5ERIA

Marr protein from peptoclostridium difficile da00132
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
153
Chain Sequence
b'RGSHMLIKTLDSNILREVGTLSRAVNSINDIKYKELKLQKGQFTFLTRICENPGINLVELSNMLKVDKATTTKAIQKLIKAGYVDKKQDKFDKRGYNLTPTDKSLEVYELIIEEENRSIEICFDNFTDEEKQVVTKLLEKMSKNVENEWFKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MarR family transcriptional regulator
molecule tags Transcription
source organism Peptoclostridium difficile
publication title Crystal structure of the multiple antibiotic resistance regulator MarR from Clostridium difficile
doi rcsb
total genus 55
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2015-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5eriA00
4R79A 1TNTA 2LNBA 4OMYA 4FX4A 1ZRCA 4ZYDA 2VE8A 5JVTA 4CGZA 1SMYF 3KEOA 2IW5A 2CW0F 4YG2F 2XAHA 4BAYA 3FMRA 2VC0A 1XCBA 4AVPA 3NQOA 2KIMA 4JK1X 4ON0A 1FYKA 2ETHA 5IT9Z 3ZMVA 3AAFA 3QRFF 4EJTA 3T1BA 3E5XA 1O3QA 1PUEE 2L54A 4CICA 4KNYA 4E70A 3JTGA 1ZLKA 3SQNA 2MD5A 2G7UA 1CF7B 5BOXA 4Q5SF 5E1WA 2FSWA 5LRRA 4KMFA 1Z9CA 1IXCA 5DD4A 1B9NA 1OPCA 4PGGA 4YFNF 4YFXF 3F3XA 2OAZA 1LDJA 5JFRA 3IKTA 1MDMA 3DP7A 1ULYA 4EGYA 2K86A 2QWWA 5ILSA 4UVCA 4Z2YA 1HQCA 3HRSA 3Q9SA 4PGHA 1KQ8A 4Q47A 2O3FA 2Y0MA 3KLOA 1Z6RA 2XIGA 3F8FA 5AIQA 1XGMA 3I4PA 1ZRFA 1IN7A 4LGWA 2M30A 4I2OA 3CUQA 4FX0A 2RNJA 5F1RA 4U7BA 3RKWA 2EFWA 3KFWX 2OBPA 4ENJA 4GYIA 4HLYA 1H9GA 1XGNA 2RQPA 1FSHA 2GWRA 4MNUA 3I59A 3ZMDA 1UHWA 5ED4A 2IVMA 4RB1A 4I09A 4RGXA 2XAQA 1Y0UA 5CYVA 1BM9A 2VXZA 2XRNA 1IN6A 1K79A 2YR2A 1O3RA 4IRIA 1U6GA 2NS0A 1QZYA 2P5LC 1R00A 4EV0A 3L09A 3FWEA 1BJAA 3KLNA 1G6NA 1BN5A 4HDVA 1Z1DA 3WG9A 5FFXA 2HKXA 2L3DA 2GIVA 4IPAA 2YX7A 2ZMEB 3BJAA 2HGCA 4KN7X 2K27A 4WXCA 3CO7C 3PFIA 2IA1A 2D1HA 3M7GA 2RN7A 1I27A 4G8XA 2CGPA 2A6EF 1LB2A 3E6MA 1B4AA 2VBWA 4OIQF 1WQ2A 2BBYA 1EV7A 3ISPA 4EJVA 2P4WA 1P6RA 1E2XA 4O5VA 5HDNA 2LDUA 4A0YA 1BI1A 1XCVA 1O3SA 2WWYA 2J5OA 2DQLA 3TOAA 2XKPA 4YIFA 4MHGA 3QOPA 3IKVA 3VFZA 1G4DA 3DQVC 2MA3A 1L3LA 4UVBA 2EV6A 4PZJA 4HQMA 3I0TA 1YYVA 3TOBA 3RYPA 3V8JA 2IT0A 5FD5A 3SXYA 1WSUA 5DYMA 5D8KB 1ZAOA 5K5QA 3GUDA 3HYIA 5HLGA 3S2WA 1BOAA 3RPQA 2UWMA 3DXJF 2W85A 3CTAA 1BIBA 3F8MA 2QLZA 2DK8A 1TQMA 3JTHA 1FYLA 3ZMSA 2QUFA 3NRVA 2VONA 5KK1A 1USSA 5D5XB 1IRGA 2E1CA 5FLXK 1F5TA 2Y48A 2FBKA 1U5TC 2VT3A 2OQGA 2W57A 4KYWA 1H0MA 2WV0A 1PP7U 2JRTA 4WF2A 5LEJA 5DDGA 5FLXZ 2RC4A 2QM3A 3F6OA 3WODF 3WU0A 1CGPA 4LK0F 2Z99A 1BI3A 2FQ3A 4P5OA 1J0RA 1SFUA 3WGHA 3CDHA 4ESJA 1P4WA 3BROA 4OU0A 3E3VA 3ZP5A 5D5UB 3HIFA 4KT5C 3K1PA 3ROUA 2UXNA 1JHFA 1U5TB 2VBXA 1IUYA 1G3TA 1YW7A 3TDZC 1BBYA 2R7DA 3I53A 4L5IA 1FOKA 1HW1A 4RAYA 2DO7A 1LJ9A 2YX4A 1GHCA 3U1DA 1YG2A 5FGMA 3W6KB 3SZTA 4GGGA 4IJAA 1AWCA 2HTSA 4EJOA 2AXLA 4G7ZF 4XSZF 4JQFA 3V7RA 3V8LA 2D45A 2NAZA 2OQRA 2IA0A 1BI2A 1FX7A 4GO1A 3VODA 2F5FA 1XGOA 2EWNA 2A69F 4A5MA 1W5SA 4KIBA 4YFKF 1LQ1A 5TJJA 5JR3A 5BQTA 3GWZA 3LQRA 2E1NA 2FXAA 3KP6A 4ENKA 5LHGA 2V6CA 3CUQC 1S8NA 4QLCU 5ICGA 5DCFA 2V9VA 3RI4A 3FMQA 4IRHA 2ZMEA 3RPUA 4EJUA 2XGXA 1KYZA 1HKSA 3R61A 3I64A 4UNOA 2O8XA 3GW2A 2V1XA 2KRFA 2PQ8A 1RI7A 1UFMA 4IF4A 3HSFA 1AOYA 3ZMUA 2RKHA 3OOPA 3O6BB 4UXNA 1IW7F 2TDXA 3HHHA 2NYXA 4Y15A 1IAWA 2RGVA 2OU2A 2FMYA 2KJBA 4HF1A 4GCVA 1MZBA 2IA2A 1K7AA 5ILVA 3U9GA 3W6JB 1O57A 2YSRA 4P96A 3HSRA 3JAMK 3WTVC 3ABTA 2NNYA 4B8XA 4I7HA 1H9TA 3R0AA 1HW5A 2ZNZA 2GXBA 5CVUA 3ZPLA 1U2WA 5D6FA 4EJWA 2P5VA 4WK8F 1STZA 2FF4A 4KUMA 4O6JA 3LA2A 1PP8F 3GFMA 2CYYA 4S04A 1P92A 4A12A 2EV5A 4KIFA 2EB7A 3REOA 2W24A 4GXOA 5L3FA 1X3UA 1Z6TA 2R3SA 1Z7UA 4M6YA 2Z9OA 3J80K 3HTSB 1OKRA 2HEOA 1HKQA 1USTA 3CUOA 2A3SA 5H6RA 3FMSA 5CVJA 3E6CC 1IF1A 4UV9A 2MBFA 1W7PD 4NQWA 4K2EA 3T8TA 3MQ0A 4L5JA 4P9FA 2A61A 4N9IA 4EQQA 1T39A 3IC7A 5L3DA 3F8BA 2VODA 5HLIA 3LAPA 5DUKA 4KIGA 4BQAA 3ML6A 2PMHA 4UVAA 1ZLJA 3WTUC 2V1UA 4BYYA 5IT9K 3WE3A 1T2KA 1DUXC 5D5VB 3TO6A 2MH9A 4HYEA 5ICCA 3FF5A 3NEUA 1TTYA 3GYHX 1BIAA 2Y75A 3GEZA 4N9HA 2OA4A 2H6BA 2PMUA 4PCQA 5F64A 3JSPA 5CVIA 2Z33A 3E6BA 3O3KA 4LK1F 3ECOA 2Q2EA 1RUOA 3JW4A 2FU4A 4G94A 1QPMA 2QQBA 4U88A 3GVAA 2FRHA 4ENMA 3GLXA 1W4MA 3T5XA 4OMZA 4G6QA 1RNLA 1TQIA 5IT3A 2D2WA 3I59B 3GFLA 3RTRA 3BPVA 3DV8A 1R7JA 1OMIA 4DNCA 2EA2A 1UB9A 4HV6A 3LWFA 1DDNA 2LF7A 5L3CA 5D5WB 5ICFA 2JPBA 3H92A 5J8FA 1O7LA 3SHFA 1QGPA 3L2CA 4A0XA 2HTJA 2ISZA 2O0YA 4XRFA 3HRMA 2GQQA 2XROA 2DAOA 3HOTA 4L0YB 2ZCWA 1Q1HA 1JGSA 2Q0OA 6PAXA 3R60A 1FBQA 2DBBA 4Y17A 4HX7A 2VC1A 3TGNA 1D5VA 4A0ZA 1OYYA 4RB3C 1XSXA 5H6QA 3KP5A 5DV5A 5JHUA 4XSXF 2ZKZA 3KP7A 4WXDA 1DPRA 2RVCA 2ZO4A 3H3UA 2CO5A 1ON1A 4WWCA 3K1MA 2KIUA 3KE2A 5CVRA 4H0EA 3ZN0A 3C3WA 4HF2A 3D0SA 2M8EA 2H27A 2HR3A 4EM1A 4ZH4F 4IHTA 3MCZA 3ZMTA 2H6CA 5AIPA 4WX9A 5ILUA 1G3YA 4UV8A 1YS6A 1QBJA 5HVQC 4QWQA 3MFKA 4L9TA 3K2ZA 1GXPA 2YU3A 3O2PE 2E7WA 1RIOH 2BEOA 2FBIA 1JE8A 3EYIA 1HSJA 4HV5A 3Q9VA 2E7XA 3R6SA 1RZ4A 4HAMA 3IRRA 3VOEA 2QYOA 5LGTA 4L9JA 5E1XA 4F7ZA 2JT1A 4CDGA 3P7NA 4OOIA 4HX8A 4AWXB 1CF7A 3G73A 5DCMA 4ASNA 4G7HF 2PN6A 1F4KA 1V3FA 2K4JA 4KFCA 1FBUA 2K02A 1XGSA 4BHPA 1ONVA 1LDKB 1R36A 4M72A 4BHCA 4RB0A 2IJLA 3Q5FA 3IWFA 3M9AA 3DF8A 2RDPA 1TW2A 2GA2A 2VE9A 2ESNA 4OINF 4AIHA 2K7LA 4ZZLA 4L9NA 2BYVE 3WTYC 2V79A 2QBYA 3FHZA 2DTRA 4HF0A 4OIOF 1VTNC 5K1YA 5K5RA 5L3BA 2YPRA 4MEYF 1XDUA 1BI0A 4L18B 3J80Z 4AIJA 3J81Z 5F6FA 3RYRA 4KMUX 1TNSA 1SFXA 2VOOA 4HW0A 3TQNA 2M1BA 4U0VA 2HKOA 2DPUA 1WWXA 4U0WA 2DQRA 2A5YB 5L3EA 4LG0A 4MQ9F 2KIFA 5DUIA 4RAZA 1FZPB 1J2XA 4MTDA 2HYGD 1KU2A 1A04A 2DPDA 4P55A 3U2RA 2XUBA 4R8HA 2HDCA 2L01A 3P9IA 2PFBA 5DCMB 3GZ6A 3J7AO 2FNAA 3J81K 2VOPA 5AONA 2MC3A 3RDIA 3LA3A 4L9VA 5CLSA 5D4SA 5E8IA 1T98A 2F2EA 3BZ6A 2WC2A 5HDGA 1FPQA 2UZKA 2VN2A 3BDDA 1KGSA 1R5HA 1SD6A 2ZFWA 4R1HA 1NHAA 4MQVA 1W5TA 2WTEA 1FBSA 4WCGA 3FX3A 2ZJ2A 4BH9A 1U3EM 1J5YA 2QENA 4IXAA 2ADUA 1WKMA 2JTVA 1ZG3A 2XAFA 4JBAA 5KVRA 3C18A 2PI0A 1D8JA 3CLOA 3EQLF 4OIRF 2L4AA 5LHIA 3E5QA 4ZYHA 3WTSC 1KU3A 1KQ9A 3WTZA 3WE2A 2PG4A 2EJRA 4LLGF 1MD0A 2M45A 4XBFA 1F1ZA 3R0JA 2DT5A 1IXSB 3L7WA 3P9KA 5A2QZ 3KETA 3FXUA 3K9TA 2XKOA 5L3GA 1YFHA 1U78A 4KDPA 1QQIA 1J7KA 2MH2A 4Y13A 1ZG1A 4LB6B 2EK5A 5J8CA 4NHJA 1HXDA 1B9MA 4HLXA 1D3YA 3ULQB 2V1DA 2Z3YA 4CXFA 1SD4A 5LEKA 2FE3A 3CO6C 4LB5A 1ZYRF 3F72A 1T0FA 3FM5A 1B6AA 1LEAA 2P5KA 3V4GA 4IHSA 3CUQB 3EYYA 5H20A 1DPUA 1J59A 1W7PB 3EDPA 4AD9A 3ECHA 5HDKA 4O3MA 4AIKA 3E97A 1ZGAA 1I6XA 2COMA 3KP4A 1S7AA 4DQ2A 4CYDA 4FHTA 1LVAA 3CJNA 3GF2A 1P4XA 3ZN1A 4RB2C 1OR7A 1SAXA 4ESBA 1R22A 1FY7A 4IRGA 1YW8A 3LSTA 2DFIA 2VT2A 2XAGA 3IRQA 1HSTA 2W25A 3WGIA 3QP5A 2GAUA 3I5UA 3TKYA 2F5EA 4U7DA 3HUGA 1TQPA 3KP3A 5CVVA 2EA4A 3DPLC 1MJAA 2BV6A 3HRUA 1L0OC 1O3TA 4M74A 2PLYA 3I58A 5LGNA 3QPTA 2L02A 1LNWA 2XAJA 2P8TA 5D4RA 4M9SA 2QVOA 1FYMA 1D8KA 3MZYA 5LBQA 2O61A 3KZZA 3R4KA 4TV7A 2GA1A 1BC7C 3K69A 3L00A 1I1SA 2QQ9A 4MGRA 2QBYB 3TO9A 5A2QK 2CQKA 3N4MA 4LD5A 2P6SA 1W7PA 1GVJA 2K4BA 5HS8A 1FNNA 5LLQA 3PQJA 1YW9A 1G3SA 4LJZF 4G6DA 3WGGA 3T0YA 1YS7A 2LF8A 4HQEA 1K6OA 1ZREA 1KA8A 4FT8A 1XD7A 4LLNA 4IVNA 4MEXF 2CG4A 2HFHA 1S7OA 1QZZA 4D0PA 1MJBA 3B73A 3DPTA 1ZARA 1R1TA 4L0ZB 2STTA 1XN7A 4GYGA 3BOQA 4S05A 5BPIA 3BJ6A 1EH8A 3BY6A 4A6EA 5HOOA 1MKMA 4M6XA 2P7VB 2EFPA 4XLNF 5DEQA 3QP6A 3GXOA 3M1EA 4M73A 4KN4X 3HHGA 1ON2A 3WTWC 1J75A 1UHMA 2X0LA 3C1DA 2A6HF 1F9NA 3ZMZA 4HBLA 2A68F 2NNNA 1XSDA 5BPDA 1LEBA 4KICA 1K78B 3T8RA 1MGTA 1R58A 3MZHA 2L4MA 5HLHA 1HKTA 4I01A 3DEUA 1FSEA 2DW4A 1KU9A 3QU6A 5FO5A 3JAMZ 1V4RA 1XB4A 2G9WA 3RKXA 3QU3A 3SZPA 2JZYA 4HX4A 3FXRA 1I5ZA 5E17F 1OYWA 3GX4X 1SFEA 2DU9A 4LLLA 3KZYA 3HTUA 2HOEA 2BGCA 3SFZA 5BMZA 5EEHA 2P6TA 1J9IA 1YIOA 1TBXA 2FEZA 4ENNA 5E20A 1YO5C 1ZGJA 5FB2A 2HZTA 3F23A 4EM2A 1U5TA 5LGUA 1IN8A 1IN4A 2MLGA 5ERIA 5E18F 4HZFA 3MAJA 2GZWA 1RUNA 1LDDA 4M71A 3M8EA 1P4AA 5LRSA 3B02A 2Q8KA 2EFQA 3V7CA 2ACJA 2W84A 3IHUA 1YQAA 5CJ9A 3WTXC 1MJ9A 1WRJA 4ZYGA 1S29A 3I71A 2HQNA 4CO8A 2PBIA 1XMKA 2VBYA 5K5OA 3F8NA 3JSOA 3FZVA 1BC8C 2PJPA 4ETSA 3F22A 4NB5A 2IPQX 5ICEA 1K78A 1IRFA 1EH7A 2KJCA 2H94A 1UCRA 1U8RA 4YIIA 1REPC 4ZYEA 2DI3A 3K0LA 2ESHA 1O7FA 1SD5A 4EMSA 3KCCA 2HQRA 4P9UA 4LMYA 3QAHA 2D1VA 1ZRDA 1QNTA 2EV0A 2M87A 2FA5A 2H09A 2RV8A 4A5NA 4A6DA 2HWVA 2O03A 2C6YA 3IL2A 1T6SA 2FMLA 4G7OF 3PQKA 4BXUA 3TO7A 1WI9A 4RS8A 3E6DA 3LFKA 2M5WA 4CHUA 1S3JA 3P9CA 4M9XA 4KA4A 4I98B 1JXSA 4MTEA 4RGSA 4UUVA 3VB2A 2GXGA 3QPHA 3RKYA 2VBZA 2UXXA 1HBXG 4ESFA 2O6GE 1ZH5A 3EETA 2XASA 4HA8A 1PDNC 4UHTA 1R1UA 3EUHA 3ZQ7A 1ZN2A 1C0WA 4B09A 3IWZA 2PEXA 3E5UA 3FM3A 2MLKA 3BWGA 3LQQA 1HW2A 3F6VA 5J6XA 1I1GA 2CSOA 3V8KA 3LAJA 5D8LB 4EGZA 5DD8A 3D5LA 5BS6A 3VEPA 4Q4ZF 1EH6A 1FT9A 2AS5F 2ISYA 1KU7A 3WTTC 4I0BA 2BE5F 3F8CA 1KQ0A 3G3ZA 4G9YA 2CFXA 2R7FA 2HS5A 3KP2A 1TW3A 1XDSA 4OIPF 3N97A 5FD6A 1MDMB 5HS7A 3ERED 2F5DA 1OYIA 1IXRC 5JI6A 3RIRA 1YTYA 3BJOA 3I54A 3DKWA 5D6EA 4HDUA 5FFZA 2JSCA 1FP2A 1KYWA 1FLIA 5E1ZB 3HSEA 3H3ZA 2FBHA 3ABUA 5LHHA 5E8GA 3COAC 2J5PA 4BHBA 3BPXA 4I0AA 2P7CB 1SMTA 1B1BA 4XLPF 1SD7A 4EVIA 1FC3A 4N0BA 4U0YA 1TLHB 2KKOA 3M8FA 2X4HA 3WU1B 3ELKA 3OV8A 2A07F 2DLLA 3FXQA 1Z91A 4RGUA 2IRFG 2NRAC 1Z05A 1R5GA 2XVCA 1S6LA 4PDKA 1ZHFA 2EFOA 2IP2A 2LSOA 3TDUC 1XSVA 3LA7A 3V7SA 2DK5A 5HS9A 1YLFA 3BP8A 1DP7P 5EEGA 2LKPA 1ODDA 3K1NA 2CWEA 2OZ6A 2QZ8A 1QO0D 2OZUA 4A2UA 3DFGA 1FP1D 1FWZA 1XMAA 1B59A 1ZG5A 2Z5UA 2FOKA 5TRDA 1JHHA 4CZZA 4ZZDA 1GXQA 3C7JA 2FNPA 2QQAA 2B0LA 1P2FA 3GZ5A 2HYFA 1IN5A 1R1VA 4M9ZA 1G3WA 2ZNYA 4BNCA 4RGRA 1R23A 3GFJA 2G7HA 1E17A 3L9FA 4WXHA 3HOSA 3MEXA 3MWMA 2XHKA 4I02A 3F21A 2ELHA 4HOBA 2ZBKA 2EFNA 3GO5A 2JPCA 3RJPA 3GFIA 2ZXJA 4EM0B 1T38A 2F5CA 2STWA 4Q48A 4LG0B 1IZ1A 2XV4S 3KEQA 2OD5A 4LFUA 3HRTA
chains in the Genus database with same CATH superfamily
5GAHJ 1JUMA 3ZRGA 4DZJA 4R79A 1TNTA 3CJTB 4HSRA 1SVMA 2IS1A 3C2HA 2QA4I 4EATA 2LNBA 2KDZA 4OMYA 4FX4A 1ZRCA 4ZYDA 3CP8A 5E3NA 2VE8A 5JVTA 3S1RJ 3CJQB 2VKVA 4CGZA 1A6IA 3BC8A 4CH7A 3MKZA 2UV1A 2LC2A 1SMYF 3OYIA 3TW6A 3KEOA 2X51A 2DFEA 3RCOA 4C3HJ 1E3HA 1BA5A 2LREA 2IW5A 5HNFA 2CW0F 4YG2F 2XC7A 2XAHA 9ANTA 2Y0SA 4BAYA 1JKOC 3FMRA 5IP6A 5F0CA 1BR2A 2M4KA 5IOZA 2VC0A 1FMVA 3PSIA 4BY7J 3A01A 1XCBA 4XL9A 1QZEA 3HGGA 5BNGA 3NQOA 4AVPA 5IPAA 2KIMA 4JK1X 5EYRA 2CH0A 1T08B 4ON0A 1FYKA 2ETHA 5IT9Z 3ZMVA 3AAFA 2WAQA 2HVSA 1DQUA 1XX5A 3QRFF 3D5RC 4EJTA 3T1BA 3E5XA 3Q0WA 3SEZA 1O3QA 1PUEE 2L54A 4CICA 3OIPA 3CMMA 4KNYA 4CCOA 3OYBA 2E71A 1Z7LA 2E60A 1K83J 3RZOJ 4E70A 3JTGA 3OYAA 1ZLKA 3AL0B 3ABMH 3SQNA 4ZDOA 5FLVA 3OSGA 1ETOA 1RR7A 3G1LA 1GV5A 2MD5A 2DMPA 2W4SA 1RKTA 2G7UA 2DMQA 4MFEA 1CF7B 5BOXA 4Q5SF 5E1WA 2FSWA 2HZDA 5LRRA 1V5FA 4KMFA 1Z9CA 1IXCA 3I56I 4OAZA 5DD4A 1B9NA 1OPCA 2EINH 2PMZN 4PGGA 3G4SI 4E6KG 4FTHA 2E36A 4YFNF 3N05A 4YFXF 3F3XA 2OAZA 1LDJA 2FUG2 5JFRA 3IKTA 1MDMA 3PNYA 3DP7A 3CMEI 3IH2A 5HNHA 1ULYA 4EGYA 4NDLA 1Z3XA 3JRFA 4ZTFA 2K86A 2QWWA 2M8GX 2BW3A 5ILSA 2XAUA 2ZXHA 4UVCA 4Z2YA 1HQCA 2L2OA 3HRSA 3Q9SA 3I4MJ 4PGHA 1KQ8A 2W82A 4B3AA 3O8GA 1W1WE 4Q47A 2O3FA 2Y0MA 3KLOA 1YHQI 1Z6RA 4XOPA 3MVPA 2XIGA 3F8FA 5AIQA 1XGMA 1FIPA 1GLNA 2R7TA 3I4PA 2JSPA 1W5CC 1IN7A 1ZRFA 3MKYB 4LGWA 2M30A 2M7BA 2Y9ZA 4I2OA 3CUQA 4FX0A 5M5WJ 2RNJA 4A3CJ 1DGWY 5F1RA 1IDYA 4U7BA 2CQXA 1ZR2A 3RKWA 5KAIC 2EFWA 3KFWX 2OBPA 4ABZA 2CUEA 4ENJA 4GYIA 4NBQA 4HLYA 1H9GA 2DA1A 1XGNA 2RQPA 1FSHA 2GWRA 4MNUA 3SDGA 3I59A 1QVUA 3L1PA 3ZMDA 1UHWA 2P81A 2IVMA 3LSIA 2JUCA 5ED4A 1WH7A 4P1WA 3K4BA 3CC4I 1FIAA 1W0TA 4RB1A 4I09A 4QIWN 4BJ6C 4RGXA 2CUJA 2WBMA 2XAQA 1UHSA 2VQCA 1Y0UA 5CYVA 1BM9A 2E34A 4W97A 3S16J 3SYTA 2VXZA 2XRNA 4BEHA 3BG5A 3IAM2 3KIOA 1IN6A 1K79A 2YR2A 1S72I 3L2UA 3GBGA 1O3RA 4CYCA 2ELJA 4UUTA 2HVRA 4IRIA 1U6GA 1S5LC 2NS0A 1E0EA 2F4IA 2LY1A 1QZYA 5FKOA 3MMYB 