5ERIA

Marr protein from peptoclostridium difficile da00132
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
153
Chain Sequence
RGSHMLIKTLDSNILREVGTLSRAVNSINDIKYKELKLQKGQFTFLTRICENPGINLVELSNMLKVDKATTTKAIQKLIKAGYVDKKQDKFDKRGYNLTPTDKSLEVYELIIEEENRSIEICFDNFTDEEKQVVTKLLEKMSKNVENEWFKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the multiple antibiotic resistance regulator MarR from Clostridium difficile
doi rcsb
source organism Peptoclostridium difficile
molecule tags Transcription
molecule keywords MarR family transcriptional regulator
total genus 55
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2015-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5eriA00
3RJPA 4WXDA 3BJ6A 1Z91A 1XCVA 3WTUC 4LLGF 3KEQA 2P6TA 5TJJA 5CVVA 5BOXA 3IWZA 2IW5A 4A2UA 1J75A 2Z5UA 3WE2A 4A6EA 4RGXA 2EA4A 3ZMSA 3KP3A 4IRGA 5FO5A 3I59B 4HOBA 5IT9K 1ZGJA 3KCCA 2D1HA 1V3FA 4YIFA 4EJUA 4AWXB 4Z2YA 3QPHA 5K5RA 1KGSA 1HW5A 1IUYA 3J81K 3H92A 4I01A 1FBSA 4UXNA 4NQWA 3O3KA 2EV6A 5JHUA 1I1GA 1MDMA 2ZNYA 2JPBA 1CF7A 5ICFA 4CICA 4I0BA 4ZYHA 4OIRF 4LG0A 2H27A 2E1CA 2WV0A 1RNLA 2CWEA 2MH2A 5FLXZ 2FSWA 1D8JA 4YIIA 2ZBKA 4EV0A 1KQ0A 1O3RA 4Q48A 1ZN2A 5HS9A 2DPDA 3BY6A 1I5ZA 5HS7A 1U2WA 1BI0A 4FX4A 5L3CA 5E1ZB 2WTEA 1S8NA 1FSHA 1QPMA 2UWMA 1ZRDA 2YX4A 5K5OA 4GYGA 1SD5A 1XGMA 3BWGA 1RUNA 3I59A 2F5DA 5BS6A 4A0YA 5AIPA 3TO9A 4ON0A 4YG2F 3U1DA 5FLXK 3P9KA 4K2EA 3GXOA 3C3WA 3HTUA 1ZARA 5ERIA 1BI1A 1FBUA 1XN7A 2FU4A 4EM0B 3O6BB 4HV6A 1WWXA 4AD9A 1KYZA 1OYWA 4HV5A 4WWCA 1CF7B 2QM3A 1LJ9A 4FHTA 5J8CA 2VN2A 2DK8A 1R5GA 1W7PA 1WQ2A 4DNCA 1H0MA 5DD4A 4I98B 3F22A 1QGPA 3FM3A 5FFXA 4LK0F 2O61A 1BIAA 1HKTA 5CVUA 1Z9CA 2VBWA 4BXUA 2ISZA 3DV8A 3F6VA 5JFRA 3OOPA 2QQ9A 1XSXA 3C1DA 3FM5A 1EH6A 1P4AA 1RI7A 5BMZA 1V4RA 3KP6A 5EEGA 5E17F 4N0BA 2M87A 2IT0A 2HFHA 2RGVA 1LEBA 2DQRA 4YFKF 3M8EA 2XROA 1U8RA 4Q47A 2VODA 1QNTA 1OMIA 5E8IA 2HDCA 4MEXF 4RB1A 3WGGA 1KYWA 1JE8A 2W25A 2VE9A 2VT3A 3QP5A 4I02A 1GXQA 1OYYA 1SD4A 5LLQA 1W7PD 4EQQA 3VEPA 5BQTA 4KT5C 3RYRA 5D5VB 1RZ4A 2O6GE 5E8GA 1W5SA 2HYFA 4Y13A 1K78A 1PP8F 2F2EA 1TNSA 4OMYA 1R00A 2QVOA 2PG4A 4M9XA 2DU9A 2O3FA 3T5XA 4M74A 3WGIA 3R60A 1LEAA 2QENA 3LFKA 2D1VA 1O57A 4MEYF 3M1EA 1I27A 4G6QA 5HVQC 5FFZA 1J2XA 2HTSA 3KP5A 1R7JA 1IN7A 4R8HA 2OBPA 4U7BA 2EFQA 4P5OA 1MZBA 5HDNA 3IRQA 1ZG1A 1TNTA 2NYXA 5FD6A 2XVCA 2A6HF 3ZN1A 1S29A 4BYYA 1GHCA 2MA3A 5LHHA 4CHUA 2F5FA 2CFXA 1NHAA 2XRNA 3NQOA 3FXQA 5EEHA 1TQMA 4LD5A 2VC0A 1ON1A 3BJAA 5E20A 3ZPLA 5D5WB 3R6SA 1TQPA 3T8RA 1TQIA 2R7DA 1T98A 2GA2A 5D5XB 1BOAA 3K0LA 1HW2A 3FXRA 2FQ3A 2BEOA 1HKQA 4L0ZB 3V7CA 3QU3A 2RVCA 3TO6A 3NRVA 2EWNA 4KUMA 1H9GA 3U2RA 5H20A 3E6CC 1G3WA 1R22A 2K4BA 3VB2A 2A61A 1SD7A 3SZTA 4A5MA 5CVIA 3JTHA 2LSOA 2DLLA 3CUOA 3RKWA 2PQ8A 2C6YA 1FC3A 1B59A 5LGNA 5CJ9A 1KQ8A 3L2CA 3ZMVA 1HSTA 4R1HA 2EFOA 3F8CA 1P6RA 4LJZF 4QLCU 4OIQF 1YO5C 3DPLC 3MWMA 2XUBA 3MQ0A 2L02A 3EETA 2FMLA 2A69F 4R79A 2JT1A 2NRAC 4ZYEA 4P96A 1KU7A 4UNOA 3CLOA 3KZYA 3SFZA 2L4AA 2J5PA 2PBIA 1ZAOA 1P4XA 2PMHA 4LB6B 3GZ6A 1D8KA 3RPUA 5HLHA 2EK5A 2V79A 1XMAA 4KIFA 1ULYA 2MLKA 4JQFA 1BJAA 1UFMA 2VBZA 1YYVA 2ZJ2A 2IP2A 1TBXA 1TLHB 1G4DA 3TDUC 2NAZA 1TTYA 3LA7A 2VOOA 2DAOA 2IJLA 1IW7F 5CLSA 3D0SA 2DK5A 1LQ1A 3JSPA 4HQEA 3Q9SA 1JGSA 2RN7A 4M6XA 2OZ6A 1SFXA 1FYLA 4P9UA 4KMFA 1XSDA 2FA5A 1KA8A 4XSXF 3W6KB 3V4GA 3MEXA 3MZYA 2KIFA 2XKPA 2K4JA 4KMUX 3CDHA 3F6OA 5IT3A 1ZREA 5AONA 5DCFA 3I4PA 3CUQA 3I64A 2X4HA 3RIRA 3F8FA 4LMYA 3U9GA 2R3SA 1U78A 3G3ZA 4IRHA 4M71A 4UV9A 2W24A 2A68F 2WC2A 4BHBA 4RS8A 3E6MA 2HOEA 3K1MA 1GVJA 4BQAA 3GFLA 2IA1A 2YX7A 1T39A 1MKMA 1E2XA 1UHWA 2VC1A 3O2PE 2DTRA 4JK1X 3HOSA 4G94A 4EGYA 3F72A 3QU6A 2XAHA 2ADUA 3WE3A 3M9AA 3J7AO 2MD5A 1ZRCA 1IN6A 4ENJA 1REPC 4O3MA 1YFHA 3J80Z 1B6AA 1P92A 4YFXF 1LB2A 2CW0F 3GLXA 4RAZA 1EH8A 1YS6A 2UZKA 2HKOA 2XAFA 3ERED 3REOA 4L18B 4IXAA 4Y17A 2RKHA 3LQQA 3WTZA 1W4MA 1H9TA 4QWQA 4I09A 1XGSA 2KJCA 4ESFA 1YQAA 1YS7A 1YW8A 3HYIA 2KRFA 5ILUA 3JAMZ 3H3UA 1IZ1A 3N97A 5ICCA 3I58A 2K02A 2VBYA 2BGCA 1A04A 4AVPA 5LRSA 4BNCA 3C7JA 4L5JA 3F21A 2YU3A 1FPQA 1Z05A 3V7RA 3KEOA 4LB5A 2HGCA 2M5WA 2QBYA 2O8XA 2ZO4A 2Q2EA 2HWVA 5D4SA 1DUXC 1UCRA 2EV0A 1WKMA 2ZFWA 1HKSA 1FOKA 1IN5A 5L3FA 3EYYA 3FMSA 3PFIA 3ZMDA 1T6SA 3R4KA 2GXBA 3PQKA 4IF4A 1B9NA 3DPTA 1W5TA 3HHHA 1U3EM 3LA3A 1K79A 2P5KA 2XAQA 3E97A 5IT9Z 2V6CA 3FZVA 4M9SA 2M30A 1HQCA 2A07F 1R1TA 3T1BA 1FX7A 2EJRA 2ZNZA 5E1XA 3ISPA 4RB0A 1IXRC 4GO1A 3MZHA 4I2OA 2LDUA 1YTYA 5F1RA 3LA2A 2H6CA 2AXLA 4LLNA 3KFWX 1U5TC 5AIQA 1R23A 4L9VA 4KICA 3BROA 1KQ9A 3D5LA 3RDIA 3CTAA 3QAHA 3W6JB 5D5UB 2P8TA 4HX8A 2PMUA 2X0LA 3KLNA 3GX4X 2XKOA 4IPAA 2XV4S 4DQ2A 4P9FA 2PI0A 3ZMTA 1ODDA 3ZN0A 1R58A 1LDKB 2CO5A 4KIBA 3I71A 3HSRA 4A12A 2GAUA 2WWYA 2Q0OA 2D45A 2FBKA 2L3DA 1BI3A 4M6YA 1RUOA 1U5TB 1QZYA 3COAC 4BHCA 3GFMA 4CO8A 3T0YA 3IRRA 1XB4A 3GZ5A 1USSA 3LAJA 3HRTA 1EV7A 5DCMB 4N9HA 4OU0A 4CYDA 4BH9A 1VTNC 4HBLA 2P6SA 3WG9A 2IA2A 2HZTA 4G6DA 2DT5A 5HS8A 5LHGA 4UUVA 1MDMB 3S2WA 3JW4A 3ECOA 2FXAA 2QWWA 1STZA 2MBFA 3QRFF 1Q1HA 4MGRA 5LHIA 2K86A 1S3JA 3QOPA 1LVAA 5TRDA 1F1ZA 2QYOA 1W7PB 1B9MA 5ILVA 4G7OF 2PFBA 2KJBA 4XBFA 3HRUA 1R5HA 4IVNA 2JZYA 3G73A 1BBYA 4WX9A 4G8XA 5LEJA 3K1PA 1HSJA 2JPCA 3BZ6A 4F7ZA 5CVRA 1B1BA 4PCQA 4KA4A 3EQLF 1XGOA 2EFPA 2STWA 3WTYC 4OIOF 1LDJA 1MJ9A 2LF7A 2ZCWA 2FOKA 2OQRA 1SAXA 5F64A 1C0WA 3E3VA 3GW2A 4IHTA 2RC4A 1O3TA 1O7FA 4WXHA 2OU2A 3BP8A 4LFUA 2YR2A 1T2KA 3EUHA 3NEUA 1YLFA 2IPQX 2EFWA 5A2QZ 1YW7A 3ELKA 3K2ZA 2RV8A 4ENKA 3ZMUA 4XLPF 1ZG5A 2CG4A 5K1YA 5L3EA 5K5QA 4Q4ZF 3V8JA 2MC3A 2FF4A 2VXZA 3FHZA 2PN6A 3FX3A 4KNYA 2ZMEB 3WTVC 3KP4A 2Z99A 1FNNA 5ICGA 4OMZA 3CJNA 3P9CA 2G7HA 1G6NA 4CZZA 3IHUA 3DP7A 3DF8A 3KLOA 3CO7C 4OINF 3T8TA 3FXUA 4UVBA 4RB3C 3V8LA 4YFNF 3QPTA 2FBIA 1S7OA 1AOYA 4NB5A 1QBJA 4ENNA 4G7ZF 1XCBA 3WGHA 1WSUA 3DEUA 4EM2A 1ZLKA 3SXYA 2DQLA 2GQQA 5ILSA 1OPCA 4S05A 3RYPA 2FNPA 1OR7A 1MD0A 2OAZA 4EJVA 2XIGA 1YG2A 1LNWA 4AIJA 4IHSA 4UVAA 5CYVA 2JTVA 5D6EA 1OKRA 3OV8A 3IWFA 4HF1A 2Z3YA 1IF1A 1D5VA 1T38A 2ZXJA 1SFUA 4XRFA 4O6JA 4IRIA 5D6FA 2V1UA 1WI9A 3HOTA 4Q5SF 4XSZF 2FEZA 3Q9VA 4HDUA 3WTXC 4OIPF 4I7HA 1CGPA 2GWRA 3IC7A 2BYVE 4N9IA 4A0ZA 3B73A 2STTA 5DYMA 2OA4A 4M72A 4HA8A 1BIBA 3JSOA 5HDGA 3Q5FA 2IVMA 3R61A 2CSOA 2P4WA 2P7CB 2ESNA 1XMKA 3HRSA 3IKVA 3I5UA 4EGZA 1YIOA 3LAPA 2L4MA 4G9YA 2XGXA 1BN5A 1ON2A 1QO0D 3VOEA 2YPRA 1B4AA 3JAMK 4UVCA 4NHJA 2Y48A 4HZFA 2R7FA 1SD6A 1O7LA 1IN4A 2A3SA 4ZYDA 5HOOA 1R36A 4IJAA 1RIOH 3ZMZA 1J9IA 4GXOA 3WU1B 4KDPA 1UHMA 4CGZA 4LK1F 4MQVA 2JRTA 2G7UA 4E70A 2IA0A 3M8FA 4GCVA 3F8MA 3KP2A 1KU2A 4EVIA 5DUIA 1D3YA 1LDDA 4PGGA 1ZH5A 3EDPA 1ZGAA 6PAXA 2DBBA 2Z9OA 2HKXA 5E18F 2ELHA 1BC7C 4M9ZA 4H0EA 4A0XA 4AIKA 3PQJA 4U0VA 5BPDA 1X3UA 2BV6A 4HAMA 2Y75A 2AS5F 4PZJA 1O3SA 2P7VB 5DCMA 3LSTA 1IN8A 3TOAA 4RAYA 3E5UA 3H3ZA 3N4MA 3K69A 5LGTA 2MH9A 1YW9A 4EMSA 3TDZC 1U6GA 5A2QK 1QQIA 1DDNA 1USTA 2FNAA 1J59A 2L01A 1UB9A 1EH7A 1BI2A 2CQKA 3M7GA 3E5QA 1FYKA 4U0YA 1FBQA 1O3QA 2K7LA 1FP2A 1IRGA 4KYWA 4B09A 3KP7A 5JVTA 1FYMA 2F5CA 2QLZA 3C18A 2E7WA 4GGGA 4ESBA 4ESJA 1MGTA 2LNBA 1IAWA 4U0WA 3SZPA 4MTDA 3B02A 5JI6A 2HYGD 3RKXA 2VOPA 2VBXA 2V1DA 5DEQA 4BHPA 2M8EA 1DPUA 1J0RA 2QQAA 4S04A 1ONVA 2XHKA 2CGPA 1ZLJA 2DFIA 3F8BA 3MAJA 2QZ8A 4MTEA 3GO5A 3SQNA 5KK1A 1DP7P 1XDUA 4G7HF 1TW2A 3BPXA 2NS0A 1P4WA 5JR3A 2DW4A 3R0AA 2RQPA 2VT2A 1JHFA 1P2FA 3E6BA 3HRMA 3HIFA 2FRHA 3MCZA 2LF8A 3F3XA 1L0OC 4HW0A 3K1NA 2W85A 4ZZLA 2V9VA 1SMYF 3LWFA 1KU9A 3HUGA 4A5NA 2FBHA 2QBYB 3E6DA 3FF5A 3ECHA 2EV5A 2IRFG 1F4KA 1DPRA 3L09A 3FMQA 5J8FA 3TGNA 1PUEE 3FWEA 4EJOA 3WTTC 4L5IA 2VE8A 2GZWA 4KIGA 3VFZA 2MLGA 2XAGA 2DO7A 2E7XA 4HQMA 4JBAA 1IXSB 3WTSC 1HW1A 1Z6RA 2O0YA 4EM1A 3CUQC 3I53A 4HF2A 1T0FA 2KIMA 1TW3A 2L54A 1HXDA 4D0PA 4MQ9F 1JHHA 4EJWA 2HR3A 2HQNA 2BBYA 5L3BA 3BDDA 2QQBA 3HSEA 3GYHX 4LG0B 2B0LA 4RGUA 2HTJA 2QUFA 5D4RA 1ZG3A 3I0TA 3F23A 3ULQB 3GFJA 1ZRFA 2JSCA 3ZP5A 2H09A 5LBQA 2NNYA 2UXXA 4CDGA 1Y0UA 3BOQA 1XSVA 4FT8A 4HF0A 3F8NA 2CYYA 1MJAA 2Y0MA 4ENMA 2V1XA 1XDSA 4ZZDA 1FSEA 1Z7UA 4ZH4F 4TV7A 3SHFA 2PLYA 3ML6A 1GXPA 5DUKA 2M45A 1FWZA 5LRRA 2VONA 1F5TA 3KE2A 4HX7A 2DPUA 3CO6C 2ETHA 4GYIA 1FLIA 4LGWA 2XAJA 2FMYA 3R0JA 2HQRA 2D2WA 3GFIA 1S6LA 1J5YA 2RDPA 1L3LA 2P5LC 3ABTA 3E5XA 2ISYA 2K27A 1XD7A 1G3TA 5D8KB 1U5TA 4WCGA 3MFKA 2BE5F 5DD8A 3K9TA 2NNNA 3RPQA 4KFCA 2GA1A 3VODA 3IL2A 2FE3A 5H6RA 3GWZA 3KETA 3GUDA 1FZPB 4WXCA 3HHGA 4KN4X 5FD5A 2P5VA 2TDXA 3GF2A 5FGMA 4U88A 3AAFA 1I1SA 1QZZA 3ABUA 3WTWC 2W57A 1G3SA 4UHTA 5J6XA 4L0YB 4UV8A 3LQRA 4BAYA 4MNUA 1ZYRF 4ETSA 3RTRA 1I6XA 5DV5A 1PP7U 1G3YA 5LEKA 3I54A 5L3GA 1FT9A 5BPIA 4KN7X 2COMA 4PGHA 5HLIA 4RGRA 1XGNA 2OZUA 3L00A 4O5VA 1SMTA 1K6OA 4RGSA 4WF2A 3TQNA 2EB7A 3TO7A 4AIHA 2W84A 2DI3A 3V8KA 3WU0A 2M1BA 3DQVC 5E1WA 2ESHA 1S7AA 4I0AA 4LLLA 5CVJA 4HLYA 3P7NA 4HLXA 1BC8C 2XASA 3TKYA 2G9WA 4XLNF 4FX0A 3DKWA 3JTGA 1SFEA 2ZKZA 4A6DA 3FMRA 3J80K 3QP6A 3RI4A 4MHGA 3IKTA 2KIUA 4Y15A 1IXCA 3BJOA 3DFGA 1IRFA 3CUQB 4U7DA 2HEOA 1K78B 5ED4A 3GVAA 1OYIA 3ROUA 4HYEA 5HDKA 4CXFA 3WODF 1F9NA 3BPVA 4L9TA 1Z6TA 2PJPA 1R1UA 2ACJA 3J81Z 1FY7A 1KU3A 4ASNA 4RB2C 1ZHFA 2ZMEA 4HDVA 3EYIA 1MJBA 1BM9A 5DDGA 2OD5A 4P55A 2HS5A 3HSFA 5H6QA 1FP1D 1PDNC 5F6FA 1R1VA 3TOBA 3ZQ7A 1AWCA 5HLGA 1HBXG 4ZYGA 2RNJA 3GEZA 4OOIA 3RKYA 5L3DA 2KKOA 5LGUA 3L7WA 4PDKA 2UXNA 4L9JA 1JXSA 1J7KA 3L9FA 4M73A 2J5OA 2E1NA 3KZZA 2O03A 3DXJF 2GXGA 2YSRA 2EFNA 2GIVA 4WK8F 4HX4A 4L9NA 2Q8KA 3V7SA 5D8LB 2A5YB 4EJTA 2PEXA 2EA2A 4B8XA 2A6EF 3P9IA 1Z1DA 2H94A 1K7AA 1WRJA 5KVRA 2Z33A 2F5EA 5ICEA 2LKPA 2H6BA 2OQGA 5FB2A 1E17A 3HTSB
