3BDDA

Crystal structure of a putative multiple antibiotic-resistance repressor (ssu05_1136) from streptococcus suis 89/1591 at 2.20 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
140
structure length
140
Chain Sequence
QEMEDLLYRLKVADETISNLFEKQLGISLTRYSILQTLLKDAPLHQLALQERLQIDRAAVTRHLKLLEESGYIIRKRNPDNQREVLVWPTEQAREALITNPSAHHQAIKTSMNQILTVEESEQFLATLDKLLIGLQNLPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Regulatory protein MarR
publication title Crystal structure of putative multiple antibiotic-resistance repressor (MarR) (ZP_00875883.1) from Streptococcus suis 89/1591 at 2.20 A resolution
rcsb
source organism Streptococcus suis
total genus 49
structure length 140
sequence length 140
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bddA00
3DP7A 3VB2A 3E6MA 1E17A 1R1VA 5LBQA 2K86A 3FWEA 3LSTA 5HS9A 5FB2A 1DDNA 2G9WA 4L18B 3PFIA 2E7WA 4DNCA 5HLHA 1F1ZA 3I64A 4M73A 2OA4A 2EFNA 1USSA 5K5RA 2DT5A 1LDDA 1HXDA 3J81K 1ZH5A 5H6RA 2F5EA 4LK0F 2QBYA 1T0FA 1J7KA 1UHWA 2FA5A 3WTTC 1OPCA 3ZQ7A 5E8GA 3J7AO 3NQOA 2XHKA 3JTHA 3I4PA 2D45A 1MD0A 3QAHA 3K1MA 3KP4A 1IF1A 1XGMA 5HLIA 2P5KA 4ENKA 3KEOA 4MGRA 2OQRA 2G7UA 3BWGA 2GA1A 3DQVC 3IRQA 1FNNA 3IKTA 5DDGA 1CF7A 2FE3A 4KICA 6PAXA 5D5UB 1FOKA 3GX4X 1SMTA 1IN6A 2D2WA 1B9MA 3TO7A 5AIQA 1U78A 2VE8A 3EETA 4I98B 4HLYA 1G6NA 3ECHA 1IW7F 3TDZC 3S2WA 1YG2A 4FX0A 3FM3A 3W6KB 3RYPA 1HKTA 3T8TA 2GXBA 4ESFA 4QLCU 1HW5A 2A61A 4N9HA 3BROA 4YG2F 3H3UA 2EFWA 1R23A 4FHTA 4HDUA 1IXRC 3FX3A 2ESHA 1GXQA 2QZ8A 3FMSA 5D8KB 1XGOA 1YS6A 3REOA 4LLLA 2DLLA 1GHCA 4UVBA 5TJJA 4G94A 3F21A 2CWEA 1LNWA 2PMHA 2IA2A 2Z3YA 3E5XA 3R60A 1IRFA 2BE5F 3E5QA 1ZG3A 2IT0A 1PDNC 1J2XA 2NNNA 3G73A 1BIBA 2VONA 4KT5C 2STWA 5DD4A 2HYFA 3DPTA 2P5LC 1STZA 1YFHA 4OINF 4RB3C 2B0LA 2OZ6A 3E6CC 2FBKA 3M1EA 1XSXA 3I0TA 2WWYA 2LNBA 3GEZA 4MQVA 3D5LA 4CDGA 4TV7A 1BIAA 1DPRA 3KP5A 4NQWA 2HOEA 1KU7A 3W6JB 1RUNA 3HSEA 3CO6C 4HX8A 2VC1A 1HSTA 2ZKZA 3TQNA 1ZG1A 1SMYF 4I02A 5D4RA 3NEUA 2O61A 4CGZA 1LQ1A 2ZO4A 2NAZA 1YYVA 2KIUA 1TNSA 2ZMEA 1P92A 2DK8A 1MDMA 5D6EA 1JHHA 2YSRA 3LAJA 1CGPA 3LA2A 4IRGA 3SXYA 5H6QA 3I71A 1Q1HA 2IJLA 2QQAA 2ZJ2A 3HOTA 1K78A 2AXLA 1FZPB 3WTXC 1W7PA 2ZNYA 4M9SA 4YIIA 4KN4X 3VOEA 2ISZA 3KE2A 5L3GA 3AAFA 2JZYA 2EV6A 2ETHA 2VC0A 1LDKB 2BV6A 1UFMA 3TOBA 5D5XB 3MQ0A 3L9FA 3MCZA 1E2XA 1P6RA 3IRRA 3TO9A 4Q47A 3PQJA 2IA1A 5JVTA 2RDPA 2EV5A 5HDKA 2OBPA 1WKMA 1R58A 2GA2A 2V1XA 2XKPA 4RB2C 4KA4A 3V4GA 2MH9A 2ZFWA 2WTEA 3RTRA 1T38A 1BC7C 1RIOH 2UXNA 2JTVA 1KU2A 1SFXA 3P9IA 2LKPA 4WXDA 2IPQX 3HTUA 1MKMA 5CLSA 4AD9A 2KJBA 4AIHA 1F9NA 2GZWA 4FT8A 1HKQA 3VEPA 1FWZA 3GF2A 4HYEA 2VBZA 4HZFA 4MNUA 4EM2A 2KIMA 2DO7A 2JRTA 3IL2A 2ZCWA 3C18A 5K5QA 3F8FA 1EV7A 3K69A 2PLYA 4ENNA 1W4MA 3HSRA 3N4MA 2CG4A 2K4BA 4KIBA 3ZN1A 4UNOA 3F6VA 2FSWA 2XRNA 2Y48A 2W85A 1J0RA 1PP7U 4G6QA 4AWXB 1KYWA 5LHIA 2PJPA 2E1NA 2XASA 3P7NA 1D5VA 3E5UA 3I59A 3F6OA 5E18F 2HKOA 2J5PA 1ZN2A 3MWMA 1G3SA 1EH8A 2ZXJA 2QWWA 4XSZF 3GW2A 4MEYF 3WE3A 2ZBKA 1HKSA 5IT3A 4CO8A 1TNTA 4MTDA 1QQIA 4HBLA 4HQEA 1RUOA 4K2EA 5BPDA 1MJ9A 1ZRCA 4GO1A 4A12A 5AONA 1H9GA 3WG9A 1O3QA 5ILSA 3WGHA 2MC3A 3T5XA 1OYYA 1YTYA 4CZZA 3KP3A 3HRSA 3R0JA 2W84A 3R4KA 2YU3A 1D3YA 4HOBA 2L02A 5IT9Z 1QO0D 2KJCA 5AIPA 1S29A 2MH2A 4I09A 1KYZA 1S6LA 2Z33A 1FP2A 3B73A 5CVRA 2XUBA 2ZNZA 4ZYGA 3ECOA 2VBYA 3WTWC 3GXOA 4Z2YA 3TO6A 1L3LA 1D8JA 5CVVA 2Y75A 5BOXA 2V1DA 3GUDA 1I6XA 4ZZDA 5DUIA 3U2RA 4LLGF 1IN7A 3F8MA 1U5TB 2VBWA 1I27A 1TLHB 4XBFA 4ASNA 3QRFF 4EGZA 3KFWX 5HOOA 4NB5A 4UV8A 1BOAA 1G3TA 2HZTA 2DW4A 2RC4A 4RGUA 4EJVA 2DU9A 5ED4A 2A3SA 2FEZA 3F3XA 5LRSA 1MGTA 1RNLA 2M8EA 5L3FA 3RPUA 3SZPA 2RGVA 4UHTA 3WTVC 1W5TA 1W7PD 2CYYA 4IHSA 2H09A 4P5OA 2VBXA 1SD7A 2UZKA 4BAYA 2FBHA 1PP8F 3L09A 2IW5A 3KP2A 2O03A 1P4AA 2PMUA 2JT1A 4HV6A 4OIOF 3LA3A 3R61A 1J75A 2H94A 3HHGA 2PN6A 3F8BA 3P9KA 2DTRA 2OAZA 1YLFA 2Y0MA 2K7LA 4ETSA 4OIPF 4OIQF 5CVIA 5DCMB 2XGXA 1IXSB 2GQQA 3EYIA 2HKXA 1QPMA 2X0LA 2ESNA 1KQ0A 5DD8A 4I0AA 3FMRA 3WGGA 2EFQA 2P7VB 1S8NA 4AVPA 2W24A 2P4WA 3HUGA 3FXUA 2EFPA 1B1BA 4M74A 4RS8A 2P7CB 2Q2EA 1FBUA 3GZ6A 4B09A 4EVIA 2XAQA 1FSEA 1ZGJA 1ZAOA 5J6XA 1FBSA 1XB4A 3CUOA 5LRRA 2ISYA 4G7OF 2OZUA 3RKWA 5HS7A 1R22A 4UVAA 3FF5A 1IUYA 4UXNA 2MA3A 4Q4ZF 3ZMZA 3DV8A 3GWZA 1U6GA 5FGMA 4A5NA 4M72A 4LGWA 3FM5A 3K1NA 5FD6A 4JK1X 1KQ8A 4HV5A 3RYRA 4RB1A 1C0WA 3MEXA 1SD6A 3R6SA 3ULQB 3K2ZA 1J9IA 3ZMDA 1HSJA 3U1DA 3BZ6A 5BPIA 4KUMA 2DFIA 2RKHA 4BQAA 2H6CA 1IN4A 3H3ZA 1JGSA 4KIGA 3OOPA 1IN8A 1YW8A 2O6GE 4EM0B 2P6TA 3TGNA 3WTZA 3CJNA 3WU1B 2HTJA 1USTA 5LGNA 1FPQA 4HA8A 3KP7A 1AWCA 1LVAA 2FMYA 2L3DA 1D8KA 2DQRA 4EJTA 5D6FA 3HYIA 2O8XA 4PGHA 3KZYA 1YW9A 3KLOA 4QWQA 2GXGA 2VODA 4L5IA 5FLXZ 4B8XA 2FMLA 1JHFA 3QPTA 2NNYA 1ZRDA 2O0YA 2UXXA 2L54A 3L00A 2BBYA 1KU3A 1XGSA 3QOPA 5ICGA 2KIFA 2HDCA 1XCBA 3M7GA 4P96A 2J5OA 4NHJA 5L3DA 1R1TA 3IKVA 2RQPA 3CUQA 3B02A 2C6YA 4A6EA 4P9FA 3MZYA 2V9VA 2GAUA 2DBBA 3MAJA 2V6CA 1B6AA 4PDKA 4WX9A 1P4WA 5IT9K 5BS6A 3SQNA 2YX4A 4E70A 4U0YA 4KN7X 1XDSA 1O7FA 5E17F 4GYGA 1TBXA 3L7WA 4BH9A 4IRIA 4BNCA 2FNAA 2QM3A 4MQ9F 5TRDA 5E8IA 1V4RA 3RJPA 1UCRA 1DUXC 3ZMUA 3O3KA 2LF7A 2G7HA 5CYVA 2K4JA 1WWXA 1XDUA 1TQIA 1FYMA 3MZHA 1YQAA 5CVUA 1ZGAA 2CQKA 4YFKF 1O7LA 3BDDA 4IF4A 2A5YB 4LG0B 2VXZA 2PEXA 3V8LA 4Q48A 2IP2A 4O5VA 3ABUA 4I2OA 3GFLA 3IWZA 1O3SA 3BP8A 4LK1F 1B4AA 2BYVE 4U88A 1FLIA 2KKOA 2D1VA 4MEXF 2EJRA 2A07F 5JI6A 2R7FA 2A69F 2DPUA 3C1DA 1P2FA 3H92A 2XV4S 1ULYA 4LLNA 4H0EA 2L4MA 1R5HA 1OMIA 1O3RA 4Y17A 4EM1A 3K9TA 1T98A 1GXPA 4M71A 3BJOA 2QQ9A 4MTEA 2FNPA 1EH7A 1ON1A 2R3SA 3CTAA 1ZG5A 2H27A 2MD5A 2V79A 2IVMA 3F8NA 1SFEA 2M1BA 5KK1A 3ZMVA 2XKOA 3Q9SA 4OMZA 3MFKA 1FC3A 3VODA 3KLNA 3TKYA 2FOKA 3K1PA 4LD5A 1LDJA 2QBYB 1TQPA 3WTSC 2L4AA 2LDUA 5ILVA 2K27A 1G3WA 5E1XA 4BYYA 4CXFA 4EMSA 4ESBA 2NRAC 4WF2A 3BPVA 5D5VB 4EJWA 1B9NA 2JSCA 3T8RA 1FT9A 2F5FA 3QP5A 4BHPA 1IN5A 4HQMA 3EUHA 4RAYA 3M8EA 5BMZA 4ZZLA 1CF7B 1MZBA 3LFKA 1ZLJA 1RZ4A 3K0LA 2F2EA 2QUFA 3VFZA 1K7AA 2FBIA 3SHFA 3HTSB 1KQ9A 1XMKA 2CO5A 5JR3A 3ZPLA 1FX7A 3LAPA 3WE2A 3RIRA 2A6EF 2BGCA 3HOSA 1QBJA 2W57A 1RI7A 3LWFA 5ILUA 4BHBA 2BEOA 3TOAA 4CICA 1HBXG 5HDNA 4WWCA 2VT3A 1Z05A 2OD5A 5HVQC 2CFXA 4UV9A 2ACJA 2VOOA 3GZ5A 3CDHA 3OV8A 1FY7A 4M6YA 1KGSA 4RGXA 3WTUC 1HW1A 1ZHFA 5D4SA 5F6FA 5FLXK 1OYIA 4UVCA 5LEJA 1BI2A 2XROA 3DF8A 2WC2A 4HF2A 4XLNF 4YIFA 2GWRA 3HRUA 5J8FA 2VOPA 4M9ZA 2ADUA 2HS5A 3CUQC 4OOIA 4OU0A 3M8FA 1BI3A 2Q0OA 1BM9A 5LGUA 4WK8F 2F5CA 4L0YB 5LLQA 3JW4A 4LB6B 2PI0A 1SD4A 1K79A 2M5WA 3FMQA 1FYLA 3NRVA 2PG4A 2WV0A 5DUKA 4P9UA 2RNJA 4WXCA 2YX7A 2EFOA 1HW2A 1TTYA 4L9NA 4MHGA 4KYWA 4AIJA 1XN7A 1K6OA 2AS5F 4WCGA 2ZMEB 5F64A 2EB7A 2MLKA 5D8LB 1MDMB 4D0PA 3EQLF 1U2WA 1FSHA 2HEOA 3BPXA 4PZJA 4LB5A 1QZYA 3JTGA 4S05A 4JQFA 2LF8A 1IAWA 1O3TA 5F1RA 1YS7A 2A6HF 1WRJA 3V8KA 3GLXA 5CVJA 1BN5A 1XMAA 1K78B 1DPUA 4EJOA 1MJBA 5EEGA 3EDPA 4HX4A 1R00A 4LMYA 5FFZA 3R0AA 4CYDA 4L9TA 2JPBA 3KZZA 3V7RA 1IRGA 2FF4A 5L3EA 4G9YA 3O6BB 4KIFA 1IZ1A 4CHUA 1YIOA 1V3FA 1WI9A 1FBQA 2RVCA 3J80Z 1YW7A 5FD5A 1SAXA 4GCVA 1B59A 4R79A 4R1HA 1R7JA 3JAMZ 2HGCA 1J59A 1Z6TA 5HLGA 1ZLKA 2E1CA 2IRFG 2O3FA 2X4HA 1XGNA 5K5OA 1QZZA 5DEQA 2NS0A 4I01A 3IHUA 3E6DA 2PFBA 1REPC 3N97A 3L2CA 1S7OA 2XAJA 1XSDA 5E1WA 4YFNF 5A2QZ 2OQGA 4EJUA 2PQ8A 2HQNA 3F23A 2DPDA 3U9GA 3KCCA 5K1YA 1BI1A 1W5SA 2NYXA 3I58A 3WTYC 5D5WB 3BJ6A 3DFGA 2JPCA 5EEHA 2K02A 4S04A 4UUVA 4A0ZA 1LJ9A 2HTSA 3JSOA 1VTNC 1GVJA 3QP6A 1F5TA 5H20A 2RV8A 1ZYRF 3I53A 1ZREA 1XCVA 3GYHX 4Q5SF 4PCQA 1T39A 5ERIA 2RN7A 4O3MA 2FQ3A 1TW3A 3KETA 2XIGA 3I59B 1L0OC 1P4XA 4N0BA 2QENA 1F4KA 4EV0A 4HW0A 1A04A 3M9AA 1U8RA 4OIRF 5LHHA 5L3CA 3ERED 1I1GA 2HFHA 2OU2A 1G3YA 4G8XA 3CLOA 1Y0UA 3QU3A 4FX4A 4A0YA 2STTA 3E97A 1R5GA 2DQLA 2LSOA 4EGYA 1J5YA 2QYOA 3QPHA 1R36A 1KA8A 2MLGA 2EWNA 4U0VA 1S7AA 4M6XA 1Z7UA 1U5TA 4XLPF 2HYGD 2CW0F 3DPLC 3T1BA 2M87A 4O6JA 4RGRA 4N9IA 3BJAA 1T6SA 4G7HF 1FP1D 5FFXA 1XD7A 3ZP5A 4KNYA 1HQCA 1XSVA 2DK5A 2V1UA 2DAOA 4A6DA 3HHHA 4EQQA 5L3BA 1WSUA 3Q5FA 2XVCA 2COMA 3KP6A 3SFZA 4I7HA 2EA2A 3V7SA 2P8TA 4WXHA 3DEUA 4L9VA 2KRFA 2EK5A 4ZH4F 1OKRA 4GGGA 1PUEE 5CJ9A 2D1HA 3BOQA 1SFUA 1MJAA 3FZVA 1LEAA 2XAFA 4IVNA 2P6SA 5DCMA 1KU9A 3F22A 3I5UA 2FXAA 3WGIA 1H0MA 4ZYHA 5DYMA 3KEQA 5HS8A 3C7JA 5FO5A 3FHZA 3LQRA 5LGTA 3JSPA 1JXSA 3ZMSA 5HDGA 2YPRA 1S3JA 1Z9CA 3J81Z 2QVOA 4KDPA 3WODF 4I0BA 1H9TA 1EH6A 2Q8KA 3J80K 1OYWA 3I54A 1YO5C 3F8CA 3LA7A 5JFRA 2EV0A 3ABTA 1I1SA 4AIKA 3FXQA 3JAMK 3GFJA 1U3EM 4RB0A 3V8JA 5J8CA 1WQ2A 3E3VA 4PGGA 2UWMA 4ON0A 3RPQA 1ONVA 3SZTA 5KVRA 1BJAA 2ELHA 1Z1DA 4HLXA 5BQTA 4U7BA 1R1UA 1X3UA 4DQ2A 2FU4A 3DXJF 2FRHA 4XSXF 4IHTA 4LJZF 3T0YA 3PQKA 2VE9A 1BC8C 4R8HA 1NHAA 5A2QK 1ZRFA 3ZMTA 3V7CA 2M45A 3GFIA 3ZN0A 3RI4A 5E1ZB 3IWFA 4KMFA 4BHCA 4GXOA 2W25A 4KMUX 2YR2A 4RAZA 4L9JA 2EA4A 2H6BA 4IJAA 4HDVA 4A0XA 1QGPA 5E20A 3GVAA 4ZYEA 5ICEA 4L5JA 5DCFA 2Z99A 2MBFA 2L01A 4IPAA 4ENMA 1AOYA 1SD5A 1UB9A 3IC7A 2HQRA 4XRFA 4A5MA 4U7DA 2CSOA 5JHUA 4ENJA 2XAHA 3TDUC 4OMYA 4GYIA 4G6DA 4JBAA 3RDIA 1Z91A 2QQBA 4HX7A 2VT2A 2CGPA 1LEBA 3HIFA 3Q9VA 1G4DA 3BY6A 1ON2A 1O57A 4HAMA 4U0WA 4ESJA 4LFUA 1OR7A 2HWVA 3E6BA 3C3WA 2E7XA 3WU0A 2Z5UA 1BBYA 5DV5A 4L0ZB 4RGSA 1LB2A 2HR3A 1TQMA 2M30A 4Y13A 4KFCA 1U5TC 3HSFA 2IA0A 3D0SA 2A68F 3FXRA 2GIVA 2R7DA 1FYKA 3GO5A 3P9CA 3CUQB 3EYYA 4F7ZA 1JE8A 3QU6A 3RKYA 1UHMA 4IRHA 4LG0A 4HF1A 2DI3A 3HRTA 5LEKA 3DKWA 4A2UA 4IXAA 3O2PE 5LHGA 5ICFA 1Z6RA 2P5VA 2F5DA 1DP7P 4P55A 3G3ZA 3ELKA 1T2KA 1ZARA 1W7PB 1IXCA 2PBIA 3RKXA 3ROUA 4YFXF 2TDXA 3CO7C 3F72A 4M9XA 1TW2A 4BXUA 1BI0A 4G7ZF 3GFMA 4ZYDA 5ICCA 3COAC 2VN2A 2Z9OA 3ML6A 3LQQA 2XAGA 1I5ZA 2QLZA 3ISPA 1ODDA 1QNTA 4HF0A 3HRMA 4Y15A
chains in the Genus database with same CATH superfamily
3BG3A 3DP7A 3VB2A 3EPZA 3E6MA 1RR7A 1E17A 2NVUB 1R1VA 5LBQA 4DBQA 3DBRB 2K86A 2IS4A 3CCRI 3FWEA 1N78A 3LSTA 5HS9A 5FB2A 3ZQIA 2G9WA 1DDNA 3BR3A 3LSRA 4L18B 3PFIA 2E7WA 4DNCA 5HLHA 1F1ZA 1JUMA 3I64A 4M73A 3M3YJ 1Y8RB 2OA4A 2EFNA 1USSA 3GTKJ 5K5RA 1Z77A 2DT5A 5C44J 1LDDA 2ICWG 1HXDA 5JVGF 4KISA 1OISA 3J81K 1ZH5A 5H6RA 5IYDJ 2F5EA 3C2HA 4LK0F 2QBYA 1T0FA 2DA5A 2B7EA 1J7KA 1UHWA 2FA5A 3EUAA 3ABLH 4ITVA 3WTTC 1OPCA 3ZQ7A 5E8GA 3J7AO 2VPRA 3NQOA 2LKSA 1NTCA 2XHKA 2YUSA 3I4PA 3JTHA 2D45A 3I56I 1MD0A 1XG1A 3BG5A 3QAHA 3K1MA 1K4SA 2EZIA 4B4CA 2R5ZA 3KP4A 1IF1A 1XGMA 3UKGA 3ZQQA 5HLIA 5TGTA 1VQ4I 2P5KA 1GVDA 4QPQA 4ENKA 2GBYA 1D1BA 3KEOA 4MGRA 3CD6I 2LKXA 2OQRA 2G7UA 2OCEA 2KLOA 3BWGA 5E3NA 2GA1A 2MABA 3K7AJ 3DTKA 3DQVC 3FISA 4LOCA 3IRQA 2ECCA 4JX4A 1FNNA 2KZVA 3IKTA 4PJJA 5DDGA 1CF7A 1Y1WJ 1K83J 1BA5A 2FE3A 4KICA 2E1MC 2BY0A 6PAXA 2CU7A 2BHYA 5KHDA 4C9YA 5D5UB 1XTAA 3DPUA 1FOKA 3GX4X 1SMTA 5J1RA 1IN6A 2D2WA 1B9MA 2VJIA 2IAIA 3TO7A 5AIQA 1U78A 1HC8A 3QWLA 2VE8A 4MFDA 3EETA 1AU7A 4I98B 4HLYA 4XONA 1G6NA 2XPWA 2P0WA 2IS2A 2CQ7A 3ECHA 1IW7F 3TDZC 3S2WA 1YG2A 4FX0A 4G6TB 3FM3A 3W6KB 3QYBA 3CESA 3RYPA 3S8PA 1HKTA 2R0QC 3T8TA 2GXBA 3FXJA 4ESFA 4QLCU 4XRMA 1HW5A 2E1MB 2XGCA 2A61A 2R7TA 1DQUA 4N9HA 3A0BC 3BROA 4YG2F 2LYCA 3H3UA 2M7AA 2F4OB 1R23A 2EFWA 4FHTA 2HXOA 4HDUA 1IXRC 3FX3A 2ESHA 1GXQA 3U21A 1B8IB 3S93A 1XPXA 2QZ8A 3FMSA 5D8KB 1XGOA 2BY1A 3OL4A 1YS6A 1BW5A 1UJ8A 3REOA 3GTQJ 4I99C 4LLLA 2DLLA 1GHCA 4UVBA 1SANA 4G94A 5TJJA 2DN0A 3F21A 4IEJA 2CWEA 1RPWA 2KZGA 3A4CA 2IGMA 5E3LA 1LNWA 3EUKL 2PMHA 2IA2A 4PSWA 4J19A 1Y1VJ 4QPOA 2R7QA 4II2A 1IUFA 1RKWA 1T95A 2Z3YA 4UUSB 3UNGC 3E5XA 3R60A 4NBQA 1IRFA 5EZHA 3H35A 4YIRX 2YS9A 1ZTRA 2BE5F 3E5QA 1ZG3A 3V42A 2IT0A 4V2FA 3LSMA 1KONA 2DOAA 1PDNC 1J2XA 2NNNA 3IAM2 3G73A 3LMMA 2FOWA 1A35A 2YU9J 1BIBA 2VONA 4KT5C 5KAIC 2STWA 5DD4A 1LE8B 2HYFA 3DPTA 2P5LC 1STZA 