4F92B 2P5LC 5J4VA 3CCUI 2K9LA 5C3EJ 1R00A 4EV0A 3L09A 2CW7A 3FWEA 3ZQCA 1BJAA 3KLNA 3DTIA 1G6NA 3H1CA 1BN5A 1O4XA 1ITYA 3CCEI 2DOEA 4HDVA 1Z1DA 3WG9A 5J1RA 1H88C 1VQ7I 3I4NJ 1ETKA 5FFXA 2KL4A 4BXXJ 1BW6A 2HKXA 1ACIA 1QHGA 2L3DA 4E7ZA 2GIVA 3C2BA 4IPAA 2YX7A 2ZMEB 3BTJA 3BJAA 2HGCA 4KN7X 2K27A 2Q1ZB 4WXCA 3L2VA 2QKLB 3CO7C 1MMNA 2M7AA 3PFIA 2IA1A 5HODA 3ZCOA 4G12A 1YJWI 3HGYA 2D1HA 3M7GA 2RN7A 1MMGA 2F6CA 1I27A 4G8XA 4PJLA 2CGPA 2A6EF 3DPUA 3E6MA 1LB2A 1B4AA 3L2WA 2NOGA 2VBWA 4OIQF 1ERDA 3SDBA 1WQ2A 4AC0A 1HC8A 1Y56A 2BBYA 1EV7A 1WHUA 5B1AH 3ISPA 2CMPA 4EJVA 2P4WA 1P6RA 2DMNA 4GRIA 1NG7A 1E2XA 1TWAJ 3E1SA 4O5VA 4BKXA 5HDNA 5CKTA 2LDUA 4A0YA 1BI1A 3GTJJ 3JRDA 1XCVA 1O3SA 2WWYA 3DEWA 4RM2A 2HU9A 2J5OA 3BQYA 1VQLI 2DQLA 2DJIA 3TOAA 1CQTA 2LVSA 2E1OA 1Z0XA 2GBYA 2XKPA 3BT9A 2JK3A 2OC6A 2V7FA 4YIFA 3OY9A 2L9VA 4MHGA 1YI2I 3QOPA 3IKVA 2JA5J 1IC8A 3VFZA 1G4DA 3DQVC 2MA3A 1L3LA 3SFIA 4QTRA 4UVBA 2EV6A 4PZJA 1IV8A 2Y30A 4HQMA 4ZDPA 3I0TA 1YYVA 3TOBA 3RYPA 1H89C 3V8JA 2IT0A 3WG7H 5FD5A 2Q2EB 3OYNA 4HG2A 3SXYA 1WSUA 1R49A 5DYMA 5D8KB 1ZAOA 5K5QA 3GUDA 3HYIA 5HLGA 3S2WA 1BOAA 3B6AA 3M1CA 3RPQA 2LKSA 2B7EA 2UWMA 2A6TA 1A6QA 2W7NA 3DXJF 3PJRA 2W85A 4DYCA 3CTAA 1BIBA 1BR1A 3F8MA 2QLZA 2DK8A 2WB1N 3PO2J 4ZDLA 1TQMA 3JTHA 1T56A 1FYLA 2AHQA 3ZMSA 2L7FP 1FOXA 2QUFA 4IHVA 3NRVA 3S3NA 1RESA 2HOTA 2VKEA 2V26A 2VONA 5KK1A 3FK6A 3NWTA 1USSA 5D5XB 1IRGA 2E1CA 4E7IA 5FLXK 1F5TA 3H9GA 3DBRB 3HOUJ 2Y48A 2FBKA 1P7IA 2BZTA 1U5TC 4FE7A 1JKPC 4BBSJ 2CRGA 2VT3A 2KMUA 2OQGA 1T0FC 2W57A 4KYWA 5J1YA 2DYRH 1H0MA 1QA6A 2E5NA 2WV0A 1PP7U 2JRTA 1ETXA 4WF2A 5LEJA 5DDGA 5FLXZ 5LFAA 3OS0A 4AUXA 2RC4A 2RAEA 4YEJA 3W2AA 2QM3A 2QF7A 3F6OA 4NC6A 1ETVA 1UZCA 3WODF 3WU0A 1CGPA 2QCOA 4LK0F 2DXIA 3UKGA 3BZCA 2Z99A 3LSGA 1BI3A 2Y69H 2FQ3A 4P5OA 5IYCJ 2CV1A 3LSKA 1J0RA 3GLLA 2VQHA 2LD5A 3WGHA 1SFUA 2XF7A 3A2KA 3CDHA 4XOTA 4ESJA 3CC7I 1IG7A 3CLQA 1P4WA 2EIKH 3BROA 4OU0A 3PSFA 1YOVB 2BHYA 3E3VA 4MIMA 5D5UB 3ZP5A 3DBHB 3AG1H 4C2UA 1IRXA 2KHMA 3HIFA 1JJ8C 1A36A 2DT6A 4KT5C 3EPZA 1OISA 3K1PA 4PJNA 3ROUA 2ZSIB 2UXNA 1JHFA 1U5TB 2VBXA 1B72A 1G3TA 1IUYA 1YW7A 3TDZC 1BBYA 1OCPA 2R7DA 3I53A 4L5IA 1KZHA 4DJAA 1HW1A 3OR1C 2QKMB 4RAYA 1FOKA 2DO7A 1LJ9A 2YX4A 3HDDA 1GHCA 3U1DA 1YG2A 2HPMA 4V2GA 1V55H 3O8HA 5FGMA 3W6KB 1GV2A 2A5WA 1Y8RB 2JN6A 1F43A 2DDAA 1D0ZA 3SZTA 2K3PA 4GGGA 4IJAA 3A01B 2MG4A 2HTSA 4EJOA 1AWCA 3QYEA 1VQ6I 2EIJH 2NVYJ 2AXLA 2ZJQF 1T8IA 4G7ZF 3DWLE 4XSZF 3HOWJ 4A3EJ 4JQFA 3V7RA 3HKZA 3V8LA 2D45A 2NAZA 2OQRA 2IA0A 1BI2A 1FX7A 4RLFA 5EG0A 4GO1A 4LG3A 3VODA 2HOSA 2VQGA 2KRCA 1N25A 2F5FA 2E35A 1XGOA 2EWNA 5K7FA 1OFCX 2A69F 2HVQA 3Q3SA 3A4CA 4V19K 1R5ID 2MW8A 1EKEA 4A5MA 3I9V2 1WZ2A 3FXJA 2NVTJ 1I6HJ 1W5SA 4KIBA 4YFKF 4IO9F 1LQ1A 3ZOBA 1VF9A 5TJJA 2O8KA 4W1UA 2X48A 2IAIA 5JR3A 3H9JA 3JRAA 5BQTA 2ZJRF 3GWZA 3LQRA 2MD0A 4I99C 2E1NA 2FXAA 3KP6A 3I55I 2CUFA 5LHGA 4ENKA 2Y0SN 2VUMJ 1X1PA 3CCYA 2V6CA 1D1BA 3CUQC 1S8NA 4QLCU 5C4XJ 4HNVA 3FK7A 5ICGA 5DCFA 2V9VA 3RI4A 3FMQA 4IRHA 2ZMEA 1RETA 1ORKA 3RPUA 2WAQN 4EJUA 2XGXA 1EJ9A 1KYZA 1HKSA 3FHNA 3S2DJ 2R0QC 3R61A 3I64A 1PJRA 3KYDB 1WFXA 4UNOA 2O8XA 3GW2A 3ZQQA 2BY1A 2V9KA 1JKRC 2V1XA 2KRFA 3AL0C 3VWBA 3K4LA 5GADJ 2QEXI 2IGMA 2PQ8A 1RI7A 3EUKL 4B47A 4CYCB 1UFMA 4IEJA 1PUFA 1YITI 4IF4A 1YE9A 3PIOF 3HSFA 1AOYA 3ZMUA 2RKHA 2RQQA 2UUZA 4IQJA 3LSMA 3OOPA 3O6BB 4NC8A 4UXNA 1IW7F 2TDXA 3HHHA 3BG7A 1P9QC 1ETWA 2TRTA 3DLLF 1X3WB 1DP3A 2NYXA 4YELA 3SEQA 4BACA 4Y15A 2KRHA 1IAWA 1VZ0A 2RGVA 2OU2A 1X4PA 2X85A 2Y2ZA 3JR9A 4M3DA 2FMYA 2KJBA 3HKZN 4F93B 2I5UA 1ZGWA 4HF1A 1SEUA 3VYTB 4GCVA 3FISA 4CA0A 1U9NA 4HSTA 1MZBA 3HC7A 2IA2A 1K7AA 1BR4A 5ILVA 2JJ7A 5J47A 3S32A 4BE1A 1R4MB 2XGDA 1WPKA 3CJRB 5F04A 3U9GA 3NWSA 3W6JB 1O57A 3ERMA 2HXOA 1AHDP 2JA8J 4XQFA 2HXIA 2YSRA 4J19A 4P96A 3HSRA 3JAMK 3WTVC 3ABTA 3IUOA 2NNYA 4B8XA 3FXOA 4I7HA 1HF0A 3BR6A 4XIDA 3R0AA 1H9TA 1HW5A 2ZNZA 1IDZA 2GXBA 5CVUA 3ZPLA 3OYFA 4BEHB 1U2WA 2NXNB 5D6FA 4RLQA 4ZC3A 4EJWA 2FX0A 3S3OA 4XKWA 2P5VA 4WK8F 1STZA 5DTDA 5CQEA 2MC4A 2FF4A 4E7HA 4KUMA 4O6JA 3LA2A 5F27A 1PP8F 4KISA 2BHZA 1WJFA 3GFMA 4HRIA 2CYYA 4BGDA 4S04A 4BDYA 1OCCH 1P92A 4A12A 2EV5A 4KIFA 3AFHA 3OYDA 2EB7A 3REOA 2V4JC 4MO7A 2W24A 4GXOA 4XLAA 5F0HA 3JRIA 4G6TB 5F0FA 5B5EC 5L3FA 4XRMA 1YJNI 1X3UA 2IEKA 1Z6TA 4UB6C 2R3SA 3VYUB 1Z7UA 4M6YA 3F9KA 4CZCA 2Z9OA 1JUSA 3J80K 3HTSB 3CCJI 1FOWA 5EZGA 1OKRA 3A1YA 2HEOA 1HKQA 3LSJA 3S1NJ 1USTA 2JA2A 3CUOA 2A3SA 3OOUA 5H6RA 3S1QJ 3FMSA 2XSDC 4A3FJ 5CVJA 3E6CC 3DKYA 1IF1A 4UV9A 2MBFA 5FKNA 1W7PD 1UG2A 2XGEA 3HUGB 4NQWA 4FQGA 4K2EA 2F4MB 2ZFUA 3T8TA 1HLVA 3MQ0A 4L5JA 4P9FA 2IXSA 2A61A 5KNLA 2ZMEC 4N9IA 4EQQA 1T39A 1OLTA 3IC7A 2OTLI 3DBLB 4PJ0C 5L3DA 3F8BA 4IOAF 3HG9A 2KT0A 2VODA 5HLIA 3LAPA 5DUKA 1B8IB 4KIGA 4BQAA 3ML6A 3ASOH 4I76A 4MLOA 5FROA 4ANJA 2PMHA 2E19A 4UVAA 5EDNA 3W2VA 1ZLJA 2P0WA 3FKIJ 3OSFA 1JKQC 1JT0A 3G1MA 2FOWA 5M3MJ 3WTUC 4D7MA 3JRGA 2FJ1A 2R5YB 4BYYA 2V1UA 5IT9K 3WE3A 4BJTA 1T2KA 3ABKH 1DUXC 5D5VB 3TO6A 2IS2A 2MH9A 2H1KA 3W6VA 4HYEA 4HEA2 5ICCA 1E3PA 3FF5A 3NEUA 4AIDA 2H1LA 1TTYA 2I10A 3GYHX 1BIAA 4M3BA 2Y75A 3GZNB 3GEZA 4N9HA 2OA4A 2H6BA 2XF5A 2PMUA 4PCQA 5F64A 4NC7A 3JSPA 3GTPJ 1WJCA 5CVIA 2EZHA 3SZGA 4AYBA 2Z33A 2LY2A 2K9QA 3E6BA 3O3KA 3H3VK 4LK1F 3ECOA 2Q2EA 1RUOA 2X1CA 3JW4A 4Y52J 2FU4A 1MMAA 4G94A 2E2IJ 1QPMA 2QQBA 2XPVA 2DTZA 4U88A 3GVAA 2B9SA 2FRHA 2FQ4A 4BE2A 4HPQA 3GLXA 4ENMA 1W4MA 3T5XA 4OMZA 4G6QA 1IUFA 3PNTA 1RNLA 1TQIA 2K9MA 5IT3A 3OYGA 2D2WA 3I59B 2CUZA 3GFLA 2DODA 3QWLA 1VQOI 1FJLA 3BPVA 3RTRA 4AU7A 2R7QA 1R7JA 3DV8A 1OMIA 1RPWA 2BOLA 2Z16A 4DNCA 2EA2A 1UB9A 4HV6A 4M6VA 3LWFA 1FTTA 3ABLH 1DDNA 1WJAA 1P7JA 2LY9A 2LF7A 5L3CA 4B1RA 5D5WB 4C3JJ 1G8XA 3L2QA 5ICFA 5EF6A 2JPBA 4XKCA 2HOAA 1JUPA 3H92A 4J01A 4XLHA 2PMZA 4E7JA 5J8FA 3U1KA 4PFOA 2ZC2A 3BTLA 4J00A 5M5XJ 3HOXJ 1O7LA 3EUHC 1SFKA 3SHFA 2VKHA 2XF6A 1TL8A 1RKWA 3CCQI 1QGPA 3L2CA 1FMWA 3M3YJ 4A0XA 2LRDA 2HDWA 5B3SH 2R7UA 2WAFA 1UJ8A 2HTJA 3OS2A 2ISZA 1VQKI 2O0YA 4XRFA 2ZJPF 2WAEA 2EBIA 2GQQA 3HRMA 1LPQA 2X1DA 3HZJA 1T33A 4RMNA 3MKLA 2XROA 2DAOA 3HOTA 4DIQA 4RAFA 4L0YB 2LR8A 3HM5A 1QVTA 1S9HA 2ZCWA 1Q1HA 2DMTA 1JGSA 1B8IA 2Q0OA 4B48A 1JJ6C 6PAXA 3VSLA 3ONQA 3R60A 4FCYA 1WJDA 1FBQA 2DBBA 1XMXA 4DZPA 4Y17A 3QODA 5FRNA 3IV5A 4HX7A 3GCMA 2VC1A 4II2A 4XNFA 2MGQA 3TGNA 4BBRJ 1D5VA 5E79C 4A0ZA 1OYYA 4RB3C 3TP3A 1XSXA 5H6QA 3KP5A 5DV5A 5JHUA 1D5YA 1V54H 4XSXF 2I8DA 1B72B 2ZKZA 3KP7A 4WXDA 3IH3A 1DPRA 2RVCA 3LMMA 2ZO4A 3H3UA 2CO5A 1ON1A 4JOMA 1SVOA 4WWCA 3K1MA 2KIUA 1DGRM 3KE2A 5CVRA 2JVHA 3PUFA 4H0EA 3Q0UA 5HLTA 1MBKA 3ZN0A 3C3WA 4HF2A 3D0SA 2M8EA 2HR3A 4ZH4F 4EM1A 2VJ4A 4DGWB 1DU0A 2H27A 4IHTA 3MCZA 3H5NA 3ZMTA 2H6CA 3AG3H 5AIPA 4WX9A 2VLAA 5ILUA 1G3YA 4N4OB 4UV8A 1K4SA 1QPIA 1YS6A 1OCRH 2ID3A 3HL2A 1MW7A 2JMWA 3ZR8X 1QBJA 4KT6A 5HVQC 4QWQA 3LNQA 3MFKA 2DA7A 4IHYA 1NTCA 3G1OA 3K2ZA 4L9TA 4E7SA 3G71I 4F52A 1GXPA 1Z3YA 4JX6A 2Y31A 2YU3A 1FOYA 3O2PE 2E7WA 4A3KJ 1RRJA 1Z77A 1RIOH 3HOYJ 2BEOA 2FBIA 2LH9A 1JE8A 3CCLI 3EYIA 1HSJA 4HV5A 4F3QA 3Q9VA 2E7XA 3R6SA 1RZ4A 4HAMA 4KITB 5FLMJ 3IRRA 3VOEA 2QYOA 5KCMA 5LGTA 4AM3A 3TP0A 4L9JA 5E1XA 2Z1DA 3LL7A 4F7ZA 2JT1A 4CDGA 2XGCA 3P7NA 1N75A 4HX8A 4OOIA 4AWXB 1CF7A 2CV0A 2D5VA 3H9QA 2DCEA 4FISA 2OPTA 3G73A 5DCMA 3ZQFA 4M3FA 2YUSA 4ASNA 5EGOB 4G7HF 3S2HJ 4IQ4A 2L7MP 2PN6A 1F4KA 1V3FA 2K40A 2K4JA 5TISC 4KFCA 1FBUA 3M8JA 4EEFG 2K02A 1XGSA 4BHPA 1ONVA 3MKWB 3BG9A 1LDKB 1R36A 2XB5A 4M72A 4BHCA 4RB0A 2IJLA 3Q5FA 3IWFA 3M9AA 4CUGA 2BW3B 3DF8A 2E2HJ 2DJNA 1WH5A 2RDPA 1U0JA 3KPHA 3OMYA 1TW2A 1VQPI 2GA2A 2VE9A 2ESNA 4OINF 2CFOA 2K7LA 4AIHA 4ZZLA 2MFZA 4L9NA 2BYVE 3WTYC 3A0HC 2ELKA 1YJ9I 4Z6YA 2V79A 2BY0A 2QBYA 3FHZA 2XSJC 2DTRA 1TWGJ 2WV1A 3K2AA 4HF0A 4OIOF 1Y8QB 2L0KA 5K1YA 5K5RA 5L3BA 2VJJA 1VTNC 2YPRA 3BR2A 4MEYF 3GTKJ 4A69C 3CCMI 1XDUA 2BXYA 3ASNH 4XORA 2GM4A 1BI0A 4L18B 1TZLA 1HDPA 4V2FA 3J80Z 4AIJA 1K61A 1N78A 4QPOA 3J81Z 1XPXA 5F6FA 3RYRA 2VIXA 2DA4A 4KMUX 1TNSA 1SFXA 4PJJA 3BZKA 2VOOA 4IHXA 4HW0A 2IGKA 2ECCA 4XR6A 3TQNA 3CCRI 2M1BA 1AU7A 2X6XA 4E7KA 4U0VA 2HKOA 3BR1A 3K70D 2DPUA 1WWXA 1R9TJ 4C2TA 3HOZJ 2R7SA 1PVEA 4U0WA 2DQRA 1AKHB 2A5YB 5L3EA 1D0XA 1U8BA 1X19A 4DW6A 2FD5A 4DYRA 5GAGJ 4LG0A 4MQ9F 2K3FA 2LG4A 4RM3A 2KIFA 5DUIA 3GMEA 4RAZA 1FZPB 3NARA 3PUBA 1J2XA 5GPAA 4MTDA 1R71A 3E0JB 4LITA 1YRNA 2HYGD 2LYCA 1KU2A 1A04A 5FKLA 2KISA 3L2RA 1WJ5A 2DPDA 2HQ5A 1I3QJ 2X6YA 5DM7F 3BR3A 2EILH 4P55A 1EA3A 3OIOA 1SVLA 2IBDA 3RSNA 2ID6A 3U2RA 1WCMJ 3S8PA 3OYMA 2XUBA 1MMDA 4R8HA 2HDCA 1X4OA 2L01A 1W36D 4HNUA 3W3CA 3P9IA 2PFBA 3JREA 5DCMB 3GZ6A 4I6ZA 2FNAA 3J7AO 5EG0B 3J81K 2DYSH 2VOPA 2VL8A 3CCSI 1LE8B 5JLWA 5AONA 2MC3A 3FDYA 3LSHA 3RDIA 3J7AY 1V5EA 3LA3A 3ZQLA 4L9VA 4XKBA 5CLSA 3HBLA 5D4SA 1YRNB 3CMAI 5E8IA 1T98A 2F2EA 3BZ6A 2WC2A 5HDGA 1FPQA 2UZKA 2VN2A 3BDDA 1KGSA 3BLYA 1R5HA 3K4CA 1SD6A 2ZFWA 3GTMJ 4R1HA 1I3AA 3OR2C 2M2EA 3H5RA 1NHAA 5K7ZA 4MQVA 1W5TA 2WTEA 1FBSA 1Z21A 1UAAA 4WCGA 3FX3A 3HJEA 2ZJ2A 2VQLA 1TP4A 2DMUA 3PM1A 4BH9A 1U3EM 1J5YA 2QENA 3DTEA 4H4KC 1OJLA 4IXAA 2ADUA 1WKMA 4C30A 2JTVA 1ZG3A 4LIVA 3ZQIA 2XAFA 4MFDA 2JVGA 2ECBA 4JBAA 5KVRA 3C18A 3F0CA 2PI0A 2DOAA 2LTPA 1D8JA 3CLOA 3EQLF 4OIRF 2L4AA 5LHIA 3E5QA 2GOXB 4ZYHA 1MIJA 3WTSC 3M4OJ 3ZQGA 1JTXA 1KQ9A 1KU3A 2VASA 3RQIA 4IHWA 4BJ5C 1SANA 2XDVA 3BG3A 3WTZA 3WE2A 2PG4A 2EJRA 4BL0B 4LLGF 1MD0A 4OAYA 4BS9A 1JTYA 2IS6A 4X1EA 1IGNA 2M45A 4XBFA 1F1ZA 4N4NB 3R0JA 2DT5A 4A3GJ 1IXSB 1VQ4I 1T95A 3G2BA 4D5FA 5M3FJ 3L7WA 1BJZA 1OCZH 2HYJA 2WY7Q 3P9KA 2JQ7A 3S17J 3QYFA 4IZZA 3UR3C 4C2MJ 2XPUA 4XLEA 2LBFA 3KYCB 2KZVA 5A2QZ 4M3GA 3KETA 3FXUA 3K9TA 2XKOA 5L3GA 2R5ZA 5JLXA 3MZ8A 2BVMA 2VI6A 3VYSB 1YFHA 1U78A 4KDPA 1QQIA 2EQRA 1J7KA 2MH2A 3CDIA 4Y13A 2EZLA 3AG2H 3DCFA 1ZG1A 4LB6B 2EK5A 5J8CA 1RC9A 4IKFA 1HXDA 4NHJA 1B9MA 4HLXA 4LOCA 4XN3A 1D3YA 3ULQB 3VPRA 4A93J 4BE0A 1EF4A 1D0YA 2V1DA 2Z3YA 4CXFA 1SD4A 2CU7A 2DFFA 2FE3A 2ZB9A 5LEKA 3CO6C 4Y7NJ 3DLAA 4LB5A 2KIQA 2MABA 2HNHA 1UG0A 4X0GA 3F72A 1ZYRF 3C2GA 1T0FA 4PUSA 1GUUA 3FM5A 1B6AA 1LEAA 1ZELA 2P5KA 4HNTA 3V4GA 4IHSA 3CUQB 3EYYA 3ESWB 5H20A 4D5CA 3CDLA 5J4YA 1N77A 1W7PB 2JUGA 2ME0A 3EDPA 3ECHA 4AD9A 3FBIB 1J59A 3GTGJ 5HDKA 4XKVA 3JRHA 4O3MA 2DOFA 4AIKA 3E97A 1ZGAA 2QSFX 1X1CA 4X6AJ 1I6XA 3E7LA 2COMA 1YX3A 3H5AA 2EPFA 3K4JA 2DFHA 3KP4A 1S7AA 2LLKA 4DQ2A 4CYDA 4FHTA 1LVAA 3CJNA 3GF2A 1P4XA 3ZN1A 4RB2C 2CQQA 1OR7A 1SAXA 3K4NA 4ESBA 1R22A 2LMDA 1FY7A 4IRGA 1YW8A 1HDDC 2YU9J 3LSTA 2DFIA 2GOMA 2M0CA 2VT2A 5FRMA 2L7ZA 2XAGA 3K6GA 1DU6A 3IRQA 3KX2A 3VSKA 1HSTA 2W25A 3WGIA 4CCLA 2CJJA 3QP5A 2VPRA 4XRSA 1M1EB 4JX5A 5GP9A 3K7AJ 2GAUA 3I5UA 2KPMA 3TKYA 4F91B 3QPSA 3K4MA 2F5EA 4U7DA 3HUGA 1XG1A 1TQPA 3KP3A 5CVVA 2EA4A 3DPLC 2CQNA 1MJAA 2BV6A 1YX5A 3HRUA 1L0OC 1I50J 3CF2A 4BQOA 1O3TA 1XS9A 2M9HA 4M74A 2PLYA 2HPIA 3I58A 2M0MA 3BR5A 5LGNA 3TMOA 4A3DJ 3P5JA 3QPTA 2L02A 2DA6A 4UUSB 1LNWA 2XAJA 3K4KA 2P8TA 2H8RA 3HPGA 4JX4A 5D4RA 4M9SA 1H8AC 1ETYA 1W0UA 3UNGC 2QVOA 5E3LA 1FYMA 1D8KA 2O7OA 2BXZA 4GDFA 3MZYA 1G59A 1WJBA 2YS9A 5LBQA 3OYLA 2E1MB 2O61A 3KZZA 3R4KA 4TV7A 4QPQA 1SFOJ 2GA1A 1BC7C 2LOOA 5IOYA 4RAGA 3K69A 2X6OA 3L00A 1WGXA 1I1SA 3GTOJ 2QQ9A 2LBFB 4MGRA 1UMQA 2QBYB 3VDXA 1D1CA 3AKZA 3TO9A 3RPUD 5A2QK 2CQKA 3BTCA 3MN2A 4XMYA 3J7YJ 4U87A 2GLOA 2AQFA 2EIMH 3FXLA 2A05A 3N4MA 4BQQA 4LD5A 2ICWG 1SAUA 2P6SA 2TCTA 3TBIA 5LD2C 1W7PA 1GVJA 5H2FC 3W2WA 2K4BA 5HS8A 1FNNA 5LLQA 1JI8A 3PQJA 1YW9A 1G3SA 1Q1VA 3DKXA 4LJZF 4G6DA 1TWFJ 3WGGA 3T0YA 1YS7A 2LF8A 4HQEA 1K6OA 1ZREA 4GFBA 3PL8A 1TT5B 1MSEC 4IX7A 1KA8A 1LVKA 2H8WA 4XONA 4FT8A 1A35A 5EGOA 1XD7A 1G2HA 4LLNA 4IVNA 1OCOH 4MEXF 2CG4A 2HFHA 2BY2A 1S7OA 1MNMC 