3BDDA

Crystal structure of a putative multiple antibiotic-resistance repressor (ssu05_1136) from streptococcus suis 89/1591 at 2.20 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
140
structure length
140
Chain Sequence
QEMEDLLYRLKVADETISNLFEKQLGISLTRYSILQTLLKDAPLHQLALQERLQIDRAAVTRHLKLLEESGYIIRKRNPDNQREVLVWPTEQAREALITNPSAHHQAIKTSMNQILTVEESEQFLATLDKLLIGLQNLPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein MarR
publication title Crystal structure of putative multiple antibiotic-resistance repressor (MarR) (ZP_00875883.1) from Streptococcus suis 89/1591 at 2.20 A resolution
rcsb
source organism Streptococcus suis
molecule tags Transcription
total genus 49
structure length 140
sequence length 140
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bddA00
2EV0A 4IPAA 2VOOA 4LLLA 4A5MA 1FYKA 2FBHA 2F5DA 2M1BA 4M9SA 1KA8A 4XLNF 4CGZA 4U7DA 2KKOA 4HYEA 1IN6A 4LB6B 1WQ2A 3GVAA 3WTWC 2CFXA 2DTRA 2YX4A 1CF7A 3IRRA 2BBYA 3K0LA 1IN8A 3MCZA 1LDJA 2XUBA 1ZRDA 1Z9CA 2DI3A 4JBAA 4YFXF 5TJJA 2ZNZA 2TDXA 3P9IA 4I01A 1U5TB 3BPVA 4KMFA 1MGTA 2DLLA 5E8IA 4G7HF 1MJAA 1FBQA 2WTEA 2Y75A 2PMUA 4A0XA 4UHTA 2EV6A 3T5XA 2R7DA 5HS9A 4KNYA 4EM1A 5F6FA 4LJZF 3MZHA 2A68F 3NRVA 4HV6A 3GFLA 3NQOA 4BQAA 3EDPA 4WXDA 2HKXA 5ILVA 1DPRA 4GCVA 2Z9OA 2CYYA 4KA4A 2BGCA 3M7GA 5FD6A 2D1HA 1HQCA 1FSEA 3RKXA 2FMYA 2G7HA 5FB2A 3GFJA 2CWEA 2QBYA 1H0MA 2D1VA 3CO7C 3SZPA 2CGPA 3WTTC 4I2OA 2VONA 4AIKA 2VT2A 3N97A 5CJ9A 3WE3A 4M6YA 1LJ9A 3B73A 1HKQA 2Z5UA 2P8TA 4Y15A 5DCFA 4YFNF 4M74A 2OQGA 2AXLA 4PCQA 4AWXB 4S05A 5DD4A 2ETHA 2V1DA 2YU3A 4G9YA 4LG0B 1V4RA 3R61A 3KEOA 4ON0A 4MQ9F 4Q5SF 1HW2A 1U2WA 1O3TA 4N9HA 2OQRA 3WGGA 4AD9A 5D4SA 5JVTA 2A61A 1ZN2A 2G9WA 1FNNA 2WWYA 2IW5A 1XDUA 5E1XA 3U1DA 4FX4A 3ECOA 4FHTA 2EWNA 5FGMA 5LEJA 2KRFA 4EGYA 5FLXK 1B9NA 2QQ9A 5IT3A 2Z3YA 1GXQA 3SFZA 1ZGJA 3V8JA 2P6SA 4HV5A 3KZZA 4A5NA 4R8HA 2UZKA 2G7UA 1YO5C 3WE2A 4BHPA 1LQ1A 2UXNA 1T0FA 2IA2A 4AIHA 4L18B 1O7FA 3GLXA 1S8NA 2FMLA 1WKMA 5HDNA 3CUQC 4WK8F 3T1BA 1QNTA 2Y48A 2RN7A 5IT9K 1QZZA 4XRFA 3WTZA 4UVCA 3E97A 2PEXA 4HDUA 2QYOA 2FBKA 5CVVA 4F7ZA 2DT5A 1ZAOA 1FT9A 2NRAC 4K2EA 4U7BA 5K5OA 1UHMA 3DP7A 3JAMZ 3DFGA 4EJWA 4P5OA 3ECHA 4IJAA 2X0LA 5JFRA 4G6QA 1QZYA 2E1CA 5DUIA 2A6HF 4IXAA 2UWMA 1IAWA 1J2XA 1T38A 4IRIA 4KN4X 1WRJA 4I02A 4YIIA 5LRSA 1IN7A 2PFBA 3C1DA 3P9KA 3K2ZA 1R00A 1XD7A 3BJ6A 1G3YA 3I0TA 3KCCA 1LVAA 1P4AA 1Z7UA 5ICEA 4LLNA 4EQQA 1T39A 1P4XA 4LMYA 3FX3A 5LEKA 1ON1A 1ZG5A 3GX4X 1IN4A 3KP3A 4GYIA 2JZYA 1KU9A 4ETSA 1KU3A 1C0WA 2GIVA 3F21A 3ZMSA 2P5LC 3HRSA 3BY6A 4L9TA 2QM3A 3SQNA 2MH9A 4HX4A 1EH6A 4RAYA 4ZZDA 3KETA 2ACJA 2GQQA 1J5YA 2GZWA 4UV8A 4KUMA 2FQ3A 2FA5A 3E6BA 1FBUA 1OMIA 1HXDA 3HHHA 2J5PA 1EH7A 4WF2A 1CGPA 5D5UB 4UNOA 2L54A 4WX9A 5AIQA 5D5WB 3I59A 3V8KA 1P2FA 2X4HA 3E5XA 4KYWA 4M9XA 1BIBA 5LGUA 2O03A 4BHCA 4RGXA 2W84A 1B1BA 1OYWA 4I0AA 1J75A 1MD0A 4UV9A 4P9FA 1XSVA 3J81K 3DKWA 1YG2A 2O8XA 4L5IA 3DEUA 1EV7A 3QOPA 3O3KA 1IZ1A 1FYLA 1J0RA 1OYYA 3T8TA 4EV0A 4HA8A 4M6XA 5L3CA 1FC3A 2DQRA 1U3EM 3IC7A 2XRNA 2D45A 1MKMA 1FPQA 2K4JA 1W5TA 3EYIA 3ABTA 1RIOH 5DCMB 3FMRA 4YG2F 5FFZA 1R58A 2EK5A 1U78A 2EFPA 1SAXA 2FU4A 2JPBA 4OIOF 4YIFA 3K9TA 1HBXG 5H6QA 5KVRA 1FYMA 2ESNA 3WGIA 3P9CA 1SFUA 3F3XA 4O5VA 2GWRA 2P4WA 5JR3A 1MDMB 4H0EA 3FXUA 1ZRCA 1FP1D 4JQFA 1UHWA 5HLIA 3HSRA 3LQQA 2B0LA 2R7FA 4XBFA 2CQKA 1YQAA 1Z05A 4PDKA 1TTYA 3LA3A 3COAC 3EYYA 5L3BA 2H6BA 3CDHA 1IXSB 5EEGA 3WTYC 4MQVA 1YW8A 1LDDA 2DK8A 3FHZA 1DDNA 3FF5A 3BDDA 5D5VB 1J59A 1SMTA 5F1RA 4HAMA 4HZFA 1QO0D 4ZYEA 3ELKA 4HBLA 1XN7A 3JSOA 1Z6TA 1G3TA 1W7PB 3QU3A 1R1VA 1S29A 4L9VA 1FX7A 1YLFA 1S7AA 1VTNC 1O3SA 2M5WA 3BROA 2EB7A 5CVIA 1HSJA 3RTRA 1WI9A 3I4PA 2COMA 2F5CA 3ABUA 4IF4A 4G7ZF 3VOEA 1I27A 2KIMA 1SD6A 1B4AA 4IVNA 1BJAA 1TW3A 4Y17A 3HSFA 4ZYGA 1OPCA 4WWCA 4MGRA 4RB3C 5CYVA 2GAUA 4BAYA 1F9NA 2L3DA 3FMQA 2LKPA 2W25A 3QU6A 2ZO4A 4G7OF 2QBYB 3F6VA 3CLOA 1K6OA 3WTXC 2Q2EA 4BXUA 2ZXJA 3HRMA 4HQEA 4ZZLA 2VXZA 4HX7A 2NNYA 3DF8A 1R7JA 1OYIA 3Q5FA 5ICFA 2UXXA 4HF0A 3LAJA 4EMSA 1B6AA 2XVCA 3VEPA 3V8LA 1T6SA 3IRQA 4RGSA 1FZPB 1L0OC 1LDKB 2RDPA 2HEOA 1ZARA 4N9IA 3CTAA 1YTYA 4A2UA 3VODA 3SZTA 4RS8A 1DPUA 3TDZC 4EJUA 1BOAA 1D8KA 3GEZA 1USTA 1D3YA 2F5EA 3F6OA 1HW1A 3GZ6A 3OV8A 3HTSB 3QAHA 3SXYA 5D6EA 3K69A 3CO6C 2VN2A 3IWFA 2ZKZA 2ELHA 4IHSA 2EA2A 2M8EA 3GWZA 3KE2A 2PJPA 2IA0A 2LNBA 4LK1F 2HGCA 1G6NA 3LQRA 3QRFF 1IRFA 2ESHA 3Q9SA 2ZCWA 1YW7A 1BC8C 2CG4A 3WTVC 2HYGD 2YPRA 4PGGA 1J7KA 3C18A 1TNSA 1TNTA 4M71A 4UXNA 3ZQ7A 1S6LA 3TDUC 1FY7A 4A0YA 1FP2A 2MBFA 3E5QA 1XSDA 5EEHA 3KLNA 1FSHA 3W6JB 4RB0A 3F8MA 4I09A 5HS8A 3MFKA 3F8FA 4ASNA 3HSEA 3NEUA 1T2KA 3BZ6A 1O3QA 3MWMA 3I71A 2VE8A 4N0BA 2DK5A 2ZMEB 2VOPA 4XLPF 2NS0A 2VC0A 3J7AO 4B8XA 2VE9A 5E1WA 3WTSC 4S04A 4HF2A 2XAHA 1QPMA 1UCRA 3VFZA 3WTUC 1XDSA 4KT5C 3RYRA 2LSOA 4BHBA 3ERED 3GO5A 5LGTA 5D4RA 5E18F 3DPTA 3T0YA 3F8CA 3FM3A 2VBXA 4BYYA 2BV6A 3L9FA 2FSWA 3L7WA 3S2WA 5HVQC 3W6KB 1S7OA 2FXAA 3TOBA 3RYPA 1O57A 1ZRFA 1BM9A 2RKHA 1G3WA 4L9JA 1MJBA 2PI0A 1XGNA 4XSZF 1BI2A 2E1NA 2GA1A 5CVUA 1TBXA 4R79A 4LG0A 3TQNA 2ZBKA 1ON2A 5E1ZB 2XASA 2CSOA 4JK1X 4L5JA 2WV0A 4WCGA 5LLQA 5CVRA 1Z91A 3DXJF 2PLYA 1K78B 1IRGA 4Q4ZF 4EM0B 2Y0MA 3BJOA 2MLGA 5HOOA 3C7JA 3R0AA 3DPLC 3V7SA 3HUGA 4U0WA 4ESFA 1G4DA 5LHHA 1YS6A 3QPTA 5JI6A 1ZHFA 3GW2A 1SMYF 3MZYA 1D8JA 1P92A 5JHUA 2PQ8A 4GYGA 3JAMK 2W57A 2O6GE 3ZN1A 3KP6A 1JGSA 4G6DA 5HDGA 2HFHA 3KZYA 4PGHA 3I5UA 5K5QA 3QP5A 3M8FA 1HKSA 1KQ9A 4LGWA 1XCVA 4ZYDA 4P55A 1SD5A 5BMZA 2VT3A 3RKYA 1DUXC 3D5LA 4OIPF 2P5KA 5L3EA 4FT8A 1TQPA 3FMSA 5FO5A 2BEOA 5LHIA 2RNJA 4OMYA 3WU1B 1BIAA 3F8BA 1V3FA 2FF4A 2HZTA 2K7LA 3LA2A 1FOKA 2XAQA 1XMAA 2VODA 3IWZA 4TV7A 3HRUA 4ESBA 1YS7A 4UUVA 3F8NA 5ILSA 2H94A 5LHGA 1UFMA 4ENKA 3DV8A 4MEXF 4HX8A 4CICA 2IP2A 2OAZA 2RGVA 5K1YA 4EM2A 3JTGA 3F22A 2HKOA 5J6XA 1PUEE 1LB2A 2M87A 3KEQA 1YW9A 1BI3A 4O6JA 3KP4A 5AONA 4U88A 2V1UA 3CUQA 3GZ5A 4M73A 2OU2A 1Q1HA 4CHUA 2H09A 4RGUA 5F64A 5CLSA 1S3JA 2V6CA 2OZUA 3H3ZA 2K02A 4KN7X 2GA2A 1BN5A 1ODDA 3TOAA 4DQ2A 4KIFA 2HQNA 1ZLKA 3ZMZA 5A2QZ 2OA4A 3ZN0A 1HW5A 2K27A 2A69F 1I5ZA 3FZVA 3GYHX 5L3DA 4E70A 3EQLF 1JE8A 3BOQA 5HDKA 1Z6RA 3ZMDA 1ZGAA 3LSTA 1ULYA 4KICA 4ENMA 2FE3A 1XMKA 3M9AA 3I64A 3D0SA 1WSUA 3V4GA 1XCBA 1ZREA 2DW4A 2QQAA 3BPXA 4CDGA 1CF7B 1GVJA 2F2EA 4ESJA 4A12A 1SD7A 4OIRF 2E7XA 2L4MA 5A2QK 3AAFA 2MLKA 5DV5A 4EJVA 1U8RA 5J8FA 2OZ6A 4EJOA 2KIUA 2XHKA 1K7AA 2OBPA 3RPUA 2E7WA 3HHGA 2XAFA 2NAZA 1IF1A 3HIFA 1AWCA 4HF1A 4RGRA 3K1NA 3IKTA 1IN5A 3ZMVA 2QLZA 3TO7A 1ZG1A 1DP7P 3BJAA 1TW2A 2DPDA 5BOXA 2O0YA 1REPC 1B9MA 2HTJA 1TQIA 4AVPA 2GXGA 1BI1A 1MDMA 4IHTA 4ZH4F 3PQJA 1QQIA 1RNLA 3WODF 4CO8A 2CO5A 3GUDA 3V7CA 2HR3A 5DUKA 4ENNA 5DEQA 5ERIA 3JSPA 2H27A 2K86A 2DBBA 3U9GA 2ZJ2A 3R0JA 3JW4A 4MTEA 4L9NA 1XGOA 2LDUA 5LRRA 1RZ4A 4FX0A 4XSXF 4D0PA 2L4AA 3ZPLA 1ONVA 1YFHA 3RJPA 2FNPA 2Q0OA 2HDCA 2XROA 1K79A 2XGXA 4CYDA 3T8RA 1IXCA 2ADUA 2YX7A 3TO6A 5HLHA 5AIPA 1KGSA 3I58A 1Z1DA 4IRHA 1W7PA 3TKYA 1XGMA 4Q48A 1E2XA 2LF7A 4LLGF 2YR2A 3ISPA 2JT1A 2VBWA 1IW7F 2H6CA 2A07F 3GF2A 4RB2C 4IRGA 4M72A 1RUNA 4NQWA 3IHUA 1IUYA 3N4MA 2A3SA 4YFKF 2ISZA 3K1PA 1LNWA 2EFOA 1BI0A 1FLIA 3ROUA 3HRTA 1U5TA 3HYIA 5LBQA 4EVIA 1HSTA 2F5FA 2VBYA 1MJ9A 2FOKA 1P4WA 1A04A 1P6RA 3LA7A 1BBYA 1J9IA 4A6DA 2W85A 5DD8A 2QZ8A 4I7HA 2EV5A 1ZYRF 2ISYA 5FLXZ 2FNAA 2RVCA 3E6CC 4KFCA 4HOBA 2O61A 3EETA 1RI7A 1R5GA 3E6MA 5DYMA 2KJBA 4R1HA 5ED4A 2HWVA 2XKOA 5K5RA 3ZP5A 3RI4A 4U0YA 1H9TA 3L2CA 1FBSA 2V9VA 4M9ZA 1YIOA 2Q8KA 3RDIA 3REOA 2IA1A 3O2PE 4Q47A 2JTVA 1TQMA 1W5SA 3WG9A 1EH8A 2AS5F 5IT9Z 3Q9VA 3GXOA 3K1MA 3BP8A 3MQ0A 3SHFA 3PFIA 1LEAA 1XSXA 3ZMUA 3CUOA 2HTSA 1JXSA 3OOPA 2BYVE 4LB5A 3FM5A 2DPUA 4LK0F 3LAPA 4PZJA 1USSA 4QWQA 1SFXA 3C3WA 3WU0A 2XKPA 2PN6A 1X3UA 3PQKA 4A0ZA 4HLXA 3IKVA 5H6RA 1W4MA 2OD5A 1W7PD 5HS7A 1QBJA 4MTDA 4QLCU 1U6GA 1O7LA 2L02A 4MEYF 2YSRA 4OU0A 3I54A 5ICCA 3QP6A 1R1UA 3VB2A 3HOSA 2Z99A 3FWEA 3MEXA 4G94A 1KU7A 3TO9A 1KYWA 4HLYA 4LFUA 5D8LB 4WXHA 1AOYA 2O3FA 2XV4S 3RKWA 5L3FA 3ML6A 3ULQB 5LGNA 2XAGA 2P6TA 1KU2A 2QENA 1XB4A 2KIFA 2KJCA 5HLGA 2DU9A 2MH2A 2ZMEA 3H92A 1IXRC 5BS6A 4EJTA 1KQ0A 2IT0A 5CVJA 3I59B 4WXCA 5TRDA 2FEZA 2IPQX 4RAZA 1KQ8A 2QVOA 4Z2YA 2EFQA 4I98B 4UVBA 4RB1A 3WGHA 4AIJA 5E20A 1G3SA 2A6EF 4P96A 1SD4A 1R23A 2FBIA 3EUHA 5ICGA 2W24A 4UVAA 5E17F 2MC3A 3KP2A 1H9GA 2WC2A 2LF8A 1T98A 4KDPA 4U0VA 2L01A 3E6DA 2RQPA 3LWFA 2GXBA 3G3ZA 4BH9A 3TGNA 4O3MA 3CUQB 4KMUX 1NHAA 4BNCA 1WWXA 3M8EA 4DNCA 3E3VA 3J81Z 2NNNA 2HOEA 2ZNYA 1LEBA 4KIBA 4HW0A 1KYZA 3U2RA 2HS5A 2STTA 1R36A 4CZZA 3HTUA 2M30A 2MD5A 4OMZA 2K4BA 2P7VB 2XAJA 5D5XB 2FRHA 3RPQA 2DAOA 1K78A 4NHJA 6PAXA 3B02A 1BC7C 1R22A 4P9UA 2HQRA 4KIGA 3GFIA 5ILUA 2EFWA 5J8CA 1SFEA 3KLOA 3QPHA 2RV8A 2P7CB 4MHGA 5KK1A 2Z33A 3E5UA 4GXOA 3J80Z 2VC1A 1RUOA 3F72A 1GXPA 1E17A 3RIRA 2IJLA 2CW0F 2PBIA 1JHHA 1ZLJA 2EA4A 3CJNA 2V1XA 2STWA 1ZH5A 2ZFWA 3H3UA 4OIQF 4EGZA 4OINF 3KP5A 2V79A 4HDVA 2M45A 3LFKA 3HOTA 5DDGA 1MZBA 5L3GA 1D5VA 1QGPA 4GO1A 3JTHA 3L00A 1R1TA 3FXRA 1I6XA 1YYVA 1STZA 2A5YB 3MAJA 2IVMA 2VBZA 1I1SA 3M1EA 4L0YB 5H20A 2QUFA 1Y0UA 1PDNC 3BWGA 3G73A 1JHFA 2EFNA 2JSCA 1F4KA 3I53A 5E8GA 1F5TA 4MNUA 3J80K 4NB5A 5BPDA 3GFMA 3ZMTA 4G8XA 3V7RA 4GGGA 3R60A 2MA3A 1OR7A 2QWWA 2PMHA 2DO7A 1GHCA 1L3LA 3F23A 3L09A 5FD5A 4I0BA 4B09A 1F1ZA 3KP7A 1FWZA 3FXQA 4CXFA 2DFIA 1PP7U 2DQLA 2JRTA 1OKRA 3R6SA 4Y13A 3P7NA 1PP8F 1B59A 2JPCA 4A6EA 3O6BB 3KFWX 4ENJA 1UB9A 3DQVC 1XGSA 5BPIA 1U5TC 2XIGA 1ZG3A 4L0ZB 3R4KA 5BQTA 3IL2A 1R5HA 2RC4A 2NYXA 1I1GA 4OOIA 2PG4A 5D8KB 5DCMA 1TLHB 2D2WA 4LD5A 5D6FA 2EJRA 2R3SA 1O3RA 2QQBA 2J5OA 4HQMA 2P5VA 2BE5F 2IRFG 2HYFA 5FFXA 1HKTA 4ZYHA 2C6YA
chains in the Genus database with same CATH superfamily
3CDIA 2EV0A 4IPAA 2VOOA 3I4MJ 4LLLA 2VASA 2Y30A 4A5MA 1FYKA 2FBHA 2F5DA 2M1BA 4M9SA 1KA8A 4XLNF 3BLYA 4CGZA 4U7DA 2KKOA 2CQ7A 4BL0B 4HYEA 1IN6A 3BTLA 3BR3A 1S9HA 4LB6B 1WQ2A 2QKMB 3GVAA 3WTWC 3W6VA 1MBKA 1Y56A 2CFXA 3OIPA 1R4NB 3S2DJ 2DTRA 2YX4A 2DCEA 3F9KA 4CCMA 1RR8C 1X4OA 4W1UA 1NTCA 1CF7A 3GMEA 5FLVA 3IRRA 4E4HA 3PSIA 3FIWA 2AQEA 2BBYA 4E7JA 3K0LA 1IN8A 3MCZA 3VYUB 1LDJA 2XUBA 4XORA 1ZRDA 1Z9CA 2DI3A 2W7NA 4JBAA 4YFXF 1VQNI 5TJJA 2ZNZA 3M07A 2TDXA 2R7TA 3P9IA 4I01A 1U5TB 3BPVA 2XPVA 4II3A 4KMFA 2XF7A 2KP6A 1MGTA 2DLLA 5E8IA 4UUSA 3KPHA 3CESA 5EG0A 1BL0A 1Z21A 1A36A 1SFKA 4G7HF 1MJAA 4N4OB 1FBQA 4BDYA 2Y0SN 2WTEA 2CQXA 5GAEJ 4CZCA 3MKWB 1V54H 2Y75A 3HZJA 4BXXJ 4MLOA 3BG3A 5J1YA 2PMUA 1R49A 2PJRB 5FJ8J 1SEUA 4A0XA 2ECCA 3CJRB 2F4OB 4UHTA 3DBHB 2EV6A 3T5XA 5DS9A 1KZHA 2R7DA 5HS9A 2BY1A 4KNYA 4EM1A 2CW7A 4LJZF 5F6FA 3MZHA 2A68F 2FOWA 4XLEA 3NRVA 4HV6A 2HZDA 3ZQFA 3GFLA 4FE4A 1QPIA 3NQOA 4XKVA 4XN0A 1DGWY 4IZZA 4BQAA 3EDPA 5HODA 4QSHA 4WXDA 1YIJI 1R9TJ 2HKXA 5ILVA 1DPRA 2EQRA 4GCVA 4I76A 4A3EJ 5J1UA 2Z9OA 1QVTA 4AUXA 2NS8A 1HDPA 1ETVA 4OWRB 3JR9A 1A6IA 1YRNB 2CYYA 4ZDLA 4KA4A 3I9V2 5HNFA 2BGCA 3M7GA 3DEWA 5FD6A 2D1HA 3FXMA 3ABLH 1HQCA 1FSEA 3IP4B 3AG4H 3RKXA 4A69C 1VQMI 3EPZA 3CQZJ 5IY5H 2FMYA 2LD5A 1Y1WJ 3HOWJ 2G7HA 5FB2A 3FKJA 3GFJA 2CWEA 3HJEA 2HQ5A 2QBYA 1H0MA 2D1VA 4DBRA 3CO7C 3GTPJ 1MW7A 3SZPA 5FKKA 2CGPA 3WTTC 4I2OA 3H5AA 1IG7A 2VONA 2R92J 1A5JA 5M5WJ 4AIKA 2VT2A 3N97A 5CJ9A 3WE3A 2XRLA 4M6YA 1LJ9A 2QCOA 3B73A 1HKQA 2Z5UA 5IP9J 1EJ9A 2P8TA 4Y15A 2TRTA 5DCFA 4QPOA 1K83J 4YFNF 4M74A 3OSGA 3EUHC 4A93J 4V19K 3DTKA 2OQGA 2AXLA 1V5FA 3BG9A 4PCQA 4XKBA 4AWXB 3Q0WA 1B72B 3G4SI 2JRMA 1KONA 1TWHJ 4S05A 2V9KA 3W2VA 3CDLA 3TL4X 2E5NA 5DD4A 2M4GA 2VL8A 2ETHA 2H1LA 2V1DA 1NH3A 4UB8C 2LOOA 2YU3A 2Y9ZA 4G9YA 2QSFX 4PUSA 2HDWA 4LG0B 4RAFA 1JGGA 1IV6A 1V4RA 1HCRA 2VI6A 2DDBA 3R61A 