2DAOA

Solution structure of ets domain transcriptional factor etv6 protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
118
structure length
118
Chain Sequence
GSSGSSGCRLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFMKTPDEIMSGRTDRLEHLESQELSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription factor ETV6
publication title Solution structure of ETS domain Transcriptional factor ETV6 protein
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 20
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2daoA01
2QBYA 4WK8F 2VBWA 3I58A 3OV8A 4KDPA 2Z9OA 4KNYA 4RGRA 2P5KA 1ON1A 1LVAA 1TW2A 3CTAA 2EWNA 4EJUA 3TGNA 2VOPA 3ELKA 4ZH4F 3KZYA 1SFEA 1FZPB 5LRRA 2FNPA 1LB2A 2G7HA 3P7NA 4S04A 1CGPA 4BQAA 1ONVA 2UXNA 1K78B 2M5WA 4CHUA 5IT9Z 2A6EF 4HQMA 3DPLC 2A69F 1G4DA 2XASA 4OU0A 2QUFA 5LHIA 4KIFA 1S6LA 5ILUA 3V7CA 2FOKA 2D1HA 1QPMA 1Z1DA 3LAJA 1K7AA 3BJOA 3VODA 4FHTA 4L9VA 4A12A 1IXCA 3GW2A 3M8EA 1OYIA 1MDMB 2VOOA 1Z7UA 2K27A 2P5VA 3SHFA 4HA8A 2FNAA 4P9FA 3ML6A 5A2QZ 2HYFA 4ZYEA 3L09A 3ZN0A 1P4WA 2J5OA 5ICCA 2RGVA 1XSXA 3BOQA 5CVIA 2VC0A 1OPCA 3WTXC 1O57A 2PEXA 3LSTA 5LEKA 2Q2EA 3ROUA 2RVCA 2EFNA 3CLOA 4UV8A 3L00A 1K78A 4HAMA 3FZVA 2ZBKA 1IXSB 2V1UA 4HF0A 3S2WA 1ZRFA 1DUXC 4M9SA 2VODA 3QP5A 2DFIA 5E18F 4N0BA 1JGSA 4I0BA 2EV6A 4HOBA 4U0YA 3TQNA 2OAZA 1K79A 1HBXG 3IHUA 4YFKF 5DV5A 5HDKA 1F4KA 5LGTA 4RB0A 1HSTA 5CVRA 3E5UA 3F23A 3E6DA 4DQ2A 1MDMA 5HDGA 1KYZA 1XDUA 5F1RA 4WWCA 3G73A 3KP3A 3E3VA 3HSRA 1FWZA 2A61A 3CO6C 1HXDA 1BC7C 3ZMSA 4ETSA 3M7GA 3WU0A 5D8KB 2DAOA 4LLLA 3F8FA 3LA3A 2M1BA 2EJRA 3U1DA 2VC1A 2OU2A 3GF2A 3TKYA 3HRTA 1U5TB 2A5YB 4A0YA 4BHBA 2H6BA 3R0AA 4S05A 2UZKA 4EMSA 4A0XA 2STWA 5LHGA 4M71A 4RAZA 5FLXK 2PJPA 2VONA 4G7HF 1J5YA 2PLYA 3IRQA 5ICGA 1FLIA 4U88A 4MEYF 2GQQA 2PMHA 3V8JA 3KLOA 4N9HA 3SQNA 1GXQA 1IRFA 4I09A 4WX9A 4U0VA 3FMQA 2JTVA 1E2XA 5BS6A 1P92A 4YFNF 3KEQA 2NAZA 3MAJA 1FP2A 2UXXA 2VBZA 4MTEA 2QQAA 4BNCA 4OOIA 5L3GA 1V3FA 5AIQA 2A68F 1XMKA 1U2WA 2XGXA 1WQ2A 3I54A 1U78A 2A07F 4CICA 4UVAA 3HYIA 1D8JA 4CO8A 4BXUA 1DPRA 2IJLA 2L4AA 2W57A 1U5TA 5E1XA 3RJPA 2EV5A 2PN6A 1B4AA 4UVCA 3JAMZ 3ECOA 1R58A 2CGPA 1R1VA 4ZYGA 1I1GA 3KP7A 2L3DA 5LEJA 2A6HF 3C1DA 2XAFA 2E7WA 3HSFA 1B59A 1QBJA 2FQ3A 3GX4X 1OKRA 2MH2A 3KP2A 1HSJA 2OA4A 3SFZA 1SD6A 4RB2C 3QPHA 5DUIA 2ESNA 5HS8A 3DEUA 4Z2YA 1BI2A 3F21A 2PG4A 2VT2A 1RI7A 4EVIA 1X3UA 2ZNYA 1LDKB 4M6YA 1R5HA 1IXRC 4HV6A 2HEOA 1XGSA 1BN5A 5CYVA 3GEZA 3CUOA 3GVAA 2STTA 2O0YA 3ZN1A 4HX4A 3RDIA 1L3LA 2K4BA 2OQRA 4IXAA 1YO5C 4HQEA 1GHCA 1IN5A 4HDUA 4UXNA 3GZ5A 2R3SA 1K6OA 2HTSA 4RAYA 5L3EA 4TV7A 3F8MA 1U5TC 1YYVA 3K1NA 1I27A 4A6DA 3PQKA 4IVNA 2Y48A 1LEBA 1RUNA 2LF8A 1T38A 1D8KA 3CUQB 1ULYA 4XSZF 3MFKA 1V4RA 2XAHA 4LJZF 3E5XA 1PUEE 4R79A 2DLLA 5IT9K 1WWXA 4Q47A 1UFMA 3KZZA 2GAUA 3HUGA 2R7FA 5L3CA 1CF7B 1WI9A 2ESHA 1G3TA 3IWFA 2QBYB 3TDUC 4Y17A 2IPQX 3P9IA 3VOEA 2AS5F 2CYYA 2XAQA 5K5QA 3T8RA 1SAXA 3BPXA 4KMUX 1HQCA 2HKXA 1Z6TA 3VFZA 4BHCA 2JRTA 2XRNA 3E6MA 1O3SA 4KN4X 2Y75A 5A2QK 1O7FA 3TO6A 3HRSA 3GWZA 3BWGA 2YPRA 1IF1A 2QWWA 2Z99A 2F5CA 2P6SA 4AWXB 2D45A 1USSA 5DD8A 1XB4A 4LFUA 1GVJA 2XIGA 1STZA 3FF5A 3V7SA 2KJBA 1MJBA 1BI0A 1R23A 2DW4A 2W25A 1TLHB 2K4JA 3GO5A 2CWEA 1W7PD 4O3MA 3MEXA 2P4WA 3BP8A 4HV5A 3DKWA 1TNTA 4FX0A 4NQWA 3GZ6A 5ICEA 4FX4A 1FNNA 4A0ZA 1LDJA 2FBKA 5FFXA 5HLIA 1I6XA 1CF7A 2ACJA 1T6SA 1HKTA 3EETA 4PZJA 1YFHA 5CVUA 3C18A 3FX3A 2H27A 1BBYA 3EYYA 3J81Z 3FXQA 3V8KA 4L18B 4HW0A 2HYGD 3WTWC 3CDHA 4EJTA 5HS7A 3TO7A 3TDZC 2W85A 1FSHA 4XSXF 1FOKA 2H09A 3VB2A 2ADUA 2EA4A 2EFQA 1DP7P 1B9MA 3J80Z 2HOEA 4JK1X 1G3SA 4M6XA 4NHJA 1KA8A 2MD5A 2VBYA 3J7AO 2DO7A 3B02A 2BBYA 5DUKA 3CUQC 4WXDA 3HTSB 1MD0A 1ODDA 1S3JA 3ZPLA 4CGZA 5DCMB 2MH9A 4I02A 4JQFA 3WTUC 3OOPA 3GUDA 3WGIA 3NEUA 1H0MA 4G7OF 1T98A 5D4RA 4Q48A 3WODF 1JHFA 1YIOA 4RGUA 3LQRA 1UCRA 1ZLKA 2COMA 3IKVA 4MNUA 2NS0A 2XKOA 5ILVA 4EM0B 1J7KA 3JSPA 5JHUA 4GYGA 4PDKA 1S29A 4I2OA 2LNBA 2YU3A 4L0YB 1ZLJA 4HZFA 4YIIA 3TOAA 2AXLA 3DP7A 1IN8A 4EGYA 5ERIA 1SMYF 3LFKA 3ISPA 3P9KA 1TQIA 4BHPA 3DXJF 1KU9A 1SD4A 1FBQA 1W5TA 3RPQA 1SD5A 1H9GA 1MKMA 1ZYRF 1YLFA 4PGHA 2J5PA 2F5DA 2LDUA 5J8FA 4RS8A 4WF2A 2XKPA 5DCMA 2IA2A 3N4MA 1T39A 1SFUA 3GXOA 1JXSA 3DV8A 3QU6A 4RGSA 2XUBA 3WGGA 3EYIA 1RNLA 3IL2A 4QLCU 1W5SA 2V1DA 2DT5A 2GA1A 2IW5A 1Y0UA 2HDCA 5H6QA 3RI4A 1YG2A 4KIGA 4M9ZA 2R7DA 5DEQA 1TNSA 1YS7A 2X0LA 5D8LB 2P5LC 2QZ8A 3AAFA 2XHKA 3HSEA 4UHTA 5K1YA 4HDVA 1TQPA 2UWMA 1S7OA 1REPC 3F72A 4RGXA 2FBHA 1KU7A 4O5VA 2FEZA 3JSOA 3PQJA 2P7CB 1GXPA 4OIRF 4G8XA 5TJJA 2DQRA 1NHAA 1QQIA 5AONA 1BM9A 1T2KA 2NRAC 4AIHA 3GFIA 4XLNF 2CG4A 1R22A 2HR3A 2JT1A 4CXFA 1A04A 1FYMA 5FFZA 2X4HA 2VE9A 1P4AA 5F64A 3U2RA 3EDPA 3TO9A 1Z9CA 3KLNA 3KCCA 3WG9A 4GGGA 2M30A 3DFGA 2CW0F 3GFMA 2GA2A 2HZTA 2JPBA 4G6DA 3R61A 4LLNA 2DPDA 3VEPA 3F8BA 1OYYA 2JSCA 1FP1D 3BPVA 3F22A 1YQAA 1IN4A 2MA3A 3R4KA 2O3FA 3Q9SA 2VE8A 3F6OA 2LKPA 4HX8A 3MZYA 4KFCA 3WTVC 1BI3A 3ERED 2RV8A 4HF2A 1KU3A 1YW7A 5E20A 3HHGA 2QQBA 4ZYHA 2HWVA 5D4SA 2EFOA 2GIVA 3GLXA 1ZGJA 2ZCWA 1UHMA 3MQ0A 5L3BA 5BOXA 4A6EA 2XV4S 4EM2A 1F5TA 4LB6B 3R60A 1XCVA 5DDGA 4KIBA 3F8NA 2KIUA 1J2XA 4B09A 5J8CA 2QYOA 3K9TA 1QZYA 2D1VA 5CLSA 5JI6A 1TBXA 3SZPA 2BYVE 3MWMA 4AIJA 2EV0A 1ZG5A 3I5UA 1FBSA 3C7JA 4WXHA 5D5VB 5BMZA 1QGPA 1UB9A 2FBIA 3DQVC 3REOA 3M9AA 3N97A 3K1MA 4E70A 1Z6RA 2JZYA 1XN7A 3FM3A 2VXZA 5FLXZ 4CYDA 4ZYDA 1IUYA 1W7PB 5D6EA 2A3SA 5BQTA 4EQQA 4GYIA 2BV6A 5DCFA 4KMFA 1OMIA 2V79A 1W4MA 1FX7A 1MZBA 2KJCA 2O03A 4BH9A 4UNOA 3Q5FA 1RZ4A 4AD9A 5E8IA 3J81K 4U7DA 3FM5A 2QVOA 2F5FA 5K5OA 4OMYA 4JBAA 3WTTC 3M8FA 2EA2A 1JE8A 4RB3C 2WWYA 3K69A 4EGZA 4P96A 2DBBA 2XAJA 3J80K 4MTDA 4P5OA 4EV0A 5HVQC 3T0YA 2K7LA 1F9NA 4CDGA 3SZTA 2HTJA 3R0JA 4GCVA 1ZH5A 4P9UA 5HDNA 5J6XA 2ZXJA 4PGGA 4EJVA 1ZG1A 2M45A 2VN2A 3IC7A 1FPQA 2L4MA 3W6KB 5FB2A 4KYWA 4D0PA 5FO5A 1T0FA 4Q5SF 5KK1A 3LQQA 3FHZA 2VBXA 4IRHA 4G7ZF 5KVRA 2WV0A 4AIKA 2DQLA 4KN7X 1TQMA 2CSOA 1QNTA 3E5QA 1BC8C 4MQ9F 5K5RA 2G7UA 3KEOA 1W7PA 2ZFWA 5HOOA 2HKOA 3FMSA 1EH7A 2F2EA 4R8HA 1B9NA 3WE2A 4B8XA 3BY6A 4ESFA 5LGNA 3RKXA 4A5MA 2OD5A 2KKOA 6PAXA 1J9IA 4ON0A 3C3WA 5BPIA 4HLYA 3ZMVA 3I0TA 2BGCA 1HKSA 4A2UA 1PP7U 2QLZA 1ZARA 2DU9A 4IHTA 4KA4A 3IRRA 2L01A 3ZMUA 1MJ9A 4HLXA 2MLKA 3G3ZA 3E97A 1R1UA 2OQGA 5DD4A 3HHHA 4ENKA 2NNNA 3RYRA 2VT3A 2TDXA 4H0EA 3B73A 3WU1B 2QM3A 3I59A 1PDNC 2CFXA 2W84A 2Y0MA 1BIAA 1U3EM 1G3YA 4I7HA 2EK5A 5CJ9A 3I53A 2L54A 2FSWA 1LJ9A 3RIRA 2PQ8A 3ZMZA 1XCBA 3QPTA 3HRUA 3IWZA 1LEAA 5FD5A 2Z33A 3D0SA 5TRDA 1L0OC 1S8NA 2IVMA 4MQVA 1Z05A 2LF7A 4ENNA 4LK1F 4ZZDA 3BJAA 2FRHA 1JHHA 5D6FA 3NRVA 1BOAA 1KQ0A 1FY7A 4ESBA 2CO5A 2FE3A 1ON2A 1G6NA 3LA2A 5E1WA 3MZHA 3ZQ7A 2PFBA 1BI1A 5FGMA 4G6QA 1J59A 1OR7A 1LDDA 4XLPF 1MJAA 2F5EA 1R00A 1G3WA 4Y15A 4WCGA 2O61A 2OZ6A 1XDSA 4KICA 3F3XA 3Q9VA 2GXGA 3HTUA 4ESJA 2KRFA 3LAPA 2O6GE 1WKMA 1P2FA 2L02A 4M74A 3D5LA 5LHHA 4YG2F 2ETHA 2EFWA 5CVJA 1EH6A 3EUHA 3O3KA 2ZMEB 5LGUA 2FF4A 2IA0A 4MGRA 1F1ZA 1ZRDA 2GWRA 5D5XB 1Q1HA 3DPTA 5E8GA 1ZREA 3KP5A 3H92A 5JFRA 3WE3A 3RPUA 2OBPA 4KUMA 4XRFA 2M8EA 4LGWA 1HW2A 1D3YA 1O3RA 2MBFA 5L3DA 1BIBA 2RC4A 1AOYA 4RB1A 1IAWA 1AWCA 1XD7A 4UUVA 3SXYA 2BEOA 1B6AA 2V6CA 3JAMK 3QU3A 2LSOA 3HRMA 3IKTA 1ZHFA 4MEXF 3ZMDA 5CVVA 3RKYA 1QZZA 1HW5A 5D5WB 1P4XA 1Z91A 1ZRCA 5L3FA 3COAC 3L7WA 2GXBA 2RN7A 5HS9A 4EJOA 2PMUA 3ZMTA 3JTHA 2QQ9A 4ENJA 2GZWA 1OYWA 3F6VA 5E1ZB 2FA5A 4LMYA 3QOPA 2ZMEA 1XGMA 3I64A 4BYYA 4A5NA 2XAGA 1HW1A 4N9IA 3CO7C 2YX7A 3RYPA 3QAHA 2K02A 5ICFA 4HF1A 5D5UB 2MLGA 3HOSA 3P9CA 1ZN2A 4EM1A 4BAYA 2Q8KA 4R1HA 4G94A 1I1SA 3RKWA 3W6JB 2NYXA 1KU2A 3LA7A 2RKHA 1KYWA 1WRJA 4OIOF 1IW7F 1WSUA 3L2CA 1O3TA 3KP4A 4IHSA 4HYEA 5JR3A 2PI0A 1C0WA 4UV9A 2FMLA 1IRGA 1H9TA 2HFHA 1YW8A 3KE2A 1LNWA 2YX4A 3EQLF 1XGNA 1ZG3A 5H20A 2Z3YA 2NNYA 4HX7A 2IRFG 4ASNA 2C6YA 1XMAA 1ZAOA 2Z5UA 2WC2A 3O6BB 2ZJ2A 3PFIA 5LRSA 2E7XA 3DF8A 2YR2A 4NB5A 3V7RA 3KP6A 4YFXF 2ZNZA 3GFJA 3GFLA 2BE5F 1FYLA 4M72A 2H94A 2W24A 1IN6A 1FC3A 1P6RA 2V1XA 3V8LA 2DI3A 4K2EA 1R36A 1U8RA 4L5IA 3RTRA 4HBLA 4LB5A 5AIPA 4L5JA 2ZO4A 3H3ZA 3WGHA 4EJWA 4LD5A 2DK5A 3MCZA 4U0WA 4P55A 3T8TA 1IN7A 1IZ1A 1R5GA 1SFXA 2CQKA 5HLHA 1KQ9A 3I4PA 3TOBA 2ISZA 3E6BA 1USTA 2H6CA 4L0ZB 2HQNA 5ILSA 5F6FA 2K86A 1MGTA 2P8TA 5E17F 3M1EA 1VTNC 2RQPA 3O2PE 3E6CC 1YW9A 4LG0B 4CZZA 1RIOH 4G9YA 3KETA 2G9WA 2ZKZA 5IT3A 4Q4ZF 3FXUA 3ZP5A 5DYMA 4F7ZA 1O3QA 2EFPA 2RDPA 4AVPA 2OZUA 1DDNA 4IPAA 5EEGA 1EH8A 3BJ6A 4IRGA 3FXRA 4M9XA 3ECHA 3K2ZA 1YS6A 4ENMA 1KQ8A 3HIFA 4MHGA 1R7JA 3JTGA 2FU4A 3BROA 1J0RA 3NQOA 5HLGA 3HOTA 2QENA 1FSEA 4M73A 2O8XA 1LQ1A 2XVCA 3K0LA 2JPCA 1UHWA 5LLQA 3T5XA 4OMZA 4L9TA 3I59B 1D5VA 3QP6A 5ED4A 2KIMA 3T1BA 1DPUA 4XBFA 1J75A 1YTYA 5H6RA 4WXCA 3BDDA 3U9GA 2P6TA 2HGCA 4GO1A 1XSDA 2XROA 2FMYA 2ELHA 2HQRA 4LLGF 4LK0F 4O6JA 3ULQB 2PBIA 1PP8F 1BJAA 1EV7A 2P7VB 1TW3A 4L9NA 4LG0A 2E1NA 2E1CA 1E17A 1RUOA 2Q0OA 2D2WA 2M87A 4ZZLA 4U7BA 2V9VA 3QRFF 1FYKA 4I98B 1ZGAA 1B1BA 2MC3A 4L9JA 3V4GA 4FT8A 3ABTA 2DK8A 1I5ZA 1TTYA 4GXOA 4IF4A 3CJNA 1SMTA 1HKQA 1KGSA 1O7LA 4QWQA 4I0AA 1U6GA 3FWEA 4UVBA 5FD6A 1R1TA 4OINF 3I71A 4OIQF 1S7AA 2EB7A 3WTYC 2DTRA 2IT0A 4OIPF 1XSVA 3WTSC 2KIFA 1XGOA 1FBUA 2IP2A 5BPDA 3CUQA 2B0LA 4YIFA 5JVTA 2HS5A 5EEHA 1SD7A 3FMRA 4PCQA 3R6SA 2DPUA 5LBQA 4IRIA 4IJAA 2IA1A 3L9FA 4KT5C 2ISYA 3ABUA 3GYHX 1FT9A 3K1PA 2YSRA 2RNJA 3BZ6A 4Y13A 3WTZA 4I01A 3JW4A 3KFWX 3H3UA 1QO0D 2FXAA 2WTEA 3F8CA 3LWFA 4DNCA
chains in the Genus database with same CATH superfamily
1BW5A 2QBYA 4A3GJ 2AQEA 4WK8F 2VBWA 3DBHB 4IQJA 4IHYA 3I58A 3OV8A 3VPRA 4KDPA 1FIAA 2Z9OA 2DA5A 5GAHJ 4KNYA 4RGRA 2P5KA 1RESA 4BACA 1ON1A 3CMMA 3DWLE 3GMEA 4F3QA 1YJ9I 1LVAA 1TW2A 2CUEA 3CTAA 2EWNA 1X3ZB 4EJUA 4E7SA 3TGNA 2EIJH 1DGRM 2VOPA 1PJRA 3BLYA 3EUKL 3ELKA 5J1UA 2EIKH 1MW7A 3KZYA 4ZH4F 2QA4I 1SFEA 4A3IJ 1FZPB 5LRRA 1HCRA 3IH3A 3HZJA 2FNPA 4CYCB 2NOGA 1LB2A 3KPHA 2G7HA 3P7NA 2BVMA 2Q2EB 2Y69H 1W0TA 3K4KA 4S04A 2K9QA 1CGPA 4BQAA 1ONVA 2MD0A 2E2JJ 2UXNA 2QSHX 2NVXJ 5KCMA 4BDZA 1K78B 2M5WA 4CHUA 3I4NJ 3D1NI 5IT9Z 2A6EF 1RR7A 4HQMA 3GTPJ 3CQZJ 2RREA 3DPLC 2A69F 4BY1J 1U9NA 2W82A 1JKRC 2XASA 3J7YJ 1G4DA 4OU0A 2QUFA 5LHIA 2VJ5A 4KIFA 1S6LA 5ILUA 3V7CA 4BJTA 2FOKA 2D1HA 1QPMA 1JUPA 5FKKA 1Z1DA 2I5UA 3LAJA 1K7AA 3BJOA 3VODA 2BXYA 4FHTA 4MLOA 4L9VA 3FIWA 1IXCA 3GW2A 4A12A 4BE0A 3FXKA 2ZSHB 1WJBA 3M8EA 5EZGA 1OYIA 1MDMB 2VOOA 1Z7UA 2K27A 2P5VA 3SHFA 1JUSA 4HA8A 2FNAA 2HDWA 4P9FA 3ML6A 5A2QZ 1PVEA 4BE1A 2HYFA 5EZHA 1R9TJ 1XG1A 4ZYEA 1I6HJ 2LYCA 3L09A 3MVPA 2E1OA 3ZN0A 4BE2A 1FOYA 3LL7A 2A6TA 1P4WA 2J5OA 3S1RJ 4IKFA 3M1CA 2DA6A 3VWBA 3OWTA 5IOZA 4Y33A 3MKYB 5ICCA 4DJAA 4IHXA 4HG2A 2ZB9A 4BEHB 3M4OJ 2RGVA 4A3KJ 4IZZA 1XSXA 2VQLA 5JVGF 2CW7A 2JWTA 1HC8A 3X2QH 3BOQA 5CVIA 3HBLA 5F0CA 2VC0A 1OPCA 3WTXC 1HA8A 3FKIJ 2HI3A 1O57A 2M3AA 2PEXA 2XF5A 3LSTA 2CU7A 3HGGA 3ZXSA 4CYCA 5LEKA 2E34A 2DOEA 2Q2EA 3IP4B 3ROUA 2RVCA 5K7FA 2W00A 2EFNA 2BY0A 3CLOA 4UV8A 1MNDA 4BQQA 2HOSA 3L00A 3M07A 1K78A 3BR2A 3FZVA 2ZBKA 4HAMA 1IXSB 2V1UA 1FOXA 4HF0A 3S2WA 1OR7C 2FD5A 4LIUA 1ZRFA 1DUXC 4M9SA 4DIQA 2VODA 2KRHA 3FBNB 1IGNA 3QP5A 3CC7I 3BTIA 2EILH 2BY2A 2DFIA 2O7OA 3CDIA 5IYCJ 1WJCA 2K3FA 2QQ8A 5E18F 5B3SH 4N0BA 1JGSA 4I0BA 2W4SA 4C2MJ 3SEZA 2EV6A 3HOXJ 3SEQA 4H4KC 4HOBA 4U0YA 3TQNA 5F27A 3G4SI 2OAZA 3G1OA 1K79A 1HBXG 2R7RA 3IHUA 4YFKF 5DV5A 3GTOJ 2ELJA 3BG3A 5HDKA 2CUJA 1N77A 2EZHA 1MBKA 1F4KA 5LGTA 4RB0A 1HSTA 5CVRA 2ECCA 3E5UA 2JA8J 1H8AC 3F23A 3EUHC 3E6DA 2XAUA 1X19A 4DQ2A 2L2OA 2KHMA 3BQZA 5HDGA 1MDMA 1KYZA 1XDUA 5F1RA 4WWCA 2NXNB 3G73A 3KP3A 1MMGA 2CRGA 3E3VA 1T8IA 3HSRA 1FWZA 2A61A 3CO6C 5GADJ 3LSRA 