2DAOA

Solution structure of ets domain transcriptional factor etv6 protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
118
structure length
118
Chain Sequence
GSSGSSGCRLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFMKTPDEIMSGRTDRLEHLESQELSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Transcription factor ETV6
publication title Solution structure of ETS domain Transcriptional factor ETV6 protein
rcsb
source organism Homo sapiens
total genus 20
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2daoA01
3DQVC 1FBSA 2ZO4A 4M6YA 4Y15A 4EGZA 3K1PA 4O3MA 3ZMTA 1BI3A 2DBBA 1W5TA 2Y75A 2CYYA 3BP8A 3BJOA 2E7XA 3FXRA 1L3LA 3WODF 2D1VA 2RGVA 4S05A 2MD5A 4HBLA 3QPTA 2F5CA 2Z9OA 1BC7C 2GAUA 3TOAA 1O57A 3JW4A 1OMIA 1R00A 4HDUA 2XAGA 3B73A 5L3DA 4WCGA 1KGSA 4CDGA 4A6DA 3HUGA 2M1BA 3D5LA 3QU3A 3ERED 2FQ3A 1YW9A 3F6OA 3QU6A 1Z1DA 2ELHA 4Q47A 2XROA 1XSXA 5FD5A 2OD5A 3ZN1A 5FD6A 3N4MA 3EYYA 4HX8A 3GFMA 2A5YB 1H0MA 4O5VA 2NNNA 4OIQF 4LB5A 2DPUA 1T98A 2IT0A 4FT8A 1R1TA 1J59A 4LG0B 4XRFA 2L4AA 3D0SA 1BIBA 1IN5A 3E97A 1W4MA 2PJPA 1V4RA 2C6YA 2LKPA 2NNYA 1J5YA 1RUOA 2XUBA 1J2XA 3L00A 5EEHA 3I71A 3GF2A 3NQOA 2V9VA 2IA2A 5ICGA 2V1UA 2WV0A 1HKQA 4HZFA 3BPXA 3QRFF 2IJLA 1LEAA 3U2RA 1OYYA 1Z6RA 2IA0A 2VE8A 3DFGA 4P55A 3IKTA 5CVUA 4Z2YA 2FMYA 2QQ9A 3WGIA 1O3TA 2M5WA 4ZYDA 3M9AA 2HFHA 4GGGA 2D2WA 1PDNC 5ILSA 3JAMK 5DCMA 3T8RA 3F6VA 4B8XA 3C7JA 4I0BA 3DPLC 4FHTA 2FE3A 3LQRA 3LSTA 2ZFWA 1E17A 1YIOA 4UVCA 2DQLA 5CVJA 3CUQA 2H27A 2XV4S 1IN8A 4Q5SF 2HS5A 4CGZA 2CG4A 4LK0F 3ECHA 5DUIA 4HV6A 3MAJA 1SD5A 3WTYC 4JK1X 2DI3A 2UXXA 2W57A 4ESBA 3K9TA 3DP7A 1RZ4A 1R1UA 1TNSA 1HBXG 4IF4A 1WSUA 1RI7A 2NYXA 3J80Z 3NRVA 4CO8A 5DV5A 2V79A 1ZG5A 3HRUA 3FZVA 3R60A 1Y0UA 2GA1A 3KZYA 4UXNA 3NEUA 1MGTA 4WX9A 4H0EA 2FBIA 2VT2A 2IRFG 3ISPA 2ACJA 2ZXJA 4ON0A 5H6RA 4U0YA 4HX7A 5LBQA 3TGNA 1ZGJA 1BJAA 1MDMB 1ON2A 1IXRC 2IA1A 2Y0MA 1QZZA 1R22A 1U5TC 4KMUX 4G8XA 4IPAA 5LLQA 2UXNA 3IRRA 2OQRA 2KRFA 3BDDA 1XSVA 2ZNZA 3V7SA 1F1ZA 2J5PA 4ZZDA 1H9TA 4OIOF 2FXAA 3IC7A 3FXUA 1G3WA 1I1GA 2KIUA 4UV8A 3CLOA 3KP3A 3GZ6A 1B4AA 2CWEA 2HZTA 3K1NA 3T0YA 2EJRA 3B02A 2QYOA 5LGUA 3KEQA 1TQPA 2GZWA 1TBXA 4OMZA 1B1BA 1FBUA 4UVAA 2PEXA 3I0TA 3MCZA 1FLIA 3S2WA 5A2QK 2KKOA 2IP2A 5FLXK 4G9YA 2EFNA 1I6XA 2MA3A 3E5XA 2KJBA 4XBFA 5E1ZB 4KDPA 4M74A 2CSOA 1BN5A 3GYHX 4A12A 4L0YB 3BY6A 3KP6A 1XMAA 1O7FA 2RC4A 4KICA 1R23A 5IT9K 1K79A 4UVBA 2PG4A 2RV8A 2YSRA 3WGHA 5ED4A 2Q0OA 3KZZA 5D4RA 1NHAA 2FOKA 2P6SA 3HRMA 1K78A 2VOPA 5DYMA 2ZNYA 1XGOA 2GXBA 3GZ5A 4LLNA 1O7LA 1OYWA 3SQNA 3LA2A 4RGRA 4HLYA 4YFNF 3KP7A 4A0YA 2OZUA 2XHKA 1T39A 1XN7A 1DP7P 3KLNA 3IWFA 1S29A 2GWRA 2XRNA 1FOKA 3MWMA 3LA3A 1F9NA 1PP8F 3GVAA 3RKXA 4G7ZF 4WF2A 3KETA 3P7NA 4HF1A 1XMKA 1HSJA 3CO6C 2D45A 1J9IA 1TNTA 2VT3A 3TKYA 3JSOA 1HSTA 4FX0A 2VXZA 4S04A 1GVJA 1ZN2A 5L3CA 5HLIA 4RS8A 4EJVA 5IT9Z 4PGHA 5L3EA 1LVAA 3M8FA 2W24A 3J7AO 5DDGA 1ZG1A 2BYVE 3KP5A 3RJPA 4EM2A 2LNBA 2DK5A 4BHCA 2OQGA 2QENA 4ZYHA 1EV7A 4KYWA 3SXYA 2M30A 2E1NA 3RPUA 2O8XA 4BH9A 3WU0A 4L9VA 2CGPA 4UV9A 4KNYA 2HTSA 4HOBA 2VBZA 3HTUA 2G9WA 1S6LA 1FYKA 4M9SA 1SAXA 4EJWA 2EV5A 4LG0A 1S3JA 1FSHA 4A5MA 1XCBA 5H20A 5LHIA 2O6GE 4EJTA 2ISYA 1CF7B 4L0ZB 1TW2A 2VC0A 2PMHA 4N9HA 4OIPF 2QWWA 3F21A 4KIFA 3ZQ7A 5IT3A 5ICEA 2D1HA 3ZMUA 3CUOA 3C1DA 5HS7A 4MEXF 5ILVA 4I0AA 4Q48A 3ZPLA 4MQ9F 1ZRFA 1KU2A 3HSFA 2XASA 1XDSA 4A6EA 4YFXF 1TW3A 4G7OF 3HYIA 2QBYB 4WXHA 4OOIA 1XDUA 1FNNA 2XAJA 4BYYA 3HTSB 4HF2A 2DLLA 1VTNC 5D8LB 2J5OA 5HLGA 4ZH4F 1ZAOA 2W84A 3JTHA 4KFCA 3WTTC 3FMSA 1IN7A 3QAHA 3TO7A 3K2ZA 4KN4X 2IW5A 3REOA 3I53A 4M71A 2UZKA 1XCVA 5AONA 3L7WA 2F2EA 1W7PA 3M8EA 1SFUA 3O2PE 4XSZF 4ASNA 1JE8A 2FNPA 2YR2A 2QLZA 1HKTA 4R79A 5ERIA 4AVPA 5E17F 4O6JA 3SFZA 5KK1A 2EWNA 2L02A 2UWMA 1DDNA 2P4WA 3FF5A 5D8KB 1LDKB 2PMUA 2WC2A 2A6EF 4IRGA 3FXQA 3MZYA 3IL2A 3ZMVA 3H3UA 3R0JA 2MH9A 4RB3C 2ISZA 3H3ZA 1QBJA 3E5QA 1MDMA 4EM0B 1YW7A 2F5EA 4KIGA 3FHZA 2YX4A 2P5VA 4RGSA 3RIRA 5F64A 1P2FA 5K5RA 4GYGA 5LRSA 5D6EA 4U0VA 2Y48A 3VEPA 3M7GA 3HHHA 2X0LA 3J80K 4ENMA 2K27A 1SD4A 4HLXA 1FSEA 2DT5A 4YG2F 2BEOA 4IHSA 1QQIA 4AIKA 2PBIA 1SFEA 2BV6A 2XVCA 2A68F 3FX3A 2XAFA 1EH7A 4U7BA 4EJOA 2RDPA 4R8HA 3T5XA 3MZHA 2P8TA 4LLLA 2O3FA 2VBWA 1F4KA 5LHHA 1R1VA 2R7DA 5HLHA 3ABUA 3HRTA 3RTRA 2QM3A 4L9NA 3BROA 2EFOA 4MEYF 1G3YA 4RAYA 1RIOH 1JGSA 5CJ9A 1UFMA 1XGSA 4EJUA 3E6CC 4LFUA 4Q4ZF 4AWXB 4D0PA 1Z6TA 2VBYA 1R5HA 1HW2A 1Z7UA 5AIQA 2AXLA 4UNOA 2G7HA 5DD4A 4DQ2A 1IXSB 2FBHA 2EFPA 4RB2C 1IXCA 4AD9A 1QZYA 5K1YA 1ZLKA 3W6KB 2HR3A 1KQ0A 4DNCA 2CO5A 1B9MA 3L2CA 1BC8C 2L3DA 3Q9SA 2XAHA 3WE2A 5D4SA 4JQFA 3GUDA 1DPRA 3O6BB 4RGXA 3G3ZA 4P9UA 1QO0D 3WTXC 3F23A 3CO7C 1YLFA 2VBXA 2IPQX 2VODA 5CLSA 5D5UB 4PGGA 1U3EM 2ZBKA 2DO7A 1MJ9A 3EDPA 3HSEA 5CVVA 2RN7A 3CDHA 3DF8A 4FX4A 4CICA 1SD7A 3MFKA 5HVQC 1J7KA 1ZLJA 3RPQA 4OU0A 3K0LA 1FY7A 4RAZA 1B9NA 4ENNA 1V3FA 4JBAA 1BI2A 1SD6A 2ESHA 3ULQB 2JSCA 2HQNA 4LMYA 3RDIA 2QZ8A 1DUXC 1BOAA 2KIFA 3K1MA 1S7OA 1ZGAA 2E7WA 5HDNA 4G6QA 2OA4A 2QVOA 1G3SA 2DAOA 4BHBA 2X4HA 3BPVA 3FWEA 4MHGA 1DPUA 3VOEA 5HS9A 4BXUA 4GCVA 4P5OA 1UCRA 3WTUC 4P9FA 2JZYA 2A69F 3KE2A 4A5NA 3LFKA 3PQKA 4MGRA 2EFWA 3FMQA 1I5ZA 1IF1A 1LDJA 2LF7A 4N9IA 4ZZLA 5E20A 1U8RA 1AOYA 1HKSA 1PP7U 2QBYA 4NB5A 3P9IA 3WTZA 4CYDA 1WWXA 2ETHA 1D8KA 2A61A 1G4DA 4EVIA 3I54A 1QPMA 3F22A 1FT9A 3AAFA 1XGNA 1C0WA 4BAYA 4WXDA 3Q5FA 2WTEA 2RVCA 1R36A 1O3RA 3HSRA 3R61A 3FM5A 1MZBA 4BNCA 2H6CA 3QPHA 2H6BA 1LB2A 1WQ2A 3BWGA 3IHUA 4GYIA 3DPTA 1U5TB 2CQKA 2FRHA 2O03A 5TRDA 4PZJA 4M72A 3R0AA 2HOEA 3TO6A 4IRHA 4I09A 1KQ9A 4LJZF 4HF0A 1YYVA 1ZYRF 5TJJA 3GLXA 5BPDA 3TDZC 3QP6A 1HW5A 3RI4A 1P4AA 2HDCA 2TDXA 1STZA 3E5UA 1H9GA 3MQ0A 1IW7F 1B6AA 1QNTA 2COMA 2JPBA 2DW4A 3MEXA 4M9XA 1EH8A 4HDVA 3I59B 3C3WA 4BHPA 4KUMA 4G7HF 1ULYA 1ODDA 3RKYA 1OYIA 1FPQA 1T38A 3LWFA 3T1BA 4AIJA 2R3SA 4YIIA 1UHWA 5DEQA 2QQAA 1R58A 2EB7A 1FYLA 1XSDA 1SMTA 1B59A 2GIVA 3RKWA 2RNJA 4CZZA 1IN6A 1LEBA 3IKVA 4L5IA 3DXJF 5DD8A 5AIPA 1HXDA 3JSPA 2STWA 4R1HA 2V6CA 4MQVA 2JTVA 1Z05A 4EQQA 1ONVA 4Y17A 4UHTA 2DU9A 2FEZA 3F8CA 3L09A 4PCQA 1XGMA 2FNAA 4CXFA 1U78A 4IXAA 4MNUA 1FWZA 1LDDA 2L54A 1EH6A 5E1XA 1O3QA 4MTEA 4HAMA 3WTWC 5ICCA 2FU4A 2HYGD 2GXGA 3P9CA 3GX4X 2STTA 2AS5F 4LLGF 3OOPA 2G7UA 2DTRA 2W85A 2F5FA 3T8TA 1WRJA 3WG9A 2EK5A 2Z3YA 1BI0A 3EETA 2VOOA 2H09A 5E18F 2RKHA 2HKOA 3U9GA 1KYZA 2MC3A 1FX7A 3COAC 1FP1D 2ZMEB 1GXQA 4HQEA 4G6DA 2JT1A 1T6SA 4IRIA 2EA2A 5F1RA 3V4GA 3ZMSA 3KCCA 2PQ8A 5L3GA 1F5TA 4IVNA 5F6FA 1LNWA 2KIMA 1YFHA 1P6RA 2K4JA 1XB4A 3GW2A 2W25A 1JHFA 1UHMA 2KJCA 2HQRA 1MJAA 5BPIA 4IHTA 3SZTA 1WKMA 2M8EA 2XKOA 1REPC 2WWYA 4XSXF 3I4PA 1D8JA 2DK8A 1S7AA 1W7PD 2HTJA 4BQAA 1CGPA 3I5UA 1XD7A 2VC1A 5CVIA 1R5GA 4M6XA 5L3BA 3BZ6A 3VB2A 1MJBA 3GFJA 1ZH5A 4K2EA 3WTVC 5BOXA 4GXOA 1ZRDA 3RYRA 4LB6B 1ZREA 2FMLA 4EMSA 2LF8A 1HW1A 5JVTA 3FM3A 5H6QA 2PFBA 4AIHA 5DCFA 5LGTA 1MD0A 4TV7A 1I27A 1ZARA 4LD5A 3I58A 5LEKA 4WWCA 1TQMA 1QGPA 3R6SA 5D6FA 3KLOA 1U2WA 6PAXA 4MTDA 4I2OA 3ZN0A 4YIFA 1ZHFA 3V7RA 4KMFA 4I98B 3ELKA 4KIBA 5BS6A 1GXPA 1KA8A 2NRAC 1T2KA 2VE9A 3QOPA 3ZMZA 3SHFA 2LSOA 3HOTA 2Z99A 3G73A 1U6GA 2BBYA 5E8IA 2EV0A 3VFZA 5DUKA 5LGNA 4HA8A 3HIFA 2NAZA 3I64A 2HGCA 3ZP5A 2P7VB 1X3UA 2BGCA 3KP2A 1D5VA 4OINF 5EEGA 2MLGA 5E8GA 2EV6A 4IJAA 2Q8KA 3GWZA 3HHGA 4E70A 2XAQA 1FYMA 1USTA 3L9FA 5JR3A 3HRSA 2CFXA 1R7JA 4G94A 4M73A 3ZMDA 3ABTA 2GQQA 3TOBA 4EV0A 4ZYGA 1LQ1A 1BIAA 3O3KA 2O0YA 4I7HA 4QLCU 2QQBA 1P4XA 3CUQC 4OIRF 4L9JA 1D3YA 3F8BA 1YS6A 2ADUA 4ESFA 4I02A 5ICFA 1W7PB 1J75A 1YO5C 3V8KA 3GO5A 5FB2A 3J81K 2PLYA 2M45A 1GHCA 4RGUA 2FBKA 1I1SA 4ENJA 5BMZA 4A2UA 2R7FA 3GEZA 3TQNA 3GFLA 2HWVA 3LAJA 2K4BA 1RNLA 1AWCA 3P9KA 2XGXA 1JHHA 3LQQA 1YTYA 1U5TA 5D5VB 2Q2EA 4U0WA 2Z33A 1W5SA 2P5KA 3F3XA 5J8FA 4PDKA 3JAMZ 3H92A 2A07F 2MBFA 1E2XA 2DFIA 2DQRA 2VN2A 2V1DA 4WXCA 3V8LA 2OAZA 1OR7A 3HOSA 2BE5F 1P4WA 2MH2A 2FSWA 3I59A 3GXOA 2K02A 4WK8F 3PFIA 4HW0A 1YW8A 4ETSA 2F5DA 2L4MA 1IUYA 1BI1A 4QWQA 2DPDA 5JI6A 3J81Z 2A6HF 2ZCWA 1ZG3A 3DV8A 5JFRA 2L01A 3M1EA 1J0RA 2CW0F 1Z91A 2EFQA 1CF7A 2PI0A 1OKRA 4A0XA 1L0OC 5D5WB 1USSA 2JPCA 1TQIA 3OV8A 4HX4A 3BOQA 5CYVA 3EQLF 1O3SA 5HDKA 2A3SA 2GA2A 2OBPA 2K86A 4RB0A 3KFWX 5DCMB 1UB9A 3IWZA 1SFXA 5L3FA 2VONA 3EYIA 3CUQB 2FF4A 3V7CA 3ECOA 2XKPA 5D5XB 1HQCA 3DEUA 3BJ6A 3WGGA 3WU1B 3U1DA 3BJAA 4RB1A 1PUEE 4KA4A 1SMYF 2IVMA 3SZPA 4CHUA 1YG2A 2QUFA 2YX7A 2LDUA 4F7ZA 1K6OA 1IRGA 3E6MA 2P7CB 2ZMEA 3LA7A 3W6JB 2OZ6A 1T0FA 3DKWA 1FP2A 3F8NA 4LGWA 1TTYA 2OU2A 2K7LA 4OMYA 2B0LA 5A2QZ 1ON1A 4P96A 3K69A 5HDGA 5FLXZ 1RUNA 5KVRA 5K5QA 3F8MA 3VODA 1S8NA 2V1XA 3ROUA 1ZRCA 4UUVA 1FBQA 3C18A 2RQPA 5E1WA 3N97A 2MLKA 3FMRA 1FZPB 1BBYA 5LEJA 3Q9VA 1IN4A 1A04A 1KYWA 3ML6A 3PQJA 4XLPF 2EA4A 1YS7A 3KP4A 3RYPA 2H94A 2ESNA 3E3VA 5K5OA 1TLHB 3WE3A 1WI9A 5HOOA 2YU3A 4I01A 3R4KA 5J8CA 1FC3A 3TO9A 5FO5A 4EM1A 3GFIA 1YQAA 4NQWA 1IRFA 4EGYA 4ESJA 4LK1F 3IRQA 5FFZA 2PN6A 1LJ9A 1KU9A 3EUHA 4YFKF 3CTAA 4U88A 1MKMA 5CVRA 4KT5C 2M87A 5FGMA 2HYFA 2ZJ2A 3F8FA 4M9ZA 1IAWA 1IZ1A 2FA5A 4HQMA 4U7DA 1G3TA 4N0BA 3V8JA 1KQ8A 4L18B 4A0ZA 5LRRA 4Y13A 1K7AA 5J6XA 1K78B 4NHJA 5BQTA 2E1CA 1BM9A 4ENKA 4L5JA 3WTSC 1JXSA 3TDUC 2P5LC 2Z5UA 3E6BA 2YPRA 4ZYEA 2JRTA 5FFXA 3QP5A 2ZKZA 2NS0A 2O61A 3LAPA 4B09A 4HYEA 5LHGA 5ILUA 1KU7A 2P6TA 3E6DA 1KU3A 3F72A 3KEOA 2HKXA 3CJNA 4GO1A 4XLNF 4HV5A 1Z9CA 1Q1HA 1P92A 2XIGA 4KN7X 1OPCA 5HS8A 4L9TA 1G6NA 3JTGA 5JHUA 2HEOA
chains in the Genus database with same CATH superfamily
4BXXJ 2JK3A 2ECBA 3BR3A 3DQVC 3Q3SA 1FBSA 2CQNA 2ZO4A 4M6YA 4Y15A 4DGWB 3G71I 4EGZA 1K61A 3K1PA 1N77A 4O3MA 3RZOJ 3PSIA 3O8HA 3ZMTA 1BI3A 5IPAA 5K7ZA 1V5GA 2DBBA 3MMYB 1W5TA 4AVZA 1X3ZB 2OV7A 2Y75A 2CYYA 3BP8A 3BJOA 2E7XA 3FXRA 1L3LA 4J01A 1LFPA 3WODF 2D1VA 2RGVA 4S05A 4XM3A 2MD5A 2VQCA 3K4LA 3PNTA 4HBLA 3DKYA 3QPTA 4J00A 1JT6A 2F5CA 2Z9OA 1BC7C 4IQ4A 4AUXA 2GAUA 2ZXIA 3TOAA 2HVSA 4BUPA 1MBJA 2BY1A 3PUBA 4AC0A 1O57A 2DXIA 3W3CA 1S7EA 3JW4A 4H4KC 5IOZA 2GLOA 1OMIA 2HQ5A 1R00A 4HDUA 2XAGA 3B73A 3NWSA 4W97A 5L3DA 4BQOA 4WCGA 4Y3OA 1KGSA 4CDGA 5JLXA 5GPCA 2KIQA 3BR0A 4A6DA 3HUGA 2M1BA 3D5LA 3QU3A 3TMOA 3ERED 1LE8B 1ZTRA 2FQ3A 1YW9A 2IGNA 3F6OA 3QU6A 1Z1DA 2ELHA 4Q47A 4I6ZA 3H5NA 3JRIA 1K4TA 2XROA 1XSXA 5FD5A 2OD5A 3G2BA 3ZN1A 5FD6A 5GTHC 3N4MA 3EYYA 4HX8A 3GFMA 2A5YB 1V55H 2RREA 2XPWA 1H0MA 5HNFA 4O5VA 2NNNA 4OIQF 2E36A 4C2MJ 3K4CA 4P1WA 4RLQA 4LB5A 2DPUA 2KP6A 2OPTA 1T98A 2IT0A 2VXDA 4FT8A 1UG0A 1R1TA 3LMMA 1J59A 5JHFA 2E2HJ 1VI0A 4QPOA 3VDXA 1W0UA 4LIUA 3JCUC 1SVLA 4B3AA 4LG0B 1QVUA 2CUEA 4XRFA 1DGWY 4C30A 2L4AA 4HG2A 3D0SA 1ETXA 3OL3A 1BIBA 1IN5A 3E97A 2XGCA 2AQFA 1DP3A 1W4MA 1ETOA 2DA7A 2WA0A 1V4RA 2PJPA 5EZHA 2C6YA 2LKPA 4PSXA 1J5YA 3QPSA 2NNYA 1RUOA 2XUBA 4QSHA 2K9NA 4DOZA 1J2XA 3L00A 5EEHA 3I71A 3GF2A 3NQOA 1E3HA 4S0HB 2E71A 1FIAA 2ICWG 2V9VA 1XMXA 1WFXA 2IA2A 3CCVI 4XRSA 1R71A 5FRNA 5ICGA 1HC8A 3BG5A 2V1UA 2WV0A 4Y33A 5FKKA 2NXNB 4BY1J 1HKQA 3BG7A 4HZFA 3CCSI 3BPXA 1RKTA 5EZGA 3OSFA 1JT0A 3QRFF 2HPMA 2IJLA 2ELJA 2JSPA 4PSWA 1CQTA 1XTAA 2KHMA 1LEAA 3U2RA 4N4OB 1OYYA 2X1DA 3CMYA 1Z6RA 2IA0A 3G1OA 4FTHA 2F48A 3S3NA 2VE8A 3HB9A 1U9OA 2DDAA 1WVRA 3DTEA 3DFGA 1ZQ3P 3OS0A 4P55A 3CLQA 5TISC 5CVUA 3IKTA 4Z2YA 3S1QJ 3D1NI 4BBSJ 2FMYA 2PJRA 2QQ9A 3CCJI 1ETWA 3WGIA 1O3TA 3DLAA 2M5WA 2XPUA 4B47A 4ZYDA 2DJIA 2W7NA 3M9AA 2DA1A 2HFHA 2QQ8A 4GGGA 2D2WA 4BU2A 3A01A 1U0JA 1PDNC 2LRDA 5ILSA 3ZQQA 3UKGA 3ASOH 4XLCA 3JAMK 1ENHA 5DCMA 2OUMA 3F6VA 1GUUA 3T8RA 4B8XA 3C7JA 3M4OJ 4I0BA 3DPLC 4FHTA 2FE3A 3LQRA 3LSTA 2ZFWA 2VL8A 1E17A 4XL9A 1YIOA 4UVCA 2DQLA 2Y31A 4BGDA 5CVJA 4F93B 3CUQA 5IYDJ 2R7WA 2H27A 