1AKHA 1QZZA 4D0PA 1MJBA 3B73A 3DPTA 1IRZA 4IL6C 1ZARA 1R1TA 4L0ZB 3MD2A 3VYRB 2K9NA 4RDUA 2STTA 1XN7A 4GYGA 3BOQA 3ZQHA 4S05A 2F48A 2W00A 5BPIA 3DTKA 3BJ6A 1EH8A 3BY6A 1KONA 4A6EA 4B4CA 5FKKA 5HOOA 1MKMA 3CESA 2L9RA 2IS4A 1XTAA 3PNVA 1R4NB 2P7VB 2EFPA 4M6XA 4XLNF 2OV7A 5DEQA 3QP6A 3GXOA 1ZK8A 1Y1VJ 3M1EA 4M73A 4XICA 1HCRA 4KN4X 1TT0A 3HHGA 3CD6I 2JRMA 1ON2A 3WTWC 1DPUA 1J75A 1BL0A 4Y4RA 5KHDA 1UHMA 2X0LA 3C1DA 4FASD 2A6HF 4KJZA 1BW5A 1F9NA 3ZMZA 1JGGA 4HBLA 2A68F 3LSRA 2NNNA 1XSDA 3G6EI 5B66C 5BPDA 4LIUA 1LEBA 1MBEA 2L7KA 2OCEA 2OF7A 3A0BC 2DN0A 4KICA 1K78B 3T8RA 1MGTA 1R58A 3MZHA 2L4MA 1GT0C 5HLHA 2EZIA 1HKTA 1TWHJ 2WA0A 4I01A 3DEUA 1FSEA 2DW4A 1KU9A 2KZGA 4DYQA 3QU6A 5FO5A 3JAMZ 1V4RA 1XB4A 2E2JJ 1VQNI 2CV2A 5GAEJ 1TC3C 3CP2A 2G9WA 2COBA 3A02A 3BG6A 2IGOA 3RKXA 3QU3A 4E4HA 3SZPA 2JZYA 2AQEA 1LKXA 2NS8A 4HX4A 3FXRA 1I5ZA 2JA7J 5E17F 1QRYA 5E3OA 1OYWA 1VQ8I 3GX4X 2Z2SB 3JCUC 3HEFA 3I3LA 1SFEA 2DU9A 4XK4A 2L9NA 4LLLA 3KZYA 4Y3OA 2R5ZB 2L9SA 4PSWA 2LFBA 3DU5A 3HTUA 3S14J 2HOEA 2OCCH 2BGCA 1LE8A 2DT7B 2VJIA 3CF5F 4XLCA 2W48A 3SFZA 2NS7A 1ENHA 5BMZA 5EEHA 1J09A 2P6TA 1J9IA 5CPRB 1YIOA 2PJRA 1TBXA 1VQ5I 2FEZA 2KLOA 4ENNA 5E20A 1YO5C 1ZGJA 3S15J 1NG6A 5FB2A 2HZTA 1AA7A 1MBHA 3EUAA 4XN0A 3F23A 4EM2A 1U5TA 2IGNA 5LGUA 2O9LA 1IN8A 4ZYAA 1IN4A 4CSWA 2MLGA 3OYKA 5ERIA 2M4GA 3CMYA 4B43A 5IP9J 3WHBA 5E18F 4HZFA 3MAJA 2B63J 2GZWA 3FXKA 4JP0A 3OL3A 1LDDA 4M71A 1LFUP 1RUNA 2HQAA 2KDOA 5DS9A 3M8EA 1P4AA 5LRSA 3B6CA 2ZXIA 3B02A 1ETQA 2Q8KA 2R7XA 2R7ZJ 1E3OC 3FBNB 2EFQA 3J7ZI 3PIPF 3K10A 3V7CA 5EEAA 2W84A 2ACJA 3IHUA 1YQAA 5CJ9A 4B44A 2NVUB 3KYLA 1VQ9I 4XRSG 4CCNA 1MMSA 3WTXC 1MJ9A 1WRJA 4ZYGA 2AXTC 1S29A 3I71A 2QGUA 4UY8I 2MSYA 2HQNA 2X6WA 2R4GA 1IJWC 5IP7J 4CO8A 3GTLJ 2PBIA 2BVLA 1XMKA 2VBYA 2OTJI 5K5OA 3F8NA 3JSOA 3FZVA 2VJ5A 1BC8C 1LFBA 4M3EA 4BU2A 2F4OB 2PJPA 4ETSA 3F22A 2QSHX 4NB5A 2IPQX 1MNDA 1WVRA 4F55A 5ICEA 1K78A 1IRFA 1EH7A 1PUFB 2KJCA 2V6EA 3ZXSA 2H94A 1UCRA 1VFCA 3SJMA 1U8RA 3LSPA 4YIIA 1REPC 4ZYEA 4NQWB 2JA6J 4XLFA 1NH3A 2DI3A 2VPLA 4A3MJ 3K0LA 3X2QH 2ESHA 1O7FA 1SD5A 5EJCA 4EMSA 2V9PA 2K85A 1MBGA 3KCCA 2HQRA 4P9UA 1MH4A 4LMYA 3IAS2 3QAHA 2O5RA 5IYBJ 2D1VA 2NVXJ 1ZRDA 1QNTA 4S0HB 1WI3A 2X9DA 2R92J 4AYBN 2EV0A 2M87A 2K9SA 2FA5A 2H09A 3Q0VA 4UB8C 2RV8A 4A5NA 2R7VA 4A6DA 2KP6A 1QU3A 2HWVA 2O03A 2C6YA 4A3JJ 3S1MJ 1OR7C 1T6SA 3IL2A 2FMLA 2CW8A 4G7OF 3PQKA 4FE4A 1S7EA 4BXUA 1NK2P 3H36A 1X3ZB 1FTZA 4OWRB 3TO7A 2M3AA 1WI9A 3CZ6A 2XB0X 4RS8A 3E6DA 3LFKA 2M5WA 2NOJB 4CHUA 1S3JA 5GTIC 3P9CA 4M9XA 2CQ7A 1Y0NA 4KA4A 4I98B 1JXSA 2RNGA 2W1OA 1Y6IA 4MTEA 4RGSA 4UUVA 3VB2A 1HA8A 5TGTA 2GXGA 3QPHA 1V5GA 3PFYA 3RKYA 2KQRA 5KAFC 2E1MC 2VBZA 3AG4H 2UXXA 1HBXG 4ESFA 2O6GE 2PX9A 1ZH5A 3EETA 1MBFA 2XASA 2Y9YA 4HA8A 1PDNC 1GDTA 4UHTA 5K7HA 4PJMA 4FETA 3WU2C 1R1UA 1X2NA 3GTQJ 4YRVA 3EUHA 3LFUA 3ZQ7A 3OS1A 2QQ8A 1YIJI 2DA2A 1ZN2A 1K6YA 3ZGKA 3A03A 1C0WA 3CC2I 2R7WA 4B09A 3IWZA 1GVDA 2PEXA 3RKQA 1Y1WJ 1F36A 3E5UA 3DEEA 5EZHA 3FM3A 2MLKA 3TEDA 3BWGA 3LQQA 2QSGX 1HW2A 3F6VA 5J6XA 2G0EA 1I1GA 1IO2A 2CSOA 3V8KA 3KEYA 3LAJA 4A3IJ 2LK2A 3IH4A 1POGA 4C9YA 3K70C 2AO9A 1ZQ3P 5IYDJ 5M5YJ 5D8LB 4EGZA 2LKXA 4PK4A 3BTIA 5DD8A 4ZTJA 3D5LA 3BCBA 5BS6A 2L5QA 2VXDA 3VEPA 4Q4ZF 1QHHD 1EH6A 4BDZA 1FT9A 3NAUA 2AS5F 2WY8Q 3FXMA 1BOBA 2ISYA 2XPWA 3HPHA 1ZTRA 3WTTC 1KU7A 5F1JA 4I0BA 1ZR4A 5DM6F 2BE5F 4D1QA 1D1AA 3F8CA 3HB9A 2EH3A 1KQ0A 3G3ZA 4G9YA 3RQ4A 1X1BA 2R7OA 2CFXA 2JWTA 1FEXA 2R7FA 1MH3A 2HS5A 3LOCA 3KP2A 4DBQA 1TW3A 1XDSA 1MBJA 2DA5A 3IP4B 4OIPF 3N97A 3H0GJ 5FD6A 1MDMB 1ZKGA 4BUPA 5HS7A 1MSFC 3ERED 2F5DA 1OYIA 1LFPA 2X1EA 3OYEA 1RR8C 1IXRC 5JI6A 3KZIC 4XM3A 3RIRA 1YTYA 3BJOA 3I54A 4RBOA 3DKWA 3QYBA 5CQGA 4CCMA 4DOZA 5D6EA 5C44J 4HDUA 5FFZA 2JSCA 1FP2A 1KYWA 2MYSA 1TWCJ 2LP0A 3OWTA 1FLIA 5E1ZB 3HSEA 1OQYA 3H3ZA 2FBHA 1SC7A 3H35A 1PYVA 3ABUA 5LHHA 5B1BH 5E8GA 1WJEA 3COAC 3PO3J 5GPCA 2J5PA 4BHBA 4ITVA 3BPXA 4I0AA 5FJ8J 2P7CB 1A31A 1SMTA 3BCAA 5C4JJ 1B1BA 4XLPF 2OJED 1SD7A 4EVIA 1FC3A 3OL4A 3RZDJ 4N0BA 4U0YA 4YIRX 1TLHB 2ZSHB 2WB1A 2KKOA 3M8FA 3CQZJ 2X4HA 1X1AA 3OYCA 4AVZA 1VQMI 4CCJA 3WU1B 2R93J 5J3LA 3ELKA 3OV8A 2F5VA 2A07F 2DLLA 3FXQA 3H0DA 1Z91A 4RGUA 2GXAA 2IRFG 2NRAC 1Z05A 1R5GA 2XVCA 4JYKA 1S6LA 4PDKA 1ZHFA 2ME6A 2EFOA 2IP2A 2LSOA 3FKJA 3FIWA 4B3XA 4BY1J 2DA3A 2KFDA 1JT6A 3DU6A 2VKDA 3TDUC 2PJRB 3M07A 4D9JA 1XSVA 1APLC 1NK3P 2N8GA 3U21A 3D1NI 3LA7A 3V7SA 4DBRA 2DK5A 5E3MA 5JHFA 5HS9A 1YLFA 4BXFA 1K4TA 3BP8A 2M34A 1DP7P 5EEGA 3HOVJ 2LKPA 1ODDA 1VI0A 3K1NA 2CWEA 3JRCA 4E7LA 2OZ6A 2QZ8A 1QO0D 3BQZA 1A5JA 2OZUA 4A2UA 3DFGA 4CCKA 5JVGF 4BQNA 1FP1D 2V1NA 4QSHA 4A3BJ 1FWZA 4PFPA 4RA2A 1XMAA 4IOCF 2RREA 1B59A 1ZG5A 5F08A 2Z5UA 2FOKA 5TRDA 3OIQA 1UELB 1JHHA 5J1UA 4CZZA 4ZZDA 2R7RA 5FKMA 4NNJA 1GXQA 2DDBA 3C7JA 2HI3A 2FNPA 3S93A 4D7NA 4NUBA 2QQAA 4Y33A 2B0LA 3BR0A 2VB6A 3GZ5A 1P2FA 2HYFA 1IN5A 1IV6A 1R1VA 1R6RA 1W36C 4M9ZA 1G3WA 1Z67A 3CCVI 2OUMA 3TW7A 2ZNYA 3OYHA 4BNCA 2R5YA 3QQAA 4RGRA 1HOMA 5GTHC 1R23A 1MNEA 3QPLA 3GFJA 1X2MA 2G7HA 4A3LJ 1E17A 4PSXA 3L9FA 4C3IJ 4WXHA 1Y39A 2XRLA 1U9OA 3MEXA 3HOSA 2HDDA 3MWMA 1LUJB 2XHKA 5IY5H 3S3MA 4I02A 3TL4X 4ZJZA 3F21A 3HXLA 2ELHA 2GIZA 2EZKA 2WADA 4HOBA 1OCTC 2ZBKA 3V42A 3D5SC 2CS3A 1VNDA 2BY3A 2E5ZA 2NVQJ 2K5CA 2EFNA 3GO5A 3JRBA 2JPCA 1XC5A 3RJPA 3GFIA 2ZXJA 4EM0B 1T38A 2F5CA 2STWA 1X1DA 5J40A 4Q48A 4LG0B 3QOEA 1X58A 1I39A 4UUSA 1IZ1A 2XV4S 3WHCA 2ZXWH 3KEQA 4II3A 2OD5A 4LFUA 3OYJA 3HRTA 4L5EA
chains in the Genus database with same CATH topology
4R79A 1TNTA 2LNBA 4OMYA 4FX4A 1ZRCA 4ZYDA 2VE8A 5JVTA 4CGZA 1SMYF 3KEOA 2IW5A 2CW0F 4YG2F 2XAHA 4BAYA 3FMRA 2VC0A 1XCBA 4AVPA 3NQOA 2KIMA 4JK1X 4ON0A 1FYKA 2ETHA 5IT9Z 3ZMVA 3AAFA 3QRFF 4EJTA 3T1BA 3E5XA 1O3QA 1PUEE 2L54A 4CICA 4KNYA 4E70A 3JTGA 1ZLKA 3SQNA 2MD5A 2G7UA 1CF7B 5BOXA 4Q5SF 5E1WA 2FSWA 5LRRA 4KMFA 1Z9CA 1IXCA 5DD4A 1B9NA 1OPCA 4PGGA 4YFNF 4YFXF 3F3XA 2OAZA 1LDJA 5JFRA 3IKTA 1MDMA 3DP7A 1ULYA 4EGYA 2K86A 2QWWA 5ILSA 4UVCA 4Z2YA 1HQCA 3HRSA 3Q9SA 4PGHA 1KQ8A 4Q47A 2O3FA 2Y0MA 3KLOA 1Z6RA 2XIGA 3F8FA 5AIQA 1XGMA 3I4PA 1ZRFA 1IN7A 4LGWA 2M30A 4I2OA 3CUQA 4FX0A 2RNJA 5F1RA 4U7BA 3RKWA 2EFWA 3KFWX 2OBPA 4ENJA 4GYIA 4HLYA 1H9GA 1XGNA 2RQPA 1FSHA 2GWRA 4MNUA 3I59A 3ZMDA 1UHWA 5ED4A 2IVMA 4RB1A 4I09A 4RGXA 2XAQA 1Y0UA 5CYVA 1BM9A 2VXZA 2XRNA 1IN6A 1K79A 2YR2A 1O3RA 4IRIA 1U6GA 2NS0A 1QZYA 2P5LC 1R00A 4EV0A 3L09A 3FWEA 1BJAA 3KLNA 1G6NA 1BN5A 4HDVA 1Z1DA 3WG9A 5FFXA 2HKXA 2L3DA 2GIVA 4IPAA 2YX7A 2ZMEB 3BJAA 2HGCA 4KN7X 2K27A 4WXCA 3CO7C 3PFIA 2IA1A 2D1HA 3M7GA 2RN7A 1I27A 4G8XA 2CGPA 2A6EF 1LB2A 3E6MA 1B4AA 2VBWA 4OIQF 1WQ2A 2BBYA 1EV7A 3ISPA 4EJVA 2P4WA 1P6RA 1E2XA 4O5VA 5HDNA 2LDUA 4A0YA 1BI1A 1XCVA 1O3SA 2WWYA 2J5OA 2DQLA 3TOAA 2XKPA 4YIFA 4MHGA 3QOPA 3IKVA 3VFZA 1G4DA 3DQVC 2MA3A 1L3LA 4UVBA 2EV6A 4PZJA 4HQMA 3I0TA 1YYVA 3TOBA 3RYPA 3V8JA 2IT0A 5FD5A 3SXYA 1WSUA 5DYMA 5D8KB 1ZAOA 5K5QA 3GUDA 3HYIA 5HLGA 3S2WA 1BOAA 3RPQA 2UWMA 3DXJF 2W85A 3CTAA 1BIBA 3F8MA 2QLZA 2DK8A 1TQMA 3JTHA 1FYLA 3ZMSA 2QUFA 3NRVA 2VONA 5KK1A 1USSA 5D5XB 1IRGA 2E1CA 5FLXK 1F5TA 2Y48A 2FBKA 1U5TC 2VT3A 2OQGA 2W57A 4KYWA 1H0MA 2WV0A 1PP7U 2JRTA 4WF2A 5LEJA 5DDGA 5FLXZ 2RC4A 2QM3A 3F6OA 3WODF 3WU0A 1CGPA 4LK0F 2Z99A 1BI3A 2FQ3A 4P5OA 1J0RA 1SFUA 3WGHA 3CDHA 4ESJA 1P4WA 3BROA 4OU0A 3E3VA 3ZP5A 5D5UB 3HIFA 4KT5C 3K1PA 3ROUA 2UXNA 1JHFA 1U5TB 2VBXA 1IUYA 1G3TA 1YW7A 3TDZC 1BBYA 2R7DA 3I53A 4L5IA 1FOKA 1HW1A 4RAYA 2DO7A 1LJ9A 2YX4A 1GHCA 3U1DA 1YG2A 5FGMA 3W6KB 3SZTA 4GGGA 4IJAA 1AWCA 2HTSA 4EJOA 2AXLA 4G7ZF 4XSZF 4JQFA 3V7RA 3V8LA 2D45A 2NAZA 2OQRA 2IA0A 1BI2A 1FX7A 4GO1A 3VODA 2F5FA 1XGOA 2EWNA 2A69F 4A5MA 1W5SA 4KIBA 4YFKF 1LQ1A 5TJJA 5JR3A 5BQTA 3GWZA 3LQRA 2E1NA 2FXAA 3KP6A 4ENKA 5LHGA 2V6CA 3CUQC 1S8NA 4QLCU 5ICGA 5DCFA 2V9VA 3RI4A 3FMQA 4IRHA 2ZMEA 3RPUA 4EJUA 2XGXA 1KYZA 1HKSA 3R61A 3I64A 4UNOA 2O8XA 3GW2A 2V1XA 2KRFA 2PQ8A 1RI7A 1UFMA 4IF4A 3HSFA 1AOYA 3ZMUA 2RKHA 3OOPA 3O6BB 4UXNA 1IW7F 2TDXA 3HHHA 2NYXA 4Y15A 1IAWA 2RGVA 2OU2A 2FMYA 2KJBA 4HF1A 4GCVA 1MZBA 2IA2A 1K7AA 5ILVA 3U9GA 3W6JB 1O57A 2YSRA 4P96A 3HSRA 3JAMK 3WTVC 3ABTA 2NNYA 4B8XA 4I7HA 1H9TA 3R0AA 1HW5A 2ZNZA 2GXBA 5CVUA 3ZPLA 1U2WA 5D6FA 4EJWA 2P5VA 4WK8F 1STZA 2FF4A 4KUMA 4O6JA 3LA2A 1PP8F 3GFMA 2CYYA 4S04A 1P92A 4A12A 2EV5A 4KIFA 2EB7A 3REOA 2W24A 4GXOA 5L3FA 1X3UA 1Z6TA 2R3SA 1Z7UA 4M6YA 2Z9OA 3J80K 3HTSB 1OKRA 2HEOA 1HKQA 1USTA 3CUOA 2A3SA 5H6RA 3FMSA 5CVJA 3E6CC 1IF1A 4UV9A 2MBFA 1W7PD 4NQWA 4K2EA 3T8TA 3MQ0A 4L5JA 4P9FA 2A61A 4N9IA 4EQQA 1T39A 3IC7A 5L3DA 3F8BA 2VODA 5HLIA 3LAPA 5DUKA 4KIGA 4BQAA 3ML6A 2PMHA 4UVAA 1ZLJA 3WTUC 2V1UA 4BYYA 5IT9K 3WE3A 1T2KA 1DUXC 5D5VB 3TO6A 2MH9A 4HYEA 5ICCA 3FF5A 3NEUA 1TTYA 3GYHX 1BIAA 2Y75A 3GEZA 4N9HA 2OA4A 2H6BA 2PMUA 4PCQA 5F64A 3JSPA 5CVIA 2Z33A 3E6BA 3O3KA 4LK1F 3ECOA 2Q2EA 1RUOA 3JW4A 2FU4A 4G94A 1QPMA 2QQBA 4U88A 3GVAA 2FRHA 4ENMA 3GLXA 1W4MA 3T5XA 4OMZA 4G6QA 1RNLA 1TQIA 5IT3A 2D2WA 3I59B 3GFLA 3RTRA 3BPVA 3DV8A 1R7JA 1OMIA 4DNCA 2EA2A 1UB9A 4HV6A 3LWFA 1DDNA 2LF7A 5L3CA 5D5WB 5ICFA 2JPBA 3H92A 5J8FA 1O7LA 3SHFA 1QGPA 3L2CA 4A0XA 2HTJA 2ISZA 2O0YA 4XRFA 3HRMA 2GQQA 2XROA 2DAOA 3HOTA 4L0YB 2ZCWA 1Q1HA 1JGSA 2Q0OA 6PAXA 3R60A 1FBQA 2DBBA 4Y17A 4HX7A 2VC1A 3TGNA 1D5VA 4A0ZA 1OYYA 4RB3C 1XSXA 5H6QA 3KP5A 5DV5A 5JHUA 4XSXF 2ZKZA 3KP7A 4WXDA 1DPRA 2RVCA 2ZO4A 3H3UA 2CO5A 1ON1A 4WWCA 3K1MA 2KIUA 3KE2A 5CVRA 4H0EA 3ZN0A 3C3WA 4HF2A 3D0SA 2M8EA 2H27A 2HR3A 4EM1A 4ZH4F 4IHTA 3MCZA 3ZMTA 2H6CA 5AIPA 4WX9A 5ILUA 1G3YA 4UV8A 1YS6A 1QBJA 5HVQC 4QWQA 3MFKA 4L9TA 3K2ZA 1GXPA 2YU3A 3O2PE 2E7WA 1RIOH 2BEOA 2FBIA 1JE8A 3EYIA 1HSJA 4HV5A 3Q9VA 2E7XA 3R6SA 1RZ4A 4HAMA 3IRRA 3VOEA 2QYOA 5LGTA 4L9JA 5E1XA 4F7ZA 2JT1A 4CDGA 3P7NA 4OOIA 4HX8A 4AWXB 1CF7A 3G73A 5DCMA 4ASNA 4G7HF 2PN6A 1F4KA 1V3FA 2K4JA 4KFCA 1FBUA 2K02A 1XGSA 4BHPA 1ONVA 1LDKB 1R36A 4M72A 4BHCA 4RB0A 2IJLA 3Q5FA 3IWFA 3M9AA 3DF8A 2RDPA 1TW2A 2GA2A 2VE9A 2ESNA 4OINF 4AIHA 2K7LA 4ZZLA 4L9NA 2BYVE 3WTYC 2V79A 2QBYA 3FHZA 2DTRA 4HF0A 4OIOF 1VTNC 5K1YA 5K5RA 5L3BA 2YPRA 4MEYF 1XDUA 1BI0A 4L18B 3J80Z 4AIJA 3J81Z 5F6FA 3RYRA 4KMUX 1TNSA 1SFXA 2VOOA 4HW0A 3TQNA 2M1BA 4U0VA 2HKOA 2DPUA 1WWXA 4U0WA 2DQRA 2A5YB 5L3EA 4LG0A 4MQ9F 2KIFA 5DUIA 4RAZA 1FZPB 1J2XA 4MTDA 2HYGD 1KU2A 1A04A 2DPDA 4P55A 3U2RA 2XUBA 4R8HA 2HDCA 2L01A 3P9IA 2PFBA 5DCMB 3GZ6A 3J7AO 2FNAA 3J81K 2VOPA 5AONA 2MC3A 3RDIA 3LA3A 4L9VA 5CLSA 5D4SA 5E8IA 1T98A 2F2EA 3BZ6A 2WC2A 5HDGA 1FPQA 2UZKA 2VN2A 3BDDA 1KGSA 1R5HA 1SD6A 2ZFWA 4R1HA 1NHAA 4MQVA 1W5TA 2WTEA 1FBSA 4WCGA 3FX3A 2ZJ2A 4BH9A 1U3EM 1J5YA 2QENA 4IXAA 2ADUA 1WKMA 2JTVA 1ZG3A 2XAFA 4JBAA 5KVRA 3C18A 2PI0A 1D8JA 3CLOA 3EQLF 4OIRF 2L4AA 5LHIA 3E5QA 4ZYHA 3WTSC 1KU3A 1KQ9A 3WTZA 3WE2A 2PG4A 2EJRA 4LLGF 1MD0A 2M45A 4XBFA 1F1ZA 3R0JA 2DT5A 1IXSB 3L7WA 3P9KA 5A2QZ 3KETA 3FXUA 3K9TA 2XKOA 5L3GA 1YFHA 1U78A 4KDPA 1QQIA 1J7KA 2MH2A 4Y13A 1ZG1A 4LB6B 2EK5A 5J8CA 4NHJA 1HXDA 1B9MA 4HLXA 1D3YA 3ULQB 2V1DA 2Z3YA 4CXFA 1SD4A 5LEKA 2FE3A 3CO6C 4LB5A 1ZYRF 3F72A 1T0FA 3FM5A 1B6AA 1LEAA 2P5KA 3V4GA 4IHSA 3CUQB 3EYYA 5H20A 1DPUA 1J59A 1W7PB 3EDPA 4AD9A 3ECHA 5HDKA 4O3MA 4AIKA 3E97A 1ZGAA 1I6XA 2COMA 3KP4A 1S7AA 4DQ2A 4CYDA 4FHTA 1LVAA 3CJNA 3GF2A 1P4XA 3ZN1A 4RB2C 1OR7A 1SAXA 4ESBA 1R22A 1FY7A 4IRGA 1YW8A 3LSTA 2DFIA 2VT2A 2XAGA 3IRQA 1HSTA 2W25A 3WGIA 3QP5A 2GAUA 3I5UA 3TKYA 2F5EA 4U7DA 3HUGA 1TQPA 3KP3A 5CVVA 2EA4A 3DPLC 1MJAA 2BV6A 3HRUA 1L0OC 1O3TA 4M74A 2PLYA 3I58A 5LGNA 3QPTA 2L02A 1LNWA 2XAJA 2P8TA 5D4RA 4M9SA 2QVOA 1FYMA 1D8KA 3MZYA 5LBQA 2O61A 3KZZA 3R4KA 4TV7A 2GA1A 1BC7C 3K69A 3L00A 1I1SA 2QQ9A 4MGRA 2QBYB 3TO9A 5A2QK 2CQKA 3N4MA 4LD5A 