5ERIA

Marr protein from peptoclostridium difficile da00132
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
153
Chain Sequence
RGSHMLIKTLDSNILREVGTLSRAVNSINDIKYKELKLQKGQFTFLTRICENPGINLVELSNMLKVDKATTTKAIQKLIKAGYVDKKQDKFDKRGYNLTPTDKSLEVYELIIEEENRSIEICFDNFTDEEKQVVTKLLEKMSKNVENEWFKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords MarR family transcriptional regulator
publication title Crystal structure of the multiple antibiotic resistance regulator MarR from Clostridium difficile
doi rcsb
source organism Peptoclostridium difficile
total genus 55
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2015-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5eriA00
1J9IA 4XBFA 3BPVA 2ZO4A 1FX7A 4KUMA 3BJ6A 1ZH5A 4U0WA 2E1NA 3P9KA 1KU9A 4M72A 1UFMA 4P55A 2VE9A 1IUYA 4M9ZA 2QM3A 3RI4A 3DV8A 3V7SA 2V9VA 1MDMA 2YPRA 2IA0A 3CUQC 1OR7A 3T8TA 2E7XA 3LQRA 3DQVC 5J8FA 4LLLA 1W7PA 3DKWA 4ZH4F 2FNAA 1SD4A 1T2KA 3T8RA 1IN4A 3C1DA 4H0EA 4YFKF 4I0AA 2NS0A 3TDUC 1DUXC 5DYMA 1BC7C 3SFZA 3DF8A 4XLPF 2RVCA 1XSVA 4LB6B 4M74A 4AIJA 3KFWX 2MC3A 1RUOA 2G7UA 5J8CA 5BQTA 3J7AO 3QPTA 4XLNF 3F23A 1DDNA 4M6XA 1ON2A 1BBYA 2PFBA 1O7FA 1EV7A 1WI9A 1O3RA 4IXAA 2P5LC 3JSPA 1KA8A 3F22A 2F5EA 3QRFF 4HBLA 1TTYA 4FT8A 3K1PA 3J81Z 4EJOA 3I71A 1GHCA 5E1XA 3WTWC 2FE3A 1XB4A 4LGWA 4ETSA 2DTRA 5HDNA 2P5VA 4PGGA 2NAZA 2RC4A 3VB2A 5KK1A 3JAMK 2DK5A 1JE8A 1ZAOA 2HYFA 2V1DA 1SD6A 4HF2A 4HV6A 2GXBA 3B02A 1R00A 2GWRA 5E20A 4KT5C 4CGZA 3C18A 3F8BA 4HQMA 3R60A 4EV0A 3QP6A 4RB0A 1OYYA 1S6LA 4ESBA 2ZNYA 3RIRA 4I01A 5JR3A 2IW5A 4MQVA 1SD5A 5ILVA 5E1ZB 3KCCA 1IN5A 1CF7A 5D5WB 2Y0MA 5EEHA 3ELKA 1FP1D 3M8EA 3QPHA 4HA8A 1TW2A 1LEBA 3I53A 5K5OA 4CXFA 4AD9A 4JBAA 3T5XA 1Z9CA 2Y75A 4HF0A 3FWEA 1KQ8A 3WU0A 3RKWA 5K5QA 4WWCA 4LLGF 2BYVE 3MCZA 2JZYA 1O3QA 2AS5F 2KIUA 1IW7F 4DQ2A 3DFGA 1O57A 3P9CA 2XAQA 5ILSA 1ZYRF 5ILUA 2EFNA 2P6SA 4I7HA 3WTTC 3V8LA 4UNOA 1U2WA 4BAYA 2VOOA 3QAHA 1C0WA 4U7DA 4KNYA 3WU1B 2ZKZA 4RB2C 2RNJA 1TQIA 4FX0A 1XCVA 2Z3YA 1S7OA 3SQNA 4PZJA 2MLGA 3KE2A 2IVMA 4GCVA 4P96A 2DLLA 2GIVA 4IRIA 3JTHA 1U5TC 5J6XA 2QYOA 3ABUA 3IL2A 1S3JA 4BQAA 3R4KA 2L4MA 3I54A 3FMSA 3RPUA 2J5PA 3HTSB 4XSXF 1ZHFA 1ODDA 2DFIA 2ZFWA 1FT9A 5DCMA 1IN6A 2HGCA 1QBJA 3J80Z 5ICFA 1IN8A 3WTYC 5BPDA 5HS8A 1R1TA 2RQPA 3E6DA 3I4PA 5L3EA 2P4WA 4N9IA 3DP7A 4A0ZA 2IJLA 5D4RA 3TDZC 1ZLKA 5FD5A 3L2CA 2XKPA 3AAFA 4M73A 2VBZA 2GAUA 1R23A 3BY6A 5DUIA 2XROA 1W7PD 3HYIA 1OKRA 5DCMB 2FEZA 4PCQA 2ESNA 2OU2A 1YTYA 3U9GA 5E1WA 3KP6A 1LVAA 2A5YB 5JFRA 1TNSA 3ECHA 1Y0UA 3KP7A 1TBXA 2KIFA 2D1VA 3S2WA 3DPLC 3MFKA 1ZREA 1G3TA 3FMQA 3TKYA 3E6BA 4HX7A 1EH7A 4IRHA 1OMIA 1R22A 5IT9Z 4M9SA 1OYIA 4ZZLA 1HQCA 3CJNA 3JSOA 2O6GE 1P4XA 2DO7A 5AONA 1OPCA 2ZCWA 2DT5A 5LGUA 2FNPA 3K1NA 2MD5A 1B9NA 3ML6A 1E17A 3H92A 3HOTA 4L0YB 5D4SA 1LQ1A 3V7RA 1R5HA 3RKXA 4CZZA 5F6FA 4LK1F 5D8LB 4AIHA 2HDCA 1JHFA 5CVUA 3LA7A 3RYPA 4A6DA 5FLXK 3HTUA 4OU0A 2DU9A 1YYVA 1BI3A 2K02A 1U3EM 5ED4A 4KFCA 2EV0A 4WXDA 2FF4A 3HHHA 1QGPA 2CO5A 2W25A 5A2QZ 1R1UA 3OV8A 4EM1A 4LG0A 3KP5A 1T39A 3HSRA 1GXQA 4GO1A 2Q8KA 1GVJA 4ON0A 1BM9A 4LMYA 2MH2A 2RN7A 4UVBA 2E1CA 5BOXA 4RS8A 3CLOA 3FHZA 1MZBA 3ULQB 2A68F 4HF1A 2C6YA 3PQJA 2EA4A 2BGCA 1MGTA 3WTUC 2ACJA 2DK8A 1G3YA 4A5MA 3CUOA 5DEQA 3P7NA 4WF2A 3E5XA 5LHGA 2EJRA 4I02A 2GXGA 3GLXA 4EVIA 4TV7A 4DNCA 1ZRFA 2HTJA 3GXOA 2LNBA 3RJPA 4CICA 2KJCA 1KYZA 4U88A 1LB2A 3WTVC 2G7HA 1FY7A 5L3DA 5DCFA 5LRRA 1FNNA 2F2EA 1ZGJA 4L9TA 5L3BA 5E8IA 3I5UA 2FSWA 4KIGA 1BJAA 1KGSA 4UVAA 3KZYA 3GFMA 2UWMA 3E5QA 1FBSA 3WODF 2JPBA 4UUVA 3E97A 2XASA 2P6TA 2V1XA 1QQIA 1DPRA 1ZRDA 5D6FA 1DPUA 4MEXF 3BP8A 3H3UA 2VBXA 4YFNF 4NHJA 1XGOA 3Q5FA 1S7AA 5D5UB 2QZ8A 4MNUA 2UZKA 1TNTA 1FYKA 5L3FA 2CQKA 1K78A 5DD8A 3U1DA 2OA4A 1IRFA 2VBWA 1T38A 2LF8A 1HSJA 2YX7A 2DW4A 3EYIA 4L9NA 2L3DA 1I1GA 4G94A 4WK8F 1J59A 1K79A 1FPQA 4PDKA 3PQKA 1FYLA 4KIBA 3WTXC 3LA3A 1MDMB 4A2UA 1YO5C 5E18F 5BMZA 1W7PB 5F1RA 5LEKA 2Z33A 2STWA 3ZMTA 2CWEA 3F3XA 3EYYA 1RUNA 4WCGA 3KP3A 4E70A 4IHSA 3WG9A 4GGGA 4EJVA 4AIKA 2MH9A 1G3WA 4HV5A 4BNCA 3H3ZA 2A6EF 3R0AA 1FBQA 2COMA 3DEUA 5K5RA 1QZYA 4YG2F 1IXCA 4OIQF 3LA2A 3NEUA 2L01A 1WRJA 4HYEA 2W24A 5HLIA 2Z99A 1TQPA 2XVCA 2W85A 2EV6A 5BPIA 1H9TA 3F8MA 2DI3A 3GFLA 1O3SA 2E7WA 3ZMDA 1J75A 2QLZA 3REOA 1WQ2A 4KIFA 1BI2A 1G4DA 2Q0OA 4UVCA 1XMAA 2D1HA 4Q48A 1ZRCA 2ZJ2A 4IVNA 3GZ5A 4G7ZF 4HAMA 4G7OF 3KLNA 3GWZA 3RYRA 2JRTA 1JXSA 1LJ9A 1XMKA 1D8JA 1HSTA 1ZLJA 3ABTA 2R3SA 1W4MA 4YIFA 5EEGA 2YX4A 1FWZA 2FA5A 3R0JA 1O7LA 1SFEA 3VEPA 1B9MA 2O61A 1YIOA 5CVIA 2H09A 1IAWA 2HS5A 6PAXA 1FSEA 3F72A 3GUDA 3WGHA 2JT1A 1PP7U 2K7LA 2M8EA 5K1YA 1CF7B 1IXSB 2CYYA 3E5UA 1LNWA 2ADUA 3IRQA 2A69F 3ZMUA 4BHBA 1NHAA 4I09A 2CFXA 4R1HA 5DV5A 1REPC 2DAOA 4M6YA 2FBIA 4RAYA 3QU6A 4WXHA 3K69A 5D5XB 3GYHX 4A0YA 3HUGA 3R61A 4BH9A 3ECOA 3GO5A 3GVAA 4HZFA 3O3KA 3TOAA 1IN7A 4ZYDA 1QZZA 5LGTA 1WSUA 4HDVA 2OZUA 1YW9A 2X4HA 3B73A 4JK1X 3MZYA 2UXXA 4LJZF 1UCRA 3BPXA 1GXPA 3ERED 1T6SA 4BHCA 4G7HF 3CUQA 4R79A 2OAZA 2ZBKA 1Z91A 3EQLF 3HRSA 3ZN1A 5HOOA 5FGMA 1QO0D 2DPUA 3WGGA 3R6SA 2QUFA 4QLCU 4KYWA 4HX4A 3V8KA 2STTA 4L9VA 2OQGA 1K6OA 2IPQX 4Q47A 2P7VB 2V6CA 2FMLA 3HSFA 5HLHA 3KP4A 2XUBA 3QU3A 2HOEA 1Z7UA 2GZWA 3CUQB 3SZPA 4I0BA 1EH8A 4YFXF 3I64A 1W5SA 1YG2A 3I58A 3FX3A 3WE3A 3KEQA 5IT3A 4QWQA 1U6GA 2LSOA 3M9AA 2F5FA 3V7CA 1ZARA 2ETHA 2PI0A 3GF2A 2LDUA 1A04A 3C7JA 4RGRA 3ISPA 4KA4A 2NRAC 3L09A 2EK5A 2NNYA 3JAMZ 3COAC 1I6XA 3NRVA 3FM3A 4ZYEA 2FBHA 2ZMEA 2FMYA 5FFXA 5H20A 2EFOA 2EWNA 3M1EA 1T0FA 2M1BA 3I59A 3N97A 2PJPA 4Y15A 2HFHA 3TO7A 1KYWA 1USTA 2LKPA 2HQRA 5DDGA 3SXYA 1PDNC 3K0LA 4D0PA 4ENKA 3K2ZA 2GQQA 3MQ0A 2CGPA 1S8NA 1TQMA 1MJ9A 4AWXB 1WKMA 2D2WA 1HXDA 2CSOA 3CDHA 3LWFA 4OMYA 5LHHA 1PUEE 5E8GA 2Z5UA 2RDPA 5L3GA 2Q2EA 4BYYA 2YSRA 2R7DA 1MKMA 2G9WA 3FXRA 3L9FA 1LDDA 5E17F 1ON1A 3EETA 2WWYA 4HLYA 4NQWA 2PQ8A 4RB3C 3HOSA 2X0LA 3BJAA 4HQEA 2CG4A 3J81K 1J2XA 3QOPA 3SZTA 3I0TA 1QPMA 5HDGA 4ENMA 1SFUA 3WGIA 4LFUA 2JTVA 1D3YA 1BIBA 2RKHA 1P2FA 2VBYA 1EH6A 4MQ9F 3WE2A 2BBYA 1Q1HA 1YS6A 1YS7A 1RNLA 4Y17A 2PLYA 4B09A 2ISZA 3WTZA 1BC8C 2IA1A 5TRDA 4CHUA 4HX8A 4LG0B 4WXCA 2PMHA 2RGVA 2DQLA 3IHUA 2DPDA 1XCBA 5JHUA 1HKQA 1U5TA 4GYGA 3E6CC 4Z2YA 1X3UA 5CVVA 3BZ6A 1ZGAA 3JTGA 3PFIA 2HEOA 2ISYA 2QVOA 5FB2A 5D8KB 1G3SA 2O0YA 1V4RA 2VXZA 2EFWA 1I1SA 2A3SA 1R7JA 2RV8A 3W6KB 4K2EA 3LFKA 2O03A 5JI6A 3O6BB 3LQQA 2HR3A 1HW2A 3EDPA 5AIPA 2PBIA 1V3FA 2R7FA 2HKXA 5CVRA 1MJBA 2IRFG 4ZYGA 4EQQA 3HRMA 1U5TB 2V79A 5LRSA 1SFXA 5LLQA 3QP5A 4M71A 1FSHA 3FXQA 4FHTA 2EB7A 4CO8A 1RZ4A 1HKSA 1F1ZA 2WV0A 1Z6RA 4IHTA 1PP8F 1QNTA 1K7AA 1BI1A 3T1BA 1ZG3A 1YFHA 4UXNA 5ERIA 4L0ZB 1BN5A 1LDKB 4ENNA 3L7WA 1JGSA 5JVTA 2V1UA 2D45A 1L3LA 2ELHA 3IRRA 4LK0F 5ICCA 4L9JA 2O8XA 3CO6C 4EGZA 2QQAA 2FOKA 2EV5A 1XD7A 1T98A 3FXUA 4PGHA 2WC2A 1Z1DA 1ONVA 1U8RA 2NYXA 2HZTA 2PEXA 1MJAA 2A07F 3K1MA 5ICEA 1H9GA 4OINF 2KRFA 3W6JB 1J0RA 1FBUA 1XDSA 2B0LA 2HWVA 1K78B 4LD5A 1H0MA 4P9FA 1BIAA 2UXNA 3LSTA 1BOAA 4EJWA 1O3TA 3BWGA 2VODA 2BV6A 1ZN2A 3J80K 2YR2A 2A6HF 3HRTA 5FO5A 1UHWA 5FLXZ 1B1BA 2Z9OA 1W5TA 5LBQA 1FP2A 1JHHA 1RIOH 2JSCA 1P4AA 2JPCA 1YQAA 5HDKA 4OOIA 1HW1A 3ZMVA 2VE8A 3G73A 5LHIA 4XRFA 5DD4A 3TQNA 2XV4S 2VC0A 4OIOF 2VONA 1YLFA 1HBXG 3ZQ7A 2VN2A 1UB9A 4RGSA 4N9HA 4RGUA 2FRHA 2P8TA 2MBFA 2XAHA 3L00A 2KKOA 1E2XA 4CYDA 5LGNA 2OD5A 3OOPA 3F8CA 3DPTA 2MLKA 3GW2A 4AVPA 1IRGA 1D5VA 4UV8A 2H6BA 2O3FA 3Q9VA 5IT9K 1S29A 4ZYHA 5HS7A 1R1VA 4U0VA 4G6DA 4RB1A 1R58A 3TO9A 2HKOA 3SHFA 1XSDA 4OIRF 4EM0B 4FX4A 4IJAA 3RTRA 2XGXA 1TLHB 3F6OA 2LF7A 2Y48A 2L54A 3FZVA 2W84A 5LEJA 4EMSA 4CDGA 3VOEA 2H27A 3RPQA 4KICA 3F21A 4IRGA 4Q5SF 2K4BA 1XGNA 3E3VA 4EGYA 5TJJA 4IPAA 4HLXA 4EJUA 3IWFA 1RI7A 2IA2A 1SMTA 4YIIA 4ZZDA 2L02A 1F5TA 3G3ZA 5L3CA 2KIMA 1LEAA 4UV9A 1F4KA 1Z05A 2DQRA 3ZPLA 4A5NA 2M30A 5A2QK 4L18B 2VC1A 2A61A 2TDXA 5D6EA 3M8FA 1KU3A 1Z6TA 5DUKA 3TO6A 1J5YA 2VOPA 3IC7A 3E6MA 3GZ6A 2K86A 3BROA 2PMUA 1TW3A 4GYIA 5CLSA 2OBPA 3KLOA 2P5KA 1P6RA 2QQ9A 4WX9A 2XAGA 4U0YA 4LB5A 4Y13A 5CYVA 4HDUA 3FM5A 4A0XA 4P9UA 3N4MA 4S05A 2L4AA 4A6EA 2XHKA 2M45A 1L0OC 1KU2A 4A12A 3C3WA 1XGMA 2IT0A 1FOKA 1B59A 4BHPA 4ESJA 4U7BA 4HOBA 4ESFA 1R36A 3BOQA 4G6QA 4KN7X 3O2PE 1P92A 1KQ9A 3KEOA 2IP2A 2OZ6A 4MHGA 3IKVA 4G9YA 4F7ZA 2EFQA 3NQOA 1P4WA 2PG4A 4KDPA 2FXAA 1SAXA 4EJTA 2QENA 3U2RA 4ASNA 4XSZF 5F64A 4Q4ZF 3ZMZA 4P5OA 2QQBA 1AOYA 3JW4A 2VT3A 2H6CA 1IXRC 5FD6A 4L5IA 1WWXA 1FYMA 4OIPF 3TGNA 3EUHA 4B8XA 3KETA 1USSA 3MEXA 3VODA 4IF4A 1I5ZA 4NB5A 4RAZA 1IF1A 4LLNA 1YW8A 4R8HA 3BDDA 3M7GA 3TOBA 1XSXA 4M9XA 4L5JA 3LAJA 2ZNZA 3ROUA 3V8JA 3RKYA 1AWCA 2XAFA 3K9TA 4O6JA 5HVQC 2W57A 4BXUA 2ZXJA 3MWMA 2PN6A 1J7KA 2XAJA 4JQFA 4O5VA 1KQ0A 3F6VA 3WTSC 2ZMEB 1SMYF 2GA2A 2VT2A 2KJBA 2BEOA 3HSEA 5HS9A 5CJ9A 3DXJF 3I59B 2FQ3A 1G6NA 3RDIA 4S04A 4I98B 4GXOA 5D5VB 1D8KA 1B4AA 2HQNA 1HKTA 4KMUX 2XRNA 3V4GA 4KN4X 1FLIA 5ICGA 4N0BA 2FBKA 1IZ1A 1OYWA 3HIFA 1STZA 2K4JA 1CGPA 2F5CA 4MGRA 1I27A 4HW0A 2K27A 3ZMSA 3FF5A 1XGSA 3KZZA 3GX4X 1MD0A 2YU3A 3T0YA 3D5LA 3D0SA 1R5GA 2WTEA 2F5DA 3BJOA 2NNNA 1BI0A 1ZG1A 1DP7P 2H94A 1FZPB 1VTNC 2M87A 2OQRA 5BS6A 1B6AA 3IWZA 3ZN0A 3IKTA 5KVRA 4O3MA 1SD7A 3LAPA 2P7CB 3HRUA 5HLGA 3FMRA 3CO7C 1XN7A 2DBBA 4MEYF 2MA3A 2XKOA 4I2OA 4ENJA 1YW7A 1FC3A 5H6QA 3ZP5A 2XIGA 2EA2A 1U78A 2EFPA 2QBYA 5AIQA 1LDJA 3P9IA 4UHTA 2BE5F 3MZHA 4MTDA 3MAJA 2HTSA 3VFZA 2AXLA 3GEZA 2J5OA 3F8NA 1F9NA 2GA1A 3Q9SA 3HHGA 5CVJA 3F8FA 4RGXA 1KU7A 5H6RA 1HW5A 2CW0F 4OMZA 2QBYB 3CTAA 3GFJA 2FU4A 4KMFA 3KP2A 1UHMA 2M5WA 4MTEA 1XDUA 1ULYA 1ZG5A 5FFZA 4EM2A 3GFIA 4G8XA 2ESHA 2QWWA 2HYGD
chains in the Genus database with same CATH superfamily
1N78A 2XF6A 4XBFA 3BPVA 1J9IA 2ZO4A 3K6GA 1FX7A 2WAFA 1ERDA 3A0HC 1M1EB 4KUMA 2JSPA 3UNGC 1MW7A 3BJ6A 1ZH5A 3S3MA 5IYBJ 4ZTFA 2VJ4A 4U0WA 3HOZJ 2E1NA 3RQIA 3P9KA 2XF5A 4IEJA 1KU9A 4M72A 1UFMA 4P55A 2VE9A 1IUYA 3QWLA 2K9QA 4M9ZA 2QM3A 3RI4A 3GTPJ 2UUZA 3J7AY 3JRHA 3DV8A 2KP6A 3V7SA 2V9VA 3PIOF 1MDMA 2YPRA 2IA0A 3S2HJ 3HGGA 4XRSA 4AYBA 3CUQC 3MVPA 3K70D 1OR7A 3T8TA 2CUZA 2E7XA 3LQRA 2ELJA 3DQVC 5F1JA 5J8FA 3OYFA 4A3DJ 4LLLA 1W7PA 3DKWA 3SDGA 3TBIA 3JRCA 2GLOA 4ZH4F 2FNAA 1SD4A 1UJ8A 1T2KA 3T8RA 1D0XA 1IN4A 2COBA 2DA2A 3Q3SA 3QPSA 3C1DA 2WA0A 4H0EA 1X1DA 4NNJA 5TGTA 4YFKF 4I0AA 2M7BA 2MG4A 2BY0A 4QSHA 2NS0A 2PMZN 3TDUC 1DGRM 1DUXC 5DYMA 2GIZA 1MBKA 4B1RA 1BC7C 3SFZA 3DF8A 1E3HA 2MGQA 4XLPF 4AUXA 4BBSJ 3VWBA 2RVCA 3FKIJ 1XSVA 4LB6B 4C3HJ 1DGWY 4M74A 1XS9A 4AIJA 3KFWX 1F36A 2HXOA 2BZTA 2MC3A 1RUOA 2G7UA 5J8CA 1S9HA 3Q0WA 5BQTA 4IOCF 3RZDJ 3J7AO 3QPTA 4XLNF 3F23A 1DDNA 4HSRA 4M6XA 3CQZJ 1ON2A 3ZQQA 1BBYA 2PFBA 1RR7A 1GV5A 1EV7A 1O7FA 2L7KA 1WI9A 3BTIA 1O3RA 4HNTA 4IXAA 2P5LC 3JSPA 4XICA 1KA8A 4HG2A 3F22A 2F5EA 2N8GA 3QRFF 4XRSG 4HBLA 2W48A 1TTYA 2O7OA 4FT8A 3TL4X 3K1PA 3J81Z 2Y9ZA 2K3FA 4EJOA 3I71A 4JX5A 1GHCA 5E1XA 3WTWC 1IGNA 2LD5A 2W4SA 2FE3A 1XB4A 4LGWA 4LITA 4ETSA 2DYRH 5IP6A 2DTRA 5HDNA 3ASOH 4C3IJ 2P5VA 4PGGA 2JVHA 2NAZA 2ZMEC 4NUBA 4BXFA 2RC4A 3CCRI 1HA8A 3VB2A 5KK1A 3JAMK 4MO7A 2DK5A 1JE8A 2JQ7A 1ZAOA 2HYFA 2V1DA 2F6CA 4CCOA 1SD6A 1T0FC 4HF2A 4HV6A 2GXBA 2E1MB 1J09A 2DA6A 5M5WJ 3B02A 1R00A 4BBRJ 2GWRA 2KZGA 4ZDOA 4QTRA 3O8GA 3HB9A 5E20A 5IY5H 4KT5C 5GAGJ 3C18A 4CGZA 4BQOA 2V1NA 2ECCA 3F8BA 2Y9YA 1D5YA 4U87A 2M0CA 4HQMA 3G1MA 3R60A 3ABMH 1MSFC 4GDFA 5J4YA 2WAQA 4M6VA 4EV0A 2YUSA 1MIJA 4C2UA 3QP6A 4RB0A 2VKHA 3CMMA 1LFBA 1OYYA 1S6LA 4ESBA 2ZNYA 4DZJA 3RIRA 1VQ6I 4I01A 3H35A 2DDAA 5JR3A 3W6VA 2IW5A 2EIJH 1UG0A 1SD5A 4MQVA 5E1ZB 5ILVA 2CQQA 3KCCA 1IN5A 1CF7A 3LMMA 5D5WB 2Y0MA 3DCFA 3BR6A 5EEHA 3ELKA 1FP1D 4DIQA 3M8EA 3FK7A 3QPHA 4HA8A 2V9PA 1TW2A 1TWGJ 