2M2EA

Solution nmr structure of the sant domain of human dnajc2, northeast structural genomics consortium target hr8254a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
71
structure length
71
Chain Sequence
FTPWTTEEQKLLEQALKTYPVNTPERWKKIAEAVPGRTKKDCMKRYKELVEMVKAKKAAQEQVLNASRAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DnaJ homolog subfamily C member 2
publication title NMR solution structure of the SANT domain of human DnaJC2.
rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 21
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2m2eA00
3A01A 1GV5A 3LSJA 1JTYA 3TP0A 4CYCB 2H8RA 1GDTA 1IG7A 4IEJA 3LSRA 1HDPA 1S7EA 5EYRA 2KDZA 1MH4A 4DYCA 1TWAJ 4FISA 3RQIA 1RKWA 1JUPA 1WI3A 2R5YB 2DMNA 3SFIA 1E3OC 1IDYA 1ZR4A 2HQ5A 1JT6A 1Q1VA 2XGDA 4EEFG 5IOZA 2VUMJ 1I6HJ 2DA6A 2HYJA 5IYDJ 1SANA 1JKOC 2ELKA 4BBSJ 4UUSB 3GTQJ 1U9OA 5F1JA 3IH4A 3S17J 2QF7A 2Y31A 3ZOBA 1W0TA 1AKHA 2D5VA 1NK2P 4AUXA 1MBHA 2YU9J 4JX4A 3ZQFA 2R0QC 5JLXA 1JJ6C 1EF4A 3A03A 3CCYA 1IV6A 3BTJA 2CQXA 2COBA 3HEFA 3UKGA 3OSGA 3H3VK 1I50J 3C2BA 1U8BA 1BW6A 2AO9A 2Y30A 3FK6A 1A5JA 5F04A 2IAIA 3TP3A 3HOXJ 1VFCA 3BTIA 1MBKA 4AC0A 1XC5A 4JYKA 3RKQA 1VNDA 3JRGA 3JRBA 3ZQCA 3BR5A 1B8IA 1WCMJ 3JRCA 3Q0WA 1IJWC 2ECBA 2E2HJ 1Z0XA 5FKOA 3S14J 2DN0A 3HOYJ 5C3EJ 3GTOJ 1IRZA 2QCOA 3PM1A 1R9TJ 2FD5A 5F27A 5FKKA 4BKXA 1H8AC 1ETYA 4G12A 3BT9A 5IP9J 5GP9A 3S1NJ 3WHCA 3GTLJ 2DTZA 3BG5A 5IP7J 1MBJA 3ZQHA 5F0HA 3FK7A 2LFBA 4BXXJ 5M3MJ 2JA6J 2KT0A 1I3QJ 3JRDA 2XPWA 5C4XJ 1GV2A 3HOZJ 2EZHA 4AYBN 5M5YJ 1JKRC 5EZHA 5E3NA 4Y7NJ 1BA5A 1TC3C 2PMZN 1CQTA 1ZK8A 4V2GA 1ZR2A 1D5YA 1QPIA 1O4XA 4A3BJ 1RKTA 1UMQA 3L1PA 3G1LA 1DU0A 3G1OA 3SJMA 1MH3A 1P7JA 4A3CJ 4I76A 3GTPJ 4M6VA 1FIAA 5J1YA 4DZJA 1MBFA 3BR2A 9ANTA 4A93J 2LVSA 1ETVA 4IHXA 3GTJJ 1AKHB 4A3IJ 1YRNA 4MFDA 1FEXA 3IV5A 1DU6A 4GFBA 2CUEA 2YS9A 1RESA 3S2DJ 1ITYA 5J1RA 2EZKA 2FX0A 2HOTA 3S1MJ 2YUSA 3QQAA 2K9SA 5C4JJ 2ZB9A 1OCTC 1RETA 2DA2A 1OJLA 2IEKA 4D5CA 1ZQ3P 3CDLA 4IHWA 1WPKA 3JRAA 4A3KJ 1JKQC 1NK3P 4BY1J 2JA7J 5E3MA 1PUFA 3LOCA 5M5XJ 4FE7A 1POGA 4ABZA 1B8IB 4M3EA 2M9HA 4XK4A 2NVTJ 1RPWA 5FLVA 2X48A 2R92J 1BL0A 3BQZA 3BR1A 5EZGA 2VKEA 2WB1N 3HM5A 1IGNA 1ZGWA 1VI0A 2DMUA 4DW6A 4D7MA 1FJLA 2DMPA 3B6CA 4X6AJ 4A3LJ 3M3YJ 4DYRA 5IPAA 3S16J 3WHBA 2L7ZA 1GT0C 1K61A 2JN6A 2CUFA 2GBYA 2Y9YA 2DMQA 4A3EJ 4MFEA 3S1QJ 5F0FA 1QVTA 2HOAA 2G0EA 1AU7A 2DMTA 1BW5A 2HI3A 3ZQGA 2ECCA 4FTHA 1MSFC 3MN2A 1F43A 2HXOA 3JR9A 3I4MJ 1QVUA 4FCYA 4XRSA 2K40A 2EZLA 3D1NI 4JX6A 2XSDC 2LTPA 2DA4A 3LSPA 4B4CA 2OF7A 1B72A 1YRNB 2EQRA 1LFBA 1AHDP 2RAEA 4C3HJ 2GM4A 1U78A 1HCRA 1FTTA 1XG1A 3A02A 1TWHJ 1OCPA 1BJZA 1TWGJ 3S1RJ 2JMWA 4C3JJ 1JTXA 3Q0VA 1ZKGA 2DA7A 2L7MP 2EZIA 2MW8A 2R93J 3GTKJ 2LLKA 1APLC 2JJ7A 4XRMA 4QTRA 2MSYA 2ID6A 3BTLA 5F0CA 1IC8A 3HDDA 1K83J 4MLOA 1PUFB 5K7FA 2O8KA 3HKZN 3MVPA 1GUUA 2E1OA 2X6OA 5FLMJ 1LFUP 1SFOJ 3GTMJ 3BG9A 4A3DJ 3IH3A 4A3GJ 3BR3A 2HDDA 5E3LA 3QPLA 3M4OJ 1Y1VJ 2JK3A 1TWCJ 2R5ZA 3BR6A 2M0CA 5C44J 4A3FJ 1JUMA 2WV1A 2VI6A 4MIMA 4DYQA 4W1UA 2AHQA 3Q0UA 3BR0A 5EEAA 5FKNA 3FISA 2Y2ZA 2DA1A 4NDLA 2NS8A 3GTGJ 2I10A 1JKPC 2XGCA 5DTDA 4RDUA 3ZQIA 2H1KA 2O9LA 4JX5A 3TEDA 4Y52J 4J19A 4QIWN 3PO2J 4M3FA 1G2HA 1RR7A 5EG0A 1WGXA 4DZPA 1MNMC 2OPTA 4C3IJ 2LD5A 2CRGA 2HOSA 2NS7A 1F36A 3ZQLA 5M3FJ 2VKVA 3BQYA 5EDNA 1W0UA 5IYBJ 1HF0A 1Y1WJ 3CMYA 1X2MA 2L0KA 2K9QA 4D5FA 1ETOA 1ETQA 5JLWA 4M3GA 1HDDC 2GLOA 2NVQJ 1QRYA 1ZTRA 5IYCJ 5J1UA 4X1EA 1T33A 4JP0A 3Q3SA 1B72B 5K7ZA 3CQZJ 1ETXA 3G1MA 1VF9A 1ETWA 3NARA 2XB0X 4L5EA 2E19A 5FJ8J 2N8GA 3HGYA 2LY9A 5DS9A 1UHSA 3PO3J 1H88C 2MGQA 2P81A 2LR8A 3JREA 1JJ8C 1ENHA 1XS9A 4UUTA 2JA8J 1Z77A 3W6VA 1HOMA 4A3JJ 2EH3A 2DA3A 3K7AJ 3E7LA 1MBGA 1X2NA 3SDGA 1LE8A 5IOYA 2L7FP 3H0GJ 5EGOA 1TWFJ 2TRTA 3BTCA 3DEWA 5K7HA 2CQQA 4CYCA 4LOCA 3GBGA 3JRHA 2NOGA 3OOUA 2LP0A 2XB5A 1ETKA 2R5ZB 3HB9A 3RZOJ 2ME0A 1WH5A 4D7NA 2R5YA 1T56A 3HOUJ 2CU7A 3LNQA 2E2JJ 3FKIJ 3OSFA 4HNVA 3F0CA 5FKLA 2XPVA 1JGGA 3JRFA 5M5WJ 2ME6A 4XICA 1MBEA 4B1RA 2M2EA 4M3DA 2B63J 3O8HA 3TW6A 4W97A 5J3LA 5HODA 1UG2A 1HLVA 4BBRJ 4UUSA 2VPRA 1JT0A 3QPSA 1U9NA 5IP6A 2EBIA 1WH7A 3RZDJ 5EG0B 2DA5A 2Y0SN 4IHYA 2NVXJ 3S15J 3FIWA 3I4NJ 2LK2A 2K9NA 2X9DA 3O8GA 3IH2A 3HBLA 1P7IA 1X58A 2CJJA 2M8GX 2XRLA 5GPAA 2M34A 4M3BA 4MO7A 3A01B 2JA5J 1FTZA 4I6ZA 1JUSA 2IBDA 1MSEC 2W48A 2XPUA 3MKLA 4B3AA 1IDZA 5GPCA 2E2IJ 1GVDA 3VPRA 5BNGA 2MG4A 2WAQN 2FQ4A 4RBOA 3HGGA 2Y9ZA 5FKMA 4C2MJ 2LKXA 4XRSG 2R7ZJ 1ORKA 5EF6A 4FE4A 2DJNA 4XIDA 3HOWJ 2XGEA 4IHVA 1H89C 4S0HB 2JWTA 1FIPA 2O7OA 3BG3A 4BY7J 3JRIA 3HOVJ 3NAUA 2ID3A 3S2HJ 1IUFA 5F08A 2FJ1A 1NTCA 1OFCX 1A6IA 2NVYJ 2TCTA 4V2FA 2HXIA 3K2AA 3B6AA 2L9RA 3DCFA 4QSHA 5E3OA 3OIOA 4A3MJ 3TW7A 4A69C 3LSGA 1LE8B 5EGOB
chains in the Genus database with same CATH superfamily
3A01A 4NC8A 1K6OA 3WGIA 4PFOA 5E79C 1IG7A 1HQCA 1R5HA 2W25A 1SFUA 2DPDA 1O3RA 2NS0A 2KDZA 1MH4A 1G3YA 3ML6A 2Y69H 3HHHA 2EB7A 1IDYA 3O6BB 5JR3A 2CQKA 1FP1D 1JT6A 1Q1VA 1JI8A 4HOBA 4DBQA 2Y0SA 1N75A 2EFNA 3WE3A 4BJ5C 4BBSJ 3EPZA 4RLQA 4TV7A 2GWRA 2Y31A 1W0TA 2D5VA 2FNAA 2FBIA 1VQMI 3MZYA 3K4JA 2D1VA 3GZ6A 1O7FA 3DU5A 2RV8A 4BHPA 3ABMH 3HEFA 5DCMA 3UKGA 3VYRB 2LBFA 1HBXG 4RGRA 4IQJA 1I50J 1TQPA 1U8BA 2X85A 5J4VA 2AO9A 2IS2A 3VWBA 2KIQA 1S29A 1SFEA 2KIMA 2M5WA 3CC2I 2DOAA 2NAZA 4ENJA 2ZJRF 1REPC 5HLIA 4UUVA 4XLPF 4II2A 1YJ9I 2P7CB 2VXDA 5FKOA 3Q9VA 4DBRA 3GTOJ 2QCOA 3PM1A 3LAJA 3H3ZA 4RGXA 3DU6A 4HRIA 4G94A 3S1NJ 2YSRA 1CGPA 3WHCA 1FT9A 4WXDA 3QP6A 2ELJA 1XD7A 2HQNA 2E35A 4LMYA 2CFXA 3KP4A 3M8FA 3CUQB 3ZQHA 3P7NA 1I5ZA 1W36D 2VONA 3OYHA 4B43A 2DAOA 2KT0A 2JA6J 1H9GA 1I3QJ 2ZJ2A 5JVTA 4N9HA 5C4XJ 3HOZJ 2QBYA 3BPVA 4G8XA 5M5YJ 1JE8A 4ZYAA 1Z6TA 4Y7NJ 5TISC 1TC3C 4LFUA 1YE9A 3EUKL 4RS8A 4ON0A 3E97A 2NOJB 5E18F 1SMYF 4A3BJ 2DDAA 1UMQA 2Z16A 2PI0A 1BR4A 3OR2C 1VQOI 2CH0A 4XN0A 2UXNA 2ZXIA 3F8CA 4M6VA 5CVRA 5J1YA 1K6YA 3RPUA 1ON2A 4YFKF 2O6GE 2PJPA 3BR2A 1DPRA 3GTJJ 4KIBA 3U21A 1AKHB 3OL4A 5JI6A 4A3IJ 4KNYA 4BJ6C 2J5OA 3S2DJ 3CP2A 1P4XA 5J1RA 2EZKA 4KISA 3ZMTA 3S1MJ 3CCLI 1MMNA 5F6FA 4EVIA 3QQAA 1VQ6I 4NC7A 1FC3A 3ECHA 3DPLC 2OTJI 3KIOA 1OJLA 1T98A 4G9YA 2ESNA 3K2ZA 4K2EA 4IHWA 1HA8A 1XCVA 3ZMZA 3BZ6A 4PGGA 1T8IA 2DFHA 2WY7Q 3ONQA 3LFUA 1JKQC 1ZH5A 2DFFA 4HNUA 3HOSA 5E3MA 1R7JA 5B3SH 1VTNC 1EV7A 4M72A 3ZCOA 1B8IB 4CICA 4XK4A 5D6EA 4HF0A 3RDIA 3E5UA 4QLCU 5J6XA 1MJ9A 1S3JA 2VBZA 2W7NA 5D4RA 2P6TA 4IL6C 4RM3A 4E4HA 2P6SA 3KPHA 2PJRB 1V3FA 3VEPA 4MTDA 2R7DA 1MNEA 5LHGA 1OYIA 2WB1N 5J8FA 4KA4A 3AL0C 3CCQI 4RAZA 4DW6A 5GTIC 2VC0A 4AYBA 2MC4A 2A6EF 4BH9A 3N4MA 1LB2A 3D5RC 3B6CA 2FMLA 4A3LJ 4FX4A 2HNHA 1UB9A 2OJED 4XKCA 3S16J 5CVVA 3JSPA 2L7ZA 3MAJA 2JSPA 3OR1C 2CW8A 1K4TA 4PZJA 2DFEA 4C30A 4E7KA 4A3EJ 3ZMSA 2DT6A 1BI3A 4XONA 4AD9A 4P5OA 3FZVA 4CZCA 1ZREA 2QUFA 4M6YA 1QVTA 3P9CA 2DFIA 1KA8A 2ZFUA 3WGHA 4EATA 1YFHA 3PFYA 4M9ZA 1Z21A 4FTHA 2EA4A 2HXOA 4F7ZA 1QBJA 4OIOF 4U87A 3E5XA 2F5FA 1W36C 2EZLA 3D1NI 3V8KA 3LQQA 3TKYA 1YIJI 4NNJA 2HVSA 2GA2A 2P0WA 2DA4A 2HTJA 3ESWB 1SAUA 1B72A 4H4KC 4M73A 4GDFA 1AHDP 3FXJA 4XLEA 3BY6A 3GYHX 1HCRA 4M9SA 5DUIA 1XG1A 3QWLA 4P55A 3IKTA 2HFHA 5LBQA 1TWHJ 5LGUA 3AKZA 1BJZA 1TWGJ 2A3SA 3C2HA 3S1RJ 2JZYA 4RGSA 2CUJA 1Z3XA 1KYZA 1KGSA 2DA7A 2KIFA 2EZIA 2MW8A 3GTKJ 3HRUA 4OIRF 2K4JA 2R7XA 1IZ1A 1OISA 4XBFA 3MKWB 3CMEI 5GAHJ 1ZN2A 4I09A 1X1AA 2O8KA 2X51A 2X6OA 3GCMA 4LG0B 3KE2A 4A3DJ 4HF1A 3IH3A 1UHMA 5FO5A 3UNGC 3EUHA 3RTRA 2F4MB 2D45A 4Z6YA 5E3LA 3IL2A 3ZXSA 1O57A 4I7HA 1J7KA 2R5ZA 1HW5A 3BR6A 2STWA 2VI6A 4MIMA 1SD5A 4KJZA 3VB2A 2QKLB 3SDBA 1R36A 3BR0A 3FISA 4XKWA 3GFIA 5EEGA 3MZHA 2DA1A 2OBPA 1FOKA 3SZGA 3OYCA 2X1DA 4E7IA 3FBIB 5J47A 4L9TA 2H1KA 4KMUX 1U2WA 4XLAA 1V55H 1EH8A 4HQMA 1J75A 3EUHC 1OYYA 4AVPA 1TQIA 1DQUA 2QEXI 5JVGF 4KYWA 2MYSA 4DZPA 2EWNA 2LD5A 1X4PA 2CRGA 4GGGA 2HOSA 1WWXA 1LJ9A 2NS7A 3L2QA 3ZQLA 2R7VA 1FOXA 2L9VA 3OL3A 3FDYA 1G6NA 3JTHA 2PLYA 3BQYA 3CD6I 1W0UA 2UWMA 3LA3A 5IYBJ 1KYWA 1Y1WJ 5E8IA 4XKVA 1X2MA 2L5QA 1R22A 3QPHA 4WXCA 3CDHA 2NNNA 4D5FA 1ETQA 1D5VA 1MZBA 1VQKI 1HDDC 1XGOA 5HVQC 4RGUA 3TL4X 3G1MA 2E5ZA 1ZHFA 1DGWY 1WJBA 4U88A 3QYEA 4XR6A 4J01A 2LY9A 3LMMA 2EJRA 3KLOA 1HKQA 4IF4A 1FOYA 4E70A 1E2XA 1A36A 3ASNH 2RGVA 3CCUI 3H5RA 4IQ4A 1OYWA 1JJ8C 1ENHA 2P5LC 3AG4H 5LGNA 2LF8A 2FXAA 4FX0A 2JA8J 3W6VA 1HOMA 3ISPA 3OV8A 1YLFA 4LITA 3K7AJ 1GXQA 3TO6A 1VZ0A 1O7LA 1DUXC 3WU1B 2X6WA 2QSGX 4IHSA 3H0GJ 1FNNA 1YOVB 1SFKA 1TWFJ 2EFOA 3DEWA 3N97A 4CYCA 3IWZA 2XF7A 2K4BA 3EQLF 3DBHB 3TQNA 4PDKA 3RZOJ 2A68F 1I1SA 3LA7A 5CQEA 6PAXA 1WH5A 2R5YA 4HSTA 3HOUJ 2CU7A 3LNQA 3IKVA 3IWFA 4OMZA 3OYLA 2QQ8A 3G2BA 5LFAA 1LQ1A 3TDUC 1MBEA 2LKPA 2IS6A 2LC2A 4RB1A 2DK5A 4M3DA 3HUGB 3O8HA 