3D5SC

Crystal structure of efb-c (r131a) / c3d complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
65
structure length
65
Chain Sequence
TDATIKKEQKLIQAQNLVREFEKTHTVSAHAKAQKAVNLVSFEYKVKKMVLQERIDNVLKQGLVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electrostatic contributions drive the interaction between Staphylococcus aureus protein Efb-C and its complement target C3d.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/toxin
molecule keywords Complement C3
total genus 27
structure length 65
sequence length 65
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF12199 efb-c Extracellular fibrinogen binding protein C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1270 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3d5sC00
2GOMA 2WY7Q 2JVGA 2JVHA 3D5RC 3D5SC 2NOJB 2GOXB 2WY8Q
chains in the Genus database with same CATH superfamily
3CMAI 3WGHA 3PQJA 1ZARA 1YIOA 3OOPA 2V6CA 1K78B 1VQ8I 2WAFA 3SXYA 1TW2A 3HRUA 1HBXG 1FOWA 2XGEA 1A6IA 1P4AA 2L7FP 2NVXJ 5DM6F 2HPIA 1K78A 2YX7A 2MSYA 3M4OJ 2L0KA 4LIUA 1T0FC 1WJAA 1K6YA 2OF7A 3S93A 1LVKA 3TDUC 2H27A 2BY0A 4M6YA 5EGOB 5EGOA 2CJJA 3J81K 4BY7J 4KISA 5HS7A 4NQWB 3B6AA 2MBFA 4I02A 5FLXK 2Z16A 3TW7A 2MYSA 2O9LA 2E7WA 1S72I 3GVAA 3Q0WA 4A3MJ 2XKPA 1XS9A 2JVGA 5F1RA 1UJ8A 2K85A 1FC3A 2ZFWA 2R5ZA 3FXLA 3A0HC 4IEJA 3QRFF 1WJEA 1DU6A 2KPMA 3IAM2 3GTQJ 1MIJA 4NC8A 4OAZA 4MTDA 3CCVI 3QAHA 5F04A 1IRFA 1I6HJ 1P4WA 1MD0A 3KPHA 2M8GX 2XSDC 2Y9ZA 3U21A 1S8NA 1OYIA 2KIUA 4M3BA 3OMYA 1U5TB 3OYMA 1HXDA 1LQ1A 3BJOA 1HW2A 4AIHA 2WV0A 2A5YB 2KJBA 1VQLI 5E1XA 2Z1DA 3ISPA 5DD8A 3S1NJ 1FT9A 4XBFA 1JTYA 3DEEA 4AUXA 2DMTA 3RQIA 1IJWC 5FRMA 1ETYA 1E3HA 2JRMA 2K9NA 2CUZA 1S9HA 4E4HA 2K9SA 2B7EA 2FX0A 1MBKA 5CKTA 2COMA 4NC7A 4BACA 2K3FA 5HNHA 5M3MJ 2CUFA 2E5ZA 2VBWA 1BOAA 3HHGA 2XF7A 2JA5J 3P5JA 3V42A 4EJOA 2VQCA 3F8CA 1MSEC 2VE8A 1N78A 3WU0A 5GTHC 3F0CA 1QPMA 1WSUA 2OTLI 1ETWA 1NHAA 3CJRB 3IH3A 1Z91A 2CWEA 3F21A 5LD2C 3H3UA 3BROA 5IP9J 1ZR2A 3FK7A 2UUZA 3CUQA 3I54A 4HEA2 1ZGJA 5DCMB 5IP6A 3V8LA 4KN4X 1SD6A 1IXRC 1H9GA 3GTMJ 4HLYA 2GXAA 2K27A 1OR7C 4XKWA 2XAQA 3CLOA 2DOEA 1HSTA 5IYBJ 4FETA 2LKSA 1WCMJ 2M5WA 2JA6J 2M87A 3FM3A 2P4WA 3PNYA 1RNLA 4LLNA 3F8BA 2QGUA 5J1RA 3FXRA 2DI3A 4A3CJ 1HQCA 2EIJH 1OYYA 3LSTA 4YIIA 5FFZA 4W97A 2EV0A 2HQNA 1QVTA 1R23A 1Q1HA 2FMYA 2R7FA 1VZ0A 4KIGA 1NG6A 4L5JA 1DP3A 2R7OA 3ZP5A 5FKLA 1V5FA 1S6LA 4IO9F 4D9JA 4UHTA 1MDMB 3R0AA 1X19A 3CD6I 4PJLA 4J19A 3OYLA 2GA1A 1N77A 1X2NA 4HQMA 1TQMA 5A2QZ 1USTA 1GV5A 2ELKA 2WWYA 1TQPA 3K70C 3CCJI 1QO0D 2IA0A 2VT3A 4GGGA 1J7KA 1Y39A 2O6GE 1MMSA 3CESA 4HA8A 3RIRA 1ZLKA 4HAMA 1YO5C 1D0ZA 1JKPC 2DJIA 2CV0A 3K2ZA 2GXGA 5GTIC 2W57A 4E7HA 3WHCA 1ULYA 2KKOA 1V55H 2DU9A 3BDDA 1MNMC 4HZFA 4RAYA 2HNHA 2LD5A 5LEJA 2F2EA 1T2KA 1KU2A 2P5LC 1GHCA 3OSFA 2XPWA 2D5VA 2V9VA 2ZXHA 4PJ0C 3ASOH 3Q5FA 3IH4A 2PX9A 3DP7A 3E7LA 5JLWA 4RB3C 1J0RA 2K9LA 5C3EJ 3MVPA 5M5XJ 3BP8A 2GA2A 3E5QA 3PQKA 5IT9Z 1CF7B 1FYLA 3M8FA 4RAZA 4PJMA 4OIRF 3A03A 1X1AA 2HXOA 1YW8A 3C2HA 3ZPLA 3QQAA 1R9TJ 2E1OA 3BZCA 2PMZA 2E1NA 2QVOA 3UR3C 3FMQA 3CF5F 3ZMTA 3E3VA 2XB5A 2KZGA 1HA8A 2IXSA 4C9YA 2GQQA 4KITB 2F5VA 2CMPA 3GLLA 1QGPA 3TW6A 3C3WA 5BS6A 5BPDA 5FD5A 4R79A 3SDGA 3L1PA 1R5ID 3RZDJ 3W6VA 2DO7A 2OQGA 1BIBA 2VL8A 2HZDA 2RVCA 4BY1J 3TO7A 4P96A 5HLTA 2WC2A 1B72B 1FBUA 2R4GA 3FXJA 4I99C 4BAYA 2DA7A 5F27A 3DF8A 4OMZA 4HNTA 1KYWA 2DMUA 1F36A 3I59B 1EA3A 3JSPA 2EBIA 2X0LA 3PO2J 4RB0A 3CMEI 4E6KG 4LK0F 3OYIA 2G0EA 2A6TA 4EGYA 5E79C 2KZVA 3BTJA 4I0AA 3D5SC 4PGGA 5IP7J 1B59A 3QYFA 3ZOBA 4JX6A 3I53A 1BN5A 3WTZA 4BJ5C 4U87A 2R7RA 2GWRA 3M1EA 2HQ5A 3DTIA 4I01A 1UAAA 2DQLA 2OCCH 4JK1X 1DPRA 2VOOA 2MW8A 1E0EA 5AONA 2J5PA 4MLOA 4LB6B 2FBKA 4BYYA 1FMWA 3KZZA 1IXSB 3NQOA 3QPHA 1WQ2A 5HVQC 2P5KA 2Z5UA 4U0VA 2WAEA 5ED4A 3FHNA 3CQZJ 3WG9A 2F48A 4IVNA 3LSIA 4BHBA 1S3JA 4U0WA 2XROA 1V3FA 3W3CA 1G3TA 1LKXA 2HR3A 2HTJA 1VQ9I 2Z99A 3ERED 4RM2A 2EINH 3KFWX 2ME6A 4UB8C 1XGSA 4L18B 5HDKA 1J9IA 2V1NA 3FKJA 1UELB 1ZAOA 3HZJA 3LOCA 2FRHA 4HV5A 2R7TA 3CCQI 2NVQJ 2L3DA 2M0MA 3K1NA 2ZCWA 2JSCA 1R5GA 3OR2C 1YJ9I 5FKOA 4WX9A 5ICCA 1ZN2A 2K40A 3FHZA 3DBRB 1YQAA 2BZTA 4M3GA 3UNGC 2Y30A 1X3ZB 4N9HA 4BQAA 3GO5A 2LBFB 5D8KB 1HCRA 3BTLA 4ZTFA 3BLYA 4N0BA 4O3MA 4JBAA 4EJVA 2V26A 1MBGA 2XSJC 3O8HA 2GIVA 3VB2A 2D1VA 1WRJA 1Y6IA 2NS7A 2F5FA 4IL6C 1DGRM 3BPVA 2L9RA 5KVRA 4FASD 4G7OF 1D8KA 2Z3YA 2DA4A 4M73A 4WXDA 5LEKA 2FNAA 2RKHA 5GAHJ 4HF1A 1JGSA 2YSRA 4CZZA 4LLGF 1FWZA 2XAJA 3L7WA 3QP6A 1QU3A 1X4OA 2VT2A 3F6OA 4P55A 2MH9A 2IGMA 4NNJA 2Q0OA 2K9QA 4MEYF 3OWTA 2EK5A 1Z67A 2JSPA 2LRDA 2BXZA 2X1CA 3A02A 4TV7A 4ANJA 5EEAA 2H6CA 3HDDA 5H2FC 4CCOA 2VJIA 3JAMK 2EFNA 4XN3A 3H0GJ 3L2UA 2XAUA 4LG0A 2HOSA 5EG0A 2AO9A 2BEOA 3TEDA 4KNYA 1V5EA 4XM3A 2WA0A 1TT5B 2L02A 2LNBA 1R00A 2V9KA 3W6KB 4A0YA 1FTTA 1TWCJ 4B43A 4XOPA 2QSHX 2LY1A 2IW5A 2Y9YA 4RLFA 4YFNF 1D5YA 3JSOA 2XRNA 4RMNA 4OMYA 1FP1D 1XGOA 1WI3A 2L9VA 1D3YA 1U0JA 3OYNA 3FKIJ 3CP2A 1BIAA 3ECHA 3ONQA 1LFPA 1R1VA 4BS9A 4F52A 1U78A 3MEXA 2NNYA 3GZ5A 1IN7A 1TZLA 4EVIA 4UUSA 1AKHA 2A69F 3C1DA 2E2HJ 4J00A 4MFEA 4OOIA 3ZQHA 2M1BA 5LGTA 1Z3YA 2BE5F 2CW7A 3L2VA 4V2FA 4G9YA 3ZN0A 2NXNB 4C3JJ 3HEFA 1MJBA 5K5RA 3N4MA 1HW5A 4RGUA 2BOLA 2CUJA 4ZYAA 4EM0B 4Q47A 4PFOA 4GO1A 3W6JB 4A6EA 4MIMA 1JUMA 2QUFA 4XKVA 3MZYA 5CVRA 3OYCA 2CV1A 4XK4A 2HWVA 4D0PA 4YFXF 3GTKJ 2PN6A 2ELJA 2VXZA 4PJNA 3DFGA 2O8XA 3WU2C 3RI4A 4B8XA 1BR1A 2PMUA 4UVCA 5DS9A 1ZK8A 3K4CA 4FISA 2DFFA 3T0YA 3TQNA 3DWLE 2JT1A 3HTUA 2ZMEA 2VKDA 2STWA 3MKLA 2DT6A 3OS2A 2R7VA 2UXXA 1XDSA 3DPLC 2DW4A 3H9JA 4KIFA 1MMAA 4D1QA 3CF2A 3W2WA 5J47A 2F5DA 3MD2A 4I98B 4CSWA 5HODA 3ZQLA 5HOOA 1MJ9A 2MFZA 2BY1A 3ZMDA 1X1BA 2I5UA 4XORA 5J40A 2JMWA 1USSA 1G4DA 2V4JC 3MKYB 3AAFA 5L3BA 2VIXA 3K7AJ 2H1LA 4ZYDA 1OCRH 2VBYA 2CV2A 1B4AA 1YX5A 2LLKA 1QZEA 2XGDA 1T98A 3QYBA 3GZ6A 2OV7A 1ZKGA 2F5EA 3PIPF 3FMRA 5KAFC 4G7HF 4B4CA 4ENKA 1ETVA 2LY2A 4XRSA 3H5NA 4S05A 1XGMA 1U8RA 1IUYA 2Y2ZA 3CCMI 2BVMA 3HJEA 3HUGB 1Y0UA 2DA6A 3L2WA 3VPRA 1ZH5A 3CDIA 2DA3A 2Z2SB 3H9QA 4GYIA 4NHJA 2LY9A 5BOXA 3ULQB 2I10A 2LC2A 2K9MA 4YFKF 4F92B 2DA1A 4MQ9F 1ZG5A 4A0XA 3GLXA 4CDGA 1ZR4A 2L2OA 2VC1A 5FD6A 2NOGA 4L0ZB 1Y0NA 4QIWN 4XLAA 2GZWA 3KEQA 1XPXA 3S14J 2R7UA 2CQXA 1YLFA 3I3LA 3PUBA 4UUVA 1U5TC 4B09A 1R71A 2DMNA 2YU9J 4XRFA 1TT0A 1WZ2A 2QA4I 2DPUA 3PNTA 2ZNYA 5D5VB 4AC0A 4AWXB 4UY8I 1CF7A 3EUAA 3RYRA 2KJCA 3I55I 2OZUA 1ETQA 2UXNA 3W2AA 3FXKA 1IDZA 2M2EA 4KYWA 4E7KA 2ESHA 3CDHA 1HDPA 2QYOA 5FLXZ 1KQ0A 2JWTA 5DM7F 1PJRA 3AG4H 1R1UA 2VQLA 4H4KC 4B44A 4CCLA 3GFMA 5E1WA 3COAC 2BY3A 3HKZA 2PBIA 1B8IA 3BR5A 3GTLJ 5GAEJ 1F43A 3WHBA 3ABKH 2OU2A 2KL4A 2ZMEB 3D1NI 3WE3A 5FROA 4CICA 3DU5A 3S3MA 5IPAA 3CJQB 2VOPA 2DT5A 4IHVA 1WVRA 2R92J 3GEZA 3E6MA 4ON0A 1I39A 2HDWA 2M4GA 3IAS2 1O3RA 3HSEA 2QKMB 2O3FA 2X1DA 4BQQA 2H94A 2KRHA 3I64A 4A2UA 3OYEA 4DQ2A 2IPQX 1RKWA 3H36A 3CCRI 5D6FA 4IHSA 1QZYA 3IC7A 3H3VK 1FX7A 1OCZH 3RDIA 3M7GA 3HKZN 1J59A 4Y17A 1DU0A 3CO6C 4C3IJ 2VJ4A 3GTPJ 1WJCA 9ANTA 1BA5A 4C2TA 3F9KA 3BC8A 1E3OC 4UV9A 4CCJA 5HS9A 1YS6A 1ZQ3P 1ITYA 2M34A 5IT9K 3BR1A 3GFLA 3DXJF 1EH7A 2CU7A 3H5RA 3I59A 4KUMA 4A93J 2PJRB 1SFUA 1LVAA 2W85A 2NOJB 1RUNA 1JHFA 3LNQA 5J1YA 1LFUP 2HZTA 1KQ8A 1SAUA 4V2GA 2EZLA 3CUQB 4XLHA 4CA0A 2F4IA 4ABZA 1I5ZA 4MNUA 4OIQF 1TL8A 2LMDA 2YS9A 2NNNA 2VBZA 4NDLA 2M0CA 1R4MB 2BW3A 2HVQA 3LFKA 4D5CA 2CSOA 2PLYA 3SZPA 2W1OA 3L09A 2QF7A 3FIWA 1V5GA 1W7PB 3J7ZI 4XNFA 2F6CA 3M07A 