2MH9A

Resonance assignment of rqc domain of human bloom syndrome protein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
127
structure length
127
Chain Sequence
CKTKDYKTRDVTDDVKSIVRFVQEHSSSQGMRNIKHVGPSGRFTMNMLVDIFLGSKSAKIQSGIFGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQAIAYVMLGNKAQTVLNGNLKVDFMETE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Bloom syndrome protein
publication title Solution structure of the RecQ C-terminal domain of human Bloom syndrome protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 127
sequence length 127
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09382 RQC RQC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2mh9A00
2CG4A 3RPQA 1U8RA 1GXQA 1RZ4A 1S7OA 4DQ2A 3L2CA 4G7ZF 2KRFA 3CUQB 1J2XA 2L02A 2DK8A 3PQJA 4S05A 1KGSA 2M87A 2ELHA 5CJ9A 3FZVA 3KP6A 3VOEA 2Z5UA 2MLKA 5F1RA 1ZRFA 4HA8A 2O03A 2RC4A 3NQOA 3L7WA 3KP3A 4M9SA 5HDGA 1VTNC 2Z3YA 2M8EA 4Y15A 1LEAA 3RI4A 5E8GA 3ZMZA 2W25A 2V9VA 4GXOA 4MEXF 3CUOA 4PGGA 1GXPA 2WTEA 3C18A 2IA1A 4TV7A 2P5KA 1WWXA 1TQIA 2XRNA 5FD5A 4G7OF 1IRGA 3WTSC 3CDHA 2MH2A 3TO7A 4S04A 3DEUA 3RDIA 2Z33A 1FNNA 4M9XA 1MJAA 2DAOA 4LGWA 3NEUA 4MNUA 2J5PA 4I01A 4MEYF 4IHSA 3SQNA 5CLSA 3FWEA 4OIOF 5D4RA 4I2OA 2K27A 3KZZA 4IPAA 3DQVC 4KN7X 5HVQC 1BIBA 3T8RA 3HSEA 2CFXA 5DCMA 4UNOA 2P7VB 3P7NA 1ZH5A 2QENA 3BY6A 4MTDA 4MQVA 2E1NA 2GXBA 1W5SA 2YPRA 4LJZF 1D8JA 2MA3A 1G3YA 1XDSA 2F5FA 3KCCA 2PJPA 3EYYA 4R79A 3RTRA 4LK1F 2O0YA 2JTVA 2L54A 2Q2EA 3J7AO 4HX7A 3KLNA 5CVJA 5JI6A 1YQAA 1W7PA 2GA1A 4NHJA 4CZZA 4ENKA 4U0YA 4IRHA 1LJ9A 4JK1X 1FZPB 2XAJA 1XB4A 5LRSA 5HOOA 2A3SA 2XHKA 3LA3A 4ZYGA 1S29A 3ELKA 2PMHA 1YLFA 2K7LA 1PP7U 2DPUA 3P9IA 3MEXA 3F3XA 2KJCA 4G6DA 5A2QK 1K6OA 3KEOA 1LDJA 4U7BA 1UFMA 4LG0A 1XN7A 2PG4A 3ZN1A 4GO1A 5D5WB 4B8XA 1EH8A 3DV8A 1YFHA 1ZG1A 3QP5A 3WTZA 4F7ZA 1PUEE 5D5UB 1DPRA 3GF2A 3F6VA 1S3JA 2HKOA 3J81K 2V1DA 5BPIA 4EV0A 5DYMA 2HGCA 1IXSB 3BPVA 1F9NA 1ZG3A 2QUFA 2OU2A 4ZZDA 1WQ2A 2KIUA 2GAUA 1XCBA 2XVCA 3E97A 4ON0A 3GLXA 4OMZA 3MAJA 3JSOA 1H9TA 2CGPA 2QQBA 4G6QA 1WRJA 1DUXC 2HR3A 4XRFA 2VOPA 1HW2A 2FOKA 4RB1A 1CF7B 1FP1D 1J9IA 1SFXA 5ERIA 1IN8A 1HKQA 4HQEA 1ZRDA 5DCMB 1T38A 3D5LA 4EJTA 4HW0A 2IJLA 4I7HA 3T0YA 3GFJA 3FXRA 4I0AA 4ZYEA 1BOAA 2RVCA 1ZRCA 4XBFA 3VFZA 4EVIA 2ADUA 3HSFA 2FEZA 5L3GA 1O3RA 4OINF 2QQAA 1MGTA 5D5XB 3K2ZA 2HOEA 3K1PA 4UHTA 1R7JA 2PBIA 3ZMSA 1KU3A 1W7PB 1XGNA 2FE3A 2O61A 2FNAA 3DFGA 5LHIA 2UZKA 1FP2A 2OQGA 1RUOA 4U7DA 3WTTC 1ZGAA 3MZHA 3ABUA 4KIGA 2XAGA 2VONA 1P92A 4CGZA 1T6SA 3T5XA 2G7UA 3ZMDA 2LDUA 2JRTA 3O2PE 3EUHA 4MQ9F 2MH9A 4RS8A 5F6FA 3P9CA 4UXNA 1FYKA 5DV5A 3ML6A 5JHUA 4YFNF 4LG0B 1OYYA 5HS9A 4EJUA 2XROA 4HV5A 1HW1A 2YX4A 2W84A 1D8KA 1YW9A 3NRVA 1Q1HA 3M8FA 1Z91A 4UVCA 3N97A 1T98A 2HZTA 1IAWA 1ZN2A 5KK1A 2UXXA 1U6GA 3WG9A 1FBSA 5HDNA 1LDKB 1KU7A 3WODF 2H6BA 3T1BA 1QGPA 1P2FA 5AONA 3DXJF 5FFXA 3BZ6A 2QM3A 4KMFA 1FYLA 2EA4A 2Z99A 2A07F 4HF0A 4YIIA 3TDUC 4P9FA 4KIFA 2BV6A 1KA8A 2K4BA 1YW7A 2NRAC 2GA2A 5DD8A 1BIAA 1RIOH 5CVIA 1QNTA 3WTYC 2STTA 2AXLA 4CHUA 2AS5F 3V7CA 3QU6A 4BHBA 4D0PA 2COMA 3H92A 4YG2F 3D0SA 2UWMA 1ZG5A 3F21A 2HTSA 1YTYA 1TW2A 2ACJA 2P7CB 3TDZC 3KFWX 3WE2A 5J6XA 5ICEA 1LQ1A 4G94A 1K78B 5FB2A 3HHGA 5BOXA 3R6SA 3BJOA 4P5OA 1AOYA 4M6YA 1U78A 4N0BA 3ZN0A 2DO7A 1SMYF 4AIKA 1S7AA 4BQAA 1D3YA 5LBQA 4IRIA 2V79A 4NQWA 1R5GA 5IT3A 3QPHA 4HDUA 2L3DA 5F64A 2RGVA 2ESHA 2O3FA 2OQRA 3TO9A 2M30A 3TOAA 4Y13A 1KQ8A 4HX8A 1IF1A 5K1YA 1BC7C 4IVNA 1XGOA 3Q9VA 1U2WA 2M5WA 3GYHX 1Z9CA 4Y17A 5FLXK 2FU4A 5DUKA 4AD9A 4G8XA 3COAC 1IZ1A 1FSEA 4AIHA 3WTXC 1ZARA 2ZNYA 4GGGA 1R36A 3RYPA 2GXGA 3E5XA 1WSUA 5AIPA 1OR7A 4M9ZA 2EFNA 2PLYA 1B59A 3W6JB 4U88A 2ZMEA 3MZYA 5D4SA 4ZZLA 3RPUA 4OIQF 3ECOA 2EFPA 1YS7A 5DCFA 3M7GA 1G3SA 1UCRA 2QLZA 2P8TA 4LMYA 5A2QZ 1FWZA 3E6CC 3DF8A 2BBYA 4FX0A 4XLPF 2VBXA 3LQQA 5BMZA 2NYXA 3RIRA 1QQIA 1USSA 4R1HA 5J8FA 1HSJA 1XDUA 1HBXG 3C3WA 1P4WA 5E18F 3CO7C 3V4GA 1C0WA 4N9IA 4ETSA 4HLYA 2DQLA 2EA2A 2P5LC 2BEOA 2J5OA 1W7PD 3BOQA 3J81Z 3I5UA 1Z7UA 3FMSA 3R60A 1QO0D 5D6EA 2HYGD 1MD0A 4A5MA 4BNCA 3CTAA 2V1UA 5ICCA 4Q5SF 2K4JA 2VT2A 1HW5A 1SD7A 1R1TA 3M9AA 5LHGA 2OA4A 2EFOA 2XIGA 3E5QA 3OOPA 5H20A 2X0LA 1TTYA 4BH9A 4EM1A 2XKOA 3F23A 5ILVA 3PQKA 1LEBA 1HSTA 4KA4A 3F22A 1WI9A 3RKXA 3B73A 3MWMA 3F6OA 3ZPLA 3GFMA 1IRFA 4B09A 2DQRA 2MBFA 2CW0F 2YSRA 2MC3A 1BBYA 1I5ZA 4R8HA 2LF7A 1QZYA 6PAXA 3BWGA 3H3UA 1Z05A 4ESBA 3ZQ7A 3WU1B 3GEZA 3V8JA 3JAMK 3ULQB 2ZXJA 1FPQA 1NHAA 4KT5C 2ZKZA 1FBUA 4P96A 1SD5A 3MFKA 3REOA 3K1NA 5CYVA 1XMKA 1RI7A 1MZBA 3DP7A 2VE8A 4L0YB 2YU3A 2GQQA 4QWQA 3IKTA 4KFCA 1FC3A 3ISPA 4ESFA 4ZH4F 2FNPA 1HQCA 2PEXA 1W5TA 3WTUC 3HRMA 4U0VA 2F5EA 2RNJA 1XSXA 4YIFA 3JTHA 2CWEA 4FHTA 4RAYA 2QZ8A 3HTUA 4ZYHA 3R4KA 5HLHA 1R22A 2PN6A 4EJOA 2F5DA 4RGRA 4CXFA 1O7LA 1HKSA 5FFZA 3WGIA 4HX4A 2P6TA 2VODA 5L3EA 2IP2A 2DTRA 4HZFA 3ZMTA 5DUIA 3KP4A 4O3MA 5CVVA 1DPUA 3L09A 1XCVA 3LAPA 3GFLA 2W57A 2XV4S 4KMUX 4IRGA 2PMUA 3F72A 3V7RA 4M72A 5BS6A 1SFEA 3ROUA 2RV8A 4ENJA 1OKRA 2D1HA 1XD7A 3L00A 2IT0A 5CVRA 1Y0UA 3I53A 4RGSA 4XLNF 3M8EA 2XASA 2F2EA 2EK5A 1IW7F 2P5VA 1USTA 2VC0A 4PDKA 1ZREA 4LFUA 1JE8A 2IPQX 3V8LA 2XGXA 2XUBA 1OYWA 3WGGA 3FMQA 4OMYA 3VB2A 4CYDA 2M45A 3H3ZA 1O57A 1IN7A 4HYEA 2ZJ2A 1KYWA 2C6YA 4BYYA 5HS8A 2ZFWA 1O3SA 3F8NA 5E8IA 5K5RA 1IUYA 2M1BA 2H6CA 2ZO4A 2MD5A 1BI3A 1Z1DA 3IHUA 3QPTA 3WGHA 2VE9A 2B0LA 2Y0MA 3P9KA 2P6SA 3WE3A 3KP2A 1IN6A 2KJBA 3QAHA 1E17A 4KDPA 2VC1A 1BC8C 3HHHA 2EJRA 3CO6C 2QBYA 3K0LA 3FM3A 3U2RA 4BXUA 3FXUA 1YW8A 5TRDA 3I58A 3GX4X 5LRRA 2PI0A 4N9HA 4HF1A 4L9TA 3GVAA 5EEGA 3IWZA 3LQRA 3EYIA 1H9GA 2Z9OA 2F5CA 4YFXF 3BROA 5D8LB 3Q5FA 1A04A 3JTGA 5IT9K 5FLXZ 4GYIA 4OIPF 1R1UA 4WCGA 5AIQA 5LGNA 3KP5A 4UUVA 3FF5A 3S2WA 1EV7A 1B1BA 5HS7A 4KN4X 3CUQA 1U3EM 3DPLC 5E20A 1GHCA 2HQNA 3BJ6A 4HLXA 1LNWA 4I09A 1JGSA 2E1CA 4IHTA 1ZLKA 2FXAA 3F8MA 1G3WA 3LSTA 1ZYRF 3GO5A 2D45A 3M1EA 2HS5A 2STWA 5LHHA 2IW5A 3SHFA 4EJVA 2K02A 3SXYA 3U1DA 3RKYA 2K86A 1FSHA 1UHWA 1KU2A 3R61A 2VXZA 2G9WA 3V7SA 2DT5A 1O3TA 2WWYA 2ESNA 2JPBA 2HDCA 4LB6B 4K2EA 4I02A 5E17F 1S6LA 1YYVA 1BI0A 1DP7P 2XAHA 2D2WA 4P55A 1XSDA 1S8NA 3LA7A 1T2KA 3IL2A 3GZ5A 3F8FA 4GCVA 5L3FA 2KIMA 1OPCA 1R58A 5BQTA 3ABTA 1R00A 1B6AA 1B9NA 3BJAA 4EGZA 4KIBA 1BI2A 2RDPA 2QQ9A 1EH7A 3LA2A 4M6XA 2DFIA 4RAZA 1H0MA 1STZA 2P4WA 4EMSA 2ETHA 3E5UA 3FM5A 5L3DA 5E1XA 5DDGA 2E7XA 3HUGA 2HFHA 1DDNA 1HXDA 1I27A 4I0BA 2HTJA 3KEQA 2VOOA 2ISYA 4MTEA 2EWNA 2MLGA 4FT8A 3I0TA 1LVAA 3LAJA 3CJNA 2NNYA 2XKPA 2DLLA 1ON1A 4HAMA 3HOSA 2O8XA 3FHZA 3Q9SA 3LWFA 4PGHA 1BM9A 2QVOA 2Y75A 4AIJA 2DK5A 4WX9A 2JZYA 1ONVA 1V4RA 4PCQA 4O5VA 4JBAA 2Q8KA 5JR3A 2ZBKA 2DW4A 1REPC 2W24A 3ZP5A 4WF2A 4LD5A 3DPTA 5L3BA 5TJJA 2FSWA 5ICFA 3CLOA 1RUNA 3TGNA 3BP8A 1YG2A 1Z6TA 2LF8A 1R1VA 3WTVC 1IXCA 4WWCA 3WTWC 1TQMA 3FX3A 4NB5A 1YIOA 5ICGA 4L9VA 1B4AA 1TNTA 3ERED 1U5TA 4EGYA 4BAYA 4Q47A 3KLOA 3PFIA 3QP6A 1FLIA 1XSVA 4MGRA 5DD4A 4Q4ZF 4HBLA 2W85A 5LLQA 1G6NA 5HDKA 1KU9A 1V3FA 1SFUA 4L0ZB 1ZHFA 3ECHA 5LGTA 2A69F 1HKTA 4A6EA 2WC2A 3B02A 4MHGA 3BDDA 3EDPA 2H27A 2KKOA 4KYWA 4E70A 4BHCA 2FA5A 2GWRA 2GZWA 4CO8A 3R0JA 2WV0A 2YR2A 5H6QA 5JFRA 3K69A 4HV6A 3ZMVA 2FBIA 1YO5C 2IVMA 2CSOA 1CGPA 2EV0A 2JT1A 3J80K 1JXSA 4G9YA 3K9TA 2Y48A 1I6XA 4DNCA 1CF7A 2X4HA 4ESJA 1FYMA 3FMRA 3AAFA 1SD6A 2XAFA 1E2XA 3WU0A 2YX7A 2V6CA 1OYIA 1G4DA 3I59A 3HRTA 1MKMA 4AWXB 2OAZA 2LSOA 5FD6A 2HEOA 3IWFA 3LFKA 3GZ6A 1UHMA 2CYYA 3RJPA 4M71A 1X3UA 2DI3A 4A12A 4LLNA 1Z6RA 2RQPA 2XAQA 2RKHA 3VEPA 3E6DA 1QBJA 3F8CA 4WXCA 2PFBA 2TDXA 4FX4A 3HIFA 3I71A 2E7WA 1XGSA 4ENMA 5K5OA 3TOBA 5ED4A 1TNSA 3TKYA 4IF4A 2FMYA 4ENNA 1ULYA 3GFIA 4OOIA 5EEHA 3HRUA 3RYRA 5HLIA 1SD4A 2ZMEB 3GXOA 4Q48A 4LK0F 4U0WA 1W4MA 4M74A 2BGCA 3KZYA 2R7FA 4M73A 2IA2A 2BYVE 3ZMUA 1RNLA 1T39A 4WXHA 3TO6A 4HF2A 1FT9A 2EFQA 5IT9Z 1K7AA 1U5TB 2HQRA 3IC7A 3V8KA 4CICA 3KETA 1ODDA 2L4AA 2D1VA 2CQKA 4I98B 4A5NA 1BN5A 2EV5A 2R3SA 2CO5A 5FO5A 1OMIA 3CUQC 1G3TA 3KE2A 4A0YA 2LKPA 1I1GA 2DBBA 2L4MA 1P4XA 4RB3C 1QZZA 1KYZA 3EETA 4ZYDA 1J75A 5LGUA 2A6EF 3QU3A 4LLGF 1J5YA 4EQQA 2PQ8A 2GIVA 4EM2A 3E6MA 3O6BB 3KP7A 4L18B 1ON2A 1D5VA 5KVRA 5E1ZB 1JHHA 3O3KA 4L5JA 4Z2YA 4HDVA 3DKWA 2BE5F 3E6BA 3OV8A 4CDGA 1T0FA 1KQ9A 5J8CA 4XSXF 1SAXA 5CVUA 3HOTA 1WKMA 1GVJA 1PDNC 4IJAA 4UVBA 1IN4A 1L0OC 3QRFF 2R7DA 3I59B 3IRRA 1TLHB 3HYIA 1F4KA 2ZCWA 1XGMA 5ILUA 3L9FA 3GWZA 4RGUA 1JHFA 3JSPA 3G73A 2DU9A 2HYFA 1K78A 2V1XA 5D8KB 3C7JA 2G7HA 4EM0B 1P6RA 5L3CA 1KQ0A 5DEQA 2OZ6A 1FY7A 1TQPA 2VT3A 2NAZA 2UXNA 1J7KA 4L9NA 2OZUA 1P4AA 2FRHA 4EJWA 2NS0A 3SZTA 3G3ZA 1MDMA 3C1DA 1J59A 4L5IA 3RKWA 2IRFG 4A0ZA 3N4MA 3JW4A 1B9MA 4O6JA 2VBZA 2A61A 3HTSB 2H09A 5FGMA 2FF4A 5D6FA 3U9GA 3GUDA 1TBXA 4KICA 4HOBA 4KNYA 1R23A 3E3VA 1FX7A 4LB5A 2EFWA 2A6HF 3BPXA 1I1SA 3T8TA 3W6KB 1LDDA 3VODA 3HRSA 1UB9A 4BHPA 5E1WA 3F8BA 4AVPA 2Q0OA 2A68F 4YFKF 3K1MA 1XMAA 2QYOA 4UVAA 1ZLJA 1U5TC 5H6RA 3SZPA 4RB0A 4HQMA 1F1ZA 2RN7A 2H94A 4A6DA 5D5VB 5BPDA 1FBQA 5LEJA 2QWWA 1SMTA 2VBWA 4G7HF 1O7FA 4A2UA 1FOKA 3I4PA 4A0XA 3FXQA 5ILSA 1EH6A 3EQLF 2FBHA 3SFZA 4H0EA 1ZGJA 2HWVA 1QPMA 3MCZA 4WK8F 4RB2C 3MQ0A 4ASNA 2HKXA 2OBPA 1BI1A 1IN5A 2IA0A 4WXDA 3J80Z 3HSRA 1YS6A 4OU0A 1PP8F 2NNNA 5LEKA 2LNBA 3I54A 1K79A 4KUMA 2O6GE 3QOPA 1L3LA 2FQ3A 4XSZF 2JPCA 2KIFA 1J0RA 4UV8A 3IKVA 1TW3A 2QBYB 4JQFA 3I64A 4UV9A 4GYGA 2EV6A 2ISZA 3IRQA 4QLCU 2JSCA 2L01A 3GW2A 4P9UA 4RGXA 5K5QA 1ZAOA 2A5YB 4IXAA 1F5TA 4OIRF 2OD5A 1IXRC 1MJ9A 4PZJA 1R5HA 4L9JA 3JAMZ 2VN2A 2ZNZA 1O3QA 2FBKA 1MDMB 3R0AA 2FMLA 3TQNA 4LLLA 2VBYA 1MJBA 5HLGA 1BJAA 1LB2A 2EB7A 1AWCA 5JVTA 2DPDA
chains in the Genus database with same CATH superfamily
4IO9F 2X6YA 2CG4A 1JTXA 1NG7A 2WB1N 3RPQA 3VYSB 4AUXA 4OWRB 1U8RA 2DT6A 1GXQA 1RZ4A 1S7OA 4DQ2A 3L2CA 4G7ZF 2KRFA 5KHDA 3A1YA 5J1UA 3CUQB 4BS9A 1J2XA 2M0CA 1ETXA 3FK6A 2L02A 4EATA 2DK8A 3PQJA 4BEHA 1MIJA 3ZQHA 3CF5F 2JA8J 4S05A 1KGSA 1TZLA 2ELHA 2M87A 1Z77A 3BR2A 4JX4A 1WZ2A 1AKHB 5CJ9A 3IUOA 1VQOI 1POGA 2TCTA 2XSDC 3HOUJ 3FZVA 3KP6A 3VOEA 2KL4A 3OS0A 1YRNA 5FRMA 2Z5UA 2MLKA 2X1DA 5F1RA 1ZRFA 1KONA 4HA8A 2O03A 1UZCA 2RC4A 2XPUA 4UUTA 3PIPF 1AA7A 2H8WA 3MD2A 3NQOA 2R7SA 1F43A 3L7WA 3KP3A 4M9SA 5HDGA 2MFZA 4II2A 1VTNC 2Z3YA 2M8EA 4Y15A 1LEAA 3IP4B 2NS8A 3RI4A 5E8GA 3ZMZA 2W25A 2DMQA 2K9LA 2V9VA 2Y31A 2XDVA 4X0GA 4GXOA 4MEXF 4XLEA 1SFOJ 3CUOA 4PGGA 3WHBA 4MFDA 1GXPA 2Q1ZB 1MBEA 2WTEA 3C18A 2IA1A 2E1OA 4TV7A 3CC7I 2P5KA 1WWXA 3CJQB 1VQLI 4XOTA 1TQIA 4GFBA 4NC7A 2XRNA 2OTLI 5FD5A 3SYTA 1I39A 2GOMA 4G7OF 1IRGA 2LYCA 2KHMA 3WTSC 1RR7A 4E6KG 2BVLA 3CDHA 3GTGJ 1VI0A 2MH2A 3TO7A 4S04A 1K61A 3AKZA 3DEUA 3RDIA 2LK2A 3UKGA 4J19A 2Z33A 4A69C 3CESA 1FNNA 4M9XA 4A93J 5FKKA 1MJAA 2DAOA 4LGWA 3NEUA 4MNUA 3S1QJ 1ZK8A 2EINH 2J5PA 4XICA 1HOMA 4I01A 3HZJA 4MEYF 4IHSA 3SQNA 5CLSA 4CCKA 2DA4A 1JUPA 3FWEA 1SVOA 3ZQQA 2XPVA 5F08A 4OIOF 3BG7A 5D4RA 3AFHA 3K4MA 4I2OA 4J01A 1SC7A 2K27A 2DYRH 3KZZA 4IPAA 2IGMA 4XKCA 2FX0A 3DQVC 4KN7X 4A3MJ 5HVQC 1BIBA 3T8RA 3HSEA 2CFXA 5GTHC 5DCMA 4UNOA 4AVZA 2P7VB 5E3MA 3P7NA 1ZH5A 2QENA 3N05A 1JTYA 1VQKI 4CYCA 3BY6A 3BQZA 2F5VA 2IS1A 2B9SA 4MTDA 5EJCA 4BUPA 4MQVA 2PMZA 2E1NA 2X6WA 2LBFB 2BXZA 2GXBA 1W5SA 2YPRA 4LJZF 1RKTA 1D8JA 4CCMA 4PJJA 3A01A 3HUGB 4ANJA 2WV1A 2MA3A 1G3YA 2Z16A 1XDSA 2F5FA 3KCCA 5FROA 2K3PA 4E7SA 2HVQA 2PJPA 5IPAA 1LE8A 4S0HB 3EYYA 2CW7A 1U8BA 4R79A 3RTRA 1UELB 3S32A 2LREA 2Y9YA 4XMYA 3CC4I 4LK1F 4D9JA 3I56I 1NH3A 1XPXA 2O0YA 1B72A 1WFXA 2JTVA 2L54A 2L7ZA 4JX5A 2E1MC 2Q2EA 3J7AO 2NXNB 3BLYA 4HX7A 3H9GA 3KLNA 3U1KA 5CVJA 5JI6A 3L2UA 1YQAA 1W7PA 2GA1A 4RDUA 4NHJA 4CZZA 4P1WA 5FKMA 4ENKA 4U0YA 4ZC3A 1XMXA 4JOMA 4IRHA 