2LOOA 5HODA 3HSRA 1HLVA 4XORA 4UUSA 2VPRA 1JT0A 3QPSA 1QO0D 5AIPA 2M30A 3KEYA 3H1CA 2BVMA 2V1XA 5A2QZ 3CP8A 3FIWA 2B9SA 3I4NJ 2GXGA 2LK2A 4A12A 3O8GA 2RREA 3NQOA 3HBLA 1BBYA 1X58A 2XRLA 4CUGA 5E1ZB 3K4MA 3A01B 3KEQA 2F4OB 3C18A 4R8HA 2JQ7A 4L5IA 2EK5A 1MSEC 3R61A 1FBQA 5GPCA 2RQPA 5DV5A 2E2IJ 5BNGA 2MLGA 5KVRA 2WAQN 1IAWA 3QU3A 5FKMA 4C2MJ 2LKXA 3OIPA 4PJLA 4XIDA 3CTAA 4YELA 1MDMA 3HOWJ 2ICWG 3PNVA 4IHVA 2R7SA 5DUKA 2OZ6A 4BE2A 1FIPA 5ILSA 2O7OA 1MMSA 1LDDA 1FP2A 3L2CA 5GADJ 1ZLJA 4EJOA 3ABKH 1WSUA 3NAUA 2Q2EA 3UR3C 1YJWI 5E1XA 3E5QA 1JXSA 2HZDA 1A6IA 2NVYJ 2HXIA 4YG2F 2ACJA 1Y8RB 3F22A 1KONA 3K1MA 4OINF 2IA0A 1IRGA 5H6QA 4RB3C 1GV5A 3LSJA 1Z7UA 3HG9A 1WJAA 1MJAA 3GW2A 2V26A 1HDPA 2PFBA 5EYRA 5A2QK 4XKBA 1XB4A 3J7YJ 2H8WA 2PMUA 5HDKA 1ZR4A 4RLFA 2WADA 2XDVA 4BJTA 2Q0OA 2M0MA 3CZ6A 4IZZA 2GXBA 2HYJA 3Q5FA 1HW1A 4HPQA 2ELKA 5H6RA 3R60A 3S2WA 4ZZLA 1UFMA 1U9OA 2AQFA 2Z99A 1K79A 3IH4A 3S17J 3FXLA 3ERED 2QF7A 5TGTA 3ZOBA 1VQ8I 1NG7A 3O2PE 2LMDA 1WKMA 3BLYA 1MBHA 2YU9J 3HTSB 2A69F 3ZQFA 1IN7A 4ENKA 2DOFA 2BHYA 1EF4A 3A0BC 5JHFA 3ABTA 1VQ9I 2DJIA 3FXOA 1WZ2A 3I59B 4PJ0C 3H35A 4DJAA 4ZZDA 4B48A 1TLHB 2FU4A 4NHJA 1UCRA 2CQXA 2COBA 4L0YB 4AM3A 3OSGA 1SAXA 2A05A 3KYLA 1B6AA 3C2BA 2M87A 1BW6A 5K1YA 3CCSI 3M1CA 4GCVA 4ZYDA 1A5JA 3M8JA 3WG9A 5L3BA 1ZYRF 5B5EC 5LEKA 3HOXJ 1H0MA 2JVHA 5LHIA 3R0JA 4AC0A 5ED4A 3H9QA 3HHGA 4JYKA 3EYIA 1T0FC 2JRTA 4PUSA 4A5NA 3ZMUA 5L3EA 2L9NA 2PG4A 4U0VA 4S05A 1T6SA 1IJWC 2ECBA 3I5UA 5FROA 4BEHB 1D0YA 3S14J 5HDGA 2DN0A 2VT2A 5C3EJ 2XAFA 1IRZA 4WXHA 3DWLE 2ZNYA 4P9FA 2IA1A 5F27A 1ETYA 4AU7A 5IP9J 2VJ5A 1IXCA 3SZPA 1IW7F 3NWSA 4Z2YA 2A5YB 4H0EA 2MD5A 2X0LA 4BS9A 4Q4ZF 2OUMA 5HS8A 4XOTA 4BXXJ 5M3MJ 2EIMH 2ETHA 4BAYA 3DQVC 4ZYEA 1BOBA 2XPWA 4F55A 3W2VA 1LVAA 2FE3A 3F3XA 3SZTA 5EZHA 1ZELA 3RYRA 1R00A 2ELHA 1CQTA 2QGUA 3L7WA 4ZYGA 2K27A 4EV0A 4A0XA 1ODDA 1O4XA 3X2QH 1DU0A 3H5NA 3SJMA 5H2FC 3E0JB 3KZYA 1DDNA 2K3FA 3JAMZ 4A3CJ 5FRNA 2XKPA 4IRGA 4DZJA 2JVGA 3BOQA 4ENNA 3OS0A 2DT7B 9ANTA 3S3OA 1R49A 2ZSIB 4HX4A 3ZGKA 1FEXA 2XRNA 1DU6A 2CUEA 2QQAA 1RESA 2MH9A 5CLSA 3PL8A 3D5LA 2HOTA 2UUZA 4DQ2A 2K9SA 2LF7A 1Y6IA 3EUAA 2HU9A 2OCEA 2E5NA 1QNTA 3RYPA 1RETA 3KLNA 3FHZA 2XVCA 3OY9A 4LB6B 2K9MA 1USTA 3ULQB 1EKEA 5KAFC 2ZMEA 1WPKA 5HLTA 4BE0A 3F6VA 1FX7A 3V8JA 4BY1J 1FY7A 2JA7J 2KRCA 1PUFA 3LOCA 4FE7A 3I3LA 1POGA 3C7JA 4OU0A 2FNPA 4E7JA 2W00A 1W5CC 3CLOA 1K78A 3S8PA 3J7AY 3RPUD 2NVTJ 3BROA 1D8KA 5FLVA 4IKFA 4E7SA 1OCRH 2X48A 3DF8A 2R92J 1LNWA 3BZKA 3HSEA 3BQZA 4WF2A 5EZGA 1WJ5A 2WAEA 2NRAC 2Y0MA 1ZGWA 1G8XA 2OTLI 1XTAA 4R1HA 2O8XA 4AIKA 1S72I 1FJLA 1VQ7I 4HV5A 1FSHA 4HDUA 4FASD 2O5RA 4HLYA 1HC8A 2M7AA 3NWTA 2DT5A 3FXRA 5J40A 4F91B 4DYRA 5IPAA 3JAMK 4KDPA 3L2VA 3COAC 2RNJA 3WHBA 1E3PA 2L02A 2OA4A 2JN6A 4RAYA 4CSWA 2XROA 2Y9YA 3W6JB 1F9NA 2DMQA 4BQQA 2E34A 2VBXA 2XGXA 4MFEA 5HLHA 2L01A 5F0FA 2XAGA 5IT3A 3FXUA 1B9NA 3HRMA 2HOAA 4ZDLA 3CMMA 2A61A 3KP6A 4PSWA 3ZQGA 1TP4A 2OAZA 3MN2A 1ZGJA 2JTVA 3I4MJ 1V54H 1E3HA 2HDCA 4I0BA 4XRSA 2E1MB 2H6CA 4XQFA 2OC6A 4JX6A 4YIIA 1TNTA 3VFZA 4BQNA 1RUOA 1BR1A 4B09A 4A5MA 1QGPA 1XMXA 2VIXA 3N05A 3CCVI 3T0YA 3LSPA 1MNDA 2OF7A 2DXIA 2PN6A 2LDUA 1YRNB 2FMYA 1SC7A 5BPDA 2RAEA 3CJTB 1Z91A 2GM4A 2M4KA 2KRHA 3D5SC 3GWZA 4Q48A 5F64A 4HF2A 1N78A 4MQ9F 1OCPA 2HS5A 2JMWA 1F1ZA 4C3JJ 3E6CC 2JSCA 2P5KA 3Q0VA 4AIHA 2AQEA 2R93J 3CF2A 5D5WB 3I71A 4Y4RA 1P9QC 4XRMA 2PQ8A 3GXOA 2MSYA 3VSKA 5F0CA 3VYSB 3HDDA 2M3AA 1IF1A 3ZR8X 4L18B 4MLOA 2IS1A 3CF5F 2BW3B 2CV0A 3CO7C 4L9VA 4YFXF 3CCEI 2UV1A 1X4OA 1LFUP 2I8DA 3OYAA 4A3GJ 2JT1A 3BR3A 3LSMA 2R7WA 1LDJA 2BYVE 4ZC3A 5L3DA 1XDSA 1TWCJ 4JBAA 5KK1A 3GMEA 4XLNF 4A3FJ 1JUMA 2KJBA 4IJAA 3HOTA 1RUNA 3B73A 3CC7I 3Q0UA 4CYDA 1PUEE 2M4GA 5EEAA 2O03A 4G6TB 2EA2A 2XAUA 1R4MB 1I3AA 3R6SA 3G71I 3LSTA 3GTGJ 4KUMA 2VBYA 1AWCA 2I10A 1JKPC 1KQ8A 2XGCA 3RKYA 5K5QA 1HXDA 4DOZA 2O3FA 4XM3A 2NXNB 4QIWN 5JHUA 3PO2J 4ANJA 4M3FA 1RR7A 3REOA 5EG0A 2OPTA 4C3IJ 2JPCA 1S8NA 2R7UA 3KP7A 3WE2A 5BQTA 2F5EA 3DPTA 1FYKA 2K02A 2VKVA 2R7QA 3K4CA 4CHUA 1ON1A 5EDNA 5ILVA 3F9KA 1HF0A 4CCKA 2KIUA 2FRHA 2VQCA 3M1EA 4Q47A 4GO1A 4F52A 3CMYA 2L0KA 2K5CA 2K9QA 2XF5A 4XNFA 5JLWA 2GLOA 3OYKA 4L0ZB 3U1KA 2NVQJ 5IYCJ 1FOWA 3S93A 4JP0A 3FHNA 5K7ZA 4C2UA 1ETXA 4GRIA 1VF9A 4I99C 2E19A 2IXSA 2N8GA 2X1CA 3HGYA 1USSA 3FMSA 3QOPA 2V79A 1S7OA 1YX5A 4KT6A 5DS9A 1UHSA 1YIOA 2D1HA 4JOMA 3OYEA 3VDXA 2MGQA 3HC7A 3JREA 1W7PA 3PQKA 1XS9A 3H5AA 4IRIA 1U5TA 5DCFA 3F8NA 1DPUA 1Z77A 2DI3A 1YX3A 4YFNF 2DA3A 3VYTB 4CA0A 2CG4A 1MBGA 2KL4A 1A6QA 1LE8A 3SQNA 3NRVA 2L7FP 4CCJA 4BDYA 1OR7A 5K7HA 1UAAA 4BHCA 1RZ4A 1G3SA 2V1UA 3M7GA 3IC7A 2KZVA 3JSOA 3HJEA 3OOUA 2LP0A 4ESFA 2WA0A 1TL8A 3HB9A 4PJJA 2ME0A 3K6GA 3MZ8A 2QWWA 3OSFA 4HNVA 3F0CA 1SMTA 2VL8A 2XPVA 3JRFA 3G4SI 2R7OA 4B1RA 4BQOA 1XMAA 1IN4A 2V1DA 2M2EA 4OOIA 3WTTC 3OS1A 2B63J 3TW6A 4DIQA 5ICEA 4W97A 3K1NA 5J3LA 1UG2A 4U7BA 4YRVA 4ESJA 1OR7C 3H3UA 1YS6A 4WCGA 4HX7A 4HDVA 2YX4A 3QODA 2EBIA 3WTZA 2ZXHA 2H1LA 3MCZA 2Y0SN 4IHYA 3V8LA 2DOEA 2COMA 2HKXA 1L0OC 2K9NA 1YW9A 2QLZA 2FQ3A 3IH2A 1XCBA 2CJJA 1OQYA 2M8GX 3DKYA 5GPAA 2M34A 1A31A 2K85A 2KQRA 3L9FA 4PK4A 1FTZA 3W2AA 2ZXJA 2CW7A 5JFRA 4RM2A 4RA2A 4HBLA 4CXFA 4CO8A 2W48A 4ASNA 4B3AA 2RVCA 2IT0A 1IDZA 2VKDA 3EYYA 2CGPA 1X19A 2MG4A 2UXXA 3DP7A 4ETSA 4RBOA 1OCCH 2Q8KA 2Z5UA 3VOEA 2R7ZJ 5GAGJ 1J2XA 3PQJA 4FE4A 1SD4A 3ZPLA 1JHHA 1XDUA 2VJIA 2XGEA 3I56I 2H09A 2LREA 3DKWA 2XASA 3A2KA 4BY7J 1OPCA 2C6YA 4Y15A 3QU6A 2ISZA 1G3TA 1R23A 2VE8A 3BPXA 2HYFA 4L5JA 5FFZA 5F08A 1NHAA 2A5WA 2ZXWH 3MFKA 3CUQA 3B6AA 2L9RA 2CV1A 2IS4A 4EM0B 4EM1A 4XOPA 5EGOB 4NQWB 3A0HC 1YITI 2E7XA 1JTYA 3TP0A 5D8KB 2KJCA 2ZFWA 4C9YA 2H8RA 3LSRA 4UB8C 1X1CA 4Y17A 5HDNA 1YJNI 1FSEA 3BWGA 3DTIA 4DYCA 4FISA 3BG6A 3RQIA 1JUPA 3BCAA 5DD4A 3S3MA 2K7LA 4WX9A 5L3FA 2DMNA 3SFIA 1LUJB 2F4IA 2VC1A 2HQ5A 2RN7A 3CUQC 3GX4X 4EEFG 2VUMJ 1I6HJ 1SD7A 2Q1ZB 4G6DA 4M71A 5IYDJ 1W4MA 2KLOA 2L2OA 2V1NA 2LKSA 4V19K 5FFXA 3DBRB 2AXLA 4MGRA 5E8GA 3AG2H 4P1WA 5F1JA 2VJ4A 3G6EI 2MABA 1AKHA 5B1BH 4J00A 1TT5B 3OYGA 2E60A 1I1GA 1ZG1A 2MBFA 3PUBA 5JLXA 1YI2I 2KKOA 5FRMA 1SVLA 2XF6A 3KZZA 3Q9SA 2CV2A 4KN4X 1ACIA 4JQFA 3L2WA 4XSZF 1QZZA 2V6CA 4Y33A 1V4RA 4P9UA 4ZTFA 3DTKA 1WVRA 3MKYB 2Y30A 2QYOA 5F04A 2VBWA 2BXZA 2IAIA 1VFCA 3BTIA 4MQVA 1CF7B 4UXNA 1XC5A 4HZFA 2CS3A 3W2WA 5BS6A 1PYVA 1UELB 1VNDA 3JRGA 3JRBA 4EJWA 1B8IA 3JRCA 3BDDA 3Q0WA 3LAPA 2E2HJ 1Z0XA 2QVOA 3HOYJ 3PFIA 1A04A 3H0DA 1IXRC 1FYMA 1N25A 1WJEA 2DCEA 3E6BA 2VE9A 3ZQQA 1R9TJ 5TRDA 2PJRA 1Z05A 1H8AC 4F93B 2R7RA 5GP9A 1WJDA 4GYGA 3ZMVA 1ZAOA 2DTZA 4FQGA 1LVKA 1PVEA 2MC3A 2DYSH 5IP7J 3VODA 2KFDA 2MH2A 3FK7A 2M8EA 4O3MA 2FUG2 2V4JC 2MA3A 3JRDA 1DP7P 1MW7A 2I5UA 4KN7X 3K9TA 1GV2A 2EZHA 4AYBN 2BGCA 2W85A 4A0YA 3KYCB 3S3NA 2BBYA 2PMZN 1ZK8A 1J5YA 3FBNB 2E36A 4OAYA 2EV5A 4V2GA 4LK0F 1ZR2A 1O3QA 3PIPF 3SFZA 1D5YA 1QPIA 2B7EA 4IHTA 4KT5C 1IN5A 3LA2A 5CKTA 2VLAA 3M8EA 3L1PA 3G1LA 1GXPA 2ESHA 1OCZH 2FEZA 3G1OA 4EM2A 4DGWB 5BMZA 3U1DA 2QSHX 2OV7A 5LLQA 2G7UA 1T38A 1P7JA 2FSWA 3MWMA 3FXKA 3GTPJ 1QQIA 2HOEA 4E7HA 3OS2A 1FIAA 4PJNA 4ZJZA 1XGMA 4PJMA 4CCNA 2LVSA 1ETVA 2DBBA 4IHXA 2F2EA 4N4OB 2GOMA 2JRMA 4E7ZA 4BACA 4KMFA 2XV4S 2ZC2A 2ZCWA 3HZJA 4BNCA 2FX0A 1XSDA 2BVLA 3GZ5A 4A2UA 2YUSA 5C4JJ 5BOXA 5DCMB 4KFCA 2KHMA 2LBFB 2DA2A 4IO9F 2IEKA 3HPGA 3KCCA 4D5CA 3ROUA 3ZP5A 1ZG5A 3JRAA 1SEUA 5DM7F 1NK3P 2KZGA 2IA2A 2JUCA 3KYDB 2Z33A 3DV8A 1IV8A 5M5XJ 3MMYB 4N4NB 1J9IA 5HNFA 1LDKB 2NVUB 4LG0A 4M3EA 2DPUA 1RPWA 1TBXA 5ICCA 4O5VA 3BP8A 1OKRA 1BL0A 1MD0A 3CJNA 2ZJPF 3WTSC 1YW7A 2VKEA 1IGNA 4XLCA 1BI0A 3U9GA 4HW0A 2R3SA 4D7MA 1GLNA 4KITB 2DMPA 4HA8A 4X6AJ 3M3YJ 4ZDPA 1D1CA 2HVRA 1GT0C 2CUFA 2GBYA 2QBYB 2V9KA 3H36A 4B8XA 4LB5A 3K0LA 1Z67A 3KP2A 4R79A 3S1QJ 2XKOA 1UJ8A 4EGYA 1BN5A 2GQQA 1XSVA 2VOPA 1XN7A 2X6YA 4MNUA 2GOXB 4IX7A 1AU7A 4WWCA 2DMTA 3QPTA 3RKWA 1FMVA 4OIPF 2XSJC 3ERMA 2ECCA 1X3ZB 4AWXB 3OOPA 1HSTA 1R58A 2IJLA 3JR9A 1WHUA 1QVUA 2CQNA 2UZKA 4B44A 2ZNZA 2K40A 5FGMA 4EJVA 2KMUA 1P4WA 3IP4B 3MKZA 1LPQA 2LTPA 1B59A 4B4CA 1SD6A 3PNYA 1KU7A 1QPMA 2EQRA 4EQQA 1LFBA 2KPMA 4U0YA 4C3HJ 1U78A 1BOAA 2K86A 1I6XA 2P5VA 4IVNA 3A1YA 1BR2A 1JTXA 2QQBA 3ZN1A 4Q5SF 4BUPA 5F1RA 2STTA 3HL2A 4OIQF 3AL0B 1ZKGA 3V7SA 1OMIA 1TW3A 2LLKA 1IN8A 2A6TA 2WV0A 3K4KA 2JJ7A 3LL7A 3CCMI 1G4DA 2W24A 1QZYA 2W84A 3CLQA 1R6RA 3FM5A 3L00A 4ZH4F 1Z9CA 5K7FA 1TW2A 3ECOA 3HKZN 3SYTA 1GUUA 2WB1A 4YEJA 5HLGA 2E1OA 5DEQA 5FLMJ 4I98B 1SFOJ 1DGRM 3BG9A 4GYIA 4OWRB 3GTMJ 3KX2A 5CYVA 3P5JA 3K69A 5LRSA 4ZDOA 3BJ6A 2HDDA 3QPLA 3M4OJ 1MMDA 1ZRFA 3BJAA 5C44J 4DYQA 2WV1A 2H94A 2CQ7A 4L9JA 2V7FA 1T39A 1FYLA 5FKNA 2HTSA 4HLXA 4A6DA 2P4WA 3QOEA 4XMYA 