3D5SC

Crystal structure of efb-c (r131a) / c3d complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
65
structure length
65
Chain Sequence
b'TDATIKKEQKLIQAQNLVREFEKTHTVSAHAKAQKAVNLVSFEYKVKKMVLQERIDNVLKQGLVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C3
publication title Electrostatic contributions drive the interaction between Staphylococcus aureus protein Efb-C and its complement target C3d.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/toxin
total genus 27
structure length 65
sequence length 65
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF12199 efb-c Extracellular fibrinogen binding protein C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1270 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3d5sC00
2GOMA 2WY7Q 3D5SC 2JVHA 3D5RC 2JVGA 2GOXB 2WY8Q 2NOJB
chains in the Genus database with same CATH superfamily
2GA2A 3WU1B 4HX8A 2X6OA 1FP1D 2WB1A 2HFHA 2DMTA 2V9PA 1GXQA 2FF4A 2J5PA 4E7LA 2EZHA 2B9SA 4WXHA 3I3LA 3D5LA 1TTYA 2BY3A 3DLAA 2Y30A 3OWTA 2E2IJ 2PMZA 2WAEA 4LB5A 4N9IA 3E3VA 5DUIA 4BACA 3TBIA 2FNAA 5JR3A 3R6SA 2UZKA 5DCMA 2CQKA 4II3A 2W82A 4N4OB 4RB0A 4BE0A 3HUGB 1VF9A 5D5XB 1FTTA 2EIKH 2OV7A 4FCYA 1X4PA 3BTLA 4MQVA 2KPMA 2G0EA 1DPRA 2E60A 2VUMJ 2JVGA 2DT7B 1XSXA 2CWEA 2QQ9A 4I7HA 1TC3C 2HOEA 1WI9A 2DJNA 4CZCA 3ELKA 4KT6A 2D1VA 1XGSA 4E7IA 5ILSA 2XAGA 3RSNA 2CV1A 2ZJ2A 2K9SA 2XVCA 1J5YA 3OR2C 2GZWA 3H35A 1Z9CA 2XSJC 4XLPF 5ERIA 1SVMA 3W3CA 2LDUA 1A5JA 2P4WA 4G7ZF 2HS5A 2VKVA 1TW3A 4N4NB 2VPLA 2IXSA 3SQNA 2O5RA 3SHFA 4P96A 4KNYA 2RGVA 4CICA 5FB2A 2K4BA 3U1DA 1MNMC 4W97A 1F9NA 1WH5A 4B8XA 2WTEA 5L3BA 4HV6A 1S7EA 4KN7X 4ESBA 1YS7A 1YJNI 4AVZA 3ABUA 1IF1A 2JA2A 2QLZA 1BW6A 4QSHA 4UUSA 1NH3A 4EGYA 1ERDA 3DEEA 4RBOA 1OYWA 3SDGA 4F55A 1IGNA 3L1PA 1SD7A 1Q1HA 3GLLA 3R4KA 4YRVA 1XMKA 1RESA 1KU2A 1P7IA 3U2RA 2VQCA 2FMLA 4HX4A 1PUFB 2L01A 5C4JJ 4HNUA 3OYLA 1YRNA 3DXJF 2E1OA 2JSPA 2K5CA 4H4KC 4W1UA 1B72B 3QRFF 3ZCOA 3UNGC 3RZDJ 2WC2A 4MEXF 1YG2A 1Z3XA 3FX3A 3FXQA 4XOPA 3S14J 2ZMEC 2IPQX 4G7OF 2QZ8A 2ZO4A 1Z3YA 2CUFA 3LSIA 4HF2A 2Q1ZB 5LEKA 2QUFA 2EINH 4XICA 2QSHX 1W36D 4FQGA 3BG7A 3GBGA 4ZDPA 2R7VA 1HA8A 4MHGA 5JI6A 2EZIA 1REPC 4MQ9F 4Q47A 3RI4A 4KIGA 3F6OA 4G7HF 3P5JA 1IXRC 5L3CA 3LA2A 3CUQB 5FROA 1MKMA 4MIMA 1GDTA 1S6LA 1B4AA 2XKOA 4D1QA 4MFEA 2JPBA 5J40A 3S3MA 3K4BA 5EGOA 4HAMA 2Y9ZA 4C3HJ 3KP4A 2Q0OA 4ZH4F 3L2RA 5FRMA 4F3QA 4LD5A 1LFBA 2TRTA 1TQPA 2H6CA 3GTOJ 2G7HA 1MMNA 2M4KA 1Y39A 1QPIA 5J1YA 3CCUI 4ON0A 2X1EA 4JX5A 2VC1A 1IRGA 1XX5A 2F2EA 5LGUA 1TP4A 5IYCJ 3GTKJ 1KYZA 3S1RJ 3JAMK 1O4XA 4PDKA 3IL2A 1BJAA 2VL8A 4XNFA 4CYDA 2CYYA 2EIMH 3HXLA 2ZXIA 1IUYA 2DK8A 3ERMA 4M9XA 2COBA 5C44J 3LFUA 3V42A 3K1MA 1Y1WJ 2H8RA 2OQGA 1JT0A 5KVRA 2VB6A 4XLFA 3SEZA 3BJAA 1X1CA 2NS0A 4X6AJ 2DFFA 2CMPA 3P9KA 5DS9A 1R1TA 3RPQA 3S3NA 1LVKA 3OYFA 1DGWY 2KMUA 2Z5UA 2BHYA 2BXYA 2AS5F 2IA2A 2IVMA 2MH2A 3D0SA 1AA7A 1XGMA 4ZYEA 1SD6A 2LG4A 5AIQA 3JRHA 2BVLA 1G3YA 1MD0A 1D8KA 1T08B 1U9NA 4BYYA 4A3EJ 3KYCB 1HKTA 1U5TB 3CLOA 3KZIC 3FK6A 5BMZA 1TW2A 3RIRA 3DU5A 1LJ9A 4E7ZA 4Y52J 3CJNA 2F5VA 2X6WA 1Z6TA 2MC4A 5CVJA 4CO8A 2RKHA 3PUBA 4GYIA 3CCVI 3M3YJ 4S0HB 3TO7A 3BC8A 1S72I 3IRRA 3ZMUA 1Y56A 1OYIA 3ZQLA 4EM0B 1BL0A 4KDPA 3MKLA 3PSFA 3JR9A 4A3LJ 5LRRA 3K70C 1WRJA 5KAFC 4HQMA 4PK4A 1H88C 5IOYA 2M0CA 1B9NA 3FM3A 5M3MJ 1TLHB 2ZFWA 3BR1A 1YW9A 2F5FA 2P6TA 3K4LA 1MGTA 3VYSB 3ASNH 3BJ6A 2VT2A 2PFBA 2QVOA 4UNOA 3DPUA 1Y0UA 3EPZA 3LWFA 1IW7F 1R1VA 3JRDA 5DUKA 4RS8A 3CLQA 1VFCA 2ISZA 3ZOBA 2QQBA 2Y2ZA 2A07F 1BBYA 4X1EA 1QPMA 1LPQA 3FDYA 1OCPA 5LHIA 1EH8A 2HQRA 4UV8A 2CV2A 3EUHA 2RAEA 4Q5SF 1T2KA 3HKZA 3I55I 2VE8A 3GZ5A 5K5RA 2YS9A 2XKPA 2ETHA 4IHWA 2DBBA 3JRFA 2RQPA 3QQAA 1ZLJA 1WCMJ 3ESWB 1XCVA 3CCRI 4HF1A 1LUJB 4LLLA 4A0XA 3K10A 5E8GA 2A5YB 3V8LA 4Z6YA 2EA4A 1FZPB 2EILH 4M3DA 3GX4X 3J81K 1WVRA 1Z0XA 1SAUA 1XTAA 2H6BA 2MD5A 1A31A 1KZHA 3I59B 1RKWA 5FLVA 1SD5A 3CP2A 1MNDA 5F1RA 4CHUA 1W5TA 5E8IA 3QPHA 3RQIA 1D8JA 3I9V2 2JTVA 2O03A 1AOYA 2Z3YA 1LDJA 2X6XA 2LMDA 3GTPJ 3H36A 3P9CA 1MMDA 3G73A 2KKOA 2QBYB 1ETOA 1R49A 4XN3A 4BGDA 1YFHA 3CTAA 3E6MA 4NQWB 4ANJA 4IHYA 5FO5A 2ME6A 4B09A 3S2WA 5DM6F 5J47A 3FXMA 2DA4A 3CZ6A 1FIAA 1YITI 1ZREA 2OCEA 3H5NA 4JX4A 1LDDA 2L3DA 3LSRA 3REOA 1MBKA 3E5QA 1IDZA 2OAZA 2X9DA 3CCYA 4CH7A 3D5SC 3S3OA 2GA1A 2NRAC 2QQ8A 2ICWG 3K4MA 4NB5A 3ASOH 1J7KA 1OQYA 4HYEA 4KITB 4L0ZB 4XLAA 4XIDA 5D6EA 2F4MB 5HNFA 1FBSA 3J7AO 2DDBA 1KYWA 1MBEA 1PDNC 4HW0A 4OOIA 3TO9A 1F1ZA 3DU6A 3OYGA 2K7LA 1I1GA 4MTEA 1AKHA 2PEXA 5CVUA 4BJTA 3H92A 3H9GA 1X1PA 3AFHA 3C2HA 3EDPA 3E6DA 4QTRA 2W57A 3CF2A 4P55A 1IN5A 3I53A 3PNYA 3OIPA 2EFOA 3VSLA 2HPMA 3S1MJ 2WA0A 2LLKA 3DTEA 1TQIA 2K85A 5LGTA 2R5ZA 1LNWA 1ZG5A 5AONA 1U5TC 3KIOA 4DIQA 1FOKA 1JUMA 4I01A 1YX3A 2EQRA 4FE4A 2O8XA 4BUPA 2KQRA 1WJFA 3BWGA 1X3UA 3M4OJ 4QPQA 2CQXA 2A69F 2ESHA 2I8DA 3E5UA 3EQLF 4IPAA 1QHGA 2RV8A 1WJBA 2LVSA 3HSRA 3QYBA 3K70D 3WTUC 1CQTA 2OTLI 4DZPA 3MKZA 4ZYDA 3LSPA 4G8XA 3X2QH 5H2FC 3IV5A 3O2PE 2NOGA 3QYFA 1VZ0A 4LB6B 1V5EA 3G1LA 3BZ6A 2F5CA 4PGHA 4ESJA 3I0TA 4WWCA 1RETA 2BV6A 1P7JA 5FFXA 1ZTRA 2FSWA 1R6RA 3BQYA 5B1BH 1GHCA 3LL7A 3Q0WA 3FXOA 3WGIA 1N75A 1MDMB 2GIVA 3WU2C 4XN0A 2XF6A 3IH2A 4UB6C 2BHZA 3DWLE 3HBLA 3W2AA 4RAZA 4A3JJ 4I98B 4L9VA 3TDUC 1CF7A 4AWXB 4E7SA 4MLOA 3WTXC 1ZAOA 2LBFB 1E17A 1R7JA 3H3VK 1QU3A 1P4XA 2DA5A 1MJBA 1LEBA 1ULYA 1S5LC 3GWZA 4WXCA 5ICFA 1W7PB 4XKBA 2IW5A 1DPUA 4RGRA 5CQGA 5EF6A 3HG9A 1MMSA 5F0HA 3L2CA 4G12A 1ODDA 2XGEA 4RAGA 1ORKA 1B59A 1QZYA 2RN7A 3JTGA 2CU7A 4B48A 4YFKF 1FP2A 2FMYA 1R4NB 4RA2A 2DAOA 1SFKA 4C2TA 5CLSA 4UXNA 3C2BA 3H0DA 1TWCJ 1WHUA 4IVNA 3ZQIA 4IQJA 1B8IA 2HYGD 1VQOI 2XUBA 2IP2A 3F23A 2K40A 2KL4A 4NNJA 4EJTA 1IN7A 2UUZA 4UV9A 4A3GJ 4OMZA 2VKDA 4JYKA 2NVXJ 3F8NA 5EG0B 1KU7A 2JRTA 5GADJ 1WQ2A 1APLC 3GTLJ 1XC5A 5ILUA 4EM1A 3T8TA 3PJRA 2M3AA 3BPXA 4BU2A 4U0YA 3ULQB 5JHUA 2DA3A 1T6SA 1I27A 1O7FA 2FX0A 2JSCA 2KIQA 3KE2A 3RYRA 3HRSA 2O8KA 3I71A 4B43A 2X85A 3AG2H 1OCOH 4RGXA 1U3EM 2DK5A 2GAUA 2KJCA 2NVYJ 4CYCB 2CUEA 4IHTA 1X1BA 3NQOA 5BOXA 3CCJI 1ZRCA 3IHUA 1A35A 3HRTA 2STTA 3WGGA 5BPDA 4FE7A 3ZR8X 2A5WA 1QA6A 5HS8A 3OSFA 2XAFA 3MKYB 4I99C 1WJDA 3BR6A 5HS9A 3C1DA 1T33A 2R7FA 2VQLA 1FBUA 2L4MA 4BXFA 3HDDA 3GTGJ 1SFXA 2CO5A 2G9WA 2V1XA 3OSGA 2IRFG 2R0QC 4ZYAA 3JSOA 5KK1A 2ZMEB 1X3WB 3ZQ7A 3BG3A 4L9NA 1MJ9A 2Y75A 3NRVA 5IT9K 1IXCA 1NG6A 2GWRA 2HOTA 2WV0A 2P0WA 1JKRC 1YIOA 4V2GA 4FT8A 3IKTA 2IA0A 3PNTA 5FLXZ 1MBFA 1UMQA 1R9TJ 2HWVA 2EB7A 3GVAA 3I54A 2Y0MA 1XSDA 1QGPA 2F4IA 4EJUA 5EJCA 1LKXA 4JOMA 1QO0D 2RREA 2I10A 5J8CA 2DU9A 3VYRB 4HF0A 1RUOA 2Y48A 4Y17A 5CJ9A 3J80Z 1IV6A 3BOQA 1H8AC 2HPIA 5FKMA 5LHGA 2A05A 5E18F 2PJRB 4R8HA 1VTNC 2M5WA 2IGKA 1PUFA 3KETA 3WTSC 5HDNA 2VQGA 2VE9A 1GUUA 3KP3A 1B72A 2JUCA 2C6YA 2EH3A 2VT3A 1RPWA 1XCBA 2MC3A 1K61A 1HDPA 2BZTA 4E70A 2WAQA 1FMWA 4BKXA 3G3ZA 1K83J 3EUKL 2LF7A 4U0WA 2EFWA 5D5UB 5M5XJ 3QODA 4ENKA 1XPXA 1V5FA 3A02A 1TT0A 2QEXI 3ML6A 2LR8A 4N0BA 1TWAJ 2EZKA 4AIDA 3FHZA 2MBFA 1SFEA 2V9VA 3CESA 5CKTA 1MH4A 4DBQA 2R7WA 2FBIA 1IDYA 4V19K 3F8BA 5F08A 3PUFA 1FOXA 3E7LA 3QWLA 1F43A 3CUQA 2XPVA 3TP3A 1IN6A 1ETKA 2CW8A 3BQZA 1QHHD 2JJ7A 3F8CA 3LOCA 2HI3A 3OS1A 4KIFA 2IS1A 2PQ8A 2MLKA 2CJJA 2JT1A 2VBYA 3HPGA 1KGSA 4HG2A 5F0FA 4BY7J 2GXGA 3E1SA 2E2JJ 2DFHA 2BW3B 2EV0A 3GUDA 3U21A 1RNLA 5DM7F 3VDXA 4HQEA 5D6FA 1GV5A 2XV4S 3T1BA 2KRFA 3TGNA 3IWFA 1IRFA 3C2GA 2XAQA 3F3XA 3FIWA 2Q2EB 4R79A 3OS2A 3BY6A 4PZJA 1R00A 1Z21A 