1ETVA 4XLAA 1LJ9A 4JK1X 1FZPB 2QQ8A 2XAJA 1XB4A 3HGYA 5LRSA 4A3EJ 3K70D 5HOOA 3GTMJ 2A3SA 2BY1A 2XHKA 3LA3A 2BVMA 4ZYGA 1S29A 3O8HA 5TGTA 3ELKA 3DCFA 4LIUA 2CJJA 2PMHA 1MBKA 1YLFA 1HDPA 4C2MJ 2K7LA 1PP7U 2DPUA 3P9IA 3MEXA 3WG7H 4RBOA 4IQJA 2L7KA 3F3XA 3MVPA 2KJCA 4G6DA 5KAFC 2ZJPF 5A2QK 4BEHB 1K6OA 1QPIA 1Y1VJ 3BR6A 3KEOA 4DYCA 1LDJA 3FBIB 4U7BA 1RR8C 2GIZA 1UFMA 4LG0A 2B7EA 1XN7A 1SEUA 2PG4A 2W48A 4HNUA 3ZN1A 3OYMA 2VPLA 2WB1A 1T8IA 4GO1A 4IKFA 5D5WB 4B8XA 1EH8A 1GDTA 2M34A 3DV8A 1YFHA 1ZG1A 3QP5A 4IL6C 1ENHA 3IV5A 2HVSA 2R5YA 3MKLA 1LFPA 2IEKA 3NARA 3S15J 3WTZA 5M5XJ 1FJLA 3JR9A 4F7ZA 1PUEE 5D5UB 1DPRA 3GF2A 1VQ6I 3F6VA 1S3JA 1ITYA 4XONA 2HKOA 3J81K 2V1DA 4X6AJ 5BPIA 4EV0A 5DYMA 2HGCA 1IXSB 3BPVA 4V2FA 1F9NA 1ZG3A 3H3VK 2QUFA 3S1NJ 2OU2A 4ZZDA 5LD2C 1VFCA 3L2RA 5EGOA 1WJCA 1G59A 1FOYA 1WQ2A 4BJTA 4BQOA 1Z7LA 2KIUA 2GAUA 2L7FP 2BXYA 1Q1VA 4XKBA 1XCBA 2XVCA 2KPMA 2P0WA 3E97A 4ON0A 3GLXA 4OMZA 3MAJA 3JSOA 1H9TA 3PSFA 3TEDA 2CGPA 2QQBA 4MFEA 2R92J 1LFUP 2VIXA 4G6QA 1WRJA 3MN2A 2MGQA 3L2VA 2HR3A 1DUXC 2OTJI 4XRFA 3CJRB 2VOPA 4RAGA 1HW2A 2ZSHB 4ZJZA 4BXXJ 2FOKA 3CZ6A 2D5VA 3VWBA 3S93A 4RB1A 2FOWA 3CQZJ 1CF7B 1FP1D 4UUSA 3JRCA 1J9IA 4N4NB 1SFXA 2HYJA 4B48A 2IBDA 3CLQA 1IN8A 5ERIA 3UNGC 1HKQA 3BG5A 4HQEA 1ZRDA 5DCMB 2JMWA 3CJTB 2AXTC 1T38A 3D5LA 3PO2J 4EJTA 1V55H 1WCMJ 2DFEA 4HW0A 4CYCB 2CFOA 1IGNA 3OL3A 2L7MP 2IJLA 4C2UA 4RA2A 2WAQN 4I7HA 1YHQI 3T0YA 3DLAA 1QVUA 3GFJA 5DTDA 1BA5A 3FXRA 3K6GA 4I0AA 3LOCA 1Y56A 2CQQA 1W5CC 4ZYEA 1BOAA 1UHSA 2RVCA 1ZRCA 4XBFA 4E7HA 1R4MB 3FXOA 3VFZA 5KCMA 5HNFA 4II3A 2ADUA 2DJIA 4EVIA 3HSFA 2FD5A 4DOZA 2FEZA 1HA8A 5L3GA 1XTAA 1O3RA 2DOAA 4GRIA 4OINF 2QQAA 1ETWA 4H4KC 1MGTA 4IQ4A 2CV0A 1FIAA 4E7LA 1UG0A 3ZRGA 3ASOH 1NTCA 5D5XB 3D5RC 3K2ZA 2HOEA 2ID6A 3K1PA 3CCEI 2NVXJ 1B72B 3HDDA 3G71I 1OCCH 4UHTA 1R7JA 2GLOA 2Q2EB 2PBIA 1SVMA 2ZSIB 1N78A 3ZMSA 1KU3A 2M9HA 1W7PB 1XGNA 2FE3A 2O61A 2Y69H 1FTTA 2FNAA 2QA4I 4IX7A 3DFGA 1TP4A 5J1YA 5LHIA 2UZKA 1FP2A 2OQGA 1OCRH 1RUOA 4U7DA 2RREA 3WTTC 3ZCOA 1AU7A 3F0CA 1TWFJ 1ZGAA 4HRIA 3H35A 3MZHA 3ABUA 4KIGA 3Q3SA 4NNJA 4BBRJ 1BR1A 1ETYA 2XAGA 5JVGF 4G12A 2VONA 3DBRB 3LSHA 3GZNB 2R7OA 4BL0B 1P92A 2JVGA 4CGZA 4M3FA 1T6SA 3T5XA 2G7UA 3ZMDA 2LDUA 2QKMB 1JUSA 5J3LA 5GAHJ 3HJEA 2JRTA 3O2PE 5F27A 1QU3A 4DBQA 3EUHA 4MQ9F 2MH9A 4RS8A 5F6FA 1QA6A 3P9CA 4UXNA 2NVUB 3PNVA 1FYKA 5DV5A 3ML6A 5JHUA 3GBGA 4YFNF 2LR8A 4LG0B 1S72I 1OCTC 1OYYA 5HS9A 4HV5A 4BKXA 2XGDA 4EJUA 1HW1A 2YX4A 2XROA 1B8IA 3AL0C 2W84A 3HOZJ 1D8KA 1YW9A 3NRVA 3CD6I 1Q1HA 3M8FA 1Z91A 5DM7F 2KIQA 4UVCA 3KEYA 5DM6F 3N97A 3OYKA 1T98A 2HZTA 1IC8A 2R5YB 1IAWA 1ZN2A 1P7IA 5K7HA 2R7UA 2M7BA 5KK1A 2UXXA 1U6GA 3WG9A 1FBSA 3LNQA 5HDNA 1LDKB 1KU7A 1QVTA 5IYCJ 1GV5A 5CKTA 2H6BA 3WODF 3T1BA 1QGPA 2VJ4A 1D1AA 3KYLA 1HLVA 4YELA 1D0YA 1P2FA 5AONA 4JP0A 5EF6A 5EGOB 3DXJF 5FFXA 3BZ6A 1EA3A 3PL8A 2QM3A 5FKOA 4KMFA 1FYLA 2V9KA 4A3IJ 2EA4A 4BJ6C 3LSIA 1ZQ3P 2Z99A 2LD5A 2DFHA 2A07F 4HF0A 4YIIA 3TDUC 3BTJA 4P9FA 4KIFA 4X1EA 5IOZA 2BV6A 1X1DA 3G1OA 1KA8A 2K4BA 4L5EA 1P7JA 1YW7A 2NRAC 2GA2A 1K83J 5DD8A 5F1JA 1BIAA 3LSGA 2QSGX 1DGRM 2Y30A 4XN3A 5CVIA 1RIOH 2OCCH 1IRZA 1R9TJ 4ZDLA 4UUSB 4DGWB 1QNTA 4MLOA 3WTYC 2STTA 2AXLA 4CHUA 2A5WA 1O4XA 2AS5F 2IGKA 1E3PA 2RQQA 3V7CA 3QU6A 4BHBA 1XX5A 2DA1A 3G2BA 1WH7A 4D0PA 2COMA 3H92A 2E36A 1JT0A 4YG2F 2O9LA 4XIDA 1JT6A 1RPWA 3Q0VA 3D0SA 3BG3A 2UWMA 2DMNA 1ZG5A 2DODA 2X6OA 4PFPA 5IY5H 1OQYA 3F21A 2HTSA 1YTYA 3QYEA 1TW2A 2ACJA 2P7CB 2EBIA 4CCLA 4C2TA 3TDZC 3KFWX 2RNGA 3WE2A 1A31A 5FLMJ 5J6XA 3JRDA 4PSXA 2E1MB 3G6EI 5ICEA 1YJWI 2CUEA 5J4YA 1LQ1A 4G94A 1X3WB 1K78B 5FB2A 3HHGA 5BOXA 1MMNA 1FEXA 3K4JA 3R6SA 3BJOA 4P5OA 1AOYA 4M6YA 3QYFA 1EJ9A 2QEXI 1U78A 4N0BA 3FKJA 2DO7A 1SMYF 3ZN0A 1HC8A 4AIKA 1S7AA 4BQAA 1D3YA 3W2WA 5LBQA 3V42A 4IRIA 2V79A 4NQWA 1R5GA 2CV2A 5IT3A 3QPHA 4BDYA 1H89C 2JQ7A 2BZTA 2G0EA 4HDUA 2L3DA 5F64A 2RGVA 2ESHA 2O3FA 2OQRA 3BG9A 3TO9A 1VQ4I 2M30A 3TOAA 4A3CJ 4Y13A 1K4SA 3LSRA 1XC5A 1KQ8A 4HX8A 2NVTJ 1IF1A 3OR1C 5K1YA 5FJ8J 3GTLJ 1BC7C 2L0KA 4IVNA 3IAS2 4A3GJ 1XGOA 3CP2A 1YE9A 1Z21A 2E71A 3Q9VA 1U2WA 4DJAA 2M5WA 3OS2A 3GYHX 1Z9CA 2DJNA 4Y17A 3W2VA 5FKNA 5C4JJ 5FLXK 1YIJI 2FU4A 5DUKA 2NVYJ 4AD9A 5JLXA 2ID3A 4G8XA 5GADJ 3COAC 1WJDA 1IZ1A 3S1MJ 1DGWY 4JYKA 1FSEA 4AIHA 3WTXC 4RLQA 1ZARA 2MYSA 2BY2A 2ZNYA 4GGGA 3GTKJ 1R36A 3RYPA 2GXGA 1OJLA 2DOFA 3E5XA 3HXLA 1G8XA 1MBHA 5AIPA 1OR7A 1WSUA 4M9ZA 1B8IB 2EFNA 2CUJA 2PLYA 1B59A 1X4OA 4A3DJ 3W6JB 4U88A 2ZMEA 3MZYA 5D4SA 4ZZLA 2XAUA 3RPUA 4OIQF 2CH0A 3ECOA 3ABKH 4ZDPA 1ETOA 2EFPA 1YS7A 5DCFA 2KDZA 4LIVA 4NUBA 3M7GA 3S3MA 1JGGA 1GV2A 1G3SA 1T56A 1UCRA 3UR3C 2MABA 3SEZA 2QLZA 2PJRA 2VASA 2XGEA 1MBFA 2P8TA 4LMYA 3OMYA 1VNDA 4XRSA 2O7OA 5C44J 3G1LA 4CSWA 2W82A 5A2QZ 1FWZA 3E6CC 4F52A 3DF8A 2BBYA 4FX0A 2AO9A 1K6YA 2TRTA 4QPOA 4XLPF 3IH4A 2VBXA 1MSFC 3LQQA 5BMZA 3FXMA 2NYXA 4PK4A 3RIRA 1V5GA 1QQIA 1USSA 4R1HA 5J8FA 1HSJA 2GBYA 4Y4RA 2XGCA 2L9NA 2M7AA 1XDUA 1V5FA 3SDBA 1HBXG 3H0DA 3C3WA 2E60A 4NC6A 1P4WA 4UB6C 5E18F 3CO7C 3V4GA 1C0WA 2YUSA 4N9IA 4XLHA 2BHZA 4ETSA 4HLYA 2DQLA 2EA2A 2P5LC 2BEOA 2J5OA 1W0UA 1W7PD 3RKQA 3BOQA 3G1MA 3J81Z 3I5UA 2ICWG 1TL8A 4GDFA 1Z7UA 2L9RA 3FMSA 4BGDA 2CW8A 3R60A 2LMDA 3SEQA 2H1KA 1D0XA 3OOUA 1QO0D 5D6EA 1WJAA 2ZXHA 3DWLE 4E7ZA 2HYGD 3K4NA 3CC2I 1MNEA 1MD0A 4A5MA 3S17J 3QYBA 4BNCA 4HNVA 4XNFA 3CTAA 3BZKA 3HM5A 2EZIA 2JA6J 3BR1A 4XKVA 2V1UA 2K9MA 4DZPA 2K4JA 5ICCA 4Q5SF 2VT2A 2XSJC 2R7XA 3MKYB 1HW5A 5EG0A 1SD7A 1R1TA 2JK3A 3CMMA 3B6AA 3M9AA 4YIRX 5LHGA 3AG1H 3OSFA 2VJIA 2OA4A 2EFOA 2XIGA 4LOCA 3VSKA 1IV8A 3QODA 3E5QA 3OOPA 5H20A 2X0LA 1TTYA 4BH9A 4F93B 2DXIA 4EM1A 2XKOA 3I9V2 3F23A 1XG1A 3OY9A 4YEJA 4W1UA 3DU6A 5CPRB 5ILVA 5HODA 3PQKA 3KIOA 1OCZH 1LEBA 1HSTA 4KA4A 3F22A 5BNGA 2UUZA 4G6TB 1WI9A 3RKXA 3FXLA 2KP6A 2L5QA 3B73A 3MWMA 3F6OA 3ZPLA 2NOGA 3GFMA 2CUZA 1IRFA 1X2NA 4B09A 2DQRA 4FASD 2MBFA 2CW0F 2OUMA 2YSRA 2MC3A 2WAFA 1BBYA 1I5ZA 4NQWB 2VJJA 4R8HA 1VF9A 3OIQA 4RM2A 2LF7A 3ZQIA 1QZYA 6PAXA 1JJ8C 3BWGA 1N75A 3H3UA 1Z05A 3LSJA 4ESBA 2ECCA 4UB8C 4QTRA 3OIPA 3ZQ7A 2EZKA 4RMNA 3WU1B 3GEZA 3JRBA 3V8JA 3JAMK 4Z6YA 2FJ1A 4CUGA 1OLTA 1X1PA 1MH3A 1S5LC 3ULQB 2ZXJA 3AL0B 1FPQA 1NHAA 4KT5C 2L2OA 2CU7A 3CCMI 2ZKZA 1FBUA 4P96A 1SD5A 3MFKA 3REOA 2L9VA 3K1NA 4XR6A 3A03A 5CYVA 2WAEA 1FOXA 4NDLA 5EYRA 3FHNA 1XMKA 1RI7A 2LKXA 1MZBA 3DP7A 1K4TA 2O8KA 2VE8A 4L0YB 2BOLA 2KRHA 2YU3A 3HOVJ 4QPQA 3SFIA 1DU6A 5IYBJ 2GQQA 1U9OA 2OF7A 4QWQA 3IKTA 4KFCA 1AHDP 2R4GA 1FC3A 4CCJA 3ISPA 2E35A 2ECBA 4ESFA 2QCOA 4ZH4F 5LFAA 2FNPA 3GTOJ 1HQCA 2JRMA 3HG9A 1UJ8A 2DYSH 2PEXA 4KT6A 1W5TA 3WTUC 1Z0XA 3HRMA 4U0VA 1YRNB 3FBNB 2EZLA 2F5EA 2RNJA 1LUJB 1XSXA 4YIFA 4DYQA 2PJRB 1YI2I 3JTHA 2CWEA 4FHTA 4RAYA 3EUHC 1IUFA 2QZ8A 3HTUA 4B1RA 2H1LA 3H9QA 4ZYHA 3R4KA 5HLHA 4V19K 1R22A 2DDAA 2PN6A 4EJOA 1MH4A 2F5DA 1HCRA 2HOTA 2EIMH 4RGRA 2IS2A 4CXFA 2HDDA 1O7LA 3PFYA 4C3IJ 1APLC 2VPRA 1HKSA 3RQ4A 2M3AA 5FFZA 2IAIA 3WGIA 1ZELA 2ZXIA 4XORA 4HX4A 2P6TA 2JJ7A 1V5EA 2VODA 5L3EA 2IP2A 2DTRA 4B43A 4IHXA 3CCSI 1D1CA 2XB0X 5C3EJ 4HZFA 1WGXA 3ZMTA 4C3JJ 5DUIA 4KISA 3KP4A 2LC2A 4O3MA 3AG3H 5CVVA 1DPUA 3L09A 5E79C 1XCVA 2X48A 3BCBA 3GFLA 3LAPA 2W57A 3SJMA 3RQIA 2OPTA 5F04A 2XV4S 4KMUX 4IRGA 2PMUA 3F72A 3V7RA 4M72A 4PFOA 4D7MA 5BS6A 1SFEA 2ME0A 1UAAA 3ROUA 2RV8A 5B3SH 4ENJA 1OKRA 2D1HA 1WI3A 2F4OB 5TISC 1XD7A 3L00A 1JJ6C 3M3YJ 3AG4H 3GTJJ 2IT0A 2HU9A 1ORKA 3DPUA 5CVRA 1Y0UA 3I53A 4RGSA 4QSHA 5EG0B 4XLNF 1I6HJ 1SAUA 1N25A 3H5RA 3M8EA 1EF4A 4FQGA 3EUAA 2XASA 2V4JC 2F2EA 2EK5A 1VQNI 1IW7F 1D1BA 1X3ZB 5HLTA 2P5VA 1USTA 2VC0A 3LSKA 2MC4A 4OAZA 4PDKA 4ZYAA 1ZREA 4LFUA 5K7ZA 1A6QA 1JE8A 1A36A 2IPQX 3V8LA 1VQ9I 2XGXA 2XUBA 2LY1A 1EKEA 4FE7A 1OYWA 3WGGA 4NC8A 3MKZA 2ZFUA 3FMQA 4OMYA 3VB2A 3SZGA 3CP8A 4CYDA 2BHYA 2M45A 3H3ZA 5K7FA 1O57A 3A01B 1IN7A 4HYEA 2A6TA 1U0JA 1Y8RB 1BJZA 2ZJ2A 1VQ7I 4C9YA 2DDBA 1KYWA 2C6YA 1YOVB 4BYYA 5HS8A 3H5AA 1TT0A 3DTIA 2ZFWA 1O3SA 3F8NA 1LE8B 1WJ5A 1GLNA 5E8IA 5K5RA 4I76A 1IUYA 3K4BA 2M1BA 2H6CA 2ZO4A 4OAYA 2VLAA 1PUFA 2MD5A 1BI3A 2R7ZJ 2YS9A 4M3DA 1Z1DA 3IHUA 3WU2C 3ZXSA 4EEFG 4BQNA 1DU0A 5C4XJ 3QPTA 3WGHA 3VDXA 2VE9A 2B0LA 2E5ZA 2Y0MA 3P9KA 2P6SA 3WE3A 3KP2A 3BC8A 1IN6A 2KJBA 2KLOA 3QAHA 2V1NA 1E17A 3BTIA 2W00A 3BR5A 3HPHA 4KDPA 2VC1A 4B4CA 1BC8C 3HHHA 2EJRA 3LFUA 3CO6C 5HNHA 2QBYA 2XF7A 3K0LA 3FM3A 3U2RA 3FXKA 2Z2SB 3FXUA 1YW8A 4BXUA 3CCVI 3SDGA 5TRDA 3I58A 2MW8A 1RRJA 1N77A 3IH2A 3GX4X 5LRRA 3OSGA 4BE2A 2PI0A 4N9HA 4HF1A 4HPQA 2FUG2 3A0BC 4L9TA 2DFFA 3GVAA 1H88C 3S2DJ 5EEGA 1RC9A 3IWZA 3LQRA 2AQFA 3EYIA 2HZDA 4NBQA 1MMGA 3CMEI 2EH3A 2HPIA 5CQGA 1H9GA 2Z9OA 2F5CA 3TBIA 4YFXF 1T33A 3BROA 3F9KA 3IAM2 5D8LB 1QRYA 3Q5FA 1XS9A 3OYAA 1BR2A 2N8GA 3M8JA 4BU2A 2F48A 2COBA 1A04A 2CQNA 2HI3A 3K4LA 4QIWN 3JTGA 5IT9K 2IS4A 4KJZA 5FLXZ 3KYDB 1R71A 2WA0A 3L2WA 5EDNA 4GYIA 3IH3A 3A0HC 4OIPF 2QSHX 4ZDOA 1R1UA 1A5JA 3PIOF 2K9NA 4WCGA 2I5UA 3QQAA 5AIQA 5LGNA 3KP5A 4E7JA 1R49A 4UUVA 1X19A 3FF5A 4HG2A 1X58A 3S2WA 4A3JJ 1EV7A 2BY3A 3DKYA 4FE4A 4XLCA 1B1BA 3BG6A 5HS7A 5M5YJ 2IGOA 1OR7C 1YITI 1JKPC 4D7NA 4KN4X 3CUQA 4MIMA 1HDDC 2CS3A 2W1OA 2M4GA 3W3CA 5F0HA 4FCYA 1ETKA 1U3EM 4F3QA 1ZTRA 1VQPI 3DPLC 5E20A 1RKWA 3JRAA 2NOJB 2ZMEC 1W0TA 1GT0C 3OR2C 1GHCA 3KYCB 2HQNA 3BJ6A 4HLXA 5F0FA 1LNWA 4I09A 1JGSA 2E1CA 4IHTA 1IRXA 3OYJA 1ZLKA 2DA6A 2FXAA 5IP9J 3F8MA 2DA7A 1G3WA 3LSTA 1ZYRF 4IOCF 3Q0WA 3RZOJ 2KMUA 3GO5A 4A3BJ 2D45A 4A3KJ 3OYNA 3DEWA 1ACIA 3M1EA 1Z3YA 2HS5A 2STWA 1TWCJ 5LHHA 1NG6A 3OYBA 5B1AH 2I10A 3A4CA 3O8GA 2IW5A 3SHFA 4EJVA 4CZCA 2R7RA 1GVDA 2X1CA 2K02A 3C2BA 4M3GA 4E7IA 2R93J 3SXYA 3U1DA 3RKYA 2K86A 1FSHA 1UHWA 3GLLA 4ZTFA 1KU2A 3R61A 2LH9A 2VXZA 2G9WA 3V7SA 2DT5A 3HEFA 1O3TA 2WWYA 5GTIC 2ESNA 2CRGA 2R5ZA 2Y9ZA 2JPBA 2HDCA 4LB6B 4K2EA 4I02A 5E17F 1S6LA 1YYVA 1BI0A 1DP7P 2XAHA 4Y33A 3U21A 3HPGA 3ABLH 2D2WA 4P55A 5B5EC 1S8NA 1XSDA 3RPUD 3LA7A 3NAUA 1T2KA 1MNDA 2PMZN 4PJ0C 3IL2A 2M4KA 3GZ5A 2ZJQF 3F8FA 4GCVA 4RLFA 5L3FA 2KIMA 1OPCA 2JSPA 5M3MJ 1R58A 2XF5A 3DBHB 5BQTA 2KQRA 3EPZA 3ABTA 3HBLA 1R00A 5CQEA 1B6AA 1FTZA 1B9NA 3BJAA 4V2GA 1NK3P 4IHWA 1P9QC 4EGZA 4KIBA 1BI2A 2RDPA 2QQ9A 2WAQA 1EH7A 3LA2A 4M6XA 2DFIA 2DA5A 4RAZA 1H0MA 2F4IA 2VKHA 1WJEA 1STZA 2P4WA 4EMSA 2ETHA 5GPAA 2K40A 2VKEA 3E5UA 2Y0SN 4FTHA 3C2GA 5M5WJ 4BBSJ 2QF7A 1BOBA 4D1QA 3M1CA 3FM5A 5L3DA 5E1XA 5DDGA 2E7XA 3A2KA 1UMQA 3HUGA 2HFHA 2LY2A 1DDNA 4BJ5C 3K10A 5H2FC 1HXDA 1I27A 2KZGA 4I0BA 1YJNI 2HTJA 3KEQA 4F91B 2JA2A 2ISYA 5J40A 4MTEA 1VQMI 2BW3A 2EWNA 2MLGA 3DU5A 4FT8A 2QSFX 3I0TA 3OL4A 1LVAA 3LAJA 1MBJA 2V6EA 3S8PA 3CJNA 2NNYA 3K7AJ 2XKPA 2DLLA 1ON1A 2E34A 2L9SA 4HAMA 3QWLA 1W36C 1X1AA 2VKDA 2ELKA 3HOSA 2O8XA 2GOXB 3FHZA 3Q9SA 1G2HA 3LWFA 2XF6A 4PGHA 1BM9A 2QVOA 3MMYB 2Y75A 3BR3A 4XKWA 1FMWA 2LVSA 1SVLA 2IS6A 2R7QA 3RSNA 4AIJA 4D5CA 2DK5A 2E2JJ 1GUUA 4HSTA 2VQGA 4WX9A 1RESA 2JZYA 2DMTA 1ONVA 1V4RA 2KRCA 3M4OJ 4PCQA 2V9PA 4F92B 4O5VA 4AU7A 4JBAA 4XRMA 4IHVA 2Q8KA 5JR3A 2ZBKA 2DW4A 1REPC 2W24A 3ZP5A 4FETA 3NWSA 4WF2A 4LD5A 1VZ0A 3DPTA 5L3BA 5TJJA 3OYLA 2FSWA 2X1EA 4I99C 5ICFA 3CLOA 1RUNA 1SFKA 1VQ8I 3TGNA 2LFBA 3BP8A 2R7TA 1YG2A 1Z6TA 2LF8A 3OYIA 1R1VA 3WTVC 1IXCA 4WWCA 3WTWC 1TQMA 3ZGKA 5IP6A 3I3LA 1T08B 3VSLA 3FX3A 3HOWJ 4NB5A 1TWHJ 3I4MJ 1YIOA 4Y7NJ 3H36A 5ICGA 4L9VA 1B4AA 2VI6A 4ZTJA 4CCOA 1TNTA 2DOEA 5FKLA 3PNTA 4DW6A 1U5TA 3ERED 4EGYA 4BAYA 2JUCA 4Q47A 3KLOA 3PFIA 1W36D 1MBGA 3QP6A 2VOOA 2K9SA 1FLIA 1U9NA 2WBMA 1XSVA 4MGRA 5DD4A 4Q4ZF 2MD0A 4HBLA 3RZDJ 2W85A 5LLQA 1G6NA 1OFCX 1KU9A 1V3FA 5HDKA 1SFUA 4L0ZB 1ZHFA 3MZ8A 3ECHA 4IZZA 5LGTA 2A69F 3JRFA 1HKTA 3FDYA 4A6EA 2WC2A 3B02A 3TP3A 4MHGA 1ERDA 3BDDA 2AQEA 