2P6SA 1W7PA 1GVJA 2K4BA 5HS8A 1FNNA 5LLQA 3PQJA 1YW9A 1G3SA 4LJZF 4G6DA 3WGGA 3T0YA 1YS7A 2LF8A 4HQEA 1K6OA 1ZREA 1KA8A 4FT8A 1XD7A 4LLNA 4IVNA 4MEXF 2CG4A 2HFHA 1S7OA 1QZZA 4D0PA 1MJBA 3B73A 3DPTA 1ZARA 1R1TA 4L0ZB 2STTA 1XN7A 4GYGA 3BOQA 4S05A 5BPIA 3BJ6A 1EH8A 3BY6A 4A6EA 5HOOA 1MKMA 4M6XA 2P7VB 2EFPA 4XLNF 5DEQA 3QP6A 3GXOA 3M1EA 4M73A 4KN4X 3HHGA 1ON2A 3WTWC 1J75A 1UHMA 2X0LA 3C1DA 2A6HF 1F9NA 3ZMZA 4HBLA 2A68F 2NNNA 1XSDA 5BPDA 1LEBA 4KICA 1K78B 3T8RA 1MGTA 1R58A 3MZHA 2L4MA 5HLHA 1HKTA 4I01A 3DEUA 1FSEA 2DW4A 1KU9A 3QU6A 5FO5A 3JAMZ 1V4RA 1XB4A 2G9WA 3RKXA 3QU3A 3SZPA 2JZYA 4HX4A 3FXRA 1I5ZA 5E17F 1OYWA 3GX4X 1SFEA 2DU9A 4LLLA 3KZYA 3HTUA 2HOEA 2BGCA 3SFZA 5BMZA 5EEHA 2P6TA 1J9IA 1YIOA 1TBXA 2FEZA 4ENNA 5E20A 1YO5C 1ZGJA 5FB2A 2HZTA 3F23A 4EM2A 1U5TA 5LGUA 1IN8A 1IN4A 2MLGA 5ERIA 5E18F 4HZFA 3MAJA 2GZWA 1RUNA 1LDDA 4M71A 3M8EA 1P4AA 5LRSA 3B02A 2Q8KA 2EFQA 3V7CA 2ACJA 2W84A 3IHUA 1YQAA 5CJ9A 3WTXC 1MJ9A 1WRJA 4ZYGA 1S29A 3I71A 2HQNA 4CO8A 2PBIA 1XMKA 2VBYA 5K5OA 3F8NA 3JSOA 3FZVA 1BC8C 2PJPA 4ETSA 3F22A 4NB5A 2IPQX 5ICEA 1K78A 1IRFA 1EH7A 2KJCA 2H94A 1UCRA 1U8RA 4YIIA 1REPC 4ZYEA 2DI3A 3K0LA 2ESHA 1O7FA 1SD5A 4EMSA 3KCCA 2HQRA 4P9UA 4LMYA 3QAHA 2D1VA 1ZRDA 1QNTA 2EV0A 2M87A 2FA5A 2H09A 2RV8A 4A5NA 4A6DA 2HWVA 2O03A 2C6YA 3IL2A 1T6SA 2FMLA 4G7OF 3PQKA 4BXUA 3TO7A 1WI9A 4RS8A 3E6DA 3LFKA 2M5WA 4CHUA 1S3JA 3P9CA 4M9XA 4KA4A 4I98B 1JXSA 4MTEA 4RGSA 4UUVA 3VB2A 2GXGA 3QPHA 3RKYA 2VBZA 2UXXA 1HBXG 4ESFA 2O6GE 1ZH5A 3EETA 2XASA 4HA8A 1PDNC 4UHTA 1R1UA 3EUHA 3ZQ7A 1ZN2A 1C0WA 4B09A 3IWZA 2PEXA 3E5UA 3FM3A 2MLKA 3BWGA 3LQQA 1HW2A 3F6VA 5J6XA 1I1GA 2CSOA 3V8KA 3LAJA 5D8LB 4EGZA 5DD8A 3D5LA 5BS6A 3VEPA 4Q4ZF 1EH6A 1FT9A 2AS5F 2ISYA 1KU7A 3WTTC 4I0BA 2BE5F 3F8CA 1KQ0A 3G3ZA 4G9YA 2CFXA 2R7FA 2HS5A 3KP2A 1TW3A 1XDSA 4OIPF 3N97A 5FD6A 1MDMB 5HS7A 3ERED 2F5DA 1OYIA 1IXRC 5JI6A 3RIRA 1YTYA 3BJOA 3I54A 3DKWA 5D6EA 4HDUA 5FFZA 2JSCA 1FP2A 1KYWA 1FLIA 5E1ZB 3HSEA 3H3ZA 2FBHA 3ABUA 5LHHA 5E8GA 3COAC 2J5PA 4BHBA 3BPXA 4I0AA 2P7CB 1SMTA 1B1BA 4XLPF 1SD7A 4EVIA 1FC3A 4N0BA 4U0YA 1TLHB 2KKOA 3M8FA 2X4HA 3WU1B 3ELKA 3OV8A 2A07F 2DLLA 3FXQA 1Z91A 4RGUA 2IRFG 2NRAC 1Z05A 1R5GA 2XVCA 1S6LA 4PDKA 1ZHFA 2EFOA 2IP2A 2LSOA 3TDUC 1XSVA 3LA7A 3V7SA 2DK5A 5HS9A 1YLFA 3BP8A 1DP7P 5EEGA 2LKPA 1ODDA 3K1NA 2CWEA 2OZ6A 2QZ8A 1QO0D 2OZUA 4A2UA 3DFGA 1FP1D 1FWZA 1XMAA 1B59A 1ZG5A 2Z5UA 2FOKA 5TRDA 1JHHA 4CZZA 4ZZDA 1GXQA 3C7JA 2FNPA 2QQAA 2B0LA 1P2FA 3GZ5A 2HYFA 1IN5A 1R1VA 4M9ZA 1G3WA 2ZNYA 4BNCA 4RGRA 1R23A 3GFJA 2G7HA 1E17A 3L9FA 4WXHA 3HOSA 3MEXA 3MWMA 2XHKA 4I02A 3F21A 2ELHA 4HOBA 2ZBKA 2EFNA 3GO5A 2JPCA 3RJPA 3GFIA 2ZXJA 4EM0B 1T38A 2F5CA 2STWA 4Q48A 4LG0B 1IZ1A 2XV4S 3KEQA 2OD5A 4LFUA 3HRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R79 A;  1TNT A;  2LNB A;  4OMY A;  4FX4 A;  1ZRC A;  4ZYD A;  2VE8 A;  5JVT A;  4CGZ A;  1SMY F;  3KEO A;  2IW5 A;  2CW0 F;  4YG2 F;  2XAH A;  4BAY A;  3FMR A;  2VC0 A;  1XCB A;  4AVP A;  3NQO A;  2KIM A;  4JK1 X;  4ON0 A;  1FYK A;  2ETH A;  5IT9 Z;  3ZMV A;  3AAF A;  3QRF F;  4EJT A;  3T1B A;  3E5X A;  1O3Q A;  1PUE E;  2L54 A;  4CIC A;  4KNY A;  4E70 A;  3JTG A;  1ZLK A;  3SQN A;  2MD5 A;  2G7U A;  1CF7 B;  5BOX A;  4Q5S F;  5E1W A;  2FSW A;  5LRR A;  4KMF A;  1Z9C A;  1IXC A;  5DD4 A;  1B9N A;  1OPC A;  4PGG A;  4YFN F;  4YFX F;  3F3X A;  2OAZ A;  1LDJ A;  5JFR A;  3IKT A;  1MDM A;  3DP7 A;  1ULY A;  4EGY A;  2K86 A;  2QWW A;  5ILS A;  4UVC A;  4Z2Y A;  1HQC A;  3HRS A;  3Q9S A;  4PGH A;  1KQ8 A;  4Q47 A;  2O3F A;  2Y0M A;  3KLO A;  1Z6R A;  2XIG A;  3F8F A;  5AIQ A;  1XGM A;  3I4P A;  1ZRF A;  1IN7 A;  4LGW A;  2M30 A;  4I2O A;  3CUQ A;  4FX0 A;  2RNJ A;  5F1R A;  4U7B A;  3RKW A;  2EFW A;  3KFW X;  2OBP A;  4ENJ A;  4GYI A;  4HLY A;  1H9G A;  1XGN A;  2RQP A;  1FSH A;  2GWR A;  4MNU A;  3I59 A;  3ZMD A;  1UHW A;  5ED4 A;  2IVM A;  4RB1 A;  4I09 A;  4RGX A;  2XAQ A;  1Y0U A;  5CYV A;  1BM9 A;  2VXZ A;  2XRN A;  1IN6 A;  1K79 A;  2YR2 A;  1O3R A;  4IRI A;  1U6G A;  2NS0 A;  1QZY A;  2P5L C;  1R00 A;  4EV0 A;  3L09 A;  3FWE A;  1BJA A;  3KLN A;  1G6N A;  1BN5 A;  4HDV A;  1Z1D A;  3WG9 A;  5FFX A;  2HKX A;  2L3D A;  2GIV A;  4IPA A;  2YX7 A;  2ZME B;  3BJA A;  2HGC A;  4KN7 X;  2K27 A;  4WXC A;  3CO7 C;  3PFI A;  2IA1 A;  2D1H A;  3M7G A;  2RN7 A;  1I27 A;  4G8X A;  2CGP A;  2A6E F;  1LB2 A;  3E6M A;  1B4A A;  2VBW A;  4OIQ F;  1WQ2 A;  2BBY A;  1EV7 A;  3ISP A;  4EJV A;  2P4W A;  1P6R A;  1E2X A;  4O5V A;  5HDN A;  2LDU A;  4A0Y A;  1BI1 A;  1XCV A;  1O3S A;  2WWY A;  2J5O A;  2DQL A;  3TOA A;  2XKP A;  4YIF A;  4MHG A;  3QOP A;  3IKV A;  3VFZ A;  1G4D A;  3DQV C;  2MA3 A;  1L3L A;  4UVB A;  2EV6 A;  4PZJ A;  4HQM A;  3I0T A;  1YYV A;  3TOB A;  3RYP A;  3V8J A;  2IT0 A;  5FD5 A;  3SXY A;  1WSU A;  5DYM A;  5D8K B;  1ZAO A;  5K5Q A;  3GUD A;  3HYI A;  5HLG A;  3S2W A;  1BOA A;  3RPQ A;  2UWM A;  3DXJ F;  2W85 A;  3CTA A;  1BIB A;  3F8M A;  2QLZ A;  2DK8 A;  1TQM A;  3JTH A;  1FYL A;  3ZMS A;  2QUF A;  3NRV A;  2VON A;  5KK1 A;  1USS A;  5D5X B;  1IRG A;  2E1C A;  5FLX K;  1F5T A;  2Y48 A;  2FBK A;  1U5T C;  2VT3 A;  2OQG A;  2W57 A;  4KYW A;  1H0M A;  2WV0 A;  1PP7 U;  2JRT A;  4WF2 A;  5LEJ A;  5DDG A;  5FLX Z;  2RC4 A;  2QM3 A;  3F6O A;  3WOD F;  3WU0 A;  1CGP A;  4LK0 F;  2Z99 A;  1BI3 A;  2FQ3 A;  4P5O A;  1J0R A;  1SFU A;  3WGH A;  3CDH A;  4ESJ A;  1P4W A;  3BRO A;  4OU0 A;  3E3V A;  3ZP5 A;  5D5U B;  3HIF A;  4KT5 C;  3K1P A;  3ROU A;  2UXN A;  1JHF A;  1U5T B;  2VBX A;  1IUY A;  1G3T A;  1YW7 A;  3TDZ C;  1BBY A;  2R7D A;  3I53 A;  4L5I A;  1FOK A;  1HW1 A;  4RAY A;  2DO7 A;  1LJ9 A;  2YX4 A;  1GHC A;  3U1D A;  1YG2 A;  5FGM A;  3W6K B;  3SZT A;  4GGG A;  4IJA A;  1AWC A;  2HTS A;  4EJO A;  2AXL A;  4G7Z F;  4XSZ F;  4JQF A;  3V7R A;  3V8L A;  2D45 A;  2NAZ A;  2OQR A;  2IA0 A;  1BI2 A;  1FX7 A;  4GO1 A;  3VOD A;  2F5F A;  1XGO A;  2EWN A;  2A69 F;  4A5M A;  1W5S A;  4KIB A;  4YFK F;  1LQ1 A;  5TJJ A;  5JR3 A;  5BQT A;  3GWZ A;  3LQR A;  2E1N A;  2FXA A;  3KP6 A;  4ENK A;  5LHG A;  2V6C A;  3CUQ C;  1S8N A;  4QLC U;  5ICG A;  5DCF A;  2V9V A;  3RI4 A;  3FMQ A;  4IRH A;  2ZME A;  3RPU A;  4EJU A;  2XGX A;  1KYZ A;  1HKS A;  3R61 A;  3I64 A;  4UNO A;  2O8X A;  3GW2 A;  2V1X A;  2KRF A;  2PQ8 A;  1RI7 A;  1UFM A;  4IF4 A;  3HSF A;  1AOY A;  3ZMU A;  2RKH A;  3OOP A;  3O6B B;  4UXN A;  1IW7 F;  2TDX A;  3HHH A;  2NYX A;  4Y15 A;  1IAW A;  2RGV A;  2OU2 A;  2FMY A;  2KJB A;  4HF1 A;  4GCV A;  1MZB A;  2IA2 A;  1K7A A;  5ILV A;  3U9G A;  3W6J B;  1O57 A;  2YSR A;  4P96 A;  3HSR A;  3JAM K;  3WTV C;  3ABT A;  2NNY A;  4B8X A;  4I7H A;  1H9T A;  3R0A A;  1HW5 A;  2ZNZ A;  2GXB A;  5CVU A;  3ZPL A;  1U2W A;  5D6F A;  4EJW A;  2P5V A;  4WK8 F;  1STZ A;  2FF4 A;  4KUM A;  4O6J A;  3LA2 A;  1PP8 F;  3GFM A;  2CYY A;  4S04 A;  1P92 A;  4A12 A;  2EV5 A;  4KIF A;  2EB7 A;  3REO A;  2W24 A;  4GXO A;  5L3F A;  1X3U A;  1Z6T A;  2R3S A;  1Z7U A;  4M6Y A;  2Z9O A;  3J80 K;  3HTS B;  1OKR A;  2HEO A;  1HKQ A;  1UST A;  3CUO A;  2A3S A;  5H6R A;  3FMS A;  5CVJ A;  3E6C C;  1IF1 A;  4UV9 A;  2MBF A;  1W7P D;  4NQW A;  4K2E A;  3T8T A;  3MQ0 A;  4L5J A;  4P9F A;  2A61 A;  4N9I A;  4EQQ A;  1T39 A;  3IC7 A;  5L3D A;  3F8B A;  2VOD A;  5HLI A;  3LAP A;  5DUK A;  4KIG A;  4BQA A;  3ML6 A;  2PMH A;  4UVA A;  1ZLJ A;  3WTU C;  2V1U A;  4BYY A;  5IT9 K;  3WE3 A;  1T2K A;  1DUX C;  5D5V B;  3TO6 A;  2MH9 A;  4HYE A;  5ICC A;  3FF5 A;  3NEU A;  1TTY A;  3GYH X;  1BIA A;  2Y75 A;  3GEZ A;  4N9H A;  2OA4 A;  2H6B A;  2PMU A;  4PCQ A;  5F64 A;  3JSP A;  5CVI A;  2Z33 A;  3E6B A;  3O3K A;  4LK1 F;  3ECO A;  2Q2E A;  1RUO A;  3JW4 A;  2FU4 A;  4G94 A;  1QPM A;  2QQB A;  4U88 A;  3GVA A;  2FRH A;  4ENM A;  3GLX A;  1W4M A;  3T5X A;  4OMZ A;  4G6Q A;  1RNL A;  1TQI A;  5IT3 A;  2D2W A;  3I59 B;  3GFL A;  3RTR A;  3BPV A;  3DV8 A;  1R7J A;  1OMI A;  4DNC A;  2EA2 A;  1UB9 A;  4HV6 A;  3LWF A;  1DDN A;  2LF7 A;  5L3C A;  5D5W B;  5ICF A;  2JPB A;  3H92 A;  5J8F A;  1O7L A;  3SHF A;  1QGP A;  3L2C A;  4A0X A;  2HTJ A;  2ISZ A;  2O0Y A;  4XRF A;  3HRM A;  2GQQ A;  2XRO A;  2DAO A;  3HOT A;  4L0Y B;  2ZCW A;  1Q1H A;  1JGS A;  2Q0O A;  6PAX A;  3R60 A;  1FBQ A;  2DBB A;  4Y17 A;  4HX7 A;  2VC1 A;  3TGN A;  1D5V A;  4A0Z A;  1OYY A;  4RB3 C;  1XSX A;  5H6Q A;  3KP5 A;  5DV5 A;  5JHU A;  4XSX F;  2ZKZ A;  3KP7 A;  4WXD A;  1DPR A;  2RVC A;  2ZO4 A;  3H3U A;  2CO5 A;  1ON1 A;  4WWC A;  3K1M A;  2KIU A;  3KE2 A;  5CVR A;  4H0E A;  3ZN0 A;  3C3W A;  4HF2 A;  3D0S A;  2M8E A;  2H27 A;  2HR3 A;  4EM1 A;  4ZH4 F;  4IHT A;  3MCZ A;  3ZMT A;  2H6C A;  5AIP A;  4WX9 A;  5ILU A;  1G3Y A;  4UV8 A;  1YS6 A;  1QBJ A;  5HVQ C;  4QWQ A;  3MFK A;  4L9T A;  3K2Z A;  1GXP A;  2YU3 A;  3O2P E;  2E7W A;  1RIO H;  2BEO A;  2FBI A;  1JE8 A;  3EYI A;  1HSJ A;  4HV5 A;  3Q9V A;  2E7X A;  3R6S A;  1RZ4 A;  4HAM A;  3IRR A;  3VOE A;  2QYO A;  5LGT A;  4L9J A;  5E1X A;  4F7Z A;  2JT1 A;  4CDG A;  3P7N A;  4OOI A;  4HX8 A;  4AWX B;  1CF7 A;  3G73 A;  5DCM A;  4ASN A;  4G7H F;  2PN6 A;  1F4K A;  1V3F A;  2K4J A;  4KFC A;  1FBU A;  2K02 A;  1XGS A;  4BHP A;  1ONV A;  1LDK B;  1R36 A;  4M72 A;  4BHC A;  4RB0 A;  2IJL A;  3Q5F A;  3IWF A;  3M9A A;  3DF8 A;  2RDP A;  1TW2 A;  2GA2 A;  2VE9 A;  2ESN A;  4OIN F;  4AIH A;  2K7L A;  4ZZL A;  4L9N A;  2BYV E;  3WTY C;  2V79 A;  2QBY A;  3FHZ A;  2DTR A;  4HF0 A;  4OIO F;  1VTN C;  5K1Y A;  5K5R A;  5L3B A;  2YPR A;  4MEY F;  1XDU A;  1BI0 A;  4L18 B;  3J80 Z;  4AIJ A;  3J81 Z;  5F6F A;  3RYR A;  4KMU X;  1TNS A;  1SFX A;  2VOO A;  4HW0 A;  3TQN A;  2M1B A;  4U0V A;  2HKO A;  2DPU A;  1WWX A;  4U0W A;  2DQR A;  2A5Y B;  5L3E A;  4LG0 A;  4MQ9 F;  2KIF A;  5DUI A;  4RAZ A;  1FZP B;  1J2X A;  4MTD A;  2HYG D;  1KU2 A;  1A04 A;  2DPD A;  4P55 A;  3U2R A;  2XUB A;  4R8H A;  2HDC A;  2L01 A;  3P9I A;  2PFB A;  5DCM B;  3GZ6 A;  3J7A O;  2FNA A;  3J81 K;  2VOP A;  5AON A;  2MC3 A;  3RDI A;  3LA3 A;  4L9V A;  5CLS A;  5D4S A;  5E8I A;  1T98 A;  2F2E A;  3BZ6 A;  2WC2 A;  5HDG A;  1FPQ A;  2UZK A;  2VN2 A;  3BDD A;  1KGS A;  1R5H A;  1SD6 A;  2ZFW A;  4R1H A;  1NHA A;  4MQV A;  1W5T A;  2WTE A;  1FBS A;  4WCG A;  3FX3 A;  2ZJ2 A;  4BH9 A;  1U3E M;  1J5Y A;  2QEN A;  4IXA A;  2ADU A;  1WKM A;  2JTV A;  1ZG3 A;  2XAF A;  4JBA A;  5KVR A;  3C18 A;  2PI0 A;  1D8J A;  3CLO A;  3EQL F;  4OIR F;  2L4A A;  5LHI A;  3E5Q A;  4ZYH A;  3WTS C;  1KU3 A;  1KQ9 A;  3WTZ A;  3WE2 A;  2PG4 A;  2EJR A;  4LLG F;  1MD0 A;  2M45 A;  4XBF A;  1F1Z A;  3R0J A;  2DT5 A;  1IXS B;  3L7W A;  3P9K A;  5A2Q Z;  3KET A;  3FXU A;  3K9T A;  2XKO A;  5L3G A;  1YFH A;  1U78 A;  4KDP A;  1QQI A;  1J7K A;  2MH2 A;  4Y13 A;  1ZG1 A;  4LB6 B;  2EK5 A;  5J8C A;  4NHJ A;  1HXD A;  1B9M A;  4HLX A;  1D3Y A;  3ULQ B;  2V1D A;  2Z3Y A;  4CXF A;  1SD4 A;  5LEK A;  2FE3 A;  3CO6 C;  4LB5 A;  1ZYR F;  3F72 A;  1T0F A;  3FM5 A;  1B6A A;  1LEA A;  2P5K A;  3V4G A;  4IHS A;  3CUQ B;  3EYY A;  5H20 A;  1DPU A;  1J59 A;  1W7P B;  3EDP A;  4AD9 A;  3ECH A;  5HDK A;  4O3M A;  4AIK A;  3E97 A;  1ZGA A;  1I6X A;  2COM A;  3KP4 A;  1S7A A;  4DQ2 A;  4CYD A;  4FHT A;  1LVA A;  3CJN A;  3GF2 A;  1P4X A;  3ZN1 A;  4RB2 C;  1OR7 A;  1SAX A;  4ESB A;  1R22 A;  1FY7 A;  4IRG A;  1YW8 A;  3LST A;  2DFI A;  2VT2 A;  2XAG A;  3IRQ A;  1HST A;  2W25 A;  3WGI A;  3QP5 A;  2GAU A;  3I5U A;  3TKY A;  2F5E A;  4U7D A;  3HUG A;  1TQP A;  3KP3 A;  5CVV A;  2EA4 A;  3DPL C;  1MJA A;  2BV6 A;  3HRU