2M2EA

Solution nmr structure of the sant domain of human dnajc2, northeast structural genomics consortium target hr8254a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
71
structure length
71
Chain Sequence
FTPWTTEEQKLLEQALKTYPVNTPERWKKIAEAVPGRTKKDCMKRYKELVEMVKAKKAAQEQVLNASRAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription regulator
molecule keywords DnaJ homolog subfamily C member 2
publication title NMR solution structure of the SANT domain of human DnaJC2.
rcsb
source organism Homo sapiens
total genus 21
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2m2eA00
2K40A 2H1KA 1APLC 2W48A 2Y0SN 2KT0A 3G1OA 3BQYA 4DW6A 3RZOJ 1JKQC 2ELKA 1JKOC 4AYBN 1IG7A 3JRGA 2ID3A 1GT0C 3GTPJ 3CQZJ 2L9RA 2R0QC 4EEFG 4A3MJ 3HDDA 4IEJA 4L5EA 3GTOJ 1ETYA 1HCRA 4AUXA 2K9SA 3JRHA 1WGXA 5EZHA 4JX5A 4A3CJ 1A5JA 3FISA 4XRSA 3LOCA 2K9NA 3B6AA 3G1LA 3BTCA 5E3MA 4HNVA 2FQ4A 3TP0A 1VI0A 1NTCA 2O8KA 3HGYA 1IUFA 2NS7A 2JA6J 3ZQIA 1IDYA 2R7ZJ 5FKKA 2M0CA 2OPTA 3QPLA 1E3OC 2DN0A 5J1RA 4D5FA 4MO7A 2ECBA 2G0EA 5EG0A 1ZR4A 3JRCA 3I4NJ 2XGDA 5M3MJ 1RR7A 4A3JJ 3HOVJ 3OSFA 4JYKA 5JLXA 1ITYA 1HDPA 3FKIJ 1F36A 3B6CA 2XB5A 1WPKA 3ZQLA 1RKTA 1T33A 1MSFC 1JUMA 3HOZJ 2CRGA 2DA2A 3JREA 2X9DA 1MH4A 4W1UA 2LTPA 1AHDP 3W6VA 3FK7A 2CU7A 2GM4A 3CDLA 2EZLA 4FE4A 4M3DA 1RPWA 2OF7A 1HF0A 1VNDA 2JA8J 1QRYA 4JX6A 5E3NA 1UHSA 4V2GA 2X48A 3HB9A 2DMTA 2D5VA 2JJ7A 3PM1A 4UUSB 1JT0A 5C3EJ 5DTDA 4IHVA 2R5YB 2DA4A 3LSJA 2FX0A 4J19A 4FTHA 2MGQA 3RQIA 1MBGA 4A3FJ 4D5CA 3ZQHA 3JRDA 2KDZA 3BQZA 1B72A 2R92J 3GTLJ 3OOUA 2LLKA 2R93J 2RAEA 2TCTA 5IYBJ 3LNQA 2EZKA 2HDDA 3BR5A 3LSPA 5EYRA 5F0HA 5GPCA 1JGGA 2N8GA 1JJ8C 3HBLA 1JUPA 5BNGA 4IHXA 1D5YA 2E2IJ 2COBA 3FK6A 4B3AA 2CUEA 3BR0A 2B63J 1QPIA 1X2NA 3C2BA 3JRIA 3BG9A 2LFBA 5DS9A 3RKQA 1LFUP 1EF4A 2LY9A 1I6HJ 3E7LA 4M3EA 4V2FA 2O9LA 2NVQJ 2ME0A 3QPSA 1MSEC 1CQTA 2MSYA 5HODA 3IV5A 4CYCA 3GBGA 2R5YA 1Q1VA 5IP6A 5EG0B 2QF7A 5C4JJ 2LP0A 3JRFA 3PO2J 4AC0A 4M6VA 2NVYJ 1OFCX 2E2HJ 2DA3A 3K2AA 5C44J 1U8BA 3S16J 1SANA 5EGOA 3TEDA 5FKMA 3O8GA 1U9NA 3A01A 3M3YJ 2JWTA 1TWCJ 1VF9A 2ECCA 2X6OA 2LVSA 1ZKGA 4D7MA 3S2DJ 4IHWA 2E1OA 5GP9A 2NVTJ 3JRBA 2ZB9A 3S2HJ 2Y31A 1JTXA 2M2EA 1NK2P 4A3KJ 3RZDJ 1JKPC 4MFEA 1FEXA 1OJLA 2DA7A 3DCFA 5K7FA 1W0UA 1IC8A 2HYJA 1Y1WJ 1FIPA 1RKWA 3HKZN 5K7ZA 1HOMA 2XPVA 2WAQN 5C4XJ 3G1MA 2LR8A 1H88C 2DMUA 2YS9A 3M4OJ 3LSRA 1B72B 2R5ZB 1GV2A 4RDUA 1W0TA 3HOWJ 4DZJA 3O8HA 1I3QJ 2WB1N 3NAUA 4X1EA 1T56A 2GBYA 2L7ZA 1G2HA 5FJ8J 1ORKA 5FLMJ 4XRSG 3BR6A 3HOXJ 1FTTA 4M3BA 2XPUA 1XC5A 3VPRA 4A3LJ 2GLOA 2DMQA 5K7HA 1F43A 1POGA 2ID6A 1SFOJ 3HOUJ 2IAIA 1IGNA 4QTRA 4IHYA 3IH2A 1GUUA 2HOTA 4GFBA 2DMNA 3H0GJ 5F0CA 2VI6A 4BBSJ 4FE7A 1JKRC 1ZK8A 2DMPA 4C2MJ 1MBHA 1GDTA 4B4CA 2Y30A 4CYCB 3NARA 1MBFA 4A3EJ 4UUTA 1VFCA 1IV6A 1FJLA 3BTJA 4MLOA 1ETXA 2IBDA 3LSGA 1R9TJ 3S1QJ 4A3DJ 4BXXJ 5FLVA 2R5ZA 2Y9ZA 4QIWN 1JUSA 5M5XJ 5IYCJ 1ETQA 3D1NI 1NK3P 3ZOBA 1A6IA 9ANTA 4XICA 3CMYA 5EGOB 2LD5A 1WH7A 3IH4A 3A01B 1ZGWA 2VUMJ 5F1JA 1MBJA 4C3JJ 2FD5A 3S14J 2M9HA 3SJMA 3JRAA 2AHQA 1QVUA 2PMZN 1HDDC 1QVTA 5EDNA 2I10A 4DYQA 2VKVA 3FIWA 2CJJA 1XG1A 5FKLA 2NVXJ 4S0HB 3BR2A 4M3FA 3ZQFA 2O7OA 3PO3J 1ENHA 3BTLA 1BL0A 2MW8A 5EZGA 5FKOA 2VPRA 4BKXA 3HM5A 2Y2ZA 5J3LA 5E3OA 4QSHA 1YRNB 2HXIA 3S15J 2DA6A 1O4XA 3A02A 1UMQA 2DA1A 4XK4A 2E2JJ 1WI3A 3GTQJ 3SDGA 5M5WJ 3OIOA 3Q3SA 4B1RA 5IPAA 2L7MP 1HLVA 4BBRJ 4JP0A 1H89C 3GTMJ 3S1MJ 2DTZA 1B8IB 4BY1J 5FKNA 5J1UA 1MNMC 2JA7J 1JJ6C 1IJWC 3TP3A 4A3IJ 3A03A 4MFDA 2HXOA 5EEAA 4M3GA 2HQ5A 2HOAA 4I6ZA 4A93J 1Y1VJ 2XSDC 3BR1A 3Q0UA 5J1YA 2NOGA 1U78A 2JMWA 4ABZA 5IOZA 4RBOA 1ETVA 2JK3A 4JX4A 2P81A 5M5YJ 3HOYJ 2XGCA 1AKHA 2XRLA 2K9QA 1YRNA 3HEFA 4XIDA 2YU9J 1WH5A 1PUFB 1U9OA 5M3FJ 5F08A 4BY7J 1LE8A 5F0FA 4DYCA 1BA5A 2LK2A 3Q0WA 1ETOA 2M8GX 3GTKJ 2EZIA 2XGEA 4FISA 5IP7J 4Y52J 4C3IJ 3WHBA 1ZR2A 3GTJJ 1B8IA 1MBKA 3S17J 1TWFJ 2LKXA 1MBEA 3IH3A 3ZQCA 2E19A 2DJNA 2NS8A 1ZTRA 1MH3A 3MN2A 1ETKA 3HGGA 1UG2A 1BJZA 1P7IA 5F04A 2L7FP 4NDLA 1IDZA 4A69C 4D7NA 1Z0XA 5F27A 1BW5A 3L1PA 2EH3A 2EZHA 1AU7A 4DYRA 4X6AJ 3I4MJ 2MG4A 1DU0A 2QCOA 2VKEA 1DU6A 4MIMA 4FCYA 1OCPA 1X2MA 5IP9J 2L0KA 1H8AC 1PUFA 5EF6A 4C3HJ 2EQRA 1OCTC 3DEWA 2JN6A 3ZQGA 5GPAA 4LOCA 1LFBA 2XB0X 1TC3C 1GVDA 3SFIA 5E3LA 3TW7A 1X58A 2JA5J 5IYDJ 2FJ1A 2Y9YA 2HOSA 3MVPA 1ZQ3P 2XPWA 1JT6A 1IRZA 3JR9A 1TWAJ 3MKLA 1I50J 3BR3A 4DZPA 3TW6A 1TWGJ 2YUSA 2IEKA 3WHCA 4Y7NJ 1JTYA 3CCYA 2WV1A 4I76A 3F0CA 3Q0VA 2EBIA 1GV5A 1K83J 2AO9A 1P7JA 2CQXA 2H8RA 3BT9A 2DA5A 3S1RJ 3H3VK 2CUFA 1RETA 1FTZA 4G12A 4XRMA 2ME6A 5IOYA 3S1NJ 3QQAA 2TRTA 3K7AJ 3UKGA 3OSGA 1S7EA 1ETWA 1BW6A 2CQQA 1AKHB 1RESA 3GTGJ 2M34A 1Z77A 4A3BJ 2HI3A 4A3GJ 1FIAA 1TWHJ 3BG3A 1XS9A 1WCMJ 3BG5A 5JLWA 1LE8B 4W97A 3BTIA 1K61A 4UUSA
chains in the Genus database with same CATH superfamily
5LLQA 3TO9A 1APLC 2R7FA 2DT5A 2A5YB 5J47A 1ZLKA 1S7OA 2Y0SN 3CCVI 1SVMA 1G3SA 2HDWA 1V4RA 2PFBA 3E1SA 2EA4A 1JKOC 3I71A 2NS0A 1NG6A 2JSCA 3JRGA 1SFEA 2ID3A 1QO0D 5HNHA 3SYTA 2VC0A 4LB5A 1MNDA 4EEFG 1D0ZA 3HDDA 4L5EA 3WTSC 3T1BA 3CP2A 3L09A 3OR1C 4AUXA 2K9SA 4BXFA 5EZHA 3GW2A 1WHUA 2Y48A 3KCCA 4JX5A 2XROA 2DDAA 3MWMA 3DP7A 3W2VA 2PJRB 2KJCA 3E5UA 3EETA 4XRSA 2LKPA 3F9KA 3FKJA 3BTCA 2X1CA 3QYBA 3HGYA 1T98A 2RN7A 3KP7A 2DBBA 3ZQIA 1IDYA 2L01A 2BXZA 2M0CA 1Z7LA 1FWZA 2IS4A 5J1RA 1DQUA 2CUJA 4MO7A 2STTA 3JRCA 1O3SA 1TQIA 1RR7A 1W1WE 4RGRA 2BVLA 3OSFA 4JYKA 3OR2C 4EJOA 1YOVB 2Q8KA 5JLXA 1XDSA 2HFHA 3HPHA 3FKIJ 4XLEA 3COAC 2XB5A 3VEPA 1MJAA 1T33A 4FASD 3EQLF 1Z3XA 4BAYA 3HOZJ 3RSNA 4W1UA 1MH4A 5L3EA 2LTPA 3FK7A 2GM4A 3ECOA 5E1XA 2P0WA 5FRMA 4A5NA 2OF7A 2NXNB 1SVOA 4P96A 3GZ6A 3S8PA 1DP3A 4HQMA 3JAMK 4RLFA 2A6EF 1ZARA 3RJPA 4PJMA 4WXHA 3EYYA 4BYYA 1IXCA 3FWEA 4CCKA 3NRVA 3E6DA 3TDZC 3HL2A 1U3EM 2F5FA 5KAFC 3DPUA 4IHVA 1V5EA 1F1ZA 3V7SA 2VJIA 2R5YB 3LSJA 2DTRA 4QPQA 4J19A 1MBGA 2BYVE 1JHFA 3GO5A 3I0TA 4UV9A 1OCCH 2QQBA 1HKQA 1X1PA 4HZFA 3KP6A 4B44A 2XAFA 2JPBA 2EILH 2RAEA 2HEOA 3FZVA 4XLAA 2R7UA 4KN4X 1XGOA 4KITB 5EYRA 3PSIA 2MBFA 2WY8Q 3CMAI 1JJ8C 2DFHA 4IHXA 2IRFG 2RV8A 1YLFA 3FK6A 2P6TA 4KA4A 2Z5UA 2D1HA 2E1NA 2B63J 5BMZA 2QKMB 2PMHA 3JCUC 3BG9A 2ELJA 1J75A 3RKQA 2XUBA 1XDUA 2W4SA 1I6HJ 1G3YA 4V2FA 4IRGA 2ZXJA 2O9LA 2ME0A 4M71A 1YJNI 1CQTA 5DCMB 3PJRA 2V26A 4ZZDA 5EG0B 4WXDA 4RGSA 1XGSA 4DQ2A 3VOEA 4I98B 2D45A 4PSXA 2Y75A 2RQPA 3PO2J 3ISPA 3IUOA 5KNLA 2NVYJ 1MDMA 2E2HJ 2QZ8A 5ICEA 1LDDA 1U8BA 3ZMUA 1SC7A 2CW0F 3D5SC 5GAGJ 3TEDA 2OC6A 2GWRA 2W84A 1L3LA 3CUQC 4DGWB 2DPUA 3ZN1A 5D6FA 3RKYA 1ZKGA 4R1HA 3S2DJ 4YFXF 4IHWA 2E1OA 5GP9A 3QYEA 4BH9A 2LH9A 1G3WA 1IRFA 2Y31A 3H3UA 5HS7A 3GVAA 4XL9A 4A6DA 2I8DA 3OIPA 4OINF 2STWA 1IC8A 1B9NA 4PDKA 3CC7I 1ZH5A 5K7ZA 1HOMA 2WAQN 2KRHA 4XSZF 1ZGJA 3ONQA 3CC2I 3M4OJ 3E0JB 3GXOA 1D1AA 2R5ZB 3AG1H 4RDUA 5D5WB 1XCBA 1OMIA 2H6CA 3O8HA 5D4SA 4D0PA 4HF2A 1BIAA 1IAWA 3S3MA 1LEAA 1UFMA 3ASOH 1XTAA 1SAXA 1J9IA 4AYBA 2XPUA 4HBLA 4A3LJ 3DLAA 3KYLA 2GLOA 2DMQA 1POGA 1SFOJ 3HOUJ 1PP8F 4L9NA 1R58A 2XV4S 4QTRA 2W82A 3IH2A 2HOTA 4NB5A 2EWNA 3IWFA 3RKWA 3GX4X 4GFBA 2EFPA 2Z2SB 4UUVA 2VXZA 2CUZA 2KIMA 4E7LA 1ZK8A 2JRTA 1Y8QB 4HLXA 1MBHA 3SHFA 1Q1HA 2VT2A 3T0YA 3WGIA 5AIPA 3P5JA 2EV0A 1IV6A 4YEJA 4AIKA 4BXXJ 1QHGA 2A07F 2DYSH 2FOKA 5FLVA 4DBQA 4UY8I 1JUSA 2AS5F 1YIOA 2M4KA 5JFRA 5GADJ 4F52A 3MZ8A 4X0GA 3MKYB 4UNOA 3RPUA 2F5DA 1V54H 3LAPA 1F4KA 4Z2YA 5GAHJ 1K7AA 2F5VA 4UV8A 5D5XB 2VBZA 5HDKA 3QOPA 4LLLA 1W5SA 1OLTA 2CQNA 3Q5FA 4PCQA 3JSPA 4NBQA 2DCEA 4C3JJ 1Z9CA 4OOIA 1KU3A 1RC9A 1VQMI 2CGPA 2HTSA 3BG7A 2AHQA 4GGGA 1UB9A 4XONA 4AWXB 1HDDC 1QVTA 2PI0A 1BR4A 2XF7A 4M6XA 5DYMA 3FIWA 4Q4ZF 1S9HA 2NVXJ 3WTXC 5D4RA 3PO3J 5EZGA 3F22A 1RRJA 2VPRA 4BKXA 3LL7A 3I3LA 5FGMA 3G3ZA 3FXUA 4EQQA 2HXIA 3EUHA 5E20A 3RPQA 3OIQA 3BPXA 4ZYEA 5BPDA 1ACIA 1U5TB 4ASNA 3U1DA 4J00A 4HF1A 2E2JJ 1W7PD 1UZCA 3WTUC 3TBIA 3OIOA 1P4AA 2L7MP 2YR2A 3CCLI 4UB8C 1HLVA 2UWMA 3O6BB 2L54A 4JP0A 3KZIC 3Q9SA 5EEGA 5HDNA 3S1MJ 1J0RA 1PJRA 4BY1J 3L00A 3PNVA 1R5ID 3KZZA 2FMLA 3CJQB 5J1UA 1MNMC 3L2QA 4O3MA 1X1BA 4A3IJ 3OYMA 1LB2A 2PBIA 4WK8F 4HDUA 2Y69H 2R4GA 4M3GA 2HQ5A 4A93J 4ESJA 2Q1ZB 2XSDC 2HQRA 2VQGA 5BS6A 2NOGA 4HYEA 2JMWA 4ABZA 2NRAC 1MGTA 3F8FA 4XSXF 3I59A 3OWTA 2P81A 1HW1A 2XGCA 1AKHA 5FRNA 1Y6IA 1YRNA 5E17F 2HKXA 2X0LA 4XIDA 2YU9J 1U9OA 3KEYA 5M3FJ 3BJOA 4YRVA 3J7AY 3L7WA 1O7FA 1K79A 4DYCA 4IKFA 2VOPA 2R7XA 2EZIA 2FE3A 4FISA 4NC8A 1SFXA 2GIZA 3ZMZA 5IP7J 3TO6A 1K6OA 2E5NA 1MBEA 3IH3A 1BBYA 2HGCA 2DJNA 1KQ8A 2M5WA 1T95A 1ETKA 3DBRB 2FRHA 4AIHA 2ZFUA 1TZLA 1SMYF 2CFXA 4BEHB 4BQOA 1BJZA 2YPRA 5F04A 3WG9A 2L7FP 1AOYA 2VQCA 2QVOA 3HIFA 1IXSB 2QEXI 1T39A 1Z0XA 5DEQA 4CA0A 4E7JA 4M72A 2EZHA 1AU7A 1LVKA 