1LEBA 3I53A 3VYRB 5K5OA 4CXFA 4AD9A 4JBAA 3T5XA 1Z9CA 2Y75A 2Z1DA 3CC4I 4HF0A 5KCMA 3FWEA 1KQ8A 1EKEA 3WU0A 3RKWA 3OWTA 1WVRA 4IKFA 4L5EA 5K5QA 4PUSA 4DJAA 1TT5B 4LLGF 4WWCA 1JJ8C 3JREA 2BYVE 1ETQA 3MCZA 2JZYA 1O3QA 2AS5F 1JKPC 2KIUA 1IW7F 4DQ2A 2RNGA 3DFGA 1O57A 2HU9A 2DT6A 3P9CA 2XAQA 2YS9A 4B3AA 3L2RA 5ILSA 1ZYRF 2GXAA 4OAZA 4HNUA 2WBMA 2EFNA 5ILUA 4BE1A 2P6SA 2F5VA 4BGDA 2HXIA 3ERMA 2OPTA 1HCRA 4I7HA 3WTTC 3OS0A 3V8LA 3S15J 2X9DA 4UNOA 1U2WA 4BAYA 1D1BA 2EZKA 3DBLB 1DQUA 3L2VA 1FIPA 2JMWA 4XORA 1U8BA 2VOOA 3QAHA 2M7AA 1C0WA 4U7DA 1V5EA 4KNYA 3WU1B 2VPLA 5E3MA 1MNDA 2ZKZA 1NG6A 2RNJA 4RB2C 1TQIA 1XCVA 2Z3YA 3MMYB 4FX0A 1S7OA 3SQNA 1BR1A 3I9V2 4PZJA 2MLGA 3KE2A 3NARA 2IVMA 4GCVA 4P96A 3AL0C 2DLLA 2GIVA 4AIDA 1E3PA 4IRIA 3JTHA 1U5TC 3A1YA 5J6XA 3OMYA 2QYOA 3SEQA 3ABUA 3IL2A 1B72A 1FEXA 1S3JA 2K9MA 2MD0A 4BQAA 4QPOA 3OYAA 1N75A 3R4KA 1SEUA 2L4MA 3I54A 3FMSA 2L7FP 3RPUA 5FKMA 2J5PA 3HTSB 3OIOA 2QQ8A 4XSXF 4B43A 2L5QA 2NXNB 1ZHFA 1WI3A 3HOVJ 1ODDA 3ZQFA 5FKLA 1UZCA 4E6KG 2DFIA 5B1BH 5F04A 1D1CA 2ZFWA 3CC7I 2KISA 2VI6A 2X51A 3FHNA 4XR6A 1FT9A 4FISA 4A3BJ 5DCMA 4ZDPA 1IN6A 2H1KA 3W2AA 2HGCA 1QBJA 5ICFA 3J80Z 1IN8A 3OYGA 3WTYC 2BY2A 3QQAA 5BPDA 4F93B 2O5RA 5HS8A 2HVSA 3FXJA 3GLLA 4DYCA 1R1TA 2RQPA 5HNHA 1Y39A 3E6DA 3CLQA 3KYCB 3I4PA 5L3EA 2P4WA 4N9IA 3DP7A 1HLVA 3HZJA 4A0ZA 2IJLA 5D4RA 5J40A 3TDZC 4J00A 1ZLKA 5IOZA 5FD5A 3L2CA 2XKPA 3GZNB 3AAFA 3BR3A 4M73A 1WCMJ 3VYUB 3CCYA 2KRCA 4A3EJ 2VBZA 2V26A 2GAUA 1A35A 1LE8B 1OLTA 1R23A 3BY6A 5DUIA 2XROA 1R9TJ 4NBQA 2ID6A 1W7PD 3HYIA 1FOWA 1OKRA 5DCMB 2FEZA 4PCQA 2ESNA 3ABLH 5HLTA 2OU2A 1YTYA 2JA8J 1X1CA 1FIAA 3OOUA 4A3CJ 3HKZN 3H36A 3U9GA 5GAEJ 4E7HA 2X1DA 5E1WA 2BXYA 3KP6A 3O8HA 2MABA 2ID3A 2KDZA 1LVAA 2LP0A 2A5YB 1R4NB 5JFRA 3KYLA 1TNSA 4C2MJ 3ECHA 1S72I 5C4JJ 1Y0UA 4YRVA 1G2HA 3PM1A 3KP7A 1TBXA 4PSWA 1VF9A 3MD2A 4E7IA 3JR9A 3M3YJ 3OYMA 4KJZA 3HL2A 1XC5A 2KIFA 2D1VA 3S2WA 5B1AH 2EPFA 3DPLC 1YX3A 3MFKA 2QKLB 1T8IA 2JJ7A 1ZREA 2EILH 2ME6A 1G3TA 4D7NA 3JRBA 2VL8A 5K7FA 3FMQA 4F52A 3TKYA 1W1WE 3E6BA 2CQNA 2IEKA 4HX7A 3AG1H 1EH7A 4JYKA 3OIQA 4IRHA 5KAFC 1OMIA 1R22A 5IT9Z 4Y52J 4M9SA 1OYIA 4ZZLA 2K40A 3L2UA 5M5YJ 1HQCA 3CJNA 3JSOA 2O6GE 2M2EA 1P4XA 2DO7A 1IRZA 4B3XA 5AONA 4M3EA 1OPCA 3GTJJ 2ZCWA 2DT5A 4II3A 5LGUA 3X2QH 2FNPA 3K1NA 2MD5A 1VQ7I 3OS2A 1B9NA 3RSNA 2VXDA 3ML6A 2HQAA 4BJ5C 1E17A 3H92A 1IRXA 3HOTA 1SVLA 4X0GA 2CRGA 1A6IA 4C9YA 4L0YB 3QODA 4RMNA 5D4SA 1OISA 1LQ1A 3V7RA 1R5HA 3RKXA 4CZZA 4RA2A 4S0HB 1JUSA 5F6FA 3FXKA 4LK1F 1WJDA 5FRMA 5F0HA 1HOMA 3OIPA 5IOYA 5D8LB 4CCLA 4AIHA 2HDCA 1JHFA 5CVUA 3LA7A 3OL4A 3RYPA 4C3JJ 2DMNA 4A6DA 3CCQI 5FLXK 3HG9A 1FOYA 3HTUA 4XN0A 4OU0A 2DU9A 1YYVA 3BR0A 4AC0A 2KHMA 1BI3A 2K02A 3VYTB 4RM2A 1ETWA 2BVLA 4B48A 3F9KA 1U3EM 5ED4A 4KFCA 2F48A 2EV0A 4WXDA 2FF4A 2VB6A 3U1KA 3HGYA 3HHHA 1BR4A 1QGPA 4NC6A 2QCOA 4P1WA 2IGOA 2CO5A 2VKVA 2E2HJ 2RQQA 5J1YA 4J19A 2W25A 5A2QZ 1Y8QB 1R1UA 3OV8A 2LOOA 3HXLA 4EM1A 4LG0A 3KP5A 3CZ6A 2LREA 2L9VA 1T39A 3HSRA 1JTYA 1D0ZA 3DKYA 4OWRB 3HOXJ 3G4SI 1CQTA 1GXQA 4GO1A 2Q8KA 1GVJA 4ON0A 1BM9A 4LMYA 2MH2A 2RN7A 2QSFX 1UMQA 4D9JA 1OFCX 1MBEA 1BA5A 4UVBA 3AG2H 4XLAA 3CDIA 2E1CA 5BOXA 4RS8A 3CLOA 3L2WA 2V9KA 3J7YJ 5K7ZA 1G8XA 3UR3C 3QYBA 2R7QA 3BG5A 3K4CA 4BXXJ 1OCCH 3WHCA 1RKTA 3FHZA 1MZBA 1AHDP 3S16J 3ULQB 2A68F 4XLCA 1I3AA 4HF1A 2C6YA 3LSGA 3S1MJ 3LOCA 2EA4A 2QF7A 2BGCA 3PQJA 1MGTA 4EATA 4E7KA 2E1OA 4XK4A 3WTUC 2I5UA 4PSXA 2CV2A 3VDXA 2ACJA 2DK8A 1G3YA 4A5MA 2XC7A 3CUOA 5DEQA 3P7NA 2ZXIA 4BY1J 4AU7A 4V2FA 4XLHA 4I76A 3E5XA 1WPKA 4WF2A 5LHGA 2EJRA 3ZQLA 4I02A 1QVTA 2D5VA 1RC9A 2GXGA 4XKCA 3I56I 1SANA 4CSWA 3H9JA 3GLXA 4EVIA 2XGDA 4TV7A 4DNCA 1ZRFA 2HTJA 1YIJI 1V55H 3GXOA 2LNBA 3K4NA 3J7ZI 3A01B 3CD6I 1K83J 3RJPA 4CICA 3DWLE 1NG7A 1R49A 2KJCA 2R7XA 4C30A 1KYZA 4U88A 1YJNI 3WTVC 2G7HA 2R0QC 1LB2A 1FY7A 5L3DA 5DCFA 1T95A 2GBYA 5LRRA 1F43A 1FNNA 4HSTA 2F2EA 4M3GA 4IHVA 1ZGJA 3EPZA 4L9TA 1QU3A 5L3BA 5E8IA 2EZIA 4CZCA 3I5UA 5FROA 2FSWA 4KIGA 3OYEA 1BJAA 1KGSA 4HPQA 3KZYA 4UVAA 1KZHA 3GTGJ 3GFMA 2UWMA 2M0MA 3E5QA 1FBSA 4A3JJ 5EG0A 1QA6A 3WODF 2JPBA 3H9QA 4UUVA 2OCCH 3E97A 2XASA 3LFUA 2P6TA 2V1XA 2O8KA 2P0WA 3LSHA 2VIXA 1RKWA 1X3ZB 3DU6A 1QQIA 1DPRA 1ZRDA 5D6FA 1DPUA 4MEXF 3OSGA 4IOAF 1R5ID 3BP8A 3H3UA 3F0CA 3SEZA 4BQQA 5BNGA 1Y1WJ 2VUMJ 2K3PA 2VBXA 4XLEA 1ZELA 4YFNF 4NHJA 1XGOA 1IDZA 3Q5FA 3MKZA 1S7AA 5IP7J 5D5UB 5C44J 2QZ8A 4MNUA 3LSRA 3RPUD 2UZKA 3FKJA 1TNTA 2JA5J 2OJED 5E3LA 2M9HA 3CP2A 2B63J 2FD5A 1FYKA 5L3FA 1QVUA 2CQKA 5LFAA 4A93J 4D5FA 1K78A 4A3FJ 2R5ZA 1ETKA 5DD8A 3U1DA 2OA4A 1G59A 4IHXA 1DU0A 1VNDA 1IRFA 3ZXSA 3OS1A 2VBWA 3CJQB 1EF4A 5FLMJ 3S14J 1T38A 2VQCA 2LF8A 3SJMA 4XL9A 2CU7A 3P5JA 1GLNA 1HSJA 2X1EA 2YX7A 4IQ4A 1QHGA 4RM3A 1NK3P 1DP3A 2DW4A 3EYIA 4L9NA 2L3DA 1I1GA 4JOMA 2E19A 3IUOA 4G94A 4WK8F 3BTLA 3CMYA 4FQGA 4BL0B 4E7LA 1J59A 1FPQA 4PDKA 3PQKA 1JKOC 1K79A 1FYLA 4KIBA 3K70C 3WTXC 2HNHA 3LA3A 4ZJZA 4IQJA 1VQNI 1MDMB 4A2UA 4IZZA 4D1QA 1YO5C 2FX0A 1V54H 3EUAA 5E18F 5BMZA 3OY9A 1IC8A 4UB8C 2L9NA 1W7PB 2R5ZB 3GTLJ 3DLLF 4OAYA 5F1RA 5LEKA 2Z33A 3BR2A 1U9OA 2STWA 2DMTA 3ZMTA 2CWEA 2PX9A 3F3XA 3EYYA 1RUNA 4WCGA 3KP3A 3CJRB 4E70A 4IHSA 3WG9A 4GGGA 2QEXI 4EJVA 4Z6YA 4AIKA 3HC7A 2MH9A 1IO2A 1G3WA 3BTJA 4HV5A 4BNCA 3H3ZA 2A6EF 3R0AA 3OYBA 2R5YA 2HZDA 1VQ8I 1FBQA 2COMA 3DEUA 5K5RA 1QZYA 3H5NA 2HI3A 4D7MA 2ZXWH 4YG2F 1IXCA 4OIQF 2KFDA 2MYSA 4ABZA 4EEFG 1TL8A 3LA2A 2NVXJ 2BHYA 3NEUA 5B3SH 2LY1A 2L01A 5IYDJ 1WRJA 4HYEA 1I39A 2W24A 2UV1A 5HLIA 2Z99A 3EUHC 3DPUA 1TQPA 2DA1A 2XVCA 4JP0A 2R7SA 3RCOA 4A3MJ 2W85A 2EV6A 1BL0A 2IGKA 5BPIA 1H9TA 3F8MA 2DI3A 3GFLA 3CCUI 1O3SA 1XX5A 1HF0A 2E7WA 1OCZH 3ZMDA 1J75A 2QLZA 1X58A 1NH3A 4LG3A 3HM5A 3REOA 3RZOJ 2CS3A 1WQ2A 2M34A 4KIFA 2ICWG 4BQNA 1R6RA 4BEHA 1Z67A 2PJRA 1BI2A 1G4DA 1GUUA 2Q0OA 4UVCA 1ZQ3P 1XMAA 2D1HA 3KPHA 3L2QA 1JT0A 1TWAJ 1ENHA 4Q48A 1ZRCA 5E3NA 2ZJ2A 4IVNA 3GZ5A 3S17J 4G7ZF 4HAMA 5FJ8J 2M8GX 2BHZA 4G7OF 3H9GA 3M1CA 3KLNA 2QGUA 3GWZA 3RYRA 2JRTA 3FXMA 3PJRA 1JXSA 1LJ9A 1XMKA 3HJEA 1D8JA 2OTJI 1BW6A 1HSTA 1I50J 1ZLJA 2R4GA 2IS2A 1MMAA 2IS1A 3ABTA 2R3SA 3BLYA 2E2IJ 4XOPA 2DJIA 1W4MA 1WH5A 2BOLA 1ZR4A 4YIFA 5EEGA 2YX4A 2ME0A 1FWZA 2FA5A 4BEHB 3LSIA 2DODA 3R0JA 2MFZA 5GPAA 1VQ4I 1O7LA 1LFPA 1RETA 1FTZA 1SFEA 2NOJB 3VEPA 3CMEI 2QSHX 1B9MA 2XDVA 2AO9A 3IP4B 1YIOA 3PSFA 2O61A 3FISA 2JA7J 3PNVA 2W82A 5CVIA 2H09A 1IAWA 2HS5A 6PAXA 1FSEA 3F72A 3B6CA 1W36C 3GUDA 3WGHA 3G2BA 1OCTC 4V19K 3BR1A 1T33A 1HC8A 1NK2P 4XN3A 2JT1A 1WJ5A 1PP7U 2K7LA 2M8EA 4F91B 5K1YA 1IXSB 2LTPA 1JUPA 2CYYA 2EBIA 3E5UA 1CF7B 1LNWA 2ADUA 3MN2A 3TW6A 3IRQA 2FUG2 3OYKA 2A69F 3ZMUA 4IHWA 4BHBA 1MMGA 1NHAA 3OYCA 2TRTA 3OR2C 1JT6A 4I09A 2RAEA 3PUBA 2CFXA 4R1HA 1UAAA 5DV5A 2ZSIB 1REPC 2DAOA 2DA5A 4M6YA 2L9RA 1V5GA 2FBIA 4AM3A 3QYEA 2PMZA 4RAYA 1EA3A 3G1LA 3QU6A 4CA0A 2V6EA 4WXHA 5DM7F 3K69A 1GV2A 5D5XB 3GYHX 4A0YA 4A3KJ 4LIUA 4ZTJA 2CQXA 1YHQI 3HUGA 3R61A 2XPVA 4XONA 4BH9A 3ECOA 1IDYA 3GO5A 3GVAA 3MKLA 4HZFA 3O3KA 1MBHA 3TOAA 1IN7A 3AG3H 3RKQA 1A5JA 1TZLA 2KZVA 4ZYDA 1QZZA 5LGTA 1WSUA 4CCMA 4HDVA 3LSKA 4X1EA 3K4JA 2OZUA 1YW9A 2KPMA 1ETOA 2X4HA 3B73A 4JK1X 2M4GA 3S3OA 3MZYA 4A3IJ 5C4XJ 4M3BA 3W2WA 2UXXA 4LJZF 1UCRA 3BPXA 1X1BA 1GXPA 3ERED 1T6SA 4BHCA 4G7HF 4B4CA 3CUQA 4R79A 2OAZA 2EIKH 2ZBKA 2JA6J 1Z91A 3EQLF 3HRSA 2DA3A 5M5XJ 3ZN1A 4DBQA 5HOOA 5FGMA 4BDZA 1W0TA 1QO0D 4RLQA 2DPUA 3HUGB 3WGGA 4HEA2 4UUSA 3FK6A 1MBJA 3R6SA 1QHHD 4KITB 2QUFA 2OUMA 1FOXA 4QLCU 2X85A 3NWSA 3K10A 4KYWA 5IPAA 4HX4A 1WJFA 2KLOA 4NC7A 4L9VA 3V8KA 2STTA 1MMSA 2OQGA 1K6OA 3U21A 2IPQX 1VQOI 4Q47A 5F0FA 2P7VB 1UG2A 2V6CA 2FMLA 2TCTA 3HSFA 3OYIA 5HLHA 2ELKA 1WJEA 2XUBA 2AXTC 3KP4A 3QU3A 2HOEA 1B72B 3S1QJ 1HDDC 1Z7UA 2GZWA 3I55I 3S93A 3JRIA 3CUQB 4Y7NJ 4XIDA 3SZPA 2DCEA 4MIMA 5FKNA 4I0BA 1EH8A 4NDLA 4YFXF 3I64A 1W5SA 1YG2A 1OCOH 5E79C 3I58A 2BVMA 4XKVA 1X3WB 4FE4A 2A5WA 4PJMA 3FX3A 3WE3A 1AU7A 4IO9F 5J4VA 4E7JA 2BXZA 3H5RA 3KEQA 4QWQA 5IT3A 5FRNA 4BJ6C 1U6GA 2LSOA 3BZCA 3M9AA 2F5FA 3V7CA 1P7JA 1ZARA 2ETHA 2PI0A 3PO3J 3GF2A 2LDUA 1A04A 3C7JA 1YJWI 1BW5A 4RGRA 3ISPA 2VPRA 4KA4A 2NRAC 1OJLA 3L09A 3FBIB 2EK5A 2NNYA 3JAMZ 3PNYA 3AG4H 3COAC 1I6XA 1JI8A 2DOEA 3D1NI 2OC6A 3NRVA 3FM3A 4ZYEA 2FBHA 4B47A 2JN6A 2R7OA 2ZMEA 3B6AA 2FMYA 3DLAA 1Y0NA 5FFXA 5H20A 5J1RA 1OR7C 3OYDA 1TC3C 2Z2SB 2EFOA 2EWNA 1IJWC 3M1EA 3A03A 3S3NA 1T0FA 2M1BA 2DOFA 3I59A 3N97A 2PJPA 1MMDA 2VQHA 2VQGA 1JUMA 2DA4A 4Y15A 1T56A 1WJBA 4M3FA 2HFHA 3Q0VA 3TO7A 1KYWA 1USTA 4PJJA 2LKPA 2HQRA 5KNLA 5DDGA 3GTOJ 3SXYA 1PDNC 3K0LA 2E60A 4D0PA 2GM4A 2JVGA 1X1PA 2X6WA 4ENKA 3K2ZA 2GQQA 1WGXA 3MQ0A 2CGPA 1S8NA 3DBHB 2O9LA 1TQMA 3WHBA 2XPUA 2Y0SN 1MJ9A 1FMWA 3BG3A 1WKMA 4AWXB 4ZDLA 2D2WA 1HXDA 2LK2A 2CSOA 1SAUA 3CDHA 3LWFA 4IX7A 4OMYA 3ZQGA 2ZFUA 3ZQHA 1RPWA 1YITI 5LHHA 1PUEE 5E8GA 2Z5UA 4BACA 2JA2A 2EZHA 2RDPA 5L3GA 2Q2EA 4UB6C 4BYYA 2YSRA 3OYJA 5FKKA 2DYSH 2E1MC 2R7DA 5F0CA 4F3QA 1MKMA 4AYBN 1VZ0A 5EJCA 3I4MJ 2G9WA 3FXRA 3AKZA 3L9FA 1LDDA 5E17F 3A2KA 1ON1A 3BG7A 3EETA 1B8IA 2WWYA 2E71A 3LSPA 2OCEA 5J3LA 2LRDA 2WV1A 4A69C 4HLYA 1W5CC 2AQEA 4NQWA 3MKWB 2PQ8A 3C2BA 4KT6A 4Y4RA 4RB3C 1XMXA 2VASA 3HOSA 2X0LA 3BJAA 4HQEA 2CG4A 3J81K 5KHDA 1J2XA 3E7LA 3QOPA 2G0EA 3SZTA 3I0TA 1QPMA 2IGNA 5HDGA 1I6HJ 4ENMA 5LD2C 1SFUA 3WGIA 4LFUA 1WFXA 2JTVA 2HQ5A 4BS9A 1X2MA 5FKOA 1D3YA 1BIBA 2RKHA 3CCMI 1P2FA 2LH9A 1YJ9I 3HOWJ 2VBYA 3HBLA 1AKHA 1EH6A 1Z3YA 2DJNA 4MQ9F 3WE2A 2AQFA 4N4NB 2BBYA 3LL7A 1Q1HA 2VJJA 4E4HA 1YS6A 1ZK8A 1YS7A 3GTQJ 1RNLA 3DEEA 1HDPA 4Y17A 2PLYA 4B09A 4CYCA 1XG1A 3S1RJ 1VI0A 4XM3A 2ISZA 3QOEA 3WTZA 1BC8C 3FXLA 2K5CA 1VQPI 4NQWB 1VQKI 2IA1A 3HPGA 9ANTA 5TRDA 2CUEA 4CHUA 4HX8A 2HPMA 3DTKA 4LG0B 3H5AA 3NWTA 4WXCA 2PMHA 2CW7A 3A4CA 2RGVA 1ZTRA 4PFPA 2DQLA 1WJAA 3IHUA 2DPDA 1XCBA 3HEFA 5JHUA 1HKQA 5CKTA 1U5TA 3K4BA 5JLWA 3L1PA 4GYGA 3E6CC 4Z2YA 1N25A 1X3UA 2YU9J 2NVQJ 2NVUB 1EJ9A 3S8PA 5CVVA 3BZ6A 4PJLA 2LMDA 1ZGAA 3JTGA 3PFIA 3BCAA 1O4XA 2HEOA 2ISYA 3H1CA 2QVOA 3BZKA 5FB2A 5D8KB 5E3OA 1G3SA 2O0YA 1V4RA 2KT0A 1PJRA 2VXZA 3HKZA 1MSEC 2EFWA 1I1SA 2A3SA 1R7JA 2RV8A 3C2HA 1ZKGA 2JUGA 2R7UA 3W6KB 1SFKA 4K2EA 3LFKA 2O03A 5JI6A 2EINH 3WU2C 3TW7A 3G71I 3O6BB 3LQQA 2HR3A 1HW2A 3EDPA 5AIPA 2PBIA 1V3FA 2R7FA 3AL0B 2HKXA 2L2OA 3TP3A 1X19A 5CVRA 1MJBA 2IRFG 4ZYGA 3M8JA 4EQQA 3HRMA 2CUFA 1U5TB 1LKXA 2V79A 5LRSA 3SZGA 1SFXA 3D5SC 3PNTA 2H1LA 4DBRA 3K4KA 4ZYAA 5LLQA 3QP5A 4E7ZA 4M71A 2W1OA 3OR1C 4YIRX 3OYNA 1FSHA 3FXQA 5CQGA 4FHTA 1YE9A 2EB7A 4CO8A 1RZ4A 2E36A 1HKSA 2L7ZA 3A0BC 2LYCA 2ZC2A 2ZJQF 1F1ZA 2WV0A 1Z6RA 3ZCOA 2OF7A 4IHTA 1MNEA 1QNTA 5JLXA 1PP8F 1K7AA 1BI1A 1IV6A 3T1BA 2JRMA 2R7TA 1ZG3A 2X48A 1YFHA 2DDBA 3EUKL 3BC8A 4UXNA 5ERIA 4N4OB 4FCYA 4L0ZB 1Z3XA 2E34A 2A05A 2EQRA 1BN5A 1LDKB 4ENNA 3L7WA 5GAHJ 1JGSA 5JVTA 2V1UA 4MFEA 4PJNA 4IL6C 2CQ7A 2D45A 2JUCA 2DXIA 5JVGF 1L3LA 4II2A 2Y0SA 1JKQC 3S1NJ 2MW8A 2ELHA 3IRRA 4LK0F 2L0KA 4F92B 5ICCA 4L9JA 2O8XA 3CO6C 4EGZA 2CMPA 2QQAA 5EG0B 4DGWB 2FOKA 2K85A 2JK3A 2EV5A 5CPRB 3CMAI 1XD7A 4Y3OA 3ZQCA 1D0YA 1T98A 3FXUA 2DN0A 4PGHA 2WC2A 4DYRA 4FASD 1Z1DA 1ONVA 5EYRA 2CH0A 1V5FA 1X4OA 1U8RA 2NYXA 2HZTA 2PEXA 2KRHA 1VQ5I 3W2VA 3LSMA 2K9LA 2L9SA 5EF6A 4YELA 2HPIA 4RLFA 1X4PA 1R4MB 1ORKA 2FQ4A 2LC2A 2LKXA 3RQ4A 2R93J 1MJAA 2A07F 3K1MA 4RAGA 5ICEA 1H9GA 4OINF 3TMOA 2KRFA 2VLAA 3W6JB 3JRDA 1J0RA 1FBUA 1XDSA 2B0LA 2HWVA 1XTAA 2MC4A 3ZQIA 1K78B 3CDLA 4LD5A 1H0MA 3K4MA 4P9FA 1BIAA 3CJTB 2UXNA 5EZGA 2FJ1A 2V4JC 3LSTA 1BOAA 2CV1A 4EJWA 4DOZA 1O3TA 1AA7A 1IUFA 3CP8A 3BWGA 2ZJPF 4ANJA 3M4OJ 2VODA 2IBDA 3V42A 2IS6A 2ZB9A 3GTMJ 3CC2I 2XSJC 2BV6A 4BE2A 1TT0A 1ZN2A 3J80K 3PSIA 2YR2A 4ZC3A 