2M2EA

Solution nmr structure of the sant domain of human dnajc2, northeast structural genomics consortium target hr8254a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
71
structure length
71
Chain Sequence
FTPWTTEEQKLLEQALKTYPVNTPERWKKIAEAVPGRTKKDCMKRYKELVEMVKAKKAAQEQVLNASRAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title NMR solution structure of the SANT domain of human DnaJC2.
rcsb
source organism Homo sapiens
molecule tags Transcription regulator
molecule keywords DnaJ homolog subfamily C member 2
total genus 21
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2m2eA00
2E2HJ 4BY1J 2JJ7A 1UHSA 2CQXA 1Z0XA 1E3OC 1ZGWA 2TCTA 2CQQA 2WB1N 1U78A 3VPRA 1DU6A 3BR0A 3MN2A 2IAIA 3LSJA 1ETQA 2DA1A 3ZQCA 3DEWA 5EF6A 4JX6A 3BR1A 1JKRC 4LOCA 3H0GJ 5HODA 3CQZJ 1I3QJ 2QF7A 2X6OA 5F08A 1NK3P 3A01A 1JKPC 2ME6A 4A93J 2MW8A 1BW6A 4A3CJ 1HDDC 1MBKA 5GP9A 1MSEC 3K7AJ 1H89C 1HCRA 4JYKA 1GDTA 3BG3A 3CMYA 4MO7A 5C3EJ 1OJLA 4M3FA 5GPCA 1FIAA 1MBFA 3BT9A 5FJ8J 3IH3A 2G0EA 1TC3C 2OPTA 4A3FJ 4QSHA 3TP3A 3HOYJ 5EDNA 3GTQJ 1Y1WJ 1RKWA 4Y52J 1TWAJ 3M3YJ 9ANTA 3BR2A 1R9TJ 5M3MJ 2XB5A 1NTCA 2DA7A 2ZB9A 3IH2A 3B6CA 1YRNA 2MSYA 1MBHA 4C3JJ 2XPWA 1IJWC 2R5ZA 1IC8A 3K2AA 5EYRA 5M5XJ 4A3LJ 4JX5A 1AHDP 2NVXJ 5DTDA 2LVSA 2N8GA 1HF0A 1Q1VA 1UMQA 5IOZA 3S1QJ 2LLKA 3F0CA 4M3GA 2HYJA 2HDDA 5IPAA 1W0TA 5IP6A 1JUSA 1MH4A 1QRYA 4HNVA 1CQTA 5FKKA 2P81A 3S1NJ 5IOYA 4L5EA 2Y2ZA 3ZQGA 5EEAA 3GTOJ 3FK7A 4X6AJ 1B72A 4XRSA 4A3BJ 3HEFA 1JJ8C 1DU0A 1F43A 3WHCA 5FLVA 4M3EA 3OSFA 4EEFG 5J1RA 2IEKA 3RZDJ 1ZTRA 4IHXA 1LFBA 2XB0X 3CDLA 4QIWN 2QCOA 1U9NA 2EZLA 1Y1VJ 1K83J 2Y0SN 1ETVA 2RAEA 4IHVA 3DCFA 1VI0A 2XGDA 5M5YJ 3LSRA 3ZQFA 4FISA 2R5YB 2FD5A 4RDUA 1X58A 1JJ6C 4UUSB 1FEXA 4XRSG 1ZR4A 4C2MJ 5J3LA 1O4XA 1IDZA 1ITYA 3JRCA 3S16J 3H3VK 1U9OA 2L7MP 4XICA 2MGQA 5FLMJ 2R0QC 2JK3A 5C4XJ 1ETXA 2LKXA 1D5YA 2Y9ZA 1W0UA 2ECCA 1VF9A 4A3JJ 2XPUA 4A3GJ 4ABZA 3BR5A 3PM1A 2DA4A 5E3MA 2M34A 4XK4A 4BY7J 2H1KA 3JR9A 1MSFC 3TEDA 2EZKA 1MBGA 2DA5A 2EZHA 1GVDA 1PUFB 3GTMJ 3W6VA 3C2BA 4MFDA 1H88C 4FCYA 3TP0A 4I6ZA 4M3DA 2IBDA 4DYCA 3NARA 3Q0VA 3BTCA 1HDPA 2CUEA 1GV5A 1XS9A 1RETA 2E1OA 2EZIA 5E3NA 4A3MJ 1K61A 2ELKA 2LY9A 1ETYA 2EBIA 2ID3A 3HKZN 2H8RA 2CU7A 2M2EA 1VFCA 3WHBA 1JGGA 3SJMA 1OCTC 2M9HA 2ECBA 2L7FP 3BG9A 5E3OA 3S17J 2Y9YA 1UG2A 2GM4A 3S2HJ 2XRLA 1P7JA 3SFIA 4A3KJ 3HDDA 4Y7NJ 2DMQA 5FKMA 2COBA 1VNDA 1ETOA 4B1RA 3O8GA 2K9NA 5FKNA 4IHWA 5F0CA 3RZOJ 3JRFA 1OFCX 1QPIA 4DYQA 2L0KA 3FIWA 5IYDJ 2PMZN 3BR6A 3JRGA 1PUFA 2Y30A 4MFEA 2VI6A 1P7IA 5C4JJ 2X48A 2D5VA 2R93J 1QVTA 1OCPA 4QTRA 3OSGA 1ETKA 1RKTA 1WPKA 2JMWA 1IRZA 3BQYA 5FKOA 1A6IA 1WH5A 3G1MA 2KDZA 3BG5A 5F1JA 2ME0A 3BTIA 1TWGJ 4X1EA 3ZOBA 1WH7A 5K7FA 1HOMA 4GFBA 2M8GX 2NS7A 3GTGJ 1FTZA 2M0CA 3GBGA 4UUSA 1AKHA 1WCMJ 4J19A 2NOGA 1XG1A 3QPLA 1JT6A 2HXOA 1GT0C 4FE7A 2HXIA 4A3EJ 1ENHA 2FX0A 4C3HJ 1TWCJ 3OOUA 2HOAA 3ZQIA 4A3IJ 3GTKJ 5J1UA 1MH3A 1G2HA 5DS9A 3HOVJ 4AC0A 1BJZA 5EGOA 3JRAA 1LE8B 3S1RJ 2VKVA 3Q0UA 1I6HJ 2EQRA 4FE4A 1WI3A 4W97A 1JUPA 4CYCA 1ZKGA 3HGYA 3A03A 2EH3A 1A5JA 1T56A 5M3FJ 4DW6A 1U8BA 1IDYA 2YUSA 5F0HA 3RKQA 1JTXA 2W48A 4DZJA 4BBSJ 5IP9J 2O8KA 3O8HA 1MBEA 2DA2A 5C44J 2VKEA 2YS9A 2FQ4A 5K7ZA 2NVQJ 1RESA 1JKOC 1IG7A 3JREA 3UKGA 4BBRJ 3A02A 5EZGA 2DMPA 1JTYA 2DJNA 5IYBJ 3GTLJ 3HOWJ 2CJJA 3S14J 2O9LA 1S7EA 2E2IJ 3RQIA 5E3LA 3LSGA 5M5WJ 3MKLA 2JA5J 2DN0A 2YU9J 3D1NI 1LE8A 2JWTA 2X9DA 2Y31A 1TWFJ 2WV1A 2HOTA 4BXXJ 2VPRA 2K9SA 3TW6A 2DA3A 4RBOA 2ID6A 2XSDC 5GPAA 2TRTA 2NVTJ 2DA6A 3IV5A 2R92J 3FK6A 5F04A 1Z77A 1XC5A 5EG0A 2KT0A 3GTPJ 3MVPA 4V2GA 1FJLA 4V2FA 1HLVA 1JKQC 3I4NJ 3FKIJ 1MNMC 1ZQ3P 1YRNB 1SFOJ 1B72B 3QPSA 4MIMA 4W1UA 3G1LA 1JUMA 5K7HA 1POGA 1IV6A 5BNGA 3HGGA 3JRDA 2LTPA 3HOXJ 1H8AC 2GBYA 4AYBN 5FKLA 2R7ZJ 1BA5A 4CYCB 4DYRA 1X2NA 4JX4A 2LP0A 4A69C 3BQZA 5IP7J 3L1PA 2K9QA 2JA8J 2I10A 5J1YA 3CCYA 1ETWA 3HM5A 3G1OA 4G12A 1WGXA 4D5CA 2JA7J 3S1MJ 2CUFA 2HQ5A 2WAQN 1B8IA 4UUTA 2HI3A 2E2JJ 2GLOA 3JRBA 1T33A 3Q3SA 3A01B 5F0FA 3LOCA 5IYCJ 4MLOA 4JP0A 4M6VA 4D7NA 1SANA 4BKXA 1APLC 2K40A 2LR8A 3S15J 4D7MA 4D5FA 2NVYJ 4FTHA 1ORKA 2L9RA 5JLWA 3FISA 1NK2P 1TWHJ 2E19A 3HB9A 2MG4A 4DZPA 3GTJJ 2FJ1A 2NS8A 2AHQA 2OF7A 3PO2J 2XGEA 2AO9A 3HOZJ 3HBLA 2XGCA 4AUXA 1ZR2A 1GUUA 1RR7A 2HOSA 2JN6A 1LFUP 3S2DJ 1IUFA 2DMUA 5JLXA 2R5YA 2XPVA 2CRGA 2B63J 1EF4A 1FTTA 2DMNA 4IHYA 1ZK8A 3HOUJ 3SDGA 3TW7A 4S0HB 1B8IB 4M3BA 2O7OA 2DTZA 3ZQLA 1AU7A 3I4MJ 1GV2A 3OIOA 4NDLA 2JA6J 3IH4A 1I50J 5EZHA 4I76A 3LSPA 1F36A 3JRHA 5EGOB 2R5ZB 4A3DJ 1QVUA 3BTJA 1MBJA 1AKHB 1BW5A 2LFBA 1FIPA 5F27A 4C3IJ 2DMTA 3B6AA 2LD5A 1X2MA 4IEJA 1RPWA 3ZQHA 3QQAA 1IGNA 3LNQA 4B4CA 3BR3A 3BTLA 3E7LA 3Q0WA 3M4OJ 1BL0A 2L7ZA 1JT0A 4XIDA 3PO3J 5EG0B 3NAUA 4XRMA 2VUMJ 3JRIA 4B3AA 2LK2A
chains in the Genus database with same CATH superfamily
2XUBA 3K4BA 3RJPA 1BIAA 3DWLE 5ICEA 1SFUA 1QZYA 2TCTA 4J00A 1PVEA 2EFPA 2WB1N 4RMNA 4E70A 2Z16A 5DCMB 1FX7A 5DUKA 5BS6A 3MZYA 1EV7A 4U88A 1SMYF 2FBKA 3MKZA 3SXYA 2DA1A 2ZJRF 4KA4A 1DPUA 1W5SA 5LLQA 5EF6A 4CO8A 2CQ7A 5FD5A 2E60A 4RB3C 4OWRB 2V26A 4WXHA 4LGWA 4RLFA 5F08A 1VQMI 4I0BA 3W3CA 3CCLI 5GP9A 3CCJI 1MSEC 3H9JA 3BOQA 2A5YB 4CCOA 1FIAA 2UV1A 1OR7A 1E17A 1W7PB 3PQKA 2XHKA 1VQ8I 1VZ0A 5KK1A 5CQGA 5EDNA 3GTQJ 1TWAJ 2MBFA 4HZFA 1UHMA 3BR2A 1ULYA 1R9TJ 3FXJA 3L7WA 3H1CA 1WKMA 2Q8KA 2V7FA 2ZB9A 3IH2A 1YG2A 4Q5SF 2MSYA 4M9SA 3J81Z 1XSDA 1LKXA 3BROA 3I0TA 2UUZA 1IJWC 2DOEA 2CUJA 3K2AA 4L0YB 2LRDA 5BPIA 5EYRA 2DFIA 3GUDA 2LVSA 3ZMDA 4CHUA 1M1EB 1MMSA 2ZBKA 3GLLA 2QKLB 2HDDA 1W0TA 4XN0A 3WTVC 4HQMA 1MH4A 1QRYA 3VYSB 2HQAA 1F9NA 4HNVA 2PJRA 2KIUA 1T8IA 2LF8A 3RPQA 4BAYA 3J7AY 3S1NJ 3SZTA 1LDJA 2XROA 1FP1D 2Y48A 3ZQGA 5EEAA 1UFMA 2H1LA 2R7VA 3KP3A 1IO2A 3S3MA 2DFEA 3PNVA 1G3WA 2RNJA 3G4SI 1OCCH 4EEFG 1O3RA 5AIPA 2X1EA 1ZTRA 5LEKA 1RR8C 3CC4I 2UXXA 2F2EA 4JQFA 4IHXA 3BJOA 4HA8A 1W1WE 2IJLA 1IN6A 2DOFA 3FF5A 4E6KG 4AWXB 3DCFA 2PJPA 1VI0A 4Z2YA 4C2UA 2O3FA 2EV6A 4FISA 1BOAA 1MNDA 2FD5A 2IT0A 4C2MJ 5J3LA 2LF7A 2A6HF 2Y0SA 3LA2A 1S72I 1V54H 1V3FA 3JRCA 1BN5A 1TLHB 2PI0A 3H3VK 1U9OA 1LEBA 5HDGA 3F22A 3DLAA 2L7MP 3FBNB 1BI1A 2MGQA 2R7RA 1YTYA 4TV7A 3CJNA 4PFOA 2LKXA 1I5ZA 2ECCA 2EV5A 3WE3A 2W4SA 3DKWA 4EJVA 4A3GJ 2NNNA 2L4MA 4F55A 3KZZA 3NWTA 3WU1B 3L00A 1XD7A 4LK1F 4XK4A 4BY7J 2I5UA 3JR9A 4CUGA 2Z5UA 5HDNA 1MBGA 2EV0A 1WSUA 2EZHA 3HPHA 1MMAA 1PUEE 5KNLA 1W5TA 3W6VA 4OIPF 4M74A 5IT3A 4XLFA 3TP0A 4ZYHA 3ROUA 2IBDA 5D5XB 4I6ZA 2CQNA 2ZMEA 4DYCA 3ERED 3CLOA 2CMPA 1RETA 5TGTA 1NG6A 4N0BA 4HX8A 2EFQA 1VQOI 5F1RA 2XVCA 4XLEA 2LDUA 2ID3A 2CU7A 4L5IA 5H2FC 1G3SA 2O0YA 4Y13A 5E3OA 1DQUA 3ZGKA 2BV6A 2JZYA 2ZFWA 3SFIA 4A3KJ 5L3CA 2LREA 5LEJA 2MYSA 3OYIA 1MZBA 4BJTA 5FKNA 4YG2F 4IHWA 4ZYDA 4PZJA 1VQ7I 3MZ8A 3REOA 3RZOJ 2Q2EB 3JRFA 1U8RA 4XKWA 3CC2I 1IUYA 2L0KA 4CCNA 4DGWB 3FXOA 3MKYB 3BR6A 1PUFA 2JUCA 1B4AA 2R7SA 2IS1A 3NRVA 2VI6A 1R22A 5CVJA 2R93J 3VWBA 1BR4A 2ZMEC 3SFZA 1XMXA 5KVRA 2CYYA 3FHNA 2HKXA 3AG4H 3BQYA 3DPUA 4Q4ZF 2NAZA 4YIRX 2O8XA 3OYFA 1VQKI 5D8LB 4N4NB 1EH6A 4BQNA 3BG5A 2VBZA 2VKDA 4X1EA 5B66C 4RM3A 2JVHA 4BDZA 2QVOA 1WJEA 2NS7A 4YIFA 3TOBA 3OWTA 1R49A 1FTZA 1N78A 1XGMA 5E79C 1GHCA 4L9NA 4L5JA 2PEXA 2NOGA 4GYGA 3OS0A 2XF7A 2OA4A 3OOPA 1JT6A 2KZGA 1KQ9A 2HXIA 3EPZA 4A3EJ 3RKYA 4ENKA 4HRIA 2WC2A 3M7GA 4XRFA 1JGSA 2CW0F 2M7AA 3KEQA 3ZQ7A 3OOUA 1LDKB 4A3IJ 5DS9A 2LBFB 4BNCA 3JRAA 4NC7A 4II3A 3S1RJ 5B1AH 1TNSA 1K4SA 4UB6C 4AIDA 3DKXA 4DIQA 2AQFA 2G7UA 3A0BC 4DQ2A 4I01A 1IZ1A 3WTZA 2QKMB 2W1OA 1ZKGA 3DTKA 3ERMA 3ZXSA 2GXAA 3E5XA 2XV4S 3A2KA 3CCSI 1NG7A 2EILH 2KPMA 4U7BA 1P4XA 1IDYA 3ASNH 3K70D 3ABTA 5LHGA 5D5WB 1P9QC 4AU7A 2DDBA 2DPUA 2JRMA 3EUHC 2L5QA 4IVNA 4A2UA 4BYYA 4BBSJ 3BG6A 2VT3A 2F5VA 5L3GA 3VSKA 1YOVB 3EUKL 2GXGA 3LSMA 1X1PA 2GA2A 2NXNB 5HLHA 3JREA 4UUVA 3TL4X 3FM5A 1XDUA 2DT7B 3PNTA 2X51A 3T0YA 2F5CA 4XOTA 5HS8A 2MC3A 3TDZC 2CJJA 3G2BA 4QPOA 1FT9A 1HW2A 3RQIA 1ZYRF 4HSTA 5H6RA 4CCKA 2JA5J 2A6TA 1N25A 4BQAA 1FP2A 2JWTA 2X9DA 2E5ZA 5HOOA 4KYWA 2WB1A 4RBOA 2XSDC 3OS2A 2NVTJ 3P9KA 2WBMA 3BP8A 1MGTA 4E4HA 4EGYA 3IKVA 1XTAA 1XC5A 2DFHA 2R4GA 4G6TB 3GTPJ 4V2GA 3PFIA 1OR7C 4V2FA 4DBRA 4PGGA 1S9HA 1B72B 3QPSA 4CDGA 5D6FA 2P6SA 3RKWA 2VXDA 3HGGA 3JRDA 3GO5A 3HOXJ 3F8CA 3K0LA 3GLXA 5FKLA 1SD6A 2GIZA 4CYCB 4DYRA 3E6CC 3E6MA 2KDOA 3A0HC 4ENJA 2MLGA 1F1ZA 3H0DA 5IP7J 1FOYA 1MJ9A 1FOXA 3HRMA 2K9QA 1V55H 2BGCA 2JA8J 2CG4A 4RAYA 1U6GA 2Z99A 2XAGA 2X6XA 3GWZA 2GAUA 4PJLA 3FMQA 1LPQA 3ML6A 1X1DA 3M1EA 4HEA2 4Z6YA 2DODA 3LSTA 4WK8F 4G7HF 1TW3A 4D5CA 2HQ5A 1FMVA 1USTA 1FNNA 2GOMA 1B8IA 2J5PA 1J5YA 2E2JJ 3A01B 2K9MA 1NH3A 4S05A 5IYCJ 4LLGF 5JHFA 3RPUD 2IW5A 3CMEI 4RM2A 5LD2C 1YYVA 1Y56A 2RGVA 