5ERIA

Marr protein from peptoclostridium difficile da00132
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
153
Chain Sequence
RGSHMLIKTLDSNILREVGTLSRAVNSINDIKYKELKLQKGQFTFLTRICENPGINLVELSNMLKVDKATTTKAIQKLIKAGYVDKKQDKFDKRGYNLTPTDKSLEVYELIIEEENRSIEICFDNFTDEEKQVVTKLLEKMSKNVENEWFKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MarR family transcriptional regulator
publication title Crystal structure of the multiple antibiotic resistance regulator MarR from Clostridium difficile
doi rcsb
source organism Peptoclostridium difficile
molecule tags Transcription
total genus 55
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2015-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5eriA00
3LWFA 2FMYA 2M87A 2DI3A 1BJAA 4KIBA 4BYYA 5ERIA 1OYWA 2MC3A 3FXRA 2ESNA 1SD5A 2ETHA 2P5KA 4FHTA 3ZMZA 1OMIA 3FMSA 3R0AA 1H9GA 3GF2A 3L00A 5K5OA 5BPIA 4LG0A 2BE5F 3MQ0A 1T6SA 1HW5A 3FWEA 3W6KB 2QYOA 2O61A 5L3FA 1BN5A 4HZFA 3KP6A 2Q8KA 4XSZF 2OU2A 3AAFA 2A68F 2HFHA 3E6MA 3R0JA 2AXLA 1FSEA 5AIPA 2V1XA 1H9TA 2ZKZA 1FZPB 3BJOA 3RJPA 2XGXA 5HDKA 3DEUA 1J75A 3BOQA 4HQEA 5D8KB 2J5PA 1LB2A 1IN6A 2Z5UA 3TDZC 3U1DA 3U9GA 2YR2A 1K78B 5LRSA 4ZYDA 4A5MA 3E5UA 4HAMA 2L54A 4XLPF 1T0FA 2IA0A 1XSVA 3T8TA 3TOBA 3V7CA 2UXXA 3GYHX 2LDUA 4L9VA 4XLNF 3J7AO 5DCFA 4G7OF 4CICA 3WGHA 5E1WA 4ZYHA 2DW4A 3J81Z 2DPDA 1HBXG 2QQAA 2OZUA 1MJAA 4BHBA 2PN6A 1GXPA 2ACJA 1MGTA 1PP8F 2A07F 3K1PA 3SZPA 4M74A 4AIJA 3MWMA 5D8LB 1U5TA 4G6QA 1SMTA 2IW5A 3ERED 3I58A 1O3TA 1FX7A 2B0LA 2XAHA 4ESBA 3F8BA 1A04A 4HDUA 4R8HA 4K2EA 5K5QA 1ULYA 2XRNA 1LJ9A 2TDXA 1LNWA 2ZCWA 1DP7P 2O03A 1G3SA 1P92A 1HW2A 2XKOA 3KZYA 1R22A 4IVNA 2KIUA 1KU3A 1R36A 5KK1A 3RI4A 1SFEA 1YO5C 2V79A 4HF2A 3E6DA 5D5UB 3P9CA 1ODDA 3H3ZA 2GWRA 1YS7A 4O6JA 4RAZA 1IRGA 2GIVA 2IT0A 1J5YA 2Y48A 4EM0B 2L02A 1DUXC 4Z2YA 2IPQX 4XRFA 1P6RA 2EV6A 4LLNA 1SAXA 1FY7A 4IRHA 1UB9A 3E97A 1L3LA 4QWQA 1QGPA 4I0BA 4ZH4F 2D2WA 2YPRA 3ZN0A 2Q2EA 3ROUA 1CF7A 3FM5A 4P55A 2DT5A 4GYIA 2E7WA 4KFCA 1OPCA 3I59B 2O6GE 4G8XA 2RV8A 1XCBA 3TQNA 2ZNZA 4PGHA 4Q4ZF 2JPBA 2EFOA 3C7JA 1MJ9A 5HS8A 3LA3A 1FP1D 2W25A 3GO5A 2MH9A 3QRFF 4M6XA 3CO6C 3EYYA 4OIOF 3D0SA 5HDGA 1U6GA 3ISPA 1B9NA 3HSEA 1Z6RA 3F6VA 3KP3A 1KQ0A 1RNLA 1LDJA 4LG0B 1G6NA 4HA8A 3HSFA 1TLHB 1U8RA 1B6AA 3E6CC 4UV9A 2GQQA 1Z7UA 1NHAA 5L3DA 1KQ8A 2L4MA 1EH6A 4AIKA 1K7AA 2DFIA 5LBQA 4BQAA 3L7WA 3GZ5A 3GW2A 4L9NA 1SD6A 1TBXA 2HKXA 4FX0A 1KU7A 1O7LA 2RKHA 1ZRFA 1YLFA 4ESFA 5E18F 2EFPA 5BS6A 2STTA 3GWZA 5K5RA 4OIRF 3RPQA 4Y15A 5IT9K 4MEYF 2QUFA 2EFQA 1BI1A 2MH2A 1IN4A 3KP2A 4B8XA 3FMRA 1GXQA 4LLLA 2HTSA 4MEXF 5JR3A 4D0PA 2QBYA 4MTDA 1XSDA 1WSUA 1YW9A 1JHFA 2HYGD 1F4KA 4LGWA 1H0MA 2XVCA 3MAJA 3RYRA 4FX4A 2ZMEA 4R1HA 1HW1A 2BBYA 2RGVA 5D6FA 1D5VA 1FOKA 2FA5A 1I1SA 4RB1A 2VN2A 1YG2A 2ISYA 3W6JB 2CG4A 3K1NA 2FE3A 2P4WA 1J2XA 2LF7A 4KUMA 1E17A 2K27A 4YFXF 3F21A 1D8JA 1W5TA 1BI3A 2ZXJA 5CYVA 2VT3A 2DK8A 2CQKA 1U5TB 1YFHA 1T39A 1R58A 3LQRA 1FLIA 1IUYA 4OIQF 2A6HF 1F9NA 4G94A 1GVJA 1ZLKA 2K4JA 5HLGA 3GX4X 2M1BA 1TNTA 2FF4A 3I53A 1XSXA 3GFLA 3WTVC 4EVIA 3CLOA 3V8JA 4L5IA 5CLSA 1SD7A 5ICCA 5A2QK 2IA1A 4CO8A 2A61A 5L3CA 1FBSA 4WXCA 1DDNA 3RYPA 1TTYA 3R61A 5LLQA 5EEGA 2JPCA 4ENMA 2CO5A 4IRGA 1R1UA 2R7DA 3BZ6A 3NQOA 4U7BA 2BV6A 3KLNA 4WWCA 3PQJA 4WCGA 4IJAA 3MCZA 1OYIA 4HBLA 2OD5A 3DFGA 3V8LA 1S3JA 3CUQA 3DPLC 2FNPA 1SMYF 1O3RA 5D4RA 1IF1A 4U0YA 2YX4A 1KQ9A 1ZHFA 3LFKA 2KRFA 3I5UA 2EA2A 1ONVA 1F5TA 1CF7B 1XDUA 3KLOA 5E1ZB 2E1CA 1R5HA 3KZZA 4N9HA 4Q5SF 2CYYA 1J9IA 3CDHA 1O57A 1R1VA 2JRTA 5D4SA 5LGTA 2HQNA 1KU2A 4RB2C 2QQBA 3VOEA 1JHHA 3T1BA 3ZMVA 2M45A 2EA4A 1QZZA 3VEPA 1K6OA 4OU0A 3HHGA 2HEOA 1W4MA 4OINF 3MEXA 5JI6A 4IHTA 1L0OC 1S7OA 2VONA 5FD5A 4WF2A 2HGCA 2HOEA 3IKTA 4P96A 2LSOA 1B59A 2Y75A 5L3EA 1ZLJA 3H3UA 2KJBA 4U0WA 4G9YA 2HDCA 5FFZA 2P5VA 1B1BA 4O5VA 3GFIA 3I54A 3KFWX 4YFKF 1RI7A 4U7DA 5L3BA 1BI2A 4KIGA 2PG4A 3OOPA 3HRSA 2FBIA 4FT8A 4IRIA 3FXQA 5HS9A 3ECOA 4EJVA 3JSPA 1S7AA 1D3YA 5JFRA 3QU3A 3V4GA 3K0LA 3B02A 2DO7A 2FSWA 1HKSA 3KETA 3DPTA 4LFUA 4M72A 5DD4A 4G7ZF 2EWNA 3M8EA 4GGGA 4EJWA 1FBQA 3IHUA 2P8TA 2DPUA 3E3VA 2ZMEB 4HX7A 4WK8F 4BHCA 5DV5A 4OMYA 2Z3YA 1SFUA 4Q47A 5D5VB 3BY6A 3ECHA 1UCRA 2MBFA 1LQ1A 3GEZA 1J0RA 4YIIA 5JHUA 4GO1A 3WGGA 1FP2A 1DPUA 3TO6A 2CGPA 3TOAA 4RS8A 5IT9Z 1MD0A 4HF0A 5CVVA 1C0WA 2E7XA 1QZYA 3WTSC 5HVQC 2NRAC 2JSCA 2OAZA 1MJBA 2XIGA 1Z6TA 1RUOA 4HOBA 4OIPF 4ZYEA 3P9KA 2WV0A 4RGSA 4GYGA 4QLCU 3K2ZA 5D5WB 4LK0F 4A0XA 1I6XA 3ELKA 1YYVA 1TW2A 3G3ZA 1WKMA 3IWZA 4EGZA 2Z33A 3SFZA 4S04A 1ZGJA 4A0ZA 3GFJA 4BHPA 3JAMK 1TQPA 2FMLA 1OKRA 1Z9CA 3CJNA 1JGSA 5CVJA 2K02A 4HV5A 1AOYA 5E20A 3TO7A 4JK1X 4UHTA 2STWA 3CUQB 1LVAA 1DPRA 2HKOA 2PEXA 4UVAA 4LMYA 1MDMA 1IN7A 3FF5A 1R7JA 3QOPA 5HS7A 1SD4A 1FNNA 3F8CA 3WTUC 3LAPA 3IL2A 3E6BA 5A2QZ 2VC0A 4ENNA 2IJLA 1K79A 2PFBA 1E2XA 4L0ZB 4GXOA 4KN4X 3SZTA 1LEAA 2ESHA 5DCMB 3KEQA 3VB2A 2GAUA 2P5LC 2DAOA 4CDGA 2V1UA 1F1ZA 3R60A 5ILUA 4KDPA 4EJOA 5LGUA 5DUIA 2V9VA 3HIFA 2P6TA 1Z1DA 3I0TA 5FD6A 1PDNC 4M73A 3WTTC 5LHHA 3ZMDA 2M30A 2F5EA 3WU1B 3CO7C 3EQLF 3DV8A 4AWXB 3O6BB 4HX4A 2ZNYA 2L01A 2Z99A 1P4XA 3L2CA 3FXUA 3GXOA 4MTEA 3N4MA 3COAC 1ZRCA 1TQIA 2DQRA 1BI0A 3C1DA 4JQFA 4UV8A 2V6CA 1Z91A 1KYWA 4UNOA 4KNYA 1XN7A 3HYIA 2CW0F 1QO0D 1J7KA 1V4RA 4KMUX 2H6CA 5ILSA 1BC8C 3Q9VA 1G3WA 4OMZA 1JE8A 5D6EA 2RC4A 3V8KA 3R4KA 1LDKB 4M9ZA 3RKXA 1YS6A 3TKYA 4I98B 3KP5A 2MA3A 1FBUA 2FRHA 3L9FA 4UUVA 3K9TA 3KP7A 1BIBA 3RDIA 1ZGAA 5J8CA 4Y13A 2OZ6A 4F7ZA 5LHGA 3ZMUA 3KCCA 2NNNA 5LRRA 5BQTA 1QPMA 2MLKA 1ZREA 4PGGA 3BPXA 3DXJF 4IHSA 5DYMA 1K78A 5FGMA 1FYMA 1XMKA 2GA1A 1FYKA 2VOOA 4LB5A 2VT2A 2QVOA 2X4HA 4ASNA 5E17F 4IXAA 3WE3A 2PMUA 1ON1A 1BBYA 5F6FA 2EFWA 3U2RA 1BM9A 2JZYA 2HYFA 1U78A 1ZN2A 4LB6B 3F8NA 3BP8A 2EB7A 2G7HA 3DP7A 2ZBKA 5FLXK 3FX3A 4RB0A 2IP2A 3LQQA 5CVRA 2MD5A 1XDSA 5FFXA 2XUBA 4HQMA 4L18B 1O3QA 4AVPA 2OQRA 3BDDA 5CVIA 1IAWA 5LEKA 3M7GA 4LJZF 1IXCA 2QM3A 1FSHA 4HLYA 4TV7A 4AIHA 3ABUA 1HQCA 2CWEA 3O3KA 3ZN1A 2EFNA 2R7FA 1FYLA 2WC2A 1IRFA 1J59A 3ML6A 2OA4A 4Q48A 4I7HA 3C18A 5BMZA 2PI0A 1XCVA 5BOXA 1I1GA 2O0YA 3WG9A 5HLIA 4M71A 1GHCA 4E70A 2COMA 2JT1A 2XASA 4N0BA 3VFZA 5LHIA 4YIFA 5TJJA 3BROA 2VODA 4NB5A 1LEBA 4ETSA 2XAJA 1P2FA 3WTYC 2HZTA 4KICA 3K1MA 2HR3A 3O2PE 3GFMA 1EH8A 3EDPA 5HOOA 3JSOA 3HTSB 3IC7A 1VTNC 2VBWA 2ELHA 5CVUA 1ZH5A 4M9SA 2O3FA 1MDMB 2UWMA 2PBIA 2RDPA 2NAZA 4YG2F 2P7CB 1ON2A 3QAHA 4B09A 4HV6A 4U88A 2XKPA 3D5LA 4I2OA 4P5OA 4YFNF 2UZKA 4CZZA 2GXBA 3FHZA 2D1VA 2FQ3A 5L3GA 3F8MA 4KT5C 1RUNA 3B73A 2DK5A 5ICGA 3M9AA 2IRFG 3LA7A 1USSA 3JAMZ 1KGSA 2K4BA 5DUKA 2RN7A 3N97A 1I5ZA 2DBBA 2QZ8A 1UHWA 1IZ1A 3KP4A 3F72A 1U5TC 2FBHA 4LD5A 4XBFA 1PUEE 3GZ6A 5BPDA 1XB4A 3F8FA 2XAGA 4RGUA 3S2WA 4KN7X 2G7UA 2XROA 1ZRDA 3TDUC 5E8GA 1XGSA 3IRRA 3T8RA 1W7PD 2C6YA 2VBXA 2CSOA 1QQIA 2MLGA 4S05A 2E1NA 2O8XA 1WRJA 4BAYA 4P9UA 4PZJA 3SXYA 4HDVA 3F3XA 5KVRA 4NHJA 4ZZLA 4KIFA 3PQKA 1KU9A 3WE2A 3C3WA 4A6EA 2RQPA 4GCVA 2J5OA 3P7NA 3BJ6A 2QBYB 4CXFA 2FBKA 4DQ2A 2IVMA 2VBZA 1HXDA 1U2WA 1JXSA 3I71A 2PMHA 1W5SA 4A6DA 4IPAA 4HW0A 1G4DA 4Y17A 3WODF 1EH7A 5H6QA 2FNAA 4RB3C 2FXAA 1XMAA 2QQ9A 1RIOH 2W85A 5LEJA 3RKYA 5CJ9A 2RNJA 1CGPA 5AIQA 4EGYA 2VXZA 1HSTA 1YW7A 2P6SA 3Q9SA 3ZMSA 2FOKA 2LNBA 4ESJA 2KJCA 2ZJ2A 4KMFA 5JVTA 1MKMA 4XSXF 2QENA 1YTYA 2YSRA 2H6BA 3HHHA 3GVAA 3JTGA 4L0YB 3OV8A 4JBAA 1FT9A 3ZP5A 2X0LA 4CHUA 4ON0A 2DLLA 2R3SA 1IW7F 3WTZA 4IF4A 3MFKA 5D5XB 5ICFA 2L3DA 2M8EA 4L5JA 3DQVC 2PJPA 2M5WA 3RKWA 1SFXA 4KA4A 3EETA 2H94A 1QNTA 3F22A 3HRMA 4MGRA 4U0VA 3WTWC 2BEOA 2DU9A 3J80K 1HKTA 3BWGA 3HOTA 2ZO4A 1YW8A 3K69A 5FLXZ 2QLZA 4BH9A 2QWWA 1XGMA 1WI9A 3SHFA 3FZVA 5TRDA 4KYWA 1P4AA 2OBPA 2RVCA 1W7PA 2F5CA 4EM2A 5J8FA 1USTA 4PCQA 4EQQA 1ZAOA 2DTRA 4RGRA 3RTRA 2W57A 4A5NA 3BJAA 2WWYA 3ZPLA 4EJTA 2W84A 4OOIA 1BOAA 4L9JA 4R79A 4EMSA 4I0AA 5DEQA 2DQLA 2BYVE 4EM1A 1UHMA 5ICEA 4AD9A 4ENJA 1T98A 2NNYA 1FWZA 1G3YA 1WWXA 3T0YA 3HSRA 1HKQA 2G9WA 2EV5A 4N9IA 3RIRA 4HF1A 3HRTA 3I4PA 1TNSA 3ZMTA 1ZG1A 5K1YA 2Z9OA 4A0YA 2NS0A 3NRVA 2HQRA 5AONA 3GLXA 1AWCA 3P9IA 2JTVA 3RPUA 1O7FA 1U3EM 4BNCA 1STZA 4G7HF 2GZWA 3E5QA 3WU0A 1X3UA 3GUDA 3V7SA 4G6DA 4UXNA 3KE2A 1YQAA 5HLHA 4MQVA 1IN8A 2L4AA 3QP5A 1TQMA 1I27A 3WTXC 1KYZA 5FB2A 3CUOA 2EJRA 1P4WA 4RAYA 5DD8A 3Q5FA 3ZQ7A 4LLGF 4A2UA 2LKPA 4UVCA 1XGOA 3L09A 5E8IA 2PQ8A 1LDDA 4P9FA 4L9TA 4NQWA 3R6SA 4HX8A 1PP7U 2WTEA 1KA8A 2P7VB 5J6XA 1Q1HA 2A69F 3F6OA 4WXHA 1ZG3A 4EJUA 1FPQA 1REPC 3CUQC 2A5YB 4I01A 3MZHA 1Y0UA 5IT3A 3T5XA 3J81K 5ED4A 4MHGA 1Z05A 2F5FA 5DDGA 2Y0MA 1HSJA 1T38A 5ILVA 1V3FA 5E1XA 3LAJA 2VE9A 1ZG5A 2PLYA 1BIAA 1R23A 3NEUA 4M6YA 3LSTA 4PDKA 4A12A 2YU3A 4EV0A 1OR7A 4MNUA 1B9MA 2FEZA 5EEHA 2XHKA 3ULQB 1S29A 2VE8A 1O3SA 2K7LA 1BC7C 1D8KA 1ZARA 2HTJA 3FMQA 4CYDA 4CGZA 3QPTA 2A3SA 6PAXA 1R1TA 3FM3A 3JW4A 1S6LA 2XV4S 2KKOA 4ENKA 1IN5A 1TW3A 5H6RA 1XD7A 3EYIA 1G3TA 2Q0OA 2XAQA 3CTAA 2ISZA 5FO5A 2F5DA 2H27A 4H0EA 2F2EA 3PFIA 1FC3A 2IA2A 2FU4A 1IXSB 3E5XA 3G73A 2D45A 2VC1A 2VOPA 4WX9A 2NYXA 3QPHA 3DF8A 4I09A 4HYEA 2GXGA 2CFXA 3VODA 4UVBA 2D1HA 3HOSA 5F64A 3WGIA 1B4AA 1RZ4A 1QBJA 2EK5A 3HRUA 2KIFA 3H92A 2ZFWA 2UXNA 3MZYA 2XAFA 3SQNA 2H09A 4ZZDA 4DNCA 1W7PB 4BXUA 3QP6A 5H20A 1XGNA 3EUHA 2KIMA 1R00A 2BGCA 3HUGA 3REOA 2VBYA 4ZYGA 3M8FA 2AS5F 3IKVA 4LK1F 2GA2A 1S8NA 2A6EF 4MQ9F 3LA2A 2W24A 3QU6A 2K86A 4HLXA 5F1RA 2EV0A 3ABTA 3I64A 1IXRC 2V1DA 3BPVA 5HDNA 4M9XA 2HWVA 3TGNA 1WQ2A 3HTUA 1T2KA 5LGNA 1ZYRF 3J80Z 2ADUA 1YIOA 3IRQA 4O3MA 1UFMA 2YX7A 3I59A 1R5GA 4RGXA 2HS5A 3DKWA 3M1EA 4WXDA 3V7RA 2LF8A 4I02A 5DCMA 1MZBA 3IWFA 3TO9A 1OYYA 3JTHA 3F23A 2OQGA 3KEOA 1EV7A
chains in the Genus database with same CATH superfamily
3G1MA 1MMNA 2JUGA 2KL4A 3QODA 4DYCA 2G0EA 3VSKA 1FTZA 3LWFA 5JLXA 2QA4I 2LKSA 2LOOA 4N4OB 3ZRGA 2FMYA 2M87A 2DI3A 1MBJA 2L9SA 1BJAA 4PJLA 4KIBA 2DN0A 1WVRA 4BYYA 1QZEA 5ERIA 1OYWA 2LBFA 2MC3A 3FXRA 2ESNA 1FEXA 1U0JA 1SD5A 2ETHA 2P5KA 2V7FA 4FHTA 3ZMZA 1OMIA 3FMSA 2DA7A 3R0AA 2AQFA 2CUJA 1H9GA 3GF2A 4IEJA 3L00A 5K5OA 2OV7A 3OYAA 3K70D 5BPIA 4LG0A 3DPUA 2BE5F 4CYCA 1QHHD 2KDOA 3MQ0A 1T6SA 4NQWB 3H5RA 1HW5A 3FWEA 3ZQCA 4V2GA 3W6KB 1DP3A 2QYOA 2O61A 3GTQJ 5L3FA 1BN5A 2AQEA 4HZFA 5GAGJ 2X6WA 4HSTA 3KP6A 1VQ7I 2Q8KA 4XSZF 2OU2A 1R49A 3AAFA 2W4SA 2DMUA 2A68F 2Z2SB 2HFHA 3E6MA 5F0FA 3R0JA 2AXLA 2KZVA 1FSEA 3H5NA 5AIPA 1R71A 2RREA 3HKZN 3WG7H 5FKKA 2V1XA 3S3OA 1H9TA 2NXNB 2ZKZA 4IHVA 1FZPB 1JT6A 1TWCJ 3BJOA 2WBMA 3RJPA 2PX9A 2XGXA 5HDKA 3SZGA 3DEUA 1J75A 3BOQA 3HBLA 4HQEA 4CCMA 5D8KB 3VWBA 2GOMA 2J5PA 4KJZA 1HOMA 1LB2A 3GTMJ 2ZJRF 1IN6A 2Z5UA 3TDZC 3U1DA 3U9GA 2YR2A 1K78B 4BJ5C 1FMWA 4MFDA 3L2QA 4BEHB 1QU3A 3K4BA 1MNEA 5LRSA 4ZYDA 4DJAA 4A5MA 4IO9F 4LG3A 1OCCH 3E5UA 3GMEA 1JUPA 1TC3C 4RAGA 4HAMA 2IBDA 2L54A 3S1RJ 4XKCA 1DGRM 3OYJA 3J7AY 4XLPF 1T0FA 2IA0A 1XSVA 3T8TA 3TOBA 4HPQA 1ORKA 2GIZA 5F04A 3V7CA 2HVRA 2UXXA 2VQHA 3AG4H 4JYKA 3GYHX 2LDUA 1YE9A 4L9VA 4XLNF 3J7AO 4CSWA 5DCFA 4G7OF 5GPAA 4CICA 3CJRB 1GVDA 1Z67A 3WGHA 2DTZA 2HZDA 2XF5A 5E1WA 4ZYHA 1M1EB 4H4KC 2DW4A 3J81Z 2DPDA 1HBXG 3TP3A 2QQAA 2VQCA 3DWLE 5HNFA 2OZUA 4JP0A 3M07A 1MJAA 1HF0A 3DU6A 1VZ0A 2JVHA 4BHBA 2WAFA 4ZC3A 2PN6A 4F3QA 1XX5A 1GXPA 2ACJA 1MGTA 1PP8F 2A07F 4MIMA 3K1PA 3SZPA 4M74A 4AIJA 2GLOA 3MWMA 2CQXA 3HM5A 2M2EA 5D8LB 1U5TA 4G6QA 1SMTA 2IW5A 4M3GA 3ERED 2IGKA 2JVGA 1MMAA 1KZHA 3I58A 4I76A 1O3TA 3FK7A 3Q0VA 3DU5A 4A69C 4BBSJ 3JRHA 3HOZJ 1FX7A 1QVTA 2B0LA 3BZKA 2ECBA 2XAHA 4ESBA 3F8BA 1A04A 4HDUA 2XSDC 4R8HA 4K2EA 5K5QA 4HEA2 1ULYA 2XRNA 3ZQGA 4HG2A 2V1NA 1LJ9A 2BZTA 2JA5J 4PK4A 2A5WA 2TDXA 4X1EA 1LNWA 2ZCWA 1DP7P 2O03A 1G3SA 4A3GJ 1S9HA 1P92A 1V5GA 1HW2A 2XKOA 3KZYA 