2LP0A 2V1NA 2HQNA 1T38A 2ZFUA 2BY2A 1LB2A 4CXFA 1F5TA 1SC7A 2HXIA 3OL4A 5JFRA 2ZBKA 1BN5A 2XPUA 4NHJA 3CCLI 3OOUA 1JT6A 2DFIA 3BTJA 2M30A 1RI7A 1W5CC 3FISA 2CS3A 3VOEA 5E1WA 4RMNA 4BL0B 1SFUA 3I4PA 2PMHA 1AHDP 3AG4H 3OS0A 2HEOA 1K4SA 2ISYA 3FXJA 3R61A 1MH3A 4DJAA 1X2MA 3GTQJ 2K4JA 1R23A 4MNUA 4D9JA 1EH6A 3HEFA 2ZNZA 5K5QA 2KT0A 3SFIA 2E5ZA 2HTJA 5LHHA 2X48A 5E1ZB 1U6GA 4LITA 4NBQA 1RR8C 1DU6A 3M1EA 2K9NA 5H20A 1A6IA 4D0PA 3LAJA 4D7MA 4M9SA 3TKYA 5CVVA 5C3EJ 1X19A 4M6XA 1S9HA 3A2KA 3HOTA 4KMUX 3NARA 1YX5A 5GP9A 1T98A 3HSEA 2HOSA 2CQNA 3LNQA 4CCOA 4OINF 1U5TA 4U0VA 3VWBA 4UVCA 5FKOA 3SZPA 1J75A 2GXBA 2LFBA 2LTPA 4M3BA 5M5YJ 3AG1H 4R1HA 2R5YB 4A3MJ 1I6XA 3GW2A 3BG5A 3F8FA 3FM5A 3OYEA 1MJAA 2E7WA 4M72A 2XASA 3TW6A 3MD2A 3QAHA 2AXTC 1M1EB 3ECHA 1LEAA 4IOCF 3I58A 2JPCA 2TDXA 3KEYA 3RDIA 2DA7A 5DEQA 2RVCA 3F6VA 1H89C 2JZYA 5IP6A 3L2QA 3A01B 3T0YA 3BZCA 3UR3C 3S32A 3R60A 2JK3A 3PNVA 1ZRFA 1LE8A 1W0UA 1PP7U 3I4MJ 3B02A 1G3TA 5BQTA 4QIWN 3N4MA 2ELKA 3H3ZA 4AYBA 3ROUA 2VJJA 4BDZA 2BE5F 1Y6IA 4MFDA 4Q4ZF 2GOMA 3MKWB 1R5GA 2O0YA 2HQ5A 3B6CA 4LK1F 1RKTA 2O9LA 1OR7C 3H9QA 3F21A 4BS9A 1IUFA 4IF4A 5KNLA 5HDKA 1BR2A 3HHHA 2R93J 4BXUA 4EJVA 5D5WB 2V79A 4DOZA 4LLNA 4C2MJ 3VEPA 2K86A 4DBRA 5DCMB 2L5QA 1BA5A 1J0RA 1JGSA 3HYIA 5K7FA 5M5WJ 3RZOJ 2BGCA 4JK1X 1MSEC 2CQ7A 2DQRA 3RTRA 1UB9A 1N77A 1VQ5I 2A6HF 4OIRF 1Y1VJ 2VI6A 2P5KA 2V6CA 3FF5A 1I50J 5E79C 2OC6A 4BE2A 4CCNA 3HOXJ 2EPFA 1W7PD 3DV8A 2R7XA 1PUEE 5K5OA 5HODA 2MSYA 4B47A 2M2EA 2HZTA 4Z2YA 4E7HA 1XDUA 3GF2A 5CVIA 2TCTA 2VJ5A 3I59A 1ETYA 2QSFX 5L3DA 3FXLA 3GYHX 1Z6RA 3L9FA 3K4NA 4XRFA 4I0AA 2HDWA 3V8JA 3IKVA 1E2XA 3E0JB 1HW1A 5B3SH 3BCAA 4HX7A 2BY1A 3O6BB 3DKYA 5L3GA 2WAFA 3O8HA 4LG0A 2QBYA 3DBLB 3K4CA 3P7NA 2M45A 4ESFA 1JKOC 1K4TA 4S05A 1H9TA 2F6CA 1BOAA 4ASNA 1QVTA 1YW8A 2JA7J 4KUMA 4IKFA 2BXZA 3G1OA 1ITYA 1BI0A 2WADA 3LSKA 3M07A 3HGYA 4UUSB 2Y0SN 3LAPA 3GFJA 4KMFA 4FISA 3Q9SA 1FY7A 3G2BA 3JTHA 2W1OA 4MO7A 5F6FA 5E3LA 3WTZA 4DYQA 4UVAA 4A3FJ 3CDLA 3MZ8A 2CW0F 2OCCH 5K7HA 4ABZA 3E6BA 1JKQC 4BQQA 1TWFJ 1J2XA 3W2VA 5GPCA 2D2WA 4XKWA 1R1UA 4GO1A 3OOPA 4KYWA 4Y4RA 4BAYA 1OYYA 2A6TA 4O5VA 4Y15A 3GMEA 2DCEA 4C9YA 5GAHJ 2W85A 2HDDA 1HXDA 5L3EA 1R22A 3RKQA 2PJPA 2BVMA 2ELJA 1JE8A 1J59A 5J1RA 1SMYF 3WHBA 4XLHA 2J5OA 3OYMA 1YO5C 3PIPF 3G71I 4C2UA 2GLOA 3RCOA 9ANTA 2KRHA 4CDGA 2PN6A 4XSZF 1XGOA 1EF4A 2UXXA 3OYAA 3BZKA 3PIOF 4RB1A 3MVPA 3LSHA 3DTIA 2RNGA 2WB1N 2EFQA 4ENMA 2P81A 3VPRA 5EGOB 3HOUJ 3Q0VA 4BXXJ 3QPTA 1GVDA 4DGWB 4J01A 3QU3A 3DKWA 1YTYA 4B4CA 2BOLA 1T0FC 1ZELA 3ZQGA 3PO3J 1DDNA 2PMZN 4CCKA 1O3SA 2L02A 3H5RA 1U8BA 1K6OA 4AIHA 1U8RA 1G6NA 1ZARA 4EVIA 2DTRA 4ETSA 2DT6A 4A12A 3W6VA 2A3SA 5K1YA 1R36A 4A93J 2HTSA 1P9QC 3PFIA 4L18B 2OZUA 1AU7A 1JHHA 4RDUA 2EFNA 1RC9A 2HVSA 1ZGJA 2LY2A 2ZB9A 3HTUA 1W1WE 4PJJA 1QVUA 5EZHA 1MDMA 3K0LA 3H0GJ 1USSA 3C7JA 4HDUA 4F7ZA 3J7YJ 2IT0A 4II2A 1D3YA 1BI3A 1I3AA 1SANA 3K4KA 2OQRA 4JX6A 1UELB 1YE9A 2RQQA 3S16J 2XROA 2LBFA 3QOEA 1VQ4I 2L9SA 4B44A 5HLTA 4A6DA 1ENHA 2NS7A 1NHAA 2QQAA 3SFZA 2DA6A 2NNNA 4E7KA 3BDDA 4IRHA 4QWQA 2L7ZA 2GXAA 1QNTA 2EJRA 3GFIA 3GZNB 5BS6A 4KICA 3OYKA 1C0WA 2KFDA 4OWRB 3ZRGA 2QSGX 3TP0A 1HOMA 4RAYA 2XAUA 3SXYA 3F0CA 5IPAA 3OV8A 2D45A 4BH9A 2DI3A 3ZQQA 3CC2I 2IS6A 1NK3P 2OD5A 3BR3A 1FIPA 2BYVE 1FYKA 2IGOA 2IA1A 1WSUA 5F04A 2NAZA 2H8WA 1XDSA 2H94A 2V26A 4A3KJ 3CJQB 3KPHA 2DOAA 1JI8A 5D8LB 3VFZA 5EG0A 2VODA 3TO6A 1STZA 2FA5A 1IV8A 4B3XA 2YX7A 1UHMA 3H3UA 2AHQA 1FSHA 1FOYA 3MZYA 4AU7A 4FASD 3S2HJ 1FX7A 5LGNA 2DMPA 2VIXA 4EJOA 5A2QK 4FX4A 1IRZA 2QKMB 3HOVJ 4YELA 2JA8J 2Y9YA 3OL3A 2R7QA 2HYFA 3SZTA 1USTA 5EZGA 3VODA 5ICEA 1OCRH 1RZ4A 2NYXA 1D1BA 3ZN0A 1J9IA 4BDYA 3OIOA 2H1LA 1GXPA 3VYUB 2Z1DA 4HEA2 1U9OA 4LG3A 5DD8A 4DW6A 2VBXA 3MQ0A 4B3AA 4IHSA 2HQAA 4ZDOA 3FHNA 1Z7LA 1A04A 1QQIA 3WU0A 3I5UA 5TRDA 3QU6A 2ZMEA 4IX7A 1R5HA 4C3JJ 1HF0A 2ECBA 2L54A 3LSJA 4RM2A 4ZZDA 3N05A 2R92J 1HKSA 2IGNA 3HOWJ 3LA7A 4BEHA 3HSFA 1WWXA 4ZJZA 1F4KA 1HSJA 2ZJPF 3H1CA 2PI0A 3EYYA 2HYJA 5D4RA 2DOEA 5L3FA 3K2ZA 3FBNB 1B6AA 3L2WA 1XS9A 1BI2A 4G9YA 1VQ9I 5GTIC 3BP8A 4ZDLA 2XC7A 4IHVA 5FD5A 5TGTA 3TOBA 2BBYA 2IBDA 2JUGA 3WE2A 2L7MP 1WJAA 3QOPA 3MWMA 2BEOA 2L7FP 2CSOA 2XRNA 2E36A 3M7GA 1ZQ3P 2DW4A 5H6QA 1IZ1A 2PJRA 2FEZA 1S8NA 2XPWA 3SDBA 1UG0A 4F92B 3QYEA 3IAS2 3WE3A 2D1HA 1ONVA 1E3PA 3WTVC 3OYIA 3S15J 3R0AA 2ZSHB 2ELHA 4XL9A 4ZZLA 4IJAA 3RKXA 1YS6A 4MEYF 3DEUA 2KIFA 2KJBA 5D8KB 3FXUA 3V4GA 1L0OC 2X6YA 5BPIA 3B73A 1QRYA 4A5NA 2OTJI 3C3WA 2EIJH 3A4CA 2IAIA 4G6QA 1ZR4A 1UFMA 2F48A 3K4JA 2MD0A 1I5ZA 1T95A 3M9AA 3OYCA 2LREA 2DA1A 4XMYA 5F27A 4D7NA 2HKOA 2NVTJ 4EV0A 2MA3A 2ID6A 2IJLA 2DQLA 2V9KA 3CMYA 1GVJA 3E5XA 1D0YA 2M1BA 2DODA 3K6GA 4A6EA 4G94A 1AKHB 3A0HC 3K1NA 3DFGA 3JSPA 1VQMI 3ZP5A 3CJTB 1FYLA 1TWGJ 2R7ZJ 2YR2A 2CV0A 3WGHA 3HUGA 2AQFA 3OYJA 5IT9Z 1G3SA 2NVQJ 1ZK8A 2F5DA 1Y8QB 2HNHA 3AKZA 3LQRA 2A6EF 2BW3A 3BROA 3K9TA 1SFOJ 1UJ8A 2DA2A 4WX9A 5FKLA 4AUXA 2HR3A 4Y3OA 4L0YB 1F36A 2Q2EA 4KN4X 1TNSA 2N8GA 3OMYA 3JRIA 3M1CA 4L9TA 1S29A 5LD2C 3HM5A 2UWMA 2K3FA 4NC6A 2LC2A 4XKVA 3WTWC 5LBQA 1HC8A 4Q48A 1H0MA 3GZ6A 2A61A 3S93A 4KJZA 5E3NA 3HKZN 4L5EA 3MZHA 2WY7Q 4LIVA 2XAHA 2D5VA 4HBLA 2HDCA 4P9UA 3HB9A 3ERED 4GDFA 3EETA 1P2FA 3FXKA 2K27A 5EEGA 2KDZA 5JVGF 3AAFA 2L9VA 3LQQA 4A2UA 1WH7A 2R3SA 2RNJA 1KA8A 3CD6I 3RJPA 4CCMA 1KQ9A 2RC4A 3DKXA 1WGXA 5BNGA 1IJWC 3VB2A 4BQOA 4OAYA 5FD6A 1BJZA 3FZVA 3J7AY 3AL0B 1MZBA 1TNTA 3FKIJ 2KRCA 3EUAA 3ABLH 1CF7B 2QYOA 4RLQA 2VONA 2EV6A 3E97A 4IO9F 2W48A 2FXAA 3CCEI 1UHWA 2OZ6A 4BBSJ 2WY8Q 2X0LA 3EUHC 4LFUA 2Z9OA 3PO2J 3IP4B 5GAEJ 3F9KA 3TQNA 4MTDA 1P4AA 3CP8A 1ZG1A 4HSTA 1IXSB 3M8FA 4Y7NJ 3IWZA 4AC0A 2HVRA 1S7OA 2LY9A 2X1CA 2XDVA 2R5YA 3QPLA 3K7AJ 3GFLA 3BR0A 1AWCA 3ZQCA 2QKLB 3WHCA 2VLAA 5HLIA 2DN0A 4CCJA 4GGGA 2NXNB 3IH4A 3H5AA 1K78B 1WJEA 2LF8A 4O3MA 2R4GA 2FOKA 2WV1A 2DXIA 2M7BA 1HKQA 4XRSA 1MIJA 3IUOA 2ZXWH 3UKGA 3A01A 1ZGWA 1FOWA 3MMYB 5E1XA 2NOJB 4H0EA 3DPTA 4UUVA 3S1QJ 3JRGA 5B66C 3KP2A 2DOFA 2HXOA 2L2OA 2UXNA 3ZMTA 5EYRA 1B8IB 2OA4A 3ISPA 1G3WA 4HZFA 3LA3A 4PJ0C 3QP6A 2QA4I 2V1DA 4OAZA 1DUXC 3HOSA 2CFOA 5E3MA 4IXAA 4A3CJ 2XB0X 3CCMI 2X1DA 1ZYRF 1D1AA 1WJCA 4I09A 3V7SA 1D0ZA 1OMIA 1IRXA 2OUMA 4G6DA 2M0MA 2LY1A 2NS8A 3OYDA 3CC7I 3V8KA 4G6TB 2QWWA 2ZC2A 1IG7A 2E2HJ 3HIFA 3FMQA 1KU3A 3W2WA 4EGZA 2M7AA 1A6QA 1FWZA 2QF7A 5LLQA 3T8RA 5IOZA 5D4SA 2M8GX 3GLXA 4L9JA 4CZZA 1IN8A 4YIFA 2ECCA 4IEJA 3KLOA 1I6HJ 2DPDA 1MW7A 1O3TA 4FHTA 3ZMSA 1WJ5A 1JXSA 2MW8A 3IH3A 3FK7A 2W4SA 4HPQA 1MBJA 5JHFA 2OU2A 3FXRA 3IC7A 2CG4A 4XRSG 1U2WA 1X58A 3TMOA 2FOWA 2E71A 4BQNA 3OYNA 2YPRA 2CW7A 4PFPA 4WXDA 4F93B 2YU9J 2E35A 4UVBA 3NWSA 4LOCA 4IRIA 4LMYA 4JP0A 1LFPA 2EA2A 2JWTA 3F8MA 5HDGA 3ECOA 1XG1A 1ETWA 3S8PA 2DO7A 2OJED 3K1PA 2E1CA 4AIKA 4PSWA 5LEJA 2XHKA 3BT9A 1BW5A 2KIUA 2XF7A 5J6XA 1IO2A 3VYTB 5GAGJ 1I1SA 3A03A 4M3GA 2IGMA 1YI2I 3NEUA 1I3QJ 4YIIA 4QLCU 4XLEA 3WG7H 2VJIA 3S1NJ 4UB8C 4RLFA 2E5NA 1MNEA 3CDIA 2CGPA 3BR5A 2HZDA 4XRMA 4U87A 3MN2A 5DCFA 4HOBA 4DZJA 3CO6C 1JUSA 3F22A 2L4AA 3CO7C 2PMUA 1KQ8A 2OPTA 2CFXA 4HA8A 5HLHA 1BM9A 5KCMA 1KQ0A 1FBQA 2VOOA 2LYCA 5J1UA 4BHBA 5LFAA 4U7BA 5E17F 2X51A 2YU3A 2XIGA 3OR1C 1ZKGA 1L3LA 2E19A 2IS2A 2K9MA 3AL0C 4LGWA 5C4XJ 2W00A 2E1NA 2ZKZA 2ESNA 3JAMZ 4A69C 1DQUA 4GRIA 3J7ZI 4GXOA 2XSDC 1SVOA 5IP7J 2W84A 3CC4I 3GTMJ 1J09A 5LRSA 5CPRB 2VPRA 2PLYA 2I5UA 2XAJA 4CUGA 4J00A 1N78A 3ONQA 4LJZF 2E1MB 4P1WA 1TWHJ 4BJ6C 2VBWA 1G59A 2LNBA 5HLGA 