2DAOA

Solution structure of ets domain transcriptional factor etv6 protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
118
structure length
118
Chain Sequence
b'GSSGSSGCRLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFMKTPDEIMSGRTDRLEHLESQELSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription factor ETV6
publication title Solution structure of ETS domain Transcriptional factor ETV6 protein
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 20
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2daoA01
2A3SA 2QYOA 3LFKA 1USTA 1ON1A 4LLLA 1ZRFA 2WC2A 2XRNA 2IP2A 2A6HF 3WTVC 4GYGA 4G94A 2JZYA 2MC3A 3BWGA 4EGYA 1PDNC 4PGGA 2F5EA 4IRGA 1U6GA 1MD0A 4LGWA 3TDUC 5A2QK 3J81K 1IRFA 1TQPA 5ILUA 3K1PA 3IRQA 3WGIA 1JHFA 2K27A 3PQKA 2HFHA 4HQMA 2ELHA 3BOQA 2D1HA 2W85A 2FEZA 4CXFA 1SD7A 4HZFA 2YU3A 4RGRA 4RB0A 2MLGA 5ICFA 5FLXK 4RAZA 2PBIA 4GGGA 4M73A 3HOTA 3K0LA 4KYWA 4Q5SF 3WTSC 2QQ9A 3RPQA 1ZG3A 4PZJA 5F1RA 2XKPA 5CVIA 4KMFA 3H3UA 1FY7A 2IA0A 4OU0A 3P9CA 2XVCA 1GXPA 1O7FA 4BNCA 1P4AA 1LJ9A 4LMYA 4OIRF 1XN7A 3KP7A 3BY6A 5E1XA 1R1TA 3ABUA 1S29A 2IVMA 3E97A 4LB5A 3V4GA 5HLIA 2EV6A 4P9UA 1Z1DA 3TQNA 1IZ1A 5ICGA 2RKHA 3KCCA 1R58A 1YG2A 3RYRA 2Z9OA 5D5WB 2W25A 1UHMA 5CVJA 1QNTA 1G6NA 3NEUA 4A12A 1F9NA 4CO8A 2J5OA 4KA4A 3DPLC 5DCFA 2EA4A 3N4MA 4M9SA 4A0ZA 3GYHX 1STZA 2HTSA 4Y15A 3REOA 3E5QA 2G7HA 1OYWA 1XGMA 2VODA 3KEQA 3BJAA 4IRIA 3U9GA 2YR2A 3LA7A 3CUQC 1ZRCA 2DFIA 1TLHB 1D3YA 3F6OA 5HS9A 4EJTA 4WF2A 4EM0B 2EK5A 1TW2A 3GXOA 2PLYA 2FOKA 2JRTA 2FNPA 2RDPA 4MTDA 1B59A 1SFEA 2GA2A 5DDGA 1G3SA 2PN6A 3F8BA 4Z2YA 1TQIA 3L00A 4L9JA 5D8LB 3MEXA 1R00A 4R79A 3E6MA 1P92A 1KYWA 4I0BA 3BROA 1T98A 2CFXA 2DO7A 1ZH5A 2HTJA 3WU0A 3BZ6A 3WU1B 1ODDA 1F1ZA 4I02A 2G9WA 2P5LC 2F5CA 2E1CA 3T1BA 4O5VA 1YO5C 4ESJA 5KK1A 1JGSA 5J8CA 1WSUA 4ON0A 3R0AA 1FNNA 5J8FA 3NRVA 5LEJA 4UNOA 2NNNA 5FFXA 4AIKA 3TO9A 1T6SA 1XDSA 2UZKA 3R60A 2EB7A 1IAWA 1FP2A 4PDKA 1Z6TA 4GCVA 4YFNF 3LA2A 5E18F 1IXSB 3HRTA 2VBWA 1LQ1A 3F8MA 4HX4A 4IXAA 2J5PA 4QWQA 3HIFA 2Z33A 5DD4A 5ILSA 1EH6A 2FXAA 3TOAA 3KP3A 1IN4A 1U8RA 3F22A 3IKTA 3TDZC 1V4RA 2IPQX 2D45A 1XMAA 4S04A 2EV5A 3V7RA 3J80Z 1XDUA 2B0LA 2EJRA 5EEGA 4BHCA 5LLQA 1R22A 2VC0A 4HW0A 1C0WA 3FXRA 1SD5A 2NS0A 2EFPA 4JQFA 2KKOA 2ZKZA 2C6YA 1SD6A 4WX9A 3QU6A 4EM1A 2CYYA 1J75A 2VXZA 3C1DA 3V7CA 2OAZA 4MNUA 4HX8A 3C7JA 3R6SA 3DFGA 4KIBA 6PAXA 4U88A 3K1MA 2FBIA 2O3FA 5E8IA 1IN8A 3D5LA 2JT1A 2LF8A 5H6RA 1U5TA 5LEKA 4WWCA 3I0TA 3ERED 1XMKA 5DCMA 2A69F 2LDUA 4ZZLA 2QBYB 3SQNA 3HHGA 4YG2F 4L18B 3OV8A 2XIGA 1MKMA 2EFQA 3KP6A 2LF7A 3VOEA 1J0RA 2QWWA 1T38A 2PQ8A 1K7AA 4RAYA 2DU9A 2XKOA 4L5IA 2RV8A 4GO1A 4LG0A 4N9IA 3I71A 3RKXA 2KJCA 2L54A 3R61A 1FT9A 3KP5A 4RGXA 2RNJA 2DBBA 4CYDA 2X0LA 1UHWA 3ECOA 2NYXA 1BI1A 2ZNZA 1ZGAA 1P6RA 3I59A 3P7NA 3O3KA 4OIQF 3S2WA 4AD9A 3EYYA 4B8XA 3KZZA 4ENJA 2K7LA 3V8LA 2FBHA 2FSWA 2ZO4A 1J2XA 3F8CA 5BS6A 2W57A 1XSVA 4QLCU 2HEOA 5H20A 5L3DA 2HOEA 4AIJA 1CGPA 1D5VA 2VT3A 1UFMA 1P4WA 4RGUA 2HQNA 2XGXA 5ED4A 2OQGA 2UWMA 1MDMA 5LRRA 5CLSA 3QAHA 1KYZA 4A5NA 4RB2C 2XAJA 4XLNF 3JTHA 2A07F 2COMA 3GW2A 3VB2A 3ULQB 4MQ9F 4R8HA 4HAMA 1DUXC 2VE9A 1D8KA 1G3TA 4LFUA 5BOXA 3M8FA 3P9KA 4M72A 2UXXA 3KEOA 3TO6A 1E2XA 4I98B 2MLKA 3IHUA 1MJ9A 3GWZA 4OMYA 3MZYA 5A2QZ 1R7JA 3J81Z 1O57A 3EYIA 4WXDA 3GLXA 3JW4A 1DDNA 1L3LA 4DNCA 2MH9A 3CUQA 4ZYGA 4XBFA 2F2EA 2R7DA 5E8GA 1K78A 1OYYA 3EDPA 1IUYA 5CJ9A 4O6JA 1WQ2A 4RB3C 5FLXZ 3HHHA 4CZZA 3H3ZA 4HDVA 2FMYA 2OU2A 3Q9VA 3QRFF 5ERIA 3JSPA 5HDKA 1MJAA 3KE2A 4P9FA 1U5TB 1FSHA 3DPTA 4YFXF 3DXJF 4A0XA 3KFWX 2PMHA 5L3GA 3V7SA 3I53A 5D6FA 1KQ8A 2ESNA 1W7PB 4K2EA 1BN5A 3RTRA 4BYYA 2ZMEA 2QM3A 2GIVA 4I01A 4M6XA 3IL2A 1YW7A 2CO5A 2PJPA 2VBZA 3IRRA 3EUHA 4IHSA 4KUMA 2W84A 5HOOA 2D1VA 2E1NA 3MWMA 2DW4A 4LG0B 1TW3A 2EFNA 5AIPA 1FYMA 1W5SA 3L09A 3BDDA 1BC8C 1ZARA 3GX4X 1KQ9A 2BGCA 1YLFA 2MH2A 2PFBA 1ULYA 4KMUX 1I5ZA 2O6GE 3HSRA 3IKVA 5BPDA 3WTUC 2E7XA 1O3QA 5FD6A 2L4MA 2RVCA 3I59B 4FX0A 3FM5A 5L3EA 2FRHA 1R1UA 5LBQA 3E6CC 2GXBA 2YX4A 4NHJA 5ICCA 3CTAA 2OA4A 1RIOH 3M1EA 1RI7A 2OZUA 1K79A 2P4WA 3KLNA 2FNAA 1R1VA 1OR7A 5AIQA 1BI2A 3W6JB 1A04A 2JPBA 5ILVA 5K5QA 4HV5A 2CWEA 5CVUA 5D4SA 4ESBA 4G7ZF 2VN2A 1QO0D 1MDMB 4MEXF 4A6DA 1V3FA 4FX4A 1XCVA 3I58A 3MQ0A 5DUKA 4LD5A 5DUIA 3KZYA 1IXRC 3BJ6A 3NQOA 2FU4A 2V1XA 1KU7A 4L5JA 2RQPA 2IRFG 1QPMA 3QPHA 4LK1F 1TNTA 3E6DA 3LQRA 1MZBA 2ADUA 1ZLKA 2GZWA 5E1WA 1IN7A 1S7OA 4WXHA 3WGHA 2NRAC 1OPCA 5JI6A 3ZN1A 4Q48A 3N97A 2HYGD 1R23A 3T5XA 1R5HA 3CO6C 1DP7P 1WWXA 1TBXA 2H6CA 4G9YA 2BYVE 2VC1A 4IJAA 1T0FA 5LHIA 1HXDA 3O2PE 4HF2A 4EJUA 1BM9A 2XAFA 2GXGA 1AWCA 4HLYA 3CUQB 1AOYA 4ENKA 3KLOA 2PG4A 4CDGA 1K78B 1HKSA 3JTGA 1XGSA 5BPIA 4L9TA 2ZCWA 1P4XA 1W5TA 1SAXA 4KN7X 2OQRA 3MAJA 3JAMK 3HSEA 2BBYA 4EJOA 2OZ6A 1O3SA 1FYKA 3RKYA 1ZREA 1HSJA 1E17A 4LLGF 2P7CB 3WG9A 4A2UA 2MBFA 3K2ZA 2Q0OA 4KN4X 2IA2A 1FC3A 4YIIA 4Y17A 1NHAA 2YSRA 5D6EA 4U0WA 1XSXA 1HW5A 3CO7C 4G6DA 4KIFA 2ZMEB 3WE2A 5HDGA 1O7LA 3IC7A 2V79A 2ACJA 1TTYA 5FD5A 2KIFA 4L9NA 5F6FA 3ECHA 2Y48A 1L0OC 3QPTA 5JR3A 5D4RA 1BJAA 2WV0A 3ML6A 4L0YB 2IJLA 4EJWA 3MZHA 1J5YA 5LGTA 3M8EA 2QQAA 3E5UA 2Y0MA 1FBSA 1XGOA 1O3TA 2STWA 4NB5A 4GXOA 2O03A 1QGPA 4ZH4F 4G7OF 1OKRA 3M9AA 1GHCA 1KU9A 3GFJA 1XGNA 4OOIA 4B09A 3ISPA 2PI0A 5HVQC 3HYIA 4I0AA 3I64A 2YPRA 3H92A 3T8RA 4UXNA 1JHHA 4ZYHA 2PEXA 2CG4A 3RKWA 5DV5A 5DEQA 3GVAA 2EWNA 2HWVA 1DPRA 1YYVA 2M8EA 3E6BA 4P55A 1CF7A 4N0BA 3VODA 1G3YA 4I2OA 4HLXA 3TGNA 1DPUA 3D0SA 4IVNA 4HOBA 5L3FA 2WWYA 5IT9K 5D8KB 5FFZA 5CYVA 2ISZA 3U1DA 1HKQA 1HW2A 3PFIA 2Q2EA 4AIHA 2R7FA 4P5OA 4R1HA 4HV6A 1I1SA 1ONVA 2HKXA 3RYPA 3SXYA 3COAC 3ZP5A 1H0MA 4ZYEA 3C18A 4IPAA 3LAJA 2XHKA 4U0YA 2ZBKA 3FX3A 2CQKA 2ISYA 1SFXA 1BIBA 4I7HA 1FOKA 3RPUA 2QQBA 1QZYA 1MJBA 3BP8A 2P6SA 2O61A 1B9MA 2NNYA 3ZMDA 3KETA 1TNSA 2QVOA 4HA8A 4JBAA 1HQCA 3F6VA 5DYMA 4UUVA 2BV6A 2GQQA 3E5XA 2VOOA 4WXCA 5LRSA 2HGCA 2P6TA 3M7GA 2QENA 3QU3A 2VBYA 3DV8A 3LWFA 1PP8F 1FBUA 1B9NA 1ZAOA 1LB2A 2K02A 5CVVA 1BI0A 4BH9A 1J59A 1LDDA 1ZRDA 4Q47A 3ZMSA 5HS8A 3DF8A 5ICEA 2JTVA 4FHTA 2FF4A 1EV7A 4BAYA 4OINF 2ETHA 1LDKB 4OIPF 1HBXG 4KICA 3LQQA 4UVAA 4NQWA 1U3EM 3WTYC 1H9GA 4YFKF 2EV0A 2Q8KA 4PGHA 1ZG5A 1YTYA 3F8FA 3MCZA 5EEHA 1ZYRF 3SZPA 1HW1A 2STTA 5L3BA 3BJOA 2DAOA 3RI4A 3QP6A 3FMSA 3B02A 4UV9A 4TV7A 3GFMA 3J7AO 3I5UA 1OYIA 1FX7A 1G4DA 2YX7A 4XLPF 1O3RA 2FBKA 3CUOA 1YW9A 1PUEE 4Y13A 1WI9A 1FZPB 2FQ3A 3GFIA 1EH7A 5LGNA 4EVIA 3ZMVA 3Q9SA 1TQMA 2Y75A 2DLLA 1CF7B 1IRGA 1FPQA 2FA5A 2P8TA 5E17F 3TOBA 1IW7F 3VEPA 1EH8A 2LSOA 3FMRA 2VOPA 1XSDA 1S6LA 2X4HA 3P9IA 3F23A 2H27A 3F72A 4A6EA 4LLNA 3T8TA 2Z99A 3KP4A 5DCMB 3SFZA 2M87A 1T2KA 2KRFA 4BHBA 4MTEA 3ZN0A 1RUNA 2KJBA 5LGUA 2VT2A 1UCRA 1SFUA 1BI3A 3T0YA 2V1DA 4XSZF 2DI3A 2D2WA 2QLZA 2PMUA 1OMIA 1KU3A 4EV0A 5J6XA 1XD7A 4H0EA 3AAFA 3IWFA 3F21A 4UV8A 1ZN2A 2V1UA 3WODF 3FM3A 2P5KA 2M30A 1LVAA 3V8JA 5HLHA 1I27A 2G7UA 1YS7A 4CICA 4M9ZA 2XAGA 4BQAA 2OBPA 2Z3YA 1GXQA 1KA8A 4LJZF 4KFCA 1S7AA 5BQTA 1W7PD 3LAPA 2GAUA 2JPCA 2F5FA 1XB4A 4HBLA 1D8JA 3GFLA 3DEUA 2H94A 1JXSA 2Z5UA 1IN6A 3ELKA 4G8XA 3ZMZA 1FP1D 1ZHFA 4DQ2A 2L4AA 5IT3A 2FE3A 3K1NA 3RIRA 1QQIA 1B1BA 3JAMZ 5KVRA 1GVJA 1VTNC 2NAZA 2DPDA 2VBXA 5E1ZB 5D5VB 2F5DA 2OD5A 4M71A 4PCQA 3JSOA 2CW0F 2ZJ2A 1FLIA 2HDCA 2KIMA 3WTZA 3WTWC 1P2FA 5TRDA 3ZMUA 1LNWA 3F3XA 1QBJA 2JSCA 3WTTC 4HDUA 2QBYA 3G3ZA 3EETA 1Q1HA 1PP7U 1YS6A 4BXUA 2L3DA 3B73A 1Z05A 4O3MA 2H09A 3FXUA 3OOPA 3L7WA 2HYFA 4L0ZB 4KT5C 5LHGA 3Q5FA 3QP5A 3K9TA 1BOAA 1J9IA 1J7KA 4UVCA 1X3UA 5D5XB 3DKWA 2CSOA 5HLGA 5HDNA 4ZZDA 1RZ4A 4EM2A 1Y0UA 5HS7A 3E3VA 2P7VB 2K86A 2DPUA 1S8NA 4EMSA 2H6BA 3ROUA 2RN7A 4Q4ZF 3R4KA 2O0YA 2E7WA 5K5OA 1YIOA 2ZNYA 4ZYDA 3SZTA 2BE5F 1T39A 4YIFA 2HR3A 2HKOA 5AONA 1IN5A 2L02A 5JHUA 1B4AA 3GUDA 3ABTA 2XASA 3L9FA 5CVRA 4MHGA 2DT5A 1XCBA 3RDIA 1BBYA 5K1YA 4MQVA 2WTEA 1W4MA 1S3JA 3GZ5A 2CGPA 5IT9Z 2XV4S 3SHFA 2EA2A 3WTXC 1WKMA 4AWXB 4IF4A 1JE8A 1HKTA 2V9VA 2HS5A 5JFRA 4OIOF 3TO7A 1LEAA 4XSXF 5BMZA 2ZFWA 1RNLA 4RGSA 2ZXJA 4U7BA 4G6QA 2LNBA 4M6YA 1I1GA 2M5WA 5K5RA 1LDJA 1ZLJA 1ZG1A 3G73A 2P5VA 4WCGA 4WK8F 4HQEA 2GA1A 1FYLA 1ON2A 2BEOA 2DK5A 5LHHA 2A5YB 1F4KA 2A68F 3BPVA 4EQQA 2EFWA 2AS5F 4MGRA 3L2CA 4ETSA 1UB9A 3K69A 3U2RA 3MFKA 3EQLF 4XRFA 2XAHA 4ENMA 4JK1X 1SD4A 3C3WA 3GZ6A 1Z6RA 1IXCA 2QUFA 3HUGA 4CHUA 3CJNA 1FSEA 4IHTA 4FT8A 4M74A 2DQRA 3CLOA 1H9TA 4RS8A 1G3WA 3HTUA 3ZPLA 1WRJA 1SMYF 1KQ0A 3LA3A 3J80K 4ENNA 3TKYA 4HF1A 1W7PA 2RGVA 3WGGA 3ZQ7A 3RJPA 1Z7UA 2RC4A 3ZMTA 2VE8A 2O8XA 4E70A 1IF1A 4RB1A 3WE3A 2HZTA 4KDPA 1MGTA 1RUOA 1Z9CA 2R3SA 4U7DA 4G7HF 1LEBA 3W6KB 2XAQA 2DQLA 5E20A 1SMTA 1I6XA 1HSTA 2IW5A 5F64A 4CGZA 2A6EF 2W24A 2IT0A 2QZ8A 4KNYA 3FXQA 2HQRA 1R36A 2DK8A 5L3CA 2TDXA 3FF5A 2ESHA 1B6AA 2XUBA 3FWEA 3HRSA 2MA3A 3HRMA 3O6BB 4LB6B 1KGSA 4U0VA 2MD5A 3QOPA 2LKPA 4OMZA 4A0YA 4ASNA 4A5MA 4ESFA 4EGZA 3HOSA 3FMQA 1REPC 3DQVC 4UHTA 1YFHA 3GEZA 4EJVA 5H6QA 4HYEA 4GYIA 3V8KA 4F7ZA 3CDHA 3IWZA 2K4JA 5FO5A 2DTRA 4UVBA 2K4BA 3R0JA 1KU2A 4BHPA 3DP7A 4HF0A 4LK0F 1YW8A 3I54A 2XROA 2L01A 1U2WA 1K6OA 4AVPA 2KIUA 3GO5A 2GWRA 4HX7A 2VONA 2V6CA 2EFOA 5D5UB 3GF2A 5JVTA 4M9XA 1FBQA 3BPXA 3PQJA 4L9VA 1U78A 1USSA 4I09A 2M1BA 4D0PA 3F8NA 4P96A 5TJJA 2IA1A 1Z91A 1F5TA 3FHZA 3VFZA 2UXNA 1ZGJA 2AXLA 3FZVA 3I4PA 4IRHA 1QZZA 2FMLA 4S05A 1FWZA 1U5TC 3HTSB 1YQAA 1BIAA 2M45A 4N9HA 5FB2A 1R5GA 5DD8A 4KIGA 3KP2A 4MEYF 5FGMA 3HRUA 1BC7C 3HSFA 2A61A 3LSTA
chains in the Genus database with same CATH superfamily
1BR4A 2A3SA 2LOOA 2QYOA 3S1MJ 2NS8A 3LFKA 2O9LA 1Q1VA 1USTA 4E6KG 2WBMA 2NVXJ 5FROA 3J7AY 1ON1A 4LLLA 1NG6A 2DA3A 3A0HC 3I3LA 1ZRFA 4E7KA 2WC2A 1LE8A 1JKOC 2XRNA 2IP2A 2A6HF 4M3EA 5C4XJ 3WTVC 4GFBA 1GDTA 2M7BA 1POGA 4GYGA 4G94A 2JUGA 2JZYA 5E3MA 2MC3A 3BWGA 2HVQA 4EGYA 1PDNC 4PGGA 3OYAA 2F5EA 4IRGA 5F0HA 1U6GA 4XN0A 2VXDA 1MD0A 4LGWA 3TDUC 5A2QK 3J81K 5CQGA 1T33A 1IRFA 1TQPA 2DA4A 2H1LA 3W3CA 5ILUA 2XSJC 3K1PA 3IRQA 1ORKA 3WGIA 1JHFA 3BTLA 2K27A 2GOXB 2WAQN 3KEYA 3PQKA 2HFHA 3H3VK 1F43A 4HQMA 2ELHA 2JQ7A 3BOQA 4RAGA 2D1HA 2W85A 3H5AA 5BNGA 3S8PA 2FEZA 3RZDJ 4CXFA 1SD7A 2OC6A 4HZFA 2DDAA 2YUSA 2ZSHB 4MO7A 2YU3A 4RGRA 4RB0A 2MLGA 5ICFA 2BY0A 5FLXK 4RAZA 2PBIA 3HBLA 4GGGA 4M73A 2I5UA 3HOTA 4RM3A 4C2UA 3K0LA 4KYWA 4Q5SF 3K4CA 3WTSC 1WJDA 2XB0X 2JA7J 2N8GA 2QQ9A 3RPQA 1ZG3A 2HQ5A 3WHCA 4PZJA 5F1RA 1XPXA 2LTPA 2V7FA 2W4SA 2XKPA 4B44A 5CVIA 4KMFA 3H3UA 1FY7A 2QCOA 2IA0A 4G12A 3CESA 1YITI 2CV0A 2CMPA 2LREA 4C9YA 4CUGA 4OU0A 2Y31A 3P9CA 3DKYA 2XVCA 1GXPA 1O7FA 5J4VA 1JKQC 4BNCA 1P4AA 1LJ9A 4LMYA 4OIRF 1XN7A 3KP7A 3HZJA 3BY6A 3RZOJ 5JVGF 3PO2J 5E1XA 3C2HA 1E3HA 4XICA 3A01A 1R1TA 4P1WA 4X1EA 4QSHA 2BXYA 2X6OA 1ZTRA 2DFFA 2P0WA 3ABUA 1S29A 2IVMA 3E97A 3RPUD 3V4GA 4LB5A 5HLIA 2EV6A 4C3JJ 4P9UA 3Q0UA 1Z1DA 3TQNA 2OTLI 1IZ1A 5ICGA 2RKHA 3KCCA 1R58A 1YG2A 2ECBA 1W5CC 3H1CA 3RYRA 2Z9OA 5D5WB 2L5QA 2W25A 1UHMA 3G4SI 4A3GJ 4D9JA 5HNHA 5CVJA 3H5RA 1QNTA 3CCUI 1S72I 1G6NA 3NEUA 4A12A 1F9NA 3MKZA 4XNFA 4CO8A 5KNLA 3HJEA 2J5OA 4B47A 4KA4A 3DPLC 5DCFA 2EA4A 3QYFA 3N4MA 4M9SA 4A0ZA 3GYHX 1STZA 1JJ8C 1X4OA 4U87A 3OS0A 2HTSA 4Y15A 3REOA 1MMDA 3E5QA 2JN6A 2L2OA 2G7HA 1OYWA 4E7ZA 1XGMA 1XX5A 2VODA 3KEQA 3BJAA 4IRIA 4C3HJ 3I9V2 3U9GA 1W0UA 2YR2A 3LA7A 3G6EI 3CUQC 3X2QH 1ZRCA 4PFOA 4A93J 1DGWY 2DMQA 4Y33A 2IS2A 2DFIA 3S16J 2IS6A 3LSJA 4BUPA 1TLHB 1X2MA 3RQIA 4BJTA 1D3YA 2DOFA 4A3IJ 1VQMI 3F6OA 5HS9A 4EJTA 4WF2A 4EM0B 5EG0A 2EK5A 1TW2A 3GXOA 2L9VA 2PLYA 2FOKA 2JRTA 2FNPA 4X6AJ 2RDPA 1GVDA 2AHQA 1ETXA 3SJMA 4MTDA 1B59A 1SFEA 2GA2A 5DDGA 2M2EA 1G3SA 2PN6A 3VDXA 3F8BA 4Z2YA 1TQIA 1WHUA 3OIOA 2XSDC 4XKVA 1OCRH 