2M2EA

Solution nmr structure of the sant domain of human dnajc2, northeast structural genomics consortium target hr8254a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
71
structure length
71
Chain Sequence
b'FTPWTTEEQKLLEQALKTYPVNTPERWKKIAEAVPGRTKKDCMKRYKELVEMVKAKKAAQEQVLNASRAKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DnaJ homolog subfamily C member 2
publication title NMR solution structure of the SANT domain of human DnaJC2.
rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 21
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2m2eA00
2JWTA 1B72A 1ETWA 1JUPA 5EZGA 2VUMJ 1U78A 1SANA 1JJ6C 2I10A 3BR6A 5EDNA 4XRSG 3HEFA 4BBRJ 3VPRA 4A3EJ 5EEAA 3S2DJ 1I6HJ 1H8AC 4M3DA 5DS9A 4Y7NJ 1WH5A 3TP3A 4A69C 4M3FA 2HI3A 5F0CA 2EZHA 4AC0A 3Q3SA 1MH4A 1WI3A 2ELKA 3UKGA 4C3HJ 3OSFA 2KT0A 4FCYA 3HBLA 2NVXJ 3GTKJ 3WHBA 2Y0SN 5F0FA 2W48A 1FTTA 2L7ZA 3BTCA 4UUSB 5IYBJ 4JX6A 3JREA 2K9QA 1A5JA 1H89C 4L5EA 1DU6A 3Q0WA 1MBFA 1TWFJ 3ZQHA 1PUFB 1AHDP 1Z77A 1WGXA 3QPLA 4MLOA 2JA8J 2XPVA 1Y1WJ 3C2BA 1T33A 2L7FP 3ZQLA 2AHQA 3TW6A 1E3OC 3E7LA 2E2IJ 1TWHJ 3RZDJ 5F0HA 3GTJJ 3OIOA 1JKPC 2XPWA 3HGGA 2JA6J 2R5YB 1ZKGA 2M0CA 2ID3A 1F43A 2O9LA 4A3KJ 1MBGA 1VNDA 4JX4A 2ME0A 2HXIA 2XGEA 1JT6A 3BTJA 2IAIA 2TCTA 3HGYA 3HOXJ 5F27A 3S16J 2JK3A 1NK2P 2DA7A 3Q0UA 4A3FJ 4A3DJ 4GFBA 5E3MA 1O4XA 5IPAA 1MBHA 5IOYA 3CMYA 2XGDA 5J1RA 1LE8B 3BR3A 1Y1VJ 5EGOB 5E3OA 3ZQGA 3I4NJ 2X9DA 1OFCX 3G1LA 4FE4A 1Z0XA 3L1PA 3BG3A 2RAEA 5JLWA 1G2HA 1TWGJ 1ETXA 2XRLA 1S7EA 1X58A 4V2FA 5FJ8J 4MFEA 1LFBA 2R0QC 2E1OA 1AKHB 4C3JJ 2YU9J 1HDDC 4MFDA 4D5CA 2Y9YA 1IG7A 2HXOA 2NS7A 2DA1A 1GT0C 5EYRA 5BNGA 1GUUA 1APLC 2XB0X 2LTPA 3HM5A 3JRGA 3M3YJ 3I4MJ 1B72B 2DTZA 3JRIA 1ETOA 3CCYA 4FISA 3JRAA 1WCMJ 3DCFA 3MKLA 3LSRA 4JX5A 2LKXA 4D5FA 1T56A 3S2HJ 4B4CA 3HDDA 4X6AJ 2H8RA 1K61A 1GV5A 5FKNA 1HDPA 1F36A 1AU7A 3IV5A 1OJLA 2K9NA 2X48A 5M5YJ 2VI6A 4CYCA 2WV1A 1P7IA 3BR5A 1X2MA 4A3BJ 4I6ZA 3LSPA 3S1RJ 2LD5A 5EG0A 1TWAJ 3S14J 3JR9A 5C4XJ 1H88C 1ZTRA 3FK6A 5JLXA 4A3LJ 5IOZA 3CQZJ 4NDLA 4BKXA 5F08A 3GTPJ 4A3GJ 1IUFA 3ZQFA 4JP0A 2EQRA 2N8GA 2PMZN 5K7FA 3SJMA 1RETA 3BTLA 4EEFG 2HOTA 3H3VK 3MVPA 3IH4A 5M3MJ 3RQIA 5IYCJ 3RZOJ 3G1OA 1IDYA 5EZHA 3ZQCA 1MH3A 4D7MA 2H1KA 3GTQJ 2QF7A 2DN0A 1K83J 2JA5J 2DMPA 2CRGA 1TWCJ 2JN6A 5K7ZA 1U9OA 5FKLA 5GPAA 2WB1N 4IHWA 3JRBA 3K2AA 2EZLA 1ORKA 4DYRA 3LSJA 4BBSJ 1A6IA 2L9RA 3BR2A 5K7HA 2XPUA 3G1MA 1MNMC 2LVSA 3ZOBA 3S17J 2VPRA 2Y2ZA 2DJNA 1IGNA 1SFOJ 2EZIA 4XICA 1B8IA 1ETVA 4RBOA 1MBJA 1IC8A 1JJ8C 3HOWJ 1JKOC 4BY7J 4DYQA 1IJWC 3HOZJ 2HDDA 2JMWA 2FX0A 1IRZA 2E19A 3OSGA 4JYKA 2NOGA 3O8GA 1VF9A 1MBEA 2LY9A 2ZB9A 3H0GJ 5FKOA 5FKMA 3A01A 2K40A 2K9SA 3GTLJ 1JTYA 1FJLA 3JRDA 3TEDA 1HOMA 2WAQN 1UG2A 1MSEC 2HOSA 2P81A 3S1QJ 3HB9A 2MGQA 2DA4A 1GV2A 5E3LA 2DMUA 4XIDA 3HOUJ 3PO2J 3GTGJ 1ETKA 2CUFA 2IBDA 3B6CA 2NVQJ 1FIAA 1ENHA 3TW7A 2CJJA 1LFUP 5J1UA 3PO3J 1QVTA 2COBA 2X6OA 3S1MJ 2HOAA 5C44J 2MG4A 2DMTA 2Y9ZA 2Y31A 2LLKA 1BL0A 2VKEA 3F0CA 2XGCA 5EF6A 2JA7J 4B1RA 3BQZA 4W1UA 3MN2A 3SDGA 3BTIA 5GPCA 1XS9A 3GBGA 3BR1A 3LSGA 4CYCB 2ECCA 1FEXA 4BXXJ 1JUMA 4UUTA 2KDZA 3FISA 3FIWA 5EG0B 2OF7A 2EBIA 3JRFA 4DW6A 1OCTC 4FTHA 1HLVA 2DA6A 3HKZN 3NARA 2R5ZA 4X1EA 4A3IJ 4M3GA 1W0TA 4B3AA 1U9NA 3IH3A 2M8GX 1YRNA 2FJ1A 2ID6A 4QTRA 5C4JJ 1U8BA 4C3IJ 4G12A 5F04A 2OPTA 3OOUA 4MIMA 2ME6A 3A03A 2GM4A 2L0KA 4S0HB 2CU7A 4M3EA 3JRHA 2NS8A 5IP9J 5FKKA 2CQQA 5M3FJ 3ZQIA 5C3EJ 4IHVA 1RR7A 2CUEA 2E2HJ 5J3LA 1ETYA 2JJ7A 3BT9A 3DEWA 3SFIA 2EZKA 5FLMJ 1ETQA 2L7MP 2MW8A 5DTDA 2CQXA 1B8IB 3HOYJ 2M34A 3WHCA 1MBKA 1UMQA 4HNVA 3Q0VA 3B6AA 3BR0A 4DZPA 3K7AJ 1BW6A 2TRTA 2FQ4A 1JT0A 3FKIJ 2DA3A 1XG1A 1JKQC 1RKTA 2FD5A 2MSYA 1POGA 3A01B 4AYBN 5M5XJ 4Y52J 2LP0A 2XB5A 4QIWN 4I76A 3IH2A 3LOCA 2M2EA 3QQAA 1Q1VA 3D1NI 4XK4A 1XC5A 4C2MJ 1HF0A 1R9TJ 1WH7A 3M4OJ 1ZK8A 2LK2A 2HYJA 1JUSA 1TC3C 2DA5A 2IEKA 1VFCA 4M6VA 5HODA 4UUSA 4BY1J 2R92J 3TP0A 4A3MJ 4QSHA 1OCPA 3GTOJ 1PUFA 1P7JA 2NVTJ 1QPIA 4A3CJ 1UHSA 1X2NA 5E3NA 2VKVA 2LFBA 2LR8A 3RKQA 4AUXA 2YS9A 1WPKA 2HQ5A 4LOCA 3FK7A 2Y30A 5IP7J 1ITYA 2E2JJ 2M9HA 3BQYA 4V2GA 2NVYJ 1JGGA 5IP6A 3NAUA 4ABZA 2R5YA 2YUSA 1D5YA 1GDTA 1GVDA 1IDZA 1JKRC 4XRMA 4IHXA 9ANTA 5IYDJ 4A3JJ 1DU0A 2B63J 2GBYA 5M5WJ 1BJZA 1QRYA 2R5ZB 4J19A 3W6VA 4IEJA 1ZQ3P 1RESA 2O7OA 2G0EA 4DYCA 4D7NA 1NTCA 3HOVJ 2XSDC 1MSFC 2R7ZJ 3CDLA 2DA2A 1NK3P 1YRNB 1LE8A 3S1NJ 3LNQA 1FIPA 4FE7A 5EGOA 1HCRA 1I3QJ 2EH3A 1FTZA 4MO7A 4DZJA 1JTXA 4A93J 1IV6A 1QVUA 3QPSA 4XRSA 5GP9A 1I50J 2DMQA 5F1JA 1W0UA 1CQTA 4IHYA 2D5VA 2ECBA 2DMNA 1BW5A 1EF4A 1BA5A 3BG9A 2QCOA 5FLVA 1ZR4A 1AKHA 4RDUA 1ZR2A 4M3BA 1RKWA 1RPWA 3A02A 1VI0A 1ZGWA 4W97A 5J1YA 2O8KA 2AO9A 3BG5A 3JRCA 3PM1A 3O8HA 3S15J 3GTMJ 2GLOA 2R93J
chains in the Genus database with same CATH superfamily
3DTKA 4LK0F 2LNBA 4I7HA 3L00A 1JUPA 5BPIA 3CCLI 3LFKA 4KIBA 5GAHJ 2DOFA 2BE5F 5IY5H 3DP7A 2EFQA 2GXAA 1J09A 4M9ZA 5EEGA 5DS9A 4PSWA 4XBFA 1WH5A 4XKWA 4O5VA 2FE3A 2CFOA 5A2QK 2IGKA 1BR2A 1QBJA 2NVUB 4E7SA 4AIJA 3I58A 4DGWB 4FX4A 3ERMA 2DO7A 2HS5A 4A5NA 4Y4RA 3E6BA 4QWQA 2WC2A 1REPC 4L5EA 2BGCA 2OCCH 4E7ZA 2Z16A 2I8DA 1N78A 1OQYA 2LKSA 4XONA 2CUJA 1PUFB 3ZQHA 1AHDP 2VJ4A 4KICA 2JA8J 2F4MB 1B1BA 2P7VB 2EFPA 3QODA 2M4KA 4ZJZA 4GO1A 1LVKA 2ZJPF 2AHQA 3ZQLA 2PQ8A 3E7LA 2XKPA 3V7CA 3CCRI 2E2IJ 4BE1A 3GWZA 4M6XA 3HGGA 1K6OA 1W1WE 1FPQA 3BZKA 2XVCA 4CO8A 1SFXA 1F43A 3DEEA 4A3KJ 1UZCA 1HW5A 4IX7A 1FOYA 2XGEA 3N05A 5JR3A 3MEXA 4I99C 4IL6C 1YTYA 1JT6A 3CP8A 4KT5C 2TCTA 3CCJI 3HOXJ 3RPUA 1TW3A 2JK3A 2R7QA 1DUXC 3Q0UA 1ZREA 3W2VA 4PSXA 2V7FA 5IPAA 2D1HA 1MBHA 1SAXA 4RGUA 4B3XA 5JHFA 2XC7A 1U8RA 4NC8A 1ZG1A 1WRJA 4LMYA 1Y1VJ 5EGOB 3I4PA 1LQ1A 3CJQB 4BQNA 2DJIA 1LDKB 2FBIA 2QZ8A 2RAEA 4H0EA 2DBBA 5JLWA 4OU0A 1TWGJ 1VQ7I 1G2HA 2XRLA 2A5WA 3ABLH 4V2FA 1F5TA 2F6CA 4U0WA 2R7OA 3DLLF 2LF7A 2GIZA 2M7AA 2KKOA 4C3JJ 2D2WA 2IGOA 2HU9A 1RR8C 2HDCA 1YOVB 4UVCA 2FNPA 3K70D 1GT0C 4MEXF 3C7JA 2XB0X 2H94A 2Q1ZB 3CLOA 2L02A 3HM5A 3P9KA 3SEQA 1G3TA 3JRGA 3LAPA 3I4MJ 1A31A 3JRIA 3OYDA 3CCYA 4M72A 1WJEA 3K4CA 4EV0A 1W36D 1K6YA 1GHCA 4YELA 2DYRH 3MKLA 1ZLJA 3WE2A 2E34A 4JX5A 2CFXA 3H5AA 3VWBA 2DFFA 3HDDA 1R6RA 2H8RA 5LD2C 1TQPA 4G8XA 2HQNA 5DCMA 2VC0A 1D1AA 2X48A 5M5YJ 4M74A 3HTUA 4RA2A 4CYCA 1O7FA 1MJBA 3H9QA 3CMEI 2QUFA 1R23A 4B47A 4I6ZA 1HC8A 4M9XA 3TL4X 1MMSA 3F8FA 3CO7C 3FK6A 5JLXA 5L3BA 1UCRA 3GZNB 2STWA 1IN8A 2IXSA 3VSKA 4HLYA 1IUFA 2OTJI 4RLFA 1TL8A 2N8GA 2Q2EA 2PMZN 3K4MA 4A6DA 3HXLA 1RETA 2HOTA 3H3VK 3MVPA 5D4RA 5M3MJ 1ZG3A 2F2EA 3RQIA 2W82A 3F9KA 2XROA 3OYNA 4KJZA 2CGPA 4YRVA 2QF7A 1K83J 2JA5J 4UB8C 5E8IA 4F52A 4XLPF 5K7ZA 5LGTA 2PEXA 4XLFA 1U9OA 1QO0D 4Z2YA 3OYJA 3WGHA 2O6GE 2Q8KA 2UZKA 4RB1A 5E20A 5K7HA 1X1PA 3OR1C 3G1MA 2LVSA 2P0WA 4ZDLA 3ZOBA 4KITB 3H9GA 2DJNA 1PP8F 2VXDA 3TDUC 1IGNA 2JRMA 3H5NA 3CC2I 3IUOA 1X3WB 1MBJA 2FNAA 4RBOA 4ZTJA 2QSGX 3R60A 3HOWJ 1JKOC 4BY7J 2CH0A 3R4KA 2DI3A 1IRZA 4EGZA 3OSGA 2VBXA 1J75A 1SFEA 3O8GA 1SVMA 2ZB9A 3J81K 1BC7C 4L0YB 1U5TA 4GDFA 3Q9SA 4FHTA 5ILUA 2K40A 4XSXF 2M7BA 3OYAA 4CCNA 1XGSA 1FJLA 4PFPA 3TEDA 3PJRA 4CYDA 1S3JA 1KU9A 2P81A 2HOSA 3S1QJ 1YITI 5AONA 2K5CA 1E2XA 3HB9A 4XOPA 5FGMA 2MGQA 3NWSA 1GV2A 2IVMA 2ZXJA 2OC6A 1XGOA 3HG9A 5ERIA 3S2WA 1PYVA 1E17A 4MEYF 1Z67A 4FETA 1ZG5A 3L2QA 1XTAA 2QVOA 1YS6A 4LGWA 1MMNA 2BBYA 3I71A 3LAJA 2RKHA 2BV6A 5DM7F 3DQVC 4HV5A 3D5RC 3ZMZA 3S1MJ 2Y9ZA 2EIKH 5HS9A 2XGCA 2ESHA 1NH3A 4KN7X 1M1EB 3MN2A 2DFIA 3SDGA 4E7KA 3FHNA 5DCMB 3L2VA 4CYCB 5HDKA 4IHTA 1FEXA 1WKMA 5D6FA 4XQFA 1B59A 3F23A 3A1YA 4OAZA 4XKCA 4PGGA 4I09A 2LG4A 3GFMA 3JTGA 4ZDOA 3JRFA 1O57A 1OCTC 3ECOA 3OMYA 4DNCA 1OCRH 1MJ9A 2QLZA 3K1MA 1S5LC 3RSNA 4A3IJ 1Y0UA 3KP3A 1W4MA 5E17F 2AS5F 2ZMEC 5GAGJ 2D1VA 2VIXA 3P9CA 2OZUA 2PMHA 2Q2EB 4BHCA 1FYLA 1HKTA 2M8GX 3S3MA 1V3FA 2FJ1A 3WGGA 4OMYA 3KFWX 2RDPA 3X2QH 3I59A 5F04A 2OPTA 1Q1HA 5LGUA 3IC7A 5CVUA 1W5CC 3O6BB 2GM4A 2MD0A 1R5ID 2YX7A 5FLXZ 4S0HB 2K27A 3HKZA 3HOSA 2CQQA 4EJUA 2DCEA 4LB6B 4IHSA 4HDUA 3LSMA 4LB5A 1JHHA 2H1LA 3PSIA 2WY7Q 4IHVA 3KZIC 4MQVA 2CUEA 2E2HJ 2Y69H 2X1EA 1MDMA 3TMOA 3Q5FA 5LRSA 1BR1A 4A12A 1ZAOA 3DEWA 3BJ6A 5LHGA 3QU3A 3SFIA 1TT5B 3FXKA 2EZKA 3B02A 1T08B 2K4JA 3AG3H 2M34A 4L9VA 1L3LA 1EH7A 3CUQA 4RB3C 5L3CA 3Q0VA 3IWFA 4DZPA 3SZGA 3K7AJ 2VLAA 4U0VA 1D3YA 1JT0A 1FY7A 4PJNA 3G71I 1U5TB 3LFUA 4FT8A 5JVGF 3PIOF 1RKTA 1Z7LA 2MSYA 5CKTA 3ABMH 4EMSA 1QPMA 4RM3A 5M5XJ 4Y52J 5FLXK 1R00A 2HOEA 4LITA 5ICCA 3ZN0A 2CMPA 4B43A 3D1NI 1XC5A 4RLQA 4C2MJ 3W2WA 1J59A 3KYCB 1TP4A 2MABA 1ZK8A 2Y0MA 1K4TA 2HYJA 3FMSA 4BE0A 4BY1J 4IJAA 1EKEA 3LWFA 2J5PA 2X85A 2BZTA 3BPVA 1K78A 3U1DA 2L3DA 5FROA 2COMA 3BJOA 1R4MB 3CZ6A 3UNGC 3U9GA 5HOOA 1QPIA 