1G2HA 1BC7C 4C3IJ 1VQNI 4GCVA 2DJIA 1OPCA 3BG9A 2B7EA 3M8JA 2KDOA 3RPUD 2M9HA 3KP6A 1UHSA 5IY5H 1O57A 1H9GA 1X1DA 3I56I 1UAAA 4WK8F 2V6EA 1D5YA 4KA4A 1HLVA 1MBHA 1ZLKA 1BI1A 2H09A 3DBRB 4A3DJ 4YIRX 1Y8RB 3GEZA 2FBKA 1VQKI 2DMQA 5ED4A 4B1RA 4YFNF 4XM3A 1V54H 3TL4X 1JTYA 1WZ2A 1TZLA 4JBAA 4RGSA 3WODF 4DQ2A 4ZYHA 5FRNA 1PJRA 1K6YA 1UG2A 1OCCH 4KFCA 1NG7A 4HRIA 1LQ1A 2LKXA 2R7SA 4BE1A 2DPUA 2ME0A 4XK4A 4A5MA 2RDPA 4NQWA 1Z77A 2Y69H 2JN6A 1XMAA 4WCGA 3KYLA 3KZZA 2HOAA 2L9RA 2VKHA 4Y13A 4F52A 5EDNA 1ZR2A 4I6ZA 1ACIA 1X3ZB 4CGZA 2JRMA 1YJWI 2V1UA 3WG9A 3KYDB 3S17J 3V7RA 2YX4A 1QBJA 4HLYA 1S7AA 2VC0A 3OYHA 2XGCA 3L00A 1D0XA 4QPOA 2CRGA 3JRBA 1RUNA 1YRNB 1BIAA 3FBIB 5ICCA 1FTZA 2DDAA 1DU0A 2NVUB 4PUSA 2W7NA 1VQ7I 4IL6C 3SYTA 3HC7A 1EA3A 2UV1A 1FNNA 1YYVA 3RQ4A 5TJJA 4ITVA 5JLXA 2R7TA 3TDZC 4M6YA 3VSKA 1B9MA 3DCFA 3M8EA 2ZCWA 2KZVA 4BBRJ 4EQQA 2MLGA 1NK2P 3HRMA 3FWEA 5FJ8J 5JLWA 2L0KA 2PG4A 3CQZJ 2ZJQF 1WFXA 2EWNA 2WAQN 4CCLA 2L9NA 3Q5FA 4X0GA 2HU9A 2EBIA 3KEOA 4M71A 4XR6A 2VOPA 3DLLF 2K9QA 3J81Z 1LVAA 3AG3H 3JCUC 2P5LC 5D5VB 2LH9A 1WI3A 2M8EA 2DMUA 1LE8B 1Z91A 3T5XA 5IYBJ 3DEWA 1ZRDA 2FD5A 4HNVA 3BPVA 3H9JA 3GCMA 3KP5A 4KT5C 4M9ZA 5KAIC 1K79A 3MCZA 4AVPA 1R5ID 2HVQA 3P9IA 4DYRA 2AXLA 1OKRA 3SEQA 2EZLA 3I64A 1OCTC 2KHMA 5IYDJ 1VI0A 4FTHA 2LD5A 1Q1VA 2GQQA 2VASA 2JQ7A 4U7DA 5HVQC 4E7JA 1VNDA 3ABKH 2VXDA 2W24A 3V7CA 3CCSI 4BHPA 5TISC 3PFYA 3O3KA 3TEDA 4PGGA 1XB4A 5DD4A 5IT3A 3BCBA 3D5RC 3DBHB 4PJNA 5J8FA 1ZH5A 3CF5F 5FLMJ 5GPAA 1SMTA 1OLTA 3F72A 2KZGA 3HZJA 3WTTC 1E3OC 2FBHA 4U88A 3A1YA 2KLOA 5HOOA 3ZN1A 4CA0A 2PBIA 2XF5A 3CJRB 5FKKA 1N25A 2E34A 2QENA 3N97A 3GTJJ 3CUQC 2K3PA 5EEHA 1Z05A 1IC8A 4HNTA 3BG6A 4RM3A 3PM1A 1TQMA 1OFCX 2E1MC 2GM4A 2CUJA 2FQ4A 2QM3A 1RR7A 3RPUA 4FX0A 3RKYA 1HDDC 2HGCA 1BR4A 4RGUA 1EH7A 4IHXA 1SD4A 4UUTA 1W7PA 3HPHA 4KIBA 1EJ9A 1DGRM 3S2DJ 5ILVA 2M87A 1KU9A 4YG2F 2ZJRF 4LG0B 3HL2A 4HV5A 2B63J 3HHGA 5FFZA 3LMMA 1YJ9I 4XONA 1QZEA 5FKNA 5J3LA 3CMMA 4PCQA 1W4MA 4ZTJA 1XSVA 4L5IA 1FC3A 4GFBA 4HSRA 3BLYA 3GO5A 1BOBA 3GFMA 1D1CA 5A2QZ 4YFXF 2XGXA 3JREA 2XRLA 1MBGA 3CDHA 1SVLA 3NAUA 1R71A 4BQAA 4PJMA 1T56A 1HW2A 3KP7A 3NWTA 3HTSB 3DQVC 1WPKA 1Z7UA 4ENNA 2P5VA 5DV5A 2P7CB 2L7KA 1QZZA 2H1KA 5F0CA 4A0YA 4ZTFA 1UZCA 1ON2A 2FUG2 3Q9VA 3L7WA 1Z1DA 1W0TA 2R7DA 2MH9A 4D5CA 4ZYGA 4XSXF 4AM3A 5AIPA 5F64A 1ON1A 5H6RA 3E6CC 1MSFC 2Q8KA 3ZPLA 1X1AA 3FMRA 3W6KB 1FT9A 2EFPA 4Y33A 1FJLA 3ZMZA 2CQQA 6PAXA 5ICGA 4RB2C 3MEXA 4CYCA 1V55H 4AD9A 5JVTA 1KONA 3G6EI 1POGA 3SZGA 2Z16A 2LK2A 1B1BA 5CVRA 5IP9J 3BR2A 2COMA 2LSOA 2FNPA 1O3QA 1FMVA 4BHCA 4K2EA 4EEFG 3Q3SA 5DDGA 5HNHA 4J19A 1ZN2A 4AYBN 1VQ8I 4UHTA 4KISA 4DYCA 4I0BA 2DT5A 4ZC3A 3RKWA 3OIQA 4C30A 2LKSA 5J4VA 2ADUA 2G7UA 4IQ4A 2K02A 2X4HA 3FKJA 2IEKA 2KP6A 4HLXA 4ENJA 1R58A 3L09A 3WTYC 3DPLC 4P9FA 3G1MA 1V3FA 2M34A 3ZMDA 2WBMA 3ZQHA 2Z2SB 3TOAA 3OY9A 2QCOA 2XGDA 3A0BC 1G4DA 1P4WA 2XB5A 4P5OA 1ETXA 2R7RA 1LDKB 4RB3C 2JMWA 2FJ1A 2DLLA 1YIJI 2DFEA 2V7FA 5CQEA 3ABMH 1A36A 1ZGAA 1P6RA 4PSXA 1XD7A 1RIOH 1JTXA 2DYRH 2O7OA 1SEUA 5EEAA 5M3FJ 1HBXG 2VBZA 2P8TA 2ZNYA 1S3JA 5CYVA 4OIOF 2MYSA 3SJMA 3COAC 4LLGF 1P92A 4XLCA 2F4OB 2STWA 1PYVA 1OISA 3CUOA 3LFKA 4OIPF 2F5EA 4NDLA 4BNCA 1X2NA 4OU0A 1D5VA 4NC7A 5K7ZA 4EM2A 2LRDA 2E7XA 2Z33A 1OR7A 1TT5B 4XOTA 4E4HA 1YHQI 2O6GE 4EJWA 4A3BJ 2LOOA 2FE3A 4MGRA 5B1AH 4IZZA 3HJEA 1O3RA 3PQKA 1DP3A 4AIJA 4RAFA 1Y0NA 2QGUA 4F91B 2VJ4A 3LSTA 2CH0A 3OYBA 1TBXA 5B5EC 1SAXA 3G4SI 1FYMA 1O7LA 1K78A 4XKCA 1K7AA 4NUBA 5GTHC 4EMSA 2MFZA 1W5SA 5DYMA 2OF7A 4M3FA 5E20A 4PJLA 4M74A 1TL8A 1FPQA 3RYPA 3EYIA 3U1KA 4BJ5C 2GOXB 1VQLI 3HOYJ 4YEJA 2GIZA 2K9LA 4GYGA 1E0EA 1OJLA 1JHFA 2EK5A 2P6SA 3JW4A 4FETA 1ETQA 4LIUA 2P7VB 1WKMA 1GT0C 1IAWA 4IRGA 3ABTA 1ZHFA 1YLFA 4N9HA 2CUZA 3MFKA 3O8GA 2O3FA 3MAJA 4I02A 1R4MB 4I2OA 3HRUA 1LFUP 4I76A 1GLNA 4O6JA 4UY8I 1HW5A 2BY0A 3KEQA 3W6JB 3ZMVA 4E6KG 2R5ZB 1Z67A 3ZQFA 3IAM2 1UCRA 3QP5A 4M73A 4TV7A 1NTCA 4D5FA 2YSRA 2MG4A 1FSEA 2OBPA 1V4RA 3K2AA 1U78A 2V4JC 4OMYA 2FRHA 4S04A 1VQPI 3DP7A 2W25A 3BJOA 3B6AA 1HCRA 1CGPA 4WF2A 1RRJA 2DYSH 2FQ3A 1VQ6I 4LK0F 3HOZJ 2KISA 2HKXA 2R7OA 4HDVA 3KFWX 1PP8F 2PX9A 1EV7A 2M4GA 1X4OA 3PQJA 3ZXSA 5F1JA 1JJ8C 4EATA 1MMAA 2B0LA 1JGGA 1I39A 3K69A 1FEXA 2NNYA 1YQAA 1XN7A 4PFOA 3L2UA 1XGNA 5FGMA 2R7UA 2JA6J 1HQCA 2Y31A 4XBFA 3CMAI 2H27A 1ETVA 3L2VA 2A68F 3I4NJ 2AQEA 4A3IJ 4BEHB 4IOAF 3BTIA 1HSTA 3JRCA 2EV5A 3KLNA 2IS4A 2VQHA 2Y0SA 1PVEA 2JA5J 3HGGA 3JRAA 1ZG3A 1BR1A 3PL8A 2GBYA 1T8IA 2AO9A 2ZSIB 1BC8C 2VXZA 3DF8A 1YOVB 3C18A 4L5JA 1DP7P 2DTZA 3ZGKA 1W36C 3LSGA 1GV2A 4M3EA 5E3OA 5DTDA 3U9GA 3CMEI 4XLNF 1JJ6C 2VKEA 2O61A 3KCCA 4CSWA 4XORA 4BY1J 2ZXJA 3FMSA 5KHDA 3IRQA 2MGQA 4M6VA 3LSMA 2ZXHA 2ID3A 2Z99A 4V2FA 1T0FA 5HS7A 3CCQI 3KX2A 1JKPC 2MABA 1OCZH 3TW7A 2VN2A 4NC8A 3D1NI 5FLXK 1IN4A 1MMGA 2FU4A 3Q0UA 1G8XA 3QPSA 3DTKA 1EKEA 2ACJA 4DNCA 1T39A 3GXOA 1U0JA 2JVHA 4XQFA 5J4YA 3BTCA 1BIBA 2YUSA 1E3HA 1JUPA 1YW7A 3KZYA 3R0JA 4OIQF 2WWYA 3J80K 1FLIA 2KIMA 2LKPA 1V5GA 3PSIA 1XMXA 2DMNA 4A0ZA 4JQFA
chains in the Genus database with same CATH topology
2DJIA 5CQGA 3HG9A 3M8JA 2KDOA 3RPUD 4II2A 2WB1A 1X1DA 3K4KA 4B48A 1UELB 1YE9A 2RQQA 4E7LA 1UAAA 2V6EA 2LBFA 3QOEA 3I3LA 2L9SA 3D5LA 4B44A 4C2TA 1SFKA 3DLAA 5HLTA 3H0DA 3OWTA 2PMZA 2WAEA 4XM3A 3TL4X 4IQJA 1TZLA 4BACA 3TBIA 4BE0A 4E7KA 4II3A 2W82A 4N4OB 3HUGB 2KL4A 4NNJA 5FRNA 2UUZA 2VKDA 1PJRA 2OV7A 1K6YA 3OYKA 1NG7A 4HRIA 4OWRB 3ZRGA 1X4PA 3PJRA 2R7SA 4BE1A 2M3AA 2KPMA 4BU2A 2E60A 2XAUA 2JVGA 2DT7B 3ZQQA 4B43A 4CZCA 2IS6A 3KYLA 2X85A 2VKHA 4KT6A 4F52A 4E7IA 3RSNA 2IGOA 2CV1A 3OR2C 2V26A 3H35A 2XSJC 3CJQB 3W3CA 1X1BA 2DOAA 1JI8A 3OYHA 1D0XA 4B3XA 4N4NB 2VPLA 2IXSA 2O5RA 3ZR8X 2A5WA 4QPOA 4AU7A 4FASD 3MKYB 1WJDA 2VQLA 2VIXA 4BXFA 3FBIB 2QKMB 4PUSA 2W7NA 3SYTA 3HC7A 1EA3A 2UV1A 4YELA 3OL3A 4ZYAA 3RQ4A 4AVZA 2JA2A 2R7QA 4ITVA 1ERDA 3DEEA 2R7TA 3VSKA 2KZVA 4F55A 1NG6A 4YRVA 1D1BA 4BDYA 2P0WA 1WFXA 3VYUB 4CCLA 2L9NA 2Z1DA 4HEA2 4X0GA 2HU9A 2VQCA 4LG3A 4XR6A 4HNUA 2HQAA 3OYLA 4ZDOA 3PNTA 3FHNA 1Z7LA 2JSPA 2K5CA 4H4KC 3ZCOA 3UNGC 1Z3XA 4XOPA 2F4IA 2LH9A 4IX7A 1LKXA 4JOMA 1Z3YA 3LSIA 2RREA 2Q1ZB 3VYRB 3H9JA 4RM2A 3N05A 2IGNA 4BEHA 2HPIA 2HVQA 1W36D 4ZJZA 2PJRB 3BG7A 3GBGA 3SEQA 4ZDPA 2R7VA 1HA8A 2IGKA 2VQGA 3FBNB 2KHMA 3L2WA 4ZDLA 2XC7A 2VASA 5HVQC 5TGTA 4E7JA 2JUGA 5FROA 2VXDA 2WAQA 1FMWA 1WJAA 3PFYA 4D1QA 3EUKL 3S3MA 3BCBA 3D5RC 3K4BA 3QODA 4PJNA 1V5FA 1TT0A 1OLTA 2PJRA 3L2RA 5FRMA 3SDBA 4F3QA 3A1YA 1UG0A 2KLOA 3CESA 5CKTA 4F92B 5HOOA 3QYEA 3IAS2 4CA0A 4DBQA 2XF5A 3CJRB 2R7WA 3OYIA 2K3PA 2ZSHB 4XL9A 4HNTA 1MMNA 2M4KA 3BG6A 4RM3A 2X1EA 2E1MC 2CUJA 2CW8A 1QHHD 3OS1A 1BR4A 2X6YA 2IS1A 3HPGA 3A4CA 4HG2A 3HPHA 1DGRM 2VL8A 4XNFA 3HL2A 3E1SA 3HXLA 2ZXIA 2BW3B 3K4JA 3LMMA 3U21A 2MD0A 1T95A 4XONA 3LFUA 3V42A 3OYCA 2LREA 3CMMA 4XMYA 3VDXA 4ZTJA 2VB6A 2V9KA 4XLFA 3C2GA 3OS2A 4HSRA 4R79A 2Q2EB 1D0YA 3BLYA 3SEZA 1BOBA 1Z21A 1D1CA 3K6GA 1X1CA 2V1NA 2CMPA 2ZFUA 4PJMA 3S3NA 1LVKA 3OYFA 3OL4A 1DGWY 2KMUA 3NWTA 3DQVC 2CV0A 2AQFA 3OYJA 3OOUA 2L7KA 2CS3A 1AA7A 2HNHA 4ZTFA 3AKZA 2LG4A 2BW3A 2FUG2 2BVLA 4RMNA 4BL0B 3OS0A 4Y3OA 4DJAA 1X1AA 3OMYA 3M1CA 3DU5A 4D9JA 4E7ZA 2F5VA 5LD2C 2UWMA 2E5ZA 2X6WA 4Y33A 2LC2A 2MC4A 4LITA 4XKVA 3PUBA 1KONA 3SZGA 2Z16A 1X19A 4KJZA 3S93A 1S9HA 3BC8A 3A2KA 3HOTA 1Y56A 2WY7Q 4LIVA 1YX5A 1FMVA 3PSFA 4CCOA 5HNHA 3K70C 3VWBA 4KISA 4ZC3A 4PK4A 3OIQA 4C30A 4CCMA 3DKXA 3OYEA 3K4LA 4IQ4A 4BQOA 4OAYA 