3D5SC

Crystal structure of efb-c (r131a) / c3d complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
65
structure length
65
Chain Sequence
TDATIKKEQKLIQAQNLVREFEKTHTVSAHAKAQKAVNLVSFEYKVKKMVLQERIDNVLKQGLVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electrostatic contributions drive the interaction between Staphylococcus aureus protein Efb-C and its complement target C3d.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/toxin
molecule keywords Complement C3
total genus 27
structure length 65
sequence length 65
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF12199 efb-c Extracellular fibrinogen binding protein C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1270 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3d5sC00
2GOMA 2JVGA 2WY7Q 3D5RC 2NOJB 3D5SC 2WY8Q 2GOXB 2JVHA
chains in the Genus database with same CATH superfamily
4CXFA 2M8EA 1IRXA 2O3FA 2XAFA 4HOBA 5TISC 3SFZA 5E18F 4KMUX 3FWEA 1VQMI 5HLTA 5GAEJ 1NH3A 3CC2I 1DPRA 4MIMA 5K7ZA 1LDDA 3F72A 4F52A 3GFMA 3VSLA 3CUQA 3C7JA 2BY0A 1R71A 1D0YA 2L4AA 3RDIA 1BR1A 2IP2A 2XAJA 4HBLA 2DDAA 2XUBA 1NHAA 5K1YA 5GAHJ 4AWXB 3TBIA 3HBLA 3KYDB 4KUMA 4QSHA 2EFOA 5F64A 4MTDA 4NHJA 2L9RA 3D5RC 3G6EI 2HQRA 1ZARA 3QAHA 1U3EM 2ME0A 4P96A 3F8FA 1TNTA 4IO9F 1CQTA 1LEBA 4CSWA 2K9QA 3NRVA 3RSNA 2LD5A 2JSPA 2E2HJ 2GOMA 4FQGA 3HOWJ 2QBYA 3W2AA 2X48A 5M5YJ 1TW2A 2X6WA 4IHWA 5TGTA 3F6VA 1F9NA 2RGVA 3GF2A 2NAZA 4EM0B 3EETA 4X0GA 5DCMB 3V7SA 1Y1WJ 5IYDJ 3K2AA 2NS8A 1QGPA 2KIFA 1TLHB 2FUG2 2KT0A 4MFEA 3B6CA 5LRSA 2V79A 5FD6A 2IA2A 2NNYA 3CD6I 2R7OA 3LL7A 4IXAA 4A3GJ 1OYWA 2ZO4A 3M1EA 1T6SA 2IGOA 3S3NA 1S8NA 4CZCA 1R36A 2HYJA 4PJMA 4JK1X 2R7FA 3GWZA 5LBQA 1FP2A 3HGGA 3HM5A 3K70D 3HUGA 2VKVA 2E34A 4UUSB 3F8CA 1YI2I 3S3OA 4LJZF 1ETYA 1MNEA 5DEQA 4B09A 5IY5H 5HS8A 3UKGA 5IP9J 4NQWB 2FBKA 2ECCA 4NC8A 2WAFA 1K78A 4C9YA 5HLHA 4J00A 2J5OA 3BQZA 1UHWA 1MH4A 4LITA 2DYRH 3IKTA 1VQOI 3TW7A 2CWEA 3PNVA 3HB9A 1BW6A 2A3SA 5H6RA 3E6MA 4ITVA 1BOAA 1XCBA 4A3BJ 1UHSA 1GDTA 3PUFA 2KRFA 4UY8I 1MSEC 4IPAA 3I64A 1TWAJ 1W0UA 3C2HA 2QKLB 3CMEI 1UZCA 4HZFA 1QZEA 3AG2H 4ESFA 1K4SA 2P5VA 3KETA 2VC1A 3FBNB 5HOOA 4OIRF 2HEOA 5J1RA 1UJ8A 3RPUA 2IS2A 1KU2A 1ACIA 4D7MA 3ZMVA 1XSDA 2E5ZA 1DQUA 3KP6A 3H92A 2EH3A 1IF1A 2DMUA 1U5TC 1L3LA 3CCSI 5JVGF 4OMYA 2B0LA 4XQFA 1FEXA 2LSOA 4BXUA 4EQQA 5J8FA 2JRMA 4XORA 1WGXA 2VOOA 4CCNA 3GTMJ 1ETKA 4YELA 5EG0B 4G6DA 4B47A 4HV5A 2M9HA 3KPHA 1WRJA 1ETXA 2R3SA 3OWTA 4I01A 2VE8A 2W4SA 3WGIA 1OISA 2EZLA 3HPGA 4XN3A 3IWFA 1IN5A 3QYEA 3JRFA 1HSJA 2DQLA 3QQAA 1WJ5A 4TV7A 3ECHA 3H5NA 1BBYA 2CFOA 3K2ZA 1YOVB 2L7MP 3ZR8X 1U0JA 3ECOA 1Y6IA 3BR1A 4PSXA 2DQRA 2EIKH 3GMEA 1R49A 3M4OJ 2FSWA 2H09A 4K2EA 2DW4A 1I3QJ 3JSOA 2VBZA 4IOCF 4A0ZA 2BYVE 4G6TB 5DTDA 3MKWB 6PAXA 2MW8A 1RIOH 1B1BA 4L9NA 1MBJA 1SVOA 2HNHA 5ICGA 2G7UA 4OIPF 3DTIA 2LC2A 2GAUA 1GT0C 4WCGA 2DPDA 3TO9A 3ZQGA 1JTXA 2W57A 3A0HC 1DP7P 3IHUA 3G2BA 3B6AA 5BOXA 4BY1J 5F08A 4BJTA 2HOTA 1FTZA 3PSFA 5B1BH 3ZQCA 4CYCA 1YITI 4XSXF 3HUGB 4P55A 4HSRA 3UNGC 1R6RA 2P0WA 5FLXK 5FO5A 2HQ5A 3REOA 4A0XA 3HL2A 4LG0B 3J81K 3FMSA 2O9LA 4IKFA 3EYYA 2ID3A 2LOOA 1MDMB 2HOEA 3OS2A 4KN4X 3JTGA 2HDDA 3PO2J 4A3LJ 4HRIA 1R4MB 3WHCA 1Z67A 1P7JA 3T0YA 5B3SH 2F2EA 2OZ6A 2FMLA 2GOXB 1KONA 4FX0A 5FKNA 4B4CA 1SANA 3I5UA 3J7YJ 5EYRA 1BA5A 5F04A 4EGZA 2K9LA 1FSEA 3DLAA 1R1UA 3TOAA 4L0YB 2ZKZA 1HKSA 4ASNA 4A3JJ 2A6EF 2JWTA 5M5WJ 4UVBA 1F5TA 1YRNA 2O7OA 2RKHA 1T38A 3RKWA 2L02A 1KU3A 4UUVA 4MO7A 1T98A 3I54A 3DLLF 1TNSA 3IRQA 3SHFA 5E79C 3S1MJ 1E3HA 1LB2A 4PGHA 4Y3OA 3OSGA 3BPXA 2XKPA 2Q2EB 3E5XA 4HYEA 4YFKF 2LDUA 3GFIA 1V5EA 3W2VA 5FFXA 4J19A 4D5FA 1S72I 1D3YA 1Z6RA 5AIQA 2L2OA 1VQPI 1LPQA 3OR2C 3OIPA 4ZYAA 3FZVA 2JSCA 2KLOA 1JTYA 3J7AO 4BEHA 3I4NJ 3ABTA 2WB1A 1HF0A 1YJ9I 4ZYEA 2QQAA 1Z21A 2COBA 4OAYA 3GFJA 3TEDA 1I6XA 1IN7A 2M7AA 3ESWB 5EGOA 3KP7A 5CPRB 5FKMA 2R0QC 2O6GE 2VB6A 4V2GA 4LIVA 5K7FA 1GV5A 3FK6A 5DM6F 3KE2A 3HTUA 4EV0A 3BTJA 4ABZA 1K7AA 2O8XA 2R7WA 1BJAA 5FB2A 3DEWA 2K7LA 4N0BA 4XKBA 3ERED 1VQ8I 1KYZA 1HC8A 3GZ6A 5IP7J 1S7OA 1K78B 4XRSA 1KU7A 3I56I 5E3OA 3IH3A 3HRUA 4ZTFA 2IAIA 1YTYA 1OCTC 3ABLH 4OIQF 3TKYA 3T5XA 4ZC3A 3D5SC 4BHCA 3H3UA 3SZPA 3P9KA 1YLFA 4LK1F 3ASNH 4YFNF 4NC7A 4BHPA 2Y69H 3TP3A 3U21A 2YPRA 1MGTA 1PUEE 4HX4A 2F4MB 2OU2A 1DGWY 1WJEA 4KJZA 1BOBA 1QO0D 1WWXA 2YX4A 3S93A 3OYLA 2AS5F 3IH4A 2E1NA 2WAQN 1OYIA 4RS8A 1HQCA 3ZCOA 4EM2A 3KEYA 5E1WA 2QA4I 2XPVA 3DKWA 2QGUA 4M9ZA 1HSTA 2VPLA 4PJNA 4IHYA 2R7RA 4XKWA 4A3IJ 5DCMA 1H0MA 1ETWA 1F1ZA 4GFBA 4B1RA 3LNQA 5HLIA 2ZJPF 1ETQA 1NTCA 4ENMA 5EG0A 3MVPA 5E20A 3NWSA 2QEXI 3KP3A 2F5DA 5DUIA 2YR2A 3LWFA 3TDUC 4CCJA 5L3BA 1WH7A 3NAUA 2VUMJ 5D5VB 1TQMA 1YIJI 3T8RA 1R00A 1X1CA 2EA2A 3CP8A 5GAGJ 3MKZA 3ABUA 1YRNB 3VEPA 5E1ZB 3OYIA 2YU9J 1RI7A 3RYPA 4UV8A 3FXOA 2HPMA 1P4XA 3CJRB 2ACJA 2XPUA 3L09A 3WHBA 1L0OC 3UR3C 1YFHA 2GA2A 2WAQA 4NQWA 5FROA 4HEA2 4IQ4A 4P9UA 2DLLA 3FISA 1UAAA 4CGZA 2Q2EA 1FBSA 4Y33A 3S16J 4GYIA 2CS3A 3A1YA 2E1MB 2M2EA 4OOIA 1LEAA 2VIXA 2HQNA 2K3PA 1I50J 4GO1A 3R6SA 4C2UA 2L0KA 2MGQA 5DCFA 3RQ4A 4Y52J 2VJ4A 1Z9CA 3D1NI 2E1CA 2EIMH 2XF6A 2MH9A 2W7NA 4QIWN 1IDYA 1B6AA 1XD7A 3ZMTA 2H8RA 1I27A 2F5VA 2QQ8A 2W24A 2GZWA 4M3GA 1R9TJ 1EH6A 1J75A 2X1CA 3C3WA 2C6YA 3V8KA 2GXAA 3BTLA 1G8XA 3BG7A 3I4MJ 2FE3A 1Z3YA 3MEXA 4GGGA 3OYNA 4CA0A 3T8TA 4D7NA 5GTHC 2DT5A 2RQQA 5EEHA 4A5NA 1DDNA 4E7IA 1PVEA 2HKXA 2LY2A 1IN6A 5TJJA 3CCVI 2KKOA 2E60A 4ZYHA 1OMIA 1R5GA 3O8GA 2A6HF 5D6EA 1SFKA 3C2BA 1Y1VJ 5DYMA 1A6QA 1SD6A 3H0GJ 3HSEA 3IUOA 1N25A 1MJBA 1IW7F 1B9NA 3F8BA 3OOPA 3WODF 4AU7A 4YG2F 1MH3A 1R1VA 2V6EA 1IDZA 2QWWA 4BQNA 1JE8A 4A3DJ 2DA2A 1RETA 3MFKA 4LIUA 3D0SA 3F0CA 2AXLA 5ILVA 2CV2A 2F6CA 4S04A 3HHGA 2NS0A 4M6XA 1PUFB 4YEJA 2PI0A 1TQIA 3I0TA 3QU6A 3WTZA 4OINF 3LQRA 1EKEA 3CCRI 1X3WB 3I53A 5TRDA 1TT0A 4ZH4F 2OCCH 3LFUA 2VL8A 3DEEA 5GP9A 5BPIA 1WSUA 2LFBA 3OSFA 5KK1A 3OYEA 3S15J 2J5PA 1IV8A 2VJJA 3HSFA 3DKXA 5HNFA 3CCQI 2LTPA 4BXFA 1SMTA 3I59B 3JRHA 2KL4A 2OAZA 4AYBN 2EFQA 2KQRA 3DPTA 3AKZA 4BXXJ 2R4GA 4Q47A 1TQPA 4CYCB 1FY7A 5CVUA 1ITYA 3VSKA 4QWQA 3PIOF 3LAPA 3O6BB 4U0VA 1JUPA 4PJ0C 4C3JJ 3VWBA 3CUOA 4UB8C 3W6KB 4C2TA 1V5FA 2G9WA 4L9TA 3TO7A 4L5IA 3JAMK 1YS6A 2LH9A 5HVQC 1OR7A 3HZJA 3HOYJ 1SVMA 5LRRA 3WTVC 3VFZA 1Z77A 1XDUA 2IA0A 3J7ZI 3H1CA 3LFKA 5EJCA 1XGMA 3RKXA 4A5MA 1FP1D 3C1DA 4YFXF 1BN5A 3VODA 4LOCA 2ZC2A 4RAFA 2BXYA 1DU6A 1TTYA 3VYUB 3PM1A 1ZYRF 2VASA 2V9VA 2DTZA 4I76A 2E7XA 3DU5A 3A03A 3S1RJ 4WX9A 3CMAI 5GTIC 3OIOA 2JT1A 1GV2A 4NDLA 2VN2A 5BS6A 1G3SA 2MSYA 2E2IJ 5IYCJ 1JT6A 3W6JB 2MC3A 3DTKA 3CCMI 3R0AA 4G12A 4DIQA 4BE2A 1IN8A 2M8GX 4XIDA 5JLXA 2HWVA 3WG9A 2ZCWA 4LLNA 3FXUA 3ZXSA 2R7SA 5EZGA 1T2KA 4UXNA 1SD5A 4IVNA 3CCJI 3CJNA 4E7JA 1B8IA 3BPVA 2NVUB 1R5ID 4XKVA 3TGNA 2KDOA 1WPKA 3CLOA 1ODDA 1BI1A 1CGPA 4MQVA 2MC4A 1PDNC 1W36D 1R23A 2UXNA 4LLLA 3Q9VA 3BJAA 1LE8A 4KICA 5LFAA 2LF7A 3U9GA 2LKPA 4MGRA 4II2A 4E6KG 1IJWC 3RJPA 2PN6A 4E7SA 3OS1A 2Y48A 3L1PA 2NYXA 3EPZA 4I09A 1U8BA 2V4JC 3CMMA 4I02A 3SEQA 2QENA 2MABA 4AVZA 1ETOA 1AKHA 1MD0A 1D8KA 2HYGD 5D5UB 1APLC 3IV5A 4HNUA 1J09A 1YW7A 3JAMZ 2R7VA 1WJFA 1D1AA 5BQTA 2ZMEA 2V1DA 3EUHA 3FXQA 2XC7A 1WH5A 5ILSA 1B72B 3GTLJ 2KMUA 4XRFA 3L2UA 1TL8A 2VBWA 3WTYC 4EJOA 1LFUP 3DFGA 1UG0A 2DK5A 2ISZA 2OD5A 5CLSA 1HKTA 2DFFA 1ZK8A 3GTPJ 3GTGJ 3EUKL 4RBOA 2FBHA 2HKOA 2KJBA 2FQ4A 1HXDA 1MZBA 3IH2A 3TW6A 3QRFF 4QTRA 2CSOA 1JKOC 4FCYA 1JT0A 1S6LA 2JN6A 2XF7A 1S3JA 4QPQA 