3D5SC

Crystal structure of efb-c (r131a) / c3d complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
65
structure length
65
Chain Sequence
TDATIKKEQKLIQAQNLVREFEKTHTVSAHAKAQKAVNLVSFEYKVKKMVLQERIDNVLKQGLVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C3
publication title Electrostatic contributions drive the interaction between Staphylococcus aureus protein Efb-C and its complement target C3d.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/toxin
total genus 27
structure length 65
sequence length 65
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF12199 efb-c Extracellular fibrinogen binding protein C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1270 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3d5sC00
2WY8Q 2JVHA 3D5RC 2GOXB 2JVGA 2GOMA 3D5SC 2WY7Q 2NOJB
chains in the Genus database with same CATH superfamily
1LFBA 4LLLA 2X6OA 1JHFA 1P4WA 2RNJA 3SYTA 2XHKA 1ERDA 1IRZA 2E1MB 2VKHA 5GAEJ 4A69C 1WZ2A 4OMYA 3TO7A 3LSPA 1K78A 5DM7F 2KL4A 3LSIA 4EVIA 2DK8A 3PSFA 2MFZA 3ZMUA 3ULQB 3KEYA 3FBIB 4C2UA 1S29A 3VYRB 2LRDA 2Y69H 5BNGA 3J7AY 1P2FA 2MGQA 3LQQA 4NC6A 2UXNA 1IDYA 1A6IA 3NWTA 2VQHA 3HRTA 1F9NA 5J47A 2WY7Q 2MA3A 4E7IA 3L2CA 1OR7A 2FBKA 4HF0A 3PQJA 2O8XA 3DPTA 2AQFA 3JRIA 1XGNA 2Y2ZA 1FYMA 3EDPA 2BZTA 3LNQA 1W1WE 5A2QK 3FKJA 1MKMA 2LF7A 1FMVA 4DW6A 4L5EA 1GVDA 4YELA 1PP8F 1K78B 2HGCA 3OS1A 2YU3A 3HTUA 1SFEA 1R5ID 2NAZA 1E17A 1W5SA 1SFXA 2CSOA 2L3DA 1ON2A 3ZMVA 4A5NA 3H0DA 2L9SA 3IL2A 3FKIJ 1ZR2A 1X19A 2MC4A 5JLWA 2VBXA 4WX9A 5LGTA 2CQQA 5AONA 2K9LA 2VQCA 3E0JB 3AL0B 4ON0A 2K85A 5EZHA 2IGNA 1YE9A 3LSGA 2O6GE 4LITA 1LFUP 3W2VA 3N05A 4CXFA 3SJMA 4E70A 4KMUX 4HNTA 5E20A 4UVAA 2G0EA 4F93B 5E3OA 3ZMZA 2VT3A 5AIPA 1QZEA 3I5UA 1JKPC 4U88A 3K0LA 5FB2A 1QO0D 4KT6A 3IP4B 1D1BA 1W0TA 3TDUC 4IHTA 1Z7UA 4EJTA 3DU5A 1MNEA 4PSWA 5L3DA 2XAJA 2DJNA 4BXUA 4P96A 4NBQA 1OKRA 4ZTFA 1FSEA 3HB9A 4PGHA 4XLHA 4DBQA 4F92B 2VLAA 2HZTA 1TNSA 2W00A 1WWXA 5CYVA 3J81Z 3OYDA 4CGZA 1GXPA 5TISC 3KLNA 4BJTA 5LHGA 5L3EA 1QVUA 2IGMA 3K69A 2ZKZA 2FEZA 4A3GJ 1NTCA 2ZSHB 1JTXA 3VSKA 1W5TA 3SHFA 2BXZA 1B1BA 4A6EA 3VDXA 3VYSB 1O7LA 4B3XA 4WXCA 4FQGA 1TW3A 2NVTJ 3FK7A 1Y0NA 4LJZF 1L3LA 3JRCA 3KP2A 2ISYA 4R79A 2EQRA 2WC2A 3KYCB 4DOZA 4J01A 3M8JA 1AKHA 1DPUA 2XROA 5K7ZA 2BYVE 4AWXB 1MH4A 4C3IJ 4Q4ZF 4IHYA 2Q1ZB 4C3HJ 5F1RA 5CVRA 4BAYA 5EDNA 3QAHA 2RQPA 5J1UA 2B0LA 1N77A 2LY9A 4AUXA 4XSXF 5E1ZB 3DEWA 2OQRA 1DP3A 2ACJA 4BKXA 1W36C 4HOBA 2FUG2 5F04A 1B72A 4A3KJ 2DTZA 4BXFA 2EZKA 2VJIA 3W3CA 4HA8A 2AHQA 4ESFA 1BI2A 3KETA 2EFNA 3V7RA 4X0GA 4KISA 3CQZJ 2XAUA 2R93J 2M34A 2QZ8A 1OCPA 3M8EA 2ZJ2A 2E1MC 2JQ7A 4E7SA 2JWTA 2X6XA 3IH3A 2LSOA 1T0FA 1FYLA 5HS9A 1G3YA 5CPRB 3DLLF 4A3IJ 4F52A 2EK5A 1I1SA 5K5QA 3P5JA 3WHBA 1XSDA 4ZDPA 1ZHFA 2HFHA 1B72B 5JFRA 4PZJA 3JRGA 3FMRA 3MKWB 2QWWA 2Z2SB 1MMSA 4JBAA 3JAMK 3DPUA 5CLSA 1X1PA 3AG2H 3O8HA 3FHNA 3TO9A 3GTPJ 4LG3A 3CCUI 5ED4A 1LDKB 1XD7A 4OWRB 1I3AA 5FLVA 2PI0A 1AWCA 2E36A 2CH0A 3I58A 2NXNB 3MQ0A 3LSKA 3T1BA 3QU3A 2K4JA 4HDUA 1J59A 2B63J 3ZMDA 2FSWA 2K9SA 2VIXA 2Y0MA 5KAFC 1RR8C 4IHWA 5K7FA 2GOXB 1UELB 4Z6YA 5E17F 2R5YA 5GP9A 5BPDA 1R1UA 1LVKA 3JRAA 5BMZA 1PUEE 4YIFA 4KIFA 3FXMA 5GPCA 1R49A 2A6TA 5B1BH 3S93A 1X1DA 2JK3A 1YI2I 3CDIA 1FZPB 3E5QA 4IO9F 2QKMB 3GO5A 3VODA 2PQ8A 2ZSIB 1HSTA 1XMKA 3OWTA 1ZGWA 1PJRA 2Y0SA 4OIPF 3SZTA 1HW2A 1Z6RA 4IQJA 3V8KA 2M7AA 4BS9A 2O3FA 4MQ9F 3J7YJ 3LFUA 2FBHA 3I64A 3O8GA 1JUMA 4E7HA 4PGGA 1S7AA 3RQ4A 4X1EA 4L5JA 2R5YB 1Z21A 3OIOA 4MHGA 1U9NA 3CF2A 2K27A 4OU0A 9ANTA 2QQ8A 3F6VA 3DTKA 2BGCA 1JE8A 1F36A 3ZQ7A 2CS3A 1T56A 2P8TA 5FKKA 5FO5A 3GMEA 3H0GJ 4A0YA 3UKGA 2HEOA 3VEPA 2CV0A 2PJPA 2EINH 2HVSA 5FKMA 4KMFA 2CO5A 3I4MJ 4RAGA 5J1RA 4Y3OA 1A35A 1PUFA 2RNGA 3RTRA 3I54A 2EIMH 4UB8C 5F6FA 1VQ4I 3WTZA 1W0UA 1GHCA 1SVLA 3SZGA 3K1NA 1T08B 2NOGA 1A5JA 2Y9YA 1FBQA 5FKOA 5EEAA 1XCBA 1X4PA 3WU0A 3WGGA 2K3FA 3S17J 2F4OB 2Q2EB 2NNNA 4G7OF 4HF1A 4Q47A 5H6QA 3CCRI 3SXYA 3FK6A 2IVMA 1DPRA 2HQAA 3FWEA 3HKZA 4EGZA 2HR3A 2VC0A 1QVTA 1UFMA 5EF6A 2V6EA 2CQXA 2M0CA 2QQ9A 3OR2C 3Q3SA 4BU2A 1IRGA 1NG7A 2XB0X 1PUFB 4PUSA 2VOOA 2XGDA 2ZNYA 3LSHA 1D8KA 4IRHA 3BLYA 1TZLA 3G1OA 4G7HF 4UUTA 1QRYA 3U21A 2GXAA 3BT9A 5FRNA 2H6BA 3FZVA 2DU9A 3IHUA 3D0SA 1XCVA 5IT9K 3BTCA 4FCYA 4QIWN 1HOMA 5L3GA 2O9LA 4HQMA 5BPIA 1OFCX 2DQLA 4TV7A 3E5UA 3GTMJ 2B7EA 2F5FA 3NWSA 3ZQHA 1VQPI 1EKEA 1I3QJ 2R92J 2F6CA 3OS2A 3HOXJ 2DK5A 4E7LA 1R00A 3FXOA 1HKTA 4LOCA 3GTOJ 3GLXA 5GADJ 1K61A 1TNTA 3HOUJ 2AS5F 3G3ZA 4GXOA 1B9NA 3GFIA 4P9UA 3MMYB 3KX2A 4XRMA 1UHWA 2KZGA 4XL9A 2R7VA 4A3DJ 5FGMA 4HZFA 1FP2A 4RM2A 2HQ5A 4L0YB 2CGPA 1ZYRF 4BL0B 1EA3A 4XM3A 3BR3A 1JKOC 2WTEA 1T0FC 3F21A 1IAWA 3CD6I 2HTJA 1MNMC 3T8TA 5DDGA 3Q0VA 2L7FP 3WGIA 4XKVA 4CCKA 1UAAA 1TQIA 4IHXA 4OIRF 3PL8A 2VKVA 3OV8A 2E19A 2Z3YA 3DV8A 4RAFA 4B1RA 5B3SH 3HGGA 2P4WA 4IRIA 1D0ZA 2ZXWH 2A69F 2VBWA 4JX5A 2I8DA 3SDBA 5IT3A 1YHQI 3F8BA 1MZBA 5B5EC 3J7ZI 2OUMA 2DW4A 3PUFA 3PIOF 2P5LC 2STWA 2LG4A 2L02A 3K1PA 1VQ9I 4CCOA 3C18A 3BC8A 3BG3A 3RDIA 3VWBA 1ODDA 2K40A 3P9CA 4X6AJ 3OIPA 4MLOA 1TT0A 1FY7A 2IA2A 1IXSB 2FJ1A 2CUJA 2HTSA 3W2AA 2VT2A 3QP5A 5LEKA 5H2FC 4HDVA 1E3PA 3I53A 1ZGJA 2OA4A 5HLHA 4YFNF 4ZTJA 1U2WA 3BR5A 3CJNA 4HSRA 1K7AA 3ZGKA 3CO7C 3GZ6A 2QCOA 1RUOA 3C1DA 2HOSA 3LA2A 2JRMA 3MVPA 3QU6A 3QYFA 2BW3A 3G2BA 1DP7P 2EA2A 2QENA 3GBGA 1WFXA 1YG2A 5F0CA 2Y0SN 3OYIA 2E1OA 3S2HJ 2R7OA 5IT9Z 2CUFA 3HUGA 5DV5A 4CYCB 2BOLA 3ABTA 1MD0A 2LLKA 2A05A 2A5YB 4A3MJ 1AU7A 5HDGA 3PIPF 4BHCA 4A93J 3C3WA 4CSWA 3H3ZA 4IKFA 2MD5A 2ZMEA 3S2WA 1IV8A 1IXRC 3CCEI 4S04A 1Z91A 1GXQA 2CW7A 2J5PA 4J19A 2VQGA 3CCLI 3G1MA 3PNYA 4FX0A 4RAYA 4ENKA 3U1KA 1XX5A 1DU6A 1Y56A 3EYYA 3QOPA 4MGRA 2BW3B 5M5YJ 4RDUA 3H5AA 3T0YA 2DLLA 4H0EA 2XVCA 5AIQA 3FBNB 2VASA 2UUZA 4HLYA 3HJEA 2A3SA 2ESNA 2K02A 1T38A 4XOTA 1K6OA 1G2HA 2BV6A 2EZLA 3FF5A 2XPWA 3HIFA 3HUGB 4EJVA 2FD5A 1K83J 4EMSA 5J40A 5J8FA 4O3MA 1U8RA 2BY2A 2KQRA 1S9HA 1P6RA 1QNTA 3RSNA 4RAZA 2ZMEB 2K5CA 3JRDA 3H35A 2DA7A 4BEHA 1MBGA 1WI9A 3A0HC 3ZQLA 1IN4A 3KP5A 4GCVA 4DYQA 4NHJA 3TBIA 3I59A 4UVBA 1R58A 1YITI 1XN7A 5KNLA 4HEA2 4N0BA 1C0WA 3AAFA 1DUXC 3RCOA 2M9HA 3V42A 4RB2C 1HW1A 2DMQA 4WF2A 4A3FJ 1CQTA 2DA5A 4MNUA 2P81A 3IUOA 3V8JA 3V7SA 2RDPA 4I0AA 4BDYA 2BE5F 4PFPA 2IW5A 1QBJA 4M3FA 1WH7A 2X0LA 2GXBA 2F48A 4XONA 2HYFA 3CMYA 2JMWA 3VYTB 1KU7A 1IV6A 2TRTA 4G94A 1OYIA 3ZOBA 4I0BA 3WTVC 2BY0A 4BEHB 1BR4A 2GQQA 4HPQA 1ETQA 2KMUA 5KK1A 2DOAA 5IYBJ 3KP4A 5FD6A 4S05A 5E3LA 3I59B 1T6SA 2DMNA 2Z5UA 2VXZA 3EPZA 4XLFA 3WG7H 1RKWA 2CFXA 3C2GA 3KLOA 1OISA 2V9VA 1JHHA 1K6YA 4BQNA 4XK4A 2KJBA 1VQ7I 1Z9CA 3OL3A 2H94A 3ZMTA 1ZLJA 3MZYA 4IF4A 2NVYJ 1P7IA 2VBYA 4R8HA 1T98A 3E6MA 4GDFA 5K5OA 3R4KA 2Y30A 1R5GA 2XC7A 3QYBA 2LYCA 2DQRA 3RQIA 1G3SA 2KIQA 4I6ZA 3LL7A 2OTLI 1XSVA 2L9RA 3I0TA 4N4OB 1ZTRA 4YFXF 5ICEA 1I6HJ 4QPOA 2V4JC 3FMQA 4MQVA 4OAZA 5DCMA 3S14J 3CC7I 4RGXA 4AVZA 4ZZDA 4B4CA 4GFBA 5IOZA 2WB1N 1R1TA 2J5OA 2JPBA 3GFMA 2XRLA 4ENNA 2QSGX 2RC4A 3HYIA 1DQUA 1J2XA 2JVGA 3HSRA 2DMPA 2OQGA 2PX9A 2EV6A 3BJAA 4I98B 4D7MA 3GTQJ 3I4PA 2HVQA 3H9QA 5HLIA 5C44J 4FHTA 5LGNA 1USSA 4OINF 2M8GX 3GZ5A 2GWRA 2FF4A 2R7QA 4L5IA 4PFOA 5CVVA 3TKYA 4RBOA 1JXSA 2CQ7A 1EF4A 3L00A 5ILSA 2NS7A 2A07F 1E3HA 1SVOA 5DCMB 3RKXA 2LKSA 3PQKA 1KQ8A 1YW7A 1R7JA 4U87A 1WGXA 5TGTA 1G59A 1UCRA 1WJEA 5J4YA 1HBXG 5JVGF 4CH7A 1WJAA 4BQAA 2UXXA 2GA2A 3ZN1A 5F0HA 2ZJQF 3WTUC 1FT9A 2M7BA 3I55I 4CCMA 1D0XA 3M1EA 2WA0A 2E7WA 