3ZN0A 4M74A 1BC7C 1NG6A 2NS8A 3GFJA 3HUGA 2HVQA 1MIJA 4EMSA 3ZQIA 2O9LA 4CCOA 2O0YA 2YU3A 4JX5A 3TEDA 3RIRA 4J19A 1S6LA 4RMNA 4MHGA 3J80Z 1WGXA 2LNBA 1IO2A 2CW0F 3I54A 2IGOA 2L9SA 2WAFA 5GAEJ 3CCRI 3PSIA 1F36A 2FOWA 5IY5H 2VOOA 3OYMA 3F8MA 5KNLA 3WTXC 4HX8A 2EIJH 1GVJA 1KU9A 3H9JA 3PNTA 3ZQ7A 1I27A 4G6QA 2BOLA 1MKMA 4XL9A 2FOKA 3V7RA 3KFWX 4XN3A 1ZTRA 2F6CA 2EILH 5J1UA 3FF5A 1T33A 4X1EA 1B4AA 3Q3SA 4YIRX 4MTEA 3WTWC 1B72B 1D0XA 2IRFG 3CQZJ 2ZMEC 4EJUA 2XB0X 4Y13A 5FJ8J 1WJCA 1T08B 4X0GA 2HEOA 3TO9A 3DEEA 3I64A 1U8RA 2RDPA 2GIVA 2LY1A 3RKXA 3R4KA 4BHBA 4C2TA 1W5SA 1IN6A 1H88C 3FMQA 4NC6A 1XMKA 3MQ0A 1FLIA 2BV6A 2L4MA 1ZG3A 4FT8A 1MMGA 3HIFA 2HR3A 2EFWA 4LLNA 4LG3A 4A3JJ 1V5GA 5ICGA 3SDGA 1LEBA 1ONVA 2XAHA 2F5DA 3DFGA 2JPBA 2F5CA 3BTCA 2TRTA 2OQGA 4ZTJA 1SFXA 5LRRA 5B1AH 1BJAA 4EGZA 5D6FA 3WG7H 3GLXA 3AFHA 3PUFA 4ESBA 2NOGA 4AVZA 3J80K 3IRRA 2XB5A 3JRHA 2R5ZB 3L09A 1BC8C 3J7AO 1R1VA 3CESA 4ENMA 1KQ0A 3FKIJ 1RI7A 1JGGA 5M5WJ 2ME6A 1FZPB 2YR2A 1ULYA 2L54A 3DKXA 1W7PD 4CCLA 4HNTA 3TGNA 2DLLA 3OWTA 2DO7A 2IGNA 2BZTA 4I0AA 1YHQI 4BBRJ 5ERIA 3U2RA 5K5RA 3GFMA 2M7BA 2WY8Q 3GZNB 3RZDJ 5FD6A 1R5ID 3LWFA 3H92A 1UG0A 1HKSA 4G7OF 4F3QA 2KRFA 1Z7LA 2EFQA 2NVXJ 3S15J 4HQEA 3E6DA 3R0AA 4JK1X 2YPRA 2QZ8A 3I59A 2IGKA 1MGTA 2ZSHB 2JA5J 4ITVA 2BY2A 2CO5A 3V4GA 1JUSA 2E71A 1V5FA 3PSFA 5DDGA 4BE1A 3NEUA 1ZGAA 4HYEA 2FQ4A 2EV6A 2X6XA 2IP2A 4XRSG 3JCUC 4BQAA 5EF6A 1R1UA 1M1EB 3C1DA 4BEHA 4LIVA 1H89C 3GEZA 3M9AA 3BG3A 1VQNI 3P9KA 2ISYA 3G3ZA 3HOVJ 3S2HJ 2HZTA 2HWVA 1V5EA 1SVOA 4IPAA 5HOOA 4F92B 1OFCX 3LFKA 2A6HF 2TCTA 3ABLH 3I58A 3K2AA 2F5VA 1U6GA 2BY1A 4D0PA 3CO6C 1IRXA 2E1NA 3OIOA 4A3MJ 3I4PA 3LSGA 4I01A 4MEYF 2IW5A 4LGWA 1R5GA 4UNOA 1K7AA 1BIBA 3QYFA 3K4LA 1W5TA 1Y8QB 4CYCB 1U0JA 1GDTA 4IEJA 2HQAA 4LJZF 2W57A 1S7EA 2W1OA 4RB0A 1PJRA 3SEZA 1TWAJ 5D4SA 2NNYA 1RKWA 1WI3A 3IUOA 5ILUA 1HW2A 1KQ9A 3QP5A 5CVJA 2R5YB 1E3OC 2Z9OA 1FWZA 3FXQA 1TT0A 3FWEA 2XGDA 5IOZA 2GAUA 3ELKA 1Z3YA 2DA6A 2DDBA 2DK8A 5EJCA 5H20A 1VQPI 2DODA 3OYIA 1WQ2A 4A6EA 1SANA 4D1QA 1JKOC 1VQ4I 3GF2A 2VT3A 1YG2A 4UUSB 3ABUA 1QA6A 3GTQJ 2BHZA 4WK8F 2LRDA 2EIKH 2L4AA 1NK2P 4AUXA 2CUZA 4JX4A 1X3UA 3L2UA 2R0QC 3WU2C 1JJ6C 4S04A 1BI1A 3A03A 2E7WA 2PMZA 3CCYA 3VYUB 4UY8I 1IV6A 2WAQA 3BTJA 3DLAA 2G9WA 3H3VK 3TDZC 3BCBA 3HYIA 2WC2A 2KDOA 3FK6A 1RRJA 4N9IA 2MFZA 3H9GA 2GZWA 1XPXA 1U5TC 5CVIA 2IPQX 3TP3A 1MBKA 2RC4A 3C3WA 4FHTA 2A07F 3RKQA 3ZQCA 2XAJA 3BR5A 4XRFA 1EH7A 4XLFA 1WCMJ 3HSFA 3LSKA 1MDMB 5FLXZ 1LKXA 1G59A 2VXZA 3DTEA 4ZYHA 3CC4I 3D0SA 2FD5A 3ZMDA 1P4AA 2VB6A 5FKKA 4BKXA 2CYYA 3BT9A 4G12A 2Q2EB 1YS7A 3WU0A 2V6EA 2DYRH 3GTLJ 3BG5A 2GXAA 3RJPA 5D8LB 1MBJA 3KP5A 4UVBA 3BJOA 3LQRA 5F0HA 3CMAI 5EEHA 1ZLKA 2LFBA 1PP8F 4LK1F 3QYBA 5IT9Z 3JTGA 5LD2C 1C0WA 2XAQA 3ZRGA 4UV8A 3PIOF 1KU3A 1T2KA 1ERDA 1TQMA 4NUBA 2TDXA 4PFPA 1JKRC 5E3NA 3K4BA 1BA5A 3T1BA 1P6RA 1F4KA 5CVUA 4BGDA 3E6MA 3L2RA 3CDIA 3GLLA 1Y0NA 1DP3A 4CGZA 2CSOA 2OU2A 4BDZA 2Y48A 2LY2A 1RKTA 1QHGA 1PP7U 4QPQA 1Y39A 1D1AA 1J09A 2HDWA 1MH3A 4I76A 1B9MA 5DYMA 5J8CA 5E20A 2WBMA 4G7HF 1VQLI 1MBFA 4KIFA 4A93J 1XSXA 1MJBA 4IRHA 3VSLA 1YRNA 1LFPA 4MFDA 1OLTA 3IV5A 1P92A 3KEOA 4GFBA 2YS9A 5LEJA 1J59A 1ITYA 4PGHA 2RNGA 2HKOA 5FLXK 1TNSA 2OCCH 3WGGA 4II3A 2OZUA 2ZB9A 3F6OA 2G7HA 4U7DA 1NH3A 3A4CA 1OCTC 2Z2SB 4A0ZA 4E6KG 2E1MC 2AS5F 3HRSA 3G73A 1ZQ3P 3CDLA 3E3VA 2BXYA 4B3XA 2R7TA 3FXMA 4A3KJ 5KAIC 1T95A 1S9HA 1AA7A 5AIQA 5IT9K 1KU2A 2BW3A 1GHCA 4ABZA 2YX7A 3F8BA 3V42A 3RPQA 2M9HA 4HSRA 1R1TA 1G3WA 5HNHA 3EETA 3J7ZI 5FB2A 3BR1A 4HEA2 1E17A 5ICFA 3HM5A 1BI2A 2LG4A 3CCJI 1VI0A 2DMUA 4QPOA 1X3WB 2V9VA 4UVAA 3DBLB 2OD5A 1HKTA 3CJQB 4HAMA 5FD5A 1N77A 1FBUA 5CPRB 2DW4A 4XLHA 3F23A 1K61A 1EA3A 1D8JA 2Z1DA 4BYYA 3DEUA 2FBHA 2ZBKA 3SHFA 4DNCA 2PX9A 3HKZA 1Z1DA 2BE5F 2QM3A 3K1PA 2ZJQF 1IXSB 1XX5A 3RQ4A 3RI4A 5D5VB 1IRFA 2G0EA 2Y75A 5D5UB 1O3SA 1BW5A 5AONA 2HI3A 3GVAA 2F48A 1S7AA 1Y56A 1MSFC 1F43A 2JUGA 2W82A 4FCYA 3WODF 3TO7A 1W1WE 3TMOA 4NBQA 1RNLA 2PMHA 2OQRA 2XSDC 1U3EM 2CWEA 3IAM2 1J0RA 1ZRDA 1I39A 4M9XA 4BXUA 5KCMA 1ZRCA 2HPIA 2VQHA 1X1BA 2QA4I 1L3LA 2VJJA 2XHKA 2FF4A 5CQGA 5HS9A 2KP6A 2DTRA 2DQRA 1ZARA 4NB5A 1FTTA 1IUYA 2BEOA 4IOAF 3A02A 4UVCA 3F21A 2J5PA 3WTVC 4AIJA 5TJJA 2L7MP 2MLKA 1TTYA 1D3YA 2H6BA 1X1DA 2ZMEB 1APLC 3IRQA 4QTRA 2ID6A 3BTLA 3V7CA 1IC8A 3E1SA 2R4GA 1UHWA 1K83J 1PDNC 1PUFB 3KP3A 5LGTA 3MVPA 4LD5A 1K78B 1D1BA 1R4NB 3GUDA 3K70D 4PSXA 4G7ZF 3BG7A 2W4SA 3O3KA 4Y3OA 4B47A 1FBSA 2VQGA 1Y1VJ 2JK3A 3BC8A 3T8TA 3QRFF 4LIUA 2FBKA 4LLLA 4AIDA 2M0CA 3IHUA 1A35A 4W1UA 1YW8A 2AHQA 2RKHA 2Z3YA 2QKMB 4HG2A 2XC7A 1QHHD 2ADUA 2Y2ZA 2EPFA 3F72A 1FPQA 3KZIC 4LLGF 4NDLA 2HQRA 1YTYA 3DXJF 3RCOA 1EJ9A 1XGNA 4N0BA 1TZLA 5DTDA 3K4NA 4RDUA 4IXAA 1JGSA 1X1PA 4Y52J 4OMYA 3OIQA 2L3DA 3EDPA 1G2HA 1JHFA 1MNMC 3GO5A 5GTHC 3OYDA 4GXOA 2LSOA 2B0LA 5M3FJ 2GA1A 3BZCA 3MD2A 2DQLA 3TOAA 5CJ9A 5BPIA 2D2WA 3PJRA 1ETOA 5D5XB 3SEQA 1SVMA 5DM6F 5KHDA 4M3GA 1FMWA 3HXLA 4EJTA 2NYXA 1B1BA 1QRYA 4YIFA 3MEXA 3B02A 3IAS2 4E7LA 4RB2C 2H27A 1YO5C 2BY0A 4L9NA 2JA2A 2VASA 4BU2A 1ETWA 3NARA 4XSXF 4L5EA 2XUBA 4CZZA 3W3CA 3I55I 2ZO4A 4D9JA 3J81Z 2KISA 1HSJA 2XIGA 4PCQA 3AAFA 4KIGA 3PO3J 4RAFA 2P81A 2LR8A 5K5OA 3M07A 1Z6RA 1Y0UA 3I53A 4FETA 3RSNA 2V9PA 1RR8C 2RQQA 2VQLA 1KZHA 2EFPA 1RC9A 4UUTA 1LEAA 3FM3A 5E1WA 2M45A 1RIOH 1QU3A 3AG1H 1T0FA 5E17F 1WRJA 2EH3A 2VODA 3WTUC 2X1EA 3HTUA 1S5LC 2K9LA 3HRTA 3E7LA 1X2NA 2M1BA 5IOYA 5HS7A 5EGOA 4NQWA 4BXFA 4CH7A 2LYCA 4O6JA 5J4YA 5L3GA 2CQQA 4CDGA 4LOCA 3GBGA 1Q1HA 1OCOH 1ETKA 2DU9A 4KICA 3WTYC 1D0ZA 4OAZA 4D7NA 1T56A 2E2JJ 2GIZA 1WFXA 5FKLA 1O3TA 3OMYA 3HPHA 3TOBA 4XICA 1K4SA 3QAHA 4RAGA 3OYFA 2HPMA 1WJFA 3JW4A 2EINH 3CUOA 3FMRA 3KETA 1EH6A 4P96A 3LSHA 2CMPA 2PBIA 1P2FA 1U9NA 5IP6A 3SXYA 1XGSA 1WH7A 2HGCA 2VKHA 3AG3H 2DA5A 2MD0A 3ASOH 5EG0B 3K70C 1F5TA 3S32A 3T8RA 3OYNA 2BY3A 2WWYA 1WI9A 2WTEA 3J81K 1BIAA 2X9DA 4QWQA 3LSIA 1R71A 2QSFX 5LHHA 4M6XA 1P7IA 2R7FA 3I9V2 2O61A 4M3BA 2VPLA 3F8FA 4MO7A 3CJRB 2ZKZA 3T5XA 4UV9A 4I6ZA 1E0EA 2IBDA 3W6KB 2XPUA 3TBIA 3I0TA 3MKLA 2QENA 3OYBA 3DPUA 1YQAA 2FA5A 1GVDA 2VN2A 3GFLA 3VPRA 4U0WA 3DLLF 1H9TA 1CF7A 2K3PA 1UZCA 3HGGA 2Y9ZA 2AXTC 4BL0B 4MEXF 1YYVA 1ORKA 2CFOA 3FX3A 2DJNA 2IGMA 3OYJA 1AOYA 3P9IA 1MMAA 1VQ5I 3C2GA 4S0HB 2JWTA 3FKJA 5DD8A 4IOCF 2PEXA 4HV6A 4CCMA 4I2OA 3JRIA 1W7PB 1BM9A 2ID3A 5B66C 2HYGD 1IUFA 1U5TB 2QQ9A 2FJ1A 2P7VB 1NTCA 4UB6C 2X4HA 5L3CA 1STZA 2L7KA 2LH9A 4I02A 4V2FA 2EV0A 2P8TA 3DCFA 4QSHA 2E1CA 5E3OA 2IVMA 3TW7A 4A69C 1LE8B 4UHTA 3K10A 1QZEA
chains in the Genus database with same CATH topology
3A01A 1GV5A 3LSJA 1JTYA 3TP0A 4CYCB 2H8RA 1GDTA 1IG7A 4IEJA 3LSRA 1HDPA 1S7EA 5EYRA 2KDZA 1MH4A 4DYCA 1TWAJ 4FISA 3RQIA 1RKWA 1JUPA 1WI3A 2R5YB 2DMNA 3SFIA 1E3OC 1IDYA 1ZR4A 2HQ5A 1JT6A 1Q1VA 2XGDA 4EEFG 5IOZA 2VUMJ 1I6HJ 2DA6A 2HYJA 5IYDJ 1SANA 1JKOC 2ELKA 4BBSJ 4UUSB 3GTQJ 1U9OA 5F1JA 3IH4A 3S17J 2QF7A 2Y31A 3ZOBA 1W0TA 1AKHA 2D5VA 1NK2P 4AUXA 1MBHA 2YU9J 4JX4A 3ZQFA 2R0QC 5JLXA 1JJ6C 1EF4A 3A03A 3CCYA 1IV6A 3BTJA 2CQXA 2COBA 3HEFA 3UKGA 3OSGA 3H3VK 1I50J 3C2BA 1U8BA 1BW6A 2AO9A 2Y30A 3FK6A 1A5JA 5F04A 2IAIA 3TP3A 3HOXJ 1VFCA 3BTIA 1MBKA 4AC0A 1XC5A 4JYKA 3RKQA 1VNDA 3JRGA 3JRBA 3ZQCA 3BR5A 1B8IA 1WCMJ 3JRCA 3Q0WA 1IJWC 2ECBA 2E2HJ 1Z0XA 5FKOA 3S14J 2DN0A 3HOYJ 5C3EJ 3GTOJ 1IRZA 2QCOA 3PM1A 1R9TJ 2FD5A 5F27A 5FKKA 4BKXA 1H8AC 1ETYA 4G12A 3BT9A 5IP9J 5GP9A 3S1NJ 3WHCA 3GTLJ 2DTZA 3BG5A 5IP7J 1MBJA 3ZQHA 5F0HA 3FK7A 2LFBA 4BXXJ 5M3MJ 2JA6J 2KT0A 1I3QJ 3JRDA 2XPWA 5C4XJ 1GV2A 3HOZJ 2EZHA 4AYBN 5M5YJ 1JKRC 5EZHA 5E3NA 4Y7NJ 1BA5A 1TC3C 2PMZN 1CQTA 1ZK8A 4V2GA 1ZR2A 1D5YA 1QPIA 1O4XA 4A3BJ 1RKTA 1UMQA 3L1PA 3G1LA 1DU0A 3G1OA 3SJMA 1MH3A 1P7JA 4A3CJ 4I76A 3GTPJ 4M6VA 1FIAA 5J1YA 4DZJA 1MBFA 3BR2A 9ANTA 4A93J 2LVSA 1ETVA 4IHXA 3GTJJ 1AKHB 4A3IJ 1YRNA 4MFDA 1FEXA 3IV5A 1DU6A 4GFBA 2CUEA 2YS9A 1RESA 3S2DJ 1ITYA 5J1RA 2EZKA 2FX0A 2HOTA 3S1MJ 2YUSA 3QQAA 2K9SA 5C4JJ 2ZB9A 1OCTC 1RETA 2DA2A 1OJLA 2IEKA 4D5CA 1ZQ3P 3CDLA 4IHWA 1WPKA 3JRAA 4A3KJ 1JKQC 1NK3P 4BY1J 2JA7J 5E3MA 1PUFA 3LOCA 5M5XJ 4FE7A 1POGA 4ABZA 1B8IB 4M3EA 2M9HA 4XK4A 2NVTJ 1RPWA 5FLVA 2X48A 2R92J 1BL0A 3BQZA 3BR1A 5EZGA 2VKEA 2WB1N 3HM5A 1IGNA 1ZGWA 1VI0A 2DMUA 4DW6A 4D7MA 1FJLA 2DMPA 3B6CA 4X6AJ 4A3LJ 3M3YJ 4DYRA 5IPAA 3S16J 3WHBA 2L7ZA 1GT0C 1K61A 2JN6A 2CUFA 2GBYA 2Y9YA 2DMQA 4A3EJ 4MFEA 3S1QJ 5F0FA 1QVTA 2HOAA 2G0EA 1AU7A 2DMTA 1BW5A 2HI3A 3ZQGA 2ECCA 4FTHA 1MSFC 3MN2A 1F43A 2HXOA 3JR9A 3I4MJ 1QVUA 4FCYA 4XRSA 2K40A 2EZLA 3D1NI 4JX6A 2XSDC 2LTPA 2DA4A 3LSPA 4B4CA 2OF7A 1B72A 1YRNB 2EQRA 1LFBA 1AHDP 2RAEA 4C3HJ 2GM4A 1U78A 1HCRA 1FTTA 1XG1A 3A02A 1TWHJ 1OCPA 1BJZA 