1UCRA 3I4MJ 4XM3A 1Y8RB 2QCOA 4MIMA 3HHHA 2ELHA 1OCPA 3W2AA 1FOWA 1W7PB 2H6BA 1H8AC 3I54A 1RR8C 3JTGA 4XKVA 1FPQA 5KAIC 1OCTC 2EK5A 5D5VB 3LFUA 5GPAA 4LOCA 4AVPA 5IY5H 2YX7A 1TC3C 3HSEA 3HKZA 1HKSA 4O6JA 2IW5A 1DUXC 4XOTA 3CLOA 2CQ7A 4ITVA 3G73A 2K27A 1ZQ3P 2DQRA 3U9GA 1I50J 3AG4H 2HU9A 4L18B 3TW6A 2YUSA 4Y7NJ 1CF7B 1JTYA 1IN8A 2WV1A 4I76A 1BI2A 2A3SA 3PNTA 4KICA 1WJ5A 3ZN0A 1GV5A 4RM2A 1ERDA 2AO9A 3VSKA 4U0VA 1P7JA 3K70D 2CUFA 1FTZA 1BN5A 2ZJQF 3RI4A 3FHNA 1O3QA 3KE2A 2D1VA 2TRTA 3GZNB 5TJJA 3UKGA 1S7EA 2ZXHA 1ETWA 1X1CA 3DBHB 4FQGA 3TMOA 2CQQA 3ZXSA 1RESA 2M30A 2M34A 1GHCA 1G3TA 4HDVA 1N25A 3OYHA 3OYNA 2DT7B 1FIAA 3PSFA 2VC1A 1XPXA 2HKOA 3ERMA 1JHHA 5J4YA 2OV7A 1WCMJ 3FM5A 4H4KC 3GFJA 3QU6A 3A1YA 3K2ZA 2IS6A 3CUOA 1ZN2A 2DOAA 2EFWA 4ENJA 1K61A 1IN7A 4IXAA 3LWFA 3M8FA 2H1KA 2BW3A 3HRTA 2W48A 3G1OA 4IX7A 3BQYA 1KU9A 1LVAA 1QBJA 2XAJA 1QZYA 4AYBN 3HRUA 3ELKA 2EFNA 5LRSA 4IHSA 2L9NA 2IA0A 4CYDA 2R0QC 1A04A 1BIBA 2DT6A 2MC3A 3K4NA 5HDGA 1IW7F 4IEJA 2HQAA 2PJPA 2RREA 2P7CB 3JRHA 4IL6C 1BC7C 2VE8A 4KFCA 3FISA 4S04A 3LOCA 2IGKA 3C7JA 2WV0A 1EH7A 3V4GA 1OR7A 5L3CA 1ZYRF 3ECHA 4HNVA 4CZCA 1NTCA 2XC7A 3K70C 2CSOA 3QRFF 3PQJA 1MJBA 1YS7A 2FNPA 3QODA 2EFOA 2EV5A 2A68F 2OPTA 3QPLA 3CJTB 4RLQA 3BP8A 3SEQA 4D5FA 4E70A 4ESBA 2MLKA 2EJRA 2DJIA 2KIFA 1ZR4A 2XGDA 1W5CC 4XLHA 3VDXA 2NNYA 4A3JJ 1P92A 1Z1DA 1YE9A 1HKTA 2IJLA 4IQJA 2VASA 3I9V2 2JUGA 1ITYA 3BZKA 5BPIA 3BWGA 2YU3A 3LA7A 4QLCU 3ZQLA 2F4MB 2A69F 4XLFA 1YFHA 1OYWA 3E3VA 3F23A 3JREA 2X9DA 1D8KA 2W00A 2CU7A 2XAGA 2VBYA 4WX9A 4FE4A 1V55H 3WTZA 3E5QA 1WJEA 2GAUA 4F7ZA 4F91B 1WQ2A 2Z3YA 1VNDA 4G7OF 1QRYA 1FBQA 1UHSA 3QU3A 1B59A 3HB9A 3ASNH 3M9AA 2E71A 1B6AA 1N75A 1ZRFA 1JT0A 4UUSB 1RZ4A 1FNNA 5DTDA 1J5YA 2VJJA 1TBXA 1FOYA 2KPMA 3IL2A 1TP4A 1BI1A 3SQNA 5GTIC 2FX0A 1EH8A 4FTHA 2MGQA 3RQIA 3KP4A 4A3FJ 2IPQX 2FF4A 3AFHA 3DQVC 4D5CA 3ZQHA 3DFGA 4GDFA 5F1RA 3H92A 1FOKA 3BQZA 2R92J 4CZZA 3OS0A 3TQNA 3V8JA 3H5NA 2LYCA 5L3FA 4MHGA 5HOOA 1T08B 1MDMB 1KQ9A 1XGNA 2HOEA 2HDCA 3HXLA 2O3FA 1TT0A 1Y0UA 4XN0A 4ZJZA 2TCTA 4LFUA 1ZG3A 2RDPA 4HPQA 2QUFA 3LNQA 2EZKA 3OL3A 2HDDA 2CW7A 5F0HA 5GPCA 2N8GA 1P4WA 1D5YA 1JI8A 3K6GA 1BI0A 4A12A 2WC2A 5HS9A 4MGRA 4EM2A 1QQIA 2KFDA 3KEQA 1QPIA 3C2BA 1DP7P 1R1UA 3HPGA 3JRIA 1PP7U 5DS9A 1MMAA 3GFLA 1D5VA 3HTSB 2GA1A 3K4JA 2GOMA 5DDGA 4BHCA 4NQWA 2MSYA 3R61A 4Q48A 5HLIA 1VQ8I 2ZC2A 5IP6A 3P9CA 1Z7UA 2QF7A 3R6SA 2FOWA 4C30A 4Y13A 1NH3A 5C4JJ 2BHYA 3JRFA 2EINH 4HV6A 5ICGA 4M6VA 1T8IA 4CCNA 2JTVA 2VE9A 3K2AA 1U6GA 3VYSB 1A36A 5ICFA 3BG6A 3CO6C 2RKHA 2F5EA 1DDNA 4B48A 5EGOA 2J5PA 2BHZA 5FKMA 2MD5A 2B0LA 3HZJA 4OMZA 3WU1B 2X6OA 4MTDA 2LVSA 4D7MA 2W7NA 3JRBA 1KYZA 1ON1A 2M2EA 1NK2P 2RQQA 1R22A 4A3KJ 2DFEA 1OYIA 1OYYA 4E4HA 1UJ8A 1JKPC 5ILVA 1G6NA 4MFEA 4OWRB 1OJLA 2DA7A 3N05A 1FEXA 3HRMA 1Z6RA 2DK5A 2HYJA 2OZUA 1Y1WJ 3B02A 1RKWA 2VL8A 3HKZN 1OCRH 2XPVA 5HLGA 2MFZA 5C4XJ 3LA3A 1E3HA 1BOAA 2DMUA 2YS9A 4BS9A 1B72B 2X4HA 2XRNA 2CH0A 2X6XA 4UXNA 4DZJA 4DBRA 1O3TA 2L5QA 1G2HA 4C9YA 1Y56A 4BGDA 1ORKA 2ZKZA 1FBUA 1ZELA 4RAFA 2DFFA 2LOOA 3HOXJ 1SMTA 1FTTA 5DD4A 3VPRA 3WTTC 1X3ZB 4BDZA 5H2FC 2R7RA 1S6LA 2DAOA 3WODF 5K7HA 3L2RA 2QQAA 5LGUA 3N4MA 1E0EA 1NHAA 1IGNA 5LHIA 1IO2A 4I7HA 3PFIA 4LD5A 1YIJI 4G9YA 5ILSA 2VI6A 4GYGA 2WA0A 1KONA 4LG3A 5DCFA 1J2XA 3H9GA 1YITI 3D5RC 2H8WA 4CYCB 3NARA 3F6OA 4EJUA 4A3EJ 5E8IA 1IN5A 1HW5A 1OQYA 1H9TA 2HNHA 4KISA 1ETXA 3AG2H 3S1QJ 1FMWA 3ABKH 3CCSI 4EGZA 3NEUA 2Q0OA 4QIWN 1VZ0A 5IYCJ 3GLLA 3K4MA 1NK3P 5KVRA 3LQRA 3NWSA 2VPLA 4E7ZA 5E1WA 2BY1A 3FHZA 2V1UA 1A6IA 9ANTA 2MH2A 3LSMA 3AKZA 1S8NA 1WH7A 3DKXA 1J09A 3KYCB 4K2EA 1IRXA 3QOEA 1UELB 1KZHA 4F92B 2F6CA 1X19A 2E60A 3DF8A 3IH4A 5L3DA 3A01B 3I56I 3GFIA 4LG0A 2FD5A 2VLAA 3WG7H 1MMGA 4QWQA 1YW9A 3ZGKA 5E79C 3T8TA 1QVUA 4CDGA 3JRAA 1VQKI 4XORA 1MIJA 4DYQA 3W6JB 2EV6A 3HJEA 4FX0A 3C1DA 3H5AA 3ZQFA 1D8JA 5B1BH 2ICWG 4P5OA 3J80Z 3EPZA 1YW7A 1BL0A 2IP2A 5FKOA 1R4NB 1F5TA 4OAZA 4QSHA 2ZFWA 1YRNB 3S15J 2DA6A 1WSUA 1MKMA 3A02A 1UMQA 1ZHFA 1XB4A 4S05A 3WU0A 2XF5A 2LRDA 4LJZF 3SDGA 4Y33A 1W36D 1OISA 4L5JA 2QLZA 3K4LA 3FF5A 2CV1A 1VQOI 4BBRJ 5CVIA 3G6EI 4PGGA 2GA2A 3PIPF 2LF7A 1R1TA 4RAGA 4AD9A 2P5KA 3FXRA 2JA7J 4BHPA 5JVGF 4LIUA 2K9MA 3MCZA 3K4KA 3WE2A 3TP3A 4AM3A 2V9PA 4MFDA 2HXOA 3IKVA 3CMEI 5EEAA 3AL0B 4TV7A 4I6ZA 1Y1VJ 1TT5B 4LK1F 4HF0A 1U78A 3H35A 1DPUA 1YJ9I 1SVLA 5IOZA 1ETVA 3QPTA 3VYUB 4IOAF 3I55I 5DD8A 4WWCA 3HOYJ 3M1CA 3IAM2 2XRLA 3VWBA 1SD5A 1T0FC 3BZ6A 2R7DA 2GXGA 3P7NA 5CKTA 4AVZA 3S3OA 1XSXA 3CDIA 2JVGA 2P4WA 1VQ4I 1LE8A 3CCJI 3GF2A 2LK2A 2PG4A 2M8GX 3S32A 3J7YJ 2XGEA 1B1BA 2UXXA 4GYIA 2A61A 1ZR2A 3PFYA 4A0XA 1B8IA 4P55A 1EV7A 3K10A 3DXJF 5LEKA 5CPRB 3ZQCA 2E19A 1RUNA 4ESFA 2ZJ2A 3MN2A 2FSWA 1FYLA 1W36C 2XF6A 1X3UA 2WY7Q 4IZZA 2ESNA 3HGGA 3K69A 4ZYHA 2EIJH 3VSLA 1WRJA 2XKPA 1FP1D 1IDZA 3WU2C 1Y0NA 2VBWA 3FMRA 1BW5A 2PJRA 4JOMA 3D5LA 2MG4A 5KK1A 1DU0A 2VKEA 2GIVA 5JR3A 5J6XA 4CXFA 4FCYA 2IT0A 4I0BA 2B7EA 1X2MA 1X3WB 1P6RA 3FMQA 3AAFA 5FB2A 3BY6A 5KCMA 3LSTA 4C3HJ 2EQRA 2JN6A 2VKDA 3ZQGA 3PIOF 3J81Z 2XB0X 3SXYA 1D1BA 3SFIA 3J80K 4YG2F 4IO9F 3TW7A 4G7ZF 3WGGA 1YYVA 1JT6A 3JR9A 4GCVA 4BDYA 2AQFA 2QBYB 1VTNC 2QSGX 1U5TC 1TWGJ 4MEXF 1XN7A 2K4JA 3KP2A 5JVTA 3G2BA 3F0CA 4XLNF 3ROUA 3KPHA 2EBIA 3KEOA 2V79A 3BT9A 4PFPA 1TQPA 3R60A 3M7GA 3MZHA 3I4PA 4XRMA 2DOEA 2KZVA 2DYRH 2ZBKA 2ISYA 3QQAA 3OSGA 2OTJI 2P5LC 2HZTA 1FSHA 2RNGA 1H0MA 2V9KA 4LGWA 2HI3A 1FT9A 2JT1A 3CP8A 3F21A 1LPQA 1XMKA 5EJCA 3E6BA 1XMXA 4BJ5C 5K5RA 4W97A 3F6VA 4IPAA 2KJBA 1SD7A 5CVRA 1VQ6I 1R6RA 1AWCA 2ADUA 4MQVA 3RZOJ 3DTEA 4ZC3A 4RAZA 1JKQC 3IHUA 4EMSA 5LEJA 1V3FA 3CF2A 4ENMA 2ZMEB 1GT0C 2VONA 3FDYA 5B1AH 2L9RA 2DPDA 4N4OB 2AXTC 4PGHA 2IGOA 4D9JA 5K1YA 2R3SA 3OL4A 3ML6A 4UVCA 3ERED 1WGXA 3RYPA 4GXOA 4J01A 4A0YA 3HUGB 4CO8A 4G94A 1XSDA 1BR1A 3T5XA 2EA2A 3B6AA 3DTKA 3G1LA 4L9VA 3GFMA 5FROA 3ZR8X 2R7TA 2OBPA 2PMZA 5E3MA 2FQ4A 1TTYA 3TP0A 1VI0A 1CGPA 4UVBA 2NS7A 4IHTA 2CQKA 1IN4A 2JA6J 2A6HF 2X51A 1S3JA 2V4JC 3V8LA 2R7ZJ 1WFXA 5FKKA 4CCJA 1E3OC 2FQ3A 2ISZA 5LGNA 2DN0A 3BDDA 4XLCA 4BL0B 2F4IA 2X6YA 3S3NA 1KYWA 3OOPA 5EG0A 3FXQA 3I4NJ 5CVVA 5M3MJ 1N78A 1EKEA 4ZTFA 2X1EA 3HRSA 1HDPA 4YFKF 4IOCF 3CCEI 1F9NA 2RVCA 4XQFA 2XKOA 1MSFC 2KDOA 4IQ4A 3W6VA 2EZLA 2JUCA 3R0AA 4M3DA 1S72I 1RPWA 2K9LA 3E6MA 1HF0A 2GZWA 2JA8J 1JE8A 1HC8A 1G59A 4ETSA 5LGTA 1LQ1A 3A2KA 1Z21A 1YQAA 2ZNYA 4V2GA 2X48A 1W4MA 2CYYA 3BCAA 4FX4A 4HSTA 2JJ7A 2ZSIB 3PM1A 2R7WA 4HV5A 5C3EJ 1O3RA 3IRQA 1VQ9I 2L7KA 2MD0A 4NQWB 1R1VA 2M3AA 2WWYA 2HYGD 2DA4A 4II3A 3V7CA 4MQ9F 3ZCOA 3F8MA 1HW2A 4A2UA 2V6EA 2A6TA 2HVQA 2K4BA 2A5WA 3QP5A 3F8CA 3CUQA 3SZTA 3RTRA 4DOZA 4A6EA 1U0JA 1KA8A 5LHGA 1L0OC 3MFKA 3GTLJ 3OOUA 1ULYA 2PQ8A 4UB6C 5CLSA 4CICA 2E35A 4L0ZB 1PVEA 5IYBJ 1WI9A 5D5UB 4EVIA 2IXSA 2D2WA 3K4CA 1G4DA 4P9FA 1Z6TA 1PDNC 2E2IJ 4B3AA 3HYIA 2CUEA 4BJ6C 5A2QZ 1IV8A 3TKYA 1T0FA 3LA2A 1LFUP 4YELA 1EF4A 4B47A 4CHUA 4PUSA 2KRFA 4KT5C 2LY9A 4FETA 3RQ4A 4RAYA 5FD5A 1K78A 3OYFA 3QPSA 1MSEC 1WKMA 1YX3A 3W6KB 2O61A 3VB2A 2Q2EA 1MMNA 2ACJA 4G6QA 4Y15A 3KYDB 2E36A 3U2RA 1SD6A 4AC0A 1J7KA 1FLIA 2BOLA 5LHHA 1OFCX 5TRDA 2W25A 3S93A 4WXCA 2BZTA 5C44J 1PUEE 2BVMA 2K85A 3LMMA 3S16J 5H6QA 1SANA 4E7KA 5D8LB 3QAHA 1Y39A 4OU0A 5E1ZB 5DUKA 2LBFA 2QSFX 1U9NA 1X1AA 2KIQA 3R4KA 4HNTA 4OIPF 1D0YA 2KISA 2ECCA 4EJTA 1R00A 3RYRA 4HNUA 3ULQB 3S2HJ 3CMMA 4U7BA 3FBIB 3V8KA 5K5OA 2KLOA 2VJ4A 4ON0A 5K7FA 3F8BA 1ZAOA 2ZXIA 2EFQA 3SZGA 2KRCA 3BJAA 2XVCA 2MA3A 3KLOA 4ZDPA 4O5VA 3G1MA 2LR8A 2ZSHB 1H88C 5F64A 4HX7A 3LSRA 2KHMA 1GV2A 1ONVA 2FXAA 5AIQA 3HOWJ 1TNTA 4KYWA 2EPFA 4RB0A 3NAUA 2V9VA 1T56A 2GBYA 2Z16A 3GCMA 4NHJA 5FJ8J 1XX5A 3HTUA 5FLMJ 3UNGC 3FXOA 3RDIA 1SAUA 1ON2A 1QPMA 2QENA 4L9TA 4JQFA 3OYCA 1XC5A 3HC7A 2VB6A 1D0XA 1YJWI 2GQQA 1X4OA 3VYTB 2BE5F 2MABA 2IAIA 2QQ8A 2BGCA 4XMYA 5L3BA 1GXPA 3WTVC 2HPIA 1P4XA 3H0GJ 5LBQA 3SZPA 3K4BA 5F0CA 4BBSJ 4DIQA 4E7HA 2GOXB 3EDPA 5B5EC 4XKBA 4A0ZA 1GDTA 2Y30A 1X4PA 4RGXA 2WADA 1MBFA 2JRMA 2FEZA 2L9SA 4UUTA 1VFCA 1RUOA 6PAXA 3BTJA 4KT6A 4MLOA 4MTEA 1YHQI 2IBDA 3LSGA 1REPC 3PL8A 5A2QK 2H27A 3GLXA 2O6GE 4PFOA 4KNYA 2IS2A 4LMYA 2Y9ZA 2E34A 1V5GA 1U8RA 5FFZA 1ETQA 4N9IA 4C2TA 5FO5A 1A6QA 3RPUD 1E3PA 3OYDA 3CMYA 2LD5A 2H94A 2E1MC 1OCZH 5CQEA 2FUG2 1ZGWA 2VUMJ 4XOPA 4IRHA 3I58A 2O03A 4RGUA 2NOJB 5ED4A 3OYAA 3UR3C 2DI3A 3CESA 3SJMA 4LB6B 3KX2A 1T38A 2IA2A 4BEHA 2AQEA 3H1CA 2PMZN 3ZMDA 5EDNA 1TL8A 1UAAA 4NC7A 4RB1A 3DKYA 2CJJA 3CC4I 1XG1A 2M8EA 5FKLA 3WTYC 3BR2A 4M3FA 4MEYF 2CMPA 4HX8A 4CUGA 5JHUA 2O7OA 1MJ9A 1Z67A 2QGUA 1ENHA 1YTYA 2E1MB 4IVNA 1VQ7I 2HTJA 5DUIA 4HLYA 2QSHX 2LF8A 1W7PA 3J7ZI 4HW0A 2UUZA 3CJRB 1ZG5A 1IRGA 4XK4A 2K3FA 