1UHSA 3D5LA 3DPTA 3H9JA 1F9NA 2G7UA 2V9VA 4XR6A 1ZRCA 3F8CA 3KX2A 1J7KA 3O2PE 3CJNA 2XIGA 1JGSA 2YS9A 1WPKA 2E5ZA 4LOCA 2Y30A 2VBWA 1ITYA 3EYYA 3DBLB 4ZDPA 2MD5A 1VQLI 2NVYJ 3S3NA 1JGGA 2H8WA 5IP6A 2MYSA 3NAUA 4ZZLA 2K85A 4ABZA 2CQNA 1SC7A 2R5YA 1UHWA 4JK1X 3CC7I 2WTEA 1D5YA 3FM3A 1IDZA 1JKRC 1S8NA 4IHXA 3VYTB 4XLHA 4BH9A 2XAUA 4YFKF 2KRCA 5TJJA 1DU0A 4XL9A 4ZYGA 1SD7A 2WAEA 1WJAA 4PJJA 2G0EA 2YX4A 2ZXIA 4D7NA 4EJOA 4E70A 1LB2A 1UG0A 2DA2A 1STZA 3GO5A 2OD5A 3I59B 3OYLA 2IA0A 3REOA 3VEPA 1U5TC 1IXCA 3QPSA 1XSVA 3S8PA 5GP9A 2P5VA 2Y48A 2VT3A 1YQAA 5TGTA 2CSOA 2XF6A 2P5LC 1CQTA 2D5VA 4G6QA 4HNUA 2QM3A 1FOKA 3KP7A 3MKYB 1EF4A 3HL2A 3JTHA 3KEQA 1MDMB 2VKDA 1S72I 5K5QA 1RKWA 4ESBA 4GYGA 1S9HA 2YR2A 1OMIA 3BG5A 2H6CA 3JRCA 2L9VA 3S15J 3OIQA 3OV8A 1P4AA 2VASA 2K9MA 4Q48A 3CUQB 2JWTA 3O3KA 1IXRC 2QWWA 1B72A 3M1CA 3R0JA 3MMYB 2KIFA 2ZKZA 2O8XA 1U78A 1JJ6C 3R6SA 3BR6A 3ZP5A 4GRIA 4J00A 1WJ5A 2LREA 2QKLB 2HFHA 2FOKA 2XAQA 3DKYA 4A3EJ 3S2DJ 1Y8QB 2MLKA 3TP3A 2PBIA 2ZJQF 4M3FA 3CDIA 5F0CA 4AC0A 3KP4A 1ZHFA 1KYZA 3Q3SA 3UKGA 2QEXI 2KT0A 1Y39A 3HBLA 3VYUB 3GTKJ 1BIBA 1IN6A 1FTTA 2W48A 1KU3A 1QU3A 2XAHA 3WTVC 5IYBJ 4JX6A 2HYGD 3JREA 1A5JA 1H89C 4DOZA 3WTSC 2FMLA 3N97A 1K78B 1MBFA 1OISA 2M4GA 4ZTFA 4CCOA 1FC3A 3C2BA 1G4DA 2L7FP 3KCCA 4OINF 1IRGA 3ZRGA 4XN0A 4U7BA 3LA7A 4R79A 1Z6RA 4EM2A 2O3FA 2DQRA 5TISC 5F0HA 3RZDJ 3LSTA 3M8JA 3OIOA 2EFNA 4Y13A 5LHIA 3PNYA 3QYEA 2R5YB 1DGWY 5F64A 1ZKGA 2M0CA 2ID3A 2LMDA 1MBGA 1VNDA 4JX4A 2Z1DA 2A6EF 3FDYA 4ZZDA 1D0XA 4PDKA 1WHUA 1YX3A 3I0TA 1RUOA 3WU2C 3K1PA 1IW7F 1D0ZA 2L4MA 4NB5A 5F27A 2DA7A 2GOMA 4OOIA 4B8XA 4A3FJ 2K7LA 3F21A 2A07F 2EV0A 1IN5A 5IOYA 1XSDA 4G9YA 2A68F 5J1RA 2W85A 4M71A 1I1GA 3BC8A 1OFCX 2E5NA 1Z0XA 3CDHA 2ZNYA 2B9SA 1Y8RB 5B1AH 1ETXA 4WK8F 2A6HF 4PJMA 5FJ8J 2EIMH 3IL2A 2JZYA 3E0JB 5F6FA 4CCMA 4AM3A 3FF5A 3KE2A 1BBYA 4RAYA 3S93A 1WJFA 2D45A 1XCBA 5K5RA 1S7OA 2YU9J 5E1XA 1VQ8I 2Y9YA 2EINH 4B44A 3DPLC 1DGRM 2JRTA 5BNGA 4EATA 1QHHD 2DFHA 5HLTA 1APLC 3SQNA 4Z6YA 4H4KC 2EPFA 1XMAA 4N4OB 2V1XA 1ZRDA 4G7OF 4N9IA 1B72B 4PJLA 1ETOA 4KMFA 1XX5A 3ZCOA 3PFIA 1B9MA 1WCMJ 3DCFA 2GOXB 4S04A 3VDXA 2BY1A 2LY2A 3LSRA 2LKXA 2PJRA 1UAAA 3LL7A 5H2FC 2P7CB 1T56A 5E79C 5D5XB 4B4CA 5LLQA 1Z9CA 5KAIC 1GV5A 1K61A 1HDPA 2HGCA 1AU7A 5ICEA 2M0MA 3H5RA 2K9NA 4Y15A 2DK5A 2KPMA 4BHBA 4PGHA 3CLQA 1N25A 5DYMA 2K3PA 3LSPA 3ABKH 2LD5A 1SMTA 2NOJB 5EG0A 3JR9A 1H88C 1ZTRA 1IN4A 3IP4B 5IOZA 3GX4X 3SEZA 1FBSA 3LSHA 5D5UB 1GVJA 4NDLA 4BKXA 1A04A 5F08A 3F6OA 3MWMA 5BQTA 2L2OA 5K7FA 5FRMA 3BTLA 1I6XA 2HQAA 3IH4A 1YO5C 2HKOA 4BJTA 4XLCA 5IYCJ 3RZOJ 1G3YA 2L9NA 1D0YA 1TT0A 4A0ZA 5HNFA 3GTQJ 3SZPA 1YIJI 2CRGA 1TWCJ 2JN6A 5B3SH 3GXOA 4HX7A 5FKLA 2HPMA 4IHWA 2EZLA 3ECHA 3LSJA 2GA1A 2A69F 3C3WA 2PMZA 5D6EA 2WY8Q 3BDDA 3G4SI 3I53A 5CVJA 4Q47A 1A6IA 2JPBA 2L9RA 4UB6C 3FWEA 2XPUA 1P92A 2XAJA 5HS7A 1MNMC 3S17J 2EV6A 4UVAA 2KQRA 2WWYA 3MD2A 3W3CA 1IF1A 1SFOJ 2EZIA 2MLGA 2IA2A 1B8IA 1W5SA 5J40A 2ACJA 2VODA 3H1CA 5KCMA 1DP7P 1JE8A 3DKWA 4BUPA 2OV7A 1FBQA 2BVMA 2KIMA 4YG2F 3FZVA 2JMWA 4BDYA 4RMNA 3QP5A 2CUZA 2YSRA 2JSPA 2PMUA 1VF9A 1VQPI 1MBEA 5FKOA 1R1VA 4CCJA 1TNSA 4XN3A 2R7SA 1HBXG 2ZMEA 1BC8C 2K9SA 1YX5A 3RCOA 5BS6A 1MD0A 5LEKA 3JRDA 5HS8A 2V6EA 2WAFA 1XSXA 1HOMA 3E5QA 3QYBA 3OR2C 5J4YA 4ENKA 1KQ0A 4NHJA 1FWZA 3OYEA 2ZXHA 2Y75A 3GVAA 3HOUJ 4R1HA 4U7DA 2IBDA 1IAWA 1YLFA 3ZMVA 3JSOA 2XV4S 1IRFA 3ASNH 4IOAF 1ENHA 1SD5A 1O3SA 2CJJA 2R7TA 2COBA 4HYEA 1E3PA 2QENA 3WTYC 3CO6C 3CCMI 4A2UA 1SD4A 2OUMA 2PJRB 3F0CA 2KISA 1S6LA 2GIVA 4BHPA 2V1DA 2DPUA 2MC4A 5GAEJ 3ZPLA 1KU7A 3T1BA 1QZYA 2ECCA 3TQNA 1VQNI 1JUMA 2IJLA 1VQMI 3JAMZ 1X1AA 2BY0A 4P55A 5FFXA 3FIWA 4YIIA 4YFXF 1JI8A 5EG0B 3RKYA 1AA7A 4DW6A 4YIRX 2P8TA 3GFIA 1U6GA 3LA2A 1ZGAA 4M3GA 1W0TA 1BI0A 1NG7A 3I64A 4EQQA 4C9YA 2G9WA 3G6EI 3EUAA 2ID6A 5E1WA 4QTRA 5C4JJ 3OOUA 2KIUA 4MIMA 3A03A 2RN7A 3A2KA 3GZ5A 2CU7A 4M3EA 4I01A 3WTUC 3JRHA 2L5QA 3AFHA 3K0LA 5FKKA 2M3AA 3K69A 1SFKA 2GZWA 2XDVA 5M3FJ 3L2RA 3IHUA 1FLIA 1FYMA 1S7AA 2HTJA 4HSTA 5C3EJ 4KMUX 3AL0B 1RR7A 5HLGA 3M07A 1XCVA 3MKZA 4CCKA 4F3QA 5KNLA 4IRIA 2HVRA 2GXGA 2BYVE 2LF8A 2WV0A 1FOXA 1QHGA 1ETQA 2RQQA 2LRDA 5DTDA 2BY2A 1B8IB 3HOYJ 1G6NA 1YJNI 1HW1A 1MBKA 1YW9A 2LBFA 1UMQA 1V5GA 2EK5A 2IRFG 1TW2A 2AXLA 1IZ1A 4BYYA 4LJZF 1D8KA 1TNTA 3B6AA 3BR0A 4M9SA 2F5VA 2TRTA 2FQ4A 4OAYA 1O7LA 3FKIJ 2DA3A 5DDGA 2L01A 4CH7A 1POGA 1BJAA 1GXPA 3GUDA 3CF5F 2ZMEB 1ZLKA 4AYBN 4F55A 2LP0A 2XB5A 1P4WA 3LOCA 2HR3A 3F72A 2W4SA 4HX4A 1FP2A 4QLCU 1HF0A 3DPUA 3MZ8A 4Q4ZF 3M4OJ 1JUSA 1IXSB 2YU3A 3ZXSA 4WCGA 1TC3C 4KISA 3FXOA 2DA5A 1ODDA 2W00A 1U3EM 1RZ4A 2GAUA 2DW4A 2DAOA 2XSJC 4QSHA 3ROUA 5B5EC 1OCPA 1P7JA 2NVTJ 3GYHX 2FRHA 5HNHA 4A3CJ 2FMYA 4PK4A 4AWXB 2OTLI 4WXCA 4DJAA 2RNJA 3TO7A 3FXJA 2LR8A 3RKQA 3LMMA 1Z1DA 1BI1A 2ISYA 3B73A 4BEHA 3L2UA 1TLHB 1WJDA 2Z5UA 4AUXA 1FP1D 2HQ5A 4C2UA 4P5OA 2E71A 2EA4A 2ELHA 2E2JJ 2NAZA 1J5YA 4MHGA 3H0DA 4EGYA 1O3QA 4YEJA 2CV1A 4KNYA 3DTIA 3VYRB 2CW0F 2X6WA 4BNCA 4CSWA 3U2RA 2YUSA 3OYCA 1GDTA 1YE9A 3AG4H 4XRMA 3AL0C 3KZZA 3U21A 3GFLA 2LDUA 9ANTA 4E4HA 5IYDJ 4DBRA 2BHZA 2B63J 2HZTA 3HYIA 4J19A 3EETA 3MCZA 4AIHA 1RESA 1H9GA 1BI3A 1R22A 2CQ7A 1ACIA 4OIOF 2XSDC 2BXZA 3CDLA 1XMXA 4WX9A 2DDAA 2XGXA 1I3QJ 3IAM2 2JSCA 3P9IA 4MO7A 3CTAA 2XAFA 1JTXA 3OL4A 4XORA 2KHMA 4BAYA 3DF8A 4A93J 4P96A 1EV7A 1IV6A 4UNOA 2M87A 1QVUA 4A0XA 3TOAA 1RIOH 4L5IA 3KZYA 2BY3A 1XDSA 2ECBA 3PSFA 4HZFA 3ZQ7A 2DMNA 2DTRA 2H27A 1TQIA 1BW5A 3CUOA 3BG9A 3IKVA 2HVSA 3CCVI 5LFAA 1ZR2A 1RPWA 2FBKA 5CVIA 4UHTA 1VI0A 3BCBA 1D8JA 1ZGWA 4W97A 3T8RA 5KHDA 2DLLA 1CF7A 5J1YA 2O8KA 2VQGA 2AO9A 4XSZF 3PM1A 2LBFB 2UV1A 2EIJH 3GTMJ 4HLXA 3CCEI 2R93J 3ZQQA 4ETSA 2H6BA 4HDVA 1QQIA 4A0YA 4BE2A 5EZGA 2VUMJ 1BN5A 2I10A 1WQ2A 4XRSG 1DPUA 4BBRJ 1BOBA 2V6CA 4GGGA 4L18B 3VPRA 3BP8A 2Z9OA 4P1WA 3HRUA 4II3A 5EEAA 1T39A 3K4KA 2NRAC 1I6HJ 1H8AC 2IS1A 5B1BH 4Y7NJ 1YS7A 3FX3A 4I02A 3HPGA 4D0PA 2R7WA 5TRDA 4EJVA 2HI3A 2EZHA 4MGRA 3UR3C 3GMEA 2O5RA 2EILH 2ELKA 4CDGA 4HF2A 3S32A 4FCYA 3LA3A 2XKOA 3WHBA 2F4IA 3WGIA 2Y0SN 5F0FA 1G3WA 2JUCA 4U0YA 5JI6A 2W1OA 1PUEE 3COAC 4P9FA 1R1TA 3QOPA 3CCUI 1X1CA 1DU6A 1Y56A 1OKRA 4HEA2 2ISZA 5AIQA 3OS2A 2VE8A 1T0FA 4ESJA 1Z77A 1WGXA 3NRVA 1KA8A 4IRGA 4QPQA 5D5WB 3J80Z 5LBQA 1I1SA 3GLLA 1LNWA 1OLTA 2M1BA 4OIRF 3TW6A 4BEHB 3QOEA 2L9SA 4TV7A 2IGMA 3GTJJ 2ZC2A 3DU6A 4XRFA 4NUBA 1O3TA 5JHUA 2JA6J 4UV8A 5ICGA 4EJWA 2E1NA 5FB2A 1DQUA 4RS8A 3G2BA 2ME0A 5E8GA 4DBQA 3D5SC 2KZVA 2HXIA 3OWTA 4A5MA 3PNVA 4ENJA 1UHMA 2V4JC 3HHHA 1T38A 3S16J 1NK2P 4YFNF 5E3MA 1O4XA 3H35A 1IUYA 3CMYA 3BZ6A 1HW2A 4Y3OA 4KFCA 2VQCA 5CYVA 3BR3A 4LG3A 4ZYDA 2VBZA 3PQKA 3RKXA 3ZQGA 3G1LA 2P4WA 3A0HC 2ZXWH 2QQ8A 2X6YA 2E1MC 1EH6A 1YW7A 2A3SA 5FO5A 3HSFA 4G6DA 3TBIA 1IN7A 2KRFA 3IAS2 2IS6A 1MMAA 1OCCH 3QAHA 3K4LA 2E36A 2DPDA 1QZZA 2X51A 2E1OA 3S3OA 3FXRA 3WU1B 1ON1A 1ZGJA 5DD4A 4HW0A 4HQMA 2ZNZA 2WAQA 3ABUA 3SDBA 5L3GA 2QKMB 3F8BA 1D5VA 4D5CA 3EYIA 5ILSA 2JVGA 1IG7A 3BJAA 2UXXA 4MTEA 1X19A 1CF7B 3BPXA 1ERDA 2DA1A 5EYRA 1YHQI 1GUUA 5JVTA 2KLOA 4HA8A 4WWCA 2QGUA 3KP6A 4I0BA 1RNLA 4HPQA 3ONQA 3MQ0A 2A5YB 3JRAA 2EB7A 4L9TA 3OYBA 2NNYA 1V4RA 2B0LA 4RM2A 4D5FA 3S2HJ 1A6QA 1T95A 5FKNA 1F36A 3DEUA 2DOEA 2VI6A 3SYTA 4B48A 1FYKA 4HF0A 4BS9A 1ZRFA 5DUKA 3S14J 5C4XJ 3CP2A 2K9LA 4I98B 3C2HA 3ZMDA 4A3LJ 1P4XA 2HWVA 5L3EA 2HYFA 3G73A 3CQZJ 4CZZA 5HDNA 4A3GJ 3KETA 5FRNA 1AWCA 3ZQFA 4JP0A 4CXFA 3HRSA 2BEOA 2BW3A 3QWLA 1DPRA 4EEFG 1HKSA 3VYSB 3DBRB 4X0GA 5CVRA 2AXTC 5GTHC 1K7AA 2LY1A 3KLNA 1FZPB 4DQ2A 1J9IA 1T8IA 1IDYA 3FXUA 3ZQCA 4D7MA 2H1KA 2CO5A 1Z3XA 1C0WA 2DMPA 4EM0B 4KN4X 2CW7A 4LD5A 5D8LB 3V7RA 4PJ0C 3TOBA 3GEZA 2RV8A 5GPAA 3ABTA 3ZMUA 3JRBA 4DYRA 3FKJA 3F8MA 4BBSJ 2R7DA 5CLSA 1ZYRF 3QPTA 4IPAA 4C30A 4CZCA 3K9TA 5GADJ 1XPXA 3GFJA 1FX7A 3BCAA 1S29A 3K4JA 4K2EA 4XICA 2MC3A 1ETVA 2BXYA 1VQOI 2L54A 3I54A 2FBHA 3ZR8X 2E7WA 2X1CA 4CA0A 4KIGA 3VODA 3OS1A 2HDDA 2IA1A 4Q5SF 2XF5A 2AQEA 2NOGA 4BQOA 5J8CA 1X3UA 3C18A 4FQGA 3RPQA 3V7SA 1XDUA 5FKMA 3U1KA 3I56I 4HX8A 3A01A 2Z99A 4LG0A 1ZH5A 1JTYA 3CCSI 2NYXA 3VOEA 2O03A 4XM3A 4HQEA 3QU6A 2WAQN 1UG2A 4UV9A 1MSEC 3F22A 3H3UA 3D0SA 2B7EA 4L0ZB 1G8XA 5ICFA 1UFMA 2DA4A 4ANJA 5KVRA 2MBFA 5E3LA 1YJWI 2DMUA 4XIDA 3PO2J 1ETKA 1VQ9I 3FM5A 1X1DA 1FMWA 3B6CA 4IZZA 3EUKL 4II2A 3HC7A 1T0FC 4XLNF 3WG9A 1LFUP 5J1UA 3PO3J 5HVQC 4KIFA 2TDXA 1KQ9A 2X6OA 5GTIC 2FOWA 1HA8A 2HOAA 5C44J 2MG4A 2VONA 3DLAA 3V4GA 1H0MA 1FMVA 5EF6A 5E1ZB 4B1RA 1USTA 3BTIA 5K5OA 3K6GA 3GBGA 3BR1A 5J47A 4XOTA 2K86A 4HSRA 3EQLF 3HZJA 5FD6A 1U2WA 2BHYA 5DD8A 2KDZA 2KMUA 2KJCA 5BMZA 1B6AA 3FISA 5BOXA 4XLEA 4D1QA 4P9UA 2OF7A 2V79A 2EBIA 4FTHA 3GZ6A 2MH9A 2DA6A 