chains in the Genus database with same CATH superfamily
1HF0A 3RJPA 4WXDA 3BJ6A 1X19A 4DW6A 1Z91A 1YI2I 1N78A 1XCVA 1FTTA 2R7XA 3E0JB 4ZDLA 3WTUC 4JX5A 4BJTA 2L9VA 3KIOA 4LLGF 2XC7A 2EIMH 3IP4B 2VJ4A 2P6TA 3KEQA 5TJJA 1WJCA 3OS1A 2LVSA 1X1PA 5CVVA 3U1KA 4J00A 2L7MP 3AG4H 5BOXA 4IHWA 4GRIA 1PJRA 1W5CC 3IWZA 2IW5A 3OYEA 4A2UA 1J75A 2Z5UA 3E7LA 1GT0C 3WE2A 4A6EA 4RGXA 3TEDA 3DU6A 1UAAA 5GAHJ 2BW3A 1VNDA 2EA4A 4RLFA 3ZMSA 3ABKH 4XQFA 3KP3A 4IRGA 1MNDA 1FOWA 3FKJA 2WAEA 3I59B 2L0KA 5FO5A 3FXKA 1FEXA 2GOMA 4HOBA 4N4NB 5IT9K 4UB6C 2H1KA 2A6TA 5FLVA 1ZGJA 3KCCA 2D1HA 1V3FA 4YIFA 2F48A 4EJUA 4AWXB 4Z2YA 3QPHA 5K5RA 1KGSA 2M2EA 3PIOF 1HW5A 1IUYA 2Y69H 2XGEA 3J81K 3H92A 4I01A 2VLAA 3J7AY 1LFUP 1A6IA 2NS8A 3FXMA 1FBSA 4UXNA 2BY1A 4NQWA 3O3KA 2EV6A 5JHUA 3OL3A 5GP9A 1I1GA 2PMZA 1S7EA 1MDMA 2DA7A 2ZNYA 5FKNA 2KQRA 2JPBA 3H5RA 2LLKA 1CF7A 5ICFA 4CICA 1GDTA 1IG7A 1Z77A 4I0BA 4BKXA 4ZYHA 4OIRF 4LG0A 2H27A 1WJEA 1HDPA 1XTAA 3ZR8X 3SYTA 1D1AA 3K4MA 2E1CA 4E4HA 3TBIA 2WV0A 1RNLA 2CWEA 2MH2A 4V2FA 3RCOA 2FSWA 5FLXZ 4IO9F 2OTJI 5HLTA 1D8JA 3CCQI 4YIIA 3DKXA 2ZBKA 1VQLI 4EV0A 1KQ0A 2E36A 1O3RA 4Q48A 5LD2C 1ZN2A 4J19A 5HS9A 2KT0A 2PJRA 1A6QA 4AC0A 2DPDA 2DT6A 2X6WA 3BY6A 1I5ZA 3CQZJ 1OQYA 3BLYA 2VPRA 1MIJA 5HS7A 1U2WA 5E3LA 3FHNA 1BI0A 4FX4A 5L3CA 5E1ZB 2WTEA 1S8NA 1FSHA 3W6VA 1QPMA 2HDDA 2UWMA 2EQRA 1OCOH 1ZRDA 3C2HA 2YX4A 5K5OA 3H9GA 3BTLA 2ME6A 1YIJI 3W2AA 4GYGA 1RKTA 4Y7NJ 4PJLA 1SD5A 2DFHA 1XGMA 3BWGA 1RUNA 4V2GA 1JKQC 2RREA 2BW3B 5HNFA 1FMVA 3I59A 3HPHA 2F5DA 3ZRGA 3KYCB 4A0YA 5BS6A 5AIPA 5CQGA 4PK4A 3TO9A 4ON0A 4YG2F 2BVMA 3CC2I 3U1DA 5FLXK 3P9KA 2R5YB 4K2EA 3GXOA 1GLNA 3C3WA 4NDLA 4IZZA 3HTUA 1ZARA 2W4SA 5ERIA 1BI1A 3OYMA 1FBUA 1XN7A 2FU4A 4NC7A 4EM0B 4L5EA 1BR2A 5GTHC 3O6BB 4HV6A 3NWSA 2JWTA 4LIVA 1WWXA 4AD9A 4XRSG 1KYZA 3BG5A 1OYWA 4HV5A 4HEA2 5F1JA 2W48A 3H35A 1D0YA 2GIZA 4WWCA 1CF7B 4X6AJ 3DU5A 2QM3A 3HOXJ 3A01A 1LJ9A 4FHTA 4BQNA 5J8CA 2VN2A 3V42A 3ZQHA 2DK8A 1R5GA 1W7PA 1WQ2A 1E3OC 1N25A 4DNCA 4B4CA 1OCPA 1R5ID 5DD4A 4I98B 3ZQCA 1H0MA 1WCMJ 3F22A 1QGPA 3FM3A 2EILH 2GXAA 4D5CA 5FFXA 4LK0F 2O61A 1BIAA 2HVQA 4II3A 2LREA 4FCYA 1HKTA 5J4YA 5CVUA 2R7SA 3PL8A 3FK6A 1D0XA 1Z9CA 1Z7LA 3MMYB 2VBWA 2DA2A 1TL8A 4XKWA 4BXUA 3KYLA 3FXJA 2ISZA 3DV8A 3F6VA 3QYBA 5FRMA 1EF4A 5JFRA 9ANTA 3OOPA 2QQ9A 4BY1J 1XSXA 3C1DA 1I39A 3K4NA 1YX5A 1TWFJ 3FM5A 2QKLB 4ZJZA 3DKYA 4NUBA 4XLAA 1IC8A 1A5JA 1EH6A 1P4AA 3BCAA 4XMYA 1RI7A 5BMZA 1V4RA 3KP6A 1LE8A 5EEGA 5E17F 4N0BA 4X0GA 2M87A 2IT0A 2HFHA 1Y56A 2RGVA 1LEBA 2JUGA 2HQ5A 2DQRA 4DGWB 4YFKF 3M8EA 4MFDA 2XROA 1U8RA 2CQQA 4Q47A 2VODA 1R6RA 1QNTA 1OMIA 5H2FC 3DTKA 5E8IA 2HDCA 2KZGA 4MEXF 4RB1A 3WGGA 1KYWA 5FROA 3QPSA 1JE8A 5IP9J 2W25A 3SDBA 2VE9A 1BW5A 2VT3A 3QP5A 4BE1A 3LL7A 4KITB 1AA7A 5EGOB 4I02A 2FD5A 2PJRB 4HRIA 1GXQA 1OYYA 1SD4A 5LLQA 2GLOA 1W7PD 4FISA 1PUFB 4EQQA 3VEPA 5HODA 2I8DA 5BQTA 4KT5C 4FASD 3RYRA 2XF5A 3OL4A 5D5VB 1RZ4A 4CCJA 5E8GA 2O6GE 4BBSJ 1W5SA 3BT9A 2GBYA 2HYFA 4Y13A 2EPFA 3I9V2 1K78A 2TRTA 2VI6A 4AYBA 1PP8F 4H4KC 4XOTA 2R7QA 2F2EA 4BL0B 2DTZA 3S1RJ 2HQAA 4E7JA 1GV2A 1TNSA 2IBDA 4OMYA 1R00A 1JT6A 4RDUA 2QVOA 2PG4A 4M9XA 2HOAA 2DU9A 2O3FA 3T5XA 2DJIA 1OCCH 3JRHA 4M74A 3WGIA 3R60A 5E79C 1LEAA 2QENA 3LFKA 2D1VA 1O57A 4DYCA 4MEYF 3RKQA 3KEYA 3M1EA 2AQFA 1I27A 4G6QA 5IYBJ 2WAQN 1J2XA 5FFZA 5HVQC 4U87A 3GTMJ 2HTSA 3KP5A 1WJBA 4UUTA 3S8PA 1YJ9I 2R5YA 1R7JA 1IN7A 4R8HA 1VF9A 2M4KA 2OBPA 4U7BA 2X6XA 2EFQA 3VSLA 3AL0B 3A1YA 1D1BA 2DT7B 4P5OA 2Q1ZB 1MZBA 5HDNA 3IRQA 2WY8Q 1ZG1A 1TNTA 3BTJA 4C3HJ 1FMWA 2NYXA 2RNGA 5FD6A 2XVCA 1SVOA 2A6HF 1BA5A 3ZN1A 2E2IJ 5J1YA 1S29A 2V4JC 4BYYA 2M4GA 1JTYA 1V55H 1GHCA 2MA3A 5LHHA 5EYRA 4IHXA 5EDNA 4CHUA 2F5FA 2WADA 3HPGA 2CFXA 1NHAA 2XRNA 1ZQ3P 3NQOA 3SFIA 3Q0WA 2CUEA 3FXQA 1POGA 5IOZA 1YX3A 5EEHA 1TQMA 2LG4A 2KMUA 4LD5A 5E3OA 2VC0A 3GTOJ 1ON1A 1EA3A 3BQYA 3AG2H 4LOCA 1SVMA 3I4MJ 2E1OA 3MVPA 3BJAA 3HXLA 5GTIC 5E20A 4B1RA 2CQNA 3ZPLA 1JTXA 4CCLA 4KJZA 3GTKJ 2LKSA 3BR2A 5C4XJ 5IYCJ 1IV6A 5D5WB 3LSKA 3R6SA 1TQPA 2OV7A 3T8RA 1TQIA 2R7DA 1T98A 2GA2A 5D5XB 4F91B 2EIKH 1BOAA 3OY9A 2W00A 3K0LA 1Y6IA 1HW2A 3FXRA 2FQ3A 5IP7J 2QSHX 2XF6A 3S1NJ 2BEOA 1HKQA 4L0ZB 3V7CA 3QU3A 3DEEA 2RVCA 2ECBA 3TO6A 3NRVA 2EWNA 4KUMA 1H9GA 3U2RA 3W2VA 3PNVA 4DYRA 5H20A 3PUBA 1S9HA 3E6CC 1S72I 2JA5J 1G3WA 4B47A 3KX2A 3MKLA 2BY2A 3EPZA 1R22A 3CCEI 1LPQA 2HDWA 2K4BA 1I50J 3VB2A 2A61A 3S17J 1SD7A 3GTGJ 4XLFA 3SZTA 5M5YJ 4Y52J 4A5MA 5CVIA 4M3DA 1SANA 1BR1A 3JTHA 1WHUA 2LSOA 2DLLA 3CUOA 3RZOJ 4JX6A 2LMDA 4FE7A 4IEJA 3BTCA 3RKWA 2PQ8A 2F5VA 1FC3A 2OF7A 2C6YA 1BW6A 1B59A 5LGNA 5CJ9A 2K85A 1KQ8A 3AKZA 1FIAA 3L2CA 3ZMVA 1HSTA 4R1HA 2DXIA 2EFOA 5C44J 3F8CA 3HZJA 2E71A 1P6RA 3D5RC 4LJZF 2ZXWH 3PO2J 4QLCU 3L2VA 3HOWJ 2DYSH 4OIQF 1R71A 1YO5C 2QSFX 3DPLC 3MWMA 2XUBA 3OIOA 4IQ4A 5EZGA 5F0HA 3MQ0A 2HNHA 2L02A 3EETA 2FMLA 2WB1N 2F4MB 2A69F 4R79A 3IV5A 4NNJA 4NQWB 1TZLA 3GLLA 2JT1A 1WJFA 2NRAC 1OJLA 5FKKA 2LBFB 4ZYEA 4P96A 1KU7A 4UNOA 3CLOA 3KZYA 3SFZA 4XKCA 2L4AA 1TWHJ 2J5PA 2PBIA 1YE9A 1ZAOA 1IDZA 3HGYA 4BACA 1P4XA 3OYKA 2PMHA 4RBOA 4LB6B 3GZ6A 1D8KA 3RPUA 5HLHA 2EK5A 3CLQA 2V79A 1XMAA 4C2MJ 5EF6A 3S3MA 4KIFA 5IPAA 1WZ2A 5JLXA 1ULYA 3S2HJ 2MLKA 3OOUA 4JQFA 3OYFA 1BJAA 1UFMA 4HG2A 2E5NA 3MD2A 2VBZA 1YYVA 2ZJ2A 2IP2A 1TBXA 1TLHB 2HXIA 3A2KA 3CP2A 4MIMA 3TDUC 3OS2A 2DOAA 2NAZA 1G4DA 1WFXA 3OYLA 1TTYA 1YITI 2HPIA 3LA7A 2VOOA 1RC9A 2DAOA 4W97A 2IJLA 1IW7F 2EIJH 5CLSA 2CV2A 3D0SA 4E6KG 2DK5A 1LQ1A 3JSPA 4RMNA 2G0EA 3G4SI 2E2HJ 4FQGA 4HQEA 1G8XA 1A36A 2WB1A 3Q9SA 3HL2A 1JGSA 2RN7A 3OMYA 4M6XA 2OZ6A 1SFXA 1FYLA 3RPUD 4JYKA 3X2QH 2K9NA 1PYVA 4P9UA 3CCMI 4KMFA 1XSDA 4M3BA 3BTIA 5B3SH 5EZHA 4ABZA 1QA6A 2IGMA 2FA5A 2E35A 3S32A 1KA8A 2BHZA 4XSXF 4ZDPA 3W6KB 3V4GA 3MEXA 3AL0C 3S3OA 3MZYA 3L1PA 3S2DJ 2KIFA 2XKPA 2DFEA 2K4JA 4KMUX 5J1RA 5GPAA 1HLVA 2BHYA 3CDHA 2HI3A 3F6OA 4IL6C 5IT3A 1ZREA 1K6YA 5AONA 3ZGKA 2QA4I 1RR7A 2IGKA 4LG3A 5DCFA 5F0FA 3JRDA 2XRLA 2VQCA 3I4PA 1WJ5A 2JRMA 3G2BA 3J7ZI 3GTLJ 2Z16A 3OWTA 3CUQA 2F6CA 3I64A 3LNQA 1OR7C 5JVGF 2X4HA 3RIRA 4E7LA 2VJIA 3CESA 3QPLA 2MG4A 2B9SA 3DPUA 3LOCA 3I56I 1WJAA 3F8FA 4LMYA 3U9GA 2R3SA 1U78A 3I4NJ 2MD0A 3ESWB 3G3ZA 1QVUA 4IRHA 3K70C 5FKOA 4M71A 5JLWA 3JRCA 1X58A 1JKRC 4UV9A 2ZJQF 2W24A 4AM3A 4G12A 1MBJA 4FE4A 2W7NA 2A68F 2P0WA 2WC2A 4BHBA 4BDYA 3ZQFA 1W0UA 4RS8A 3E6MA 3A0HC 2HOEA 1H88C 3K1MA 1NK3P 1GVJA 1JUSA 2R4GA 4BQAA 3GFLA 1LFBA 2IA1A 3F9KA 3CC7I 5FRNA 2YX7A 3CD6I 1T39A 1MKMA 4EATA 1YJNI 1E2XA 4UUSB 1UHWA 2VC1A 2X1EA 2X6YA 3O2PE 1ENHA 2BZTA 2DTRA 2OJED 4JK1X 3LSRA 1V5EA 3KZIC 3ZOBA 3HOSA 4G94A 4EGYA 3F72A 3QU6A 2K3PA 1N75A 2XAHA 1FIPA 2ADUA 3AG3H 3TMOA 3WE3A 4YIRX 1R4NB 3M9AA 3J7AO 2MD5A 1ZRCA 1IN6A 2JK3A 2RQQA 3K4KA 4XR6A 4ENJA 3CZ6A 1REPC 2NVXJ 4O3MA 1YFHA 3J80Z 1B6AA 2XB5A 3DLLF 3M07A 1OCZH 1P92A 1R4MB 4QPQA 4YFXF 2JA8J 1LB2A 4RA2A 2CW0F 3GLXA 4RAZA 1EH8A 1XG1A 1YS6A 2DJNA 5F27A 2UZKA 2HKOA 5HNHA 2FQ4A 2XAFA 3HEFA 5TISC 3ERED 2K40A 1DU6A 2WAQA 3REOA 2QEXI 4L18B 4IXAA 4A3JJ 2KFDA 4Y17A 2RKHA 3DLAA 3LQQA 3WTZA 1W4MA 4CSWA 1H9TA 4XKBA 3BG3A 4QWQA 4I09A 1XGSA 3ZQGA 1RR8C 2KJCA 4ESFA 4M3FA 