A;  1L0O C;  1O3T A;  4M74 A;  2PLY A;  3I58 A;  5LGN A;  3QPT A;  2L02 A;  1LNW A;  2XAJ A;  2P8T A;  5D4R A;  4M9S A;  2QVO A;  1FYM A;  1D8K A;  3MZY A;  5LBQ A;  2O61 A;  3KZZ A;  3R4K A;  4TV7 A;  2GA1 A;  1BC7 C;  3K69 A;  3L00 A;  1I1S A;  2QQ9 A;  4MGR A;  2QBY B;  3TO9 A;  5A2Q K;  2CQK A;  3N4M A;  4LD5 A;  2P6S A;  1W7P A;  1GVJ A;  2K4B A;  5HS8 A;  1FNN A;  5LLQ A;  3PQJ A;  1YW9 A;  1G3S A;  4LJZ F;  4G6D A;  3WGG A;  3T0Y A;  1YS7 A;  2LF8 A;  4HQE A;  1K6O A;  1ZRE A;  1KA8 A;  4FT8 A;  1XD7 A;  4LLN A;  4IVN A;  4MEX F;  2CG4 A;  2HFH A;  1S7O A;  1QZZ A;  4D0P A;  1MJB A;  3B73 A;  3DPT A;  1ZAR A;  1R1T A;  4L0Z B;  2STT A;  1XN7 A;  4GYG A;  3BOQ A;  4S05 A;  5BPI A;  3BJ6 A;  1EH8 A;  3BY6 A;  4A6E A;  5HOO A;  1MKM A;  4M6X A;  2P7V B;  2EFP A;  4XLN F;  5DEQ A;  3QP6 A;  3GXO A;  3M1E A;  4M73 A;  4KN4 X;  3HHG A;  1ON2 A;  3WTW C;  1J75 A;  1UHM A;  2X0L A;  3C1D A;  2A6H F;  1F9N A;  3ZMZ A;  4HBL A;  2A68 F;  2NNN A;  1XSD A;  5BPD A;  1LEB A;  4KIC A;  1K78 B;  3T8R A;  1MGT A;  1R58 A;  3MZH A;  2L4M A;  5HLH A;  1HKT A;  4I01 A;  3DEU A;  1FSE A;  2DW4 A;  1KU9 A;  3QU6 A;  5FO5 A;  3JAM Z;  1V4R A;  1XB4 A;  2G9W A;  3RKX A;  3QU3 A;  3SZP A;  2JZY A;  4HX4 A;  3FXR A;  1I5Z A;  5E17 F;  1OYW A;  3GX4 X;  1SFE A;  2DU9 A;  4LLL A;  3KZY A;  3HTU A;  2HOE A;  2BGC A;  3SFZ A;  5BMZ A;  5EEH A;  2P6T A;  1J9I A;  1YIO A;  1TBX A;  2FEZ A;  4ENN A;  5E20 A;  1YO5 C;  1ZGJ A;  5FB2 A;  2HZT A;  3F23 A;  4EM2 A;  1U5T A;  5LGU A;  1IN8 A;  1IN4 A;  2MLG A;  5ERI A;  5E18 F;  4HZF A;  3MAJ A;  2GZW A;  1RUN A;  1LDD A;  4M71 A;  3M8E A;  1P4A A;  5LRS A;  3B02 A;  2Q8K A;  2EFQ A;  3V7C A;  2ACJ A;  2W84 A;  3IHU A;  1YQA A;  5CJ9 A;  3WTX C;  1MJ9 A;  1WRJ A;  4ZYG A;  1S29 A;  3I71 A;  2HQN A;  4CO8 A;  2PBI A;  1XMK A;  2VBY A;  5K5O A;  3F8N A;  3JSO A;  3FZV A;  1BC8 C;  2PJP A;  4ETS A;  3F22 A;  4NB5 A;  2IPQ X;  5ICE A;  1K78 A;  1IRF A;  1EH7 A;  2KJC A;  2H94 A;  1UCR A;  1U8R A;  4YII A;  1REP C;  4ZYE A;  2DI3 A;  3K0L A;  2ESH A;  1O7F A;  1SD5 A;  4EMS A;  3KCC A;  2HQR A;  4P9U A;  4LMY A;  3QAH A;  2D1V A;  1ZRD A;  1QNT A;  2EV0 A;  2M87 A;  2FA5 A;  2H09 A;  2RV8 A;  4A5N A;  4A6D A;  2HWV A;  2O03 A;  2C6Y A;  3IL2 A;  1T6S A;  2FML A;  4G7O F;  3PQK A;  4BXU A;  3TO7 A;  1WI9 A;  4RS8 A;  3E6D A;  3LFK A;  2M5W A;  4CHU A;  1S3J A;  3P9C A;  4M9X A;  4KA4 A;  4I98 B;  1JXS A;  4MTE A;  4RGS A;  4UUV A;  3VB2 A;  2GXG A;  3QPH A;  3RKY A;  2VBZ A;  2UXX A;  1HBX G;  4ESF A;  2O6G E;  1ZH5 A;  3EET A;  2XAS A;  4HA8 A;  1PDN C;  4UHT A;  1R1U A;  3EUH A;  3ZQ7 A;  1ZN2 A;  1C0W A;  4B09 A;  3IWZ A;  2PEX A;  3E5U A;  3FM3 A;  2MLK A;  3BWG A;  3LQQ A;  1HW2 A;  3F6V A;  5J6X A;  1I1G A;  2CSO A;  3V8K A;  3LAJ A;  5D8L B;  4EGZ A;  5DD8 A;  3D5L A;  5BS6 A;  3VEP A;  4Q4Z F;  1EH6 A;  1FT9 A;  2AS5 F;  2ISY A;  1KU7 A;  3WTT C;  4I0B A;  2BE5 F;  3F8C A;  1KQ0 A;  3G3Z A;  4G9Y A;  2CFX A;  2R7F A;  2HS5 A;  3KP2 A;  1TW3 A;  1XDS A;  4OIP F;  3N97 A;  5FD6 A;  1MDM B;  5HS7 A;  3ERE D;  2F5D A;  1OYI A;  1IXR C;  5JI6 A;  3RIR A;  1YTY A;  3BJO A;  3I54 A;  3DKW A;  5D6E A;  4HDU A;  5FFZ A;  2JSC A;  1FP2 A;  1KYW A;  1FLI A;  5E1Z B;  3HSE A;  3H3Z A;  2FBH A;  3ABU A;  5LHH A;  5E8G A;  3COA C;  2J5P A;  4BHB A;  3BPX A;  4I0A A;  2P7C B;  1SMT A;  1B1B A;  4XLP F;  1SD7 A;  4EVI A;  1FC3 A;  4N0B A;  4U0Y A;  1TLH B;  2KKO A;  3M8F A;  2X4H A;  3WU1 B;  3ELK A;  3OV8 A;  2A07 F;  2DLL A;  3FXQ A;  1Z91 A;  4RGU A;  2IRF G;  2NRA C;  1Z05 A;  1R5G A;  2XVC A;  1S6L A;  4PDK A;  1ZHF A;  2EFO A;  2IP2 A;  2LSO A;  3TDU C;  1XSV A;  3LA7 A;  3V7S A;  2DK5 A;  5HS9 A;  1YLF A;  3BP8 A;  1DP7 P;  5EEG A;  2LKP A;  1ODD A;  3K1N A;  2CWE A;  2OZ6 A;  2QZ8 A;  1QO0 D;  2OZU A;  4A2U A;  3DFG A;  1FP1 D;  1FWZ A;  1XMA A;  1B59 A;  1ZG5 A;  2Z5U A;  2FOK A;  5TRD A;  1JHH A;  4CZZ A;  4ZZD A;  1GXQ A;  3C7J A;  2FNP A;  2QQA A;  2B0L A;  1P2F A;  3GZ5 A;  2HYF A;  1IN5 A;  1R1V A;  4M9Z A;  1G3W A;  2ZNY A;  4BNC A;  4RGR A;  1R23 A;  3GFJ A;  2G7H A;  1E17 A;  3L9F A;  4WXH A;  3HOS A;  3MEX A;  3MWM A;  2XHK A;  4I02 A;  3F21 A;  2ELH A;  4HOB A;  2ZBK A;  2EFN A;  3GO5 A;  2JPC A;  3RJP A;  3GFI A;  2ZXJ A;  4EM0 B;  1T38 A;  2F5C A;  2STW A;  4Q48 A;  4LG0 B;  1IZ1 A;  2XV4 S;  3KEQ A;  2OD5 A;  4LFU A;  3HRT A; 
#chains in the Genus database with same CATH topology
 5GAH J;  1JUM A;  3ZRG A;  4DZJ A;  4R79 A;  1TNT A;  3CJT B;  4HSR A;  1SVM A;  2IS1 A;  3C2H A;  2QA4 I;  4EAT A;  2LNB A;  2KDZ A;  4OMY A;  4FX4 A;  1ZRC A;  4ZYD A;  3CP8 A;  5E3N A;  2VE8 A;  5JVT A;  3S1R J;  3CJQ B;  2VKV A;  4CGZ A;  1A6I A;  3BC8 A;  4CH7 A;  3MKZ A;  2UV1 A;  2LC2 A;  1SMY F;  3OYI A;  3TW6 A;  3KEO A;  2X51 A;  2DFE A;  3RCO A;  4C3H J;  1E3H A;  1BA5 A;  2LRE A;  2IW5 A;  5HNF A;  2CW0 F;  4YG2 F;  2XC7 A;  2XAH A;  9ANT A;  2Y0S A;  4BAY A;  1JKO C;  3FMR A;  5IP6 A;  5F0C A;  1BR2 A;  2M4K A;  5IOZ A;  2VC0 A;  1FMV A;  3PSI A;  4BY7 J;  3A01 A;  1XCB A;  4XL9 A;  1QZE A;  3HGG A;  5BNG A;  3NQO A;  4AVP A;  5IPA A;  2KIM A;  4JK1 X;  5EYR A;  2CH0 A;  1T08 B;  4ON0 A;  1FYK A;  2ETH A;  5IT9 Z;  3ZMV A;  3AAF A;  2WAQ A;  2HVS A;  1DQU A;  1XX5 A;  3QRF F;  3D5R C;  4EJT A;  3T1B A;  3E5X A;  3Q0W A;  3SEZ A;  1O3Q A;  1PUE E;  2L54 A;  4CIC A;  3OIP A;  3CMM A;  4KNY A;  4CCO A;  3OYB A;  2E71 A;  1Z7L A;  2E60 A;  1K83 J;  3RZO J;  4E70 A;  3JTG A;  3OYA A;  1ZLK A;  3AL0 B;  3ABM H;  3SQN A;  4ZDO A;  5FLV A;  3OSG A;  1ETO A;  1RR7 A;  3G1L A;  1GV5 A;  2MD5 A;  2DMP A;  2W4S A;  1RKT A;  2G7U A;  2DMQ A;  4MFE A;  1CF7 B;  5BOX A;  4Q5S F;  5E1W A;  2FSW A;  2HZD A;  5LRR A;  1V5F A;  4KMF A;  1Z9C A;  1IXC A;  3I56 I;  4OAZ A;  5DD4 A;  1B9N A;  1OPC A;  2EIN H;  2PMZ N;  4PGG A;  3G4S I;  4E6K G;  4FTH A;  2E36 A;  4YFN F;  3N05 A;  4YFX F;  3F3X A;  2OAZ A;  1LDJ A;  2FUG 2;  5JFR A;  3IKT A;  1MDM A;  3PNY A;  3DP7 A;  3CME I;  3IH2 A;  5HNH A;  1ULY A;  4EGY A;  4NDL A;  1Z3X A;  3JRF A;  4ZTF A;  2K86 A;  2QWW A;  2M8G X;  2BW3 A;  5ILS A;  2XAU A;  2ZXH A;  4UVC A;  4Z2Y A;  1HQC A;  2L2O A;  3HRS A;  3Q9S A;  3I4M J;  4PGH A;  1KQ8 A;  2W82 A;  4B3A A;  3O8G A;  1W1W E;  4Q47 A;  2O3F A;  2Y0M A;  3KLO A;  1YHQ I;  1Z6R A;  4XOP A;  3MVP A;  2XIG A;  3F8F A;  5AIQ A;  1XGM A;  1FIP A;  1GLN A;  2R7T A;  3I4P A;  2JSP A;  1W5C C;  1IN7 A;  1ZRF A;  3MKY B;  4LGW A;  2M30 A;  2M7B A;  2Y9Z A;  4I2O A;  3CUQ A;  4FX0 A;  5M5W J;  2RNJ A;  4A3C J;  1DGW Y;  5F1R A;  1IDY A;  4U7B A;  2CQX A;  1ZR2 A;  3RKW A;  5KAI C;  2EFW A;  3KFW X;  2OBP A;  4ABZ A;  2CUE A;  4ENJ A;  4GYI A;  4NBQ A;  4HLY A;  1H9G A;  2DA1 A;  1XGN A;  2RQP A;  1FSH A;  2GWR A;  4MNU A;  3SDG A;  3I59 A;  1QVU A;  3L1P A;  3ZMD A;  1UHW A;  2P81 A;  2IVM A;  3LSI A;  2JUC A;  5ED4 A;  1WH7 A;  4P1W A;  3K4B A;  3CC4 I;  1FIA A;  1W0T A;  4RB1 A;  4I09 A;  4QIW N;  4BJ6 C;  4RGX A;  2CUJ A;  2WBM A;  2XAQ A;  1UHS A;  2VQC A;  1Y0U A;  5CYV A;  1BM9 A;  2E34 A;  4W97 A;  3S16 J;  3SYT A;  2VXZ A;  2XRN A;  4BEH A;  3BG5 A;  3IAM 2;  3KIO A;  1IN6 A;  1K79 A;  2YR2 A;  1S72 I;  3L2U A;  3GBG A;  1O3R A;  4CYC A;  2ELJ A;  4UUT A;  2HVR A;  4IRI A;  1U6G A;  1S5L C;  2NS0 A;  1E0E A;  2F4I A;  2LY1 A;  1QZY A;  5FKO A;  3MMY B;  4F92 B;  2P5L C;  5J4V A;  3CCU I;  2K9L A;  5C3E J;  1R00 A;  4EV0 A;  3L09 A;  2CW7 A;  3FWE A;  3ZQC A;  1BJA A;  3KLN A;  3DTI A;  1G6N A;  3H1C A;  1BN5 A;  1O4X A;  1ITY A;  3CCE I;  2DOE A;  4HDV A;  1Z1D A;  3WG9 A;  5J1R A;  1H88 C;  1VQ7 I;  3I4N J;  1ETK A;  5FFX A;  2KL4 A;  4BXX J;  1BW6 A;  2HKX A;  1ACI A;  1QHG A;  2L3D A;  4E7Z A;  2GIV A;  3C2B A;  4IPA A;  2YX7 A;  2ZME B;  3BTJ A;  3BJA A;  2HGC A;  4KN7 X;  2K27 A;  2Q1Z B;  4WXC A;  3L2V A;  2QKL B;  3CO7 C;  1MMN A;  2M7A A;  3PFI A;  2IA1 A;  5HOD A;  3ZCO A;  4G12 A;  1YJW I;  3HGY A;  2D1H A;  3M7G A;  2RN7 A;  1MMG A;  2F6C A;  1I27 A;  4G8X A;  4PJL A;  2CGP A;  2A6E F;  3DPU A;  3E6M A;  1LB2 A;  1B4A A;  3L2W A;  2NOG A;  2VBW A;  4OIQ F;  1ERD A;  3SDB A;  1WQ2 A;  4AC0 A;  1HC8 A;  1Y56 A;  2BBY A;  1EV7 A;  1WHU A;  5B1A H;  3ISP A;  2CMP A;  4EJV A;  2P4W A;  1P6R A;  2DMN A;  4GRI A;  1NG7 A;  1E2X A;  1TWA J;  3E1S A;  4O5V A;  4BKX A;  5HDN A;  5CKT A;  2LDU A;  4A0Y A;  1BI1 A;  3GTJ J;  3JRD A;  1XCV A;  1O3S A;  2WWY A;  3DEW A;  4RM2 A;  2HU9 A;  2J5O A;  3BQY A;  1VQL I;  2DQL A;  2DJI A;  3TOA A;  1CQT A;  2LVS A;  2E1O A;  1Z0X A;  2GBY A;  2XKP A;  3BT9 A;  2JK3 A;  2OC6 A;  2V7F A;  4YIF A;  3OY9 A;  2L9V A;  4MHG A;  1YI2 I;  3QOP A;  3IKV A;  2JA5 J;  1IC8 A;  3VFZ A;  1G4D A;  3DQV C;  2MA3 A;  1L3L A;  3SFI A;  4QTR A;  4UVB A;  2EV6 A;  4PZJ A;  1IV8 A;  2Y30 A;  4HQM A;  4ZDP A;  3I0T A;  1YYV A;  3TOB A;  3RYP A;  1H89 C;  3V8J A;  2IT0 A;  3WG7 H;  5FD5 A;  2Q2E B;  3OYN A;  4HG2 A;  3SXY A;  1WSU A;  1R49 A;  5DYM A;  5D8K B;  1ZAO A;  5K5Q A;  3GUD A;  3HYI A;  5HLG A;  3S2W A;  1BOA A;  3B6A A;  3M1C A;  3RPQ A;  2LKS A;  2B7E A;  2UWM A;  2A6T A;  1A6Q A;  2W7N A;  3DXJ F;  3PJR A;  2W85 A;  4DYC A;  3CTA A;  1BIB A;  1BR1 A;  3F8M A;  2QLZ A;  2DK8 A;  2WB1 N;  3PO2 J;  4ZDL A;  1TQM A;  3JTH A;  1T56 A;  1FYL A;  2AHQ A;  3ZMS A;  2L7F P;  1FOX A;  2QUF A;  4IHV A;  3NRV A;  3S3N A;  1RES A;  2HOT A;  2VKE A;  2V26 A;  2VON A;  5KK1 A;  3FK6 A;  3NWT A;  1USS A;  5D5X B;  1IRG A;  2E1C A;  4E7I A;  5FLX K;  1F5T A;  3H9G A;  3DBR B;  3HOU J;  2Y48 A;  2FBK A;  1P7I A;  2BZT A;  1U5T C;  4FE7 A;  1JKP C;  4BBS J;  2CRG A;  2VT3 A;  2KMU A;  2OQG A;  1T0F C;  2W57 A;  4KYW A;  5J1Y A;  2DYR H;  1H0M A;  1QA6 A;  2E5N A;  2WV0 A;  1PP7 U;  2JRT A;  1ETX A;  4WF2 A;  5LEJ A;  5DDG A;  5FLX Z;  5LFA A;  3OS0 A;  4AUX A;  2RC4 A;  2RAE A;  4YEJ A;  3W2A A;  2QM3 A;  2QF7 A;  3F6O A;  4NC6 A;  1ETV A;  1UZC A;  3WOD F;  3WU0 A;  1CGP A;  2QCO A;  4LK0 F;  2DXI A;  3UKG A;  3BZC A;  2Z99 A;  3LSG A;  1BI3 A;  2Y69 H;  2FQ3 A;  4P5O A;  5IYC J;  2CV1 A;  3LSK A;  1J0R A;  3GLL A;  2VQH A;  2LD5 A;  3WGH A;  1SFU A;  2XF7 A;  3A2K A;  3CDH A;  4XOT A;  4ESJ A;  3CC7 I;  1IG7 A;  3CLQ A;  1P4W A;  2EIK H;  3BRO A;  4OU0 A;  3PSF A;  1YOV B;  2BHY A;  3E3V A;  4MIM A;  5D5U B;  3ZP5 A;  3DBH B;  3AG1 H;  4C2U A;  1IRX A;  2KHM A;  3HIF A;  1JJ8 C;  1A36 A;  2DT6 A;  4KT5 C;  3EPZ A;  1OIS A;  3K1P A;  4PJN A;  3ROU A;  2ZSI B;  2UXN A;  1JHF A;  1U5T B;  2VBX A;  1B72 A;  1G3T A;  1IUY A;  1YW7 A;  3TDZ C;  1BBY A;  1OCP A;  2R7D A;  3I53 A;  4L5I A;  1KZH A;  4DJA A;  1HW1 A;  3OR1 C;  2QKM B;  4RAY A;  1FOK A;  2DO7 A;  1LJ9 A;  2YX4 A;  3HDD A;  1GHC A;  3U1D A;  1YG2 A;  2HPM A;  4V2G A;  1V55 H;  3O8H A;  5FGM A;  3W6K B;  1GV2 A;  2A5W A;  1Y8R B;  2JN6 A;  1F43 A;  2DDA A;  1D0Z A;  3SZT A;  2K3P A;  4GGG A;  4IJA A;  3A01 B;  2MG4 A;  2HTS A;  4EJO A;  1AWC A;  3QYE A;  1VQ6 I;  2EIJ H;  2NVY J;  2AXL A;  2ZJQ F;  1T8I A;  4G7Z F;  3DWL E;  4XSZ F;  3HOW J;  4A3E J;  4JQF A;  3V7R A;  3HKZ A;  3V8L A;  2D45 A;  2NAZ A;  2OQR A;  2IA0 A;  1BI2 A;  1FX7 A;  4RLF A;  5EG0 A;  4GO1 A;  4LG3 A;  3VOD A;  2HOS A;  2VQG A;  2KRC A;  1N25 A;  2F5F A;  2E35 A;  1XGO A;  2EWN A;  5K7F A;  1OFC X;  2A69 F;  2HVQ A;  3Q3S A;  3A4C A;  4V19 K;  1R5I D;  2MW8 A;  1EKE A;  4A5M A;  3I9V 2;  1WZ2 A;  3FXJ A;  2NVT J;  1I6H J;  1W5S A;  4KIB A;  4YFK F;  4IO9 F;  1LQ1 A;  3ZOB