1R1TA 1RESA 4HX8A 4DZJA 1DPUA 1EH7A 3M07A 1ETVA 1KQ8A 1ULYA 1MJ9A 2WBMA 5CKTA 1TC3C 4Y4RA 3S2HJ 3ZRGA 5ICEA 2DBBA 2OJED 1FOKA 5ILUA 1O3TA 4PFPA 4F7ZA 5HNHA 3H5RA 3FHZA 3JRAA 4E4HA 2LR8A 2AO9A 3LSPA 1E0EA 4M9XA 2DOAA 4MNUA 1GLNA 2EINH 2BE5F 3WU2C 2K3FA 3NARA 1OJLA 5C44J 1QPIA 1W7PB 4ZTJA 3BT9A 2FD5A 4Z2YA 2VC0A 1QQIA 1X58A 1W7PD 5EZHA 4O3MA 3HGYA 1O4XA 1UMQA 1R5HA 3D5LA 1MMNA 3FDYA 4ZJZA 2ELHA 2XAUA 2L01A 2MFZA 3E0JB 4IZZA 1USSA 1JJ6C 3KYLA 2MD0A 1HW2A 3CCLI 3K10A 1FNNA 3G1MA 1IN4A 2L5QA 1H8AC 3E6CC 5LEKA 1BJZA 3OIQA 3WG7H 4KT6A 2M0CA 1G3TA 3SZTA 4JP0A 4RGXA 3ZGKA 4HF2A 3EDPA 1P92A 1WI9A 2PG4A 1MBKA 1LDKB 1U5TA 3WTXC 2PEXA 2QVOA 4NBQA 5L3GA 3HOVJ 3OYBA 1Q1HA 1RUOA 5JFRA 1SAUA 4XK4A 3HOZJ 1B8IB 2ELJA 2OBPA 1SFOJ 3F3XA 2Z2SB 1LDJA 3CCEI 1OCPA 2DMNA 2DOFA 4YRVA 2JA6J 1ZKGA 1E3PA 4GCVA 3VYSB 2TCTA 2XAQA 3M8EA 3AAFA 1CF7A 5D4RA 3ZQLA 1ZH5A 2CYYA 1ERDA 1XX5A 2IGNA 1FLIA 2FNPA 3FF5A 5FFZA 2P7VB 1KU9A 1NK2P 1F4KA 1Y56A 5DDGA 5J4VA 4OAZA 1I3AA 5AIPA 1JI8A 3BG5A 1XGOA 3KCCA 3ZMZA 4A3FJ 2VODA 2MD5A 2YX7A 4AC0A 2R5YB 1X3ZB 5FKOA 1GVJA 1GHCA 3CJTB 1FOWA 2DA6A 4FTHA 2DMTA 3BDDA 2HVSA 1ONVA 5LHHA 1IXSB 3S8PA 2M7BA 3A02A 3ZQ7A 3P9CA 1T56A 2DI3A 2ZMEC 3EUHC 2F5FA 4E7HA 3TOBA 2JTVA 4BGDA 1U2WA 3K1PA 2EWNA 4A3CJ 4BDZA 4RGSA 4AM3A 4HV6A 1IZ1A 2WC2A 4BQQA 2Y30A 2WY7Q 4HF0A 4IHTA 1TWFJ 2L7KA 3K4JA 2GLOA 3CP2A 1J5YA 2DK8A 1MMGA 2V1XA 2L9NA 2WTEA 4L9JA 1IXRC 1WQ2A 5CVIA 1VQ9I 2JUCA 2WADA 3RIRA 3KYCB 2VQGA 2K5CA 3QPSA 2BBYA 3IL2A 1NK3P 3CTAA 1U78A 1VQKI 1J7KA 2VKDA 1T39A 4GRIA 2OQGA 1ZHFA 3E6DA 2HFHA 1FC3A 4AIDA 3FM5A 3V4GA 4ZDPA 1MMSA 2BVMA 4BDYA 3L2VA 2QSGX 2P5LC 3RKYA 4C2MJ 1QU3A 3B73A 1U8RA 2STTA 4CHUA 1BL0A 2E2JJ 5CVRA 2KP6A 1J2XA 1O57A 4GXOA 1JUMA 1A6IA 4I0BA 3BOQA 1ZLKA 2BY1A 1H9GA 3F8MA 2ECBA 2R7TA 3ZQHA 2X6OA 1VI0A 2VJIA 3JRGA 3I59A 3VB2A 4R79A 4V19K 1V4RA 1N78A 1K83J 1U6GA 1RKTA 2LBFB 1O3SA 3SDBA 4CYDA 3SYTA 4RM3A 1W5TA 2ZXWH 3BLYA 2UV1A 2HTSA 4MHGA 4A12A 4A6EA 4LFUA 3BR3A 3TP0A 2H6BA 4ENJA 1FIAA 5J3LA 2IT0A 3G4SI 1WJCA 3PJRA 4IRIA 2BHYA 3OV8A 3I58A 4LD5A 3K1MA 4BE1A 3KEQA 1D0XA 3CO7C 4HLYA 2WV0A 1JXSA 2V9KA 3QYFA 1A04A 2EILH 1BR2A 1HDPA 4XR6A 4D0PA 5LGNA 3ZN1A 2CW0F 4OU0A 4LLGF 3L2RA 1R4NB 2YU3A 1LFBA 5IPAA 5D5WB 4IX7A 3BZKA 2L9SA 2A69F 3QWLA 3M3YJ 2D2WA 3BR0A 4EVIA 2LMDA 4HQMA 1H89C 2LBFA 4KNYA 1TBXA 5A2QZ 2DA4A 2DA3A 1MMDA 2B7EA 4XONA 3GO5A 3G1OA 2BY3A 4F93B 2EPFA 2GA1A 2FF4A 3I4PA 5FLXZ 3L00A 1U9OA 3IRRA 1HW1A 2RN7A 1BI0A 3HOXJ 1MMAA 2XGDA 2K9MA 3K4LA 2CFXA 3MN2A 3OR1C 3WE2A 4M6VA 4UHTA 2EFPA 3GFLA 3F22A 3DU6A 3H3ZA 2M34A 3FBIB 2XROA 3OYAA 1W0TA 1EJ9A 3ABKH 4CCLA 1YE9A 4MLOA 5EF6A 2JA7J 1PJRA 1QA6A 1Y8RB 4LB6B 4XN0A 4RM2A 2CG4A 3ASOH 2R7ZJ 1MSFC 2Y0SA 4BEHB 4BBRJ 4CO8A 2R93J 1IUYA 3E97A 2LLKA 2JPCA 2BVLA 1S7AA 4E7KA 2ADUA 3LMMA 5KVRA 2MG4A 5FD5A 2IS1A 3MZHA 2XPWA 2HZTA 2ZXHA 2TDXA 2PMUA 5J4YA 1B72A 4V2FA 1ZN2A 4HDUA 2JK3A 5D8KB 4UUTA 3RKQA 4DW6A 2QCOA 5FRMA 2DOEA 1I1SA 3CDIA 2PJPA 2R7QA 2VQHA 2XVCA 4DNCA 3HRMA 2VE9A 3LAJA 2AHQA 3MMYB 2FQ3A 3WU0A 4KYWA 2X0LA 1FBQA 5E8GA 4J01A 1T33A 2HZDA 3OOUA 2DA1A 3SQNA 1G4DA 3DPLC 3GZ5A 5IOZA 3WGHA 1IUFA 1N75A 2R5YA 3LA2A 2K9SA 1MBEA 2W25A 3V7RA 3MZYA 2E19A 1T0FC 2Y0MA 2A6TA 3R60A 3SJMA 1UELB 4I2OA 5HLGA 2IPQX 1OLTA 5C4XJ 1S5LC 4I6ZA 2CQKA 3H35A 3O8HA 3KZIC 1JKPC 3BWGA 3G73A 4RAGA 3ZPLA 2W1OA 2K9NA 2OV7A 3CUQB 4D5CA 1GXPA 5HODA 2IS6A 3MKYB 4EJWA 5ERIA 4DYCA 2OA4A 1M1EB 3IKVA 4KIGA 4ETSA 3M8FA 3A01A 3S14J 3LQQA 3FXJA 4BY7J 1N77A 2DTRA 3LSGA 2DODA 1YHQI 2HXOA 2K40A 1VF9A 2LKSA 2UUZA 4CICA 1Z7UA 5CQEA 3A0BC 5J40A 4AIJA 3ML6A 4CZZA 3WTUC 2X1DA 2CU7A 2FXAA 2DJIA 5JR3A 5EGOB 2HXIA 2KPMA 3QPLA 1LJ9A 1OCRH 4M73A 3TDZC 4U0YA 3G71I 1JGGA 2CMPA 1YW9A 3KZYA 1OKRA 3GZNB 4HG2A 1D5YA 1VQ6I 2Z1DA 4AIKA 3OYFA 1VNDA 3BJ6A 4G7HF 1FYMA 3DP7A 3X2QH 4IHSA 3L7WA 1Z6TA 2LF8A 4IOAF 2DO7A 2R7XA 4I99C 3JRCA 3BTCA 3J80Z 2QF7A 3R61A 1MIJA 1FMVA 2IEKA 1YX5A 2PFBA 4L5EA 4M3BA 1REPC 3KIOA 1SMYF 3FMRA 2XSDC 3JW4A 2CQ7A 2R5ZB 4ZDOA 3IAS2 4Q48A 2QYOA 3VOEA 1RNLA 5JHUA 2CQNA 3K4CA 4U88A 3ISPA 4HPQA 2VPRA 1TP4A 4KMFA 1UCRA 4U7BA 1LQ1A 5J8CA 4KDPA 1VQNI 1H88C 1BIBA 1ZAOA 2FOKA 1W5CC 3HKZA 4IEJA 1QZYA 2VXDA 2G7HA 2GM4A 1EH8A 4N4OB 4WF2A 5J1YA 3COAC 4LMYA 3SFIA 3FM3A 2VBXA 3AG3H 3H9JA 1Z7LA 2RNGA 5D5XB 2I10A 2K02A 2KRHA 2ZSIB 3CC7I 4OIOF 3H5AA 4C3HJ 2K4BA 4EJVA 2DT7B 3CCUI 3F23A 2JVHA 2VOPA 1YO5C 5F6FA 2P6TA 1E17A 1R7JA 2DA7A 2WWYA 1LVAA 2ZJQF 2OCEA 2H27A 1IGNA 2FX0A 3FKJA 3P7NA 3GLLA 4D9JA 2VXZA 1YIOA 2R5ZA 1E3OC 1J0RA 2RDPA 3QOEA 1S7EA 4M3DA 2ESHA 2XGCA 1YQAA 2XRNA 3JREA 4HDVA 1SD7A 3RYRA 4F92B 2X51A 4B3XA 1ZTRA 3CDLA 2O8KA 2X6XA 1OCCH 1RPWA 4ZZDA 2Q8KA 3LOCA 2EV0A 4YIRX 2QM3A 1SVLA 3QP6A 2Z9OA 1MNDA 2GQQA 3F6OA 3B02A 3RPQA 2CUFA 2X6YA 5L3EA 5ICFA 1SEUA 4DOZA 1PUFA 2V1NA 3Q0VA 4E70A 3G3ZA 3JCUC 3OS0A 3F21A 2JVGA 3BR6A 3IAM2 4XRMA 2R92J 1X3UA 2ZXJA 3LSJA 1V3FA 1MW7A 4GDFA 1U9NA 3A01B 3RTRA 1DU0A 2NOGA 1Y0UA 4EGYA 2VT3A 1P2FA 2DYSH 2O0YA 2VQCA 4IF4A 1WI3A 2JJ7A 1FYLA 3WTTC 3BG3A 4R1HA 1XSXA 1G6NA 2BHZA 1BM9A 5L3CA 5C4JJ 1W1WE 3LA7A 1P6RA 3HYIA 2EZIA 3J81Z 1BIAA 3I9V2 4XLHA 5DS9A 4G9YA 2K27A 5B66C 3RZOJ 2K86A 2BW3B 5HS9A 1ON2A 2NRAC 2CRGA 1B9MA 1T8IA 4II3A 3R4KA 1K61A 1WKMA 5ICCA 3L2QA 1IC8A 5FRNA 2LYCA 4PGGA 1BR4A 3HRSA 3BY6A 2HGCA 4XKCA 5CVJA 1IG7A 3RQIA 3SDGA 4HNVA 3KLOA 3QODA 4L9VA 3CF2A 3C2GA 2W84A 4EMSA 3CLQA 4JX4A 3LA3A 3CO6C 4BBSJ 2B9SA 2HQAA 3O3KA 1X1AA 4ON0A 3BJOA 2ZFUA 3K4KA 1JUSA 4XLNF 1I39A 5IOYA 2PMZA 3FX3A 4ENKA 2BGCA 3ZMDA 1XG1A 2M45A 4P5OA 1UG2A 1E2XA 5IT9K 1V54H 2QSHX 2L3DA 2E1OA 2G0EA 4ANJA 4BYYA 4JQFA 1IRFA 2XF5A 1Z1DA 3RI4A 3CMYA 2ZSHB 2NOJB 1YW8A 1FBUA 3CESA 3HHHA 3BR2A 5H6QA 4HLXA 4FETA 2Y9YA 3PNTA 4ZYGA 3KP4A 1D8JA 2P81A 4ESJA 2O61A 2HYFA 2FJ1A 5J47A 3S2DJ 1AOYA 3TO6A 4H0EA 1ZRCA 2VLAA 4DBQA 5JLWA 1IO2A 2E7WA 3WTWC 5D8LB 2LRDA 3BZCA 4HA8A 5D4SA 3IP4B 1HBXG 3KX2A 2P4WA 4XBFA 1IAWA 2EQRA 4RB1A 4BJ6C 3AFHA 5DV5A 5E3NA 3ELKA 1ON1A 3JRBA 2GXGA 1V55H 4JX5A 4KITB 4RAZA 4MEXF 2YSRA 4O6JA 1XN7A 3PQKA 2MA3A 3CQZJ 2JRTA 4JX6A 3GTKJ 2VKEA 2P8TA 2LY9A 3KFWX 3L2CA 2L54A 1FX7A 2IJLA 2O5RA 3P5JA 3AL0C 5F0CA 1MBHA 5LHGA 5LEJA 3AG1H 3ZQFA 4PUSA 3T1BA 2XKOA 4HSTA 1OFCX 1ZRDA 2XGEA 3GEZA 4B8XA 2PMZN 2H1LA 4M6YA 2FOWA 4F55A 1WVRA 4EEFG 3WE3A 4LB5A 2JQ7A 4HF1A 3U2RA 4BAYA 1V5GA 1XMXA 5J6XA 2CV1A 3BZ6A 2XV4S 2HR3A 2KFDA 3HKZN 3HRTA 1OR7C 1LUJB 4U87A 1TT5B 3K70C 2ME6A 2FMYA 2A5WA 2MH2A 4FT8A 3ROUA 3N05A 1S29A 5EDNA 5K7HA 1X1DA 2D1HA 3MD2A 3SZGA 1XGNA 3WU1B 1I1GA 2NNNA 3BCBA 3Q0WA 2JA8J 1OCZH 4BUPA 3GTJJ 2KDZA 2HOSA 2A05A 5DD4A 2XAGA 2JPBA 3ONQA 1T08B 2V6CA 5FLMJ 3NQOA 4RA2A 1FTTA 2A68F 3ZP5A 3QU3A 2QLZA 3ZQQA 4XICA 1MKMA 5CYVA 4EJTA 1YJNI 4RGUA 4PK4A 1A31A 2Y75A 1B59A 3KZZA 3A4CA 3MAJA 1T95A 4U0WA 2VQLA 1VTNC 3LSRA 5KHDA 1FT9A 1Y39A 2XDVA 1JGSA 3BR5A 3WGGA 1WHUA 1FOYA 2A5YB 2FU4A 2WV1A 4O5VA 4XOTA 4Y17A 3NEUA 4XRSG 1VZ0A 3JSPA 3K1NA 2UZKA 3QPTA 2IA1A 1UFMA 4MEYF 3K0LA 2VONA 4L0ZB 4UUSA 4KIFA 2W00A 1BC7C 4QLCU 2M87A 5FJ8J 3HC7A 1RUNA 4RLQA 1TWCJ 2KIUA 1XCVA 1H9TA 5LGTA 1P9QC 4BQAA 3HDDA 2NXNB 2L4MA 3BP8A 5IYBJ 1YYVA 1QVUA 2E36A 3M9AA 3TQNA 1W36C 1WJDA 3FK7A 4QPOA 1XSVA 4XLPF 1XPXA 1G3YA 4B44A 2QKMB 2CUZA 3F9KA 4G6QA 1TZLA 2HI3A 1AWCA 3E3VA 1X1PA 2EJRA 5K5RA 2CV0A 3S17J 2HVRA 3DKYA 2JA5J 5FGMA 2QZ8A 1DGRM 3SXYA 2BV6A 1ZREA 3S2WA 1G3WA 4XLCA 3BQYA 2F4OB 3NWTA 4BHBA 5DM7F 5FLVA 4PFOA 2DPUA 4IL6C 1F43A 1A35A 4HX7A 3MKLA 3S1QJ 3LSMA 3Q9SA 2QQ9A 2RV8A 3FKIJ 