4Z6YA 1ETYA 2K5CA 1HXDA 4XLHA 3ZMSA 1R71A 1BC7C 4ETSA 3B6AA 3M7GA 2ICWG 3WU0A 5D8KB 2KDOA 2DAOA 1AHDP 1AA7A 2OTLI 4LLLA 3F8FA 3LA3A 2M1BA 2EJRA 3I56I 4A3DJ 3U1DA 2V26A 2VC1A 2OU2A 3GF2A 2NS7A 1Y1VJ 4RMNA 4XR6A 3P5JA 1BR4A 3HRTA 3TKYA 3DTKA 3HG9A 4BL0B 1U5TB 2A5YB 4A0YA 4BEHA 4F55A 3SFIA 2H6BA 3R0AA 4BHBA 4S05A 2UZKA 2QGUA 4EMSA 4A0XA 2STWA 5LHGA 4M71A 4RAZA 3C2HA 5FLXK 2PJPA 2VONA 4G7HF 1J5YA 4E4HA 2PLYA 3IRQA 2F48A 5ICGA 1FLIA 4U88A 4IHWA 2X6OA 2NOJB 1WJEA 4MEYF 2GQQA 4MIMA 2PMHA 3V8JA 2CUFA 2R7UA 3KLOA 4N9HA 3F0CA 2VKHA 3SQNA 1GXQA 1S9HA 1IRFA 5J1YA 4I09A 3BR5A 3U1KA 3OYHA 2L9NA 4WX9A 4U0VA 2LG4A 3FMQA 4E7JA 4HSRA 2JTVA 1Z21A 1E2XA 1K61A 1VQ8I 5BS6A 1P92A 4YFNF 2R7WA 3KEQA 2NAZA 5FRNA 1JTYA 1VQMI 1A6IA 3CCJI 4Y7NJ 3K4LA 3MAJA 3H5RA 1RR8C 1FP2A 2JA7J 2MABA 3DCFA 3PUFA 1MBHA 4XMYA 2AXTC 1TWGJ 2UXXA 2WBMA 2VBZA 2GBYA 4FISA 5JHFA 4MTEA 1JT6A 2QQAA 4BNCA 3A4CA 3E7LA 5CKTA 5GPAA 1FMWA 4OOIA 3I4MJ 5L3GA 2DMUA 3OYAA 4RLFA 1F43A 3DEEA 1MBFA 1V3FA 5EJCA 3JR9A 1IRZA 5AIQA 2A68F 2IGKA 1XMKA 2OC6A 2ZMEC 1U2WA 2XSDC 5E3MA 2XGXA 1WQ2A 3I54A 3EUAA 2YUSA 1HLVA 2CS3A 2R7XA 4E7ZA 1S72I 1U78A 2A07F 4CICA 1QRYA 4UVAA 3HYIA 2WAQA 1D8JA 2CH0A 2LREA 3BR6A 2ID3A 1S5LC 4CO8A 4KITB 2WAQN 4BXUA 2KQRA 1DPRA 3S1QJ 2IJLA 2L4AA 2W57A 3RKQA 1U5TA 5E1XA 3GLLA 1GDTA 3RJPA 4E6KG 3SDBA 2EV5A 2PN6A 1B4AA 4F92B 4A3MJ 2L7ZA 2CFOA 2OCEA 3NAUA 5BNGA 4UVCA 1TT0A 2ZJRF 4GFBA 4XLAA 3JAMZ 3OSGA 1JUMA 3ECOA 1R58A 1MMAA 2DDAA 5E3NA 1GV5A 4HNVA 2CGPA 3MKZA 1R1VA 3VSLA 4ZYGA 1I1GA 4RDUA 3KP7A 2L3DA 4B4CA 3MD2A 2X51A 4MFDA 2A6HF 3C1DA 2XAFA 5LEJA 2E7WA 3HSFA 1B59A 4CCOA 3AL0B 1QBJA 4GDFA 2DOAA 2FQ3A 3GX4X 4FASD 1OKRA 4UY8I 2MH2A 3KP2A 2R7ZJ 1HSJA 2OA4A 1ZK8A 2E60A 2OPTA 3SFZA 5F0HA 4II2A 4FTHA 1ENHA 1SD6A 4B3XA 5C4XJ 4RB2C 3QPHA 3GTGJ 5DUIA 2ESNA 5HS8A 2FJ1A 2R0QC 3DEUA 4Z2YA 5GP9A 1BI2A 2JJ7A 3F21A 2PG4A 2VT2A 1X1PA 1RI7A 2KISA 3PSIA 1K4SA 3CCEI 4B43A 3Q0VA 1X3UA 4EVIA 1K83J 2GXAA 2ZNYA 4QPOA 4RM3A 1LDKB 5EEAA 2DA4A 4M6YA 1R5HA 3ZR8X 1IXRC 4HV6A 2HEOA 3HOUJ 2KZVA 1CQTA 5HODA 1XGSA 3HOYJ 3PNTA 1D0ZA 1BN5A 5CYVA 3GEZA 2V6EA 3H35A 4F52A 1LKXA 3CUOA 3FKJA 3GVAA 2STTA 1X2NA 2RQQA 2O0YA 4ANJA 3ZN1A 3TL4X 4HX4A 2FX0A 1Z77A 3RDIA 1L3LA 1UZCA 2K4BA 2OQRA 4IXAA 2DT7B 2HVSA 3K4JA 1YO5C 4HQEA 5FKOA 5B1AH 4NC6A 3OS0A 2R5YB 4BBSJ 1GHCA 2X9DA 1IN5A 4P1WA 3PO3J 4HDUA 4HEA2 4UXNA 3GZ5A 2R3SA 3C2GA 2IS1A 4M6VA 1K6OA 2HTSA 1IRXA 4RAYA 4CCLA 5L3EA 4TV7A 1JGGA 3F8MA 1U5TC 1YYVA 3TW6A 3K1NA 2P81A 1I27A 1VQ6I 1MMDA 3BZCA 1MH3A 4A6DA 3PQKA 3K70C 4IVNA 2Y48A 5GAGJ 1LEBA 1WH5A 1RUNA 2O5RA 1YE9A 2LF8A 4CUGA 1T38A 4OAYA 4Y3OA 1D8KA 3CUQB 2OF7A 1ULYA 4XSZF 2LKSA 3MFKA 4KISA 1FTZA 4PSWA 3TBIA 2FQ4A 1HF0A 1P9QC 1V4RA 1IJWC 2DTZA 1X1AA 2XAHA 4LJZF 1LE8B 1NK2P 3E5XA 1PUEE 1POGA 4R79A 3PFYA 2DMNA 2DLLA 3PL8A 3D5RC 4NNJA 2VQGA 5IT9K 2E35A 1WWXA 4NQWB 4Q47A 2WA0A 1UFMA 3KX2A 3KZZA 3S8PA 1TC3C 2GAUA 3HUGA 3OL4A 1D1BA 2R7FA 2BOLA 4XM3A 4F91B 4I6ZA 5L3CA 1CF7B 1WI9A 1I3QJ 3MKLA 2ESHA 1G3TA 3IWFA 2WB1A 2QBYB 5FKLA 3TDUC 4YIRX 3G6EI 2NVUB 2Y9YA 2WB1N 5IP7J 4Y17A 2IEKA 1OJLA 2IPQX 2UV1A 3P9IA 2E2IJ 2KDZA 3VOEA 2AS5F 1BR1A 3NWSA 3W6VA 2CYYA 2LBFB 2XAQA 5K5QA 1YJNI 3T8RA 1SAXA 3KYLA 3HPGA 3BPXA 4KMUX 1HQCA 2HKXA 3AG3H 1T33A 1Z6TA 3VFZA 4BHCA 2ZXHA 1OCZH 1XS9A 2JRTA 1MNMC 2XRNA 1VQ7I 3E6MA 2ZFUA 2R5YA 2VIXA 1O3SA 1IC8A 4KN4X 2JUGA 5LFAA 2Y75A 5A2QK 1O7FA 3I3LA 3TO6A 1XTAA 1LFUP 3HRSA 2V7FA 3GWZA 2MGQA 2BHYA 2VQCA 1RETA 2R7QA 5C4JJ 3FISA 1WFXA 3FXLA 3BWGA 3S93A 4V2FA 2YPRA 1IF1A 2QWWA 2Z99A 1N25A 2F5CA 2P6SA 3QYEA 2L7MP 1WPKA 2V4JC 4AWXB 2D45A 1NK3P 1USSA 2IGNA 2V1NA 2XGCA 5DD8A 1XB4A 4LFUA 4BBRJ 2WAFA 2XDVA 5J3LA 1GVJA 2XIGA 1STZA 3FF5A 3V7SA 1ZR2A 1KZHA 2KJBA 2W1OA 1MJBA 1R23A 1BI0A 4PSXA 3OYLA 3RSNA 1LE8A 2DW4A 2W25A 1TLHB 2K4JA 3GO5A 4X6AJ 2CWEA 4BJ6C 1W7PD 4O3MA 3MEXA 2X1EA 2P4WA 3BP8A 2M7AA 4HV5A 4A3FJ 1SFOJ 3BTLA 2YU9J 3DKWA 1TNTA 4FX0A 4NQWA 3CCMI 2DOFA 1UG2A 5ICEA 3GZ6A 4FX4A 1FNNA 1X58A 2XPUA 4A0ZA 1LDJA 4JX5A 1WHUA 2FBKA 5FFXA 5HLIA 4FCYA 1I6XA 4BDYA 1CF7A 1JKPC 2L5QA 2ACJA 1T6SA 3ZCOA 1T56A 1HKTA 3EETA 4PZJA 1YFHA 5CVUA 3S1NJ 4DZJA 1I39A 3C18A 4JYKA 2WV1A 3FX3A 3H9QA 3K2AA 2H27A 4AM3A 3OY9A 1TWCJ 1BBYA 1G2HA 3L1PA 3W2AA 3EYYA 3S3NA 4S0HB 2JA6J 1P7IA 2LBFA 1R5ID 1IUYA 4N4OB 2XF6A 4BY7J 3J81Z 3FXQA 2WY7Q 3V8KA 4L18B 4HW0A 2HYGD 3WTWC 3CDHA 4ZTJA 4EJTA 3PNYA 4PFOA 4YRVA 4J19A 5HS7A 2PMZA 2F4OB 4M3EA 3TO7A 3TDZC 2W85A 4UB6C 1FSHA 3HDDA 5FLVA 1OCOH 3BCAA 4XSXF 2PMZN 1FOKA 2BY3A 2H09A 1QVTA 3DKXA 3VB2A 2E2HJ 2ADUA 4ZC3A 2EA4A 3FK7A 5K7HA 5M5XJ 3S1MJ 3SDGA 2EFQA 2HDDA 1DP7P 1B9MA 3J80Z 2HOEA 1MBJA 4JK1X 5M3FJ 1G3SA 1MBGA 4M6XA 3CZ6A 2E1MB 3A0HC 4NHJA 3CF2A 3FDYA 4ZTFA 1KA8A 2H8WA 2MD5A 2VBYA 5E3LA 3J7AO 2DO7A 3B02A 3L2VA 4E7HA 2E36A 2BBYA 4IEJA 4N4NB 3GTMJ 5DTDA 2GIZA 2XSJC 4C3JJ 3LSGA 4DBRA 3G71I 5DUKA 3CUQC 4WXDA 1TWFJ 1MD0A 3HTSB 4FE7A 3CJQB 3KYCB 1ODDA 2AHQA 4J01A 5B1BH 1S3JA 2L9VA 1OCPA 3ZPLA 2GOMA 4CGZA 5DCMB 2VPRA 4XL9A 2MH9A 4RBOA 1ERDA 4I02A 4JQFA 2Z2SB 1VNDA 3K4BA 3WTUC 3BG5A 4HNUA 2CQNA 3MN2A 3OOPA 2E5NA 3ZGKA 3GUDA 3WGIA 4C3IJ 3NEUA 1LFPA 1A6QA 2R7VA 2XF7A 3GTQJ 1H0MA 4G7OF 1T98A 3RQ4A 2K9MA 5D4RA 4Q48A 3H5AA 5HNFA 1ACIA 2CV1A 4B44A 3OYKA 1FTTA 5K7ZA 3WODF 2QSGX 3S2HJ 3LSHA 1JHFA 1YIOA 1V54H 4RGUA 3LQRA 1UCRA 2LKXA 1SVMA 1ZLKA 2COMA 3IKVA 3G2BA 1SEUA 4MNUA 1BL0A 2NS0A 2BXZA 2XKOA 3A1YA 2XRLA 3J7ZI 5ILVA 4EM0B 3GTJJ 1J7KA 1MMSA 3JSPA 5JHUA 4GYGA 2B9SA 4PDKA 1VI0A 1S29A 4I99C 4I2OA 2G0EA 1B72B 2LNBA 2YU3A 4L0YB 1ZLJA 4HZFA 4YIIA 3ABMH 3TOAA 3CMYA 2AXLA 2M8GX 3DP7A 1IN8A 4EGYA 2V9KA 2VI6A 1H89C 4C2TA 4U87A 5ERIA 1BW6A 1SMYF 3AG2H 3LFKA 3O8GA 2WADA 4NUBA 4DW6A 3ISPA 3P9KA 2K85A 1TQIA 4MFEA 3DKYA 3DXJF 4BHPA 2DT6A 1KU9A 1SD4A 1WJFA 2Y2ZA 2LLKA 5IYBJ 4B47A 1FBQA 5FRMA 2EBIA 4CCNA 1TL8A 2RAEA 1W5TA 1NG7A 3RPQA 2HOTA 1O4XA 4NDLA 4CZCA 1SD5A 1H9GA 1Y0NA 1QVUA 2VKEA 1MKMA 2DMTA 2HPIA 3IH2A 1ZYRF 3FXJA 4D5FA 4DZPA 1YLFA 4PGHA 2J5PA 2F5DA 2LDUA 5J8FA 4RAGA 4RS8A 2DFFA 4X1EA 5EDNA 1A31A 4WF2A 2XKPA 1U0JA 5DCMA 4GRIA 3RPUD 2JK3A 2JA5J 2IA2A 3N4MA 3WU2C 1SFUA 1T39A 3GXOA 1JXSA 3DV8A 3QU6A 4RGSA 3GZNB 2XUBA 4CCMA 4AC0A 3A03A 3HJEA 3WGGA 5KNLA 2MG4A 3BR0A 4M3DA 3EYIA 3F9KA 2QCOA 1RNLA 3IL2A 3OYNA 2OJED 2Y30A 4QLCU 3Q0WA 4X0GA 4M3FA 1WCMJ 3VSKA 1W5SA 1S7EA 2V1DA 1W36C 4M3BA 2DT5A 2GA1A 2IW5A 1Y0UA 1JT0A 2HDCA 3QQAA 4XNFA 3ABKH 3OS2A 1EA3A 5H6QA 3RI4A 3OYFA 1YG2A 4IO9F 1DP3A 4KIGA 4M9ZA 2R7DA 2JQ7A 2HPMA 5DEQA 2LK2A 1TNSA 1YS7A 1Y8RB 2V9PA 2X0LA 5D8LB 2WAEA 2P5LC 2QZ8A 2Q1ZB 3AAFA 2XHKA 3HSEA 4BU2A 1ZELA 3Q0UA 4UHTA 5K1YA 1B72A 1MNEA 4HDVA 4BQOA 1TQPA 1G59A 1E3PA 1P7JA 2UWMA 1S7OA 3ASNH 1REPC 4HPQA 3F72A 4RGXA 2FBHA 1KU7A 4XIDA 3LSJA 4O5VA 1T95A 2FEZA 3LWFA 3W2WA 5F1JA 2DJNA 3JSOA 1GVDA 3PQJA 2E1MC 2X85A 1ETXA 4E7LA 1ZGWA 4E7IA 2P7CB 2O8KA 4BQNA 3PM1A 1GXPA 4LOCA 2CUZA 3MZ8A 4OIRF 2R7OA 3WHBA 1HDDC 4G8XA 2OUMA 3KEYA 5TJJA 2DQRA 1NHAA 1QQIA 5AONA 1BM9A 2DMQA 1T2KA 1AKHB 2X6YA 2ELKA 1WJDA 1R4NB 2R5ZB 2NRAC 2I8DA 4IQ4A 1MSEC 4AIHA 1LFBA 3GFIA 4XLNF 2CG4A 1R22A 1V5EA 2HR3A 2JT1A 4CXFA 1A04A 1FYMA 5FFZA 3ZOBA 2X4HA 2VE9A 2JUCA 1ZTRA 3DPUA 1P4AA 5F64A 3OYEA 2LY9A 4E7KA 5JLXA 3A01B 3U2RA 3EDPA 1I50J 3TO9A 2A05A 4BXXJ 1Z9CA 4V19K 5C44J 2HOAA 3KLNA 4UUTA 4HNTA 3KCCA 3WG9A 4GGGA 5EG0A 4LIVA 1MMNA 2M30A 3DBRB 3DFGA 3I55I 1MSFC 2HVRA 4EEFG 2CW0F 3GFMA 2GA2A 3VYRB 2HZTA 2JPBA 4G6DA 5M5WJ 1D0XA 4XLEA 2ME6A 1DU6A 3R61A 1YX5A 4LLNA 1SAUA 3CJTB 2DPDA 3VEPA 3F8BA 1OYYA 2JSCA 1FP1D 3BPVA 4PJ0C 3F22A 3E1SA 1YQAA 3OIQA 1U9OA 1X4PA 2KMUA 2NVYJ 1IN4A 1X1BA 2MA3A 3R4KA 2O3FA 3Q9SA 4BUPA 2VE8A 3F6OA 3I9V2 2LKPA 3S17J 4HX8A 3MZYA 2HXOA 4W1UA 3GCMA 4KFCA 3WTVC 1BI3A 1FEXA 3ERED 1IDYA 5GAEJ 2RV8A 2N8GA 4HF2A 1KU3A 1YW7A 5E20A 3HHGA 3ASOH 3KIOA 1BJZA 2QQBA 1R49A 4ZYHA 1ZKGA 2HWVA 5D4SA 5B5EC 3Q3SA 2ID6A 2EFOA 2GIVA 4A3LJ 2OCCH 1Y56A 3GLXA 1ZGJA 2ZCWA 1QPIA 3PJRA 1UHMA 3MQ0A 1D5YA 3PNVA 2EZKA 5L3BA 2B63J 1JI8A 5BOXA 4A3BJ 4A6EA 2XV4S 3OMYA 4EM2A 3D5SC 1F5TA 1AKHA 4LB6B 1APLC 1K4TA 2R5ZA 3H5NA 3R60A 1XCVA 2ECBA 5DDGA 4KIBA 3M8JA 3F8NA 2KIUA 3CMAI 1J2XA 4B09A 2LY2A 5J8CA 2QYOA 3K9TA 1QZYA 2D1VA 5CLSA 5JI6A 3K7AJ 3HUGB 5TISC 1TBXA 1WH7A 3SZPA 3O8HA 3TP3A 2IS4A 1V5FA 2QKMB 3A01A 2BYVE 3MWMA 3RQIA 4AIJA 2EV0A 4QIWN 1RPWA 4V2GA 2IS2A 3UR3C 1ZG5A 2X6WA 3I5UA 1FBSA 1GV2A 3K70D 3C7JA 5KAIC 3J7AY 4WXHA 4XONA 2R7TA 5D5VB 1Z67A 3A0BC 1YJWI 5BMZA 1QGPA 1UB9A 2FBIA 2IXSA 4D1QA 3DQVC 3REOA 3M9AA 1UAAA 3N97A 3K1MA 4E70A 3UNGC 3E0JB 2L7KA 1Z6RA 2JZYA 1XN7A 3FM3A 3BCBA 2K9SA 2VXZA 2LR8A 5FLXZ 3A2KA 4CYDA 4ZYDA 3GTLJ 2IS6A 1W7PB 5D6EA 2A3SA 2HZDA 5BQTA 5E3OA 1LPQA 4EQQA 1YITI 4AU7A 4GYIA 4XKCA 2BV6A 5DCFA 3HB9A 4M3GA 1OMIA 4BXFA 1JTXA 2V79A 5EF6A 4KMFA 2CMPA 1W4MA 1FX7A 1MZBA 2KJCA 4DGWB 2O03A 4BH9A 4UNOA 4BKXA 3H0DA 3Q5FA 3NWTA 2KZGA 1OLTA 3V42A 1X3WB 1RZ4A 4AD9A 1W5CC 3BR3A 5E8IA 3J81K 4U7DA 1QA6A 2TRTA 3FM5A 2M9HA 2QVOA 1XC5A 2UUZA 4QTRA 3HL2A 2VQHA 1A35A 2F5FA 5K5OA 4OMYA 4CSWA 2XPVA 4JBAA 2XB0X 3M8FA 3WTTC 2EA2A 1JE8A 4RB3C 2WWYA 3K69A 4EGZA 4P96A 2X1DA 2DBBA 2CV0A 2XAJA 3J80K 1NH3A 1E0EA 4XN3A 4MTDA 4P5OA 4EV0A 5HVQC 3T0YA 2ZJQF 2K7LA 3H9JA 4D5CA 1F9NA 3CP8A 4CDGA 3SZTA 2HTJA 3FK6A 3R0JA 4GCVA 1YOVB 1ZH5A 4P9UA 5HDNA 1X1CA 1U8BA 5J6XA 3CESA 3H0GJ 2Z16A 2ZXJA 3CCLI 3JRDA 2CQQA 4PGGA 1VFCA 4EJVA 1ZG1A 1DQUA 2M45A 2VN2A 3IC7A 1J09A 1FPQA 2L4MA 3W6KB 1PYVA 5FB2A 3FHNA 3KZIC 4KYWA 4D0PA 5FO5A 1T0FA 4Q5SF 2F4IA 5KK1A 1IG7A 3LQQA 3FHZA 1W0UA 1UELB 2M7BA 2VBXA 2YS9A 4IRHA 4G7ZF 3ESWB 2WV0A 5KVRA 1SVLA 4AIKA 2DQLA 2L0KA 1I3AA 3CCVI 2IAIA 4KN7X 1TQMA 2CSOA 3HOWJ 5J40A 5JLWA 2BHZA 1QNTA 2LVSA 3ABLH 4G12A 3E5QA 1GT0C 1BC8C 3LOCA 4MQ9F 5K5RA 1HOMA 4XORA 2AQFA 2G7UA 2ZSIB 4OAZA 3KEOA 3CC4I 1W7PA 2ME0A 2ZFWA 5HOOA 2HKOA 2LH9A 3FMSA 2QF7A 1EH7A 2F2EA 1B9NA 2K3PA 4R8HA 3WE2A 4ABZA 1JKQC 3RZOJ 2XPWA 3K4NA 1FIPA 4B8XA 1D1CA 2K9NA 3BY6A 4ESFA 3OYMA 5LGNA 3RKXA 4A5MA 1D1AA 2H1LA 2OD5A 2KKOA 2XGDA 4CH7A 6PAXA 1J9IA 5TGTA 4ON0A 3C3WA 5BPIA 3FBIB 4HLYA 3ZMVA 3OYDA 3OYIA 3I0TA 2BGCA 1HKSA 4ZDOA 4A2UA 4FETA 1PP7U 2QLZA 1ZARA 2DU9A 4XOTA 4IHTA 1YIJI 3HXLA 4KA4A 3IRRA 2L01A 3ZMUA 1MJ9A 3H3VK 1A5JA 4HLXA 2MLKA 3AL0C 3G3ZA 1DGWY 1R1UA 2K9LA 2KP6A 3E97A 2OQGA 4BGDA 5J47A 1SC7A 4XICA 2CQXA 5DD4A 3HHHA 4PJJA 5J1RA 5GTIC 3K6GA 4ENKA 3K4CA 1VQLI 2NNNA 3N05A 2R4GA 1IV8A 3RYRA 2VT3A 4DYRA 2TDXA 4H0EA 3JREA 3B73A 2JMWA 3WU1B 2QM3A 3I59A 2PJRB 1PDNC 2CFXA 2W84A 2Y0SA 2Y0MA 1BIAA 2EPFA 2MFZA 1U3EM 2Y0SN 1G3YA 4I7HA 2R7SA 1Z3XA 1FOWA 2M34A 2EK5A 3S3OA 5CJ9A 2LOOA 2P0WA 3BG6A 3B6CA 1HDPA 3S15J 3I53A 1YRNB 2Y31A 3LSIA 2L54A 2FSWA 1LJ9A 3RIRA 2PQ8A 3ZMZA 1WJ5A 3OR2C 1XCBA 2DA2A 3QPTA 4JP0A 3HRUA 2BZTA 3IWZA 2KPMA 1LEAA 5FD5A 5IP9J 2VPLA 2Z33A 3CD6I 5CQGA 3D0SA 1LVKA 5TRDA 1L0OC 1ETKA 1S8NA 1V5GA 2IVMA 5LD2C 4MQVA 2DCEA 1Z05A 3CMEI 2W7NA 2LF7A 3QWLA 4ENNA 3IAS2 4LK1F 4ZZDA 3BJAA 2FRHA 2X1CA 3CP2A 1JHHA 4QSHA 5D6FA 3NRVA 1BOAA 1IO2A 1KQ0A 2M4GA 1FY7A 3TP0A 4ESBA 2CO5A 2Y9ZA 1DU0A 3LSMA 9ANTA 2FE3A 5B66C 1ON2A 1G6NA 3LA2A 4KJZA 5E1WA 3MZHA 3ZQ7A 2HYJA 2PFBA 1BI1A 4JOMA 5FGMA 1OCTC 1WI3A 4G6QA 2NVTJ 2VXDA 3HPHA 1J59A 2IBDA 4AIDA 1VQKI 4IHVA 1OR7A 1QHGA 1LDDA 4XKBA 3A02A 4XLPF 4C9YA 3VYUB 1MJAA 4B1RA 2F5EA 1R00A 4YELA 2KLOA 1G3WA 2QEXI 4JX4A 4Y15A 3ZQFA 4WCGA 4C30A 1FMVA 2O61A 2OZ6A 4PJMA 1XDSA 3F3XA 4KICA 3Q9VA 2GXGA 3HTUA 4ESJA 3OYCA 4IOCF 3CCYA 3OYGA 2PJRA 2KRFA 3DEWA 5HNHA 2KL4A 3ZQGA 3LAPA 2O6GE 1WKMA 1P2FA 2L02A 4M74A 1QHHD 3D5LA 5LHHA 1EKEA 4YG2F 2ETHA 4A93J 5DM6F 2EFWA 5CVJA 1EH6A 3EUHA 3O3KA 4BJ5C 1X1DA 1EJ9A 4LITA 4RLQA 4RM2A 2ZMEB 2VKVA 5LGUA 3GTKJ 2X6XA 1YRNA 