1QHHD 1B9MA 4L0ZB 5D8LB 1HKSA 2YUSA 3CP2A 2EV5A 4EM2A 4EQQA 3HOVJ 3VPRA 2O8KA 2PBIA 2M0MA 3CJTB 3FM3A 2A68F 4F55A 4PK4A 3P7NA 1I6XA 4DIQA 1IG7A 1X3ZB 2XAQA 4IZZA 2K9NA 3TOAA 4P9FA 3E7LA 1IF1A 1MJBA 2EFPA 2ZMEC 2EH3A 2FBIA 1KQ9A 3H1CA 1DGWY 1NHAA 4Y52J 4Y17A 4IHVA 2QKLB 1XC5A 4XN0A 4PJMA 1AHDP 2EBIA 4AM3A 4E7KA 1LE8B 1VQ8I 5CQEA 3FX3A 1YS7A 5GTHC 2CFOA 1G3WA 3LMMA 1LQ1A 3PO2J 4ANJA 3BR1A 2NNYA 2BBYA 2R7RA 4L9VA 4I7HA 2H1KA 4I76A 3BR0A 3LA7A 1JGSA 2R7ZJ 2G7UA 3L7WA 3OL4A 1JJ6C 1PDNC 4KIGA 2HKOA 3A01A 1FWZA 3RPUA 2MG4A 2IA1A 2VBZA 2XGEA 3R6SA 2UV1A 2P5VA 4M72A 4WXDA 2VE9A 4HX8A 3P9IA 1YFHA 1ZH5A 1LVAA 2D1VA 3FXLA 2QSHX 1BOAA 2QSFX 3WE3A 1YW8A 3MCZA 3IRRA 3JRBA 2X4HA 2HWVA 1J7KA 4IX7A 2VXDA 5M5XJ 4EM0B 3H36A 4GGGA 2KHMA 2W24A 1N25A 4GO1A 3N97A 2ELHA 3FHZA 1UG0A 4PJLA 5FKLA 2XV4S 1J75A 1F1ZA 2JSCA 4UV9A 1YJWI 2FA5A 1JTYA 3ABLH 3A01B 2V1UA 4XICA 5HDKA 3DCFA 2WBMA 2M87A 4YIRX 2IA0A 2DA6A 1IRXA 4XKWA 4G8XA 2E2HJ 4LB5A 2ELKA 5FLMJ 3FDYA 1IGNA 1ZRDA 4RS8A 3ERMA 4YG2F 2V1XA 3H9GA 1D1CA 5K7HA 2PMHA 2K86A 5D4RA 1KU9A 4JX6A 1HDDC 2V9KA 2XAGA 2FOKA 2L0KA 1ZR4A 3LFKA 3ZR8X 1VQ5I 2EFQA 3BR2A 2W85A 3I3LA 4HBLA 2X1DA 2MYSA 4LIVA 5H6RA 2Z9OA 1ZAOA 1VQLI 4O6JA 4BY7J 2FMLA 4AU7A 1RESA 3HRUA 5BQTA 3LAJA 2OCCH 2CW0F 3EQLF 1OCCH 3OYNA 5E1XA 4KNYA 2F5DA 1R6RA 2RVCA 5B1AH 2JA7J 2VJJA 2JUGA 3PFIA 4RGUA 1O3TA 2XUBA 2M45A 1HKQA 4RMNA 1FOYA 5GAGJ 1I39A 3NQOA 2PG4A 2L4AA 3DTIA 2R7WA 1S5LC 4AD9A 3SDGA 3BWGA 5B66C 4UB6C 4C30A 3MEXA 3V4GA 1OYWA 3BCAA 5JVTA 1GLNA 3Q5FA 2HS5A 3VOEA 2ZFWA 2OF7A 4H4KC 2XAHA 1EH8A 4L9NA 1PVEA 1WH5A 3QYEA 4PJNA 2EWNA 2Y9ZA 2PEXA 4KDPA 4WWCA 2OU2A 2W48A 4E7JA 4FTHA 1Y0UA 2GAUA 4V2GA 4ZC3A 5LLQA 2DJIA 2QUFA 1AKHB 4LLNA 2BY3A 1HA8A 5LFAA 1EV7A 3NEUA 3DWLE 3H9JA 2RREA 2M5WA 2RQQA 3KP7A 4IHSA 3SEQA 3ELKA 5J6XA 1YJ9I 1WHUA 1W4MA 3A03A 1MNDA 4DQ2A 2R0QC 4IOCF 3B6CA 1ZGAA 2CG4A 2LBFA 3KZIC 4M3EA 4UXNA 1IN5A 1LUJB 1POGA 1JKQC 2HPMA 1PYVA 2LKPA 2W57A 4I02A 3S1QJ 3A2KA 2MD0A 4MEYF 3D1NI 1WKMA 3BQYA 1XS9A 4HAMA 2W84A 4ABZA 5M3MJ 3F72A 3IAS2 3IRQA 4BGDA 2XB5A 1ZG1A 1KQ0A 3CMEI 2E2JJ 4LMYA 2L7ZA 4WK8F 3KEQA 2KZVA 5HLTA 3A1YA 2CU7A 4XLPF 5HOOA 1IJWC 3Q0UA 3TQNA 5LBQA 3WU1B 3L2UA 3GTJJ 2L2OA 2LBFB 5ICCA 1G3TA 3CMMA 3TDZC 2EV0A 3BJ6A 1X58A 3PO3J 2R7XA 4B8XA 1MMDA 4BUPA 1U78A 4XBFA 2ZCWA 3RPUD 4LG0A 3F9KA 5GPAA 3VSLA 1Z3YA 3RJPA 3WU2C 1AA7A 3OYKA 3H3VK 4WXHA 4C3JJ 4A3LJ 1QA6A 2PLYA 1WRJA 4M6VA 5FJ8J 2FNAA 2IGKA 5DD4A 1APLC 2LR8A 1VI0A 2L54A 3JRHA 1FC3A 3K4NA 1RI7A 3BP8A 1Z6TA 1B4AA 2DA4A 3IAM2 2H27A 1X1BA 2GLOA 1BN5A 1R36A 3AG3H 4CCNA 5JHUA 3LSJA 1BJZA 3RZOJ 2JA2A 3COAC 2DYSH 1J09A 1XMXA 3OYLA 4LG0B 3QQAA 1XG1A 3IV5A 3BQZA 3GTKJ 1N78A 3HOYJ 3DBRB 3TW7A 5CQGA 1YS6A 2E60A 4LB6B 1JKRC 1ZQ3P 3OOUA 2IEKA 2KISA 5EZGA 3A02A 4ZYGA 5KAIC 4OMZA 1WJCA 1XB4A 2DA1A 3E97A 4BBRJ 1X3WB 5J8CA 3BDDA 3AFHA 1HF0A 2DPUA 1ITYA 1HQCA 4IL6C 1VTNC 3D5LA 1YOVB 3FXQA 3DQVC 2H8RA 1A6QA 3M07A 3LA3A 1O4XA 1RR7A 2EIJH 1SAUA 3FXRA 1LDDA 5M5WJ 1RUNA 1WSUA 3L9FA 2WAEA 2IAIA 1LEBA 1FYKA 1D1AA 1ACIA 1S8NA 2K3PA 4MFEA 5JHFA 2KDZA 5FLXZ 3CCYA 4A6DA 1ETOA 3RYRA 2M1BA 1U6GA 1IRFA 5FROA 3S15J 3BROA 3DXJF 1UHSA 4IRGA 4RLQA 2F5VA 4HV6A 3MKZA 2V1DA 3S3NA 1IUYA 1RPWA 4XRSA 2NS8A 1JJ8C 1TTYA 1FX7A 3IWZA 1TWFJ 4B44A 1S7OA 3CCJI 1ETWA 3MFKA 3MAJA 3GUDA 4ETSA 4FX4A 1BL0A 5C4JJ 1NG6A 3C2BA 1IDZA 1A04A 2OJED 2HU9A 2KIMA 3U2RA 3HHHA 1MH3A 2TDXA 4MIMA 2WAFA 4CZCA 1P4AA 3QPHA 1Y39A 3HEFA 3H92A 1H9TA 2OTJI 5LRRA 3VFZA 2EZIA 1D0YA 1WCMJ 4B48A 2HZDA 2I10A 1XMAA 1ZN2A 3K4MA 4NUBA 2KKOA 2WB1A 5JR3A 3OYGA 3M4OJ 4RA2A 2HXOA 2LDUA 3OR1C 1IC8A 1A36A 1UHMA 4XR6A 1U8BA 5ICGA 2GIZA 2O0YA 1XGSA 3OYBA 3FISA 2IP2A 1SD5A 1PP7U 2IS2A 3CJRB 5EYRA 4BE0A 1I1GA 2H1LA 2NVQJ 2HVRA 2F4IA 3CCQI 3C7JA 1RNLA 3ZXSA 3WODF 5FRMA 2FE3A 2W7NA 3EYIA 2IS1A 3JREA 1CGPA 1FEXA 1DDNA 2JVHA 2BXYA 3DF8A 1ETVA 1FMWA 2A61A 2EFOA 2ZXIA 4XRFA 3TL4X 2LP0A 4ZYEA 3EUKL 2JTVA 4LGWA 1Z77A 5FD5A 4V19K 1S72I 3DEUA 2F2EA 1GVJA 5J4VA 2VN2A 2E7XA 2GOMA 2TCTA 1LEAA 4EGYA 2LK2A 2GM4A 5E8IA 1XPXA 3CDLA 1SD4A 2EPFA 1YQAA 4ZDLA 3K4BA 4M9SA 1QZYA 2WY8Q 2A6HF 2ME0A 2E5NA 5DS9A 1W7PA 4A0ZA 3KZYA 1TWGJ 1JT6A 2PMZN 3WE2A 2EJRA 4IEJA 2NVUB 2YX4A 4Q48A 2L01A 3GX4X 2VOPA 1TWHJ 5D8KB 2XRNA 5EGOA 2KT0A 3W6VA 1BW5A 2MW8A 5K1YA 1R4NB 4LK0F 3RIRA 5DUKA 4IXAA 4A3BJ 3PNTA 2P6TA 4XN3A 4HLXA 2DYRH 4RB0A 4A12A 1MBEA 4MFDA 1R4MB 1GUUA 1Y8QB 3TGNA 2JA6J 1F43A 2COBA 2OAZA 4CA0A 3RKQA 3RKWA 2Q8KA 2KJCA 1H0MA 3R60A 3VYUB 1MMNA 3P9KA 2HYGD 1J9IA 1ETYA 2I5UA 1TL8A 2HKXA 1U3EM 1OCOH 2O61A 3GEZA 4M73A 1BC8C 1WQ2A 4HX7A 4CICA 5D5WB 4C2TA 3KZZA 4C2MJ 4M9XA 3TO6A 2DT6A 5EEGA 2HQRA 3R0AA 1TQMA 1G4DA 3K1MA 4BHPA 3CZ6A 3RKYA 4OIQF 1O3SA 2LH9A 1K79A 4KN7X 1BM9A 4G7ZF 1BW6A 3J80Z 1TW2A 2DPDA 1KA8A 3K10A 5ILVA 5BS6A 3K2AA 2A5WA 2A6EF 5KCMA 4ASNA 1I50J 3RPQA 4AC0A 2OBPA 3BCBA 4U7BA 1UMQA 2BY1A 2LKXA 3WGHA 5L3CA 1FJLA 4HX4A 2VPRA 4KN4X 5DTDA 1KONA 4KYWA 1SANA 1SFOJ 3DPLC 2HDWA 4AIDA 2NS0A 3QRFF 2HXIA 2JSPA 3V8LA 4ESJA 4BHBA 4KICA 2M2EA 2V9PA 3L2WA 1OPCA 1TWAJ 3HOZJ 2DOFA 2IXSA 4M74A 4AYBN 4EJOA 3AG4H 3DKYA 3IKTA 2JZYA 2Q0OA 1OYYA 1FSHA 2E71A 1RKTA 3QWLA 3U1DA 4BXXJ 1F5TA 5BOXA 3D5SC 2E2IJ 3HOWJ 4XLEA 2ZXJA 2KDOA 1MBJA 3TOBA 3HC7A 4U7DA 3OMYA 2DI3A 1ZK8A 1ETKA 4Q5SF 1T95A 4ITVA 1WVRA 1V55H 3AKZA 5F0FA 4PCQA 2H6CA 3QPLA 3JRFA 3OSGA 1VZ0A 2IGOA 2FMYA 3H5RA 1M1EB 4XOPA 1R71A 2QA4I 1XSXA 2CMPA 2DMUA 2E34A 3W2WA 1X1AA 4HRIA 1OQYA 3MD2A 2VE8A 3EUHA 1XGMA 1DGRM 3NARA 3CDHA 2XGXA 3HL2A 1MMAA 4KT5C 3J7AO 1K4SA 2XAFA 1Z7LA 1V4RA 4BQOA 2P0WA 3N4MA 2BHYA 2KLOA 4HF2A 3K4LA 1TLHB 4G6TB 2BVMA 1UJ8A 1ULYA 2DFEA 3K70D 1TC3C 2FRHA 2HNHA 3K70C 4DYRA 1WI3A 4JQFA 1REPC 1KZHA 1U5TA 2KIFA 3ECHA 2UZKA 2ZO4A 3ZPLA 2X1EA 1G8XA 1VQMI 4BDZA 3TEDA 3KCCA 1XDUA 2ID6A 1R9TJ 2ELJA 4II3A 2PFBA 1KU3A 4LIUA 4ENMA 1GV2A 2DO7A 2R5ZA 1I27A 1BI3A 2WAQN 3L2RA 3WG9A 3GXOA 1V3FA 2RGVA 1QGPA 1SD7A 2EFWA 5IY5H 1BA5A 3ZN0A 2JJ7A 4A2UA 2L7KA 4I99C 4RGSA 1USTA 3BTLA 3BZKA 2Z1DA 1W7PD 1TQPA 1HXDA 1U5TB 2GZWA 4F3QA 1D3YA 2CWEA 2QM3A 2QQBA 3BJOA 1QQIA 3OYJA 3V7CA 3CCSI 2CW8A 3QOEA 4D7NA 1YRNA 2HDCA 2DA2A 3DU6A 3S32A 2DFFA 1ORKA 2V6CA 3SQNA 4YEJA 2EB7A 4BE2A 2G7HA 4DZJA 1SFUA 4NC7A 5HDNA 2QLZA 3FXJA 2VKDA 4WCGA 2STTA 3BG7A 4ZYHA 5CVUA 1HW5A 3Q9SA 1MIJA 3DFGA 5L3FA 4P5OA 2ESHA 1YIOA 2JRTA 2HI3A 3R61A 4XORA 4DJAA 2DODA 1O7FA 1BBYA 1LJ9A 2VONA 1LFPA 3ZP5A 1SMTA 4G6DA 2O5RA 5DEQA 1JI8A 2PJRA 4ENJA 4CHUA 2Z16A 3BPXA 4FETA 3QP6A 3M9AA 4MTDA 1BJAA 3JCUC 1V5EA 2LREA 4QSHA 1Z05A 2JUCA 1YRNB 2XF7A 3LSMA 1XTAA 2ZBKA 3CESA 5FKNA 3FIWA 2M4KA 2VJ4A 1JUPA 2P7CB 3CUQC 2X85A 3PUBA 1SEUA 5E18F 4M3GA 4LLGF 1MBKA 3CTAA 1BI1A 2D5VA 4G6QA 1DU0A 3QPSA 4QTRA 3KYDB 4CZZA 2VI6A 1VQNI 1WJBA 2L4MA 1TT5B 4V2FA 3HRSA 4D1QA 2PJRB 1IO2A 2XSJC 5DYMA 4D9JA 3F8MA 5M3FJ 3NRVA 3DBHB 2LD5A 2HDDA 1BR1A 1MDMA 1LNWA 4D5FA 1HDPA 2KRHA 1FOXA 3CLQA 3HPHA 1SVMA 2RAEA 2CUZA 1X2MA 3S3MA 4A0XA 5F1JA 3ERED 4A3CJ 3I9V2 1P7JA 4GYGA 3TW6A 1IUFA 2OPTA 3W6JB 5JLXA 5IPAA 1NK3P 1VNDA 3GZNB 4EV0A 2KIUA 1QU3A 4UHTA 2F5CA 2JA5J 2ZXHA 3ECOA 1QPIA 5CJ9A 3F3XA 3GCMA 2EA4A 4P1WA 4XMYA 2ECBA 4HNUA 3OYMA 1FIAA 2RV8A 1Y1WJ 4AIHA 3HSEA 4XLNF 4NB5A 3PJRA 1H8AC 5D4SA 2V1NA 3CLOA 3JTHA 1MDMB 2LMDA 3ABMH 2XSDC 2K7LA 4N9HA 4KIBA 4ZZLA 3KYLA 4XLCA 1NH3A 1ZLKA 4E4HA 4AIKA 5LHIA 2X51A 4XRSG 2FOWA 5E1WA 4NQWA 2ZJPF 1L0OC 3HGYA 4M6YA 3QODA 2AXLA 3BPVA 3EUHC 3M1CA 1YTYA 2R7TA 4EJUA 1ZELA 5D5UB 5HODA 4YRVA 2N8GA 2ZB9A 4MO7A 5J1YA 2CV2A 