2CFOA 1YFHA 3HOYJ 2HOAA 9ANTA 4OINF 4RB3C 1V5FA 2G0EA 3BLYA 1MNEA 5EJCA 5EDNA 4RDUA 2B0LA 2OZ6A 3CMYA 3E6CC 3LL7A 2FBKA 3M1EA 3OIOA 1XSXA 3I0TA 2WWYA 3CCLI 2LNBA 4BY7J 4DIQA 3GEZA 1MH3A 1X1BA 2MD0A 3D5LA 4MQVA 4CDGA 4TV7A 1BIAA 2N8GA 1X2NA 1DPRA 2Q1ZB 3K10A 2GOXB 3KP5A 4XLAA 3OY9A 4NQWA 2HOEA 1KU7A 1BW6A 1OR7C 3W6JB 1RUNA 3HSEA 3CO6C 1YJNI 4HX8A 4OWRB 2VC1A 2F48A 4F92B 2JVHA 1HSTA 2ZKZA 3TQNA 1ZG1A 2X85A 2E2HJ 1SMYF 1TT5B 4I02A 1JUPA 5D4RA 3NEUA 1AHDP 3BR6A 5CQGA 1X3WB 3TEDA 1FIAA 2O61A 3N05A 4CGZA 3DEWA 1LQ1A 2ZO4A 2NAZA 3A1YA 3HPGA 1YYVA 2GIZA 2AQFA 2KIUA 1TNSA 2IBDA 4IKFA 2ZMEA 1R4NB 1P92A 1QHGA 4E4HA 2DK8A 1WJAA 1MDMA 5D6EA 1JHHA 2YSRA 3CC7I 1GLNA 3LAJA 5EG0A 5DM6F 1CGPA 2KHMA 3LA2A 4IRGA 1IRXA 3SXYA 4XK4A 3I3LA 2DA2A 2KQRA 4E7ZA 4OAYA 3PSIA 5H6QA 4ZDOA 4YELA 2NOJB 2NXNB 3I71A 3CCJI 4XNFA 1Q1HA 1ZR4A 2IJLA 2QQAA 3A01B 2ZJ2A 3FXKA 3HOTA 1K78A 2AXLA 1FZPB 3WTXC 1W7PA 2ZNYA 2RREA 4F52A 4M9SA 4YIIA 3JCUC 3CJQB 3CCEI 4KN4X 3VOEA 2ISZA 3KE2A 5L3GA 2JK3A 3AAFA 5CQEA 3FBNB 2JZYA 4MLOA 2EV6A 3GTLJ 2ETHA 2VC0A 2K9MA 3K4CA 1UZCA 3OS2A 1LDKB 5B5EC 1DU6A 2BV6A 1UFMA 4FASD 3BQYA 2M4KA 5FKKA 3TOBA 3S1RJ 5D5XB 3MQ0A 3HZJA 4N4OB 2L7KA 3L9FA 4AIDA 3DKXA 3MCZA 1E2XA 2L5QA 4DGWB 3BZCA 2Z16A 1P6RA 1X19A 4BUPA 2W4SA 3IRRA 4OAZA 3TO9A 4M6VA 4Q47A 3PQJA 2VJ4A 2IA1A 5JVTA 4RM3A 2DT7B 2V9PA 2Y0SN 2RDPA 5EEAA 2EV5A 1TC3C 5HDKA 1A31A 2OBPA 1I39A 3ASOH 3ZQHA 1WKMA 1U9NA 4G12A 1R58A 2GA2A 2V1XA 2XKPA 4RB2C 2VPLA 4KA4A 3V4GA 2LTPA 2MH9A 2ZFWA 4PSXA 3BTIA 2WTEA 3RTRA 3PIOF 1V55H 1T38A 1WJCA 2QA4I 3I9V2 2V1NA 5GP9A 5KNLA 4XLEA 2JJ7A 3IP4B 1BC7C 1RIOH 2UXNA 1QVTA 2JTVA 1YJ9I 2DA3A 4PK4A 2JQ7A 3HDDA 2DA4A 2WA0A 1KU2A 1SFXA 2CMPA 3P9IA 3LNQA 2CV1A 2K40A 4XRSG 2LKPA 2KL4A 1P9QC 1TT0A 2OCCH 2IPQX 4WXDA 4D1QA 3FXLA 3HTUA 1MKMA 5E3MA 1T0FC 1MMDA 2CQNA 5CLSA 4DYRA 1VQ8I 2ZXIA 4AD9A 2K9SA 2KJBA 4AIHA 1F9NA 1EKEA 2GZWA 4FT8A 3TW6A 1HKQA 5IYCJ 4C30A 2CRGA 2BHZA 1MBKA 4FQGA 3OYBA 1W1WE 2E35A 3WG7H 3L2UA 3VEPA 1FWZA 3GF2A 4C3JJ 3BZKA 3ESWB 3M07A 2VBZA 4HZFA 4HYEA 4MNUA 1R9TJ 1JKRC 4EM2A 1A6IA 1NG7A 2KIMA 3QYEA 2X48A 2DO7A 2Y0SA 2JRTA 5GTHC 3IL2A 2ZCWA 3C18A 3E0JB 5K5QA 3F8FA 1ENHA 1EV7A 3OIPA 2EZLA 4CCLA 3K69A 1SC7A 2PLYA 1WGXA 2QGUA 2DFEA 1RR8C 1ZK8A 4ENNA 3OYMA 1W4MA 3K4NA 3HSRA 4M3FA 3N4MA 1EF4A 4D5FA 1HOMA 2IGOA 3NARA 3S17J 1X1AA 2CG4A 2X1DA 2X51A 2K4BA 3H0DA 4KIBA 3ZN1A 1F36A 3NWSA 4UNOA 3F6VA 1JI8A 1E3HA 4DZPA 1Z3XA 2FSWA 2XRNA 5EF6A 3BR2A 2Y48A 3H36A 4XM3A 3K4KA 2W85A 1OCPA 5FJ8J 2Y69H 1J0RA 1PP7U 4G6QA 1RKTA 4ZYAA 4AWXB 2JA8J 1U0JA 3B6AA 1KYWA 5LHIA 5B1BH 3VYRB 4BJTA 2PJPA 2E1NA 3AKZA 4BJ6C 2XASA 2Y31A 2ZXWH 3P7NA 3M4OJ 1D5VA 3E5UA 3I59A 3F6OA 1NG6A 5E18F 2HKOA 2J5PA 3OYNA 1I3AA 4C2TA 1ZN2A 1WH5A 3MWMA 4RLFA 1S7EA 1G3SA 3C2BA 1EH8A 3HB9A 1VQLI 4XLHA 3G4SI 2ZXJA 2QWWA 4XSZF 4QSHA 3GW2A 4MEYF 3WE3A 3FKIJ 1UG2A 2ZBKA 1HKSA 2W82A 4DBRA 5IT3A 4CO8A 1TNTA 5CPRB 2KMUA 3S15J 4MTDA 4FTHA 1QQIA 1JJ8C 4HBLA 4E7JA 4HQEA 1RUOA 2M0CA 3BQZA 2Z2SB 4K2EA 5BPDA 3FXMA 1MJ9A 1ETKA 2MYSA 2XC7A 1ZRCA 4GO1A 2EIJH 3QPLA 2LFBA 2ID6A 4A12A 2JA2A 5AONA 3HM5A 5H2FC 1H9GA 3WG9A 1O3QA 3KEYA 5ILSA 2M34A 3WGHA 4D9JA 3H5NA 2MC3A 1MMGA 3OL3A 3T5XA 3SYTA 4IO9F 5J1YA 1OYYA 1YTYA 1HF0A 4CZZA 1K61A 2WADA 2R7ZJ 3KP3A 3HRSA 3RKQA 3PNTA 1SFOJ 3G2BA 3R0JA 1RC9A 2W84A 2O9LA 2VQGA 3R4KA 1D1AA 2YU3A 1D3YA 2FUG2 4HOBA 2L02A 5IT9Z 4FETA 2EZHA 5M5WJ 3MKZA 1QO0D 2GXAA 2KJCA 3GZNB 5AIPA 2CS3A 2VKEA 3BG9A 1R4MB 2Z1DA 1S29A 3ZR8X 3RQIA 2VQCA 1IC8A 2MH2A 4I09A 2QKMB 1KYZA 1S6LA 2CUEA 2Z33A 2M4GA 1FP2A 3B73A 2LRDA 4HSTA 1LPQA 5CVRA 2XUBA 3DWLE 3OR2C 4HNTA 1D1CA 2ZNZA 4ZYGA 3ECOA 2VBYA 3WTWC 3GXOA 2O8KA 1WJDA 4Z2YA 5DTDA 5TISC 3TO6A 1L3LA 1D8JA 5CVVA 2Y75A 5BOXA 2V1DA 1V5EA 2JVGA 3GUDA 1I6XA 4A93J 3OWTA 4ZZDA 5DUIA 4EEFG 3U2RA 4LLGF 1PUFB 1IN7A 3F8MA 1B72B 1U5TB 4XL9A 2VBWA 1QVUA 1I27A 3AL0B 1TLHB 4XBFA 4ASNA 5IP7J 3S3MA 3QRFF 4EGZA 2IGKA 3KFWX 4DYQA 5HOOA 4B48A 3ERMA 3BT9A 3W3CA 4NB5A 4UV8A 4CYCA 3JRCA 4BY1J 3CDIA 3CMEI 1BOAA 2JWTA 1G3TA 1J09A 2DW4A 2HZTA 2RC4A 4RGUA 3S1MJ 4E7IA 1MMAA 3MMYB 4EJVA 2DU9A 5LD2C 5ED4A 2A3SA 2FEZA 3F3XA 4CH7A 5LRSA 1GDTA 3FDYA 4IQ4A 4IL6C 5J40A 2JUGA 1MGTA 1RNLA 2M8EA 5L3FA 4HEA2 3RPUA 3SZPA 2RGVA 4UHTA 3OS0A 3UR3C 3WTVC 1W5TA 1W7PD 2CYYA 4IHSA 2H09A 3CMMA 4P5OA 2JA5J 2VBXA 1SD7A 3L2RA 2UZKA 4BAYA 2FBHA 3GTMJ 3OS1A 1PP8F 3BCAA 3L09A 2IW5A 3KP2A 2O03A 2DXIA 4RLQA 4IHYA 5F27A 1P4AA 2PMUA 2JT1A 4HV6A 3HOWJ 4OIOF 3LA3A 3R61A 1J75A 1V54H 2KFDA 2H94A 2VB6A 2LY1A 4KITB 3AG4H 3OYCA 3HHGA 2PN6A 3F8BA 3P9KA 1A36A 2JMWA 2DTRA 1BOBA 2HQ5A 2OAZA 4LITA 1YLFA 2Y0MA 4XRSA 2K7LA 3QPSA 1MBGA 3HJEA 4ETSA 1SEUA 4OIQF 4OIPF 5CVIA 5DCMB 2XGXA 1IXSB 2GQQA 4Y3OA 2Y30A 3EYIA 4A3IJ 3S3OA 1W0TA 2HKXA 1QPMA 3BG7A 2X0LA 3LOCA 2E34A 1MBEA 2E71A 2ESNA 1KQ0A 4I6ZA 5DD8A 4I0AA 3FMRA 3WGGA 3WHBA 4ZTJA 2EFQA 2P7VB 1S9HA 2V4JC 1S8NA 4II3A 2W24A 3VYSB 4AVPA 5IP6A 1JT6A 2P4WA 2I5UA 3HUGA 3FXUA 2EFPA 1B1BA 3ASNH 4M74A 4RS8A 3IUOA 2P7CB 2Q2EA 1FBUA 3GZ6A 4B09A 4EVIA 2XAQA 4V2GA 4CSWA 1TWFJ 5F04A 2ELJA 2LD5A 2L7MP 2HOSA 1FSEA 1ZGJA 3LSGA 1ZAOA 5J6XA 1WJ5A 1Y39A 1FBSA 1XB4A 1T56A 3CUOA 3PUBA 5LRRA 1DGRM 4BE1A 5F0CA 1TZLA 5IOZA 2MSYA 3TMOA 2ISYA 2XF7A 4CCMA 4UB6C 4F55A 4G7OF 2KRHA 2OZUA 5HS7A 3RKWA 2PJRB 2K9LA 1R22A 3F0CA 4UVAA 3FF5A 1IUYA 4UXNA 3BR1A 3SEQA 4ABZA 2MA3A 4Q4ZF 3K4MA 3ZMZA 3DV8A 3GWZA 1U6GA 5FGMA 2F5VA 4BEHB 4A5NA 2WAEA 4M72A 4LGWA 3FM5A 3K1NA 5FD6A 4B44A 3I55I 4JK1X 2DA7A 1JTXA 2GLOA 4CCJA 3CF5F 1KQ8A 4HV5A 2E5NA 3RYRA 4RB1A 1D0ZA 2XF5A 1C0WA 3MEXA 4A3FJ 1I6HJ 2IEKA 1SD6A 2CW8A 4FCYA 3R6SA 3ULQB 2WY8Q 3K2ZA 1J9IA 1LVKA 3ZMDA 1HSJA 2B63J 3U1DA 5FROA 3BZ6A 4AUXA 5BPIA 3CLQA 3CCYA 4KUMA 2DFIA 2RKHA 1OCZH 1R5ID 4BQAA 4QIWN 2H6CA 1IN4A 3H3ZA 5EYRA 1JGSA 1I50J 4KIGA 2A6TA 5M3FJ 3OOPA 3ZQLA 1IN8A 4PFPA 1YW8A 1XC5A 2O6GE 2X6WA 4EM0B 2P6TA 3TGNA 3TW7A 3WTZA 3CJNA 3WU1B 2HTJA 3KYLA 3SFIA 1USTA 5LGNA 3GLLA 5KAFC 1FPQA 1WPKA 2AO9A 4HA8A 4BQOA 3KP7A 2E1OA 1AWCA 1LVAA 2L9RA 2FMYA 2L3DA 1D8KA 2DQRA 2L9SA 4EJTA 1FMVA 5D6FA 3OYJA 3HYIA 2O8XA 4PGHA 3KZYA 1YW9A 2JUCA 3KLOA 4QWQA 4GFBA 2GXGA 3PSFA 1VFCA 3O8HA 2LK2A 2VODA 4L5IA 5CKTA 2HOTA 3HOVJ 1QZEA 2XF6A 4RBOA 1UG0A 5FLXZ 2MGQA 4B8XA 4P1WA 1XS9A 2FMLA 1JHFA 3QPTA 2NNYA 2RNGA 1BR1A 4MO7A 1ZRDA 1ETXA 3S2HJ 3CP8A 1DP3A 2LVSA 1W5CC 2O0YA 4CCKA 2R5YA 2UXXA 3H9JA 1W36D 2L54A 3L00A 4FISA 2BBYA 2QKLB 1KU3A 3KYDB 1XGSA 3QOPA 5ICGA 2KIFA 3RQ4A 2HDCA 1XCBA 2X9DA 3M7GA 4P96A 4LIUA 2J5OA 4NHJA 5L3DA 1R1TA 2DA1A 3IKVA 2RQPA 4A3BJ 2KP6A 4YRVA 3FK6A 3CUQA 3D5SC 3B02A 2R7SA 2C6YA 3JREA 2VKHA 4A6EA 4P9FA 2X1CA 3MZYA 1JKQC 2V9VA 2GAUA 2DBBA 3MAJA 3CQZJ 2V6CA 2HVSA 2M2EA 1B6AA 4PDKA 1VQ5I 2A05A 4WX9A 1P4WA 5IT9K 5BS6A 3SQNA 2YX4A 4E70A 2MFZA 4U0YA 4KN7X 1XDSA 1O7FA 4A3LJ 2LBFA 5E17F 4GYGA 2GOMA 3OYDA 1HDDC 2JA6J 1TBXA 3L7WA 4BH9A 4IRIA 4BNCA 2FNAA 2QM3A 2VQHA 4BU2A 3PL8A 5EGOB 3PJRA 2L9NA 1HLVA 2L9VA 4PJNA 4MQ9F 4PJ0C 1MBHA 5TRDA 5E8IA 5FRNA 4BE2A 4PFOA 2CW7A 1V4RA 3RJPA 4D5CA 1HA8A 1UCRA 2DOEA 1DUXC 3J7AY 3ZMUA 5FKOA 3O3KA 2V6EA 2LF7A 2G7HA 5CYVA 4CA0A 2K4JA 2I8DA 1WWXA 2VLAA 1XDUA 1TQIA 2DYRH 3ABMH 1FYMA 2KRCA 3H5RA 3MZHA 1YQAA 5CVUA 1ZGAA 2CQKA 2R7UA 4YFKF 4C2MJ 1O7LA 3BDDA 4IF4A 2A5YB 4LG0B 2VXZA 1IDZA 2Y2ZA 2PEXA 4Q48A 3V8LA 1YRNB 2IP2A 2R7WA 4JYKA 4O5VA 3ABUA 5KCMA 3VYUB 4XLCA 3GFLA 1YX5A 4RAGA 3DBHB 3VSKA 5GPCA 4I2OA 3IWZA 4I76A 1O3SA 3FIWA 3BP8A 3BG6A 3KPHA 2ME0A 4LK1F 1B4AA 3LSJA 2BYVE 5GAHJ 4U88A 1FLIA 2KKOA 2D1VA 5J47A 5HLTA 4MEXF 2EJRA 2A07F 3BCBA 5JI6A 2TRTA 3W2AA 4AM3A 1JGGA 2WB1N 2R7FA 3K70D 4M3EA 3GCMA 4XKVA 4S0HB 4UY8I 4DZJA 5C3EJ 1AKHB 2A69F 1Y8QB 2DCEA 3M8JA 2DPUA 3JRDA 4CCOA 3C1DA 3SEZA 1P2FA 4HSRA 3H92A 3OYLA 2COBA 2XAUA 1R49A 2XV4S 1ULYA 4LLNA 4H0EA 2E5ZA 2L4MA 1R5HA 2OF7A 3RPUD 3ZCOA 5FKNA 1OMIA 2XB0X 4E7HA 1O3RA 3H5AA 4D7MA 4X6AJ 2BW3B 4Y17A 3DCFA 4ZC3A 4EM1A 3K9TA 2K9NA 3AFHA 1T98A 1GXPA 4M71A 4XN0A 3BJOA 2ZJQF 1VQ7I 2QQ9A 2DMPA 3LFUA 4MTEA 2FNPA 1EH7A 1ON1A 2R3SA 2F6CA 3CTAA 1ZG5A 1FTZA 4GDFA 2H27A 1QPIA 2MD5A 4V19K 5C4JJ 2ZJRF 1TWAJ 3SJMA 2V79A 2IVMA 4M3BA 3OYFA 3DU5A 3F8NA 1SFEA 5IP9J 3HXLA 4IHVA 4IOAF 4A3DJ 1OCOH 2M1BA 4Z6YA 2QQ8A 5KK1A 1ZQ3P 3ZMVA 1VNDA 4Y52J 2XKOA 2WB1A 1WCMJ 3Q9SA 4OMZA 3MFKA 2QSGX 1FC3A 3VODA 3KLNA 3TKYA 2EH3A 2FOKA 2XGEA 2DMQA 2NVQJ 2XDVA 4XKBA 3K1PA 4LD5A 1T08B 1LDJA 2QBYB 1TQPA 2LY2A 4UB8C 4BGDA 1ETOA 3WTSC 1FEXA 1M1EB 1YE9A 2L4AA 2UV1A 2LDUA 5ILVA 3OYAA 3RZOJ 2K27A 2M8GX 1G3WA 4E6KG 5E1XA 1SVLA 1SAUA 4BYYA 3PM1A 4CXFA 4EMSA 4ESBA 2NRAC 5M5XJ 1ETWA 4WF2A 2CH0A 3BPVA 1FOYA 3WU2C 2DMUA 3MKLA 5D5VB 2R5ZB 4EJWA 1B9NA 2JSCA 5JLXA 3T8RA 2KPMA 1FT9A 2F5FA 3QP5A 3QOEA 4BHPA 2OTLI 3JRGA 1IN5A 3CC4I 4HQMA 3EUHA 3BR0A 3J7YJ 2CJJA 3G1MA 2XPVA 4RAYA 2HXIA 1B8IA 1G8XA 3M8EA 4M3DA 4A69C 2GM4A 2CUFA 1WVRA 5BMZA 1FOXA 5K7FA 2WY7Q 4ZZLA 1CF7B 1MZBA 2HQAA 3LFKA 1ZLJA 1OJLA 3DBLB 1FTTA 1RZ4A 3K0LA 3G6EI 1YIJI 2WV1A 2F2EA 3NWTA 3TL4X 3S2DJ 2QUFA 3VFZA 1K7AA 2FBIA 3CCQI 4UUSA 3SHFA 3HTSB 5J1UA 5IYBJ 2AHQA 1HDPA 1KQ9A 1XMKA 3CF2A 1X3ZB 2CO5A 1T8IA 5JR3A 2NVTJ 2EIMH 1PJRA 2XB5A 3ZPLA 5F1JA 1FX7A 1WHUA 3WE2A 3LAPA 3RIRA 2A6EF 2BGCA 3HOSA 5BNGA 2Y9ZA 1NH3A 1QBJA 2W57A 1LE8A 3MVPA 1RI7A 2FJ1A 3LWFA 1AA7A 5ILUA 1YI2I 2W7NA 4BHBA 2BEOA 4NDLA 2BVLA 3TOAA 4CICA 1HBXG 2A5WA 5HDNA 4WWCA 5M3MJ 2ZXHA 1X1CA 3HOXJ 2VT3A 5F08A 1MSFC 3L2VA 2WAFA 3JRAA 1Z05A 4A3KJ 2OD5A 4BDZA 5HVQC 2XSDC 2CFXA 4UV9A 2ACJA 2WBMA 1TWCJ 3K4JA 2VOOA 3GZ5A 5GADJ 3CDHA 3F9KA 1U8BA 3JRFA 2DMNA 3KIOA 2MG4A 3OV8A 1FY7A 4M6YA 2E36A 1O4XA 1KGSA 4RGXA 4W1UA 2VUMJ 3WTUC 1HW1A 1ZHFA 3G1LA 2VKDA 5D4SA 5F6FA 5JHFA 5FLXK 3JRHA 1OYIA 4RAFA 1WFXA 2XSJC 4UVCA 1BI2A 5LEJA 2XROA 3LSPA 1VQOI 4MIMA 3PO3J 4A3GJ 1TWGJ 3DF8A 2WC2A 1N77A 4HF2A 3CC2I 2KT0A 3LSHA 4XLNF 4YIFA 3PIPF 2HPMA 2GWRA 3HRUA 5GTIC 5J8FA 4M9ZA 2VOPA 2CQXA 2ADUA 2HS5A 3CUQC 3ZQGA 4OOIA 4OU0A 3M8FA 1BI3A 1XMXA 3AG2H 2Q0OA 1VQNI 1BM9A 5LGUA 4WK8F 2F5CA 4Y33A 2OTJI 2VI6A 3PNVA 5DS9A 5FLMJ 2ZMEC 4L0YB 1MW7A 2QCOA 5EZGA 2PX9A 4BXXJ 4L5EA 3JW4A 5LLQA 3OYKA 3A01A 3TP0A 3MKYB 4BDYA 1ZR2A 4LB6B 1OQYA 4NQWB 3A2KA 2PI0A 1SD4A 1K79A 2M5WA 3FMQA 1FYLA 1LFUP 3NRVA 1PYVA 4YEJA 4QTRA 2PG4A 2WV0A 5DUKA 4P9UA 2RNJA 4WXCA 5FKMA 2YX7A 2EFOA 1BR2A 2OV7A 2NS8A 2BOLA 2OJED 2HNHA 1HW2A 3GTOJ 1E3PA 2I10A 1LKXA 3D5RC 1TTYA 2ZSHB 4L9NA 4MHGA 4KYWA 4AIJA 3CCUI 1OCCH 1XN7A 4C3HJ 5B1AH 1K6OA 3OIQA 2AS5F 4WCGA 4B1RA 3HG9A 2ZMEB 5F64A 1RRJA 2EB7A 2MLKA 5D8LB 1E0EA 3K4BA 4D0PA 1MDMB 1JKOC 3EQLF 1U2WA 5EG0B 3JRBA 1FSHA 2HEOA 3BPXA 4AC0A 4PZJA 4LB5A 3DKYA 1GT0C 1GV5A 1QZYA 1JTYA 3A02A 4PUSA 3JTGA 3VWBA 4S05A 2M9HA 4JQFA 2LF8A 3O8GA 3X2QH 1IAWA 1O3TA 5F1RA 1YS7A 2A6HF 1IDYA 1WRJA 3V8KA 3GLXA 5CVJA 2QSHX 1BN5A 1XMAA 1K78B 3I4NJ 3CP2A 1Z3YA 1DPUA 4EJOA 2V7FA 1MJBA 3C2GA 5EEGA 3EDPA 4HX4A 3HL2A 3I4MJ 3CJTB 1R00A 2E2IJ 2EIKH 2V9KA 4LMYA 5FFZA 1SVOA 5GAEJ 3R0AA 3MKWB 4CYDA 4L9TA 1MMSA 3S14J 3CCMI 2JPBA 3KZZA 4UUTA 3V7RA 1IRGA 2FF4A 5L3EA 4G9YA 2VL8A 3O6BB 4BKXA 4BACA 4KIFA 1UMQA 3VDXA 3VPRA 2HYJA 5F0FA 1IZ1A 1I3QJ 1KZHA 2B9SA 1FIPA 1X2MA 4HG2A 5K7HA 3HGYA 1IV6A 3ABKH 2VASA 1S72I 4CHUA 3S1QJ 2LG4A 4E7SA 1YIOA 1N25A 1V3FA 2DTZA 1WI9A 1Z0XA 2DJNA 1A5JA 1FBQA 2RVCA 3J80Z 3H3VK 1YW7A 3Q3SA 5FD5A 4BXFA 4C3IJ 3WHCA 1QHHD 4NNJA 1SAXA 4GCVA 1R6RA 2JRMA 1B59A 3L2QA 1MBFA 2VJ5A 4R79A 4R1HA 2W00A 1R7JA 1ETQA 1UAAA 2X6XA 2LLKA 3H0GJ 5IY5H 1APLC 3JAMZ 3IAS2 3J7ZI 2HGCA 2EILH 2XPUA 2HPIA 3BTLA 1V5GA 4MFEA 1J59A 2L7FP 1Z6TA 5HLGA 1ZLKA 2HDDA 2E1CA 2IRFG 1D0XA 4DJAA 5M5YJ 4XIDA 3PNYA 2O3FA 2X4HA 4BE0A 5J3LA 2X1EA 1XGNA 2LOOA 2ECBA 5K5OA 1QZZA 2TCTA 5DEQA 4CZCA 2NS0A 3W2VA 3OYGA 4KJZA 4I01A 3IHUA 2DT6A 