3KEOA 4UY8I 4ON0A 2DOAA 4MQ9F 4E7IA 4Q5SF 3DBLB 1HW2A 2DMTA 1U2WA 1O3TA 2V7FA 4C3JJ 1AKHB 2DN0A 3OYDA 4N9HA 3CC7I 3OS2A 2OQRA 3ZQLA 2QSHX 3BQZA 3WGGA 4AD9A 1QU3A 1UHSA 5D4SA 5JVTA 2DMUA 4BUPA 1RPWA 2A61A 1ZN2A 2JA6J 2G9WA 2UV1A 1FNNA 2WWYA 3G1LA 4ZDPA 3PIOF 2NOGA 2IW5A 4A3DJ 1XDUA 3ESWB 2OCEA 5E1XA 3H36A 4JX6A 5BNGA 3U1DA 4A3KJ 4FX4A 3ECOA 4FHTA 2EWNA 5FGMA 2VJJA 3HUGB 4Z6YA 5LEJA 2EZLA 2KRFA 4EGYA 1B8IA 1VZ0A 5FLXK 1I3AA 1B9NA 4ABZA 4Y52J 2QQ9A 5IT3A 2Z3YA 1GXQA 3SFZA 4V2FA 1ZGJA 3V8JA 2P6SA 4HV5A 3KZZA 4A5NA 4NUBA 2HOSA 4R8HA 2B63J 1S7EA 2UZKA 2G7UA 2IAIA 1YO5C 3JRBA 1VQ7I 2R4GA 4NNJA 3WE2A 4BHPA 1LQ1A 2UXNA 1T0FA 5F0FA 1Z3XA 2IA2A 4AIHA 3CCYA 4L18B 3K4JA 9ANTA 2X48A 1O7FA 3UR3C 3GLXA 5J4YA 1S8NA 2FMLA 1MMAA 1WKMA 1BW5A 5HDNA 3CUQC 4WK8F 3T1BA 1K61A 1QNTA 2Y48A 5B1BH 3W2WA 3AG1H 2RN7A 3OR1C 3SEZA 3I4NJ 1W36D 1H89C 3W3CA 5IT9K 1QZZA 4XRFA 1D1AA 4MFDA 3S32A 4DZJA 2BY2A 4UVCA 3E97A 3WTZA 2PEXA 2DXIA 4HDUA 3QWLA 2QYOA 2Y69H 2FBKA 4W97A 3D5SC 5CVVA 4F7ZA 2DA6A 3OS1A 4PK4A 2DT5A 3RZDJ 1ZAOA 1FT9A 2NRAC 4K2EA 1PYVA 4U7BA 3HBLA 5K5OA 1UHMA 1X19A 1ETOA 3DP7A 3JAMZ 3DFGA 3G1MA 4P5OA 5F0CA 4EJWA 3ECHA 1RR7A 4IJAA 2X0LA 5JFRA 2L7FP 4G6QA 1MNDA 1QZYA 2E1CA 3L2UA 5DUIA 1OFCX 2A6HF 1WJAA 4IXAA 2LBFB 2UWMA 4DOZA 1IAWA 2M7AA 1PUFA 1J2XA 1T38A 4BS9A 2X9DA 4IRIA 2ELJA 3A01A 3AG3H 2F6CA 4KN4X 4N4NB 2CUJA 1WRJA 2BHYA 3M4OJ 3G2BA 1JTXA 2O9LA 1EKEA 3H9JA 2LYCA 1YI2I 3S16J 4I02A 1A31A 2CV2A 4YIIA 5LRSA 2OJED 3A03A 1IN7A 3K4BA 3VYTB 4E7KA 2PFBA 1T56A 3C1DA 3P9KA 3VYRB 3K2ZA 1R00A 1X1DA 3ABMH 4PFPA 3DLAA 1IC8A 1XD7A 3BJ6A 1G3YA 3I0TA 3KCCA 3ZQGA 3HOXJ 1LVAA 1YHQI 1P4AA 1Z7UA 5ICEA 2HU9A 4LLNA 3H9QA 4EQQA 2H8RA 4BY1J 1T39A 1P4XA 4LMYA 3FX3A 2V9PA 5LEKA 2HPMA 1WH7A 4XLAA 1ON1A 1T33A 3V42A 1AHDP 4BQOA 4BQQA 1ZG5A 1SAUA 2FUG2 1TWFJ 3GX4X 3S3OA 2JWTA 4KISA 1IN4A 3KP3A 4GYIA 2JZYA 1SVMA 1I39A 1KU9A 1WJCA 4ETSA 3PNYA 1KU3A 1C0WA 5EZHA 2GIVA 1MBGA 1X58A 2DMNA 3F21A 2QQ8A 4PJJA 3S17J 2CU7A 4A3GJ 1WJEA 3ZMSA 2P5LC 4IOAF 4NC7A 3HRSA 3BY6A 2CQQA 2DJIA 2QM3A 4L9TA 3SQNA 1CQTA 2MH9A 4HX4A 1EH6A 2ZFUA 3HEFA 4RAYA 3S3NA 3VPRA 4ZZDA 4F55A 3KETA 2ACJA 1JT0A 2GQQA 4G12A 1J5YA 2GZWA 2YS9A 2ZB9A 4UV8A 4KUMA 2FQ3A 2FA5A 2GIZA 3E6BA 2IS1A 3L2WA 1FBUA 1OMIA 4M3DA 3G71I 4A3JJ 1HXDA 3HHHA 2J5PA 4CYCA 4GDFA 1EH7A 3CD6I 4WF2A 1CGPA 5D5UB 4UNOA 1LKXA 2L54A 2LR8A 3FISA 1WH5A 1VQ9I 5FROA 4J01A 2YU9J 4WX9A 5AIQA 5D5WB 3I59A 2K9SA 3V8KA 1S5LC 1P2FA 1D0ZA 3S1RJ 2X4HA 3E5XA 3JRHA 1YITI 2EPFA 4KYWA 4M9XA 1BIBA 3IH3A 3BG6A 1MBEA 2F4IA 2R7QA 4MFEA 5LGUA 2O03A 4BHCA 2K40A 4RGXA 2W84A 1B1BA 1OYWA 4I0AA 3C2GA 1J75A 3S2HJ 4XICA 1ACIA 1MD0A 2R5ZA 4DW6A 4UV9A 4P9FA 2ICWG 1XSVA 2L7KA 3IV5A 2CRGA 5C3EJ 3J81K 2IGMA 3DKWA 1YG2A 2KMUA 2O8XA 4L5IA 2E71A 3DEUA 1EV7A 1Y39A 1UMQA 2DOFA 2XF5A 1ETXA 3QOPA 3O3KA 1IZ1A 3BZKA 1FYLA 1ERDA 3LMMA 1I6HJ 1J0RA 2MW8A 4P1WA 3ZQHA 1OYYA 2FQ4A 2KRCA 2XAUA 3T8TA 4A3MJ 1Y8RB 2WAQN 4EV0A 3TW6A 2X6WA 3ASOH 4HA8A 4M6XA 4IHXA 5L3CA 2F4MB 1FC3A 2DQRA 3CF5F 1U3EM 3IC7A 2XRNA 2D45A 3GZNB 1MKMA 1FPQA 2K4JA 1W5TA 2VKEA 4S0HB 2ZC2A 3EYIA 2Z16A 3OYLA 3ABTA 3CCUI 1N75A 1RIOH 5DCMB 1R71A 1P9QC 4C3HJ 3FMRA 2OV7A 4YG2F 3MKLA 1R58A 5FFZA 2EK5A 2WBMA 1U78A 3UKGA 5F27A 1RKTA 1WI3A 2EFPA 1X3WB 1FMWA 3DPUA 3K4KA 1SAXA 3GTLJ 3QPLA 2FU4A 2JPBA 4CCLA 4JX5A 4OIOF 4YIFA 3CCMI 3K9TA 3G6EI 3I3LA 5FLMJ 1HBXG 5H6QA 2E1OA 1A6QA 5KVRA 2RAEA 4IHYA 1FYMA 2ESNA 2GLOA 3WGIA 3P9CA 1OCCH 3D5RC 1SFUA 3F3XA 3IUOA 4O5VA 2GWRA 3OYAA 2XGCA 3PL8A 4DJAA 4B1RA 1PVEA 2DODA 2P4WA 4XLHA 3HXLA 4AC0A 5JR3A 4H0EA 1MDMB 1UAAA 3FXUA 5EGOA 2DA7A 1ZRCA 1FP1D 5J4VA 4JQFA 1UHWA 3ZCOA 5HLIA 3HSRA 3LQQA 3OIQA 2AO9A 1ZR2A 2IBDA 2B0LA 2R7FA 4BQNA 2Z1DA 4XBFA 1WPKA 2DYSH 3KYDB 2CQKA 1NG7A 1YQAA 2E36A 1Z05A 3OYHA 4PDKA 4RLFA 1TTYA 3LA3A 3COAC 1VQ5I 4UUTA 3EYYA 4BEHB 4XKCA 3F0CA 2H6BA 5L3BA 1Q1VA 3OYIA 2R7ZJ 3TBIA 2LVSA 2K3FA 3CDHA 1IXSB 4J00A 5EEGA 3KZIC 2ID3A 3WTYC 4MQVA 1YW8A 5B5EC 1LDDA 2DK8A 3FHZA 2E19A 1DDNA 3FF5A 1BJZA 2OPTA 1ZQ3P 1FMVA 3L2VA 3B6CA 3BDDA 2JSPA 2CUEA 4D7MA 5D5VB 1J59A 2LY1A 1SMTA 5F1RA 1P7IA 2JN6A 2K3PA 4HAMA 2MYSA 1RETA 4HZFA 4F93B 1BOBA 3JRAA 1QO0D 5EG0B 4HNUA 4ZYEA 3ELKA 4HBLA 1XN7A 3JSOA 1A35A 1Z6TA 2L0KA 4YEJA 2JVHA 3LSKA 1G3TA 2A6TA 2BXYA 1W7PB 2XSDC 3QU3A 1R1VA 1S29A 4L9VA 1FX7A 2BVLA 2JUGA 1YLFA 1S7AA 3SDGA 1Z0XA 1D5YA 1VTNC 1O3SA 2M5WA 3BROA 2EB7A 5CVIA 2M4KA 1HSJA 2F5VA 3RTRA 1VF9A 1WI9A 4DGWB 3I4PA 2COMA 1G8XA 2F5CA 3ABUA 1ETQA 4IF4A 4G7ZF 4CCKA 2E5ZA 3BT9A 3VOEA 1I27A 3CCQI 3BZCA 5C4JJ 2KIMA 1SD6A 1B4AA 3PO2J 2L2OA 4IVNA 1BJAA 1TW3A 2HNHA 4Y17A 5M5YJ 1K4SA 3HSFA 4ZYGA 4CA0A 1OPCA 4NQWB 4WWCA 1IRXA 4MGRA 3OR2C 5KCMA 4RB3C 5CYVA 4A3FJ 3DBRB 4XLCA 1OCRH 1GLNA 2GAUA 2VQCA 1MSEC 4BAYA 3LSJA 1F9NA 3OYEA 1WFXA 2L3DA 3FMQA 2LKPA 2W25A 3PJRA 3QU6A 2ZO4A 2KIQA 3QYFA 4I6ZA 2QBYB 3MKZA 4G7OF 3F6VA 3MZ8A 5GPAA 3CLOA 1K6OA 1SC7A 2R7SA 3CCJI 3WTXC 2Q2EA 3PUBA 3M1CA 4NDLA 4BXUA 3LNQA 2ZXJA 3HRMA 2VLAA 4ZZLA 4HQEA 2RNGA 2VXZA 4HX7A 2NNYA 3DF8A 1R7JA 5IYBJ 4M3EA 1ZKGA 1OYIA 1K4TA 3Q5FA 3JRCA 2CUZA 3CF2A 5ICFA 1WJ5A 3OYJA 2KPMA 2UXXA 3DCFA 4HF0A 3E1SA 3LAJA 4EMSA 1B6AA 2XVCA 3VEPA 1I3QJ 3V8LA 1T6SA 3IRQA 2W4SA 2A5WA 3Q3SA 4RGSA 1BW6A 3DKXA 1G59A 1FZPB 3HPGA 2Z2SB 1L0OC 1LDKB 1J09A 1SVLA 3PM1A 4D7NA 1S72I 2RDPA 1XC5A 2HEOA 1ZARA 5GTHC 4N9IA 3CTAA 1YTYA 4A2UA 3KEYA 3VODA 3Q0UA 4RS8A 3SZTA 1W5CC 1DPUA 3TDZC 4EJUA 1BOAA 1D8KA 3GEZA 1USTA 2BW3A 1D3YA 2BY0A 1HF0A 3SEQA 2ZMEC 2D5VA 2F5EA 3F6OA 1HW1A 3GZ6A 5M5XJ 3OV8A 3DLLF 3HTSB 3QAHA 4QIWN 4RAGA 4IQ4A 3SXYA 5D6EA 3K69A 3CO6C 3BR1A 2VN2A 3IWFA 2ZKZA 1JUPA 1UJ8A 2ELHA 3MD2A 3OYBA 3M3YJ 4A3BJ 4IHSA 2EA2A 2M8EA 3GWZA 3KE2A 4XOPA 2R7OA 5K7ZA 2EZHA 4B48A 2TCTA 2PJPA 5IYDJ 3GLLA 4RMNA 2IA0A 1FTZA 2LNBA 4D9JA 4LK1F 2HGCA 4DYQA 3S93A 2LTPA 1FIAA 1G6NA 1UZCA 2Q1ZB 3ZQIA 2EIKH 3LQRA 5JVGF 2NVXJ 3QRFF 5LFAA 1B8IB 5GADJ 1IRFA 2ESHA 3Q9SA 1BR1A 4II2A 4CH7A 3GTMJ 1VQOI 2EBIA 2ZCWA 1YW7A 1BC8C 2CG4A 3WTVC 2HYGD 5HNHA 2YPRA 3C2BA 2CH0A 2K9LA 4PGGA 1J7KA 3FXJA 4FTHA 3C18A 1TNSA 1TNTA 4M71A 4UXNA 3ZQ7A 3S8PA 3OOUA 4FETA 3ZR8X 2LLKA 3KYCB 1JUSA 1S6LA 4FQGA 3TDUC 1FY7A 3TW7A 4A0YA 1FP2A 2MGQA 3CLQA 2JVGA 2MBFA 4BKXA 1Y6IA 3FKIJ 3E5QA 2PJRA 2VQGA 1XSDA 5EEHA 2HVRA 3OL3A 4ZJZA 3OMYA 1D0YA 5GAGJ 3KLNA 1FSHA 3W6JB 4RB0A 3HGGA 1NG6A 2QKLB 3F8MA 4I09A 5HS8A 3MFKA 4XONA 3F8FA 4ASNA 3QYEA 2HVQA 3HSEA 2ID6A 3HKZN 3QQAA 3NEUA 1T2KA 3BZ6A 3ASNH 1O3QA 1Y0NA 3MWMA 2PX9A 1JJ6C 1I50J 3I71A 2VE8A 1FOYA 1R5ID 1LE8B 4N0BA 2DK5A 4XQFA 3WG7H 2ZMEB 2VOPA 2XB5A 4XLPF 3K6GA 2K9QA 2P81A 2E2HJ 1WJBA 2NS0A 2EINH 2VC0A 5DM6F 3J7AO 4B8XA 2VE9A 5E1WA 3WTSC 3A01B 4S04A 4HF2A 2XAHA 1QPMA 1UCRA 3VFZA 3WTUC 5K7HA 1XDSA 4KT5C 2DJNA 2DDAA 3J7ZI 3RYRA 3I56I 2LSOA 2WAEA 4BHBA 3P5JA 3ERED 2ME0A 2GOXB 3GO5A 3K2AA 5LGTA 5D4RA 3KYLA 5E18F 3DPTA 3T0YA 3F8CA 2L9SA 3FM3A 1QHGA 2N8GA 2VBXA 4BYYA 2VB6A 3HOYJ 2BV6A 3L9FA 1BA5A 2FSWA 5EEAA 4QTRA 3L7WA 3BCAA 3S2WA 3DEEA 3NAUA 5C4XJ 1Y1VJ 2B7EA 3LSPA 3PIPF 2R7VA 5HVQC 3W6KB 1S7OA 4OAYA 2R7WA 2FXAA 4OAZA 3TOBA 3DU6A 3RYPA 1O57A 1ZRFA 1BM9A 2RKHA 1G3WA 4ITVA 4L9JA 1MJBA 5EF6A 1SANA 2PI0A 2IS2A 1D0XA 1XGNA 4XSZF 4BE0A 1BI2A 2E1NA 2GA1A 1VFCA 5CVUA 5H2FC 3BG7A 1HC8A 5IP6A 1TBXA 4R79A 4LG0A 3TQNA 4CSWA 2ZBKA 3FK7A 3HOZJ 1ON2A 5E1ZB 2XASA 2CSOA 2LMDA 1AKHA 1DU6A 3CMEI 4JK1X 1VI0A 2LG4A 2WV0A 4L5JA 1UG0A 1X4PA 4DYRA 1QHHD 4WCGA 2WB1N 1X1PA 3NARA 5LLQA 1WCMJ 5CVRA 1Z91A 4BACA 3DXJF 2PLYA 1OR7C 3K4NA 1K78B 3S1NJ 1IRGA 1WVRA 4Q4ZF 4EM0B 4GRIA 1K6YA 3IH4A 2Y0MA 3BJOA 2MLGA 1H8AC 5HOOA 3C7JA 3CJQB 2MD0A 2KQRA 3R0AA 2JA2A 3VSLA 3DPLC 3MN2A 4CYCB 4E7LA 3V7SA 3HUGA 4U0WA 3A2KA 4ESFA 2L9NA 4RLQA 4BJ5C 1G4DA 1JTYA 5LHHA 1YS6A 3JCUC 3HDDA 4FASD 1IUFA 1DQUA 3K4LA 3QPTA 3UNGC 5JI6A 2EIMH 1GUUA 2VJ4A 1TWAJ 4XK4A 3TMOA 3OL4A 1ZHFA 4JOMA 3GW2A 1JT6A 1SMYF 3MZYA 3JREA 1D8JA 2R93J 1P92A 5JHUA 3IAM2 1T08B 2PQ8A 4M6VA 4GYGA 2ZXIA 3WHCA 2R5ZB 1GVDA 2PMZN 3JAMK 2KDOA 2W57A 3ZN1A 2O6GE 3FDYA 2KL4A 3KP6A 1VQLI 3H5RA 4LIUA 1JGSA 4D1QA 1OCZH 4G6DA 2NOJB 5HDGA 2HFHA 3K70D 3BQYA 3KZYA 1VNDA 2LREA 4PGHA 4XMYA 3I5UA 5K5QA 3K4CA 3QP5A 1ETWA 2CFOA 5F1JA 3M8FA 1HKSA 2IGOA 3IH2A 3OYNA 3N05A 1KQ9A 1WJDA 3G1OA 4LGWA 1XCVA 4ZYDA 3D1NI 4P55A 2M34A 4ZYAA 4Y33A 5GTIC 1SD5A 3CCEI 5BMZA 5K7FA 3ABKH 4XIDA 3ONQA 2VT3A 3RKYA 5DM7F 1MNMC 1DUXC 3QOEA 5E3OA 3CC2I 3D5LA 5B3SH 4OIPF 3SFIA 1TP4A 2P5KA 5CQEA 5L3EA 3PNVA 3E0JB 4FT8A 1TQPA 3FMSA 3GTJJ 5FO5A 2BEOA 2LBFA 2Y0SA 5LHIA 2RNJA 2QEXI 3HPHA 1X2MA 4OMYA 3WU1B 4DZPA 1BIAA 2VKDA 2DT6A 3F8BA 1OCPA 1V3FA 2FF4A 1ZELA 2HZTA 4IO9F 2K7LA 3LA2A 5E3LA 2V1NA 4MIMA 2XAQA 1FOKA 1XMAA 5JLXA 2RQQA 2KT0A 2VODA 4AYBN 2ELKA 3IWZA 1W1WE 4TV7A 4AU7A 3HRUA 4PJNA 1ZTRA 3BTJA 2ME6A 2BY3A 4ESBA 1YS7A 4FCYA 4XL9A 4UUVA 3F8NA 3MVPA 2YUSA 5M3MJ 4XRSA 4RDUA 5ILSA 2H94A 2K9MA 2XB0X 2DOEA 4H4KC 5LHGA 2DTZA 4PSWA 4XR6A 2VUMJ 1UFMA 4ENKA 2DFHA 3K4MA 3DV8A 4MEXF 3FHNA 2IGKA 4HX8A 4CICA 2IP2A 2OAZA 2VPRA 4M3FA 2RGVA 5K1YA 4EM2A 3JTGA 2VJ5A 3OWTA 3F22A 2HKOA 5J6XA 1ENHA 3LSIA 3WHBA 1PUEE 3BTCA 2M87A 1LB2A 3KEQA 5FRMA 2W00A 4CCOA 3H0GJ 1JKOC 1YW9A 1BI3A 4O6JA 3KP4A 4PFOA 2DYRH 5AONA 4U88A 2V1UA 2Y31A 3CUQA 2R0QC 3GZ5A 4M73A 2VIXA 4E7HA 2OU2A 1Q1HA 4CHUA 2IEKA 2H09A 4RGUA 5F64A 5CLSA 1S3JA 2V6CA 1MH4A 2OZUA 3H3ZA 2GXAA 1AU7A 1N25A 2K02A 2LP0A 4KN7X 3BCBA 2XSJC 4A3CJ 1X3ZB 2GA2A 1BN5A 1ODDA 3TOAA 1G2HA 4DQ2A 4KIFA 1TT5B 2HQNA 3OIOA 1E3HA 1ZLKA 3ZMZA 5A2QZ 2LY9A 2OA4A 3ZN0A 1ETYA 1TZLA 1HW5A 4KJZA 2NVYJ 1GV5A 2CS3A 2K27A 2A69F 4LITA 1I5ZA 3FZVA 4F91B 5E3NA 1W36C 3LOCA 3TEDA 3GYHX 1IO2A 3GBGA 2VQLA 2HXIA 4DYCA 4BBSJ 5L3DA 4E70A 1MBHA 3EQLF 1JE8A 4Y3OA 3BOQA 5HDKA 2M9HA 1Z6RA 3ZMDA 1T95A 2DFFA 2DT7B 2ZJRF 1ZGAA 2L9RA 3LSTA 3LSHA 1ULYA 2IS6A 1MMNA 3A0BC 4HRIA 4KICA 1OISA 3CMYA 2BVMA 4ENMA 2FE3A 5CQGA 2W1OA 3FBNB 4Y4RA 3VYSB 5TGTA 1XMKA 2O7OA 3HKZA 3I64A 3D0SA 3M9AA 4F92B 1YJ9I 1WSUA 2HDDA 3V4GA 2EILH 4XRMA 2XDVA 1XCBA 4XRSG 1ZREA 4EATA 2DW4A 2QQAA 3BPXA 4CDGA 2DFEA 3B6AA 4C3IJ 1CF7B 2X85A 1F36A 2RREA 5EDNA 2KZVA 2DA5A 1GVJA 2F2EA 2O5RA 4ESJA 4A12A 1SD7A 4OIRF 1WZ2A 3AFHA 2MG4A 2E7XA 3W2AA 3NWTA 2L4MA 2M0MA 5A2QK 3AAFA 2I10A 1XPXA 4X1EA 4IKFA 4DBQA 2MLKA 5DV5A 4EJVA 3JRGA 1U8RA 5J8FA 1QVUA 3JRDA 1P7JA 2OZ6A 4EJOA 4UUSB 2KIUA 2XHKA 1K7AA 2H8WA 2OTLI 3EUKL 2M2EA 1YX5A 3ZGKA 3LSMA 1HOMA 4EEFG 3JRFA 2OBPA 3GTOJ 2V6EA 3RPUA 4C2UA 2NVUB 4BJ6C 2E7WA 5FKLA 3HHGA 3PSFA 2XAFA 2NAZA 3OS0A 3LSRA 1IF1A 3HIFA 5JLWA 2B9SA 1AWCA 3CCVI 3H3VK 1OCTC 2OC6A 1JUMA 2WV1A 4HF1A 1FEXA 4RGRA 1IDYA 3K1NA 3IKTA 1IN5A 1OJLA 3ZMVA 1BR4A 2KISA 2QLZA 3TO7A 1ZG1A 4BJTA 1DP7P 3PO3J 3BJAA 1TW2A 2DPDA 1T8IA 5BOXA 3FXOA 2O0YA 3S1MJ 3DTIA 3GTQJ 1REPC 4F52A 1GV2A 2LFBA 3CCRI 1B9MA 3FK6A 2BXZA 1ZGWA 4X6AJ 3DTEA 2HTJA 1TQIA 2LK2A 4AVPA 2GXGA 1BI1A 2BW3B 1MDMA 4IHTA 2XPUA 4ZH4F 3PQJA 2AQFA 1QQIA 1UG2A 1RNLA 3TP3A 3WODF 4CO8A 1R4MB 2HQAA 2CO5A 4LIVA 3GUDA 2L5QA 2HR3A 3V7CA 5DUKA 4ENNA 1VQ4I 2UUZA 5DEQA 2HYJA 5ERIA 2WB1A 3S14J 3JSPA 2H27A 2K86A 4DIQA 2DBBA 2OCCH 4BEHA 3U9GA 2F48A 1D1BA 4J19A 2ZJ2A 3R0JA 3JW4A 4MTEA 4L9NA 1ITYA 1E0EA 1XGOA 1XG1A 1T0FC 2CW8A 3IAS2 2LDUA 2JA5J 5LRRA 1RZ4A 4FX0A 4XSXF 5E3MA 2VXDA 3CP8A 3ZQQA 4D0PA 2L4AA 3ZPLA 4KITB 3A0HC 1ONVA 1YFHA 3A4CA 4BXFA 1M1EB 1OCOH 3RJPA 1FOWA 2FNPA 2Q0OA 2HDCA 1U9OA 2XROA 5IPAA 1K79A 2XGXA 4CYDA 5TISC 3T8RA 4YIRX 1IXCA 2ADUA 1IDZA 4B4CA 5IP7J 1MMGA 2R5YA 3BR6A 2YX7A 3TO6A 3S15J 4IHWA 5HLHA 5AIPA 1IJWC 1KGSA 2JMWA 3I58A 1Z1DA 4IRHA 1W7PA 3KX2A 3TKYA 1XGMA 3WU2C 3H5NA 2PMZA 2VPLA 3ZXSA 4Q48A 4RM2A 1E2XA 2LF7A 1WJFA 4LLGF 4CCNA 2ZXWH 4PSXA 3J7AY 3CCSI 3RQIA 2YR2A 2EIJH 2VJIA 4HNVA 3ZRGA 3ISPA 2HOAA 1LVKA 1RESA 