ4 A;  2ZSI B;  5BMZ A;  3BTI A;  2CFO A;  2L4A A;  3VWB A;  1BW5 A;  2M9H A;  5AON A;  4HF2 A;  4IX7 A;  2DA6 A;  2H1L A;  3OYB A;  3VDX A;  3FIS A;  3X2Q H;  3U1D A;  3ASO H;  3R4K A;  4NBQ A;  4BQA A;  2XGE A;  1JT0 A;  1OCT C;  2NS0 A;  3I5U A;  3D5S C;  3JW4 A;  1JJ6 C;  4XQF A;  2P7C B; 
#chains in the Genus database with same CATH homology
 2VN2 A;  4G6Q A;  2DTR A;  2FML A;  3E6M A;  3FM3 A;  1HQC A;  2PQ8 A;  2IVM A;  1D8K A;  4Q48 A;  1IF1 A;  1GHC A;  2P4W A;  1R5H A;  3D0S A;  3HYI A;  1Z6R A;  1BIB A;  3TKY A;  1YFH A;  3KP2 A;  2QWW A;  2TDX A;  4EGZ A;  1IZ1 A;  3WTT C;  2GAU A;  4MQ9 F;  4RAZ A;  2HGC A;  2PG4 A;  2QVO A;  4L5I A;  2O8X A;  2KIM A;  5JR3 A;  3QPH A;  1IXR C;  4EMS A;  5ICF A;  1P6R A;  1TBX A;  2QBY A;  1P4W A;  4LG0 B;  2HTS A;  1QNT A;  3TQN A;  2R7D A;  4UV8 A;  2XUB A;  4WXH A;  2W24 A;  3SQN A;  4MTD A;  2ZXJ A;  5IT9 K;  3FZV A;  4I09 A;  3ROU A;  2G7U A;  1F1Z A;  2OQR A;  4UV9 A;  2JZY A;  5J8C A;  2EFO A;  1U2W A;  4ON0 A;  3HRT A;  3ZMD A;  3P9C A;  3ZP5 A;  1I1S A;  4G7Z F;  1T98 A;  4A0Z A;  1W7P A;  1XMA A;  3WOD F;  4IHS A;  4YFX F;  2A5Y B;  3SHF A;  3HRS A;  1KU3 A;  5L3B A;  2F5F A;  1QZZ A;  3FM5 A;  5A2Q Z;  4N0B A;  2KJC A;  3SFZ A;  1OR7 A;  1I6X A;  4I7H A;  2F5D A;  3GW2 A;  2HR3 A;  3KP3 A;  1UHM A;  2AS5 F;  5DD4 A;  3T0Y A;  5CVV A;  5DV5 A;  3WTW C;  2FRH A;  1IN6 A;  2OA4 A;  4LJZ F;  2BBY A;  2FMY A;  2UZK A;  2RQP A;  1WQ2 A;  2J5P A;  4EM1 A;  3BWG A;  3TDU C;  1LEA A;  2Z33 A;  1OKR A;  4KIF A;  1P92 A;  1MJA A;  1KA8 A;  3CDH A;  2DQL A;  5BOX A;  5LEK A;  4L9T A;  1O3S A;  3IWF A;  3CTA A;  2EA2 A;  4HW0 A;  4R79 A;  4ASN A;  3IWZ A;  1RUO A;  1A04 A;  4CXF A;  1U3E M;  4HA8 A;  2Q2E A;  1G4D A;  1RIO H;  4O5V A;  2FNA A;  4IRH A;  3I53 A;  2HQR A;  2CFX A;  4PZJ A;  1BI1 A;  3HOS A;  3EQL F;  5E8I A;  3KEQ A;  2EV0 A;  4G94 A;  5F1R A;  2E1N A;  1XB4 A;  1JHH A;  3V8L A;  4ZYH A;  4RB3 C;  4U7D A;  3I58 A;  2HEO A;  5E17 F;  3DPT A;  4EM0 B;  2IP2 A;  5E1X A;  3ZQ7 A;  2Q8K A;  2H6C A;  1MJB A;  5LGT A;  1MD0 A;  1R5G A;  4ETS A;  4ENM A;  4LG0 A;  2MLG A;  1QBJ A;  4KN7 X;  3BOQ A;  4BHP A;  3WTX C;  2OZU A;  3ERE D;  2ISY A;  5FD6 A;  3HIF A;  3RKW A;  1DPR A;  