A;  1VF9 A;  5TJJ A;  2O8K A;  4W1U A;  2X48 A;  2IAI A;  5JR3 A;  3H9J A;  3JRA A;  5BQT A;  2ZJR F;  3GWZ A;  3LQR A;  2MD0 A;  4I99 C;  2E1N A;  2FXA A;  3KP6 A;  3I55 I;  2CUF A;  5LHG A;  4ENK A;  2Y0S N;  2VUM J;  1X1P A;  3CCY A;  2V6C A;  1D1B A;  3CUQ C;  1S8N A;  4QLC U;  5C4X J;  4HNV A;  3FK7 A;  5ICG A;  5DCF A;  2V9V A;  3RI4 A;  3FMQ A;  4IRH A;  2ZME A;  1RET A;  1ORK A;  3RPU A;  2WAQ N;  4EJU A;  2XGX A;  1EJ9 A;  1KYZ A;  1HKS A;  3FHN A;  3S2D J;  2R0Q C;  3R61 A;  3I64 A;  1PJR A;  3KYD B;  1WFX A;  4UNO A;  2O8X A;  3GW2 A;  3ZQQ A;  2BY1 A;  2V9K A;  1JKR C;  2V1X A;  2KRF A;  3AL0 C;  3VWB A;  3K4L A;  5GAD J;  2QEX I;  2IGM A;  2PQ8 A;  1RI7 A;  3EUK L;  4B47 A;  4CYC B;  1UFM A;  4IEJ A;  1PUF A;  1YIT I;  4IF4 A;  1YE9 A;  3PIO F;  3HSF A;  1AOY A;  3ZMU A;  2RKH A;  2RQQ A;  2UUZ A;  4IQJ A;  3LSM A;  3OOP A;  3O6B B;  4NC8 A;  4UXN A;  1IW7 F;  2TDX A;  3HHH A;  3BG7 A;  1P9Q C;  1ETW A;  2TRT A;  3DLL F;  1X3W B;  1DP3 A;  2NYX A;  4YEL A;  3SEQ A;  4BAC A;  4Y15 A;  2KRH A;  1IAW A;  1VZ0 A;  2RGV A;  2OU2 A;  1X4P A;  2X85 A;  2Y2Z A;  3JR9 A;  4M3D A;  2FMY A;  2KJB A;  3HKZ N;  4F93 B;  2I5U A;  1ZGW A;  4HF1 A;  1SEU A;  3VYT B;  4GCV A;  3FIS A;  4CA0 A;  1U9N A;  4HST A;  1MZB A;  3HC7 A;  2IA2 A;  1K7A A;  1BR4 A;  5ILV A;  2JJ7 A;  5J47 A;  3S32 A;  4BE1 A;  1R4M B;  2XGD A;  1WPK A;  3CJR B;  5F04 A;  3U9G A;  3NWS A;  3W6J B;  1O57 A;  3ERM A;  2HXO A;  1AHD P;  2JA8 J;  4XQF A;  2HXI A;  2YSR A;  4J19 A;  4P96 A;  3HSR A;  3JAM K;  3WTV C;  3ABT A;  3IUO A;  2NNY A;  4B8X A;  3FXO A;  4I7H A;  1HF0 A;  3BR6 A;  4XID A;  3R0A A;  1H9T A;  1HW5 A;  2ZNZ A;  1IDZ A;  2GXB A;  5CVU A;  3ZPL A;  3OYF A;  4BEH B;  1U2W A;  2NXN B;  5D6F A;  4RLQ A;  4ZC3 A;  4EJW A;  2FX0 A;  3S3O A;  4XKW A;  2P5V A;  4WK8 F;  1STZ A;  5DTD A;  5CQE A;  2MC4 A;  2FF4 A;  4E7H A;  4KUM A;  4O6J A;  3LA2 A;  5F27 A;  1PP8 F;  4KIS A;  2BHZ A;  1WJF A;  3GFM A;  4HRI A;  2CYY A;  4BGD A;  4S04 A;  4BDY A;  1OCC H;  1P92 A;  4A12 A;  2EV5 A;  4KIF A;  3AFH A;  3OYD A;  2EB7 A;  3REO A;  2V4J C;  4MO7 A;  2W24 A;  4GXO A;  4XLA A;  5F0H A;  3JRI A;  4G6T B;  5F0F A;  5B5E C;  5L3F A;  4XRM A;  1YJN I;  1X3U A;  2IEK A;  1Z6T A;  4UB6 C;  2R3S A;  3VYU B;  1Z7U A;  4M6Y A;  3F9K A;  4CZC A;  2Z9O A;  1JUS A;  3J80 K;  3HTS B;  3CCJ I;  1FOW A;  5EZG A;  1OKR A;  3A1Y A;  2HEO A;  1HKQ A;  3LSJ A;  3S1N J;  1UST A;  2JA2 A;  3CUO A;  2A3S A;  3OOU A;  5H6R A;  3S1Q J;  3FMS A;  2XSD C;  4A3F J;  5CVJ A;  3E6C C;  3DKY A;  1IF1 A;  4UV9 A;  2MBF A;  5FKN A;  1W7P D;  1UG2 A;  2XGE A;  3HUG B;  4NQW A;  4FQG A;  4K2E A;  2F4M B;  2ZFU A;  3T8T A;  1HLV A;  3MQ0 A;  4L5J A;  4P9F A;  2IXS A;  2A61 A;  5KNL A;  2ZME C;  4N9I A;  4EQQ A;  1T39 A;  1OLT A;  3IC7 A;  2OTL I;  3DBL B;  4PJ0 C;  5L3D A;  3F8B A;  4IOA F;  3HG9 A;  2KT0 A;  2VOD A;  5HLI A;  3LAP A;  5DUK A;  1B8I B;  4KIG A;  4BQA A;  3ML6 A;  3ASO H;  4I76 A;  4MLO A;  5FRO A;  4ANJ A;  2PMH A;  2E19 A;  4UVA A;  5EDN A;  3W2V A;  1ZLJ A;  2P0W A;  3FKI J;  3OSF A;  1JKQ C;  1JT0 A;  3G1M A;  2FOW A;  5M3M J;  3WTU C;  4D7M A;  3JRG A;  2FJ1 A;  2R5Y B;  4BYY A;  2V1U A;  5IT9 K;  3WE3 A;  4BJT A;  1T2K A;  3ABK H;  1DUX C;  5D5V B;  3TO6 A;  2IS2 A;  2MH9 A;  2H1K A;  3W6V A;  4HYE A;  4HEA 2;  5ICC A;  1E3P A;  3FF5 A;  3NEU A;  4AID A;  2H1L A;  1TTY A;  2I10 A;  3GYH X;  1BIA A;  4M3B A;  2Y75 A;  3GZN B;  3GEZ A;  4N9H A;  2OA4 A;  2H6B A;  2XF5 A;  2PMU A;  4PCQ A;  5F64 A;  4NC7 A;  3JSP A;  3GTP J;  1WJC A;  5CVI A;  2EZH A;  3SZG A;  4AYB A;  2Z33 A;  2LY2 A;  2K9Q A;  3E6B A;  3O3K A;  3H3V K;  4LK1 F;  3ECO A;  2Q2E A;  1RUO A;  2X1C A;  3JW4 A;  4Y52 J;  2FU4 A;  1MMA A;  4G94 A;  2E2I J;  1QPM A;  2QQB A;  2XPV A;  2DTZ A;  4U88 A;  3GVA A;  2B9S A;  2FRH A;  2FQ4 A;  4BE2 A;  4HPQ A;  3GLX A;  4ENM A;  1W4M A;  3T5X A;  4OMZ A;  4G6Q A;  1IUF A;  3PNT A;  1RNL A;  1TQI A;  2K9M A;  5IT3 A;  3OYG A;  2D2W A;  3I59 B;  2CUZ A;  3GFL A;  2DOD A;  3QWL A;  1VQO I;  1FJL A;  3BPV A;  3RTR A;  4AU7 A;  2R7Q A;  1R7J A;  3DV8 A;  1OMI A;  1RPW A;  2BOL A;  2Z16 A;  4DNC A;  2EA2 A;  1UB9 A;  4HV6 A;  4M6V A;  3LWF A;  1FTT A;  3ABL H;  1DDN A;  1WJA A;  1P7J A;  2LY9 A;  2LF7 A;  5L3C A;  4B1R A;  5D5W B;  4C3J J;  1G8X A;  3L2Q A;  5ICF A;  5EF6 A;  2JPB A;  4XKC A;  2HOA A;  1JUP A;  3H92 A;  4J01 A;  4XLH A;  2PMZ A;  4E7J A;  5J8F A;  3U1K A;  4PFO A;  2ZC2 A;  3BTL A;  4J00 A;  5M5X J;  3HOX J;  1O7L A;  3EUH C;  1SFK A;  3SHF A;  2VKH A;  2XF6 A;  1TL8 A;  1RKW A;  3CCQ I;  1QGP A;  3L2C A;  1FMW A;  3M3Y J;  4A0X A;  2LRD A;  2HDW A;  5B3S H;  2R7U A;  2WAF A;  1UJ8 A;  2HTJ A;  3OS2 A;  2ISZ A;  1VQK I;  2O0Y A;  4XRF A;  2ZJP F;  2WAE A;  2EBI A;  2GQQ A;  3HRM A;  1LPQ A;  2X1D A;  3HZJ A;  1T33 A;  4RMN A;  3MKL A;  2XRO A;  2DAO A;  3HOT A;  4DIQ A;  4RAF A;  4L0Y B;  2LR8 A;  3HM5 A;  1QVT A;  1S9H A;  2ZCW A;  1Q1H A;  2DMT A;  1JGS A;  1B8I A;  2Q0O A;  4B48 A;  1JJ6 C;  6PAX A;  3VSL A;  3ONQ A;  3R60 A;  4FCY A;  1WJD A;  1FBQ A;  2DBB A;  1XMX A;  4DZP A;  4Y17 A;  3QOD A;  5FRN A;  3IV5 A;  4HX7 A;  3GCM A;  2VC1 A;  4II2 A;  4XNF A;  2MGQ A;  3TGN A;  4BBR J;  1D5V A;  5E79 C;  4A0Z A;  1OYY A;  4RB3 C;  3TP3 A;  1XSX A;  5H6Q A;  3KP5 A;  5DV5 A;  5JHU A;  1D5Y A;  1V54 H;  4XSX F;  2I8D A;  1B72 B;  2ZKZ A;  3KP7 A;  4WXD A;  3IH3 A;  1DPR A;  2RVC A;  3LMM A;  2ZO4 A;  3H3U A;  2CO5 A;  1ON1 A;  4JOM A;  1SVO A;  4WWC A;  3K1M A;  2KIU A;  1DGR M;  3KE2 A;  5CVR A;  2JVH A;  3PUF A;  4H0E A;  3Q0U A;  5HLT A;  1MBK A;  3ZN0 A;  3C3W A;  4HF2 A;  3D0S A;  2M8E A;  2HR3 A;  4ZH4 F;  4EM1 A;  2VJ4 A;  4DGW B;  1DU0 A;  2H27 A;  4IHT A;  3MCZ A;  3H5N A;  3ZMT A;  2H6C A;  3AG3 H;  5AIP A;  4WX9 A;  2VLA A;  5ILU A;  1G3Y A;  4N4O B;  4UV8 A;  1K4S A;  1QPI A;  1YS6 A;  1OCR H;  2ID3 A;  3HL2 A;  1MW7 A;  2JMW A;  3ZR8 X;  1QBJ A;  4KT6 A;  5HVQ C;  4QWQ A;  3LNQ A;  3MFK A;  2DA7 A;  4IHY A;  1NTC A;  3G1O A;  3K2Z A;  4L9T A;  4E7S A;  3G71 I;  4F52 A;  1GXP A;  1Z3Y A;  4JX6 A;  2Y31 A;  2YU3 A;  1FOY A;  3O2P E;  2E7W A;  4A3K J;  1RRJ A;  1Z77 A;  1RIO H;  3HOY J;  2BEO A;  2FBI A;  2LH9 A;  1JE8 A;  3CCL I;  3EYI A;  1HSJ A;  4HV5 A;  4F3Q A;  3Q9V A;  2E7X A;  3R6S A;  1RZ4 A;  4HAM A;  4KIT B;  5FLM J;  3IRR A;  3VOE A;  2QYO A;  5KCM A;  5LGT A;  4AM3 A;  3TP0 A;  4L9J A;  5E1X A;  2Z1D A;  3LL7 A;  4F7Z A;  2JT1 A;  4CDG A;  2XGC A;  3P7N A;  1N75 A;  4HX8 A;  4OOI A;  4AWX B;  1CF7 A;  2CV0 A;  2D5V A;  3H9Q A;  2DCE A;  4FIS A;  2OPT A;  3G73 A;  5DCM A;  3ZQF A;  4M3F A;  2YUS A;  4ASN A;  5EGO B;  4G7H F;  3S2H J;  4IQ4 A;  2L7M P;  2PN6 A;  1F4K A;  1V3F A;  2K40 A;  2K4J A;  5TIS C;  4KFC A;  1FBU A;  3M8J A;  4EEF G;  2K02 A;  1XGS A;  4BHP A;  1ONV A;  3MKW B;  3BG9 A;  1LDK B;  1R36 A;  2XB5 A;  4M72 A;  4BHC A;  4RB0 A;  2IJL A;  3Q5F A;  3IWF A;  3M9A A;  4CUG A;  2BW3 B;  3DF8 A;  2E2H J;  2DJN A;  1WH5 A;  2RDP A;  1U0J A;  3KPH A;  3OMY A;  1TW2 A;  1VQP I;  2GA2 A;  2VE9 A;  2ESN A;  4OIN F;  2CFO A;  2K7L A;  4AIH A;  4ZZL A;  2MFZ A;  4L9N A;  2BYV E;  3WTY C;  3A0H C;  2ELK A;  1YJ9 I;  4Z6Y A;  2V79 A;  2BY0 A;  2QBY A;  3FHZ A;  2XSJ C;  2DTR A;  1TWG J;  2WV1 A;  3K2A A;  4HF0 A;  4OIO F;  1Y8Q B;  2L0K A;  5K1Y A;  5K5R A;  5L3B A;  2VJJ A;  1VTN C;  2YPR A;  3BR2 A;  4MEY F;  3GTK J;  4A69 C;  3CCM I;  1XDU A;  2BXY A;  3ASN H;  4XOR A;  2GM4 A;  1BI0 A;  4L18 B;  1TZL A;  1HDP A;  4V2F A;  3J80 Z;  4AIJ A;  1K61 A;  1N78 A;  4QPO A;  3J81 Z;  1XPX A;  5F6F A;  3RYR A;  2VIX A;  2DA4 A;  4KMU X;  1TNS A;  1SFX A;  4PJJ A;  3BZK A;  2VOO A;  4IHX A;  4HW0 A;  2IGK A;  2ECC A;  4XR6 A;  3TQN A;  3CCR I;  2M1B A;  1AU7 A;  2X6X A;  4E7K A;  4U0V A;  2HKO A;  3BR1 A;  3K70 D;  2DPU A;  1WWX A;  1R9T J;  4C2T A;  3HOZ J;  2R7S A;  1PVE A;  4U0W A;  2DQR A;  1AKH B;  2A5Y B;  5L3E A;  1D0X A;  1U8B A;  1X19 A;  4DW6 A;  2FD5 A;  4DYR A;  5GAG J;  4LG0 A;  4MQ9 F;  2K3F A;  2LG4 A;  4RM3 A;  2KIF A;  5DUI A;  3GME A;  4RAZ A;  1FZP B;  3NAR A;  3PUB A;  1J2X A;  5GPA A;  4MTD A;  1R71 A;  3E0J B;  4LIT A;  1YRN A;  2HYG D;  2LYC A;  1KU2 A;  1A04 A;  5FKL A;  2KIS A;  3L2R A;  1WJ5 A;  2DPD A;  2HQ5 A;  1I3Q J;  2X6Y A;  5DM7 F;  3BR3 A;  2EIL H;  4P55 A;  1EA3 A;  3OIO A;  1SVL A;  2IBD A;  3RSN A;  2ID6 A;  3U2R A;  1WCM J;  3S8P A;  3OYM A;  2XUB A;  1MMD A;  4R8H A;  2HDC A;  1X4O A;  2L01 A;  1W36 D;  4HNU A;  3W3C A;  3P9I A;  2PFB A;  3JRE A;  5DCM B;  3GZ6 A;  4I6Z A;  2FNA A;  3J7A O;  5EG0 B;  3J81 K;  2DYS H;  2VOP A;  2VL8 A;  3CCS I;  1LE8 B;  5JLW A;  5AON A;  2MC3 A;  3FDY A;  3LSH A;  3RDI A;  3J7A Y;  1V5E A;  3LA3 A;  3ZQL A;  4L9V A;  4XKB A;  5CLS A;  3HBL A;  5D4S A;  1YRN B;  3CMA I;  5E8I A;  1T98 A;  2F2E A;  3BZ6 A;  2WC2 A;  5HDG A;  1FPQ A;  2UZK A;  2VN2 A;  3BDD A;  1KGS A;  3BLY A;  1R5H A;  3K4C A;  1SD6 A;  2ZFW A;  3GTM J;  4R1H A;  1I3A A;  3OR2 C;  2M2E A;  3H5R A;  1NHA A;  5K7Z A;  4MQV A;  1W5T A;  2WTE A;  1FBS A;  1Z21 A;  1UAA A;  4WCG A;  3FX3 A;  3HJE A;  2ZJ2 A;  2VQL A;  1TP4 A;  2DMU A;  3PM1 A;  4BH9 A;  1U3E M;  1J5Y A;  2QEN A;  3DTE A;  4H4K C;  1OJL A;  4IXA A;  2ADU A;  1WKM A;  4C30 A;  2JTV A;  1ZG3 A;  4LIV A;  3ZQI A;  2XAF A;  4MFD A;  2JVG A;  2ECB A;  4JBA A;  5KVR A;  3C18 A;  3F0C A;  2PI0 A;  2DOA A;  2LTP A;  1D8J A;  3CLO A;  3EQL F;  4OIR F;  2L4A A;  5LHI A;  3E5Q A;  2GOX B;  4ZYH A;  1MIJ A;  3WTS C;  3M4O J;  3ZQG A;  1JTX A;  1KQ9 A;  1KU3 A;  2VAS A;  3RQI A;  4IHW A;  4BJ5 C;  1SAN A;  2XDV A;  3BG3 A;  3WTZ A;  3WE2 A;  2PG4 A;  2EJR A;  4BL0 B;  4LLG F;  1MD0 A;  4OAY A;  4BS9 A;  1JTY A;  2IS6 A;  4X1E A;  1IGN A;  2M45 A;  4XBF A;  1F1Z A;  4N4N B;  3R0J A;  2DT5 A;  4A3G J;  1IXS B;  1VQ4 I;  1T95 A;  3G2B A;  4D5F A;  5M3F J;  3L7W A;  1BJZ A;  1OCZ H;  2HYJ A;  2WY7 Q;  3P9K A;  2JQ7 A;  3S17 J;  3QYF A;  4IZZ A;  3UR3 C;  4C2M J;  2XPU A;  4XLE A;  2LBF A;  3KYC B;  2KZV A;  5A2Q Z;  4M3G A;  3KET A;  3FXU A;  3K9T A;  2XKO A;  5L3G A;  2R5Z A;  5JLX A;  3MZ8 A;  2BVM A;  2VI6 A;  3VYS B;  1YFH A;  1U78 A;  4KDP A;  1QQI A;  2EQR A;  1J7K A;  2MH2 A;  3CDI A;  4Y13 A;  2EZL A;  3AG2 H;  3DCF A;  1ZG1 A;  4LB6 B;  2EK5 A;  5J8C A;  1RC9 A;  4IKF A;  1HXD A;  4NHJ A;  1B9M A;  4HLX A;  4LOC A;  4XN3 A;  1D3Y A;  3ULQ B;  3VPR A;  4A93 J;  4BE0 A;  1EF4 A;  1D0Y A;  2V1D A;  2Z3Y A;  4CXF A;  1SD4 A;  2CU7 A;  2DFF A;  2FE3 A;  2ZB9 A;  5LEK A;  3CO6 C;  4Y7N J;  3DLA A;  4LB5 A;  2KIQ A;  2MAB A;  2HNH A;  1UG0 A;  4X0G A;  3F72 A;  1ZYR F;  3C2G A;  1T0F A;  4PUS A;  1GUU A;  3FM5 A;  1B6A A;  1LEA A;  1ZEL A;  2P5K A;  4HNT A;  3V4G A;  4IHS A;  3CUQ B;  3EYY A;  3ESW B;  5H20 A;  4D5C A;  3CDL A;  5J4Y A;  1N77 A;  1W7P B;  2JUG A;  2ME0 A;  3EDP A;  3ECH A;  4AD9 A;  3FBI B;  1J59 A;  3GTG J;  5HDK A;  4XKV A;  3JRH A;  4O3M A;  2DOF A;  4AIK A;  3E97 A;  1ZGA A;  2QSF X;  1X1C A;  4X6A J;  1I6X A;  3E7L A;  2COM A;  1YX3 A;  3H5A A;  2EPF A;  3K4J A;  2DFH A;  3KP4 A;  1S7A A;  2LLK A;  4DQ2 A;  4CYD A;  4FHT A;  1LVA A;  3CJN A;  3GF2 A;  1P4X A;  3ZN1 A;  4RB2 C;  2CQQ A;  1OR7 A;  1SAX A;  3K4N A;  4ESB A;  1R22 A;  2LMD A;  1FY7 A;  4IRG A;  1YW8 A;  1HDD C;  2YU9 J;  3LST A;  2DFI A;  2GOM A;  2M0C A;  2VT2 A;  5FRM A;  2L7Z A;  2XAG A;  3K6G A;  1DU6 A;  3IRQ A;  3KX2 A;  3VSK A;  1HST A;  2W25 