2NVYJ 1R22A 2L7KA 3OYCA 3K6GA 4IVNA 2KIUA 2X48A 3E0JB 1DU6A 3ZXSA 5E3OA 1MMGA 3J7YJ 1KU3A 1R36A 2FOWA 4XMYA 2EQRA 5KK1A 3RI4A 1SFEA 1YO5C 2V79A 4HF2A 2Z16A 3HUGB 2E5ZA 3E6DA 5D5UB 3P9CA 1ODDA 3H3ZA 3IUOA 2X51A 2GWRA 4UB6C 1YS7A 4O6JA 4RAZA 2JMWA 2UUZA 1R4NB 3S16J 4BKXA 1IRGA 2GIVA 1E3HA 4BXFA 2IT0A 1J5YA 3PNTA 2QEXI 3H0GJ 2LC2A 2Y48A 2ZXHA 4EM0B 2L02A 4BL0B 5GP9A 1HLVA 3OS0A 3W2AA 3CCLI 1OR7C 4BDYA 4Z2YA 1DUXC 2IPQX 4XRFA 1P6RA 2EV6A 4LLNA 1J09A 4DGWB 3F9KA 1SAXA 1FY7A 4IRHA 2NVTJ 5B3SH 1UB9A 3D5RC 3K7AJ 2OF7A 3E97A 3Q3SA 3SDGA 1Y39A 3G2BA 1L3LA 2LRDA 3OS1A 4QWQA 1QGPA 4I0BA 2QGUA 4ZH4F 3ZQLA 2D2WA 2YPRA 3ZN0A 2Q2EA 3ROUA 1JKQC 2AHQA 2CUFA 1CF7A 1A6QA 1ETOA 3FM5A 4P55A 2DT5A 4GYIA 2E7WA 4KFCA 4A3IJ 2WA0A 1OPCA 1VQ4I 4HRIA 1K4TA 3DTEA 3I59B 2O6GE 5B1AH 4G8XA 2IAIA 1YX5A 2XPWA 2RV8A 1XCBA 3TQNA 3GCMA 2ZNZA 4PGHA 4Q4ZF 2JPBA 1VFCA 4Y4RA 1IV8A 2EFOA 1A36A 3C7JA 1MJ9A 2COBA 4HNTA 4C2UA 3KX2A 5IP9J 5HS8A 2NS8A 3LA3A 4ZTJA 1FP1D 1CQTA 2W25A 4MLOA 1S72I 3CMEI 3GO5A 2MH9A 1PJRA 2WY7Q 3QRFF 1SFOJ 2DYRH 4IOCF 4M6XA 2F4MB 1OJLA 2F4OB 3BR3A 3CO6C 3EYYA 4OIOF 3D0SA 2CRGA 5HDGA 3PL8A 3CC7I 1U6GA 3ISPA 3RSNA 1B9NA 3HSEA 1WJDA 2V4JC 2LBFB 4IHYA 1Z6RA 3F6VA 3S32A 5FRMA 4CH7A 3DEEA 2LYCA 1U8BA 2V9KA 3KP3A 1RKTA 1KQ0A 1B72A 1RNLA 1LDJA 4LG0B 2VXDA 4A3DJ 4A3KJ 1G6NA 4HA8A 2VKDA 4XIDA 3HSFA 1TLHB 4E7LA 1U8RA 1B6AA 2MW8A 3VYSB 3E6CC 4UV9A 1TWGJ 1R9TJ 2GQQA 1Z7UA 1NHAA 5L3DA 2CQNA 5E3LA 1SC7A 5IYBJ 1KQ8A 2L4MA 3NWSA 3H3VK 1EH6A 2XAUA 4AIKA 1K7AA 2DFIA 5LBQA 4BQAA 3L7WA 3GZ5A 4UUSA 3EUHC 3ZCOA 3GW2A 3HPGA 2EZIA 1SD6A 1TBXA 1YX3A 4L9NA 5M3MJ 2HKXA 2JN6A 4FX0A 4XR6A 2EINH 1O7LA 2CMPA 2BXYA 2P0WA 1KU7A 2RKHA 1ZRFA 1YLFA 4ESFA 5E18F 2X6XA 1JJ6C 2E71A 1GV5A 3D1NI 2EFPA 5BS6A 2STTA 3GWZA 5K5RA 4OIRF 3RPQA 4A3CJ 3L2WA 4Y15A 1VQOI 4MEYF 2E2IJ 5IT9K 2QUFA 2EFQA 1BI1A 2MH2A 3JRAA 5JVGF 3EUKL 2DODA 1IN4A 3KP2A 4P1WA 3FMRA 4B8XA 1GXQA 1PUFA 1ETVA 4LLLA 2OCEA 2HPMA 2HTSA 4MEXF 1GDTA 5JR3A 3PNYA 5M5XJ 4D0PA 2K9MA 5FROA 3BTLA 2Y9ZA 2QBYA 5IYCJ 3KYLA 4MTDA 1XSDA 3S3MA 1WSUA 2RAEA 3ZQHA 1YW9A 1FTTA 1JHFA 2HYGD 1F4KA 4LGWA 1H0MA 1A5JA 5FJ8J 2UV1A 2XVCA 3MAJA 3RYRA 4FX4A 2ZMEA 4R1HA 1HW1A 2DMTA 1OCOH 2XSJC 2BBYA 1ZELA 2RGVA 5D6FA 1D5VA 3PFYA 3OIPA 1YIJI 1FOKA 3ZGKA 2FA5A 4LIUA 4M3EA 1I1SA 4RB1A 2VN2A 1YG2A 3MMYB 2ISYA 4XRSG 3W6JB 1Z3XA 2CG4A 3K1NA 2FE3A 2P4WA 1J2XA 2K9SA 2LF7A 4KUMA 3OYLA 1E17A 2HXOA 2K27A 4YFXF 3F21A 1D8JA 3OYMA 4II2A 3CP2A 2MABA 1W5TA 4QPOA 3HG9A 1BI3A 2ZXJA 2VIXA 5CYVA 5FRNA 2VT3A 1TL8A 2DK8A 1UG2A 2CQKA 2DA3A 2TRTA 1U5TB 3KYDB 1YFHA 1T39A 1R58A 3LQRA 1FLIA 1IUYA 4OIQF 2A6HF 4D7MA 1F9NA 4G94A 5DM7F 1GVJA 1ZLKA 2K4JA 3FHNA 5HLGA 3QYFA 4OWRB 3GX4X 2M1BA 4XLAA 1TNTA 1X1CA 2VLAA 2FF4A 2K85A 3I53A 4RAFA 1XSXA 2VPLA 3GFLA 5KNLA 1WFXA 2GXAA 3WTVC 4EVIA 3GTLJ 2WAQA 1X4OA 2K5CA 4E6KG 5IOZA 4XICA 2JA7J 3CLOA 3V8JA 4L5IA 1T8IA 5CLSA 1SD7A 5ICCA 5IP6A 2IA1A 5A2QK 4CO8A 2A61A 4B3AA 5L3CA 1FBSA 1T95A 2WY8Q 4WXCA 3LSJA 1VQKI 4BQNA 3FIWA 1DDNA 2WV1A 3N05A 5J3LA 2OCCH 2BY2A 3RYPA 2KT0A 3H0DA 1TTYA 2LLKA 3R61A 5LLQA 5EEGA 2JPCA 4AC0A 2CO5A 4ENMA 4IRGA 4XNFA 2TCTA 3CQZJ 1R1UA 1EA3A 3HB9A 2R7DA 4C3JJ 3BZ6A 3NQOA 4U7BA 2BV6A 3KLNA 4WWCA 3PQJA 4WCGA 1VQ6I 4IJAA 3MCZA 1V5FA 5M5WJ 3H35A 1OYIA 2W82A 4HBLA 1UJ8A 2IS6A 3BR1A 1F36A 2OD5A 3DFGA 3V8LA 3A2KA 1S3JA 1T56A 4XONA 3CUQA 2DMQA 2NVUB 3DPLC 2FNPA 1SMYF 3G1LA 1O3RA 2GM4A 5D4RA 3OIQA 1IF1A 4U0YA 2YX4A 3IAS2 4BE2A 1T0FC 2KRHA 1N78A 3WU2C 4RDUA 3WHBA 1KQ9A 1RKWA 1WJFA 1ZHFA 3LFKA 2M4GA 2KRFA 3I5UA 2EA2A 2Q2EB 1ONVA 1F5TA 1CF7B 1Q1VA 2ZJPF 4C2TA 1XDUA 3KLOA 5E1ZB 1JGGA 2E1CA 2BHYA 1R5HA 3AL0C 4BE0A 3KZZA 2ECCA 4A3LJ 4N9HA 4Q5SF 2CYYA 2X1DA 1H89C 4XOTA 3CDHA 1J9IA 4NUBA 1O57A 1OFCX 1R1VA 2JRTA 2Y69H 5D4SA 5LGTA 1K83J 2OUMA 2HQNA 1KU2A 4RB2C 3H5AA 2BY3A 4XLCA 3S3NA 2QQBA 3VOEA 4E7JA 3IV5A 1JHHA 3T1BA 5TISC 3ZMVA 1E3PA 2M45A 4XL9A 2EA4A 3DEWA 1HCRA 1IO2A 1QZZA 3VEPA 1K6OA 2JWTA 4OU0A 1D0ZA 2N8GA 3HHGA 3FDYA 2HEOA 1W4MA 1JUSA 4OINF 1Y1VJ 4II3A 3MEXA 5JI6A 4DBRA 4YIRX 4IHTA 2I8DA 1MMDA 2XPUA 4Y7NJ 1L0OC 1S7OA 2CUEA 4C3HJ 3VYUB 2VONA 3L2RA 3Q0WA 5FD5A 4A3JJ 2R7TA 4WF2A 2HGCA 2HOEA 4Y33A 2NVQJ 1MMSA 3IKTA 1LVKA 1D5YA 4XM3A 1A35A 4P96A 1T33A 2LSOA 1A6IA 1B72B 1B59A 1W1WE 2Y75A 5L3EA 2YU9J 2LVSA 1WJAA 1ZLJA 3H3UA 1MSFC 2KJBA 1LFPA 4ZDOA 1LUJB 4U0WA 3FISA 3BZCA 5F27A 1VQLI 3BR0A 4G9YA 2KHMA 2XF6A 3K4NA 4J00A 5FFZA 2P5VA 1B1BA 4O5VA 3WHCA 2HDCA 3HDDA 2KLOA 3GFIA 3TW6A 2X1CA 1E3OC 3I54A 3KFWX 2LY1A 4YFKF 3GTJJ 2QSGX 1RI7A 1SAUA 3BR5A 2EZKA 2LH9A 4Y52J 4U7DA 5L3BA 3H9QA 1BI2A 3K70C 4KIGA 2KRCA 2PG4A 3OOPA 5B66C 3TL4X 1P7IA 3OL4A 3HRSA 5CPRB 5J40A 2FBIA 4UUSB 3GBGA 3OY9A 3MKLA 2CS3A 4FT8A 4IRIA 2DA5A 1TWFJ 3FXQA 3BG3A 5HS9A 2F6CA 3ECOA 4HNVA 3TP0A 4DW6A 4EJVA 3JSPA 1S7AA 1D3YA 5JFRA 1HA8A 1X3ZB 3QU3A 1K4SA 3V4GA 4B43A 1RR8C 3S1QJ 1D1BA 3K0LA 3B02A 3BTIA 2DO7A 2VASA 1JKRC 2FSWA 3CCUI 1HKSA 1VQ9I 1MH4A 3HOVJ 3KETA 2E1MC 3A4CA 1S5LC 5KHDA 1PUFB 3DPTA 4LFUA 5HNHA 5JHFA 1IV6A 2DOFA 4M72A 4S0HB 5DD4A 5KAFC 5EZGA 1FOYA 4G7ZF 3LSGA 4PUSA 2LTPA 1X1BA 1NK2P 5CKTA 2RQQA 4E7SA 2EWNA 3M8EA 1LFBA 4RM2A 4GGGA 4EJWA 1XPXA 5IPAA 4DYRA 3ABMH 2CV2A 1FBQA 3IHUA 2P8TA 2DPUA 3E3VA 2DXIA 2ZMEB 4HX7A 4WK8F 4BHCA 4NC6A 5DV5A 3OR1C 2X85A 2HXIA 4OMYA 2Z3YA 2BW3B 4OAYA 4Q47A 2R5YA 1SFUA 5D5VB 1OQYA 3BY6A 1U9OA 3ECHA 3SYTA 2EIJH 1BR2A 2YUSA 1UCRA 4ZTFA 1Z0XA 2MBFA 3MKZA 1AKHA 2WAQN 1GT0C 1LQ1A 3GEZA 2M9HA 2O8KA 4CCKA 1J0RA 1D1CA 2L0KA 4YIIA 2IXSA 3CLQA 5JHUA 3KZIC 1DGWY 1NG6A 4GO1A 4F52A 3WGGA 1FP2A 1DPUA 3CDLA 2HDWA 4PJNA 3TO6A 2CGPA 3TOAA 2VJJA 4RS8A 3L1PA 1D0YA 3CCJI 1ERDA 2Z1DA 4GRIA 5IT9Z 1MD0A 3OYHA 4PFOA 4HF0A 5CVVA 1C0WA 3S14J 2E7XA 1QZYA 3WTSC 1EJ9A 5HVQC 1Y0NA 2NRAC 3K4JA 1IDZA 1I3AA 1XMXA 1MNMC 2JSCA 4FQGA 1AU7A 3BCAA 2OAZA 3BTJA 1MJBA 2XIGA 1Z6TA 1GUUA 1RUOA 2EILH 1I6HJ 4HOBA 3CJTB 4OIPF 4ZYEA 3M3YJ 3P9KA 2R7QA 2WV0A 3HOYJ 2DFEA 2VPRA 1VNDA 4RGSA 3CCEI 4GYGA 4QLCU 2DJNA 2H1LA 3K2ZA 5D5WB 3M8JA 4LK0F 4A0XA 1I6XA 3ELKA 2WB1N 4AM3A 3I4NJ 1YYVA 1TW2A 1RRJA 2ID6A 2ELKA 4JX6A 3G3ZA 3ZOBA 1WKMA 2LKXA 3IWZA 5FLVA 3S8PA 3W2WA 3S15J 4V19K 4EGZA 4A3EJ 2R5ZA 5J1YA 3ERMA 4XQFA 2ZC2A 2Z33A 4YRVA 3SFZA 3IP4B 3A0HC 4S04A 1ZGJA 4XKVA 4A0ZA 1YJWI 2E2JJ 2GBYA 2XC7A 2E1OA 3GFJA 1RESA 3IH2A 4RM3A 2M0CA 4BHPA 3JAMK 3L2UA 1TQPA 2PJRA 2FMLA 1FMVA 2FJ1A 3QPLA 1OKRA 1Z9CA 3CJNA 4F91B 1JGSA 5CVJA 2K02A 4DYQA 4W1UA 5CQEA 4B48A 2L7FP 4HV5A 1H8AC 1V5EA 1AHDP 3NWTA 4J19A 1AOYA 4M3BA 5E20A 4JK1X 3TO7A 4UHTA 3PIPF 2STWA 3CUQB 4QSHA 2EIMH 1LVAA 2E36A 2HU9A 2K3FA 2BXZA 3ZQIA 2CUZA 1DPRA 2HKOA 3CC2I 2PEXA 4BS9A 4C3IJ 5EYRA 4UVAA 2MSYA 4LMYA 3FKJA 5J47A 2K9LA 1O4XA 1MDMA 1POGA 1IN7A 3FF5A 3HC7A 1R7JA 5M5YJ 3QOPA 1OCRH 2YS9A 2F4IA 4A3MJ 5HS7A 5FKNA 4PFPA 2HYJA 1SD4A 2ZMEC 3MZ8A 3SJMA 1FNNA 3F8CA 3HZJA 3WTUC 3LAPA 1B8IA 3IL2A 4AU7A 1MSEC 1X4PA 3E6BA 5KCMA 5A2QZ 1LE8A 2VC0A 4ENNA 2IJLA 1K79A 2PFBA 1E2XA 4L0ZB 1FIAA 4KISA 2E60A 4GXOA 1IGNA 4J01A 4KN4X 3SZTA 3S1NJ 4EEFG 1LEAA 2ESHA 5DCMB 3KEQA 1Z77A 2GAUA 3VB2A 3JR9A 2P5LC 4IX7A 2QSHX 3OOUA 2KISA 3KEYA 2DAOA 1ZR2A 4CDGA 3CF2A 3CF5F 2V1UA 1NG7A 4BBRJ 1F1ZA 1FJLA 3R60A 5GADJ 5ILUA 4XN3A 4KDPA 4EJOA 3FKIJ 3SFIA 5LGUA 5DUIA 3AG1H 2V9VA 1BR1A 3HIFA 3FXOA 2P6TA 3RQIA 1VQ8I 1Z1DA 3I0TA 5FD6A 1PDNC 2DJIA 3KYCB 2NVXJ 2R7OA 4M73A 5K7ZA 3WTTC 3C2BA 2Y31A 5LHHA 2R7SA 3ZMDA 2L9RA 2A6TA 1QRYA 2M30A 1DQUA 3K4MA 2F5EA 2CQQA 3WU1B 3CO7C 3EQLF 3DV8A 4JX4A 4AWXB 4BUPA 1HC8A 3JRGA 3O6BB 4HX4A 2ZNYA 2L01A 1RPWA 2L5QA 2Z99A 1P4XA 3ESWB 3L2CA 3FXUA 4CYCB 3GXOA 3S2HJ 4MTEA 3N4MA 3COAC 1ZRCA 2EH3A 1TQIA 3I55I 1FIPA 1VQPI 2KPMA 2DQRA 1I50J 1BI0A 4NC7A 5EGOA 3C1DA 4FISA 2XGDA 4JQFA 4EATA 1VI0A 2ID3A 4MFEA 4UV8A 2V6CA 2ZSHB 1Z91A 3OYEA 3QQAA 2HDDA 1KYWA 4UNOA 4KNYA 2E19A 4FE4A 5EG0A 4IOAF 2R7XA 1XN7A 3HYIA 2CW0F 1QO0D 4B47A 2NOGA 4DZPA 1J7KA 1V4RA 4KMUX 2H6CA 5ILSA 4GFBA 1BC8C 3Q9VA 4NNJA 1G3WA 4OMZA 1JE8A 2MYSA 5D6EA 2RC4A 3V8KA 4BY1J 3GTPJ 3CD6I 2M8GX 1Y8RB 2EZLA 3R4KA 3S93A 1LDKB 3C2HA 2MD0A 4M9ZA 3RKXA 1YS6A 3TKYA 4I98B 3KP5A 2MA3A 1FBUA 2KZGA 2FRHA 3L9FA 3ZQFA 5E3NA 2DCEA 4UUVA 3K9TA 3EUAA 3KP7A 3OR2C 1BIBA 1OISA 3FXKA 3SDBA 3RDIA 2HVQA 1H88C 1BJZA 1ZGAA 5J8CA 3LSRA 3MKWB 1QA6A 4Y13A 4PJ0C 4BXXJ 2LFBA 3FXLA 2LK2A 1I39A 1D1AA 2P81A 2OZ6A 4F7ZA 5LHGA 4HNUA 3NAUA 2E35A 3HGGA 3OYBA 3ZMUA 3KCCA 1SVLA 2NNNA 5LRRA 5BQTA 1QPMA 1JUMA 2MLKA 1ZREA 2MC4A 4PGGA 3AG3H 3G6EI 3BPXA 3DXJF 4IHSA 3OS2A 4B1RA 5DYMA 1QHGA 3G1OA 1K78A 5FGMA 4N4NB 1RR7A 1FYMA 1XMKA 3CCMI 1WJBA 4NC8A 3PM1A 2GA1A 3GLLA 2BY0A 2XRLA 4BEHA 1FYKA 2VOOA 4LB5A 2IS1A 2VT2A 4XLHA 3GTGJ 3QOEA 3JRCA 1SEUA 4UB8C 2QVOA 3RQ4A 4XOPA 2X4HA 1AKHB 2K40A 4ASNA 5GTIC 1Z7LA 5E17F 4IXAA 3WE3A 2PMUA 1ON1A 1BBYA 5F6FA 1WCMJ 3W2VA 1ETWA 2EFWA 1FOXA 3K2AA 3U2RA 1BM9A 2JZYA 2HYFA 1U78A 2VKVA 1ZN2A 4LB6B 3F8NA 4BACA 2RNGA 2EB7A 3BP8A 3LSHA 2G7HA 3DP7A 2ZBKA 4D5FA 5FLXK 3FX3A 3O8HA 9ANTA 3OYGA 4RB0A 2JQ7A 1YJ9I 4E4HA 4XRMA 2IP2A 2X1EA 3LQQA 5C44J 5CQGA 5CVRA 1N25A 3AG2H 3CJQB 2ME6A 2MD5A 3ABKH 1XDSA 5FFXA 2XUBA 4HQMA 4BQOA 2R7UA 3A01A 1G8XA 2LR8A 4L18B 3UR3C 1O3QA 5B1BH 3OL3A 1W36D 1ITYA 1BA5A 4AVPA 2OQRA 3BDDA 5CVIA 3BT9A 1IUFA 1EKEA 2M7BA 1R4MB 1IAWA 5LEKA 3M7GA 3I56I 4LJZF 4BY7J 2ZB9A 1IXCA 4ZDLA 2QM3A 1FSHA 2W1OA 4HLYA 4TV7A 3EPZA 4AIHA 3ABUA 3PUBA 1HQCA 3C2GA 2CWEA 2R5ZB 3O3KA 3ZN1A 1MBEA 2EFNA 2R7FA 2R7RA 1FYLA 2WC2A 1IRFA 1J59A 3SEQA 2LY2A 3ML6A 3TBIA 1W0UA 2OA4A 4Q48A 1Y8QB 4ZDPA 4I7HA 3C18A 5BMZA 2PI0A 1WGXA 1XCVA 1TWAJ 5C4JJ 5BOXA 1I1GA 1MBGA 2HQ5A 2O0YA 3BLYA 3HOUJ 4IQJA 3JRBA 4C30A 3BCBA 3WG9A 5HLIA 4M71A 2R7VA 1GHCA 2DMNA 1IG7A 2DFHA 4E70A 2COMA 2JT1A 3BG5A 2PJRB 3BG7A 4DOZA 1GLNA 2LREA 2R7ZJ 2XASA 5M3FJ 5F1JA 2DT6A 2JA2A 2EBIA 4N0BA 2LP0A 2ZSIB 5DTDA 2CQ7A 3VFZA 1G2HA 3LSIA 4YIFA 5TJJA 2KMUA 5LHIA 3BROA 3OYDA 1IJWC 2VODA 4DZJA 2DYSH 4NB5A 3V42A 1LEBA 4ETSA 2XAJA 4B4CA 1P2FA 3WTYC 2HZTA 1VF9A 1PVEA 3K1MA 2HR3A 4KICA 3O2PE 4BJTA 1Z21A 2WB1A 3GFMA 1EH8A 3EDPA 5HOOA 3AKZA 1ZTRA 3J7ZI 3JSOA 1VQMI 2H8RA 2WADA 3IC7A 3HTSB 1VTNC 2NS7A 2VBWA 2ELHA 5CVUA 1ZH5A 3QWLA 2O3FA 4M9SA 1MDMB 1NK3P 2PBIA 2UWMA 2ICWG 2KIQA 2RDPA 2NAZA 2OPTA 4YG2F 1WH5A 2P7CB 5FLMJ 1ON2A 3JREA 3QAHA 4B09A 4HV6A 4U88A 1X1AA 1Z3YA 2XKPA 3QYEA 1B8IB 3D5LA 1WHUA 3BR6A 4I2OA 3MN2A 1LE8B 2L2OA 4P5OA 4YFNF 1OCPA 2UZKA 2DOAA 4CZZA 1ZQ3P 4IHXA 3FHZA 2GXBA 2D1VA 1U9NA 2FQ3A 4D1QA 5L3GA 3F8MA 4KT5C 2VQGA 3NARA 3H36A 3B6AA 1RUNA 3B73A 4BGDA 1P7JA 2DK5A 5ICGA 3F0CA 3ASNH 2IEKA 3M9AA 2JA8J 1OLTA 5LFAA 2IRFG 3H1CA 3LA7A 1USSA 2CJJA 3QPSA 3JAMZ 1KGSA 5EEAA 3E1SA 2CV0A 2K4BA 5DUKA 2RN7A 2B7EA 3N97A 1I5ZA 2DBBA 2QZ8A 1UHWA 1IZ1A 1ACIA 1MNDA 3KP4A 3K4LA 4FASD 2HI3A 3CDIA 3F72A 1E0EA 1U5TC 5FKMA 2FBHA 2V9PA 3I4MJ 4ZYAA 3ZR8X 1MIJA 1ZKGA 1QPIA 1LFUP 3ZQQA 4LD5A 4XBFA 1PUEE 3GZ6A 1IDYA 5BPDA 2MG4A 4RLQA 5GTHC 3U1KA 1HDDC 3OYFA 1XB4A 3F8FA 2XAGA 4RGUA 3S2WA 4V2FA 1JTXA 1X2NA 4KN7X 2G7UA 4ITVA 1MW7A 2XROA 1IRZA 4CUGA 4AVZA 3S17J 2XB5A 1Y1WJ 4A93J 3K4KA 4U87A 5EGOB 1ZRDA 3TDUC 3A0BC 5E8GA 1XGSA 2CFOA 4X0GA 4F55A 3IRRA 3T8RA 3RZOJ 4B3XA 4LIVA 4MO7A 1N75A 2QKMB 2QKLB 2VI6A 4D9JA 5EG0B 2OJED 5F0HA 1YI2I 4KITB 3K10A 2R93J 1W7PD 2C6YA 2DOEA 2VBXA 3DTKA 4CCOA 3HOWJ 3U21A 2DA6A 2M4KA 2CSOA 1NTCA 2LG4A 1YRNA 1QQIA 2MLGA 2V26A 2K3PA 4S05A 2E1NA 4M3FA 3HXLA 2O8XA 1JTYA 1WRJA 4BAYA 4P9UA 4PZJA 3SXYA 4HDVA 1ETYA 3Q0UA 4PJJA 3F3XA 3A03A 5KVRA 1TWHJ 4NHJA 2DT7B 2IS2A 1ZGWA 4ZZLA 2MGQA 4KIFA 2VJ4A 1SFKA 3PQKA 5GAHJ 1KU9A 4QTRA 3L2VA 3WE2A 3TW7A 3C3WA 3JRIA 4A6EA 3OMYA 1BL0A 2OC6A 2RQPA 4GCVA 2J5OA 3P7NA 2IGMA 2R7WA 3HOXJ 3BJ6A 2E34A 2QBYB 3PSFA 3VPRA 3OIOA 2GOXB 2XGCA 4CXFA 2FBKA 