3L00A 3LSKA 4L9JA 5D8LB 3MEXA 1R00A 2MSYA 4R79A 3E6MA 2ELJA 1A5JA 2XPVA 3OYMA 1P92A 1FOWA 1KONA 3GTOJ 3K4MA 1KYWA 2O7OA 5K7HA 4M3DA 4CYCA 1FOXA 4I0BA 3BROA 1T98A 5F0FA 2CFXA 2DO7A 3S3MA 1ZH5A 2HTJA 3OIPA 1MBJA 3WU0A 2W1OA 1BJZA 3BZ6A 4EATA 3FBIB 2ZMEC 3WU1B 2JA6J 3CP8A 3OS1A 1ODDA 2E2IJ 1F1ZA 2DFEA 4I02A 5LFAA 2G9WA 2P5LC 3E1SA 2F5CA 2E1CA 3T1BA 4O5VA 2E71A 1YO5C 3EUHC 5DM7F 2L7KA 4ESJA 1LE8B 4RLFA 4GRIA 5IYBJ 5KK1A 1JGSA 2CUFA 5J8CA 1Z67A 3BR6A 1WSUA 4ON0A 1HLVA 3R0AA 1FNNA 2GOMA 1IO2A 3FISA 2ZSIB 5J8FA 3NRVA 5LEJA 4UNOA 2NNNA 2ZFUA 5FFXA 2K3FA 3TO9A 4AIKA 1T6SA 1XDSA 2X1DA 2UZKA 3R60A 2EB7A 1IAWA 3ABKH 1FP2A 2DODA 2MYSA 2ME6A 4PDKA 1Z6TA 2CJJA 4GCVA 4YFNF 4BJ6C 2LKSA 3LA2A 4UUSB 5E18F 1IXSB 1OISA 3HRTA 4IKFA 2VBWA 4HG2A 5J47A 4HSRA 1LQ1A 4A3DJ 2KRHA 3F8MA 3FIWA 1G8XA 2DFHA 4FISA 2GLOA 4HX4A 4IXAA 2H8WA 1D0ZA 2J5PA 4QWQA 4PJNA 1V5EA 3MKYB 2K3PA 2M34A 3HIFA 2Z33A 5DD4A 5GP9A 3BG3A 5ILSA 4F91B 1U0JA 3KZIC 1EH6A 2FXAA 3TOAA 1A36A 2DYSH 3KP3A 1IN4A 1U8RA 3U1KA 3F22A 1MMSA 2EIJH 3IKTA 3TDZC 1V4RA 2IPQX 2D45A 2VLAA 1WJCA 1XMAA 1EF4A 4S04A 3ZXSA 2WADA 4F92B 1OR7C 2EV5A 3V7RA 3J80Z 4AUXA 1ETQA 1VNDA 2BY3A 2DOAA 1MH4A 5IY5H 2CQNA 2VKHA 4II2A 3ZQLA 1XDUA 2B0LA 2Q1ZB 2EJRA 5EEGA 4BHCA 2VJ5A 5LLQA 4IOAF 2R7TA 1R22A 4ZDOA 2VC0A 4HW0A 4XQFA 4CA0A 1MH3A 1C0WA 3FXRA 1SD5A 2NS0A 2EFPA 3PFYA 4JQFA 3A01B 2KKOA 2X6YA 2ZKZA 2C6YA 1SD6A 4WX9A 3CMMA 3QU6A 4EM1A 2CYYA 3OYEA 1G59A 1JT6A 3MN2A 1J75A 2HVRA 2WA0A 3HM5A 2VXZA 1N77A 3C1DA 3V7CA 4E7HA 4IO9F 2R7WA 2OAZA 1QA6A 4JX4A 4L5EA 4HX8A 3C7JA 4MNUA 3R6SA 3DFGA 3CDIA 2B7EA 4KIBA 6PAXA 1YX5A 4PFPA 4U88A 3K4JA 5J1UA 2V4JC 2LBFA 3K1MA 2FBIA 2O3FA 3ZOBA 3GMEA 4B3AA 2ZB9A 5E8IA 3IV5A 2CU7A 3RSNA 1IN8A 3JRHA 3D5LA 2JT1A 4BGDA 2K40A 2LF8A 4ABZA 1WI3A 5H6RA 1U5TA 5LEKA 3WU2C 4WWCA 3I0TA 3ERED 3BG7A 1XMKA 1E0EA 2QKMB 1ITYA 5DCMA 2A69F 2LDUA 4ZZLA 3A1YA 2QBYB 3SQNA 2ECCA 2Z1DA 1Z7LA 3HHGA 4YG2F 1T0FC 4L18B 4BU2A 4Y52J 3NWSA 3D5RC 3OV8A 5J3LA 1VQ8I 1DU6A 4NC6A 1EKEA 2XIGA 1HC8A 4XLCA 1MKMA 2EFQA 4A3EJ 3KP6A 2LF7A 2VIXA 3VOEA 4JOMA 2E2HJ 3HC7A 1J0RA 4YIRX 2QWWA 1T38A 5IYDJ 2PQ8A 3OY9A 1K7AA 2MABA 3CCEI 1VI0A 4RAYA 2BZTA 2OJED 2WB1A 2DU9A 2XKOA 2EBIA 4L5IA 2RV8A 5EG0B 4GO1A 4E7IA 1I50J 4LG0A 2F4MB 3PIPF 2XGEA 4N9IA 3I71A 3RKXA 2KJCA 2L54A 3R61A 2IGMA 1FT9A 3KP5A 4F93B 4DYRA 1IC8A 5DTDA 3ABMH 3BQYA 3CQZJ 3DCFA 2JA2A 4RGXA 3HOZJ 1QRYA 1ZKGA 3GLLA 2RNJA 2DBBA 4CYDA 2E5NA 4MIMA 2VPLA 1X1AA 2X0LA 3JREA 1K6YA 5KCMA 1UHWA 3ECOA 1AHDP 2HXIA 2NYXA 4FETA 1BI1A 2ZNZA 4CYCB 1R6RA 5M3MJ 1ZGAA 1P6RA 2E1MB 1ETOA 1JTXA 3I59A 3P7NA 1W0TA 4LITA 2XGDA 4V2FA 3CJRB 3O3KA 4OIQF 3S2WA 2IBDA 1DQUA 4AD9A 3EYYA 1MBEA 1S5LC 1BA5A 4B8XA 2RAEA 3KZZA 4ENJA 4HNVA 2K7LA 3V8LA 5J40A 4FCYA 2FBHA 4KISA 4RA2A 2FSWA 2ZO4A 1J2XA 1RKTA 3QPLA 3F8CA 3MD2A 3I4MJ 5BS6A 2W57A 1XSVA 3CCSI 4ZTJA 1VQ6I 5J1RA 1I3AA 4QLCU 1NK3P 4JYKA 2HEOA 5H20A 1TWHJ 5L3DA 2HOEA 2DMUA 4AIJA 1CGPA 1D5VA 2X9DA 4ZDPA 3OYDA 2K5CA 1Z3XA 2QF7A 2VT3A 1ZQ3P 1WJBA 2JJ7A 3IP4B 1UFMA 4PSWA 5HNFA 1P4WA 4RGUA 2VI6A 3VSKA 2HQNA 2XGXA 5ED4A 2OQGA 3G71I 1VQ7I 2UWMA 1MDMA 3DTIA 5LRRA 5CLSA 3QAHA 3CDLA 1KYZA 1Y8QB 4A5NA 4RB2C 1BOBA 1HDPA 2RREA 2R7VA 2XAJA 2OCCH 4XLNF 4JX5A 3JTHA 5J4YA 2A07F 1WJ5A 2COMA 3GW2A 1B8IB 2DA6A 5FKNA 2KISA 1VF9A 4J01A 2HPMA 1E3PA 4XM3A 2IS4A 3VB2A 2E19A 3KYDB 1LFUP 3ULQB 3CMEI 2QGUA 3P5JA 2RQQA 4MQ9F 4PK4A 4CCNA 2BXZA 4R8HA 4HAMA 1SC7A 5FKKA 1DUXC 3S1NJ 3S1QJ 2VE9A 1D8KA 3IH2A 1G3TA 4XLEA 4LFUA 4A3LJ 3HKZA 1U9NA 3DTKA 2LP0A 5BOXA 3M8FA 4KJZA 3P9KA 4M72A 2UXXA 3KEOA 3TO6A 3IUOA 1E2XA 1WVRA 4UY8I 4I98B 3S1RJ 2MLKA 1MSEC 3IHUA 1UMQA 4YELA 4BBSJ 4F3QA 3I4NJ 1JT0A 1MJ9A 2R5ZA 3GWZA 4OMYA 3MZYA 2LD5A 3BZKA 5A2QZ 1R7JA 3J81Z 1O57A 3EYIA 1V5FA 4WXDA 3GLXA 3JW4A 3KPHA 1DDNA 2FD5A 1L3LA 3AFHA 4DNCA 2MH9A 4CZCA 3K4LA 3OL3A 1Z21A 3CUQA 4XBFA 4ZYGA 2F2EA 2R7DA 4XKCA 5E8GA 4C2TA 1PYVA 3LMMA 5EDNA 1K78A 4B48A 1OYYA 3EDPA 2V9KA 3K6GA 1TT5B 1ERDA 1HCRA 1IUYA 4E7LA 5CJ9A 4O6JA 4Z6YA 1WQ2A 4RB3C 5FLXZ 3HHHA 2ELKA 2LBFB 2ME0A 4CZZA 1ZGWA 1AKHA 3H3ZA 4HDVA 2LC2A 2X1EA 2OTJI 1A31A 1QU3A 2FMYA 2OU2A 3L2RA 4AYBA 3Q9VA 1NG7A 1LKXA 3QRFF 5ERIA 1I39A 3JSPA 5HDKA 4C3IJ 4B43A 1MJAA 3KE2A 3LL7A 4P9FA 3ZQGA 1U5TB 5EEAA 3WHBA 1FSHA 3BG6A 3ZCOA 3DPTA 3GTGJ 4YFXF 3DXJF 4IEJA 4DGWB 4A0XA 3KFWX 4D7MA 2PMHA 5L3GA 1Y56A 3V7SA 2V6EA 3I53A 5D6FA 1KQ8A 3CP2A 2ESNA 1W7PB 1YHQI 1JKPC 1OLTA 3A0BC 4K2EA 1BN5A 3RTRA 4QIWN 1QVTA 4BYYA 1MBKA 2ZMEA 3A03A 4W1UA 2QM3A 4D5CA 1D1AA 2GIVA 4I01A 4M6XA 4RAFA 3H0DA 3IL2A 4LIUA 3D1NI 1RC9A 1ETVA 1YW7A 1YJ9I 2CO5A 2PJPA 2VBZA 4F52A 3IRRA 2DOEA 3EUHA 5EJCA 3SYTA 4IHSA 4KUMA 4B3XA 2W84A 5HOOA 1IRZA 2D1VA 2G0EA 2E1NA 5J1YA 2JSPA 3MWMA 2DW4A 4LG0B 3EPZA 1TW3A 2EFNA 3DEEA 5AIPA 3HPHA 1FYMA 1W5SA 3L09A 3BDDA 1BC8C 1ZARA 3PSIA 3GX4X 3OYGA 3M4OJ 1KQ9A 2F48A 2BGCA 1YLFA 2MH2A 2PFBA 1ULYA 4KMUX 3LSHA 1P7IA 1UG0A 2CW7A 2ZJPF 2QSGX 1I5ZA 1GT0C 2O6GE 2FOWA 3HSRA 3IKVA 2JK3A 4RDUA 5BPDA 5FRMA 2WAFA 3ZGKA 2E7XA 4ZJZA 3WTUC 4NUBA 1O3QA 5FLVA 3S2DJ 2JVHA 2VASA 4B1RA 4FASD 5FD6A 2L4MA 2RVCA 3DU6A 3I59B 4J00A 2K9LA 2X6XA 1G2HA 4CCJA 5IYCJ 1A6QA 4BJ5C 5E3LA 5DM6F 3A2KA 4FX0A 3FM5A 1YJNI 5L3EA 2NXNB 2FRHA 1R1UA 2KPMA 5LBQA 3E6CC 2GXBA 2VJIA 1UAAA 3AG2H 2YX4A 4NHJA 5ICCA 2EINH 3CTAA 2OA4A 3OYJA 2DA1A 1RIOH 3M1EA 1RI7A 2OZUA 3A4CA 1K79A 2P4WA 3KLNA 4IZZA 4ITVA 2FNAA 1TT0A 1R1VA 1U9OA 2LVSA 3BTCA 1OR7A 5AIQA 1LFBA 3DU5A 1BI2A 2R5YB 3W6JB 2L9RA 1A04A 2JPBA 5ILVA 3H5NA 5K5QA 2LFBA 4HV5A 4XKWA 1FEXA 5FJ8J 2CWEA 5CVUA 4RLQA 2M4KA 3IH4A 4BE2A 5D4SA 2YS9A 4ESBA 4BXXJ 1BR1A 4DYCA 3PNVA 4G7ZF 1D5YA 2VKVA 2VN2A 1QO0D 4BBRJ 5EYRA 1MDMB 4MEXF 2XF5A 4A6DA 1V3FA 4FX4A 1XCVA 3I58A 3MQ0A 5DUKA 4LD5A 2DJIA 1TWFJ 4QPOA 5DUIA 3KZYA 1IXRC 3CLQA 3BJ6A 3NQOA 2FU4A 2V1XA 2BVMA 1KU7A 2DT7B 4L5JA 5JLWA 1O4XA 2RQPA 3BG9A 4DJAA 2IRFG 1XS9A 1QPMA 1SANA 3QPHA 1SEUA 4LK1F 3LSIA 4FE4A 1TNTA 3E6DA 3LQRA 1MZBA 2ADUA 2E35A 3OYNA 1ZLKA 2GZWA 5E1WA 1IN7A 4HPQA 5K7FA 1S7OA 4WXHA 3WGHA 2NRAC 1OPCA 5JI6A 3ZN1A 2BW3A 4Q48A 1VZ0A 3N97A 3OSGA 2CUZA 3O8HA 2HYGD 1R23A 2WAQA 3T5XA 1MIJA 2KFDA 3KX2A 1QZEA 2BY2A 5E3NA 3PUBA 1FJLA 1R5HA 3TW7A 1U8BA 2M9HA 4XLAA 1VFCA 2XPUA 3W2WA 3CO6C 1DP7P 3SFIA 1WWXA 1TBXA 2H6CA 3B6CA 2VL8A 3CMYA 2R5ZB 4G9YA 1NK2P 2BYVE 2VC1A 4IJAA 1T0FA 4MFDA 4V2GA 5LHIA 1HXDA 3BR1A 3O2PE 4HF2A 4Y4RA 4EJUA 1BM9A 3IAM2 2XAFA 1BR2A 2GXGA 2OPTA 3WG7H 3QWLA 4NNJA 4HLYA 1X58A 3CUQB 4N4NB 3M8JA 1AWCA 3HOYJ 5GTIC 3ZQQA 4ENKA 3KLOA 1AOYA 4BACA 2MFZA 2PG4A 4CDGA 1K78B 2R7XA 1HKSA 1RRJA 3JTGA 3ERMA 1XGSA 1TP4A 5BPIA 3ZQCA 1P9QC 4L9TA 2ZCWA 1P4XA 3G1LA 1UELB 1JGGA 1FOYA 1W5TA 4IX7A 1SAXA 1AKHB 4KN7X 2OQRA 3MAJA 3JAMK 5M5WJ 2L7ZA 2OF7A 1D1CA 3HSEA 2BBYA 4EJOA 2FQ4A 2OZ6A 1ETWA 1O3SA 3IH3A 4BY7J 1FYKA 3BQZA 2VQCA 1X1PA 3RKYA 1ZREA 1HSJA 4G6TB 4XK4A 1E17A 3BTIA 4LLGF 1IV8A 4NBQA 2P7CB 3WG9A 3FHNA 2R7SA 4A2UA 2MBFA 3K2ZA 2Q0OA 3HGGA 4GDFA 4IHVA 4KN4X 2IA2A 1FC3A 4YIIA 4JP0A 1S7EA 4Y17A 1NHAA 2YSRA 5D6EA 4U0WA 2M0MA 2CUJA 1XSXA 1HW5A 5EZGA 1X2NA 4G6DA 3CO7C 4KIFA 3S14J 3L2QA 2ZMEB 3WE2A 2A5WA 5HDGA 4DIQA 1O7LA 2KZGA 2QSFX 3IC7A 2V79A 3OWTA 4D1QA 2ACJA 1TTYA 5FD5A 2KIFA 4L9NA 5F6FA 3ECHA 2Y48A 2LY1A 3CJTB 1L0OC 2LG4A 3QPTA 2KLOA 5F08A 5JR3A 4E4HA 1QHGA 4XRSG 3B6AA 2A6TA 1ENHA 4X0GA 2X6WA 5D4RA 1BJAA 2WV0A 1H88C 3ML6A 5C44J 4W97A 1WZ2A 4L0YB 1R5ID 3NWTA 3CC2I 3H9JA 2IJLA 4EJWA 3MZHA 1J5YA 5LGTA 3M8EA 2QA4I 3PJRA 2DA2A 1LPQA 2QQAA 3E5UA 2AO9A 2Y0MA 1FBSA 4XORA 1XGOA 1O3TA 5CQEA 2Y9YA 2STWA 4NB5A 3RQ4A 4GXOA 2O03A 2F5VA 3DKXA 3ASNH 1QGPA 1OCPA 4ZDLA 4ZH4F 1XC5A 1R71A 4G7OF 1OKRA 2E60A 3M9AA 4D7NA 1GHCA 1KU9A 4XL9A 1YI2I 2CQXA 3OYLA 3GFJA 1XGNA 4OOIA 3CF5F 3CCJI 1H89C 4B09A 3ISPA 1PJRA 3OYCA 2PI0A 2VB6A 4XN3A 5HVQC 3HYIA 4I0AA 2DMPA 5LD2C 3BR2A 3I64A 2YPRA 3H92A 2DXIA 3BCAA 3T8RA 2PJRA 4UXNA 1JHHA 4ZYHA 2PEXA 2CG4A 3RKWA 5DV5A 3TL4X 1J09A 5DEQA 1SVLA 3GVAA 2EWNA 4QPQA 3CCLI 2HWVA 1DPRA 1YYVA 2M8EA 1K4SA 2XC7A 3E6BA 4P55A 1CF7A 4N0BA 3VODA 1G3YA 3BZCA 4I2OA 4XLFA 1Z0XA 2K9QA 5GPCA 4HLXA 3MKLA 3TGNA 5KAFC 5FKLA 1MW7A 1DPUA 3D0SA 3PM1A 5H2FC 1TZLA 1VQ4I 2R93J 1A6IA 2CQ7A 4IVNA 4KITB 4HOBA 5K7ZA 3G1MA 5L3FA 3JRCA 2WWYA 5IT9K 4S0HB 3H0GJ 5D8KB 1IGNA 3CCYA 5FFZA 5CYVA 4AVZA 2ISZA 2DDBA 2UUZA 3U1DA 1YRNA 1HKQA 4F55A 4PJMA 1HW2A 2R7OA 4DOZA 3PFIA 3JRGA 2Q2EA 2X85A 4AIHA 2QSHX 2X1CA 2R7FA 4P5OA 2KHMA 4R1HA 2EZKA 4UUSA 1DGRM 2HVSA 4HV6A 3PO3J 3E0JB 1I1SA 1ONVA 2HKXA 4I99C 3VSLA 5GPAA 2R92J 3ONQA 5FRNA 2WY8Q 3RYPA 2LY9A 3SXYA 2AQFA 5F27A 3TW6A 2WY7Q 3BR0A 3FKIJ 3COAC 3ZP5A 1H0MA 1IDZA 3ZQHA 4PSXA 2QKLB 4ZYEA 3C18A 2Z16A 4IPAA 5DS9A 3OR1C 2EPFA 1X19A 3LAJA 2XHKA 3FK6A 4CSWA 4U0YA 2ZBKA 2KQRA 1X3WB 3AL0B 1WFXA 3BTJA 3FX3A 2CQKA 2ISYA 1SFXA 1BIBA 1ZK8A 4I7HA 3CZ6A 2F4OB 2NOJB 1FOKA 3RPUA 2NVYJ 2QQBA 1QZYA 1MJBA 2JUCA 1Y39A 2VUMJ 2JVGA 2MC4A 2LK2A 3BP8A 2P6SA 3NARA 4BXFA 2O61A 1YIJI 1B9MA 2NNYA 3ZMDA 3OS2A 1ACIA 3K4KA 1TNSA 3KETA 2QVOA 4HA8A 3G1OA 4JBAA 1HQCA 3F6VA 2IAIA 5DYMA 2BV6A 4UUVA 2GQQA 3E5XA 3E7LA 4OAYA 3UNGC 4BS9A 2VOOA 4AM3A 4WXCA 5LRSA 2HGCA 1RKWA 2P6TA 3KYCB 1D0XA 2E1OA 1BW6A 2QENA 3M7GA 3CCQI 3QU3A 4ANJA 2VBYA 3DV8A 3LWFA 1PP8F 2KL4A 1FBUA 3LNQA 1B9NA 2Y9ZA 1OJLA 2K85A 2CS3A 1N25A 1ZAOA 1LB2A 2K02A 4A3BJ 5CVVA 4BE1A 2EQRA 1X4PA 1IG7A 1CQTA 1BI0A 2KZVA 2VQLA 4BH9A 2GXAA 2XGCA 1J59A 2ICWG 1LDDA 1ZRDA 2M0CA 3KIOA 3QYBA 4RBOA 4Q47A 3FKJA 3ZMSA 5HS8A 3JR9A 5F1JA 3DF8A 5ICEA 2JTVA 1P7JA 4FHTA 2FF4A 2H8RA 1EV7A 1X3ZB 3W6VA 2LLKA 4BAYA 4OINF 1X1CA 2ETHA 1LDKB 2P81A 1MNMC 4OIPF 4PJLA 4LIVA 4A69C 4M3FA 3LSPA 1HBXG 2UV1A 4AC0A 4AYBN 1LUJB 5C3EJ 1V5GA 2YU9J 4KICA 3FXOA 3LQQA 4M6VA 4UVAA 4CCOA 2KMUA 4NQWA 1U3EM 4AIDA 3DLAA 3WTYC 4BQQA 4LOCA 1ETYA 3S32A 1H9GA 4YFKF 2EV0A 5EZHA 2FUG2 4HSTA 3M3YJ 2Q8KA 4CH7A 1Y6IA 1ZR2A 4BQNA 2HZDA 1VQOI 4PGHA 1ZG5A 2Y0SA 3QQAA 1YTYA 1APLC 1IDYA 3F8FA 1W36C 4N4OB 3NAUA 3RCOA 3MCZA 2VKEA 5EEHA 1ZYRF 3SZPA 1HW1A 2STTA 5L3BA 2MD0A 3BJOA 4BL0B 1PVEA 2DAOA 2E5ZA 2L7MP 1UZCA 3RI4A 2E36A 3QP6A 5F0CA 3FMSA 2HNHA 3B02A 5EGOA 4UV9A 1OCCH 3PIOF 4TV7A 2M7AA 3GFMA 2ZJRF 3J7AO 3I5UA 2VJJA 1OYIA 4DZJA 1FX7A 5CKTA 1G4DA 2YX7A 3DBLB 4XLPF 1O3RA 1JI8A 2CW8A 2FBKA 3GTQJ 3CUOA 3DLLF 4DZPA 2Y2ZA 1R9TJ 1YW9A 2K9NA 1GV5A 1OQYA 3OYIA 2DCEA 4UUTA 3S93A 1PUEE 1FTTA 4Y13A 1UHSA 1WI9A 2ID6A 1FZPB 2FQ3A 2PJRB 3GFIA 1EH7A 5LGNA 1T56A 4EVIA 3ZMVA 1Y1WJ 3Q9SA 1TQMA 1H8AC 2Y75A 3HOUJ 2DLLA 1CF7B 4A3MJ 1IRGA 1FPQA 2FA5A 2DYRH 2P8TA 5E17F 3TOBA 2DTZA 1IW7F 2MW8A 3VEPA 1WPKA 4IHYA 3K10A 1GLNA 2LH9A 1EJ9A 2V26A 1EH8A 3OOUA 2HPIA 2I10A 3LFUA 1RR8C 3C2BA 5TGTA 2VKDA 4XIDA 2LSOA 3FMRA 1DP3A 2VOPA 1XSDA 3I55I 1S6LA 2W00A 2X4HA 3C2GA 3P9IA 3F23A 3PNYA 2H27A 5IPAA 1FMVA 3HOWJ 3F72A 4A6EA 2TRTA 4BEHA 4LLNA 1W36D 3T8TA 2Z99A 1QVUA 3H9QA 1YRNB 1VQ5I 3ZQIA 2IGNA 3KP4A 3LSRA 5TISC 5DCMB 3SFZA 2Q2EB 3HDDA 4II3A 2M87A 4CCMA 1T2KA 4DBQA 2KRFA 3FDYA 1GV2A 2EIKH 3ESWB 3GTMJ 4BHBA 3FK7A 4MTEA 3ZN0A 2NOGA 1MMNA 2H1KA 2BOLA 1RUNA 2QEXI 2KJBA 5LGUA 3ZR8X 3SDGA 2VT2A 1UCRA 2K9SA 1SFUA 3CCRI 4BDZA 3F9KA 1BI3A 2M3AA 1MSFC 3T0YA 2V1DA 3Q0WA 3TEDA 3VWBA 3D5SC 4XSZF 3LOCA 3FXLA 2DI3A 2JMWA 4NDLA 2D2WA 2QLZA 2PMUA 3UR3C 1QPIA 1OMIA 3EUKL 1KU3A 4EV0A 5J6XA 1XD7A 4H0EA 3JRAA 2R7QA 3IWFA 3AAFA 4A3CJ 2X51A 3F21A 1OCTC 4UV8A 1ZN2A 2V1UA 3GCMA 3WODF 2HQAA 4HNUA 4IHXA 3FM3A 2R0QC 2P5KA 2CFOA 2VPRA 2M30A 1LVAA 3V8JA 5HLHA 1I27A 3H36A 1LFPA 2K9MA 2LKXA 3PSFA 2G7UA 2HOTA 1MBGA 1YS7A 4CICA 4M9ZA 2E34A 2XB5A 4IQJA 1ZELA 2XAGA 3Q0VA 3HEFA 4BQAA 2IXSA 2OBPA 2Z3YA 3K4BA 1QHHD 5EF6A 1GXQA 1KA8A 4YRVA 4LJZF 5GADJ 4PJJA 3JRBA 4XR6A 1JUPA 1XMXA 4KFCA 1S7AA 1E3OC 1I3QJ 5BQTA 