1QGPA 2ELHA 1HKTA 1X3UA 1B9NA 2ZXIA 4FTHA 1WI9A 1ORKA 4LMYA 3H36A 1TWHJ 2GOXB 2EFNA 3CMAI 1ZRDA 5DEQA 4DZPA 3U2RA 1MMDA 3A4CA 3HOZJ 4QPQA 4BHPA 1YLFA 2IGMA 4I98B 3SYTA 3FHZA 4AUXA 2HU9A 1F4KA 2QQAA 4YIIA 3MCZA 2A6EF 5KCMA 2DMUA 2R5YA 2XPVA 2CRGA 4ZZDA 5FD6A 4GDFA 5ILVA 4EV0A 2Y0MA 5TJJA 3U21A 1CF7B 4RGRA 4L9VA 3E5QA 4EATA 3ABUA 2DTZA 3AFHA 2O03A 1TTYA 3DF8A 4IPAA 3VFZA 4HX7A 1VQ5I 4AM3A 3HRUA 4XORA 2JA6J 3C3WA 2XKOA 1TW2A 4ON0A 4IQ4A 3LSPA 3HJEA 1F36A 2DO7A 4XL9A 5GTHC 4KT5C 2WY8Q 2KFDA 5ICGA 3BTJA 5EEGA 1RNLA 2DMTA 2BEOA 1RPWA 3ZQHA 3QQAA 1IGNA 1X1AA 4MEYF 3QU3A 3BTLA 3CCVI 2E71A 3Q0WA 1MIJA 1H9TA 2ZXWH 1ZRFA 3M4OJ 1OYIA 2L7ZA 2WTEA 5ED4A 2X4HA 1JT0A 2LC2A 1X3WB 4PJJA 1SD4A 2DJIA 3JRIA 1HW5A 1BC7C 2P6TA 1R36A 2E2HJ 4K2EA 1UHSA 4BGDA 1REPC 1GVJA 1E3OC 1ZGWA 3Q9VA 4BACA 2EJRA 3P5JA 1XSVA 3CP2A 3BR0A 3JCUC 3F72A 4IL6C 2IAIA 2HKOA 1G8XA 3WG7H 3LA3A 2QEXI 1AOYA 3WG9A 1ETQA 2VQLA 4XLAA 3ZQCA 3K4CA 3RTRA 2FF4A 4HX4A 1JKRC 3H0GJ 3CQZJ 1I3QJ 1NK3P 5E20A 2QSFX 3A01A 3HUGB 4IKFA 1JKPC 2JSPA 1R5GA 4ZDLA 4PDKA 1QBJA 2HR3A 4BUPA 2A68F 1HDDC 3K7AJ 1H89C 4HF2A 4JYKA 3RCOA 2R7OA 1WJBA 2F48A 5FGMA 1YX5A 2QBYA 3OYHA 5FJ8J 4WXDA 2G0EA 3MKWB 1W7PD 3ZP5A 3F6OA 3M9AA 4A3FJ 1RUNA 1J59A 3HOYJ 1SMTA 1U3EM 1RKWA 3QYFA 2VOOA 1YE9A 3SDBA 9ANTA 3DBRB 2RNGA 4AIKA 1KU9A 1J0RA 1MBHA 2WV0A 1EA3A 3EETA 1AWCA 1ZELA 1OKRA 2HPMA 2EA2A 3BZ6A 2R5ZA 1W7PA 4M72A 2AQEA 3GFIA 1SD5A 5M5XJ 2KKOA 4A3LJ 1PDNC 3E3VA 5IT9Z 3MD2A 1HF0A 3FDYA 1Q1VA 1UMQA 5D5VB 3F0CA 3LL7A 5IPAA 3PSIA 4KT6A 3N4MA 3J7ZI 1OQYA 2BE5F 1CQTA 4ANJA 3BJ6A 1ERDA 1VQNI 3CDIA 2XASA 4LD5A 4WWCA 1DGRM 4IOCF 4EM2A 3CJTB 4PSWA 1DP3A 3TOAA 4II2A 4FQGA 3G3ZA 4CGZA 2E7WA 4M3EA 3S93A 2IEKA 2W84A 4A12A 1HBXG 3S2WA 1VTNC 4XKCA 4BHBA 3CDLA 3MMYB 2QCOA 1U9NA 1Y1VJ 2K02A 2Y0SN 2RREA 1JXSA 2FA5A 3KETA 1ETVA 2KIMA 4IHVA 2PMZA 4XNFA 1G3TA 2H6CA 2MD5A 2OBPA 2XGDA 3DQVC 2W24A 1I1GA 4IRGA 3OYEA 1FOKA 5D4SA 3BG7A 4IHSA 4QWQA 2R5YB 2QM3A 1I1SA 1X58A 1JJ6C 1A6QA 4UUSB 2BXYA 5L3EA 4GGGA 1CF7A 1ITYA 4ESBA 4WXCA 1SC7A 1BBYA 2E1MC 2PMUA 3I71A 2D45A 3PL8A 4PFPA 5C4XJ 1BM9A 3U9GA 4F93B 1D5YA 3K2ZA 2JRTA 3QP5A 2VQCA 4XLPF 3ZRGA 3KCCA 1ZG5A 2P5KA 5ICFA 5DD4A 2ZSIB 3EUAA 3BR5A 3PM1A 4YFNF 3JAMZ 5LHIA 4R79A 4RLQA 4XSXF 2DA4A 3CCQI 4E7KA 2NOJB 4NB5A 1E0EA 2VODA 2VJIA 5FRMA 2LYCA 5H6QA 2H1KA 1MSFC 3TEDA 1UELB 2EZKA 3IWZA 2DA5A 1G6NA 1GVDA 3V8KA 3QRFF 2BHYA 3NEUA 5FO5A 1TBXA 3I64A 2UWMA 4M3DA 2LMDA 2FUG2 3PUBA 2QSHX 3BTCA 1WJ5A 3GFJA 1HDPA 2NRAC 3PFYA 1R4NB 3OIQA 1I27A 2EZIA 5E3NA 3OYMA 4A3MJ 1B8IB 5K5RA 1IN8A 2MA3A 2NNYA 2Z2SB 3BPXA 2PQ8A 3IWFA 4M9ZA 3DTEA 3WU2C 4P55A 4YRVA 1SD7A 1VFCA 3KYDB 3LA7A 4LK0F 4I99C 1JGGA 1OCTC 2M9HA 3S17J 2Y9YA 2GM4A 3S2HJ 4G6DA 3WODF 2XRLA 2DMQA 2YSRA 1ETOA 4F7ZA 3E5UA 3HOTA 2L2OA 2HNHA 1WRJA 2CSOA 4RGSA 5F0CA 2HTJA 2CV1A 2VJ4A 3KLNA 4FX4A 1G59A 3A1YA 3RI4A 1K79A 3KEYA 4Y17A 4KNYA 4MFEA 5C4JJ 2QBYB 2X48A 2D5VA 3VOEA 1BJAA 3OSGA 1ETKA 1RKTA 1WJCA 1WPKA 3FM3A 4YFXF 4EVIA 5FKOA 1LNWA 1A6IA 2ISYA 1ZG3A 4RGUA 3AAFA 4A0XA 1WH5A 5HNHA 4ZJZA 1SVOA 1KU7A 3G1MA 2V79A 1F5TA 4I2OA 2EPFA 5HNFA 5J4YA 1J09A 2ME0A 3OYNA 2QWWA 4UV8A 1J7KA 2DAOA 3HUGA 1JE8A 4GFBA 1ZGAA 5B3SH 2M8GX 3GTGJ 3NQOA 1J2XA 4HQEA 5CPRB 2CQKA 4UUSA 4PSXA 2F5DA 3N05A 4HV5A 4CZCA 3H3UA 1WCMJ 3KZIC 3SQNA 4BEHA 4J19A 4FT8A 1XG1A 2MD0A 5E17F 4FE7A 3KP2A 2VPLA 2R7XA 1Z05A 3JAMK 5D4RA 2LY2A 1A35A 3BLYA 3OL4A 4PCQA 3CCRI 1G2HA 3HOVJ 1ON2A 1LE8B 1YW9A 3B73A 3QAHA 2FMYA 1Z3XA 2Y69H 1IRFA 4W97A 3BDDA 3QYEA 4D0PA 1JUPA 3ISPA 4IRIA 1KQ8A 4OMZA 2K7LA 2VE8A 1QO0D 3VODA 1XB4A 3IC7A 4OAYA 1T56A 2XSJC 1SVLA 3R6SA 1X19A 2OJED 2YUSA 5F0HA 3DBHB 2XRNA 3WTWC 3I9V2 1U2WA 2OD5A 1IRGA 4PGHA 1IW7F 2E1NA 3DEUA 3K1PA 2O8KA 2BW3B 3O8HA 4HNTA 1QHGA 2VC0A 3FKJA 2FQ4A 1EKEA 2FSWA 3I56I 2NVQJ 1ONVA 1JKOC 2Q1ZB 2HWVA 1IG7A 3UKGA 3KPHA 3Q9SA 2FEZA 1UG0A 4L9TA 4AYBA 3GTLJ 1FC3A 4BHCA 5BOXA 3S14J 1S7EA 1R1VA 3LSGA 4UHTA 3S3OA 3CP8A 3RQ4A 2DTRA 2QYOA 3OMYA 3QYBA 2Y31A 2R7UA 3PIPF 1TWFJ 1VQ9I 3CCEI 4XN3A 2HDWA 3O6BB 1YIJI 3DKYA 2K4JA 2HOTA 1Z3YA 4BXXJ 1A36A 3D5LA 2DA6A 1RIOH 2P8TA 1Z91A 1UCRA 2ZKZA 2IGNA 5F04A 2M4GA 1Z77A 5A2QZ 5GAHJ 3MVPA 2CV0A 4R8HA 2IGKA 3I4NJ 3FKIJ 3CUQA 4B09A 2GA1A 1YRNB 2V1UA 2H8WA 2Z1DA 2YU3A 3G1LA 1XN7A 1LDDA 3HRTA 4W1UA 4BL0B 5K7HA 4DJAA 3HL2A 4L9JA 1EJ9A 2LTPA 1H8AC 2JQ7A 1ACIA 4F91B 2GBYA 3H9GA 1IN4A 4XR6A 3VSLA 5TRDA 4A69C 2DOAA 1YS6A 2ZJPF 3E6DA 2W7NA 3CF5F 1QA6A 1GXQA 2EIJH 3CCYA 2VXZA 3K69A 1ETWA 5HVQC 4RB1A 2LOOA 4ZH4F 3D0SA 4NC8A 1WGXA 4IQJA 3BZCA 3S32A 3EQLF 2ZMEB 2P5LC 2MLKA 3G73A 3WTTC 2HI3A 3CTAA 2GLOA 5D6EA 3E1SA 1IRXA 2CO5A 1FYKA 2V1DA 4JP0A 3V7SA 4EGZA 4M6VA 3ZMSA 3HSFA 4D7NA 4HF0A 1APLC 1TZLA 5E18F 3S15J 4V19K 1ZAOA 5B5EC 3R4KA 3IRRA 2NVYJ 2CS3A 2C6YA 1S5LC 2L9RA 3IP4B 1LVKA 1NK2P 2FNPA 3CMMA 3IRQA 3HB9A 3QP6A 3BJAA 2ISZA 2FJ1A 2NS8A 4HDVA 1D1CA 1LJ9A 2BZTA 2KRFA 1W36D 1XGNA 3F3XA 2L02A 4BEHB 4PK4A 2OZ6A 1IUFA 2XAJA 1WVRA 2V9KA 3U1DA 1R1UA 2M4KA 1TT0A 2B63J 1EF4A 1FTTA 3HYIA 1P6RA 1Y8QB 3K6GA 2QQBA 2V9VA 3TW7A 4PJNA 4S0HB 2HQNA 3KLOA 4M3BA 4KMUX 4M71A 4UV9A 1K6OA 2LKSA 3K4KA 3ZQLA 1H0MA 1KYZA 4H0EA 1AU7A 2HDCA 2PG4A 1GV2A 3OIOA 4RB2C 3CDHA 2A07F 4NDLA 3IH4A 2MFZA 2LNBA 2ESNA 5CKTA 2QSGX 2M3AA 4LFUA 1Z7LA 1MNEA 3LSIA 4HNUA 5CLSA 2XAQA 1BW5A 3DLLF 2JPBA 5F27A 2LD5A 2OCEA 1X2MA 3C1DA 2HOEA 3LNQA 3ASOH 3BR3A 3E7LA 3GW2A 3CUOA 5AIQA 2X6YA 1BL0A 5GAGJ 4KITB 2PJRB 1KGSA 2RQQA 4XRMA 2IRFG 3ELKA 4PUSA 2XGXA 3FBIB 2VBXA 1D0YA 3GZ5A 2CQXA 2HFHA 1Z0XA 3CLQA 4IO9F 3ECHA 3QWLA 1V4RA 2FBHA 1K78B 1MMNA 3J7AO 1DU6A 3I54A 2XF5A 4HYEA 1WJDA 3VDXA 5F6FA 4ESFA 3HOSA 4GYIA 4ASNA 2X1CA 3DEWA 3CCUI 3CJRB 3DBLB 5DM7F 2KRHA 2E36A 4P9FA 1P4WA 3BR1A 4ITVA 1R4MB 5FFXA 2X6OA 4XLHA 5E1WA 3RYRA 2ZNZA 3W6KB 2VL8A 4A93J 3E0JB 3OYCA 2IS4A 3I53A 3LWFA 2MW8A 1BW6A 3ZMUA 2H27A 1ZLJA 3O3KA 3ZN0A 1KU3A 2VASA 4EQQA 3HPGA 1KZHA 1O3SA 4XBFA 1GDTA 3F8BA 2R7DA 6PAXA 1OJLA 5GPCA 3OR2C 1DDNA 4BJ5C 3M8FA 2CW7A 3J81K 1D0XA 3IH3A 1TC3C 4CZZA 2OPTA 2DQLA 3TP3A 4MTDA 5DDGA 1TQIA 3K1NA 2ZFUA 2KISA 1WJAA 2DXIA 1D1AA 1ZARA 4OU0A 1MD0A 1R6RA 3M3YJ 5M3MJ 2PN6A 2VN2A 2DA7A 2ACJA 1MDMB 3B6CA 1ZH5A 1YRNA 4ENMA 3K4MA 4C3JJ 1Y6IA 1V5EA 2L9VA 2XIGA 5ILUA 4F52A 1HW1A 4BQQA 3CESA 2WA0A 3ABMH 2BHZA 5KAIC 2PMHA 2XAUA 4ZYEA 5J40A 1AHDP 2KIFA 2OAZA 2NVXJ 5DTDA 2H94A 3S1QJ 5IOZA 2LLKA 4M3GA 1T38A 5IP6A 4XSZF 3AG2H 2KZVA 2YPRA 3GX4X 2P81A 5IOYA 3KX2A 1G3YA 2Y2ZA 2HGCA 2G7HA 3GTOJ 3FK7A 4X6AJ 1B72A 1XMAA 4KJZA 4MGRA 2WY7Q 2NVUB 3ZMVA 4A3BJ 3HEFA 1JJ8C 1F43A 3WHCA 2UXNA 5FLVA 4BH9A 1ZGJA 4UXNA 3OSFA 5DYMA 1YX3A 3IUOA 1JHFA 2OUMA 3V8LA 3RZDJ 1YIOA 2A3SA 4LG0A 4B3XA 1LFBA 4R1HA 2EIMH 2XB0X 5LRRA 4IF4A 2QUFA 4U87A 4ZYGA 1QHHD 1R23A 1RRJA 1UZCA 3ABLH 5M5YJ 4CCJA 2W85A 4MQVA 5ILSA 2ZJQF 3I55I 1FBQA 1FEXA 1Y0NA 1V5GA 2Y75A 1ZR4A 1T98A 1O4XA 4M73A 3QU6A 1IDZA 3L2CA 2ETHA 2X6WA 1QNTA 2STWA 3QPHA 3S16J 5K5OA 5CVRA 4WCGA 2O61A 3I4PA 2DYRH 4E7SA 2XF6A 2R0QC 1HC8A 3FXKA 1W0UA 3VYTB 2J5OA 1RUOA 2XPUA 3V42A 4DOZA 2VT2A 2DCEA 5LHHA 2CWEA 1O7LA 3W2VA 3N97A 1D8JA 4P1WA 1FZPB 5E3MA 2M30A 4MNUA 1CGPA 2B0LA 3MAJA 3TO7A 1YQAA 2R7FA 4KISA 4KN7X 4OMYA 4ENNA 4A0ZA 4BE0A 1H88C 1P92A 4FCYA 3J7YJ 2KIQA 3I5UA 2M5WA 3NARA 3Q0VA 4KUMA 5ERIA 1J9IA 2ZO4A 3L2VA 1MW7A 1LUJB 3T8RA 5ICCA 4YEJA 1X1BA 4QLCU 1PJRA 5IY5H 1K61A 1MMGA 1E2XA 2LY9A 3OL3A 1ETYA 3FWEA 1K78A 3H3ZA 1Y39A 1JHHA 1HKSA 4HAMA 2IGOA 1FBSA 3HKZN 2FBIA 2M2EA 3WHBA 4A6EA 2A05A 2H6BA 2L7FP 2P7VB 2AS5F 1O7FA 1Q1HA 1P7JA 2DU9A 3V8JA 4UNOA 3S8PA 2COBA 2EFOA 4IX7A 1VNDA 4B1RA 3O8GA 3OY9A 2W82A 4BXFA 2B7EA 1QZEA 1BC8C 2WAQA 1OFCX 4Q48A 1Z6RA 3PIOF 1QPIA 5IYDJ 1TT5B 1B9MA 2PMZN 3T8TA 4LIVA 3CO6C 4DBQA 2Y30A 1P7IA 1U5TC 2L54A 4ETSA 5HLIA 3KIOA 4WX9A 3HXLA 3F8NA 1I3AA 2GZWA 2HS5A 3DU5A 4D1QA 2M87A 1HA8A 1SFKA 2KDZA 4G7OF 5K1YA 2XC7A 2QLZA 5F1JA 3BTIA 5DM6F 2BVLA 3P9CA 3AL0B 5K7FA 1WH7A 3OR1C 2Q2EA 1GXPA 1B6AA 3V7CA 2O6GE 2M0CA 5LRSA 3T1BA 1IXCA 3KP7A 3NWSA 2MH2A 3HG9A 2K86A 1IV8A 4WF2A 1GLNA 1UJ8A 2QGUA 3HTSB 3FXRA 1ENHA 2FX0A 4EJTA 4JBAA 2L9NA 3M8EA 5L3FA 4C3HJ 3R61A 3ZQIA 1MH3A 1BJZA 5EGOA 1LQ1A 2HZTA 2BY0A 1A31A 5FROA 2Q0OA 2CV2A 3EYYA 2IA2A 4O6JA 1MDMA 1C0WA 1WI3A 3OYJA 3OYLA 5LGTA 4UVAA 3HGYA 2FU4A 3A03A 5LGUA 1A5JA 5M3FJ 1U8BA 5DUIA 4UY8I 5HDKA 1TNTA 2GXBA 4NHJA 1FMWA 4E7ZA 4XKBA 3K10A 2VE9A 3ZN1A 2RV8A 4RGXA 2F6CA 2KP6A 4F92B 1P4AA 3LAJA 2LSOA 5AONA 4ZC3A 4Y4RA 5IP9J 2FE3A 5LFAA 4CXFA 1MBEA 2DA2A 3TO9A 2IXSA 5C44J 2VKEA 2VONA 1YITI 1BI2A 4G8XA 5K7ZA 3H5AA 1RESA 3MWMA 1TL8A 2MABA 3DU6A 1U5TB 1IN7A 4LG0B 3A02A 1FLIA 1XX5A 5EZGA 4C9YA 3JSPA 2DMPA 4NC6A 2VB6A 2W57A 1JTYA 2JVGA 2V9PA 5IYBJ 4NQWB 1HSTA 1S7AA 2E1CA 5E8GA 2O9LA 