2JT1A 1TWCJ 2VBWA 4C2MJ 2I5UA 1MMSA 1IW7F 2NVQJ 4NC8A 1FIPA 2H6CA 2A07F 3GF2A 4RB2C 5KNLA 3HOUJ 4IRGA 3K10A 1OLTA 4M72A 1RUNA 4NQWA 1U9NA 1ORKA 5FKOA 2VKVA 3FBIB 3IHUA 4MO7A 4IQJA 1LFUP 2MC4A 1IUYA 2VKHA 2KLOA 2A3SA 3N4MA 4YFKF 2OF7A 1IV8A 3SJMA 5EZGA 2E2JJ 2ISZA 3K1PA 2DA3A 1LNWA 2EFOA 1BI0A 2GOMA 1FLIA 3ROUA 3HGYA 3HRTA 1RRJA 1U5TA 1VQKI 3HYIA 4XM3A 1MMDA 5LBQA 4EVIA 3FXKA 1Z67A 1HSTA 2F5FA 2VBYA 3CC4I 4ZC3A 1MJ9A 1LPQA 1YOVB 2FOKA 1P4WA 5F08A 4AYBA 1A04A 3L2RA 1P6RA 2XGEA 1POGA 3RPUD 1QA6A 3LA7A 2NVTJ 1BBYA 3SYTA 2LRDA 1J9IA 4A6DA 1W0TA 2W85A 5DD8A 2QZ8A 4V2GA 1N78A 4I7HA 1JI8A 2EV5A 2QF7A 1ZYRF 5JHFA 5LD2C 2ISYA 5FLXZ 3OYFA 5F04A 3OYKA 1GT0C 2FX0A 2HXOA 2FNAA 1BR2A 2E60A 2RVCA 2WY8Q 3E6CC 4KFCA 4D5FA 4HOBA 2O61A 3OSFA 3EETA 1RI7A 4B43A 4E7ZA 1R5GA 3E6MA 4G6TB 4XOTA 5DYMA 2KJBA 1VQPI 4R1HA 5ED4A 3RCOA 2HWVA 3HM5A 2XKOA 3LL7A 4B3XA 5K5RA 3ZP5A 4U0YA 3RI4A 4BGDA 1DGRM 1H9TA 2WAQA 2M3AA 3L2CA 4AM3A 1FBSA 3CZ6A 2V9VA 4M9ZA 1YIOA 2Q8KA 3RDIA 3REOA 4C9YA 2I8DA 2ZSHB 2IA1A 3O2PE 1YRNA 4Q47A 4AIDA 4X0GA 2K9NA 2JTVA 1TQMA 1OQYA 1RC9A 1W5SA 1EH8A 3WG9A 1FJLA 1MNEA 2AS5F 4CUGA 3I55I 2KDZA 5J40A 4JP0A 4PJMA 4YELA 1PUFB 5IT9Z 3Q9VA 2W48A 3GXOA 3K1MA 5KAFC 3BP8A 3MQ0A 5HLTA 1MBFA 3L1PA 4B44A 3SHFA 3OYGA 3PFIA 2V4JC 3SZGA 1LEAA 2XC7A 3GTGJ 1R6RA 2X6YA 5KAIC 1XSXA 2A05A 3AKZA 3ZMUA 3HL2A 4IL6C 3CUOA 5DTDA 5FRNA 1APLC 2HTSA 1JXSA 2M0CA 3OOPA 2E2IJ 2BYVE 4LB5A 1Z3YA 3FM5A 2DPUA 2E34A 5GP9A 4LK0F 3LAPA 1JKPC 2VQHA 1U0JA 4PZJA 1USSA 4QWQA 1SFXA 3C3WA 4PJLA 3WU0A 1F43A 1LFBA 2M8GX 1QRYA 2XKPA 2PN6A 5IOZA 1X3UA 1RKWA 2NXNB 4D5CA 3PQKA 2LKXA 4Y7NJ 4A0ZA 4HLXA 3DU5A 3IKVA 3S1QJ 1B72A 1Y8QB 4B3AA 5H6RA 1U8BA 1W4MA 1AA7A 2H1KA 2OD5A 1W7PD 5HS7A 1QBJA 4MTDA 2JK3A 3ZQCA 4QLCU 4IEJA 1U6GA 1O7LA 1YJWI 3PNTA 1SFOJ 2X1DA 4B47A 2L02A 2JA8J 2LH9A 2MFZA 4MEYF 4IX7A 2CJJA 2YSRA 4OU0A 4IOCF 5GPCA 1H88C 4HPQA 2HOTA 3I54A 5ICCA 3QP6A 1R1UA 3S3MA 1HDDC 3QYBA 3VB2A 3HOSA 2Z99A 3FWEA 3MEXA 4G94A 1KU7A 2X6OA 3H35A 5CKTA 3TO9A 1KYWA 1D1CA 4HLYA 4XKWA 4JX4A 4LFUA 2QA4I 3HC7A 2R7UA 1TWGJ 5D8LB 5FKMA 3A02A 3CJTB 1DP3A 4WXHA 2DA1A 4C30A 4BDZA 4I99C 1AOYA 2O3FA 2XV4S 5GAHJ 3RKWA 1X1BA 5L3FA 3ML6A 3U21A 3ULQB 2IXSA 2KRHA 5LGNA 2XAGA 2P6TA 1KU2A 3OYMA 2QENA 1XB4A 3O8HA 4HEA2 2KIFA 1LE8A 2KJCA 2XF6A 5HLGA 2DU9A 2MH2A 2ZMEA 3H92A 3VDXA 4L5EA 1IXRC 5BS6A 4EJTA 1KQ0A 2DA2A 2R7XA 1LFPA 2IT0A 4UB6C 2WADA 3CP2A 5CVJA 3I59B 4BBRJ 4WXCA 2XPWA 1PJRA 2IS4A 3RKQA 5TRDA 2FEZA 2IPQX 4RAZA 3K7AJ 1KQ8A 2QVOA 1MBJA 4F3QA 4Z2YA 3CMMA 3AL0C 2EFQA 4I98B 4UVBA 1ZR4A 4RB1A 3WGHA 4E7SA 4AIJA 5E20A 1G3SA 2COBA 4RBOA 1Z7LA 2A6EF 5B1AH 2HPIA 4P96A 1SD4A 2EZKA 1FTTA 1R23A 2FBIA 3EUHA 5CPRB 5ICGA 2O8KA 4AVZA 2W24A 4UVAA 5E17F 2MC3A 3BR0A 3KP2A 1H9GA 1TT0A 2WC2A 2KHMA 5J1RA 2XGDA 5KHDA 2LF8A 4XN3A 1T98A 5J3LA 3RSNA 2QSGX 1Z77A 4KDPA 2M7BA 4U0VA 4KT6A 2L01A 3E6DA 3BC8A 2RQPA 3HB9A 3LWFA 4JYKA 4BY7J 2GXBA 3C2HA 1MH3A 3G3ZA 3TGNA 4BH9A 2JQ7A 3L2QA 4O3MA 5E79C 3CUQB 1N77A 4KMUX 1NHAA 1WGXA 4BNCA 1WWXA 3M8EA 4DNCA 3E3VA 3H0DA 1V5GA 2EZIA 1NK2P 1TL8A 4A3IJ 3J81Z 3GCMA 1SVOA 2ZNYA 2HOEA 2NNNA 2L7MP 4HW0A 4KIBA 1LEBA 2OUMA 1KYZA 1WHUA 2WY7Q 3DKYA 3U2RA 2HS5A 2WA0A 4LOCA 4NBQA 2STTA 4IHVA 2X1EA 1HA8A 3TP0A 2R7RA 3LSGA 1R36A 4CZZA 3HTUA 2M30A 2MD5A 2DA4A 4OMZA 1IRZA 2K4BA 2P7VB 1JKRC 1MIJA 1X1CA 2XAJA 2ZSIB 5D5XB 2FRHA 3RPQA 2DAOA 1K78A 4ZTFA 4NHJA 6PAXA 3B02A 1BC7C 1R22A 1YX3A 4P9UA 2JA7J 2HQRA 4KIGA 4BU2A 3M8JA 1VQ6I 4HG2A 4NC6A 3GFIA 1EF4A 5ILUA 2EFWA 2V26A 5J8CA 3U1KA 3GTKJ 2CUFA 1SFEA 3KLOA 2MABA 5IYCJ 1YE9A 3E7LA 4YRVA 3PFYA 3QPHA 2RV8A 2P7CB 5FKNA 4MHGA 2FJ1A 5KK1A 5EGOB 2Z33A 3E5UA 3VWBA 4GXOA 3J80Z 2VC1A 2X6XA 3PUFA 1RUOA 5J47A 2FD5A 3H9GA 2HI3A 3F72A 2LKSA 1GXPA 3RIRA 1E17A 2IJLA 1TC3C 2NS7A 2CW0F 2PBIA 1JHHA 3AG2H 1ZLJA 1MSFC 2EA4A 3CJNA 3AL0B 2V1XA 2STWA 1ZH5A 3A1YA 2ZFWA 2HVSA 3H3UA 1ETKA 4OIQF 4EGZA 1E3PA 4OINF 1O4XA 3KP5A 3NWSA 2V79A 4HDVA 2K85A 2X51A 5EYRA 2M45A 3LFKA 3HOTA 5DDGA 1MZBA 5L3GA 1D5VA 5C44J 3BTIA 1QGPA 2KFDA 3FXLA 1V5EA 4BE1A 4GO1A 3JTHA 3L00A 1R1TA 4U87A 4M3BA 3FXRA 1I6XA 1YYVA 3RQ4A 1STZA 1XX5A 2A5YB 2E1MC 3MAJA 2IVMA 2VBZA 3OYCA 1I1SA 3M1EA 1X1AA 4L0YB 5H20A 4QPQA 2ZJQF 4XNFA 2L7ZA 2QUFA 4ANJA 1E3OC 1Y0UA 4HSRA 3DWLE 4GFBA 4M3GA 1PDNC 2DMQA 3BWGA 1JHFA 2EFNA 3G73A 2JSCA 3LFUA 1F4KA 3I53A 4ZDOA 1XS9A 2BZTA 5E8GA 3VSKA 1F5TA 4HNTA 4MNUA 2GBYA 1NK3P 1IGNA 2CQNA 2Y9YA 4NB5A 3J80K 5BPDA 1VQ8I 1YJNI 1XTAA 2AXTC 3GFMA 3ZMTA 4G8XA 3V7RA 4GGGA 4FE7A 2ZJPF 3R60A 2BOLA 2MA3A 1OR7A 2QWWA 2PMHA 2QGUA 2DO7A 2KZGA 2P0WA 3OY9A 1L3LA 1GHCA 3F23A 3L09A 1ZK8A 1GDTA 5FD5A 5F0HA 4I0BA 2AHQA 4ZTJA 4B09A 2GM4A 4CCJA 1F1ZA 3KP7A 1FWZA 1V55H 3O8GA 3BG5A 2BHZA 3FXQA 4CXFA 3ZOBA 3CMAI 2JJ7A 2DFIA 1PP7U 2DQLA 1JJ8C 2JRTA 1OKRA 2JUCA 3H1CA 3MMYB 3R6SA 4E6KG 4Y13A 3P7NA 1PP8F 1B59A 2JPCA 2CMPA 4BE2A 4A6EA 1W0UA 3O6BB 3KFWX 4ENJA 4FISA 3ERMA 5B66C 3EUAA 1UB9A 2LC2A 1XMXA 3DQVC 1XGSA 5BPIA 1U5TC 2G0EA 2MSYA 3MKYB 2XIGA 2DMPA 1ZG3A 3BR5A 4L0ZB 3QPSA 3KIOA 2W82A 3R4KA 1X2NA 2ZXHA 3X2QH 5EJCA 5BQTA 3IL2A 2Q2EB 1R5HA 1LUJB 2RC4A 2NYXA 3RZOJ 1FOXA 1I1GA 2EH3A 4OOIA 2PG4A 4RA2A 5D8KB 2OTJI 1QZEA 1UELB 1EA3A 5DCMA 1TLHB 3SDBA 2D2WA 4LD5A 5D6FA 2EJRA 4C2TA 2R3SA 2E1MB 1O3RA 3QODA 2WAFA 2QQBA 2J5OA 3BR2A 4HQMA 2X1CA 2P5VA 4LG3A 3CCLI 3JRIA 4PJ0C 2BE5F 2L9VA 2CV1A 2IRFG 1HLVA 2R5YB 4XLFA 2ECBA 2HYFA 3K70C 3J7YJ 2E35A 2K5CA 3HG9A 3Q0VA 2IGNA 4A3LJ 5IOYA 1DU0A 2Y2ZA 5FFXA 5M3FJ 2CV0A 4RM3A 1HKTA 4ZYHA 2C6YA 1JKQC 2LY2A 3HOVJ 4HSTA
chains in the Genus database with same CATH topology
2EV0A 4IPAA 2VOOA 4LLLA 4A5MA 1FYKA 2FBHA 2F5DA 2M1BA 4M9SA 1KA8A 4XLNF 4CGZA 4U7DA 2KKOA 4HYEA 1IN6A 4LB6B 1WQ2A 3GVAA 3WTWC 2CFXA 2DTRA 2YX4A 1CF7A 3IRRA 2BBYA 3K0LA 1IN8A 3MCZA 1LDJA 2XUBA 1ZRDA 1Z9CA 2DI3A 4JBAA 4YFXF 5TJJA 2ZNZA 2TDXA 3P9IA 4I01A 1U5TB 3BPVA 4KMFA 1MGTA 2DLLA 5E8IA 4G7HF 1MJAA 1FBQA 2WTEA 2Y75A 2PMUA 4A0XA 4UHTA 2EV6A 3T5XA 2R7DA 5HS9A 4KNYA 4EM1A 5F6FA 4LJZF 3MZHA 2A68F 3NRVA 4HV6A 3GFLA 3NQOA 4BQAA 3EDPA 4WXDA 2HKXA 5ILVA 1DPRA 4GCVA 2Z9OA 2CYYA 4KA4A 2BGCA 3M7GA 5FD6A 2D1HA 1HQCA 1FSEA 3RKXA 2FMYA 2G7HA 5FB2A 3GFJA 2CWEA 2QBYA 1H0MA 2D1VA 3CO7C 3SZPA 2CGPA 3WTTC 4I2OA 2VONA 4AIKA 2VT2A 3N97A 5CJ9A 3WE3A 4M6YA 1LJ9A 3B73A 1HKQA 2Z5UA 2P8TA 4Y15A 5DCFA 4YFNF 4M74A 2OQGA 2AXLA 4PCQA 4AWXB 4S05A 5DD4A 2ETHA 2V1DA 2YU3A 4G9YA 4LG0B 1V4RA 3R61A 3KEOA 4ON0A 4MQ9F 4Q5SF 1HW2A 1U2WA 1O3TA 4N9HA 2OQRA 3WGGA 4AD9A 5D4SA 5JVTA 2A61A 1ZN2A 2G9WA 1FNNA 2WWYA 2IW5A 1XDUA 5E1XA 3U1DA 4FX4A 3ECOA 4FHTA 2EWNA 5FGMA 5LEJA 2KRFA 4EGYA 5FLXK 1B9NA 2QQ9A 5IT3A 2Z3YA 1GXQA 3SFZA 1ZGJA 3V8JA 2P6SA 4HV5A 3KZZA 4A5NA 4R8HA 2UZKA 2G7UA 1YO5C 3WE2A 4BHPA 1LQ1A 2UXNA 1T0FA 2IA2A 4AIHA 4L18B 1O7FA 3GLXA 1S8NA 2FMLA 1WKMA 5HDNA 3CUQC 4WK8F 3T1BA 1QNTA 2Y48A 2RN7A 5IT9K 1QZZA 4XRFA 3WTZA 4UVCA 3E97A 2PEXA 4HDUA 2QYOA 2FBKA 5CVVA 4F7ZA 2DT5A 1ZAOA 1FT9A 2NRAC 4K2EA 4U7BA 5K5OA 1UHMA 3DP7A 3JAMZ 3DFGA 4EJWA 4P5OA 3ECHA 4IJAA 2X0LA 5JFRA 4G6QA 1QZYA 2E1CA 5DUIA 2A6HF 4IXAA 2UWMA 1IAWA 1J2XA 1T38A 4IRIA 4KN4X 1WRJA 4I02A 4YIIA 5LRSA 1IN7A 2PFBA 3C1DA 3P9KA 3K2ZA 1R00A 1XD7A 3BJ6A 1G3YA 3I0TA 3KCCA 1LVAA 1P4AA 1Z7UA 5ICEA 4LLNA 4EQQA 1T39A 1P4XA 4LMYA 3FX3A 5LEKA 1ON1A 1ZG5A 3GX4X 1IN4A 3KP3A 4GYIA 2JZYA 1KU9A 4ETSA 1KU3A 1C0WA 2GIVA 3F21A 3ZMSA 2P5LC 3HRSA 3BY6A 4L9TA 2QM3A 3SQNA 2MH9A 4HX4A 1EH6A 4RAYA 4ZZDA 3KETA 2ACJA 2GQQA 1J5YA 2GZWA 4UV8A 4KUMA 2FQ3A 2FA5A 3E6BA 1FBUA 1OMIA 1HXDA 3HHHA 2J5PA 1EH7A 4WF2A 1CGPA 5D5UB 4UNOA 2L54A 4WX9A 5AIQA 5D5WB 3I59A 3V8KA 1P2FA 2X4HA 3E5XA 4KYWA 4M9XA 1BIBA 5LGUA 2O03A 4BHCA 4RGXA 2W84A 1B1BA 1OYWA 4I0AA 1J75A 1MD0A 4UV9A 4P9FA 1XSVA 3J81K 3DKWA 1YG2A 2O8XA 4L5IA 3DEUA 1EV7A 3QOPA 3O3KA 1IZ1A 1FYLA 1J0RA 1OYYA 3T8TA 4EV0A 4HA8A 4M6XA 5L3CA 1FC3A 2DQRA 1U3EM 3IC7A 2XRNA 2D45A 1MKMA 1FPQA 2K4JA 1W5TA 3EYIA 3ABTA 1RIOH 5DCMB 3FMRA 4YG2F 5FFZA 1R58A 2EK5A 1U78A 2EFPA 1SAXA 2FU4A 2JPBA 4OIOF 4YIFA 3K9TA 1HBXG 5H6QA 5KVRA 1FYMA 2ESNA 3WGIA 3P9CA 1SFUA 3F3XA 4O5VA 2GWRA 2P4WA 5JR3A 1MDMB 4H0EA 3FXUA 1ZRCA 1FP1D 4JQFA 1UHWA 5HLIA 3HSRA 3LQQA 2B0LA 2R7FA 4XBFA 2CQKA 1YQAA 1Z05A 4PDKA 1TTYA 3LA3A 3COAC 3EYYA 5L3BA 2H6BA 3CDHA 1IXSB 5EEGA 3WTYC 4MQVA 1YW8A 1LDDA 2DK8A 3FHZA 1DDNA 3FF5A 3BDDA 5D5VB 1J59A 1SMTA 5F1RA 4HAMA 4HZFA 1QO0D 4ZYEA 3ELKA 4HBLA 1XN7A 3JSOA 1Z6TA 1G3TA 1W7PB 3QU3A 1R1VA 1S29A 4L9VA 1FX7A 1YLFA 1S7AA 1VTNC 1O3SA 2M5WA 3BROA 2EB7A 5CVIA 1HSJA 3RTRA 1WI9A 3I4PA 2COMA 2F5CA 3ABUA 4IF4A 4G7ZF 3VOEA 1I27A 2KIMA 1SD6A 1B4AA 4IVNA 1BJAA 1TW3A 4Y17A 3HSFA 4ZYGA 1OPCA 4WWCA 4MGRA 4RB3C 5CYVA 2GAUA 4BAYA 1F9NA 2L3DA 3FMQA 2LKPA 2W25A 3QU6A 2ZO4A 4G7OF 2QBYB 3F6VA 3CLOA 1K6OA 3WTXC 2Q2EA 4BXUA 2ZXJA 3HRMA 4HQEA 4ZZLA 2VXZA 4HX7A 2NNYA 3DF8A 1R7JA 1OYIA 3Q5FA 5ICFA 2UXXA 4HF0A 3LAJA 4EMSA 1B6AA 2XVCA 3VEPA 3V8LA 1T6SA 3IRQA 4RGSA 1FZPB 1L0OC 1LDKB 2RDPA 2HEOA 1ZARA 4N9IA 3CTAA 1YTYA 4A2UA 3VODA 3SZTA 4RS8A 1DPUA 3TDZC 4EJUA 1BOAA 1D8KA 3GEZA 1USTA 1D3YA 2F5EA 3F6OA 1HW1A 3GZ6A 3OV8A 3HTSB 3QAHA 3SXYA 5D6EA 3K69A 3CO6C 2VN2A 3IWFA 2ZKZA 2ELHA 4IHSA 2EA2A 2M8EA 3GWZA 3KE2A 2PJPA 2IA0A 2LNBA 4LK1F 2HGCA 1G6NA 3LQRA 3QRFF 1IRFA 2ESHA 3Q9SA 2ZCWA 1YW7A 1BC8C 2CG4A 3WTVC 2HYGD 2YPRA 4PGGA 1J7KA 3C18A 1TNSA 1TNTA 4M71A 4UXNA 3ZQ7A 1S6LA 3TDUC 1FY7A 4A0YA 1FP2A 2MBFA 3E5QA 1XSDA 5EEHA 3KLNA 1FSHA 3W6JB 4RB0A 3F8MA 4I09A 5HS8A 3MFKA 3F8FA 4ASNA 3HSEA 3NEUA 1T2KA 3BZ6A 1O3QA 3MWMA 3I71A 2VE8A 4N0BA 2DK5A 2ZMEB 2VOPA 4XLPF 2NS0A 2VC0A 3J7AO 4B8XA 2VE9A 5E1WA 3WTSC 4S04A 4HF2A 2XAHA 1QPMA 1UCRA 3VFZA 3WTUC 1XDSA 4KT5C 3RYRA 2LSOA 4BHBA 3ERED 3GO5A 5LGTA 5D4RA 5E18F 3DPTA 3T0YA 3F8CA 3FM3A 2VBXA 4BYYA 2BV6A 3L9FA 2FSWA 3L7WA 3S2WA 5HVQC 3W6KB 1S7OA 2FXAA 3TOBA 3RYPA 1O57A 1ZRFA 1BM9A 2RKHA 1G3WA 4L9JA 1MJBA 2PI0A 1XGNA 4XSZF 1BI2A 2E1NA 2GA1A 5CVUA 1TBXA 4R79A 4LG0A 3TQNA 2ZBKA 1ON2A 5E1ZB 2XASA 2CSOA 4JK1X 4L5JA 2WV0A 4WCGA 5LLQA 5CVRA 1Z91A 3DXJF 2PLYA 1K78B 1IRGA 4Q4ZF 4EM0B 2Y0MA 3BJOA 2MLGA 5HOOA 3C7JA 3R0AA 3DPLC 3V7SA 3HUGA 4U0WA 4ESFA 1G4DA 5LHHA 1YS6A 3QPTA 5JI6A 1ZHFA 3GW2A 1SMYF 3MZYA 1D8JA 1P92A 5JHUA 2PQ8A 4GYGA 3JAMK 2W57A 2O6GE 3ZN1A 3KP6A 1JGSA 4G6DA 5HDGA 2HFHA 3KZYA 4PGHA 3I5UA 5K5QA 3QP5A 3M8FA 1HKSA 1KQ9A 4LGWA 1XCVA 4ZYDA 4P55A 1SD5A 5BMZA 2VT3A 3RKYA 1DUXC 3D5LA 4OIPF 2P5KA 5L3EA 4FT8A 1TQPA 3FMSA 5FO5A 2BEOA 5LHIA 2RNJA 4OMYA 3WU1B 1BIAA 3F8BA 1V3FA 2FF4A 2HZTA 2K7LA 3LA2A 1FOKA 2XAQA 1XMAA 2VODA 3IWZA 4TV7A 3HRUA 4ESBA 1YS7A 4UUVA 3F8NA 5ILSA 2H94A 5LHGA 1UFMA 4ENKA 3DV8A 4MEXF 4HX8A 4CICA 2IP2A 2OAZA 2RGVA 5K1YA 4EM2A 3JTGA 3F22A 2HKOA 5J6XA 1PUEE 1LB2A 2M87A 3KEQA 1YW9A 1BI3A 4O6JA 3KP4A 5AONA 4U88A 2V1UA 3CUQA 3GZ5A 4M73A 2OU2A 1Q1HA 4CHUA 2H09A 4RGUA 5F64A 5CLSA 1S3JA 2V6CA 2OZUA 3H3ZA 2K02A 4KN7X 2GA2A 1BN5A 1ODDA 3TOAA 4DQ2A 4KIFA 2HQNA 1ZLKA 3ZMZA 5A2QZ 2OA4A 3ZN0A 1HW5A 2K27A 2A69F 1I5ZA 3FZVA 3GYHX 5L3DA 4E70A 3EQLF 1JE8A 3BOQA 5HDKA 1Z6RA 3ZMDA 1ZGAA 3LSTA 1ULYA 4KICA 4ENMA 2FE3A 1XMKA 3M9AA 3I64A 3D0SA 1WSUA 3V4GA 1XCBA 1ZREA 2DW4A 2QQAA 3BPXA 4CDGA 1CF7B 1GVJA 2F2EA 4ESJA 4A12A 1SD7A 4OIRF 2E7XA 2L4MA 5A2QK 3AAFA 2MLKA 5DV5A 4EJVA 1U8RA 5J8FA 2OZ6A 4EJOA 2KIUA 2XHKA 1K7AA 2OBPA 3RPUA 2E7WA 3HHGA 2XAFA 2NAZA 1IF1A 3HIFA 1AWCA 4HF1A 4RGRA 3K1NA 3IKTA 1IN5A 3ZMVA 2QLZA 3TO7A 1ZG1A 1DP7P 3BJAA 1TW2A 2DPDA 5BOXA 2O0YA 1REPC 1B9MA 2HTJA 1TQIA 4AVPA 2GXGA 1BI1A 1MDMA 4IHTA 4ZH4F 3PQJA 1QQIA 1RNLA 3WODF 4CO8A 2CO5A 3GUDA 3V7CA 2HR3A 5DUKA 4ENNA 5DEQA 5ERIA 3JSPA 2H27A 2K86A 2DBBA 3U9GA 2ZJ2A 3R0JA 3JW4A 4MTEA 4L9NA 1XGOA 2LDUA 5LRRA 1RZ4A 4FX0A 4XSXF 4D0PA 2L4AA 3ZPLA 1ONVA 1YFHA 3RJPA 2FNPA 