1V54H 4UVCA 4BE1A 4BACA 1E0EA 2K4BA 4IVNA 4HQEA 5D6FA 2KRFA 2ETHA 3JW4A 2RN7A 1P92A 3HDDA 2JPCA 3KIOA 2WWYA 2X48A 1LPQA 4OIOF 1U5TC 2VUMJ 4HV5A 2ZC2A 3WTYC 3REOA 5HS7A 1LKXA 2OV7A 4NQWB 3MKLA 4I09A 2XGCA 4M3BA 4N9IA 2EILH 3BZCA 1WPKA 1UG2A 4P55A 4M3DA 4A3EJ 2MBFA 1OCTC 2DMTA 2QVOA 2C6YA 3KP6A 5E3MA 3PSIA 4U0WA 3IKVA 1Y6IA 3A0BC 3HZJA 3ROUA 4MEXF 2DAOA 1HSJA 3QPTA 2DFHA 1W36D 3F8NA 1ZG3A 2HPIA 3S8PA 4DGWB 2X9DA 4RM3A 4N4NB 4G12A 3ZQFA 2GIVA 1H9GA 3FXKA 2FNPA 5ICFA 2CYYA 3T5XA 2G9WA 5FFXA 2D1HA 4EEFG 3LQRA 3BZ6A 1E3OC 2XASA 1MBFA 4KA4A 5GTIC 5A2QZ 2L9VA 2LVSA 1ON1A 1BR2A 5FLXK 2KPMA 6PAXA 1Y1VJ 3L09A 1ZARA 4UUVA 5D6EA 1VF9A 1X1CA 4CO8A 1W5CC 3KPHA 5C3EJ 4L9JA 3JTGA 3CP8A 3K6GA 3MZ8A 3G1LA 3HRMA 1IXCA 2P6SA 4II2A 3TP0A 4U0YA 3E1SA 3WTXC 3F23A 2LY2A 4M9ZA 1ETXA 3BTJA 4I01A 4Y4RA 1T39A 5EG0A 3LWFA 2X1CA 2Y31A 3OYEA 2NOJB 2R4GA 3TMOA 4CYDA 1SC7A 2ZNZA 3Q0WA 3VB2A 2PMZA 4BJ5C 4IOAF 2JT1A 3SZPA 4W1UA 1QZZA 2VC1A 3E6BA 3GW2A 3K9TA 3KEOA 5ERIA 2QEXI 4KFCA 5CKTA 2LOOA 2IS6A 4FASD 2MH9A 5GAHJ 2CQNA 4G9YA 4FISA 1ZRCA 2BVLA 3OYHA 4HYEA 4JP0A 4YFKF 1RC9A 4PJJA 3K4CA 5EJCA 5JI6A 5DD8A 4BQQA 1S7EA 3TP3A 1RETA 1H89C 1Z0XA 1OR7C 5E79C 5KVRA 2MABA 3I56I 3ZCOA 3AL0C 2CUEA 3BTIA 4JX4A 3RYPA 3CCMI 5EG0B 1R5HA 1ZKGA 2DDAA 3OYFA 1IZ1A 3BG9A 2IRFG 4LFUA 1J0RA 4KJZA 4BJ6C 4EJWA 4MTEA 3S1NJ 4FE4A 2Z33A 1B59A 3FMSA 3I71A 3DKWA 2L5QA 3E6DA 2AQEA 2RKHA 3GFLA 1FTTA 2ISZA 4XIDA 1QPMA 5LEJA 1O3RA 3MWMA 2XF5A 1LB2A 3WTTC 4HNVA 2Q2EA 5C4XJ 3M8FA 5CVJA 3FXUA 3DLAA 4IQ4A 1V5GA 3F8CA 4A3JJ 3OOPA 1IN6A 3HPGA 3ML6A 2E5ZA 3SFZA 5IP7J 2OZ6A 3OY9A 3BOQA 4O5VA 2IS4A 1MMGA 1JUSA 3KP3A 4F7ZA 2VPLA 2DXIA 2ZFUA 4ZDOA 2JA8J 2YX7A 5E8GA 2FQ3A 1OJLA 4DNCA 4UY8I 3DTEA 4IPAA 1Z3XA 5CVIA 1X2NA 3JSPA 4JOMA 3S1RJ 3LSRA 4AYBA 1B6AA 2R7FA 2CRGA 1YIJI 3LAPA 2QBYA 2DT7B 5IYCJ 2LFBA 1GDTA 3GTLJ 1JGGA 3S1MJ 3PFYA 4M6XA 1SAXA 4PDKA 4HW0A 4GRIA 4FE7A 1WJ5A 2XDVA 3FM5A 4ZJZA 1CF7A 1YLFA 1J5YA 1D5VA 2XKOA 2L7MP 5HVQC 1D5YA 2VB6A 4XKCA 3D5RC 5E3NA 3JAMZ 1Y8RB 3S2DJ 3OYAA 1MJ9A 1JT0A 4BY1J 3ABUA 4DZPA 2D2WA 3HM5A 1IN8A 4M71A 1MW7A 4Y33A 5LRSA 3B02A 2ZJRF 2ID3A 2X6YA 4FT8A 2FXAA 4ZYAA 2L9NA 2QBYB 3ZQIA 4ZH4F 3J80K 2KRCA 1SD6A 2F4MB 3BG5A 3KE2A 4OOIA 2R7DA 2M4GA 4L9TA 4QLCU 1CF7B 3ZQQA 4A5MA 3E3VA 4QPQA 1G6NA 5IP9J 3DKXA 3HTSB 1GV5A 2EIKH 3O3KA 2VKEA 4PJ0C 2LF8A 2UWMA 1FIPA 2YU9J 3KFWX 4PSXA 1MSEC 1S6LA 3B73A 3MN2A 1ONVA 4BBSJ 2P5KA 3GWZA 5HS8A 4L18B 2VODA 2DBBA 1ZG5A 4F91B 2MLGA 4W97A 4I2OA 1IW7F 2LNBA 3S16J 1Q1HA 1X3UA 5TJJA 3RZDJ 3K4JA 2WAQA 3G73A 5K5RA 3ASOH 2VQLA 3BR6A 4B09A 1EH6A 1YJNI 4RGRA 3E5XA 3OIQA 2V79A 3ZMSA 2JN6A 5HNFA 4JYKA 2DFIA 4AVPA 3HG9A 2MSYA 2CJJA 2PMUA 4U0VA 3T8RA 1QHGA 3H5NA 2OCEA 3WTWC 5HNHA 3M3YJ 2QQAA 3F8FA 1I5ZA 5KHDA 5L3BA 2PN6A 3X2QH 1YX5A 4Z2YA 1AOYA 3G6EI 1KGSA 1KYWA 1U0JA 3L2QA 3ZRGA 2DCEA 1YX3A 2WV1A 3O2PE 1F4KA 2GXGA 3R0JA 3ZQCA 1WJFA 2E35A 4CYCA 4HSTA 4NC8A 3GF2A 2YR2A 2O03A 4ZYDA 1GT0C 1TBXA 2MC3A 2KFDA 4CCLA 4CCJA 3F6OA 2DN0A 1SMYF 3ESWB 1IN7A 3PM1A 3SEZA 2LY1A 4AIJA 5IP6A 2XPUA 2D45A 1TWCJ 4IJAA 4QWQA 3UNGC 5D5XB 4RB1A 3L1PA 4HG2A 1Z67A 3C2HA 4CDGA 1D8JA 5H20A 3GLLA 1V5FA 2AO9A 1W7PB 4NNJA 3OS0A 4JK1X 1BC7C 3IH4A 5HLGA 2CV1A 4ESBA 1STZA 2LTPA 2IPQX 2W1OA 3IWFA 2R3SA 3S3OA 4B47A 3K7AJ 1T33A 2KP6A 2DDBA 4GYIA 1MBHA 3GFJA 5EGOB 4UUSA 1BI0A 5J3LA 5LD2C 3LSTA 4EATA 4XKBA 2O7OA 1FP1D 2YS9A 5F64A 1VQOI 3B6AA 1T2KA 2H09A 1MJAA 2E1NA 2F5EA 3WTSC 2V7FA 4XQFA 3CUQA 1EH7A 1UZCA 1FBSA 2Y75A 2OZUA 5D5VB 1OLTA 3GYHX 3ASNH 2FQ4A 2V26A 2X6WA 2YSRA 2OC6A 3CC2I 3DP7A 4XLAA 1ZREA 2M3AA 3UR3C 3EUAA 4R1HA 4D5CA 3CF5F 2FX0A 3MZHA 3HOTA 4UUSB 1FPQA 2XF6A 1OCZH 3CJQB 1B8IA 2HOEA 3K2ZA 1OMIA 3HBLA 4XNFA 4Y7NJ 5LGUA 1OCRH 3HXLA 2ICWG 3CUQB 1E2XA 2ME6A 3G4SI 2IJLA 2QF7A 1HC8A 2ECCA 2NVXJ 2R7SA 1H88C 4CUGA 3HSFA 3L2VA 3HKZN 3JSOA 1NK2P 2P7VB 3OYCA 5TRDA 1FNNA 4B43A 1LDJA 1T8IA 3F0CA 3K4KA 2LC2A 2WV0A 1ZRFA 1R23A 3G71I 3MKYB 1A31A 1FOWA 2M8EA 2VL8A 3U9GA 4UNOA 2VJ5A 4KITB 2GA1A 2W25A 3EETA 5DCFA 1R1VA 5DM6F 5F08A 1B8IB 4Y13A 3O6BB 3E6CC 2K9MA 2IT0A 3SFIA 3JR9A 4J00A 1K4TA 4LK1F 2BHZA 2EZHA 3ABKH 3GTGJ 5LHHA 3BY6A 2ADUA 1O3QA 3HHGA 1FBUA 2BEOA 3CC4I 2Z99A 4S0HB 1KYZA 3BG6A 1BIAA 1RRJA 2HOAA 1Q1VA 3ISPA 4BYYA 1VFCA 1FLIA 1N75A 4DBRA 2HOTA 1R22A 4B3AA 3ONQA 3ZQGA 3LOCA 1O57A 2NYXA 2CQKA 1MSFC 1RIOH 1BIBA 2FU4A 4UV8A 2Y48A 4LD5A 3W6KB 5IOYA 2QYOA 1XDSA 2DA3A 4KUMA 3DEEA 4NDLA 4RB3C 1SFKA 3NAUA 1HCRA 3RI4A 4K2EA 2HQNA 1Z1DA 2MH2A 2OD5A 3HOSA 2R7UA 4YIIA 2MLKA 5F27A 1ENHA 1WJDA 4D0PA 3I4NJ 2GBYA 4OAYA 4Y15A 3CMAI 2DT5A 1TP4A 5ILUA 3GVAA 2XKPA 3A4CA 2XPVA 3CO6C 3OSFA 3M7GA 2W4SA 1XGOA 2DOEA 4EM1A 2NRAC 4BNCA 3CCVI 3IC7A 4E6KG 3PNVA 1MGTA 1VQKI 2COMA 2M30A 2W82A 1HLVA 1BOBA 1YW9A 1UB9A 3DBLB 1RZ4A 4XSZF 1YO5C 2R5ZB 4BH9A 1P9QC 2DTRA 1VQ6I 2K9QA 5DUIA 1U9OA 1FTZA 2WADA 3F22A 3Q9VA 3J81K 2YPRA 3CUOA 2B9SA 1P4XA 2XIGA 2HYJA 5FFZA 2E1CA 3WHCA 2H8WA 1LE8A 5IYDJ 1YYVA 1EJ9A 2IBDA 4RLFA 1S3JA 4E7ZA 2AXTC 2QGUA 3IH2A 3H3UA 4DYCA 4C9YA 3AG1H 1X4OA 1FOKA 5EEHA 1KU2A
chains in the Genus database with same CATH topology
2KQRA 1S9HA 3RSNA 4B44A 2K5CA 3SYTA 3H35A 1ERDA 4BEHA 2E1MB 1NG6A 2VKHA 3TBIA 2HU9A 2KL4A 3LSIA 4HEA2 3PSFA 1BR2A 5KNLA 2MFZA 2KPMA 2WAFA 3KEYA 3FBIB 4C2UA 4CZCA 3VYRB 2LRDA 3J7AY 1X1CA 3RCOA 3V42A 3NWTA 3IUOA 2VQHA 4BDYA 2WY7Q 4E7IA 3CP8A 4PFPA 3K6GA 4XONA 1D0YA 4B48A 4II2A 2HZDA 3DPTA 3E1SA 2AQFA 4NUBA 2LY2A 3K4MA 2WB1A 3OYGA 3VYTB 3OR1C 4Y4RA 4XR6A 4BEHB 1BR4A 2X1CA 3OYEA 4HPQA 2NOJB 2KMUA 2R4GA 2DOAA 3TMOA 3OYBA 3FKJA 2IS2A 1FMVA 3CJRB 2PMZA 4YELA 4BJ5C 4BE0A 2HVRA 2F4IA 3OS1A 2VXZA 3EPZA 4XLFA 3C2GA 3ZXSA 4BQNA 1K6YA 5FRMA 2W7NA 3H0DA 3OL3A 2IS1A 2L9SA 5CKTA 2LOOA 2IS6A 4FASD 2JVHA 1X19A 2MC4A 1FMWA 3TL4X 2ZXIA 3EUKL 2BVLA 3OYHA 2K9LA 4PJJA 3K4CA 2VQCA 3E0JB 3AL0B 4BQQA 2XC7A 2IGNA 3QYBA 2LYCA 1YE9A 1OR7C 3LSGA 2MABA 3LL7A 3ZCOA 3AL0C 4LITA 4N4OB 3N05A 3W2VA 4HNTA 4F93B 2GOMA 4QPOA 3OYFA 2V4JC 4OAZA 4KJZA 4AVZA 4KT6A 4BJ6C 4ZDLA 3K4BA 3IP4B 2WY8Q 1D1BA 2E5NA 3DU5A 1MNEA 4PSWA 1DQUA 2JVGA 2L5QA 2AQEA 4ZTFA 4XLHA 2HVQA 4DBQA 4F92B 2VLAA 3H9QA 2W00A 3OYDA 2XF5A 4PFOA 4BJTA 2R7QA 2IGMA 3DLAA 4IQ4A 1V5GA 2ZSHB 3VSKA 3VDXA 3HPGA 3PNTA 3VYSB 4B3XA 2E5ZA 4XN3A 3OY9A 2IS4A 1MMGA 4CA0A 4U87A 2DXIA 2VPLA 2ZFUA 5TGTA 4R79A 1WJEA 1G59A 4ZDOA 4DOZA 3VYUB 1MMNA 4CH7A 1WJAA 3M8JA 4J01A 3DTEA 1Z3XA 2M7BA 2Q1ZB 4JOMA 4CCMA 4C2TA 1D0XA 2WA0A 4AYBA 1QHHD 1N77A 2DT6A 3CP2A 1DP3A 2DT7B 3CZ6A 2LH9A 3PFYA 1W36C 2FUG2 2M0MA 4BXFA 4GRIA 3K10A 1WJ5A 2XDVA 4F55A 4PK4A 4ZJZA 2VJIA 3W3CA 4DIQA 2A5WA 5KCMA 5HVQC 4IZZA 2VB6A 4U7BA 3BCBA 4X0GA 4KISA 4XKCA 3D5RC 2XAUA 3OYAA 1DGWY 1KONA 2E1MC 2QKLB 4E7SA 2X6XA 4XN0A 4PJMA 1MW7A 3DPLC 2HDWA 4Y33A 2JSPA 2X6YA 4E7KA 5CPRB 5CQEA 4ZYAA 2L9NA 4F52A 2CFOA 3LMMA 3L2WA 4ANJA 2KRCA 2R7RA 4ZDPA 2M4GA 3MKWB 2IXSA 3ZQQA 3OL4A 3DKYA 2Z2SB 4QPQA 3DKXA 3DPUA 2UWMA 3FHNA 4PSXA 4LG3A 1LDKB 2UV1A 4OWRB 3D5SC 2CH0A 4XLEA 2KDOA 3HC7A 3LSKA 3OMYA 1T95A 2VIXA 4F91B 4IX7A 4ITVA 2VXDA 2GOXB 3AKZA 1UELB 3K4JA 2WAQA 1VZ0A 2IGOA 2KHMA 2VQLA 1LVKA 3H5RA 4XOPA 1UG0A 4PJLA 2CMPA 3OIQA 3W2WA 5HNFA 1X1AA 4HRIA 3MD2A 2A6TA 3S93A 1X1DA 3HG9A 2QKMB 1DGRM 2WBMA 2ZSIB 3OWTA 1QHGA 3H5NA 1PJRA 2Y0SA 5HNHA 1IRXA 4XKWA 3HL2A 1MMAA 4IQJA 2M7AA 4BS9A 5KHDA 1Z7LA 4BQOA 2P0WA 1YX5A 2KLOA 3K4LA 3FDYA 4G6TB 2BVMA 3H9GA 3LFUA 1D1CA 3K70D 1U0JA 3L2QA 4E7HA 3ZRGA 2V9KA 2DCEA 1YX3A 2HNHA 3RQ4A 3K70C 3ZR8X 4JQFA 1Z21A 3I3LA 3CF2A 