1K6YA 3CMAI 2BY1A 4DQ2A 2IVMA 2VBZA 1HXDA 1U2WA 1UZCA 1JXSA 3I71A 2PMHA 4B44A 1W5SA 4A6DA 4IPAA 4HW0A 1ENHA 1G4DA 3LSPA 5J1UA 5EF6A 3RPUD 4Y17A 3WODF 2B63J 4FTHA 3DKXA 1BR4A 1EH7A 4M3DA 2FNAA 5H6QA 5HODA 4RB3C 4IHWA 2FXAA 1XMAA 2QQ9A 1X1PA 1RIOH 2W85A 3RCOA 5LEJA 3RKYA 2LY9A 3FK6A 5CJ9A 1HDPA 1MBFA 4ANJA 1G59A 4I99C 2W48A 5GAEJ 2RNJA 4D5CA 1K61A 1CGPA 5AIQA 4EGYA 3JRDA 3ABLH 2VXZA 1HSTA 1YW7A 4XN0A 3VYRB 1WH7A 2P6SA 2L9VA 3Q9SA 5H2FC 1X19A 4L5EA 3ZMSA 2I5UA 2FOKA 2LNBA 4ESJA 2KJCA 2ZJ2A 4KMFA 3GTOJ 1SANA 5JVTA 1MKMA 4XSXF 3PNVA 4C2MJ 3CMYA 2QENA 1YTYA 1XC5A 3FXMA 4UUTA 4CCJA 4YELA 3VSLA 2YSRA 4CZCA 2H6BA 3HHHA 3GVAA 3A01B 2M3AA 3JTGA 4L0YB 3OV8A 4JBAA 5DS9A 1FT9A 4CCLA 3ZP5A 2X0LA 2KP6A 4ON0A 2DLLA 3UKGA 2R3SA 4XLFA 4CHUA 1IW7F 2DMPA 2QF7A 2ZXIA 3WTZA 4IF4A 4XORA 3BG6A 2B9SA 3MFKA 5D5XB 5ICFA 1BW6A 2L3DA 2M8EA 4AYBA 3LFUA 3JCUC 4L5JA 1VQNI 3DCFA 2Y2ZA 1KONA 2XGEA 3DQVC 1MH3A 2CW7A 2PJPA 3IH4A 2F5VA 2IGOA 2M5WA 2R4GA 4PSXA 3RKWA 1SFXA 5HLTA 4KA4A 2PMZN 3EETA 2H94A 3CMMA 1QNTA 2JK3A 1WZ2A 3CP8A 5K7FA 5EJCA 3F22A 3HRMA 4MGRA 4JX5A 4XKWA 4U0VA 4F92B 2OTLI 3WTWC 2BEOA 4PSWA 2AXTC 5J4VA 2DA2A 3CCSI 2DU9A 3W3CA 4RLFA 3J80K 1HKTA 3BWGA 4FCYA 3HOTA 2ZO4A 3ASOH 2LD5A 1YW8A 1Y6IA 3K69A 5FLXZ 2QLZA 2ZFUA 4BH9A 4HSRA 3OYKA 1ZK8A 1R6RA 1X3WB 1XGMA 2QWWA 3B6CA 4KT6A 3PJRA 2D5VA 1WI9A 3SHFA 3FZVA 4IZZA 5TRDA 4KYWA 2BVMA 1WPKA 1P4AA 2OBPA 2RVCA 3MKYB 1W7PA 2F5CA 4PJMA 4EM2A 1UELB 1VQ5I 3S2DJ 2IS4A 5J8FA 1USTA 4PCQA 4EQQA 3CCYA 1ZAOA 2DTRA 5DM6F 4RGRA 3RTRA 2E5NA 2W57A 4A5NA 5B5EC 1WJ5A 3BJAA 2MFZA 2WWYA 2BHZA 3ZPLA 3P5JA 4EJTA 5F08A 3D5SC 3JRFA 2W84A 2HOTA 1EF4A 4OOIA 1BOAA 3AFHA 5KAIC 1JJ8C 3A02A 4L9JA 4R79A 4BE1A 4EMSA 4I0AA 1MBHA 2DQLA 4IL6C 5DEQA 4AIDA 2V6EA 2BYVE 1JKOC 4EM1A 2F48A 4F93B 2BVLA 2W00A 5GPCA 5LD2C 1UHMA 5ICEA 2FUG2 4AD9A 2CH0A 4ENJA 1YJNI 2XB0X 1A31A 2HVSA 4XKBA 1T98A 2NNYA 2E2HJ 2CW8A 1FWZA 1P9QC 1G3YA 5TGTA 1WWXA 2EPFA 1GV2A 1ZR4A 4IQ4A 3HSRA 3T0YA 1HKQA 1JT0A 2VJ5A 3CZ6A 3I3LA 3KPHA 3TMOA 5E79C 2ELJA 2G9WA 2O7OA 3HGYA 1JI8A 2EV5A 4N9IA 3RIRA 4HF1A 3HRTA 3VYTB 3I4PA 3FBNB 1TNSA 2X6YA 2W7NA 3ZMTA 3BQYA 1ZG1A 1MBKA 5K1YA 2Z9OA 1V54H 4A0YA 3PO3J 3VDXA 4ABZA 2NS0A 3NRVA 2HQRA 5AONA 4X6AJ 3GLXA 1AWCA 3P9IA 2JTVA 3RPUA 2QQ8A 2VUMJ 2JRMA 2JA6J 5EZHA 4FE7A 3SEZA 1O7FA 1U3EM 3HL2A 4BNCA 1STZA 2DFFA 2VJIA 4G7HF 4E7HA 3CC4I 2CV1A 2XF7A 5IYDJ 1OCTC 3BTCA 2GZWA 3LNQA 3E5QA 1WJCA 3WU0A 1X3UA 3DLAA 3GUDA 3V7SA 3RKQA 4G6DA 4E7IA 4DBQA 4QPQA 4UXNA 3KE2A 1ETKA 3LSKA 5J1RA 1YQAA 2EIKH 4MQVA 5HLHA 2WAEA 3IAM2 1IN8A 3BG9A 2L4AA 2LMDA 1TQMA 3QP5A 2Q1ZB 2M34A 3DTIA 1I27A 3WTXC 4E7KA 4DIQA 1KYZA 4BQQA 5FB2A 3CUOA 4A3FJ 2XPVA 2EJRA 1D0XA 1P4WA 4RAYA 5DD8A 2VKHA 3Q5FA 3CCRI 3ZQ7A 2Y0SA 4LLGF 4A2UA 1F43A 2LKPA 4GDFA 4UVCA 1RC9A 1XGOA 3GZNB 2PQ8A 1LDDA 3L09A 5E8IA 4P9FA 4L9TA 3DBHB 4NQWA 3R6SA 2NOJB 2Y30A 4HX8A 1PP7U 2WTEA 4RMNA 4BJ6C 1YRNB 2JJ7A 1KA8A 4CCNA 1NH3A 2P7VB 2I10A 5J6XA 1X1DA 1Q1HA 2A69F 3F6OA 4WXHA 5IY5H 2ME0A 3FBIB 1W0TA 1ZG3A 3BR2A 4EJUA 3I9V2 1FPQA 2HOAA 3BQZA 3DBLB 3H9JA 4AUXA 3CUQC 1REPC 2A5YB 4I01A 3MZHA 3PIOF 1Y0UA 4G6TB 5IT3A 3T5XA 4XRSA 3J81K 1I3QJ 5ED4A 4MHGA 1Z05A 4JOMA 2F5FA 2JSPA 5DDGA 3LOCA 2FD5A 2Y0MA 2X9DA 1HSJA 1T38A 5ILVA 1V3FA 5E1XA 3LAJA 2L9NA 2VE9A 1ZG5A 2PLYA 1BIAA 1R23A 2L7ZA 5BNGA 3NEUA 4M6YA 3LSTA 3M1CA 4PDKA 2QSFX 4XK4A 4A12A 2K9QA 2YU3A 4I6ZA 1DU0A 2R5YB 1PYVA 4EV0A 2HPIA 1OR7A 3DLLF 4MNUA 1B9MA 2FEZA 3PSIA 4LOCA 5EEHA 2XHKA 1TT5B 3DKYA 3H9GA 3UNGC 3ULQB 4AYBN 2L7MP 1S29A 2VE8A 1O3SA 2K7LA 1BC7C 1X58A 1UMQA 1D8KA 1ZARA 4IKFA 1WJEA 2HTJA 3FMQA 1UAAA 4CYDA 4CGZA 4D7NA 3QPTA 1UG0A 2A3SA 6PAXA 1R1TA 3FM3A 3IH3A 2DDBA 1YOVB 3JW4A 1S6LA 2HNHA 4UY8I 3AL0B 2BW3A 2VB6A 2XV4S 2KKOA 1OCZH 4ENKA 1IN5A 4QIWN 1LPQA 3HKZA 2VL8A 1TW3A 3LSMA 5H6RA 2R92J 2KQRA 3ONQA 1XD7A 3OSGA 4BDZA 1G3TA 3EYIA 2Q0OA 2XAQA 3OWTA 1W5CC 3CTAA 2ISZA 5FO5A 4A3BJ 1LKXA 2F5DA 3KIOA 4W97A 3K4CA 2H27A 4H0EA 3HEFA 2F2EA 3O8GA 5C3EJ 3PFIA 1FC3A 2IA2A 1R5ID 2FU4A 1IXSB 3E5XA 4G12A 1QVUA 2CU7A 1UHSA 1YITI 3G73A 2D45A 3PUFA 2VC1A 2VOPA 4WX9A 2NYXA 3QPHA 3DF8A 4I09A 4HYEA 5FKLA 2VQLA 2GXGA 2DA4A 3OYNA 2CFXA 4M6VA 1BOBA 3CCVI 1W36C 3LMMA 3VODA 4ZJZA 1IC8A 1IRXA 4UVBA 2D1HA 2QCOA 5F0CA 2Y9YA 1YHQI 1BW5A 1SVOA 1FOWA 3HJEA 1X2MA 2ZXWH 3HPHA 1APLC 3HOSA 5F64A 1XS9A 2H1KA 4C9YA 3WGIA 2A05A 4LITA 1TZLA 4RA2A 1B4AA 1ETQA 3DBRB 3TEDA 1RZ4A 1QBJA 2EK5A 3HRUA 4OAZA 2KIFA 3H92A 2ZFWA 2UXNA 3MZYA 2XAFA 5E3MA 1TP4A 3SQNA 2H09A 5C4XJ 3MVPA 3G71I 4ZZDA 3W6VA 3GTKJ 4DNCA 1W7PB 4BXUA 3X2QH 3BC8A 2O9LA 5EDNA 3QP6A 3LL7A 5H20A 1XGNA 4Z6YA 3EUHA 2KIMA 1R00A 2BGCA 5FKOA 3HUGA 4CA0A 3REOA 2VBYA 4YEJA 3M8FA 4ZYGA 2AS5F 3CESA 3IKVA 4LK1F 2PMZA 2GA2A 1S8NA 5JLWA 1V55H 2A6EF 4MQ9F 3LA2A 4E7ZA 2X6OA 1SVMA 2HQAA 2W24A 3E7LA 3QU6A 4Y3OA 1XTAA 5IP7J 4RBOA 4BU2A 2K86A 2M7AA 4FETA 3FXJA 4HLXA 5F1RA 3OYIA 2ZJQF 2M0MA 2E1MB 2EV0A 3ABTA 3G4SI 3I64A 2OTJI 1IXRC 3A1YA 1ETXA 1TT0A 2FQ4A 2V1DA 3CCQI 3QYBA 3BPVA 5HDNA 2FX0A 4M9XA 2HWVA 2DDAA 3PO2J 3TGNA 1WQ2A 2R0QC 2XDVA 3HTUA 1T2KA 5IOYA 5LGNA 1ZYRF 3J80Z 2KFDA 3M4OJ 2DA1A 2JUCA 2ADUA 1YIOA 3IRQA 4O3MA 5J4YA 1UFMA 2K9NA 2Y0SN 2YX7A 1T08B 1S7EA 2O5RA 2KDZA 1AA7A 3I59A 1R5GA 3S1MJ 1RETA 1JKPC 2IGNA 4RGXA 2HS5A 1WI3A 3DKWA 3M1EA 4NDLA 1N77A 4WXDA 3V7RA 2AO9A 2LF8A 4I02A 5DCMA 2EZHA 1MZBA 5K7HA 3RZDJ 2VKEA 3OSFA 2BOLA 3IWFA 2HOSA 3MD2A 1Y56A 3TO9A 1OYYA 3JTHA 4XLEA 3F23A 2OQGA 3KEOA 2H8WA 1XG1A 1EV7A 4NBQA
chains in the Genus database with same CATH topology
3LWFA 2FMYA 2M87A 2DI3A 1BJAA 4KIBA 4BYYA 5ERIA 1OYWA 2MC3A 3FXRA 2ESNA 1SD5A 2ETHA 2P5KA 4FHTA 3ZMZA 1OMIA 3FMSA 3R0AA 1H9GA 3GF2A 3L00A 5K5OA 5BPIA 4LG0A 2BE5F 3MQ0A 1T6SA 1HW5A 3FWEA 3W6KB 2QYOA 2O61A 5L3FA 1BN5A 4HZFA 3KP6A 2Q8KA 4XSZF 2OU2A 3AAFA 2A68F 2HFHA 3E6MA 3R0JA 2AXLA 1FSEA 5AIPA 2V1XA 1H9TA 2ZKZA 1FZPB 3BJOA 3RJPA 2XGXA 5HDKA 3DEUA 1J75A 3BOQA 4HQEA 5D8KB 2J5PA 1LB2A 1IN6A 2Z5UA 3TDZC 3U1DA 3U9GA 2YR2A 1K78B 5LRSA 4ZYDA 4A5MA 3E5UA 4HAMA 2L54A 4XLPF 1T0FA 2IA0A 1XSVA 3T8TA 3TOBA 3V7CA 2UXXA 3GYHX 2LDUA 4L9VA 4XLNF 3J7AO 5DCFA 4G7OF 4CICA 3WGHA 5E1WA 4ZYHA 2DW4A 3J81Z 2DPDA 1HBXG 2QQAA 2OZUA 1MJAA 4BHBA 2PN6A 1GXPA 2ACJA 1MGTA 1PP8F 2A07F 3K1PA 3SZPA 4M74A 4AIJA 3MWMA 5D8LB 1U5TA 4G6QA 1SMTA 2IW5A 3ERED 3I58A 1O3TA 1FX7A 2B0LA 2XAHA 4ESBA 3F8BA 1A04A 4HDUA 4R8HA 4K2EA 5K5QA 1ULYA 2XRNA 1LJ9A 2TDXA 1LNWA 2ZCWA 1DP7P 2O03A 1G3SA 1P92A 1HW2A 2XKOA 3KZYA 1R22A 4IVNA 2KIUA 1KU3A 1R36A 5KK1A 3RI4A 1SFEA 1YO5C 2V79A 4HF2A 3E6DA 5D5UB 3P9CA 1ODDA 3H3ZA 2GWRA 1YS7A 4O6JA 4RAZA 1IRGA 2GIVA 2IT0A 1J5YA 2Y48A 4EM0B 2L02A 1DUXC 4Z2YA 2IPQX 4XRFA 1P6RA 2EV6A 4LLNA 1SAXA 1FY7A 4IRHA 1UB9A 3E97A 1L3LA 4QWQA 1QGPA 4I0BA 4ZH4F 2D2WA 2YPRA 3ZN0A 2Q2EA 3ROUA 1CF7A 3FM5A 4P55A 2DT5A 4GYIA 2E7WA 4KFCA 1OPCA 3I59B 2O6GE 4G8XA 2RV8A 1XCBA 3TQNA 2ZNZA 4PGHA 4Q4ZF 2JPBA 2EFOA 3C7JA 1MJ9A 5HS8A 3LA3A 1FP1D 2W25A 3GO5A 2MH9A 3QRFF 4M6XA 3CO6C 3EYYA 4OIOF 3D0SA 5HDGA 1U6GA 3ISPA 1B9NA 3HSEA 1Z6RA 3F6VA 3KP3A 1KQ0A 1RNLA 1LDJA 4LG0B 1G6NA 4HA8A 3HSFA 1TLHB 1U8RA 1B6AA 3E6CC 4UV9A 2GQQA 1Z7UA 1NHAA 5L3DA 1KQ8A 2L4MA 1EH6A 4AIKA 1K7AA 2DFIA 5LBQA 4BQAA 3L7WA 3GZ5A 3GW2A 4L9NA 1SD6A 1TBXA 2HKXA 4FX0A 1KU7A 1O7LA 2RKHA 1ZRFA 1YLFA 4ESFA 5E18F 2EFPA 5BS6A 2STTA 3GWZA 5K5RA 4OIRF 3RPQA 4Y15A 5IT9K 4MEYF 2QUFA 2EFQA 1BI1A 2MH2A 1IN4A 3KP2A 4B8XA 3FMRA 1GXQA 4LLLA 2HTSA 4MEXF 5JR3A 4D0PA 2QBYA 4MTDA 1XSDA 1WSUA 1YW9A 1JHFA 2HYGD 1F4KA 4LGWA 1H0MA 2XVCA 3MAJA 3RYRA 4FX4A 2ZMEA 4R1HA 1HW1A 2BBYA 2RGVA 5D6FA 1D5VA 1FOKA 2FA5A 1I1SA 4RB1A 2VN2A 1YG2A 2ISYA 3W6JB 2CG4A 3K1NA 2FE3A 2P4WA 1J2XA 2LF7A 4KUMA 1E17A 2K27A 4YFXF 3F21A 1D8JA 1W5TA 1BI3A 2ZXJA 5CYVA 2VT3A 2DK8A 2CQKA 1U5TB 1YFHA 1T39A 1R58A 3LQRA 1FLIA 1IUYA 4OIQF 2A6HF 1F9NA 4G94A 1GVJA 1ZLKA 2K4JA 5HLGA 3GX4X 2M1BA 1TNTA 2FF4A 3I53A 1XSXA 3GFLA 3WTVC 4EVIA 3CLOA 3V8JA 4L5IA 5CLSA 1SD7A 5ICCA 5A2QK 2IA1A 4CO8A 2A61A 5L3CA 1FBSA 4WXCA 1DDNA 3RYPA 1TTYA 3R61A 5LLQA 5EEGA 2JPCA 4ENMA 2CO5A 4IRGA 1R1UA 2R7DA 3BZ6A 3NQOA 4U7BA 2BV6A 3KLNA 4WWCA 3PQJA 4WCGA 4IJAA 3MCZA 1OYIA 4HBLA 2OD5A 3DFGA 3V8LA 1S3JA 3CUQA 3DPLC 2FNPA 1SMYF 1O3RA 5D4RA 1IF1A 4U0YA 2YX4A 1KQ9A 1ZHFA 3LFKA 2KRFA 3I5UA 2EA2A 1ONVA 1F5TA 1CF7B 1XDUA 3KLOA 5E1ZB 2E1CA 1R5HA 3KZZA 4N9HA 4Q5SF 2CYYA 1J9IA 3CDHA 1O57A 1R1VA 2JRTA 5D4SA 5LGTA 2HQNA 1KU2A 4RB2C 2QQBA 3VOEA 1JHHA 3T1BA 3ZMVA 2M45A 2EA4A 1QZZA 3VEPA 1K6OA 4OU0A 3HHGA 2HEOA 1W4MA 4OINF 3MEXA 5JI6A 4IHTA 1L0OC 1S7OA 2VONA 5FD5A 4WF2A 2HGCA 2HOEA 3IKTA 4P96A 2LSOA 1B59A 2Y75A 5L3EA 1ZLJA 3H3UA 2KJBA 4U0WA 4G9YA 2HDCA 5FFZA 2P5VA 1B1BA 4O5VA 3GFIA 3I54A 3KFWX 4YFKF 1RI7A 4U7DA 5L3BA 1BI2A 4KIGA 2PG4A 3OOPA 3HRSA 2FBIA 4FT8A 4IRIA 3FXQA 5HS9A 3ECOA 4EJVA 3JSPA 1S7AA 1D3YA 5JFRA 3QU3A 3V4GA 3K0LA 3B02A 2DO7A 2FSWA 1HKSA 3KETA 3DPTA 4LFUA 4M72A 5DD4A 4G7ZF 2EWNA 3M8EA 4GGGA 4EJWA 1FBQA 3IHUA 2P8TA 2DPUA 3E3VA 2ZMEB 4HX7A 4WK8F 4BHCA 5DV5A 4OMYA 2Z3YA 1SFUA 4Q47A 5D5VB 3BY6A 3ECHA 1UCRA 2MBFA 1LQ1A 3GEZA 1J0RA 4YIIA 5JHUA 4GO1A 3WGGA 1FP2A 1DPUA 3TO6A 2CGPA 3TOAA 4RS8A 5IT9Z 1MD0A 4HF0A 5CVVA 1C0WA 2E7XA 1QZYA 3WTSC 5HVQC 2NRAC 2JSCA 2OAZA 1MJBA 2XIGA 1Z6TA 1RUOA 4HOBA 4OIPF 4ZYEA 3P9KA 2WV0A 4RGSA 4GYGA 4QLCU 3K2ZA 5D5WB 4LK0F 4A0XA 1I6XA 3ELKA 1YYVA 1TW2A 3G3ZA 1WKMA 3IWZA 4EGZA 2Z33A 3SFZA 4S04A 1ZGJA 4A0ZA 3GFJA 4BHPA 3JAMK 1TQPA 2FMLA 1OKRA 1Z9CA 3CJNA 1JGSA 5CVJA 2K02A 4HV5A 1AOYA 5E20A 3TO7A 4JK1X 4UHTA 2STWA 3CUQB 1LVAA 1DPRA 2HKOA 2PEXA 4UVAA 4LMYA 1MDMA 1IN7A 3FF5A 1R7JA 3QOPA 5HS7A 1SD4A 1FNNA 3F8CA 3WTUC 3LAPA 3IL2A 3E6BA 5A2QZ 2VC0A 4ENNA 2IJLA 1K79A 2PFBA 1E2XA 4L0ZB 4GXOA 4KN4X 3SZTA 1LEAA 2ESHA 5DCMB 3KEQA 3VB2A 2GAUA 2P5LC 2DAOA 4CDGA 2V1UA 1F1ZA 3R60A 5ILUA 4KDPA 4EJOA 5LGUA 5DUIA 2V9VA 3HIFA 2P6TA 1Z1DA 3I0TA 5FD6A 1PDNC 4M73A 3WTTC 5LHHA 3ZMDA 2M30A 2F5EA 3WU1B 3CO7C 3EQLF 3DV8A 4AWXB 3O6BB 4HX4A 2ZNYA 2L01A 2Z99A 1P4XA 3L2CA 3FXUA 3GXOA 4MTEA 3N4MA 3COAC 1ZRCA 1TQIA 2DQRA 1BI0A 3C1DA 4JQFA 4UV8A 2V6CA 1Z91A 1KYWA 4UNOA 4KNYA 1XN7A 3HYIA 2CW0F 1QO0D 1J7KA 1V4RA 4KMUX 2H6CA 5ILSA 1BC8C 3Q9VA 1G3WA 4OMZA 1JE8A 5D6EA 2RC4A 3V8KA 3R4KA 1LDKB 4M9ZA 3RKXA 1YS6A 3TKYA 4I98B 3KP5A 2MA3A 1FBUA 2FRHA 3L9FA 4UUVA 3K9TA 3KP7A 1BIBA 3RDIA 1ZGAA 5J8CA 4Y13A 2OZ6A 4F7ZA 5LHGA 3ZMUA 3KCCA 2NNNA 5LRRA 5BQTA 1QPMA 2MLKA 1ZREA 4PGGA 3BPXA 3DXJF 4IHSA 5DYMA 1K78A 5FGMA 1FYMA 1XMKA 2GA1A 1FYKA 2VOOA 4LB5A 2VT2A 2QVOA 2X4HA 4ASNA 5E17F 4IXAA 3WE3A 2PMUA 1ON1A 1BBYA 5F6FA 2EFWA 3U2RA 1BM9A 2JZYA 2HYFA 1U78A 1ZN2A 4LB6B 3F8NA 3BP8A 2EB7A 2G7HA 3DP7A 2ZBKA 5FLXK 3FX3A 4RB0A 2IP2A 3LQQA 5CVRA 2MD5A 1XDSA 5FFXA 2XUBA 4HQMA 4L18B 1O3QA 4AVPA 2OQRA 3BDDA 5CVIA 1IAWA 5LEKA 3M7GA 4LJZF 1IXCA 2QM3A 1FSHA 4HLYA 4TV7A 4AIHA 3ABUA 1HQCA 2CWEA 3O3KA 3ZN1A 2EFNA 2R7FA 1FYLA 2WC2A 1IRFA 1J59A 3ML6A 2OA4A 4Q48A 4I7HA 3C18A 5BMZA 2PI0A 1XCVA 5BOXA 1I1GA 2O0YA 3WG9A 5HLIA 4M71A 1GHCA 4E70A 2COMA 2JT1A 2XASA 4N0BA 3VFZA 5LHIA 4YIFA 5TJJA 3BROA 2VODA 4NB5A 1LEBA 4ETSA 2XAJA 1P2FA 3WTYC 2HZTA 4KICA 3K1MA 2HR3A 3O2PE 3GFMA 1EH8A 3EDPA 5HOOA 3JSOA 3HTSB 3IC7A 1VTNC 2VBWA 2ELHA 5CVUA 1ZH5A 4M9SA 2O3FA 1MDMB 2UWMA 2PBIA 2RDPA 2NAZA 4YG2F 2P7CB 1ON2A 3QAHA 4B09A 4HV6A 4U88A 2XKPA 3D5LA 4I2OA 4P5OA 4YFNF 2UZKA 4CZZA 2GXBA 3FHZA 2D1VA 2FQ3A 5L3GA 3F8MA 4KT5C 1RUNA 3B73A 2DK5A 5ICGA 3M9AA 2IRFG 3LA7A 1USSA 3JAMZ 1KGSA 2K4BA 5DUKA 2RN7A 3N97A 1I5ZA 2DBBA 2QZ8A 1UHWA 1IZ1A 3KP4A 3F72A 1U5TC 2FBHA 4LD5A 4XBFA 1PUEE 3GZ6A 5BPDA 1XB4A 3F8FA 2XAGA 4RGUA 3S2WA 4KN7X 2G7UA 2XROA 1ZRDA 3TDUC 5E8GA 1XGSA 3IRRA 3T8RA 1W7PD 2C6YA 2VBXA 2CSOA 1QQIA 2MLGA 4S05A 2E1NA 2O8XA 1WRJA 