3H92A 3L2WA 5D8KB 2R5ZA 4X1EA 1IRXA 2E7XA 3CCQI 1LDDA 2BW3B 2NNNA 3VFZA 4B3AA 2JPCA 3HSRA 2VBYA 3QYFA 3CJRB 2WA0A 4Y33A 1WZ2A 1LDJA 2EFOA 2MH2A 4O3MA 2PFBA 4C3IJ 1J2XA 3M9AA 2VJIA 2ZSHB 4G12A 4L5JA 2PX9A 3WTWC 2DQLA 2ME6A 4LIVA 3BOQA 2L0KA 3QRFF 2RC4A 2CQKA 2LOOA 2VJ5A 3OIPA 5IP9J 1OYYA 3J7ZI 2DODA 2JTVA 3OOPA 1WJBA 2NS0A 3LSIA 5B66C 4NBQA 2DFEA 3RYPA 3PQJA 1KQ8A 4F7ZA 3V8JA 2AQFA 2UXNA 4NC6A 2QA4I 4IQ4A 1LEBA 2JJ7A 1D1BA 4RB2C 3JSPA 4RAFA 3RKWA 2RGVA 1WFXA 1DP3A 1HSJA 1Z21A 5FLMJ 2L7MP 3BY6A 3V42A 4HF1A 2CQXA 3ZN1A 4AIKA 2FF4A 3WHCA 2F5CA 1EH8A 1YJ9I 3EUHA 3KLOA 5EEHA 2PLYA 4BACA 2OQGA 4HNVA 4AVPA 2FU4A 2HDWA 4N4NB 1BW6A 1WVRA 3OL3A 2KFDA 1YI2I 3PIPF 3K4NA 1XG1A 3IRQA 2GQQA 4I0AA 2O61A 1JKQC 1N77A 3I5UA 2FD5A 1SFUA 2R7RA 1R1UA 3A01B 4LG0B 1GXQA 2VQLA 1G3SA 2RVCA 3HPHA 3IH2A 2W25A 1EA3A 4IF4A 4IO9F 2M2EA 1A36A 1E0EA 1Q1VA 3LQRA 2MFZA 3E1SA 4XK4A 1FNNA 3BZCA 3FMQA 4LK1F 2OCEA 4A6EA 3F6VA 3H36A 1SAUA 1FOWA 1VFCA 4M6VA 4UUSA 2KJBA 1MIJA 3T8TA 2VJJA 4AYBA 4G7ZF 3IWZA 3GTOJ 4CGZA 3KP2A 1VQ6I 2HTSA 3RIRA 3FBIB 3KP5A 1OYWA 3L2CA 1X2NA 3SFZA 5E3NA 1R71A 4IVNA 5IT9Z 2Z33A 1V5EA 1OCZH 2OQRA 4BL0B 3FK7A 4LFUA 3RJPA 5IP7J 1I39A 4V2GA 1R4NB 4OIQF 5FD5A 2XAGA 3HIFA 2V9KA 2I5UA 3M8FA 3GW2A 3OYFA 3WODF 2E1CA 5M5WJ 1JXSA 1BJZA 3E5XA 2F4OB 2R5ZB 3W6VA 4IEJA 1ZQ3P 2CS3A 3CJTB 4GCVA 4YIFA 1R7JA 4EM1A 1R5HA 1NTCA 3F3XA 2R7ZJ 1NK3P 1LE8A 2F48A 1FIPA 2VB6A 3LNQA 1TBXA 1HCRA 2HKXA 2M5WA 1FTZA 5IT9K 4DZJA 4RB0A 5EJCA 3SHFA 1YYVA 2X4HA 2H09A 2KL4A 3DU5A 4XRSA 4I2OA 2JVHA 3HRMA 3HOTA 5F1JA 3TO6A 4BQQA 3KYLA 1OCOH 2ZJRF 1ULYA 2XUBA 1K4SA 2DT6A 1ONVA 1BA5A 5FLVA 3I9V2 1WI9A 1AKHA 4RDUA 4M3BA 2OBPA 3FXQA 3I3LA 4R8HA 3RI4A 2CG4A 2WBMA 2W84A 4U87A 1LVAA 1UJ8A 2DU9A 4N0BA 1EJ9A 2Z3YA 1XGNA 2GLOA 1G59A 3ASOH 1ETWA 4FASD 2VKHA 1H9TA 1OYIA 1W7PA 3JAMK 4UY8I 3FMRA 1SANA 5EDNA 5ILVA 3HEFA 4FX0A 2LH9A 2KRHA 5CQEA 3E97A 1VQKI 1P2FA 1K79A 1ZARA 2RREA 5DEQA 4M3DA 2HEOA 3NEUA 5L3DA 1KONA 1PDNC 2OA4A 3E6MA 3DFGA 4A69C 2NXNB 3NWTA 1HQCA 1MH4A 1WI3A 1LEAA 1HXDA 4C3HJ 1MKMA 3ML6A 3OSFA 3NQOA 2R4GA 3N4MA 1F1ZA 2NVXJ 1OPCA 3EDPA 3J81Z 3BG7A 2L7ZA 3BTCA 3A0BC 3M8EA 4UUSB 3CC4I 4KDPA 1FBUA 4JOMA 2K9QA 3ZMSA 1XMKA 2C6YA 2OAZA 3Q0WA 2V9PA 3LSKA 1TWFJ 2M45A 3QPLA 1IV8A 4MLOA 1SMYF 2XPVA 1Y1WJ 1R36A 2KZGA 1T33A 3MAJA 2ZSIB 3OYGA 3KEOA 2IPQX 3L9FA 1QNTA 2VE9A 4LLLA 1E3OC 3I55I 6PAXA 2VT2A 2Y0SA 1TWHJ 1D1CA 3DBHB 4E7LA 4XLAA 1JKPC 2XPWA 3QPHA 5LEJA 3GLXA 4LLNA 4UVBA 5DUIA 3K2ZA 3PL8A 2A6TA 1XGMA 2IP2A 2WB1A 2O9LA 3KPHA 4D9JA 3ZMTA 2P5KA 2Q0OA 5J4VA 2A05A 4N9HA 3HJEA 3BTJA 2FSWA 1JHFA 2IAIA 4Y17A 3HGYA 4HV6A 1PVEA 2F5FA 4A3DJ 1WSUA 2GA2A 4RGRA 4GFBA 5H20A 3J7YJ 1W5TA 1R49A 3EUHC 1FT9A 2XGDA 1P6RA 3E6DA 1WJCA 5KK1A 1RRJA 1LE8B 4CHUA 1R58A 4ZC3A 1CGPA 5E3OA 3ISPA 3I4NJ 3DKXA 2X9DA 2FEZA 4RAGA 4UUVA 1Z91A 4FE4A 4CICA 2EWNA 3L1PA 1Y6IA 3BG3A 1E3HA 2WADA 1V54H 1S7EA 1X58A 4BXFA 1TZLA 1XN7A 5F1RA 2ZCWA 2IS2A 2ADUA 4MFEA 1LFBA 2ZBKA 2R0QC 1FSHA 2W57A 3CMAI 1KGSA 3SZTA 1V5FA 2QQ9A 3FBNB 4CCLA 3E6CC 3OS0A 4M73A 1AKHB 2CV2A 3OYMA 1LUJB 1HSTA 1NHAA 1HDDC 4MFDA 2HXOA 2P6SA 2NS7A 5IT3A 4NC7A 1XD7A 3SXYA 2FQ3A 2YPRA 5DCFA 1ZN2A 2LTPA 3M3YJ 1L0OC 2DTZA 4JBAA 4NQWA 4QPOA 1OR7A 1W7PB 2JA2A 4FISA 3OYKA 4WXHA 3MFKA 3KYDB 4HAMA 4NNJA 2ZFWA 2R7XA 3Q9VA 1RC9A 2R7UA 3W6JB 4X6AJ 3R61A 1SEUA 2QSFX 4E6KG 3IV5A 3JW4A 1OJLA 2J5OA 1SD6A 2W7NA 2ICWG 2WV1A 1P7IA 3BR5A 3QP6A 1X2MA 4A3BJ 2VOOA 1PJRA 2ESNA 2E1MB 4F92B 3S1RJ 1TWAJ 2VOPA 2GXBA 5D5VB 4ITVA 2R3SA 2L7KA 1IO2A 2QYOA 3RDIA 3GTPJ 2QSHX 1YFHA 3DTEA 3AKZA 4IOCF 2EQRA 2EA2A 3SJMA 1BI2A 1LKXA 3RTRA 4IQJA 4KYWA 1MNDA 1B4AA 3GCMA 3G1OA 5EZHA 3OYHA 4G7HF 1MH3A 4U88A 1YIOA 2DN0A 4HG2A 4J01A 4AIDA 2FA5A 3WTTC 4ZYEA 5CPRB 3T5XA 3TDZC 3TGNA 2KP6A 4HRIA 1MW7A 1QZEA 2WB1N 2IT0A 3K2AA 4ASNA 1ORKA 1X4PA 4RGSA 4EVIA 4E7HA 3BR2A 1X4OA 2ZO4A 1ZELA 2HVQA 1DDNA 2BOLA 3OY9A 3J7AY 5J6XA 2VPRA 2XASA 3HUGA 2Y2ZA 4BQAA 1NG6A 1RUNA 3DXJF 4L9NA 3P7NA 4G6TB 2KDOA 3FHZA 4AU7A 2ZJ2A 1IC8A 3W2AA 2FXAA 1Z7UA 1JJ8C 2XF7A 2LKPA 4L9JA 4DYQA 4HNTA 2IS4A 1IJWC 2V1UA 1N75A 3HOZJ 2FX0A 1HKQA 2E19A 4JYKA 3V8LA 4BGDA 4LIUA 4HOBA 2LY9A 3H0GJ 4KA4A 3K10A 1AOYA 1XB4A 3W6KB 2XHKA 3IKTA 3E5UA 2XRNA 4CUGA 3GTLJ 3ERED 3CESA 3VSLA 1SVLA 2VXZA 2MA3A 2VN2A 2RNGA 2UUZA 4E7JA 4BXUA 3OYIA 3J80K 3AG2H 3EPZA 1UB9A 2EFWA 1GLNA 5DM6F 1QGPA 4MNUA 4G94A 5E18F 4ENNA 3GTGJ 2CUFA 4RGXA 1I5ZA 2ELJA 3VB2A 1F4KA 2NVQJ 1FIAA 2KIQA 3TW7A 4NQWB 2VQHA 4XKBA 5J8FA 1QVTA 1T98A 5AIPA 2HPIA 2DMTA 5D4SA 2Y31A 1VTNC 2LLKA 1BL0A 3V8KA 2VKEA 3KIOA 2JA7J 3BQZA 1VQ5I 4W1UA 1UELB 5CQGA 5GPCA 1LJ9A 1XS9A 3LSGA 2QQBA 1Z3YA 3PUBA 4WXDA 2CWEA 4BXXJ 3WTZA 3CF2A 4UUTA 5CVVA 3HHGA 4OMZA 1BOAA 4M6YA 1QA6A 5HLIA 4V19K 2W24A 3H3ZA 1LPQA 1HLVA 1KU2A 2G7HA 3HKZN 2E35A 5K1YA 4B09A 4KUMA 3NARA 2JT1A 4KT6A 2JQ7A 4IXAA 1MNEA 1I3AA 1U9NA 3PNTA 5LGNA 1MMGA 1VQ4I 4BJ6C 1A35A 3IH3A 4MQ9F 4HBLA 4ON0A 4ZYAA 1YRNA 2PJPA 2QBYA 1U8BA 3R0AA 4GXOA 2DXIA 5HLHA 2M8EA 4BU2A 3A4CA 2X1DA 4IRHA 5LRRA 2ZFUA 3RPUD 2NS8A 3C1DA 1BIAA 2F5DA 2EJRA 3ZQIA 3HRTA 4GYIA 1Z6TA 5JFRA 3L09A 5J3LA 1ETYA 3BT9A 2X6XA 3M7GA 3HUGB 3PUFA 1SVOA 4ENMA 2E60A 3BLYA 2MW8A 2LC2A 1O3RA 1USSA 4F91B 2RQPA 3K1NA 2IGNA 1ON2A 2V26A 3WU0A 1BM9A 3WG7H 4E7IA 2K4BA 2DT7B 1LFPA 3MKWB 1OR7C 2QQAA 3J7AO 3HTSB 3KEYA 2OU2A 5L3FA 1X1BA 1P9QC 3FXLA 4PUSA 3DWLE 3E3VA 2R7FA 3BWGA 2O0YA 5H6RA 2FUG2 2LSOA 4QIWN 2IW5A 2CV0A 4I76A 1PP7U 3WE3A 2P6TA 1MJAA 3QQAA 4PZJA 1X3ZB 5ED4A 2DK8A 2DT5A 4OIPF 2VL8A 2CYYA 1I27A 1WH7A 1R9TJ 1B9NA 2LK2A 4PCQA 3G3ZA 3K4BA 2IEKA 4XKVA 2GWRA 2DYSH 5HODA 4JQFA 2R92J 3TP0A 4A3MJ 3P5JA 1YG2A 2R7VA 3WTXC 2OJED 2X0LA 1PUFA 1R5GA 1U0JA 1W7PD 4IKFA 4EJTA 5HDGA 2BVLA 2OZ6A 2VKVA 1MGTA 2LFBA 5LHHA 2PN6A 3C2GA 3JCUC 2HNHA 3GF2A 3LQQA 3IRRA 3CD6I 5DV5A 2ETHA 4RAZA 2Z2SB 3M1EA 3TO9A 3AG1H 4O6JA 1V55H 3TKYA 2M9HA 3BROA 3BQYA 2K02A 1Z05A 4LLGF 4ZYHA 2V1NA 4BJ5C 3ELKA 2VPLA 1MZBA 3CUQC 1Y0NA 1GVDA 4BDZA 2K3FA 1T6SA 2EV5A 3CMMA 1KZHA 3F8NA 4MTDA 4A3JJ 1FSEA 3RQ4A 2DOAA 3RYRA 4F93B 2GBYA 5CJ9A 1QRYA 3L7WA 3FXMA 3T0YA 1WWXA 2O7OA 3K70C 4DYCA 2STTA 2A61A 1RI7A 3HOVJ 3ULQB 1MSFC 1YW8A 4ZH4F 1YRNB 1TQMA 3S1NJ 2QBYB 4FE7A 4AD9A 5EGOA 3DV8A 2LYCA 4OWRB 1W36C 1MMDA 2F5EA 2JUGA 4XMYA 2EH3A 2HQRA 2PI0A 2M30A 2PG4A 2VC1A 1T2KA 3ZGKA 5FFZA 4WF2A 3MZYA 1KYWA 4S05A 2L4AA 2CW8A 3BG6A 5A2QZ 4C2TA 1I50J 2DMQA 1VZ0A 1W0UA 4IHYA 5BPDA 3HSEA 4DIQA 4XNFA 3MZHA 1BR4A 1TTYA 1J0RA 3AAFA 2UWMA 4ESFA 3PFYA 2QCOA 1ZR4A 2HZDA 3A02A 4PFOA 4UXNA 4AVZA 5H6QA 3O8HA 3ESWB 5KAFC 2DDBA
chains in the Genus database with same CATH topology
2JWTA 1B72A 1ETWA 1JUPA 5EZGA 2VUMJ 1U78A 1SANA 1JJ6C 2I10A 3BR6A 5EDNA 4XRSG 3HEFA 4BBRJ 3VPRA 4A3EJ 5EEAA 3S2DJ 1I6HJ 1H8AC 4M3DA 5DS9A 4Y7NJ 1WH5A 3TP3A 4A69C 4M3FA 2HI3A 5F0CA 2EZHA 4AC0A 3Q3SA 1MH4A 1WI3A 2ELKA 3UKGA 4C3HJ 3OSFA 2KT0A 4FCYA 3HBLA 2NVXJ 3GTKJ 3WHBA 2Y0SN 5F0FA 2W48A 1FTTA 2L7ZA 3BTCA 4UUSB 5IYBJ 4JX6A 3JREA 2K9QA 1A5JA 1H89C 4L5EA 1DU6A 3Q0WA 1MBFA 1TWFJ 3ZQHA 1PUFB 1AHDP 1Z77A 1WGXA 3QPLA 4MLOA 2JA8J 2XPVA 1Y1WJ 3C2BA 1T33A 2L7FP 3ZQLA 2AHQA 3TW6A 1E3OC 3E7LA 2E2IJ 1TWHJ 3RZDJ 5F0HA 3GTJJ 3OIOA 1JKPC 2XPWA 3HGGA 2JA6J 2R5YB 1ZKGA 2M0CA 2ID3A 1F43A 2O9LA 4A3KJ 1MBGA 1VNDA 4JX4A 2ME0A 2HXIA 2XGEA 1JT6A 3BTJA 2IAIA 2TCTA 3HGYA 3HOXJ 5F27A 3S16J 2JK3A 1NK2P 2DA7A 3Q0UA 4A3FJ 4A3DJ 4GFBA 5E3MA 1O4XA 5IPAA 1MBHA 5IOYA 3CMYA 2XGDA 5J1RA 1LE8B 3BR3A 1Y1VJ 5EGOB 5E3OA 3ZQGA 3I4NJ 2X9DA 1OFCX 3G1LA 4FE4A 1Z0XA 3L1PA 3BG3A 2RAEA 5JLWA 1G2HA 1TWGJ 1ETXA 2XRLA 1S7EA 1X58A 4V2FA 5FJ8J 4MFEA 1LFBA 2R0QC 2E1OA 1AKHB 4C3JJ 2YU9J 1HDDC 4MFDA 4D5CA 2Y9YA 1IG7A 2HXOA 2NS7A 2DA1A 1GT0C 5EYRA 5BNGA 1GUUA 1APLC 2XB0X 2LTPA 3HM5A 3JRGA 3M3YJ 3I4MJ 1B72B 2DTZA 3JRIA 1ETOA 3CCYA 4FISA 3JRAA 1WCMJ 3DCFA 3MKLA 3LSRA 4JX5A 2LKXA 4D5FA 1T56A 3S2HJ 4B4CA 3HDDA 4X6AJ 2H8RA 1K61A 1GV5A 5FKNA 1HDPA 1F36A 1AU7A 3IV5A 1OJLA 2K9NA 2X48A 5M5YJ 2VI6A 4CYCA 2WV1A 1P7IA 3BR5A 1X2MA 4A3BJ 4I6ZA 3LSPA 3S1RJ 2LD5A 5EG0A 1TWAJ 3S14J 3JR9A 5C4XJ 1H88C 1ZTRA 3FK6A 5JLXA 4A3LJ 5IOZA 3CQZJ 4NDLA 4BKXA 5F08A 3GTPJ 4A3GJ 1IUFA 3ZQFA 4JP0A 2EQRA 2N8GA 2PMZN 5K7FA 3SJMA 1RETA 3BTLA 4EEFG 2HOTA 3H3VK 3MVPA 3IH4A 5M3MJ 3RQIA 5IYCJ 3RZOJ 3G1OA 1IDYA 5EZHA 3ZQCA 1MH3A 4D7MA 2H1KA 3GTQJ 2QF7A 2DN0A 1K83J 2JA5J 2DMPA 2CRGA 1TWCJ 2JN6A 5K7ZA 1U9OA 5FKLA 5GPAA 2WB1N 4IHWA 3JRBA 3K2AA 2EZLA 1ORKA 4DYRA 3LSJA 4BBSJ 1A6IA 2L9RA 3BR2A 5K7HA 2XPUA 3G1MA 1MNMC 2LVSA 3ZOBA 3S17J 2VPRA 2Y2ZA 2DJNA 1IGNA 1SFOJ 2EZIA 4XICA 1B8IA 1ETVA 4RBOA 1MBJA 1IC8A 1JJ8C 3HOWJ 1JKOC 4BY7J 4DYQA 1IJWC 3HOZJ 2HDDA 2JMWA 2FX0A 1IRZA 2E19A 3OSGA 4JYKA 2NOGA 3O8GA 1VF9A 1MBEA 2LY9A 2ZB9A 