4GCV A;  1BC7 C;  3PFI A;  4JQF A;  4CO8 A;  3IKT A;  2ETH A;  3DV8 A;  2F2E A;  3ZPL A;  2OD5 A;  1GXQ A;  2HKX A;  1RUN A;  3QP5 A;  1IXC A;  5L3D A;  3J81 Z;  2X0L A;  3I0T A;  1U8R A;  4A12 A;  2B0L A;  2EA4 A;  4PCQ A;  2RC4 A;  4P55 A;  1R1U A;  1E2X A;  1B9M A;  1P4X A;  1TNT A;  2FNP A;  1SD6 A;  1HKT A;  2K86 A;  3T8R A;  2GZW A;  5ERI A;  4UVB A;  1L3L A;  1S8N A;  2IRF G;  5E1Z B;  2FF4 A;  4RGX A;  3GO5 A;  3T5X A;  2Y48 A;  1WKM A;  1I1G A;  1W5S A;  2H6B A;  2EJR A;  3TGN A;  1GXP A;  3K69 A;  5CYV A;  4OMZ A;  2YU3 A;  2HTJ A;  3RDI A;  1Z9C A;  4KN4 X;  4R8H A;  4HF0 A;  1Z7U A;  3KCC A;  5D8K B;  5DCM A;  2ZCW A;  3JTG A;  1FP1 D;  5DDG A;  4WXC A;  1TNS A;  3EUH A;  3I4P A;  2GWR A;  1O7F A;  1R1T A;  1G3T A;  1XGN A;  1O3R A;  3KP5 A;  3JSO A;  2PI0 A;  3HRU A;  1Z05 A;  1K7A A;  2M87 A;  3QU6 A;  4KMU X;  1HW5 A;  1KQ0 A;  1S7O A;  3FXR A;  5FB2 A;  3ISP A;  3J80 K;  1CGP A;  1BI2 A;  2EFQ A;  5CVI A;  5DEQ A;  1AWC A;  1BIA A;  3K0L A;  4HF1 A;  3WU0 A;  4A6D A;  2HWV A;  1ZAR A;  3COA C;  4KT5 C;  1IUY A;  3I59 A;  3WGI A;  1WRJ A;  2ZBK A;  5J8F A;  4M72 A;  3KLN A;  1LDK B;  1W5T A;  2JRT A;  3BRO A;  2O3F A;  2LF8 A;  2UWM A;  3ZN1 A;  4E70 A;  1D8J A;  3H92 A;  2XKP A;  2XAH A;  2KIU A;  3KEO A;  2HS5 A;  5E1W A;  2FEZ A;  1EH7 A;  3DFG A;  5HDK A;  3KP7 A;  3GEZ A;  4OMY A;  2HZT A;  2OQG A;  2VC0 A;  1W4M A;  4FX4 A;  5LHH A;  2ELH A;  2YX4 A;  5BPD A;  3FHZ A;  5ILS A;  2O6G E;  5ED4 A;  4IF4 A;  3RKY A;  3LQQ A;  1ZRD A;  2CWE A;  2P5V A;  4UUV A;  2P6S A;  3OOP A;  5JHU A;  1H0M A;  2BV6 A;  1JXS A;  5LGU A;  1WWX A;  5JI6 A;  2QBY B;  2H27 A;  2P5K A;  4I01 A;  2VON A;  2ESN A;  2H09 A;  2OU2 A;  4EJW A;  4HOB A;  4S05 A;  3WTS C;  3E5X A;  1B4A A;  3H3U A;  3IHU A;  2W57 A;  5L3E A;  4FHT A;  3TO7 A;  2VC1 A;  1LVA A;  2VT2 A;  5FD5 A;  4KMF A;  1UHW A;  2W25 A;  2RKH A;  2QQA A;  1W7P B;  4Y15 A;  3VOE A;  3P7N A;  4MEX F;  2DQR A;  1YW7 A;  4EV0 A;  4M9Z A;  2A69 F;  1KU2 A;  2HYF A;  4RGU A;  1J5Y A;  1XCV A;  2EB7 A;  2NYX A;  3WTZ A;  4I98 B;  1FC3 A;  3CLO A;  4YG2 F;  3RYR A;  4KNY A;  2QZ8 A;  1RI7 A;  4EJT A;  3VFZ A;  2XKO A;  1KYW A;  1HKQ A;  5BPI A;  5LHI A;  3GZ5 A;  2OBP A;  2LKP