5E79C 2XV4S 1IN8A 2QEXI 3E1SA 4Q5SF 4AIDA 3MD2A 1IDYA 2HS5A 4CGZA 2CG4A 4LK0F 1IRZA 3ECHA 1D0XA 5DUIA 4HV6A 3MAJA 1SD5A 3WTYC 3OYCA 4JK1X 4E7SA 2CV0A 2L7MP 2CH0A 2DI3A 2UXXA 2BXZA 3K4NA 3SDBA 2W57A 3H9QA 3K9TA 4ESBA 3DP7A 1BOBA 2K9QA 1R6RA 1RZ4A 1P9QC 4XICA 1OLTA 1R1UA 1TNSA 1R49A 1LUJB 1OCOH 2TCTA 3ZRGA 1HBXG 4IF4A 3VPRA 2HXIA 5K7HA 1WSUA 1RI7A 2NYXA 3E0JB 3I56I 1UELB 3NRVA 3J80Z 4CO8A 3HOZJ 3ZQCA 3JRBA 3TW6A 5DV5A 2V79A 5IP6A 3RSNA 1ZG5A 2YS9A 3Q0VA 3HRUA 3FZVA 4CCOA 1RKWA 1D1CA 3R60A 1Y0UA 2GA1A 3KZYA 3TP3A 4UXNA 3NEUA 2WAFA 1X3WB 1MGTA 3C2GA 4WX9A 4H0EA 2FBIA 4I76A 4IHYA 2E34A 4BACA 4CCKA 2VT2A 5KCMA 2IRFG 1RR8C 3ISPA 2E2JJ 2ACJA 2ZXJA 4ON0A 3ABLH 1SANA 5H6RA 4U0YA 4HX7A 1WGXA 5LBQA 4XKBA 4G6TB 3TEDA 1Y1WJ 1YOVB 1ZGJA 3TGNA 2X6OA 1BJAA 2M9HA 1MDMB 1ON2A 5E3OA 1IXRC 2IA1A 2W1OA 4ABZA 2HDWA 2QKMB 2VPRA 3FK6A 2Y0MA 1QZZA 3G6EI 1R22A 1U5TC 3BQYA 4KMUX 1N78A 4G8XA 4IPAA 5LLQA 4IOCF 2UXNA 3IRRA 2OQRA 2KRFA 3BDDA 4II3A 1XSVA 2ZNZA 3V7SA 2JVHA 3OYLA 3HKZA 1ZGWA 1F1ZA 2EH3A 2J5PA 2M8GX 4ZZDA 1H9TA 2BZTA 4OIOF 2FXAA 4HSRA 3TP0A 3IC7A 3FXUA 2XAUA 1G3WA 4M3BA 2JUGA 1R5ID 1I1GA 1XG1A 2KIUA 4UV8A 2P81A 3CLOA 3KP3A 1B4AA 1OR7C 3GZ6A 3EPZA 2CWEA 2HZTA 2L7KA 3K1NA 3T0YA 1SFOJ 2EJRA 3B02A 2QYOA 2QSGX 5LGUA 4PJLA 3ZXSA 4BKXA 3KEQA 1JUPA 4RAFA 1W5CC 1TQPA 2GZWA 1TBXA 4OMZA 2R7VA 1B1BA 1FBUA 4UVAA 2PEXA 3I0TA 3MCZA 2CUFA 1FLIA 2ZJPF 4BY7J 3S2WA 5A2QK 2JA6J 2KKOA 2IP2A 3BTIA 3MZ8A 3ERMA 2WAQN 3DU5A 1H8AC 5M5WJ 5FLXK 4G9YA 3VYTB 1ETYA 2EFNA 1I6XA 2MA3A 2IGOA 3E5XA 2KJBA 2HOAA 4MFEA 1NH3A 4XBFA 2BY3A 5E1ZB 4PJJA 4M74A 1PUFB 4KDPA 2CSOA 1BN5A 1LFBA 3DEWA 1MMDA 2H1LA 3GYHX 4A12A 4L0YB 4PJMA 3BY6A 1W36C 3KP6A 1XMAA 2MFZA 1O7FA 3D5SC 3KYCB 2RC4A 3OIOA 1W36D 4KICA 1R23A 5M3MJ 4KJZA 4B48A 3OIPA 5IT9K 3RQ4A 1W0TA 1QA6A 1K79A 1FTZA 4UVBA 3ONQA 2PG4A 2XC7A 2L5QA 2RV8A 4E7IA 2YSRA 3WGHA 5ED4A 2Q0OA 2DFFA 3KZZA 3CJTB 5D4RA 1NHAA 2FOKA 3ZR8X 2P6SA 3HRMA 1K78A 2VOPA 2EIMH 5DYMA 2ZNYA 3CZ6A 4JYKA 1XGOA 2GXBA 1JUMA 3GZ5A 3DKXA 4LLNA 1O7LA 1OYWA 3SQNA 2DA6A 3LA2A 4RGRA 3JRCA 4IZZA 4HLYA 2NS7A 4YFNF 4CYCB 1VQLI 1AKHB 3S17J 3KP7A 3BTCA 3O8GA 4A0YA 2OZUA 2XHKA 2WBMA 1T39A 2LFBA 5EDNA 1XN7A 2QCOA 4BE1A 3RKQA 1DP7P 3AG3H 3KLNA 3IWFA 1S29A 2GWRA 4D5CA 2XRNA 1FOKA 1OCRH 1WJBA 4D5FA 2DJNA 3MWMA 3LA3A 1F9NA 4DYCA 1T8IA 4RA2A 1GDTA 1PP8F 2D5VA 3GVAA 1OCCH 2GOMA 3RKXA 4XLEA 4G7ZF 5FKOA 4WF2A 3KETA 3P7NA 2V7FA 4HF1A 2LY2A 2M4GA 2ZMEC 4LIVA 1XMKA 1T0FC 1HSJA 3CO6C 2D45A 1J9IA 2ZJRF 1TNTA 2VT3A 1YI2I 1Z67A 3TKYA 4ZC3A 3JSOA 1HSTA 5KAFC 4A93J 4FX0A 1JJ6C 2E1MB 3JRHA 2VXZA 3BZKA 4S04A 1GVJA 3H5AA 1ZN2A 4A3DJ 4E6KG 5L3CA 5HLIA 2A05A 1WJDA 4RS8A 4EJVA 5IT9Z 3W2VA 4PGHA 5L3EA 1LVAA 3M8FA 2W24A 3J7AO 3SZGA 5DDGA 2DMNA 2R7TA 1OCZH 1ZG1A 2BYVE 3KP5A 2VKDA 2COBA 2DA3A 4KT6A 3RJPA 4MLOA 4EM2A 5B3SH 1OCTC 3NARA 2LD5A 3P5JA 5KHDA 2QGUA 3QYFA 2LNBA 2DK5A 3GMEA 4BHCA 3K2AA 1QHGA 4U87A 3CMAI 1LE8A 2OQGA 2QENA 1YHQI 3HEFA 3K4KA 2KRHA 4ZYHA 1EV7A 4E7JA 1FIPA 4KYWA 3HOVJ 4CH7A 1GV5A 3SXYA 3HOXJ 5FLMJ 2M30A 3H0DA 2E1NA 3RPUA 5J1YA 2B7EA 2O8XA 4BH9A 3WU0A 4A3JJ 4L9VA 2CGPA 2XB0X 4UV9A 4KNYA 2HTSA 3GTQJ 4C2TA 3LNQA 4HOBA 2VBZA 3AKZA 3HTUA 3OYAA 1MSFC 2G9WA 2LYCA 3LSRA 1S6LA 3J7ZI 2K5CA 1FYKA 3OYMA 4M9SA 3F9KA 1SAXA 4EJWA 2EV5A 2NVQJ 1X19A 4LG0A 1S3JA 1IJWC 2HXOA 2EILH 2IXSA 4RM3A 4A5MA 1FSHA 2CMPA 1XCBA 5H20A 5LHIA 3OYBA 2O6GE 4EJTA 2ISYA 1CF7B 2KISA 5FKLA 4F52A 4L0ZB 4V2FA 1TW2A 2VKHA 4L5EA 2VC0A 3PUFA 5GAHJ 3EUHC 3M3YJ 2PMHA 4N9HA 1MIJA 4OIPF 4UB8C 1E3PA 2MW8A 2QWWA 2X51A 3SYTA 3F21A 2XB5A 1VQ5I 4KIFA 3H0GJ 1ITYA 3ZQ7A 5IT3A 5ICEA 2D1HA 3ZMUA 2QSFX 3CUOA 3VSKA 3BC8A 3S2HJ 1VQ4I 3C1DA 2R5ZB 5HS7A 4MEXF 4RM2A 5ILVA 4I0AA 4XNFA 4Q48A 3ZPLA 5FKMA 4NC7A 4MQ9F 1ZRFA 5F04A 1KU2A 3HSFA 5DM6F 2XASA 1G59A 3A4CA 1XDSA 4B43A 1HA8A 4A6EA 4BJTA 4YFXF 5EEAA 1TW3A 4ZDOA 3JRGA 2B9SA 4XLFA 4G7OF 3PNYA 3B6CA 3HYIA 2QBYB 1ACIA 4WXHA 1BR1A 1T56A 1JKRC 4OOIA 2L0KA 4FISA 1XDUA 5GTIC 1FNNA 1Y8RB 2NOGA 2XAJA 4C2UA 4BYYA 3HTSB 3QOEA 5IP7J 4HF2A 2DLLA 4XR6A 1VTNC 5D8LB 1AA7A 3M07A 3RCOA 2J5OA 5HLGA 4XRSG 3SDGA 4ZH4F 2LBFB 2AXTC 1ZAOA 5GAGJ 5B1BH 1QVTA 2W84A 2XF7A 2ZC2A 1JTYA 3JTHA 4KFCA 3WTTC 3FMSA 1IN7A 3CF2A 3QAHA 3KX2A 2Q1ZB 3K2ZA 3TO7A 2H8RA 2W4SA 3G4SI 3NWTA 4KN4X 4XMYA 2IW5A 2MABA 3REOA 3OL4A 1X58A 3I53A 2NOJB 4M71A 1DU6A 2FQ4A 2UZKA 1XCVA 1RR7A 3L7WA 4XKWA 5AONA 4JX5A 2F2EA 2KLOA 3S93A 1W7PA 1Z21A 2LKSA 3M8EA 1SFUA 3O2PE 4DJAA 4XSZF 4ASNA 3IH4A 1JE8A 2E19A 3S1NJ 4BE0A 2FNPA 2WB1N 2YR2A 2QLZA 1HKTA 4KISA 4R79A 4QPQA 3LSPA 5ERIA 2KL4A 4AVPA 5IP9J 5E17F 1JKOC 1FTTA 4O6JA 3SFZA 5KK1A 1IGNA 3S1MJ 1Z77A 2ELKA 2ECCA 2DA2A 1Y39A 2EWNA 2VUMJ 2L02A 1PYVA 3OYHA 4D7NA 2ZSHB 4DW6A 4XIDA 1PJRA 2HVRA 2UWMA 1HDPA 1MMAA 1DDNA 2P4WA 1D1BA 1TT0A 2ZFUA 3FF5A 5D8KB 2EPFA 1LDKB 2PMUA 5B66C 2WC2A 4ITVA 2A6EF 4IRGA 2KZVA 3FXQA 1WJ5A 3MZYA 2GXAA 3DWLE 3IL2A 3ZMVA 1NG7A 1X1BA 3H9GA 4BQNA 1V5EA 3H3UA 3QQAA 3R0JA 4BE2A 1F43A 3L2WA 2MH9A 4RB3C 2ISZA 3G1MA 5IYCJ 3DTKA 2GIZA 1ERDA 3LSMA 3H3ZA 4IOAF 2Y30A 1QBJA 3E5QA 1UHSA 1MDMA 2ME0A 4EM0B 3MN2A 2KDZA 1YW7A 3AL0C 2F5EA 5J40A 2Y69H 5C3EJ 1GT0C 4RLFA 4KIGA 4A3EJ 1SVMA 3FHZA 4ZYAA 1EF4A 2YX4A 2P5VA 2E1OA 2JRMA 4RGSA 2Y2ZA 2JVGA 3RIRA 5F64A 1P2FA 5JVGF 2RQQA 5K5RA 1OISA 3SJMA 4GYGA 5LRSA 2EZIA 5D6EA 1RC9A 4U0VA 1BJZA 5FRMA 1IV8A 2Y48A 3VEPA 3M7GA 1B8IB 1A31A 3ZQIA 2LR8A 3HHHA 2X0LA 5F27A 3J80K 1FOYA 3ASNH 2K27A 4ENMA 1SD4A 4HLXA 1FSEA 2DT5A 3JREA 3I4MJ 3OR1C 2EINH 2L7ZA 3TL4X 4YG2F 2BEOA 4IHSA 1QQIA 1EJ9A 4A3CJ 5EGOA 2F4OB 4FCYA 2EZKA 4AIKA 1VQPI 4HSTA 2OF7A 2PBIA 1TWCJ 3DBHB 1SFEA 2BV6A 3PM1A 4CSWA 2XVCA 9ANTA 2A68F 1V54H 3FX3A 4XOTA 2XAFA 5F08A 2IEKA 4XORA 4NDLA 1EH7A 5HNHA 4U7BA 4RAGA 4EJOA 2RDPA 4PJ0C 3AFHA 2XSJC 4A3LJ 2CW8A 3PJRA 4A3KJ 4D7MA 4R8HA 3H1CA 3T5XA 3MZHA 1HCRA 2P8TA 4LLLA 2O3FA 2M7BA 2VBWA 5C4XJ 1VNDA 2DYRH 2VIXA 3J7YJ 1F4KA 2CV2A 2JUCA 5LHHA 1R1VA 2R7DA 5HLHA 2RAEA 3ABUA 3BR1A 1MMSA 3HRTA 3JR9A 4B3XA 3RTRA 1X2NA 2QM3A 3ZQLA 4L9NA 2QF7A 5F0FA 3K6GA 1BR4A 2VQHA 4BS9A 4XLAA 3S2DJ 2IBDA 3BROA 2EFOA 4MEYF 1G3YA 3GTLJ 3QWLA 4RAYA 1RIOH 1JGSA 5CJ9A 1MMNA 1UFMA 1XGSA 4DYQA 3GTOJ 3VYUB 4IEJA 2HOSA 2MD0A 1FEXA 3HPGA 4EJUA 3E6CC 4LFUA 4Q4ZF 2HVQA 4AWXB 4D0PA 2HOTA 1Z6TA 2VBYA 3AG2H 1R5HA 3W6VA 4A69C 2VKVA 4BL0B 2FUG2 1HW2A 1YX5A 1Z7UA 2GBYA 5AIQA 2AXLA 3I55I 4UNOA 2G7HA 5DD4A 3OYDA 4IO9F 2EZHA 3LL7A 4F3QA 3H3VK 4HPQA 3S32A 1AKHA 4CZCA 4DQ2A 1IXSB 1M1EB 4BQQA 2FBHA 2EFPA 3OIQA 2BY2A 4RB2C 1IXCA 2L2OA 4AD9A 4C3JJ 1QZYA 5K1YA 1LFUP 1YX3A 1ZLKA 3W6KB 2HR3A 1D0ZA 2LK2A 1KQ0A 4NNJA 3HGYA 4DNCA 1QHHD 2CO5A 1B9MA 3HGGA 1A5JA 3L2CA 1YRNA 1BC8C 2Z1DA 1LVKA 4AYBA 4ZDLA 4X1EA 4BBRJ 1NG6A 1ZELA 2L3DA 3Q9SA 2ZSIB 3VYRB 2DMTA 2XAHA 3WE2A 5D4SA 4JQFA 1VFCA 3GUDA 1TT5B 1TWHJ 2PMZN 1DPRA 1YIJI 3O6BB 4RGXA 1EKEA 4ZTFA 3BLYA 1ETVA 3G3ZA 1OFCX 4P9UA 1QO0D 4JX4A 2LREA 3WTXC 1VQ6I 3TW7A 3F23A 2L9NA 3CO7C 1FMWA 2R7UA 2XF6A 3HZJA 1G2HA 2LG4A 1YLFA 2VBXA 4BDYA 3AL0B 2IPQX 1KZHA 2VODA 1UMQA 3CCEI 5J4VA 5CLSA 5D5UB 1Y56A 4PGGA 1U3EM 2ZBKA 2VQLA 1ZR2A 2DO7A 1MJ9A 4HNUA 5CQGA 5DTDA 3DBLB 2M0CA 3HJEA 2CQ7A 3EDPA 3DU6A 3HSEA 5CVVA 2RN7A 3CDHA 3DF8A 5CQEA 4FX4A 4CICA 2M2EA 1SD7A 3MFKA 5HVQC 1J7KA 1ZLJA 3RPQA 4QIWN 2A6TA 4OU0A 3K0LA 1ZR4A 1YITI 1FY7A 1GVDA 3HDDA 2LOOA 4LG3A 1B9NA 4RAZA 4XK4A 4ENNA 1V3FA 4JBAA 5DM7F 1BI2A 1SD6A 2ESHA 3ULQB 2JSCA 2LH9A 2R0QC 1FJLA 2HQNA 4FQGA 3HXLA 1DQUA 1NK2P 4E7LA 5K7FA 4N4NB 1H88C 4DBQA 1VQ8I 2R7OA 2KRCA 3VYSB 3BCAA 4LMYA 3RDIA 2QZ8A 1HF0A 4MIMA 1DUXC 4G12A 3LSJA 1BOAA 3W2WA 3K70C 2KIFA 3K1MA 1S7OA 1ZGAA 2VI6A 2XGDA 2E7WA 5HDNA 3K70D 1OQYA 4G6QA 2OA4A 2V26A 2QVOA 4V19K 5TGTA 1G3SA 4B44A 2DAOA 4BHBA 4DBRA 2NS8A 3A02A 3S3OA 2X4HA 3FBNB 3H5RA 3BPVA 4F91B 3FWEA 4MHGA 1DPUA 1AHDP 1NK3P 2M34A 2JA5J 3VOEA 5HS9A 4BXUA 1X1DA 4GCVA 3L2RA 2X48A 4JP0A 4P5OA 1UCRA 3CCMI 3IH2A 1D1AA 2W82A 1V5FA 2H1KA 3WTUC 1RRJA 2WB1A 1JGGA 1APLC 4FETA 3FKIJ 1YJ9I 1WHUA 4P9FA 4ANJA 2JZYA 3D5RC 4IL6C 2CU7A 2A69F 3KE2A 4A5NA 1TWGJ 2R5ZA 3LFKA 3PQKA 4MGRA 2EFWA 2IS2A 5J1RA 1IO2A 3CC7I 4KITB 3FMQA 2VPLA 2JN6A 3HM5A 1I5ZA 2VQGA 4JOMA 5B5EC 3FXMA 5F1JA 1VQOI 2LMDA 1IF1A 1RPWA 3B6AA 3CP8A 1P7IA 2O8KA 1LDJA 2LF7A 4N9IA 4ZZLA 5E20A 1U8RA 1AOYA 1HKSA 3CCUI 1PP7U 2QBYA 2BXYA 4E4HA 1WZ2A 1I3AA 4NB5A 1Q1VA 3QODA 2R7ZJ 3MKWB 1W1WE 4DIQA 2DTZA 4E7ZA 1XS9A 3P9IA 2XDVA 3WTZA 4CYDA 4IHVA 1WWXA 2ETHA 1D8KA 2JA2A 4A3MJ 1VQMI 2A61A 2LBFA 2IGMA 1G4DA 3FXLA 4EVIA 3I54A 1QPMA 3F22A 1FT9A 3AAFA 1XGNA 1TZLA 1C0WA 4BAYA 2BHYA 4WXDA 3Q5FA 1VQNI 2WTEA 2HI3A 2RVCA 1R36A 1GLNA 1O3RA 2MSYA 3HSRA 3R61A 2OCEA 3FM5A 1MZBA 4BNCA 4BDZA 5HLTA 3ZGKA 2X1CA 4LITA 2H6CA 3QPHA 2KQRA 1WI3A 2H6BA 4GFBA 1Z7LA 5LFAA 1LB2A 2KZGA 1WQ2A 2V9KA 3BWGA 1XC5A 3IHUA 4GYIA 2Y0SN 3DPTA 3IAM2 1U5TB 2CQKA 5J4YA 2FRHA 2Q2EB 4XONA 1GV2A 1TWFJ 2E5ZA 1SVOA 3NAUA 2O03A 5TRDA 4PZJA 4M72A 3R0AA 2CQQA 2HOEA 3TO6A 4IRHA 4I09A 5J1UA 1KQ9A 3FIWA 4LJZF 4II2A 1MMGA 4HF0A 2FX0A 5FKNA 1YYVA 1ZYRF 5TJJA 3OYIA 2NVUB 2GOXB 2JA7J 2KMUA 3GLXA 5BPDA 3TDZC 3QP6A 3OS2A 1HW5A 3RI4A 1P4AA 2IS4A 2HDCA 2TDXA 1STZA 3E5UA 1H9GA 1IW7F 1B6AA 1QNTA 2COMA 2JPBA 1A6QA 3MQ0A 2DW4A 3MEXA 4M9XA 1EH8A 4BHPA 3I59B 3C3WA 4UUSB 2BW3B 4KUMA 4HDVA 4G7HF 1ULYA 1ODDA 3RKYA 1QPIA 1OYIA 3SFIA 1FPQA 1T38A 3LWFA 3T1BA 3CCYA 2YUSA 4AIJA 4XOPA 4M3GA 2R3SA 3K4BA 3F0CA 4YIIA 1I50J 1UHWA 5DEQA 4IKFA 2QQAA 3ABKH 1R58A 2EB7A 2L7FP 1FYLA 1XSDA 1SMTA 1B59A 2GIVA 3OMYA 3RKWA 3GTMJ 3AG4H 2RNJA 4CZZA 5KNLA 2XGEA 1IN6A 1LEBA 3IKVA 5M5XJ 4A3GJ 4L5IA 3DXJF 5DD8A 5AIPA 1HXDA 3DTIA 3JSPA 2LY9A 2STWA 1Y6IA 4R1HA 2V6CA 4MQVA 2Y9ZA 2JTVA 4ZTJA 1Z05A 1WJCA 2OCCH 4EQQA 4NC8A 1ONVA 4Y17A 3QYEA 3BCBA 4UHTA 1F36A 4HNVA 2DU9A 2FEZA 1X1AA 3CMMA 3UR3C 3F8CA 4CCNA 3CQZJ 2DYSH 3L09A 2K9MA 1JKQC 4PCQA 1XGMA 2FNAA 2LY1A 2DOFA 4CXFA 1U78A 1BA5A 2N8GA 3RQIA 4IXAA 4CA0A 2O9LA 2EBIA 2I5UA 3K4JA 2K9SA 1DU0A 2NVXJ 4MNUA 1FWZA 1LDDA 2L54A 3FXOA 1EH6A 3ABMH 1BW6A 5E1XA 1O3QA 3BG9A 4MTEA 4HAMA 3WTWC 3IH3A 2DMUA 5ICCA 3HPHA 4GDFA 2R5YB 1QU3A 2FU4A 2HYGD 4AU7A 2GXGA 3P9CA 3GX4X 2OJED 1JJ8C 2STTA 2AS5F 4LLGF 3BTLA 3OOPA 1Y0NA 2G7UA 2DTRA 2W85A 3PO2J 1LPQA 2F5FA 3HBLA 3T8TA 4Z6YA 3BQZA 1WRJA 2M0MA 2L9SA 3WG9A 1N75A 2EK5A 2Z3YA 1BI0A 3KIOA 1KONA 3MKLA 3EETA 2VOOA 2H09A 5DS9A 5E18F 2RKHA 4RDUA 2HKOA 3U9GA 5BNGA 1KYZA 1BW5A 2AQEA 4C9YA 2MC3A 3GLLA 2HU9A 1FX7A 3COAC 3BZCA 1FP1D 2ZMEB 1GXQA 2R7QA 3FXJA 4J19A 1JKPC 1OJLA 4HQEA 4G6DA 2JT1A 1T6SA 5EJCA 4IRIA 2EA2A 3PSFA 2BVLA 3FHNA 5F1RA 4IHWA 3V4GA 5E3NA 2CJJA 1WH5A 4HEA2 3IUOA 3ZMSA 3KCCA 2PQ8A 2VASA 5L3GA 2F6CA 1F5TA 2F5VA 3I3LA 1Y8QB 4X0GA 4IVNA 5F6FA 1LNWA 2IGKA 3S3MA 2KIMA 1YFHA 1P6RA 2K4JA 3WHBA 1XB4A 3GW2A 3HOUJ 2DT7B 2W25A 3S1RJ 5F0CA 2L9VA 1JHFA 1UHMA 1R9TJ 2KJCA 2G0EA 2HQRA 2K3PA 3BG6A 1MJAA 2DCEA 5BPIA 4IHTA 5IOYA 3SZTA 1WKMA 3DCFA 3HC7A 2M8EA 2XKOA 3A0HC 1YJNI 1REPC 2WWYA 4XSXF 1WJEA 3I4PA 1G8XA 2WAQA 3H9JA 2DK8A 1MNMC 1D8JA 4A3BJ 3C2BA 1S7AA 4IX7A 1W7PD 1JTXA 4E7KA 3CC2I 2HTJA 4BQAA 2CUJA 3L1PA 1CGPA 5C44J 3I5UA 2E2IJ 3U1KA 2LLKA 4AM3A 2BHZA 2AO9A 2JWTA 1XD7A 2R4GA 2VC1A 5CVIA 2CFOA 1R5GA 1BR2A 1X1PA 2O5RA 4M6XA 2E60A 4BEHB 2DA5A 4E7HA 5L3BA 5GPAA 4YELA 2B63J 4XKVA 1XPXA 5GADJ 3BZ6A 1Z3XA 2LP0A 1A6IA 3VB2A 5M5YJ 3OR2C 1MJBA 3GFJA 4HRIA 1ZH5A 4K2EA 3OYEA 2TRTA 1T95A 3WTVC 3J7AY 4NQWB 5E3MA 5BOXA 4GXOA 1ZRDA 3RYRA 4LB6B 1ZREA 3CJQB 2FMLA 2ID6A 5HODA 4EMSA 2DN0A 2LF8A 1WPKA 1JI8A 3PIOF 1HW1A 1MH3A 5JVTA 2VKEA 2XPVA 3FM3A 4XKCA 5H6QA 1B72B 2PFBA 4AIHA 5DCFA 1IV6A 3GZNB 3KEYA 2IS6A 5LGTA 1MD0A 4TV7A 4M6VA 4M3FA 1I27A 1ZARA 1MBFA 4LD5A 2MGQA 4XN3A 3L2VA 3I58A 5LEKA 4WWCA 2PX9A 