3H0GJ 5FKOA 5FKMA 3A01A 2K40A 2K9SA 3GTLJ 1JTYA 1FJLA 3JRDA 3TEDA 1HOMA 2WAQN 1UG2A 1MSEC 2HOSA 2P81A 3S1QJ 3HB9A 2MGQA 2DA4A 1GV2A 5E3LA 2DMUA 4XIDA 3HOUJ 3PO2J 3GTGJ 1ETKA 2CUFA 2IBDA 3B6CA 2NVQJ 1FIAA 1ENHA 3TW7A 2CJJA 1LFUP 5J1UA 3PO3J 1QVTA 2COBA 2X6OA 3S1MJ 2HOAA 5C44J 2MG4A 2DMTA 2Y9ZA 2Y31A 2LLKA 1BL0A 2VKEA 3F0CA 2XGCA 5EF6A 2JA7J 4B1RA 3BQZA 4W1UA 3MN2A 3SDGA 3BTIA 5GPCA 1XS9A 3GBGA 3BR1A 3LSGA 4CYCB 2ECCA 1FEXA 4BXXJ 1JUMA 4UUTA 2KDZA 3FISA 3FIWA 5EG0B 2OF7A 2EBIA 3JRFA 4DW6A 1OCTC 4FTHA 1HLVA 2DA6A 3HKZN 3NARA 2R5ZA 4X1EA 4A3IJ 4M3GA 1W0TA 4B3AA 1U9NA 3IH3A 2M8GX 1YRNA 2FJ1A 2ID6A 4QTRA 5C4JJ 1U8BA 4C3IJ 4G12A 5F04A 2OPTA 3OOUA 4MIMA 2ME6A 3A03A 2GM4A 2L0KA 4S0HB 2CU7A 4M3EA 3JRHA 2NS8A 5IP9J 5FKKA 2CQQA 5M3FJ 3ZQIA 5C3EJ 4IHVA 1RR7A 2CUEA 2E2HJ 5J3LA 1ETYA 2JJ7A 3BT9A 3DEWA 3SFIA 2EZKA 5FLMJ 1ETQA 2L7MP 2MW8A 5DTDA 2CQXA 1B8IB 3HOYJ 2M34A 3WHCA 1MBKA 1UMQA 4HNVA 3Q0VA 3B6AA 3BR0A 4DZPA 3K7AJ 1BW6A 2TRTA 2FQ4A 1JT0A 3FKIJ 2DA3A 1XG1A 1JKQC 1RKTA 2FD5A 2MSYA 1POGA 3A01B 4AYBN 5M5XJ 4Y52J 2LP0A 2XB5A 4QIWN 4I76A 3IH2A 3LOCA 2M2EA 3QQAA 1Q1VA 3D1NI 4XK4A 1XC5A 4C2MJ 1HF0A 1R9TJ 1WH7A 3M4OJ 1ZK8A 2LK2A 2HYJA 1JUSA 1TC3C 2DA5A 2IEKA 1VFCA 4M6VA 5HODA 4UUSA 4BY1J 2R92J 3TP0A 4A3MJ 4QSHA 1OCPA 3GTOJ 1PUFA 1P7JA 2NVTJ 1QPIA 4A3CJ 1UHSA 1X2NA 5E3NA 2VKVA 2LFBA 2LR8A 3RKQA 4AUXA 2YS9A 1WPKA 2HQ5A 4LOCA 3FK7A 2Y30A 5IP7J 1ITYA 2E2JJ 2M9HA 3BQYA 4V2GA 2NVYJ 1JGGA 5IP6A 3NAUA 4ABZA 2R5YA 2YUSA 1D5YA 1GDTA 1GVDA 1IDZA 1JKRC 4XRMA 4IHXA 9ANTA 5IYDJ 4A3JJ 1DU0A 2B63J 2GBYA 5M5WJ 1BJZA 1QRYA 2R5ZB 4J19A 3W6VA 4IEJA 1ZQ3P 1RESA 2O7OA 2G0EA 4DYCA 4D7NA 1NTCA 3HOVJ 2XSDC 1MSFC 2R7ZJ 3CDLA 2DA2A 1NK3P 1YRNB 1LE8A 3S1NJ 3LNQA 1FIPA 4FE7A 5EGOA 1HCRA 1I3QJ 2EH3A 1FTZA 4MO7A 4DZJA 1JTXA 4A93J 1IV6A 1QVUA 3QPSA 4XRSA 5GP9A 1I50J 2DMQA 5F1JA 1W0UA 1CQTA 4IHYA 2D5VA 2ECBA 2DMNA 1BW5A 1EF4A 1BA5A 3BG9A 2QCOA 5FLVA 1ZR4A 1AKHA 4RDUA 1ZR2A 4M3BA 1RKWA 1RPWA 3A02A 1VI0A 1ZGWA 4W97A 5J1YA 2O8KA 2AO9A 3BG5A 3JRCA 3PM1A 3O8HA 3S15J 3GTMJ 2GLOA 2R93J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JWT A;  1B72 A;  1ETW A;  1JUP A;  5EZG A;  2VUM J;  1U78 A;  1SAN A;  1JJ6 C;  2I10 A;  3BR6 A;  5EDN A;  4XRS G;  3HEF A;  4BBR J;  3VPR A;  4A3E J;  5EEA A;  3S2D J;  1I6H J;  1H8A C;  4M3D A;  5DS9 A;  4Y7N J;  1WH5 A;  3TP3 A;  4A69 C;  4M3F A;  2HI3 A;  5F0C A;  2EZH A;  4AC0 A;  3Q3S A;  1MH4 A;  1WI3 A;  2ELK A;  3UKG A;  4C3H J;  3OSF A;  2KT0 A;  4FCY A;  3HBL A;  2NVX J;  3GTK J;  3WHB A;  2Y0S N;  5F0F A;  2W48 A;  1FTT A;  2L7Z A;  3BTC A;  4UUS B;  5IYB J;  4JX6 A;  3JRE A;  2K9Q A;  1A5J A;  1H89 C;  4L5E A;  1DU6 A;  3Q0W A;  1MBF A;  1TWF J;  3ZQH A;  1PUF B;  1AHD P;  1Z77 A;  1WGX A;  3QPL A;  4MLO A;  2JA8 J;  2XPV A;  1Y1W J;  3C2B A;  1T33 A;  2L7F P;  3ZQL A;  2AHQ A;  3TW6 A;  1E3O C;  3E7L A;  2E2I J;  1TWH J;  3RZD J;  5F0H A;  3GTJ J;  3OIO A;  1JKP C;  2XPW A;  3HGG A;  2JA6 J;  2R5Y B;  1ZKG A;  2M0C A;  2ID3 A;  1F43 A;  2O9L A;  4A3K J;  1MBG A;  1VND A;  4JX4 A;  2ME0 A;  2HXI A;  2XGE A;  1JT6 A;  3BTJ A;  2IAI A;  2TCT A;  3HGY A;  3HOX J;  5F27 A;  3S16 J;  2JK3 A;  1NK2 P;  2DA7 A;  3Q0U A;  4A3F J;  4A3D J;  4GFB A;  5E3M A;  1O4X A;  5IPA A;  1MBH A;  5IOY A;  3CMY A;  2XGD A;  5J1R A;  1LE8 B;  3BR3 A;  1Y1V J;  5EGO B;  5E3O A;  3ZQG A;  3I4N J;  2X9D A;  1OFC X;  3G1L A;  4FE4 A;  1Z0X A;  3L1P A;  3BG3 A;  2RAE A;  5JLW A;  1G2H A;  1TWG J;  1ETX A;  2XRL A;  1S7E A;  1X58 A;  4V2F A;  5FJ8 J;  4MFE A;  1LFB A;  2R0Q C;  2E1O A;  1AKH B;  4C3J J;  2YU9 J;  1HDD C;  4MFD A;  4D5C A;  2Y9Y A;  1IG7 A;  2HXO A;  2NS7 A;  2DA1 A;  1GT0 C;  5EYR A;  5BNG A;  1GUU A;  1APL C;  2XB0 X;  2LTP A;  3HM5 A;  3JRG A;  3M3Y J;  3I4M J;  1B72 B;  2DTZ A;  3JRI A;  1ETO A;  3CCY A;  4FIS A;  3JRA A;  1WCM J;  3DCF A;  3MKL A;  3LSR A;  4JX5 A;  2LKX A;  4D5F A;  1T56 A;  3S2H J;  4B4C A;  3HDD A;  4X6A J;  2H8R A;  1K61 A;  1GV5 A;  5FKN A;  1HDP A;  1F36 A;  1AU7 A;  3IV5 A;  1OJL A;  2K9N A;  2X48 A;  5M5Y J;  2VI6 A;  4CYC A;  2WV1 A;  1P7I A;  3BR5 A;  1X2M A;  4A3B J;  4I6Z A;  3LSP A;  3S1R J;  2LD5 A;  5EG0 A;  1TWA J;  3S14 J;  3JR9 A;  5C4X J;  1H88 C;  1ZTR A;  3FK6 A;  5JLX A;  4A3L J;  5IOZ A;  3CQZ J;  4NDL A;  4BKX A;  5F08 A;  3GTP J;  4A3G J;  1IUF A;  3ZQF A;  4JP0 A;  2EQR A;  2N8G A;  2PMZ N;  5K7F A;  3SJM A;  1RET A;  3BTL A;  4EEF G;  2HOT A;  3H3V K;  3MVP A;  3IH4 A;  5M3M J;  3RQI A;  5IYC J;  3RZO J;  3G1O A;  1IDY A;  5EZH A;  3ZQC A;  1MH3 A;  4D7M A;  2H1K A;  3GTQ J;  2QF7 A;  2DN0 A;  1K83 J;  2JA5 J;  2DMP A;  2CRG A;  1TWC J;  2JN6 A;  5K7Z A;  1U9O A;  5FKL A;  5GPA A;  2WB1 N;  4IHW A;  3JRB A;  3K2A A;  2EZL A;  1ORK A;  4DYR A;  3LSJ A;  4BBS J;  1A6I A;  2L9R A;  3BR2 A;  5K7H A;  2XPU A;  3G1M A;  1MNM C;  2LVS A;  3ZOB A;  3S17 J;  2VPR A;  2Y2Z A;  2DJN A;  1IGN A;  1SFO J;  2EZI A;  4XIC A;  1B8I A;  1ETV A;  4RBO A;  1MBJ A;  1IC8 A;  1JJ8 C;  3HOW J;  1JKO C;  4BY7 J;  4DYQ A;  1IJW C;  3HOZ J;  2HDD A;  2JMW A;  2FX0 A;  1IRZ A;  2E19 A;  3OSG A;  4JYK A;  2NOG A;  3O8G A;  1VF9 A;  1MBE A;  2LY9 A;  2ZB9 A;  3H0G J;  5FKO A;  5FKM A;  3A01 A;  2K40 A;  2K9S A;  3GTL J;  1JTY A;  1FJL A;  3JRD A;  3TED A;  1HOM A;  2WAQ N;  1UG2 A;  1MSE C;  2HOS A;  2P81 A;  3S1Q J;  3HB9 A;  2MGQ A;  2DA4 A;  1GV2 A;  5E3L A;  2DMU A;  4XID A;  3HOU J;  3PO2 J;  3GTG J;  1ETK A;  2CUF A;  2IBD A;  3B6C A;  2NVQ J;  1FIA A;  1ENH A;  3TW7 A;  2CJJ A;  1LFU P;  5J1U A;  3PO3 J;  1QVT A;  2COB A;  2X6O A;  3S1M J;  2HOA A;  5C44 J;  2MG4 A;  2DMT A;  2Y9Z A;  2Y31 A;  2LLK A;  1BL0 A;  2VKE A;  3F0C A;  2XGC A;  5EF6 A;  2JA7 J;  4B1R A;  3BQZ A;  4W1U A;  3MN2 A;  3SDG A;  3BTI A;  5GPC A;  1XS9 A;  3GBG A;  3BR1 A;  3LSG A;  4CYC B;  2ECC A;  1FEX A;  4BXX J;  1JUM A;  4UUT A;  2KDZ A;  3FIS A;  3FIW A;  5EG0 B;  2OF7 A;  2EBI A;  3JRF A;  4DW6 A;  1OCT C;  4FTH A;  1HLV A;  2DA6 A;  3HKZ N;  3NAR A;  2R5Z A;  4X1E A;  4A3I J;  4M3G A;  1W0T A;  4B3A A;  1U9N A;  3IH3 A;  2M8G X;  1YRN A;  2FJ1 A;  2ID6 A;  4QTR A;  5C4J J;  1U8B A;  4C3I J;  4G12 A;  5F04 A;  2OPT A;  3OOU A;  4MIM A;  2ME6 A;  3A03 A;  2GM4 A;  2L0K A;  4S0H B;  2CU7 A;  4M3E A;  3JRH A;  2NS8 A;  5IP9 J;  5FKK A;  2CQQ A;  5M3F J;  3ZQI A;  5C3E J;  4IHV A;  1RR7 A;  2CUE A;  2E2H J;  5J3L A;  1ETY A;  2JJ7 A;  3BT9 A;  3DEW A;  3SFI A;  2EZK A;  5FLM J;  1ETQ A;  2L7M P;  2MW8 A;  5DTD A;  2CQX A;  1B8I B;  3HOY J;  2M34 A;  3WHC A;  1MBK A;  1UMQ A;  4HNV A;  3Q0V A;  3B6A A;  3BR0 A;  4DZP A;  3K7A J;  1BW6 A;  2TRT A;  2FQ4 A;  1JT0 A;  3FKI J;  2DA3 A;  1XG1 A;  1JKQ C;  1RKT A;  2FD5 A;  2MSY A;  1POG A;  3A01 B;  4AYB N;  5M5X J;  4Y52 J;  2LP0 A;  2XB5 A;  4QIW N;  4I76 A;  3IH2 A;  3LOC A;  2M2E A;  3QQA A;  1Q1V A;  3D1N I;  4XK4 A;  1XC5 A;  4C2M J;  1HF0 A;  1R9T J;  1WH7 A;  3M4O J;  1ZK8 A;  2LK2 A;  2HYJ A;  1JUS A;  1TC3 C;  2DA5 A;  2IEK A;  1VFC A;  4M6V A;  5HOD A;  4UUS A;  4BY1 J;  2R92 J;  3TP0 A;  4A3M J;  4QSH A;  1OCP A;  3GTO J;  1PUF A;  1P7J A;  2NVT J;  1QPI A;  4A3C J;  1UHS A;  1X2N A;  5E3N A;  2VKV A;  2LFB A;  2LR8 A;  3RKQ A;  4AUX A;  2YS9 A;  1WPK A;  2HQ5 A;  4LOC A;  3FK7 A;  2Y30 A;  5IP7 J;  1ITY A;  2E2J J;  2M9H A;  3BQY A;  4V2G A;  2NVY J;  1JGG A;  5IP6 A;  3NAU A;  4ABZ A;  2R5Y A;  2YUS A;  1D5Y A;  1GDT A;  1GVD A;  1IDZ A;  1JKR C;  4XRM A;  4IHX A;  9ANT A;  5IYD J;  4A3J J;  1DU0 A;  2B63 J;  2GBY A;  5M5W J;  1BJZ A;  1QRY A;  2R5Z B;  4J19 A;  3W6V A;  4IEJ A;  1ZQ3 P;  1RES A;  2O7O A;  2G0E A;  4DYC A;  4D7N A;  1NTC A;  3HOV J;  2XSD C;  1MSF C;  2R7Z J;  3CDL A;  2DA2 A;  1NK3 P;  1YRN B;  1LE8 A;  3S1N J;  3LNQ A;  1FIP A;  4FE7 A;  5EGO A;  1HCR A;  1I3Q J;  2EH3 A;  1FTZ A;  4MO7 A;  4DZJ A;  1JTX A;  4A93 J;  1IV6 A;  1QVU A;  3QPS A;  4XRS A;  5GP9 A;  1I50 J;  2DMQ A;  5F1J A;  1W0U A;  1CQT A;  4IHY A;  2D5V A;  2ECB A;  2DMN A;  1BW5 A;  1EF4 A;  1BA5 A;  3BG9 A;  2QCO A;  5FLV A;  1ZR4 A;  1AKH A;  4RDU A;  1ZR2 A;  4M3B A;  1RKW A;  1RPW A;  3A02 A;  1VI0 A;  1ZGW A;  4W97 A;  5J1Y A;  2O8K A;  2AO9 A;  3BG5 A;  3JRC A;  3PM1 A;  3O8H A;  3S15 J;  3GTM J;  2GLO A;  2R93 J; 
#chains in the Genus database with same CATH topology