A;  1ZG3 A;  3CUQ A;  5AIQ A;  3O6B B;  4P9F A;  4A0Y A;  3FF5 A;  4XLN F;  4RB2 C;  5DD8 A;  1LNW A;  3HHG A;  3DKW A;  1IN8 A;  4MHG A;  3F23 A;  2CW0 F;  2DK8 A;  2L3D A;  4EVI A;  2XGX A;  4M74 A;  4IVN A;  1G3W A;  1SD5 A;  1I5Z A;  2CGP A;  4RS8 A;  1ZLK A;  1LEB A;  3TOA A;  5FLX K;  3HSE A;  3S2W A;  4KIC A;  1ZRC A;  1DPU A;  2D45 A;  3FXQ A;  3GLX A;  3C1D A;  4IRI A;  3HSR A;  4ZYG A;  3FXU A;  2HOE A;  2DO7 A;  5J6X A;  4ENN A;  4IHT A;  1YYV A;  3GWZ A;  4LB5 A;  2GA1 A;  3B02 A;  2QEN A;  3P9K A;  2KRF A;  5E8G A;  3GZ6 A;  4R1H A;  2GXG A;  2LDU A;  4ZYD A;  4HX8 A;  3V7R A;  1IW7 F;  4FT8 A;  4OIQ F;  4WCG A;  5ILV A;  2FU4 A;  1NHA A;  1BI0 A;  1CF7 A;  4RB0 A;  2Z3Y A;  2FXA A;  2CQK A;  1L0O C;  3CUO A;  4PGH A;  4Q5S F;  2DT5 A;  2FA5 A;  1XDS A;  1YIO A;  2YR2 A;  3QP6 A;  2VBW A;  1TW2 A;  3BJA A;  1FP2 A;  2FQ3 A;  2ZFW A;  5F64 A;  5CVJ A;  1R00 A;  2EFW A;  3FMR A;  5LLQ A;  3DPL C;  4HQM A;  4YFK F;  2XIG A;  4M6Y A;  2JTV A;  3J7A O;  5K1Y A;  3FX3 A;  2O0Y A;  4A2U A;  1JE8 A;  4HQE A;  2ZNZ A;  1XSX A;  2JSC A;  3MCZ A;  1SAX A;  3K2Z A;  2A07 F;  3RPU A;  4QWQ A;  1OMI A;  1ON1 A;  4ESJ A;  3IKV A;  2R7F A;  2UXN A;  5HLI A;  4CYD A;  4OIO F;  5DCM B;  4OIP F;  3EYY A;  5HS8 A;  3LA7 A;  4HYE A;  1TQM A;  1YLF A;  5D5W B;  5KVR A;  2K7L A;  1MKM A;  2DLL A;  1BBY A;  4MNU A;  4K2E A;  4EJO A;  4ENK A;  2M45 A;  2E7X A;  4WF2 A;  4M9S A;  4ENJ A;  1HST A;  1E17 A;  3K1N A;  1TLH B;  4Q47 A;  1MGT A;  2E1C A;  2HKO A;  4WX9 A;  1FZP B;  1J59 A;  3I59 B;  3MZY A;  4LD5 A;  5A2Q K;  2CG4 A;  1YW9 A;  1ZG1 A;  1I27 A;  2HFH A;  2V1U A;  4RGS A;  4XSX F;  3BY6 A;  2W84 A;  3JTH A;  4HDU A;  3SZT A;  3KP6 A;  3R0A A;  3EYI A;  2D2W A;  5HOO A;  4AD9 A;  1QO0 D;  2KKO A;  4M73 A;  1MJ9 A;  4M9X A;  5E20 A;  4KA4 A;  3HSF A;  4G7O F;  2IA0 A;  3DQV C;  3DP7 A;  3CJN A;  2W85 A;  3RJP A;  1H9G A;  5D5V B;  2M30 A;  2XAJ A;  2D1V A;  4WWC A;  4UHT A;  1ZRE A;  1U5T A;  4JBA A;  2BEO A;  2DU9 A;  5HS9 A;  3V8J A;  4GO1 A;  1ZG5 A;  4LFU A;  4M71 A;  1KQ8 A;  2WC2 A;  1PP8 F;  3WE3 A;  3EDP A;  4QLC U;  1LJ9 A;  4UNO A;  5HS7 A;  3ABU A;  4YFN F;  1RZ4 A;  3K9T A;  2STW A;  1K78 A;  2XAS A;  4L9N A;  4RAY A;  