5GP9A 3OY9A 3M8JA 3CCRI 1TQMA 3LSHA 1QGPA 3R6SA 2CRGA 4DZPA 5D6FA 1UJ8A 1HDDC 4F92B 2XF5A 3KLOA 3Q0UA 1T33A 1U2WA 4F55A 4XN0A 6PAXA 4MTDA 4I2OA 3ZN0A 1POGA 1HOMA 4YIFA 1ZHFA 5FROA 3V7RA 4KMFA 1MBGA 4I98B 3ELKA 4KIBA 5BS6A 3FDYA 1GXPA 1KA8A 2NRAC 1D0YA 1T2KA 2VE9A 3QOPA 3KYDB 3OYJA 3ZMZA 3SHFA 3UNGC 2VJ5A 2LSOA 2KT0A 2KFDA 3HOTA 2Z99A 4OWRB 3G73A 1U6GA 2BBYA 5E8IA 3OWTA 2EV0A 3VFZA 4HA8A 5DUKA 5LGNA 2JMWA 3HIFA 3PFYA 2NAZA 1PUFA 3FISA 3I64A 3MVPA 2HGCA 4DYRA 2OTLI 3ZP5A 2P7VB 1MNEA 1X3UA 4RBOA 2CV1A 2BGCA 3KP2A 1D5VA 4YEJA 5EEGA 4OINF 2MLGA 2Y0SA 4UUTA 2X6YA 5E8GA 2EV6A 5JLWA 3S16J 4IJAA 1RESA 4NUBA 4XRMA 4Y7NJ 2Q8KA 3GWZA 3HHGA 4CCJA 5F0HA 3CF5F 3FXKA 4E70A 5LD2C 2XAQA 4JX6A 1MNDA 3K10A 1FYMA 1USTA 3L9FA 3WHCA 5JR3A 3HRSA 2CFXA 5EG0B 1OCPA 1R7JA 2HYJA 3PNVA 4G94A 3ABTA 2GQQA 4M73A 4XLHA 3TOBA 3ZMDA 4EV0A 4ZYGA 2LTPA 3CMEI 2X85A 4NC6A 1LQ1A 4PJNA 1BIAA 3O3KA 2O0YA 2CW7A 4I7HA 4QLCU 3FBIB 1X4OA 1QRYA 2K85A 2MG4A 2Z2SB 1QZEA 2QQBA 1WJAA 1IDZA 3GTGJ 1T08B 2E5NA 3BR2A 2VB6A 1P4XA 1SAUA 3CUQC 1X2MA 3HOWJ 4OIRF 1Z0XA 4L9JA 2ME6A 1D3YA 4CYCA 3F8BA 2Z16A 1YS6A 2WV1A 5C4JJ 2ADUA 4EATA 2CQXA 4ESFA 4I02A 2DMPA 5ICFA 2X6WA 1E0EA 1W7PB 3DPUA 5FJ8J 2F4MB 1J75A 1WJFA 2I8DA 2NVTJ 1YO5C 3V8KA 3GO5A 5FB2A 3J81K 1VF9A 1E3OC 2PLYA 2E35A 2QKLB 3IP4B 2A5WA 2M45A 1ORKA 1GHCA 4RGUA 2FBKA 2DFEA 4M3EA 1I1SA 2R92J 2YU9J 4ENJA 3HUGB 5BMZA 3ZQHA 1P7JA 1UZCA 2R7FA 4A2UA 3GEZA 1AU7A 2K40A 3OYKA 3TQNA 3GFLA 2HWVA 2NVYJ 3LAJA 2K4BA 1R4MB 2HPIA 3BR5A 1RNLA 4FASD 1R4NB 2V9PA 1AWCA 2XRLA 2MYSA 3P9KA 2XGXA 1JHHA 1MSEC 4HNTA 1VQ7I 3LQQA 3QPLA 3SEQA 1UAAA 3A1YA 3PO3J 2OTJI 3CDIA 4PFPA 2K3FA 4FE4A 3PIPF 3BTJA 2X6XA 1YTYA 2I10A 1U5TA 3FKJA 5D5VB 2Q2EA 3HG9A 2W48A 4U0WA 2Z33A 1W5SA 3OS1A 2P5KA 3F3XA 5J8FA 3WU2C 4PDKA 3JAMZ 3H92A 1IC8A 2E1MC 2DMQA 4YIRX 2A07F 2MBFA 1SC7A 1NTCA 2JJ7A 5EF6A 3LSGA 1E2XA 2BOLA 3N05A 2VJJA 2R93J 5IY5H 3Q0WA 2DFIA 2DQRA 2VN2A 3H36A 2V1DA 2DODA 4WXCA 3V8LA 1EA3A 3JRFA 2OAZA 1OR7A 1ZK8A 4ZDPA 3G1LA 1UG2A 2WAEA 2V4JC 3EUKL 1XX5A 2ID3A 3HOSA 2BE5F 1P4WA 2MH2A 2FSWA 3I59A 4M3DA 2BW3A 4UUSA 3GXOA 2K02A 4WK8F 3KPHA 3PFIA 4HW0A 1YW8A 4ETSA 2F5DA 1LKXA 3ESWB 3M1CA 2L4MA 2LVSA 3JRDA 3KZIC 3U21A 1IUYA 1BI1A 4QWQA 5E3LA 2DPDA 4D9JA 5JI6A 2ZB9A 2HNHA 3LSKA 2A6HF 3J81Z 3VWBA 1YE9A 2ZCWA 1VQKI 1ZG3A 5EGOB 2JQ7A 1I6HJ 3DV8A 5JFRA 4FE7A 3ZQFA 3W2AA 1MBKA 2L01A 2BVMA 3M1EA 1I3QJ 4A3FJ 1J0RA 2CW0F 1TC3C 1Z91A 1JUSA 3S14J 4D1QA 3CCLI 2H8WA 2EFQA 4Y4RA 1CF7A 2LC2A 2PI0A 1OKRA 4A0XA 1ETQA 2IS1A 1L0OC 5D5WB 1USSA 4UB6C 2JPCA 1TQIA 1IG7A 2PJRB 3OV8A 5EYRA 3ZQGA 1RETA 4UY8I 4HX4A 3BOQA 2MC4A 5CYVA 1FMVA 3EQLF 3A01B 4DZJA 1O3SA 1IUFA 2A3SA 2GA2A 5HDKA 3CCQI 2OBPA 1SFKA 2VJ4A 1DGRM 2K86A 4RB0A 3KFWX 2BY0A 5DCMB 3OSGA 2ZXWH 1UB9A 3IWZA 3DLLF 1SFXA 2Y9YA 5J47A 5L3FA 2X1EA 1BL0A 2L9RA 3OOUA 2VONA 3EYIA 1FOXA 4ZJZA 3CUQB 4B4CA 2FF4A 2M7AA 3V7CA 2KPMA 3ECOA 2XKPA 1X4PA 5D5XB 1HQCA 5FLVA 2FOWA 3DEUA 4YRVA 2R5YA 3KYLA 3BJ6A 3WGGA 3WU1B 1K4SA 3L2UA 3U1DA 1MW7A 3BJAA 3WG7H 4RB1A 2R7RA 1PUEE 3CP2A 1Z3YA 3EUAA 3OYNA 1SMYF 4KA4A 2IVMA 4RMNA 3SZPA 4CHUA 3OYGA 2DOEA 3GTPJ 1YG2A 2QUFA 2YX7A 2LDUA 4F7ZA 2WY8Q 1A36A 1K6OA 1IRGA 1S5LC 3E6MA 1N25A 2HDDA 2P7CB 4BXFA 2ZMEA 3LA7A 3W6JB 2OZ6A 1T0FA 3DKWA 3K4MA 1FP2A 3F8NA 2JA8J 4LGWA 1TTYA 1Y1VJ 2OU2A 5B1AH 2K7LA 4I99C 3CDLA 3PL8A 3CESA 4CUGA 4OMYA 2UUZA 2B0LA 5GAEJ 1YRNB 3SEZA 2KDOA 5A2QZ 1ON1A 4P96A 3K69A 5HDGA 5FLXZ 1K83J 2P0WA 2VJIA 1RUNA 5KVRA 5K5QA 2DFHA 3F8MA 5M3FJ 1YJWI 3A03A 3QYBA 3VODA 2DA4A 1S8NA 1D5YA 2V1XA 3ROUA 2W00A 2WADA 2UV1A 1ZRCA 2M3AA 4UUVA 3AG1H 3CJRB 3LFUA 3A2KA 3MKZA 1FBQA 3C18A 1WCMJ 2EIKH 2RQPA 5E1WA 4IHXA 3N97A 2MLKA 1S72I 1VQ9I 2HZDA 3OYFA 3FMRA 2LKXA 4Y52J 1FZPB 3FK7A 1BBYA 5LEJA 1FOWA 3Q9VA 2XSDC 2IAIA 3V42A 1U8BA 3IAS2 4XQFA 1A04A 1IN4A 4BJ6C 1KYWA 3ML6A 3PQJA 2VLAA 1ETKA 1X1CA 3RZDJ 4PFOA 1U9NA 4XLPF 3MKYB 2EA4A 2FD5A 1YS7A 3KP4A 3RYPA 2H94A 1ZKGA 2ESNA 4GRIA 3E3VA 2EZLA 5CKTA 3A0BC 5K5OA 3BG3A 1TLHB 4LOCA 2GM4A 1PVEA 3WE3A 4BEHA 2FJ1A 1WI9A 5HOOA 2YU3A 3I4NJ 4MO7A 4I01A 3R4KA 2DDBA 1FC3A 5J8CA 3CC4I 1H89C 3TO9A 5H2FC 2K9LA 4V2GA 5FO5A 3BR6A 4EM1A 3GFIA 2HQAA 1YQAA 3DBRB 2CUZA 4C3IJ 4X6AJ 1A35A 3K7AJ 3LSIA 4NQWA 1IRFA 3GCMA 4OAYA 4EGYA 2QSHX 4ESJA 4LK1F 3IRQA 5FFZA 2PN6A 4EEFG 1LJ9A 2CS3A 3RPUD 3DEEA 1KU9A 4CCLA 3EUHA 1I39A 5CPRB 2QA4I 2EIJH 1B72A 4YFKF 1J09A 3TBIA 3CTAA 1WH7A 4U88A 1MKMA 5CVRA 4OAZA 4KT5C 2M87A 5FGMA 4AYBN 2DOAA 3IV5A 2HYFA 3S8PA 1B8IA 1K6YA 2F4IA 2ZJ2A 3F8FA 3L2QA 4M9ZA 2EQRA 1IAWA 1IZ1A 2FA5A 4HQMA 4U7DA 4BJ5C 1G3TA 5J3LA 1VZ0A 3CD6I 2V1NA 4N0BA 1SEUA 3V8JA 3BT9A 3VSLA 1KQ8A 4L18B 2M4KA 2WY7Q 4A0ZA 5LRRA 4Y13A 4QTRA 2R7XA 3HL2A 1K7AA 1IRXA 2R7SA 5J6XA 1K78B 3S15J 4NHJA 2DT6A 5BQTA 4PK4A 4PUSA 3ZCOA 2E1CA 1BM9A 4ENKA 3GBGA 4L5JA 3WTSC 2ZXHA 3TDUC 1JXSA 2P5LC 2ZJQF 2OC6A 2Z5UA 4W1UA 2RNGA 2PMZA 4B1RA 2V6EA 3E6BA 3GTKJ 3C2HA 2YPRA 4NBQA 4ZYEA 1S9HA 2JRTA 4CCMA 4A3IJ 5FFXA 3QP5A 3H35A 3LOCA 2ZKZA 3JRAA 2NS0A 2O61A 3LAPA 2X9DA 3E7LA 4MFDA 3HKZN 4B09A 2AHQA 1TP4A 4HYEA 5LHGA 5ILUA 1KU7A 3GTJJ 2P6TA 4C3HJ 3E6DA 1KU3A 1MBEA 3F72A 3KEOA 2HKXA 3CJNA 1TWAJ 4GO1A 4XLNF 3ZOBA 1HLVA 4HV5A 5IYBJ 3X2QH 1Z9CA 1Q1HA 1P92A 3HOYJ 2XIGA 4KN7X 1OPCA 3I9V2 5HS8A 2O7OA 1TL8A 1O4XA 1MBHA 1G6NA 4L9TA 3JTGA 4IQJA 5JHUA 1MH4A 5EG0A 5KAIC 2HEOA
chains in the Genus database with same CATH topology
3DQVC 1FBSA 2ZO4A 4M6YA 4Y15A 4EGZA 3K1PA 4O3MA 3ZMTA 1BI3A 2DBBA 1W5TA 2Y75A 2CYYA 3BP8A 3BJOA 2E7XA 3FXRA 1L3LA 3WODF 2D1VA 2RGVA 4S05A 2MD5A 4HBLA 3QPTA 2F5CA 2Z9OA 1BC7C 2GAUA 3TOAA 1O57A 3JW4A 1OMIA 1R00A 4HDUA 2XAGA 3B73A 5L3DA 4WCGA 1KGSA 4CDGA 4A6DA 3HUGA 2M1BA 3D5LA 3QU3A 3ERED 2FQ3A 1YW9A 3F6OA 3QU6A 1Z1DA 2ELHA 4Q47A 2XROA 1XSXA 5FD5A 2OD5A 3ZN1A 5FD6A 3N4MA 3EYYA 4HX8A 3GFMA 2A5YB 1H0MA 4O5VA 2NNNA 4OIQF 4LB5A 2DPUA 1T98A 2IT0A 4FT8A 1R1TA 1J59A 4LG0B 4XRFA 2L4AA 3D0SA 1BIBA 1IN5A 3E97A 1W4MA 2PJPA 1V4RA 2C6YA 2LKPA 2NNYA 1J5YA 1RUOA 2XUBA 1J2XA 3L00A 5EEHA 3I71A 3GF2A 3NQOA 2V9VA 2IA2A 5ICGA 2V1UA 2WV0A 1HKQA 4HZFA 3BPXA 3QRFF 2IJLA 1LEAA 3U2RA 1OYYA 1Z6RA 2IA0A 2VE8A 3DFGA 4P55A 3IKTA 5CVUA 4Z2YA 2FMYA 2QQ9A 3WGIA 1O3TA 2M5WA 4ZYDA 3M9AA 2HFHA 4GGGA 2D2WA 1PDNC 5ILSA 3JAMK 5DCMA 3T8RA 3F6VA 4B8XA 3C7JA 4I0BA 3DPLC 4FHTA 2FE3A 3LQRA 3LSTA 2ZFWA 1E17A 1YIOA 4UVCA 2DQLA 5CVJA 3CUQA 2H27A 2XV4S 1IN8A 4Q5SF 2HS5A 4CGZA 2CG4A 4LK0F 3ECHA 5DUIA 4HV6A 3MAJA 1SD5A 3WTYC 4JK1X 2DI3A 2UXXA 2W57A 4ESBA 3K9TA 3DP7A 1RZ4A 1R1UA 1TNSA 1HBXG 4IF4A 1WSUA 1RI7A 2NYXA 3J80Z 3NRVA 4CO8A 5DV5A 2V79A 1ZG5A 3HRUA 3FZVA 3R60A 1Y0UA 2GA1A 3KZYA 4UXNA 3NEUA 1MGTA 4WX9A 4H0EA 2FBIA 2VT2A 2IRFG 3ISPA 2ACJA 2ZXJA 4ON0A 5H6RA 4U0YA 4HX7A 5LBQA 3TGNA 1ZGJA 1BJAA 1MDMB 1ON2A 1IXRC 2IA1A 2Y0MA 1QZZA 1R22A 1U5TC 4KMUX 4G8XA 4IPAA 5LLQA 2UXNA 3IRRA 2OQRA 2KRFA 3BDDA 1XSVA 2ZNZA 3V7SA 1F1ZA 2J5PA 4ZZDA 1H9TA 4OIOF 2FXAA 3IC7A 3FXUA 1G3WA 1I1GA 2KIUA 4UV8A 3CLOA 3KP3A 3GZ6A 1B4AA 2CWEA 2HZTA 3K1NA 3T0YA 2EJRA 3B02A 2QYOA 5LGUA 3KEQA 1TQPA 2GZWA 1TBXA 4OMZA 1B1BA 1FBUA 4UVAA 2PEXA 3I0TA 3MCZA 1FLIA 3S2WA 5A2QK 2KKOA 2IP2A 5FLXK 4G9YA 2EFNA 1I6XA 2MA3A 3E5XA 2KJBA 4XBFA 5E1ZB 4KDPA 4M74A 2CSOA 1BN5A 3GYHX 4A12A 4L0YB 3BY6A 3KP6A 1XMAA 1O7FA 2RC4A 4KICA 1R23A 5IT9K 1K79A 4UVBA 2PG4A 2RV8A 2YSRA 3WGHA 5ED4A 2Q0OA 3KZZA 5D4RA 1NHAA 2FOKA 2P6SA 3HRMA 1K78A 2VOPA 5DYMA 2ZNYA 1XGOA 2GXBA 3GZ5A 4LLNA 1O7LA 1OYWA 3SQNA 3LA2A 4RGRA 4HLYA 4YFNF 3KP7A 4A0YA 2OZUA 2XHKA 1T39A 1XN7A 1DP7P 3KLNA 3IWFA 1S29A 2GWRA 2XRNA 1FOKA 3MWMA 3LA3A 1F9NA 1PP8F 3GVAA 3RKXA 4G7ZF 4WF2A 3KETA 3P7NA 4HF1A 1XMKA 1HSJA 3CO6C 2D45A 1J9IA 1TNTA 2VT3A 3TKYA 3JSOA 1HSTA 4FX0A 2VXZA 4S04A 1GVJA 1ZN2A 5L3CA 5HLIA 4RS8A 4EJVA 5IT9Z 4PGHA 5L3EA 1LVAA 3M8FA 2W24A 3J7AO 5DDGA 1ZG1A 2BYVE 3KP5A 3RJPA 4EM2A 2LNBA 2DK5A 4BHCA 2OQGA 2QENA 4ZYHA 1EV7A 4KYWA 3SXYA 2M30A 2E1NA 3RPUA 2O8XA 4BH9A 3WU0A 4L9VA 2CGPA 4UV9A 4KNYA 2HTSA 4HOBA 2VBZA 3HTUA 2G9WA 1S6LA 1FYKA 4M9SA 1SAXA 4EJWA 2EV5A 4LG0A 1S3JA 1FSHA 4A5MA 1XCBA 5H20A 5LHIA 2O6GE 4EJTA 2ISYA 1CF7B 4L0ZB 1TW2A 2VC0A 2PMHA 4N9HA 4OIPF 2QWWA 3F21A 4KIFA 3ZQ7A 5IT3A 5ICEA 2D1HA 3ZMUA 3CUOA 3C1DA 5HS7A 4MEXF 5ILVA 4I0AA 4Q48A 3ZPLA 4MQ9F 1ZRFA 1KU2A 3HSFA 2XASA 1XDSA 4A6EA 4YFXF 1TW3A 4G7OF 3HYIA 2QBYB 4WXHA 4OOIA 1XDUA 1FNNA 2XAJA 4BYYA 3HTSB 4HF2A 2DLLA 1VTNC 5D8LB 2J5OA 5HLGA 4ZH4F 1ZAOA 2W84A 3JTHA 4KFCA 3WTTC 3FMSA 1IN7A 3QAHA 3TO7A 3K2ZA 4KN4X 2IW5A 3REOA 3I53A 4M71A 2UZKA 1XCVA 5AONA 3L7WA 2F2EA 1W7PA 3M8EA 1SFUA 3O2PE 4XSZF 4ASNA 1JE8A 2FNPA 2YR2A 2QLZA 1HKTA 4R79A 5ERIA 4AVPA 5E17F 4O6JA 3SFZA 5KK1A 2EWNA 2L02A 2UWMA 1DDNA 2P4WA 3FF5A 5D8KB 1LDKB 2PMUA 2WC2A 2A6EF 4IRGA 3FXQA 3MZYA 3IL2A 3ZMVA 3H3UA 3R0JA 2MH9A 4RB3C 2ISZA 3H3ZA 1QBJA 3E5QA 1MDMA 4EM0B 1YW7A 2F5EA 4KIGA 3FHZA 2YX4A 2P5VA 4RGSA 3RIRA 5F64A 1P2FA 5K5RA 4GYGA 5LRSA 5D6EA 4U0VA 2Y48A 3VEPA 3M7GA 3HHHA 2X0LA 3J80K 4ENMA 2K27A 1SD4A 4HLXA 1FSEA 2DT5A 4YG2F 2BEOA 4IHSA 1QQIA 4AIKA 2PBIA 1SFEA 2BV6A 2XVCA 2A68F 3FX3A 2XAFA 1EH7A 4U7BA 4EJOA 2RDPA 4R8HA 3T5XA 3MZHA 2P8TA 4LLLA 2O3FA 2VBWA 1F4KA 5LHHA 1R1VA 2R7DA 5HLHA 3ABUA 3HRTA 3RTRA 2QM3A 4L9NA 3BROA 2EFOA 4MEYF 1G3YA 4RAYA 1RIOH 1JGSA 5CJ9A 1UFMA 1XGSA 4EJUA 3E6CC 4LFUA 4Q4ZF 4AWXB 4D0PA 1Z6TA 2VBYA 1R5HA 1HW2A 1Z7UA 5AIQA 2AXLA 4UNOA 2G7HA 5DD4A 4DQ2A 1IXSB 2FBHA 2EFPA 4RB2C 1IXCA 4AD9A 1QZYA 5K1YA 1ZLKA 3W6KB 2HR3A 1KQ0A 4DNCA 2CO5A 1B9MA 3L2CA 1BC8C 2L3DA 3Q9SA 2XAHA 3WE2A 5D4SA 4JQFA 3GUDA 1DPRA 3O6BB 4RGXA 3G3ZA 4P9UA 1QO0D 3WTXC 3F23A 3CO7C 1YLFA 2VBXA 2IPQX 2VODA 5CLSA 5D5UB 4PGGA 1U3EM 2ZBKA 2DO7A 1MJ9A 3EDPA 3HSEA 5CVVA 2RN7A 3CDHA 3DF8A 4FX4A 4CICA 1SD7A 3MFKA 5HVQC 1J7KA 1ZLJA 3RPQA 4OU0A 3K0LA 1FY7A 4RAZA 1B9NA 4ENNA 1V3FA 4JBAA 1BI2A 1SD6A 2ESHA 3ULQB 2JSCA 2HQNA 4LMYA 3RDIA 2QZ8A 1DUXC 1BOAA 2KIFA 3K1MA 1S7OA 1ZGAA 2E7WA 5HDNA 4G6QA 2OA4A 2QVOA 1G3SA 2DAOA 4BHBA 2X4HA 3BPVA 3FWEA 4MHGA 1DPUA 3VOEA 5HS9A 4BXUA 4GCVA 4P5OA 1UCRA 3WTUC 4P9FA 2JZYA 2A69F 3KE2A 4A5NA 3LFKA 3PQKA 4MGRA 2EFWA 3FMQA 1I5ZA 1IF1A 1LDJA 2LF7A 4N9IA 4ZZLA 5E20A 1U8RA 1AOYA 1HKSA 1PP7U 2QBYA 4NB5A 3P9IA 3WTZA 4CYDA 1WWXA 2ETHA 1D8KA 2A61A 1G4DA 4EVIA 3I54A 1QPMA 3F22A 1FT9A 3AAFA 1XGNA 1C0WA 4BAYA 4WXDA 3Q5FA 2WTEA 2RVCA 1R36A 1O3RA 3HSRA 3R61A 3FM5A 1MZBA 4BNCA 2H6CA 3QPHA 2H6BA 1LB2A 1WQ2A 3BWGA 3IHUA 4GYIA 3DPTA 1U5TB 2CQKA 2FRHA 2O03A 5TRDA 4PZJA 4M72A 3R0AA 2HOEA 3TO6A 4IRHA 4I09A 1KQ9A 4LJZF 4HF0A 1YYVA 1ZYRF 5TJJA 3GLXA 5BPDA 3TDZC 3QP6A 1HW5A 3RI4A 1P4AA 2HDCA 2TDXA 1STZA 3E5UA 1H9GA 3MQ0A 1IW7F 1B6AA 1QNTA 2COMA 2JPBA 2DW4A 3MEXA 4M9XA 1EH8A 4HDVA 3I59B 3C3WA 4BHPA 4KUMA 4G7HF 1ULYA 1ODDA 3RKYA 1OYIA 1FPQA 1T38A 3LWFA 3T1BA 4AIJA 2R3SA 4YIIA 1UHWA 5DEQA 2QQAA 1R58A 2EB7A 1FYLA 1XSDA 1SMTA 1B59A 2GIVA 3RKWA 2RNJA 4CZZA 1IN6A 1LEBA 3IKVA 4L5IA 3DXJF 5DD8A 5AIPA 1HXDA 3JSPA 2STWA 4R1HA 2V6CA 4MQVA 2JTVA 1Z05A 4EQQA 1ONVA 4Y17A 4UHTA 2DU9A 2FEZA 3F8CA 3L09A 4PCQA 1XGMA 2FNAA 4CXFA 1U78A 4IXAA 4MNUA 1FWZA 1LDDA 2L54A 1EH6A 5E1XA 1O3QA 4MTEA 4HAMA 3WTWC 5ICCA 2FU4A 2HYGD 2GXGA 3P9CA 3GX4X 2STTA 2AS5F 4LLGF 3OOPA 2G7UA 2DTRA 2W85A 2F5FA 3T8TA 1WRJA 3WG9A 2EK5A 2Z3YA 1BI0A 3EETA 2VOOA 2H09A 5E18F 2RKHA 2HKOA 3U9GA 1KYZA 2MC3A 1FX7A 3COAC 1FP1D 2ZMEB 1GXQA 4HQEA 4G6DA 2JT1A 1T6SA 4IRIA 2EA2A 5F1RA 3V4GA 3ZMSA 3KCCA 2PQ8A 5L3GA 1F5TA 4IVNA 5F6FA 1LNWA 2KIMA 1YFHA 1P6RA 2K4JA 1XB4A 3GW2A 2W25A 1JHFA 1UHMA 2KJCA 2HQRA 1MJAA 5BPIA 4IHTA 3SZTA 1WKMA 2M8EA 2XKOA 1REPC 2WWYA 4XSXF 3I4PA 1D8JA 2DK8A 1S7AA 1W7PD 2HTJA 4BQAA 1CGPA 3I5UA 1XD7A 2VC1A 5CVIA 1R5GA 4M6XA 5L3BA 3BZ6A 3VB2A 1MJBA 3GFJA 1ZH5A 4K2EA 3WTVC 