 3DTK A;  4LK0 F;  2LNB A;  4I7H A;  3L00 A;  1JUP A;  5BPI A;  3CCL I;  3LFK A;  4KIB A;  5GAH J;  2DOF A;  2BE5 F;  5IY5 H;  3DP7 A;  2EFQ A;  2GXA A;  1J09 A;  4M9Z A;  5EEG A;  5DS9 A;  4PSW A;  4XBF A;  1WH5 A;  4XKW A;  4O5V A;  2FE3 A;  2CFO A;  5A2Q K;  2IGK A;  1BR2 A;  1QBJ A;  2NVU B;  4E7S A;  4AIJ A;  3I58 A;  4DGW B;  4FX4 A;  3ERM A;  2DO7 A;  2HS5 A;  4A5N A;  4Y4R A;  3E6B A;  4QWQ A;  2WC2 A;  1REP C;  4L5E A;  2BGC A;  2OCC H;  4E7Z A;  2Z16 A;  2I8D A;  1N78 A;  1OQY A;  2LKS A;  4XON A;  2CUJ A;  1PUF B;  3ZQH A;  1AHD P;  2VJ4 A;  4KIC A;  2JA8 J;  2F4M B;  1B1B A;  2P7V B;  2EFP A;  3QOD A;  2M4K A;  4ZJZ A;  4GO1 A;  1LVK A;  2ZJP F;  2AHQ A;  3ZQL A;  2PQ8 A;  3E7L A;  2XKP A;  3V7C A;  3CCR I;  2E2I J;  4BE1 A;  3GWZ A;  4M6X A;  3HGG A;  1K6O A;  1W1W E;  1FPQ A;  3BZK A;  2XVC A;  4CO8 A;  1SFX A;  1F43 A;  3DEE A;  4A3K J;  1UZC A;  1HW5 A;  4IX7 A;  1FOY A;  2XGE A;  3N05 A;  5JR3 A;  3MEX A;  4I99 C;  4IL6 C;  1YTY A;  1JT6 A;  3CP8 A;  4KT5 C;  2TCT A;  3CCJ I;  3HOX J;  3RPU A;  1TW3 A;  2JK3 A;  2R7Q A;  1DUX C;  3Q0U A;  1ZRE A;  3W2V A;  4PSX A;  2V7F A;  5IPA A;  2D1H A;  1MBH A;  1SAX A;  4RGU A;  4B3X A;  5JHF A;  2XC7 A;  1U8R A;  4NC8 A;  1ZG1 A;  1WRJ A;  4LMY A;  1Y1V J;  5EGO B;  3I4P A;  1LQ1 A;  3CJQ B;  4BQN A;  2DJI A;  1LDK B;  2FBI A;  2QZ8 A;  2RAE A;  4H0E A;  2DBB A;  5JLW A;  4OU0 A;  1TWG J;  1VQ7 I;  1G2H A;  2XRL A;  2A5W A;  3ABL H;  4V2F A;  1F5T A;  2F6C A;  4U0W A;  2R7O A;  3DLL F;  2LF7 A;  2GIZ A;  2M7A A;  2KKO A;  4C3J J;  2D2W A;  2IGO A;  2HU9 A;  1RR8 C;  2HDC A;  1YOV B;  4UVC A;  2FNP A;  3K70 D;  1GT0 C;  4MEX F;  3C7J A;  2XB0 X;  2H94 A;  2Q1Z B;  3CLO A;  2L02 A;  3HM5 A;  3P9K A;  3SEQ A;  1G3T A;  3JRG A;  3LAP A;  3I4M J;  1A31 A;  3JRI A;  3OYD A;  3CCY A;  4M72 A;  1WJE A;  3K4C A;  4EV0 A;  1W36 D;  1K6Y A;  1GHC A;  4YEL A;  2DYR H;  3MKL A;  1ZLJ A;  3WE2 A;  2E34 A;  4JX5 A;  2CFX A;  3H5A A;  3VWB A;  2DFF A;  3HDD A;  1R6R A;  2H8R A;  5LD2 C;  1TQP A;  4G8X A;  2HQN A;  5DCM A;  2VC0 A;  1D1A A;  2X48 A;  5M5Y J;  4M74 A;  3HTU A;  4RA2 A;  4CYC A;  1O7F A;  1MJB A;  3H9Q A;  3CME I;  2QUF A;  1R23 A;  4B47 A;  4I6Z A;  1HC8 A;  4M9X A;  3TL4 X;  1MMS A;  3F8F A;  3CO7 C;  3FK6 A;  5JLX A;  5L3B A;  1UCR A;  3GZN B;  2STW A;  1IN8 A;  2IXS A;  3VSK A;  4HLY A;  1IUF A;  2OTJ I;  4RLF A;  1TL8 A;  2N8G A;  2Q2E A;  2PMZ N;  3K4M A;  4A6D A;  3HXL A;  1RET A;  2HOT A;  3H3V K;  3MVP A;  5D4R A;  5M3M J;  1ZG3 A;  2F2E A;  3RQI A;  2W82 A;  3F9K A;  2XRO A;  3OYN A;  4KJZ A;  2CGP A;  4YRV A;  2QF7 A;  1K83 J;  2JA5 J;  4UB8 C;  5E8I A;  4F52 A;  4XLP F;  5K7Z A;  5LGT A;  2PEX A;  4XLF A;  1U9O A;  1QO0 D;  4Z2Y A;  3OYJ A;  3WGH A;  2O6G E;  2Q8K A;  2UZK A;  4RB1 A;  5E20 A;  5K7H A;  1X1P A;  3OR1 C;  3G1M A;  2LVS A;  2P0W A;  4ZDL A;  3ZOB A;  4KIT B;  3H9G A;  2DJN A;  1PP8 F;  2VXD A;  3TDU C;  1IGN A;  2JRM A;  3H5N A;  3CC2 I;  3IUO A;  1X3W B;  1MBJ A;  2FNA A;  4RBO A;  4ZTJ A;  2QSG X;  3R60 A;  3HOW J;  1JKO C;  4BY7 J;  2CH0 A;  3R4K A;  2DI3 A;  1IRZ A;  4EGZ A;  3OSG A;  2VBX A;  1J75 A;  1SFE A;  3O8G A;  1SVM A;  2ZB9 A;  3J81 K;  1BC7 C;  4L0Y B;  1U5T A;  4GDF A;  3Q9S A;  4FHT A;  5ILU A;  2K40 A;  4XSX F;  2M7B A;  3OYA A;  4CCN A;  1XGS A;  1FJL A;  4PFP A;  3TED A;  3PJR A;  4CYD A;  1S3J A;  1KU9 A;  2P81 A;  2HOS A;  3S1Q J;  1YIT I;  5AON A;  2K5C A;  1E2X A;  3HB9 A;  4XOP A;  5FGM A;  2MGQ A;  3NWS A;  1GV2 A;  2IVM A;  2ZXJ A;  2OC6 A;  1XGO A;  3HG9 A;  5ERI A;  3S2W A;  1PYV A;  1E17 A;  4MEY F;  1Z67 A;  4FET A;  1ZG5 A;  3L2Q A;  1XTA A;  2QVO A;  1YS6 A;  4LGW A;  1MMN A;  2BBY A;  3I71 A;  3LAJ A;  2RKH A;  2BV6 A;  5DM7 F;  3DQV C;  4HV5 A;  3D5R C;  3ZMZ A;  3S1M J;  2Y9Z A;  2EIK H;  5HS9 A;  2XGC A;  2ESH A;  1NH3 A;  4KN7 X;  1M1E B;  3MN2 A;  2DFI A;  3SDG A;  4E7K A;  3FHN A;  5DCM B;  3L2V A;  4CYC B;  5HDK A;  4IHT A;  1FEX A;  1WKM A;  5D6F A;  4XQF A;  1B59 A;  3F23 A;  3A1Y A;  4OAZ A;  4XKC A;  4PGG A;  4I09 A;  2LG4 A;  3GFM A;  3JTG A;  4ZDO A;  3JRF A;  1O57 A;  1OCT C;  3ECO A;  3OMY A;  4DNC A;  1OCR H;  1MJ9 A;  2QLZ A;  3K1M A;  1S5L C;  3RSN A;  4A3I J;  1Y0U A;  3KP3 A;  1W4M A;  5E17 F;  2AS5 F;  2ZME C;  5GAG J;  2D1V A;  2VIX A;  3P9C A;  2OZU A;  2PMH A;  2Q2E B;  4BHC A;  1FYL A;  1HKT A;  2M8G X;  3S3M A;  1V3F A;  2FJ1 A;  3WGG A;  4OMY A;  3KFW X;  2RDP A;  3X2Q H;  3I59 A;  5F04 A;  2OPT A;  1Q1H A;  5LGU A;  3IC7 A;  5CVU A;  1W5C C;  3O6B B;  2GM4 A;  2MD0 A;  1R5I D;  2YX7 A;  5FLX Z;  4S0H B;  2K27 A;  3HKZ A;  3HOS A;  2CQQ A;  4EJU A;  2DCE A;  4LB6 B;  4IHS A;  4HDU A;  3LSM A;  4LB5 A;  1JHH A;  2H1L A;  3PSI A;  2WY7 Q;  4IHV A;  3KZI C;  4MQV A;  2CUE A;  2E2H J;  2Y69 H;  2X1E A;  1MDM A;  3TMO A;  3Q5F A;  5LRS A;  1BR1 A;  4A12 A;  1ZAO A;  3DEW A;  3BJ6 A;  5LHG A;  3QU3 A;  3SFI A;  1TT5 B;  3FXK A;  2EZK A;  3B02 A;  1T08 B;  2K4J A;  3AG3 H;  2M34 A;  4L9V A;  1L3L A;  1EH7 A;  3CUQ A;  4RB3 C;  5L3C A;  3Q0V A;  3IWF A;  4DZP A;  3SZG A;  3K7A J;  2VLA A;  4U0V A;  1D3Y A;  1JT0 A;  1FY7 A;  4PJN A;  3G71 I;  1U5T B;  3LFU A;  4FT8 A;  5JVG F;  3PIO F;  1RKT A;  1Z7L A;  2MSY A;  5CKT A;  3ABM H;  4EMS A;  1QPM A;  4RM3 A;  5M5X J;  4Y52 J;  5FLX K;  1R00 A;  2HOE A;  4LIT A;  5ICC A;  3ZN0 A;  2CMP A;  4B43 A;  3D1N I;  1XC5 A;  4RLQ A;  4C2M J;  3W2W A;  1J59 A;  3KYC B;  1TP4 A;  2MAB A;  1ZK8 A;  2Y0M A;  1K4T A;  2HYJ A;  3FMS A;  4BE0 A;  4BY1 J;  4IJA A;  1EKE A;  3LWF A;  2J5P A;  2X85 A;  2BZT A;  3BPV A;  1K78 A;  3U1D A;  2L3D A;  5FRO A;  2COM A;  3BJO A;  1R4M B;  3CZ6 A;  3UNG C;  3U9G A;  5HOO A;  1QPI A;  1UHS A;  3D5L A;  3DPT A;  3H9J A;  1F9N A;  2G7U A;  2V9V A;  4XR6 A;  1ZRC A;  3F8C A;  3KX2 A;  1J7K A;  3O2P E;  3CJN A;  2XIG A;  1JGS A;  2YS9 A;  1WPK A;  2E5Z A;  4LOC A;  2Y30 A;  2VBW A;  1ITY A;  3EYY A;  3DBL B;  4ZDP A;  2MD5 A;  1VQL I;  2NVY J;  3S3N A;  1JGG A;  2H8W A;  5IP6 A;  2MYS A;  3NAU A;  4ZZL A;  2K85 A;  4ABZ A;  2CQN A;  1SC7 A;  2R5Y A;  1UHW A;  4JK1 X;  3CC7 I;  2WTE A;  1D5Y A;  3FM3 A;  1IDZ A;  1JKR C;  1S8N A;  4IHX A;  3VYT B;  4XLH A;  4BH9 A;  2XAU A;  4YFK F;  2KRC A;  5TJJ A;  1DU0 A;  4XL9 A;  4ZYG A;  1SD7 A;  2WAE A;  1WJA A;  4PJJ A;  2G0E A;  2YX4 A;  2ZXI A;  4D7N A;  4EJO A;  4E70 A;  1LB2 A;  1UG0 A;  2DA2 A;  1STZ A;  3GO5 A;  2OD5 A;  3I59 B;  3OYL A;  2IA0 A;  3REO A;  3VEP A;  1U5T C;  1IXC A;  3QPS A;  1XSV A;  3S8P A;  5GP9 A;  2P5V A;  2Y48 A;  2VT3 A;  1YQA A;  5TGT A;  2CSO A;  2XF6 A;  2P5L C;  1CQT A;  2D5V A;  4G6Q A;  4HNU A;  2QM3 A;  1FOK A;  3KP7 A;  3MKY B;  1EF4 A;  3HL2 A;  3JTH A;  3KEQ A;  1MDM B;  2VKD A;  1S72 I;  5K5Q A;  1RKW A;  4ESB A;  4GYG A;  1S9H A;  2YR2 A;  1OMI A;  3BG5 A;  2H6C A;  3JRC A;  2L9V A;  3S15 J;  3OIQ A;  3OV8 A;  1P4A A;  2VAS A;  2K9M A;  4Q48 A;  3CUQ B;  2JWT A;  3O3K A;  1IXR C;  2QWW A;  1B72 A;  3M1C A;  3R0J A;  3MMY B;  2KIF A;  2ZKZ A;  2O8X A;  1U78 A;  1JJ6 C;  3R6S A;  3BR6 A;  3ZP5 A;  4GRI A;  4J00 A;  1WJ5 A;  2LRE A;  2QKL B;  2HFH A;  2FOK A;  2XAQ A;  3DKY A;  4A3E J;  3S2D J;  1Y8Q B;  2MLK A;  3TP3 A;  2PBI A;  2ZJQ F;  4M3F A;  3CDI A;  5F0C A;  4AC0 A;  3KP4 A;  1ZHF A;  1KYZ A;  3Q3S A;  3UKG A;  2QEX I;  2KT0 A;  1Y39 A;  3HBL A;  3VYU B;  3GTK J;  1BIB A;  1IN6 A;  1FTT A;  2W48 A;  1KU3 A;  1QU3 A;  2XAH A;  3WTV C;  5IYB J;  4JX6 A;  2HYG D;  3JRE A;  1A5J A;  1H89 C;  4DOZ A;  3WTS C;  2FML A;  3N97 A;  1K78 B;  1MBF A;  1OIS A;  2M4G A;  4ZTF A;  4CCO A;  1FC3 A;  3C2B A;  1G4D A;  2L7F P;  3KCC A;  4OIN F;  1IRG A;  3ZRG A;  4XN0 A;  4U7B A;  3LA7 A;  4R79 A;  1Z6R A;  4EM2 A;  2O3F A;  2DQR A;  5TIS C;  5F0H A;  3RZD J;  3LST A;  3M8J A;  3OIO A;  2EFN A;  4Y13 A;  5LHI A;  3PNY A;  3QYE A;  2R5Y B;  1DGW Y;  5F64 A;  1ZKG A;  2M0C A;  2ID3 A;  2LMD A;  1MBG A;  1VND A;  4JX4 A;  2Z1D A;  2A6E F;  3FDY A;  4ZZD A;  1D0X A;  4PDK A;  1WHU A;  1YX3 A;  3I0T A;  1RUO A;  3WU2 C;  3K1P A;  1IW7 F;  1D0Z A;  2L4M A;  4NB5 A;  5F27 A;  2DA7 A;  2GOM A;  4OOI A;  4B8X A;  4A3F J;  2K7L A;  3F21 A;  2A07 F;  2EV0 A;  1IN5 A;  5IOY A;  1XSD A;  4G9Y A;  2A68 F;  5J1R A;  2W85 A;  4M71 A;  1I1G A;  3BC8 A;  1OFC X;  2E5N A;  1Z0X A;  3CDH A;  2ZNY A;  2B9S A;  1Y8R B;  5B1A H;  1ETX A;  4WK8 F;  2A6H F;  4PJM A;  5FJ8 J;  2EIM H;  3IL2 A;  2JZY A;  3E0J B;  5F6F A;  4CCM A;  4AM3 A;  3FF5 A;  3KE2 A;  1BBY A;  4RAY A;  3S93 A;  1WJF A;  2D45 A;  1XCB A;  5K5R A;  1S7O A;  2YU9 J;  5E1X A;  1VQ8 I;  2Y9Y A;  2EIN H;  4B44 A;  3DPL C;  1DGR M;  2JRT A;  5BNG A;  4EAT A;  1QHH D;  2DFH A;  5HLT A;  1APL C;  3SQN A;  4Z6Y A;  4H4K C;  2EPF A;  1XMA A;  4N4O B;  2V1X A;  1ZRD A;  4G7O F;  4N9I A;  1B72 B;  