1TWGJ 3S1RJ 2JMWA 4C3JJ 1JTXA 3Q0VA 1ZKGA 2DA7A 2L7MP 2EZIA 2MW8A 2R93J 3GTKJ 2LLKA 1APLC 2JJ7A 4XRMA 4QTRA 2MSYA 2ID6A 3BTLA 5F0CA 1IC8A 3HDDA 1K83J 4MLOA 1PUFB 5K7FA 2O8KA 3HKZN 3MVPA 1GUUA 2E1OA 2X6OA 5FLMJ 1LFUP 1SFOJ 3GTMJ 3BG9A 4A3DJ 3IH3A 4A3GJ 3BR3A 2HDDA 5E3LA 3QPLA 3M4OJ 1Y1VJ 2JK3A 1TWCJ 2R5ZA 3BR6A 2M0CA 5C44J 4A3FJ 1JUMA 2WV1A 2VI6A 4MIMA 4DYQA 4W1UA 2AHQA 3Q0UA 3BR0A 5EEAA 5FKNA 3FISA 2Y2ZA 2DA1A 4NDLA 2NS8A 3GTGJ 2I10A 1JKPC 2XGCA 5DTDA 4RDUA 3ZQIA 2H1KA 2O9LA 4JX5A 3TEDA 4Y52J 4J19A 4QIWN 3PO2J 4M3FA 1G2HA 1RR7A 5EG0A 1WGXA 4DZPA 1MNMC 2OPTA 4C3IJ 2LD5A 2CRGA 2HOSA 2NS7A 1F36A 3ZQLA 5M3FJ 2VKVA 3BQYA 5EDNA 1W0UA 5IYBJ 1HF0A 1Y1WJ 3CMYA 1X2MA 2L0KA 2K9QA 4D5FA 1ETOA 1ETQA 5JLWA 4M3GA 1HDDC 2GLOA 2NVQJ 1QRYA 1ZTRA 5IYCJ 5J1UA 4X1EA 1T33A 4JP0A 3Q3SA 1B72B 5K7ZA 3CQZJ 1ETXA 3G1MA 1VF9A 1ETWA 3NARA 2XB0X 4L5EA 2E19A 5FJ8J 2N8GA 3HGYA 2LY9A 5DS9A 1UHSA 3PO3J 1H88C 2MGQA 2P81A 2LR8A 3JREA 1JJ8C 1ENHA 1XS9A 4UUTA 2JA8J 1Z77A 3W6VA 1HOMA 4A3JJ 2EH3A 2DA3A 3K7AJ 3E7LA 1MBGA 1X2NA 3SDGA 1LE8A 5IOYA 2L7FP 3H0GJ 5EGOA 1TWFJ 2TRTA 3BTCA 3DEWA 5K7HA 2CQQA 4CYCA 4LOCA 3GBGA 3JRHA 2NOGA 3OOUA 2LP0A 2XB5A 1ETKA 2R5ZB 3HB9A 3RZOJ 2ME0A 1WH5A 4D7NA 2R5YA 1T56A 3HOUJ 2CU7A 3LNQA 2E2JJ 3FKIJ 3OSFA 4HNVA 3F0CA 5FKLA 2XPVA 1JGGA 3JRFA 5M5WJ 2ME6A 4XICA 1MBEA 4B1RA 2M2EA 4M3DA 2B63J 3O8HA 3TW6A 4W97A 5J3LA 5HODA 1UG2A 1HLVA 4BBRJ 4UUSA 2VPRA 1JT0A 3QPSA 1U9NA 5IP6A 2EBIA 1WH7A 3RZDJ 5EG0B 2DA5A 2Y0SN 4IHYA 2NVXJ 3S15J 3FIWA 3I4NJ 2LK2A 2K9NA 2X9DA 3O8GA 3IH2A 3HBLA 1P7IA 1X58A 2CJJA 2M8GX 2XRLA 5GPAA 2M34A 4M3BA 4MO7A 3A01B 2JA5J 1FTZA 4I6ZA 1JUSA 2IBDA 1MSEC 2W48A 2XPUA 3MKLA 4B3AA 1IDZA 5GPCA 2E2IJ 1GVDA 3VPRA 5BNGA 2MG4A 2WAQN 2FQ4A 4RBOA 3HGGA 2Y9ZA 5FKMA 4C2MJ 2LKXA 4XRSG 2R7ZJ 1ORKA 5EF6A 4FE4A 2DJNA 4XIDA 3HOWJ 2XGEA 4IHVA 1H89C 4S0HB 2JWTA 1FIPA 2O7OA 3BG3A 4BY7J 3JRIA 3HOVJ 3NAUA 2ID3A 3S2HJ 1IUFA 5F08A 2FJ1A 1NTCA 1OFCX 1A6IA 2NVYJ 2TCTA 4V2FA 2HXIA 3K2AA 3B6AA 2L9RA 3DCFA 4QSHA 5E3OA 3OIOA 4A3MJ 3TW7A 4A69C 3LSGA 1LE8B 5EGOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A01 A;  1GV5 A;  3LSJ A;  1JTY A;  3TP0 A;  4CYC B;  2H8R A;  1GDT A;  1IG7 A;  4IEJ A;  3LSR A;  1HDP A;  1S7E A;  5EYR A;  2KDZ A;  1MH4 A;  4DYC A;  1TWA J;  4FIS A;  3RQI A;  1RKW A;  1JUP A;  1WI3 A;  2R5Y B;  2DMN A;  3SFI A;  1E3O C;  1IDY A;  1ZR4 A;  2HQ5 A;  1JT6 A;  1Q1V A;  2XGD A;  4EEF G;  5IOZ A;  2VUM J;  1I6H J;  2DA6 A;  2HYJ A;  5IYD J;  1SAN A;  1JKO C;  2ELK A;  4BBS J;  4UUS B;  3GTQ J;  1U9O A;  5F1J A;  3IH4 A;  3S17 J;  2QF7 A;  2Y31 A;  3ZOB A;  1W0T A;  1AKH A;  2D5V A;  1NK2 P;  4AUX A;  1MBH A;  2YU9 J;  4JX4 A;  3ZQF A;  2R0Q C;  5JLX A;  1JJ6 C;  1EF4 A;  3A03 A;  3CCY A;  1IV6 A;  3BTJ A;  2CQX A;  2COB A;  3HEF A;  3UKG A;  3OSG A;  3H3V K;  1I50 J;  3C2B A;  1U8B A;  1BW6 A;  2AO9 A;  2Y30 A;  3FK6 A;  1A5J A;  5F04 A;  2IAI A;  3TP3 A;  3HOX J;  1VFC A;  3BTI A;  1MBK A;  4AC0 A;  1XC5 A;  4JYK A;  3RKQ A;  1VND A;  3JRG A;  3JRB A;  3ZQC A;  3BR5 A;  1B8I A;  1WCM J;  3JRC A;  3Q0W A;  1IJW C;  2ECB A;  2E2H J;  1Z0X A;  5FKO A;  3S14 J;  2DN0 A;  3HOY J;  5C3E J;  3GTO J;  1IRZ A;  2QCO A;  3PM1 A;  1R9T J;  2FD5 A;  5F27 A;  5FKK A;  4BKX A;  1H8A C;  1ETY A;  4G12 A;  3BT9 A;  5IP9 J;  5GP9 A;  3S1N J;  3WHC A;  3GTL J;  2DTZ A;  3BG5 A;  5IP7 J;  1MBJ A;  3ZQH A;  5F0H A;  3FK7 A;  2LFB A;  4BXX J;  5M3M J;  2JA6 J;  2KT0 A;  1I3Q J;  3JRD A;  2XPW A;  5C4X J;  1GV2 A;  3HOZ J;  2EZH A;  4AYB N;  5M5Y J;  1JKR C;  5EZH A;  5E3N A;  4Y7N J;  1BA5 A;  1TC3 C;  2PMZ N;  1CQT A;  1ZK8 A;  4V2G A;  1ZR2 A;  1D5Y A;  1QPI A;  1O4X A;  4A3B J;  1RKT A;  1UMQ A;  3L1P A;  3G1L A;  1DU0 A;  3G1O A;  3SJM A;  1MH3 A;  1P7J A;  4A3C J;  4I76 A;  3GTP J;  4M6V A;  1FIA A;  5J1Y A;  4DZJ A;  1MBF A;  3BR2 A;  9ANT A;  4A93 J;  2LVS A;  1ETV A;  4IHX A;  3GTJ J;  1AKH B;  4A3I J;  1YRN A;  4MFD A;  1FEX A;  3IV5 A;  1DU6 A;  4GFB A;  2CUE A;  2YS9 A;  1RES A;  3S2D J;  1ITY A;  5J1R A;  2EZK A;  2FX0 A;  2HOT A;  3S1M J;  2YUS A;  3QQA A;  2K9S A;  5C4J J;  2ZB9 A;  1OCT C;  1RET A;  2DA2 A;  1OJL A;  2IEK A;  4D5C A;  1ZQ3 P;  3CDL A;  4IHW A;  1WPK A;  3JRA A;  4A3K J;  1JKQ C;  1NK3 P;  4BY1 J;  2JA7 J;  5E3M A;  1PUF A;  3LOC A;  5M5X J;  4FE7 A;  1POG A;  4ABZ A;  1B8I B;  4M3E A;  2M9H A;  4XK4 A;  2NVT J;  1RPW A;  5FLV A;  2X48 A;  2R92 J;  1BL0 A;  3BQZ A;  3BR1 A;  5EZG A;  2VKE A;  2WB1 N;  3HM5 A;  1IGN A;  1ZGW A;  1VI0 A;  2DMU A;  4DW6 A;  4D7M A;  1FJL A;  2DMP A;  3B6C A;  4X6A J;  4A3L J;  3M3Y J;  4DYR A;  5IPA A;  3S16 J;  3WHB A;  2L7Z A;  1GT0 C;  1K61 A;  2JN6 A;  2CUF A;  2GBY A;  2Y9Y A;  2DMQ A;  4A3E J;  4MFE A;  3S1Q J;  5F0F A;  1QVT A;  2HOA A;  2G0E A;  1AU7 A;  2DMT A;  1BW5 A;  2HI3 A;  3ZQG A;  2ECC A;  4FTH A;  1MSF C;  3MN2 A;  1F43 A;  2HXO A;  3JR9 A;  3I4M J;  1QVU A;  4FCY A;  4XRS A;  2K40 A;  2EZL A;  3D1N I;  4JX6 A;  2XSD C;  2LTP A;  2DA4 A;  3LSP A;  4B4C A;  2OF7 A;  1B72 A;  1YRN B;  2EQR A;  1LFB A;  1AHD P;  2RAE A;  4C3H J;  2GM4 A;  1U78 A;  1HCR A;  1FTT A;  1XG1 A;  3A02 A;  1TWH J;  1OCP A;  1BJZ A;  1TWG J;  3S1R J;  2JMW A;  4C3J J;  1JTX A;  3Q0V A;  1ZKG A;  2DA7 A;  2L7M P;  2EZI A;  2MW8 A;  2R93 J;  3GTK J;  2LLK A;  1APL C;  2JJ7 A;  4XRM A;  4QTR A;  2MSY A;  2ID6 A;  3BTL A;  5F0C A;  1IC8 A;  3HDD A;  1K83 J;  4MLO A;  1PUF B;  5K7F A;  2O8K A;  3HKZ N;  3MVP A;  1GUU A;  2E1O A;  2X6O A;  5FLM J;  1LFU P;  1SFO J;  3GTM J;  3BG9 A;  4A3D J;  3IH3 A;  4A3G J;  3BR3 A;  2HDD A;  5E3L A;  3QPL A;  3M4O J;  1Y1V J;  2JK3 A;  1TWC J;  2R5Z A;  3BR6 A;  2M0C A;  5C44 J;  4A3F J;  1JUM A;  2WV1 A;  2VI6 A;  4MIM A;  4DYQ A;  4W1U A;  2AHQ A;  3Q0U A;  3BR0 A;  5EEA A;  5FKN A;  3FIS A;  2Y2Z A;  2DA1 A;  4NDL A;  2NS8 A;  3GTG J;  2I10 A;  1JKP C;  2XGC A;  5DTD A;  4RDU A;  3ZQI A;  2H1K A;  2O9L A;  4JX5 A;  3TED A;  4Y52 J;  4J19 A;  4QIW N;  3PO2 J;  4M3F A;  1G2H A;  1RR7 A;  5EG0 A;  1WGX A;  4DZP A;  1MNM C;  2OPT A;  4C3I J;  2LD5 A;  2CRG A;  2HOS A;  2NS7 A;  1F36 A;  3ZQL A;  5M3F J;  2VKV A;  3BQY A;  5EDN A;  1W0U A;  5IYB J;  1HF0 A;  1Y1W J;  3CMY A;  1X2M A;  2L0K A;  2K9Q A;  4D5F A;  1ETO A;  1ETQ A;  5JLW A;  4M3G A;  1HDD C;  2GLO A;  2NVQ J;  1QRY A;  1ZTR A;  5IYC J;  5J1U A;  4X1E A;  1T33 A;  4JP0 A;  3Q3S A;  1B72 B;  5K7Z A;  3CQZ J;  1ETX A;  3G1M A;  1VF9 A;  1ETW A;  3NAR A;  2XB0 X;  4L5E A;  2E19 A;  5FJ8 J;  2N8G A;  3HGY A;  2LY9 A;  5DS9 A;  1UHS A;  3PO3 J;  1H88 C;  2MGQ A;  2P81 A;  2LR8 A;  3JRE A;  1JJ8 C;  1ENH A;  1XS9 A;  4UUT A;  2JA8 J;  1Z77 A;  3W6V A;  1HOM A;  4A3J J;  2EH3 A;  2DA3 A;  3K7A J;  3E7L A;  1MBG A;  1X2N A;  3SDG A;  1LE8 A;  5IOY A;  2L7F P;  3H0G J;  5EGO A;  1TWF J;  2TRT A;  3BTC A;  3DEW A;  5K7H A;  2CQQ A;  4CYC A;  4LOC A;  3GBG A;  3JRH A;  2NOG A;  3OOU A;  2LP0 A;  2XB5 A;  1ETK A;  2R5Z B;  3HB9 A;  3RZO J;  2ME0 A;  1WH5 A;  4D7N A;  2R5Y A;  1T56 A;  3HOU J;  2CU7 A;  3LNQ A;  2E2J J;  3FKI J;  3OSF A;  4HNV A;  3F0C A;  5FKL A;  2XPV A;  1JGG A;  3JRF A;  5M5W J;  2ME6 A;  4XIC A;  1MBE A;  4B1R A;  2M2E A;  4M3D A;  2B63 J;  3O8H A;  3TW6 A;  4W97 A;  5J3L A;  5HOD A;  1UG2 A;  1HLV A;  4BBR J;  4UUS A;  2VPR A;  1JT0 A;  3QPS A;  1U9N A;  5IP6 A;  2EBI A;  1WH7 A;  3RZD J;  5EG0 B;  2DA5 A;  2Y0S N;  4IHY A;  2NVX J;  3S15 J;  3FIW A;  3I4N J;  2LK2 A;  2K9N A;  2X9D A;  3O8G A;  3IH2 A;  3HBL A;  1P7I A;  1X58 A;  2CJJ A;  2M8G X;  2XRL A;  5GPA A;  2M34 A;  4M3B A;  4MO7 A;  3A01 B;  2JA5 J;  1FTZ A;  4I6Z A;  1JUS A;  2IBD A;  1MSE C;  2W48 A;  2XPU A;  3MKL A;  4B3A A;  1IDZ A;  5GPC A;  2E2I J;  1GVD A;  3VPR A;  5BNG A;  2MG4 A;  2WAQ N;  2FQ4 A;  4RBO A;  3HGG A;  2Y9Z A;  5FKM A;  4C2M J;  2LKX A;  4XRS G;  2R7Z J;  1ORK A;  5EF6 A;  4FE4 A;  2DJN A;  4XID A;  3HOW J;  2XGE A;  4IHV A;  1H89 C;  4S0H B;  2JWT A;  1FIP A;  2O7O A;  3BG3 A;  4BY7 J;  3JRI A;  3HOV J;  3NAU A;  2ID3 A;  3S2H J;  1IUF A;  5F08 A;  2FJ1 A;  1NTC A;  1OFC X;  1A6I A;  2NVY J;  2TCT A;  4V2F A;  2HXI A;  3K2A A;  3B6A A;  2L9R A;  3DCF A;  4QSH A;  5E3O A;  3OIO A;  4A3M J;  3TW7 A;  4A69 C;  3LSG A;  1LE8 B;  5EGO B; 
#chains in the Genus database with same CATH topology