3VYSB 3FKJA 3J7AY 2KP6A 3AL0B 3MD2A 3DPUA 2KRCA 3EPZA 3DPLC 3EUAA 2WBMA 4RLQA 3KEYA 2Z2SB 3OY9A 4P5OA 2R7RA 3FDYA 3L2QA 2WY8Q 1LDKB 3EUHC 2CV2A 3IP4B 3F9KA 2V7FA 5CQEA 3CP8A 3UR3C 4HSTA 3HKZA 3S32A 4PSXA 2HVRA 3PNVA 2X1CA 2XDVA 2MYSA 2QKLB 2VLAA 4CCJA 4AYBA 3H5AA 1WJEA 2VJJA 4XLCA 4BDZA 3K10A 2R4GA 1PYVA 1Y6IA 2DXIA 2M7BA 2GOMA 3MKWB 4NC7A 3IUOA 1OR7C 2LRDA 3H9QA 3MMYB 1SAUA 2NOJB 4XOTA 4E4HA 4BS9A 2LOOA 5KNLA 4IZZA 3DPTA 1DP3A 1BR2A 2L2OA 3CP2A 1MNDA 4DOZA 4F91B 2VJ4A 4DBRA 2L5QA 2CH0A 3OYBA 4OAZA 3HOSA 3RTRA 2CFOA 4XKCA 3I9V2 4NUBA 1N77A 2MFZA 2X6XA 1MMDA 2X1DA 2OC6A 4PJLA 4BE2A 4XN3A 4CCNA 4BGDA 1D1AA 1WJCA 2R7XA 1D0ZA 4BJ5C 2GOXB 4NQWB 1IRXA 2OUMA 4YEJA 4ANJA 2M0MA 4B47A 2LY1A 4E7HA 2K9LA 3OYDA 1E0EA 2VJ5A 4G6TB 3CZ6A 3K4NA 3H5NA 4FETA 2HDWA 4LIUA 3W2WA 2M7AA 3E0JB 2CUZA 3BCAA 4CH7A 3D5SC 3S3OA 3DKYA 2WAFA 3K4MA 1GLNA 3K4CA 2F6CA 4KITB 4XLAA 4E6KG 5HNFA 1MW7A 4IKFA 1WJ5A 3IAM2 2WADA 2W4SA 3LSKA 4HPQA 5JHFA 3DU6A 3OYGA 2V4JC 3G2BA 2W1OA 4BJTA 3TMOA 3H9GA 3AFHA 3C2HA 4BQNA 3OYNA 2CW7A 4BQQA 4PFPA 4F93B 3CF2A 2R7OA 3NWSA 3PNYA 3OIPA 3W2VA 3VSLA 2HPMA 2WA0A 3DTEA 4XKWA 1LFPA 2M4GA 3S8PA 1X4OA 3ZXSA 4PSWA 4EATA 4DIQA 1MMAA 4Y4RA 2A6TA 2DCEA 4C9YA 2XF7A 1YX3A 4PFOA 3L2UA 4BUPA 2R7UA 2KQRA 1WJFA 3VYTB 2IGMA 4QPQA 2BVMA 2ELJA 2I8DA 4XLEA 1QHGA 3L2VA 3QYBA 1WJBA 3K70D 2AQEA 2VJIA 4XLHA 4BEHB 4RLFA 2E5NA 1MNEA 3MKZA 2HZDA 3OYMA 4U87A 2IS4A 2VQHA 2Y0SA 4C2UA 3RCOA 2KRHA 1BR1A 3PL8A 3QYFA 2ZSIB 1VZ0A 1V5EA 2VXZA 3OYAA 5KCMA 3ZGKA 1W36C 3LSGA 3LSHA 2LYCA 5LFAA 3DTIA 2RNGA 4U7BA 1R6RA 2X51A 4CSWA 4XORA 3OR1C 3LL7A 5KHDA 2IS2A 1N75A 4DGWB 2K9MA 4J01A 3AL0C 3LSMA 2W00A 4XN0A 2XF6A 2ZXHA 2BOLA 1T0FC 1ZELA 3DWLE 1DQUA 3W2AA 4GRIA 3KX2A 2MABA 4NC8A 4CCKA 4E7SA 3H5RA 1MMGA 4MLOA 1J09A 1G8XA 2LBFB 5CPRB 3DTKA 2DT6A 1QU3A 1U0JA 2JVHA 4CUGA 4J00A 4XQFA 1N78A 3ONQA 1P9QC 2E1MB 4P1WA 2HVSA 4BJ6C 1G59A 1V5GA 2LY2A 3PSIA 4PJJA 4XKBA 4JQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GOM A;  2WY7 Q;  3D5S C;  2JVH A;  3D5R C;  2JVG A;  2GOX B;  2WY8 Q;  2NOJ B; 
#chains in the Genus database with same CATH topology
 2GA2 A;  3WU1 B;  4HX8 A;  2X6O A;  1FP1 D;  2WB1 A;  2HFH A;  2DMT A;  2V9P A;  1GXQ A;  2FF4 A;  2J5P A;  4E7L A;  2EZH A;  2B9S A;  4WXH A;  3I3L A;  3D5L A;  1TTY A;  2BY3 A;  3DLA A;  2Y30 A;  3OWT A;  2E2I J;  2PMZ A;  2WAE A;  4LB5 A;  4N9I A;  3E3V A;  5DUI A;  4BAC A;  3TBI A;  2FNA A;  5JR3 A;  3R6S A;  2UZK A;  5DCM A;  2CQK A;  4II3 A;  2W82 A;  4N4O B;  4RB0 A;  4BE0 A;  3HUG B;  1VF9 A;  5D5X B;  1FTT A;  2EIK H;  2OV7 A;  4FCY A;  1X4P A;  3BTL A;  4MQV A;  2KPM A;  2G0E A;  1DPR A;  2E60 A;  2VUM J;  2JVG A;  2DT7 B;  1XSX A;  2CWE A;  2QQ9 A;  4I7H A;  1TC3 C;  2HOE A;  1WI9 A;  2DJN A;  4CZC A;  3ELK A;  4KT6 A;  2D1V A;  1XGS A;  4E7I A;  5ILS A;  2XAG A;  3RSN A;  2CV1 A;  2ZJ2 A;  2K9S A;  2XVC A;  1J5Y A;  3OR2 C;  2GZW A;  3H35 A;  1Z9C A;  2XSJ C;  4XLP F;  5ERI A;  1SVM A;  3W3C A;  2LDU A;  1A5J A;  2P4W A;  4G7Z F;  2HS5 A;  2VKV A;  1TW3 A;  4N4N B;  2VPL A;  2IXS A;  3SQN A;  2O5R A;  3SHF A;  4P96 A;  4KNY A;  2RGV A;  4CIC A;  5FB2 A;  2K4B A;  3U1D A;  1MNM C;  4W97 A;  1F9N A;  1WH5 A;  4B8X A;  2WTE A;  5L3B A;  4HV6 A;  1S7E A;  4KN7 X;  4ESB A;  1YS7 A;  1YJN I;  4AVZ A;  3ABU A;  1IF1 A;  2JA2 A;  2QLZ A;  1BW6 A;  4QSH A;  4UUS A;  1NH3 A;  4EGY A;  1ERD A;  3DEE A;  4RBO A;  1OYW A;  3SDG A;  4F55 A;  1IGN A;  3L1P A;  1SD7 A;  1Q1H A;  3GLL A;  3R4K A;  4YRV A;  1XMK A;  1RES A;  1KU2 A;  1P7I A;  3U2R A;  2VQC A;  2FML A;  4HX4 A;  1PUF B;  2L01 A;  5C4J J;  4HNU A;  3OYL A;  1YRN A;  3DXJ F;  2E1O A;  2JSP A;  2K5C A;  4H4K C;  4W1U A;  1B72 B;  3QRF F;  3ZCO A;  3UNG C;  3RZD J;  2WC2 A;  4MEX F;  1YG2 A;  1Z3X A;  3FX3 A;  3FXQ A;  4XOP A;  3S14 J;  2ZME C;  2IPQ X;  4G7O F;  2QZ8 A;  2ZO4 A;  1Z3Y A;  2CUF A;  3LSI A;  4HF2 A;  2Q1Z B;  5LEK A;  2QUF A;  2EIN H;  4XIC A;  2QSH X;  1W36 D;  4FQG A;  3BG7 A;  3GBG A;  4ZDP A;  2R7V A;  1HA8 A;  4MHG A;  5JI6 A;  2EZI A;  1REP C;  4MQ9 F;  4Q47 A;  3RI4 A;  4KIG A;  3F6O A;  4G7H F;  3P5J A;  1IXR C;  5L3C A;  3LA2 A;  3CUQ B;  5FRO A;  1MKM A;  4MIM A;  1GDT A;  1S6L A;  1B4A A;  2XKO A;  4D1Q A;  4MFE A;  2JPB A;  5J40 A;  3S3M A;  3K4B A;  5EGO A;  4HAM A;  2Y9Z A;  4C3H J;  3KP4 A;  2Q0O A;  4ZH4 F;  3L2R A;  5FRM A;  4F3Q A;  4LD5 A;  1LFB A;  2TRT A;  1TQP A;  2H6C A;  3GTO J;  2G7H A;  1MMN A;  2M4K A;  1Y39 A;  1QPI A;  5J1Y A;  3CCU I;  4ON0 A;  2X1E A;  4JX5 A;  2VC1 A;  1IRG A;  1XX5 A;  2F2E A;  5LGU A;  1TP4 A;  5IYC J;  3GTK J;  1KYZ A;  3S1R J;  3JAM K;  1O4X A;  4PDK A;  3IL2 A;  1BJA A;  2VL8 A;  4XNF A;  4CYD A;  2CYY A;  2EIM H;  3HXL A;  2ZXI A;  1IUY A;  2DK8 A;  3ERM A;  4M9X A;  2COB A;  5C44 J;  3LFU A;  3V42 A;  3K1M A;  1Y1W J;  2H8R A;  2OQG A;  1JT0 A;  5KVR A;  2VB6 A;  4XLF A;  3SEZ A;  3BJA A;  1X1C A;  2NS0 A;  4X6A J;  2DFF A;  2CMP A;  3P9K A;  5DS9 A;  1R1T A;  3RPQ A;  3S3N A;  1LVK A;  3OYF A;  1DGW Y;  2KMU A;  2Z5U A;  2BHY A;  2BXY A;  2AS5 F;  2IA2 A;  2IVM A;  2MH2 A;  3D0S A;  1AA7 A;  1XGM A;  4ZYE A;  1SD6 A;  2LG4 A;  5AIQ A;  3JRH A;  2BVL A;  1G3Y A;  1MD0 A;  1D8K A;  1T08 B;  1U9N A;  4BYY A;  4A3E J;  3KYC B;  1HKT A;  1U5T B;  3CLO A;  3KZI C;  3FK6 A;  5BMZ A;  1TW2 A;  3RIR A;  3DU5 A;  1LJ9 A;  4E7Z A;  4Y52 J;  3CJN A;  2F5V A;  2X6W A;  1Z6T A;  2MC4 A;  5CVJ A;  4CO8 A;  2RKH A;  3PUB A;  4GYI A;  3CCV I;  3M3Y J;  4S0H B;  3TO7 A;  3BC8 A;  1S72 I;  3IRR A;  3ZMU A;  1Y56 A;  1OYI A;  3ZQL A;  4EM0 B;  1BL0 A;  4KDP A;  3MKL A;  3PSF A;  3JR9 A;  4A3L J;  5LRR A;  3K70 C;  1WRJ A;  5KAF C;  4HQM A;  4PK4 A;  1H88 C;  5IOY A;  2M0C A;  1B9N A;  3FM3 A;  5M3M J;  1TLH B;  2ZFW A;  3BR1 A;  1YW9 A;  2F5F A;  2P6T A;  3K4L A;  1MGT A;  3VYS B;  3ASN H;  3BJ6 A;  2VT2 A;  2PFB A;  2QVO A;  4UNO A;  3DPU A;  1Y0U A;  3EPZ A;  3LWF A;  1IW7 F;  1R1V A;  3JRD A;  5DUK A;  4RS8 A;  3CLQ A;  1VFC A;  2ISZ A;  3ZOB A;  2QQB A;  2Y2Z A;  2A07 F;  1BBY A;  4X1E A;  1QPM A;  1LPQ A;  3FDY A;  1OCP A;  5LHI A;  1EH8 A;  2HQR A;  4UV8 A;  2CV2 A;  3EUH A;  2RAE A;  4Q5S F;  1T2K A;  3HKZ A;  3I55 I;  2VE8 A;  3GZ5 A;  5K5R A;  2YS9 A;  2XKP A;  2ETH A;  4IHW A;  2DBB A;  3JRF A;  2RQP A;  3QQA A;  1ZLJ A;  1WCM J;  3ESW B;  1XCV A;  3CCR I;  4HF1 A;  1LUJ B;  4LLL A;  4A0X A;  3K10 A;  5E8G A;  2A5Y B;  3V8L A;  4Z6Y A;  2EA4 A;  1FZP B;  2EIL H;  4M3D A;  3GX4 X;  3J81 K;  1WVR A;  1Z0X A;  1SAU A;  1XTA A;  2H6B A;  2MD5 A;  1A31 A;  1KZH A;  3I59 B;  1RKW A;  5FLV A;  1SD5 A;  3CP2 A;  1MND A;  5F1R A;  4CHU A;  1W5T A;  5E8I A;  3QPH A;  3RQI A;  1D8J A;  3I9V 2;  2JTV A;  2O03 A;  1AOY A;  2Z3Y A;  1LDJ A;  2X6X A;  2LMD A;  3GTP J;  3H36 A;  3P9C A;  1MMD A;  3G73 A;  2KKO A;  2QBY B;  1ETO A;  1R49 A;  4XN3 A;  4BGD A;  1YFH A;  3CTA A;  3E6M A;  4NQW B;  4ANJ A;  4IHY A;  5FO5 A;  2ME6 A;  4B09 A;  3S2W A;  5DM6 F;  5J47 A;  3FXM A;  2DA4 A;  3CZ6 A;  1FIA A;  1YIT I;  1ZRE A;  2OCE A;  3H5N A;  4JX4 A;  1LDD A;  2L3D A;  3LSR A;  3REO A;  1MBK A;  3E5Q A;  1IDZ A;  2OAZ A;  2X9D A;  3CCY A;  4CH7 A;  3D5S C;  3S3O A;  2GA1 A;  2NRA C;  2QQ8 A;  2ICW G;  3K4M A;  4NB5 A;  3ASO H;  1J7K A;  1OQY A;  4HYE A;  4KIT B;  4L0Z B;  4XLA A;  4XID A;  5D6E A;  2F4M B;  5HNF A;  1FBS A;  3J7A O;  2DDB A;  1KYW