4BAYA 4P9UA 4PZJA 3SXYA 4HDVA 3F3XA 5KVRA 4NHJA 4ZZLA 4KIFA 3PQKA 1KU9A 3WE2A 3C3WA 4A6EA 2RQPA 4GCVA 2J5OA 3P7NA 3BJ6A 2QBYB 4CXFA 2FBKA 4DQ2A 2IVMA 2VBZA 1HXDA 1U2WA 1JXSA 3I71A 2PMHA 1W5SA 4A6DA 4IPAA 4HW0A 1G4DA 4Y17A 3WODF 1EH7A 5H6QA 2FNAA 4RB3C 2FXAA 1XMAA 2QQ9A 1RIOH 2W85A 5LEJA 3RKYA 5CJ9A 2RNJA 1CGPA 5AIQA 4EGYA 2VXZA 1HSTA 1YW7A 2P6SA 3Q9SA 3ZMSA 2FOKA 2LNBA 4ESJA 2KJCA 2ZJ2A 4KMFA 5JVTA 1MKMA 4XSXF 2QENA 1YTYA 2YSRA 2H6BA 3HHHA 3GVAA 3JTGA 4L0YB 3OV8A 4JBAA 1FT9A 3ZP5A 2X0LA 4CHUA 4ON0A 2DLLA 2R3SA 1IW7F 3WTZA 4IF4A 3MFKA 5D5XB 5ICFA 2L3DA 2M8EA 4L5JA 3DQVC 2PJPA 2M5WA 3RKWA 1SFXA 4KA4A 3EETA 2H94A 1QNTA 3F22A 3HRMA 4MGRA 4U0VA 3WTWC 2BEOA 2DU9A 3J80K 1HKTA 3BWGA 3HOTA 2ZO4A 1YW8A 3K69A 5FLXZ 2QLZA 4BH9A 2QWWA 1XGMA 1WI9A 3SHFA 3FZVA 5TRDA 4KYWA 1P4AA 2OBPA 2RVCA 1W7PA 2F5CA 4EM2A 5J8FA 1USTA 4PCQA 4EQQA 1ZAOA 2DTRA 4RGRA 3RTRA 2W57A 4A5NA 3BJAA 2WWYA 3ZPLA 4EJTA 2W84A 4OOIA 1BOAA 4L9JA 4R79A 4EMSA 4I0AA 5DEQA 2DQLA 2BYVE 4EM1A 1UHMA 5ICEA 4AD9A 4ENJA 1T98A 2NNYA 1FWZA 1G3YA 1WWXA 3T0YA 3HSRA 1HKQA 2G9WA 2EV5A 4N9IA 3RIRA 4HF1A 3HRTA 3I4PA 1TNSA 3ZMTA 1ZG1A 5K1YA 2Z9OA 4A0YA 2NS0A 3NRVA 2HQRA 5AONA 3GLXA 1AWCA 3P9IA 2JTVA 3RPUA 1O7FA 1U3EM 4BNCA 1STZA 4G7HF 2GZWA 3E5QA 3WU0A 1X3UA 3GUDA 3V7SA 4G6DA 4UXNA 3KE2A 1YQAA 5HLHA 4MQVA 1IN8A 2L4AA 3QP5A 1TQMA 1I27A 3WTXC 1KYZA 5FB2A 3CUOA 2EJRA 1P4WA 4RAYA 5DD8A 3Q5FA 3ZQ7A 4LLGF 4A2UA 2LKPA 4UVCA 1XGOA 3L09A 5E8IA 2PQ8A 1LDDA 4P9FA 4L9TA 4NQWA 3R6SA 4HX8A 1PP7U 2WTEA 1KA8A 2P7VB 5J6XA 1Q1HA 2A69F 3F6OA 4WXHA 1ZG3A 4EJUA 1FPQA 1REPC 3CUQC 2A5YB 4I01A 3MZHA 1Y0UA 5IT3A 3T5XA 3J81K 5ED4A 4MHGA 1Z05A 2F5FA 5DDGA 2Y0MA 1HSJA 1T38A 5ILVA 1V3FA 5E1XA 3LAJA 2VE9A 1ZG5A 2PLYA 1BIAA 1R23A 3NEUA 4M6YA 3LSTA 4PDKA 4A12A 2YU3A 4EV0A 1OR7A 4MNUA 1B9MA 2FEZA 5EEHA 2XHKA 3ULQB 1S29A 2VE8A 1O3SA 2K7LA 1BC7C 1D8KA 1ZARA 2HTJA 3FMQA 4CYDA 4CGZA 3QPTA 2A3SA 6PAXA 1R1TA 3FM3A 3JW4A 1S6LA 2XV4S 2KKOA 4ENKA 1IN5A 1TW3A 5H6RA 1XD7A 3EYIA 1G3TA 2Q0OA 2XAQA 3CTAA 2ISZA 5FO5A 2F5DA 2H27A 4H0EA 2F2EA 3PFIA 1FC3A 2IA2A 2FU4A 1IXSB 3E5XA 3G73A 2D45A 2VC1A 2VOPA 4WX9A 2NYXA 3QPHA 3DF8A 4I09A 4HYEA 2GXGA 2CFXA 3VODA 4UVBA 2D1HA 3HOSA 5F64A 3WGIA 1B4AA 1RZ4A 1QBJA 2EK5A 3HRUA 2KIFA 3H92A 2ZFWA 2UXNA 3MZYA 2XAFA 3SQNA 2H09A 4ZZDA 4DNCA 1W7PB 4BXUA 3QP6A 5H20A 1XGNA 3EUHA 2KIMA 1R00A 2BGCA 3HUGA 3REOA 2VBYA 4ZYGA 3M8FA 2AS5F 3IKVA 4LK1F 2GA2A 1S8NA 2A6EF 4MQ9F 3LA2A 2W24A 3QU6A 2K86A 4HLXA 5F1RA 2EV0A 3ABTA 3I64A 1IXRC 2V1DA 3BPVA 5HDNA 4M9XA 2HWVA 3TGNA 1WQ2A 3HTUA 1T2KA 5LGNA 1ZYRF 3J80Z 2ADUA 1YIOA 3IRQA 4O3MA 1UFMA 2YX7A 3I59A 1R5GA 4RGXA 2HS5A 3DKWA 3M1EA 4WXDA 3V7RA 2LF8A 4I02A 5DCMA 1MZBA 3IWFA 3TO9A 1OYYA 3JTHA 3F23A 2OQGA 3KEOA 1EV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWF A;  2FMY A;  2M87 A;  2DI3 A;  1BJA A;  4KIB A;  4BYY A;  5ERI A;  1OYW A;  2MC3 A;  3FXR A;  2ESN A;  1SD5 A;  2ETH A;  2P5K A;  4FHT A;  3ZMZ A;  1OMI A;  3FMS A;  3R0A A;  1H9G A;  3GF2 A;  3L00 A;  5K5O A;  5BPI A;  4LG0 A;  2BE5 F;  3MQ0 A;  1T6S A;  1HW5 A;  3FWE A;  3W6K B;  2QYO A;  2O61 A;  5L3F A;  1BN5 A;  4HZF A;  3KP6 A;  2Q8K A;  4XSZ F;  2OU2 A;  3AAF A;  2A68 F;  2HFH A;  3E6M A;  3R0J A;  2AXL A;  1FSE A;  5AIP A;  2V1X A;  1H9T A;  2ZKZ A;  1FZP B;  3BJO A;  3RJP A;  2XGX A;  5HDK A;  3DEU A;  1J75 A;  3BOQ A;  4HQE A;  5D8K B;  2J5P A;  1LB2 A;  1IN6 A;  2Z5U A;  3TDZ C;  3U1D A;  3U9G A;  2YR2 A;  1K78 B;  5LRS A;  4ZYD A;  4A5M A;  3E5U A;  4HAM A;  2L54 A;  4XLP F;  1T0F A;  2IA0 A;  1XSV A;  3T8T A;  3TOB A;  3V7C A;  2UXX A;  3GYH X;  2LDU A;  4L9V A;  4XLN F;  3J7A O;  5DCF A;  4G7O F;  4CIC A;  3WGH A;  5E1W A;  4ZYH A;  2DW4 A;  3J81 Z;  2DPD A;  1HBX G;  2QQA A;  2OZU A;  1MJA A;  4BHB A;  2PN6 A;  1GXP A;  2ACJ A;  1MGT A;  1PP8 F;  2A07 F;  3K1P A;  3SZP A;  4M74 A;  4AIJ A;  3MWM A;  5D8L B;  1U5T A;  4G6Q A;  1SMT A;  2IW5 A;  3ERE D;  3I58 A;  1O3T A;  1FX7 A;  2B0L A;  2XAH A;  4ESB A;  3F8B A;  1A04 A;  4HDU A;  4R8H A;  4K2E A;  5K5Q A;  1ULY A;  2XRN A;  1LJ9 A;  2TDX A;  1LNW A;  2ZCW A;  1DP7 P;  2O03 A;  1G3S A;  1P92 A;  1HW2 A;  2XKO A;  3KZY A;  1R22 A;  4IVN A;  2KIU A;  1KU3 A;  1R36 A;  5KK1 A;  3RI4 A;  1SFE A;  1YO5 C;  2V79 A;  4HF2 A;  3E6D A;  5D5U B;  3P9C A;  1ODD A;  3H3Z A;  2GWR A;  1YS7 A;  4O6J A;  4RAZ A;  1IRG A;  2GIV A;  2IT0 A;  1J5Y A;  2Y48 A;  4EM0 B;  2L02 A;  1DUX C;  4Z2Y A;  2IPQ X;  4XRF A;  1P6R A;  2EV6 A;  4LLN A;  1SAX A;  1FY7 A;  4IRH A;  1UB9 A;  3E97 A;  1L3L A;  4QWQ A;  1QGP A;  4I0B A;  4ZH4 F;  2D2W A;  2YPR A;  3ZN0 A;  2Q2E A;  3ROU A;  1CF7 A;  3FM5 A;  4P55 A;  2DT5 A;  4GYI A;  2E7W A;  4KFC A;  1OPC A;  3I59 B;  2O6G E;  4G8X A;  2RV8 A;  1XCB A;  3TQN A;  2ZNZ A;  4PGH A;  4Q4Z F;  2JPB A;  2EFO A;  3C7J A;  1MJ9 A;  5HS8 A;  3LA3 A;  1FP1 D;  2W25 A;  3GO5 A;  2MH9 A;  3QRF F;  4M6X A;  3CO6 C;  3EYY A;  4OIO F;  3D0S A;  5HDG A;  1U6G A;  3ISP A;  1B9N A;  3HSE A;  1Z6R A;  3F6V A;  3KP3 A;  1KQ0 A;  1RNL A;  1LDJ A;  4LG0 B;  1G6N A;  4HA8 A;  3HSF A;  1TLH B;  1U8R A;  1B6A A;  3E6C C;  4UV9 A;  2GQQ A;  1Z7U A;  1NHA A;  5L3D A;  1KQ8 A;  2L4M A;  1EH6 A;  4AIK A;  1K7A A;  2DFI A;  5LBQ A;  4BQA A;  3L7W A;  3GZ5 A;  3GW2 A;  4L9N A;  1SD6 A;  1TBX A;  2HKX A;  4FX0 A;  1KU7 A;  1O7L A;  2RKH A;  1ZRF A;  1YLF A;  4ESF A;  5E18 F;  2EFP A;  5BS6 A;  2STT A;  3GWZ A;  5K5R A;  4OIR F;  3RPQ A;  4Y15 A;  5IT9 K;  4MEY F;  2QUF A;  2EFQ A;  1BI1 A;  2MH2 A;  1IN4 A;  3KP2 A;  4B8X A;  3FMR A;  1GXQ A;  4LLL A;  2HTS A;  4MEX F;  5JR3 A;  4D0P A;  2QBY A;  4MTD A;  1XSD A;  1WSU A;  1YW9 A;  1JHF A;  2HYG D;  1F4K A;  4LGW A;  1H0M A;  2XVC A;  3MAJ A;  3RYR A;  4FX4 A;  2ZME A;  4R1H A;  1HW1 A;  2BBY A;  2RGV A;  5D6F A;  1D5V A;  1FOK A;  2FA5 A;  1I1S A;  4RB1 A;  2VN2 A;  1YG2 A;  2ISY A;  3W6J B;  2CG4 A;  3K1N A;  2FE3 A;  2P4W A;  1J2X A;  2LF7 A;  4KUM A;  1E17 A;  2K27 A;  4YFX F;  3F21 A;  1D8J A;  1W5T A;  1BI3 A;  2ZXJ A;  5CYV A;  2VT3 A;  2DK8 A;  2CQK A;  1U5T B;  1YFH A;  1T39 A;  1R58 A;  3LQR A;  1FLI A;  1IUY A;  4OIQ F;  2A6H F;  1F9N A;  4G94 A;  1GVJ A;  1ZLK A;  2K4J A;  5HLG A;  3GX4 X;  2M1B A;  1TNT A;  2FF4 A;  3I53 A;  1XSX A;  3GFL A;  3WTV C;  4EVI A;  3CLO A;  3V8J A;  4L5I A;  5CLS A;  1SD7 A;  5ICC A;  5A2Q K;  2IA1 A;  4CO8 A;  2A61 A;  5L3C A;  1FBS A;  4WXC A;  1DDN A;  3RYP A;  1TTY A;  3R61 A;  5LLQ A;  5EEG A;  2JPC A;  4ENM A;  2CO5 A;  4IRG A;  1R1U A;  2R7D A;  3BZ6 A;  3NQO A;  4U7B A;  2BV6 A;  3KLN A;  4WWC A;  3PQJ A;  4WCG A;  4IJA A;  3MCZ A;  1OYI A;  4HBL A;  2OD5 A;  3DFG A;  3V8L A;  1S3J A;  3CUQ A;  3DPL C;  2FNP A;  1SMY F;  1O3R A;  5D4R A;  1IF1 A;  4U0Y A;  2YX4 A;  1KQ9 A;  1ZHF A;  3LFK A;  2KRF A;  3I5U A;  2EA2 A;  1ONV A;  1F5T A;  1CF7 B;  1XDU A;  3KLO A;  5E1Z B;  2E1C A;  1R5H A;  3KZZ A;  4N9H A;  4Q5S F;  2CYY A;  1J9I A;  3CDH A;  1O57 A;  1R1V A;  2JRT A;  5D4S A;  5LGT A;  2HQN A;  1KU2 A;  4RB2 C;  2QQB A;  3VOE A;  1JHH A;  3T1B A;  3ZMV A;  2M45 A;  2EA4 A;  1QZZ A;  3VEP A;  1K6O A;  4OU0 A;  3HHG A;  2HEO A;  1W4M A;  4OIN F;  3MEX A;  5JI6 A;  4IHT A;  1L0O C;  1S7O A;  2VON A;  5FD5 A;  4WF2 A;  2HGC A;  2HOE A;  3IKT A;  4P96 A;  2LSO A;  1B59 A;  2Y75 A;  5L3E A;  1ZLJ A;  3H3U A;  2KJB A;  4U0W A;  4G9Y A;  2HDC A;  5FFZ A;  2P5V A;  1B1B A;  4O5V A;  3GFI A;  3I54 A;  3KFW X;  4YFK F;  1RI7 A;  4U7D A;  5L3B A;  1BI2 A;  4KIG A;  2PG4 A;  3OOP A;  3HRS A;  2FBI A;  4FT8 A;  4IRI A;  3FXQ A;  5HS9 A;  3ECO A;  4EJV A;  3JSP A;  1S7A A;  1D3Y A;  5JFR A;  3QU3 A;  3V4G A;  3K0L A;  3B02 A;  2DO7 A;  2FSW A;  1HKS A;  3KET A;  3DPT A;  4LFU A;  4M72 A;  5DD4 A;  4G7Z F;  2EWN A;  3M8E A;  4GGG A;  4EJW A;  1FBQ A;  3IHU A;  2P8T A;  2DPU A;  3E3V A;  2ZME B;  4HX7 A;  4WK8 F;  4BHC A;  5DV5 A;  4OMY A;  2Z3Y A;  1SFU A;  4Q47 A;  5D5V B;  3BY6 A;  3ECH A;  1UCR A;  2MBF A;  1LQ1 A;  3GEZ A;  1J0R A;  4YII A;  5JHU A;  4GO1 A;  3WGG A;  1FP2 A;  1DPU A;  3TO6 A;  2CGP A;  3TOA A;  4RS8 A;  5IT9 Z;  1MD0 A;  4HF0 A;  5CVV A;  1C0W A;  2E7X A;  1QZY A;  3WTS C;  5HVQ C;  2NRA C;  2JSC A;  2OAZ A;  1MJB A;  2XIG A;  1Z6T A;  1RUO A;  4HOB A;  4OIP F;  4ZYE A;  3P9K A;  2WV0 A;  4RGS A;  4GYG A;  4QLC U;  3K2Z A;  5D5W B;  4LK0 F;  4A0X A;  1I6X A;  3ELK A;  1YYV A;  1TW2 A;  3G3Z A;  1WKM A;  3IWZ A;  4EGZ A;  2Z33 A;  3SFZ A;  4S04 A;  1ZGJ A;  4A0Z A;  3GFJ A;  4BHP A;  3JAM K;  1TQP A;  2FML A;  1OKR A;  1Z9C A;  3CJN A;  1JGS A;  5CVJ A;  2K02 A;  4HV5 A;  1AOY A;  5E20 A;  3TO7 A;  4JK1 X;  4UHT A;  2STW A;  3CUQ B;  1LVA A;  1DPR A;  2HKO A;  2PEX A;  4UVA A;  4LMY A;  1MDM A;  1IN7 A;  3FF5 A;  1R7J A;  3QOP A;  5HS7 A;  1SD4 A;  1FNN A;  3F8C A;  3WTU C;  3LAP A;  3IL2 A;  3E6B A;  5A2Q Z;  2VC0 A;  4ENN A;  2IJL A;  1K79 A;  2PFB A;  1E2X A;  4L0Z B;  4GXO A;  4KN4 X;  3SZT A;  1LEA A;  2ESH A;  5DCM B;  3KEQ A;  3VB2 A;  2GAU A;  2P5L C;  2DAO A;  4CDG A;  2V1U A;  1F1Z A;  3R60 A;  5ILU A;  4KDP A;  4EJO A;  5LGU A;  5DUI A;  2V9V A;  3HIF A;  2P6T A;  1Z1D A;  3I0T A;  5FD6 A;  1PDN C;  4M73 A;  3WTT C;  5LHH A;  3ZMD A;  2M30 A;  2F5E A;  3WU1 B;  3CO7 C;  3EQL F;  3DV8 A;  4AWX B;  3O6B B;  4HX4 A;  2ZNY A;  2L01 A;  2Z99 A;  1P4X A;  3L2C A;  3FXU A;  3GXO A;  4MTE A;  3N4M A;  3COA C;  1ZRC A;  1TQI A;  2DQR A;  1BI0 A;  3C1D A;  4JQF A;  4UV8 A;  2V6C A;  1Z91 A;  1KYW A;  4UNO A;  4KNY A;  1XN7 A;  3HYI A;  2CW0 F;  1QO0 D;  1J7K A;  1V4R A;  4KMU X;  2H6C A;  5ILS A;  1BC8 C;  3Q9V A;  1G3W A;  4OMZ A;  1JE8 A;  5D6E A;  2RC4 A;  3V8K A;  3R4K A;  1LDK B;  4M9Z A;  3RKX A;  1YS6 A;  3TKY A;  4I98 B;  3KP5 A;  2MA3 A;  1FBU A;  2FRH A;  3L9F A;  4UUV A;  3K9T A;  3KP7 A;  1BIB A;  3RDI A;  1ZGA A;  5J8C A;  4Y13 A;  2OZ6 A;  4F7Z A;  5LHG A;  3ZMU A;  3KCC A;  2NNN A;  5LRR A;  5BQT A;  1QPM A;  2MLK A;  1ZRE A;  4PGG A;  3BPX A;  3DXJ F;  4IHS A;  5DYM A;  1K78 A;  5FGM A;  1FYM A;  1XMK A;  2GA1 A;  1FYK A;  2VOO A;  4LB5 A;  2VT2 A;  2QVO A;  2X4H A;  4ASN A;  5E17 F;  4IXA A;  3WE3 A;  2PMU A;  1ON1 A;  1BBY A;  5F6F A;  2EFW A;  3U2R A;  1BM9 A;  2JZY A;  2HYF A;  1U78 A;  1ZN2 A;  4LB6 B;  3F8N A;  3BP8 A;  2EB7 A;  2G7H A;  3DP7 A;  2ZBK A;  5FLX K;  3FX3 A;  4RB0 A;  2IP2 A;  3LQQ A;  5CVR A;  2MD5 A;  1XDS A;  5FFX A;  2XUB A;  4HQM A;  4L18 B;  1O3Q A;  4AVP A;  2OQR A;  3BDD A;  5CVI A;  1IAW A;  5LEK A;  3M7G A;  4LJZ F;  1IXC A;  2QM3 A;  1FSH A;  4HLY A;  4TV7 A;  4AIH A;  3ABU A;  1HQC A;  2CWE A;  3O3K A;  3ZN1 A;  2EFN A;  2R7F A;  1FYL A;  2WC2 A;  1IRF A;  1J59 A;  3ML6 A;  2OA4 A;  4Q48 A;  4I7H A;  3C18 A;  5BMZ A;  2PI0 A;  1XCV A;  5BOX A;  1I1G A;  2O0Y A;  3WG9 A;  5HLI A;  4M71 A;  1GHC A;  4E70 A;  2COM A;  2JT1 A;  2XAS A;  4N0B A;  3VFZ A;  5LHI A;  4YIF A;  5TJJ A;  3BRO A;  2VOD A;  4NB5 A;  1LEB A;  4ETS A;  2XAJ A;  1P2F A;  3WTY C;  2HZT A;  4KIC A;  3K1M A;  2HR3 A;  3O2P E;  3GFM A;  1EH8 A;  3EDP A;  5HOO A;  3JSO A;  3HTS B;  3IC7 A;  1VTN C;  2VBW A;  2ELH A;  5CVU A;  1ZH5 A;  4M9S A;  2O3F A;  1MDM B;  2UWM A;  2PBI A;  2RDP A;  2NAZ A;  4YG2 F;  2P7C B;  1ON2 A;  3QAH A;  4B09 A;  4HV6 A;  4U88 A;  2XKP A;  3D5L A;  4I2O A;  4P5O A;  4YFN F;  2UZK A;  4CZZ A;  2GXB A;  3FHZ A;  2D1V A;  2FQ3 A;  5L3G A;  3F8M A;  4KT5 C;  1RUN A;  3B73 A;  2DK5 A;  5ICG A;  3M9A A;  2IRF G;  3LA7 A;  1USS A;  3JAM Z;  1KGS A;  2K4B A;  5DUK A;  2RN7 A;  3N97 A;  1I5Z A;  2DBB A;  2QZ8 A;  