1W7PD 2IEKA 3LAPA 2GAUA 2MG4A 4XOTA 3SEQA 4D5FA 4V19K 2JPCA 2V9PA 2Y30A 2F5FA 3ABLH 2OUMA 2DMTA 1HA8A 2DA5A 4XRMA 2PMZA 2HYJA 2NVQJ 1XB4A 2HDDA 3L2VA 4I6ZA 3PNTA 3KYLA 4HBLA 4UB6C 1D8JA 3GFLA 4I76A 2OV7A 3DEUA 3J7YJ 2H94A 2VQHA 1OCZH 2Z5UA 3GBGA 3OIQA 3DPUA 1JXSA 1IN6A 2XDVA 4NQWB 1PUFA 1JUSA 3RKQA 3ELKA 4G8XA 3ZMZA 3VYRB 1AA7A 4ZTFA 1TL8A 1FP1D 1ZHFA 3OYHA 4DQ2A 2L4AA 5IT3A 2M4GA 2FE3A 2BY1A 5B3SH 1K4TA 3K1NA 3RIRA 3FXKA 1QQIA 1B1BA 1GUUA 3JAMZ 3DWLE 3G2BA 5KVRA 1GVJA 2V1NA 1VTNC 3VPRA 1FTZA 2ZC2A 2NAZA 2DPDA 2EZLA 1MBFA 1B72A 2VBXA 4M3BA 5E1ZB 2LMDA 5D5VB 2F5DA 3AG3H 2OD5A 3F0CA 4M71A 4PCQA 3HB9A 5B66C 3JSOA 2CW0F 3K7AJ 2ZJ2A 1FLIA 2HDCA 2KIMA 1SAUA 1SVMA 3WTZA 5EGOB 1AU7A 3WTWC 5KHDA 1P2FA 5FKOA 3TP3A 1I6HJ 1VQ9I 5TRDA 4C30A 3FXJA 1F36A 3ZMUA 1LNWA 3DEWA 3SDBA 3TBIA 3F3XA 5M5XJ 2JSCA 1QBJA 2HOSA 3WTTC 4HDUA 2QBYA 1JKRC 3G3ZA 5E79C 3FXMA 3OR2C 3EETA 3QYEA 1Q1HA 1X1BA 1PP7U 1A35A 4A3JJ 1YS6A 2R4GA 4BXUA 2CV1A 2L3DA 1JJ6C 2W48A 3B73A 1IJWC 3U21A 4OWRB 1Z05A 2D5VA 2GM4A 1RESA 4O3MA 2H09A 1FMWA 3VYTB 3FXUA 3OOPA 4BE0A 1Y0NA 1V55H 3L7WA 2HYFA 2KT0A 2LR8A 1BL0A 4L0ZB 4KT5C 5GAHJ 5LHGA 2NVUB 5GAEJ 4IOCF 4BDYA 3Q5FA 3S3NA 3QP5A 3K9TA 1BOAA 1T8IA 2VJ4A 4XRSA 3JCUC 3CD6I 2XAUA 1WCMJ 1J9IA 1J7KA 4UVCA 2DMNA 1X3UA 3QODA 3DKWA 5D5XB 2CSOA 5HLGA 5HDNA 2XF7A 2O5RA 2HOAA 1WJAA 4ZZDA 3O8GA 1W1WE 4XLHA 1RZ4A 1T95A 4EM2A 4BEHB 3HOVJ 3S17J 1Y0UA 4IHWA 5HS7A 3CMAI 3E3VA 2P7VB 2K86A 2DPUA 1S8NA 1LVKA 3PUFA 2H6BA 4EMSA 2KDZA 2XF6A 3ROUA 2RN7A 3S15J 3A02A 4Q4ZF 3JRIA 3R4KA 2O0YA 2E7WA 5K5OA 3TP0A 1YIOA 3J7ZI 3HGYA 2L9SA 5JLXA 3ZRGA 2ZNYA 1WGXA 4ZYDA 3AG4H 3SZTA 2MGQA 2BE5F 1T39A 4YIFA 2HR3A 2HKOA 5AONA 1IN5A 2ZXWH 2L02A 2CQQA 5JHUA 1B4AA 3GUDA 3ABTA 2XASA 3VYUB 1WJEA 3L9FA 5CVRA 4MHGA 2DT5A 4M3GA 3GTKJ 3L2UA 2F4IA 2JA5J 1JTYA 1HF0A 1XCBA 4Y7NJ 1MMAA 4FQGA 3DBRB 1TWCJ 3RDIA 1BBYA 2DN0A 5GTHC 4MQVA 5K1YA 2HXOA 2WTEA 2KRCA 1W4MA 2PX9A 1S3JA 2B9SA 3GZ5A 3ZQFA 1VQNI 2BVLA 2CGPA 3CF2A 5IT9Z 2XV4S 3SHFA 2EA2A 4MFEA 2KP6A 3WTXC 4QTRA 1WKMA 1SVOA 2EILH 4AWXB 3HG9A 5HLTA 4IF4A 3OSFA 1JE8A 4FE7A 2WB1N 3CJQB 1B8IA 1Y1VJ 3HL2A 1VQLI 1HKTA 2V9VA 2HS5A 3GTLJ 5JFRA 4OIOF 3TO7A 1LEAA 5IP6A 1Z3YA 2LYCA 4XSXF 1BW5A 1VQKI 5BMZA 3MZ8A 2ZFWA 1D1BA 2TCTA 1OFCX 3MMYB 4AU7A 1RNLA 3N05A 4RGSA 2ZXJA 2X48A 4U7BA 2XRLA 4ZYAA 2CRGA 4BKXA 3QOEA 4G6QA 2EH3A 2LNBA 4M6YA 1I1GA 3W2AA 1WH5A 1MNEA 2M5WA 1FIAA 2JRMA 5K5RA 1LDJA 1ZLJA 1ZG1A 3G73A 2P5VA 4WCGA 4WK8F 4HQEA 5E3OA 2GA1A 1FYLA 1ON2A 3K2AA 3LSMA 2BEOA 3PL8A 2DK5A 2R7UA 5LHHA 3OYBA 1YJWI 2A5YB 5B5EC 2NVTJ 1F4KA 4OAZA 2A68F 3BPVA 4EQQA 2EFWA 3OYFA 1MBHA 2R7RA 2AS5F 2CUEA 1RETA 1PUFB 2CV2A 4MGRA 4ZC3A 4HRIA 3L2CA 3W2VA 4ETSA 1UB9A 3K69A 3U2RA 4UB8C 1YOVB 4KT6A 2IGOA 1N78A 3MFKA 4PJ0C 1SFOJ 2EZHA 3EQLF 4XRFA 2XAHA 5F04A 4ENMA 4JK1X 1SD4A 1B72B 3C3WA 4NC8A 5B1AH 3GZ6A 1Z6RA 1IXCA 2QUFA 3CCVI 3HUGA 1IRXA 4CHUA 3CJNA 1ETKA 1FSEA 4FT8A 1NH3A 4M74A 4IHTA 2DQRA 3TMOA 5M3FJ 3CLOA 1H9TA 3DBHB 2WAEA 4RS8A 1G3WA 3HTUA 1TWAJ 3BR5A 1R4NB 2BW3B 4A3FJ 3ZPLA 1WRJA 3M07A 3AL0C 1SMYF 1KQ0A 2DT6A 2JWTA 4NC7A 4XMYA 3LA3A 3J80K 2Y0SN 4H4KC 2ID3A 1OCOH 4ENNA 3GTPJ 3TKYA 4HF1A 3OYKA 4DYQA 1W7PA 2OCEA 2XPWA 1RR7A 2RGVA 3AG1H 3WGGA 3S2HJ 3ZQ7A 3RJPA 1Z7UA 1D0YA 2LRDA 2RC4A 2KIQA 3CCMI 4PUSA 3ZMTA 3UKGA 3K70C 5IP7J 5FLMJ 2VE8A 2O8XA 1SFKA 4E70A 3HKZN 1DU0A 1IF1A 4RB1A 3WE3A 1WJFA 2HZTA 4KDPA 3DTEA 3FBNB 4LG3A 2DA7A 1MGTA 2HI3A 3L1PA 3GTJJ 2E1MC 2EIMH 2BHYA 1T08B 1N75A 1RUOA 2WV1A 1X1DA 2ZXHA 2Z2SB 2R3SA 3JRFA 1Z9CA 4U7DA 5B1BH 5FKMA 3JRDA 9ANTA 5CPRB 4G7HF 1LEBA 3W6KB 3L2WA 2XAQA 5IP9J 2Y69H 3BCBA 2DQLA 4HNTA 4Y3OA 5E20A 2COBA 2AQEA 3ASOH 1SMTA 1I6XA 1HSTA 1YE9A 2IW5A 1IV6A 2E2JJ 5GAGJ 5F64A 4CGZA 2A6EF 2W24A 2IT0A 1Y8RB 1R49A 3V42A 2QZ8A 4KNYA 3FXQA 3BLYA 2HQRA 1R36A 2DK8A 5L3CA 2TDXA 3BR3A 3FF5A 2FX0A 4J19A 2ESHA 1B6AA 2ZJQF 2XUBA 2L0KA 2RNGA 5IOYA 3FWEA 3HRSA 2I8DA 2MA3A 3IAS2 3HRMA 3O6BB 4LB6B 1KGSA 2HU9A 1Z77A 1IUFA 2O8KA 4U0VA 2MD5A 5KAIC 3QOPA 2F6CA 1UJ8A 2LKPA 4OMZA 4A0YA 4ASNA 4A5MA 3M1CA 3Q3SA 1XG1A 3EUAA 2CH0A 3SEZA 4ESFA 4EGZA 3HOSA 4CCLA 3MVPA 3FMQA 1REPC 2R5YA 3DQVC 4UHTA 2A05A 1YFHA 2M8GX 3GEZA 5M5YJ 4EJVA 2W7NA 4EEFG 5H6QA 4HYEA 4HEA2 4GYIA 3V8KA 4F7ZA 4DW6A 3K70D 3CDHA 2W82A 1ZR4A 3IWZA 2K4JA 2ZXIA 5FO5A 2DTRA 4UVBA 1TC3C 1MNDA 2K4BA 2IGKA 4B4CA 3R0JA 1KU2A 4DBRA 1M1EB 4BHPA 5IOZA 3DP7A 4HF0A 2AXTC 1NTCA 1S9HA 2B63J 4LK0F 1YW8A 3I54A 2XROA 2L01A 3AKZA 3HOXJ 1YX3A 1U2WA 3K4NA 1K6OA 4E7SA 1FIPA 4AVPA 2KIUA 3GO5A 2GWRA 4HX7A 2VONA 4A3KJ 2V6CA 3S3OA 2EFOA 2DJNA 4RM2A 5D5UB 3GF2A 2BHZA 4IQ4A 3H9GA 4RMNA 3OMYA 4FTHA 2L9NA 2VQGA 5JVTA 4M9XA 3QPSA 4C2MJ 1FBQA 3BPXA 3CC4I 3PQJA 4L9VA 1U78A 4BY1J 2FJ1A 1USSA 1R4MB 2GBYA 2GIZA 4YEJA 3OL4A 2KDOA 3HPGA 3BC8A 3I56I 4I09A 4CCKA 2M1BA 1WH7A 2QQ8A 4XOPA 3H35A 3SZGA 4D0PA 3F8NA 4MLOA 3BG5A 4P96A 5TJJA 1JUMA 2IA1A 3HXLA 5HODA 1Z91A 1F5TA 4JX6A 1EA3A 2HDWA 1KZHA 3FHZA 3VFZA 2UXNA 1ZGJA 2AXLA 5JHFA 4BQOA 3FZVA 3I4PA 1RPWA 4IL6C 2IS1A 4IRHA 1QZZA 2FMLA 5C4JJ 4S05A 4XKBA 1FWZA 2LY2A 1HOMA 1U5TC 3GZNB 1VQPI 3HTSB 1YQAA 1BIAA 2M45A 4N9HA 1XTAA 2NS7A 2EZIA 3BT9A 3LSGA 1MMGA 5FB2A 1HDDC 3VYSB 1R5GA 2PMZN 2JA8J 3CC7I 4XONA 5DD8A 4KIGA 1V54H 3KP2A 2L7FP 4MEYF 3HRUA 5FGMA 4E7JA 1BC7C 3HSFA 1K61A 1K83J 1TWGJ 3HUGB 1UG2A 2A61A 3LSTA 2R7ZJ 3MKWB
chains in the Genus database with same CATH topology
2A3SA 2QYOA 3LFKA 1USTA 1ON1A 4LLLA 1ZRFA 2WC2A 2XRNA 2IP2A 2A6HF 3WTVC 4GYGA 4G94A 2JZYA 2MC3A 3BWGA 4EGYA 1PDNC 4PGGA 2F5EA 4IRGA 1U6GA 1MD0A 4LGWA 3TDUC 5A2QK 3J81K 1IRFA 1TQPA 5ILUA 3K1PA 3IRQA 3WGIA 1JHFA 2K27A 3PQKA 2HFHA 4HQMA 2ELHA 3BOQA 2D1HA 2W85A 2FEZA 4CXFA 1SD7A 4HZFA 2YU3A 4RGRA 4RB0A 2MLGA 5ICFA 5FLXK 4RAZA 2PBIA 4GGGA 4M73A 3HOTA 3K0LA 4KYWA 4Q5SF 3WTSC 2QQ9A 3RPQA 1ZG3A 4PZJA 5F1RA 2XKPA 5CVIA 4KMFA 3H3UA 1FY7A 2IA0A 4OU0A 3P9CA 2XVCA 1GXPA 1O7FA 4BNCA 1P4AA 1LJ9A 4LMYA 4OIRF 1XN7A 3KP7A 3BY6A 5E1XA 1R1TA 3ABUA 1S29A 2IVMA 3E97A 4LB5A 3V4GA 5HLIA 2EV6A 4P9UA 1Z1DA 3TQNA 1IZ1A 5ICGA 2RKHA 3KCCA 1R58A 1YG2A 3RYRA 2Z9OA 5D5WB 2W25A 1UHMA 5CVJA 1QNTA 1G6NA 3NEUA 4A12A 1F9NA 4CO8A 2J5OA 4KA4A 3DPLC 5DCFA 2EA4A 3N4MA 4M9SA 4A0ZA 3GYHX 1STZA 2HTSA 4Y15A 3REOA 3E5QA 2G7HA 1OYWA 1XGMA 2VODA 3KEQA 3BJAA 4IRIA 3U9GA 2YR2A 3LA7A 3CUQC 1ZRCA 2DFIA 1TLHB 1D3YA 3F6OA 5HS9A 4EJTA 4WF2A 4EM0B 2EK5A 1TW2A 3GXOA 2PLYA 2FOKA 2JRTA 2FNPA 2RDPA 4MTDA 1B59A 1SFEA 2GA2A 5DDGA 1G3SA 2PN6A 3F8BA 4Z2YA 1TQIA 3L00A 4L9JA 5D8LB 3MEXA 1R00A 4R79A 3E6MA 1P92A 1KYWA 4I0BA 3BROA 1T98A 2CFXA 2DO7A 1ZH5A 2HTJA 3WU0A 3BZ6A 3WU1B 1ODDA 1F1ZA 4I02A 2G9WA 2P5LC 2F5CA 2E1CA 3T1BA 4O5VA 1YO5C 4ESJA 5KK1A 1JGSA 5J8CA 1WSUA 4ON0A 3R0AA 1FNNA 5J8FA 3NRVA 5LEJA 4UNOA 2NNNA 5FFXA 4AIKA 3TO9A 1T6SA 1XDSA 2UZKA 3R60A 2EB7A 1IAWA 1FP2A 4PDKA 1Z6TA 4GCVA 4YFNF 3LA2A 5E18F 1IXSB 3HRTA 2VBWA 1LQ1A 3F8MA 4HX4A 4IXAA 2J5PA 4QWQA 3HIFA 2Z33A 5DD4A 5ILSA 1EH6A 2FXAA 3TOAA 3KP3A 1IN4A 1U8RA 3F22A 3IKTA 3TDZC 1V4RA 2IPQX 2D45A 1XMAA 4S04A 2EV5A 3V7RA 3J80Z 1XDUA 2B0LA 2EJRA 5EEGA 4BHCA 5LLQA 1R22A 2VC0A 4HW0A 1C0WA 3FXRA 1SD5A 2NS0A 2EFPA 4JQFA 2KKOA 2ZKZA 2C6YA 1SD6A 4WX9A 3QU6A 4EM1A 2CYYA 1J75A 2VXZA 3C1DA 3V7CA 2OAZA 4MNUA 4HX8A 3C7JA 3R6SA 3DFGA 4KIBA 6PAXA 4U88A 3K1MA 2FBIA 2O3FA 5E8IA 1IN8A 3D5LA 2JT1A 2LF8A 5H6RA 1U5TA 5LEKA 4WWCA 3I0TA 3ERED 1XMKA 5DCMA 2A69F 2LDUA 4ZZLA 2QBYB 3SQNA 3HHGA 4YG2F 4L18B 3OV8A 2XIGA 1MKMA 2EFQA 3KP6A 2LF7A 3VOEA 1J0RA 2QWWA 1T38A 2PQ8A 1K7AA 4RAYA 2DU9A 2XKOA 4L5IA 2RV8A 4GO1A 4LG0A 4N9IA 3I71A 3RKXA 2KJCA 2L54A 3R61A 1FT9A 3KP5A 4RGXA 2RNJA 2DBBA 4CYDA 2X0LA 1UHWA 3ECOA 2NYXA 1BI1A 2ZNZA 1ZGAA 1P6RA 3I59A 3P7NA 3O3KA 4OIQF 3S2WA 4AD9A 3EYYA 4B8XA 3KZZA 4ENJA 2K7LA 3V8LA 2FBHA 2FSWA 2ZO4A 1J2XA 3F8CA 5BS6A 2W57A 1XSVA 4QLCU 2HEOA 5H20A 5L3DA 2HOEA 4AIJA 1CGPA 1D5VA 2VT3A 1UFMA 1P4WA 4RGUA 2HQNA 2XGXA 5ED4A 2OQGA 2UWMA 1MDMA 5LRRA 5CLSA 3QAHA 1KYZA 4A5NA 4RB2C 2XAJA 4XLNF 3JTHA 2A07F 2COMA 3GW2A 3VB2A 3ULQB 4MQ9F 4R8HA 4HAMA 1DUXC 2VE9A 1D8KA 1G3TA 4LFUA 5BOXA 3M8FA 3P9KA 4M72A 2UXXA 3KEOA 3TO6A 1E2XA 4I98B 2MLKA 3IHUA 1MJ9A 3GWZA 4OMYA 3MZYA 5A2QZ 1R7JA 3J81Z 1O57A 3EYIA 4WXDA 3GLXA 3JW4A 1DDNA 1L3LA 4DNCA 2MH9A 3CUQA 4ZYGA 4XBFA 2F2EA 2R7DA 5E8GA 1K78A 1OYYA 3EDPA 1IUYA 5CJ9A 4O6JA 1WQ2A 4RB3C 5FLXZ 3HHHA 4CZZA 3H3ZA 4HDVA 2FMYA 2OU2A 3Q9VA 3QRFF 5ERIA 3JSPA 5HDKA 1MJAA 3KE2A 4P9FA 1U5TB 1FSHA 3DPTA 4YFXF 3DXJF 4A0XA 3KFWX 2PMHA 5L3GA 3V7SA 3I53A 5D6FA 1KQ8A 2ESNA 1W7PB 4K2EA 1BN5A 3RTRA 4BYYA 2ZMEA 2QM3A 2GIVA 4I01A 4M6XA 3IL2A 1YW7A 2CO5A 2PJPA 2VBZA 3IRRA 3EUHA 4IHSA 4KUMA 2W84A 5HOOA 2D1VA 2E1NA 3MWMA 2DW4A 4LG0B 1TW3A 2EFNA 5AIPA 1FYMA 1W5SA 3L09A 3BDDA 1BC8C 1ZARA 3GX4X 1KQ9A 2BGCA 1YLFA 2MH2A 2PFBA 1ULYA 4KMUX 1I5ZA 2O6GE 3HSRA 3IKVA 5BPDA 3WTUC 2E7XA 1O3QA 5FD6A 2L4MA 2RVCA 3I59B 4FX0A 3FM5A 5L3EA 2FRHA 1R1UA 5LBQA 3E6CC 2GXBA 2YX4A 4NHJA 5ICCA 3CTAA 2OA4A 1RIOH 3M1EA 1RI7A 2OZUA 1K79A 2P4WA 3KLNA 2FNAA 1R1VA 1OR7A 5AIQA 1BI2A 3W6JB 1A04A 2JPBA 5ILVA 5K5QA 4HV5A 2CWEA 5CVUA 5D4SA 4ESBA 4G7ZF 2VN2A 1QO0D 1MDMB 4MEXF 4A6DA 1V3FA 4FX4A 1XCVA 3I58A 3MQ0A 5DUKA 4LD5A 5DUIA 3KZYA 1IXRC 3BJ6A 3NQOA 2FU4A 2V1XA 1KU7A 4L5JA 2RQPA 2IRFG 1QPMA 3QPHA 4LK1F 1TNTA 3E6DA 3LQRA 1MZBA 2ADUA 1ZLKA 2GZWA 5E1WA 1IN7A 1S7OA 4WXHA 3WGHA 2NRAC 1OPCA 5JI6A 3ZN1A 4Q48A 3N97A 2HYGD 1R23A 3T5XA 1R5HA 3CO6C 1DP7P 1WWXA 1TBXA 2H6CA 4G9YA 2BYVE 2VC1A 4IJAA 1T0FA 5LHIA 1HXDA 3O2PE 4HF2A 4EJUA 1BM9A 2XAFA 2GXGA 1AWCA 4HLYA 3CUQB 1AOYA 4ENKA 3KLOA 2PG4A 4CDGA 1K78B 1HKSA 3JTGA 1XGSA 5BPIA 4L9TA 2ZCWA 1P4XA 1W5TA 1SAXA 4KN7X 2OQRA 3MAJA 3JAMK 3HSEA 2BBYA 4EJOA 2OZ6A 1O3SA 1FYKA 3RKYA 1ZREA 1HSJA 1E17A 4LLGF 2P7CB 3WG9A 4A2UA 2MBFA 3K2ZA 2Q0OA 4KN4X 2IA2A 1FC3A 4YIIA 4Y17A 1NHAA 2YSRA 5D6EA 4U0WA 1XSXA 1HW5A 3CO7C 4G6DA 4KIFA 2ZMEB 3WE2A 5HDGA 1O7LA 3IC7A 2V79A 2ACJA 1TTYA 5FD5A 2KIFA 4L9NA 5F6FA 3ECHA 2Y48A 1L0OC 3QPTA 5JR3A 5D4RA 1BJAA 2WV0A 3ML6A 4L0YB 2IJLA 4EJWA 3MZHA 1J5YA 5LGTA 3M8EA 2QQAA 3E5UA 2Y0MA 1FBSA 1XGOA 1O3TA 2STWA 4NB5A 4GXOA 2O03A 1QGPA 4ZH4F 4G7OF 1OKRA 3M9AA 1GHCA 1KU9A 3GFJA 1XGNA 4OOIA 4B09A 3ISPA 2PI0A 5HVQC 3HYIA 4I0AA 3I64A 2YPRA 3H92A 3T8RA 4UXNA 1JHHA 4ZYHA 2PEXA 2CG4A 3RKWA 5DV5A 5DEQA 3GVAA 2EWNA 2HWVA 1DPRA 1YYVA 2M8EA 3E6BA 4P55A 1CF7A 4N0BA 3VODA 1G3YA 4I2OA 4HLXA 3TGNA 1DPUA 3D0SA 4IVNA 4HOBA 5L3FA 2WWYA 5IT9K 5D8KB 5FFZA 5CYVA 2ISZA 3U1DA 1HKQA 1HW2A 3PFIA 2Q2EA 4AIHA 2R7FA 4P5OA 4R1HA 4HV6A 1I1SA 1ONVA 2HKXA 3RYPA 3SXYA 3COAC 3ZP5A 1H0MA 4ZYEA 3C18A 4IPAA 3LAJA 2XHKA 4U0YA 2ZBKA 3FX3A 2CQKA 2ISYA 1SFXA 1BIBA 4I7HA 1FOKA 3RPUA 2QQBA 1QZYA 1MJBA 3BP8A 2P6SA 2O61A 1B9MA 2NNYA 3ZMDA 3KETA 1TNSA 2QVOA 4HA8A 4JBAA 1HQCA 3F6VA 5DYMA 4UUVA 2BV6A 2GQQA 3E5XA 2VOOA 4WXCA 5LRSA 2HGCA 2P6TA 3M7GA 2QENA 3QU3A 2VBYA 3DV8A 3LWFA 1PP8F 1FBUA 1B9NA 1ZAOA 1LB2A 2K02A 5CVVA 1BI0A 4BH9A 1J59A 1LDDA 1ZRDA 4Q47A 3ZMSA 5HS8A 3DF8A 5ICEA 2JTVA 4FHTA 2FF4A 1EV7A 4BAYA 4OINF 2ETHA 1LDKB 4OIPF 1HBXG 4KICA 3LQQA 4UVAA 4NQWA 1U3EM 3WTYC 1H9GA 4YFKF 2EV0A 2Q8KA 4PGHA 1ZG5A 1YTYA 3F8FA 3MCZA 5EEHA 1ZYRF 3SZPA 1HW1A 2STTA 5L3BA 3BJOA 2DAOA 3RI4A 3QP6A 3FMSA 3B02A 4UV9A 4TV7A 3GFMA 3J7AO 3I5UA 1OYIA 1FX7A 1G4DA 2YX7A 4XLPF 1O3RA 2FBKA 3CUOA 1YW9A 1PUEE 4Y13A 1WI9A 1FZPB 2FQ3A 3GFIA 1EH7A 5LGNA 4EVIA 3ZMVA 3Q9SA 1TQMA 2Y75A 2DLLA 1CF7B 1IRGA 1FPQA 2FA5A 2P8TA 5E17F 3TOBA 1IW7F 3VEPA 1EH8A 2LSOA 3FMRA 2VOPA 1XSDA 1S6LA 2X4HA 3P9IA 3F23A 2H27A 3F72A 4A6EA 4LLNA 3T8TA 2Z99A 3KP4A 5DCMB 3SFZA 2M87A 1T2KA 2KRFA 4BHBA 4MTEA 3ZN0A 1RUNA 2KJBA 5LGUA 2VT2A 1UCRA 1SFUA 1BI3A 3T0YA 2V1DA 4XSZF 2DI3A 2D2WA 2QLZA 2PMUA 