2X6XA 2A6HF 1LFUP 3HRTA 5FO5A 1UHWA 5FLXZ 1B1BA 2Z9OA 2QKMB 1W5TA 5K7HA 2XB0X 5B66C 5LBQA 3BG9A 2L7MP 1FP2A 1JHHA 1RIOH 2JSCA 1P4AA 1MNMC 2JPCA 3VPRA 5HNFA 1YQAA 5HDKA 4V2GA 4OOIA 1A6QA 1HW1A 3ZMVA 2VE8A 3G73A 5LHIA 4XRFA 3MKYB 2Y69H 1MBGA 1S7EA 1YOVB 5DD4A 3OSFA 5TISC 1POGA 5J47A 1WH7A 1QPIA 4UUTA 3PL8A 2WB1N 4XLFA 3TQNA 2XV4S 2VC0A 1R71A 4OIOF 1UHSA 1Z77A 2VONA 1MH4A 1YLFA 1HBXG 2EH3A 3ZQ7A 2VJ5A 2VN2A 1U0JA 5F08A 1UB9A 2R5YB 1LPQA 4RGSA 2HOSA 4N9HA 4RGUA 2FRHA 2P8TA 2MBFA 4DZPA 3FBNB 3HPHA 2XAHA 3L00A 2KKOA 1E2XA 4CYDA 5LGNA 1XPXA 4RBOA 2OD5A 3OOPA 1RESA 1ZGWA 2LBFA 3F8CA 3DPTA 3FDYA 2MLKA 4J01A 5GADJ 3GW2A 3H0GJ 1DU6A 2WAEA 4AVPA 4PFOA 3D5RC 1IRGA 1D5VA 4UV8A 2W00A 2H6BA 2O3FA 2Y30A 3Q9VA 5IT9K 1S29A 4ZYHA 2KQRA 5HS7A 2QSGX 1R1VA 4U0VA 2F4IA 2KMUA 3IH3A 4G6DA 4RB1A 1PUFA 1FJLA 1R58A 3TO9A 2HKOA 4XRMA 3SHFA 1XSDA 2PJRB 4OIRF 1IV8A 2DMQA 4EM0B 4FX4A 1K61A 4IJAA 3RTRA 3SFIA 2A6TA 1TLHB 2XGXA 3F6OA 2LF7A 2Y48A 2OV7A 4CCNA 2L54A 2R92J 3FZVA 2I8DA 2W84A 1W36D 4XNFA 1MMNA 4DYQA 5LEJA 4EMSA 4CDGA 2LBFB 1K6YA 3ZOBA 3PO2J 3VOEA 2H27A 1W0UA 3RPQA 4KICA 3F21A 4IRGA 2V7FA 2K4BA 1XGNA 4Q5SF 4RDUA 4BDYA 3E3VA 4EGYA 5TJJA 4IPAA 4HLXA 4XKBA 4PJ0C 4EJUA 3HOYJ 3BQYA 3IWFA 2NOGA 1RI7A 2XB5A 2LLKA 4HRIA 2IA2A 1SMTA 4BU2A 1PUFB 3JRGA 4YIIA 4ZZDA 2L02A 4M3DA 1SFOJ 3KEYA 1F5TA 3LSJA 1H89C 2WADA 2R7RA 3OYHA 3G3ZA 1APLC 3KIOA 3S2DJ 2AHQA 3G1OA 5L3CA 2KIMA 4HNVA 1LEAA 4UV9A 1F4KA 3SDBA 5GP9A 3QYFA 2HDWA 1Z05A 2DQRA 2BY3A 1VQMI 3ZPLA 3IAM2 2MSYA 2DT7B 3NAUA 1JTXA 4XKWA 1Z7LA 2WY7Q 4A5NA 4BJTA 5JHFA 2M30A 4KISA 4H4KC 3TP0A 5A2QK 1MBFA 3CCVI 4L18B 2VC1A 4XMYA 2A61A 2TDXA 5D6EA 3M8FA 2HVQA 3ZRGA 5EEAA 1KU3A 5DM6F 2HYJA 1Z6TA 3N05A 1P9QC 2LVSA 5DUKA 1YRNB 3TO6A 1J5YA 2F4OB 2VOPA 3ABKH 3IC7A 3E6MA 4NC8A 3GZ6A 1K4SA 1ITYA 4MFDA 2K86A 3BROA 2PMUA 1T08B 1TW3A 3K7AJ 4GYIA 2M3AA 3ASNH 2NS7A 5CLSA 2OBPA 1PVEA 3KLOA 2IXSA 3IH4A 2WY8Q 1JJ6C 1VQ9I 3HDDA 2P5KA 4YEJA 5KAIC 1Y56A 1P6RA 2QQ9A 4WX9A 2XAGA 4U0YA 1S5LC 4LB5A 4Y13A 1GT0C 4QIWN 5CYVA 1KONA 3GMEA 5GPCA 4HDUA 2Z16A 3FM5A 4A0XA 3JRAA 1K4TA 1SVOA 4P9UA 3N4MA 4BKXA 4S05A 2L4AA 1RRJA 4A6EA 1H8AC 2XHKA 2M45A 1L0OC 1KU2A 1FMVA 4A12A 2DFHA 2EIMH 3C3WA 1Q1VA 1XGMA 2IT0A 3CESA 3VSLA 5GTHC 4Y33A 1FOKA 4W1UA 5DS9A 5EGOA 2M4KA 1UELB 1B59A 4MLOA 4BHPA 3FXOA 1JGGA 4ESJA 3DBRB 4U7BA 3CCEI 4HOBA 3DEWA 1VFCA 4ESFA 1R36A 1TWFJ 5C3EJ 3AFHA 1LE8A 2WB1A 2CJJA 2H8WA 2ZXHA 3BOQA 4G6QA 4KN7X 3O2PE 1P92A 5DTDA 5GTIC 1KQ9A 5IP9J 3KEOA 2IP2A 3DTEA 2OZ6A 2OTLI 4MHGA 4UUSB 2ZJRF 3IKVA 1WJCA 2VKDA 3PFYA 4G9YA 4F7ZA 2BY1A 2EFQA 1JKRC 3NQOA 1P4WA 5CQEA 2PG4A 4FTHA 4KDPA 2FXAA 5F27A 1SAXA 5EGOB 4EJTA 2QENA 3C2GA 3K4LA 3G6EI 4IHYA 1QZEA 3U2RA 2R7ZJ 4ASNA 1GVDA 4XSZF 3OYLA 5F64A 4Q4ZF 2ECBA 3ZMZA 3ZGKA 4X6AJ 2KDOA 4P5OA 2DOAA 2QQBA 1AOYA 2XSDC 3JW4A 3BCBA 2VT3A 2H6CA 2LR8A 1IXRC 2BW3A 5FD6A 1FTTA 4L5IA 1Z0XA 2IAIA 4AVZA 3BR5A 2DFEA 1WWXA 1TP4A 2RREA 1FYMA 4OIPF 3E1SA 2VJIA 3TGNA 1U9NA 3EUHA 4B8XA 3KETA 1USSA 3MEXA 3VODA 4F55A 4IF4A 3KYDB 2E5ZA 1PYVA 1I5ZA 4NB5A 4RAZA 2LFBA 4XQFA 1IF1A 4I99C 4CCJA 2HDDA 4LLNA 1YW8A 2VQLA 4R8HA 3BDDA 3M7GA 3LNQA 3TOBA 1XSXA 1RR8C 4M9XA 3CCJI 2K9SA 1YI2I 2IGMA 4L5JA 3LAJA 3GCMA 2HOAA 2ZNZA 2XF7A 3DKXA 3ROUA 3V8JA 1OQYA 3RKYA 1AWCA 2XAUA 4UY8I 2XAFA 3K9TA 4O6JA 5HVQC 2BW3B 2W57A 3I3LA 4BXUA 2ZXJA 2I10A 3MWMA 2PN6A 3M07A 1J7KA 2XAJA 4JQFA 4CCKA 3IH2A 4O5VA 1OCRH 1KQ0A 3F6VA 4JX4A 2DTZA 4QPQA 2R7WA 3WTSC 3FIWA 2ZMEB 3SYTA 1SMYF 2GA2A 3QPLA 2VT2A 2KJBA 4FE7A 3A02A 2NVYJ 3DTIA 1QRYA 3MZ8A 2BEOA 1Z21A 2GOXB 4B44A 3VSKA 2XGEA 3HSEA 4RAFA 5HS9A 4LIVA 4CH7A 3PIPF 5CJ9A 3DXJF 2XPWA 3I59B 5J1UA 2FQ3A 1G6NA 3RDIA 4S04A 3KZIC 1X1AA 4I98B 4GXOA 5D5VB 4A3GJ 3K2AA 1D8KA 1B4AA 1IG7A 2H8RA 4XOTA 4BUPA 2HQNA 2F4MB 1HKTA 4JX6A 2LG4A 3CCLI 4KMUX 4W97A 2XRNA 3I4NJ 3V4GA 2DMUA 4GRIA 3IV5A 4KN4X 4I6ZA 1FLIA 5ICGA 4N0BA 2FBKA 2DMPA 2X6YA 1GDTA 2NVTJ 1IZ1A 1OYWA 4BE0A 3KX2A 5HODA 3HIFA 1STZA 2K4JA 1CGPA 2CV0A 3BG6A 2EZLA 5M3MJ 2F5CA 4MGRA 3GBGA 1ETVA 1I27A 2B7EA 4HW0A 3OL3A 4ITVA 2K27A 3ZMSA 2XGCA 1XGSA 3FF5A 3KZZA 3GX4X 2Q2EB 1MD0A 2YU3A 1N77A 4DW6A 3T0YA 3D5LA 3D0SA 1R5GA 2WTEA 3VYSB 2F5DA 1Y6IA 3BJOA 2HVRA 4G6TB 2NNNA 5FLVA 1BI0A 1ZR2A 1ZG1A 1Y8RB 1DP7P 2CUJA 3Q0UA 2H94A 4BY7J 1FZPB 3TEDA 1VTNC 2M87A 3E0JB 2XRLA 4LOCA 4E7SA 3ESWB 2OQRA 1B8IB 5BS6A 2R7VA 1B6AA 2KIQA 2NS8A 2KL4A 3IWZA 3ZN0A 1OCPA 3IKTA 5KVRA 5EDNA 4O3MA 1A31A 1SD7A 3LAPA 4D5CA 2P7CB 2E2JJ 3HRUA 1MH3A 1WHUA 2FOWA 4G12A 5HLGA 2IS4A 3FMRA 3S32A 2X1CA 3CO7C 1ACIA 2LY2A 3BQZA 4PK4A 2E35A 1NTCA 2P81A 2K9NA 1XN7A 1SC7A 2VKEA 2DBBA 4MEYF 2W7NA 1E0EA 4CUGA 2LY9A 1D1AA 2MA3A 2XKOA 4I2OA 4ENJA 1YW7A 1FC3A 5H6QA 3ZP5A 2CFOA 1WZ2A 2XIGA 4A3LJ 1I3QJ 3IAS2 3JRFA 2EA2A 1U78A 2Q1ZB 3W3CA 2EFPA 3BTCA 2QBYA 2E5NA 1AKHB 1VQLI 3H0DA 5AIQA 3A01A 1LDJA 3P9IA 4UHTA 2BE5F 3MZHA 3H3VK 4MTDA 3MAJA 2B9SA 2HTSA 4CYCB 3UKGA 1LUJB 3VFZA 5H2FC 3DU5A 1ETYA 2AXLA 2ZSHB 2J5OA 3GEZA 3JCUC 1LVKA 3F8NA 3ZR8X 1F9NA 2X6OA 3WG7H 2Y31A 2GA1A 2HOTA 3Q9SA 1TWHJ 4FETA 3HHGA 5CVJA 1Y1VJ 1YX5A 3F8FA 4RGXA 1BOBA 1KU7A 5H6RA 3BT9A 1YRNA 1HW5A 2CW0F 3CF2A 4OMZA 1TWCJ 1H88C 2DFFA 1BR2A 2QBYB 1SVMA 4GFBA 3CTAA 3GTKJ 3GFJA 2FU4A 4KMFA 3KP2A 1UHMA 5M3FJ 5EZHA 2WAQN 1A36A 2M5WA 1X2NA 2LKSA 2CW8A 1ETXA 2GOMA 4MTEA 2JWTA 2DA7A 1XDUA 5IYCJ 1ULYA 4C2TA 1ZG5A 2QA4I 1BJZA 5FFZA 4EM2A 3ONQA 3GFIA 3CF5F 3PUFA 5B5EC 1E3OC 4G8XA 2Y2ZA 3HOUJ 1P7IA 3CCSI 2ESHA 2QWWA 2HYGD
chains in the Genus database with same CATH topology
1J9IA 4XBFA 3BPVA 2ZO4A 1FX7A 4KUMA 3BJ6A 1ZH5A 4U0WA 2E1NA 3P9KA 1KU9A 4M72A 1UFMA 4P55A 2VE9A 1IUYA 4M9ZA 2QM3A 3RI4A 3DV8A 3V7SA 2V9VA 1MDMA 2YPRA 2IA0A 3CUQC 1OR7A 3T8TA 2E7XA 3LQRA 3DQVC 5J8FA 4LLLA 1W7PA 3DKWA 4ZH4F 2FNAA 1SD4A 1T2KA 3T8RA 1IN4A 3C1DA 4H0EA 4YFKF 4I0AA 2NS0A 3TDUC 1DUXC 5DYMA 1BC7C 3SFZA 3DF8A 4XLPF 2RVCA 1XSVA 4LB6B 4M74A 4AIJA 3KFWX 2MC3A 1RUOA 2G7UA 5J8CA 5BQTA 3J7AO 3QPTA 4XLNF 3F23A 1DDNA 4M6XA 1ON2A 1BBYA 2PFBA 1O7FA 1EV7A 1WI9A 1O3RA 4IXAA 2P5LC 3JSPA 1KA8A 3F22A 2F5EA 3QRFF 4HBLA 1TTYA 4FT8A 3K1PA 3J81Z 4EJOA 3I71A 1GHCA 5E1XA 3WTWC 2FE3A 1XB4A 4LGWA 4ETSA 2DTRA 5HDNA 2P5VA 4PGGA 2NAZA 2RC4A 3VB2A 5KK1A 3JAMK 2DK5A 1JE8A 1ZAOA 2HYFA 2V1DA 1SD6A 4HF2A 4HV6A 2GXBA 3B02A 1R00A 2GWRA 5E20A 4KT5C 4CGZA 3C18A 3F8BA 4HQMA 3R60A 4EV0A 3QP6A 4RB0A 1OYYA 1S6LA 4ESBA 2ZNYA 3RIRA 4I01A 5JR3A 2IW5A 4MQVA 1SD5A 5ILVA 5E1ZB 3KCCA 1IN5A 1CF7A 5D5WB 2Y0MA 5EEHA 3ELKA 1FP1D 3M8EA 3QPHA 4HA8A 1TW2A 1LEBA 3I53A 5K5OA 4CXFA 4AD9A 4JBAA 3T5XA 1Z9CA 2Y75A 4HF0A 3FWEA 1KQ8A 3WU0A 3RKWA 5K5QA 4WWCA 4LLGF 2BYVE 3MCZA 2JZYA 1O3QA 2AS5F 2KIUA 1IW7F 4DQ2A 3DFGA 1O57A 3P9CA 2XAQA 5ILSA 1ZYRF 5ILUA 2EFNA 2P6SA 4I7HA 3WTTC 3V8LA 4UNOA 1U2WA 4BAYA 2VOOA 3QAHA 1C0WA 4U7DA 4KNYA 3WU1B 2ZKZA 4RB2C 2RNJA 1TQIA 4FX0A 1XCVA 2Z3YA 1S7OA 3SQNA 4PZJA 2MLGA 3KE2A 2IVMA 4GCVA 4P96A 2DLLA 2GIVA 4IRIA 3JTHA 1U5TC 5J6XA 2QYOA 3ABUA 3IL2A 1S3JA 4BQAA 3R4KA 2L4MA 3I54A 3FMSA 3RPUA 2J5PA 3HTSB 4XSXF 1ZHFA 1ODDA 2DFIA 2ZFWA 1FT9A 5DCMA 1IN6A 2HGCA 1QBJA 3J80Z 5ICFA 1IN8A 3WTYC 5BPDA 5HS8A 1R1TA 2RQPA 3E6DA 3I4PA 5L3EA 2P4WA 4N9IA 3DP7A 4A0ZA 2IJLA 5D4RA 3TDZC 1ZLKA 5FD5A 3L2CA 2XKPA 3AAFA 4M73A 2VBZA 2GAUA 1R23A 3BY6A 5DUIA 2XROA 1W7PD 3HYIA 1OKRA 5DCMB 2FEZA 4PCQA 2ESNA 2OU2A 1YTYA 3U9GA 5E1WA 3KP6A 1LVAA 2A5YB 5JFRA 1TNSA 3ECHA 1Y0UA 3KP7A 1TBXA 2KIFA 2D1VA 3S2WA 3DPLC 3MFKA 1ZREA 1G3TA 3FMQA 3TKYA 3E6BA 4HX7A 1EH7A 4IRHA 1OMIA 1R22A 5IT9Z 4M9SA 1OYIA 4ZZLA 1HQCA 3CJNA 3JSOA 2O6GE 1P4XA 2DO7A 5AONA 1OPCA 2ZCWA 2DT5A 5LGUA 2FNPA 3K1NA 2MD5A 1B9NA 3ML6A 1E17A 3H92A 3HOTA 4L0YB 5D4SA 1LQ1A 3V7RA 1R5HA 3RKXA 4CZZA 5F6FA 4LK1F 5D8LB 4AIHA 2HDCA 1JHFA 5CVUA 3LA7A 3RYPA 4A6DA 5FLXK 3HTUA 4OU0A 2DU9A 1YYVA 1BI3A 2K02A 1U3EM 5ED4A 4KFCA 2EV0A 4WXDA 2FF4A 3HHHA 1QGPA 2CO5A 2W25A 5A2QZ 1R1UA 3OV8A 4EM1A 4LG0A 3KP5A 1T39A 3HSRA 1GXQA 4GO1A 2Q8KA 1GVJA 4ON0A 1BM9A 4LMYA 2MH2A 2RN7A 4UVBA 2E1CA 5BOXA 4RS8A 3CLOA 3FHZA 1MZBA 3ULQB 2A68F 4HF1A 2C6YA 3PQJA 2EA4A 2BGCA 1MGTA 3WTUC 2ACJA 2DK8A 1G3YA 4A5MA 3CUOA 5DEQA 3P7NA 4WF2A 3E5XA 5LHGA 2EJRA 4I02A 2GXGA 3GLXA 4EVIA 4TV7A 4DNCA 1ZRFA 2HTJA 3GXOA 2LNBA 3RJPA 4CICA 2KJCA 1KYZA 4U88A 1LB2A 3WTVC 2G7HA 1FY7A 5L3DA 5DCFA 5LRRA 1FNNA 2F2EA 1ZGJA 4L9TA 5L3BA 5E8IA 3I5UA 2FSWA 4KIGA 1BJAA 1KGSA 4UVAA 3KZYA 3GFMA 2UWMA 3E5QA 1FBSA 3WODF 2JPBA 4UUVA 3E97A 2XASA 2P6TA 2V1XA 1QQIA 1DPRA 1ZRDA 5D6FA 1DPUA 4MEXF 3BP8A 3H3UA 2VBXA 4YFNF 4NHJA 1XGOA 3Q5FA 1S7AA 5D5UB 2QZ8A 4MNUA 2UZKA 1TNTA 1FYKA 5L3FA 2CQKA 1K78A 5DD8A 3U1DA 2OA4A 1IRFA 2VBWA 1T38A 2LF8A 1HSJA 2YX7A 2DW4A 3EYIA 4L9NA 2L3DA 1I1GA 4G94A 4WK8F 1J59A 1K79A 1FPQA 4PDKA 3PQKA 1FYLA 4KIBA 3WTXC 3LA3A 1MDMB 4A2UA 1YO5C 5E18F 5BMZA 1W7PB 5F1RA 5LEKA 2Z33A 2STWA 3ZMTA 2CWEA 3F3XA 3EYYA 1RUNA 4WCGA 3KP3A 4E70A 4IHSA 3WG9A 4GGGA 4EJVA 4AIKA 2MH9A 1G3WA 4HV5A 4BNCA 3H3ZA 2A6EF 3R0AA 1FBQA 2COMA 3DEUA 5K5RA 1QZYA 4YG2F 1IXCA 4OIQF 3LA2A 3NEUA 2L01A 1WRJA 4HYEA 2W24A 5HLIA 2Z99A 1TQPA 2XVCA 2W85A 2EV6A 5BPIA 1H9TA 3F8MA 2DI3A 3GFLA 1O3SA 2E7WA 3ZMDA 1J75A 2QLZA 3REOA 1WQ2A 4KIFA 1BI2A 1G4DA 2Q0OA 4UVCA 1XMAA 2D1HA 4Q48A 1ZRCA 2ZJ2A 4IVNA 3GZ5A 4G7ZF 4HAMA 4G7OF 3KLNA 3GWZA 3RYRA 2JRTA 1JXSA 1LJ9A 1XMKA 1D8JA 1HSTA 1ZLJA 3ABTA 2R3SA 1W4MA 4YIFA 5EEGA 2YX4A 1FWZA 2FA5A 3R0JA 1O7LA 1SFEA 3VEPA 1B9MA 2O61A 1YIOA 5CVIA 2H09A 1IAWA 2HS5A 6PAXA 1FSEA 3F72A 3GUDA 3WGHA 2JT1A 1PP7U 2K7LA 2M8EA 5K1YA 1CF7B 1IXSB 2CYYA 3E5UA 1LNWA 2ADUA 3IRQA 2A69F 3ZMUA 4BHBA 1NHAA 4I09A 2CFXA 4R1HA 5DV5A 1REPC 2DAOA 4M6YA 2FBIA 4RAYA 3QU6A 4WXHA 3K69A 5D5XB 3GYHX 4A0YA 3HUGA 3R61A 4BH9A 3ECOA 3GO5A 3GVAA 4HZFA 3O3KA 3TOAA 1IN7A 4ZYDA 1QZZA 5LGTA 1WSUA 4HDVA 2OZUA 1YW9A 2X4HA 3B73A 4JK1X 3MZYA 2UXXA 4LJZF 1UCRA 3BPXA 1GXPA 3ERED 1T6SA 4BHCA 4G7HF 3CUQA 4R79A 2OAZA 2ZBKA 1Z91A 3EQLF 3HRSA 3ZN1A 5HOOA 5FGMA 1QO0D 2DPUA 3WGGA 3R6SA 2QUFA 4QLCU 4KYWA 4HX4A 3V8KA 2STTA 4L9VA 2OQGA 1K6OA 2IPQX 4Q47A 2P7VB 2V6CA 2FMLA 3HSFA 5HLHA 3KP4A 2XUBA 3QU3A 2HOEA 1Z7UA 2GZWA 3CUQB 3SZPA 4I0BA 1EH8A 4YFXF 3I64A 1W5SA 1YG2A 3I58A 3FX3A 3WE3A 3KEQA 5IT3A 4QWQA 1U6GA 2LSOA 3M9AA 2F5FA 3V7CA 1ZARA 2ETHA 2PI0A 3GF2A 2LDUA 1A04A 3C7JA 4RGRA 3ISPA 4KA4A 2NRAC 3L09A 2EK5A 2NNYA 3JAMZ 3COAC 1I6XA 3NRVA 3FM3A 4ZYEA 2FBHA 2ZMEA 2FMYA 5FFXA 5H20A 2EFOA 2EWNA 3M1EA 1T0FA 2M1BA 3I59A 3N97A 2PJPA 4Y15A 2HFHA 3TO7A 1KYWA 1USTA 2LKPA 2HQRA 5DDGA 3SXYA 1PDNC 3K0LA 4D0PA 4ENKA 3K2ZA 2GQQA 3MQ0A 2CGPA 1S8NA 1TQMA 1MJ9A 4AWXB 1WKMA 2D2WA 1HXDA 2CSOA 3CDHA 3LWFA 4OMYA 5LHHA 1PUEE 5E8GA 2Z5UA 2RDPA 5L3GA 2Q2EA 4BYYA 2YSRA 2R7DA 1MKMA 2G9WA 3FXRA 3L9FA 1LDDA 5E17F 1ON1A 3EETA 2WWYA 4HLYA 4NQWA 2PQ8A 4RB3C 3HOSA 2X0LA 3BJAA 4HQEA 2CG4A 3J81K 1J2XA 3QOPA 3SZTA 3I0TA 1QPMA 5HDGA 4ENMA 1SFUA 3WGIA 4LFUA 2JTVA 1D3YA 1BIBA 2RKHA 1P2FA 2VBYA 1EH6A 4MQ9F 3WE2A 2BBYA 1Q1HA 1YS6A 1YS7A 1RNLA 4Y17A 2PLYA 4B09A 2ISZA 3WTZA 1BC8C 2IA1A 5TRDA 4CHUA 4HX8A 4LG0B 4WXCA 2PMHA 2RGVA 2DQLA 3IHUA 2DPDA 1XCBA 5JHUA 1HKQA 1U5TA 4GYGA 3E6CC 4Z2YA 1X3UA 5CVVA 3BZ6A 1ZGAA 3JTGA 3PFIA 2HEOA 2ISYA 2QVOA 5FB2A 5D8KB 1G3SA 2O0YA 1V4RA 2VXZA 2EFWA 1I1SA 2A3SA 1R7JA 2RV8A 3W6KB 4K2EA 3LFKA 2O03A 5JI6A 3O6BB 3LQQA 2HR3A 1HW2A 3EDPA 5AIPA 2PBIA 1V3FA 2R7FA 2HKXA 5CVRA 1MJBA 2IRFG 4ZYGA 4EQQA 3HRMA 1U5TB 2V79A 5LRSA 1SFXA 5LLQA 3QP5A 4M71A 1FSHA 3FXQA 4FHTA 2EB7A 4CO8A 1RZ4A 1HKSA 1F1ZA 2WV0A 1Z6RA 4IHTA 1PP8F 1QNTA 1K7AA 1BI1A 3T1BA 1ZG3A 1YFHA 4UXNA 5ERIA 4L0ZB 1BN5A 1LDKB 4ENNA 3L7WA 1JGSA 5JVTA 2V1UA 2D45A 1L3LA 2ELHA 3IRRA 4LK0F 5ICCA 4L9JA 2O8XA 3CO6C 4EGZA 2QQAA 2FOKA 2EV5A 1XD7A 1T98A 3FXUA 4PGHA 2WC2A 1Z1DA 1ONVA 1U8RA 2NYXA 2HZTA 