1UHW A;  1IZ1 A;  3KP4 A;  3F72 A;  1U5T C;  2FBH A;  4LD5 A;  4XBF A;  1PUE E;  3GZ6 A;  5BPD A;  1XB4 A;  3F8F A;  2XAG A;  4RGU A;  3S2W A;  4KN7 X;  2G7U A;  2XRO A;  1ZRD A;  3TDU C;  5E8G A;  1XGS A;  3IRR A;  3T8R A;  1W7P D;  2C6Y A;  2VBX A;  2CSO A;  1QQI A;  2MLG A;  4S05 A;  2E1N A;  2O8X A;  1WRJ A;  4BAY A;  4P9U A;  4PZJ A;  3SXY A;  4HDV A;  3F3X A;  5KVR A;  4NHJ A;  4ZZL A;  4KIF A;  3PQK A;  1KU9 A;  3WE2 A;  3C3W A;  4A6E A;  2RQP A;  4GCV A;  2J5O A;  3P7N A;  3BJ6 A;  2QBY B;  4CXF A;  2FBK A;  4DQ2 A;  2IVM A;  2VBZ A;  1HXD A;  1U2W A;  1JXS A;  3I71 A;  2PMH A;  1W5S A;  4A6D A;  4IPA A;  4HW0 A;  1G4D A;  4Y17 A;  3WOD F;  1EH7 A;  5H6Q A;  2FNA A;  4RB3 C;  2FXA A;  1XMA A;  2QQ9 A;  1RIO H;  2W85 A;  5LEJ A;  3RKY A;  5CJ9 A;  2RNJ A;  1CGP A;  5AIQ A;  4EGY A;  2VXZ A;  1HST A;  1YW7 A;  2P6S A;  3Q9S A;  3ZMS A;  2FOK A;  2LNB A;  4ESJ A;  2KJC A;  2ZJ2 A;  4KMF A;  5JVT A;  1MKM A;  4XSX F;  2QEN A;  1YTY A;  2YSR A;  2H6B A;  3HHH A;  3GVA A;  3JTG A;  4L0Y B;  3OV8 A;  4JBA A;  1FT9 A;  3ZP5 A;  2X0L A;  4CHU A;  4ON0 A;  2DLL A;  2R3S A;  1IW7 F;  3WTZ A;  4IF4 A;  3MFK A;  5D5X B;  5ICF A;  2L3D A;  2M8E A;  4L5J A;  3DQV C;  2PJP A;  2M5W A;  3RKW A;  1SFX A;  4KA4 A;  3EET A;  2H94 A;  1QNT A;  3F22 A;  3HRM A;  4MGR A;  4U0V A;  3WTW C;  2BEO A;  2DU9 A;  3J80 K;  1HKT A;  3BWG A;  3HOT A;  2ZO4 A;  1YW8 A;  3K69 A;  5FLX Z;  2QLZ A;  4BH9 A;  2QWW A;  1XGM A;  1WI9 A;  3SHF A;  3FZV A;  5TRD A;  4KYW A;  1P4A A;  2OBP A;  2RVC A;  1W7P A;  2F5C A;  4EM2 A;  5J8F A;  1UST A;  4PCQ A;  4EQQ A;  1ZAO A;  2DTR A;  4RGR A;  3RTR A;  2W57 A;  4A5N A;  3BJA A;  2WWY A;  3ZPL A;  4EJT A;  2W84 A;  4OOI A;  1BOA A;  4L9J A;  4R79 A;  4EMS A;  4I0A A;  5DEQ A;  2DQL A;  2BYV E;  4EM1 A;  1UHM A;  5ICE A;  4AD9 A;  4ENJ A;  1T98 A;  2NNY A;  1FWZ A;  1G3Y A;  1WWX A;  3T0Y A;  3HSR A;  1HKQ A;  2G9W A;  2EV5 A;  4N9I A;  3RIR A;  4HF1 A;  3HRT A;  3I4P A;  1TNS A;  3ZMT A;  1ZG1 A;  5K1Y A;  2Z9O A;  4A0Y A;  2NS0 A;  3NRV A;  2HQR A;  5AON A;  3GLX A;  1AWC A;  3P9I A;  2JTV A;  3RPU A;  1O7F A;  1U3E M;  4BNC A;  1STZ A;  4G7H F;  2GZW A;  3E5Q A;  3WU0 A;  1X3U A;  3GUD A;  3V7S A;  4G6D A;  4UXN A;  3KE2 A;  1YQA A;  5HLH A;  4MQV A;  1IN8 A;  2L4A A;  3QP5 A;  1TQM A;  1I27 A;  3WTX C;  1KYZ A;  5FB2 A;  3CUO A;  2EJR A;  1P4W A;  4RAY A;  5DD8 A;  3Q5F A;  3ZQ7 A;  4LLG F;  4A2U A;  2LKP A;  4UVC A;  1XGO A;  3L09 A;  5E8I A;  2PQ8 A;  1LDD A;  4P9F A;  4L9T A;  4NQW A;  3R6S A;  4HX8 A;  1PP7 U;  2WTE A;  1KA8 A;  2P7V B;  5J6X A;  1Q1H A;  2A69 F;  3F6O A;  4WXH A;  1ZG3 A;  4EJU A;  1FPQ A;  1REP C;  3CUQ C;  2A5Y B;  4I01 A;  3MZH A;  1Y0U A;  5IT3 A;  3T5X A;  3J81 K;  5ED4 A;  4MHG A;  1Z05 A;  2F5F A;  5DDG A;  2Y0M A;  1HSJ A;  1T38 A;  5ILV A;  1V3F A;  5E1X A;  3LAJ A;  2VE9 A;  1ZG5 A;  2PLY A;  1BIA A;  1R23 A;  3NEU A;  4M6Y A;  3LST A;  4PDK A;  4A12 A;  2YU3 A;  4EV0 A;  1OR7 A;  4MNU A;  1B9M A;  2FEZ A;  5EEH A;  2XHK A;  3ULQ B;  1S29 A;  2VE8 A;  1O3S A;  2K7L A;  1BC7 C;  1D8K A;  1ZAR A;  2HTJ A;  3FMQ A;  4CYD A;  4CGZ A;  3QPT A;  2A3S A;  6PAX A;  1R1T A;  3FM3 A;  3JW4 A;  1S6L A;  2XV4 S;  2KKO A;  4ENK A;  1IN5 A;  1TW3 A;  5H6R A;  1XD7 A;  3EYI A;  1G3T A;  2Q0O A;  2XAQ A;  3CTA A;  2ISZ A;  5FO5 A;  2F5D A;  2H27 A;  4H0E A;  2F2E A;  3PFI A;  1FC3 A;  2IA2 A;  2FU4 A;  1IXS B;  3E5X A;  3G73 A;  2D45 A;  2VC1 A;  2VOP A;  4WX9 A;  2NYX A;  3QPH A;  3DF8 A;  4I09 A;  4HYE A;  2GXG A;  2CFX A;  3VOD A;  4UVB A;  2D1H A;  3HOS A;  5F64 A;  3WGI A;  1B4A A;  1RZ4 A;  1QBJ A;  2EK5 A;  3HRU A;  2KIF A;  3H92 A;  2ZFW A;  2UXN A;  3MZY A;  2XAF A;  3SQN A;  2H09 A;  4ZZD A;  4DNC A;  1W7P B;  4BXU A;  3QP6 A;  5H20 A;  1XGN A;  3EUH A;  2KIM A;  1R00 A;  2BGC A;  3HUG A;  3REO A;  2VBY A;  4ZYG A;  3M8F A;  2AS5 F;  3IKV A;  4LK1 F;  2GA2 A;  1S8N A;  2A6E F;  4MQ9 F;  3LA2 A;  2W24 A;  3QU6 A;  2K86 A;  4HLX A;  5F1R A;  2EV0 A;  3ABT A;  3I64 A;  1IXR C;  2V1D A;  3BPV A;  5HDN A;  4M9X A;  2HWV A;  3TGN A;  1WQ2 A;  3HTU A;  1T2K A;  5LGN A;  1ZYR F;  3J80 Z;  2ADU A;  1YIO A;  3IRQ A;  4O3M A;  1UFM A;  2YX7 A;  3I59 A;  1R5G A;  4RGX A;  2HS5 A;  3DKW A;  3M1E A;  4WXD A;  3V7R A;  2LF8 A;  4I02 A;  5DCM A;  1MZB A;  3IWF A;  3TO9 A;  1OYY A;  3JTH A;  3F23 A;  2OQG A;  3KEO A;  1EV7 A; 
#chains in the Genus database with same CATH topology
 3G1M A;  1MMN A;  2JUG A;  2KL4 A;  3QOD A;  4DYC A;  2G0E A;  3VSK A;  1FTZ A;  3LWF A;  5JLX A;  2QA4 I;  2LKS A;  2LOO A;  4N4O B;  3ZRG A;  2FMY A;  2M87 A;  2DI3 A;  1MBJ A;  2L9S A;  1BJA A;  4PJL A;  4KIB A;  2DN0 A;  1WVR A;  4BYY A;  1QZE A;  5ERI A;  1OYW A;  2LBF A;  2MC3 A;  3FXR A;  2ESN A;  1FEX A;  1U0J A;  1SD5 A;  2ETH A;  2P5K A;  2V7F A;  4FHT A;  3ZMZ A;  1OMI A;  3FMS A;  2DA7 A;  3R0A A;  2AQF A;  2CUJ A;  1H9G A;  3GF2 A;  4IEJ A;  3L00 A;  5K5O A;  2OV7 A;  3OYA A;  3K70 D;  5BPI A;  4LG0 A;  3DPU A;  2BE5 F;  4CYC A;  1QHH D;  2KDO A;  3MQ0 A;  1T6S A;  4NQW B;  3H5R A;  1HW5 A;  3FWE A;  3ZQC A;  4V2G A;  3W6K B;  1DP3 A;  2QYO A;  2O61 A;  3GTQ J;  5L3F A;  1BN5 A;  2AQE A;  4HZF A;  5GAG J;  2X6W A;  4HST A;  3KP6 A;  1VQ7 I;  2Q8K A;  4XSZ F;  2OU2 A;  1R49 A;  3AAF A;  2W4S A;  2DMU A;  2A68 F;  2Z2S B;  2HFH A;  3E6M A;  5F0F A;  3R0J A;  2AXL A;  2KZV A;  1FSE A;  3H5N A;  5AIP A;  1R71 A;  2RRE A;  3HKZ N;  3WG7 H;  5FKK A;  2V1X A;  3S3O A;  1H9T A;  2NXN B;  2ZKZ A;  4IHV A;  1FZP B;  1JT6 A;  1TWC J;  3BJO A;  2WBM A;  3RJP A;  2PX9 A;  2XGX A;  5HDK A;  3SZG A;  3DEU A;  1J75 A;  3BOQ A;  3HBL A;  4HQE A;  4CCM A;  5D8K B;  3VWB A;  2GOM A;  2J5P A;  4KJZ A;  1HOM A;  1LB2 A;  3GTM J;  2ZJR F;  1IN6 A;  2Z5U A;  3TDZ C;  3U1D A;  3U9G A;  2YR2 A;  1K78 B;  4BJ5 C;  1FMW A;  4MFD A;  3L2Q A;  4BEH B;  1QU3 A;  3K4B A;  1MNE A;  5LRS A;  4ZYD A;  4DJA A;  4A5M A;  4IO9 F;  4LG3 A;  1OCC H;  3E5U A;  3GME A;  1JUP A;  1TC3 C;  4RAG A;  4HAM A;  2IBD A;  2L54 A;  3S1R J;  4XKC A;  1DGR M;  3OYJ A;  3J7A Y;  4XLP F;  1T0F A;  2IA0 A;  1XSV A;  3T8T A;  3TOB A;  4HPQ A;  1ORK A;  2GIZ A;  5F04 A;  3V7C A;  2HVR A;  2UXX A;  2VQH A;  3AG4 H;  4JYK A;  3GYH X;  2LDU A;  1YE9 A;  4L9V A;  4XLN F;  3J7A O;  4CSW A;  5DCF A;  4G7O F;  5GPA A;  4CIC A;  3CJR B;  1GVD A;  1Z67 A;  3WGH A;  2DTZ A;  2HZD A;  2XF5 A;  5E1W A;  4ZYH A;  1M1E B;  4H4K C;  2DW4 A;  3J81 Z;  2DPD A;  1HBX G;  3TP3 A;  2QQA A;  2VQC A;  3DWL E;  5HNF A;  2OZU A;  4JP0 A;  3M07 A;  1MJA A;  1HF0 A;  3DU6 A;  1VZ0 A;  2JVH A;  4BHB A;  2WAF A;  4ZC3 A;  2PN6 A;  4F3Q A;  1XX5 A;  1GXP A;  2ACJ A;  1MGT A;  1PP8 F;  2A07 F;  4MIM A;  3K1P A;  3SZP A;  4M74 A;  4AIJ A;  2GLO A;  3MWM A;  2CQX A;  3HM5 A;  2M2E A;  5D8L B;  1U5T A;  4G6Q A;  1SMT A;  2IW5 A;  4M3G A;  3ERE D;  2IGK A;  2JVG A;  1MMA A;  1KZH A;  3I58 A;  4I76 A;  1O3T A;  3FK7 A;  3Q0V A;  3DU5 A;  4A69 C;  4BBS J;  3JRH A;  3HOZ J;  1FX7 A;  1QVT A;  2B0L A;  3BZK A;  2ECB A;  2XAH A;  4ESB A;  3F8B A;  1A04 A;  4HDU A;  2XSD C;  4R8H A;  4K2E A;  5K5Q A;  4HEA 2;  1ULY A;  2XRN A;  3ZQG A;  4HG2 A;  2V1N A;  1LJ9 A;  2BZT A;  2JA5 J;  4PK4 A;  2A5W A;  2TDX A;  4X1E A;  1LNW A;  2ZCW A;  1DP7 P;  2O03 A;  1G3S A;  4A3G J;  1S9H A;  1P92 A;  1V5G A;  1HW2 A;  2XKO A;  3KZY A;  2NVY J;  1R22 A;  2L7K A;  3OYC A;  3K6G A;  4IVN A;  2KIU A;  2X48 A;  3E0J B;  1DU6 A;  3ZXS A;  5E3O A;  1MMG A;  3J7Y J;  1KU3 A;  1R36 A;  2FOW A;  4XMY A;  2EQR A;  5KK1 A;  3RI4 A;  1SFE A;  1YO5 C;  2V79 A;  4HF2 A;  2Z16 A;  3HUG B;  2E5Z A;  3E6D A;  5D5U B;  3P9C A;  1ODD A;  3H3Z A;  3IUO A;  2X51 A;  2GWR A;  4UB6 C;  1YS7 A;  4O6J A;  4RAZ A;  2JMW A;  2UUZ A;  1R4N B;  3S16 J;  4BKX A;  1IRG A;  2GIV A;  1E3H A;  4BXF A;  2IT0 A;  1J5Y A;  3PNT A;  2QEX I;  3H0G J;  2LC2 A;  2Y48 A;  2ZXH A;  4EM0 B;  2L02 A;  4BL0 B;  5GP9 A;  1HLV A;  3OS0 A;  3W2A A;  3CCL I;  1OR7 C;  4BDY A;  4Z2Y A;  1DUX C;  2IPQ X;  4XRF A;  1P6R A;  2EV6 A;  4LLN A;  1J09 A;  4DGW B;  3F9K A;  1SAX A;  1FY7 A;  4IRH A;  2NVT J;  5B3S H;  1UB9 A;  3D5R C;  3K7A J;  2OF7 A;  3E97 A;  3Q3S A;  3SDG A;  1Y39 A;  3G2B A;  1L3L A;  2LRD A;  3OS1 A;  4QWQ A;  1QGP A;  4I0B A;  2QGU A;  4ZH4 F;  3ZQL A;  2D2W A;  2YPR A;  3ZN0 A;  2Q2E A;  3ROU A;  1JKQ C;  2AHQ A;  2CUF A;  1CF7 A;  1A6Q A;  1ETO A;  3FM5 A;  4P55 A;  2DT5 A;  4GYI A;  2E7W A;  4KFC A;  4A3I J;  2WA0 A;  1OPC A;  1VQ4 I;  4HRI A;  1K4T A;  3DTE A;  3I59 B;  2O6G E;  5B1A H;  4G8X A;  2IAI A;  1YX5 A;  2XPW A;  2RV8 A;  1XCB A;  3TQN A;  3GCM A;  2ZNZ A;  4PGH A;  4Q4Z F;  2JPB A;  1VFC A;  4Y4R A;  1IV8 A;  2EFO A;  1A36 A;  3C7J A;  1MJ9 A;  2COB A;  4HNT A;  4C2U A;  3KX2 A;  5IP9 J;  5HS8 A;  2NS8 A;  3LA3 A;  4ZTJ A;  1FP1 D;  1CQT A;  2W25 A;  4MLO A;  1S72 I;  3CME I;  3GO5 A;  2MH9 A;  1PJR A;  2WY7 Q;  3QRF F;  1SFO J;  2DYR H;  4IOC F;  4M6X A;  2F4M B;  1OJL A;  2F4O B;  3BR3 A;  3CO6 C;  3EYY A;  4OIO F;  3D0S A;  2CRG A;  5HDG A;  3PL8 A;  3CC7 I;  1U6G A;  3ISP A;  3RSN A;  1B9N A;  3HSE A;  1WJD A;  2V4J C;  2LBF B;  4IHY A;  1Z6R A;  3F6V A;  3S32 A;  5FRM A;  4CH7 A;  3DEE A;  2LYC A;  1U8B A;  2V9K A;  3KP3 A;  1RKT A;  1KQ0 A;  1B72 A;  1RNL A;  1LDJ A;  4LG0 B;  2VXD A;  4A3D J;  4A3K J;  1G6N A;  4HA8 A;  2VKD A;  4XID A;  3HSF A;  1TLH B;  4E7L A;  1U8R A;  1B6A A;  2MW8 A;  3VYS B;  3E6C C;  4UV9 A;  1TWG J;  1R9T J;  2GQQ A;  1Z7U A;  1NHA A;  5L3D A;  2CQN A;  5E3L A;  1SC7 A;  5IYB J;  1KQ8 A;  2L4M A;  3NWS A;  3H3V K;  1EH6 A;  2XAU A;  4AIK A;  1K7A A;  2DFI A;  5LBQ A;  4BQA A;  3L7W A;  3GZ5 A;  4UUS A;  3EUH C;  3ZCO A;  3GW2 A;  3HPG A;  2EZI A;  1SD6 A;  1TBX A;  1YX3 A;  4L9N A;  5M3M J;  2HKX A;  2JN6 A;  4FX0 A;  4XR6 A;  2EIN H;  1O7L A;  2CMP A;  2BXY A;  2P0W A;  1KU7 A;  2RKH A;  1ZRF A;  1YLF A;  4ESF A;  5E18 F;  2X6X A;  1JJ6 C;  2E71 A;  1GV5 A;  3D1N I;  2EFP A;  5BS6 A;  2STT A;  3GWZ A;  5K5R A;  4OIR F;  3RPQ A;  4A3C J;  3L2W A;  4Y15 A;  1VQO I;  4MEY F;  2E2I J;  5IT9 K;  2QUF A;  2EFQ A;  1BI1 A;  2MH2 A;  3JRA A;  5JVG F;  3EUK L;  2DOD A;  1IN4 A;  3KP2 A;  4P1W A;  3FMR A;  4B8X A;  1GXQ A;  1PUF A;  1ETV A;  4LLL A;  2OCE A;  2HPM A;  2HTS A;  4MEX F;  1GDT A;  5JR3 A;  3PNY A;  5M5X J;  4D0P A;  2K9M A;  5FRO A;  3BTL A;  2Y9Z A;  2QBY A;  5IYC J;  3KYL A;  4MTD A;  1XSD A;  3S3M A;  1WSU A;  2RAE A;  3ZQH A;  1YW9 A;  1FTT A;  1JHF A;  2HYG D;  1F4K A;  4LGW A;  1H0M A;  1A5J A;  5FJ8 J;  2UV1 A;  2XVC A;  3MAJ A;  3RYR A;  4FX4 A;  2ZME A;  4R1H A;  1HW1 A;  2DMT A;  1OCO H;  2XSJ C;  2BBY A;  1ZEL A;  2RGV A;  5D6F A;  1D5V A;  3PFY A;  3OIP A;  1YIJ I;  1FOK A;  3ZGK A;  2FA5 A;  4LIU A;  4M3E A;  1I1S A;  4RB1 A;  2VN2 A;  1YG2 A;  3MMY B;  2ISY A;  4XRS G;  3W6J B;  1Z3X A;  2CG4 A;  3K1N A;  2FE3 A;  2P4W A;  1J2X A;  2K9S A;  2LF7 A;  4KUM A;  3OYL A;  1E17 A;  2HXO A;  2K27 A;  4YFX F;  3F21 A;  1D8J A;  3OYM A;  4II2 A;  3CP2 A;  2MAB A;  1W5T A;  4QPO A;  3HG9 A;  1BI3 A;  2ZXJ A;  2VIX A;  5CYV A;  5FRN A;  2VT3 A;  1TL8 A;  2DK8 A;  1UG2 A;  2CQK A;  2DA3 A;  2TRT A;  1U5T B;  3KYD B;  1YFH A;  1T39 A;  1R58 A;  3LQR A;  1FLI A;  1IUY A;  4OIQ F;  2A6H F;  4D7M A;  1F9N A;  4G94 A;  5DM7 F;  1GVJ A;  1ZLK A;  2K4J A;  3FHN A;  5HLG A;  3QYF A;  4OWR B;  3GX4 X;  2M1B A;  4XLA A;  1TNT A;  1X1C A;  2VLA A;  2FF4 A;  2K85 A;  3I53 A;  4RAF A;  1XSX