3ONQA 1YQAA 1YS7A 1YW8A 3HYIA 2KRFA 5ILUA 3JAMZ 3NARA 3F0CA 3H3UA 3VSKA 1IZ1A 3N97A 5ICCA 3I58A 3QWLA 5IYDJ 2K02A 2VBYA 4A3BJ 2NXNB 2PMZN 2BGCA 1A04A 4AVPA 1VQOI 5LRSA 4BNCA 3C7JA 4L5JA 1MH4A 4XL9A 3P5JA 3F21A 1ZR4A 5DM7F 1X4OA 2VKVA 2R7RA 3L2WA 2YU3A 5M3FJ 1FPQA 2ZJPF 2CRGA 2FUG2 1UG0A 1Z05A 3LSHA 3V7RA 3KEOA 2DA6A 2NOJB 3LSJA 4LB5A 2HGCA 2M5WA 3S3NA 2QBYA 2JMWA 2KZVA 4CCMA 3TP0A 2O8XA 3DCFA 2ZO4A 1MSFC 2L9RA 2Q2EA 2MYSA 2HWVA 2QQ8A 5D4SA 3OYJA 1DUXC 2LOOA 3S1MJ 4E7ZA 4EEFG 1UCRA 2EV0A 1WKMA 2ZFWA 3OS0A 1R49A 1HKSA 4XN3A 1U8BA 1FOKA 1IN5A 3CCUI 5L3FA 3CCLI 3EYYA 2WV1A 2AO9A 2ID6A 3FMSA 1IV8A 2QCOA 3PFIA 1YRNA 3ZMDA 3MKZA 1T6SA 3I55I 3R4KA 2GXBA 3PQKA 4A3CJ 3E1SA 4IF4A 3VYRB 1B9NA 3DPTA 3Q3SA 4A3EJ 1W5TA 3HHHA 2KLOA 5CQEA 1U3EM 3LA3A 1EKEA 1K79A 2OCCH 2P5KA 2XAQA 3E97A 3HDDA 5IT9Z 2V6CA 3FZVA 4DIQA 2KIQA 2HVSA 2QKMB 4M9SA 2M30A 4RM3A 1HQCA 2V9KA 2A07F 4AIDA 1R1TA 2EZHA 3T1BA 1P7JA 3H36A 1TT0A 1FX7A 4QPOA 3OSGA 3JRFA 1UJ8A 1TWGJ 1Z67A 2I5UA 4X1EA 2EJRA 2V26A 2ZNZA 5E1XA 4DBQA 1F36A 2H8WA 3CJTB 4XKVA 1Y1WJ 3ISPA 1D1CA 4RB0A 1NK2P 4BBRJ 1ETQA 1IXRC 4GO1A 3GTPJ 3MZHA 1H89C 3CJQB 4I2OA 3BZCA 2LDUA 3HB9A 1YTYA 4YEJA 2HVRA 5F1RA 3VWBA 2X1CA 3LA2A 4BS9A 2H6CA 2AXLA 4LLNA 3KFWX 1U5TC 5AIQA 5GPCA 1R23A 1IUFA 4A3GJ 4L9VA 4KICA 3BROA 1DU0A 1KQ9A 3D5LA 2E5ZA 3RDIA 2DMUA 4BXFA 2IGOA 5C4JJ 1JUPA 4XLEA 4CH7A 3OYCA 3CTAA 2LD5A 3QAHA 3W6JB 3ZXSA 5D5UB 2P8TA 2YS9A 1JKPC 4HX8A 2PMUA 2X0LA 3H5AA 3BZKA 3KLNA 2AQEA 4GFBA 4BXXJ 3G6EI 3GX4X 2XKOA 4IPAA 3ZCOA 1MBEA 3PFYA 5M3MJ 3PNTA 2XV4S 4DQ2A 4A3LJ 5J1UA 4P9FA 2PI0A 3ZMTA 5B1BH 1VQ4I 2VB6A 3HM5A 1ODDA 2KDOA 3HG9A 1YHQI 4S0HB 1R58A 3ZN0A 3BR0A 2Y31A 3MN2A 1CQTA 1LDKB 2CO5A 2KRCA 4KIBA 4RLQA 5TGTA 3I71A 3RZDJ 3HSRA 4A12A 2GAUA 2WWYA 1T33A 2Q0OA 3FBNB 2D45A 2HZDA 3AG1H 2FBKA 1AKHA 2L3DA 1BI3A 4CCKA 4M6YA 2DMQA 1RUOA 1U5TB 1KZHA 1QZYA 1B72B 2X9DA 3COAC 2M7AA 2NVQJ 4HPQA 4XM3A 3PNYA 4BHCA 3GFMA 4LITA 5J4VA 2DA1A 4AVZA 4CO8A 3T0YA 3AFHA 3IRRA 1XB4A 3GZ5A 1USSA 3LAJA 3HRTA 1EV7A 2LTPA 5DCMB 1RKWA 3K6GA 3QOEA 3CC4I 1D0ZA 4N9HA 2DDBA 4OU0A 4CYDA 4FETA 4BH9A 1VTNC 3IAM2 4HBLA 4PSXA 1WPKA 2P6SA 3EUHC 3WG9A 3GTJJ 1MMDA 4CUGA 2IA2A 2HZTA 1QU3A 1VQPI 2VQGA 3WHCA 4G6DA 2DMTA 2CW8A 2DT5A 2O5RA 5HS8A 5LHGA 2W82A 4UUVA 3M4OJ 1OFCX 2VPLA 2BVLA 1MDMB 3S2WA 2JA6J 3JW4A 3CDLA 1ETXA 3ECOA 2FXAA 2LY9A 1MMSA 3IAS2 4M6VA 2QWWA 1STZA 2MBFA 1A35A 4PFPA 3QRFF 5FKLA 1Q1HA 4MGRA 5LHIA 2AHQA 2LRDA 2ZFUA 2K86A 3PIPF 2CQXA 3M8JA 1S3JA 3QOPA 1LVAA 2D5VA 5TRDA 1F1ZA 2QYOA 1W7PB 2XDVA 1B9MA 2Z1DA 3Q0UA 3SEZA 5ILVA 2BY3A 4G7OF 4DZPA 2PFBA 2XB0X 4XICA 2KJBA 1MBFA 4XBFA 1V5GA 4E7HA 2MSYA 4KISA 1E0EA 3HRUA 1R5HA 4IVNA 3A03A 4OAZA 2JZYA 3G73A 1BBYA 4WX9A 3ASOH 1ETVA 1V54H 2XPUA 4G8XA 5LEJA 3K1PA 1HSJA 4XLCA 2JPCA 2ME0A 4D7NA 1T0FC 3BZ6A 3J7YJ 2O8KA 4BE2A 3ERMA 4F7ZA 5IY5H 3IUOA 5CVRA 4C9YA 3U21A 1B1BA 4PCQA 2DMPA 2H8RA 1E3PA 2XPWA 2VL8A 1LE8B 4KA4A 2HYJA 5EGOA 3EQLF 1XGOA 2EFPA 1X1BA 3WTYC 4I6ZA 2STWA 4OIOF 1LDJA 5GAEJ 3GTQJ 3FBIB 1MJ9A 2LF7A 2ZCWA 2FOKA 2OQRA 1SAXA 5F64A 4E7SA 1SEUA 4UB8C 3MKWB 1H8AC 1C0WA 2I10A 3E3VA 3D5SC 2L7KA 3S14J 3GW2A 3PUFA 4IHTA 2RC4A 1MBGA 1O3TA 1O7FA 3QQAA 3BR3A 4WXHA 4PUSA 2OU2A 4XNFA 3BP8A 4LFUA 2YR2A 4BU2A 1T2KA 3EUHA 1XPXA 3FIWA 3QYFA 3OYHA 2NVTJ 3NEUA 1Y1VJ 1YLFA 2L5QA 2IPQX 3BG6A 2EFWA 1VQKI 5A2QZ 1YW7A 3ELKA 2Z2SB 3TW7A 5EEAA 3K2ZA 2RV8A 5CKTA 2A05A 5KAFC 4ENKA 3HUGB 2R93J 3SZGA 2OCEA 1NG7A 3ZMUA 4GDFA 4BGDA 1K4SA 4XLPF 1O4XA 1S5LC 2CG4A 1ZG5A 1AU7A 5K1YA 5FKMA 4BQOA 1X2NA 2R7UA 1AKHB 5L3EA 4RAFA 5K5QA 3L2QA 4Q4ZF 3V8JA 4A3IJ 4YELA 5M5XJ 2VKHA 2MC3A 4Z6YA 2FF4A 2VXZA 1Z3XA 3FHZA 2PN6A 2W1OA 2AXTC 2R92J 3FX3A 4KNYA 2ZMEB 3G1OA 3LMMA 3UNGC 4E7IA 3WTVC 3KP4A 3B6CA 4C3JJ 3PO3J 2Z99A 3OYDA 1FNNA 2XGDA 5ICGA 4OMZA 1LKXA 3OYGA 4XRMA 2VQHA 3CJNA 3P9CA 2G7HA 1W1WE 3SEQA 2B7EA 2MFZA 3ZQLA 2XPVA 1G6NA 4CZZA 2OC6A 3IHUA 3DP7A 3JREA 1VQ8I 1I6HJ 4MO7A 3DF8A 1OCRH 1HDDC 3OYAA 3LSIA 3KLOA 4DBRA 3CO7C 4OINF 3HKZA 3T8TA 1QRYA 3OR2C 3FXUA 4UVBA 4BY7J 4RB3C 1SFOJ 4LIUA 1XC5A 3V8LA 4YFNF 2EH3A 3QPTA 2CW7A 2FBIA 3CDIA 1S7OA 4B3AA 2ELKA 1AOYA 1WJDA 1VZ0A 3DBRB 2HU9A 4NB5A 1QVTA 1QBJA 4ENNA 4G7ZF 2ECCA 1QPIA 3G71I 5JHFA 1XCBA 3WGHA 3H0DA 1WSUA 4PJMA 3DEUA 4EM2A 2JQ7A 2NOGA 4JX4A 5KNLA 1ZLKA 2MW8A 3SXYA 2CS3A 2DQLA 3S1QJ 4A3KJ 2GQQA 2WA0A 5ILSA 2NVUB 4PJ0C 1OPCA 4S05A 2B63J 3RYPA 2FNPA 2CFOA 1OR7A 3ZQQA 4D7MA 4CYCA 1MD0A 3K70D 2OAZA 2L7ZA 4EJVA 2EINH 2XIGA 4DZJA 1YG2A 1LNWA 3I3LA 4A3FJ 4AIJA 1MMAA 4IHSA 3CMEI 4UVAA 5CYVA 3K10A 2JTVA 1ZK8A 3NAUA 5D6EA 1OKRA 4RAGA 3OV8A 2E34A 3FXLA 3IWFA 4HF1A 4F92B 2Z3YA 3HKZN 1IF1A 1D5VA 1T38A 2Q2EB 2ZXJA 1SFUA 3S16J 4XRFA 4O6JA 3A02A 4ZTJA 5D6FA 4IRIA 5J40A 2LKXA 2V1UA 2VIXA 1WI9A 2VUMJ 3HOTA 4BDZA 4Q5SF 2JA7J 4XSZF 2FEZA 3DTEA 1VI0A 1UMQA 1RETA 1NG6A 3TW6A 2YU9J 3Q0VA 3Q9VA 4CA0A 3FISA 4HDUA 3CMMA 3WTXC 4OIPF 2WAFA 3MKYB 4A3MJ 2M7BA 1E3HA 4I7HA 1CGPA 2M9HA 2GWRA 2IAIA 2E19A 3M3YJ 3IC7A 2BYVE 4A93J 2ZSIB 4N9IA 3BG7A 1FTZA 1JUMA 4B43A 3PM1A 4A0ZA 4XLHA 3B73A 2STTA 5DYMA 1ITYA 2OA4A 4M72A 1G59A 1Z21A 4HA8A 5F04A 1BIBA 3JSOA 2EBIA 3K4CA 2E2JJ 5HDGA 3Q5FA 3HOVJ 1X1AA 2IVMA 3H9QA 3R61A 2CSOA 2P4WA 2P7CB 1X4PA 1XMKA 2ESNA 4DOZA 4I76A 3EUKL 5BNGA 3HRSA 3IKVA 3I5UA 2KPMA 3JRIA 4P1WA 2M34A 4EGZA 2ZXIA 1YIOA 1K83J 3VYSB 3LAPA 1BL0A 2L4MA 1X2MA 4G9YA 3JRBA 2XGXA 1BN5A 1ON2A 1B8IB 1QO0D 3VOEA 1SAUA 2YPRA 4A3DJ 1B4AA 3JAMK 4QTRA 4UVCA 2Y48A 4HZFA 4NHJA 2R7FA 1SD6A 2X1DA 1O7LA 1IN4A 2A3SA 1Z0XA 2V1NA 4BQQA 4ZYDA 5HOOA 1R36A 4IJAA 1RIOH 4B44A 3L2UA 1Y0NA 3ZMZA 1J9IA 4GXOA 2NS7A 2K3FA 3WU1B 3CMAI 2LP0A 4KDPA 1UHMA 4MQVA 4LK1F 4CGZA 2JRTA 5B66C 2G7UA 4Y4RA 4AUXA 4E70A 1XS9A 2CUJA 4BEHB 2IA0A 3M8FA 2MGQA 4GCVA 3F8MA 1OLTA 4HNVA 3KP2A 2M0MA 1KU2A 2K9LA 3HBLA 4EVIA 5DUIA 4ZC3A 1D3YA 1IDYA 1X3WB 2M8GX 1JKOC 1LDDA 4PGGA 2F4IA 1ZH5A 1I3AA 2V9PA 1ZGAA 3EDPA 6PAXA 1VQ5I 4ZYAA 2DBBA 2VKDA 2Z9OA 1J09A 3GZNB 2HKXA 2JSPA 5E18F 2JUCA 3IH4A 2ELHA 3K2AA 1BC7C 2ZMEC 2CQ7A 4M9ZA 2L7FP 1MBHA 4H0EA 4A0XA 4AIKA 2M0CA 3PQJA 3CCVI 2R7TA 4U0VA 5BPDA 1X3UA 1TT5B 3FDYA 2K9QA 2DDAA 2FX0A 3BQZA 2BV6A 4HAMA 2Y75A 2AS5F 1APLC 1VQ6I 3N05A 4PZJA 1O3SA 2P7VB 1QZEA 5DCMA 3LSTA 4F3QA 1IN8A 1OISA 2KHMA 4RAYA 3TOAA 3HC7A 3HOYJ 4BJ5C 3H3VK 3E5UA 3H3ZA 3N4MA 3GBGA 1HA8A 3K69A 2DOFA 2LY2A 1MSEC 5LGTA 1JJ6C 3KPHA 3W3CA 3B6AA 2DA5A 2MH9A 1YW9A 4C2UA 4EMSA 3TDZC 3BR5A 1U6GA 1X1CA 2DN0A 3VPRA 2KL4A 3DBLB 2RAEA 5A2QK 1QQIA 1RRJA 1T8IA 1DDNA 1USTA 2FNAA 1J59A 4PJJA 1UELB 2L01A 1GV5A 1UB9A 4XRSA 1SC7A 3H5NA 1EH7A 1BI2A 2CQKA 3M7GA 1T95A 3E5QA 2ZC2A 4U0YA 1FYKA 2R7ZJ 1FBQA 4OAYA 1O3QA 2K7LA 1FP2A 1IRGA 2HXOA 4KYWA 3RSNA 4B09A 3KP7A 2JVHA 5JVTA 2R7VA 1FYMA 2F5CA 2QLZA 2R7OA 3C18A 3HOUJ 4B3XA 2E7WA 3O8GA 4GGGA 4ESBA 2DOEA 1K4TA 4ESJA 4NC8A 4IHYA 1WI3A 4II2A 2R5ZA 1MGTA 1MNEA 1PVEA 2LNBA 2XGCA 1UZCA 1NH3A 1IAWA 1FJLA 4U0WA 3PSIA 2EZKA 3SJMA 4DYQA 4FTHA 3SZPA 2M3AA 4MTDA 4CCOA 3B02A 5JI6A 1MBKA 2HYGD 3RKXA 1HC8A 3CP8A 3HJEA 1Y39A 2VOPA 2LY1A 5K7ZA 3CF5F 3K4JA 2VBXA 2V1DA 5DEQA 4BHPA 2M8EA 1DPUA 1J0RA 2QQAA 3H9JA 3VYUB 2QGUA 1VFCA 2BXZA 3OYNA 1ETYA 4S04A 1ONVA 2XHKA 2P81A 2CGPA 2WY7Q 3DEWA 1ZLJA 5F08A 1Z3YA 2DFIA 5LFAA 3NWTA 3FK7A 4UY8I 2VXDA 3F8BA 1N77A 4IQJA 3MAJA 3TP3A 2X6OA 2QZ8A 4PSWA 4MTEA 2HPMA 5C3EJ 4XOPA 3GO5A 3SQNA 2ID3A 1SFKA 4M3EA 5KK1A 3TL4X 1DP7P 1XDUA 4JOMA 1Y8RB 2ICWG 3G1MA 4MFEA 5FLMJ 4G7HF 2CV1A 1XMXA 4V19K 1TW2A 3BPXA 2NS0A 1P4WA 5JR3A 4ZDOA 2DW4A 1QHHD 3R0AA 5EJCA 2DODA 2BXYA 2RQPA 4QSHA 1VQMI 1P9QC 1UG2A 2EZLA 2VT2A 3ZQIA 1JHFA 1P2FA 2JJ7A 3E6BA 3HRMA 3HIFA 2FRHA 2K5CA 3MCZA 2LF8A 1DGRM 4HNUA 1WGXA 3F3XA 1L0OC 4BJ6C 1X3ZB 4HW0A 3K1NA 2E1MB 2W85A 2F4OB 2OPTA 2BOLA 1TWCJ 2XF7A 3K4BA 4ZZLA 2KP6A 1ACIA 2V9VA 4C2TA 1SMYF 3LWFA 1KU9A 3HUGA 3IH3A 1JT0A 2O9LA 4C3IJ 4A5NA 3S15J 2FBHA 2GOXB 3RQIA 2QBYB 3E6DA 3LSPA 4XIDA 2XSJC 3FF5A 3ECHA 2EV5A 1G2HA 1YOVB 2IRFG 2FJ1A 3GCMA 4CZCA 2IS4A 1F4KA 1DPRA 1IRXA 2Y9YA 1GVDA 5E3NA 3L09A 4OWRB 3M1CA 1U9OA 3FMQA 1U0JA 2IS2A 5J8FA 3TGNA 3JR9A 1PUEE 1EJ9A 3FWEA 5B5EC 3K7AJ 4EJOA 1TWAJ 3WTTC 4L5IA 4I99C 2KRHA 2X85A 2CUZA 4XK4A 2VE8A 2GZWA 3OIPA 4KIGA 3VFZA 3L2RA 2MLGA 2XAGA 1W36D 1YRNB 2HOSA 2BY0A 2DO7A 3BC8A 2E7XA 1ETOA 4HQMA 4JBAA 1IXSB 4HNTA 3WTSC 1HW1A 1Z6RA 1TP4A 2O0YA 4EM1A 3CF2A 3CUQC 3I53A 4XN0A 4F52A 1T0FA 4HF2A 2KIMA 1TW3A 4PJNA 1TC3C 2L54A 3UR3C 