3D5SC

Crystal structure of efb-c (r131a) / c3d complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
65
structure length
65
Chain Sequence
TDATIKKEQKLIQAQNLVREFEKTHTVSAHAKAQKAVNLVSFEYKVKKMVLQERIDNVLKQGLVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C3
publication title Electrostatic contributions drive the interaction between Staphylococcus aureus protein Efb-C and its complement target C3d.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/toxin
total genus 27
structure length 65
sequence length 65
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF12199 efb-c Extracellular fibrinogen binding protein C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1270 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3d5sC00
3D5RC 2GOXB 2WY8Q 2NOJB 2WY7Q 3D5SC 2JVHA 2GOMA 2JVGA
chains in the Genus database with same CATH superfamily
4MIMA 2EZKA 4XLHA 4YEJA 4XLEA 3DPUA 2KT0A 3OS2A 4PJMA 1X3WB 4A12A 1XS9A 3JRAA 3MZYA 3HBLA 3TW6A 4IF4A 4D9JA 1UELB 1W5SA 3I59A 1YRNA 3CJRB 4ZYEA 1ZLKA 2P5VA 3OV8A 3IC7A 1IV6A 2JK3A 1ZQ3P 5ICGA 2V26A 5D5UB 1W5CC 5EGOA 3GTLJ 1QVUA 2D2WA 3LA2A 3TQNA 2LMDA 5DS9A 4QPOA 1JHFA 1OFCX 2CJJA 1YX5A 1K7AA 4V19K 1P4AA 2GZWA 2IS4A 4IRGA 2EFQA 1FNNA 3G1MA 3HPHA 3LQRA 4E7SA 4ITVA 3PNVA 3FX3A 2R5YB 2R5ZB 2DMTA 2O03A 2X1CA 1PYVA 2F5VA 2XKOA 4UUSA 2IAIA 3A1YA 3L1PA 4P9FA 3M8JA 1IUFA 5KVRA 1HCRA 2V1DA 3CMMA 2MH9A 2EFWA 5FO5A 3CCMI 1OQYA 4JX6A 2O6GE 3KE2A 1J09A 2A5YB 1OCZH 2LYCA 4FTHA 1WJDA 2DMUA 5E1XA 3WHCA 1NHAA 2H6CA 2FMLA 1FIAA 2L5QA 2GA1A 4I98B 3I55I 2FUG2 1KZHA 3BR0A 1X1DA 2CQQA 2DW4A 4GYIA 3EUHA 4KIFA 4BGDA 4BHPA 2OZUA 1T0FA 3LSRA 3NEUA 3JRDA 4J19A 1H0MA 2RAEA 2XGCA 3IRQA 5FKLA 2QUFA 3MVPA 3BY6A 2OF7A 1SFEA 2X4HA 3WHBA 2ELKA 1VQ8I 2IGOA 1UMQA 4GDFA 4I09A 5GAHJ 3OYBA 2A3SA 1XSXA 2FD5A 1LEAA 3K7AJ 4LG0A 4N4OB 2A68F 4DZJA 1WPKA 4P1WA 3FMRA 2PJRB 5DTDA 1Y6IA 1VQPI 3H3VK 2HZDA 1JKPC 2HTSA 1Z3XA 4M72A 2G7HA 3LSMA 3ZCOA 1R1UA 1DP3A 3B6AA 2K7LA 1SEUA 2K40A 5EEAA 2FXAA 3OL4A 5D4RA 2OA4A 3F6OA 4LB5A 3MD2A 3E3VA 3CDIA 2QZ8A 3OYIA 3CO6C 5D6EA 4MLOA 1MMGA 1X2NA 2LDUA 1YS7A 3VPRA 3IH4A 5HNHA 1ODDA 2E5NA 3D5RC 3CCJI 2VT3A 1C0WA 2K9NA 1S72I 3MKZA 3E1SA 1SVMA 3GVAA 2CQXA 2JT1A 2I8DA 2KFDA 2KL4A 2TRTA 4LGWA 3K4MA 3HOTA 1Y56A 3E7LA 1TLHB 4XR6A 2V9VA 1X2MA 2HYFA 2E7WA 3TP3A 2HVSA 2HVQA 1BW6A 3HHGA 2D5VA 3C1DA 3FKIJ 2AQEA 3VYUB 4QIWN 5B5EC 1NK3P 4CZZA 3DQVC 4HF1A 1XG1A 2FX0A 2Y30A 1QZEA 3ZQ7A 2R5YA 2R5ZA 4E70A 2IT0A 4LLGF 1MBEA 1QZZA 3TEDA 4DYCA 4MNUA 2CW7A 2CRGA 1J0RA 2K9MA 3TDUC 2QF7A 4W97A 3WTUC 3FKJA 2Y9ZA 3R4KA 1FTTA 4AIJA 2K4BA 4BJ5C 2R3SA 5FLXK 3UR3C 2DN0A 1SD5A 3ZQCA 2X48A 1Z91A 4A5MA 2MSYA 2BZTA 5HDKA 1YI2I 3CP2A 3FXKA 2JJ7A 4EM2A 1EV7A 2DA2A 1B9MA 3KP5A 1IG7A 2LC2A 2HQAA 2VBYA 3HKZA 1FSHA 2VQHA 2WAEA 4P9UA 2KIQA 1A04A 1G59A 3GFIA 2JA7J 1BR4A 4LFUA 1H88C 3CZ6A 3DEWA 3OOPA 4J00A 4E7JA 4ZTJA 3ZP5A 3HYIA 2H94A 2C6YA 3ZRGA 2KIMA 4QLCU 2UUZA 4KMFA 2LLKA 2NVQJ 1BM9A 3J80Z 2JRMA 4X0GA 3F8BA 1YTYA 1LEBA 2WAQA 3HSFA 3M4OJ 2PJRA 4I02A 2DA1A 3DFGA 5DCMB 2MD5A 4D0PA 4CH7A 4RAYA 2L7KA 1D1CA 4RB0A 2A07F 1T98A 2BEOA 1VQ5I 1MBJA 2P7CB 2BYVE 3G2BA 4L9VA 1M1EB 4X6AJ 1ZKGA 4AC0A 1XCBA 3FDYA 3ABKH 3GXOA 4KA4A 1MBFA 2WADA 2K9QA 1LFPA 2RNGA 2EZHA 2VBXA 3I4NJ 3I54A 1FWZA 3CP8A 3GW2A 1XSDA 4HNTA 3GFJA 2F5EA 1AKHB 4QSHA 2IS6A 3H36A 2BE5F 4NDLA 1X1AA 2HQ5A 3M07A 5CVUA 4BYYA 5DD8A 1QBJA 3FXOA 4ON0A 1ZG5A 3FBIB 1KGSA 5EF6A 3VYTB 3R60A 2EILH 3R61A 2ZNYA 1HXDA 2L9NA 4BJTA 1IGNA 4YFNF 4L5IA 5K7FA 2KQRA 3N4MA 2M34A 3PUBA 4PFPA 5FRMA 2IS1A 4CCLA 3J7ZI 1QVTA 5E18F 3ZPLA 4BE2A 3EYYA 1K6YA 2X85A 4A6DA 5F1JA 3FM5A 3K1NA 3FXRA 4GGGA 3CD6I 2MC4A 3DKWA 4Y7NJ 5LFAA 2VL8A 3IAM2 3KFWX 4G9YA 4Q4ZF 2MYSA 2VE8A 3DEUA 3Q9SA 3MFKA 2QCOA 4HF0A 1EA3A 3ZMTA 1D5VA 3OYHA 1NG6A 4EJVA 1ETQA 4DBRA 3KP7A 2DPDA 3S32A 2DXIA 4IHVA 3MAJA 4BDYA 2X6WA 3ESWB 2XPVA 4XSZF 1R36A 2Y0SN 4LOCA 2E34A 4RB2C 5KNLA 1OKRA 1AHDP 5DYMA 1BI2A 3WU1B 5L3EA 1E2XA 5C4XJ 4UXNA 3S3OA 2EIKH 4XMYA 2F4IA 2DA6A 1VFCA 2EQRA 5FROA 1YS6A 4ZH4F 3H0DA 1KQ0A 2XF6A 5C44J 1HF0A 1RUOA 4MGRA 2ZJPF 4A3LJ 3ZQHA 1KYZA 2PMZA 2EH3A 4WF2A 5FKNA 2E1NA 5JHUA 1SC7A 3I53A 1IRXA 2BY3A 2Z9OA 2DFFA 4LK0F 1KA8A 2M4GA 3KX2A 1OPCA 3QPTA 1TW3A 4JOMA 1SFUA 4KNYA 4BJ6C 2R7QA 3CMAI 2EINH 3K6GA 3HRSA 2Z5UA 3WE2A 3GLLA 5L3GA 4IZZA 1MGTA 1U2WA 2Z3YA 1T08B 3CUOA 5DCMA 3KYCB 1TWAJ 2GOMA 3EUHC 3KEYA 5FKMA 3AL0B 3VSKA 1XC5A 3HSEA 4IQ4A 4NC8A 2EV5A 2V9PA 1O3RA 4Y4RA 1IAWA 4XLCA 3L2WA 2I10A 4JX4A 1T56A 4BEHB 3JR9A 3PNTA 2OJED 2BOLA 1AKHA 2H1KA 1QQIA 2LNBA 2XRNA 4C2MJ 2KJBA 2QSGX 3ASOH 2XROA 1A31A 3OL3A 2Z1DA 2FA5A 4I2OA 3U9GA 5J8CA 1RKWA 1I27A 2LF8A 2LFBA 2QGUA 2BBYA 3G1OA 2O61A 3V8LA 5GTHC 3L2CA 1B59A 1LFBA 2H8RA 3O2PE 1XB4A 1IUYA 2W4SA 4MO7A 3A03A 3WG9A 4DIQA 1QU3A 1RUNA 4UVBA 2P4WA 5AIQA 2XSDC 5JVTA 3W6JB 1FMVA 2ZSHB 4KITB 4GCVA 2Z99A 4BXXJ 3D5SC 2PI0A 1F36A 2RVCA 1TP4A 3HSRA 2TCTA 4N9HA 4ZYHA 2BW3B 2YSRA 3BG5A 2RV8A 3RPUA 1T33A 1A35A 1D0YA 3S3MA 3FM3A 1OJLA 4KUMA 5JLWA 1QNTA 2M4KA 2LKXA 1XN7A 2FQ3A 1YFHA 1XGMA 5D5XB 2QQAA 4UHTA 2EA2A 3BR5A 3UNGC 3PQKA 3FXLA 4IVNA 1ETKA 1FOWA 3LNQA 3A2KA 3KP2A 3CLOA 4TV7A 3AKZA 2FBHA 3FIWA 2NOJB 1JJ6C 5CKTA 1ZLJA 2CUZA 3I4PA 3MKLA 2Y9YA 3JW4A 2ETHA 3JRCA 5CLSA 3SEQA 2M8GX 1O7LA 4WX9A 3O6BB 3WGHA 1O3TA 1BW5A 3SZTA 3KIOA 2WTEA 4FHTA 1VQ9I 2DMPA 3G3ZA 2Q2EB 3HG9A 3OYDA 3A01B 2E71A 1NK2P 4XRFA 4Y17A 4HEA2 1MIJA 3VYSB 2E2JJ 3BZCA 1G3SA 4IQJA 1K79A 1R6RA 2PLYA 2QWWA 3DXJF 3ZN0A 1UJ8A 3V8KA 3JRHA 3CCSI 1OCRH 2YU3A 3JAMK 5LEJA 3H5NA 5JLXA 1L3LA 1KYWA 1KU7A 3LMMA 3ERMA 4RA2A 5BMZA 4R79A 4B3AA 4XRMA 5GAGJ 1JGGA 2WY7Q 4HOBA 1DPUA 1HSTA 3QAHA 4BEHA 4M73A 5K7ZA 4WCGA 4FX4A 4A0ZA 4E7LA 1GVJA 1OISA 2DI3A 5LGTA 2LY1A 3BOQA 4UVCA 2PX9A 3GMEA 3LA7A 5J6XA 5HLHA 4GXOA 5H20A 1K4SA 4ENKA 3BTLA 2VXDA 4CZCA 3WGIA 4DGWB 4NC7A 2CW8A 3H3UA 1BBYA 9ANTA 2DLLA 1J2XA 1MNEA 2VIXA 1YO5C 1BI1A 1S29A 5ERIA 1R5GA 4XOTA 4CCKA 3KYLA 2IGMA 4C2UA 4OAYA 4L0YB 4L9JA 2ZSIB 2DT5A 2HPMA 2JVHA 3I4MJ 3S1MJ 1OCPA 5H6RA 1A6IA 4Q47A 2QM3A 2KJCA 4UUTA 3K2ZA 2K85A 1Z1DA 4LJZF 3U1DA 2Z2SB 2BW3A 4LB6B 2ME6A 4N0BA 4EGYA 1LDDA 5B3SH 5J1UA 2EK5A 2VC0A 4DQ2A 1VQ4I 2CQ7A 2WBMA 2EFOA 1ZH5A 4PGGA 5EYRA 5LLQA 1ZREA 3WTXC 1O57A 1O4XA 2O5RA 4FE4A 2LTPA 4AVZA 1YJWI 2EJRA 2BV6A 4B47A 2L0KA 1USSA 3SDGA 5DM6F 4HA8A 2L9VA 2VBZA 5IOYA 1J7KA 1V54H 4JK1X 5JFRA 1QHGA 1YW8A 1Z0XA 2P8TA 3GTMJ 3HXLA 2RNJA 2YUSA 2K3FA 1ZAOA 2STTA 2ELHA 4HV6A 1QGPA 5HLTA 5TJJA 1ETOA 4HNVA 4NHJA 2VJ4A 2EFPA 1WSUA 1LDKB 2M5WA 2Q2EA 1Y0UA 2KZGA 2W00A 3A01A 2K5CA 1FP1D 2VOPA 2UZKA 3E6MA 4ZTFA 2JN6A 2DYRH 1ON1A 2Q0OA 4B1RA 3JRFA 4EGZA 2RN7A 3C18A 4CHUA 2HTJA 2MG4A 2NYXA 1VTNC 2DBBA 1WJAA 1LQ1A 3F8NA 3S16J 1AA7A 3H35A 1QPMA 4CYCB 2QLZA 2FNPA 1IRFA 1BOBA 3REOA 4CDGA 4Y13A 2R7VA 2UXXA 3PIOF 2VPRA 1RETA 3H9JA 5E1ZB 5IYBJ 4S0HB 1D3YA 2M1BA 1VQLI 1B1BA 3H92A 2QQBA 1WWXA 2XC7A 3CLQA 4XKCA 3SDBA 2CV1A 2MLGA 5F27A 1UG0A 3LSPA 4M6VA 3GTJJ 3E0JB 1A5JA 4JQFA 3ROUA 5KHDA 4MFEA 1Z21A 1FX7A 5IP9J 1LB2A 3DBRB 3FHZA 2W25A 1VQMI 1S8NA 3AG1H 4BNCA 2KRHA 4NUBA 1X19A 2L3DA 1GHCA 1FMWA 3Q0VA 3OYKA 4UB6C 3TO6A 3WG7H 4BBSJ 5LGNA 1SANA 1YIOA 4PJ0C 1O3QA 5M3MJ 1ERDA 2BHYA 1H9TA 4IRIA 4F3QA 2PBIA 2DYSH 1WH5A 3PJRA 2X6XA 4XONA 5E8IA 1VQ7I 2UV1A 3HUGB 6PAXA 1W36D 3K69A 1RZ4A 1HQCA 2RGVA 5HVQC 3DLLF 5TGTA 2IRFG 2IS2A 2LBFB 2IA0A 1JT0A 3OYGA 4KYWA 1WCMJ 1YG2A 2COMA 1HA8A 2XHKA 3QOPA 3CJNA 5JR3A 3W2AA 4A3CJ 4YELA 1PVEA 1RC9A 3EUKL 1D8JA 