1D1BA 5M5WJ 3MKLA 2NS0A 2DN0A 4LITA 4GXOA 4BDYA 2YU9J 1MKMA 1LE8A 3H9QA 3IAM2 4B8XA 4XLNF 1OLTA 4HPQA 2E5NA 2BY1A 3TW6A 5JHUA 3GZ6A 2E34A 2DA3A 2FOKA 3W2WA 2JA2A 4IOAF 1T6SA 4IRHA 3GXOA 4AD9A 5HLGA 2EK5A 2X85A 4OIRF 5EG0A 1OISA 2BXZA 2KT0A 3SZGA 5TISC 1STZA 2ICWG 2CFOA 1ZHFA 3OYGA 4E7JA 1SFEA 3OIPA 4HBLA 1SFOJ 3KP4A 3PQJA 1JUMA 3F9KA 1POGA 4MTEA 5BNGA 3DP7A 2K3PA 3M8JA 3F8MA 1BA5A 2EA4A 4PJ0C 4X0GA 5E8IA 2LP0A 2RKHA 2BW3A 3EDPA 1XSXA 4XKVA 1HXDA 2I10A 4EMSA 1XCBA 4G12A 5KAFC 1IXSB 3QODA 1O57A 4CICA 4N4OB 1KONA 1MJAA 2JA7J 5E1ZB 1FBUA 1L0OC 1HQCA 2HVQA 3JRBA 3IAS2 5F0FA 3LOCA 4ZYAA 3RYPA 1WFXA 4MLOA 2A61A 3HIFA 3OYKA 2ESHA 1SANA 4BKXA 2K40A 5KHDA 4I02A 5DD8A 2VC1A 4KMFA 4N9HA 3E6BA 2VQHA 3LSHA 5EEHA 5JLWA 3KFWX 1Y8RB 3JW4A 5FLXZ 3AKZA 5CQEA 4GCVA 2R3SA 3C18A 3ULQB 4CCLA 2OF7A 2AHQA 1Z9CA 3I59A 1IAWA 3KEOA 3COAC 3PO2J 3RPUA 2XGEA 3WE2A 5H20A 3ZMTA 3CD6I 3I58A 1Z21A 3IL2A 3AG1H 4RS8A 3X2QH 3CUQB 4A0YA 4B44A 1ZR2A 1RR7A 2HOSA 1LFUP 1XCVA 5JLXA 3L09A 4HF1A 3WTXC 1Z7UA 2V4JC 2DMNA 4LJZF 3KE2A 2DQRA 4IHYA 1ZK8A 2ZC2A 3H5RA 2AXLA 3GFMA 4KFCA 2VJ5A 3Q5FA 2O7OA 4ZDPA 4OIQF 2XDVA 3I4MJ 4AIJA 1BOBA 2D2WA 1I50J 5EZHA 4ZDOA 2ZNYA 5IT9K 1DGWY 1X4OA 4I76A 3JRHA 1OPCA 5EGOB 1OCRH 1XGOA 2R5ZB 1R00A 3EUHA 1QVUA 2EB7A 1Z6TA 1MBJA 2P5VA 5D8KB 2LFBA 1FIPA 4C3IJ 3B6AA 3DEEA 2V6CA 3FZVA 4IEJA 4AVZA 1Z67A 5BPDA 3CZ6A 4UVBA 2KQRA 1BR1A 4XM3A 2XKPA 4XIDA 3QOPA 2BOLA 4P5OA 5EG0B 4ZZLA 1FWZA 3BWGA 3K9TA 2Z3YA 1E3PA 3OYDA 2HEOA 2FNAA 1YO5C 3RKXA 4G9YA 4DNCA 4BY1J 4BS9A 2JJ7A 3M1CA 2H09A 3CO7C 2IA0A 1ZRCA 4RA2A 1SFXA 4L18B 4EJWA 2CQQA 2K9LA 3GF2A 3BY6A 1U78A 1WQ2A 3DPTA 3KZYA 3VPRA 4B47A 2PFBA 1T0FC 3LMMA 5K5QA 3MN2A 3KYCB 3MEXA 3LSJA 4MEXF 3W6JB 1WJFA 3F21A 1PYVA 4G7ZF 4CYDA 3HRSA 4JX6A 4B43A 1KQ0A 1R5ID 4NQWA 4LOCA 1G4DA 5HODA 3K4JA 2QF7A 4AIHA 4UB8C 2ME6A 3H5NA 2ADUA 2VJJA 4HW0A 1PP8F 2HVRA 3WGHA 3L2QA 4A3CJ 4JK1X 1MBKA 3HKZA 1HCRA 3BG3A 3CMYA 4MO7A 5C3EJ 4M3FA 1YW8A 4J01A 2JPCA 5F64A 1MBFA 1W36C 3BT9A 2PLYA 2DYSH 2BYVE 3DTIA 1N75A 3F23A 2IS6A 4XLCA 4QSHA 3TQNA 4C2TA 3M07A 1Y1WJ 2IVMA 4Y52J 2CUZA 3FXLA 2HTSA 4Y33A 2XB5A 3ZPLA 1NTCA 1P2FA 2M45A 3F8FA 5JFRA 2ZSHB 3WTYC 2XPWA 1VQPI 3R60A 1BI0A 4LG3A 5LGNA 4BU2A 4Q47A 1IC8A 3RSNA 2VOPA 1OMIA 3UR3C 3K4NA 5J4VA 2DLLA 1N77A 1ON1A 1USSA 2STTA 4JX5A 2DK5A 4I0AA 1WWXA 2N8GA 3P7NA 4CCMA 3GMEA 2WWYA 3C2HA 2DW4A 2HYJA 3KYLA 4RAFA 4OAZA 5J6XA 1JUSA 4Y3OA 4KIBA 1QU3A 1ZLKA 1LFPA 5CVUA 4EM0B 5CJ9A 3FX3A 5FKKA 3DPLC 4LB5A 3S3NA 4FETA 4L5EA 1YS7A 2L9SA 2EFWA 4XRSA 4CSWA 3BC8A 2X0LA 1DUXC 1DU0A 4U0VA 1RC9A 2MC4A 5J1RA 3KP5A 4M9XA 3QOEA 3AG3H 1OYYA 5HS7A 3E97A 4IZZA 4QIWN 4P96A 2EZLA 2M0MA 2DI3A 2RVCA 2K5CA 1K83J 3GCMA 1FY7A 1H9GA 2QENA 2RAEA 2LBFA 3MQ0A 1KU2A 3U1KA 1X1CA 1FYLA 3RDIA 2TDXA 1YJWI 5GTIC 3LSRA 4CA0A 2F5EA 2F4OB 3HTUA 3ZQFA 4ESJA 4HDUA 2LG4A 2BBYA 3ABKH 4IXAA 1D5VA 4RDUA 1S7OA 4XRSG 2VBYA 2RC4A 1R58A 2OQGA 3BPVA 3OYBA 1EH7A 1Z1DA 2V1NA 4OIOF 2CH0A 4XICA 1ZN2A 5FLMJ 2IS2A 3V7RA 2JK3A 1ETXA 2P0WA 1S3JA 2IP2A 5CYVA 2Y9ZA 2M7BA 4YFKF 4XQFA 5E1XA 1VF9A 2YX7A 3FXUA 4A3JJ 3ZCOA 3L9FA 2FXAA 4KIFA 3HHHA 3HSEA 4ABZA 5GAEJ 2QA4I 3CF2A 1TP4A 4RAZA 5JR3A 1YFHA 1YI2I 2FOWA 3ECOA 5DCMA 4ZTFA 2EINH 4EJOA 2M34A 3SZPA 1OCOH 2V6EA 2JT1A 3BCAA 2NYXA 4S04A 1RI7A 2K27A 3GTMJ 1PUFB 2W00A 1U0JA 2XAFA 1X3ZB 2I8DA 4NUBA 3C2BA 4MFDA 4OINF 3R0JA 1U5TA 2HYGD 3FXQA 1QQIA 4U7DA 1SAXA 2XAHA 2KJBA 1XGSA 4F3QA 2CUEA 3HHGA 3MFKA 1GV5A 1OCZH 5GADJ 2UZKA 1XS9A 1K4TA 2E1OA 3D5SC 4BE1A 2ELKA 4M6XA 1I39A 2X1DA 2EBIA 1IN5A 1T0FA 3CUQC 5FLXK 1VQ6I 2HYFA 3C7JA 2H8RA 1S8NA 2QQ9A 4NBQA 2HVSA 3OYAA 2EIKH 2HPIA 1SAUA 1EH8A 1SVMA 4A5MA 5L3BA 1S29A 3SJMA 1FYMA 1T95A 2ECBA 3BG9A 2KMUA 5BQTA 1UG2A 3PSFA 1WHUA 2G9WA 3IKTA 3HDDA 4Y7NJ 5FKMA 4E7IA 3WTUC 2HZDA 3G6EI 1TQPA 2E35A 3BCBA 2IA1A 2K9NA 3D5RC 1HSJA 1VQ4I 1W5CC 2OTJI 4DYQA 1L3LA 3FIWA 4I7HA 3JRGA 2RN7A 4HOBA 4U0WA 1QVTA 2FRHA 1OCPA 4QTRA 4P9UA 1R7JA 2F4IA 2JMWA 2A5WA 1IRZA 1IF1A 4I09A 3R0AA 3SEZA 1KYWA 5JVTA 2KHMA 1FPQA 5CVIA 2ELJA 2DDAA 3QPTA 3L2WA 1D8KA 1R5HA 3IHUA 5DCFA 1TWGJ 4OOIA 2YR2A 3ZOBA 1HOMA 2KL4A 5A2QK 5HS9A 2BVMA 4H4KC 2FQ3A 3TDUC 5HLTA 2JSCA 1R71A 2CGPA 2DPDA 2GIVA 3GBGA 3FXMA 2WAEA 3WGIA 1AKHA 1MJBA 4BXUA 4HG2A 3QPLA 1GT0C 2HXOA 3TKYA 5J8FA 2QQ8A 2R7WA 2A69F 2F4MB 2LKPA 2OQRA 3H92A 1UAAA 1TWCJ 2DFFA 2HOAA 3V4GA 3GTKJ 5J1UA 5D5UB 3SHFA 3C2GA 2OC6A 4AC0A 2D1HA 3HSRA 5EJCA 4RB0A 2VKVA 3Q0UA 1K7AA 1I6HJ 1ODDA 2EQRA 3I59B 3WTSC 4FE4A 2PX9A 3VYUB 3OS1A 2CW8A 3WU0A 2KJCA 1JI8A 1QPMA 4MQ9F 4CYCA 1XDSA 4LLLA 1A04A 3DFGA 4KDPA 2EH3A 1O3TA 2P4WA 4NNJA 3VB2A 4DW6A 3CJQB 1R1TA 2HQRA 1ZG1A 2R7TA 3RKQA 1UB9A 3K4LA 3EYIA 1T08B 2GQQA 5FB2A 4MHGA 2PBIA 1LB2A 3JSOA 1JTXA 1BI3A 3O2PE 1NHAA 4FASD 1ZREA 2W48A 2D1VA 5FFZA 4B48A 4DZJA 5FRNA 3ZR8X 2VBWA 2K85A 5J47A 3TBIA 2DBBA 4EJUA 3J80Z 4D9JA 4O3MA 4BE2A 5JVGF 2YS9A 2VLAA 3DXJF 4BJ6C 1KA8A 3MZHA 1IXRC 1V5FA 3PNYA 4G6QA 3HC7A 4O5VA 3P9IA 4BBRJ 4AVPA 3DV8A 4XONA 2IPQX 1E3HA 2OTLI 1QZZA 1VQLI 3OV8A 4L0ZB 2DJNA 4Y15A 4IJAA 1XMKA 3TO6A 3LQQA 3T5XA 2MH9A 4KIGA 3ZMZA 3HOWJ 1B1BA 3ESWB 2P7CB 3G71I 2W25A 1I6XA 3RIRA 2E2IJ 2KRCA 5E3LA 2ZCWA 4PJMA 3SEQA 2RQPA 4A5NA 4EM1A 4XMYA 3D1NI 4HV6A 2COMA 2F5FA 2WV1A 2E1MB 3W2AA 2DK8A 1OYWA 2VPRA 2K9SA 2M8EA 4BQOA 1RZ4A 4HLYA 2ID6A 2VQGA 5GPAA 5L3DA 2TRTA 4G94A 3GFLA 1BIBA 5DV5A 1T2KA 3IV5A 2R92J 3JTGA 3FK6A 2FMLA 4CH7A 1FJLA 2L4AA 2L3DA 3L2RA 1HLVA 4FX0A 1JKQC 1MNMC 1ZQ3P 1WZ2A 1XPXA 4MIMA 1IV6A 5JI6A 4E7LA 4GRIA 2JUGA 2O5RA 3K70C 1TQMA 4AYBN 4U0YA 2R7ZJ 4XOPA 1S6LA 2RDPA 1X2NA 4JX4A 3AL0C 4LLNA 3BQZA 4YELA 1DPRA 2LY1A 3UNGC 3L1PA 1SEUA 5J1YA 2JTVA 3LFKA 3HM5A 3G1OA 4KICA 4FHTA 1YHQI 3S1MJ 2CUFA 2WAQN 2DT6A 3LSKA 1YW7A 3PUFA 4UUTA 2OU2A 1FOWA 4RAGA 2VKHA 4C30A 1T33A 3Q3SA 4UVCA 2CFXA 5CVVA 3JTHA 3CC7I 1O3QA 1J75A 4LB6B 2LR8A 3VEPA 4D7MA 1YJNI 4D5FA 3FISA 4GO1A 4LIUA 2E19A 4HSRA 3VYRB 3J80K 2MG4A 4KN4X 3GTJJ 3LAPA 1PP7U 3GVAA 3K1MA 1LVAA 3GEZA 3B02A 2QZ8A 4HLXA 2AO9A 2L7KA 1DP7P 2K3FA 3HBLA 2XGCA 1BR2A 2GWRA 2ZJ2A 2VIXA 2BY3A 3KP6A 4A6DA 1GUUA 4ZTJA 2WAFA 1HKQA 2L01A 2JN6A 2EWNA 3S2DJ 2ZXJA 5B1BH 4N9IA 3CCMI 1D3YA 2BY2A 1B59A 2OZUA 3TMOA 3HOUJ 3SDGA 3GYHX 4E7HA 1AA7A 2AXTC 2M1BA 2K4BA 3HZJA 3FMSA 3I3LA 2YX4A 5BMZA 2ZXHA 1Y0UA 4JOMA 1W4MA 2Z9OA 2OV7A 2DT5A 2WADA 1LEAA 4IHTA 4A3DJ 1X4PA 1FSHA 2V1XA 1K6YA 1AKHB 3WGGA 5LBQA 3PJRA 1T39A 2B9SA 3H35A 2Z33A 1YJ9I 1FSEA 2E7XA 3BZKA 3ZQQA 2R7QA 4B4CA 2OCCH 3L2UA 3LFUA 4M6YA 2KLOA 5J8CA 3ONQA 3PO3J 1D0ZA 3LQRA 1UHWA 3FMRA 3GZNB 3NAUA 3F6VA 2VUMJ 4B3AA 3TGNA 2LH9A 2LK2A
chains in the Genus database with same CATH topology
2E2HJ 4BY1J 2JJ7A 1UHSA 2CQXA 1Z0XA 1E3OC 1ZGWA 2TCTA 2CQQA 2WB1N 1U78A 3VPRA 1DU6A 3BR0A 3MN2A 2IAIA 3LSJA 1ETQA 2DA1A 3ZQCA 3DEWA 5EF6A 4JX6A 3BR1A 1JKRC 4LOCA 3H0GJ 5HODA 3CQZJ 1I3QJ 2QF7A 2X6OA 5F08A 1NK3P 3A01A 1JKPC 2ME6A 4A93J 2MW8A 1BW6A 4A3CJ 1HDDC 1MBKA 5GP9A 1MSEC 3K7AJ 1H89C 1HCRA 4JYKA 1GDTA 3BG3A 3CMYA 4MO7A 5C3EJ 1OJLA 4M3FA 5GPCA 1FIAA 1MBFA 3BT9A 5FJ8J 3IH3A 2G0EA 1TC3C 2OPTA 4A3FJ 4QSHA 3TP3A 3HOYJ 5EDNA 3GTQJ 1Y1WJ 1RKWA 4Y52J 1TWAJ 3M3YJ 9ANTA 3BR2A 1R9TJ 5M3MJ 2XB5A 1NTCA 2DA7A 2ZB9A 3IH2A 3B6CA 1YRNA 2MSYA 1MBHA 4C3JJ 2XPWA 1IJWC 2R5ZA 1IC8A 3K2AA 5EYRA 5M5XJ 4A3LJ 4JX5A 1AHDP 2NVXJ 5DTDA 2LVSA 2N8GA 1HF0A 1Q1VA 1UMQA 5IOZA 3S1QJ 2LLKA 3F0CA 4M3GA 2HYJA 2HDDA 5IPAA 1W0TA 5IP6A 1JUSA 1MH4A 1QRYA 4HNVA 1CQTA 5FKKA 2P81A 3S1NJ 5IOYA 4L5EA 2Y2ZA 3ZQGA 5EEAA 3GTOJ 3FK7A 4X6AJ 1B72A 4XRSA 4A3BJ 3HEFA 1JJ8C 1DU0A 1F43A 3WHCA 5FLVA 4M3EA 3OSFA 4EEFG 5J1RA 2IEKA 3RZDJ 1ZTRA 4IHXA 1LFBA 2XB0X 3CDLA 4QIWN 2QCOA 1U9NA 2EZLA 1Y1VJ 1K83J 2Y0SN 1ETVA 2RAEA 4IHVA 3DCFA 1VI0A 2XGDA 5M5YJ 3LSRA 3ZQFA 4FISA 2R5YB 2FD5A 4RDUA 1X58A 1JJ6C 4UUSB 1FEXA 4XRSG 1ZR4A 4C2MJ 5J3LA 1O4XA 1IDZA 1ITYA 3JRCA 3S16J 3H3VK 1U9OA 2L7MP 4XICA 2MGQA 5FLMJ 2R0QC 2JK3A 5C4XJ 1ETXA 2LKXA 1D5YA 2Y9ZA 1W0UA 2ECCA 1VF9A 4A3JJ 2XPUA 4A3GJ 4ABZA 3BR5A 3PM1A 2DA4A 5E3MA 2M34A 4XK4A 4BY7J 2H1KA 3JR9A 1MSFC 3TEDA 2EZKA 1MBGA 2DA5A 2EZHA 1GVDA 1PUFB 3GTMJ 3W6VA 3C2BA 4MFDA 1H88C 4FCYA 3TP0A 4I6ZA 4M3DA 2IBDA 4DYCA 3NARA 3Q0VA 3BTCA 1HDPA 2CUEA 1GV5A 1XS9A 1RETA 2E1OA 2EZIA 5E3NA 4A3MJ 1K61A 2ELKA 2LY9A 1ETYA 2EBIA 2ID3A 3HKZN 2H8RA 2CU7A 2M2EA 1VFCA 3WHBA 1JGGA 3SJMA 1OCTC 2M9HA 2ECBA 2L7FP 3BG9A 5E3OA 3S17J 2Y9YA 1UG2A 2GM4A 3S2HJ 2XRLA 1P7JA 3SFIA 4A3KJ 3HDDA 4Y7NJ 2DMQA 5FKMA 2COBA 1VNDA 1ETOA 4B1RA 3O8GA 2K9NA 5FKNA 4IHWA 5F0CA 3RZOJ 3JRFA 1OFCX 1QPIA 4DYQA 2L0KA 3FIWA 5IYDJ 2PMZN 3BR6A 3JRGA 1PUFA 2Y30A 4MFEA 2VI6A 1P7IA 5C4JJ 2X48A 2D5VA 2R93J 1QVTA 1OCPA 4QTRA 3OSGA 1ETKA 1RKTA 1WPKA 2JMWA 1IRZA 3BQYA 5FKOA 1A6IA 1WH5A 