3E6DA 1Q1VA 1YHQI 3VYTB 2PFBA 4CUGA 2W48A 1REPC 1W0UA 2HZDA 2EPFA 3N97A 1MMNA 3L2CA 1S7OA 4AVZA 3P5JA 2XAJA 1XSDA 3E7LA 5E1WA 2PMZN 4XN3A 2HVQA 3OMYA 4YFNF 4NC8A 4GRIA 4J01A 5A2QZ 1H88C 1ACIA 2QF7A 2JN6A 1Y0NA 2OQGA 4BS9A 4EJUA 2PQ8A 2HQNA 4XOPA 5E79C 3F23A 2BY2A 2VQLA 1ZKGA 3EUHC 2DPDA 3U9GA 1Z7LA 2BY3A 4ANJA 1XX5A 3KCCA 2R7VA 5K1YA 1BI1A 2OPTA 2XRLA 1W5SA 3CMAI 2NYXA 3PFYA 3I58A 1QU3A 1Y6IA 4ZDLA 3RSNA 3WTYC 2LREA 2DMTA 5D5WB 3BJ6A 3IV5A 2P81A 3DFGA 4N4NB 2JPCA 5EEHA 2K02A 5J4YA 2E60A 4RA2A 4S04A 4UUVA 4A0ZA 1LJ9A 2NVXJ 3QYFA 2RQQA 3M1CA 2HTSA 3JSOA 1VTNC 1GVJA 3QP6A 1F5TA 3VSLA 2FD5A 4XQFA 1VQPI 2BXZA 4A3CJ 5H20A 2RV8A 1ZYRF 3I53A 1VF9A 1OCRH 3FKJA 1ZREA 1XCVA 3GYHX 2BZTA 4Q5SF 4PCQA 3CJRB 1T39A 5ERIA 3L1PA 5E3OA 2RN7A 1T33A 4O3MA 1NK3P 3H9QA 2FQ3A 1W36C 4E7LA 4H4KC 4IZZA 1TW3A 2PMZA 3KETA 2XIGA 3I59B 1PVEA 2AQEA 1QA6A 2OUMA 2M7BA 3DTIA 3GMEA 4FE7A 1L0OC 1P4XA 2NOGA 4N0BA 2QENA 2CUJA 1F4KA 3ZOBA 4EV0A 1ETVA 4HW0A 1A04A 5LFAA 2QEXI 2DOFA 1JKPC 3M9AA 2EQRA 3TBIA 3H9GA 1U8RA 2K9QA 1SFKA 5B3SH 3HGGA 4KT6A 5FKLA 4F91B 4OIRF 3W6VA 1TL8A 4AU7A 4HNVA 5LHHA 5L3CA 3ERED 3E1SA 1I1GA 2HFHA 2OU2A 2V26A 1G3YA 4G8XA 4DOZA 1FJLA 2R7OA 4XMYA 3RZDJ 3CLOA 1Y0UA 3QU3A 3BR5A 4XKWA 4FX4A 4A0YA 2STTA 4A3MJ 3E97A 1R5GA 4X0GA 2O5RA 4Y7NJ 1MBJA 1MNMC 2DQLA 1VQMI 2LSOA 4EGYA 1X1PA 1J5YA 3G1OA 4E7KA 2QYOA 3QPHA 1R36A 4U87A 1YITI 1KA8A 2VKVA 4X1EA 2MLGA 4HRIA 2EWNA 1IGNA 4U0VA 1S7AA 3FXOA 3OYHA 4M6XA 1R71A 3DU6A 1VQ6I 1YOVB 2LY9A 1OLTA 2W1OA 4NUBA 1PUFA 1Z7UA 1B72A 1U5TA 4XLPF 3ONQA 2AXTC 2HYGD 2CW0F 2K85A 3DPLC 2DYSH 3T1BA 3MN2A 2M87A 1VI0A 1WH7A 2H8RA 4O6JA 1H8AC 4RGRA 4N9IA 2R93J 3BJAA 1T6SA 4G7HF 1FP1D 5FFXA 2ZSIB 2IXSA 3AG3H 1G2HA 1XD7A 1E3OC 2QSFX 3ZP5A 2EZKA 5GAGJ 1P7IA 4KNYA 1HQCA 1XSVA 1LFBA 2DK5A 2V1UA 1UHSA 2DAOA 2NVYJ 2O7OA 5FLVA 4A6DA 4AYBN 3HHHA 4EQQA 3K70C 1JT0A 4JX5A 5L3BA 2LMDA 1WSUA 2MC4A 3ZQCA 3Q5FA 4XORA 1QRYA 4BBRJ 2XVCA 3OR1C 2COMA 3KP6A 4LG3A 1BR4A 1EA3A 3SFZA 4I7HA 3HKZN 2EA2A 1ETYA 2FX0A 1POGA 3V7SA 2P8TA 4WXHA 3DEUA 4L9VA 2ZJPF 1EJ9A 2KRFA 3CCSI 2EK5A 4ZH4F 1OKRA 4HPQA 4GGGA 1PUEE 4JOMA 5CJ9A 3S16J 1YJWI 4F93B 2D1HA 3BOQA 1SFUA 1MJAA 2LR8A 3FZVA 4CYCB 1LEAA 2JSPA 3OOUA 2XAFA 1IG7A 4IVNA 1Y56A 2P6SA 5DCMA 1KU9A 1OFCX 3F22A 3I5UA 2LC2A 3CZ6A 4ZJZA 1H89C 2FXAA 1WJFA 3TP3A 3WGIA 1FMWA 1H0MA 1JJ6C 4ZYHA 1G59A 5DYMA 3KEQA 5HS8A 3G71I 1IJWC 3PUFA 3JR9A 1VQKI 1N75A 2K3FA 3C7JA 5FO5A 3FHZA 3LQRA 1DU0A 5LGTA 3JSPA 4A3EJ 1JXSA 2DODA 3A03A 3ZMSA 2MW8A 5HDGA 3S3NA 2YPRA 4B43A 2F4MB 4AYBA 1S3JA 2H1LA 1Z9CA 3J81Z 3AG1H 2QVOA 2BXYA 4KDPA 2IS1A 3WODF 3Q0VA 4I0BA 1H9TA 1EH6A 2DFFA 2Q8KA 3J80K 3DLAA 2BVMA 1OYWA 3HKZA 3GTJJ 2DDBA 4DW6A 3I54A 1IV8A 1YO5C 3F8CA 1Z67A 3LA7A 4BJ5C 2EV0A 2VIXA 3NAUA 5JFRA 3ABTA 1I1SA 2R92J 4AIKA 2PJRA 3FXQA 1ITYA 3QQAA 1MIJA 4BQQA 3GFJA 3JAMK 4XR6A 2HI3A 1X4OA 1U3EM 2E2JJ 2CV2A 4RB0A 3V8JA 5J8CA 4ZTFA 5HNFA 5FRMA 1WQ2A 2KIQA 3E3VA 3SZGA 3CCVI 4IHXA 4Y4RA 5IPAA 4BEHA 4JP0A 4PGGA 3RCOA 2UWMA 1WJBA 5DM7F 4ON0A 1LFPA 3ZQFA 3JRIA 2R7RA 1K4TA 1JUSA 3RPQA 3W2WA 1ONVA 3SZTA 5K7ZA 3GTGJ 2IS6A 3OSFA 5KVRA 2VXDA 1BJAA 2ELHA 3HBLA 1Z1DA 3HUGB 4HLXA 5BQTA 4U7BA 1R1UA 1X3UA 4DQ2A 2FU4A 3DXJF 2FRHA 4XSXF 4IHTA 2Q2EB 2IGNA 2DA6A 1CQTA 3QODA 4IHWA 3S32A 1YX3A 4A3JJ 3OYEA 4LJZF 3T0YA 3FK7A 3HPHA 3LSKA 3PQKA 3KX2A 5HNHA 2VE9A 1BC8C 4R8HA 1NHAA 5A2QK 2DFHA 3SDBA 3K6GA 1BJZA 2OC6A 1ZRFA 3ZMTA 3V7CA 2M45A 3GFIA 3ZN0A 2NS7A 4IX7A 3RI4A 2LP0A 5E1ZB 5HODA 2M3AA 1IO2A 4J00A 3IWFA 4KMFA 1A6QA 2RAEA 4XOTA 3IH2A 4BHCA 3DTEA 4GXOA 2W25A 1Z21A 4KMUX 2KDZA 1TWHJ 2YR2A 2R4GA 4RAZA 3Q0WA 2CUZA 3K4LA 4CCNA 4L9JA 5IOYA 2EA4A 2H6BA 3ZGKA 4B47A 4IJAA 4HDVA 4NC6A 4A0XA 1QGPA 3KZIC 4C2UA 1ERDA 1FOWA 5E20A 2E19A 3GVAA 4ZYEA 1GUUA 5ICEA 1WI3A 3KYCB 4L5JA 2ID3A 4XICA 5DCFA 2Z99A 3IH3A 2MBFA 2L01A 4IPAA 4ENMA 3GTPJ 2CQQA 1AOYA 1SD5A 3Q0UA 3ZRGA 3BTCA 4PJLA 1BL0A 1UB9A 3IC7A 4XKCA 2ZFUA 2HQRA 3FBIB 4XRFA 1DGWY 4A5MA 4JX6A 1X58A 4U7DA 1UELB 2CSOA 5JHUA 4ENJA 2XAHA 3TDUC 4OMYA 4GYIA 1IRZA 1SVMA 4G6DA 4JBAA 3RDIA 1P7JA 1Z91A 2QQBA 2LH9A 4HX7A 3MZ8A 2VT2A 2CGPA 3B6CA 2ELKA 3U1KA 1LEBA 2ZB9A 3HIFA 2R7XA 4BQNA 3HC7A 1RETA 3DLLF 3Q9VA 2L0KA 2KISA 1S5LC 1G4DA 2JA7J 3OSGA 3BC8A 3BY6A 3GBGA 3HEFA 3IH4A 1ON2A 3FHNA 1O57A 3LSIA 4D7NA 4HNUA 4HAMA 4U0WA 4ESJA 4LFUA 3PO2J 1OR7A 4ZDPA 4FE4A 4NC7A 2D5VA 2HWVA 2H1KA 3E6BA 2UUZA 1D5YA 3BTJA 3C3WA 2E7XA 1ZGWA 3WU0A 2Z5UA 1BBYA 2Y9YA 5EGOA 2WAQN 5DV5A 4L0ZB 1X1DA 2EBIA 1X4PA 4RGSA 1LB2A 2R5YB 2HR3A 1LUJB 1TQMA 2M30A 1ZELA 2L7ZA 4Y13A 2H8WA 4KFCA 4RM2A 3K2AA 3A0HC 1U5TC 3SDGA 2VJJA 3HSFA 3AL0C 2IA0A 3D0SA 3ZXSA 4B3XA 1D0YA 2A68F 5C4XJ 3FXRA 4F3QA 1RESA 2GIVA 2R7DA 2FQ4A 1FYKA 3GO5A 5F0HA 3L2WA 3P9CA 3CUQB 2HU9A 1K6YA 3EYYA 4RMNA 4F7ZA 1JE8A 3QU6A 3RKYA 4BBSJ 1F43A 1TP4A 1UHMA 4EATA 4IRHA 3H1CA 4LG0A 4XLFA 5B66C 1WZ2A 4HF1A 2DI3A 1ORKA 3HRTA 3DKWA 5LEKA 1YRNA 2F4IA 5GPAA 3DEEA 2K3PA 2LBFB 4A2UA 2DDAA 5J4VA 3HOZJ 2L2OA 2KDOA 5JLWA 2M0MA 4IXAA 3O2PE 4BL0B 5LHGA 5ICFA 1WJEA 1Z6RA 1VQ9I 1MSEC 2ME6A 3HOUJ 4IOCF 2EINH 1U9OA 2P5VA 2F5DA 2X6YA 2HVRA 1DP7P 2CV0A 4P55A 2HDWA 2WAQA 3G3ZA 1AKHA 3ELKA 1T2KA 1ZARA 1VZ0A 4W97A 2ZC2A 1HCRA 1W7PB 1IXCA 3S1NJ 2PBIA 1MNDA 3RKXA 3ROUA 4YFXF 1NK2P 2TDXA 1MH4A 4PJMA 2DJIA 3F72A 4M9XA 3CO7C 1OCTC 1TW2A 4BXUA 1BI0A 4G7ZF 2XGDA 3GFMA 4ZYDA 5ICCA 3COAC 3CDLA 2VN2A 4M3GA 2Z9OA 3ML6A 2X6OA 3LQQA 2XAGA 4LIVA 1I5ZA 2QLZA 3ISPA 3D1NI 2BW3A 1ODDA 1GV2A 1QNTA 2K5CA 4DYCA 4B3AA 4HF0A 3OYIA 3MD2A 3HRMA 4IQJA 4Y15A
chains in the Genus database with same CATH topology
3DP7A 3VB2A 3E6MA 1E17A 1R1VA 5LBQA 2K86A 3FWEA 3LSTA 5HS9A 5FB2A 1DDNA 2G9WA 4L18B 3PFIA 2E7WA 4DNCA 5HLHA 1F1ZA 3I64A 4M73A 2OA4A 2EFNA 1USSA 5K5RA 2DT5A 1LDDA 1HXDA 3J81K 1ZH5A 5H6RA 2F5EA 4LK0F 2QBYA 1T0FA 1J7KA 1UHWA 2FA5A 3WTTC 1OPCA 3ZQ7A 5E8GA 3J7AO 3NQOA 2XHKA 3JTHA 3I4PA 2D45A 1MD0A 3QAHA 3K1MA 3KP4A 1IF1A 1XGMA 5HLIA 2P5KA 4ENKA 3KEOA 4MGRA 2OQRA 2G7UA 3BWGA 2GA1A 3DQVC 3IRQA 1FNNA 3IKTA 5DDGA 1CF7A 2FE3A 4KICA 6PAXA 5D5UB 1FOKA 3GX4X 1SMTA 1IN6A 2D2WA 1B9MA 3TO7A 5AIQA 1U78A 2VE8A 3EETA 4I98B 4HLYA 1G6NA 3ECHA 1IW7F 3TDZC 3S2WA 1YG2A 4FX0A 3FM3A 3W6KB 3RYPA 1HKTA 3T8TA 2GXBA 4ESFA 4QLCU 1HW5A 2A61A 4N9HA 3BROA 4YG2F 3H3UA 2EFWA 1R23A 4FHTA 4HDUA 1IXRC 3FX3A 2ESHA 1GXQA 2QZ8A 3FMSA 5D8KB 1XGOA 1YS6A 3REOA 4LLLA 2DLLA 1GHCA 4UVBA 5TJJA 4G94A 3F21A 2CWEA 1LNWA 2PMHA 2IA2A 2Z3YA 3E5XA 3R60A 1IRFA 2BE5F 3E5QA 1ZG3A 2IT0A 1PDNC 1J2XA 2NNNA 3G73A 1BIBA 2VONA 4KT5C 2STWA 5DD4A 2HYFA 3DPTA 2P5LC 1STZA 1YFHA 4OINF 4RB3C 2B0LA 2OZ6A 3E6CC 2FBKA 3M1EA 1XSXA 3I0TA 2WWYA 2LNBA 3GEZA 4MQVA 3D5LA 4CDGA 4TV7A 1BIAA 1DPRA 3KP5A 4NQWA 2HOEA 1KU7A 3W6JB 1RUNA 3HSEA 3CO6C 4HX8A 2VC1A 1HSTA 2ZKZA 3TQNA 1ZG1A 1SMYF 4I02A 5D4RA 3NEUA 2O61A 4CGZA 1LQ1A 2ZO4A 2NAZA 1YYVA 2KIUA 1TNSA 2ZMEA 1P92A 2DK8A 1MDMA 5D6EA 1JHHA 2YSRA 3LAJA 1CGPA 3LA2A 4IRGA 3SXYA 5H6QA 3I71A 1Q1HA 2IJLA 2QQAA 2ZJ2A 3HOTA 1K78A 2AXLA 1FZPB 3WTXC 1W7PA 2ZNYA 4M9SA 4YIIA 4KN4X 3VOEA 2ISZA 3KE2A 5L3GA 3AAFA 2JZYA 2EV6A 2ETHA 2VC0A 1LDKB 2BV6A 1UFMA 3TOBA 5D5XB 3MQ0A 3L9FA 3MCZA 1E2XA 1P6RA 3IRRA 3TO9A 4Q47A 3PQJA 2IA1A 5JVTA 2RDPA 2EV5A 5HDKA 2OBPA 1WKMA 1R58A 2GA2A 2V1XA 2XKPA 4RB2C 4KA4A 3V4GA 2MH9A 2ZFWA 2WTEA 3RTRA 1T38A 1BC7C 1RIOH 2UXNA 2JTVA 1KU2A 1SFXA 3P9IA 2LKPA 4WXDA 2IPQX 3HTUA 1MKMA 5CLSA 4AD9A 2KJBA 4AIHA 1F9NA 2GZWA 4FT8A 1HKQA 3VEPA 1FWZA 3GF2A 4HYEA 2VBZA 4HZFA 4MNUA 4EM2A 2KIMA 2DO7A 2JRTA 3IL2A 2ZCWA 3C18A 5K5QA 3F8FA 1EV7A 3K69A 2PLYA 4ENNA 1W4MA 3HSRA 3N4MA 2CG4A 2K4BA 4KIBA 3ZN1A 4UNOA 3F6VA 2FSWA 2XRNA 2Y48A 2W85A 1J0RA 1PP7U 4G6QA 4AWXB 1KYWA 5LHIA 2PJPA 2E1NA 2XASA 3P7NA 1D5VA 3E5UA 3I59A 3F6OA 5E18F 2HKOA 2J5PA 1ZN2A 3MWMA 1G3SA 1EH8A 2ZXJA 2QWWA 4XSZF 3GW2A 4MEYF 3WE3A 2ZBKA 1HKSA 5IT3A 4CO8A 1TNTA 4MTDA 1QQIA 4HBLA 4HQEA 1RUOA 4K2EA 5BPDA 1MJ9A 1ZRCA 4GO1A 4A12A 5AONA 1H9GA 3WG9A 1O3QA 5ILSA 3WGHA 2MC3A 3T5XA 1OYYA 1YTYA 4CZZA 3KP3A 3HRSA 3R0JA 2W84A 3R4KA 2YU3A 1D3YA 4HOBA 2L02A 5IT9Z 1QO0D 2KJCA 5AIPA 1S29A 2MH2A 4I09A 1KYZA 1S6LA 2Z33A 1FP2A 3B73A 5CVRA 2XUBA 2ZNZA 4ZYGA 3ECOA 2VBYA 3WTWC 3GXOA 4Z2YA 3TO6A 1L3LA 1D8JA 5CVVA 2Y75A 5BOXA 2V1DA 3GUDA 1I6XA 4ZZDA 5DUIA 3U2RA 4LLGF 1IN7A 3F8MA 1U5TB 2VBWA 1I27A 1TLHB 4XBFA 4ASNA 3QRFF 4EGZA 3KFWX 5HOOA 4NB5A 4UV8A 1BOAA 1G3TA 2HZTA 2DW4A 2RC4A 4RGUA 4EJVA 2DU9A 5ED4A 2A3SA 2FEZA 3F3XA 5LRSA 1MGTA 1RNLA 2M8EA 5L3FA 3RPUA 3SZPA 2RGVA 4UHTA 3WTVC 1W5TA 1W7PD 2CYYA 4IHSA 2H09A 4P5OA 2VBXA 1SD7A 2UZKA 4BAYA 2FBHA 1PP8F 3L09A 2IW5A 3KP2A 2O03A 1P4AA 2PMUA 2JT1A 4HV6A 4OIOF 3LA3A 3R61A 1J75A 2H94A 3HHGA 2PN6A 3F8BA 3P9KA 2DTRA 2OAZA 1YLFA 2Y0MA 2K7LA 4ETSA 4OIPF 4OIQF 5CVIA 5DCMB 2XGXA 1IXSB 2GQQA 3EYIA 2HKXA 1QPMA 2X0LA 2ESNA 1KQ0A 5DD8A 4I0AA 3FMRA 3WGGA 2EFQA 2P7VB 1S8NA 4AVPA 2W24A 2P4WA 3HUGA 3FXUA 2EFPA 1B1BA 4M74A 4RS8A 2P7CB 2Q2EA 1FBUA 3GZ6A 4B09A 4EVIA 2XAQA 1FSEA 1ZGJA 1ZAOA 5J6XA 1FBSA 1XB4A 3CUOA 5LRRA 2ISYA 4G7OF 2OZUA 3RKWA 5HS7A 1R22A 4UVAA 3FF5A 1IUYA 4UXNA 2MA3A 4Q4ZF 3ZMZA 3DV8A 3GWZA 1U6GA 5FGMA 4A5NA 4M72A 4LGWA 3FM5A 3K1NA 5FD6A 4JK1X 1KQ8A 4HV5A 3RYRA 4RB1A 1C0WA 3MEXA 1SD6A 3R6SA 3ULQB 3K2ZA 1J9IA 3ZMDA 1HSJA 3U1DA 3BZ6A 5BPIA 4KUMA 2DFIA 2RKHA 4BQAA 2H6CA 1IN4A 3H3ZA 1JGSA 4KIGA 3OOPA 1IN8A 1YW8A 2O6GE 4EM0B 2P6TA 3TGNA 3WTZA 3CJNA 3WU1B 2HTJA 1USTA 5LGNA 1FPQA 4HA8A 3KP7A 1AWCA 1LVAA 2FMYA 2L3DA 1D8KA 2DQRA 4EJTA 5D6FA 3HYIA 2O8XA 4PGHA 3KZYA 1YW9A 3KLOA 4QWQA 2GXGA 2VODA 4L5IA 5FLXZ 4B8XA 2FMLA 1JHFA 3QPTA 2NNYA 1ZRDA 2O0YA 2UXXA 2L54A 3L00A 2BBYA 1KU3A 1XGSA 3QOPA 5ICGA 2KIFA 2HDCA 1XCBA 3M7GA 4P96A 2J5OA 4NHJA 5L3DA 1R1TA 3IKVA 2RQPA 3CUQA 3B02A 2C6YA 4A6EA 4P9FA 3MZYA 2V9VA 2GAUA 2DBBA 3MAJA 2V6CA 1B6AA 4PDKA 4WX9A 1P4WA 5IT9K 5BS6A 3SQNA 2YX4A 4E70A 4U0YA 4KN7X 1XDSA 1O7FA 5E17F 4GYGA 1TBXA 3L7WA 4BH9A 4IRIA 4BNCA 2FNAA 2QM3A 4MQ9F 5TRDA 5E8IA 1V4RA 3RJPA 1UCRA 1DUXC 3ZMUA 3O3KA 2LF7A 2G7HA 5CYVA 2K4JA 1WWXA 1XDUA 1TQIA 1FYMA 3MZHA 1YQAA 5CVUA 1ZGAA 2CQKA 4YFKF 1O7LA 3BDDA 4IF4A 2A5YB 4LG0B 2VXZA 2PEXA 3V8LA 4Q48A 2IP2A 4O5VA 3ABUA 4I2OA 3GFLA 3IWZA 1O3SA 3BP8A 4LK1F 1B4AA 2BYVE 4U88A 1FLIA 2KKOA 2D1VA 4MEXF 2EJRA 2A07F 5JI6A 2R7FA 2A69F 2DPUA 3C1DA 1P2FA 3H92A 2XV4S 1ULYA 4LLNA 4H0EA 2L4MA 1R5HA 1OMIA 1O3RA 4Y17A 4EM1A 3K9TA 1T98A 1GXPA 4M71A 3BJOA 2QQ9A 4MTEA 2FNPA 1EH7A 1ON1A 2R3SA 3CTAA 1ZG5A 2H27A 2MD5A 2V79A 2IVMA 3F8NA 1SFEA 2M1BA 5KK1A 3ZMVA 2XKOA 3Q9SA 4OMZA 3MFKA 1FC3A 3VODA 3KLNA 3TKYA 2FOKA 3K1PA 4LD5A 1LDJA 2QBYB 1TQPA 3WTSC 2L4AA 2LDUA 5ILVA 2K27A 1G3WA 5E1XA 4BYYA 4CXFA 4EMSA 4ESBA 2NRAC 4WF2A 3BPVA 5D5VB 4EJWA 1B9NA 2JSCA 3T8RA 1FT9A 2F5FA 3QP5A 4BHPA 1IN5A 4HQMA 3EUHA 4RAYA 3M8EA 5BMZA 4ZZLA 1CF7B 1MZBA 3LFKA 1ZLJA 1RZ4A 3K0LA 2F2EA 2QUFA 3VFZA 1K7AA 2FBIA 3SHFA 3HTSB 1KQ9A 1XMKA 2CO5A 5JR3A 3ZPLA 1FX7A 3LAPA 3WE2A 3RIRA 2A6EF 2BGCA 3HOSA 1QBJA 2W57A 1RI7A 3LWFA 5ILUA 4BHBA 2BEOA 3TOAA 4CICA 1HBXG 5HDNA 4WWCA 2VT3A 1Z05A 2OD5A 5HVQC 2CFXA 4UV9A 2ACJA 2VOOA 3GZ5A 3CDHA 3OV8A 1FY7A 4M6YA 1KGSA 4RGXA 3WTUC 1HW1A 1ZHFA 5D4SA 5F6FA 5FLXK 1OYIA 4UVCA 5LEJA 1BI2A 2XROA 3DF8A 2WC2A 4HF2A 4XLNF 4YIFA 2GWRA 3HRUA 5J8FA 2VOPA 4M9ZA 2ADUA 2HS5A 3CUQC 4OOIA 4OU0A 3M8FA 1BI3A 2Q0OA 1BM9A 5LGUA 4WK8F 2F5CA 4L0YB 5LLQA 3JW4A 4LB6B 2PI0A 1SD4A 1K79A 2M5WA 3FMQA 1FYLA 3NRVA 2PG4A 2WV0A 5DUKA 4P9UA 2RNJA 4WXCA 2YX7A 2EFOA 1HW2A 1TTYA 4L9NA 4MHGA 4KYWA 4AIJA 1XN7A 1K6OA 2AS5F 4WCGA 2ZMEB 5F64A 2EB7A 2MLKA 5D8LB 1MDMB 4D0PA 3EQLF 1U2WA 1FSHA 2HEOA 3BPXA 4PZJA 4LB5A 1QZYA 3JTGA 4S05A 4JQFA 2LF8A 1IAWA 1O3TA 5F1RA 1YS7A 2A6HF 1WRJA 3V8KA 3GLXA 5CVJA 1BN5A 1XMAA 1K78B 1DPUA 4EJOA 1MJBA 5EEGA 