3DTEA 4C2TA 3BWGA 4IEJA 1LFUP 2R7OA 3VYRB 5CPRB 3K4BA 4CXFA 1AOYA 2STWA 2JRTA 5HS8A 4U7DA 4DYQA 2VPLA 2DA5A 3BJAA 1F5TA 2NVUB 2W7NA 1FYMA 2L7MP 4WXCA 2BGCA 4RBOA 4HX7A 5F0HA 1G6NA 4M9SA 1D8KA 2XUBA 4A0XA 4MTEA 5IOZA 4EJTA 3Q0WA 2EB7A 2VN2A 1S7OA 4ESBA 1H8AC 2R7SA 1FLIA 1YYVA 2A61A 4A3IJ 3LWFA 4KDPA 1N78A 3CCUI 4V2GA 3RKXA 1RR7A 1SVOA 1XDUA 2IJLA 3G73A 3K2AA 2R93J 3HRTA 2VQLA 3LFUA 3SXYA 3KETA 3OYAA 4BE0A 3WU2C 3VDXA 2FOWA 3EETA 4H0EA 2IBDA 3A4CA 4AU7A 2Z16A 3S3NA 1RKTA 4ZDLA 1P7IA 4XSXF 5CJ9A 2Y0SA 3K10A 2CH0A 5CYVA 2OTLI 1U78A 1I6XA 1UCRA 5GPAA 1NH3A 2K9LA 3QODA 2Y75A 1MMDA 4CYCA 2X0LA 1TNTA 2OQGA 2W82A 5CQEA 1XX5A 4HG2A 2ELJA 3OIPA 4EQQA 5JHFA 5J1RA 2K4JA 4BU2A 3CCVI 5H6QA 5FLXZ 4XRSA 4M9XA 2M87A 2BVMA 4M3GA 3OMYA 4BH9A 1F1ZA 2DK5A 4PCQA 2MABA 4IJAA 4W1UA 3TKYA 3DKXA 2AS5F 2W57A 3QQAA 1FBQA 3FXUA 3KZYA 4IHSA 2LD5A 2P5LC 5BNGA 1S7EA 2M7BA 5GTIC 3JTGA 3EYIA 3C2BA 2JA8J 2NVTJ 2MGQA 3QPSA 3U1KA 2VASA 4RGXA 2OBPA 1X4PA 3AL0C 2I5UA 3QPHA 3A02A 2GM4A 2DCEA 1STZA 3M1EA 3JTHA 2CG4A 1KU2A 1K4TA 4Q48A 2YU9J 2W24A 4HSTA 2GXAA 4RAGA 1BJAA 2YS9A 2ZKZA 3BP8A 2D45A 2B9SA 2RREA 2RC4A 1Z9CA 1JKQC 3HUGA 3M3YJ 1SMYF 2N8GA 2W85A 4XBFA 4XICA 3IUOA 1X3ZB 1ZRCA 2LBFA 3P9KA 2FBKA 4C30A 5M5YJ 3K1PA 3BG9A 2JMWA 3F3XA 1MBHA 2MFZA 2HI3A 5F1RA 1S6LA 4IO9F 2VQCA 4YRVA 3MCZA 3F9KA 5F08A 3TOBA 1WJ5A 1VZ0A 3FXMA 1U8RA 4OIQF 1IN4A 1JXSA 1WI3A 4AYBN 1IV8A 4DW6A 2VQGA 2NVYJ 4BACA 5M5WJ 1DGWY 2CWEA 1W5TA 4CICA 2NRAC 1Z7UA 2CGPA 3I9V2 2R7ZJ 2VKHA 5EZHA 1SFOJ 5GAEJ 3PL8A 5M5XJ 3MMYB 4O5VA 1HDDC 5FLVA 3TGNA 2YX4A 3H9GA 3B02A 2WB1N 2WAFA 3U2RA 3F21A 1T8IA 1QZYA 1G8XA 2H1LA 3RTRA 4AUXA 1SD7A 4A3FJ 1HBXG 3OR2C 4E7KA 4IHXA 1W7PB 4FQGA 1D0ZA 2P5KA 3IWFA 4BY7J 2ZCWA 5HNFA 1FTZA 2A05A 3GWZA 4PFOA 3G71I 1Z67A 1VQ6I 5FGMA 2KISA 2NVXJ 2LY2A 3GFMA 1F43A 2GAUA 2Y48A 3HRUA 3M7GA 4C9YA 5TISC 2JZYA 1MSEC 4BQNA 1Z6RA 2KIUA 5E20A 4EMSA 5DUKA 1A6QA 2NNNA 2P6TA 2YR2A 2XSJC 5AONA 3GTKJ 2XB5A 3FMQA 2E2IJ 3O3KA 3BR6A 3D1NI 3W3CA 3TDZC 2VONA 2AXTC 3RYPA 3E5QA 3T1BA 3V7SA 1XGNA 1BL0A 4L9NA 1UHSA 3CDLA 3K4LA 3ZMVA 4CSWA 1FBUA 1XSVA 4II2A 1RNLA 3LL7A 1XGOA 4XL9A 5LGUA 3L2QA 1P4WA 1HW2A 4AIHA 3HOSA 1I1SA 2DFEA 2DJIA 2V1NA 3S17J 3RKYA 1EF4A 2QYOA 2JUCA 1R5HA 5FD6A 2HS5A 1FT9A 1BJZA 2FSWA 3U21A 3ZMSA 2KIFA 4ESFA 4HNUA 4XRSG 5K5RA 1ZRFA 5GADJ 2VKDA 3HIFA 3CMYA 3DWLE 2E1CA 3BZKA 2F48A 2VT2A 4JBAA 5CVIA 1B8IB 5LD2C 4Q5SF 2WV0A 4IHYA 2QENA 1ZN2A 3L2VA 2M8EA 3HOWJ 3FBNB 1WJEA 2MC3A 1EJ9A 3OY9A 2KMUA 4BXFA 5H2FC 4F92B 3RI4A 1UB9A 2AO9A 4X1EA 4R8HA 3QRFF 2F5DA 2FOKA 1ZGWA 2BHZA 4IL6C 4B44A 2CUFA 4EEFG 1P4XA 2HYJA 3CC4I 4BY1J 3SFIA 3ZGKA 2R0QC 3HOYJ 1P6RA 4U0YA 2FMYA 4BE1A 4OIOF 4CCMA 2D1HA 3ZQIA 4LG3A 1E3PA 3AG3H 2FQ4A 2HDDA 2HGCA 2QVOA 3QYBA 3FXJA 4JYKA 4PDKA 1U9NA 2F2EA 5K7HA 4BQOA 2XAGA 1NTCA 3E5XA 5GP9A 1YJNI 3LFKA 5J8FA 1MW7A 4HV5A 2BY2A 2Y31A 2CFOA 2DA3A 2HKXA 2X1EA 5E79C 1QPIA 2ME0A 4G7ZF 1JUMA 2DOAA 1IN5A 3GF2A 5L3BA 4RM2A 3LQQA 3MKWB 2OC6A 4ENMA 1ZELA 3IV5A 4AWXB 3KCCA 1W7PA 2R7FA 3ZN1A 3NARA 3LAPA 2GOXB 1YITI 3GTPJ 4I01A 4D7NA 1FOKA 1WRJA 2PQ8A 5J4YA 2VODA 5C4JJ 1ZG3A 2IVMA 3I71A 2HXIA 5IPAA 1LJ9A 2KRCA 1FBSA 3KEOA 1VQNI 3SFZA 2UWMA 2P81A 1JTYA 4DZPA 1MKMA 3RQIA 3V4GA 4A5NA 4HQMA 4KT6A 4YIRX 3CC7I 3BQZA 1P2FA 2QQ8A 5K5QA 1JJ8C 2LH9A 5FLMJ 4B3XA 1D1AA 3Q3SA 4Y52J 4HF2A 3VB2A 5CVRA 5K1YA 2HEOA 1WI9A 2CQNA 3DPTA 2V4JC 3MN2A 5HDGA 1T6SA 1LE8B 5FFXA 5FB2A 3GFLA 3HEFA 2A6HF 1HW5A 2DDAA 3ZMDA 1R9TJ 2K27A 3BCBA 2WV1A 1SVLA 3DU5A 4I0AA 4GRIA 5D4SA 4PZJA 2LP0A 3CJQB 4YG2F 1MJAA 1R23A 1ZG1A 3NWTA 1IJWC 2LY9A 1G3WA 4M3EA 1UFMA 1R58A 1GDTA 4N4NB 5HDNA 5HLGA 4JX5A 4M71A 3VWBA 1MBKA 3HM5A 2ECBA 5E1WA 5IT9Z 1G3YA 2FRHA 1USTA 3F8CA 3ML6A 3R0AA 4NBQA 1ZHFA 1B8IA 2L7FP 1XCVA 1DU6A 3PO3J 1FZPB 3JAMZ 4HRIA 3MZHA 4ZJZA 1X1PA 4QWQA 3IRRA 1XPXA 2HYGD 4IOCF 1IF1A 3HPGA 4XLNF 4CCNA 3OYNA 1YJ9I 4I76A 3OS0A 1ZRDA 5EEHA 2L7ZA 4QTRA 1APLC 5HS9A 2XAQA 3RKWA 1J9IA 4HQEA 2HNHA 4BXUA 1IN8A 3ULQB 3FISA 3FHNA 2VBWA 1MZBA 1OMIA 3ABMH 2DODA 4KT5C 2HOEA 1D0XA 4A3BJ 4E4HA 3KZIC 2OUMA 3DTKA 1WVRA 5EJCA 4I6ZA 3PNYA 2ZXHA 1S3JA 5DUIA 4S04A 4CA0A 1F4KA 3H5AA 3CF2A 1MMNA 1MD0A 4F7ZA 2CS3A 3OYJA 3BTCA 1IXSB 5EDNA 4ZDPA 2O8KA 4L5EA 2QKMB 1MNDA 2ZO4A 4ENJA 3JCUC 1DP7P 1HSJA 3JRBA 2HOTA 2R7TA 2BY1A 1TWCJ 4KICA 1XMAA 4M9ZA 4Z6YA 4XKBA 5FD5A 5CVJA 5D5WB 3KLNA 1GXQA 2EA4A 3TMOA 1OR7A 2E19A 1BIAA 1LUJB 2Y2ZA 3RCOA 3QPLA 1KONA 1W7PD 5IT9K 1R1VA 2V6EA 1KQ8A 1WJFA 4EM1A 3TO7A 3E6DA 5J40A 4B09A 4CCOA 1X58A 2E1OA 4FCYA 2LRDA 4OAZA 1Q1HA 2JA2A 3P5JA 4F55A 3H9QA 3I64A 1BN5A 3F22A 2VE9A 1YOVB 5HS7A 1IC8A 1FEXA 1FY7A 1LE8A 3BT9A 5EEGA 1U3EM 3HB9A 5CQGA 4YIIA 1I3AA 1IN7A 2L9RA 1LVKA 5ILVA 1HLVA 2NXNB 3LOCA 3ZOBA 3ZMZA 2H09A 1Z05A 2V7FA 1JT6A 1QO0D 3LSJA 2MBFA 2QA4I 3BR3A 1FC3A 3BJOA 2RQPA 1SD6A 2CW0F 3HL2A 1ZR4A 2OCCH 4BHCA 1FYLA 3J7AY 1V5EA 5HLIA 2Q1ZB 1W1WE 2XGXA 4UUVA 1REPC 5IYDJ 3SEZA 1I5ZA 5B1BH 3T8TA 3E6CC 3CQZJ 2HOSA 2GLOA 5F04A 3FK7A 2M7AA 4UB8C 4E6KG 2AXLA 4YIFA 3BG7A 1ENHA 1JGSA 2FBIA 1IXRC 3OWTA 3SHFA 3L2UA 1N25A 2XRLA 4GFBA 2IW5A 3H3ZA 5BPIA 4PUSA 3I58A 1R5ID 3SZPA 2QKLB 3NAUA 5DV5A 1N75A 2E7XA 5BS6A 2EV6A 2KHMA 2HDCA 2HWVA 3F72A 3PSFA 2GXBA 2NS0A 4CUGA 2EFNA 5CVVA 4WWCA 2RDPA 3DPLC 1RRJA 3P7NA 1XTAA 4G94A 2AQFA 3AG4H 4OMYA 3QU6A 4RLQA 1KQ9A 4EATA 3GZ6A 2QSHX 4ZYGA 3BJ6A 3M8FA 4KN7X 1V5GA 2BY0A 1JTXA 2XB0X 1ETWA 2OV7A 1YE9A 4EJOA 5ILSA 5FFZA 1IO2A 1YX3A 2IXSA 3JSPA 1P92A 2Z33A 5IP6A 2CV2A 3S2DJ 2F5CA 5F6FA 2MH2A 1ITYA 1WHUA 3MEXA 3TOAA 4ENNA 2XAJA 1ZARA 1B4AA 3FXQA 4OMZA 3ZQLA 4BQQA 4ASNA 3BC8A 1RR8C 2PEXA 1PP8F 2R7XA 3QP6A 2EWNA 2FNAA 1BC8C 4V2FA 1OCOH 2VC1A 3IKVA 3EUAA 2PMUA 5E3LA 2JQ7A 4IXAA 1YHQI 4AYBA 2QBYB 3BQYA 4BS9A 3MWMA 4ZZDA 2DOFA 3GZNB 2XAHA 4AVPA 3IHUA 5DCFA 4IKFA 4IX7A 3OOUA 1ZYRF 4AIKA 1IN6A 4B43A 1Y39A 2R7DA 4A3EJ 3OSFA 5BOXA 1GLNA 2CQKA 4ANJA 1LNWA 3CJTB 2R7UA 4HSRA 2WB1A 4UY8I 1D5YA 2CV0A 2EIJH 1HKSA 1ETVA 4XKWA 2B7EA 4A3DJ 3NWSA 2DDBA 1A36A 3QWLA 1TWFJ 2DT6A 3T8RA 3K4KA 4R1HA 3DU6A 3PM1A 3BTJA 4G8XA 4LIUA 1B6AA 4EV0A 5HODA 3WODF 4KISA 2XAFA 2LR8A 1W0TA 1S5LC 4OU0A 2BXZA 2JTVA 4PGHA 3DP7A 2FEZA 3OR1C 5FKOA 3PFYA 1ZK8A 1EH8A 1WJCA 2JPBA 3RJPA 4U0VA 2K86A 2B0LA 3H1CA 1CF7B 4OIRF 5HOOA 1HW1A 1GXPA 2VLAA 3OIOA 1MDMB 1G4DA 3ZQGA 1YLFA 2G0EA 3RZDJ 2H8WA 3TL4X 1L0OC 2MD0A 2X51A 4M3BA 4HLXA 4O3MA 2PFBA 2L4MA 1EKEA 3BG6A 4AIDA 1TC3C 3VEPA 2DQRA 2JSPA 3L2RA 1TBXA 2M30A 1GV5A 1SMTA 4C3IJ 1J75A 2EZLA 1SAUA 3L09A 3MKYB 1WKMA 2FJ1A 3VOEA 4E7IA 2F4OB 4ZDOA 2XV4S 3ZXSA 2WY8Q 3DCFA 3C2GA 3TBIA 2J5OA 3C2HA 4GO1A 4EJWA 1QHHD 5J47A 2M0MA 3V8JA 3GLXA 5BPDA 1BI0A 4E7HA 2V1UA 3GTQJ 5F0CA 2QSFX 4YFKF 5F64A 4OOIA 1U5TB 2PN6A 3BPXA 5LBQA 3C3WA 1BIBA 4U7BA 2P0WA 2CUEA 3CCQI 2VOOA 5AIPA 5LEKA 1X4OA 3ABTA 1LPQA 1IW7F 1BR1A 4G6DA 2WWYA 2GIVA 3F6VA 2LOOA 2M45A 4XKVA 3WTVC 2L02A 4RGUA 4II3A 3FWEA 3GBGA 2ADUA 2KDOA 3FZVA 4C3HJ 5JVGF 2QBYA 4D5CA 3OIQA 4LD5A 1SD4A 1FPQA 2FU4A 4EJUA 3BR1A 3I5UA 1GV2A 1JUSA 1XMKA 5KK1A 1F9NA 3KPHA 2JWTA 3LSTA 1O3SA 3R6SA 2VJIA 2G7UA 4DNCA 3L00A 4AD9A 2VB6A 2LKPA 3M8EA 3O8GA 4XLPF 2E35A 3G1LA 4WK8F 2XGDA 1UHMA 2CUJA 4XORA 3RQ4A 3CUQC 2M9HA 1OR7C 5E3MA 3CC2I 1EH6A 4H4KC 3WTTC 4A93J 1FOYA 3D0SA 1TQMA 3ERED 2NAZA 1ULYA 2XF7A 3CDHA 4DOZA 5FRNA 4PJNA 4IOAF 2LVSA 4XLFA 4G12A 4PSXA 1WQ2A 3KP6A 4NB5A 1Y1VJ 1MSFC 3ELKA 3S93A 3GX4X 2OCEA 3SQNA 3ZQFA 1X1CA 2OPTA 3M1CA 4MQ9F 2OU2A 2VJJA 4LMYA 3OYCA 2LF7A 4LITA 1IRGA 2ZMEC 3DV8A 2IA1A 1KU9A 3C7JA 