3G1MA 2KDZA 3BG5A 5F1JA 2ME0A 3BTIA 1TWGJ 4X1EA 3ZOBA 1WH7A 5K7FA 1HOMA 4GFBA 2M8GX 2NS7A 3GTGJ 1FTZA 2M0CA 3GBGA 4UUSA 1AKHA 1WCMJ 4J19A 2NOGA 1XG1A 3QPLA 1JT6A 2HXOA 1GT0C 4FE7A 2HXIA 4A3EJ 1ENHA 2FX0A 4C3HJ 1TWCJ 3OOUA 2HOAA 3ZQIA 4A3IJ 3GTKJ 5J1UA 1MH3A 1G2HA 5DS9A 3HOVJ 4AC0A 1BJZA 5EGOA 3JRAA 1LE8B 3S1RJ 2VKVA 3Q0UA 1I6HJ 2EQRA 4FE4A 1WI3A 4W97A 1JUPA 4CYCA 1ZKGA 3HGYA 3A03A 2EH3A 1A5JA 1T56A 5M3FJ 4DW6A 1U8BA 1IDYA 2YUSA 5F0HA 3RKQA 1JTXA 2W48A 4DZJA 4BBSJ 5IP9J 2O8KA 3O8HA 1MBEA 2DA2A 5C44J 2VKEA 2YS9A 2FQ4A 5K7ZA 2NVQJ 1RESA 1JKOC 1IG7A 3JREA 3UKGA 4BBRJ 3A02A 5EZGA 2DMPA 1JTYA 2DJNA 5IYBJ 3GTLJ 3HOWJ 2CJJA 3S14J 2O9LA 1S7EA 2E2IJ 3RQIA 5E3LA 3LSGA 5M5WJ 3MKLA 2JA5J 2DN0A 2YU9J 3D1NI 1LE8A 2JWTA 2X9DA 2Y31A 1TWFJ 2WV1A 2HOTA 4BXXJ 2VPRA 2K9SA 3TW6A 2DA3A 4RBOA 2ID6A 2XSDC 5GPAA 2TRTA 2NVTJ 2DA6A 3IV5A 2R92J 3FK6A 5F04A 1Z77A 1XC5A 5EG0A 2KT0A 3GTPJ 3MVPA 4V2GA 1FJLA 4V2FA 1HLVA 1JKQC 3I4NJ 3FKIJ 1MNMC 1ZQ3P 1YRNB 1SFOJ 1B72B 3QPSA 4MIMA 4W1UA 3G1LA 1JUMA 5K7HA 1POGA 1IV6A 5BNGA 3HGGA 3JRDA 2LTPA 3HOXJ 1H8AC 2GBYA 4AYBN 5FKLA 2R7ZJ 1BA5A 4CYCB 4DYRA 1X2NA 4JX4A 2LP0A 4A69C 3BQZA 5IP7J 3L1PA 2K9QA 2JA8J 2I10A 5J1YA 3CCYA 1ETWA 3HM5A 3G1OA 4G12A 1WGXA 4D5CA 2JA7J 3S1MJ 2CUFA 2HQ5A 2WAQN 1B8IA 4UUTA 2HI3A 2E2JJ 2GLOA 3JRBA 1T33A 3Q3SA 3A01B 5F0FA 3LOCA 5IYCJ 4MLOA 4JP0A 4M6VA 4D7NA 1SANA 4BKXA 1APLC 2K40A 2LR8A 3S15J 4D7MA 4D5FA 2NVYJ 4FTHA 1ORKA 2L9RA 5JLWA 3FISA 1NK2P 1TWHJ 2E19A 3HB9A 2MG4A 4DZPA 3GTJJ 2FJ1A 2NS8A 2AHQA 2OF7A 3PO2J 2XGEA 2AO9A 3HOZJ 3HBLA 2XGCA 4AUXA 1ZR2A 1GUUA 1RR7A 2HOSA 2JN6A 1LFUP 3S2DJ 1IUFA 2DMUA 5JLXA 2R5YA 2XPVA 2CRGA 2B63J 1EF4A 1FTTA 2DMNA 4IHYA 1ZK8A 3HOUJ 3SDGA 3TW7A 4S0HB 1B8IB 4M3BA 2O7OA 2DTZA 3ZQLA 1AU7A 3I4MJ 1GV2A 3OIOA 4NDLA 2JA6J 3IH4A 1I50J 5EZHA 4I76A 3LSPA 1F36A 3JRHA 5EGOB 2R5ZB 4A3DJ 1QVUA 3BTJA 1MBJA 1AKHB 1BW5A 2LFBA 1FIPA 5F27A 4C3IJ 2DMTA 3B6AA 2LD5A 1X2MA 4IEJA 1RPWA 3ZQHA 3QQAA 1IGNA 3LNQA 4B4CA 3BR3A 3BTLA 3E7LA 3Q0WA 3M4OJ 1BL0A 2L7ZA 1JT0A 4XIDA 3PO3J 5EG0B 3NAUA 4XRMA 2VUMJ 3JRIA 4B3AA 2LK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2H J;  4BY1 J;  2JJ7 A;  1UHS A;  2CQX A;  1Z0X A;  1E3O C;  1ZGW A;  2TCT A;  2CQQ A;  2WB1 N;  1U78 A;  3VPR A;  1DU6 A;  3BR0 A;  3MN2 A;  2IAI A;  3LSJ A;  1ETQ A;  2DA1 A;  3ZQC A;  3DEW A;  5EF6 A;  4JX6 A;  3BR1 A;  1JKR C;  4LOC A;  3H0G J;  5HOD A;  3CQZ J;  1I3Q J;  2QF7 A;  2X6O A;  5F08 A;  1NK3 P;  3A01 A;  1JKP C;  2ME6 A;  4A93 J;  2MW8 A;  1BW6 A;  4A3C J;  1HDD C;  1MBK A;  5GP9 A;  1MSE C;  3K7A J;  1H89 C;  1HCR A;  4JYK A;  1GDT A;  3BG3 A;  3CMY A;  4MO7 A;  5C3E J;  1OJL A;  4M3F A;  5GPC A;  1FIA A;  1MBF A;  3BT9 A;  5FJ8 J;  3IH3 A;  2G0E A;  1TC3 C;  2OPT A;  4A3F J;  4QSH A;  3TP3 A;  3HOY J;  5EDN A;  3GTQ J;  1Y1W J;  1RKW A;  4Y52 J;  1TWA J;  3M3Y J;  9ANT A;  3BR2 A;  1R9T J;  5M3M J;  2XB5 A;  1NTC A;  2DA7 A;  2ZB9 A;  3IH2 A;  3B6C A;  1YRN A;  2MSY A;  1MBH A;  4C3J J;  2XPW A;  1IJW C;  2R5Z A;  1IC8 A;  3K2A A;  5EYR A;  5M5X J;  4A3L J;  4JX5 A;  1AHD P;  2NVX J;  5DTD A;  2LVS A;  2N8G A;  1HF0 A;  1Q1V A;  1UMQ A;  5IOZ A;  3S1Q J;  2LLK A;  3F0C A;  4M3G A;  2HYJ A;  2HDD A;  5IPA A;  1W0T A;  5IP6 A;  1JUS A;  1MH4 A;  1QRY A;  4HNV A;  1CQT A;  5FKK A;  2P81 A;  3S1N J;  5IOY A;  4L5E A;  2Y2Z A;  3ZQG A;  5EEA A;  3GTO J;  3FK7 A;  4X6A J;  1B72 A;  4XRS A;  4A3B J;  3HEF A;  1JJ8 C;  1DU0 A;  1F43 A;  3WHC A;  5FLV A;  4M3E A;  3OSF A;  4EEF G;  5J1R A;  2IEK A;  3RZD J;  1ZTR A;  4IHX A;  1LFB A;  2XB0 X;  3CDL A;  4QIW N;  2QCO A;  1U9N A;  2EZL A;  1Y1V J;  1K83 J;  2Y0S N;  1ETV A;  2RAE A;  4IHV A;  3DCF A;  1VI0 A;  2XGD A;  5M5Y J;  3LSR A;  3ZQF A;  4FIS A;  2R5Y B;  2FD5 A;  4RDU A;  1X58 A;  1JJ6 C;  4UUS B;  1FEX A;  4XRS G;  1ZR4 A;  4C2M J;  5J3L A;  1O4X A;  1IDZ A;  1ITY A;  3JRC A;  3S16 J;  3H3V K;  1U9O A;  2L7M P;  4XIC A;  2MGQ A;  5FLM J;  2R0Q C;  2JK3 A;  5C4X J;  1ETX A;  2LKX A;  1D5Y A;  2Y9Z A;  1W0U A;  2ECC A;  1VF9 A;  4A3J J;  2XPU A;  4A3G J;  4ABZ A;  3BR5 A;  3PM1 A;  2DA4 A;  5E3M A;  2M34 A;  4XK4 A;  4BY7 J;  2H1K A;  3JR9 A;  1MSF C;  3TED A;  2EZK A;  1MBG A;  2DA5 A;  2EZH A;  1GVD A;  1PUF B;  3GTM J;  3W6V A;  3C2B A;  4MFD A;  1H88 C;  4FCY A;  3TP0 A;  4I6Z A;  4M3D A;  2IBD A;  4DYC A;  3NAR A;  3Q0V A;  3BTC A;  1HDP A;  2CUE A;  1GV5 A;  1XS9 A;  1RET A;  2E1O A;  2EZI A;  5E3N A;  4A3M J;  1K61 A;  2ELK A;  2LY9 A;  1ETY A;  2EBI A;  2ID3 A;  3HKZ N;  2H8R A;  2CU7 A;  2M2E A;  1VFC A;  3WHB A;  1JGG A;  3SJM A;  1OCT C;  2M9H A;  2ECB A;  2L7F P;  3BG9 A;  5E3O A;  3S17 J;  2Y9Y A;  1UG2 A;  2GM4 A;  3S2H J;  2XRL A;  1P7J A;  3SFI A;  4A3K J;  3HDD A;  4Y7N J;  2DMQ A;  5FKM A;  2COB A;  1VND A;  1ETO A;  4B1R A;  3O8G A;  2K9N A;  5FKN A;  4IHW A;  5F0C A;  3RZO J;  3JRF A;  1OFC X;  1QPI A;  4DYQ A;  2L0K A;  3FIW A;  5IYD J;  2PMZ N;  3BR6 A;  3JRG A;  1PUF A;  2Y30 A;  4MFE A;  2VI6 A;  1P7I A;  5C4J J;  2X48 A;  2D5V A;  2R93 J;  1QVT A;  1OCP A;  4QTR A;  3OSG A;  1ETK A;  1RKT A;  1WPK A;  2JMW A;  1IRZ A;  3BQY A;  5FKO A;  1A6I A;  1WH5 A;  3G1M A;  2KDZ A;  3BG5 A;  5F1J A;  2ME0 A;  3BTI A;  1TWG J;  4X1E A;  3ZOB A;  1WH7 A;  5K7F A;  1HOM A;  4GFB A;  2M8G X;  2NS7 A;  3GTG J;  1FTZ A;  2M0C A;  3GBG A;  4UUS A;  1AKH A;  1WCM J;  4J19 A;  2NOG A;  1XG1 A;  3QPL A;  1JT6 A;  2HXO A;  1GT0 C;  4FE7 A;  2HXI A;  4A3E J;  1ENH A;  2FX0 A;  4C3H J;  1TWC J;  3OOU A;  2HOA A;  3ZQI A;  4A3I J;  3GTK J;  5J1U A;  1MH3 A;  1G2H A;  5DS9 A;  3HOV J;  4AC0 A;  1BJZ A;  5EGO A;  3JRA A;  1LE8 B;  3S1R J;  2VKV A;  3Q0U A;  1I6H J;  2EQR A;  4FE4 A;  1WI3 A;  4W97 A;  1JUP A;  4CYC A;  1ZKG A;  3HGY A;  3A03 A;  2EH3 A;  1A5J A;  1T56 A;  5M3F J;  4DW6 A;  1U8B A;  1IDY A;  2YUS A;  5F0H A;  3RKQ A;  1JTX A;  2W48 A;  4DZJ A;  4BBS J;  5IP9 J;  2O8K A;  3O8H A;  1MBE A;  2DA2 A;  5C44 J;  2VKE A;  2YS9 A;  2FQ4 A;  5K7Z A;  2NVQ J;  1RES A;  1JKO C;  1IG7 A;  3JRE A;  3UKG A;  4BBR J;  3A02 A;  5EZG A;  2DMP A;  1JTY A;  2DJN A;  5IYB J;  3GTL J;  3HOW J;  2CJJ A;  3S14 J;  2O9L A;  1S7E A;  2E2I J;  3RQI A;  5E3L A;  3LSG A;  5M5W J;  3MKL A;  2JA5 J;  2DN0 A;  2YU9 J;  3D1N I;  1LE8 A;  2JWT A;  2X9D A;  2Y31 A;  1TWF J;  2WV1 A;  2HOT A;  4BXX J;  2VPR A;  2K9S A;  3TW6 A;  2DA3 A;  4RBO A;  2ID6 A;  2XSD C;  5GPA A;  2TRT A;  2NVT J;  2DA6 A;  3IV5 A;  2R92 J;  3FK6 A;  5F04 A;  1Z77 A;  1XC5 A;  5EG0 A;  2KT0 A;  3GTP J;  3MVP A;  4V2G A;  1FJL A;  4V2F A;  1HLV A;  1JKQ C;  3I4N J;  3FKI J;  1MNM C;  1ZQ3 P;  1YRN B;  1SFO J;  1B72 B;  3QPS A;  4MIM A;  4W1U A;  3G1L A;  1JUM A;  5K7H A;  1POG A;  1IV6 A;  5BNG A;  3HGG A;  3JRD A;  2LTP A;  3HOX J;  1H8A C;  2GBY A;  4AYB N;  5FKL A;  2R7Z J;  1BA5 A;  4CYC B;  4DYR A;  1X2N A;  4JX4 A;  2LP0 A;  4A69 C;  3BQZ A;  5IP7 J;  3L1P A;  2K9Q A;  2JA8 J;  2I10 A;  5J1Y A;  3CCY A;  1ETW A;  3HM5 A;  3G1O A;  4G12 A;  1WGX A;  4D5C A;  2JA7 J;  3S1M J;  2CUF A;  2HQ5 A;  2WAQ N;  1B8I A;  4UUT A;  2HI3 A;  2E2J J;  2GLO A;  3JRB A;  1T33 A;  3Q3S A;  3A01 B;  5F0F A;  3LOC A;  5IYC J;  4MLO A;  4JP0 A;  4M6V A;  4D7N A;  1SAN A;  4BKX A;  1APL C;  2K40 A;  2LR8 A;  3S15 J;  4D7M A;  4D5F A;  2NVY J;  4FTH A;  1ORK A;  2L9R A;  5JLW A;  3FIS A;  1NK2 P;  1TWH J;  2E19 A;  3HB9 A;  2MG4 A;  4DZP A;  3GTJ J;  2FJ1 A;  2NS8 A;  2AHQ A;  2OF7 A;  3PO2 J;  2XGE A;  2AO9 A;  3HOZ J;  3HBL A;  2XGC A;  4AUX A;  1ZR2 A;  1GUU A;  1RR7 A;  2HOS A;  2JN6 A;  1LFU P;  3S2D J;  1IUF A;  2DMU A;  5JLX A;  2R5Y A;  2XPV A;  2CRG A;  2B63 J;  1EF4 A;  1FTT A;  2DMN A;  4IHY A;  1ZK8 A;  3HOU J;  3SDG A;  3TW7 A;  4S0H B;  1B8I B;  4M3B A;  2O7O A;  2DTZ A;  3ZQL A;  1AU7 A;  3I4M J;  1GV2 A;  3OIO A;  4NDL A;  2JA6 J;  3IH4 A;  1I50 J;  5EZH A;  4I76 A;  3LSP A;  1F36 A;  3JRH A;  5EGO B;  2R5Z B;  4A3D J;  1QVU A;  3BTJ A;  1MBJ A;  1AKH B;  1BW5 A;  2LFB A;  1FIP A;  5F27 A;  4C3I J;  2DMT A;  3B6A A;  2LD5 A;  1X2M A;  4IEJ A;  1RPW A;  3ZQH A;  3QQA A;  1IGN A;  3LNQ A;  4B4C A;  3BR3 A;  3BTL A;  3E7L A;  3Q0W A;  3M4O J;  1BL0 A;  2L7Z A;  1JT0 A;  4XID A;  3PO3 J;  5EG0 B;  3NAU A;  4XRM A;  2VUM J;  3JRI A;  4B3A A;  2LK2 A; 
#chains in the Genus database with same CATH topology