A;  1MBE A;  1PDN C;  4HW0 A;  4OOI A;  3TO9 A;  1F1Z A;  3DU6 A;  3OYG A;  2K7L A;  1I1G A;  4MTE A;  1AKH A;  2PEX A;  5CVU A;  4BJT A;  3H92 A;  3H9G A;  1X1P A;  3AFH A;  3C2H A;  3EDP A;  3E6D A;  4QTR A;  2W57 A;  3CF2 A;  4P55 A;  1IN5 A;  3I53 A;  3PNY A;  3OIP A;  2EFO A;  3VSL A;  2HPM A;  3S1M J;  2WA0 A;  2LLK A;  3DTE A;  1TQI A;  2K85 A;  5LGT A;  2R5Z A;  1LNW A;  1ZG5 A;  5AON A;  1U5T C;  3KIO A;  4DIQ A;  1FOK A;  1JUM A;  4I01 A;  1YX3 A;  2EQR A;  4FE4 A;  2O8X A;  4BUP A;  2KQR A;  1WJF A;  3BWG A;  1X3U A;  3M4O J;  4QPQ A;  2CQX A;  2A69 F;  2ESH A;  2I8D A;  3E5U A;  3EQL F;  4IPA A;  1QHG A;  2RV8 A;  1WJB A;  2LVS A;  3HSR A;  3QYB A;  3K70 D;  3WTU C;  1CQT A;  2OTL I;  4DZP A;  3MKZ A;  4ZYD A;  3LSP A;  4G8X A;  3X2Q H;  5H2F C;  3IV5 A;  3O2P E;  2NOG A;  3QYF A;  1VZ0 A;  4LB6 B;  1V5E A;  3G1L A;  3BZ6 A;  2F5C A;  4PGH A;  4ESJ A;  3I0T A;  4WWC A;  1RET A;  2BV6 A;  1P7J A;  5FFX A;  1ZTR A;  2FSW A;  1R6R A;  3BQY A;  5B1B H;  1GHC A;  3LL7 A;  3Q0W A;  3FXO A;  3WGI A;  1N75 A;  1MDM B;  2GIV A;  3WU2 C;  4XN0 A;  2XF6 A;  3IH2 A;  4UB6 C;  2BHZ A;  3DWL E;  3HBL A;  3W2A A;  4RAZ A;  4A3J J;  4I98 B;  4L9V A;  3TDU C;  1CF7 A;  4AWX B;  4E7S A;  4MLO A;  3WTX C;  1ZAO A;  2LBF B;  1E17 A;  1R7J A;  3H3V K;  1QU3 A;  1P4X A;  2DA5 A;  1MJB A;  1LEB A;  1ULY A;  1S5L C;  3GWZ A;  4WXC A;  5ICF A;  1W7P B;  4XKB A;  2IW5 A;  1DPU A;  4RGR A;  5CQG A;  5EF6 A;  3HG9 A;  1MMS A;  5F0H A;  3L2C A;  4G12 A;  1ODD A;  2XGE A;  4RAG A;  1ORK A;  1B59 A;  1QZY A;  2RN7 A;  3JTG A;  2CU7 A;  4B48 A;  4YFK F;  1FP2 A;  2FMY A;  1R4N B;  4RA2 A;  2DAO A;  1SFK A;  4C2T A;  5CLS A;  4UXN A;  3C2B A;  3H0D A;  1TWC J;  1WHU A;  4IVN A;  3ZQI A;  4IQJ A;  1B8I A;  2HYG D;  1VQO I;  2XUB A;  2IP2 A;  3F23 A;  2K40 A;  2KL4 A;  4NNJ A;  4EJT A;  1IN7 A;  2UUZ A;  4UV9 A;  4A3G J;  4OMZ A;  2VKD A;  4JYK A;  2NVX J;  3F8N A;  5EG0 B;  1KU7 A;  2JRT A;  5GAD J;  1WQ2 A;  1APL C;  3GTL J;  1XC5 A;  5ILU A;  4EM1 A;  3T8T A;  3PJR A;  2M3A A;  3BPX A;  4BU2 A;  4U0Y A;  3ULQ B;  5JHU A;  2DA3 A;  1T6S A;  1I27 A;  1O7F A;  2FX0 A;  2JSC A;  2KIQ A;  3KE2 A;  3RYR A;  3HRS A;  2O8K A;  3I71 A;  4B43 A;  2X85 A;  3AG2 H;  1OCO H;  4RGX A;  1U3E M;  2DK5 A;  2GAU A;  2KJC A;  2NVY J;  4CYC B;  2CUE A;  4IHT A;  1X1B A;  3NQO A;  5BOX A;  3CCJ I;  1ZRC A;  3IHU A;  1A35 A;  3HRT A;  2STT A;  3WGG A;  5BPD A;  4FE7 A;  3ZR8 X;  2A5W A;  1QA6 A;  5HS8 A;  3OSF A;  2XAF A;  3MKY B;  4I99 C;  1WJD A;  3BR6 A;  5HS9 A;  3C1D A;  1T33 A;  2R7F A;  2VQL A;  1FBU A;  2L4M A;  4BXF A;  3HDD A;  3GTG J;  1SFX A;  2CO5 A;  2G9W A;  2V1X A;  3OSG A;  2IRF G;  2R0Q C;  4ZYA A;  3JSO A;  5KK1 A;  2ZME B;  1X3W B;  3ZQ7 A;  3BG3 A;  4L9N A;  1MJ9 A;  2Y75 A;  3NRV A;  5IT9 K;  1IXC A;  1NG6 A;  2GWR A;  2HOT A;  2WV0 A;  2P0W A;  1JKR C;  1YIO A;  4V2G A;  4FT8 A;  3IKT A;  2IA0 A;  3PNT A;  5FLX Z;  1MBF A;  1UMQ A;  1R9T J;  2HWV A;  2EB7 A;  3GVA A;  3I54 A;  2Y0M A;  1XSD A;  1QGP A;  2F4I A;  4EJU A;  5EJC A;  1LKX A;  4JOM A;  1QO0 D;  2RRE A;  2I10 A;  5J8C A;  2DU9 A;  3VYR B;  4HF0 A;  1RUO A;  2Y48 A;  4Y17 A;  5CJ9 A;  3J80 Z;  1IV6 A;  3BOQ A;  1H8A C;  2HPI A;  5FKM A;  5LHG A;  2A05 A;  5E18 F;  2PJR B;  4R8H A;  1VTN C;  2M5W A;  2IGK A;  1PUF A;  3KET A;  3WTS C;  5HDN A;  2VQG A;  2VE9 A;  1GUU A;  3KP3 A;  1B72 A;  2JUC A;  2C6Y A;  2EH3 A;  2VT3 A;  1RPW A;  1XCB A;  2MC3 A;  1K61 A;  1HDP A;  2BZT A;  4E70 A;  2WAQ A;  1FMW A;  4BKX A;  3G3Z A;  1K83 J;  3EUK L;  2LF7 A;  4U0W A;  2EFW A;  5D5U B;  5M5X J;  3QOD A;  4ENK A;  1XPX A;  1V5F A;  3A02 A;  1TT0 A;  2QEX I;  3ML6 A;  2LR8 A;  4N0B A;  1TWA J;  2EZK A;  4AID A;  3FHZ A;  2MBF A;  1SFE A;  2V9V A;  3CES A;  5CKT A;  1MH4 A;  4DBQ A;  2R7W A;  2FBI A;  1IDY A;  4V19 K;  3F8B A;  5F08 A;  3PUF A;  1FOX A;  3E7L A;  3QWL A;  1F43 A;  3CUQ A;  2XPV A;  3TP3 A;  1IN6 A;  1ETK A;  2CW8 A;  3BQZ A;  1QHH D;  2JJ7 A;  3F8C A;  3LOC A;  2HI3 A;  3OS1 A;  4KIF A;  2IS1 A;  2PQ8 A;  2MLK A;  2CJJ A;  2JT1 A;  2VBY A;  3HPG A;  1KGS A;  4HG2 A;  5F0F A;  4BY7 J;  2GXG A;  3E1S A;  2E2J J;  2DFH A;  2BW3 B;  2EV0 A;  3GUD A;  3U21 A;  1RNL A;  5DM7 F;  3VDX A;  4HQE A;  5D6F A;  1GV5 A;  2XV4 S;  3T1B A;  2KRF A;  3TGN A;  3IWF A;  1IRF A;  3C2G A;  2XAQ A;  3F3X A;  3FIW A;  2Q2E B;  4R79 A;  3OS2 A;  3BY6 A;  4PZJ A;  1R00 A;  1Z21 A;  2LP0 A;  2V1N A;  2HQN A;  1T38 A;  2ZFU A;  2BY2 A;  1LB2 A;  4CXF A;  1F5T A;  1SC7 A;  2HXI A;  3OL4 A;  5JFR A;  2ZBK A;  1BN5 A;  2XPU A;  4NHJ A;  3CCL I;  3OOU A;  1JT6 A;  2DFI A;  3BTJ A;  2M30 A;  1RI7 A;  1W5C C;  3FIS A;  2CS3 A;  3VOE A;  5E1W A;  4RMN A;  4BL0 B;  1SFU A;  3I4P A;  2PMH A;  1AHD P;  3AG4 H;  3OS0 A;  2HEO A;  1K4S A;  2ISY A;  3FXJ A;  3R61 A;  1MH3 A;  4DJA A;  1X2M A;  3GTQ J;  2K4J A;  1R23 A;  4MNU A;  4D9J A;  1EH6 A;  3HEF A;  2ZNZ A;  5K5Q A;  2KT0 A;  3SFI A;  2E5Z A;  2HTJ A;  5LHH A;  2X48 A;  5E1Z B;  1U6G A;  4LIT A;  4NBQ A;  1RR8 C;  1DU6 A;  3M1E A;  2K9N A;  5H20 A;  1A6I A;  4D0P A;  3LAJ A;  4D7M A;  4M9S A;  3TKY A;  5CVV A;  5C3E J;  1X19 A;  4M6X A;  1S9H A;  3A2K A;  3HOT A;  4KMU X;  3NAR A;  1YX5 A;  5GP9 A;  1T98 A;  3HSE A;  2HOS A;  2CQN A;  3LNQ A;  4CCO A;  4OIN F;  1U5T A;  4U0V A;  3VWB A;  4UVC A;  5FKO A;  3SZP A;  1J75 A;  2GXB A;  2LFB A;  2LTP A;  4M3B A;  5M5Y J;  3AG1 H;  4R1H A;  2R5Y B;  4A3M J;  1I6X A;  3GW2 A;  3BG5 A;  3F8F A;  3FM5 A;  3OYE A;  1MJA A;  2E7W A;  4M72 A;  2XAS A;  3TW6 A;  3MD2 A;  3QAH A;  2AXT C;  1M1E B;  3ECH A;  1LEA A;  4IOC F;  3I58 A;  2JPC A;  2TDX A;  3KEY A;  3RDI A;  2DA7 A;  5DEQ A;  2RVC A;  3F6V A;  1H89 C;  2JZY A;  5IP6 A;  3L2Q A;  3A01 B;  3T0Y A;  3BZC A;  3UR3 C;  3S32 A;  3R60 A;  2JK3 A;  3PNV A;  1ZRF A;  1LE8 A;  1W0U A;  1PP7 U;  3I4M J;  3B02 A;  1G3T A;  5BQT A;  4QIW N;  3N4M A;  2ELK A;  3H3Z A;  4AYB A;  3ROU A;  2VJJ A;  4BDZ A;  2BE5 F;  1Y6I A;  4MFD A;  4Q4Z F;  2GOM A;  3MKW B;  1R5G A;  2O0Y A;  2HQ5 A;  3B6C A;  4LK1 F;  1RKT A;  2O9L A;  1OR7 C;  3H9Q A;  3F21 A;  4BS9 A;  1IUF A;  4IF4 A;  5KNL A;  5HDK A;  1BR2 A;  3HHH A;  2R93 J;  4BXU A;  4EJV A;  5D5W B;  2V79 A;  4DOZ A;  4LLN A;  4C2M J;  3VEP A;  2K86 A;  4DBR A;  5DCM B;  2L5Q A;  1BA5 A;  1J0R A;  1JGS A;  3HYI A;  5K7F A;  5M5W J;  3RZO J;  2BGC A;  4JK1 X;  1MSE C;  2CQ7 A;  2DQR A;  3RTR A;  1UB9 A;  1N77 A;  1VQ5 I;  2A6H F;  4OIR F;  1Y1V J;  2VI6 A;  2P5K A;  2V6C A;  3FF5 A;  1I50 J;  5E79 C;  2OC6 A;  4BE2 A;  4CCN A;  3HOX J;  2EPF A;  1W7P D;  3DV8 A;  2R7X A;  1PUE E;  5K5O A;  5HOD A;  2MSY A;  4B47 A;  2M2E A;  2HZT A;  4Z2Y A;  4E7H A;  1XDU A;  3GF2 A;  5CVI A;  2TCT A;  2VJ5 A;  3I59 A;  1ETY A;  2QSF X;  5L3D A;  3FXL A;  3GYH X;  1Z6R A;  3L9F A;  3K4N A;  4XRF A;  4I0A A;  2HDW A;  3V8J A;  3IKV A;  1E2X A;  3E0J B;  1HW1 A;  5B3S H;  3BCA A;  4HX7 A;  2BY1 A;  3O6B B;  3DKY A;  5L3G A;  2WAF A;  3O8H A;  4LG0 A;  2QBY A;  3DBL B;  3K4C A;  3P7N A;  2M45 A;  4ESF A;  1JKO C;  1K4T A;  4S05 A;  1H9T A;  2F6C A;  1BOA A;  4ASN A;  1QVT A;  1YW8 A;  2JA7 J;  4KUM A;  4IKF A;  2BXZ A;  3G1O A;  1ITY A;  1BI0 A;  2WAD A;  3LSK A;  3M07 A;  3HGY A;  4UUS B;  2Y0S N;  3LAP A;  3GFJ A;  4KMF A;  4FIS A;  3Q9S A;  1FY7 A;  3G2B A;  3JTH A;  