5BOXA 4GXOA 1ZRDA 3RYRA 4LB6B 1ZREA 2FMLA 4EMSA 2LF8A 1HW1A 5JVTA 3FM3A 5H6QA 2PFBA 4AIHA 5DCFA 5LGTA 1MD0A 4TV7A 1I27A 1ZARA 4LD5A 3I58A 5LEKA 4WWCA 1TQMA 1QGPA 3R6SA 5D6FA 3KLOA 1U2WA 6PAXA 4MTDA 4I2OA 3ZN0A 4YIFA 1ZHFA 3V7RA 4KMFA 4I98B 3ELKA 4KIBA 5BS6A 1GXPA 1KA8A 2NRAC 1T2KA 2VE9A 3QOPA 3ZMZA 3SHFA 2LSOA 3HOTA 2Z99A 3G73A 1U6GA 2BBYA 5E8IA 2EV0A 3VFZA 5DUKA 5LGNA 4HA8A 3HIFA 2NAZA 3I64A 2HGCA 3ZP5A 2P7VB 1X3UA 2BGCA 3KP2A 1D5VA 4OINF 5EEGA 2MLGA 5E8GA 2EV6A 4IJAA 2Q8KA 3GWZA 3HHGA 4E70A 2XAQA 1FYMA 1USTA 3L9FA 5JR3A 3HRSA 2CFXA 1R7JA 4G94A 4M73A 3ZMDA 3ABTA 2GQQA 3TOBA 4EV0A 4ZYGA 1LQ1A 1BIAA 3O3KA 2O0YA 4I7HA 4QLCU 2QQBA 1P4XA 3CUQC 4OIRF 4L9JA 1D3YA 3F8BA 1YS6A 2ADUA 4ESFA 4I02A 5ICFA 1W7PB 1J75A 1YO5C 3V8KA 3GO5A 5FB2A 3J81K 2PLYA 2M45A 1GHCA 4RGUA 2FBKA 1I1SA 4ENJA 5BMZA 4A2UA 2R7FA 3GEZA 3TQNA 3GFLA 2HWVA 3LAJA 2K4BA 1RNLA 1AWCA 3P9KA 2XGXA 1JHHA 3LQQA 1YTYA 1U5TA 5D5VB 2Q2EA 4U0WA 2Z33A 1W5SA 2P5KA 3F3XA 5J8FA 4PDKA 3JAMZ 3H92A 2A07F 2MBFA 1E2XA 2DFIA 2DQRA 2VN2A 2V1DA 4WXCA 3V8LA 2OAZA 1OR7A 3HOSA 2BE5F 1P4WA 2MH2A 2FSWA 3I59A 3GXOA 2K02A 4WK8F 3PFIA 4HW0A 1YW8A 4ETSA 2F5DA 2L4MA 1IUYA 1BI1A 4QWQA 2DPDA 5JI6A 3J81Z 2A6HF 2ZCWA 1ZG3A 3DV8A 5JFRA 2L01A 3M1EA 1J0RA 2CW0F 1Z91A 2EFQA 1CF7A 2PI0A 1OKRA 4A0XA 1L0OC 5D5WB 1USSA 2JPCA 1TQIA 3OV8A 4HX4A 3BOQA 5CYVA 3EQLF 1O3SA 5HDKA 2A3SA 2GA2A 2OBPA 2K86A 4RB0A 3KFWX 5DCMB 1UB9A 3IWZA 1SFXA 5L3FA 2VONA 3EYIA 3CUQB 2FF4A 3V7CA 3ECOA 2XKPA 5D5XB 1HQCA 3DEUA 3BJ6A 3WGGA 3WU1B 3U1DA 3BJAA 4RB1A 1PUEE 4KA4A 1SMYF 2IVMA 3SZPA 4CHUA 1YG2A 2QUFA 2YX7A 2LDUA 4F7ZA 1K6OA 1IRGA 3E6MA 2P7CB 2ZMEA 3LA7A 3W6JB 2OZ6A 1T0FA 3DKWA 1FP2A 3F8NA 4LGWA 1TTYA 2OU2A 2K7LA 4OMYA 2B0LA 5A2QZ 1ON1A 4P96A 3K69A 5HDGA 5FLXZ 1RUNA 5KVRA 5K5QA 3F8MA 3VODA 1S8NA 2V1XA 3ROUA 1ZRCA 4UUVA 1FBQA 3C18A 2RQPA 5E1WA 3N97A 2MLKA 3FMRA 1FZPB 1BBYA 5LEJA 3Q9VA 1IN4A 1A04A 1KYWA 3ML6A 3PQJA 4XLPF 2EA4A 1YS7A 3KP4A 3RYPA 2H94A 2ESNA 3E3VA 5K5OA 1TLHB 3WE3A 1WI9A 5HOOA 2YU3A 4I01A 3R4KA 5J8CA 1FC3A 3TO9A 5FO5A 4EM1A 3GFIA 1YQAA 4NQWA 1IRFA 4EGYA 4ESJA 4LK1F 3IRQA 5FFZA 2PN6A 1LJ9A 1KU9A 3EUHA 4YFKF 3CTAA 4U88A 1MKMA 5CVRA 4KT5C 2M87A 5FGMA 2HYFA 2ZJ2A 3F8FA 4M9ZA 1IAWA 1IZ1A 2FA5A 4HQMA 4U7DA 1G3TA 4N0BA 3V8JA 1KQ8A 4L18B 4A0ZA 5LRRA 4Y13A 1K7AA 5J6XA 1K78B 4NHJA 5BQTA 2E1CA 1BM9A 4ENKA 4L5JA 3WTSC 1JXSA 3TDUC 2P5LC 2Z5UA 3E6BA 2YPRA 4ZYEA 2JRTA 5FFXA 3QP5A 2ZKZA 2NS0A 2O61A 3LAPA 4B09A 4HYEA 5LHGA 5ILUA 1KU7A 2P6TA 3E6DA 1KU3A 3F72A 3KEOA 2HKXA 3CJNA 4GO1A 4XLNF 4HV5A 1Z9CA 1Q1HA 1P92A 2XIGA 4KN7X 1OPCA 5HS8A 4L9TA 1G6NA 3JTGA 5JHUA 2HEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DQV C;  1FBS A;  2ZO4 A;  4M6Y A;  4Y15 A;  4EGZ A;  3K1P A;  4O3M A;  3ZMT A;  1BI3 A;  2DBB A;  1W5T A;  2Y75 A;  2CYY A;  3BP8 A;  3BJO A;  2E7X A;  3FXR A;  1L3L A;  3WOD F;  2D1V A;  2RGV A;  4S05 A;  2MD5 A;  4HBL A;  3QPT A;  2F5C A;  2Z9O A;  1BC7 C;  2GAU A;  3TOA A;  1O57 A;  3JW4 A;  1OMI A;  1R00 A;  4HDU A;  2XAG A;  3B73 A;  5L3D A;  4WCG A;  1KGS A;  4CDG A;  4A6D A;  3HUG A;  2M1B A;  3D5L A;  3QU3 A;  3ERE D;  2FQ3 A;  1YW9 A;  3F6O A;  3QU6 A;  1Z1D A;  2ELH A;  4Q47 A;  2XRO A;  1XSX A;  5FD5 A;  2OD5 A;  3ZN1 A;  5FD6 A;  3N4M A;  3EYY A;  4HX8 A;  3GFM A;  2A5Y B;  1H0M A;  4O5V A;  2NNN A;  4OIQ F;  4LB5 A;  2DPU A;  1T98 A;  2IT0 A;  4FT8 A;  1R1T A;  1J59 A;  4LG0 B;  4XRF A;  2L4A A;  3D0S A;  1BIB A;  1IN5 A;  3E97 A;  1W4M A;  2PJP A;  1V4R A;  2C6Y A;  2LKP A;  2NNY A;  1J5Y A;  1RUO A;  2XUB A;  1J2X A;  3L00 A;  5EEH A;  3I71 A;  3GF2 A;  3NQO A;  2V9V A;  2IA2 A;  5ICG A;  2V1U A;  2WV0 A;  1HKQ A;  4HZF A;  3BPX A;  3QRF F;  2IJL A;  1LEA A;  3U2R A;  1OYY A;  1Z6R A;  2IA0 A;  2VE8 A;  3DFG A;  4P55 A;  3IKT A;  5CVU A;  4Z2Y A;  2FMY A;  2QQ9 A;  3WGI A;  1O3T A;  2M5W A;  4ZYD A;  3M9A A;  2HFH A;  4GGG A;  2D2W A;  1PDN C;  5ILS A;  3JAM K;  5DCM A;  3T8R A;  3F6V A;  4B8X A;  3C7J A;  4I0B A;  3DPL C;  4FHT A;  2FE3 A;  3LQR A;  3LST A;  2ZFW A;  1E17 A;  1YIO A;  4UVC A;  2DQL A;  5CVJ A;  3CUQ A;  2H27 A;  2XV4 S;  1IN8 A;  4Q5S F;  2HS5 A;  4CGZ A;  2CG4 A;  4LK0 F;  3ECH A;  5DUI A;  4HV6 A;  3MAJ A;  1SD5 A;  3WTY C;  4JK1 X;  2DI3 A;  2UXX A;  2W57 A;  4ESB A;  3K9T A;  3DP7 A;  1RZ4 A;  1R1U A;  1TNS A;  1HBX G;  4IF4 A;  1WSU A;  1RI7 A;  2NYX A;  3J80 Z;  3NRV A;  4CO8 A;  5DV5 A;  2V79 A;  1ZG5 A;  3HRU A;  3FZV A;  3R60 A;  1Y0U A;  2GA1 A;  3KZY A;  4UXN A;  3NEU A;  1MGT A;  4WX9 A;  4H0E A;  2FBI A;  2VT2 A;  2IRF G;  3ISP A;  2ACJ A;  2ZXJ A;  4ON0 A;  5H6R A;  4U0Y A;  4HX7 A;  5LBQ A;  3TGN A;  1ZGJ A;  1BJA A;  1MDM B;  1ON2 A;  1IXR C;  2IA1 A;  2Y0M A;  1QZZ A;  1R22 A;  1U5T C;  4KMU X;  4G8X A;  4IPA A;  5LLQ A;  2UXN A;  3IRR A;  2OQR A;  2KRF A;  3BDD A;  1XSV A;  2ZNZ A;  3V7S A;  1F1Z A;  2J5P A;  4ZZD A;  1H9T A;  4OIO F;  2FXA A;  3IC7 A;  3FXU A;  1G3W A;  1I1G A;  2KIU A;  4UV8 A;  3CLO A;  3KP3 A;  3GZ6 A;  1B4A A;  2CWE A;  2HZT A;  3K1N A;  3T0Y A;  2EJR A;  3B02 A;  2QYO A;  5LGU A;  3KEQ A;  1TQP A;  2GZW A;  1TBX A;  4OMZ A;  1B1B A;  1FBU A;  4UVA A;  2PEX A;  3I0T A;  3MCZ A;  1FLI A;  3S2W A;  5A2Q K;  2KKO A;  2IP2 A;  5FLX K;  4G9Y A;  2EFN A;  1I6X A;  2MA3 A;  3E5X A;  2KJB A;  4XBF A;  5E1Z B;  4KDP A;  4M74 A;  2CSO A;  1BN5 A;  3GYH X;  4A12 A;  4L0Y B;  3BY6 A;  3KP6 A;  1XMA A;  1O7F A;  2RC4 A;  4KIC A;  1R23 A;  5IT9 K;  1K79 A;  4UVB A;  2PG4 A;  2RV8 A;  2YSR A;  3WGH A;  5ED4 A;  2Q0O A;  3KZZ A;  5D4R A;  1NHA A;  2FOK A;  2P6S A;  3HRM A;  1K78 A;  2VOP A;  5DYM A;  2ZNY A;  1XGO A;  2GXB A;  3GZ5 A;  4LLN A;  1O7L A;  1OYW A;  3SQN A;  3LA2 A;  4RGR A;  4HLY A;  4YFN F;  3KP7 A;  4A0Y A;  2OZU A;  2XHK A;  1T39 A;  1XN7 A;  1DP7 P;  3KLN A;  3IWF A;  1S29 A;  2GWR A;  2XRN A;  1FOK A;  3MWM A;  3LA3 A;  1F9N A;  1PP8 F;  3GVA A;  3RKX A;  4G7Z F;  4WF2 A;  3KET A;  3P7N A;  4HF1 A;  1XMK A;  1HSJ A;  3CO6 C;  2D45 A;  1J9I A;  1TNT A;  2VT3 A;  3TKY A;  3JSO A;  1HST A;  4FX0 A;  2VXZ A;  4S04 A;  1GVJ A;  1ZN2 A;  5L3C A;  5HLI A;  4RS8 A;  4EJV A;  5IT9 Z;  4PGH A;  5L3E A;  1LVA A;  3M8F A;  2W24 A;  3J7A O;  5DDG A;  1ZG1 A;  2BYV E;  3KP5 A;  3RJP A;  4EM2 A;  2LNB A;  2DK5 A;  4BHC A;  2OQG A;  2QEN A;  4ZYH A;  1EV7 A;  4KYW A;  3SXY A;  2M30 A;  2E1N A;  3RPU A;  2O8X A;  4BH9 A;  3WU0 A;  4L9V A;  2CGP A;  4UV9 A;  4KNY A;  2HTS A;  4HOB A;  2VBZ A;  3HTU A;  2G9W A;  1S6L A;  1FYK A;  4M9S A;  1SAX A;  4EJW A;  2EV5 A;  4LG0 A;  1S3J A;  1FSH A;  4A5M A;  1XCB A;  5H20 A;  5LHI A;  2O6G E;  4EJT A;  2ISY A;  1CF7 B;  4L0Z B;  1TW2 A;  2VC0 A;  2PMH A;  4N9H A;  4OIP F;  2QWW A;  3F21 A;  4KIF A;  3ZQ7 A;  5IT3 A;  5ICE A;  2D1H A;  3ZMU A;  3CUO A;  3C1D A;  5HS7 A;  4MEX F;  5ILV A;  4I0A A;  4Q48 A;  3ZPL A;  4MQ9 F;  1ZRF A;  1KU2 A;  3HSF A;  2XAS A;  1XDS A;  4A6E A;  4YFX F;  1TW3 A;  4G7O F;  3HYI A;  2QBY B;  4WXH A;  4OOI A;  1XDU A;  1FNN A;  2XAJ A;  4BYY A;  3HTS B;  4HF2 A;  2DLL A;  1VTN C;  5D8L B;  2J5O A;  5HLG A;  4ZH4 F;  1ZAO A;  2W84 A;  3JTH A;  4KFC A;  3WTT C;  3FMS A;  1IN7 A;  3QAH A;  3TO7 A;  3K2Z A;  4KN4 X;  2IW5 A;  3REO A;  3I53 A;  4M71 A;  2UZK A;  1XCV A;  5AON A;  3L7W A;  2F2E A;  1W7P A;  3M8E A;  1SFU A;  3O2P E;  4XSZ F;  4ASN A;  1JE8 A;  2FNP A;  2YR2 A;  2QLZ A;  1HKT A;  4R79 A;  5ERI A;  4AVP A;  5E17 F;  4O6J A;  3SFZ A;  5KK1 A;  2EWN A;  2L02 A;  2UWM A;  1DDN A;  2P4W A;  3FF5 A;  5D8K B;  1LDK B;  2PMU A;  2WC2 A;  2A6E F;  4IRG A;  3FXQ A;  3MZY A;  3IL2 A;  3ZMV A;  3H3U A;  3R0J A;  2MH9 A;  4RB3 C;  2ISZ A;  3H3Z A;  1QBJ A;  3E5Q A;  1MDM A;  4EM0 B;  1YW7 A;  2F5E A;  4KIG A;  3FHZ A;  2YX4 A;  2P5V A;  4RGS A;  3RIR A;  5F64 A;  1P2F A;  5K5R A;  4GYG A;  5LRS A;  5D6E A;  4U0V A;  2Y48 A;  3VEP A;  3M7G A;  3HHH A;  2X0L A;  3J80 K;  4ENM A;  2K27 A;  1SD4 A;  4HLX A;  1FSE A;  2DT5 A;  4YG2 F;  2BEO A;  4IHS A;  1QQI A;  4AIK A;  2PBI A;  1SFE A;  2BV6 A;  2XVC A;  2A68 F;  3FX3 A;  2XAF A;  1EH7 A;  4U7B A;  4EJO A;  2RDP A;  4R8H A;  3T5X A;  3MZH A;  2P8T A;  4LLL A;  2O3F A;  2VBW A;  1F4K A;  5LHH A;  1R1V A;  2R7D A;  5HLH A;  3ABU A;  3HRT A;  3RTR A;  2QM3 A;  4L9N A;  3BRO A;  2EFO A;  4MEY F;  1G3Y A;  4RAY A;  1RIO H;  1JGS A;  5CJ9 A;  1UFM A;  1XGS A;  4EJU A;  3E6C C;  4LFU A;  4Q4Z F;  4AWX B;  4D0P A;  1Z6T A;  2VBY A;  1R5H A;  1HW2 A;  1Z7U A;  5AIQ A;  2AXL A;  4UNO A;  2G7H A;  5DD4 A;  4DQ2 A;  1IXS B;  2FBH A;  2EFP A;  4RB2 C;  1IXC A;  4AD9 A;  1QZY A;  5K1Y A;  1ZLK A;  3W6K B;  2HR3 A;  1KQ0 A;  4DNC A;  2CO5 A;  1B9M A;  3L2C A;  1BC8 C;  2L3D A;  3Q9S A;  2XAH A;  3WE2 A;  5D4S A;  4JQF A;  3GUD A;  1DPR A;  3O6B B;  4RGX A;  3G3Z A;  4P9U A;  1QO0 D;  3WTX C;  3F23 A;  3CO7 C;  1YLF A;  2VBX A;  2IPQ X;  2VOD A;  5CLS A;  5D5U B;  4PGG A;  1U3E M;  2ZBK A;  2DO7 A;  1MJ9 A;  3EDP A;  3HSE A;  5CVV A;  2RN7 A;  3CDH A;  3DF8 A;  4FX4 A;  4CIC A;  1SD7 A;  3MFK A;  5HVQ C;  1J7K A;  1ZLJ A;  3RPQ A;  4OU0 A;  3K0L A;  1FY7 A;  4RAZ A;  1B9N A;  4ENN A;  1V3F A;  4JBA A;  1BI2 A;  1SD6 A;  2ESH A;  3ULQ B;  2JSC A;  2HQN A;  4LMY A;  3RDI A;  2QZ8 A;  1DUX C;  1BOA A;  2KIF A;  3K1M A;  1S7O A;  1ZGA A;  2E7W A;  5HDN A;  4G6Q A;  2OA4 A;  2QVO A;  1G3S A;  2DAO A;  4BHB A;  2X4H A;  3BPV A;  3FWE A;  4MHG A;  1DPU A;  3VOE A;  5HS9 A;  4BXU A;  4GCV A;  4P5O A;  1UCR A;  3WTU C;  4P9F A;  2JZY A;  2A69 F;  3KE2 A;  4A5N A;  3LFK A;  3PQK A;  4MGR A;  2EFW A;  3FMQ A;  1I5Z A;  1IF1 A;  1LDJ A;  2LF7 A;  4N9I A;  4ZZL A;  5E20 A;  1U8R A;  1AOY A;  1HKS A;  1PP7 U;  2QBY A;  4NB5 A;  3P9I A;  3WTZ A;  4CYD A;  1WWX A;  2ETH A;  1D8K A;  2A61 A;  1G4D A;  4EVI A;  3I54 A;  1QPM A;  3F22 A;  1FT9 A;  3AAF A;  1XGN A;  1C0W A;  4BAY A;  4WXD A;  3Q5F A;  2WTE A;  2RVC A;  1R36 A;  1O3R A;  3HSR A;  3R61 A;  3FM5 A;  1MZB A;  4BNC A;  2H6C A;  3QPH A;  2H6B A;  1LB2 A;  1WQ2 A;  3BWG A;  3IHU A;  4GYI A;  3DPT A;  1U5T B;  2CQK A;  2FRH A;  2O03 A;  5TRD A;  4PZJ A;  4M72 A;  3R0A A;  2HOE A;  3TO6 A;  4IRH A;  4I09 A;  1KQ9 A;  4LJZ F;  4HF0 A;  1YYV A;  1ZYR F;  5TJJ A;  3GLX A;  5BPD A;  3TDZ C;  3QP6 A;  1HW5 A;  3RI4 A;  1P4A A;  2HDC A;  2TDX A;  1STZ A;  3E5U A;  1H9G A;  3MQ0 A;  1IW7 F;  1B6A A;  1QNT A;  2COM A;  2JPB A;  2DW4 A;  3MEX A;  4M9X A;  1EH8 A;  4HDV A;  3I59 B;  3C3W A;  4BHP A;  4KUM A;  4G7H F;  1ULY A;  1ODD A;  3RKY A;  1OYI A;  1FPQ A;  1T38 A;  3LWF A;  3T1B A;  4AIJ A;  2R3S A;  4YII A;  1UHW A;  5DEQ A;  2QQA A;  1R58 A;  2EB7 A;  1FYL A;  1XSD A;  1SMT A;  1B59 A;  2GIV A;  3RKW A;  2RNJ A;  4CZZ A;  1IN6 A;  1LEB A;  3IKV A;  4L5I A;  3DXJ F;  5DD8 A;  5AIP A;  1HXD A;  3JSP A;  2STW A;  4R1H A;  2V6C A;  4MQV A;  2JTV A;  1Z05 A;  4EQQ A;  1ONV A;  4Y17 A;  4UHT A;  2DU9 A;  2FEZ A;  3F8C A;  3L09 A;  4PCQ A;  1XGM A;  2FNA A;  4CXF A;  1U78 A;  4IXA A;  4MNU A;  1FWZ A;  1LDD A;  2L54 A;  1EH6 A;  5E1X A;  1O3Q A;  4MTE A;  4HAM A;  3WTW C;  5ICC A;  2FU4 A;  2HYG D;  2GXG A;  3P9C A;  3GX4 X;  2STT A;  2AS5 F;  4LLG F;  3OOP A;  2G7U A;  2DTR A;  2W85 A;  2F5F A;  3T8T A;  1WRJ A;  3WG9 A;  2EK5 A;  2Z3Y A;  1BI0 A;  3EET A;  2VOO A;  2H09 A;  5E18 F;  2RKH A;  2HKO A;  3U9G A;  1KYZ A;  2MC3 A;  1FX7 A;  3COA C;  1FP1 D;  2ZME B;  1GXQ A;  4HQE A;  4G6D A;  2JT1 A;  1T6S A;  4IRI A;  2EA2 A;  5F1R A;  3V4G A;  3ZMS A;  3KCC A;  2PQ8 A;  5L3G A;  1F5T A;  4IVN A;  5F6F