5B1AH 3H0DA 1KZHA 1K6YA 2EFNA 5JI6A 2JMWA 2XRLA 4RB3C 3H36A 3HXLA 1HOMA 2CQXA 5E17F 1P4AA 1R22A 4RLFA 3CDHA 2FRHA 1YJWI 2CJJA 4RB2C 2MYSA 2AXTC 2F4IA 3DEUA 5L3FA 3FXLA 4FISA 1X2NA 5GPAA 3HIFA 5H2FC 3J7AY 3P9IA 4G7ZF 2COMA 4XLAA 4IHXA 5J1UA 4Q5SF 2QUFA 3AL0B 4U7DA 2OZUA 5LHIA 3LSIA 4EATA 3QP5A 1AHDP 4PJJA 1GXQA 1HLVA 2L9VA 2XB0X 1VQ5I 2BZTA 4ZZLA 2DXIA 2EA4A 1K6OA 3PFYA 1VQ4I 1A5JA 3KP2A 1X4PA 3L9FA 3CUQC 2H94A 4M9SA 1XMAA 1QHHD 2D45A 1ZR4A 3FXKA 2R7UA 2DT6A 1DP3A 3H3VK 2ZMEB 1KA8A 1T0FA 3PFIA 2Q1ZB 3BC8A 5FKKA 4KT5C 1SAXA 4KN7X 1Y8QB 5BNGA 4CCKA 3OYCA 1CF7B 1RR7A 3SEZA 2ZNZA 4XLFA 2ZJ2A 5CQGA 2LKXA 1QBJA 2LK2A 3K4NA 1DUXC 4DGWB 4RGRA 3OYMA 5HDKA 3HOTA 5E3MA 2XAHA 1FJLA 3EYIA 4GYGA 3DBRB 3CJQB 3PNYA 2VJ5A 1K4TA 2BY2A 2HU9A 2BW3A 1ZELA 2XGXA 1GVDA 2F5EA 1W4MA 4YIIA 2P7CB 4BH9A 3GTOJ 4IRHA 1FZPB 1MJAA 3I71A 3WTSC 1Y0NA 5AONA 1MDMA 3GBGA 1S9HA 2M1BA 3OY9A 3HPHA 2DFHA 1O7FA 1F36A 1FWZA 2P6SA 2IGKA 1B4AA 2PMHA 4A3EJ 2LY1A 4BS9A 2KJCA 2LREA 3PIPF 4I7HA 5K5QA 2KHMA 2LNBA 2IRFG 5K5OA 2AQEA 2TRTA 5IT9Z 5M3MJ 3HOUJ 2HS5A 3EUAA 3FMQA 1KGSA 2M5WA 5E8IA 2MLKA 2E71A 3CF5F 3V42A 1XC5A 4CDGA 2M4GA 2DFEA 3S32A 2BOLA 3CC4I 1R58A 3U1DA 2ZB9A 5C3EJ 2Y31A 1QNTA 4NB5A 4WWCA 2Z5UA 2PJRB 2OTJI 4BNCA 3BROA 1ZLJA 3V8LA 4WXCA 4B43A 1QHGA 3S1NJ 2GBYA 4WXDA 1Z0XA 4UVCA 4S0HB 1QVTA 3MQ0A 1VQLI 4Y15A 3F8NA 1UHMA 3GCMA 2RQPA 4EJUA 2DDBA 1NG6A 3KEOA 2CUEA 3DXJF 1SFEA 3LSTA 3VYRB 2ZNYA 3VDXA 5L3DA 3Q3SA 4HAMA 2XHKA 3PQJA 1O3QA 2L7ZA 2XIGA 2QQBA 1FSHA 1RZ4A 2M3AA 4UB6C 3VYTB 3GXOA 2CO5A 4JYKA 2CH0A 4CUGA 2Y0SN 4PZJA 2WA0A 1IRZA 4M3EA 4C3IJ 5LD2C 1POGA 3V7CA 1FOXA 5FKLA 1BI3A 5A2QK 2OPTA 3JRIA 4R8HA 3A2KA 3DQVC 4CCMA 1RRJA 1PYVA 3E5UA 4E7LA 3QOPA 2OTLI 1G59A 5DD8A 1D5VA 3JTHA 4XOPA 4ZDLA 2WY8Q 2EFWA 2PJRA 3GUDA 1RC9A 4XMYA 2V7FA 4PCQA 4RB0A 5LLQA 1O7LA 5JVTA 3C18A 2W48A 2HPIA 1JKRC 3E7LA 4IJAA 4B3AA 1ZGAA 2D1VA 2WAEA 5F0HA 1X4OA 2DU9A 4DZPA 2NVTJ 2ZXIA 3JR9A 2OUMA 2Y2ZA 2IXSA 2PLYA 2H6CA 3MWMA 1YG2A 2LG4A 2JZYA 3FHNA 4BACA 3FIWA 1MBGA 3RPUD 3TMOA 5KAIC 2FEZA 3GYHX 1J9IA 3CCYA 2F48A 2W85A 2HVQA 4LK0F 3J80K 3V8JA 3W6VA 2M0MA 1XDSA 4X6AJ 1W5SA 3MZ8A 1EA3A 4KISA 1QZZA 3OYKA 5BMZA 1LFPA 2JUGA 3R0JA 3KLNA 2E5NA 1OQYA 4FHTA 5F27A 2OF7A 4AVPA 3E1SA 3KP5A 2I8DA 3RCOA 2IS4A 3K4BA 1PP7U 1JHHA 2RAEA 4OMZA 1I5ZA 1NG7A 1USTA 1AA7A 2P5KA 2A61A 3H9QA 1Z91A 5M5XJ 2DJNA 4LG3A 1O3RA 2QBYB 2RVCA 2BEOA 4WXHA 1K79A 4Q4ZF 2VI6A 1MBFA 2CGPA 2DMQA 4MQ9F 2F5CA 3GX4X 2CQQA 2K85A 1ZGWA 2CW8A 1WCMJ 4ENNA 3QYBA 2WB1N 2OQRA 3RZDJ 4W97A 1SFUA 1HCRA 4NUBA 4F3QA 5B5EC 4FE7A 2N8GA 2KIMA 4Z6YA 1LKXA 2Z99A 3K4MA 1LNWA 4A2UA 2Q0OA 2A07F 4KFCA 2LVSA 3HTSB 2DCEA 2X1EA 3ULQB 2PQ8A 4XL9A 2FNAA 2ETHA 2HDWA 4F91B 4AYBA 4W1UA 5F0FA 2AQFA 3DTEA 2OC6A 4IHVA 3PO3J 3PSIA 5CJ9A 4BQOA 2H8WA 1J59A 1WFXA 3I3LA 5H20A 2HOAA 2HDCA 2RNJA 5D6FA 4XLEA 2B63J 3GLXA 2XASA 4G7OF 1P7IA 3EQLF 3ZMSA 2NVYJ 3CZ6A 5E3LA 2H1KA 2EBIA 1AU7A 1D1CA 3K6GA 4M3FA 1ZG3A 2EIJH 4E7ZA 1I6HJ 2YS9A 1Q1VA 2JA2A 1SC7A 2V9PA 3M7GA 3FXRA 2MLGA 1SFXA 3HJEA 3HEFA 2CW7A 3N4MA 2R7DA 3E5QA 1OYYA 4IRGA 3O2PE 4C30A 3ZOBA 3GVAA 1P4WA 1HDDC 2LP0A 4UV9A 1AKHB 4G8XA 1TW3A 1X1BA 2L7FP 4XNFA 1XGSA 2ZJRF 1WZ2A 5BPDA 2BXZA 3DV8A 2KRCA 4FASD 2GWRA 4A3KJ 1SD4A 2K4JA 1FPQA 5GADJ 3IWZA 4BU2A 4M72A 1FYKA 2DA5A 4MFDA 1ORKA 4DJAA 4XM3A 3PL8A 4KA4A 2NVXJ 4BJ5C 1BI2A 2Z16A 4RAYA 1KQ0A 4A3MJ 3ERMA 2YUSA 3ZN0A 2V26A 4AD9A 5LGUA 4HQEA 5M3FJ 3ZMUA 2MBFA 3H9GA 2EK5A 3K7AJ 1WJBA 3OYDA 3Q5FA 1XMKA 4NC6A 2M4KA 1EF4A 1ENHA 4M74A 4DYRA 4FE4A 1C0WA 1WJAA 1ZG1A 4FX4A 1IXCA 4DQ2A 5HDGA 1HA8A 2E35A 4N4NB 4X1EA 5KNLA 3OL4A 3OL3A 4IQJA 1PP8F 3K69A 2GXBA 3DBHB 3FXMA 1XB4A 3VPRA 1W7PA 4I0AA 1STZA 3W3CA 2FBIA 4CCOA 4A93J 1OCOH 1IRGA 2O03A 2IVMA 3M8JA 2DFIA 2W82A 2NVQJ 4DYQA 4M71A 1ZRFA 2KZVA 2EV6A 2PBIA 1FIPA 1LE8B 4G94A 2Y9ZA 3K9TA 4AIHA 4JBAA 4NNJA 3HOSA 1TWHJ 1FMWA 5DUKA 2V1UA 3GW2A 1Z3XA 1HW5A 2DMPA 2VBYA 3BTIA 4BE0A 3S3MA 1RKWA 1X2MA 3DWLE 4A69C 1QPMA 3ABMH 2EV5A 2HTJA 1OPCA 4XSZF 1JKQC 1G2HA 5F1JA 2ESNA 1X19A 4L18B 2X9DA 5CVVA 3M1CA 4HW0A 4BL0B 4YIFA 5KCMA 2IW5A 2IBDA 3MCZA 5JHFA 4RDUA 4LG0A 2EZHA 1KQ9A 9ANTA 4DBRA 3ZQIA 1RR8C 2M30A 1ZG5A 1A36A 1HKQA 1ZGJA 2ICWG 3Q0UA 3BG6A 3LSHA 4RMNA 4Y13A 4B48A 2ZBKA 2X4HA 4D1QA 2NS7A 3TL4X 3AG4H 1MNMC 2ELKA 2RC4A 3OYHA 4UNOA 5KAFC 4ZYDA 1GUUA 3N97A 5IP6A 2ID6A 4WK8F 2EB7A 4PDKA 2GIZA 4MTEA 1D0ZA 2I5UA 2KIQA 2XSJC 2ZFWA 4PSWA 3E6BA 2EZKA 3G1LA 3DBLB 2IGMA 4N9IA 2STWA 3OYGA 4UVAA 4PJLA 4S05A 3BG9A 1XS9A 2VT2A 4N9HA 4LGWA 2RREA 2X85A 1D1BA 5E1XA 3I55I 2Z33A 4HNTA 4JOMA 3IC7A 1ZQ3P 4KIBA 1JJ8C 4EM1A 5HS7A 1VFCA 1LVKA 2XB5A 3QPHA 3HSRA 1JHFA 1Z05A 3LSKA 2D5VA 3OYJA 2KISA 4A6DA 1TWGJ 1KYWA 4P1WA 3BCAA 2FA5A 5GPCA 3DCFA 1YX3A 2DAOA 4Y7NJ 1XTAA 1BC8C 4A0YA 4L5JA 5EEGA 3DPUA 3GTQJ 2DN0A 4ESBA 4H4KC 2UXXA 1QRYA 2UWMA 4BKXA 2KZGA 3DF8A 4CH7A 2ISYA 2E1MC 1UB9A 2PX9A 1BW5A 4OWRB 5EEAA 1VQ7I 2GIVA 5HDNA 1ZR2A 3PUBA 3HG9A 2QSFX 2CUJA 2Z3YA 1IV6A 5F1RA 3OMYA 4P9FA 1EV7A 1YS7A 2VKHA 3L2WA 5ED4A 1U5TB 4AUXA 5IT3A 3JRDA 3U1KA 3W2WA 4I98B
chains in the Genus database with same CATH topology
4AU7A 3AL0B 1IRXA 3LSIA 4EATA 2V6EA 5HLTA 4PJJA 4BQNA 5FRMA 4F52A 3VSLA 4LIUA 2R7QA 2VQHA 2CV2A 2DXIA 1D0YA 1BR1A 2F6CA 3PFYA 3MMYB 1X4PA 4YEJA 4J01A 1QHHD 2HZDA 3OOUA 2R7UA 1DP3A 1TT0A 2DT6A 3LFUA 3TBIA 2VL8A 3DPLC 3DEEA 1N75A 3D5RC 2Q1ZB 3BC8A 4CCKA 3OYEA 3OYCA 2VJJA 1T0FC 2A6TA 3SEZA 4XLFA 5CQGA 3DKXA 1UELB 4CSWA 5HNFA 3K4NA 4DGWB 1OLTA 3RSNA 2JSPA 2GOMA 3H35A 4BXFA 3OYMA 3HOTA 3W2AA 2KL4A 3CJQB 3PNYA 2KQRA 2X6WA 2VJ5A 3DPTA 5TGTA 3AKZA 2R4GA 2HU9A 2BW3A 1ZELA 2OV7A 2W1OA 2IS6A 3VSKA 3MKYB 4X0GA 4C2TA 3VWBA 1V5FA 1N77A 2FUG2 3LSGA 2R7OA 3GBGA 1S9HA 3LL7A 3OY9A 3HPHA 2UUZA 2LH9A 5HVQC 5CQEA 2IGKA 2IGOA 3S3NA 2X1DA 4CZCA 2DJIA 2LY1A 4PJMA 2LREA 4BS9A 2KPMA 2KHMA 3K70D 2AQEA 2CMPA 3VYUB 3EUAA 4HG2A 3S3OA 2VASA 2Z1DA 1MNEA 3V42A 3DU5A 2M4GA 3OYFA 3S32A 2BOLA 4NQWB 4NC8A 2WAFA 2R7XA 4C9YA 2PJRB 3DTKA 4J00A 4B43A 1QHGA 4DIQA 4BE2A 1FMVA 4LITA 1YX5A 2R7SA 3ZXSA 4ZDOA 3IAS2 1NG6A 3PNVA 3VYRB 4ITVA 4E7JA 3VDXA 3K4CA 4XKVA 2KDOA 4HPQA 2MC4A 4U7BA 2M3AA 3C2HA 2QKLB 3VYTB 3HKZA 1W36D 2VXDA 2CH0A 4CUGA 4N4OB 2WA0A 5LFAA 3FBNB 5HOOA 5LD2C 3H9JA 4II2A 1Z7LA 4E6KG 2RNGA 3A2KA 2IS2A 4E7SA 3DQVC 4CCMA 3OS1A 1PYVA 2KRHA 3EPZA 2V4JC 2ZSIB 3CMMA 4E7LA 2E5ZA 3H5AA 3SEQA 1DQUA 1G59A 2DT7B 4XOPA 4ZDLA 2WY8Q 2JVHA 2PJRA 2MABA 4AVZA 4XMYA 4XQFA 2V7FA 3FKJA 4XORA 4CCNA 4D9JA 2VXZA 1J09A 4HNUA 2R7VA 1WJFA 1D1AA 4YELA 4B47A 2HPIA 3QOEA 2XC7A 2KMUA 3OWTA 3L2UA 2WAEA 1UG0A 2W4SA 1X4OA 4F92B 2X51A 4B3XA 3HPGA 2X6XA 2ZXIA 4XN3A 3EUKL 2OUMA 3QYEA 2IXSA 1WJ5A 1MNDA 2X6YA 2LG4A 3H5NA 2CFOA 2XF7A 4QPQA 3FHNA 4DOZA 4BACA 2V1NA 3ZR8X 3RPUD 3TMOA 1U0JA 2WBMA 1Y6IA 5CKTA 3OS0A 4PSXA 2JVGA 2HVQA 3IAM2 4Y4RA 2M0MA 4KISA 1EA3A 3ZRGA 1MW7A 3OYKA 1LFPA 2JUGA 4G6TB 3MKWB 3RTRA 2E5NA 4PFPA 5HNHA 2HNHA 3H5RA 3E1SA 2I8DA 3DTIA 3RCOA 2LC2A 4E4HA 1E0EA 2IS4A 2VQCA 2DOAA 3K4BA 1GLNA 1NG7A 1AA7A 3G2BA 3H9QA 4LG3A 4ZTJA 4BJTA 3I9V2 3PSFA 4XLHA 2BW3B 3HUGB 4II3A 4HSRA 3UNGC 3D5LA 1MMNA 2CW8A 1R6RA 3FDYA 3L2QA 5FRNA 2LYCA 4ZJZA 1BR4A 2P0WA 2XAUA 3QYBA 3E0JB 2MFZA 4XKCA 3HL2A 4IZZA 3KYLA 2MD0A 3K10A 3QODA 4IKFA 2LOOA 3CF2A 4NUBA 4F3QA 2L5QA 3OS2A 3C2GA 3OIQA 4HRIA 1LKXA 3K4MA 4KT6A 3ZGKA 2DCEA 2GOXB 1KONA 2X1EA 2HQAA 4XL9A 1LDKB 1X1AA 2HDWA 4F91B 2ZFUA 4AYBA 3OYBA 2AQFA 3K4KA 1SAUA 2OC6A 3DTEA 2K9LA 3PSIA 2ELJA 2PMZA 4BQOA 3DLAA 1WFXA 2Z2SB 3I3LA 