4JP0A 5E3NA 3ZMUA 2GXGA 3T5XA 1SFKA 2W84A 1CF7A 1IDYA 2HPIA 4RS8A 1PDNC 3G4SI 3A0BC 1UAAA 4P5OA 4HLYA 1ETXA 1MDMA 2VXZA 1IDZA 2OQRA 2GQQA 2JUGA 3B73A 2NNYA 4RAFA 3KZZA 2NS7A 1Z6TA 3M9AA 2CU7A 3J81Z 2Y0MA 4WXDA 2ZJ2A 4HDVA 4RLFA 1V4RA 3N05A 5DM7F 1RI7A 2HQNA 3W2WA 5TRDA 1OCTC 2OTJI 4RB1A 1MMSA 2HFHA 2LKSA 4MTDA 2ICWG 3H5RA 1U0JA 1HKTA 3NQOA 4FASD 2QQ9A 2QEXI 4CGZA 2K9SA 2DU9A 4FISA 5M3FJ 1S7AA 2E1MB 2B63J 4KJZA 3WTYC 4ETSA 5DD4A 2M0CA 3TW7A 2CMPA 4Z2YA 4BBRJ 1W0UA 1FP2A 1W36C 4NC6A 3GZ5A 3P9CA 5L3CA 1WFXA 4CO8A 3GTOJ 2H6BA 1U5TA 1MMAA 2OAZA 2ZC2A 1T39A 2O7OA 1E3OC 1POGA 1TQIA 2KPMA 1QA6A 1ONVA 4KIBA 1GUUA 2KP6A 1MJBA 1DGRM 2DOEA 2LG4A 4A3JJ 4UNOA 2HOAA 2PJPA 3H0GJ 3IWZA 4LK1F 1R00A 1LDJA 3KP3A 3WU0A 4D7MA 3JSOA 3V42A 1OYIA 3I0TA 2PG4A 2X1DA 2NS8A 1B9NA 1T2KA 4ZYAA 5JI6A 2ZXWH 4B4CA 2DMQA 3J7AO 4I0BA 3SYTA 4F91B 1IZ1A 3KP4A 2GBYA 1OCCH 1MJ9A 2XASA 4BKXA 3BZ6A 1Y1WJ 4AM3A 4L9TA 3RKQA 2A6TA 1SAXA 3J81K 2A6EF 4M6XA 2XPUA 2ISYA 3E97A 5J3LA 3HOVJ 5KCMA 4KIGA 3KYDB 4IPAA 2VI6A 1LVAA 2V9KA 3G6EI 4HPQA 3QYFA 4A3KJ 2ID6A 4C3JJ 2E5ZA 1PUEE 3HRMA 1TZLA 2XAUA 1I6HJ 4FE7A 3CCYA 2ESNA 3LSHA 2L4AA 3AAFA 3IH3A 2R4GA 3BROA 2XKPA 4MQVA 3K70D 2Q8KA 3GEZA 1R22A 3RIRA 1ZGAA 2OD5A 1P9QC 1E17A 1E3HA 1IRZA 1NG7A 3K4JA 2ZJQF 4NQWB 1P7JA 2M3AA 5D6FA 5D8LB 1AWCA 3I56I 2E2HJ 1X1BA 3HGGA 3FK6A 3PSIA 4ESJA 1BR2A 1VI0A 3VSLA 1JHHA 4XN0A 2ZJRF 2WC2A 4XM3A 1UHWA 5KAIC 1ON2A 3QU3A 2P7VB 1FIPA 4OWRB 3JRIA 3DEEA 3IH2A 4Y3OA 4RAZA 5D5VB 1TQPA 1TT0A 3SJMA 5IT3A 3CCEI 2DK8A 4I99C 4DYRA 3T0YA 3D5LA 4E7ZA 1PUFB 1DDNA 2DPUA 2ESHA 1V3FA 4U88A 2VKEA 2F6CA 2L54A 4ABZA 1K78B 1E0EA 4XQFA 3QYEA 1SFXA 4Y15A 1XDSA 2IGKA 2HR3A 2IPQX 3CO7C 4OIPF 2PMHA 1ETYA 3GTGJ 3S2HJ 2VUMJ 3J80K 5ICEA 1VNDA 2CO5A 2JPCA 3PQJA 4BHBA 1ORKA 4BAYA 3UKGA 1WZ2A 2R7WA 2O0YA 1LKXA 3DLAA 4PJLA 1RPWA 3HOUJ 3GO5A 3TP0A 3DKYA 3CUQB 3W2VA 3N97A 1JUPA 2IGNA 4G6TB 2ISZA 1YIJI 2IP2A 3HC7A 4XK4A 3CCRI 2KDZA 3DBHB 1UG2A 2E36A 1DQUA 4A3MJ 1XMXA 1HC8A 2M2EA 3GUDA 1HOMA 3MZ8A 3LA3A 2IEKA 4B48A 2ZMEB 4UV8A 1YW9A 2LREA 4PJJA 5ED4A 1U9OA 3V7RA 2E60A 4A0YA 1B72B 4J01A 4YFXF 1RIOH 3BLYA 3HTSB 1R4MB 5GPCA 2L2OA 2BXYA 4ZYDA 3CCLI 4HDUA 5B66C 1FYKA 4RGSA 4QPQA 1MH3A 4CYDA 1VQOI 4WXHA 1JE8A 1EH7A 1GVDA 3K1MA 2X6OA 1I50J 2GA2A 2ECCA 2P6SA 4F93B 1R1TA 3PIPF 1FJLA 1OYWA 1R4NB 1TW2A 5IY5H 1T0FC 3HOXJ 3P9IA 3AFHA 4NQWA 4LLLA 4HX8A 3W6KB 4U87A 3HDDA 4HYEA 3MQ0A 5FJ8J 5LHHA 2DTZA 3RPQA 3K0LA 2HQRA 5L3DA 3ABLH 4ZZLA 2DJNA 3TO9A 1UZCA 4G7HF 2FE3A 3DTIA 2RKHA 3KLOA 3EQLF 4KN4X 5EZGA 2G9WA 4FETA 3OYEA 3K70C 2ZNZA 1N77A 2V79A 3F8FA 4NNJA 1Y8RB 2OZ6A 4PK4A 3F8MA 3S15J 2DO7A 3HZJA 1MH4A 1PUFA 5LHIA 3FF5A 2HU9A 2HKOA 1RESA 1K78A 2A5WA 1MBGA 2ID3A 1R7JA 1Y0NA 4A69C 4F52A 4XN3A 5LHGA 3PFIA 3F23A 4MHGA 1R49A 1VQKI 4RGRA 4L0ZB 1U6GA 1H9GA 1WJBA 2VKVA 1J59A 2F4MB 4LLNA 1FSEA 3KEQA 2JA5J 4CCJA 3HKZN 5B1AH 3IAS2 5KAFC 1J5YA 3WE3A 5EG0B 2CYYA 3CTAA 3OS1A 3OYFA 3LSGA 1JKRC 4Y33A 2NOGA 2JSCA 3CMEI 3IKTA 3HHHA 4MFDA 2Y69H 3SZGA 3OSGA 3S8PA 1G3TA 4BUPA 1BOAA 2MW8A 1DPRA 3BDDA 3CUQA 1JI8A 4HW0A 2L9SA 5J4VA 3Q9VA 1OYYA 2WAQN 2XIGA 3EPZA 1TWHJ 3K4CA 4N9IA 1FOXA 1K83J 2X9DA 3S14J 2EPFA 4EVIA 3IL2A 4A6EA 5LRSA 2EIMH 4G7OF 3R0JA 2HDWA 3WTZA 4BL0B 3OYMA 2H27A 1Y8QB 2XGEA 2AHQA 1TTYA 4M6YA 3HJEA 1U5TC 5E8GA 1YQAA 4GYGA 1WGXA 2ZMEA 2LK2A 2DFHA 4RDUA 2DT7B 5E17F 1B72A 4IHWA 1YW7A 2ZFWA 2DFIA 2EBIA 1I3QJ 1TWGJ 2ACJA 1K61A 2HZTA 1I39A 1R71A 5ILUA 4D5FA 2ZBKA 2KLOA 3ISPA 2XPWA 2DA4A 4M74A 3ZQQA 3RYRA 4A2UA 2ZB9A 3ASNH 2WA0A 3ZR8X 5E3OA 3OYLA 4MEXF 3JREA 3E6BA 2X6YA 4DJAA 3B6CA 1JKOC 2V6CA 1ZTRA 1Z7LA 3ABUA 3BCAA 2HXOA 2ZXIA 1CGPA 2ZFUA 4L5JA 1TT5B 3GYHX 3L9FA 3VODA 3RSNA 5D8KB 4O6JA 4UV9A 2K02A 4MEYF 2JA6J 3Q5FA 2XDVA 3HOZJ 2GWRA 3NRVA 3BG3A 3GCMA 2DAOA 2CFXA 2COBA 1TNSA 3RDIA 1V5FA 5J1YA 2F5FA 4EM0B 3S1NJ 2EV0A 1KU3A 1W4MA 3A0HC 3I59B 1G2HA 3HGYA 1BC7C 1YRNB 4RB3C 3J7YJ 2KZVA 2XF5A 4I7HA 2KKOA 1H89C 2R7RA 3CESA 3F0CA 4IRHA 1IXCA 1K6OA 2XVCA 4HX4A 4XOPA 3LSKA 3S1QJ 3DF8A 3QP5A 4UVAA 2EZIA 3LSIA 5A2QZ 5IYCJ 5EGOB 1CQTA 4XIDA 1XD7A 1XGSA 1TL8A 2YX7A 3FMSA 3WTWC 1DU0A 4L18B 1QRYA 2V1XA 3BPVA 2DQLA 3S2WA 3K4NA 1V55H 2TDXA 3EDPA 5EG0A 5LRRA 3ONQA 4HZFA 3RPUD 4FX0A 3AG2H 4UUSB 2PMZN 3K9TA 3BTIA 2DMNA 2FF4A 4XNFA 1MNMC 3ECOA 2W48A 3PUFA 5BQTA 1S9HA 3X2QH 1Z3YA 3I3LA 4ZC3A 4XLAA 2YPRA 4B8XA 2O3FA 4P96A 4D1QA 1T95A 5K5OA 5ICCA 5ICFA 1ZGJA 2E1MC 3IP4B 5IP7J 3DBLB 3WGGA 1I1GA 2O9LA 2K3PA 4IHTA 4DBQA 1U8BA 1GT0C 4RM3A 2BVLA 3WTSC 1OLTA 2MLKA 3BR2A 3ECHA 4KFCA 3JRGA 2L01A 1VF9A 3QOEA 2HVRA 1WH7A 2D1VA 4P55A 3HTUA 5DDGA 3O8HA 3COAC 4KMUX 5DEQA 2DA7A 4HBLA 4RMNA 5F0FA 2W1OA 3L7WA 3LAJA 4HAMA 4K2EA 2VJ5A 1AU7A 3W6VA 2J5PA 2JVGA 3Q0UA 2LSOA 1ZR2A 2RQQA 2UXNA 1DUXC 4G6QA 1Q1VA 4FT8A 4U0WA 2GIZA 4S05A 3RZOJ 4BQAA 2ZXJA 4LG0B 1BA5A 3V7CA 5A2QK 1D1BA 4M3FA 1X3UA 2IA2A 4BDZA 2R92J 2KRFA 4LIVA 1ACIA 5C3EJ 1BI3A 3VFZA 1HDPA 2CSOA 4PSWA 1PP7U 4A3GJ 1PJRA 2A69F 4M3DA 2MA3A 5L3FA 3PO2J 1Z77A 2O8XA 4OINF 3CF5F 3E5UA 1T38A 2DTRA 3S1RJ 1HKQA 5FKKA 1O7FA
chains in the Genus database with same CATH topology
4XLHA 2DOAA 4YEJA 3H5RA 1U0JA 4XLEA 3DPUA 4RM2A 3LMMA 4FASD 3OS2A 4PJMA 3MKWB 2OC6A 1ZELA 2E1MB 4R79A 4KJZA 4D9JA 1UELB 2WY7Q 2GOXB 2CMPA 1W36C 1WFXA 4BEHA 1MMAA 4E7LA 3CJRB 2KRCA 2KPMA 2UWMA 2LY1A 2KP6A 4KT6A 1DGRM 2LG4A 2V26A 2LH9A 4B3XA 1D1AA 4QPOA 3DPTA 2V4JC 2VXDA 4CZCA 1YX5A 3V42A 4DGWB 4NC7A 2CW8A 2IS4A 4E7SA 1MNEA 2VIXA 3HPHA 4ITVA 2X1DA 3PNVA 3BCBA 4XOTA 2X1CA 4ZYAA 1PYVA 2F5VA 2IGMA 4CCKA 3KYLA 4C2UA 4OAYA 3DU5A 3SYTA 2ZSIB 3A1YA 4F91B 2JVHA 4GRIA 2HPMA 3CJQB 3M8JA 3CMMA 3NWTA 2A6TA 1J09A 2LYCA 2Z2SB 4N4NB 1WJDA 2BW3A 5KCMA 3VWBA 2L5QA 2V9KA 4HPQA 3QYFA 2E5ZA 2FUG2 1TZLA 2XAUA 1X1DA 4BGDA 2WBMA 3LSHA 2R4GA 4HRIA 3K70D 2O5RA 4ZJZA 4AVZA 4B47A 1P9QC 3HPGA 4CCNA 3OYNA 3OS0A 1NG7A 3K4JA 2IGOA 4NQWB 2HNHA 1QHGA 2M3AA 3OYBA 1X1BA 3FHNA 3HXLA 3W2WA 3PSIA 4N4OB 1BR2A 5HLTA 1D0XA 3VSLA 4XN0A 4P1WA 4E4HA 2PJRB 2OUMA 1Y6IA 3DTKA 4XM3A 2VJ4A 3PNYA 2ZXHA 1LDKB 2W00A 2HZDA 2K5CA 4CA0A 3H5AA 3CF2A 1MMNA 4OWRB 1Z3XA 3DEEA 3LSMA 4Y3OA 3ZCOA 4ZTFA 1DP3A 2CS3A 3OYJA 4ZDPA 1TT0A 2QKMB 1MNDA 3OL4A 3D5LA 4E7ZA 3MD2A 3OYIA 2R7TA 2F6CA 1MMGA 4MLOA 1WJAA 4XKBA 1AA7A 1E0EA 3H35A 4XQFA 3D5RC 2E5NA 5HNHA 3QYEA 2IGKA 3TMOA 1BOBA 2R7VA 3MKZA 3E1SA 3H9JA 3RCOA 2I8DA 2KL4A 3HOTA 1KONA 3K4MA 2V6EA 1Y56A 1WJFA 4XR6A 2XC7A 4XKCA 2CV1A 3SDBA 4CCOA 1UG0A 2R7WA 2HVSA 3E0JB 2HVQA 1LKXA 3DLAA 4PJLA 2LRDA 4OAZA 2JA2A 4F55A 2AQEA 3H9QA 4JQFA 3VYUB 5KHDA 1Z21A 3DKYA 3W2VA 3DQVC 2IGNA 4G6TB 5CQGA 3HC7A 2KRHA 4NUBA 1X19A 1LVKA 1FMWA 3OYKA 2V7FA 2CW7A 1ERDA 2K9MA 1DQUA 3FKJA 4F3QA 3PJRA 2X6XA 4XONA 4B48A 2LREA 4PJJA 2UV1A 4BJ5C 3HUGB 2E60A 1W36D 3HL2A 4J01A 3UR3C 3BLYA 5HVQC 3J7AY 1V5EA 2Q1ZB 5TGTA 2L2OA 2IS2A 2LBFB 3OYGA 1HA8A 3SEZA 4QPQA 3CP2A 3W2AA 4YELA 3EUKL 3DTEA 2LC2A 2M7AA 2HQAA 4C2TA 4E6KG 3BG7A 3HKZA 2R7OA 3VYRB 2VQHA 2WAEA 3K4BA 5CPRB 4F93B 1G59A 3OWTA 3L2UA 1BR4A 1T0FC 2VPLA 3CZ6A 3AFHA 4J00A 4PUSA 4E7JA 2QKLB 2W7NA 4ZTJA 4U87A 3ZRGA 1N75A 2UUZA 2KHMA 2R7SA 3PSFA 4X0GA 4CUGA 2WAQA 3DPLC 2PJRA 1N78A 2AQFA 3DTIA 4EATA 4RLQA 4CH7A 4FETA 2VQLA 2L7KA 1D1CA 3LFUA 3OYAA 1V5GA 3OYEA 4NNJA 3K70C 4BE0A 1N77A 3VDXA 3G2BA 2OV7A 1YE9A 4PK4A 3A4CA 4AU7A 3FDYA 1YX3A 2IXSA 2Z16A 3S3NA 2CV2A 4ZDLA 2WADA 1LFPA 2RNGA 2Y0SA 3K10A 3CP8A 2CH0A 2HU9A 4HNTA 2K9LA 3QODA 2A5WA 2IS6A 1MMDA 4F52A 4XN3A 1X1AA 5CQEA 2W82A 4BQQA 4HG2A 3FBIB 2ELJA 3BC8A 