2PEXA 1MJAA 2A07F 3K1MA 5ICEA 1H9GA 4OINF 2KRFA 3W6JB 1J0RA 1FBUA 1XDSA 2B0LA 2HWVA 1K78B 4LD5A 1H0MA 4P9FA 1BIAA 2UXNA 3LSTA 1BOAA 4EJWA 1O3TA 3BWGA 2VODA 2BV6A 1ZN2A 3J80K 2YR2A 2A6HF 3HRTA 5FO5A 1UHWA 5FLXZ 1B1BA 2Z9OA 1W5TA 5LBQA 1FP2A 1JHHA 1RIOH 2JSCA 1P4AA 2JPCA 1YQAA 5HDKA 4OOIA 1HW1A 3ZMVA 2VE8A 3G73A 5LHIA 4XRFA 5DD4A 3TQNA 2XV4S 2VC0A 4OIOF 2VONA 1YLFA 1HBXG 3ZQ7A 2VN2A 1UB9A 4RGSA 4N9HA 4RGUA 2FRHA 2P8TA 2MBFA 2XAHA 3L00A 2KKOA 1E2XA 4CYDA 5LGNA 2OD5A 3OOPA 3F8CA 3DPTA 2MLKA 3GW2A 4AVPA 1IRGA 1D5VA 4UV8A 2H6BA 2O3FA 3Q9VA 5IT9K 1S29A 4ZYHA 5HS7A 1R1VA 4U0VA 4G6DA 4RB1A 1R58A 3TO9A 2HKOA 3SHFA 1XSDA 4OIRF 4EM0B 4FX4A 4IJAA 3RTRA 2XGXA 1TLHB 3F6OA 2LF7A 2Y48A 2L54A 3FZVA 2W84A 5LEJA 4EMSA 4CDGA 3VOEA 2H27A 3RPQA 4KICA 3F21A 4IRGA 4Q5SF 2K4BA 1XGNA 3E3VA 4EGYA 5TJJA 4IPAA 4HLXA 4EJUA 3IWFA 1RI7A 2IA2A 1SMTA 4YIIA 4ZZDA 2L02A 1F5TA 3G3ZA 5L3CA 2KIMA 1LEAA 4UV9A 1F4KA 1Z05A 2DQRA 3ZPLA 4A5NA 2M30A 5A2QK 4L18B 2VC1A 2A61A 2TDXA 5D6EA 3M8FA 1KU3A 1Z6TA 5DUKA 3TO6A 1J5YA 2VOPA 3IC7A 3E6MA 3GZ6A 2K86A 3BROA 2PMUA 1TW3A 4GYIA 5CLSA 2OBPA 3KLOA 2P5KA 1P6RA 2QQ9A 4WX9A 2XAGA 4U0YA 4LB5A 4Y13A 5CYVA 4HDUA 3FM5A 4A0XA 4P9UA 3N4MA 4S05A 2L4AA 4A6EA 2XHKA 2M45A 1L0OC 1KU2A 4A12A 3C3WA 1XGMA 2IT0A 1FOKA 1B59A 4BHPA 4ESJA 4U7BA 4HOBA 4ESFA 1R36A 3BOQA 4G6QA 4KN7X 3O2PE 1P92A 1KQ9A 3KEOA 2IP2A 2OZ6A 4MHGA 3IKVA 4G9YA 4F7ZA 2EFQA 3NQOA 1P4WA 2PG4A 4KDPA 2FXAA 1SAXA 4EJTA 2QENA 3U2RA 4ASNA 4XSZF 5F64A 4Q4ZF 3ZMZA 4P5OA 2QQBA 1AOYA 3JW4A 2VT3A 2H6CA 1IXRC 5FD6A 4L5IA 1WWXA 1FYMA 4OIPF 3TGNA 3EUHA 4B8XA 3KETA 1USSA 3MEXA 3VODA 4IF4A 1I5ZA 4NB5A 4RAZA 1IF1A 4LLNA 1YW8A 4R8HA 3BDDA 3M7GA 3TOBA 1XSXA 4M9XA 4L5JA 3LAJA 2ZNZA 3ROUA 3V8JA 3RKYA 1AWCA 2XAFA 3K9TA 4O6JA 5HVQC 2W57A 4BXUA 2ZXJA 3MWMA 2PN6A 1J7KA 2XAJA 4JQFA 4O5VA 1KQ0A 3F6VA 3WTSC 2ZMEB 1SMYF 2GA2A 2VT2A 2KJBA 2BEOA 3HSEA 5HS9A 5CJ9A 3DXJF 3I59B 2FQ3A 1G6NA 3RDIA 4S04A 4I98B 4GXOA 5D5VB 1D8KA 1B4AA 2HQNA 1HKTA 4KMUX 2XRNA 3V4GA 4KN4X 1FLIA 5ICGA 4N0BA 2FBKA 1IZ1A 1OYWA 3HIFA 1STZA 2K4JA 1CGPA 2F5CA 4MGRA 1I27A 4HW0A 2K27A 3ZMSA 3FF5A 1XGSA 3KZZA 3GX4X 1MD0A 2YU3A 3T0YA 3D5LA 3D0SA 1R5GA 2WTEA 2F5DA 3BJOA 2NNNA 1BI0A 1ZG1A 1DP7P 2H94A 1FZPB 1VTNC 2M87A 2OQRA 5BS6A 1B6AA 3IWZA 3ZN0A 3IKTA 5KVRA 4O3MA 1SD7A 3LAPA 2P7CB 3HRUA 5HLGA 3FMRA 3CO7C 1XN7A 2DBBA 4MEYF 2MA3A 2XKOA 4I2OA 4ENJA 1YW7A 1FC3A 5H6QA 3ZP5A 2XIGA 2EA2A 1U78A 2EFPA 2QBYA 5AIQA 1LDJA 3P9IA 4UHTA 2BE5F 3MZHA 4MTDA 3MAJA 2HTSA 3VFZA 2AXLA 3GEZA 2J5OA 3F8NA 1F9NA 2GA1A 3Q9SA 3HHGA 5CVJA 3F8FA 4RGXA 1KU7A 5H6RA 1HW5A 2CW0F 4OMZA 2QBYB 3CTAA 3GFJA 2FU4A 4KMFA 3KP2A 1UHMA 2M5WA 4MTEA 1XDUA 1ULYA 1ZG5A 5FFZA 4EM2A 3GFIA 4G8XA 2ESHA 2QWWA 2HYGD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J9I A;  4XBF A;  3BPV A;  2ZO4 A;  1FX7 A;  4KUM A;  3BJ6 A;  1ZH5 A;  4U0W A;  2E1N A;  3P9K A;  1KU9 A;  4M72 A;  1UFM A;  4P55 A;  2VE9 A;  1IUY A;  4M9Z A;  2QM3 A;  3RI4 A;  3DV8 A;  3V7S A;  2V9V A;  1MDM A;  2YPR A;  2IA0 A;  3CUQ C;  1OR7 A;  3T8T A;  2E7X A;  3LQR A;  3DQV C;  5J8F A;  4LLL A;  1W7P A;  3DKW A;  4ZH4 F;  2FNA A;  1SD4 A;  1T2K A;  3T8R A;  1IN4 A;  3C1D A;  4H0E A;  4YFK F;  4I0A A;  2NS0 A;  3TDU C;  1DUX C;  5DYM A;  1BC7 C;  3SFZ A;  3DF8 A;  4XLP F;  2RVC A;  1XSV A;  4LB6 B;  4M74 A;  4AIJ A;  3KFW X;  2MC3 A;  1RUO A;  2G7U A;  5J8C A;  5BQT A;  3J7A O;  3QPT A;  4XLN F;  3F23 A;  1DDN A;  4M6X A;  1ON2 A;  1BBY A;  2PFB A;  1O7F A;  1EV7 A;  1WI9 A;  1O3R A;  4IXA A;  2P5L C;  3JSP A;  1KA8 A;  3F22 A;  2F5E A;  3QRF F;  4HBL A;  1TTY A;  4FT8 A;  3K1P A;  3J81 Z;  4EJO A;  3I71 A;  1GHC A;  5E1X A;  3WTW C;  2FE3 A;  1XB4 A;  4LGW A;  4ETS A;  2DTR A;  5HDN A;  2P5V A;  4PGG A;  2NAZ A;  2RC4 A;  3VB2 A;  5KK1 A;  3JAM K;  2DK5 A;  1JE8 A;  1ZAO A;  2HYF A;  2V1D A;  1SD6 A;  4HF2 A;  4HV6 A;  2GXB A;  3B02 A;  1R00 A;  2GWR A;  5E20 A;  4KT5 C;  4CGZ A;  3C18 A;  3F8B A;  4HQM A;  3R60 A;  4EV0 A;  3QP6 A;  4RB0 A;  1OYY A;  1S6L A;  4ESB A;  2ZNY A;  3RIR A;  4I01 A;  5JR3 A;  2IW5 A;  4MQV A;  1SD5 A;  5ILV A;  5E1Z B;  3KCC A;  1IN5 A;  1CF7 A;  5D5W B;  2Y0M A;  5EEH A;  3ELK A;  1FP1 D;  3M8E A;  3QPH A;  4HA8 A;  1TW2 A;  1LEB A;  3I53 A;  5K5O A;  4CXF A;  4AD9 A;  4JBA A;  3T5X A;  1Z9C A;  2Y75 A;  4HF0 A;  3FWE A;  1KQ8 A;  3WU0 A;  3RKW A;  5K5Q A;  4WWC A;  4LLG F;  2BYV E;  3MCZ A;  2JZY A;  1O3Q A;  2AS5 F;  2KIU A;  1IW7 F;  4DQ2 A;  3DFG A;  1O57 A;  3P9C A;  2XAQ A;  5ILS A;  1ZYR F;  5ILU A;  2EFN A;  2P6S A;  4I7H A;  3WTT C;  3V8L A;  4UNO A;  1U2W A;  4BAY A;  2VOO A;  3QAH A;  1C0W A;  4U7D A;  4KNY A;  3WU1 B;  2ZKZ A;  4RB2 C;  2RNJ A;  1TQI A;  4FX0 A;  1XCV A;  2Z3Y A;  1S7O A;  3SQN A;  4PZJ A;  2MLG A;  3KE2 A;  2IVM A;  4GCV A;  4P96 A;  2DLL A;  2GIV A;  4IRI A;  3JTH A;  1U5T C;  5J6X A;  2QYO A;  3ABU A;  3IL2 A;  1S3J A;  4BQA A;  3R4K A;  2L4M A;  3I54 A;  3FMS A;  3RPU A;  2J5P A;  3HTS B;  4XSX F;  1ZHF A;  1ODD A;  2DFI A;  2ZFW A;  1FT9 A;  5DCM A;  1IN6 A;  2HGC A;  1QBJ A;  3J80 Z;  5ICF A;  1IN8 A;  3WTY C;  5BPD A;  5HS8 A;  1R1T A;  2RQP A;  3E6D A;  3I4P A;  5L3E A;  2P4W A;  4N9I A;  3DP7 A;  4A0Z A;  2IJL A;  5D4R A;  3TDZ C;  1ZLK A;  5FD5 A;  3L2C A;  2XKP A;  3AAF A;  4M73 A;  2VBZ A;  2GAU A;  1R23 A;  3BY6 A;  5DUI A;  2XRO A;  1W7P D;  3HYI A;  1OKR A;  5DCM B;  2FEZ A;  4PCQ A;  2ESN A;  2OU2 A;  1YTY A;  3U9G A;  5E1W A;  3KP6 A;  1LVA A;  2A5Y B;  5JFR A;  1TNS A;  3ECH A;  1Y0U A;  3KP7 A;  1TBX A;  2KIF A;  2D1V A;  3S2W A;  3DPL C;  3MFK A;  1ZRE A;  1G3T A;  3FMQ A;  3TKY A;  3E6B A;  4HX7 A;  1EH7 A;  4IRH A;  1OMI A;  1R22 A;  5IT9 Z;  4M9S A;  1OYI A;  4ZZL A;  1HQC A;  3CJN A;  3JSO A;  2O6G E;  1P4X A;  2DO7 A;  5AON A;  1OPC A;  2ZCW A;  2DT5 A;  5LGU A;  2FNP A;  3K1N A;  2MD5 A;  1B9N A;  3ML6 A;  1E17 A;  3H92 A;  3HOT A;  4L0Y B;  5D4S A;  1LQ1 A;  3V7R A;  1R5H A;  3RKX A;  4CZZ A;  5F6F A;  4LK1 F;  5D8L B;  4AIH A;  2HDC A;  1JHF A;  5CVU A;  3LA7 A;  3RYP A;  4A6D A;  5FLX K;  3HTU A;  4OU0 A;  2DU9 A;  1YYV A;  1BI3 A;  2K02 A;  1U3E M;  5ED4 A;  4KFC A;  2EV0 A;  4WXD A;  2FF4 A;  3HHH A;  1QGP A;  2CO5 A;  2W25 A;  5A2Q Z;  1R1U A;  3OV8 A;  4EM1 A;  4LG0 A;  3KP5 A;  1T39 A;  3HSR A;  1GXQ A;  4GO1 A;  2Q8K A;  1GVJ A;  4ON0 A;  1BM9 A;  4LMY A;  2MH2 A;  2RN7 A;  4UVB A;  2E1C A;  5BOX A;  4RS8 A;  3CLO A;  3FHZ A;  1MZB A;  3ULQ B;  2A68 F;  4HF1 A;  2C6Y A;  3PQJ A;  2EA4 A;  2BGC A;  1MGT A;  3WTU C;  2ACJ A;  2DK8 A;  1G3Y A;  4A5M A;  3CUO A;  5DEQ A;  3P7N A;  4WF2 A;  3E5X A;  5LHG A;  2EJR A;  4I02 A;  2GXG A;  3GLX A;  4EVI A;  4TV7 A;  4DNC A;  1ZRF A;  2HTJ A;  3GXO A;  2LNB A;  3RJP A;  4CIC A;  2KJC A;  1KYZ A;  4U88 A;  1LB2 A;  3WTV C;  2G7H A;  1FY7 A;  5L3D A;  5DCF A;  5LRR A;  1FNN A;  2F2E A;  1ZGJ A;  4L9T A;  5L3B A;  5E8I A;  3I5U A;  2FSW A;  4KIG A;  1BJA A;  1KGS A;  4UVA A;  3KZY A;  3GFM A;  2UWM A;  3E5Q A;  1FBS A;  3WOD F;  2JPB A;  4UUV A;  3E97 A;  2XAS A;  2P6T A;  2V1X A;  1QQI A;  1DPR A;  1ZRD A;  5D6F A;  1DPU A;  4MEX F;  3BP8 A;  3H3U A;  2VBX A;  4YFN F;  4NHJ A;  1XGO A;  3Q5F A;  1S7A A;  5D5U B;  2QZ8 A;  4MNU A;  2UZK A;  1TNT A;  1FYK A;  5L3F A;  2CQK A;  1K78 A;  5DD8 A;  3U1D A;  2OA4 A;  1IRF A;  2VBW A;  1T38 A;  2LF8 A;  1HSJ A;  2YX7 A;  2DW4 A;  3EYI A;  4L9N A;  2L3D A;  1I1G A;  4G94 A;  4WK8 F;  1J59 A;  1K79 A;  1FPQ A;  4PDK A;  3PQK A;  1FYL A;  4KIB A;  3WTX C;  3LA3 A;  1MDM B;  4A2U A;  1YO5 C;  5E18 F;  5BMZ A;  1W7P B;  5F1R A;  5LEK A;  2Z33 A;  2STW A;  3ZMT A;  2CWE A;  3F3X A;  3EYY A;  1RUN A;  4WCG A;  3KP3 A;  4E70 A;  4IHS A;  3WG9 A;  4GGG A;  4EJV A;  4AIK A;  2MH9 A;  1G3W A;  4HV5 A;  4BNC A;  3H3Z A;  2A6E F;  3R0A A;  1FBQ A;  2COM A;  3DEU A;  5K5R A;  1QZY A;  4YG2 F;  1IXC A;  4OIQ F;  3LA2 A;  3NEU A;  2L01 A;  1WRJ A;  4HYE A;  2W24 A;  5HLI A;  2Z99 A;  1TQP A;  2XVC A;  2W85 A;  2EV6 A;  5BPI A;  1H9T A;  3F8M A;  2DI3 A;  3GFL A;  1O3S A;  2E7W A;  3ZMD A;  1J75 A;  2QLZ A;  3REO A;  1WQ2 A;  4KIF A;  1BI2 A;  1G4D A;  2Q0O A;  4UVC A;  1XMA A;  2D1H A;  4Q48 A;  1ZRC A;  2ZJ2 A;  4IVN A;  3GZ5 A;  4G7Z F;  4HAM A;  4G7O F;  3KLN A;  3GWZ A;  3RYR A;  2JRT A;  1JXS A;  1LJ9 A;  1XMK A;  1D8J A;  1HST A;  1ZLJ A;  3ABT A;  2R3S A;  1W4M A;  4YIF A;  5EEG A;  2YX4 A;  1FWZ A;  2FA5 A;  3R0J A;  1O7L A;  1SFE A;  3VEP A;  1B9M A;  2O61 A;  1YIO A;  5CVI A;  2H09 A;  1IAW A;  2HS5 A;  6PAX A;  1FSE A;  3F72 A;  3GUD A;  3WGH A;  2JT1 A;  1PP7 U;  2K7L A;  2M8E A;  5K1Y A;  1CF7 B;  1IXS B;  2CYY A;  3E5U A;  1LNW A;  2ADU A;  3IRQ A;  2A69 F;  3ZMU A;  4BHB A;  1NHA A;  4I09 A;  2CFX A;  4R1H A;  5DV5 A;  1REP C;  2DAO A;  4M6Y A;  2FBI A;  4RAY A;  3QU6 A;  4WXH A;  3K69 A;  5D5X B;  3GYH X;  4A0Y A;  3HUG A;  3R61 A;  4BH9 A;  3ECO A;  3GO5 A;  3GVA A;  4HZF A;  3O3K A;  3TOA A;  1IN7 A;  4ZYD A;  1QZZ A;  5LGT A;  1WSU A;  4HDV A;  2OZU A;  1YW9 A;  2X4H A;  3B73 A;  4JK1 X;  3MZY A;  2UXX A;  4LJZ F;  1UCR A;  3BPX A;  1GXP A;  3ERE D;  1T6S A;  4BHC A;  4G7H F;  3CUQ A;  4R79 A;  2OAZ A;  2ZBK A;  1Z91 A;  3EQL F;  3HRS A;  3ZN1 A;  5HOO A;  5FGM A;  1QO0 D;  2DPU A;  3WGG A;  3R6S A;  2QUF A;  4QLC U;  4KYW A;  4HX4 A;  3V8K A;  2STT A;  4L9V A;  2OQG A;  1K6O A;  2IPQ X;  4Q47 A;  2P7V B;  2V6C A;  2FML A;  3HSF A;  5HLH A;  3KP4 A;  2XUB A;  3QU3 A;  2HOE A;  1Z7U A;  2GZW A;  3CUQ B;  3SZP A;  4I0B A;  1EH8 A;  4YFX F;  3I64 A;  1W5S A;  1YG2 A;  3I58 A;  3FX3 A;  3WE3 A;  3KEQ A;  5IT3 A;  4QWQ A;  1U6G A;  2LSO A;  3M9A A;  2F5F A;  3V7C A;  1ZAR A;  2ETH A;  2PI0 A;  3GF2 A;  2LDU A;  1A04 A;  3C7J A;  4RGR A;  3ISP A;  4KA4 A;  2NRA C;  3L09 A;  2EK5 A;  2NNY A;  3JAM Z;  3COA C;  1I6X A;  3NRV A;  3FM3 A;  4ZYE A;  2FBH A;  2ZME A;  2FMY A;  5FFX A;  5H20 A;  2EFO A;  2EWN A;  3M1E A;  1T0F A;  2M1B A;  3I59 A;  3N97 A;  2PJP A;  4Y15 A;  2HFH A;  3TO7 A;  1KYW A;  1UST A;  2LKP A;  2HQR A;  5DDG A;  3SXY A;  1PDN C;  3K0L A;  4D0P A;  4ENK A;  3K2Z A;  2GQQ A;  3MQ0 A;  2CGP A;  1S8N A;  1TQM A;  1MJ9 A;  4AWX B;  1WKM A;  2D2W A;  1HXD A;  2CSO A;  3CDH A;  3LWF A;  4OMY A;  5LHH A;  1PUE E;  5E8G A;  2Z5U A;  2RDP A;  5L3G A;  2Q2E A;  4BYY A;  2YSR A;  2R7D A;  1MKM A;  2G9W A;  3FXR A;  3L9F A;  1LDD A;  5E17 F;  1ON1 A;  3EET A;  2WWY A;  4HLY A;  4NQW A;  2PQ8 A;  4RB3 C;  3HOS A;  2X0L A;  3BJA A;  4HQE A;  2CG4 A;  3J81 K;  1J2X A;  3QOP A;  3SZT A;  3I0T A;  1QPM A;  5HDG A;  4ENM A;  1SFU A;  3WGI A;  4LFU A;  2JTV A;  1D3Y A;  1BIB A;  2RKH A;  1P2F A;  2VBY A;  1EH6 A;  4MQ9 F;  3WE2 A;  2BBY A;  1Q1H A;  1YS6 A;  1YS7 A;  1RNL A;  4Y17 A;  2PLY A;  4B09 A;  2ISZ A;  3WTZ A;  1BC8 C;  2IA1 A;  5TRD A;  4CHU A;  4HX8 A;  4LG0 B;  4WXC A;  2PMH A;  2RGV A;  2DQL A;  3IHU A;  2DPD A;  1XCB A;  5JHU A;  1HKQ A;  1U5T A;  4GYG A;  3E6C C;  4Z2Y A;  1X3U A;  5CVV A;  3BZ6 A;  1ZGA A;  3JTG A;  3PFI A;  2HEO A;  2ISY A;  2QVO A;  5FB2 A;  5D8K B;  1G3S A;  2O0Y A;  1V4R A;  2VXZ A;  2EFW A;  1I1S A;  2A3S A;  1R7J A;  2RV8 A;  3W6K B;  4K2E A;  3LFK A;  2O03 A;  5JI6 A;  3O6B B;  3LQQ A;  2HR3 A;  1HW2 A;  3EDP A;  5AIP A;  2PBI A;  1V3F A;  2R7F A;  2HKX A;  5CVR A;  1MJB A;  2IRF G;  4ZYG A;  4EQQ A;  3HRM A;  1U5T B;  2V79 A;  5LRS A;  1SFX A;  5LLQ A;  3QP5 A;  4M71 A;  1FSH A;  3FXQ A;  4FHT A;  2EB7 A;  4CO8 A;  1RZ4 A;  1HKS A;  1F1Z A;  2WV0 A;  1Z6R A;  4IHT A;  1PP8 F;  1QNT A;  1K7A A;  