2FF4A 2IA0A 4MGRA 2DYRH 3OS1A 1F1ZA 1ZRDA 2GWRA 5D5XB 2HNHA 1Q1HA 2LTPA 3DPTA 5E8GA 3DU6A 1ZREA 3KP5A 3H92A 5JFRA 3WE3A 3RPUA 2M0CA 3HM5A 2OBPA 4KUMA 3VYSB 4XRFA 2M8EA 2D5VA 1G8XA 4LGWA 3DU5A 3PUBA 3JRGA 3LNQA 1HW2A 1D3YA 1O3RA 2MBFA 1W1WE 1ZR4A 4C3HJ 1GUUA 1XMXA 5L3DA 3L2QA 3CJRB 1IUFA 1Z7LA 1BIBA 2GM4A 4CA0A 1TWAJ 2RC4A 4NC7A 1EF4A 1Y8QB 4MO7A 3ZQIA 4PK4A 4ZDLA 2DFEA 1AOYA 3AG1H 4RB1A 4Y52J 2HQ5A 3FXMA 1IAWA 1Y6IA 2VKDA 1AWCA 2DMPA 1UG0A 1XD7A 4XKVA 5F04A 3RZDJ 3SXYA 1W36D 3G1LA 4JX6A 4UUVA 2EINH 2OV7A 3IAM2 1BOBA 2BEOA 2L9SA 4AYBA 1B6AA 2V6CA 2MSYA 2VB6A 2VASA 1YX3A 3JAMK 3ZRGA 4XN0A 4AYBN 2R92J 3QU3A 5F08A 2LSOA 4CCJA 3ONQA 1UMQA 2L9RA 3HRMA 3IKTA 2A5WA 1ZHFA 4MEXF 3ZMDA 5CVVA 3L2UA 4DBQA 3AFHA 3RKYA 1QZZA 3IH4A 2CQ7A 5CQEA 1HW5A 3IUOA 2DODA 5D5WB 1TZLA 3QPLA 3U21A 1P4XA 4HSTA 1JKOC 1Z91A 3ERMA 2E71A 1ZRCA 5L3FA 3COAC 3L7WA 2GXBA 2RN7A 5EG0B 5HS9A 4EJOA 3WG7H 2PMUA 3ZMTA 3PSFA 4OWRB 4UB8C 1XX5A 3JTHA 2QQ9A 3OSFA 3CCSI 4AVZA 4ENJA 2CV2A 2IGMA 5C3EJ 2GZWA 1OYWA 3BG7A 3F6VA 2EIMH 5E1ZB 2FA5A 4LMYA 3QOPA 2ZMEA 1XGMA 3DTIA 1F36A 3I64A 5HLTA 2NS8A 4LG3A 4BYYA 3JRBA 4A5NA 2XAGA 1HW1A 3HGYA 4N9IA 3CO7C 5DS9A 2YX7A 3S2DJ 3RYPA 1WZ2A 3OIPA 3QAHA 2HXIA 1OFCX 2K02A 3HKZA 3CDLA 5ICFA 2LRDA 3FXOA 1R4MB 2E19A 2EH3A 1XPXA 2JVGA 3HKZN 1RKWA 4W97A 1TWHJ 3LSPA 4HF1A 2VL8A 3PIOF 2ZC2A 5D5UB 1SANA 2MLGA 3HOSA 2XGEA 2LD5A 1RKTA 3P9CA 1ZN2A 2EZLA 2R93J 4EM1A 4BAYA 2X48A 2Q8KA 5IPAA 4IOAF 3JRHA 4R1HA 1TP4A 4G94A 2DFHA 3ZQCA 1I1SA 3L2RA 1QZEA 3RKWA 2E5ZA 3W6JB 2NYXA 1N75A 1QU3A 1KU2A 1ZQ3P 2M0MA 2VJIA 4Y4RA 1KONA 2RKHA 3LA7A 4DNCA 1Y39A 1KYWA 1WRJA 4PJNA 4OIOF 2KRCA 1IW7F 3KYDB 2ZXWH 1WSUA 3L2CA 1O3TA 4IL6C 3KP4A 1ETQA 2KT0A 4D9JA 4J00A 4IHSA 3S14J 1ORKA 4HYEA 1VF9A 5JR3A 3SYTA 2PI0A 1B8IB 1C0WA 4UV9A 4A3EJ 2FMLA 1IRGA 1H9TA 5FKNA 2HFHA 2XC7A 2Z1DA 3OIOA 5FKMA 1YW8A 3KE2A 3OR1C 1LNWA 2YX4A 3L2WA 3EQLF 4XK4A 1XGNA 2GLOA 1ZG3A 4XLCA 2Z3YA 5H20A 3ZQLA 3DTEA 2NNYA 1T08B 4HX7A 2QSFX 5IY5H 3PIPF 2IRFG 1OISA 2WY8Q 3QODA 1XMAA 3W3CA 5F0FA 4ASNA 2C6YA 1ZAOA 2Z5UA 2WC2A 2FOWA 3O6BB 2ZJ2A 3PFIA 4RA2A 5LRSA 2E7XA 3DF8A 2YR2A 4NB5A 2F5VA 3KP6A 3V7RA 4YFXF 2ZNZA 3GFJA 3GFLA 4A69C 2BE5F 1FYLA 3OYBA 4DOZA 4M72A 3CF5F 2O9LA 2H94A 3SZGA 1OQYA 2W24A 1IN6A 2KFDA 2JA2A 4HRIA 1FC3A 4XRSA 3OYJA 1TT5B 1P6RA 3NARA 2V1XA 3V8LA 4I76A 4RAFA 2DI3A 4K2EA 4XLFA 1R36A 3G1MA 1U8RA 4L5IA 3RTRA 4HBLA 1UHSA 4LB5A 5AIPA 3BG9A 4L5JA 4C2UA 2ZO4A 3H3ZA 3WGHA 4EJWA 4G6TB 2ISZA 4FE4A 4LD5A 1Q1VA 1X4OA 2DK5A 1JJ6C 2H1KA 3MCZA 4KT6A 4U0WA 2OTJI 4P55A 1WVRA 3T8TA 1Z3YA 4EATA 1IN7A 1IZ1A 4NC8A 1R5GA 1SFXA 2CQKA 3DLLF 3LMMA 2CJJA 1N78A 5HLHA 2BW3B 1VQ5I 1KQ9A 3DLAA 1SFKA 3I4PA 1V55H 3OL3A 3TOBA 3E6BA 1USTA 2DA1A 2H6CA 4B3AA 3AKZA 2HQNA 1UJ8A 5ILSA 4L0ZB 5F6FA 2K86A 1B8IA 1MGTA 2P8TA 5E17F 3M1EA 3S16J 1VTNC 2RQPA 1PUFB 2AO9A 3O2PE 3E6CC 1YHQI 2F6CA 2VUMJ 4A3CJ 1YW9A 4LG0B 5KHDA 4CZZA 1E3HA 2BVLA 3S32A 1RIOH 1ETOA 2GOXB 4G9YA 1WJAA 3KETA 4L5EA 2M4KA 2G9WA 2ZKZA 1OCCH 1X2MA 1GLNA 2HQAA 5EYRA 5IT3A 4XRSG 4Q4ZF 2CW8A 3FXUA 3CCUI 4YEJA 3ZP5A 5DYMA 4F7ZA 2LP0A 3UKGA 1O3QA 1AU7A 2EFPA 4DYCA 3S3MA 2RDPA 4XKWA 3CCRI 4AVPA 5M5YJ 2OZUA 1VQ9I 1NTCA 1DDNA 4IPAA 5EEGA 1EH8A 3BJ6A 5IOYA 5IP6A 4D7NA 4IRGA 3FXRA 3K10A 4M9XA 4PFPA 1VQ4I 3ECHA 3K2ZA 1ETWA 1YS6A 4UUSB 4ENMA 1KQ8A 3H36A 3HIFA 4MHGA 1IV6A 3LSKA 3ZQHA 2DN0A 1R7JA 1M1EB 2L7FP 5EGOB 3JTGA 4IX7A 2FU4A 2LC2A 2HU9A 2DXIA 3BROA 1J0RA 3NQOA 5HLGA 2LY1A 3HOTA 1MBEA 2QENA 1VQOI 1FSEA 2JSPA 3HOZJ 4M73A 4XRMA 2O8XA 3HOVJ 2PX9A 1RC9A 1LQ1A 2LFBA 2XVCA 2LMDA 3QYBA 5J4VA 5IYDJ 3K0LA 3SJMA 2JPCA 1UHWA 3QPSA 4ZDPA 5LLQA 2M2EA 3BT9A 3T5XA 4OMZA 2KIQA 4DYQA 5M3MJ 4L9TA 3I59B 1D5VA 3QP6A 5ED4A 4AUXA 2KIMA 3T1BA 2BY1A 1DPUA 4XBFA 3BC8A 2TCTA 1J75A 2BW3A 5H6RA 1YTYA 2XB5A 2NVQJ 3MKWB 1A36A 3CC2I 4WXCA 3BDDA 3U9GA 2P6TA 1BR2A 2HGCA 3DBLB 4GO1A 1XSDA 2XROA 2FMYA 3VDXA 2ELHA 1K6YA 2HQRA 3AG4H 3BTJA 4LK0F 4LLGF 4O6JA 3HC7A 3QYFA 3ULQB 5DM7F 4PJLA 2MYSA 1ETVA 2PBIA 1PP8F 1PUFA 1BJAA 2COBA 1EV7A 1MH4A 5GTHC 4II3A 2P7VB 1VQNI 1TW3A 3M3YJ 5H2FC 4L9NA 4LG0A 1WGXA 2E1NA 3EPZA 2E1CA 1E17A 1RUOA 2Q0OA 3OOUA 2D2WA 2JVHA 2I10A 4PUSA 2M87A 3CLQA 1SVOA 5KAFC 2DA7A 2DJIA 4ZZLA 4U7BA 2V9VA 1BA5A 5E79C 2EZIA 3QRFF 3K4MA 1Y1WJ 2JN6A 4I98B 2F4MB 1ZGAA 5J4YA 1FYKA 1B1BA 2DA3A 2IGOA 2MC3A 2MC4A 4L9JA 3V4GA 4FT8A 1VZ0A 1MIJA 4ITVA 2W48A 3WHCA 3ABTA 2DK8A 1H88C 1ITYA 1I5ZA 2ZXIA 1TTYA 4GXOA 4IF4A 1OCRH 1SMTA 3CJNA 3IV5A 1HKQA 2DYSH 1KGSA 5FJ8J 3QOEA 3BZKA 1O7LA 3JRFA 4QWQA 4I0AA 1U6GA 3FWEA 3TEDA 3TMOA 4UUSA 4UVBA 1R1TA 1LUJB 4OINF 5FD6A 3H9GA 3C2BA 3HEFA 3I71A 3LFUA 3MMYB 4F93B 2VLAA 2ZJPF 1S7AA 4OIQF 2EB7A 3WTYC 3VYTB 2DTRA 5EGOA 1FJLA 4BS9A 3JCUC 2IT0A 4OIPF 3JRAA 1XSVA 3WTSC 3BTCA 2KIFA 4XOPA 5FROA 2VJJA 1XGOA 1VQPI 1FBUA 2H8RA 4XQFA 3W2VA 1YI2I 2B7EA 4ZYAA 2K40A 2IP2A 4CCKA 5FLMJ 5GPCA 5BPDA 3CUQA 2B0LA 4YIFA 4D7MA 5JVTA 2HS5A 4B48A 5EEHA 1SD7A 2DDBA 4QPQA 3JRCA 3FMRA 2HVQA 2QKLB 4PCQA 3R6SA 2DPUA 1IDZA 5LBQA 3BQYA 4IRIA 3BR1A 4IJAA 2MW8A 1RRJA 2IA1A 3L9FA 1Z0XA 4KT5C 2JRMA 2ISYA 3PO2J 3ABUA 3GYHX 1FT9A 4NBQA 3K1PA 5CPRB 1JJ8C 2RNGA 2YSRA 2EQRA 2RNJA 1NG6A 3BZ6A 3ZQQA 1E3OC 4Y13A 3WTZA 4I01A 1D0YA 3JW4A 3KFWX 1T0FC 1R6RA 3H1CA 3H3UA 4A3JJ 4FQGA 1QO0D 2FXAA 2WTEA 3JRIA 3CCQI 4ZJZA 3TW7A 3F8CA 3GBGA 2FUG2 3RCOA 2VJ4A
chains in the Genus database with same CATH topology
2QBYA 4WK8F 2VBWA 3I58A 3OV8A 4KDPA 2Z9OA 4KNYA 4RGRA 2P5KA 1ON1A 1LVAA 1TW2A 3CTAA 2EWNA 4EJUA 3TGNA 2VOPA 3ELKA 4ZH4F 3KZYA 1SFEA 1FZPB 5LRRA 2FNPA 1LB2A 2G7HA 3P7NA 4S04A 1CGPA 4BQAA 1ONVA 2UXNA 1K78B 2M5WA 4CHUA 5IT9Z 2A6EF 4HQMA 3DPLC 2A69F 1G4DA 2XASA 4OU0A 2QUFA 5LHIA 4KIFA 1S6LA 5ILUA 3V7CA 2FOKA 2D1HA 1QPMA 1Z1DA 3LAJA 1K7AA 3BJOA 3VODA 4FHTA 4L9VA 4A12A 1IXCA 3GW2A 3M8EA 1OYIA 1MDMB 2VOOA 1Z7UA 2K27A 2P5VA 3SHFA 4HA8A 2FNAA 4P9FA 3ML6A 5A2QZ 2HYFA 4ZYEA 3L09A 3ZN0A 1P4WA 2J5OA 5ICCA 2RGVA 1XSXA 3BOQA 5CVIA 2VC0A 1OPCA 3WTXC 1O57A 2PEXA 3LSTA 5LEKA 2Q2EA 3ROUA 2RVCA 2EFNA 3CLOA 4UV8A 3L00A 1K78A 4HAMA 3FZVA 2ZBKA 1IXSB 2V1UA 4HF0A 3S2WA 1ZRFA 1DUXC 4M9SA 2VODA 3QP5A 2DFIA 5E18F 4N0BA 1JGSA 4I0BA 2EV6A 4HOBA 4U0YA 3TQNA 2OAZA 1K79A 1HBXG 3IHUA 4YFKF 5DV5A 5HDKA 1F4KA 5LGTA 4RB0A 1HSTA 5CVRA 3E5UA 3F23A 3E6DA 4DQ2A 1MDMA 5HDGA 1KYZA 1XDUA 5F1RA 4WWCA 3G73A 3KP3A 3E3VA 3HSRA 1FWZA 2A61A 3CO6C 1HXDA 1BC7C 3ZMSA 4ETSA 3M7GA 3WU0A 5D8KB 2DAOA 4LLLA 3F8FA 3LA3A 2M1BA 2EJRA 3U1DA 2VC1A 2OU2A 3GF2A 3TKYA 3HRTA 1U5TB 2A5YB 4A0YA 4BHBA 2H6BA 3R0AA 4S05A 2UZKA 4EMSA 4A0XA 2STWA 5LHGA 4M71A 4RAZA 5FLXK 2PJPA 2VONA 4G7HF 1J5YA 2PLYA 3IRQA 5ICGA 1FLIA 4U88A 4MEYF 2GQQA 2PMHA 3V8JA 3KLOA 4N9HA 3SQNA 1GXQA 1IRFA 4I09A 4WX9A 4U0VA 3FMQA 2JTVA 1E2XA 5BS6A 1P92A 4YFNF 3KEQA 2NAZA 3MAJA 1FP2A 2UXXA 2VBZA 4MTEA 2QQAA 4BNCA 4OOIA 5L3GA 1V3FA 5AIQA 2A68F 1XMKA 1U2WA 2XGXA 1WQ2A 3I54A 1U78A 2A07F 4CICA 4UVAA 3HYIA 1D8JA 4CO8A 4BXUA 1DPRA 2IJLA 2L4AA 2W57A 1U5TA 5E1XA 3RJPA 2EV5A 2PN6A 1B4AA 4UVCA 3JAMZ 3ECOA 1R58A 2CGPA 1R1VA 4ZYGA 1I1GA 3KP7A 2L3DA 5LEJA 2A6HF 3C1DA 2XAFA 2E7WA 3HSFA 1B59A 1QBJA 2FQ3A 3GX4X 1OKRA 2MH2A 3KP2A 1HSJA 2OA4A 3SFZA 1SD6A 4RB2C 3QPHA 5DUIA 2ESNA 5HS8A 3DEUA 4Z2YA 1BI2A 3F21A 2PG4A 2VT2A 1RI7A 4EVIA 1X3UA 2ZNYA 1LDKB 4M6YA 1R5HA 1IXRC 4HV6A 2HEOA 1XGSA 1BN5A 5CYVA 3GEZA 3CUOA 3GVAA 2STTA 2O0YA 3ZN1A 4HX4A 3RDIA 1L3LA 2K4BA 2OQRA 4IXAA 1YO5C 4HQEA 1GHCA 1IN5A 4HDUA 4UXNA 3GZ5A 2R3SA 1K6OA 2HTSA 4RAYA 5L3EA 4TV7A 3F8MA 1U5TC 1YYVA 3K1NA 1I27A 4A6DA 3PQKA 4IVNA 2Y48A 1LEBA 1RUNA 2LF8A 1T38A 1D8KA 3CUQB 1ULYA 4XSZF 3MFKA 1V4RA 2XAHA 4LJZF 3E5XA 1PUEE 4R79A 2DLLA 5IT9K 1WWXA 4Q47A 1UFMA 3KZZA 2GAUA 3HUGA 2R7FA 5L3CA 1CF7B 1WI9A 2ESHA 1G3TA 3IWFA 2QBYB 3TDUC 4Y17A 2IPQX 3P9IA 3VOEA 2AS5F 2CYYA 2XAQA 5K5QA 3T8RA 1SAXA 3BPXA 4KMUX 1HQCA 2HKXA 1Z6TA 3VFZA 4BHCA 2JRTA 2XRNA 3E6MA 1O3SA 4KN4X 2Y75A 5A2QK 1O7FA 3TO6A 3HRSA 3GWZA 3BWGA 2YPRA 1IF1A 2QWWA 2Z99A 2F5CA 2P6SA 4AWXB 2D45A 1USSA 5DD8A 1XB4A 4LFUA 1GVJA 2XIGA 1STZA 3FF5A 3V7SA 2KJBA 1MJBA 1BI0A 1R23A 2DW4A 2W25A 1TLHB 2K4JA 3GO5A 2CWEA 1W7PD 4O3MA 3MEXA 2P4WA 3BP8A 4HV5A 3DKWA 1TNTA 4FX0A 4NQWA 3GZ6A 5ICEA 4FX4A 1FNNA 4A0ZA 1LDJA 2FBKA 5FFXA 5HLIA 1I6XA 1CF7A 2ACJA 1T6SA 1HKTA 3EETA 4PZJA 1YFHA 5CVUA 3C18A 3FX3A 2H27A 1BBYA 3EYYA 3J81Z 3FXQA 3V8KA 4L18B 4HW0A 2HYGD 3WTWC 3CDHA 4EJTA 5HS7A 3TO7A 3TDZC 2W85A 1FSHA 4XSXF 1FOKA 2H09A 3VB2A 2ADUA 2EA4A 2EFQA 1DP7P 1B9MA 3J80Z 2HOEA 4JK1X 1G3SA 4M6XA 4NHJA 1KA8A 2MD5A 2VBYA 3J7AO 2DO7A 3B02A 2BBYA 5DUKA 3CUQC 4WXDA 3HTSB 1MD0A 1ODDA 1S3JA 3ZPLA 4CGZA 5DCMB 2MH9A 4I02A 4JQFA 3WTUC 3OOPA 3GUDA 3WGIA 3NEUA 1H0MA 4G7OF 1T98A 5D4RA 4Q48A 3WODF 1JHFA 1YIOA 4RGUA 3LQRA 1UCRA 1ZLKA 2COMA 3IKVA 4MNUA 2NS0A 2XKOA 5ILVA 4EM0B 1J7KA 3JSPA 5JHUA 4GYGA 4PDKA 1S29A 4I2OA 2LNBA 2YU3A 4L0YB 1ZLJA 4HZFA 4YIIA 3TOAA 2AXLA 3DP7A 1IN8A 4EGYA 5ERIA 1SMYF 3LFKA 3ISPA 3P9KA 1TQIA 4BHPA 3DXJF 1KU9A 1SD4A 1FBQA 1W5TA 3RPQA 1SD5A 1H9GA 1MKMA 1ZYRF 1YLFA 4PGHA 2J5PA 2F5DA 2LDUA 5J8FA 4RS8A 4WF2A 2XKPA 5DCMA 2IA2A 3N4MA 1T39A 1SFUA 3GXOA 1JXSA 3DV8A 3QU6A 4RGSA 2XUBA 3WGGA 3EYIA 1RNLA 3IL2A 4QLCU 1W5SA 2V1DA 2DT5A 2GA1A 2IW5A 1Y0UA 2HDCA 5H6QA 3RI4A 1YG2A 4KIGA 4M9ZA 2R7DA 5DEQA 1TNSA 1YS7A 2X0LA 5D8LB 2P5LC 2QZ8A 3AAFA 2XHKA 3HSEA 4UHTA 5K1YA 4HDVA 1TQPA 2UWMA 1S7OA 1REPC 3F72A 4RGXA 2FBHA 1KU7A 4O5VA 2FEZA 3JSOA 3PQJA 2P7CB 1GXPA 4OIRF 4G8XA 5TJJA 2DQRA 1NHAA 1QQIA 5AONA 1BM9A 1T2KA 2NRAC 4AIHA 3GFIA 4XLNF 2CG4A 1R22A 2HR3A 2JT1A 4CXFA 1A04A 1FYMA 5FFZA 2X4HA 2VE9A 1P4AA 5F64A 3U2RA 3EDPA 3TO9A 1Z9CA 3KLNA 3KCCA 3WG9A 4GGGA 2M30A 3DFGA 2CW0F 3GFMA 2GA2A 2HZTA 2JPBA 4G6DA 3R61A 4LLNA 2DPDA 3VEPA 3F8BA 1OYYA 2JSCA 1FP1D 3BPVA 3F22A 1YQAA 1IN4A 2MA3A 3R4KA 2O3FA 3Q9SA 2VE8A 3F6OA 2LKPA 4HX8A 3MZYA 4KFCA 3WTVC 1BI3A 3ERED 2RV8A 4HF2A 1KU3A 1YW7A 5E20A 3HHGA 2QQBA 4ZYHA 2HWVA 5D4SA 2EFOA 2GIVA 3GLXA 1ZGJA 2ZCWA 1UHMA 3MQ0A 5L3BA 5BOXA 4A6EA 2XV4S 4EM2A 1F5TA 4LB6B 3R60A 1XCVA 5DDGA 4KIBA 3F8NA 2KIUA 1J2XA 4B09A 5J8CA 2QYOA 3K9TA 1QZYA 2D1VA 5CLSA 5JI6A 1TBXA 3SZPA 2BYVE 3MWMA 4AIJA 2EV0A 1ZG5A 3I5UA 1FBSA 3C7JA 4WXHA 5D5VB 5BMZA 1QGPA 1UB9A 2FBIA 3DQVC 3REOA 3M9AA 3N97A 3K1MA 4E70A 1Z6RA 2JZYA 1XN7A 3FM3A 2VXZA 5FLXZ 4CYDA 4ZYDA 1IUYA 1W7PB 5D6EA 2A3SA 5BQTA 4EQQA 4GYIA 2BV6A 5DCFA 4KMFA 1OMIA 2V79A 1W4MA 1FX7A 1MZBA 2KJCA 2O03A 4BH9A 4UNOA 3Q5FA 1RZ4A 4AD9A 5E8IA 3J81K 4U7DA 3FM5A 2QVOA 2F5FA 5K5OA 4OMYA 4JBAA 3WTTC 3M8FA 2EA2A 1JE8A 4RB3C 2WWYA 3K69A 4EGZA 4P96A 2DBBA 2XAJA 3J80K 4MTDA 4P5OA 4EV0A 5HVQC 3T0YA 2K7LA 1F9NA 4CDGA 3SZTA 2HTJA 3R0JA 4GCVA 1ZH5A 4P9UA 5HDNA 5J6XA 2ZXJA 4PGGA 4EJVA 1ZG1A 2M45A 2VN2A 3IC7A 1FPQA 2L4MA 3W6KB 5FB2A 4KYWA 4D0PA 5FO5A 1T0FA 4Q5SF 5KK1A 3LQQA 3FHZA 2VBXA 4IRHA 4G7ZF 5KVRA 2WV0A 4AIKA 2DQLA 4KN7X 1TQMA 2CSOA 1QNTA 3E5QA 1BC8C 4MQ9F 5K5RA 2G7UA 3KEOA 1W7PA 2ZFWA 5HOOA 2HKOA 3FMSA 1EH7A 2F2EA 4R8HA 1B9NA 3WE2A 4B8XA 3BY6A 4ESFA 5LGNA 3RKXA 4A5MA 2OD5A 2KKOA 6PAXA 1J9IA 4ON0A 3C3WA 5BPIA 4HLYA 3ZMVA 3I0TA 2BGCA 1HKSA 4A2UA 1PP7U 2QLZA 1ZARA 2DU9A 4IHTA 4KA4A 3IRRA 2L01A 3ZMUA 1MJ9A 4HLXA 2MLKA 3G3ZA 3E97A 1R1UA 2OQGA 5DD4A 3HHHA 4ENKA 2NNNA 3RYRA 2VT3A 2TDXA 4H0EA 3B73A 3WU1B 2QM3A 3I59A 1PDNC 2CFXA 2W84A 2Y0MA 1BIAA 1U3EM 1G3YA 4I7HA 2EK5A 5CJ9A 3I53A 2L54A 2FSWA 1LJ9A 3RIRA 2PQ8A 3ZMZA 1XCBA 3QPTA 3HRUA 3IWZA 1LEAA 5FD5A 2Z33A 3D0SA 5TRDA 1L0OC 1S8NA 2IVMA 4MQVA 1Z05A 2LF7A 4ENNA 4LK1F 4ZZDA 3BJAA 2FRHA 1JHHA 5D6FA 3NRVA 1BOAA 1KQ0A 1FY7A 4ESBA 2CO5A 2FE3A 1ON2A 1G6NA 3LA2A 5E1WA 3MZHA 3ZQ7A 2PFBA 1BI1A 5FGMA 4G6QA 1J59A 1OR7A 1LDDA 4XLPF 1MJAA 2F5EA 1R00A 1G3WA 4Y15A 4WCGA 