2QGUA 2XPWA 3EDPA 2KKOA 3CCRI 2H27A 3ASNH 4KYWA 4E70A 3H9JA 1WPKA 2HXOA 4BHCA 1IO2A 2FA5A 2GWRA 4E4HA 4CA0A 2GZWA 3I55I 1PYVA 4BACA 1WHUA 1SANA 3R0JA 4CO8A 2EQRA 2WV0A 2YR2A 5H6QA 5JFRA 3MKWB 4Y3OA 3K69A 3E7LA 4HV6A 2R5ZB 1TC3C 3ZMVA 2FBIA 1YO5C 1IDZA 2IVMA 2VJ5A 5KAIC 5IP7J 2CSOA 4B44A 4KITB 2LP0A 1CGPA 3J7ZI 2EV0A 2JT1A 3J80K 1JXSA 2X51A 1YX3A 4G9YA 1MMSA 4M3EA 3K9TA 1FMVA 2LTPA 1MW7A 3H5NA 1MSEC 2JN6A 2Y48A 1I6XA 3ZOBA 2GM4A 4DNCA 1CF7A 2X4HA 4ESJA 2LKSA 1FYMA 3S16J 3FMRA 2JA7J 2EIKH 3AAFA 1SD6A 2K9QA 2HNHA 1E2XA 2XAFA 3WU0A 3ONQA 3K70C 2KZVA 2E2HJ 4PJMA 2YX7A 2V6CA 3C2HA 1OYIA 5GP9A 2R7WA 1G4DA 2M2EA 2UV1A 2DMPA 3I59A 3HRTA 4D5FA 1MKMA 4AWXB 3K2AA 2OAZA 4DBRA 1T0FC 2LSOA 4PUSA 5FD6A 2HOSA 2F4MB 3HOYJ 2A05A 3K4KA 2HEOA 3IWFA 2DCEA 5J1RA 1JKOC 3LFKA 3GZ6A 1UHMA 3QPSA 2CYYA 3RJPA 4M71A 2VL8A 2CQ7A 1X3UA 1DP3A 2DI3A 4A12A 1JUMA 4LLNA 3HGGA 3BCAA 1LFBA 1Z6RA 2RQPA 1F36A 3OWTA 2XAQA 2RKHA 3VEPA 3E6DA 2BW3B 3D5SC 1QBJA 3F8CA 4WXCA 3BTCA 2PFBA 2TDXA 3KX2A 3ERMA 4FX4A 3HIFA 3PNYA 3I71A 4AC0A 2E7WA 1XGSA 4ENMA 4B47A 5K5OA 3TOBA 1A6IA 5ED4A 1TNSA 1ZGWA 1X1BA 2Y0SA 4BQQA 2DT7B 1PVEA 3TKYA 3OYEA 4HNTA 1E3OC 4IF4A 4U87A 3OYGA 2FMYA 3EUKL 4ENNA 2LRDA 2DTZA 3ZR8X 1ULYA 4Y52J 3GFIA 3ZQCA 2HOAA 4OOIA 4XRSG 3FISA 5EEHA 4BY7J 3OIOA 1WVRA 4CH7A 3HRUA 2K85A 1BW5A 3RYRA 5HLIA 1SD4A 2ZMEB 3G4SI 1Z3XA 3GXOA 2M8GX 4LK0F 4Q48A 4DZJA 1ZKGA 4U0WA 3AG2H 3CF2A 5F0CA 1WJFA 4IOAF 3CCLI 3GMEA 1W4MA 3L1PA 4M74A 1QHHD 1E0EA 2BGCA 1I50J 1Y6IA 3KZYA 2R7FA 2F6CA 4M73A 1R6RA 3K4CA 2IA2A 2NS7A 2BYVE 4AIDA 2P81A 3ZMUA 4HSRA 3JRHA 1RNLA 1T39A 2NVQJ 5B1BH 2EPFA 4WXHA 5DS9A 3TO6A 4HF2A 1FT9A 1A35A 2EFQA 5IT9Z 3BQYA 1K7AA 1U5TB 2HQRA 3IC7A 3V8KA 4XK4A 4CICA 3JRIA 3KETA 3TW6A 1ODDA 1I3AA 2L4AA 2D1VA 2CQKA 3CCYA 4I98B 2FQ4A 1BN5A 4A5NA 4UY8I 1IG7A 1W1WE 3DBLB 2HQ5A 3S2HJ 3LMMA 3CMYA 1LPQA 3VYRB 2X9DA 2EV5A 2LG4A 2R3SA 2W4SA 2CO5A 3BTLA 5FO5A 3OS1A 1OMIA 3CUQC 1G3TA 3KE2A 4A0YA 2LKPA 3HC7A 1I1GA 3J7YJ 1ETQA 2DBBA 4DYRA 2VUMJ 2WADA 1BL0A 2L4MA 1P4XA 4RB3C 3HKZN 1ZR4A 3W6VA 1QZZA 1X1CA 3OYHA 4M6VA 1MMDA 1Y0NA 1KYZA 3EETA 4ZYDA 1JKRC 2E19A 2VXDA 3CCUI 5IYDJ 5E3LA 1J75A 2OC6A 5LGUA 2A6EF 4RM3A 3QU3A 4LLGF 1V54H 3TMOA 1J5YA 4EQQA 2KISA 1DQUA 2E2IJ 2PQ8A 2GIVA 4EM2A 3E6MA 2ZB9A 2ME6A 3O6BB 3TL4X 2H8RA 3KP7A 4L18B 5GAEJ 1LKXA 1ON2A 1D5VA 5KVRA 5E1ZB 3H0GJ 5FLVA 1H8AC 3FXJA 4HEA2 1JHHA 3S3NA 3H1CA 3O3KA 4L5JA 4Z2YA 4PSWA 4HDVA 1WH5A 2HDWA 3DKWA 2ZJRF 2WY8Q 2ZC2A 3PUFA 2IGNA 2DMUA 2BE5F 3E6BA 3OV8A 4CDGA 1T0FA 1CQTA 1Y39A 1KQ9A 4M3BA 2VQHA 3BR0A 4XQFA 4F55A 4C30A 5J8CA 4XSXF 3GCMA 1SAXA 5CVUA 3HOTA 1WKMA 1GVJA 1PDNC 4IJAA 3P5JA 4UVBA 1IN4A 1L0OC 3QRFF 2R7DA 3I59B 4XL9A 3IRRA 2AHQA 1R5ID 5J4VA 2Y2ZA 1OCPA 1TLHB 3HYIA 1TWGJ 3ESWB 1F4KA 2ZCWA 1XGMA 3BT9A 3S1RJ 2EZHA 4BXFA 1RETA 2X6XA 5ILUA 3L9FA 1JI8A 3GWZA 4RGUA 1JHFA 3JSPA 3DTEA 2HXIA 3G73A 3PM1A 3B6CA 3KZIC 2DU9A 4RAFA 2HYFA 2W7NA 2VQLA 4BE0A 1K78A 2V1XA 5D8KB 3FIWA 2E5NA 3C7JA 1OCOH 2G7HA 4EM0B 1P6RA 4ITVA 1YJ9I 5IOYA 5L3CA 2DA2A 1KQ0A 5DEQA 2OZ6A 1FY7A 1TQPA 3FKIJ 4AYBN 2JUGA 2VT3A 2NAZA 3DLLF 3QOEA 2DA3A 2UXNA 4LG3A 1J7KA 2XC7A 2DN0A 4L9NA 9ANTA 3X2QH 1BW6A 2OZUA 4ABZA 2X85A 2K5CA 1P4AA 2RAEA 2FRHA 2LLKA 4BY1J 1T95A 4EJWA 1BR4A 1NK2P 5E3NA 2NS0A 3OYCA 3SZTA 3G3ZA 3CCQI 1MDMA 3C1DA 3VPRA 1J59A 3ZQLA 4AM3A 3BZCA 4L5IA 3RKWA 1D0ZA 1IV6A 2V7FA 1JKQC 2IRFG 3W2AA 5M3FJ 2MSYA 1OISA 4YRVA 2VKVA 1LVKA 4A0ZA 3JCUC 1TWAJ 2KDOA 3E0JB 1FOWA 5EZGA 3N4MA 3JW4A 2HPMA 2R7VA 3VYTB 2EIJH 1B9MA 1YX5A 4O6JA 2VBZA 2KFDA 2A61A 3HL2A 1Y1WJ 3S3OA 3HTSB 2H09A 2R0QC 5GPCA 3DEEA 4CCNA 2BY0A 2VQCA 2FF4A 2VB6A 5FGMA 4A3FJ 4BE1A 4W97A 3CCJI 1X2MA 3LSPA 1WJBA 5D6FA 3U9GA 4PJNA 1TT5B 5J47A 3GUDA 4I6ZA 3S14J 2ELJA 3WHCA 3QPLA 1TBXA 1AKHA 4KICA 4HOBA 2GXAA 3OYDA 3JREA 3GTQJ 4KNYA 3ZQGA 3HOXJ 1R23A 3PUBA 3E3VA 1FX7A 3J7AY 4LB5A 4DIQA 4JX6A 2EFWA 1S7EA 2A6HF 3BPXA 4FISA 2EILH 2ZXWH 3M07A 3T8TA 1I1SA 4LITA 4N4OB 3W6KB 1LDDA 1QZEA 3HRSA 3VODA 5JLWA 2Z1DA 1PJRA 1UB9A 5E1WA 3F8BA 4BHPA 4AVPA 2OV7A 2Q0OA 4E7KA 2CQXA 2A68F 4YFKF 1Y8QB 4IHYA 3K1MA 3E1SA 1XMAA 5EZHA 2QYOA 3RCOA 2YU9J 4UVAA 1ZLJA 1U5TC 2OCEA 5H6RA 3SZPA 3TW7A 3KPHA 4RB0A 3OYFA 4HQMA 1F1ZA 2RN7A 2H94A 4A6DA 2V26A 2PX9A 5D5VB 5JHFA 5BPDA 2HQAA 1FBQA 4XM3A 5LEJA 2QWWA 4XLFA 1SMTA 2VBWA 4G7HF 3PO3J 3HKZA 1O7FA 4A2UA 1I3QJ 1FOKA 3I4PA 4A0XA 3FXQA 3FK7A 1MNMC 5B66C 5ILSA 2LY9A 1EH6A 3EQLF 3CDIA 2FBHA 2OJED 4IEJA 3SFZA 4H0EA 1ZGJA 2HWVA 1QPMA 3HB9A 3MCZA 4WK8F 2CV1A 4RB2C 4B3XA 3MQ0A 4BDZA 4ASNA 3TP0A 3PJRA 5EEAA 2JA5J 2XB5A 3I4NJ 3L2QA 2HKXA 3JRGA 2OBPA 3CMAI 1BI1A 1X4PA 1PUFB 1IN5A 4XN0A 2IA0A 4WXDA 4MO7A 3J80Z 3A02A 1VQ5I 3HSRA 2QKLB 1YS6A 4OU0A 1PP8F 2NNNA 5LEKA 2LNBA 2I8DA 3I54A 1K79A 4KUMA 2O6GE 2K3FA 1IJWC 3QOPA 4A3LJ 1D5YA 1L3LA 3NWTA 1HF0A 2FQ3A 4XSZF 2JPCA 3DKXA 1J0RA 2KIFA 2M0MA 2LBFA 4PJLA 4B3AA 2B63J 4UV8A 3IKVA 1TW3A 2MG4A 2JVHA 1M1EB 2QBYB 4JQFA 3I64A 2CUFA 4UV9A 3ZQFA 2LOOA 4GYGA 3VYUB 2EV6A 4C3HJ 2ISZA 3PSIA 3CDLA 3IRQA 2JWTA 4QLCU 2JSCA 2L01A 1UG2A 4J00A 3GW2A 4P9UA 4RGXA 1KZHA 1FIPA 3GTPJ 5K5QA 1MMAA 5E3OA 1ZAOA 3D1NI 3Q0UA 2A5YB 4IXAA 1J09A 1E3HA 2XRLA 1ZR2A 1F5TA 1R4NB 4OIRF 2OD5A 5FRNA 4XOPA 1Z67A 3LSMA 1IXRC 1MJ9A 4PZJA 1R5HA 4L9JA 3JAMZ 1IDYA 2VN2A 3LL7A 1QHGA 2CMPA 2ZNZA 5GAGJ 1O3QA 2FBKA 1MDMB 2HVRA 3R0AA 2FMLA 3TQNA 5KNLA 4LLLA 2KT0A 2IXSA 2VBYA 3ABMH 3DTKA 1MJBA 5HLGA 1BJAA 1LB2A 2O5RA 2EB7A 4AYBA 1S9HA 5JVTA 1AWCA 2WY7Q 2DPDA
chains in the Genus database with same CATH topology
2CG4A 3RPQA 1U8RA 1GXQA 1RZ4A 1S7OA 4DQ2A 3L2CA 4G7ZF 2KRFA 3CUQB 1J2XA 2L02A 2DK8A 3PQJA 4S05A 1KGSA 2M87A 2ELHA 5CJ9A 3FZVA 3KP6A 3VOEA 2Z5UA 2MLKA 5F1RA 1ZRFA 4HA8A 2O03A 2RC4A 3NQOA 3L7WA 3KP3A 4M9SA 5HDGA 1VTNC 2Z3YA 2M8EA 4Y15A 1LEAA 3RI4A 5E8GA 3ZMZA 2W25A 2V9VA 4GXOA 4MEXF 3CUOA 4PGGA 1GXPA 2WTEA 3C18A 2IA1A 4TV7A 2P5KA 1WWXA 1TQIA 2XRNA 5FD5A 4G7OF 1IRGA 3WTSC 3CDHA 2MH2A 3TO7A 4S04A 3DEUA 3RDIA 2Z33A 1FNNA 4M9XA 1MJAA 2DAOA 4LGWA 3NEUA 4MNUA 2J5PA 4I01A 4MEYF 4IHSA 3SQNA 5CLSA 3FWEA 4OIOF 5D4RA 4I2OA 2K27A 3KZZA 4IPAA 3DQVC 4KN7X 5HVQC 1BIBA 3T8RA 3HSEA 2CFXA 5DCMA 4UNOA 2P7VB 3P7NA 1ZH5A 2QENA 3BY6A 4MTDA 4MQVA 2E1NA 2GXBA 1W5SA 2YPRA 4LJZF 1D8JA 2MA3A 1G3YA 1XDSA 2F5FA 3KCCA 2PJPA 3EYYA 4R79A 3RTRA 4LK1F 2O0YA 2JTVA 2L54A 2Q2EA 3J7AO 4HX7A 3KLNA 5CVJA 5JI6A 1YQAA 1W7PA 2GA1A 4NHJA 4CZZA 4ENKA 4U0YA 4IRHA 1LJ9A 4JK1X 1FZPB 2XAJA 1XB4A 5LRSA 5HOOA 2A3SA 2XHKA 3LA3A 4ZYGA 1S29A 3ELKA 2PMHA 1YLFA 2K7LA 1PP7U 2DPUA 3P9IA 3MEXA 3F3XA 2KJCA 4G6DA 5A2QK 1K6OA 3KEOA 1LDJA 4U7BA 1UFMA 4LG0A 1XN7A 2PG4A 3ZN1A 4GO1A 5D5WB 4B8XA 1EH8A 3DV8A 1YFHA 1ZG1A 3QP5A 3WTZA 4F7ZA 1PUEE 5D5UB 1DPRA 3GF2A 3F6VA 1S3JA 2HKOA 3J81K 2V1DA 5BPIA 4EV0A 5DYMA 2HGCA 1IXSB 3BPVA 1F9NA 1ZG3A 2QUFA 2OU2A 4ZZDA 1WQ2A 2KIUA 2GAUA 1XCBA 2XVCA 3E97A 4ON0A 3GLXA 4OMZA 3MAJA 3JSOA 1H9TA 2CGPA 2QQBA 4G6QA 1WRJA 1DUXC 2HR3A 4XRFA 2VOPA 1HW2A 2FOKA 4RB1A 1CF7B 1FP1D 1J9IA 1SFXA 5ERIA 1IN8A 1HKQA 4HQEA 1ZRDA 5DCMB 1T38A 3D5LA 4EJTA 4HW0A 2IJLA 4I7HA 3T0YA 3GFJA 3FXRA 4I0AA 4ZYEA 1BOAA 2RVCA 1ZRCA 4XBFA 3VFZA 4EVIA 2ADUA 3HSFA 2FEZA 5L3GA 1O3RA 4OINF 2QQAA 1MGTA 5D5XB 3K2ZA 2HOEA 3K1PA 4UHTA 1R7JA 2PBIA 3ZMSA 1KU3A 1W7PB 1XGNA 2FE3A 2O61A 2FNAA 3DFGA 5LHIA 2UZKA 1FP2A 2OQGA 1RUOA 4U7DA 3WTTC 1ZGAA 3MZHA 3ABUA 4KIGA 2XAGA 2VONA 1P92A 4CGZA 1T6SA 3T5XA 2G7UA 3ZMDA 2LDUA 2JRTA 3O2PE 3EUHA 4MQ9F 2MH9A 4RS8A 5F6FA 3P9CA 4UXNA 1FYKA 5DV5A 3ML6A 5JHUA 4YFNF 4LG0B 1OYYA 5HS9A 4EJUA 2XROA 4HV5A 1HW1A 2YX4A 2W84A 1D8KA 1YW9A 3NRVA 1Q1HA 3M8FA 1Z91A 4UVCA 3N97A 1T98A 2HZTA 1IAWA 1ZN2A 5KK1A 2UXXA 1U6GA 3WG9A 1FBSA 5HDNA 1LDKB 1KU7A 3WODF 2H6BA 3T1BA 1QGPA 1P2FA 5AONA 3DXJF 5FFXA 3BZ6A 2QM3A 4KMFA 1FYLA 2EA4A 2Z99A 2A07F 4HF0A 4YIIA 3TDUC 4P9FA 4KIFA 2BV6A 1KA8A 2K4BA 1YW7A 2NRAC 2GA2A 5DD8A 1BIAA 1RIOH 5CVIA 1QNTA 3WTYC 2STTA 2AXLA 4CHUA 2AS5F 3V7CA 3QU6A 4BHBA 4D0PA 2COMA 3H92A 4YG2F 3D0SA 2UWMA 1ZG5A 3F21A 2HTSA 1YTYA 1TW2A 2ACJA 2P7CB 3TDZC 3KFWX 3WE2A 5J6XA 5ICEA 1LQ1A 4G94A 1K78B 5FB2A 3HHGA 5BOXA 3R6SA 3BJOA 4P5OA 1AOYA 4M6YA 1U78A 4N0BA 3ZN0A 2DO7A 1SMYF 4AIKA 1S7AA 4BQAA 1D3YA 5LBQA 4IRIA 2V79A 4NQWA 1R5GA 5IT3A 3QPHA 4HDUA 2L3DA 5F64A 2RGVA 2ESHA 2O3FA 2OQRA 3TO9A 2M30A 3TOAA 4Y13A 1KQ8A 4HX8A 1IF1A 5K1YA 1BC7C 4IVNA 1XGOA 3Q9VA 1U2WA 2M5WA 3GYHX 1Z9CA 4Y17A 5FLXK 2FU4A 5DUKA 4AD9A 4G8XA 3COAC 1IZ1A 1FSEA 4AIHA 3WTXC 1ZARA 2ZNYA 4GGGA 1R36A 3RYPA 2GXGA 3E5XA 1WSUA 5AIPA 1OR7A 4M9ZA 2EFNA 2PLYA 1B59A 3W6JB 4U88A 2ZMEA 3MZYA 5D4SA 4ZZLA 3RPUA 4OIQF 3ECOA 2EFPA 1YS7A 5DCFA 3M7GA 1G3SA 1UCRA 2QLZA 2P8TA 4LMYA 5A2QZ 1FWZA 3E6CC 3DF8A 2BBYA 4FX0A 4XLPF 2VBXA 3LQQA 5BMZA 2NYXA 3RIRA 1QQIA 1USSA 4R1HA 5J8FA 1HSJA 1XDUA 1HBXG 3C3WA 1P4WA 5E18F 3CO7C 3V4GA 1C0WA 4N9IA 4ETSA 4HLYA 2DQLA 2EA2A 2P5LC 2BEOA 2J5OA 1W7PD 3BOQA 3J81Z 3I5UA 1Z7UA 3FMSA 3R60A 1QO0D 5D6EA 2HYGD 1MD0A 4A5MA 4BNCA 3CTAA 2V1UA 5ICCA 4Q5SF 2K4JA 2VT2A 1HW5A 1SD7A 1R1TA 3M9AA 5LHGA 2OA4A 2EFOA 2XIGA 3E5QA 3OOPA 5H20A 2X0LA 1TTYA 4BH9A 4EM1A 2XKOA 3F23A 5ILVA 3PQKA 1LEBA 1HSTA 4KA4A 3F22A 1WI9A 3RKXA 3B73A 3MWMA 3F6OA 3ZPLA 3GFMA 1IRFA 4B09A 2DQRA 2MBFA 2CW0F 2YSRA 2MC3A 1BBYA 1I5ZA 4R8HA 2LF7A 1QZYA 6PAXA 3BWGA 3H3UA 1Z05A 4ESBA 3ZQ7A 3WU1B 3GEZA 3V8JA 3JAMK 3ULQB 2ZXJA 1FPQA 1NHAA 4KT5C 2ZKZA 1FBUA 4P96A 1SD5A 3MFKA 3REOA 3K1NA 5CYVA 1XMKA 1RI7A 1MZBA 3DP7A 2VE8A 4L0YB 2YU3A 2GQQA 4QWQA 3IKTA 4KFCA 1FC3A 3ISPA 4ESFA 4ZH4F 2FNPA 1HQCA 2PEXA 1W5TA 3WTUC 3HRMA 4U0VA 2F5EA 2RNJA 1XSXA 4YIFA 3JTHA 2CWEA 4FHTA 4RAYA 2QZ8A 3HTUA 4ZYHA 3R4KA 5HLHA 1R22A 2PN6A 4EJOA 2F5DA 4RGRA 4CXFA 1O7LA 1HKSA 5FFZA 3WGIA 4HX4A 2P6TA 2VODA 5L3EA 2IP2A 2DTRA 4HZFA 3ZMTA 5DUIA 3KP4A 4O3MA 5CVVA 1DPUA 3L09A 1XCVA 3LAPA 3GFLA 2W57A 2XV4S 4KMUX 4IRGA 2PMUA 3F72A 3V7RA 4M72A 5BS6A 1SFEA 3ROUA 2RV8A 4ENJA 1OKRA 2D1HA 1XD7A 3L00A 2IT0A 5CVRA 1Y0UA 3I53A 4RGSA 4XLNF 3M8EA 2XASA 2F2EA 2EK5A 1IW7F 2P5VA 1USTA 2VC0A 4PDKA 1ZREA 4LFUA 1JE8A 2IPQX 3V8LA 2XGXA 2XUBA 1OYWA 3WGGA 3FMQA 4OMYA 3VB2A 4CYDA 2M45A 3H3ZA 1O57A 1IN7A 4HYEA 2ZJ2A 1KYWA 2C6YA 4BYYA 5HS8A 2ZFWA 1O3SA 3F8NA 5E8IA 5K5RA 1IUYA 2M1BA 2H6CA 2ZO4A 2MD5A 1BI3A 1Z1DA 3IHUA 3QPTA 3WGHA 2VE9A 2B0LA 2Y0MA 3P9KA 2P6SA 3WE3A 3KP2A 1IN6A 2KJBA 3QAHA 1E17A 4KDPA 2VC1A 1BC8C 3HHHA 2EJRA 3CO6C 2QBYA 3K0LA 3FM3A 3U2RA 4BXUA 3FXUA 1YW8A 5TRDA 3I58A 3GX4X 5LRRA 2PI0A 4N9HA 4HF1A 4L9TA 3GVAA 5EEGA 3IWZA 3LQRA 3EYIA 1H9GA 2Z9OA 2F5CA 4YFXF 3BROA 5D8LB 3Q5FA 1A04A 3JTGA 5IT9K 5FLXZ 4GYIA 4OIPF 1R1UA 4WCGA 5AIQA 5LGNA 3KP5A 4UUVA 3FF5A 3S2WA 1EV7A 1B1BA 5HS7A 4KN4X 3CUQA 1U3EM 3DPLC 5E20A 1GHCA 2HQNA 3BJ6A 4HLXA 1LNWA 4I09A 1JGSA 2E1CA 4IHTA 1ZLKA 2FXAA 3F8MA 1G3WA 3LSTA 1ZYRF 3GO5A 2D45A 3M1EA 2HS5A 2STWA 5LHHA 2IW5A 3SHFA 4EJVA 2K02A 3SXYA 3U1DA 3RKYA 2K86A 1FSHA 1UHWA 1KU2A 3R61A 2VXZA 2G9WA 3V7SA 2DT5A 1O3TA 2WWYA 2ESNA 2JPBA 2HDCA 4LB6B 4K2EA 4I02A 5E17F 1S6LA 1YYVA 1BI0A 1DP7P 2XAHA 2D2WA 4P55A 1XSDA 1S8NA 3LA7A 1T2KA 3IL2A 3GZ5A 3F8FA 4GCVA 5L3FA 2KIMA 1OPCA 1R58A 5BQTA 3ABTA 1R00A 1B6AA 1B9NA 3BJAA 4EGZA 4KIBA 1BI2A 2RDPA 2QQ9A 1EH7A 3LA2A 4M6XA 2DFIA 4RAZA 1H0MA 1STZA 2P4WA 4EMSA 2ETHA 3E5UA 3FM5A 5L3DA 5E1XA 5DDGA 2E7XA 3HUGA 2HFHA 1DDNA 1HXDA 1I27A 4I0BA 2HTJA 3KEQA 2VOOA 2ISYA 4MTEA 2EWNA 2MLGA 4FT8A 3I0TA 1LVAA 3LAJA 3CJNA 2NNYA 2XKPA 2DLLA 1ON1A 4HAMA 3HOSA 2O8XA 3FHZA 3Q9SA 3LWFA 4PGHA 1BM9A 2QVOA 2Y75A 4AIJA 2DK5A 4WX9A 2JZYA 1ONVA 1V4RA 4PCQA 4O5VA 4JBAA 2Q8KA 5JR3A 2ZBKA 2DW4A 1REPC 2W24A 3ZP5A 4WF2A 4LD5A 3DPTA 5L3BA 5TJJA 2FSWA 5ICFA 3CLOA 1RUNA 3TGNA 3BP8A 1YG2A 1Z6TA 2LF8A 1R1VA 3WTVC 1IXCA 4WWCA 3WTWC 1TQMA 3FX3A 4NB5A 1YIOA 5ICGA 