1BI1 A;  3T1B A;  1ZG3 A;  1YFH A;  4UXN A;  5ERI A;  4L0Z B;  1BN5 A;  1LDK B;  4ENN A;  3L7W A;  1JGS A;  5JVT A;  2V1U A;  2D45 A;  1L3L A;  2ELH A;  3IRR A;  4LK0 F;  5ICC A;  4L9J A;  2O8X A;  3CO6 C;  4EGZ A;  2QQA A;  2FOK A;  2EV5 A;  1XD7 A;  1T98 A;  3FXU A;  4PGH A;  2WC2 A;  1Z1D A;  1ONV A;  1U8R A;  2NYX A;  2HZT A;  2PEX A;  1MJA A;  2A07 F;  3K1M A;  5ICE A;  1H9G A;  4OIN F;  2KRF A;  3W6J B;  1J0R A;  1FBU A;  1XDS A;  2B0L A;  2HWV A;  1K78 B;  4LD5 A;  1H0M A;  4P9F A;  1BIA A;  2UXN A;  3LST A;  1BOA A;  4EJW A;  1O3T A;  3BWG A;  2VOD A;  2BV6 A;  1ZN2 A;  3J80 K;  2YR2 A;  2A6H F;  3HRT A;  5FO5 A;  1UHW A;  5FLX Z;  1B1B A;  2Z9O A;  1W5T A;  5LBQ A;  1FP2 A;  1JHH A;  1RIO H;  2JSC A;  1P4A A;  2JPC A;  1YQA A;  5HDK A;  4OOI A;  1HW1 A;  3ZMV A;  2VE8 A;  3G73 A;  5LHI A;  4XRF A;  5DD4 A;  3TQN A;  2XV4 S;  2VC0 A;  4OIO F;  2VON A;  1YLF A;  1HBX G;  3ZQ7 A;  2VN2 A;  1UB9 A;  4RGS A;  4N9H A;  4RGU A;  2FRH A;  2P8T A;  2MBF A;  2XAH A;  3L00 A;  2KKO A;  1E2X A;  4CYD A;  5LGN A;  2OD5 A;  3OOP A;  3F8C A;  3DPT A;  2MLK A;  3GW2 A;  4AVP A;  1IRG A;  1D5V A;  4UV8 A;  2H6B A;  2O3F A;  3Q9V A;  5IT9 K;  1S29 A;  4ZYH A;  5HS7 A;  1R1V A;  4U0V A;  4G6D A;  4RB1 A;  1R58 A;  3TO9 A;  2HKO A;  3SHF A;  1XSD A;  4OIR F;  4EM0 B;  4FX4 A;  4IJA A;  3RTR A;  2XGX A;  1TLH B;  3F6O A;  2LF7 A;  2Y48 A;  2L54 A;  3FZV A;  2W84 A;  5LEJ A;  4EMS A;  4CDG A;  3VOE A;  2H27 A;  3RPQ A;  4KIC A;  3F21 A;  4IRG A;  4Q5S F;  2K4B A;  1XGN A;  3E3V A;  4EGY A;  5TJJ A;  4IPA A;  4HLX A;  4EJU A;  3IWF A;  1RI7 A;  2IA2 A;  1SMT A;  4YII A;  4ZZD A;  2L02 A;  1F5T A;  3G3Z A;  5L3C A;  2KIM A;  1LEA A;  4UV9 A;  1F4K A;  1Z05 A;  2DQR A;  3ZPL A;  4A5N A;  2M30 A;  5A2Q K;  4L18 B;  2VC1 A;  2A61 A;  2TDX A;  5D6E A;  3M8F A;  1KU3 A;  1Z6T A;  5DUK A;  3TO6 A;  1J5Y A;  2VOP A;  3IC7 A;  3E6M A;  3GZ6 A;  2K86 A;  3BRO A;  2PMU A;  1TW3 A;  4GYI A;  5CLS A;  2OBP A;  3KLO A;  2P5K A;  1P6R A;  2QQ9 A;  4WX9 A;  2XAG A;  4U0Y A;  4LB5 A;  4Y13 A;  5CYV A;  4HDU A;  3FM5 A;  4A0X A;  4P9U A;  3N4M A;  4S05 A;  2L4A A;  4A6E A;  2XHK A;  2M45 A;  1L0O C;  1KU2 A;  4A12 A;  3C3W A;  1XGM A;  2IT0 A;  1FOK A;  1B59 A;  4BHP A;  4ESJ A;  4U7B A;  4HOB A;  4ESF A;  1R36 A;  3BOQ A;  4G6Q A;  4KN7 X;  3O2P E;  1P92 A;  1KQ9 A;  3KEO A;  2IP2 A;  2OZ6 A;  4MHG A;  3IKV A;  4G9Y A;  4F7Z A;  2EFQ A;  3NQO A;  1P4W A;  2PG4 A;  4KDP A;  2FXA A;  1SAX A;  4EJT A;  2QEN A;  3U2R A;  4ASN A;  4XSZ F;  5F64 A;  4Q4Z F;  3ZMZ A;  4P5O A;  2QQB A;  1AOY A;  3JW4 A;  2VT3 A;  2H6C A;  1IXR C;  5FD6 A;  4L5I A;  1WWX A;  1FYM A;  4OIP F;  3TGN A;  3EUH A;  4B8X A;  3KET A;  1USS A;  3MEX A;  3VOD A;  4IF4 A;  1I5Z A;  4NB5 A;  4RAZ A;  1IF1 A;  4LLN A;  1YW8 A;  4R8H A;  3BDD A;  3M7G A;  3TOB A;  1XSX A;  4M9X A;  4L5J A;  3LAJ A;  2ZNZ A;  3ROU A;  3V8J A;  3RKY A;  1AWC A;  2XAF A;  3K9T A;  4O6J A;  5HVQ C;  2W57 A;  4BXU A;  2ZXJ A;  3MWM A;  2PN6 A;  1J7K A;  2XAJ A;  4JQF A;  4O5V A;  1KQ0 A;  3F6V A;  3WTS C;  2ZME B;  1SMY F;  2GA2 A;  2VT2 A;  2KJB A;  2BEO A;  3HSE A;  5HS9 A;  5CJ9 A;  3DXJ F;  3I59 B;  2FQ3 A;  1G6N A;  3RDI A;  4S04 A;  4I98 B;  4GXO A;  5D5V B;  1D8K A;  1B4A A;  2HQN A;  1HKT A;  4KMU X;  2XRN A;  3V4G A;  4KN4 X;  1FLI A;  5ICG A;  4N0B A;  2FBK A;  1IZ1 A;  1OYW A;  3HIF A;  1STZ A;  2K4J A;  1CGP A;  2F5C A;  4MGR A;  1I27 A;  4HW0 A;  2K27 A;  3ZMS A;  3FF5 A;  1XGS A;  3KZZ A;  3GX4 X;  1MD0 A;  2YU3 A;  3T0Y A;  3D5L A;  3D0S A;  1R5G A;  2WTE A;  2F5D A;  3BJO A;  2NNN A;  1BI0 A;  1ZG1 A;  1DP7 P;  2H94 A;  1FZP B;  1VTN C;  2M87 A;  2OQR A;  5BS6 A;  1B6A A;  3IWZ A;  3ZN0 A;  3IKT A;  5KVR A;  4O3M A;  1SD7 A;  3LAP A;  2P7C B;  3HRU A;  5HLG A;  3FMR A;  3CO7 C;  1XN7 A;  2DBB A;  4MEY F;  2MA3 A;  2XKO A;  4I2O A;  4ENJ A;  1YW7 A;  1FC3 A;  5H6Q A;  3ZP5 A;  2XIG A;  2EA2 A;  1U78 A;  2EFP A;  2QBY A;  5AIQ A;  1LDJ A;  3P9I A;  4UHT A;  2BE5 F;  3MZH A;  4MTD A;  3MAJ A;  2HTS A;  3VFZ A;  2AXL A;  3GEZ A;  2J5O A;  3F8N A;  1F9N A;  2GA1 A;  3Q9S A;  3HHG A;  5CVJ A;  3F8F A;  4RGX A;  1KU7 A;  5H6R A;  1HW5 A;  2CW0 F;  4OMZ A;  2QBY B;  3CTA A;  3GFJ A;  2FU4 A;  4KMF A;  3KP2 A;  1UHM A;  2M5W A;  4MTE A;  1XDU A;  1ULY A;  1ZG5 A;  5FFZ A;  4EM2 A;  3GFI A;  4G8X A;  2ESH A;  2QWW A;  2HYG D; 
#chains in the Genus database with same CATH topology
 1N78 A;  2XF6 A;  4XBF A;  3BPV A;  1J9I A;  2ZO4 A;  3K6G A;  1FX7 A;  2WAF A;  1ERD A;  3A0H C;  1M1E B;  4KUM A;  2JSP A;  3UNG C;  1MW7 A;  3BJ6 A;  1ZH5 A;  3S3M A;  5IYB J;  4ZTF A;  2VJ4 A;  4U0W A;  3HOZ J;  2E1N A;  3RQI A;  3P9K A;  2XF5 A;  4IEJ A;  1KU9 A;  4M72 A;  1UFM A;  4P55 A;  2VE9 A;  1IUY A;  3QWL A;  2K9Q A;  4M9Z A;  2QM3 A;  3RI4 A;  3GTP J;  2UUZ A;  3J7A Y;  3JRH A;  3DV8 A;  2KP6 A;  3V7S A;  2V9V A;  3PIO F;  1MDM A;  2YPR A;  2IA0 A;  3S2H J;  3HGG A;  4XRS A;  4AYB A;  3CUQ C;  3MVP A;  3K70 D;  1OR7 A;  3T8T A;  2CUZ A;  2E7X A;  3LQR A;  2ELJ A;  3DQV C;  5F1J A;  5J8F A;  3OYF A;  4A3D J;  4LLL A;  1W7P A;  3DKW A;  3SDG A;  3TBI A;  3JRC A;  2GLO A;  4ZH4 F;  2FNA A;  1SD4 A;  1UJ8 A;  1T2K A;  3T8R A;  1D0X A;  1IN4 A;  2COB A;  2DA2 A;  3Q3S A;  3QPS A;  3C1D A;  2WA0 A;  4H0E A;  1X1D A;  4NNJ A;  5TGT A;  4YFK F;  4I0A A;  2M7B A;  2MG4 A;  2BY0 A;  4QSH A;  2NS0 A;  2PMZ N;  3TDU C;  1DGR M;  1DUX C;  5DYM A;  2GIZ A;  1MBK A;  4B1R A;  1BC7 C;  3SFZ A;  3DF8 A;  1E3H A;  2MGQ A;  4XLP F;  4AUX A;  4BBS J;  3VWB A;  2RVC A;  3FKI J;  1XSV A;  4LB6 B;  4C3H J;  1DGW Y;  4M74 A;  1XS9 A;  4AIJ A;  3KFW X;  1F36 A;  2HXO A;  2BZT A;  2MC3 A;  1RUO A;  2G7U A;  5J8C A;  1S9H A;  3Q0W A;  5BQT A;  4IOC F;  3RZD J;  3J7A O;  3QPT A;  4XLN F;  3F23 A;  1DDN A;  4HSR A;  4M6X A;  3CQZ J;  1ON2 A;  3ZQQ A;  1BBY A;  2PFB A;  1RR7 A;  1GV5 A;  1EV7 A;  1O7F A;  2L7K A;  1WI9 A;  3BTI A;  1O3R A;  4HNT A;  4IXA A;  2P5L C;  3JSP A;  4XIC A;  1KA8 A;  4HG2 A;  3F22 A;  2F5E A;  2N8G A;  3QRF F;  4XRS G;  4HBL A;  2W48 A;  1TTY A;  2O7O A;  4FT8 A;  3TL4 X;  3K1P A;  3J81 Z;  2Y9Z A;  2K3F A;  4EJO A;  3I71 A;  4JX5 A;  1GHC A;  5E1X A;  3WTW C;  1IGN A;  2LD5 A;  2W4S A;  2FE3 A;  1XB4 A;  4LGW A;  4LIT A;  4ETS A;  2DYR H;  5IP6 A;  2DTR A;  5HDN A;  3ASO H;  4C3I J;  2P5V A;  4PGG A;  2JVH A;  2NAZ A;  2ZME C;  4NUB A;  4BXF A;  2RC4 A;  3CCR I;  1HA8 A;  3VB2 A;  5KK1 A;  3JAM K;  4MO7 A;  2DK5 A;  1JE8 A;  2JQ7 A;  1ZAO A;  2HYF A;  2V1D A;  2F6C A;  4CCO A;  1SD6 A;  1T0F C;  4HF2 A;  4HV6 A;  2GXB A;  2E1M B;  1J09 A;  2DA6 A;  5M5W J;  3B02 A;  1R00 A;  4BBR J;  2GWR A;  2KZG A;  4ZDO A;  4QTR A;  3O8G A;  3HB9 A;  5E20 A;  5IY5 H;  4KT5 C;  5GAG J;  3C18 A;  4CGZ A;  4BQO A;  2V1N A;  2ECC A;  3F8B A;  2Y9Y A;  1D5Y A;  4U87 A;  2M0C A;  4HQM A;  3G1M A;  3R60 A;  3ABM H;  1MSF C;  4GDF A;  5J4Y A;  2WAQ A;  4M6V A;  4EV0 A;  2YUS A;  1MIJ A;  4C2U A;  3QP6 A;  4RB0 A;  2VKH A;  3CMM A;  1LFB A;  1OYY A;  1S6L A;  4ESB A;  2ZNY A;  4DZJ A;  3RIR A;  1VQ6 I;  4I01 A;  3H35 A;  2DDA A;  5JR3 A;  3W6V A;  2IW5 A;  2EIJ H;  1UG0 A;  1SD5 A;  4MQV A;  5E1Z B;  5ILV A;  2CQQ A;  3KCC A;  1IN5 A;  1CF7 A;  3LMM A;  5D5W B;  2Y0M A;  3DCF A;  3BR6 A;  5EEH A;  3ELK A;  1FP1 D;  4DIQ A;  3M8E A;  3FK7 A;  3QPH A;  4HA8 A;  2V9P A;  1TW2 A;  1TWG J;  1LEB A;  3I53 A;  3VYR B;  5K5O A;  4CXF A;  4AD9 A;  4JBA A;  3T5X A;  1Z9C A;  2Y75 A;  2Z1D A;  3CC4 I;  4HF0 A;  5KCM A;  3FWE A;  1KQ8 A;  1EKE A;  3WU0 A;  3RKW A;  3OWT A;  1WVR A;  4IKF A;  4L5E A;  5K5Q A;  4PUS A;  4DJA A;  1TT5 B;  4LLG F;  4WWC A;  1JJ8 C;  3JRE A;  2BYV E;  1ETQ A;  3MCZ A;  2JZY A;  1O3Q A;  2AS5 F;  1JKP C;  2KIU A;  1IW7 F;  4DQ2 A;  2RNG A;  3DFG A;  1O57 A;  2HU9 A;  2DT6 A;  3P9C A;  2XAQ A;  2YS9 A;  4B3A A;  3L2R A;  5ILS A;  1ZYR F;  2GXA A;  4OAZ A;  4HNU A;  2WBM A;  2EFN A;  5ILU A;  4BE1 A;  2P6S A;  2F5V A;  4BGD A;  2HXI A;  3ERM A;  2OPT A;  1HCR A;  4I7H A;  3WTT C;  3OS0 A;  3V8L A;  3S15 J;  2X9D A;  4UNO A;  1U2W A;  4BAY A;  1D1B A;  2EZK A;  3DBL B;  1DQU A;  3L2V A;  1FIP A;  2JMW A;  4XOR A;  1U8B A;  2VOO A;  3QAH A;  2M7A A;  1C0W A;  4U7D A;  1V5E A;  4KNY A;  3WU1 B;  2VPL A;  5E3M A;  1MND A;  2ZKZ A;  1NG6 A;  2RNJ A;  4RB2 C;  1TQI A;  1XCV A;  2Z3Y A;  3MMY B;  4FX0 A;  1S7O A;  3SQN A;  1BR1 A;  3I9V 2;  4PZJ A;  2MLG A;  3KE2 A;  3NAR A;  2IVM A;  4GCV A;  4P96 A;  3AL0 C;  2DLL A;  2GIV A;  4AID A;  1E3P A;  4IRI A;  3JTH A;  1U5T C;  3A1Y A;  5J6X A;  3OMY A;  2QYO A;  3SEQ A;  3ABU A;  3IL2 A;  1B72 A;  1FEX A;  1S3J A;  2K9M A;  2MD0 A;  4BQA A;  4QPO A;  3OYA A;  1N75 A;  3R4K A;  1SEU A;  2L4M A;  3I54 A;  3FMS A;  2L7F P;  3RPU A;  5FKM A;  2J5P A;  3HTS B;  3OIO A;  2QQ8 A;  4XSX F;  4B43 A;  2L5Q A;  2NXN B;  1ZHF A;  1WI3 A;  3HOV J;  1ODD A;  3ZQF A;  5FKL A;  1UZC A;  4E6K G;  2DFI A;  5B1B H;  5F04 A;  1D1C A;  2ZFW A;  3CC7 I;  2KIS A;  2VI6 A;  2X51 A;  3FHN A;  4XR6 A;  1FT9 A;  4FIS A;  4A3B J;  5DCM A;  4ZDP A;  1IN6 A;  2H1K A;  3W2A A;  2HGC A;  1QBJ A;  5ICF A;  3J80 Z;  1IN8 A;  3OYG A;  3WTY C;  2BY2 A;  3QQA A;  5BPD A;  4F93 B;  2O5R A;  5HS8 A;  2HVS A;  3FXJ A;  3GLL A;  4DYC A;  1R1T A;  2RQP A;  5HNH A;  1Y39 A;  3E6D A;  3CLQ A;  3KYC B;  3I4P A;  5L3E A;  2P4W A;  4N9I A;  3DP7 A;  1HLV A;  3HZJ A;  4A0Z A;  2IJL A;  5D4R A;  5J40 A;  3TDZ C;  4J00 A;  1ZLK A;  5IOZ A;  5FD5 A;  3L2C A;  2XKP A;  3GZN B;  3AAF A;  3BR3 A;  4M73 A;  1WCM J;  3VYU B;  3CCY A;  2KRC A;  4A3E J;  2VBZ A;  2V26 A;  2GAU A;  1A35 A;  1LE8 B;  1OLT A;  1R23 A;  3BY6 A;  5DUI A;  2XRO A;  1R9T J;  4NBQ A;  2ID6 A;  1W7P D;  3HYI A;  1FOW A;  1OKR A;  5DCM B;  2FEZ A;  4PCQ A;  2ESN A;  3ABL H;  5HLT A;  2OU2 A;  1YTY A;  2JA8 J;  1X1C A;  1FIA A;  3OOU A;  4A3C J;  3HKZ N;  3H36 A;  3U9G A;  5GAE J;  4E7H A;  2X1D A;  5E1W A;  2BXY A;  3KP6 A;  3O8H A;  2MAB A;  2ID3 A;  2KDZ A;  1LVA A;  2LP0 A;  2A5Y B;  1R4N B;  5JFR A;  3KYL A;  1TNS A;  4C2M J;  3ECH A;  1S72 I;  5C4J J;  1Y0U A;  4YRV A;  1G2H A;  3PM1 A;  3KP7 A;  1TBX A;  4PSW A;  1VF9 A;  3MD2 A;  4E7I A;  3JR9 A;  3M3Y J;  3OYM A;  4KJZ A;  3HL2 A;  1XC5 A;  2KIF A;  2D1V A;  3S2W A;  5B1A H;  2EPF A;  3DPL C;  1YX3 A;  3MFK A;  2QKL B;  1T8I A;  2JJ7 A;  1ZRE A;  2EIL H;  2ME6 A;  1G3T A;  4D7N A;  3JRB A;  2VL8 A;  5K7F A;  3FMQ A;  4F52 A;  3TKY A;  1W1W E;  3E6B A;  2CQN A;  2IEK A;  4HX7 A;  3AG1 H;  1EH7 A;  4JYK A;  3OIQ A;  4IRH A;  5KAF C;  1OMI A;  1R22 A;  5IT9 Z;  4Y52 J;  4M9S A;  1OYI A;  4ZZL A;  2K40 A;  3L2U A;  5M5Y J;  1HQC A;  3CJN A;  3JSO A;  2O6G E;  2M2E A;  1P4X A;  2DO7 A;  1IRZ A;  4B3X A;  5AON A;  4M3E A;  1OPC A;  3GTJ J;  2ZCW A;  2DT5 A;  4II3 A;  5LGU A;  3X2Q H;  2FNP A;  3K1N A;  2MD5 A;  1VQ7 I;  3OS2 A;  1B9N A;  3RSN A;  2VXD A;  3ML6 A;  2HQA A;  4BJ5 C;  1E17 A;  3H92 A;  1IRX A;  3HOT A;  1SVL A;  4X0G A;  2CRG A;  1A6I A;  4C9Y A;  4L0Y B;  3QOD A;  4RMN A;  5D4S A;  1OIS A;  1LQ1 A;  3V7R A;  1R5H A;  3RKX A;  4CZZ A;  4RA2 A;  4S0H B;  1JUS A;  5F6F A;  3FXK A;  4LK1 F;  1WJD A;  5FRM A;  5F0H A;  1HOM A;  3OIP A;  5IOY A;  5D8L B;  4CCL A;  4AIH A;  2HDC A;  1JHF A;  5CVU A;  3LA7 A;  3OL4 A;  3RYP A;  4C3J J;  2DMN A;  4A6D A;  3CCQ I;  5FLX K;  3HG9 A;  1FOY A;  3HTU A;  4XN0 A;  4OU0 A;  2DU9 A;  1YYV A;  3BR0 A;  4AC0 A;  2KHM A;  1BI3 A;  2K02 A;  3VYT B;  4RM2 