2O61A 2OZ6A 1XDSA 4KICA 3F3XA 3Q9VA 2GXGA 3HTUA 4ESJA 2KRFA 3LAPA 2O6GE 1WKMA 1P2FA 2L02A 4M74A 3D5LA 5LHHA 4YG2F 2ETHA 2EFWA 5CVJA 1EH6A 3EUHA 3O3KA 2ZMEB 5LGUA 2FF4A 2IA0A 4MGRA 1F1ZA 1ZRDA 2GWRA 5D5XB 1Q1HA 3DPTA 5E8GA 1ZREA 3KP5A 3H92A 5JFRA 3WE3A 3RPUA 2OBPA 4KUMA 4XRFA 2M8EA 4LGWA 1HW2A 1D3YA 1O3RA 2MBFA 5L3DA 1BIBA 2RC4A 1AOYA 4RB1A 1IAWA 1AWCA 1XD7A 4UUVA 3SXYA 2BEOA 1B6AA 2V6CA 3JAMK 3QU3A 2LSOA 3HRMA 3IKTA 1ZHFA 4MEXF 3ZMDA 5CVVA 3RKYA 1QZZA 1HW5A 5D5WB 1P4XA 1Z91A 1ZRCA 5L3FA 3COAC 3L7WA 2GXBA 2RN7A 5HS9A 4EJOA 2PMUA 3ZMTA 3JTHA 2QQ9A 4ENJA 2GZWA 1OYWA 3F6VA 5E1ZB 2FA5A 4LMYA 3QOPA 2ZMEA 1XGMA 3I64A 4BYYA 4A5NA 2XAGA 1HW1A 4N9IA 3CO7C 2YX7A 3RYPA 3QAHA 2K02A 5ICFA 4HF1A 5D5UB 2MLGA 3HOSA 3P9CA 1ZN2A 4EM1A 4BAYA 2Q8KA 4R1HA 4G94A 1I1SA 3RKWA 3W6JB 2NYXA 1KU2A 3LA7A 2RKHA 1KYWA 1WRJA 4OIOF 1IW7F 1WSUA 3L2CA 1O3TA 3KP4A 4IHSA 4HYEA 5JR3A 2PI0A 1C0WA 4UV9A 2FMLA 1IRGA 1H9TA 2HFHA 1YW8A 3KE2A 1LNWA 2YX4A 3EQLF 1XGNA 1ZG3A 5H20A 2Z3YA 2NNYA 4HX7A 2IRFG 4ASNA 2C6YA 1XMAA 1ZAOA 2Z5UA 2WC2A 3O6BB 2ZJ2A 3PFIA 5LRSA 2E7XA 3DF8A 2YR2A 4NB5A 3V7RA 3KP6A 4YFXF 2ZNZA 3GFJA 3GFLA 2BE5F 1FYLA 4M72A 2H94A 2W24A 1IN6A 1FC3A 1P6RA 2V1XA 3V8LA 2DI3A 4K2EA 1R36A 1U8RA 4L5IA 3RTRA 4HBLA 4LB5A 5AIPA 4L5JA 2ZO4A 3H3ZA 3WGHA 4EJWA 4LD5A 2DK5A 3MCZA 4U0WA 4P55A 3T8TA 1IN7A 1IZ1A 1R5GA 1SFXA 2CQKA 5HLHA 1KQ9A 3I4PA 3TOBA 2ISZA 3E6BA 1USTA 2H6CA 4L0ZB 2HQNA 5ILSA 5F6FA 2K86A 1MGTA 2P8TA 5E17F 3M1EA 1VTNC 2RQPA 3O2PE 3E6CC 1YW9A 4LG0B 4CZZA 1RIOH 4G9YA 3KETA 2G9WA 2ZKZA 5IT3A 4Q4ZF 3FXUA 3ZP5A 5DYMA 4F7ZA 1O3QA 2EFPA 2RDPA 4AVPA 2OZUA 1DDNA 4IPAA 5EEGA 1EH8A 3BJ6A 4IRGA 3FXRA 4M9XA 3ECHA 3K2ZA 1YS6A 4ENMA 1KQ8A 3HIFA 4MHGA 1R7JA 3JTGA 2FU4A 3BROA 1J0RA 3NQOA 5HLGA 3HOTA 2QENA 1FSEA 4M73A 2O8XA 1LQ1A 2XVCA 3K0LA 2JPCA 1UHWA 5LLQA 3T5XA 4OMZA 4L9TA 3I59B 1D5VA 3QP6A 5ED4A 2KIMA 3T1BA 1DPUA 4XBFA 1J75A 1YTYA 5H6RA 4WXCA 3BDDA 3U9GA 2P6TA 2HGCA 4GO1A 1XSDA 2XROA 2FMYA 2ELHA 2HQRA 4LLGF 4LK0F 4O6JA 3ULQB 2PBIA 1PP8F 1BJAA 1EV7A 2P7VB 1TW3A 4L9NA 4LG0A 2E1NA 2E1CA 1E17A 1RUOA 2Q0OA 2D2WA 2M87A 4ZZLA 4U7BA 2V9VA 3QRFF 1FYKA 4I98B 1ZGAA 1B1BA 2MC3A 4L9JA 3V4GA 4FT8A 3ABTA 2DK8A 1I5ZA 1TTYA 4GXOA 4IF4A 3CJNA 1SMTA 1HKQA 1KGSA 1O7LA 4QWQA 4I0AA 1U6GA 3FWEA 4UVBA 5FD6A 1R1TA 4OINF 3I71A 4OIQF 1S7AA 2EB7A 3WTYC 2DTRA 2IT0A 4OIPF 1XSVA 3WTSC 2KIFA 1XGOA 1FBUA 2IP2A 5BPDA 3CUQA 2B0LA 4YIFA 5JVTA 2HS5A 5EEHA 1SD7A 3FMRA 4PCQA 3R6SA 2DPUA 5LBQA 4IRIA 4IJAA 2IA1A 3L9FA 4KT5C 2ISYA 3ABUA 3GYHX 1FT9A 3K1PA 2YSRA 2RNJA 3BZ6A 4Y13A 3WTZA 4I01A 3JW4A 3KFWX 3H3UA 1QO0D 2FXAA 2WTEA 3F8CA 3LWFA 4DNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QBY A;  4WK8 F;  2VBW A;  3I58 A;  3OV8 A;  4KDP A;  2Z9O A;  4KNY A;  4RGR A;  2P5K A;  1ON1 A;  1LVA A;  1TW2 A;  3CTA A;  2EWN A;  4EJU A;  3TGN A;  2VOP A;  3ELK A;  4ZH4 F;  3KZY A;  1SFE A;  1FZP B;  5LRR A;  2FNP A;  1LB2 A;  2G7H A;  3P7N A;  4S04 A;  1CGP A;  4BQA A;  1ONV A;  2UXN A;  1K78 B;  2M5W A;  4CHU A;  5IT9 Z;  2A6E F;  4HQM A;  3DPL C;  2A69 F;  1G4D A;  2XAS A;  4OU0 A;  2QUF A;  5LHI A;  4KIF A;  1S6L A;  5ILU A;  3V7C A;  2FOK A;  2D1H A;  1QPM A;  1Z1D A;  3LAJ A;  1K7A A;  3BJO A;  3VOD A;  4FHT A;  4L9V A;  4A12 A;  1IXC A;  3GW2 A;  3M8E A;  1OYI A;  1MDM B;  2VOO A;  1Z7U A;  2K27 A;  2P5V A;  3SHF A;  4HA8 A;  2FNA A;  4P9F A;  3ML6 A;  5A2Q Z;  2HYF A;  4ZYE A;  3L09 A;  3ZN0 A;  1P4W A;  2J5O A;  5ICC A;  2RGV A;  1XSX A;  3BOQ A;  5CVI A;  2VC0 A;  1OPC A;  3WTX C;  1O57 A;  2PEX A;  3LST A;  5LEK A;  2Q2E A;  3ROU A;  2RVC A;  2EFN A;  3CLO A;  4UV8 A;  3L00 A;  1K78 A;  4HAM A;  3FZV A;  2ZBK A;  1IXS B;  2V1U A;  4HF0 A;  3S2W A;  1ZRF A;  1DUX C;  4M9S A;  2VOD A;  3QP5 A;  2DFI A;  5E18 F;  4N0B A;  1JGS A;  4I0B A;  2EV6 A;  4HOB A;  4U0Y A;  3TQN A;  2OAZ A;  1K79 A;  1HBX G;  3IHU A;  4YFK F;  5DV5 A;  5HDK A;  1F4K A;  5LGT A;  4RB0 A;  1HST A;  5CVR A;  3E5U A;  3F23 A;  3E6D A;  4DQ2 A;  1MDM A;  5HDG A;  1KYZ A;  1XDU A;  5F1R A;  4WWC A;  3G73 A;  3KP3 A;  3E3V A;  3HSR A;  1FWZ A;  2A61 A;  3CO6 C;  1HXD A;  1BC7 C;  3ZMS A;  4ETS A;  3M7G A;  3WU0 A;  5D8K B;  2DAO A;  4LLL A;  3F8F A;  3LA3 A;  2M1B A;  2EJR A;  3U1D A;  2VC1 A;  2OU2 A;  3GF2 A;  3TKY A;  3HRT A;  1U5T B;  2A5Y B;  4A0Y A;  4BHB A;  2H6B A;  3R0A A;  4S05 A;  2UZK A;  4EMS A;  4A0X A;  2STW A;  5LHG A;  4M71 A;  4RAZ A;  5FLX K;  2PJP A;  2VON A;  4G7H F;  1J5Y A;  2PLY A;  3IRQ A;  5ICG A;  1FLI A;  4U88 A;  4MEY F;  2GQQ A;  2PMH A;  3V8J A;  3KLO A;  4N9H A;  3SQN A;  1GXQ A;  1IRF A;  4I09 A;  4WX9 A;  4U0V A;  3FMQ A;  2JTV A;  1E2X A;  5BS6 A;  1P92 A;  4YFN F;  3KEQ A;  2NAZ A;  3MAJ A;  1FP2 A;  2UXX A;  2VBZ A;  4MTE A;  2QQA A;  4BNC A;  4OOI A;  5L3G A;  1V3F A;  5AIQ A;  2A68 F;  1XMK A;  1U2W A;  2XGX A;  1WQ2 A;  3I54 A;  1U78 A;  2A07 F;  4CIC A;  4UVA A;  3HYI A;  1D8J A;  4CO8 A;  4BXU A;  1DPR A;  2IJL A;  2L4A A;  2W57 A;  1U5T A;  5E1X A;  3RJP A;  2EV5 A;  2PN6 A;  1B4A A;  4UVC A;  3JAM Z;  3ECO A;  1R58 A;  2CGP A;  1R1V A;  4ZYG A;  1I1G A;  3KP7 A;  2L3D A;  5LEJ A;  2A6H F;  3C1D A;  2XAF A;  2E7W A;  3HSF A;  1B59 A;  1QBJ A;  2FQ3 A;  3GX4 X;  1OKR A;  2MH2 A;  3KP2 A;  1HSJ A;  2OA4 A;  3SFZ A;  1SD6 A;  4RB2 C;  3QPH A;  5DUI A;  2ESN A;  5HS8 A;  3DEU A;  4Z2Y A;  1BI2 A;  3F21 A;  2PG4 A;  2VT2 A;  1RI7 A;  4EVI A;  1X3U A;  2ZNY A;  1LDK B;  4M6Y A;  1R5H A;  1IXR C;  4HV6 A;  2HEO A;  1XGS A;  1BN5 A;  5CYV A;  3GEZ A;  3CUO A;  3GVA A;  2STT A;  2O0Y A;  3ZN1 A;  4HX4 A;  3RDI A;  1L3L A;  2K4B A;  2OQR A;  4IXA A;  1YO5 C;  4HQE A;  1GHC A;  1IN5 A;  4HDU A;  4UXN A;  3GZ5 A;  2R3S A;  1K6O A;  2HTS A;  4RAY A;  5L3E A;  4TV7 A;  3F8M A;  1U5T C;  1YYV A;  3K1N A;  1I27 A;  4A6D A;  3PQK A;  4IVN A;  2Y48 A;  1LEB A;  1RUN A;  2LF8 A;  1T38 A;  1D8K A;  3CUQ B;  1ULY A;  4XSZ F;  3MFK A;  1V4R A;  2XAH A;  4LJZ F;  3E5X A;  1PUE E;  4R79 A;  2DLL A;  5IT9 K;  1WWX A;  4Q47 A;  1UFM A;  3KZZ A;  2GAU A;  3HUG A;  2R7F A;  5L3C A;  1CF7 B;  1WI9 A;  2ESH A;  1G3T A;  3IWF A;  2QBY B;  3TDU C;  4Y17 A;  2IPQ X;  3P9I A;  3VOE A;  2AS5 F;  2CYY A;  2XAQ A;  5K5Q A;  3T8R A;  1SAX A;  3BPX A;  4KMU X;  1HQC A;  2HKX A;  1Z6T A;  3VFZ A;  4BHC A;  2JRT A;  2XRN A;  3E6M A;  1O3S A;  4KN4 X;  2Y75 A;  5A2Q K;  1O7F A;  3TO6 A;  3HRS A;  3GWZ A;  3BWG A;  2YPR A;  1IF1 A;  2QWW A;  2Z99 A;  2F5C A;  2P6S A;  4AWX B;  2D45 A;  1USS A;  5DD8 A;  1XB4 A;  4LFU A;  1GVJ A;  2XIG A;  1STZ A;  3FF5 A;  3V7S A;  2KJB A;  1MJB A;  1BI0 A;  1R23 A;  2DW4 A;  2W25 A;  1TLH B;  2K4J A;  3GO5 A;  2CWE A;  1W7P D;  4O3M A;  3MEX A;  2P4W A;  3BP8 A;  4HV5 A;  3DKW A;  1TNT A;  4FX0 A;  4NQW A;  3GZ6 A;  5ICE A;  4FX4 A;  1FNN A;  4A0Z A;  1LDJ A;  2FBK A;  5FFX A;  5HLI A;  1I6X A;  1CF7 A;  2ACJ A;  1T6S A;  1HKT A;  3EET A;  4PZJ A;  1YFH A;  5CVU A;  3C18 A;  3FX3 A;  2H27 A;  1BBY A;  3EYY A;  3J81 Z;  3FXQ A;  3V8K A;  4L18 B;  4HW0 A;  2HYG D;  3WTW C;  3CDH A;  4EJT A;  5HS7 A;  3TO7 A;  3TDZ C;  2W85 A;  1FSH A;  4XSX F;  1FOK A;  2H09 A;  3VB2 A;  2ADU A;  2EA4 A;  2EFQ A;  1DP7 P;  1B9M A;  3J80 Z;  2HOE A;  4JK1 X;  1G3S A;  4M6X A;  4NHJ A;  1KA8 A;  2MD5 A;  2VBY A;  3J7A O;  2DO7 A;  3B02 A;  2BBY A;  5DUK A;  3CUQ C;  4WXD A;  3HTS B;  1MD0 A;  1ODD A;  1S3J A;  3ZPL A;  4CGZ A;  5DCM B;  2MH9 A;  4I02 A;  4JQF A;  3WTU C;  3OOP A;  3GUD A;  3WGI A;  3NEU A;  1H0M A;  4G7O F;  1T98 A;  5D4R A;  4Q48 A;  3WOD F;  1JHF A;  1YIO A;  4RGU A;  3LQR A;  1UCR A;  1ZLK A;  2COM A;  3IKV A;  4MNU A;  2NS0 A;  2XKO A;  5ILV A;  4EM0 B;  1J7K A;  3JSP A;  5JHU A;  4GYG A;  4PDK A;  1S29 A;  4I2O A;  2LNB A;  2YU3 A;  4L0Y B;  1ZLJ A;  4HZF A;  4YII A;  3TOA A;  2AXL A;  3DP7 A;  1IN8 A;  4EGY A;  5ERI A;  1SMY F;  3LFK A;  3ISP A;  3P9K A;  1TQI A;  4BHP A;  3DXJ F;  1KU9 A;  1SD4 A;  1FBQ A;  1W5T A;  3RPQ A;  1SD5 A;  1H9G A;  1MKM A;  1ZYR F;  1YLF A;  4PGH A;  2J5P A;  2F5D A;  2LDU A;  5J8F A;  4RS8 A;  4WF2 A;  2XKP A;  5DCM A;  2IA2 A;  3N4M A;  1T39 A;  1SFU A;  3GXO A;  1JXS A;  3DV8 A;  3QU6 A;  4RGS A;  2XUB A;  3WGG A;  3EYI A;  1RNL A;  3IL2 A;  4QLC U;  1W5S A;  2V1D A;  2DT5 A;  2GA1 A;  2IW5 A;  1Y0U A;  2HDC A;  5H6Q A;  3RI4 A;  1YG2 A;  4KIG A;  4M9Z A;  2R7D A;  5DEQ A;  1TNS A;  1YS7 A;  2X0L A;  5D8L B;  2P5L C;  2QZ8 A;  3AAF A;  2XHK A;  3HSE A;  4UHT A;  5K1Y A;  4HDV A;  1TQP A;  2UWM A;  1S7O A;  1REP C;  3F72 A;  4RGX A;  2FBH A;  1KU7 A;  4O5V A;  2FEZ A;  3JSO A;  3PQJ A;  2P7C B;  1GXP A;  4OIR F;  4G8X A;  5TJJ A;  2DQR A;  1NHA A;  1QQI A;  5AON A;  1BM9 A;  1T2K A;  2NRA C;  4AIH A;  3GFI A;  4XLN F;  2CG4 A;  1R22 A;  2HR3 A;  2JT1 A;  4CXF A;  1A04 A;  1FYM A;  5FFZ A;  2X4H A;  2VE9 A;  1P4A A;  5F64 A;  3U2R A;  3EDP A;  3TO9 A;  1Z9C A;  3KLN A;  3KCC A;  3WG9 A;  4GGG A;  2M30 A;  3DFG A;  2CW0 F;  3GFM A;  2GA2 A;  2HZT A;  2JPB A;  4G6D A;  3R61 A;  4LLN A;  2DPD A;  3VEP A;  3F8B A;  1OYY A;  2JSC A;  1FP1 D;  3BPV A;  3F22 A;  1YQA A;  1IN4 A;  2MA3 A;  3R4K A;  2O3F A;  3Q9S A;  2VE8 A;  3F6O A;  2LKP A;  4HX8 A;  3MZY A;  4KFC A;  3WTV C;  1BI3 A;  3ERE D;  2RV8 A;  4HF2 A;  1KU3 A;  1YW7 A;  5E20 A;  3HHG A;  2QQB A;  4ZYH A;  2HWV A;  5D4S A;  2EFO A;  2GIV A;  3GLX A;  1ZGJ A;  2ZCW A;  1UHM A;  3MQ0 A;  5L3B A;  5BOX A;  4A6E A;  2XV4 S;  4EM2 A;  1F5T A;  4LB6 B;  3R60 A;  1XCV A;  5DDG A;  4KIB A;  3F8N A;  2KIU A;  1J2X A;  4B09 A;  5J8C A;  2QYO A;  3K9T A;  1QZY A;  2D1V A;  5CLS A;  5JI6 A;  1TBX A;  3SZP A;  2BYV E;  3MWM A;  4AIJ A;  2EV0 A;  1ZG5 A;  3I5U A;  1FBS A;  3C7J A;  4WXH A;  5D5V B;  5BMZ A;  1QGP A;  1UB9 A;  2FBI A;  3DQV C;  3REO A;  3M9A A;  3N97 A;  3K1M A;  4E70 A;  1Z6R A;  2JZY A;  1XN7 A;  3FM3 A;  2VXZ A;  5FLX Z;  4CYD A;  4ZYD A;  1IUY A;  1W7P B;  5D6E A;  2A3S A;  5BQT A;  4EQQ A;  4GYI A;  2BV6 A;  5DCF A;  4KMF A;  1OMI A;  2V79 A;  1W4M A;  1FX7 A;  1MZB A;  2KJC A;  2O03 A;  4BH9 A;  4UNO A;  3Q5F A;  1RZ4 A;  4AD9 A;  5E8I A;  3J81 K;  4U7D A;  3FM5 A;  2QVO A;  2F5F A;  5K5O A;  4OMY A;  4JBA A;  3WTT C;  3M8F A;  2EA2 A;  1JE8 A;  4RB3 C;  2WWY A;  3K69 A;  4EGZ A;  4P96 A;  2DBB A;  2XAJ A;  3J80 K;  4MTD A;  4P5O A;  4EV0 A;  5HVQ C;  3T0Y A;  2K7L A;  1F9N A;  4CDG A;  3SZT A;  2HTJ A;  3R0J A;  4GCV A;  1ZH5 A;  4P9U A;  5HDN A;  5J6X A;  2ZXJ A;  4PGG A;  4EJV A;  1ZG1 A;  2M45 A;  2VN2 A;  3IC7 A;  1FPQ A;  2L4M A;  3W6K B;  5FB2 A;  4KYW A;  4D0P A;  5FO5 A;  1T0F A;  4Q5S F;  5KK1 A;  3LQQ A;  3FHZ A;  2VBX A;  4IRH A;  4G7Z F;  5KVR A;  2WV0 A;  4AIK A;  2DQL A;  4KN7 X;  1TQM A;  2CSO A;  1QNT A;  3E5Q A;  1BC8 C;  4MQ9 F;  5K5R A;  2G7U A;  3KEO A;  1W7P A;  2ZFW A;  5HOO A;  2HKO A;  3FMS A;  1EH7 A;  2F2E A;  4R8H A;  1B9N A;  3WE2 A;  4B8X A;  3BY6 A;  4ESF A;  5LGN A;  3RKX A;  4A5M A;  2OD5 A;  2KKO A;  6PAX A;  1J9I A;  4ON0 A;  3C3W A;  5BPI A;  4HLY A;  3ZMV A;  3I0T A;  2BGC A;  1HKS A;  4A2U A;  1PP7 U;  2QLZ A;  1ZAR A;  2DU9 A;  4IHT A;  4KA4 A;  3IRR A;  2L01 A;  3ZMU A;  1MJ9 A;  4HLX A;  2MLK A;  3G3Z A;  3E97 A;  1R1U A;  2OQG A;  5DD4 A;  3HHH A;  4ENK A;  2NNN A;  3RYR A;  2VT3 A;  2TDX A;  4H0E A;  3B73 A;  3WU1 B;  2QM3 A;  3I59 A;  1PDN C;  2CFX A;  2W84 A;  2Y0M A;  1BIA A;  1U3E M;  1G3Y A;  4I7H A;  2EK5 A;  5CJ9 A;  3I53 A;  2L54 A;  2FSW A;  1LJ9 A;  3RIR A;  2PQ8 A;  3ZMZ A;  1XCB A;  3QPT A;  3HRU A;  3IWZ A;  1LEA A;  5FD5 A;  2Z33 A;  3D0S A;  5TRD A;  1L0O C;  1S8N A;  2IVM A;  4MQV A;  1Z05 A;  2LF7 A;  4ENN A;  4LK1 F;  4ZZD A;  3BJA A;  2FRH A;  1JHH A;  5D6F A;  3NRV A;  1BOA A;  1KQ0 A;  1FY7 A;  4ESB A;  2CO5 A;  2FE3 A;  1ON2 A;  1G6N A;  3LA2 A;  5E1W A;  3MZH A;  3ZQ7 A;  2PFB A;  1BI1 A;  5FGM A;  4G6Q A;  1J59 A;  1OR7 A;  1LDD A;  4XLP F;  1MJA A;  2F5E A;  1R00 A;  1G3W A;  4Y15 A;  4WCG A;  2O61 A;  2OZ6 A;  1XDS A;  4KIC A;  3F3X A;  3Q9V A;  2GXG A;  3HTU A;  4ESJ A;  2KRF A;  3LAP A;  2O6G E;  1WKM A;  1P2F A;  2L02 A;  4M74 A;  3D5L A;  5LHH A;  4YG2 F;  2ETH A;  2EFW A;  5CVJ A;  1EH6 A;  3EUH A;  3O3K A;  2ZME B;  5LGU A;  2FF4 A;  2IA0 A;  4MGR A;  1F1Z A;  1ZRD A;  2GWR A;  5D5X B;  1Q1H A;  3DPT A;  5E8G A;  1ZRE A;  3KP5 A;  3H92 A;  5JFR A;  3WE3 A;  3RPU A;  2OBP A;  4KUM A;  4XRF A;  2M8E A;  4LGW A;  1HW2 A;  1D3Y A;  1O3R A;  2MBF A;  5L3D A;  1BIB A;  2RC4 A;  1AOY A;  4RB1 A;  1IAW A;  1AWC A;  1XD7 A;  4UUV A;  3SXY A;  2BEO A;  1B6A A;  2V6C A;  3JAM K;  3QU3 A;  2LSO A;  3HRM A;  3IKT A;  1ZHF A;  4MEX F;  3ZMD A;  5CVV A;  3RKY A;  1QZZ A;  1HW5 A;  5D5W B;  1P4X A;  1Z91 A;  1ZRC A;  5L3F A;  3COA C;  3L7W A;  2GXB A;  2RN7 A;  5HS9 A;  4EJO A;  2PMU A;  3ZMT A;  3JTH A;  2QQ9 A;  4ENJ A;  2GZW A;  1OYW A;  3F6V A;  5E1Z B;  2FA5 A;  4LMY A;  3QOP A;  2ZME A;  1XGM A;  3I64 A;  4BYY A;  4A5N A;  2XAG A;  1HW1 A;  4N9I A;  3CO7 C;  2YX7 A;  3RYP A;  3QAH A;  2K02 A;  5ICF A;  4HF1 A;  5D5U B;  2MLG A;  3HOS A;  3P9C A;  1ZN2 A;  4EM1 A;  4BAY A;  2Q8K A;  4R1H A;  4G94 A;  1I1S A;  3RKW A;  3W6J B;  2NYX A;  1KU2 A;  3LA7 A;  2RKH A;  1KYW A;  1WRJ A;  4OIO F;  1IW7 F;  1WSU A;  3L2C A;  1O3T A;  3KP4 A;  4IHS A;  4HYE A;  5JR3 A;  2PI0 A;  1C0W A;  4UV9 A;  2FML A;  1IRG A;  1H9T A;  2HFH A;  1YW8 A;  3KE2 A;  1LNW A;  2YX4 A;  3EQL F;  1XGN A;  1ZG3 A;  5H20 A;  2Z3Y A;  2NNY A;  4HX7 A;  2IRF G;  4ASN A;  2C6Y A;  1XMA A;  1ZAO A;  2Z5U A;  2WC2 A;  3O6B B;  2ZJ2 A;  3PFI A;  5LRS A;  2E7X A;  3DF8 A;  2YR2 A;  4NB5 A;  3V7R A;  3KP6 A;  4YFX F;  2ZNZ A;  3GFJ A;  3GFL A;  2BE5 F;  1FYL A;  4M72 A;  2H94 A;  2W24 A;  1IN6 A;  1FC3 A;  1P6R A;  2V1X A;  3V8L A;  2DI3 A;  4K2E A;  1R36 A;  1U8R A;  4L5I A;  3RTR A;  4HBL A;  4LB5 A;  5AIP A;  4L5J A;  2ZO4 A;  3H3Z A;  3WGH A;  4EJW A;  4LD5 A;  2DK5 A;  3MCZ A;  4U0W A;  4P55 A;  3T8T A;  1IN7 A;  1IZ1 A;  1R5G A;  1SFX A;  2CQK A;  5HLH A;  1KQ9 A;  3I4P A;  3TOB A;  2ISZ A;  3E6B A;  1UST A;  2H6C A;  4L0Z B;  2HQN A;  5ILS A;  5F6F A;  2K86 A;  1MGT A;  2P8T A;  5E17 F;  3M1E A;  1VTN C;  2RQP A;  3O2P E;  3E6C C;  1YW9 A;  4LG0 B;  4CZZ A;  1RIO H;  4G9Y A;  3KET A;  2G9W A;  2ZKZ A;  5IT3 A;  4Q4Z F;  3FXU A;  3ZP5 A;  5DYM A;  4F7Z A;  1O3Q A;  2EFP A;  2RDP A;  4AVP A;  2OZU A;  1DDN A;  4IPA A;  5EEG A;  1EH8 A;  3BJ6 A;  4IRG A;  3FXR A;  4M9X A;  3ECH A;  3K2Z A;  1YS6 A;  4ENM A;  1KQ8 A;  3HIF A;  4MHG A;  1R7J A;  3JTG A;  2FU4 A;  3BRO A;  1J0R A;  3NQO A;  5HLG A;  3HOT A;  2QEN A;  1FSE A;  4M73 A;  2O8X A;  1LQ1 A;  2XVC A;  3K0L A;  2JPC A;  1UHW A;  5LLQ A;  3T5X A;  4OMZ A;  4L9T A;  3I59 B;  1D5V A;  3QP6 A;  5ED4 A;  2KIM A;  3T1B A;  1DPU A;  4XBF A;  1J75 A;  1YTY A;  5H6R A;  4WXC A;  3BDD A;  3U9G A;  2P6T A;  2HGC A;  4GO1 A;  1XSD A;  2XRO A;  2FMY A;  2ELH A;  2HQR A;  4LLG F;  4LK0 F;  4O6J A;  3ULQ B;  2PBI A;  1PP8 F;  1BJA A;  1EV7 A;  2P7V B;  1TW3 A;  4L9N A;  4LG0 A;  2E1N A;  2E1C A;  1E17 A;  1RUO A;  2Q0O A;  2D2W A;  2M87 A;  4ZZL A;  4U7B A;  2V9V A;  3QRF F;  1FYK A;  4I98 B;  1ZGA A;  1B1B A;  2MC3 A;  4L9J A;  3V4G A;  4FT8 A;  3ABT A;  2DK8 A;  1I5Z A;  1TTY A;  4GXO A;  4IF4 A;  3CJN A;  1SMT A;  1HKQ A;  1KGS A;  1O7L A;  4QWQ A;  4I0A A;  1U6G A;  3FWE A;  4UVB A;  5FD6 A;  1R1T A;  4OIN F;  3I71 A;  4OIQ F;  1S7A A;  2EB7 A;  3WTY C;  2DTR A;  2IT0 A;  4OIP F;  1XSV A;  3WTS C;  2KIF A;  1XGO A;  1FBU A;  2IP2 A;  5BPD A;  3CUQ A;  2B0L A;  4YIF A;  5JVT A;  2HS5 A;  5EEH A;  1SD7 A;  3FMR A;  4PCQ A;  3R6S A;  2DPU A;  5LBQ A;  4IRI A;  4IJA A;  2IA1 A;  3L9F A;  4KT5 C;  2ISY A;  3ABU A;  3GYH X;  1FT9 A;  3K1P A;  2YSR A;  2RNJ A;  3BZ6 A;  4Y13 A;  3WTZ A;  4I01 A;  3JW4 A;  3KFW X;  3H3U A;  1QO0 D;  2FXA A;  2WTE A;  3F8C A;  3LWF A;  4DNC A; 
#chains in the Genus database with same CATH topology
 1BW5 A;  2QBY A;  4A3G J;  2AQE A;  4WK8 F;  2VBW A;  3DBH B;  4IQJ A;  4IHY A;  3I58 A;  3OV8 A;  3VPR A;  4KDP A;  1FIA A;  2Z9O A;  2DA5 A;  5GAH J;  4KNY A;  4RGR A;  2P5K A;  1RES A;  4BAC A;  1ON1 A;  3CMM A;  3DWL E;  3GME A;  4F3Q A;  1YJ9 I;  1LVA A;  1TW2 A;  2CUE A;  3CTA A;  2EWN A;  1X3Z B;  4EJU A;  4E7S A;  3TGN A;  2EIJ H;  1DGR M;  2VOP A;  1PJR A;  3BLY A;  3EUK L;  3ELK A;  5J1U A;  2EIK H;  1MW7 A;  3KZY A;  4ZH4 F;  2QA4 I;  1SFE A;  4A3I J;  1FZP B;  5LRR A;  1HCR A;  3IH3 A;  3HZJ A;  2FNP A;  4CYC B;  2NOG A;  1LB2 A;  3KPH A;  2G7H A;  3P7N A;  2BVM A;  2Q2E B;  2Y69 H;  1W0T A;  3K4K A;  4S04 A;  2K9Q A;  1CGP A;  4BQA A;  1ONV A;  2MD0 A;  2E2J J;  2UXN A;  2QSH X;  2NVX J;  5KCM A;  4BDZ A;  1K78 B;  2M5W A;  4CHU A;  3I4N J;  3D1N I;  5IT9 Z;  2A6E F;  1RR7 A;  4HQM A;  3GTP J;  3CQZ J;  2RRE A;  3DPL C;  2A69 F;  4BY1 J;  1U9N A;  2W82 A;  1JKR C;  2XAS A;  3J7Y J;  1G4D A;  4OU0 A;  2QUF A;  5LHI A;  2VJ5 A;  4KIF A;  1S6L A;  5ILU A;  3V7C A;  4BJT A;  2FOK A;  2D1H A;  1QPM A;  1JUP A;  5FKK A;  1Z1D A;  2I5U A;  3LAJ A;  1K7A A;  3BJO A;  3VOD A;  2BXY A;  4FHT A;  4MLO A;  4L9V A;  3FIW A;  1IXC A;  3GW2 A;  4A12 A;  4BE0 A;  3FXK A;  2ZSH B;  1WJB A;  3M8E A;  5EZG A;  1OYI A;  1MDM B;  2VOO A;  1Z7U A;  2K27 A;  2P5V A;  3SHF A;  1JUS A;  4HA8 A;  2FNA A;  2HDW A;  4P9F A;  3ML6 A;  5A2Q Z;  1PVE A;  4BE1 A;  2HYF A;  5EZH A;  1R9T J;  1XG1 A;  4ZYE A;  1I6H J;  2LYC A;  3L09 A;  3MVP A;  2E1O A;  3ZN0 A;  4BE2 A;  1FOY A;  3LL7 A;  2A6T A;  1P4W A;  2J5O A;  3S1R J;  4IKF A;  3M1C A;  2DA6 A;  3VWB A;  3OWT A;  5IOZ A;  4Y33 A;  3MKY B;  5ICC A;  4DJA A;  4IHX A;  4HG2 A;  2ZB9 A;  4BEH B;  3M4O J;  2RGV A;  4A3K J;  4IZZ A;  1XSX A;  2VQL A;  5JVG F;  2CW7 A;  2JWT A;  1HC8 A;  3X2Q H;  3BOQ A;  5CVI A;  3HBL A;  5F0C A;  2VC0 A;  1OPC A;  3WTX C;  1HA8 A;  3FKI J;  2HI3 A;  1O57 A;  2M3A A;  2PEX A;  2XF5 A;  3LST A;  2CU7 A;  3HGG A;  3ZXS A;  4CYC A;  5LEK A;  2E34 A;  2DOE A;  2Q2E A;  3IP4 B;  3ROU A;  2RVC A;  5K7F A;  2W00 A;  2EFN A;  2BY0 A;  3CLO A;  4UV8 A;  1MND A;  4BQQ A;  2HOS A;  3L00 A;  3M07 A;  1K78 A;  3BR2 A;  3FZV A;  2ZBK A;  4HAM A;  1IXS B;  2V1U A;  1FOX A;  4HF0 A;  3S2W A;  1OR7 C;  2FD5 A;  4LIU A;  1ZRF A;  1DUX C;  4M9S A;  4DIQ A;  2VOD A;  2KRH A;  3FBN B;  1IGN A;  3QP5 A;  3CC7 I;  3BTI A;  2EIL H;  2BY2 A;  2DFI A;  2O7O A;  3CDI A;  5IYC J;  1WJC A;  2K3F A;  2QQ8 A;  5E18 F;  5B3S H;  4N0B A;  1JGS A;  4I0B A;  2W4S A;  4C2M J;  3SEZ A;  2EV6 A;  3HOX J;  3SEQ A;  4H4K C;  4HOB A;  4U0Y A;  3TQN A;  5F27 A;  3G4S I;  2OAZ A;  3G1O A;  1K79 A;  1HBX G;  2R7R A;  3IHU A;  4YFK F;  5DV5 A;  3GTO J;  2ELJ A;  3BG3 A;  5HDK A;  2CUJ A;  1N77 A;  2EZH A;  1MBK A;  1F4K A;  5LGT A;  4RB0 A;  1HST A;  5CVR A;  2ECC A;  3E5U A;  2JA8 J;  1H8A C;  3F23 A;  3EUH C;  3E6D A;  2XAU A;  1X19 A;  4DQ2 A;  2L2O A;  2KHM A;  3BQZ A;  5HDG A;  1MDM A;  1KYZ A;  1XDU A;  5F1R A;  4WWC A;  2NXN B;  3G73 A;  3KP3 A;  1MMG A;  2CRG A;  3E3V A;  1T8I A;  3HSR A;  1FWZ A;  2A61 A;  3CO6 C;  5GAD J;  3LSR A;  4Z6Y A;  1ETY A;  2K5C A;  1HXD A;  4XLH A;  3ZMS A;  1R71 A;  1BC7 C;  4ETS A;  3B6A A;  3M7G A;  2ICW G;  3WU0 A;  5D8K B;  2KDO A;  2DAO A;  1AHD P;  1AA7 A;  2OTL I;  4LLL A;  3F8F A;  3LA3 A;  2M1B A;  2EJR A;  3I56 I;  4A3D J;  3U1D A;  2V26 A;  2VC1 A;  2OU2 A;  3GF2 A;  2NS7 A;  1Y1V J;  4RMN A;  4XR6 A;  3P5J A;  1BR4 A;  3HRT A;  3TKY A;  3DTK A;  3HG9 A;  4BL0 B;  1U5T B;  2A5Y B;  4A0Y A;  4BEH A;  4F55 A;  3SFI A;  2H6B A;  3R0A A;  4BHB A;  4S05 A;  2UZK A;  2QGU A;  4EMS A;  4A0X A;  2STW A;  5LHG A;  4M71 A;  4RAZ A;  3C2H A;  5FLX K;  2PJP A;  2VON A;  4G7H F;  1J5Y A;  4E4H A;  2PLY A;  3IRQ A;  2F48 A;  5ICG A;  1FLI A;  4U88 A;  4IHW A;  2X6O A;  2NOJ B;  1WJE A;  4MEY F;  2GQQ A;  4MIM A;  2PMH A;  3V8J A;  2CUF A;  2R7U A;  3KLO A;  4N9H A;  3F0C A;  2VKH A;  3SQN A;  1GXQ A;  1S9H A;  1IRF A;  5J1Y A;  4I09 A;  3BR5 A;  3U1K A;  3OYH A;  2L9N A;  4WX9 A;  4U0V A;  2LG4 A;  3FMQ A;  4E7J A;  4HSR A;  2JTV A;  1Z21 A;  1E2X A;  1K61 A;  1VQ8 I;  5BS6 A;  1P92 A;  4YFN F;  2R7W A;  3KEQ A;  2NAZ A;  5FRN A;  1JTY A;  1VQM I;  1A6I A;  3CCJ I;  4Y7N J;  3K4L A;  3MAJ A;  3H5R A;  1RR8 C;  1FP2 A;  2JA7 J;  2MAB A;  3DCF A;  3PUF A;  1MBH A;  4XMY A;  2AXT C;  1TWG J;  2UXX A;  2WBM A;  2VBZ A;  2GBY A;  4FIS A;  5JHF A;  4MTE A;  1JT6 A;  2QQA A;  4BNC A;  3A4C A;  3E7L A;  5CKT A;  5GPA A;  1FMW A;  4OOI A;  3I4M J;  5L3G A;  2DMU A;  3OYA A;  4RLF A;  1F43 A;  3DEE A;  1MBF A;  1V3F A;  5EJC A;  3JR9 A;  1IRZ A;  5AIQ A;  2A68 F;  2IGK A;  1XMK A;  2OC6 A;  2ZME C;  1U2W A;  2XSD C;  5E3M A;  2XGX A;  1WQ2 A;  3I54 A;  3EUA A;  2YUS A;  1HLV A;  2CS3 A;  2R7X A;  4E7Z A;  1S72 I;  1U78 A;  2A07 F;  4CIC A;  1QRY A;  4UVA A;  3HYI A;  2WAQ A;  1D8J A;  2CH0 A;  2LRE A;  3BR6 A;  2ID3 A;  1S5L C;  4CO8 A;  4KIT B;  2WAQ N;  4BXU A;  2KQR A;  1DPR A;  3S1Q J;  2IJL A;  2L4A A;  2W57 A;  3RKQ A;  1U5T A;  5E1X A;  3GLL A;  1GDT A;  3RJP A;  4E6K G;  3SDB A;  2EV5 A;  2PN6 A;  1B4A A;  4F92 B;  4A3M J;  2L7Z A;  2CFO A;  2OCE A;  3NAU A;  5BNG A;  4UVC A;  1TT0 A;  2ZJR F;  4GFB A;  4XLA A;  3JAM Z;  3OSG A;  1JUM A;  3ECO A;  1R58 A;  1MMA A;  2DDA A;  5E3N A;  1GV5 A;  4HNV A;  2CGP A;  3MKZ A;  1R1V A;  3VSL A;  4ZYG A;  1I1G A;  4RDU A;  3KP7 A;  2L3D A;  4B4C A;  3MD2 A;  2X51 A;  4MFD A;  2A6H F;  3C1D A;  2XAF A;  5LEJ A;  2E7W A;  3HSF A;  1B59 A;  4CCO A;  3AL0 B;  1QBJ A;  4GDF A;  2DOA A;  2FQ3 A;  3GX4 X;  4FAS D;  1OKR A;  4UY8 I;  2MH2 A;  3KP2 A;  2R7Z J;  1HSJ A;  2OA4 A;  1ZK8 A;  2E60 A;  2OPT A;  3SFZ A;  5F0H A;  4II2 A;  4FTH A;  1ENH A;  1SD6 A;  4B3X A;  5C4X J;  4RB2 C;  3QPH A;  3GTG J;  5DUI A;  2ESN A;  5HS8 A;  2FJ1 A;  2R0Q C;  3DEU A;  4Z2Y A;  5GP9 A;  1BI2 A;  2JJ7 A;  3F21 A;  2PG4 A;  2VT2 A;  1X1P A;  1RI7 A;  2KIS A;  3PSI A;  1K4S A;  3CCE I;  4B43 A;  3Q0V A;  1X3U A;  4EVI A;  1K83 J;  2GXA A;  2ZNY A;  4QPO A;  4RM3 A;  1LDK B;  5EEA A;  2DA4 A;  4M6Y A;  1R5H A;  3ZR8 X;  1IXR C;  4HV6 A;  2HEO A;  3HOU J;  2KZV A;  1CQT A;  5HOD A;  1XGS A;  3HOY J;  3PNT A;  1D0Z A;  1BN5 A;  5CYV A;  3GEZ A;  2V6E A;  3H35 A;  4F52 A;  1LKX A;  3CUO A;  3FKJ A;  3GVA A;  2STT A;  1X2N A;  2RQQ A;  2O0Y A;  4ANJ A;  3ZN1 A;  3TL4 X;  4HX4 A;  2FX0 A;  1Z77 A;  3RDI A;  1L3L A;  1UZC A;  2K4B A;  2OQR A;  4IXA A;  2DT7 B;  2HVS A;  3K4J A;  1YO5 C;  4HQE A;  5FKO A;  5B1A H;  4NC6 A;  3OS0 A;  2R5Y B;  4BBS J;  1GHC A;  2X9D A;  1IN5 A;  4P1W A;  3PO3 J;  4HDU A;  4HEA 2;  4UXN A;  3GZ5 A;  2R3S A;  3C2G A;  2IS1 A;  4M6V A;  1K6O A;  2HTS A;  1IRX A;  4RAY A;  4CCL A;  5L3E A;  4TV7 A;  1JGG A;  3F8M A;  1U5T C;  1YYV A;  3TW6 A;  3K1N A;  2P81 A;  1I27 A;  1VQ6 I;  1MMD A;  3BZC A;  1MH3 A;  4A6D A;  3PQK A;  3K70 C;  4IVN A;  2Y48 A;  5GAG J;  1LEB A;  1WH5 A;  1RUN A;  2O5R A;  1YE9 A;  2LF8 A;  4CUG A;  1T38 A;  4OAY A;  4Y3O A;  1D8K A;  3CUQ B;  2OF7 A;  1ULY A;  