2Q0OA 2HDCA 2XROA 1K79A 2XGXA 4CYDA 3T8RA 1IXCA 2ADUA 2YX7A 3TO6A 5HLHA 5AIPA 1KGSA 3I58A 1Z1DA 4IRHA 1W7PA 3TKYA 1XGMA 4Q48A 1E2XA 2LF7A 4LLGF 2YR2A 3ISPA 2JT1A 2VBWA 1IW7F 2H6CA 2A07F 3GF2A 4RB2C 4IRGA 4M72A 1RUNA 4NQWA 3IHUA 1IUYA 3N4MA 2A3SA 4YFKF 2ISZA 3K1PA 1LNWA 2EFOA 1BI0A 1FLIA 3ROUA 3HRTA 1U5TA 3HYIA 5LBQA 4EVIA 1HSTA 2F5FA 2VBYA 1MJ9A 2FOKA 1P4WA 1A04A 1P6RA 3LA7A 1BBYA 1J9IA 4A6DA 2W85A 5DD8A 2QZ8A 4I7HA 2EV5A 1ZYRF 2ISYA 5FLXZ 2FNAA 2RVCA 3E6CC 4KFCA 4HOBA 2O61A 3EETA 1RI7A 1R5GA 3E6MA 5DYMA 2KJBA 4R1HA 5ED4A 2HWVA 2XKOA 5K5RA 3ZP5A 3RI4A 4U0YA 1H9TA 3L2CA 1FBSA 2V9VA 4M9ZA 1YIOA 2Q8KA 3RDIA 3REOA 2IA1A 3O2PE 4Q47A 2JTVA 1TQMA 1W5SA 3WG9A 1EH8A 2AS5F 5IT9Z 3Q9VA 3GXOA 3K1MA 3BP8A 3MQ0A 3SHFA 3PFIA 1LEAA 1XSXA 3ZMUA 3CUOA 2HTSA 1JXSA 3OOPA 2BYVE 4LB5A 3FM5A 2DPUA 4LK0F 3LAPA 4PZJA 1USSA 4QWQA 1SFXA 3C3WA 3WU0A 2XKPA 2PN6A 1X3UA 3PQKA 4A0ZA 4HLXA 3IKVA 5H6RA 1W4MA 2OD5A 1W7PD 5HS7A 1QBJA 4MTDA 4QLCU 1U6GA 1O7LA 2L02A 4MEYF 2YSRA 4OU0A 3I54A 5ICCA 3QP6A 1R1UA 3VB2A 3HOSA 2Z99A 3FWEA 3MEXA 4G94A 1KU7A 3TO9A 1KYWA 4HLYA 4LFUA 5D8LB 4WXHA 1AOYA 2O3FA 2XV4S 3RKWA 5L3FA 3ML6A 3ULQB 5LGNA 2XAGA 2P6TA 1KU2A 2QENA 1XB4A 2KIFA 2KJCA 5HLGA 2DU9A 2MH2A 2ZMEA 3H92A 1IXRC 5BS6A 4EJTA 1KQ0A 2IT0A 5CVJA 3I59B 4WXCA 5TRDA 2FEZA 2IPQX 4RAZA 1KQ8A 2QVOA 4Z2YA 2EFQA 4I98B 4UVBA 4RB1A 3WGHA 4AIJA 5E20A 1G3SA 2A6EF 4P96A 1SD4A 1R23A 2FBIA 3EUHA 5ICGA 2W24A 4UVAA 5E17F 2MC3A 3KP2A 1H9GA 2WC2A 2LF8A 1T98A 4KDPA 4U0VA 2L01A 3E6DA 2RQPA 3LWFA 2GXBA 3G3ZA 4BH9A 3TGNA 4O3MA 3CUQB 4KMUX 1NHAA 4BNCA 1WWXA 3M8EA 4DNCA 3E3VA 3J81Z 2NNNA 2HOEA 2ZNYA 1LEBA 4KIBA 4HW0A 1KYZA 3U2RA 2HS5A 2STTA 1R36A 4CZZA 3HTUA 2M30A 2MD5A 4OMZA 2K4BA 2P7VB 2XAJA 5D5XB 2FRHA 3RPQA 2DAOA 1K78A 4NHJA 6PAXA 3B02A 1BC7C 1R22A 4P9UA 2HQRA 4KIGA 3GFIA 5ILUA 2EFWA 5J8CA 1SFEA 3KLOA 3QPHA 2RV8A 2P7CB 4MHGA 5KK1A 2Z33A 3E5UA 4GXOA 3J80Z 2VC1A 1RUOA 3F72A 1GXPA 1E17A 3RIRA 2IJLA 2CW0F 2PBIA 1JHHA 1ZLJA 2EA4A 3CJNA 2V1XA 2STWA 1ZH5A 2ZFWA 3H3UA 4OIQF 4EGZA 4OINF 3KP5A 2V79A 4HDVA 2M45A 3LFKA 3HOTA 5DDGA 1MZBA 5L3GA 1D5VA 1QGPA 4GO1A 3JTHA 3L00A 1R1TA 3FXRA 1I6XA 1YYVA 1STZA 2A5YB 3MAJA 2IVMA 2VBZA 1I1SA 3M1EA 4L0YB 5H20A 2QUFA 1Y0UA 1PDNC 3BWGA 3G73A 1JHFA 2EFNA 2JSCA 1F4KA 3I53A 5E8GA 1F5TA 4MNUA 3J80K 4NB5A 5BPDA 3GFMA 3ZMTA 4G8XA 3V7RA 4GGGA 3R60A 2MA3A 1OR7A 2QWWA 2PMHA 2DO7A 1GHCA 1L3LA 3F23A 3L09A 5FD5A 4I0BA 4B09A 1F1ZA 3KP7A 1FWZA 3FXQA 4CXFA 2DFIA 1PP7U 2DQLA 2JRTA 1OKRA 3R6SA 4Y13A 3P7NA 1PP8F 1B59A 2JPCA 4A6EA 3O6BB 3KFWX 4ENJA 1UB9A 3DQVC 1XGSA 5BPIA 1U5TC 2XIGA 1ZG3A 4L0ZB 3R4KA 5BQTA 3IL2A 1R5HA 2RC4A 2NYXA 1I1GA 4OOIA 2PG4A 5D8KB 5DCMA 1TLHB 2D2WA 4LD5A 5D6FA 2EJRA 2R3SA 1O3RA 2QQBA 2J5OA 4HQMA 2P5VA 2BE5F 2IRFG 2HYFA 5FFXA 1HKTA 4ZYHA 2C6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EV0 A;  4IPA A;  2VOO A;  4LLL A;  4A5M A;  1FYK A;  2FBH A;  2F5D A;  2M1B A;  4M9S A;  1KA8 A;  4XLN F;  4CGZ A;  4U7D A;  2KKO A;  4HYE A;  1IN6 A;  4LB6 B;  1WQ2 A;  3GVA A;  3WTW C;  2CFX A;  2DTR A;  2YX4 A;  1CF7 A;  3IRR A;  2BBY A;  3K0L A;  1IN8 A;  3MCZ A;  1LDJ A;  2XUB A;  1ZRD A;  1Z9C A;  2DI3 A;  4JBA A;  4YFX F;  5TJJ A;  2ZNZ A;  2TDX A;  3P9I A;  4I01 A;  1U5T B;  3BPV A;  4KMF A;  1MGT A;  2DLL A;  5E8I A;  4G7H F;  1MJA A;  1FBQ A;  2WTE A;  2Y75 A;  2PMU A;  4A0X A;  4UHT A;  2EV6 A;  3T5X A;  2R7D A;  5HS9 A;  4KNY A;  4EM1 A;  5F6F A;  4LJZ F;  3MZH A;  2A68 F;  3NRV A;  4HV6 A;  3GFL A;  3NQO A;  4BQA A;  3EDP A;  4WXD A;  2HKX A;  5ILV A;  1DPR A;  4GCV A;  2Z9O A;  2CYY A;  4KA4 A;  2BGC A;  3M7G A;  5FD6 A;  2D1H A;  1HQC A;  1FSE A;  3RKX A;  2FMY A;  2G7H A;  5FB2 A;  3GFJ A;  2CWE A;  2QBY A;  1H0M A;  2D1V A;  3CO7 C;  3SZP A;  2CGP A;  3WTT C;  4I2O A;  2VON A;  4AIK A;  2VT2 A;  3N97 A;  5CJ9 A;  3WE3 A;  4M6Y A;  1LJ9 A;  3B73 A;  1HKQ A;  2Z5U A;  2P8T A;  4Y15 A;  5DCF A;  4YFN F;  4M74 A;  2OQG A;  2AXL A;  4PCQ A;  4AWX B;  4S05 A;  5DD4 A;  2ETH A;  2V1D A;  2YU3 A;  4G9Y A;  4LG0 B;  1V4R A;  3R61 A;  3KEO A;  4ON0 A;  4MQ9 F;  4Q5S F;  1HW2 A;  1U2W A;  1O3T A;  4N9H A;  2OQR A;  3WGG A;  4AD9 A;  5D4S A;  5JVT A;  2A61 A;  1ZN2 A;  2G9W A;  1FNN A;  2WWY A;  2IW5 A;  1XDU A;  5E1X A;  3U1D A;  4FX4 A;  3ECO A;  4FHT A;  2EWN A;  5FGM A;  5LEJ A;  2KRF A;  4EGY A;  5FLX K;  1B9N A;  2QQ9 A;  5IT3 A;  2Z3Y A;  1GXQ A;  3SFZ A;  1ZGJ A;  3V8J A;  2P6S A;  4HV5 A;  3KZZ A;  4A5N A;  4R8H A;  2UZK A;  2G7U A;  1YO5 C;  3WE2 A;  4BHP A;  1LQ1 A;  2UXN A;  1T0F A;  2IA2 A;  4AIH A;  4L18 B;  1O7F A;  3GLX A;  1S8N A;  2FML A;  1WKM A;  5HDN A;  3CUQ C;  4WK8 F;  3T1B A;  1QNT A;  2Y48 A;  2RN7 A;  5IT9 K;  1QZZ A;  4XRF A;  3WTZ A;  4UVC A;  3E97 A;  2PEX A;  4HDU A;  2QYO A;  2FBK A;  5CVV A;  4F7Z A;  2DT5 A;  1ZAO A;  1FT9 A;  2NRA C;  4K2E A;  4U7B A;  5K5O A;  1UHM A;  3DP7 A;  3JAM Z;  3DFG A;  4EJW A;  4P5O A;  3ECH A;  4IJA A;  2X0L A;  5JFR A;  4G6Q A;  1QZY A;  2E1C A;  5DUI A;  2A6H F;  4IXA A;  2UWM A;  1IAW A;  1J2X A;  1T38 A;  4IRI A;  4KN4 X;  1WRJ A;  4I02 A;  4YII A;  5LRS A;  1IN7 A;  2PFB A;  3C1D A;  3P9K A;  3K2Z A;  1R00 A;  1XD7 A;  3BJ6 A;  1G3Y A;  3I0T A;  3KCC A;  1LVA A;  1P4A A;  1Z7U A;  5ICE A;  4LLN A;  4EQQ A;  1T39 A;  1P4X A;  4LMY A;  3FX3 A;  5LEK A;  1ON1 A;  1ZG5 A;  3GX4 X;  1IN4 A;  3KP3 A;  4GYI A;  2JZY A;  1KU9 A;  4ETS A;  1KU3 A;  1C0W A;  2GIV A;  3F21 A;  3ZMS A;  2P5L C;  3HRS A;  3BY6 A;  4L9T A;  2QM3 A;  3SQN A;  2MH9 A;  4HX4 A;  1EH6 A;  4RAY A;  4ZZD A;  3KET A;  2ACJ A;  2GQQ A;  1J5Y A;  2GZW A;  4UV8 A;  4KUM A;  2FQ3 A;  2FA5 A;  3E6B A;  1FBU A;  1OMI A;  1HXD A;  3HHH A;  2J5P A;  1EH7 A;  4WF2 A;  1CGP A;  5D5U B;  4UNO A;  2L54 A;  4WX9 A;  5AIQ A;  5D5W B;  3I59 A;  3V8K A;  1P2F A;  2X4H A;  3E5X A;  4KYW A;  4M9X A;  1BIB A;  5LGU A;  2O03 A;  4BHC A;  4RGX A;  2W84 A;  1B1B A;  1OYW A;  4I0A A;  1J75 A;  1MD0 A;  4UV9 A;  4P9F A;  1XSV A;  3J81 K;  3DKW A;  1YG2 A;  2O8X A;  4L5I A;  3DEU A;  1EV7 A;  3QOP A;  3O3K A;  1IZ1 A;  1FYL A;  1J0R A;  1OYY A;  3T8T A;  4EV0 A;  4HA8 A;  4M6X A;  5L3C A;  1FC3 A;  2DQR A;  1U3E M;  3IC7 A;  2XRN A;  2D45 A;  1MKM A;  1FPQ A;  2K4J A;  1W5T A;  3EYI A;  3ABT A;  1RIO H;  5DCM B;  3FMR A;  4YG2 F;  5FFZ A;  1R58 A;  2EK5 A;  1U78 A;  2EFP A;  1SAX A;  2FU4 A;  2JPB A;  4OIO F;  4YIF A;  3K9T A;  1HBX G;  5H6Q A;  5KVR A;  1FYM A;  2ESN A;  3WGI A;  3P9C A;  1SFU A;  3F3X A;  4O5V A;  2GWR A;  2P4W A;  5JR3 A;  1MDM B;  4H0E A;  3FXU A;  1ZRC A;  1FP1 D;  4JQF A;  1UHW A;  5HLI A;  3HSR A;  3LQQ A;  2B0L A;  2R7F A;  4XBF A;  2CQK A;  1YQA A;  1Z05 A;  4PDK A;  1TTY A;  3LA3 A;  3COA C;  3EYY A;  5L3B A;  2H6B A;  3CDH A;  1IXS B;  5EEG A;  3WTY C;  4MQV A;  1YW8 A;  1LDD A;  2DK8 A;  3FHZ A;  1DDN A;  3FF5 A;  3BDD A;  5D5V B;  1J59 A;  1SMT A;  5F1R A;  4HAM A;  4HZF A;  1QO0 D;  4ZYE A;  3ELK A;  4HBL A;  1XN7 A;  3JSO A;  1Z6T A;  1G3T A;  1W7P B;  3QU3 A;  1R1V A;  1S29 A;  4L9V A;  1FX7 A;  1YLF A;  1S7A A;  1VTN C;  1O3S A;  2M5W A;  3BRO A;  2EB7 A;  5CVI A;  1HSJ A;  3RTR A;  1WI9 A;  3I4P A;  2COM A;  2F5C A;  3ABU A;  4IF4 A;  4G7Z F;  3VOE A;  1I27 A;  2KIM A;  1SD6 A;  1B4A A;  4IVN A;  1BJA A;  1TW3 A;  4Y17 A;  3HSF A;  4ZYG A;  1OPC A;  4WWC A;  4MGR A;  4RB3 C;  5CYV A;  2GAU A;  4BAY A;  1F9N A;  2L3D A;  3FMQ A;  2LKP A;  2W25 A;  3QU6 A;  2ZO4 A;  4G7O F;  2QBY B;  3F6V A;  3CLO A;  1K6O A;  3WTX C;  2Q2E A;  4BXU A;  2ZXJ A;  3HRM A;  4HQE A;  4ZZL A;  2VXZ A;  4HX7 A;  2NNY A;  3DF8 A;  1R7J A;  1OYI A;  3Q5F A;  5ICF A;  2UXX A;  4HF0 A;  3LAJ A;  4EMS A;  1B6A A;  2XVC A;  3VEP A;  3V8L A;  1T6S A;  3IRQ A;  4RGS A;  1FZP B;  1L0O C;  1LDK B;  2RDP A;  2HEO A;  1ZAR A;  4N9I A;  3CTA A;  1YTY A;  4A2U A;  3VOD A;  3SZT A;  4RS8 A;  1DPU A;  3TDZ C;  4EJU A;  1BOA A;  1D8K A;  3GEZ A;  1UST A;  1D3Y A;  2F5E A;  3F6O A;  1HW1 A;  3GZ6 A;  3OV8 A;  3HTS B;  3QAH A;  3SXY A;  5D6E A;  3K69 A;  3CO6 C;  2VN2 A;  3IWF A;  2ZKZ A;  2ELH A;  4IHS A;  2EA2 A;  2M8E A;  3GWZ A;  3KE2 A;  2PJP A;  2IA0 A;  2LNB A;  4LK1 F;  2HGC A;  1G6N A;  3LQR A;  3QRF F;  1IRF A;  2ESH A;  3Q9S A;  2ZCW A;  1YW7 A;  1BC8 C;  2CG4 A;  3WTV C;  2HYG D;  2YPR A;  4PGG A;  1J7K A;  3C18 A;  1TNS A;  1TNT A;  4M71 A;  4UXN A;  3ZQ7 A;  1S6L A;  3TDU C;  1FY7 A;  4A0Y A;  1FP2 A;  2MBF A;  3E5Q A;  1XSD A;  5EEH A;  3KLN A;  1FSH A;  3W6J B;  4RB0 A;  3F8M A;  4I09 A;  5HS8 A;  3MFK A;  3F8F A;  4ASN A;  3HSE A;  3NEU A;  1T2K A;  3BZ6 A;  1O3Q A;  3MWM A;  3I71 A;  2VE8 A;  4N0B A;  2DK5 A;  2ZME B;  2VOP A;  4XLP F;  2NS0 A;  2VC0 A;  3J7A O;  4B8X A;  2VE9 A;  5E1W A;  3WTS C;  4S04 A;  4HF2 A;  2XAH A;  1QPM A;  1UCR A;  3VFZ A;  3WTU C;  1XDS A;  4KT5 C;  3RYR A;  2LSO A;  4BHB A;  3ERE D;  3GO5 A;  5LGT A;  5D4R A;  5E18 F;  3DPT A;  3T0Y A;  3F8C A;  3FM3 A;  2VBX A;  4BYY A;  2BV6 A;  3L9F A;  2FSW A;  3L7W A;  3S2W A;  5HVQ C;  3W6K B;  1S7O A;  2FXA A;  3TOB A;  3RYP A;  1O57 A;  1ZRF A;  1BM9 A;  2RKH A;  1G3W A;  4L9J A;  1MJB A;  2PI0 A;  1XGN A;  4XSZ F;  1BI2 A;  2E1N A;  2GA1 A;  5CVU A;  1TBX A;  4R79 A;  4LG0 A;  3TQN A;  2ZBK A;  1ON2 A;  5E1Z B;  2XAS A;  2CSO A;  4JK1 X;  4L5J A;  2WV0 A;  4WCG A;  5LLQ A;  5CVR A;  1Z91 A;  3DXJ F;  2PLY A;  1K78 B;  1IRG A;  4Q4Z F;  4EM0 B;  2Y0M A;  3BJO A;  2MLG A;  5HOO A;  3C7J A;  3R0A A;  3DPL C;  3V7S A;  3HUG A;  4U0W A;  4ESF A;  1G4D A;  5LHH A;  1YS6 A;  3QPT A;  5JI6 A;  1ZHF A;  3GW2 A;  1SMY F;  3MZY A;  1D8J A;  1P92 A;  5JHU A;  2PQ8 A;  4GYG A;  3JAM K;  2W57 A;  2O6G E;  3ZN1 A;  3KP6 A;  1JGS A;  4G6D A;  5HDG A;  2HFH A;  3KZY A;  4PGH A;  3I5U A;  5K5Q A;  3QP5 A;  3M8F A;  1HKS A;  1KQ9 A;  4LGW A;  1XCV A;  4ZYD A;  4P55 A;  1SD5 A;  5BMZ A;  2VT3 A;  3RKY A;  1DUX C;  3D5L A;  4OIP F;  2P5K A;  5L3E A;  4FT8 A;  1TQP A;  3FMS A;  5FO5 A;  2BEO A;  5LHI A;  2RNJ A;  4OMY A;  3WU1 B;  1BIA A;  3F8B A;  1V3F A;  2FF4 A;  2HZT A;  2K7L A;  3LA2 A;  1FOK A;  2XAQ A;  1XMA A;  2VOD A;  3IWZ A;  4TV7 A;  3HRU A;  4ESB A;  1YS7 A;  4UUV A;  3F8N A;  5ILS A;  2H94 A;  5LHG A;  1UFM A;  4ENK A;  3DV8 A;  4MEX F;  4HX8 A;  4CIC A;  2IP2 A;  2OAZ A;  2RGV A;  5K1Y A;  4EM2 A;  3JTG A;  3F22 A;  2HKO A;  5J6X A;  1PUE E;  1LB2 A;  2M87 A;  3KEQ A;  1YW9 A;  1BI3 A;  4O6J A;  3KP4 A;  5AON A;  4U88 A;  2V1U A;  3CUQ A;  3GZ5 A;  4M73 A;  2OU2 A;  1Q1H A;  4CHU A;  2H09 A;  4RGU A;  5F64 A;  5CLS A;  1S3J A;  2V6C A;  2OZU A;  3H3Z A;  2K02 A;  4KN7 X;  2GA2 A;  1BN5 A;  1ODD A;  3TOA A;  4DQ2 A;  4KIF A;  2HQN A;  1ZLK A;  3ZMZ A;  5A2Q Z;  2OA4 A;  3ZN0 A;  1HW5 A;  2K27 A;  2A69 F;  1I5Z A;  3FZV A;  3GYH X;  5L3D A;  4E70 A;  3EQL F;  1JE8 A;  3BOQ A;  5HDK A;  1Z6R A;  3ZMD A;  1ZGA A;  3LST A;  1ULY A;  4KIC A;  4ENM A;  2FE3 A;  1XMK A;  3M9A A;  3I64 A;  3D0S A;  1WSU A;  3V4G A;  1XCB A;  1ZRE A;  2DW4 A;  2QQA A;  3BPX A;  4CDG A;  1CF7 B;  1GVJ A;  2F2E A;  4ESJ A;  4A12 A;  1SD7 A;  4OIR F;  2E7X A;  2L4M A;  5A2Q K;  3AAF A;  2MLK A;  5DV5 A;  4EJV A;  1U8R A;  5J8F A;  2OZ6 A;  4EJO A;  2KIU A;  2XHK A;  1K7A A;  2OBP A;  3RPU A;  2E7W A;  3HHG A;  2XAF A;  2NAZ A;  1IF1 A;  3HIF A;  1AWC A;  4HF1 A;  4RGR A;  3K1N A;  3IKT A;  1IN5 A;  3ZMV A;  2QLZ A;  3TO7 A;  1ZG1 A;  1DP7 P;  3BJA A;  1TW2 A;  2DPD A;  5BOX A;  2O0Y A;  1REP C;  1B9M A;  2HTJ A;  1TQI A;  4AVP A;  2GXG A;  1BI1 A;  1MDM A;  4IHT A;  4ZH4 F;  3PQJ A;  1QQI A;  1RNL A;  3WOD