1DP3A 1HXDA 1LVKA 4D0PA 2E60A 3JCUC 4MQ9F 1JHHA 2COBA 2LBFA 2LH9A 4EJWA 2VQLA 2L2OA 2HR3A 1HCRA 2HQNA 3G1LA 2BBYA 4CCNA 3HGGA 5L3BA 3BDDA 2QQBA 3HSEA 3GYHX 4LG0B 2B0LA 1KONA 2CUFA 4RGUA 2HTJA 4AYBN 2R7WA 2R0QC 2MC4A 2QUFA 5D4RA 2V7FA 1ZG3A 4KT6A 1FOYA 1NTCA 3I0TA 1BR4A 1X1DA 3OSFA 3F23A 3ULQB 2R5ZB 3GFJA 1ZRFA 2VJ5A 2JSCA 3ZP5A 2H09A 5LBQA 2NNYA 2UXXA 3BCBA 3BR1A 5FJ8J 4CDGA 1BOBA 1UHSA 3W2WA 1Y0UA 2Y0SN 1XSVA 1GUUA 3BOQA 2ZJRF 4FT8A 4HF0A 2QF7A 3F8NA 4DJAA 3OYIA 2CYYA 3K4LA 1MJAA 2Y0MA 1IO2A 4ENMA 2V1XA 1I3QJ 2UV1A 1XDSA 4ZZDA 4XONA 3CCJI 1FSEA 1ZELA 3ABMH 1Z7UA 2CMPA 4ZH4F 4TV7A 3SHFA 2PLYA 2DMNA 2LFBA 3ML6A 4Y3OA 1GXPA 5DUKA 1W36C 2FOWA 2M45A 1FWZA 1ZTRA 5LRRA 1R9TJ 2VONA 1Q1VA 1VQ9I 1F5TA 3H1CA 1DQUA 3FXOA 3KE2A 4HX7A 2DPUA 3CO6C 2ETHA 4GYIA 1FLIA 4LGWA 2XAJA 2FMYA 2Y30A 4YRVA 3R0JA 3FKIJ 2HQRA 3OR1C 2D2WA 3GFIA 4F55A 5KHDA 1VQNI 1S6LA 1IRZA 2L9SA 1J5YA 3CCYA 1MNMC 2RDPA 1RESA 1L3LA 2LK2A 2P5LC 3ABTA 3CCSI 3E5XA 2XSDC 3CMYA 3UKGA 2WBMA 2K27A 2ISYA 1XD7A 1G3TA 5D8KB 1VQ7I 2VASA 2ZB9A 1U5TA 2N8GA 4WCGA 3MFKA 2CU7A 1U9NA 4G6TB 2Y0SA 4Y33A 2BE5F 5DD8A 1LUJB 3K9TA 2NNNA 3LFUA 3RPQA 1RPWA 4AU7A 1QHGA 4KFCA 2GA1A 1YJWI 3VODA 3IL2A 2FE3A 5KCMA 3DTIA 5H6RA 3QYEA 3GWZA 4A69C 3QODA 3KETA 3GUDA 2CH0A 2CJJA 2K9MA 1FZPB 2YUSA 4WXCA 3HHGA 3EUAA 1ORKA 2EZIA 5CPRB 4KN4X 3ABLH 5FD5A 2P5VA 2TDXA 3A01B 3GF2A 5J47A 5FGMA 4D5FA 4U88A 3AAFA 1DGWY 4B48A 3C2GA 1I1SA 1QZZA 3ABUA 2IGNA 3A0BC 2W57A 3WTWC 5EG0B 1W0TA 1G3SA 4UHTA 5J6XA 4L0YB 2NVYJ 2Y9ZA 4UV8A 1SVLA 3LQRA 2DA3A 2HOTA 1P7IA 4BAYA 4MNUA 1B8IA 1BJZA 3IH2A 1ZYRF 3O8HA 4XORA 4ETSA 4QIWN 3RTRA 1I6XA 4ANJA 5DV5A 2CV0A 1PP7U 1G3YA 2DFFA 2KDZA 5LEKA 4E7KA 2L9NA 3I54A 5L3GA 4JP0A 1FT9A 1F43A 2OUMA 3RQ4A 5BPIA 4KN7X 2E1MC 2COMA 4HSTA 4PGHA 2LYCA 5DS9A 4IX7A 2ZXHA 5HLIA 4RGRA 1XGNA 3D1NI 2OZUA 1Y8QB 3L00A 1JGGA 4O5VA 2K9SA 2X51A 1SMTA 4BEHA 1K6OA 4RGSA 4WF2A 3TQNA 2EB7A 4MLOA 5M5WJ 5B1AH 3TO7A 4AIHA 2W84A 2DI3A 3LSGA 1M1EB 3V8KA 3WU0A 2M1BA 3DQVC 5E1WA 2ESHA 1ETKA 2V6EA 4IHVA 1S7AA 4I0AA 1HOMA 4LLLA 5CVJA 4HLYA 2H1LA 5E3MA 3P7NA 4HLXA 1BC8C 2XASA 2IXSA 1ERDA 3TKYA 2G9WA 4N4OB 2PX9A 4XLNF 4M3GA 4IOCF 1ZKGA 4FX0A 4F93B 2JVGA 3DKWA 3JTGA 3LSMA 3DWLE 2XAUA 1SFEA 2ZKZA 1A31A 4A6DA 3FMRA 1WVRA 3J80K 3QP6A 3RI4A 1PUFA 3JRAA 4NBQA 3GMEA 4MHGA 3IKTA 1B72A 3MZ8A 2KIUA 2JA2A 4Y15A 2MABA 4BE0A 1IXCA 3BJOA 3BR6A 3DFGA 1MH3A 3WG7H 1JI8A 3PJRA 1IRFA 3CUQB 4J01A 2IS6A 2QSGX 4U7DA 2HEOA 1K78B 5ED4A 3GVAA 2IEKA 5GAGJ 1OYIA 4CYCB 3ROUA 4HYEA 3A4CA 2ZSHB 5HDKA 4CXFA 3WODF 1F9NA 3BPVA 4L9TA 4D1QA 1Z6TA 1IJWC 5J3LA 4D9JA 5IP6A 2PJPA 1R1UA 5K7HA 5K7FA 2ACJA 3BG9A 5GADJ 3J81Z 1FY7A 3CJRB 1ZGWA 1KU3A 4ASNA 1WH7A 4RB2C 1T08B 1MW7A 1ZHFA 2DYRH 2ZMEA 1LFPA 3PSFA 4HDVA 3EYIA 1MJBA 1BM9A 3VYTB 3H0GJ 2OD5A 5DDGA 4P55A 2HS5A 3HSFA 5H6QA 2JN6A 5DM6F 1FP1D 2O7OA 1PDNC 2TCTA 1MMNA 1T56A 1R1VA 5F6FA 3TOBA 3ZQ7A 1AWCA 5HLGA 3JRGA 3ASNH 3WHBA 1HBXG 3OIQA 3SDGA 4ZYGA 2RNJA 3GEZA 2OTLI 2KISA 2VJJA 3OYBA 4OOIA 3RKYA 5L3DA 4ZTFA 1XX5A 2X48A 5F0CA 2KKOA 5LGUA 3L7WA 3WU2C 4PDKA 1MMGA 4UUSA 2UXNA 4L9JA 1JXSA 1J7KA 3L9FA 4M73A 1V5FA 2J5OA 1D5YA 1OCTC 3KYDB 2E1NA 4PFOA 3KZZA 4C30A 2O03A 3DXJF 2GXGA 2YSRA 3CCRI 1WH5A 2ELJA 2EFNA 5KAIC 2GIVA 2LC2A 4WK8F 3VDXA 4HX4A 4L9NA 3S93A 5EG0A 4IOAF 2LR8A 2VKEA 2Q8KA 3V7SA 5D8LB 2A5YB 4W1UA 4EJTA 2PEXA 2GM4A 4HSRA 2EA2A 2DA4A 2A5WA 4ITVA 5IOYA 1JJ8C 2IS1A 4B8XA 1ZR2A 2A6EF 3P9IA 1FOXA 4NC6A 3HOZJ 3C2BA 1Z1DA 1IGNA 2H94A 1K7AA 1WRJA 1ETWA 5KVRA 2Z33A 4IKFA 2F5EA 5ICEA 2LKPA 1K61A 2H6BA 3DBHB 2OQGA 2Y2ZA 5FB2A 2UUZA 1AHDP 4BUPA 4RM2A 5DTDA 1E17A 3HTSB 2DCEA
chains in the Genus database with same CATH topology
3RJPA 4WXDA 3BJ6A 1Z91A 1XCVA 3WTUC 4LLGF 3KEQA 2P6TA 5TJJA 5CVVA 5BOXA 3IWZA 2IW5A 4A2UA 1J75A 2Z5UA 3WE2A 4A6EA 4RGXA 2EA4A 3ZMSA 3KP3A 4IRGA 5FO5A 3I59B 4HOBA 5IT9K 1ZGJA 3KCCA 2D1HA 1V3FA 4YIFA 4EJUA 4AWXB 4Z2YA 3QPHA 5K5RA 1KGSA 1HW5A 1IUYA 3J81K 3H92A 4I01A 1FBSA 4UXNA 4NQWA 3O3KA 2EV6A 5JHUA 1I1GA 1MDMA 2ZNYA 2JPBA 1CF7A 5ICFA 4CICA 4I0BA 4ZYHA 4OIRF 4LG0A 2H27A 2E1CA 2WV0A 1RNLA 2CWEA 2MH2A 5FLXZ 2FSWA 1D8JA 4YIIA 2ZBKA 4EV0A 1KQ0A 1O3RA 4Q48A 1ZN2A 5HS9A 2DPDA 3BY6A 1I5ZA 5HS7A 1U2WA 1BI0A 4FX4A 5L3CA 5E1ZB 2WTEA 1S8NA 1FSHA 1QPMA 2UWMA 1ZRDA 2YX4A 5K5OA 4GYGA 1SD5A 1XGMA 3BWGA 1RUNA 3I59A 2F5DA 5BS6A 4A0YA 5AIPA 3TO9A 4ON0A 4YG2F 3U1DA 5FLXK 3P9KA 4K2EA 3GXOA 3C3WA 3HTUA 1ZARA 5ERIA 1BI1A 1FBUA 1XN7A 2FU4A 4EM0B 3O6BB 4HV6A 1WWXA 4AD9A 1KYZA 1OYWA 4HV5A 4WWCA 1CF7B 2QM3A 1LJ9A 4FHTA 5J8CA 2VN2A 2DK8A 1R5GA 1W7PA 1WQ2A 4DNCA 1H0MA 5DD4A 4I98B 3F22A 1QGPA 3FM3A 5FFXA 4LK0F 2O61A 1BIAA 1HKTA 5CVUA 1Z9CA 2VBWA 4BXUA 2ISZA 3DV8A 3F6VA 5JFRA 3OOPA 2QQ9A 1XSXA 3C1DA 3FM5A 1EH6A 1P4AA 1RI7A 5BMZA 1V4RA 3KP6A 5EEGA 5E17F 4N0BA 2M87A 2IT0A 2HFHA 2RGVA 1LEBA 2DQRA 4YFKF 3M8EA 2XROA 1U8RA 4Q47A 2VODA 1QNTA 1OMIA 5E8IA 2HDCA 4MEXF 4RB1A 3WGGA 1KYWA 1JE8A 2W25A 2VE9A 2VT3A 3QP5A 4I02A 1GXQA 1OYYA 1SD4A 5LLQA 1W7PD 4EQQA 3VEPA 5BQTA 4KT5C 3RYRA 5D5VB 1RZ4A 2O6GE 5E8GA 1W5SA 2HYFA 4Y13A 1K78A 1PP8F 2F2EA 1TNSA 4OMYA 1R00A 2QVOA 2PG4A 4M9XA 2DU9A 2O3FA 3T5XA 4M74A 3WGIA 3R60A 1LEAA 2QENA 3LFKA 2D1VA 1O57A 4MEYF 3M1EA 1I27A 4G6QA 5HVQC 5FFZA 1J2XA 2HTSA 3KP5A 1R7JA 1IN7A 4R8HA 2OBPA 4U7BA 2EFQA 4P5OA 1MZBA 5HDNA 3IRQA 1ZG1A 1TNTA 2NYXA 5FD6A 2XVCA 2A6HF 3ZN1A 1S29A 4BYYA 1GHCA 2MA3A 5LHHA 4CHUA 2F5FA 2CFXA 1NHAA 2XRNA 3NQOA 3FXQA 5EEHA 1TQMA 4LD5A 2VC0A 1ON1A 3BJAA 5E20A 3ZPLA 5D5WB 3R6SA 1TQPA 3T8RA 1TQIA 2R7DA 1T98A 2GA2A 5D5XB 1BOAA 3K0LA 1HW2A 3FXRA 2FQ3A 2BEOA 1HKQA 4L0ZB 3V7CA 3QU3A 2RVCA 3TO6A 3NRVA 2EWNA 4KUMA 1H9GA 3U2RA 5H20A 3E6CC 1G3WA 1R22A 2K4BA 3VB2A 2A61A 1SD7A 3SZTA 4A5MA 5CVIA 3JTHA 2LSOA 2DLLA 3CUOA 3RKWA 2PQ8A 2C6YA 1FC3A 1B59A 5LGNA 5CJ9A 1KQ8A 3L2CA 3ZMVA 1HSTA 4R1HA 2EFOA 3F8CA 1P6RA 4LJZF 4QLCU 4OIQF 1YO5C 3DPLC 3MWMA 2XUBA 3MQ0A 2L02A 3EETA 2FMLA 2A69F 4R79A 2JT1A 2NRAC 4ZYEA 4P96A 1KU7A 4UNOA 3CLOA 3KZYA 3SFZA 2L4AA 2J5PA 2PBIA 1ZAOA 1P4XA 2PMHA 4LB6B 3GZ6A 1D8KA 3RPUA 5HLHA 2EK5A 2V79A 1XMAA 4KIFA 1ULYA 2MLKA 4JQFA 1BJAA 1UFMA 2VBZA 1YYVA 2ZJ2A 2IP2A 1TBXA 1TLHB 1G4DA 3TDUC 2NAZA 1TTYA 3LA7A 2VOOA 2DAOA 2IJLA 1IW7F 5CLSA 3D0SA 2DK5A 1LQ1A 3JSPA 4HQEA 3Q9SA 1JGSA 2RN7A 4M6XA 2OZ6A 1SFXA 1FYLA 4P9UA 4KMFA 1XSDA 2FA5A 1KA8A 4XSXF 3W6KB 3V4GA 3MEXA 3MZYA 2KIFA 2XKPA 2K4JA 4KMUX 3CDHA 3F6OA 5IT3A 1ZREA 5AONA 5DCFA 3I4PA 3CUQA 3I64A 2X4HA 3RIRA 3F8FA 4LMYA 3U9GA 2R3SA 1U78A 3G3ZA 4IRHA 4M71A 4UV9A 2W24A 2A68F 2WC2A 4BHBA 4RS8A 3E6MA 2HOEA 3K1MA 1GVJA 4BQAA 3GFLA 2IA1A 2YX7A 1T39A 1MKMA 1E2XA 1UHWA 2VC1A 3O2PE 2DTRA 4JK1X 3HOSA 4G94A 4EGYA 3F72A 3QU6A 2XAHA 2ADUA 3WE3A 3M9AA 3J7AO 2MD5A 1ZRCA 1IN6A 4ENJA 1REPC 4O3MA 1YFHA 3J80Z 1B6AA 1P92A 4YFXF 1LB2A 2CW0F 3GLXA 4RAZA 1EH8A 1YS6A 2UZKA 2HKOA 2XAFA 3ERED 3REOA 4L18B 4IXAA 4Y17A 2RKHA 3LQQA 3WTZA 1W4MA 1H9TA 4QWQA 4I09A 1XGSA 2KJCA 4ESFA 1YQAA 1YS7A 1YW8A 3HYIA 2KRFA 5ILUA 3JAMZ 3H3UA 1IZ1A 3N97A 5ICCA 3I58A 2K02A 2VBYA 2BGCA 1A04A 4AVPA 5LRSA 4BNCA 3C7JA 4L5JA 3F21A 2YU3A 1FPQA 1Z05A 3V7RA 3KEOA 4LB5A 2HGCA 2M5WA 2QBYA 2O8XA 2ZO4A 2Q2EA 2HWVA 5D4SA 1DUXC 1UCRA 2EV0A 1WKMA 2ZFWA 1HKSA 1FOKA 1IN5A 5L3FA 3EYYA 3FMSA 3PFIA 3ZMDA 1T6SA 3R4KA 2GXBA 3PQKA 4IF4A 1B9NA 3DPTA 1W5TA 3HHHA 1U3EM 3LA3A 1K79A 2P5KA 2XAQA 3E97A 5IT9Z 2V6CA 3FZVA 4M9SA 2M30A 1HQCA 2A07F 1R1TA 3T1BA 1FX7A 2EJRA 2ZNZA 5E1XA 3ISPA 4RB0A 1IXRC 4GO1A 3MZHA 4I2OA 2LDUA 1YTYA 5F1RA 3LA2A 2H6CA 2AXLA 4LLNA 3KFWX 1U5TC 5AIQA 1R23A 4L9VA 4KICA 3BROA 1KQ9A 3D5LA 3RDIA 3CTAA 3QAHA 3W6JB 5D5UB 2P8TA 4HX8A 2PMUA 2X0LA 3KLNA 3GX4X 2XKOA 4IPAA 2XV4S 4DQ2A 4P9FA 2PI0A 3ZMTA 1ODDA 3ZN0A 1R58A 1LDKB 2CO5A 4KIBA 3I71A 3HSRA 4A12A 2GAUA 2WWYA 2Q0OA 2D45A 2FBKA 2L3DA 1BI3A 4M6YA 1RUOA 1U5TB 1QZYA 3COAC 4BHCA 3GFMA 4CO8A 3T0YA 3IRRA 1XB4A 3GZ5A 1USSA 3LAJA 3HRTA 1EV7A 5DCMB 4N9HA 4OU0A 4CYDA 4BH9A 1VTNC 4HBLA 2P6SA 3WG9A 2IA2A 2HZTA 4G6DA 2DT5A 5HS8A 5LHGA 4UUVA 1MDMB 3S2WA 3JW4A 3ECOA 2FXAA 2QWWA 1STZA 2MBFA 3QRFF 1Q1HA 4MGRA 5LHIA 2K86A 1S3JA 3QOPA 1LVAA 5TRDA 1F1ZA 2QYOA 1W7PB 1B9MA 5ILVA 4G7OF 2PFBA 2KJBA 4XBFA 3HRUA 1R5HA 4IVNA 2JZYA 3G73A 1BBYA 4WX9A 4G8XA 5LEJA 3K1PA 1HSJA 2JPCA 3BZ6A 4F7ZA 5CVRA 1B1BA 4PCQA 4KA4A 3EQLF 1XGOA 2EFPA 2STWA 3WTYC 4OIOF 1LDJA 1MJ9A 2LF7A 2ZCWA 2FOKA 2OQRA 1SAXA 5F64A 1C0WA 3E3VA 3GW2A 4IHTA 2RC4A 1O3TA 