5HLG A;  5DUI A;  3M7G A;  3MEX A;  3ULQ B;  4BYY A;  2C6Y A;  1ZLJ A;  3TOB A;  2BE5 F;  2DK5 A;  2M5W A;  3WGG A;  4IJA A;  3MQ0 A;  4KYW A;  1FY7 A;  3MZH A;  3HRM A;  2PN6 A;  4IPA A;  2PEX A;  3KZY A;  1HXD A;  3HHH A;  3L00 A;  1YO5 C;  2VBZ A;  1J7K A;  1IN5 A;  2O03 A;  2RDP A;  2QLZ A;  2NRA C;  6PAX A;  1LB2 A;  1UFM A;  1HKS A;  2G7H A;  1XCB A;  4RB1 A;  5JFR A;  2ZME A;  2K4B A;  3T1B A;  2F5C A;  4UXN A;  1K79 A;  1KU9 A;  3J81 K;  4M6X A;  3SXY A;  5K5R A;  2STT A;  2ZO4 A;  5EEG A;  3CUQ C;  3CUQ B;  3RTR A;  1QZY A;  1AOY A;  2RNJ A;  1ZHF A;  1Z1D A;  5ICC A;  4Z2Y A;  3M1E A;  3NRV A;  1BI3 A;  4XSZ F;  1WI9 A;  1RNL A;  1J9I A;  5CJ9 A;  4L18 B;  2XVC A;  2ZNY A;  1FYL A;  3F8B A;  3LA3 A;  1C0W A;  1IAW A;  1OYI A;  1R36 A;  1IN7 A;  4G9Y A;  4BNC A;  3GFM A;  1LDD A;  2F5E A;  4HX7 A;  1USS A;  2CSO A;  2ESH A;  5LHG A;  2KJB A;  2YPR A;  4ZYE A;  1W7P D;  2E7W A;  3L2C A;  2IPQ X;  3B73 A;  4LGW A;  3HOT A;  3RYP A;  2OAZ A;  4BAY A;  3EET A;  4Y17 A;  1QGP A;  1JHF A;  3F3X A;  4DNC A;  1R1V A;  2A6H F;  4IRG A;  1S7A A;  4CGZ A;  3WTY C;  2X4H A;  3WTV C;  5EEH A;  5H20 A;  1YTY A;  3C7J A;  2PFB A;  3NEU A;  2WTE A;  4S04 A;  2WWY A;  3GUD A;  1D5V A;  1MDM A;  1VTN C;  1R22 A;  4O3M A;  2Y75 A;  3BJ6 A;  1PDN C;  3JSP A;  5FFZ A;  4AWX B;  1P2F A;  5F6F A;  1CF7 B;  3F8M A;  5K5O A;  1YS6 A;  2VOD A;  4BH9 A;  1DDN A;  2PMH A;  3DF8 A;  3ECH A;  3SZP A;  1BN5 A;  2QQB A;  1DP7 P;  1UST A;  4JK1 X;  4HLY A;  3H3Z A;  1PP7 U;  2FE3 A;  3G3Z A;  2ZKZ A;  4A6E A;  2VT3 A;  4MEY F;  2Q0O A;  2K02 A;  1UCR A;  2XRN A;  1EH8 A;  2MLK A;  3REO A;  3GX4 X;  5HDG A;  3VOD A;  3DXJ F;  3L9F A;  5LBQ A;  4LLG F;  4KUM A;  5TRD A;  2YSR A;  3KZZ A;  1IRG A;  1K6O A;  2V1D A;  3HTS B;  1QPM A;  5D5U B;  2V79 A;  3LQR A;  3F8N A;  4LB6 B;  4I02 A;  4G7H F;  3RI4 A;  2QYO A;  4XRF A;  1Q1H A;  4NB5 A;  3WG9 A;  1J75 A;  1S29 A;  2XV4 S;  5FO5 A;  1XGS A;  2IT0 A;  3F8C A;  3M8F A;  5H6Q A;  4MQV A;  5AIP A;  1Z6T A;  4H0E A;  3VEP A;  1F4K A;  3W6J B;  4U88 A;  2GQQ A;  4L0Y B;  1SD4 A;  2NNN A;  3ABT A;  2VBX A;  5CLS A;  3E6C C;  5IT9 Z;  1S3J A;  3IC7 A;  4A0X A;  5LEJ A;  2RN7 A;  3I54 A;  3QPT A;  1TQP A;  3KE2 