2X1DA 1WJFA 2MYSA 4HSTA 4LIVA 3DTKA 4NC8A 2X1EA 1G8XA 4BDZA 2CS3A 4AU7A 2ELJA 4CCLA 4II3A 4CCJA 4LIUA 3OYNA 2CV0A 3L2RA 2HVSA 3SEZA 1R6RA 2LY1A 4Y3OA 2RNGA 2VJJA 3RTRA 3UNGC 2JUGA 4HG2A 3C2HA 3SZGA 2L7KA 1V5FA 4NNJA 4RMNA 3OS0A 2Z1DA 2CV1A 1X4PA 3DTIA 2R7WA 2W1OA 4F3QA 3S3OA 4B47A 2KP6A 2Q2EB 4C30A 5LD2C 3BCAA 4EATA 1GLNA 4XKBA 3OYJA 2HQAA 3HKZA 4H4KC 2CW8A 3QOEA 2V6EA 3QYEA 4PJNA 3OR2C 3DU6A 4BU2A 3S32A 1NG7A 2V7FA 4XQFA 4YEJA 4BE2A 4PUSA 3LSHA 4NC7A 3BLYA 1TZLA 2VKDA 3BG7A 4E7JA 3U21A 1OLTA 4ZC3A 5FRNA 2DJIA 1HA8A 5LFAA 4P5OA 2V26A 2X6WA 2OC6A 4XORA 4DJAA 3DWLE 3H9JA 4XLAA 1LFPA 2M3AA 2RREA 2RQQA 3UR3C 3EUAA 2O5RA 1JI8A 3SEQA 2PJRA 2Z16A 4FETA 3HOTA 3NWSA 2XF6A 3CJQB 1MNDA 1V5EA 2LREA 2F6CA 3OS2A 4XNFA 4E7LA 2LBFA 2XF7A 3HXLA 3LSMA 3CESA 2M4KA 2VJ4A 1PYVA 2HPMA 2R7SA 4CUGA 3A2KA 2MD0A 2X85A 3PUBA 3L2VA 3MMYB 3KX2A 3OYCA 4XL9A 4B43A 2R7VA 3IAS2 3K4KA 4BGDA 2LC2A 1WJBA 4RM2A 3MKYB 4D1QA 2PJRB 4BL0B 2XSJC 2VL8A 4D9JA 1EA3A 4XM3A 2VJ5A 2KZVA 4KITB 5HLTA 1T0FC 3A1YA 5HOOA 1BR1A 2K9MA 3L2UA 4XKVA 2L2OA 2KRHA 2LBFB 4CCKA 1UAAA 3HPHA 4J00A 3CMMA 3PL8A 2CUZA 3S3MA 1D0ZA 3I9V2 2R7XA 1MMDA 4BUPA 2I8DA 3SDBA 3BG6A 3RPUD 1QU3A 3F9KA 3VSLA 1Z3YA 2ZXHA 2OUMA 1AA7A 3OYKA 4P1WA 4XMYA 1N75A 2LG4A 4DBRA 4HNUA 3ONQA 3OYMA 4CCOA 3BC8A 3PJRA 3VWBA 2IGKA 2V1NA 3DEEA 3OIPA 4MLOA 3K4NA 1SFKA 1TT0A 3W2AA 2CUJA 3IAM2 3KYLA 4XLCA 1X1BA 3HOSA 4E4HA 4CCNA 2X51A 2R7UA 2JA2A 3QODA 1J09A 3OYLA 1WJDA 4ZTJA 3EUHC 4HSRA 3M1CA 4OAYA 3ZGKA 2R7TA 1ZELA 1N78A 5CQGA 4YRVA 2E60A 3QYFA 2BW3A 3A4CA 3G2BA 3OOUA 2CV2A 3GBGA 1WJCA 4BE1A 4BACA 1WFXA 1E0EA 2W4SA 3AFHA 3OYIA 2R7OA 4E6KG 2BOLA 3D5LA 3PNVA 3DQVC 2W82A 1BOBA 4CSWA 4IKFA 1LKXA 2OV7A 1SAUA 4NQWB 2CW7A 1P9QC 2VQGA 2WAEA 3PNYA 2WADA 1D1AA 1Y56A 2K3PA 2BW3B 3PSIA 5JHFA 3H5AA 3FBNB 2VASA 2UUZA 5FROA 1Y6IA 4RLFA 4XOTA 1W36D 4E7ZA 3HUGB 2HPIA 3S8PA 4C9YA 4DGWB 4RLQA 2F5VA 3S3NA 1X4OA 4RM3A 4N4NB 3MKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WY8 Q;  2JVH A;  3D5R C;  2GOX B;  2JVG A;  2GOM A;  3D5S C;  2WY7 Q;  2NOJ B; 
#chains in the Genus database with same CATH topology
 1LFB A;  4LLL A;  2X6O A;  1JHF A;  1P4W A;  2RNJ A;  3SYT A;  2XHK A;  1ERD A;  1IRZ A;  2E1M B;  2VKH A;  5GAE J;  4A69 C;  1WZ2 A;  4OMY A;  3TO7 A;  3LSP A;  1K78 A;  5DM7 F;  2KL4 A;  3LSI A;  4EVI A;  2DK8 A;  3PSF A;  2MFZ A;  3ZMU A;  3ULQ B;  3KEY A;  3FBI B;  4C2U A;  1S29 A;  3VYR B;  2LRD A;  2Y69 H;  5BNG A;  3J7A Y;  1P2F A;  2MGQ A;  3LQQ A;  4NC6 A;  2UXN A;  1IDY A;  1A6I A;  3NWT A;  2VQH A;  3HRT A;  1F9N A;  5J47 A;  2WY7 Q;  2MA3 A;  4E7I A;  3L2C A;  1OR7 A;  2FBK A;  4HF0 A;  3PQJ A;  2O8X A;  3DPT A;  2AQF A;  3JRI A;  1XGN A;  2Y2Z A;  1FYM A;  3EDP A;  2BZT A;  3LNQ A;  1W1W E;  5A2Q K;  3FKJ A;  1MKM A;  2LF7 A;  1FMV A;  4DW6 A;  4L5E A;  1GVD A;  4YEL A;  1PP8 F;  1K78 B;  2HGC A;  3OS1 A;  2YU3 A;  3HTU A;  1SFE A;  1R5I D;  2NAZ A;  1E17 A;  1W5S A;  1SFX A;  2CSO A;  2L3D A;  1ON2 A;  3ZMV A;  4A5N A;  3H0D A;  2L9S A;  3IL2 A;  3FKI J;  1ZR2 A;  1X19 A;  2MC4 A;  5JLW A;  2VBX A;  4WX9 A;  5LGT A;  2CQQ A;  5AON A;  2K9L A;  2VQC A;  3E0J B;  3AL0 B;  4ON0 A;  2K85 A;  5EZH A;  2IGN A;  1YE9 A;  3LSG A;  2O6G E;  4LIT A;  1LFU P;  3W2V A;  3N05 A;  4CXF A;  3SJM A;  4E70 A;  4KMU X;  4HNT A;  5E20 A;  4UVA A;  2G0E A;  4F93 B;  5E3O A;  3ZMZ A;  2VT3 A;  5AIP A;  1QZE A;  3I5U A;  1JKP C;  4U88 A;  3K0L A;  5FB2 A;  1QO0 D;  4KT6 A;  3IP4 B;  1D1B A;  1W0T A;  3TDU C;  4IHT A;  1Z7U A;  4EJT A;  3DU5 A;  1MNE A;  4PSW A;  5L3D A;  2XAJ A;  2DJN A;  4BXU A;  4P96 A;  4NBQ A;  1OKR A;  4ZTF A;  1FSE A;  3HB9 A;  4PGH A;  4XLH A;  4DBQ A;  4F92 B;  2VLA A;  2HZT A;  1TNS A;  2W00 A;  1WWX A;  5CYV A;  3J81 Z;  3OYD A;  4CGZ A;  1GXP A;  5TIS C;  3KLN A;  4BJT A;  5LHG A;  5L3E A;  1QVU A;  2IGM A;  3K69 A;  2ZKZ A;  2FEZ A;  4A3G J;  1NTC A;  2ZSH B;  1JTX A;  3VSK A;  1W5T A;  3SHF A;  2BXZ A;  1B1B A;  4A6E A;  3VDX A;  3VYS B;  1O7L A;  4B3X A;  4WXC A;  4FQG A;  1TW3 A;  2NVT J;  3FK7 A;  1Y0N A;  4LJZ F;  1L3L A;  3JRC A;  3KP2 A;  2ISY A;  4R79 A;  2EQR A;  2WC2 A;  3KYC B;  4DOZ A;  4J01 A;  3M8J A;  1AKH A;  1DPU A;  2XRO A;  5K7Z A;  2BYV E;  4AWX B;  1MH4 A;  4C3I J;  4Q4Z F;  4IHY A;  2Q1Z B;  4C3H J;  5F1R A;  5CVR A;  4BAY A;  5EDN A;  3QAH A;  2RQP A;  5J1U A;  2B0L A;  1N77 A;  2LY9 A;  4AUX A;  4XSX F;  5E1Z B;  3DEW A;  2OQR A;  1DP3 A;  2ACJ A;  4BKX A;  1W36 C;  4HOB A;  2FUG 2;  5F04 A;  1B72 A;  4A3K J;  2DTZ A;  4BXF A;  2EZK A;  2VJI A;  3W3C A;  4HA8 A;  2AHQ A;  4ESF A;  1BI2 A;  3KET A;  2EFN A;  3V7R A;  4X0G A;  4KIS A;  3CQZ J;  2XAU A;  2R93 J;  2M34 A;  2QZ8 A;  1OCP A;  3M8E A;  2ZJ2 A;  2E1M C;  2JQ7 A;  4E7S A;  2JWT A;  2X6X A;  3IH3 A;  2LSO A;  1T0F A;  1FYL A;  5HS9 A;  1G3Y A;  5CPR B;  3DLL F;  4A3I J;  4F52 A;  2EK5 A;  1I1S A;  5K5Q A;  3P5J A;  3WHB A;  1XSD A;  4ZDP A;  1ZHF A;  2HFH A;  1B72 B;  5JFR A;  4PZJ A;  3JRG A;  3FMR A;  3MKW B;  2QWW A;  2Z2S B;  1MMS A;  4JBA A;  3JAM K;  3DPU A;  5CLS A;  1X1P A;  3AG2 H;  3O8H A;  3FHN A;  3TO9 A;  3GTP J;  4LG3 A;  3CCU I;  5ED4 A;  1LDK B;  1XD7 A;  4OWR B;  1I3A A;  5FLV A;  2PI0 A;  1AWC A;  2E36 A;  2CH0 A;  3I58 A;  2NXN B;  3MQ0 A;  3LSK A;  3T1B A;  3QU3 A;  2K4J A;  4HDU A;  1J59 A;  2B63 J;  3ZMD A;  2FSW A;  2K9S A;  2VIX A;  2Y0M A;  5KAF C;  1RR8 C;  4IHW A;  5K7F A;  2GOX B;  1UEL B;  4Z6Y A;  5E17 F;  2R5Y A;  5GP9 A;  5BPD A;  1R1U A;  1LVK A;  3JRA A;  5BMZ A;  1PUE E;  4YIF A;  4KIF A;  3FXM A;  5GPC A;  1R49 A;  2A6T A;  5B1B H;  3S93 A;  1X1D A;  2JK3 A;  1YI2 I;  3CDI A;  1FZP B;  3E5Q A;  4IO9 F;  2QKM B;  3GO5 A;  3VOD A;  2PQ8 A;  2ZSI B;  1HST A;  1XMK A;  3OWT A;  1ZGW A;  1PJR A;  2Y0S A;  4OIP F;  3SZT A;  1HW2 A;  1Z6R A;  4IQJ A;  3V8K A;  2M7A A;  4BS9 A;  2O3F A;  4MQ9 F;  3J7Y J;  3LFU A;  2FBH A;  3I64 A;  3O8G A;  1JUM A;  4E7H A;  4PGG A;  1S7A A;  3RQ4 A;  4X1E A;  4L5J A;  2R5Y B;  1Z21 A;  3OIO A;  4MHG A;  1U9N A;  3CF2 A;  2K27 A;  4OU0 A;  9ANT A;  2QQ8 A;  3F6V A;  3DTK A;  2BGC A;  1JE8 A;  1F36 A;  3ZQ7 A;  2CS3 A;  1T56 A;  2P8T A;  5FKK A;  5FO5 A;  3GME A;  3H0G J;  4A0Y A;  3UKG A;  2HEO A;  3VEP A;  2CV0 A;  2PJP A;  2EIN H;  2HVS A;  5FKM A;  4KMF A;  2CO5 A;  3I4M J;  4RAG A;  5J1R A;  4Y3O A;  1A35 A;  1PUF A;  2RNG A;  3RTR A;  3I54 A;  2EIM H;  4UB8 C;  5F6F A;  1VQ4 I;  3WTZ A;  1W0U A;  1GHC A;  1SVL A;  3SZG A;  3K1N A;  1T08 B;  2NOG A;  1A5J A;  2Y9Y A;  1FBQ A;  5FKO A;  5EEA A;  1XCB A;  1X4P A;  3WU0 A;  3WGG A;  2K3F A;  3S17 J;  2F4O B;  2Q2E B;  2NNN A;  4G7O F;  4HF1 A;  4Q47 A;  5H6Q A;  3CCR I;  3SXY A;  3FK6 A;  2IVM A;  1DPR A;  2HQA A;  3FWE A;  3HKZ A;  4EGZ A;  2HR3 A;  2VC0 A;  1QVT A;  1UFM A;  5EF6 A;  2V6E A;  2CQX A;  2M0C A;  2QQ9 A;  3OR2 C;  3Q3S A;  4BU2 A;  1IRG A;  1NG7 A;  2XB0 X;  1PUF B;  4PUS A;  2VOO A;  2XGD A;  2ZNY A;  3LSH A;  1D8K A;  4IRH A;  3BLY A;  1TZL A;  3G1O A;  4G7H F;  4UUT A;  1QRY A;  3U21 A;  2GXA A;  3BT9 A;  5FRN A;  2H6B A;  3FZV A;  2DU9 A;  3IHU A;  3D0S A;  1XCV A;  5IT9 K;  3BTC A;  4FCY A;  4QIW N;  1HOM A;  5L3G A;  2O9L A;  4HQM A;  5BPI A;  1OFC X;  2DQL A;  4TV7 A;  3E5U A;  3GTM J;  2B7E A;  2F5F A;  3NWS A;  3ZQH A;  1VQP I;  1EKE A;  1I3Q J;  2R92 J;  2F6C A;  3OS2 A;  3HOX J;  2DK5 A;  4E7L A;  1R00 