1WI3A 3GTQJ 2FNAA 1FX7A 3C3WA 1OCOH 5HS8A 1U2WA 4B1RA 5IPAA 2KIUA 1S7AA 1MW7A 1XD7A 4IRIA 4CSWA 1IXRC 4KIGA 2DTZA 4I09A 2HVSA 4RB3C 4G6TB 1B8IB 3OS1A 1WJBA 4P9UA 3PUBA 3K0LA 5LFAA 1UHMA 1VQ5I 1CF7A 3BPVA 2NAZA 1JJ6C 3SDBA 3A03A 1LNWA 3ABUA 1S29A 3GUDA 2HZDA 4KIBA 2KL4A 3OYGA 3BR1A 2M7BA 3Q0UA 1UG0A 5CJ9A 5JI6A 2E1CA 2EIKH 4KIFA 3P9KA 1MMSA 4RBOA 3SEZA 4NUBA 5J8CA 1T6SA 2DOFA 3PNYA 1USTA 2K9QA 3I64A 4BUPA 4L9JA 2C6YA 3HEFA 4XLPF 1V5FA 2DK8A 2L2OA 2PX9A 2EIMH 2FMYA 4B09A 3FXLA 2P8TA 1BA5A 2M7AA 5HLHA 1WJFA 2DXIA 1ETOA 2YX4A 4M9XA 3GTKJ 5FLXZ 3L2VA 4R8HA 4Y52J 1LJ9A 3WHBA 3GTJJ 1MNEA 3S17J 1TWFJ 3EUHC 4PJNA 1FYKA 2NS8A 4DJAA 1MH3A 4I2OA 3L2WA 2L9VA 3KETA 1ZRCA 4P1WA 1YX5A 4OIRF 1UG2A 4HA8A 2VQHA 3V42A 4L5IA 3DU5A 1EA3A 1BOBA 2FU4A 2LREA 3A4CA 4NDLA 2ZJPF 4PJJA 4XBFA 3SFZA 2RGVA 2UXNA 4D7NA 2DO7A 2PN6A 4B3XA 4YFNF 4KJZA 2OQGA 4DYRA 4X6AJ 3BC8A 4G8XA 3DPLC 1SFUA 4U0WA 2CFOA 2V7FA 1Z3YA 1QGPA 4G6DA 5IP9J 4I02A 1TW2A 1PUFA 1FZPB 2WTEA 3L9FA 2QYOA 1STZA 4QPOA 3DEWA 3GYHX 4XN3A 2UZKA 2BEOA 1GVJA 5FFXA 1GLNA 1RIOH 4BNCA 4Y3OA 5IYDJ 2FJ1A 2Y9YA 4II2A 2HOSA 2FA5A 2XPWA 4XRFA 1IRZA 1TWAJ 3BR3A 3MKZA 3CDHA 3CTAA 2WB1A 3LSKA 5J40A 1MMDA 3EYIA 3DWLE 3CD6I 4E7SA 2K02A 3CCYA 2HR3A 4YIFA 3Q0VA 1BR2A 1K83J 3RKXA 3LSIA 3MQ0A 2OJED 3MD2A 2H8RA 3ZRGA 4CCMA 3H3VK 2BBYA 2G9WA 1DGWY 1LKXA 4N4NB 2ME6A 4AU7A 3I59B 5E8GA 5BQTA 1BW6A 1MZBA 2V1XA 5ERIA 4CCOA 1AKHB 3GTGJ 1HXDA 2DLLA 1LUJB 3HOSA 3IAS2 4A3GJ 2W24A 3BG3A 3F8NA 1XS9A 2GXBA 3E6CC 2CW8A 3AL0C 2W1OA 4WCGA 4U7DA 3I53A 3ABTA 1A31A 1FMVA 4XKCA 4UUSA 2K40A 3CCRI 3MZYA 2HS5A 2KT0A 4DW6A 2ELKA 2NYXA 1IG7A 2NNNA 4ZYGA 3OMYA 2VN2A 3GTPJ 2FBHA 4H0EA 3CQZJ 1T2KA 1ZLJA 3S2WA 2VT3A 4N0BA 4A3MJ 2XDVA 4EATA 5D8KB 2HQNA 1EH6A 5FLXK 3GTOJ 1ETYA 1O7LA 1HCRA 3T8RA 2Z9OA 1BJAA 3N97A 3H0DA 3KP5A 4A3CJ 1A5JA 2WAEA 4GRIA 4KDPA 2K9NA 3IRRA 1FP2A 4ZDLA 2QWWA 3LAJA 1SD4A 3HOTA 3G71I 2ZXWH 1OKRA 4BHBA 3WGHA 3OYKA 1IUFA 4D1QA 2LG4A 2O8KA 1H9GA 1K4TA 2M0MA 1R4MB 1VQLI 2J5OA 4E7IA 1I39A 4ZZLA 2KMUA 1IF1A 3IC7A 4LIVA 2ECBA 2G0EA 2V6CA 1UHWA 5TISC 2OAZA 2IS1A 4HEA2 3CUQB 2M4GA 2GXAA 1RI7A 2XASA 3ABMH 3HOVJ 1QZEA 2PEXA 5E18F 4ZYAA 2WBMA 1F36A 3B6CA 3FX3A 2PLYA 1FC3A 1WPKA 3C2HA 1RKTA 2Z99A 2CG4A 2KZGA 3OS2A 2ZNZA 1EJ9A 1QNTA 3D0SA 2CO5A 1JUMA 1YI2I 2CRGA 2DA2A 2W57A 1I5ZA 3U21A 1AHDP 1QHHD 3CDLA 2DQLA 1GXQA 1MD0A 4NC6A 1ZGAA 1LDKB 2VOOA 4KMUX 3FBNB 1RNLA 3GEZA 1HSTA 4JBAA 2X6WA 3JTHA 4JX6A 1XGMA 5E3NA 1FYMA 1BC8C 4ZDOA 4EV0A 1HBXG 2VJ5A 3GZ5A 3TOBA 5H6RA 2DMTA 5GTHC 2D5VA 4HG2A 4IJAA 5B66C 1K78B 3MEXA 2G7UA 3ZQ7A 3NWTA 4BE1A 1KQ0A 2XIGA 2BW3B 3GWZA 2Q2EB 1OR7C 4F55A 3H9JA 4RM3A 3E97A 1WWXA 2JZYA 3JRDA 5CVJA 5TGTA 2KDZA 1B72A 2CV0A 1ZREA 2KQRA 1D3YA 3M07A 5CYVA 2CWEA 2LLKA 2ZO4A 4KMFA 2R93J 1I1SA 2JSPA 1I27A 2KP6A 1B9MA 4EM0B 2M45A 3BR5A 2E5ZA 3LSPA 1P9QC 2FBKA 1NG7A 1LDJA 3DPTA 1JGGA 2LBFB 1E2XA 2F4OB 1JUPA 3HBLA 5BNGA 4EJVA 3OV8A 5ICCA 1HQCA 3ESWB 3CLQA 3LSHA 2COBA 4Y4RA 2ZMEC 3ZMVA 2L4MA 3R0JA 3F72A 3BR0A 1WZ2A 1X2NA 2LFBA 1DGRM 3LFKA 1O57A 4RS8A 2IGMA 4Z6YA 3E7LA 3PQKA 4M3EA 2L4AA 4BXUA 2NVQJ 4ZH4F 4RA2A 1SFKA 1R71A 4UVAA 4LLGF 1M1EB 3AG3H 3TOAA 5HODA 3IV5A 4CYCA 4E6KG 3GBGA 1ZRDA 2R5YA 1Q1VA 1YO5C 2XGXA 5EEHA 5HLTA 1ODDA 1TNSA 3ZPLA 2VIXA 1KGSA 1VQNI 2LP0A 4PJ0C 3DKWA 2ETHA 2R7OA 3EUKL 2IA1A 1I1GA 2JVHA 2MH9A 2OCEA 5JHFA 1D1CA 2DA3A 3L2UA 5J8FA 3JSOA 2BY2A 3QPHA 2Y0MA 2K86A 3KLNA 1WVRA 1IN6A 3O8GA 3VODA 5J4VA 3A01A 3M3YJ 2JWTA 4BQAA 1TWCJ 1VF9A 3CF5F 1R5GA 2H09A 5D6EA 4XKWA 2VQLA 2NVTJ 2ZB9A 2O5RA 1B4AA 1JTXA 3HSFA 3KFWX 4PZJA 3REOA 3RZDJ 3JW4A 3DCFA 1TQMA 2LY2A 3W2WA 2YSRA 1W0UA 1HA8A 1XSVA 1I3AA 2QQ9A 5DCMA 5LD2C 3Q9VA 2X85A 2V1NA 2BY0A 1LEBA 1FIPA 4IF4A 2CV2A 1R49A 5L3GA 2K5CA 1K4SA 4A5MA 2R7VA 3J7AO 1IZ1A 2K7LA 4U0YA 3KIOA 2MLGA 5CQGA 1KU7A 2E7XA 1W0TA 1IUYA 4YIRX 3MKWB 1I3QJ 2WB1N 4X1EA 4I01A 3J81K 2L7ZA 3KP3A 2R7QA 2Y0SA 2R7SA 2XAUA 4RMNA 3BR6A 2NVUB 1X1DA 4XRSG 3HSRA 4M3BA 1YW8A 2RNJA 2OQRA 5IT3A 4OIQF 3OYLA 2TDXA 4NNJA 1F43A 2E7WA 2ID6A 1FOXA 2UV1A 3HHGA 4BJTA 3QYFA 5AONA 4IHYA 3DV8A 1GUUA 4JK1X 4OAYA 3LQQA 2DMNA 4CH7A 3M8JA 4FE7A 4N9HA 4B8XA 4BACA 1JKRC 1DPRA 2DMPA 1ZG1A 4C2MJ 4B4CA 2B9SA 4BE2A 2P6SA 1TLHB 3B73A 4F3QA 4AIJA 4ENNA 1P2FA 2KKOA 2DDBA 3M1EA 3G4SI 1FJLA 4LITA 5DM6F 3DLLF 1R9TJ 4A3DJ 3VYRB 2X1DA 1C0WA 1Z05A 2R5ZA 4Q47A 5M5XJ 5IT9Z 3D1NI 5DM7F 1PYVA 3DEUA 3F3XA 4CGZA 3CCMI 3ZOBA 2O8XA 2A05A 2P7VB 5B3SH 4XICA 3EUAA 5EGOB 3CCUI 2DODA 1S5LC 5DV5A 2LKSA 4V19K 2XSJC 1JGSA 4F93B 3X2QH 3O3KA 5F1JA 2AXLA 1MBJA 3S14J 2M9HA 3L2CA 4GO1A 5H20A 4ZTJA 4HX4A 2JPCA 1E17A 3WTWC 2I10A 2OU2A 4LK0F 2VKVA 3BCBA 3C2GA 5F6FA 4S0HB 3CCQI 3ZMSA 3GMEA 1I6XA 1R5HA 3HG9A 2F2EA 4PSWA 2XAHA 3BTLA 1BI3A 2MW8A 3FXJA 4M6YA 3WE3A 4BQQA 2COMA 3H5RA 3VFZA 5LRRA 4LLNA 2V1DA 2Y2ZA 3HM5A 4FT8A 5J3LA 3H36A 5E3OA 4L0YB 1XMAA 2BY3A 3OY9A 3DU6A 3K9TA 1O4XA 4Q5SF 4M9ZA 2DA1A 2HWVA 1R36A 4Y17A 3BJ6A 3TDUC 1AA7A 5M5WJ 3BLYA 2EB7A 1Z91A 4YIIA 1R23A 3Q3SA 2H1LA 1G8XA 4B43A 4BU2A 1H89C 3GTMJ 3H9QA 1W5TA 1QU3A 4BE0A 4EGYA 4M73A 5FKNA 4PK4A 2QBYA 2ZCWA 4AIDA 1R7JA 2VKHA 3I5UA 3V7RA 2FBIA 1IJWC 4KN7X 4ZYDA 3ZQQA 2Z33A 2VXDA 4BQNA 2L3DA 4I99C 2LMDA 3MAJA 2HVRA 4M74A 2HOAA 2OD5A 2BXYA 1OPCA 2O0YA 5J1YA 5KHDA 4ANJA 2LC2A 1VQPI 3TO7A 3CJNA 2JK3A 3IWZA 1N77A 1XCVA 3W3CA 2HYFA 5BOXA 4JX4A 4WF2A 2DW4A 5M5YJ 4PJLA 3K1PA 2L02A 2W85A 2QA4I 4G7HF 3BROA 3O2PE 2CS3A 1U5TA 3E5XA 1WH5A 1PUFB 5F08A 4HRIA 4BY7J 4OIOF 5F0FA 3TL4X 1HSJA 1FY7A 3Q0WA 3KZYA 4CCLA 2OZ6A 4FHTA 4C3IJ 1USSA 4RB2C 1SEUA 2OA4A 3OYIA 1MBKA 3MMYB 2MYSA 2LKXA 3FXMA 1FBSA 3QWLA 4XR6A 1ZTRA 4LG0B 1K6YA 5GAEJ 5IT9K 2ZMEA 3U1KA 5HNFA 3ZP5A 2VODA 3K1NA 2RC4A 2QKLB 1P7IA 4A69C 4U87A 2OCCH 2G7HA 1JXSA 3A0BC 1J59A 3NQOA 2JQ7A 4U88A 3OYBA 4EM1A 2Z1DA 5F27A 3HUGA 3L1PA 3FMSA 2EH3A 4EJWA 4M9SA 5HVQC 2HPMA 2JA2A 3K1MA 5K5QA 2DU9A 1WJDA 2F48A 1DU6A 1TW3A 3CO7C 2ESHA 3FXKA 3DBLB 1KU2A 4HAMA 3RCOA 2L0KA 3OYJA 3DEEA 5EF6A 4OMYA 1BM9A 5FD6A 2M87A 2XHKA 3H3ZA 1LFBA 4ENKA 3BOQA 1GVDA 4XNFA 4HOBA 1FSEA 4UHTA 2IVMA 3FM3A 2WAQA 2LY1A 5E3LA 1X58A 1WJCA 2LDUA 5CVUA 2JA5J 3TGNA 2P5VA 2LNBA 3MVPA 3RIRA 3IKTA 3MKLA 1QZZA 2IGNA 4DZPA 1YS6A 2XAQA 3ZMTA 3M8EA 2IEKA 4HSRA 3WHCA 2OTLI 3P9IA 3A0HC 3JAMZ 2VBXA 3PUFA 2PMUA 2K3PA 2I5UA 4DNCA 2CQXA 1LFPA 2DA5A 2DFIA 3S1RJ 4R79A 4HQEA 1RETA 2F5CA 4G12A 1A35A 5ILUA 5IOYA 3IP4B 3S1NJ 3K7AJ 4C2UA 1YG2A 2LSOA 4MNUA 1WJAA 2M1BA 2BV6A 3OYEA 4KUMA 1QA6A 1Z77A 4A3BJ 2ZJRF 2WAFA 3CZ6A 3C18A 1TWHJ 2MC4A 3DTIA 4I0AA 3BG5A 5JLWA 1LE8B 2QM3A 3BTIA 3QP6A 3ABLH 2OUMA 3BZCA
chains in the Genus database with same CATH topology
2K40A 2H1KA 1APLC 2W48A 2Y0SN 2KT0A 3G1OA 3BQYA 4DW6A 3RZOJ 1JKQC 2ELKA 1JKOC 4AYBN 1IG7A 3JRGA 2ID3A 1GT0C 3GTPJ 3CQZJ 2L9RA 2R0QC 4EEFG 4A3MJ 3HDDA 4IEJA 4L5EA 3GTOJ 1ETYA 1HCRA 4AUXA 2K9SA 3JRHA 1WGXA 5EZHA 4JX5A 4A3CJ 1A5JA 3FISA 4XRSA 3LOCA 2K9NA 3B6AA 3G1LA 3BTCA 5E3MA 4HNVA 2FQ4A 3TP0A 1VI0A 1NTCA 2O8KA 3HGYA 1IUFA 2NS7A 2JA6J 3ZQIA 1IDYA 2R7ZJ 5FKKA 2M0CA 2OPTA 3QPLA 1E3OC 2DN0A 5J1RA 4D5FA 4MO7A 2ECBA 2G0EA 5EG0A 1ZR4A 3JRCA 3I4NJ 2XGDA 5M3MJ 1RR7A 4A3JJ 3HOVJ 3OSFA 4JYKA 5JLXA 1ITYA 1HDPA 3FKIJ 1F36A 3B6CA 2XB5A 1WPKA 3ZQLA 1RKTA 1T33A 1MSFC 1JUMA 3HOZJ 2CRGA 2DA2A 3JREA 2X9DA 1MH4A 4W1UA 2LTPA 1AHDP 3W6VA 3FK7A 2CU7A 2GM4A 3CDLA 2EZLA 4FE4A 4M3DA 1RPWA 2OF7A 1HF0A 1VNDA 2JA8J 1QRYA 4JX6A 5E3NA 1UHSA 4V2GA 2X48A 3HB9A 2DMTA 2D5VA 2JJ7A 3PM1A 4UUSB 1JT0A 5C3EJ 5DTDA 4IHVA 2R5YB 2DA4A 3LSJA 2FX0A 4J19A 4FTHA 2MGQA 3RQIA 1MBGA 4A3FJ 4D5CA 3ZQHA 3JRDA 2KDZA 3BQZA 1B72A 2R92J 3GTLJ 3OOUA 2LLKA 2R93J 2RAEA 2TCTA 5IYBJ 3LNQA 2EZKA 2HDDA 3BR5A 3LSPA 5EYRA 5F0HA 5GPCA 1JGGA 2N8GA 1JJ8C 3HBLA 1JUPA 5BNGA 4IHXA 1D5YA 2E2IJ 2COBA 3FK6A 4B3AA 2CUEA 3BR0A 2B63J 1QPIA 1X2NA 3C2BA 3JRIA 3BG9A 2LFBA 5DS9A 3RKQA 1LFUP 1EF4A 2LY9A 1I6HJ 3E7LA 4M3EA 4V2FA 2O9LA 2NVQJ 2ME0A 3QPSA 1MSEC 1CQTA 2MSYA 5HODA 3IV5A 4CYCA 3GBGA 2R5YA 1Q1VA 5IP6A 5EG0B 2QF7A 5C4JJ 2LP0A 3JRFA 3PO2J 4AC0A 4M6VA 2NVYJ 1OFCX 2E2HJ 2DA3A 3K2AA 5C44J 1U8BA 3S16J 1SANA 5EGOA 3TEDA 5FKMA 3O8GA 1U9NA 3A01A 3M3YJ 2JWTA 1TWCJ 1VF9A 2ECCA 2X6OA 2LVSA 1ZKGA 4D7MA 3S2DJ 4IHWA 2E1OA 5GP9A 2NVTJ 3JRBA 2ZB9A 3S2HJ 2Y31A 1JTXA 2M2EA 1NK2P 4A3KJ 3RZDJ 1JKPC 4MFEA 1FEXA 1OJLA 2DA7A 3DCFA 5K7FA 1W0UA 1IC8A 2HYJA 1Y1WJ 1FIPA 1RKWA 3HKZN 5K7ZA 1HOMA 2XPVA 2WAQN 5C4XJ 3G1MA 2LR8A 1H88C 2DMUA 2YS9A 3M4OJ 3LSRA 1B72B 2R5ZB 1GV2A 4RDUA 1W0TA 3HOWJ 4DZJA 3O8HA 1I3QJ 2WB1N 3NAUA 4X1EA 1T56A 2GBYA 2L7ZA 1G2HA 5FJ8J 1ORKA 5FLMJ 4XRSG 3BR6A 3HOXJ 1FTTA 4M3BA 2XPUA 1XC5A 3VPRA 4A3LJ 2GLOA 2DMQA 5K7HA 1F43A 1POGA 2ID6A 1SFOJ 3HOUJ 2IAIA 1IGNA 4QTRA 4IHYA 3IH2A 1GUUA 2HOTA 