1O7FA 4WXHA 2OU2A 3BP8A 4LFUA 2YR2A 1T2KA 3EUHA 3NEUA 1YLFA 2IPQX 2EFWA 5A2QZ 1YW7A 3ELKA 3K2ZA 2RV8A 4ENKA 3ZMUA 4XLPF 1ZG5A 2CG4A 5K1YA 5L3EA 5K5QA 4Q4ZF 3V8JA 2MC3A 2FF4A 2VXZA 3FHZA 2PN6A 3FX3A 4KNYA 2ZMEB 3WTVC 3KP4A 2Z99A 1FNNA 5ICGA 4OMZA 3CJNA 3P9CA 2G7HA 1G6NA 4CZZA 3IHUA 3DP7A 3DF8A 3KLOA 3CO7C 4OINF 3T8TA 3FXUA 4UVBA 4RB3C 3V8LA 4YFNF 3QPTA 2FBIA 1S7OA 1AOYA 4NB5A 1QBJA 4ENNA 4G7ZF 1XCBA 3WGHA 1WSUA 3DEUA 4EM2A 1ZLKA 3SXYA 2DQLA 2GQQA 5ILSA 1OPCA 4S05A 3RYPA 2FNPA 1OR7A 1MD0A 2OAZA 4EJVA 2XIGA 1YG2A 1LNWA 4AIJA 4IHSA 4UVAA 5CYVA 2JTVA 5D6EA 1OKRA 3OV8A 3IWFA 4HF1A 2Z3YA 1IF1A 1D5VA 1T38A 2ZXJA 1SFUA 4XRFA 4O6JA 4IRIA 5D6FA 2V1UA 1WI9A 3HOTA 4Q5SF 4XSZF 2FEZA 3Q9VA 4HDUA 3WTXC 4OIPF 4I7HA 1CGPA 2GWRA 3IC7A 2BYVE 4N9IA 4A0ZA 3B73A 2STTA 5DYMA 2OA4A 4M72A 4HA8A 1BIBA 3JSOA 5HDGA 3Q5FA 2IVMA 3R61A 2CSOA 2P4WA 2P7CB 2ESNA 1XMKA 3HRSA 3IKVA 3I5UA 4EGZA 1YIOA 3LAPA 2L4MA 4G9YA 2XGXA 1BN5A 1ON2A 1QO0D 3VOEA 2YPRA 1B4AA 3JAMK 4UVCA 4NHJA 2Y48A 4HZFA 2R7FA 1SD6A 1O7LA 1IN4A 2A3SA 4ZYDA 5HOOA 1R36A 4IJAA 1RIOH 3ZMZA 1J9IA 4GXOA 3WU1B 4KDPA 1UHMA 4CGZA 4LK1F 4MQVA 2JRTA 2G7UA 4E70A 2IA0A 3M8FA 4GCVA 3F8MA 3KP2A 1KU2A 4EVIA 5DUIA 1D3YA 1LDDA 4PGGA 1ZH5A 3EDPA 1ZGAA 6PAXA 2DBBA 2Z9OA 2HKXA 5E18F 2ELHA 1BC7C 4M9ZA 4H0EA 4A0XA 4AIKA 3PQJA 4U0VA 5BPDA 1X3UA 2BV6A 4HAMA 2Y75A 2AS5F 4PZJA 1O3SA 2P7VB 5DCMA 3LSTA 1IN8A 3TOAA 4RAYA 3E5UA 3H3ZA 3N4MA 3K69A 5LGTA 2MH9A 1YW9A 4EMSA 3TDZC 1U6GA 5A2QK 1QQIA 1DDNA 1USTA 2FNAA 1J59A 2L01A 1UB9A 1EH7A 1BI2A 2CQKA 3M7GA 3E5QA 1FYKA 4U0YA 1FBQA 1O3QA 2K7LA 1FP2A 1IRGA 4KYWA 4B09A 3KP7A 5JVTA 1FYMA 2F5CA 2QLZA 3C18A 2E7WA 4GGGA 4ESBA 4ESJA 1MGTA 2LNBA 1IAWA 4U0WA 3SZPA 4MTDA 3B02A 5JI6A 2HYGD 3RKXA 2VOPA 2VBXA 2V1DA 5DEQA 4BHPA 2M8EA 1DPUA 1J0RA 2QQAA 4S04A 1ONVA 2XHKA 2CGPA 1ZLJA 2DFIA 3F8BA 3MAJA 2QZ8A 4MTEA 3GO5A 3SQNA 5KK1A 1DP7P 1XDUA 4G7HF 1TW2A 3BPXA 2NS0A 1P4WA 5JR3A 2DW4A 3R0AA 2RQPA 2VT2A 1JHFA 1P2FA 3E6BA 3HRMA 3HIFA 2FRHA 3MCZA 2LF8A 3F3XA 1L0OC 4HW0A 3K1NA 2W85A 4ZZLA 2V9VA 1SMYF 3LWFA 1KU9A 3HUGA 4A5NA 2FBHA 2QBYB 3E6DA 3FF5A 3ECHA 2EV5A 2IRFG 1F4KA 1DPRA 3L09A 3FMQA 5J8FA 3TGNA 1PUEE 3FWEA 4EJOA 3WTTC 4L5IA 2VE8A 2GZWA 4KIGA 3VFZA 2MLGA 2XAGA 2DO7A 2E7XA 4HQMA 4JBAA 1IXSB 3WTSC 1HW1A 1Z6RA 2O0YA 4EM1A 3CUQC 3I53A 4HF2A 1T0FA 2KIMA 1TW3A 2L54A 1HXDA 4D0PA 4MQ9F 1JHHA 4EJWA 2HR3A 2HQNA 2BBYA 5L3BA 3BDDA 2QQBA 3HSEA 3GYHX 4LG0B 2B0LA 4RGUA 2HTJA 2QUFA 5D4RA 1ZG3A 3I0TA 3F23A 3ULQB 3GFJA 1ZRFA 2JSCA 3ZP5A 2H09A 5LBQA 2NNYA 2UXXA 4CDGA 1Y0UA 3BOQA 1XSVA 4FT8A 4HF0A 3F8NA 2CYYA 1MJAA 2Y0MA 4ENMA 2V1XA 1XDSA 4ZZDA 1FSEA 1Z7UA 4ZH4F 4TV7A 3SHFA 2PLYA 3ML6A 1GXPA 5DUKA 2M45A 1FWZA 5LRRA 2VONA 1F5TA 3KE2A 4HX7A 2DPUA 3CO6C 2ETHA 4GYIA 1FLIA 4LGWA 2XAJA 2FMYA 3R0JA 2HQRA 2D2WA 3GFIA 1S6LA 1J5YA 2RDPA 1L3LA 2P5LC 3ABTA 3E5XA 2ISYA 2K27A 1XD7A 1G3TA 5D8KB 1U5TA 4WCGA 3MFKA 2BE5F 5DD8A 3K9TA 2NNNA 3RPQA 4KFCA 2GA1A 3VODA 3IL2A 2FE3A 5H6RA 3GWZA 3KETA 3GUDA 1FZPB 4WXCA 3HHGA 4KN4X 5FD5A 2P5VA 2TDXA 3GF2A 5FGMA 4U88A 3AAFA 1I1SA 1QZZA 3ABUA 3WTWC 2W57A 1G3SA 4UHTA 5J6XA 4L0YB 4UV8A 3LQRA 4BAYA 4MNUA 1ZYRF 4ETSA 3RTRA 1I6XA 5DV5A 1PP7U 1G3YA 5LEKA 3I54A 5L3GA 1FT9A 5BPIA 4KN7X 2COMA 4PGHA 5HLIA 4RGRA 1XGNA 2OZUA 3L00A 4O5VA 1SMTA 1K6OA 4RGSA 4WF2A 3TQNA 2EB7A 3TO7A 4AIHA 2W84A 2DI3A 3V8KA 3WU0A 2M1BA 3DQVC 5E1WA 2ESHA 1S7AA 4I0AA 4LLLA 5CVJA 4HLYA 3P7NA 4HLXA 1BC8C 2XASA 3TKYA 2G9WA 4XLNF 4FX0A 3DKWA 3JTGA 1SFEA 2ZKZA 4A6DA 3FMRA 3J80K 3QP6A 3RI4A 4MHGA 3IKTA 2KIUA 4Y15A 1IXCA 3BJOA 3DFGA 1IRFA 3CUQB 4U7DA 2HEOA 1K78B 5ED4A 3GVAA 1OYIA 3ROUA 4HYEA 5HDKA 4CXFA 3WODF 1F9NA 3BPVA 4L9TA 1Z6TA 2PJPA 1R1UA 2ACJA 3J81Z 1FY7A 1KU3A 4ASNA 4RB2C 1ZHFA 2ZMEA 4HDVA 3EYIA 1MJBA 1BM9A 5DDGA 2OD5A 4P55A 2HS5A 3HSFA 5H6QA 1FP1D 1PDNC 5F6FA 1R1VA 3TOBA 3ZQ7A 1AWCA 5HLGA 1HBXG 4ZYGA 2RNJA 3GEZA 4OOIA 3RKYA 5L3DA 2KKOA 5LGUA 3L7WA 4PDKA 2UXNA 4L9JA 1JXSA 1J7KA 3L9FA 4M73A 2J5OA 2E1NA 3KZZA 2O03A 3DXJF 2GXGA 2YSRA 2EFNA 2GIVA 4WK8F 4HX4A 4L9NA 2Q8KA 3V7SA 5D8LB 2A5YB 4EJTA 2PEXA 2EA2A 4B8XA 2A6EF 3P9IA 1Z1DA 2H94A 1K7AA 1WRJA 5KVRA 2Z33A 2F5EA 5ICEA 2LKPA 2H6BA 2OQGA 5FB2A 1E17A 3HTSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RJP A;  4WXD A;  3BJ6 A;  1Z91 A;  1XCV A;  3WTU C;  4LLG F;  3KEQ A;  2P6T A;  5TJJ A;  5CVV A;  5BOX A;  3IWZ A;  2IW5 A;  4A2U A;  1J75 A;  2Z5U A;  3WE2 A;  4A6E A;  4RGX A;  2EA4 A;  3ZMS A;  3KP3 A;  4IRG A;  5FO5 A;  3I59 B;  4HOB A;  5IT9 K;  1ZGJ A;  3KCC A;  2D1H A;  1V3F A;  4YIF A;  4EJU A;  4AWX B;  4Z2Y A;  3QPH A;  5K5R A;  1KGS A;  1HW5 A;  1IUY A;  3J81 K;  3H92 A;  4I01 A;  1FBS A;  4UXN A;  4NQW A;  3O3K A;  2EV6 A;  5JHU A;  1I1G A;  1MDM A;  2ZNY A;  2JPB A;  1CF7 A;  5ICF A;  4CIC A;  4I0B A;  4ZYH A;  4OIR F;  4LG0 A;  2H27 A;  2E1C A;  2WV0 A;  1RNL A;  2CWE A;  2MH2 A;  5FLX Z;  2FSW A;  1D8J A;  4YII A;  2ZBK A;  4EV0 A;  1KQ0 A;  1O3R A;  4Q48 A;  1ZN2 A;  5HS9 A;  2DPD A;  3BY6 A;  1I5Z A;  5HS7 A;  1U2W A;  1BI0 A;  4FX4 A;  5L3C A;  5E1Z B;  2WTE A;  1S8N A;  1FSH A;  1QPM A;  2UWM A;  1ZRD A;  2YX4 A;  5K5O A;  4GYG A;  1SD5 A;  1XGM A;  3BWG A;  1RUN A;  3I59 A;  2F5D A;  5BS6 A;  4A0Y A;  5AIP A;  3TO9 A;  4ON0 A;  4YG2 F;  3U1D A;  5FLX K;  3P9K A;  4K2E A;  3GXO A;  3C3W A;  3HTU A;  1ZAR A;  5ERI A;  1BI1 A;  1FBU A;  1XN7 A;  2FU4 A;  4EM0 B;  3O6B B;  4HV6 A;  1WWX A;  4AD9 A;  1KYZ A;  1OYW A;  4HV5 A;  4WWC A;  1CF7 B;  2QM3 A;  1LJ9 A;  4FHT A;  5J8C A;  2VN2 A;  2DK8 A;  1R5G A;  1W7P A;  1WQ2 A;  4DNC A;  1H0M A;  5DD4 A;  4I98 B;  3F22 A;  1QGP A;  3FM3 A;  5FFX A;  4LK0 F;  2O61 A;  1BIA A;  1HKT A;  5CVU A;  1Z9C A;  2VBW A;  4BXU A;  2ISZ A;  3DV8 A;  3F6V A;  5JFR A;  3OOP A;  2QQ9 A;  1XSX A;  3C1D A;  3FM5 A;  1EH6 A;  1P4A A;  1RI7 A;  5BMZ A;  1V4R A;  3KP6 A;  5EEG A;  5E17 F;  4N0B A;  2M87 A;  2IT0 A;  2HFH A;  2RGV A;  1LEB A;  2DQR A;  4YFK F;  3M8E A;  2XRO A;  1U8R A;  4Q47 A;  2VOD A;  1QNT A;  1OMI A;  5E8I A;  2HDC A;  4MEX F;  4RB1 A;  3WGG A;  1KYW A;  1JE8 A;  2W25 A;  2VE9 A;  2VT3 A;  3QP5 A;  4I02 A;  1GXQ A;  1OYY A;  1SD4 A;  5LLQ A;  1W7P D;  4EQQ A;  3VEP A;  5BQT A;  4KT5 C;  3RYR A;  5D5V B;  1RZ4 A;  2O6G E;  5E8G A;  1W5S A;  2HYF A;  4Y13 A;  1K78 A;  1PP8 F;  2F2E A;  1TNS A;  4OMY A;  1R00 A;  2QVO A;  2PG4 A;  4M9X A;  2DU9 A;  2O3F A;  3T5X A;  4M74 A;  3WGI A;  3R60 A;  1LEA A;  2QEN A;  3LFK A;  2D1V A;  1O57 A;  4MEY F;  3M1E A;  1I27 A;  4G6Q A;  5HVQ C;  5FFZ A;  1J2X A;  2HTS A;  3KP5 A;  1R7J A;  1IN7 A;  4R8H A;  2OBP A;  4U7B A;  2EFQ A;  4P5O A;  1MZB A;  5HDN A;  3IRQ A;  1ZG1 A;  1TNT A;  2NYX A;  5FD6 A;  2XVC A;  2A6H F;  3ZN1 A;  1S29 A;  4BYY A;  1GHC A;  2MA3 A;  5LHH A;  4CHU A;  2F5F A;  2CFX A;  1NHA A;  2XRN A;  3NQO A;  3FXQ A;  5EEH A;  1TQM A;  4LD5 A;  2VC0 A;  1ON1 A;  3BJA A;  5E20 A;  3ZPL A;  5D5W B;  3R6S A;  1TQP A;  3T8R A;  1TQI A;  2R7D A;  1T98 A;  2GA2 A;  5D5X B;  1BOA A;  3K0L A;  1HW2 A;  3FXR A;  2FQ3 A;  2BEO A;  1HKQ A;  4L0Z B;  3V7C A;  3QU3 A;  2RVC A;  3TO6 A;  3NRV A;  2EWN A;  4KUM A;  1H9G A;  3U2R A;  5H20 A;  3E6C C;  1G3W A;  1R22 A;  2K4B A;  3VB2 A;  2A61 A;  1SD7 A;  3SZT A;  4A5M A;  5CVI A;  3JTH A;  2LSO A;  2DLL A;  3CUO A;  3RKW A;  2PQ8 A;  2C6Y A;  1FC3 A;  1B59 A;  5LGN A;  5CJ9 A;  1KQ8 A;  3L2C A;  3ZMV A;  1HST A;  4R1H A;  2EFO A;  3F8C A;  1P6R A;  4LJZ F;  4QLC U;  4OIQ F;  1YO5 C;  3DPL C;  3MWM A;  2XUB A;  3MQ0 A;  2L02 A;  3EET A;  2FML A;  2A69 F;  4R79 A;  2JT1 A;  2NRA C;  4ZYE A;  4P96 A;  1KU7 A;  4UNO A;  3CLO A;  3KZY A;  3SFZ A;  2L4A A;  2J5P A;  2PBI A;  1ZAO A;  1P4X A;  2PMH A;  4LB6 B;  3GZ6 A;  1D8K A;  3RPU A;  5HLH A;  2EK5 A;  2V79 A;  1XMA A;  4KIF A;  1ULY A;  2MLK A;  4JQF A;  1BJA A;  1UFM A;  2VBZ A;  1YYV A;  2ZJ2 A;  2IP2 A;  1TBX A;  1TLH B;  1G4D A;  3TDU C;  2NAZ A;  1TTY A;  3LA7 A;  2VOO A;  2DAO A;  2IJL A;  1IW7 F;  5CLS A;  3D0S A;  2DK5 A;  1LQ1 A;  3JSP A;  4HQE A;  3Q9S A;  1JGS A;  2RN7 A;  4M6X A;  2OZ6 A;  1SFX A;  1FYL A;  4P9U A;  4KMF A;  1XSD A;  2FA5 A;  1KA8 A;  4XSX F;  3W6K B;  3V4G A;  3MEX A;  3MZY A;  2KIF A;  2XKP A;  2K4J A;  4KMU X;  3CDH A;  3F6O A;  5IT3 A;  1ZRE A;  5AON A;  5DCF A;  3I4P A;  3CUQ A;  3I64 A;  2X4H A;  3RIR