F;  4CO8 A;  2CO5 A;  3GUD A;  3V7C A;  2HR3 A;  5DUK A;  4ENN A;  5DEQ A;  5ERI A;  3JSP A;  2H27 A;  2K86 A;  2DBB A;  3U9G A;  2ZJ2 A;  3R0J A;  3JW4 A;  4MTE A;  4L9N A;  1XGO A;  2LDU A;  5LRR A;  1RZ4 A;  4FX0 A;  4XSX F;  4D0P A;  2L4A A;  3ZPL A;  1ONV A;  1YFH A;  3RJP A;  2FNP A;  2Q0O A;  2HDC A;  2XRO A;  1K79 A;  2XGX A;  4CYD A;  3T8R A;  1IXC A;  2ADU A;  2YX7 A;  3TO6 A;  5HLH A;  5AIP A;  1KGS A;  3I58 A;  1Z1D A;  4IRH A;  1W7P A;  3TKY A;  1XGM A;  4Q48 A;  1E2X A;  2LF7 A;  4LLG F;  2YR2 A;  3ISP A;  2JT1 A;  2VBW A;  1IW7 F;  2H6C A;  2A07 F;  3GF2 A;  4RB2 C;  4IRG A;  4M72 A;  1RUN A;  4NQW A;  3IHU A;  1IUY A;  3N4M A;  2A3S A;  4YFK F;  2ISZ A;  3K1P A;  1LNW A;  2EFO A;  1BI0 A;  1FLI A;  3ROU A;  3HRT A;  1U5T A;  3HYI A;  5LBQ A;  4EVI A;  1HST A;  2F5F A;  2VBY A;  1MJ9 A;  2FOK A;  1P4W A;  1A04 A;  1P6R A;  3LA7 A;  1BBY A;  1J9I A;  4A6D A;  2W85 A;  5DD8 A;  2QZ8 A;  4I7H A;  2EV5 A;  1ZYR F;  2ISY A;  5FLX Z;  2FNA A;  2RVC A;  3E6C C;  4KFC A;  4HOB A;  2O61 A;  3EET A;  1RI7 A;  1R5G A;  3E6M A;  5DYM A;  2KJB A;  4R1H A;  5ED4 A;  2HWV A;  2XKO A;  5K5R A;  3ZP5 A;  3RI4 A;  4U0Y A;  1H9T A;  3L2C A;  1FBS A;  2V9V A;  4M9Z A;  1YIO A;  2Q8K A;  3RDI A;  3REO A;  2IA1 A;  3O2P E;  4Q47 A;  2JTV A;  1TQM A;  1W5S A;  3WG9 A;  1EH8 A;  2AS5 F;  5IT9 Z;  3Q9V A;  3GXO A;  3K1M A;  3BP8 A;  3MQ0 A;  3SHF A;  3PFI A;  1LEA A;  1XSX A;  3ZMU A;  3CUO A;  2HTS A;  1JXS A;  3OOP A;  2BYV E;  4LB5 A;  3FM5 A;  2DPU A;  4LK0 F;  3LAP A;  4PZJ A;  1USS A;  4QWQ A;  1SFX A;  3C3W A;  3WU0 A;  2XKP A;  2PN6 A;  1X3U A;  3PQK A;  4A0Z A;  4HLX A;  3IKV A;  5H6R A;  1W4M A;  2OD5 A;  1W7P D;  5HS7 A;  1QBJ A;  4MTD A;  4QLC U;  1U6G A;  1O7L A;  2L02 A;  4MEY F;  2YSR A;  4OU0 A;  3I54 A;  5ICC A;  3QP6 A;  1R1U A;  3VB2 A;  3HOS A;  2Z99 A;  3FWE A;  3MEX A;  4G94 A;  1KU7 A;  3TO9 A;  1KYW A;  4HLY A;  4LFU A;  5D8L B;  4WXH A;  1AOY A;  2O3F A;  2XV4 S;  3RKW A;  5L3F A;  3ML6 A;  3ULQ B;  5LGN A;  2XAG A;  2P6T A;  1KU2 A;  2QEN A;  1XB4 A;  2KIF A;  2KJC A;  5HLG A;  2DU9 A;  2MH2 A;  2ZME A;  3H92 A;  1IXR C;  5BS6 A;  4EJT A;  1KQ0 A;  2IT0 A;  5CVJ A;  3I59 B;  4WXC A;  5TRD A;  2FEZ A;  2IPQ X;  4RAZ A;  1KQ8 A;  2QVO A;  4Z2Y A;  2EFQ A;  4I98 B;  4UVB A;  4RB1 A;  3WGH A;  4AIJ A;  5E20 A;  1G3S A;  2A6E F;  4P96 A;  1SD4 A;  1R23 A;  2FBI A;  3EUH A;  5ICG A;  2W24 A;  4UVA A;  5E17 F;  2MC3 A;  3KP2 A;  1H9G A;  2WC2 A;  2LF8 A;  1T98 A;  4KDP A;  4U0V A;  2L01 A;  3E6D A;  2RQP A;  3LWF A;  2GXB A;  3G3Z A;  4BH9 A;  3TGN A;  4O3M A;  3CUQ B;  4KMU X;  1NHA A;  4BNC A;  1WWX A;  3M8E A;  4DNC A;  3E3V A;  3J81 Z;  2NNN A;  2HOE A;  2ZNY A;  1LEB A;  4KIB A;  4HW0 A;  1KYZ A;  3U2R A;  2HS5 A;  2STT A;  1R36 A;  4CZZ A;  3HTU A;  2M30 A;  2MD5 A;  4OMZ A;  2K4B A;  2P7V B;  2XAJ A;  5D5X B;  2FRH A;  3RPQ A;  2DAO A;  1K78 A;  4NHJ A;  6PAX A;  3B02 A;  1BC7 C;  1R22 A;  4P9U A;  2HQR A;  4KIG A;  3GFI A;  5ILU A;  2EFW A;  5J8C A;  1SFE A;  3KLO A;  3QPH A;  2RV8 A;  2P7C B;  4MHG A;  5KK1 A;  2Z33 A;  3E5U A;  4GXO A;  3J80 Z;  2VC1 A;  1RUO A;  3F72 A;  1GXP A;  1E17 A;  3RIR A;  2IJL A;  2CW0 F;  2PBI A;  1JHH A;  1ZLJ A;  2EA4 A;  3CJN A;  2V1X A;  2STW A;  1ZH5 A;  2ZFW A;  3H3U A;  4OIQ F;  4EGZ A;  4OIN F;  3KP5 A;  2V79 A;  4HDV A;  2M45 A;  3LFK A;  3HOT A;  5DDG A;  1MZB A;  5L3G A;  1D5V A;  1QGP A;  4GO1 A;  3JTH A;  3L00 A;  1R1T A;  3FXR A;  1I6X A;  1YYV A;  1STZ A;  2A5Y B;  3MAJ A;  2IVM A;  2VBZ A;  1I1S A;  3M1E A;  4L0Y B;  5H20 A;  2QUF A;  1Y0U A;  1PDN C;  3BWG A;  3G73 A;  1JHF A;  2EFN A;  2JSC A;  1F4K A;  3I53 A;  5E8G A;  1F5T A;  4MNU A;  3J80 K;  4NB5 A;  5BPD A;  3GFM A;  3ZMT A;  4G8X A;  3V7R A;  4GGG A;  3R60 A;  2MA3 A;  1OR7 A;  2QWW A;  2PMH A;  2DO7 A;  1GHC A;  1L3L A;  3F23 A;  3L09 A;  5FD5 A;  4I0B A;  4B09 A;  1F1Z A;  3KP7 A;  1FWZ A;  3FXQ A;  4CXF A;  2DFI A;  1PP7 U;  2DQL A;  2JRT A;  1OKR A;  3R6S A;  4Y13 A;  3P7N A;  1PP8 F;  1B59 A;  2JPC A;  4A6E A;  3O6B B;  3KFW X;  4ENJ A;  1UB9 A;  3DQV C;  1XGS A;  5BPI A;  1U5T C;  2XIG A;  1ZG3 A;  4L0Z B;  3R4K A;  5BQT A;  3IL2 A;  1R5H A;  2RC4 A;  2NYX A;  1I1G A;  4OOI A;  2PG4 A;  5D8K B;  5DCM A;  1TLH B;  2D2W A;  4LD5 A;  5D6F A;  2EJR A;  2R3S A;  1O3R A;  2QQB A;  2J5O A;  4HQM A;  2P5V A;  2BE5 F;  2IRF G;  2HYF A;  5FFX A;  1HKT A;  4ZYH A;  2C6Y A; 
#chains in the Genus database with same CATH topology
 3CDI A;  2EV0 A;  4IPA A;  2VOO A;  3I4M J;  4LLL A;  2VAS A;  2Y30 A;  4A5M A;  1FYK A;  2FBH A;  2F5D A;  2M1B A;  4M9S A;  1KA8 A;  4XLN F;  3BLY A;  4CGZ A;  4U7D A;  2KKO A;  2CQ7 A;  4BL0 B;  4HYE A;  1IN6 A;  3BTL A;  3BR3 A;  1S9H A;  4LB6 B;  1WQ2 A;  2QKM B;  3GVA A;  3WTW C;  3W6V A;  1MBK A;  1Y56 A;  2CFX A;  3OIP A;  1R4N B;  3S2D J;  2DTR A;  2YX4 A;  2DCE A;  3F9K A;  4CCM A;  1RR8 C;  1X4O A;  4W1U A;  1NTC A;  1CF7 A;  3GME A;  5FLV A;  3IRR A;  4E4H A;  3PSI A;  3FIW A;  2AQE A;  2BBY A;  4E7J A;  3K0L A;  1IN8 A;  3MCZ A;  3VYU B;  1LDJ A;  2XUB A;  4XOR A;  1ZRD A;  1Z9C A;  2DI3 A;  2W7N A;  4JBA A;  4YFX F;  1VQN I;  5TJJ A;  2ZNZ A;  3M07 A;  2TDX A;  2R7T A;  3P9I A;  4I01 A;  1U5T B;  3BPV A;  2XPV A;  4II3 A;  4KMF A;  2XF7 A;  2KP6 A;  1MGT A;  2DLL A;  5E8I A;  4UUS A;  3KPH A;  3CES A;  5EG0 A;  1BL0 A;  1Z21 A;  1A36 A;  1SFK A;  4G7H F;  1MJA A;  4N4O B;  1FBQ A;  4BDY A;  2Y0S N;  2WTE A;  2CQX A;  5GAE J;  4CZC A;  3MKW B;  1V54 H;  2Y75 A;  3HZJ A;  4BXX J;  4MLO A;  3BG3 A;  5J1Y A;  2PMU A;  1R49 A;  2PJR B;  5FJ8 J;  1SEU A;  4A0X A;  2ECC A;  3CJR B;  2F4O B;  4UHT A;  3DBH B;  2EV6 A;  3T5X A;  5DS9 A;  1KZH A;  2R7D A;  5HS9 A;  2BY1 A;  4KNY A;  4EM1 A;  2CW7 A;  4LJZ F;  5F6F A;  3MZH A;  2A68 F;  2FOW A;  4XLE A;  3NRV A;  4HV6 A;  2HZD A;  3ZQF A;  3GFL A;  4FE4 A;  1QPI A;  3NQO A;  4XKV A;  4XN0 A;  1DGW Y;  4IZZ A;  4BQA A;  3EDP A;  5HOD A;  4QSH A;  4WXD A;  1YIJ I;  1R9T J;  2HKX A;  5ILV A;  1DPR A;  2EQR A;  4GCV A;  4I76 A;  4A3E J;  5J1U A;  2Z9O A;  1QVT A;  4AUX A;  2NS8 A;  1HDP A;  1ETV A;  4OWR B;  3JR9 A;  1A6I A;  1YRN B;  2CYY A;  4ZDL A;  4KA4 A;  3I9V 2;  5HNF A;  2BGC A;  3M7G A;  3DEW A;  5FD6 A;  2D1H A;  3FXM A;  3ABL H;  1HQC A;  1FSE A;  3IP4 B;  3AG4 H;  3RKX A;  4A69 C;  1VQM I;  3EPZ A;  3CQZ J;  5IY5 H;  2FMY A;  2LD5 A;  1Y1W J;  3HOW J;  2G7H A;  5FB2 A;  3FKJ A;  3GFJ A;  2CWE A;  3HJE A;  2HQ5 A;  2QBY A;  1H0M A;  2D1V A;  4DBR A;  3CO7 C;  3GTP J;  1MW7 A;  3SZP A;  5FKK A;  2CGP A;  3WTT C;  4I2O A;  3H5A A;  1IG7 A;  2VON A;  2R92 J;  1A5J A;  5M5W J;  4AIK A;  2VT2 A;  3N97 A;  5CJ9 A;  3WE3 A;  2XRL A;  4M6Y A;  1LJ9 A;  2QCO A;  3B73 A;  1HKQ A;  2Z5U A;  5IP9 J;  1EJ9 A;  2P8T A;  4Y15 A;  2TRT A;  5DCF A;  4QPO A;  1K83 J;  4YFN F;  4M74 A;  3OSG A;  3EUH C;  4A93 J;  4V19 K;  3DTK A;  2OQG A;  2AXL A;  1V5F A;  3BG9 A;  4PCQ A;  4XKB A;  4AWX B;  3Q0W A;  1B72 B;  3G4S I;  2JRM A;  1KON A;  1TWH J;  4S05 A;  2V9K A;  3W2V A;  3CDL A;  3TL4 X;  2E5N A;  5DD4 A;  2M4G A;  2VL8 A;  2ETH A;  2H1L A;  2V1D A;  1NH3 A;  4UB8 C;  2LOO A;  2YU3 A;  2Y9Z A;  4G9Y A;  2QSF X;  4PUS A;  2HDW A;  4LG0 B;  4RAF A;  1JGG A;  1IV6 A;  1V4R A;  1HCR A;  2VI6 A;  2DDB A;  3R61 A;  3KEO A;  4UY8 I;  4ON0 A;  2DOA A;  4MQ9 F;  4E7I A;  4Q5S F;  3DBL B;  1HW2 A;  2DMT A;  1U2W A;  1O3T A;  2V7F A;  4C3J J;  1AKH B;  2DN0 A;  3OYD A;  4N9H A;  3CC7 I;  3OS2 A;  2OQR A;  3ZQL A;  2QSH X;  3BQZ A;  3WGG A;  4AD9 A;  1QU3 A;  1UHS A;  5D4S A;  5JVT A;  2DMU A;  4BUP A;  1RPW A;  2A61 A;  1ZN2 A;  2JA6 J;  2G9W A;  2UV1 A;  1FNN A;  2WWY A;  3G1L A;  4ZDP A;  3PIO F;  2NOG A;  2IW5 A;  4A3D J;  1XDU A;  3ESW B;  2OCE A;  5E1X A;  3H36 A;  4JX6 A;  5BNG A;  3U1D A;  4A3K J;  4FX4 A;  3ECO A;  4FHT A;  2EWN A;  5FGM A;  2VJJ A;  3HUG B;  4Z6Y A;  5LEJ A;  2EZL A;  2KRF A;  4EGY A;  1B8I A;  1VZ0 A;  5FLX K;  1I3A A;  1B9N A;  4ABZ A;  4Y52 J;  2QQ9 A;  5IT3 A;  2Z3Y A;  1GXQ A;  3SFZ A;  4V2F A;  1ZGJ A;  3V8J A;  2P6S A;  4HV5 A;  3KZZ A;  4A5N A;  4NUB A;  2HOS A;  4R8H A;  2B63 J;  1S7E A;  2UZK A;  2G7U A;  2IAI A;  1YO5 C;  3JRB A;  1VQ7 I;  2R4G A;  4NNJ A;  3WE2 A;  4BHP A;  1LQ1 A;  2UXN A;  1T0F A;  5F0F A;  1Z3X A;  2IA2 A;  4AIH A;  3CCY A;  4L18 B;  3K4J A;  9ANT A;  2X48 A;  1O7F A;  3UR3 C;  3GLX A;  5J4Y A;  1S8N A;  2FML A;  1MMA A;  1WKM A;  1BW5 A;  5HDN A;  3CUQ C;  4WK8 F;  3T1B A;  1K61 A;  1QNT A;  2Y48 A;  5B1B H;  3W2W A;  3AG1 H;  2RN7 A;  3OR1 C;  3SEZ A;  3I4N J;  1W36 D;  1H89 C;  3W3C A;  5IT9 K;  1QZZ A;  4XRF A;  1D1A A;  4MFD A;  3S32 A;  4DZJ A;  2BY2 A;  4UVC A;  3E97 A;  3WTZ A;  2PEX A;  2DXI A;  4HDU A;  3QWL A;  2QYO A;  2Y69 H;  2FBK A;  4W97 A;  3D5S C;  5CVV A;  4F7Z A;  2DA6 A;  3OS1 A;  4PK4 A;  2DT5 A;  3RZD J;  1ZAO A;  1FT9 A;  2NRA C;  4K2E A;  1PYV A;  4U7B A;  3HBL A;  5K5O A;  1UHM A;  1X19 A;  1ETO A;  3DP7 A;  3JAM Z;  3DFG A;  3G1M A;  4P5O A;  5F0C A;  4EJW A;  3ECH A;  1RR7 A;  4IJA A;  2X0L A;  5JFR A;  2L7F P;  4G6Q A;  1MND A;  1QZY A;  2E1C A;  3L2U A;  5DUI A;  1OFC X;  2A6H F;  1WJA A;  4IXA A;  2LBF B;  2UWM A;  4DOZ A;  1IAW A;  2M7A A;  1PUF A;  1J2X A;  1T38 A;  4BS9 A;  2X9D A;  4IRI A;  2ELJ A;  3A01 A;  3AG3 H;  2F6C A;  4KN4 X;  4N4N B;  2CUJ A;  1WRJ A;  2BHY A;  3M4O J;  3G2B A;  1JTX A;  2O9L A;  1EKE A;  3H9J A;  2LYC A;  1YI2 I;  3S16 J;  4I02 A;  1A31 A;  2CV2 A;  4YII A;  5LRS A;  2OJE D;  3A03 A;  1IN7 A;  3K4B A;  3VYT B;  4E7K A;  2PFB A;  1T56 A;  3C1D A;  3P9K A;  3VYR B;  3K2Z A;  1R00 A;  1X1D A;  3ABM H;  4PFP A;  3DLA A;  1IC8 A;  1XD7 A;  3BJ6 A;  1G3Y A;  3I0T A;  3KCC A;  3ZQG A;  3HOX J;  1LVA A;  1YHQ I;  1P4A A;  1Z7U A;  5ICE A;  2HU9 A;  4LLN A;  3H9Q A;  4EQQ A;  2H8R A;  4BY1 J;  1T39 A;  1P4X A;  4LMY A;  3FX3 A;  2V9P A;  5LEK A;  2HPM A;  1WH7 A;  4XLA A;  1ON1 A;  1T33 A;  3V42 A;  1AHD P;  4BQO A;  4BQQ A;  1ZG5 A;  1SAU A;  2FUG 2;  1TWF J;  3GX4 X;  3S3O A;  2JWT A;  4KIS A;  1IN4 A;  3KP3 A;  4GYI A;  2JZY A;  1SVM A;  1I39 A;  1KU9 A;  1WJC A;  4ETS A;  3PNY A;  1KU3 A;  1C0W A;  5EZH A;  2GIV A;  1MBG A;  1X58 A;  2DMN A;  3F21 A;  2QQ8 A;  4PJJ A;  3S17 J;  2CU7 A;  4A3G J;  1WJE A;  3ZMS A;  2P5L C;  4IOA F;  4NC7 A;  3HRS A;  3BY6 A;  2CQQ A;  2DJI A;  2QM3 A;  4L9T A;  3SQN A;  1CQT A;  2MH9 A;  4HX4 A;  1EH6 A;  2ZFU A;  3HEF A;  4RAY A;  3S3N A;  3VPR A;  4ZZD A;  4F55 A;  3KET A;  2ACJ A;  1JT0 A;  2GQQ A;  4G12 A;  1J5Y A;  2GZW A;  2YS9 A;  2ZB9 A;  4UV8 A;  4KUM A;  2FQ3 A;  2FA5 A;  2GIZ A;  3E6B A;  2IS1 A;  3L2W A;  1FBU A;  1OMI A;  4M3D A;  3G71 I;  4A3J J;  1HXD A;  3HHH A;  2J5P A;  4CYC A;  4GDF A;  1EH7 A;  3CD6 I;  4WF2 A;  1CGP A;  5D5U B;  4UNO A;  1LKX A;  2L54 A;  2LR8 A;  3FIS A;  1WH5 A;  1VQ9 I;  5FRO A;  4J01 A;  2YU9 J;  4WX9 A;  5AIQ A;  5D5W B;  3I59 A;  2K9S A;  3V8K A;  1S5L C;  1P2F A;  1D0Z A;  3S1R J;  2X4H A;  3E5X A;  3JRH A;  1YIT I;  2EPF A;  4KYW A;  4M9X A;  1BIB A;  3IH3 A;  3BG6 A;  1MBE A;  2F4I A;  2R7Q A;  4MFE A;  5LGU A;  2O03 A;  4BHC A;  2K40 A;  4RGX A;  2W84 A;  1B1B A;  1OYW A;  4I0A A;  3C2G A;  1J75 A;  3S2H J;  4XIC A;  1ACI A;  1MD0 A;  2R5Z A;  4DW6 A;  4UV9 A;  4P9F A;  2ICW G;  1XSV A;  2L7K A;  3IV5 A;  2CRG A;  5C3E J;  3J81 K;  2IGM A;  3DKW A;  1YG2 A;  2KMU A;  2O8X A;  4L5I A;  2E71 A;  3DEU A;  1EV7 A;  1Y39 A;  1UMQ A;  2DOF A;  2XF5 A;  1ETX