1OMIA 1KU3A 4EV0A 5J6XA 1XD7A 4H0EA 3AAFA 3IWFA 3F21A 4UV8A 1ZN2A 2V1UA 3WODF 3FM3A 2P5KA 2M30A 1LVAA 3V8JA 5HLHA 1I27A 2G7UA 1YS7A 4CICA 4M9ZA 2XAGA 4BQAA 2OBPA 2Z3YA 1GXQA 1KA8A 4LJZF 4KFCA 1S7AA 5BQTA 1W7PD 3LAPA 2GAUA 2JPCA 2F5FA 1XB4A 4HBLA 1D8JA 3GFLA 3DEUA 2H94A 1JXSA 2Z5UA 1IN6A 3ELKA 4G8XA 3ZMZA 1FP1D 1ZHFA 4DQ2A 2L4AA 5IT3A 2FE3A 3K1NA 3RIRA 1QQIA 1B1BA 3JAMZ 5KVRA 1GVJA 1VTNC 2NAZA 2DPDA 2VBXA 5E1ZB 5D5VB 2F5DA 2OD5A 4M71A 4PCQA 3JSOA 2CW0F 2ZJ2A 1FLIA 2HDCA 2KIMA 3WTZA 3WTWC 1P2FA 5TRDA 3ZMUA 1LNWA 3F3XA 1QBJA 2JSCA 3WTTC 4HDUA 2QBYA 3G3ZA 3EETA 1Q1HA 1PP7U 1YS6A 4BXUA 2L3DA 3B73A 1Z05A 4O3MA 2H09A 3FXUA 3OOPA 3L7WA 2HYFA 4L0ZB 4KT5C 5LHGA 3Q5FA 3QP5A 3K9TA 1BOAA 1J9IA 1J7KA 4UVCA 1X3UA 5D5XB 3DKWA 2CSOA 5HLGA 5HDNA 4ZZDA 1RZ4A 4EM2A 1Y0UA 5HS7A 3E3VA 2P7VB 2K86A 2DPUA 1S8NA 4EMSA 2H6BA 3ROUA 2RN7A 4Q4ZF 3R4KA 2O0YA 2E7WA 5K5OA 1YIOA 2ZNYA 4ZYDA 3SZTA 2BE5F 1T39A 4YIFA 2HR3A 2HKOA 5AONA 1IN5A 2L02A 5JHUA 1B4AA 3GUDA 3ABTA 2XASA 3L9FA 5CVRA 4MHGA 2DT5A 1XCBA 3RDIA 1BBYA 5K1YA 4MQVA 2WTEA 1W4MA 1S3JA 3GZ5A 2CGPA 5IT9Z 2XV4S 3SHFA 2EA2A 3WTXC 1WKMA 4AWXB 4IF4A 1JE8A 1HKTA 2V9VA 2HS5A 5JFRA 4OIOF 3TO7A 1LEAA 4XSXF 5BMZA 2ZFWA 1RNLA 4RGSA 2ZXJA 4U7BA 4G6QA 2LNBA 4M6YA 1I1GA 2M5WA 5K5RA 1LDJA 1ZLJA 1ZG1A 3G73A 2P5VA 4WCGA 4WK8F 4HQEA 2GA1A 1FYLA 1ON2A 2BEOA 2DK5A 5LHHA 2A5YB 1F4KA 2A68F 3BPVA 4EQQA 2EFWA 2AS5F 4MGRA 3L2CA 4ETSA 1UB9A 3K69A 3U2RA 3MFKA 3EQLF 4XRFA 2XAHA 4ENMA 4JK1X 1SD4A 3C3WA 3GZ6A 1Z6RA 1IXCA 2QUFA 3HUGA 4CHUA 3CJNA 1FSEA 4IHTA 4FT8A 4M74A 2DQRA 3CLOA 1H9TA 4RS8A 1G3WA 3HTUA 3ZPLA 1WRJA 1SMYF 1KQ0A 3LA3A 3J80K 4ENNA 3TKYA 4HF1A 1W7PA 2RGVA 3WGGA 3ZQ7A 3RJPA 1Z7UA 2RC4A 3ZMTA 2VE8A 2O8XA 4E70A 1IF1A 4RB1A 3WE3A 2HZTA 4KDPA 1MGTA 1RUOA 1Z9CA 2R3SA 4U7DA 4G7HF 1LEBA 3W6KB 2XAQA 2DQLA 5E20A 1SMTA 1I6XA 1HSTA 2IW5A 5F64A 4CGZA 2A6EF 2W24A 2IT0A 2QZ8A 4KNYA 3FXQA 2HQRA 1R36A 2DK8A 5L3CA 2TDXA 3FF5A 2ESHA 1B6AA 2XUBA 3FWEA 3HRSA 2MA3A 3HRMA 3O6BB 4LB6B 1KGSA 4U0VA 2MD5A 3QOPA 2LKPA 4OMZA 4A0YA 4ASNA 4A5MA 4ESFA 4EGZA 3HOSA 3FMQA 1REPC 3DQVC 4UHTA 1YFHA 3GEZA 4EJVA 5H6QA 4HYEA 4GYIA 3V8KA 4F7ZA 3CDHA 3IWZA 2K4JA 5FO5A 2DTRA 4UVBA 2K4BA 3R0JA 1KU2A 4BHPA 3DP7A 4HF0A 4LK0F 1YW8A 3I54A 2XROA 2L01A 1U2WA 1K6OA 4AVPA 2KIUA 3GO5A 2GWRA 4HX7A 2VONA 2V6CA 2EFOA 5D5UB 3GF2A 5JVTA 4M9XA 1FBQA 3BPXA 3PQJA 4L9VA 1U78A 1USSA 4I09A 2M1BA 4D0PA 3F8NA 4P96A 5TJJA 2IA1A 1Z91A 1F5TA 3FHZA 3VFZA 2UXNA 1ZGJA 2AXLA 3FZVA 3I4PA 4IRHA 1QZZA 2FMLA 4S05A 1FWZA 1U5TC 3HTSB 1YQAA 1BIAA 2M45A 4N9HA 5FB2A 1R5GA 5DD8A 4KIGA 3KP2A 4MEYF 5FGMA 3HRUA 1BC7C 3HSFA 2A61A 3LSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A3S A;  2QYO A;  3LFK A;  1UST A;  1ON1 A;  4LLL A;  1ZRF A;  2WC2 A;  2XRN A;  2IP2 A;  2A6H F;  3WTV C;  4GYG A;  4G94 A;  2JZY A;  2MC3 A;  3BWG A;  4EGY A;  1PDN C;  4PGG A;  2F5E A;  4IRG A;  1U6G A;  1MD0 A;  4LGW A;  3TDU C;  5A2Q K;  3J81 K;  1IRF A;  1TQP A;  5ILU A;  3K1P A;  3IRQ A;  3WGI A;  1JHF A;  2K27 A;  3PQK A;  2HFH A;  4HQM A;  2ELH A;  3BOQ A;  2D1H A;  2W85 A;  2FEZ A;  4CXF A;  1SD7 A;  4HZF A;  2YU3 A;  4RGR A;  4RB0 A;  2MLG A;  5ICF A;  5FLX K;  4RAZ A;  2PBI A;  4GGG A;  4M73 A;  3HOT A;  3K0L A;  4KYW A;  4Q5S F;  3WTS C;  2QQ9 A;  3RPQ A;  1ZG3 A;  4PZJ A;  5F1R A;  2XKP A;  5CVI A;  4KMF A;  3H3U A;  1FY7 A;  2IA0 A;  4OU0 A;  3P9C A;  2XVC A;  1GXP A;  1O7F A;  4BNC A;  1P4A A;  1LJ9 A;  4LMY A;  4OIR F;  1XN7 A;  3KP7 A;  3BY6 A;  5E1X A;  1R1T A;  3ABU A;  1S29 A;  2IVM A;  3E97 A;  4LB5 A;  3V4G A;  5HLI A;  2EV6 A;  4P9U A;  1Z1D A;  3TQN A;  1IZ1 A;  5ICG A;  2RKH A;  3KCC A;  1R58 A;  1YG2 A;  3RYR A;  2Z9O A;  5D5W B;  2W25 A;  1UHM A;  5CVJ A;  1QNT A;  1G6N A;  3NEU A;  4A12 A;  1F9N A;  4CO8 A;  2J5O A;  4KA4 A;  3DPL C;  5DCF A;  2EA4 A;  3N4M A;  4M9S A;  4A0Z A;  3GYH X;  1STZ A;  2HTS A;  4Y15 A;  3REO A;  3E5Q A;  2G7H A;  1OYW A;  1XGM A;  2VOD A;  3KEQ A;  3BJA A;  4IRI A;  3U9G A;  2YR2 A;  3LA7 A;  3CUQ C;  1ZRC A;  2DFI A;  1TLH B;  1D3Y A;  3F6O A;  5HS9 A;  4EJT A;  4WF2 A;  4EM0 B;  2EK5 A;  1TW2 A;  3GXO A;  2PLY A;  2FOK A;  2JRT A;  2FNP A;  2RDP A;  4MTD A;  1B59 A;  1SFE A;  2GA2 A;  5DDG A;  1G3S A;  2PN6 A;  3F8B A;  4Z2Y A;  1TQI A;  3L00 A;  4L9J A;  5D8L B;  3MEX A;  1R00 A;  4R79 A;  3E6M A;  1P92 A;  1KYW A;  4I0B A;  3BRO A;  1T98 A;  2CFX A;  2DO7 A;  1ZH5 A;  2HTJ A;  3WU0 A;  3BZ6 A;  3WU1 B;  1ODD A;  1F1Z A;  4I02 A;  2G9W A;  2P5L C;  2F5C A;  2E1C A;  3T1B A;  4O5V A;  1YO5 C;  4ESJ A;  5KK1 A;  1JGS A;  5J8C A;  1WSU A;  4ON0 A;  3R0A A;  1FNN A;  5J8F A;  3NRV A;  5LEJ A;  4UNO A;  2NNN A;  5FFX A;  4AIK A;  3TO9 A;  1T6S A;  1XDS A;  2UZK A;  3R60 A;  2EB7 A;  1IAW A;  1FP2 A;  4PDK A;  1Z6T A;  4GCV A;  4YFN F;  3LA2 A;  5E18 F;  1IXS B;  3HRT A;  2VBW A;  1LQ1 A;  3F8M A;  4HX4 A;  4IXA A;  2J5P A;  4QWQ A;  3HIF A;  2Z33 A;  5DD4 A;  5ILS A;  1EH6 A;  2FXA A;  3TOA A;  3KP3 A;  1IN4 A;  1U8R A;  3F22 A;  3IKT A;  3TDZ C;  1V4R A;  2IPQ X;  2D45 A;  1XMA A;  4S04 A;  2EV5 A;  3V7R A;  3J80 Z;  1XDU A;  2B0L A;  2EJR A;  5EEG A;  4BHC A;  5LLQ A;  1R22 A;  2VC0 A;  4HW0 A;  1C0W A;  3FXR A;  1SD5 A;  2NS0 A;  2EFP A;  4JQF A;  2KKO A;  2ZKZ A;  2C6Y A;  1SD6 A;  4WX9 A;  3QU6 A;  4EM1 A;  2CYY A;  1J75 A;  2VXZ A;  3C1D A;  3V7C A;  2OAZ A;  4MNU A;  4HX8 A;  3C7J A;  3R6S A;  3DFG A;  4KIB A;  6PAX A;  4U88 A;  3K1M A;  2FBI A;  2O3F A;  5E8I A;  1IN8 A;  3D5L A;  2JT1 A;  2LF8 A;  5H6R A;  1U5T A;  5LEK A;  4WWC A;  3I0T A;  3ERE D;  1XMK A;  5DCM A;  2A69 F;  2LDU A;  4ZZL A;  2QBY B;  3SQN A;  3HHG A;  4YG2 F;  4L18 B;  3OV8 A;  2XIG A;  1MKM A;  2EFQ A;  3KP6 A;  2LF7 A;  3VOE A;  1J0R A;  2QWW A;  1T38 A;  2PQ8 A;  1K7A A;  4RAY A;  2DU9 A;  2XKO A;  4L5I A;  2RV8 A;  4GO1 A;  4LG0 A;  4N9I A;  3I71 A;  3RKX A;  2KJC A;  2L54 A;  3R61 A;  1FT9 A;  3KP5 A;  4RGX A;  2RNJ A;  2DBB A;  4CYD A;  2X0L A;  1UHW A;  3ECO A;  2NYX A;  1BI1 A;  2ZNZ A;  1ZGA A;  1P6R A;  3I59 A;  3P7N A;  3O3K A;  4OIQ F;  3S2W A;  4AD9 A;  3EYY A;  4B8X A;  3KZZ A;  4ENJ A;  2K7L A;  3V8L A;  2FBH A;  2FSW A;  2ZO4 A;  1J2X A;  3F8C A;  5BS6 A;  2W57 A;  1XSV A;  4QLC U;  2HEO A;  5H20 A;  5L3D A;  2HOE A;  4AIJ A;  1CGP A;  1D5V A;  2VT3 A;  1UFM A;  1P4W A;  4RGU A;  2HQN A;  2XGX A;  5ED4 A;  2OQG A;  2UWM A;  1MDM A;  5LRR A;  5CLS A;  3QAH A;  1KYZ A;  4A5N A;  4RB2 C;  2XAJ A;  4XLN F;  3JTH A;  2A07 F;  2COM A;  3GW2 A;  3VB2 A;  3ULQ B;  4MQ9 F;  4R8H A;  4HAM A;  1DUX C;  2VE9 A;  1D8K A;  1G3T A;  4LFU A;  5BOX A;  3M8F A;  3P9K A;  4M72 A;  2UXX A;  3KEO A;  3TO6 A;  1E2X A;  4I98 B;  2MLK A;  3IHU A;  1MJ9 A;  3GWZ A;  4OMY A;  3MZY A;  5A2Q Z;  1R7J A;  3J81 Z;  1O57 A;  3EYI A;  4WXD A;  3GLX A;  3JW4 A;  1DDN A;  1L3L A;  4DNC A;  2MH9 A;  3CUQ A;  4ZYG A;  4XBF A;  2F2E A;  2R7D A;  5E8G A;  1K78 A;  1OYY A;  3EDP A;  1IUY A;  5CJ9 A;  4O6J A;  1WQ2 A;  4RB3 C;  5FLX Z;  3HHH A;  4CZZ A;  3H3Z A;  4HDV A;  2FMY A;  2OU2 A;  3Q9V A;  3QRF F;  5ERI A;  3JSP A;  5HDK A;  1MJA A;  3KE2 A;  4P9F A;  1U5T B;  1FSH A;  3DPT A;  4YFX F;  3DXJ F;  4A0X A;  3KFW X;  2PMH A;  5L3G A;  3V7S A;  3I53 A;  5D6F A;  1KQ8 A;  2ESN A;  1W7P B;  4K2E A;  1BN5 A;  3RTR A;  4BYY A;  2ZME A;  2QM3 A;  2GIV A;  4I01 A;  4M6X A;  3IL2 A;  1YW7 A;  2CO5 A;  2PJP A;  2VBZ A;  3IRR A;  3EUH A;  4IHS A;  4KUM A;  2W84 A;  5HOO A;  2D1V A;  2E1N A;  3MWM A;  2DW4 A;  4LG0 B;  1TW3 A;  2EFN A;  5AIP A;  1FYM A;  1W5S A;  3L09 A;  3BDD A;  1BC8 C;  1ZAR A;  3GX4 X;  1KQ9 A;  2BGC A;  1YLF A;  2MH2 A;  2PFB A;  1ULY A;  4KMU X;  1I5Z A;  2O6G E;  3HSR A;  3IKV A;  5BPD A;  3WTU C;  2E7X A;  1O3Q A;  5FD6 A;  2L4M A;  2RVC A;  3I59 B;  4FX0 A;  3FM5 A;  5L3E A;  2FRH A;  1R1U A;  5LBQ A;  3E6C C;  2GXB A;  2YX4 A;  4NHJ A;  5ICC A;  3CTA A;  2OA4 A;  1RIO H;  3M1E A;  1RI7 A;  2OZU A;  1K79 A;  2P4W A;  3KLN A;  2FNA A;  1R1V A;  1OR7 A;  5AIQ A;  1BI2 A;  3W6J B;  1A04 A;  2JPB A;  5ILV A;  5K5Q A;  4HV5 A;  2CWE A;  5CVU A;  5D4S A;  4ESB A;  4G7Z F;  2VN2 A;  1QO0 D;  1MDM B;  4MEX F;  4A6D A;  1V3F A;  4FX4 A;  1XCV A;  3I58 A;  3MQ0 A;  5DUK A;  4LD5 A;  5DUI A;  3KZY A;  1IXR C;  3BJ6 A;  3NQO A;  2FU4 A;  2V1X A;  1KU7 A;  4L5J A;  2RQP A;  2IRF G;  1QPM A;  3QPH A;  4LK1 F;  1TNT A;  3E6D A;  3LQR A;  1MZB A;  2ADU A;  1ZLK A;  2GZW A;  5E1W A;  1IN7 A;  1S7O A;  4WXH A;  3WGH A;  2NRA C;  1OPC A;  5JI6 A;  3ZN1 A;  4Q48 A;  3N97 A;  2HYG D;  1R23 A;  3T5X A;  1R5H A;  3CO6 C;  1DP7 P;  1WWX A;  1TBX A;  2H6C A;  4G9Y A;  2BYV E;  2VC1 A;  4IJA A;  1T0F A;  5LHI A;  1HXD A;  3O2P E;  4HF2 A;  4EJU A;  1BM9 A;  2XAF A;  2GXG A;  1AWC A;  4HLY A;  3CUQ B;  1AOY A;  4ENK A;  3KLO A;  2PG4 A;  4CDG A;  1K78 B;  1HKS A;  3JTG A;  1XGS A;  5BPI A;  4L9T A;  2ZCW A;  1P4X A;  1W5T A;  1SAX A;  4KN7 X;  2OQR A;  3MAJ A;  3JAM K;  3HSE A;  2BBY A;  4EJO A;  2OZ6 A;  1O3S A;  1FYK A;  3RKY A;  1ZRE A;  1HSJ A;  1E17 A;  4LLG F;  2P7C B;  3WG9 A;  4A2U A;  2MBF A;  3K2Z A;  2Q0O A;  4KN4 X;  2IA2 A;  1FC3 A;  4YII A;  4Y17 A;  1NHA A;  2YSR A;  5D6E A;  4U0W A;  1XSX A;  1HW5 A;  3CO7 C;  4G6D A;  4KIF A;  2ZME B;  3WE2 A;  5HDG A;  1O7L A;  3IC7 A;  2V79 A;  2ACJ A;  1TTY A;  5FD5 A;  2KIF A;  4L9N A;  5F6F A;  3ECH A;  2Y48 A;  1L0O C;  3QPT A;  5JR3 A;  5D4R A;  1BJA A;  2WV0 A;  3ML6 A;  4L0Y B;  2IJL A;  4EJW A;  3MZH A;  1J5Y A;  5LGT A;  3M8E A;  2QQA A;  3E5U A;  2Y0M A;  1FBS A;  1XGO A;  1O3T A;  2STW A;  4NB5 A;  4GXO A;  2O03 A;  1QGP A;  4ZH4 F;  4G7O F;  1OKR A;  3M9A A;  1GHC A;  1KU9 A;  3GFJ A;  1XGN A;  4OOI A;  4B09 A;  3ISP A;  2PI0 A;  5HVQ C;  3HYI A;  4I0A A;  3I64 A;  2YPR A;  3H92 A;  3T8R A;  4UXN A;  1JHH A;  4ZYH A;  2PEX A;  2CG4 A;  3RKW A;  5DV5 A;  5DEQ A;  3GVA A;  2EWN A;  2HWV A;  1DPR A;  1YYV A;  2M8E A;  3E6B A;  4P55 A;  1CF7 A;  4N0B A;  3VOD A;  1G3Y A;  4I2O A;  4HLX A;  3TGN A;  1DPU A;  3D0S A;  4IVN A;  4HOB A;  5L3F A;  2WWY A;  5IT9 K;  5D8K B;  5FFZ A;  5CYV A;  2ISZ A;  3U1D A;  1HKQ A;  1HW2 A;  3PFI A;  2Q2E A;  4AIH A;  2R7F A;  4P5O A;  4R1H A;  4HV6 A;  1I1S A;  1ONV A;  2HKX A;  3RYP A;  3SXY A;  3COA C;  3ZP5 A;  1H0M A;  4ZYE A;  3C18 A;  4IPA A;  3LAJ A;  2XHK A;  4U0Y A;  2ZBK A;  3FX3 A;  2CQK A;  2ISY A;  1SFX A;  1BIB A;  4I7H A;  1FOK A;  3RPU A;  2QQB A;  1QZY A;  1MJB A;  3BP8 A;  2P6S A;  2O61 A;  1B9M A;  2NNY A;  3ZMD A;  3KET A;  1TNS A;  2QVO A;  4HA8 A;  4JBA A;  1HQC A;  3F6V A;  5DYM A;  4UUV A;  2BV6 A;  2GQQ A;  3E5X A;  2VOO A;  4WXC A;  5LRS A;  2HGC A;  2P6T A;  3M7G A;  2QEN A;  3QU3 A;  2VBY A;  3DV8 A;  3LWF A;  1PP8 F;  1FBU A;  1B9N A;  1ZAO A;  1LB2 A;  2K02 A;  5CVV A;  1BI0 A;  4BH9 A;  1J59 A;  1LDD A;  1ZRD A;  4Q47 A;  3ZMS A;  5HS8 A;  3DF8 A;  5ICE A;  2JTV A;  4FHT A;  2FF4 A;  1EV7 A;  4BAY A;  4OIN F;  2ETH A;  1LDK B;  4OIP F;  1HBX G;  4KIC A;  3LQQ A;  4UVA A;  4NQW A;  1U3E M;  3WTY C;  1H9G A;  4YFK F;  2EV0 A;  2Q8K A;  4PGH A;  1ZG5 A;  1YTY A;  3F8F A;  3MCZ A;  5EEH A;  1ZYR F;  3SZP A;  1HW1 A;  2STT A;  5L3B A;  3BJO A;  2DAO A;  3RI4 A;  3QP6 A;  3FMS A;  3B02 A;  4UV9 A;  4TV7 A;  3GFM A;  3J7A O;  3I5U A;  1OYI A;  1FX7 A;  1G4D A;  2YX7 A;  4XLP F;  1O3R A;  2FBK A;  3CUO A;  1YW9 A;  1PUE E;  4Y13 A;  1WI9 A;  1FZP B;  2FQ3 A;  3GFI A;  1EH7 A;  5LGN A;  4EVI A;  3ZMV A;  3Q9S A;  1TQM A;  2Y75 A;  2DLL A;  1CF7 B;  1IRG A;  1FPQ A;  2FA5 