4YRVA 4P5OA 4XLEA 3VYSB 4ANJA 3CZ6A 4JQFA 1ERDA 2XF5A 2IGNA 1D1CA 3K6GA 2ZSHB 2NOJB 4E7ZA 3CESA 1Y56A 2JA2A 4FETA 4OAZA 3PNTA 4Y3OA 1JI8A 2CW7A 2Q2EB 4C30A 1V5EA 3W2VA 1X1BA 4XNFA 2L2OA 3OR2C 3OIPA 4ZYAA 2KLOA 2VLAA 4DBQA 2KRCA 4FASD 4BEHA 2HVSA 2LRDA 2WB1A 3S8PA 3IP4B 4BU2A 2M7BA 1Z21A 3KX2A 4OAYA 4BJ6C 3AFHA 3EUHC 4DJAA 4XM3A 3PL8A 4E7HA 4BGDA 2M7AA 4BJ5C 5CPRB 4KITB 4BDZA 2Z16A 2VB6A 4LIVA 2V26A 4BQQA 2WY7Q 2L7KA 3K4JA 3CP2A 3H9GA 2R7WA 1MMGA 2L9NA 1WJBA 3OYDA 2WADA 2O5RA 4XKBA 3AL0C 2VQGA 2M4KA 2K5CA 1WJAA 2VKDA 4PUSA 4ZTFA 4GRIA 4HSTA 4ZC3A 3D5SC 1HA8A 5KNLA 4N4NB 3OL4A 3OL3A 4ZDPA 4IQJA 2BVMA 4F55A 4BDYA 3L2VA 1QU3A 3W3CA 4CCOA 4NC7A 1V5GA 2KP6A 2CV1A 3U21A 3M8JA 1OR7C 4U87A 2W82A 3K70C 2R7TA 1DGWY 1WJEA 2A5WA 1BOBA 4KJZA 2KZVA 3N05A 3S93A 2VJIA 1X1DA 3OYLA 3MD2A 3SZGA 3ZCOA 4NNJA 4R79A 3KEYA 3HOSA 3BCBA 1N78A 4BUPA 1FMWA 2LBFB 3SDBA 2VPLA 4PJNA 3ONQA 3SYTA 1Z3XA 4RM3A 4BE0A 3S3MA 2R7RA 3BLYA 4XKWA 2UV1A 3DWLE 3ZQQA 1X19A 4PK4A 1WJCA 3PJRA 3A4CA 1T95A 3M1CA 3NWSA 2VQLA 4BL0B 4CCJA 5KCMA 5KHDA 4BE1A 1D0XA 2XDVA 5JHFA 2V9KA 3QYFA 4XR6A 1BR2A 4XOTA 1X1CA 3CP8A 3MKZA 4DBRA 1VZ0A 3L2RA 3BG6A 3LSHA 4RMNA 4B48A 3OYIA 2HPMA 4D1QA 4IX7A 2W00A 3TL4X 2L9SA 3CJRB 3OYHA 3HC7A 3UR3C 4RLQA 2WAQA 5FROA 4HEA2 1P9QC 4IQ4A 2LBFA 1UAAA 1D0ZA 2XSJC 4Y33A 1W36C 1WJDA 4PSWA 4QPOA 1MMDA 2CS3A 3A1YA 2IGMA 4XONA 4B44A 3OYGA 2QKMB 2CUZA 3F9KA 4PJLA 1TZLA 2E1MB 4F93B 2CV0A 2VIXA 2K3PA 2RREA 4C2UA 2X85A 2HVRA 3DKYA 1D1BA 3RQ4A 2VJ4A 4HNTA 4JOMA 1DGRM 1MMAA 2XF6A 2K9MA 3K4LA 2W7NA 3OR1C 1LVKA 4XLCA 3LSKA 2F5VA 3OYJA 3DU6A 3NWTA 4P1WA 4PFOA 3BCAA 3FBIB 3OYAA 1YX3A 4CCLA 1YE9A 2X1CA 3LSMA 4MLOA 1PJRA 1G8XA 3BG7A 3DPUA 3H0DA 1K6YA 4H4KC 1Z3YA 4RM2A 4XN0A 2UWMA 3OYNA 4CA0A 4CH7A 2Y0SA 2E1MC 3HXLA 4BEHB 2RQQA 4OWRB 4E7IA 3PUBA 4RLFA 3HG9A 2BVLA 2LY2A 2CUJA 2MYSA 4E7KA 2F4IA 2E60A 3OMYA 3LMMA 2VKHA 3L2WA 2IS1A 1SFKA 3J7AY 4XLAA 3IUOA 2ZXHA 3W2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GOM A;  2JVG A;  2WY7 Q;  3D5R C;  2NOJ B;  3D5S C;  2WY8 Q;  2GOX B;  2JVH A; 
#chains in the Genus database with same CATH topology
 4CXF A;  2M8E A;  1IRX A;  2O3F A;  2XAF A;  4HOB A;  5TIS C;  3SFZ A;  5E18 F;  4KMU X;  3FWE A;  1VQM I;  5HLT A;  5GAE J;  1NH3 A;  3CC2 I;  1DPR A;  4MIM A;  5K7Z A;  1LDD A;  3F72 A;  4F52 A;  3GFM A;  3VSL A;  3CUQ A;  3C7J A;  2BY0 A;  1R71 A;  1D0Y A;  2L4A A;  3RDI A;  1BR1 A;  2IP2 A;  2XAJ A;  4HBL A;  2DDA A;  2XUB A;  1NHA A;  5K1Y A;  5GAH J;  4AWX B;  3TBI A;  3HBL A;  3KYD B;  4KUM A;  4QSH A;  2EFO A;  5F64 A;  4MTD A;  4NHJ A;  2L9R A;  3D5R C;  3G6E I;  2HQR A;  1ZAR A;  3QAH A;  1U3E M;  2ME0 A;  4P96 A;  3F8F A;  1TNT A;  4IO9 F;  1CQT A;  1LEB A;  4CSW A;  2K9Q A;  3NRV A;  3RSN A;  2LD5 A;  2JSP A;  2E2H J;  2GOM A;  4FQG A;  3HOW J;  2QBY A;  3W2A A;  2X48 A;  5M5Y J;  1TW2 A;  2X6W A;  4IHW A;  5TGT A;  3F6V A;  1F9N A;  2RGV A;  3GF2 A;  2NAZ A;  4EM0 B;  3EET A;  4X0G A;  5DCM B;  3V7S A;  1Y1W J;  5IYD J;  3K2A A;  2NS8 A;  1QGP A;  2KIF A;  1TLH B;  2FUG 2;  2KT0 A;  4MFE A;  3B6C A;  5LRS A;  2V79 A;  5FD6 A;  2IA2 A;  2NNY A;  3CD6 I;  2R7O A;  3LL7 A;  4IXA A;  4A3G J;  1OYW A;  2ZO4 A;  3M1E A;  1T6S A;  2IGO A;  3S3N A;  1S8N A;  4CZC A;  1R36 A;  2HYJ A;  4PJM A;  4JK1 X;  2R7F A;  3GWZ A;  5LBQ A;  1FP2 A;  3HGG A;  3HM5 A;  3K70 D;  3HUG A;  2VKV A;  2E34 A;  4UUS B;  3F8C A;  1YI2 I;  3S3O A;  4LJZ F;  1ETY A;  1MNE A;  5DEQ A;  4B09 A;  5IY5 H;  5HS8 A;  3UKG A;  5IP9 J;  4NQW B;  2FBK A;  2ECC A;  4NC8 A;  2WAF A;  1K78 A;  4C9Y A;  5HLH A;  4J00 A;  2J5O A;  3BQZ A;  1UHW A;  1MH4 A;  4LIT A;  2DYR H;  3IKT A;  1VQO I;  3TW7 A;  2CWE A;  3PNV A;  3HB9 A;  1BW6 A;  2A3S A;  5H6R A;  3E6M A;  4ITV A;  1BOA A;  1XCB A;  4A3B J;  1UHS A;  1GDT A;  3PUF A;  2KRF A;  4UY8 I;  1MSE C;  4IPA A;  3I64 A;  1TWA J;  1W0U A;  3C2H A;  2QKL B;  3CME I;  1UZC A;  4HZF A;  1QZE A;  3AG2 H;  4ESF A;  1K4S A;  2P5V A;  3KET A;  2VC1 A;  3FBN B;  5HOO A;  4OIR F;  2HEO A;  5J1R A;  1UJ8 A;  3RPU A;  2IS2 A;  1KU2 A;  1ACI A;  4D7M A;  3ZMV A;  1XSD A;  2E5Z A;  1DQU A;  3KP6 A;  3H92 A;  2EH3 A;  1IF1 A;  2DMU A;  1U5T C;  1L3L A;  3CCS I;  5JVG F;  4OMY A;  2B0L A;  4XQF A;  1FEX A;  2LSO A;  4BXU A;  4EQQ A;  5J8F A;  2JRM A;  4XOR A;  1WGX A;  2VOO A;  4CCN A;  3GTM J;  1ETK A;  4YEL A;  5EG0 B;  4G6D A;  4B47 A;  4HV5 A;  2M9H A;  3KPH A;  1WRJ A;  1ETX A;  2R3S A;  3OWT A;  4I01 A;  2VE8 A;  2W4S A;  3WGI A;  1OIS A;  2EZL A;  3HPG A;  4XN3 A;  3IWF A;  1IN5 A;  3QYE A;  3JRF A;  1HSJ A;  2DQL A;  3QQA A;  1WJ5 A;  4TV7 A;  3ECH A;  3H5N A;  1BBY A;  2CFO A;  3K2Z A;  1YOV B;  2L7M P;  3ZR8 X;  1U0J A;  3ECO A;  1Y6I A;  3BR1 A;  4PSX A;  2DQR A;  2EIK H;  3GME A;  1R49 A;  3M4O J;  2FSW A;  2H09 A;  4K2E A;  2DW4 A;  1I3Q J;  3JSO A;  2VBZ A;  4IOC F;  4A0Z A;  2BYV E;  4G6T B;  5DTD A;  3MKW B;  6PAX A;  2MW8 A;  1RIO H;  1B1B A;  4L9N A;  1MBJ A;  1SVO A;  2HNH A;  5ICG A;  2G7U A;  4OIP F;  3DTI A;  2LC2 A;  2GAU A;  1GT0 C;  4WCG A;  2DPD A;  3TO9 A;  3ZQG A;  1JTX A;  2W57 A;  3A0H C;  1DP7 P;  3IHU A;  3G2B A;  3B6A A;  5BOX A;  4BY1 J;  5F08 A;  4BJT A;  2HOT A;  1FTZ A;  3PSF A;  5B1B H;  3ZQC A;  4CYC A;  1YIT I;  4XSX F;  3HUG B;  4P55 A;  4HSR A;  3UNG C;  1R6R A;  2P0W A;  5FLX K;  5FO5 A;  2HQ5 A;  3REO A;  4A0X A;  3HL2 A;  4LG0 B;  3J81 K;  3FMS A;  2O9L A;  4IKF A;  3EYY A;  2ID3 A;  2LOO A;  1MDM B;  2HOE A;  3OS2 A;  4KN4 X;  3JTG A;  2HDD A;  3PO2 J;  4A3L J;  4HRI A;  1R4M B;  3WHC A;  1Z67 A;  1P7J A;  3T0Y A;  5B3S H;  2F2E A;  2OZ6 A;  2FML A;  2GOX B;  1KON A;  4FX0 A;  5FKN A;  4B4C A;  1SAN A;  3I5U A;  3J7Y J;  5EYR A;  1BA5 A;  5F04 A;  4EGZ A;  2K9L A;  1FSE A;  3DLA A;  1R1U A;  3TOA A;  4L0Y B;  2ZKZ A;  1HKS A;  4ASN A;  4A3J J;  2A6E F;  2JWT A;  5M5W J;  4UVB A;  1F5T A;  1YRN A;  2O7O A;  2RKH A;  1T38 A;  3RKW A;  2L02 A;  1KU3 A;  4UUV A;  4MO7 A;  1T98 A;  3I54 A;  3DLL F;  1TNS A;  3IRQ A;  3SHF A;  5E79 C;  3S1M J;  1E3H A;  1LB2 A;  4PGH A;  4Y3O A;  3OSG A;  3BPX A;  2XKP A;  2Q2E B;  3E5X A;  4HYE A;  4YFK F;  2LDU A;  3GFI A;  1V5E A;  3W2V A;  5FFX A;  4J19 A;  4D5F A;  1S72 I;  1D3Y A;  1Z6R A;  5AIQ A;  2L2O A;  1VQP I;  1LPQ A;  3OR2 C;  3OIP A;  4ZYA A;  3FZV A;  2JSC A;  2KLO A;  1JTY A;  3J7A O;  4BEH A;  3I4N J;  3ABT A;  2WB1 A;  1HF0 A;  1YJ9 I;  4ZYE A;  2QQA A;  1Z21 A;  2COB A;  4OAY A;  3GFJ A;  3TED A;  1I6X A;  1IN7 A;  2M7A A;  3ESW B;  5EGO A;  3KP7 A;  5CPR B;  5FKM A;  2R0Q C;  2O6G E;  2VB6 A;  4V2G A;  4LIV A;  5K7F A;  1GV5 A;  3FK6 A;  5DM6 F;  3KE2 A;  3HTU A;  4EV0 A;  3BTJ A;  4ABZ A;  1K7A A;  2O8X A;  2R7W A;  1BJA A;  5FB2 A;  3DEW A;  2K7L A;  4N0B A;  4XKB A;  3ERE D;  1VQ8 I;  1KYZ A;  1HC8 A;  3GZ6 A;  5IP7 J;  1S7O A;  1K78 B;  4XRS A;  1KU7 A;  3I56 I;  5E3O A;  3IH3 A;  3HRU A;  4ZTF A;  2IAI A;  1YTY A;  1OCT C;  3ABL H;  4OIQ F;  3TKY A;  3T5X A;  4ZC3 A;  3D5S C;  4BHC A;  3H3U A;  3SZP A;  3P9K A;  1YLF A;  4LK1 F;  3ASN H;  4YFN F;  4NC7 A;  4BHP A;  2Y69 H;  3TP3 A;  3U21 A;  2YPR A;  1MGT A;  1PUE E;  4HX4 A;  2F4M B;  2OU2 A;  1DGW Y;  1WJE A;  4KJZ A;  1BOB A;  1QO0 D;  1WWX A;  2YX4 A;  3S93 A;  3OYL A;  2AS5 F;  3IH4 A;  2E1N A;  2WAQ N;  1OYI A;  4RS8 A;  1HQC A;  3ZCO A;  4EM2 A;  3KEY A;  5E1W A;  2QA4 I;  2XPV A;  