A;  3F8F A;  4LMY A;  3U9G A;  2R3S A;  1U78 A;  3G3Z A;  4IRH A;  4M71 A;  4UV9 A;  2W24 A;  2A68 F;  2WC2 A;  4BHB A;  4RS8 A;  3E6M A;  2HOE A;  3K1M A;  1GVJ A;  4BQA A;  3GFL A;  2IA1 A;  2YX7 A;  1T39 A;  1MKM A;  1E2X A;  1UHW A;  2VC1 A;  3O2P E;  2DTR A;  4JK1 X;  3HOS A;  4G94 A;  4EGY A;  3F72 A;  3QU6 A;  2XAH A;  2ADU A;  3WE3 A;  3M9A A;  3J7A O;  2MD5 A;  1ZRC A;  1IN6 A;  4ENJ A;  1REP C;  4O3M A;  1YFH A;  3J80 Z;  1B6A A;  1P92 A;  4YFX F;  1LB2 A;  2CW0 F;  3GLX A;  4RAZ A;  1EH8 A;  1YS6 A;  2UZK A;  2HKO A;  2XAF A;  3ERE D;  3REO A;  4L18 B;  4IXA A;  4Y17 A;  2RKH A;  3LQQ A;  3WTZ A;  1W4M A;  1H9T A;  4QWQ A;  4I09 A;  1XGS A;  2KJC A;  4ESF A;  1YQA A;  1YS7 A;  1YW8 A;  3HYI A;  2KRF A;  5ILU A;  3JAM Z;  3H3U A;  1IZ1 A;  3N97 A;  5ICC A;  3I58 A;  2K02 A;  2VBY A;  2BGC A;  1A04 A;  4AVP A;  5LRS A;  4BNC A;  3C7J A;  4L5J A;  3F21 A;  2YU3 A;  1FPQ A;  1Z05 A;  3V7R A;  3KEO A;  4LB5 A;  2HGC A;  2M5W A;  2QBY A;  2O8X A;  2ZO4 A;  2Q2E A;  2HWV A;  5D4S A;  1DUX C;  1UCR A;  2EV0 A;  1WKM A;  2ZFW A;  1HKS A;  1FOK A;  1IN5 A;  5L3F A;  3EYY A;  3FMS A;  3PFI A;  3ZMD A;  1T6S A;  3R4K A;  2GXB A;  3PQK A;  4IF4 A;  1B9N A;  3DPT A;  1W5T A;  3HHH A;  1U3E M;  3LA3 A;  1K79 A;  2P5K A;  2XAQ A;  3E97 A;  5IT9 Z;  2V6C A;  3FZV A;  4M9S A;  2M30 A;  1HQC A;  2A07 F;  1R1T A;  3T1B A;  1FX7 A;  2EJR A;  2ZNZ A;  5E1X A;  3ISP A;  4RB0 A;  1IXR C;  4GO1 A;  3MZH A;  4I2O A;  2LDU A;  1YTY A;  5F1R A;  3LA2 A;  2H6C A;  2AXL A;  4LLN A;  3KFW X;  1U5T C;  5AIQ A;  1R23 A;  4L9V A;  4KIC A;  3BRO A;  1KQ9 A;  3D5L A;  3RDI A;  3CTA A;  3QAH A;  3W6J B;  5D5U B;  2P8T A;  4HX8 A;  2PMU A;  2X0L A;  3KLN A;  3GX4 X;  2XKO A;  4IPA A;  2XV4 S;  4DQ2 A;  4P9F A;  2PI0 A;  3ZMT A;  1ODD A;  3ZN0 A;  1R58 A;  1LDK B;  2CO5 A;  4KIB A;  3I71 A;  3HSR A;  4A12 A;  2GAU A;  2WWY A;  2Q0O A;  2D45 A;  2FBK A;  2L3D A;  1BI3 A;  4M6Y A;  1RUO A;  1U5T B;  1QZY A;  3COA C;  4BHC A;  3GFM A;  4CO8 A;  3T0Y A;  3IRR A;  1XB4 A;  3GZ5 A;  1USS A;  3LAJ A;  3HRT A;  1EV7 A;  5DCM B;  4N9H A;  4OU0 A;  4CYD A;  4BH9 A;  1VTN C;  4HBL A;  2P6S A;  3WG9 A;  2IA2 A;  2HZT A;  4G6D A;  2DT5 A;  5HS8 A;  5LHG A;  4UUV A;  1MDM B;  3S2W A;  3JW4 A;  3ECO A;  2FXA A;  2QWW A;  1STZ A;  2MBF A;  3QRF F;  1Q1H A;  4MGR A;  5LHI A;  2K86 A;  1S3J A;  3QOP A;  1LVA A;  5TRD A;  1F1Z A;  2QYO A;  1W7P B;  1B9M A;  5ILV A;  4G7O F;  2PFB A;  2KJB A;  4XBF A;  3HRU A;  1R5H A;  4IVN A;  2JZY A;  3G73 A;  1BBY A;  4WX9 A;  4G8X A;  5LEJ A;  3K1P A;  1HSJ A;  2JPC A;  3BZ6 A;  4F7Z A;  5CVR A;  1B1B A;  4PCQ A;  4KA4 A;  3EQL F;  1XGO A;  2EFP A;  2STW A;  3WTY C;  4OIO F;  1LDJ A;  1MJ9 A;  2LF7 A;  2ZCW A;  2FOK A;  2OQR A;  1SAX A;  5F64 A;  1C0W A;  3E3V A;  3GW2 A;  4IHT A;  2RC4 A;  1O3T A;  1O7F A;  4WXH A;  2OU2 A;  3BP8 A;  4LFU A;  2YR2 A;  1T2K A;  3EUH A;  3NEU A;  1YLF A;  2IPQ X;  2EFW A;  5A2Q Z;  1YW7 A;  3ELK A;  3K2Z A;  2RV8 A;  4ENK A;  3ZMU A;  4XLP F;  1ZG5 A;  2CG4 A;  5K1Y A;  5L3E A;  5K5Q A;  4Q4Z F;  3V8J A;  2MC3 A;  2FF4 A;  2VXZ A;  3FHZ A;  2PN6 A;  3FX3 A;  4KNY A;  2ZME B;  3WTV C;  3KP4 A;  2Z99 A;  1FNN A;  5ICG A;  4OMZ A;  3CJN A;  3P9C A;  2G7H A;  1G6N A;  4CZZ A;  3IHU A;  3DP7 A;  3DF8 A;  3KLO A;  3CO7 C;  4OIN F;  3T8T A;  3FXU A;  4UVB A;  4RB3 C;  3V8L A;  4YFN F;  3QPT A;  2FBI A;  1S7O A;  1AOY A;  4NB5 A;  1QBJ A;  4ENN A;  4G7Z F;  1XCB A;  3WGH A;  1WSU A;  3DEU A;  4EM2 A;  1ZLK A;  3SXY A;  2DQL A;  2GQQ A;  5ILS A;  1OPC A;  4S05 A;  3RYP A;  2FNP A;  1OR7 A;  1MD0 A;  2OAZ A;  4EJV A;  2XIG A;  1YG2 A;  1LNW A;  4AIJ A;  4IHS A;  4UVA A;  5CYV A;  2JTV A;  5D6E A;  1OKR A;  3OV8 A;  3IWF A;  4HF1 A;  2Z3Y A;  1IF1 A;  1D5V A;  1T38 A;  2ZXJ A;  1SFU A;  4XRF A;  4O6J A;  4IRI A;  5D6F A;  2V1U A;  1WI9 A;  3HOT A;  4Q5S F;  4XSZ F;  2FEZ A;  3Q9V A;  4HDU A;  3WTX C;  4OIP F;  4I7H A;  1CGP A;  2GWR A;  3IC7 A;  2BYV E;  4N9I A;  4A0Z A;  3B73 A;  2STT A;  5DYM A;  2OA4 A;  4M72 A;  4HA8 A;  1BIB A;  3JSO A;  5HDG A;  3Q5F A;  2IVM A;  3R61 A;  2CSO A;  2P4W A;  2P7C B;  2ESN A;  1XMK A;  3HRS A;  3IKV A;  3I5U A;  4EGZ A;  1YIO A;  3LAP A;  2L4M A;  4G9Y A;  2XGX A;  1BN5 A;  1ON2 A;  1QO0 D;  3VOE A;  2YPR A;  1B4A A;  3JAM K;  4UVC A;  4NHJ A;  2Y48 A;  4HZF A;  2R7F A;  1SD6 A;  1O7L A;  1IN4 A;  2A3S A;  4ZYD A;  5HOO A;  1R36 A;  4IJA A;  1RIO H;  3ZMZ A;  1J9I A;  4GXO A;  3WU1 B;  4KDP A;  1UHM A;  4CGZ A;  4LK1 F;  4MQV A;  2JRT A;  2G7U A;  4E70 A;  2IA0 A;  3M8F A;  4GCV A;  3F8M A;  3KP2 A;  1KU2 A;  4EVI A;  5DUI A;  1D3Y A;  1LDD A;  4PGG A;  1ZH5 A;  3EDP A;  1ZGA A;  6PAX A;  2DBB A;  2Z9O A;  2HKX A;  5E18 F;  2ELH A;  1BC7 C;  4M9Z A;  4H0E A;  4A0X A;  4AIK A;  3PQJ A;  4U0V A;  5BPD A;  1X3U A;  2BV6 A;  4HAM A;  2Y75 A;  2AS5 F;  4PZJ A;  1O3S A;  2P7V B;  5DCM A;  3LST A;  1IN8 A;  3TOA A;  4RAY A;  3E5U A;  3H3Z A;  3N4M A;  3K69 A;  5LGT A;  2MH9 A;  1YW9 A;  4EMS A;  3TDZ C;  1U6G A;  5A2Q K;  1QQI A;  1DDN A;  1UST A;  2FNA A;  1J59 A;  2L01 A;  1UB9 A;  1EH7 A;  1BI2 A;  2CQK A;  3M7G A;  3E5Q A;  1FYK A;  4U0Y A;  1FBQ A;  1O3Q A;  2K7L A;  1FP2 A;  1IRG A;  4KYW A;  4B09 A;  3KP7 A;  5JVT A;  1FYM A;  2F5C A;  2QLZ A;  3C18 A;  2E7W A;  4GGG A;  4ESB A;  4ESJ A;  1MGT A;  2LNB A;  1IAW A;  4U0W A;  3SZP A;  4MTD A;  3B02 A;  5JI6 A;  2HYG D;  3RKX A;  2VOP A;  2VBX A;  2V1D A;  5DEQ A;  4BHP A;  2M8E A;  1DPU A;  1J0R A;  2QQA A;  4S04 A;  1ONV A;  2XHK A;  2CGP A;  1ZLJ A;  2DFI A;  3F8B A;  3MAJ A;  2QZ8 A;  4MTE A;  3GO5 A;  3SQN A;  5KK1 A;  1DP7 P;  1XDU A;  4G7H F;  1TW2 A;  3BPX A;  2NS0 A;  1P4W A;  5JR3 A;  2DW4 A;  3R0A A;  2RQP A;  2VT2 A;  1JHF A;  1P2F A;  3E6B A;  3HRM A;  3HIF A;  2FRH A;  3MCZ A;  2LF8 A;  3F3X A;  1L0O C;  4HW0 A;  3K1N A;  2W85 A;  4ZZL A;  2V9V A;  1SMY F;  3LWF A;  1KU9 A;  3HUG A;  4A5N A;  2FBH A;  2QBY B;  3E6D A;  3FF5 A;  3ECH A;  2EV5 A;  2IRF G;  1F4K A;  1DPR A;  3L09 A;  3FMQ A;  5J8F A;  3TGN A;  1PUE E;  3FWE A;  4EJO A;  3WTT C;  4L5I A;  2VE8 A;  2GZW A;  4KIG A;  3VFZ A;  2MLG A;  2XAG A;  2DO7 A;  2E7X A;  4HQM A;  4JBA A;  1IXS B;  3WTS C;  1HW1 A;  1Z6R A;  2O0Y A;  4EM1 A;  3CUQ C;  3I53 A;  4HF2 A;  1T0F A;  2KIM A;  1TW3 A;  2L54 A;  1HXD A;  4D0P A;  4MQ9 F;  1JHH A;  4EJW A;  2HR3 A;  2HQN A;  2BBY A;  5L3B A;  3BDD A;  2QQB A;  3HSE A;  3GYH X;  4LG0 B;  2B0L A;  4RGU A;  2HTJ A;  2QUF A;  5D4R A;  1ZG3 A;  3I0T A;  3F23 A;  3ULQ B;  3GFJ A;  1ZRF A;  2JSC A;  3ZP5 A;  2H09 A;  5LBQ A;  2NNY A;  2UXX A;  4CDG A;  1Y0U A;  3BOQ A;  1XSV A;  4FT8 A;  4HF0 A;  3F8N A;  2CYY A;  1MJA A;  2Y0M A;  4ENM A;  2V1X A;  1XDS A;  4ZZD A;  1FSE A;  1Z7U A;  4ZH4 F;  4TV7 A;  3SHF A;  2PLY A;  3ML6 A;  1GXP A;  5DUK A;  2M45 A;  1FWZ A;  5LRR A;  2VON A;  1F5T A;  3KE2 A;  4HX7 A;  2DPU A;  3CO6 C;  2ETH A;  4GYI A;  1FLI A;  4LGW A;  2XAJ A;  2FMY A;  3R0J A;  2HQR A;  2D2W A;  3GFI A;  1S6L A;  1J5Y A;  2RDP A;  1L3L A;  2P5L C;  3ABT A;  3E5X A;  2ISY A;  2K27 A;  1XD7 A;  1G3T A;  5D8K B;  1U5T A;  4WCG A;  3MFK A;  2BE5 F;  5DD8 A;  3K9T A;  2NNN A;  3RPQ A;  4KFC A;  2GA1 A;  3VOD A;  3IL2 A;  2FE3 A;  5H6R A;  3GWZ A;  3KET A;  3GUD A;  1FZP B;  4WXC A;  3HHG A;  4KN4 X;  5FD5 A;  2P5V A;  2TDX A;  3GF2 A;  5FGM A;  4U88 A;  3AAF A;  1I1S A;  1QZZ A;  3ABU A;  3WTW C;  2W57 A;  1G3S A;  4UHT A;  5J6X A;  4L0Y B;  4UV8 A;  3LQR A;  4BAY A;  4MNU A;  1ZYR F;  4ETS A;  3RTR A;  1I6X A;  5DV5 A;  1PP7 U;  1G3Y A;  5LEK A;  3I54 A;  5L3G A;  1FT9 A;  5BPI A;  4KN7 X;  2COM A;  4PGH A;  5HLI A;  4RGR A;  1XGN A;  2OZU A;  3L00 A;  4O5V A;  1SMT A;  1K6O A;  4RGS A;  4WF2 A;  3TQN A;  2EB7 A;  3TO7 A;  4AIH A;  2W84 A;  2DI3 A;  3V8K A;  3WU0 A;  2M1B A;  3DQV C;  5E1W A;  2ESH A;  1S7A A;  4I0A A;  4LLL A;  5CVJ A;  4HLY A;  3P7N A;  4HLX A;  1BC8 C;  2XAS A;  3TKY A;  2G9W A;  4XLN F;  4FX0 A;  3DKW A;  3JTG A;  1SFE A;  2ZKZ A;  4A6D A;  3FMR A;  3J80 K;  3QP6 A;  3RI4 A;  4MHG A;  3IKT A;  2KIU A;  4Y15 A;  1IXC A;  3BJO A;  3DFG A;  1IRF A;  3CUQ B;  4U7D A;  2HEO A;  1K78 B;  5ED4 A;  3GVA A;  1OYI A;  3ROU A;  4HYE A;  5HDK A;  4CXF A;  3WOD F;  1F9N A;  3BPV A;  4L9T A;  1Z6T A;  2PJP A;  1R1U A;  2ACJ A;  3J81 Z;  1FY7 A;  1KU3 A;  4ASN A;  4RB2 C;  1ZHF A;  2ZME A;  4HDV A;  3EYI A;  1MJB A;  1BM9 A;  5DDG A;  2OD5 A;  4P55 A;  2HS5 A;  3HSF A;  5H6Q A;  1FP1 D;  1PDN C;  5F6F A;  1R1V A;  3TOB A;  3ZQ7 A;  1AWC A;  5HLG A;  1HBX G;  4ZYG A;  2RNJ A;  3GEZ A;  4OOI A;  3RKY A;  5L3D A;  2KKO A;  5LGU A;  3L7W A;  4PDK A;  2UXN A;  4L9J A;  1JXS A;  1J7K A;  3L9F A;  4M73 A;  2J5O A;  2E1N A;  3KZZ A;  2O03 A;  3DXJ F;  2GXG A;  2YSR A;  2EFN A;  2GIV A;  4WK8 F;  4HX4 A;  4L9N A;  2Q8K A;  3V7S A;  5D8L B;  2A5Y B;  4EJT A;  2PEX A;  2EA2 A;  4B8X A;  2A6E F;  3P9I A;  1Z1D A;  2H94 A;  1K7A A;  1WRJ A;  5KVR A;  2Z33 A;  2F5E A;  5ICE A;  2LKP A;  2H6B A;  2OQG A;  5FB2 A;  1E17 A;  3HTS B; 