A;  4AIK A;  1STZ A;  4U7B A;  2QQ9 A;  1F9N A;  4HX4 A;  4B8X A;  1U78 A;  3R6S A;  2VOO A;  4BHB A;  2DPD A;  1ONV A;  3RPQ A;  1F5T A;  2IA2 A;  4TV7 A;  4N9I A;  3E6B A;  3ELK A;  4Q4Z F;  2EFN A;  2FBI A;  1YS7 A;  3VB2 A;  4OOI A;  4RGR A;  5LRR A;  3G73 A;  5DCF A;  2VE8 A;  4GXO A;  2XAQ A;  3R61 A;  4I2O A;  3FWE A;  2UXX A;  4I0A A;  1MZB A;  1SFU A;  4Y13 A;  1LDJ A;  2BYV E;  2M8E A;  1YQA A;  3M9A A;  3WGH A;  3NQO A;  1OYY A;  2OZ6 A;  2Z5U A;  4L0Z B;  2V1X A;  2ISZ A;  3K1P A;  3QU3 A;  4G6D A;  1U5T C;  1U5T B;  5L3C A;  4AIH A;  1ZH5 A;  4KIB A;  2A68 F;  4IXA A;  4MGR A;  1B1B A;  1KGS A;  4BXU A;  4A5N A;  4CDG A;  1GVJ A;  3BPV A;  2V6C A;  1T6S A;  4ZZD A;  1D3Y A;  3FMS A;  1ZRF A;  3KLO A;  3TO9 A;  1K78 B;  5D6E A;  3F21 A;  5E18 F;  3V7S A;  4KIG A;  2HYG D;  1O3T A;  1R7J A;  2BGC A;  1KU7 A;  4U0V A;  5HLH A;  4ESB A;  2ADU A;  1SMT A;  1X3U A;  3BDD A;  4L9J A;  1FYK A;  2EV5 A;  2IJL A;  1O3Q A;  1XGO A;  1T39 A;  2MC3 A;  3QAH A;  4MTE A;  3WU1 B;  4GYI A;  1FWZ A;  1XDU A;  1ZAO A;  1ON2 A;  2A61 A;  1R23 A;  2G9W A;  1XMK A;  2ZME B;  3E5U A;  4N9H A;  2D1H A;  3K1M A;  3Q9V A;  2MBF A;  4DQ2 A;  1HW1 A;  1UB9 A;  2XAG A;  5CVR A;  1BM9 A;  3BPX A;  3QOP A;  4O6J A;  3TO6 A;  2FSW A;  3TDZ C;  3F6V A;  3N97 A;  4ESF A;  5ILU A;  2IA1 A;  1QQI A;  5DUK A;  3MFK A;  3F6O A;  5JVT A;  4HV5 A;  1FSH A;  4PGG A;  1H9T A;  5BS6 A;  2YX7 A;  2O61 A;  5ICE A;  3PQJ A;  3E97 A;  3MWM A;  4P5O A;  5LGN A;  4U0Y A;  2P6T A;  1FYM A;  1REP C;  1ZGA A;  1XSV A;  2DW4 A;  4L9V A;  2NNY A;  3FMQ A;  1IRF A;  1WSU A;  2XRO A;  4OIN F;  3P9I A;  1DUX C;  1TW3 A;  2P8T A;  2FBH A;  4L5J A;  5DYM A;  4EJU A;  4HLX A;  3ZN0 A;  4OIR F;  2Z9O A;  2L02 A;  3V4G A;  3E6D A;  3GVA A;  4A5M A;  2PJP A;  3HTU A;  3AAF A;  1HW2 A;  2DAO A;  3ZMV A;  1FLI A;  4HV6 A;  1ZYR F;  1FX7 A;  3QRF F;  1T38 A;  2FBK A;  1OPC A;  3LAJ A;  5H6R A;  2DI3 A;  5KK1 A;  1MDM B;  1V3F A;  3GF2 A;  2GIV A;  2K27 A;  2CYY A;  1YW8 A;  3ZMS A;  2A6E F;  2Z99 A;  1EV7 A;  4FX0 A;  1J2X A;  4YIF A;  2M1B A;  3LAP A;  1IXS B;  2GA2 A;  3F72 A;  2WV0 A;  3IRR A;  3J80 Z;  1U6G A;  3R0J A;  2MA3 A;  3WTU C;  2R3S A;  1TTY A;  2PLY A;  3L09 A;  