4GFBA 2DMNA 3H0GJ 5F0CA 2VI6A 4BBSJ 4FE7A 1JKRC 1ZK8A 2DMPA 4C2MJ 1MBHA 1GDTA 4B4CA 2Y30A 4CYCB 3NARA 1MBFA 4A3EJ 4UUTA 1VFCA 1IV6A 1FJLA 3BTJA 4MLOA 1ETXA 2IBDA 3LSGA 1R9TJ 3S1QJ 4A3DJ 4BXXJ 5FLVA 2R5ZA 2Y9ZA 4QIWN 1JUSA 5M5XJ 5IYCJ 1ETQA 3D1NI 1NK3P 3ZOBA 1A6IA 9ANTA 4XICA 3CMYA 5EGOB 2LD5A 1WH7A 3IH4A 3A01B 1ZGWA 2VUMJ 5F1JA 1MBJA 4C3JJ 2FD5A 3S14J 2M9HA 3SJMA 3JRAA 2AHQA 1QVUA 2PMZN 1HDDC 1QVTA 5EDNA 2I10A 4DYQA 2VKVA 3FIWA 2CJJA 1XG1A 5FKLA 2NVXJ 4S0HB 3BR2A 4M3FA 3ZQFA 2O7OA 3PO3J 1ENHA 3BTLA 1BL0A 2MW8A 5EZGA 5FKOA 2VPRA 4BKXA 3HM5A 2Y2ZA 5J3LA 5E3OA 4QSHA 1YRNB 2HXIA 3S15J 2DA6A 1O4XA 3A02A 1UMQA 2DA1A 4XK4A 2E2JJ 1WI3A 3GTQJ 3SDGA 5M5WJ 3OIOA 3Q3SA 4B1RA 5IPAA 2L7MP 1HLVA 4BBRJ 4JP0A 1H89C 3GTMJ 3S1MJ 2DTZA 1B8IB 4BY1J 5FKNA 5J1UA 1MNMC 2JA7J 1JJ6C 1IJWC 3TP3A 4A3IJ 3A03A 4MFDA 2HXOA 5EEAA 4M3GA 2HQ5A 2HOAA 4I6ZA 4A93J 1Y1VJ 2XSDC 3BR1A 3Q0UA 5J1YA 2NOGA 1U78A 2JMWA 4ABZA 5IOZA 4RBOA 1ETVA 2JK3A 4JX4A 2P81A 5M5YJ 3HOYJ 2XGCA 1AKHA 2XRLA 2K9QA 1YRNA 3HEFA 4XIDA 2YU9J 1WH5A 1PUFB 1U9OA 5M3FJ 5F08A 4BY7J 1LE8A 5F0FA 4DYCA 1BA5A 2LK2A 3Q0WA 1ETOA 2M8GX 3GTKJ 2EZIA 2XGEA 4FISA 5IP7J 4Y52J 4C3IJ 3WHBA 1ZR2A 3GTJJ 1B8IA 1MBKA 3S17J 1TWFJ 2LKXA 1MBEA 3IH3A 3ZQCA 2E19A 2DJNA 2NS8A 1ZTRA 1MH3A 3MN2A 1ETKA 3HGGA 1UG2A 1BJZA 1P7IA 5F04A 2L7FP 4NDLA 1IDZA 4A69C 4D7NA 1Z0XA 5F27A 1BW5A 3L1PA 2EH3A 2EZHA 1AU7A 4DYRA 4X6AJ 3I4MJ 2MG4A 1DU0A 2QCOA 2VKEA 1DU6A 4MIMA 4FCYA 1OCPA 1X2MA 5IP9J 2L0KA 1H8AC 1PUFA 5EF6A 4C3HJ 2EQRA 1OCTC 3DEWA 2JN6A 3ZQGA 5GPAA 4LOCA 1LFBA 2XB0X 1TC3C 1GVDA 3SFIA 5E3LA 3TW7A 1X58A 2JA5J 5IYDJ 2FJ1A 2Y9YA 2HOSA 3MVPA 1ZQ3P 2XPWA 1JT6A 1IRZA 3JR9A 1TWAJ 3MKLA 1I50J 3BR3A 4DZPA 3TW6A 1TWGJ 2YUSA 2IEKA 3WHCA 4Y7NJ 1JTYA 3CCYA 2WV1A 4I76A 3F0CA 3Q0VA 2EBIA 1GV5A 1K83J 2AO9A 1P7JA 2CQXA 2H8RA 3BT9A 2DA5A 3S1RJ 3H3VK 2CUFA 1RETA 1FTZA 4G12A 4XRMA 2ME6A 5IOYA 3S1NJ 3QQAA 2TRTA 3K7AJ 3UKGA 3OSGA 1S7EA 1ETWA 1BW6A 2CQQA 1AKHB 1RESA 3GTGJ 2M34A 1Z77A 4A3BJ 2HI3A 4A3GJ 1FIAA 1TWHJ 3BG3A 1XS9A 1WCMJ 3BG5A 5JLWA 1LE8B 4W97A 3BTIA 1K61A 4UUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K40 A;  2H1K A;  1APL C;  2W48 A;  2Y0S N;  2KT0 A;  3G1O A;  3BQY A;  4DW6 A;  3RZO J;  1JKQ C;  2ELK A;  1JKO C;  4AYB N;  1IG7 A;  3JRG A;  2ID3 A;  1GT0 C;  3GTP J;  3CQZ J;  2L9R A;  2R0Q C;  4EEF G;  4A3M J;  3HDD A;  4IEJ A;  4L5E A;  3GTO J;  1ETY A;  1HCR A;  4AUX A;  2K9S A;  3JRH A;  1WGX A;  5EZH A;  4JX5 A;  4A3C J;  1A5J A;  3FIS A;  4XRS A;  3LOC A;  2K9N A;  3B6A A;  3G1L A;  3BTC A;  5E3M A;  4HNV A;  2FQ4 A;  3TP0 A;  1VI0 A;  1NTC A;  2O8K A;  3HGY A;  1IUF A;  2NS7 A;  2JA6 J;  3ZQI A;  1IDY A;  2R7Z J;  5FKK A;  2M0C A;  2OPT A;  3QPL A;  1E3O C;  2DN0 A;  5J1R A;  4D5F A;  4MO7 A;  2ECB A;  2G0E A;  5EG0 A;  1ZR4 A;  3JRC A;  3I4N J;  2XGD A;  5M3M J;  1RR7 A;  4A3J J;  3HOV J;  3OSF A;  4JYK A;  5JLX A;  1ITY A;  1HDP A;  3FKI J;  1F36 A;  3B6C A;  2XB5 A;  1WPK A;  3ZQL A;  1RKT A;  1T33 A;  1MSF C;  1JUM A;  3HOZ J;  2CRG A;  2DA2 A;  3JRE A;  2X9D A;  1MH4 A;  4W1U A;  2LTP A;  1AHD P;  3W6V A;  3FK7 A;  2CU7 A;  2GM4 A;  3CDL A;  2EZL A;  4FE4 A;  4M3D A;  1RPW A;  2OF7 A;  1HF0 A;  1VND A;  2JA8 J;  1QRY A;  4JX6 A;  5E3N A;  1UHS A;  4V2G A;  2X48 A;  3HB9 A;  2DMT A;  2D5V A;  2JJ7 A;  3PM1 A;  4UUS B;  1JT0 A;  5C3E J;  5DTD A;  4IHV A;  2R5Y B;  2DA4 A;  3LSJ A;  2FX0 A;  4J19 A;  4FTH A;  2MGQ A;  3RQI A;  1MBG A;  4A3F J;  4D5C A;  3ZQH A;  3JRD A;  2KDZ A;  3BQZ A;  1B72 A;  2R92 J;  3GTL J;  3OOU A;  2LLK A;  2R93 J;  2RAE A;  2TCT A;  5IYB J;  3LNQ A;  2EZK A;  2HDD A;  3BR5 A;  3LSP A;  5EYR A;  5F0H A;  5GPC A;  1JGG A;  2N8G A;  1JJ8 C;  3HBL A;  1JUP A;  5BNG A;  4IHX A;  1D5Y A;  2E2I J;  2COB A;  3FK6 A;  4B3A A;  2CUE A;  3BR0 A;  2B63 J;  1QPI A;  1X2N A;  3C2B A;  3JRI A;  3BG9 A;  2LFB A;  5DS9 A;  3RKQ A;  1LFU P;  1EF4 A;  2LY9 A;  1I6H J;  3E7L A;  4M3E A;  4V2F A;  2O9L A;  2NVQ J;  2ME0 A;  3QPS A;  1MSE C;  1CQT A;  2MSY A;  5HOD A;  3IV5 A;  4CYC A;  3GBG A;  2R5Y A;  1Q1V A;  5IP6 A;  5EG0 B;  2QF7 A;  5C4J J;  2LP0 A;  3JRF A;  3PO2 J;  4AC0 A;  4M6V A;  2NVY J;  1OFC X;  2E2H J;  2DA3 A;  3K2A A;  5C44 J;  1U8B A;  3S16 J;  1SAN A;  5EGO A;  3TED A;  5FKM A;  3O8G A;  1U9N A;  3A01 A;  3M3Y J;  2JWT A;  1TWC J;  1VF9 A;  2ECC A;  2X6O A;  2LVS A;  1ZKG A;  4D7M A;  3S2D J;  4IHW A;  2E1O A;  5GP9 A;  2NVT J;  3JRB A;  2ZB9 A;  3S2H J;  2Y31 A;  1JTX A;  2M2E A;  1NK2 P;  4A3K J;  3RZD J;  1JKP C;  4MFE A;  1FEX A;  1OJL A;  2DA7 A;  3DCF A;  5K7F A;  1W0U A;  1IC8 A;  2HYJ A;  1Y1W J;  1FIP A;  1RKW A;  3HKZ N;  5K7Z A;  1HOM A;  2XPV A;  2WAQ N;  5C4X J;  3G1M A;  2LR8 A;  1H88 C;  2DMU A;  2YS9 A;  3M4O J;  3LSR A;  1B72 B;  2R5Z B;  1GV2 A;  4RDU A;  1W0T A;  3HOW J;  4DZJ A;  3O8H A;  1I3Q J;  2WB1 N;  3NAU A;  4X1E A;  1T56 A;  2GBY A;  2L7Z A;  1G2H A;  5FJ8 J;  1ORK A;  5FLM J;  4XRS G;  3BR6 A;  3HOX J;  1FTT A;  4M3B A;  2XPU A;  1XC5 A;  3VPR A;  4A3L J;  2GLO A;  2DMQ A;  5K7H A;  1F43 A;  1POG A;  2ID6 A;  1SFO J;  3HOU J;  2IAI A;  1IGN A;  4QTR A;  4IHY A;  3IH2 A;  1GUU A;  2HOT A;  4GFB A;  2DMN A;  3H0G J;  5F0C A;  2VI6 A;  4BBS J;  4FE7 A;  1JKR C;  1ZK8 A;  2DMP A;  4C2M J;  1MBH A;  1GDT A;  4B4C A;  2Y30 A;  4CYC B;  3NAR A;  1MBF A;  4A3E J;  4UUT A;  1VFC A;  1IV6 A;  1FJL A;  3BTJ A;  4MLO A;  1ETX A;  2IBD A;  3LSG A;  1R9T J;  3S1Q J;  4A3D J;  4BXX J;  5FLV A;  2R5Z A;  2Y9Z A;  4QIW N;  1JUS A;  5M5X J;  5IYC J;  1ETQ A;  3D1N I;  1NK3 P;  3ZOB A;  1A6I A;  9ANT A;  4XIC A;  3CMY A;  5EGO B;  2LD5 A;  1WH7 A;  3IH4 A;  3A01 B;  1ZGW A;  2VUM J;  5F1J A;  1MBJ A;  4C3J J;  2FD5 A;  3S14 J;  2M9H A;  3SJM A;  3JRA A;  2AHQ A;  1QVU A;  2PMZ N;  1HDD C;  1QVT A;  5EDN A;  2I10 A;  4DYQ A;  2VKV A;  3FIW A;  2CJJ A;  1XG1 A;  5FKL A;  2NVX J;  4S0H B;  3BR2 A;  4M3F A;  3ZQF A;  2O7O A;  3PO3 J;  1ENH A;  3BTL A;  1BL0 A;  2MW8 A;  5EZG A;  5FKO A;  2VPR A;  4BKX A;  3HM5 A;  2Y2Z A;  5J3L A;  5E3O A;  4QSH A;  1YRN B;  2HXI A;  3S15 J;  2DA6 A;  1O4X A;  3A02 A;  1UMQ A;  2DA1 A;  4XK4 A;  2E2J J;  1WI3 A;  3GTQ J;  3SDG A;  5M5W J;  3OIO A;  3Q3S A;  4B1R A;  5IPA A;  2L7M P;  1HLV A;  4BBR J;  4JP0 A;  1H89 C;  3GTM J;  3S1M J;  2DTZ A;  1B8I B;  4BY1 J;  5FKN A;  5J1U A;  1MNM C;  2JA7 J;  1JJ6 C;  1IJW C;  3TP3 A;  4A3I J;  3A03 A;  4MFD A;  2HXO A;  5EEA A;  4M3G A;  2HQ5 A;  2HOA A;  4I6Z A;  4A93 J;  1Y1V J;  2XSD C;  3BR1 A;  3Q0U A;  5J1Y A;  2NOG A;  1U78 A;  2JMW A;  4ABZ A;  5IOZ A;  4RBO A;  1ETV A;  2JK3 A;  4JX4 A;  2P81 A;  5M5Y J;  3HOY J;  2XGC A;  1AKH A;  2XRL A;  2K9Q A;  1YRN A;  3HEF A;  4XID A;  2YU9 J;  1WH5 A;  1PUF B;  1U9O A;  5M3F J;  5F08 A;  4BY7 J;  1LE8 A;  5F0F A;  4DYC A;  1BA5 A;  2LK2 A;  3Q0W A;  1ETO A;  2M8G X;  3GTK J;  2EZI A;  2XGE A;  4FIS A;  5IP7 J;  4Y52 J;  4C3I J;  3WHB A;  1ZR2 A;  3GTJ J;  1B8I A;  1MBK A;  3S17 J;  1TWF J;  2LKX A;  1MBE A;  3IH3 A;  3ZQC A;  2E19 A;  2DJN A;  2NS8 A;  1ZTR A;  1MH3 A;  3MN2 A;  1ETK A;  3HGG A;  1UG2 A;  1BJZ A;  1P7I A;  5F04 A;  2L7F P;  4NDL A;  1IDZ A;  4A69 C;  4D7N A;  1Z0X A;  5F27 A;  1BW5 A;  3L1P A;  2EH3 A;  2EZH A;  1AU7 A;  4DYR A;  4X6A J;  3I4M J;  2MG4 A;  1DU0 A;  2QCO A;  2VKE A;  1DU6 A;  4MIM A;  4FCY A;  1OCP A;  1X2M A;  5IP9 J;  2L0K A;  1H8A C;  1PUF A;  5EF6 A;  4C3H J;  2EQR A;  1OCT C;  3DEW A;  2JN6 A;  3ZQG A;  5GPA A;  4LOC A;  1LFB A;  2XB0 X;  1TC3 C;  1GVD A;  3SFI A;  5E3L A;  3TW7 A;  1X58 A;  2JA5 J;  5IYD J;  2FJ1 A;  2Y9Y A;  2HOS A;  3MVP A;  1ZQ3 P;  2XPW A;  1JT6 A;  1IRZ A;  3JR9 A;  1TWA J;  3MKL A;  1I50 J;  3BR3 A;  4DZP A;  3TW6 A;  1TWG J;  2YUS A;  2IEK A;  3WHC A;  4Y7N J;  1JTY A;  3CCY A;  2WV1 A;  4I76 A;  3F0C A;  3Q0V A;  2EBI A;  1GV5 A;  1K83 J;  2AO9 A;  1P7J A;  2CQX A;  2H8R A;  3BT9 A;  2DA5 A;  3S1R J;  3H3V K;  2CUF A;  1RET A;  1FTZ A;  4G12 A;  4XRM A;  2ME6 A;  5IOY A;  3S1N J;  3QQA A;  2TRT A;  3K7A J;  3UKG A;  3OSG A;  1S7E A;  1ETW A;  1BW6 A;  2CQQ A;  1AKH B;  1RES A;  3GTG J;  2M34 A;  1Z77 A;  4A3B J;  2HI3 A;  4A3G J;  1FIA A;  1TWH J;  3BG3 A;  1XS9 A;  1WCM J;  3BG5 A;  5JLW A;  1LE8 B;  4W97 A;  3BTI A;  1K61 A;  4UUS A; 
#chains in the Genus database with same CATH topology