 3A01 A;  4NC8 A;  1K6O A;  3WGI A;  4PFO A;  5E79 C;  1IG7 A;  1HQC A;  1R5H A;  2W25 A;  1SFU A;  2DPD A;  1O3R A;  2NS0 A;  2KDZ A;  1MH4 A;  1G3Y A;  3ML6 A;  2Y69 H;  3HHH A;  2EB7 A;  1IDY A;  3O6B B;  5JR3 A;  2CQK A;  1FP1 D;  1JT6 A;  1Q1V A;  1JI8 A;  4HOB A;  4DBQ A;  2Y0S A;  1N75 A;  2EFN A;  3WE3 A;  4BJ5 C;  4BBS J;  3EPZ A;  4RLQ A;  4TV7 A;  2GWR A;  2Y31 A;  1W0T A;  2D5V A;  2FNA A;  2FBI A;  1VQM I;  3MZY A;  3K4J A;  2D1V A;  3GZ6 A;  1O7F A;  3DU5 A;  2RV8 A;  4BHP A;  3ABM H;  3HEF A;  5DCM A;  3UKG A;  3VYR B;  2LBF A;  1HBX G;  4RGR A;  4IQJ A;  1I50 J;  1TQP A;  1U8B A;  2X85 A;  5J4V A;  2AO9 A;  2IS2 A;  3VWB A;  2KIQ A;  1S29 A;  1SFE A;  2KIM A;  2M5W A;  3CC2 I;  2DOA A;  2NAZ A;  4ENJ A;  2ZJR F;  1REP C;  5HLI A;  4UUV A;  4XLP F;  4II2 A;  1YJ9 I;  2P7C B;  2VXD A;  5FKO A;  3Q9V A;  4DBR A;  3GTO J;  2QCO A;  3PM1 A;  3LAJ A;  3H3Z A;  4RGX A;  3DU6 A;  4HRI A;  4G94 A;  3S1N J;  2YSR A;  1CGP A;  3WHC A;  1FT9 A;  4WXD A;  3QP6 A;  2ELJ A;  1XD7 A;  2HQN A;  2E35 A;  4LMY A;  2CFX A;  3KP4 A;  3M8F A;  3CUQ B;  3ZQH A;  3P7N A;  1I5Z A;  1W36 D;  2VON A;  3OYH A;  4B43 A;  2DAO A;  2KT0 A;  2JA6 J;  1H9G A;  1I3Q J;  2ZJ2 A;  5JVT A;  4N9H A;  5C4X J;  3HOZ J;  2QBY A;  3BPV A;  4G8X A;  5M5Y J;  1JE8 A;  4ZYA A;  1Z6T A;  4Y7N J;  5TIS C;  1TC3 C;  4LFU A;  1YE9 A;  3EUK L;  4RS8 A;  4ON0 A;  3E97 A;  2NOJ B;  5E18 F;  1SMY F;  4A3B J;  2DDA A;  1UMQ A;  2Z16 A;  2PI0 A;  1BR4 A;  3OR2 C;  1VQO I;  2CH0 A;  4XN0 A;  2UXN A;  2ZXI A;  3F8C A;  4M6V A;  5CVR A;  5J1Y A;  1K6Y A;  3RPU A;  1ON2 A;  4YFK F;  2O6G E;  2PJP A;  3BR2 A;  1DPR A;  3GTJ J;  4KIB A;  3U21 A;  1AKH B;  3OL4 A;  5JI6 A;  4A3I J;  4KNY A;  4BJ6 C;  2J5O A;  3S2D J;  3CP2 A;  1P4X A;  5J1R A;  2EZK A;  4KIS A;  3ZMT A;  3S1M J;  3CCL I;  1MMN A;  5F6F A;  4EVI A;  3QQA A;  1VQ6 I;  4NC7 A;  1FC3 A;  3ECH A;  3DPL C;  2OTJ I;  3KIO A;  1OJL A;  1T98 A;  4G9Y A;  2ESN A;  3K2Z A;  4K2E A;  4IHW A;  1HA8 A;  1XCV A;  3ZMZ A;  3BZ6 A;  4PGG A;  1T8I A;  2DFH A;  2WY7 Q;  3ONQ A;  3LFU A;  1JKQ C;  1ZH5 A;  2DFF A;  4HNU A;  3HOS A;  5E3M A;  1R7J A;  5B3S H;  1VTN C;  1EV7 A;  4M72 A;  3ZCO A;  1B8I B;  4CIC A;  4XK4 A;  5D6E A;  4HF0 A;  3RDI A;  3E5U A;  4QLC U;  5J6X A;  1MJ9 A;  1S3J A;  2VBZ A;  2W7N A;  5D4R A;  2P6T A;  4IL6 C;  4RM3 A;  4E4H A;  2P6S A;  3KPH A;  2PJR B;  1V3F A;  3VEP A;  4MTD A;  2R7D A;  1MNE A;  5LHG A;  1OYI A;  2WB1 N;  5J8F A;  4KA4 A;  3AL0 C;  3CCQ I;  4RAZ A;  4DW6 A;  5GTI C;  2VC0 A;  4AYB A;  2MC4 A;  2A6E F;  4BH9 A;  3N4M A;  1LB2 A;  3D5R C;  3B6C A;  2FML A;  4A3L J;  4FX4 A;  2HNH A;  1UB9 A;  2OJE D;  4XKC A;  3S16 J;  5CVV A;  3JSP A;  2L7Z A;  3MAJ A;  2JSP A;  3OR1 C;  2CW8 A;  1K4T A;  4PZJ A;  2DFE A;  4C30 A;  4E7K A;  4A3E J;  3ZMS A;  2DT6 A;  1BI3 A;  4XON A;  4AD9 A;  4P5O A;  3FZV A;  4CZC A;  1ZRE A;  2QUF A;  4M6Y A;  1QVT A;  3P9C A;  2DFI A;  1KA8 A;  2ZFU A;  3WGH A;  4EAT A;  1YFH A;  3PFY A;  4M9Z A;  1Z21 A;  4FTH A;  2EA4 A;  2HXO A;  4F7Z A;  1QBJ A;  4OIO F;  4U87 A;  3E5X A;  2F5F A;  1W36 C;  2EZL A;  3D1N I;  3V8K A;  3LQQ A;  3TKY A;  1YIJ I;  4NNJ A;  2HVS A;  2GA2 A;  2P0W A;  2DA4 A;  2HTJ A;  3ESW B;  1SAU A;  1B72 A;  4H4K C;  4M73 A;  4GDF A;  1AHD P;  3FXJ A;  4XLE A;  3BY6 A;  3GYH X;  1HCR A;  4M9S A;  5DUI A;  1XG1 A;  3QWL A;  4P55 A;  3IKT A;  2HFH A;  5LBQ A;  1TWH J;  5LGU A;  3AKZ A;  1BJZ A;  1TWG J;  2A3S A;  3C2H A;  3S1R J;  2JZY A;  4RGS A;  2CUJ A;  1Z3X A;  1KYZ A;  1KGS A;  2DA7 A;  2KIF A;  2EZI A;  2MW8 A;  3GTK J;  3HRU A;  4OIR F;  2K4J A;  2R7X A;  1IZ1 A;  1OIS A;  4XBF A;  3MKW B;  3CME I;  5GAH J;  1ZN2 A;  4I09 A;  1X1A A;  2O8K A;  2X51 A;  2X6O A;  3GCM A;  4LG0 B;  3KE2 A;  4A3D J;  4HF1 A;  3IH3 A;  1UHM A;  5FO5 A;  3UNG C;  3EUH A;  3RTR A;  2F4M B;  2D45 A;  4Z6Y A;  5E3L A;  3IL2 A;  3ZXS A;  1O57 A;  4I7H A;  1J7K A;  2R5Z A;  1HW5 A;  3BR6 A;  2STW A;  2VI6 A;  4MIM A;  1SD5 A;  4KJZ A;  3VB2 A;  2QKL B;  3SDB A;  1R36 A;  3BR0 A;  3FIS A;  4XKW A;  3GFI A;  5EEG A;  3MZH A;  2DA1 A;  2OBP A;  1FOK A;  3SZG A;  3OYC A;  2X1D A;  4E7I A;  3FBI B;  5J47 A;  4L9T A;  2H1K A;  4KMU X;  1U2W A;  4XLA A;  1V55 H;  1EH8 A;  4HQM A;  1J75 A;  3EUH C;  1OYY A;  4AVP A;  1TQI A;  1DQU A;  2QEX I;  5JVG F;  4KYW A;  2MYS A;  4DZP A;  2EWN A;  2LD5 A;  1X4P A;  2CRG A;  4GGG A;  2HOS A;  1WWX A;  1LJ9 A;  2NS7 A;  3L2Q A;  3ZQL A;  2R7V A;  1FOX A;  2L9V A;  3OL3 A;  3FDY A;  1G6N A;  3JTH A;  2PLY A;  3BQY A;  3CD6 I;  1W0U A;  2UWM A;  3LA3 A;  5IYB J;  1KYW A;  1Y1W J;  5E8I A;  4XKV A;  1X2M A;  2L5Q A;  1R22 A;  3QPH A;  4WXC A;  3CDH A;  2NNN A;  4D5F A;  1ETQ A;  1D5V A;  1MZB A;  1VQK I;  1HDD C;  1XGO A;  5HVQ C;  4RGU A;  3TL4 X;  3G1M A;  2E5Z A;  1ZHF A;  1DGW Y;  1WJB A;  4U88 A;  3QYE A;  4XR6 A;  4J01 A;  2LY9 A;  3LMM A;  2EJR A;  3KLO A;  1HKQ A;  4IF4 A;  1FOY A;  4E70 A;  1E2X A;  1A36 A;  3ASN H;  2RGV A;  3CCU I;  3H5R A;  4IQ4 A;  1OYW A;  1JJ8 C;  1ENH A;  2P5L C;  3AG4 H;  5LGN A;  2LF8 A;  2FXA A;  4FX0 A;  2JA8 J;  3W6V A;  1HOM A;  3ISP A;  3OV8 A;  1YLF A;  4LIT A;  3K7A J;  1GXQ A;  3TO6 A;  1VZ0 A;  1O7L A;  1DUX C;  3WU1 B;  2X6W A;  2QSG X;  4IHS A;  3H0G J;  1FNN A;  1YOV B;  1SFK A;  1TWF J;  2EFO A;  3DEW A;  3N97 A;  4CYC A;  3IWZ A;  2XF7 A;  2K4B A;  3EQL F;  3DBH B;  3TQN A;  4PDK A;  3RZO J;  2A68 F;  1I1S A;  3LA7 A;  5CQE A;  6PAX A;  1WH5 A;  2R5Y A;  4HST A;  3HOU J;  2CU7 A;  3LNQ A;  3IKV A;  3IWF A;  4OMZ A;  3OYL A;  2QQ8 A;  3G2B A;  5LFA A;  1LQ1 A;  3TDU C;  1MBE A;  2LKP A;  2IS6 A;  2LC2 A;  4RB1 A;  2DK5 A;  4M3D A;  3HUG B;  3O8H A;  2LOO A;  5HOD A;  3HSR A;  1HLV A;  4XOR A;  4UUS A;  2VPR A;  1JT0 A;  3QPS A;  1QO0 D;  5AIP A;  2M30 A;  3KEY A;  3H1C A;  2BVM A;  2V1X A;  5A2Q Z;  3CP8 A;  3FIW A;  2B9S A;  3I4N J;  2GXG A;  2LK2 A;  4A12 A;  3O8G A;  2RRE A;  3NQO A;  3HBL A;  1BBY A;  1X58 A;  2XRL A;  4CUG A;  5E1Z B;  3K4M A;  3A01 B;  3KEQ A;  2F4O B;  3C18 A;  4R8H A;  2JQ7 A;  4L5I A;  2EK5 A;  1MSE C;  3R61 A;  1FBQ A;  5GPC A;  2RQP A;  5DV5 A;  2E2I J;  5BNG A;  2MLG A;  5KVR A;  2WAQ N;  1IAW A;  3QU3 A;  5FKM A;  4C2M J;  2LKX A;  3OIP A;  4PJL A;  4XID A;  3CTA A;  4YEL A;  1MDM A;  3HOW J;  2ICW G;  3PNV A;  4IHV A;  2R7S A;  5DUK A;  2OZ6 A;  4BE2 A;  1FIP A;  5ILS A;  2O7O A;  1MMS A;  1LDD A;  1FP2 A;  3L2C A;  5GAD J;  1ZLJ A;  4EJO A;  3ABK H;  1WSU A;  3NAU A;  2Q2E A;  3UR3 C;  1YJW I;  5E1X A;  3E5Q A;  1JXS A;  2HZD A;  1A6I A;  2NVY J;  2HXI A;  4YG2 F;  2ACJ A;  1Y8R B;  3F22 A;  1KON A;  3K1M A;  4OIN F;  2IA0 A;  1IRG A;  5H6Q A;  4RB3 C;  1GV5 A;  3LSJ A;  1Z7U A;  3HG9 A;  1WJA A;  1MJA A;  3GW2 A;  2V26 A;  1HDP A;  2PFB A;  5EYR A;  5A2Q K;  4XKB A;  1XB4 A;  3J7Y J;  2H8W A;  2PMU A;  5HDK A;  1ZR4 A;  4RLF A;  2WAD A;  2XDV A;  4BJT A;  2Q0O A;  2M0M A;  3CZ6 A;  4IZZ A;  2GXB A;  2HYJ A;  3Q5F A;  1HW1 A;  4HPQ A;  2ELK A;  5H6R A;  3R60 A;  3S2W A;  4ZZL A;  1UFM A;  1U9O A;  2AQF A;  2Z99 A;  1K79 A;  3IH4 A;  3S17 J;  3FXL A;  3ERE D;  2QF7 A;  5TGT A;  3ZOB A;  1VQ8 I;  1NG7 A;  3O2P E;  2LMD A;  1WKM A;  3BLY A;  1MBH A;  2YU9 J;  3HTS B;  2A69 F;  3ZQF A;  1IN7 A;  4ENK A;  2DOF A;  2BHY A;  1EF4 A;  3A0B C;  5JHF A;  3ABT A;  1VQ9 I;  2DJI A;  3FXO A;  1WZ2 A;  3I59 B;  4PJ0 C;  3H35 A;  4DJA A;  4ZZD A;  4B48 A;  1TLH B;  2FU4 A;  4NHJ A;  1UCR A;  2CQX A;  2COB A;  4L0Y B;  4AM3 A;  3OSG A;  1SAX A;  2A05 A;  3KYL A;  1B6A A;  3C2B A;  2M87 A;  1BW6 A;  5K1Y A;  3CCS I;  3M1C A;  4GCV A;  4ZYD A;  1A5J A;  3M8J A;  3WG9 A;  5L3B A;  1ZYR F;  5B5E C;  5LEK A;  3HOX J;  1H0M A;  2JVH A;  5LHI A;  3R0J A;  4AC0 A;  5ED4 A;  3H9Q A;  3HHG A;  4JYK A;  3EYI A;  1T0F C;  2JRT A;  4PUS A;  4A5N A;  3ZMU A;  5L3E A;  2L9N A;  2PG4 A;  4U0V A;  4S05 A;  1T6S A;  1IJW C;  2ECB A;  3I5U A;  5FRO A;  4BEH B;  1D0Y A;  3S14 J;  5HDG A;  2DN0 A;  2VT2 A;  5C3E J;  2XAF A;  1IRZ A;  4WXH A;  3DWL E;  2ZNY A;  4P9F A;  2IA1 A;  5F27 A;  1ETY A;  4AU7 A;  5IP9 J;  2VJ5 A;  1IXC A;  3SZP A;  1IW7 F;  3NWS A;  4Z2Y A;  2A5Y B;  4H0E A;  2MD5 A;  2X0L A;  4BS9 A;  4Q4Z F;  2OUM A;  5HS8 A;  4XOT A;  4BXX J;  5M3M J;  2EIM H;  2ETH A;  4BAY A;  3DQV C;  4ZYE A;  1BOB A;  2XPW A;  4F55 A;  3W2V A;  1LVA A;  2FE3 A;  3F3X A;  3SZT A;  5EZH A;  1ZEL A;  3RYR A;  1R00 A;  2ELH A;  1CQT A;  2QGU A;  3L7W A;  4ZYG A;  2K27 A;  4EV0 A;  4A0X A;  1ODD A;  1O4X A;  3X2Q H;  1DU0 A;  3H5N A;  3SJM A;  5H2F C;  3E0J B;  3KZY A;  1DDN A;  2K3F A;  3JAM Z;  4A3C J;  5FRN A;  2XKP A;  4IRG A;  4DZJ A;  2JVG A;  3BOQ A;  4ENN A;  3OS0 A;  2DT7 B;  9ANT A;  3S3O A;  1R49 A;  2ZSI B;  4HX4 A;  3ZGK A;  1FEX A;  2XRN A;  1DU6 A;  2CUE A;  