2FOWA 1RR7A 2EIMH 4JYKA 3BG5A 5DDGA 4II3A 2WB1A 2M8EA 4I6ZA 4L9NA 4NC6A 4CHUA 5C4JJ 1A31A 4CYCA 1T08B 2M7AA 1BJAA 5TGTA 5HDNA 4Z6YA 4OU0A 4A3EJ 2VI6A 3GTGJ 2CH0A 5H20A 2ZJPF 2CQNA 4Y4RA 3GTOJ 3VEPA 4XLCA 3K4NA 3ZMSA 4MFDA 3DEWA 4DYQA 5A2QK 4BBSJ 3O3KA 3H35A 3GBGA 3LAJA 1W0TA 3ZQGA 3RKWA 3ABUA 3B6CA 3R60A 2TCTA 5LRSA 2ZJQF 3G2BA 5TISC 3RCOA 3HL2A 1Q1VA 2O61A 2AQFA 2VUMJ 1KQ9A 4PSWA 3TO6A 5J8CA 4RGSA 4L9JA 2DPDA 4BEHB 3W2VA 1WFXA 2LBFA 3C2BA 3H0DA 3S17J 5FJ8J 1OCCH 2XF5A 3E0JB 4YIRX 4LFUA 1K83J 2ISZA 2DYSH 3J80K 2JA8J 1OKRA 4NQWA 1MDMA 3V7SA 3BCAA 2O5RA 3KP4A 3M8JA 2LP0A 3SYTA 4KIBA 3GF2A 4YELA 3RYPA 4UB6C 4B47A 4PJJA 4RA2A 4DJAA 2DN0A 5AIPA 3VSLA 3TOBA 2XAGA 4OINF 1T38A 2IT0A 2OJED 1P9QC 3QOEA 3G71I 3WTXC 4IOAF 5DCFA 4R1HA 4ENNA 2HXIA 4AVPA 4FX0A 2A3SA 4A3IJ 3NWTA 1BI2A 1RETA 2JUGA 5KCMA 3LQQA 3GTJJ 2ZSIB 3KCCA 2OA4A 2E2JJ 4ZTJA 2FXAA 2LVSA 3ASNH 2ZB9A 4EGZA 1UHWA 2ACJA 4Y3OA 1N75A 3C7JA 1UB9A 4FE7A 4BJTA 3EUKL 3WODF 2QENA 3JRIA 3OYHA 3PNVA 2LH9A 2RC4A 3S3NA 2GIZA 4DYCA 2WB1N 3RQ4A 3JTGA 1YTYA 1HKQA 5F0HA 3OYKA 2I8DA 3TMOA 1AA7A 2L54A 1W7PA 4DBQA 1EJ9A 2E7XA 2VXDA 3F8NA 4A3FJ 3K9TA 2DK5A 2M45A 1V54H 5D4RA 2MG4A 1ODDA 2P8TA 2XIGA 4D7MA 1HDDC 4IRIA 4MO7A 2ID6A 3IHUA 2ZXJA 4LK1F 1FJLA 5AIQA 4F3QA 2HOEA 1IN5A 1R22A 4O5VA 3KP5A 3OL4A 4XMYA 5B1AH 3M9AA 2EFPA 2K4BA 1W5TA 2NS0A 4HBLA 1MBEA 5IT3A 3DBHB 3Q3SA 3CZ6A 2CYYA 4HPQA 3OL3A 2QZ8A 4EM2A 2V1DA 2MLKA 4E7SA 2GBYA 1P92A 5KNLA 1X2MA 1B1BA 2A68F 4HW0A 2A6EF 4F55A 4XLFA 3O2PE 2DLLA 3OS1A 3B73A 1AOYA 4L9VA 3BJAA 2XGCA 3RJPA 3PO3J 2XHKA 3LWFA 5E3NA 1QHGA 3R4KA 3N97A 2LR8A 1IF1A 3IH2A 2Y48A 3V7CA 5EJCA 3J81Z 4G6TB 1MJAA 4UXNA 2O8KA 4FQGA 2P6SA 4M74A 1IN4A 2LSOA 3BR0A 4UVAA 1YRNA 5FRNA 3I4PA 1VFCA 1VQNI 4RLQA 1T56A 2HYJA 3GXOA 3WE2A 4IJAA 3C2GA 1JT0A 5EEHA 5D4SA 1SFOJ 1K79A 1PUEE 1QZZA 4X1EA 3VSKA 4B3AA 4M6VA 4E7IA 1O7LA 2RN7A 4IQJA 4II2A 4BQOA 1TNTA 4IHXA 2FD5A 3ZMUA 4LMYA 2K4JA 3DLAA 4JX4A 1UHMA 1O7FA 2EV5A 4A5MA 1Z0XA 2P0WA 1Y56A 4B3XA 5JLXA 2LREA 1B8IB 1U6GA 3K4LA 2NRAC 5E8GA 4A3BJ 2DA5A 3C18A 2NYXA 5D5WB 2QBYA 2JA2A 2G7HA 2GOXB 3E6CC 3ZQCA 1LEBA 2TRTA 3HGGA 3CO7C 2L4MA 4CCKA 2L7MP 2L5QA 3ABTA 4FT8A 3LA3A 2EZIA 4EEFG 3L9FA 1W5SA 2VN2A 4BEHA 3BTIA 1OMIA 4D7NA 2IS1A 2AXLA 5DTDA 4H0EA 2FA5A 4S04A 3I71A 3OS0A 1ORKA 2K5CA 1A04A 3CJTB 3GW2A 3HOUJ 4RB1A 3SZGA 5EDNA 3WTUC 1GT0C 2Y31A 2OUMA 2P7VB 1YITI 3FBNB 4ZYGA 4CZCA 2VONA 1S29A 1HOMA 1YIJI 4HNUA 3A4CA 1ZG3A 1XB4A 1NTCA 3BR2A 4W1UA 4CYCB 3ZN1A 1Z3XA 1Z9CA 1M1EB 3G3ZA 5DCMA 5F0FA 2E71A 3PSFA 2KIMA 2LKPA 3O8GA 1B9MA 2CFOA 2ECBA 1MSFC 2B63J 3VODA 3QPSA 1W36D 2EPFA 5M3FJ 3BJ6A 3REOA 1WWXA 1YX3A 3KEOA 1BBYA 3L00A 1SC7A 1APLC 3I4NJ 1LB2A 1LDJA 1ZREA 3CCLI 2P5VA 1U3EM 2Y0SA 1XMXA 1XN7A 5DEQA 1IN6A 3SEQA 2Z33A 2PFBA 3RPQA 3BCBA 3F6VA 3HOWJ 1IAWA 5E3MA 1R36A 3G73A 4V19K 2RNGA 2L7ZA 2QCOA 3QYEA 1WHUA 2FQ3A 3NWSA 3OV8A 3U9GA 2ZJRF 4BE1A 4KDPA 2QQBA 3HOVJ 2HYGD 1R5HA 2Y0SN 3AL0C 3K4KA 3HOXJ 2EZHA 2HI3A 1ACIA 1C0WA 4BHPA 3MWMA 2F4MB 3AG1H 3EYYA 5H6RA 2A6HF 5LBQA 1KGSA 2P7CB 3G6EI 5CVUA 2ME0A 2QQ8A 3O6BB 2MLGA 4WXHA 3K4MA 2B0LA 5GPAA 1FOKA 1UCRA 4DW6A 4DBRA 1T33A 2DK8A 4CCNA 2CUEA 2KISA 1IZ1A 2EFWA 5B5EC 3PM1A 2IRFG 4G6DA 1IO2A 2R7QA 5E3LA 3OYFA 1U5TA 1SEUA 1JGGA 1GDTA 2X51A 3WGIA 1UG0A 2DXIA 4L0YB 2R7SA 3H9GA 3KP2A 5FO5A 5CQEA 4BDZA 3K1PA 2JTVA 1E3PA 2L9NA 3DTKA 3KX2A 3EPZA 4M9SA 1B9NA 3OOUA 4QSHA 2ECCA 2DJNA 1OFCX 4DIQA 3BTCA 4BQNA 3JRGA 1A5JA 2EFOA 1R4NB 4IHWA 1G6NA 2W4SA 2MH2A 4P9FA 1FNNA 2OAZA 4I7HA 3OSGA 1QBJA 1YG2A 2EH3A 5KK1A 2H8RA 3E5UA 1SD4A 3OIQA 1A6QA 5EZGA 2EZKA 1ONVA 4X0GA 4JP0A 4P1WA 3OYDA 3WTTC 2UZKA 4KT5C 3MAJA 3KIOA 4ASNA 2CS3A 1VNDA 4XLPF 2O0YA 4DNCA 2PI0A 2Q2EA 3T8RA 5K7FA 1ZGWA 1WJBA 5DV5A 3BG9A 2P81A 3EUHC 4BXFA 4Q4ZF 2VC0A 4XN0A 1XCVA 3WG7H 2KDOA 2WADA 4F91B 4CUGA 2KFDA 1XG1A 2PQ8A 3ZMVA 1MW7A 3S2WA 2TDXA 1AHDP 4AIKA 2JQ7A 2NVTJ 2R93J 1TC3C 4AIJA 4UUTA 4DZPA 5F64A 4FX4A 5CVIA 1B72A 5FLMJ 5IOYA 3RZOJ 2ZFUA 4N4OB 3SDBA 5H6QA 3H1CA 4Q48A 4JX5A 5EG0B 1R6RA 3VDXA 4U7BA 1TTYA 3HOZJ 2QQ9A 4NB5A 5ICGA 2JZYA 3V7RA 5FGMA 3F3XA 1CGPA 5FKKA 4B1RA 1K6OA 2VQHA 2IA2A 4Y13A 2W00A 1IRXA 1K7AA 2XF6A 4ZDPA 2R3SA 3BQYA 3R61A 3LSPA 5ICEA 2RGVA 1R58A 3L2CA 4ZYHA 4IHYA 1T8IA 1YW7A 1BC8C 2R7WA 3ML6A 1G3WA 2JJ7A 4GCVA 1I3QJ 2X9DA 4U88A 3F22A 3E5XA 1WJDA 2XVCA 2QEXI 1HKSA 3HSRA 1FOXA 4S0HB 2Q2EB 1YYVA 2E36A 3EYIA 4PSXA 4ENMA 3EDPA 3BR6A 5J6XA 5CYVA 2EA4A 1YJNI 1DPUA 3P9CA 4HDUA 4XQFA 1Z6RA 5LFAA 1FY7A 2XRLA 5D8LB 2NVYJ 1T95A 1QPIA 2K02A 3IKTA 4HDVA 1I3AA 3KE2A 2FOKA 3QP5A 5C4XJ 3TGNA 3CLQA 3RKQA 1MMGA 2EJRA 3HM5A 2XAHA 2RQQA 4LB5A 4ESFA 3HTSB 2VPRA 4HG2A 4E7JA 1PVEA 3GWZA 2JRTA 3I4MJ 3JRFA 5D6EA 2WY8Q 1X1PA 5HNFA 2CGPA 4HRIA 5LGNA 2ADUA 2FUG2 2HFHA 2VKHA 3G1LA 3HPHA 2EB7A 2E1MB 1X58A 4HX4A 3VFZA 1OLTA 2L01A 2W24A 3BOQA 2UV1A 2IP2A 4Y15A 3FMSA 3H5AA 4XKCA 2K3PA 3OY9A 2E19A 1UHSA 1VQOI 3CP8A 1LPQA 4BNCA 5CVVA 4CGZA 5HS8A 4GYGA 2DBBA 3I58A 3ELKA 4LOCA 1BL0A 4G6QA 1ZLJA 1IV8A 2QLZA 2YR2A 1X1CA 1AKHB 4XRSG 3IWFA 3HPGA 3PIOF 3KP7A 1TWFJ 2RDPA 4LLLA 3S2HJ 3K1MA 2PEXA 1U9OA 5DUIA 4M71A 1Z77A 3LMMA 4ENJA 1BC7C 1QQIA 2AS5F 3A1YA 3LSRA 3HYIA 1P4XA 1DGWY 3FDYA 3X2QH 1GXPA 1T39A 1OCPA 1FTZA 2YU3A 5JI6A 2JVHA 4XRMA 2HVSA 3KETA 2Y75A 3V8KA 1EH8A 1WJFA 5ERIA 3ECOA 1TNSA 1JJ8C 2VODA 3NEUA 3DPUA 2MC3A 3OR1C 5CJ9A 3BZ6A 2KIQA 2ISYA 1SAXA 1DP7P 1ON1A 4M3EA 3TP3A 4EM1A 4HSTA 2W84A 5K7HA 1DDNA 3Q9SA 2IGKA 5EEGA 2OPTA 1W0UA 4RAFA 4I09A 4ZDLA 1FIAA 1RESA 4L9TA 3F8MA 2E1CA 4JOMA 4RBOA 1G2HA 3GCMA 4HNVA 5LHHA 1JKQC 1NK3P 1G8XA 3EQLF 4IF4A 4BE2A 2BVLA 3E6BA 2BBYA 5JFRA 1OQYA 1YW9A 1MZBA 4PZJA 3A01A 4PDKA 2BY2A 2BHYA 4B48A 1PP8F 3WU1B 1JKRC 4GFBA 1P6RA 3HOYJ 1BR2A 3ESWB 2EQRA 1S7EA 5GP9A 4KT6A 2J5OA 1VTNC 2LTPA 2V6EA 4LJZF 4AYBA 2IEKA 1D5VA 1TW3A 3FXUA 1TWGJ 2DQRA 1PUFA 1W7PD 5C44J 4KFCA 3S3OA 4M72A 4WXCA 3ZQFA 1PDNC 3DEUA 1EKEA 4BBRJ 1S5LC 1TP4A 1H0MA 4RAGA 2YPRA 3SHFA 5HLIA 4F93B 1TWHJ 2R5YA 3TL4X 2R7ZJ 1RC9A 3J7YJ 3RPUA 3CCUI 4EJWA 4KJZA 1J5YA 2MD0A 3CC4I 3FBIB 5DYMA 1JKOC 4GDFA 3DCFA 1ZRDA 1FSEA 1Z6TA 2BW3B 3HIFA 3K0LA 3ZQ7A 3DV8A 4I76A 1VQ6I 2CQKA 4HQEA 3VWBA 3MZHA 4XKBA 4HOBA 1JI8A 4RB2C 1CQTA 2IS2A 4FCYA 1Y8QB 4KMUX 2WY7Q 1LE8A 4LIVA 1J75A 4E7LA 4AIDA 1RI7A 4HX8A 4A3LJ 4A0ZA 2XAFA 3ZGKA 3G4SI 2ZMEC 3T5XA 1ZRCA 3ERMA 1U9NA 1H9TA 2Y0MA 2PJRA 4OAYA 5B1BH 2HDCA 4CH7A 3MN2A 1SVOA 1I6XA 3LL7A 2HDDA 2JPBA 5CPRB 1ZG1A 3ZQIA 1XC5A 2FJ1A 3D5RC 2HGCA 1MNDA 1YOVB 1Y1WJ 5TJJA 1KYZA 3Q9VA 3HC7A 4HYEA 2IJLA 2HQAA 1O3SA 3OIOA 2ZKZA 2JN6A 1UZCA 4Q5SF 1MH3A 3BR3A 4G7ZF 1R49A 3WTSC 3K70D 4BH9A 4UUSB 1OCTC 1MKMA 1TWAJ 3MCZA 1GV2A 4D5FA 1H8AC 2Q1ZB 2F4OB 3FX3A 3IL2A 4ESJA 4MTEA 5FKNA 2VQGA 1JHHA 2DODA 2ELHA 1S7OA 2H8WA 3KYCB 4M9ZA 3ZR8X 2F5CA 2ZC2A 1W36C 2CQQA 2GM4A 2AXTC 1GVJA 1IXCA 4Z2YA 2DAOA 1JUPA 1Z1DA 3LFUA 2EILH 2QQAA 2QBYB 2XASA 1IN8A 2R0QC 2H6BA 2XPUA 1F4KA 4BHCA 1LE8B 4M9XA 5E8IA 2KDZA 4HLXA 2YUSA 3LSGA 1XMAA 4RGXA 3S1MJ 1J2XA 3DPTA 3CJNA 5J4VA 1VQ7I 3JREA 4G8XA 1WH5A 4RM3A 5M5WJ 2K86A 2XUBA 4UV8A 3BT9A 2VPLA 3ZQQA 4OIOF 4XR6A 2L7KA 3KZYA 2R7XA 2WBMA 3R6SA 2DA2A 4E70A 3WTVC 1SFKA 4MGRA 2FBIA 3ROUA 1HW1A 3LA2A 4R8HA 1WPKA 2DT7B 2STTA 2FQ4A 2XGXA 2RNJA 2ZNZA 1JE8A 3K6GA 4IOCF 2CG4A 2XDVA 5KAIC 2LF8A 1SVMA 2ZBKA 1YI2I 2M7BA 1SFXA 3Q0UA 3FF5A 1YRNB 4G12A 1BI3A 4XSZF 2A5WA 1Z7LA 2D1HA 3FZVA 3HUGA 3DKXA 3GX4X 1XDUA 2HKXA 2DOFA 3M8EA 3A2KA 3IWZA 4DZJA 4LG3A 5J3LA 2XV4S 1XSDA 4P9UA 3KLOA 3HRTA 2MA3A 2RQPA 