 5LLQ A;  3TO9 A;  1APL C;  2R7F A;  2DT5 A;  2A5Y B;  5J47 A;  1ZLK A;  1S7O A;  2Y0S N;  3CCV I;  1SVM A;  1G3S A;  2HDW A;  1V4R A;  2PFB A;  3E1S A;  2EA4 A;  1JKO C;  3I71 A;  2NS0 A;  1NG6 A;  2JSC A;  3JRG A;  1SFE A;  2ID3 A;  1QO0 D;  5HNH A;  3SYT A;  2VC0 A;  4LB5 A;  1MND A;  4EEF G;  1D0Z A;  3HDD A;  4L5E A;  3WTS C;  3T1B A;  3CP2 A;  3L09 A;  3OR1 C;  4AUX A;  2K9S A;  4BXF A;  5EZH A;  3GW2 A;  1WHU A;  2Y48 A;  3KCC A;  4JX5 A;  2XRO A;  2DDA A;  3MWM A;  3DP7 A;  3W2V A;  2PJR B;  2KJC A;  3E5U A;  3EET A;  4XRS A;  2LKP A;  3F9K A;  3FKJ A;  3BTC A;  2X1C A;  3QYB A;  3HGY A;  1T98 A;  2RN7 A;  3KP7 A;  2DBB A;  3ZQI A;  1IDY A;  2L01 A;  2BXZ A;  2M0C A;  1Z7L A;  1FWZ A;  2IS4 A;  5J1R A;  1DQU A;  2CUJ A;  4MO7 A;  2STT A;  3JRC A;  1O3S A;  1TQI A;  1RR7 A;  1W1W E;  4RGR A;  2BVL A;  3OSF A;  4JYK A;  3OR2 C;  4EJO A;  1YOV B;  2Q8K A;  5JLX A;  1XDS A;  2HFH A;  3HPH A;  3FKI J;  4XLE A;  3COA C;  2XB5 A;  3VEP A;  1MJA A;  1T33 A;  4FAS D;  3EQL F;  1Z3X A;  4BAY A;  3HOZ J;  3RSN A;  4W1U A;  1MH4 A;  5L3E A;  2LTP A;  3FK7 A;  2GM4 A;  3ECO A;  5E1X A;  2P0W A;  5FRM A;  4A5N A;  2OF7 A;  2NXN B;  1SVO A;  4P96 A;  3GZ6 A;  3S8P A;  1DP3 A;  4HQM A;  3JAM K;  4RLF A;  2A6E F;  1ZAR A;  3RJP A;  4PJM A;  4WXH A;  3EYY A;  4BYY A;  1IXC A;  3FWE A;  4CCK A;  3NRV A;  3E6D A;  3TDZ C;  3HL2 A;  1U3E M;  2F5F A;  5KAF C;  3DPU A;  4IHV A;  1V5E A;  1F1Z A;  3V7S A;  2VJI A;  2R5Y B;  3LSJ A;  2DTR A;  4QPQ A;  4J19 A;  1MBG A;  2BYV E;  1JHF A;  3GO5 A;  3I0T A;  4UV9 A;  1OCC H;  2QQB A;  1HKQ A;  1X1P A;  4HZF A;  3KP6 A;  4B44 A;  2XAF A;  2JPB A;  2EIL H;  2RAE A;  2HEO A;  3FZV A;  4XLA A;  2R7U A;  4KN4 X;  1XGO A;  4KIT B;  5EYR A;  3PSI A;  2MBF A;  2WY8 Q;  3CMA I;  1JJ8 C;  2DFH A;  4IHX A;  2IRF G;  2RV8 A;  1YLF A;  3FK6 A;  2P6T A;  4KA4 A;  2Z5U A;  2D1H A;  2E1N A;  2B63 J;  5BMZ A;  2QKM B;  2PMH A;  3JCU C;  3BG9 A;  2ELJ A;  1J75 A;  3RKQ A;  2XUB A;  1XDU A;  2W4S A;  1I6H J;  1G3Y A;  4V2F A;  4IRG A;  2ZXJ A;  2O9L A;  2ME0 A;  4M71 A;  1YJN I;  1CQT A;  5DCM B;  3PJR A;  2V26 A;  4ZZD A;  5EG0 B;  4WXD A;  4RGS A;  1XGS A;  4DQ2 A;  3VOE A;  4I98 B;  2D45 A;  4PSX A;  2Y75 A;  2RQP A;  3PO2 J;  3ISP A;  3IUO A;  5KNL A;  2NVY J;  1MDM A;  2E2H J;  2QZ8 A;  5ICE A;  1LDD A;  1U8B A;  3ZMU A;  1SC7 A;  2CW0 F;  3D5S C;  5GAG J;  3TED A;  2OC6 A;  2GWR A;  2W84 A;  1L3L A;  3CUQ C;  4DGW B;  2DPU A;  3ZN1 A;  5D6F A;  3RKY A;  1ZKG A;  4R1H A;  3S2D J;  4YFX F;  4IHW A;  2E1O A;  5GP9 A;  3QYE A;  4BH9 A;  2LH9 A;  1G3W A;  1IRF A;  2Y31 A;  3H3U A;  5HS7 A;  3GVA A;  4XL9 A;  4A6D A;  2I8D A;  3OIP A;  4OIN F;  2STW A;  1IC8 A;  1B9N A;  4PDK A;  3CC7 I;  1ZH5 A;  5K7Z A;  1HOM A;  2WAQ N;  2KRH A;  4XSZ F;  1ZGJ A;  3ONQ A;  3CC2 I;  3M4O J;  3E0J B;  3GXO A;  1D1A A;  2R5Z B;  3AG1 H;  4RDU A;  5D5W B;  1XCB A;  1OMI A;  2H6C A;  3O8H A;  5D4S A;  4D0P A;  4HF2 A;  1BIA A;  1IAW A;  3S3M A;  1LEA A;  1UFM A;  3ASO H;  1XTA A;  1SAX A;  1J9I A;  4AYB A;  2XPU A;  4HBL A;  4A3L J;  3DLA A;  3KYL A;  2GLO A;  2DMQ A;  1POG A;  1SFO J;  3HOU J;  1PP8 F;  4L9N A;  1R58 A;  2XV4 S;  4QTR A;  2W82 A;  3IH2 A;  2HOT A;  4NB5 A;  2EWN A;  3IWF A;  3RKW A;  3GX4 X;  4GFB A;  2EFP A;  2Z2S B;  4UUV A;  2VXZ A;  2CUZ A;  2KIM A;  4E7L A;  1ZK8 A;  2JRT A;  1Y8Q B;  4HLX A;  1MBH A;  3SHF A;  1Q1H A;  2VT2 A;  3T0Y A;  3WGI A;  5AIP A;  3P5J A;  2EV0 A;  1IV6 A;  4YEJ A;  4AIK A;  4BXX J;  1QHG A;  2A07 F;  2DYS H;  2FOK A;  5FLV A;  4DBQ A;  4UY8 I;  1JUS A;  2AS5 F;  1YIO A;  2M4K A;  5JFR A;  5GAD J;  4F52 A;  3MZ8 A;  4X0G A;  3MKY B;  4UNO A;  3RPU A;  2F5D A;  1V54 H;  3LAP A;  1F4K A;  4Z2Y A;  5GAH J;  1K7A A;  2F5V A;  4UV8 A;  5D5X B;  2VBZ A;  5HDK A;  3QOP A;  4LLL A;  1W5S A;  1OLT A;  2CQN A;  3Q5F A;  4PCQ A;  3JSP A;  4NBQ A;  2DCE A;  4C3J J;  1Z9C A;  4OOI A;  1KU3 A;  1RC9 A;  1VQM I;  2CGP A;  2HTS A;  3BG7 A;  2AHQ A;  4GGG A;  1UB9 A;  4XON A;  4AWX B;  1HDD C;  1QVT A;  2PI0 A;  1BR4 A;  2XF7 A;  4M6X A;  5DYM A;  3FIW A;  4Q4Z F;  1S9H A;  2NVX J;  3WTX C;  5D4R A;  3PO3 J;  5EZG A;  3F22 A;  1RRJ A;  2VPR A;  4BKX A;  3LL7 A;  3I3L A;  5FGM A;  3G3Z A;  3FXU A;  4EQQ A;  2HXI A;  3EUH A;  5E20 A;  3RPQ A;  3OIQ A;  3BPX A;  4ZYE A;  5BPD A;  1ACI A;  1U5T B;  4ASN A;  3U1D A;  4J00 A;  4HF1 A;  2E2J J;  1W7P D;  1UZC A;  3WTU C;  3TBI A;  3OIO A;  1P4A A;  2L7M P;  2YR2 A;  3CCL I;  4UB8 C;  1HLV A;  2UWM A;  3O6B B;  2L54 A;  4JP0 A;  3KZI C;  3Q9S A;  5EEG A;  5HDN A;  3S1M J;  1J0R A;  1PJR A;  4BY1 J;  3L00 A;  3PNV A;  1R5I D;  3KZZ A;  2FML A;  3CJQ B;  5J1U A;  1MNM C;  3L2Q A;  4O3M A;  1X1B A;  4A3I J;  3OYM A;  1LB2 A;  2PBI A;  4WK8 F;  4HDU A;  2Y69 H;  2R4G A;  4M3G A;  2HQ5 A;  4A93 J;  4ESJ A;  2Q1Z B;  2XSD C;  2HQR A;  2VQG A;  5BS6 A;  2NOG A;  4HYE A;  2JMW A;  4ABZ A;  2NRA C;  1MGT A;  3F8F A;  4XSX F;  3I59 A;  3OWT A;  2P81 A;  1HW1 A;  2XGC A;  1AKH A;  5FRN A;  1Y6I A;  1YRN A;  5E17 F;  2HKX A;  2X0L A;  4XID A;  2YU9 J;  1U9O A;  3KEY A;  5M3F J;  3BJO A;  4YRV A;  3J7A Y;  3L7W A;  1O7F A;  1K79 A;  4DYC A;  4IKF A;  2VOP A;  2R7X A;  2EZI A;  2FE3 A;  4FIS A;  4NC8 A;  1SFX A;  2GIZ A;  3ZMZ A;  5IP7 J;  3TO6 A;  1K6O A;  2E5N A;  1MBE A;  3IH3 A;  1BBY A;  2HGC A;  2DJN A;  1KQ8 A;  2M5W A;  1T95 A;  1ETK A;  3DBR B;  2FRH A;  4AIH A;  2ZFU A;  1TZL A;  1SMY F;  2CFX A;  4BEH B;  4BQO A;  1BJZ A;  2YPR A;  5F04 A;  3WG9 A;  2L7F P;  1AOY A;  2VQC A;  2QVO A;  3HIF A;  1IXS B;  2QEX I;  1T39 A;  1Z0X A;  5DEQ A;  4CA0 A;  4E7J A;  4M72 A;  2EZH A;  1AU7 A;  1LVK A;  1UCR A;  3I4M J;  4XM3 A;  1Y8R B;  2QCO A;  4MIM A;  3HHH A;  2ELH A;  1OCP A;  3W2A A;  1FOW A;  1W7P B;  2H6B A;  1H8A C;  3I54 A;  1RR8 C;  3JTG A;  4XKV A;  1FPQ A;  5KAI C;  1OCT C;  2EK5 A;  5D5V B;  3LFU A;  5GPA A;  4LOC A;  4AVP A;  5IY5 H;  2YX7 A;  1TC3 C;  3HSE A;  3HKZ A;  1HKS A;  4O6J A;  2IW5 A;  1DUX C;  4XOT A;  3CLO A;  2CQ7 A;  4ITV A;  3G73 A;  2K27 A;  1ZQ3 P;  2DQR A;  3U9G A;  1I50 J;  3AG4 H;  2HU9 A;  4L18 B;  3TW6 A;  2YUS A;  4Y7N J;  1CF7 B;  1JTY A;  1IN8 A;  2WV1 A;  4I76 A;  1BI2 A;  2A3S A;  3PNT A;  4KIC A;  1WJ5 A;  3ZN0 A;  1GV5 A;  4RM2 A;  1ERD A;  2AO9 A;  3VSK A;  4U0V A;  1P7J A;  3K70 D;  2CUF A;  1FTZ A;  1BN5 A;  2ZJQ F;  3RI4 A;  3FHN A;  1O3Q A;  3KE2 A;  2D1V A;  2TRT A;  3GZN B;  5TJJ A;  3UKG A;  1S7E A;  2ZXH A;  1ETW A;  1X1C A;  3DBH B;  4FQG A;  3TMO A;  2CQQ A;  3ZXS A;  1RES A;  2M30 A;  2M34 A;  1GHC A;  1G3T A;  4HDV A;  1N25 A;  3OYH A;  3OYN A;  2DT7 B;  1FIA A;  3PSF A;  2VC1 A;  1XPX A;  2HKO A;  3ERM A;  1JHH A;  5J4Y A;  2OV7 A;  1WCM J;  3FM5 A;  4H4K C;  3GFJ A;  3QU6 A;  3A1Y A;  3K2Z A;  2IS6 A;  3CUO A;  1ZN2 A;  2DOA A;  2EFW A;  4ENJ A;  1K61 A;  1IN7 A;  4IXA A;  3LWF A;  3M8F A;  2H1K A;  2BW3 A;  3HRT A;  2W48 A;  3G1O A;  4IX7 A;  3BQY A;  1KU9 A;  1LVA A;  1QBJ A;  2XAJ A;  1QZY A;  4AYB N;  3HRU A;  3ELK A;  2EFN A;  5LRS A;  4IHS A;  2L9N A;  2IA0 A;  4CYD A;  2R0Q C;  1A04 A;  1BIB A;  2DT6 A;  2MC3 A;  3K4N A;  5HDG A;  1IW7 F;  4IEJ A;  2HQA A;  2PJP A;  2RRE A;  2P7C B;  3JRH A;  4IL6 C;  1BC7 C;  2VE8 A;  4KFC A;  3FIS A;  4S04 A;  3LOC A;  2IGK A;  3C7J A;  2WV0 A;  1EH7 A;  3V4G A;  1OR7 A;  5L3C A;  1ZYR F;  3ECH A;  4HNV A;  4CZC A;  1NTC A;  2XC7 A;  3K70 C;  2CSO A;  3QRF F;  3PQJ A;  1MJB A;  1YS7 A;  2FNP A;  3QOD A;  2EFO A;  2EV5 A;  2A68 F;  2OPT A;  3QPL A;  3CJT B;  4RLQ A;  3BP8 A;  3SEQ A;  4D5F A;  4E70 A;  4ESB A;  2MLK A;  2EJR A;  2DJI A;  2KIF A;  1ZR4 A;  2XGD A;  1W5C C;  4XLH A;  3VDX A;  2NNY A;  4A3J J;  1P92 A;  1Z1D A;  1YE9 A;  1HKT A;  2IJL A;  4IQJ A;  2VAS A;  3I9V 2;  2JUG A;  1ITY A;  3BZK A;  5BPI A;  3BWG A;  2YU3 A;  3LA7 A;  4QLC U;  3ZQL A;  2F4M B;  2A69 F;  4XLF A;  1YFH A;  1OYW A;  3E3V A;  3F23 A;  3JRE A;  2X9D A;  1D8K A;  2W00 A;  2CU7 A;  2XAG A;  2VBY A;  4WX9 A;  4FE4 A;  1V55 H;  3WTZ A;  3E5Q A;  1WJE A;  2GAU A;  4F7Z A;  4F91 B;  1WQ2 A;  2Z3Y A;  1VND A;  4G7O F;  1QRY A;  1FBQ A;  1UHS A;  3QU3 A;  1B59 A;  3HB9 A;  3ASN H;  3M9A A;  2E71 A;  1B6A A;  1N75 A;  1ZRF A;  1JT0 A;  4UUS B;  1RZ4 A;  1FNN A;  5DTD A;  1J5Y A;  2VJJ A;  1TBX A;  1FOY A;  2KPM A;  3IL2 A;  1TP4 A;  1BI1 A;  3SQN A;  5GTI C;  2FX0 A;  1EH8 A;  4FTH A;  2MGQ A;  3RQI A;  3KP4 A;  4A3F J;  2IPQ X;  2FF4 A;  3AFH A;  3DQV C;  4D5C A;  3ZQH A;  3DFG A;  4GDF A;  5F1R A;  3H92 A;  1FOK A;  3BQZ A;  2R92 J;  4CZZ A;  3OS0 A;  3TQN A;  3V8J A;  3H5N A;  2LYC A;  5L3F A;  4MHG A;  5HOO A;  1T08 B;  1MDM B;  1KQ9 A;  1XGN A;  2HOE A;  2HDC A;  3HXL A;  2O3F A;  1TT0 A;  1Y0U A;  4XN0 A;  4ZJZ A;  2TCT A;  4LFU A;  1ZG3 A;  2RDP A;  4HPQ A;  