3OIPA 3VYTB 5JHFA 2R7XA 1WJBA 4BU2A 3EUAA 2L9NA 4CCJA 4BJTA 3IAS2 2BVMA 4AYBA 2KQRA 3OMYA 4BS9A 2MABA 3PUBA 3OS1A 3OYFA 4PFPA 3DKXA 5FRMA 3LSGA 4CCLA 4IKFA 2IS1A 4Y33A 4IX7A 4BE2A 3OOUA 1K6YA 2X85A 4B43A 3SZGA 3S8PA 4BUPA 2M7BA 1JI8A 2MC4A 5LFAA 1GLNA 2VL8A 3IAM2 2VASA 2L9SA 4ANJA 1X4PA 3AL0C 2R7UA 4HSRA 2WB1A 2MYSA 3EPZA 3K4CA 2DCEA 2CV0A 1EA3A 3OYHA 1NG6A 4XKWA 2HDWA 4BL0B 3OYMA 3NWSA 4HSTA 4DBRA 2DT6A 2RREA 3S32A 3K4KA 2DXIA 3DU6A 2DT7B 4BDYA 4LIUA 2X6WA 3IUOA 4KISA 2LBFA 5KNLA 4C30A 3S3OA 3OR1C 2KLOA 2MFZA 3PFYA 4XMYA 2F4IA 1WJCA 2VQCA 4YRVA 3F9KA 3ZQQA 1WJ5A 5FROA 1VZ0A 5HOOA 3H0DA 2WA0A 2XF6A 3ZR8X 3OYLA 2VLAA 2X6YA 4DJAA 3TL4X 2PMZA 2VQGA 2MD0A 1Z7LA 2X51A 4BACA 3BCAA 1IRXA 1DGWY 2ZXIA 2ZFUA 3BG6A 2M4GA 3KX2A 3I9V2 2JSPA 3L2RA 4JOMA 3RSNA 2VKHA 4BJ6C 2R7QA 1SAUA 3PL8A 3MKYB 3MMYB 4E7IA 3K6GA 4IZZA 2XDVA 3H9GA 4ZDOA 3ZXSA 2WY8Q 2WAFA 2GOMA 3EUHC 3C2GA 3KEYA 3TBIA 3VSKA 3AL0B 1G8XA 3RTRA 1V5FA 3OR2C 3C2HA 4IQ4A 4NC8A 1QHHD 4E7KA 2M0MA 1D0ZA 4E7HA 5HNFA 4PFOA 4Y4RA 4XLCA 3L2WA 2KZVA 2XF5A 2LY2A 4BEHB 3PNTA 2R7RA 2BOLA 4C9YA 4U7BA 2P0WA 3CESA 4BQNA 4XOPA 3OL3A 1X4OA 2Z1DA 3LSKA 1BR1A 2XSJC 3LSIA 2LOOA 4XKVA 4II3A 3GBGA 2KDOA 2W4SA 3W3CA 3K4NA 3OIQA 3ONQA 4DIQA 1QU3A 3RPUD 4XNFA 1FMVA 2ZSHB 4KITB 1S9HA 3K4LA 1Z3YA 3D5SC 3I3LA 4ZC3A 4CSWA 4II2A 3LL7A 4XL9A 3L2QA 4XLAA 3HOSA 2DJIA 2V1NA 2VJIA 2VB6A 2BW3B 4D1QA 3U21A 1T95A 4HNUA 2E1MC 3IP4B 4XORA 2CUJA 3RQ4A 1OR7C 2VKDA 4H4KC 2K3PA 4DBQA 3DWLE 2XF7A 1D0YA 4RM3A 4DOZA 3S3MA 5FRNA 2BVLA 4PJNA 4XLFA 4PSXA 2M4KA 1OLTA 5LD2C 3S93A 1X1CA 3UNGC 3QOEA 3L2VA 3M1CA 3OYCA 2VJJA 2HVRA 3FBNB 1WJEA 4LITA 3OY9A 2KMUA 3A2KA 4BXFA 4F92B 4RMNA 3AKZA 2W1OA 2VJ5A 2NOJB 5CKTA 2JVGA 2CUZA 1SFKA 2RQQA 2HPIA 4B44A 3SEQA 1UAAA 4P5OA 3ZGKA 2VXZA 1D1BA 2JUGA 4BE1A 4BDZA 4LIVA 4CCMA 4LG3A 4PSWA 1PJRA 2Q2EB 3HG9A 3OYDA 3QYBA 4HEA2 3VYSB 4BQOA 4IQJA 1R6RA 1MW7A 4RLFA 2CFOA 3N05A 2X1EA 3H5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D5R C;  2GOX B;  2WY8 Q;  2NOJ B;  2WY7 Q;  3D5S C;  2JVH A;  2GOM A;  2JVG A; 
#chains in the Genus database with same CATH topology
 4MIM A;  2EZK A;  4XLH A;  4YEJ A;  4XLE A;  3DPU A;  2KT0 A;  3OS2 A;  4PJM A;  1X3W B;  4A12 A;  1XS9 A;  3JRA A;  3MZY A;  3HBL A;  3TW6 A;  4IF4 A;  4D9J A;  1UEL B;  1W5S A;  3I59 A;  1YRN A;  3CJR B;  4ZYE A;  1ZLK A;  2P5V A;  3OV8 A;  3IC7 A;  1IV6 A;  2JK3 A;  1ZQ3 P;  5ICG A;  2V26 A;  5D5U B;  1W5C C;  5EGO A;  3GTL J;  1QVU A;  2D2W A;  3LA2 A;  3TQN A;  2LMD A;  5DS9 A;  4QPO A;  1JHF A;  1OFC X;  2CJJ A;  1YX5 A;  1K7A A;  4V19 K;  1P4A A;  2GZW A;  2IS4 A;  4IRG A;  2EFQ A;  1FNN A;  3G1M A;  3HPH A;  3LQR A;  4E7S A;  4ITV A;  3PNV A;  3FX3 A;  2R5Y B;  2R5Z B;  2DMT A;  2O03 A;  2X1C A;  1PYV A;  2F5V A;  2XKO A;  4UUS A;  2IAI A;  3A1Y A;  3L1P A;  4P9F A;  3M8J A;  1IUF A;  5KVR A;  1HCR A;  2V1D A;  3CMM A;  2MH9 A;  2EFW A;  5FO5 A;  3CCM I;  1OQY A;  4JX6 A;  2O6G E;  3KE2 A;  1J09 A;  2A5Y B;  1OCZ H;  2LYC A;  4FTH A;  1WJD A;  2DMU A;  5E1X A;  3WHC A;  1NHA A;  2H6C A;  2FML A;  1FIA A;  2L5Q A;  2GA1 A;  4I98 B;  3I55 I;  2FUG 2;  1KZH A;  3BR0 A;  1X1D A;  2CQQ A;  2DW4 A;  4GYI A;  3EUH A;  4KIF A;  4BGD A;  4BHP A;  2OZU A;  1T0F A;  3LSR A;  3NEU A;  3JRD A;  4J19 A;  1H0M A;  2RAE A;  2XGC A;  3IRQ A;  5FKL A;  2QUF A;  3MVP A;  3BY6 A;  2OF7 A;  1SFE A;  2X4H A;  3WHB A;  2ELK A;  1VQ8 I;  2IGO A;  1UMQ A;  4GDF A;  4I09 A;  5GAH J;  3OYB A;  2A3S A;  1XSX A;  2FD5 A;  1LEA A;  3K7A J;  4LG0 A;  4N4O B;  2A68 F;  4DZJ A;  1WPK A;  4P1W A;  3FMR A;  2PJR B;  5DTD A;  1Y6I A;  1VQP I;  3H3V K;  2HZD A;  1JKP C;  2HTS A;  1Z3X A;  4M72 A;  2G7H A;  3LSM A;  3ZCO A;  1R1U A;  1DP3 A;  3B6A A;  2K7L A;  1SEU A;  2K40 A;  5EEA A;  2FXA A;  3OL4 A;  5D4R A;  2OA4 A;  3F6O A;  4LB5 A;  3MD2 A;  3E3V A;  3CDI A;  2QZ8 A;  3OYI A;  3CO6 C;  5D6E A;  4MLO A;  1MMG A;  1X2N A;  2LDU A;  1YS7 A;  3VPR A;  3IH4 A;  5HNH A;  1ODD A;  2E5N A;  3D5R C;  3CCJ I;  2VT3 A;  1C0W A;  2K9N A;  1S72 I;  3MKZ A;  3E1S A;  1SVM A;  3GVA A;  2CQX A;  2JT1 A;  2I8D A;  2KFD A;  2KL4 A;  2TRT A;  4LGW A;  3K4M A;  3HOT A;  1Y56 A;  3E7L A;  1TLH B;  4XR6 A;  2V9V A;  1X2M A;  2HYF A;  2E7W A;  3TP3 A;  2HVS A;  2HVQ A;  1BW6 A;  3HHG A;  2D5V A;  3C1D A;  3FKI J;  2AQE A;  3VYU B;  4QIW N;  5B5E C;  1NK3 P;  4CZZ A;  3DQV C;  4HF1 A;  1XG1 A;  2FX0 A;  2Y30 A;  1QZE A;  3ZQ7 A;  2R5Y A;  2R5Z A;  4E70 A;  2IT0 A;  4LLG F;  1MBE A;  1QZZ A;  3TED A;  4DYC A;  4MNU A;  2CW7 A;  2CRG A;  1J0R A;  2K9M A;  3TDU C;  2QF7 A;  4W97 A;  3WTU C;  3FKJ A;  2Y9Z A;  3R4K A;  1FTT A;  4AIJ A;  2K4B A;  4BJ5 C;  2R3S A;  5FLX K;  3UR3 C;  2DN0 A;  1SD5 A;  3ZQC A;  2X48 A;  1Z91 A;  4A5M A;  2MSY A;  2BZT A;  5HDK A;  1YI2 I;  3CP2 A;  3FXK A;  2JJ7 A;  4EM2 A;  1EV7 A;  2DA2 A;  1B9M A;  3KP5 A;  1IG7 A;  2LC2 A;  2HQA A;  2VBY A;  3HKZ A;  1FSH A;  2VQH A;  2WAE A;  4P9U A;  2KIQ A;  1A04 A;  1G59 A;  3GFI A;  2JA7 J;  1BR4 A;  4LFU A;  1H88 C;  3CZ6 A;  3DEW A;  3OOP A;  4J00 A;  4E7J A;  4ZTJ A;  3ZP5 A;  3HYI A;  2H94 A;  2C6Y A;  3ZRG A;  2KIM A;  4QLC U;  2UUZ A;  4KMF A;  2LLK A;  2NVQ J;  1BM9 A;  3J80 Z;  2JRM A;  4X0G A;  3F8B A;  1YTY A;  1LEB A;  2WAQ A;  3HSF A;  3M4O J;  2PJR A;  4I02 A;  2DA1 A;  3DFG A;  5DCM B;  2MD5 A;  4D0P A;  4CH7 A;  4RAY A;  2L7K A;  1D1C A;  4RB0 A;  2A07 F;  1T98 A;  2BEO A;  1VQ5 I;  1MBJ A;  2P7C B;  2BYV E;  3G2B A;  4L9V A;  1M1E B;  4X6A J;  1ZKG A;  4AC0 A;  1XCB A;  3FDY A;  3ABK H;  3GXO A;  4KA4 A;  1MBF A;  2WAD A;  2K9Q A;  1LFP A;  2RNG A;  2EZH A;  2VBX A;  3I4N J;  3I54 A;  1FWZ A;  3CP8 A;  3GW2 A;  1XSD A;  4HNT A;  3GFJ A;  2F5E A;  1AKH B;  4QSH A;  2IS6 A;  3H36 A;  2BE5 F;  4NDL A;  1X1A A;  2HQ5 A;  3M07 A;  5CVU A;  4BYY A;  5DD8 A;  1QBJ A;  3FXO A;  4ON0 A;  1ZG5 A;  3FBI B;  1KGS A;  5EF6 A;  3VYT B;  3R60 A;  2EIL H;  3R61 A;  2ZNY A;  1HXD A;  2L9N A;  4BJT A;  1IGN A;  4YFN F;  4L5I A;  5K7F A;  2KQR A;  3N4M A;  2M34 A;  3PUB A;  4PFP A;  5FRM A;  2IS1 A;  4CCL A;  3J7Z I;  1QVT A;  5E18 F;  3ZPL A;  4BE2 A;  3EYY A;  1K6Y A;  2X85 A;  4A6D A;  5F1J A;  3FM5 A;  3K1N A;  3FXR A;  4GGG A;  3CD6 I;  2MC4 A;  3DKW A;  4Y7N J;  5LFA A;  2VL8 A;  3IAM 2;  3KFW X;  4G9Y A;  4Q4Z F;  2MYS A;  2VE8 A;  3DEU A;  3Q9S A;  3MFK A;  2QCO A;  4HF0 A;  1EA3 A;  3ZMT A;  1D5V A;  3OYH A;  1NG6 A;  4EJV A;  1ETQ A;  4DBR A;  3KP7 A;  2DPD A;  3S32 A;  2DXI A;  4IHV A;  3MAJ A;  4BDY A;  2X6W A;  3ESW B;  2XPV A;  4XSZ F;  1R36 A;  2Y0S N;  4LOC A;  2E34 A;  4RB2 C;  5KNL A;  1OKR A;  1AHD P;  5DYM A;  1BI2 A;  3WU1 B;  5L3E A;  1E2X A;  5C4X J;  4UXN A;  3S3O A;  2EIK H;  4XMY A;  2F4I A;  2DA6 A;  1VFC A;  2EQR A;  5FRO A;  1YS6 A;  4ZH4 F;  3H0D A;  1KQ0 A;  2XF6 A;  5C44 J;  1HF0 A;  1RUO A;  4MGR A;  2ZJP F;  4A3L J;  3ZQH A;  1KYZ A;  2PMZ A;  2EH3 A;  4WF2 A;  5FKN A;  2E1N A;  5JHU A;  1SC7 A;  3I53 A;  1IRX A;  2BY3 A;  2Z9O A;  2DFF A;  4LK0 F;  1KA8 A;  2M4G A;  3KX2 A;  1OPC A;  3QPT A;  1TW3 A;  4JOM A;  1SFU A;  4KNY A;  4BJ6 C;  2R7Q A;  3CMA I;  2EIN H;  3K6G A;  3HRS A;  2Z5U A;  3WE2 A;  3GLL A;  5L3G A;  4IZZ A;  1MGT A;  1U2W A;  2Z3Y A;  1T08 B;  3CUO A;  5DCM A;  3KYC B;  1TWA J;  2GOM A;  3EUH C;  3KEY A;  5FKM A;  3AL0 B;  3VSK A;  1XC5 A;  3HSE A;  4IQ4 A;  4NC8 A;  2EV5 