A;  3QOP A;  3O3K A;  1IZ1 A;  3BZK A;  1FYL A;  1ERD A;  3LMM A;  1I6H J;  1J0R A;  2MW8 A;  4P1W A;  3ZQH A;  1OYY A;  2FQ4 A;  2KRC A;  2XAU A;  3T8T A;  4A3M J;  1Y8R B;  2WAQ N;  4EV0 A;  3TW6 A;  2X6W A;  3ASO H;  4HA8 A;  4M6X A;  4IHX A;  5L3C A;  2F4M B;  1FC3 A;  2DQR A;  3CF5 F;  1U3E M;  3IC7 A;  2XRN A;  2D45 A;  3GZN B;  1MKM A;  1FPQ A;  2K4J A;  1W5T A;  2VKE A;  4S0H B;  2ZC2 A;  3EYI A;  2Z16 A;  3OYL A;  3ABT A;  3CCU I;  1N75 A;  1RIO H;  5DCM B;  1R71 A;  1P9Q C;  4C3H J;  3FMR A;  2OV7 A;  4YG2 F;  3MKL A;  1R58 A;  5FFZ A;  2EK5 A;  2WBM A;  1U78 A;  3UKG A;  5F27 A;  1RKT A;  1WI3 A;  2EFP A;  1X3W B;  1FMW A;  3DPU A;  3K4K A;  1SAX A;  3GTL J;  3QPL A;  2FU4 A;  2JPB A;  4CCL A;  4JX5 A;  4OIO F;  4YIF A;  3CCM I;  3K9T A;  3G6E I;  3I3L A;  5FLM J;  1HBX G;  5H6Q A;  2E1O A;  1A6Q A;  5KVR A;  2RAE A;  4IHY A;  1FYM A;  2ESN A;  2GLO A;  3WGI A;  3P9C A;  1OCC H;  3D5R C;  1SFU A;  3F3X A;  3IUO A;  4O5V A;  2GWR A;  3OYA A;  2XGC A;  3PL8 A;  4DJA A;  4B1R A;  1PVE A;  2DOD A;  2P4W A;  4XLH A;  3HXL A;  4AC0 A;  5JR3 A;  4H0E A;  1MDM B;  1UAA A;  3FXU A;  5EGO A;  2DA7 A;  1ZRC A;  1FP1 D;  5J4V A;  4JQF A;  1UHW A;  3ZCO A;  5HLI A;  3HSR A;  3LQQ A;  3OIQ A;  2AO9 A;  1ZR2 A;  2IBD A;  2B0L A;  2R7F A;  4BQN A;  2Z1D A;  4XBF A;  1WPK A;  2DYS H;  3KYD B;  2CQK A;  1NG7 A;  1YQA A;  2E36 A;  1Z05 A;  3OYH A;  4PDK A;  4RLF A;  1TTY A;  3LA3 A;  3COA C;  1VQ5 I;  4UUT A;  3EYY A;  4BEH B;  4XKC A;  3F0C A;  2H6B A;  5L3B A;  1Q1V A;  3OYI A;  2R7Z J;  3TBI A;  2LVS A;  2K3F A;  3CDH A;  1IXS B;  4J00 A;  5EEG A;  3KZI C;  2ID3 A;  3WTY C;  4MQV A;  1YW8 A;  5B5E C;  1LDD A;  2DK8 A;  3FHZ A;  2E19 A;  1DDN A;  3FF5 A;  1BJZ A;  2OPT A;  1ZQ3 P;  1FMV A;  3L2V A;  3B6C A;  3BDD A;  2JSP A;  2CUE A;  4D7M A;  5D5V B;  1J59 A;  2LY1 A;  1SMT A;  5F1R A;  1P7I A;  2JN6 A;  2K3P A;  4HAM A;  2MYS A;  1RET A;  4HZF A;  4F93 B;  1BOB A;  3JRA A;  1QO0 D;  5EG0 B;  4HNU A;  4ZYE A;  3ELK A;  4HBL A;  1XN7 A;  3JSO A;  1A35 A;  1Z6T A;  2L0K A;  4YEJ A;  2JVH A;  3LSK A;  1G3T A;  2A6T A;  2BXY A;  1W7P B;  2XSD C;  3QU3 A;  1R1V A;  1S29 A;  4L9V A;  1FX7 A;  2BVL A;  2JUG A;  1YLF A;  1S7A A;  3SDG A;  1Z0X A;  1D5Y A;  1VTN C;  1O3S A;  2M5W A;  3BRO A;  2EB7 A;  5CVI A;  2M4K A;  1HSJ A;  2F5V A;  3RTR A;  1VF9 A;  1WI9 A;  4DGW B;  3I4P A;  2COM A;  1G8X A;  2F5C A;  3ABU A;  1ETQ A;  4IF4 A;  4G7Z F;  4CCK A;  2E5Z A;  3BT9 A;  3VOE A;  1I27 A;  3CCQ I;  3BZC A;  5C4J J;  2KIM A;  1SD6 A;  1B4A A;  3PO2 J;  2L2O A;  4IVN A;  1BJA A;  1TW3 A;  2HNH A;  4Y17 A;  5M5Y J;  1K4S A;  3HSF A;  4ZYG A;  4CA0 A;  1OPC A;  4NQW B;  4WWC A;  1IRX A;  4MGR A;  3OR2 C;  5KCM A;  4RB3 C;  5CYV A;  4A3F J;  3DBR B;  4XLC A;  1OCR H;  1GLN A;  2GAU A;  2VQC A;  1MSE C;  4BAY A;  3LSJ A;  1F9N A;  3OYE A;  1WFX A;  2L3D A;  3FMQ A;  2LKP A;  2W25 A;  3PJR A;  3QU6 A;  2ZO4 A;  2KIQ A;  3QYF A;  4I6Z A;  2QBY B;  3MKZ A;  4G7O F;  3F6V A;  3MZ8 A;  5GPA A;  3CLO A;  1K6O A;  1SC7 A;  2R7S A;  3CCJ I;  3WTX C;  2Q2E A;  3PUB A;  3M1C A;  4NDL A;  4BXU A;  3LNQ A;  2ZXJ A;  3HRM A;  2VLA A;  4ZZL A;  4HQE A;  2RNG A;  2VXZ A;  4HX7 A;  2NNY A;  3DF8 A;  1R7J A;  5IYB J;  4M3E A;  1ZKG A;  1OYI A;  1K4T A;  3Q5F A;  3JRC A;  2CUZ A;  3CF2 A;  5ICF A;  1WJ5 A;  3OYJ A;  2KPM A;  2UXX A;  3DCF A;  4HF0 A;  3E1S A;  3LAJ A;  4EMS A;  1B6A A;  2XVC A;  3VEP A;  1I3Q J;  3V8L A;  1T6S A;  3IRQ A;  2W4S A;  2A5W A;  3Q3S A;  4RGS A;  1BW6 A;  3DKX A;  1G59 A;  1FZP B;  3HPG A;  2Z2S B;  1L0O C;  1LDK B;  1J09 A;  1SVL A;  3PM1 A;  4D7N A;  1S72 I;  2RDP A;  1XC5 A;  2HEO A;  1ZAR A;  5GTH C;  4N9I A;  3CTA A;  1YTY A;  4A2U A;  3KEY A;  3VOD A;  3Q0U A;  4RS8 A;  3SZT A;  1W5C C;  1DPU A;  3TDZ C;  4EJU A;  1BOA A;  1D8K A;  3GEZ A;  1UST A;  2BW3 A;  1D3Y A;  2BY0 A;  1HF0 A;  3SEQ A;  2ZME C;  2D5V A;  2F5E A;  3F6O A;  1HW1 A;  3GZ6 A;  5M5X J;  3OV8 A;  3DLL F;  3HTS B;  3QAH A;  4QIW N;  4RAG A;  4IQ4 A;  3SXY A;  5D6E A;  3K69 A;  3CO6 C;  3BR1 A;  2VN2 A;  3IWF A;  2ZKZ A;  1JUP A;  1UJ8 A;  2ELH A;  3MD2 A;  3OYB A;  3M3Y J;  4A3B J;  4IHS A;  2EA2 A;  2M8E A;  3GWZ A;  3KE2 A;  4XOP A;  2R7O A;  5K7Z A;  2EZH A;  4B48 A;  2TCT A;  2PJP A;  5IYD J;  3GLL A;  4RMN A;  2IA0 A;  1FTZ A;  2LNB A;  4D9J A;  4LK1 F;  2HGC A;  4DYQ A;  3S93 A;  2LTP A;  1FIA A;  1G6N A;  1UZC A;  2Q1Z B;  3ZQI A;  2EIK H;  3LQR A;  5JVG F;  2NVX J;  3QRF F;  5LFA A;  1B8I B;  5GAD J;  1IRF A;  2ESH A;  3Q9S A;  1BR1 A;  4II2 A;  4CH7 A;  3GTM J;  1VQO I;  2EBI A;  2ZCW A;  1YW7 A;  1BC8 C;  2CG4 A;  3WTV C;  2HYG D;  5HNH A;  2YPR A;  3C2B A;  2CH0 A;  2K9L A;  4PGG A;  1J7K A;  3FXJ A;  4FTH A;  3C18 A;  1TNS A;  1TNT A;  4M71 A;  4UXN A;  3ZQ7 A;  3S8P A;  3OOU A;  4FET A;  3ZR8 X;  2LLK A;  3KYC B;  1JUS A;  1S6L A;  4FQG A;  3TDU C;  1FY7 A;  3TW7 A;  4A0Y A;  1FP2 A;  2MGQ A;  3CLQ A;  2JVG A;  2MBF A;  4BKX A;  1Y6I A;  3FKI J;  3E5Q A;  2PJR A;  2VQG A;  1XSD A;  5EEH A;  2HVR A;  3OL3 A;  4ZJZ A;  3OMY A;  1D0Y A;  5GAG J;  3KLN A;  1FSH A;  3W6J B;  4RB0 A;  3HGG A;  1NG6 A;  2QKL B;  3F8M A;  4I09 A;  5HS8 A;  3MFK A;  4XON A;  3F8F A;  4ASN A;  3QYE A;  2HVQ A;  3HSE A;  2ID6 A;  3HKZ N;  3QQA A;  3NEU A;  1T2K A;  3BZ6 A;  3ASN H;  1O3Q A;  1Y0N A;  3MWM A;  2PX9 A;  1JJ6 C;  1I50 J;  3I71 A;  2VE8 A;  1FOY A;  1R5I D;  1LE8 B;  4N0B A;  2DK5 A;  4XQF A;  3WG7 H;  2ZME B;  2VOP A;  2XB5 A;  4XLP F;  3K6G A;  2K9Q A;  2P81 A;  2E2H J;  1WJB A;  2NS0 A;  2EIN H;  2VC0 A;  5DM6 F;  3J7A O;  4B8X A;  2VE9 A;  5E1W A;  3WTS C;  3A01 B;  4S04 A;  4HF2 A;  2XAH A;  1QPM A;  1UCR A;  3VFZ A;  3WTU C;  5K7H A;  1XDS A;  4KT5 C;  2DJN A;  2DDA A;  3J7Z I;  3RYR A;  3I56 I;  2LSO A;  2WAE A;  4BHB A;  3P5J A;  3ERE D;  2ME0 A;  2GOX B;  3GO5 A;  3K2A A;  5LGT A;  5D4R A;  3KYL A;  5E18 F;  3DPT A;  3T0Y A;  3F8C A;  2L9S A;  3FM3 A;  1QHG A;  2N8G A;  2VBX A;  4BYY A;  2VB6 A;  3HOY J;  2BV6 A;  3L9F A;  1BA5 A;  2FSW A;  5EEA A;  4QTR A;  3L7W A;  3BCA A;  3S2W A;  3DEE A;  3NAU A;  5C4X J;  1Y1V J;  2B7E A;  3LSP A;  3PIP F;  2R7V A;  5HVQ C;  3W6K B;  1S7O A;  4OAY A;  2R7W A;  2FXA A;  4OAZ A;  3TOB A;  3DU6 A;  3RYP A;  1O57 A;  1ZRF A;  1BM9 A;  2RKH A;  1G3W A;  4ITV A;  4L9J A;  1MJB A;  5EF6 A;  1SAN A;  2PI0 A;  2IS2 A;  1D0X A;  1XGN A;  4XSZ F;  4BE0 A;  1BI2 A;  2E1N A;  2GA1 A;  1VFC A;  5CVU A;  5H2F C;  3BG7 A;  1HC8 A;  5IP6 A;  1TBX A;  4R79 A;  4LG0 A;  3TQN A;  4CSW A;  2ZBK A;  3FK7 A;  3HOZ J;  1ON2 A;  5E1Z B;  2XAS A;  2CSO A;  2LMD A;  1AKH A;  1DU6 A;  3CME I;  4JK1 X;  1VI0 A;  2LG4 A;  2WV0 A;  4L5J A;  1UG0 A;  1X4P A;  4DYR A;  1QHH D;  4WCG A;  2WB1 N;  1X1P A;  3NAR A;  5LLQ A;  1WCM J;  5CVR A;  1Z91 A;  4BAC A;  3DXJ F;  2PLY A;  1OR7 C;  3K4N A;  1K78 B;  3S1N J;  1IRG A;  1WVR A;  4Q4Z F;  4EM0 B;  4GRI A;  1K6Y A;  3IH4 A;  2Y0M A;  3BJO A;  2MLG A;  1H8A C;  5HOO A;  3C7J A;  3CJQ B;  2MD0 A;  2KQR A;  3R0A A;  2JA2 A;  3VSL A;  3DPL C;  3MN2 A;  4CYC B;  4E7L A;  3V7S A;  3HUG A;  4U0W A;  3A2K A;  4ESF A;  2L9N A;  4RLQ A;  4BJ5 C;  1G4D A;  1JTY A;  5LHH A;  1YS6 A;  3JCU C;  3HDD A;  4FAS D;  1IUF A;  1DQU A;  3K4L A;  3QPT A;  3UNG C;  5JI6 A;  2EIM H;  1GUU A;  2VJ4 A;  1TWA J;  4XK4 A;  3TMO A;  3OL4 A;  1ZHF A;  4JOM A;  3GW2 A;  1JT6 A;  1SMY F;  3MZY A;  3JRE A;  1D8J A;  2R93 J;  1P92 A;  5JHU A;  3IAM 2;  1T08 B;  2PQ8 A;  4M6V A;  4GYG A;  2ZXI A;  3WHC A;  2R5Z B;  1GVD A;  2PMZ N;  3JAM K;  2KDO A;  2W57 A;  3ZN1 A;  2O6G E;  3FDY A;  2KL4 A;  3KP6 A;  1VQL I;  3H5R A;  4LIU A;  1JGS A;  4D1Q A;  1OCZ H;  4G6D A;  2NOJ B;  5HDG A;  2HFH A;  3K70 D;  3BQY A;  3KZY A;  1VND A;  2LRE A;  4PGH A;  4XMY A;  3I5U A;  5K5Q A;  3K4C A;  3QP5 A;  1ETW A;  2CFO A;  5F1J A;  3M8F A;  1HKS A;  2IGO A;  3IH2 A;  3OYN A;  3N05 A;  1KQ9 A;  1WJD A;  3G1O A;  4LGW A;  1XCV A;  4ZYD A;  3D1N I;  4P55 A;  2M34 A;  4ZYA A;  4Y33 A;  5GTI C;  1SD5 A;  3CCE I;  5BMZ A;  5K7F A;  3ABK H;  4XID A;  3ONQ A;  2VT3 A;  3RKY A;  5DM7 F;  1MNM C;  1DUX C;  3QOE A;  5E3O A;  3CC2 I;  3D5L A;  5B3S H;  4OIP F;  3SFI A;  1TP4 A;  2P5K A;  5CQE A;  5L3E A;  3PNV A;  3E0J B;  4FT8 A;  1TQP A;  3FMS A;  3GTJ J;  5FO5 A;  2BEO A;  2LBF A;  2Y0S A;  5LHI A;  2RNJ A;  2QEX I;  3HPH A;  1X2M A;  4OMY A;  3WU1 B;  4DZP A;  1BIA A;  2VKD A;  2DT6 A;  3F8B A;  1OCP A;  1V3F A;  2FF4 A;  1ZEL A;  2HZT A;  4IO9 F;  2K7L A;  3LA2 A;  5E3L A;  2V1N A;  4MIM A;  2XAQ A;  1FOK A;  1XMA A;  5JLX A;  2RQQ A;  2KT0 A;  2VOD A;  4AYB N;  2ELK A;  3IWZ A;  1W1W E;  4TV7 A;  4AU7 A;  3HRU A;  4PJN A;  1ZTR A;  3BTJ A;  2ME6 A;  2BY3 A;  4ESB A;  1YS7 A;  4FCY A;  4XL9 A;  4UUV A;  3F8N A;  3MVP A;  2YUS A;  5M3M J;  4XRS A;  4RDU A;  5ILS A;  2H94 A;  2K9M A;  2XB0 X;  2DOE A;  4H4K C;  5LHG A;  2DTZ A;  4PSW A;  4XR6 A;  2VUM J;  1UFM A;  4ENK A;  2DFH A;  3K4M A;  3DV8 A;  4MEX F;  3FHN A;  2IGK A;  4HX8 A;  4CIC A;  2IP2 A;  2OAZ A;  2VPR A;  4M3F A;  2RGV A;  5K1Y A;  4EM2 A;  3JTG A;  2VJ5 A;  3OWT A;  3F22 A;  2HKO A;  5J6X A;  1ENH A;  3LSI A;  3WHB A;  1PUE E;  3BTC A;  2M87 A;  1LB2 A;  3KEQ A;  5FRM A;  2W00 A;  4CCO A;  3H0G J;  1JKO C;  1YW9 A;  1BI3 A;  4O6J A;  3KP4 A;  4PFO A;  2DYR H;  5AON A;  4U88 A;  2V1U A;  2Y31 A;  3CUQ A;  2R0Q C;  3GZ5 A;  4M73 A;  2VIX A;  4E7H A;  2OU2 A;  1Q1H A;  4CHU A;  2IEK A;  2H09 A;  4RGU A;  5F64 A;  5CLS A;  1S3J A;  2V6C A;  1MH4 A;  2OZU A;  3H3Z A;  2GXA A;  1AU7 A;  1N25 A;  2K02 A;  2LP0 A;  4KN7 X;  3BCB A;  2XSJ C;  4A3C J;  1X3Z B;  2GA2 A;  1BN5 A;  1ODD A;  3TOA A;  1G2H A;  4DQ2 A;  4KIF A;  1TT5 B;  2HQN A;  3OIO A;  1E3H A;  1ZLK A;  3ZMZ A;  5A2Q Z;  2LY9 A;  2OA4 A;  3ZN0 A;  1ETY A;  1TZL A;  1HW5 A;  4KJZ A;  2NVY J;  1GV5 A;  2CS3 A;  2K27 A;  2A69 F;  4LIT A;  1I5Z A;  3FZV A;  4F91 B;  5E3N A;  1W36 C;  3LOC A;  3TED A;  3GYH X;  1IO2 A;  3GBG A;  2VQL A;  2HXI A;  4DYC A;  4BBS J;  5L3D A;  4E70 A;  1MBH A;  3EQL F;  1JE8 A;  4Y3O A;  3BOQ A;  5HDK A;  2M9H A;  1Z6R A;  3ZMD A;  1T95 A;  2DFF A;  2DT7 B;  2ZJR F;  1ZGA A;  2L9R A;  3LST A;  3LSH A;  1ULY A;  2IS6 A;  1MMN A;  3A0B C;  4HRI A;  4KIC A;  1OIS A;  3CMY A;  2BVM A;  4ENM A;  2FE3 A;  5CQG A;  2W1O A;  3FBN B;  4Y4R A;  3VYS B;  5TGT A;  1XMK A;  2O7O A;  3HKZ A;  3I64 A;  3D0S A;  3M9A A;  4F92 B;  1YJ9 I;  1WSU A;  2HDD A;  3V4G A;  2EIL H;  4XRM A;  2XDV A;  1XCB A;  4XRS G;  1ZRE A;  4EAT A;  2DW4 A;  2QQA A;  3BPX A;  4CDG A;  2DFE A;  3B6A A;  4C3I J;  1CF7 B;  2X85 A;  1F36 A;  2RRE A;  5EDN A;  2KZV A;  2DA5 A;  1GVJ A;  2F2E A;  2O5R A;  4ESJ A;  4A12 A;  1SD7 A;  4OIR F;  1WZ2 A;  3AFH A;  2MG4 A;  2E7X A;  3W2A A;  3NWT A;  2L4M A;  2M0M A;  5A2Q K;  3AAF A;  2I10 A;  1XPX A;  4X1E A;  4IKF A;  4DBQ A;  2MLK A;  5DV5 A;  4EJV A;  3JRG A;  1U8R A;  5J8F A;  1QVU A;  3JRD A;  1P7J A;  2OZ6 A;  4EJO A;  4UUS B;  2KIU A;  2XHK A;  1K7A A;  2H8W A;  2OTL I;  3EUK L;  2M2E A;  1YX5 A;  3ZGK A;  3LSM A;  1HOM A;  4EEF G;  3JRF A;  2OBP A;  3GTO J;  2V6E A;  3RPU A;  4C2U A;  2NVU B;  4BJ6 C;  2E7W A;  5FKL A;  3HHG A;  3PSF A;  2XAF A;  2NAZ A;  3OS0 A;  3LSR A;  1IF1 A;  3HIF A;  5JLW A;  2B9S A;  1AWC A;  3CCV I;  3H3V K;  1OCT C;  2OC6 A;  1JUM A;  2WV1 A;  4HF1 A;  1FEX A;  4RGR A;  1IDY A;  3K1N A;  3IKT A;  1IN5 A;  1OJL A;  3ZMV A;  1BR4 A;  2KIS A;  2QLZ A;  3TO7 A;  1ZG1 A;  4BJT