3EDPA 4HX4A 1R00A 4LMYA 5FFZA 3R0AA 4CYDA 4L9TA 2JPBA 3KZZA 3V7RA 1IRGA 2FF4A 5L3EA 4G9YA 3O6BB 4KIFA 1IZ1A 4CHUA 1YIOA 1V3FA 1WI9A 1FBQA 2RVCA 3J80Z 1YW7A 5FD5A 1SAXA 4GCVA 1B59A 4R79A 4R1HA 1R7JA 3JAMZ 2HGCA 1J59A 1Z6TA 5HLGA 1ZLKA 2E1CA 2IRFG 2O3FA 2X4HA 1XGNA 5K5OA 1QZZA 5DEQA 2NS0A 4I01A 3IHUA 3E6DA 2PFBA 1REPC 3N97A 3L2CA 1S7OA 2XAJA 1XSDA 5E1WA 4YFNF 5A2QZ 2OQGA 4EJUA 2PQ8A 2HQNA 3F23A 2DPDA 3U9GA 3KCCA 5K1YA 1BI1A 1W5SA 2NYXA 3I58A 3WTYC 5D5WB 3BJ6A 3DFGA 2JPCA 5EEHA 2K02A 4S04A 4UUVA 4A0ZA 1LJ9A 2HTSA 3JSOA 1VTNC 1GVJA 3QP6A 1F5TA 5H20A 2RV8A 1ZYRF 3I53A 1ZREA 1XCVA 3GYHX 4Q5SF 4PCQA 1T39A 5ERIA 2RN7A 4O3MA 2FQ3A 1TW3A 3KETA 2XIGA 3I59B 1L0OC 1P4XA 4N0BA 2QENA 1F4KA 4EV0A 4HW0A 1A04A 3M9AA 1U8RA 4OIRF 5LHHA 5L3CA 3ERED 1I1GA 2HFHA 2OU2A 1G3YA 4G8XA 3CLOA 1Y0UA 3QU3A 4FX4A 4A0YA 2STTA 3E97A 1R5GA 2DQLA 2LSOA 4EGYA 1J5YA 2QYOA 3QPHA 1R36A 1KA8A 2MLGA 2EWNA 4U0VA 1S7AA 4M6XA 1Z7UA 1U5TA 4XLPF 2HYGD 2CW0F 3DPLC 3T1BA 2M87A 4O6JA 4RGRA 4N9IA 3BJAA 1T6SA 4G7HF 1FP1D 5FFXA 1XD7A 3ZP5A 4KNYA 1HQCA 1XSVA 2DK5A 2V1UA 2DAOA 4A6DA 3HHHA 4EQQA 5L3BA 1WSUA 3Q5FA 2XVCA 2COMA 3KP6A 3SFZA 4I7HA 2EA2A 3V7SA 2P8TA 4WXHA 3DEUA 4L9VA 2KRFA 2EK5A 4ZH4F 1OKRA 4GGGA 1PUEE 5CJ9A 2D1HA 3BOQA 1SFUA 1MJAA 3FZVA 1LEAA 2XAFA 4IVNA 2P6SA 5DCMA 1KU9A 3F22A 3I5UA 2FXAA 3WGIA 1H0MA 4ZYHA 5DYMA 3KEQA 5HS8A 3C7JA 5FO5A 3FHZA 3LQRA 5LGTA 3JSPA 1JXSA 3ZMSA 5HDGA 2YPRA 1S3JA 1Z9CA 3J81Z 2QVOA 4KDPA 3WODF 4I0BA 1H9TA 1EH6A 2Q8KA 3J80K 1OYWA 3I54A 1YO5C 3F8CA 3LA7A 5JFRA 2EV0A 3ABTA 1I1SA 4AIKA 3FXQA 3JAMK 3GFJA 1U3EM 4RB0A 3V8JA 5J8CA 1WQ2A 3E3VA 4PGGA 2UWMA 4ON0A 3RPQA 1ONVA 3SZTA 5KVRA 1BJAA 2ELHA 1Z1DA 4HLXA 5BQTA 4U7BA 1R1UA 1X3UA 4DQ2A 2FU4A 3DXJF 2FRHA 4XSXF 4IHTA 4LJZF 3T0YA 3PQKA 2VE9A 1BC8C 4R8HA 1NHAA 5A2QK 1ZRFA 3ZMTA 3V7CA 2M45A 3GFIA 3ZN0A 3RI4A 5E1ZB 3IWFA 4KMFA 4BHCA 4GXOA 2W25A 4KMUX 2YR2A 4RAZA 4L9JA 2EA4A 2H6BA 4IJAA 4HDVA 4A0XA 1QGPA 5E20A 3GVAA 4ZYEA 5ICEA 4L5JA 5DCFA 2Z99A 2MBFA 2L01A 4IPAA 4ENMA 1AOYA 1SD5A 1UB9A 3IC7A 2HQRA 4XRFA 4A5MA 4U7DA 2CSOA 5JHUA 4ENJA 2XAHA 3TDUC 4OMYA 4GYIA 4G6DA 4JBAA 3RDIA 1Z91A 2QQBA 4HX7A 2VT2A 2CGPA 1LEBA 3HIFA 3Q9VA 1G4DA 3BY6A 1ON2A 1O57A 4HAMA 4U0WA 4ESJA 4LFUA 1OR7A 2HWVA 3E6BA 3C3WA 2E7XA 3WU0A 2Z5UA 1BBYA 5DV5A 4L0ZB 4RGSA 1LB2A 2HR3A 1TQMA 2M30A 4Y13A 4KFCA 1U5TC 3HSFA 2IA0A 3D0SA 2A68F 3FXRA 2GIVA 2R7DA 1FYKA 3GO5A 3P9CA 3CUQB 3EYYA 4F7ZA 1JE8A 3QU6A 3RKYA 1UHMA 4IRHA 4LG0A 4HF1A 2DI3A 3HRTA 5LEKA 3DKWA 4A2UA 4IXAA 3O2PE 5LHGA 5ICFA 1Z6RA 2P5VA 2F5DA 1DP7P 4P55A 3G3ZA 3ELKA 1T2KA 1ZARA 1W7PB 1IXCA 2PBIA 3RKXA 3ROUA 4YFXF 2TDXA 3CO7C 3F72A 4M9XA 1TW2A 4BXUA 1BI0A 4G7ZF 3GFMA 4ZYDA 5ICCA 3COAC 2VN2A 2Z9OA 3ML6A 3LQQA 2XAGA 1I5ZA 2QLZA 3ISPA 1ODDA 1QNTA 4HF0A 3HRMA 4Y15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DP7 A;  3VB2 A;  3E6M A;  1E17 A;  1R1V A;  5LBQ A;  2K86 A;  3FWE A;  3LST A;  5HS9 A;  5FB2 A;  1DDN A;  2G9W A;  4L18 B;  3PFI A;  2E7W A;  4DNC A;  5HLH A;  1F1Z A;  3I64 A;  4M73 A;  2OA4 A;  2EFN A;  1USS A;  5K5R A;  2DT5 A;  1LDD A;  1HXD A;  3J81 K;  1ZH5 A;  5H6R A;  2F5E A;  4LK0 F;  2QBY A;  1T0F A;  1J7K A;  1UHW A;  2FA5 A;  3WTT C;  1OPC A;  3ZQ7 A;  5E8G A;  3J7A O;  3NQO A;  2XHK A;  3JTH A;  3I4P A;  2D45 A;  1MD0 A;  3QAH A;  3K1M A;  3KP4 A;  1IF1 A;  1XGM A;  5HLI A;  2P5K A;  4ENK A;  3KEO A;  4MGR A;  2OQR A;  2G7U A;  3BWG A;  2GA1 A;  3DQV C;  3IRQ A;  1FNN A;  3IKT A;  5DDG A;  1CF7 A;  2FE3 A;  4KIC A;  6PAX A;  5D5U B;  1FOK A;  3GX4 X;  1SMT A;  1IN6 A;  2D2W A;  1B9M A;  3TO7 A;  5AIQ A;  1U78 A;  2VE8 A;  3EET A;  4I98 B;  4HLY A;  1G6N A;  3ECH A;  1IW7 F;  3TDZ C;  3S2W A;  1YG2 A;  4FX0 A;  3FM3 A;  3W6K B;  3RYP A;  1HKT A;  3T8T A;  2GXB A;  4ESF A;  4QLC U;  1HW5 A;  2A61 A;  4N9H A;  3BRO A;  4YG2 F;  3H3U A;  2EFW A;  1R23 A;  4FHT A;  4HDU A;  1IXR C;  3FX3 A;  2ESH A;  1GXQ A;  2QZ8 A;  3FMS A;  5D8K B;  1XGO A;  1YS6 A;  3REO A;  4LLL A;  2DLL A;  1GHC A;  4UVB A;  5TJJ A;  4G94 A;  3F21 A;  2CWE A;  1LNW A;  2PMH A;  2IA2 A;  2Z3Y A;  3E5X A;  3R60 A;  1IRF A;  2BE5 F;  3E5Q A;  1ZG3 A;  2IT0 A;  1PDN C;  1J2X A;  2NNN A;  3G73 A;  1BIB A;  2VON A;  4KT5 C;  2STW A;  5DD4 A;  2HYF A;  3DPT A;  2P5L C;  1STZ A;  1YFH A;  4OIN F;  4RB3 C;  2B0L A;  2OZ6 A;  3E6C C;  2FBK A;  3M1E A;  1XSX A;  3I0T A;  2WWY A;  2LNB A;  3GEZ A;  4MQV A;  3D5L A;  4CDG A;  4TV7 A;  1BIA A;  1DPR A;  3KP5 A;  4NQW A;  2HOE A;  1KU7 A;  3W6J B;  1RUN A;  3HSE A;  3CO6 C;  4HX8 A;  2VC1 A;  1HST A;  2ZKZ A;  3TQN A;  1ZG1 A;  1SMY F;  4I02 A;  5D4R A;  3NEU A;  2O61 A;  4CGZ A;  1LQ1 A;  2ZO4 A;  2NAZ A;  1YYV A;  2KIU A;  1TNS A;  2ZME A;  1P92 A;  2DK8 A;  1MDM A;  5D6E A;  1JHH A;  2YSR A;  3LAJ A;  1CGP A;  3LA2 A;  4IRG A;  3SXY A;  5H6Q A;  3I71 A;  1Q1H A;  2IJL A;  2QQA A;  2ZJ2 A;  3HOT A;  1K78 A;  2AXL A;  1FZP B;  3WTX C;  1W7P A;  2ZNY A;  4M9S A;  4YII A;  4KN4 X;  3VOE A;  2ISZ A;  3KE2 A;  5L3G A;  3AAF A;  2JZY A;  2EV6 A;  2ETH A;  2VC0 A;  1LDK B;  2BV6 A;  1UFM A;  3TOB A;  5D5X B;  3MQ0 A;  3L9F A;  3MCZ A;  1E2X A;  1P6R A;  3IRR A;  3TO9 A;  4Q47 A;  3PQJ A;  2IA1 A;  5JVT A;  2RDP A;  2EV5 A;  5HDK A;  2OBP A;  1WKM A;  1R58 A;  2GA2 A;  2V1X A;  2XKP A;  4RB2 C;  4KA4 A;  3V4G A;  2MH9 A;  2ZFW A;  2WTE A;  3RTR A;  1T38 A;  1BC7 C;  1RIO H;  2UXN A;  2JTV A;  1KU2 A;  1SFX A;  3P9I A;  2LKP A;  4WXD A;  2IPQ X;  3HTU A;  1MKM A;  5CLS A;  4AD9 A;  2KJB A;  4AIH A;  1F9N A;  2GZW A;  4FT8 A;  1HKQ A;  3VEP A;  1FWZ A;  3GF2 A;  4HYE A;  2VBZ A;  4HZF A;  4MNU A;  4EM2 A;  2KIM A;  2DO7 A;  2JRT A;  3IL2 A;  2ZCW A;  3C18 A;  5K5Q A;  3F8F A;  1EV7 A;  3K69 A;  2PLY A;  4ENN A;  1W4M A;  3HSR A;  3N4M A;  2CG4 A;  2K4B A;  4KIB A;  3ZN1 A;  4UNO A;  3F6V A;  2FSW A;  2XRN A;  2Y48 A;  2W85 A;  1J0R A;  1PP7 U;  4G6Q A;  4AWX B;  1KYW A;  5LHI A;  2PJP A;  2E1N A;  2XAS A;  3P7N A;  1D5V A;  3E5U A;  3I59 A;  3F6O A;  5E18 F;  2HKO A;  2J5P A;  1ZN2 A;  3MWM A;  1G3S A;  1EH8 A;  2ZXJ A;  2QWW A;  4XSZ F;  3GW2 A;  4MEY F;  3WE3 A;  2ZBK A;  1HKS A;  5IT3 A;  4CO8 A;  1TNT A;  4MTD A;  1QQI A;  4HBL A;  4HQE A;  1RUO A;  4K2E A;  5BPD A;  1MJ9 A;  1ZRC A;  4GO1 A;  4A12 A;  5AON A;  1H9G A;  3WG9 A;  1O3Q A;  5ILS A;  3WGH A;  2MC3 A;  3T5X A;  1OYY A;  1YTY A;  4CZZ A;  3KP3 A;  3HRS A;  3R0J A;  2W84 A;  3R4K A;  2YU3 A;  1D3Y A;  4HOB A;  2L02 A;  5IT9 Z;  1QO0 D;  2KJC A;  5AIP A;  1S29 A;  2MH2 A;  4I09 A;  1KYZ A;  1S6L A;  2Z33 A;  1FP2 A;  3B73 A;  5CVR A;  2XUB A;  2ZNZ A;  4ZYG A;  3ECO A;  2VBY A;  3WTW C;  3GXO A;  4Z2Y A;  3TO6 A;  1L3L A;  1D8J A;  5CVV A;  2Y75 A;  5BOX A;  2V1D A;  3GUD A;  1I6X A;  4ZZD A;  5DUI A;  3U2R A;  4LLG F;  1IN7 A;  3F8M A;  1U5T B;  2VBW A;  1I27 A;  1TLH B;  4XBF A;  4ASN A;  3QRF F;  4EGZ A;  3KFW X;  5HOO A;  4NB5 A;  4UV8 A;  1BOA A;  1G3T A;  2HZT A;  2DW4 A;  2RC4 A;  4RGU A;  4EJV A;  2DU9 A;  5ED4 A;  2A3S A;  2FEZ A;  3F3X A;  5LRS A;  1MGT A;  1RNL A;  2M8E A;  5L3F A;  3RPU A;  3SZP A;  2RGV A;  4UHT A;  3WTV C;  1W5T A;  1W7P D;  2CYY A;  4IHS A;  2H09 A;  4P5O A;  2VBX A;  1SD7 A;  2UZK A;  4BAY A;  2FBH A;  1PP8 F;  3L09 A;  2IW5 A;  3KP2 A;  2O03 A;  1P4A A;  2PMU A;  2JT1 A;  4HV6 A;  4OIO F;  3LA3 A;  3R61 A;  1J75 A;  2H94 A;  3HHG A;  2PN6 A;  3F8B A;  3P9K A;  2DTR A;  2OAZ A;  1YLF A;  2Y0M A;  2K7L A;  4ETS A;  4OIP F;  4OIQ F;  5CVI A;  5DCM B;  2XGX A;  1IXS B;  2GQQ A;  3EYI A;  2HKX A;  1QPM A;  2X0L A;  2ESN A;  1KQ0 A;  5DD8 A;  4I0A A;  3FMR A;  3WGG A;  2EFQ A;  2P7V B;  1S8N A;  4AVP A;  2W24 A;  2P4W A;  3HUG A;  3FXU A;  2EFP A;  1B1B A;  4M74 A;  4RS8 A;  2P7C B;  2Q2E A;  1FBU A;  3GZ6 A;  4B09 A;  4EVI A;  2XAQ A;  1FSE A;  1ZGJ A;  1ZAO A;  5J6X A;  1FBS A;  1XB4 A;  3CUO A;  5LRR A;  2ISY A;  4G7O F;  2OZU A;  3RKW A;  5HS7 A;  1R22 A;  4UVA A;  3FF5 A;  1IUY A;  4UXN A;  2MA3 A;  4Q4Z F;  3ZMZ A;  3DV8 A;  3GWZ A;  1U6G A;  5FGM A;  4A5N A;  4M72 A;  4LGW A;  3FM5 A;  3K1N A;  5FD6 A;  4JK1 X;  1KQ8 A;  4HV5 A;  3RYR A;  4RB1 A;  1C0W A;  3MEX A;  1SD6 A;  3R6S A;  3ULQ B;  3K2Z A;  1J9I A;  3ZMD A;  1HSJ A;  3U1D A;  3BZ6 A;  5BPI A;  4KUM A;  2DFI A;  2RKH A;  4BQA A;  2H6C A;  1IN4 A;  3H3Z A;  1JGS A;  4KIG A;  3OOP A;  1IN8 A;  1YW8 A;  2O6G E;  4EM0 B;  2P6T A;  3TGN A;  3WTZ A;  3CJN A;  3WU1 B;  2HTJ A;  1UST A;  5LGN A;  1FPQ A;  4HA8 A;  3KP7 A;  1AWC A;  1LVA A;  2FMY A;  2L3D A;  1D8K A;  2DQR A;  4EJT A;  5D6F A;  3HYI A;  2O8X A;  4PGH A;  3KZY A;  1YW9 A;  3KLO A;  4QWQ A;  2GXG A;  2VOD A;  4L5I A;  5FLX Z;  4B8X A;  2FML A;  1JHF A;  3QPT A;  2NNY A;  1ZRD A;  2O0Y A;  2UXX A;  2L54 A;  3L00 A;  2BBY A;  1KU3 A;  1XGS A;  3QOP A;  5ICG A;  2KIF A;  2HDC A;  1XCB A;  3M7G A;  4P96 A;  2J5O A;  4NHJ A;  5L3D A;  1R1T A;  3IKV A;  2RQP A;  3CUQ A;  3B02 A;  2C6Y A;  4A6E A;  4P9F A;  3MZY A;  2V9V A;  2GAU A;  2DBB A;  3MAJ A;  2V6C A;  1B6A A;  4PDK A;  4WX9 A;  1P4W A;  5IT9 K;  5BS6 A;  3SQN A;  2YX4 A;  4E70 A;  4U0Y A;  4KN7 X;  1XDS A;  1O7F A;  5E17 F;  4GYG A;  1TBX A;  3L7W A;  4BH9 A;  4IRI A;  4BNC A;  2FNA A;  2QM3 A;  4MQ9 F;  5TRD A;  5E8I A;  1V4R A;  3RJP A;  1UCR A;  1DUX C;  3ZMU A;  3O3K A;  2LF7 A;  2G7H A;  5CYV A;  2K4J A;  1WWX A;  1XDU A;  1TQI A;  1FYM A;  3MZH A;  1YQA A;  5CVU A;  1ZGA A;  2CQK A;  4YFK F;  1O7L A;  3BDD A;  4IF4 A;  2A5Y B;  4LG0 B;  2VXZ A;  2PEX A;  3V8L A;  4Q48 A;  2IP2 A;  4O5V A;  3ABU A;  4I2O A;  3GFL A;  3IWZ A;  1O3S A;  3BP8 A;  4LK1 F;  1B4A A;  2BYV E;  4U88 A;  1FLI A;  2KKO A;  2D1V A;  4MEX F;  2EJR A;  2A07 F;  5JI6 A;  2R7F A;  2A69 F;  2DPU A;  3C1D A;  1P2F A;  3H92 A;  2XV4 S;  1ULY A;  4LLN A;  4H0E A;  2L4M A;  1R5H A;  1OMI A;  1O3R A;  4Y17 A;  4EM1 A;  3K9T A;  1T98 A;  1GXP A;  4M71 A;  3BJO A;  2QQ9 A;  4MTE A;  2FNP A;  1EH7 A;  1ON1 A;  2R3S A;  3CTA A;  1ZG5 A;  2H27 A;  2MD5 A;  2V79 A;  2IVM A;  3F8N A;  1SFE A;  2M1B A;  5KK1 A;  3ZMV A;  2XKO A;  3Q9S A;  4OMZ A;  3MFK A;  1FC3 A;  3VOD A;  3KLN A;  3TKY A;  2FOK A;  3K1P A;  4LD5 A;  1LDJ A;  2QBY B;  1TQP A;  3WTS C;  2L4A A;  2LDU A;  5ILV A;  2K27 A;  1G3W A;  5E1X A;  4BYY A;  4CXF A;  4EMS A;  4ESB A;  2NRA C;  4WF2 A;  3BPV A;  5D5V B;  4EJW A;  1B9N A;  2JSC A;  3T8R A;  1FT9 A;  2F5F A;  3QP5 A;  4BHP A;  1IN5 A;  4HQM A;  3EUH A;  4RAY A;  3M8E A;  5BMZ A;  4ZZL A;  1CF7 B;  1MZB A;  3LFK A;  1ZLJ A;  1RZ4 A;  3K0L A;  2F2E A;  2QUF A;  3VFZ A;  1K7A A;  2FBI A;  3SHF A;  3HTS B;  1KQ9 A;  1XMK A;  2CO5 A;  5JR3 A;  3ZPL A;  1FX7 A;  3LAP A;  3WE2 A;  3RIR A;  2A6E F;  2BGC A;  3HOS A;  1QBJ A;  2W57 A;  1RI7 A;  3LWF A;  5ILU A;  4BHB A;  2BEO A;  3TOA A;  4CIC A;  1HBX G;  5HDN A;  4WWC A;  2VT3 A;  1Z05 A;  2OD5 A;  5HVQ C;  2CFX A;  4UV9 A;  2ACJ A;  2VOO A;  3GZ5 A;  3CDH A;  3OV8 A;  1FY7 A;  4M6Y A;  1KGS A;  4RGX A;  3WTU C;  1HW1 A;  1ZHF A;  5D4S A;  5F6F A;  5FLX K;  1OYI A;  4UVC A;  5LEJ A;  1BI2 A;  2XRO A;  3DF8 A;  2WC2 A;  4HF2 A;  4XLN F;  4YIF A;  2GWR A;  3HRU A;  5J8F A;  2VOP A;  4M9Z A;  2ADU A;  2HS5 A;  3CUQ C;  4OOI A;  4OU0 A;  3M8F A;  1BI3 A;  2Q0O A;  1BM9 A;  5LGU A;  4WK8 F;  2F5C A;  4L0Y B;  5LLQ A;  3JW4 A;  4LB6 B;  2PI0 A;  1SD4 A;  1K79 A;  2M5W A;  3FMQ A;  1FYL A;  3NRV A;  2PG4 A;  2WV0 A;  5DUK A;  4P9U A;  2RNJ A;  4WXC A;  2YX7 A;  2EFO A;  1HW2 A;  1TTY A;  4L9N A;  4MHG A;  4KYW A;  4AIJ A;  1XN7 A;  1K6O A;  2AS5 F;  4WCG A;  2ZME B;  5F64 A;  2EB7 