A;  2P8T A;  5E17 F;  3TOB A;  1IW7 F;  3VEP A;  1EH8 A;  2LSO A;  3FMR A;  2VOP A;  1XSD A;  1S6L A;  2X4H A;  3P9I A;  3F23 A;  2H27 A;  3F72 A;  4A6E A;  4LLN A;  3T8T A;  2Z99 A;  3KP4 A;  5DCM B;  3SFZ A;  2M87 A;  1T2K A;  2KRF A;  4BHB A;  4MTE A;  3ZN0 A;  1RUN A;  2KJB A;  5LGU A;  2VT2 A;  1UCR A;  1SFU A;  1BI3 A;  3T0Y A;  2V1D A;  4XSZ F;  2DI3 A;  2D2W A;  2QLZ A;  2PMU A;  1OMI A;  1KU3 A;  4EV0 A;  5J6X A;  1XD7 A;  4H0E A;  3AAF A;  3IWF A;  3F21 A;  4UV8 A;  1ZN2 A;  2V1U A;  3WOD F;  3FM3 A;  2P5K A;  2M30 A;  1LVA A;  3V8J A;  5HLH A;  1I27 A;  2G7U A;  1YS7 A;  4CIC A;  4M9Z A;  2XAG A;  4BQA A;  2OBP A;  2Z3Y A;  1GXQ A;  1KA8 A;  4LJZ F;  4KFC A;  1S7A A;  5BQT A;  1W7P D;  3LAP A;  2GAU A;  2JPC A;  2F5F A;  1XB4 A;  4HBL A;  1D8J A;  3GFL A;  3DEU A;  2H94 A;  1JXS A;  2Z5U A;  1IN6 A;  3ELK A;  4G8X A;  3ZMZ A;  1FP1 D;  1ZHF A;  4DQ2 A;  2L4A A;  5IT3 A;  2FE3 A;  3K1N A;  3RIR A;  1QQI A;  1B1B A;  3JAM Z;  5KVR A;  1GVJ A;  1VTN C;  2NAZ A;  2DPD A;  2VBX A;  5E1Z B;  5D5V B;  2F5D A;  2OD5 A;  4M71 A;  4PCQ A;  3JSO A;  2CW0 F;  2ZJ2 A;  1FLI A;  2HDC A;  2KIM A;  3WTZ A;  3WTW C;  1P2F A;  5TRD A;  3ZMU A;  1LNW A;  3F3X A;  1QBJ A;  2JSC A;  3WTT C;  4HDU A;  2QBY A;  3G3Z A;  3EET A;  1Q1H A;  1PP7 U;  1YS6 A;  4BXU A;  2L3D A;  3B73 A;  1Z05 A;  4O3M A;  2H09 A;  3FXU A;  3OOP A;  3L7W A;  2HYF A;  4L0Z B;  4KT5 C;  5LHG A;  3Q5F A;  3QP5 A;  3K9T A;  1BOA A;  1J9I A;  1J7K A;  4UVC A;  1X3U A;  5D5X B;  3DKW A;  2CSO A;  5HLG A;  5HDN A;  4ZZD A;  1RZ4 A;  4EM2 A;  1Y0U A;  5HS7 A;  3E3V A;  2P7V B;  2K86 A;  2DPU A;  1S8N A;  4EMS A;  2H6B A;  3ROU A;  2RN7 A;  4Q4Z F;  3R4K A;  2O0Y A;  2E7W A;  5K5O A;  1YIO A;  2ZNY A;  4ZYD A;  3SZT A;  2BE5 F;  1T39 A;  4YIF A;  2HR3 A;  2HKO A;  5AON A;  1IN5 A;  2L02 A;  5JHU A;  1B4A A;  3GUD A;  3ABT A;  2XAS A;  3L9F A;  5CVR A;  4MHG A;  2DT5 A;  1XCB A;  3RDI A;  1BBY A;  5K1Y A;  4MQV A;  2WTE A;  1W4M A;  1S3J A;  3GZ5 A;  2CGP A;  5IT9 Z;  2XV4 S;  3SHF A;  2EA2 A;  3WTX C;  1WKM A;  4AWX B;  4IF4 A;  1JE8 A;  1HKT A;  2V9V A;  2HS5 A;  5JFR A;  4OIO F;  3TO7 A;  1LEA A;  4XSX F;  5BMZ A;  2ZFW A;  1RNL A;  4RGS A;  2ZXJ A;  4U7B A;  4G6Q A;  2LNB A;  4M6Y A;  1I1G A;  2M5W A;  5K5R A;  1LDJ A;  1ZLJ A;  1ZG1 A;  3G73 A;  2P5V A;  4WCG A;  4WK8 F;  4HQE A;  2GA1 A;  1FYL A;  1ON2 A;  2BEO A;  2DK5 A;  5LHH A;  2A5Y B;  1F4K A;  2A68 F;  3BPV A;  4EQQ A;  2EFW A;  2AS5 F;  4MGR A;  3L2C A;  4ETS A;  1UB9 A;  3K69 A;  3U2R A;  3MFK A;  3EQL F;  4XRF A;  2XAH A;  4ENM A;  4JK1 X;  1SD4 A;  3C3W A;  3GZ6 A;  1Z6R A;  1IXC A;  2QUF A;  3HUG A;  4CHU A;  3CJN A;  1FSE A;  4IHT A;  4FT8 A;  4M74 A;  2DQR A;  3CLO A;  1H9T A;  4RS8 A;  1G3W A;  3HTU A;  3ZPL A;  1WRJ A;  1SMY F;  1KQ0 A;  3LA3 A;  3J80 K;  4ENN A;  3TKY A;  4HF1 A;  1W7P A;  2RGV A;  3WGG A;  3ZQ7 A;  3RJP A;  1Z7U A;  2RC4 A;  3ZMT A;  2VE8 A;  2O8X A;  4E70 A;  1IF1 A;  4RB1 A;  3WE3 A;  2HZT A;  4KDP A;  1MGT A;  1RUO A;  1Z9C A;  2R3S A;  4U7D A;  4G7H F;  1LEB A;  3W6K B;  2XAQ A;  2DQL A;  5E20 A;  1SMT A;  1I6X A;  1HST A;  2IW5 A;  5F64 A;  4CGZ A;  2A6E F;  2W24 A;  2IT0 A;  2QZ8 A;  4KNY A;  3FXQ A;  2HQR A;  1R36 A;  2DK8 A;  5L3C A;  2TDX A;  3FF5 A;  2ESH A;  1B6A A;  2XUB A;  3FWE A;  3HRS A;  2MA3 A;  3HRM A;  3O6B B;  4LB6 B;  1KGS A;  4U0V A;  2MD5 A;  3QOP A;  2LKP A;  4OMZ A;  4A0Y A;  4ASN A;  4A5M A;  4ESF A;  4EGZ A;  3HOS A;  3FMQ A;  1REP C;  3DQV C;  4UHT A;  1YFH A;  3GEZ A;  4EJV A;  5H6Q A;  4HYE A;  4GYI A;  3V8K A;  4F7Z A;  3CDH A;  3IWZ A;  2K4J A;  5FO5 A;  2DTR A;  4UVB A;  2K4B A;  3R0J A;  1KU2 A;  4BHP A;  3DP7 A;  4HF0 A;  4LK0 F;  1YW8 A;  3I54 A;  2XRO A;  2L01 A;  1U2W A;  1K6O A;  4AVP A;  2KIU A;  3GO5 A;  2GWR A;  4HX7 A;  2VON A;  2V6C A;  2EFO A;  5D5U B;  3GF2 A;  5JVT A;  4M9X A;  1FBQ A;  3BPX A;  3PQJ A;  4L9V A;  1U78 A;  1USS A;  4I09 A;  2M1B A;  4D0P A;  3F8N A;  4P96 A;  5TJJ A;  2IA1 A;  1Z91 A;  1F5T A;  3FHZ A;  3VFZ A;  2UXN A;  1ZGJ A;  2AXL A;  3FZV A;  3I4P A;  4IRH A;  1QZZ A;  2FML A;  4S05 A;  1FWZ A;  1U5T C;  3HTS B;  1YQA A;  1BIA A;  2M45 A;  4N9H A;  5FB2 A;  1R5G A;  5DD8 A;  4KIG A;  3KP2 A;  4MEY F;  5FGM A;  3HRU A;  1BC7 C;  3HSF A;  2A61 A;  3LST A; 
#chains in the Genus database with same CATH topology
 1BR4 A;  2A3S A;  2LOO A;  2QYO A;  3S1M J;  2NS8 A;  3LFK A;  2O9L A;  1Q1V A;  1UST A;  4E6K G;  2WBM A;  2NVX J;  5FRO A;  3J7A Y;  1ON1 A;  4LLL A;  1NG6 A;  2DA3 A;  3A0H C;  3I3L A;  1ZRF A;  4E7K A;  2WC2 A;  1LE8 A;  1JKO C;  2XRN A;  2IP2 A;  2A6H F;  4M3E A;  5C4X J;  3WTV C;  4GFB A;  1GDT A;  2M7B A;  1POG A;  4GYG A;  4G94 A;  2JUG A;  2JZY A;  5E3M A;  2MC3 A;  3BWG A;  2HVQ A;  4EGY A;  1PDN C;  4PGG A;  3OYA A;  2F5E A;  4IRG A;  5F0H A;  1U6G A;  4XN0 A;  2VXD A;  1MD0 A;  4LGW A;  3TDU C;  5A2Q K;  3J81 K;  5CQG A;  1T33 A;  1IRF A;  1TQP A;  2DA4 A;  2H1L A;  3W3C A;  5ILU A;  2XSJ C;  3K1P A;  3IRQ A;  1ORK A;  3WGI A;  1JHF A;  3BTL A;  2K27 A;  2GOX B;  2WAQ N;  3KEY A;  3PQK A;  2HFH A;  3H3V K;  1F43 A;  4HQM A;  2ELH A;  2JQ7 A;  3BOQ A;  4RAG A;  2D1H A;  2W85 A;  3H5A A;  5BNG A;  3S8P A;  2FEZ A;  3RZD J;  4CXF A;  1SD7 A;  2OC6 A;  4HZF A;  2DDA A;  2YUS A;  2ZSH B;  4MO7 A;  2YU3 A;  4RGR A;  4RB0 A;  2MLG A;  5ICF A;  2BY0 A;  5FLX K;  4RAZ A;  2PBI A;  3HBL A;  4GGG A;  4M73 A;  2I5U A;  3HOT A;  4RM3 A;  4C2U A;  3K0L A;  4KYW A;  4Q5S F;  3K4C A;  3WTS C;  1WJD A;  2XB0 X;  2JA7 J;  2N8G A;  2QQ9 A;  3RPQ A;  1ZG3 A;  2HQ5 A;  3WHC A;  4PZJ A;  5F1R A;  1XPX A;  2LTP A;  2V7F A;  2W4S A;  2XKP A;  4B44 A;  5CVI A;  4KMF A;  3H3U A;  1FY7 A;  2QCO A;  2IA0 A;  4G12 A;  3CES A;  1YIT I;  2CV0 A;  2CMP A;  2LRE A;  4C9Y A;  4CUG A;  4OU0 A;  2Y31 A;  3P9C A;  3DKY A;  2XVC A;  1GXP A;  1O7F A;  5J4V A;  1JKQ C;  4BNC A;  1P4A A;  1LJ9 A;  4LMY A;  4OIR F;  1XN7 A;  3KP7 A;  3HZJ A;  3BY6 A;  3RZO J;  5JVG F;  3PO2 J;  5E1X A;  3C2H A;  1E3H A;  4XIC A;  3A01 A;  1R1T A;  4P1W A;  4X1E A;  4QSH A;  2BXY A;  2X6O A;  1ZTR A;  2DFF A;  2P0W A;  3ABU A;  1S29 A;  2IVM A;  3E97 A;  3RPU D;  3V4G A;  4LB5 A;  5HLI A;  2EV6 A;  4C3J J;  4P9U A;  3Q0U A;  1Z1D A;  3TQN A;  2OTL I;  1IZ1 A;  5ICG A;  2RKH A;  3KCC A;  1R58 A;  1YG2 A;  2ECB A;  1W5C C;  3H1C A;  3RYR A;  2Z9O A;  5D5W B;  2L5Q A;  2W25 A;  1UHM A;  3G4S I;  4A3G J;  4D9J A;  5HNH A;  5CVJ A;  3H5R A;  1QNT A;  3CCU I;  1S72 I;  1G6N A;  3NEU A;  4A12 A;  1F9N A;  3MKZ A;  4XNF A;  4CO8 A;  5KNL A;  3HJE A;  2J5O A;  4B47 A;  4KA4 A;  3DPL C;  5DCF A;  2EA4 A;  3QYF A;  3N4M A;  4M9S A;  4A0Z A;  3GYH X;  1STZ A;  1JJ8 C;  1X4O A;  4U87 A;  3OS0 A;  2HTS A;  4Y15 A;  3REO A;  1MMD A;  3E5Q A;  2JN6 A;  2L2O A;  2G7H A;  1OYW A;  4E7Z A;  1XGM A;  1XX5 A;  2VOD A;  3KEQ A;  3BJA A;  4IRI A;  4C3H J;  3I9V 2;  3U9G A;  1W0U A;  2YR2 A;  3LA7 A;  3G6E I;  3CUQ C;  3X2Q H;  1ZRC A;  4PFO A;  4A93 J;  1DGW Y;  2DMQ A;  4Y33 A;  2IS2 A;  2DFI A;  3S16 J;  2IS6 A;  3LSJ A;  4BUP A;  1TLH B;  1X2M A;  3RQI A;  4BJT A;  1D3Y A;  2DOF A;  4A3I J;  1VQM I;  3F6O A;  5HS9 A;  4EJT A;  4WF2 A;  4EM0 B;  5EG0 A;  2EK5 A;  1TW2 A;  3GXO A;  2L9V A;  2PLY A;  2FOK A;  2JRT A;  2FNP A;  4X6A J;  2RDP A;  1GVD A;  2AHQ A;  1ETX A;  3SJM A;  4MTD A;  1B59 A;  1SFE A;  2GA2 A;  5DDG A;  2M2E A;  1G3S A;  2PN6 A;  3VDX A;  3F8B A;  4Z2Y A;  1TQI A;  1WHU A;  3OIO A;  2XSD C;  4XKV A;  1OCR H;  3L00 A;  3LSK A;  4L9J A;  5D8L B;  3MEX A;  1R00 A;  2MSY A;  4R79 A;  3E6M A;  2ELJ A;  1A5J A;  2XPV A;  3OYM A;  1P92 A;  1FOW A;  1KON A;  3GTO J;  3K4M A;  1KYW A;  2O7O A;  5K7H A;  4M3D A;  4CYC A;  1FOX A;  4I0B A;  3BRO A;  1T98 A;  5F0F A;  2CFX A;  2DO7 A;  3S3M A;  1ZH5 A;  2HTJ A;  3OIP A;  1MBJ A;  3WU0 A;  2W1O A;  1BJZ A;  3BZ6 A;  4EAT A;  3FBI B;  2ZME C;  3WU1 B;  2JA6 J;  3CP8 A;  3OS1 A;  1ODD A;  2E2I J;  1F1Z A;  2DFE A;  4I02 A;  5LFA A;  2G9W A;  2P5L C;  3E1S A;  2F5C A;  2E1C A;  3T1B A;  4O5V A;  2E71 A;  1YO5 C;  3EUH C;  5DM7 F;  2L7K A;  4ESJ A;  1LE8 B;  4RLF A;  4GRI A;  5IYB J;  5KK1 A;  1JGS A;  2CUF A;  5J8C A;  1Z67 A;  3BR6 A;  1WSU A;  4ON0 A;  1HLV A;  3R0A A;  1FNN A;  2GOM A;  1IO2 A;  3FIS A;  2ZSI B;  5J8F A;  3NRV A;  5LEJ A;  4UNO A;  2NNN A;  2ZFU A;  5FFX A;  2K3F A;  3TO9 A;  4AIK A;  1T6S A;  1XDS A;  2X1D A;  2UZK A;  3R60 A;  2EB7 A;  1IAW A;  3ABK H;  1FP2 A;  2DOD A;  2MYS A;  2ME6 A;  4PDK A;  1Z6T A;  2CJJ A;  4GCV A;  4YFN F;  4BJ6 C;  2LKS A;  3LA2 A;  4UUS B;  5E18 F;  1IXS B;  1OIS A;  3HRT A;  4IKF A;  2VBW A;  4HG2 A;  5J47 A;  4HSR A;  1LQ1 A;  4A3D J;  2KRH A;  3F8M A;  3FIW A;  1G8X A;  2DFH A;  4FIS A;  2GLO A;  4HX4 A;  4IXA A;  2H8W A;  1D0Z A;  2J5P A;  4QWQ A;  4PJN A;  1V5E A;  3MKY B;  2K3P A;  2M34 A;  3HIF A;  2Z33 A;  5DD4 A;  5GP9 A;  3BG3 A;  5ILS A;  4F91 B;  1U0J A;  3KZI C;  1EH6 A;  2FXA A;  3TOA A;  1A36 A;  2DYS H;  3KP3 A;  1IN4 A;  1U8R A;  3U1K A;  3F22 A;  1MMS A;  2EIJ H;  3IKT A;  3TDZ C;  1V4R A;  2IPQ X;  2D45 A;  2VLA A;  1WJC A;  1XMA A;  1EF4 A;  4S04 A;  3ZXS A;  2WAD A;  4F92 B;  1OR7 C;  2EV5 A;  3V7R A;  3J80 Z;  4AUX A;  1ETQ A;  1VND A;  2BY3 A;  2DOA A;  1MH4 A;  5IY5 H;  2CQN A;  2VKH A;  4II2 A;  3ZQL A;  1XDU A;  2B0L A;  2Q1Z B;  2EJR A;  5EEG A;  4BHC A;  2VJ5 A;  5LLQ A;  4IOA F;  2R7T A;  1R22 A;  4ZDO A;  2VC0 A;  4HW0 A;  4XQF A;  4CA0 A;  1MH3 A;  1C0W A;  3FXR A;  1SD5 A;  2NS0 A;  2EFP A;  3PFY A;  4JQF A;  3A01 B;  2KKO A;  2X6Y A;  2ZKZ A;  2C6Y A;  1SD6 A;  4WX9 A;  3CMM A;  3QU6 A;  4EM1 A;  2CYY A;  3OYE A;  1G59 A;  1JT6 A;  3MN2 A;  1J75 A;  2HVR A;  2WA0 A;  3HM5 A;  2VXZ A;  1N77 A;  3C1D A;  3V7C A;  4E7H A;  4IO9 F;  2R7W A;  2OAZ A;  1QA6 A;  4JX4 A;  4L5E A;  4HX8 A;  3C7J A;  4MNU A;  3R6S A;  3DFG A;  3CDI A;  2B7E A;  4KIB A;  6PAX A;  1YX5 A;  4PFP A;  4U88 A;  3K4J A;  5J1U A;  2V4J C;  2LBF A;  3K1M A;  2FBI A;  2O3F A;  3ZOB A;  3GME A;  4B3A A;  2ZB9 A;  5E8I A;  3IV5 A;  2CU7 A;  3RSN A;  1IN8 A;  3JRH A;  3D5L A;  2JT1 A;  4BGD A;  2K40 A;  2LF8 A;  4ABZ A;  1WI3 A;  5H6R A;  1U5T A;  5LEK A;  3WU2 C;  4WWC A;  3I0T A;  3ERE D;  3BG7 A;  1XMK A;  1E0E A;  2QKM B;  1ITY A;  5DCM A;  2A69 F;  2LDU A;  4ZZL A;  3A1Y A;  2QBY B;  3SQN A;  2ECC A;  2Z1D A;  1Z7L A;  3HHG A;  4YG2 F;  1T0F C;  4L18 B;  4BU2 A;  4Y52 J;  3NWS A;  3D5R C;  3OV8 A;  5J3L A;  1VQ8 I;  1DU6 A;  4NC6 A;  1EKE A;  2XIG A;  1HC8 A;  4XLC A;  1MKM A;  2EFQ A;  4A3E J;  3KP6 A;  2LF7 A;  2VIX A;  3VOE A;  4JOM A;  2E2H J;  3HC7 A;  1J0R A;  4YIR X;  2QWW A;  1T38 A;  5IYD J;  2PQ8 A;  3OY9 A;  1K7A A;  2MAB A;  3CCE I;  1VI0 A;  4RAY A;  2BZT A;  2OJE D;  2WB1 A;  2DU9 A;  2XKO A;  2EBI A;  4L5I A;  2RV8 A;  5EG0 B;  4GO1 A;  4E7I A;  1I50 J;  4LG0 A;  2F4M B;  3PIP F;  2XGE A;  4N9I A;  3I71 A;  3RKX A;  2KJC A;  2L54 A;  3R61 A;  2IGM A;  1FT9 A;  3KP5 A;  4F93 B;  4DYR A;  1IC8 A;  5DTD A;  3ABM H;  3BQY A;  3CQZ J;  3DCF A;  2JA2 A;  4RGX A;  3HOZ J;  1QRY A;  1ZKG A;  3GLL A;  2RNJ A;  2DBB A;  4CYD A;  2E5N A;  4MIM A;  2VPL A;  1X1A A;  2X0L A;  3JRE A;  1K6Y A;  5KCM A;  1UHW A;  3ECO A;  1AHD P;  2HXI A;  2NYX A;  4FET A;  1BI1 A;  2ZNZ A;  4CYC B;  1R6R A;  5M3M J;  1ZGA A;  1P6R A;  2E1M B;  1ETO A;  1JTX A;  3I59 A;  3P7N A;  1W0T A;  4LIT A;  2XGD A;  4V2F A;  3CJR B;  3O3K A;  4OIQ F;  3S2W A;  