A;  2V9P A;  1O3R A;  4Y4R A;  1IAW A;  4XLC A;  3L2W A;  2I10 A;  4JX4 A;  1T56 A;  4BEH B;  3JR9 A;  3PNT A;  2OJE D;  2BOL A;  1AKH A;  2H1K A;  1QQI A;  2LNB A;  2XRN A;  4C2M J;  2KJB A;  2QSG X;  3ASO H;  2XRO A;  1A31 A;  3OL3 A;  2Z1D A;  2FA5 A;  4I2O A;  3U9G A;  5J8C A;  1RKW A;  1I27 A;  2LF8 A;  2LFB A;  2QGU A;  2BBY A;  3G1O A;  2O61 A;  3V8L A;  5GTH C;  3L2C A;  1B59 A;  1LFB A;  2H8R A;  3O2P E;  1XB4 A;  1IUY A;  2W4S A;  4MO7 A;  3A03 A;  3WG9 A;  4DIQ A;  1QU3 A;  1RUN A;  4UVB A;  2P4W A;  5AIQ A;  2XSD C;  5JVT A;  3W6J B;  1FMV A;  2ZSH B;  4KIT B;  4GCV A;  2Z99 A;  4BXX J;  3D5S C;  2PI0 A;  1F36 A;  2RVC A;  1TP4 A;  3HSR A;  2TCT A;  4N9H A;  4ZYH A;  2BW3 B;  2YSR A;  3BG5 A;  2RV8 A;  3RPU A;  1T33 A;  1A35 A;  1D0Y A;  3S3M A;  3FM3 A;  1OJL A;  4KUM A;  5JLW A;  1QNT A;  2M4K A;  2LKX A;  1XN7 A;  2FQ3 A;  1YFH A;  1XGM A;  5D5X B;  2QQA A;  4UHT A;  2EA2 A;  3BR5 A;  3UNG C;  3PQK A;  3FXL A;  4IVN A;  1ETK A;  1FOW A;  3LNQ A;  3A2K A;  3KP2 A;  3CLO A;  4TV7 A;  3AKZ A;  2FBH A;  3FIW A;  2NOJ B;  1JJ6 C;  5CKT A;  1ZLJ A;  2CUZ A;  3I4P A;  3MKL A;  2Y9Y A;  3JW4 A;  2ETH A;  3JRC A;  5CLS A;  3SEQ A;  2M8G X;  1O7L A;  4WX9 A;  3O6B B;  3WGH A;  1O3T A;  1BW5 A;  3SZT A;  3KIO A;  2WTE A;  4FHT A;  1VQ9 I;  2DMP A;  3G3Z A;  2Q2E B;  3HG9 A;  3OYD A;  3A01 B;  2E71 A;  1NK2 P;  4XRF A;  4Y17 A;  4HEA 2;  1MIJ A;  3VYS B;  2E2J J;  3BZC A;  1G3S A;  4IQJ A;  1K79 A;  1R6R A;  2PLY A;  2QWW A;  3DXJ F;  3ZN0 A;  1UJ8 A;  3V8K A;  3JRH A;  3CCS I;  1OCR H;  2YU3 A;  3JAM K;  5LEJ A;  3H5N A;  5JLX A;  1L3L A;  1KYW A;  1KU7 A;  3LMM A;  3ERM A;  4RA2 A;  5BMZ A;  4R79 A;  4B3A A;  4XRM A;  5GAG J;  1JGG A;  2WY7 Q;  4HOB A;  1DPU A;  1HST A;  3QAH A;  4BEH A;  4M73 A;  5K7Z A;  4WCG A;  4FX4 A;  4A0Z A;  4E7L A;  1GVJ A;  1OIS A;  2DI3 A;  5LGT A;  2LY1 A;  3BOQ A;  4UVC A;  2PX9 A;  3GME A;  3LA7 A;  5J6X A;  5HLH A;  4GXO A;  5H20 A;  1K4S A;  4ENK A;  3BTL A;  2VXD A;  4CZC A;  3WGI A;  4DGW B;  4NC7 A;  2CW8 A;  3H3U A;  1BBY A;  9ANT A;  2DLL A;  1J2X A;  1MNE A;  2VIX A;  1YO5 C;  1BI1 A;  1S29 A;  5ERI A;  1R5G A;  4XOT A;  4CCK A;  3KYL A;  2IGM A;  4C2U A;  4OAY A;  4L0Y B;  4L9J A;  2ZSI B;  2DT5 A;  2HPM A;  2JVH A;  3I4M J;  3S1M J;  1OCP A;  5H6R A;  1A6I A;  4Q47 A;  2QM3 A;  2KJC A;  4UUT A;  3K2Z A;  2K85 A;  1Z1D A;  4LJZ F;  3U1D A;  2Z2S B;  2BW3 A;  4LB6 B;  2ME6 A;  4N0B A;  4EGY A;  1LDD A;  5B3S H;  5J1U A;  2EK5 A;  2VC0 A;  4DQ2 A;  1VQ4 I;  2CQ7 A;  2WBM A;  2EFO A;  1ZH5 A;  4PGG A;  5EYR A;  5LLQ A;  1ZRE A;  3WTX C;  1O57 A;  1O4X A;  2O5R A;  4FE4 A;  2LTP A;  4AVZ A;  1YJW I;  2EJR A;  2BV6 A;  4B47 A;  2L0K A;  1USS A;  3SDG A;  5DM6 F;  4HA8 A;  2L9V A;  2VBZ A;  5IOY A;  1J7K A;  1V54 H;  4JK1 X;  5JFR A;  1QHG A;  1YW8 A;  1Z0X A;  2P8T A;  3GTM J;  3HXL A;  2RNJ A;  2YUS A;  2K3F A;  1ZAO A;  2STT A;  2ELH A;  4HV6 A;  1QGP A;  5HLT A;  5TJJ A;  1ETO A;  4HNV A;  4NHJ A;  2VJ4 A;  2EFP A;  1WSU A;  1LDK B;  2M5W A;  2Q2E A;  1Y0U A;  2KZG A;  2W00 A;  3A01 A;  2K5C A;  1FP1 D;  2VOP A;  2UZK A;  3E6M A;  4ZTF A;  2JN6 A;  2DYR H;  1ON1 A;  2Q0O A;  4B1R A;  3JRF A;  4EGZ A;  2RN7 A;  3C18 A;  4CHU A;  2HTJ A;  2MG4 A;  2NYX A;  1VTN C;  2DBB A;  1WJA A;  1LQ1 A;  3F8N A;  3S16 J;  1AA7 A;  3H35 A;  1QPM A;  4CYC B;  2QLZ A;  2FNP A;  1IRF A;  1BOB A;  3REO A;  4CDG A;  4Y13 A;  2R7V A;  2UXX A;  3PIO F;  2VPR A;  1RET A;  3H9J A;  5E1Z B;  5IYB J;  4S0H B;  1D3Y A;  2M1B A;  1VQL I;  1B1B A;  3H92 A;  2QQB A;  1WWX A;  2XC7 A;  3CLQ A;  4XKC A;  3SDB A;  2CV1 A;  2MLG A;  5F27 A;  1UG0 A;  3LSP A;  4M6V A;  3GTJ J;  3E0J B;  1A5J A;  4JQF A;  3ROU A;  5KHD A;  4MFE A;  1Z21 A;  1FX7 A;  5IP9 J;  1LB2 A;  3DBR B;  3FHZ A;  2W25 A;  1VQM I;  1S8N A;  3AG1 H;  4BNC A;  2KRH A;  4NUB A;  1X19 A;  2L3D A;  1GHC A;  1FMW A;  3Q0V A;  3OYK A;  4UB6 C;  3TO6 A;  3WG7 H;  4BBS J;  5LGN A;  1SAN A;  1YIO A;  4PJ0 C;  1O3Q A;  5M3M J;  1ERD A;  2BHY A;  1H9T A;  4IRI A;  4F3Q A;  2PBI A;  2DYS H;  1WH5 A;  3PJR A;  2X6X A;  4XON A;  5E8I A;  1VQ7 I;  2UV1 A;  3HUG B;  6PAX A;  1W36 D;  3K69 A;  1RZ4 A;  1HQC A;  2RGV A;  5HVQ C;  3DLL F;  5TGT A;  2IRF G;  2IS2 A;  2LBF B;  2IA0 A;  1JT0 A;  3OYG A;  4KYW A;  1WCM J;  1YG2 A;  2COM A;  1HA8 A;  2XHK A;  3QOP A;  3CJN A;  5JR3 A;  3W2A A;  4A3C J;  4YEL A;  1PVE A;  1RC9 A;  3EUK L;  1D8J A;  3DTE A;  4C2T A;  3BWG A;  4IEJ A;  1LFU P;  2R7O A;  3VYR B;  5CPR B;  3K4B A;  4CXF A;  1AOY A;  2STW A;  2JRT A;  5HS8 A;  4U7D A;  4DYQ A;  2VPL A;  2DA5 A;  3BJA A;  1F5T A;  2NVU B;  2W7N A;  1FYM A;  2L7M P;  4WXC A;  2BGC A;  4RBO A;  4HX7 A;  5F0H A;  1G6N A;  4M9S A;  1D8K A;  2XUB A;  4A0X A;  4MTE A;  5IOZ A;  4EJT A;  3Q0W A;  2EB7 A;  2VN2 A;  1S7O A;  4ESB A;  1H8A C;  2R7S A;  1FLI A;  1YYV A;  2A61 A;  4A3I J;  3LWF A;  4KDP A;  1N78 A;  3CCU I;  4V2G A;  3RKX A;  1RR7 A;  1SVO A;  1XDU A;  2IJL A;  3G73 A;  3K2A A;  2R93 J;  3HRT A;  2VQL A;  3LFU A;  3SXY A;  3KET A;  3OYA A;  4BE0 A;  3WU2 C;  3VDX A;  2FOW A;  3EET A;  4H0E A;  2IBD A;  3A4C A;  4AU7 A;  2Z16 A;  3S3N A;  1RKT A;  4ZDL A;  1P7I A;  4XSX F;  5CJ9 A;  2Y0S A;  3K10 A;  2CH0 A;  5CYV A;  2OTL I;  1U78 A;  1I6X A;  1UCR A;  5GPA A;  1NH3 A;  2K9L A;  3QOD A;  2Y75 A;  1MMD A;  4CYC A;  2X0L A;  1TNT A;  2OQG A;  2W82 A;  5CQE A;  1XX5 A;  4HG2 A;  2ELJ A;  3OIP A;  4EQQ A;  5JHF A;  5J1R A;  2K4J A;  4BU2 A;  3CCV I;  5H6Q A;  5FLX Z;  4XRS A;  4M9X A;  2M87 A;  2BVM A;  4M3G A;  3OMY A;  4BH9 A;  1F1Z A;  2DK5 A;  4PCQ A;  2MAB A;  4IJA A;  4W1U A;  3TKY A;  3DKX A;  2AS5 F;  2W57 A;  3QQA A;  1FBQ A;  3FXU A;  3KZY A;  4IHS A;  2LD5 A;  2P5L C;  5BNG A;  1S7E A;  2M7B A;  5GTI C;  3JTG A;  3EYI A;  3C2B A;  2JA8 J;  2NVT J;  2MGQ A;  3QPS A;  3U1K A;  2VAS A;  4RGX A;  2OBP A;  1X4P A;  3AL0 C;  2I5U A;  3QPH A;  3A02 A;  2GM4 A;  2DCE A;  1STZ A;  3M1E A;  3JTH A;  2CG4 A;  1KU2 A;  1K4T A;  4Q48 A;  2YU9 J;  2W24 A;  4HST A;  2GXA A;  4RAG A;  1BJA A;  2YS9 A;  2ZKZ A;  3BP8 A;  2D45 A;  2B9S A;  2RRE A;  2RC4 A;  1Z9C A;  1JKQ C;  3HUG A;  3M3Y J;  1SMY F;  2N8G A;  2W85 A;  4XBF A;  4XIC A;  3IUO A;  1X3Z B;  1ZRC A;  2LBF A;  3P9K A;  2FBK A;  4C30 A;  5M5Y J;  3K1P A;  3BG9 A;  2JMW A;  3F3X A;  1MBH A;  2MFZ A;  2HI3 A;  5F1R A;  1S6L A;  4IO9 F;  2VQC A;  4YRV A;  3MCZ A;  3F9K A;  5F08 A;  3TOB A;  1WJ5 A;  1VZ0 A;  3FXM A;  1U8R A;  4OIQ F;  1IN4 A;  1JXS A;  1WI3 A;  4AYB N;  1IV8 A;  4DW6 A;  2VQG A;  2NVY J;  4BAC A;  5M5W J;  1DGW Y;  2CWE A;  1W5T A;  4CIC A;  2NRA C;  1Z7U A;  2CGP A;  3I9V 2;  2R7Z J;  2VKH A;  5EZH A;  1SFO J;  5GAE J;  3PL8 A;  5M5X J;  3MMY B;  4O5V A;  1HDD C;  5FLV A;  3TGN A;  2YX4 A;  3H9G A;  3B02 A;  2WB1 N;  2WAF A;  3U2R A;  3F21 A;  1T8I A;  1QZY A;  1G8X A;  2H1L A;  3RTR A;  4AUX A;  1SD7 A;  4A3F J;  1HBX G;  3OR2 C;  4E7K A;  4IHX A;  1W7P B;  4FQG A;  1D0Z A;  2P5K A;  3IWF A;  4BY7 J;  2ZCW A;  5HNF A;  1FTZ A;  2A05 A;  3GWZ A;  4PFO A;  3G71 I;  1Z67 A;  1VQ6 I;  5FGM A;  2KIS A;  2NVX J;  2LY2 A;  3GFM A;  1F43 A;  2GAU A;  2Y48 A;  3HRU A;  3M7G A;  4C9Y A;  5TIS C;  2JZY A;  1MSE C;  4BQN A;  1Z6R A;  2KIU A;  5E20 A;  4EMS A;  5DUK A;  1A6Q A;  2NNN A;  2P6T A;  2YR2 A;  2XSJ C;  5AON A;  3GTK J;  