4PJL A;  1ETO A;  4KMF A;  1XX5 A;  3ZCO A;  3PFI A;  1B9M A;  1WCM J;  3DCF A;  2GOX B;  4S04 A;  3VDX A;  2BY1 A;  2LY2 A;  3LSR A;  2LKX A;  2PJR A;  1UAA A;  3LL7 A;  5H2F C;  2P7C B;  1T56 A;  5E79 C;  5D5X B;  4B4C A;  5LLQ A;  1Z9C A;  5KAI C;  1GV5 A;  1K61 A;  1HDP A;  2HGC A;  1AU7 A;  5ICE A;  2M0M A;  3H5R A;  2K9N A;  4Y15 A;  2DK5 A;  2KPM A;  4BHB A;  4PGH A;  3CLQ A;  1N25 A;  5DYM A;  2K3P A;  3LSP A;  3ABK H;  2LD5 A;  1SMT A;  2NOJ B;  5EG0 A;  3JR9 A;  1H88 C;  1ZTR A;  1IN4 A;  3IP4 B;  5IOZ A;  3GX4 X;  3SEZ A;  1FBS A;  3LSH A;  5D5U B;  1GVJ A;  4NDL A;  4BKX A;  1A04 A;  5F08 A;  3F6O A;  3MWM A;  5BQT A;  2L2O A;  5K7F A;  5FRM A;  3BTL A;  1I6X A;  2HQA A;  3IH4 A;  1YO5 C;  2HKO A;  4BJT A;  4XLC A;  5IYC J;  3RZO J;  1G3Y A;  2L9N A;  1D0Y A;  1TT0 A;  4A0Z A;  5HNF A;  3GTQ J;  3SZP A;  1YIJ I;  2CRG A;  1TWC J;  2JN6 A;  5B3S H;  3GXO A;  4HX7 A;  5FKL A;  2HPM A;  4IHW A;  2EZL A;  3ECH A;  3LSJ A;  2GA1 A;  2A69 F;  3C3W A;  2PMZ A;  5D6E A;  2WY8 Q;  3BDD A;  3G4S I;  3I53 A;  5CVJ A;  4Q47 A;  1A6I A;  2JPB A;  2L9R A;  4UB6 C;  3FWE A;  2XPU A;  1P92 A;  2XAJ A;  5HS7 A;  1MNM C;  3S17 J;  2EV6 A;  4UVA A;  2KQR A;  2WWY A;  3MD2 A;  3W3C A;  1IF1 A;  1SFO J;  2EZI A;  2MLG A;  2IA2 A;  1B8I A;  1W5S A;  5J40 A;  2ACJ A;  2VOD A;  3H1C A;  5KCM A;  1DP7 P;  1JE8 A;  3DKW A;  4BUP A;  2OV7 A;  1FBQ A;  2BVM A;  2KIM A;  4YG2 F;  3FZV A;  2JMW A;  4BDY A;  4RMN A;  3QP5 A;  2CUZ A;  2YSR A;  2JSP A;  2PMU A;  1VF9 A;  1VQP I;  1MBE A;  5FKO A;  1R1V A;  4CCJ A;  1TNS A;  4XN3 A;  2R7S A;  1HBX G;  2ZME A;  1BC8 C;  2K9S A;  1YX5 A;  3RCO A;  5BS6 A;  1MD0 A;  5LEK A;  3JRD A;  5HS8 A;  2V6E A;  2WAF A;  1XSX A;  1HOM A;  3E5Q A;  3QYB A;  3OR2 C;  5J4Y A;  4ENK A;  1KQ0 A;  4NHJ A;  1FWZ A;  3OYE A;  2ZXH A;  2Y75 A;  3GVA A;  3HOU J;  4R1H A;  4U7D A;  2IBD A;  1IAW A;  1YLF A;  3ZMV A;  3JSO A;  2XV4 S;  1IRF A;  3ASN H;  4IOA F;  1ENH A;  1SD5 A;  1O3S A;  2CJJ A;  2R7T A;  2COB A;  4HYE A;  1E3P A;  2QEN A;  3WTY C;  3CO6 C;  3CCM I;  4A2U A;  1SD4 A;  2OUM A;  2PJR B;  3F0C A;  2KIS A;  1S6L A;  2GIV A;  4BHP A;  2V1D A;  2DPU A;  2MC4 A;  5GAE J;  3ZPL A;  1KU7 A;  3T1B A;  1QZY A;  2ECC A;  3TQN A;  1VQN I;  1JUM A;  2IJL A;  1VQM I;  3JAM Z;  1X1A A;  2BY0 A;  4P55 A;  5FFX A;  3FIW A;  4YII A;  4YFX F;  1JI8 A;  5EG0 B;  3RKY A;  1AA7 A;  4DW6 A;  4YIR X;  2P8T A;  3GFI A;  1U6G A;  3LA2 A;  1ZGA A;  4M3G A;  1W0T A;  1BI0 A;  1NG7 A;  3I64 A;  4EQQ A;  4C9Y A;  2G9W A;  3G6E I;  3EUA A;  2ID6 A;  5E1W A;  4QTR A;  5C4J J;  3OOU A;  2KIU A;  4MIM A;  3A03 A;  2RN7 A;  3A2K A;  3GZ5 A;  2CU7 A;  4M3E A;  4I01 A;  3WTU C;  3JRH A;  2L5Q A;  3AFH A;  3K0L A;  5FKK A;  2M3A A;  3K69 A;  1SFK A;  2GZW A;  2XDV A;  5M3F J;  3L2R A;  3IHU A;  1FLI A;  1FYM A;  1S7A A;  2HTJ A;  4HST A;  5C3E J;  4KMU X;  3AL0 B;  1RR7 A;  5HLG A;  3M07 A;  1XCV A;  3MKZ A;  4CCK A;  4F3Q A;  5KNL A;  4IRI A;  2HVR A;  2GXG A;  2BYV E;  2LF8 A;  2WV0 A;  1FOX A;  1QHG A;  1ETQ A;  2RQQ A;  2LRD A;  5DTD A;  2BY2 A;  1B8I B;  3HOY J;  1G6N A;  1YJN I;  1HW1 A;  1MBK A;  1YW9 A;  2LBF A;  1UMQ A;  1V5G A;  2EK5 A;  2IRF G;  1TW2 A;  2AXL A;  1IZ1 A;  4BYY A;  4LJZ F;  1D8K A;  1TNT A;  3B6A A;  3BR0 A;  4M9S A;  2F5V A;  2TRT A;  2FQ4 A;  4OAY A;  1O7L A;  3FKI J;  2DA3 A;  5DDG A;  2L01 A;  4CH7 A;  1POG A;  1BJA A;  1GXP A;  3GUD A;  3CF5 F;  2ZME B;  1ZLK A;  4AYB N;  4F55 A;  2LP0 A;  2XB5 A;  1P4W A;  3LOC A;  2HR3 A;  3F72 A;  2W4S A;  4HX4 A;  1FP2 A;  4QLC U;  1HF0 A;  3DPU A;  3MZ8 A;  4Q4Z F;  3M4O J;  1JUS A;  1IXS B;  2YU3 A;  3ZXS A;  4WCG A;  1TC3 C;  4KIS A;  3FXO A;  2DA5 A;  1ODD A;  2W00 A;  1U3E M;  1RZ4 A;  2GAU A;  2DW4 A;  2DAO A;  2XSJ C;  4QSH A;  3ROU A;  5B5E C;  1OCP A;  1P7J A;  2NVT J;  3GYH X;  2FRH A;  5HNH A;  4A3C J;  2FMY A;  4PK4 A;  4AWX B;  2OTL I;  4WXC A;  4DJA A;  2RNJ A;  3TO7 A;  3FXJ A;  2LR8 A;  3RKQ A;  3LMM A;  1Z1D A;  1BI1 A;  2ISY A;  3B73 A;  4BEH A;  3L2U A;  1TLH B;  1WJD A;  2Z5U A;  4AUX A;  1FP1 D;  2HQ5 A;  4C2U A;  4P5O A;  2E71 A;  2EA4 A;  2ELH A;  2E2J J;  2NAZ A;  1J5Y A;  4MHG A;  3H0D A;  4EGY A;  1O3Q A;  4YEJ A;  2CV1 A;  4KNY A;  3DTI A;  3VYR B;  2CW0 F;  2X6W A;  4BNC A;  4CSW A;  3U2R A;  2YUS A;  3OYC A;  1GDT A;  1YE9 A;  3AG4 H;  4XRM A;  3AL0 C;  3KZZ A;  3U21 A;  3GFL A;  2LDU A;  9ANT A;  4E4H A;  5IYD J;  4DBR A;  2BHZ A;  2B63 J;  2HZT A;  3HYI A;  4J19 A;  3EET A;  3MCZ A;  4AIH A;  1RES A;  1H9G A;  1BI3 A;  1R22 A;  2CQ7 A;  1ACI A;  4OIO F;  2XSD C;  2BXZ A;  3CDL A;  1XMX A;  4WX9 A;  2DDA A;  2XGX A;  1I3Q J;  3IAM 2;  2JSC A;  3P9I A;  4MO7 A;  3CTA A;  2XAF A;  1JTX A;  3OL4 A;  4XOR A;  2KHM A;  4BAY A;  3DF8 A;  4A93 J;  4P96 A;  1EV7 A;  1IV6 A;  4UNO A;  2M87 A;  1QVU A;  4A0X A;  3TOA A;  1RIO H;  4L5I A;  3KZY A;  2BY3 A;  1XDS A;  2ECB A;  3PSF A;  4HZF A;  3ZQ7 A;  2DMN A;  2DTR A;  2H27 A;  1TQI A;  1BW5 A;  3CUO A;  3BG9 A;  3IKV A;  2HVS A;  3CCV I;  5LFA A;  1ZR2 A;  1RPW A;  2FBK A;  5CVI A;  4UHT A;  1VI0 A;  3BCB A;  1D8J A;  1ZGW A;  4W97 A;  3T8R A;  5KHD A;  2DLL A;  1CF7 A;  5J1Y A;  2O8K A;  2VQG A;  2AO9 A;  4XSZ F;  3PM1 A;  2LBF B;  2UV1 A;  2EIJ H;  3GTM J;  4HLX A;  3CCE I;  2R93 J;  3ZQQ A;  4ETS A;  2H6B A;  4HDV A;  1QQI A;  4A0Y A;  4BE2 A;  5EZG A;  2VUM J;  1BN5 A;  2I10 A;  1WQ2 A;  4XRS G;  1DPU A;  4BBR J;  1BOB A;  2V6C A;  4GGG A;  4L18 B;  3VPR A;  3BP8 A;  2Z9O A;  4P1W A;  3HRU A;  4II3 A;  5EEA A;  1T39 A;  3K4K A;  2NRA C;  1I6H J;  1H8A C;  2IS1 A;  5B1B H;  4Y7N J;  1YS7 A;  3FX3 A;  4I02 A;  3HPG A;  4D0P A;  2R7W A;  5TRD A;  4EJV A;  2HI3 A;  2EZH A;  4MGR A;  3UR3 C;  3GME A;  2O5R A;  2EIL H;  2ELK A;  4CDG A;  4HF2 A;  3S32 A;  4FCY A;  3LA3 A;  2XKO A;  3WHB A;  2F4I A;  3WGI A;  2Y0S N;  5F0F A;  1G3W A;  2JUC A;  4U0Y A;  5JI6 A;  2W1O A;  1PUE E;  3COA C;  4P9F A;  1R1T A;  3QOP A;  3CCU I;  1X1C A;  1DU6 A;  1Y56 A;  1OKR A;  4HEA 2;  2ISZ A;  5AIQ A;  3OS2 A;  2VE8 A;  1T0F A;  4ESJ A;  1Z77 A;  1WGX A;  3NRV A;  1KA8 A;  4IRG A;  4QPQ A;  5D5W B;  3J80 Z;  5LBQ A;  1I1S A;  3GLL A;  1LNW A;  1OLT A;  2M1B A;  4OIR F;  3TW6 A;  4BEH B;  3QOE A;  2L9S A;  4TV7 A;  2IGM A;  3GTJ J;  2ZC2 A;  3DU6 A;  4XRF A;  4NUB A;  1O3T A;  5JHU A;  2JA6 J;  4UV8 A;  5ICG A;  4EJW A;  2E1N A;  5FB2 A;  1DQU A;  4RS8 A;  3G2B A;  2ME0 A;  5E8G A;  4DBQ A;  3D5S C;  2KZV A;  2HXI A;  3OWT A;  4A5M A;  3PNV A;  4ENJ A;  1UHM A;  2V4J C;  3HHH A;  1T38 A;  3S16 J;  1NK2 P;  4YFN F;  5E3M A;  1O4X A;  3H35 A;  1IUY A;  3CMY A;  3BZ6 A;  1HW2 A;  4Y3O A;  4KFC A;  2VQC A;  5CYV A;  3BR3 A;  4LG3 A;  4ZYD A;  2VBZ A;  3PQK A;  3RKX A;  3ZQG A;  3G1L A;  2P4W A;  3A0H C;  2ZXW H;  2QQ8 A;  2X6Y A;  2E1M C;  1EH6 A;  1YW7 A;  2A3S A;  5FO5 A;  3HSF A;  4G6D A;  3TBI A;  1IN7 A;  2KRF A;  3IAS 2;  2IS6 A;  1MMA A;  1OCC H;  3QAH A;  3K4L A;  2E36 A;  2DPD A;  1QZZ A;  2X51 A;  2E1O A;  3S3O A;  3FXR A;  3WU1 B;  1ON1 A;  1ZGJ A;  5DD4 A;  4HW0 A;  4HQM A;  2ZNZ A;  2WAQ A;  3ABU A;  3SDB A;  5L3G A;  2QKM B;  3F8B A;  1D5V A;  4D5C A;  3EYI A;  5ILS A;  2JVG A;  1IG7 A;  3BJA A;  2UXX A;  4MTE A;  1X19 A;  1CF7 B;  3BPX A;  1ERD A;  2DA1 A;  5EYR A;  1YHQ I;  1GUU A;  5JVT A;  2KLO A;  4HA8 A;  4WWC A;  2QGU A;  3KP6 A;  4I0B A;  1RNL A;  4HPQ A;  3ONQ A;  3MQ0 A;  2A5Y B;  3JRA A;  2EB7 A;  4L9T A;  3OYB A;  2NNY A;  1V4R A;  2B0L A;  4RM2 A;  4D5F A;  3S2H J;  1A6Q A;  1T95 A;  5FKN A;  1F36 A;  3DEU A;  2DOE A;  2VI6 A;  3SYT A;  4B48 A;  1FYK A;  4HF0 A;  4BS9 A;  1ZRF A;  5DUK A;  3S14 J;  5C4X J;  3CP2 A;  2K9L A;  4I98 B;  3C2H A;  3ZMD A;  4A3L J;  1P4X A;  2HWV A;  5L3E A;  2HYF A;  3G73 A;  3CQZ J;  4CZZ A;  5HDN A;  4A3G J;  3KET A;  5FRN A;  1AWC A;  3ZQF A;  4JP0 A;  4CXF A;  3HRS A;  2BEO A;  2BW3 A;  3QWL A;  1DPR A;  4EEF G;  1HKS A;  3VYS B;  3DBR B;  4X0G A;  5CVR A;  2AXT C;  5GTH C;  1K7A A;  2LY1 A;  3KLN A;  1FZP B;  4DQ2 A;  1J9I A;  1T8I A;  1IDY A;  3FXU A;  3ZQC A;  4D7M A;  2H1K A;  2CO5 A;  1Z3X A;  1C0W A;  2DMP A;  4EM0 B;  4KN4 X;  2CW7 A;  4LD5 A;  5D8L B;  3V7R A;  4PJ0 C;  3TOB A;  3GEZ A;  2RV8 A;  5GPA A;  3ABT A;  3ZMU A;  3JRB A;  4DYR A;  3FKJ A;  3F8M A;  4BBS J;  2R7D A;  5CLS A;  1ZYR F;  3QPT A;  4IPA A;  4C30 A;  4CZC A;  3K9T A;  5GAD J;  1XPX A;  3GFJ A;  1FX7 A;  3BCA A;  1S29 A;  3K4J A;  4K2E A;  4XIC A;  2MC3 A;  1ETV A;  2BXY A;  1VQO I;  2L54 A;  3I54 A;  2FBH A;  