A;  2MLK A;  5D8L B;  1MDM B;  4D0P A;  3EQL F;  1U2W A;  1FSH A;  2HEO A;  3BPX A;  4PZJ A;  4LB5 A;  1QZY A;  3JTG A;  4S05 A;  4JQF A;  2LF8 A;  1IAW A;  1O3T A;  5F1R A;  1YS7 A;  2A6H F;  1WRJ A;  3V8K A;  3GLX A;  5CVJ A;  1BN5 A;  1XMA A;  1K78 B;  1DPU A;  4EJO A;  1MJB A;  5EEG A;  3EDP A;  4HX4 A;  1R00 A;  4LMY A;  5FFZ A;  3R0A A;  4CYD A;  4L9T A;  2JPB A;  3KZZ A;  3V7R A;  1IRG A;  2FF4 A;  5L3E A;  4G9Y A;  3O6B B;  4KIF A;  1IZ1 A;  4CHU A;  1YIO A;  1V3F A;  1WI9 A;  1FBQ A;  2RVC A;  3J80 Z;  1YW7 A;  5FD5 A;  1SAX A;  4GCV A;  1B59 A;  4R79 A;  4R1H A;  1R7J A;  3JAM Z;  2HGC A;  1J59 A;  1Z6T A;  5HLG A;  1ZLK A;  2E1C A;  2IRF G;  2O3F A;  2X4H A;  1XGN A;  5K5O A;  1QZZ A;  5DEQ A;  2NS0 A;  4I01 A;  3IHU A;  3E6D A;  2PFB A;  1REP C;  3N97 A;  3L2C A;  1S7O A;  2XAJ A;  1XSD A;  5E1W A;  4YFN F;  5A2Q Z;  2OQG A;  4EJU A;  2PQ8 A;  2HQN A;  3F23 A;  2DPD A;  3U9G A;  3KCC A;  5K1Y A;  1BI1 A;  1W5S A;  2NYX A;  3I58 A;  3WTY C;  5D5W B;  3BJ6 A;  3DFG A;  2JPC A;  5EEH A;  2K02 A;  4S04 A;  4UUV A;  4A0Z A;  1LJ9 A;  2HTS A;  3JSO A;  1VTN C;  1GVJ A;  3QP6 A;  1F5T A;  5H20 A;  2RV8 A;  1ZYR F;  3I53 A;  1ZRE A;  1XCV A;  3GYH X;  4Q5S F;  4PCQ A;  1T39 A;  5ERI A;  2RN7 A;  4O3M A;  2FQ3 A;  1TW3 A;  3KET A;  2XIG A;  3I59 B;  1L0O C;  1P4X A;  4N0B A;  2QEN A;  1F4K A;  4EV0 A;  4HW0 A;  1A04 A;  3M9A A;  1U8R A;  4OIR F;  5LHH A;  5L3C A;  3ERE D;  1I1G A;  2HFH A;  2OU2 A;  1G3Y A;  4G8X A;  3CLO A;  1Y0U A;  3QU3 A;  4FX4 A;  4A0Y A;  2STT A;  3E97 A;  1R5G A;  2DQL A;  2LSO A;  4EGY A;  1J5Y A;  2QYO A;  3QPH A;  1R36 A;  1KA8 A;  2MLG A;  2EWN A;  4U0V A;  1S7A A;  4M6X A;  1Z7U A;  1U5T A;  4XLP F;  2HYG D;  2CW0 F;  3DPL C;  3T1B A;  2M87 A;  4O6J A;  4RGR A;  4N9I A;  3BJA A;  1T6S A;  4G7H F;  1FP1 D;  5FFX A;  1XD7 A;  3ZP5 A;  4KNY A;  1HQC A;  1XSV A;  2DK5 A;  2V1U A;  2DAO A;  4A6D A;  3HHH A;  4EQQ A;  5L3B A;  1WSU A;  3Q5F A;  2XVC A;  2COM A;  3KP6 A;  3SFZ A;  4I7H A;  2EA2 A;  3V7S A;  2P8T A;  4WXH A;  3DEU A;  4L9V A;  2KRF A;  2EK5 A;  4ZH4 F;  1OKR A;  4GGG A;  1PUE E;  5CJ9 A;  2D1H A;  3BOQ A;  1SFU A;  1MJA A;  3FZV A;  1LEA A;  2XAF A;  4IVN A;  2P6S A;  5DCM A;  1KU9 A;  3F22 A;  3I5U A;  2FXA A;  3WGI A;  1H0M A;  4ZYH A;  5DYM A;  3KEQ A;  5HS8 A;  3C7J A;  5FO5 A;  3FHZ A;  3LQR A;  5LGT A;  3JSP A;  1JXS A;  3ZMS A;  5HDG A;  2YPR A;  1S3J A;  1Z9C A;  3J81 Z;  2QVO A;  4KDP A;  3WOD F;  4I0B A;  1H9T A;  1EH6 A;  2Q8K A;  3J80 K;  1OYW A;  3I54 A;  1YO5 C;  3F8C A;  3LA7 A;  5JFR A;  2EV0 A;  3ABT A;  1I1S A;  4AIK A;  3FXQ A;  3JAM K;  3GFJ A;  1U3E M;  4RB0 A;  3V8J A;  5J8C A;  1WQ2 A;  3E3V A;  4PGG A;  2UWM A;  4ON0 A;  3RPQ A;  1ONV A;  3SZT A;  5KVR A;  1BJA A;  2ELH A;  1Z1D A;  4HLX A;  5BQT A;  4U7B A;  1R1U A;  1X3U A;  4DQ2 A;  2FU4 A;  3DXJ F;  2FRH A;  4XSX F;  4IHT A;  4LJZ F;  3T0Y A;  3PQK A;  2VE9 A;  1BC8 C;  4R8H A;  1NHA A;  5A2Q K;  1ZRF A;  3ZMT A;  3V7C A;  2M45 A;  3GFI A;  3ZN0 A;  3RI4 A;  5E1Z B;  3IWF A;  4KMF A;  4BHC A;  4GXO A;  2W25 A;  4KMU X;  2YR2 A;  4RAZ A;  4L9J A;  2EA4 A;  2H6B A;  4IJA A;  4HDV A;  4A0X A;  1QGP A;  5E20 A;  3GVA A;  4ZYE A;  5ICE A;  4L5J A;  5DCF A;  2Z99 A;  2MBF A;  2L01 A;  4IPA A;  4ENM A;  1AOY A;  1SD5 A;  1UB9 A;  3IC7 A;  2HQR A;  4XRF A;  4A5M A;  4U7D A;  2CSO A;  5JHU A;  4ENJ A;  2XAH A;  3TDU C;  4OMY A;  4GYI A;  4G6D A;  4JBA A;  3RDI A;  1Z91 A;  2QQB A;  4HX7 A;  2VT2 A;  2CGP A;  1LEB A;  3HIF A;  3Q9V A;  1G4D A;  3BY6 A;  1ON2 A;  1O57 A;  4HAM A;  4U0W A;  4ESJ A;  4LFU A;  1OR7 A;  2HWV A;  3E6B A;  3C3W A;  2E7X A;  3WU0 A;  2Z5U A;  1BBY A;  5DV5 A;  4L0Z B;  4RGS A;  1LB2 A;  2HR3 A;  1TQM A;  2M30 A;  4Y13 A;  4KFC A;  1U5T C;  3HSF A;  2IA0 A;  3D0S A;  2A68 F;  3FXR A;  2GIV A;  2R7D A;  1FYK A;  3GO5 A;  3P9C A;  3CUQ B;  3EYY A;  4F7Z A;  1JE8 A;  3QU6 A;  3RKY A;  1UHM A;  4IRH A;  4LG0 A;  4HF1 A;  2DI3 A;  3HRT A;  5LEK A;  3DKW A;  4A2U A;  4IXA A;  3O2P E;  5LHG A;  5ICF A;  1Z6R A;  2P5V A;  2F5D A;  1DP7 P;  4P55 A;  3G3Z A;  3ELK A;  1T2K A;  1ZAR A;  1W7P B;  1IXC A;  2PBI A;  3RKX A;  3ROU A;  4YFX F;  2TDX A;  3CO7 C;  3F72 A;  4M9X A;  1TW2 A;  4BXU A;  1BI0 A;  4G7Z F;  3GFM A;  4ZYD A;  5ICC A;  3COA C;  2VN2 A;  2Z9O A;  3ML6 A;  3LQQ A;  2XAG A;  1I5Z A;  2QLZ A;  3ISP A;  1ODD A;  1QNT A;  4HF0 A;  3HRM A;  4Y15 A; 
#chains in the Genus database with same CATH topology
 3BG3 A;  3DP7 A;  3VB2 A;  3EPZ A;  3E6M A;  1RR7 A;  1E17 A;  2NVU B;  1R1V A;  5LBQ A;  4DBQ A;  3DBR B;  2K86 A;  2IS4 A;  3CCR I;  3FWE A;  1N78 A;  3LST A;  5HS9 A;  5FB2 A;  3ZQI A;  2G9W A;  1DDN A;  3BR3 A;  3LSR A;  4L18 B;  3PFI A;  2E7W A;  4DNC A;  5HLH A;  1F1Z A;  1JUM A;  3I64 A;  4M73 A;  3M3Y J;  1Y8R B;  2OA4 A;  2EFN A;  1USS A;  3GTK J;  5K5R A;  1Z77 A;  2DT5 A;  5C44 J;  1LDD A;  2ICW G;  1HXD A;  5JVG F;  4KIS A;  1OIS A;  3J81 K;  1ZH5 A;  5H6R A;  5IYD J;  2F5E A;  3C2H A;  4LK0 F;  2QBY A;  1T0F A;  2DA5 A;  2B7E A;  1J7K A;  1UHW A;  2FA5 A;  3EUA A;  3ABL H;  4ITV A;  3WTT C;  1OPC A;  3ZQ7 A;  5E8G A;  3J7A O;  2VPR A;  3NQO A;  2LKS A;  1NTC A;  2XHK A;  2YUS A;  3I4P A;  3JTH A;  2D45 A;  3I56 I;  1MD0 A;  1XG1 A;  3BG5 A;  3QAH A;  3K1M A;  1K4S A;  2EZI A;  4B4C A;  2R5Z A;  3KP4 A;  1IF1 A;  1XGM A;  3UKG A;  3ZQQ A;  5HLI A;  5TGT A;  1VQ4 I;  2P5K A;  1GVD A;  4QPQ A;  4ENK A;  2GBY A;  1D1B A;  3KEO A;  4MGR A;  3CD6 I;  2LKX A;  2OQR A;  2G7U A;  2OCE A;  2KLO A;  3BWG A;  5E3N A;  2GA1 A;  2MAB A;  3K7A J;  3DTK A;  3DQV C;  3FIS A;  4LOC A;  3IRQ A;  2ECC A;  4JX4 A;  1FNN A;  2KZV A;  3IKT A;  4PJJ A;  5DDG A;  1CF7 A;  1Y1W J;  1K83 J;  1BA5 A;  2FE3 A;  4KIC A;  2E1M C;  2BY0 A;  6PAX A;  2CU7 A;  2BHY A;  5KHD A;  4C9Y A;  5D5U B;  1XTA A;  3DPU A;  1FOK A;  3GX4 X;  1SMT A;  5J1R A;  1IN6 A;  2D2W A;  1B9M A;  2VJI A;  2IAI A;  3TO7 A;  5AIQ A;  1U78 A;  1HC8 A;  3QWL A;  2VE8 A;  4MFD A;  3EET A;  1AU7 A;  4I98 B;  4HLY A;  4XON A;  1G6N A;  2XPW A;  2P0W A;  2IS2 A;  2CQ7 A;  3ECH A;  1IW7 F;  3TDZ C;  3S2W A;  1YG2 A;  4FX0 A;  4G6T B;  3FM3 A;  3W6K B;  3QYB A;  3CES A;  3RYP A;  3S8P A;  1HKT A;  2R0Q C;  3T8T A;  2GXB A;  3FXJ A;  4ESF A;  4QLC U;  4XRM A;  1HW5 A;  2E1M B;  2XGC A;  2A61 A;  2R7T A;  1DQU A;  4N9H A;  3A0B C;  3BRO A;  4YG2 F;  2LYC A;  3H3U A;  2M7A A;  2F4O B;  1R23 A;  2EFW A;  4FHT A;  2HXO A;  4HDU A;  1IXR C;  3FX3 A;  2ESH A;  1GXQ A;  3U21 A;  1B8I B;  3S93 A;  1XPX A;  2QZ8 A;  3FMS A;  5D8K B;  1XGO A;  2BY1 A;  3OL4 A;  1YS6 A;  1BW5 A;  1UJ8 A;  3REO A;  3GTQ J;  4I99 C;  4LLL A;  2DLL A;  1GHC A;  4UVB A;  1SAN A;  4G94 A;  5TJJ A;  2DN0 A;  3F21 A;  4IEJ A;  2CWE A;  1RPW A;  2KZG A;  3A4C A;  2IGM A;  5E3L A;  1LNW A;  3EUK L;  2PMH A;  2IA2 A;  4PSW A;  4J19 A;  1Y1V J;  4QPO A;  2R7Q A;  4II2 A;  1IUF A;  1RKW A;  1T95 A;  2Z3Y A;  4UUS B;  3UNG C;  3E5X A;  3R60 A;  4NBQ A;  1IRF A;  5EZH A;  3H35 A;  4YIR X;  2YS9 A;  1ZTR A;  2BE5 F;  3E5Q A;  1ZG3 A;  3V42 A;  2IT0 A;  4V2F A;  3LSM A;  1KON A;  2DOA A;  1PDN C;  1J2X A;  2NNN A;  3IAM 2;  3G73 A;  3LMM A;  2FOW A;  1A35 A;  2YU9 J;  1BIB A;  2VON A;  4KT5 C;  5KAI C;  2STW A;  5DD4 A;  1LE8 B;  2HYF A;  3DPT A;  2P5L C;  1STZ A;  2CFO A;  1YFH A;  3HOY J;  2HOA A;  9ANT A;  4OIN F;  4RB3 C;  1V5F A;  2G0E A;  3BLY A;  1MNE A;  5EJC A;  5EDN A;  4RDU A;  2B0L A;  2OZ6 A;  3CMY A;  3E6C C;  3LL7 A;  2FBK A;  3M1E A;  3OIO A;  1XSX A;  3I0T A;  2WWY A;  3CCL I;  2LNB A;  4BY7 J;  4DIQ A;  3GEZ A;  1MH3 A;  1X1B A;  2MD0 A;  3D5L A;  4MQV A;  4CDG A;  4TV7 A;  1BIA A;  2N8G A;  1X2N A;  1DPR A;  2Q1Z B;  3K10 A;  2GOX B;  3KP5 A;  4XLA A;  3OY9 A;  4NQW A;  2HOE A;  1KU7 A;  1BW6 A;  1OR7 C;  3W6J B;  1RUN A;  3HSE A;  3CO6 C;  1YJN I;  4HX8 A;  4OWR B;  2VC1 A;  2F48 A;  4F92 B;  2JVH A;  1HST A;  2ZKZ A;  3TQN A;  1ZG1 A;  2X85 A;  2E2H J;  1SMY F;  1TT5 B;  4I02 A;  1JUP A;  5D4R A;  3NEU A;  1AHD P;  3BR6 A;  5CQG A;  1X3W B;  3TED A;  1FIA A;  2O61 A;  3N05 A;  4CGZ A;  3DEW A;  1LQ1 A;  2ZO4 A;  2NAZ A;  3A1Y A;  3HPG A;  1YYV A;  2GIZ A;  2AQF A;  2KIU A;  1TNS A;  2IBD A;  4IKF A;  2ZME A;  1R4N B;  1P92 A;  1QHG A;  4E4H A;  2DK8 A;  1WJA A;  1MDM A;  5D6E A;  1JHH A;  2YSR A;  3CC7 I;  1GLN A;  3LAJ A;  5EG0 A;  5DM6 F;  1CGP A;  2KHM A;  3LA2 A;  4IRG A;  1IRX A;  3SXY A;  4XK4 A;  3I3L A;  2DA2 A;  2KQR A;  4E7Z A;  4OAY A;  3PSI A;  5H6Q A;  4ZDO A;  4YEL A;  2NOJ B;  2NXN B;  3I71 A;  3CCJ I;  4XNF A;  1Q1H A;  1ZR4 A;  2IJL A;  2QQA A;  3A01 B;  2ZJ2 A;  3FXK A;  3HOT A;  1K78 A;  2AXL A;  1FZP B;  3WTX C;  1W7P A;  2ZNY A;  2RRE A;  4F52 A;  4M9S A;  4YII A;  3JCU C;  3CJQ B;  3CCE I;  4KN4 X;  3VOE A;  2ISZ A;  3KE2 A;  5L3G A;  2JK3 A;  3AAF A;  5CQE A;  3FBN B;  2JZY A;  4MLO A;  2EV6 A;  3GTL J;  2ETH A;  2VC0 A;  2K9M A;  3K4C A;  1UZC A;  3OS2 A;  1LDK B;  5B5E C;  1DU6 A;  2BV6 A;  1UFM A;  4FAS D;  3BQY A;  2M4K A;  5FKK A;  3TOB A;  3S1R J;  5D5X B;  3MQ0 A;  3HZJ A;  4N4O B;  2L7K A;  3L9F A;  4AID A;  3DKX A;  3MCZ A;  1E2X A;  2L5Q A;  4DGW B;  3BZC A;  2Z16 A;  1P6R A;  1X19 A;  4BUP A;  2W4S A;  3IRR A;  4OAZ A;  3TO9 A;  4M6V A;  4Q47 A;  3PQJ A;  2VJ4 A;  2IA1 A;  5JVT A;  4RM3 A;  2DT7 B;  2V9P A;  2Y0S N;  2RDP A;  5EEA A;  2EV5 A;  1TC3 C;  5HDK A;  1A31 A;  2OBP A;  1I39 A;  3ASO H;  3ZQH A;  1WKM A;  1U9N A;  4G12 A;  1R58 A;  2GA2 A;  2V1X A;  2XKP A;  4RB2 C;  2VPL A;  4KA4 A;  3V4G A;  2LTP A;  2MH9 A;  2ZFW A;  4PSX A;  3BTI A;  2WTE A;  3RTR A;  3PIO F;  1V55 H;  1T38 A;  1WJC A;  2QA4 I;  3I9V 2;  2V1N A;  5GP9 A;  5KNL A;  4XLE A;  2JJ7 A;  3IP4 B;  1BC7 C;  1RIO H;  2UXN A;  1QVT A;  2JTV A;  1YJ9 I;  2DA3 A;  4PK4 A;  2JQ7 A;  3HDD A;  2DA4 A;  2WA0 A;  1KU2 A;  1SFX A;  2CMP A;  3P9I A;  3LNQ A;  2CV1 A;  2K40 A;  4XRS G;  2LKP A;  2KL4 A;  1P9Q C;  1TT0 A;  2OCC H;  2IPQ X;  4WXD A;  4D1Q A;  3FXL A;  3HTU A;  1MKM A;  5E3M A;  1T0F C;  1MMD A;  2CQN A;  5CLS A;  4DYR A;  1VQ8 I;  2ZXI A;  4AD9 A;  2K9S A;  2KJB A;  4AIH A;  1F9N A;  1EKE A;  2GZW A;  4FT8 A;  3TW6 A;  1HKQ A;  5IYC J;  4C30 A;  2CRG A;  2BHZ A;  1MBK A;  4FQG A;  3OYB A;  1W1W E;  2E35 A;  3WG7 H;  3L2U A;  3VEP A;  1FWZ A;  3GF2 A;  4C3J J;  3BZK A;  3ESW B;  3M07 A;  2VBZ A;  4HZF A;  4HYE A;  4MNU A;  1R9T J;  1JKR C;  4EM2 A;  1A6I A;  1NG7 A;  2KIM A;  3QYE A;  2X48 A;  2DO7 A;  2Y0S A;  2JRT A;  5GTH C;  3IL2 A;  2ZCW A;  3C18 A;  3E0J B;  5K5Q A;  3F8F A;  1ENH A;  1EV7 A;  3OIP A;  2EZL A;  4CCL A;  3K69 A;  1SC7 A;  2PLY A;  1WGX A;  2QGU A;  2DFE A;  1RR8 C;  1ZK8 A;  4ENN A;  3OYM A;  1W4M A;  3K4N A;  3HSR A;  4M3F A;  3N4M A;  1EF4 A;  4D5F A;  1HOM A;  2IGO A;  3NAR A;  3S17 J;  1X1A A;  2CG4 A;  2X1D A;  2X51 A;  2K4B A;  3H0D A;  4KIB A;  3ZN1 A;  1F36 A;  3NWS A;  4UNO A;  3F6V A;  1JI8 A;  1E3H A;  4DZP A;  1Z3X A;  2FSW A;  2XRN A;  5EF6 A;  3BR2 A;  2Y48 A;  3H36 A;  4XM3 A;  3K4K A;  2W85 A;  1OCP A;  5FJ8 J;  2Y69 H;  1J0R A;  1PP7 U;  4G6Q A;  1RKT A;  4ZYA A;  4AWX B;  2JA8 J;  1U0J A;  3B6A A;  1KYW A;  5LHI A;  5B1B H;  3VYR B;  4BJT A;  2PJP A;  2E1N A;  3AKZ A;  4BJ6 C;  2XAS A;  2Y31 A;  2ZXW H;  3P7N A;  3M4O J;  1D5V A;  3E5U A;  3I59 A;  3F6O A;  1NG6 A;  5E18 F;  2HKO A;  2J5P A;  3OYN A;  1I3A A;  4C2T A;  1ZN2 A;  1WH5 A;  3MWM A;  4RLF A;  1S7E A;  1G3S A;  3C2B A;  1EH8 A;  3HB9 A;  1VQL I;  