2XB5 A;  3FMQ A;  2E2I J;  3O3K A;  3BR6 A;  3D1N I;  3W3C A;  3TDZ C;  2VON A;  2AXT C;  3RYP A;  3E5Q A;  3T1B A;  3V7S A;  1XGN A;  1BL0 A;  4L9N A;  1UHS A;  3CDL A;  3K4L A;  3ZMV A;  4CSW A;  1FBU A;  1XSV A;  4II2 A;  1RNL A;  3LL7 A;  1XGO A;  4XL9 A;  5LGU A;  3L2Q A;  1P4W A;  1HW2 A;  4AIH A;  3HOS A;  1I1S A;  2DFE A;  2DJI A;  2V1N A;  3S17 J;  3RKY A;  1EF4 A;  2QYO A;  2JUC A;  1R5H A;  5FD6 A;  2HS5 A;  1FT9 A;  1BJZ A;  2FSW A;  3U21 A;  3ZMS A;  2KIF A;  4ESF A;  4HNU A;  4XRS G;  5K5R A;  1ZRF A;  5GAD J;  2VKD A;  3HIF A;  3CMY A;  3DWL E;  2E1C A;  3BZK A;  2F48 A;  2VT2 A;  4JBA A;  5CVI A;  1B8I B;  5LD2 C;  4Q5S F;  2WV0 A;  4IHY A;  2QEN A;  1ZN2 A;  3L2V A;  2M8E A;  3HOW J;  3FBN B;  1WJE A;  2MC3 A;  1EJ9 A;  3OY9 A;  2KMU A;  4BXF A;  5H2F C;  4F92 B;  3RI4 A;  1UB9 A;  2AO9 A;  4X1E A;  4R8H A;  3QRF F;  2F5D A;  2FOK A;  1ZGW A;  2BHZ A;  4IL6 C;  4B44 A;  2CUF A;  4EEF G;  1P4X A;  2HYJ A;  3CC4 I;  4BY1 J;  3SFI A;  3ZGK A;  2R0Q C;  3HOY J;  1P6R A;  4U0Y A;  2FMY A;  4BE1 A;  4OIO F;  4CCM A;  2D1H A;  3ZQI A;  4LG3 A;  1E3P A;  3AG3 H;  2FQ4 A;  2HDD A;  2HGC A;  2QVO A;  3QYB A;  3FXJ A;  4JYK A;  4PDK A;  1U9N A;  2F2E A;  5K7H A;  4BQO A;  2XAG A;  1NTC A;  3E5X A;  5GP9 A;  1YJN I;  3LFK A;  5J8F A;  1MW7 A;  4HV5 A;  2BY2 A;  2Y31 A;  2CFO A;  2DA3 A;  2HKX A;  2X1E A;  5E79 C;  1QPI A;  2ME0 A;  4G7Z F;  1JUM A;  2DOA A;  1IN5 A;  3GF2 A;  5L3B A;  4RM2 A;  3LQQ A;  3MKW B;  2OC6 A;  4ENM A;  1ZEL A;  3IV5 A;  4AWX B;  3KCC A;  1W7P A;  2R7F A;  3ZN1 A;  3NAR A;  3LAP A;  2GOX B;  1YIT I;  3GTP J;  4I01 A;  4D7N A;  1FOK A;  1WRJ A;  2PQ8 A;  5J4Y A;  2VOD A;  5C4J J;  1ZG3 A;  2IVM A;  3I71 A;  2HXI A;  5IPA A;  1LJ9 A;  2KRC A;  1FBS A;  3KEO A;  1VQN I;  3SFZ A;  2UWM A;  2P81 A;  1JTY A;  4DZP A;  1MKM A;  3RQI A;  3V4G A;  4A5N A;  4HQM A;  4KT6 A;  4YIR X;  3CC7 I;  3BQZ A;  1P2F A;  2QQ8 A;  5K5Q A;  1JJ8 C;  2LH9 A;  5FLM J;  4B3X A;  1D1A A;  3Q3S A;  4Y52 J;  4HF2 A;  3VB2 A;  5CVR A;  5K1Y A;  2HEO A;  1WI9 A;  2CQN A;  3DPT A;  2V4J C;  3MN2 A;  5HDG A;  1T6S A;  1LE8 B;  5FFX A;  5FB2 A;  3GFL A;  3HEF A;  2A6H F;  1HW5 A;  2DDA A;  3ZMD A;  1R9T J;  2K27 A;  3BCB A;  2WV1 A;  1SVL A;  3DU5 A;  4I0A A;  4GRI A;  5D4S A;  4PZJ A;  2LP0 A;  3CJQ B;  4YG2 F;  1MJA A;  1R23 A;  1ZG1 A;  3NWT A;  1IJW C;  2LY9 A;  1G3W A;  4M3E A;  1UFM A;  1R58 A;  1GDT A;  4N4N B;  5HDN A;  5HLG A;  4JX5 A;  4M71 A;  3VWB A;  1MBK A;  3HM5 A;  2ECB A;  5E1W A;  5IT9 Z;  1G3Y A;  2FRH A;  1UST A;  3F8C A;  3ML6 A;  3R0A A;  4NBQ A;  1ZHF A;  1B8I A;  2L7F P;  1XCV A;  1DU6 A;  3PO3 J;  1FZP B;  3JAM Z;  4HRI A;  3MZH A;  4ZJZ A;  1X1P A;  4QWQ A;  3IRR A;  1XPX A;  2HYG D;  4IOC F;  1IF1 A;  3HPG A;  4XLN F;  4CCN A;  3OYN A;  1YJ9 I;  4I76 A;  3OS0 A;  1ZRD A;  5EEH A;  2L7Z A;  4QTR A;  1APL C;  5HS9 A;  2XAQ A;  3RKW A;  1J9I A;  4HQE A;  2HNH A;  4BXU A;  1IN8 A;  3ULQ B;  3FIS A;  3FHN A;  2VBW A;  1MZB A;  1OMI A;  3ABM H;  2DOD A;  4KT5 C;  2HOE A;  1D0X A;  4A3B J;  4E4H A;  3KZI C;  2OUM A;  3DTK A;  1WVR A;  5EJC A;  4I6Z A;  3PNY A;  2ZXH A;  1S3J A;  5DUI A;  4S04 A;  4CA0 A;  1F4K A;  3H5A A;  3CF2 A;  1MMN A;  1MD0 A;  4F7Z A;  2CS3 A;  3OYJ A;  3BTC A;  1IXS B;  5EDN A;  4ZDP A;  2O8K A;  4L5E A;  2QKM B;  1MND A;  2ZO4 A;  4ENJ A;  3JCU C;  1DP7 P;  1HSJ A;  3JRB A;  2HOT A;  2R7T A;  2BY1 A;  1TWC J;  4KIC A;  1XMA A;  4M9Z A;  4Z6Y A;  4XKB A;  5FD5 A;  5CVJ A;  5D5W B;  3KLN A;  1GXQ A;  2EA4 A;  3TMO A;  1OR7 A;  2E19 A;  1BIA A;  1LUJ B;  2Y2Z A;  3RCO A;  3QPL A;  1KON A;  1W7P D;  5IT9 K;  1R1V A;  2V6E A;  1KQ8 A;  1WJF A;  4EM1 A;  3TO7 A;  3E6D A;  5J40 A;  4B09 A;  4CCO A;  1X58 A;  2E1O A;  4FCY A;  2LRD A;  4OAZ A;  1Q1H A;  2JA2 A;  3P5J A;  4F55 A;  3H9Q A;  3I64 A;  1BN5 A;  3F22 A;  2VE9 A;  1YOV B;  5HS7 A;  1IC8 A;  1FEX A;  1FY7 A;  1LE8 A;  3BT9 A;  5EEG A;  1U3E M;  3HB9 A;  5CQG A;  4YII A;  1I3A A;  1IN7 A;  2L9R A;  1LVK A;  5ILV A;  1HLV A;  2NXN B;  3LOC A;  3ZOB A;  3ZMZ A;  2H09 A;  1Z05 A;  2V7F A;  1JT6 A;  1QO0 D;  3LSJ A;  2MBF A;  2QA4 I;  3BR3 A;  1FC3 A;  3BJO A;  2RQP A;  1SD6 A;  2CW0 F;  3HL2 A;  1ZR4 A;  2OCC H;  4BHC A;  1FYL A;  3J7A Y;  1V5E A;  5HLI A;  2Q1Z B;  1W1W E;  2XGX A;  4UUV A;  1REP C;  5IYD J;  3SEZ A;  1I5Z A;  5B1B H;  3T8T A;  3E6C C;  3CQZ J;  2HOS A;  2GLO A;  5F04 A;  3FK7 A;  2M7A A;  4UB8 C;  4E6K G;  2AXL A;  4YIF A;  3BG7 A;  1ENH A;  1JGS A;  2FBI A;  1IXR C;  3OWT A;  3SHF A;  3L2U A;  1N25 A;  2XRL A;  4GFB A;  2IW5 A;  3H3Z A;  5BPI A;  4PUS A;  3I58 A;  1R5I D;  3SZP A;  2QKL B;  3NAU A;  5DV5 A;  1N75 A;  2E7X A;  5BS6 A;  2EV6 A;  2KHM A;  2HDC A;  2HWV A;  3F72 A;  3PSF A;  2GXB A;  2NS0 A;  4CUG A;  2EFN A;  5CVV A;  4WWC A;  2RDP A;  3DPL C;  1RRJ A;  3P7N A;  1XTA A;  4G94 A;  2AQF A;  3AG4 H;  4OMY A;  3QU6 A;  4RLQ A;  1KQ9 A;  4EAT A;  3GZ6 A;  2QSH X;  4ZYG A;  3BJ6 A;  3M8F A;  4KN7 X;  1V5G A;  2BY0 A;  1JTX A;  2XB0 X;  1ETW A;  2OV7 A;  1YE9 A;  4EJO A;  5ILS A;  5FFZ A;  1IO2 A;  1YX3 A;  2IXS A;  3JSP A;  1P92 A;  2Z33 A;  5IP6 A;  2CV2 A;  3S2D J;  2F5C A;  5F6F A;  2MH2 A;  1ITY A;  1WHU A;  3MEX A;  3TOA A;  4ENN A;  2XAJ A;  1ZAR A;  1B4A A;  3FXQ A;  4OMZ A;  3ZQL A;  4BQQ A;  4ASN A;  3BC8 A;  1RR8 C;  2PEX A;  1PP8 F;  2R7X A;  3QP6 A;  2EWN A;  2FNA A;  1BC8 C;  4V2F A;  1OCO H;  2VC1 A;  3IKV A;  3EUA A;  2PMU A;  5E3L A;  2JQ7 A;  4IXA A;  1YHQ I;  4AYB A;  2QBY B;  3BQY A;  4BS9 A;  3MWM A;  4ZZD A;  2DOF A;  3GZN B;  2XAH A;  4AVP A;  3IHU A;  5DCF A;  4IKF A;  4IX7 A;  3OOU A;  1ZYR F;  4AIK A;  1IN6 A;  4B43 A;  1Y39 A;  2R7D A;  4A3E J;  3OSF A;  5BOX A;  1GLN A;  2CQK A;  4ANJ A;  1LNW A;  3CJT B;  2R7U A;  4HSR A;  2WB1 A;  4UY8 I;  1D5Y A;  2CV0 A;  2EIJ H;  1HKS A;  1ETV A;  4XKW A;  2B7E A;  4A3D J;  3NWS A;  2DDB A;  1A36 A;  3QWL A;  1TWF J;  2DT6 A;  3T8R A;  3K4K A;  4R1H A;  3DU6 A;  3PM1 A;  3BTJ A;  4G8X A;  4LIU A;  1B6A A;  4EV0 A;  5HOD A;  3WOD F;  4KIS A;  2XAF A;  2LR8 A;  1W0T A;  1S5L C;  4OU0 A;  2BXZ A;  2JTV A;  4PGH A;  3DP7 A;  2FEZ A;  3OR1 C;  5FKO A;  3PFY A;  1ZK8 A;  1EH8 A;  1WJC A;  2JPB A;  3RJP A;  4U0V A;  2K86 A;  2B0L A;  3H1C A;  1CF7 B;  4OIR F;  5HOO A;  1HW1 A;  1GXP A;  2VLA A;  3OIO A;  1MDM B;  1G4D A;  3ZQG A;  1YLF A;  2G0E A;  3RZD J;  2H8W A;  3TL4 X;  1L0O C;  2MD0 A;  2X51 A;  4M3B A;  4HLX A;  4O3M A;  2PFB A;  2L4M A;  1EKE A;  3BG6 A;  4AID A;  1TC3 C;  3VEP A;  2DQR A;  2JSP A;  3L2R A;  1TBX A;  2M30 A;  1GV5 A;  1SMT A;  4C3I J;  1J75 A;  2EZL A;  1SAU A;  3L09 A;  3MKY B;  1WKM A;  2FJ1 A;  3VOE A;  4E7I A;  2F4O B;  4ZDO A;  2XV4 S;  3ZXS A;  2WY8 Q;  3DCF A;  3C2G A;  3TBI A;  2J5O A;  3C2H A;  4GO1 A;  4EJW A;  1QHH D;  5J47 A;  2M0M A;  3V8J A;  3GLX A;  5BPD A;  1BI0 A;  4E7H A;  2V1U A;  3GTQ J;  5F0C A;  2QSF X;  4YFK F;  5F64 A;  4OOI A;  1U5T B;  2PN6 A;  3BPX A;  5LBQ A;  3C3W A;  1BIB A;  4U7B A;  2P0W A;  2CUE A;  3CCQ I;  2VOO A;  5AIP A;  5LEK A;  1X4O A;  3ABT A;  1LPQ A;  1IW7 F;  1BR1 A;  4G6D A;  2WWY A;  2GIV A;  3F6V A;  2LOO A;  2M45 A;  4XKV A;  3WTV C;  2L02 A;  4RGU A;  4II3 A;  3FWE A;  3GBG A;  2ADU A;  2KDO A;  3FZV A;  4C3H J;  5JVG F;  2QBY A;  4D5C A;  3OIQ A;  4LD5 A;  1SD4 A;  1FPQ A;  2FU4 A;  