3DKW A;  2QGU A;  4M9Z A;  1HST A;  2VPL A;  4PJN A;  4IHY A;  2R7R A;  4XKW A;  4A3I J;  5DCM A;  1H0M A;  1ETW A;  1F1Z A;  4GFB A;  4B1R A;  3LNQ A;  5HLI A;  2ZJP F;  1ETQ A;  1NTC A;  4ENM A;  5EG0 A;  3MVP A;  5E20 A;  3NWS A;  2QEX I;  3KP3 A;  2F5D A;  5DUI A;  2YR2 A;  3LWF A;  3TDU C;  4CCJ A;  5L3B A;  1WH7 A;  3NAU A;  2VUM J;  5D5V B;  1TQM A;  1YIJ I;  3T8R A;  1R00 A;  1X1C A;  2EA2 A;  3CP8 A;  5GAG J;  3MKZ A;  3ABU A;  1YRN B;  3VEP A;  5E1Z B;  3OYI A;  2YU9 J;  1RI7 A;  3RYP A;  4UV8 A;  3FXO A;  2HPM A;  1P4X A;  3CJR B;  2ACJ A;  2XPU A;  3L09 A;  3WHB A;  1L0O C;  3UR3 C;  1YFH A;  2GA2 A;  2WAQ A;  4NQW A;  5FRO A;  4HEA 2;  4IQ4 A;  4P9U A;  2DLL A;  3FIS A;  1UAA A;  4CGZ A;  2Q2E A;  1FBS A;  4Y33 A;  3S16 J;  4GYI A;  2CS3 A;  3A1Y A;  2E1M B;  2M2E A;  4OOI A;  1LEA A;  2VIX A;  2HQN A;  2K3P A;  1I50 J;  4GO1 A;  3R6S A;  4C2U A;  2L0K A;  2MGQ A;  5DCF A;  3RQ4 A;  4Y52 J;  2VJ4 A;  1Z9C A;  3D1N I;  2E1C A;  2EIM H;  2XF6 A;  2MH9 A;  2W7N A;  4QIW N;  1IDY A;  1B6A A;  1XD7 A;  3ZMT A;  2H8R A;  1I27 A;  2F5V A;  2QQ8 A;  2W24 A;  2GZW A;  4M3G A;  1R9T J;  1EH6 A;  1J75 A;  2X1C A;  3C3W A;  2C6Y A;  3V8K A;  2GXA A;  3BTL A;  1G8X A;  3BG7 A;  3I4M J;  2FE3 A;  1Z3Y A;  3MEX A;  4GGG A;  3OYN A;  4CA0 A;  3T8T A;  4D7N A;  5GTH C;  2DT5 A;  2RQQ A;  5EEH A;  4A5N A;  1DDN A;  4E7I A;  1PVE A;  2HKX A;  2LY2 A;  1IN6 A;  5TJJ A;  3CCV I;  2KKO A;  2E60 A;  4ZYH A;  1OMI A;  1R5G A;  3O8G A;  2A6H F;  5D6E A;  1SFK A;  3C2B A;  1Y1V J;  5DYM A;  1A6Q A;  1SD6 A;  3H0G J;  3HSE A;  3IUO A;  1N25 A;  1MJB A;  1IW7 F;  1B9N A;  3F8B A;  3OOP A;  3WOD F;  4AU7 A;  4YG2 F;  1MH3 A;  1R1V A;  2V6E A;  1IDZ A;  2QWW A;  4BQN A;  1JE8 A;  4A3D J;  2DA2 A;  1RET A;  3MFK A;  4LIU A;  3D0S A;  3F0C A;  2AXL A;  5ILV A;  2CV2 A;  2F6C A;  4S04 A;  3HHG A;  2NS0 A;  4M6X A;  1PUF B;  4YEJ A;  2PI0 A;  1TQI A;  3I0T A;  3QU6 A;  3WTZ A;  4OIN F;  3LQR A;  1EKE A;  3CCR I;  1X3W B;  3I53 A;  5TRD A;  1TT0 A;  4ZH4 F;  2OCC H;  3LFU A;  2VL8 A;  3DEE A;  5GP9 A;  5BPI A;  1WSU A;  2LFB A;  3OSF A;  5KK1 A;  3OYE A;  3S15 J;  2J5P A;  1IV8 A;  2VJJ A;  3HSF A;  3DKX A;  5HNF A;  3CCQ I;  2LTP A;  4BXF A;  1SMT A;  3I59 B;  3JRH A;  2KL4 A;  2OAZ A;  4AYB N;  2EFQ A;  2KQR A;  3DPT A;  3AKZ A;  4BXX J;  2R4G A;  4Q47 A;  1TQP A;  4CYC B;  1FY7 A;  5CVU A;  1ITY A;  3VSK A;  4QWQ A;  3PIO F;  3LAP A;  3O6B B;  4U0V A;  1JUP A;  4PJ0 C;  4C3J J;  3VWB A;  3CUO A;  4UB8 C;  3W6K B;  4C2T A;  1V5F A;  2G9W A;  4L9T A;  3TO7 A;  4L5I A;  3JAM K;  1YS6 A;  2LH9 A;  5HVQ C;  1OR7 A;  3HZJ A;  3HOY J;  1SVM A;  5LRR A;  3WTV C;  3VFZ A;  1Z77 A;  1XDU A;  2IA0 A;  3J7Z I;  3H1C A;  3LFK A;  5EJC A;  1XGM A;  3RKX A;  4A5M A;  1FP1 D;  3C1D A;  4YFX F;  1BN5 A;  3VOD A;  4LOC A;  2ZC2 A;  4RAF A;  2BXY A;  1DU6 A;  1TTY A;  3VYU B;  3PM1 A;  1ZYR F;  2VAS A;  2V9V A;  2DTZ A;  4I76 A;  2E7X A;  3DU5 A;  3A03 A;  3S1R J;  4WX9 A;  3CMA I;  5GTI C;  3OIO A;  2JT1 A;  1GV2 A;  4NDL A;  2VN2 A;  5BS6 A;  1G3S A;  2MSY A;  2E2I J;  5IYC J;  1JT6 A;  3W6J B;  2MC3 A;  3DTK A;  3CCM I;  3R0A A;  4G12 A;  4DIQ A;  4BE2 A;  1IN8 A;  2M8G X;  4XID A;  5JLX A;  2HWV A;  3WG9 A;  2ZCW A;  4LLN A;  3FXU A;  3ZXS A;  2R7S A;  5EZG A;  1T2K A;  4UXN A;  1SD5 A;  4IVN A;  3CCJ I;  3CJN A;  4E7J A;  1B8I A;  3BPV A;  2NVU B;  1R5I D;  4XKV A;  3TGN A;  2KDO A;  1WPK A;  3CLO A;  1ODD A;  1BI1 A;  1CGP A;  4MQV A;  2MC4 A;  1PDN C;  1W36 D;  1R23 A;  2UXN A;  4LLL A;  3Q9V A;  3BJA A;  1LE8 A;  4KIC A;  5LFA A;  2LF7 A;  3U9G A;  2LKP A;  4MGR A;  4II2 A;  4E6K G;  1IJW C;  3RJP A;  2PN6 A;  4E7S A;  3OS1 A;  2Y48 A;  3L1P A;  2NYX A;  3EPZ A;  4I09 A;  1U8B A;  2V4J C;  3CMM A;  4I02 A;  3SEQ A;  2QEN A;  2MAB A;  4AVZ A;  1ETO A;  1AKH A;  1MD0 A;  1D8K A;  2HYG D;  5D5U B;  1APL C;  3IV5 A;  4HNU A;  1J09 A;  1YW7 A;  3JAM Z;  2R7V A;  1WJF A;  1D1A A;  5BQT A;  2ZME A;  2V1D A;  3EUH A;  3FXQ A;  2XC7 A;  1WH5 A;  5ILS A;  1B72 B;  3GTL J;  2KMU A;  4XRF A;  3L2U A;  1TL8 A;  2VBW A;  3WTY C;  4EJO A;  1LFU P;  3DFG A;  1UG0 A;  2DK5 A;  2ISZ A;  2OD5 A;  5CLS A;  1HKT A;  2DFF A;  1ZK8 A;  3GTP J;  3GTG J;  3EUK L;  4RBO A;  2FBH A;  2HKO A;  2KJB A;  2FQ4 A;  1HXD A;  1MZB A;  3IH2 A;  3TW6 A;  3QRF F;  4QTR A;  2CSO A;  1JKO C;  4FCY A;  1JT0 A;  1S6L A;  2JN6 A;  2XF7 A;  1S3J A;  4QPQ A;  1R1T A;  1RES A;  4HX8 A;  4DZJ A;  1DPU A;  1EH7 A;  3M07 A;  1ETV A;  1KQ8 A;  1ULY A;  1MJ9 A;  2WBM A;  5CKT A;  1TC3 C;  4Y4R A;  3S2H J;  3ZRG A;  5ICE A;  2DBB A;  2OJE D;  1FOK A;  5ILU A;  1O3T A;  4PFP A;  4F7Z A;  5HNH A;  3H5R A;  3FHZ A;  3JRA A;  4E4H A;  2LR8 A;  2AO9 A;  3LSP A;  1E0E A;  4M9X A;  2DOA A;  4MNU A;  1GLN A;  2EIN H;  2BE5 F;  3WU2 C;  2K3F A;  3NAR A;  1OJL A;  5C44 J;  1QPI A;  1W7P B;  4ZTJ A;  3BT9 A;  2FD5 A;  4Z2Y A;  2VC0 A;  1QQI A;  1X58 A;  1W7P D;  5EZH A;  4O3M A;  3HGY A;  1O4X A;  1UMQ A;  1R5H A;  3D5L A;  1MMN A;  3FDY A;  4ZJZ A;  2ELH A;  2XAU A;  2L01 A;  2MFZ A;  3E0J B;  4IZZ A;  1USS A;  1JJ6 C;  3KYL A;  2MD0 A;  1HW2 A;  3CCL I;  3K10 A;  1FNN A;  3G1M A;  1IN4 A;  2L5Q A;  1H8A C;  3E6C C;  5LEK A;  1BJZ A;  3OIQ A;  3WG7 H;  4KT6 A;  2M0C A;  1G3T A;  3SZT A;  4JP0 A;  4RGX A;  3ZGK A;  4HF2 A;  3EDP A;  1P92 A;  1WI9 A;  2PG4 A;  1MBK A;  1LDK B;  1U5T A;  3WTX C;  2PEX A;  2QVO A;  4NBQ A;  5L3G A;  3HOV J;  3OYB A;  1Q1H A;  1RUO A;  5JFR A;  1SAU A;  4XK4 A;  3HOZ J;  1B8I B;  2ELJ A;  2OBP A;  1SFO J;  3F3X A;  2Z2S B;  1LDJ A;  3CCE I;  1OCP A;  2DMN A;  2DOF A;  4YRV A;  2JA6 J;  1ZKG A;  1E3P A;  4GCV A;  3VYS B;  2TCT A;  2XAQ A;  3M8E A;  3AAF A;  1CF7 A;  5D4R A;  3ZQL A;  1ZH5 A;  2CYY A;  1ERD A;  1XX5 A;  2IGN A;  1FLI A;  2FNP A;  3FF5 A;  5FFZ A;  2P7V B;  1KU9 A;  1NK2 P;  1F4K A;  1Y56 A;  5DDG A;  5J4V A;  4OAZ A;  1I3A A;  5AIP A;  1JI8 A;  3BG5 A;  1XGO A;  3KCC A;  3ZMZ A;  4A3F J;  2VOD A;  2MD5 A;  2YX7 A;  4AC0 A;  2R5Y B;  1X3Z B;  5FKO A;  1GVJ A;  1GHC A;  3CJT B;  1FOW A;  2DA6 A;  4FTH A;  2DMT A;  3BDD A;  2HVS A;  1ONV A;  5LHH A;  1IXS B;  3S8P A;  2M7B A;  3A02 A;  3ZQ7 A;  3P9C A;  1T56 A;  2DI3 A;  2ZME C;  3EUH C;  2F5F A;  4E7H A;  3TOB A;  2JTV A;  4BGD A;  1U2W A;  3K1P A;  2EWN A;  4A3C J;  4BDZ A;  4RGS A;  4AM3 A;  4HV6 A;  1IZ1 A;  2WC2 A;  4BQQ A;  2Y30 A;  2WY7 Q;  4HF0 A;  4IHT A;  1TWF J;  2L7K A;  3K4J A;  2GLO A;  3CP2 A;  1J5Y A;  2DK8 A;  1MMG A;  2V1X A;  2L9N A;  2WTE A;  4L9J A;  1IXR C;  1WQ2 A;  5CVI A;  1VQ9 I;  2JUC A;  2WAD A;  3RIR A;  3KYC B;  2VQG A;  2K5C A;  3QPS A;  2BBY A;  3IL2 A;  1NK3 P;  3CTA A;  1U78 A;  1VQK I;  1J7K A;  2VKD A;  1T39 A;  4GRI A;  2OQG A;  1ZHF A;  3E6D A;  2HFH A;  1FC3 A;  4AID A;  3FM5 A;  3V4G A;  4ZDP A;  1MMS A;  2BVM A;  4BDY A;  3L2V A;  2QSG X;  2P5L C;  3RKY A;  4C2M J;  1QU3 A;  3B73 A;  1U8R A;  2STT A;  4CHU A;  1BL0 A;  2E2J J;  5CVR A;  2KP6 A;  1J2X A;  1O57 A;  4GXO A;  1JUM A;  1A6I A;  4I0B A;  3BOQ A;  1ZLK A;  2BY1 A;  1H9G A;  3F8M A;  2ECB A;  2R7T A;  3ZQH A;  2X6O A;  1VI0 A;  2VJI A;  3JRG A;  3I59 A;  3VB2 A;  4R79 A;  4V19 K;  1V4R A;  1N78 A;  1K83 J;  1U6G A;  1RKT A;  2LBF B;  1O3S A;  3SDB A;  4CYD A;  3SYT A;  4RM3 A;  1W5T A;  2ZXW H;  3BLY A;  2UV1 A;  2HTS A;  4MHG A;  4A12 