#chains in the Genus database with same CATH topology
 1HF0 A;  3RJP A;  4WXD A;  3BJ6 A;  1X19 A;  4DW6 A;  1Z91 A;  1YI2 I;  1N78 A;  1XCV A;  1FTT A;  2R7X A;  3E0J B;  4ZDL A;  3WTU C;  4JX5 A;  4BJT A;  2L9V A;  3KIO A;  4LLG F;  2XC7 A;  2EIM H;  3IP4 B;  2VJ4 A;  2P6T A;  3KEQ A;  5TJJ A;  1WJC A;  3OS1 A;  2LVS A;  1X1P A;  5CVV A;  3U1K A;  4J00 A;  2L7M P;  3AG4 H;  5BOX A;  4IHW A;  4GRI A;  1PJR A;  1W5C C;  3IWZ A;  2IW5 A;  3OYE A;  4A2U A;  1J75 A;  2Z5U A;  3E7L A;  1GT0 C;  3WE2 A;  4A6E A;  4RGX A;  3TED A;  3DU6 A;  1UAA A;  5GAH J;  2BW3 A;  1VND A;  2EA4 A;  4RLF A;  3ZMS A;  3ABK H;  4XQF A;  3KP3 A;  4IRG A;  1MND A;  1FOW A;  3FKJ A;  2WAE A;  3I59 B;  2L0K A;  5FO5 A;  3FXK A;  1FEX A;  2GOM A;  4HOB A;  4N4N B;  5IT9 K;  4UB6 C;  2H1K A;  2A6T A;  5FLV A;  1ZGJ A;  3KCC A;  2D1H A;  1V3F A;  4YIF A;  2F48 A;  4EJU A;  4AWX B;  4Z2Y A;  3QPH A;  5K5R A;  1KGS A;  2M2E A;  3PIO F;  1HW5 A;  1IUY A;  2Y69 H;  2XGE A;  3J81 K;  3H92 A;  4I01 A;  2VLA A;  3J7A Y;  1LFU P;  1A6I A;  2NS8 A;  3FXM A;  1FBS A;  4UXN A;  2BY1 A;  4NQW A;  3O3K A;  2EV6 A;  5JHU A;  3OL3 A;  5GP9 A;  1I1G A;  2PMZ A;  1S7E A;  1MDM A;  2DA7 A;  2ZNY A;  5FKN A;  2KQR A;  2JPB A;  3H5R A;  2LLK A;  1CF7 A;  5ICF A;  4CIC A;  1GDT A;  1IG7 A;  1Z77 A;  4I0B A;  4BKX A;  4ZYH A;  4OIR F;  4LG0 A;  2H27 A;  1WJE A;  1HDP A;  1XTA A;  3ZR8 X;  3SYT A;  1D1A A;  3K4M A;  2E1C A;  4E4H A;  3TBI A;  2WV0 A;  1RNL A;  2CWE A;  2MH2 A;  4V2F A;  3RCO A;  2FSW A;  5FLX Z;  4IO9 F;  2OTJ I;  5HLT A;  1D8J A;  3CCQ I;  4YII A;  3DKX A;  2ZBK A;  1VQL I;  4EV0 A;  1KQ0 A;  2E36 A;  1O3R A;  4Q48 A;  5LD2 C;  1ZN2 A;  4J19 A;  5HS9 A;  2KT0 A;  2PJR A;  1A6Q A;  4AC0 A;  2DPD A;  2DT6 A;  2X6W A;  3BY6 A;  1I5Z A;  3CQZ J;  1OQY A;  3BLY A;  2VPR A;  1MIJ A;  5HS7 A;  1U2W A;  5E3L A;  3FHN A;  1BI0 A;  4FX4 A;  5L3C A;  5E1Z B;  2WTE A;  1S8N A;  1FSH A;  3W6V A;  1QPM A;  2HDD A;  2UWM A;  2EQR A;  1OCO H;  1ZRD A;  3C2H A;  2YX4 A;  5K5O A;  3H9G A;  3BTL A;  2ME6 A;  1YIJ I;  3W2A A;  4GYG A;  1RKT A;  4Y7N J;  4PJL A;  1SD5 A;  2DFH A;  1XGM A;  3BWG A;  1RUN A;  4V2G A;  1JKQ C;  2RRE A;  2BW3 B;  5HNF A;  1FMV A;  3I59 A;  3HPH A;  2F5D A;  3ZRG A;  3KYC B;  4A0Y A;  5BS6 A;  5AIP A;  5CQG A;  4PK4 A;  3TO9 A;  4ON0 A;  4YG2 F;  2BVM A;  3CC2 I;  3U1D A;  5FLX K;  3P9K A;  2R5Y B;  4K2E A;  3GXO A;  1GLN A;  3C3W A;  4NDL A;  4IZZ A;  3HTU A;  1ZAR A;  2W4S A;  5ERI A;  1BI1 A;  3OYM A;  1FBU A;  1XN7 A;  2FU4 A;  4NC7 A;  4EM0 B;  4L5E A;  1BR2 A;  5GTH C;  3O6B B;  4HV6 A;  3NWS A;  2JWT A;  4LIV A;  1WWX A;  4AD9 A;  4XRS G;  1KYZ A;  3BG5 A;  1OYW A;  4HV5 A;  4HEA 2;  5F1J A;  2W48 A;  3H35 A;  1D0Y A;  2GIZ A;  4WWC A;  1CF7 B;  4X6A J;  3DU5 A;  2QM3 A;  3HOX J;  3A01 A;  1LJ9 A;  4FHT A;  4BQN A;  5J8C A;  2VN2 A;  3V42 A;  3ZQH A;  2DK8 A;  1R5G A;  1W7P A;  1WQ2 A;  1E3O C;  1N25 A;  4DNC A;  4B4C A;  1OCP A;  1R5I D;  5DD4 A;  4I98 B;  3ZQC A;  1H0M A;  1WCM J;  3F22 A;  1QGP A;  3FM3 A;  2EIL H;  2GXA A;  4D5C A;  5FFX A;  4LK0 F;  2O61 A;  1BIA A;  2HVQ A;  4II3 A;  2LRE A;  4FCY A;  1HKT A;  5J4Y A;  5CVU A;  2R7S A;  3PL8 A;  3FK6 A;  1D0X A;  1Z9C A;  1Z7L A;  3MMY B;  2VBW A;  2DA2 A;  1TL8 A;  4XKW A;  4BXU A;  3KYL A;  3FXJ A;  2ISZ A;  3DV8 A;  3F6V A;  3QYB A;  5FRM A;  1EF4 A;  5JFR A;  9ANT A;  3OOP A;  2QQ9 A;  4BY1 J;  1XSX A;  3C1D A;  1I39 A;  3K4N A;  1YX5 A;  1TWF J;  3FM5 A;  2QKL B;  4ZJZ A;  3DKY A;  4NUB A;  4XLA A;  1IC8 A;  1A5J A;  1EH6 A;  1P4A A;  3BCA A;  4XMY A;  1RI7 A;  5BMZ A;  1V4R A;  3KP6 A;  1LE8 A;  5EEG A;  5E17 F;  4N0B A;  4X0G A;  2M87 A;  2IT0 A;  2HFH A;  1Y56 A;  2RGV A;  1LEB A;  2JUG A;  2HQ5 A;  2DQR A;  4DGW B;  4YFK F;  3M8E A;  4MFD A;  2XRO A;  1U8R A;  2CQQ A;  4Q47 A;  2VOD A;  1R6R A;  1QNT A;  1OMI A;  5H2F C;  3DTK A;  5E8I A;  2HDC A;  2KZG A;  4MEX F;  4RB1 A;  3WGG A;  1KYW A;  5FRO A;  3QPS A;  1JE8 A;  5IP9 J;  2W25 A;  3SDB A;  2VE9 A;  1BW5 A;  2VT3 A;  3QP5 A;  4BE1 A;  3LL7 A;  4KIT B;  1AA7 A;  5EGO B;  4I02 A;  2FD5 A;  2PJR B;  4HRI A;  1GXQ A;  1OYY A;  1SD4 A;  5LLQ A;  2GLO A;  1W7P D;  4FIS A;  1PUF B;  4EQQ A;  3VEP A;  5HOD A;  2I8D A;  5BQT A;  4KT5 C;  4FAS D;  3RYR A;  2XF5 A;  3OL4 A;  5D5V B;  1RZ4 A;  4CCJ A;  5E8G A;  2O6G E;  4BBS J;  1W5S A;  3BT9 A;  2GBY A;  2HYF A;  4Y13 A;  2EPF A;  3I9V 2;  1K78 A;  2TRT A;  2VI6 A;  4AYB A;  1PP8 F;  4H4K C;  4XOT A;  2R7Q A;  2F2E A;  4BL0 B;  2DTZ A;  3S1R J;  2HQA A;  4E7J A;  1GV2 A;  1TNS A;  2IBD A;  4OMY A;  1R00 A;  1JT6 A;  4RDU A;  2QVO A;  2PG4 A;  4M9X A;  2HOA A;  2DU9 A;  2O3F A;  3T5X A;  2DJI A;  1OCC H;  3JRH A;  4M74 A;  3WGI A;  3R60 A;  5E79 C;  1LEA A;  2QEN A;  3LFK A;  2D1V A;  1O57 A;  4DYC A;  4MEY F;  3RKQ A;  3KEY A;  3M1E A;  2AQF A;  1I27 A;  4G6Q A;  5IYB J;  2WAQ N;  1J2X A;  5FFZ A;  5HVQ C;  4U87 A;  3GTM J;  2HTS A;  3KP5 A;  1WJB A;  4UUT A;  3S8P A;  1YJ9 I;  2R5Y A;  1R7J A;  1IN7 A;  4R8H A;  1VF9 A;  2M4K A;  2OBP A;  4U7B A;  2X6X A;  2EFQ A;  3VSL A;  3AL0 B;  3A1Y A;  1D1B A;  2DT7 B;  4P5O A;  2Q1Z B;  1MZB A;  5HDN A;  3IRQ A;  2WY8 Q;  1ZG1 A;  1TNT A;  3BTJ A;  4C3H J;  1FMW A;  2NYX A;  2RNG A;  5FD6 A;  2XVC A;  1SVO A;  2A6H F;  1BA5 A;  3ZN1 A;  2E2I J;  5J1Y A;  1S29 A;  2V4J C;  4BYY A;  2M4G A;  1JTY A;  1V55 H;  1GHC A;  2MA3 A;  5LHH A;  5EYR A;  4IHX A;  5EDN A;  4CHU A;  2F5F A;  2WAD A;  3HPG A;  2CFX A;  1NHA A;  2XRN A;  1ZQ3 P;  3NQO A;  3SFI A;  3Q0W A;  2CUE A;  3FXQ A;  1POG A;  5IOZ A;  1YX3 A;  5EEH A;  1TQM A;  2LG4 A;  2KMU A;  4LD5 A;  5E3O A;  2VC0 A;  3GTO J;  1ON1 A;  1EA3 A;  3BQY A;  3AG2 H;  4LOC A;  1SVM A;  3I4M J;  2E1O A;  3MVP A;  3BJA A;  3HXL A;  5GTI C;  5E20 A;  4B1R A;  2CQN A;  3ZPL A;  1JTX A;  4CCL A;  4KJZ A;  3GTK J;  2LKS A;  3BR2 A;  5C4X J;  5IYC J;  1IV6 A;  5D5W B;  3LSK A;  3R6S A;  1TQP A;  2OV7 A;  3T8R A;  1TQI A;  2R7D A;  1T98 A;  2GA2 A;  5D5X B;  4F91 B;  2EIK H;  1BOA A;  3OY9 A;  2W00 A;  3K0L A;  1Y6I A;  1HW2 A;  3FXR A;  2FQ3 A;  5IP7 J;  2QSH X;  2XF6 A;  3S1N J;  2BEO A;  1HKQ A;  4L0Z B;  3V7C A;  3QU3 A;  3DEE A;  2RVC A;  2ECB A;  3TO6 A;  3NRV A;  2EWN A;  4KUM A;  1H9G A;  3U2R A;  3W2V A;  3PNV A;  4DYR A;  5H20 A;  3PUB A;  1S9H A;  3E6C C;  1S72 I;  2JA5 J;  1G3W A;  4B47 A;  3KX2 A;  3MKL A;  2BY2 A;  3EPZ A;  1R22 A;  3CCE I;  1LPQ A;  2HDW A;  2K4B A;  1I50 J;  3VB2 A;  2A61 A;  3S17 J;  1SD7 A;  3GTG J;  4XLF A;  3SZT A;  5M5Y J;  4Y52 J;  4A5M A;  5CVI A;  4M3D A;  1SAN A;  1BR1 A;  3JTH A;  1WHU A;  2LSO A;  2DLL A;  3CUO A;  3RZO J;  4JX6 A;  2LMD A;  4FE7 A;  4IEJ A;  3BTC A;  3RKW A;  2PQ8 A;  2F5V A;  1FC3 A;  2OF7 A;  2C6Y A;  1BW6 A;  1B59 A;  5LGN A;  5CJ9 A;  2K85 A;  1KQ8 A;  3AKZ A;  1FIA A;  3L2C A;  3ZMV A;  1HST A;  4R1H A;  2DXI A;  2EFO A;  5C44 J;  3F8C A;  3HZJ A;  2E71 A;  1P6R A;  3D5R C;  4LJZ F;  2ZXW H;  3PO2 J;  4QLC U;  3L2V A;  3HOW J;  2DYS H;  4OIQ F;  1R71 A;  1YO5 C;  2QSF X;  3DPL C;  3MWM A;  2XUB A;  3OIO A;  4IQ4 A;  5EZG A;  5F0H A;  3MQ0 A;  2HNH A;  2L02 A;  3EET A;  2FML A;  2WB1 N;  2F4M B;  2A69 F;  4R79 A;  3IV5 A;  4NNJ A;  4NQW B;  1TZL A;  3GLL A;  2JT1 A;  1WJF A;  2NRA C;  1OJL A;  5FKK A;  2LBF B;  4ZYE A;  4P96 A;  1KU7 A;  4UNO A;  3CLO A;  3KZY A;  3SFZ A;  4XKC A;  2L4A A;  1TWH J;  2J5P A;  2PBI A;  1YE9 A;  1ZAO