 2XUB A;  3K4B A;  3RJP A;  1BIA A;  3DWL E;  5ICE A;  1SFU A;  1QZY A;  2TCT A;  4J00 A;  1PVE A;  2EFP A;  2WB1 N;  4RMN A;  4E70 A;  2Z16 A;  5DCM B;  1FX7 A;  5DUK A;  5BS6 A;  3MZY A;  1EV7 A;  4U88 A;  1SMY F;  2FBK A;  3MKZ A;  3SXY A;  2DA1 A;  2ZJR F;  4KA4 A;  1DPU A;  1W5S A;  5LLQ A;  5EF6 A;  4CO8 A;  2CQ7 A;  5FD5 A;  2E60 A;  4RB3 C;  4OWR B;  2V26 A;  4WXH A;  4LGW A;  4RLF A;  5F08 A;  1VQM I;  4I0B A;  3W3C A;  3CCL I;  5GP9 A;  3CCJ I;  1MSE C;  3H9J A;  3BOQ A;  2A5Y B;  4CCO A;  1FIA A;  2UV1 A;  1OR7 A;  1E17 A;  1W7P B;  3PQK A;  2XHK A;  1VQ8 I;  1VZ0 A;  5KK1 A;  5CQG A;  5EDN A;  3GTQ J;  1TWA J;  2MBF A;  4HZF A;  1UHM A;  3BR2 A;  1ULY A;  1R9T J;  3FXJ A;  3L7W A;  3H1C A;  1WKM A;  2Q8K A;  2V7F A;  2ZB9 A;  3IH2 A;  1YG2 A;  4Q5S F;  2MSY A;  4M9S A;  3J81 Z;  1XSD A;  1LKX A;  3BRO A;  3I0T A;  2UUZ A;  1IJW C;  2DOE A;  2CUJ A;  3K2A A;  4L0Y B;  2LRD A;  5BPI A;  5EYR A;  2DFI A;  3GUD A;  2LVS A;  3ZMD A;  4CHU A;  1M1E B;  1MMS A;  2ZBK A;  3GLL A;  2QKL B;  2HDD A;  1W0T A;  4XN0 A;  3WTV C;  4HQM A;  1MH4 A;  1QRY A;  3VYS B;  2HQA A;  1F9N A;  4HNV A;  2PJR A;  2KIU A;  1T8I A;  2LF8 A;  3RPQ A;  4BAY A;  3J7A Y;  3S1N J;  3SZT A;  1LDJ A;  2XRO A;  1FP1 D;  2Y48 A;  3ZQG A;  5EEA A;  1UFM A;  2H1L A;  2R7V A;  3KP3 A;  1IO2 A;  3S3M A;  2DFE A;  3PNV A;  1G3W A;  2RNJ A;  3G4S I;  1OCC H;  4EEF G;  1O3R A;  5AIP A;  2X1E A;  1ZTR A;  5LEK A;  1RR8 C;  3CC4 I;  2UXX A;  2F2E A;  4JQF A;  4IHX A;  3BJO A;  4HA8 A;  1W1W E;  2IJL A;  1IN6 A;  2DOF A;  3FF5 A;  4E6K G;  4AWX B;  3DCF A;  2PJP A;  1VI0 A;  4Z2Y A;  4C2U A;  2O3F A;  2EV6 A;  4FIS A;  1BOA A;  1MND A;  2FD5 A;  2IT0 A;  4C2M J;  5J3L A;  2LF7 A;  2A6H F;  2Y0S A;  3LA2 A;  1S72 I;  1V54 H;  1V3F A;  3JRC A;  1BN5 A;  1TLH B;  2PI0 A;  3H3V K;  1U9O A;  1LEB A;  5HDG A;  3F22 A;  3DLA A;  2L7M P;  3FBN B;  1BI1 A;  2MGQ A;  2R7R A;  1YTY A;  4TV7 A;  3CJN A;  4PFO A;  2LKX A;  1I5Z A;  2ECC A;  2EV5 A;  3WE3 A;  2W4S A;  3DKW A;  4EJV A;  4A3G J;  2NNN A;  2L4M A;  4F55 A;  3KZZ A;  3NWT A;  3WU1 B;  3L00 A;  1XD7 A;  4LK1 F;  4XK4 A;  4BY7 J;  2I5U A;  3JR9 A;  4CUG A;  2Z5U A;  5HDN A;  1MBG A;  2EV0 A;  1WSU A;  2EZH A;  3HPH A;  1MMA A;  1PUE E;  5KNL A;  1W5T A;  3W6V A;  4OIP F;  4M74 A;  5IT3 A;  4XLF A;  3TP0 A;  4ZYH A;  3ROU A;  2IBD A;  5D5X B;  4I6Z A;  2CQN A;  2ZME A;  4DYC A;  3ERE D;  3CLO A;  2CMP A;  1RET A;  5TGT A;  1NG6 A;  4N0B A;  4HX8 A;  2EFQ A;  1VQO I;  5F1R A;  2XVC A;  4XLE A;  2LDU A;  2ID3 A;  2CU7 A;  4L5I A;  5H2F C;  1G3S A;  2O0Y A;  4Y13 A;  5E3O A;  1DQU A;  3ZGK A;  2BV6 A;  2JZY A;  2ZFW A;  3SFI A;  4A3K J;  5L3C A;  2LRE A;  5LEJ A;  2MYS A;  3OYI A;  1MZB A;  4BJT A;  5FKN A;  4YG2 F;  4IHW A;  4ZYD A;  4PZJ A;  1VQ7 I;  3MZ8 A;  3REO A;  3RZO J;  2Q2E B;  3JRF A;  1U8R A;  4XKW A;  3CC2 I;  1IUY A;  2L0K A;  4CCN A;  4DGW B;  3FXO A;  3MKY B;  3BR6 A;  1PUF A;  2JUC A;  1B4A A;  2R7S A;  2IS1 A;  3NRV A;  2VI6 A;  1R22 A;  5CVJ A;  2R93 J;  3VWB A;  1BR4 A;  2ZME C;  3SFZ A;  1XMX A;  5KVR A;  2CYY A;  3FHN A;  2HKX A;  3AG4 H;  3BQY A;  3DPU A;  4Q4Z F;  2NAZ A;  4YIR X;  2O8X A;  3OYF A;  1VQK I;  5D8L B;  4N4N B;  1EH6 A;  4BQN A;  3BG5 A;  2VBZ A;  2VKD A;  4X1E A;  5B66 C;  4RM3 A;  2JVH A;  4BDZ A;  2QVO A;  1WJE A;  2NS7 A;  4YIF A;  3TOB A;  3OWT A;  1R49 A;  1FTZ A;  1N78 A;  1XGM A;  5E79 C;  1GHC A;  4L9N A;  4L5J A;  2PEX A;  2NOG A;  4GYG A;  3OS0 A;  2XF7 A;  2OA4 A;  3OOP A;  1JT6 A;  2KZG A;  1KQ9 A;  2HXI A;  3EPZ A;  4A3E J;  3RKY A;  4ENK A;  4HRI A;  2WC2 A;  3M7G A;  4XRF A;  1JGS A;  2CW0 F;  2M7A A;  3KEQ A;  3ZQ7 A;  3OOU A;  1LDK B;  4A3I J;  5DS9 A;  2LBF B;  4BNC A;  3JRA A;  4NC7 A;  4II3 A;  3S1R J;  5B1A H;  1TNS A;  1K4S A;  4UB6 C;  4AID A;  3DKX A;  4DIQ A;  2AQF A;  2G7U A;  3A0B C;  4DQ2 A;  4I01 A;  1IZ1 A;  3WTZ A;  2QKM B;  2W1O A;  1ZKG A;  3DTK A;  3ERM A;  3ZXS A;  2GXA A;  3E5X A;  2XV4 S;  3A2K A;  3CCS I;  1NG7 A;  2EIL H;  2KPM A;  4U7B A;  1P4X A;  1IDY A;  3ASN H;  3K70 D;  3ABT A;  5LHG A;  5D5W B;  1P9Q C;  4AU7 A;  2DDB A;  2DPU A;  2JRM A;  3EUH C;  2L5Q A;  4IVN A;  4A2U A;  4BYY A;  4BBS J;  3BG6 A;  2VT3 A;  2F5V A;  5L3G A;  3VSK A;  1YOV B;  3EUK L;  2GXG A;  3LSM A;  1X1P A;  2GA2 A;  2NXN B;  5HLH A;  3JRE A;  4UUV A;  3TL4 X;  3FM5 A;  1XDU A;  2DT7 B;  3PNT A;  2X51 A;  3T0Y A;  2F5C A;  4XOT A;  5HS8 A;  2MC3 A;  3TDZ C;  2CJJ A;  3G2B A;  4QPO A;  1FT9 A;  1HW2 A;  3RQI A;  1ZYR F;  4HST A;  5H6R A;  4CCK A;  2JA5 J;  2A6T A;  1N25 A;  4BQA A;  1FP2 A;  2JWT A;  2X9D A;  2E5Z A;  5HOO A;  4KYW A;  2WB1 A;  4RBO A;  2XSD C;  3OS2 A;  2NVT J;  3P9K A;  2WBM A;  3BP8 A;  1MGT A;  4E4H A;  4EGY A;  3IKV A;  1XTA A;  1XC5 A;  2DFH A;  2R4G A;  4G6T B;  3GTP J;  4V2G A;  3PFI A;  1OR7 C;  4V2F A;  4DBR A;  4PGG A;  1S9H A;  1B72 B;  3QPS A;  4CDG A;  5D6F A;  2P6S A;  3RKW A;  2VXD A;  3HGG A;  3JRD A;  3GO5 A;  3HOX J;  3F8C A;  3K0L A;  3GLX A;  5FKL A;  1SD6 A;  2GIZ A;  4CYC B;  4DYR A;  3E6C C;  3E6M A;  2KDO A;  3A0H C;  4ENJ A;  2MLG A;  1F1Z A;  3H0D A;  5IP7 J;  1FOY A;  1MJ9 A;  1FOX A;  3HRM A;  2K9Q A;  1V55 H;  2BGC A;  2JA8 J;  2CG4 A;  4RAY A;  1U6G A;  2Z99 A;  2XAG A;  2X6X A;  3GWZ A;  2GAU A;  4PJL A;  3FMQ A;  1LPQ A;  3ML6 A;  1X1D A;  3M1E A;  4HEA 2;  4Z6Y A;  2DOD A;  3LST A;  4WK8 F;  4G7H F;  1TW3 A;  4D5C A;  2HQ5 A;  1FMV A;  1UST A;  1FNN A;  2GOM A;  1B8I A;  2J5P A;  1J5Y A;  2E2J J;  3A01 B;  2K9M A;  1NH3 A;  4S05 A;  5IYC J;  4LLG F;  5JHF A;  3RPU D;  2IW5 A;  3CME I;  4RM2 A;  5LD2 C;  1YYV A;  1Y56 A;  2RGV A;  1QGP A;  2ELH A;  1HKT A;  1X3U A;  1B9N A;  2ZXI A;  4FTH A;  1WI9 A;  1ORK A;  4LMY A;  3H36 A;  1TWH J;  2GOX B;  2EFN A;  3CMA I;  1ZRD A;  5DEQ A;  4DZP A;  3U2R A;  1MMD A;  3A4C A;  3HOZ J;  4QPQ A;  4BHP A;  1YLF A;  2IGM A;  4I98 B;  3SYT A;  3FHZ A;  4AUX A;  2HU9 A;  1F4K A;  2QQA A;  4YII A;  3MCZ A;  2A6E F;  5KCM A;  2DMU A;  2R5Y A;  2XPV A;  2CRG A;  4ZZD A;  5FD6 A;  4GDF A;  5ILV A;  4EV0 A;  2Y0M A;  5TJJ A;  3U21 A;  1CF7 B;  4RGR A;  4L9V A;  3E5Q A;  4EAT A;  3ABU A;  2DTZ A;  3AFH A;  2O03 A;  1TTY A;  3DF8 A;  4IPA A;  3VFZ A;  4HX7 A;  1VQ5 I;  4AM3 A;  3HRU A;  4XOR A;  2JA6 J;  3C3W A;  2XKO A;  1TW2 A;  4ON0 A;  4IQ4 A;  3LSP A;  3HJE A;  1F36 A;  2DO7 A;  4XL9 A;  5GTH C;  4KT5 C;  2WY8 Q;  2KFD A;  5ICG A;  3BTJ A;  5EEG A;  1RNL A;  2DMT A;  2BEO A;  1RPW A;  3ZQH A;  3QQA A;  1IGN A;  1X1A A;  4MEY F;  3QU3 A;  3BTL A;  3CCV I;  2E71 A;  3Q0W A;  1MIJ A;  1H9T A;  2ZXW H;  1ZRF A;  3M4O J;  1OYI A;  2L7Z A;  2WTE A;  5ED4 A;  2X4H A;  1JT0 A;  2LC2 A;  1X3W B;  4PJJ A;  1SD4 A;  2DJI A;  3JRI A;  1HW5 A;  1BC7 C;  2P6T A;  1R36 A;  2E2H J;  4K2E A;  1UHS A;  4BGD A;  1REP C;  1GVJ A;  1E3O C;  1ZGW A;  3Q9V A;  4BAC A;  2EJR A;  3P5J A;  1XSV A;  3CP2 A;  3BR0 A;  3JCU C;  3F72 A;  4IL6 C;  2IAI A;  2HKO A;  1G8X A;  3WG7 H;  3LA3 A;  2QEX I;  1AOY A;  3WG9 A;  1ETQ A;  2VQL A;  4XLA A;  3ZQC A;  3K4C A;  3RTR A;  2FF4 A;  4HX4 A;  1JKR C;  3H0G J;  3CQZ J;  1I3Q J;  1NK3 P;  5E20 A;  2QSF X;  3A01 A;  3HUG B;  4IKF A;  1JKP C;  2JSP A;  1R5G A;  4ZDL A;  4PDK A;  1QBJ A;  2HR3 A;  4BUP A;  2A68 F;  1HDD C;  3K7A J;  1H89 C;  4HF2 A;  4JYK A;  3RCO A;  2R7O A;  1WJB A;  2F48 A;  5FGM A;  1YX5 A;  2QBY A;  3OYH A;  5FJ8 J;  4WXD A;  2G0E A;  3MKW B;  1W7P D;  3ZP5 A;  3F6O A;  3M9A A;  4A3F J;  1RUN A;  1J59 A;  3HOY J;  1SMT A;  1U3E M;  1RKW A;  3QYF A;  2VOO A;  1YE9 A;  3SDB A;  9ANT A;  3DBR B;  2RNG A;  4AIK A;  1KU9 A;  1J0R A;  1MBH A;  2WV0 A;  1EA3 A;  3EET A;  1AWC A;  1ZEL A;  1OKR A;  2HPM A;  2EA2 A;  3BZ6 A;  2R5Z A;  1W7P A;  4M72 A;  2AQE A;  3GFI A;  1SD5 A;  5M5X J;  2KKO A;  4A3L J;  1PDN C;  3E3V A;  5IT9 Z;  3MD2 A;  1HF0 A;  3FDY A;  1Q1V A;  1UMQ A;  5D5V B;  3F0C A;  3LL7 A;  5IPA A;  3PSI A;  4KT6 A;  3N4M A;  3J7Z I;  1OQY A;  2BE5 F;  1CQT A;  4ANJ A;  3BJ6 A;  1ERD A;  1VQN I;  3CDI A;  2XAS A;  4LD5 A;  4WWC A;  1DGR M;  4IOC F;  4EM2 A;  3CJT B;  4PSW A;  1DP3 A;  3TOA A;  4II2 A;  4FQG A;  3G3Z A;  4CGZ A;  2E7W A;  4M3E A;  3S93 A;  2IEK A;  2W84 A;  4A12 A;  1HBX G;  3S2W A;  1VTN C;  4XKC A;  4BHB A;  3CDL A;  3MMY B;  2QCO A;  1U9N A;  1Y1V J;  2K02 A;  2Y0S N;  2RRE A;  1JXS A;  2FA5 A;  3KET A;  1ETV A;  2KIM A;  4IHV A;  2PMZ A;  4XNF A;  1G3T A;  2H6C A;  2MD5 A;  2OBP A;  2XGD A;  3DQV C;  2W24 A;  1I1G A;  4IRG A;  3OYE A;  1FOK A;  5D4S A;  3BG7 A;  4IHS A;  4QWQ A;  2R5Y B;  2QM3 A;  1I1S A;  1X58 A;  1JJ6 C;  1A6Q A;  4UUS B;  2BXY A;  5L3E A;  4GGG A;  1CF7 A;  1ITY A;  4ESB A;  4WXC A;  1SC7 A;  1BBY A;  2E1M C;  2PMU A;  3I71 A;  2D45 A;  3PL8 A;  4PFP A;  5C4X J;  1BM9 