4EJU A;  3BR1 A;  3I5U A;  1GV2 A;  1JUS A;  1XMK A;  5KK1 A;  1F9N A;  3KPH A;  2JWT A;  3LST A;  1O3S A;  3R6S A;  2VJI A;  2G7U A;  4DNC A;  3L00 A;  4AD9 A;  2VB6 A;  2LKP A;  3M8E A;  3O8G A;  4XLP F;  2E35 A;  3G1L A;  4WK8 F;  2XGD A;  1UHM A;  2CUJ A;  4XOR A;  3RQ4 A;  3CUQ C;  2M9H A;  1OR7 C;  5E3M A;  3CC2 I;  1EH6 A;  4H4K C;  3WTT C;  4A93 J;  1FOY A;  3D0S A;  1TQM A;  3ERE D;  2NAZ A;  1ULY A;  2XF7 A;  3CDH A;  4DOZ A;  5FRN A;  4PJN A;  4IOA F;  2LVS A;  4XLF A;  4G12 A;  4PSX A;  1WQ2 A;  3KP6 A;  4NB5 A;  1Y1V J;  1MSF C;  3ELK A;  3S93 A;  3GX4 X;  2OCE A;  3SQN A;  3ZQF A;  1X1C A;  2OPT A;  3M1C A;  4MQ9 F;  2OU2 A;  2VJJ A;  4LMY A;  3OYC A;  2LF7 A;  4LIT A;  1IRG A;  2ZME C;  3DV8 A;  2IA1 A;  1KU9 A;  3C7J A;  4JP0 A;  5E3N A;  3ZMU A;  2GXG A;  3T5X A;  1SFK A;  2W84 A;  1CF7 A;  1IDY A;  2HPI A;  4RS8 A;  1PDN C;  3G4S I;  3A0B C;  1UAA A;  4P5O A;  4HLY A;  1ETX A;  1MDM A;  2VXZ A;  1IDZ A;  2OQR A;  2GQQ A;  2JUG A;  3B73 A;  2NNY A;  4RAF A;  3KZZ A;  2NS7 A;  1Z6T A;  3M9A A;  2CU7 A;  3J81 Z;  2Y0M A;  4WXD A;  2ZJ2 A;  4HDV A;  4RLF A;  1V4R A;  3N05 A;  5DM7 F;  1RI7 A;  2HQN A;  3W2W A;  5TRD A;  1OCT C;  2OTJ I;  4RB1 A;  1MMS A;  2HFH A;  2LKS A;  4MTD A;  2ICW G;  3H5R A;  1U0J A;  1HKT A;  3NQO A;  4FAS D;  2QQ9 A;  2QEX I;  4CGZ A;  2K9S A;  2DU9 A;  4FIS A;  5M3F J;  1S7A A;  2E1M B;  2B63 J;  4KJZ A;  3WTY C;  4ETS A;  5DD4 A;  2M0C A;  3TW7 A;  2CMP A;  4Z2Y A;  4BBR J;  1W0U A;  1FP2 A;  1W36 C;  4NC6 A;  3GZ5 A;  3P9C A;  5L3C A;  1WFX A;  4CO8 A;  3GTO J;  2H6B A;  1U5T A;  1MMA A;  2OAZ A;  2ZC2 A;  1T39 A;  2O7O A;  1E3O C;  1POG A;  1TQI A;  2KPM A;  1QA6 A;  1ONV A;  4KIB A;  1GUU A;  2KP6 A;  1MJB A;  1DGR M;  2DOE A;  2LG4 A;  4A3J J;  4UNO A;  2HOA A;  2PJP A;  3H0G J;  3IWZ A;  4LK1 F;  1R00 A;  1LDJ A;  3KP3 A;  3WU0 A;  4D7M A;  3JSO A;  3V42 A;  1OYI A;  3I0T A;  2PG4 A;  2X1D A;  2NS8 A;  1B9N A;  1T2K A;  4ZYA A;  5JI6 A;  2ZXW H;  4B4C A;  2DMQ A;  3J7A O;  4I0B A;  3SYT A;  4F91 B;  1IZ1 A;  3KP4 A;  2GBY A;  1OCC H;  1MJ9 A;  2XAS A;  4BKX A;  3BZ6 A;  1Y1W J;  4AM3 A;  4L9T A;  3RKQ A;  2A6T A;  1SAX A;  3J81 K;  2A6E F;  4M6X A;  2XPU A;  2ISY A;  3E97 A;  5J3L A;  3HOV J;  5KCM A;  4KIG A;  3KYD B;  4IPA A;  2VI6 A;  1LVA A;  2V9K A;  3G6E I;  4HPQ A;  3QYF A;  4A3K J;  2ID6 A;  4C3J J;  2E5Z A;  1PUE E;  3HRM A;  1TZL A;  2XAU A;  1I6H J;  4FE7 A;  3CCY A;  2ESN A;  3LSH A;  2L4A A;  3AAF A;  3IH3 A;  2R4G A;  3BRO A;  2XKP A;  4MQV A;  3K70 D;  2Q8K A;  3GEZ A;  1R22 A;  3RIR A;  1ZGA A;  2OD5 A;  1P9Q C;  1E17 A;  1E3H A;  1IRZ A;  1NG7 A;  3K4J A;  2ZJQ F;  4NQW B;  1P7J A;  2M3A A;  5D6F A;  5D8L B;  1AWC A;  3I56 I;  2E2H J;  1X1B A;  3HGG A;  3FK6 A;  3PSI A;  4ESJ A;  1BR2 A;  1VI0 A;  3VSL A;  1JHH A;  4XN0 A;  2ZJR F;  2WC2 A;  4XM3 A;  1UHW A;  5KAI C;  1ON2 A;  3QU3 A;  2P7V B;  1FIP A;  4OWR B;  3JRI A;  3DEE A;  3IH2 A;  4Y3O A;  4RAZ A;  5D5V B;  1TQP A;  1TT0 A;  3SJM A;  5IT3 A;  3CCE I;  2DK8 A;  4I99 C;  4DYR A;  3T0Y A;  3D5L A;  4E7Z A;  1PUF B;  1DDN A;  2DPU A;  2ESH A;  1V3F A;  4U88 A;  2VKE A;  2F6C A;  2L54 A;  4ABZ A;  1K78 B;  1E0E A;  4XQF A;  3QYE A;  1SFX A;  4Y15 A;  1XDS A;  2IGK A;  2HR3 A;  2IPQ X;  3CO7 C;  4OIP F;  2PMH A;  1ETY A;  3GTG J;  3S2H J;  2VUM J;  3J80 K;  5ICE A;  1VND A;  2CO5 A;  2JPC A;  3PQJ A;  4BHB A;  1ORK A;  4BAY A;  3UKG A;  1WZ2 A;  2R7W A;  2O0Y A;  1LKX A;  3DLA A;  4PJL A;  1RPW A;  3HOU J;  3GO5 A;  3TP0 A;  3DKY A;  3CUQ B;  3W2V A;  3N97 A;  1JUP A;  2IGN A;  4G6T B;  2ISZ A;  1YIJ I;  2IP2 A;  3HC7 A;  4XK4 A;  3CCR I;  2KDZ A;  3DBH B;  1UG2 A;  2E36 A;  1DQU A;  4A3M J;  1XMX A;  1HC8 A;  2M2E A;  3GUD A;  1HOM A;  3MZ8 A;  3LA3 A;  2IEK A;  4B48 A;  2ZME B;  4UV8 A;  1YW9 A;  2LRE A;  4PJJ A;  5ED4 A;  1U9O A;  3V7R A;  2E60 A;  4A0Y A;  1B72 B;  4J01 A;  4YFX F;  1RIO H;  3BLY A;  3HTS B;  1R4M B;  5GPC A;  2L2O A;  2BXY A;  4ZYD A;  3CCL I;  4HDU A;  5B66 C;  1FYK A;  4RGS A;  4QPQ A;  1MH3 A;  4CYD A;  1VQO I;  4WXH A;  1JE8 A;  1EH7 A;  1GVD A;  3K1M A;  2X6O A;  1I50 J;  2GA2 A;  2ECC A;  2P6S A;  4F93 B;  1R1T A;  3PIP F;  1FJL A;  1OYW A;  1R4N B;  1TW2 A;  5IY5 H;  1T0F C;  3HOX J;  3P9I A;  3AFH A;  4NQW A;  4LLL A;  4HX8 A;  3W6K B;  4U87 A;  3HDD A;  4HYE A;  3MQ0 A;  5FJ8 J;  5LHH A;  2DTZ A;  3RPQ A;  3K0L A;  2HQR A;  5L3D A;  3ABL H;  4ZZL A;  2DJN A;  3TO9 A;  1UZC A;  4G7H F;  2FE3 A;  3DTI A;  2RKH A;  3KLO A;  3EQL F;  4KN4 X;  5EZG A;  2G9W A;  4FET A;  3OYE A;  3K70 C;  2ZNZ A;  1N77 A;  2V79 A;  3F8F A;  4NNJ A;  1Y8R B;  2OZ6 A;  4PK4 A;  3F8M A;  3S15 J;  2DO7 A;  3HZJ A;  1MH4 A;  1PUF A;  5LHI A;  3FF5 A;  2HU9 A;  2HKO A;  1RES A;  1K78 A;  2A5W A;  1MBG A;  2ID3 A;  1R7J A;  1Y0N A;  4A69 C;  4F52 A;  4XN3 A;  5LHG A;  3PFI A;  3F23 A;  4MHG A;  1R49 A;  1VQK I;  4RGR A;  4L0Z B;  1U6G A;  1H9G A;  1WJB A;  2VKV A;  1J59 A;  2F4M B;  4LLN A;  1FSE A;  3KEQ A;  2JA5 J;  4CCJ A;  3HKZ N;  5B1A H;  3IAS 2;  5KAF C;  1J5Y A;  3WE3 A;  5EG0 B;  2CYY A;  3CTA A;  3OS1 A;  3OYF A;  3LSG A;  1JKR C;  4Y33 A;  2NOG A;  2JSC A;  3CME I;  3IKT A;  3HHH A;  4MFD A;  2Y69 H;  3SZG A;  3OSG A;  3S8P A;  1G3T A;  4BUP A;  1BOA A;  2MW8 A;  1DPR A;  3BDD A;  3CUQ A;  1JI8 A;  4HW0 A;  2L9S A;  5J4V A;  3Q9V A;  1OYY A;  2WAQ N;  2XIG A;  3EPZ A;  1TWH J;  3K4C A;  4N9I A;  1FOX A;  1K83 J;  2X9D A;  3S14 J;  2EPF A;  4EVI A;  3IL2 A;  4A6E A;  5LRS A;  2EIM H;  4G7O F;  3R0J A;  2HDW A;  3WTZ A;  4BL0 B;  3OYM A;  2H27 A;  1Y8Q B;  2XGE A;  2AHQ A;  1TTY A;  4M6Y A;  3HJE A;  1U5T C;  5E8G A;  1YQA A;  4GYG A;  1WGX A;  2ZME A;  2LK2 A;  2DFH A;  4RDU A;  2DT7 B;  5E17 F;  1B72 A;  4IHW A;  1YW7 A;  2ZFW A;  2DFI A;  2EBI A;  1I3Q J;  1TWG J;  2ACJ A;  1K61 A;  2HZT A;  1I39 A;  1R71 A;  5ILU A;  4D5F A;  2ZBK A;  2KLO A;  3ISP A;  2XPW A;  2DA4 A;  4M74 A;  3ZQQ A;  3RYR A;  4A2U A;  2ZB9 A;  3ASN H;  2WA0 A;  3ZR8 X;  5E3O A;  3OYL A;  4MEX F;  3JRE A;  3E6B A;  2X6Y A;  4DJA A;  3B6C A;  1JKO C;  2V6C A;  1ZTR A;  1Z7L A;  3ABU A;  3BCA A;  2HXO A;  2ZXI A;  1CGP A;  2ZFU A;  4L5J A;  1TT5 B;  3GYH X;  3L9F A;  3VOD A;  3RSN A;  5D8K B;  4O6J A;  4UV9 A;  2K02 A;  4MEY F;  2JA6 J;  3Q5F A;  2XDV A;  3HOZ J;  2GWR A;  3NRV A;  3BG3 A;  3GCM A;  2DAO A;  2CFX A;  2COB A;  1TNS A;  3RDI A;  1V5F A;  5J1Y A;  2F5F A;  4EM0 B;  3S1N J;  2EV0 A;  1KU3 A;  1W4M A;  3A0H C;  3I59 B;  1G2H A;  3HGY A;  1BC7 C;  1YRN B;  4RB3 C;  3J7Y J;  2KZV A;  2XF5 A;  4I7H A;  2KKO A;  1H89 C;  2R7R A;  3CES A;  3F0C A;  4IRH A;  1IXC A;  1K6O A;  2XVC A;  4HX4 A;  4XOP A;  3LSK A;  3S1Q J;  3DF8 A;  3QP5 A;  4UVA A;  2EZI A;  3LSI A;  5A2Q Z;  5IYC J;  5EGO B;  1CQT A;  4XID A;  1XD7 A;  1XGS A;  1TL8 A;  2YX7 A;  3FMS A;  3WTW C;  1DU0 A;  4L18 B;  1QRY A;  2V1X A;  3BPV A;  2DQL A;  3S2W A;  3K4N A;  1V55 H;  2TDX A;  3EDP A;  5EG0 A;  5LRR A;  3ONQ A;  4HZF A;  3RPU D;  4FX0 A;  3AG2 H;  4UUS B;  2PMZ N;  3K9T A;  3BTI A;  2DMN A;  2FF4 A;  4XNF A;  1MNM C;  3ECO A;  2W48 A;  3PUF A;  5BQT A;  1S9H A;  3X2Q H;  1Z3Y A;  3I3L A;  4ZC3 A;  4XLA A;  2YPR A;  4B8X A;  2O3F A;  4P96 A;  4D1Q A;  1T95 A;  5K5O A;  5ICC A;  5ICF A;  1ZGJ A;  2E1M C;  3IP4 B;  5IP7 J;  3DBL B;  3WGG A;  1I1G A;  2O9L A;  2K3P A;  4IHT A;  4DBQ A;  1U8B A;  1GT0 C;  4RM3 A;  2BVL A;  3WTS C;  1OLT A;  2MLK A;  3BR2 A;  3ECH A;  4KFC A;  3JRG A;  2L01 A;  1VF9 A;  3QOE A;  2HVR A;  1WH7 A;  2D1V A;  4P55 A;  3HTU A;  5DDG A;  3O8H A;  3COA C;  4KMU X;  5DEQ A;  2DA7 A;  4HBL A;  4RMN A;  5F0F A;  2W1O A;  3L7W A;  3LAJ A;  4HAM A;  4K2E A;  2VJ5 A;  1AU7 A;  3W6V A;  2J5P A;  2JVG A;  3Q0U A;  2LSO A;  1ZR2 A;  2RQQ A;  2UXN A;  1DUX C;  4G6Q A;  1Q1V A;  4FT8 A;  4U0W A;  2GIZ A;  4S05 A;  3RZO J;  4BQA A;  2ZXJ A;  4LG0 B;  1BA5 A;  3V7C A;  5A2Q K;  1D1B A;  4M3F A;  1X3U A;  2IA2 A;  4BDZ A;  2R92 J;  2KRF A;  4LIV A;  1ACI A;  5C3E J;  1BI3 A;  3VFZ A;  1HDP A;  2CSO A;  4PSW A;  1PP7 U;  4A3G J;  1PJR A;  2A69 F;  4M3D A;  2MA3 A;  5L3F A;  3PO2 J;  1Z77 A;  2O8X A;  4OIN F;  3CF5 F;  3E5U A;  1T38 A;  2DTR A;  3S1R J;  1HKQ A;  5FKK A;  1O7F A; 