A;  1ETW A;  2BVL A;  4B48 A;  3F9K A;  1U3E M;  5ED4 A;  4KFC A;  2F48 A;  2EV0 A;  4WXD A;  2FF4 A;  2VB6 A;  3U1K A;  3HGY A;  3HHH A;  1BR4 A;  1QGP A;  4NC6 A;  2QCO A;  4P1W A;  2IGO A;  2CO5 A;  2VKV A;  2E2H J;  2RQQ A;  5J1Y A;  4J19 A;  2W25 A;  5A2Q Z;  1Y8Q B;  1R1U A;  3OV8 A;  2LOO A;  3HXL A;  4EM1 A;  4LG0 A;  3KP5 A;  3CZ6 A;  2LRE A;  2L9V A;  1T39 A;  3HSR A;  1JTY A;  1D0Z A;  3DKY A;  4OWR B;  3HOX J;  3G4S I;  1CQT A;  1GXQ A;  4GO1 A;  2Q8K A;  1GVJ A;  4ON0 A;  1BM9 A;  4LMY A;  2MH2 A;  2RN7 A;  2QSF X;  1UMQ A;  4D9J A;  1OFC X;  1MBE A;  1BA5 A;  4UVB A;  3AG2 H;  4XLA A;  3CDI A;  2E1C A;  5BOX A;  4RS8 A;  3CLO A;  3L2W A;  2V9K A;  3J7Y J;  5K7Z A;  1G8X A;  3UR3 C;  3QYB A;  2R7Q A;  3BG5 A;  3K4C A;  4BXX J;  1OCC H;  3WHC A;  1RKT A;  3FHZ A;  1MZB A;  1AHD P;  3S16 J;  3ULQ B;  2A68 F;  4XLC A;  1I3A A;  4HF1 A;  2C6Y A;  3LSG A;  3S1M J;  3LOC A;  2EA4 A;  2QF7 A;  2BGC A;  3PQJ A;  1MGT A;  4EAT A;  4E7K A;  2E1O A;  4XK4 A;  3WTU C;  2I5U A;  4PSX A;  2CV2 A;  3VDX A;  2ACJ A;  2DK8 A;  1G3Y A;  4A5M A;  2XC7 A;  3CUO A;  5DEQ A;  3P7N A;  2ZXI A;  4BY1 J;  4AU7 A;  4V2F A;  4XLH A;  4I76 A;  3E5X A;  1WPK A;  4WF2 A;  5LHG A;  2EJR A;  3ZQL A;  4I02 A;  1QVT A;  2D5V A;  1RC9 A;  2GXG A;  4XKC A;  3I56 I;  1SAN A;  4CSW A;  3H9J A;  3GLX A;  4EVI A;  2XGD A;  4TV7 A;  4DNC A;  1ZRF A;  2HTJ A;  1YIJ I;  1V55 H;  3GXO A;  2LNB A;  3K4N A;  3J7Z I;  3A01 B;  3CD6 I;  1K83 J;  3RJP A;  4CIC A;  3DWL E;  1NG7 A;  1R49 A;  2KJC A;  2R7X A;  4C30 A;  1KYZ A;  4U88 A;  1YJN I;  3WTV C;  2G7H A;  2R0Q C;  1LB2 A;  1FY7 A;  5L3D A;  5DCF A;  1T95 A;  2GBY A;  5LRR A;  1F43 A;  1FNN A;  4HST A;  2F2E A;  4M3G A;  4IHV A;  1ZGJ A;  3EPZ A;  4L9T A;  1QU3 A;  5L3B A;  5E8I A;  2EZI A;  4CZC A;  3I5U A;  5FRO A;  2FSW A;  4KIG A;  3OYE A;  1BJA A;  1KGS A;  4HPQ A;  3KZY A;  4UVA A;  1KZH A;  3GTG J;  3GFM A;  2UWM A;  2M0M A;  3E5Q A;  1FBS A;  4A3J J;  5EG0 A;  1QA6 A;  3WOD F;  2JPB A;  3H9Q A;  4UUV A;  2OCC H;  3E97 A;  2XAS A;  3LFU A;  2P6T A;  2V1X A;  2O8K A;  2P0W A;  3LSH A;  2VIX A;  1RKW A;  1X3Z B;  3DU6 A;  1QQI A;  1DPR A;  1ZRD A;  5D6F A;  1DPU A;  4MEX F;  3OSG A;  4IOA F;  1R5I D;  3BP8 A;  3H3U A;  3F0C A;  3SEZ A;  4BQQ A;  5BNG A;  1Y1W J;  2VUM J;  2K3P A;  2VBX A;  4XLE A;  1ZEL A;  4YFN F;  4NHJ A;  1XGO A;  1IDZ A;  3Q5F A;  3MKZ A;  1S7A A;  5IP7 J;  5D5U B;  5C44 J;  2QZ8 A;  4MNU A;  3LSR A;  3RPU D;  2UZK A;  3FKJ A;  1TNT A;  2JA5 J;  2OJE D;  5E3L A;  2M9H A;  3CP2 A;  2B63 J;  2FD5 A;  1FYK A;  5L3F A;  1QVU A;  2CQK A;  5LFA A;  4A93 J;  4D5F A;  1K78 A;  4A3F J;  2R5Z A;  1ETK A;  5DD8 A;  3U1D A;  2OA4 A;  1G59 A;  4IHX A;  1DU0 A;  1VND A;  1IRF A;  3ZXS A;  3OS1 A;  2VBW A;  3CJQ B;  1EF4 A;  5FLM J;  3S14 J;  1T38 A;  2VQC A;  2LF8 A;  3SJM A;  4XL9 A;  2CU7 A;  3P5J A;  1GLN A;  1HSJ A;  2X1E A;  2YX7 A;  4IQ4 A;  1QHG A;  4RM3 A;  1NK3 P;  1DP3 A;  2DW4 A;  3EYI A;  4L9N A;  2L3D A;  1I1G A;  4JOM A;  2E19 A;  3IUO A;  4G94 A;  4WK8 F;  3BTL A;  3CMY A;  4FQG A;  4BL0 B;  4E7L A;  1J59 A;  1FPQ A;  4PDK A;  3PQK A;  1JKO C;  1K79 A;  1FYL A;  4KIB A;  3K70 C;  3WTX C;  2HNH A;  3LA3 A;  4ZJZ A;  4IQJ A;  1VQN I;  1MDM B;  4A2U A;  4IZZ A;  4D1Q A;  1YO5 C;  2FX0 A;  1V54 H;  3EUA A;  5E18 F;  5BMZ A;  3OY9 A;  1IC8 A;  4UB8 C;  2L9N A;  1W7P B;  2R5Z B;  3GTL J;  3DLL F;  4OAY A;  5F1R A;  5LEK A;  2Z33 A;  3BR2 A;  1U9O A;  2STW A;  2DMT A;  3ZMT A;  2CWE A;  2PX9 A;  3F3X A;  3EYY A;  1RUN A;  4WCG A;  3KP3 A;  3CJR B;  4E70 A;  4IHS A;  3WG9 A;  4GGG A;  2QEX I;  4EJV A;  4Z6Y A;  4AIK A;  3HC7 A;  2MH9 A;  1IO2 A;  1G3W A;  3BTJ A;  4HV5 A;  4BNC A;  3H3Z A;  2A6E F;  3R0A A;  3OYB A;  2R5Y A;  2HZD A;  1VQ8 I;  1FBQ A;  2COM A;  3DEU A;  5K5R A;  1QZY A;  3H5N A;  2HI3 A;  4D7M A;  2ZXW H;  4YG2 F;  1IXC A;  4OIQ F;  2KFD A;  2MYS A;  4ABZ A;  4EEF G;  1TL8 A;  3LA2 A;  2NVX J;  2BHY A;  3NEU A;  5B3S H;  2LY1 A;  2L01 A;  5IYD J;  1WRJ A;  4HYE A;  1I39 A;  2W24 A;  2UV1 A;  5HLI A;  2Z99 A;  3EUH C;  3DPU A;  1TQP A;  2DA1 A;  2XVC A;  4JP0 A;  2R7S A;  3RCO A;  4A3M J;  2W85 A;  2EV6 A;  1BL0 A;  2IGK A;  5BPI A;  1H9T A;  3F8M A;  2DI3 A;  3GFL A;  3CCU I;  1O3S A;  1XX5 A;  1HF0 A;  2E7W A;  1OCZ H;  3ZMD A;  1J75 A;  2QLZ A;  1X58 A;  1NH3 A;  4LG3 A;  3HM5 A;  3REO A;  3RZO J;  2CS3 A;  1WQ2 A;  2M34 A;  4KIF A;  2ICW G;  4BQN A;  1R6R A;  4BEH A;  1Z67 A;  2PJR A;  1BI2 A;  1G4D A;  1GUU A;  2Q0O A;  4UVC A;  1ZQ3 P;  1XMA A;  2D1H A;  3KPH A;  3L2Q A;  1JT0 A;  1TWA J;  1ENH A;  4Q48 A;  1ZRC A;  5E3N A;  2ZJ2 A;  4IVN A;  3GZ5 A;  3S17 J;  4G7Z F;  4HAM A;  5FJ8 J;  2M8G X;  2BHZ A;  4G7O F;  3H9G A;  3M1C A;  3KLN A;  2QGU A;  3GWZ A;  3RYR A;  2JRT A;  3FXM A;  3PJR A;  1JXS A;  1LJ9 A;  1XMK A;  3HJE A;  1D8J A;  2OTJ I;  1BW6 A;  1HST A;  1I50 J;  1ZLJ A;  2R4G A;  2IS2 A;  1MMA A;  2IS1 A;  3ABT A;  2R3S A;  3BLY A;  2E2I J;  4XOP A;  2DJI A;  1W4M A;  1WH5 A;  2BOL A;  1ZR4 A;  4YIF A;  5EEG A;  2YX4 A;  2ME0 A;  1FWZ A;  2FA5 A;  4BEH B;  3LSI A;  2DOD A;  3R0J A;  2MFZ A;  5GPA A;  1VQ4 I;  1O7L A;  1LFP A;  1RET A;  1FTZ A;  1SFE A;  2NOJ B;  3VEP A;  3CME I;  2QSH X;  1B9M A;  2XDV A;  2AO9 A;  3IP4 B;  1YIO A;  3PSF A;  2O61 A;  3FIS A;  2JA7 J;  3PNV A;  2W82 A;  5CVI A;  2H09 A;  1IAW A;  2HS5 A;  6PAX A;  1FSE A;  3F72 A;  3B6C A;  1W36 C;  3GUD A;  3WGH A;  3G2B A;  1OCT C;  4V19 K;  3BR1 A;  1T33 A;  1HC8 A;  1NK2 P;  4XN3 A;  2JT1 A;  1WJ5 A;  1PP7 U;  2K7L A;  2M8E A;  4F91 B;  5K1Y A;  1IXS B;  2LTP A;  1JUP A;  2CYY A;  2EBI A;  3E5U A;  1CF7 B;  1LNW A;  2ADU A;  3MN2 A;  3TW6 A;  3IRQ A;  2FUG 2;  3OYK A;  2A69 F;  3ZMU A;  4IHW A;  4BHB A;  1MMG A;  1NHA A;  3OYC A;  2TRT A;  3OR2 C;  1JT6 A;  4I09 A;  2RAE A;  3PUB A;  2CFX A;  4R1H A;  1UAA A;  5DV5 A;  2ZSI B;  1REP C;  2DAO A;  2DA5 A;  4M6Y A;  2L9R A;  1V5G A;  2FBI A;  4AM3 A;  3QYE A;  2PMZ A;  4RAY A;  1EA3 A;  3G1L A;  3QU6 A;  4CA0 A;  2V6E A;  4WXH A;  5DM7 F;  3K69 A;  1GV2 A;  5D5X B;  3GYH X;  4A0Y A;  4A3K J;  4LIU A;  4ZTJ A;  2CQX A;  1YHQ I;  3HUG A;  3R61 A;  2XPV A;  4XON A;  4BH9 A;  3ECO A;  1IDY A;  3GO5 A;  3GVA A;  3MKL A;  4HZF A;  3O3K A;  1MBH A;  3TOA A;  1IN7 A;  3AG3 H;  3RKQ A;  1A5J A;  1TZL A;  2KZV A;  4ZYD A;  1QZZ A;  5LGT A;  1WSU A;  4CCM A;  4HDV A;  3LSK A;  4X1E A;  3K4J A;  2OZU A;  1YW9 A;  2KPM A;  1ETO A;  2X4H A;  3B73 A;  4JK1 X;  2M4G A;  3S3O A;  3MZY A;  4A3I J;  5C4X J;  4M3B A;  3W2W A;  2UXX A;  4LJZ F;  1UCR A;  3BPX A;  1X1B A;  1GXP A;  3ERE D;  1T6S A;  4BHC A;  4G7H F;  4B4C A;  3CUQ A;  4R79 A;  2OAZ A;  2EIK H;  2ZBK A;  2JA6 J;  1Z91 A;  3EQL F;  3HRS A;  2DA3 A;  5M5X J;  3ZN1 A;  4DBQ A;  5HOO A;  5FGM A;  4BDZ A;  1W0T A;  1QO0 D;  4RLQ A;  2DPU A;  3HUG B;  3WGG A;  4HEA 2;  4UUS A;  3FK6 A;  1MBJ A;  3R6S A;  1QHH D;  4KIT B;  2QUF A;  2OUM A;  1FOX A;  4QLC U;  2X85 A;  3NWS A;  3K10 A;  4KYW A;  5IPA A;  4HX4 A;  1WJF A;  2KLO A;  4NC7 A;  4L9V A;  3V8K A;  2STT A;  1MMS A;  2OQG A;  1K6O A;  3U21 A;  2IPQ X;  1VQO I;  4Q47 A;  5F0F A;  2P7V B;  1UG2 A;  2V6C A;  2FML A;  2TCT A;  3HSF A;  3OYI A;  5HLH A;  2ELK A;  1WJE A;  2XUB A;  2AXT C;  3KP4 A;  3QU3 A;  2HOE A;  1B72 B;  3S1Q J;  1HDD C;  1Z7U A;  2GZW A;  3I55 I;  3S93 A;  3JRI A;  3CUQ B;  4Y7N J;  4XID A;  3SZP A;  2DCE A;  4MIM A;  5FKN A;  4I0B A;  1EH8 A;  4NDL A;  4YFX F;  3I64 A;  1W5S A;  1YG2 A;  1OCO H;  5E79 C;  3I58 A;  2BVM A;  4XKV A;  1X3W B;  4FE4 A;  2A5W A;  4PJM A;  3FX3 A;  3WE3 A;  1AU7 A;  4IO9 F;  5J4V A;  4E7J A;  2BXZ A;  3H5R A;  3KEQ A;  4QWQ A;  5IT3 A;  5FRN A;  4BJ6 C;  1U6G A;  2LSO A;  3BZC A;  3M9A A;  2F5F A;  3V7C A;  1P7J A;  1ZAR A;  2ETH A;  2PI0 A;  3PO3 J;  3GF2 A;  2LDU A;  1A04 A;  3C7J A;  1YJW I;  1BW5 A;  4RGR A;  3ISP A;  2VPR A;  4KA4 A;  2NRA C;  1OJL A;  3L09 A;  3FBI B;  2EK5 A;  2NNY A;  3JAM Z;  3PNY A;  3AG4 H;  3COA C;  1I6X A;  1JI8 A;  2DOE A;  3D1N I;  2OC6 A;  3NRV A;  3FM3 A;  4ZYE A;  2FBH A;  4B47 A;  2JN6 A;  2R7O A;  2ZME A;  3B6A A;  2FMY A;  3DLA A;  1Y0N A;  5FFX A;  5H20 A;  5J1R A;  1OR7 C;  3OYD A;  1TC3 C;  2Z2S B;  2EFO A;  2EWN A;  1IJW C;  3M1E A;  3A03 A;  3S3N A;  1T0F A;  2M1B A;  2DOF A;  3I59 A;  3N97 A;  2PJP A;  1MMD A;  2VQH A;  2VQG A;  1JUM A;  2DA4 A;  4Y15 A;  1T56 A;  1WJB A;  4M3F A;  2HFH A;  3Q0V A;  3TO7 A;  1KYW A;  1UST A;  4PJJ A;  2LKP A;  2HQR A;  5KNL A;  5DDG A;  3GTO J;  3SXY A;  1PDN C;  3K0L A;  2E60 A;  4D0P A;  2GM4 A;  2JVG A;  1X1P A;  2X6W A;  4ENK A;  3K2Z A;  2GQQ A;  1WGX A;  3MQ0 A;  2CGP A;  1S8N A;  3DBH B;  2O9L A;  1TQM A;  3WHB A;  2XPU A;  2Y0S N;  1MJ9 A;  1FMW A;  3BG3 A;  1WKM A;  4AWX B;  4ZDL A;  2D2W A;  1HXD A;  2LK2 A;  2CSO A;  1SAU A;  3CDH A;  3LWF A;  4IX7 A;  4OMY A;  3ZQG A;  2ZFU A;  3ZQH A;  1RPW A;  1YIT I;  5LHH A;  1PUE E;  5E8G A;  2Z5U A;  4BAC A;  2JA2 A;  2EZH A;  2RDP A;  5L3G A;  2Q2E A;  4UB6 C;  4BYY A;  2YSR A;  3OYJ A;  5FKK A;  2DYS H;  2E1M C;  2R7D A;  5F0C A;  4F3Q A;  1MKM A;  4AYB N;  1VZ0 A;  5EJC A;  3I4M J;  2G9W A;  3FXR A;  3AKZ A;  3L9F A;  1LDD A;  5E17 F;  3A2K A;  1ON1 A;  3BG7 A;  3EET A;  1B8I A;  2WWY A;  2E71 A;  3LSP A;  2OCE A;  5J3L A;  2LRD A;  2WV1 A;  4A69 C;  4HLY A;  1W5C C;  2AQE A;  4NQW A;  3MKW B;  2PQ8 A;  3C2B A;  4KT6 A;  4Y4R A;  4RB3 C;  1XMX A;  2VAS A;  3HOS A;  2X0L A;  3BJA A;  4HQE A;  2CG4 A;  3J81 K;  5KHD A;  1J2X A;  3E7L A;  3QOP A;  2G0E A;  3SZT A;  3I0T A;  1QPM A;  2IGN A;  5HDG A;  1I6H J;  4ENM A;  5LD2 C;  1SFU A;  3WGI A;  4LFU A;  1WFX A;  2JTV A;  2HQ5 A;  4BS9 A;  1X2M A;  5FKO A;  1D3Y A;  1BIB A;  2RKH A;  3CCM I;  1P2F A;  2LH9 A;  1YJ9 I;  3HOW J;  2VBY A;  3HBL A;  1AKH A;  1EH6 A;  1Z3Y A;  2DJN A;  4MQ9 F;  3WE2 A;  2AQF A;  4N4N B;  2BBY A;  3LL7 A;  1Q1H A;  2VJJ A;  4E4H A;  1YS6 A;  1ZK8 A;  1YS7 A;  3GTQ J;  1RNL A;  3DEE A;  1HDP A;  4Y17 A;  2PLY A;  4B09 A;  4CYC A;  1XG1 A;  3S1R J;  1VI0 A;  4XM3 A;  2ISZ A;  3QOE A;  3WTZ A;  1BC8 C;  3FXL A;  2K5C A;  1VQP I;  4NQW B;  1VQK I;  2IA1 A;  3HPG A;  9ANT A;  5TRD A;  2CUE A;  4CHU A;  4HX8 A;  2HPM A;  3DTK A;  4LG0 B;  3H5A A;  3NWT A;  4WXC A;  2PMH A;  2CW7 A;  3A4C A;  2RGV A;  1ZTR A;  4PFP A;  2DQL A;  1WJA A;  3IHU A;  2DPD A;  1XCB A;  3HEF A;  5JHU A;  1HKQ A;  5CKT A;  1U5T A;  3K4B A;  5JLW A;  3L1P A;  4GYG A;  3E6C C;  4Z2Y A;  1N25 A;  1X3U A;  2YU9 J;  2NVQ J;  2NVU B;  1EJ9 A;  3S8P A;  5CVV A;  3BZ6 A;  4PJL A;  2LMD A;  1ZGA A;  3JTG A;  3PFI A;  3BCA A;  1O4X A;  2HEO A;  2ISY A;  3H1C A;  2QVO A;  3BZK A;  5FB2 A;  5D8K B;  5E3O A;  1G3S A;  2O0Y A;  1V4R A;  2KT0 A;  1PJR A;  2VXZ A;  3HKZ A;  1MSE C;  2EFW A;  1I1S A;  2A3S A;  1R7J A;  2RV8 A;  3C2H A;  1ZKG A;  2JUG A;  2R7U A;  3W6K B;  1SFK A;  4K2E A;  3LFK A;  2O03 A;  5JI6 A;  2EIN H;  3WU2 C;  3TW7 A;  3G71 I;  3O6B B;  3LQQ A;  2HR3 A;  1HW2 A;  3EDP A;  5AIP A;  2PBI A;  1V3F A;  2R7F A;  3AL0 B;  2HKX A;  2L2O A;  3TP3 A;  1X19 A;  5CVR A;  1MJB A;  2IRF G;  4ZYG A;  3M8J A;  4EQQ A;  3HRM A;  2CUF A;  1U5T B;  1LKX A;  2V79 A;  5LRS A;  3SZG A;  1SFX A;  3D5S C;  3PNT A;  2H1L A;  4DBR A;  3K4K A;  4ZYA A;  5LLQ A;  3QP5 A;  4E7Z A;  4M71 A;  2W1O A;  3OR1 C;  4YIR X;  3OYN A;  1FSH A;  3FXQ A;  5CQG A;  4FHT A;  1YE9 A;  2EB7 A;  4CO8 A;  1RZ4 A;  2E36 A;  1HKS A;  2L7Z A;  3A0B