2W1O A;  4MO7 A;  5F6F A;  5E3L A;  3WTZ A;  4DYQ A;  4UVA A;  4A3F J;  3CDL A;  3MZ8 A;  2CW0 F;  2OCC H;  5K7H A;  4ABZ A;  3E6B A;  1JKQ C;  4BQQ A;  1TWF J;  1J2X A;  3W2V A;  5GPC A;  2D2W A;  4XKW A;  1R1U A;  4GO1 A;  3OOP A;  4KYW A;  4Y4R A;  4BAY A;  1OYY A;  2A6T A;  4O5V A;  4Y15 A;  3GME A;  2DCE A;  4C9Y A;  5GAH J;  2W85 A;  2HDD A;  1HXD A;  5L3E A;  1R22 A;  3RKQ A;  2PJP A;  2BVM A;  2ELJ A;  1JE8 A;  1J59 A;  5J1R A;  1SMY F;  3WHB A;  4XLH A;  2J5O A;  3OYM A;  1YO5 C;  3PIP F;  3G71 I;  4C2U A;  2GLO A;  3RCO A;  9ANT A;  2KRH A;  4CDG A;  2PN6 A;  4XSZ F;  1XGO A;  1EF4 A;  2UXX A;  3OYA A;  3BZK A;  3PIO F;  4RB1 A;  3MVP A;  3LSH A;  3DTI A;  2RNG A;  2WB1 N;  2EFQ A;  4ENM A;  2P81 A;  3VPR A;  5EGO B;  3HOU J;  3Q0V A;  4BXX J;  3QPT A;  1GVD A;  4DGW B;  4J01 A;  3QU3 A;  3DKW A;  1YTY A;  4B4C A;  2BOL A;  1T0F C;  1ZEL A;  3ZQG A;  3PO3 J;  1DDN A;  2PMZ N;  4CCK A;  1O3S A;  2L02 A;  3H5R A;  1U8B A;  1K6O A;  4AIH A;  1U8R A;  1G6N A;  1ZAR A;  4EVI A;  2DTR A;  4ETS A;  2DT6 A;  4A12 A;  3W6V A;  2A3S A;  5K1Y A;  1R36 A;  4A93 J;  2HTS A;  1P9Q C;  3PFI A;  4L18 B;  2OZU A;  1AU7 A;  1JHH A;  4RDU A;  2EFN A;  1RC9 A;  2HVS A;  1ZGJ A;  2LY2 A;  2ZB9 A;  3HTU A;  1W1W E;  4PJJ A;  1QVU A;  5EZH A;  1MDM A;  3K0L A;  3H0G J;  1USS A;  3C7J A;  4HDU A;  4F7Z A;  3J7Y J;  2IT0 A;  4II2 A;  1D3Y A;  1BI3 A;  1I3A A;  1SAN A;  3K4K A;  2OQR A;  4JX6 A;  1UEL B;  1YE9 A;  2RQQ A;  3S16 J;  2XRO A;  2LBF A;  3QOE A;  1VQ4 I;  2L9S A;  4B44 A;  5HLT A;  4A6D A;  1ENH A;  2NS7 A;  1NHA A;  2QQA A;  3SFZ A;  2DA6 A;  2NNN A;  4E7K A;  3BDD A;  4IRH A;  4QWQ A;  2L7Z A;  2GXA A;  1QNT A;  2EJR A;  3GFI A;  3GZN B;  5BS6 A;  4KIC A;  3OYK A;  1C0W A;  2KFD A;  4OWR B;  3ZRG A;  2QSG X;  3TP0 A;  1HOM A;  4RAY A;  2XAU A;  3SXY A;  3F0C A;  5IPA A;  3OV8 A;  2D45 A;  4BH9 A;  2DI3 A;  3ZQQ A;  3CC2 I;  2IS6 A;  1NK3 P;  2OD5 A;  3BR3 A;  1FIP A;  2BYV E;  1FYK A;  2IGO A;  2IA1 A;  1WSU A;  5F04 A;  2NAZ A;  2H8W A;  1XDS A;  2H94 A;  2V26 A;  4A3K J;  3CJQ B;  3KPH A;  2DOA A;  1JI8 A;  5D8L B;  3VFZ A;  5EG0 A;  2VOD A;  3TO6 A;  1STZ A;  2FA5 A;  1IV8 A;  4B3X A;  2YX7 A;  1UHM A;  3H3U A;  2AHQ A;  1FSH A;  1FOY A;  3MZY A;  4AU7 A;  4FAS D;  3S2H J;  1FX7 A;  5LGN A;  2DMP A;  2VIX A;  4EJO A;  5A2Q K;  4FX4 A;  1IRZ A;  2QKM B;  3HOV J;  4YEL A;  2JA8 J;  2Y9Y A;  3OL3 A;  2R7Q A;  2HYF A;  3SZT A;  1UST A;  5EZG A;  3VOD A;  5ICE A;  1OCR H;  1RZ4 A;  2NYX A;  1D1B A;  3ZN0 A;  1J9I A;  4BDY A;  3OIO A;  2H1L A;  1GXP A;  3VYU B;  2Z1D A;  4HEA 2;  1U9O A;  4LG3 A;  5DD8 A;  4DW6 A;  2VBX A;  3MQ0 A;  4B3A A;  4IHS A;  2HQA A;  4ZDO A;  3FHN A;  1Z7L A;  1A04 A;  1QQI A;  3WU0 A;  3I5U A;  5TRD A;  3QU6 A;  2ZME A;  4IX7 A;  1R5H A;  4C3J J;  1HF0 A;  2ECB A;  2L54 A;  3LSJ A;  4RM2 A;  4ZZD A;  3N05 A;  2R92 J;  1HKS A;  2IGN A;  3HOW J;  3LA7 A;  4BEH A;  3HSF A;  1WWX A;  4ZJZ A;  1F4K A;  1HSJ A;  2ZJP F;  3H1C A;  2PI0 A;  3EYY A;  2HYJ A;  5D4R A;  2DOE A;  5L3F A;  3K2Z A;  3FBN B;  1B6A A;  3L2W A;  1XS9 A;  1BI2 A;  4G9Y A;  1VQ9 I;  5GTI C;  3BP8 A;  4ZDL A;  2XC7 A;  4IHV A;  5FD5 A;  5TGT A;  3TOB A;  2BBY A;  2IBD A;  2JUG A;  3WE2 A;  2L7M P;  1WJA A;  3QOP A;  3MWM A;  2BEO A;  2L7F P;  2CSO A;  2XRN A;  2E36 A;  3M7G A;  1ZQ3 P;  2DW4 A;  5H6Q A;  1IZ1 A;  2PJR A;  2FEZ A;  1S8N A;  2XPW A;  3SDB A;  1UG0 A;  4F92 B;  3QYE A;  3IAS 2;  3WE3 A;  2D1H A;  1ONV A;  1E3P A;  3WTV C;  3OYI A;  3S15 J;  3R0A A;  2ZSH B;  2ELH A;  4XL9 A;  4ZZL A;  4IJA A;  3RKX A;  1YS6 A;  4MEY F;  3DEU A;  2KIF A;  2KJB A;  5D8K B;  3FXU A;  3V4G A;  1L0O C;  2X6Y A;  5BPI A;  3B73 A;  1QRY A;  4A5N A;  2OTJ I;  3C3W A;  2EIJ H;  3A4C A;  2IAI A;  4G6Q A;  1ZR4 A;  1UFM A;  2F48 A;  3K4J A;  2MD0 A;  1I5Z A;  1T95 A;  3M9A A;  3OYC A;  2LRE A;  2DA1 A;  4XMY A;  5F27 A;  4D7N A;  2HKO A;  2NVT J;  4EV0 A;  2MA3 A;  2ID6 A;  2IJL A;  2DQL A;  2V9K A;  3CMY A;  1GVJ A;  3E5X A;  1D0Y A;  2M1B A;  2DOD A;  3K6G A;  4A6E A;  4G94 A;  1AKH B;  3A0H C;  3K1N A;  3DFG A;  3JSP A;  1VQM I;  3ZP5 A;  3CJT B;  1FYL A;  1TWG J;  2R7Z J;  2YR2 A;  2CV0 A;  3WGH A;  3HUG A;  2AQF A;  3OYJ A;  5IT9 Z;  1G3S A;  2NVQ J;  1ZK8 A;  2F5D A;  1Y8Q B;  2HNH A;  3AKZ A;  3LQR A;  2A6E F;  2BW3 A;  3BRO A;  3K9T A;  1SFO J;  1UJ8 A;  2DA2 A;  4WX9 A;  5FKL A;  4AUX A;  2HR3 A;  4Y3O A;  4L0Y B;  1F36 A;  2Q2E A;  4KN4 X;  1TNS A;  2N8G A;  3OMY A;  3JRI A;  3M1C A;  4L9T A;  1S29 A;  5LD2 C;  3HM5 A;  2UWM A;  2K3F A;  4NC6 A;  2LC2 A;  4XKV A;  3WTW C;  5LBQ A;  1HC8 A;  4Q48 A;  1H0M A;  3GZ6 A;  2A61 A;  3S93 A;  4KJZ A;  5E3N A;  3HKZ N;  4L5E A;  3MZH A;  2WY7 Q;  4LIV A;  2XAH A;  2D5V A;  4HBL A;  2HDC A;  4P9U A;  3HB9 A;  3ERE D;  4GDF A;  3EET A;  1P2F A;  3FXK A;  2K27 A;  5EEG A;  2KDZ A;  5JVG F;  3AAF A;  2L9V A;  3LQQ A;  4A2U A;  1WH7 A;  2R3S A;  2RNJ A;  1KA8 A;  3CD6 I;  3RJP A;  4CCM A;  1KQ9 A;  2RC4 A;  3DKX A;  1WGX A;  5BNG A;  1IJW C;  3VB2 A;  4BQO A;  4OAY A;  5FD6 A;  1BJZ A;  3FZV A;  3J7A Y;  3AL0 B;  1MZB A;  1TNT A;  3FKI J;  2KRC A;  3EUA A;  3ABL H;  1CF7 B;  2QYO A;  4RLQ A;  2VON A;  2EV6 A;  3E97 A;  4IO9 F;  2W48 A;  2FXA A;  3CCE I;  1UHW A;  2OZ6 A;  4BBS J;  2WY8 Q;  2X0L A;  3EUH C;  4LFU A;  2Z9O A;  3PO2 J;  3IP4 B;  5GAE J;  3F9K A;  3TQN A;  4MTD A;  1P4A A;  3CP8 A;  1ZG1 A;  4HST A;  1IXS B;  3M8F A;  4Y7N J;  3IWZ A;  4AC0 A;  2HVR A;  1S7O A;  2LY9 A;  2X1C A;  2XDV A;  2R5Y A;  3QPL A;  3K7A J;  3GFL A;  3BR0 A;  1AWC A;  3ZQC A;  2QKL B;  3WHC A;  2VLA A;  5HLI A;  2DN0 A;  4CCJ A;  4GGG A;  2NXN B;  3IH4 A;  3H5A A;  1K78 B;  1WJE A;  2LF8 A;  4O3M A;  2R4G A;  2FOK A;  2WV1 A;  2DXI A;  2M7B A;  1HKQ A;  4XRS A;  1MIJ A;  3IUO A;  2ZXW H;  3UKG A;  3A01 A;  1ZGW A;  1FOW A;  3MMY B;  5E1X A;  2NOJ B;  4H0E A;  3DPT A;  4UUV A;  3S1Q J;  3JRG A;  5B66 C;  3KP2 A;  2DOF A;  2HXO A;  2L2O A;  2UXN A;  3ZMT A;  5EYR A;  1B8I B;  2OA4 A;  3ISP A;  1G3W A;  4HZF A;  3LA3 A;  4PJ0 C;  3QP6 A;  2QA4 I;  2V1D A;  4OAZ A;  1DUX C;  3HOS A;  2CFO A;  5E3M A;  4IXA A;  4A3C J;  2XB0 X;  3CCM I;  2X1D A;  1ZYR F;  1D1A A;  1WJC A;  4I09 A;  3V7S A;  1D0Z A;  1OMI A;  1IRX A;  2OUM A;  4G6D A;  2M0M A;  2LY1 A;  2NS8 A;  3OYD A;  3CC7 I;  3V8K A;  4G6T B;  2QWW A;  2ZC2 A;  1IG7 A;  2E2H J;  3HIF A;  3FMQ A;  1KU3 A;  3W2W A;  4EGZ A;  2M7A A;  1A6Q A;  1FWZ A;  2QF7 A;  5LLQ A;  3T8R A;  5IOZ A;  5D4S A;  2M8G X;  3GLX A;  4L9J A;  4CZZ A;  1IN8 A;  4YIF A;  2ECC A;  4IEJ A;  3KLO A;  1I6H J;  2DPD A;  1MW7 A;  1O3T A;  4FHT A;  3ZMS A;  1WJ5 A;  1JXS A;  2MW8 A;  3IH3 A;  3FK7 A;  2W4S A;  4HPQ A;  1MBJ A;  5JHF A;  2OU2 A;  3FXR A;  3IC7 A;  2CG4 A;  4XRS G;  1U2W A;  1X58 A;  3TMO A;  2FOW A;  2E71 A;  4BQN A;  3OYN A;  2YPR A;  2CW7 A;  4PFP A;  4WXD A;  4F93 B;  2YU9 J;  2E35 A;  4UVB A;  3NWS A;  4LOC A;  4IRI A;  4LMY A;  4JP0 A;  1LFP A;  2EA2 A;  2JWT A;  3F8M A;  5HDG A;  3ECO A;  1XG1 A;  1ETW A;  3S8P A;  2DO7 A;  2OJE D;  3K1P A;  2E1C A;  4AIK A;  4PSW A;  5LEJ A;  2XHK A;  3BT9 A;  1BW5 A;  2KIU A;  2XF7 A;  5J6X A;  1IO2 A;  3VYT B;  5GAG J;  1I1S A;  3A03 A;  4M3G A;  2IGM A;  1YI2 I;  3NEU A;  1I3Q J;  4YII A;  4QLC U;  4XLE A;  3WG7 H;  2VJI A;  3S1N J;  4UB8 C;  4RLF A;  