A;  1LNW A;  2KIM A;  1YFH A;  1P6R A;  2K4J A;  1XB4 A;  3GW2 A;  2W25 A;  1JHF A;  1UHM A;  2KJC A;  2HQR A;  1MJA A;  5BPI A;  4IHT A;  3SZT A;  1WKM A;  2M8E A;  2XKO A;  1REP C;  2WWY A;  4XSX F;  3I4P A;  1D8J A;  2DK8 A;  1S7A A;  1W7P D;  2HTJ A;  4BQA A;  1CGP A;  3I5U A;  1XD7 A;  2VC1 A;  5CVI A;  1R5G A;  4M6X A;  5L3B A;  3BZ6 A;  3VB2 A;  1MJB A;  3GFJ A;  1ZH5 A;  4K2E A;  3WTV C;  5BOX A;  4GXO A;  1ZRD A;  3RYR A;  4LB6 B;  1ZRE A;  2FML A;  4EMS A;  2LF8 A;  1HW1 A;  5JVT A;  3FM3 A;  5H6Q A;  2PFB A;  4AIH A;  5DCF A;  5LGT A;  1MD0 A;  4TV7 A;  1I27 A;  1ZAR A;  4LD5 A;  3I58 A;  5LEK A;  4WWC A;  1TQM A;  1QGP A;  3R6S A;  5D6F A;  3KLO A;  1U2W A;  6PAX A;  4MTD A;  4I2O A;  3ZN0 A;  4YIF A;  1ZHF A;  3V7R A;  4KMF A;  4I98 B;  3ELK A;  4KIB A;  5BS6 A;  1GXP A;  1KA8 A;  2NRA C;  1T2K A;  2VE9 A;  3QOP A;  3ZMZ A;  3SHF A;  2LSO A;  3HOT A;  2Z99 A;  3G73 A;  1U6G A;  2BBY A;  5E8I A;  2EV0 A;  3VFZ A;  5DUK A;  5LGN A;  4HA8 A;  3HIF A;  2NAZ A;  3I64 A;  2HGC A;  3ZP5 A;  2P7V B;  1X3U A;  2BGC A;  3KP2 A;  1D5V A;  4OIN F;  5EEG A;  2MLG A;  5E8G A;  2EV6 A;  4IJA A;  2Q8K A;  3GWZ A;  3HHG A;  4E70 A;  2XAQ A;  1FYM A;  1UST A;  3L9F A;  5JR3 A;  3HRS A;  2CFX A;  1R7J A;  4G94 A;  4M73 A;  3ZMD A;  3ABT A;  2GQQ A;  3TOB A;  4EV0 A;  4ZYG A;  1LQ1 A;  1BIA A;  3O3K A;  2O0Y A;  4I7H A;  4QLC U;  2QQB A;  1P4X A;  3CUQ C;  4OIR F;  4L9J A;  1D3Y A;  3F8B A;  1YS6 A;  2ADU A;  4ESF A;  4I02 A;  5ICF A;  1W7P B;  1J75 A;  1YO5 C;  3V8K A;  3GO5 A;  5FB2 A;  3J81 K;  2PLY A;  2M45 A;  1GHC A;  4RGU A;  2FBK A;  1I1S A;  4ENJ A;  5BMZ A;  4A2U A;  2R7F A;  3GEZ A;  3TQN A;  3GFL A;  2HWV A;  3LAJ A;  2K4B A;  1RNL A;  1AWC A;  3P9K A;  2XGX A;  1JHH A;  3LQQ A;  1YTY A;  1U5T A;  5D5V B;  2Q2E A;  4U0W A;  2Z33 A;  1W5S A;  2P5K A;  3F3X A;  5J8F A;  4PDK A;  3JAM Z;  3H92 A;  2A07 F;  2MBF A;  1E2X A;  2DFI A;  2DQR A;  2VN2 A;  2V1D A;  4WXC A;  3V8L A;  2OAZ A;  1OR7 A;  3HOS A;  2BE5 F;  1P4W A;  2MH2 A;  2FSW A;  3I59 A;  3GXO A;  2K02 A;  4WK8 F;  3PFI A;  4HW0 A;  1YW8 A;  4ETS A;  2F5D A;  2L4M A;  1IUY A;  1BI1 A;  4QWQ A;  2DPD A;  5JI6 A;  3J81 Z;  2A6H F;  2ZCW A;  1ZG3 A;  3DV8 A;  5JFR A;  2L01 A;  3M1E A;  1J0R A;  2CW0 F;  1Z91 A;  2EFQ A;  1CF7 A;  2PI0 A;  1OKR A;  4A0X A;  1L0O C;  5D5W B;  1USS A;  2JPC A;  1TQI A;  3OV8 A;  4HX4 A;  3BOQ A;  5CYV A;  3EQL F;  1O3S A;  5HDK A;  2A3S A;  2GA2 A;  2OBP A;  2K86 A;  4RB0 A;  3KFW X;  5DCM B;  1UB9 A;  3IWZ A;  1SFX A;  5L3F A;  2VON A;  3EYI A;  3CUQ B;  2FF4 A;  3V7C A;  3ECO A;  2XKP A;  5D5X B;  1HQC A;  3DEU A;  3BJ6 A;  3WGG A;  3WU1 B;  3U1D A;  3BJA A;  4RB1 A;  1PUE E;  4KA4 A;  1SMY F;  2IVM A;  3SZP A;  4CHU A;  1YG2 A;  2QUF A;  2YX7 A;  2LDU A;  4F7Z A;  1K6O A;  1IRG A;  3E6M A;  2P7C B;  2ZME A;  3LA7 A;  3W6J B;  2OZ6 A;  1T0F A;  3DKW A;  1FP2 A;  3F8N A;  4LGW A;  1TTY A;  2OU2 A;  2K7L A;  4OMY A;  2B0L A;  5A2Q Z;  1ON1 A;  4P96 A;  3K69 A;  5HDG A;  5FLX Z;  1RUN A;  5KVR A;  5K5Q A;  3F8M A;  3VOD A;  1S8N A;  2V1X A;  3ROU A;  1ZRC A;  4UUV A;  1FBQ A;  3C18 A;  2RQP A;  5E1W A;  3N97 A;  2MLK A;  3FMR A;  1FZP B;  1BBY A;  5LEJ A;  3Q9V A;  1IN4 A;  1A04 A;  1KYW A;  3ML6 A;  3PQJ A;  4XLP F;  2EA4 A;  1YS7 A;  3KP4 A;  3RYP A;  2H94 A;  2ESN A;  3E3V A;  5K5O A;  1TLH B;  3WE3 A;  1WI9 A;  5HOO A;  2YU3 A;  4I01 A;  3R4K A;  5J8C A;  1FC3 A;  3TO9 A;  5FO5 A;  4EM1 A;  3GFI A;  1YQA A;  4NQW A;  1IRF A;  4EGY A;  4ESJ A;  4LK1 F;  3IRQ A;  5FFZ A;  2PN6 A;  1LJ9 A;  1KU9 A;  3EUH A;  4YFK F;  3CTA A;  4U88 A;  1MKM A;  5CVR A;  4KT5 C;  2M87 A;  5FGM A;  2HYF A;  2ZJ2 A;  3F8F A;  4M9Z A;  1IAW A;  1IZ1 A;  2FA5 A;  4HQM A;  4U7D A;  1G3T A;  4N0B A;  3V8J A;  1KQ8 A;  4L18 B;  4A0Z A;  5LRR A;  4Y13 A;  1K7A A;  5J6X A;  1K78 B;  4NHJ A;  5BQT A;  2E1C A;  1BM9 A;  4ENK A;  4L5J A;  3WTS C;  1JXS A;  3TDU C;  2P5L C;  2Z5U A;  3E6B A;  2YPR A;  4ZYE A;  2JRT A;  5FFX A;  3QP5 A;  2ZKZ A;  2NS0 A;  2O61 A;  3LAP A;  4B09 A;  4HYE A;  5LHG A;  5ILU A;  1KU7 A;  2P6T A;  3E6D A;  1KU3 A;  3F72 A;  3KEO A;  2HKX A;  3CJN A;  4GO1 A;  4XLN F;  4HV5 A;  1Z9C A;  1Q1H A;  1P92 A;  2XIG A;  4KN7 X;  1OPC A;  5HS8 A;  4L9T A;  1G6N A;  3JTG A;  5JHU A;  2HEO A; 
#chains in the Genus database with same CATH topology
 4BXX J;  2JK3 A;  2ECB A;  3BR3 A;  3DQV C;  3Q3S A;  1FBS A;  2CQN A;  2ZO4 A;  4M6Y A;  4Y15 A;  4DGW B;  3G71 I;  4EGZ A;  1K61 A;  3K1P A;  1N77 A;  4O3M A;  3RZO J;  3PSI A;  3O8H A;  3ZMT A;  1BI3 A;  5IPA A;  5K7Z A;  1V5G A;  2DBB A;  3MMY B;  1W5T A;  4AVZ A;  1X3Z B;  2OV7 A;  2Y75 A;  2CYY A;  3BP8 A;  3BJO A;  2E7X A;  3FXR A;  1L3L A;  4J01 A;  1LFP A;  3WOD F;  2D1V A;  2RGV A;  4S05 A;  4XM3 A;  2MD5 A;  2VQC A;  3K4L A;  3PNT A;  4HBL A;  3DKY A;  3QPT A;  4J00 A;  1JT6 A;  2F5C A;  2Z9O A;  1BC7 C;  4IQ4 A;  4AUX A;  2GAU A;  2ZXI A;  3TOA A;  2HVS A;  4BUP A;  1MBJ A;  2BY1 A;  3PUB A;  4AC0 A;  1O57 A;  2DXI A;  3W3C A;  1S7E A;  3JW4 A;  4H4K C;  5IOZ A;  2GLO A;  1OMI A;  2HQ5 A;  1R00 A;  4HDU A;  2XAG A;  3B73 A;  3NWS A;  4W97 A;  5L3D A;  4BQO A;  4WCG A;  4Y3O A;  1KGS A;  4CDG A;  5JLX A;  5GPC A;  2KIQ A;  3BR0 A;  4A6D A;  3HUG A;  2M1B A;  3D5L A;  3QU3 A;  3TMO A;  3ERE D;  1LE8 B;  1ZTR A;  2FQ3 A;  1YW9 A;  2IGN A;  3F6O A;  3QU6 A;  1Z1D A;  2ELH A;  4Q47 A;  4I6Z A;  3H5N A;  3JRI A;  1K4T A;  2XRO A;  1XSX A;  5FD5 A;  2OD5 A;  3G2B A;  3ZN1 A;  5FD6 A;  5GTH C;  3N4M A;  3EYY A;  4HX8 A;  3GFM A;  2A5Y B;  1V55 H;  2RRE A;  2XPW A;  1H0M A;  5HNF A;  4O5V A;  2NNN A;  4OIQ F;  2E36 A;  4C2M J;  3K4C A;  4P1W A;  4RLQ A;  4LB5 A;  2DPU A;  2KP6 A;  2OPT A;  1T98 A;  2IT0 A;  2VXD A;  4FT8 A;  1UG0 A;  1R1T A;  3LMM A;  1J59 A;  5JHF A;  2E2H J;  1VI0 A;  4QPO A;  3VDX A;  1W0U A;  4LIU A;  3JCU C;  1SVL A;  4B3A A;  4LG0 B;  1QVU A;  2CUE A;  4XRF A;  1DGW Y;  4C30 A;  2L4A A;  4HG2 A;  3D0S A;  1ETX A;  3OL3 A;  1BIB A;  1IN5 A;  3E97 A;  2XGC A;  2AQF A;  1DP3 A;  1W4M A;  1ETO A;  2DA7 A;  2WA0 A;  1V4R A;  2PJP A;  5EZH A;  2C6Y A;  2LKP A;  4PSX A;  1J5Y A;  3QPS A;  2NNY A;  1RUO A;  2XUB A;  4QSH A;  2K9N A;  4DOZ A;  1J2X A;  3L00 A;  5EEH A;  3I71 A;  3GF2 A;  3NQO A;  1E3H A;  4S0H B;  2E71 A;  1FIA A;  2ICW G;  2V9V A;  1XMX A;  1WFX A;  2IA2 A;  3CCV I;  4XRS A;  1R71 A;  5FRN A;  5ICG A;  1HC8 A;  3BG5 A;  2V1U A;  2WV0 A;  4Y33 A;  5FKK A;  2NXN B;  4BY1 J;  1HKQ A;  3BG7 A;  4HZF A;  3CCS I;  3BPX A;  1RKT A;  5EZG A;  3OSF A;  1JT0 A;  3QRF F;  2HPM A;  2IJL A;  2ELJ A;  2JSP A;  4PSW A;  1CQT A;  1XTA A;  2KHM A;  1LEA A;  3U2R A;  4N4O B;  1OYY A;  2X1D A;  3CMY A;  1Z6R A;  2IA0 A;  3G1O A;  4FTH A;  2F48 A;  3S3N A;  2VE8 A;  3HB9 A;  1U9O A;  2DDA A;  1WVR A;  3DTE A;  3DFG A;  1ZQ3 P;  3OS0 A;  4P55 A;  3CLQ A;  5TIS C;  5CVU A;  3IKT A;  4Z2Y A;  3S1Q J;  3D1N I;  4BBS J;  2FMY A;  2PJR A;  2QQ9 A;  3CCJ I;  1ETW A;  3WGI A;  1O3T A;  3DLA A;  2M5W A;  2XPU A;  4B47 A;  4ZYD A;  2DJI A;  2W7N A;  3M9A A;  2DA1 A;  2HFH A;  2QQ8 A;  4GGG A;  2D2W A;  4BU2 A;  3A01 A;  1U0J A;  1PDN C;  2LRD A;  5ILS A;  3ZQQ A;  3UKG A;  3ASO H;  4XLC A;  3JAM K;  1ENH A;  5DCM A;  2OUM A;  3F6V A;  1GUU A;  3T8R A;  4B8X A;  3C7J A;  3M4O J;  4I0B A;  3DPL C;  4FHT A;  2FE3 A;  3LQR A;  3LST A;  2ZFW A;  2VL8 A;  1E17 A;  4XL9 A;  1YIO A;  4UVC A;  2DQL A;  2Y31 A;  4BGD A;  5CVJ A;  4F93 B;  3CUQ A;  5IYD J;  2R7W A;  2H27 A;  5E79 C;  2XV4 S;  1IN8 A;  2QEX I;  3E1S A;  4Q5S F;  4AID A;  3MD2 A;  1IDY A;  2HS5 A;  4CGZ A;  2CG4 A;  4LK0 F;  1IRZ A;  3ECH A;  1D0X A;  5DUI A;  4HV6 A;  3MAJ A;  1SD5 A;  3WTY C;  3OYC A;  4JK1 X;  4E7S A;  2CV0 A;  2L7M P;  2CH0 A;  2DI3 A;  2UXX A;  2BXZ A;  3K4N A;  3SDB A;  2W57 A;  3H9Q A;  3K9T A;  4ESB A;  3DP7 A;  1BOB A;  2K9Q A;  1R6R A;  1RZ4 A;  1P9Q C;  4XIC A;  1OLT A;  1R1U A;  1TNS A;  1R49 A;  1LUJ B;  1OCO H;  2TCT A;  3ZRG A;  1HBX G;  4IF4 A;  3VPR A;  2HXI A;  5K7H A;  1WSU A;  1RI7 A;  2NYX A;  3E0J B;  3I56 I;  1UEL B;  3NRV A;  3J80 Z;  4CO8 A;  3HOZ J;  3ZQC A;  3JRB A;  3TW6 A;  5DV5 A;  2V79 A;  5IP6 A;  3RSN A;  1ZG5 A;  2YS9 A;  3Q0V A;  3HRU A;  3FZV A;  4CCO A;  1RKW A;  1D1C A;  3R60 A;  1Y0U A;  2GA1 A;  3KZY A;  3TP3 A;  4UXN A;  3NEU A;  2WAF A;  1X3W B;  1MGT A;  3C2G A;  4WX9 A;  4H0E A;  2FBI A;  4I76 A;  4IHY A;  2E34 A;  4BAC A;  4CCK A;  2VT2 A;  5KCM A;  2IRF G;  1RR8 C;  3ISP A;  2E2J J;  2ACJ A;  2ZXJ A;  4ON0 A;  3ABL H;  1SAN A;  5H6R A;  4U0Y A;  4HX7 A;  1WGX A;  5LBQ A;  4XKB A;  4G6T B;  3TED A;  1Y1W J;  1YOV B;  1ZGJ A;  3TGN A;  2X6O A;  1BJA A;  2M9H A;  1MDM B;  1ON2 A;  5E3O A;  1IXR C;  2IA1 A;  2W1O A;  4ABZ A;  2HDW A;  2QKM B;  2VPR A;  3FK6 A;  2Y0M A;  1QZZ A;  3G6E I;  1R22 A;  1U5T C;  3BQY A;  4KMU X;  1N78 A;  4G8X A;  4IPA A;  5LLQ A;  4IOC F;  2UXN A;  3IRR A;  2OQR A;  2KRF A;  3BDD A;  4II3 A;  1XSV A;  2ZNZ A;  3V7S A;  2JVH A;  3OYL A;  3HKZ A;  1ZGW A;  1F1Z A;  2EH3 A;  2J5P A;  2M8G X;  4ZZD A;  1H9T A;  2BZT A;  4OIO F;  2FXA A;  4HSR A;  3TP0 A;  3IC7 A;  3FXU A;  2XAU A;  1G3W A;  4M3B A;  2JUG A;  1R5I D;  1I1G A;  1XG1 A;  2KIU A;  4UV8 A;  2P81 A;  3CLO A;  3KP3 A;  1B4A A;  1OR7 C;  3GZ6 A;  3EPZ A;  2CWE A;  2HZT A;  2L7K A;  3K1N A;  3T0Y A;  1SFO J;  2EJR A;  3B02 A;  2QYO A;  2QSG X;  5LGU A;  4PJL A;  3ZXS A;  4BKX A;  3KEQ A;  1JUP A;  4RAF A;  1W5C C;  1TQP A;  2GZW A;  1TBX A;  4OMZ A;  2R7V A;  1B1B A;  1FBU A;  4UVA A;  2PEX A;  3I0T A;  3MCZ A;  2CUF A;  1FLI A;  2ZJP F;  4BY7 J;  3S2W A;  5A2Q K;  2JA6 J;  2KKO A;  2IP2 A;  3BTI A;  3MZ8 A;  3ERM A;  2WAQ N;  3DU5 A;  1H8A C;  5M5W J;  5FLX K;  4G9Y A;  3VYT B;  1ETY A;  2EFN A;  1I6X A;  2MA3 A;  2IGO A;  3E5X A;  2KJB A;  2HOA A;  4MFE A;  1NH3 A;  4XBF A;  2BY3 A;  5E1Z B;  4PJJ A;  4M74 A;  1PUF B;  4KDP A;  2CSO A;  1BN5 A;  1LFB A;  3DEW A;  1MMD A;  2H1L A;  3GYH X;  4A12 A;  4L0Y B;  4PJM A;  3BY6 A;  1W36 C;  3KP6 A;  1XMA A;  2MFZ A;  1O7F A;  3D5S C;  3KYC B;  2RC4 A;  3OIO A;  1W36 D;  4KIC A;  1R23 A;  5M3M J;  4KJZ A;  4B48 A;  3OIP A;  5IT9 K;  3RQ4 A;  1W0T A;  1QA6 A;  1K79 A;  1FTZ A;  4UVB A;  3ONQ A;  2PG4 A;  2XC7 A;  2L5Q A;  2RV8 A;  4E7I A;  2YSR A;  3WGH A;  5ED4 A;  2Q0O A;  2DFF A;  3KZZ A;  3CJT B;  5D4R A;  1NHA A;  2FOK A;  3ZR8 X;  2P6S A;  3HRM A;  1K78 A;  2VOP A;  2EIM H;  5DYM A;  2ZNY A;  3CZ6 A;  4JYK A;  1XGO A;  2GXB A;  1JUM A;  3GZ5 A;  3DKX A;  4LLN A;  1O7L A;  1OYW A;  3SQN A;  2DA6 A;  3LA2 A;  4RGR A;  3JRC A;  4IZZ A;  4HLY A;  2NS7 A;  4YFN F;  4CYC B;  1VQL I;  1AKH B;  3S17 J;  3KP7 A;  3BTC A;  3O8G A;  4A0Y A;  2OZU A;  2XHK A;  2WBM A;  1T39 A;  2LFB A;  5EDN A;  1XN7 A;  2QCO A;  4BE1 A;  3RKQ A;  1DP7 P;  3AG3 H;  3KLN A;  3IWF A;  1S29 A;  2GWR A;  4D5C A;  2XRN A;  1FOK A;  1OCR H;  1WJB A;  4D5F A;  2DJN A;  3MWM A;  3LA3 A;  1F9N A;  4DYC A;  1T8I A;  4RA2 A;  1GDT A;  1PP8 F;  2D5V A;  3GVA A;  1OCC H;  2GOM A;  3RKX A;  4XLE A;  4G7Z F;  5FKO A;  4WF2 A;  3KET A;  3P7N A;  2V7F A;  4HF1 A;  2LY2 A;  2M4G A;  2ZME C;  4LIV A;  1XMK A;  1T0F C;  1HSJ A;  3CO6 C;  2D45 A;  1J9I A;  2ZJR F;  1TNT A;  2VT3 A;  1YI2 I;  1Z67 A;  3TKY A;  4ZC3 A;  3JSO A;  1HST A;  5KAF C;  4A93 J;  4FX0 A;  1JJ6 C;  2E1M B;  3JRH A;  2VXZ A;  3BZK A;  4S04 A;  1GVJ A;  3H5A A;  1ZN2 A;  4A3D J;  4E6K G;  5L3C A;  