4L9VA 1B4AA 1TNTA 3ERED 1U5TA 4EGYA 4BAYA 4Q47A 3KLOA 3PFIA 3QP6A 1FLIA 1XSVA 4MGRA 5DD4A 4Q4ZF 4HBLA 2W85A 5LLQA 1G6NA 5HDKA 1KU9A 1V3FA 1SFUA 4L0ZB 1ZHFA 3ECHA 5LGTA 2A69F 1HKTA 4A6EA 2WC2A 3B02A 4MHGA 3BDDA 3EDPA 2H27A 2KKOA 4KYWA 4E70A 4BHCA 2FA5A 2GWRA 2GZWA 4CO8A 3R0JA 2WV0A 2YR2A 5H6QA 5JFRA 3K69A 4HV6A 3ZMVA 2FBIA 1YO5C 2IVMA 2CSOA 1CGPA 2EV0A 2JT1A 3J80K 1JXSA 4G9YA 3K9TA 2Y48A 1I6XA 4DNCA 1CF7A 2X4HA 4ESJA 1FYMA 3FMRA 3AAFA 1SD6A 2XAFA 1E2XA 3WU0A 2YX7A 2V6CA 1OYIA 1G4DA 3I59A 3HRTA 1MKMA 4AWXB 2OAZA 2LSOA 5FD6A 2HEOA 3IWFA 3LFKA 3GZ6A 1UHMA 2CYYA 3RJPA 4M71A 1X3UA 2DI3A 4A12A 4LLNA 1Z6RA 2RQPA 2XAQA 2RKHA 3VEPA 3E6DA 1QBJA 3F8CA 4WXCA 2PFBA 2TDXA 4FX4A 3HIFA 3I71A 2E7WA 1XGSA 4ENMA 5K5OA 3TOBA 5ED4A 1TNSA 3TKYA 4IF4A 2FMYA 4ENNA 1ULYA 3GFIA 4OOIA 5EEHA 3HRUA 3RYRA 5HLIA 1SD4A 2ZMEB 3GXOA 4Q48A 4LK0F 4U0WA 1W4MA 4M74A 2BGCA 3KZYA 2R7FA 4M73A 2IA2A 2BYVE 3ZMUA 1RNLA 1T39A 4WXHA 3TO6A 4HF2A 1FT9A 2EFQA 5IT9Z 1K7AA 1U5TB 2HQRA 3IC7A 3V8KA 4CICA 3KETA 1ODDA 2L4AA 2D1VA 2CQKA 4I98B 4A5NA 1BN5A 2EV5A 2R3SA 2CO5A 5FO5A 1OMIA 3CUQC 1G3TA 3KE2A 4A0YA 2LKPA 1I1GA 2DBBA 2L4MA 1P4XA 4RB3C 1QZZA 1KYZA 3EETA 4ZYDA 1J75A 5LGUA 2A6EF 3QU3A 4LLGF 1J5YA 4EQQA 2PQ8A 2GIVA 4EM2A 3E6MA 3O6BB 3KP7A 4L18B 1ON2A 1D5VA 5KVRA 5E1ZB 1JHHA 3O3KA 4L5JA 4Z2YA 4HDVA 3DKWA 2BE5F 3E6BA 3OV8A 4CDGA 1T0FA 1KQ9A 5J8CA 4XSXF 1SAXA 5CVUA 3HOTA 1WKMA 1GVJA 1PDNC 4IJAA 4UVBA 1IN4A 1L0OC 3QRFF 2R7DA 3I59B 3IRRA 1TLHB 3HYIA 1F4KA 2ZCWA 1XGMA 5ILUA 3L9FA 3GWZA 4RGUA 1JHFA 3JSPA 3G73A 2DU9A 2HYFA 1K78A 2V1XA 5D8KB 3C7JA 2G7HA 4EM0B 1P6RA 5L3CA 1KQ0A 5DEQA 2OZ6A 1FY7A 1TQPA 2VT3A 2NAZA 2UXNA 1J7KA 4L9NA 2OZUA 1P4AA 2FRHA 4EJWA 2NS0A 3SZTA 3G3ZA 1MDMA 3C1DA 1J59A 4L5IA 3RKWA 2IRFG 4A0ZA 3N4MA 3JW4A 1B9MA 4O6JA 2VBZA 2A61A 3HTSB 2H09A 5FGMA 2FF4A 5D6FA 3U9GA 3GUDA 1TBXA 4KICA 4HOBA 4KNYA 1R23A 3E3VA 1FX7A 4LB5A 2EFWA 2A6HF 3BPXA 1I1SA 3T8TA 3W6KB 1LDDA 3VODA 3HRSA 1UB9A 4BHPA 5E1WA 3F8BA 4AVPA 2Q0OA 2A68F 4YFKF 3K1MA 1XMAA 2QYOA 4UVAA 1ZLJA 1U5TC 5H6RA 3SZPA 4RB0A 4HQMA 1F1ZA 2RN7A 2H94A 4A6DA 5D5VB 5BPDA 1FBQA 5LEJA 2QWWA 1SMTA 2VBWA 4G7HF 1O7FA 4A2UA 1FOKA 3I4PA 4A0XA 3FXQA 5ILSA 1EH6A 3EQLF 2FBHA 3SFZA 4H0EA 1ZGJA 2HWVA 1QPMA 3MCZA 4WK8F 4RB2C 3MQ0A 4ASNA 2HKXA 2OBPA 1BI1A 1IN5A 2IA0A 4WXDA 3J80Z 3HSRA 1YS6A 4OU0A 1PP8F 2NNNA 5LEKA 2LNBA 3I54A 1K79A 4KUMA 2O6GE 3QOPA 1L3LA 2FQ3A 4XSZF 2JPCA 2KIFA 1J0RA 4UV8A 3IKVA 1TW3A 2QBYB 4JQFA 3I64A 4UV9A 4GYGA 2EV6A 2ISZA 3IRQA 4QLCU 2JSCA 2L01A 3GW2A 4P9UA 4RGXA 5K5QA 1ZAOA 2A5YB 4IXAA 1F5TA 4OIRF 2OD5A 1IXRC 1MJ9A 4PZJA 1R5HA 4L9JA 3JAMZ 2VN2A 2ZNZA 1O3QA 2FBKA 1MDMB 3R0AA 2FMLA 3TQNA 4LLLA 2VBYA 1MJBA 5HLGA 1BJAA 1LB2A 2EB7A 1AWCA 5JVTA 2DPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CG4 A;  3RPQ A;  1U8R A;  1GXQ A;  1RZ4 A;  1S7O A;  4DQ2 A;  3L2C A;  4G7Z F;  2KRF A;  3CUQ B;  1J2X A;  2L02 A;  2DK8 A;  3PQJ A;  4S05 A;  1KGS A;  2M87 A;  2ELH A;  5CJ9 A;  3FZV A;  3KP6 A;  3VOE A;  2Z5U A;  2MLK A;  5F1R A;  1ZRF A;  4HA8 A;  2O03 A;  2RC4 A;  3NQO A;  3L7W A;  3KP3 A;  4M9S A;  5HDG A;  1VTN C;  2Z3Y A;  2M8E A;  4Y15 A;  1LEA A;  3RI4 A;  5E8G A;  3ZMZ A;  2W25 A;  2V9V A;  4GXO A;  4MEX F;  3CUO A;  4PGG A;  1GXP A;  2WTE A;  3C18 A;  2IA1 A;  4TV7 A;  2P5K A;  1WWX A;  1TQI A;  2XRN A;  5FD5 A;  4G7O F;  1IRG A;  3WTS C;  3CDH A;  2MH2 A;  3TO7 A;  4S04 A;  3DEU A;  3RDI A;  2Z33 A;  1FNN A;  4M9X A;  1MJA A;  2DAO A;  4LGW A;  3NEU A;  4MNU A;  2J5P A;  4I01 A;  4MEY F;  4IHS A;  3SQN A;  5CLS A;  3FWE A;  4OIO F;  5D4R A;  4I2O A;  2K27 A;  3KZZ A;  4IPA A;  3DQV C;  4KN7 X;  5HVQ C;  1BIB A;  3T8R A;  3HSE A;  2CFX A;  5DCM A;  4UNO A;  2P7V B;  3P7N A;  1ZH5 A;  2QEN A;  3BY6 A;  4MTD A;  4MQV A;  2E1N A;  2GXB A;  1W5S A;  2YPR A;  4LJZ F;  1D8J A;  2MA3 A;  1G3Y A;  1XDS A;  2F5F A;  3KCC A;  2PJP A;  3EYY A;  4R79 A;  3RTR A;  4LK1 F;  2O0Y A;  2JTV A;  2L54 A;  2Q2E A;  3J7A O;  4HX7 A;  3KLN A;  5CVJ A;  5JI6 A;  1YQA A;  1W7P A;  2GA1 A;  4NHJ A;  4CZZ A;  4ENK A;  4U0Y A;  4IRH A;  1LJ9 A;  4JK1 X;  1FZP B;  2XAJ A;  1XB4 A;  5LRS A;  5HOO A;  2A3S A;  2XHK A;  3LA3 A;  4ZYG A;  1S29 A;  3ELK A;  2PMH A;  1YLF A;  2K7L A;  1PP7 U;  2DPU A;  3P9I A;  3MEX A;  3F3X A;  2KJC A;  4G6D A;  5A2Q K;  1K6O A;  3KEO A;  1LDJ A;  4U7B A;  1UFM A;  4LG0 A;  1XN7 A;  2PG4 A;  3ZN1 A;  4GO1 A;  5D5W B;  4B8X A;  1EH8 A;  3DV8 A;  1YFH A;  1ZG1 A;  3QP5 A;  3WTZ A;  4F7Z A;  1PUE E;  5D5U B;  1DPR A;  3GF2 A;  3F6V A;  1S3J A;  2HKO A;  3J81 K;  2V1D A;  5BPI A;  4EV0 A;  5DYM A;  2HGC A;  1IXS B;  3BPV A;  1F9N A;  1ZG3 A;  2QUF A;  2OU2 A;  4ZZD A;  1WQ2 A;  2KIU A;  2GAU A;  1XCB A;  2XVC A;  3E97 A;  4ON0 A;  3GLX A;  4OMZ A;  3MAJ A;  3JSO A;  1H9T A;  2CGP A;  2QQB A;  4G6Q A;  1WRJ A;  1DUX C;  2HR3 A;  4XRF A;  2VOP A;  1HW2 A;  2FOK A;  4RB1 A;  1CF7 B;  1FP1 D;  1J9I A;  1SFX A;  5ERI A;  1IN8 A;  1HKQ A;  4HQE A;  1ZRD A;  5DCM B;  1T38 A;  3D5L A;  4EJT A;  4HW0 A;  2IJL A;  4I7H A;  3T0Y A;  3GFJ A;  3FXR A;  4I0A A;  4ZYE A;  1BOA A;  2RVC A;  1ZRC A;  4XBF A;  3VFZ A;  4EVI A;  2ADU A;  3HSF A;  2FEZ A;  5L3G A;  1O3R A;  4OIN F;  2QQA A;  1MGT A;  5D5X B;  3K2Z A;  2HOE A;  3K1P A;  4UHT A;  1R7J A;  2PBI A;  3ZMS A;  1KU3 A;  1W7P B;  1XGN A;  2FE3 A;  2O61 A;  2FNA A;  3DFG A;  5LHI A;  2UZK A;  1FP2 A;  2OQG A;  1RUO A;  4U7D A;  3WTT C;  1ZGA A;  3MZH A;  3ABU A;  4KIG A;  2XAG A;  2VON A;  1P92 A;  4CGZ A;  1T6S A;  3T5X A;  2G7U A;  3ZMD A;  2LDU A;  2JRT A;  3O2P E;  3EUH A;  4MQ9 F;  2MH9 A;  4RS8 A;  5F6F A;  3P9C A;  4UXN A;  1FYK A;  5DV5 A;  3ML6 A;  5JHU A;  4YFN F;  4LG0 B;  1OYY A;  5HS9 A;  4EJU A;  2XRO A;  4HV5 A;  1HW1 A;  2YX4 A;  2W84 A;  1D8K A;  1YW9 A;  3NRV A;  1Q1H A;  3M8F A;  1Z91 A;  4UVC A;  3N97 A;  1T98 A;  2HZT A;  1IAW A;  1ZN2 A;  5KK1 A;  2UXX A;  1U6G A;  3WG9 A;  1FBS A;  5HDN A;  1LDK B;  1KU7 A;  3WOD F;  2H6B A;  3T1B A;  1QGP A;  1P2F A;  5AON A;  3DXJ F;  5FFX A;  3BZ6 A;  2QM3 A;  4KMF A;  1FYL A;  2EA4 A;  2Z99 A;  2A07 F;  4HF0 A;  4YII A;  3TDU C;  4P9F A;  4KIF A;  2BV6 A;  1KA8 A;  2K4B A;  1YW7 A;  2NRA C;  2GA2 A;  5DD8 A;  1BIA A;  1RIO H;  5CVI A;  1QNT A;  3WTY C;  2STT A;  2AXL A;  4CHU A;  2AS5 F;  3V7C A;  3QU6 A;  4BHB A;  4D0P A;  2COM A;  3H92 A;  4YG2 F;  3D0S A;  2UWM A;  1ZG5 A;  3F21 A;  2HTS A;  1YTY A;  1TW2 A;  2ACJ A;  2P7C B;  3TDZ C;  3KFW X;  3WE2 A;  5J6X A;  5ICE A;  1LQ1 A;  4G94 A;  1K78 B;  5FB2 A;  3HHG A;  5BOX A;  3R6S A;  3BJO A;  4P5O A;  1AOY A;  4M6Y A;  1U78 A;  4N0B A;  3ZN0 A;  2DO7 A;  1SMY F;  4AIK A;  1S7A A;  4BQA A;  1D3Y A;  5LBQ A;  4IRI A;  2V79 A;  4NQW A;  1R5G A;  5IT3 A;  3QPH A;  4HDU A;  2L3D A;  5F64 A;  2RGV A;  2ESH A;  2O3F A;  2OQR A;  3TO9 A;  2M30 A;  3TOA A;  4Y13 A;  1KQ8 A;  4HX8 A;  1IF1 A;  5K1Y A;  1BC7 C;  4IVN A;  1XGO A;  3Q9V A;  1U2W A;  2M5W A;  3GYH X;  1Z9C A;  4Y17 A;  5FLX K;  2FU4 A;  5DUK A;  4AD9 A;  4G8X A;  3COA C;  1IZ1 A;  1FSE A;  4AIH A;  3WTX C;  1ZAR A;  2ZNY A;  4GGG A;  1R36 A;  3RYP A;  2GXG A;  3E5X A;  1WSU A;  5AIP A;  1OR7 A;  4M9Z A;  2EFN A;  2PLY A;  1B59 A;  3W6J B;  4U88 A;  2ZME A;  3MZY A;  5D4S A;  4ZZL A;  3RPU A;  4OIQ F;  3ECO A;  2EFP A;  1YS7 A;  5DCF A;  3M7G A;  1G3S A;  1UCR A;  2QLZ A;  2P8T A;  4LMY A;  5A2Q Z;  1FWZ A;  3E6C C;  3DF8 A;  2BBY A;  4FX0 A;  4XLP F;  2VBX A;  3LQQ A;  5BMZ A;  2NYX A;  3RIR A;  1QQI A;  1USS A;  4R1H A;  5J8F A;  1HSJ A;  1XDU A;  1HBX G;  3C3W A;  1P4W A;  5E18 F;  3CO7 C;  3V4G A;  1C0W A;  4N9I A;  4ETS A;  4HLY A;  2DQL A;  2EA2 A;  2P5L C;  2BEO A;  2J5O A;  1W7P D;  3BOQ A;  3J81 Z;  3I5U A;  1Z7U A;  3FMS A;  3R60 A;  1QO0 D;  5D6E A;  2HYG D;  1MD0 A;  4A5M A;  4BNC A;  3CTA A;  2V1U A;  5ICC A;  4Q5S F;  2K4J A;  2VT2 A;  1HW5 A;  1SD7 A;  1R1T A;  3M9A A;  5LHG A;  2OA4 A;  2EFO A;  2XIG A;  3E5Q A;  3OOP A;  5H20 A;  2X0L A;  1TTY A;  4BH9 A;  4EM1 A;  2XKO A;  3F23 A;  5ILV A;  3PQK A;  1LEB A;  1HST A;  4KA4 A;  3F22 A;  1WI9 A;  3RKX A;  3B73 A;  3MWM A;  3F6O A;  3ZPL A;  3GFM A;  1IRF A;  4B09 A;  2DQR A;  2MBF A;  2CW0 F;  2YSR A;  2MC3 A;  1BBY A;  1I5Z A;  4R8H A;  2LF7 A;  1QZY A;  6PAX A;  3BWG A;  3H3U A;  1Z05 A;  4ESB A;  3ZQ7 A;  3WU1 B;  3GEZ A;  3V8J A;  3JAM K;  3ULQ B;  2ZXJ A;  1FPQ A;  1NHA A;  4KT5 C;  2ZKZ A;  1FBU A;  4P96 A;  1SD5 A;  3MFK A;  3REO A;  3K1N A;  5CYV A;  1XMK A;  1RI7 A;  1MZB A;  3DP7 A;  2VE8 A;  4L0Y B;  2YU3 A;  2GQQ A;  4QWQ A;  3IKT A;  4KFC A;  1FC3 A;  3ISP A;  4ESF A;  4ZH4 F;  2FNP A;  1HQC A;  2PEX A;  1W5T A;  3WTU C;  3HRM A;  4U0V A;  2F5E A;  2RNJ A;  1XSX A;  4YIF A;  3JTH A;  2CWE A;  4FHT A;  4RAY A;  2QZ8 A;  3HTU A;  4ZYH A;  3R4K A;  5HLH A;  1R22 A;  2PN6 A;  4EJO A;  2F5D A;  4RGR A;  4CXF A;  1O7L A;  1HKS A;  5FFZ A;  3WGI A;  4HX4 A;  2P6T A;  2VOD A;  5L3E A;  2IP2 A;  2DTR A;  4HZF A;  3ZMT A;  5DUI A;  3KP4 A;  4O3M A;  5CVV A;  1DPU A;  3L09 A;  1XCV A;  3LAP A;  3GFL A;  2W57 A;  2XV4 S;  4KMU X;  4IRG A;  2PMU A;  3F72 A;  3V7R A;  4M72 A;  5BS6 A;  1SFE A;  3ROU A;  2RV8 A;  4ENJ A;  1OKR A;  2D1H A;  1XD7 A;  3L00 A;  2IT0 A;  5CVR A;  1Y0U A;  3I53 A;  4RGS A;  4XLN F;  3M8E A;  2XAS A;  2F2E A;  2EK5 A;  1IW7 F;  2P5V A;  1UST A;  2VC0 A;  4PDK A;  1ZRE A;  4LFU A;  1JE8 A;  2IPQ X;  3V8L A;  2XGX A;  2XUB A;  1OYW A;  3WGG A;  3FMQ A;  4OMY A;  3VB2 A;  4CYD A;  2M45 A;  3H3Z A;  1O57 A;  1IN7 A;  4HYE A;  2ZJ2 A;  1KYW A;  2C6Y A;  4BYY A;  5HS8 A;  2ZFW A;  1O3S A;  3F8N A;  5E8I A;  5K5R A;  1IUY A;  2M1B A;  2H6C A;  2ZO4 A;  2MD5 A;  1BI3 A;  1Z1D A;  3IHU A;  3QPT A;  3WGH A;  2VE9 A;  2B0L A;  2Y0M A;  3P9K A;  2P6S A;  3WE3 A;  3KP2 A;  1IN6 A;  2KJB A;  3QAH A;  1E17 A;  4KDP A;  2VC1 A;  1BC8 C;  3HHH A;  2EJR A;  3CO6 C;  2QBY A;  3K0L A;  3FM3 A;  3U2R A;  4BXU A;  3FXU A;  1YW8 A;  5TRD A;  3I58 A;  3GX4 X;  5LRR A;  2PI0 A;  4N9H A;  4HF1 A;  4L9T A;  3GVA A;  5EEG A;  3IWZ A;  3LQR A;  3EYI A;  1H9G A;  2Z9O A;  2F5C A;  4YFX F;  3BRO A;  5D8L B;  3Q5F A;  1A04 A;  3JTG A;  5IT9 K;  5FLX Z;  4GYI A;  4OIP F;  1R1U A;  4WCG A;  5AIQ A;  5LGN A;  3KP5 A;  4UUV A;  3FF5 A;  3S2W A;  1EV7 A;  1B1B A;  5HS7 A;  4KN4 X;  3CUQ A;  1U3E M;  3DPL C;  5E20 A;  1GHC A;  2HQN A;  3BJ6 A;  4HLX A;  1LNW A;  4I09 A;  1JGS A;  2E1C A;  4IHT A;  1ZLK A;  2FXA A;  3F8M A;  1G3W A;  3LST A;  1ZYR F;  3GO5 A;  2D45 A;  3M1E A;  2HS5 A;  2STW A;  5LHH A;  2IW5 A;  3SHF A;  4EJV A;  2K02 A;  3SXY A;  3U1D A;  3RKY A;  2K86 A;  1FSH A;  1UHW A;  1KU2 A;  3R61 A;  2VXZ A;  2G9W A;  3V7S A;  2DT5 A;  1O3T A;  2WWY A;  2ESN A;  2JPB A;  2HDC A;  4LB6 B;  4K2E A;  4I02 A;  5E17 F;  1S6L A;  1YYV A;  1BI0 A;  1DP7 P;  2XAH A;  2D2W A;  4P55 A;  1XSD A;  1S8N A;  3LA7 A;  1T2K A;  3IL2 A;  3GZ5 A;  3F8F A;  4GCV A;  5L3F A;  2KIM A;  1OPC A;  1R58 A;  5BQT A;  3ABT A;  1R00 A;  1B6A A;  1B9N A;  3BJA A;  4EGZ A;  4KIB A;  1BI2 A;  2RDP A;  2QQ9 A;  1EH7 A;  3LA2 A;  4M6X A;  2DFI A;  4RAZ A;  1H0M A;  1STZ A;  2P4W A;  4EMS A;  2ETH A;  3E5U A;  3FM5 A;  5L3D A;  5E1X A;  5DDG A;  2E7X A;  3HUG A;  2HFH A;  1DDN A;  1HXD A;  1I27 A;  4I0B A;  2HTJ A;  3KEQ A;  2VOO A;  2ISY A;  4MTE A;  2EWN A;  2MLG A;  4FT8 A;  3I0T A;  1LVA A;  3LAJ A;  3CJN A;  2NNY A;  2XKP A;  2DLL A;  1ON1 A;  4HAM A;  3HOS A;  2O8X A;  3FHZ A;  3Q9S A;  3LWF A;  4PGH A;  1BM9 A;  2QVO A;  2Y75 A;  4AIJ A;  2DK5 A;  4WX9 A;  2JZY