2IBD A;  1DQU A;  4AD9 A;  3EYY A;  1MBE A;  1S5L C;  1BA5 A;  4B8X A;  2RAE A;  3KZZ A;  4ENJ A;  4HNV A;  2K7L A;  3V8L A;  5J40 A;  4FCY A;  2FBH A;  4KIS A;  4RA2 A;  2FSW A;  2ZO4 A;  1J2X A;  1RKT A;  3QPL A;  3F8C A;  3MD2 A;  3I4M J;  5BS6 A;  2W57 A;  1XSV A;  3CCS I;  4ZTJ A;  1VQ6 I;  5J1R A;  1I3A A;  4QLC U;  1NK3 P;  4JYK A;  2HEO A;  5H20 A;  1TWH J;  5L3D A;  2HOE A;  2DMU A;  4AIJ A;  1CGP A;  1D5V A;  2X9D A;  4ZDP A;  3OYD A;  2K5C A;  1Z3X A;  2QF7 A;  2VT3 A;  1ZQ3 P;  1WJB A;  2JJ7 A;  3IP4 B;  1UFM A;  4PSW A;  5HNF A;  1P4W A;  4RGU A;  2VI6 A;  3VSK A;  2HQN A;  2XGX A;  5ED4 A;  2OQG A;  3G71 I;  1VQ7 I;  2UWM A;  1MDM A;  3DTI A;  5LRR A;  5CLS A;  3QAH A;  3CDL A;  1KYZ A;  1Y8Q B;  4A5N A;  4RB2 C;  1BOB A;  1HDP A;  2RRE A;  2R7V A;  2XAJ A;  2OCC H;  4XLN F;  4JX5 A;  3JTH A;  5J4Y A;  2A07 F;  1WJ5 A;  2COM A;  3GW2 A;  1B8I B;  2DA6 A;  5FKN A;  2KIS A;  1VF9 A;  4J01 A;  2HPM A;  1E3P A;  4XM3 A;  2IS4 A;  3VB2 A;  2E19 A;  3KYD B;  1LFU P;  3ULQ B;  3CME I;  2QGU A;  3P5J A;  2RQQ A;  4MQ9 F;  4PK4 A;  4CCN A;  2BXZ A;  4R8H A;  4HAM A;  1SC7 A;  5FKK A;  1DUX C;  3S1N J;  3S1Q J;  2VE9 A;  1D8K A;  3IH2 A;  1G3T A;  4XLE A;  4LFU A;  4A3L J;  3HKZ A;  1U9N A;  3DTK A;  2LP0 A;  5BOX A;  3M8F A;  4KJZ A;  3P9K A;  4M72 A;  2UXX A;  3KEO A;  3TO6 A;  3IUO A;  1E2X A;  1WVR A;  4UY8 I;  4I98 B;  3S1R J;  2MLK A;  1MSE C;  3IHU A;  1UMQ A;  4YEL A;  4BBS J;  4F3Q A;  3I4N J;  1JT0 A;  1MJ9 A;  2R5Z A;  3GWZ A;  4OMY A;  3MZY A;  2LD5 A;  3BZK A;  5A2Q Z;  1R7J A;  3J81 Z;  1O57 A;  3EYI A;  1V5F A;  4WXD A;  3GLX A;  3JW4 A;  3KPH A;  1DDN A;  2FD5 A;  1L3L A;  3AFH A;  4DNC A;  2MH9 A;  4CZC A;  3K4L A;  3OL3 A;  1Z21 A;  3CUQ A;  4XBF A;  4ZYG A;  2F2E A;  2R7D A;  4XKC A;  5E8G A;  4C2T A;  1PYV A;  3LMM A;  5EDN A;  1K78 A;  4B48 A;  1OYY A;  3EDP A;  2V9K A;  3K6G A;  1TT5 B;  1ERD A;  1HCR A;  1IUY A;  4E7L A;  5CJ9 A;  4O6J A;  4Z6Y A;  1WQ2 A;  4RB3 C;  5FLX Z;  3HHH A;  2ELK A;  2LBF B;  2ME0 A;  4CZZ A;  1ZGW A;  1AKH A;  3H3Z A;  4HDV A;  2LC2 A;  2X1E A;  2OTJ I;  1A31 A;  1QU3 A;  2FMY A;  2OU2 A;  3L2R A;  4AYB A;  3Q9V A;  1NG7 A;  1LKX A;  3QRF F;  5ERI A;  1I39 A;  3JSP A;  5HDK A;  4C3I J;  4B43 A;  1MJA A;  3KE2 A;  3LL7 A;  4P9F A;  3ZQG A;  1U5T B;  5EEA A;  3WHB A;  1FSH A;  3BG6 A;  3ZCO A;  3DPT A;  3GTG J;  4YFX F;  3DXJ F;  4IEJ A;  4DGW B;  4A0X A;  3KFW X;  4D7M A;  2PMH A;  5L3G A;  1Y56 A;  3V7S A;  2V6E A;  3I53 A;  5D6F A;  1KQ8 A;  3CP2 A;  2ESN A;  1W7P B;  1YHQ I;  1JKP C;  1OLT A;  3A0B C;  4K2E A;  1BN5 A;  3RTR A;  4QIW N;  1QVT A;  4BYY A;  1MBK A;  2ZME A;  3A03 A;  4W1U A;  2QM3 A;  4D5C A;  1D1A A;  2GIV A;  4I01 A;  4M6X A;  4RAF A;  3H0D A;  3IL2 A;  4LIU A;  3D1N I;  1RC9 A;  1ETV A;  1YW7 A;  1YJ9 I;  2CO5 A;  2PJP A;  2VBZ A;  4F52 A;  3IRR A;  2DOE A;  3EUH A;  5EJC A;  3SYT A;  4IHS A;  4KUM A;  4B3X A;  2W84 A;  5HOO A;  1IRZ A;  2D1V A;  2G0E A;  2E1N A;  5J1Y A;  2JSP A;  3MWM A;  2DW4 A;  4LG0 B;  3EPZ A;  1TW3 A;  2EFN A;  3DEE A;  5AIP A;  3HPH A;  1FYM A;  1W5S A;  3L09 A;  3BDD A;  1BC8 C;  1ZAR A;  3PSI A;  3GX4 X;  3OYG A;  3M4O J;  1KQ9 A;  2F48 A;  2BGC A;  1YLF A;  2MH2 A;  2PFB A;  1ULY A;  4KMU X;  3LSH A;  1P7I A;  1UG0 A;  2CW7 A;  2ZJP F;  2QSG X;  1I5Z A;  1GT0 C;  2O6G E;  2FOW A;  3HSR A;  3IKV A;  2JK3 A;  4RDU A;  5BPD A;  5FRM A;  2WAF A;  3ZGK A;  2E7X A;  4ZJZ A;  3WTU C;  4NUB A;  1O3Q A;  5FLV A;  3S2D J;  2JVH A;  2VAS A;  4B1R A;  4FAS D;  5FD6 A;  2L4M A;  2RVC A;  3DU6 A;  3I59 B;  4J00 A;  2K9L A;  2X6X A;  1G2H A;  4CCJ A;  5IYC J;  1A6Q A;  4BJ5 C;  5E3L A;  5DM6 F;  3A2K A;  4FX0 A;  3FM5 A;  1YJN I;  5L3E A;  2NXN B;  2FRH A;  1R1U A;  2KPM A;  5LBQ A;  3E6C C;  2GXB A;  2VJI A;  1UAA A;  3AG2 H;  2YX4 A;  4NHJ A;  5ICC A;  2EIN H;  3CTA A;  2OA4 A;  3OYJ A;  2DA1 A;  1RIO H;  3M1E A;  1RI7 A;  2OZU A;  3A4C A;  1K79 A;  2P4W A;  3KLN A;  4IZZ A;  4ITV A;  2FNA A;  1TT0 A;  1R1V A;  1U9O A;  2LVS A;  3BTC A;  1OR7 A;  5AIQ A;  1LFB A;  3DU5 A;  1BI2 A;  2R5Y B;  3W6J B;  2L9R A;  1A04 A;  2JPB A;  5ILV A;  3H5N A;  5K5Q A;  2LFB A;  4HV5 A;  4XKW A;  1FEX A;  5FJ8 J;  2CWE A;  5CVU A;  4RLQ A;  2M4K A;  3IH4 A;  4BE2 A;  5D4S A;  2YS9 A;  4ESB A;  4BXX J;  1BR1 A;  4DYC A;  3PNV A;  4G7Z F;  1D5Y A;  2VKV A;  2VN2 A;  1QO0 D;  4BBR J;  5EYR A;  1MDM B;  4MEX F;  2XF5 A;  4A6D A;  1V3F A;  4FX4 A;  1XCV A;  3I58 A;  3MQ0 A;  5DUK A;  4LD5 A;  2DJI A;  1TWF J;  4QPO A;  5DUI A;  3KZY A;  1IXR C;  3CLQ A;  3BJ6 A;  3NQO A;  2FU4 A;  2V1X A;  2BVM A;  1KU7 A;  2DT7 B;  4L5J A;  5JLW A;  1O4X A;  2RQP A;  3BG9 A;  4DJA A;  2IRF G;  1XS9 A;  1QPM A;  1SAN A;  3QPH A;  1SEU A;  4LK1 F;  3LSI A;  4FE4 A;  1TNT A;  3E6D A;  3LQR A;  1MZB A;  2ADU A;  2E35 A;  3OYN A;  1ZLK A;  2GZW A;  5E1W A;  1IN7 A;  4HPQ A;  5K7F A;  1S7O A;  4WXH A;  3WGH A;  2NRA C;  1OPC A;  5JI6 A;  3ZN1 A;  2BW3 A;  4Q48 A;  1VZ0 A;  3N97 A;  3OSG A;  2CUZ A;  3O8H A;  2HYG D;  1R23 A;  2WAQ A;  3T5X A;  1MIJ A;  2KFD A;  3KX2 A;  1QZE A;  2BY2 A;  5E3N A;  3PUB A;  1FJL A;  1R5H A;  3TW7 A;  1U8B A;  2M9H A;  4XLA A;  1VFC A;  2XPU A;  3W2W A;  3CO6 C;  1DP7 P;  3SFI A;  1WWX A;  1TBX A;  2H6C A;  3B6C A;  2VL8 A;  3CMY A;  2R5Z B;  4G9Y A;  1NK2 P;  2BYV E;  2VC1 A;  4IJA A;  1T0F A;  4MFD A;  4V2G A;  5LHI A;  1HXD A;  3BR1 A;  3O2P E;  4HF2 A;  4Y4R A;  4EJU A;  1BM9 A;  3IAM 2;  2XAF A;  1BR2 A;  2GXG A;  2OPT A;  3WG7 H;  3QWL A;  4NNJ A;  4HLY A;  1X58 A;  3CUQ B;  4N4N B;  3M8J A;  1AWC A;  3HOY J;  5GTI C;  3ZQQ A;  4ENK A;  3KLO A;  1AOY A;  4BAC A;  2MFZ A;  2PG4 A;  4CDG A;  1K78 B;  2R7X A;  1HKS A;  1RRJ A;  3JTG A;  3ERM A;  1XGS A;  1TP4 A;  5BPI A;  3ZQC A;  1P9Q C;  4L9T A;  2ZCW A;  1P4X A;  3G1L A;  1UEL B;  1JGG A;  1FOY A;  1W5T A;  4IX7 A;  1SAX A;  1AKH B;  4KN7 X;  2OQR A;  3MAJ A;  3JAM K;  5M5W J;  2L7Z A;  2OF7 A;  1D1C A;  3HSE A;  2BBY A;  4EJO A;  2FQ4 A;  2OZ6 A;  1ETW A;  1O3S A;  3IH3 A;  4BY7 J;  1FYK A;  3BQZ A;  2VQC A;  1X1P A;  3RKY A;  1ZRE A;  1HSJ A;  4G6T B;  4XK4 A;  1E17 A;  3BTI A;  4LLG F;  1IV8 A;  4NBQ A;  2P7C B;  3WG9 A;  3FHN A;  2R7S A;  4A2U A;  2MBF A;  3K2Z A;  2Q0O A;  3HGG A;  4GDF A;  4IHV A;  4KN4 X;  2IA2 A;  1FC3 A;  4YII A;  4JP0 A;  1S7E A;  4Y17 A;  1NHA A;  2YSR A;  5D6E A;  4U0W A;  2M0M A;  2CUJ A;  1XSX A;  1HW5 A;  5EZG A;  1X2N A;  4G6D A;  3CO7 C;  4KIF A;  3S14 J;  3L2Q A;  2ZME B;  3WE2 A;  2A5W A;  5HDG A;  4DIQ A;  1O7L A;  2KZG A;  2QSF X;  3IC7 A;  2V79 A;  3OWT A;  4D1Q A;  2ACJ A;  1TTY A;  5FD5 A;  2KIF A;  4L9N A;  5F6F A;  3ECH A;  2Y48 A;  2LY1 A;  3CJT B;  1L0O C;  2LG4 A;  3QPT A;  2KLO A;  5F08 A;  5JR3 A;  4E4H A;  1QHG A;  4XRS G;  3B6A A;  2A6T A;  1ENH A;  4X0G A;  2X6W A;  5D4R A;  1BJA A;  2WV0 A;  1H88 C;  3ML6 A;  5C44 J;  4W97 A;  1WZ2 A;  4L0Y B;  1R5I D;  3NWT A;  3CC2 I;  3H9J A;  2IJL A;  4EJW A;  3MZH A;  1J5Y A;  5LGT A;  3M8E A;  2QA4 I;  3PJR A;  2DA2 A;  1LPQ A;  2QQA A;  3E5U A;  2AO9 A;  2Y0M A;  1FBS A;  4XOR A;  1XGO A;  1O3T A;  5CQE A;  2Y9Y A;  2STW A;  4NB5 A;  3RQ4 A;  4GXO A;  2O03 A;  2F5V A;  3DKX A;  3ASN H;  1QGP A;  1OCP A;  4ZDL A;  4ZH4 F;  1XC5 A;  1R71 A;  4G7O F;  1OKR A;  2E60 A;  3M9A A;  4D7N A;  1GHC A;  1KU9 A;  4XL9 A;  1YI2 I;  2CQX A;  3OYL A;  3GFJ A;  1XGN A;  4OOI A;  3CF5 F;  3CCJ I;  1H89 C;  4B09 A;  3ISP A;  1PJR A;  3OYC A;  2PI0 A;  2VB6 A;  4XN3 A;  5HVQ C;  3HYI A;  4I0A A;  2DMP A;  5LD2 C;  3BR2 A;  3I64 A;  2YPR A;  3H92 A;  2DXI A;  3BCA A;  3T8R A;  2PJR A;  4UXN A;  1JHH A;  4ZYH A;  2PEX A;  2CG4 A;  3RKW A;  5DV5 A;  3TL4 X;  1J09 A;  5DEQ A;  1SVL A;  3GVA A;  2EWN A;  4QPQ A;  3CCL I;  2HWV A;  1DPR A;  1YYV A;  2M8E A;  1K4S A;  2XC7 A;  3E6B A;  4P55 A;  1CF7 A;  4N0B A;  3VOD A;  1G3Y A;  3BZC A;  4I2O A;  4XLF A;  1Z0X A;  2K9Q A;  5GPC A;  4HLX A;  3MKL A;  3TGN A;  5KAF C;  5FKL A;  1MW7 A;  1DPU A;  3D0S A;  3PM1 A;  5H2F C;  1TZL A;  1VQ4 I;  2R93 J;  1A6I A;  2CQ7 A;  4IVN A;  4KIT B;  4HOB A;  5K7Z A;  3G1M A;  5L3F A;  3JRC A;  2WWY A;  5IT9 K;  4S0H B;  3H0G J;  5D8K B;  1IGN A;  3CCY A;  5FFZ A;  5CYV A;  4AVZ A;  2ISZ A;  2DDB A;  2UUZ A;  3U1D A;  1YRN A;  1HKQ A;  4F55 A;  4PJM A;  1HW2 A;  2R7O A;  4DOZ A;  3PFI A;  3JRG A;  2Q2E A;  2X85 A;  4AIH A;  2QSH X;  2X1C A;  2R7F A;  4P5O A;  2KHM A;  4R1H A;  2EZK A;  4UUS A;  1DGR M;  2HVS A;  4HV6 A;  3PO3 J;  3E0J B;  1I1S A;  1ONV A;  2HKX A;  4I99 C;  3VSL A;  5GPA A;  2R92 J;  3ONQ A;  5FRN A;  2WY8 Q;  3RYP A;  2LY9 A;  3SXY A;  2AQF A;  5F27 A;  3TW6 A;  2WY7 Q;  3BR0 A;  3FKI J;  3COA C;  3ZP5 A;  1H0M A;  1IDZ A;  3ZQH A;  4PSX A;  2QKL B;  4ZYE A;  3C18 A;  2Z16 A;  4IPA A;  5DS9 A;  3OR1 C;  2EPF A;  1X19 A;  3LAJ A;  2XHK A;  3FK6 A;  4CSW A;  4U0Y A;  2ZBK A;  2KQR A;  1X3W B;  3AL0 B;  1WFX A;  3BTJ A;  3FX3 A;  2CQK A;  2ISY A;  1SFX A;  1BIB A;  1ZK8 A;  4I7H A;  3CZ6 A;  2F4O B;  2NOJ B;  1FOK A;  3RPU A;  2NVY J;  2QQB A;  1QZY A;  1MJB A;  2JUC A;  1Y39 A;  2VUM J;  2JVG A;  2MC4 A;  2LK2 A;  3BP8 A;  2P6S A;  3NAR A;  4BXF A;  2O61 A;  1YIJ I;  1B9M A;  2NNY A;  3ZMD A;  3OS2 A;  1ACI A;  3K4K A;  1TNS A;  3KET A;  2QVO A;  4HA8 A;  3G1O A;  4JBA A;  1HQC A;  3F6V A;  2IAI A;  5DYM A;  2BV6 A;  4UUV A;  2GQQ A;  3E5X A;  3E7L A;  4OAY A;  3UNG C;  4BS9 A;  2VOO A;  4AM3 A;  4WXC A;  5LRS A;  2HGC A;  1RKW A;  2P6T A;  3KYC B;  1D0X A;  2E1O A;  1BW6 A;  2QEN A;  3M7G A;  3CCQ I;  3QU3 A;  4ANJ A;  2VBY A;  3DV8 A;  3LWF A;  1PP8 F;  2KL4 A;  1FBU A;  3LNQ A;  1B9N A;  2Y9Z A;  1OJL A;  2K85 A;  2CS3 A;  1N25 A;  1ZAO A;  1LB2 A;  2K02 A;  4A3B J;  5CVV A;  4BE1 A;  2EQR A;  1X4P A;  1IG7 A;  1CQT A;  1BI0 A;  2KZV A;  2VQL A;  4BH9 A;  2GXA A;  2XGC A;  1J59 A;  2ICW G;  1LDD A;  1ZRD A;  2M0C A;  3KIO A;  3QYB A;  4RBO A;  4Q47 A;  3FKJ A;  3ZMS A;  5HS8 A;  3JR9 A;  5F1J A;  3DF8 A;  5ICE A;  2JTV A;  1P7J A;  4FHT A;  2FF4 A;  2H8R A;  1EV7 A;  1X3Z B;  3W6V A;  2LLK A;  4BAY A;  4OIN F;  1X1C A;  2ETH A;  1LDK B;  2P81 A;  1MNM C;  4OIP F;  4PJL A;  4LIV A;  4A69 C;  4M3F A;  3LSP A;  1HBX G;  2UV1 A;  4AC0 A;  4AYB N;  1LUJ B;  5C3E J;  1V5G A;  2YU9 J;  4KIC A;  3FXO A;  3LQQ A;  4M6V A;  4UVA A;  4CCO A;  2KMU A;  4NQW A;  1U3E M;  4AID A;  3DLA A;  3WTY C;  4BQQ A;  4LOC A;  1ETY A;  3S32 A;  1H9G A;  4YFK F;  2EV0 A;  5EZH A;  2FUG 2;  4HST A;  3M3Y J;  2Q8K A;  4CH7 A;  1Y6I A;  1ZR2 A;  4BQN A;  2HZD A;  1VQO I;  4PGH A;  1ZG5 A;  2Y0S A;  3QQA A;  1YTY A;  1APL C;  1IDY A;  3F8F A;  1W36 C;  4N4O B;  3NAU A;  3RCO A;  3MCZ A;  2VKE A;  5EEH A;  1ZYR F;  3SZP A;  1HW1 A;  2STT A;  5L3B A;  2MD0 A;  3BJO A;  4BL0 B;  1PVE A;  2DAO A;  2E5Z A;  2L7M P;  1UZC A;  3RI4 A;  2E36 A;  3QP6 A;  5F0C A;  3FMS A;  2HNH A;  3B02 A;  5EGO A;  4UV9 A;  1OCC H;  3PIO F;  4TV7 A;  2M7A A;  3GFM A;  2ZJR F;  3J7A O;  3I5U A;  2VJJ A;  1OYI A;  4DZJ A;  1FX7 A;  5CKT A;  1G4D A;  2YX7 A;  3DBL B;  4XLP F;  1O3R A;  1JI8 A;  2CW8 A;  2FBK A;  3GTQ J;  3CUO A;  3DLL F;  4DZP A;  2Y2Z A;  1R9T J;  1YW9 A;  2K9N A;  1GV5 A;  1OQY A;  3OYI A;  2DCE A;  4UUT A;  3S93 A;  1PUE E;  1FTT A;  4Y13 A;  1UHS A;  1WI9 A;  2ID6 A;  1FZP B;  2FQ3 A;  2PJR B;  3GFI A;  1EH7 A;  5LGN A;  1T56 A;  4EVI A;  3ZMV A;  1Y1W J;  3Q9S A;  1TQM A;  1H8A C;  2Y75 A;  3HOU J;  2DLL A;  1CF7 B;  4A3M