4XSZ F;  2LKS A;  3MFK A;  4KIS A;  1FTZ A;  4PSW A;  3TBI A;  2FQ4 A;  1HF0 A;  1P9Q C;  1V4R A;  1IJW C;  2DTZ A;  1X1A A;  2XAH A;  4LJZ F;  1LE8 B;  1NK2 P;  3E5X A;  1PUE E;  1POG A;  4R79 A;  3PFY A;  2DMN A;  2DLL A;  3PL8 A;  3D5R C;  4NNJ A;  2VQG A;  5IT9 K;  2E35 A;  1WWX A;  4NQW B;  4Q47 A;  2WA0 A;  1UFM A;  3KX2 A;  3KZZ A;  3S8P A;  1TC3 C;  2GAU A;  3HUG A;  3OL4 A;  1D1B A;  2R7F A;  2BOL A;  4XM3 A;  4F91 B;  4I6Z A;  5L3C A;  1CF7 B;  1WI9 A;  1I3Q J;  3MKL A;  2ESH A;  1G3T A;  3IWF A;  2WB1 A;  2QBY B;  5FKL A;  3TDU C;  4YIR X;  3G6E I;  2NVU B;  2Y9Y A;  2WB1 N;  5IP7 J;  4Y17 A;  2IEK A;  1OJL A;  2IPQ X;  2UV1 A;  3P9I A;  2E2I J;  2KDZ A;  3VOE A;  2AS5 F;  1BR1 A;  3NWS A;  3W6V A;  2CYY A;  2LBF B;  2XAQ A;  5K5Q A;  1YJN I;  3T8R A;  1SAX A;  3KYL A;  3HPG A;  3BPX A;  4KMU X;  1HQC A;  2HKX A;  3AG3 H;  1T33 A;  1Z6T A;  3VFZ A;  4BHC A;  2ZXH A;  1OCZ H;  1XS9 A;  2JRT A;  1MNM C;  2XRN A;  1VQ7 I;  3E6M A;  2ZFU A;  2R5Y A;  2VIX A;  1O3S A;  1IC8 A;  4KN4 X;  2JUG A;  5LFA A;  2Y75 A;  5A2Q K;  1O7F A;  3I3L A;  3TO6 A;  1XTA A;  1LFU P;  3HRS A;  2V7F A;  3GWZ A;  2MGQ A;  2BHY A;  2VQC A;  1RET A;  2R7Q A;  5C4J J;  3FIS A;  1WFX A;  3FXL A;  3BWG A;  3S93 A;  4V2F A;  2YPR A;  1IF1 A;  2QWW A;  2Z99 A;  1N25 A;  2F5C A;  2P6S A;  3QYE A;  2L7M P;  1WPK A;  2V4J C;  4AWX B;  2D45 A;  1NK3 P;  1USS A;  2IGN A;  2V1N A;  2XGC A;  5DD8 A;  1XB4 A;  4LFU A;  4BBR J;  2WAF A;  2XDV A;  5J3L A;  1GVJ A;  2XIG A;  1STZ A;  3FF5 A;  3V7S A;  1ZR2 A;  1KZH A;  2KJB A;  2W1O A;  1MJB A;  1R23 A;  1BI0 A;  4PSX A;  3OYL A;  3RSN A;  1LE8 A;  2DW4 A;  2W25 A;  1TLH B;  2K4J A;  3GO5 A;  4X6A J;  2CWE A;  4BJ6 C;  1W7P D;  4O3M A;  3MEX A;  2X1E A;  2P4W A;  3BP8 A;  2M7A A;  4HV5 A;  4A3F J;  1SFO J;  3BTL A;  2YU9 J;  3DKW A;  1TNT A;  4FX0 A;  4NQW A;  3CCM I;  2DOF A;  1UG2 A;  5ICE A;  3GZ6 A;  4FX4 A;  1FNN A;  1X58 A;  2XPU A;  4A0Z A;  1LDJ A;  4JX5 A;  1WHU A;  2FBK A;  5FFX A;  5HLI A;  4FCY A;  1I6X A;  4BDY A;  1CF7 A;  1JKP C;  2L5Q A;  2ACJ A;  1T6S A;  3ZCO A;  1T56 A;  1HKT A;  3EET A;  4PZJ A;  1YFH A;  5CVU A;  3S1N J;  4DZJ A;  1I39 A;  3C18 A;  4JYK A;  2WV1 A;  3FX3 A;  3H9Q A;  3K2A A;  2H27 A;  4AM3 A;  3OY9 A;  1TWC J;  1BBY A;  1G2H A;  3L1P A;  3W2A A;  3EYY A;  3S3N A;  4S0H B;  2JA6 J;  1P7I A;  2LBF A;  1R5I D;  1IUY A;  4N4O B;  2XF6 A;  4BY7 J;  3J81 Z;  3FXQ A;  2WY7 Q;  3V8K A;  4L18 B;  4HW0 A;  2HYG D;  3WTW C;  3CDH A;  4ZTJ A;  4EJT A;  3PNY A;  4PFO A;  4YRV A;  4J19 A;  5HS7 A;  2PMZ A;  2F4O B;  4M3E A;  3TO7 A;  3TDZ C;  2W85 A;  4UB6 C;  1FSH A;  3HDD A;  5FLV A;  1OCO H;  3BCA A;  4XSX F;  2PMZ N;  1FOK A;  2BY3 A;  2H09 A;  1QVT A;  3DKX A;  3VB2 A;  2E2H J;  2ADU A;  4ZC3 A;  2EA4 A;  3FK7 A;  5K7H A;  5M5X J;  3S1M J;  3SDG A;  2EFQ A;  2HDD A;  1DP7 P;  1B9M A;  3J80 Z;  2HOE A;  1MBJ A;  4JK1 X;  5M3F J;  1G3S A;  1MBG A;  4M6X A;  3CZ6 A;  2E1M B;  3A0H C;  4NHJ A;  3CF2 A;  3FDY A;  4ZTF A;  1KA8 A;  2H8W A;  2MD5 A;  2VBY A;  5E3L A;  3J7A O;  2DO7 A;  3B02 A;  3L2V A;  4E7H A;  2E36 A;  2BBY A;  4IEJ A;  4N4N B;  3GTM J;  5DTD A;  2GIZ A;  2XSJ C;  4C3J J;  3LSG A;  4DBR A;  3G71 I;  5DUK A;  3CUQ C;  4WXD A;  1TWF J;  1MD0 A;  3HTS B;  4FE7 A;  3CJQ B;  3KYC B;  1ODD A;  2AHQ A;  4J01 A;  5B1B H;  1S3J A;  2L9V A;  1OCP A;  3ZPL A;  2GOM A;  4CGZ A;  5DCM B;  2VPR A;  4XL9 A;  2MH9 A;  4RBO A;  1ERD A;  4I02 A;  4JQF A;  2Z2S B;  1VND A;  3K4B A;  3WTU C;  3BG5 A;  4HNU A;  2CQN A;  3MN2 A;  3OOP A;  2E5N A;  3ZGK A;  3GUD A;  3WGI A;  4C3I J;  3NEU A;  1LFP A;  1A6Q A;  2R7V A;  2XF7 A;  3GTQ J;  1H0M A;  4G7O F;  1T98 A;  3RQ4 A;  2K9M A;  5D4R A;  4Q48 A;  3H5A A;  5HNF A;  1ACI A;  2CV1 A;  4B44 A;  3OYK A;  1FTT A;  5K7Z A;  3WOD F;  2QSG X;  3S2H J;  3LSH A;  1JHF A;  1YIO A;  1V54 H;  4RGU A;  3LQR A;  1UCR A;  2LKX A;  1SVM A;  1ZLK A;  2COM A;  3IKV A;  3G2B A;  1SEU A;  4MNU A;  1BL0 A;  2NS0 A;  2BXZ A;  2XKO A;  3A1Y A;  2XRL A;  3J7Z I;  5ILV A;  4EM0 B;  3GTJ J;  1J7K A;  1MMS A;  3JSP A;  5JHU A;  4GYG A;  2B9S A;  4PDK A;  1VI0 A;  1S29 A;  4I99 C;  4I2O A;  2G0E A;  1B72 B;  2LNB A;  2YU3 A;  4L0Y B;  1ZLJ A;  4HZF A;  4YII A;  3ABM H;  3TOA A;  3CMY A;  2AXL A;  2M8G X;  3DP7 A;  1IN8 A;  4EGY A;  2V9K A;  2VI6 A;  1H89 C;  4C2T A;  4U87 A;  5ERI A;  1BW6 A;  1SMY F;  3AG2 H;  3LFK A;  3O8G A;  2WAD A;  4NUB A;  4DW6 A;  3ISP A;  3P9K A;  2K85 A;  1TQI A;  4MFE A;  3DKY A;  3DXJ F;  4BHP A;  2DT6 A;  1KU9 A;  1SD4 A;  1WJF A;  2Y2Z A;  2LLK A;  5IYB J;  4B47 A;  1FBQ A;  5FRM A;  2EBI A;  4CCN A;  1TL8 A;  2RAE A;  1W5T A;  1NG7 A;  3RPQ A;  2HOT A;  1O4X A;  4NDL A;  4CZC A;  1SD5 A;  1H9G A;  1Y0N A;  1QVU A;  2VKE A;  1MKM A;  2DMT A;  2HPI A;  3IH2 A;  1ZYR F;  3FXJ A;  4D5F A;  4DZP A;  1YLF A;  4PGH A;  2J5P A;  2F5D A;  2LDU A;  5J8F A;  4RAG A;  4RS8 A;  2DFF A;  4X1E A;  5EDN A;  1A31 A;  4WF2 A;  2XKP A;  1U0J A;  5DCM A;  4GRI A;  3RPU D;  2JK3 A;  2JA5 J;  2IA2 A;  3N4M A;  3WU2 C;  1SFU A;  1T39 A;  3GXO A;  1JXS A;  3DV8 A;  3QU6 A;  4RGS A;  3GZN B;  2XUB A;  4CCM A;  4AC0 A;  3A03 A;  3HJE A;  3WGG A;  5KNL A;  2MG4 A;  3BR0 A;  4M3D A;  3EYI A;  3F9K A;  2QCO A;  1RNL A;  3IL2 A;  3OYN A;  2OJE D;  2Y30 A;  4QLC U;  3Q0W A;  4X0G A;  4M3F A;  1WCM J;  3VSK A;  1W5S A;  1S7E A;  2V1D A;  1W36 C;  4M3B A;  2DT5 A;  2GA1 A;  2IW5 A;  1Y0U A;  1JT0 A;  2HDC A;  3QQA A;  4XNF A;  3ABK H;  3OS2 A;  1EA3 A;  5H6Q A;  3RI4 A;  3OYF A;  1YG2 A;  4IO9 F;  1DP3 A;  4KIG A;  4M9Z A;  2R7D A;  2JQ7 A;  2HPM A;  5DEQ A;  2LK2 A;  1TNS A;  1YS7 A;  1Y8R B;  2V9P A;  2X0L A;  5D8L B;  2WAE A;  2P5L C;  2QZ8 A;  2Q1Z B;  3AAF A;  2XHK A;  3HSE A;  4BU2 A;  1ZEL A;  3Q0U A;  4UHT A;  5K1Y A;  1B72 A;  1MNE A;  4HDV A;  4BQO A;  1TQP A;  1G59 A;  1E3P A;  1P7J A;  2UWM A;  1S7O A;  3ASN H;  1REP C;  4HPQ A;  3F72 A;  4RGX A;  2FBH A;  1KU7 A;  4XID A;  3LSJ A;  4O5V A;  1T95 A;  2FEZ A;  3LWF A;  3W2W A;  5F1J A;  2DJN A;  3JSO A;  1GVD A;  3PQJ A;  2E1M C;  2X85 A;  1ETX A;  4E7L A;  1ZGW A;  4E7I A;  2P7C B;  2O8K A;  4BQN A;  3PM1 A;  1GXP A;  4LOC A;  2CUZ A;  3MZ8 A;  4OIR F;  2R7O A;  3WHB A;  1HDD C;  4G8X A;  2OUM A;  3KEY A;  5TJJ A;  2DQR A;  1NHA A;  1QQI A;  5AON A;  1BM9 A;  2DMQ A;  1T2K A;  1AKH B;  2X6Y A;  2ELK A;  1WJD A;  1R4N B;  2R5Z B;  2NRA C;  2I8D A;  4IQ4 A;  1MSE C;  4AIH A;  1LFB A;  3GFI A;  4XLN F;  2CG4 A;  1R22 A;  1V5E A;  2HR3 A;  2JT1 A;  4CXF A;  1A04 A;  1FYM A;  5FFZ A;  3ZOB A;  2X4H A;  2VE9 A;  2JUC A;  1ZTR A;  3DPU A;  1P4A A;  5F64 A;  3OYE A;  2LY9 A;  4E7K A;  5JLX A;  3A01 B;  3U2R A;  3EDP A;  1I50 J;  3TO9 A;  2A05 A;  4BXX J;  1Z9C A;  4V19 K;  5C44 J;  2HOA A;  3KLN A;  4UUT A;  4HNT A;  3KCC A;  3WG9 A;  4GGG A;  5EG0 A;  4LIV A;  1MMN A;  2M30 A;  3DBR B;  3DFG A;  3I55 I;  1MSF C;  2HVR A;  4EEF G;  2CW0 F;  3GFM A;  2GA2 A;  3VYR B;  2HZT A;  2JPB A;  4G6D A;  5M5W J;  1D0X A;  4XLE A;  2ME6 A;  1DU6 A;  3R61 A;  1YX5 A;  4LLN A;  1SAU A;  3CJT B;  2DPD A;  3VEP A;  3F8B A;  1OYY A;  2JSC A;  1FP1 D;  3BPV A;  4PJ0 C;  3F22 A;  3E1S A;  1YQA A;  3OIQ A;  1U9O A;  1X4P A;  2KMU A;  2NVY J;  1IN4 A;  1X1B A;  2MA3 A;  3R4K A;  2O3F A;  3Q9S A;  4BUP A;  2VE8 A;  3F6O A;  3I9V 2;  2LKP A;  3S17 J;  4HX8 A;  3MZY A;  2HXO A;  4W1U A;  3GCM A;  4KFC A;  3WTV C;  1BI3 A;  1FEX A;  3ERE D;  1IDY A;  5GAE J;  2RV8 A;  2N8G A;  4HF2 A;  1KU3 A;  1YW7 A;  5E20 A;  3HHG A;  3ASO H;  3KIO A;  1BJZ A;  2QQB A;  1R49 A;  4ZYH A;  1ZKG A;  2HWV A;  5D4S A;  5B5E C;  3Q3S A;  2ID6 A;  2EFO A;  2GIV A;  4A3L J;  2OCC H;  1Y56 A;  3GLX A;  1ZGJ A;  2ZCW A;  1QPI A;  3PJR A;  1UHM A;  3MQ0 A;  1D5Y A;  3PNV A;  2EZK A;  5L3B A;  2B63 J;  1JI8 A;  5BOX A;  4A3B J;  4A6E A;  2XV4 S;  3OMY A;  4EM2 A;  3D5S C;  1F5T A;  1AKH A;  4LB6 B;  1APL C;  1K4T A;  2R5Z A;  3H5N A;  3R60 A;  1XCV A;  2ECB A;  5DDG A;  4KIB A;  3M8J A;  3F8N A;  2KIU A;  3CMA I;  1J2X A;  4B09 A;  2LY2 A;  5J8C A;  2QYO A;  3K9T A;  1QZY A;  2D1V A;  5CLS A;  5JI6 A;  3K7A J;  3HUG B;  5TIS C;  1TBX A;  1WH7 A;  3SZP A;  3O8H A;  3TP3 A;  2IS4 A;  1V5F A;  2QKM B;  3A01 A;  2BYV E;  3MWM A;  3RQI A;  4AIJ A;  2EV0 A;  4QIW N;  1RPW A;  4V2G A;  2IS2 A;  3UR3 C;  1ZG5 A;  2X6W A;  3I5U A;  1FBS A;  1GV2 A;  3K70 D;  3C7J A;  5KAI C;  3J7A Y;  4WXH A;  4XON A;  2R7T A;  5D5V B;  1Z67 A;  3A0B C;  1YJW I;  5BMZ A;  1QGP A;  1UB9 A;  2FBI A;  2IXS A;  4D1Q A;  3DQV C;  3REO A;  3M9A A;  1UAA A;  3N97 A;  3K1M A;  4E70 A;  3UNG C;  3E0J B;  2L7K A;  1Z6R A;  2JZY A;  1XN7 A;  3FM3 A;  3BCB A;  2K9S A;  2VXZ A;  2LR8 A;  5FLX Z;  3A2K A;  4CYD A;  4ZYD A;  3GTL J;  2IS6 A;  1W7P B;  5D6E A;  2A3S A;  2HZD A;  5BQT A;  5E3O A;  1LPQ A;  4EQQ A;  1YIT I;  4AU7 A;  4GYI A;  4XKC A;  2BV6 A;  5DCF A;  3HB9 A;  4M3G A;  1OMI A;  4BXF A;  1JTX A;  2V79 A;  5EF6 A;  4KMF A;  2CMP A;  1W4M A;  1FX7 A;  1MZB A;  2KJC A;  4DGW B;  2O03 A;  4BH9 A;  4UNO A;  4BKX A;  3H0D A;  3Q5F A;  3NWT A;  2KZG A;  1OLT A;  3V42 A;  1X3W B;  1RZ4 A;  4AD9 A;  1W5C C;  3BR3 A;  5E8I A;  3J81 K;  4U7D A;  1QA6 A;  2TRT A;  3FM5 A;  2M9H A;  2QVO A;  1XC5 A;  2UUZ A;  4QTR A;  3HL2 A;  2VQH A;  1A35 A;  2F5F A;  5K5O A;  4OMY A;  4CSW A;  2XPV A;  4JBA A;  2XB0 X;  3M8F A;  3WTT C;  2EA2 A;  1JE8 A;  4RB3 C;  2WWY A;  3K69 A;  4EGZ A;  4P96 A;  2X1D A;  2DBB A;  2CV0 A;  2XAJ A;  3J80 K;  1NH3 A;  1E0E A;  4XN3 A;  4MTD A;  4P5O A;  4EV0 A;  5HVQ C;  3T0Y A;  2ZJQ F;  2K7L A;  3H9J A;  4D5C A;  1F9N A;  3CP8 A;  4CDG A;  3SZT A;  2HTJ A;  3FK6 A;  3R0J A;  4GCV A;  1YOV B;  1ZH5 A;  4P9U A;  5HDN A;  1X1C A;  1U8B A;  5J6X A;  3CES A;  3H0G J;  2Z16 A;  2ZXJ A;  3CCL I;  3JRD A;  2CQQ A;  4PGG A;  1VFC A;  4EJV A;  1ZG1 A;  1DQU A;  2M45 A;  2VN2 A;  3IC7 A;  1J09 A;  1FPQ A;  2L4M A;  3W6K B;  1PYV A;  5FB2 A;  3FHN A;  3KZI C;  4KYW A;  4D0P A;  5FO5 A;  1T0F A;  4Q5S F;  2F4I A;  5KK1 A;  1IG7 A;  3LQQ A;  3FHZ A;  1W0U A;  1UEL B;  2M7B A;  2VBX A;  2YS9 A;  4IRH A;  4G7Z F;  3ESW B;  2WV0 A;  5KVR A;  1SVL A;  4AIK A;  2DQL A;  2L0K A;  1I3A A;  3CCV I;  2IAI A;  4KN7 X;  1TQM A;  2CSO A;  3HOW J;  5J40 A;  5JLW A;  2BHZ A;  1QNT A;  2LVS A;  3ABL H;  4G12 A;  3E5Q A;  1GT0 C;  1BC8 C;  3LOC A;  4MQ9 F;  5K5R A;  1HOM A;  4XOR A;  2AQF A;  2G7U A;  2ZSI B;  4OAZ A;  3KEO A;  3CC4 I;  1W7P A;  2ME0 A;  2ZFW A;  5HOO A;  2HKO A;  2LH9 A;  3FMS A;  2QF7 A;  1EH7 A;  2F2E A;  1B9N A;  2K3P A;  4R8H A;  3WE2 A;  4ABZ A;  1JKQ C;  3RZO J;  2XPW A;  3K4N A;  1FIP A;  4B8X A;  1D1C A;  2K9N A;  3BY6 A;  4ESF A;  3OYM A;  5LGN A;  3RKX A;  4A5M A;  1D1A A;  2H1L A;  2OD5 A;  2KKO A;  2XGD A;  4CH7 A;  6PAX A;  1J9I A;  5TGT A;  4ON0 A;  3C3W A;  5BPI A;  3FBI B;  4HLY A;  3ZMV A;  3OYD A;  3OYI A;  3I0T A;  2BGC A;  1HKS A;  4ZDO A;  4A2U A;  4FET A;  1PP7 U;  2QLZ A;  1ZAR A;  2DU9 A;  4XOT A;  4IHT A;  1YIJ I;  3HXL A;  4KA4 A;  3IRR A;  2L01 A;  3ZMU A;  1MJ9 A;  3H3V K;  1A5J A;  4HLX A;  2MLK A;  3AL0 C;  3G3Z A;  1DGW Y;  1R1U A;  2K9L A;  2KP6 A;  3E97 A;  2OQG A;  4BGD A;  5J47 A;  1SC7 A;  4XIC A;  2CQX A;  5DD4 A;  3HHH A;  4PJJ A;  5J1R A;  5GTI C;  3K6G A;  4ENK A;  3K4C A;  1VQL I;  2NNN A;  3N05 A;  2R4G A;  1IV8 A;  3RYR A;  2VT3 A;  4DYR A;  2TDX A;  4H0E A;  3JRE A;  3B73 A;  2JMW A;  3WU1 B;  2QM3 A;  3I59 