1X3WB 2WAQN 4CYDA 3SJMA 1G3SA 2NAZA 1BW6A 2IGNA 1QVUA 1N25A 4RGRA 5E17F 3QU6A 2R7DA 4P5OA 3L2RA 4A3KJ 1GUUA 1VQ4I 5CQGA 4HF2A 3M1CA 1SANA 2G9WA 2E34A 2WTEA 5IOZA 2EA2A 4FE4A 5E3OA 3VYTB 3NRVA 2Z9OA 2KMUA 4IX7A 2FE3A 4MQVA 1F5TA 1OISA 1U8BA 4RS8A 1XGNA 1QA6A 1ZELA 2MD5A 4YG2F 1VQPI 2X6WA 3BY6A 3VOEA 1R1TA 1D0XA 3AG3H 5ICFA 3MKZA 2BXYA 3K4BA 2XKOA 4ZC3A 4U7DA 2DTZA 4C2UA 3B02A 1STZA 2IAIA 5KHDA 2COBA 2EFQA 1DQUA 2A05A 2NS8A 1G3YA 3AFHA 2CO5A 4I2OA 1MBJA 4YIFA 1UMQA 4M3FA 4XLNF 1X3UA 4IXAA 2W7NA 2RAEA 3F72A 3ZRGA 5K7ZA 2A07F 2LYCA 1TBXA 2GAUA 2X6OA 1TLHB 2JPCA 1ZTRA 4F7ZA 4IRHA 3OYGA 1E17A 1SVLA 1ZRFA 1T0FA 2L4AA 4ESBA 5LGUA 2D2WA 2HYFA 3PSIA 5LHIA 2LK2A 3T8TA 3G1OA 1MH4A 1A36A 4XICA 1SFEA 2X6XA 2VASA 1QRYA 1KU7A 1BM9A 2HOAA 3N05A 2HS5A 3TP0A 1G59A 3EETA 4OIPF 5JVGF 3BWGA 3TOAA 2KQRA 3SZTA 1K61A 1VQMI 2KT0A 1EH6A 1YS7A 1Z7UA 1EF4A 4LITA 2V1XA 3U1KA 1WKMA 4QTRA 3JRHA 3DLLF 3HHHA 3CUOA 1EV7A 3JR9A 2KRCA 3BQZA 1ENHA 3DKWA 3PJRA 2NVUB 3KZIC 4IRGA 1L0OC 1YFHA 4KMFA 3V8JA 4HX7A 3HBLA 3H92A 1KZHA 5ILVA 3DQVC 3HXLA 2ZO4A 1DUXC 2CW8A 3MZ8A 1YJWI 4BU2A 2LG4A 1FZPB 3WTWC 3I0TA 4ITVA 5FLVA 3JRCA 3IRQA 2Y69H 2OTJI 1JTXA 3GUDA 3V4GA 1XX5A 2JUCA 1FBSA 1ZGAA 2IBDA 2LF7A 4IPAA 3S15J 1LFBA 4XL9A 2JK3A 2RV8A 4A12A 1O3TA 3DKYA 2N8GA 5F1JA 1IRZA 5B3SH 3CMYA 1B6AA 4G94A 3LSMA 3QPTA 1Z21A 1FIPA 2LOOA 1UG2A 3IUOA 3S1RJ 1XTAA 3LAPA 1TQIA 2XC7A 1VF9A 2AQEA 1H89C 4ZYEA 4DYRA 2M30A 4ZDOA 2BHZA 2WAQA 2E60A 2BYVE 4PUSA 4J01A 5E20A 2BGCA 2EV6A 1PUFB 1VQKI 3CC2I 5HDGA 3FWEA 5F0CA 3BG3A 4EQQA 3HOTA 4FTHA 5F6FA 3VYSB 1FMVA 1BR4A 2KRFA 1FSHA 1D8JA 1MNEA 2X4HA 2FSWA 2GOMA 5GAGJ 4GXOA 3QWLA 1F9NA 2CW0F 1ON2A 3I5UA 4CO8A 5HLGA 3IV5A 4GRIA 1IGNA 1D1BA 5DUKA 2DYRH 5CVJA 1W1WE 4BJ6C 4U0YA 3CCSI 1SD7A 3ABLH 2VB6A 4HV6A 3JAMZ 3H3ZA 2DOAA 3PFYA 3OIPA 2QM3A 2PJPA 4N4NB 3VYRB 4BKXA 4AVZA 3GZNB 5JHUA 1FYMA 3OYJA 5J8FA 1SMTA 1WH7A 2ICWG 3HRMA 1OCOH 2CQ7A 3IRRA 1XCBA 1FPQA 1QHHD 4HSRA 2DMQA 3RTRA 3T1BA 5LHGA 3KEYA 2DFEA 2DFHA 1BI1A 1WJ5A 1AWCA 2V9PA 4MHGA 4L5IA 5BNGA 4I0BA 5EF6A 4XLEA 1POGA 3CUQC 1Z05A 1LJ9A 3K69A 1HC8A 1K4SA 5EZHA 2EIKH 2G7UA 3LQRA 1WI9A 1MMDA 1XD7A 4DOZA 5LLQA 2PMHA 3RKYA 5JR3A 4PGHA 1JJ6C 5B66C 3QODA 5L3EA 2DDBA 1D1CA 2X48A 4QLCU 3S1QJ 4EJTA 2X1EA 4A3DJ 2HTSA 3MQ0A 1D1AA 1RR8C 2OD5A 4EJUA 3S2DJ 2QKLB 4LGWA 2DMPA 3RKXA 1PP7U 5L3CA 1UFMA 3LSHA 2HEOA 3E97A 3CCYA 3BZKA 4YRVA 5D5XB 4OWRB 3PL8A 4AD9A 2IS6A 1RPWA 2HQRA 2FBHA 4HF0A 3CC7I 3WTYC 3J7AO 4MEXF 3TDZC 1MBFA 5FKMA 4NBQA 3ABMH 2V7FA 5K5OA 5HLHA 1A35A 2ZJ2A 5K1YA 3I9V2 2M9HA 4BXXJ 2E1MC 2KLOA 2LFBA 1MGTA 3TBIA 1QNTA 1VI0A 1OR7A 2ETHA 3CDLA 3R0JA 5EYRA 3KP6A 1LUJB 2E35A 4LD5A 4C2MJ 5M5YJ 1D0YA 3Q0VA 5L3GA 4A3GJ 2M3AA 4EMSA 3E1SA 4ZZDA 5JVTA 1ZYRF 5BMZA 2DTRA 2RREA 1RKTA 2OQRA 4Y33A 2M4KA 3PUFA 4A5NA 3NAUA 1IDYA 1ETOA 3SEZA 2IVMA 1J09A 2MABA 4NUBA 2HPMA 4QPOA 3S8PA 2R5YB 3VYUB 1FEXA 3FK6A 3KLNA 3U1DA 2GXBA 3GFJA 2FMLA 2FEZA 3OYAA 3K10A 1RRJA 3EUHA 2L9SA 2ESNA 1K4TA 1O3QA 2W82A 4X6AJ 1L3LA 2ZSHB 1RZ4A 2VKVA 4ZJZA 3P9KA 3F23A 4C3HJ 1LDDA 5FFXA 1FBQA 2W25A 4PFPA 4A69C 4BXUA 3JW4A 4L5EA 4AYBN 1U2WA 1LEAA 1XSXA 1HF0A 3P9IA 3DU6A 3AL0B 3ZMZA 4AM3A 2X6YA 3OYBA 4WWCA 3HB9A 2ID3A 2C6YA 3SFZA 3RSNA 2V79A 4JQFA 3E6DA 1I1SA 2OBPA 2YX4A 4EATA 1ETXA 2VBXA 4KN7X 2HKOA 2VJ5A 3BG6A 5GADJ 3FXQA 2R5ZB 3A01B 1RUOA 2OZ6A 3L2QA 1ERDA 2V1UA 3CMMA 1YE9A 2PG4A 2PMZN 5ILUA 3HOSA 3SQNA 3QU3A 1P7IA 3FISA 2A61A 3ZCOA 5LRRA 5IYCJ 3UKGA 1I27A 1S7AA 4N9IA 4IHTA 2CFXA 5IY5H 1KU3A 2HOTA 3BPXA 3CTAA 4WF2A 2LKXA 2VLAA 1IC8A 3LA7A 4KICA 4Y7NJ 3FXOA 1OYWA 4CXFA 3SFIA 5DD4A 3GFIA 3DTEA 1BOBA 4FHTA 4M3DA 1NK2P 4DGWB 1RIOH 1T6SA 1KONA 2FNPA 4ZH4F 5L3DA 3JTHA 4EV0A 1VQ5I 3IP4B 2QSGX 1FOYA 2O7OA 3P7NA 4PCQA 5J4YA 1FP2A 3JRDA 4O6JA 4QWQA 5GPCA 4UVBA 5E18F 2H09A 4YEJA 1X4PA 2MGQA 2QWWA 4BE0A 2VE9A 1O57A 2B9SA 3BG7A 1JXSA 1NG7A 3TO9A 2OCEA 4Y52J 2ZXWH 3D5LA 2K7LA 1IUFA 1BW5A 1ZHFA 3KP3A 1HLVA 3MFKA 5TRDA 3KYDB 1GVDA 2BV6A 1P2FA 3I56I 2JA7J 2Q8KA 1REPC 1BJZA 2VKEA 1XSVA 4XIDA 2HU9A 1XMKA 1GLNA 3HSFA 4IZZA 4KA4A 5F08A 3A0BC 1ETKA 4AU7A 5CLSA 1OPCA 4LG0B 5E1ZB 3WGGA 4WCGA 3HGYA 1JT6A 1Y8RB 5IYDJ 1IRGA 2KP6A 3MMYB 1IG7A 3PFIA 4BUPA 3JRAA 1R7JA 1HKTA 4ZZLA 1WGXA 2KIFA 2XPVA 3LSJA 2MC4A 1LDKB 3J7AY 1FLIA 2UWMA 1OJLA 2AHQA 2CRGA 1W4MA 2IS4A 2LDUA 4BGDA 1H88C 1F1ZA 1I50J 1SMYF 4PK4A 3F8FA 1I1GA 4CCMA 3KYLA 3CCEI 2D45A 2OC6A 4XONA 3S32A 1BI0A 3GYHX 1HSJA 5BPIA 4XSXF 2KHMA 3J80Z 2P6TA 5K5QA 4RDUA 2WV1A 1LNWA 1P7JA 3K4JA 3S16J 4A3JJ 1IW7F 2VJJA 3JCUC 3D0SA 3NARA 5J1UA 4C30A 5BQTA 3LSKA 1MMNA 1W5CC 1MBHA 2W48A 3HRSA 3FXMA 3G1MA 1O4XA 2E5NA 1SD5A 5ILSA 2IGOA 3RPUD 3AKZA 2HVRA 1NH3A 5JHFA 2DFIA 6PAXA 2IA1A 4E7ZA 2GLOA 2O03A 1JUSA 5D5UB 1Y1VJ 2QSFX 3IKVA 4XOTA 4ETSA 2E2IJ 3K2AA 3GMEA 1E2XA 1IV6A 1AU7A 2DDAA 4IKFA 3ZXSA 2EWNA 3QOPA 1GXQA 3JRBA 2FF4A 2FU4A 1YHQI 3DBLB 4BDYA 1X1DA 4QPQA 1V4RA 4A6DA 2X85A 2XB0X 1PYVA 4UNOA 1KU9A 3QPLA 4K2EA 5L3FA 3AG2H 4BL0B 4M6XA 3TKYA 3U2RA 1KA8A 2ZXIA 3HG9A 3FM5A 2DCEA 3MKWB 4WK8F 5FB2A 1FYKA 2H1KA 4IQ4A 3M3YJ
chains in the Genus database with same CATH topology
2CFOA 2DT6A 3OS2A 3VYTB 2R7VA 2KMUA 4IX7A 1W36D 3DPLC 3H9JA 1MMAA 4D1QA 2WAFA 3CF2A 3W2WA 1YX3A 3MD2A 4CSWA 2Y0SA 1ZELA 5HOOA 2MFZA 1X1BA 2HPIA 2X6WA 4XORA 3SEQA 1D0XA 2V4JC 3BCBA 3MKYB 3MKZA 2VIXA 4LIUA 1T0FC 2RNGA 3K4BA 1WJAA 1K6YA 4ZC3A 3S93A 4C2UA 3QYEA 1LVKA 5KHDA 2CV2A 1YX5A 3NWSA 1DQUA 4BE1A 3QYBA 4KISA 3AFHA 2OV7A 4NQWB 3AL0C 3K4KA 2Z16A 2MYSA 2W7NA 3ZRGA 2JVGA 2LYCA 2LY2A 3OYGA 3H5NA 1WJEA 2KPMA 3IAM2 2BVMA 4NC8A 4OAZA 3K4MA 3HUGB 3L2WA 4DBRA 3PSIA 4CCNA 2Z2SB 3U21A 3H9QA 2R7QA 2X6XA 3OMYA 3OYFA 2VASA 2LC2A 2K9MA 3N05A 3OYMA 2X51A 4F92B 1G59A 1UG0A 2DXIA 2KQRA 2R7SA 3H9GA 5CQEA 2L2OA 4BDZA 4LITA 2L9NA 3KX2A 3DTKA 3EPZA 2Z1DA 4XLAA 3OOUA 2KRCA 3DEEA 2R7UA 3I3LA 3PUBA 5FRMA 3PJRA 4DIQA 4E4HA 2CUZA 1S9HA 4BQNA 1TT0A 2W4SA 3DQVC 3HXLA 5CKTA 3PSFA 3PNTA 4NC7A 4BACA 2CW8A 5HNHA 4BU2A 2LG4A 2E5ZA 4ITVA 2XF7A 3EUAA 3OIQA 4X0GA 3W2AA 4P1WA 3V42A 3OYDA 2VQCA 4E7KA 2CS3A 1N78A 4XL9A 1PJRA 3DKYA 2VQLA 4H4KC 1WJBA 4B44A 3LSMA 3CJRB 4CCLA 4BXFA 3EUHC 5LD2C 1Z21A 3HKZA 2UUZA 2LOOA 4XN0A 3IUOA 2KDOA 2WADA 4F91B 4HEA2 2KL4A 4CUGA 1MW7A 2XC7A 5FROA 2AQEA 3DU5A 3S3MA 4ZDOA 2WAQA 2E60A 4PUSA 4XKWA 1OR7C 3CJQB 4J01A 2ZFUA 4N4OB 3SDBA 4FETA 3HOTA 1R6RA 3VDXA 2HDWA 4U7BA 2M4GA 3IAS2 3PNYA 3VYSB 1FMVA 2QKMB 1BR4A 1MNEA 2GOMA 2X1DA 4BQQA 2KRHA 3OYEA 4GRIA 1D1BA 1VZ0A 2VQHA 2W00A 4BJ6C 1IRXA 1NG6A 1DP3A 2VB6A 2R7OA 2XF6A 4ZDPA 1V5FA 2VJ4A 4D9JA 1WJCA 2DOAA 3PFYA 3OIPA 4N4NB 3VYRB 1X19A 4AVZA 4C2TA 4PJLA 3OYJA 3OYLA 3F9KA 3BC8A 1N77A 4CCJA 2R7WA 4HSRA 1QHHD 3RTRA 3K70C 3KEYA 1WJDA 3H5RA 1WJ5A 2PJRB 3CESA 2NOJB 2Q2EB 4XLEA 4PSXA 1D0ZA 2DJIA 1SAUA 2CV0A 4E7HA 4XLHA 4XQFA 4CA0A 1MMDA 2F4IA 4DOZA 5LFAA 1T95A 2HNHA 3QODA 1D1CA 2BW3A 2ZXHA 2HVQA 1MMGA 2RQQA 2X1EA 2W1OA 4HG2A 4E7JA 1V5GA 1D1AA 4XNFA 2QKLB 2F6CA 2K9LA 2WY8Q 5HNFA 3LSHA 4HRIA 3HPHA 2FUG2 2VKHA 4PJMA 4II3A 4YRVA 2E1MB 2WB1A 1X1AA 1OLTA 4OWRB 3C2HA 3PL8A 2IS6A 2UV1A 2M7AA 3H5AA 5TGTA 4XKCA 2K3PA 2PMZA 3UR3C 3OY9A 2CH0A 1HA8A 2IXSA 2V7FA 4C9YA 4KITB 2F5VA 2CMPA 3CP8A 4Y4RA 4XLCA 3K4NA 3I9V2 4R79A 3H35A 3GBGA 2E1MC 2KLOA 3TBIA 2VL8A 2HZDA 1X1CA 1D0YA 3G2BA 2M3AA 3HPGA 5HLTA 3RCOA 3HL2A 3E1SA 2AQFA 2R4GA 4PSWA 2RREA 3LMMA 4Y33A 2M4KA 3A1YA 4HNTA 4BEHB 3W2VA 1WFXA 2LBFA 1EA3A 1DGWY 3FDYA 3SEZA 3H0DA 1J09A 2MABA 4NUBA 2HPMA 4E6KG 4QPOA 3S8PA 3VYUB 2XF5A 3OYIA 