A;  3WGI A;  4CCL A;  2CJJ A;  3QP5 A;  2VPR A;  4XRS A;  1M1E B;  4JX5 A;  5GP9 A;  3K7A J;  2GAU A;  3I5U A;  2KPM A;  3TKY A;  4F91 B;  3QPS A;  3K4M A;  2F5E A;  4U7D A;  3HUG A;  1XG1 A;  1TQP A;  3KP3 A;  5CVV A;  2EA4 A;  3DPL C;  2CQN A;  1MJA A;  2BV6 A;  1YX5 A;  3HRU A;  1L0O C;  1I50 J;  3CF2 A;  4BQO A;  1O3T A;  1XS9 A;  2M9H A;  4M74 A;  2PLY A;  2HPI A;  3I58 A;  2M0M A;  3BR5 A;  5LGN A;  3TMO A;  4A3D J;  3P5J A;  3QPT A;  2L02 A;  2DA6 A;  4UUS B;  1LNW A;  2XAJ A;  3K4K A;  2P8T A;  2H8R A;  3HPG A;  4JX4 A;  5D4R A;  4M9S A;  1H8A C;  1ETY A;  1W0U A;  3UNG C;  2QVO A;  5E3L A;  1FYM A;  1D8K A;  2O7O A;  2BXZ A;  4GDF A;  3MZY A;  1G59 A;  1WJB A;  2YS9 A;  5LBQ A;  3OYL A;  2E1M B;  2O61 A;  3KZZ A;  3R4K A;  4TV7 A;  4QPQ A;  1SFO J;  2GA1 A;  1BC7 C;  2LOO A;  5IOY A;  4RAG A;  3K69 A;  2X6O A;  3L00 A;  1WGX A;  1I1S A;  3GTO J;  2QQ9 A;  2LBF B;  4MGR A;  1UMQ A;  2QBY B;  3VDX A;  1D1C A;  3AKZ A;  3TO9 A;  3RPU D;  5A2Q K;  2CQK A;  3BTC A;  3MN2 A;  4XMY A;  3J7Y J;  4U87 A;  2GLO A;  2AQF A;  2EIM H;  3FXL A;  2A05 A;  3N4M A;  4BQQ A;  4LD5 A;  2ICW G;  1SAU A;  2P6S A;  2TCT A;  3TBI A;  5LD2 C;  1W7P A;  1GVJ A;  5H2F C;  3W2W A;  2K4B A;  5HS8 A;  1FNN A;  5LLQ A;  1JI8 A;  3PQJ A;  1YW9 A;  1G3S A;  1Q1V A;  3DKX A;  4LJZ F;  4G6D A;  1TWF J;  3WGG A;  3T0Y A;  1YS7 A;  2LF8 A;  4HQE A;  1K6O A;  1ZRE A;  4GFB A;  3PL8 A;  1TT5 B;  1MSE C;  4IX7 A;  1KA8 A;  1LVK A;  2H8W A;  4XON A;  4FT8 A;  1A35 A;  5EGO A;  1XD7 A;  1G2H A;  4LLN A;  4IVN A;  1OCO H;  4MEX F;  2CG4 A;  2HFH A;  2BY2 A;  1S7O A;  1MNM C;  1AKH A;  1QZZ A;  4D0P A;  1MJB A;  3B73 A;  3DPT A;  1IRZ A;  4IL6 C;  1ZAR A;  1R1T A;  4L0Z B;  3MD2 A;  3VYR B;  2K9N A;  4RDU A;  2STT A;  1XN7 A;  4GYG A;  3BOQ A;  3ZQH A;  4S05 A;  2F48 A;  2W00 A;  5BPI A;  3DTK A;  3BJ6 A;  1EH8 A;  3BY6 A;  1KON A;  4A6E A;  4B4C A;  5FKK A;  5HOO A;  1MKM A;  3CES A;  2L9R A;  2IS4 A;  1XTA A;  3PNV A;  1R4N B;  2P7V B;  2EFP A;  4M6X A;  4XLN F;  2OV7 A;  5DEQ A;  3QP6 A;  3GXO A;  1ZK8 A;  1Y1V J;  3M1E A;  4M73 A;  4XIC A;  1HCR A;  4KN4 X;  1TT0 A;  3HHG A;  3CD6 I;  2JRM A;  1ON2 A;  3WTW C;  1DPU A;  1J75 A;  1BL0 A;  4Y4R A;  5KHD A;  1UHM A;  2X0L A;  3C1D A;  4FAS D;  2A6H F;  4KJZ A;  1BW5 A;  1F9N A;  3ZMZ A;  1JGG A;  4HBL A;  2A68 F;  3LSR A;  2NNN A;  1XSD A;  3G6E I;  5B66 C;  5BPD A;  4LIU A;  1LEB A;  1MBE A;  2L7K A;  2OCE A;  2OF7 A;  3A0B C;  2DN0 A;  4KIC A;  1K78 B;  3T8R A;  1MGT A;  1R58 A;  3MZH A;  2L4M A;  1GT0 C;  5HLH A;  2EZI A;  1HKT A;  1TWH J;  2WA0 A;  4I01 A;  3DEU A;  1FSE A;  2DW4 A;  1KU9 A;  2KZG A;  4DYQ A;  3QU6 A;  5FO5 A;  3JAM Z;  1V4R A;  1XB4 A;  2E2J J;  1VQN I;  2CV2 A;  5GAE J;  1TC3 C;  3CP2 A;  2G9W A;  2COB A;  3A02 A;  3BG6 A;  2IGO A;  3RKX A;  3QU3 A;  4E4H A;  3SZP A;  2JZY A;  2AQE A;  1LKX A;  2NS8 A;  4HX4 A;  3FXR A;  1I5Z A;  2JA7 J;  5E17 F;  1QRY A;  5E3O A;  1OYW A;  1VQ8 I;  3GX4 X;  2Z2S B;  3JCU C;  3HEF A;  3I3L A;  1SFE A;  2DU9 A;  4XK4 A;  2L9N A;  4LLL A;  3KZY A;  4Y3O A;  2R5Z B;  2L9S A;  4PSW A;  2LFB A;  3DU5 A;  3HTU A;  3S14 J;  2HOE A;  2OCC H;  2BGC A;  1LE8 A;  2DT7 B;  2VJI A;  3CF5 F;  4XLC A;  2W48 A;  3SFZ A;  2NS7 A;  1ENH A;  5BMZ A;  5EEH A;  1J09 A;  2P6T A;  1J9I A;  5CPR B;  1YIO A;  2PJR A;  1TBX A;  1VQ5 I;  2FEZ A;  2KLO A;  4ENN A;  5E20 A;  1YO5 C;  1ZGJ A;  3S15 J;  1NG6 A;  5FB2 A;  2HZT A;  1AA7 A;  1MBH A;  3EUA A;  4XN0 A;  3F23 A;  4EM2 A;  1U5T A;  2IGN A;  5LGU A;  2O9L A;  1IN8 A;  4ZYA A;  1IN4 A;  4CSW A;  2MLG A;  3OYK A;  5ERI A;  2M4G A;  3CMY A;  4B43 A;  5IP9 J;  3WHB A;  5E18 F;  4HZF A;  3MAJ A;  2B63 J;  2GZW A;  3FXK A;  4JP0 A;  3OL3 A;  1LDD A;  4M71 A;  1LFU P;  1RUN A;  2HQA A;  2KDO A;  5DS9 A;  3M8E A;  1P4A A;  5LRS A;  3B6C A;  2ZXI A;  3B02 A;  1ETQ A;  2Q8K A;  2R7X A;  2R7Z J;  1E3O C;  3FBN B;  2EFQ A;  3J7Z I;  3PIP F;  3K10 A;  3V7C A;  5EEA A;  2W84 A;  2ACJ A;  3IHU A;  1YQA A;  5CJ9 A;  4B44 A;  2NVU B;  3KYL A;  1VQ9 I;  4XRS G;  4CCN A;  1MMS A;  3WTX C;  1MJ9 A;  1WRJ A;  4ZYG A;  2AXT C;  1S29 A;  3I71 A;  2QGU A;  4UY8 I;  2MSY A;  2HQN A;  2X6W A;  2R4G A;  1IJW C;  5IP7 J;  4CO8 A;  3GTL J;  2PBI A;  2BVL A;  1XMK A;  2VBY A;  2OTJ I;  5K5O A;  3F8N A;  3JSO A;  3FZV A;  2VJ5 A;  1BC8 C;  1LFB A;  4M3E A;  4BU2 A;  2F4O B;  2PJP A;  4ETS A;  3F22 A;  2QSH X;  4NB5 A;  2IPQ X;  1MND A;  1WVR A;  4F55 A;  5ICE A;  1K78 A;  1IRF A;  1EH7 A;  1PUF B;  2KJC A;  2V6E A;  3ZXS A;  2H94 A;  1UCR A;  1VFC A;  3SJM A;  1U8R A;  3LSP A;  4YII A;  1REP C;  4ZYE A;  4NQW B;  2JA6 J;  4XLF A;  1NH3 A;  2DI3 A;  2VPL A;  4A3M J;  3K0L A;  3X2Q H;  2ESH A;  1O7F A;  1SD5 A;  5EJC A;  4EMS A;  2V9P A;  2K85 A;  1MBG A;  3KCC A;  2HQR A;  4P9U A;  1MH4 A;  4LMY A;  3IAS 2;  3QAH A;  2O5R A;  5IYB J;  2D1V A;  2NVX J;  1ZRD A;  1QNT A;  4S0H B;  1WI3 A;  2X9D A;  2R92 J;  4AYB N;  2EV0 A;  2M87 A;  2K9S A;  2FA5 A;  2H09 A;  3Q0V A;  4UB8 C;  2RV8 A;  4A5N A;  2R7V A;  4A6D A;  2KP6 A;  1QU3 A;  2HWV A;  2O03 A;  2C6Y A;  4A3J J;  3S1M J;  1OR7 C;  1T6S A;  3IL2 A;  2FML A;  2CW8 A;  4G7O F;  3PQK A;  4FE4 A;  1S7E A;  4BXU A;  1NK2 P;  3H36 A;  1X3Z B;  1FTZ A;  4OWR B;  3TO7 A;  2M3A A;  1WI9 A;  3CZ6 A;  2XB0 X;  4RS8 A;  3E6D A;  3LFK A;  2M5W A;  2NOJ B;  4CHU A;  1S3J A;  5GTI C;  3P9C A;  4M9X A;  2CQ7 A;  1Y0N A;  4KA4 A;  4I98 B;  1JXS A;  2RNG A;  2W1O A;  1Y6I A;  4MTE A;  4RGS A;  4UUV A;  3VB2 A;  1HA8 A;  5TGT A;  2GXG A;  3QPH A;  1V5G A;  3PFY A;  3RKY A;  2KQR A;  5KAF C;  2E1M C;  2VBZ A;  3AG4 H;  2UXX A;  1HBX G;  4ESF A;  2O6G E;  2PX9 A;  1ZH5 A;  3EET A;  1MBF A;  2XAS A;  2Y9Y A;  4HA8 A;  1PDN C;  1GDT A;  4UHT A;  5K7H A;  4PJM A;  4FET A;  3WU2 C;  1R1U A;  1X2N A;  3GTQ J;  4YRV A;  3EUH A;  3LFU A;  3ZQ7 A;  3OS1 A;  2QQ8 A;  1YIJ I;  2DA2 A;  1ZN2 A;  1K6Y A;  3ZGK A;  3A03 A;  1C0W A;  3CC2 I;  2R7W A;  4B09 A;  3IWZ A;  1GVD A;  2PEX A;  3RKQ A;  1Y1W J;  1F36 A;  3E5U A;  3DEE A;  5EZH A;  3FM3 A;  2MLK A;  3TED A;  3BWG A;  3LQQ A;  2QSG X;  1HW2 A;  3F6V A;  5J6X A;  2G0E A;  1I1G A;  1IO2 A;  2CSO A;  3V8K A;  3KEY A;  3LAJ A;  4A3I J;  2LK2 A;  3IH4 A;  1POG A;  4C9Y A;  3K70 C;  2AO9 A;  1ZQ3 P;  5IYD J;  5M5Y J;  5D8L B;  4EGZ A;  2LKX A;  4PK4 A;  3BTI A;  5DD8 A;  4ZTJ A;  3D5L A;  3BCB A;  5BS6 A;  2L5Q A;  2VXD A;  3VEP A;  4Q4Z F;  1QHH D;  1EH6 A;  4BDZ A;  1FT9 A;  3NAU A;  2AS5 F;  2WY8 Q;  3FXM A;  1BOB A;  2ISY A;  2XPW A;  3HPH A;  1ZTR A;  3WTT C;  1KU7 A;  5F1J A;  4I0B A;  1ZR4 A;  5DM6 F;  2BE5 F;  4D1Q A;  1D1A A;  3F8C A;  3HB9 A;  2EH3 A;  1KQ0 A;  3G3Z A;  4G9Y A;  3RQ4 A;  1X1B A;  2R7O A;  2CFX A;  2JWT A;  1FEX A;  2R7F A;  1MH3 A;  2HS5 A;  3LOC A;  3KP2 A;  4DBQ A;  1TW3 A;  1XDS A;  1MBJ A;  2DA5 A;  3IP4 B;  4OIP F;  3N97 A;  3H0G J;  5FD6 A;  1MDM B;  1ZKG A;  4BUP A;  5HS7 A;  1MSF C;  3ERE D;  2F5D A;  1OYI A;  1LFP A;  2X1E A;  3OYE A;  1RR8 C;  1IXR C;  5JI6 A;  3KZI C;  4XM3 A;  3RIR A;  1YTY A;  3BJO A;  3I54 A;  4RBO A;  3DKW A;  3QYB A;  5CQG A;  4CCM A;  4DOZ A;  5D6E A;  5C44 J;  4HDU A;  5FFZ A;  2JSC A;  1FP2 A;  1KYW A;  2MYS A;  1TWC J;  2LP0 A;  3OWT A;  1FLI A;  5E1Z B;  3HSE A;  1OQY A;  3H3Z A;  2FBH A;  1SC7 A;  3H35 A;  1PYV A;  3ABU A;  5LHH A;  5B1B H;  5E8G A;  1WJE A;  3COA C;  3PO3 J;  5GPC A;  2J5P A;  4BHB A;  4ITV A;  3BPX A;  4I0A A;  5FJ8 J;  2P7C B;  1A31 A;  1SMT A;  3BCA A;  5C4J J;  1B1B A;  4XLP F;  2OJE D;  1SD7 A;  4EVI A;  1FC3 A;  3OL4 A;  3RZD J;  4N0B A;  4U0Y A;  4YIR X;  1TLH B;  2ZSH B;  2WB1 A;  2KKO A;  3M8F A;  3CQZ J;  2X4H A;  1X1A A;  3OYC A;  4AVZ A;  1VQM I;  4CCJ A;  3WU1 B;  2R93 J;  5J3L A;  3ELK A;  3OV8 A;  2F5V A;  2A07 F;  2DLL A;  3FXQ A;  3H0D A;  1Z91 A;  4RGU A;  2GXA A;  2IRF G;  2NRA C;  1Z05 A;  1R5G A;  2XVC A;  4JYK A;  1S6L A;  4PDK A;  1ZHF A;  2ME6 A;  2EFO A;  2IP2 A;  2LSO A;  3FKJ A;  3FIW A;  4B3X A;  4BY1 J;  2DA3 A;  2KFD A;  1JT6 A;  3DU6 A;  2VKD A;  3TDU C;  2PJR B;  3M07 A;  4D9J A;  1XSV A;  1APL C;  1NK3 P;  2N8G A;  3U21 A;  3D1N I;  3LA7 A;  3V7S A;  4DBR A;  2DK5 A;  5E3M A;  5JHF A;  5HS9 A;  1YLF A;  4BXF A;  1K4T A;  3BP8 A;  2M34 A;  1DP7 P;  5EEG A;  3HOV J;  2LKP A;  1ODD A;  1VI0 A;  3K1N A;  2CWE A;  3JRC A;  4E7L A;  2OZ6 A;  2QZ8 A;  1QO0 D;  3BQZ A;  1A5J A;  2OZU A;  4A2U A;  3DFG A;  4CCK A;  5JVG F;  4BQN A;  1FP1 D;  2V1N A;  4QSH A;  4A3B J;  1FWZ A;  4PFP A;  4RA2 A;  1XMA A;  4IOC F;  2RRE A;  1B59 A;  1ZG5 A;  5F08 A;  2Z5U A;  2FOK A;  5TRD A;  3OIQ A;  1UEL B;  1JHH A;  5J1U A;  4CZZ A;  4ZZD A;  2R7R A;  5FKM A;  4NNJ A;  1GXQ A;  2DDB A;  3C7J A;  2HI3 A;  2FNP A;  3S93 A;  4D7N A;  4NUB A;  2QQA A;  4Y33 A;  2B0L A;  3BR0 A;  2VB6 A;  3GZ5 A;  1P2F A;  2HYF A;  1IN5 A;  1IV6 A;  1R1V A;  1R6R A;  1W36 C;  4M9Z A;  1G3W A;  1Z67 A;  3CCV I;  2OUM A;  3TW7 A;  2ZNY A;  3OYH A;  4BNC A;  2R5Y A;  3QQA A;  4RGR A;  1HOM A;  5GTH C;  1R23 A;  1MNE A;  3QPL A;  3GFJ A;  1X2M A;  2G7H A;  4A3L J;  1E17 A;  4PSX A;  3L9F A;  4C3I J;  4WXH A;  1Y39 A;  2XRL A;  1U9O A;  3MEX A;  3HOS A;  2HDD A;  3MWM A;  1LUJ B;  2XHK A;  5IY5 H;  3S3M A;  4I02 A;  3TL4 X;  4ZJZ A;  3F21 A;  3HXL A;  2ELH A;  2GIZ A;  2EZK A;  2WAD A;  4HOB A;  1OCT C;  2ZBK A;  3V42 A;  3D5S C;  2CS3 A;  1VND A;  2BY3 A;  2E5Z A;  2NVQ J;  2K5C A;  2EFN A;  3GO5 A;  3JRB A;  2JPC A;  1XC5 A;  3RJP A;  3GFI A;  2ZXJ A;  4EM0 B;  1T38 A;  2F5C A;  2STW A;  1X1D A;  5J40 A;  4Q48 A;  4LG0 B;  3QOE A;  1X58 A;  1I39 A;  4UUS A;  1IZ1 A;  2XV4 S;  3WHC A;  2ZXW H;  3KEQ A;  4II3 A;  2OD5 A;  4LFU A;  3OYJ A;  3HRT A;  4L5E A; 
#chains in the Genus database with same CATH homology