J;  1IRG A;  1FPQ A;  2FA5 A;  2DYR H;  2P8T A;  5E17 F;  3TOB A;  2DTZ A;  1IW7 F;  2MW8 A;  3VEP A;  1WPK A;  4IHY A;  3K10 A;  1GLN A;  2LH9 A;  1EJ9 A;  2V26 A;  1EH8 A;  3OOU A;  2HPI A;  2I10 A;  3LFU A;  1RR8 C;  3C2B A;  5TGT A;  2VKD A;  4XID A;  2LSO A;  3FMR A;  1DP3 A;  2VOP A;  1XSD A;  3I55 I;  1S6L A;  2W00 A;  2X4H A;  3C2G A;  3P9I A;  3F23 A;  3PNY A;  2H27 A;  5IPA A;  1FMV A;  3HOW J;  3F72 A;  4A6E A;  2TRT A;  4BEH A;  4LLN A;  1W36 D;  3T8T A;  2Z99 A;  1QVU A;  3H9Q A;  1YRN B;  1VQ5 I;  3ZQI A;  2IGN A;  3KP4 A;  3LSR A;  5TIS C;  5DCM B;  3SFZ A;  2Q2E B;  3HDD A;  4II3 A;  2M87 A;  4CCM A;  1T2K A;  4DBQ A;  2KRF A;  3FDY A;  1GV2 A;  2EIK H;  3ESW B;  3GTM J;  4BHB A;  3FK7 A;  4MTE A;  3ZN0 A;  2NOG A;  1MMN A;  2H1K A;  2BOL A;  1RUN A;  2QEX I;  2KJB A;  5LGU A;  3ZR8 X;  3SDG A;  2VT2 A;  1UCR A;  2K9S A;  1SFU A;  3CCR I;  4BDZ A;  3F9K A;  1BI3 A;  2M3A A;  1MSF C;  3T0Y A;  2V1D A;  3Q0W A;  3TED A;  3VWB A;  3D5S C;  4XSZ F;  3LOC A;  3FXL A;  2DI3 A;  2JMW A;  4NDL A;  2D2W A;  2QLZ A;  2PMU A;  3UR3 C;  1QPI A;  1OMI A;  3EUK L;  1KU3 A;  4EV0 A;  5J6X A;  1XD7 A;  4H0E A;  3JRA A;  2R7Q A;  3IWF A;  3AAF A;  4A3C J;  2X51 A;  3F21 A;  1OCT C;  4UV8 A;  1ZN2 A;  2V1U A;  3GCM A;  3WOD F;  2HQA A;  4HNU A;  4IHX A;  3FM3 A;  2R0Q C;  2P5K A;  2CFO A;  2VPR A;  2M30 A;  1LVA A;  3V8J A;  5HLH A;  1I27 A;  3H36 A;  1LFP A;  2K9M A;  2LKX A;  3PSF A;  2G7U A;  2HOT A;  1MBG A;  1YS7 A;  4CIC A;  4M9Z A;  2E34 A;  2XB5 A;  4IQJ A;  1ZEL A;  2XAG A;  3Q0V A;  3HEF A;  4BQA A;  2IXS A;  2OBP A;  2Z3Y A;  3K4B A;  1QHH D;  5EF6 A;  1GXQ A;  1KA8 A;  4YRV A;  4LJZ F;  5GAD J;  4PJJ A;  3JRB A;  4XR6 A;  1JUP A;  1XMX A;  4KFC A;  1S7A A;  1E3O C;  1I3Q J;  5BQT A;  1W7P D;  2IEK A;  3LAP A;  2GAU A;  2MG4 A;  4XOT A;  3SEQ A;  4D5F A;  4V19 K;  2JPC A;  2V9P A;  2Y30 A;  2F5F A;  3ABL H;  2OUM A;  2DMT A;  1HA8 A;  2DA5 A;  4XRM A;  2PMZ A;  2HYJ A;  2NVQ J;  1XB4 A;  2HDD A;  3L2V A;  4I6Z A;  3PNT A;  3KYL A;  4HBL A;  4UB6 C;  1D8J A;  3GFL A;  4I76 A;  2OV7 A;  3DEU A;  3J7Y J;  2H94 A;  2VQH A;  1OCZ H;  2Z5U A;  3GBG A;  3OIQ A;  3DPU A;  1JXS A;  1IN6 A;  2XDV A;  4NQW B;  1PUF A;  1JUS A;  3RKQ A;  3ELK A;  4G8X A;  3ZMZ A;  3VYR B;  1AA7 A;  4ZTF A;  1TL8 A;  1FP1 D;  1ZHF A;  3OYH A;  4DQ2 A;  2L4A A;  5IT3 A;  2M4G A;  2FE3 A;  2BY1 A;  5B3S H;  1K4T A;  3K1N A;  3RIR A;  3FXK A;  1QQI A;  1B1B A;  1GUU A;  3JAM Z;  3DWL E;  3G2B A;  5KVR A;  1GVJ A;  2V1N A;  1VTN C;  3VPR A;  1FTZ A;  2ZC2 A;  2NAZ A;  2DPD A;  2EZL A;  1MBF A;  1B72 A;  2VBX A;  4M3B A;  5E1Z B;  2LMD A;  5D5V B;  2F5D A;  3AG3 H;  2OD5 A;  3F0C A;  4M71 A;  4PCQ A;  3HB9 A;  5B66 C;  3JSO A;  2CW0 F;  3K7A J;  2ZJ2 A;  1FLI A;  2HDC A;  2KIM A;  1SAU A;  1SVM A;  3WTZ A;  5EGO B;  1AU7 A;  3WTW C;  5KHD A;  1P2F A;  5FKO A;  3TP3 A;  1I6H J;  1VQ9 I;  5TRD A;  4C30 A;  3FXJ A;  1F36 A;  3ZMU A;  1LNW A;  3DEW A;  3SDB A;  3TBI A;  3F3X A;  5M5X J;  2JSC A;  1QBJ A;  2HOS A;  3WTT C;  4HDU A;  2QBY A;  1JKR C;  3G3Z A;  5E79 C;  3FXM A;  3OR2 C;  3EET A;  3QYE A;  1Q1H A;  1X1B A;  1PP7 U;  1A35 A;  4A3J J;  1YS6 A;  2R4G A;  4BXU A;  2CV1 A;  2L3D A;  1JJ6 C;  2W48 A;  3B73 A;  1IJW C;  3U21 A;  4OWR B;  1Z05 A;  2D5V A;  2GM4 A;  1RES A;  4O3M A;  2H09 A;  1FMW A;  3VYT B;  3FXU A;  3OOP A;  4BE0 A;  1Y0N A;  1V55 H;  3L7W A;  2HYF A;  2KT0 A;  2LR8 A;  1BL0 A;  4L0Z B;  4KT5 C;  5GAH J;  5LHG A;  2NVU B;  5GAE J;  4IOC F;  4BDY A;  3Q5F A;  3S3N A;  3QP5 A;  3K9T A;  1BOA A;  1T8I A;  2VJ4 A;  4XRS A;  3JCU C;  3CD6 I;  2XAU A;  1WCM J;  1J9I A;  1J7K A;  4UVC A;  2DMN A;  1X3U A;  3QOD A;  3DKW A;  5D5X B;  2CSO A;  5HLG A;  5HDN A;  2XF7 A;  2O5R A;  2HOA A;  1WJA A;  4ZZD A;  3O8G A;  1W1W E;  4XLH A;  1RZ4 A;  1T95 A;  4EM2 A;  4BEH B;  3HOV J;  3S17 J;  1Y0U A;  4IHW A;  5HS7 A;  3CMA I;  3E3V A;  2P7V B;  2K86 A;  2DPU A;  1S8N A;  1LVK A;  3PUF A;  2H6B A;  4EMS A;  2KDZ A;  2XF6 A;  3ROU A;  2RN7 A;  3S15 J;  3A02 A;  4Q4Z F;  3JRI A;  3R4K A;  2O0Y A;  2E7W A;  5K5O A;  3TP0 A;  1YIO A;  3J7Z I;  3HGY A;  2L9S A;  5JLX A;  3ZRG A;  2ZNY A;  1WGX A;  4ZYD A;  3AG4 H;  3SZT A;  2MGQ A;  2BE5 F;  1T39 A;  4YIF A;  2HR3 A;  2HKO A;  5AON A;  1IN5 A;  2ZXW H;  2L02 A;  2CQQ A;  5JHU A;  1B4A A;  3GUD A;  3ABT A;  2XAS A;  3VYU B;  1WJE A;  3L9F A;  5CVR A;  4MHG A;  2DT5 A;  4M3G A;  3GTK J;  3L2U A;  2F4I A;  2JA5 J;  1JTY A;  1HF0 A;  1XCB A;  4Y7N J;  1MMA A;  4FQG A;  3DBR B;  1TWC J;  3RDI A;  1BBY A;  2DN0 A;  5GTH C;  4MQV A;  5K1Y A;  2HXO A;  2WTE A;  2KRC A;  1W4M A;  2PX9 A;  1S3J A;  2B9S A;  3GZ5 A;  3ZQF A;  1VQN I;  2BVL A;  2CGP A;  3CF2 A;  5IT9 Z;  2XV4 S;  3SHF A;  2EA2 A;  4MFE A;  2KP6 A;  3WTX C;  4QTR A;  1WKM A;  1SVO A;  2EIL H;  4AWX B;  3HG9 A;  5HLT A;  4IF4 A;  3OSF A;  1JE8 A;  4FE7 A;  2WB1 N;  3CJQ B;  1B8I A;  1Y1V J;  3HL2 A;  1VQL I;  1HKT A;  2V9V A;  2HS5 A;  3GTL J;  5JFR A;  4OIO F;  3TO7 A;  1LEA A;  5IP6 A;  1Z3Y A;  2LYC A;  4XSX F;  1BW5 A;  1VQK I;  5BMZ A;  3MZ8 A;  2ZFW A;  1D1B A;  2TCT A;  1OFC X;  3MMY B;  4AU7 A;  1RNL A;  3N05 A;  4RGS A;  2ZXJ A;  2X48 A;  4U7B A;  2XRL A;  4ZYA A;  2CRG A;  4BKX A;  3QOE A;  4G6Q A;  2EH3 A;  2LNB A;  4M6Y A;  1I1G A;  3W2A A;  1WH5 A;  1MNE A;  2M5W A;  1FIA A;  2JRM A;  5K5R A;  1LDJ A;  1ZLJ A;  1ZG1 A;  3G73 A;  2P5V A;  4WCG A;  4WK8 F;  4HQE A;  5E3O A;  2GA1 A;  1FYL A;  1ON2 A;  3K2A A;  3LSM A;  2BEO A;  3PL8 A;  2DK5 A;  2R7U A;  5LHH A;  3OYB A;  1YJW I;  2A5Y B;  5B5E C;  2NVT J;  1F4K A;  4OAZ A;  2A68 F;  3BPV A;  4EQQ A;  2EFW A;  3OYF A;  1MBH A;  2R7R A;  2AS5 F;  2CUE A;  1RET A;  1PUF B;  2CV2 A;  4MGR A;  4ZC3 A;  4HRI A;  3L2C A;  3W2V A;  4ETS A;  1UB9 A;  3K69 A;  3U2R A;  4UB8 C;  1YOV B;  4KT6 A;  2IGO A;  1N78 A;  3MFK A;  4PJ0 C;  1SFO J;  2EZH A;  3EQL F;  4XRF A;  2XAH A;  5F04 A;  4ENM A;  4JK1 X;  1SD4 A;  1B72 B;  3C3W A;  4NC8 A;  5B1A H;  3GZ6 A;  1Z6R A;  1IXC A;  2QUF A;  3CCV I;  3HUG A;  1IRX A;  4CHU A;  3CJN A;  1ETK A;  1FSE A;  4FT8 A;  1NH3 A;  4M74 A;  4IHT A;  2DQR A;  3TMO A;  5M3F J;  3CLO A;  1H9T A;  3DBH B;  2WAE A;  4RS8 A;  1G3W A;  3HTU A;  1TWA J;  3BR5 A;  1R4N B;  2BW3 B;  4A3F J;  3ZPL A;  1WRJ A;  3M07 A;  3AL0 C;  1SMY F;  1KQ0 A;  2DT6 A;  2JWT A;  4NC7 A;  4XMY A;  3LA3 A;  3J80 K;  2Y0S N;  4H4K C;  2ID3 A;  1OCO H;  4ENN A;  3GTP J;  3TKY A;  4HF1 A;  3OYK A;  4DYQ A;  1W7P A;  2OCE A;  2XPW A;  1RR7 A;  2RGV A;  3AG1 H;  3WGG A;  3S2H J;  3ZQ7 A;  3RJP A;  1Z7U A;  1D0Y A;  2LRD A;  2RC4 A;  2KIQ A;  3CCM I;  4PUS A;  3ZMT A;  3UKG A;  3K70 C;  5IP7 J;  5FLM J;  2VE8 A;  2O8X A;  1SFK A;  4E70 A;  3HKZ N;  1DU0 A;  1IF1 A;  4RB1 A;  3WE3 A;  1WJF A;  2HZT A;  4KDP A;  3DTE A;  3FBN B;  4LG3 A;  2DA7 A;  1MGT A;  2HI3 A;  3L1P A;  3GTJ J;  2E1M C;  2EIM H;  2BHY A;  1T08 B;  1N75 A;  1RUO A;  2WV1 A;  1X1D A;  2ZXH A;  2Z2S B;  2R3S A;  3JRF A;  1Z9C A;  4U7D A;  5B1B H;  5FKM A;  3JRD A;  9ANT A;  5CPR B;  4G7H F;  1LEB A;  3W6K B;  3L2W A;  2XAQ A;  5IP9 J;  2Y69 H;  3BCB A;  2DQL A;  4HNT A;  4Y3O A;  5E20 A;  2COB A;  2AQE A;  3ASO H;  1SMT A;  1I6X A;  1HST A;  1YE9 A;  2IW5 A;  1IV6 A;  2E2J J;  5GAG J;  5F64 A;  4CGZ A;  2A6E F;  2W24 A;  2IT0 A;  1Y8R B;  1R49 A;  3V42 A;  2QZ8 A;  4KNY A;  3FXQ A;  3BLY A;  2HQR A;  1R36 A;  2DK8 A;  5L3C A;  2TDX A;  3BR3 A;  3FF5 A;  2FX0 A;  4J19 A;  2ESH A;  1B6A A;  2ZJQ F;  2XUB A;  2L0K A;  2RNG A;  5IOY A;  3FWE A;  3HRS A;  2I8D A;  2MA3 A;  3IAS 2;  3HRM A;  3O6B B;  4LB6 B;  1KGS A;  2HU9 A;  1Z77 A;  1IUF A;  2O8K A;  4U0V A;  2MD5 A;  5KAI C;  3QOP A;  2F6C A;  1UJ8 A;  2LKP A;  4OMZ A;  4A0Y A;  4ASN A;  4A5M A;  3M1C A;  3Q3S A;  1XG1 A;  3EUA A;  2CH0 A;  3SEZ A;  4ESF A;  4EGZ A;  3HOS A;  4CCL A;  3MVP A;  3FMQ A;  1REP C;  2R5Y A;  3DQV C;  4UHT A;  2A05 A;  1YFH A;  2M8G X;  3GEZ A;  5M5Y J;  4EJV A;  2W7N A;  4EEF G;  5H6Q A;  4HYE A;  4HEA 2;  4GYI A;  3V8K A;  4F7Z A;  4DW6 A;  3K70 D;  3CDH A;  2W82 A;  1ZR4 A;  3IWZ A;  2K4J A;  2ZXI A;  5FO5 A;  2DTR A;  4UVB A;  1TC3 C;  1MND A;  2K4B A;  2IGK A;  4B4C A;  3R0J A;  1KU2 A;  4DBR A;  1M1E B;  4BHP A;  5IOZ A;  3DP7 A;  4HF0 A;  2AXT C;  1NTC A;  1S9H A;  2B63 J;  4LK0 F;  1YW8 A;  3I54 A;  2XRO A;  2L01 A;  3AKZ A;  3HOX J;  1YX3 A;  1U2W A;  3K4N A;  1K6O A;  4E7S A;  1FIP A;  4AVP A;  2KIU A;  3GO5 A;  2GWR A;  4HX7 A;  2VON A;  4A3K J;  2V6C A;  3S3O A;  2EFO A;  2DJN A;  4RM2 A;  5D5U B;  3GF2 A;  2BHZ A;  4IQ4 A;  3H9G A;  4RMN A;  3OMY A;  4FTH A;  2L9N A;  2VQG A;  5JVT A;  4M9X A;  3QPS A;  4C2M J;  1FBQ A;  3BPX A;  3CC4 I;  3PQJ A;  4L9V A;  1U78 A;  4BY1 J;  2FJ1 A;  1USS A;  1R4M B;  2GBY A;  2GIZ A;  4YEJ A;  3OL4 A;  2KDO A;  3HPG A;  3BC8 A;  3I56 I;  4I09 A;  4CCK A;  2M1B A;  1WH7 A;  2QQ8 A;  4XOP A;  3H35 A;  3SZG A;  4D0P A;  3F8N A;  4MLO A;  3BG5 A;  4P96 A;  5TJJ A;  1JUM A;  2IA1 A;  3HXL A;  5HOD A;  1Z91 A;  1F5T A;  4JX6 A;  1EA3 A;  2HDW A;  1KZH A;  3FHZ A;  3VFZ A;  2UXN A;  1ZGJ A;  2AXL A;  5JHF A;  4BQO A;  3FZV A;  3I4P A;  1RPW A;  4IL6 C;  2IS1 A;  4IRH A;  1QZZ A;  2FML A;  5C4J J;  4S05 A;  4XKB A;  1FWZ A;  2LY2 A;  1HOM A;  1U5T C;  3GZN B;  1VQP I;  3HTS B;  1YQA A;  1BIA A;  2M45 A;  4N9H A;  1XTA A;  2NS7 A;  2EZI A;  3BT9 A;  3LSG A;  1MMG A;  5FB2 A;  1HDD C;  3VYS B;  1R5G A;  2PMZ N;  2JA8 J;  3CC7 I;  4XON A;  5DD8 A;  4KIG A;  1V54 H;  3KP2 A;  2L7F P;  4MEY F;  3HRU A;  5FGM A;  4E7J A;  1BC7 C;  3HSF A;  1K61 A;  1K83 J;  1TWG J;  3HUG B;  1UG2 A;  2A61 A;  3LST A;  2R7Z J;  3MKW B; 
#chains in the Genus database with same CATH homology