3E0JB 2A6TA 2JVHA 2HVSA 3OYAA 1WJFA 3K10A 2KZVA 2L9SA 3D5SC 3BCAA 2O5RA 2W82A 3M8JA 2ZSHB 3SYTA 3QYFA 4ZJZA 3DPUA 3OR1C 4YELA 4BJ5C 4U87A 2R7RA 3DTIA 4PFPA 4B47A 1UAAA 4PJJA 4DJAA 1E0EA 4MLOA 3VSLA 3DU6A 3AL0B 4HSTA 2X6YA 1P9QC 3OYBA 1FMWA 2IGKA 3QOEA 4ZDLA 3RSNA 4JOMA 4JQFA 5HVQC 3NWTA 1G8XA 2JUGA 4EATA 4BE2A 5KCMA 2BVLA 2VJ5A 2ZSIB 3BG6A 2WAEA 3FHNA 3L2QA 1ERDA 3LSIA 4ZTJA 3CMMA 4B48A 1YE9A 3W3CA 3HOSA 1BR2A 1LKXA 4Y3OA 1N75A 4BJTA 4KT6A 3EUKL 4RM2A 3ZCOA 3OYHA 3PNVA 2LH9A 3S3NA 2V6EA 3RQ4A 4AYBA 2V1NA 2I8DA 3OYKA 3FKJA 1UELB 3TMOA 2R7TA 1AA7A 2VLAA 2M0MA 4DBQA 3OR2C 2VXDA 3S3OA 3DTEA 1BOBA 4DGWB 3UNGC 1KONA 4F93B 3TL4X 4F3QA 3IP4B 2LBFB 3OL4A 4KJZA 4XMYA 2MD0A 3FBIB 4ZTFA 3BLYA 2BW3B 4YEJA 1X4PA 2V26A 4BE0A 3CZ6A 4HPQA 2XSJC 3OL3A 3VWBA 4E7SA 3BG7A 4XKBA 1NG7A 1Y6IA 1JI8A 1DGRM 3D5LA 5KNLA 4FASD 2IS2A 2WY7Q 4F55A 4XLFA 4LIVA 4E7LA 3OS1A 3ZGKA 2PJRA 4OAYA 2HU9A 1QHGA 4CH7A 1X4OA 1GLNA 4IZZA 1QU3A 3LL7A 2IGMA 4NNJA 5CPRB 4AU7A 3OWTA 4G6TB 2JSPA 2LRDA 3D5RC 1MNDA 2X1CA 3HC7A 2KP6A 3MMYB 2HQAA 4BUPA 4ANJA 5FRNA 4RLQA 2MC4A 1LDKB 2VJIA 4CCOA 4XN3A 3J7AY 3L2UA 2UWMA 2XAUA 3C2GA 2IS4A 4BGDA 3K70D 1V5EA 4XM3A 4PK4A 2WA0A 2V9KA 4CCMA 3VSKA 3KYLA 2OC6A 4XONA 3S32A 4E7IA 2Q1ZB 4B43A 4XOPA 4IQJA 2LY1A 4II2A 4BQOA 2KHMA 2VQGA 4RLFA 3DLAA 4RMNA 3ZR8X 1W36C 2P0WA 3K4JA 1Y56A 4B3XA 2LREA 3K4LA 2VJJA 1U0JA 3OYNA 4C30A 3LFUA 3LSKA 2JA2A 1MMNA 2GOXB 3CP2A 3ONQA 1LFPA 4BS9A 2E5NA 4F52A 2IGOA 3RPUD 3AKZA 4CCKA 2L5QA 1TZLA 2HVRA 3LSGA 4J00A 3DPTA 5JHFA 4RM3A 4E7ZA 1Z3YA 2VPLA 3ZQQA 4BEHA 4XR6A 2L7KA 2CW7A 3L2VA 2WBMA 2R7XA 1SFKA 2IS1A 4XOTA 3OS0A 2DT7B 2BOLA 2K5CA 4IKFA 2CUJA 3ZXSA 4ZYAA 3K6GA 2XDVA 4PFOA 3SZGA 2M7BA 4BDYA 1X1DA 4QPQA 2A5WA 1Z7LA 2OUMA 3DKXA 2X85A 1PYVA 3A2KA 4XKVA 4LG3A 3OYCA 2CV1A 3FBNB 4BL0B 4CZCA 2ELJA 2VXZA 4PJNA 4HNUA 3A4CA 2ZXIA 3HG9A 2DCEA 3MKWB 2IGNA 1BR1A 3K4CA 1Z3XA 3DWLE 4IQ4A 4P5OA 3L2RA 5CQGA 2VKDA 3M1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GOM A;  2WY7 Q;  2JVG A;  2JVH A;  3D5R C;  3D5S C;  2NOJ B;  2GOX B;  2WY8 Q; 
#chains in the Genus database with same CATH topology
 3CMA I;  3WGH A;  3PQJ A;  1ZAR A;  1YIO A;  3OOP A;  2V6C A;  1K78 B;  1VQ8 I;  2WAF A;  3SXY A;  1TW2 A;  3HRU A;  1HBX G;  1FOW A;  2XGE A;  1A6I A;  1P4A A;  2L7F P;  2NVX J;  5DM6 F;  2HPI A;  1K78 A;  2YX7 A;  2MSY A;  3M4O J;  2L0K A;  4LIU A;  1T0F C;  1WJA A;  1K6Y A;  2OF7 A;  3S93 A;  1LVK A;  3TDU C;  2H27 A;  2BY0 A;  4M6Y A;  5EGO B;  5EGO A;  2CJJ A;  3J81 K;  4BY7 J;  4KIS A;  5HS7 A;  4NQW B;  3B6A A;  2MBF A;  4I02 A;  5FLX K;  2Z16 A;  3TW7 A;  2MYS A;  2O9L A;  2E7W A;  1S72 I;  3GVA A;  3Q0W A;  4A3M J;  2XKP A;  1XS9 A;  2JVG A;  5F1R A;  1UJ8 A;  2K85 A;  1FC3 A;  2ZFW A;  2R5Z A;  3FXL A;  3A0H C;  4IEJ A;  3QRF F;  1WJE A;  1DU6 A;  2KPM A;  3IAM 2;  3GTQ J;  1MIJ A;  4NC8 A;  4OAZ A;  4MTD A;  3CCV I;  3QAH A;  5F04 A;  1IRF A;  1I6H J;  1P4W A;  1MD0 A;  3KPH A;  2M8G X;  2XSD C;  2Y9Z A;  3U21 A;  1S8N A;  1OYI A;  2KIU A;  4M3B A;  3OMY A;  1U5T B;  3OYM A;  1HXD A;  1LQ1 A;  3BJO A;  1HW2 A;  4AIH A;  2WV0 A;  2A5Y B;  2KJB A;  1VQL I;  5E1X A;  2Z1D A;  3ISP A;  5DD8 A;  3S1N J;  1FT9 A;  4XBF A;  1JTY A;  3DEE A;  4AUX A;  2DMT A;  3RQI A;  1IJW C;  5FRM A;  1ETY A;  1E3H A;  2JRM A;  2K9N A;  2CUZ A;  1S9H A;  4E4H A;  2K9S A;  2B7E A;  2FX0 A;  1MBK A;  5CKT A;  2COM A;  4NC7 A;  4BAC A;  2K3F A;  5HNH A;  5M3M J;  2CUF A;  2E5Z A;  2VBW A;  1BOA A;  3HHG A;  2XF7 A;  2JA5 J;  3P5J A;  3V42 A;  4EJO A;  2VQC A;  3F8C A;  1MSE C;  2VE8 A;  1N78 A;  3WU0 A;  5GTH C;  3F0C A;  1QPM A;  1WSU A;  2OTL I;  1ETW A;  1NHA A;  3CJR B;  3IH3 A;  1Z91 A;  2CWE A;  3F21 A;  5LD2 C;  3H3U A;  3BRO A;  5IP9 J;  1ZR2 A;  3FK7 A;  2UUZ A;  3CUQ A;  3I54 A;  4HEA 2;  1ZGJ A;  5DCM B;  5IP6 A;  3V8L A;  4KN4 X;  1SD6 A;  1IXR C;  1H9G A;  3GTM J;  4HLY A;  2GXA A;  2K27 A;  1OR7 C;  4XKW A;  2XAQ A;  3CLO A;  2DOE A;  1HST A;  5IYB J;  4FET A;  2LKS A;  1WCM J;  2M5W A;  2JA6 J;  2M87 A;  3FM3 A;  2P4W A;  3PNY A;  1RNL A;  4LLN A;  3F8B A;  2QGU A;  5J1R A;  3FXR A;  2DI3 A;  4A3C J;  1HQC A;  2EIJ H;  1OYY A;  3LST A;  4YII A;  5FFZ A;  4W97 A;  2EV0 A;  2HQN A;  1QVT A;  1R23 A;  1Q1H A;  2FMY A;  2R7F A;  1VZ0 A;  4KIG A;  1NG6 A;  4L5J A;  1DP3 A;  2R7O A;  3ZP5 A;  5FKL A;  1V5F A;  1S6L A;  4IO9 F;  4D9J A;  4UHT A;  1MDM B;  3R0A A;  1X19 A;  3CD6 I;  4PJL A;  4J19 A;  3OYL A;  2GA1 A;  1N77 A;  1X2N A;  4HQM A;  1TQM A;  5A2Q Z;  1UST A;  1GV5 A;  2ELK A;  2WWY A;  1TQP A;  3K70 C;  3CCJ I;  1QO0 D;  2IA0 A;  2VT3 A;  4GGG A;  1J7K A;  1Y39 A;  2O6G E;  1MMS A;  3CES A;  4HA8 A;  3RIR A;  1ZLK A;  4HAM A;  1YO5 C;  1D0Z A;  1JKP C;  2DJI A;  2CV0 A;  3K2Z A;  2GXG A;  5GTI C;  2W57 A;  4E7H A;  3WHC A;  1ULY A;  2KKO A;  1V55 H;  2DU9 A;  3BDD A;  1MNM C;  4HZF A;  4RAY A;  2HNH A;  2LD5 A;  5LEJ A;  2F2E A;  1T2K A;  1KU2 A;  2P5L C;  1GHC A;  3OSF A;  2XPW A;  2D5V A;  2V9V A;  2ZXH A;  4PJ0 C;  3ASO H;  3Q5F A;  3IH4 A;  2PX9 A;  3DP7 A;  3E7L A;  5JLW A;  4RB3 C;  1J0R A;  2K9L A;  5C3E J;  3MVP A;  5M5X J;  3BP8 A;  2GA2 A;  3E5Q A;  3PQK A;  5IT9 Z;  1CF7 B;  1FYL A;  3M8F A;  4RAZ A;  4PJM A;  4OIR F;  3A03 A;  1X1A A;  2HXO A;  1YW8 A;  3C2H A;  3ZPL A;  3QQA A;  1R9T J;  2E1O A;  3BZC A;  2PMZ A;  2E1N A;  2QVO A;  3UR3 C;  3FMQ A;  3CF5 F;  3ZMT A;  3E3V A;  2XB5 A;  2KZG A;  1HA8 A;  2IXS A;  4C9Y A;  2GQQ A;  4KIT B;  2F5V A;  2CMP A;  3GLL A;  1QGP A;  3TW6 A;  3C3W A;  5BS6 A;  5BPD A;  5FD5 A;  4R79 A;  3SDG A;  3L1P A;  1R5I D;  3RZD J;  3W6V A;  2DO7 A;  2OQG A;  1BIB A;  2VL8 A;  2HZD A;  2RVC A;  4BY1 J;  3TO7 A;  4P96 A;  5HLT A;  2WC2 A;  1B72 B;  1FBU A;  2R4G A;  3FXJ A;  4I99 C;  4BAY A;  2DA7 A;  5F27 A;  3DF8 A;  4OMZ A;  4HNT A;  1KYW A;  2DMU A;  1F36 A;  3I59 B;  1EA3 A;  3JSP A;  2EBI A;  2X0L A;  3PO2 J;  4RB0 A;  3CME I;  4E6K G;  4LK0 F;  3OYI A;  2G0E A;  2A6T A;  4EGY A;  5E79 C;  2KZV A;  3BTJ A;  4I0A A;  3D5S C;  4PGG A;  5IP7 J;  1B59 A;  3QYF A;  3ZOB A;  4JX6 A;  3I53 A;  1BN5 A;  3WTZ A;  4BJ5 C;  4U87 A;  2R7R A;  2GWR A;  3M1E A;  2HQ5 A;  3DTI A;  4I01 A;  1UAA A;  2DQL A;  2OCC H;  4JK1 X;  1DPR A;  2VOO A;  2MW8 A;  1E0E A;  5AON A;  2J5P A;  4MLO A;  4LB6 B;  2FBK A;  4BYY A;  1FMW A;  3KZZ A;  1IXS B;  3NQO A;  3QPH A;  1WQ2 A;  5HVQ C;  2P5K A;  2Z5U A;  4U0V A;  2WAE A;  5ED4 A;  3FHN A;  3CQZ J;  3WG9 A;  2F48 A;  4IVN A;  3LSI A;  4BHB A;  1S3J A;  4U0W A;  2XRO A;  1V3F A;  3W3C A;  1G3T A;  1LKX A;  2HR3 A;  2HTJ A;  1VQ9 I;  2Z99 A;  3ERE D;  4RM2 A;  2EIN H;  3KFW X;  2ME6 A;  4UB8 C;  1XGS A;  4L18 B;  5HDK A;  1J9I A;  2V1N A;  3FKJ A;  1UEL B;  1ZAO A;  3HZJ A;  3LOC A;  2FRH A;  4HV5 A;  2R7T A;  3CCQ I;  2NVQ J;  2L3D A;  2M0M A;  3K1N A;  2ZCW A;  2JSC A;  1R5G A;  3OR2 C;  1YJ9 I;  5FKO A;  4WX9 A;  5ICC A;  1ZN2 A;  2K40 A;  3FHZ A;  3DBR B;  1YQA A;  2BZT A;  4M3G A;  3UNG C;  2Y30 A;  1X3Z B;  4N9H A;  4BQA A;  3GO5 A;  2LBF B;  5D8K B;  1HCR A;  3BTL A;  4ZTF A;  3BLY A;  4N0B A;  4O3M A;  4JBA A;  4EJV A;  2V26 A;  1MBG A;  2XSJ C;  3O8H A;  2GIV A;  3VB2 A;  2D1V A;  1WRJ A;  1Y6I A;  2NS7 A;  2F5F A;  4IL6 C;  1DGR M;  3BPV A;  2L9R A;  5KVR A;  4FAS D;  4G7O F;  1D8K A;  2Z3Y A;  2DA4 A;  4M73 A;  4WXD A;  5LEK A;  2FNA A;  2RKH A;  5GAH J;  