A;  2VPL A;  3GFL A;  5KNL A;  1WFX A;  2GXA A;  3WTV C;  4EVI A;  3GTL J;  2WAQ A;  1X4O A;  2K5C A;  4E6K G;  5IOZ A;  4XIC A;  2JA7 J;  3CLO A;  3V8J A;  4L5I A;  1T8I A;  5CLS A;  1SD7 A;  5ICC A;  5IP6 A;  2IA1 A;  5A2Q K;  4CO8 A;  2A61 A;  4B3A A;  5L3C A;  1FBS A;  1T95 A;  2WY8 Q;  4WXC A;  3LSJ A;  1VQK I;  4BQN A;  3FIW A;  1DDN A;  2WV1 A;  3N05 A;  5J3L A;  2OCC H;  2BY2 A;  3RYP A;  2KT0 A;  3H0D A;  1TTY A;  2LLK A;  3R61 A;  5LLQ A;  5EEG A;  2JPC A;  4AC0 A;  2CO5 A;  4ENM A;  4IRG A;  4XNF A;  2TCT A;  3CQZ J;  1R1U A;  1EA3 A;  3HB9 A;  2R7D A;  4C3J J;  3BZ6 A;  3NQO A;  4U7B A;  2BV6 A;  3KLN A;  4WWC A;  3PQJ A;  4WCG A;  1VQ6 I;  4IJA A;  3MCZ A;  1V5F A;  5M5W J;  3H35 A;  1OYI A;  2W82 A;  4HBL A;  1UJ8 A;  2IS6 A;  3BR1 A;  1F36 A;  2OD5 A;  3DFG A;  3V8L A;  3A2K A;  1S3J A;  1T56 A;  4XON A;  3CUQ A;  2DMQ A;  2NVU B;  3DPL C;  2FNP A;  1SMY F;  3G1L A;  1O3R A;  2GM4 A;  5D4R A;  3OIQ A;  1IF1 A;  4U0Y A;  2YX4 A;  3IAS 2;  4BE2 A;  1T0F C;  2KRH A;  1N78 A;  3WU2 C;  4RDU A;  3WHB A;  1KQ9 A;  1RKW A;  1WJF A;  1ZHF A;  3LFK A;  2M4G A;  2KRF A;  3I5U A;  2EA2 A;  2Q2E B;  1ONV A;  1F5T A;  1CF7 B;  1Q1V A;  2ZJP F;  4C2T A;  1XDU A;  3KLO A;  5E1Z B;  1JGG A;  2E1C A;  2BHY A;  1R5H A;  3AL0 C;  4BE0 A;  3KZZ A;  2ECC A;  4A3L J;  4N9H A;  4Q5S F;  2CYY A;  2X1D A;  1H89 C;  4XOT A;  3CDH A;  1J9I A;  4NUB A;  1O57 A;  1OFC X;  1R1V A;  2JRT A;  2Y69 H;  5D4S A;  5LGT A;  1K83 J;  2OUM A;  2HQN A;  1KU2 A;  4RB2 C;  3H5A A;  2BY3 A;  4XLC A;  3S3N A;  2QQB A;  3VOE A;  4E7J A;  3IV5 A;  1JHH A;  3T1B A;  5TIS C;  3ZMV A;  1E3P A;  2M45 A;  4XL9 A;  2EA4 A;  3DEW A;  1HCR A;  1IO2 A;  1QZZ A;  3VEP A;  1K6O A;  2JWT A;  4OU0 A;  1D0Z A;  2N8G A;  3HHG A;  3FDY A;  2HEO A;  1W4M A;  1JUS A;  4OIN F;  1Y1V J;  4II3 A;  3MEX A;  5JI6 A;  4DBR A;  4YIR X;  4IHT A;  2I8D A;  1MMD A;  2XPU A;  4Y7N J;  1L0O C;  1S7O A;  2CUE A;  4C3H J;  3VYU B;  2VON A;  3L2R A;  3Q0W A;  5FD5 A;  4A3J J;  2R7T A;  4WF2 A;  2HGC A;  2HOE A;  4Y33 A;  2NVQ J;  1MMS A;  3IKT A;  1LVK A;  1D5Y A;  4XM3 A;  1A35 A;  4P96 A;  1T33 A;  2LSO A;  1A6I A;  1B72 B;  1B59 A;  1W1W E;  2Y75 A;  5L3E A;  2YU9 J;  2LVS A;  1WJA A;  1ZLJ A;  3H3U A;  1MSF C;  2KJB A;  1LFP A;  4ZDO A;  1LUJ B;  4U0W A;  3FIS A;  3BZC A;  5F27 A;  1VQL I;  3BR0 A;  4G9Y A;  2KHM A;  2XF6 A;  3K4N A;  4J00 A;  5FFZ A;  2P5V A;  1B1B A;  4O5V A;  3WHC A;  2HDC A;  3HDD A;  2KLO A;  3GFI A;  3TW6 A;  2X1C A;  1E3O C;  3I54 A;  3KFW X;  2LY1 A;  4YFK F;  3GTJ J;  2QSG X;  1RI7 A;  1SAU A;  3BR5 A;  2EZK A;  2LH9 A;  4Y52 J;  4U7D A;  5L3B A;  3H9Q A;  1BI2 A;  3K70 C;  4KIG A;  2KRC A;  2PG4 A;  3OOP A;  5B66 C;  3TL4 X;  1P7I A;  3OL4 A;  3HRS A;  5CPR B;  5J40 A;  2FBI A;  4UUS B;  3GBG A;  3OY9 A;  3MKL A;  2CS3 A;  4FT8 A;  4IRI A;  2DA5 A;  1TWF J;  3FXQ A;  3BG3 A;  5HS9 A;  2F6C A;  3ECO A;  4HNV A;  3TP0 A;  4DW6 A;  4EJV A;  3JSP A;  1S7A A;  1D3Y A;  5JFR A;  1HA8 A;  1X3Z B;  3QU3 A;  1K4S A;  3V4G A;  4B43 A;  1RR8 C;  3S1Q J;  1D1B A;  3K0L A;  3B02 A;  3BTI A;  2DO7 A;  2VAS A;  1JKR C;  2FSW A;  3CCU I;  1HKS A;  1VQ9 I;  1MH4 A;  3HOV J;  3KET A;  2E1M C;  3A4C A;  1S5L C;  5KHD A;  1PUF B;  3DPT A;  4LFU A;  5HNH A;  5JHF A;  1IV6 A;  2DOF A;  4M72 A;  4S0H B;  5DD4 A;  5KAF C;  5EZG A;  1FOY A;  4G7Z F;  3LSG A;  4PUS A;  2LTP A;  1X1B A;  1NK2 P;  5CKT A;  2RQQ A;  4E7S A;  2EWN A;  3M8E A;  1LFB A;  4RM2 A;  4GGG A;  4EJW A;  1XPX A;  5IPA A;  4DYR A;  3ABM H;  2CV2 A;  1FBQ A;  3IHU A;  2P8T A;  2DPU A;  3E3V A;  2DXI A;  2ZME B;  4HX7 A;  4WK8 F;  4BHC A;  4NC6 A;  5DV5 A;  3OR1 C;  2X85 A;  2HXI A;  4OMY A;  2Z3Y A;  2BW3 B;  4OAY A;  4Q47 A;  2R5Y A;  1SFU A;  5D5V B;  1OQY A;  3BY6 A;  1U9O A;  3ECH A;  3SYT A;  2EIJ H;  1BR2 A;  2YUS A;  1UCR A;  4ZTF A;  1Z0X A;  2MBF A;  3MKZ A;  1AKH A;  2WAQ N;  1GT0 C;  1LQ1 A;  3GEZ A;  2M9H A;  2O8K A;  4CCK A;  1J0R A;  1D1C A;  2L0K A;  4YII A;  2IXS A;  3CLQ A;  5JHU A;  3KZI C;  1DGW Y;  1NG6 A;  4GO1 A;  4F52 A;  3WGG A;  1FP2 A;  1DPU A;  3CDL A;  2HDW A;  4PJN A;  3TO6 A;  2CGP A;  3TOA A;  2VJJ A;  4RS8 A;  3L1P A;  1D0Y A;  3CCJ I;  1ERD A;  2Z1D A;  4GRI A;  5IT9 Z;  1MD0 A;  3OYH A;  4PFO A;  4HF0 A;  5CVV A;  1C0W A;  3S14 J;  2E7X A;  1QZY A;  3WTS C;  1EJ9 A;  5HVQ C;  1Y0N A;  2NRA C;  3K4J A;  1IDZ A;  1I3A A;  1XMX A;  1MNM C;  2JSC A;  4FQG A;  1AU7 A;  3BCA A;  2OAZ A;  3BTJ A;  1MJB A;  2XIG A;  1Z6T A;  1GUU A;  1RUO A;  2EIL H;  1I6H J;  4HOB A;  3CJT B;  4OIP F;  4ZYE A;  3M3Y J;  3P9K A;  2R7Q A;  2WV0 A;  3HOY J;  2DFE A;  2VPR A;  1VND A;  4RGS A;  3CCE I;  4GYG A;  4QLC U;  2DJN A;  2H1L A;  3K2Z A;  5D5W B;  3M8J A;  4LK0 F;  4A0X A;  1I6X A;  3ELK A;  2WB1 N;  4AM3 A;  3I4N J;  1YYV A;  1TW2 A;  1RRJ A;  2ID6 A;  2ELK A;  4JX6 A;  3G3Z A;  3ZOB A;  1WKM A;  2LKX A;  3IWZ A;  5FLV A;  3S8P A;  3W2W A;  3S15 J;  4V19 K;  4EGZ A;  4A3E J;  2R5Z A;  5J1Y A;  3ERM A;  4XQF A;  2ZC2 A;  2Z33 A;  4YRV A;  3SFZ A;  3IP4 B;  3A0H C;  4S04 A;  1ZGJ A;  4XKV A;  4A0Z A;  1YJW I;  2E2J J;  2GBY A;  2XC7 A;  2E1O A;  3GFJ A;  1RES A;  3IH2 A;  4RM3 A;  2M0C A;  4BHP A;  3JAM K;  3L2U A;  1TQP A;  2PJR A;  2FML A;  1FMV A;  2FJ1 A;  3QPL A;  1OKR A;  1Z9C A;  3CJN A;  4F91 B;  1JGS A;  5CVJ A;  2K02 A;  4DYQ A;  4W1U A;  5CQE A;  4B48 A;  2L7F P;  4HV5 A;  1H8A C;  1V5E A;  1AHD P;  3NWT A;  4J19 A;  1AOY A;  4M3B A;  5E20 A;  4JK1 X;  3TO7 A;  4UHT A;  3PIP F;  2STW A;  3CUQ B;  4QSH A;  2EIM H;  1LVA A;  2E36 A;  2HU9 A;  2K3F A;  2BXZ A;  3ZQI A;  2CUZ A;  1DPR A;  2HKO A;  3CC2 I;  2PEX A;  4BS9 A;  4C3I J;  5EYR A;  4UVA A;  2MSY A;  4LMY A;  3FKJ A;  5J47 A;  2K9L A;  1O4X A;  1MDM A;  1POG A;  1IN7 A;  3FF5 A;  3HC7 A;  1R7J A;  5M5Y J;  3QOP A;  1OCR H;  2YS9 A;  2F4I A;  4A3M J;  5HS7 A;  5FKN A;  4PFP A;  2HYJ A;  1SD4 A;  2ZME C;  3MZ8 A;  3SJM A;  1FNN A;  3F8C A;  3HZJ A;  3WTU C;  3LAP A;  1B8I A;  3IL2 A;  4AU7 A;  1MSE C;  1X4P A;  3E6B A;  5KCM A;  5A2Q Z;  1LE8 A;  2VC0 A;  4ENN A;  2IJL A;  1K79 A;  2PFB A;  1E2X A;  4L0Z B;  1FIA A;  4KIS A;  2E60 A;  4GXO A;  1IGN A;  4J01 A;  4KN4 X;  3SZT A;  3S1N J;  4EEF G;  1LEA A;  2ESH A;  5DCM B;  3KEQ A;  1Z77 A;  2GAU A;  3VB2 A;  3JR9 A;  2P5L C;  4IX7 A;  2QSH X;  3OOU A;  2KIS A;  3KEY A;  2DAO A;  1ZR2 A;  4CDG A;  3CF2 A;  3CF5 F;  2V1U A;  1NG7 A;  4BBR J;  1F1Z A;  1FJL A;  3R60 A;  5GAD J;  5ILU A;  4XN3 A;  4KDP A;  4EJO A;  3FKI J;  3SFI A;  5LGU A;  5DUI A;  3AG1 H;  2V9V A;  1BR1 A;  3HIF A;  3FXO A;  2P6T A;  3RQI A;  1VQ8 I;  1Z1D A;  3I0T A;  5FD6 A;  1PDN C;  2DJI A;  3KYC B;  2NVX J;  2R7O A;  4M73 A;  5K7Z A;  3WTT C;  3C2B A;  2Y31 A;  5LHH A;  2R7S A;  3ZMD A;  2L9R A;  2A6T A;  1QRY A;  2M30 A;  1DQU A;  3K4M A;  2F5E A;  2CQQ A;  3WU1 B;  3CO7 C;  3EQL F;  3DV8 A;  4JX4 A;  4AWX B;  4BUP A;  1HC8 A;  3JRG A;  3O6B B;  4HX4 A;  2ZNY A;  2L01 A;  1RPW A;  2L5Q A;  2Z99 A;  1P4X A;  3ESW B;  3L2C A;  3FXU A;  4CYC B;  3GXO A;  3S2H J;  4MTE A;  3N4M A;  3COA C;  1ZRC A;  2EH3 A;  1TQI A;  3I55 I;  1FIP A;  1VQP I;  2KPM A;  2DQR A;  1I50 J;  1BI0 A;  4NC7 A;  5EGO A;  3C1D A;  4FIS A;  2XGD A;  4JQF A;  4EAT A;  1VI0 A;  2ID3 A;  4MFE A;  4UV8 A;  2V6C A;  2ZSH B;  1Z91 A;  3OYE A;  3QQA A;  2HDD A;  1KYW A;  4UNO A;  4KNY A;  2E19 A;  4FE4 A;  5EG0 A;  4IOA F;  2R7X A;  1XN7 A;  3HYI A;  2CW0 F;  1QO0 D;  4B47 A;  2NOG A;  4DZP A;  1J7K A;  1V4R A;  4KMU X;  2H6C A;  5ILS A;  4GFB A;  1BC8 C;  3Q9V A;  4NNJ A;  1G3W A;  4OMZ A;  1JE8 A;  2MYS A;  5D6E A;  2RC4 A;  3V8K A;  4BY1 J;  3GTP J;  3CD6 I;  2M8G X;  1Y8R B;  2EZL A;  3R4K A;  3S93 A;  1LDK B;  3C2H A;  2MD0 A;  4M9Z A;  3RKX A;  1YS6 A;  3TKY A;  4I98 B;  3KP5 A;  2MA3 A;  1FBU A;  2KZG A;  2FRH A;  3L9F A;  3ZQF A;  5E3N A;  2DCE A;  4UUV A;  3K9T A;  3EUA A;  3KP7 A;  3OR2 C;  1BIB A;  1OIS A;  3FXK A;  3SDB A;  3RDI A;  2HVQ A;  1H88 C;  1BJZ A;  1ZGA A;  5J8C A;  3LSR A;  3MKW B;  1QA6 A;  4Y13 A;  4PJ0 C;  4BXX J;  2LFB A;  3FXL A;  2LK2 A;  1I39 A;  1D1A A;  2P81 A;  2OZ6 A;  4F7Z A;  5LHG A;  4HNU A;  3NAU A;  2E35 A;  3HGG A;  3OYB A;  3ZMU A;  3KCC A;  1SVL A;  2NNN A;  5LRR A;  5BQT A;  1QPM A;  1JUM A;  2MLK A;  1ZRE A;  2MC4 A;  4PGG A;  3AG3 H;  3G6E I;  3BPX A;  3DXJ F;  4IHS A;  3OS2 A;  4B1R A;  5DYM A;  1QHG A;  3G1O A;  1K78 A;  5FGM A;  4N4N B;  1RR7 A;  1FYM A;  1XMK A;  3CCM I;  1WJB A;  4NC8 A;  3PM1 A;  2GA1 A;  3GLL A;  2BY0 A;  2XRL A;  4BEH A;  1FYK A;  2VOO A;  4LB5 A;  2IS1 A;  2VT2 A;  4XLH A;  3GTG J;  3QOE A;  3JRC A;  1SEU A;  4UB8 C;  2QVO A;  3RQ4 A;  4XOP A;  2X4H A;  1AKH B;  2K40 A;  4ASN A;  5GTI C;  1Z7L A;  5E17 F;  4IXA A;  3WE3 A;  2PMU A;  1ON1 A;  1BBY A;  5F6F A;  1WCM J;  3W2V A;  1ETW A;  2EFW A;  1FOX A;  3K2A A;  3U2R A;  1BM9 A;  2JZY A;  2HYF A;  1U78 A;  2VKV A;  1ZN2 A;  4LB6 B;  3F8N A;  4BAC A;  2RNG A;  2EB7 A;  3BP8 A;  3LSH A;  2G7H A;  3DP7 A;  2ZBK A;  4D5F A;  5FLX K;  3FX3 A;  3O8H A;  9ANT A;  3OYG A;  4RB0 A;  2JQ7 A;  1YJ9 I;  4E4H A;  4XRM A;  2IP2 A;  2X1E A;  3LQQ A;  5C44 J;  5CQG A;  5CVR A;  1N25 A;  3AG2 H;  3CJQ B;  2ME6 A;  2MD5 A;  3ABK H;  1XDS A;  5FFX A;  2XUB A;  4HQM A;  4BQO A;  2R7U A;  3A01 A;  1G8X A;  2LR8 A;  4L18 B;  3UR3 C;  1O3Q A;  5B1B H;  3OL3 A;  1W36 D;  1ITY A;  1BA5 A;  4AVP A;  2OQR A;  3BDD A;  5CVI A;  3BT9 A;  1IUF A;  1EKE A;  2M7B A;  1R4M B;  1IAW A;  5LEK A;  3M7G A;  3I56 I;  4LJZ F;  4BY7 J;  2ZB9 A;  1IXC A;  4ZDL A;  2QM3 A;  1FSH A;  2W1O A;  4HLY A;  4TV7 A;  3EPZ A;  4AIH A;  3ABU A;  3PUB A;  1HQC A;  3C2G A;  2CWE A;  2R5Z B;  3O3K A;  3ZN1 A;  1MBE A;  2EFN A;  2R7F A;  2R7R A;  1FYL A;  2WC2 A;  1IRF A;  1J59 A;  3SEQ A;  2LY2 A;  3ML6 A;  3TBI A;  1W0U A;  2OA4 A;  4Q48 A;  1Y8Q B;  4ZDP A;  4I7H A;  3C18 A;  5BMZ A;  2PI0 A;  1WGX A;  1XCV A;  1TWA J;  5C4J J;  5BOX A;  1I1G A;  1MBG A;  2HQ5 A;  2O0Y A;  3BLY A;  3HOU J;  4IQJ A;  3JRB A;  4C30 A;  3BCB A;  3WG9 A;  5HLI A;  4M71 A;  2R7V A;  1GHC A;  2DMN A;  1IG7 A;  2DFH A;  4E70 A;  2COM A;  2JT1 A;  3BG5 A;  2PJR B;  3BG7 A;  4DOZ A;  1GLN A;  2LRE A;  2R7Z J;  2XAS A;  5M3F J;  5F1J A;  2DT6 A;  2JA2 A;  2EBI A;  4N0B A;  2LP0 A;  2ZSI B;  5DTD A;  2CQ7 A;  3VFZ A;  1G2H A;  3LSI A;  4YIF A;  5TJJ A;  2KMU A;  5LHI A;  3BRO A;  3OYD A;  1IJW C;  2VOD A;  4DZJ A;  2DYS H;  4NB5 A;  3V42 A;  1LEB A;  4ETS A;  2XAJ A;  4B4C A;  1P2F A;  3WTY C;  2HZT A;  1VF9 A;  1PVE A;  3K1M A;  2HR3 A;  4KIC A;  3O2P E;  4BJT A;  1Z21 A;  2WB1 A;  3GFM A;  1EH8 A;  3EDP A;  5HOO A;  3AKZ A;  1ZTR A;  3J7Z I;  3JSO A;  1VQM I;  2H8R A;  2WAD A;  3IC7 A;  3HTS B;  1VTN C;  2NS7 A;  2VBW A;  2ELH A;  5CVU A;  1ZH5 A;  3QWL A;  2O3F A;  4M9S A;  1MDM B;  1NK3 P;  2PBI A;  2UWM A;  2ICW G;  2KIQ A;  2RDP A;  2NAZ A;  2OPT A;  4YG2 F;  1WH5 A;  2P7C B;  5FLM J;  1ON2 A;  3JRE A;  3QAH A;  4B09 A;  4HV6 A;  4U88 A;  1X1A A;  1Z3Y A;  2XKP A;  3QYE A;  1B8I B;  3D5L A;  1WHU A;  3BR6 A;  4I2O A;  3MN2 A;  1LE8 B;  2L2O A;  4P5O A;  4YFN F;  1OCP A;  2UZK A;  2DOA A;  4CZZ A;  1ZQ3 P;  4IHX A;  3FHZ A;  2GXB A;  2D1V A;  1U9N A;  2FQ3 A;  4D1Q A;  5L3G A;  3F8M A;  4KT5 C;  2VQG A;  3NAR A;  3H36 A;  3B6A A;  1RUN A;  3B73 A;  4BGD A;  1P7J A;  2DK5 A;  5ICG A;  3F0C A;  3ASN H;  2IEK A;  3M9A A;  2JA8 J;  1OLT A;  5LFA A;  2IRF G;  3H1C A;  3LA7 A;  1USS A;  2CJJ A;  3QPS A;  3JAM Z;  1KGS A;  5EEA A;  3E1S A;  2CV0 A;  2K4B A;  5DUK A;  2RN7 A;  2B7E A;  3N97 A;  1I5Z A;  2DBB A;  2QZ8 A;  1UHW A;  1IZ1 A;  1ACI A;  1MND A;  3KP4 A;  3K4L A;  4FAS D;  2HI3 A;  3CDI A;  3F72 A;  1E0E A;  1U5T C;  5FKM A;  2FBH A;  2V9P A;  3I4M J;  4ZYA A;  3ZR8 X;  1MIJ A;  1ZKG A;  1QPI A;  1LFU P;  3ZQQ A;  4LD5 A;  4XBF A;  1PUE E;  3GZ6 A;  1IDY A;  5BPD A;  2MG4 A;  4RLQ A;  5GTH C;  3U1K A;  1HDD C;  3OYF A;  1XB4 A;  3F8F A;  2XAG A;  4RGU A;  3S2W A;  4V2F A;  1JTX A;  1X2N A;  4KN7 X;  2G7U A;  4ITV A;  1MW7 A;  2XRO A;  1IRZ A;  4CUG A;  4AVZ A;  3S17 J;  2XB5 A;  1Y1W J;  4A93 J;  3K4K A;  4U87 A;  5EGO B;  1ZRD A;  3TDU C;  3A0B C;  5E8G A;  1XGS A;  2CFO A;  4X0G A;  4F55 A;  3IRR A;  3T8R A;  3RZO J;  4B3X A;  4LIV A;  4MO7 A;  1N75 A;  2QKM B;  2QKL B;  2VI6 A;  4D9J A;  5EG0 B;  2OJE D;  5F0H A;  1YI2 I;  4KIT B;  3K10 A;  2R93 J;  1W7P D;  2C6Y A;  2DOE A;  2VBX A;  3DTK A;  4CCO A;  3HOW J;  3U21 A;  2DA6 A;  2M4K A;  2CSO A;  1NTC A;  2LG4 A;  1YRN A;  1QQI A;  2MLG A;  2V26 A;  2K3P A;  4S05 A;  2E1N A;  4M3F A;  3HXL A;  2O8X A;  1JTY A;  1WRJ A;  4BAY A;  4P9U A;  4PZJ A;  3SXY A;  4HDV A;  1ETY A;  3Q0U A;  4PJJ A;  3F3X A;  3A03 A;  5KVR A;  1TWH J;  4NHJ A;  2DT7 B;  2IS2 A;  1ZGW A;  4ZZL A;  2MGQ A;  4KIF A;  2VJ4 A;  1SFK A;  3PQK A;  5GAH J;  1KU9 A;  4QTR A;  3L2V A;  3WE2 A;  3TW7 A;  3C3W A;  3JRI A;  4A6E A;  3OMY A;  1BL0 A;  2OC6 A;  2RQP A;  4GCV A;  2J5O A;  3P7N A;  2IGM A;  2R7W A;  3HOX J;  3BJ6 A;  2E34 A;  2QBY B;  3PSF A;  3VPR A;  3OIO A;  2GOX B;  2XGC A;  4CXF A;  2FBK A;  1K6Y A;  3CMA I;  2BY1 A;  4DQ2 A;  2IVM A;  2VBZ A;  1HXD A;  1U2W A;  1UZC A;  1JXS A;  3I71 A;  2PMH A;  4B44 A;  1W5S A;  4A6D A;  4IPA A;  4HW0 A;  1ENH A;  1G4D A;  3LSP A;  5J1U A;  5EF6 A;  3RPU D;  4Y17 A;  3WOD F;  2B63 J;  4FTH A;  3DKX A;  1BR4 A;  1EH7 A;  4M3D A;  2FNA A;  5H6Q A;  5HOD A;  4RB3 C;  4IHW A;  2FXA A;  1XMA A;  2QQ9 A;  1X1P A;  1RIO H;  2W85 A;  3RCO A;  5LEJ A;  3RKY A;  2LY9 A;  3FK6 A;  5CJ9 A;  1HDP A;  1MBF A;  4ANJ A;  1G59 A;  4I99 C;  2W48 A;  5GAE J;  2RNJ A;  4D5C A;  1K61 A;  1CGP A;  5AIQ A;  4EGY A;  3JRD A;  3ABL H;  2VXZ A;  1HST A;  1YW7 A;  4XN0 A;  3VYR B;  1WH7 A;  2P6S A;  2L9V A;  3Q9S A;  5H2F C;  1X19 A;  4L5E A;  3ZMS A;  2I5U A;  2FOK A;  2LNB A;  4ESJ A;  2KJC A;  2ZJ2 A;  4KMF A;  3GTO J;  1SAN A;  5JVT A;  1MKM A;  4XSX F;  3PNV A;  4C2M J;  3CMY A;  2QEN A;  1YTY A;  1XC5 A;  3FXM A;  4UUT A;  4CCJ A;  4YEL A;  3VSL A;  2YSR A;  4CZC A;  2H6B A;  3HHH A;  3GVA A;  3A01 B;  2M3A A;  3JTG A;  4L0Y B;  3OV8 A;  4JBA A;  5DS9 A;  1FT9 A;  4CCL A;  3ZP5 A;  2X0L A;  2KP6 A;  4ON0 A;  2DLL A;  3UKG A;  2R3S A;  4XLF A;  4CHU A;  1IW7 F;  2DMP A;  2QF7 A;  2ZXI A;  3WTZ A;  4IF4 A;  4XOR A;  3BG6 A;  2B9S A;  3MFK A;  5D5X B;  5ICF A;  1BW6 A;  2L3D A;  2M8E A;  4AYB A;  3LFU A;  3JCU C;  4L5J A;  1VQN I;  3DCF A;  2Y2Z A;  1KON A;  2XGE A;  3DQV C;  1MH3 A;  2CW7 A;  2PJP A;  3IH4 A;  2F5V A;  2IGO A;  2M5W A;  2R4G A;  4PSX A;  3RKW A;  1SFX A;  5HLT A;  4KA4 A;  2PMZ N;  3EET A;  2H94 A;  3CMM A;  1QNT A;  2JK3 A;  1WZ2 A;  3CP8 A;  5K7F A;  5EJC A;  3F22 A;  3HRM A;  4MGR A;  4JX5 A;  4XKW A;  4U0V A;  4F92 B;  2OTL I;  3WTW C;  2BEO A;  4PSW A;  2AXT C;  5J4V A;  2DA2 A;  3CCS I;  2DU9 A;  3W3C A;  4RLF A;  3J80 K;  1HKT A;  3BWG A;  4FCY A;  3HOT A;  2ZO4 A;  3ASO H;  2LD5 A;  1YW8 A;  1Y6I A;  3K69 A;  5FLX Z;  2QLZ A;  2ZFU A;  4BH9 A;  4HSR A;  3OYK A;  1ZK8 A;  1R6R A;  1X3W B;  1XGM A;  2QWW A;  3B6C A;  4KT6 A;  3PJR A;  2D5V A;  1WI9 A;  3SHF A;  3FZV A;  4IZZ A;  5TRD A;  4KYW A;  2BVM A;  1WPK A;  1P4A A;  2OBP A;  2RVC A;  3MKY B;  1W7P A;  2F5C A;  4PJM A;  4EM2 A;  1UEL B;  1VQ5 I;  3S2D J;  2IS4 A;  5J8F A;  1UST A;  4PCQ A;  4EQQ A;  3CCY A;  1ZAO A;  2DTR A;  5DM6 F;  4RGR A;  3RTR A;  2E5N A;  2W57 A;  4A5N A;  5B5E C;  1WJ5 A;  3BJA A;  2MFZ A;  2WWY A;  2BHZ A;  3ZPL A;  3P5J A;  4EJT A;  5F08 A;  3D5S C;  3JRF A;  2W84 A;  2HOT A;  1EF4 A;  4OOI A;  1BOA A;  3AFH A;  5KAI C;  1JJ8 C;  3A02 A;  4L9J A;  4R79 A;  4BE1 A;  4EMS A;  4I0A A;  1MBH A;  2DQL A;  4IL6 C;  5DEQ A;  4AID A;  2V6E A;  2BYV E;  1JKO C;  4EM1 A;  2F48 A;  4F93 B;  2BVL A;  2W00 A;  5GPC A;  5LD2 C;  1UHM A;  5ICE A;  2FUG 2;  4AD9 A;  2CH0 A;  4ENJ A;  1YJN I;  2XB0 X;  1A31 A;  2HVS A;  4XKB A;  1T98 A;  2NNY A;  2E2H J;  2CW8 A;  1FWZ A;  1P9Q C;  1G3Y A;  5TGT A;  1WWX A;  2EPF A;  1GV2 A;  1ZR4 A;  4IQ4 A;  3HSR A;  3T0Y A;  1HKQ A;  1JT0 A;  2VJ5 A;  3CZ6 A;  3I3L A;  3KPH A;  3TMO A;  5E79 C;  2ELJ A;  2G9W A;  2O7O A;  3HGY A;  1JI8 A;  2EV5 A;  4N9I A;  3RIR A;  4HF1 A;  3HRT A;  3VYT B;  3I4P A;  3FBN B;  1TNS A;  2X6Y A;  2W7N A;  3ZMT A;  3BQY A;  1ZG1 A;  1MBK A;  5K1Y A;  2Z9O A;  1V54 H;  4A0Y A;  3PO3 J;  3VDX A;  4ABZ A;  2NS0 A;  3NRV A;  2HQR A;  5AON A;  4X6A J;  3GLX A;  1AWC A;  3P9I A;  2JTV A;  3RPU A;  2QQ8 A;  2VUM J;  2JRM A;  2JA6 J;  5EZH A;  4FE7 A;  3SEZ A;  1O7F A;  1U3E M;  3HL2 A;  4BNC A;  1STZ A;  2DFF A;  2VJI A;  4G7H F;  4E7H A;  3CC4 I;  2CV1 A;  2XF7 A;  5IYD J;  1OCT C;  3BTC A;  2GZW A;  3LNQ A;  3E5Q A;  1WJC A;  3WU0 A;  1X3U A;  3DLA A;  3GUD A;  3V7S A;  3RKQ A;  4G6D A;  4E7I A;  4DBQ A;  4QPQ A;  4UXN A;  3KE2 A;  1ETK A;  3LSK A;  5J1R A;  1YQA A;  2EIK H;  4MQV A;  5HLH A;  2WAE A;  3IAM 2;  1IN8 A;  3BG9 A;  2L4A A;  2LMD A;  1TQM A;  3QP5 A;  2Q1Z B;  2M34 A;  3DTI A;  1I27 A;  3WTX C;  4E7K A;  4DIQ A;  1KYZ A;  4BQQ A;  5FB2 A;  3CUO A;  4A3F J;  2XPV A;  2EJR A;  1D0X A;  1P4W A;  4RAY A;  5DD8 A;  2VKH A;  3Q5F A;  3CCR I;  3ZQ7 A;  2Y0S A;  4LLG F;  4A2U A;  1F43 A;  2LKP A;  4GDF A;  4UVC A;  1RC9 A;  1XGO A;  3GZN B;  2PQ8 A;  1LDD A;  3L09 A;  5E8I A;  4P9F A;  4L9T A;  3DBH B;  4NQW A;  3R6S A;  2NOJ B;  2Y30 A;  4HX8 A;  1PP7 U;  2WTE A;  4RMN A;  4BJ6 C;  1YRN B;  2JJ7 A;  1KA8 A;  4CCN A;  1NH3 A;  2P7V B;  2I10 A;  5J6X A;  1X1D A;  1Q1H A;  2A69 F;  3F6O A;  4WXH A;  5IY5 H;  2ME0 A;  3FBI B;  1W0T A;  1ZG3 A;  3BR2 A;  4EJU A;  3I9V 2;  1FPQ A;  2HOA A;  3BQZ A;  3DBL B;  3H9J A;  4AUX A;  3CUQ C;  1REP C;  2A5Y B;  4I01 A;  3MZH A;  3PIO F;  1Y0U A;  4G6T B;  5IT3 A;  3T5X A;  4XRS A;  3J81 K;  1I3Q J;  5ED4 A;  4MHG A;  1Z05 A;  4JOM A;  2F5F A;  2JSP A;  5DDG A;  3LOC A;  2FD5 A;  2Y0M A;  2X9D A;  1HSJ A;  1T38 A;  5ILV A;  1V3F A;  5E1X A;  3LAJ A;  2L9N A;  2VE9 A;  1ZG5 A;  2PLY A;  1BIA A;  1R23 A;  2L7Z A;  5BNG A;  3NEU A;  4M6Y A;  3LST A;  3M1C A;  4PDK A;  2QSF X;  4XK4 A;  4A12 A;  2K9Q A;  2YU3 A;  4I6Z A;  1DU0 A;  2R5Y B;  1PYV A;  4EV0 A;  2HPI A;  1OR7 A;  3DLL F;  4MNU A;  1B9M A;  2FEZ A;  3PSI A;  4LOC A;  5EEH A;  2XHK A;  1TT5 B;  3DKY A;  3H9G A;  3UNG C;  3ULQ B;  4AYB N;  2L7M P;  1S29 A;  2VE8 A;  1O3S A;  2K7L A;  1BC7 C;  1X58 A;  1UMQ A;  1D8K A;  1ZAR A;  4IKF A;  1WJE A;  2HTJ A;  3FMQ A;  1UAA A;  4CYD A;  4CGZ A;  4D7N A;  3QPT A;  1UG0 A;  2A3S A;  6PAX A;  1R1T A;  3FM3 A;  3IH3 A;  2DDB A;  1YOV B;  3JW4 A;  1S6L A;  2HNH A;  4UY8 I;  3AL0 B;  2BW3 A;  2VB6 A;  2XV4 S;  2KKO A;  1OCZ H;  4ENK A;  1IN5 A;  4QIW N;  1LPQ A;  3HKZ A;  2VL8 A;  1TW3 A;  3LSM A;  5H6R A;  2R92 J;  2KQR A;  3ONQ A;  1XD7 A;  3OSG A;  4BDZ A;  1G3T A;  3EYI A;  2Q0O A;  2XAQ A;  3OWT A;  1W5C C;  3CTA A;  2ISZ A;  5FO5 A;  4A3B J;  1LKX A;  2F5D A;  3KIO A;  4W97 A;  3K4C A;  2H27 A;  4H0E A;  3HEF A;  2F2E A;  3O8G A;  5C3E J;  3PFI A;  1FC3 A;  2IA2 A;  1R5I D;  2FU4 A;  1IXS B;  3E5X A;  4G12 A;  1QVU A;  2CU7 A;  1UHS A;  1YIT I;  3G73 A;  2D45 A;  3PUF A;  2VC1 A;  2VOP A;  4WX9 A;  2NYX A;  3QPH A;  3DF8 A;  4I09 A;  4HYE A;  5FKL A;  2VQL A;  2GXG A;  2DA4 A;  3OYN A;  2CFX A;  4M6V A;  1BOB A;  3CCV I;  1W36 C;  3LMM A;  3VOD A;  4ZJZ A;  1IC8 A;  1IRX A;  4UVB A;  2D1H A;  2QCO A;  5F0C A;  2Y9Y A;  1YHQ I;  1BW5 A;  1SVO A;  1FOW A;  3HJE A;  1X2M A;  2ZXW H;  3HPH A;  1APL C;  3HOS A;  5F64 A;  1XS9 A;  2H1K A;  4C9Y A;  3WGI A;  2A05 A;  4LIT A;  1TZL A;  4RA2 A;  1B4A A;  1ETQ A;  3DBR B;  3TED A;  1RZ4 A;  1QBJ A;  2EK5 A;  3HRU A;  4OAZ A;  2KIF A;  3H92 A;  2ZFW A;  2UXN A;  3MZY A;  2XAF A;  5E3M A;  1TP4 A;  3SQN A;  2H09 A;  5C4X J;  3MVP A;  3G71 I;  4ZZD A;  3W6V A;  3GTK J;  4DNC A;  1W7P B;  4BXU A;  3X2Q H;  3BC8 A;  2O9L A;  5EDN A;  3QP6 A;  3LL7 A;  5H20 A;  1XGN A;  4Z6Y A;  3EUH A;  2KIM A;  1R00 A;  2BGC A;  5FKO A;  3HUG A;  4CA0 A;  3REO A;  2VBY A;  4YEJ A;  3M8F A;  4ZYG A;  2AS5 F;  3CES A;  3IKV A;  4LK1 F;  2PMZ A;  2GA2 A;  1S8N A;  5JLW A;  1V55 H;  2A6E F;  4MQ9 F;  3LA2 A;  4E7Z A;  2X6O A;  1SVM A;  2HQA A;  2W24 A;  3E7L A;  3QU6 A;  4Y3O A;  1XTA A;  5IP7 J;  4RBO A;  4BU2 A;  2K86 A;  2M7A A;  4FET A;  3FXJ A;  4HLX A;  5F1R A;  3OYI A;  2ZJQ F;  2M0M A;  2E1M B;  2EV0 A;  3ABT A;  3G4S I;  3I64 A;  2OTJ I;  1IXR C;  3A1Y A;  1ETX A;  1TT0 A;  2FQ4 A;  2V1D A;  3CCQ I;  3QYB A;  3BPV A;  5HDN A;  2FX0 A;  4M9X A;  2HWV A;  2DDA A;  3PO2 J;  3TGN A;  1WQ2 A;  2R0Q C;  2XDV A;  3HTU A;  1T2K A;  5IOY A;  5LGN A;  1ZYR F;  3J80 Z;  2KFD A;  3M4O J;  2DA1 A;  2JUC A;  2ADU A;  1YIO A;  3IRQ A;  4O3M A;  5J4Y A;  1UFM A;  2K9N A;  2Y0S N;  2YX7 A;  1T08 B;  1S7E A;  2O5R A;  2KDZ A;  1AA7 A;  3I59 A;  1R5G A;  3S1M J;  1RET A;  1JKP C;  2IGN A;  4RGX A;  2HS5 A;  1WI3 A;  3DKW A;  3M1E A;  4NDL A;  1N77 A;  4WXD A;  3V7R A;  2AO9 A;  2LF8 A;  4I02 A;  5DCM A;  2EZH A;  1MZB A;  5K7H A;  3RZD J;  2VKE A;  3OSF A;  2BOL A;  3IWF A;  2HOS A;  3MD2 A;  1Y56 A;  3TO9 A;  1OYY A;  3JTH A;  4XLE A;  3F23 A;  2OQG A;  3KEO A;  2H8W A;  1XG1 A;  1EV7 A;  4NBQ A; 
#chains in the Genus database with same CATH homology