5HLI A;  2A05 A;  1WJD A;  4RS8 A;  4EJV A;  5IT9 Z;  3W2V A;  4PGH A;  5L3E A;  1LVA A;  3M8F A;  2W24 A;  3J7A O;  3SZG A;  5DDG A;  2DMN A;  2R7T A;  1OCZ H;  1ZG1 A;  2BYV E;  3KP5 A;  2VKD A;  2COB A;  2DA3 A;  4KT6 A;  3RJP A;  4MLO A;  4EM2 A;  5B3S H;  1OCT C;  3NAR A;  2LD5 A;  3P5J A;  5KHD A;  2QGU A;  3QYF A;  2LNB A;  2DK5 A;  3GME A;  4BHC A;  3K2A A;  1QHG A;  4U87 A;  3CMA I;  1LE8 A;  2OQG A;  2QEN A;  1YHQ I;  3HEF A;  3K4K A;  2KRH A;  4ZYH A;  1EV7 A;  4E7J A;  1FIP A;  4KYW A;  3HOV J;  4CH7 A;  1GV5 A;  3SXY A;  3HOX J;  5FLM J;  2M30 A;  3H0D A;  2E1N A;  3RPU A;  5J1Y A;  2B7E A;  2O8X A;  4BH9 A;  3WU0 A;  4A3J J;  4L9V A;  2CGP A;  2XB0 X;  4UV9 A;  4KNY A;  2HTS A;  3GTQ J;  4C2T A;  3LNQ A;  4HOB A;  2VBZ A;  3AKZ A;  3HTU A;  3OYA A;  1MSF C;  2G9W A;  2LYC A;  3LSR A;  1S6L A;  3J7Z I;  2K5C A;  1FYK A;  3OYM A;  4M9S A;  3F9K A;  1SAX A;  4EJW A;  2EV5 A;  2NVQ J;  1X19 A;  4LG0 A;  1S3J A;  1IJW C;  2HXO A;  2EIL H;  2IXS A;  4RM3 A;  4A5M A;  1FSH A;  2CMP A;  1XCB A;  5H20 A;  5LHI A;  3OYB A;  2O6G E;  4EJT A;  2ISY A;  1CF7 B;  2KIS A;  5FKL A;  4F52 A;  4L0Z B;  4V2F A;  1TW2 A;  2VKH A;  4L5E A;  2VC0 A;  3PUF A;  5GAH J;  3EUH C;  3M3Y J;  2PMH A;  4N9H A;  1MIJ A;  4OIP F;  4UB8 C;  1E3P A;  2MW8 A;  2QWW A;  2X51 A;  3SYT A;  3F21 A;  2XB5 A;  1VQ5 I;  4KIF A;  3H0G J;  1ITY A;  3ZQ7 A;  5IT3 A;  5ICE A;  2D1H A;  3ZMU A;  2QSF X;  3CUO A;  3VSK A;  3BC8 A;  3S2H J;  1VQ4 I;  3C1D A;  2R5Z B;  5HS7 A;  4MEX F;  4RM2 A;  5ILV A;  4I0A A;  4XNF A;  4Q48 A;  3ZPL A;  5FKM A;  4NC7 A;  4MQ9 F;  1ZRF A;  5F04 A;  1KU2 A;  3HSF A;  5DM6 F;  2XAS A;  1G59 A;  3A4C A;  1XDS A;  4B43 A;  1HA8 A;  4A6E A;  4BJT A;  4YFX F;  5EEA A;  1TW3 A;  4ZDO A;  3JRG A;  2B9S A;  4XLF A;  4G7O F;  3PNY A;  3B6C A;  3HYI A;  2QBY B;  1ACI A;  4WXH A;  1BR1 A;  1T56 A;  1JKR C;  4OOI A;  2L0K A;  4FIS A;  1XDU A;  5GTI C;  1FNN A;  1Y8R B;  2NOG A;  2XAJ A;  4C2U A;  4BYY A;  3HTS B;  3QOE A;  5IP7 J;  4HF2 A;  2DLL A;  4XR6 A;  1VTN C;  5D8L B;  1AA7 A;  3M07 A;  3RCO A;  2J5O A;  5HLG A;  4XRS G;  3SDG A;  4ZH4 F;  2LBF B;  2AXT C;  1ZAO A;  5GAG J;  5B1B H;  1QVT A;  2W84 A;  2XF7 A;  2ZC2 A;  1JTY A;  3JTH A;  4KFC A;  3WTT C;  3FMS A;  1IN7 A;  3CF2 A;  3QAH A;  3KX2 A;  2Q1Z B;  3K2Z A;  3TO7 A;  2H8R A;  2W4S A;  3G4S I;  3NWT A;  4KN4 X;  4XMY A;  2IW5 A;  2MAB A;  3REO A;  3OL4 A;  1X58 A;  3I53 A;  2NOJ B;  4M71 A;  1DU6 A;  2FQ4 A;  2UZK A;  1XCV A;  1RR7 A;  3L7W A;  4XKW A;  5AON A;  4JX5 A;  2F2E A;  2KLO A;  3S93 A;  1W7P A;  1Z21 A;  2LKS A;  3M8E A;  1SFU A;  3O2P E;  4DJA A;  4XSZ F;  4ASN A;  3IH4 A;  1JE8 A;  2E19 A;  3S1N J;  4BE0 A;  2FNP A;  2WB1 N;  2YR2 A;  2QLZ A;  1HKT A;  4KIS A;  4R79 A;  4QPQ A;  3LSP A;  5ERI A;  2KL4 A;  4AVP A;  5IP9 J;  5E17 F;  1JKO C;  1FTT A;  4O6J A;  3SFZ A;  5KK1 A;  1IGN A;  3S1M J;  1Z77 A;  2ELK A;  2ECC A;  2DA2 A;  1Y39 A;  2EWN A;  2VUM J;  2L02 A;  1PYV A;  3OYH A;  4D7N A;  2ZSH B;  4DW6 A;  4XID A;  1PJR A;  2HVR A;  2UWM A;  1HDP A;  1MMA A;  1DDN A;  2P4W A;  1D1B A;  1TT0 A;  2ZFU A;  3FF5 A;  5D8K B;  2EPF A;  1LDK B;  2PMU A;  5B66 C;  2WC2 A;  4ITV A;  2A6E F;  4IRG A;  2KZV A;  3FXQ A;  1WJ5 A;  3MZY A;  2GXA A;  3DWL E;  3IL2 A;  3ZMV A;  1NG7 A;  1X1B A;  3H9G A;  4BQN A;  1V5E A;  3H3U A;  3QQA A;  3R0J A;  4BE2 A;  1F43 A;  3L2W A;  2MH9 A;  4RB3 C;  2ISZ A;  3G1M A;  5IYC J;  3DTK A;  2GIZ A;  1ERD A;  3LSM A;  3H3Z A;  4IOA F;  2Y30 A;  1QBJ A;  3E5Q A;  1UHS A;  1MDM A;  2ME0 A;  4EM0 B;  3MN2 A;  2KDZ A;  1YW7 A;  3AL0 C;  2F5E A;  5J40 A;  2Y69 H;  5C3E J;  1GT0 C;  4RLF A;  4KIG A;  4A3E J;  1SVM A;  3FHZ A;  4ZYA A;  1EF4 A;  2YX4 A;  2P5V A;  2E1O A;  2JRM A;  4RGS A;  2Y2Z A;  2JVG A;  3RIR A;  5F64 A;  1P2F A;  5JVG F;  2RQQ A;  5K5R A;  1OIS A;  3SJM A;  4GYG A;  5LRS A;  2EZI A;  5D6E A;  1RC9 A;  4U0V A;  1BJZ A;  5FRM A;  1IV8 A;  2Y48 A;  3VEP A;  3M7G A;  1B8I B;  1A31 A;  3ZQI A;  2LR8 A;  3HHH A;  2X0L A;  5F27 A;  3J80 K;  1FOY A;  3ASN H;  2K27 A;  4ENM A;  1SD4 A;  4HLX A;  1FSE A;  2DT5 A;  3JRE A;  3I4M J;  3OR1 C;  2EIN H;  2L7Z A;  3TL4 X;  4YG2 F;  2BEO A;  4IHS A;  1QQI A;  1EJ9 A;  4A3C J;  5EGO A;  2F4O B;  4FCY A;  2EZK A;  4AIK A;  1VQP I;  4HST A;  2OF7 A;  2PBI A;  1TWC J;  3DBH B;  1SFE A;  2BV6 A;  3PM1 A;  4CSW A;  2XVC A;  9ANT A;  2A68 F;  1V54 H;  3FX3 A;  4XOT A;  2XAF A;  5F08 A;  2IEK A;  4XOR A;  4NDL A;  1EH7 A;  5HNH A;  4U7B A;  4RAG A;  4EJO A;  2RDP A;  4PJ0 C;  3AFH A;  2XSJ C;  4A3L J;  2CW8 A;  3PJR A;  4A3K J;  4D7M A;  4R8H A;  3H1C A;  3T5X A;  3MZH A;  1HCR A;  2P8T A;  4LLL A;  2O3F A;  2M7B A;  2VBW A;  5C4X J;  1VND A;  2DYR H;  2VIX A;  3J7Y J;  1F4K A;  2CV2 A;  2JUC A;  5LHH A;  1R1V A;  2R7D A;  5HLH A;  2RAE A;  3ABU A;  3BR1 A;  1MMS A;  3HRT A;  3JR9 A;  4B3X A;  3RTR A;  1X2N A;  2QM3 A;  3ZQL A;  4L9N A;  2QF7 A;  5F0F A;  3K6G A;  1BR4 A;  2VQH A;  4BS9 A;  4XLA A;  3S2D J;  2IBD A;  3BRO A;  2EFO A;  4MEY F;  1G3Y A;  3GTL J;  3QWL A;  4RAY A;  1RIO H;  1JGS A;  5CJ9 A;  1MMN A;  1UFM A;  1XGS A;  4DYQ A;  3GTO J;  3VYU B;  4IEJ A;  2HOS A;  2MD0 A;  1FEX A;  3HPG A;  4EJU A;  3E6C C;  4LFU A;  4Q4Z F;  2HVQ A;  4AWX B;  4D0P A;  2HOT A;  1Z6T A;  2VBY A;  3AG2 H;  1R5H A;  3W6V A;  4A69 C;  2VKV A;  4BL0 B;  2FUG 2;  1HW2 A;  1YX5 A;  1Z7U A;  2GBY A;  5AIQ A;  2AXL A;  3I55 I;  4UNO A;  2G7H A;  5DD4 A;  3OYD A;  4IO9 F;  2EZH A;  3LL7 A;  4F3Q A;  3H3V K;  4HPQ A;  3S32 A;  1AKH A;  4CZC A;  4DQ2 A;  1IXS B;  1M1E B;  4BQQ A;  2FBH A;  2EFP A;  3OIQ A;  2BY2 A;  4RB2 C;  1IXC A;  2L2O A;  4AD9 A;  4C3J J;  1QZY A;  5K1Y A;  1LFU P;  1YX3 A;  1ZLK A;  3W6K B;  2HR3 A;  1D0Z A;  2LK2 A;  1KQ0 A;  4NNJ A;  3HGY A;  4DNC A;  1QHH D;  2CO5 A;  1B9M A;  3HGG A;  1A5J A;  3L2C A;  1YRN A;  1BC8 C;  2Z1D A;  1LVK A;  4AYB A;  4ZDL A;  4X1E A;  4BBR J;  1NG6 A;  1ZEL A;  2L3D A;  3Q9S A;  2ZSI B;  3VYR B;  2DMT A;  2XAH A;  3WE2 A;  5D4S A;  4JQF A;  1VFC A;  3GUD A;  1TT5 B;  1TWH J;  2PMZ N;  1DPR A;  1YIJ I;  3O6B B;  4RGX A;  1EKE A;  4ZTF A;  3BLY A;  1ETV A;  3G3Z A;  1OFC X;  4P9U A;  1QO0 D;  4JX4 A;  2LRE A;  3WTX C;  1VQ6 I;  3TW7 A;  3F23 A;  2L9N A;  3CO7 C;  1FMW A;  2R7U A;  2XF6 A;  3HZJ A;  1G2H A;  2LG4 A;  1YLF A;  2VBX A;  4BDY A;  3AL0 B;  2IPQ X;  1KZH A;  2VOD A;  1UMQ A;  3CCE I;  5J4V A;  5CLS A;  5D5U B;  1Y56 A;  4PGG A;  1U3E M;  2ZBK A;  2VQL A;  1ZR2 A;  2DO7 A;  1MJ9 A;  4HNU A;  5CQG A;  5DTD A;  3DBL B;  2M0C A;  3HJE A;  2CQ7 A;  3EDP A;  3DU6 A;  3HSE A;  5CVV A;  2RN7 A;  3CDH A;  3DF8 A;  5CQE A;  4FX4 A;  4CIC A;  2M2E A;  1SD7 A;  3MFK A;  5HVQ C;  1J7K A;  1ZLJ A;  3RPQ A;  4QIW N;  2A6T A;  4OU0 A;  3K0L A;  1ZR4 A;  1YIT I;  1FY7 A;  1GVD A;  3HDD A;  2LOO A;  4LG3 A;  1B9N A;  4RAZ A;  4XK4 A;  4ENN A;  1V3F A;  4JBA A;  5DM7 F;  1BI2 A;  1SD6 A;  2ESH A;  3ULQ B;  2JSC A;  2LH9 A;  2R0Q C;  1FJL A;  2HQN A;  4FQG A;  3HXL A;  1DQU A;  1NK2 P;  4E7L A;  5K7F A;  4N4N B;  1H88 C;  4DBQ A;  1VQ8 I;  2R7O A;  2KRC A;  3VYS B;  3BCA A;  4LMY A;  3RDI A;  2QZ8 A;  1HF0 A;  4MIM A;  1DUX C;  4G12 A;  3LSJ A;  1BOA A;  3W2W A;  3K70 C;  2KIF A;  3K1M A;  1S7O A;  1ZGA A;  2VI6 A;  2XGD A;  2E7W A;  5HDN A;  3K70 D;  1OQY A;  4G6Q A;  2OA4 A;  2V26 A;  2QVO A;  4V19 K;  5TGT A;  1G3S A;  4B44 A;  2DAO A;  4BHB A;  4DBR A;  2NS8 A;  3A02 A;  3S3O A;  2X4H A;  3FBN B;  3H5R A;  3BPV A;  4F91 B;  3FWE A;  4MHG A;  1DPU A;  1AHD P;  1NK3 P;  2M34 A;  2JA5 J;  3VOE A;  5HS9 A;  4BXU A;  1X1D A;  4GCV A;  3L2R A;  2X48 A;  4JP0 A;  4P5O A;  1UCR A;  3CCM I;  3IH2 A;  1D1A A;  2W82 A;  1V5F A;  2H1K A;  3WTU C;  1RRJ A;  2WB1 A;  1JGG A;  1APL C;  4FET A;  3FKI J;  1YJ9 I;  1WHU A;  4P9F A;  4ANJ A;  2JZY A;  3D5R C;  4IL6 C;  2CU7 A;  2A69 F;  3KE2 A;  4A5N A;  1TWG J;  2R5Z A;  3LFK A;  3PQK A;  4MGR A;  2EFW A;  2IS2 A;  5J1R A;  1IO2 A;  3CC7 I;  4KIT B;  3FMQ A;  2VPL A;  2JN6 A;  3HM5 A;  1I5Z A;  2VQG A;  4JOM A;  5B5E C;  3FXM A;  5F1J A;  1VQO I;  2LMD A;  1IF1 A;  1RPW A;  3B6A A;  3CP8 A;  1P7I A;  2O8K A;  1LDJ A;  2LF7 A;  4N9I A;  4ZZL A;  5E20 A;  1U8R A;  1AOY A;  1HKS A;  3CCU I;  1PP7 U;  2QBY A;  2BXY A;  4E4H A;  1WZ2 A;  1I3A A;  4NB5 A;  1Q1V A;  3QOD A;  2R7Z J;  3MKW B;  1W1W E;  4DIQ A;  2DTZ A;  4E7Z A;  1XS9 A;  3P9I A;  2XDV A;  3WTZ A;  4CYD A;  4IHV A;  1WWX A;  2ETH A;  1D8K A;  2JA2 A;  4A3M J;  1VQM I;  2A61 A;  2LBF A;  2IGM A;  1G4D A;  3FXL A;  4EVI A;  3I54 A;  1QPM A;  3F22 A;  1FT9 A;  3AAF A;  1XGN A;  1TZL A;  1C0W A;  4BAY A;  2BHY A;  4WXD A;  3Q5F A;  1VQN I;  2WTE A;  2HI3 A;  2RVC A;  1R36 A;  1GLN A;  1O3R A;  2MSY A;  3HSR A;  3R61 A;  2OCE A;  3FM5 A;  1MZB A;  4BNC A;  4BDZ A;  5HLT A;  3ZGK A;  2X1C A;  4LIT A;  2H6C A;  3QPH A;  2KQR A;  1WI3 A;  2H6B A;  4GFB A;  1Z7L A;  5LFA A;  1LB2 A;  2KZG A;  1WQ2 A;  2V9K A;  3BWG A;  1XC5 A;  3IHU A;  4GYI A;  2Y0S N;  3DPT A;  3IAM 2;  1U5T B;  2CQK A;  5J4Y A;  2FRH A;  2Q2E B;  4XON A;  1GV2 A;  1TWF J;  2E5Z A;  1SVO A;  3NAU A;  2O03 A;  5TRD A;  4PZJ A;  4M72 A;  3R0A A;  2CQQ A;  2HOE A;  3TO6 A;  4IRH A;  4I09 A;  5J1U A;  1KQ9 A;  3FIW A;  4LJZ F;  4II2 A;  1MMG A;  4HF0 A;  2FX0 A;  5FKN A;  1YYV A;  1ZYR F;  5TJJ A;  3OYI A;  2NVU B;  2GOX B;  2JA7 J;  2KMU A;  3GLX A;  5BPD A;  3TDZ C;  3QP6 A;  3OS2 A;  1HW5 A;  3RI4 A;  1P4A A;  2IS4 A;  2HDC A;  2TDX A;  1STZ A;  3E5U A;  1H9G A;  1IW7 F;  1B6A A;  1QNT A;  2COM A;  2JPB A;  1A6Q A;  3MQ0 A;  2DW4 A;  3MEX A;  4M9X A;  1EH8 A;  4BHP A;  3I59 B;  3C3W A;  4UUS B;  2BW3 B;  4KUM A;  4HDV A;  4G7H F;  1ULY A;  1ODD A;  3RKY A;  1QPI A;  1OYI A;  3SFI A;  1FPQ A;  1T38 A;  3LWF A;  3T1B A;  3CCY A;  2YUS A;  4AIJ A;  4XOP A;  4M3G A;  2R3S A;  3K4B A;  3F0C A;  4YII A;  1I50 J;  1UHW A;  5DEQ A;  4IKF A;  2QQA A;  3ABK H;  1R58 A;  2EB7 A;  2L7F P;  1FYL A;  1XSD A;  1SMT A;  1B59 A;  2GIV A;  3OMY A;  3RKW A;  3GTM J;  3AG4 H;  2RNJ A;  4CZZ A;  5KNL A;  2XGE A;  1IN6 A;  1LEB A;  3IKV A;  5M5X J;  4A3G J;  4L5I A;  3DXJ F;  5DD8 A;  5AIP A;  1HXD A;  3DTI A;  3JSP A;  2LY9 A;  2STW A;  1Y6I A;  4R1H A;  2V6C A;  4MQV A;  2Y9Z A;  2JTV A;  4ZTJ A;  1Z05 A;  1WJC A;  2OCC H;  4EQQ A;  4NC8 A;  1ONV A;  4Y17 A;  3QYE A;  3BCB A;  4UHT A;  1F36 A;  4HNV A;  2DU9 A;  2FEZ A;  1X1A A;  3CMM A;  3UR3 C;  3F8C A;  4CCN A;  3CQZ J;  2DYS H;  3L09 A;  2K9M A;  1JKQ C;  4PCQ A;  1XGM A;  2FNA A;  2LY1 A;  2DOF A;  4CXF A;  1U78 A;  1BA5 A;  2N8G A;  3RQI A;  4IXA A;  4CA0 A;  2O9L A;  2EBI A;  2I5U A;  3K4J A;  2K9S A;  1DU0 A;  2NVX J;  4MNU A;  1FWZ A;  1LDD A;  2L54 A;  3FXO A;  1EH6 A;  3ABM H;  1BW6 A;  5E1X A;  1O3Q A;  3BG9 A;  4MTE A;  4HAM A;  3WTW C;  3IH3 A;  2DMU A;  5ICC A;  3HPH A;  4GDF A;  2R5Y B;  1QU3 A;  2FU4 A;  2HYG D;  4AU7 A;  2GXG A;  3P9C A;  3GX4 X;  2OJE D;  1JJ8 C;  2STT A;  2AS5 F;  4LLG F;  3BTL A;  3OOP A;  1Y0N A;  2G7U A;  2DTR A;  2W85 A;  3PO2 J;  1LPQ A;  2F5F A;  3HBL A;  3T8T A;  4Z6Y A;  3BQZ A;  1WRJ A;  2M0M A;  2L9S A;  3WG9 A;  1N75 A;  2EK5 A;  2Z3Y A;  1BI0 A;  3KIO A;  1KON A;  3MKL A;  3EET A;  2VOO A;  2H09 A;  5DS9 A;  5E18 F;  2RKH A;  4RDU A;  2HKO A;  3U9G A;  5BNG A;  1KYZ A;  1BW5 A;  2AQE A;  4C9Y A;  2MC3 A;  3GLL A;  2HU9 A;  1FX7 A;  3COA C;  3BZC A;  1FP1 D;  2ZME B;  1GXQ A;  2R7Q A;  3FXJ A;  4J19 