C;  2LYC A;  2ZC2 A;  2ZJQ F;  1F1Z A;  2WV0 A;  1Z6R A;  3ZCO A;  2OF7 A;  4IHT A;  1MNE A;  1QNT A;  5JLX A;  1PP8 F;  1K7A A;  1BI1 A;  1IV6 A;  3T1B A;  2JRM A;  2R7T A;  1ZG3 A;  2X48 A;  1YFH A;  2DDB A;  3EUK L;  3BC8 A;  4UXN A;  5ERI A;  4N4O B;  4FCY A;  4L0Z B;  1Z3X A;  2E34 A;  2A05 A;  2EQR A;  1BN5 A;  1LDK B;  4ENN A;  3L7W A;  5GAH J;  1JGS A;  5JVT A;  2V1U A;  4MFE A;  4PJN A;  4IL6 C;  2CQ7 A;  2D45 A;  2JUC A;  2DXI A;  5JVG F;  1L3L A;  4II2 A;  2Y0S A;  1JKQ C;  3S1N J;  2MW8 A;  2ELH A;  3IRR A;  4LK0 F;  2L0K A;  4F92 B;  5ICC A;  4L9J A;  2O8X A;  3CO6 C;  4EGZ A;  2CMP A;  2QQA A;  5EG0 B;  4DGW B;  2FOK A;  2K85 A;  2JK3 A;  2EV5 A;  5CPR B;  3CMA I;  1XD7 A;  4Y3O A;  3ZQC A;  1D0Y A;  1T98 A;  3FXU A;  2DN0 A;  4PGH A;  2WC2 A;  4DYR A;  4FAS D;  1Z1D A;  1ONV A;  5EYR A;  2CH0 A;  1V5F A;  1X4O A;  1U8R A;  2NYX A;  2HZT A;  2PEX A;  2KRH A;  1VQ5 I;  3W2V A;  3LSM A;  2K9L A;  2L9S A;  5EF6 A;  4YEL A;  2HPI A;  4RLF A;  1X4P A;  1R4M B;  1ORK A;  2FQ4 A;  2LC2 A;  2LKX A;  3RQ4 A;  2R93 J;  1MJA A;  2A07 F;  3K1M A;  4RAG A;  5ICE A;  1H9G A;  4OIN F;  3TMO A;  2KRF A;  2VLA A;  3W6J B;  3JRD A;  1J0R A;  1FBU A;  1XDS A;  2B0L A;  2HWV A;  1XTA A;  2MC4 A;  3ZQI A;  1K78 B;  3CDL A;  4LD5 A;  1H0M A;  3K4M A;  4P9F A;  1BIA A;  3CJT B;  2UXN A;  5EZG A;  2FJ1 A;  2V4J C;  3LST A;  1BOA A;  2CV1 A;  4EJW A;  4DOZ A;  1O3T A;  1AA7 A;  1IUF A;  3CP8 A;  3BWG A;  2ZJP F;  4ANJ A;  3M4O J;  2VOD A;  2IBD A;  3V42 A;  2IS6 A;  2ZB9 A;  3GTM J;  3CC2 I;  2XSJ C;  2BV6 A;  4BE2 A;  1TT0 A;  1ZN2 A;  3J80 K;  3PSI A;  2YR2 A;  4ZC3 A;  2X6X A;  2A6H F;  1LFU P;  3HRT A;  5FO5 A;  1UHW A;  5FLX Z;  1B1B A;  2Z9O A;  2QKM B;  1W5T A;  5K7H A;  2XB0 X;  5B66 C;  5LBQ A;  3BG9 A;  2L7M P;  1FP2 A;  1JHH A;  1RIO H;  2JSC A;  1P4A A;  1MNM C;  2JPC A;  3VPR A;  5HNF A;  1YQA A;  5HDK A;  4V2G A;  4OOI A;  1A6Q A;  1HW1 A;  3ZMV A;  2VE8 A;  3G73 A;  5LHI A;  4XRF A;  3MKY B;  2Y69 H;  1MBG A;  1S7E A;  1YOV B;  5DD4 A;  3OSF A;  5TIS C;  1POG A;  5J47 A;  1WH7 A;  1QPI A;  4UUT A;  3PL8 A;  2WB1 N;  4XLF A;  3TQN A;  2XV4 S;  2VC0 A;  1R71 A;  4OIO F;  1UHS A;  1Z77 A;  2VON A;  1MH4 A;  1YLF A;  1HBX G;  2EH3 A;  3ZQ7 A;  2VJ5 A;  2VN2 A;  1U0J A;  5F08 A;  1UB9 A;  2R5Y B;  1LPQ A;  4RGS A;  2HOS A;  4N9H A;  4RGU A;  2FRH A;  2P8T A;  2MBF A;  4DZP A;  3FBN B;  3HPH A;  2XAH A;  3L00 A;  2KKO A;  1E2X A;  4CYD A;  5LGN A;  1XPX A;  4RBO A;  2OD5 A;  3OOP A;  1RES A;  1ZGW A;  2LBF A;  3F8C A;  3DPT A;  3FDY A;  2MLK A;  4J01 A;  5GAD J;  3GW2 A;  3H0G J;  1DU6 A;  2WAE A;  4AVP A;  4PFO A;  3D5R C;  1IRG A;  1D5V A;  4UV8 A;  2W00 A;  2H6B A;  2O3F A;  2Y30 A;  3Q9V A;  5IT9 K;  1S29 A;  4ZYH A;  2KQR A;  5HS7 A;  2QSG X;  1R1V A;  4U0V A;  2F4I A;  2KMU A;  3IH3 A;  4G6D A;  4RB1 A;  1PUF A;  1FJL A;  1R58 A;  3TO9 A;  2HKO A;  4XRM A;  3SHF A;  1XSD A;  2PJR B;  4OIR F;  1IV8 A;  2DMQ A;  4EM0 B;  4FX4 A;  1K61 A;  4IJA A;  3RTR A;  3SFI A;  2A6T A;  1TLH B;  2XGX A;  3F6O A;  2LF7 A;  2Y48 A;  2OV7 A;  4CCN A;  2L54 A;  2R92 J;  3FZV A;  2I8D A;  2W84 A;  1W36 D;  4XNF A;  1MMN A;  4DYQ A;  5LEJ A;  4EMS A;  4CDG A;  2LBF B;  1K6Y A;  3ZOB A;  3PO2 J;  3VOE A;  2H27 A;  1W0U A;  3RPQ A;  4KIC A;  3F21 A;  4IRG A;  2V7F A;  2K4B A;  1XGN A;  4Q5S F;  4RDU A;  4BDY A;  3E3V A;  4EGY A;  5TJJ A;  4IPA A;  4HLX A;  4XKB A;  4PJ0 C;  4EJU A;  3HOY J;  3BQY A;  3IWF A;  2NOG A;  1RI7 A;  2XB5 A;  2LLK A;  4HRI A;  2IA2 A;  1SMT A;  4BU2 A;  1PUF B;  3JRG A;  4YII A;  4ZZD A;  2L02 A;  4M3D A;  1SFO J;  3KEY A;  1F5T A;  3LSJ A;  1H89 C;  2WAD A;  2R7R A;  3OYH A;  3G3Z A;  1APL C;  3KIO A;  3S2D J;  2AHQ A;  3G1O A;  5L3C A;  2KIM A;  4HNV A;  1LEA A;  4UV9 A;  1F4K A;  3SDB A;  5GP9 A;  3QYF A;  2HDW A;  1Z05 A;  2DQR A;  2BY3 A;  1VQM I;  3ZPL A;  3IAM 2;  2MSY A;  2DT7 B;  3NAU A;  1JTX A;  4XKW A;  1Z7L A;  2WY7 Q;  4A5N A;  4BJT A;  5JHF A;  2M30 A;  4KIS A;  4H4K C;  3TP0 A;  5A2Q K;  1MBF A;  3CCV I;  4L18 B;  2VC1 A;  4XMY A;  2A61 A;  2TDX A;  5D6E A;  3M8F A;  2HVQ A;  3ZRG A;  5EEA A;  1KU3 A;  5DM6 F;  2HYJ A;  1Z6T A;  3N05 A;  1P9Q C;  2LVS A;  5DUK A;  1YRN B;  3TO6 A;  1J5Y A;  2F4O B;  2VOP A;  3ABK H;  3IC7 A;  3E6M A;  4NC8 A;  3GZ6 A;  1K4S A;  1ITY A;  4MFD A;  2K86 A;  3BRO A;  2PMU A;  1T08 B;  1TW3 A;  3K7A J;  4GYI A;  2M3A A;  3ASN H;  2NS7 A;  5CLS A;  2OBP A;  1PVE A;  3KLO A;  2IXS A;  3IH4 A;  2WY8 Q;  1JJ6 C;  1VQ9 I;  3HDD A;  2P5K A;  4YEJ A;  5KAI C;  1Y56 A;  1P6R A;  2QQ9 A;  4WX9 A;  2XAG A;  4U0Y A;  1S5L C;  4LB5 A;  4Y13 A;  1GT0 C;  4QIW N;  5CYV A;  1KON A;  3GME A;  5GPC A;  4HDU A;  2Z16 A;  3FM5 A;  4A0X A;  3JRA A;  1K4T A;  1SVO A;  4P9U A;  3N4M A;  4BKX A;  4S05 A;  2L4A A;  1RRJ A;  4A6E A;  1H8A C;  2XHK A;  2M45 A;  1L0O C;  1KU2 A;  1FMV A;  4A12 A;  2DFH A;  2EIM H;  3C3W A;  1Q1V A;  1XGM A;  2IT0 A;  3CES A;  3VSL A;  5GTH C;  4Y33 A;  1FOK A;  4W1U A;  5DS9 A;  5EGO A;  2M4K A;  1UEL B;  1B59 A;  4MLO A;  4BHP A;  3FXO A;  1JGG A;  4ESJ A;  3DBR B;  4U7B A;  3CCE I;  4HOB A;  3DEW A;  1VFC A;  4ESF A;  1R36 A;  1TWF J;  5C3E J;  3AFH A;  1LE8 A;  2WB1 A;  2CJJ A;  2H8W A;  2ZXH A;  3BOQ A;  4G6Q A;  4KN7 X;  3O2P E;  1P92 A;  5DTD A;  5GTI C;  1KQ9 A;  5IP9 J;  3KEO A;  2IP2 A;  3DTE A;  2OZ6 A;  2OTL I;  4MHG A;  4UUS B;  2ZJR F;  3IKV A;  1WJC A;  2VKD A;  3PFY A;  4G9Y A;  4F7Z A;  2BY1 A;  2EFQ A;  1JKR C;  3NQO A;  1P4W A;  5CQE A;  2PG4 A;  4FTH A;  4KDP A;  2FXA A;  5F27 A;  1SAX A;  5EGO B;  4EJT A;  2QEN A;  3C2G A;  3K4L A;  3G6E I;  4IHY A;  1QZE A;  3U2R A;  2R7Z J;  4ASN A;  1GVD A;  4XSZ F;  3OYL A;  5F64 A;  4Q4Z F;  2ECB A;  3ZMZ A;  3ZGK A;  4X6A J;  2KDO A;  4P5O A;  2DOA A;  2QQB A;  1AOY A;  2XSD C;  3JW4 A;  3BCB A;  2VT3 A;  2H6C A;  2LR8 A;  1IXR C;  2BW3 A;  5FD6 A;  1FTT A;  4L5I A;  1Z0X A;  2IAI A;  4AVZ A;  3BR5 A;  2DFE A;  1WWX A;  1TP4 A;  2RRE A;  1FYM A;  4OIP F;  3E1S A;  2VJI A;  3TGN A;  1U9N A;  3EUH A;  4B8X A;  3KET A;  1USS A;  3MEX A;  3VOD A;  4F55 A;  4IF4 A;  3KYD B;  2E5Z A;  1PYV A;  1I5Z A;  4NB5 A;  4RAZ A;  2LFB A;  4XQF A;  1IF1 A;  4I99 C;  4CCJ A;  2HDD A;  4LLN A;  1YW8 A;  2VQL A;  4R8H A;  3BDD A;  3M7G A;  3LNQ A;  3TOB A;  1XSX A;  1RR8 C;  4M9X A;  3CCJ I;  2K9S A;  1YI2 I;  2IGM A;  4L5J A;  3LAJ A;  3GCM A;  2HOA A;  2ZNZ A;  2XF7 A;  3DKX A;  3ROU A;  3V8J A;  1OQY A;  3RKY A;  1AWC A;  2XAU A;  4UY8 I;  2XAF A;  3K9T A;  4O6J A;  5HVQ C;  2BW3 B;  2W57 A;  3I3L A;  4BXU A;  2ZXJ A;  2I10 A;  3MWM A;  2PN6 A;  3M07 A;  1J7K A;  2XAJ A;  4JQF A;  4CCK A;  3IH2 A;  4O5V A;  1OCR H;  1KQ0 A;  3F6V A;  4JX4 A;  2DTZ A;  4QPQ A;  2R7W A;  3WTS C;  3FIW A;  2ZME B;  3SYT A;  1SMY F;  2GA2 A;  3QPL A;  2VT2 A;  2KJB A;  4FE7 A;  3A02 A;  2NVY J;  3DTI A;  1QRY A;  3MZ8 A;  2BEO A;  1Z21 A;  2GOX B;  4B44 A;  3VSK A;  2XGE A;  3HSE A;  4RAF A;  5HS9 A;  4LIV A;  4CH7 A;  3PIP F;  5CJ9 A;  3DXJ F;  2XPW A;  3I59 B;  5J1U A;  2FQ3 A;  1G6N A;  3RDI A;  4S04 A;  3KZI C;  1X1A A;  4I98 B;  4GXO A;  5D5V B;  4A3G J;  3K2A A;  1D8K A;  1B4A A;  1IG7 A;  2H8R A;  4XOT A;  4BUP A;  2HQN A;  2F4M B;  1HKT A;  4JX6 A;  2LG4 A;  3CCL I;  4KMU X;  4W97 A;  2XRN A;  3I4N J;  3V4G A;  2DMU A;  4GRI A;  3IV5 A;  4KN4 X;  4I6Z A;  1FLI A;  5ICG A;  4N0B A;  2FBK A;  2DMP A;  2X6Y A;  1GDT A;  2NVT J;  1IZ1 A;  1OYW A;  4BE0 A;  3KX2 A;  5HOD A;  3HIF A;  1STZ A;  2K4J A;  1CGP A;  2CV0 A;  3BG6 A;  2EZL A;  5M3M J;  2F5C A;  4MGR A;  3GBG A;  1ETV A;  1I27 A;  2B7E A;  4HW0 A;  3OL3 A;  4ITV A;  2K27 A;  3ZMS A;  2XGC A;  1XGS A;  3FF5 A;  3KZZ A;  3GX4 X;  2Q2E B;  1MD0 A;  2YU3 A;  1N77 A;  4DW6 A;  3T0Y A;  3D5L A;  3D0S A;  1R5G A;  2WTE A;  3VYS B;  2F5D A;  1Y6I A;  3BJO A;  2HVR A;  4G6T B;  2NNN A;  5FLV A;  1BI0 A;  1ZR2 A;  1ZG1 A;  1Y8R B;  1DP7 P;  2CUJ A;  3Q0U A;  2H94 A;  4BY7 J;  1FZP B;  3TED A;  1VTN C;  2M87 A;  3E0J B;  2XRL A;  4LOC A;  4E7S A;  3ESW B;  2OQR A;  1B8I B;  5BS6 A;  2R7V A;  1B6A A;  2KIQ A;  2NS8 A;  2KL4 A;  3IWZ A;  3ZN0 A;  1OCP A;  3IKT A;  5KVR A;  5EDN A;  4O3M A;  1A31 A;  1SD7 A;  3LAP A;  4D5C A;  2P7C B;  2E2J J;  3HRU A;  1MH3 A;  1WHU A;  2FOW A;  4G12 A;  5HLG A;  2IS4 A;  3FMR A;  3S32 A;  2X1C A;  3CO7 C;  1ACI A;  2LY2 A;  3BQZ A;  4PK4 A;  2E35 A;  1NTC A;  2P81 A;  2K9N A;  1XN7 A;  1SC7 A;  2VKE A;  2DBB A;  4MEY F;  2W7N A;  1E0E A;  4CUG A;  2LY9 A;  1D1A A;  2MA3 A;  2XKO A;  4I2O A;  4ENJ A;  1YW7 A;  1FC3 A;  5H6Q A;  3ZP5 A;  2CFO A;  1WZ2 A;  2XIG A;  4A3L J;  1I3Q J;  3IAS 2;  3JRF A;  2EA2 A;  1U78 A;  2Q1Z B;  3W3C A;  2EFP A;  3BTC A;  2QBY A;  2E5N A;  1AKH B;  1VQL I;  3H0D A;  5AIQ A;  3A01 A;  1LDJ A;  3P9I A;  4UHT A;  2BE5 F;  3MZH A;  3H3V K;  4MTD A;  3MAJ A;  2B9S A;  2HTS A;  4CYC B;  3UKG A;  1LUJ B;  3VFZ A;  5H2F C;  3DU5 A;  1ETY A;  2AXL A;  2ZSH B;  2J5O A;  3GEZ A;  3JCU C;  1LVK A;  3F8N A;  3ZR8 X;  1F9N A;  2X6O A;  3WG7 H;  2Y31 A;  2GA1 A;  2HOT A;  3Q9S A;  1TWH J;  4FET A;  3HHG A;  5CVJ A;  1Y1V J;  1YX5 A;  3F8F A;  4RGX A;  1BOB A;  1KU7 A;  5H6R A;  3BT9 A;  1YRN A;  1HW5 A;  2CW0 F;  3CF2 A;  4OMZ A;  1TWC J;  1H88 C;  2DFF A;  1BR2 A;  2QBY B;  1SVM A;  4GFB A;  3CTA A;  3GTK J;  3GFJ A;  2FU4 A;  4KMF A;  3KP2 A;  1UHM A;  5M3F J;  5EZH A;  2WAQ N;  1A36 A;  2M5W A;  1X2N A;  2LKS A;  2CW8 A;  1ETX A;  2GOM A;  4MTE A;  2JWT A;  2DA7 A;  1XDU A;  5IYC J;  1ULY A;  4C2T A;  1ZG5 A;  2QA4 I;  1BJZ A;  5FFZ A;  4EM2 A;  3ONQ A;  3GFI A;  3CF5 F;  3PUF A;  5B5E C;  1E3O C;  4G8X A;  2Y2Z A;  3HOU J;  1P7I A;  3CCS I;  2ESH A;  2QWW A;  2HYG D; 
#chains in the Genus database with same CATH homology