2QQA A;  1RES A;  2MH9 A;  5CLS A;  3PL8 A;  3D5L A;  2HOT A;  2UUZ A;  4DQ2 A;  2K9S A;  2LF7 A;  1Y6I A;  3EUA A;  2HU9 A;  2OCE A;  2E5N A;  1QNT A;  3RYP A;  1RET A;  3KLN A;  3FHZ A;  2XVC A;  3OY9 A;  4LB6 B;  2K9M A;  1UST A;  3ULQ B;  1EKE A;  5KAF C;  2ZME A;  1WPK A;  5HLT A;  4BE0 A;  3F6V A;  1FX7 A;  3V8J A;  4BY1 J;  1FY7 A;  2JA7 J;  2KRC A;  1PUF A;  3LOC A;  4FE7 A;  3I3L A;  1POG A;  3C7J A;  4OU0 A;  2FNP A;  4E7J A;  2W00 A;  1W5C C;  3CLO A;  1K78 A;  3S8P A;  3J7A Y;  3RPU D;  2NVT J;  3BRO A;  1D8K A;  5FLV A;  4IKF A;  4E7S A;  1OCR H;  2X48 A;  3DF8 A;  2R92 J;  1LNW A;  3BZK A;  3HSE A;  3BQZ A;  4WF2 A;  5EZG A;  1WJ5 A;  2WAE A;  2NRA C;  2Y0M A;  1ZGW A;  1G8X A;  2OTL I;  1XTA A;  4R1H A;  2O8X A;  4AIK A;  1S72 I;  1FJL A;  1VQ7 I;  4HV5 A;  1FSH A;  4HDU A;  4FAS D;  2O5R A;  4HLY A;  1HC8 A;  2M7A A;  3NWT A;  2DT5 A;  3FXR A;  5J40 A;  4F91 B;  4DYR A;  5IPA A;  3JAM K;  4KDP A;  3L2V A;  3COA C;  2RNJ A;  3WHB A;  1E3P A;  2L02 A;  2OA4 A;  2JN6 A;  4RAY A;  4CSW A;  2XRO A;  2Y9Y A;  3W6J B;  1F9N A;  2DMQ A;  4BQQ A;  2E34 A;  2VBX A;  2XGX A;  4MFE A;  5HLH A;  2L01 A;  5F0F A;  2XAG A;  5IT3 A;  3FXU A;  1B9N A;  3HRM A;  2HOA A;  4ZDL A;  3CMM A;  2A61 A;  3KP6 A;  4PSW A;  3ZQG A;  1TP4 A;  2OAZ A;  3MN2 A;  1ZGJ A;  2JTV A;  3I4M J;  1V54 H;  1E3H A;  2HDC A;  4I0B A;  4XRS A;  2E1M B;  2H6C A;  4XQF A;  2OC6 A;  4JX6 A;  4YII A;  1TNT A;  3VFZ A;  4BQN A;  1RUO A;  1BR1 A;  4B09 A;  4A5M A;  1QGP A;  1XMX A;  2VIX A;  3N05 A;  3CCV I;  3T0Y A;  3LSP A;  1MND A;  2OF7 A;  2DXI A;  2PN6 A;  2LDU A;  1YRN B;  2FMY A;  1SC7 A;  5BPD A;  2RAE A;  3CJT B;  1Z91 A;  2GM4 A;  2M4K A;  2KRH A;  3D5S C;  3GWZ A;  4Q48 A;  5F64 A;  4HF2 A;  1N78 A;  4MQ9 F;  1OCP A;  2HS5 A;  2JMW A;  1F1Z A;  4C3J J;  3E6C C;  2JSC A;  2P5K A;  3Q0V A;  4AIH A;  2AQE A;  2R93 J;  3CF2 A;  5D5W B;  3I71 A;  4Y4R A;  1P9Q C;  4XRM A;  2PQ8 A;  3GXO A;  2MSY A;  3VSK A;  5F0C A;  3VYS B;  3HDD A;  2M3A A;  1IF1 A;  3ZR8 X;  4L18 B;  4MLO A;  2IS1 A;  3CF5 F;  2BW3 B;  2CV0 A;  3CO7 C;  4L9V A;  4YFX F;  3CCE I;  2UV1 A;  1X4O A;  1LFU P;  2I8D A;  3OYA A;  4A3G J;  2JT1 A;  3BR3 A;  3LSM A;  2R7W A;  1LDJ A;  2BYV E;  4ZC3 A;  5L3D A;  1XDS A;  1TWC J;  4JBA A;  5KK1 A;  3GME A;  4XLN F;  4A3F J;  1JUM A;  2KJB A;  4IJA A;  3HOT A;  1RUN A;  3B73 A;  3CC7 I;  3Q0U A;  4CYD A;  1PUE E;  2M4G A;  5EEA A;  2O03 A;  4G6T B;  2EA2 A;  2XAU A;  1R4M B;  1I3A A;  3R6S A;  3G71 I;  3LST A;  3GTG J;  4KUM A;  2VBY A;  1AWC A;  2I10 A;  1JKP C;  1KQ8 A;  2XGC A;  3RKY A;  5K5Q A;  1HXD A;  4DOZ A;  2O3F A;  4XM3 A;  2NXN B;  4QIW N;  5JHU A;  3PO2 J;  4ANJ A;  4M3F A;  1RR7 A;  3REO A;  5EG0 A;  2OPT A;  4C3I J;  2JPC A;  1S8N A;  2R7U A;  3KP7 A;  3WE2 A;  5BQT A;  2F5E A;  3DPT A;  1FYK A;  2K02 A;  2VKV A;  2R7Q A;  3K4C A;  4CHU A;  1ON1 A;  5EDN A;  5ILV A;  3F9K A;  1HF0 A;  4CCK A;  2KIU A;  2FRH A;  2VQC A;  3M1E A;  4Q47 A;  4GO1 A;  4F52 A;  3CMY A;  2L0K A;  2K5C A;  2K9Q A;  2XF5 A;  4XNF A;  5JLW A;  2GLO A;  3OYK A;  4L0Z B;  3U1K A;  2NVQ J;  5IYC J;  1FOW A;  3S93 A;  4JP0 A;  3FHN A;  5K7Z A;  4C2U A;  1ETX A;  4GRI A;  1VF9 A;  4I99 C;  2E19 A;  2IXS A;  2N8G A;  2X1C A;  3HGY A;  1USS A;  3FMS A;  3QOP A;  2V79 A;  1S7O A;  1YX5 A;  4KT6 A;  5DS9 A;  1UHS A;  1YIO A;  2D1H A;  4JOM A;  3OYE A;  3VDX A;  2MGQ A;  3HC7 A;  3JRE A;  1W7P A;  3PQK A;  1XS9 A;  3H5A A;  4IRI A;  1U5T A;  5DCF A;  3F8N A;  1DPU A;  1Z77 A;  2DI3 A;  1YX3 A;  4YFN F;  2DA3 A;  3VYT B;  4CA0 A;  2CG4 A;  1MBG A;  2KL4 A;  1A6Q A;  1LE8 A;  3SQN A;  3NRV A;  2L7F P;  4CCJ A;  4BDY A;  1OR7 A;  5K7H A;  1UAA A;  4BHC A;  1RZ4 A;  1G3S A;  2V1U A;  3M7G A;  3IC7 A;  2KZV A;  3JSO A;  3HJE A;  3OOU A;  2LP0 A;  4ESF A;  2WA0 A;  1TL8 A;  3HB9 A;  4PJJ A;  2ME0 A;  3K6G A;  3MZ8 A;  2QWW A;  3OSF A;  4HNV A;  3F0C A;  1SMT A;  2VL8 A;  2XPV A;  3JRF A;  3G4S I;  2R7O A;  4B1R A;  4BQO A;  1XMA A;  1IN4 A;  2V1D A;  2M2E A;  4OOI A;  3WTT C;  3OS1 A;  2B63 J;  3TW6 A;  4DIQ A;  5ICE A;  4W97 A;  3K1N A;  5J3L A;  1UG2 A;  4U7B A;  4YRV A;  4ESJ A;  1OR7 C;  3H3U A;  1YS6 A;  4WCG A;  4HX7 A;  4HDV A;  2YX4 A;  3QOD A;  2EBI A;  3WTZ A;  2ZXH A;  2H1L A;  3MCZ A;  2Y0S N;  4IHY A;  3V8L A;  2DOE A;  2COM A;  2HKX A;  1L0O C;  2K9N A;  1YW9 A;  2QLZ A;  2FQ3 A;  3IH2 A;  1XCB A;  2CJJ A;  1OQY A;  2M8G X;  3DKY A;  5GPA A;  2M34 A;  1A31 A;  2K85 A;  2KQR A;  3L9F A;  4PK4 A;  1FTZ A;  3W2A A;  2ZXJ A;  2CW7 A;  5JFR A;  4RM2 A;  4RA2 A;  4HBL A;  4CXF A;  4CO8 A;  2W48 A;  4ASN A;  4B3A A;  2RVC A;  2IT0 A;  1IDZ A;  2VKD A;  3EYY A;  2CGP A;  1X19 A;  2MG4 A;  2UXX A;  3DP7 A;  4ETS A;  4RBO A;  1OCC H;  2Q8K A;  2Z5U A;  3VOE A;  2R7Z J;  5GAG J;  1J2X A;  3PQJ A;  4FE4 A;  1SD4 A;  3ZPL A;  1JHH A;  1XDU A;  2VJI A;  2XGE A;  3I56 I;  2H09 A;  2LRE A;  3DKW A;  2XAS A;  3A2K A;  4BY7 J;  1OPC A;  2C6Y A;  4Y15 A;  3QU6 A;  2ISZ A;  1G3T A;  1R23 A;  2VE8 A;  3BPX A;  2HYF A;  4L5J A;  5FFZ A;  5F08 A;  1NHA A;  2A5W A;  2ZXW H;  3MFK A;  3CUQ A;  3B6A A;  2L9R A;  2CV1 A;  2IS4 A;  4EM0 B;  4EM1 A;  4XOP A;  5EGO B;  4NQW B;  3A0H C;  1YIT I;  2E7X A;  1JTY A;  3TP0 A;  5D8K B;  2KJC A;  2ZFW A;  4C9Y A;  2H8R A;  3LSR A;  4UB8 C;  1X1C A;  4Y17 A;  5HDN A;  1YJN I;  1FSE A;  3BWG A;  3DTI A;  4DYC A;  4FIS A;  3BG6 A;  3RQI A;  1JUP A;  3BCA A;  5DD4 A;  3S3M A;  2K7L A;  4WX9 A;  5L3F A;  2DMN A;  3SFI A;  1LUJ B;  2F4I A;  2VC1 A;  2HQ5 A;  2RN7 A;  3CUQ C;  3GX4 X;  4EEF G;  2VUM J;  1I6H J;  1SD7 A;  2Q1Z B;  4G6D A;  4M71 A;  5IYD J;  1W4M A;  2KLO A;  2L2O A;  2V1N A;  2LKS A;  4V19 K;  5FFX A;  3DBR B;  2AXL A;  4MGR A;  5E8G A;  3AG2 H;  4P1W A;  5F1J A;  2VJ4 A;  3G6E I;  2MAB A;  1AKH A;  5B1B H;  4J00 A;  1TT5 B;  3OYG A;  2E60 A;  1I1G A;  1ZG1 A;  2MBF A;  3PUB A;  5JLX A;  1YI2 I;  2KKO A;  5FRM A;  1SVL A;  2XF6 A;  3KZZ A;  3Q9S A;  2CV2 A;  4KN4 X;  1ACI A;  4JQF A;  3L2W A;  4XSZ F;  1QZZ A;  2V6C A;  4Y33 A;  1V4R A;  4P9U A;  4ZTF A;  3DTK A;  1WVR A;  3MKY B;  2Y30 A;  2QYO A;  5F04 A;  2VBW A;  2BXZ A;  2IAI A;  1VFC A;  3BTI A;  4MQV A;  1CF7 B;  4UXN A;  1XC5 A;  4HZF A;  2CS3 A;  3W2W A;  5BS6 A;  1PYV A;  1UEL B;  1VND A;  3JRG A;  3JRB A;  4EJW A;  1B8I A;  3JRC A;  3BDD A;  3Q0W A;  3LAP A;  2E2H J;  1Z0X A;  2QVO A;  3HOY J;  3PFI A;  1A04 A;  3H0D A;  1IXR C;  1FYM A;  1N25 A;  1WJE A;  2DCE A;  3E6B A;  2VE9 A;  3ZQQ A;  1R9T J;  5TRD A;  2PJR A;  1Z05 A;  1H8A C;  4F93 B;  2R7R A;  5GP9 A;  1WJD A;  4GYG A;  3ZMV A;  1ZAO A;  2DTZ A;  4FQG A;  1LVK A;  1PVE A;  2MC3 A;  2DYS H;  5IP7 J;  3VOD A;  2KFD A;  2MH2 A;  3FK7 A;  2M8E A;  4O3M A;  2FUG 2;  2V4J C;  2MA3 A;  3JRD A;  1DP7 P;  1MW7 A;  2I5U A;  4KN7 X;  3K9T A;  1GV2 A;  2EZH A;  4AYB N;  2BGC A;  2W85 A;  4A0Y A;  3KYC B;  3S3N A;  2BBY A;  2PMZ N;  1ZK8 A;  1J5Y A;  3FBN B;  2E36 A;  4OAY A;  2EV5 A;  4V2G A;  4LK0 F;  1ZR2 A;  1O3Q A;  3PIP F;  3SFZ A;  1D5Y A;  1QPI A;  2B7E A;  4IHT A;  4KT5 C;  1IN5 A;  3LA2 A;  5CKT A;  2VLA A;  3M8E A;  3L1P A;  3G1L A;  1GXP A;  2ESH A;  1OCZ H;  2FEZ A;  3G1O A;  4EM2 A;  4DGW B;  5BMZ A;  3U1D A;  2QSH X;  2OV7 A;  5LLQ A;  2G7U A;  1T38 A;  1P7J A;  2FSW A;  3MWM A;  3FXK A;  3GTP J;  1QQI A;  2HOE A;  4E7H A;  3OS2 A;  1FIA A;  4PJN A;  4ZJZ A;  1XGM A;  4PJM A;  4CCN A;  2LVS A;  1ETV A;  2DBB A;  4IHX A;  2F2E A;  4N4O B;  2GOM A;  2JRM A;  4E7Z A;  4BAC A;  4KMF A;  2XV4 S;  2ZC2 A;  2ZCW A;  3HZJ A;  4BNC A;  2FX0 A;  1XSD A;  2BVL A;  3GZ5 A;  4A2U A;  2YUS A;  5C4J J;  5BOX A;  5DCM B;  4KFC A;  2KHM A;  2LBF B;  2DA2 A;  4IO9 F;  2IEK A;  3HPG A;  3KCC A;  4D5C A;  3ROU A;  3ZP5 A;  1ZG5 A;  3JRA A;  1SEU A;  5DM7 F;  1NK3 P;  2KZG A;  2IA2 A;  2JUC A;  3KYD B;  2Z33 A;  3DV8 A;  1IV8 A;  5M5X J;  3MMY B;  4N4N B;  1J9I A;  5HNF A;  1LDK B;  2NVU B;  4LG0 A;  4M3E A;  2DPU A;  1RPW A;  1TBX A;  5ICC A;  4O5V A;  3BP8 A;  1OKR A;  1BL0 A;  1MD0 A;  3CJN A;  2ZJP F;  3WTS C;  1YW7 A;  2VKE A;  1IGN A;  4XLC A;  1BI0 A;  3U9G A;  4HW0 A;  2R3S A;  4D7M A;  1GLN A;  4KIT B;  2DMP A;  4HA8 A;  4X6A J;  3M3Y J;  4ZDP A;  1D1C A;  2HVR A;  1GT0 C;  2CUF A;  2GBY A;  2QBY B;  2V9K A;  3H36 A;  4B8X A;  4LB5 A;  3K0L A;  1Z67 A;  3KP2 A;  4R79 A;  3S1Q J;  2XKO A;  1UJ8 A;  4EGY A;  1BN5 A;  2GQQ A;  1XSV A;  2VOP A;  1XN7 A;  2X6Y A;  4MNU A;  2GOX B;  4IX7 A;  1AU7 A;  4WWC A;  2DMT A;  3QPT A;  3RKW A;  1FMV A;  