 4R79 A;  1TNT A;  2LNB A;  4OMY A;  4FX4 A;  1ZRC A;  4ZYD A;  2VE8 A;  5JVT A;  4CGZ A;  1SMY F;  3KEO A;  2IW5 A;  2CW0 F;  4YG2 F;  2XAH A;  4BAY A;  3FMR A;  2VC0 A;  1XCB A;  4AVP A;  3NQO A;  2KIM A;  4JK1 X;  4ON0 A;  1FYK A;  2ETH A;  5IT9 Z;  3ZMV A;  3AAF A;  3QRF F;  4EJT A;  3T1B A;  3E5X A;  1O3Q A;  1PUE E;  2L54 A;  4CIC A;  4KNY A;  4E70 A;  3JTG A;  1ZLK A;  3SQN A;  2MD5 A;  2G7U A;  1CF7 B;  5BOX A;  4Q5S F;  5E1W A;  2FSW A;  5LRR A;  4KMF A;  1Z9C A;  1IXC A;  5DD4 A;  1B9N A;  1OPC A;  4PGG A;  4YFN F;  4YFX F;  3F3X A;  2OAZ A;  1LDJ A;  5JFR A;  3IKT A;  1MDM A;  3DP7 A;  1ULY A;  4EGY A;  2K86 A;  2QWW A;  5ILS A;  4UVC A;  4Z2Y A;  1HQC A;  3HRS A;  3Q9S A;  4PGH A;  1KQ8 A;  4Q47 A;  2O3F A;  2Y0M A;  3KLO A;  1Z6R A;  2XIG A;  3F8F A;  5AIQ A;  1XGM A;  3I4P A;  1ZRF A;  1IN7 A;  4LGW A;  2M30 A;  4I2O A;  3CUQ A;  4FX0 A;  2RNJ A;  5F1R A;  4U7B A;  3RKW A;  2EFW A;  3KFW X;  2OBP A;  4ENJ A;  4GYI A;  4HLY A;  1H9G A;  1XGN A;  2RQP A;  1FSH A;  2GWR A;  4MNU A;  3I59 A;  3ZMD A;  1UHW A;  5ED4 A;  2IVM A;  4RB1 A;  4I09 A;  4RGX A;  2XAQ A;  1Y0U A;  5CYV A;  1BM9 A;  2VXZ A;  2XRN A;  1IN6 A;  1K79 A;  2YR2 A;  1O3R A;  4IRI A;  1U6G A;  2NS0 A;  1QZY A;  2P5L C;  1R00 A;  4EV0 A;  3L09 A;  3FWE A;  1BJA A;  3KLN A;  1G6N A;  1BN5 A;  4HDV A;  1Z1D A;  3WG9 A;  5FFX A;  2HKX A;  2L3D A;  2GIV A;  4IPA A;  2YX7 A;  2ZME B;  3BJA A;  2HGC A;  4KN7 X;  2K27 A;  4WXC A;  3CO7 C;  3PFI A;  2IA1 A;  2D1H A;  3M7G A;  2RN7 A;  1I27 A;  4G8X A;  2CGP A;  2A6E F;  1LB2 A;  3E6M A;  1B4A A;  2VBW A;  4OIQ F;  1WQ2 A;  2BBY A;  1EV7 A;  3ISP A;  4EJV A;  2P4W A;  1P6R A;  1E2X A;  4O5V A;  5HDN A;  2LDU A;  4A0Y A;  1BI1 A;  1XCV A;  1O3S A;  2WWY A;  2J5O A;  2DQL A;  3TOA A;  2XKP A;  4YIF A;  4MHG A;  3QOP A;  3IKV A;  3VFZ A;  1G4D A;  3DQV C;  2MA3 A;  1L3L A;  4UVB A;  2EV6 A;  4PZJ A;  4HQM A;  3I0T A;  1YYV A;  3TOB A;  3RYP A;  3V8J A;  2IT0 A;  5FD5 A;  3SXY A;  1WSU A;  5DYM A;  5D8K B;  1ZAO A;  5K5Q A;  3GUD A;  3HYI A;  5HLG A;  3S2W A;  1BOA A;  3RPQ A;  2UWM A;  3DXJ F;  2W85 A;  3CTA A;  1BIB A;  3F8M A;  2QLZ A;  2DK8 A;  1TQM A;  3JTH A;  1FYL A;  3ZMS A;  2QUF A;  3NRV A;  2VON A;  5KK1 A;  1USS A;  5D5X B;  1IRG A;  2E1C A;  5FLX K;  1F5T A;  2Y48 A;  2FBK A;  1U5T C;  2VT3 A;  2OQG A;  2W57 A;  4KYW A;  1H0M A;  2WV0 A;  1PP7 U;  2JRT A;  4WF2 A;  5LEJ A;  5DDG A;  5FLX Z;  2RC4 A;  2QM3 A;  3F6O A;  3WOD F;  3WU0 A;  1CGP A;  4LK0 F;  2Z99 A;  1BI3 A;  2FQ3 A;  4P5O A;  1J0R A;  1SFU A;  3WGH A;  3CDH A;  4ESJ A;  1P4W A;  3BRO A;  4OU0 A;  3E3V A;  3ZP5 A;  5D5U B;  3HIF A;  4KT5 C;  3K1P A;  3ROU A;  2UXN A;  1JHF A;  1U5T B;  2VBX A;  1IUY A;  1G3T A;  1YW7 A;  3TDZ C;  1BBY A;  2R7D A;  3I53 A;  4L5I A;  1FOK A;  1HW1 A;  4RAY A;  2DO7 A;  1LJ9 A;  2YX4 A;  1GHC A;  3U1D A;  1YG2 A;  5FGM A;  3W6K B;  3SZT A;  4GGG A;  4IJA A;  1AWC A;  2HTS A;  4EJO A;  2AXL A;  4G7Z F;  4XSZ F;  4JQF A;  3V7R A;  3V8L A;  2D45 A;  2NAZ A;  2OQR A;  2IA0 A;  1BI2 A;  1FX7 A;  4GO1 A;  3VOD A;  2F5F A;  1XGO A;  2EWN A;  2A69 F;  4A5M A;  1W5S A;  4KIB A;  4YFK F;  1LQ1 A;  5TJJ A;  5JR3 A;  5BQT A;  3GWZ A;  3LQR A;  2E1N A;  2FXA A;  3KP6 A;  4ENK A;  5LHG A;  2V6C A;  3CUQ C;  1S8N A;  4QLC U;  5ICG A;  5DCF A;  2V9V A;  3RI4 A;  3FMQ A;  4IRH A;  2ZME A;  3RPU A;  4EJU A;  2XGX A;  1KYZ A;  1HKS A;  3R61 A;  3I64 A;  4UNO A;  2O8X A;  3GW2 A;  2V1X A;  2KRF A;  2PQ8 A;  1RI7 A;  1UFM A;  4IF4 A;  3HSF A;  1AOY A;  3ZMU A;  2RKH A;  3OOP A;  3O6B B;  4UXN A;  1IW7 F;  2TDX A;  3HHH A;  2NYX A;  4Y15 A;  1IAW A;  2RGV A;  2OU2 A;  2FMY A;  2KJB A;  4HF1 A;  4GCV A;  1MZB A;  2IA2 A;  1K7A A;  5ILV A;  3U9G A;  3W6J B;  1O57 A;  2YSR A;  4P96 A;  3HSR A;  3JAM K;  3WTV C;  3ABT A;  2NNY A;  4B8X A;  4I7H A;  1H9T A;  3R0A A;  1HW5 A;  2ZNZ A;  2GXB A;  5CVU A;  3ZPL A;  1U2W A;  5D6F A;  4EJW A;  2P5V A;  4WK8 F;  1STZ A;  2FF4 A;  4KUM A;  4O6J A;  3LA2 A;  1PP8 F;  3GFM A;  2CYY A;  4S04 A;  1P92 A;  4A12 A;  2EV5 A;  4KIF A;  2EB7 A;  3REO A;  2W24 A;  4GXO A;  5L3F A;  1X3U A;  1Z6T A;  2R3S A;  1Z7U A;  4M6Y A;  2Z9O A;  3J80 K;  3HTS B;  1OKR A;  2HEO A;  1HKQ A;  1UST A;  3CUO A;  2A3S A;  5H6R A;  3FMS A;  5CVJ A;  3E6C C;  1IF1 A;  4UV9 A;  2MBF A;  1W7P D;  4NQW A;  4K2E A;  3T8T A;  3MQ0 A;  4L5J A;  4P9F A;  2A61 A;  4N9I A;  4EQQ A;  1T39 A;  3IC7 A;  5L3D A;  3F8B A;  2VOD A;  5HLI A;  3LAP A;  5DUK A;  4KIG A;  4BQA A;  3ML6 A;  2PMH A;  4UVA A;  1ZLJ A;  3WTU C;  2V1U A;  4BYY A;  5IT9 K;  3WE3 A;  1T2K A;  1DUX C;  5D5V B;  3TO6 A;  2MH9 A;  4HYE A;  5ICC A;  3FF5 A;  3NEU A;  1TTY A;  3GYH X;  1BIA A;  2Y75 A;  3GEZ A;  4N9H A;  2OA4 A;  2H6B A;  2PMU A;  4PCQ A;  5F64 A;  3JSP A;  5CVI A;  2Z33 A;  3E6B A;  3O3K A;  4LK1 F;  3ECO A;  2Q2E A;  1RUO A;  3JW4 A;  2FU4 A;  4G94 A;  1QPM A;  2QQB A;  4U88 A;  3GVA A;  2FRH A;  4ENM A;  3GLX A;  1W4M A;  3T5X A;  4OMZ A;  4G6Q A;  1RNL A;  1TQI A;  5IT3 A;  2D2W A;  3I59 B;  3GFL A;  3RTR A;  3BPV A;  3DV8 A;  1R7J A;  1OMI A;  4DNC A;  2EA2 A;  1UB9 A;  4HV6 A;  3LWF A;  1DDN A;  2LF7 A;  5L3C A;  5D5W B;  5ICF A;  2JPB A;  3H92 A;  5J8F A;  1O7L A;  3SHF A;  1QGP A;  3L2C A;  4A0X A;  2HTJ A;  2ISZ A;  2O0Y A;  4XRF A;  3HRM A;  2GQQ A;  2XRO A;  2DAO A;  3HOT A;  4L0Y B;  2ZCW A;  1Q1H A;  1JGS A;  2Q0O A;  6PAX A;  3R60 A;  1FBQ A;  2DBB A;  4Y17 A;  4HX7 A;  2VC1 A;  3TGN A;  1D5V A;  4A0Z A;  1OYY A;  4RB3 C;  1XSX A;  5H6Q A;  3KP5 A;  5DV5 A;  5JHU A;  4XSX F;  2ZKZ A;  3KP7 A;  4WXD A;  1DPR A;  2RVC A;  2ZO4 A;  3H3U A;  2CO5 A;  1ON1 A;  4WWC A;  3K1M A;  2KIU A;  3KE2 A;  5CVR A;  4H0E A;  3ZN0 A;  3C3W A;  4HF2 A;  3D0S A;  2M8E A;  2H27 A;  2HR3 A;  4EM1 A;  4ZH4 F;  4IHT A;  3MCZ A;  3ZMT A;  2H6C A;  5AIP A;  4WX9 A;  5ILU A;  1G3Y A;  4UV8 A;  1YS6 A;  1QBJ A;  5HVQ C;  4QWQ A;  3MFK A;  4L9T A;  3K2Z A;  1GXP A;  2YU3 A;  3O2P E;  2E7W A;  1RIO H;  2BEO A;  2FBI A;  1JE8 A;  3EYI A;  1HSJ A;  4HV5 A;  3Q9V A;  2E7X A;  3R6S A;  1RZ4 A;  4HAM A;  3IRR A;  3VOE A;  2QYO A;  5LGT A;  4L9J A;  5E1X A;  4F7Z A;  2JT1 A;  4CDG A;  3P7N A;  4OOI A;  4HX8 A;  4AWX B;  1CF7 A;  3G73 A;  5DCM A;  4ASN A;  4G7H F;  2PN6 A;  1F4K A;  1V3F A;  2K4J A;  4KFC A;  1FBU A;  2K02 A;  1XGS A;  4BHP A;  1ONV A;  1LDK B;  1R36 A;  4M72 A;  4BHC A;  4RB0 A;  2IJL A;  3Q5F A;  3IWF A;  3M9A A;  3DF8 A;  2RDP A;  1TW2 A;  2GA2 A;  2VE9 A;  2ESN A;  4OIN F;  4AIH A;  2K7L A;  4ZZL A;  4L9N A;  2BYV E;  3WTY C;  2V79 A;  2QBY A;  3FHZ A;  2DTR A;  4HF0 A;  4OIO F;  1VTN C;  5K1Y A;  5K5R A;  5L3B A;  2YPR A;  4MEY F;  1XDU A;  1BI0 A;  4L18 B;  3J80 Z;  4AIJ A;  3J81 Z;  5F6F A;  3RYR A;  4KMU X;  1TNS A;  1SFX A;  2VOO A;  4HW0 A;  3TQN A;  2M1B A;  4U0V A;  2HKO A;  2DPU A;  1WWX A;  4U0W A;  2DQR A;  2A5Y B;  5L3E A;  4LG0 A;  4MQ9 F;  2KIF A;  5DUI A;  4RAZ A;  1FZP B;  1J2X A;  4MTD A;  2HYG D;  1KU2 A;  1A04 A;  2DPD A;  4P55 A;  3U2R A;  2XUB A;  4R8H A;  2HDC A;  2L01 A;  3P9I A;  2PFB A;  5DCM B;  3GZ6 A;  3J7A O;  2FNA A;  3J81 K;  2VOP A;  5AON A;  2MC3 A;  3RDI A;  3LA3 A;  4L9V A;  5CLS A;  5D4S A;  5E8I A;  1T98 A;  2F2E A;  3BZ6 A;  2WC2 A;  5HDG A;  1FPQ A;  2UZK A;  2VN2 A;  3BDD A;  1KGS A;  1R5H A;  1SD6 A;  2ZFW A;  4R1H A;  1NHA A;  4MQV A;  1W5T A;  2WTE A;  1FBS A;  4WCG A;  3FX3 A;  2ZJ2 A;  4BH9 A;  1U3E M;  1J5Y A;  2QEN A;  4IXA A;  2ADU A;  1WKM A;  2JTV A;  1ZG3 A;  2XAF A;  4JBA A;  5KVR A;  3C18 A;  2PI0 A;  1D8J A;  3CLO A;  3EQL F;  4OIR F;  2L4A A;  5LHI A;  3E5Q A;  4ZYH A;  3WTS C;  1KU3 A;  1KQ9 A;  3WTZ A;  3WE2 A;  2PG4 A;  2EJR A;  4LLG F;  1MD0 A;  2M45 A;  4XBF A;  1F1Z A;  3R0J A;  2DT5 A;  1IXS B;  3L7W A;  3P9K A;  5A2Q Z;  3KET A;  3FXU A;  3K9T A;  2XKO A;  5L3G A;  1YFH A;  1U78 A;  4KDP A;  1QQI A;  1J7K A;  2MH2 A;  4Y13 A;  1ZG1 A;  4LB6 B;  2EK5 A;  5J8C A;  4NHJ A;  1HXD A;  1B9M A;  4HLX A;  1D3Y A;  3ULQ B;  2V1D A;  2Z3Y A;  4CXF A;  1SD4 A;  5LEK A;  2FE3 A;  3CO6 C;  4LB5 A;  1ZYR F;  3F72 A;  1T0F A;  3FM5 A;  1B6A A;  1LEA A;  2P5K A;  3V4G A;  4IHS A;  3CUQ B;  3EYY A;  5H20 A;  1DPU A;  1J59 A;  1W7P B;  3EDP A;  4AD9 A;  3ECH A;  5HDK A;  4O3M A;  4AIK A;  3E97 A;  1ZGA A;  1I6X A;  2COM A;  3KP4 A;  1S7A A;  4DQ2 A;  4CYD A;  4FHT A;  1LVA A;  3CJN A;  3GF2 A;  1P4X A;  3ZN1 A;  4RB2 C;  1OR7 A;  1SAX A;  4ESB A;  1R22 A;  1FY7 A;  4IRG A;  1YW8 A;  3LST A;  2DFI A;  2VT2 A;  2XAG A;  3IRQ A;  1HST A;  2W25 A;  3WGI A;  3QP5 A;  2GAU A;  3I5U A;  3TKY A;  2F5E A;  4U7D A;  3HUG A;  1TQP A;  3KP3 A;  5CVV A;  2EA4 A;  3DPL C;  1MJA A;  2BV6 A;  3HRU A;  1L0O C;  1O3T A;  4M74 A;  2PLY A;  3I58 A;  5LGN A;  3QPT A;  2L02 A;  1LNW A;  2XAJ A;  2P8T A;  5D4R A;  4M9S A;  2QVO A;  1FYM A;  1D8K A;  3MZY A;  5LBQ A;  2O61 A;  3KZZ A;  3R4K A;  4TV7 A;  2GA1 A;  1BC7 C;  3K69 A;  3L00 A;  1I1S A;  2QQ9 A;  4MGR A;  2QBY B;  3TO9 A;  5A2Q K;  2CQK A;  3N4M A;  4LD5 A;  2P6S A;  1W7P A;  1GVJ A;  2K4B A;  5HS8 A;  1FNN A;  5LLQ A;  3PQJ A;  1YW9 A;  1G3S A;  4LJZ F;  4G6D A;  3WGG A;  3T0Y A;  1YS7 A;  2LF8 A;  4HQE A;  1K6O A;  1ZRE A;  1KA8 A;  4FT8 A;  1XD7 A;  4LLN A;  4IVN A;  4MEX F;  2CG4 A;  2HFH A;  1S7O A;  1QZZ A;  4D0P A;  1MJB A;  3B73 A;  3DPT A;  1ZAR A;  1R1T A;  4L0Z B;  2STT A;  1XN7 A;  4GYG A;  3BOQ A;  4S05 A;  5BPI A;  3BJ6 A;  1EH8 A;  3BY6 A;  4A6E A;  5HOO A;  1MKM A;  4M6X A;  2P7V B;  2EFP A;  4XLN F;  5DEQ A;  3QP6 A;  3GXO A;  3M1E A;  4M73 A;  4KN4 X;  3HHG A;  1ON2 A;  3WTW C;  1J75 A;  1UHM A;  2X0L A;  3C1D A;  2A6H F;  1F9N A;  3ZMZ A;  4HBL A;  2A68 F;  2NNN A;  1XSD A;  5BPD A;  1LEB A;  4KIC A;  1K78 B;  3T8R A;  1MGT A;  1R58 A;  3MZH A;  2L4M A;  5HLH A;  1HKT A;  4I01 A;  3DEU A;  1FSE A;  2DW4 A;  1KU9 A;  3QU6 A;  5FO5 A;  3JAM Z;  1V4R A;  1XB4 A;  2G9W A;  3RKX A;  3QU3 A;  3SZP A;  2JZY A;  4HX4 A;  3FXR A;  1I5Z A;  5E17 F;  1OYW A;  3GX4 X;  1SFE A;  2DU9 A;  4LLL A;  3KZY A;  3HTU A;  2HOE A;  2BGC A;  3SFZ A;  5BMZ A;  5EEH A;  2P6T A;  1J9I A;  1YIO A;  1TBX A;  2FEZ A;  4ENN A;  5E20 A;  1YO5 C;  1ZGJ A;  5FB2 A;  2HZT A;  3F23 A;  4EM2 A;  1U5T A;  5LGU A;  1IN8 A;  1IN4 A;  2MLG A;  5ERI A;  5E18 F;  4HZF A;  3MAJ A;  2GZW A;  1RUN A;  1LDD A;  4M71 A;  3M8E A;  1P4A A;  5LRS A;  3B02 A;  2Q8K A;  2EFQ A;  3V7C A;  2ACJ A;  2W84 A;  3IHU A;  1YQA A;  5CJ9 A;  3WTX C;  1MJ9 A;  1WRJ A;  4ZYG A;  1S29 A;  3I71 A;  2HQN A;  4CO8 A;  2PBI A;  1XMK A;  2VBY A;  5K5O A;  3F8N A;  3JSO A;  3FZV A;  1BC8 C;  2PJP A;  4ETS A;  3F22 A;  4NB5 A;  2IPQ X;  5ICE A;  1K78 A;  1IRF A;  1EH7 A;  2KJC A;  2H94 A;  1UCR A;  1U8R A;  4YII A;  1REP C;  4ZYE A;  2DI3 A;  3K0L A;  2ESH A;  1O7F A;  1SD5 A;  4EMS A;  3KCC A;  2HQR A;  4P9U A;  4LMY A;  3QAH A;  2D1V A;  1ZRD A;  1QNT A;  2EV0 A;  2M87 A;  2FA5 A;  2H09 A;  2RV8 A;  4A5N A;  4A6D A;  2HWV A;  2O03 A;  2C6Y A;  3IL2 A;  1T6S A;  2FML A;  4G7O F;  3PQK A;  4BXU A;  3TO7 A;  1WI9 A;  4RS8 A;  3E6D A;  3LFK A;  2M5W A;  4CHU A;  1S3J A;  3P9C A;  4M9X A;  4KA4 A;  4I98 B;  1JXS A;  4MTE A;  4RGS A;  4UUV A;  3VB2 A;  2GXG A;  3QPH A;  3RKY A;  2VBZ A;  2UXX A;  1HBX G;  4ESF A;  2O6G E;  1ZH5 A;  3EET A;  2XAS A;  4HA8 A;  1PDN C;  4UHT A;  1R1U A;  3EUH A;  3ZQ7 A;  1ZN2 A;  1C0W A;  4B09 A;  3IWZ A;  2PEX A;  3E5U A;  3FM3 A;  2MLK A;  3BWG A;  3LQQ A;  1HW2 A;  3F6V A;  5J6X A;  1I1G A;  2CSO A;  3V8K A;  3LAJ A;  5D8L B;  4EGZ A;  5DD8 A;  3D5L A;  5BS6 A;  3VEP A;  4Q4Z F;  1EH6 A;  1FT9 A;  2AS5 F;  2ISY A;  1KU7 A;  3WTT C;  4I0B A;  2BE5 F;  3F8C A;  1KQ0 A;  3G3Z A;  4G9Y A;  2CFX A;  2R7F A;  2HS5 A;  3KP2 A;  1TW3 A;  1XDS A;  4OIP F;  3N97 A;  5FD6 A;  1MDM B;  5HS7 A;  3ERE D;  2F5D A;  1OYI A;  1IXR C;  5JI6 A;  3RIR A;  1YTY A;  3BJO A;  3I54 A;  3DKW A;  5D6E A;  4HDU A;  5FFZ A;  2JSC A;  1FP2 A;  1KYW A;  1FLI A;  5E1Z B;  3HSE A;  3H3Z A;  2FBH A;  3ABU A;  5LHH A;  5E8G A;  3COA C;  2J5P A;  4BHB A;  3BPX A;  4I0A A;  2P7C B;  1SMT A;  1B1B A;  4XLP F;  1SD7 A;  4EVI A;  1FC3 A;  4N0B A;  4U0Y A;  1TLH B;  2KKO A;  3M8F A;  2X4H A;  3WU1 B;  3ELK A;  3OV8 A;  2A07 F;  2DLL A;  3FXQ A;  1Z91 A;  4RGU A;  2IRF G;  2NRA C;  1Z05 A;  1R5G A;  2XVC A;  1S6L A;  4PDK A;  1ZHF A;  2EFO A;  2IP2 A;  2LSO A;  3TDU C;  1XSV A;  3LA7 A;  3V7S A;  2DK5 A;  5HS9 A;  1YLF A;  3BP8 A;  1DP7 P;  5EEG A;  2LKP A;  1ODD A;  3K1N A;  2CWE A;  2OZ6 A;  2QZ8 A;  1QO0 D;  2OZU A;  4A2U A;  3DFG A;  1FP1 D;  1FWZ A;  1XMA A;  1B59 A;  1ZG5 A;  2Z5U A;  2FOK A;  5TRD A;  1JHH A;  4CZZ A;  4ZZD A;  1GXQ A;  3C7J A;  2FNP A;  2QQA A;  2B0L A;  1P2F A;  3GZ5 A;  2HYF A;  1IN5 A;  1R1V A;  4M9Z A;  1G3W A;  2ZNY A;  4BNC A;  4RGR A;  1R23 A;  3GFJ A;  2G7H A;  1E17 A;  3L9F A;  4WXH A;  3HOS A;  3MEX A;  3MWM A;  2XHK A;  4I02 A;  3F21 A;  2ELH A;  4HOB A;  2ZBK A;  2EFN A;  3GO5 A;  2JPC A;  3RJP A;  3GFI A;  2ZXJ A;  4EM0 B;  1T38 A;  2F5C A;  2STW A;  4Q48 A;  4LG0 B;  1IZ1 A;  2XV4 S;  3KEQ A;  2OD5 A;  4LFU A;  3HRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...