3ZR8 X;  2E7W A;  2X1C A;  4CA0 A;  4KIG A;  3VOD A;  3OS1 A;  2HDD A;  2IA1 A;  4Q5S F;  2XF5 A;  2AQE A;  2NOG A;  4BQO A;  5J8C A;  1X3U A;  3C18 A;  4FQG A;  3RPQ A;  3V7S A;  1XDU A;  5FKM A;  3U1K A;  3I56 I;  4HX8 A;  3A01 A;  2Z99 A;  4LG0 A;  1ZH5 A;  1JTY A;  3CCS I;  2NYX A;  3VOE A;  2O03 A;  4XM3 A;  4HQE A;  3QU6 A;  2WAQ N;  1UG2 A;  4UV9 A;  1MSE C;  3F22 A;  3H3U A;  3D0S A;  2B7E A;  4L0Z B;  1G8X A;  5ICF A;  1UFM A;  2DA4 A;  4ANJ A;  5KVR A;  2MBF A;  5E3L A;  1YJW I;  2DMU A;  4XID A;  3PO2 J;  1ETK A;  1VQ9 I;  3FM5 A;  1X1D A;  1FMW A;  3B6C A;  4IZZ A;  3EUK L;  4II2 A;  3HC7 A;  1T0F C;  4XLN F;  3WG9 A;  1LFU P;  5J1U A;  3PO3 J;  5HVQ C;  4KIF A;  2TDX A;  1KQ9 A;  2X6O A;  5GTI C;  2FOW A;  1HA8 A;  2HOA A;  5C44 J;  2MG4 A;  2VON A;  3DLA A;  3V4G A;  1H0M A;  1FMV A;  5EF6 A;  5E1Z B;  4B1R A;  1UST A;  3BTI A;  5K5O A;  3K6G A;  3GBG A;  3BR1 A;  5J47 A;  4XOT A;  2K86 A;  4HSR A;  3EQL F;  3HZJ A;  5FD6 A;  1U2W A;  2BHY A;  5DD8 A;  2KDZ A;  2KMU A;  2KJC A;  5BMZ A;  1B6A A;  3FIS A;  5BOX A;  4XLE A;  4D1Q A;  4P9U A;  2OF7 A;  2V79 A;  2EBI A;  4FTH A;  3GZ6 A;  2MH9 A;  2DA6 A;  3H92 A;  3L2W A;  5D8K B;  2R5Z A;  4X1E A;  1IRX A;  2E7X A;  3CCQ I;  1LDD A;  2BW3 B;  2NNN A;  3VFZ A;  4B3A A;  2JPC A;  3HSR A;  2VBY A;  3QYF A;  3CJR B;  2WA0 A;  4Y33 A;  1WZ2 A;  1LDJ A;  2EFO A;  2MH2 A;  4O3M A;  2PFB A;  4C3I J;  1J2X A;  3M9A A;  2VJI A;  2ZSH B;  4G12 A;  4L5J A;  2PX9 A;  3WTW C;  2DQL A;  2ME6 A;  4LIV A;  3BOQ A;  2L0K A;  3QRF F;  2RC4 A;  2CQK A;  2LOO A;  2VJ5 A;  3OIP A;  5IP9 J;  1OYY A;  3J7Z I;  2DOD A;  2JTV A;  3OOP A;  1WJB A;  2NS0 A;  3LSI A;  5B66 C;  4NBQ A;  2DFE A;  3RYP A;  3PQJ A;  1KQ8 A;  4F7Z A;  3V8J A;  2AQF A;  2UXN A;  4NC6 A;  2QA4 I;  4IQ4 A;  1LEB A;  2JJ7 A;  1D1B A;  4RB2 C;  3JSP A;  4RAF A;  3RKW A;  2RGV A;  1WFX A;  1DP3 A;  1HSJ A;  1Z21 A;  5FLM J;  2L7M P;  3BY6 A;  3V42 A;  4HF1 A;  2CQX A;  3ZN1 A;  4AIK A;  2FF4 A;  3WHC A;  2F5C A;  1EH8 A;  1YJ9 I;  3EUH A;  3KLO A;  5EEH A;  2PLY A;  4BAC A;  2OQG A;  4HNV A;  4AVP A;  2FU4 A;  2HDW A;  4N4N B;  1BW6 A;  1WVR A;  3OL3 A;  2KFD A;  1YI2 I;  3PIP F;  3K4N A;  1XG1 A;  3IRQ A;  2GQQ A;  4I0A A;  2O61 A;  1JKQ C;  1N77 A;  3I5U A;  2FD5 A;  1SFU A;  2R7R A;  1R1U A;  3A01 B;  4LG0 B;  1GXQ A;  2VQL A;  1G3S A;  2RVC A;  3HPH A;  3IH2 A;  2W25 A;  1EA3 A;  4IF4 A;  4IO9 F;  2M2E A;  1A36 A;  1E0E A;  1Q1V A;  3LQR A;  2MFZ A;  3E1S A;  4XK4 A;  1FNN A;  3BZC A;  3FMQ A;  4LK1 F;  2OCE A;  4A6E A;  3F6V A;  3H36 A;  1SAU A;  1FOW A;  1VFC A;  4M6V A;  4UUS A;  2KJB A;  1MIJ A;  3T8T A;  2VJJ A;  4AYB A;  4G7Z F;  3IWZ A;  3GTO J;  4CGZ A;  3KP2 A;  1VQ6 I;  2HTS A;  3RIR A;  3FBI B;  3KP5 A;  1OYW A;  3L2C A;  1X2N A;  3SFZ A;  5E3N A;  1R71 A;  4IVN A;  5IT9 Z;  2Z33 A;  1V5E A;  1OCZ H;  2OQR A;  4BL0 B;  3FK7 A;  4LFU A;  3RJP A;  5IP7 J;  1I39 A;  4V2G A;  1R4N B;  4OIQ F;  5FD5 A;  2XAG A;  3HIF A;  2V9K A;  2I5U A;  3M8F A;  3GW2 A;  3OYF A;  3WOD F;  2E1C A;  5M5W J;  1JXS A;  1BJZ A;  3E5X A;  2F4O B;  2R5Z B;  3W6V A;  4IEJ A;  1ZQ3 P;  2CS3 A;  3CJT B;  4GCV A;  4YIF A;  1R7J A;  4EM1 A;  1R5H A;  1NTC A;  3F3X A;  2R7Z J;  1NK3 P;  1LE8 A;  2F48 A;  1FIP A;  2VB6 A;  3LNQ A;  1TBX A;  1HCR A;  2HKX A;  2M5W A;  1FTZ A;  5IT9 K;  4DZJ A;  4RB0 A;  5EJC A;  3SHF A;  1YYV A;  2X4H A;  2H09 A;  2KL4 A;  3DU5 A;  4XRS A;  4I2O A;  2JVH A;  3HRM A;  3HOT A;  5F1J A;  3TO6 A;  4BQQ A;  3KYL A;  1OCO H;  2ZJR F;  1ULY A;  2XUB A;  1K4S A;  2DT6 A;  1ONV A;  1BA5 A;  5FLV A;  3I9V 2;  1WI9 A;  1AKH A;  4RDU A;  4M3B A;  2OBP A;  3FXQ A;  3I3L A;  4R8H A;  3RI4 A;  2CG4 A;  2WBM A;  2W84 A;  4U87 A;  1LVA A;  1UJ8 A;  2DU9 A;  4N0B A;  1EJ9 A;  2Z3Y A;  1XGN A;  2GLO A;  1G59 A;  3ASO H;  1ETW A;  4FAS D;  2VKH A;  1H9T A;  1OYI A;  1W7P A;  3JAM K;  4UY8 I;  3FMR A;  1SAN A;  5EDN A;  5ILV A;  3HEF A;  4FX0 A;  2LH9 A;  2KRH A;  5CQE A;  3E97 A;  1VQK I;  1P2F A;  1K79 A;  1ZAR A;  2RRE A;  5DEQ A;  4M3D A;  2HEO A;  3NEU A;  5L3D A;  1KON A;  1PDN C;  2OA4 A;  3E6M A;  3DFG A;  4A69 C;  2NXN B;  3NWT A;  1HQC A;  1MH4 A;  1WI3 A;  1LEA A;  1HXD A;  4C3H J;  1MKM A;  3ML6 A;  3OSF A;  3NQO A;  2R4G A;  3N4M A;  1F1Z A;  2NVX J;  1OPC A;  3EDP A;  3J81 Z;  3BG7 A;  2L7Z A;  3BTC A;  3A0B C;  3M8E A;  4UUS B;  3CC4 I;  4KDP A;  1FBU A;  4JOM A;  2K9Q A;  3ZMS A;  1XMK A;  2C6Y A;  2OAZ A;  3Q0W A;  2V9P A;  3LSK A;  1TWF J;  2M45 A;  3QPL A;  1IV8 A;  4MLO A;  1SMY F;  2XPV A;  1Y1W J;  1R36 A;  2KZG A;  1T33 A;  3MAJ A;  2ZSI B;  3OYG A;  3KEO A;  2IPQ X;  3L9F A;  1QNT A;  2VE9 A;  4LLL A;  1E3O C;  3I55 I;  6PAX A;  2VT2 A;  2Y0S A;  1TWH J;  1D1C A;  3DBH B;  4E7L A;  4XLA A;  1JKP C;  2XPW A;  3QPH A;  5LEJ A;  3GLX A;  4LLN A;  4UVB A;  5DUI A;  3K2Z A;  3PL8 A;  2A6T A;  1XGM A;  2IP2 A;  2WB1 A;  2O9L A;  3KPH A;  4D9J A;  3ZMT A;  2P5K A;  2Q0O A;  5J4V A;  2A05 A;  4N9H A;  3HJE A;  3BTJ A;  2FSW A;  1JHF A;  2IAI A;  4Y17 A;  3HGY A;  4HV6 A;  1PVE A;  2F5F A;  4A3D J;  1WSU A;  2GA2 A;  4RGR A;  4GFB A;  5H20 A;  3J7Y J;  1W5T A;  1R49 A;  3EUH C;  1FT9 A;  2XGD A;  1P6R A;  3E6D A;  1WJC A;  5KK1 A;  1RRJ A;  1LE8 B;  4CHU A;  1R58 A;  4ZC3 A;  1CGP A;  5E3O A;  3ISP A;  3I4N J;  3DKX A;  2X9D A;  2FEZ A;  4RAG A;  4UUV A;  1Z91 A;  4FE4 A;  4CIC A;  2EWN A;  3L1P A;  1Y6I A;  3BG3 A;  1E3H A;  2WAD A;  1V54 H;  1S7E A;  1X58 A;  4BXF A;  1TZL A;  1XN7 A;  5F1R A;  2ZCW A;  2IS2 A;  2ADU A;  4MFE A;  1LFB A;  2ZBK A;  2R0Q C;  1FSH A;  2W57 A;  3CMA I;  1KGS A;  3SZT A;  1V5F A;  2QQ9 A;  3FBN B;  4CCL A;  3E6C C;  3OS0 A;  4M73 A;  1AKH B;  2CV2 A;  3OYM A;  1LUJ B;  1HST A;  1NHA A;  1HDD C;  4MFD A;  2HXO A;  2P6S A;  2NS7 A;  5IT3 A;  4NC7 A;  1XD7 A;  3SXY A;  2FQ3 A;  2YPR A;  5DCF A;  1ZN2 A;  2LTP A;  3M3Y J;  1L0O C;  2DTZ A;  4JBA A;  4NQW A;  4QPO A;  1OR7 A;  1W7P B;  2JA2 A;  4FIS A;  3OYK A;  4WXH A;  3MFK A;  3KYD B;  4HAM A;  4NNJ A;  2ZFW A;  2R7X A;  3Q9V A;  1RC9 A;  2R7U A;  3W6J B;  4X6A J;  3R61 A;  1SEU A;  2QSF X;  4E6K G;  3IV5 A;  3JW4 A;  1OJL A;  2J5O A;  1SD6 A;  2W7N A;  2ICW G;  2WV1 A;  1P7I A;  3BR5 A;  3QP6 A;  1X2M A;  4A3B J;  2VOO A;  1PJR A;  2ESN A;  2E1M B;  4F92 B;  3S1R J;  1TWA J;  2VOP A;  2GXB A;  5D5V B;  4ITV A;  2R3S A;  2L7K A;  1IO2 A;  2QYO A;  3RDI A;  3GTP J;  2QSH X;  1YFH A;  3DTE A;  3AKZ A;  4IOC F;  2EQR A;  2EA2 A;  3SJM A;  1BI2 A;  1LKX A;  3RTR A;  4IQJ A;  4KYW A;  1MND A;  1B4A A;  3GCM A;  3G1O A;  5EZH A;  3OYH A;  4G7H F;  1MH3 A;  4U88 A;  1YIO A;  2DN0 A;  4HG2 A;  4J01 A;  4AID A;  2FA5 A;  3WTT C;  4ZYE A;  5CPR B;  3T5X A;  3TDZ C;  3TGN A;  2KP6 A;  4HRI A;  1MW7 A;  1QZE A;  2WB1 N;  2IT0 A;  3K2A A;  4ASN A;  1ORK A;  1X4P A;  4RGS A;  4EVI A;  4E7H A;  3BR2 A;  1X4O A;  2ZO4 A;  1ZEL A;  2HVQ A;  1DDN A;  2BOL A;  3OY9 A;  3J7A Y;  5J6X A;  2VPR A;  2XAS A;  3HUG A;  2Y2Z A;  4BQA A;  1NG6 A;  1RUN A;  3DXJ F;  4L9N A;  3P7N A;  4G6T B;  2KDO A;  3FHZ A;  4AU7 A;  2ZJ2 A;  1IC8 A;  3W2A A;  2FXA A;  1Z7U A;  1JJ8 C;  2XF7 A;  2LKP A;  4L9J A;  4DYQ A;  4HNT A;  2IS4 A;  1IJW C;  2V1U A;  1N75 A;  3HOZ J;  2FX0 A;  1HKQ A;  2E19 A;  4JYK A;  3V8L A;  4BGD A;  4LIU A;  4HOB A;  2LY9 A;  3H0G J;  4KA4 A;  3K10 A;  1AOY A;  1XB4 A;  3W6K B;  2XHK A;  3IKT A;  3E5U A;  2XRN A;  4CUG A;  3GTL J;  3ERE D;  3CES A;  3VSL A;  1SVL A;  2VXZ A;  2MA3 A;  2VN2 A;  2RNG A;  2UUZ A;  4E7J A;  4BXU A;  3OYI A;  3J80 K;  3AG2 H;  3EPZ A;  1UB9 A;  2EFW A;  1GLN A;  5DM6 F;  1QGP A;  4MNU A;  4G94 A;  5E18 F;  4ENN A;  3GTG J;  2CUF A;  4RGX A;  1I5Z A;  2ELJ A;  3VB2 A;  1F4K A;  2NVQ J;  1FIA A;  2KIQ A;  3TW7 A;  4NQW B;  2VQH A;  4XKB A;  5J8F A;  1QVT A;  1T98 A;  5AIP A;  2HPI A;  2DMT A;  5D4S A;  2Y31 A;  1VTN C;  2LLK A;  1BL0 A;  3V8K A;  2VKE A;  3KIO A;  2JA7 J;  3BQZ A;  1VQ5 I;  4W1U A;  1UEL B;  5CQG A;  5GPC A;  1LJ9 A;  1XS9 A;  3LSG A;  2QQB A;  1Z3Y A;  3PUB A;  4WXD A;  2CWE A;  4BXX J;  3WTZ A;  3CF2 A;  4UUT A;  5CVV A;  3HHG A;  4OMZ A;  1BOA A;  4M6Y A;  1QA6 A;  5HLI A;  4V19 K;  2W24 A;  3H3Z A;  1LPQ A;  1HLV A;  1KU2 A;  2G7H A;  3HKZ N;  2E35 A;  5K1Y A;  4B09 A;  4KUM A;  3NAR A;  2JT1 A;  4KT6 A;  2JQ7 A;  4IXA A;  1MNE A;  1I3A A;  1U9N A;  3PNT A;  5LGN A;  1MMG A;  1VQ4 I;  4BJ6 C;  1A35 A;  3IH3 A;  4MQ9 F;  4HBL A;  4ON0 A;  4ZYA A;  1YRN A;  2PJP A;  2QBY A;  1U8B A;  3R0A A;  4GXO A;  2DXI A;  5HLH A;  2M8E