4HF1 A;  1JGS A;  2YSR A;  4CZZ A;  4LLG F;  1FWZ A;  2XAJ A;  3L7W A;  3QP6 A;  1QU3 A;  1X4O A;  2VT2 A;  3F6O A;  4P55 A;  2MH9 A;  2IGM A;  4NNJ A;  2Q0O A;  2K9Q A;  4MEY F;  3OWT A;  2EK5 A;  1Z67 A;  2JSP A;  2LRD A;  2BXZ A;  2X1C A;  3A02 A;  4TV7 A;  4ANJ A;  5EEA A;  2H6C A;  3HDD A;  5H2F C;  4CCO A;  2VJI A;  3JAM K;  2EFN A;  4XN3 A;  3H0G J;  3L2U A;  2XAU A;  4LG0 A;  2HOS A;  5EG0 A;  2AO9 A;  2BEO A;  3TED A;  4KNY A;  1V5E A;  4XM3 A;  2WA0 A;  1TT5 B;  2L02 A;  2LNB A;  1R00 A;  2V9K A;  3W6K B;  4A0Y A;  1FTT A;  1TWC J;  4B43 A;  4XOP A;  2QSH X;  2LY1 A;  2IW5 A;  2Y9Y A;  4RLF A;  4YFN F;  1D5Y A;  3JSO A;  2XRN A;  4RMN A;  4OMY A;  1FP1 D;  1XGO A;  1WI3 A;  2L9V A;  1D3Y A;  1U0J A;  3OYN A;  3FKI J;  3CP2 A;  1BIA A;  3ECH A;  3ONQ A;  1LFP A;  1R1V A;  4BS9 A;  4F52 A;  1U78 A;  3MEX A;  2NNY A;  3GZ5 A;  1IN7 A;  1TZL A;  4EVI A;  4UUS A;  1AKH A;  2A69 F;  3C1D A;  2E2H J;  4J00 A;  4MFE A;  4OOI A;  3ZQH A;  2M1B A;  5LGT A;  1Z3Y A;  2BE5 F;  2CW7 A;  3L2V A;  4V2F A;  4G9Y A;  3ZN0 A;  2NXN B;  4C3J J;  3HEF A;  1MJB A;  5K5R A;  3N4M A;  1HW5 A;  4RGU A;  2BOL A;  2CUJ A;  4ZYA A;  4EM0 B;  4Q47 A;  4PFO A;  4GO1 A;  3W6J B;  4A6E A;  4MIM A;  1JUM A;  2QUF A;  4XKV A;  3MZY A;  5CVR A;  3OYC A;  2CV1 A;  4XK4 A;  2HWV A;  4D0P A;  4YFX F;  3GTK J;  2PN6 A;  2ELJ A;  2VXZ A;  4PJN A;  3DFG A;  2O8X A;  3WU2 C;  3RI4 A;  4B8X A;  1BR1 A;  2PMU A;  4UVC A;  5DS9 A;  1ZK8 A;  3K4C A;  4FIS A;  2DFF A;  3T0Y A;  3TQN A;  3DWL E;  2JT1 A;  3HTU A;  2ZME A;  2VKD A;  2STW A;  3MKL A;  2DT6 A;  3OS2 A;  2R7V A;  2UXX A;  1XDS A;  3DPL C;  2DW4 A;  3H9J A;  4KIF A;  1MMA A;  4D1Q A;  3CF2 A;  3W2W A;  5J47 A;  2F5D A;  3MD2 A;  4I98 B;  4CSW A;  5HOD A;  3ZQL A;  5HOO A;  1MJ9 A;  2MFZ A;  2BY1 A;  3ZMD A;  1X1B A;  2I5U A;  4XOR A;  5J40 A;  2JMW A;  1USS A;  1G4D A;  2V4J C;  3MKY B;  3AAF A;  5L3B A;  2VIX A;  3K7A J;  2H1L A;  4ZYD A;  1OCR H;  2VBY A;  2CV2 A;  1B4A A;  1YX5 A;  2LLK A;  1QZE A;  2XGD A;  1T98 A;  3QYB A;  3GZ6 A;  2OV7 A;  1ZKG A;  2F5E A;  3PIP F;  3FMR A;  5KAF C;  4G7H F;  4B4C A;  4ENK A;  1ETV A;  2LY2 A;  4XRS A;  3H5N A;  4S05 A;  1XGM A;  1U8R A;  1IUY A;  2Y2Z A;  3CCM I;  2BVM A;  3HJE A;  3HUG B;  1Y0U A;  2DA6 A;  3L2W A;  3VPR A;  1ZH5 A;  3CDI A;  2DA3 A;  2Z2S B;  3H9Q A;  4GYI A;  4NHJ A;  2LY9 A;  5BOX A;  3ULQ B;  2I10 A;  2LC2 A;  2K9M A;  4YFK F;  4F92 B;  2DA1 A;  4MQ9 F;  1ZG5 A;  4A0X A;  3GLX A;  4CDG A;  1ZR4 A;  2L2O A;  2VC1 A;  5FD6 A;  2NOG A;  4L0Z B;  1Y0N A;  4QIW N;  4XLA A;  2GZW A;  3KEQ A;  1XPX A;  3S14 J;  2R7U A;  2CQX A;  1YLF A;  3I3L A;  3PUB A;  4UUV A;  1U5T C;  4B09 A;  1R71 A;  2DMN A;  2YU9 J;  4XRF A;  1TT0 A;  1WZ2 A;  2QA4 I;  2DPU A;  3PNT A;  2ZNY A;  5D5V B;  4AC0 A;  4AWX B;  4UY8 I;  1CF7 A;  3EUA A;  3RYR A;  2KJC A;  3I55 I;  2OZU A;  1ETQ A;  2UXN A;  3W2A A;  3FXK A;  1IDZ A;  2M2E A;  4KYW A;  4E7K A;  2ESH A;  3CDH A;  1HDP A;  2QYO A;  5FLX Z;  1KQ0 A;  2JWT A;  5DM7 F;  1PJR A;  3AG4 H;  1R1U A;  2VQL A;  4H4K C;  4B44 A;  4CCL A;  3GFM A;  5E1W A;  3COA C;  2BY3 A;  3HKZ A;  2PBI A;  1B8I A;  3BR5 A;  3GTL J;  5GAE J;  1F43 A;  3WHB A;  3ABK H;  2OU2 A;  2KL4 A;  2ZME B;  3D1N I;  3WE3 A;  5FRO A;  4CIC A;  3DU5 A;  3S3M A;  5IPA A;  3CJQ B;  2VOP A;  2DT5 A;  4IHV A;  1WVR A;  2R92 J;  3GEZ A;  3E6M A;  4ON0 A;  1I39 A;  2HDW A;  2M4G A;  3IAS 2;  1O3R A;  3HSE A;  2QKM B;  2O3F A;  2X1D A;  4BQQ A;  2H94 A;  2KRH A;  3I64 A;  4A2U A;  3OYE A;  4DQ2 A;  2IPQ X;  1RKW A;  3H36 A;  3CCR I;  5D6F A;  4IHS A;  1QZY A;  3IC7 A;  3H3V K;  1FX7 A;  1OCZ H;  3RDI A;  3M7G A;  3HKZ N;  1J59 A;  4Y17 A;  1DU0 A;  3CO6 C;  4C3I J;  2VJ4 A;  3GTP J;  1WJC A;  9ANT A;  1BA5 A;  4C2T A;  3F9K A;  3BC8 A;  1E3O C;  4UV9 A;  4CCJ A;  5HS9 A;  1YS6 A;  1ZQ3 P;  1ITY A;  2M34 A;  5IT9 K;  3BR1 A;  3GFL A;  3DXJ F;  1EH7 A;  2CU7 A;  3H5R A;  3I59 A;  4KUM A;  4A93 J;  2PJR B;  1SFU A;  1LVA A;  2W85 A;  2NOJ B;  1RUN A;  1JHF A;  3LNQ A;  5J1Y A;  1LFU P;  2HZT A;  1KQ8 A;  1SAU A;  4V2G A;  2EZL A;  3CUQ B;  4XLH A;  4CA0 A;  2F4I A;  4ABZ A;  1I5Z A;  4MNU A;  4OIQ F;  1TL8 A;  2LMD A;  2YS9 A;  2NNN A;  2VBZ A;  4NDL A;  2M0C A;  1R4M B;  2BW3 A;  2HVQ A;  3LFK A;  4D5C A;  2CSO A;  2PLY A;  3SZP A;  2W1O A;  3L09 A;  2QF7 A;  3FIW A;  1V5G A;  1W7P B;  3J7Z I;  4XNF A;  2F6C A;  3M07 A;  2FOW A;  1RR7 A;  2EIM H;  4JYK A;  3BG5 A;  5DDG A;  4II3 A;  2WB1 A;  2M8E A;  4I6Z A;  4L9N A;  4NC6 A;  4CHU A;  5C4J J;  1A31 A;  4CYC A;  1T08 B;  2M7A A;  1BJA A;  5TGT A;  5HDN A;  4Z6Y A;  4OU0 A;  4A3E J;  2VI6 A;  3GTG J;  2CH0 A;  5H20 A;  2ZJP F;  2CQN A;  4Y4R A;  3GTO J;  3VEP A;  4XLC A;  3K4N A;  3ZMS A;  4MFD A;  3DEW A;  4DYQ A;  5A2Q K;  4BBS J;  3O3K A;  3H35 A;  3GBG A;  3LAJ A;  1W0T A;  3ZQG A;  3RKW A;  3ABU A;  3B6C A;  3R60 A;  2TCT A;  5LRS A;  2ZJQ F;  3G2B A;  5TIS C;  3RCO A;  3HL2 A;  1Q1V A;  2O61 A;  2AQF A;  2VUM J;  1KQ9 A;  4PSW A;  3TO6 A;  5J8C A;  4RGS A;  4L9J A;  2DPD A;  4BEH B;  3W2V A;  1WFX A;  2LBF A;  3C2B A;  3H0D A;  3S17 J;  5FJ8 J;  1OCC H;  2XF5 A;  3E0J B;  4YIR X;  4LFU A;  1K83 J;  2ISZ A;  2DYS H;  3J80 K;  2JA8 J;  1OKR A;  4NQW A;  1MDM A;  3V7S A;  3BCA A;  2O5R A;  3KP4 A;  3M8J A;  2LP0 A;  3SYT A;  4KIB A;  3GF2 A;  4YEL A;  3RYP A;  4UB6 C;  4B47 A;  4PJJ A;  4RA2 A;  4DJA A;  2DN0 A;  5AIP A;  3VSL A;  3TOB A;  2XAG A;  4OIN F;  1T38 A;  2IT0 A;  2OJE D;  1P9Q C;  3QOE A;  3G71 I;  3WTX C;  4IOA F;  5DCF A;  4R1H A;  4ENN A;  2HXI A;  4AVP A;  4FX0 A;  2A3S A;  4A3I J;  3NWT A;  1BI2 A;  1RET A;  2JUG A;  5KCM A;  3LQQ A;  3GTJ J;  2ZSI B;  3KCC A;  2OA4 A;  2E2J J;  4ZTJ A;  2FXA A;  2LVS A;  3ASN H;  2ZB9 A;  4EGZ A;  1UHW A;  2ACJ A;  4Y3O A;  1N75 A;  3C7J A;  1UB9 A;  4FE7 A;  4BJT A;  3EUK L;  3WOD F;  2QEN A;  3JRI A;  3OYH A;  3PNV A;  2LH9 A;  2RC4 A;  3S3N A;  2GIZ A;  4DYC A;  2WB1 N;  3RQ4 A;  3JTG A;  1YTY A;  1HKQ A;  5F0H A;  3OYK A;  2I8D A;  3TMO A;  1AA7 A;  2L54 A;  1W7P A;  4DBQ A;  1EJ9 A;  2E7X A;  2VXD A;  3F8N A;  4A3F J;  3K9T A;  2DK5 A;  2M45 A;  1V54 H;  5D4R A;  2MG4 A;  1ODD A;  2P8T A;  2XIG A;  4D7M A;  1HDD C;  4IRI A;  4MO7 A;  2ID6 A;  3IHU A;  2ZXJ A;  4LK1 F;  1FJL A;  5AIQ A;  4F3Q A;  2HOE A;  1IN5 A;  1R22 A;  4O5V A;  3KP5 A;  3OL4 A;  4XMY A;  5B1A H;  3M9A A;  2EFP A;  2K4B A;  1W5T A;  2NS0 A;  4HBL A;  1MBE A;  5IT3 A;  3DBH B;  3Q3S A;  3CZ6 A;  2CYY A;  4HPQ A;  3OL3 A;  2QZ8 A;  4EM2 A;  2V1D A;  2MLK A;  4E7S A;  2GBY A;  1P92 A;  5KNL A;  1X2M A;  1B1B A;  2A68 F;  4HW0 A;  2A6E F;  4F55 A;  4XLF A;  3O2P E;  2DLL A;  3OS1 A;  3B73 A;  1AOY A;  4L9V A;  3BJA A;  2XGC A;  3RJP A;  3PO3 J;  2XHK A;  3LWF A;  5E3N A;  1QHG A;  3R4K A;  3N97 A;  2LR8 A;  1IF1 A;  3IH2 A;  2Y48 A;  3V7C A;  5EJC A;  3J81 Z;  4G6T B;  1MJA A;  4UXN A;  2O8K A;  4FQG A;  2P6S A;  4M74 A;  1IN4 A;  2LSO A;  3BR0 A;  4UVA A;  1YRN A;  5FRN A;  3I4P A;  1VFC A;  1VQN I;  4RLQ A;  1T56 A;  2HYJ A;  3GXO A;  3WE2 A;  4IJA A;  3C2G A;  1JT0 A;  5EEH A;  5D4S A;  1SFO J;  1K79 A;  1PUE E;  1QZZ A;  4X1E A;  3VSK A;  4B3A A;  4M6V A;  4E7I A;  1O7L A;  2RN7 A;  4IQJ A;  4II2 A;  4BQO A;  1TNT A;  4IHX A;  2FD5 A;  3ZMU A;  4LMY A;  2K4J A;  3DLA A;  4JX4 A;  1UHM A;  1O7F