2E5N A;  1MNE A;  3CDI A;  2CGP A;  3BR5 A;  2HZD A;  4XRM A;  4U87 A;  3MN2 A;  5DCF A;  4HOB A;  4DZJ A;  3CO6 C;  1JUS A;  3F22 A;  2L4A A;  3CO7 C;  2PMU A;  1KQ8 A;  2OPT A;  2CFX A;  4HA8 A;  5HLH A;  1BM9 A;  5KCM A;  1KQ0 A;  1FBQ A;  2VOO A;  2LYC A;  5J1U A;  4BHB A;  5LFA A;  4U7B A;  5E17 F;  2X51 A;  2YU3 A;  2XIG A;  3OR1 C;  1ZKG A;  1L3L A;  2E19 A;  2IS2 A;  2K9M A;  3AL0 C;  4LGW A;  5C4X J;  2W00 A;  2E1N A;  2ZKZ A;  2ESN A;  3JAM Z;  4A69 C;  1DQU A;  4GRI A;  3J7Z I;  4GXO A;  2XSD C;  1SVO A;  5IP7 J;  2W84 A;  3CC4 I;  3GTM J;  1J09 A;  5LRS A;  5CPR B;  2VPR A;  2PLY A;  2I5U A;  2XAJ A;  4CUG A;  4J00 A;  1N78 A;  3ONQ A;  4LJZ F;  2E1M B;  4P1W A;  1TWH J;  4BJ6 C;  2VBW A;  1G59 A;  2LNB A;  5HLG A;  1G2H A;  1BC7 C;  4C3I J;  1VQN I;  4GCV A;  2DJI A;  1OPC A;  3BG9 A;  2B7E A;  3M8J A;  2KDO A;  3RPU D;  2M9H A;  3KP6 A;  1UHS A;  5IY5 H;  1O57 A;  1H9G A;  1X1D A;  3I56 I;  1UAA A;  4WK8 F;  2V6E A;  1D5Y A;  4KA4 A;  1HLV A;  1MBH A;  1ZLK A;  1BI1 A;  2H09 A;  3DBR B;  4A3D J;  4YIR X;  1Y8R B;  3GEZ A;  2FBK A;  1VQK I;  2DMQ A;  5ED4 A;  4B1R A;  4YFN F;  4XM3 A;  1V54 H;  3TL4 X;  1JTY A;  1WZ2 A;  1TZL A;  4JBA A;  4RGS A;  3WOD F;  4DQ2 A;  4ZYH A;  5FRN A;  1PJR A;  1K6Y A;  1UG2 A;  1OCC H;  4KFC A;  1NG7 A;  4HRI A;  1LQ1 A;  2LKX A;  2R7S A;  4BE1 A;  2DPU A;  2ME0 A;  4XK4 A;  4A5M A;  2RDP A;  4NQW A;  1Z77 A;  2Y69 H;  2JN6 A;  1XMA A;  4WCG A;  3KYL A;  3KZZ A;  2HOA A;  2L9R A;  2VKH A;  4Y13 A;  4F52 A;  5EDN A;  1ZR2 A;  4I6Z A;  1ACI A;  1X3Z B;  4CGZ A;  2JRM A;  1YJW I;  2V1U A;  3WG9 A;  3KYD B;  3S17 J;  3V7R A;  2YX4 A;  1QBJ A;  4HLY A;  1S7A A;  2VC0 A;  3OYH A;  2XGC A;  3L00 A;  1D0X A;  4QPO A;  2CRG A;  3JRB A;  1RUN A;  1YRN B;  1BIA A;  3FBI B;  5ICC A;  1FTZ A;  2DDA A;  1DU0 A;  2NVU B;  4PUS A;  2W7N A;  1VQ7 I;  4IL6 C;  3SYT A;  3HC7 A;  1EA3 A;  2UV1 A;  1FNN A;  1YYV A;  3RQ4 A;  5TJJ A;  4ITV A;  5JLX A;  2R7T A;  3TDZ C;  4M6Y A;  3VSK A;  1B9M A;  3DCF A;  3M8E A;  2ZCW A;  2KZV A;  4BBR J;  4EQQ A;  2MLG A;  1NK2 P;  3HRM A;  3FWE A;  5FJ8 J;  5JLW A;  2L0K A;  2PG4 A;  3CQZ J;  2ZJQ F;  1WFX A;  2EWN A;  2WAQ N;  4CCL A;  2L9N A;  3Q5F A;  4X0G A;  2HU9 A;  2EBI A;  3KEO A;  4M71 A;  4XR6 A;  2VOP A;  3DLL F;  2K9Q A;  3J81 Z;  1LVA A;  3AG3 H;  3JCU C;  2P5L C;  5D5V B;  2LH9 A;  1WI3 A;  2M8E A;  2DMU A;  1LE8 B;  1Z91 A;  3T5X A;  5IYB J;  3DEW A;  1ZRD A;  2FD5 A;  4HNV A;  3BPV A;  3H9J A;  3GCM A;  3KP5 A;  4KT5 C;  4M9Z A;  5KAI C;  1K79 A;  3MCZ A;  4AVP A;  1R5I D;  2HVQ A;  3P9I A;  4DYR A;  2AXL A;  1OKR A;  3SEQ A;  2EZL A;  3I64 A;  1OCT C;  2KHM A;  5IYD J;  1VI0 A;  4FTH A;  2LD5 A;  1Q1V A;  2GQQ A;  2VAS A;  2JQ7 A;  4U7D A;  5HVQ C;  4E7J A;  1VND A;  3ABK H;  2VXD A;  2W24 A;  3V7C A;  3CCS I;  4BHP A;  5TIS C;  3PFY A;  3O3K A;  3TED A;  4PGG A;  1XB4 A;  5DD4 A;  5IT3 A;  3BCB A;  3D5R C;  3DBH B;  4PJN A;  5J8F A;  1ZH5 A;  3CF5 F;  5FLM J;  5GPA A;  1SMT A;  1OLT A;  3F72 A;  2KZG A;  3HZJ A;  3WTT C;  1E3O C;  2FBH A;  4U88 A;  3A1Y A;  2KLO A;  5HOO A;  3ZN1 A;  4CA0 A;  2PBI A;  2XF5 A;  3CJR B;  5FKK A;  1N25 A;  2E34 A;  2QEN A;  3N97 A;  3GTJ J;  3CUQ C;  2K3P A;  5EEH A;  1Z05 A;  1IC8 A;  4HNT A;  3BG6 A;  4RM3 A;  3PM1 A;  1TQM A;  1OFC X;  2E1M C;  2GM4 A;  2CUJ A;  2FQ4 A;  2QM3 A;  1RR7 A;  3RPU A;  4FX0 A;  3RKY A;  1HDD C;  2HGC A;  1BR4 A;  4RGU A;  1EH7 A;  4IHX A;  1SD4 A;  4UUT A;  1W7P A;  3HPH A;  4KIB A;  1EJ9 A;  1DGR M;  3S2D J;  5ILV A;  2M87 A;  1KU9 A;  4YG2 F;  2ZJR F;  4LG0 B;  3HL2 A;  4HV5 A;  2B63 J;  3HHG A;  5FFZ A;  3LMM A;  1YJ9 I;  4XON A;  1QZE A;  5FKN A;  5J3L A;  3CMM A;  4PCQ A;  1W4M A;  4ZTJ A;  1XSV A;  4L5I A;  1FC3 A;  4GFB A;  4HSR A;  3BLY A;  3GO5 A;  1BOB A;  3GFM A;  1D1C A;  5A2Q Z;  4YFX F;  2XGX A;  3JRE A;  2XRL A;  1MBG A;  3CDH A;  1SVL A;  3NAU A;  1R71 A;  4BQA A;  4PJM A;  1T56 A;  1HW2 A;  3KP7 A;  3NWT A;  3HTS B;  3DQV C;  1WPK A;  1Z7U A;  4ENN A;  2P5V A;  5DV5 A;  2P7C B;  2L7K A;  1QZZ A;  2H1K A;  5F0C A;  4A0Y A;  4ZTF A;  1UZC A;  1ON2 A;  2FUG 2;  3Q9V A;  3L7W A;  1Z1D A;  1W0T A;  2R7D A;  2MH9 A;  4D5C A;  4ZYG A;  4XSX F;  4AM3 A;  5AIP A;  5F64 A;  1ON1 A;  5H6R A;  3E6C C;  1MSF C;  2Q8K A;  3ZPL A;  1X1A A;  3FMR A;  3W6K B;  1FT9 A;  2EFP A;  4Y33 A;  1FJL A;  3ZMZ A;  2CQQ A;  6PAX A;  5ICG A;  4RB2 C;  3MEX A;  4CYC A;  1V55 H;  4AD9 A;  5JVT A;  1KON A;  3G6E I;  1POG A;  3SZG A;  2Z16 A;  2LK2 A;  1B1B A;  5CVR A;  5IP9 J;  3BR2 A;  2COM A;  2LSO A;  2FNP A;  1O3Q A;  1FMV A;  4BHC A;  4K2E A;  4EEF G;  3Q3S A;  5DDG A;  5HNH A;  4J19 A;  1ZN2 A;  4AYB N;  1VQ8 I;  4UHT A;  4KIS A;  4DYC A;  4I0B A;  2DT5 A;  4ZC3 A;  3RKW A;  3OIQ A;  4C30 A;  2LKS A;  5J4V A;  2ADU A;  2G7U A;  4IQ4 A;  2K02 A;  2X4H A;  3FKJ A;  2IEK A;  2KP6 A;  4HLX A;  4ENJ A;  1R58 A;  3L09 A;  3WTY C;  3DPL C;  4P9F A;  3G1M A;  1V3F A;  2M34 A;  3ZMD A;  2WBM A;  3ZQH A;  2Z2S B;  3TOA A;  3OY9 A;  2QCO A;  2XGD A;  3A0B C;  1G4D A;  1P4W A;  2XB5 A;  4P5O A;  1ETX A;  2R7R A;  1LDK B;  4RB3 C;  2JMW A;  2FJ1 A;  2DLL A;  1YIJ I;  2DFE A;  2V7F A;  5CQE A;  3ABM H;  1A36 A;  1ZGA A;  1P6R A;  4PSX A;  1XD7 A;  1RIO H;  1JTX A;  2DYR H;  2O7O A;  1SEU A;  5EEA A;  5M3F J;  1HBX G;  2VBZ A;  2P8T A;  2ZNY A;  1S3J A;  5CYV A;  4OIO F;  2MYS A;  3SJM A;  3COA C;  4LLG F;  1P92 A;  4XLC A;  2F4O B;  2STW A;  1PYV A;  1OIS A;  3CUO A;  3LFK A;  4OIP F;  2F5E A;  4NDL A;  4BNC A;  1X2N A;  4OU0 A;  1D5V A;  4NC7 A;  5K7Z A;  4EM2 A;  2LRD A;  2E7X A;  2Z33 A;  1OR7 A;  1TT5 B;  4XOT A;  4E4H A;  1YHQ I;  2O6G E;  4EJW A;  4A3B J;  2LOO A;  2FE3 A;  4MGR A;  5B1A H;  4IZZ A;  3HJE A;  1O3R A;  3PQK A;  1DP3 A;  4AIJ A;  4RAF A;  1Y0N A;  2QGU A;  4F91 B;  2VJ4 A;  3LST A;  2CH0 A;  3OYB A;  1TBX A;  5B5E C;  1SAX A;  3G4S I;  1FYM A;  1O7L A;  1K78 A;  4XKC A;  1K7A A;  4NUB A;  5GTH C;  4EMS A;  2MFZ A;  1W5S A;  5DYM A;  2OF7 A;  4M3F A;  5E20 A;  4PJL A;  4M74 A;  1TL8 A;  1FPQ A;  3RYP A;  3EYI A;  3U1K A;  4BJ5 C;  2GOX B;  1VQL I;  3HOY J;  4YEJ A;  2GIZ A;  2K9L A;  4GYG A;  1E0E A;  1OJL A;  1JHF A;  2EK5 A;  2P6S A;  3JW4 A;  4FET A;  1ETQ A;  4LIU A;  2P7V B;  1WKM A;  1GT0 C;  1IAW A;  4IRG A;  3ABT A;  1ZHF A;  1YLF A;  4N9H A;  2CUZ A;  3MFK A;  3O8G A;  2O3F A;  3MAJ A;  4I02 A;  1R4M B;  4I2O A;  3HRU A;  1LFU P;  4I76 A;  1GLN A;  4O6J A;  4UY8 I;  1HW5 A;  2BY0 A;  3KEQ A;  3W6J B;  3ZMV A;  4E6K G;  2R5Z B;  1Z67 A;  3ZQF A;  3IAM 2;  1UCR A;  3QP5 A;  4M73 A;  4TV7 A;  1NTC A;  4D5F A;  2YSR A;  2MG4 A;  1FSE A;  2OBP A;  1V4R A;  3K2A A;  1U78 A;  2V4J C;  4OMY A;  2FRH A;  4S04 A;  1VQP I;  3DP7 A;  2W25 A;  3BJO A;  3B6A A;  1HCR A;  1CGP A;  4WF2 A;  1RRJ A;  2DYS H;  2FQ3 A;  1VQ6 I;  4LK0 F;  3HOZ J;  2KIS A;  2HKX A;  2R7O A;  4HDV A;  3KFW X;  1PP8 F;  2PX9 A;  1EV7 A;  2M4G A;  1X4O A;  3PQJ A;  3ZXS A;  5F1J A;  1JJ8 C;  4EAT A;  1MMA A;  2B0L A;  1JGG A;  1I39 A;  3K69 A;  1FEX A;  2NNY A;  1YQA A;  1XN7 A;  4PFO A;  3L2U A;  1XGN A;  5FGM A;  2R7U A;  2JA6 J;  1HQC A;  2Y31 A;  4XBF A;  3CMA I;  2H27 A;  1ETV A;  3L2V A;  2A68 F;  3I4N J;  2AQE A;  4A3I J;  4BEH B;  4IOA F;  3BTI A;  1HST A;  3JRC A;  2EV5 A;  3KLN A;  2IS4 A;  2VQH A;  2Y0S A;  1PVE A;  2JA5 J;  3HGG A;  3JRA A;  1ZG3 A;  1BR1 A;  3PL8 A;  2GBY A;  1T8I A;  2AO9 A;  2ZSI B;  1BC8 C;  2VXZ A;  3DF8 A;  1YOV B;  3C18 A;  4L5J A;  1DP7 P;  2DTZ A;  3ZGK A;  1W36 C;  3LSG A;  1GV2 A;  4M3E A;  5E3O A;  5DTD A;  3U9G A;  3CME I;  4XLN F;  1JJ6 C;  2VKE A;  2O61 A;  3KCC A;  4CSW A;  4XOR A;  4BY1 J;  2ZXJ A;  3FMS A;  5KHD A;  3IRQ A;  2MGQ A;  4M6V A;  3LSM A;  2ZXH A;  2ID3 A;  2Z99 A;  4V2F A;  1T0F A;  5HS7 A;  3CCQ I;  3KX2 A;  1JKP C;  2MAB A;  1OCZ H;  3TW7 A;  2VN2 A;  4NC8 A;  3D1N I;  5FLX K;  1IN4 A;  1MMG A;  2FU4 A;  3Q0U A;  1G8X A;  3QPS A;  3DTK A;  1EKE A;  2ACJ A;  4DNC A;  1T39 A;  3GXO A;  1U0J A;  2JVH A;  4XQF A;  5J4Y A;  3BTC A;  1BIB A;  2YUS A;  1E3H A;  1JUP A;  1YW7 A;  3KZY A;  3R0J A;  4OIQ F;  2WWY A;  3J80 K;  1FLI A;  2KIM A;  2LKP A;  1V5G A;  3PSI A;  1XMX A;  2DMN A;  4A0Z A;  4JQF A; 