A;  3FXO A;  1HKT A;  4LOC A;  3GTO J;  3GLX A;  5GAD J;  1K61 A;  1TNT A;  3HOU J;  2AS5 F;  3G3Z A;  4GXO A;  1B9N A;  3GFI A;  4P9U A;  3MMY B;  3KX2 A;  4XRM A;  1UHW A;  2KZG A;  4XL9 A;  2R7V A;  4A3D J;  5FGM A;  4HZF A;  1FP2 A;  4RM2 A;  2HQ5 A;  4L0Y B;  2CGP A;  1ZYR F;  4BL0 B;  1EA3 A;  4XM3 A;  3BR3 A;  1JKO C;  2WTE A;  1T0F C;  3F21 A;  1IAW A;  3CD6 I;  2HTJ A;  1MNM C;  3T8T A;  5DDG A;  3Q0V A;  2L7F P;  3WGI A;  4XKV A;  4CCK A;  1UAA A;  1TQI A;  4IHX A;  4OIR F;  3PL8 A;  2VKV A;  3OV8 A;  2E19 A;  2Z3Y A;  3DV8 A;  4RAF A;  4B1R A;  5B3S H;  3HGG A;  2P4W A;  4IRI A;  1D0Z A;  2ZXW H;  2A69 F;  2VBW A;  4JX5 A;  2I8D A;  3SDB A;  5IT3 A;  1YHQ I;  3F8B A;  1MZB A;  5B5E C;  3J7Z I;  2OUM A;  2DW4 A;  3PUF A;  3PIO F;  2P5L C;  2STW A;  2LG4 A;  2L02 A;  3K1P A;  1VQ9 I;  4CCO A;  3C18 A;  3BC8 A;  3BG3 A;  3RDI A;  3VWB A;  1ODD A;  2K40 A;  3P9C A;  4X6A J;  3OIP A;  4MLO A;  1TT0 A;  1FY7 A;  2IA2 A;  1IXS B;  2FJ1 A;  2CUJ A;  2HTS A;  3W2A A;  2VT2 A;  3QP5 A;  5LEK A;  5H2F C;  4HDV A;  1E3P A;  3I53 A;  1ZGJ A;  2OA4 A;  5HLH A;  4YFN F;  4ZTJ A;  1U2W A;  3BR5 A;  3CJN A;  4HSR A;  1K7A A;  3ZGK A;  3CO7 C;  3GZ6 A;  2QCO A;  1RUO A;  3C1D A;  2HOS A;  3LA2 A;  2JRM A;  3MVP A;  3QU6 A;  3QYF A;  2BW3 A;  3G2B A;  1DP7 P;  2EA2 A;  2QEN A;  3GBG A;  1WFX A;  1YG2 A;  5F0C A;  2Y0S N;  3OYI A;  2E1O A;  3S2H J;  2R7O A;  5IT9 Z;  2CUF A;  3HUG A;  5DV5 A;  4CYC B;  2BOL A;  3ABT A;  1MD0 A;  2LLK A;  2A05 A;  2A5Y B;  4A3M J;  1AU7 A;  5HDG A;  3PIP F;  4BHC A;  4A93 J;  3C3W A;  4CSW A;  3H3Z A;  4IKF A;  2MD5 A;  2ZME A;  3S2W A;  1IV8 A;  1IXR C;  3CCE I;  4S04 A;  1Z91 A;  1GXQ A;  2CW7 A;  2J5P A;  4J19 A;  2VQG A;  3CCL I;  3G1M A;  3PNY A;  4FX0 A;  4RAY A;  4ENK A;  3U1K A;  1XX5 A;  1DU6 A;  1Y56 A;  3EYY A;  3QOP A;  4MGR A;  2BW3 B;  5M5Y J;  4RDU A;  3H5A A;  3T0Y A;  2DLL A;  4H0E A;  2XVC A;  5AIQ A;  3FBN B;  2VAS A;  2UUZ A;  4HLY A;  3HJE A;  2A3S A;  2ESN A;  2K02 A;  1T38 A;  4XOT A;  1K6O A;  1G2H A;  2BV6 A;  2EZL A;  3FF5 A;  2XPW A;  3HIF A;  3HUG B;  4EJV A;  2FD5 A;  1K83 J;  4EMS A;  5J40 A;  5J8F A;  4O3M A;  1U8R A;  2BY2 A;  2KQR A;  1S9H A;  1P6R A;  1QNT A;  3RSN A;  4RAZ A;  2ZME B;  2K5C A;  3JRD A;  3H35 A;  2DA7 A;  4BEH A;  1MBG A;  1WI9 A;  3A0H C;  3ZQL A;  1IN4 A;  3KP5 A;  4GCV A;  4DYQ A;  4NHJ A;  3TBI A;  3I59 A;  4UVB A;  1R58 A;  1YIT I;  1XN7 A;  5KNL A;  4HEA 2;  4N0B A;  1C0W A;  3AAF A;  1DUX C;  3RCO A;  2M9H A;  3V42 A;  4RB2 C;  1HW1 A;  2DMQ A;  4WF2 A;  4A3F J;  1CQT A;  2DA5 A;  4MNU A;  2P81 A;  3IUO A;  3V8J A;  3V7S A;  2RDP A;  4I0A A;  4BDY A;  2BE5 F;  4PFP A;  2IW5 A;  1QBJ A;  4M3F A;  1WH7 A;  2X0L A;  2GXB A;  2F48 A;  4XON A;  2HYF A;  3CMY A;  2JMW A;  3VYT B;  1KU7 A;  1IV6 A;  2TRT A;  4G94 A;  1OYI A;  3ZOB A;  4I0B A;  3WTV C;  2BY0 A;  4BEH B;  1BR4 A;  2GQQ A;  4HPQ A;  1ETQ A;  2KMU A;  5KK1 A;  2DOA A;  5IYB J;  3KP4 A;  5FD6 A;  4S05 A;  5E3L A;  3I59 B;  1T6S A;  2DMN A;  2Z5U A;  2VXZ A;  3EPZ A;  4XLF A;  3WG7 H;  1RKW A;  2CFX A;  3C2G A;  3KLO A;  1OIS A;  2V9V A;  1JHH A;  1K6Y A;  4BQN A;  4XK4 A;  2KJB A;  1VQ7 I;  1Z9C A;  3OL3 A;  2H94 A;  3ZMT A;  1ZLJ A;  3MZY A;  4IF4 A;  2NVY J;  1P7I A;  2VBY A;  4R8H A;  1T98 A;  3E6M A;  4GDF A;  5K5O A;  3R4K A;  2Y30 A;  1R5G A;  2XC7 A;  3QYB A;  2LYC A;  2DQR A;  3RQI A;  1G3S A;  2KIQ A;  4I6Z A;  3LL7 A;  2OTL I;  1XSV A;  2L9R A;  3I0T A;  4N4O B;  1ZTR A;  4YFX F;  5ICE A;  1I6H J;  4QPO A;  2V4J C;  3FMQ A;  4MQV A;  4OAZ A;  5DCM A;  3S14 J;  3CC7 I;  4RGX A;  4AVZ A;  4ZZD A;  4B4C A;  4GFB A;  5IOZ A;  2WB1 N;  1R1T A;  2J5O A;  2JPB A;  3GFM A;  2XRL A;  4ENN A;  2QSG X;  2RC4 A;  3HYI A;  1DQU A;  1J2X A;  2JVG A;  3HSR A;  2DMP A;  2OQG A;  2PX9 A;  2EV6 A;  3BJA A;  4I98 B;  4D7M A;  3GTQ J;  3I4P A;  2HVQ A;  3H9Q A;  5HLI A;  5C44 J;  4FHT A;  5LGN A;  1USS A;  4OIN F;  2M8G X;  3GZ5 A;  2GWR A;  2FF4 A;  2R7Q A;  4L5I A;  4PFO A;  5CVV A;  3TKY A;  4RBO A;  1JXS A;  2CQ7 A;  1EF4 A;  3L00 A;  5ILS A;  2NS7 A;  2A07 F;  1E3H A;  1SVO A;  5DCM B;  3RKX A;  2LKS A;  3PQK A;  1KQ8 A;  1YW7 A;  1R7J A;  4U87 A;  1WGX A;  5TGT A;  1G59 A;  1UCR A;  1WJE A;  5J4Y A;  1HBX G;  5JVG F;  4CH7 A;  1WJA A;  4BQA A;  2UXX A;  2GA2 A;  3ZN1 A;  5F0H A;  2ZJQ F;  3WTU C;  1FT9 A;  2M7B A;  3I55 I;  4CCM A;  1D0X A;  3M1E A;  2WA0 A;  2E7W A;  1QHH D;  1B9M A;  4L0Z B;  5D8L B;  1HKS A;  2YUS A;  3CP2 A;  2EV5 A;  4EM2 A;  4EQQ A;  3HOV J;  3VPR A;  2O8K A;  2PBI A;  2M0M A;  3CJT B;  3FM3 A;  2A68 F;  4F55 A;  4PK4 A;  3P7N A;  1I6X A;  4DIQ A;  1IG7 A;  1X3Z B;  2XAQ A;  4IZZ A;  2K9N A;  3TOA A;  4P9F A;  3E7L A;  1IF1 A;  1MJB A;  2EFP A;  2ZME C;  2EH3 A;  2FBI A;  1KQ9 A;  3H1C A;  1DGW Y;  1NHA A;  4Y52 J;  4Y17 A;  4IHV A;  2QKL B;  1XC5 A;  4XN0 A;  4PJM A;  1AHD P;  2EBI A;  4AM3 A;  4E7K A;  1LE8 B;  1VQ8 I;  5CQE A;  3FX3 A;  1YS7 A;  5GTH C;  2CFO A;  1G3W A;  3LMM A;  1LQ1 A;  3PO2 J;  4ANJ A;  3BR1 A;  2NNY A;  2BBY A;  2R7R A;  4L9V A;  4I7H A;  2H1K A;  4I76 A;  3BR0 A;  3LA7 A;  1JGS A;  2R7Z J;  2G7U A;  3L7W A;  3OL4 A;  1JJ6 C;  1PDN C;  4KIG A;  2HKO A;  3A01 A;  1FWZ A;  3RPU A;  2MG4 A;  2IA1 A;  2VBZ A;  2XGE A;  3R6S A;  2UV1 A;  2P5V A;  4M72 A;  4WXD A;  2VE9 A;  4HX8 A;  3P9I A;  1YFH A;  1ZH5 A;  1LVA A;  2D1V A;  3FXL A;  2QSH X;  1BOA A;  2QSF X;  3WE3 A;  1YW8 A;  3MCZ A;  3IRR A;  3JRB A;  2X4H A;  2HWV A;  1J7K A;  4IX7 A;  2VXD A;  5M5X J;  4EM0 B;  3H36 A;  4GGG A;  2KHM A;  2W24 A;  1N25 A;  4GO1 A;  3N97 A;  2ELH A;  3FHZ A;  1UG0 A;  4PJL A;  5FKL A;  2XV4 S;  1J75 A;  1F1Z A;  2JSC A;  4UV9 A;  1YJW I;  2FA5 A;  1JTY A;  3ABL H;  3A01 B;  2V1U A;  4XIC A;  5HDK A;  3DCF A;  2WBM A;  2M87 A;  4YIR X;  2IA0 A;  2DA6 A;  1IRX A;  4XKW A;  4G8X A;  2E2H J;  4LB5 A;  2ELK A;  5FLM J;  3FDY A;  1IGN A;  1ZRD A;  4RS8 A;  3ERM A;  4YG2 F;  2V1X A;  3H9G A;  1D1C A;  5K7H A;  2PMH A;  2K86 A;  5D4R A;  1KU9 A;  4JX6 A;  1HDD C;  2V9K A;  2XAG A;  2FOK A;  2L0K A;  1ZR4 A;  3LFK A;  3ZR8 X;  1VQ5 I;  2EFQ A;  3BR2 A;  2W85 A;  3I3L A;  4HBL A;  2X1D A;  2MYS A;  4LIV A;  5H6R A;  2Z9O A;  1ZAO A;  1VQL I;  4O6J A;  4BY7 J;  2FML A;  4AU7 A;  1RES A;  3HRU A;  5BQT A;  3LAJ A;  2OCC H;  2CW0 F;  3EQL F;  1OCC H;  3OYN A;  5E1X A;  4KNY A;  2F5D A;  1R6R A;  2RVC A;  5B1A H;  2JA7 J;  2VJJ A;  2JUG A;  3PFI A;  4RGU A;  1O3T A;  2XUB A;  2M45 A;  1HKQ A;  4RMN A;  1FOY A;  5GAG J;  1I39 A;  3NQO A;  2PG4 A;  2L4A A;  3DTI A;  2R7W A;  1S5L C;  4AD9 A;  3SDG A;  3BWG A;  5B66 C;  4UB6 C;  4C30 A;  3MEX A;  3V4G A;  1OYW A;  3BCA A;  5JVT A;  1GLN A;  3Q5F A;  2HS5 A;  3VOE A;  2ZFW A;  2OF7 A;  4H4K C;  2XAH A;  1EH8 A;  4L9N A;  1PVE A;  1WH5 A;  3QYE A;  4PJN A;  2EWN A;  2Y9Z A;  2PEX A;  4KDP A;  4WWC A;  2OU2 A;  2W48 A;  4E7J A;  4FTH A;  1Y0U A;  2GAU A;  4V2G A;  4ZC3 A;  5LLQ A;  2DJI A;  2QUF A;  1AKH B;  4LLN A;  2BY3 A;  1HA8 A;  5LFA A;  1EV7 A;  3NEU A;  3DWL E;  3H9J A;  2RRE A;  2M5W A;  2RQQ A;  3KP7 A;  4IHS A;  3SEQ A;  3ELK A;  5J6X A;  1YJ9 I;  1WHU A;  1W4M A;  3A03 A;  1MND A;  4DQ2 A;  2R0Q C;  4IOC F;  3B6C A;  1ZGA A;  2CG4 A;  2LBF A;  3KZI C;  4M3E A;  4UXN A;  1IN5 A;  1LUJ B;  1POG A;  1JKQ C;  2HPM A;  1PYV A;  2LKP A;  