 3LWF A;  2FMY A;  2M87 A;  2DI3 A;  1BJA A;  4KIB A;  4BYY A;  5ERI A;  1OYW A;  2MC3 A;  3FXR A;  2ESN A;  1SD5 A;  2ETH A;  2P5K A;  4FHT A;  3ZMZ A;  1OMI A;  3FMS A;  3R0A A;  1H9G A;  3GF2 A;  3L00 A;  5K5O A;  5BPI A;  4LG0 A;  2BE5 F;  3MQ0 A;  1T6S A;  1HW5 A;  3FWE A;  3W6K B;  2QYO A;  2O61 A;  5L3F A;  1BN5 A;  4HZF A;  3KP6 A;  2Q8K A;  4XSZ F;  2OU2 A;  3AAF A;  2A68 F;  2HFH A;  3E6M A;  3R0J A;  2AXL A;  1FSE A;  5AIP A;  2V1X A;  1H9T A;  2ZKZ A;  1FZP B;  3BJO A;  3RJP A;  2XGX A;  5HDK A;  3DEU A;  1J75 A;  3BOQ A;  4HQE A;  5D8K B;  2J5P A;  1LB2 A;  1IN6 A;  2Z5U A;  3TDZ C;  3U1D A;  3U9G A;  2YR2 A;  1K78 B;  5LRS A;  4ZYD A;  4A5M A;  3E5U A;  4HAM A;  2L54 A;  4XLP F;  1T0F A;  2IA0 A;  1XSV A;  3T8T A;  3TOB A;  3V7C A;  2UXX A;  3GYH X;  2LDU A;  4L9V A;  4XLN F;  3J7A O;  5DCF A;  4G7O F;  4CIC A;  3WGH A;  5E1W A;  4ZYH A;  2DW4 A;  3J81 Z;  2DPD A;  1HBX G;  2QQA A;  2OZU A;  1MJA A;  4BHB A;  2PN6 A;  1GXP A;  2ACJ A;  1MGT A;  1PP8 F;  2A07 F;  3K1P A;  3SZP A;  4M74 A;  4AIJ A;  3MWM A;  5D8L B;  1U5T A;  4G6Q A;  1SMT A;  2IW5 A;  3ERE D;  3I58 A;  1O3T A;  1FX7 A;  2B0L A;  2XAH A;  4ESB A;  3F8B A;  1A04 A;  4HDU A;  4R8H A;  4K2E A;  5K5Q A;  1ULY A;  2XRN A;  1LJ9 A;  2TDX A;  1LNW A;  2ZCW A;  1DP7 P;  2O03 A;  1G3S A;  1P92 A;  1HW2 A;  2XKO A;  3KZY A;  1R22 A;  4IVN A;  2KIU A;  1KU3 A;  1R36 A;  5KK1 A;  3RI4 A;  1SFE A;  1YO5 C;  2V79 A;  4HF2 A;  3E6D A;  5D5U B;  3P9C A;  1ODD A;  3H3Z A;  2GWR A;  1YS7 A;  4O6J A;  4RAZ A;  1IRG A;  2GIV A;  2IT0 A;  1J5Y A;  2Y48 A;  4EM0 B;  2L02 A;  1DUX C;  4Z2Y A;  2IPQ X;  4XRF A;  1P6R A;  2EV6 A;  4LLN A;  1SAX A;  1FY7 A;  4IRH A;  1UB9 A;  3E97 A;  1L3L A;  4QWQ A;  1QGP A;  4I0B A;  4ZH4 F;  2D2W A;  2YPR A;  3ZN0 A;  2Q2E A;  3ROU A;  1CF7 A;  3FM5 A;  4P55 A;  2DT5 A;  4GYI A;  2E7W A;  4KFC A;  1OPC A;  3I59 B;  2O6G E;  4G8X A;  2RV8 A;  1XCB A;  3TQN A;  2ZNZ A;  4PGH A;  4Q4Z F;  2JPB A;  2EFO A;  3C7J A;  1MJ9 A;  5HS8 A;  3LA3 A;  1FP1 D;  2W25 A;  3GO5 A;  2MH9 A;  3QRF F;  4M6X A;  3CO6 C;  3EYY A;  4OIO F;  3D0S A;  5HDG A;  1U6G A;  3ISP A;  1B9N A;  3HSE A;  1Z6R A;  3F6V A;  3KP3 A;  1KQ0 A;  1RNL A;  1LDJ A;  4LG0 B;  1G6N A;  4HA8 A;  3HSF A;  1TLH B;  1U8R A;  1B6A A;  3E6C C;  4UV9 A;  2GQQ A;  1Z7U A;  1NHA A;  5L3D A;  1KQ8 A;  2L4M A;  1EH6 A;  4AIK A;  1K7A A;  2DFI A;  5LBQ A;  4BQA A;  3L7W A;  3GZ5 A;  3GW2 A;  4L9N A;  1SD6 A;  1TBX A;  2HKX A;  4FX0 A;  1KU7 A;  1O7L A;  2RKH A;  1ZRF A;  1YLF A;  4ESF A;  5E18 F;  2EFP A;  5BS6 A;  2STT A;  3GWZ A;  5K5R A;  4OIR F;  3RPQ A;  4Y15 A;  5IT9 K;  4MEY F;  2QUF A;  2EFQ A;  1BI1 A;  2MH2 A;  1IN4 A;  3KP2 A;  4B8X A;  3FMR A;  1GXQ A;  4LLL A;  2HTS A;  4MEX F;  5JR3 A;  4D0P A;  2QBY A;  4MTD A;  1XSD A;  1WSU A;  1YW9 A;  1JHF A;  2HYG D;  1F4K A;  4LGW A;  1H0M A;  2XVC A;  3MAJ A;  3RYR A;  4FX4 A;  2ZME A;  4R1H A;  1HW1 A;  2BBY A;  2RGV A;  5D6F A;  1D5V A;  1FOK A;  2FA5 A;  1I1S A;  4RB1 A;  2VN2 A;  1YG2 A;  2ISY A;  3W6J B;  2CG4 A;  3K1N A;  2FE3 A;  2P4W A;  1J2X A;  2LF7 A;  4KUM A;  1E17 A;  2K27 A;  4YFX F;  3F21 A;  1D8J A;  1W5T A;  1BI3 A;  2ZXJ A;  5CYV A;  2VT3 A;  2DK8 A;  2CQK A;  1U5T B;  1YFH A;  1T39 A;  1R58 A;  3LQR A;  1FLI A;  1IUY A;  4OIQ F;  2A6H F;  1F9N A;  4G94 A;  1GVJ A;  1ZLK A;  2K4J A;  5HLG A;  3GX4 X;  2M1B A;  1TNT A;  2FF4 A;  3I53 A;  1XSX A;  3GFL A;  3WTV C;  4EVI A;  3CLO A;  3V8J A;  4L5I A;  5CLS A;  1SD7 A;  5ICC A;  5A2Q K;  2IA1 A;  4CO8 A;  2A61 A;  5L3C A;  1FBS A;  4WXC A;  1DDN A;  3RYP A;  1TTY A;  3R61 A;  5LLQ A;  5EEG A;  2JPC A;  4ENM A;  2CO5 A;  4IRG A;  1R1U A;  2R7D A;  3BZ6 A;  3NQO A;  4U7B A;  2BV6 A;  3KLN A;  4WWC A;  3PQJ A;  4WCG A;  4IJA A;  3MCZ A;  1OYI A;  4HBL A;  2OD5 A;  3DFG A;  3V8L A;  1S3J A;  3CUQ A;  3DPL C;  2FNP A;  1SMY F;  1O3R A;  5D4R A;  1IF1 A;  4U0Y A;  2YX4 A;  1KQ9 A;  1ZHF A;  3LFK A;  2KRF A;  3I5U A;  2EA2 A;  1ONV A;  1F5T A;  1CF7 B;  1XDU A;  3KLO A;  5E1Z B;  2E1C A;  1R5H A;  3KZZ A;  4N9H A;  4Q5S F;  2CYY A;  1J9I A;  3CDH A;  1O57 A;  1R1V A;  2JRT A;  5D4S A;  5LGT A;  2HQN A;  1KU2 A;  4RB2 C;  2QQB A;  3VOE A;  1JHH A;  3T1B A;  3ZMV A;  2M45 A;  2EA4 A;  1QZZ A;  3VEP A;  1K6O A;  4OU0 A;  3HHG A;  2HEO A;  1W4M A;  4OIN F;  3MEX A;  5JI6 A;  4IHT A;  1L0O C;  1S7O A;  2VON A;  5FD5 A;  4WF2 A;  2HGC A;  2HOE A;  3IKT A;  4P96 A;  2LSO A;  1B59 A;  2Y75 A;  5L3E A;  1ZLJ A;  3H3U A;  2KJB A;  4U0W A;  4G9Y A;  2HDC A;  5FFZ A;  2P5V A;  1B1B A;  4O5V A;  3GFI A;  3I54 A;  3KFW X;  4YFK F;  1RI7 A;  4U7D A;  5L3B A;  1BI2 A;  4KIG A;  2PG4 A;  3OOP A;  3HRS A;  2FBI A;  4FT8 A;  4IRI A;  3FXQ A;  5HS9 A;  3ECO A;  4EJV A;  3JSP A;  1S7A A;  1D3Y A;  5JFR A;  3QU3 A;  3V4G A;  3K0L A;  3B02 A;  2DO7 A;  2FSW A;  1HKS A;  3KET A;  3DPT A;  4LFU A;  4M72 A;  5DD4 A;  4G7Z F;  2EWN A;  3M8E A;  4GGG A;  4EJW A;  1FBQ A;  3IHU A;  2P8T A;  2DPU A;  3E3V A;  2ZME B;  4HX7 A;  4WK8 F;  4BHC A;  5DV5 A;  4OMY A;  2Z3Y A;  1SFU A;  4Q47 A;  5D5V B;  3BY6 A;  3ECH A;  1UCR A;  2MBF A;  1LQ1 A;  3GEZ A;  1J0R A;  4YII A;  5JHU A;  4GO1 A;  3WGG A;  1FP2 A;  1DPU A;  3TO6 A;  2CGP A;  3TOA A;  4RS8 A;  5IT9 Z;  1MD0 A;  4HF0 A;  5CVV A;  1C0W A;  2E7X A;  1QZY A;  3WTS C;  5HVQ C;  2NRA C;  2JSC A;  2OAZ A;  1MJB A;  2XIG A;  1Z6T A;  1RUO A;  4HOB A;  4OIP F;  4ZYE A;  3P9K A;  2WV0 A;  4RGS A;  4GYG A;  4QLC U;  3K2Z A;  5D5W B;  4LK0 F;  4A0X A;  1I6X A;  3ELK A;  1YYV A;  1TW2 A;  3G3Z A;  1WKM A;  3IWZ A;  4EGZ A;  2Z33 A;  3SFZ A;  4S04 A;  1ZGJ A;  4A0Z A;  3GFJ A;  4BHP A;  3JAM K;  1TQP A;  2FML A;  1OKR A;  1Z9C A;  3CJN A;  1JGS A;  5CVJ A;  2K02 A;  4HV5 A;  1AOY A;  5E20 A;  3TO7 A;  4JK1 X;  4UHT A;  2STW A;  3CUQ B;  1LVA A;  1DPR A;  2HKO A;  2PEX A;  4UVA A;  4LMY A;  1MDM A;  1IN7 A;  3FF5 A;  1R7J A;  3QOP A;  5HS7 A;  1SD4 A;  1FNN A;  3F8C A;  3WTU C;  3LAP A;  3IL2 A;  3E6B A;  5A2Q Z;  2VC0 A;  4ENN A;  2IJL A;  1K79 A;  2PFB A;  1E2X A;  4L0Z B;  4GXO A;  4KN4 X;  3SZT A;  1LEA A;  2ESH A;  5DCM B;  3KEQ A;  3VB2 A;  2GAU A;  2P5L C;  2DAO A;  4CDG A;  2V1U A;  1F1Z A;  3R60 A;  5ILU A;  4KDP A;  4EJO A;  5LGU A;  5DUI A;  2V9V A;  3HIF A;  2P6T A;  1Z1D A;  3I0T A;  5FD6 A;  1PDN C;  4M73 A;  3WTT C;  5LHH A;  3ZMD A;  2M30 A;  2F5E A;  3WU1 B;  3CO7 C;  3EQL F;  3DV8 A;  4AWX B;  3O6B B;  4HX4 A;  2ZNY A;  2L01 A;  2Z99 A;  1P4X A;  3L2C A;  3FXU A;  3GXO A;  4MTE A;  3N4M A;  3COA C;  1ZRC A;  1TQI A;  2DQR A;  1BI0 A;  3C1D A;  4JQF A;  4UV8 A;  2V6C A;  1Z91 A;  1KYW A;  4UNO A;  4KNY A;  1XN7 A;  3HYI A;  2CW0 F;  1QO0 D;  1J7K A;  1V4R A;  4KMU X;  2H6C A;  5ILS A;  1BC8 C;  3Q9V A;  1G3W A;  4OMZ A;  1JE8 A;  5D6E A;  2RC4 A;  3V8K A;  3R4K A;  1LDK B;  4M9Z A;  3RKX A;  1YS6 A;  3TKY A;  4I98 B;  3KP5 A;  2MA3 A;  1FBU A;  2FRH A;  3L9F A;  4UUV A;  3K9T A;  3KP7 A;  1BIB A;  3RDI A;  1ZGA A;  5J8C A;  4Y13 A;  2OZ6 A;  4F7Z A;  5LHG A;  3ZMU A;  3KCC A;  2NNN A;  5LRR A;  5BQT A;  1QPM A;  2MLK A;  1ZRE A;  4PGG A;  3BPX A;  3DXJ F;  4IHS A;  5DYM A;  1K78 A;  5FGM A;  1FYM A;  1XMK A;  2GA1 A;  1FYK A;  2VOO A;  4LB5 A;  2VT2 A;  2QVO A;  2X4H A;  4ASN A;  5E17 F;  4IXA A;  3WE3 A;  2PMU A;  1ON1 A;  1BBY A;  5F6F A;  2EFW A;  3U2R A;  1BM9 A;  2JZY A;  2HYF A;  1U78 A;  1ZN2 A;  4LB6 B;  3F8N A;  3BP8 A;  2EB7 A;  2G7H A;  3DP7 A;  2ZBK A;  5FLX K;  3FX3 A;  4RB0 A;  2IP2 A;  3LQQ A;  5CVR A;  2MD5 A;  1XDS A;  5FFX A;  2XUB A;  4HQM A;  4L18 B;  1O3Q A;  4AVP A;  2OQR A;  3BDD A;  5CVI A;  1IAW A;  5LEK A;  3M7G A;  4LJZ F;  1IXC A;  2QM3 A;  1FSH A;  4HLY A;  4TV7 A;  4AIH A;  3ABU A;  1HQC A;  2CWE A;  3O3K A;  3ZN1 A;  2EFN A;  2R7F A;  1FYL A;  2WC2 A;  1IRF A;  1J59 A;  3ML6 A;  2OA4 A;  4Q48 A;  4I7H A;  3C18 A;  5BMZ A;  2PI0 A;  1XCV A;  5BOX A;  1I1G A;  2O0Y A;  3WG9 A;  5HLI A;  4M71 A;  1GHC A;  4E70 A;  2COM A;  2JT1 A;  2XAS A;  4N0B A;  3VFZ A;  5LHI A;  4YIF A;  5TJJ A;  3BRO A;  2VOD A;  4NB5 A;  1LEB A;  4ETS A;  2XAJ A;  1P2F A;  3WTY C;  2HZT A;  4KIC A;  3K1M A;  2HR3 A;  3O2P E;  3GFM A;  1EH8 A;  3EDP A;  5HOO A;  3JSO A;  3HTS B;  3IC7 A;  1VTN C;  2VBW A;  2ELH A;  5CVU A;  1ZH5 A;  4M9S A;  2O3F A;  1MDM B;  2UWM A;  2PBI A;  2RDP A;  2NAZ A;  4YG2 F;  2P7C B;  1ON2 A;  3QAH A;  4B09 A;  4HV6 A;  4U88 A;  2XKP A;  3D5L A;  4I2O A;  4P5O A;  4YFN F;  2UZK A;  4CZZ A;  2GXB A;  3FHZ A;  2D1V A;  2FQ3 A;  5L3G A;  3F8M A;  4KT5 C;  1RUN A;  3B73 A;  2DK5 A;  5ICG A;  3M9A A;  2IRF G;  3LA7 A;  1USS A;  3JAM Z;  1KGS A;  2K4B A;  5DUK A;  2RN7 A;  3N97 A;  1I5Z A;  2DBB A;  2QZ8 A;  1UHW A;  1IZ1 A;  3KP4 A;  3F72 A;  1U5T C;  2FBH A;  4LD5 A;  4XBF A;  1PUE E;  3GZ6 A;  5BPD A;  1XB4 A;  3F8F A;  2XAG A;  4RGU A;  3S2W A;  4KN7 X;  2G7U A;  2XRO A;  1ZRD A;  3TDU C;  5E8G A;  1XGS A;  3IRR A;  3T8R A;  1W7P D;  2C6Y A;  2VBX A;  2CSO A;  1QQI A;  2MLG A;  4S05 A;  2E1N A;  2O8X A;  1WRJ A;  4BAY A;  4P9U A;  4PZJ A;  3SXY A;  4HDV A;  3F3X A;  5KVR A;  4NHJ A;  4ZZL A;  4KIF A;  3PQK A;  1KU9 A;  3WE2 A;  3C3W A;  4A6E A;  2RQP A;  4GCV A;  2J5O A;  3P7N A;  3BJ6 A;  2QBY B;  4CXF A;  2FBK A;  4DQ2 A;  2IVM A;  2VBZ A;  1HXD A;  1U2W A;  1JXS A;  3I71 A;  2PMH A;  1W5S A;  4A6D A;  4IPA A;  4HW0 A;  1G4D A;  4Y17 A;  3WOD F;  1EH7 A;  5H6Q A;  2FNA A;  4RB3 C;  2FXA A;  1XMA A;  2QQ9 A;  1RIO H;  2W85 A;  5LEJ A;  3RKY A;  5CJ9 A;  2RNJ A;  1CGP A;  5AIQ A;  4EGY A;  2VXZ A;  1HST A;  1YW7 A;  2P6S A;  3Q9S A;  3ZMS A;  2FOK A;  2LNB A;  4ESJ A;  2KJC A;  2ZJ2 A;  4KMF A;  5JVT A;  1MKM A;  4XSX F;  2QEN A;  1YTY A;  2YSR A;  2H6B A;  3HHH A;  3GVA A;  3JTG A;  4L0Y B;  3OV8 A;  4JBA A;  1FT9 A;  3ZP5 A;  2X0L A;  4CHU A;  4ON0 A;  2DLL A;  2R3S A;  1IW7 F;  3WTZ A;  4IF4 A;  3MFK A;  5D5X B;  5ICF A;  2L3D A;  2M8E A;  4L5J A;  3DQV C;  2PJP A;  2M5W A;  3RKW A;  1SFX A;  4KA4 A;  3EET A;  2H94 A;  1QNT A;  3F22 A;  3HRM A;  4MGR A;  4U0V A;  3WTW C;  2BEO A;  2DU9 A;  3J80 K;  1HKT A;  3BWG A;  3HOT A;  2ZO4 A;  1YW8 A;  3K69 A;  5FLX Z;  2QLZ A;  4BH9 A;  2QWW A;  1XGM A;  1WI9 A;  3SHF A;  3FZV A;  5TRD A;  4KYW A;  1P4A A;  2OBP A;  2RVC A;  1W7P A;  2F5C A;  4EM2 A;  5J8F A;  1UST A;  4PCQ A;  4EQQ A;  1ZAO A;  2DTR A;  4RGR A;  3RTR A;  2W57 A;  4A5N A;  3BJA A;  2WWY A;  3ZPL A;  4EJT A;  2W84 A;  4OOI A;  1BOA A;  4L9J A;  4R79 A;  4EMS A;  4I0A A;  5DEQ A;  2DQL A;  2BYV E;  4EM1 A;  1UHM A;  5ICE A;  4AD9 A;  4ENJ A;  1T98 A;  2NNY A;  1FWZ A;  1G3Y A;  1WWX A;  3T0Y A;  3HSR A;  1HKQ A;  2G9W A;  2EV5 A;  4N9I A;  3RIR A;  4HF1 A;  3HRT A;  3I4P A;  1TNS A;  3ZMT A;  1ZG1 A;  5K1Y A;  2Z9O A;  4A0Y A;  2NS0 A;  3NRV A;  2HQR A;  5AON A;  3GLX A;  1AWC A;  3P9I A;  2JTV A;  3RPU A;  1O7F A;  1U3E M;  4BNC A;  1STZ A;  4G7H F;  2GZW A;  3E5Q A;  3WU0 A;  1X3U A;  3GUD A;  3V7S A;  4G6D A;  4UXN A;  3KE2 A;  1YQA A;  5HLH A;  4MQV A;  1IN8 A;  2L4A A;  3QP5 A;  1TQM A;  1I27 A;  3WTX C;  1KYZ A;  5FB2 A;  3CUO A;  2EJR A;  1P4W A;  4RAY A;  5DD8 A;  3Q5F A;  3ZQ7 A;  4LLG F;  4A2U A;  2LKP A;  4UVC A;  1XGO A;  3L09 A;  5E8I A;  2PQ8 A;  1LDD A;  4P9F A;  4L9T A;  4NQW A;  3R6S A;  4HX8 A;  1PP7 U;  2WTE A;  1KA8 A;  2P7V B;  5J6X A;  1Q1H A;  2A69 F;  3F6O A;  4WXH A;  1ZG3 A;  4EJU A;  1FPQ A;  1REP C;  3CUQ C;  2A5Y B;  4I01 A;  3MZH A;  1Y0U A;  5IT3 A;  3T5X A;  3J81 K;  5ED4 A;  4MHG A;  1Z05 A;  2F5F A;  5DDG A;  2Y0M A;  1HSJ A;  1T38 A;  5ILV A;  1V3F A;  5E1X A;  3LAJ A;  2VE9 A;  1ZG5 A;  2PLY A;  1BIA A;  1R23 A;  3NEU A;  4M6Y A;  3LST A;  4PDK A;  4A12 A;  2YU3 A;  4EV0 A;  1OR7 A;  4MNU A;  1B9M A;  2FEZ A;  5EEH A;  2XHK A;  3ULQ B;  1S29 A;  2VE8 A;  1O3S A;  2K7L A;  1BC7 C;  1D8K A;  1ZAR A;  2HTJ A;  3FMQ A;  4CYD A;  4CGZ A;  3QPT A;  2A3S A;  6PAX A;  1R1T A;  3FM3 A;  3JW4 A;  1S6L A;  2XV4 S;  2KKO A;  4ENK A;  1IN5 A;  1TW3 A;  5H6R A;  1XD7 A;  3EYI A;  1G3T A;  2Q0O A;  2XAQ A;  3CTA A;  2ISZ A;  5FO5 A;  2F5D A;  2H27 A;  4H0E A;  2F2E A;  3PFI A;  1FC3 A;  2IA2 A;  2FU4 A;  1IXS B;  3E5X A;  3G73 A;  2D45 A;  2VC1 A;  2VOP A;  4WX9 A;  2NYX A;  3QPH A;  3DF8 A;  4I09 A;  4HYE A;  2GXG A;  2CFX A;  3VOD A;  4UVB A;  2D1H A;  3HOS A;  5F64 A;  3WGI A;  1B4A A;  1RZ4 A;  1QBJ A;  2EK5 A;  3HRU A;  2KIF A;  3H92 A;  2ZFW A;  2UXN A;  3MZY A;  2XAF A;  3SQN A;  2H09 A;  4ZZD A;  4DNC A;  1W7P B;  4BXU A;  3QP6 A;  5H20 A;  1XGN A;  3EUH A;  2KIM A;  1R00 A;  2BGC A;  3HUG A;  3REO A;  2VBY A;  4ZYG A;  3M8F A;  2AS5 F;  3IKV A;  4LK1 F;  2GA2 A;  1S8N A;  2A6E F;  4MQ9 F;  3LA2 A;  2W24 A;  3QU6 A;  2K86 A;  4HLX A;  5F1R A;  2EV0 A;  3ABT A;  3I64 A;  1IXR C;  2V1D A;  3BPV A;  5HDN A;  4M9X A;  2HWV A;  3TGN A;  1WQ2 A;  3HTU A;  1T2K A;  5LGN A;  1ZYR F;  3J80 Z;  2ADU A;  1YIO A;  3IRQ A;  4O3M A;  1UFM A;  2YX7 A;  3I59 A;  1R5G A;  4RGX A;  2HS5 A;  3DKW A;  3M1E A;  4WXD A;  3V7R A;  2LF8 A;  4I02 A;  5DCM A;  1MZB A;  3IWF A;  3TO9 A;  1OYY A;  3JTH A;  3F23 A;  2OQG A;  3KEO A;  1EV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...