4XLH A;  3G4S I;  2ZXJ A;  2QWW A;  4XSZ F;  4QSH A;  3GW2 A;  4MEY F;  3WE3 A;  3FKI J;  1UG2 A;  2ZBK A;  1HKS A;  2W82 A;  4DBR A;  5IT3 A;  4CO8 A;  1TNT A;  5CPR B;  2KMU A;  3S15 J;  4MTD A;  4FTH A;  1QQI A;  1JJ8 C;  4HBL A;  4E7J A;  4HQE A;  1RUO A;  2M0C A;  3BQZ A;  2Z2S B;  4K2E A;  5BPD A;  3FXM A;  1MJ9 A;  1ETK A;  2MYS A;  2XC7 A;  1ZRC A;  4GO1 A;  2EIJ H;  3QPL A;  2LFB A;  2ID6 A;  4A12 A;  2JA2 A;  5AON A;  3HM5 A;  5H2F C;  1H9G A;  3WG9 A;  1O3Q A;  3KEY A;  5ILS A;  2M34 A;  3WGH A;  4D9J A;  3H5N A;  2MC3 A;  1MMG A;  3OL3 A;  3T5X A;  3SYT A;  4IO9 F;  5J1Y A;  1OYY A;  1YTY A;  1HF0 A;  4CZZ A;  1K61 A;  2WAD A;  2R7Z J;  3KP3 A;  3HRS A;  3RKQ A;  3PNT A;  1SFO J;  3G2B A;  3R0J A;  1RC9 A;  2W84 A;  2O9L A;  2VQG A;  3R4K A;  1D1A A;  2YU3 A;  1D3Y A;  2FUG 2;  4HOB A;  2L02 A;  5IT9 Z;  4FET A;  2EZH A;  5M5W J;  3MKZ A;  1QO0 D;  2GXA A;  2KJC A;  3GZN B;  5AIP A;  2CS3 A;  2VKE A;  3BG9 A;  1R4M B;  2Z1D A;  1S29 A;  3ZR8 X;  3RQI A;  2VQC A;  1IC8 A;  2MH2 A;  4I09 A;  2QKM B;  1KYZ A;  1S6L A;  2CUE A;  2Z33 A;  2M4G A;  1FP2 A;  3B73 A;  2LRD A;  4HST A;  1LPQ A;  5CVR A;  2XUB A;  3DWL E;  3OR2 C;  4HNT A;  1D1C A;  2ZNZ A;  4ZYG A;  3ECO A;  2VBY A;  3WTW C;  3GXO A;  2O8K A;  1WJD A;  4Z2Y A;  5DTD A;  5TIS C;  3TO6 A;  1L3L A;  1D8J A;  5CVV A;  2Y75 A;  5BOX A;  2V1D A;  1V5E A;  2JVG A;  3GUD A;  1I6X A;  4A93 J;  3OWT A;  4ZZD A;  5DUI A;  4EEF G;  3U2R A;  4LLG F;  1PUF B;  1IN7 A;  3F8M A;  1B72 B;  1U5T B;  4XL9 A;  2VBW A;  1QVU A;  1I27 A;  3AL0 B;  1TLH B;  4XBF A;  4ASN A;  5IP7 J;  3S3M A;  3QRF F;  4EGZ A;  2IGK A;  3KFW X;  4DYQ A;  5HOO A;  4B48 A;  3ERM A;  3BT9 A;  3W3C A;  4NB5 A;  4UV8 A;  4CYC A;  3JRC A;  4BY1 J;  3CDI A;  3CME I;  1BOA A;  2JWT A;  1G3T A;  1J09 A;  2DW4 A;  2HZT A;  2RC4 A;  4RGU A;  3S1M J;  4E7I A;  1MMA A;  3MMY B;  4EJV A;  2DU9 A;  5LD2 C;  5ED4 A;  2A3S A;  2FEZ A;  3F3X A;  4CH7 A;  5LRS A;  1GDT A;  3FDY A;  4IQ4 A;  4IL6 C;  5J40 A;  2JUG A;  1MGT A;  1RNL A;  2M8E A;  5L3F A;  4HEA 2;  3RPU A;  3SZP A;  2RGV A;  4UHT A;  3OS0 A;  3UR3 C;  3WTV C;  1W5T A;  1W7P D;  2CYY A;  4IHS A;  2H09 A;  3CMM A;  4P5O A;  2JA5 J;  2VBX A;  1SD7 A;  3L2R A;  2UZK A;  4BAY A;  2FBH A;  3GTM J;  3OS1 A;  1PP8 F;  3BCA A;  3L09 A;  2IW5 A;  3KP2 A;  2O03 A;  2DXI A;  4RLQ A;  4IHY A;  5F27 A;  1P4A A;  2PMU A;  2JT1 A;  4HV6 A;  3HOW J;  4OIO F;  3LA3 A;  3R61 A;  1J75 A;  1V54 H;  2KFD A;  2H94 A;  2VB6 A;  2LY1 A;  4KIT B;  3AG4 H;  3OYC A;  3HHG A;  2PN6 A;  3F8B A;  3P9K A;  1A36 A;  2JMW A;  2DTR A;  1BOB A;  2HQ5 A;  2OAZ A;  4LIT A;  1YLF A;  2Y0M A;  4XRS A;  2K7L A;  3QPS A;  1MBG A;  3HJE A;  4ETS A;  1SEU A;  4OIQ F;  4OIP F;  5CVI A;  5DCM B;  2XGX A;  1IXS B;  2GQQ A;  4Y3O A;  2Y30 A;  3EYI A;  4A3I J;  3S3O A;  1W0T A;  2HKX A;  1QPM A;  3BG7 A;  2X0L A;  3LOC A;  2E34 A;  1MBE A;  2E71 A;  2ESN A;  1KQ0 A;  4I6Z A;  5DD8 A;  4I0A A;  3FMR A;  3WGG A;  3WHB A;  4ZTJ A;  2EFQ A;  2P7V B;  1S9H A;  2V4J C;  1S8N A;  4II3 A;  2W24 A;  3VYS B;  4AVP A;  5IP6 A;  1JT6 A;  2P4W A;  2I5U A;  3HUG A;  3FXU A;  2EFP A;  1B1B A;  3ASN H;  4M74 A;  4RS8 A;  3IUO A;  2P7C B;  2Q2E A;  1FBU A;  3GZ6 A;  4B09 A;  4EVI A;  2XAQ A;  4V2G A;  4CSW A;  1TWF J;  5F04 A;  2ELJ A;  2LD5 A;  2L7M P;  2HOS A;  1FSE A;  1ZGJ A;  3LSG A;  1ZAO A;  5J6X A;  1WJ5 A;  1Y39 A;  1FBS A;  1XB4 A;  1T56 A;  3CUO A;  3PUB A;  5LRR A;  1DGR M;  4BE1 A;  5F0C A;  1TZL A;  5IOZ A;  2MSY A;  3TMO A;  2ISY A;  2XF7 A;  4CCM A;  4UB6 C;  4F55 A;  4G7O F;  2KRH A;  2OZU A;  5HS7 A;  3RKW A;  2PJR B;  2K9L A;  1R22 A;  3F0C A;  4UVA A;  3FF5 A;  1IUY A;  4UXN A;  3BR1 A;  3SEQ A;  4ABZ A;  2MA3 A;  4Q4Z F;  3K4M A;  3ZMZ A;  3DV8 A;  3GWZ A;  1U6G A;  5FGM A;  2F5V A;  4BEH B;  4A5N A;  2WAE A;  4M72 A;  4LGW A;  3FM5 A;  3K1N A;  5FD6 A;  4B44 A;  3I55 I;  4JK1 X;  2DA7 A;  1JTX A;  2GLO A;  4CCJ A;  3CF5 F;  1KQ8 A;  4HV5 A;  2E5N A;  3RYR A;  4RB1 A;  1D0Z A;  2XF5 A;  1C0W A;  3MEX A;  4A3F J;  1I6H J;  2IEK A;  1SD6 A;  2CW8 A;  4FCY A;  3R6S A;  3ULQ B;  2WY8 Q;  3K2Z A;  1J9I A;  1LVK A;  3ZMD A;  1HSJ A;  2B63 J;  3U1D A;  5FRO A;  3BZ6 A;  4AUX A;  5BPI A;  3CLQ A;  3CCY A;  4KUM A;  2DFI A;  2RKH A;  1OCZ H;  1R5I D;  4BQA A;  4QIW N;  2H6C A;  1IN4 A;  3H3Z A;  5EYR A;  1JGS A;  1I50 J;  4KIG A;  2A6T A;  5M3F J;  3OOP A;  3ZQL A;  1IN8 A;  4PFP A;  1YW8 A;  1XC5 A;  2O6G E;  2X6W A;  4EM0 B;  2P6T A;  3TGN A;  3TW7 A;  3WTZ A;  3CJN A;  3WU1 B;  2HTJ A;  3KYL A;  3SFI A;  1UST A;  5LGN A;  3GLL A;  5KAF C;  1FPQ A;  1WPK A;  2AO9 A;  4HA8 A;  4BQO A;  3KP7 A;  2E1O A;  1AWC A;  1LVA A;  2L9R A;  2FMY A;  2L3D A;  1D8K A;  2DQR A;  2L9S A;  4EJT A;  1FMV A;  5D6F A;  3OYJ A;  3HYI A;  2O8X A;  4PGH A;  3KZY A;  1YW9 A;  2JUC A;  3KLO A;  4QWQ A;  4GFB A;  2GXG A;  3PSF A;  1VFC A;  3O8H A;  2LK2 A;  2VOD A;  4L5I A;  5CKT A;  2HOT A;  3HOV J;  1QZE A;  2XF6 A;  4RBO A;  1UG0 A;  5FLX Z;  2MGQ A;  4B8X A;  4P1W A;  1XS9 A;  2FML A;  1JHF A;  3QPT A;  2NNY A;  2RNG A;  1BR1 A;  4MO7 A;  1ZRD A;  1ETX A;  3S2H J;  3CP8 A;  1DP3 A;  2LVS A;  1W5C C;  2O0Y A;  4CCK A;  2R5Y A;  2UXX A;  3H9J A;  1W36 D;  2L54 A;  3L00 A;  4FIS A;  2BBY A;  2QKL B;  1KU3 A;  3KYD B;  1XGS A;  3QOP A;  5ICG A;  2KIF A;  3RQ4 A;  2HDC A;  1XCB A;  2X9D A;  3M7G A;  4P96 A;  4LIU A;  2J5O A;  4NHJ A;  5L3D A;  1R1T A;  2DA1 A;  3IKV A;  2RQP A;  4A3B J;  2KP6 A;  4YRV A;  3FK6 A;  3CUQ A;  3D5S C;  3B02 A;  2R7S A;  2C6Y A;  3JRE A;  2VKH A;  4A6E A;  4P9F A;  2X1C A;  3MZY A;  1JKQ C;  2V9V A;  2GAU A;  2DBB A;  3MAJ A;  3CQZ J;  2V6C A;  2HVS A;  2M2E A;  1B6A A;  4PDK A;  1VQ5 I;  2A05 A;  4WX9 A;  1P4W A;  5IT9 K;  5BS6 A;  3SQN A;  2YX4 A;  4E70 A;  2MFZ A;  4U0Y A;  4KN7 X;  1XDS A;  1O7F A;  4A3L J;  2LBF A;  5E17 F;  4GYG A;  2GOM A;  3OYD A;  1HDD C;  2JA6 J;  1TBX A;  3L7W A;  4BH9 A;  4IRI A;  4BNC A;  2FNA A;  2QM3 A;  2VQH A;  4BU2 A;  3PL8 A;  5EGO B;  3PJR A;  2L9N A;  1HLV A;  2L9V A;  4PJN A;  4MQ9 F;  4PJ0 C;  1MBH A;  5TRD A;  5E8I A;  5FRN A;  4BE2 A;  4PFO A;  2CW7 A;  1V4R A;  3RJP A;  4D5C A;  1HA8 A;  1UCR A;  2DOE A;  1DUX C;  3J7A Y;  3ZMU A;  5FKO A;  3O3K A;  2V6E A;  2LF7 A;  2G7H A;  5CYV A;  4CA0 A;  2K4J A;  2I8D A;  1WWX A;  2VLA A;  1XDU A;  1TQI A;  2DYR H;  3ABM H;  1FYM A;  2KRC A;  3H5R A;  3MZH A;  1YQA A;  5CVU A;  1ZGA A;  2CQK A;  2R7U A;  4YFK F;  4C2M J;  1O7L A;  3BDD A;  4IF4 A;  2A5Y B;  4LG0 B;  2VXZ A;  1IDZ A;  2Y2Z A;  2PEX A;  4Q48 A;  3V8L A;  1YRN B;  2IP2 A;  2R7W A;  4JYK A;  4O5V A;  3ABU A;  5KCM A;  3VYU B;  4XLC A;  3GFL A;  1YX5 A;  4RAG A;  3DBH B;  3VSK A;  5GPC A;  4I2O A;  3IWZ A;  4I76 A;  1O3S A;  3FIW A;  3BP8 A;  3BG6 A;  3KPH A;  2ME0 A;  4LK1 F;  1B4A A;  3LSJ A;  2BYV E;  5GAH J;  4U88 A;  1FLI A;  2KKO A;  2D1V A;  5J47 A;  5HLT A;  4MEX F;  2EJR A;  2A07 F;  3BCB A;  5JI6 A;  2TRT A;  3W2A A;  4AM3 A;  1JGG A;  2WB1 N;  2R7F A;  3K70 D;  4M3E A;  3GCM A;  4XKV A;  4S0H B;  4UY8 I;  4DZJ A;  5C3E J;  1AKH B;  2A69 F;  1Y8Q B;  2DCE A;  3M8J A;  2DPU A;  3JRD A;  4CCO A;  3C1D A;  3SEZ A;  1P2F A;  4HSR A;  3H92 A;  3OYL A;  2COB A;  2XAU A;  1R49 A;  2XV4 S;  1ULY A;  4LLN A;  4H0E A;  2E5Z A;  2L4M A;  1R5H A;  2OF7 A;  3RPU D;  3ZCO A;  5FKN A;  1OMI A;  2XB0 X;  4E7H A;  1O3R A;  3H5A A;  4D7M A;  4X6A J;  2BW3 B;  4Y17 A;  3DCF A;  4ZC3 A;  4EM1 A;  3K9T A;  2K9N A;  3AFH A;  1T98 A;  1GXP A;  4M71 A;  4XN0 A;  3BJO A;  2ZJQ F;  1VQ7 I;  2QQ9 A;  2DMP A;  3LFU A;  4MTE A;  2FNP A;  1EH7 A;  1ON1 A;  2R3S A;  2F6C A;  3CTA A;  1ZG5 A;  1FTZ A;  4GDF A;  2H27 A;  1QPI A;  2MD5 A;  4V19 K;  5C4J J;  2ZJR F;  1TWA J;  3SJM A;  2V79 A;  2IVM A;  4M3B A;  3OYF A;  3DU5 A;  3F8N A;  1SFE A;  5IP9 J;  3HXL A;  4IHV A;  4IOA F;  4A3D J;  1OCO H;  2M1B A;  4Z6Y A;  2QQ8 A;  5KK1 A;  1ZQ3 P;  3ZMV A;  1VND A;  4Y52 J;  2XKO A;  2WB1 A;  1WCM J;  3Q9S A;  4OMZ A;  3MFK A;  2QSG X;  1FC3 A;  3VOD A;  3KLN A;  3TKY A;  2EH3 A;  2FOK A;  2XGE A;  2DMQ A;  2NVQ J;  2XDV A;  4XKB A;  3K1P A;  4LD5 A;  1T08 B;  1LDJ A;  2QBY B;  1TQP A;  2LY2 A;  4UB8 C;  4BGD A;  1ETO A;  3WTS C;  1FEX A;  1M1E B;  1YE9 A;  2L4A A;  2UV1 A;  2LDU A;  5ILV A;  3OYA A;  3RZO J;  2K27 A;  2M8G X;  1G3W A;  4E6K G;  5E1X A;  1SVL A;  1SAU A;  4BYY A;  3PM1 A;  4CXF A;  4EMS A;  4ESB A;  2NRA C;  5M5X J;  1ETW A;  4WF2 A;  2CH0 A;  3BPV A;  1FOY A;  3WU2 C;  2DMU A;  3MKL A;  5D5V B;  2R5Z B;  4EJW A;  1B9N A;  2JSC A;  5JLX A;  3T8R A;  2KPM A;  1FT9 A;  2F5F A;  3QP5 A;  3QOE A;  4BHP A;  2OTL I;  3JRG A;  1IN5 A;  3CC4 I;  4HQM A;  3EUH A;  3BR0 A;  3J7Y J;  2CJJ A;  3G1M A;  2XPV A;  4RAY A;  2HXI A;  1B8I A;  1G8X A;  3M8E A;  4M3D A;  4A69 C;  2GM4 A;  2CUF A;  1WVR A;  5BMZ A;  1FOX A;  5K7F A;  2WY7 Q;  4ZZL A;  1CF7 B;  1MZB A;  2HQA A;  3LFK A;  1ZLJ A;  1OJL A;  3DBL B;  1FTT A;  1RZ4 A;  3K0L A;  3G6E I;  1YIJ I;  2WV1 A;  2F2E A;  3NWT A;  3TL4 X;  3S2D J;  2QUF A;  3VFZ A;  1K7A A;  2FBI A;  3CCQ I;  4UUS A;  3SHF A;  3HTS B;  5J1U A;  5IYB J;  2AHQ A;  1HDP A;  1KQ9 A;  1XMK A;  3CF2 A;  1X3Z B;  2CO5 A;  1T8I A;  5JR3 A;  2NVT J;  2EIM H;  1PJR A;  2XB5 A;  3ZPL A;  5F1J A;  1FX7 A;  1WHU A;  3WE2 A;  3LAP A;  3RIR A;  2A6E F;  2BGC A;  3HOS A;  5BNG A;  2Y9Z A;  1NH3 A;  1QBJ A;  2W57 A;  1LE8 A;  3MVP A;  1RI7 A;  2FJ1 A;  3LWF A;  1AA7 A;  5ILU A;  1YI2 I;  2W7N A;  4BHB A;  2BEO A;  4NDL A;  2BVL A;  3TOA A;  4CIC A;  1HBX G;  2A5W A;  5HDN A;  4WWC A;  5M3M J;  2ZXH A;  1X1C A;  3HOX J;  2VT3 A;  5F08 A;  1MSF C;  3L2V A;  2WAF A;  3JRA A;  1Z05 A;  4A3K J;  2OD5 A;  4BDZ A;  5HVQ C;  2XSD C;  2CFX A;  4UV9 A;  2ACJ A;  2WBM A;  1TWC J;  3K4J A;  2VOO A;  3GZ5 A;  5GAD J;  3CDH A;  3F9K A;  1U8B A;  3JRF A;  2DMN A;  3KIO A;  2MG4 A;  3OV8 A;  1FY7 A;  4M6Y A;  2E36 A;  1O4X A;  1KGS A;  4RGX A;  4W1U A;  2VUM J;  3WTU C;  1HW1 A;  1ZHF A;  3G1L A;  2VKD A;  5D4S A;  5F6F A;  5JHF A;  5FLX K;  3JRH A;  1OYI A;  4RAF A;  1WFX A;  2XSJ C;  4UVC A;  1BI2 A;  5LEJ A;  2XRO A;  3LSP A;  1VQO I;  4MIM A;  3PO3 J;  4A3G J;  1TWG J;  3DF8 A;  2WC2 A;  1N77 A;  4HF2 A;  3CC2 I;  2KT0 A;  3LSH A;  4XLN F;  4YIF A;  3PIP F;  2HPM A;  2GWR A;  3HRU A;  5GTI C;  5J8F A;  4M9Z A;  2VOP A;  2CQX A;  2ADU A;  2HS5 A;  3CUQ C;  3ZQG A;  4OOI A;  4OU0 A;  3M8F A;  1BI3 A;  1XMX A;  3AG2 H;  2Q0O A;  1VQN I;  1BM9 A;  5LGU A;  4WK8 F;  2F5C A;  4Y33 A;  2OTJ I;  2VI6 A;  3PNV A;  5DS9 A;  5FLM J;  2ZME C;  4L0Y B;  1MW7 A;  2QCO A;  5EZG A;  2PX9 A;  4BXX J;  4L5E A;  3JW4 A;  5LLQ A;  3OYK A;  3A01 A;  3TP0 A;  3MKY B;  4BDY A;  1ZR2 A;  4LB6 B;  1OQY A;  4NQW B;  3A2K A;  2PI0 A;  1SD4 A;  1K79 A;  2M5W A;  3FMQ A;  1FYL A;  1LFU P;  3NRV A;  1PYV A;  4YEJ A;  4QTR A;  2PG4 A;  2WV0 A;  5DUK A;  4P9U A;  2RNJ A;  4WXC A;  5FKM A;  2YX7 A;  2EFO A;  1BR2 A;  2OV7 A;  2NS8 A;  2BOL A;  2OJE D;  2HNH A;  1HW2 A;  3GTO J;  1E3P A;  2I10 A;  1LKX A;  3D5R C;  1TTY A;  2ZSH B;  4L9N A;  4MHG A;  4KYW A;  4AIJ A;  3CCU I;  1OCC H;  1XN7 A;  4C3H J;  5B1A H;  1K6O A;  3OIQ A;  2AS5 F;  4WCG A;  4B1R A;  3HG9 A;  2ZME B;  5F64 A;  1RRJ A;  2EB7 A;  2MLK A;  5D8L B;  1E0E A;  3K4B A;  4D0P A;  1MDM B;  1JKO C;  3EQL F;  1U2W A;  5EG0 B;  3JRB A;  1FSH A;  2HEO A;  3BPX A;  4AC0 A;  4PZJ A;  4LB5 A;  3DKY A;  1GT0 C;  1GV5 A;  1QZY A;  1JTY A;  3A02 A;  