2W57 A;  4I02 A;  3S1Q J;  3A2K A;  2MD0 A;  4MEY F;  3D1N I;  1WKM A;  3BQY A;  1XS9 A;  4HAM A;  2W84 A;  4ABZ A;  5M3M J;  3F72 A;  3IAS 2;  3IRQ A;  4BGD A;  2XB5 A;  1ZG1 A;  1KQ0 A;  3CME I;  2E2J J;  4LMY A;  2L7Z A;  4WK8 F;  3KEQ A;  2KZV A;  5HLT A;  3A1Y A;  2CU7 A;  4XLP F;  5HOO A;  1IJW C;  3Q0U A;  3TQN A;  5LBQ A;  3WU1 B;  3L2U A;  3GTJ J;  2L2O A;  2LBF B;  5ICC A;  1G3T A;  3CMM A;  3TDZ C;  2EV0 A;  3BJ6 A;  1X58 A;  3PO3 J;  2R7X A;  4B8X A;  1MMD A;  4BUP A;  1U78 A;  4XBF A;  2ZCW A;  3RPU D;  4LG0 A;  3F9K A;  5GPA A;  3VSL A;  1Z3Y A;  3RJP A;  3WU2 C;  1AA7 A;  3OYK A;  3H3V K;  4WXH A;  4C3J J;  4A3L J;  1QA6 A;  2PLY A;  1WRJ A;  4M6V A;  5FJ8 J;  2FNA A;  2IGK A;  5DD4 A;  1APL C;  2LR8 A;  1VI0 A;  2L54 A;  3JRH A;  1FC3 A;  3K4N A;  1RI7 A;  3BP8 A;  1Z6T A;  1B4A A;  2DA4 A;  3IAM 2;  2H27 A;  1X1B A;  2GLO A;  1BN5 A;  1R36 A;  3AG3 H;  4CCN A;  5JHU A;  3LSJ A;  1BJZ A;  3RZO J;  2JA2 A;  3COA C;  2DYS H;  1J09 A;  1XMX A;  3OYL A;  4LG0 B;  3QQA A;  1XG1 A;  3IV5 A;  3BQZ A;  3GTK J;  1N78 A;  3HOY J;  3DBR B;  3TW7 A;  5CQG A;  1YS6 A;  2E60 A;  4LB6 B;  1JKR C;  1ZQ3 P;  3OOU A;  2IEK A;  2KIS A;  5EZG A;  3A02 A;  4ZYG A;  5KAI C;  4OMZ A;  1WJC A;  1XB4 A;  2DA1 A;  3E97 A;  4BBR J;  1X3W B;  5J8C A;  3BDD A;  3AFH A;  1HF0 A;  2DPU A;  1ITY A;  1HQC A;  4IL6 C;  1VTN C;  3D5L A;  1YOV B;  3FXQ A;  3DQV C;  2H8R A;  1A6Q A;  3M07 A;  3LA3 A;  1O4X A;  1RR7 A;  2EIJ H;  1SAU A;  3FXR A;  1LDD A;  5M5W J;  1RUN A;  1WSU A;  3L9F A;  2WAE A;  2IAI A;  1LEB A;  1FYK A;  1D1A A;  1ACI A;  1S8N A;  2K3P A;  4MFE A;  5JHF A;  2KDZ A;  5FLX Z;  3CCY A;  4A6D A;  1ETO A;  3RYR A;  2M1B A;  1U6G A;  1IRF A;  5FRO A;  3S15 J;  3BRO A;  3DXJ F;  1UHS A;  4IRG A;  4RLQ A;  2F5V A;  4HV6 A;  3MKZ A;  2V1D A;  3S3N A;  1IUY A;  1RPW A;  4XRS A;  2NS8 A;  1JJ8 C;  1TTY A;  1FX7 A;  3IWZ A;  1TWF J;  4B44 A;  1S7O A;  3CCJ I;  1ETW A;  3MFK A;  3MAJ A;  3GUD A;  4ETS A;  4FX4 A;  1BL0 A;  5C4J J;  1NG6 A;  3C2B A;  1IDZ A;  1A04 A;  2OJE D;  2HU9 A;  2KIM A;  3U2R A;  3HHH A;  1MH3 A;  2TDX A;  4MIM A;  2WAF A;  4CZC A;  1P4A A;  3QPH A;  1Y39 A;  3HEF A;  3H92 A;  1H9T A;  2OTJ I;  5LRR A;  3VFZ A;  2EZI A;  1D0Y A;  1WCM J;  4B48 A;  2HZD A;  2I10 A;  1XMA A;  1ZN2 A;  3K4M A;  4NUB A;  2KKO A;  2WB1 A;  5JR3 A;  3OYG A;  3M4O J;  4RA2 A;  2HXO A;  2LDU A;  3OR1 C;  1IC8 A;  1A36 A;  1UHM A;  4XR6 A;  1U8B A;  5ICG A;  2GIZ A;  2O0Y A;  1XGS A;  3OYB A;  3FIS A;  2IP2 A;  1SD5 A;  1PP7 U;  2IS2 A;  3CJR B;  5EYR A;  4BE0 A;  1I1G A;  2H1L A;  2NVQ J;  2HVR A;  2F4I A;  3CCQ I;  3C7J A;  1RNL A;  3ZXS A;  3WOD F;  5FRM A;  2FE3 A;  2W7N A;  3EYI A;  2IS1 A;  3JRE A;  1CGP A;  1FEX A;  1DDN A;  2JVH A;  2BXY A;  3DF8 A;  1ETV A;  1FMW A;  2A61 A;  2EFO A;  2ZXI A;  4XRF A;  3TL4 X;  2LP0 A;  4ZYE A;  3EUK L;  2JTV A;  4LGW A;  1Z77 A;  5FD5 A;  4V19 K;  1S72 I;  3DEU A;  2F2E A;  1GVJ A;  5J4V A;  2VN2 A;  2E7X A;  2GOM A;  2TCT A;  1LEA A;  4EGY A;  2LK2 A;  2GM4 A;  5E8I A;  1XPX A;  3CDL A;  1SD4 A;  2EPF A;  1YQA A;  4ZDL A;  3K4B A;  4M9S A;  1QZY A;  2WY8 Q;  2A6H F;  2ME0 A;  2E5N A;  5DS9 A;  1W7P A;  4A0Z A;  3KZY A;  1TWG J;  1JT6 A;  2PMZ N;  3WE2 A;  2EJR A;  4IEJ A;  2NVU B;  2YX4 A;  4Q48 A;  2L01 A;  3GX4 X;  2VOP A;  1TWH J;  5D8K B;  2XRN A;  5EGO A;  2KT0 A;  3W6V A;  1BW5 A;  2MW8 A;  5K1Y A;  1R4N B;  4LK0 F;  3RIR A;  5DUK A;  4IXA A;  4A3B J;  3PNT A;  2P6T A;  4XN3 A;  4HLX A;  2DYR H;  4RB0 A;  4A12 A;  1MBE A;  4MFD A;  1R4M B;  1GUU A;  1Y8Q B;  3TGN A;  2JA6 J;  1F43 A;  2COB A;  2OAZ A;  4CA0 A;  3RKQ A;  3RKW A;  2Q8K A;  2KJC A;  1H0M A;  3R60 A;  3VYU B;  1MMN A;  3P9K A;  2HYG D;  1J9I A;  1ETY A;  2I5U A;  1TL8 A;  2HKX A;  1U3E M;  1OCO H;  2O61 A;  3GEZ A;  4M73 A;  1BC8 C;  1WQ2 A;  4HX7 A;  4CIC A;  5D5W B;  4C2T A;  3KZZ A;  4C2M J;  4M9X A;  3TO6 A;  2DT6 A;  5EEG A;  2HQR A;  3R0A A;  1TQM A;  1G4D A;  3K1M A;  4BHP A;  3CZ6 A;  3RKY A;  4OIQ F;  1O3S A;  2LH9 A;  1K79 A;  4KN7 X;  1BM9 A;  4G7Z F;  1BW6 A;  3J80 Z;  1TW2 A;  2DPD A;  1KA8 A;  3K10 A;  5ILV A;  5BS6 A;  3K2A A;  2A5W A;  2A6E F;  5KCM A;  4ASN A;  1I50 J;  3RPQ A;  4AC0 A;  2OBP A;  3BCB A;  4U7B A;  1UMQ A;  2BY1 A;  2LKX A;  3WGH A;  5L3C A;  1FJL A;  4HX4 A;  2VPR A;  4KN4 X;  5DTD A;  1KON A;  4KYW A;  1SAN A;  1SFO J;  3DPL C;  2HDW A;  4AID A;  2NS0 A;  3QRF F;  2HXI A;  2JSP A;  3V8L A;  4ESJ A;  4BHB A;  4KIC A;  2M2E A;  2V9P A;  3L2W A;  1OPC A;  1TWA J;  3HOZ J;  2DOF A;  2IXS A;  4M74 A;  4AYB N;  4EJO A;  3AG4 H;  3DKY A;  3IKT A;  2JZY A;  2Q0O A;  1OYY A;  1FSH A;  2E71 A;  1RKT A;  3QWL A;  3U1D A;  4BXX J;  1F5T A;  5BOX A;  3D5S C;  2E2I J;  3HOW J;  4XLE A;  2ZXJ A;  2KDO A;  1MBJ A;  3TOB A;  3HC7 A;  4U7D A;  3OMY A;  2DI3 A;  1ZK8 A;  1ETK A;  4Q5S F;  1T95 A;  4ITV A;  1WVR A;  1V55 H;  3AKZ A;  5F0F A;  4PCQ A;  2H6C A;  3QPL A;  3JRF A;  3OSG A;  1VZ0 A;  2IGO A;  2FMY A;  3H5R A;  1M1E B;  4XOP A;  1R71 A;  2QA4 I;  1XSX A;  2CMP A;  2DMU A;  2E34 A;  3W2W A;  1X1A A;  4HRI A;  1OQY A;  3MD2 A;  2VE8 A;  3EUH A;  1XGM A;  1DGR M;  3NAR A;  3CDH A;  2XGX A;  3HL2 A;  1MMA A;  4KT5 C;  3J7A O;  1K4S A;  2XAF A;  1Z7L A;  1V4R A;  4BQO A;  2P0W A;  3N4M A;  2BHY A;  2KLO A;  4HF2 A;  3K4L A;  1TLH B;  4G6T B;  2BVM A;  1UJ8 A;  1ULY A;  2DFE A;  3K70 D;  1TC3 C;  2FRH A;  2HNH A;  3K70 C;  4DYR A;  1WI3 A;  4JQF A;  1REP C;  1KZH A;  1U5T A;  2KIF A;  3ECH A;  2UZK A;  2ZO4 A;  3ZPL A;  2X1E A;  1G8X A;  1VQM I;  4BDZ A;  3TED A;  3KCC A;  1XDU A;  2ID6 A;  1R9T J;  2ELJ A;  4II3 A;  2PFB A;  1KU3 A;  4LIU A;  4ENM A;  1GV2 A;  2DO7 A;  2R5Z A;  1I27 A;  1BI3 A;  2WAQ N;  3L2R A;  3WG9 A;  3GXO A;  1V3F A;  2RGV A;  1QGP A;  1SD7 A;  2EFW A;  5IY5 H;  1BA5 A;  3ZN0 A;  2JJ7 A;  4A2U A;  2L7K A;  4I99 C;  4RGS A;  1UST A;  3BTL A;  3BZK A;  2Z1D A;  1W7P D;  1TQP A;  1HXD A;  1U5T B;  2GZW A;  4F3Q A;  1D3Y A;  2CWE A;  2QM3 A;  2QQB A;  3BJO A;  1QQI A;  3OYJ A;  3V7C A;  3CCS I;  2CW8 A;  3QOE A;  4D7N A;  1YRN A;  2HDC A;  2DA2 A;  3DU6 A;  3S32 A;  2DFF A;  1ORK A;  2V6C A;  3SQN A;  4YEJ A;  2EB7 A;  4BE2 A;  2G7H A;  4DZJ A;  1SFU A;  4NC7 A;  5HDN A;  2QLZ A;  3FXJ A;  2VKD A;  4WCG A;  2STT A;  3BG7 A;  4ZYH A;  5CVU A;  1HW5 A;  3Q9S A;  1MIJ A;  3DFG A;  5L3F A;  4P5O A;  2ESH A;  1YIO A;  2JRT A;  2HI3 A;  3R61 A;  4XOR A;  4DJA A;  2DOD A;  1O7F A;  1BBY A;  1LJ9 A;  2VON A;  1LFP A;  3ZP5 A;  1SMT A;  4G6D A;  2O5R A;  5DEQ A;  1JI8 A;  2PJR A;  4ENJ A;  4CHU A;  2Z16 A;  3BPX A;  4FET A;  3QP6 A;  3M9A A;  4MTD A;  1BJA A;  3JCU C;  1V5E A;  2LRE A;  4QSH A;  1Z05 A;  2JUC A;  1YRN B;  2XF7 A;  3LSM A;  1XTA A;  2ZBK A;  3CES A;  5FKN A;  3FIW A;  2M4K A;  2VJ4 A;  1JUP A;  2P7C B;  3CUQ C;  2X85 A;  3PUB A;  1SEU A;  5E18 F;  4M3G A;  4LLG F;  1MBK A;  3CTA A;  1BI1 A;  2D5V A;  4G6Q A;  1DU0 A;  3QPS A;  4QTR A;  3KYD B;  4CZZ A;  2VI6 A;  1VQN I;  1WJB A;  2L4M A;  1TT5 B;  4V2F A;  3HRS A;  4D1Q A;  2PJR B;  1IO2 A;  2XSJ C;  5DYM A;  4D9J A;  3F8M A;  5M3F J;  3NRV A;  3DBH B;  2LD5 A;  2HDD A;  1BR1 A;  1MDM A;  1LNW A;  4D5F A;  1HDP A;  2KRH A;  1FOX A;  3CLQ A;  3HPH A;  1SVM A;  2RAE A;  2CUZ A;  1X2M A;  3S3M A;  4A0X A;  5F1J A;  3ERE D;  4A3C J;  3I9V 2;  