#chains in the Genus database with same CATH homology
 2DJI A;  5CQG A;  3HG9 A;  3M8J A;  2KDO A;  3RPU D;  4II2 A;  2WB1 A;  1X1D A;  3K4K A;  4B48 A;  1UEL B;  1YE9 A;  2RQQ A;  4E7L A;  1UAA A;  2V6E A;  2LBF A;  3QOE A;  3I3L A;  2L9S A;  3D5L A;  4B44 A;  4C2T A;  1SFK A;  3DLA A;  5HLT A;  3H0D A;  3OWT A;  2PMZ A;  2WAE A;  4XM3 A;  3TL4 X;  4IQJ A;  1TZL A;  4BAC A;  3TBI A;  4BE0 A;  4E7K A;  4II3 A;  2W82 A;  4N4O B;  3HUG B;  2KL4 A;  4NNJ A;  5FRN A;  2UUZ A;  2VKD A;  1PJR A;  2OV7 A;  1K6Y A;  3OYK A;  1NG7 A;  4HRI A;  4OWR B;  3ZRG A;  1X4P A;  3PJR A;  2R7S A;  4BE1 A;  2M3A A;  2KPM A;  4BU2 A;  2E60 A;  2XAU A;  2JVG A;  2DT7 B;  3ZQQ A;  4B43 A;  4CZC A;  2IS6 A;  3KYL A;  2X85 A;  2VKH A;  4KT6 A;  4F52 A;  4E7I A;  3RSN A;  2IGO A;  2CV1 A;  3OR2 C;  2V26 A;  3H35 A;  2XSJ C;  3CJQ B;  3W3C A;  1X1B A;  2DOA A;  1JI8 A;  3OYH A;  1D0X A;  4B3X A;  4N4N B;  2VPL A;  2IXS A;  2O5R A;  3ZR8 X;  2A5W A;  4QPO A;  4AU7 A;  4FAS D;  3MKY B;  1WJD A;  2VQL A;  2VIX A;  4BXF A;  3FBI B;  2QKM B;  4PUS A;  2W7N A;  3SYT A;  3HC7 A;  1EA3 A;  2UV1 A;  4YEL A;  3OL3 A;  4ZYA A;  3RQ4 A;  4AVZ A;  2JA2 A;  2R7Q A;  4ITV A;  1ERD A;  3DEE A;  2R7T A;  3VSK A;  2KZV A;  4F55 A;  1NG6 A;  4YRV A;  1D1B A;  4BDY A;  2P0W A;  1WFX A;  3VYU B;  4CCL A;  2L9N A;  2Z1D A;  4HEA 2;  4X0G A;  2HU9 A;  2VQC A;  4LG3 A;  4XR6 A;  4HNU A;  2HQA A;  3OYL A;  4ZDO A;  3PNT A;  3FHN A;  1Z7L A;  2JSP A;  2K5C A;  4H4K C;  3ZCO A;  3UNG C;  1Z3X A;  4XOP A;  2F4I A;  2LH9 A;  4IX7 A;  1LKX A;  4JOM A;  1Z3Y A;  3LSI A;  2RRE A;  2Q1Z B;  3VYR B;  3H9J A;  4RM2 A;  3N05 A;  2IGN A;  4BEH A;  2HPI A;  2HVQ A;  1W36 D;  4ZJZ A;  2PJR B;  3BG7 A;  3GBG A;  3SEQ A;  4ZDP A;  2R7V A;  1HA8 A;  2IGK A;  2VQG A;  3FBN B;  2KHM A;  3L2W A;  4ZDL A;  2XC7 A;  2VAS A;  5HVQ C;  5TGT A;  4E7J A;  2JUG A;  5FRO A;  2VXD A;  2WAQ A;  1FMW A;  1WJA A;  3PFY A;  4D1Q A;  3EUK L;  3S3M A;  3BCB A;  3D5R C;  3K4B A;  3QOD A;  4PJN A;  1V5F A;  1TT0 A;  1OLT A;  2PJR A;  3L2R A;  5FRM A;  3SDB A;  4F3Q A;  3A1Y A;  1UG0 A;  2KLO A;  3CES A;  5CKT A;  4F92 B;  5HOO A;  3QYE A;  3IAS 2;  4CA0 A;  4DBQ A;  2XF5 A;  3CJR B;  2R7W A;  3OYI A;  2K3P A;  2ZSH B;  4XL9 A;  4HNT A;  1MMN A;  2M4K A;  3BG6 A;  4RM3 A;  2X1E A;  2E1M C;  2CUJ A;  2CW8 A;  1QHH D;  3OS1 A;  1BR4 A;  2X6Y A;  2IS1 A;  3HPG A;  3A4C A;  4HG2 A;  3HPH A;  1DGR M;  2VL8 A;  4XNF A;  3HL2 A;  3E1S A;  3HXL A;  2ZXI A;  2BW3 B;  3K4J A;  3LMM A;  3U21 A;  2MD0 A;  1T95 A;  4XON A;  3LFU A;  3V42 A;  3OYC A;  2LRE A;  3CMM A;  4XMY A;  3VDX A;  4ZTJ A;  2VB6 A;  2V9K A;  4XLF A;  3C2G A;  3OS2 A;  4HSR A;  4R79 A;  2Q2E B;  1D0Y A;  3BLY A;  3SEZ A;  1BOB A;  1Z21 A;  1D1C A;  3K6G A;  1X1C A;  2V1N A;  2CMP A;  2ZFU A;  4PJM A;  3S3N A;  1LVK A;  3OYF A;  3OL4 A;  1DGW Y;  2KMU A;  3NWT A;  3DQV C;  2CV0 A;  2AQF A;  3OYJ A;  3OOU A;  2L7K A;  2CS3 A;  1AA7 A;  2HNH A;  4ZTF A;  3AKZ A;  2LG4 A;  2BW3 A;  2FUG 2;  2BVL A;  4RMN A;  4BL0 B;  3OS0 A;  4Y3O A;  4DJA A;  1X1A A;  3OMY A;  3M1C A;  3DU5 A;  4D9J A;  4E7Z A;  2F5V A;  5LD2 C;  2UWM A;  2E5Z A;  2X6W A;  4Y33 A;  2LC2 A;  2MC4 A;  4LIT A;  4XKV A;  3PUB A;  1KON A;  3SZG A;  2Z16 A;  1X19 A;  4KJZ A;  3S93 A;  1S9H A;  3BC8 A;  3A2K A;  3HOT A;  1Y56 A;  2WY7 Q;  4LIV A;  1YX5 A;  1FMV A;  3PSF A;  4CCO A;  5HNH A;  3K70 C;  3VWB A;  4KIS A;  4ZC3 A;  4PK4 A;  3OIQ A;  4C30 A;  4CCM A;  3DKX A;  3OYE A;  3K4L A;  4IQ4 A;  4BQO A;  4OAY A;  3VYS B;  3FKJ A;  3J7A Y;  2KP6 A;  3AL0 B;  3MD2 A;  3DPU A;  2KRC A;  3EPZ A;  3DPL C;  3EUA A;  2WBM A;  4RLQ A;  3KEY A;  2Z2S B;  3OY9 A;  4P5O A;  2R7R A;  3FDY A;  3L2Q A;  2WY8 Q;  1LDK B;  3EUH C;  2CV2 A;  3IP4 B;  3F9K A;  2V7F A;  5CQE A;  3CP8 A;  3UR3 C;  4HST A;  3HKZ A;  3S32 A;  4PSX A;  2HVR A;  3PNV A;  2X1C A;  2XDV A;  2MYS A;  2QKL B;  2VLA A;  4CCJ A;  4AYB A;  3H5A A;  1WJE A;  2VJJ A;  4XLC A;  4BDZ A;  3K10 A;  2R4G A;  1PYV A;  1Y6I A;  2DXI A;  2M7B A;  2GOM A;  3MKW B;  4NC7 A;  3IUO A;  1OR7 C;  2LRD A;  3H9Q A;  3MMY B;  1SAU A;  2NOJ B;  4XOT A;  4E4H A;  4BS9 A;  2LOO A;  5KNL A;  4IZZ A;  3DPT A;  1DP3 A;  1BR2 A;  2L2O A;  3CP2 A;  1MND A;  4DOZ A;  4F91 B;  2VJ4 A;  4DBR A;  2L5Q A;  2CH0 A;  3OYB A;  4OAZ A;  3HOS A;  3RTR A;  2CFO A;  4XKC A;  3I9V 2;  4NUB A;  1N77 A;  2MFZ A;  2X6X A;  1MMD A;  2X1D A;  2OC6 A;  4PJL A;  4BE2 A;  4XN3 A;  4CCN A;  4BGD A;  1D1A A;  1WJC A;  2R7X A;  1D0Z A;  4BJ5 C;  2GOX B;  4NQW B;  1IRX A;  2OUM A;  4YEJ A;  4ANJ A;  2M0M A;  4B47 A;  2LY1 A;  4E7H A;  2K9L A;  3OYD A;  1E0E A;  2VJ5 A;  4G6T B;  3CZ6 A;  3K4N A;  3H5N A;  4FET A;  2HDW A;  4LIU A;  3W2W A;  2M7A A;  3E0J B;  2CUZ A;  3BCA A;  4CH7 A;  3D5S C;  3S3O A;  3DKY A;  2WAF A;  3K4M A;  1GLN A;  3K4C A;  2F6C A;  4KIT B;  4XLA A;  4E6K G;  5HNF A;  1MW7 A;  4IKF A;  1WJ5 A;  3IAM 2;  2WAD A;  2W4S A;  3LSK A;  4HPQ A;  5JHF A;  3DU6 A;  3OYG A;  2V4J C;  3G2B A;  2W1O A;  4BJT A;  3TMO A;  3H9G A;  3AFH A;  3C2H A;  4BQN A;  3OYN A;  2CW7 A;  4BQQ A;  4PFP A;  4F93 B;  3CF2 A;  2R7O A;  3NWS A;  3PNY A;  3OIP A;  3W2V A;  3VSL A;  2HPM A;  2WA0 A;  3DTE A;  4XKW A;  1LFP A;  2M4G A;  3S8P A;  1X4O A;  3ZXS A;  4PSW A;  4EAT A;  4DIQ A;  1MMA A;  4Y4R A;  2A6T A;  2DCE A;  4C9Y A;  2XF7 A;  1YX3 A;  4PFO A;  3L2U A;  4BUP A;  2R7U A;  2KQR A;  1WJF A;  3VYT B;  2IGM A;  4QPQ A;  2BVM A;  2ELJ A;  2I8D A;  4XLE A;  1QHG A;  3L2V A;  3QYB A;  1WJB A;  3K70 D;  2AQE A;  2VJI A;  4XLH A;  4BEH B;  4RLF A;  2E5N A;  1MNE A;  3MKZ A;  2HZD A;  3OYM A;  4U87 A;  2IS4 A;  2VQH A;  2Y0S A;  4C2U A;  3RCO A;  2KRH A;  1BR1 A;  3PL8 A;  3QYF A;  2ZSI B;  1VZ0 A;  1V5E A;  2VXZ A;  3OYA A;  5KCM A;  3ZGK A;  1W36 C;  3LSG A;  3LSH A;  2LYC A;  5LFA A;  3DTI A;  2RNG A;  4U7B A;  1R6R A;  2X51 A;  4CSW A;  4XOR A;  3OR1 C;  3LL7 A;  5KHD A;  2IS2 A;  1N75 A;  4DGW B;  2K9M A;  4J01 A;  3AL0 C;  3LSM A;  2W00 A;  4XN0 A;  2XF6 A;  2ZXH A;  2BOL A;  1T0F C;  1ZEL A;  3DWL E;  1DQU A;  3W2A A;  4GRI A;  3KX2 A;  2MAB A;  4NC8 A;  4CCK A;  4E7S A;  3H5R A;  1MMG A;  4MLO A;  1J09 A;  1G8X A;  2LBF B;  5CPR B;  3DTK A;  2DT6 A;  1QU3 A;  1U0J A;  2JVH A;  4CUG A;  4J00 A;  4XQF A;  1N78 A;  3ONQ A;  1P9Q C;  2E1M B;  4P1W A;  2HVS A;  4BJ6 C;  1G59 A;  1V5G A;  2LY2 A;  3PSI A;  4PJJ A;  4XKB A;  4JQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...