A;  4A6E A;  4LFU A;  3BR3 A;  3TP0 A;  2H6B A;  4ENJ A;  1FIA A;  5J3L A;  2IT0 A;  3G4S I;  1WJC A;  3PJR A;  4IRI A;  2BHY A;  3OV8 A;  3I58 A;  4LD5 A;  3K1M A;  4BE1 A;  3KEQ A;  1D0X A;  3CO7 C;  4HLY A;  2WV0 A;  1JXS A;  2V9K A;  3QYF A;  1A04 A;  2EIL H;  1BR2 A;  1HDP A;  4XR6 A;  4D0P A;  5LGN A;  3ZN1 A;  2CW0 F;  4OU0 A;  4LLG F;  3L2R A;  1R4N B;  2YU3 A;  1LFB A;  5IPA A;  5D5W B;  4IX7 A;  3BZK A;  2L9S A;  2A69 F;  3QWL A;  3M3Y J;  2D2W A;  3BR0 A;  4EVI A;  2LMD A;  4HQM A;  1H89 C;  2LBF A;  4KNY A;  1TBX A;  5A2Q Z;  2DA4 A;  2DA3 A;  1MMD A;  2B7E A;  4XON A;  3GO5 A;  3G1O A;  2BY3 A;  4F93 B;  2EPF A;  2GA1 A;  2FF4 A;  3I4P A;  5FLX Z;  3L00 A;  1U9O A;  3IRR A;  1HW1 A;  2RN7 A;  1BI0 A;  3HOX J;  1MMA A;  2XGD A;  2K9M A;  3K4L A;  2CFX A;  3MN2 A;  3OR1 C;  3WE2 A;  4M6V A;  4UHT A;  2EFP A;  3GFL A;  3F22 A;  3DU6 A;  3H3Z A;  2M34 A;  3FBI B;  2XRO A;  3OYA A;  1W0T A;  1EJ9 A;  3ABK H;  4CCL A;  1YE9 A;  4MLO A;  5EF6 A;  2JA7 J;  1PJR A;  1QA6 A;  1Y8R B;  4LB6 B;  4XN0 A;  4RM2 A;  2CG4 A;  3ASO H;  2R7Z J;  1MSF C;  2Y0S A;  4BEH B;  4BBR J;  4CO8 A;  2R93 J;  1IUY A;  3E97 A;  2LLK A;  2JPC A;  2BVL A;  1S7A A;  4E7K A;  2ADU A;  3LMM A;  5KVR A;  2MG4 A;  5FD5 A;  2IS1 A;  3MZH A;  2XPW A;  2HZT A;  2ZXH A;  2TDX A;  2PMU A;  5J4Y A;  1B72 A;  4V2F A;  1ZN2 A;  4HDU A;  2JK3 A;  5D8K B;  4UUT A;  3RKQ A;  4DW6 A;  2QCO A;  5FRM A;  2DOE A;  1I1S A;  3CDI A;  2PJP A;  2R7Q A;  2VQH A;  2XVC A;  4DNC A;  3HRM A;  2VE9 A;  3LAJ A;  2AHQ A;  3MMY B;  2FQ3 A;  3WU0 A;  4KYW A;  2X0L A;  1FBQ A;  5E8G A;  4J01 A;  1T33 A;  2HZD A;  3OOU A;  2DA1 A;  3SQN A;  1G4D A;  3DPL C;  3GZ5 A;  5IOZ A;  3WGH A;  1IUF A;  1N75 A;  2R5Y A;  3LA2 A;  2K9S A;  1MBE A;  2W25 A;  3V7R A;  3MZY A;  2E19 A;  1T0F C;  2Y0M A;  2A6T A;  3R60 A;  3SJM A;  1UEL B;  4I2O A;  5HLG A;  2IPQ X;  1OLT A;  5C4X J;  1S5L C;  4I6Z A;  2CQK A;  3H35 A;  3O8H A;  3KZI C;  1JKP C;  3BWG A;  3G73 A;  4RAG A;  3ZPL A;  2W1O A;  2K9N A;  2OV7 A;  3CUQ B;  4D5C A;  1GXP A;  5HOD A;  2IS6 A;  3MKY B;  4EJW A;  5ERI A;  4DYC A;  2OA4 A;  1M1E B;  3IKV A;  4KIG A;  4ETS A;  3M8F A;  3A01 A;  3S14 J;  3LQQ A;  3FXJ A;  4BY7 J;  1N77 A;  2DTR A;  3LSG A;  2DOD A;  1YHQ I;  2HXO A;  2K40 A;  1VF9 A;  2LKS A;  2UUZ A;  4CIC A;  1Z7U A;  5CQE A;  3A0B C;  5J40 A;  4AIJ A;  3ML6 A;  4CZZ A;  3WTU C;  2X1D A;  2CU7 A;  2FXA A;  2DJI A;  5JR3 A;  5EGO B;  2HXI A;  2KPM A;  3QPL A;  1LJ9 A;  1OCR H;  4M73 A;  3TDZ C;  4U0Y A;  3G71 I;  1JGG A;  2CMP A;  1YW9 A;  3KZY A;  1OKR A;  3GZN B;  4HG2 A;  1D5Y A;  1VQ6 I;  2Z1D A;  4AIK A;  3OYF A;  1VND A;  3BJ6 A;  4G7H F;  1FYM A;  3DP7 A;  3X2Q H;  4IHS A;  3L7W A;  1Z6T A;  2LF8 A;  4IOA F;  2DO7 A;  2R7X A;  4I99 C;  3JRC A;  3BTC A;  3J80 Z;  2QF7 A;  3R61 A;  1MIJ A;  1FMV A;  2IEK A;  1YX5 A;  2PFB A;  4L5E A;  4M3B A;  1REP C;  3KIO A;  1SMY F;  3FMR A;  2XSD C;  3JW4 A;  2CQ7 A;  2R5Z B;  4ZDO A;  3IAS 2;  4Q48 A;  2QYO A;  3VOE A;  1RNL A;  5JHU A;  2CQN A;  3K4C A;  4U88 A;  3ISP A;  4HPQ A;  2VPR A;  1TP4 A;  4KMF A;  1UCR A;  4U7B A;  1LQ1 A;  5J8C A;  4KDP A;  1VQN I;  1H88 C;  1BIB A;  1ZAO A;  2FOK A;  1W5C C;  3HKZ A;  4IEJ A;  1QZY A;  2VXD A;  2G7H A;  2GM4 A;  1EH8 A;  4N4O B;  4WF2 A;  5J1Y A;  3COA C;  4LMY A;  3SFI A;  3FM3 A;  2VBX A;  3AG3 H;  3H9J A;  1Z7L A;  2RNG A;  5D5X B;  2I10 A;  2K02 A;  2KRH A;  2ZSI B;  3CC7 I;  4OIO F;  3H5A A;  4C3H J;  2K4B A;  4EJV A;  2DT7 B;  3CCU I;  3F23 A;  2JVH A;  2VOP A;  1YO5 C;  5F6F A;  2P6T A;  1E17 A;  1R7J A;  2DA7 A;  2WWY A;  1LVA A;  2ZJQ F;  2OCE A;  2H27 A;  1IGN A;  2FX0 A;  3FKJ A;  3P7N A;  3GLL A;  4D9J A;  2VXZ A;  1YIO A;  2R5Z A;  1E3O C;  1J0R A;  2RDP A;  3QOE A;  1S7E A;  4M3D A;  2ESH A;  2XGC A;  1YQA A;  2XRN A;  3JRE A;  4HDV A;  1SD7 A;  3RYR A;  4F92 B;  2X51 A;  4B3X A;  1ZTR A;  3CDL A;  2O8K A;  2X6X A;  1OCC H;  1RPW A;  4ZZD A;  2Q8K A;  3LOC A;  2EV0 A;  4YIR X;  2QM3 A;  1SVL A;  3QP6 A;  2Z9O A;  1MND A;  2GQQ A;  3F6O A;  3B02 A;  3RPQ A;  2CUF A;  2X6Y A;  5L3E A;  5ICF A;  1SEU A;  4DOZ A;  1PUF A;  2V1N A;  3Q0V A;  4E70 A;  3G3Z A;  3JCU C;  3OS0 A;  3F21 A;  2JVG A;  3BR6 A;  3IAM 2;  4XRM A;  2R92 J;  1X3U A;  2ZXJ A;  3LSJ A;  1V3F A;  1MW7 A;  4GDF A;  1U9N A;  3A01 B;  3RTR A;  1DU0 A;  2NOG A;  1Y0U A;  4EGY A;  2VT3 A;  1P2F A;  2DYS H;  2O0Y A;  2VQC A;  4IF4 A;  1WI3 A;  2JJ7 A;  1FYL A;  3WTT C;  3BG3 A;  4R1H A;  1XSX A;  1G6N A;  2BHZ A;  1BM9 A;  5L3C A;  5C4J J;  1W1W E;  3LA7 A;  1P6R A;  3HYI A;  2EZI A;  3J81 Z;  1BIA A;  3I9V 2;  4XLH A;  5DS9 A;  4G9Y A;  2K27 A;  5B66 C;  3RZO J;  2K86 A;  2BW3 B;  5HS9 A;  1ON2 A;  2NRA C;  2CRG A;  1B9M A;  1T8I A;  4II3 A;  3R4K A;  1K61 A;  1WKM A;  5ICC A;  3L2Q A;  1IC8 A;  5FRN A;  2LYC A;  4PGG A;  1BR4 A;  3HRS A;  3BY6 A;  2HGC A;  4XKC A;  5CVJ A;  1IG7 A;  3RQI A;  3SDG A;  4HNV A;  3KLO A;  3QOD A;  4L9V A;  3CF2 A;  3C2G A;  2W84 A;  4EMS A;  3CLQ A;  4JX4 A;  3LA3 A;  3CO6 C;  4BBS J;  2B9S A;  2HQA A;  3O3K A;  1X1A A;  4ON0 A;  3BJO A;  2ZFU A;  3K4K A;  1JUS A;  4XLN F;  1I39 A;  5IOY A;  2PMZ A;  3FX3 A;  4ENK A;  2BGC A;  3ZMD A;  1XG1 A;  2M45 A;  4P5O A;  1UG2 A;  1E2X A;  5IT9 K;  1V54 H;  2QSH X;  2L3D A;  2E1O A;  2G0E A;  4ANJ A;  4BYY A;  4JQF A;  1IRF A;  2XF5 A;  1Z1D A;  3RI4 A;  3CMY A;  2ZSH B;  2NOJ B;  1YW8 A;  1FBU A;  3CES A;  3HHH A;  3BR2 A;  5H6Q A;  4HLX A;  4FET A;  2Y9Y A;  3PNT A;  4ZYG A;  3KP4 A;  1D8J A;  2P81 A;  4ESJ A;  2O61 A;  2HYF A;  2FJ1 A;  5J47 A;  3S2D J;  1AOY A;  3TO6 A;  4H0E A;  1ZRC A;  2VLA A;  4DBQ A;  5JLW A;  1IO2 A;  2E7W A;  3WTW C;  5D8L B;  2LRD A;  3BZC A;  4HA8 A;  5D4S A;  3IP4 B;  1HBX G;  3KX2 A;  2P4W A;  4XBF A;  1IAW A;  2EQR A;  4RB1 A;  4BJ6 C;  3AFH A;  5DV5 A;  5E3N A;  3ELK A;  1ON1 A;  3JRB A;  2GXG A;  1V55 H;  4JX5 A;  4KIT B;  4RAZ A;  4MEX F;  2YSR A;  4O6J A;  1XN7 A;  3PQK A;  2MA3 A;  3CQZ J;  2JRT A;  4JX6 A;  3GTK J;  2VKE A;  2P8T A;  2LY9 A;  3KFW X;  3L2C A;  2L54 A;  1FX7 A;  2IJL A;  2O5R A;  3P5J A;  3AL0 C;  5F0C A;  1MBH A;  5LHG A;  5LEJ A;  3AG1 H;  3ZQF A;  4PUS A;  3T1B A;  2XKO A;  4HST A;  1OFC X;  1ZRD A;  2XGE A;  3GEZ A;  4B8X A;  2PMZ N;  2H1L A;  4M6Y A;  2FOW A;  4F55 A;  1WVR A;  4EEF G;  3WE3 A;  4LB5 A;  2JQ7 A;  4HF1 A;  3U2R A;  4BAY A;  1V5G A;  1XMX A;  5J6X A;  2CV1 A;  3BZ6 A;  2XV4 S;  2HR3 A;  2KFD A;  3HKZ N;  3HRT A;  1OR7 C;  1LUJ B;  4U87 A;  1TT5 B;  3K70 C;  2ME6 A;  2FMY A;  2A5W A;  2MH2 A;  4FT8 A;  3ROU A;  3N05 A;  1S29 A;  5EDN A;  5K7H A;  1X1D A;  2D1H A;  3MD2 A;  3SZG A;  1XGN A;  3WU1 B;  1I1G A;  2NNN A;  3BCB A;  3Q0W A;  2JA8 J;  1OCZ H;  4BUP A;  3GTJ J;  2KDZ A;  2HOS A;  2A05 A;  5DD4 A;  2XAG A;  2JPB A;  3ONQ A;  1T08 B;  2V6C A;  5FLM J;  3NQO A;  4RA2 A;  1FTT A;  2A68 F;  3ZP5 A;  3QU3 A;  2QLZ A;  3ZQQ A;  4XIC A;  1MKM A;  5CYV A;  4EJT A;  1YJN I;  4RGU A;  4PK4 A;  1A31 A;  2Y75 A;  1B59 A;  3KZZ A;  3A4C A;  3MAJ A;  1T95 A;  4U0W A;  2VQL A;  1VTN C;  3LSR A;  5KHD A;  1FT9 A;  1Y39 A;  2XDV A;  1JGS A;  3BR5 A;  3WGG A;  1WHU A;  1FOY A;  2A5Y B;  2FU4 A;  2WV1 A;  4O5V A;  4XOT A;  4Y17 A;  3NEU A;  4XRS G;  1VZ0 A;  3JSP A;  3K1N A;  2UZK A;  3QPT A;  2IA1 A;  1UFM A;  4MEY F;  3K0L A;  2VON A;  