1P7J A;  4GYG A;  3TW6 A;  1IUF A;  2OPT A;  3W6J B;  5JLX A;  5IPA A;  1NK3 P;  1VND A;  3GZN B;  4EV0 A;  2KIU A;  1QU3 A;  4UHT A;  2F5C A;  2JA5 J;  2ZXH A;  3ECO A;  1QPI A;  5CJ9 A;  3F3X A;  3GCM A;  2EA4 A;  4P1W A;  4XMY A;  2ECB A;  4HNU A;  3OYM A;  1FIA A;  2RV8 A;  1Y1W J;  4AIH A;  3HSE A;  4XLN F;  4NB5 A;  3PJR A;  1H8A C;  5D4S A;  2V1N A;  3CLO A;  3JTH A;  1MDM B;  2LMD A;  3ABM H;  2XSD C;  2K7L A;  4N9H A;  4KIB A;  4ZZL A;  3KYL A;  4XLC A;  1NH3 A;  1ZLK A;  4E4H A;  4AIK A;  5LHI A;  2X51 A;  4XRS G;  2FOW A;  5E1W A;  4NQW A;  2ZJP F;  1L0O C;  3HGY A;  4M6Y A;  3QOD A;  2AXL A;  3BPV A;  3EUH C;  3M1C A;  1YTY A;  2R7T A;  4EJU A;  1ZEL A;  5D5U B;  5HOD A;  4YRV A;  2N8G A;  2ZB9 A;  4MO7 A;  5J1Y A;  2CV2 A;  1V54 H;  4UVC A;  4BE1 A;  4BAC A;  1E0E A;  2K4B A;  4IVN A;  4HQE A;  5D6F A;  2KRF A;  2ETH A;  3JW4 A;  2RN7 A;  1P92 A;  3HDD A;  2JPC A;  3KIO A;  2WWY A;  2X48 A;  1LPQ A;  4OIO F;  1U5T C;  2VUM J;  4HV5 A;  2ZC2 A;  3WTY C;  3REO A;  5HS7 A;  1LKX A;  2OV7 A;  4NQW B;  3MKL A;  4I09 A;  2XGC A;  4M3B A;  4N9I A;  2EIL H;  3BZC A;  1WPK A;  1UG2 A;  4P55 A;  4M3D A;  4A3E J;  2MBF A;  1OCT C;  2DMT A;  2QVO A;  2C6Y A;  3KP6 A;  5E3M A;  3PSI A;  4U0W A;  3IKV A;  1Y6I A;  3A0B C;  3HZJ A;  3ROU A;  4MEX F;  2DAO A;  1HSJ A;  3QPT A;  2DFH A;  1W36 D;  3F8N A;  1ZG3 A;  2HPI A;  3S8P A;  4DGW B;  2X9D A;  4RM3 A;  4N4N B;  4G12 A;  3ZQF A;  2GIV A;  1H9G A;  3FXK A;  2FNP A;  5ICF A;  2CYY A;  3T5X A;  2G9W A;  5FFX A;  2D1H A;  4EEF G;  3LQR A;  3BZ6 A;  1E3O C;  2XAS A;  1MBF A;  4KA4 A;  5GTI C;  5A2Q Z;  2L9V A;  2LVS A;  1ON1 A;  1BR2 A;  5FLX K;  2KPM A;  6PAX A;  1Y1V J;  3L09 A;  1ZAR A;  4UUV A;  5D6E A;  1VF9 A;  1X1C A;  4CO8 A;  1W5C C;  3KPH A;  5C3E J;  4L9J A;  3JTG A;  3CP8 A;  3K6G A;  3MZ8 A;  3G1L A;  3HRM A;  1IXC A;  2P6S A;  4II2 A;  3TP0 A;  4U0Y A;  3E1S A;  3WTX C;  3F23 A;  2LY2 A;  4M9Z A;  1ETX A;  3BTJ A;  4I01 A;  4Y4R A;  1T39 A;  5EG0 A;  3LWF A;  2X1C A;  2Y31 A;  3OYE A;  2NOJ B;  2R4G A;  3TMO A;  4CYD A;  1SC7 A;  2ZNZ A;  3Q0W A;  3VB2 A;  2PMZ A;  4BJ5 C;  4IOA F;  2JT1 A;  3SZP A;  4W1U A;  1QZZ A;  2VC1 A;  3E6B A;  3GW2 A;  3K9T A;  3KEO A;  5ERI A;  2QEX I;  4KFC A;  5CKT A;  2LOO A;  2IS6 A;  4FAS D;  2MH9 A;  5GAH J;  2CQN A;  4G9Y A;  4FIS A;  1ZRC A;  2BVL A;  3OYH A;  4HYE A;  4JP0 A;  4YFK F;  1RC9 A;  4PJJ A;  3K4C A;  5EJC A;  5JI6 A;  5DD8 A;  4BQQ A;  1S7E A;  3TP3 A;  1RET A;  1H89 C;  1Z0X A;  1OR7 C;  5E79 C;  5KVR A;  2MAB A;  3I56 I;  3ZCO A;  3AL0 C;  2CUE A;  3BTI A;  4JX4 A;  3RYP A;  3CCM I;  5EG0 B;  1R5H A;  1ZKG A;  2DDA A;  3OYF A;  1IZ1 A;  3BG9 A;  2IRF G;  4LFU A;  1J0R A;  4KJZ A;  4BJ6 C;  4EJW A;  4MTE A;  3S1N J;  4FE4 A;  2Z33 A;  1B59 A;  3FMS A;  3I71 A;  3DKW A;  2L5Q A;  3E6D A;  2AQE A;  2RKH A;  3GFL A;  1FTT A;  2ISZ A;  4XID A;  1QPM A;  5LEJ A;  1O3R A;  3MWM A;  2XF5 A;  1LB2 A;  3WTT C;  4HNV A;  2Q2E A;  5C4X J;  3M8F A;  5CVJ A;  3FXU A;  3DLA A;  4IQ4 A;  1V5G A;  3F8C A;  4A3J J;  3OOP A;  1IN6 A;  3HPG A;  3ML6 A;  2E5Z A;  3SFZ A;  5IP7 J;  2OZ6 A;  3OY9 A;  3BOQ A;  4O5V A;  2IS4 A;  1MMG A;  1JUS A;  3KP3 A;  4F7Z A;  2VPL A;  2DXI A;  2ZFU A;  4ZDO A;  2JA8 J;  2YX7 A;  5E8G A;  2FQ3 A;  1OJL A;  4DNC A;  4UY8 I;  3DTE A;  4IPA A;  1Z3X A;  5CVI A;  1X2N A;  3JSP A;  4JOM A;  3S1R J;  3LSR A;  4AYB A;  1B6A A;  2R7F A;  2CRG A;  1YIJ I;  3LAP A;  2QBY A;  2DT7 B;  5IYC J;  2LFB A;  1GDT A;  3GTL J;  1JGG A;  3S1M J;  3PFY A;  4M6X A;  1SAX A;  4PDK A;  4HW0 A;  4GRI A;  4FE7 A;  1WJ5 A;  2XDV A;  3FM5 A;  4ZJZ A;  1CF7 A;  1YLF A;  1J5Y A;  1D5V A;  2XKO A;  2L7M P;  5HVQ C;  1D5Y A;  2VB6 A;  4XKC A;  3D5R C;  5E3N A;  3JAM Z;  1Y8R B;  3S2D J;  3OYA A;  1MJ9 A;  1JT0 A;  4BY1 J;  3ABU A;  4DZP A;  2D2W A;  3HM5 A;  1IN8 A;  4M71 A;  1MW7 A;  4Y33 A;  5LRS A;  3B02 A;  2ZJR F;  2ID3 A;  2X6Y A;  4FT8 A;  2FXA A;  4ZYA A;  2L9N A;  2QBY B;  3ZQI A;  4ZH4 F;  3J80 K;  2KRC A;  1SD6 A;  2F4M B;  3BG5 A;  3KE2 A;  4OOI A;  2R7D A;  2M4G A;  4L9T A;  4QLC U;  1CF7 B;  3ZQQ A;  4A5M A;  3E3V A;  4QPQ A;  1G6N A;  5IP9 J;  3DKX A;  3HTS B;  1GV5 A;  2EIK H;  3O3K A;  2VKE A;  4PJ0 C;  2LF8 A;  2UWM A;  1FIP A;  2YU9 J;  3KFW X;  4PSX A;  1MSE C;  1S6L A;  3B73 A;  3MN2 A;  1ONV A;  4BBS J;  2P5K A;  3GWZ A;  5HS8 A;  4L18 B;  2VOD A;  2DBB A;  1ZG5 A;  4F91 B;  2MLG A;  4W97 A;  4I2O A;  1IW7 F;  2LNB A;  3S16 J;  1Q1H A;  1X3U A;  5TJJ A;  3RZD J;  3K4J A;  2WAQ A;  3G73 A;  5K5R A;  3ASO H;  2VQL A;  3BR6 A;  4B09 A;  1EH6 A;  1YJN I;  4RGR A;  3E5X A;  3OIQ A;  2V79 A;  3ZMS A;  2JN6 A;  5HNF A;  4JYK A;  2DFI A;  4AVP A;  3HG9 A;  2MSY A;  2CJJ A;  2PMU A;  4U0V A;  3T8R A;  1QHG A;  3H5N A;  2OCE A;  3WTW C;  5HNH A;  3M3Y J;  2QQA A;  3F8F A;  1I5Z A;  5KHD A;  5L3B A;  2PN6 A;  3X2Q H;  1YX5 A;  4Z2Y A;  1AOY A;  3G6E I;  1KGS A;  1KYW A;  1U0J A;  3L2Q A;  3ZRG A;  2DCE A;  1YX3 A;  2WV1 A;  3O2P E;  1F4K A;  2GXG A;  3R0J A;  3ZQC A;  1WJF A;  2E35 A;  4CYC A;  4HST A;  4NC8 A;  3GF2 A;  2YR2 A;  2O03 A;  4ZYD A;  1GT0 C;  1TBX A;  2MC3 A;  2KFD A;  4CCL A;  4CCJ A;  3F6O A;  2DN0 A;  1SMY F;  3ESW B;  1IN7 A;  3PM1 A;  3SEZ A;  2LY1 A;  4AIJ A;  5IP6 A;  2XPU A;  2D45 A;  1TWC J;  4IJA A;  4QWQ A;  3UNG C;  5D5X B;  4RB1 A;  3L1P A;  4HG2 A;  1Z67 A;  3C2H A;  4CDG A;  1D8J A;  5H20 A;  3GLL A;  1V5F A;  2AO9 A;  1W7P B;  4NNJ A;  3OS0 A;  4JK1 X;  1BC7 C;  3IH4 A;  5HLG A;  2CV1 A;  4ESB A;  1STZ A;  2LTP A;  2IPQ X;  2W1O A;  3IWF A;  2R3S A;  3S3O A;  4B47 A;  3K7A J;  1T33 A;  2KP6 A;  2DDB A;  4GYI A;  1MBH A;  3GFJ A;  5EGO B;  4UUS A;  1BI0 A;  5J3L A;  5LD2 C;  3LST A;  4EAT A;  4XKB A;  2O7O A;  1FP1 D;  2YS9 A;  5F64 A;  1VQO I;  3B6A A;  1T2K A;  2H09 A;  1MJA A;  2E1N A;  2F5E A;  3WTS C;  2V7F A;  4XQF A;  3CUQ A;  1EH7 A;  1UZC A;  1FBS A;  2Y75 A;  2OZU A;  5D5V B;  1OLT A;  3GYH X;  3ASN H;  2FQ4 A;  2V26 A;  2X6W A;  2YSR A;  2OC6 A;  3CC2 I;  3DP7 A;  4XLA A;  1ZRE A;  2M3A A;  3UR3 C;  3EUA A;  4R1H A;  4D5C A;  3CF5 F;  2FX0 A;  3MZH A;  3HOT A;  4UUS B;  1FPQ A;  2XF6 A;  1OCZ H;  3CJQ B;  1B8I A;  2HOE A;  3K2Z A;  1OMI A;  3HBL A;  4XNF A;  4Y7N J;  5LGU A;  1OCR H;  3HXL A;  2ICW G;  3CUQ B;  1E2X A;  2ME6 A;  3G4S I;  2IJL A;  2QF7 A;  1HC8 A;  2ECC A;  2NVX J;  2R7S A;  1H88 C;  4CUG A;  3HSF A;  3L2V A;  3HKZ N;  3JSO A;  1NK2 P;  2P7V B;  3OYC A;  5TRD A;  1FNN A;  4B43 A;  1LDJ A;  1T8I A;  3F0C A;  3K4K A;  2LC2 A;  2WV0 A;  1ZRF A;  1R23 A;  3G71 I;  3MKY B;  1A31 A;  1FOW A;  2M8E A;  2VL8 A;  3U9G A;  4UNO A;  2VJ5 A;  4KIT B;  2GA1 A;  2W25 A;  3EET A;  5DCF A;  1R1V A;  5DM6 F;  5F08 A;  1B8I B;  4Y13 A;  3O6B B;  3E6C C;  2K9M A;  2IT0 A;  3SFI A;  3JR9 A;  4J00 A;  1K4T A;  4LK1 F;  2BHZ A;  2EZH A;  3ABK H;  3GTG J;  5LHH A;  3BY6 A;  2ADU A;  1O3Q A;  3HHG A;  1FBU A;  2BEO A;  3CC4 I;  2Z99 A;  4S0H B;  1KYZ A;  3BG6 A;  1BIA A;  1RRJ A;  2HOA A;  1Q1V A;  3ISP A;  4BYY A;  1VFC A;  1FLI A;  1N75 A;  4DBR A;  2HOT A;  1R22 A;  4B3A A;  3ONQ A;  3ZQG A;  3LOC A;  1O57 A;  2NYX A;  2CQK A;  1MSF C;  1RIO H;  1BIB A;  2FU4 A;  4UV8 A;  2Y48 A;  4LD5 A;  3W6K B;  5IOY A;  2QYO A;  1XDS A;  2DA3 A;  4KUM A;  3DEE A;  4NDL A;  4RB3 C;  1SFK A;  3NAU A;  1HCR A;  3RI4 A;  4K2E A;  2HQN A;  1Z1D A;  2MH2 A;  2OD5 A;  3HOS A;  2R7U A;  4YII A;  2MLK A;  5F27 A;  1ENH A;  1WJD A;  4D0P A;  3I4N J;  2GBY A;  4OAY A;  4Y15 A;  3CMA I;  2DT5 A;  1TP4 A;  5ILU A;  3GVA A;  2XKP A;  3A4C A;  2XPV A;  3CO6 C;  3OSF A;  3M7G A;  2W4S A;  1XGO A;  2DOE A;  4EM1 A;  2NRA C;  4BNC A;  3CCV I;  3IC7 A;  4E6K G;  3PNV A;  1MGT A;  1VQK I;  2COM A;  2M30 A;  2W82 A;  1HLV A;  1BOB A;  1YW9 A;  1UB9 A;  3DBL B;  1RZ4 A;  4XSZ F;  1YO5 C;  2R5Z B;  4BH9 A;  1P9Q C;  2DTR A;  1VQ6 I;  2K9Q A;  5DUI A;  1U9O A;  1FTZ A;  2WAD A;  3F22 A;  3Q9V A;  3J81 K;  2YPR A;  3CUO A;  2B9S A;  1P4X A;  2XIG A;  2HYJ A;  5FFZ A;  2E1C A;  3WHC A;  2H8W A;  1LE8 A;  5IYD J;  1YYV A;  1EJ9 A;  2IBD A;  4RLF A;  1S3J A;  4E7Z A;  2AXT C;  2QGU A;  3IH2 A;  3H3U A;  4DYC A;  4C9Y A;  3AG1 H;  1X4O A;  1FOK A;  5EEH A;  1KU2 A; 