A;  2EV5 A;  4A5M A;  1Z0X A;  2P0W A;  1Y56 A;  4B3X A;  5JLX A;  2LRE A;  1B8I B;  1U6G A;  3K4L A;  2NRA C;  5E8G A;  4A3B J;  2DA5 A;  3C18 A;  2NYX A;  5D5W B;  2QBY A;  2JA2 A;  2G7H A;  2GOX B;  3E6C C;  3ZQC A;  1LEB A;  2TRT A;  3HGG A;  3CO7 C;  2L4M A;  4CCK A;  2L7M P;  2L5Q A;  3ABT A;  4FT8 A;  3LA3 A;  2EZI A;  4EEF G;  3L9F A;  1W5S A;  2VN2 A;  4BEH A;  3BTI A;  1OMI A;  4D7N A;  2IS1 A;  2AXL A;  5DTD A;  4H0E A;  2FA5 A;  4S04 A;  3I71 A;  3OS0 A;  1ORK A;  2K5C A;  1A04 A;  3CJT B;  3GW2 A;  3HOU J;  4RB1 A;  3SZG A;  5EDN A;  3WTU C;  1GT0 C;  2Y31 A;  2OUM A;  2P7V B;  1YIT I;  3FBN B;  4ZYG A;  4CZC A;  2VON A;  1S29 A;  1HOM A;  1YIJ I;  4HNU A;  3A4C A;  1ZG3 A;  1XB4 A;  1NTC A;  3BR2 A;  4W1U A;  4CYC B;  3ZN1 A;  1Z3X A;  1Z9C A;  1M1E B;  3G3Z A;  5DCM A;  5F0F A;  2E71 A;  3PSF A;  2KIM A;  2LKP A;  3O8G A;  1B9M A;  2CFO A;  2ECB A;  1MSF C;  2B63 J;  3VOD A;  3QPS A;  1W36 D;  2EPF A;  5M3F J;  3BJ6 A;  3REO A;  1WWX A;  1YX3 A;  3KEO A;  1BBY A;  3L00 A;  1SC7 A;  1APL C;  3I4N J;  1LB2 A;  1LDJ A;  1ZRE A;  3CCL I;  2P5V A;  1U3E M;  2Y0S A;  1XMX A;  1XN7 A;  5DEQ A;  1IN6 A;  3SEQ A;  2Z33 A;  2PFB A;  3RPQ A;  3BCB A;  3F6V A;  3HOW J;  1IAW A;  5E3M A;  1R36 A;  3G73 A;  4V19 K;  2RNG A;  2L7Z A;  2QCO A;  3QYE A;  1WHU A;  2FQ3 A;  3NWS A;  3OV8 A;  3U9G A;  2ZJR F;  4BE1 A;  4KDP A;  2QQB A;  3HOV J;  2HYG D;  1R5H A;  2Y0S N;  3AL0 C;  3K4K A;  3HOX J;  2EZH A;  2HI3 A;  1ACI A;  1C0W A;  4BHP A;  3MWM A;  2F4M B;  3AG1 H;  3EYY A;  5H6R A;  2A6H F;  5LBQ A;  1KGS A;  2P7C B;  3G6E I;  5CVU A;  2ME0 A;  2QQ8 A;  3O6B B;  2MLG A;  4WXH A;  3K4M A;  2B0L A;  5GPA A;  1FOK A;  1UCR A;  4DW6 A;  4DBR A;  1T33 A;  2DK8 A;  4CCN A;  2CUE A;  2KIS A;  1IZ1 A;  2EFW A;  5B5E C;  3PM1 A;  2IRF G;  4G6D A;  1IO2 A;  2R7Q A;  5E3L A;  3OYF A;  1U5T A;  1SEU A;  1JGG A;  1GDT A;  2X51 A;  3WGI A;  1UG0 A;  2DXI A;  4L0Y B;  2R7S A;  3H9G A;  3KP2 A;  5FO5 A;  5CQE A;  4BDZ A;  3K1P A;  2JTV A;  1E3P A;  2L9N A;  3DTK A;  3KX2 A;  3EPZ A;  4M9S A;  1B9N A;  3OOU A;  4QSH A;  2ECC A;  2DJN A;  1OFC X;  4DIQ A;  3BTC A;  4BQN A;  3JRG A;  1A5J A;  2EFO A;  1R4N B;  4IHW A;  1G6N A;  2W4S A;  2MH2 A;  4P9F A;  1FNN A;  2OAZ A;  4I7H A;  3OSG A;  1QBJ A;  1YG2 A;  2EH3 A;  5KK1 A;  2H8R A;  3E5U A;  1SD4 A;  3OIQ A;  1A6Q A;  5EZG A;  2EZK A;  1ONV A;  4X0G A;  4JP0 A;  4P1W A;  3OYD A;  3WTT C;  2UZK A;  4KT5 C;  3MAJ A;  3KIO A;  4ASN A;  2CS3 A;  1VND A;  4XLP F;  2O0Y A;  4DNC A;  2PI0 A;  2Q2E A;  3T8R A;  5K7F A;  1ZGW A;  1WJB A;  5DV5 A;  3BG9 A;  2P81 A;  3EUH C;  4BXF A;  4Q4Z F;  2VC0 A;  4XN0 A;  1XCV A;  3WG7 H;  2KDO A;  2WAD A;  4F91 B;  4CUG A;  2KFD A;  1XG1 A;  2PQ8 A;  3ZMV A;  1MW7 A;  3S2W A;  2TDX A;  1AHD P;  4AIK A;  2JQ7 A;  2NVT J;  2R93 J;  1TC3 C;  4AIJ A;  4UUT A;  4DZP A;  5F64 A;  4FX4 A;  5CVI A;  1B72 A;  5FLM J;  5IOY A;  3RZO J;  2ZFU A;  4N4O B;  3SDB A;  5H6Q A;  3H1C A;  4Q48 A;  4JX5 A;  5EG0 B;  1R6R A;  3VDX A;  4U7B A;  1TTY A;  3HOZ J;  2QQ9 A;  4NB5 A;  5ICG A;  2JZY A;  3V7R A;  5FGM A;  3F3X A;  1CGP A;  5FKK A;  4B1R A;  1K6O A;  2VQH A;  2IA2 A;  4Y13 A;  2W00 A;  1IRX A;  1K7A A;  2XF6 A;  4ZDP A;  2R3S A;  3BQY A;  3R61 A;  3LSP A;  5ICE A;  2RGV A;  1R58 A;  3L2C A;  4ZYH A;  4IHY A;  1T8I A;  1YW7 A;  1BC8 C;  2R7W A;  3ML6 A;  1G3W A;  2JJ7 A;  4GCV A;  1I3Q J;  2X9D A;  4U88 A;  3F22 A;  3E5X A;  1WJD A;  2XVC A;  2QEX I;  1HKS A;  3HSR A;  1FOX A;  4S0H B;  2Q2E B;  1YYV A;  2E36 A;  3EYI A;  4PSX A;  4ENM A;  3EDP A;  3BR6 A;  5J6X A;  5CYV A;  2EA4 A;  1YJN I;  1DPU A;  3P9C A;  4HDU A;  4XQF A;  1Z6R A;  5LFA A;  1FY7 A;  2XRL A;  5D8L B;  2NVY J;  1T95 A;  1QPI A;  2K02 A;  3IKT A;  4HDV A;  1I3A A;  3KE2 A;  2FOK A;  3QP5 A;  5C4X J;  3TGN A;  3CLQ A;  3RKQ A;  1MMG A;  2EJR A;  3HM5 A;  2XAH A;  2RQQ A;  4LB5 A;  4ESF A;  3HTS B;  2VPR A;  4HG2 A;  4E7J A;  1PVE A;  3GWZ A;  2JRT A;  3I4M J;  3JRF A;  5D6E A;  2WY8 Q;  1X1P A;  5HNF A;  2CGP A;  4HRI A;  5LGN A;  2ADU A;  2FUG 2;  2HFH A;  2VKH A;  3G1L A;  3HPH A;  2EB7 A;  2E1M B;  1X58 A;  4HX4 A;  3VFZ A;  1OLT A;  2L01 A;  2W24 A;  3BOQ A;  2UV1 A;  2IP2 A;  4Y15 A;  3FMS A;  3H5A A;  4XKC A;  2K3P A;  3OY9 A;  2E19 A;  1UHS A;  1VQO I;  3CP8 A;  1LPQ A;  4BNC A;  5CVV A;  4CGZ A;  5HS8 A;  4GYG A;  2DBB A;  3I58 A;  3ELK A;  4LOC A;  1BL0 A;  4G6Q A;  1ZLJ A;  1IV8 A;  2QLZ A;  2YR2 A;  1X1C A;  1AKH B;  4XRS G;  3IWF A;  3HPG A;  3PIO F;  3KP7 A;  1TWF J;  2RDP A;  4LLL A;  3S2H J;  3K1M A;  2PEX A;  1U9O A;  5DUI A;  4M71 A;  1Z77 A;  3LMM A;  4ENJ A;  1BC7 C;  1QQI A;  2AS5 F;  3A1Y A;  3LSR A;  3HYI A;  1P4X A;  1DGW Y;  3FDY A;  3X2Q H;  1GXP A;  1T39 A;  1OCP A;  1FTZ A;  2YU3 A;  5JI6 A;  2JVH A;  4XRM A;  2HVS A;  3KET A;  2Y75 A;  3V8K A;  1EH8 A;  1WJF A;  5ERI A;  3ECO A;  1TNS A;  1JJ8 C;  2VOD A;  3NEU A;  3DPU A;  2MC3 A;  3OR1 C;  5CJ9 A;  3BZ6 A;  2KIQ A;  2ISY A;  1SAX A;  1DP7 P;  1ON1 A;  4M3E A;  3TP3 A;  4EM1 A;  4HST A;  2W84 A;  5K7H A;  1DDN A;  3Q9S A;  2IGK A;  5EEG A;  2OPT A;  1W0U A;  4RAF A;  4I09 A;  4ZDL A;  1FIA A;  1RES A;  4L9T A;  3F8M A;  2E1C A;  4JOM A;  4RBO A;  1G2H A;  3GCM A;  4HNV A;  5LHH A;  1JKQ C;  1NK3 P;  1G8X A;  3EQL F;  4IF4 A;  4BE2 A;  2BVL A;  3E6B A;  2BBY A;  5JFR A;  1OQY A;  1YW9 A;  1MZB A;  4PZJ A;  3A01 A;  4PDK A;  2BY2 A;  2BHY A;  4B48 A;  1PP8 F;  3WU1 B;  1JKR C;  4GFB A;  1P6R A;  3HOY J;  1BR2 A;  3ESW B;  2EQR A;  1S7E A;  5GP9 A;  4KT6 A;  2J5O A;  1VTN C;  2LTP A;  2V6E A;  4LJZ F;  4AYB A;  2IEK A;  1D5V A;  1TW3 A;  3FXU A;  1TWG J;  2DQR A;  1PUF A;  1W7P D;  5C44 J;  4KFC A;  3S3O A;  4M72 A;  4WXC A;  3ZQF A;  1PDN C;  3DEU A;  1EKE A;  4BBR J;  1S5L C;  1TP4 A;  1H0M A;  4RAG A;  2YPR A;  3SHF A;  5HLI A;  4F93 B;  1TWH J;  2R5Y A;  3TL4 X;  2R7Z J;  1RC9 A;  3J7Y J;  3RPU A;  3CCU I;  4EJW A;  4KJZ A;  1J5Y A;  2MD0 A;  3CC4 I;  3FBI B;  5DYM A;  1JKO C;  4GDF A;  3DCF A;  1ZRD A;  1FSE A;  1Z6T A;  2BW3 B;  3HIF A;  3K0L A;  3ZQ7 A;  3DV8 A;  4I76 A;  1VQ6 I;  2CQK A;  4HQE A;  3VWB A;  3MZH A;  4XKB A;  4HOB A;  1JI8 A;  4RB2 C;  1CQT A;  2IS2 A;  4FCY A;  1Y8Q B;  4KMU X;  2WY7 Q;  1LE8 A;  4LIV A;  1J75 A;  4E7L A;  4AID A;  1RI7 A;  4HX8 A;  4A3L J;  4A0Z A;  2XAF A;  3ZGK A;  3G4S I;  2ZME C;  3T5X A;  1ZRC A;  3ERM A;  1U9N A;  1H9T A;  2Y0M A;  2PJR A;  4OAY A;  5B1B H;  2HDC A;  4CH7 A;  3MN2 A;  1SVO A;  1I6X A;  3LL7 A;  2HDD A;  2JPB A;  5CPR B;  1ZG1 A;  3ZQI A;  1XC5 A;  2FJ1 A;  3D5R C;  2HGC A;  1MND A;  1YOV B;  1Y1W J;  5TJJ A;  1KYZ A;  3Q9V A;  3HC7 A;  4HYE A;  2IJL A;  2HQA A;  1O3S A;  3OIO A;  2ZKZ A;  2JN6 A;  1UZC A;  4Q5S F;  1MH3 A;  3BR3 A;  4G7Z F;  1R49 A;  3WTS C;  3K70 D;  4BH9 A;  4UUS B;  1OCT C;  1MKM A;  1TWA J;  3MCZ A;  1GV2 A;  4D5F A;  1H8A C;  2Q1Z B;  2F4O B;  3FX3 A;  3IL2 A;  4ESJ A;  4MTE A;  5FKN A;  2VQG A;  1JHH A;  2DOD A;  2ELH A;  1S7O A;  2H8W A;  3KYC B;  4M9Z A;  3ZR8 X;  2F5C A;  2ZC2 A;  1W36 C;  2CQQ A;  2GM4 A;  2AXT C;  1GVJ A;  1IXC A;  4Z2Y A;  2DAO A;  1JUP A;  1Z1D A;  3LFU A;  2EIL H;  2QQA A;  2QBY B;  2XAS A;  1IN8 A;  2R0Q C;  2H6B A;  2XPU A;  1F4K A;  4BHC A;  1LE8 B;  4M9X A;  5E8I A;  2KDZ A;  4HLX A;  2YUS A;  3LSG A;  1XMA A;  4RGX A;  3S1M J;  