5L3F A;  3M8E A;  5L3G A;  3LFK A;  4EQQ A;  3DEU A;  2V9V A;  3R60 A;  4UVC A;  3JAM Z;  2AXL A;  4CIC A;  3KP4 A;  2MH9 A;  2EK5 A;  2IW5 A;  1FOK A;  2DBB A;  4EJV A;  3GFJ A;  1SMY F;  2QUF A;  1S6L A;  1V4R A;  4D0P A;  1IN4 A;  3IL2 A;  1FBQ A;  3O2P E;  3Q9S A;  1XD7 A;  1HBX G;  1FBS A;  2Y0M A;  1BOA A;  4GGG A;  2QM3 A;  4EM2 A;  1G6N A;  1HSJ A;  5CVU A;  2GXB A;  2RGV A;  5D4R A;  1J0R A;  2CO5 A;  3ZMZ A;  1ODD A;  1R58 A;  3D5L A;  3HUG A;  3KFW X;  1B59 A;  5D5X B;  1P4A A;  2EV6 A;  5FGM A;  4BHC A;  3T8T A;  3E3V A;  4WXD A;  4UVA A;  1G3S A;  3IRQ A;  5HDN A;  2RVC A;  3RKX A;  1OYW A;  2L01 A;  2K4J A;  3F22 A;  2MD5 A;  4WK8 F;  1XN7 A;  1SFE A;  3BZ6 A;  3JAM K;  2JPB A;  3C18 A;  1KQ9 A;  2DFI A;  3Q5F A;  4U0W A;  4G8X A;  1LQ1 A;  2HDC A;  3PQK A;  4HBL A;  1SFX A;  2P7V B;  4HDV A;  3GFI A;  1T0F A;  4HZF A;  4ZH4 F;  2H94 A;  3U2R A;  2EFP A;  4F7Z A;  4P9U A;  2P5L C;  2PBI A;  3BP8 A;  2A3S A;  3WE2 A;  2MH2 A;  1FBU A;  4AVP A;  3U9G A;  3ZMT A;  4KDP A;  2L4M A;  3OV8 A;  2LNB A;  2DPU A;  1JGS A;  3MAJ A;  3C3W A;  3LST A;  1O7L A;  1EH6 A;  1T2K A;  3BJO A;  4CHU A;  4LLN A;  2PMU A;  5TJJ A;  5D8L B;  3ECO A;  2J5O A;  3I64 A;  3O3K A;  4NHJ A;  1FNN A;  2EWN A;  4LMY A;  1B6A A;  2NAZ A;  3N4M A;  1FSE A;  3I71 A;  2L54 A;  3GFL A;  3V8K A;  1Z91 A;  1ZN2 A;  3L7W A;  4AIJ A;  1PUE E;  4OU0 A;  2FOK A;  3GYH X;  2XHK A;  1ULY A;  1ZGJ A;  3GXO A;  3ML6 A;  2VBY A;  3CO7 C;  3CO6 C;  2COM A;  1KYZ A;  2HQN A;  1SD7 A;  4EGY A;  5FLX Z;  4PDK A;  3E5Q A;  1BJA A;  2JPC A;  3RIR A;  1G3Y A;  2RV8 A;  3ZMU A;  2XAF A;  2LSO A;  2LF7 A;  4XBF A;  1TQI A;  5BQT A;  4KFC A;  5HVQ C;  2JT1 A;  4B09 A;  4NQW A;  4CZZ A;  4XLP F;  5K5Q A;  2VOP A;  4LK1 F;  4YII A;  5LRS A;  3KET A;  1O57 A;  1B9N A;  5D6F A;  1Y0U A;  1FPQ A;  2VE9 A;  5D4S A;  3F8F A;  3LA2 A;  1FT9 A;  3W6K B;  1XGM A;  2ACJ A;  4I0B A;  1YG2 A;  4LLL A;  2VXZ A;  5FFX A;  1XSD A;  5IT3 A;  2ZJ2 A;  4P96 A;  3V7C A;  4LK0 F;  3LWF A;  4ZZL A;  2KIF A;  5ICG A;  4HAM A;  4GYG A;  1BC8 C;  5BMZ A;  2L4A A;  5AON A;  4HF2 A;  3U1D A;  3R4K A;  4BQA A;  2NS0 A;  3I5U A;  3JW4 A;  2P7C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...