A;  1DP7 P;  3PO3 J;  3BJA A;  1TW2 A;  2DPD A;  1T8I A;  5BOX A;  3FXO A;  2O0Y A;  3S1M J;  3DTI A;  3GTQ J;  1REP C;  4F52 A;  1GV2 A;  2LFB A;  3CCR I;  1B9M A;  3FK6 A;  2BXZ A;  1ZGW A;  4X6A J;  3DTE A;  2HTJ A;  1TQI A;  2LK2 A;  4AVP A;  2GXG A;  1BI1 A;  2BW3 B;  1MDM A;  4IHT A;  2XPU A;  4ZH4 F;  3PQJ A;  2AQF A;  1QQI A;  1UG2 A;  1RNL A;  3TP3 A;  3WOD F;  4CO8 A;  1R4M B;  2HQA A;  2CO5 A;  4LIV A;  3GUD A;  2L5Q A;  2HR3 A;  3V7C A;  5DUK A;  4ENN A;  1VQ4 I;  2UUZ A;  5DEQ A;  2HYJ A;  5ERI A;  2WB1 A;  3S14 J;  3JSP A;  2H27 A;  2K86 A;  4DIQ A;  2DBB A;  2OCC H;  4BEH A;  3U9G A;  2F48 A;  1D1B A;  4J19 A;  2ZJ2 A;  3R0J A;  3JW4 A;  4MTE A;  4L9N A;  1ITY A;  1E0E A;  1XGO A;  1XG1 A;  1T0F C;  2CW8 A;  3IAS 2;  2LDU A;  2JA5 J;  5LRR A;  1RZ4 A;  4FX0 A;  4XSX F;  5E3M A;  2VXD A;  3CP8 A;  3ZQQ A;  4D0P A;  2L4A A;  3ZPL A;  4KIT B;  3A0H C;  1ONV A;  1YFH A;  3A4C A;  4BXF A;  1M1E B;  1OCO H;  3RJP A;  1FOW A;  2FNP A;  2Q0O A;  2HDC A;  1U9O A;  2XRO A;  5IPA A;  1K79 A;  2XGX A;  4CYD A;  5TIS C;  3T8R A;  4YIR X;  1IXC A;  2ADU A;  1IDZ A;  4B4C A;  5IP7 J;  1MMG A;  2R5Y A;  3BR6 A;  2YX7 A;  3TO6 A;  3S15 J;  4IHW A;  5HLH A;  5AIP A;  1IJW C;  1KGS A;  2JMW A;  3I58 A;  1Z1D A;  4IRH A;  1W7P A;  3KX2 A;  3TKY A;  1XGM A;  3WU2 C;  3H5N A;  2PMZ A;  2VPL A;  3ZXS A;  4Q48 A;  4RM2 A;  1E2X A;  2LF7 A;  1WJF A;  4LLG F;  4CCN A;  2ZXW H;  4PSX A;  3J7A Y;  3CCS I;  3RQI A;  2YR2 A;  2EIJ H;  2VJI A;  4HNV A;  3ZRG A;  3ISP A;  2HOA A;  1LVK A;  1RES A;  2JT1 A;  1TWC J;  2VBW A;  4C2M J;  2I5U A;  1MMS A;  1IW7 F;  2NVQ J;  4NC8 A;  1FIP A;  2H6C A;  2A07 F;  3GF2 A;  4RB2 C;  5KNL A;  3HOU J;  4IRG A;  3K10 A;  1OLT A;  4M72 A;  1RUN A;  4NQW A;  1U9N A;  1ORK A;  5FKO A;  2VKV A;  3FBI B;  3IHU A;  4MO7 A;  4IQJ A;  1LFU P;  2MC4 A;  1IUY A;  2VKH A;  2KLO A;  2A3S A;  3N4M A;  4YFK F;  2OF7 A;  1IV8 A;  3SJM A;  5EZG A;  2E2J J;  2ISZ A;  3K1P A;  2DA3 A;  1LNW A;  2EFO A;  1BI0 A;  2GOM A;  1FLI A;  3ROU A;  3HGY A;  3HRT A;  1RRJ A;  1U5T A;  1VQK I;  3HYI A;  4XM3 A;  1MMD A;  5LBQ A;  4EVI A;  3FXK A;  1Z67 A;  1HST A;  2F5F A;  2VBY A;  3CC4 I;  4ZC3 A;  1MJ9 A;  1LPQ A;  1YOV B;  2FOK A;  1P4W A;  5F08 A;  4AYB A;  1A04 A;  3L2R A;  1P6R A;  2XGE A;  1POG A;  3RPU D;  1QA6 A;  3LA7 A;  2NVT J;  1BBY A;  3SYT A;  2LRD A;  1J9I A;  4A6D A;  1W0T A;  2W85 A;  5DD8 A;  2QZ8 A;  4V2G A;  1N78 A;  4I7H A;  1JI8 A;  2EV5 A;  2QF7 A;  1ZYR F;  5JHF A;  5LD2 C;  2ISY A;  5FLX Z;  3OYF A;  5F04 A;  3OYK A;  1GT0 C;  2FX0 A;  2HXO A;  2FNA A;  1BR2 A;  2E60 A;  2RVC A;  2WY8 Q;  3E6C C;  4KFC A;  4D5F A;  4HOB A;  2O61 A;  3OSF A;  3EET A;  1RI7 A;  4B43 A;  4E7Z A;  1R5G A;  3E6M A;  4G6T B;  4XOT A;  5DYM A;  2KJB A;  1VQP I;  4R1H A;  5ED4 A;  3RCO A;  2HWV A;  3HM5 A;  2XKO A;  3LL7 A;  4B3X A;  5K5R A;  3ZP5 A;  4U0Y A;  3RI4 A;  4BGD A;  1DGR M;  1H9T A;  2WAQ A;  2M3A A;  3L2C A;  4AM3 A;  1FBS A;  3CZ6 A;  2V9V A;  4M9Z A;  1YIO A;  2Q8K A;  3RDI A;  3REO A;  4C9Y A;  2I8D A;  2ZSH B;  2IA1 A;  3O2P E;  1YRN A;  4Q47 A;  4AID A;  4X0G A;  2K9N A;  2JTV A;  1TQM A;  1OQY A;  1RC9 A;  1W5S A;  1EH8 A;  3WG9 A;  1FJL A;  1MNE A;  2AS5 F;  4CUG A;  3I55 I;  2KDZ A;  5J40 A;  4JP0 A;  4PJM A;  4YEL A;  1PUF B;  5IT9 Z;  3Q9V A;  2W48 A;  3GXO A;  3K1M A;  5KAF C;  3BP8 A;  3MQ0 A;  5HLT A;  1MBF A;  3L1P A;  4B44 A;  3SHF A;  3OYG A;  3PFI A;  2V4J C;  3SZG A;  1LEA A;  2XC7 A;  3GTG J;  1R6R A;  2X6Y A;  5KAI C;  1XSX A;  2A05 A;  3AKZ A;  3ZMU A;  3HL2 A;  4IL6 C;  3CUO A;  5DTD A;  5FRN A;  1APL C;  2HTS A;  1JXS A;  2M0C A;  3OOP A;  2E2I J;  2BYV E;  4LB5 A;  1Z3Y A;  3FM5 A;  2DPU A;  2E34 A;  5GP9 A;  4LK0 F;  3LAP A;  1JKP C;  2VQH A;  1U0J A;  4PZJ A;  1USS A;  4QWQ A;  1SFX A;  3C3W A;  4PJL A;  3WU0 A;  1F43 A;  1LFB A;  2M8G X;  1QRY A;  2XKP A;  2PN6 A;  5IOZ A;  1X3U A;  1RKW A;  2NXN B;  4D5C A;  3PQK A;  2LKX A;  4Y7N J;  4A0Z A;  4HLX A;  3DU5 A;  3IKV A;  3S1Q J;  1B72 A;  1Y8Q B;  4B3A A;  5H6R A;  1U8B A;  1W4M A;  1AA7 A;  2H1K A;  2OD5 A;  1W7P D;  5HS7 A;  1QBJ A;  4MTD A;  2JK3 A;  3ZQC A;  4QLC U;  4IEJ A;  1U6G A;  1O7L A;  1YJW I;  3PNT A;  1SFO J;  2X1D A;  4B47 A;  2L02 A;  2JA8 J;  2LH9 A;  2MFZ A;  4MEY F;  4IX7 A;  2CJJ A;  2YSR A;  4OU0 A;  4IOC F;  5GPC A;  1H88 C;  4HPQ A;  2HOT A;  3I54 A;  5ICC A;  3QP6 A;  1R1U A;  3S3M A;  1HDD C;  3QYB A;  3VB2 A;  3HOS A;  2Z99 A;  3FWE A;  3MEX A;  4G94 A;  1KU7 A;  2X6O A;  3H35 A;  5CKT A;  3TO9 A;  1KYW A;  1D1C A;  4HLY A;  4XKW A;  4JX4 A;  4LFU A;  2QA4 I;  3HC7 A;  2R7U A;  1TWG J;  5D8L B;  5FKM A;  3A02 A;  3CJT B;  1DP3 A;  4WXH A;  2DA1 A;  4C30 A;  4BDZ A;  4I99 C;  1AOY A;  2O3F A;  2XV4 S;  5GAH J;  3RKW A;  1X1B A;  5L3F A;  3ML6 A;  3U21 A;  3ULQ B;  2IXS A;  2KRH A;  5LGN A;  2XAG A;  2P6T A;  1KU2 A;  3OYM A;  2QEN A;  1XB4 A;  3O8H A;  4HEA 2;  2KIF A;  1LE8 A;  2KJC A;  2XF6 A;  5HLG A;  2DU9 A;  2MH2 A;  2ZME A;  3H92 A;  3VDX A;  4L5E A;  1IXR C;  5BS6 A;  4EJT A;  1KQ0 A;  2DA2 A;  2R7X A;  1LFP A;  2IT0 A;  4UB6 C;  2WAD A;  3CP2 A;  5CVJ A;  3I59 B;  4BBR J;  4WXC A;  2XPW A;  1PJR A;  2IS4 A;  3RKQ A;  5TRD A;  2FEZ A;  2IPQ X;  4RAZ A;  3K7A J;  1KQ8 A;  2QVO A;  1MBJ A;  4F3Q A;  4Z2Y A;  3CMM A;  3AL0 C;  2EFQ A;  4I98 B;  4UVB A;  1ZR4 A;  4RB1 A;  3WGH A;  4E7S A;  4AIJ A;  5E20 A;  1G3S A;  2COB A;  4RBO A;  1Z7L A;  2A6E F;  5B1A H;  2HPI A;  4P96 A;  1SD4 A;  2EZK A;  1FTT A;  1R23 A;  2FBI A;  3EUH A;  5CPR B;  5ICG A;  2O8K A;  4AVZ A;  2W24 A;  4UVA A;  5E17 F;  2MC3 A;  3BR0 A;  3KP2 A;  1H9G A;  1TT0 A;  2WC2 A;  2KHM A;  5J1R A;  2XGD A;  5KHD A;  2LF8 A;  4XN3 A;  1T98 A;  5J3L A;  3RSN A;  2QSG X;  1Z77 A;  4KDP A;  2M7B A;  4U0V A;  4KT6 A;  2L01 A;  3E6D A;  3BC8 A;  2RQP A;  3HB9 A;  3LWF A;  4JYK A;  4BY7 J;  2GXB A;  3C2H A;  1MH3 A;  3G3Z A;  3TGN A;  4BH9 A;  2JQ7 A;  3L2Q A;  4O3M A;  5E79 C;  3CUQ B;  1N77 A;  4KMU X;  1NHA A;  1WGX A;  4BNC A;  1WWX A;  3M8E A;  4DNC A;  3E3V A;  3H0D A;  1V5G A;  2EZI A;  1NK2 P;  1TL8 A;  4A3I J;  3J81 Z;  3GCM A;  1SVO A;  2ZNY A;  2HOE A;  2NNN A;  2L7M P;  4HW0 A;  4KIB A;  1LEB A;  2OUM A;  1KYZ A;  1WHU A;  2WY7 Q;  3DKY A;  3U2R A;  2HS5 A;  2WA0 A;  4LOC A;  4NBQ A;  2STT A;  4IHV A;  2X1E A;  1HA8 A;  3TP0 A;  2R7R A;  3LSG A;  1R36 A;  4CZZ A;  3HTU A;  2M30 A;  2MD5 A;  2DA4 A;  4OMZ A;  1IRZ A;  2K4B A;  2P7V B;  1JKR C;  1MIJ A;  1X1C A;  2XAJ A;  2ZSI B;  5D5X B;  2FRH A;  3RPQ A;  2DAO A;  1K78 A;  4ZTF A;  4NHJ A;  6PAX A;  3B02 A;  1BC7 C;  1R22 A;  1YX3 A;  4P9U A;  2JA7 J;  2HQR A;  4KIG A;  4BU2 A;  3M8J A;  1VQ6 I;  4HG2 A;  4NC6 A;  3GFI A;  1EF4 A;  5ILU A;  2EFW A;  2V26 A;  5J8C A;  3U1K A;  3GTK J;  2CUF A;  1SFE A;  3KLO A;  2MAB A;  5IYC J;  1YE9 A;  3E7L A;  4YRV A;  3PFY A;  3QPH A;  2RV8 A;  2P7C B;  5FKN A;  4MHG A;  2FJ1 A;  5KK1 A;  5EGO B;  2Z33 A;  3E5U A;  3VWB A;  4GXO A;  3J80 Z;  2VC1 A;  2X6X A;  3PUF A;  1RUO A;  5J47 A;  2FD5 A;  3H9G A;  2HI3 A;  3F72 A;  2LKS A;  1GXP A;  3RIR A;  1E17 A;  2IJL A;  1TC3 C;  2NS7 A;  2CW0 F;  2PBI A;  1JHH A;  3AG2 H;  1ZLJ A;  1MSF C;  2EA4 A;  3CJN A;  3AL0 B;  2V1X A;  2STW A;  1ZH5 A;  3A1Y A;  2ZFW A;  2HVS A;  3H3U A;  1ETK A;  4OIQ F;  4EGZ A;  1E3P A;  4OIN F;  1O4X A;  3KP5 A;  3NWS A;  2V79 A;  4HDV A;  2K85 A;  2X51 A;  5EYR A;  2M45 A;  3LFK A;  3HOT A;  5DDG A;  1MZB A;  5L3G A;  1D5V A;  5C44 J;  3BTI A;  1QGP A;  2KFD A;  3FXL A;  1V5E A;  4BE1 A;  4GO1 A;  3JTH A;  3L00 A;  1R1T A;  4U87 A;  4M3B A;  3FXR A;  1I6X A;  1YYV A;  3RQ4 A;  1STZ A;  1XX5 A;  2A5Y B;  2E1M C;  3MAJ A;  2IVM A;  2VBZ A;  3OYC A;  1I1S A;  3M1E A;  1X1A A;  4L0Y B;  5H20 A;  4QPQ A;  2ZJQ F;  4XNF A;  2L7Z A;  2QUF A;  4ANJ A;  1E3O C;  1Y0U A;  4HSR A;  3DWL E;  4GFB A;  4M3G A;  1PDN C;  2DMQ A;  3BWG A;  1JHF A;  2EFN A;  3G73 A;  2JSC A;  3LFU A;  1F4K A;  3I53 A;  4ZDO A;  1XS9 A;  2BZT A;  5E8G A;  3VSK A;  1F5T A;  4HNT A;  4MNU A;  2GBY A;  1NK3 P;  1IGN A;  2CQN A;  2Y9Y A;  4NB5 A;  3J80 K;  5BPD A;  1VQ8 I;  1YJN I;  1XTA A;  2AXT C;  3GFM A;  3ZMT A;  4G8X A;  3V7R A;  4GGG A;  4FE7 A;  2ZJP F;  3R60 A;  2BOL A;  2MA3 A;  1OR7 A;  2QWW A;  2PMH A;  2QGU A;  2DO7 A;  2KZG A;  2P0W A;  3OY9 A;  1L3L A;  1GHC A;  3F23 A;  3L09 A;  1ZK8 A;  1GDT A;  5FD5 A;  5F0H A;  4I0B A;  2AHQ A;  4ZTJ A;  4B09 A;  2GM4 A;  4CCJ A;  1F1Z A;  3KP7 A;  1FWZ A;  1V55 H;  3O8G A;  3BG5 A;  2BHZ A;  3FXQ A;  4CXF A;  3ZOB A;  3CMA I;  2JJ7 A;  2DFI A;  1PP7 U;  2DQL A;  1JJ8 C;  2JRT A;  1OKR A;  2JUC A;  3H1C A;  3MMY B;  3R6S A;  4E6K G;  4Y13 A;  3P7N A;  1PP8 F;  1B59 A;  2JPC A;  2CMP A;  4BE2 A;  4A6E A;  1W0U A;  3O6B B;  3KFW X;  4ENJ A;  4FIS A;  3ERM A;  5B66 C;  3EUA A;  1UB9 A;  2LC2 A;  1XMX A;  3DQV C;  1XGS A;  5BPI A;  1U5T C;  2G0E A;  2MSY A;  3MKY B;  2XIG A;  2DMP A;  1ZG3 A;  3BR5 A;  4L0Z B;  3QPS A;  3KIO A;  2W82 A;  3R4K A;  1X2N A;  2ZXH A;  3X2Q H;  5EJC A;  5BQT A;  3IL2 A;  2Q2E B;  1R5H A;  1LUJ B;  2RC4 A;  2NYX A;  3RZO J;  1FOX A;  1I1G A;  2EH3 A;  4OOI A;  2PG4 A;  4RA2 A;  5D8K B;  2OTJ I;  1QZE A;  1UEL B;  1EA3 A;  5DCM A;  1TLH B;  3SDB A;  2D2W A;  4LD5 A;  5D6F A;  2EJR A;  4C2T A;  2R3S A;  2E1M B;  1O3R A;  3QOD A;  2WAF A;  2QQB A;  2J5O A;  3BR2 A;  4HQM A;  2X1C A;  2P5V A;  4LG3 A;  3CCL I;  3JRI A;  4PJ0 C;  2BE5 F;  2L9V A;  2CV1 A;  2IRF G;  1HLV A;  2R5Y B;  4XLF A;  2ECB A;  2HYF A;  3K70 C;  3J7Y J;  2E35 A;  2K5C A;  3HG9 A;  3Q0V A;  2IGN A;  4A3L J;  5IOY A;  1DU0 A;  2Y2Z A;  5FFX A;  5M3F J;  2CV0 A;  4RM3 A;  1HKT A;  4ZYH A;  2C6Y A;  1JKQ C;  2LY2 A;  3HOV J;  4HST A; 
#chains in the Genus database with same CATH homology