1J2X A;  3DPT A;  3CJN A;  5J4V A;  1VQ7 I;  3JRE A;  4G8X A;  1WH5 A;  4RM3 A;  5M5W J;  2K86 A;  2XUB A;  4UV8 A;  3BT9 A;  2VPL A;  3ZQQ A;  4OIO F;  4XR6 A;  2L7K A;  3KZY A;  2R7X A;  2WBM A;  3R6S A;  2DA2 A;  4E70 A;  3WTV C;  1SFK A;  4MGR A;  2FBI A;  3ROU A;  1HW1 A;  3LA2 A;  4R8H A;  1WPK A;  2DT7 B;  2STT A;  2FQ4 A;  2XGX A;  2RNJ A;  2ZNZ A;  1JE8 A;  3K6G A;  4IOC F;  2CG4 A;  2XDV A;  5KAI C;  2LF8 A;  1SVM A;  2ZBK A;  1YI2 I;  2M7B A;  1SFX A;  3Q0U A;  3FF5 A;  1YRN B;  4G12 A;  1BI3 A;  4XSZ F;  2A5W A;  1Z7L A;  2D1H A;  3FZV A;  3HUG A;  3DKX A;  3GX4 X;  1XDU A;  2HKX A;  2DOF A;  3M8E A;  3A2K A;  3IWZ A;  4DZJ A;  4LG3 A;  5J3L A;  2XV4 S;  1XSD A;  4P9U A;  3KLO A;  3HRT A;  2MA3 A;  2RQP A;  1X3W B;  2WAQ N;  4CYD A;  3SJM A;  1G3S A;  2NAZ A;  1BW6 A;  2IGN A;  1QVU A;  1N25 A;  4RGR A;  5E17 F;  3QU6 A;  2R7D A;  4P5O A;  3L2R A;  4A3K J;  1GUU A;  1VQ4 I;  5CQG A;  4HF2 A;  3M1C A;  1SAN A;  2G9W A;  2E34 A;  2WTE A;  5IOZ A;  2EA2 A;  4FE4 A;  5E3O A;  3VYT B;  3NRV A;  2Z9O A;  2KMU A;  4IX7 A;  2FE3 A;  4MQV A;  1F5T A;  1OIS A;  1U8B A;  4RS8 A;  1XGN A;  1QA6 A;  1ZEL A;  2MD5 A;  4YG2 F;  1VQP I;  2X6W A;  3BY6 A;  3VOE A;  1R1T A;  1D0X A;  3AG3 H;  5ICF A;  3MKZ A;  2BXY A;  3K4B A;  2XKO A;  4ZC3 A;  4U7D A;  2DTZ A;  4C2U A;  3B02 A;  1STZ A;  2IAI A;  5KHD A;  2COB A;  2EFQ A;  1DQU A;  2A05 A;  2NS8 A;  1G3Y A;  3AFH A;  2CO5 A;  4I2O A;  1MBJ A;  4YIF A;  1UMQ A;  4M3F A;  4XLN F;  1X3U A;  4IXA A;  2W7N A;  2RAE A;  3F72 A;  3ZRG A;  5K7Z A;  2A07 F;  2LYC A;  1TBX A;  2GAU A;  2X6O A;  1TLH B;  2JPC A;  1ZTR A;  4F7Z A;  4IRH A;  3OYG A;  1E17 A;  1SVL A;  1ZRF A;  1T0F A;  2L4A A;  4ESB A;  5LGU A;  2D2W A;  2HYF A;  3PSI A;  5LHI A;  2LK2 A;  3T8T A;  3G1O A;  1MH4 A;  1A36 A;  4XIC A;  1SFE A;  2X6X A;  2VAS A;  1QRY A;  1KU7 A;  1BM9 A;  2HOA A;  3N05 A;  2HS5 A;  3TP0 A;  1G59 A;  3EET A;  4OIP F;  5JVG F;  3BWG A;  3TOA A;  2KQR A;  3SZT A;  1K61 A;  1VQM I;  2KT0 A;  1EH6 A;  1YS7 A;  1Z7U A;  1EF4 A;  4LIT A;  2V1X A;  3U1K A;  1WKM A;  4QTR A;  3JRH A;  3DLL F;  3HHH A;  3CUO A;  1EV7 A;  3JR9 A;  2KRC A;  3BQZ A;  1ENH A;  3DKW A;  3PJR A;  2NVU B;  3KZI C;  4IRG A;  1L0O C;  1YFH A;  4KMF A;  3V8J A;  4HX7 A;  3HBL A;  3H92 A;  1KZH A;  5ILV A;  3DQV C;  3HXL A;  2ZO4 A;  1DUX C;  2CW8 A;  3MZ8 A;  1YJW I;  4BU2 A;  2LG4 A;  1FZP B;  3WTW C;  3I0T A;  4ITV A;  5FLV A;  3JRC A;  3IRQ A;  2Y69 H;  2OTJ I;  1JTX A;  3GUD A;  3V4G A;  1XX5 A;  2JUC A;  1FBS A;  1ZGA A;  2IBD A;  2LF7 A;  4IPA A;  3S15 J;  1LFB A;  4XL9 A;  2JK3 A;  2RV8 A;  4A12 A;  1O3T A;  3DKY A;  2N8G A;  5F1J A;  1IRZ A;  5B3S H;  3CMY A;  1B6A A;  4G94 A;  3LSM A;  3QPT A;  1Z21 A;  1FIP A;  2LOO A;  1UG2 A;  3IUO A;  3S1R J;  1XTA A;  3LAP A;  1TQI A;  2XC7 A;  1VF9 A;  2AQE A;  1H89 C;  4ZYE A;  4DYR A;  2M30 A;  4ZDO A;  2BHZ A;  2WAQ A;  2E60 A;  2BYV E;  4PUS A;  4J01 A;  5E20 A;  2BGC A;  2EV6 A;  1PUF B;  1VQK I;  3CC2 I;  5HDG A;  3FWE A;  5F0C A;  3BG3 A;  4EQQ A;  3HOT A;  4FTH A;  5F6F A;  3VYS B;  1FMV A;  1BR4 A;  2KRF A;  1FSH A;  1D8J A;  1MNE A;  2X4H A;  2FSW A;  2GOM A;  5GAG J;  4GXO A;  3QWL A;  1F9N A;  2CW0 F;  1ON2 A;  3I5U A;  4CO8 A;  5HLG A;  3IV5 A;  4GRI A;  1IGN A;  1D1B A;  5DUK A;  2DYR H;  5CVJ A;  1W1W E;  4BJ6 C;  4U0Y A;  3CCS I;  1SD7 A;  3ABL H;  2VB6 A;  4HV6 A;  3JAM Z;  3H3Z A;  2DOA A;  3PFY A;  3OIP A;  2QM3 A;  2PJP A;  4N4N B;  3VYR B;  4BKX A;  4AVZ A;  3GZN B;  5JHU A;  1FYM A;  3OYJ A;  5J8F A;  1SMT A;  1WH7 A;  2ICW G;  3HRM A;  1OCO H;  2CQ7 A;  3IRR A;  1XCB A;  1FPQ A;  1QHH D;  4HSR A;  2DMQ A;  3RTR A;  3T1B A;  5LHG A;  3KEY A;  2DFE A;  2DFH A;  1BI1 A;  1WJ5 A;  1AWC A;  2V9P A;  4MHG A;  4L5I A;  5BNG A;  4I0B A;  5EF6 A;  4XLE A;  1POG A;  3CUQ C;  1Z05 A;  1LJ9 A;  3K69 A;  1HC8 A;  1K4S A;  5EZH A;  2EIK H;  2G7U A;  3LQR A;  1WI9 A;  1MMD A;  1XD7 A;  4DOZ A;  5LLQ A;  2PMH A;  3RKY A;  5JR3 A;  4PGH A;  1JJ6 C;  5B66 C;  3QOD A;  5L3E A;  2DDB A;  1D1C A;  2X48 A;  4QLC U;  3S1Q J;  4EJT A;  2X1E A;  4A3D J;  2HTS A;  3MQ0 A;  1D1A A;  1RR8 C;  2OD5 A;  4EJU A;  3S2D J;  2QKL B;  4LGW A;  2DMP A;  3RKX A;  1PP7 U;  5L3C A;  1UFM A;  3LSH A;  2HEO A;  3E97 A;  3CCY A;  3BZK A;  4YRV A;  5D5X B;  4OWR B;  3PL8 A;  4AD9 A;  2IS6 A;  1RPW A;  2HQR A;  2FBH A;  4HF0 A;  3CC7 I;  3WTY C;  3J7A O;  4MEX F;  3TDZ C;  1MBF A;  5FKM A;  4NBQ A;  3ABM H;  2V7F A;  5K5O A;  5HLH A;  1A35 A;  2ZJ2 A;  5K1Y A;  3I9V 2;  2M9H A;  4BXX J;  2E1M C;  2KLO A;  2LFB A;  1MGT A;  3TBI A;  1QNT A;  1VI0 A;  1OR7 A;  2ETH A;  3CDL A;  3R0J A;  5EYR A;  3KP6 A;  1LUJ B;  2E35 A;  4LD5 A;  4C2M J;  5M5Y J;  1D0Y A;  3Q0V A;  5L3G A;  4A3G J;  2M3A A;  4EMS A;  3E1S A;  4ZZD A;  5JVT A;  1ZYR F;  5BMZ A;  2DTR A;  2RRE A;  1RKT A;  2OQR A;  4Y33 A;  2M4K A;  3PUF A;  4A5N A;  3NAU A;  1IDY A;  1ETO A;  3SEZ A;  2IVM A;  1J09 A;  2MAB A;  4NUB A;  2HPM A;  4QPO A;  3S8P A;  2R5Y B;  3VYU B;  1FEX A;  3FK6 A;  3KLN A;  3U1D A;  2GXB A;  3GFJ A;  2FML A;  2FEZ A;  3OYA A;  3K10 A;  1RRJ A;  3EUH A;  2L9S A;  2ESN A;  1K4T A;  1O3Q A;  2W82 A;  4X6A J;  1L3L A;  2ZSH B;  1RZ4 A;  2VKV A;  4ZJZ A;  3P9K A;  3F23 A;  4C3H J;  1LDD A;  5FFX A;  1FBQ A;  2W25 A;  4PFP A;  4A69 C;  4BXU A;  3JW4 A;  4L5E A;  4AYB N;  1U2W A;  1LEA A;  1XSX A;  1HF0 A;  3P9I A;  3DU6 A;  3AL0 B;  3ZMZ A;  4AM3 A;  2X6Y A;  3OYB A;  4WWC A;  3HB9 A;  2ID3 A;  2C6Y A;  3SFZ A;  3RSN A;  2V79 A;  4JQF A;  3E6D A;  1I1S A;  2OBP A;  2YX4 A;  4EAT A;  1ETX A;  2VBX A;  4KN7 X;  2HKO A;  2VJ5 A;  3BG6 A;  5GAD J;  3FXQ A;  2R5Z B;  3A01 B;  1RUO A;  2OZ6 A;  3L2Q A;  1ERD A;  2V1U A;  3CMM A;  1YE9 A;  2PG4 A;  2PMZ N;  5ILU A;  3HOS A;  3SQN A;  3QU3 A;  1P7I A;  3FIS A;  2A61 A;  3ZCO A;  5LRR A;  5IYC J;  3UKG A;  1I27 A;  1S7A A;  4N9I A;  4IHT A;  2CFX A;  5IY5 H;  1KU3 A;  2HOT A;  3BPX A;  3CTA A;  4WF2 A;  2LKX A;  2VLA A;  1IC8 A;  3LA7 A;  4KIC A;  4Y7N J;  3FXO A;  1OYW A;  4CXF A;  3SFI A;  5DD4 A;  3GFI A;  3DTE A;  1BOB A;  4FHT A;  4M3D A;  1NK2 P;  4DGW B;  1RIO H;  1T6S A;  1KON A;  2FNP A;  4ZH4 F;  5L3D A;  3JTH A;  4EV0 A;  1VQ5 I;  3IP4 B;  2QSG X;  1FOY A;  2O7O A;  3P7N A;  4PCQ A;  5J4Y A;  1FP2 A;  3JRD A;  4O6J A;  4QWQ A;  5GPC A;  4UVB A;  5E18 F;  2H09 A;  4YEJ A;  1X4P A;  2MGQ A;  2QWW A;  4BE0 A;  2VE9 A;  1O57 A;  2B9S A;  3BG7 A;  1JXS A;  1NG7 A;  3TO9 A;  2OCE A;  4Y52 J;  2ZXW H;  3D5L A;  2K7L A;  1IUF A;  1BW5 A;  1ZHF A;  3KP3 A;  1HLV A;  3MFK A;  5TRD A;  3KYD B;  1GVD A;  2BV6 A;  1P2F A;  3I56 I;  2JA7 J;  2Q8K A;  1REP C;  1BJZ A;  2VKE A;  1XSV A;  4XID A;  2HU9 A;  1XMK A;  1GLN A;  3HSF A;  4IZZ A;  4KA4 A;  5F08 A;  3A0B C;  1ETK A;  4AU7 A;  5CLS A;  1OPC A;  4LG0 B;  5E1Z B;  3WGG A;  4WCG A;  3HGY A;  1JT6 A;  1Y8R B;  5IYD J;  1IRG A;  2KP6 A;  3MMY B;  1IG7 A;  3PFI A;  4BUP A;  3JRA A;  1R7J A;  1HKT A;  4ZZL A;  1WGX A;  2KIF A;  2XPV A;  3LSJ A;  2MC4 A;  1LDK B;  3J7A Y;  1FLI A;  2UWM A;  1OJL A;  2AHQ A;  2CRG A;  1W4M A;  2IS4 A;  2LDU A;  4BGD A;  1H88 C;  1F1Z A;  1I50 J;  1SMY F;  4PK4 A;  3F8F A;  1I1G A;  4CCM A;  3KYL A;  3CCE I;  2D45 A;  2OC6 A;  4XON A;  3S32 A;  1BI0 A;  3GYH X;  1HSJ A;  5BPI A;  4XSX F;  2KHM A;  3J80 Z;  2P6T A;  5K5Q A;  4RDU A;  2WV1 A;  1LNW A;  1P7J A;  3K4J A;  3S16 J;  4A3J J;  1IW7 F;  2VJJ A;  3JCU C;  3D0S A;  3NAR A;  5J1U A;  4C30 A;  5BQT A;  3LSK A;  1MMN A;  1W5C C;  1MBH A;  2W48 A;  3HRS A;  3FXM A;  3G1M A;  1O4X A;  2E5N A;  1SD5 A;  5ILS A;  2IGO A;  3RPU D;  3AKZ A;  2HVR A;  1NH3 A;  5JHF A;  2DFI A;  6PAX A;  2IA1 A;  4E7Z A;  2GLO A;  2O03 A;  1JUS A;  5D5U B;  1Y1V J;  2QSF X;  3IKV A;  4XOT A;  4ETS A;  2E2I J;  3K2A A;  3GME A;  1E2X A;  1IV6 A;  1AU7 A;  2DDA A;  4IKF A;  3ZXS A;  2EWN A;  3QOP A;  1GXQ A;  3JRB A;  2FF4 A;  2FU4 A;  1YHQ I;  3DBL B;  4BDY A;  1X1D A;  4QPQ A;  1V4R A;  4A6D A;  2X85 A;  2XB0 X;  1PYV A;  4UNO A;  1KU9 A;  3QPL A;  4K2E A;  5L3F A;  3AG2 H;  4BL0 B;  4M6X A;  3TKY A;  3U2R A;  1KA8 A;  2ZXI A;  3HG9 A;  3FM5 A;  2DCE A;  3MKW B;  4WK8 F;  5FB2 A;  1FYK A;  2H1K A;  4IQ4 A;  3M3Y J; 