 1J9I A;  4XBF A;  3BPV A;  2ZO4 A;  1FX7 A;  4KUM A;  3BJ6 A;  1ZH5 A;  4U0W A;  2E1N A;  3P9K A;  1KU9 A;  4M72 A;  1UFM A;  4P55 A;  2VE9 A;  1IUY A;  4M9Z A;  2QM3 A;  3RI4 A;  3DV8 A;  3V7S A;  2V9V A;  1MDM A;  2YPR A;  2IA0 A;  3CUQ C;  1OR7 A;  3T8T A;  2E7X A;  3LQR A;  3DQV C;  5J8F A;  4LLL A;  1W7P A;  3DKW A;  4ZH4 F;  2FNA A;  1SD4 A;  1T2K A;  3T8R A;  1IN4 A;  3C1D A;  4H0E A;  4YFK F;  4I0A A;  2NS0 A;  3TDU C;  1DUX C;  5DYM A;  1BC7 C;  3SFZ A;  3DF8 A;  4XLP F;  2RVC A;  1XSV A;  4LB6 B;  4M74 A;  4AIJ A;  3KFW X;  2MC3 A;  1RUO A;  2G7U A;  5J8C A;  5BQT A;  3J7A O;  3QPT A;  4XLN F;  3F23 A;  1DDN A;  4M6X A;  1ON2 A;  1BBY A;  2PFB A;  1O7F A;  1EV7 A;  1WI9 A;  1O3R A;  4IXA A;  2P5L C;  3JSP A;  1KA8 A;  3F22 A;  2F5E A;  3QRF F;  4HBL A;  1TTY A;  4FT8 A;  3K1P A;  3J81 Z;  4EJO A;  3I71 A;  1GHC A;  5E1X A;  3WTW C;  2FE3 A;  1XB4 A;  4LGW A;  4ETS A;  2DTR A;  5HDN A;  2P5V A;  4PGG A;  2NAZ A;  2RC4 A;  3VB2 A;  5KK1 A;  3JAM K;  2DK5 A;  1JE8 A;  1ZAO A;  2HYF A;  2V1D A;  1SD6 A;  4HF2 A;  4HV6 A;  2GXB A;  3B02 A;  1R00 A;  2GWR A;  5E20 A;  4KT5 C;  4CGZ A;  3C18 A;  3F8B A;  4HQM A;  3R60 A;  4EV0 A;  3QP6 A;  4RB0 A;  1OYY A;  1S6L A;  4ESB A;  2ZNY A;  3RIR A;  4I01 A;  5JR3 A;  2IW5 A;  4MQV A;  1SD5 A;  5ILV A;  5E1Z B;  3KCC A;  1IN5 A;  1CF7 A;  5D5W B;  2Y0M A;  5EEH A;  3ELK A;  1FP1 D;  3M8E A;  3QPH A;  4HA8 A;  1TW2 A;  1LEB A;  3I53 A;  5K5O A;  4CXF A;  4AD9 A;  4JBA A;  3T5X A;  1Z9C A;  2Y75 A;  4HF0 A;  3FWE A;  1KQ8 A;  3WU0 A;  3RKW A;  5K5Q A;  4WWC A;  4LLG F;  2BYV E;  3MCZ A;  2JZY A;  1O3Q A;  2AS5 F;  2KIU A;  1IW7 F;  4DQ2 A;  3DFG A;  1O57 A;  3P9C A;  2XAQ A;  5ILS A;  1ZYR F;  5ILU A;  2EFN A;  2P6S A;  4I7H A;  3WTT C;  3V8L A;  4UNO A;  1U2W A;  4BAY A;  2VOO A;  3QAH A;  1C0W A;  4U7D A;  4KNY A;  3WU1 B;  2ZKZ A;  4RB2 C;  2RNJ A;  1TQI A;  4FX0 A;  1XCV A;  2Z3Y A;  1S7O A;  3SQN A;  4PZJ A;  2MLG A;  3KE2 A;  2IVM A;  4GCV A;  4P96 A;  2DLL A;  2GIV A;  4IRI A;  3JTH A;  1U5T C;  5J6X A;  2QYO A;  3ABU A;  3IL2 A;  1S3J A;  4BQA A;  3R4K A;  2L4M A;  3I54 A;  3FMS A;  3RPU A;  2J5P A;  3HTS B;  4XSX F;  1ZHF A;  1ODD A;  2DFI A;  2ZFW A;  1FT9 A;  5DCM A;  1IN6 A;  2HGC A;  1QBJ A;  3J80 Z;  5ICF A;  1IN8 A;  3WTY C;  5BPD A;  5HS8 A;  1R1T A;  2RQP A;  3E6D A;  3I4P A;  5L3E A;  2P4W A;  4N9I A;  3DP7 A;  4A0Z A;  2IJL A;  5D4R A;  3TDZ C;  1ZLK A;  5FD5 A;  3L2C A;  2XKP A;  3AAF A;  4M73 A;  2VBZ A;  2GAU A;  1R23 A;  3BY6 A;  5DUI A;  2XRO A;  1W7P D;  3HYI A;  1OKR A;  5DCM B;  2FEZ A;  4PCQ A;  2ESN A;  2OU2 A;  1YTY A;  3U9G A;  5E1W A;  3KP6 A;  1LVA A;  2A5Y B;  5JFR A;  1TNS A;  3ECH A;  1Y0U A;  3KP7 A;  1TBX A;  2KIF A;  2D1V A;  3S2W A;  3DPL C;  3MFK A;  1ZRE A;  1G3T A;  3FMQ A;  3TKY A;  3E6B A;  4HX7 A;  1EH7 A;  4IRH A;  1OMI A;  1R22 A;  5IT9 Z;  4M9S A;  1OYI A;  4ZZL A;  1HQC A;  3CJN A;  3JSO A;  2O6G E;  1P4X A;  2DO7 A;  5AON A;  1OPC A;  2ZCW A;  2DT5 A;  5LGU A;  2FNP A;  3K1N A;  2MD5 A;  1B9N A;  3ML6 A;  1E17 A;  3H92 A;  3HOT A;  4L0Y B;  5D4S A;  1LQ1 A;  3V7R A;  1R5H A;  3RKX A;  4CZZ A;  5F6F A;  4LK1 F;  5D8L B;  4AIH A;  2HDC A;  1JHF A;  5CVU A;  3LA7 A;  3RYP A;  4A6D A;  5FLX K;  3HTU A;  4OU0 A;  2DU9 A;  1YYV A;  1BI3 A;  2K02 A;  1U3E M;  5ED4 A;  4KFC A;  2EV0 A;  4WXD A;  2FF4 A;  3HHH A;  1QGP A;  2CO5 A;  2W25 A;  5A2Q Z;  1R1U A;  3OV8 A;  4EM1 A;  4LG0 A;  3KP5 A;  1T39 A;  3HSR A;  1GXQ A;  4GO1 A;  2Q8K A;  1GVJ A;  4ON0 A;  1BM9 A;  4LMY A;  2MH2 A;  2RN7 A;  4UVB A;  2E1C A;  5BOX A;  4RS8 A;  3CLO A;  3FHZ A;  1MZB A;  3ULQ B;  2A68 F;  4HF1 A;  2C6Y A;  3PQJ A;  2EA4 A;  2BGC A;  1MGT A;  3WTU C;  2ACJ A;  2DK8 A;  1G3Y A;  4A5M A;  3CUO A;  5DEQ A;  3P7N A;  4WF2 A;  3E5X A;  5LHG A;  2EJR A;  4I02 A;  2GXG A;  3GLX A;  4EVI A;  4TV7 A;  4DNC A;  1ZRF A;  2HTJ A;  3GXO A;  2LNB A;  3RJP A;  4CIC A;  2KJC A;  1KYZ A;  4U88 A;  1LB2 A;  3WTV C;  2G7H A;  1FY7 A;  5L3D A;  5DCF A;  5LRR A;  1FNN A;  2F2E A;  1ZGJ A;  4L9T A;  5L3B A;  5E8I A;  3I5U A;  2FSW A;  4KIG A;  1BJA A;  1KGS A;  4UVA A;  3KZY A;  3GFM A;  2UWM A;  3E5Q A;  1FBS A;  3WOD F;  2JPB A;  4UUV A;  3E97 A;  2XAS A;  2P6T A;  2V1X A;  1QQI A;  1DPR A;  1ZRD A;  5D6F A;  1DPU A;  4MEX F;  3BP8 A;  3H3U A;  2VBX A;  4YFN F;  4NHJ A;  1XGO A;  3Q5F A;  1S7A A;  5D5U B;  2QZ8 A;  4MNU A;  2UZK A;  1TNT A;  1FYK A;  5L3F A;  2CQK A;  1K78 A;  5DD8 A;  3U1D A;  2OA4 A;  1IRF A;  2VBW A;  1T38 A;  2LF8 A;  1HSJ A;  2YX7 A;  2DW4 A;  3EYI A;  4L9N A;  2L3D A;  1I1G A;  4G94 A;  4WK8 F;  1J59 A;  1K79 A;  1FPQ A;  4PDK A;  3PQK A;  1FYL A;  4KIB A;  3WTX C;  3LA3 A;  1MDM B;  4A2U A;  1YO5 C;  5E18 F;  5BMZ A;  1W7P B;  5F1R A;  5LEK A;  2Z33 A;  2STW A;  3ZMT A;  2CWE A;  3F3X A;  3EYY A;  1RUN A;  4WCG A;  3KP3 A;  4E70 A;  4IHS A;  3WG9 A;  4GGG A;  4EJV A;  4AIK A;  2MH9 A;  1G3W A;  4HV5 A;  4BNC A;  3H3Z A;  2A6E F;  3R0A A;  1FBQ A;  2COM A;  3DEU A;  5K5R A;  1QZY A;  4YG2 F;  1IXC A;  4OIQ F;  3LA2 A;  3NEU A;  2L01 A;  1WRJ A;  4HYE A;  2W24 A;  5HLI A;  2Z99 A;  1TQP A;  2XVC A;  2W85 A;  2EV6 A;  5BPI A;  1H9T A;  3F8M A;  2DI3 A;  3GFL A;  1O3S A;  2E7W A;  3ZMD A;  1J75 A;  2QLZ A;  3REO A;  1WQ2 A;  4KIF A;  1BI2 A;  1G4D A;  2Q0O A;  4UVC A;  1XMA A;  2D1H A;  4Q48 A;  1ZRC A;  2ZJ2 A;  4IVN A;  3GZ5 A;  4G7Z F;  4HAM A;  4G7O F;  3KLN A;  3GWZ A;  3RYR A;  2JRT A;  1JXS A;  1LJ9 A;  1XMK A;  1D8J A;  1HST A;  1ZLJ A;  3ABT A;  2R3S A;  1W4M A;  4YIF A;  5EEG A;  2YX4 A;  1FWZ A;  2FA5 A;  3R0J A;  1O7L A;  1SFE A;  3VEP A;  1B9M A;  2O61 A;  1YIO A;  5CVI A;  2H09 A;  1IAW A;  2HS5 A;  6PAX A;  1FSE A;  3F72 A;  3GUD A;  3WGH A;  2JT1 A;  1PP7 U;  2K7L A;  2M8E A;  5K1Y A;  1CF7 B;  1IXS B;  2CYY A;  3E5U A;  1LNW A;  2ADU A;  3IRQ A;  2A69 F;  3ZMU A;  4BHB A;  1NHA A;  4I09 A;  2CFX A;  4R1H A;  5DV5 A;  1REP C;  2DAO A;  4M6Y A;  2FBI A;  4RAY A;  3QU6 A;  4WXH A;  3K69 A;  5D5X B;  3GYH X;  4A0Y A;  3HUG A;  3R61 A;  4BH9 A;  3ECO A;  3GO5 A;  3GVA A;  4HZF A;  3O3K A;  3TOA A;  1IN7 A;  4ZYD A;  1QZZ A;  5LGT A;  1WSU A;  4HDV A;  2OZU A;  1YW9 A;  2X4H A;  3B73 A;  4JK1 X;  3MZY A;  2UXX A;  4LJZ F;  1UCR A;  3BPX A;  1GXP A;  3ERE D;  1T6S A;  4BHC A;  4G7H F;  3CUQ A;  4R79 A;  2OAZ A;  2ZBK A;  1Z91 A;  3EQL F;  3HRS A;  3ZN1 A;  5HOO A;  5FGM A;  1QO0 D;  2DPU A;  3WGG A;  3R6S A;  2QUF A;  4QLC U;  4KYW A;  4HX4 A;  3V8K A;  2STT A;  4L9V A;  2OQG A;  1K6O A;  2IPQ X;  4Q47 A;  2P7V B;  2V6C A;  2FML A;  3HSF A;  5HLH A;  3KP4 A;  2XUB A;  3QU3 A;  2HOE A;  1Z7U A;  2GZW A;  3CUQ B;  3SZP A;  4I0B A;  1EH8 A;  4YFX F;  3I64 A;  1W5S A;  1YG2 A;  3I58 A;  3FX3 A;  3WE3 A;  3KEQ A;  5IT3 A;  4QWQ A;  1U6G A;  2LSO A;  3M9A A;  2F5F A;  3V7C A;  1ZAR A;  2ETH A;  2PI0 A;  3GF2 A;  2LDU A;  1A04 A;  3C7J A;  4RGR A;  3ISP A;  4KA4 A;  2NRA C;  3L09 A;  2EK5 A;  2NNY A;  3JAM Z;  3COA C;  1I6X A;  3NRV A;  3FM3 A;  4ZYE A;  2FBH A;  2ZME A;  2FMY A;  5FFX A;  5H20 A;  2EFO A;  2EWN A;  3M1E A;  1T0F A;  2M1B A;  3I59 A;  3N97 A;  2PJP A;  4Y15 A;  2HFH A;  3TO7 A;  1KYW A;  1UST A;  2LKP A;  2HQR A;  5DDG A;  3SXY A;  1PDN C;  3K0L A;  4D0P A;  4ENK A;  3K2Z A;  2GQQ A;  3MQ0 A;  2CGP A;  1S8N A;  1TQM A;  1MJ9 A;  4AWX B;  1WKM A;  2D2W A;  1HXD A;  2CSO A;  3CDH A;  3LWF A;  4OMY A;  5LHH A;  1PUE E;  5E8G A;  2Z5U A;  2RDP A;  5L3G A;  2Q2E A;  4BYY A;  2YSR A;  2R7D A;  1MKM A;  2G9W A;  3FXR A;  3L9F A;  1LDD A;  5E17 F;  1ON1 A;  3EET A;  2WWY A;  4HLY A;  4NQW A;  2PQ8 A;  4RB3 C;  3HOS A;  2X0L A;  3BJA A;  4HQE A;  2CG4 A;  3J81 K;  1J2X A;  3QOP A;  3SZT A;  3I0T A;  1QPM A;  5HDG A;  4ENM A;  1SFU A;  3WGI A;  4LFU A;  2JTV A;  1D3Y A;  1BIB A;  2RKH A;  1P2F A;  2VBY A;  1EH6 A;  4MQ9 F;  3WE2 A;  2BBY A;  1Q1H A;  1YS6 A;  1YS7 A;  1RNL A;  4Y17 A;  2PLY A;  4B09 A;  2ISZ A;  3WTZ A;  1BC8 C;  2IA1 A;  5TRD A;  4CHU A;  4HX8 A;  4LG0 B;  4WXC A;  2PMH A;  2RGV A;  2DQL A;  3IHU A;  2DPD A;  1XCB A;  5JHU A;  1HKQ A;  1U5T A;  4GYG A;  3E6C C;  4Z2Y A;  1X3U A;  5CVV A;  3BZ6 A;  1ZGA A;  3JTG A;  3PFI A;  2HEO A;  2ISY A;  2QVO A;  5FB2 A;  5D8K B;  1G3S A;  2O0Y A;  1V4R A;  2VXZ A;  2EFW A;  1I1S A;  2A3S A;  1R7J A;  2RV8 A;  3W6K B;  4K2E A;  3LFK A;  2O03 A;  5JI6 A;  3O6B B;  3LQQ A;  2HR3 A;  1HW2 A;  3EDP A;  5AIP A;  2PBI A;  1V3F A;  2R7F A;  2HKX A;  5CVR A;  1MJB A;  2IRF G;  4ZYG A;  4EQQ A;  3HRM A;  1U5T B;  2V79 A;  5LRS A;  1SFX A;  5LLQ A;  3QP5 A;  4M71 A;  1FSH A;  3FXQ A;  4FHT A;  2EB7 A;  4CO8 A;  1RZ4 A;  1HKS A;  1F1Z A;  2WV0 A;  1Z6R A;  4IHT A;  1PP8 F;  1QNT A;  1K7A A;  1BI1 A;  3T1B A;  1ZG3 A;  1YFH A;  4UXN A;  5ERI A;  4L0Z B;  1BN5 A;  1LDK B;  4ENN A;  3L7W A;  1JGS A;  5JVT A;  2V1U A;  2D45 A;  1L3L A;  2ELH A;  3IRR A;  4LK0 F;  5ICC A;  4L9J A;  2O8X A;  3CO6 C;  4EGZ A;  2QQA A;  2FOK A;  2EV5 A;  1XD7 A;  1T98 A;  3FXU A;  4PGH A;  2WC2 A;  1Z1D A;  1ONV A;  1U8R A;  2NYX A;  2HZT A;  2PEX A;  1MJA A;  2A07 F;  3K1M A;  5ICE A;  1H9G A;  4OIN F;  2KRF A;  3W6J B;  1J0R A;  1FBU A;  1XDS A;  2B0L A;  2HWV A;  1K78 B;  4LD5 A;  1H0M A;  4P9F A;  1BIA A;  2UXN A;  3LST A;  1BOA A;  4EJW A;  1O3T A;  3BWG A;  2VOD A;  2BV6 A;  1ZN2 A;  3J80 K;  2YR2 A;  2A6H F;  3HRT A;  5FO5 A;  1UHW A;  5FLX Z;  1B1B A;  2Z9O A;  1W5T A;  5LBQ A;  1FP2 A;  1JHH A;  1RIO H;  2JSC A;  1P4A A;  2JPC A;  1YQA A;  5HDK A;  4OOI A;  1HW1 A;  3ZMV A;  2VE8 A;  3G73 A;  5LHI A;  4XRF A;  5DD4 A;  3TQN A;  2XV4 S;  2VC0 A;  4OIO F;  2VON A;  1YLF A;  1HBX G;  3ZQ7 A;  2VN2 A;  1UB9 A;  4RGS A;  4N9H A;  4RGU A;  2FRH A;  2P8T A;  2MBF A;  2XAH A;  3L00 A;  2KKO A;  1E2X A;  4CYD A;  5LGN A;  2OD5 A;  3OOP A;  3F8C A;  3DPT A;  2MLK A;  3GW2 A;  4AVP A;  1IRG A;  1D5V A;  4UV8 A;  2H6B A;  2O3F A;  3Q9V A;  5IT9 K;  1S29 A;  4ZYH A;  5HS7 A;  1R1V A;  4U0V A;  4G6D A;  4RB1 A;  1R58 A;  3TO9 A;  2HKO A;  3SHF A;  1XSD A;  4OIR F;  4EM0 B;  4FX4 A;  4IJA A;  3RTR A;  2XGX A;  1TLH B;  3F6O A;  2LF7 A;  2Y48 A;  2L54 A;  3FZV A;  2W84 A;  5LEJ A;  4EMS A;  4CDG A;  3VOE A;  2H27 A;  3RPQ A;  4KIC A;  3F21 A;  4IRG A;  4Q5S F;  2K4B A;  1XGN A;  3E3V A;  4EGY A;  5TJJ A;  4IPA A;  4HLX A;  4EJU A;  3IWF A;  1RI7 A;  2IA2 A;  1SMT A;  4YII A;  4ZZD A;  2L02 A;  1F5T A;  3G3Z A;  5L3C A;  2KIM A;  1LEA A;  4UV9 A;  1F4K A;  1Z05 A;  2DQR A;  3ZPL A;  4A5N A;  2M30 A;  5A2Q K;  4L18 B;  2VC1 A;  2A61 A;  2TDX A;  5D6E A;  3M8F A;  1KU3 A;  1Z6T A;  5DUK A;  3TO6 A;  1J5Y A;  2VOP A;  3IC7 A;  3E6M A;  3GZ6 A;  2K86 A;  3BRO A;  2PMU A;  1TW3 A;  4GYI A;  5CLS A;  2OBP A;  3KLO A;  2P5K A;  1P6R A;  2QQ9 A;  4WX9 A;  2XAG A;  4U0Y A;  4LB5 A;  4Y13 A;  5CYV A;  4HDU A;  3FM5 A;  4A0X A;  4P9U A;  3N4M A;  4S05 A;  2L4A A;  4A6E A;  2XHK A;  2M45 A;  1L0O C;  1KU2 A;  4A12 A;  3C3W A;  1XGM A;  2IT0 A;  1FOK A;  1B59 A;  4BHP A;  4ESJ A;  4U7B A;  4HOB A;  4ESF A;  1R36 A;  3BOQ A;  4G6Q A;  4KN7 X;  3O2P E;  1P92 A;  1KQ9 A;  3KEO A;  2IP2 A;  2OZ6 A;  4MHG A;  3IKV A;  4G9Y A;  4F7Z A;  2EFQ A;  3NQO A;  1P4W A;  2PG4 A;  4KDP A;  2FXA A;  1SAX A;  4EJT A;  2QEN A;  3U2R A;  4ASN A;  4XSZ F;  5F64 A;  4Q4Z F;  3ZMZ A;  4P5O A;  2QQB A;  1AOY A;  3JW4 A;  2VT3 A;  2H6C A;  1IXR C;  5FD6 A;  4L5I A;  1WWX A;  1FYM A;  4OIP F;  3TGN A;  3EUH A;  4B8X A;  3KET A;  1USS A;  3MEX A;  3VOD A;  4IF4 A;  1I5Z A;  4NB5 A;  4RAZ A;  1IF1 A;  4LLN A;  1YW8 A;  4R8H A;  3BDD A;  3M7G A;  3TOB A;  1XSX A;  4M9X A;  4L5J A;  3LAJ A;  2ZNZ A;  3ROU A;  3V8J A;  3RKY A;  1AWC A;  2XAF A;  3K9T A;  4O6J A;  5HVQ C;  2W57 A;  4BXU A;  2ZXJ A;  3MWM A;  2PN6 A;  1J7K A;  2XAJ A;  4JQF A;  4O5V A;  1KQ0 A;  3F6V A;  3WTS C;  2ZME B;  1SMY F;  2GA2 A;  2VT2 A;  2KJB A;  2BEO A;  3HSE A;  5HS9 A;  5CJ9 A;  3DXJ F;  3I59 B;  2FQ3 A;  1G6N A;  3RDI A;  4S04 A;  4I98 B;  4GXO A;  5D5V B;  1D8K A;  1B4A A;  2HQN A;  1HKT A;  4KMU X;  2XRN A;  3V4G A;  4KN4 X;  1FLI A;  5ICG A;  4N0B A;  2FBK A;  1IZ1 A;  1OYW A;  3HIF A;  1STZ A;  2K4J A;  1CGP A;  2F5C A;  4MGR A;  1I27 A;  4HW0 A;  2K27 A;  3ZMS A;  3FF5 A;  1XGS A;  3KZZ A;  3GX4 X;  1MD0 A;  2YU3 A;  3T0Y A;  3D5L A;  3D0S A;  1R5G A;  2WTE A;  2F5D A;  3BJO A;  2NNN A;  1BI0 A;  1ZG1 A;  1DP7 P;  2H94 A;  1FZP B;  1VTN C;  2M87 A;  2OQR A;  5BS6 A;  1B6A A;  3IWZ A;  3ZN0 A;  3IKT A;  5KVR A;  4O3M A;  1SD7 A;  3LAP A;  2P7C B;  3HRU A;  5HLG A;  3FMR A;  3CO7 C;  1XN7 A;  2DBB A;  4MEY F;  2MA3 A;  2XKO A;  4I2O A;  4ENJ A;  1YW7 A;  1FC3 A;  5H6Q A;  3ZP5 A;  2XIG A;  2EA2 A;  1U78 A;  2EFP A;  2QBY A;  5AIQ A;  1LDJ A;  3P9I A;  4UHT A;  2BE5 F;  3MZH A;  4MTD A;  3MAJ A;  2HTS A;  3VFZ A;  2AXL A;  3GEZ A;  2J5O A;  3F8N A;  1F9N A;  2GA1 A;  3Q9S A;  3HHG A;  5CVJ A;  3F8F A;  4RGX A;  1KU7 A;  5H6R A;  1HW5 A;  2CW0 F;  4OMZ A;  2QBY B;  3CTA A;  3GFJ A;  2FU4 A;  4KMF A;  3KP2 A;  1UHM A;  2M5W A;  4MTE A;  1XDU A;  1ULY A;  1ZG5 A;  5FFZ A;  4EM2 A;  3GFI A;  4G8X A;  2ESH A;  2QWW A;  2HYG D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...