4L0Z B;  4UUS A;  4KIF A;  2W00 A;  1BC7 C;  4QLC U;  2M87 A;  5FJ8 J;  3HC7 A;  1RUN A;  4RLQ A;  1TWC J;  2KIU A;  1XCV A;  1H9T A;  5LGT A;  1P9Q C;  4BQA A;  3HDD A;  2NXN B;  2L4M A;  3BP8 A;  5IYB J;  1YYV A;  1QVU A;  2E36 A;  3M9A A;  3TQN A;  1W36 C;  1WJD A;  3FK7 A;  4QPO A;  1XSV A;  4XLP F;  1XPX A;  1G3Y A;  4B44 A;  2QKM B;  2CUZ A;  3F9K A;  4G6Q A;  1TZL A;  2HI3 A;  1AWC A;  3E3V A;  1X1P A;  2EJR A;  5K5R A;  2CV0 A;  3S17 J;  2HVR A;  3DKY A;  2JA5 J;  5FGM A;  2QZ8 A;  1DGR M;  3SXY A;  2BV6 A;  1ZRE A;  3S2W A;  1G3W A;  4XLC A;  3BQY A;  2F4O B;  3NWT A;  4BHB A;  5DM7 F;  5FLV A;  4PFO A;  2DPU A;  4IL6 C;  1F43 A;  1A35 A;  4HX7 A;  3MKL A;  3S1Q J;  3LSM A;  3Q9S A;  2QQ9 A;  2RV8 A;  3FKI J;  5B1A H;  3H0D A;  1KZH A;  1K6Y A;  2EFN A;  5JI6 A;  2JMW A;  2XRL A;  4RB3 C;  3H36 A;  3HXL A;  1HOM A;  2CQX A;  5E17 F;  1P4A A;  1R22 A;  4RLF A;  3CDH A;  2FRH A;  1YJW I;  2CJJ A;  4RB2 C;  2MYS A;  2AXT C;  2F4I A;  3DEU A;  5L3F A;  3FXL A;  4FIS A;  1X2N A;  5GPA A;  3HIF A;  5H2F C;  3J7A Y;  3P9I A;  4G7Z F;  2COM A;  4XLA A;  4IHX A;  5J1U A;  4Q5S F;  2QUF A;  3AL0 B;  4U7D A;  2OZU A;  5LHI A;  3LSI A;  4EAT A;  3QP5 A;  1AHD P;  4PJJ A;  1GXQ A;  1HLV A;  2L9V A;  2XB0 X;  1VQ5 I;  2BZT A;  4ZZL A;  2DXI A;  2EA4 A;  1K6O A;  3PFY A;  1VQ4 I;  1A5J A;  3KP2 A;  1X4P A;  3L9F A;  3CUQ C;  2H94 A;  4M9S A;  1XMA A;  1QHH D;  2D45 A;  1ZR4 A;  3FXK A;  2R7U A;  2DT6 A;  1DP3 A;  3H3V K;  2ZME B;  1KA8 A;  1T0F A;  3PFI A;  2Q1Z B;  3BC8 A;  5FKK A;  4KT5 C;  1SAX A;  4KN7 X;  1Y8Q B;  5BNG A;  4CCK A;  3OYC A;  1CF7 B;  1RR7 A;  3SEZ A;  2ZNZ A;  4XLF A;  2ZJ2 A;  5CQG A;  2LKX A;  1QBJ A;  2LK2 A;  3K4N A;  1DUX C;  4DGW B;  4RGR A;  3OYM A;  5HDK A;  3HOT A;  5E3M A;  2XAH A;  1FJL A;  3EYI A;  4GYG A;  3DBR B;  3CJQ B;  3PNY A;  2VJ5 A;  1K4T A;  2BY2 A;  2HU9 A;  2BW3 A;  1ZEL A;  2XGX A;  1GVD A;  2F5E A;  1W4M A;  4YII A;  2P7C B;  4BH9 A;  3GTO J;  4IRH A;  1FZP B;  1MJA A;  3I71 A;  3WTS C;  1Y0N A;  5AON A;  1MDM A;  3GBG A;  1S9H A;  2M1B A;  3OY9 A;  3HPH A;  2DFH A;  1O7F A;  1F36 A;  1FWZ A;  2P6S A;  2IGK A;  1B4A A;  2PMH A;  4A3E J;  2LY1 A;  4BS9 A;  2KJC A;  2LRE A;  3PIP F;  4I7H A;  5K5Q A;  2KHM A;  2LNB A;  2IRF G;  5K5O A;  2AQE A;  2TRT A;  5IT9 Z;  5M3M J;  3HOU J;  2HS5 A;  3EUA A;  3FMQ A;  1KGS A;  2M5W A;  5E8I A;  2MLK A;  2E71 A;  3CF5 F;  3V42 A;  1XC5 A;  4CDG A;  2M4G A;  2DFE A;  3S32 A;  2BOL A;  3CC4 I;  1R58 A;  3U1D A;  2ZB9 A;  5C3E J;  2Y31 A;  1QNT A;  4NB5 A;  4WWC A;  2Z5U A;  2PJR B;  2OTJ I;  4BNC A;  3BRO A;  1ZLJ A;  3V8L A;  4WXC A;  4B43 A;  1QHG A;  3S1N J;  2GBY A;  4WXD A;  1Z0X A;  4UVC A;  4S0H B;  1QVT A;  3MQ0 A;  1VQL I;  4Y15 A;  3F8N A;  1UHM A;  3GCM A;  2RQP A;  4EJU A;  2DDB A;  1NG6 A;  3KEO A;  2CUE A;  3DXJ F;  1SFE A;  3LST A;  3VYR B;  2ZNY A;  3VDX A;  5L3D A;  3Q3S A;  4HAM A;  2XHK A;  3PQJ A;  1O3Q A;  2L7Z A;  2XIG A;  2QQB A;  1FSH A;  1RZ4 A;  2M3A A;  4UB6 C;  3VYT B;  3GXO A;  2CO5 A;  4JYK A;  2CH0 A;  4CUG A;  2Y0S N;  4PZJ A;  2WA0 A;  1IRZ A;  4M3E A;  4C3I J;  5LD2 C;  1POG A;  3V7C A;  1FOX A;  5FKL A;  1BI3 A;  5A2Q K;  2OPT A;  3JRI A;  4R8H A;  3A2K A;  3DQV C;  4CCM A;  1RRJ A;  1PYV A;  3E5U A;  4E7L A;  3QOP A;  2OTL I;  1G59 A;  5DD8 A;  1D5V A;  3JTH A;  4XOP A;  4ZDL A;  2WY8 Q;  2EFW A;  2PJR A;  3GUD A;  1RC9 A;  4XMY A;  2V7F A;  4PCQ A;  4RB0 A;  5LLQ A;  1O7L A;  5JVT A;  3C18 A;  2W48 A;  2HPI A;  1JKR C;  3E7L A;  4IJA A;  4B3A A;  1ZGA A;  2D1V A;  2WAE A;  5F0H A;  1X4O A;  2DU9 A;  4DZP A;  2NVT J;  2ZXI A;  3JR9 A;  2OUM A;  2Y2Z A;  2IXS A;  2PLY A;  2H6C A;  3MWM A;  1YG2 A;  2LG4 A;  2JZY A;  3FHN A;  4BAC A;  3FIW A;  1MBG A;  3RPU D;  3TMO A;  5KAI C;  2FEZ A;  3GYH X;  1J9I A;  3CCY A;  2F48 A;  2W85 A;  2HVQ A;  4LK0 F;  3J80 K;  3V8J A;  3W6V A;  2M0M A;  1XDS A;  4X6A J;  1W5S A;  3MZ8 A;  1EA3 A;  4KIS A;  1QZZ A;  3OYK A;  5BMZ A;  1LFP A;  2JUG A;  3R0J A;  3KLN A;  2E5N A;  1OQY A;  4FHT A;  5F27 A;  2OF7 A;  4AVP A;  3E1S A;  3KP5 A;  2I8D A;  3RCO A;  2IS4 A;  3K4B A;  1PP7 U;  1JHH A;  2RAE A;  4OMZ A;  1I5Z A;  1NG7 A;  1UST A;  1AA7 A;  2P5K A;  2A61 A;  3H9Q A;  1Z91 A;  5M5X J;  2DJN A;  4LG3 A;  1O3R A;  2QBY B;  2RVC A;  2BEO A;  4WXH A;  1K79 A;  4Q4Z F;  2VI6 A;  1MBF A;  2CGP A;  2DMQ A;  4MQ9 F;  2F5C A;  3GX4 X;  2CQQ A;  2K85 A;  1ZGW A;  2CW8 A;  1WCM J;  4ENN A;  3QYB A;  2WB1 N;  2OQR A;  3RZD J;  4W97 A;  1SFU A;  1HCR A;  4NUB A;  4F3Q A;  5B5E C;  4FE7 A;  2N8G A;  2KIM A;  4Z6Y A;  1LKX A;  2Z99 A;  3K4M A;  1LNW A;  4A2U A;  2Q0O A;  2A07 F;  4KFC A;  2LVS A;  3HTS B;  2DCE A;  2X1E A;  3ULQ B;  2PQ8 A;  4XL9 A;  2FNA A;  2ETH A;  2HDW A;  4F91 B;  4AYB A;  4W1U A;  5F0F A;  2AQF A;  3DTE A;  2OC6 A;  4IHV A;  3PO3 J;  3PSI A;  5CJ9 A;  4BQO A;  2H8W A;  1J59 A;  1WFX A;  3I3L A;  5H20 A;  2HOA A;  2HDC A;  2RNJ A;  5D6F A;  4XLE A;  2B63 J;  3GLX A;  2XAS A;  4G7O F;  1P7I A;  3EQL F;  3ZMS A;  2NVY J;  3CZ6 A;  5E3L A;  2H1K A;  2EBI A;  1AU7 A;  1D1C A;  3K6G A;  4M3F A;  1ZG3 A;  2EIJ H;  4E7Z A;  1I6H J;  2YS9 A;  1Q1V A;  2JA2 A;  1SC7 A;  2V9P A;  3M7G A;  3FXR A;  2MLG A;  1SFX A;  3HJE A;  3HEF A;  2CW7 A;  3N4M A;  2R7D A;  3E5Q A;  1OYY A;  4IRG A;  3O2P E;  4C30 A;  3ZOB A;  3GVA A;  1P4W A;  1HDD C;  2LP0 A;  4UV9 A;  1AKH B;  4G8X A;  1TW3 A;  1X1B A;  2L7F P;  4XNF A;  1XGS A;  2ZJR F;  1WZ2 A;  5BPD A;  2BXZ A;  3DV8 A;  2KRC A;  4FAS D;  2GWR A;  4A3K J;  1SD4 A;  2K4J A;  1FPQ A;  5GAD J;  3IWZ A;  4BU2 A;  4M72 A;  1FYK A;  2DA5 A;  4MFD A;  1ORK A;  4DJA A;  4XM3 A;  3PL8 A;  4KA4 A;  2NVX J;  4BJ5 C;  1BI2 A;  2Z16 A;  4RAY A;  1KQ0 A;  4A3M J;  3ERM A;  2YUS A;  3ZN0 A;  2V26 A;  4AD9 A;  5LGU A;  4HQE A;  5M3F J;  3ZMU A;  2MBF A;  3H9G A;  2EK5 A;  3K7A J;  1WJB A;  3OYD A;  3Q5F A;  1XMK A;  4NC6 A;  2M4K A;  1EF4 A;  1ENH A;  4M74 A;  4DYR A;  4FE4 A;  1C0W A;  1WJA A;  1ZG1 A;  4FX4 A;  1IXC A;  4DQ2 A;  5HDG A;  1HA8 A;  2E35 A;  4N4N B;  4X1E A;  5KNL A;  3OL4 A;  3OL3 A;  4IQJ A;  1PP8 F;  3K69 A;  2GXB A;  3DBH B;  3FXM A;  1XB4 A;  3VPR A;  1W7P A;  4I0A A;  1STZ A;  3W3C A;  2FBI A;  4CCO A;  4A93 J;  1OCO H;  1IRG A;  2O03 A;  2IVM A;  3M8J A;  2DFI A;  2W82 A;  2NVQ J;  4DYQ A;  4M71 A;  1ZRF A;  2KZV A;  2EV6 A;  2PBI A;  1FIP A;  1LE8 B;  4G94 A;  2Y9Z A;  3K9T A;  4AIH A;  4JBA A;  4NNJ A;  3HOS A;  1TWH J;  1FMW A;  5DUK A;  2V1U A;  3GW2 A;  1Z3X A;  1HW5 A;  2DMP A;  2VBY A;  3BTI A;  4BE0 A;  3S3M A;  1RKW A;  1X2M A;  3DWL E;  4A69 C;  1QPM A;  3ABM H;  2EV5 A;  2HTJ A;  1OPC A;  4XSZ F;  1JKQ C;  1G2H A;  5F1J A;  2ESN A;  1X19 A;  4L18 B;  2X9D A;  5CVV A;  3M1C A;  4HW0 A;  4BL0 B;  4YIF A;  5KCM A;  2IW5 A;  2IBD A;  3MCZ A;  5JHF A;  4RDU A;  4LG0 A;  2EZH A;  1KQ9 A;  9ANT A;  4DBR A;  3ZQI A;  1RR8 C;  2M30 A;  1ZG5 A;  1A36 A;  1HKQ A;  1ZGJ A;  2ICW G;  3Q0U A;  3BG6 A;  3LSH A;  4RMN A;  4Y13 A;  4B48 A;  2ZBK A;  2X4H A;  4D1Q A;  2NS7 A;  3TL4 X;  3AG4 H;  1MNM C;  2ELK A;  2RC4 A;  3OYH A;  4UNO A;  5KAF C;  4ZYD A;  1GUU A;  3N97 A;  5IP6 A;  2ID6 A;  4WK8 F;  2EB7 A;  4PDK A;  2GIZ A;  4MTE A;  1D0Z A;  2I5U A;  2KIQ A;  2XSJ C;  2ZFW A;  4PSW A;  3E6B A;  2EZK A;  3G1L A;  3DBL B;  2IGM A;  4N9I A;  2STW A;  3OYG A;  4UVA A;  4PJL A;  4S05 A;  3BG9 A;  1XS9 A;  2VT2 A;  4N9H A;  4LGW A;  2RRE A;  2X85 A;  1D1B A;  5E1X A;  3I55 I;  2Z33 A;  4HNT A;  4JOM A;  3IC7 A;  1ZQ3 P;  4KIB A;  1JJ8 C;  4EM1 A;  5HS7 A;  1VFC A;  1LVK A;  2XB5 A;  3QPH A;  3HSR A;  1JHF A;  1Z05 A;  3LSK A;  2D5V A;  3OYJ A;  2KIS A;  4A6D A;  1TWG J;  1KYW A;  4P1W A;  3BCA A;  2FA5 A;  5GPC A;  3DCF A;  1YX3 A;  2DAO A;  4Y7N J;  1XTA A;  1BC8 C;  4A0Y A;  4L5J A;  5EEG A;  3DPU A;  3GTQ J;  2DN0 A;  4ESB A;  4H4K C;  2UXX A;  1QRY A;  2UWM A;  4BKX A;  2KZG A;  3DF8 A;  4CH7 A;  2ISY A;  2E1M C;  1UB9 A;  2PX9 A;  1BW5 A;  4OWR B;  5EEA A;  1VQ7 I;  2GIV A;  5HDN A;  1ZR2 A;  3PUB A;  3HG9 A;  2QSF X;  2CUJ A;  2Z3Y A;  1IV6 A;  5F1R A;  3OMY A;  4P9F A;  1EV7 A;  1YS7 A;  2VKH A;  3L2W A;  5ED4 A;  1U5T B;  4AUX A;  5IT3 A;  3JRD A;  3U1K A;  3W2W A;  4I98 B; 