#chains in the Genus database with same CATH homology
 2CFO A;  2DT6 A;  3OS2 A;  3VYT B;  2R7V A;  2KMU A;  4IX7 A;  1W36 D;  3DPL C;  3H9J A;  1MMA A;  4D1Q A;  2WAF A;  3CF2 A;  3W2W A;  1YX3 A;  3MD2 A;  4CSW A;  2Y0S A;  1ZEL A;  5HOO A;  2MFZ A;  1X1B A;  2HPI A;  2X6W A;  4XOR A;  3SEQ A;  1D0X A;  2V4J C;  3BCB A;  3MKY B;  3MKZ A;  2VIX A;  4LIU A;  1T0F C;  2RNG A;  3K4B A;  1WJA A;  1K6Y A;  4ZC3 A;  3S93 A;  4C2U A;  3QYE A;  1LVK A;  5KHD A;  2CV2 A;  1YX5 A;  3NWS A;  1DQU A;  4BE1 A;  3QYB A;  4KIS A;  3AFH A;  2OV7 A;  4NQW B;  3AL0 C;  3K4K A;  2Z16 A;  2MYS A;  2W7N A;  3ZRG A;  2JVG A;  2LYC A;  2LY2 A;  3OYG A;  3H5N A;  1WJE A;  2KPM A;  3IAM 2;  2BVM A;  4NC8 A;  4OAZ A;  3K4M A;  3HUG B;  3L2W A;  4DBR A;  3PSI A;  4CCN A;  2Z2S B;  3U21 A;  3H9Q A;  2R7Q A;  2X6X A;  3OMY A;  3OYF A;  2VAS A;  2LC2 A;  2K9M A;  3N05 A;  3OYM A;  2X51 A;  4F92 B;  1G59 A;  1UG0 A;  2DXI A;  2KQR A;  2R7S A;  3H9G A;  5CQE A;  2L2O A;  4BDZ A;  4LIT A;  2L9N A;  3KX2 A;  3DTK A;  3EPZ A;  2Z1D A;  4XLA A;  3OOU A;  2KRC A;  3DEE A;  2R7U A;  3I3L A;  3PUB A;  5FRM A;  3PJR A;  4DIQ A;  4E4H A;  2CUZ A;  1S9H A;  4BQN A;  1TT0 A;  2W4S A;  3DQV C;  3HXL A;  5CKT A;  3PSF A;  3PNT A;  4NC7 A;  4BAC A;  2CW8 A;  5HNH A;  4BU2 A;  2LG4 A;  2E5Z A;  4ITV A;  2XF7 A;  3EUA A;  3OIQ A;  4X0G A;  3W2A A;  4P1W A;  3V42 A;  3OYD A;  2VQC A;  4E7K A;  2CS3 A;  1N78 A;  4XL9 A;  1PJR A;  3DKY A;  2VQL A;  4H4K C;  1WJB A;  4B44 A;  3LSM A;  3CJR B;  4CCL A;  4BXF A;  3EUH C;  5LD2 C;  1Z21 A;  3HKZ A;  2UUZ A;  2LOO A;  4XN0 A;  3IUO A;  2KDO A;  2WAD A;  4F91 B;  4HEA 2;  2KL4 A;  4CUG A;  1MW7 A;  2XC7 A;  5FRO A;  2AQE A;  3DU5 A;  3S3M A;  4ZDO A;  2WAQ A;  2E60 A;  4PUS A;  4XKW A;  1OR7 C;  3CJQ B;  4J01 A;  2ZFU A;  4N4O B;  3SDB A;  4FET A;  3HOT A;  1R6R A;  3VDX A;  2HDW A;  4U7B A;  2M4G A;  3IAS 2;  3PNY A;  3VYS B;  1FMV A;  2QKM B;  1BR4 A;  1MNE A;  2GOM A;  2X1D A;  4BQQ A;  2KRH A;  3OYE A;  4GRI A;  1D1B A;  1VZ0 A;  2VQH A;  2W00 A;  4BJ6 C;  1IRX A;  1NG6 A;  1DP3 A;  2VB6 A;  2R7O A;  2XF6 A;  4ZDP A;  1V5F A;  2VJ4 A;  4D9J A;  1WJC A;  2DOA A;  3PFY A;  3OIP A;  4N4N B;  3VYR B;  1X19 A;  4AVZ A;  4C2T A;  4PJL A;  3OYJ A;  3OYL A;  3F9K A;  3BC8 A;  1N77 A;  4CCJ A;  2R7W A;  4HSR A;  1QHH D;  3RTR A;  3K70 C;  3KEY A;  1WJD A;  3H5R A;  1WJ5 A;  2PJR B;  3CES A;  2NOJ B;  2Q2E B;  4XLE A;  4PSX A;  1D0Z A;  2DJI A;  1SAU A;  2CV0 A;  4E7H A;  4XLH A;  4XQF A;  4CA0 A;  1MMD A;  2F4I A;  4DOZ A;  5LFA A;  1T95 A;  2HNH A;  3QOD A;  1D1C A;  2BW3 A;  2ZXH A;  2HVQ A;  1MMG A;  2RQQ A;  2X1E A;  2W1O A;  4HG2 A;  4E7J A;  1V5G A;  1D1A A;  4XNF A;  2QKL B;  2F6C A;  2K9L A;  2WY8 Q;  5HNF A;  3LSH A;  4HRI A;  3HPH A;  2FUG 2;  2VKH A;  4PJM A;  4II3 A;  4YRV A;  2E1M B;  2WB1 A;  1X1A A;  1OLT A;  4OWR B;  3C2H A;  3PL8 A;  2IS6 A;  2UV1 A;  2M7A A;  3H5A A;  5TGT A;  4XKC A;  2K3P A;  2PMZ A;  3UR3 C;  3OY9 A;  2CH0 A;  1HA8 A;  2IXS A;  2V7F A;  4C9Y A;  4KIT B;  2F5V A;  2CMP A;  3CP8 A;  4Y4R A;  4XLC A;  3K4N A;  3I9V 2;  4R79 A;  3H35 A;  3GBG A;  2E1M C;  2KLO A;  3TBI A;  2VL8 A;  2HZD A;  1X1C A;  1D0Y A;  3G2B A;  2M3A A;  3HPG A;  5HLT A;  3RCO A;  3HL2 A;  3E1S A;  2AQF A;  2R4G A;  4PSW A;  2RRE A;  3LMM A;  4Y33 A;  2M4K A;  3A1Y A;  4HNT A;  4BEH B;  3W2V A;  1WFX A;  2LBF A;  1EA3 A;  1DGW Y;  3FDY A;  3SEZ A;  3H0D A;  1J09 A;  2MAB A;  4NUB A;  2HPM A;  4E6K G;  4QPO A;  3S8P A;  3VYU B;  2XF5 A;  3OYI A;  3E0J B;  2A6T A;  2JVH A;  2HVS A;  3OYA A;  1WJF A;  3K10 A;  2KZV A;  2L9S A;  3D5S C;  3BCA A;  2O5R A;  2W82 A;  3M8J A;  2ZSH B;  3SYT A;  3QYF A;  4ZJZ A;  3DPU A;  3OR1 C;  4YEL A;  4BJ5 C;  4U87 A;  2R7R A;  3DTI A;  4PFP A;  4B47 A;  1UAA A;  4PJJ A;  4DJA A;  1E0E A;  4MLO A;  3VSL A;  3DU6 A;  3AL0 B;  4HST A;  2X6Y A;  1P9Q C;  3OYB A;  1FMW A;  2IGK A;  3QOE A;  4ZDL A;  3RSN A;  4JOM A;  4JQF A;  5HVQ C;  3NWT A;  1G8X A;  2JUG A;  4EAT A;  4BE2 A;  5KCM A;  2BVL A;  2VJ5 A;  2ZSI B;  3BG6 A;  2WAE A;  3FHN A;  3L2Q A;  1ERD A;  3LSI A;  4ZTJ A;  3CMM A;  4B48 A;  1YE9 A;  3W3C A;  3HOS A;  1BR2 A;  1LKX A;  4Y3O A;  1N75 A;  4BJT A;  4KT6 A;  3EUK L;  4RM2 A;  3ZCO A;  3OYH A;  3PNV A;  2LH9 A;  3S3N A;  2V6E A;  3RQ4 A;  4AYB A;  2V1N A;  2I8D A;  3OYK A;  3FKJ A;  1UEL B;  3TMO A;  2R7T A;  1AA7 A;  2VLA A;  2M0M A;  4DBQ A;  3OR2 C;  2VXD A;  3S3O A;  3DTE A;  1BOB A;  4DGW B;  3UNG C;  1KON A;  4F93 B;  3TL4 X;  4F3Q A;  3IP4 B;  2LBF B;  3OL4 A;  4KJZ A;  4XMY A;  2MD0 A;  3FBI B;  4ZTF A;  3BLY A;  2BW3 B;  4YEJ A;  1X4P A;  2V26 A;  4BE0 A;  3CZ6 A;  4HPQ A;  2XSJ C;  3OL3 A;  3VWB A;  4E7S A;  3BG7 A;  4XKB A;  1NG7 A;  1Y6I A;  1JI8 A;  1DGR M;  3D5L A;  5KNL A;  4FAS D;  2IS2 A;  2WY7 Q;  4F55 A;  4XLF A;  4LIV A;  4E7L A;  3OS1 A;  3ZGK A;  2PJR A;  4OAY A;  2HU9 A;  1QHG A;  4CH7 A;  1X4O A;  1GLN A;  4IZZ A;  1QU3 A;  3LL7 A;  2IGM A;  4NNJ A;  5CPR B;  4AU7 A;  3OWT A;  4G6T B;  2JSP A;  2LRD A;  3D5R C;  1MND A;  2X1C A;  3HC7 A;  2KP6 A;  3MMY B;  2HQA A;  4BUP A;  4ANJ A;  5FRN A;  4RLQ A;  2MC4 A;  1LDK B;  2VJI A;  4CCO A;  4XN3 A;  3J7A Y;  3L2U A;  2UWM A;  2XAU A;  3C2G A;  2IS4 A;  4BGD A;  3K70 D;  1V5E A;  4XM3 A;  4PK4 A;  2WA0 A;  2V9K A;  4CCM A;  3VSK A;  3KYL A;  2OC6 A;  4XON A;  3S32 A;  4E7I A;  2Q1Z B;  4B43 A;  4XOP A;  4IQJ A;  2LY1 A;  4II2 A;  4BQO A;  2KHM A;  2VQG A;  4RLF A;  3DLA A;  4RMN A;  3ZR8 X;  1W36 C;  2P0W A;  3K4J A;  1Y56 A;  4B3X A;  2LRE A;  3K4L A;  2VJJ A;  1U0J A;  3OYN A;  4C30 A;  3LFU A;  3LSK A;  2JA2 A;  1MMN A;  2GOX B;  3CP2 A;  3ONQ A;  1LFP A;  4BS9 A;  2E5N A;  4F52 A;  2IGO A;  3RPU D;  3AKZ A;  4CCK A;  2L5Q A;  1TZL A;  2HVR A;  3LSG A;  4J00 A;  3DPT A;  5JHF A;  4RM3 A;  4E7Z A;  1Z3Y A;  2VPL A;  3ZQQ A;  4BEH A;  4XR6 A;  2L7K A;  2CW7 A;  3L2V A;  2WBM A;  2R7X A;  1SFK A;  2IS1 A;  4XOT A;  3OS0 A;  2DT7 B;  2BOL A;  2K5C A;  4IKF A;  2CUJ A;  3ZXS A;  4ZYA A;  3K6G A;  2XDV A;  4PFO A;  3SZG A;  2M7B A;  4BDY A;  1X1D A;  4QPQ A;  2A5W A;  1Z7L A;  2OUM A;  3DKX A;  2X85 A;  1PYV A;  3A2K A;  4XKV A;  4LG3 A;  3OYC A;  2CV1 A;  3FBN B;  4BL0 B;  4CZC A;  2ELJ A;  2VXZ A;  4PJN A;  4HNU A;  3A4C A;  2ZXI A;  3HG9 A;  2DCE A;  3MKW B;  2IGN A;  1BR1 A;  3K4C A;  1Z3X A;  3DWL E;  4IQ4 A;  4P5O A;  3L2R A;  5CQG A;  2VKD A;  3M1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...