4PUS A;  3JTG A;  3VWB A;  4S05 A;  2M9H A;  4JQF A;  2LF8 A;  3O8G A;  3X2Q H;  1IAW A;  1O3T A;  5F1R A;  1YS7 A;  2A6H F;  1IDY A;  1WRJ A;  3V8K A;  3GLX A;  5CVJ A;  2QSH X;  1BN5 A;  1XMA A;  1K78 B;  3I4N J;  3CP2 A;  1Z3Y A;  1DPU A;  4EJO A;  2V7F A;  1MJB A;  3C2G A;  5EEG A;  3EDP A;  4HX4 A;  3HL2 A;  3I4M J;  3CJT B;  1R00 A;  2E2I J;  2EIK H;  2V9K A;  4LMY A;  5FFZ A;  1SVO A;  5GAE J;  3R0A A;  3MKW B;  4CYD A;  4L9T A;  1MMS A;  3S14 J;  3CCM I;  2JPB A;  3KZZ A;  4UUT A;  3V7R A;  1IRG A;  2FF4 A;  5L3E A;  4G9Y A;  2VL8 A;  3O6B B;  4BKX A;  4BAC A;  4KIF A;  1UMQ A;  3VDX A;  3VPR A;  2HYJ A;  5F0F A;  1IZ1 A;  1I3Q J;  1KZH A;  2B9S A;  1FIP A;  1X2M A;  4HG2 A;  5K7H A;  3HGY A;  1IV6 A;  3ABK H;  2VAS A;  1S72 I;  4CHU A;  3S1Q J;  2LG4 A;  4E7S A;  1YIO A;  1N25 A;  1V3F A;  2DTZ A;  1WI9 A;  1Z0X A;  2DJN A;  1A5J A;  1FBQ A;  2RVC A;  3J80 Z;  3H3V K;  1YW7 A;  3Q3S A;  5FD5 A;  4BXF A;  4C3I J;  3WHC A;  1QHH D;  4NNJ A;  1SAX A;  4GCV A;  1R6R A;  2JRM A;  1B59 A;  3L2Q A;  1MBF A;  2VJ5 A;  4R79 A;  4R1H A;  2W00 A;  1R7J A;  1ETQ A;  1UAA A;  2X6X A;  2LLK A;  3H0G J;  5IY5 H;  1APL C;  3JAM Z;  3IAS 2;  3J7Z I;  2HGC A;  2EIL H;  2XPU A;  2HPI A;  3BTL A;  1V5G A;  4MFE A;  1J59 A;  2L7F P;  1Z6T A;  5HLG A;  1ZLK A;  2HDD A;  2E1C A;  2IRF G;  1D0X A;  4DJA A;  5M5Y J;  4XID A;  3PNY A;  2O3F A;  2X4H A;  4BE0 A;  5J3L A;  2X1E A;  1XGN A;  2LOO A;  2ECB A;  5K5O A;  1QZZ A;  2TCT A;  5DEQ A;  4CZC A;  2NS0 A;  3W2V A;  3OYG A;  4KJZ A;  4I01 A;  3IHU A;  2DT6 A;  3E6D A;  1Q1V A;  1YHQ I;  3VYT B;  2PFB A;  4CUG A;  2W48 A;  1REP C;  1W0U A;  2HZD A;  2EPF A;  3N97 A;  1MMN A;  3L2C A;  1S7O A;  4AVZ A;  3P5J A;  2XAJ A;  1XSD A;  3E7L A;  5E1W A;  2PMZ N;  4XN3 A;  2HVQ A;  3OMY A;  4YFN F;  4NC8 A;  4GRI A;  4J01 A;  5A2Q Z;  1H88 C;  1ACI A;  2QF7 A;  2JN6 A;  1Y0N A;  2OQG A;  4BS9 A;  4EJU A;  2PQ8 A;  2HQN A;  4XOP A;  5E79 C;  3F23 A;  2BY2 A;  2VQL A;  1ZKG A;  3EUH C;  2DPD A;  3U9G A;  1Z7L A;  2BY3 A;  4ANJ A;  1XX5 A;  3KCC A;  2R7V A;  5K1Y A;  1BI1 A;  2OPT A;  2XRL A;  1W5S A;  3CMA I;  2NYX A;  3PFY A;  3I58 A;  1QU3 A;  1Y6I A;  4ZDL A;  3RSN A;  3WTY C;  2LRE A;  2DMT A;  5D5W B;  3BJ6 A;  3IV5 A;  2P81 A;  3DFG A;  4N4N B;  2JPC A;  5EEH A;  2K02 A;  5J4Y A;  2E60 A;  4RA2 A;  4S04 A;  4UUV A;  4A0Z A;  1LJ9 A;  2NVX J;  3QYF A;  2RQQ A;  3M1C A;  2HTS A;  3JSO A;  1VTN C;  1GVJ A;  3QP6 A;  1F5T A;  3VSL A;  2FD5 A;  4XQF A;  1VQP I;  2BXZ A;  4A3C J;  5H20 A;  2RV8 A;  1ZYR F;  3I53 A;  1VF9 A;  1OCR H;  3FKJ A;  1ZRE A;  1XCV A;  3GYH X;  2BZT A;  4Q5S F;  4PCQ A;  3CJR B;  1T39 A;  5ERI A;  3L1P A;  5E3O A;  2RN7 A;  1T33 A;  4O3M A;  1NK3 P;  3H9Q A;  2FQ3 A;  1W36 C;  4E7L A;  4H4K C;  4IZZ A;  1TW3 A;  2PMZ A;  3KET A;  2XIG A;  3I59 B;  1PVE A;  2AQE A;  1QA6 A;  2OUM A;  2M7B A;  3DTI A;  3GME A;  4FE7 A;  1L0O C;  1P4X A;  2NOG A;  4N0B A;  2QEN A;  2CUJ A;  1F4K A;  3ZOB A;  4EV0 A;  1ETV A;  4HW0 A;  1A04 A;  5LFA A;  2QEX I;  2DOF A;  1JKP C;  3M9A A;  2EQR A;  3TBI A;  3H9G A;  1U8R A;  2K9Q A;  1SFK A;  5B3S H;  3HGG A;  4KT6 A;  5FKL A;  4F91 B;  4OIR F;  3W6V A;  1TL8 A;  4AU7 A;  4HNV A;  5LHH A;  5L3C A;  3ERE D;  3E1S A;  1I1G A;  2HFH A;  2OU2 A;  2V26 A;  1G3Y A;  4G8X A;  4DOZ A;  1FJL A;  2R7O A;  4XMY A;  3RZD J;  3CLO A;  1Y0U A;  3QU3 A;  3BR5 A;  4XKW A;  4FX4 A;  4A0Y A;  2STT A;  4A3M J;  3E97 A;  1R5G A;  4X0G A;  2O5R A;  4Y7N J;  1MBJ A;  1MNM C;  2DQL A;  1VQM I;  2LSO A;  4EGY A;  1X1P A;  1J5Y A;  3G1O A;  4E7K A;  2QYO A;  3QPH A;  1R36 A;  4U87 A;  1YIT I;  1KA8 A;  2VKV A;  4X1E A;  2MLG A;  4HRI A;  2EWN A;  1IGN A;  4U0V A;  1S7A A;  3FXO A;  3OYH A;  4M6X A;  1R71 A;  3DU6 A;  1VQ6 I;  1YOV B;  2LY9 A;  1OLT A;  2W1O A;  4NUB A;  1PUF A;  1Z7U A;  1B72 A;  1U5T A;  4XLP F;  3ONQ A;  2AXT C;  2HYG D;  2CW0 F;  2K85 A;  3DPL C;  2DYS H;  3T1B A;  3MN2 A;  2M87 A;  1VI0 A;  1WH7 A;  2H8R A;  4O6J A;  1H8A C;  4RGR A;  4N9I A;  2R93 J;  3BJA A;  1T6S A;  4G7H F;  1FP1 D;  5FFX A;  2ZSI B;  2IXS A;  3AG3 H;  1G2H A;  1XD7 A;  1E3O C;  2QSF X;  3ZP5 A;  2EZK A;  5GAG J;  1P7I A;  4KNY A;  1HQC A;  1XSV A;  1LFB A;  2DK5 A;  2V1U A;  1UHS A;  2DAO A;  2NVY J;  2O7O A;  5FLV A;  4A6D A;  4AYB N;  3HHH A;  4EQQ A;  3K70 C;  1JT0 A;  4JX5 A;  5L3B A;  2LMD A;  1WSU A;  2MC4 A;  3ZQC A;  3Q5F A;  4XOR A;  1QRY A;  4BBR J;  2XVC A;  3OR1 C;  2COM A;  3KP6 A;  4LG3 A;  1BR4 A;  1EA3 A;  3SFZ A;  4I7H A;  3HKZ N;  2EA2 A;  1ETY A;  2FX0 A;  1POG A;  3V7S A;  2P8T A;  4WXH A;  3DEU A;  4L9V A;  2ZJP F;  1EJ9 A;  2KRF A;  3CCS I;  2EK5 A;  4ZH4 F;  1OKR A;  4HPQ A;  4GGG A;  1PUE E;  4JOM A;  5CJ9 A;  3S16 J;  1YJW I;  4F93 B;  2D1H A;  3BOQ A;  1SFU A;  1MJA A;  2LR8 A;  3FZV A;  4CYC B;  1LEA A;  2JSP A;  3OOU A;  2XAF A;  1IG7 A;  4IVN A;  1Y56 A;  2P6S A;  5DCM A;  1KU9 A;  1OFC X;  3F22 A;  3I5U A;  2LC2 A;  3CZ6 A;  4ZJZ A;  1H89 C;  2FXA A;  1WJF A;  3TP3 A;  3WGI A;  1FMW A;  1H0M A;  1JJ6 C;  4ZYH A;  1G59 A;  5DYM A;  3KEQ A;  5HS8 A;  3G71 I;  1IJW C;  3PUF A;  3JR9 A;  1VQK I;  1N75 A;  2K3F A;  3C7J A;  5FO5 A;  3FHZ A;  3LQR A;  1DU0 A;  5LGT A;  3JSP A;  4A3E J;  1JXS A;  2DOD A;  3A03 A;  3ZMS A;  2MW8 A;  5HDG A;  3S3N A;  2YPR A;  4B43 A;  2F4M B;  4AYB A;  1S3J A;  2H1L A;  1Z9C A;  3J81 Z;  3AG1 H;  2QVO A;  2BXY A;  4KDP A;  2IS1 A;  3WOD F;  3Q0V A;  4I0B A;  1H9T A;  1EH6 A;  2DFF A;  2Q8K A;  3J80 K;  3DLA A;  2BVM A;  1OYW A;  3HKZ A;  3GTJ J;  2DDB A;  4DW6 A;  3I54 A;  1IV8 A;  1YO5 C;  3F8C A;  1Z67 A;  3LA7 A;  4BJ5 C;  2EV0 A;  2VIX A;  3NAU A;  5JFR A;  3ABT A;  1I1S A;  2R92 J;  4AIK A;  2PJR A;  3FXQ A;  1ITY A;  3QQA A;  1MIJ A;  4BQQ A;  3GFJ A;  3JAM K;  4XR6 A;  2HI3 A;  1X4O A;  1U3E M;  2E2J J;  2CV2 A;  4RB0 A;  3V8J A;  5J8C A;  4ZTF A;  5HNF A;  5FRM A;  1WQ2 A;  2KIQ A;  3E3V A;  3SZG A;  3CCV I;  4IHX A;  4Y4R A;  5IPA A;  4BEH A;  4JP0 A;  4PGG A;  3RCO A;  2UWM A;  1WJB A;  5DM7 F;  4ON0 A;  1LFP A;  3ZQF A;  3JRI A;  2R7R A;  1K4T A;  1JUS A;  3RPQ A;  3W2W A;  1ONV A;  3SZT A;  5K7Z A;  3GTG J;  2IS6 A;  3OSF A;  5KVR A;  2VXD A;  1BJA A;  2ELH A;  3HBL A;  1Z1D A;  3HUG B;  4HLX A;  5BQT A;  4U7B A;  1R1U A;  1X3U A;  4DQ2 A;  2FU4 A;  3DXJ F;  2FRH A;  4XSX F;  4IHT A;  2Q2E B;  2IGN A;  2DA6 A;  1CQT A;  3QOD A;  4IHW A;  3S32 A;  1YX3 A;  4A3J J;  3OYE A;  4LJZ F;  3T0Y A;  3FK7 A;  3HPH A;  3LSK A;  3PQK A;  3KX2 A;  5HNH A;  2VE9 A;  1BC8 C;  4R8H A;  1NHA A;  5A2Q K;  2DFH A;  3SDB A;  3K6G A;  1BJZ A;  2OC6 A;  1ZRF A;  3ZMT A;  3V7C A;  2M45 A;  3GFI A;  3ZN0 A;  2NS7 A;  4IX7 A;  3RI4 A;  2LP0 A;  5E1Z B;  5HOD A;  2M3A A;  1IO2 A;  4J00 A;  3IWF A;  4KMF A;  1A6Q A;  2RAE A;  4XOT A;  3IH2 A;  4BHC A;  3DTE A;  4GXO A;  2W25 A;  1Z21 A;  4KMU X;  2KDZ A;  1TWH J;  2YR2 A;  2R4G A;  4RAZ A;  3Q0W A;  2CUZ A;  3K4L A;  4CCN A;  4L9J A;  5IOY A;  2EA4 A;  2H6B A;  3ZGK A;  4B47 A;  4IJA A;  4HDV A;  4NC6 A;  4A0X A;  1QGP A;  3KZI C;  4C2U A;  1ERD A;  1FOW A;  5E20 A;  2E19 A;  3GVA A;  4ZYE A;  1GUU A;  5ICE A;  1WI3 A;  3KYC B;  4L5J A;  2ID3 A;  4XIC A;  5DCF A;  2Z99 A;  3IH3 A;  2MBF A;  2L01 A;  4IPA A;  4ENM A;  3GTP J;  2CQQ A;  1AOY A;  1SD5 A;  3Q0U A;  3ZRG A;  3BTC A;  4PJL A;  1BL0 A;  1UB9 A;  3IC7 A;  4XKC A;  2ZFU A;  2HQR A;  3FBI B;  4XRF A;  1DGW Y;  4A5M A;  4JX6 A;  1X58 A;  4U7D A;  1UEL B;  2CSO A;  5JHU A;  4ENJ A;  2XAH A;  3TDU C;  4OMY A;  4GYI A;  1IRZ A;  1SVM A;  4G6D A;  4JBA A;  3RDI A;  1P7J A;  1Z91 A;  2QQB A;  2LH9 A;  4HX7 A;  3MZ8 A;  2VT2 A;  2CGP A;  3B6C A;  2ELK A;  3U1K A;  1LEB A;  2ZB9 A;  3HIF A;  2R7X A;  4BQN A;  3HC7 A;  1RET A;  3DLL F;  3Q9V A;  2L0K A;  2KIS A;  1S5L C;  1G4D A;  2JA7 J;  3OSG A;  3BC8 A;  3BY6 A;  3GBG A;  3HEF A;  3IH4 A;  1ON2 A;  3FHN A;  1O57 A;  3LSI A;  4D7N A;  4HNU A;  4HAM A;  4U0W A;  4ESJ A;  4LFU A;  3PO2 J;  1OR7 A;  4ZDP A;  4FE4 A;  4NC7 A;  2D5V A;  2HWV A;  2H1K A;  3E6B A;  2UUZ A;  1D5Y A;  3BTJ A;  3C3W A;  2E7X A;  1ZGW A;  3WU0 A;  2Z5U A;  1BBY A;  2Y9Y A;  5EGO A;  2WAQ N;  5DV5 A;  4L0Z B;  1X1D A;  2EBI A;  1X4P A;  4RGS A;  1LB2 A;  2R5Y B;  2HR3 A;  1LUJ B;  1TQM A;  2M30 A;  1ZEL A;  2L7Z A;  4Y13 A;  2H8W A;  4KFC A;  4RM2 A;  3K2A A;  3A0H C;  1U5T C;  3SDG A;  2VJJ A;  3HSF A;  3AL0 C;  2IA0 A;  3D0S A;  3ZXS A;  4B3X A;  1D0Y A;  2A68 F;  5C4X J;  3FXR A;  4F3Q A;  1RES A;  2GIV A;  2R7D A;  2FQ4 A;  1FYK A;  3GO5 A;  5F0H A;  3L2W A;  3P9C A;  3CUQ B;  2HU9 A;  1K6Y A;  3EYY A;  4RMN A;  4F7Z A;  1JE8 A;  3QU6 A;  3RKY A;  4BBS J;  1F43 A;  1TP4 A;  1UHM A;  4EAT A;  4IRH A;  3H1C A;  4LG0 A;  4XLF A;  5B66 C;  1WZ2 A;  4HF1 A;  2DI3 A;  1ORK A;  3HRT A;  3DKW A;  5LEK A;  1YRN A;  2F4I A;  5GPA A;  3DEE A;  2K3P A;  2LBF B;  4A2U A;  2DDA A;  5J4V A;  3HOZ J;  2L2O A;  2KDO A;  5JLW A;  2M0M A;  4IXA A;  3O2P E;  4BL0 B;  5LHG A;  5ICF A;  1WJE A;  1Z6R A;  1VQ9 I;  1MSE C;  2ME6 A;  3HOU J;  4IOC F;  2EIN H;  1U9O A;  2P5V A;  2F5D A;  2X6Y A;  2HVR A;  1DP7 P;  2CV0 A;  4P55 A;  2HDW A;  2WAQ A;  3G3Z A;  1AKH A;  3ELK A;  1T2K A;  1ZAR A;  1VZ0 A;  4W97 A;  2ZC2 A;  1HCR A;  1W7P B;  1IXC A;  3S1N J;  2PBI A;  1MND A;  3RKX A;  3ROU A;  4YFX F;  1NK2 P;  2TDX A;  1MH4 A;  4PJM A;  2DJI A;  3F72 A;  4M9X A;  3CO7 C;  1OCT C;  1TW2 A;  4BXU A;  1BI0 A;  4G7Z F;  2XGD A;  3GFM A;  4ZYD A;  5ICC A;  3COA C;  3CDL A;  2VN2 A;  4M3G A;  2Z9O A;  3ML6 A;  2X6O A;  3LQQ A;  2XAG A;  4LIV A;  1I5Z A;  2QLZ A;  3ISP A;  3D1N I;  2BW3 A;  1ODD A;  1GV2 A;  1QNT A;  2K5C A;  4DYC A;  4B3A A;  4HF0 A;  3OYI A;  3MD2 A;  3HRM A;  4IQJ A;  4Y15 A; 
#chains in the Genus database with same CATH homology