A;  1ONV A;  1V4R A;  4PCQ A;  4O5V A;  4JBA A;  2Q8K A;  5JR3 A;  2ZBK A;  2DW4 A;  1REP C;  2W24 A;  3ZP5 A;  4WF2 A;  4LD5 A;  3DPT A;  5L3B A;  5TJJ A;  2FSW A;  5ICF A;  3CLO A;  1RUN A;  3TGN A;  3BP8 A;  1YG2 A;  1Z6T A;  2LF8 A;  1R1V A;  3WTV C;  1IXC A;  4WWC A;  3WTW C;  1TQM A;  3FX3 A;  4NB5 A;  1YIO A;  5ICG A;  4L9V A;  1B4A A;  1TNT A;  3ERE D;  1U5T A;  4EGY A;  4BAY A;  4Q47 A;  3KLO A;  3PFI A;  3QP6 A;  1FLI A;  1XSV A;  4MGR A;  5DD4 A;  4Q4Z F;  4HBL A;  2W85 A;  5LLQ A;  1G6N A;  5HDK A;  1KU9 A;  1V3F A;  1SFU A;  4L0Z B;  1ZHF A;  3ECH A;  5LGT A;  2A69 F;  1HKT A;  4A6E A;  2WC2 A;  3B02 A;  4MHG A;  3BDD A;  3EDP A;  2H27 A;  2KKO A;  4KYW A;  4E70 A;  4BHC A;  2FA5 A;  2GWR A;  2GZW A;  4CO8 A;  3R0J A;  2WV0 A;  2YR2 A;  5H6Q A;  5JFR A;  3K69 A;  4HV6 A;  3ZMV A;  2FBI A;  1YO5 C;  2IVM A;  2CSO A;  1CGP A;  2EV0 A;  2JT1 A;  3J80 K;  1JXS A;  4G9Y A;  3K9T A;  2Y48 A;  1I6X A;  4DNC A;  1CF7 A;  2X4H A;  4ESJ A;  1FYM A;  3FMR A;  3AAF A;  1SD6 A;  2XAF A;  1E2X A;  3WU0 A;  2YX7 A;  2V6C A;  1OYI A;  1G4D A;  3I59 A;  3HRT A;  1MKM A;  4AWX B;  2OAZ A;  2LSO A;  5FD6 A;  2HEO A;  3IWF A;  3LFK A;  3GZ6 A;  1UHM A;  2CYY A;  3RJP A;  4M71 A;  1X3U A;  2DI3 A;  4A12 A;  4LLN A;  1Z6R A;  2RQP A;  2XAQ A;  2RKH A;  3VEP A;  3E6D A;  1QBJ A;  3F8C A;  4WXC A;  2PFB A;  2TDX A;  4FX4 A;  3HIF A;  3I71 A;  2E7W A;  1XGS A;  4ENM A;  5K5O A;  3TOB A;  5ED4 A;  1TNS A;  3TKY A;  4IF4 A;  2FMY A;  4ENN A;  1ULY A;  3GFI A;  4OOI A;  5EEH A;  3HRU A;  3RYR A;  5HLI A;  1SD4 A;  2ZME B;  3GXO A;  4Q48 A;  4LK0 F;  4U0W A;  1W4M A;  4M74 A;  2BGC A;  3KZY A;  2R7F A;  4M73 A;  2IA2 A;  2BYV E;  3ZMU A;  1RNL A;  1T39 A;  4WXH A;  3TO6 A;  4HF2 A;  1FT9 A;  2EFQ A;  5IT9 Z;  1K7A A;  1U5T B;  2HQR A;  3IC7 A;  3V8K A;  4CIC A;  3KET A;  1ODD A;  2L4A A;  2D1V A;  2CQK A;  4I98 B;  4A5N A;  1BN5 A;  2EV5 A;  2R3S A;  2CO5 A;  5FO5 A;  1OMI A;  3CUQ C;  1G3T A;  3KE2 A;  4A0Y A;  2LKP A;  1I1G A;  2DBB A;  2L4M A;  1P4X A;  4RB3 C;  1QZZ A;  1KYZ A;  3EET A;  4ZYD A;  1J75 A;  5LGU A;  2A6E F;  3QU3 A;  4LLG F;  1J5Y A;  4EQQ A;  2PQ8 A;  2GIV A;  4EM2 A;  3E6M A;  3O6B B;  3KP7 A;  4L18 B;  1ON2 A;  1D5V A;  5KVR A;  5E1Z B;  1JHH A;  3O3K A;  4L5J A;  4Z2Y A;  4HDV A;  3DKW A;  2BE5 F;  3E6B A;  3OV8 A;  4CDG A;  1T0F A;  1KQ9 A;  5J8C A;  4XSX F;  1SAX A;  5CVU A;  3HOT A;  1WKM A;  1GVJ A;  1PDN C;  4IJA A;  4UVB A;  1IN4 A;  1L0O C;  3QRF F;  2R7D A;  3I59 B;  3IRR A;  1TLH B;  3HYI A;  1F4K A;  2ZCW A;  1XGM A;  5ILU A;  3L9F A;  3GWZ A;  4RGU A;  1JHF A;  3JSP A;  3G73 A;  2DU9 A;  2HYF A;  1K78 A;  2V1X A;  5D8K B;  3C7J A;  2G7H A;  4EM0 B;  1P6R A;  5L3C A;  1KQ0 A;  5DEQ A;  2OZ6 A;  1FY7 A;  1TQP A;  2VT3 A;  2NAZ A;  2UXN A;  1J7K A;  4L9N A;  2OZU A;  1P4A A;  2FRH A;  4EJW A;  2NS0 A;  3SZT A;  3G3Z A;  1MDM A;  3C1D A;  1J59 A;  4L5I A;  3RKW A;  2IRF G;  4A0Z A;  3N4M A;  3JW4 A;  1B9M A;  4O6J A;  2VBZ A;  2A61 A;  3HTS B;  2H09 A;  5FGM A;  2FF4 A;  5D6F A;  3U9G A;  3GUD A;  1TBX A;  4KIC A;  4HOB A;  4KNY A;  1R23 A;  3E3V A;  1FX7 A;  4LB5 A;  2EFW A;  2A6H F;  3BPX A;  1I1S A;  3T8T A;  3W6K B;  1LDD A;  3VOD A;  3HRS A;  1UB9 A;  4BHP A;  5E1W A;  3F8B A;  4AVP A;  2Q0O A;  2A68 F;  4YFK F;  3K1M A;  1XMA A;  2QYO A;  4UVA A;  1ZLJ A;  1U5T C;  5H6R A;  3SZP A;  4RB0 A;  4HQM A;  1F1Z A;  2RN7 A;  2H94 A;  4A6D A;  5D5V B;  5BPD A;  1FBQ A;  5LEJ A;  2QWW A;  1SMT A;  2VBW A;  4G7H F;  1O7F A;  4A2U A;  1FOK A;  3I4P A;  4A0X A;  3FXQ A;  5ILS A;  1EH6 A;  3EQL F;  2FBH A;  3SFZ A;  4H0E A;  1ZGJ A;  2HWV A;  1QPM A;  3MCZ A;  4WK8 F;  4RB2 C;  3MQ0 A;  4ASN A;  2HKX A;  2OBP A;  1BI1 A;  1IN5 A;  2IA0 A;  4WXD A;  3J80 Z;  3HSR A;  1YS6 A;  4OU0 A;  1PP8 F;  2NNN A;  5LEK A;  2LNB A;  3I54 A;  1K79 A;  4KUM A;  2O6G E;  3QOP A;  1L3L A;  2FQ3 A;  4XSZ F;  2JPC A;  2KIF A;  1J0R A;  4UV8 A;  3IKV A;  1TW3 A;  2QBY B;  4JQF A;  3I64 A;  4UV9 A;  4GYG A;  2EV6 A;  2ISZ A;  3IRQ A;  4QLC U;  2JSC A;  2L01 A;  3GW2 A;  4P9U A;  4RGX A;  5K5Q A;  1ZAO A;  2A5Y B;  4IXA A;  1F5T A;  4OIR F;  2OD5 A;  1IXR C;  1MJ9 A;  4PZJ A;  1R5H A;  4L9J A;  3JAM Z;  2VN2 A;  2ZNZ A;  1O3Q A;  2FBK A;  1MDM B;  3R0A A;  2FML A;  3TQN A;  4LLL A;  2VBY A;  1MJB A;  5HLG A;  1BJA A;  1LB2 A;  2EB7 A;  1AWC A;  5JVT A;  2DPD A; 
#chains in the Genus database with same CATH topology
 4IO9 F;  2X6Y A;  2CG4 A;  1JTX A;  1NG7 A;  2WB1 N;  3RPQ A;  3VYS B;  4AUX A;  4OWR B;  1U8R A;  2DT6 A;  1GXQ A;  1RZ4 A;  1S7O A;  4DQ2 A;  3L2C A;  4G7Z F;  2KRF A;  5KHD A;  3A1Y A;  5J1U A;  3CUQ B;  4BS9 A;  1J2X A;  2M0C A;  1ETX A;  3FK6 A;  2L02 A;  4EAT A;  2DK8 A;  3PQJ A;  4BEH A;  1MIJ A;  3ZQH A;  3CF5 F;  2JA8 J;  4S05 A;  1KGS A;  1TZL A;  2ELH A;  2M87 A;  1Z77 A;  3BR2 A;  4JX4 A;  1WZ2 A;  1AKH B;  5CJ9 A;  3IUO A;  1VQO I;  1POG A;  2TCT A;  2XSD C;  3HOU J;  3FZV A;  3KP6 A;  3VOE A;  2KL4 A;  3OS0 A;  1YRN A;  5FRM A;  2Z5U A;  2MLK A;  2X1D A;  5F1R A;  1ZRF A;  1KON A;  4HA8 A;  2O03 A;  1UZC A;  2RC4 A;  2XPU A;  4UUT A;  3PIP F;  1AA7 A;  2H8W A;  3MD2 A;  3NQO A;  2R7S A;  1F43 A;  3L7W A;  3KP3 A;  4M9S A;  5HDG A;  2MFZ A;  4II2 A;  1VTN C;  2Z3Y A;  2M8E A;  4Y15 A;  1LEA A;  3IP4 B;  2NS8 A;  3RI4 A;  5E8G A;  3ZMZ A;  2W25 A;  2DMQ A;  2K9L A;  2V9V A;  2Y31 A;  2XDV A;  4X0G A;  4GXO A;  4MEX F;  4XLE A;  1SFO J;  3CUO A;  4PGG A;  3WHB A;  4MFD A;  1GXP A;  2Q1Z B;  1MBE A;  2WTE A;  3C18 A;  2IA1 A;  2E1O A;  4TV7 A;  3CC7 I;  2P5K A;  1WWX A;  3CJQ B;  1VQL I;  4XOT A;  1TQI A;  4GFB A;  4NC7 A;  2XRN A;  2OTL I;  5FD5 A;  3SYT A;  1I39 A;  2GOM A;  4G7O F;  1IRG A;  2LYC A;  2KHM A;  3WTS C;  1RR7 A;  4E6K G;  2BVL A;  3CDH A;  3GTG J;  1VI0 A;  2MH2 A;  3TO7 A;  4S04 A;  1K61 A;  3AKZ A;  3DEU A;  3RDI A;  2LK2 A;  3UKG A;  4J19 A;  2Z33 A;  4A69 C;  3CES A;  1FNN A;  4M9X A;  4A93 J;  5FKK A;  1MJA A;  2DAO A;  4LGW A;  3NEU A;  4MNU A;  3S1Q J;  1ZK8 A;  2EIN H;  2J5P A;  4XIC A;  1HOM A;  4I01 A;  3HZJ A;  4MEY F;  4IHS A;  3SQN A;  5CLS A;  4CCK A;  2DA4 A;  1JUP A;  3FWE A;  1SVO A;  3ZQQ A;  2XPV A;  5F08 A;  4OIO F;  3BG7 A;  5D4R A;  3AFH A;  3K4M A;  4I2O A;  4J01 A;  1SC7 A;  2K27 A;  2DYR H;  3KZZ A;  4IPA A;  2IGM A;  4XKC A;  2FX0 A;  3DQV C;  4KN7 X;  4A3M J;  5HVQ C;  1BIB A;  3T8R A;  3HSE A;  2CFX A;  5GTH C;  5DCM A;  4UNO A;  4AVZ A;  2P7V B;  5E3M A;  3P7N A;  1ZH5 A;  2QEN A;  3N05 A;  1JTY A;  1VQK I;  4CYC A;  3BY6 A;  3BQZ A;  2F5V A;  2IS1 A;  2B9S A;  4MTD A;  5EJC A;  4BUP A;  4MQV A;  2PMZ A;  2E1N A;  2X6W A;  2LBF B;  2BXZ A;  2GXB A;  1W5S A;  2YPR A;  4LJZ F;  1RKT A;  1D8J A;  4CCM A;  4PJJ A;  3A01 A;  3HUG B;  4ANJ A;  2WV1 A;  2MA3 A;  1G3Y A;  2Z16 A;  1XDS A;  2F5F A;  3KCC A;  5FRO A;  2K3P A;  4E7S A;  2HVQ A;  2PJP A;  5IPA A;  1LE8 A;  4S0H B;  3EYY A;  2CW7 A;  1U8B A;  4R79 A;  3RTR A;  1UEL B;  3S32 A;  2LRE A;  2Y9Y A;  4XMY A;  3CC4 I;  4LK1 F;  4D9J A;  3I56 I;  1NH3 A;  1XPX A;  2O0Y A;  1B72 A;  1WFX A;  2JTV A;  2L54 A;  2L7Z A;  4JX5 A;  2E1M C;  2Q2E A;  3J7A O;  2NXN B;  3BLY A;  4HX7 A;  3H9G A;  3KLN A;  3U1K A;  5CVJ A;  5JI6 A;  3L2U A;  1YQA A;  1W7P A;  2GA1 A;  4RDU A;  4NHJ A;  4CZZ A;  4P1W A;  5FKM A;  4ENK A;  4U0Y A;  4ZC3 A;  1XMX A;  4JOM A;  4IRH A;  1ETV A;  4XLA A;  1LJ9 A;  4JK1 X;  1FZP B;  2QQ8 A;  2XAJ A;  1XB4 A;  3HGY A;  5LRS A;  4A3E J;  3K70 D;  5HOO A;  3GTM J;  2A3S A;  2BY1 A;  2XHK A;  3LA3 A;  2BVM A;  4ZYG A;  1S29 A;  3O8H A;  5TGT A;  3ELK A;  3DCF A;  4LIU A;  2CJJ A;  2PMH A;  1MBK A;  1YLF A;  1HDP A;  4C2M J;  2K7L A;  1PP7 U;  2DPU A;  3P9I A;  3MEX A;  3WG7 H;  4RBO A;  4IQJ A;  2L7K A;  3F3X A;  3MVP A;  2KJC A;  4G6D A;  5KAF C;  2ZJP F;  5A2Q K;  4BEH B;  1K6O A;  1QPI A;  1Y1V J;  3BR6 A;  3KEO A;  4DYC A;  1LDJ A;  3FBI B;  4U7B A;  1RR8 C;  2GIZ A;  1UFM A;  4LG0 A;  2B7E A;  1XN7 A;  1SEU A;  2PG4 A;  2W48 A;  4HNU A;  3ZN1 A;  3OYM A;  2VPL A;  2WB1 A;  1T8I A;  4GO1 A;  4IKF A;  5D5W B;  4B8X A;  1EH8 A;  1GDT A;  2M34 A;  3DV8 A;  1YFH A;  1ZG1 A;  3QP5 A;  4IL6 C;  1ENH A;  3IV5 A;  2HVS A;  2R5Y A;  3MKL A;  1LFP A;  2IEK A;  3NAR A;  3S15 J;  3WTZ A;  5M5X J;  1FJL A;  3JR9 A;  4F7Z A;  1PUE E;  5D5U B;  1DPR A;  3GF2 A;  1VQ6 I;  3F6V A;  1S3J A;  1ITY A;  4XON A;  2HKO A;  3J81 K;  2V1D A;  4X6A J;  5BPI A;  4EV0 A;  5DYM A;  2HGC A;  1IXS B;  3BPV A;  4V2F A;  1F9N A;  1ZG3 A;  3H3V K;  2QUF A;  3S1N J;  2OU2 A;  4ZZD A;  5LD2 C;  1VFC A;  3L2R A;  5EGO A;  1WJC A;  1G59 A;  1FOY A;  1WQ2 A;  4BJT A;  4BQO A;  1Z7L A;  2KIU A;  2GAU A;  2L7F P;  2BXY A;  1Q1V A;  4XKB A;  1XCB A;  2XVC A;  2KPM A;  2P0W A;  3E97 A;  4ON0 A;  3GLX A;  4OMZ A;  3MAJ A;  3JSO A;  1H9T A;  3PSF A;  3TED A;  2CGP A;  2QQB A;  4MFE A;  2R92 J;  1LFU P;  2VIX A;  4G6Q A;  1WRJ A;  3MN2 A;  2MGQ A;  3L2V A;  2HR3 A;  1DUX C;  2OTJ I;  4XRF A;  3CJR B;  2VOP A;  4RAG A;  1HW2 A;  2ZSH B;  4ZJZ A;  4BXX J;  2FOK A;  3CZ6 A;  2D5V A;  3VWB A;  3S93 A;  4RB1 A;  2FOW A;  3CQZ J;  1CF7 B;  1FP1 D;  4UUS A;  3JRC A;  1J9I A;  4N4N B;  1SFX A;  2HYJ A;  4B48 A;  2IBD A;  3CLQ A;  1IN8 A;  5ERI A;  3UNG C;  1HKQ A;  3BG5 A;  4HQE A;  1ZRD A;  5DCM B;  2JMW A;  3CJT B;  2AXT C;  1T38 A;  3D5L A;  3PO2 J;  4EJT A;  1V55 H;  1WCM J;  2DFE A;  4HW0 A;  4CYC B;  2CFO A;  1IGN A;  3OL3 A;  2L7M P;  2IJL A;  4C2U A;  4RA2 A;  2WAQ N;  4I7H A;  1YHQ I;  3T0Y A;  3DLA A;  1QVU A;  3GFJ A;  5DTD A;  1BA5 A;  3FXR A;  3K6G A;  4I0A A;  3LOC A;  1Y56 A;  2CQQ A;  1W5C C;  4ZYE A;  1BOA A;  1UHS A;  2RVC A;  1ZRC A;  4XBF A;  4E7H A;  1R4M B;  3FXO A;  3VFZ A;  5KCM A;  5HNF A;  4II3 A;  2ADU A;  2DJI A;  4EVI A;  3HSF A;  2FD5 A;  4DOZ A;  2FEZ A;  1HA8 A;  5L3G A;  1XTA A;  1O3R A;  2DOA A;  4GRI A;  4OIN F;  2QQA A;  1ETW A;  4H4K C;  1MGT A;  4IQ4 A;  2CV0 A;  1FIA A;  4E7L A;  1UG0 A;  3ZRG A;  3ASO H;  1NTC A;  5D5X B;  3D5R C;  3K2Z A;  2HOE A;  2ID6 A;  3K1P A;  3CCE I;  2NVX J;  1B72 B;  3HDD A;  3G71 I;  1OCC H;  4UHT A;  1R7J A;  2GLO A;  2Q2E B;  2PBI A;  1SVM A;  2ZSI B;  1N78 A;  3ZMS A;  1KU3 A;  2M9H A;  1W7P B;  1XGN A;  2FE3 A;  2O61 A;  2Y69 H;  1FTT A;  2FNA A;  2QA4 I;  4IX7 A;  3DFG A;  1TP4 A;  5J1Y A;  5LHI A;  2UZK A;  1FP2 A;  2OQG A;  1OCR H;  1RUO A;  4U7D A;  2RRE A;  3WTT C;  3ZCO A;  1AU7 A;  3F0C A;  1TWF J;  1ZGA A;  4HRI A;  3H35 A;  3MZH A;  3ABU A;  4KIG A;  3Q3S A;  4NNJ A;  4BBR J;  1BR1 A;  1ETY A;  2XAG A;  5JVG F;  4G12 A;  2VON A;  3DBR B;  3LSH A;  3GZN B;  2R7O A;  4BL0 B;  1P92 A;  2JVG A;  4CGZ A;  4M3F A;  1T6S A;  3T5X A;  2G7U A;  3ZMD A;  2LDU A;  2QKM B;  1JUS A;  5J3L A;  5GAH J;  3HJE A;  2JRT A;  3O2P E;  5F27 A;  1QU3 A;  4DBQ A;  3EUH A;  4MQ9 F;  2MH9 A;  4RS8 A;  5F6F A;  1QA6 A;  3P9C A;  4UXN A;  2NVU B;  3PNV A;  1FYK A;  5DV5 A;  3ML6 A;  5JHU A;  3GBG A;  4YFN F;  2LR8 A;  4LG0 B;  1S72 I;  1OCT C;  1OYY A;  5HS9 A;  4HV5 A;  4BKX A;  2XGD A;  4EJU A;  1HW1 A;  2YX4 A;  2XRO A;  1B8I A;  3AL0 C;  2W84 A;  3HOZ J;  1D8K A;  1YW9 A;  3NRV A;  3CD6 I;  1Q1H A;  3M8F A;  1Z91 A;  5DM7 F;  2KIQ A;  4UVC A;  3KEY A;  5DM6 F;  3N97 A;  3OYK A;  1T98 A;  2HZT A;  1IC8 A;  2R5Y B;  1IAW A;  1ZN2 A;  1P7I A;  5K7H A;  2R7U A;  2M7B A;  5KK1 A;  2UXX A;  1U6G A;  3WG9 A;  1FBS A;  3LNQ A;  5HDN A;  1LDK B;  1KU7 A;  1QVT A;  5IYC J;  1GV5 A;  5CKT A;  2H6B