A;  3U9G A;  4F93 B;  1D5Y A;  3K2Z A;  2JRT A;  3QP5 A;  2VQC A;  4XLP F;  3ZRG A;  3KCC A;  1ZG5 A;  2P5K A;  5ICF A;  5DD4 A;  2ZSI B;  3EUA A;  3BR5 A;  3PM1 A;  4YFN F;  3JAM Z;  5LHI A;  4R79 A;  4RLQ A;  4XSX F;  2DA4 A;  3CCQ I;  4E7K A;  2NOJ B;  4NB5 A;  1E0E A;  2VOD A;  2VJI A;  5FRM A;  2LYC A;  5H6Q A;  2H1K A;  1MSF C;  3TED A;  1UEL B;  2EZK A;  3IWZ A;  2DA5 A;  1G6N A;  1GVD A;  3V8K A;  3QRF F;  2BHY A;  3NEU A;  5FO5 A;  1TBX A;  3I64 A;  2UWM A;  4M3D A;  2LMD A;  2FUG 2;  3PUB A;  2QSH X;  3BTC A;  1WJ5 A;  3GFJ A;  1HDP A;  2NRA C;  3PFY A;  1R4N B;  3OIQ A;  1I27 A;  2EZI A;  5E3N A;  3OYM A;  4A3M J;  1B8I B;  5K5R A;  1IN8 A;  2MA3 A;  2NNY A;  2Z2S B;  3BPX A;  2PQ8 A;  3IWF A;  4M9Z A;  3DTE A;  3WU2 C;  4P55 A;  4YRV A;  1SD7 A;  1VFC A;  3KYD B;  3LA7 A;  4LK0 F;  4I99 C;  1JGG A;  1OCT C;  2M9H A;  3S17 J;  2Y9Y A;  2GM4 A;  3S2H J;  4G6D A;  3WOD F;  2XRL A;  2DMQ A;  2YSR A;  1ETO A;  4F7Z A;  3E5U A;  3HOT A;  2L2O A;  2HNH A;  1WRJ A;  2CSO A;  4RGS A;  5F0C A;  2HTJ A;  2CV1 A;  2VJ4 A;  3KLN A;  4FX4 A;  1G59 A;  3A1Y A;  3RI4 A;  1K79 A;  3KEY A;  4Y17 A;  4KNY A;  4MFE A;  5C4J J;  2QBY B;  2X48 A;  2D5V A;  3VOE A;  1BJA A;  3OSG A;  1ETK A;  1RKT A;  1WJC A;  1WPK A;  3FM3 A;  4YFX F;  4EVI A;  5FKO A;  1LNW A;  1A6I A;  2ISY A;  1ZG3 A;  4RGU A;  3AAF A;  4A0X A;  1WH5 A;  5HNH A;  4ZJZ A;  1SVO A;  1KU7 A;  3G1M A;  2V79 A;  1F5T A;  4I2O A;  2EPF A;  5HNF A;  5J4Y A;  1J09 A;  2ME0 A;  3OYN A;  2QWW A;  4UV8 A;  1J7K A;  2DAO A;  3HUG A;  1JE8 A;  4GFB A;  1ZGA A;  5B3S H;  2M8G X;  3GTG J;  3NQO A;  1J2X A;  4HQE A;  5CPR B;  2CQK A;  4UUS A;  4PSX A;  2F5D A;  3N05 A;  4HV5 A;  4CZC A;  3H3U A;  1WCM J;  3KZI C;  3SQN A;  4BEH A;  4J19 A;  4FT8 A;  1XG1 A;  2MD0 A;  5E17 F;  4FE7 A;  3KP2 A;  2VPL A;  2R7X A;  1Z05 A;  3JAM K;  5D4R A;  2LY2 A;  1A35 A;  3BLY A;  3OL4 A;  4PCQ A;  3CCR I;  1G2H A;  3HOV J;  1ON2 A;  1LE8 B;  1YW9 A;  3B73 A;  3QAH A;  2FMY A;  1Z3X A;  2Y69 H;  1IRF A;  4W97 A;  3BDD A;  3QYE A;  4D0P A;  1JUP A;  3ISP A;  4IRI A;  1KQ8 A;  4OMZ A;  2K7L A;  2VE8 A;  1QO0 D;  3VOD A;  1XB4 A;  3IC7 A;  4OAY A;  1T56 A;  2XSJ C;  1SVL A;  3R6S A;  1X19 A;  2OJE D;  2YUS A;  5F0H A;  3DBH B;  2XRN A;  3WTW C;  3I9V 2;  1U2W A;  2OD5 A;  1IRG A;  4PGH A;  1IW7 F;  2E1N A;  3DEU A;  3K1P A;  2O8K A;  2BW3 B;  3O8H A;  4HNT A;  1QHG A;  2VC0 A;  3FKJ A;  2FQ4 A;  1EKE A;  2FSW A;  3I56 I;  2NVQ J;  1ONV A;  1JKO C;  2Q1Z B;  2HWV A;  1IG7 A;  3UKG A;  3KPH A;  3Q9S A;  2FEZ A;  1UG0 A;  4L9T A;  4AYB A;  3GTL J;  1FC3 A;  4BHC A;  5BOX A;  3S14 J;  1S7E A;  1R1V A;  3LSG A;  4UHT A;  3S3O A;  3CP8 A;  3RQ4 A;  2DTR A;  2QYO A;  3OMY A;  3QYB A;  2Y31 A;  2R7U A;  3PIP F;  1TWF J;  1VQ9 I;  3CCE I;  4XN3 A;  2HDW A;  3O6B B;  1YIJ I;  3DKY A;  2K4J A;  2HOT A;  1Z3Y A;  4BXX J;  1A36 A;  3D5L A;  2DA6 A;  1RIO H;  2P8T A;  1Z91 A;  1UCR A;  2ZKZ A;  2IGN A;  5F04 A;  2M4G A;  1Z77 A;  5A2Q Z;  5GAH J;  3MVP A;  2CV0 A;  4R8H A;  2IGK A;  3I4N J;  3FKI J;  3CUQ A;  4B09 A;  2GA1 A;  1YRN B;  2V1U A;  2H8W A;  2Z1D A;  2YU3 A;  3G1L A;  1XN7 A;  1LDD A;  3HRT A;  4W1U A;  4BL0 B;  5K7H A;  4DJA A;  3HL2 A;  4L9J A;  1EJ9 A;  2LTP A;  1H8A C;  2JQ7 A;  1ACI A;  4F91 B;  2GBY A;  3H9G A;  1IN4 A;  4XR6 A;  3VSL A;  5TRD A;  4A69 C;  2DOA A;  1YS6 A;  2ZJP F;  3E6D A;  2W7N A;  3CF5 F;  1QA6 A;  1GXQ A;  2EIJ H;  3CCY A;  2VXZ A;  3K69 A;  1ETW A;  5HVQ C;  4RB1 A;  2LOO A;  4ZH4 F;  3D0S A;  4NC8 A;  1WGX A;  4IQJ A;  3BZC A;  3S32 A;  3EQL F;  2ZME B;  2P5L C;  2MLK A;  3G73 A;  3WTT C;  2HI3 A;  3CTA A;  2GLO A;  5D6E A;  3E1S A;  1IRX A;  2CO5 A;  1FYK A;  2V1D A;  4JP0 A;  3V7S A;  4EGZ A;  4M6V A;  3ZMS A;  3HSF A;  4D7N A;  4HF0 A;  1APL C;  1TZL A;  5E18 F;  3S15 J;  4V19 K;  1ZAO A;  5B5E C;  3R4K A;  3IRR A;  2NVY J;  2CS3 A;  2C6Y A;  1S5L C;  2L9R A;  3IP4 B;  1LVK A;  1NK2 P;  2FNP A;  3CMM A;  3IRQ A;  3HB9 A;  3QP6 A;  3BJA A;  2ISZ A;  2FJ1 A;  2NS8 A;  4HDV A;  1D1C A;  1LJ9 A;  2BZT A;  2KRF A;  1W36 D;  1XGN A;  3F3X A;  2L02 A;  4BEH B;  4PK4 A;  2OZ6 A;  1IUF A;  2XAJ A;  1WVR A;  2V9K A;  3U1D A;  1R1U A;  2M4K A;  1TT0 A;  2B63 J;  1EF4 A;  1FTT A;  3HYI A;  1P6R A;  1Y8Q B;  3K6G A;  2QQB A;  2V9V A;  3TW7 A;  4PJN A;  4S0H B;  2HQN A;  3KLO A;  4M3B A;  4KMU X;  4M71 A;  4UV9 A;  1K6O A;  2LKS A;  3K4K A;  3ZQL A;  1H0M A;  1KYZ A;  4H0E A;  1AU7 A;  2HDC A;  2PG4 A;  1GV2 A;  3OIO A;  4RB2 C;  3CDH A;  2A07 F;  4NDL A;  3IH4 A;  2MFZ A;  2LNB A;  2ESN A;  5CKT A;  2QSG X;  2M3A A;  4LFU A;  1Z7L A;  1MNE A;  3LSI A;  4HNU A;  5CLS A;  2XAQ A;  1BW5 A;  3DLL F;  2JPB A;  5F27 A;  2LD5 A;  2OCE A;  1X2M A;  3C1D A;  2HOE A;  3LNQ A;  3ASO H;  3BR3 A;  3E7L A;  3GW2 A;  3CUO A;  5AIQ A;  2X6Y A;  1BL0 A;  5GAG J;  4KIT B;  2PJR B;  1KGS A;  2RQQ A;  4XRM A;  2IRF G;  3ELK A;  4PUS A;  2XGX A;  3FBI B;  2VBX A;  1D0Y A;  3GZ5 A;  2CQX A;  2HFH A;  1Z0X A;  3CLQ A;  4IO9 F;  3ECH A;  3QWL A;  1V4R A;  2FBH A;  1K78 B;  1MMN A;  3J7A O;  1DU6 A;  3I54 A;  2XF5 A;  4HYE A;  1WJD A;  3VDX A;  5F6F A;  4ESF A;  3HOS A;  4GYI A;  4ASN A;  2X1C A;  3DEW A;  3CCU I;  3CJR B;  3DBL B;  5DM7 F;  2KRH A;  2E36 A;  4P9F A;  1P4W A;  3BR1 A;  4ITV A;  1R4M B;  5FFX A;  2X6O A;  4XLH A;  5E1W A;  3RYR A;  2ZNZ A;  3W6K B;  2VL8 A;  4A93 J;  3E0J B;  3OYC A;  2IS4 A;  3I53 A;  3LWF A;  2MW8 A;  1BW6 A;  3ZMU A;  2H27 A;  1ZLJ A;  3O3K A;  3ZN0 A;  1KU3 A;  2VAS A;  4EQQ A;  3HPG A;  1KZH A;  1O3S A;  4XBF A;  1GDT A;  3F8B A;  2R7D A;  6PAX A;  1OJL A;  5GPC A;  3OR2 C;  1DDN A;  4BJ5 C;  3M8F A;  2CW7 A;  3J81 K;  1D0X A;  3IH3 A;  1TC3 C;  4CZZ A;  2OPT A;  2DQL A;  3TP3 A;  4MTD A;  5DDG A;  1TQI A;  3K1N A;  2ZFU A;  2KIS A;  1WJA A;  2DXI A;  1D1A A;  1ZAR A;  4OU0 A;  1MD0 A;  1R6R A;  3M3Y J;  5M3M J;  2PN6 A;  2VN2 A;  2DA7 A;  2ACJ A;  1MDM B;  3B6C A;  1ZH5 A;  1YRN A;  4ENM A;  3K4M A;  4C3J J;  1Y6I A;  1V5E A;  2L9V A;  2XIG A;  5ILU A;  4F52 A;  1HW1 A;  4BQQ A;  3CES A;  2WA0 A;  3ABM H;  2BHZ A;  5KAI C;  2PMH A;  2XAU A;  4ZYE A;  5J40 A;  1AHD P;  2KIF A;  2OAZ A;  2NVX J;  5DTD A;  2H94 A;  3S1Q J;  5IOZ A;  2LLK A;  4M3G A;  1T38 A;  5IP6 A;  4XSZ F;  3AG2 H;  2KZV A;  2YPR A;  3GX4 X;  2P81 A;  5IOY A;  3KX2 A;  1G3Y A;  2Y2Z A;  2HGC A;  2G7H A;  3GTO J;  3FK7 A;  4X6A J;  1B72 A;  1XMA A;  4KJZ A;  4MGR A;  2WY7 Q;  2NVU B;  3ZMV A;  4A3B J;  3HEF A;  1JJ8 C;  1F43 A;  3WHC A;  2UXN A;  5FLV A;  4BH9 A;  1ZGJ A;  4UXN A;  3OSF A;  5DYM A;  1YX3 A;  3IUO A;  1JHF A;  2OUM A;  3V8L A;  3RZD J;  1YIO A;  2A3S A;  4LG0 A;  4B3X A;  1LFB A;  4R1H A;  2EIM H;  2XB0 X;  5LRR A;  4IF4 A;  2QUF A;  4U87 A;  4ZYG A;  1QHH D;  1R23 A;  1RRJ A;  1UZC A;  3ABL H;  5M5Y J;  4CCJ A;  2W85 A;  4MQV A;  5ILS A;  2ZJQ F;  3I55 I;  1FBQ A;  1FEX A;  1Y0N A;  1V5G A;  2Y75 A;  1ZR4 A;  1T98 A;  1O4X A;  4M73 A;  3QU6 A;  1IDZ A;  3L2C A;  2ETH A;  2X6W A;  1QNT A;  2STW A;  3QPH A;  3S16 J;  5K5O A;  5CVR A;  4WCG A;  2O61 A;  3I4P A;  2DYR H;  4E7S A;  2XF6 A;  2R0Q C;  1HC8 A;  3FXK A;  1W0U A;  3VYT B;  2J5O A;  1RUO A;  2XPU A;  3V42 A;  4DOZ A;  2VT2 A;  2DCE A;  5LHH A;  2CWE A;  1O7L A;  3W2V A;  3N97 A;  1D8J A;  4P1W A;  1FZP B;  5E3M A;  2M30 A;  4MNU A;  1CGP A;  2B0L A;  3MAJ A;  3TO7 A;  1YQA A;  2R7F A;  4KIS A;  4KN7 X;  4OMY A;  4ENN A;  4A0Z A;  4BE0 A;  1H88 C;  1P92 A;  4FCY A;  3J7Y J;  2KIQ A;  3I5U A;  2M5W A;  3NAR A;  3Q0V A;  4KUM A;  5ERI A;  1J9I A;  2ZO4 A;  3L2V A;  1MW7 A;  1LUJ B;  3T8R A;  5ICC A;  4YEJ A;  1X1B A;  4QLC U;  1PJR A;  5IY5 H;  1K61 A;  1MMG A;  1E2X A;  2LY9 A;  3OL3 A;  1ETY A;  3FWE A;  1K78 A;  3H3Z A;  1Y39 A;  1JHH A;  1HKS A;  4HAM A;  2IGO A;  1FBS A;  3HKZ N;  2FBI A;  2M2E A;  3WHB A;  4A6E A;  2A05 A;  2H6B A;  2L7F P;  2P7V B;  2AS5 F;  1O7F A;  1Q1H A;  1P7J A;  2DU9 A;  3V8J A;  4UNO A;  3S8P A;  2COB A;  2EFO A;  4IX7 A;  1VND A;  4B1R A;  3O8G A;  3OY9 A;  2W82 A;  4BXF A;  2B7E A;  1QZE A;  1BC8 C;  2WAQ A;  1OFC X;  4Q48 A;  1Z6R A;  3PIO F;  1QPI A;  5IYD J;  1TT5 B;  1B9M A;  2PMZ N;  3T8T A;  4LIV A;  3CO6 C;  4DBQ A;  2Y30 A;  1P7I A;  1U5T C;  2L54 A;  4ETS A;  5HLI A;  3KIO A;  4WX9 A;  3HXL A;  3F8N A;  1I3A A;  2GZW A;  2HS5 A;  3DU5 A;  4D1Q A;  2M87 A;  1HA8 A;  1SFK A;  2KDZ A;  4G7O F;  5K1Y A;  2XC7 A;  2QLZ A;  5F1J A;  3BTI A;  5DM6 F;  2BVL A;  3P9C A;  3AL0 B;  5K7F A;  1WH7 A;  3OR1 C;  2Q2E A;  1GXP A;  