 3DP7 A;  3VB2 A;  3E6M A;  1E17 A;  1R1V A;  5LBQ A;  2K86 A;  3FWE A;  3LST A;  5HS9 A;  5FB2 A;  1DDN A;  2G9W A;  4L18 B;  3PFI A;  2E7W A;  4DNC A;  5HLH A;  1F1Z A;  3I64 A;  4M73 A;  2OA4 A;  2EFN A;  1USS A;  5K5R A;  2DT5 A;  1LDD A;  1HXD A;  3J81 K;  1ZH5 A;  5H6R A;  2F5E A;  4LK0 F;  2QBY A;  1T0F A;  1J7K A;  1UHW A;  2FA5 A;  3WTT C;  1OPC A;  3ZQ7 A;  5E8G A;  3J7A O;  3NQO A;  2XHK A;  3JTH A;  3I4P A;  2D45 A;  1MD0 A;  3QAH A;  3K1M A;  3KP4 A;  1IF1 A;  1XGM A;  5HLI A;  2P5K A;  4ENK A;  3KEO A;  4MGR A;  2OQR A;  2G7U A;  3BWG A;  2GA1 A;  3DQV C;  3IRQ A;  1FNN A;  3IKT A;  5DDG A;  1CF7 A;  2FE3 A;  4KIC A;  6PAX A;  5D5U B;  1FOK A;  3GX4 X;  1SMT A;  1IN6 A;  2D2W A;  1B9M A;  3TO7 A;  5AIQ A;  1U78 A;  2VE8 A;  3EET A;  4I98 B;  4HLY A;  1G6N A;  3ECH A;  1IW7 F;  3TDZ C;  3S2W A;  1YG2 A;  4FX0 A;  3FM3 A;  3W6K B;  3RYP A;  1HKT A;  3T8T A;  2GXB A;  4ESF A;  4QLC U;  1HW5 A;  2A61 A;  4N9H A;  3BRO A;  4YG2 F;  3H3U A;  2EFW A;  1R23 A;  4FHT A;  4HDU A;  1IXR C;  3FX3 A;  2ESH A;  1GXQ A;  2QZ8 A;  3FMS A;  5D8K B;  1XGO A;  1YS6 A;  3REO A;  4LLL A;  2DLL A;  1GHC A;  4UVB A;  5TJJ A;  4G94 A;  3F21 A;  2CWE A;  1LNW A;  2PMH A;  2IA2 A;  2Z3Y A;  3E5X A;  3R60 A;  1IRF A;  2BE5 F;  3E5Q A;  1ZG3 A;  2IT0 A;  1PDN C;  1J2X A;  2NNN A;  3G73 A;  1BIB A;  2VON A;  4KT5 C;  2STW A;  5DD4 A;  2HYF A;  3DPT A;  2P5L C;  1STZ A;  1YFH A;  4OIN F;  4RB3 C;  2B0L A;  2OZ6 A;  3E6C C;  2FBK A;  3M1E A;  1XSX A;  3I0T A;  2WWY A;  2LNB A;  3GEZ A;  4MQV A;  3D5L A;  4CDG A;  4TV7 A;  1BIA A;  1DPR A;  3KP5 A;  4NQW A;  2HOE A;  1KU7 A;  3W6J B;  1RUN A;  3HSE A;  3CO6 C;  4HX8 A;  2VC1 A;  1HST A;  2ZKZ A;  3TQN A;  1ZG1 A;  1SMY F;  4I02 A;  5D4R A;  3NEU A;  2O61 A;  4CGZ A;  1LQ1 A;  2ZO4 A;  2NAZ A;  1YYV A;  2KIU A;  1TNS A;  2ZME A;  1P92 A;  2DK8 A;  1MDM A;  5D6E A;  1JHH A;  2YSR A;  3LAJ A;  1CGP A;  3LA2 A;  4IRG A;  3SXY A;  5H6Q A;  3I71 A;  1Q1H A;  2IJL A;  2QQA A;  2ZJ2 A;  3HOT A;  1K78 A;  2AXL A;  1FZP B;  3WTX C;  1W7P A;  2ZNY A;  4M9S A;  4YII A;  4KN4 X;  3VOE A;  2ISZ A;  3KE2 A;  5L3G A;  3AAF A;  2JZY A;  2EV6 A;  2ETH A;  2VC0 A;  1LDK B;  2BV6 A;  1UFM A;  3TOB A;  5D5X B;  3MQ0 A;  3L9F A;  3MCZ A;  1E2X A;  1P6R A;  3IRR A;  3TO9 A;  4Q47 A;  3PQJ A;  2IA1 A;  5JVT A;  2RDP A;  2EV5 A;  5HDK A;  2OBP A;  1WKM A;  1R58 A;  2GA2 A;  2V1X A;  2XKP A;  4RB2 C;  4KA4 A;  3V4G A;  2MH9 A;  2ZFW A;  2WTE A;  3RTR A;  1T38 A;  1BC7 C;  1RIO H;  2UXN A;  2JTV A;  1KU2 A;  1SFX A;  3P9I A;  2LKP A;  4WXD A;  2IPQ X;  3HTU A;  1MKM A;  5CLS A;  4AD9 A;  2KJB A;  4AIH A;  1F9N A;  2GZW A;  4FT8 A;  1HKQ A;  3VEP A;  1FWZ A;  3GF2 A;  4HYE A;  2VBZ A;  4HZF A;  4MNU A;  4EM2 A;  2KIM A;  2DO7 A;  2JRT A;  3IL2 A;  2ZCW A;  3C18 A;  5K5Q A;  3F8F A;  1EV7 A;  3K69 A;  2PLY A;  4ENN A;  1W4M A;  3HSR A;  3N4M A;  2CG4 A;  2K4B A;  4KIB A;  3ZN1 A;  4UNO A;  3F6V A;  2FSW A;  2XRN A;  2Y48 A;  2W85 A;  1J0R A;  1PP7 U;  4G6Q A;  4AWX B;  1KYW A;  5LHI A;  2PJP A;  2E1N A;  2XAS A;  3P7N A;  1D5V A;  3E5U A;  3I59 A;  3F6O A;  5E18 F;  2HKO A;  2J5P A;  1ZN2 A;  3MWM A;  1G3S A;  1EH8 A;  2ZXJ A;  2QWW A;  4XSZ F;  3GW2 A;  4MEY F;  3WE3 A;  2ZBK A;  1HKS A;  5IT3 A;  4CO8 A;  1TNT A;  4MTD A;  1QQI A;  4HBL A;  4HQE A;  1RUO A;  4K2E A;  5BPD A;  1MJ9 A;  1ZRC A;  4GO1 A;  4A12 A;  5AON A;  1H9G A;  3WG9 A;  1O3Q A;  5ILS A;  3WGH A;  2MC3 A;  3T5X A;  1OYY A;  1YTY A;  4CZZ A;  3KP3 A;  3HRS A;  3R0J A;  2W84 A;  3R4K A;  2YU3 A;  1D3Y A;  4HOB A;  2L02 A;  5IT9 Z;  1QO0 D;  2KJC A;  5AIP A;  1S29 A;  2MH2 A;  4I09 A;  1KYZ A;  1S6L A;  2Z33 A;  1FP2 A;  3B73 A;  5CVR A;  2XUB A;  2ZNZ A;  4ZYG A;  3ECO A;  2VBY A;  3WTW C;  3GXO A;  4Z2Y A;  3TO6 A;  1L3L A;  1D8J A;  5CVV A;  2Y75 A;  5BOX A;  2V1D A;  3GUD A;  1I6X A;  4ZZD A;  5DUI A;  3U2R A;  4LLG F;  1IN7 A;  3F8M A;  1U5T B;  2VBW A;  1I27 A;  1TLH B;  4XBF A;  4ASN A;  3QRF F;  4EGZ A;  3KFW X;  5HOO A;  4NB5 A;  4UV8 A;  1BOA A;  1G3T A;  2HZT A;  2DW4 A;  2RC4 A;  4RGU A;  4EJV A;  2DU9 A;  5ED4 A;  2A3S A;  2FEZ A;  3F3X A;  5LRS A;  1MGT A;  1RNL A;  2M8E A;  5L3F A;  3RPU A;  3SZP A;  2RGV A;  4UHT A;  3WTV C;  1W5T A;  1W7P D;  2CYY A;  4IHS A;  2H09 A;  4P5O A;  2VBX A;  1SD7 A;  2UZK A;  4BAY A;  2FBH A;  1PP8 F;  3L09 A;  2IW5 A;  3KP2 A;  2O03 A;  1P4A A;  2PMU A;  2JT1 A;  4HV6 A;  4OIO F;  3LA3 A;  3R61 A;  1J75 A;  2H94 A;  3HHG A;  2PN6 A;  3F8B A;  3P9K A;  2DTR A;  2OAZ A;  1YLF A;  2Y0M A;  2K7L A;  4ETS A;  4OIP F;  4OIQ F;  5CVI A;  5DCM B;  2XGX A;  1IXS B;  2GQQ A;  3EYI A;  2HKX A;  1QPM A;  2X0L A;  2ESN A;  1KQ0 A;  5DD8 A;  4I0A A;  3FMR A;  3WGG A;  2EFQ A;  2P7V B;  1S8N A;  4AVP A;  2W24 A;  2P4W A;  3HUG A;  3FXU A;  2EFP A;  1B1B A;  4M74 A;  4RS8 A;  2P7C B;  2Q2E A;  1FBU A;  3GZ6 A;  4B09 A;  4EVI A;  2XAQ A;  1FSE A;  1ZGJ A;  1ZAO A;  5J6X A;  1FBS A;  1XB4 A;  3CUO A;  5LRR A;  2ISY A;  4G7O F;  2OZU A;  3RKW A;  5HS7 A;  1R22 A;  4UVA A;  3FF5 A;  1IUY A;  4UXN A;  2MA3 A;  4Q4Z F;  3ZMZ A;  3DV8 A;  3GWZ A;  1U6G A;  5FGM A;  4A5N A;  4M72 A;  4LGW A;  3FM5 A;  3K1N A;  5FD6 A;  4JK1 X;  1KQ8 A;  4HV5 A;  3RYR A;  4RB1 A;  1C0W A;  3MEX A;  1SD6 A;  3R6S A;  3ULQ B;  3K2Z A;  1J9I A;  3ZMD A;  1HSJ A;  3U1D A;  3BZ6 A;  5BPI A;  4KUM A;  2DFI A;  2RKH A;  4BQA A;  2H6C A;  1IN4 A;  3H3Z A;  1JGS A;  4KIG A;  3OOP A;  1IN8 A;  1YW8 A;  2O6G E;  4EM0 B;  2P6T A;  3TGN A;  3WTZ A;  3CJN A;  3WU1 B;  2HTJ A;  1UST A;  5LGN A;  1FPQ A;  4HA8 A;  3KP7 A;  1AWC A;  1LVA A;  2FMY A;  2L3D A;  1D8K A;  2DQR A;  4EJT A;  5D6F A;  3HYI A;  2O8X A;  4PGH A;  3KZY A;  1YW9 A;  3KLO A;  4QWQ A;  2GXG A;  2VOD A;  4L5I A;  5FLX Z;  4B8X A;  2FML A;  1JHF A;  3QPT A;  2NNY A;  1ZRD A;  2O0Y A;  2UXX A;  2L54 A;  3L00 A;  2BBY A;  1KU3 A;  1XGS A;  3QOP A;  5ICG A;  2KIF A;  2HDC A;  1XCB A;  3M7G A;  4P96 A;  2J5O A;  4NHJ A;  5L3D A;  1R1T A;  3IKV A;  2RQP A;  3CUQ A;  3B02 A;  2C6Y A;  4A6E A;  4P9F A;  3MZY A;  2V9V A;  2GAU A;  2DBB A;  3MAJ A;  2V6C A;  1B6A A;  4PDK A;  4WX9 A;  1P4W A;  5IT9 K;  5BS6 A;  3SQN A;  2YX4 A;  4E70 A;  4U0Y A;  4KN7 X;  1XDS A;  1O7F A;  5E17 F;  4GYG A;  1TBX A;  3L7W A;  4BH9 A;  4IRI A;  4BNC A;  2FNA A;  2QM3 A;  4MQ9 F;  5TRD A;  5E8I A;  1V4R A;  3RJP A;  1UCR A;  1DUX C;  3ZMU A;  3O3K A;  2LF7 A;  2G7H A;  5CYV A;  2K4J A;  1WWX A;  1XDU A;  1TQI A;  1FYM A;  3MZH A;  1YQA A;  5CVU A;  1ZGA A;  2CQK A;  4YFK F;  1O7L A;  3BDD A;  4IF4 A;  2A5Y B;  4LG0 B;  2VXZ A;  2PEX A;  3V8L A;  4Q48 A;  2IP2 A;  4O5V A;  3ABU A;  4I2O A;  3GFL A;  3IWZ A;  1O3S A;  3BP8 A;  4LK1 F;  1B4A A;  2BYV E;  4U88 A;  1FLI A;  2KKO A;  2D1V A;  4MEX F;  2EJR A;  2A07 F;  5JI6 A;  2R7F A;  2A69 F;  2DPU A;  3C1D A;  1P2F A;  3H92 A;  2XV4 S;  1ULY A;  4LLN A;  4H0E A;  2L4M A;  1R5H A;  1OMI A;  1O3R A;  4Y17 A;  4EM1 A;  3K9T A;  1T98 A;  1GXP A;  4M71 A;  3BJO A;  2QQ9 A;  4MTE A;  2FNP A;  1EH7 A;  1ON1 A;  2R3S A;  3CTA A;  1ZG5 A;  2H27 A;  2MD5 A;  2V79 A;  2IVM A;  3F8N A;  1SFE A;  2M1B A;  5KK1 A;  3ZMV A;  2XKO A;  3Q9S A;  4OMZ A;  3MFK A;  1FC3 A;  3VOD A;  3KLN A;  3TKY A;  2FOK A;  3K1P A;  4LD5 A;  1LDJ A;  2QBY B;  1TQP A;  3WTS C;  2L4A A;  2LDU A;  5ILV A;  2K27 A;  1G3W A;  5E1X A;  4BYY A;  4CXF A;  4EMS A;  4ESB A;  2NRA C;  4WF2 A;  3BPV A;  5D5V B;  4EJW A;  1B9N A;  2JSC A;  3T8R A;  1FT9 A;  2F5F A;  3QP5 A;  4BHP A;  1IN5 A;  4HQM A;  3EUH A;  4RAY A;  3M8E A;  5BMZ A;  4ZZL A;  1CF7 B;  1MZB A;  3LFK A;  1ZLJ A;  1RZ4 A;  3K0L A;  2F2E A;  2QUF A;  3VFZ A;  1K7A A;  2FBI A;  3SHF A;  3HTS B;  1KQ9 A;  1XMK A;  2CO5 A;  5JR3 A;  3ZPL A;  1FX7 A;  3LAP A;  3WE2 A;  3RIR A;  2A6E F;  2BGC A;  3HOS A;  1QBJ A;  2W57 A;  1RI7 A;  3LWF A;  5ILU A;  4BHB A;  2BEO A;  3TOA A;  4CIC A;  1HBX G;  5HDN A;  4WWC A;  2VT3 A;  1Z05 A;  2OD5 A;  5HVQ C;  2CFX A;  4UV9 A;  2ACJ A;  2VOO A;  3GZ5 A;  3CDH A;  3OV8 A;  1FY7 A;  4M6Y A;  1KGS A;  4RGX A;  3WTU C;  1HW1 A;  1ZHF A;  5D4S A;  5F6F A;  5FLX K;  1OYI A;  4UVC A;  5LEJ A;  1BI2 A;  2XRO A;  3DF8 A;  2WC2 A;  4HF2 A;  4XLN F;  4YIF A;  2GWR A;  3HRU A;  5J8F A;  2VOP A;  4M9Z A;  2ADU A;  2HS5 A;  3CUQ C;  4OOI A;  4OU0 A;  3M8F A;  1BI3 A;  2Q0O A;  1BM9 A;  5LGU A;  4WK8 F;  2F5C A;  4L0Y B;  5LLQ A;  3JW4 A;  4LB6 B;  2PI0 A;  1SD4 A;  1K79 A;  2M5W A;  3FMQ A;  1FYL A;  3NRV A;  2PG4 A;  2WV0 A;  5DUK A;  4P9U A;  2RNJ A;  4WXC A;  2YX7 A;  2EFO A;  1HW2 A;  1TTY A;  4L9N A;  4MHG A;  4KYW A;  4AIJ A;  1XN7 A;  1K6O A;  2AS5 F;  4WCG A;  2ZME B;  5F64 A;  2EB7 A;  2MLK A;  5D8L B;  1MDM B;  4D0P A;  3EQL F;  1U2W A;  1FSH A;  2HEO A;  3BPX A;  4PZJ A;  4LB5 A;  1QZY A;  3JTG A;  4S05 A;  4JQF A;  2LF8 A;  1IAW A;  1O3T A;  5F1R A;  1YS7 A;  2A6H F;  1WRJ A;  3V8K A;  3GLX A;  5CVJ A;  1BN5 A;  1XMA A;  1K78 B;  1DPU A;  4EJO A;  1MJB A;  5EEG A;  3EDP A;  4HX4 A;  1R00 A;  4LMY A;  5FFZ A;  3R0A A;  4CYD A;  4L9T A;  2JPB A;  3KZZ A;  3V7R A;  1IRG A;  2FF4 A;  5L3E A;  4G9Y A;  3O6B B;  4KIF A;  1IZ1 A;  4CHU A;  1YIO A;  1V3F A;  1WI9 A;  1FBQ A;  2RVC A;  3J80 Z;  1YW7 A;  5FD5 A;  1SAX A;  4GCV A;  1B59 A;  4R79 A;  4R1H A;  1R7J A;  3JAM Z;  2HGC A;  1J59 A;  1Z6T A;  5HLG A;  1ZLK A;  2E1C A;  2IRF G;  2O3F A;  2X4H A;  1XGN A;  5K5O A;  1QZZ A;  5DEQ A;  2NS0 A;  4I01 A;  3IHU A;  3E6D A;  2PFB A;  1REP C;  3N97 A;  3L2C A;  1S7O A;  2XAJ A;  1XSD A;  5E1W A;  4YFN F;  5A2Q Z;  2OQG A;  4EJU A;  2PQ8 A;  2HQN A;  3F23 A;  2DPD A;  3U9G A;  3KCC A;  5K1Y A;  1BI1 A;  1W5S A;  2NYX A;  3I58 A;  3WTY C;  5D5W B;  3BJ6 A;  3DFG A;  2JPC A;  5EEH A;  2K02 A;  4S04 A;  4UUV A;  4A0Z A;  1LJ9 A;  2HTS A;  3JSO A;  1VTN C;  1GVJ A;  3QP6 A;  1F5T A;  5H20 A;  2RV8 A;  1ZYR F;  3I53 A;  1ZRE A;  1XCV A;  3GYH X;  4Q5S F;  4PCQ A;  1T39 A;  5ERI A;  2RN7 A;  4O3M A;  2FQ3 A;  1TW3 A;  3KET A;  2XIG A;  3I59 B;  1L0O C;  1P4X A;  4N0B A;  2QEN A;  1F4K A;  4EV0 A;  4HW0 A;  1A04 A;  3M9A A;  1U8R A;  4OIR F;  5LHH A;  5L3C A;  3ERE D;  1I1G A;  2HFH A;  2OU2 A;  1G3Y A;  4G8X A;  3CLO A;  1Y0U A;  3QU3 A;  4FX4 A;  4A0Y A;  2STT A;  3E97 A;  1R5G A;  2DQL A;  2LSO A;  4EGY A;  1J5Y A;  2QYO A;  3QPH A;  1R36 A;  1KA8 A;  2MLG A;  2EWN A;  4U0V A;  1S7A A;  4M6X A;  1Z7U A;  1U5T A;  4XLP F;  2HYG D;  2CW0 F;  3DPL C;  3T1B A;  2M87 A;  4O6J A;  4RGR A;  4N9I A;  3BJA A;  1T6S A;  4G7H F;  1FP1 D;  5FFX A;  1XD7 A;  3ZP5 A;  4KNY A;  1HQC A;  1XSV A;  2DK5 A;  2V1U A;  2DAO A;  4A6D A;  3HHH A;  4EQQ A;  5L3B A;  1WSU A;  3Q5F A;  2XVC A;  2COM A;  3KP6 A;  3SFZ A;  4I7H A;  2EA2 A;  3V7S A;  2P8T A;  4WXH A;  3DEU A;  4L9V A;  2KRF A;  2EK5 A;  4ZH4 F;  1OKR A;  4GGG A;  1PUE E;  5CJ9 A;  2D1H A;  3BOQ A;  1SFU A;  1MJA A;  3FZV A;  1LEA A;  2XAF A;  4IVN A;  2P6S A;  5DCM A;  1KU9 A;  3F22 A;  3I5U A;  2FXA A;  3WGI A;  1H0M A;  4ZYH A;  5DYM A;  3KEQ A;  5HS8 A;  3C7J A;  5FO5 A;  3FHZ A;  3LQR A;  5LGT A;  3JSP A;  1JXS A;  3ZMS A;  5HDG A;  2YPR A;  1S3J A;  1Z9C A;  3J81 Z;  2QVO A;  4KDP A;  3WOD F;  4I0B A;  1H9T A;  1EH6 A;  2Q8K A;  3J80 K;  1OYW A;  3I54 A;  1YO5 C;  3F8C A;  3LA7 A;  5JFR A;  2EV0 A;  3ABT A;  1I1S A;  4AIK A;  3FXQ A;  3JAM K;  3GFJ A;  1U3E M;  4RB0 A;  3V8J A;  5J8C A;  1WQ2 A;  3E3V A;  4PGG A;  2UWM A;  4ON0 A;  3RPQ A;  1ONV A;  3SZT A;  5KVR A;  1BJA A;  2ELH A;  1Z1D A;  4HLX A;  5BQT A;  4U7B A;  1R1U A;  1X3U A;  4DQ2 A;  2FU4 A;  3DXJ F;  2FRH A;  4XSX F;  4IHT A;  4LJZ F;  3T0Y A;  3PQK A;  2VE9 A;  1BC8 C;  4R8H A;  1NHA A;  5A2Q K;  1ZRF A;  3ZMT A;  3V7C A;  2M45 A;  3GFI A;  3ZN0 A;  3RI4 A;  5E1Z B;  3IWF A;  4KMF A;  4BHC A;  4GXO A;  2W25 A;  4KMU X;  2YR2 A;  4RAZ A;  4L9J A;  2EA4 A;  2H6B A;  4IJA A;  4HDV A;  4A0X A;  1QGP A;  5E20 A;  3GVA A;  4ZYE A;  5ICE A;  4L5J A;  5DCF A;  2Z99 A;  2MBF A;  2L01 A;  4IPA A;  4ENM A;  1AOY A;  1SD5 A;  1UB9 A;  3IC7 A;  2HQR A;  4XRF A;  4A5M A;  4U7D A;  2CSO A;  5JHU A;  4ENJ A;  2XAH A;  3TDU C;  4OMY A;  4GYI A;  4G6D A;  4JBA A;  3RDI A;  1Z91 A;  2QQB A;  4HX7 A;  2VT2 A;  2CGP A;  1LEB A;  3HIF A;  3Q9V A;  1G4D A;  3BY6 A;  1ON2 A;  1O57 A;  4HAM A;  4U0W A;  4ESJ A;  4LFU A;  1OR7 A;  2HWV A;  3E6B A;  3C3W A;  2E7X A;  3WU0 A;  2Z5U A;  1BBY A;  5DV5 A;  4L0Z B;  4RGS A;  1LB2 A;  2HR3 A;  1TQM A;  2M30 A;  4Y13 A;  4KFC A;  1U5T C;  3HSF A;  2IA0 A;  3D0S A;  2A68 F;  3FXR A;  2GIV A;  2R7D A;  1FYK A;  3GO5 A;  3P9C A;  3CUQ B;  3EYY A;  4F7Z A;  1JE8 A;  3QU6 A;  3RKY A;  1UHM A;  4IRH A;  4LG0 A;  4HF1 A;  2DI3 A;  3HRT A;  5LEK A;  3DKW A;  4A2U A;  4IXA A;  3O2P E;  5LHG A;  5ICF A;  1Z6R A;  2P5V A;  2F5D A;  1DP7 P;  4P55 A;  3G3Z A;  3ELK A;  1T2K A;  1ZAR A;  1W7P B;  1IXC A;  2PBI A;  3RKX A;  3ROU A;  4YFX F;  2TDX A;  3CO7 C;  3F72 A;  4M9X A;  1TW2 A;  4BXU A;  1BI0 A;  4G7Z F;  3GFM A;  4ZYD A;  5ICC A;  3COA C;  2VN2 A;  2Z9O A;  3ML6 A;  3LQQ A;  2XAG A;  1I5Z A;  2QLZ A;  3ISP A;  1ODD A;  1QNT A;  4HF0 A;  3HRM A;  4Y15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...