A;  3WOD F;  3T1B A;  1QGP A;  2VJ4 A;  1D1A A;  3KYL A;  1HLV A;  4YEL A;  1D0Y A;  1P2F A;  5AON A;  4JP0 A;  5EF6 A;  5EGO B;  3DXJ F;  5FFX A;  3BZ6 A;  1EA3 A;  3PL8 A;  2QM3 A;  5FKO A;  4KMF A;  1FYL A;  2V9K A;  4A3I J;  2EA4 A;  4BJ6 C;  3LSI A;  1ZQ3 P;  2Z99 A;  2LD5 A;  2DFH A;  2A07 F;  4HF0 A;  4YII A;  3TDU C;  3BTJ A;  4P9F A;  4KIF A;  4X1E A;  5IOZ A;  2BV6 A;  1X1D A;  3G1O A;  1KA8 A;  2K4B A;  4L5E A;  1P7J A;  1YW7 A;  2NRA C;  2GA2 A;  1K83 J;  5DD8 A;  5F1J A;  1BIA A;  3LSG A;  2QSG X;  1DGR M;  2Y30 A;  4XN3 A;  5CVI A;  1RIO H;  2OCC H;  1IRZ A;  1R9T J;  4ZDL A;  4UUS B;  4DGW B;  1QNT A;  4MLO A;  3WTY C;  2STT A;  2AXL A;  4CHU A;  2A5W A;  1O4X A;  2AS5 F;  2IGK A;  1E3P A;  2RQQ A;  3V7C A;  3QU6 A;  4BHB A;  1XX5 A;  2DA1 A;  3G2B A;  1WH7 A;  4D0P A;  2COM A;  3H92 A;  2E36 A;  1JT0 A;  4YG2 F;  2O9L A;  4XID A;  1JT6 A;  1RPW A;  3Q0V A;  3D0S A;  3BG3 A;  2UWM A;  2DMN A;  1ZG5 A;  2DOD A;  2X6O A;  4PFP A;  5IY5 H;  1OQY A;  3F21 A;  2HTS A;  1YTY A;  3QYE A;  1TW2 A;  2ACJ A;  2P7C B;  2EBI A;  4CCL A;  4C2T A;  3TDZ C;  3KFW X;  2RNG A;  3WE2 A;  1A31 A;  5FLM J;  5J6X A;  3JRD A;  4PSX A;  2E1M B;  3G6E I;  5ICE A;  1YJW I;  2CUE A;  5J4Y A;  1LQ1 A;  4G94 A;  1X3W B;  1K78 B;  5FB2 A;  3HHG A;  5BOX A;  1MMN A;  1FEX A;  3K4J A;  3R6S A;  3BJO A;  4P5O A;  1AOY A;  4M6Y A;  3QYF A;  1EJ9 A;  2QEX I;  1U78 A;  4N0B A;  3FKJ A;  2DO7 A;  1SMY F;  3ZN0 A;  1HC8 A;  4AIK A;  1S7A A;  4BQA A;  1D3Y A;  3W2W A;  5LBQ A;  3V42 A;  4IRI A;  2V79 A;  4NQW A;  1R5G A;  2CV2 A;  5IT3 A;  3QPH A;  4BDY A;  1H89 C;  2JQ7 A;  2BZT A;  2G0E A;  4HDU A;  2L3D A;  5F64 A;  2RGV A;  2ESH A;  2O3F A;  2OQR A;  3BG9 A;  3TO9 A;  1VQ4 I;  2M30 A;  3TOA A;  4A3C J;  4Y13 A;  1K4S A;  3LSR A;  1XC5 A;  1KQ8 A;  4HX8 A;  2NVT J;  1IF1 A;  3OR1 C;  5K1Y A;  5FJ8 J;  3GTL J;  1BC7 C;  2L0K A;  4IVN A;  3IAS 2;  4A3G J;  1XGO A;  3CP2 A;  1YE9 A;  1Z21 A;  2E71 A;  3Q9V A;  1U2W A;  4DJA A;  2M5W A;  3OS2 A;  3GYH X;  1Z9C A;  2DJN A;  4Y17 A;  3W2V A;  5FKN A;  5C4J J;  5FLX K;  1YIJ I;  2FU4 A;  5DUK A;  2NVY J;  4AD9 A;  5JLX A;  2ID3 A;  4G8X A;  5GAD J;  3COA C;  1WJD A;  1IZ1 A;  3S1M J;  1DGW Y;  4JYK A;  1FSE A;  4AIH A;  3WTX C;  4RLQ A;  1ZAR A;  2MYS A;  2BY2 A;  2ZNY A;  4GGG A;  3GTK J;  1R36 A;  3RYP A;  2GXG A;  1OJL A;  2DOF A;  3E5X A;  3HXL A;  1G8X A;  1MBH A;  5AIP A;  1OR7 A;  1WSU A;  4M9Z A;  1B8I B;  2EFN A;  2CUJ A;  2PLY A;  1B59 A;  1X4O A;  4A3D J;  3W6J B;  4U88 A;  2ZME A;  3MZY A;  5D4S A;  4ZZL A;  2XAU A;  3RPU A;  4OIQ F;  2CH0 A;  3ECO A;  3ABK H;  4ZDP A;  1ETO A;  2EFP A;  1YS7 A;  5DCF A;  2KDZ A;  4LIV A;  4NUB A;  3M7G A;  3S3M A;  1JGG A;  1GV2 A;  1G3S A;  1T56 A;  1UCR A;  3UR3 C;  2MAB A;  3SEZ A;  2QLZ A;  2PJR A;  2VAS A;  2XGE A;  1MBF A;  2P8T A;  4LMY A;  3OMY A;  1VND A;  4XRS A;  2O7O A;  5C44 J;  3G1L A;  4CSW A;  2W82 A;  5A2Q Z;  1FWZ A;  3E6C C;  4F52 A;  3DF8 A;  2BBY A;  4FX0 A;  2AO9 A;  1K6Y A;  2TRT A;  4QPO A;  4XLP F;  3IH4 A;  2VBX A;  1MSF C;  3LQQ A;  5BMZ A;  3FXM A;  2NYX A;  4PK4 A;  3RIR A;  1V5G A;  1QQI A;  1USS A;  4R1H A;  5J8F A;  1HSJ A;  2GBY A;  4Y4R A;  2XGC A;  2L9N A;  2M7A A;  1XDU A;  1V5F A;  3SDB A;  1HBX G;  3H0D A;  3C3W A;  2E60 A;  4NC6 A;  1P4W A;  4UB6 C;  5E18 F;  3CO7 C;  3V4G A;  1C0W A;  2YUS A;  4N9I A;  4XLH A;  2BHZ A;  4ETS A;  4HLY A;  2DQL A;  2EA2 A;  2P5L C;  2BEO A;  2J5O A;  1W0U A;  1W7P D;  3RKQ A;  3BOQ A;  3G1M A;  3J81 Z;  3I5U A;  2ICW G;  1TL8 A;  4GDF A;  1Z7U A;  2L9R A;  3FMS A;  4BGD A;  2CW8 A;  3R60 A;  2LMD A;  3SEQ A;  2H1K A;  1D0X A;  3OOU A;  1QO0 D;  5D6E A;  1WJA A;  2ZXH A;  3DWL E;  4E7Z A;  2HYG D;  3K4N A;  3CC2 I;  1MNE A;  1MD0 A;  4A5M A;  3S17 J;  3QYB A;  4BNC A;  4HNV A;  4XNF A;  3CTA A;  3BZK A;  3HM5 A;  2EZI A;  2JA6 J;  3BR1 A;  4XKV A;  2V1U A;  2K9M A;  4DZP A;  2K4J A;  5ICC A;  4Q5S F;  2VT2 A;  2XSJ C;  2R7X A;  3MKY B;  1HW5 A;  5EG0 A;  1SD7 A;  1R1T A;  2JK3 A;  3CMM A;  3B6A A;  3M9A A;  4YIR X;  5LHG A;  3AG1 H;  3OSF A;  2VJI A;  2OA4 A;  2EFO A;  2XIG A;  4LOC A;  3VSK A;  1IV8 A;  3QOD A;  3E5Q A;  3OOP A;  5H20 A;  2X0L A;  1TTY A;  4BH9 A;  4F93 B;  2DXI A;  4EM1 A;  2XKO A;  3I9V 2;  3F23 A;  1XG1 A;  3OY9 A;  4YEJ A;  4W1U A;  3DU6 A;  5CPR B;  5ILV A;  5HOD A;  3PQK A;  3KIO A;  1OCZ H;  1LEB A;  1HST A;  4KA4 A;  3F22 A;  5BNG A;  2UUZ A;  4G6T B;  1WI9 A;  3RKX A;  3FXL A;  2KP6 A;  2L5Q A;  3B73 A;  3MWM A;  3F6O A;  3ZPL A;  2NOG A;  3GFM A;  2CUZ A;  1IRF A;  1X2N A;  4B09 A;  2DQR A;  4FAS D;  2MBF A;  2CW0 F;  2OUM A;  2YSR A;  2MC3 A;  2WAF A;  1BBY A;  1I5Z A;  4NQW B;  2VJJ A;  4R8H A;  1VF9 A;  3OIQ A;  4RM2 A;  2LF7 A;  3ZQI A;  1QZY A;  6PAX A;  1JJ8 C;  3BWG A;  1N75 A;  3H3U A;  1Z05 A;  3LSJ A;  4ESB A;  2ECC A;  4UB8 C;  4QTR A;  3OIP A;  3ZQ7 A;  2EZK A;  4RMN A;  3WU1 B;  3GEZ A;  3JRB A;  3V8J A;  3JAM K;  4Z6Y A;  2FJ1 A;  4CUG A;  1OLT A;  1X1P A;  1MH3 A;  1S5L C;  3ULQ B;  2ZXJ A;  3AL0 B;  1FPQ A;  1NHA A;  4KT5 C;  2L2O A;  2CU7 A;  3CCM I;  2ZKZ A;  1FBU A;  4P96 A;  1SD5 A;  3MFK A;  3REO A;  2L9V A;  3K1N A;  4XR6 A;  3A03 A;  5CYV A;  2WAE A;  1FOX A;  4NDL A;  5EYR A;  3FHN A;  1XMK A;  1RI7 A;  2LKX A;  1MZB A;  3DP7 A;  1K4T A;  2O8K A;  2VE8 A;  4L0Y B;  2BOL A;  2KRH A;  2YU3 A;  3HOV J;  4QPQ A;  3SFI A;  1DU6 A;  5IYB J;  2GQQ A;  1U9O A;  2OF7 A;  4QWQ A;  3IKT A;  4KFC A;  1AHD P;  2R4G A;  1FC3 A;  4CCJ A;  3ISP A;  2E35 A;  2ECB A;  4ESF A;  2QCO A;  4ZH4 F;  5LFA A;  2FNP A;  3GTO J;  1HQC A;  2JRM A;  3HG9 A;  1UJ8 A;  2DYS H;  2PEX A;  4KT6 A;  1W5T A;  3WTU C;  1Z0X A;  3HRM A;  4U0V A;  1YRN B;  3FBN B;  2EZL A;  2F5E A;  2RNJ A;  1LUJ B;  1XSX A;  4YIF A;  4DYQ A;  2PJR B;  1YI2 I;  3JTH A;  2CWE A;  4FHT A;  4RAY A;  3EUH C;  1IUF A;  2QZ8 A;  3HTU A;  4B1R A;  2H1L A;  3H9Q A;  4ZYH A;  3R4K A;  5HLH A;  4V19 K;  1R22 A;  2DDA A;  2PN6 A;  4EJO A;  1MH4 A;  2F5D A;  1HCR A;  2HOT A;  2EIM H;  4RGR A;  2IS2 A;  4CXF A;  2HDD A;  1O7L A;  3PFY A;  4C3I J;  1APL C;  2VPR A;  1HKS A;  3RQ4 A;  2M3A A;  5FFZ A;  2IAI A;  3WGI A;  1ZEL A;  2ZXI A;  4XOR A;  4HX4 A;  2P6T A;  2JJ7 A;  1V5E A;  2VOD A;  5L3E A;  2IP2 A;  2DTR A;  4B43 A;  4IHX A;  3CCS I;  1D1C A;  2XB0 X;  5C3E J;  4HZF A;  1WGX A;  3ZMT A;  4C3J J;  5DUI A;  4KIS A;  3KP4 A;  2LC2 A;  4O3M A;  3AG3 H;  5CVV A;  1DPU A;  3L09 A;  5E79 C;  1XCV A;  2X48 A;  3BCB A;  3GFL A;  3LAP A;  2W57 A;  3SJM A;  3RQI A;  2OPT A;  5F04 A;  2XV4 S;  4KMU X;  4IRG A;  2PMU A;  3F72 A;  3V7R A;  4M72 A;  4PFO A;  4D7M A;  5BS6 A;  1SFE A;  2ME0 A;  1UAA A;  3ROU A;  2RV8 A;  5B3S H;  4ENJ A;  1OKR A;  2D1H A;  1WI3 A;  2F4O B;  5TIS C;  1XD7 A;  3L00 A;  1JJ6 C;  3M3Y J;  3AG4 H;  3GTJ J;  2IT0 A;  2HU9 A;  1ORK A;  3DPU A;  5CVR A;  1Y0U A;  3I53 A;  4RGS A;  4QSH A;  5EG0 B;  4XLN F;  1I6H J;  1SAU A;  1N25 A;  3H5R A;  3M8E A;  1EF4 A;  4FQG A;  3EUA A;  2XAS A;  2V4J C;  2F2E A;  2EK5 A;  1VQN I;  1IW7 F;  1D1B A;  1X3Z B;  5HLT A;  2P5V A;  1UST A;  2VC0 A;  3LSK A;  2MC4 A;  4OAZ A;  4PDK A;  4ZYA A;  1ZRE A;  4LFU A;  5K7Z A;  1A6Q A;  1JE8 A;  1A36 A;  2IPQ X;  3V8L A;  1VQ9 I;  2XGX A;  2XUB A;  2LY1 A;  1EKE A;  4FE7 A;  1OYW A;  3WGG A;  4NC8 A;  3MKZ A;  2ZFU A;  3FMQ A;  4OMY A;  3VB2 A;  3SZG A;  3CP8 A;  4CYD A;  2BHY A;  2M45 A;  3H3Z A;  5K7F A;  1O57 A;  3A01 B;  1IN7 A;  4HYE A;  2A6T A;  1U0J A;  1Y8R B;  1BJZ A;  2ZJ2 A;  1VQ7 I;  4C9Y A;  2DDB A;  1KYW A;  2C6Y A;  1YOV B;  4BYY A;  5HS8 A;  3H5A A;  1TT0 A;  3DTI A;  2ZFW A;  1O3S A;  3F8N A;  1LE8 B;  1WJ5 A;  1GLN A;  5E8I A;  5K5R A;  4I76 A;  1IUY A;  3K4B A;  2M1B A;  2H6C A;  2ZO4 A;  4OAY A;  2VLA A;  1PUF A;  2MD5 A;  1BI3 A;  2R7Z J;  2YS9 A;  4M3D A;  1Z1D A;  3IHU A;  3WU2 C;  3ZXS A;  4EEF G;  4BQN A;  1DU0 A;  5C4X J;  3QPT A;  3WGH A;  3VDX A;  2VE9 A;  2B0L A;  2E5Z A;  2Y0M A;  3P9K A;  2P6S A;  3WE3 A;  3KP2 A;  3BC8 A;  1IN6 A;  2KJB A;  2KLO A;  3QAH A;  2V1N A;  1E17 A;  3BTI A;  2W00 A;  3BR5 A;  3HPH A;  4KDP A;  2VC1 A;  4B4C A;  1BC8 C;  3HHH A;  2EJR A;  3LFU A;  3CO6 C;  5HNH A;  2QBY A;  2XF7 A;  3K0L A;  3FM3 A;  3U2R A;  3FXK A;  2Z2S B;  3FXU A;  1YW8 A;  4BXU A;  3CCV I;  3SDG A;  5TRD A;  3I58 A;  2MW8 A;  1RRJ A;  1N77 A;  3IH2 A;  3GX4 X;  5LRR A;  3OSG A;  4BE2 A;  2PI0 A;  4N9H A;  4HF1 A;  4HPQ A;  2FUG 2;  3A0B C;  4L9T A;  2DFF A;  3GVA A;  1H88 C;  3S2D J;  5EEG A;  1RC9 A;  3IWZ A;  3LQR A;  2AQF A;  3EYI A;  2HZD A;  4NBQ A;  1MMG A;  3CME I;  2EH3 A;  2HPI A;  5CQG A;  1H9G A;  2Z9O A;  2F5C A;  3TBI A;  4YFX F;  1T33 A;  3BRO A;  3F9K A;  3IAM 2;  5D8L B;  1QRY A;  3Q5F A;  1XS9 A;  3OYA A;  1BR2 A;  2N8G A;  3M8J A;  4BU2 A;  2F48 A;  2COB A;  1A04 A;  2CQN A;  2HI3 A;  3K4L A;  4QIW N;  3JTG A;  5IT9 K;  2IS4 A;  4KJZ A;  5FLX Z;  3KYD B;  1R71 A;  2WA0 A;  3L2W A;  5EDN A;  4GYI A;  3IH3 A;  3A0H C;  4OIP F;  2QSH X;  4ZDO A;  1R1U A;  1A5J A;  3PIO F;  2K9N A;  4WCG A;  2I5U A;  3QQA A;  5AIQ A;  5LGN A;  3KP5 A;  4E7J A;  1R49 A;  4UUV A;  1X19 A;  3FF5 A;  4HG2 A;  1X58 A;  3S2W A;  4A3J J;  1EV7 A;  2BY3 A;  3DKY A;  4FE4 A;  4XLC A;  1B1B A;  3BG6 A;  5HS7 A;  5M5Y J;  2IGO A;  1OR7 C;  1YIT I;  1JKP C;  4D7N A;  4KN4 X;  3CUQ A;  4MIM A;  1HDD C;  2CS3 A;  2W1O A;  2M4G A;  3W3C A;  5F0H A;  4FCY A;  1ETK A;  1U3E M;  4F3Q A;  1ZTR A;  1VQP I;  3DPL C;  5E20 A;  1RKW A;  3JRA A;  2NOJ B;  2ZME C;  1W0T A;  1GT0 C;  3OR2 C;  1GHC A;  3KYC B;  2HQN A;  3BJ6 A;  4HLX A;  5F0F A;  1LNW A;  4I09 A;  1JGS A;  2E1C A;  4IHT A;  1IRX A;  3OYJ A;  1ZLK A;  2DA6 A;  2FXA A;  5IP9 J;  3F8M A;  2DA7 A;  1G3W A;  3LST A;  1ZYR F;  4IOC F;  3Q0W A;  3RZO J;  2KMU A;  3GO5 A;  4A3B J;  2D45 A;  4A3K J;  3OYN A;  3DEW A;  1ACI A;  3M1E A;  1Z3Y A;  2HS5 A;  2STW A;  1TWC J;  5LHH A;  1NG6 A;  3OYB A;  5B1A H;  2I10 A;  3A4C A;  3O8G A;  2IW5 A;  3SHF A;  4EJV A;  4CZC A;  2R7R A;  1GVD A;  2X1C A;  2K02 A;  3C2B A;  4M3G A;  4E7I A;  2R93 J;  3SXY A;  3U1D A;  3RKY A;  2K86 A;  1FSH A;  1UHW A;  3GLL A;  4ZTF A;  1KU2 A;  3R61 A;  2LH9 A;  2VXZ A;  2G9W A;  3V7S A;  2DT5 A;  3HEF A;  1O3T A;  2WWY A;  5GTI C;  2ESN A;  2CRG A;  2R5Z A;  2Y9Z A;  2JPB A;  2HDC A;  4LB6 B;  4K2E A;  4I02 A;  5E17 F;  1S6L A;  1YYV A;  1BI0 A;  1DP7 P;  2XAH A;  4Y33 A;  3U21 A;  3HPG A;  3ABL H;  2D2W A;  4P55 A;  5B5E C;  1S8N A;  1XSD A;  3RPU D;  3LA7 A;  3NAU A;  1T2K A;  1MND A;  2PMZ N;  4PJ0 C;  3IL2 A;  2M4K A;  3GZ5 A;  2ZJQ F;  3F8F A;  4GCV A;  4RLF A;  5L3F A;  2KIM A;  1OPC A;  2JSP A;  5M3M J;  1R58 A;  2XF5 A;  3DBH B;  5BQT A;  2KQR A;  3EPZ A;  3ABT A;  3HBL A;  1R00 A;  5CQE A;  1B6A A;  1FTZ A;  1B9N A;  3BJA A;  4V2G A;  1NK3 P;  4IHW A;  1P9Q C;  4EGZ A;  4KIB A;  1BI2 A;  2RDP A;  2QQ9 A;  2WAQ A;  1EH7 A;  3LA2 A;  4M6X A;  2DFI A;  2DA5 A;  4RAZ A;  1H0M A;  2F4I A;  2VKH A;  1WJE A;  1STZ A;  2P4W A;  4EMS A;  2ETH A;  5GPA A;  2K40 A;  2VKE A;  3E5U A;  2Y0S N;  4FTH A;  3C2G A;  5M5W J;  4BBS J;  2QF7 A;  1BOB A;  4D1Q A;  3M1C A;  3FM5 A;  5L3D A;  5E1X A;  5DDG A;  2E7X A;  3A2K A;  1UMQ A;  3HUG A;  2HFH A;  2LY2 A;  1DDN A;  4BJ5 C;  3K10 A;  5H2F C;  1HXD A;  1I27 A;  2KZG A;  4I0B A;  1YJN I;  2HTJ A;  3KEQ A;  4F91 B;  2JA2 A;  2ISY A;  5J40 A;  4MTE A;  1VQM I;  2BW3 A;  2EWN A;  2MLG A;  3DU5 A;  4FT8 A;  2QSF X;  