#chains in the Genus database with same CATH homology
 4XLH A;  2DOA A;  4YEJ A;  3H5R A;  1U0J A;  4XLE A;  3DPU A;  4RM2 A;  3LMM A;  4FAS D;  3OS2 A;  4PJM A;  3MKW B;  2OC6 A;  1ZEL A;  2E1M B;  4R79 A;  4KJZ A;  4D9J A;  1UEL B;  2WY7 Q;  2GOX B;  2CMP A;  1W36 C;  1WFX A;  4BEH A;  1MMA A;  4E7L A;  3CJR B;  2KRC A;  2KPM A;  2UWM A;  2LY1 A;  2KP6 A;  4KT6 A;  1DGR M;  2LG4 A;  2V26 A;  2LH9 A;  4B3X A;  1D1A A;  4QPO A;  3DPT A;  2V4J C;  2VXD A;  4CZC A;  1YX5 A;  3V42 A;  4DGW B;  4NC7 A;  2CW8 A;  2IS4 A;  4E7S A;  1MNE A;  2VIX A;  3HPH A;  4ITV A;  2X1D A;  3PNV A;  3BCB A;  4XOT A;  2X1C A;  4ZYA A;  1PYV A;  2F5V A;  2IGM A;  4CCK A;  3KYL A;  4C2U A;  4OAY A;  3DU5 A;  3SYT A;  2ZSI B;  3A1Y A;  4F91 B;  2JVH A;  4GRI A;  2HPM A;  3CJQ B;  3M8J A;  3CMM A;  3NWT A;  2A6T A;  1J09 A;  2LYC A;  2Z2S B;  4N4N B;  1WJD A;  2BW3 A;  5KCM A;  3VWB A;  2L5Q A;  2V9K A;  4HPQ A;  3QYF A;  2E5Z A;  2FUG 2;  1TZL A;  2XAU A;  1X1D A;  4BGD A;  2WBM A;  3LSH A;  2R4G A;  4HRI A;  3K70 D;  2O5R A;  4ZJZ A;  4AVZ A;  4B47 A;  1P9Q C;  3HPG A;  4CCN A;  3OYN A;  3OS0 A;  1NG7 A;  3K4J A;  2IGO A;  4NQW B;  2HNH A;  1QHG A;  2M3A A;  3OYB A;  1X1B A;  3FHN A;  3HXL A;  3W2W A;  3PSI A;  4N4O B;  1BR2 A;  5HLT A;  1D0X A;  3VSL A;  4XN0 A;  4P1W A;  4E4H A;  2PJR B;  2OUM A;  1Y6I A;  3DTK A;  4XM3 A;  2VJ4 A;  3PNY A;  2ZXH A;  1LDK B;  2W00 A;  2HZD A;  2K5C A;  4CA0 A;  3H5A A;  3CF2 A;  1MMN A;  4OWR B;  1Z3X A;  3DEE A;  3LSM A;  4Y3O A;  3ZCO A;  4ZTF A;  1DP3 A;  2CS3 A;  3OYJ A;  4ZDP A;  1TT0 A;  2QKM B;  1MND A;  3OL4 A;  3D5L A;  4E7Z A;  3MD2 A;  3OYI A;  2R7T A;  2F6C A;  1MMG A;  4MLO A;  1WJA A;  4XKB A;  1AA7 A;  1E0E A;  3H35 A;  4XQF A;  3D5R C;  2E5N A;  5HNH A;  3QYE A;  2IGK A;  3TMO A;  1BOB A;  2R7V A;  3MKZ A;  3E1S A;  3H9J A;  3RCO A;  2I8D A;  2KL4 A;  3HOT A;  1KON A;  3K4M A;  2V6E A;  1Y56 A;  1WJF A;  4XR6 A;  2XC7 A;  4XKC A;  2CV1 A;  3SDB A;  4CCO A;  1UG0 A;  2R7W A;  2HVS A;  3E0J B;  2HVQ A;  1LKX A;  3DLA A;  4PJL A;  2LRD A;  4OAZ A;  2JA2 A;  4F55 A;  2AQE A;  3H9Q A;  4JQF A;  3VYU B;  5KHD A;  1Z21 A;  3DKY A;  3W2V A;  3DQV C;  2IGN A;  4G6T B;  5CQG A;  3HC7 A;  2KRH A;  4NUB A;  1X19 A;  1LVK A;  1FMW A;  3OYK A;  2V7F A;  2CW7 A;  1ERD A;  2K9M A;  1DQU A;  3FKJ A;  4F3Q A;  3PJR A;  2X6X A;  4XON A;  4B48 A;  2LRE A;  4PJJ A;  2UV1 A;  4BJ5 C;  3HUG B;  2E60 A;  1W36 D;  3HL2 A;  4J01 A;  3UR3 C;  3BLY A;  5HVQ C;  3J7A Y;  1V5E A;  2Q1Z B;  5TGT A;  2L2O A;  2IS2 A;  2LBF B;  3OYG A;  1HA8 A;  3SEZ A;  4QPQ A;  3CP2 A;  3W2A A;  4YEL A;  3EUK L;  3DTE A;  2LC2 A;  2M7A A;  2HQA A;  4C2T A;  4E6K G;  3BG7 A;  3HKZ A;  2R7O A;  3VYR B;  2VQH A;  2WAE A;  3K4B A;  5CPR B;  4F93 B;  1G59 A;  3OWT A;  3L2U A;  1BR4 A;  1T0F C;  2VPL A;  3CZ6 A;  3AFH A;  4J00 A;  4PUS A;  4E7J A;  2QKL B;  2W7N A;  4ZTJ A;  4U87 A;  3ZRG A;  1N75 A;  2UUZ A;  2KHM A;  2R7S A;  3PSF A;  4X0G A;  4CUG A;  2WAQ A;  3DPL C;  2PJR A;  1N78 A;  2AQF A;  3DTI A;  4EAT A;  4RLQ A;  4CH7 A;  4FET A;  2VQL A;  2L7K A;  1D1C A;  3LFU A;  3OYA A;  1V5G A;  3OYE A;  4NNJ A;  3K70 C;  4BE0 A;  1N77 A;  3VDX A;  3G2B A;  2OV7 A;  1YE9 A;  4PK4 A;  3A4C A;  4AU7 A;  3FDY A;  1YX3 A;  2IXS A;  2Z16 A;  3S3N A;  2CV2 A;  4ZDL A;  2WAD A;  1LFP A;  2RNG A;  2Y0S A;  3K10 A;  3CP8 A;  2CH0 A;  2HU9 A;  4HNT A;  2K9L A;  3QOD A;  2A5W A;  2IS6 A;  1MMD A;  4F52 A;  4XN3 A;  1X1A A;  5CQE A;  2W82 A;  4BQQ A;  4HG2 A;  3FBI B;  2ELJ A;  3BC8 A;  3OIP A;  3VYT B;  5JHF A;  2R7X A;  1WJB A;  4BU2 A;  3EUA A;  2L9N A;  4CCJ A;  4BJT A;  3IAS 2;  2BVM A;  4AYB A;  2KQR A;  3OMY A;  4BS9 A;  2MAB A;  3PUB A;  3OS1 A;  3OYF A;  4PFP A;  3DKX A;  5FRM A;  3LSG A;  4CCL A;  4IKF A;  2IS1 A;  4Y33 A;  4IX7 A;  4BE2 A;  3OOU A;  1K6Y A;  2X85 A;  4B43 A;  3SZG A;  3S8P A;  4BUP A;  2M7B A;  1JI8 A;  2MC4 A;  5LFA A;  1GLN A;  2VL8 A;  3IAM 2;  2VAS A;  2L9S A;  4ANJ A;  1X4P A;  3AL0 C;  2R7U A;  4HSR A;  2WB1 A;  2MYS A;  3EPZ A;  3K4C A;  2DCE A;  2CV0 A;  1EA3 A;  3OYH A;  1NG6 A;  4XKW A;  2HDW A;  4BL0 B;  3OYM A;  3NWS A;  4HST A;  4DBR A;  2DT6 A;  2RRE A;  3S32 A;  3K4K A;  2DXI A;  3DU6 A;  2DT7 B;  4BDY A;  4LIU A;  2X6W A;  3IUO A;  4KIS A;  2LBF A;  5KNL A;  4C30 A;  3S3O A;  3OR1 C;  2KLO A;  2MFZ A;  3PFY A;  4XMY A;  2F4I A;  1WJC A;  2VQC A;  4YRV A;  3F9K A;  3ZQQ A;  1WJ5 A;  5FRO A;  1VZ0 A;  5HOO A;  3H0D A;  2WA0 A;  2XF6 A;  3ZR8 X;  3OYL A;  2VLA A;  2X6Y A;  4DJA A;  3TL4 X;  2PMZ A;  2VQG A;  2MD0 A;  1Z7L A;  2X51 A;  4BAC A;  3BCA A;  1IRX A;  1DGW Y;  2ZXI A;  2ZFU A;  3BG6 A;  2M4G A;  3KX2 A;  3I9V 2;  2JSP A;  3L2R A;  4JOM A;  3RSN A;  2VKH A;  4BJ6 C;  2R7Q A;  1SAU A;  3PL8 A;  3MKY B;  3MMY B;  4E7I A;  3K6G A;  4IZZ A;  2XDV A;  3H9G A;  4ZDO A;  3ZXS A;  2WY8 Q;  2WAF A;  2GOM A;  3EUH C;  3C2G A;  3KEY A;  3TBI A;  3VSK A;  3AL0 B;  1G8X A;  3RTR A;  1V5F A;  3OR2 C;  3C2H A;  4IQ4 A;  4NC8 A;  1QHH D;  4E7K A;  2M0M A;  1D0Z A;  4E7H A;  5HNF A;  4PFO A;  4Y4R A;  4XLC A;  3L2W A;  2KZV A;  2XF5 A;  2LY2 A;  4BEH B;  3PNT A;  2R7R A;  2BOL A;  4C9Y A;  4U7B A;  2P0W A;  3CES A;  4BQN A;  4XOP A;  3OL3 A;  1X4O A;  2Z1D A;  3LSK A;  1BR1 A;  2XSJ C;  3LSI A;  2LOO A;  4XKV A;  4II3 A;  3GBG A;  2KDO A;  2W4S A;  3W3C A;  3K4N A;  3OIQ A;  3ONQ A;  4DIQ A;  1QU3 A;  3RPU D;  4XNF A;  1FMV A;  2ZSH B;  4KIT B;  1S9H A;  3K4L A;  1Z3Y A;  3D5S C;  3I3L A;  4ZC3 A;  4CSW A;  4II2 A;  3LL7 A;  4XL9 A;  3L2Q A;  4XLA A;  3HOS A;  2DJI A;  2V1N A;  2VJI A;  2VB6 A;  2BW3 B;  4D1Q A;  3U21 A;  1T95 A;  4HNU A;  2E1M C;  3IP4 B;  4XOR A;  2CUJ A;  3RQ4 A;  1OR7 C;  2VKD A;  4H4K C;  2K3P A;  4DBQ A;  3DWL E;  2XF7 A;  1D0Y A;  4RM3 A;  4DOZ A;  3S3M A;  5FRN A;  2BVL A;  4PJN A;  4XLF A;  4PSX A;  2M4K A;  1OLT A;  5LD2 C;  3S93 A;  1X1C A;  3UNG C;  3QOE A;  3L2V A;  3M1C A;  3OYC A;  2VJJ A;  2HVR A;  3FBN B;  1WJE A;  4LIT A;  3OY9 A;  2KMU A;  3A2K A;  4BXF A;  4F92 B;  4RMN A;  3AKZ A;  2W1O A;  2VJ5 A;  2NOJ B;  5CKT A;  2JVG A;  2CUZ A;  1SFK A;  2RQQ A;  2HPI A;  4B44 A;  3SEQ A;  1UAA A;  4P5O A;  3ZGK A;  2VXZ A;  1D1B A;  2JUG A;  4BE1 A;  4BDZ A;  4LIV A;  4CCM A;  4LG3 A;  4PSW A;  1PJR A;  2Q2E B;  3HG9 A;  3OYD A;  3QYB A;  4HEA 2;  3VYS B;  4BQO A;  4IQJ A;  1R6R A;  1MW7 A;  4RLF A;  2CFO A;  3N05 A;  2X1E A;  3H5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...