A;  1JKP C;  1OJL A;  4HQE A;  4G6D A;  2JT1 A;  1T6S A;  5EJC A;  4IRI A;  2EA2 A;  3PSF A;  2BVL A;  3FHN A;  5F1R A;  4IHW A;  3V4G A;  5E3N A;  2CJJ A;  1WH5 A;  4HEA 2;  3IUO A;  3ZMS A;  3KCC A;  2PQ8 A;  2VAS A;  5L3G A;  2F6C A;  1F5T A;  2F5V A;  3I3L A;  1Y8Q B;  4X0G A;  4IVN A;  5F6F A;  1LNW A;  2IGK A;  3S3M A;  2KIM A;  1YFH A;  1P6R A;  2K4J A;  3WHB A;  1XB4 A;  3GW2 A;  3HOU J;  2DT7 B;  2W25 A;  3S1R J;  5F0C A;  2L9V A;  1JHF A;  1UHM A;  1R9T J;  2KJC A;  2G0E A;  2HQR A;  2K3P A;  3BG6 A;  1MJA A;  2DCE A;  5BPI A;  4IHT A;  5IOY A;  3SZT A;  1WKM A;  3DCF A;  3HC7 A;  2M8E A;  2XKO A;  3A0H C;  1YJN I;  1REP C;  2WWY A;  4XSX F;  1WJE A;  3I4P A;  1G8X A;  2WAQ A;  3H9J A;  2DK8 A;  1MNM C;  1D8J A;  4A3B J;  3C2B A;  1S7A A;  4IX7 A;  1W7P D;  1JTX A;  4E7K A;  3CC2 I;  2HTJ A;  4BQA A;  2CUJ A;  3L1P A;  1CGP A;  5C44 J;  3I5U A;  2E2I J;  3U1K A;  2LLK A;  4AM3 A;  2BHZ A;  2AO9 A;  2JWT A;  1XD7 A;  2R4G A;  2VC1 A;  5CVI A;  2CFO A;  1R5G A;  1BR2 A;  1X1P A;  2O5R A;  4M6X A;  2E60 A;  4BEH B;  2DA5 A;  4E7H A;  5L3B A;  5GPA A;  4YEL A;  2B63 J;  4XKV A;  1XPX A;  5GAD J;  3BZ6 A;  1Z3X A;  2LP0 A;  1A6I A;  3VB2 A;  5M5Y J;  3OR2 C;  1MJB A;  3GFJ A;  4HRI A;  1ZH5 A;  4K2E A;  3OYE A;  2TRT A;  1T95 A;  3WTV C;  3J7A Y;  4NQW B;  5E3M A;  5BOX A;  4GXO A;  1ZRD A;  3RYR A;  4LB6 B;  1ZRE A;  3CJQ B;  2FML A;  2ID6 A;  5HOD A;  4EMS A;  2DN0 A;  2LF8 A;  1WPK A;  1JI8 A;  3PIO F;  1HW1 A;  1MH3 A;  5JVT A;  2VKE A;  2XPV A;  3FM3 A;  4XKC A;  5H6Q A;  1B72 B;  2PFB A;  4AIH A;  5DCF A;  1IV6 A;  3GZN B;  3KEY A;  2IS6 A;  5LGT A;  1MD0 A;  4TV7 A;  4M6V A;  4M3F A;  1I27 A;  1ZAR A;  1MBF A;  4LD5 A;  2MGQ A;  4XN3 A;  3L2V A;  3I58 A;  5LEK A;  4WWC A;  2PX9 A;  5GP9 A;  3OY9 A;  3M8J A;  3CCR I;  1TQM A;  3LSH A;  1QGP A;  3R6S A;  2CRG A;  4DZP A;  5D6F A;  1UJ8 A;  1HDD C;  4F92 B;  2XF5 A;  3KLO A;  3Q0U A;  1T33 A;  1U2W A;  4F55 A;  4XN0 A;  6PAX A;  4MTD A;  4I2O A;  3ZN0 A;  1POG A;  1HOM A;  4YIF A;  1ZHF A;  5FRO A;  3V7R A;  4KMF A;  1MBG A;  4I98 B;  3ELK A;  4KIB A;  5BS6 A;  3FDY A;  1GXP A;  1KA8 A;  2NRA C;  1D0Y A;  1T2K A;  2VE9 A;  3QOP A;  3KYD B;  3OYJ A;  3ZMZ A;  3SHF A;  3UNG C;  2VJ5 A;  2LSO A;  2KT0 A;  2KFD A;  3HOT A;  2Z99 A;  4OWR B;  3G73 A;  1U6G A;  2BBY A;  5E8I A;  3OWT A;  2EV0 A;  3VFZ A;  4HA8 A;  5DUK A;  5LGN A;  2JMW A;  3HIF A;  3PFY A;  2NAZ A;  1PUF A;  3FIS A;  3I64 A;  3MVP A;  2HGC A;  4DYR A;  2OTL I;  3ZP5 A;  2P7V B;  1MNE A;  1X3U A;  4RBO A;  2CV1 A;  2BGC A;  3KP2 A;  1D5V A;  4YEJ A;  5EEG A;  4OIN F;  2MLG A;  2Y0S A;  4UUT A;  2X6Y A;  5E8G A;  2EV6 A;  5JLW A;  3S16 J;  4IJA A;  1RES A;  4NUB A;  4XRM A;  4Y7N J;  2Q8K A;  3GWZ A;  3HHG A;  4CCJ A;  5F0H A;  3CF5 F;  3FXK A;  4E70 A;  5LD2 C;  2XAQ A;  4JX6 A;  1MND A;  3K10 A;  1FYM A;  1UST A;  3L9F A;  3WHC A;  5JR3 A;  3HRS A;  2CFX A;  5EG0 B;  1OCP A;  1R7J A;  2HYJ A;  3PNV A;  4G94 A;  3ABT A;  2GQQ A;  4M73 A;  4XLH A;  3TOB A;  3ZMD A;  4EV0 A;  4ZYG A;  2LTP A;  3CME I;  2X85 A;  4NC6 A;  1LQ1 A;  4PJN A;  1BIA A;  3O3K A;  2O0Y A;  2CW7 A;  4I7H A;  4QLC U;  3FBI B;  1X4O A;  1QRY A;  2K85 A;  2MG4 A;  2Z2S B;  1QZE A;  2QQB A;  1WJA A;  1IDZ A;  3GTG J;  1T08 B;  2E5N A;  3BR2 A;  2VB6 A;  1P4X A;  1SAU A;  3CUQ C;  1X2M A;  3HOW J;  4OIR F;  1Z0X A;  4L9J A;  2ME6 A;  1D3Y A;  4CYC A;  3F8B A;  2Z16 A;  1YS6 A;  2WV1 A;  5C4J J;  2ADU A;  4EAT A;  2CQX A;  4ESF A;  4I02 A;  2DMP A;  5ICF A;  2X6W A;  1E0E A;  1W7P B;  3DPU A;  5FJ8 J;  2F4M B;  1J75 A;  1WJF A;  2I8D A;  2NVT J;  1YO5 C;  3V8K A;  3GO5 A;  5FB2 A;  3J81 K;  1VF9 A;  1E3O C;  2PLY A;  2E35 A;  2QKL B;  3IP4 B;  2A5W A;  2M45 A;  1ORK A;  1GHC A;  4RGU A;  2FBK A;  2DFE A;  4M3E A;  1I1S A;  2R92 J;  2YU9 J;  4ENJ A;  3HUG B;  5BMZ A;  3ZQH A;  1P7J A;  1UZC A;  2R7F A;  4A2U A;  3GEZ A;  1AU7 A;  2K40 A;  3OYK A;  3TQN A;  3GFL A;  2HWV A;  2NVY J;  3LAJ A;  2K4B A;  1R4M B;  2HPI A;  3BR5 A;  1RNL A;  4FAS D;  1R4N B;  2V9P A;  1AWC A;  2XRL A;  2MYS A;  3P9K A;  2XGX A;  1JHH A;  1MSE C;  4HNT A;  1VQ7 I;  3LQQ A;  3QPL A;  3SEQ A;  1UAA A;  3A1Y A;  3PO3 J;  2OTJ I;  3CDI A;  4PFP A;  2K3F A;  4FE4 A;  3PIP F;  3BTJ A;  2X6X A;  1YTY A;  2I10 A;  1U5T A;  3FKJ A;  5D5V B;  2Q2E A;  3HG9 A;  2W48 A;  4U0W A;  2Z33 A;  1W5S A;  3OS1 A;  2P5K A;  3F3X A;  5J8F A;  3WU2 C;  4PDK A;  3JAM Z;  3H92 A;  1IC8 A;  2E1M C;  2DMQ A;  4YIR X;  2A07 F;  2MBF A;  1SC7 A;  1NTC A;  2JJ7 A;  5EF6 A;  3LSG A;  1E2X A;  2BOL A;  3N05 A;  2VJJ A;  2R93 J;  5IY5 H;  3Q0W A;  2DFI A;  2DQR A;  2VN2 A;  3H36 A;  2V1D A;  2DOD A;  4WXC A;  3V8L A;  1EA3 A;  3JRF A;  2OAZ A;  1OR7 A;  1ZK8 A;  4ZDP A;  3G1L A;  1UG2 A;  2WAE A;  2V4J C;  3EUK L;  1XX5 A;  2ID3 A;  3HOS A;  2BE5 F;  1P4W A;  2MH2 A;  2FSW A;  3I59 A;  4M3D A;  2BW3 A;  4UUS A;  3GXO A;  2K02 A;  4WK8 F;  3KPH A;  3PFI A;  4HW0 A;  1YW8 A;  4ETS A;  2F5D A;  1LKX A;  3ESW B;  3M1C A;  2L4M A;  2LVS A;  3JRD A;  3KZI C;  3U21 A;  1IUY A;  1BI1 A;  4QWQ A;  5E3L A;  2DPD A;  4D9J A;  5JI6 A;  2ZB9 A;  2HNH A;  3LSK A;  2A6H F;  3J81 Z;  3VWB A;  1YE9 A;  2ZCW A;  1VQK I;  1ZG3 A;  5EGO B;  2JQ7 A;  1I6H J;  3DV8 A;  5JFR A;  4FE7 A;  3ZQF A;  3W2A A;  1MBK A;  2L01 A;  2BVM A;  3M1E A;  1I3Q J;  4A3F J;  1J0R A;  2CW0 F;  1TC3 C;  1Z91 A;  1JUS A;  3S14 J;  4D1Q A;  3CCL I;  2H8W A;  2EFQ A;  4Y4R A;  1CF7 A;  2LC2 A;  2PI0 A;  1OKR A;  4A0X A;  1ETQ A;  2IS1 A;  1L0O C;  5D5W B;  1USS A;  4UB6 C;  2JPC A;  1TQI A;  1IG7 A;  2PJR B;  3OV8 A;  5EYR A;  3ZQG A;  1RET A;  4UY8 I;  4HX4 A;  3BOQ A;  2MC4 A;  5CYV A;  1FMV A;  3EQL F;  3A01 B;  4DZJ A;  1O3S A;  1IUF A;  2A3S A;  2GA2 A;  5HDK A;  3CCQ I;  2OBP A;  1SFK A;  2VJ4 A;  1DGR M;  2K86 A;  4RB0 A;  3KFW X;  2BY0 A;  5DCM B;  3OSG A;  2ZXW H;  1UB9 A;  3IWZ A;  3DLL F;  1SFX A;  2Y9Y A;  5J47 A;  5L3F A;  2X1E A;  1BL0 A;  2L9R A;  3OOU A;  2VON A;  3EYI A;  1FOX A;  4ZJZ A;  3CUQ B;  4B4C A;  2FF4 A;  2M7A A;  3V7C A;  2KPM A;  3ECO A;  2XKP A;  1X4P A;  5D5X B;  1HQC A;  5FLV A;  2FOW A;  3DEU A;  4YRV A;  2R5Y A;  3KYL A;  3BJ6 A;  3WGG A;  3WU1 B;  1K4S A;  3L2U A;  3U1D A;  1MW7 A;  3BJA A;  3WG7 H;  4RB1 A;  2R7R A;  1PUE E;  3CP2 A;  1Z3Y A;  3EUA A;  3OYN A;  1SMY F;  4KA4 A;  2IVM A;  4RMN A;  3SZP A;  4CHU A;  3OYG A;  2DOE A;  3GTP J;  1YG2 A;  2QUF A;  2YX7 A;  2LDU A;  4F7Z A;  2WY8 Q;  1A36 A;  1K6O A;  1IRG A;  1S5L C;  3E6M A;  1N25 A;  2HDD A;  2P7C B;  4BXF A;  2ZME A;  3LA7 A;  3W6J B;  2OZ6 A;  1T0F A;  3DKW A;  3K4M A;  1FP2 A;  3F8N A;  2JA8 J;  4LGW A;  1TTY A;  1Y1V J;  2OU2 A;  5B1A H;  2K7L A;  4I99 C;  3CDL A;  3PL8 A;  3CES A;  4CUG A;  4OMY A;  2UUZ A;  2B0L A;  5GAE J;  1YRN B;  3SEZ A;  2KDO A;  5A2Q Z;  1ON1 A;  4P96 A;  3K69 A;  5HDG A;  5FLX Z;  1K83 J;  2P0W A;  2VJI A;  1RUN A;  5KVR A;  5K5Q A;  2DFH A;  3F8M A;  5M3F J;  1YJW I;  3A03 A;  3QYB A;  3VOD A;  2DA4 A;  1S8N A;  1D5Y A;  2V1X A;  3ROU A;  2W00 A;  2WAD A;  2UV1 A;  1ZRC A;  2M3A A;  4UUV A;  3AG1 H;  3CJR B;  3LFU A;  3A2K A;  3MKZ A;  1FBQ A;  3C18 A;  1WCM J;  2EIK H;  2RQP A;  5E1W A;  4IHX A;  3N97 A;  2MLK A;  1S72 I;  1VQ9 I;  2HZD A;  3OYF A;  3FMR A;  2LKX A;  4Y52 J;  1FZP B;  3FK7 A;  1BBY A;  5LEJ A;  1FOW A;  3Q9V A;  2XSD C;  2IAI A;  3V42 A;  1U8B A;  3IAS 2;  4XQF A;  1A04 A;  1IN4 A;  4BJ6 C;  1KYW A;  3ML6 A;  3PQJ A;  2VLA A;  1ETK A;  1X1C A;  3RZD J;  4PFO A;  1U9N A;  4XLP F;  3MKY B;  2EA4 A;  2FD5 A;  1YS7 A;  3KP4 A;  3RYP A;  2H94 A;  1ZKG A;  2ESN A;  4GRI A;  3E3V A;  2EZL A;  5CKT A;  3A0B C;  5K5O A;  3BG3 A;  1TLH B;  4LOC A;  2GM4 A;  1PVE A;  3WE3 A;  4BEH A;  2FJ1 A;  1WI9 A;  5HOO A;  2YU3 A;  3I4N J;  4MO7 A;  4I01 A;  3R4K A;  2DDB A;  1FC3 A;  5J8C A;  3CC4 I;  1H89 C;  3TO9 A;  5H2F C;  2K9L A;  4V2G A;  5FO5 A;  3BR6 A;  4EM1 A;  3GFI A;  2HQA A;  1YQA A;  3DBR B;  2CUZ A;  4C3I J;  4X6A J;  1A35 A;  3K7A J;  3LSI A;  4NQW A;  1IRF A;  3GCM A;  4OAY A;  4EGY A;  2QSH X;  4ESJ A;  4LK1 F;  3IRQ A;  5FFZ A;  2PN6 A;  4EEF G;  1LJ9 A;  2CS3 A;  3RPU D;  3DEE A;  1KU9 A;  4CCL A;  3EUH A;  1I39 A;  5CPR B;  2QA4 I;  2EIJ H;  1B72 A;  4YFK F;  1J09 A;  3TBI A;  3CTA A;  1WH7 A;  4U88 A;  1MKM A;  5CVR A;  4OAZ A;  4KT5 C;  2M87 A;  5FGM A;  4AYB N;  2DOA A;  3IV5 A;  2HYF A;  3S8P A;  1B8I A;  1K6Y A;  2F4I A;  2ZJ2 A;  3F8F A;  3L2Q A;  4M9Z A;  2EQR A;  1IAW A;  1IZ1 A;  2FA5 A;  4HQM A;  4U7D A;  4BJ5 C;  1G3T A;  5J3L A;  1VZ0 A;  3CD6 I;  2V1N A;  4N0B A;  1SEU A;  3V8J A;  3BT9 A;  3VSL A;  1KQ8 A;  4L18 B;  2M4K A;  2WY7 Q;  4A0Z A;  5LRR A;  4Y13 A;  4QTR A;  2R7X A;  3HL2 A;  1K7A A;  1IRX A;  2R7S A;  5J6X A;  1K78 B;  3S15 J;  4NHJ A;  2DT6 A;  5BQT A;  4PK4 A;  4PUS A;  3ZCO A;  2E1C A;  1BM9 A;  4ENK A;  3GBG A;  4L5J A;  3WTS C;  2ZXH A;  3TDU C;  1JXS A;  2P5L C;  2ZJQ F;  2OC6 A;  2Z5U A;  4W1U A;  2RNG A;  2PMZ A;  4B1R A;  2V6E A;  3E6B A;  3GTK J;  3C2H A;  2YPR A;  4NBQ A;  4ZYE A;  1S9H A;  2JRT A;  4CCM A;  4A3I J;  5FFX A;  3QP5 A;  3H35 A;  3LOC A;  2ZKZ A;  3JRA A;  2NS0 A;  2O61 A;  3LAP A;  2X9D A;  3E7L A;  4MFD A;  3HKZ N;  4B09 A;  2AHQ A;  1TP4 A;  4HYE A;  5LHG A;  5ILU A;  1KU7 A;  3GTJ J;  2P6T A;  4C3H J;  3E6D A;  1KU3 A;  1MBE A;  3F72 A;  3KEO A;  2HKX A;  3CJN A;  1TWA J;  4GO1 A;  4XLN F;  3ZOB A;  1HLV A;  4HV5 A;  5IYB J;  3X2Q H;  1Z9C A;  1Q1H A;  1P92 A;  3HOY J;  2XIG A;  4KN7 X;  1OPC A;  3I9V 2;  5HS8 A;  2O7O A;  1TL8 A;  1O4X A;  1MBH A;  1G6N A;  4L9T A;  3JTG A;  4IQJ A;  5JHU A;  1MH4 A;  5EG0 A;  5KAI C;  2HEO A; 
#chains in the Genus database with same CATH homology