A;  4BU2 A;  3A4C A;  2X1D A;  4IRH A;  5LRR A;  2ZFU A;  3RPU D;  2NS8 A;  3C1D A;  1BIA A;  2F5D A;  2EJR A;  3ZQI A;  3HRT A;  4GYI A;  1Z6T A;  5JFR A;  3L09 A;  5J3L A;  1ETY A;  3BT9 A;  2X6X A;  3M7G A;  3HUG B;  3PUF A;  1SVO A;  4ENM A;  2E60 A;  3BLY A;  2MW8 A;  2LC2 A;  1O3R A;  1USS A;  4F91 B;  2RQP A;  3K1N A;  2IGN A;  1ON2 A;  2V26 A;  3WU0 A;  1BM9 A;  3WG7 H;  4E7I A;  2K4B A;  2DT7 B;  1LFP A;  3MKW B;  1OR7 C;  2QQA A;  3J7A O;  3HTS B;  3KEY A;  2OU2 A;  5L3F A;  1X1B A;  1P9Q C;  3FXL A;  4PUS A;  3DWL E;  3E3V A;  2R7F A;  3BWG A;  2O0Y A;  5H6R A;  2FUG 2;  2LSO A;  4QIW N;  2IW5 A;  2CV0 A;  4I76 A;  1PP7 U;  3WE3 A;  2P6T A;  1MJA A;  3QQA A;  4PZJ A;  1X3Z B;  5ED4 A;  2DK8 A;  2DT5 A;  4OIP F;  2VL8 A;  2CYY A;  1I27 A;  1WH7 A;  1R9T J;  1B9N A;  2LK2 A;  4PCQ A;  3G3Z A;  3K4B A;  2IEK A;  4XKV A;  2GWR A;  2DYS H;  5HOD A;  4JQF A;  2R92 J;  3TP0 A;  4A3M J;  3P5J A;  1YG2 A;  2R7V A;  3WTX C;  2OJE D;  2X0L A;  1PUF A;  1R5G A;  1U0J A;  1W7P D;  4IKF A;  4EJT A;  5HDG A;  2BVL A;  2OZ6 A;  2VKV A;  1MGT A;  2LFB A;  5LHH A;  2PN6 A;  3C2G A;  3JCU C;  2HNH A;  3GF2 A;  3LQQ A;  3IRR A;  3CD6 I;  5DV5 A;  2ETH A;  4RAZ A;  2Z2S B;  3M1E A;  3TO9 A;  3AG1 H;  4O6J A;  1V55 H;  3TKY A;  2M9H A;  3BRO A;  3BQY A;  2K02 A;  1Z05 A;  4LLG F;  4ZYH A;  2V1N A;  4BJ5 C;  3ELK A;  2VPL A;  1MZB A;  3CUQ C;  1Y0N A;  1GVD A;  4BDZ A;  2K3F A;  1T6S A;  2EV5 A;  3CMM A;  1KZH A;  3F8N A;  4MTD A;  4A3J J;  1FSE A;  3RQ4 A;  2DOA A;  3RYR A;  4F93 B;  2GBY A;  5CJ9 A;  1QRY A;  3L7W A;  3FXM A;  3T0Y A;  1WWX A;  2O7O A;  3K70 C;  4DYC A;  2STT A;  2A61 A;  1RI7 A;  3HOV J;  3ULQ B;  1MSF C;  1YW8 A;  4ZH4 F;  1YRN B;  1TQM A;  3S1N J;  2QBY B;  4FE7 A;  4AD9 A;  5EGO A;  3DV8 A;  2LYC A;  4OWR B;  1W36 C;  1MMD A;  2F5E A;  2JUG A;  4XMY A;  2EH3 A;  2HQR A;  2PI0 A;  2M30 A;  2PG4 A;  2VC1 A;  1T2K A;  3ZGK A;  5FFZ A;  4WF2 A;  3MZY A;  1KYW A;  4S05 A;  2L4A A;  2CW8 A;  3BG6 A;  5A2Q Z;  4C2T A;  1I50 J;  2DMQ A;  1VZ0 A;  1W0U A;  4IHY A;  5BPD A;  3HSE A;  4DIQ A;  4XNF A;  3MZH A;  1BR4 A;  1TTY A;  1J0R A;  3AAF A;  2UWM A;  4ESF A;  3PFY A;  2QCO A;  1ZR4 A;  2HZD A;  3A02 A;  4PFO A;  4UXN A;  4AVZ A;  5H6Q A;  3O8H A;  3ESW B;  5KAF C;  2DDB A; 
#chains in the Genus database with same CATH homology
 2JWT A;  1B72 A;  1ETW A;  1JUP A;  5EZG A;  2VUM J;  1U78 A;  1SAN A;  1JJ6 C;  2I10 A;  3BR6 A;  5EDN A;  4XRS G;  3HEF A;  4BBR J;  3VPR A;  4A3E J;  5EEA A;  3S2D J;  1I6H J;  1H8A C;  4M3D A;  5DS9 A;  4Y7N J;  1WH5 A;  3TP3 A;  4A69 C;  4M3F A;  2HI3 A;  5F0C A;  2EZH A;  4AC0 A;  3Q3S A;  1MH4 A;  1WI3 A;  2ELK A;  3UKG A;  4C3H J;  3OSF A;  2KT0 A;  4FCY A;  3HBL A;  2NVX J;  3GTK J;  3WHB A;  2Y0S N;  5F0F A;  2W48 A;  1FTT A;  2L7Z A;  3BTC A;  4UUS B;  5IYB J;  4JX6 A;  3JRE A;  2K9Q A;  1A5J A;  1H89 C;  4L5E A;  1DU6 A;  3Q0W A;  1MBF A;  1TWF J;  3ZQH A;  1PUF B;  1AHD P;  1Z77 A;  1WGX A;  3QPL A;  4MLO A;  2JA8 J;  2XPV A;  1Y1W J;  3C2B A;  1T33 A;  2L7F P;  3ZQL A;  2AHQ A;  3TW6 A;  1E3O C;  3E7L A;  2E2I J;  1TWH J;  3RZD J;  5F0H A;  3GTJ J;  3OIO A;  1JKP C;  2XPW A;  3HGG A;  2JA6 J;  2R5Y B;  1ZKG A;  2M0C A;  2ID3 A;  1F43 A;  2O9L A;  4A3K J;  1MBG A;  1VND A;  4JX4 A;  2ME0 A;  2HXI A;  2XGE A;  1JT6 A;  3BTJ A;  2IAI A;  2TCT A;  3HGY A;  3HOX J;  5F27 A;  3S16 J;  2JK3 A;  1NK2 P;  2DA7 A;  3Q0U A;  4A3F J;  4A3D J;  4GFB A;  5E3M A;  1O4X A;  5IPA A;  1MBH A;  5IOY A;  3CMY A;  2XGD A;  5J1R A;  1LE8 B;  3BR3 A;  1Y1V J;  5EGO B;  5E3O A;  3ZQG A;  3I4N J;  2X9D A;  1OFC X;  3G1L A;  4FE4 A;  1Z0X A;  3L1P A;  3BG3 A;  2RAE A;  5JLW A;  1G2H A;  1TWG J;  1ETX A;  2XRL A;  1S7E A;  1X58 A;  4V2F A;  5FJ8 J;  4MFE A;  1LFB A;  2R0Q C;  2E1O A;  1AKH B;  4C3J J;  2YU9 J;  1HDD C;  4MFD A;  4D5C A;  2Y9Y A;  1IG7 A;  2HXO A;  2NS7 A;  2DA1 A;  1GT0 C;  5EYR A;  5BNG A;  1GUU A;  1APL C;  2XB0 X;  2LTP A;  3HM5 A;  3JRG A;  3M3Y J;  3I4M J;  1B72 B;  2DTZ A;  3JRI A;  1ETO A;  3CCY A;  4FIS A;  3JRA A;  1WCM J;  3DCF A;  3MKL A;  3LSR A;  4JX5 A;  2LKX A;  4D5F A;  1T56 A;  3S2H J;  4B4C A;  3HDD A;  4X6A J;  2H8R A;  1K61 A;  1GV5 A;  5FKN A;  1HDP A;  1F36 A;  1AU7 A;  3IV5 A;  1OJL A;  2K9N A;  2X48 A;  5M5Y J;  2VI6 A;  4CYC A;  2WV1 A;  1P7I A;  3BR5 A;  1X2M A;  4A3B J;  4I6Z A;  3LSP A;  3S1R J;  2LD5 A;  5EG0 A;  1TWA J;  3S14 J;  3JR9 A;  5C4X J;  1H88 C;  1ZTR A;  3FK6 A;  5JLX A;  4A3L J;  5IOZ A;  3CQZ J;  4NDL A;  4BKX A;  5F08 A;  3GTP J;  4A3G J;  1IUF A;  3ZQF A;  4JP0 A;  2EQR A;  2N8G A;  2PMZ N;  5K7F A;  3SJM A;  1RET A;  3BTL A;  4EEF G;  2HOT A;  3H3V K;  3MVP A;  3IH4 A;  5M3M J;  3RQI A;  5IYC J;  3RZO J;  3G1O A;  1IDY A;  5EZH A;  3ZQC A;  1MH3 A;  4D7M A;  2H1K A;  3GTQ J;  2QF7 A;  2DN0 A;  1K83 J;  2JA5 J;  2DMP A;  2CRG A;  1TWC J;  2JN6 A;  5K7Z A;  1U9O A;  5FKL A;  5GPA A;  2WB1 N;  4IHW A;  3JRB A;  3K2A A;  2EZL A;  1ORK A;  4DYR A;  3LSJ A;  4BBS J;  1A6I A;  2L9R A;  3BR2 A;  5K7H A;  2XPU A;  3G1M A;  1MNM C;  2LVS A;  3ZOB A;  3S17 J;  2VPR A;  2Y2Z A;  2DJN A;  1IGN A;  1SFO J;  2EZI A;  4XIC A;  1B8I A;  1ETV A;  4RBO A;  1MBJ A;  1IC8 A;  1JJ8 C;  3HOW J;  1JKO C;  4BY7 J;  4DYQ A;  1IJW C;  3HOZ J;  2HDD A;  2JMW A;  2FX0 A;  1IRZ A;  2E19 A;  3OSG A;  4JYK A;  2NOG A;  3O8G A;  1VF9 A;  1MBE A;  2LY9 A;  2ZB9 A;  3H0G J;  5FKO A;  5FKM A;  3A01 A;  2K40 A;  2K9S A;  3GTL J;  1JTY A;  1FJL A;  3JRD A;  3TED A;  1HOM A;  2WAQ N;  1UG2 A;  1MSE C;  2HOS A;  2P81 A;  3S1Q J;  3HB9 A;  2MGQ A;  2DA4 A;  1GV2 A;  5E3L A;  2DMU A;  4XID A;  3HOU J;  3PO2 J;  3GTG J;  1ETK A;  2CUF A;  2IBD A;  3B6C A;  2NVQ J;  1FIA A;  1ENH A;  3TW7 A;  2CJJ A;  1LFU P;  5J1U A;  3PO3 J;  1QVT A;  2COB A;  2X6O A;  3S1M J;  2HOA A;  5C44 J;  2MG4 A;  2DMT A;  2Y9Z A;  2Y31 A;  2LLK A;  1BL0 A;  2VKE A;  3F0C A;  2XGC A;  5EF6 A;  2JA7 J;  4B1R A;  3BQZ A;  4W1U A;  3MN2 A;  3SDG A;  3BTI A;  5GPC A;  1XS9 A;  3GBG A;  3BR1 A;  3LSG A;  4CYC B;  2ECC A;  1FEX A;  4BXX J;  1JUM A;  4UUT A;  2KDZ A;  3FIS A;  3FIW A;  5EG0 B;  2OF7 A;  2EBI A;  3JRF A;  4DW6 A;  1OCT C;  4FTH A;  1HLV A;  2DA6 A;  3HKZ N;  3NAR A;  2R5Z A;  4X1E A;  4A3I J;  4M3G A;  1W0T A;  4B3A A;  1U9N A;  3IH3 A;  2M8G X;  1YRN A;  2FJ1 A;  2ID6 A;  4QTR A;  5C4J J;  1U8B A;  4C3I J;  4G12 A;  5F04 A;  2OPT A;  3OOU A;  4MIM A;  2ME6 A;  3A03 A;  2GM4 A;  2L0K A;  4S0H B;  2CU7 A;  4M3E A;  3JRH A;  2NS8 A;  5IP9 J;  5FKK A;  2CQQ A;  5M3F J;  3ZQI A;  5C3E J;  4IHV A;  1RR7 A;  2CUE A;  2E2H J;  5J3L A;  1ETY A;  2JJ7 A;  3BT9 A;  3DEW A;  3SFI A;  2EZK A;  5FLM J;  1ETQ A;  2L7M P;  2MW8 A;  5DTD A;  2CQX A;  1B8I B;  3HOY J;  2M34 A;  3WHC A;  1MBK A;  1UMQ A;  4HNV A;  3Q0V A;  3B6A A;  3BR0 A;  4DZP A;  3K7A J;  1BW6 A;  2TRT A;  2FQ4 A;  1JT0 A;  3FKI J;  2DA3 A;  1XG1 A;  1JKQ C;  1RKT A;  2FD5 A;  2MSY A;  1POG A;  3A01 B;  4AYB N;  5M5X J;  4Y52 J;  2LP0 A;  2XB5 A;  4QIW N;  4I76 A;  3IH2 A;  3LOC A;  2M2E A;  3QQA A;  1Q1V A;  3D1N I;  4XK4 A;  1XC5 A;  4C2M J;  1HF0 A;  1R9T J;  1WH7 A;  3M4O J;  1ZK8 A;  2LK2 A;  2HYJ A;  1JUS A;  1TC3 C;  2DA5 A;  2IEK A;  1VFC A;  4M6V A;  5HOD A;  4UUS A;  4BY1 J;  2R92 J;  3TP0 A;  4A3M J;  4QSH A;  1OCP A;  3GTO J;  1PUF A;  1P7J A;  2NVT J;  1QPI A;  4A3C J;  1UHS A;  1X2N A;  5E3N A;  2VKV A;  2LFB A;  2LR8 A;  3RKQ A;  4AUX A;  2YS9 A;  1WPK A;  2HQ5 A;  4LOC A;  3FK7 A;  2Y30 A;  5IP7 J;  1ITY A;  2E2J J;  2M9H A;  3BQY A;  4V2G A;  2NVY J;  1JGG A;  5IP6 A;  3NAU A;  4ABZ A;  2R5Y A;  2YUS A;  1D5Y A;  1GDT A;  1GVD A;  1IDZ A;  1JKR C;  4XRM A;  4IHX A;  9ANT A;  5IYD J;  4A3J J;  1DU0 A;  2B63 J;  2GBY A;  5M5W J;  1BJZ A;  1QRY A;  2R5Z B;  4J19 A;  3W6V A;  4IEJ A;  1ZQ3 P;  1RES A;  2O7O A;  2G0E A;  4DYC A;  4D7N A;  1NTC A;  3HOV J;  2XSD C;  1MSF C;  2R7Z J;  3CDL A;  2DA2 A;  1NK3 P;  1YRN B;  1LE8 A;  3S1N J;  3LNQ A;  1FIP A;  4FE7 A;  5EGO A;  1HCR A;  1I3Q J;  2EH3 A;  1FTZ A;  4MO7 A;  4DZJ A;  1JTX A;  4A93 J;  1IV6 A;  1QVU A;  3QPS A;  4XRS A;  5GP9 A;  1I50 J;  2DMQ A;  5F1J A;  1W0U A;  1CQT A;  4IHY A;  2D5V A;  2ECB A;  2DMN A;  1BW5 A;  1EF4 A;  1BA5 A;  3BG9 A;  2QCO A;  5FLV A;  1ZR4 A;  1AKH A;  4RDU A;  1ZR2 A;  4M3B A;  1RKW A;  1RPW A;  3A02 A;  1VI0 A;  1ZGW A;  4W97 A;  5J1Y A;  2O8K A;  2AO9 A;  3BG5 A;  3JRC A;  3PM1 A;  3O8H A;  3S15 J;  3GTM J;  2GLO A;  2R93 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...