4OIP F;  2XSJ C;  3ERM A;  2ECC A;  1X3Z B;  4AWX B;  3OOP A;  1HST A;  1R58 A;  2IJL A;  3JR9 A;  1WHU A;  1QVU A;  2CQN A;  2UZK A;  4B44 A;  2ZNZ A;  2K40 A;  5FGM A;  4EJV A;  2KMU A;  1P4W A;  3IP4 B;  3MKZ A;  1LPQ A;  2LTP A;  1B59 A;  4B4C A;  1SD6 A;  3PNY A;  1KU7 A;  1QPM A;  2EQR A;  4EQQ A;  1LFB A;  2KPM A;  4U0Y A;  4C3H J;  1U78 A;  1BOA A;  2K86 A;  1I6X A;  2P5V A;  4IVN A;  3A1Y A;  1BR2 A;  1JTX A;  2QQB A;  3ZN1 A;  4Q5S F;  4BUP A;  5F1R A;  2STT A;  3HL2 A;  4OIQ F;  3AL0 B;  1ZKG A;  3V7S A;  1OMI A;  1TW3 A;  2LLK A;  1IN8 A;  2A6T A;  2WV0 A;  3K4K A;  2JJ7 A;  3LL7 A;  3CCM I;  1G4D A;  2W24 A;  1QZY A;  2W84 A;  3CLQ A;  1R6R A;  3FM5 A;  3L00 A;  4ZH4 F;  1Z9C A;  5K7F A;  1TW2 A;  3ECO A;  3HKZ N;  3SYT A;  1GUU A;  2WB1 A;  4YEJ A;  5HLG A;  2E1O A;  5DEQ A;  5FLM J;  4I98 B;  1SFO J;  1DGR M;  3BG9 A;  4GYI A;  4OWR B;  3GTM J;  3KX2 A;  5CYV A;  3P5J A;  3K69 A;  5LRS A;  4ZDO A;  3BJ6 A;  2HDD A;  3QPL A;  3M4O J;  1MMD A;  1ZRF A;  3BJA A;  5C44 J;  4DYQ A;  2WV1 A;  2H94 A;  2CQ7 A;  4L9J A;  2V7F A;  1T39 A;  1FYL A;  5FKN A;  2HTS A;  4HLX A;  4A6D A;  2P4W A;  3QOE A;  4XMY A;  3ZN0 A;  4M74 A;  1BC7 C;  1NG6 A;  2NS8 A;  3GFJ A;  3HUG A;  2HVQ A;  1MIJ A;  4EMS A;  3ZQI A;  2O9L A;  4CCO A;  2O0Y A;  2YU3 A;  4JX5 A;  3TED A;  3RIR A;  4J19 A;  1S6L A;  4RMN A;  4MHG A;  3J80 Z;  1WGX A;  2LNB A;  1IO2 A;  2CW0 F;  3I54 A;  2IGO A;  2L9S A;  2WAF A;  5GAE J;  3CCR I;  3PSI A;  1F36 A;  2FOW A;  5IY5 H;  2VOO A;  3OYM A;  3F8M A;  5KNL A;  3WTX C;  4HX8 A;  2EIJ H;  1GVJ A;  1KU9 A;  3H9J A;  3PNT A;  3ZQ7 A;  1I27 A;  4G6Q A;  2BOL A;  1MKM A;  4XL9 A;  2FOK A;  3V7R A;  3KFW X;  4XN3 A;  1ZTR A;  2F6C A;  2EIL H;  5J1U A;  3FF5 A;  1T33 A;  4X1E A;  1B4A A;  3Q3S A;  4YIR X;  4MTE A;  3WTW C;  1B72 B;  1D0X A;  2IRF G;  3CQZ J;  2ZME C;  4EJU A;  2XB0 X;  4Y13 A;  5FJ8 J;  1WJC A;  1T08 B;  4X0G A;  2HEO A;  3TO9 A;  3DEE A;  3I64 A;  1U8R A;  2RDP A;  2GIV A;  2LY1 A;  3RKX A;  3R4K A;  4BHB A;  4C2T A;  1W5S A;  1IN6 A;  1H88 C;  3FMQ A;  4NC6 A;  1XMK A;  3MQ0 A;  1FLI A;  2BV6 A;  2L4M A;  1ZG3 A;  4FT8 A;  1MMG A;  3HIF A;  2HR3 A;  2EFW A;  4LLN A;  4LG3 A;  4A3J J;  1V5G A;  5ICG A;  3SDG A;  1LEB A;  1ONV A;  2XAH A;  2F5D A;  3DFG A;  2JPB A;  2F5C A;  3BTC A;  2TRT A;  2OQG A;  4ZTJ A;  1SFX A;  5LRR A;  5B1A H;  1BJA A;  4EGZ A;  5D6F A;  3WG7 H;  3GLX A;  3AFH A;  3PUF A;  4ESB A;  2NOG A;  4AVZ A;  3J80 K;  3IRR A;  2XB5 A;  3JRH A;  2R5Z B;  3L09 A;  1BC8 C;  3J7A O;  1R1V A;  3CES A;  4ENM A;  1KQ0 A;  3FKI J;  1RI7 A;  1JGG A;  5M5W J;  2ME6 A;  1FZP B;  2YR2 A;  1ULY A;  2L54 A;  3DKX A;  1W7P D;  4CCL A;  4HNT A;  3TGN A;  2DLL A;  3OWT A;  2DO7 A;  2IGN A;  2BZT A;  4I0A A;  1YHQ I;  4BBR J;  5ERI A;  3U2R A;  5K5R A;  3GFM A;  2M7B A;  2WY8 Q;  3GZN B;  3RZD J;  5FD6 A;  1R5I D;  3LWF A;  3H92 A;  1UG0 A;  1HKS A;  4G7O F;  4F3Q A;  2KRF A;  1Z7L A;  2EFQ A;  2NVX J;  3S15 J;  4HQE A;  3E6D A;  3R0A A;  4JK1 X;  2YPR A;  2QZ8 A;  3I59 A;  2IGK A;  1MGT A;  2ZSH B;  2JA5 J;  4ITV A;  2BY2 A;  2CO5 A;  3V4G A;  1JUS A;  2E71 A;  1V5F A;  3PSF A;  5DDG A;  4BE1 A;  3NEU A;  1ZGA A;  4HYE A;  2FQ4 A;  2EV6 A;  2X6X A;  2IP2 A;  4XRS G;  3JCU C;  4BQA A;  5EF6 A;  1R1U A;  1M1E B;  3C1D A;  4BEH A;  4LIV A;  1H89 C;  3GEZ A;  3M9A A;  3BG3 A;  1VQN I;  3P9K A;  2ISY A;  3G3Z A;  3HOV J;  3S2H J;  2HZT A;  2HWV A;  1V5E A;  1SVO A;  4IPA A;  5HOO A;  4F92 B;  1OFC X;  3LFK A;  2A6H F;  2TCT A;  3ABL H;  3I58 A;  3K2A A;  2F5V A;  1U6G A;  2BY1 A;  4D0P A;  3CO6 C;  1IRX A;  2E1N A;  3OIO A;  4A3M J;  3I4P A;  3LSG A;  4I01 A;  4MEY F;  2IW5 A;  4LGW A;  1R5G A;  4UNO A;  1K7A A;  1BIB A;  3QYF A;  3K4L A;  1W5T A;  1Y8Q B;  4CYC B;  1U0J A;  1GDT A;  4IEJ A;  2HQA A;  4LJZ F;  2W57 A;  1S7E A;  2W1O A;  4RB0 A;  1PJR A;  3SEZ A;  1TWA J;  5D4S A;  2NNY A;  1RKW A;  1WI3 A;  3IUO A;  5ILU A;  1HW2 A;  1KQ9 A;  3QP5 A;  5CVJ A;  2R5Y B;  1E3O C;  2Z9O A;  1FWZ A;  3FXQ A;  1TT0 A;  3FWE A;  2XGD A;  5IOZ A;  2GAU A;  3ELK A;  1Z3Y A;  2DA6 A;  2DDB A;  2DK8 A;  5EJC A;  5H20 A;  1VQP I;  2DOD A;  3OYI A;  1WQ2 A;  4A6E A;  1SAN A;  4D1Q A;  1JKO C;  1VQ4 I;  3GF2 A;  2VT3 A;  1YG2 A;  4UUS B;  3ABU A;  1QA6 A;  3GTQ J;  2BHZ A;  4WK8 F;  2LRD A;  2EIK H;  2L4A A;  1NK2 P;  4AUX A;  2CUZ A;  4JX4 A;  1X3U A;  3L2U A;  2R0Q C;  3WU2 C;  1JJ6 C;  4S04 A;  1BI1 A;  3A03 A;  2E7W A;  2PMZ A;  3CCY A;  3VYU B;  4UY8 I;  1IV6 A;  2WAQ A;  3BTJ A;  3DLA A;  2G9W A;  3H3V K;  3TDZ C;  3BCB A;  3HYI A;  2WC2 A;  2KDO A;  3FK6 A;  1RRJ A;  4N9I A;  2MFZ A;  3H9G A;  2GZW A;  1XPX A;  1U5T C;  5CVI A;  2IPQ X;  3TP3 A;  1MBK A;  2RC4 A;  3C3W A;  4FHT A;  2A07 F;  3RKQ A;  3ZQC A;  2XAJ A;  3BR5 A;  4XRF A;  1EH7 A;  4XLF A;  1WCM J;  3HSF A;  3LSK A;  1MDM B;  5FLX Z;  1LKX A;  1G59 A;  2VXZ A;  3DTE A;  4ZYH A;  3CC4 I;  3D0S A;  2FD5 A;  3ZMD A;  1P4A A;  2VB6 A;  5FKK A;  4BKX A;  2CYY A;  3BT9 A;  4G12 A;  2Q2E B;  1YS7 A;  3WU0 A;  2V6E A;  2DYR H;  3GTL J;  3BG5 A;  2GXA A;  3RJP A;  5D8L B;  1MBJ A;  3KP5 A;  4UVB A;  3BJO A;  3LQR A;  5F0H A;  3CMA I;  5EEH A;  1ZLK A;  2LFB A;  1PP8 F;  4LK1 F;  3QYB A;  5IT9 Z;  3JTG A;  5LD2 C;  1C0W A;  2XAQ A;  3ZRG A;  4UV8 A;  3PIO F;  1KU3 A;  1T2K A;  1ERD A;  1TQM A;  4NUB A;  2TDX A;  4PFP A;  1JKR C;  5E3N A;  3K4B A;  1BA5 A;  3T1B A;  1P6R A;  1F4K A;  5CVU A;  4BGD A;  3E6M A;  3L2R A;  3CDI A;  3GLL A;  1Y0N A;  1DP3 A;  4CGZ A;  2CSO A;  2OU2 A;  4BDZ A;  2Y48 A;  2LY2 A;  1RKT A;  1QHG A;  1PP7 U;  4QPQ A;  1Y39 A;  1D1A A;  1J09 A;  2HDW A;  1MH3 A;  4I76 A;  1B9M A;  5DYM A;  5J8C A;  5E20 A;  2WBM A;  4G7H F;  1VQL I;  1MBF A;  4KIF A;  4A93 J;  1XSX A;  1MJB A;  4IRH A;  3VSL A;  1YRN A;  1LFP A;  4MFD A;  1OLT A;  3IV5 A;  1P92 A;  3KEO A;  4GFB A;  2YS9 A;  5LEJ A;  1J59 A;  1ITY A;  4PGH A;  2RNG A;  2HKO A;  5FLX K;  1TNS A;  2OCC H;  3WGG A;  4II3 A;  2OZU A;  2ZB9 A;  3F6O A;  2G7H A;  4U7D A;  1NH3 A;  3A4C A;  1OCT C;  2Z2S B;  4A0Z A;  4E6K G;  2E1M C;  2AS5 F;  3HRS A;  3G73 A;  1ZQ3 P;  3CDL A;  3E3V A;  2BXY A;  4B3X A;  2R7T A;  3FXM A;  4A3K J;  5KAI C;  1T95 A;  1S9H A;  1AA7 A;  5AIQ A;  5IT9 K;  1KU2 A;  2BW3 A;  1GHC A;  4ABZ A;  2YX7 A;  3F8B A;  3V42 A;  3RPQ A;  2M9H A;  4HSR A;  1R1T A;  1G3W A;  5HNH A;  3EET A;  3J7Z I;  5FB2 A;  3BR1 A;  4HEA 2;  1E17 A;  5ICF A;  3HM5 A;  1BI2 A;  2LG4 A;  3CCJ I;  1VI0 A;  2DMU A;  4QPO A;  1X3W B;  2V9V A;  4UVA A;  3DBL B;  2OD5 A;  1HKT A;  3CJQ B;  4HAM A;  5FD5 A;  1N77 A;  1FBU A;  5CPR B;  2DW4 A;  4XLH A;  3F23 A;  1K61 A;  1EA3 A;  1D8J A;  2Z1D A;  4BYY A;  3DEU A;  2FBH A;  2ZBK A;  3SHF A;  4DNC A;  2PX9 A;  3HKZ A;  1Z1D A;  2BE5 F;  2QM3 A;  3K1P A;  2ZJQ F;  1IXS B;  1XX5 A;  3RQ4 A;  3RI4 A;  5D5V B;  1IRF A;  2G0E A;  2Y75 A;  5D5U B;  1O3S A;  1BW5 A;  5AON A;  2HI3 A;  3GVA A;  2F48 A;  1S7A A;  1Y56 A;  1MSF C;  1F43 A;  2JUG A;  2W82 A;  4FCY A;  3WOD F;  3TO7 A;  1W1W E;  3TMO A;  4NBQ A;  1RNL A;  2PMH A;  2OQR A;  2XSD C;  1U3E M;  2CWE A;  3IAM 2;  1J0R A;  1ZRD A;  1I39 A;  4M9X A;  4BXU A;  5KCM A;  1ZRC A;  2HPI A;  2VQH A;  1X1B A;  2QA4 I;  1L3L A;  2VJJ A;  2XHK A;  2FF4 A;  5CQG A;  5HS9 A;  2KP6 A;  2DTR A;  2DQR A;  1ZAR A;  4NB5 A;  1FTT A;  1IUY A;  2BEO A;  4IOA F;  3A02 A;  4UVC A;  3F21 A;  2J5P A;  3WTV C;  4AIJ A;  5TJJ A;  2L7M P;  2MLK A;  1TTY A;  1D3Y A;  2H6B A;  1X1D A;  2ZME B;  1APL C;  3IRQ A;  4QTR A;  2ID6 A;  3BTL A;  3V7C A;  1IC8 A;  3E1S A;  2R4G A;  1UHW A;  1K83 J;  1PDN C;  1PUF B;  3KP3 A;  5LGT A;  3MVP A;  4LD5 A;  1K78 B;  1D1B A;  1R4N B;  3GUD A;  3K70 D;  4PSX A;  4G7Z F;  3BG7 A;  2W4S A;  3O3K A;  4Y3O A;  4B47 A;  1FBS A;  2VQG A;  1Y1V J;  2JK3 A;  3BC8 A;  3T8T A;  3QRF F;  4LIU A;  2FBK A;  4LLL A;  4AID A;  2M0C A;  3IHU A;  1A35 A;  4W1U A;  1YW8 A;  2AHQ A;  2RKH A;  2Z3Y A;  2QKM B;  4HG2 A;  2XC7 A;  1QHH D;  2ADU A;  2Y2Z A;  2EPF A;  3F72 A;  1FPQ A;  3KZI C;  4LLG F;  4NDL A;  2HQR A;  1YTY A;  3DXJ F;  3RCO A;  1EJ9 A;  1XGN A;  4N0B A;  1TZL A;  5DTD A;  3K4N A;  4RDU A;  4IXA A;  1JGS A;  1X1P A;  4Y52 J;  4OMY A;  3OIQ A;  2L3D A;  3EDP A;  1G2H A;  1JHF A;  1MNM C;  3GO5 A;  5GTH C;  3OYD A;  4GXO A;  2LSO A;  2B0L A;  5M3F J;  2GA1 A;  3BZC A;  3MD2 A;  2DQL A;  3TOA A;  5CJ9 A;  5BPI A;  2D2W A;  3PJR A;  1ETO A;  5D5X B;  3SEQ A;  1SVM A;  5DM6 F;  5KHD A;  4M3G A;  1FMW A;  3HXL A;  4EJT A;  2NYX