 3DQV C;  1FBS A;  2ZO4 A;  4M6Y A;  4Y15 A;  4EGZ A;  3K1P A;  4O3M A;  3ZMT A;  1BI3 A;  2DBB A;  1W5T A;  2Y75 A;  2CYY A;  3BP8 A;  3BJO A;  2E7X A;  3FXR A;  1L3L A;  3WOD F;  2D1V A;  2RGV A;  4S05 A;  2MD5 A;  4HBL A;  3QPT A;  2F5C A;  2Z9O A;  1BC7 C;  2GAU A;  3TOA A;  1O57 A;  3JW4 A;  1OMI A;  1R00 A;  4HDU A;  2XAG A;  3B73 A;  5L3D A;  4WCG A;  1KGS A;  4CDG A;  4A6D A;  3HUG A;  2M1B A;  3D5L A;  3QU3 A;  3ERE D;  2FQ3 A;  1YW9 A;  3F6O A;  3QU6 A;  1Z1D A;  2ELH A;  4Q47 A;  2XRO A;  1XSX A;  5FD5 A;  2OD5 A;  3ZN1 A;  5FD6 A;  3N4M A;  3EYY A;  4HX8 A;  3GFM A;  2A5Y B;  1H0M A;  4O5V A;  2NNN A;  4OIQ F;  4LB5 A;  2DPU A;  1T98 A;  2IT0 A;  4FT8 A;  1R1T A;  1J59 A;  4LG0 B;  4XRF A;  2L4A A;  3D0S A;  1BIB A;  1IN5 A;  3E97 A;  1W4M A;  2PJP A;  1V4R A;  2C6Y A;  2LKP A;  2NNY A;  1J5Y A;  1RUO A;  2XUB A;  1J2X A;  3L00 A;  5EEH A;  3I71 A;  3GF2 A;  3NQO A;  2V9V A;  2IA2 A;  5ICG A;  2V1U A;  2WV0 A;  1HKQ A;  4HZF A;  3BPX A;  3QRF F;  2IJL A;  1LEA A;  3U2R A;  1OYY A;  1Z6R A;  2IA0 A;  2VE8 A;  3DFG A;  4P55 A;  3IKT A;  5CVU A;  4Z2Y A;  2FMY A;  2QQ9 A;  3WGI A;  1O3T A;  2M5W A;  4ZYD A;  3M9A A;  2HFH A;  4GGG A;  2D2W A;  1PDN C;  5ILS A;  3JAM K;  5DCM A;  3T8R A;  3F6V A;  4B8X A;  3C7J A;  4I0B A;  3DPL C;  4FHT A;  2FE3 A;  3LQR A;  3LST A;  2ZFW A;  1E17 A;  1YIO A;  4UVC A;  2DQL A;  5CVJ A;  3CUQ A;  2H27 A;  2XV4 S;  1IN8 A;  4Q5S F;  2HS5 A;  4CGZ A;  2CG4 A;  4LK0 F;  3ECH A;  5DUI A;  4HV6 A;  3MAJ A;  1SD5 A;  3WTY C;  4JK1 X;  2DI3 A;  2UXX A;  2W57 A;  4ESB A;  3K9T A;  3DP7 A;  1RZ4 A;  1R1U A;  1TNS A;  1HBX G;  4IF4 A;  1WSU A;  1RI7 A;  2NYX A;  3J80 Z;  3NRV A;  4CO8 A;  5DV5 A;  2V79 A;  1ZG5 A;  3HRU A;  3FZV A;  3R60 A;  1Y0U A;  2GA1 A;  3KZY A;  4UXN A;  3NEU A;  1MGT A;  4WX9 A;  4H0E A;  2FBI A;  2VT2 A;  2IRF G;  3ISP A;  2ACJ A;  2ZXJ A;  4ON0 A;  5H6R A;  4U0Y A;  4HX7 A;  5LBQ A;  3TGN A;  1ZGJ A;  1BJA A;  1MDM B;  1ON2 A;  1IXR C;  2IA1 A;  2Y0M A;  1QZZ A;  1R22 A;  1U5T C;  4KMU X;  4G8X A;  4IPA A;  5LLQ A;  2UXN A;  3IRR A;  2OQR A;  2KRF A;  3BDD A;  1XSV A;  2ZNZ A;  3V7S A;  1F1Z A;  2J5P A;  4ZZD A;  1H9T A;  4OIO F;  2FXA A;  3IC7 A;  3FXU A;  1G3W A;  1I1G A;  2KIU A;  4UV8 A;  3CLO A;  3KP3 A;  3GZ6 A;  1B4A A;  2CWE A;  2HZT A;  3K1N A;  3T0Y A;  2EJR A;  3B02 A;  2QYO A;  5LGU A;  3KEQ A;  1TQP A;  2GZW A;  1TBX A;  4OMZ A;  1B1B A;  1FBU A;  4UVA A;  2PEX A;  3I0T A;  3MCZ A;  1FLI A;  3S2W A;  5A2Q K;  2KKO A;  2IP2 A;  5FLX K;  4G9Y A;  2EFN A;  1I6X A;  2MA3 A;  3E5X A;  2KJB A;  4XBF A;  5E1Z B;  4KDP A;  4M74 A;  2CSO A;  1BN5 A;  3GYH X;  4A12 A;  4L0Y B;  3BY6 A;  3KP6 A;  1XMA A;  1O7F A;  2RC4 A;  4KIC A;  1R23 A;  5IT9 K;  1K79 A;  4UVB A;  2PG4 A;  2RV8 A;  2YSR A;  3WGH A;  5ED4 A;  2Q0O A;  3KZZ A;  5D4R A;  1NHA A;  2FOK A;  2P6S A;  3HRM A;  1K78 A;  2VOP A;  5DYM A;  2ZNY A;  1XGO A;  2GXB A;  3GZ5 A;  4LLN A;  1O7L A;  1OYW A;  3SQN A;  3LA2 A;  4RGR A;  4HLY A;  4YFN F;  3KP7 A;  4A0Y A;  2OZU A;  2XHK A;  1T39 A;  1XN7 A;  1DP7 P;  3KLN A;  3IWF A;  1S29 A;  2GWR A;  2XRN A;  1FOK A;  3MWM A;  3LA3 A;  1F9N A;  1PP8 F;  3GVA A;  3RKX A;  4G7Z F;  4WF2 A;  3KET A;  3P7N A;  4HF1 A;  1XMK A;  1HSJ A;  3CO6 C;  2D45 A;  1J9I A;  1TNT A;  2VT3 A;  3TKY A;  3JSO A;  1HST A;  4FX0 A;  2VXZ A;  4S04 A;  1GVJ A;  1ZN2 A;  5L3C A;  5HLI A;  4RS8 A;  4EJV A;  5IT9 Z;  4PGH A;  5L3E A;  1LVA A;  3M8F A;  2W24 A;  3J7A O;  5DDG A;  1ZG1 A;  2BYV E;  3KP5 A;  3RJP A;  4EM2 A;  2LNB A;  2DK5 A;  4BHC A;  2OQG A;  2QEN A;  4ZYH A;  1EV7 A;  4KYW A;  3SXY A;  2M30 A;  2E1N A;  3RPU A;  2O8X A;  4BH9 A;  3WU0 A;  4L9V A;  2CGP A;  4UV9 A;  4KNY A;  2HTS A;  4HOB A;  2VBZ A;  3HTU A;  2G9W A;  1S6L A;  1FYK A;  4M9S A;  1SAX A;  4EJW A;  2EV5 A;  4LG0 A;  1S3J A;  1FSH A;  4A5M A;  1XCB A;  5H20 A;  5LHI A;  2O6G E;  4EJT A;  2ISY A;  1CF7 B;  4L0Z B;  1TW2 A;  2VC0 A;  2PMH A;  4N9H A;  4OIP F;  2QWW A;  3F21 A;  4KIF A;  3ZQ7 A;  5IT3 A;  5ICE A;  2D1H A;  3ZMU A;  3CUO A;  3C1D A;  5HS7 A;  4MEX F;  5ILV A;  4I0A A;  4Q48 A;  3ZPL A;  4MQ9 F;  1ZRF A;  1KU2 A;  3HSF A;  2XAS A;  1XDS A;  4A6E A;  4YFX F;  1TW3 A;  4G7O F;  3HYI A;  2QBY B;  4WXH A;  4OOI A;  1XDU A;  1FNN A;  2XAJ A;  4BYY A;  3HTS B;  4HF2 A;  2DLL A;  1VTN C;  5D8L B;  2J5O A;  5HLG A;  4ZH4 F;  1ZAO A;  2W84 A;  3JTH A;  4KFC A;  3WTT C;  3FMS A;  1IN7 A;  3QAH A;  3TO7 A;  3K2Z A;  4KN4 X;  2IW5 A;  3REO A;  3I53 A;  4M71 A;  2UZK A;  1XCV A;  5AON A;  3L7W A;  2F2E A;  1W7P A;  3M8E A;  1SFU A;  3O2P E;  4XSZ F;  4ASN A;  1JE8 A;  2FNP A;  2YR2 A;  2QLZ A;  1HKT A;  4R79 A;  5ERI A;  4AVP A;  5E17 F;  4O6J A;  3SFZ A;  5KK1 A;  2EWN A;  2L02 A;  2UWM A;  1DDN A;  2P4W A;  3FF5 A;  5D8K B;  1LDK B;  2PMU A;  2WC2 A;  2A6E F;  4IRG A;  3FXQ A;  3MZY A;  3IL2 A;  3ZMV A;  3H3U A;  3R0J A;  2MH9 A;  4RB3 C;  2ISZ A;  3H3Z A;  1QBJ A;  3E5Q A;  1MDM A;  4EM0 B;  1YW7 A;  2F5E A;  4KIG A;  3FHZ A;  2YX4 A;  2P5V A;  4RGS A;  3RIR A;  5F64 A;  1P2F A;  5K5R A;  4GYG A;  5LRS A;  5D6E A;  4U0V A;  2Y48 A;  3VEP A;  3M7G A;  3HHH A;  2X0L A;  3J80 K;  4ENM A;  2K27 A;  1SD4 A;  4HLX A;  1FSE A;  2DT5 A;  4YG2 F;  2BEO A;  4IHS A;  1QQI A;  4AIK A;  2PBI A;  1SFE A;  2BV6 A;  2XVC A;  2A68 F;  3FX3 A;  2XAF A;  1EH7 A;  4U7B A;  4EJO A;  2RDP A;  4R8H A;  3T5X A;  3MZH A;  2P8T A;  4LLL A;  2O3F A;  2VBW A;  1F4K A;  5LHH A;  1R1V A;  2R7D A;  5HLH A;  3ABU A;  3HRT A;  3RTR A;  2QM3 A;  4L9N A;  3BRO A;  2EFO A;  4MEY F;  1G3Y A;  4RAY A;  1RIO H;  1JGS A;  5CJ9 A;  1UFM A;  1XGS A;  4EJU A;  3E6C C;  4LFU A;  4Q4Z F;  4AWX B;  4D0P A;  1Z6T A;  2VBY A;  1R5H A;  1HW2 A;  1Z7U A;  5AIQ A;  2AXL A;  4UNO A;  2G7H A;  5DD4 A;  4DQ2 A;  1IXS B;  2FBH A;  2EFP A;  4RB2 C;  1IXC A;  4AD9 A;  1QZY A;  5K1Y A;  1ZLK A;  3W6K B;  2HR3 A;  1KQ0 A;  4DNC A;  2CO5 A;  1B9M A;  3L2C A;  1BC8 C;  2L3D A;  3Q9S A;  2XAH A;  3WE2 A;  5D4S A;  4JQF A;  3GUD A;  1DPR A;  3O6B B;  4RGX A;  3G3Z A;  4P9U A;  1QO0 D;  3WTX C;  3F23 A;  3CO7 C;  1YLF A;  2VBX A;  2IPQ X;  2VOD A;  5CLS A;  5D5U B;  4PGG A;  1U3E M;  2ZBK A;  2DO7 A;  1MJ9 A;  3EDP A;  3HSE A;  5CVV A;  2RN7 A;  3CDH A;  3DF8 A;  4FX4 A;  4CIC A;  1SD7 A;  3MFK A;  5HVQ C;  1J7K A;  1ZLJ A;  3RPQ A;  4OU0 A;  3K0L A;  1FY7 A;  4RAZ A;  1B9N A;  4ENN A;  1V3F A;  4JBA A;  1BI2 A;  1SD6 A;  2ESH A;  3ULQ B;  2JSC A;  2HQN A;  4LMY A;  3RDI A;  2QZ8 A;  1DUX C;  1BOA A;  2KIF A;  3K1M A;  1S7O A;  1ZGA A;  2E7W A;  5HDN A;  4G6Q A;  2OA4 A;  2QVO A;  1G3S A;  2DAO A;  4BHB A;  2X4H A;  3BPV A;  3FWE A;  4MHG A;  1DPU A;  3VOE A;  5HS9 A;  4BXU A;  4GCV A;  4P5O A;  1UCR A;  3WTU C;  4P9F A;  2JZY A;  2A69 F;  3KE2 A;  4A5N A;  3LFK A;  3PQK A;  4MGR A;  2EFW A;  3FMQ A;  1I5Z A;  1IF1 A;  1LDJ A;  2LF7 A;  4N9I A;  4ZZL A;  5E20 A;  1U8R A;  1AOY A;  1HKS A;  1PP7 U;  2QBY A;  4NB5 A;  3P9I A;  3WTZ A;  4CYD A;  1WWX A;  2ETH A;  1D8K A;  2A61 A;  1G4D A;  4EVI A;  3I54 A;  1QPM A;  3F22 A;  1FT9 A;  3AAF A;  1XGN A;  1C0W A;  4BAY A;  4WXD A;  3Q5F A;  2WTE A;  2RVC A;  1R36 A;  1O3R A;  3HSR A;  3R61 A;  3FM5 A;  1MZB A;  4BNC A;  2H6C A;  3QPH A;  2H6B A;  1LB2 A;  1WQ2 A;  3BWG A;  3IHU A;  4GYI A;  3DPT A;  1U5T B;  2CQK A;  2FRH A;  2O03 A;  5TRD A;  4PZJ A;  4M72 A;  3R0A A;  2HOE A;  3TO6 A;  4IRH A;  4I09 A;  1KQ9 A;  4LJZ F;  4HF0 A;  1YYV A;  1ZYR F;  5TJJ A;  3GLX A;  5BPD A;  3TDZ C;  3QP6 A;  1HW5 A;  3RI4 A;  1P4A A;  2HDC A;  2TDX A;  1STZ A;  3E5U A;  1H9G A;  3MQ0 A;  1IW7 F;  1B6A A;  1QNT A;  2COM A;  2JPB A;  2DW4 A;  3MEX A;  4M9X A;  1EH8 A;  4HDV A;  3I59 B;  3C3W A;  4BHP A;  4KUM A;  4G7H F;  1ULY A;  1ODD A;  3RKY A;  1OYI A;  1FPQ A;  1T38 A;  3LWF A;  3T1B A;  4AIJ A;  2R3S A;  4YII A;  1UHW A;  5DEQ A;  2QQA A;  1R58 A;  2EB7 A;  1FYL A;  1XSD A;  1SMT A;  1B59 A;  2GIV A;  3RKW A;  2RNJ A;  4CZZ A;  1IN6 A;  1LEB A;  3IKV A;  4L5I A;  3DXJ F;  5DD8 A;  5AIP A;  1HXD A;  3JSP A;  2STW A;  4R1H A;  2V6C A;  4MQV A;  2JTV A;  1Z05 A;  4EQQ A;  1ONV A;  4Y17 A;  4UHT A;  2DU9 A;  2FEZ A;  3F8C A;  3L09 A;  4PCQ A;  1XGM A;  2FNA A;  4CXF A;  1U78 A;  4IXA A;  4MNU A;  1FWZ A;  1LDD A;  2L54 A;  1EH6 A;  5E1X A;  1O3Q A;  4MTE A;  4HAM A;  3WTW C;  5ICC A;  2FU4 A;  2HYG D;  2GXG A;  3P9C A;  3GX4 X;  2STT A;  2AS5 F;  4LLG F;  3OOP A;  2G7U A;  2DTR A;  2W85 A;  2F5F A;  3T8T A;  1WRJ A;  3WG9 A;  2EK5 A;  2Z3Y A;  1BI0 A;  3EET A;  2VOO A;  2H09 A;  5E18 F;  2RKH A;  2HKO A;  3U9G A;  1KYZ A;  2MC3 A;  1FX7 A;  3COA C;  1FP1 D;  2ZME B;  1GXQ A;  4HQE A;  4G6D A;  2JT1 A;  1T6S A;  4IRI A;  2EA2 A;  5F1R A;  3V4G A;  3ZMS A;  3KCC A;  2PQ8 A;  5L3G A;  1F5T A;  4IVN A;  5F6F A;  1LNW A;  2KIM A;  1YFH A;  1P6R A;  2K4J A;  1XB4 A;  3GW2 A;  2W25 A;  1JHF A;  1UHM A;  2KJC A;  2HQR A;  1MJA A;  5BPI A;  4IHT A;  3SZT A;  1WKM A;  2M8E A;  2XKO A;  1REP C;  2WWY A;  4XSX F;  3I4P A;  1D8J A;  2DK8 A;  1S7A A;  1W7P D;  2HTJ A;  4BQA A;  1CGP A;  3I5U A;  1XD7 A;  2VC1 A;  5CVI A;  1R5G A;  4M6X A;  5L3B A;  3BZ6 A;  3VB2 A;  1MJB A;  3GFJ A;  1ZH5 A;  4K2E A;  3WTV C;  5BOX A;  4GXO A;  1ZRD A;  3RYR A;  4LB6 B;  1ZRE A;  2FML A;  4EMS A;  2LF8 A;  1HW1 A;  5JVT A;  3FM3 A;  5H6Q A;  2PFB A;  4AIH A;  5DCF A;  5LGT A;  1MD0 A;  4TV7 A;  1I27 A;  1ZAR A;  4LD5 A;  3I58 A;  5LEK A;  4WWC A;  1TQM A;  1QGP A;  3R6S A;  5D6F A;  3KLO A;  1U2W A;  6PAX A;  4MTD A;  4I2O A;  3ZN0 A;  4YIF A;  1ZHF A;  3V7R A;  4KMF A;  4I98 B;  3ELK A;  4KIB A;  5BS6 A;  1GXP A;  1KA8 A;  2NRA C;  1T2K A;  2VE9 A;  3QOP A;  3ZMZ A;  3SHF A;  2LSO A;  3HOT A;  2Z99 A;  3G73 A;  1U6G A;  2BBY A;  5E8I A;  2EV0 A;  3VFZ A;  5DUK A;  5LGN A;  4HA8 A;  3HIF A;  2NAZ A;  3I64 A;  2HGC A;  3ZP5 A;  2P7V B;  1X3U A;  2BGC A;  3KP2 A;  1D5V A;  4OIN F;  5EEG A;  2MLG A;  5E8G A;  2EV6 A;  4IJA A;  2Q8K A;  3GWZ A;  3HHG A;  4E70 A;  2XAQ A;  1FYM A;  1UST A;  3L9F A;  5JR3 A;  3HRS A;  2CFX A;  1R7J A;  4G94 A;  4M73 A;  3ZMD A;  3ABT A;  2GQQ A;  3TOB A;  4EV0 A;  4ZYG A;  1LQ1 A;  1BIA A;  3O3K A;  2O0Y A;  4I7H A;  4QLC U;  2QQB A;  1P4X A;  3CUQ C;  4OIR F;  4L9J A;  1D3Y A;  3F8B A;  1YS6 A;  2ADU A;  4ESF A;  4I02 A;  5ICF A;  1W7P B;  1J75 A;  1YO5 C;  3V8K A;  3GO5 A;  5FB2 A;  3J81 K;  2PLY A;  2M45 A;  1GHC A;  4RGU A;  2FBK A;  1I1S A;  4ENJ A;  5BMZ A;  4A2U A;  2R7F A;  3GEZ A;  3TQN A;  3GFL A;  2HWV A;  3LAJ A;  2K4B A;  1RNL A;  1AWC A;  3P9K A;  2XGX A;  1JHH A;  3LQQ A;  1YTY A;  1U5T A;  5D5V B;  2Q2E A;  4U0W A;  2Z33 A;  1W5S A;  2P5K A;  3F3X A;  5J8F A;  4PDK A;  3JAM Z;  3H92 A;  2A07 F;  2MBF A;  1E2X A;  2DFI A;  2DQR A;  2VN2 A;  2V1D A;  4WXC A;  3V8L A;  2OAZ A;  1OR7 A;  3HOS A;  2BE5 F;  1P4W A;  2MH2 A;  2FSW A;  3I59 A;  3GXO A;  2K02 A;  4WK8 F;  3PFI A;  4HW0 A;  1YW8 A;  4ETS A;  2F5D A;  2L4M A;  1IUY A;  1BI1 A;  4QWQ A;  2DPD A;  5JI6 A;  3J81 Z;  2A6H F;  2ZCW A;  1ZG3 A;  3DV8 A;  5JFR A;  2L01 A;  3M1E A;  1J0R A;  2CW0 F;  1Z91 A;  2EFQ A;  1CF7 A;  2PI0 A;  1OKR A;  4A0X A;  1L0O C;  5D5W B;  1USS A;  2JPC A;  1TQI A;  3OV8 A;  4HX4 A;  3BOQ A;  5CYV A;  3EQL F;  1O3S A;  5HDK A;  2A3S A;  2GA2 A;  2OBP A;  2K86 A;  4RB0 A;  3KFW X;  5DCM B;  1UB9 A;  3IWZ A;  1SFX A;  5L3F A;  2VON A;  3EYI A;  3CUQ B;  2FF4 A;  3V7C A;  3ECO A;  2XKP A;  5D5X B;  1HQC A;  3DEU A;  3BJ6 A;  3WGG A;  3WU1 B;  3U1D A;  3BJA A;  4RB1 A;  1PUE E;  4KA4 A;  1SMY F;  2IVM A;  3SZP A;  4CHU A;  1YG2 A;  2QUF A;  2YX7 A;  2LDU A;  4F7Z A;  1K6O A;  1IRG A;  3E6M A;  2P7C B;  2ZME A;  3LA7 A;  3W6J B;  2OZ6 A;  1T0F A;  3DKW A;  1FP2 A;  3F8N A;  4LGW A;  1TTY A;  2OU2 A;  2K7L A;  4OMY A;  2B0L A;  5A2Q Z;  1ON1 A;  4P96 A;  3K69 A;  5HDG A;  5FLX Z;  1RUN A;  5KVR A;  5K5Q A;  3F8M A;  3VOD A;  1S8N A;  2V1X A;  3ROU A;  1ZRC A;  4UUV A;  1FBQ A;  3C18 A;  2RQP A;  5E1W A;  3N97 A;  2MLK A;  3FMR A;  1FZP B;  1BBY A;  5LEJ A;  3Q9V A;  1IN4 A;  1A04 A;  1KYW A;  3ML6 A;  3PQJ A;  4XLP F;  2EA4 A;  1YS7 A;  3KP4 A;  3RYP A;  2H94 A;  2ESN A;  3E3V A;  5K5O A;  1TLH B;  3WE3 A;  1WI9 A;  5HOO A;  2YU3 A;  4I01 A;  3R4K A;  5J8C A;  1FC3 A;  3TO9 A;  5FO5 A;  4EM1 A;  3GFI A;  1YQA A;  4NQW A;  1IRF A;  4EGY A;  4ESJ A;  4LK1 F;  3IRQ A;  5FFZ A;  2PN6 A;  1LJ9 A;  1KU9 A;  3EUH A;  4YFK F;  3CTA A;  4U88 A;  1MKM A;  5CVR A;  4KT5 C;  2M87 A;  5FGM A;  2HYF A;  2ZJ2 A;  3F8F A;  4M9Z A;  1IAW A;  1IZ1 A;  2FA5 A;  4HQM A;  4U7D A;  1G3T A;  4N0B A;  3V8J A;  1KQ8 A;  4L18 B;  4A0Z A;  5LRR A;  4Y13 A;  1K7A A;  5J6X A;  1K78 B;  4NHJ A;  5BQT A;  2E1C A;  1BM9 A;  4ENK A;  4L5J A;  3WTS C;  1JXS A;  3TDU C;  2P5L C;  2Z5U A;  3E6B A;  2YPR A;  4ZYE A;  2JRT A;  5FFX A;  3QP5 A;  2ZKZ A;  2NS0 A;  2O61 A;  3LAP A;  4B09 A;  4HYE A;  5LHG A;  5ILU A;  1KU7 A;  2P6T A;  3E6D A;  1KU3 A;  3F72 A;  3KEO A;  2HKX A;  3CJN A;  4GO1 A;  4XLN F;  4HV5 A;  1Z9C A;  1Q1H A;  1P92 A;  2XIG A;  4KN7 X;  1OPC A;  5HS8 A;  4L9T A;  1G6N A;  3JTG A;  5JHU A;  2HEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...