A;  2PJR B;  1PDN C;  2CFX A;  2W84 A;  2Y0S A;  2Y0M A;  1BIA A;  2EPF A;  2MFZ A;  1U3E M;  2Y0S N;  1G3Y A;  4I7H A;  2R7S A;  1Z3X A;  1FOW A;  2M34 A;  2EK5 A;  3S3O A;  5CJ9 A;  2LOO A;  2P0W A;  3BG6 A;  3B6C A;  1HDP A;  3S15 J;  3I53 A;  1YRN B;  2Y31 A;  3LSI A;  2L54 A;  2FSW A;  1LJ9 A;  3RIR A;  2PQ8 A;  3ZMZ A;  1WJ5 A;  3OR2 C;  1XCB A;  2DA2 A;  3QPT A;  4JP0 A;  3HRU A;  2BZT A;  3IWZ A;  2KPM A;  1LEA A;  5FD5 A;  5IP9 J;  2VPL A;  2Z33 A;  3CD6 I;  5CQG A;  3D0S A;  1LVK A;  5TRD A;  1L0O C;  1ETK A;  1S8N A;  1V5G A;  2IVM A;  5LD2 C;  4MQV A;  2DCE A;  1Z05 A;  3CME I;  2W7N A;  2LF7 A;  3QWL A;  4ENN A;  3IAS 2;  4LK1 F;  4ZZD A;  3BJA A;  2FRH A;  2X1C A;  3CP2 A;  1JHH A;  4QSH A;  5D6F A;  3NRV A;  1BOA A;  1IO2 A;  1KQ0 A;  2M4G A;  1FY7 A;  3TP0 A;  4ESB A;  2CO5 A;  2Y9Z A;  1DU0 A;  3LSM A;  9ANT A;  2FE3 A;  5B66 C;  1ON2 A;  1G6N A;  3LA2 A;  4KJZ A;  5E1W A;  3MZH A;  3ZQ7 A;  2HYJ A;  2PFB A;  1BI1 A;  4JOM A;  5FGM A;  1OCT C;  1WI3 A;  4G6Q A;  2NVT J;  2VXD A;  3HPH A;  1J59 A;  2IBD A;  4AID A;  1VQK I;  4IHV A;  1OR7 A;  1QHG A;  1LDD A;  4XKB A;  3A02 A;  4XLP F;  4C9Y A;  3VYU B;  1MJA A;  4B1R A;  2F5E A;  1R00 A;  4YEL A;  2KLO A;  1G3W A;  2QEX I;  4JX4 A;  4Y15 A;  3ZQF A;  4WCG A;  4C30 A;  1FMV A;  2O61 A;  2OZ6 A;  4PJM A;  1XDS A;  3F3X A;  4KIC A;  3Q9V A;  2GXG A;  3HTU A;  4ESJ A;  3OYC A;  4IOC F;  3CCY A;  3OYG A;  2PJR A;  2KRF A;  3DEW A;  5HNH A;  2KL4 A;  3ZQG A;  3LAP A;  2O6G E;  1WKM A;  1P2F A;  2L02 A;  4M74 A;  1QHH D;  3D5L A;  5LHH A;  1EKE A;  4YG2 F;  2ETH A;  4A93 J;  5DM6 F;  2EFW A;  5CVJ A;  1EH6 A;  3EUH A;  3O3K A;  4BJ5 C;  1X1D A;  1EJ9 A;  4LIT A;  4RLQ A;  4RM2 A;  2ZME B;  2VKV A;  5LGU A;  3GTK J;  2X6X A;  1YRN A;  2FF4 A;  2IA0 A;  4MGR A;  2DYR H;  3OS1 A;  1F1Z A;  1ZRD A;  2GWR A;  5D5X B;  2HNH A;  1Q1H A;  2LTP A;  3DPT A;  5E8G A;  3DU6 A;  1ZRE A;  3KP5 A;  3H92 A;  5JFR A;  3WE3 A;  3RPU A;  2M0C A;  3HM5 A;  2OBP A;  4KUM A;  3VYS B;  4XRF A;  2M8E A;  2D5V A;  1G8X A;  4LGW A;  3DU5 A;  3PUB A;  3JRG A;  3LNQ A;  1HW2 A;  1D3Y A;  1O3R A;  2MBF A;  1W1W E;  1ZR4 A;  4C3H J;  1GUU A;  1XMX A;  5L3D A;  3L2Q A;  3CJR B;  1IUF A;  1Z7L A;  1BIB A;  2GM4 A;  4CA0 A;  1TWA J;  2RC4 A;  4NC7 A;  1EF4 A;  1Y8Q B;  4MO7 A;  3ZQI A;  4PK4 A;  4ZDL A;  2DFE A;  1AOY A;  3AG1 H;  4RB1 A;  4Y52 J;  2HQ5 A;  3FXM A;  1IAW A;  1Y6I A;  2VKD A;  1AWC A;  2DMP A;  1UG0 A;  1XD7 A;  4XKV A;  5F04 A;  3RZD J;  3SXY A;  1W36 D;  3G1L A;  4JX6 A;  4UUV A;  2EIN H;  2OV7 A;  3IAM 2;  1BOB A;  2BEO A;  2L9S A;  4AYB A;  1B6A A;  2V6C A;  2MSY A;  2VB6 A;  2VAS A;  1YX3 A;  3JAM K;  3ZRG A;  4XN0 A;  4AYB N;  2R92 J;  3QU3 A;  5F08 A;  2LSO A;  4CCJ A;  3ONQ A;  1UMQ A;  2L9R A;  3HRM A;  3IKT A;  2A5W A;  1ZHF A;  4MEX F;  3ZMD A;  5CVV A;  3L2U A;  4DBQ A;  3AFH A;  3RKY A;  1QZZ A;  3IH4 A;  2CQ7 A;  5CQE A;  1HW5 A;  3IUO A;  2DOD A;  5D5W B;  1TZL A;  3QPL A;  3U21 A;  1P4X A;  4HST A;  1JKO C;  1Z91 A;  3ERM A;  2E71 A;  1ZRC A;  5L3F A;  3COA C;  3L7W A;  2GXB A;  2RN7 A;  5EG0 B;  5HS9 A;  4EJO A;  3WG7 H;  2PMU A;  3ZMT A;  3PSF A;  4OWR B;  4UB8 C;  1XX5 A;  3JTH A;  2QQ9 A;  3OSF A;  3CCS I;  4AVZ A;  4ENJ A;  2CV2 A;  2IGM A;  5C3E J;  2GZW A;  1OYW A;  3BG7 A;  3F6V A;  2EIM H;  5E1Z B;  2FA5 A;  4LMY A;  3QOP A;  2ZME A;  1XGM A;  3DTI A;  1F36 A;  3I64 A;  5HLT A;  2NS8 A;  4LG3 A;  4BYY A;  3JRB A;  4A5N A;  2XAG A;  1HW1 A;  3HGY A;  4N9I A;  3CO7 C;  5DS9 A;  2YX7 A;  3S2D J;  3RYP A;  1WZ2 A;  3OIP A;  3QAH A;  2HXI A;  1OFC X;  2K02 A;  3HKZ A;  3CDL A;  5ICF A;  2LRD A;  3FXO A;  1R4M B;  2E19 A;  2EH3 A;  1XPX A;  2JVG A;  3HKZ N;  1RKW A;  4W97 A;  1TWH J;  3LSP A;  4HF1 A;  2VL8 A;  3PIO F;  2ZC2 A;  5D5U B;  1SAN A;  2MLG A;  3HOS A;  2XGE A;  2LD5 A;  1RKT A;  3P9C A;  1ZN2 A;  2EZL A;  2R93 J;  4EM1 A;  4BAY A;  2X48 A;  2Q8K A;  5IPA A;  4IOA F;  3JRH A;  4R1H A;  1TP4 A;  4G94 A;  2DFH A;  3ZQC A;  1I1S A;  3L2R A;  1QZE A;  3RKW A;  2E5Z A;  3W6J B;  2NYX A;  1N75 A;  1QU3 A;  1KU2 A;  1ZQ3 P;  2M0M A;  2VJI A;  4Y4R A;  1KON A;  2RKH A;  3LA7 A;  4DNC A;  1Y39 A;  1KYW A;  1WRJ A;  4PJN A;  4OIO F;  2KRC A;  1IW7 F;  3KYD B;  2ZXW H;  1WSU A;  3L2C A;  1O3T A;  4IL6 C;  3KP4 A;  1ETQ A;  2KT0 A;  4D9J A;  4J00 A;  4IHS A;  3S14 J;  1ORK A;  4HYE A;  1VF9 A;  5JR3 A;  3SYT A;  2PI0 A;  1B8I B;  1C0W A;  4UV9 A;  4A3E J;  2FML A;  1IRG A;  1H9T A;  5FKN A;  2HFH A;  2XC7 A;  2Z1D A;  3OIO A;  5FKM A;  1YW8 A;  3KE2 A;  3OR1 C;  1LNW A;  2YX4 A;  3L2W A;  3EQL F;  4XK4 A;  1XGN A;  2GLO A;  1ZG3 A;  4XLC A;  2Z3Y A;  5H20 A;  3ZQL A;  3DTE A;  2NNY A;  1T08 B;  4HX7 A;  2QSF X;  5IY5 H;  3PIP F;  2IRF G;  1OIS A;  2WY8 Q;  3QOD A;  1XMA A;  3W3C A;  5F0F A;  4ASN A;  2C6Y A;  1ZAO A;  2Z5U A;  2WC2 A;  2FOW A;  3O6B B;  2ZJ2 A;  3PFI A;  4RA2 A;  5LRS A;  2E7X A;  3DF8 A;  2YR2 A;  4NB5 A;  2F5V A;  3KP6 A;  3V7R A;  4YFX F;  2ZNZ A;  3GFJ A;  3GFL A;  4A69 C;  2BE5 F;  1FYL A;  3OYB A;  4DOZ A;  4M72 A;  3CF5 F;  2O9L A;  2H94 A;  3SZG A;  1OQY A;  2W24 A;  1IN6 A;  2KFD A;  2JA2 A;  4HRI A;  1FC3 A;  4XRS A;  3OYJ A;  1TT5 B;  1P6R A;  3NAR A;  2V1X A;  3V8L A;  4I76 A;  4RAF A;  2DI3 A;  4K2E A;  4XLF A;  1R36 A;  3G1M A;  1U8R A;  4L5I A;  3RTR A;  4HBL A;  1UHS A;  4LB5 A;  5AIP A;  3BG9 A;  4L5J A;  4C2U A;  2ZO4 A;  3H3Z A;  3WGH A;  4EJW A;  4G6T B;  2ISZ A;  4FE4 A;  4LD5 A;  1Q1V A;  1X4O A;  2DK5 A;  1JJ6 C;  2H1K A;  3MCZ A;  4KT6 A;  4U0W A;  2OTJ I;  4P55 A;  1WVR A;  3T8T A;  1Z3Y A;  4EAT A;  1IN7 A;  1IZ1 A;  4NC8 A;  1R5G A;  1SFX A;  2CQK A;  3DLL F;  3LMM A;  2CJJ A;  1N78 A;  5HLH A;  2BW3 B;  1VQ5 I;  1KQ9 A;  3DLA A;  1SFK A;  3I4P A;  1V55 H;  3OL3 A;  3TOB A;  3E6B A;  1UST A;  2DA1 A;  2H6C A;  4B3A A;  3AKZ A;  2HQN A;  1UJ8 A;  5ILS A;  4L0Z B;  5F6F A;  2K86 A;  1B8I A;  1MGT A;  2P8T A;  5E17 F;  3M1E A;  3S16 J;  1VTN C;  2RQP A;  1PUF B;  2AO9 A;  3O2P E;  3E6C C;  1YHQ I;  2F6C A;  2VUM J;  4A3C J;  1YW9 A;  4LG0 B;  5KHD A;  4CZZ A;  1E3H A;  2BVL A;  3S32 A;  1RIO H;  1ETO A;  2GOX B;  4G9Y A;  1WJA A;  3KET A;  4L5E A;  2M4K A;  2G9W A;  2ZKZ A;  1OCC H;  1X2M A;  1GLN A;  2HQA A;  5EYR A;  5IT3 A;  4XRS G;  4Q4Z F;  2CW8 A;  3FXU A;  3CCU I;  4YEJ A;  3ZP5 A;  5DYM A;  4F7Z A;  2LP0 A;  3UKG A;  1O3Q A;  1AU7 A;  2EFP A;  4DYC A;  3S3M A;  2RDP A;  4XKW A;  3CCR I;  4AVP A;  5M5Y J;  2OZU A;  1VQ9 I;  1NTC A;  1DDN A;  4IPA A;  5EEG A;  1EH8 A;  3BJ6 A;  5IOY A;  5IP6 A;  4D7N A;  4IRG A;  3FXR A;  3K10 A;  4M9X A;  4PFP A;  1VQ4 I;  3ECH A;  3K2Z A;  1ETW A;  1YS6 A;  4UUS B;  4ENM A;  1KQ8 A;  3H36 A;  3HIF A;  4MHG A;  1IV6 A;  3LSK A;  3ZQH A;  2DN0 A;  1R7J A;  1M1E B;  2L7F P;  5EGO B;  3JTG A;  4IX7 A;  2FU4 A;  2LC2 A;  2HU9 A;  2DXI A;  3BRO A;  1J0R A;  3NQO A;  5HLG A;  2LY1 A;  3HOT A;  1MBE A;  2QEN A;  1VQO I;  1FSE A;  2JSP A;  3HOZ J;  4M73 A;  4XRM A;  2O8X A;  3HOV J;  2PX9 A;  1RC9 A;  1LQ1 A;  2LFB A;  2XVC A;  2LMD A;  3QYB A;  5J4V A;  5IYD J;  3K0L A;  3SJM A;  2JPC A;  1UHW A;  3QPS A;  4ZDP A;  5LLQ A;  2M2E A;  3BT9 A;  3T5X A;  4OMZ A;  2KIQ A;  4DYQ A;  5M3M J;  4L9T A;  3I59 B;  1D5V A;  3QP6 A;  5ED4 A;  4AUX A;  2KIM A;  3T1B A;  2BY1 A;  1DPU A;  4XBF A;  3BC8 A;  2TCT A;  1J75 A;  2BW3 A;  5H6R A;  1YTY A;  2XB5 A;  2NVQ J;  3MKW B;  1A36 A;  3CC2 I;  4WXC A;  3BDD A;  3U9G A;  2P6T A;  1BR2 A;  2HGC A;  3DBL B;  4GO1 A;  1XSD A;  2XRO A;  2FMY A;  3VDX A;  2ELH A;  1K6Y A;  2HQR A;  3AG4 H;  3BTJ A;  4LK0 F;  4LLG F;  4O6J A;  3HC7 A;  3QYF A;  3ULQ B;  5DM7 F;  4PJL A;  2MYS A;  1ETV A;  2PBI A;  1PP8 F;  1PUF A;  1BJA A;  2COB A;  1EV7 A;  1MH4 A;  5GTH C;  4II3 A;  2P7V B;  1VQN I;  1TW3 A;  3M3Y J;  5H2F C;  4L9N A;  4LG0 A;  1WGX A;  2E1N A;  3EPZ A;  2E1C A;  1E17 A;  1RUO A;  2Q0O A;  3OOU A;  2D2W A;  2JVH A;  2I10 A;  4PUS A;  2M87 A;  3CLQ A;  1SVO A;  5KAF C;  2DA7 A;  2DJI A;  4ZZL A;  4U7B A;  2V9V A;  1BA5 A;  5E79 C;  2EZI A;  3QRF F;  3K4M A;  1Y1W J;  2JN6 A;  4I98 B;  2F4M B;  1ZGA A;  5J4Y A;  1FYK A;  1B1B A;  2DA3 A;  2IGO A;  2MC3 A;  2MC4 A;  4L9J A;  3V4G A;  4FT8 A;  1VZ0 A;  1MIJ A;  4ITV A;  2W48 A;  3WHC A;  3ABT A;  2DK8 A;  1H88 C;  1ITY A;  1I5Z A;  2ZXI A;  1TTY A;  4GXO A;  4IF4 A;  1OCR H;  1SMT A;  3CJN A;  3IV5 A;  1HKQ A;  2DYS H;  1KGS A;  5FJ8 J;  3QOE A;  3BZK A;  1O7L A;  3JRF A;  4QWQ A;  4I0A A;  1U6G A;  3FWE A;  3TED A;  3TMO A;  4UUS A;  4UVB A;  1R1T A;  1LUJ B;  4OIN F;  5FD6 A;  3H9G A;  3C2B A;  3HEF A;  3I71 A;  3LFU A;  3MMY B;  4F93 B;  2VLA A;  2ZJP F;  1S7A A;  4OIQ F;  2EB7 A;  3WTY C;  3VYT B;  2DTR A;  5EGO A;  1FJL A;  4BS9 A;  3JCU C;  2IT0 A;  4OIP F;  3JRA A;  1XSV A;  3WTS C;  3BTC A;  2KIF A;  4XOP A;  5FRO A;  2VJJ A;  1XGO A;  1VQP I;  1FBU A;  2H8R A;  4XQF A;  3W2V A;  1YI2 I;  2B7E A;  4ZYA A;  2K40 A;  2IP2 A;  4CCK A;  5FLM J;  5GPC A;  5BPD A;  3CUQ A;  2B0L A;  4YIF A;  4D7M A;  5JVT A;  2HS5 A;  4B48 A;  5EEH A;  1SD7 A;  2DDB A;  4QPQ A;  3JRC A;  3FMR A;  2HVQ A;  2QKL B;  4PCQ A;  3R6S A;  2DPU A;  1IDZ A;  5LBQ A;  3BQY A;  4IRI A;  3BR1 A;  4IJA A;  2MW8 A;  1RRJ A;  2IA1 A;  3L9F A;  1Z0X A;  4KT5 C;  2JRM A;  2ISY A;  3PO2 J;  3ABU A;  3GYH X;  1FT9 A;  4NBQ A;  3K1P A;  5CPR B;  1JJ8 C;  2RNG A;  2YSR A;  2EQR A;  2RNJ A;  1NG6 A;  3BZ6 A;  3ZQQ A;  1E3O C;  4Y13 A;  3WTZ A;  4I01 A;  1D0Y A;  3JW4 A;  3KFW X;  1T0F C;  1R6R A;  3H1C A;  3H3U A;  4A3J J;  4FQG A;  1QO0 D;  2FXA A;  2WTE A;  3JRI A;  3CCQ I;  4ZJZ A;  3TW7 A;  3F8C A;  3GBG A;  2FUG 2;  3RCO A;  2VJ4 A; 
#chains in the Genus database with same CATH homology