3I0T A;  3OL4 A;  1LVA A;  3LAJ A;  1MBJ A;  2V6E A;  3S8P A;  3CJN A;  2NNY A;  3K7A J;  2XKP A;  2DLL A;  1ON1 A;  2E34 A;  2L9S A;  4HAM A;  3QWL A;  1W36 C;  1X1A A;  2VKD A;  2ELK A;  3HOS A;  2O8X A;  2GOX B;  3FHZ A;  3Q9S A;  1G2H A;  3LWF A;  2XF6 A;  4PGH A;  1BM9 A;  2QVO A;  3MMY B;  2Y75 A;  3BR3 A;  4XKW A;  1FMW A;  2LVS A;  1SVL A;  2IS6 A;  2R7Q A;  3RSN A;  4AIJ A;  4D5C A;  2DK5 A;  2E2J J;  1GUU A;  4HST A;  2VQG A;  4WX9 A;  1RES A;  2JZY A;  2DMT A;  1ONV A;  1V4R A;  2KRC A;  3M4O J;  4PCQ A;  2V9P A;  4F92 B;  4O5V A;  4AU7 A;  4JBA A;  4XRM A;  4IHV A;  2Q8K A;  5JR3 A;  2ZBK A;  2DW4 A;  1REP C;  2W24 A;  3ZP5 A;  4FET A;  3NWS A;  4WF2 A;  4LD5 A;  1VZ0 A;  3DPT A;  5L3B A;  5TJJ A;  3OYL A;  2FSW A;  2X1E A;  4I99 C;  5ICF A;  3CLO A;  1RUN A;  1SFK A;  1VQ8 I;  3TGN A;  2LFB A;  3BP8 A;  2R7T A;  1YG2 A;  1Z6T A;  2LF8 A;  3OYI A;  1R1V A;  3WTV C;  1IXC A;  4WWC A;  3WTW C;  1TQM A;  3ZGK A;  5IP6 A;  3I3L A;  1T08 B;  3VSL A;  3FX3 A;  3HOW J;  4NB5 A;  1TWH J;  3I4M J;  1YIO A;  4Y7N J;  3H36 A;  5ICG A;  4L9V A;  1B4A A;  2VI6 A;  4ZTJ A;  4CCO A;  1TNT A;  2DOE A;  5FKL A;  3PNT A;  4DW6 A;  1U5T A;  3ERE D;  4EGY A;  4BAY A;  2JUC A;  4Q47 A;  3KLO A;  3PFI A;  1W36 D;  1MBG A;  3QP6 A;  2VOO A;  2K9S A;  1FLI A;  1U9N A;  2WBM A;  1XSV A;  4MGR A;  5DD4 A;  4Q4Z F;  2MD0 A;  4HBL A;  3RZD J;  2W85 A;  5LLQ A;  1G6N A;  1OFC X;  1KU9 A;  1V3F A;  5HDK A;  1SFU A;  4L0Z B;  1ZHF A;  3MZ8 A;  3ECH A;  4IZZ A;  5LGT A;  2A69 F;  3JRF A;  1HKT A;  3FDY A;  4A6E A;  2WC2 A;  3B02 A;  3TP3 A;  4MHG A;  1ERD A;  3BDD A;  2AQE A;  2QGU A;  2XPW A;  3EDP A;  2KKO A;  3CCR I;  2H27 A;  3ASN H;  4KYW A;  4E70 A;  3H9J A;  1WPK A;  2HXO A;  4BHC A;  1IO2 A;  2FA5 A;  2GWR A;  4E4H A;  4CA0 A;  2GZW A;  3I55 I;  1PYV A;  4BAC A;  1WHU A;  1SAN A;  3R0J A;  4CO8 A;  2EQR A;  2WV0 A;  2YR2 A;  5H6Q A;  5JFR A;  3MKW B;  4Y3O A;  3K69 A;  3E7L A;  4HV6 A;  2R5Z B;  1TC3 C;  3ZMV A;  2FBI A;  1YO5 C;  1IDZ A;  2IVM A;  2VJ5 A;  5KAI C;  5IP7 J;  2CSO A;  4B44 A;  4KIT B;  2LP0 A;  1CGP A;  3J7Z I;  2EV0 A;  2JT1 A;  3J80 K;  1JXS A;  2X51 A;  1YX3 A;  4G9Y A;  1MMS A;  4M3E A;  3K9T A;  1FMV A;  2LTP A;  1MW7 A;  3H5N A;  1MSE C;  2JN6 A;  2Y48 A;  1I6X A;  3ZOB A;  2GM4 A;  4DNC A;  1CF7 A;  2X4H A;  4ESJ A;  2LKS A;  1FYM A;  3S16 J;  3FMR A;  2JA7 J;  2EIK H;  3AAF A;  1SD6 A;  2K9Q A;  2HNH A;  1E2X A;  2XAF A;  3WU0 A;  3ONQ A;  3K70 C;  2KZV A;  2E2H J;  4PJM A;  2YX7 A;  2V6C A;  3C2H A;  1OYI A;  5GP9 A;  2R7W A;  1G4D A;  2M2E A;  2UV1 A;  2DMP A;  3I59 A;  3HRT A;  4D5F A;  1MKM A;  4AWX B;  3K2A A;  2OAZ A;  4DBR A;  1T0F C;  2LSO A;  4PUS A;  5FD6 A;  2HOS A;  2F4M B;  3HOY J;  2A05 A;  3K4K A;  2HEO A;  3IWF A;  2DCE A;  5J1R A;  1JKO C;  3LFK A;  3GZ6 A;  1UHM A;  3QPS A;  2CYY A;  3RJP A;  4M71 A;  2VL8 A;  2CQ7 A;  1X3U A;  1DP3 A;  2DI3 A;  4A12 A;  1JUM A;  4LLN A;  3HGG A;  3BCA A;  1LFB A;  1Z6R A;  2RQP A;  1F36 A;  3OWT A;  2XAQ A;  2RKH A;  3VEP A;  3E6D A;  2BW3 B;  3D5S C;  1QBJ A;  3F8C A;  4WXC A;  3BTC A;  2PFB A;  2TDX A;  3KX2 A;  3ERM A;  4FX4 A;  3HIF A;  3PNY A;  3I71 A;  4AC0 A;  2E7W A;  1XGS A;  4ENM A;  4B47 A;  5K5O A;  3TOB A;  1A6I A;  5ED4 A;  1TNS A;  1ZGW A;  1X1B A;  2Y0S A;  4BQQ A;  2DT7 B;  1PVE A;  3TKY A;  3OYE A;  4HNT A;  1E3O C;  4IF4 A;  4U87 A;  3OYG A;  2FMY A;  3EUK L;  4ENN A;  2LRD A;  2DTZ A;  3ZR8 X;  1ULY A;  4Y52 J;  3GFI A;  3ZQC A;  2HOA A;  4OOI A;  4XRS G;  3FIS A;  5EEH A;  4BY7 J;  3OIO A;  1WVR A;  4CH7 A;  3HRU A;  2K85 A;  1BW5 A;  3RYR A;  5HLI A;  1SD4 A;  2ZME B;  3G4S I;  1Z3X A;  3GXO A;  2M8G X;  4LK0 F;  4Q48 A;  4DZJ A;  1ZKG A;  4U0W A;  3AG2 H;  3CF2 A;  5F0C A;  1WJF A;  4IOA F;  3CCL I;  3GME A;  1W4M A;  3L1P A;  4M74 A;  1QHH D;  1E0E A;  2BGC A;  1I50 J;  1Y6I A;  3KZY A;  2R7F A;  2F6C A;  4M73 A;  1R6R A;  3K4C A;  2IA2 A;  2NS7 A;  2BYV E;  4AID A;  2P81 A;  3ZMU A;  4HSR A;  3JRH A;  1RNL A;  1T39 A;  2NVQ J;  5B1B H;  2EPF A;  4WXH A;  5DS9 A;  3TO6 A;  4HF2 A;  1FT9 A;  1A35 A;  2EFQ A;  5IT9 Z;  3BQY A;  1K7A A;  1U5T B;  2HQR A;  3IC7 A;  3V8K A;  4XK4 A;  4CIC A;  3JRI A;  3KET A;  3TW6 A;  1ODD A;  1I3A A;  2L4A A;  2D1V A;  2CQK A;  3CCY A;  4I98 B;  2FQ4 A;  1BN5 A;  4A5N A;  4UY8 I;  1IG7 A;  1W1W E;  3DBL B;  2HQ5 A;  3S2H J;  3LMM A;  3CMY A;  1LPQ A;  3VYR B;  2X9D A;  2EV5 A;  2LG4 A;  2R3S A;  2W4S A;  2CO5 A;  3BTL A;  5FO5 A;  3OS1 A;  1OMI A;  3CUQ C;  1G3T A;  3KE2 A;  4A0Y A;  2LKP A;  3HC7 A;  1I1G A;  3J7Y J;  1ETQ A;  2DBB A;  4DYR A;  2VUM J;  2WAD A;  1BL0 A;  2L4M A;  1P4X A;  4RB3 C;  3HKZ N;  1ZR4 A;  3W6V A;  1QZZ A;  1X1C A;  3OYH A;  4M6V A;  1MMD A;  1Y0N A;  1KYZ A;  3EET A;  4ZYD A;  1JKR C;  2E19 A;  2VXD A;  3CCU I;  5IYD J;  5E3L A;  1J75 A;  2OC6 A;  5LGU A;  2A6E F;  4RM3 A;  3QU3 A;  4LLG F;  1V54 H;  3TMO A;  1J5Y A;  4EQQ A;  2KIS A;  1DQU A;  2E2I J;  2PQ8 A;  2GIV A;  4EM2 A;  3E6M A;  2ZB9 A;  2ME6 A;  3O6B B;  3TL4 X;  2H8R A;  3KP7 A;  4L18 B;  5GAE J;  1LKX A;  1ON2 A;  1D5V A;  5KVR A;  5E1Z B;  3H0G J;  5FLV A;  1H8A C;  3FXJ A;  4HEA 2;  1JHH A;  3S3N A;  3H1C A;  3O3K A;  4L5J A;  4Z2Y A;  4PSW A;  4HDV A;  1WH5 A;  2HDW A;  3DKW A;  2ZJR F;  2WY8 Q;  2ZC2 A;  3PUF A;  2IGN A;  2DMU A;  2BE5 F;  3E6B A;  3OV8 A;  4CDG A;  1T0F A;  1CQT A;  1Y39 A;  1KQ9 A;  4M3B A;  2VQH A;  3BR0 A;  4XQF A;  4F55 A;  4C30 A;  5J8C A;  4XSX F;  3GCM A;  1SAX A;  5CVU A;  3HOT A;  1WKM A;  1GVJ A;  1PDN C;  4IJA A;  3P5J A;  4UVB A;  1IN4 A;  1L0O C;  3QRF F;  2R7D A;  3I59 B;  4XL9 A;  3IRR A;  2AHQ A;  1R5I D;  5J4V A;  2Y2Z A;  1OCP A;  1TLH B;  3HYI A;  1TWG J;  3ESW B;  1F4K A;  2ZCW A;  1XGM A;  3BT9 A;  3S1R J;  2EZH A;  4BXF A;  1RET A;  2X6X A;  5ILU A;  3L9F A;  1JI8 A;  3GWZ A;  4RGU A;  1JHF A;  3JSP A;  3DTE A;  2HXI A;  3G73 A;  3PM1 A;  3B6C A;  3KZI C;  2DU9 A;  4RAF A;  2HYF A;  2W7N A;  2VQL A;  4BE0 A;  1K78 A;  2V1X A;  5D8K B;  3FIW A;  2E5N A;  3C7J A;  1OCO H;  2G7H A;  4EM0 B;  1P6R A;  4ITV A;  1YJ9 I;  5IOY A;  5L3C A;  2DA2 A;  1KQ0 A;  5DEQ A;  2OZ6 A;  1FY7 A;  1TQP A;  3FKI J;  4AYB N;  2JUG A;  2VT3 A;  2NAZ A;  3DLL F;  3QOE A;  2DA3 A;  2UXN A;  4LG3 A;  1J7K A;  2XC7 A;  2DN0 A;  4L9N A;  9ANT A;  3X2Q H;  1BW6 A;  2OZU A;  4ABZ A;  2X85 A;  2K5C A;  1P4A A;  2RAE A;  2FRH A;  2LLK A;  4BY1 J;  1T95 A;  4EJW A;  1BR4 A;  1NK2 P;  5E3N A;  2NS0 A;  3OYC A;  3SZT A;  3G3Z A;  3CCQ I;  1MDM A;  3C1D A;  3VPR A;  1J59 A;  3ZQL A;  4AM3 A;  3BZC A;  4L5I A;  3RKW A;  1D0Z A;  1IV6 A;  2V7F A;  1JKQ C;  2IRF G;  3W2A A;  5M3F J;  2MSY A;  1OIS A;  4YRV A;  2VKV A;  1LVK A;  4A0Z A;  3JCU C;  1TWA J;  2KDO A;  3E0J B;  1FOW A;  5EZG A;  3N4M A;  3JW4 A;  2HPM A;  2R7V A;  3VYT B;  2EIJ H;  1B9M A;  1YX5 A;  4O6J A;  2VBZ A;  2KFD A;  2A61 A;  3HL2 A;  1Y1W J;  3S3O A;  3HTS B;  2H09 A;  2R0Q C;  5GPC A;  3DEE A;  4CCN A;  2BY0 A;  2VQC A;  2FF4 A;  2VB6 A;  5FGM A;  4A3F J;  4BE1 A;  4W97 A;  3CCJ I;  1X2M A;  3LSP A;  1WJB A;  5D6F A;  3U9G A;  4PJN A;  1TT5 B;  5J47 A;  3GUD A;  4I6Z A;  3S14 J;  2ELJ A;  3WHC A;  3QPL A;  1TBX A;  1AKH A;  4KIC A;  4HOB A;  2GXA A;  3OYD A;  3JRE A;  3GTQ J;  4KNY A;  3ZQG A;  3HOX J;  1R23 A;  3PUB A;  3E3V A;  1FX7 A;  3J7A Y;  4LB5 A;  4DIQ A;  4JX6 A;  2EFW A;  1S7E A;  2A6H F;  3BPX A;  4FIS A;  2EIL H;  2ZXW H;  3M07 A;  3T8T A;  1I1S A;  4LIT A;  4N4O B;  3W6K B;  1LDD A;  1QZE A;  3HRS A;  3VOD A;  5JLW A;  2Z1D A;  1PJR A;  1UB9 A;  5E1W A;  3F8B A;  4BHP A;  4AVP A;  2OV7 A;  2Q0O A;  4E7K A;  2CQX A;  2A68 F;  4YFK F;  1Y8Q B;  4IHY A;  3K1M A;  3E1S A;  1XMA A;  5EZH A;  2QYO A;  3RCO A;  2YU9 J;  4UVA A;  1ZLJ A;  1U5T C;  2OCE A;  5H6R A;  3SZP A;  3TW7 A;  3KPH A;  4RB0 A;  3OYF A;  4HQM A;  1F1Z A;  2RN7 A;  2H94 A;  4A6D A;  2V26 A;  2PX9 A;  5D5V B;  5JHF A;  5BPD A;  2HQA A;  1FBQ A;  4XM3 A;  5LEJ A;  2QWW A;  4XLF A;  1SMT A;  2VBW A;  4G7H F;  3PO3 J;  3HKZ A;  1O7F A;  4A2U A;  1I3Q J;  1FOK A;  3I4P A;  4A0X A;  3FXQ A;  3FK7 A;  1MNM C;  5B66 C;  5ILS A;  2LY9 A;  1EH6 A;  3EQL F;  3CDI A;  2FBH A;  2OJE D;  4IEJ A;  3SFZ A;  4H0E A;  1ZGJ A;  2HWV A;  1QPM A;  3HB9 A;  3MCZ A;  4WK8 F;  2CV1 A;  4RB2 C;  4B3X A;  3MQ0 A;  4BDZ A;  4ASN A;  3TP0 A;  3PJR A;  5EEA A;  2JA5 J;  2XB5 A;  3I4N J;  3L2Q A;  2HKX A;  3JRG A;  2OBP A;  3CMA I;  1BI1 A;  1X4P A;  1PUF B;  1IN5 A;  4XN0 A;  2IA0 A;  4WXD A;  4MO7 A;  3J80 Z;  3A02 A;  1VQ5 I;  3HSR A;  2QKL B;  1YS6 A;  4OU0 A;  1PP8 F;  2NNN A;  5LEK A;  2LNB A;  2I8D A;  3I54 A;  1K79 A;  4KUM A;  2O6G E;  2K3F A;  1IJW C;  3QOP A;  4A3L J;  1D5Y A;  1L3L A;  3NWT A;  1HF0 A;  2FQ3 A;  4XSZ F;  2JPC A;  3DKX A;  1J0R A;  2KIF A;  2M0M A;  2LBF A;  4PJL A;  4B3A A;  2B63 J;  4UV8 A;  3IKV A;  1TW3 A;  2MG4 A;  2JVH A;  1M1E B;  2QBY B;  4JQF A;  3I64 A;  2CUF A;  4UV9 A;  3ZQF A;  2LOO A;  4GYG A;  3VYU B;  2EV6 A;  4C3H J;  2ISZ A;  3PSI A;  3CDL A;  3IRQ A;  2JWT A;  4QLC U;  2JSC A;  2L01 A;  1UG2 A;  4J00 A;  3GW2 A;  4P9U A;  4RGX A;  1KZH A;  1FIP A;  3GTP J;  5K5Q A;  1MMA A;  5E3O A;  1ZAO A;  3D1N I;  3Q0U A;  2A5Y B;  4IXA A;  1J09 A;  1E3H A;  2XRL A;  1ZR2 A;  1F5T A;  1R4N B;  4OIR F;  2OD5 A;  5FRN A;  4XOP A;  1Z67 A;  3LSM A;  1IXR C;  1MJ9 A;  4PZJ A;  1R5H A;  4L9J A;  3JAM Z;  1IDY A;  2VN2 A;  3LL7 A;  1QHG A;  2CMP A;  2ZNZ A;  5GAG J;  1O3Q A;  2FBK A;  1MDM B;  2HVR A;  3R0A A;  2FML A;  3TQN A;  5KNL A;  4LLL A;  2KT0 A;  2IXS A;  2VBY A;  3ABM H;  3DTK A;  1MJB A;  5HLG A;  1BJA A;  1LB2 A;  2O5R A;  2EB7 A;  4AYB A;  1S9H A;  5JVT A;  1AWC A;  2WY7 Q;  2DPD A; 
#chains in the Genus database with same CATH homology