1B6A A;  3V7C A;  2O6G E;  2M0C A;  5LRS A;  3T1B A;  1IXC A;  3KP7 A;  3NWS A;  2MH2 A;  3HG9 A;  2K86 A;  1IV8 A;  4WF2 A;  1GLN A;  1UJ8 A;  2QGU A;  3HTS B;  3FXR A;  1ENH A;  2FX0 A;  4EJT A;  4JBA A;  2L9N A;  3M8E A;  5L3F A;  4C3H J;  3R61 A;  3ZQI A;  1MH3 A;  1BJZ A;  5EGO A;  1LQ1 A;  2HZT A;  2BY0 A;  1A31 A;  5FRO A;  2Q0O A;  2CV2 A;  3EYY A;  2IA2 A;  4O6J A;  1MDM A;  1C0W A;  1WI3 A;  3OYJ A;  3OYL A;  5LGT A;  4UVA A;  3HGY A;  2FU4 A;  3A03 A;  5LGU A;  1A5J A;  5M3F J;  1U8B A;  5DUI A;  4UY8 I;  5HDK A;  1TNT A;  2GXB A;  4NHJ A;  1FMW A;  4E7Z A;  4XKB A;  3K10 A;  2VE9 A;  3ZN1 A;  2RV8 A;  4RGX A;  2F6C A;  2KP6 A;  4F92 B;  1P4A A;  3LAJ A;  2LSO A;  5AON A;  4ZC3 A;  4Y4R A;  5IP9 J;  2FE3 A;  5LFA A;  4CXF A;  1MBE A;  2DA2 A;  3TO9 A;  2IXS A;  5C44 J;  2VKE A;  2VON A;  1YIT I;  1BI2 A;  4G8X A;  5K7Z A;  3H5A A;  1RES A;  3MWM A;  1TL8 A;  2MAB A;  3DU6 A;  1U5T B;  1IN7 A;  4LG0 B;  3A02 A;  1FLI A;  1XX5 A;  5EZG A;  4C9Y A;  3JSP A;  2DMP A;  4NC6 A;  2VB6 A;  2W57 A;  1JTY A;  2JVG A;  2V9P A;  5IYB J;  4NQW B;  1HST A;  1S7A A;  2E1C A;  5E8G A;  2O9L A;  1D1B A;  5M5W J;  3MKL A;  2NS0 A;  2DN0 A;  4LIT A;  4GXO A;  4BDY A;  2YU9 J;  1MKM A;  1LE8 A;  3H9Q A;  3IAM 2;  4B8X A;  4XLN F;  1OLT A;  4HPQ A;  2E5N A;  2BY1 A;  3TW6 A;  5JHU A;  3GZ6 A;  2E34 A;  2DA3 A;  2FOK A;  3W2W A;  2JA2 A;  4IOA F;  1T6S A;  4IRH A;  3GXO A;  4AD9 A;  5HLG A;  2EK5 A;  2X85 A;  4OIR F;  5EG0 A;  1OIS A;  2BXZ A;  2KT0 A;  3SZG A;  5TIS C;  1STZ A;  2ICW G;  2CFO A;  1ZHF A;  3OYG A;  4E7J A;  1SFE A;  3OIP A;  4HBL A;  1SFO J;  3KP4 A;  3PQJ A;  1JUM A;  3F9K A;  1POG A;  4MTE A;  5BNG A;  3DP7 A;  2K3P A;  3M8J A;  3F8M A;  1BA5 A;  2EA4 A;  4PJ0 C;  4X0G A;  5E8I A;  2LP0 A;  2RKH A;  2BW3 A;  3EDP A;  1XSX A;  4XKV A;  1HXD A;  2I10 A;  4EMS A;  1XCB A;  4G12 A;  5KAF C;  1IXS B;  3QOD A;  1O57 A;  4CIC A;  4N4O B;  1KON A;  1MJA A;  2JA7 J;  5E1Z B;  1FBU A;  1L0O C;  1HQC A;  2HVQ A;  3JRB A;  3IAS 2;  5F0F A;  3LOC A;  4ZYA A;  3RYP A;  1WFX A;  4MLO A;  2A61 A;  3HIF A;  3OYK A;  2ESH A;  1SAN A;  4BKX A;  2K40 A;  5KHD A;  4I02 A;  5DD8 A;  2VC1 A;  4KMF A;  4N9H A;  3E6B A;  2VQH A;  3LSH A;  5EEH A;  5JLW A;  3KFW X;  1Y8R B;  3JW4 A;  5FLX Z;  3AKZ A;  5CQE A;  4GCV A;  2R3S A;  3C18 A;  3ULQ B;  4CCL A;  2OF7 A;  2AHQ A;  1Z9C A;  3I59 A;  1IAW A;  3KEO A;  3COA C;  3PO2 J;  3RPU A;  2XGE A;  3WE2 A;  5H20 A;  3ZMT A;  3CD6 I;  3I58 A;  1Z21 A;  3IL2 A;  3AG1 H;  4RS8 A;  3X2Q H;  3CUQ B;  4A0Y A;  4B44 A;  1ZR2 A;  1RR7 A;  2HOS A;  1LFU P;  1XCV A;  5JLX A;  3L09 A;  4HF1 A;  3WTX C;  1Z7U A;  2V4J C;  2DMN A;  4LJZ F;  3KE2 A;  2DQR A;  4IHY A;  1ZK8 A;  2ZC2 A;  3H5R A;  2AXL A;  3GFM A;  4KFC A;  2VJ5 A;  3Q5F A;  2O7O A;  4ZDP A;  4OIQ F;  2XDV A;  3I4M J;  4AIJ A;  1BOB A;  2D2W A;  1I50 J;  5EZH A;  4ZDO A;  2ZNY A;  5IT9 K;  1DGW Y;  1X4O A;  4I76 A;  3JRH A;  1OPC A;  5EGO B;  1OCR H;  1XGO A;  2R5Z B;  1R00 A;  3EUH A;  1QVU A;  2EB7 A;  1Z6T A;  1MBJ A;  2P5V A;  5D8K B;  2LFB A;  1FIP A;  4C3I J;  3B6A A;  3DEE A;  2V6C A;  3FZV A;  4IEJ A;  4AVZ A;  1Z67 A;  5BPD A;  3CZ6 A;  4UVB A;  2KQR A;  1BR1 A;  4XM3 A;  2XKP A;  4XID A;  3QOP A;  2BOL A;  4P5O A;  5EG0 B;  4ZZL A;  1FWZ A;  3BWG A;  3K9T A;  2Z3Y A;  1E3P A;  3OYD A;  2HEO A;  2FNA A;  1YO5 C;  3RKX A;  4G9Y A;  4DNC A;  4BY1 J;  4BS9 A;  2JJ7 A;  3M1C A;  2H09 A;  3CO7 C;  2IA0 A;  1ZRC A;  4RA2 A;  1SFX A;  4L18 B;  4EJW A;  2CQQ A;  2K9L A;  3GF2 A;  3BY6 A;  1U78 A;  1WQ2 A;  3DPT A;  3KZY A;  3VPR A;  4B47 A;  2PFB A;  1T0F C;  3LMM A;  5K5Q A;  3MN2 A;  3KYC B;  3MEX A;  3LSJ A;  4MEX F;  3W6J B;  1WJF A;  3F21 A;  1PYV A;  4G7Z F;  4CYD A;  3HRS A;  4JX6 A;  4B43 A;  1KQ0 A;  1R5I D;  4NQW A;  4LOC A;  1G4D A;  5HOD A;  3K4J A;  2QF7 A;  4AIH A;  4UB8 C;  2ME6 A;  3H5N A;  2ADU A;  2VJJ A;  4HW0 A;  1PP8 F;  2HVR A;  3WGH A;  3L2Q A;  4A3C J;  4JK1 X;  1MBK A;  3HKZ A;  1HCR A;  3BG3 A;  3CMY A;  4MO7 A;  5C3E J;  4M3F A;  1YW8 A;  4J01 A;  2JPC A;  5F64 A;  1MBF A;  1W36 C;  3BT9 A;  2PLY A;  2DYS H;  2BYV E;  3DTI A;  1N75 A;  3F23 A;  2IS6 A;  4XLC A;  4QSH A;  3TQN A;  4C2T A;  3M07 A;  1Y1W J;  2IVM A;  4Y52 J;  2CUZ A;  3FXL A;  2HTS A;  4Y33 A;  2XB5 A;  3ZPL A;  1NTC A;  1P2F A;  2M45 A;  3F8F A;  5JFR A;  2ZSH B;  3WTY C;  2XPW A;  1VQP I;  3R60 A;  1BI0 A;  4LG3 A;  5LGN A;  4BU2 A;  4Q47 A;  1IC8 A;  3RSN A;  2VOP A;  1OMI A;  3UR3 C;  3K4N A;  5J4V A;  2DLL A;  1N77 A;  1ON1 A;  1USS A;  2STT A;  4JX5 A;  2DK5 A;  4I0A A;  1WWX A;  2N8G A;  3P7N A;  4CCM A;  3GME A;  2WWY A;  3C2H A;  2DW4 A;  2HYJ A;  3KYL A;  4RAF A;  4OAZ A;  5J6X A;  1JUS A;  4Y3O A;  4KIB A;  1QU3 A;  1ZLK A;  1LFP A;  5CVU A;  4EM0 B;  5CJ9 A;  3FX3 A;  5FKK A;  3DPL C;  4LB5 A;  3S3N A;  4FET A;  4L5E A;  1YS7 A;  2L9S A;  2EFW A;  4XRS A;  4CSW A;  3BC8 A;  2X0L A;  1DUX C;  1DU0 A;  4U0V A;  1RC9 A;  2MC4 A;  5J1R A;  3KP5 A;  4M9X A;  3QOE A;  3AG3 H;  1OYY A;  5HS7 A;  3E97 A;  4IZZ A;  4QIW N;  4P96 A;  2EZL A;  2M0M A;  2DI3 A;  2RVC A;  2K5C A;  1K83 J;  3GCM A;  1FY7 A;  1H9G A;  2QEN A;  2RAE A;  2LBF A;  3MQ0 A;  1KU2 A;  3U1K A;  1X1C A;  1FYL A;  3RDI A;  2TDX A;  1YJW I;  5GTI C;  3LSR A;  4CA0 A;  2F5E A;  2F4O B;  3HTU A;  3ZQF A;  4ESJ A;  4HDU A;  2LG4 A;  2BBY A;  3ABK H;  4IXA A;  1D5V A;  4RDU A;  1S7O A;  4XRS G;  2VBY A;  2RC4 A;  1R58 A;  2OQG A;  3BPV A;  3OYB A;  1EH7 A;  1Z1D A;  2V1N A;  4OIO F;  2CH0 A;  4XIC A;  1ZN2 A;  5FLM J;  2IS2 A;  3V7R A;  2JK3 A;  1ETX A;  2P0W A;  1S3J A;  2IP2 A;  5CYV A;  2Y9Z A;  2M7B A;  4YFK F;  4XQF A;  5E1X A;  1VF9 A;  2YX7 A;  3FXU A;  4A3J J;  3ZCO A;  3L9F A;  2FXA A;  4KIF A;  3HHH A;  3HSE A;  4ABZ A;  5GAE J;  2QA4 I;  3CF2 A;  1TP4 A;  4RAZ A;  5JR3 A;  1YFH A;  1YI2 I;  2FOW A;  3ECO A;  5DCM A;  4ZTF A;  2EIN H;  4EJO A;  2M34 A;  3SZP A;  1OCO H;  2V6E A;  2JT1 A;  3BCA A;  2NYX A;  4S04 A;  1RI7 A;  2K27 A;  3GTM J;  1PUF B;  2W00 A;  1U0J A;  2XAF A;  1X3Z B;  2I8D A;  4NUB A;  3C2B A;  4MFD A;  4OIN F;  3R0J A;  1U5T A;  2HYG D;  3FXQ A;  1QQI A;  4U7D A;  1SAX A;  2XAH A;  2KJB A;  1XGS A;  4F3Q A;  2CUE A;  3HHG A;  3MFK A;  1GV5 A;  1OCZ H;  5GAD J;  2UZK A;  1XS9 A;  1K4T A;  2E1O A;  3D5S C;  4BE1 A;  2ELK A;  4M6X A;  1I39 A;  2X1D A;  2EBI A;  1IN5 A;  1T0F A;  3CUQ C;  5FLX K;  1VQ6 I;  2HYF A;  3C7J A;  2H8R A;  1S8N A;  2QQ9 A;  4NBQ A;  2HVS A;  3OYA A;  2EIK H;  2HPI A;  1SAU A;  1EH8 A;  1SVM A;  4A5M A;  5L3B A;  1S29 A;  3SJM A;  1FYM A;  1T95 A;  2ECB A;  3BG9 A;  2KMU A;  5BQT A;  1UG2 A;  3PSF A;  1WHU A;  2G9W A;  3IKT A;  3HDD A;  4Y7N J;  5FKM A;  4E7I A;  3WTU C;  2HZD A;  3G6E I;  1TQP A;  2E35 A;  3BCB A;  2IA1 A;  2K9N A;  3D5R C;  1HSJ A;  1VQ4 I;  1W5C C;  2OTJ I;  4DYQ A;  1L3L A;  3FIW A;  4I7H A;  3JRG A;  2RN7 A;  4HOB A;  4U0W A;  1QVT A;  2FRH A;  1OCP A;  4QTR A;  4P9U A;  1R7J A;  2F4I A;  2JMW A;  2A5W A;  1IRZ A;  1IF1 A;  4I09 A;  3R0A A;  3SEZ A;  1KYW A;  5JVT A;  2KHM A;  1FPQ A;  5CVI A;  2ELJ A;  2DDA A;  3QPT A;  3L2W A;  1D8K A;  1R5H A;  3IHU A;  5DCF A;  1TWG J;  4OOI A;  2YR2 A;  3ZOB A;  1HOM A;  2KL4 A;  5A2Q K;  5HS9 A;  2BVM A;  4H4K C;  2FQ3 A;  3TDU C;  5HLT A;  2JSC A;  1R71 A;  2CGP A;  2DPD A;  2GIV A;  3GBG A;  3FXM A;  2WAE A;  3WGI A;  1AKH A;  1MJB A;  4BXU A;  4HG2 A;  3QPL A;  1GT0 C;  2HXO A;  3TKY A;  5J8F A;  2QQ8 A;  2R7W A;  2A69 F;  2F4M B;  2LKP A;  2OQR A;  3H92 A;  1UAA A;  1TWC J;  2DFF A;  2HOA A;  3V4G A;  3GTK J;  5J1U A;  5D5U B;  3SHF A;  3C2G A;  2OC6 A;  4AC0 A;  2D1H A;  3HSR A;  5EJC A;  4RB0 A;  2VKV A;  3Q0U A;  1K7A A;  1I6H J;  1ODD A;  2EQR A;  3I59 B;  3WTS C;  4FE4 A;  2PX9 A;  3VYU B;  3OS1 A;  2CW8 A;  3WU0 A;  2KJC A;  1JI8 A;  1QPM A;  4MQ9 F;  4CYC A;  1XDS A;  4LLL A;  1A04 A;  3DFG A;  4KDP A;  2EH3 A;  1O3T A;  2P4W A;  4NNJ A;  3VB2 A;  4DW6 A;  3CJQ B;  1R1T A;  2HQR A;  1ZG1 A;  2R7T A;  3RKQ A;  1UB9 A;  3K4L A;  3EYI A;  1T08 B;  2GQQ A;  5FB2 A;  4MHG A;  2PBI A;  1LB2 A;  3JSO A;  1JTX A;  1BI3 A;  3O2P E;  1NHA A;  4FAS D;  1ZRE A;  2W48 A;  2D1V A;  5FFZ A;  4B48 A;  4DZJ A;  5FRN A;  3ZR8 X;  2VBW A;  2K85 A;  5J47 A;  3TBI A;  2DBB A;  4EJU A;  3J80 Z;  4D9J A;  4O3M A;  4BE2 A;  5JVG F;  2YS9 A;  2VLA A;  3DXJ F;  4BJ6 C;  1KA8 A;  3MZH A;  1IXR C;  1V5F A;  3PNY A;  4G6Q A;  3HC7 A;  4O5V A;  3P9I A;  4BBR J;  4AVP A;  3DV8 A;  4XON A;  2IPQ X;  1E3H A;  2OTL I;  1QZZ A;  