2QUF A;  3LNQ A;  2EZK A;  3OL3 A;  2HDD A;  2CW7 A;  5F0H A;  5GPC A;  2N8G A;  1P4W A;  1D5Y A;  1JI8 A;  3K6G A;  1BI0 A;  4A12 A;  2WC2 A;  5HS9 A;  4MGR A;  4EM2 A;  1QQI A;  2KFD A;  3KEQ A;  1QPI A;  3C2B A;  1DP7 P;  1R1U A;  3HPG A;  3JRI A;  1PP7 U;  5DS9 A;  1MMA A;  3GFL A;  1D5V A;  3HTS B;  2GA1 A;  3K4J A;  2GOM A;  5DDG A;  4BHC A;  4NQW A;  2MSY A;  3R61 A;  4Q48 A;  5HLI A;  1VQ8 I;  2ZC2 A;  5IP6 A;  3P9C A;  1Z7U A;  2QF7 A;  3R6S A;  2FOW A;  4C30 A;  4Y13 A;  1NH3 A;  5C4J J;  2BHY A;  3JRF A;  2EIN H;  4HV6 A;  5ICG A;  4M6V A;  1T8I A;  4CCN A;  2JTV A;  2VE9 A;  3K2A A;  1U6G A;  3VYS B;  1A36 A;  5ICF A;  3BG6 A;  3CO6 C;  2RKH A;  2F5E A;  1DDN A;  4B48 A;  5EGO A;  2J5P A;  2BHZ A;  5FKM A;  2MD5 A;  2B0L A;  3HZJ A;  4OMZ A;  3WU1 B;  2X6O A;  4MTD A;  2LVS A;  4D7M A;  2W7N A;  3JRB A;  1KYZ A;  1ON1 A;  2M2E A;  1NK2 P;  2RQQ A;  1R22 A;  4A3K J;  2DFE A;  1OYI A;  1OYY A;  4E4H A;  1UJ8 A;  1JKP C;  5ILV A;  1G6N A;  4MFE A;  4OWR B;  1OJL A;  2DA7 A;  3N05 A;  1FEX A;  3HRM A;  1Z6R A;  2DK5 A;  2HYJ A;  2OZU A;  1Y1W J;  3B02 A;  1RKW A;  2VL8 A;  3HKZ N;  1OCR H;  2XPV A;  5HLG A;  2MFZ A;  5C4X J;  3LA3 A;  1E3H A;  1BOA A;  2DMU A;  2YS9 A;  4BS9 A;  1B72 B;  2X4H A;  2XRN A;  2CH0 A;  2X6X A;  4UXN A;  4DZJ A;  4DBR A;  1O3T A;  2L5Q A;  1G2H A;  4C9Y A;  1Y56 A;  4BGD A;  1ORK A;  2ZKZ A;  1FBU A;  1ZEL A;  4RAF A;  2DFF A;  2LOO A;  3HOX J;  1SMT A;  1FTT A;  5DD4 A;  3VPR A;  3WTT C;  1X3Z B;  4BDZ A;  5H2F C;  2R7R A;  1S6L A;  2DAO A;  3WOD F;  5K7H A;  3L2R A;  2QQA A;  5LGU A;  3N4M A;  1E0E A;  1NHA A;  1IGN A;  5LHI A;  1IO2 A;  4I7H A;  3PFI A;  4LD5 A;  1YIJ I;  4G9Y A;  5ILS A;  2VI6 A;  4GYG A;  2WA0 A;  1KON A;  4LG3 A;  5DCF A;  1J2X A;  3H9G A;  1YIT I;  3D5R C;  2H8W A;  4CYC B;  3NAR A;  3F6O A;  4EJU A;  4A3E J;  5E8I A;  1IN5 A;  1HW5 A;  1OQY A;  1H9T A;  2HNH A;  4KIS A;  1ETX A;  3AG2 H;  3S1Q J;  1FMW A;  3ABK H;  3CCS I;  4EGZ A;  3NEU A;  2Q0O A;  4QIW N;  1VZ0 A;  5IYC J;  3GLL A;  3K4M A;  1NK3 P;  5KVR A;  3LQR A;  3NWS A;  2VPL A;  4E7Z A;  5E1W A;  2BY1 A;  3FHZ A;  2V1U A;  1A6I A;  9ANT A;  2MH2 A;  3LSM A;  3AKZ A;  1S8N A;  1WH7 A;  3DKX A;  1J09 A;  3KYC B;  4K2E A;  1IRX A;  3QOE A;  1UEL B;  1KZH A;  4F92 B;  2F6C A;  1X19 A;  2E60 A;  3DF8 A;  3IH4 A;  5L3D A;  3A01 B;  3I56 I;  3GFI A;  4LG0 A;  2FD5 A;  2VLA A;  3WG7 H;  1MMG A;  4QWQ A;  1YW9 A;  3ZGK A;  5E79 C;  3T8T A;  1QVU A;  4CDG A;  3JRA A;  1VQK I;  4XOR A;  1MIJ A;  4DYQ A;  3W6J B;  2EV6 A;  3HJE A;  4FX0 A;  3C1D A;  3H5A A;  3ZQF A;  1D8J A;  5B1B H;  2ICW G;  4P5O A;  3J80 Z;  3EPZ A;  1YW7 A;  1BL0 A;  2IP2 A;  5FKO A;  1R4N B;  1F5T A;  4OAZ A;  4QSH A;  2ZFW A;  1YRN B;  3S15 J;  2DA6 A;  1WSU A;  1MKM A;  3A02 A;  1UMQ A;  1ZHF A;  1XB4 A;  4S05 A;  3WU0 A;  2XF5 A;  2LRD A;  4LJZ F;  3SDG A;  4Y33 A;  1W36 D;  1OIS A;  4L5J A;  2QLZ A;  3K4L A;  3FF5 A;  2CV1 A;  1VQO I;  4BBR J;  5CVI A;  3G6E I;  4PGG A;  2GA2 A;  3PIP F;  2LF7 A;  1R1T A;  4RAG A;  4AD9 A;  2P5K A;  3FXR A;  2JA7 J;  4BHP A;  5JVG F;  4LIU A;  2K9M A;  3MCZ A;  3K4K A;  3WE2 A;  3TP3 A;  4AM3 A;  2V9P A;  4MFD A;  2HXO A;  3IKV A;  3CME I;  5EEA A;  3AL0 B;  4TV7 A;  4I6Z A;  1Y1V J;  1TT5 B;  4LK1 F;  4HF0 A;  1U78 A;  3H35 A;  1DPU A;  1YJ9 I;  1SVL A;  5IOZ A;  1ETV A;  3QPT A;  3VYU B;  4IOA F;  3I55 I;  5DD8 A;  4WWC A;  3HOY J;  3M1C A;  3IAM 2;  2XRL A;  3VWB A;  1SD5 A;  1T0F C;  3BZ6 A;  2R7D A;  2GXG A;  3P7N A;  5CKT A;  4AVZ A;  3S3O A;  1XSX A;  3CDI A;  2JVG A;  2P4W A;  1VQ4 I;  1LE8 A;  3CCJ I;  3GF2 A;  2LK2 A;  2PG4 A;  2M8G X;  3S32 A;  3J7Y J;  2XGE A;  1B1B A;  2UXX A;  4GYI A;  2A61 A;  1ZR2 A;  3PFY A;  4A0X A;  1B8I A;  4P55 A;  1EV7 A;  3K10 A;  3DXJ F;  5LEK A;  5CPR B;  3ZQC A;  2E19 A;  1RUN A;  4ESF A;  2ZJ2 A;  3MN2 A;  2FSW A;  1FYL A;  1W36 C;  2XF6 A;  1X3U A;  2WY7 Q;  4IZZ A;  2ESN A;  3HGG A;  3K69 A;  4ZYH A;  2EIJ H;  3VSL A;  1WRJ A;  2XKP A;  1FP1 D;  1IDZ A;  3WU2 C;  1Y0N A;  2VBW A;  3FMR A;  1BW5 A;  2PJR A;  4JOM A;  3D5L A;  2MG4 A;  5KK1 A;  1DU0 A;  2VKE A;  2GIV A;  5JR3 A;  5J6X A;  4CXF A;  4FCY A;  2IT0 A;  4I0B A;  2B7E A;  1X2M A;  1X3W B;  1P6R A;  3FMQ A;  3AAF A;  5FB2 A;  3BY6 A;  5KCM A;  3LST A;  4C3H J;  2EQR A;  2JN6 A;  2VKD A;  3ZQG A;  3PIO F;  3J81 Z;  2XB0 X;  3SXY A;  1D1B A;  3SFI A;  3J80 K;  4YG2 F;  4IO9 F;  3TW7 A;  4G7Z F;  3WGG A;  1YYV A;  1JT6 A;  3JR9 A;  4GCV A;  4BDY A;  2AQF A;  2QBY B;  1VTN C;  2QSG X;  1U5T C;  1TWG J;  4MEX F;  1XN7 A;  2K4J A;  3KP2 A;  5JVT A;  3G2B A;  3F0C A;  4XLN F;  3ROU A;  3KPH A;  2EBI A;  3KEO A;  2V79 A;  3BT9 A;  4PFP A;  1TQP A;  3R60 A;  3M7G A;  3MZH A;  3I4P A;  4XRM A;  2DOE A;  2KZV A;  2DYR H;  2ZBK A;  2ISY A;  3QQA A;  3OSG A;  2OTJ I;  2P5L C;  2HZT A;  1FSH A;  2RNG A;  1H0M A;  2V9K A;  4LGW A;  2HI3 A;  1FT9 A;  2JT1 A;  3CP8 A;  3F21 A;  1LPQ A;  1XMK A;  5EJC A;  3E6B A;  1XMX A;  4BJ5 C;  5K5R A;  4W97 A;  3F6V A;  4IPA A;  2KJB A;  1SD7 A;  5CVR A;  1VQ6 I;  1R6R A;  1AWC A;  2ADU A;  4MQV A;  3RZO J;  3DTE A;  4ZC3 A;  4RAZ A;  1JKQ C;  3IHU A;  4EMS A;  5LEJ A;  1V3F A;  3CF2 A;  4ENM A;  2ZME B;  1GT0 C;  2VON A;  3FDY A;  5B1A H;  2L9R A;  2DPD A;  4N4O B;  2AXT C;  4PGH A;  2IGO A;  4D9J A;  5K1Y A;  2R3S A;  3OL4 A;  3ML6 A;  4UVC A;  3ERE D;  1WGX A;  3RYP A;  4GXO A;  4J01 A;  4A0Y A;  3HUG B;  4CO8 A;  4G94 A;  1XSD A;  1BR1 A;  3T5X A;  2EA2 A;  3B6A A;  3DTK A;  3G1L A;  4L9V A;  3GFM A;  5FRO A;  3ZR8 X;  2R7T A;  2OBP A;  2PMZ A;  5E3M A;  2FQ4 A;  1TTY A;  3TP0 A;  1VI0 A;  1CGP A;  4UVB A;  2NS7 A;  4IHT A;  2CQK A;  1IN4 A;  2JA6 J;  2A6H F;  2X51 A;  1S3J A;  2V4J C;  3V8L A;  2R7Z J;  1WFX A;  5FKK A;  4CCJ A;  1E3O C;  2FQ3 A;  2ISZ A;  5LGN A;  2DN0 A;  3BDD A;  4XLC A;  4BL0 B;  2F4I A;  2X6Y A;  3S3N A;  1KYW A;  3OOP A;  5EG0 A;  3FXQ A;  3I4N J;  5CVV A;  5M3M J;  1N78 A;  1EKE A;  4ZTF A;  2X1E A;  3HRS A;  1HDP A;  4YFK F;  4IOC F;  3CCE I;  1F9N A;  2RVC A;  4XQF A;  2XKO A;  1MSF C;  2KDO A;  4IQ4 A;  3W6V A;  2EZL A;  2JUC A;  3R0A A;  4M3D A;  1S72 I;  1RPW A;  2K9L A;  3E6M A;  1HF0 A;  2GZW A;  2JA8 J;  1JE8 A;  1HC8 A;  1G59 A;  4ETS A;  5LGT A;  1LQ1 A;  3A2K A;  1Z21 A;  1YQA A;  2ZNY A;  4V2G A;  2X48 A;  1W4M A;  2CYY A;  3BCA A;  4FX4 A;  4HST A;  2JJ7 A;  2ZSI B;  3PM1 A;  2R7W A;  4HV5 A;  5C3E J;  1O3R A;  3IRQ A;  1VQ9 I;  2L7K A;  2MD0 A;  4NQW B;  1R1V A;  2M3A A;  2WWY A;  2HYG D;  2DA4 A;  4II3 A;  3V7C A;  4MQ9 F;  3ZCO A;  3F8M A;  1HW2 A;  4A2U A;  2V6E A;  2A6T A;  2HVQ A;  2K4B A;  2A5W A;  3QP5 A;  3F8C A;  3CUQ A;  3SZT A;  3RTR A;  4DOZ A;  4A6E A;  1U0J A;  1KA8 A;  5LHG A;  1L0O C;  3MFK A;  3GTL J;  3OOU A;  1ULY A;  2PQ8 A;  4UB6 C;  5CLS A;  4CIC A;  2E35 A;  4L0Z B;  1PVE A;  5IYB J;  1WI9 A;  5D5U B;  4EVI A;  2IXS A;  2D2W A;  3K4C A;  1G4D A;  4P9F A;  1Z6T A;  1PDN C;  2E2I J;  4B3A A;  3HYI A;  2CUE A;  4BJ6 C;  5A2Q Z;  1IV8 A;  3TKY A;  1T0F A;  3LA2 A;  1LFU P;  4YEL A;  1EF4 A;  4B47 A;  4CHU A;  4PUS A;  2KRF A;  4KT5 C;  2LY9 A;  4FET A;  3RQ4 A;  4RAY A;  5FD5 A;  1K78 A;  3OYF A;  3QPS A;  1MSE C;  1WKM A;  1YX3 A;  3W6K B;  2O61 A;  3VB2 A;  2Q2E A;  1MMN A;  2ACJ A;  4G6Q A;  4Y15 A;  3KYD B;  2E36 A;  3U2R A;  1SD6 A;  4AC0 A;  1J7K A;  1FLI A;  2BOL A;  5LHH A;  1OFC X;  5TRD A;  2W25 A;  3S93 A;  4WXC A;  2BZT A;  5C44 J;  1PUE E;  2BVM A;  2K85 A;  3LMM A;  3S16 J;  5H6Q A;  1SAN A;  4E7K A;  5D8L B;  3QAH A;  1Y39 A;  4OU0 A;  5E1Z B;  5DUK A;  2LBF A;  2QSF X;  1U9N A;  1X1A A;  2KIQ A;  3R4K A;  4HNT A;  4OIP F;  1D0Y A;  2KIS A;  2ECC A;  4EJT A;  1R00 A;  3RYR A;  4HNU A;  3ULQ B;  3S2H J;  3CMM A;  4U7B A;  3FBI B;  3V8K A;  5K5O A;  2KLO A;  2VJ4 A;  4ON0 A;  5K7F A;  3F8B A;  1ZAO A;  2ZXI A;  2EFQ A;  3SZG A;  2KRC A;  3BJA A;  2XVC A;  2MA3 A;  3KLO A;  4ZDP A;  4O5V A;  3G1M A;  2LR8 A;  2ZSH B;  1H88 C;  5F64 A;  4HX7 A;  3LSR A;  2KHM A;  1GV2 A;  1ONV A;  2FXA A;  5AIQ A;  3HOW J;  1TNT A;  4KYW A;  2EPF A;  4RB0 A;  3NAU A;  2V9V A;  1T56 A;  2GBY A;  2Z16 A;  3GCM A;  4NHJ A;  5FJ8 J;  1XX5 A;  3HTU A;  5FLM J;  3UNG C;  3FXO A;  3RDI A;  1SAU A;  1ON2 A;  1QPM A;  2QEN A;  4L9T A;  4JQF A;  3OYC A;  1XC5 A;  3HC7 A;  2VB6 A;  1D0X A;  1YJW I;  2GQQ A;  1X4O A;  3VYT B;  2BE5 F;  2MAB A;  2IAI A;  2QQ8 A;  2BGC A;  4XMY A;  5L3B A;  1GXP A;  3WTV C;  2HPI A;  1P4X A;  3H0G J;  5LBQ A;  3SZP A;  3K4B A;  5F0C