#chains in the Genus database with same CATH homology
 4AU7 A;  3AL0 B;  1IRX A;  3LSI A;  4EAT A;  2V6E A;  5HLT A;  4PJJ A;  4BQN A;  5FRM A;  4F52 A;  3VSL A;  4LIU A;  2R7Q A;  2VQH A;  2CV2 A;  2DXI A;  1D0Y A;  1BR1 A;  2F6C A;  3PFY A;  3MMY B;  1X4P A;  4YEJ A;  4J01 A;  1QHH D;  2HZD A;  3OOU A;  2R7U A;  1DP3 A;  1TT0 A;  2DT6 A;  3LFU A;  3TBI A;  2VL8 A;  3DPL C;  3DEE A;  1N75 A;  3D5R C;  2Q1Z B;  3BC8 A;  4CCK A;  3OYE A;  3OYC A;  2VJJ A;  1T0F C;  2A6T A;  3SEZ A;  4XLF A;  5CQG A;  3DKX A;  1UEL B;  4CSW A;  5HNF A;  3K4N A;  4DGW B;  1OLT A;  3RSN A;  2JSP A;  2GOM A;  3H35 A;  4BXF A;  3OYM A;  3HOT A;  3W2A A;  2KL4 A;  3CJQ B;  3PNY A;  2KQR A;  2X6W A;  2VJ5 A;  3DPT A;  5TGT A;  3AKZ A;  2R4G A;  2HU9 A;  2BW3 A;  1ZEL A;  2OV7 A;  2W1O A;  2IS6 A;  3VSK A;  3MKY B;  4X0G A;  4C2T A;  3VWB A;  1V5F A;  1N77 A;  2FUG 2;  3LSG A;  2R7O A;  3GBG A;  1S9H A;  3LL7 A;  3OY9 A;  3HPH A;  2UUZ A;  2LH9 A;  5HVQ C;  5CQE A;  2IGK A;  2IGO A;  3S3N A;  2X1D A;  4CZC A;  2DJI A;  2LY1 A;  4PJM A;  2LRE A;  4BS9 A;  2KPM A;  2KHM A;  3K70 D;  2AQE A;  2CMP A;  3VYU B;  3EUA A;  4HG2 A;  3S3O A;  2VAS A;  2Z1D A;  1MNE A;  3V42 A;  3DU5 A;  2M4G A;  3OYF A;  3S32 A;  2BOL A;  4NQW B;  4NC8 A;  2WAF A;  2R7X A;  4C9Y A;  2PJR B;  3DTK A;  4J00 A;  4B43 A;  1QHG A;  4DIQ A;  4BE2 A;  1FMV A;  4LIT A;  1YX5 A;  2R7S A;  3ZXS A;  4ZDO A;  3IAS 2;  1NG6 A;  3PNV A;  3VYR B;  4ITV A;  4E7J A;  3VDX A;  3K4C A;  4XKV A;  2KDO A;  4HPQ A;  2MC4 A;  4U7B A;  2M3A A;  3C2H A;  2QKL B;  3VYT B;  3HKZ A;  1W36 D;  2VXD A;  2CH0 A;  4CUG A;  4N4O B;  2WA0 A;  5LFA A;  3FBN B;  5HOO A;  5LD2 C;  3H9J A;  4II2 A;  1Z7L A;  4E6K G;  2RNG A;  3A2K A;  2IS2 A;  4E7S A;  3DQV C;  4CCM A;  3OS1 A;  1PYV A;  2KRH A;  3EPZ A;  2V4J C;  2ZSI B;  3CMM A;  4E7L A;  2E5Z A;  3H5A A;  3SEQ A;  1DQU A;  1G59 A;  2DT7 B;  4XOP A;  4ZDL A;  2WY8 Q;  2JVH A;  2PJR A;  2MAB A;  4AVZ A;  4XMY A;  4XQF A;  2V7F A;  3FKJ A;  4XOR A;  4CCN A;  4D9J A;  2VXZ A;  1J09 A;  4HNU A;  2R7V A;  1WJF A;  1D1A A;  4YEL A;  4B47 A;  2HPI A;  3QOE A;  2XC7 A;  2KMU A;  3OWT A;  3L2U A;  2WAE A;  1UG0 A;  2W4S A;  1X4O A;  4F92 B;  2X51 A;  4B3X A;  3HPG A;  2X6X A;  2ZXI A;  4XN3 A;  3EUK L;  2OUM A;  3QYE A;  2IXS A;  1WJ5 A;  1MND A;  2X6Y A;  2LG4 A;  3H5N A;  2CFO A;  2XF7 A;  4QPQ A;  3FHN A;  4DOZ A;  4BAC A;  2V1N A;  3ZR8 X;  3RPU D;  3TMO A;  1U0J A;  2WBM A;  1Y6I A;  5CKT A;  3OS0 A;  4PSX A;  2JVG A;  2HVQ A;  3IAM 2;  4Y4R A;  2M0M A;  4KIS A;  1EA3 A;  3ZRG A;  1MW7 A;  3OYK A;  1LFP A;  2JUG A;  4G6T B;  3MKW B;  3RTR A;  2E5N A;  4PFP A;  5HNH A;  2HNH A;  3H5R A;  3E1S A;  2I8D A;  3DTI A;  3RCO A;  2LC2 A;  4E4H A;  1E0E A;  2IS4 A;  2VQC A;  2DOA A;  3K4B A;  1GLN A;  1NG7 A;  1AA7 A;  3G2B A;  3H9Q A;  4LG3 A;  4ZTJ A;  4BJT A;  3I9V 2;  3PSF A;  4XLH A;  2BW3 B;  3HUG B;  4II3 A;  4HSR A;  3UNG C;  3D5L A;  1MMN A;  2CW8 A;  1R6R A;  3FDY A;  3L2Q A;  5FRN A;  2LYC A;  4ZJZ A;  1BR4 A;  2P0W A;  2XAU A;  3QYB A;  3E0J B;  2MFZ A;  4XKC A;  3HL2 A;  4IZZ A;  3KYL A;  2MD0 A;  3K10 A;  3QOD A;  4IKF A;  2LOO A;  3CF2 A;  4NUB A;  4F3Q A;  2L5Q A;  3OS2 A;  3C2G A;  3OIQ A;  4HRI A;  1LKX A;  3K4M A;  4KT6 A;  3ZGK A;  2DCE A;  2GOX B;  1KON A;  2X1E A;  2HQA A;  4XL9 A;  1LDK B;  1X1A A;  2HDW A;  4F91 B;  2ZFU A;  4AYB A;  3OYB A;  2AQF A;  3K4K A;  1SAU A;  2OC6 A;  3DTE A;  2K9L A;  3PSI A;  2ELJ A;  2PMZ A;  4BQO A;  3DLA A;  1WFX A;  2Z2S B;  3I3L A;  4YRV A;  4P5O A;  4XLE A;  3VYS B;  4ANJ A;  3CZ6 A;  4JQF A;  1ERD A;  2XF5 A;  2IGN A;  1D1C A;  3K6G A;  2ZSH B;  2NOJ B;  4E7Z A;  3CES A;  1Y56 A;  2JA2 A;  4FET A;  4OAZ A;  3PNT A;  4Y3O A;  1JI8 A;  2CW7 A;  2Q2E B;  4C30 A;  1V5E A;  3W2V A;  1X1B A;  4XNF A;  2L2O A;  3OR2 C;  3OIP A;  4ZYA A;  2KLO A;  2VLA A;  4DBQ A;  2KRC A;  4FAS D;  4BEH A;  2HVS A;  2LRD A;  2WB1 A;  3S8P A;  3IP4 B;  4BU2 A;  2M7B A;  1Z21 A;  3KX2 A;  4OAY A;  4BJ6 C;  3AFH A;  3EUH C;  4DJA A;  4XM3 A;  3PL8 A;  4E7H A;  4BGD A;  2M7A A;  4BJ5 C;  5CPR B;  4KIT B;  4BDZ A;  2Z16 A;  2VB6 A;  4LIV A;  2V26 A;  4BQQ A;  2WY7 Q;  2L7K A;  3K4J A;  3CP2 A;  3H9G A;  2R7W A;  1MMG A;  2L9N A;  1WJB A;  3OYD A;  2WAD A;  2O5R A;  4XKB A;  3AL0 C;  2VQG A;  2M4K A;  2K5C A;  1WJA A;  2VKD A;  4PUS A;  4ZTF A;  4GRI A;  4HST A;  4ZC3 A;  3D5S C;  1HA8 A;  5KNL A;  4N4N B;  3OL4 A;  3OL3 A;  4ZDP A;  4IQJ A;  2BVM A;  4F55 A;  4BDY A;  3L2V A;  1QU3 A;  3W3C A;  4CCO A;  4NC7 A;  1V5G A;  2KP6 A;  2CV1 A;  3U21 A;  3M8J A;  1OR7 C;  4U87 A;  2W82 A;  3K70 C;  2R7T A;  1DGW Y;  1WJE A;  2A5W A;  1BOB A;  4KJZ A;  2KZV A;  3N05 A;  3S93 A;  2VJI A;  1X1D A;  3OYL A;  3MD2 A;  3SZG A;  3ZCO A;  4NNJ A;  4R79 A;  3KEY A;  3HOS A;  3BCB A;  1N78 A;  4BUP A;  1FMW A;  2LBF B;  3SDB A;  2VPL A;  4PJN A;  3ONQ A;  3SYT A;  1Z3X A;  4RM3 A;  4BE0 A;  3S3M A;  2R7R A;  3BLY A;  4XKW A;  2UV1 A;  3DWL E;  3ZQQ A;  1X19 A;  4PK4 A;  1WJC A;  3PJR A;  3A4C A;  1T95 A;  3M1C A;  3NWS A;  2VQL A;  4BL0 B;  4CCJ A;  5KCM A;  5KHD A;  4BE1 A;  1D0X A;  2XDV A;  5JHF A;  2V9K A;  3QYF A;  4XR6 A;  1BR2 A;  4XOT A;  1X1C A;  3CP8 A;  3MKZ A;  4DBR A;  1VZ0 A;  3L2R A;  3BG6 A;  3LSH A;  4RMN A;  4B48 A;  3OYI A;  2HPM A;  4D1Q A;  4IX7 A;  2W00 A;  3TL4 X;  2L9S A;  3CJR B;  3OYH A;  3HC7 A;  3UR3 C;  4RLQ A;  2WAQ A;  5FRO A;  4HEA 2;  1P9Q C;  4IQ4 A;  2LBF A;  1UAA A;  1D0Z A;  2XSJ C;  4Y33 A;  1W36 C;  1WJD A;  4PSW A;  4QPO A;  1MMD A;  2CS3 A;  3A1Y A;  2IGM A;  4XON A;  4B44 A;  3OYG A;  2QKM B;  2CUZ A;  3F9K A;  4PJL A;  1TZL A;  2E1M B;  4F93 B;  2CV0 A;  2VIX A;  2K3P A;  2RRE A;  4C2U A;  2X85 A;  2HVR A;  3DKY A;  1D1B A;  3RQ4 A;  2VJ4 A;  4HNT A;  4JOM A;  1DGR M;  1MMA A;  2XF6 A;  2K9M A;  3K4L A;  2W7N A;  3OR1 C;  1LVK A;  4XLC A;  3LSK A;  2F5V A;  3OYJ A;  3DU6 A;  3NWT A;  4P1W A;  4PFO A;  3BCA A;  3FBI B;  3OYA A;  1YX3 A;  4CCL A;  1YE9 A;  2X1C A;  3LSM A;  4MLO A;  1PJR A;  1G8X A;  3BG7 A;  3DPU A;  3H0D A;  1K6Y A;  4H4K C;  1Z3Y A;  4RM2 A;  4XN0 A;  2UWM A;  3OYN A;  4CA0 A;  4CH7 A;  2Y0S A;  2E1M C;  3HXL A;  4BEH B;  2RQQ A;  4OWR B;  4E7I A;  3PUB A;  4RLF A;  3HG9 A;  2BVL A;  2LY2 A;  2CUJ A;  2MYS A;  4E7K A;  2F4I A;  2E60 A;  3OMY A;  3LMM A;  2VKH A;  3L2W A;  2IS1 A;  1SFK A;  3J7A Y;  4XLA A;  3IUO A;  2ZXH A;  3W2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...