 2QBY A;  4WK8 F;  2VBW A;  3I58 A;  3OV8 A;  4KDP A;  2Z9O A;  4KNY A;  4RGR A;  2P5K A;  1ON1 A;  1LVA A;  1TW2 A;  3CTA A;  2EWN A;  4EJU A;  3TGN A;  2VOP A;  3ELK A;  4ZH4 F;  3KZY A;  1SFE A;  1FZP B;  5LRR A;  2FNP A;  1LB2 A;  2G7H A;  3P7N A;  4S04 A;  1CGP A;  4BQA A;  1ONV A;  2UXN A;  1K78 B;  2M5W A;  4CHU A;  5IT9 Z;  2A6E F;  4HQM A;  3DPL C;  2A69 F;  1G4D A;  2XAS A;  4OU0 A;  2QUF A;  5LHI A;  4KIF A;  1S6L A;  5ILU A;  3V7C A;  2FOK A;  2D1H A;  1QPM A;  1Z1D A;  3LAJ A;  1K7A A;  3BJO A;  3VOD A;  4FHT A;  4L9V A;  4A12 A;  1IXC A;  3GW2 A;  3M8E A;  1OYI A;  1MDM B;  2VOO A;  1Z7U A;  2K27 A;  2P5V A;  3SHF A;  4HA8 A;  2FNA A;  4P9F A;  3ML6 A;  5A2Q Z;  2HYF A;  4ZYE A;  3L09 A;  3ZN0 A;  1P4W A;  2J5O A;  5ICC A;  2RGV A;  1XSX A;  3BOQ A;  5CVI A;  2VC0 A;  1OPC A;  3WTX C;  1O57 A;  2PEX A;  3LST A;  5LEK A;  2Q2E A;  3ROU A;  2RVC A;  2EFN A;  3CLO A;  4UV8 A;  3L00 A;  1K78 A;  4HAM A;  3FZV A;  2ZBK A;  1IXS B;  2V1U A;  4HF0 A;  3S2W A;  1ZRF A;  1DUX C;  4M9S A;  2VOD A;  3QP5 A;  2DFI A;  5E18 F;  4N0B A;  1JGS A;  4I0B A;  2EV6 A;  4HOB A;  4U0Y A;  3TQN A;  2OAZ A;  1K79 A;  1HBX G;  3IHU A;  4YFK F;  5DV5 A;  5HDK A;  1F4K A;  5LGT A;  4RB0 A;  1HST A;  5CVR A;  3E5U A;  3F23 A;  3E6D A;  4DQ2 A;  1MDM A;  5HDG A;  1KYZ A;  1XDU A;  5F1R A;  4WWC A;  3G73 A;  3KP3 A;  3E3V A;  3HSR A;  1FWZ A;  2A61 A;  3CO6 C;  1HXD A;  1BC7 C;  3ZMS A;  4ETS A;  3M7G A;  3WU0 A;  5D8K B;  2DAO A;  4LLL A;  3F8F A;  3LA3 A;  2M1B A;  2EJR A;  3U1D A;  2VC1 A;  2OU2 A;  3GF2 A;  3TKY A;  3HRT A;  1U5T B;  2A5Y B;  4A0Y A;  4BHB A;  2H6B A;  3R0A A;  4S05 A;  2UZK A;  4EMS A;  4A0X A;  2STW A;  5LHG A;  4M71 A;  4RAZ A;  5FLX K;  2PJP A;  2VON A;  4G7H F;  1J5Y A;  2PLY A;  3IRQ A;  5ICG A;  1FLI A;  4U88 A;  4MEY F;  2GQQ A;  2PMH A;  3V8J A;  3KLO A;  4N9H A;  3SQN A;  1GXQ A;  1IRF A;  4I09 A;  4WX9 A;  4U0V A;  3FMQ A;  2JTV A;  1E2X A;  5BS6 A;  1P92 A;  4YFN F;  3KEQ A;  2NAZ A;  3MAJ A;  1FP2 A;  2UXX A;  2VBZ A;  4MTE A;  2QQA A;  4BNC A;  4OOI A;  5L3G A;  1V3F A;  5AIQ A;  2A68 F;  1XMK A;  1U2W A;  2XGX A;  1WQ2 A;  3I54 A;  1U78 A;  2A07 F;  4CIC A;  4UVA A;  3HYI A;  1D8J A;  4CO8 A;  4BXU A;  1DPR A;  2IJL A;  2L4A A;  2W57 A;  1U5T A;  5E1X A;  3RJP A;  2EV5 A;  2PN6 A;  1B4A A;  4UVC A;  3JAM Z;  3ECO A;  1R58 A;  2CGP A;  1R1V A;  4ZYG A;  1I1G A;  3KP7 A;  2L3D A;  5LEJ A;  2A6H F;  3C1D A;  2XAF A;  2E7W A;  3HSF A;  1B59 A;  1QBJ A;  2FQ3 A;  3GX4 X;  1OKR A;  2MH2 A;  3KP2 A;  1HSJ A;  2OA4 A;  3SFZ A;  1SD6 A;  4RB2 C;  3QPH A;  5DUI A;  2ESN A;  5HS8 A;  3DEU A;  4Z2Y A;  1BI2 A;  3F21 A;  2PG4 A;  2VT2 A;  1RI7 A;  4EVI A;  1X3U A;  2ZNY A;  1LDK B;  4M6Y A;  1R5H A;  1IXR C;  4HV6 A;  2HEO A;  1XGS A;  1BN5 A;  5CYV A;  3GEZ A;  3CUO A;  3GVA A;  2STT A;  2O0Y A;  3ZN1 A;  4HX4 A;  3RDI A;  1L3L A;  2K4B A;  2OQR A;  4IXA A;  1YO5 C;  4HQE A;  1GHC A;  1IN5 A;  4HDU A;  4UXN A;  3GZ5 A;  2R3S A;  1K6O A;  2HTS A;  4RAY A;  5L3E A;  4TV7 A;  3F8M A;  1U5T C;  1YYV A;  3K1N A;  1I27 A;  4A6D A;  3PQK A;  4IVN A;  2Y48 A;  1LEB A;  1RUN A;  2LF8 A;  1T38 A;  1D8K A;  3CUQ B;  1ULY A;  4XSZ F;  3MFK A;  1V4R A;  2XAH A;  4LJZ F;  3E5X A;  1PUE E;  4R79 A;  2DLL A;  5IT9 K;  1WWX A;  4Q47 A;  1UFM A;  3KZZ A;  2GAU A;  3HUG A;  2R7F A;  5L3C A;  1CF7 B;  1WI9 A;  2ESH A;  1G3T A;  3IWF A;  2QBY B;  3TDU C;  4Y17 A;  2IPQ X;  3P9I A;  3VOE A;  2AS5 F;  2CYY A;  2XAQ A;  5K5Q A;  3T8R A;  1SAX A;  3BPX A;  4KMU X;  1HQC A;  2HKX A;  1Z6T A;  3VFZ A;  4BHC A;  2JRT A;  2XRN A;  3E6M A;  1O3S A;  4KN4 X;  2Y75 A;  5A2Q K;  1O7F A;  3TO6 A;  3HRS A;  3GWZ A;  3BWG A;  2YPR A;  1IF1 A;  2QWW A;  2Z99 A;  2F5C A;  2P6S A;  4AWX B;  2D45 A;  1USS A;  5DD8 A;  1XB4 A;  4LFU A;  1GVJ A;  2XIG A;  1STZ A;  3FF5 A;  3V7S A;  2KJB A;  1MJB A;  1BI0 A;  1R23 A;  2DW4 A;  2W25 A;  1TLH B;  2K4J A;  3GO5 A;  2CWE A;  1W7P D;  4O3M A;  3MEX A;  2P4W A;  3BP8 A;  4HV5 A;  3DKW A;  1TNT A;  4FX0 A;  4NQW A;  3GZ6 A;  5ICE A;  4FX4 A;  1FNN A;  4A0Z A;  1LDJ A;  2FBK A;  5FFX A;  5HLI A;  1I6X A;  1CF7 A;  2ACJ A;  1T6S A;  1HKT A;  3EET A;  4PZJ A;  1YFH A;  5CVU A;  3C18 A;  3FX3 A;  2H27 A;  1BBY A;  3EYY A;  3J81 Z;  3FXQ A;  3V8K A;  4L18 B;  4HW0 A;  2HYG D;  3WTW C;  3CDH A;  4EJT A;  5HS7 A;  3TO7 A;  3TDZ C;  2W85 A;  1FSH A;  4XSX F;  1FOK A;  2H09 A;  3VB2 A;  2ADU A;  2EA4 A;  2EFQ A;  1DP7 P;  1B9M A;  3J80 Z;  2HOE A;  4JK1 X;  1G3S A;  4M6X A;  4NHJ A;  1KA8 A;  2MD5 A;  2VBY A;  3J7A O;  2DO7 A;  3B02 A;  2BBY A;  5DUK A;  3CUQ C;  4WXD A;  3HTS B;  1MD0 A;  1ODD A;  1S3J A;  3ZPL A;  4CGZ A;  5DCM B;  2MH9 A;  4I02 A;  4JQF A;  3WTU C;  3OOP A;  3GUD A;  3WGI A;  3NEU A;  1H0M A;  4G7O F;  1T98 A;  5D4R A;  4Q48 A;  3WOD F;  1JHF A;  1YIO A;  4RGU A;  3LQR A;  1UCR A;  1ZLK A;  2COM A;  3IKV A;  4MNU A;  2NS0 A;  2XKO A;  5ILV A;  4EM0 B;  1J7K A;  3JSP A;  5JHU A;  4GYG A;  4PDK A;  1S29 A;  4I2O A;  2LNB A;  2YU3 A;  4L0Y B;  1ZLJ A;  4HZF A;  4YII A;  3TOA A;  2AXL A;  3DP7 A;  1IN8 A;  4EGY A;  5ERI A;  1SMY F;  3LFK A;  3ISP A;  3P9K A;  1TQI A;  4BHP A;  3DXJ F;  1KU9 A;  1SD4 A;  1FBQ A;  1W5T A;  3RPQ A;  1SD5 A;  1H9G A;  1MKM A;  1ZYR F;  1YLF A;  4PGH A;  2J5P A;  2F5D A;  2LDU A;  5J8F A;  4RS8 A;  4WF2 A;  2XKP A;  5DCM A;  2IA2 A;  3N4M A;  1T39 A;  1SFU A;  3GXO A;  1JXS A;  3DV8 A;  3QU6 A;  4RGS A;  2XUB A;  3WGG A;  3EYI A;  1RNL A;  3IL2 A;  4QLC U;  1W5S A;  2V1D A;  2DT5 A;  2GA1 A;  2IW5 A;  1Y0U A;  2HDC A;  5H6Q A;  3RI4 A;  1YG2 A;  4KIG A;  4M9Z A;  2R7D A;  5DEQ A;  1TNS A;  1YS7 A;  2X0L A;  5D8L B;  2P5L C;  2QZ8 A;  3AAF A;  2XHK A;  3HSE A;  4UHT A;  5K1Y A;  4HDV A;  1TQP A;  2UWM A;  1S7O A;  1REP C;  3F72 A;  4RGX A;  2FBH A;  1KU7 A;  4O5V A;  2FEZ A;  3JSO A;  3PQJ A;  2P7C B;  1GXP A;  4OIR F;  4G8X A;  5TJJ A;  2DQR A;  1NHA A;  1QQI A;  5AON A;  1BM9 A;  1T2K A;  2NRA C;  4AIH A;  3GFI A;  4XLN F;  2CG4 A;  1R22 A;  2HR3 A;  2JT1 A;  4CXF A;  1A04 A;  1FYM A;  5FFZ A;  2X4H A;  2VE9 A;  1P4A A;  5F64 A;  3U2R A;  3EDP A;  3TO9 A;  1Z9C A;  3KLN A;  3KCC A;  3WG9 A;  4GGG A;  2M30 A;  3DFG A;  2CW0 F;  3GFM A;  2GA2 A;  2HZT A;  2JPB A;  4G6D A;  3R61 A;  4LLN A;  2DPD A;  3VEP A;  3F8B A;  1OYY A;  2JSC A;  1FP1 D;  3BPV A;  3F22 A;  1YQA A;  1IN4 A;  2MA3 A;  3R4K A;  2O3F A;  3Q9S A;  2VE8 A;  3F6O A;  2LKP A;  4HX8 A;  3MZY A;  4KFC A;  3WTV C;  1BI3 A;  3ERE D;  2RV8 A;  4HF2 A;  1KU3 A;  1YW7 A;  5E20 A;  3HHG A;  2QQB A;  4ZYH A;  2HWV A;  5D4S A;  2EFO A;  2GIV A;  3GLX A;  1ZGJ A;  2ZCW A;  1UHM A;  3MQ0 A;  5L3B A;  5BOX A;  4A6E A;  2XV4 S;  4EM2 A;  1F5T A;  4LB6 B;  3R60 A;  1XCV A;  5DDG A;  4KIB A;  3F8N A;  2KIU A;  1J2X A;  4B09 A;  5J8C A;  2QYO A;  3K9T A;  1QZY A;  2D1V A;  5CLS A;  5JI6 A;  1TBX A;  3SZP A;  2BYV E;  3MWM A;  4AIJ A;  2EV0 A;  1ZG5 A;  3I5U A;  1FBS A;  3C7J A;  4WXH A;  5D5V B;  5BMZ A;  1QGP A;  1UB9 A;  2FBI A;  3DQV C;  3REO A;  3M9A A;  3N97 A;  3K1M A;  4E70 A;  1Z6R A;  2JZY A;  1XN7 A;  3FM3 A;  2VXZ A;  5FLX Z;  4CYD A;  4ZYD A;  1IUY A;  1W7P B;  5D6E A;  2A3S A;  5BQT A;  4EQQ A;  4GYI A;  2BV6 A;  5DCF A;  4KMF A;  1OMI A;  2V79 A;  1W4M A;  1FX7 A;  1MZB A;  2KJC A;  2O03 A;  4BH9 A;  4UNO A;  3Q5F A;  1RZ4 A;  4AD9 A;  5E8I A;  3J81 K;  4U7D A;  3FM5 A;  2QVO A;  2F5F A;  5K5O A;  4OMY A;  4JBA A;  3WTT C;  3M8F A;  2EA2 A;  1JE8 A;  4RB3 C;  2WWY A;  3K69 A;  4EGZ A;  4P96 A;  2DBB A;  2XAJ A;  3J80 K;  4MTD A;  4P5O A;  4EV0 A;  5HVQ C;  3T0Y A;  2K7L A;  1F9N A;  4CDG A;  3SZT A;  2HTJ A;  3R0J A;  4GCV A;  1ZH5 A;  4P9U A;  5HDN A;  5J6X A;  2ZXJ A;  4PGG A;  4EJV A;  1ZG1 A;  2M45 A;  2VN2 A;  3IC7 A;  1FPQ A;  2L4M A;  3W6K B;  5FB2 A;  4KYW A;  4D0P A;  5FO5 A;  1T0F A;  4Q5S F;  5KK1 A;  3LQQ A;  3FHZ A;  2VBX A;  4IRH A;  4G7Z F;  5KVR A;  2WV0 A;  4AIK A;  2DQL A;  4KN7 X;  1TQM A;  2CSO A;  1QNT A;  3E5Q A;  1BC8 C;  4MQ9 F;  5K5R A;  2G7U A;  3KEO A;  1W7P A;  2ZFW A;  5HOO A;  2HKO A;  3FMS A;  1EH7 A;  2F2E A;  4R8H A;  1B9N A;  3WE2 A;  4B8X A;  3BY6 A;  4ESF A;  5LGN A;  3RKX A;  4A5M A;  2OD5 A;  2KKO A;  6PAX A;  1J9I A;  4ON0 A;  3C3W A;  5BPI A;  4HLY A;  3ZMV A;  3I0T A;  2BGC A;  1HKS A;  4A2U A;  1PP7 U;  2QLZ A;  1ZAR A;  2DU9 A;  4IHT A;  4KA4 A;  3IRR A;  2L01 A;  3ZMU A;  1MJ9 A;  4HLX A;  2MLK A;  3G3Z A;  3E97 A;  1R1U A;  2OQG A;  5DD4 A;  3HHH A;  4ENK A;  2NNN A;  3RYR A;  2VT3 A;  2TDX A;  4H0E A;  3B73 A;  3WU1 B;  2QM3 A;  3I59 A;  1PDN C;  2CFX A;  2W84 A;  2Y0M A;  1BIA A;  1U3E M;  1G3Y A;  4I7H A;  2EK5 A;  5CJ9 A;  3I53 A;  2L54 A;  2FSW A;  1LJ9 A;  3RIR A;  2PQ8 A;  3ZMZ A;  1XCB A;  3QPT A;  3HRU A;  3IWZ A;  1LEA A;  5FD5 A;  2Z33 A;  3D0S A;  5TRD A;  1L0O C;  1S8N A;  2IVM A;  4MQV A;  1Z05 A;  2LF7 A;  4ENN A;  4LK1 F;  4ZZD A;  3BJA A;  2FRH A;  1JHH A;  5D6F A;  3NRV A;  1BOA A;  1KQ0 A;  1FY7 A;  4ESB A;  2CO5 A;  2FE3 A;  1ON2 A;  1G6N A;  3LA2 A;  5E1W A;  3MZH A;  3ZQ7 A;  2PFB A;  1BI1 A;  5FGM A;  4G6Q A;  1J59 A;  1OR7 A;  1LDD A;  4XLP F;  1MJA A;  2F5E A;  1R00 A;  1G3W A;  4Y15 A;  4WCG A;  2O61 A;  2OZ6 A;  1XDS A;  4KIC A;  3F3X A;  3Q9V A;  2GXG A;  3HTU A;  4ESJ A;  2KRF A;  3LAP A;  2O6G E;  1WKM A;  1P2F A;  2L02 A;  4M74 A;  3D5L A;  5LHH A;  4YG2 F;  2ETH A;  2EFW A;  5CVJ A;  1EH6 A;  3EUH A;  3O3K A;  2ZME B;  5LGU A;  2FF4 A;  2IA0 A;  4MGR A;  1F1Z A;  1ZRD A;  2GWR A;  5D5X B;  1Q1H A;  3DPT A;  5E8G A;  1ZRE A;  3KP5 A;  3H92 A;  5JFR A;  3WE3 A;  3RPU A;  2OBP A;  4KUM A;  4XRF A;  2M8E A;  4LGW A;  1HW2 A;  1D3Y A;  1O3R A;  2MBF A;  5L3D A;  1BIB A;  2RC4 A;  1AOY A;  4RB1 A;  1IAW A;  1AWC A;  1XD7 A;  4UUV A;  3SXY A;  2BEO A;  1B6A A;  2V6C A;  3JAM K;  3QU3 A;  2LSO A;  3HRM A;  3IKT A;  1ZHF A;  4MEX F;  3ZMD A;  5CVV A;  3RKY A;  1QZZ A;  1HW5 A;  5D5W B;  1P4X A;  1Z91 A;  1ZRC A;  5L3F A;  3COA C;  3L7W A;  2GXB A;  2RN7 A;  5HS9 A;  4EJO A;  2PMU A;  3ZMT A;  3JTH A;  2QQ9 A;  4ENJ A;  2GZW A;  1OYW A;  3F6V A;  5E1Z B;  2FA5 A;  4LMY A;  3QOP A;  2ZME A;  1XGM A;  3I64 A;  4BYY A;  4A5N A;  2XAG A;  1HW1 A;  4N9I A;  3CO7 C;  2YX7 A;  3RYP A;  3QAH A;  2K02 A;  5ICF A;  4HF1 A;  5D5U B;  2MLG A;  3HOS A;  3P9C A;  1ZN2 A;  4EM1 A;  4BAY A;  2Q8K A;  4R1H A;  4G94 A;  1I1S A;  3RKW A;  3W6J B;  2NYX A;  1KU2 A;  3LA7 A;  2RKH A;  1KYW A;  1WRJ A;  4OIO F;  1IW7 F;  1WSU A;  3L2C A;  1O3T A;  3KP4 A;  4IHS A;  4HYE A;  5JR3 A;  2PI0 A;  1C0W A;  4UV9 A;  2FML A;  1IRG A;  1H9T A;  2HFH A;  1YW8 A;  3KE2 A;  1LNW A;  2YX4 A;  3EQL F;  1XGN A;  1ZG3 A;  5H20 A;  2Z3Y A;  2NNY A;  4HX7 A;  2IRF G;  4ASN A;  2C6Y A;  1XMA A;  1ZAO A;  2Z5U A;  2WC2 A;  3O6B B;  2ZJ2 A;  3PFI A;  5LRS A;  2E7X A;  3DF8 A;  2YR2 A;  4NB5 A;  3V7R A;  3KP6 A;  4YFX F;  2ZNZ A;  3GFJ A;  3GFL A;  2BE5 F;  1FYL A;  4M72 A;  2H94 A;  2W24 A;  1IN6 A;  1FC3 A;  1P6R A;  2V1X A;  3V8L A;  2DI3 A;  4K2E A;  1R36 A;  1U8R A;  4L5I A;  3RTR A;  4HBL A;  4LB5 A;  5AIP A;  4L5J A;  2ZO4 A;  3H3Z A;  3WGH A;  4EJW A;  4LD5 A;  2DK5 A;  3MCZ A;  4U0W A;  4P55 A;  3T8T A;  1IN7 A;  1IZ1 A;  1R5G A;  1SFX A;  2CQK A;  5HLH A;  1KQ9 A;  3I4P A;  3TOB A;  2ISZ A;  3E6B A;  1UST A;  2H6C A;  4L0Z B;  2HQN A;  5ILS A;  5F6F A;  2K86 A;  1MGT A;  2P8T A;  5E17 F;  3M1E A;  1VTN C;  2RQP A;  3O2P E;  3E6C C;  1YW9 A;  4LG0 B;  4CZZ A;  1RIO H;  4G9Y A;  3KET A;  2G9W A;  2ZKZ A;  5IT3 A;  4Q4Z F;  3FXU A;  3ZP5 A;  5DYM A;  4F7Z A;  1O3Q A;  2EFP A;  2RDP A;  4AVP A;  2OZU A;  1DDN A;  4IPA A;  5EEG A;  1EH8 A;  3BJ6 A;  4IRG A;  3FXR A;  4M9X A;  3ECH A;  3K2Z A;  1YS6 A;  4ENM A;  1KQ8 A;  3HIF A;  4MHG A;  1R7J A;  3JTG A;  2FU4 A;  3BRO A;  1J0R A;  3NQO A;  5HLG A;  3HOT A;  2QEN A;  1FSE A;  4M73 A;  2O8X A;  1LQ1 A;  2XVC A;  3K0L A;  2JPC A;  1UHW A;  5LLQ A;  3T5X A;  4OMZ A;  4L9T A;  3I59 B;  1D5V A;  3QP6 A;  5ED4 A;  2KIM A;  3T1B A;  1DPU A;  4XBF A;  1J75 A;  1YTY A;  5H6R A;  4WXC A;  3BDD A;  3U9G A;  2P6T A;  2HGC A;  4GO1 A;  1XSD A;  2XRO A;  2FMY A;  2ELH A;  2HQR A;  4LLG F;  4LK0 F;  4O6J A;  3ULQ B;  2PBI A;  1PP8 F;  1BJA A;  1EV7 A;  2P7V B;  1TW3 A;  4L9N A;  4LG0 A;  2E1N A;  2E1C A;  1E17 A;  1RUO A;  2Q0O A;  2D2W A;  2M87 A;  4ZZL A;  4U7B A;  2V9V A;  3QRF F;  1FYK A;  4I98 B;  1ZGA A;  1B1B A;  2MC3 A;  4L9J A;  3V4G A;  4FT8 A;  3ABT A;  2DK8 A;  1I5Z A;  1TTY A;  4GXO A;  4IF4 A;  3CJN A;  1SMT A;  1HKQ A;  1KGS A;  1O7L A;  4QWQ A;  4I0A A;  1U6G A;  3FWE A;  4UVB A;  5FD6 A;  1R1T A;  4OIN F;  3I71 A;  4OIQ F;  1S7A A;  2EB7 A;  3WTY C;  2DTR A;  2IT0 A;  4OIP F;  1XSV A;  3WTS C;  2KIF A;  1XGO A;  1FBU A;  2IP2 A;  5BPD A;  3CUQ A;  2B0L A;  4YIF A;  5JVT A;  2HS5 A;  5EEH A;  1SD7 A;  3FMR A;  4PCQ A;  3R6S A;  2DPU A;  5LBQ A;  4IRI A;  4IJA A;  2IA1 A;  3L9F A;  4KT5 C;  2ISY A;  3ABU A;  3GYH X;  1FT9 A;  3K1P A;  2YSR A;  2RNJ A;  3BZ6 A;  4Y13 A;  3WTZ A;  4I01 A;  3JW4 A;  3KFW X;  3H3U A;  1QO0 D;  2FXA A;  2WTE A;  3F8C A;  3LWF A;  4DNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...