A;  4BBS J;  4DIQ A;  4E7H A;  2GOX B;  3EDP A;  5B5E C;  4XKB A;  4A0Z A;  1GDT A;  2Y30 A;  1X4P A;  4RGX A;  2WAD A;  1MBF A;  2JRM A;  2FEZ A;  2L9S A;  4UUT A;  1VFC A;  1RUO A;  6PAX A;  3BTJ A;  4KT6 A;  4MLO A;  4MTE A;  1YHQ I;  2IBD A;  3LSG A;  1REP C;  3PL8 A;  5A2Q K;  2H27 A;  3GLX A;  2O6G E;  4PFO A;  4KNY A;  2IS2 A;  4LMY A;  2Y9Z A;  2E34 A;  1V5G A;  1U8R A;  5FFZ A;  1ETQ A;  4N9I A;  4C2T A;  5FO5 A;  1A6Q A;  3RPU D;  1E3P A;  3OYD A;  3CMY A;  2LD5 A;  2H94 A;  2E1M C;  1OCZ H;  5CQE A;  2FUG 2;  1ZGW A;  2VUM J;  4XOP A;  4IRH A;  3I58 A;  2O03 A;  4RGU A;  2NOJ B;  5ED4 A;  3OYA A;  3UR3 C;  2DI3 A;  3CES A;  3SJM A;  4LB6 B;  3KX2 A;  1T38 A;  2IA2 A;  4BEH A;  2AQE A;  3H1C A;  2PMZ N;  3ZMD A;  5EDN A;  1TL8 A;  1UAA A;  4NC7 A;  4RB1 A;  3DKY A;  2CJJ A;  3CC4 I;  1XG1 A;  2M8E A;  5FKL A;  3WTY C;  3BR2 A;  4M3F A;  4MEY F;  2CMP A;  4HX8 A;  4CUG A;  5JHU A;  2O7O A;  1MJ9 A;  1Z67 A;  2QGU A;  1ENH A;  1YTY A;  2E1M B;  4IVN A;  1VQ7 I;  2HTJ A;  5DUI A;  4HLY A;  2QSH X;  2LF8 A;  1W7P A;  3J7Z I;  4HW0 A;  2UUZ A;  3CJR B;  1ZG5 A;  1IRG A;  4XK4 A;  2K3F A;  1WI3 A;  3GTQ J;  2FNA A;  1FX7 A;  3C3W A;  1OCO H;  5HS8 A;  1U2W A;  4B1R A;  5IPA A;  2KIU A;  1S7A A;  1MW7 A;  1XD7 A;  4IRI A;  4CSW A;  1IXR C;  4KIG A;  2DTZ A;  4I09 A;  2HVS A;  4RB3 C;  4G6T B;  1B8I B;  3OS1 A;  1WJB A;  4P9U A;  3PUB A;  3K0L A;  5LFA A;  1UHM A;  1VQ5 I;  1CF7 A;  3BPV A;  2NAZ A;  1JJ6 C;  3SDB A;  3A03 A;  1LNW A;  3ABU A;  1S29 A;  3GUD A;  2HZD A;  4KIB A;  2KL4 A;  3OYG A;  3BR1 A;  2M7B A;  3Q0U A;  1UG0 A;  5CJ9 A;  5JI6 A;  2E1C A;  2EIK H;  4KIF A;  3P9K A;  1MMS A;  4RBO A;  3SEZ A;  4NUB A;  5J8C A;  1T6S A;  2DOF A;  3PNY A;  1UST A;  2K9Q A;  3I64 A;  4BUP A;  4L9J A;  2C6Y A;  3HEF A;  4XLP F;  1V5F A;  2DK8 A;  2L2O A;  2PX9 A;  2EIM H;  2FMY A;  4B09 A;  3FXL A;  2P8T A;  1BA5 A;  2M7A A;  5HLH A;  1WJF A;  2DXI A;  1ETO A;  2YX4 A;  4M9X A;  3GTK J;  5FLX Z;  3L2V A;  4R8H A;  4Y52 J;  1LJ9 A;  3WHB A;  3GTJ J;  1MNE A;  3S17 J;  1TWF J;  3EUH C;  4PJN A;  1FYK A;  2NS8 A;  4DJA A;  1MH3 A;  4I2O A;  3L2W A;  2L9V A;  3KET A;  1ZRC A;  4P1W A;  1YX5 A;  4OIR F;  1UG2 A;  4HA8 A;  2VQH A;  3V42 A;  4L5I A;  3DU5 A;  1EA3 A;  1BOB A;  2FU4 A;  2LRE A;  3A4C A;  4NDL A;  2ZJP F;  4PJJ A;  4XBF A;  3SFZ A;  2RGV A;  2UXN A;  4D7N A;  2DO7 A;  2PN6 A;  4B3X A;  4YFN F;  4KJZ A;  2OQG A;  4DYR A;  4X6A J;  3BC8 A;  4G8X A;  3DPL C;  1SFU A;  4U0W A;  2CFO A;  2V7F A;  1Z3Y A;  1QGP A;  4G6D A;  5IP9 J;  4I02 A;  1TW2 A;  1PUF A;  1FZP B;  2WTE A;  3L9F A;  2QYO A;  1STZ A;  4QPO A;  3DEW A;  3GYH X;  4XN3 A;  2UZK A;  2BEO A;  1GVJ A;  5FFX A;  1GLN A;  1RIO H;  4BNC A;  4Y3O A;  5IYD J;  2FJ1 A;  2Y9Y A;  4II2 A;  2HOS A;  2FA5 A;  2XPW A;  4XRF A;  1IRZ A;  1TWA J;  3BR3 A;  3MKZ A;  3CDH A;  3CTA A;  2WB1 A;  3LSK A;  5J40 A;  1MMD A;  3EYI A;  3DWL E;  3CD6 I;  4E7S A;  2K02 A;  3CCY A;  2HR3 A;  4YIF A;  3Q0V A;  1BR2 A;  1K83 J;  3RKX A;  3LSI A;  3MQ0 A;  2OJE D;  3MD2 A;  2H8R A;  3ZRG A;  4CCM A;  3H3V K;  2BBY A;  2G9W A;  1DGW Y;  1LKX A;  4N4N B;  2ME6 A;  4AU7 A;  3I59 B;  5E8G A;  5BQT A;  1BW6 A;  1MZB A;  2V1X A;  5ERI A;  4CCO A;  1AKH B;  3GTG J;  1HXD A;  2DLL A;  1LUJ B;  3HOS A;  3IAS 2;  4A3G J;  2W24 A;  3BG3 A;  3F8N A;  1XS9 A;  2GXB A;  3E6C C;  2CW8 A;  3AL0 C;  2W1O A;  4WCG A;  4U7D A;  3I53 A;  3ABT A;  1A31 A;  1FMV A;  4XKC A;  4UUS A;  2K40 A;  3CCR I;  3MZY A;  2HS5 A;  2KT0 A;  4DW6 A;  2ELK A;  2NYX A;  1IG7 A;  2NNN A;  4ZYG A;  3OMY A;  2VN2 A;  3GTP J;  2FBH A;  4H0E A;  3CQZ J;  1T2K A;  1ZLJ A;  3S2W A;  2VT3 A;  4N0B A;  4A3M J;  2XDV A;  4EAT A;  5D8K B;  2HQN A;  1EH6 A;  5FLX K;  3GTO J;  1ETY A;  1O7L A;  1HCR A;  3T8R A;  2Z9O A;  1BJA A;  3N97 A;  3H0D A;  3KP5 A;  4A3C J;  1A5J A;  2WAE A;  4GRI A;  4KDP A;  2K9N A;  3IRR A;  1FP2 A;  4ZDL A;  2QWW A;  3LAJ A;  1SD4 A;  3HOT A;  3G71 I;  2ZXW H;  1OKR A;  4BHB A;  3WGH A;  3OYK A;  1IUF A;  4D1Q A;  2LG4 A;  2O8K A;  1H9G A;  1K4T A;  2M0M A;  1R4M B;  1VQL I;  2J5O A;  4E7I A;  1I39 A;  4ZZL A;  2KMU A;  1IF1 A;  3IC7 A;  4LIV A;  2ECB A;  2G0E A;  2V6C A;  1UHW A;  5TIS C;  2OAZ A;  2IS1 A;  4HEA 2;  3CUQ B;  2M4G A;  2GXA A;  1RI7 A;  2XAS A;  3ABM H;  3HOV J;  1QZE A;  2PEX A;  5E18 F;  4ZYA A;  2WBM A;  1F36 A;  3B6C A;  3FX3 A;  2PLY A;  1FC3 A;  1WPK A;  3C2H A;  1RKT A;  2Z99 A;  2CG4 A;  2KZG A;  3OS2 A;  2ZNZ A;  1EJ9 A;  1QNT A;  3D0S A;  2CO5 A;  1JUM A;  1YI2 I;  2CRG A;  2DA2 A;  2W57 A;  1I5Z A;  3U21 A;  1AHD P;  1QHH D;  3CDL A;  2DQL A;  1GXQ A;  1MD0 A;  4NC6 A;  1ZGA A;  1LDK B;  2VOO A;  4KMU X;  3FBN B;  1RNL A;  3GEZ A;  1HST A;  4JBA A;  2X6W A;  3JTH A;  4JX6 A;  1XGM A;  5E3N A;  1FYM A;  1BC8 C;  4ZDO A;  4EV0 A;  1HBX G;  2VJ5 A;  3GZ5 A;  3TOB A;  5H6R A;  2DMT A;  5GTH C;  2D5V A;  4HG2 A;  4IJA A;  5B66 C;  1K78 B;  3MEX A;  2G7U A;  3ZQ7 A;  3NWT A;  4BE1 A;  1KQ0 A;  2XIG A;  2BW3 B;  3GWZ A;  2Q2E B;  1OR7 C;  4F55 A;  3H9J A;  4RM3 A;  3E97 A;  1WWX A;  2JZY A;  3JRD A;  5CVJ A;  5TGT A;  2KDZ A;  1B72 A;  2CV0 A;  1ZRE A;  2KQR A;  1D3Y A;  3M07 A;  5CYV A;  2CWE A;  2LLK A;  2ZO4 A;  4KMF A;  2R93 J;  1I1S A;  2JSP A;  1I27 A;  2KP6 A;  1B9M A;  4EM0 B;  2M45 A;  3BR5 A;  2E5Z A;  3LSP A;  1P9Q C;  2FBK A;  1NG7 A;  1LDJ A;  3DPT A;  1JGG A;  2LBF B;  1E2X A;  2F4O B;  1JUP A;  3HBL A;  5BNG A;  4EJV A;  3OV8 A;  5ICC A;  1HQC A;  3ESW B;  3CLQ A;  3LSH A;  2COB A;  4Y4R A;  2ZME C;  3ZMV A;  2L4M A;  3R0J A;  3F72 A;  3BR0 A;  1WZ2 A;  1X2N A;  2LFB A;  1DGR M;  3LFK A;  1O57 A;  4RS8 A;  2IGM A;  4Z6Y A;  3E7L A;  3PQK A;  4M3E A;  2L4A A;  4BXU A;  2NVQ J;  4ZH4 F;  4RA2 A;  1SFK A;  1R71 A;  4UVA A;  4LLG F;  1M1E B;  3AG3 H;  3TOA A;  5HOD A;  3IV5 A;  4CYC A;  4E6K G;  3GBG A;  1ZRD A;  2R5Y A;  1Q1V A;  1YO5 C;  2XGX A;  5EEH A;  5HLT A;  1ODD A;  1TNS A;  3ZPL A;  2VIX A;  1KGS A;  1VQN I;  2LP0 A;  4PJ0 C;  3DKW A;  2ETH A;  2R7O A;  3EUK L;  2IA1 A;  1I1G A;  2JVH A;  2MH9 A;  2OCE A;  5JHF A;  1D1C A;  2DA3 A;  3L2U A;  5J8F A;  3JSO A;  2BY2 A;  3QPH A;  2Y0M A;  2K86 A;  3KLN A;  1WVR A;  1IN6 A;  3O8G A;  3VOD A;  5J4V A;  3A01 A;  3M3Y J;  2JWT A;  4BQA A;  1TWC J;  1VF9 A;  3CF5 F;  1R5G A;  2H09 A;  5D6E A;  4XKW A;  2VQL A;  2NVT J;  2ZB9 A;  2O5R A;  1B4A A;  1JTX A;  3HSF A;  3KFW X;  4PZJ A;  3REO A;  3RZD J;  3JW4 A;  3DCF A;  1TQM A;  2LY2 A;  3W2W A;  2YSR A;  1W0U A;  1HA8 A;  1XSV A;  1I3A A;  2QQ9 A;  5DCM A;  5LD2 C;  3Q9V A;  2X85 A;  2V1N A;  2BY0 A;  1LEB A;  1FIP A;  4IF4 A;  2CV2 A;  1R49 A;  5L3G A;  2K5C A;  1K4S A;  4A5M A;  2R7V A;  3J7A O;  1IZ1 A;  2K7L A;  4U0Y A;  3KIO A;  2MLG A;  5CQG A;  1KU7 A;  2E7X A;  1W0T A;  1IUY A;  4YIR X;  3MKW B;  1I3Q J;  2WB1 N;  4X1E A;  4I01 A;  3J81 K;  2L7Z A;  3KP3 A;  2R7Q A;  2Y0S A;  2R7S A;  2XAU A;  4RMN A;  3BR6 A;  2NVU B;  1X1D A;  4XRS G;  3HSR A;  4M3B A;  1YW8 A;  2RNJ A;  2OQR A;  5IT3 A;  4OIQ F;  3OYL A;  2TDX A;  4NNJ A;  1F43 A;  2E7W A;  2ID6 A;  1FOX A;  2UV1 A;  3HHG A;  4BJT A;  3QYF A;  5AON A;  4IHY A;  3DV8 A;  1GUU A;  4JK1 X;  4OAY A;  3LQQ A;  2DMN A;  4CH7 A;  3M8J A;  4FE7 A;  4N9H A;  4B8X A;  4BAC A;  1JKR C;  1DPR A;  2DMP A;  1ZG1 A;  4C2M J;  4B4C A;  2B9S A;  4BE2 A;  2P6S A;  1TLH B;  3B73 A;  4F3Q A;  4AIJ A;  4ENN A;  1P2F A;  2KKO A;  2DDB A;  3M1E A;  3G4S I;  1FJL A;  4LIT A;  5DM6 F;  3DLL F;  1R9T J;  4A3D J;  3VYR B;  2X1D A;  1C0W A;  1Z05 A;  2R5Z A;  4Q47 A;  5M5X J;  5IT9 Z;  3D1N I;  5DM7 F;  1PYV A;  3DEU A;  3F3X A;  4CGZ A;  3CCM I;  3ZOB A;  2O8X A;  2A05 A;  2P7V B;  5B3S H;  4XIC A;  3EUA A;  5EGO B;  3CCU I;  2DOD A;  1S5L C;  5DV5 A;  2LKS A;  4V19 K;  2XSJ C;  1JGS A;  4F93 B;  3X2Q H;  3O3K A;  5F1J A;  2AXL A;  1MBJ A;  3S14 J;  2M9H A;  3L2C A;  4GO1 A;  5H20 A;  4ZTJ A;  4HX4 A;  2JPC A;  1E17 A;  3WTW C;  2I10 A;  2OU2 A;  4LK0 F;  2VKV A;  3BCB A;  3C2G A;  5F6F A;  4S0H B;  3CCQ I;  3ZMS A;  3GME A;  1I6X A;  1R5H A;  3HG9 A;  2F2E A;  4PSW A;  2XAH A;  3BTL A;  1BI3 A;  2MW8 A;  3FXJ A;  4M6Y A;  3WE3 A;  4BQQ A;  2COM A;  3H5R A;  3VFZ A;  5LRR A;  4LLN A;  2V1D A;  2Y2Z A;  3HM5 A;  4FT8 A;  5J3L A;  3H36 A;  5E3O A;  4L0Y B;  1XMA A;  2BY3 A;  3OY9 A;  3DU6 A;  3K9T A;  1O4X A;  4Q5S F;  4M9Z A;  2DA1 A;  2HWV A;  1R36 A;  4Y17 A;  3BJ6 A;  3TDU C;  1AA7 A;  5M5W J;  3BLY A;  2EB7 A;  1Z91 A;  4YII A;  1R23 A;  3Q3S A;  2H1L A;  1G8X A;  