1VQL I;  3OV8 A;  4L0Z B;  2DJN A;  4Y15 A;  4IJA A;  1XMK A;  3TO6 A;  3LQQ A;  3T5X A;  2MH9 A;  4KIG A;  3ZMZ A;  3HOW J;  1B1B A;  3ESW B;  2P7C B;  3G71 I;  2W25 A;  1I6X A;  3RIR A;  2E2I J;  2KRC A;  5E3L A;  2ZCW A;  4PJM A;  3SEQ A;  2RQP A;  4A5N A;  4EM1 A;  4XMY A;  3D1N I;  4HV6 A;  2COM A;  2F5F A;  2WV1 A;  2E1M B;  3W2A A;  2DK8 A;  1OYW A;  2VPR A;  2K9S A;  2M8E A;  4BQO A;  1RZ4 A;  4HLY A;  2ID6 A;  2VQG A;  5GPA A;  5L3D A;  2TRT A;  4G94 A;  3GFL A;  1BIB A;  5DV5 A;  1T2K A;  3IV5 A;  2R92 J;  3JTG A;  3FK6 A;  2FML A;  4CH7 A;  1FJL A;  2L4A A;  2L3D A;  3L2R A;  1HLV A;  4FX0 A;  1JKQ C;  1MNM C;  1ZQ3 P;  1WZ2 A;  1XPX A;  4MIM A;  1IV6 A;  5JI6 A;  4E7L A;  4GRI A;  2JUG A;  2O5R A;  3K70 C;  1TQM A;  4AYB N;  4U0Y A;  2R7Z J;  4XOP A;  1S6L A;  2RDP A;  1X2N A;  4JX4 A;  3AL0 C;  4LLN A;  3BQZ A;  4YEL A;  1DPR A;  2LY1 A;  3UNG C;  3L1P A;  1SEU A;  5J1Y A;  2JTV A;  3LFK A;  3HM5 A;  3G1O A;  4KIC A;  4FHT A;  1YHQ I;  3S1M J;  2CUF A;  2WAQ N;  2DT6 A;  3LSK A;  1YW7 A;  3PUF A;  4UUT A;  2OU2 A;  1FOW A;  4RAG A;  2VKH A;  4C30 A;  1T33 A;  3Q3S A;  4UVC A;  2CFX A;  5CVV A;  3JTH A;  3CC7 I;  1O3Q A;  1J75 A;  4LB6 B;  2LR8 A;  3VEP A;  4D7M A;  1YJN I;  4D5F A;  3FIS A;  4GO1 A;  4LIU A;  2E19 A;  4HSR A;  3VYR B;  3J80 K;  2MG4 A;  4KN4 X;  3GTJ J;  3LAP A;  1PP7 U;  3GVA A;  3K1M A;  1LVA A;  3GEZ A;  3B02 A;  2QZ8 A;  4HLX A;  2AO9 A;  2L7K A;  1DP7 P;  2K3F A;  3HBL A;  2XGC A;  1BR2 A;  2GWR A;  2ZJ2 A;  2VIX A;  2BY3 A;  3KP6 A;  4A6D A;  1GUU A;  4ZTJ A;  2WAF A;  1HKQ A;  2L01 A;  2JN6 A;  2EWN A;  3S2D J;  2ZXJ A;  5B1B H;  4N9I A;  3CCM I;  1D3Y A;  2BY2 A;  1B59 A;  2OZU A;  3TMO A;  3HOU J;  3SDG A;  3GYH X;  4E7H A;  1AA7 A;  2AXT C;  2M1B A;  2K4B A;  3HZJ A;  3FMS A;  3I3L A;  2YX4 A;  5BMZ A;  2ZXH A;  1Y0U A;  4JOM A;  1W4M A;  2Z9O A;  2OV7 A;  2DT5 A;  2WAD A;  1LEA A;  4IHT A;  4A3D J;  1X4P A;  1FSH A;  2V1X A;  1K6Y A;  1AKH B;  3WGG A;  5LBQ A;  3PJR A;  1T39 A;  2B9S A;  3H35 A;  2Z33 A;  1YJ9 I;  1FSE A;  2E7X A;  3BZK A;  3ZQQ A;  2R7Q A;  4B4C A;  2OCC H;  3L2U A;  3LFU A;  4M6Y A;  2KLO A;  5J8C A;  3ONQ A;  3PO3 J;  1D0Z A;  3LQR A;  1UHW A;  3FMR A;  3GZN B;  3NAU A;  3F6V A;  2VUM J;  4B3A A;  3TGN A;  2LH9 A;  2LK2 A; 
#chains in the Genus database with same CATH homology
 2E2H J;  4BY1 J;  2JJ7 A;  1UHS A;  2CQX A;  1Z0X A;  1E3O C;  1ZGW A;  2TCT A;  2CQQ A;  2WB1 N;  1U78 A;  3VPR A;  1DU6 A;  3BR0 A;  3MN2 A;  2IAI A;  3LSJ A;  1ETQ A;  2DA1 A;  3ZQC A;  3DEW A;  5EF6 A;  4JX6 A;  3BR1 A;  1JKR C;  4LOC A;  3H0G J;  5HOD A;  3CQZ J;  1I3Q J;  2QF7 A;  2X6O A;  5F08 A;  1NK3 P;  3A01 A;  1JKP C;  2ME6 A;  4A93 J;  2MW8 A;  1BW6 A;  4A3C J;  1HDD C;  1MBK A;  5GP9 A;  1MSE C;  3K7A J;  1H89 C;  1HCR A;  4JYK A;  1GDT A;  3BG3 A;  3CMY A;  4MO7 A;  5C3E J;  1OJL A;  4M3F A;  5GPC A;  1FIA A;  1MBF A;  3BT9 A;  5FJ8 J;  3IH3 A;  2G0E A;  1TC3 C;  2OPT A;  4A3F J;  4QSH A;  3TP3 A;  3HOY J;  5EDN A;  3GTQ J;  1Y1W J;  1RKW A;  4Y52 J;  1TWA J;  3M3Y J;  9ANT A;  3BR2 A;  1R9T J;  5M3M J;  2XB5 A;  1NTC A;  2DA7 A;  2ZB9 A;  3IH2 A;  3B6C A;  1YRN A;  2MSY A;  1MBH A;  4C3J J;  2XPW A;  1IJW C;  2R5Z A;  1IC8 A;  3K2A A;  5EYR A;  5M5X J;  4A3L J;  4JX5 A;  1AHD P;  2NVX J;  5DTD A;  2LVS A;  2N8G A;  1HF0 A;  1Q1V A;  1UMQ A;  5IOZ A;  3S1Q J;  2LLK A;  3F0C A;  4M3G A;  2HYJ A;  2HDD A;  5IPA A;  1W0T A;  5IP6 A;  1JUS A;  1MH4 A;  1QRY A;  4HNV A;  1CQT A;  5FKK A;  2P81 A;  3S1N J;  5IOY A;  4L5E A;  2Y2Z A;  3ZQG A;  5EEA A;  3GTO J;  3FK7 A;  4X6A J;  1B72 A;  4XRS A;  4A3B J;  3HEF A;  1JJ8 C;  1DU0 A;  1F43 A;  3WHC A;  5FLV A;  4M3E A;  3OSF A;  4EEF G;  5J1R A;  2IEK A;  3RZD J;  1ZTR A;  4IHX A;  1LFB A;  2XB0 X;  3CDL A;  4QIW N;  2QCO A;  1U9N A;  2EZL A;  1Y1V J;  1K83 J;  2Y0S N;  1ETV A;  2RAE A;  4IHV A;  3DCF A;  1VI0 A;  2XGD A;  5M5Y J;  3LSR A;  3ZQF A;  4FIS A;  2R5Y B;  2FD5 A;  4RDU A;  1X58 A;  1JJ6 C;  4UUS B;  1FEX A;  4XRS G;  1ZR4 A;  4C2M J;  5J3L A;  1O4X A;  1IDZ A;  1ITY A;  3JRC A;  3S16 J;  3H3V K;  1U9O A;  2L7M P;  4XIC A;  2MGQ A;  5FLM J;  2R0Q C;  2JK3 A;  5C4X J;  1ETX A;  2LKX A;  1D5Y A;  2Y9Z A;  1W0U A;  2ECC A;  1VF9 A;  4A3J J;  2XPU A;  4A3G J;  4ABZ A;  3BR5 A;  3PM1 A;  2DA4 A;  5E3M A;  2M34 A;  4XK4 A;  4BY7 J;  2H1K A;  3JR9 A;  1MSF C;  3TED A;  2EZK A;  1MBG A;  2DA5 A;  2EZH A;  1GVD A;  1PUF B;  3GTM J;  3W6V A;  3C2B A;  4MFD A;  1H88 C;  4FCY A;  3TP0 A;  4I6Z A;  4M3D A;  2IBD A;  4DYC A;  3NAR A;  3Q0V A;  3BTC A;  1HDP A;  2CUE A;  1GV5 A;  1XS9 A;  1RET A;  2E1O A;  2EZI A;  5E3N A;  4A3M J;  1K61 A;  2ELK A;  2LY9 A;  1ETY A;  2EBI A;  2ID3 A;  3HKZ N;  2H8R A;  2CU7 A;  2M2E A;  1VFC A;  3WHB A;  1JGG A;  3SJM A;  1OCT C;  2M9H A;  2ECB A;  2L7F P;  3BG9 A;  5E3O A;  3S17 J;  2Y9Y A;  1UG2 A;  2GM4 A;  3S2H J;  2XRL A;  1P7J A;  3SFI A;  4A3K J;  3HDD A;  4Y7N J;  2DMQ A;  5FKM A;  2COB A;  1VND A;  1ETO A;  4B1R A;  3O8G A;  2K9N A;  5FKN A;  4IHW A;  5F0C A;  3RZO J;  3JRF A;  1OFC X;  1QPI A;  4DYQ A;  2L0K A;  3FIW A;  5IYD J;  2PMZ N;  3BR6 A;  3JRG A;  1PUF A;  2Y30 A;  4MFE A;  2VI6 A;  1P7I A;  5C4J J;  2X48 A;  2D5V A;  2R93 J;  1QVT A;  1OCP A;  4QTR A;  3OSG A;  1ETK A;  1RKT A;  1WPK A;  2JMW A;  1IRZ A;  3BQY A;  5FKO A;  1A6I A;  1WH5 A;  3G1M A;  2KDZ A;  3BG5 A;  5F1J A;  2ME0 A;  3BTI A;  1TWG J;  4X1E A;  3ZOB A;  1WH7 A;  5K7F A;  1HOM A;  4GFB A;  2M8G X;  2NS7 A;  3GTG J;  1FTZ A;  2M0C A;  3GBG A;  4UUS A;  1AKH A;  1WCM J;  4J19 A;  2NOG A;  1XG1 A;  3QPL A;  1JT6 A;  2HXO A;  1GT0 C;  4FE7 A;  2HXI A;  4A3E J;  1ENH A;  2FX0 A;  4C3H J;  1TWC J;  3OOU A;  2HOA A;  3ZQI A;  4A3I J;  3GTK J;  5J1U A;  1MH3 A;  1G2H A;  5DS9 A;  3HOV J;  4AC0 A;  1BJZ A;  5EGO A;  3JRA A;  1LE8 B;  3S1R J;  2VKV A;  3Q0U A;  1I6H J;  2EQR A;  4FE4 A;  1WI3 A;  4W97 A;  1JUP A;  4CYC A;  1ZKG A;  3HGY A;  3A03 A;  2EH3 A;  1A5J A;  1T56 A;  5M3F J;  4DW6 A;  1U8B A;  1IDY A;  2YUS A;  5F0H A;  3RKQ A;  1JTX A;  2W48 A;  4DZJ A;  4BBS J;  5IP9 J;  2O8K A;  3O8H A;  1MBE A;  2DA2 A;  5C44 J;  2VKE A;  2YS9 A;  2FQ4 A;  5K7Z A;  2NVQ J;  1RES A;  1JKO C;  1IG7 A;  3JRE A;  3UKG A;  4BBR J;  3A02 A;  5EZG A;  2DMP A;  1JTY A;  2DJN A;  5IYB J;  3GTL J;  3HOW J;  2CJJ A;  3S14 J;  2O9L A;  1S7E A;  2E2I J;  3RQI A;  5E3L A;  3LSG A;  5M5W J;  3MKL A;  2JA5 J;  2DN0 A;  2YU9 J;  3D1N I;  1LE8 A;  2JWT A;  2X9D A;  2Y31 A;  1TWF J;  2WV1 A;  2HOT A;  4BXX J;  2VPR A;  2K9S A;  3TW6 A;  2DA3 A;  4RBO A;  2ID6 A;  2XSD C;  5GPA A;  2TRT A;  2NVT J;  2DA6 A;  3IV5 A;  2R92 J;  3FK6 A;  5F04 A;  1Z77 A;  1XC5 A;  5EG0 A;  2KT0 A;  3GTP J;  3MVP A;  4V2G A;  1FJL A;  4V2F A;  1HLV A;  1JKQ C;  3I4N J;  3FKI J;  1MNM C;  1ZQ3 P;  1YRN B;  1SFO J;  1B72 B;  3QPS A;  4MIM A;  4W1U A;  3G1L A;  1JUM A;  5K7H A;  1POG A;  1IV6 A;  5BNG A;  3HGG A;  3JRD A;  2LTP A;  3HOX J;  1H8A C;  2GBY A;  4AYB N;  5FKL A;  2R7Z J;  1BA5 A;  4CYC B;  4DYR A;  1X2N A;  4JX4 A;  2LP0 A;  4A69 C;  3BQZ A;  5IP7 J;  3L1P A;  2K9Q A;  2JA8 J;  2I10 A;  5J1Y A;  3CCY A;  1ETW A;  3HM5 A;  3G1O A;  4G12 A;  1WGX A;  4D5C A;  2JA7 J;  3S1M J;  2CUF A;  2HQ5 A;  2WAQ N;  1B8I A;  4UUT A;  2HI3 A;  2E2J J;  2GLO A;  3JRB A;  1T33 A;  3Q3S A;  3A01 B;  5F0F A;  3LOC A;  5IYC J;  4MLO A;  4JP0 A;  4M6V A;  4D7N A;  1SAN A;  4BKX A;  1APL C;  2K40 A;  2LR8 A;  3S15 J;  4D7M A;  4D5F A;  2NVY J;  4FTH A;  1ORK A;  2L9R A;  5JLW A;  3FIS A;  1NK2 P;  1TWH J;  2E19 A;  3HB9 A;  2MG4 A;  4DZP A;  3GTJ J;  2FJ1 A;  2NS8 A;  2AHQ A;  2OF7 A;  3PO2 J;  2XGE A;  2AO9 A;  3HOZ J;  3HBL A;  2XGC A;  4AUX A;  1ZR2 A;  1GUU A;  1RR7 A;  2HOS A;  2JN6 A;  1LFU P;  3S2D J;  1IUF A;  2DMU A;  5JLX A;  2R5Y A;  2XPV A;  2CRG A;  2B63 J;  1EF4 A;  1FTT A;  2DMN A;  4IHY A;  1ZK8 A;  3HOU J;  3SDG A;  3TW7 A;  4S0H B;  1B8I B;  4M3B A;  2O7O A;  2DTZ A;  3ZQL A;  1AU7 A;  3I4M J;  1GV2 A;  3OIO A;  4NDL A;  2JA6 J;  3IH4 A;  1I50 J;  5EZH A;  4I76 A;  3LSP A;  1F36 A;  3JRH A;  5EGO B;  2R5Z B;  4A3D J;  1QVU A;  3BTJ A;  1MBJ A;  1AKH B;  1BW5 A;  2LFB A;  1FIP A;  5F27 A;  4C3I J;  2DMT A;  3B6A A;  2LD5 A;  1X2M A;  4IEJ A;  1RPW A;  3ZQH A;  3QQA A;  1IGN A;  3LNQ A;  4B4C A;  3BR3 A;  3BTL A;  3E7L A;  3Q0W A;  3M4O J;  1BL0 A;  2L7Z A;  1JT0 A;  4XID A;  3PO3 J;  5EG0 B;  3NAU A;  4XRM A;  2VUM J;  3JRI A;  4B3A A;  2LK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...