 2CG4 A;  3RPQ A;  1U8R A;  1GXQ A;  1RZ4 A;  1S7O A;  4DQ2 A;  3L2C A;  4G7Z F;  2KRF A;  3CUQ B;  1J2X A;  2L02 A;  2DK8 A;  3PQJ A;  4S05 A;  1KGS A;  2M87 A;  2ELH A;  5CJ9 A;  3FZV A;  3KP6 A;  3VOE A;  2Z5U A;  2MLK A;  5F1R A;  1ZRF A;  4HA8 A;  2O03 A;  2RC4 A;  3NQO A;  3L7W A;  3KP3 A;  4M9S A;  5HDG A;  1VTN C;  2Z3Y A;  2M8E A;  4Y15 A;  1LEA A;  3RI4 A;  5E8G A;  3ZMZ A;  2W25 A;  2V9V A;  4GXO A;  4MEX F;  3CUO A;  4PGG A;  1GXP A;  2WTE A;  3C18 A;  2IA1 A;  4TV7 A;  2P5K A;  1WWX A;  1TQI A;  2XRN A;  5FD5 A;  4G7O F;  1IRG A;  3WTS C;  3CDH A;  2MH2 A;  3TO7 A;  4S04 A;  3DEU A;  3RDI A;  2Z33 A;  1FNN A;  4M9X A;  1MJA A;  2DAO A;  4LGW A;  3NEU A;  4MNU A;  2J5P A;  4I01 A;  4MEY F;  4IHS A;  3SQN A;  5CLS A;  3FWE A;  4OIO F;  5D4R A;  4I2O A;  2K27 A;  3KZZ A;  4IPA A;  3DQV C;  4KN7 X;  5HVQ C;  1BIB A;  3T8R A;  3HSE A;  2CFX A;  5DCM A;  4UNO A;  2P7V B;  3P7N A;  1ZH5 A;  2QEN A;  3BY6 A;  4MTD A;  4MQV A;  2E1N A;  2GXB A;  1W5S A;  2YPR A;  4LJZ F;  1D8J A;  2MA3 A;  1G3Y A;  1XDS A;  2F5F A;  3KCC A;  2PJP A;  3EYY A;  4R79 A;  3RTR A;  4LK1 F;  2O0Y A;  2JTV A;  2L54 A;  2Q2E A;  3J7A O;  4HX7 A;  3KLN A;  5CVJ A;  5JI6 A;  1YQA A;  1W7P A;  2GA1 A;  4NHJ A;  4CZZ A;  4ENK A;  4U0Y A;  4IRH A;  1LJ9 A;  4JK1 X;  1FZP B;  2XAJ A;  1XB4 A;  5LRS A;  5HOO A;  2A3S A;  2XHK A;  3LA3 A;  4ZYG A;  1S29 A;  3ELK A;  2PMH A;  1YLF A;  2K7L A;  1PP7 U;  2DPU A;  3P9I A;  3MEX A;  3F3X A;  2KJC A;  4G6D A;  5A2Q K;  1K6O A;  3KEO A;  1LDJ A;  4U7B A;  1UFM A;  4LG0 A;  1XN7 A;  2PG4 A;  3ZN1 A;  4GO1 A;  5D5W B;  4B8X A;  1EH8 A;  3DV8 A;  1YFH A;  1ZG1 A;  3QP5 A;  3WTZ A;  4F7Z A;  1PUE E;  5D5U B;  1DPR A;  3GF2 A;  3F6V A;  1S3J A;  2HKO A;  3J81 K;  2V1D A;  5BPI A;  4EV0 A;  5DYM A;  2HGC A;  1IXS B;  3BPV A;  1F9N A;  1ZG3 A;  2QUF A;  2OU2 A;  4ZZD A;  1WQ2 A;  2KIU A;  2GAU A;  1XCB A;  2XVC A;  3E97 A;  4ON0 A;  3GLX A;  4OMZ A;  3MAJ A;  3JSO A;  1H9T A;  2CGP A;  2QQB A;  4G6Q A;  1WRJ A;  1DUX C;  2HR3 A;  4XRF A;  2VOP A;  1HW2 A;  2FOK A;  4RB1 A;  1CF7 B;  1FP1 D;  1J9I A;  1SFX A;  5ERI A;  1IN8 A;  1HKQ A;  4HQE A;  1ZRD A;  5DCM B;  1T38 A;  3D5L A;  4EJT A;  4HW0 A;  2IJL A;  4I7H A;  3T0Y A;  3GFJ A;  3FXR A;  4I0A A;  4ZYE A;  1BOA A;  2RVC A;  1ZRC A;  4XBF A;  3VFZ A;  4EVI A;  2ADU A;  3HSF A;  2FEZ A;  5L3G A;  1O3R A;  4OIN F;  2QQA A;  1MGT A;  5D5X B;  3K2Z A;  2HOE A;  3K1P A;  4UHT A;  1R7J A;  2PBI A;  3ZMS A;  1KU3 A;  1W7P B;  1XGN A;  2FE3 A;  2O61 A;  2FNA A;  3DFG A;  5LHI A;  2UZK A;  1FP2 A;  2OQG A;  1RUO A;  4U7D A;  3WTT C;  1ZGA A;  3MZH A;  3ABU A;  4KIG A;  2XAG A;  2VON A;  1P92 A;  4CGZ A;  1T6S A;  3T5X A;  2G7U A;  3ZMD A;  2LDU A;  2JRT A;  3O2P E;  3EUH A;  4MQ9 F;  2MH9 A;  4RS8 A;  5F6F A;  3P9C A;  4UXN A;  1FYK A;  5DV5 A;  3ML6 A;  5JHU A;  4YFN F;  4LG0 B;  1OYY A;  5HS9 A;  4EJU A;  2XRO A;  4HV5 A;  1HW1 A;  2YX4 A;  2W84 A;  1D8K A;  1YW9 A;  3NRV A;  1Q1H A;  3M8F A;  1Z91 A;  4UVC A;  3N97 A;  1T98 A;  2HZT A;  1IAW A;  1ZN2 A;  5KK1 A;  2UXX A;  1U6G A;  3WG9 A;  1FBS A;  5HDN A;  1LDK B;  1KU7 A;  3WOD F;  2H6B A;  3T1B A;  1QGP A;  1P2F A;  5AON A;  3DXJ F;  5FFX A;  3BZ6 A;  2QM3 A;  4KMF A;  1FYL A;  2EA4 A;  2Z99 A;  2A07 F;  4HF0 A;  4YII A;  3TDU C;  4P9F A;  4KIF A;  2BV6 A;  1KA8 A;  2K4B A;  1YW7 A;  2NRA C;  2GA2 A;  5DD8 A;  1BIA A;  1RIO H;  5CVI A;  1QNT A;  3WTY C;  2STT A;  2AXL A;  4CHU A;  2AS5 F;  3V7C A;  3QU6 A;  4BHB A;  4D0P A;  2COM A;  3H92 A;  4YG2 F;  3D0S A;  2UWM A;  1ZG5 A;  3F21 A;  2HTS A;  1YTY A;  1TW2 A;  2ACJ A;  2P7C B;  3TDZ C;  3KFW X;  3WE2 A;  5J6X A;  5ICE A;  1LQ1 A;  4G94 A;  1K78 B;  5FB2 A;  3HHG A;  5BOX A;  3R6S A;  3BJO A;  4P5O A;  1AOY A;  4M6Y A;  1U78 A;  4N0B A;  3ZN0 A;  2DO7 A;  1SMY F;  4AIK A;  1S7A A;  4BQA A;  1D3Y A;  5LBQ A;  4IRI A;  2V79 A;  4NQW A;  1R5G A;  5IT3 A;  3QPH A;  4HDU A;  2L3D A;  5F64 A;  2RGV A;  2ESH A;  2O3F A;  2OQR A;  3TO9 A;  2M30 A;  3TOA A;  4Y13 A;  1KQ8 A;  4HX8 A;  1IF1 A;  5K1Y A;  1BC7 C;  4IVN A;  1XGO A;  3Q9V A;  1U2W A;  2M5W A;  3GYH X;  1Z9C A;  4Y17 A;  5FLX K;  2FU4 A;  5DUK A;  4AD9 A;  4G8X A;  3COA C;  1IZ1 A;  1FSE A;  4AIH A;  3WTX C;  1ZAR A;  2ZNY A;  4GGG A;  1R36 A;  3RYP A;  2GXG A;  3E5X A;  1WSU A;  5AIP A;  1OR7 A;  4M9Z A;  2EFN A;  2PLY A;  1B59 A;  3W6J B;  4U88 A;  2ZME A;  3MZY A;  5D4S A;  4ZZL A;  3RPU A;  4OIQ F;  3ECO A;  2EFP A;  1YS7 A;  5DCF A;  3M7G A;  1G3S A;  1UCR A;  2QLZ A;  2P8T A;  4LMY A;  5A2Q Z;  1FWZ A;  3E6C C;  3DF8 A;  2BBY A;  4FX0 A;  4XLP F;  2VBX A;  3LQQ A;  5BMZ A;  2NYX A;  3RIR A;  1QQI A;  1USS A;  4R1H A;  5J8F A;  1HSJ A;  1XDU A;  1HBX G;  3C3W A;  1P4W A;  5E18 F;  3CO7 C;  3V4G A;  1C0W A;  4N9I A;  4ETS A;  4HLY A;  2DQL A;  2EA2 A;  2P5L C;  2BEO A;  2J5O A;  1W7P D;  3BOQ A;  3J81 Z;  3I5U A;  1Z7U A;  3FMS A;  3R60 A;  1QO0 D;  5D6E A;  2HYG D;  1MD0 A;  4A5M A;  4BNC A;  3CTA A;  2V1U A;  5ICC A;  4Q5S F;  2K4J A;  2VT2 A;  1HW5 A;  1SD7 A;  1R1T A;  3M9A A;  5LHG A;  2OA4 A;  2EFO A;  2XIG A;  3E5Q A;  3OOP A;  5H20 A;  2X0L A;  1TTY A;  4BH9 A;  4EM1 A;  2XKO A;  3F23 A;  5ILV A;  3PQK A;  1LEB A;  1HST A;  4KA4 A;  3F22 A;  1WI9 A;  3RKX A;  3B73 A;  3MWM A;  3F6O A;  3ZPL A;  3GFM A;  1IRF A;  4B09 A;  2DQR A;  2MBF A;  2CW0 F;  2YSR A;  2MC3 A;  1BBY A;  1I5Z A;  4R8H A;  2LF7 A;  1QZY A;  6PAX A;  3BWG A;  3H3U A;  1Z05 A;  4ESB A;  3ZQ7 A;  3WU1 B;  3GEZ A;  3V8J A;  3JAM K;  3ULQ B;  2ZXJ A;  1FPQ A;  1NHA A;  4KT5 C;  2ZKZ A;  1FBU A;  4P96 A;  1SD5 A;  3MFK A;  3REO A;  3K1N A;  5CYV A;  1XMK A;  1RI7 A;  1MZB A;  3DP7 A;  2VE8 A;  4L0Y B;  2YU3 A;  2GQQ A;  4QWQ A;  3IKT A;  4KFC A;  1FC3 A;  3ISP A;  4ESF A;  4ZH4 F;  2FNP A;  1HQC A;  2PEX A;  1W5T A;  3WTU C;  3HRM A;  4U0V A;  2F5E A;  2RNJ A;  1XSX A;  4YIF A;  3JTH A;  2CWE A;  4FHT A;  4RAY A;  2QZ8 A;  3HTU A;  4ZYH A;  3R4K A;  5HLH A;  1R22 A;  2PN6 A;  4EJO A;  2F5D A;  4RGR A;  4CXF A;  1O7L A;  1HKS A;  5FFZ A;  3WGI A;  4HX4 A;  2P6T A;  2VOD A;  5L3E A;  2IP2 A;  2DTR A;  4HZF A;  3ZMT A;  5DUI A;  3KP4 A;  4O3M A;  5CVV A;  1DPU A;  3L09 A;  1XCV A;  3LAP A;  3GFL A;  2W57 A;  2XV4 S;  4KMU X;  4IRG A;  2PMU A;  3F72 A;  3V7R A;  4M72 A;  5BS6 A;  1SFE A;  3ROU A;  2RV8 A;  4ENJ A;  1OKR A;  2D1H A;  1XD7 A;  3L00 A;  2IT0 A;  5CVR A;  1Y0U A;  3I53 A;  4RGS A;  4XLN F;  3M8E A;  2XAS A;  2F2E A;  2EK5 A;  1IW7 F;  2P5V A;  1UST A;  2VC0 A;  4PDK A;  1ZRE A;  4LFU A;  1JE8 A;  2IPQ X;  3V8L A;  2XGX A;  2XUB A;  1OYW A;  3WGG A;  3FMQ A;  4OMY A;  3VB2 A;  4CYD A;  2M45 A;  3H3Z A;  1O57 A;  1IN7 A;  4HYE A;  2ZJ2 A;  1KYW A;  2C6Y A;  4BYY A;  5HS8 A;  2ZFW A;  1O3S A;  3F8N A;  5E8I A;  5K5R A;  1IUY A;  2M1B A;  2H6C A;  2ZO4 A;  2MD5 A;  1BI3 A;  1Z1D A;  3IHU A;  3QPT A;  3WGH A;  2VE9 A;  2B0L A;  2Y0M A;  3P9K A;  2P6S A;  3WE3 A;  3KP2 A;  1IN6 A;  2KJB A;  3QAH A;  1E17 A;  4KDP A;  2VC1 A;  1BC8 C;  3HHH A;  2EJR A;  3CO6 C;  2QBY A;  3K0L A;  3FM3 A;  3U2R A;  4BXU A;  3FXU A;  1YW8 A;  5TRD A;  3I58 A;  3GX4 X;  5LRR A;  2PI0 A;  4N9H A;  4HF1 A;  4L9T A;  3GVA A;  5EEG A;  3IWZ A;  3LQR A;  3EYI A;  1H9G A;  2Z9O A;  2F5C A;  4YFX F;  3BRO A;  5D8L B;  3Q5F A;  1A04 A;  3JTG A;  5IT9 K;  5FLX Z;  4GYI A;  4OIP F;  1R1U A;  4WCG A;  5AIQ A;  5LGN A;  3KP5 A;  4UUV A;  3FF5 A;  3S2W A;  1EV7 A;  1B1B A;  5HS7 A;  4KN4 X;  3CUQ A;  1U3E M;  3DPL C;  5E20 A;  1GHC A;  2HQN A;  3BJ6 A;  4HLX A;  1LNW A;  4I09 A;  1JGS A;  2E1C A;  4IHT A;  1ZLK A;  2FXA A;  3F8M A;  1G3W A;  3LST A;  1ZYR F;  3GO5 A;  2D45 A;  3M1E A;  2HS5 A;  2STW A;  5LHH A;  2IW5 A;  3SHF A;  4EJV A;  2K02 A;  3SXY A;  3U1D A;  3RKY A;  2K86 A;  1FSH A;  1UHW A;  1KU2 A;  3R61 A;  2VXZ A;  2G9W A;  3V7S A;  2DT5 A;  1O3T A;  2WWY A;  2ESN A;  2JPB A;  2HDC A;  4LB6 B;  4K2E A;  4I02 A;  5E17 F;  1S6L A;  1YYV A;  1BI0 A;  1DP7 P;  2XAH A;  2D2W A;  4P55 A;  1XSD A;  1S8N A;  3LA7 A;  1T2K A;  3IL2 A;  3GZ5 A;  3F8F A;  4GCV A;  5L3F A;  2KIM A;  1OPC A;  1R58 A;  5BQT A;  3ABT A;  1R00 A;  1B6A A;  1B9N A;  3BJA A;  4EGZ A;  4KIB A;  1BI2 A;  2RDP A;  2QQ9 A;  1EH7 A;  3LA2 A;  4M6X A;  2DFI A;  4RAZ A;  1H0M A;  1STZ A;  2P4W A;  4EMS A;  2ETH A;  3E5U A;  3FM5 A;  5L3D A;  5E1X A;  5DDG A;  2E7X A;  3HUG A;  2HFH A;  1DDN A;  1HXD A;  1I27 A;  4I0B A;  2HTJ A;  3KEQ A;  2VOO A;  2ISY A;  4MTE A;  2EWN A;  2MLG A;  4FT8 A;  3I0T A;  1LVA A;  3LAJ A;  3CJN A;  2NNY A;  2XKP A;  2DLL A;  1ON1 A;  4HAM A;  3HOS A;  2O8X A;  3FHZ A;  3Q9S A;  3LWF A;  4PGH A;  1BM9 A;  2QVO A;  2Y75 A;  4AIJ A;  2DK5 A;  4WX9 A;  2JZY A;  1ONV A;  1V4R A;  4PCQ A;  4O5V A;  4JBA A;  2Q8K A;  5JR3 A;  2ZBK A;  2DW4 A;  1REP C;  2W24 A;  3ZP5 A;  4WF2 A;  4LD5 A;  3DPT A;  5L3B A;  5TJJ A;  2FSW A;  5ICF A;  3CLO A;  1RUN A;  3TGN A;  3BP8 A;  1YG2 A;  1Z6T A;  2LF8 A;  1R1V A;  3WTV C;  1IXC A;  4WWC A;  3WTW C;  1TQM A;  3FX3 A;  4NB5 A;  1YIO A;  5ICG A;  4L9V A;  1B4A A;  1TNT A;  3ERE D;  1U5T A;  4EGY A;  4BAY A;  4Q47 A;  3KLO A;  3PFI A;  3QP6 A;  1FLI A;  1XSV A;  4MGR A;  5DD4 A;  4Q4Z F;  4HBL A;  2W85 A;  5LLQ A;  1G6N A;  5HDK A;  1KU9 A;  1V3F A;  1SFU A;  4L0Z B;  1ZHF A;  3ECH A;  5LGT A;  2A69 F;  1HKT A;  4A6E A;  2WC2 A;  3B02 A;  4MHG A;  3BDD A;  3EDP A;  2H27 A;  2KKO A;  4KYW A;  4E70 A;  4BHC A;  2FA5 A;  2GWR A;  2GZW A;  4CO8 A;  3R0J A;  2WV0 A;  2YR2 A;  5H6Q A;  5JFR A;  3K69 A;  4HV6 A;  3ZMV A;  2FBI A;  1YO5 C;  2IVM A;  2CSO A;  1CGP A;  2EV0 A;  2JT1 A;  3J80 K;  1JXS A;  4G9Y A;  3K9T A;  2Y48 A;  1I6X A;  4DNC A;  1CF7 A;  2X4H A;  4ESJ A;  1FYM A;  3FMR A;  3AAF A;  1SD6 A;  2XAF A;  1E2X A;  3WU0 A;  2YX7 A;  2V6C A;  1OYI A;  1G4D A;  3I59 A;  3HRT A;  1MKM A;  4AWX B;  2OAZ A;  2LSO A;  5FD6 A;  2HEO A;  3IWF A;  3LFK A;  3GZ6 A;  1UHM A;  2CYY A;  3RJP A;  4M71 A;  1X3U A;  2DI3 A;  4A12 A;  4LLN A;  1Z6R A;  2RQP A;  2XAQ A;  2RKH A;  3VEP A;  3E6D A;  1QBJ A;  3F8C A;  4WXC A;  2PFB A;  2TDX A;  4FX4 A;  3HIF A;  3I71 A;  2E7W A;  1XGS A;  4ENM A;  5K5O A;  3TOB A;  5ED4 A;  1TNS A;  3TKY A;  4IF4 A;  2FMY A;  4ENN A;  1ULY A;  3GFI A;  4OOI A;  5EEH A;  3HRU A;  3RYR A;  5HLI A;  1SD4 A;  2ZME B;  3GXO A;  4Q48 A;  4LK0 F;  4U0W A;  1W4M A;  4M74 A;  2BGC A;  3KZY A;  2R7F A;  4M73 A;  2IA2 A;  2BYV E;  3ZMU A;  1RNL A;  1T39 A;  4WXH A;  3TO6 A;  4HF2 A;  1FT9 A;  2EFQ A;  5IT9 Z;  1K7A A;  1U5T B;  2HQR A;  3IC7 A;  3V8K A;  4CIC A;  3KET A;  1ODD A;  2L4A A;  2D1V A;  2CQK A;  4I98 B;  4A5N A;  1BN5 A;  2EV5 A;  2R3S A;  2CO5 A;  5FO5 A;  1OMI A;  3CUQ C;  1G3T A;  3KE2 A;  4A0Y A;  2LKP A;  1I1G A;  2DBB A;  2L4M A;  1P4X A;  4RB3 C;  1QZZ A;  1KYZ A;  3EET A;  4ZYD A;  1J75 A;  5LGU A;  2A6E F;  3QU3 A;  4LLG F;  1J5Y A;  4EQQ A;  2PQ8 A;  2GIV A;  4EM2 A;  3E6M A;  3O6B B;  3KP7 A;  4L18 B;  1ON2 A;  1D5V A;  5KVR A;  5E1Z B;  1JHH A;  3O3K A;  4L5J A;  4Z2Y A;  4HDV A;  3DKW A;  2BE5 F;  3E6B A;  3OV8 A;  4CDG A;  1T0F A;  1KQ9 A;  5J8C A;  4XSX F;  1SAX A;  5CVU A;  3HOT A;  1WKM A;  1GVJ A;  1PDN C;  4IJA A;  4UVB A;  1IN4 A;  1L0O C;  3QRF F;  2R7D A;  3I59 B;  3IRR A;  1TLH B;  3HYI A;  1F4K A;  2ZCW A;  1XGM A;  5ILU A;  3L9F A;  3GWZ A;  4RGU A;  1JHF A;  3JSP A;  3G73 A;  2DU9 A;  2HYF A;  1K78 A;  2V1X A;  5D8K B;  3C7J A;  2G7H A;  4EM0 B;  1P6R A;  5L3C A;  1KQ0 A;  5DEQ A;  2OZ6 A;  1FY7 A;  1TQP A;  2VT3 A;  2NAZ A;  2UXN A;  1J7K A;  4L9N A;  2OZU A;  1P4A A;  2FRH A;  4EJW A;  2NS0 A;  3SZT A;  3G3Z A;  1MDM A;  3C1D A;  1J59 A;  4L5I A;  3RKW A;  2IRF G;  4A0Z A;  3N4M A;  3JW4 A;  1B9M A;  4O6J A;  2VBZ A;  2A61 A;  3HTS B;  2H09 A;  5FGM A;  2FF4 A;  5D6F A;  3U9G A;  3GUD A;  1TBX A;  4KIC A;  4HOB A;  4KNY A;  1R23 A;  3E3V A;  1FX7 A;  4LB5 A;  2EFW A;  2A6H F;  3BPX A;  1I1S A;  3T8T A;  3W6K B;  1LDD A;  3VOD A;  3HRS A;  1UB9 A;  4BHP A;  5E1W A;  3F8B A;  4AVP A;  2Q0O A;  2A68 F;  4YFK F;  3K1M A;  1XMA A;  2QYO A;  4UVA A;  1ZLJ A;  1U5T C;  5H6R A;  3SZP A;  4RB0 A;  4HQM A;  1F1Z A;  2RN7 A;  2H94 A;  4A6D A;  5D5V B;  5BPD A;  1FBQ A;  5LEJ A;  2QWW A;  1SMT A;  2VBW A;  4G7H F;  1O7F A;  4A2U A;  1FOK A;  3I4P A;  4A0X A;  3FXQ A;  5ILS A;  1EH6 A;  3EQL F;  2FBH A;  3SFZ A;  4H0E A;  1ZGJ A;  2HWV A;  1QPM A;  3MCZ A;  4WK8 F;  4RB2 C;  3MQ0 A;  4ASN A;  2HKX A;  2OBP A;  1BI1 A;  1IN5 A;  2IA0 A;  4WXD A;  3J80 Z;  3HSR A;  1YS6 A;  4OU0 A;  1PP8 F;  2NNN A;  5LEK A;  2LNB A;  3I54 A;  1K79 A;  4KUM A;  2O6G E;  3QOP A;  1L3L A;  2FQ3 A;  4XSZ F;  2JPC A;  2KIF A;  1J0R A;  4UV8 A;  3IKV A;  1TW3 A;  2QBY B;  4JQF A;  3I64 A;  4UV9 A;  4GYG A;  2EV6 A;  2ISZ A;  3IRQ A;  4QLC U;  2JSC A;  2L01 A;  3GW2 A;  4P9U A;  4RGX A;  5K5Q A;  1ZAO A;  2A5Y B;  4IXA A;  1F5T A;  4OIR F;  2OD5 A;  1IXR C;  1MJ9 A;  4PZJ A;  1R5H A;  4L9J A;  3JAM Z;  2VN2 A;  2ZNZ A;  1O3Q A;  2FBK A;  1MDM B;  3R0A A;  2FML A;  3TQN A;  4LLL A;  2VBY A;  1MJB A;  5HLG A;  1BJA A;  1LB2 A;  2EB7 A;  1AWC A;  5JVT A;  2DPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...