4B43 A;  4BU2 A;  1H89 C;  3GTM J;  3H9Q A;  1W5T A;  1QU3 A;  4BE0 A;  4EGY A;  4M73 A;  5FKN A;  4PK4 A;  2QBY A;  2ZCW A;  4AID A;  1R7J A;  2VKH A;  3I5U A;  3V7R A;  2FBI A;  1IJW C;  4KN7 X;  4ZYD A;  3ZQQ A;  2Z33 A;  2VXD A;  4BQN A;  2L3D A;  4I99 C;  2LMD A;  3MAJ A;  2HVR A;  4M74 A;  2HOA A;  2OD5 A;  2BXY A;  1OPC A;  2O0Y A;  5J1Y A;  5KHD A;  4ANJ A;  2LC2 A;  1VQP I;  3TO7 A;  3CJN A;  2JK3 A;  3IWZ A;  1N77 A;  1XCV A;  3W3C A;  2HYF A;  5BOX A;  4JX4 A;  4WF2 A;  2DW4 A;  5M5Y J;  4PJL A;  3K1P A;  2L02 A;  2W85 A;  2QA4 I;  4G7H F;  3BRO A;  3O2P E;  2CS3 A;  1U5T A;  3E5X A;  1WH5 A;  1PUF B;  5F08 A;  4HRI A;  4BY7 J;  4OIO F;  5F0F A;  3TL4 X;  1HSJ A;  1FY7 A;  3Q0W A;  3KZY A;  4CCL A;  2OZ6 A;  4FHT A;  4C3I J;  1USS A;  4RB2 C;  1SEU A;  2OA4 A;  3OYI A;  1MBK A;  3MMY B;  2MYS A;  2LKX A;  3FXM A;  1FBS A;  3QWL A;  4XR6 A;  1ZTR A;  4LG0 B;  1K6Y A;  5GAE J;  5IT9 K;  2ZME A;  3U1K A;  5HNF A;  3ZP5 A;  2VOD A;  3K1N A;  2RC4 A;  2QKL B;  1P7I A;  4A69 C;  4U87 A;  2OCC H;  2G7H A;  1JXS A;  3A0B C;  1J59 A;  3NQO A;  2JQ7 A;  4U88 A;  3OYB A;  4EM1 A;  2Z1D A;  5F27 A;  3HUG A;  3L1P A;  3FMS A;  2EH3 A;  4EJW A;  4M9S A;  5HVQ C;  2HPM A;  2JA2 A;  3K1M A;  5K5Q A;  2DU9 A;  1WJD A;  2F48 A;  1DU6 A;  1TW3 A;  3CO7 C;  2ESH A;  3FXK A;  3DBL B;  1KU2 A;  4HAM A;  3RCO A;  2L0K A;  3OYJ A;  3DEE A;  5EF6 A;  4OMY A;  1BM9 A;  5FD6 A;  2M87 A;  2XHK A;  3H3Z A;  1LFB A;  4ENK A;  3BOQ A;  1GVD A;  4XNF A;  4HOB A;  1FSE A;  4UHT A;  2IVM A;  3FM3 A;  2WAQ A;  2LY1 A;  5E3L A;  1X58 A;  1WJC A;  2LDU A;  5CVU A;  2JA5 J;  3TGN A;  2P5V A;  2LNB A;  3MVP A;  3RIR A;  3IKT A;  3MKL A;  1QZZ A;  2IGN A;  4DZP A;  1YS6 A;  2XAQ A;  3ZMT A;  3M8E A;  2IEK A;  4HSR A;  3WHC A;  2OTL I;  3P9I A;  3A0H C;  3JAM Z;  2VBX A;  3PUF A;  2PMU A;  2K3P A;  2I5U A;  4DNC A;  2CQX A;  1LFP A;  2DA5 A;  2DFI A;  3S1R J;  4R79 A;  4HQE A;  1RET A;  2F5C A;  4G12 A;  1A35 A;  5ILU A;  5IOY A;  3IP4 B;  3S1N J;  3K7A J;  4C2U A;  1YG2 A;  2LSO A;  4MNU A;  1WJA A;  2M1B A;  2BV6 A;  3OYE A;  4KUM A;  1QA6 A;  1Z77 A;  4A3B J;  2ZJR F;  2WAF A;  3CZ6 A;  3C18 A;  1TWH J;  2MC4 A;  3DTI A;  4I0A A;  3BG5 A;  5JLW A;  1LE8 B;  2QM3 A;  3BTI A;  3QP6 A;  3ABL H;  2OUM A;  3BZC A; 
#chains in the Genus database with same CATH homology
 2K40 A;  2H1K A;  1APL C;  2W48 A;  2Y0S N;  2KT0 A;  3G1O A;  3BQY A;  4DW6 A;  3RZO J;  1JKQ C;  2ELK A;  1JKO C;  4AYB N;  1IG7 A;  3JRG A;  2ID3 A;  1GT0 C;  3GTP J;  3CQZ J;  2L9R A;  2R0Q C;  4EEF G;  4A3M J;  3HDD A;  4IEJ A;  4L5E A;  3GTO J;  1ETY A;  1HCR A;  4AUX A;  2K9S A;  3JRH A;  1WGX A;  5EZH A;  4JX5 A;  4A3C J;  1A5J A;  3FIS A;  4XRS A;  3LOC A;  2K9N A;  3B6A A;  3G1L A;  3BTC A;  5E3M A;  4HNV A;  2FQ4 A;  3TP0 A;  1VI0 A;  1NTC A;  2O8K A;  3HGY A;  1IUF A;  2NS7 A;  2JA6 J;  3ZQI A;  1IDY A;  2R7Z J;  5FKK A;  2M0C A;  2OPT A;  3QPL A;  1E3O C;  2DN0 A;  5J1R A;  4D5F A;  4MO7 A;  2ECB A;  2G0E A;  5EG0 A;  1ZR4 A;  3JRC A;  3I4N J;  2XGD A;  5M3M J;  1RR7 A;  4A3J J;  3HOV J;  3OSF A;  4JYK A;  5JLX A;  1ITY A;  1HDP A;  3FKI J;  1F36 A;  3B6C A;  2XB5 A;  1WPK A;  3ZQL A;  1RKT A;  1T33 A;  1MSF C;  1JUM A;  3HOZ J;  2CRG A;  2DA2 A;  3JRE A;  2X9D A;  1MH4 A;  4W1U A;  2LTP A;  1AHD P;  3W6V A;  3FK7 A;  2CU7 A;  2GM4 A;  3CDL A;  2EZL A;  4FE4 A;  4M3D A;  1RPW A;  2OF7 A;  1HF0 A;  1VND A;  2JA8 J;  1QRY A;  4JX6 A;  5E3N A;  1UHS A;  4V2G A;  2X48 A;  3HB9 A;  2DMT A;  2D5V A;  2JJ7 A;  3PM1 A;  4UUS B;  1JT0 A;  5C3E J;  5DTD A;  4IHV A;  2R5Y B;  2DA4 A;  3LSJ A;  2FX0 A;  4J19 A;  4FTH A;  2MGQ A;  3RQI A;  1MBG A;  4A3F J;  4D5C A;  3ZQH A;  3JRD A;  2KDZ A;  3BQZ A;  1B72 A;  2R92 J;  3GTL J;  3OOU A;  2LLK A;  2R93 J;  2RAE A;  2TCT A;  5IYB J;  3LNQ A;  2EZK A;  2HDD A;  3BR5 A;  3LSP A;  5EYR A;  5F0H A;  5GPC A;  1JGG A;  2N8G A;  1JJ8 C;  3HBL A;  1JUP A;  5BNG A;  4IHX A;  1D5Y A;  2E2I J;  2COB A;  3FK6 A;  4B3A A;  2CUE A;  3BR0 A;  2B63 J;  1QPI A;  1X2N A;  3C2B A;  3JRI A;  3BG9 A;  2LFB A;  5DS9 A;  3RKQ A;  1LFU P;  1EF4 A;  2LY9 A;  1I6H J;  3E7L A;  4M3E A;  4V2F A;  2O9L A;  2NVQ J;  2ME0 A;  3QPS A;  1MSE C;  1CQT A;  2MSY A;  5HOD A;  3IV5 A;  4CYC A;  3GBG A;  2R5Y A;  1Q1V A;  5IP6 A;  5EG0 B;  2QF7 A;  5C4J J;  2LP0 A;  3JRF A;  3PO2 J;  4AC0 A;  4M6V A;  2NVY J;  1OFC X;  2E2H J;  2DA3 A;  3K2A A;  5C44 J;  1U8B A;  3S16 J;  1SAN A;  5EGO A;  3TED A;  5FKM A;  3O8G A;  1U9N A;  3A01 A;  3M3Y J;  2JWT A;  1TWC J;  1VF9 A;  2ECC A;  2X6O A;  2LVS A;  1ZKG A;  4D7M A;  3S2D J;  4IHW A;  2E1O A;  5GP9 A;  2NVT J;  3JRB A;  2ZB9 A;  3S2H J;  2Y31 A;  1JTX A;  2M2E A;  1NK2 P;  4A3K J;  3RZD J;  1JKP C;  4MFE A;  1FEX A;  1OJL A;  2DA7 A;  3DCF A;  5K7F A;  1W0U A;  1IC8 A;  2HYJ A;  1Y1W J;  1FIP A;  1RKW A;  3HKZ N;  5K7Z A;  1HOM A;  2XPV A;  2WAQ N;  5C4X J;  3G1M A;  2LR8 A;  1H88 C;  2DMU A;  2YS9 A;  3M4O J;  3LSR A;  1B72 B;  2R5Z B;  1GV2 A;  4RDU A;  1W0T A;  3HOW J;  4DZJ A;  3O8H A;  1I3Q J;  2WB1 N;  3NAU A;  4X1E A;  1T56 A;  2GBY A;  2L7Z A;  1G2H A;  5FJ8 J;  1ORK A;  5FLM J;  4XRS G;  3BR6 A;  3HOX J;  1FTT A;  4M3B A;  2XPU A;  1XC5 A;  3VPR A;  4A3L J;  2GLO A;  2DMQ A;  5K7H A;  1F43 A;  1POG A;  2ID6 A;  1SFO J;  3HOU J;  2IAI A;  1IGN A;  4QTR A;  4IHY A;  3IH2 A;  1GUU A;  2HOT A;  4GFB A;  2DMN A;  3H0G J;  5F0C A;  2VI6 A;  4BBS J;  4FE7 A;  1JKR C;  1ZK8 A;  2DMP A;  4C2M J;  1MBH A;  1GDT A;  4B4C A;  2Y30 A;  4CYC B;  3NAR A;  1MBF A;  4A3E J;  4UUT A;  1VFC A;  1IV6 A;  1FJL A;  3BTJ A;  4MLO A;  1ETX A;  2IBD A;  3LSG A;  1R9T J;  3S1Q J;  4A3D J;  4BXX J;  5FLV A;  2R5Z A;  2Y9Z A;  4QIW N;  1JUS A;  5M5X J;  5IYC J;  1ETQ A;  3D1N I;  1NK3 P;  3ZOB A;  1A6I A;  9ANT A;  4XIC A;  3CMY A;  5EGO B;  2LD5 A;  1WH7 A;  3IH4 A;  3A01 B;  1ZGW A;  2VUM J;  5F1J A;  1MBJ A;  4C3J J;  2FD5 A;  3S14 J;  2M9H A;  3SJM A;  3JRA A;  2AHQ A;  1QVU A;  2PMZ N;  1HDD C;  1QVT A;  5EDN A;  2I10 A;  4DYQ A;  2VKV A;  3FIW A;  2CJJ A;  1XG1 A;  5FKL A;  2NVX J;  4S0H B;  3BR2 A;  4M3F A;  3ZQF A;  2O7O A;  3PO3 J;  1ENH A;  3BTL A;  1BL0 A;  2MW8 A;  5EZG A;  5FKO A;  2VPR A;  4BKX A;  3HM5 A;  2Y2Z A;  5J3L A;  5E3O A;  4QSH A;  1YRN B;  2HXI A;  3S15 J;  2DA6 A;  1O4X A;  3A02 A;  1UMQ A;  2DA1 A;  4XK4 A;  2E2J J;  1WI3 A;  3GTQ J;  3SDG A;  5M5W J;  3OIO A;  3Q3S A;  4B1R A;  5IPA A;  2L7M P;  1HLV A;  4BBR J;  4JP0 A;  1H89 C;  3GTM J;  3S1M J;  2DTZ A;  1B8I B;  4BY1 J;  5FKN A;  5J1U A;  1MNM C;  2JA7 J;  1JJ6 C;  1IJW C;  3TP3 A;  4A3I J;  3A03 A;  4MFD A;  2HXO A;  5EEA A;  4M3G A;  2HQ5 A;  2HOA A;  4I6Z A;  4A93 J;  1Y1V J;  2XSD C;  3BR1 A;  3Q0U A;  5J1Y A;  2NOG A;  1U78 A;  2JMW A;  4ABZ A;  5IOZ A;  4RBO A;  1ETV A;  2JK3 A;  4JX4 A;  2P81 A;  5M5Y J;  3HOY J;  2XGC A;  1AKH A;  2XRL A;  2K9Q A;  1YRN A;  3HEF A;  4XID A;  2YU9 J;  1WH5 A;  1PUF B;  1U9O A;  5M3F J;  5F08 A;  4BY7 J;  1LE8 A;  5F0F A;  4DYC A;  1BA5 A;  2LK2 A;  3Q0W A;  1ETO A;  2M8G X;  3GTK J;  2EZI A;  2XGE A;  4FIS A;  5IP7 J;  4Y52 J;  4C3I J;  3WHB A;  1ZR2 A;  3GTJ J;  1B8I A;  1MBK A;  3S17 J;  1TWF J;  2LKX A;  1MBE A;  3IH3 A;  3ZQC A;  2E19 A;  2DJN A;  2NS8 A;  1ZTR A;  1MH3 A;  3MN2 A;  1ETK A;  3HGG A;  1UG2 A;  1BJZ A;  1P7I A;  5F04 A;  2L7F P;  4NDL A;  1IDZ A;  4A69 C;  4D7N A;  1Z0X A;  5F27 A;  1BW5 A;  3L1P A;  2EH3 A;  2EZH A;  1AU7 A;  4DYR A;  4X6A J;  3I4M J;  2MG4 A;  1DU0 A;  2QCO A;  2VKE A;  1DU6 A;  4MIM A;  4FCY A;  1OCP A;  1X2M A;  5IP9 J;  2L0K A;  1H8A C;  1PUF A;  5EF6 A;  4C3H J;  2EQR A;  1OCT C;  3DEW A;  2JN6 A;  3ZQG A;  5GPA A;  4LOC A;  1LFB A;  2XB0 X;  1TC3 C;  1GVD A;  3SFI A;  5E3L A;  3TW7 A;  1X58 A;  2JA5 J;  5IYD J;  2FJ1 A;  2Y9Y A;  2HOS A;  3MVP A;  1ZQ3 P;  2XPW A;  1JT6 A;  1IRZ A;  3JR9 A;  1TWA J;  3MKL A;  1I50 J;  3BR3 A;  4DZP A;  3TW6 A;  1TWG J;  2YUS A;  2IEK A;  3WHC A;  4Y7N J;  1JTY A;  3CCY A;  2WV1 A;  4I76 A;  3F0C A;  3Q0V A;  2EBI A;  1GV5 A;  1K83 J;  2AO9 A;  1P7J A;  2CQX A;  2H8R A;  3BT9 A;  2DA5 A;  3S1R J;  3H3V K;  2CUF A;  1RET A;  1FTZ A;  4G12 A;  4XRM A;  2ME6 A;  5IOY A;  3S1N J;  3QQA A;  2TRT A;  3K7A J;  3UKG A;  3OSG A;  1S7E A;  1ETW A;  1BW6 A;  2CQQ A;  1AKH B;  1RES A;  3GTG J;  2M34 A;  1Z77 A;  4A3B J;  2HI3 A;  4A3G J;  1FIA A;  1TWH J;  3BG3 A;  1XS9 A;  1WCM J;  3BG5 A;  5JLW A;  1LE8 B;  4W97 A;  3BTI A;  1K61 A;  4UUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...