A;  1B1B A;  1QRY A;  4YIF A;  3MEX A;  3B02 A;  3IAS 2;  4E7L A;  4RB2 C;  2H27 A;  1YO5 C;  2BY0 A;  4L9N A;  2JA2 A;  2VAS A;  4BU2 A;  1ETW A;  3NAR A;  4XSX F;  4L5E A;  2XUB A;  4CZZ A;  3W3C A;  3I55 I;  2ZO4 A;  4D9J A;  3J81 Z;  2KIS A;  1HSJ A;  2XIG A;  4PCQ A;  3AAF A;  4KIG A;  3PO3 J;  4RAF A;  2P81 A;  2LR8 A;  5K5O A;  3M07 A;  1Z6R A;  1Y0U A;  3I53 A;  4FET A;  3RSN A;  2V9P A;  1RR8 C;  2RQQ A;  2VQL A;  1KZH A;  2EFP A;  1RC9 A;  4UUT A;  1LEA A;  3FM3 A;  5E1W A;  2M45 A;  1RIO H;  1QU3 A;  3AG1 H;  1T0F A;  5E17 F;  1WRJ A;  2EH3 A;  2VOD A;  3WTU C;  2X1E A;  3HTU A;  1S5L C;  2K9L A;  3HRT A;  3E7L A;  1X2N A;  2M1B A;  5IOY A;  5HS7 A;  5EGO A;  4NQW A;  4BXF A;  4CH7 A;  2LYC A;  4O6J A;  5J4Y A;  5L3G A;  2CQQ A;  4CDG A;  4LOC A;  3GBG A;  1Q1H A;  1OCO H;  1ETK A;  2DU9 A;  4KIC A;  3WTY C;  1D0Z A;  4OAZ A;  4D7N A;  1T56 A;  2E2J J;  2GIZ A;  1WFX A;  5FKL A;  1O3T A;  3OMY A;  3HPH A;  3TOB A;  4XIC A;  1K4S A;  3QAH A;  4RAG A;  3OYF A;  2HPM A;  1WJF A;  3JW4 A;  2EIN H;  3CUO A;  3FMR A;  3KET A;  1EH6 A;  4P96 A;  3LSH A;  2CMP A;  2PBI A;  1P2F A;  1U9N A;  5IP6 A;  3SXY A;  1XGS A;  1WH7 A;  2HGC A;  2VKH A;  3AG3 H;  2DA5 A;  2MD0 A;  3ASO H;  5EG0 B;  3K70 C;  1F5T A;  3S32 A;  3T8R A;  3OYN A;  2BY3 A;  2WWY A;  1WI9 A;  2WTE A;  3J81 K;  1BIA A;  2X9D A;  4QWQ A;  3LSI A;  1R71 A;  2QSF X;  5LHH A;  4M6X A;  1P7I A;  2R7F A;  3I9V 2;  2O61 A;  4M3B A;  2VPL A;  3F8F A;  4MO7 A;  3CJR B;  2ZKZ A;  3T5X A;  4UV9 A;  4I6Z A;  1E0E A;  2IBD A;  3W6K B;  2XPU A;  3TBI A;  3I0T A;  3MKL A;  2QEN A;  3OYB A;  3DPU A;  1YQA A;  2FA5 A;  1GVD A;  2VN2 A;  3GFL A;  3VPR A;  4U0W A;  3DLL F;  1H9T A;  1CF7 A;  2K3P A;  1UZC A;  3HGG A;  2Y9Z A;  2AXT C;  4BL0 B;  4MEX F;  1YYV A;  1ORK A;  2CFO A;  3FX3 A;  2DJN A;  2IGM A;  3OYJ A;  1AOY A;  3P9I A;  1MMA A;  1VQ5 I;  3C2G A;  4S0H B;  2JWT A;  3FKJ A;  5DD8 A;  4IOC F;  2PEX A;  4HV6 A;  4CCM A;  4I2O A;  3JRI A;  1W7P B;  1BM9 A;  2ID3 A;  5B66 C;  2HYG D;  1IUF A;  1U5T B;  2QQ9 A;  2FJ1 A;  2P7V B;  1NTC A;  4UB6 C;  2X4H A;  5L3C A;  1STZ A;  2L7K A;  2LH9 A;  4I02 A;  4V2F A;  2EV0 A;  2P8T A;  3DCF A;  4QSH A;  2E1C A;  5E3O A;  2IVM A;  3TW7 A;  4A69 C;  1LE8 B;  4UHT A;  3K10 A;  1QZE A; 
#chains in the Genus database with same CATH homology
 3A01 A;  1GV5 A;  3LSJ A;  1JTY A;  3TP0 A;  4CYC B;  2H8R A;  1GDT A;  1IG7 A;  4IEJ A;  3LSR A;  1HDP A;  1S7E A;  5EYR A;  2KDZ A;  1MH4 A;  4DYC A;  1TWA J;  4FIS A;  3RQI A;  1RKW A;  1JUP A;  1WI3 A;  2R5Y B;  2DMN A;  3SFI A;  1E3O C;  1IDY A;  1ZR4 A;  2HQ5 A;  1JT6 A;  1Q1V A;  2XGD A;  4EEF G;  5IOZ A;  2VUM J;  1I6H J;  2DA6 A;  2HYJ A;  5IYD J;  1SAN A;  1JKO C;  2ELK A;  4BBS J;  4UUS B;  3GTQ J;  1U9O A;  5F1J A;  3IH4 A;  3S17 J;  2QF7 A;  2Y31 A;  3ZOB A;  1W0T A;  1AKH A;  2D5V A;  1NK2 P;  4AUX A;  1MBH A;  2YU9 J;  4JX4 A;  3ZQF A;  2R0Q C;  5JLX A;  1JJ6 C;  1EF4 A;  3A03 A;  3CCY A;  1IV6 A;  3BTJ A;  2CQX A;  2COB A;  3HEF A;  3UKG A;  3OSG A;  3H3V K;  1I50 J;  3C2B A;  1U8B A;  1BW6 A;  2AO9 A;  2Y30 A;  3FK6 A;  1A5J A;  5F04 A;  2IAI A;  3TP3 A;  3HOX J;  1VFC A;  3BTI A;  1MBK A;  4AC0 A;  1XC5 A;  4JYK A;  3RKQ A;  1VND A;  3JRG A;  3JRB A;  3ZQC A;  3BR5 A;  1B8I A;  1WCM J;  3JRC A;  3Q0W A;  1IJW C;  2ECB A;  2E2H J;  1Z0X A;  5FKO A;  3S14 J;  2DN0 A;  3HOY J;  5C3E J;  3GTO J;  1IRZ A;  2QCO A;  3PM1 A;  1R9T J;  2FD5 A;  5F27 A;  5FKK A;  4BKX A;  1H8A C;  1ETY A;  4G12 A;  3BT9 A;  5IP9 J;  5GP9 A;  3S1N J;  3WHC A;  3GTL J;  2DTZ A;  3BG5 A;  5IP7 J;  1MBJ A;  3ZQH A;  5F0H A;  3FK7 A;  2LFB A;  4BXX J;  5M3M J;  2JA6 J;  2KT0 A;  1I3Q J;  3JRD A;  2XPW A;  5C4X J;  1GV2 A;  3HOZ J;  2EZH A;  4AYB N;  5M5Y J;  1JKR C;  5EZH A;  5E3N A;  4Y7N J;  1BA5 A;  1TC3 C;  2PMZ N;  1CQT A;  1ZK8 A;  4V2G A;  1ZR2 A;  1D5Y A;  1QPI A;  1O4X A;  4A3B J;  1RKT A;  1UMQ A;  3L1P A;  3G1L A;  1DU0 A;  3G1O A;  3SJM A;  1MH3 A;  1P7J A;  4A3C J;  4I76 A;  3GTP J;  4M6V A;  1FIA A;  5J1Y A;  4DZJ A;  1MBF A;  3BR2 A;  9ANT A;  4A93 J;  2LVS A;  1ETV A;  4IHX A;  3GTJ J;  1AKH B;  4A3I J;  1YRN A;  4MFD A;  1FEX A;  3IV5 A;  1DU6 A;  4GFB A;  2CUE A;  2YS9 A;  1RES A;  3S2D J;  1ITY A;  5J1R A;  2EZK A;  2FX0 A;  2HOT A;  3S1M J;  2YUS A;  3QQA A;  2K9S A;  5C4J J;  2ZB9 A;  1OCT C;  1RET A;  2DA2 A;  1OJL A;  2IEK A;  4D5C A;  1ZQ3 P;  3CDL A;  4IHW A;  1WPK A;  3JRA A;  4A3K J;  1JKQ C;  1NK3 P;  4BY1 J;  2JA7 J;  5E3M A;  1PUF A;  3LOC A;  5M5X J;  4FE7 A;  1POG A;  4ABZ A;  1B8I B;  4M3E A;  2M9H A;  4XK4 A;  2NVT J;  1RPW A;  5FLV A;  2X48 A;  2R92 J;  1BL0 A;  3BQZ A;  3BR1 A;  5EZG A;  2VKE A;  2WB1 N;  3HM5 A;  1IGN A;  1ZGW A;  1VI0 A;  2DMU A;  4DW6 A;  4D7M A;  1FJL A;  2DMP A;  3B6C A;  4X6A J;  4A3L J;  3M3Y J;  4DYR A;  5IPA A;  3S16 J;  3WHB A;  2L7Z A;  1GT0 C;  1K61 A;  2JN6 A;  2CUF A;  2GBY A;  2Y9Y A;  2DMQ A;  4A3E J;  4MFE A;  3S1Q J;  5F0F A;  1QVT A;  2HOA A;  2G0E A;  1AU7 A;  2DMT A;  1BW5 A;  2HI3 A;  3ZQG A;  2ECC A;  4FTH A;  1MSF C;  3MN2 A;  1F43 A;  2HXO A;  3JR9 A;  3I4M J;  1QVU A;  4FCY A;  4XRS A;  2K40 A;  2EZL A;  3D1N I;  4JX6 A;  2XSD C;  2LTP A;  2DA4 A;  3LSP A;  4B4C A;  2OF7 A;  1B72 A;  1YRN B;  2EQR A;  1LFB A;  1AHD P;  2RAE A;  4C3H J;  2GM4 A;  1U78 A;  1HCR A;  1FTT A;  1XG1 A;  3A02 A;  1TWH J;  1OCP A;  1BJZ A;  1TWG J;  3S1R J;  2JMW A;  4C3J J;  1JTX A;  3Q0V A;  1ZKG A;  2DA7 A;  2L7M P;  2EZI A;  2MW8 A;  2R93 J;  3GTK J;  2LLK A;  1APL C;  2JJ7 A;  4XRM A;  4QTR A;  2MSY A;  2ID6 A;  3BTL A;  5F0C A;  1IC8 A;  3HDD A;  1K83 J;  4MLO A;  1PUF B;  5K7F A;  2O8K A;  3HKZ N;  3MVP A;  1GUU A;  2E1O A;  2X6O A;  5FLM J;  1LFU P;  1SFO J;  3GTM J;  3BG9 A;  4A3D J;  3IH3 A;  4A3G J;  3BR3 A;  2HDD A;  5E3L A;  3QPL A;  3M4O J;  1Y1V J;  2JK3 A;  1TWC J;  2R5Z A;  3BR6 A;  2M0C A;  5C44 J;  4A3F J;  1JUM A;  2WV1 A;  2VI6 A;  4MIM A;  4DYQ A;  4W1U A;  2AHQ A;  3Q0U A;  3BR0 A;  5EEA A;  5FKN A;  3FIS A;  2Y2Z A;  2DA1 A;  4NDL A;  2NS8 A;  3GTG J;  2I10 A;  1JKP C;  2XGC A;  5DTD A;  4RDU A;  3ZQI A;  2H1K A;  2O9L A;  4JX5 A;  3TED A;  4Y52 J;  4J19 A;  4QIW N;  3PO2 J;  4M3F A;  1G2H A;  1RR7 A;  5EG0 A;  1WGX A;  4DZP A;  1MNM C;  2OPT A;  4C3I J;  2LD5 A;  2CRG A;  2HOS A;  2NS7 A;  1F36 A;  3ZQL A;  5M3F J;  2VKV A;  3BQY A;  5EDN A;  1W0U A;  5IYB J;  1HF0 A;  1Y1W J;  3CMY A;  1X2M A;  2L0K A;  2K9Q A;  4D5F A;  1ETO A;  1ETQ A;  5JLW A;  4M3G A;  1HDD C;  2GLO A;  2NVQ J;  1QRY A;  1ZTR A;  5IYC J;  5J1U A;  4X1E A;  1T33 A;  4JP0 A;  3Q3S A;  1B72 B;  5K7Z A;  3CQZ J;  1ETX A;  3G1M A;  1VF9 A;  1ETW A;  3NAR A;  2XB0 X;  4L5E A;  2E19 A;  5FJ8 J;  2N8G A;  3HGY A;  2LY9 A;  5DS9 A;  1UHS A;  3PO3 J;  1H88 C;  2MGQ A;  2P81 A;  2LR8 A;  3JRE A;  1JJ8 C;  1ENH A;  1XS9 A;  4UUT A;  2JA8 J;  1Z77 A;  3W6V A;  1HOM A;  4A3J J;  2EH3 A;  2DA3 A;  3K7A J;  3E7L A;  1MBG A;  1X2N A;  3SDG A;  1LE8 A;  5IOY A;  2L7F P;  3H0G J;  5EGO A;  1TWF J;  2TRT A;  3BTC A;  3DEW A;  5K7H A;  2CQQ A;  4CYC A;  4LOC A;  3GBG A;  3JRH A;  2NOG A;  3OOU A;  2LP0 A;  2XB5 A;  1ETK A;  2R5Z B;  3HB9 A;  3RZO J;  2ME0 A;  1WH5 A;  4D7N A;  2R5Y A;  1T56 A;  3HOU J;  2CU7 A;  3LNQ A;  2E2J J;  3FKI J;  3OSF A;  4HNV A;  3F0C A;  5FKL A;  2XPV A;  1JGG A;  3JRF A;  5M5W J;  2ME6 A;  4XIC A;  1MBE A;  4B1R A;  2M2E A;  4M3D A;  2B63 J;  3O8H A;  3TW6 A;  4W97 A;  5J3L A;  5HOD A;  1UG2 A;  1HLV A;  4BBR J;  4UUS A;  2VPR A;  1JT0 A;  3QPS A;  1U9N A;  5IP6 A;  2EBI A;  1WH7 A;  3RZD J;  5EG0 B;  2DA5 A;  2Y0S N;  4IHY A;  2NVX J;  3S15 J;  3FIW A;  3I4N J;  2LK2 A;  2K9N A;  2X9D A;  3O8G A;  3IH2 A;  3HBL A;  1P7I A;  1X58 A;  2CJJ A;  2M8G X;  2XRL A;  5GPA A;  2M34 A;  4M3B A;  4MO7 A;  3A01 B;  2JA5 J;  1FTZ A;  4I6Z A;  1JUS A;  2IBD A;  1MSE C;  2W48 A;  2XPU A;  3MKL A;  4B3A A;  1IDZ A;  5GPC A;  2E2I J;  1GVD A;  3VPR A;  5BNG A;  2MG4 A;  2WAQ N;  2FQ4 A;  4RBO A;  3HGG A;  2Y9Z A;  5FKM A;  4C2M J;  2LKX A;  4XRS G;  2R7Z J;  1ORK A;  5EF6 A;  4FE4 A;  2DJN A;  4XID A;  3HOW J;  2XGE A;  4IHV A;  1H89 C;  4S0H B;  2JWT A;  1FIP A;  2O7O A;  3BG3 A;  4BY7 J;  3JRI A;  3HOV J;  3NAU A;  2ID3 A;  3S2H J;  1IUF A;  5F08 A;  2FJ1 A;  1NTC A;  1OFC X;  1A6I A;  2NVY J;  2TCT A;  4V2F A;  2HXI A;  3K2A A;  3B6A A;  2L9R A;  3DCF A;  4QSH A;  5E3O A;  3OIO A;  4A3M J;  3TW7 A;  4A69 C;  3LSG A;  1LE8 B;  5EGO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...