 2A3S A;  2QYO A;  3LFK A;  1UST A;  1ON1 A;  4LLL A;  1ZRF A;  2WC2 A;  2XRN A;  2IP2 A;  2A6H F;  3WTV C;  4GYG A;  4G94 A;  2JZY A;  2MC3 A;  3BWG A;  4EGY A;  1PDN C;  4PGG A;  2F5E A;  4IRG A;  1U6G A;  1MD0 A;  4LGW A;  3TDU C;  5A2Q K;  3J81 K;  1IRF A;  1TQP A;  5ILU A;  3K1P A;  3IRQ A;  3WGI A;  1JHF A;  2K27 A;  3PQK A;  2HFH A;  4HQM A;  2ELH A;  3BOQ A;  2D1H A;  2W85 A;  2FEZ A;  4CXF A;  1SD7 A;  4HZF A;  2YU3 A;  4RGR A;  4RB0 A;  2MLG A;  5ICF A;  5FLX K;  4RAZ A;  2PBI A;  4GGG A;  4M73 A;  3HOT A;  3K0L A;  4KYW A;  4Q5S F;  3WTS C;  2QQ9 A;  3RPQ A;  1ZG3 A;  4PZJ A;  5F1R A;  2XKP A;  5CVI A;  4KMF A;  3H3U A;  1FY7 A;  2IA0 A;  4OU0 A;  3P9C A;  2XVC A;  1GXP A;  1O7F A;  4BNC A;  1P4A A;  1LJ9 A;  4LMY A;  4OIR F;  1XN7 A;  3KP7 A;  3BY6 A;  5E1X A;  1R1T A;  3ABU A;  1S29 A;  2IVM A;  3E97 A;  4LB5 A;  3V4G A;  5HLI A;  2EV6 A;  4P9U A;  1Z1D A;  3TQN A;  1IZ1 A;  5ICG A;  2RKH A;  3KCC A;  1R58 A;  1YG2 A;  3RYR A;  2Z9O A;  5D5W B;  2W25 A;  1UHM A;  5CVJ A;  1QNT A;  1G6N A;  3NEU A;  4A12 A;  1F9N A;  4CO8 A;  2J5O A;  4KA4 A;  3DPL C;  5DCF A;  2EA4 A;  3N4M A;  4M9S A;  4A0Z A;  3GYH X;  1STZ A;  2HTS A;  4Y15 A;  3REO A;  3E5Q A;  2G7H A;  1OYW A;  1XGM A;  2VOD A;  3KEQ A;  3BJA A;  4IRI A;  3U9G A;  2YR2 A;  3LA7 A;  3CUQ C;  1ZRC A;  2DFI A;  1TLH B;  1D3Y A;  3F6O A;  5HS9 A;  4EJT A;  4WF2 A;  4EM0 B;  2EK5 A;  1TW2 A;  3GXO A;  2PLY A;  2FOK A;  2JRT A;  2FNP A;  2RDP A;  4MTD A;  1B59 A;  1SFE A;  2GA2 A;  5DDG A;  1G3S A;  2PN6 A;  3F8B A;  4Z2Y A;  1TQI A;  3L00 A;  4L9J A;  5D8L B;  3MEX A;  1R00 A;  4R79 A;  3E6M A;  1P92 A;  1KYW A;  4I0B A;  3BRO A;  1T98 A;  2CFX A;  2DO7 A;  1ZH5 A;  2HTJ A;  3WU0 A;  3BZ6 A;  3WU1 B;  1ODD A;  1F1Z A;  4I02 A;  2G9W A;  2P5L C;  2F5C A;  2E1C A;  3T1B A;  4O5V A;  1YO5 C;  4ESJ A;  5KK1 A;  1JGS A;  5J8C A;  1WSU A;  4ON0 A;  3R0A A;  1FNN A;  5J8F A;  3NRV A;  5LEJ A;  4UNO A;  2NNN A;  5FFX A;  4AIK A;  3TO9 A;  1T6S A;  1XDS A;  2UZK A;  3R60 A;  2EB7 A;  1IAW A;  1FP2 A;  4PDK A;  1Z6T A;  4GCV A;  4YFN F;  3LA2 A;  5E18 F;  1IXS B;  3HRT A;  2VBW A;  1LQ1 A;  3F8M A;  4HX4 A;  4IXA A;  2J5P A;  4QWQ A;  3HIF A;  2Z33 A;  5DD4 A;  5ILS A;  1EH6 A;  2FXA A;  3TOA A;  3KP3 A;  1IN4 A;  1U8R A;  3F22 A;  3IKT A;  3TDZ C;  1V4R A;  2IPQ X;  2D45 A;  1XMA A;  4S04 A;  2EV5 A;  3V7R A;  3J80 Z;  1XDU A;  2B0L A;  2EJR A;  5EEG A;  4BHC A;  5LLQ A;  1R22 A;  2VC0 A;  4HW0 A;  1C0W A;  3FXR A;  1SD5 A;  2NS0 A;  2EFP A;  4JQF A;  2KKO A;  2ZKZ A;  2C6Y A;  1SD6 A;  4WX9 A;  3QU6 A;  4EM1 A;  2CYY A;  1J75 A;  2VXZ A;  3C1D A;  3V7C A;  2OAZ A;  4MNU A;  4HX8 A;  3C7J A;  3R6S A;  3DFG A;  4KIB A;  6PAX A;  4U88 A;  3K1M A;  2FBI A;  2O3F A;  5E8I A;  1IN8 A;  3D5L A;  2JT1 A;  2LF8 A;  5H6R A;  1U5T A;  5LEK A;  4WWC A;  3I0T A;  3ERE D;  1XMK A;  5DCM A;  2A69 F;  2LDU A;  4ZZL A;  2QBY B;  3SQN A;  3HHG A;  4YG2 F;  4L18 B;  3OV8 A;  2XIG A;  1MKM A;  2EFQ A;  3KP6 A;  2LF7 A;  3VOE A;  1J0R A;  2QWW A;  1T38 A;  2PQ8 A;  1K7A A;  4RAY A;  2DU9 A;  2XKO A;  4L5I A;  2RV8 A;  4GO1 A;  4LG0 A;  4N9I A;  3I71 A;  3RKX A;  2KJC A;  2L54 A;  3R61 A;  1FT9 A;  3KP5 A;  4RGX A;  2RNJ A;  2DBB A;  4CYD A;  2X0L A;  1UHW A;  3ECO A;  2NYX A;  1BI1 A;  2ZNZ A;  1ZGA A;  1P6R A;  3I59 A;  3P7N A;  3O3K A;  4OIQ F;  3S2W A;  4AD9 A;  3EYY A;  4B8X A;  3KZZ A;  4ENJ A;  2K7L A;  3V8L A;  2FBH A;  2FSW A;  2ZO4 A;  1J2X A;  3F8C A;  5BS6 A;  2W57 A;  1XSV A;  4QLC U;  2HEO A;  5H20 A;  5L3D A;  2HOE A;  4AIJ A;  1CGP A;  1D5V A;  2VT3 A;  1UFM A;  1P4W A;  4RGU A;  2HQN A;  2XGX A;  5ED4 A;  2OQG A;  2UWM A;  1MDM A;  5LRR A;  5CLS A;  3QAH A;  1KYZ A;  4A5N A;  4RB2 C;  2XAJ A;  4XLN F;  3JTH A;  2A07 F;  2COM A;  3GW2 A;  3VB2 A;  3ULQ B;  4MQ9 F;  4R8H A;  4HAM A;  1DUX C;  2VE9 A;  1D8K A;  1G3T A;  4LFU A;  5BOX A;  3M8F A;  3P9K A;  4M72 A;  2UXX A;  3KEO A;  3TO6 A;  1E2X A;  4I98 B;  2MLK A;  3IHU A;  1MJ9 A;  3GWZ A;  4OMY A;  3MZY A;  5A2Q Z;  1R7J A;  3J81 Z;  1O57 A;  3EYI A;  4WXD A;  3GLX A;  3JW4 A;  1DDN A;  1L3L A;  4DNC A;  2MH9 A;  3CUQ A;  4ZYG A;  4XBF A;  2F2E A;  2R7D A;  5E8G A;  1K78 A;  1OYY A;  3EDP A;  1IUY A;  5CJ9 A;  4O6J A;  1WQ2 A;  4RB3 C;  5FLX Z;  3HHH A;  4CZZ A;  3H3Z A;  4HDV A;  2FMY A;  2OU2 A;  3Q9V A;  3QRF F;  5ERI A;  3JSP A;  5HDK A;  1MJA A;  3KE2 A;  4P9F A;  1U5T B;  1FSH A;  3DPT A;  4YFX F;  3DXJ F;  4A0X A;  3KFW X;  2PMH A;  5L3G A;  3V7S A;  3I53 A;  5D6F A;  1KQ8 A;  2ESN A;  1W7P B;  4K2E A;  1BN5 A;  3RTR A;  4BYY A;  2ZME A;  2QM3 A;  2GIV A;  4I01 A;  4M6X A;  3IL2 A;  1YW7 A;  2CO5 A;  2PJP A;  2VBZ A;  3IRR A;  3EUH A;  4IHS A;  4KUM A;  2W84 A;  5HOO A;  2D1V A;  2E1N A;  3MWM A;  2DW4 A;  4LG0 B;  1TW3 A;  2EFN A;  5AIP A;  1FYM A;  1W5S A;  3L09 A;  3BDD A;  1BC8 C;  1ZAR A;  3GX4 X;  1KQ9 A;  2BGC A;  1YLF A;  2MH2 A;  2PFB A;  1ULY A;  4KMU X;  1I5Z A;  2O6G E;  3HSR A;  3IKV A;  5BPD A;  3WTU C;  2E7X A;  1O3Q A;  5FD6 A;  2L4M A;  2RVC A;  3I59 B;  4FX0 A;  3FM5 A;  5L3E A;  2FRH A;  1R1U A;  5LBQ A;  3E6C C;  2GXB A;  2YX4 A;  4NHJ A;  5ICC A;  3CTA A;  2OA4 A;  1RIO H;  3M1E A;  1RI7 A;  2OZU A;  1K79 A;  2P4W A;  3KLN A;  2FNA A;  1R1V A;  1OR7 A;  5AIQ A;  1BI2 A;  3W6J B;  1A04 A;  2JPB A;  5ILV A;  5K5Q A;  4HV5 A;  2CWE A;  5CVU A;  5D4S A;  4ESB A;  4G7Z F;  2VN2 A;  1QO0 D;  1MDM B;  4MEX F;  4A6D A;  1V3F A;  4FX4 A;  1XCV A;  3I58 A;  3MQ0 A;  5DUK A;  4LD5 A;  5DUI A;  3KZY A;  1IXR C;  3BJ6 A;  3NQO A;  2FU4 A;  2V1X A;  1KU7 A;  4L5J A;  2RQP A;  2IRF G;  1QPM A;  3QPH A;  4LK1 F;  1TNT A;  3E6D A;  3LQR A;  1MZB A;  2ADU A;  1ZLK A;  2GZW A;  5E1W A;  1IN7 A;  1S7O A;  4WXH A;  3WGH A;  2NRA C;  1OPC A;  5JI6 A;  3ZN1 A;  4Q48 A;  3N97 A;  2HYG D;  1R23 A;  3T5X A;  1R5H A;  3CO6 C;  1DP7 P;  1WWX A;  1TBX A;  2H6C A;  4G9Y A;  2BYV E;  2VC1 A;  4IJA A;  1T0F A;  5LHI A;  1HXD A;  3O2P E;  4HF2 A;  4EJU A;  1BM9 A;  2XAF A;  2GXG A;  1AWC A;  4HLY A;  3CUQ B;  1AOY A;  4ENK A;  3KLO A;  2PG4 A;  4CDG A;  1K78 B;  1HKS A;  3JTG A;  1XGS A;  5BPI A;  4L9T A;  2ZCW A;  1P4X A;  1W5T A;  1SAX A;  4KN7 X;  2OQR A;  3MAJ A;  3JAM K;  3HSE A;  2BBY A;  4EJO A;  2OZ6 A;  1O3S A;  1FYK A;  3RKY A;  1ZRE A;  1HSJ A;  1E17 A;  4LLG F;  2P7C B;  3WG9 A;  4A2U A;  2MBF A;  3K2Z A;  2Q0O A;  4KN4 X;  2IA2 A;  1FC3 A;  4YII A;  4Y17 A;  1NHA A;  2YSR A;  5D6E A;  4U0W A;  1XSX A;  1HW5 A;  3CO7 C;  4G6D A;  4KIF A;  2ZME B;  3WE2 A;  5HDG A;  1O7L A;  3IC7 A;  2V79 A;  2ACJ A;  1TTY A;  5FD5 A;  2KIF A;  4L9N A;  5F6F A;  3ECH A;  2Y48 A;  1L0O C;  3QPT A;  5JR3 A;  5D4R A;  1BJA A;  2WV0 A;  3ML6 A;  4L0Y B;  2IJL A;  4EJW A;  3MZH A;  1J5Y A;  5LGT A;  3M8E A;  2QQA A;  3E5U A;  2Y0M A;  1FBS A;  1XGO A;  1O3T A;  2STW A;  4NB5 A;  4GXO A;  2O03 A;  1QGP A;  4ZH4 F;  4G7O F;  1OKR A;  3M9A A;  1GHC A;  1KU9 A;  3GFJ A;  1XGN A;  4OOI A;  4B09 A;  3ISP A;  2PI0 A;  5HVQ C;  3HYI A;  4I0A A;  3I64 A;  2YPR A;  3H92 A;  3T8R A;  4UXN A;  1JHH A;  4ZYH A;  2PEX A;  2CG4 A;  3RKW A;  5DV5 A;  5DEQ A;  3GVA A;  2EWN A;  2HWV A;  1DPR A;  1YYV A;  2M8E A;  3E6B A;  4P55 A;  1CF7 A;  4N0B A;  3VOD A;  1G3Y A;  4I2O A;  4HLX A;  3TGN A;  1DPU A;  3D0S A;  4IVN A;  4HOB A;  5L3F A;  2WWY A;  5IT9 K;  5D8K B;  5FFZ A;  5CYV A;  2ISZ A;  3U1D A;  1HKQ A;  1HW2 A;  3PFI A;  2Q2E A;  4AIH A;  2R7F A;  4P5O A;  4R1H A;  4HV6 A;  1I1S A;  1ONV A;  2HKX A;  3RYP A;  3SXY A;  3COA C;  3ZP5 A;  1H0M A;  4ZYE A;  3C18 A;  4IPA A;  3LAJ A;  2XHK A;  4U0Y A;  2ZBK A;  3FX3 A;  2CQK A;  2ISY A;  1SFX A;  1BIB A;  4I7H A;  1FOK A;  3RPU A;  2QQB A;  1QZY A;  1MJB A;  3BP8 A;  2P6S A;  2O61 A;  1B9M A;  2NNY A;  3ZMD A;  3KET A;  1TNS A;  2QVO A;  4HA8 A;  4JBA A;  1HQC A;  3F6V A;  5DYM A;  4UUV A;  2BV6 A;  2GQQ A;  3E5X A;  2VOO A;  4WXC A;  5LRS A;  2HGC A;  2P6T A;  3M7G A;  2QEN A;  3QU3 A;  2VBY A;  3DV8 A;  3LWF A;  1PP8 F;  1FBU A;  1B9N A;  1ZAO A;  1LB2 A;  2K02 A;  5CVV A;  1BI0 A;  4BH9 A;  1J59 A;  1LDD A;  1ZRD A;  4Q47 A;  3ZMS A;  5HS8 A;  3DF8 A;  5ICE A;  2JTV A;  4FHT A;  2FF4 A;  1EV7 A;  4BAY A;  4OIN F;  2ETH A;  1LDK B;  4OIP F;  1HBX G;  4KIC A;  3LQQ A;  4UVA A;  4NQW A;  1U3E M;  3WTY C;  1H9G A;  4YFK F;  2EV0 A;  2Q8K A;  4PGH A;  1ZG5 A;  1YTY A;  3F8F A;  3MCZ A;  5EEH A;  1ZYR F;  3SZP A;  1HW1 A;  2STT A;  5L3B A;  3BJO A;  2DAO A;  3RI4 A;  3QP6 A;  3FMS A;  3B02 A;  4UV9 A;  4TV7 A;  3GFM A;  3J7A O;  3I5U A;  1OYI A;  1FX7 A;  1G4D A;  2YX7 A;  4XLP F;  1O3R A;  2FBK A;  3CUO A;  1YW9 A;  1PUE E;  4Y13 A;  1WI9 A;  1FZP B;  2FQ3 A;  3GFI A;  1EH7 A;  5LGN A;  4EVI A;  3ZMV A;  3Q9S A;  1TQM A;  2Y75 A;  2DLL A;  1CF7 B;  1IRG A;  1FPQ A;  2FA5 A;  2P8T A;  5E17 F;  3TOB A;  1IW7 F;  3VEP A;  1EH8 A;  2LSO A;  3FMR A;  2VOP A;  1XSD A;  1S6L A;  2X4H A;  3P9I A;  3F23 A;  2H27 A;  3F72 A;  4A6E A;  4LLN A;  3T8T A;  2Z99 A;  3KP4 A;  5DCM B;  3SFZ A;  2M87 A;  1T2K A;  2KRF A;  4BHB A;  4MTE A;  3ZN0 A;  1RUN A;  2KJB A;  5LGU A;  2VT2 A;  1UCR A;  1SFU A;  1BI3 A;  3T0Y A;  2V1D A;  4XSZ F;  2DI3 A;  2D2W A;  2QLZ A;  2PMU A;  1OMI A;  1KU3 A;  4EV0 A;  5J6X A;  1XD7 A;  4H0E A;  3AAF A;  3IWF A;  3F21 A;  4UV8 A;  1ZN2 A;  2V1U A;  3WOD F;  3FM3 A;  2P5K A;  2M30 A;  1LVA A;  3V8J A;  5HLH A;  1I27 A;  2G7U A;  1YS7 A;  4CIC A;  4M9Z A;  2XAG A;  4BQA A;  2OBP A;  2Z3Y A;  1GXQ A;  1KA8 A;  4LJZ F;  4KFC A;  1S7A A;  5BQT A;  1W7P D;  3LAP A;  2GAU A;  2JPC A;  2F5F A;  1XB4 A;  4HBL A;  1D8J A;  3GFL A;  3DEU A;  2H94 A;  1JXS A;  2Z5U A;  1IN6 A;  3ELK A;  4G8X A;  3ZMZ A;  1FP1 D;  1ZHF A;  4DQ2 A;  2L4A A;  5IT3 A;  2FE3 A;  3K1N A;  3RIR A;  1QQI A;  1B1B A;  3JAM Z;  5KVR A;  1GVJ A;  1VTN C;  2NAZ A;  2DPD A;  2VBX A;  5E1Z B;  5D5V B;  2F5D A;  2OD5 A;  4M71 A;  4PCQ A;  3JSO A;  2CW0 F;  2ZJ2 A;  1FLI A;  2HDC A;  2KIM A;  3WTZ A;  3WTW C;  1P2F A;  5TRD A;  3ZMU A;  1LNW A;  3F3X A;  1QBJ A;  2JSC A;  3WTT C;  4HDU A;  2QBY A;  3G3Z A;  3EET A;  1Q1H A;  1PP7 U;  1YS6 A;  4BXU A;  2L3D A;  3B73 A;  1Z05 A;  4O3M A;  2H09 A;  3FXU A;  3OOP A;  3L7W A;  2HYF A;  4L0Z B;  4KT5 C;  5LHG A;  3Q5F A;  3QP5 A;  3K9T A;  1BOA A;  1J9I A;  1J7K A;  4UVC A;  1X3U A;  5D5X B;  3DKW A;  2CSO A;  5HLG A;  5HDN A;  4ZZD A;  1RZ4 A;  4EM2 A;  1Y0U A;  5HS7 A;  3E3V A;  2P7V B;  2K86 A;  2DPU A;  1S8N A;  4EMS A;  2H6B A;  3ROU A;  2RN7 A;  4Q4Z F;  3R4K A;  2O0Y A;  2E7W A;  5K5O A;  1YIO A;  2ZNY A;  4ZYD A;  3SZT A;  2BE5 F;  1T39 A;  4YIF A;  2HR3 A;  2HKO A;  5AON A;  1IN5 A;  2L02 A;  5JHU A;  1B4A A;  3GUD A;  3ABT A;  2XAS A;  3L9F A;  5CVR A;  4MHG A;  2DT5 A;  1XCB A;  3RDI A;  1BBY A;  5K1Y A;  4MQV A;  2WTE A;  1W4M A;  1S3J A;  3GZ5 A;  2CGP A;  5IT9 Z;  2XV4 S;  3SHF A;  2EA2 A;  3WTX C;  1WKM A;  4AWX B;  4IF4 A;  1JE8 A;  1HKT A;  2V9V A;  2HS5 A;  5JFR A;  4OIO F;  3TO7 A;  1LEA A;  4XSX F;  5BMZ A;  2ZFW A;  1RNL A;  4RGS A;  2ZXJ A;  4U7B A;  4G6Q A;  2LNB A;  4M6Y A;  1I1G A;  2M5W A;  5K5R A;  1LDJ A;  1ZLJ A;  1ZG1 A;  3G73 A;  2P5V A;  4WCG A;  4WK8 F;  4HQE A;  2GA1 A;  1FYL A;  1ON2 A;  2BEO A;  2DK5 A;  5LHH A;  2A5Y B;  1F4K A;  2A68 F;  3BPV A;  4EQQ A;  2EFW A;  2AS5 F;  4MGR A;  3L2C A;  4ETS A;  1UB9 A;  3K69 A;  3U2R A;  3MFK A;  3EQL F;  4XRF A;  2XAH A;  4ENM A;  4JK1 X;  1SD4 A;  3C3W A;  3GZ6 A;  1Z6R A;  1IXC A;  2QUF A;  3HUG A;  4CHU A;  3CJN A;  1FSE A;  4IHT A;  4FT8 A;  4M74 A;  2DQR A;  3CLO A;  1H9T A;  4RS8 A;  1G3W A;  3HTU A;  3ZPL A;  1WRJ A;  1SMY F;  1KQ0 A;  3LA3 A;  3J80 K;  4ENN A;  3TKY A;  4HF1 A;  1W7P A;  2RGV A;  3WGG A;  3ZQ7 A;  3RJP A;  1Z7U A;  2RC4 A;  3ZMT A;  2VE8 A;  2O8X A;  4E70 A;  1IF1 A;  4RB1 A;  3WE3 A;  2HZT A;  4KDP A;  1MGT A;  1RUO A;  1Z9C A;  2R3S A;  4U7D A;  4G7H F;  1LEB A;  3W6K B;  2XAQ A;  2DQL A;  5E20 A;  1SMT A;  1I6X A;  1HST A;  2IW5 A;  5F64 A;  4CGZ A;  2A6E F;  2W24 A;  2IT0 A;  2QZ8 A;  4KNY A;  3FXQ A;  2HQR A;  1R36 A;  2DK8 A;  5L3C A;  2TDX A;  3FF5 A;  2ESH A;  1B6A A;  2XUB A;  3FWE A;  3HRS A;  2MA3 A;  3HRM A;  3O6B B;  4LB6 B;  1KGS A;  4U0V A;  2MD5 A;  3QOP A;  2LKP A;  4OMZ A;  4A0Y A;  4ASN A;  4A5M A;  4ESF A;  4EGZ A;  3HOS A;  3FMQ A;  1REP C;  3DQV C;  4UHT A;  1YFH A;  3GEZ A;  4EJV A;  5H6Q A;  4HYE A;  4GYI A;  3V8K A;  4F7Z A;  3CDH A;  3IWZ A;  2K4J A;  5FO5 A;  2DTR A;  4UVB A;  2K4B A;  3R0J A;  1KU2 A;  4BHP A;  3DP7 A;  4HF0 A;  4LK0 F;  1YW8 A;  3I54 A;  2XRO A;  2L01 A;  1U2W A;  1K6O A;  4AVP A;  2KIU A;  3GO5 A;  2GWR A;  4HX7 A;  2VON A;  2V6C A;  2EFO A;  5D5U B;  3GF2 A;  5JVT A;  4M9X A;  1FBQ A;  3BPX A;  3PQJ A;  4L9V A;  1U78 A;  1USS A;  4I09 A;  2M1B A;  4D0P A;  3F8N A;  4P96 A;  5TJJ A;  2IA1 A;  1Z91 A;  1F5T A;  3FHZ A;  3VFZ A;  2UXN A;  1ZGJ A;  2AXL A;  3FZV A;  3I4P A;  4IRH A;  1QZZ A;  2FML A;  4S05 A;  1FWZ A;  1U5T C;  3HTS B;  1YQA A;  1BIA A;  2M45 A;  4N9H A;  5FB2 A;  1R5G A;  5DD8 A;  4KIG A;  3KP2 A;  4MEY F;  5FGM A;  3HRU A;  1BC7 C;  3HSF A;  2A61 A;  3LST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...