#chains in the Genus database with same CATH homology
 2KQR A;  1S9H A;  3RSN A;  4B44 A;  2K5C A;  3SYT A;  3H35 A;  1ERD A;  4BEH A;  2E1M B;  1NG6 A;  2VKH A;  3TBI A;  2HU9 A;  2KL4 A;  3LSI A;  4HEA 2;  3PSF A;  1BR2 A;  5KNL A;  2MFZ A;  2KPM A;  2WAF A;  3KEY A;  3FBI B;  4C2U A;  4CZC A;  3VYR B;  2LRD A;  3J7A Y;  1X1C A;  3RCO A;  3V42 A;  3NWT A;  3IUO A;  2VQH A;  4BDY A;  2WY7 Q;  4E7I A;  3CP8 A;  4PFP A;  3K6G A;  4XON A;  1D0Y A;  4B48 A;  4II2 A;  2HZD A;  3DPT A;  3E1S A;  2AQF A;  4NUB A;  2LY2 A;  3K4M A;  2WB1 A;  3OYG A;  3VYT B;  3OR1 C;  4Y4R A;  4XR6 A;  4BEH B;  1BR4 A;  2X1C A;  3OYE A;  4HPQ A;  2NOJ B;  2KMU A;  2R4G A;  2DOA A;  3TMO A;  3OYB A;  3FKJ A;  2IS2 A;  1FMV A;  3CJR B;  2PMZ A;  4YEL A;  4BJ5 C;  4BE0 A;  2HVR A;  2F4I A;  3OS1 A;  2VXZ A;  3EPZ A;  4XLF A;  3C2G A;  3ZXS A;  4BQN A;  1K6Y A;  5FRM A;  2W7N A;  3H0D A;  3OL3 A;  2IS1 A;  2L9S A;  5CKT A;  2LOO A;  2IS6 A;  4FAS D;  2JVH A;  1X19 A;  2MC4 A;  1FMW A;  3TL4 X;  2ZXI A;  3EUK L;  2BVL A;  3OYH A;  2K9L A;  4PJJ A;  3K4C A;  2VQC A;  3E0J B;  3AL0 B;  4BQQ A;  2XC7 A;  2IGN A;  3QYB A;  2LYC A;  1YE9 A;  1OR7 C;  3LSG A;  2MAB A;  3LL7 A;  3ZCO A;  3AL0 C;  4LIT A;  4N4O B;  3N05 A;  3W2V A;  4HNT A;  4F93 B;  2GOM A;  4QPO A;  3OYF A;  2V4J C;  4OAZ A;  4KJZ A;  4AVZ A;  4KT6 A;  4BJ6 C;  4ZDL A;  3K4B A;  3IP4 B;  2WY8 Q;  1D1B A;  2E5N A;  3DU5 A;  1MNE A;  4PSW A;  1DQU A;  2JVG A;  2L5Q A;  2AQE A;  4ZTF A;  4XLH A;  2HVQ A;  4DBQ A;  4F92 B;  2VLA A;  3H9Q A;  2W00 A;  3OYD A;  2XF5 A;  4PFO A;  4BJT A;  2R7Q A;  2IGM A;  3DLA A;  4IQ4 A;  1V5G A;  2ZSH B;  3VSK A;  3VDX A;  3HPG A;  3PNT A;  3VYS B;  4B3X A;  2E5Z A;  4XN3 A;  3OY9 A;  2IS4 A;  1MMG A;  4CA0 A;  4U87 A;  2DXI A;  2VPL A;  2ZFU A;  5TGT A;  4R79 A;  1WJE A;  1G59 A;  4ZDO A;  4DOZ A;  3VYU B;  1MMN A;  4CH7 A;  1WJA A;  3M8J A;  4J01 A;  3DTE A;  1Z3X A;  2M7B A;  2Q1Z B;  4JOM A;  4CCM A;  4C2T A;  1D0X A;  2WA0 A;  4AYB A;  1QHH D;  1N77 A;  2DT6 A;  3CP2 A;  1DP3 A;  2DT7 B;  3CZ6 A;  2LH9 A;  3PFY A;  1W36 C;  2FUG 2;  2M0M A;  4BXF A;  4GRI A;  3K10 A;  1WJ5 A;  2XDV A;  4F55 A;  4PK4 A;  4ZJZ A;  2VJI A;  3W3C A;  4DIQ A;  2A5W A;  5KCM A;  5HVQ C;  4IZZ A;  2VB6 A;  4U7B A;  3BCB A;  4X0G A;  4KIS A;  4XKC A;  3D5R C;  2XAU A;  3OYA A;  1DGW Y;  1KON A;  2E1M C;  2QKL B;  4E7S A;  2X6X A;  4XN0 A;  4PJM A;  1MW7 A;  3DPL C;  2HDW A;  4Y33 A;  2JSP A;  2X6Y A;  4E7K A;  5CPR B;  5CQE A;  4ZYA A;  2L9N A;  4F52 A;  2CFO A;  3LMM A;  3L2W A;  4ANJ A;  2KRC A;  2R7R A;  4ZDP A;  2M4G A;  3MKW B;  2IXS A;  3ZQQ A;  3OL4 A;  3DKY A;  2Z2S B;  4QPQ A;  3DKX A;  3DPU A;  2UWM A;  3FHN A;  4PSX A;  4LG3 A;  1LDK B;  2UV1 A;  4OWR B;  3D5S C;  2CH0 A;  4XLE A;  2KDO A;  3HC7 A;  3LSK A;  3OMY A;  1T95 A;  2VIX A;  4F91 B;  4IX7 A;  4ITV A;  2VXD A;  2GOX B;  3AKZ A;  1UEL B;  3K4J A;  2WAQ A;  1VZ0 A;  2IGO A;  2KHM A;  2VQL A;  1LVK A;  3H5R A;  4XOP A;  1UG0 A;  4PJL A;  2CMP A;  3OIQ A;  3W2W A;  5HNF A;  1X1A A;  4HRI A;  3MD2 A;  2A6T A;  3S93 A;  1X1D A;  3HG9 A;  2QKM B;  1DGR M;  2WBM A;  2ZSI B;  3OWT A;  1QHG A;  3H5N A;  1PJR A;  2Y0S A;  5HNH A;  1IRX A;  4XKW A;  3HL2 A;  1MMA A;  4IQJ A;  2M7A A;  4BS9 A;  5KHD A;  1Z7L A;  4BQO A;  2P0W A;  1YX5 A;  2KLO A;  3K4L A;  3FDY A;  4G6T B;  2BVM A;  3H9G A;  3LFU A;  1D1C A;  3K70 D;  1U0J A;  3L2Q A;  4E7H A;  3ZRG A;  2V9K A;  2DCE A;  1YX3 A;  2HNH A;  3RQ4 A;  3K70 C;  3ZR8 X;  4JQF A;  1Z21 A;  3I3L A;  3CF2 A;  2X1D A;  1WJF A;  2MYS A;  4HST A;  4LIV A;  3DTK A;  4NC8 A;  2X1E A;  1G8X A;  4BDZ A;  2CS3 A;  4AU7 A;  2ELJ A;  4CCL A;  4II3 A;  4CCJ A;  4LIU A;  3OYN A;  2CV0 A;  3L2R A;  2HVS A;  3SEZ A;  1R6R A;  2LY1 A;  4Y3O A;  2RNG A;  2VJJ A;  3RTR A;  3UNG C;  2JUG A;  4HG2 A;  3C2H A;  3SZG A;  2L7K A;  1V5F A;  4NNJ A;  4RMN A;  3OS0 A;  2Z1D A;  2CV1 A;  1X4P A;  3DTI A;  2R7W A;  2W1O A;  4F3Q A;  3S3O A;  4B47 A;  2KP6 A;  2Q2E B;  4C30 A;  5LD2 C;  3BCA A;  4EAT A;  1GLN A;  4XKB A;  3OYJ A;  2HQA A;  3HKZ A;  4H4K C;  2CW8 A;  3QOE A;  2V6E A;  3QYE A;  4PJN A;  3OR2 C;  3DU6 A;  4BU2 A;  3S32 A;  1NG7 A;  2V7F A;  4XQF A;  4YEJ A;  4BE2 A;  4PUS A;  3LSH A;  4NC7 A;  3BLY A;  1TZL A;  2VKD A;  3BG7 A;  4E7J A;  3U21 A;  1OLT A;  4ZC3 A;  5FRN A;  2DJI A;  1HA8 A;  5LFA A;  4P5O A;  2V26 A;  2X6W A;  2OC6 A;  4XOR A;  4DJA A;  3DWL E;  3H9J A;  4XLA A;  1LFP A;  2M3A A;  2RRE A;  2RQQ A;  3UR3 C;  3EUA A;  2O5R A;  1JI8 A;  3SEQ A;  2PJR A;  2Z16 A;  4FET A;  3HOT A;  3NWS A;  2XF6 A;  3CJQ B;  1MND A;  1V5E A;  2LRE A;  2F6C A;  3OS2 A;  4XNF A;  4E7L A;  2LBF A;  2XF7 A;  3HXL A;  3LSM A;  3CES A;  2M4K A;  2VJ4 A;  1PYV A;  2HPM A;  2R7S A;  4CUG A;  3A2K A;  2MD0 A;  2X85 A;  3PUB A;  3L2V A;  3MMY B;  3KX2 A;  3OYC A;  4XL9 A;  4B43 A;  2R7V A;  3IAS 2;  3K4K A;  4BGD A;  2LC2 A;  1WJB A;  4RM2 A;  3MKY B;  4D1Q A;  2PJR B;  4BL0 B;  2XSJ C;  2VL8 A;  4D9J A;  1EA3 A;  4XM3 A;  2VJ5 A;  2KZV A;  4KIT B;  5HLT A;  1T0F C;  3A1Y A;  5HOO A;  1BR1 A;  2K9M A;  3L2U A;  4XKV A;  2L2O A;  2KRH A;  2LBF B;  4CCK A;  1UAA A;  3HPH A;  4J00 A;  3CMM A;  3PL8 A;  2CUZ A;  3S3M A;  1D0Z A;  3I9V 2;  2R7X A;  1MMD A;  4BUP A;  2I8D A;  3SDB A;  3BG6 A;  3RPU D;  1QU3 A;  3F9K A;  3VSL A;  1Z3Y A;  2ZXH A;  2OUM A;  1AA7 A;  3OYK A;  4P1W A;  4XMY A;  1N75 A;  2LG4 A;  4DBR A;  4HNU A;  3ONQ A;  3OYM A;  4CCO A;  3BC8 A;  3PJR A;  3VWB A;  2IGK A;  2V1N A;  3DEE A;  3OIP A;  4MLO A;  3K4N A;  1SFK A;  1TT0 A;  3W2A A;  2CUJ A;  3IAM 2;  3KYL A;  4XLC A;  1X1B A;  3HOS A;  4E4H A;  4CCN A;  2X51 A;  2R7U A;  2JA2 A;  3QOD A;  1J09 A;  3OYL A;  1WJD A;  4ZTJ A;  3EUH C;  4HSR A;  3M1C A;  4OAY A;  3ZGK A;  2R7T A;  1ZEL A;  1N78 A;  5CQG A;  4YRV A;  2E60 A;  3QYF A;  2BW3 A;  3A4C A;  3G2B A;  3OOU A;  2CV2 A;  3GBG A;  1WJC A;  4BE1 A;  4BAC A;  1WFX A;  1E0E A;  2W4S A;  3AFH A;  3OYI A;  2R7O A;  4E6K G;  2BOL A;  3D5L A;  3PNV A;  3DQV C;  2W82 A;  1BOB A;  4CSW A;  4IKF A;  1LKX A;  2OV7 A;  1SAU A;  4NQW B;  2CW7 A;  1P9Q C;  2VQG A;  2WAE A;  3PNY A;  2WAD A;  1D1A A;  1Y56 A;  2K3P A;  2BW3 B;  3PSI A;  5JHF A;  3H5A A;  3FBN B;  2VAS A;  2UUZ A;  5FRO A;  1Y6I A;  4RLF A;  4XOT A;  1W36 D;  4E7Z A;  3HUG B;  2HPI A;  3S8P A;  4C9Y A;  4DGW B;  4RLQ A;  2F5V A;  3S3N A;  1X4O A;  4RM3 A;  4N4N B;  3MKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...