 2EV0 A;  4IPA A;  2VOO A;  4LLL A;  4A5M A;  1FYK A;  2FBH A;  2F5D A;  2M1B A;  4M9S A;  1KA8 A;  4XLN F;  4CGZ A;  4U7D A;  2KKO A;  4HYE A;  1IN6 A;  4LB6 B;  1WQ2 A;  3GVA A;  3WTW C;  2CFX A;  2DTR A;  2YX4 A;  1CF7 A;  3IRR A;  2BBY A;  3K0L A;  1IN8 A;  3MCZ A;  1LDJ A;  2XUB A;  1ZRD A;  1Z9C A;  2DI3 A;  4JBA A;  4YFX F;  5TJJ A;  2ZNZ A;  2TDX A;  3P9I A;  4I01 A;  1U5T B;  3BPV A;  4KMF A;  1MGT A;  2DLL A;  5E8I A;  4G7H F;  1MJA A;  1FBQ A;  2WTE A;  2Y75 A;  2PMU A;  4A0X A;  4UHT A;  2EV6 A;  3T5X A;  2R7D A;  5HS9 A;  4KNY A;  4EM1 A;  5F6F A;  4LJZ F;  3MZH A;  2A68 F;  3NRV A;  4HV6 A;  3GFL A;  3NQO A;  4BQA A;  3EDP A;  4WXD A;  2HKX A;  5ILV A;  1DPR A;  4GCV A;  2Z9O A;  2CYY A;  4KA4 A;  2BGC A;  3M7G A;  5FD6 A;  2D1H A;  1HQC A;  1FSE A;  3RKX A;  2FMY A;  2G7H A;  5FB2 A;  3GFJ A;  2CWE A;  2QBY A;  1H0M A;  2D1V A;  3CO7 C;  3SZP A;  2CGP A;  3WTT C;  4I2O A;  2VON A;  4AIK A;  2VT2 A;  3N97 A;  5CJ9 A;  3WE3 A;  4M6Y A;  1LJ9 A;  3B73 A;  1HKQ A;  2Z5U A;  2P8T A;  4Y15 A;  5DCF A;  4YFN F;  4M74 A;  2OQG A;  2AXL A;  4PCQ A;  4AWX B;  4S05 A;  5DD4 A;  2ETH A;  2V1D A;  2YU3 A;  4G9Y A;  4LG0 B;  1V4R A;  3R61 A;  3KEO A;  4ON0 A;  4MQ9 F;  4Q5S F;  1HW2 A;  1U2W A;  1O3T A;  4N9H A;  2OQR A;  3WGG A;  4AD9 A;  5D4S A;  5JVT A;  2A61 A;  1ZN2 A;  2G9W A;  1FNN A;  2WWY A;  2IW5 A;  1XDU A;  5E1X A;  3U1D A;  4FX4 A;  3ECO A;  4FHT A;  2EWN A;  5FGM A;  5LEJ A;  2KRF A;  4EGY A;  5FLX K;  1B9N A;  2QQ9 A;  5IT3 A;  2Z3Y A;  1GXQ A;  3SFZ A;  1ZGJ A;  3V8J A;  2P6S A;  4HV5 A;  3KZZ A;  4A5N A;  4R8H A;  2UZK A;  2G7U A;  1YO5 C;  3WE2 A;  4BHP A;  1LQ1 A;  2UXN A;  1T0F A;  2IA2 A;  4AIH A;  4L18 B;  1O7F A;  3GLX A;  1S8N A;  2FML A;  1WKM A;  5HDN A;  3CUQ C;  4WK8 F;  3T1B A;  1QNT A;  2Y48 A;  2RN7 A;  5IT9 K;  1QZZ A;  4XRF A;  3WTZ A;  4UVC A;  3E97 A;  2PEX A;  4HDU A;  2QYO A;  2FBK A;  5CVV A;  4F7Z A;  2DT5 A;  1ZAO A;  1FT9 A;  2NRA C;  4K2E A;  4U7B A;  5K5O A;  1UHM A;  3DP7 A;  3JAM Z;  3DFG A;  4EJW A;  4P5O A;  3ECH A;  4IJA A;  2X0L A;  5JFR A;  4G6Q A;  1QZY A;  2E1C A;  5DUI A;  2A6H F;  4IXA A;  2UWM A;  1IAW A;  1J2X A;  1T38 A;  4IRI A;  4KN4 X;  1WRJ A;  4I02 A;  4YII A;  5LRS A;  1IN7 A;  2PFB A;  3C1D A;  3P9K A;  3K2Z A;  1R00 A;  1XD7 A;  3BJ6 A;  1G3Y A;  3I0T A;  3KCC A;  1LVA A;  1P4A A;  1Z7U A;  5ICE A;  4LLN A;  4EQQ A;  1T39 A;  1P4X A;  4LMY A;  3FX3 A;  5LEK A;  1ON1 A;  1ZG5 A;  3GX4 X;  1IN4 A;  3KP3 A;  4GYI A;  2JZY A;  1KU9 A;  4ETS A;  1KU3 A;  1C0W A;  2GIV A;  3F21 A;  3ZMS A;  2P5L C;  3HRS A;  3BY6 A;  4L9T A;  2QM3 A;  3SQN A;  2MH9 A;  4HX4 A;  1EH6 A;  4RAY A;  4ZZD A;  3KET A;  2ACJ A;  2GQQ A;  1J5Y A;  2GZW A;  4UV8 A;  4KUM A;  2FQ3 A;  2FA5 A;  3E6B A;  1FBU A;  1OMI A;  1HXD A;  3HHH A;  2J5P A;  1EH7 A;  4WF2 A;  1CGP A;  5D5U B;  4UNO A;  2L54 A;  4WX9 A;  5AIQ A;  5D5W B;  3I59 A;  3V8K A;  1P2F A;  2X4H A;  3E5X A;  4KYW A;  4M9X A;  1BIB A;  5LGU A;  2O03 A;  4BHC A;  4RGX A;  2W84 A;  1B1B A;  1OYW A;  4I0A A;  1J75 A;  1MD0 A;  4UV9 A;  4P9F A;  1XSV A;  3J81 K;  3DKW A;  1YG2 A;  2O8X A;  4L5I A;  3DEU A;  1EV7 A;  3QOP A;  3O3K A;  1IZ1 A;  1FYL A;  1J0R A;  1OYY A;  3T8T A;  4EV0 A;  4HA8 A;  4M6X A;  5L3C A;  1FC3 A;  2DQR A;  1U3E M;  3IC7 A;  2XRN A;  2D45 A;  1MKM A;  1FPQ A;  2K4J A;  1W5T A;  3EYI A;  3ABT A;  1RIO H;  5DCM B;  3FMR A;  4YG2 F;  5FFZ A;  1R58 A;  2EK5 A;  1U78 A;  2EFP A;  1SAX A;  2FU4 A;  2JPB A;  4OIO F;  4YIF A;  3K9T A;  1HBX G;  5H6Q A;  5KVR A;  1FYM A;  2ESN A;  3WGI A;  3P9C A;  1SFU A;  3F3X A;  4O5V A;  2GWR A;  2P4W A;  5JR3 A;  1MDM B;  4H0E A;  3FXU A;  1ZRC A;  1FP1 D;  4JQF A;  1UHW A;  5HLI A;  3HSR A;  3LQQ A;  2B0L A;  2R7F A;  4XBF A;  2CQK A;  1YQA A;  1Z05 A;  4PDK A;  1TTY A;  3LA3 A;  3COA C;  3EYY A;  5L3B A;  2H6B A;  3CDH A;  1IXS B;  5EEG A;  3WTY C;  4MQV A;  1YW8 A;  1LDD A;  2DK8 A;  3FHZ A;  1DDN A;  3FF5 A;  3BDD A;  5D5V B;  1J59 A;  1SMT A;  5F1R A;  4HAM A;  4HZF A;  1QO0 D;  4ZYE A;  3ELK A;  4HBL A;  1XN7 A;  3JSO A;  1Z6T A;  1G3T A;  1W7P B;  3QU3 A;  1R1V A;  1S29 A;  4L9V A;  1FX7 A;  1YLF A;  1S7A A;  1VTN C;  1O3S A;  2M5W A;  3BRO A;  2EB7 A;  5CVI A;  1HSJ A;  3RTR A;  1WI9 A;  3I4P A;  2COM A;  2F5C A;  3ABU A;  4IF4 A;  4G7Z F;  3VOE A;  1I27 A;  2KIM A;  1SD6 A;  1B4A A;  4IVN A;  1BJA A;  1TW3 A;  4Y17 A;  3HSF A;  4ZYG A;  1OPC A;  4WWC A;  4MGR A;  4RB3 C;  5CYV A;  2GAU A;  4BAY A;  1F9N A;  2L3D A;  3FMQ A;  2LKP A;  2W25 A;  3QU6 A;  2ZO4 A;  4G7O F;  2QBY B;  3F6V A;  3CLO A;  1K6O A;  3WTX C;  2Q2E A;  4BXU A;  2ZXJ A;  3HRM A;  4HQE A;  4ZZL A;  2VXZ A;  4HX7 A;  2NNY A;  3DF8 A;  1R7J A;  1OYI A;  3Q5F A;  5ICF A;  2UXX A;  4HF0 A;  3LAJ A;  4EMS A;  1B6A A;  2XVC A;  3VEP A;  3V8L A;  1T6S A;  3IRQ A;  4RGS A;  1FZP B;  1L0O C;  1LDK B;  2RDP A;  2HEO A;  1ZAR A;  4N9I A;  3CTA A;  1YTY A;  4A2U A;  3VOD A;  3SZT A;  4RS8 A;  1DPU A;  3TDZ C;  4EJU A;  1BOA A;  1D8K A;  3GEZ A;  1UST A;  1D3Y A;  2F5E A;  3F6O A;  1HW1 A;  3GZ6 A;  3OV8 A;  3HTS B;  3QAH A;  3SXY A;  5D6E A;  3K69 A;  3CO6 C;  2VN2 A;  3IWF A;  2ZKZ A;  2ELH A;  4IHS A;  2EA2 A;  2M8E A;  3GWZ A;  3KE2 A;  2PJP A;  2IA0 A;  2LNB A;  4LK1 F;  2HGC A;  1G6N A;  3LQR A;  3QRF F;  1IRF A;  2ESH A;  3Q9S A;  2ZCW A;  1YW7 A;  1BC8 C;  2CG4 A;  3WTV C;  2HYG D;  2YPR A;  4PGG A;  1J7K A;  3C18 A;  1TNS A;  1TNT A;  4M71 A;  4UXN A;  3ZQ7 A;  1S6L A;  3TDU C;  1FY7 A;  4A0Y A;  1FP2 A;  2MBF A;  3E5Q A;  1XSD A;  5EEH A;  3KLN A;  1FSH A;  3W6J B;  4RB0 A;  3F8M A;  4I09 A;  5HS8 A;  3MFK A;  3F8F A;  4ASN A;  3HSE A;  3NEU A;  1T2K A;  3BZ6 A;  1O3Q A;  3MWM A;  3I71 A;  2VE8 A;  4N0B A;  2DK5 A;  2ZME B;  2VOP A;  4XLP F;  2NS0 A;  2VC0 A;  3J7A O;  4B8X A;  2VE9 A;  5E1W A;  3WTS C;  4S04 A;  4HF2 A;  2XAH A;  1QPM A;  1UCR A;  3VFZ A;  3WTU C;  1XDS A;  4KT5 C;  3RYR A;  2LSO A;  4BHB A;  3ERE D;  3GO5 A;  5LGT A;  5D4R A;  5E18 F;  3DPT A;  3T0Y A;  3F8C A;  3FM3 A;  2VBX A;  4BYY A;  2BV6 A;  3L9F A;  2FSW A;  3L7W A;  3S2W A;  5HVQ C;  3W6K B;  1S7O A;  2FXA A;  3TOB A;  3RYP A;  1O57 A;  1ZRF A;  1BM9 A;  2RKH A;  1G3W A;  4L9J A;  1MJB A;  2PI0 A;  1XGN A;  4XSZ F;  1BI2 A;  2E1N A;  2GA1 A;  5CVU A;  1TBX A;  4R79 A;  4LG0 A;  3TQN A;  2ZBK A;  1ON2 A;  5E1Z B;  2XAS A;  2CSO A;  4JK1 X;  4L5J A;  2WV0 A;  4WCG A;  5LLQ A;  5CVR A;  1Z91 A;  3DXJ F;  2PLY A;  1K78 B;  1IRG A;  4Q4Z F;  4EM0 B;  2Y0M A;  3BJO A;  2MLG A;  5HOO A;  3C7J A;  3R0A A;  3DPL C;  3V7S A;  3HUG A;  4U0W A;  4ESF A;  1G4D A;  5LHH A;  1YS6 A;  3QPT A;  5JI6 A;  1ZHF A;  3GW2 A;  1SMY F;  3MZY A;  1D8J A;  1P92 A;  5JHU A;  2PQ8 A;  4GYG A;  3JAM K;  2W57 A;  2O6G E;  3ZN1 A;  3KP6 A;  1JGS A;  4G6D A;  5HDG A;  2HFH A;  3KZY A;  4PGH A;  3I5U A;  5K5Q A;  3QP5 A;  3M8F A;  1HKS A;  1KQ9 A;  4LGW A;  1XCV A;  4ZYD A;  4P55 A;  1SD5 A;  5BMZ A;  2VT3 A;  3RKY A;  1DUX C;  3D5L A;  4OIP F;  2P5K A;  5L3E A;  4FT8 A;  1TQP A;  3FMS A;  5FO5 A;  2BEO A;  5LHI A;  2RNJ A;  4OMY A;  3WU1 B;  1BIA A;  3F8B A;  1V3F A;  2FF4 A;  2HZT A;  2K7L A;  3LA2 A;  1FOK A;  2XAQ A;  1XMA A;  2VOD A;  3IWZ A;  4TV7 A;  3HRU A;  4ESB A;  1YS7 A;  4UUV A;  3F8N A;  5ILS A;  2H94 A;  5LHG A;  1UFM A;  4ENK A;  3DV8 A;  4MEX F;  4HX8 A;  4CIC A;  2IP2 A;  2OAZ A;  2RGV A;  5K1Y A;  4EM2 A;  3JTG A;  3F22 A;  2HKO A;  5J6X A;  1PUE E;  1LB2 A;  2M87 A;  3KEQ A;  1YW9 A;  1BI3 A;  4O6J A;  3KP4 A;  5AON A;  4U88 A;  2V1U A;  3CUQ A;  3GZ5 A;  4M73 A;  2OU2 A;  1Q1H A;  4CHU A;  2H09 A;  4RGU A;  5F64 A;  5CLS A;  1S3J A;  2V6C A;  2OZU A;  3H3Z A;  2K02 A;  4KN7 X;  2GA2 A;  1BN5 A;  1ODD A;  3TOA A;  4DQ2 A;  4KIF A;  2HQN A;  1ZLK A;  3ZMZ A;  5A2Q Z;  2OA4 A;  3ZN0 A;  1HW5 A;  2K27 A;  2A69 F;  1I5Z A;  3FZV A;  3GYH X;  5L3D A;  4E70 A;  3EQL F;  1JE8 A;  3BOQ A;  5HDK A;  1Z6R A;  3ZMD A;  1ZGA A;  3LST A;  1ULY A;  4KIC A;  4ENM A;  2FE3 A;  1XMK A;  3M9A A;  3I64 A;  3D0S A;  1WSU A;  3V4G A;  1XCB A;  1ZRE A;  2DW4 A;  2QQA A;  3BPX A;  4CDG A;  1CF7 B;  1GVJ A;  2F2E A;  4ESJ A;  4A12 A;  1SD7 A;  4OIR F;  2E7X A;  2L4M A;  5A2Q K;  3AAF A;  2MLK A;  5DV5 A;  4EJV A;  1U8R A;  5J8F A;  2OZ6 A;  4EJO A;  2KIU A;  2XHK A;  1K7A A;  2OBP A;  3RPU A;  2E7W A;  3HHG A;  2XAF A;  2NAZ A;  1IF1 A;  3HIF A;  1AWC A;  4HF1 A;  4RGR A;  3K1N A;  3IKT A;  1IN5 A;  3ZMV A;  2QLZ A;  3TO7 A;  1ZG1 A;  1DP7 P;  3BJA A;  1TW2 A;  2DPD A;  5BOX A;  2O0Y A;  1REP C;  1B9M A;  2HTJ A;  1TQI A;  4AVP A;  2GXG A;  1BI1 A;  1MDM A;  4IHT A;  4ZH4 F;  3PQJ A;  1QQI A;  1RNL A;  3WOD F;  4CO8 A;  2CO5 A;  3GUD A;  3V7C A;  2HR3 A;  5DUK A;  4ENN A;  5DEQ A;  5ERI A;  3JSP A;  2H27 A;  2K86 A;  2DBB A;  3U9G A;  2ZJ2 A;  3R0J A;  3JW4 A;  4MTE A;  4L9N A;  1XGO A;  2LDU A;  5LRR A;  1RZ4 A;  4FX0 A;  4XSX F;  4D0P A;  2L4A A;  3ZPL A;  1ONV A;  1YFH A;  3RJP A;  2FNP A;  2Q0O A;  2HDC A;  2XRO A;  1K79 A;  2XGX A;  4CYD A;  3T8R A;  1IXC A;  2ADU A;  2YX7 A;  3TO6 A;  5HLH A;  5AIP A;  1KGS A;  3I58 A;  1Z1D A;  4IRH A;  1W7P A;  3TKY A;  1XGM A;  4Q48 A;  1E2X A;  2LF7 A;  4LLG F;  2YR2 A;  3ISP A;  2JT1 A;  2VBW A;  1IW7 F;  2H6C A;  2A07 F;  3GF2 A;  4RB2 C;  4IRG A;  4M72 A;  1RUN A;  4NQW A;  3IHU A;  1IUY A;  3N4M A;  2A3S A;  4YFK F;  2ISZ A;  3K1P A;  1LNW A;  2EFO A;  1BI0 A;  1FLI A;  3ROU A;  3HRT A;  1U5T A;  3HYI A;  5LBQ A;  4EVI A;  1HST A;  2F5F A;  2VBY A;  1MJ9 A;  2FOK A;  1P4W A;  1A04 A;  1P6R A;  3LA7 A;  1BBY A;  1J9I A;  4A6D A;  2W85 A;  5DD8 A;  2QZ8 A;  4I7H A;  2EV5 A;  1ZYR F;  2ISY A;  5FLX Z;  2FNA A;  2RVC A;  3E6C C;  4KFC A;  4HOB A;  2O61 A;  3EET A;  1RI7 A;  1R5G A;  3E6M A;  5DYM A;  2KJB A;  4R1H A;  5ED4 A;  2HWV A;  2XKO A;  5K5R A;  3ZP5 A;  3RI4 A;  4U0Y A;  1H9T A;  3L2C A;  1FBS A;  2V9V A;  4M9Z A;  1YIO A;  2Q8K A;  3RDI A;  3REO A;  2IA1 A;  3O2P E;  4Q47 A;  2JTV A;  1TQM A;  1W5S A;  3WG9 A;  1EH8 A;  2AS5 F;  5IT9 Z;  3Q9V A;  3GXO A;  3K1M A;  3BP8 A;  3MQ0 A;  3SHF A;  3PFI A;  1LEA A;  1XSX A;  3ZMU A;  3CUO A;  2HTS A;  1JXS A;  3OOP A;  2BYV E;  4LB5 A;  3FM5 A;  2DPU A;  4LK0 F;  3LAP A;  4PZJ A;  1USS A;  4QWQ A;  1SFX A;  3C3W A;  3WU0 A;  2XKP A;  2PN6 A;  1X3U A;  3PQK A;  4A0Z A;  4HLX A;  3IKV A;  5H6R A;  1W4M A;  2OD5 A;  1W7P D;  5HS7 A;  1QBJ A;  4MTD A;  4QLC U;  1U6G A;  1O7L A;  2L02 A;  4MEY F;  2YSR A;  4OU0 A;  3I54 A;  5ICC A;  3QP6 A;  1R1U A;  3VB2 A;  3HOS A;  2Z99 A;  3FWE A;  3MEX A;  4G94 A;  1KU7 A;  3TO9 A;  1KYW A;  4HLY A;  4LFU A;  5D8L B;  4WXH A;  1AOY A;  2O3F A;  2XV4 S;  3RKW A;  5L3F A;  3ML6 A;  3ULQ B;  5LGN A;  2XAG A;  2P6T A;  1KU2 A;  2QEN A;  1XB4 A;  2KIF A;  2KJC A;  5HLG A;  2DU9 A;  2MH2 A;  2ZME A;  3H92 A;  1IXR C;  5BS6 A;  4EJT A;  1KQ0 A;  2IT0 A;  5CVJ A;  3I59 B;  4WXC A;  5TRD A;  2FEZ A;  2IPQ X;  4RAZ A;  1KQ8 A;  2QVO A;  4Z2Y A;  2EFQ A;  4I98 B;  4UVB A;  4RB1 A;  3WGH A;  4AIJ A;  5E20 A;  1G3S A;  2A6E F;  4P96 A;  1SD4 A;  1R23 A;  2FBI A;  3EUH A;  5ICG A;  2W24 A;  4UVA A;  5E17 F;  2MC3 A;  3KP2 A;  1H9G A;  2WC2 A;  2LF8 A;  1T98 A;  4KDP A;  4U0V A;  2L01 A;  3E6D A;  2RQP A;  3LWF A;  2GXB A;  3G3Z A;  4BH9 A;  3TGN A;  4O3M A;  3CUQ B;  4KMU X;  1NHA A;  4BNC A;  1WWX A;  3M8E A;  4DNC A;  3E3V A;  3J81 Z;  2NNN A;  2HOE A;  2ZNY A;  1LEB A;  4KIB A;  4HW0 A;  1KYZ A;  3U2R A;  2HS5 A;  2STT A;  1R36 A;  4CZZ A;  3HTU A;  2M30 A;  2MD5 A;  4OMZ A;  2K4B A;  2P7V B;  2XAJ A;  5D5X B;  2FRH A;  3RPQ A;  2DAO A;  1K78 A;  4NHJ A;  6PAX A;  3B02 A;  1BC7 C;  1R22 A;  4P9U A;  2HQR A;  4KIG A;  3GFI A;  5ILU A;  2EFW A;  5J8C A;  1SFE A;  3KLO A;  3QPH A;  2RV8 A;  2P7C B;  4MHG A;  5KK1 A;  2Z33 A;  3E5U A;  4GXO A;  3J80 Z;  2VC1 A;  1RUO A;  3F72 A;  1GXP A;  1E17 A;  3RIR A;  2IJL A;  2CW0 F;  2PBI A;  1JHH A;  1ZLJ A;  2EA4 A;  3CJN A;  2V1X A;  2STW A;  1ZH5 A;  2ZFW A;  3H3U A;  4OIQ F;  4EGZ A;  4OIN F;  3KP5 A;  2V79 A;  4HDV A;  2M45 A;  3LFK A;  3HOT A;  5DDG A;  1MZB A;  5L3G A;  1D5V A;  1QGP A;  4GO1 A;  3JTH A;  3L00 A;  1R1T A;  3FXR A;  1I6X A;  1YYV A;  1STZ A;  2A5Y B;  3MAJ A;  2IVM A;  2VBZ A;  1I1S A;  3M1E A;  4L0Y B;  5H20 A;  2QUF A;  1Y0U A;  1PDN C;  3BWG A;  3G73 A;  1JHF A;  2EFN A;  2JSC A;  1F4K A;  3I53 A;  5E8G A;  1F5T A;  4MNU A;  3J80 K;  4NB5 A;  5BPD A;  3GFM A;  3ZMT A;  4G8X A;  3V7R A;  4GGG A;  3R60 A;  2MA3 A;  1OR7 A;  2QWW A;  2PMH A;  2DO7 A;  1GHC A;  1L3L A;  3F23 A;  3L09 A;  5FD5 A;  4I0B A;  4B09 A;  1F1Z A;  3KP7 A;  1FWZ A;  3FXQ A;  4CXF A;  2DFI A;  1PP7 U;  2DQL A;  2JRT A;  1OKR A;  3R6S A;  4Y13 A;  3P7N A;  1PP8 F;  1B59 A;  2JPC A;  4A6E A;  3O6B B;  3KFW X;  4ENJ A;  1UB9 A;  3DQV C;  1XGS A;  5BPI A;  1U5T C;  2XIG A;  1ZG3 A;  4L0Z B;  3R4K A;  5BQT A;  3IL2 A;  1R5H A;  2RC4 A;  2NYX A;  1I1G A;  4OOI A;  2PG4 A;  5D8K B;  5DCM A;  1TLH B;  2D2W A;  4LD5 A;  5D6F A;  2EJR A;  2R3S A;  1O3R A;  2QQB A;  2J5O A;  4HQM A;  2P5V A;  2BE5 F;  2IRF G;  2HYF A;  5FFX A;  1HKT A;  4ZYH A;  2C6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...