A;  1IDZ A;  3HGY A;  4BAC A;  1P4X A;  3OYK A;  2PMH A;  4RBO A;  4LB6 B;  3GZ6 A;  1D8K A;  3RPU A;  5HLH A;  2EK5 A;  3CLQ A;  2V79 A;  1XMA A;  4C2M J;  5EF6 A;  3S3M A;  4KIF A;  5IPA A;  1WZ2 A;  5JLX A;  1ULY A;  3S2H J;  2MLK A;  3OOU A;  4JQF A;  3OYF A;  1BJA A;  1UFM A;  4HG2 A;  2E5N A;  3MD2 A;  2VBZ A;  1YYV A;  2ZJ2 A;  2IP2 A;  1TBX A;  1TLH B;  2HXI A;  3A2K A;  3CP2 A;  4MIM A;  3TDU C;  3OS2 A;  2DOA A;  2NAZ A;  1G4D A;  1WFX A;  3OYL A;  1TTY A;  1YIT I;  2HPI A;  3LA7 A;  2VOO A;  1RC9 A;  2DAO A;  4W97 A;  2IJL A;  1IW7 F;  2EIJ H;  5CLS A;  2CV2 A;  3D0S A;  4E6K G;  2DK5 A;  1LQ1 A;  3JSP A;  4RMN A;  2G0E A;  3G4S I;  2E2H J;  4FQG A;  4HQE A;  1G8X A;  1A36 A;  2WB1 A;  3Q9S A;  3HL2 A;  1JGS A;  2RN7 A;  3OMY A;  4M6X A;  2OZ6 A;  1SFX A;  1FYL A;  3RPU D;  4JYK A;  3X2Q H;  2K9N A;  1PYV A;  4P9U A;  3CCM I;  4KMF A;  1XSD A;  4M3B A;  3BTI A;  5B3S H;  5EZH A;  4ABZ A;  1QA6 A;  2IGM A;  2FA5 A;  2E35 A;  3S32 A;  1KA8 A;  2BHZ A;  4XSX F;  4ZDP A;  3W6K B;  3V4G A;  3MEX A;  3AL0 C;  3S3O A;  3MZY A;  3L1P A;  3S2D J;  2KIF A;  2XKP A;  2DFE A;  2K4J A;  4KMU X;  5J1R A;  5GPA A;  1HLV A;  2BHY A;  3CDH A;  2HI3 A;  3F6O A;  4IL6 C;  5IT3 A;  1ZRE A;  1K6Y A;  5AON A;  3ZGK A;  2QA4 I;  1RR7 A;  2IGK A;  4LG3 A;  5DCF A;  5F0F A;  3JRD A;  2XRL A;  2VQC A;  3I4P A;  1WJ5 A;  2JRM A;  3G2B A;  3J7Z I;  3GTL J;  2Z16 A;  3OWT A;  3CUQ A;  2F6C A;  3I64 A;  3LNQ A;  1OR7 C;  5JVG F;  2X4H A;  3RIR A;  4E7L A;  2VJI A;  3CES A;  3QPL A;  2MG4 A;  2B9S A;  3DPU A;  3LOC A;  3I56 I;  1WJA A;  3F8F A;  4LMY A;  3U9G A;  2R3S A;  1U78 A;  3I4N J;  2MD0 A;  3ESW B;  3G3Z A;  1QVU A;  4IRH A;  3K70 C;  5FKO A;  4M71 A;  5JLW A;  3JRC A;  1X58 A;  1JKR C;  4UV9 A;  2ZJQ F;  2W24 A;  4AM3 A;  4G12 A;  1MBJ A;  4FE4 A;  2W7N A;  2A68 F;  2P0W A;  2WC2 A;  4BHB A;  4BDY A;  3ZQF A;  1W0U A;  4RS8 A;  3E6M A;  3A0H C;  2HOE A;  1H88 C;  3K1M A;  1NK3 P;  1GVJ A;  1JUS A;  2R4G A;  4BQA A;  3GFL A;  1LFB A;  2IA1 A;  3F9K A;  3CC7 I;  5FRN A;  2YX7 A;  3CD6 I;  1T39 A;  1MKM A;  4EAT A;  1YJN I;  1E2X A;  4UUS B;  1UHW A;  2VC1 A;  2X1E A;  2X6Y A;  3O2P E;  1ENH A;  2BZT A;  2DTR A;  2OJE D;  4JK1 X;  3LSR A;  1V5E A;  3KZI C;  3ZOB A;  3HOS A;  4G94 A;  4EGY A;  3F72 A;  3QU6 A;  2K3P A;  1N75 A;  2XAH A;  1FIP A;  2ADU A;  3AG3 H;  3TMO A;  3WE3 A;  4YIR X;  1R4N B;  3M9A A;  3J7A O;  2MD5 A;  1ZRC A;  1IN6 A;  2JK3 A;  2RQQ A;  3K4K A;  4XR6 A;  4ENJ A;  3CZ6 A;  1REP C;  2NVX J;  4O3M A;  1YFH A;  3J80 Z;  1B6A A;  2XB5 A;  3DLL F;  3M07 A;  1OCZ H;  1P92 A;  1R4M B;  4QPQ A;  4YFX F;  2JA8 J;  1LB2 A;  4RA2 A;  2CW0 F;  3GLX A;  4RAZ A;  1EH8 A;  1XG1 A;  1YS6 A;  2DJN A;  5F27 A;  2UZK A;  2HKO A;  5HNH A;  2FQ4 A;  2XAF A;  3HEF A;  5TIS C;  3ERE D;  2K40 A;  1DU6 A;  2WAQ A;  3REO A;  2QEX I;  4L18 B;  4IXA A;  4A3J J;  2KFD A;  4Y17 A;  2RKH A;  3DLA A;  3LQQ A;  3WTZ A;  1W4M A;  4CSW A;  1H9T A;  4XKB A;  3BG3 A;  4QWQ A;  4I09 A;  1XGS A;  3ZQG A;  1RR8 C;  2KJC A;  4ESF A;  4M3F A;  3ONQ A;  1YQA A;  1YS7 A;  1YW8 A;  3HYI A;  2KRF A;  5ILU A;  3JAM Z;  3NAR A;  3F0C A;  3H3U A;  3VSK A;  1IZ1 A;  3N97 A;  5ICC A;  3I58 A;  3QWL A;  5IYD J;  2K02 A;  2VBY A;  4A3B J;  2NXN B;  2PMZ N;  2BGC A;  1A04 A;  4AVP A;  1VQO I;  5LRS A;  4BNC A;  3C7J A;  4L5J A;  1MH4 A;  4XL9 A;  3P5J A;  3F21 A;  1ZR4 A;  5DM7 F;  1X4O A;  2VKV A;  2R7R A;  3L2W A;  2YU3 A;  5M3F J;  1FPQ A;  2ZJP F;  2CRG A;  2FUG 2;  1UG0 A;  1Z05 A;  3LSH A;  3V7R A;  3KEO A;  2DA6 A;  2NOJ B;  3LSJ A;  4LB5 A;  2HGC A;  2M5W A;  3S3N A;  2QBY A;  2JMW A;  2KZV A;  4CCM A;  3TP0 A;  2O8X A;  3DCF A;  2ZO4 A;  1MSF C;  2L9R A;  2Q2E A;  2MYS A;  2HWV A;  2QQ8 A;  5D4S A;  3OYJ A;  1DUX C;  2LOO A;  3S1M J;  4E7Z A;  4EEF G;  1UCR A;  2EV0 A;  1WKM A;  2ZFW A;  3OS0 A;  1R49 A;  1HKS A;  4XN3 A;  1U8B A;  1FOK A;  1IN5 A;  3CCU I;  5L3F A;  3CCL I;  3EYY A;  2WV1 A;  2AO9 A;  2ID6 A;  3FMS A;  1IV8 A;  2QCO A;  3PFI A;  1YRN A;  3ZMD A;  3MKZ A;  1T6S A;  3I55 I;  3R4K A;  2GXB A;  3PQK A;  4A3C J;  3E1S A;  4IF4 A;  3VYR B;  1B9N A;  3DPT A;  3Q3S A;  4A3E J;  1W5T A;  3HHH A;  2KLO A;  5CQE A;  1U3E M;  3LA3 A;  1EKE A;  1K79 A;  2OCC H;  2P5K A;  2XAQ A;  3E97 A;  3HDD A;  5IT9 Z;  2V6C A;  3FZV A;  4DIQ A;  2KIQ A;  2HVS A;  2QKM B;  4M9S A;  2M30 A;  4RM3 A;  1HQC A;  2V9K A;  2A07 F;  4AID A;  1R1T A;  2EZH A;  3T1B A;  1P7J A;  3H36 A;  1TT0 A;  1FX7 A;  4QPO A;  3OSG A;  3JRF A;  1UJ8 A;  1TWG J;  1Z67 A;  2I5U A;  4X1E A;  2EJR A;  2V26 A;  2ZNZ A;  5E1X A;  4DBQ A;  1F36 A;  2H8W A;  3CJT B;  4XKV A;  1Y1W J;  3ISP A;  1D1C A;  4RB0 A;  1NK2 P;  4BBR J;  1ETQ A;  1IXR C;  4GO1 A;  3GTP J;  3MZH A;  1H89 C;  3CJQ B;  4I2O A;  3BZC A;  2LDU A;  3HB9 A;  1YTY A;  4YEJ A;  2HVR A;  5F1R A;  3VWB A;  2X1C A;  3LA2 A;  4BS9 A;  2H6C A;  2AXL A;  4LLN A;  3KFW X;  1U5T C;  5AIQ A;  5GPC A;  1R23 A;  1IUF A;  4A3G J;  4L9V A;  4KIC A;  3BRO A;  1DU0 A;  1KQ9 A;  3D5L A;  2E5Z A;  3RDI A;  2DMU A;  4BXF A;  2IGO A;  5C4J J;  1JUP A;  4XLE A;  4CH7 A;  3OYC A;  3CTA A;  2LD5 A;  3QAH A;  3W6J B;  3ZXS A;  5D5U B;  2P8T A;  2YS9 A;  1JKP C;  4HX8 A;  2PMU A;  2X0L A;  3H5A A;  3BZK A;  3KLN A;  2AQE A;  4GFB A;  4BXX J;  3G6E I;  3GX4 X;  2XKO A;  4IPA A;  3ZCO A;  1MBE A;  3PFY A;  5M3M J;  3PNT A;  2XV4 S;  4DQ2 A;  4A3L J;  5J1U A;  4P9F A;  2PI0 A;  3ZMT A;  5B1B H;  1VQ4 I;  2VB6 A;  3HM5 A;  1ODD A;  2KDO A;  3HG9 A;  1YHQ I;  4S0H B;  1R58 A;  3ZN0 A;  3BR0 A;  2Y31 A;  3MN2 A;  1CQT A;  1LDK B;  2CO5 A;  2KRC A;  4KIB A;  4RLQ A;  5TGT A;  3I71 A;  3RZD J;  3HSR A;  4A12 A;  2GAU A;  2WWY A;  1T33 A;  2Q0O A;  3FBN B;  2D45 A;  2HZD A;  3AG1 H;  2FBK A;  1AKH A;  2L3D A;  1BI3 A;  4CCK A;  4M6Y A;  2DMQ A;  1RUO A;  1U5T B;  1KZH A;  1QZY A;  1B72 B;  2X9D A;  3COA C;  2M7A A;  2NVQ J;  4HPQ A;  4XM3 A;  3PNY A;  4BHC A;  3GFM A;  4LIT A;  5J4V A;  2DA1 A;  4AVZ A;  4CO8 A;  3T0Y A;  3AFH A;  3IRR A;  1XB4 A;  3GZ5 A;  1USS A;  3LAJ A;  3HRT A;  1EV7 A;  2LTP A;  5DCM B;  1RKW A;  3K6G A;  3QOE A;  3CC4 I;  1D0Z A;  4N9H A;  2DDB A;  4OU0 A;  4CYD A;  4FET A;  4BH9 A;  1VTN C;  3IAM 2;  4HBL A;  4PSX A;  1WPK A;  2P6S A;  3EUH C;  3WG9 A;  3GTJ J;  1MMD A;  4CUG A;  2IA2 A;  2HZT A;  1QU3 A;  1VQP I;  2VQG A;  3WHC A;  4G6D A;  2DMT A;  2CW8 A;  2DT5 A;  2O5R A;  5HS8 A;  5LHG A;  2W82 A;  4UUV A;  3M4O J;  1OFC X;  2VPL A;  2BVL A;  1MDM B;  3S2W A;  2JA6 J;  3JW4 A;  3CDL A;  1ETX A;  3ECO A;  2FXA A;  2LY9 A;  1MMS A;  3IAS 2;  4M6V A;  2QWW A;  1STZ A;  2MBF A;  1A35 A;  4PFP A;  3QRF F;  5FKL A;  1Q1H A;  4MGR A;  5LHI A;  2AHQ A;  2LRD A;  2ZFU A;  2K86 A;  3PIP F;  2CQX A;  3M8J A;  1S3J A;  3QOP A;  1LVA A;  2D5V A;  5TRD A;  1F1Z A;  2QYO A;  1W7P B;  2XDV A;  1B9M A;  2Z1D A;  3Q0U A;  3SEZ A;  5ILV A;  2BY3 A;  4G7O F;  4DZP A;  2PFB A;  2XB0 X;  4XIC A;  2KJB A;  1MBF A;  4XBF A;  1V5G A;  4E7H A;  2MSY A;  4KIS A;  1E0E A;  3HRU A;  1R5H A;  4IVN A;  3A03 A;  4OAZ A;  2JZY A;  3G73 A;  1BBY A;  4WX9 A;  3ASO H;  1ETV A;  1V54 H;  2XPU A;  4G8X A;  5LEJ A;  3K1P A;  1HSJ A;  4XLC A;  2JPC A;  2ME0 A;  4D7N A;  1T0F C;  3BZ6 A;  3J7Y J;  2O8K A;  4BE2 A;  3ERM A;  4F7Z A;  5IY5 H;  3IUO A;  5CVR A;  4C9Y A;  3U21 A;  1B1B A;  4PCQ A;  2DMP A;  2H8R A;  1E3P A;  2XPW A;  2VL8 A;  1LE8 B;  4KA4 A;  2HYJ A;  5EGO A;  3EQL F;  1XGO A;  2EFP A;  1X1B A;  3WTY C;  4I6Z A;  2STW A;  4OIO F;  1LDJ A;  5GAE J;  3GTQ J;  3FBI B;  1MJ9 A;  2LF7 A;  2ZCW A;  2FOK A;  2OQR A;  1SAX A;  5F64 A;  4E7S A;  1SEU A;  4UB8 C;  3MKW B;  1H8A C;  1C0W A;  2I10 A;  3E3V A;  3D5S C;  2L7K A;  3S14 J;  3GW2 A;  3PUF A;  4IHT A;  2RC4 A;  1MBG A;  1O3T A;  1O7F A;  3QQA A;  3BR3 A;  4WXH A;  4PUS A;  2OU2 A;  4XNF A;  3BP8 A;  4LFU A;  2YR2 A;  4BU2 A;  1T2K A;  3EUH A;  1XPX A;  3FIW A;  3QYF A;  3OYH A;  2NVT J;  3NEU A;  1Y1V J;  1YLF A;  2L5Q A;  2IPQ X;  3BG6 A;  2EFW A;  1VQK I;  5A2Q Z;  1YW7 A;  3ELK A;  2Z2S B;  3TW7 A;  5EEA A;  3K2Z A;  2RV8 A;  5CKT A;  2A05 A;  5KAF C;  4ENK A;  3HUG B;  2R93 J;  3SZG A;  2OCE A;  1NG7 A;  3ZMU A;  4GDF A;  4BGD A;  1K4S A;  4XLP F;  1O4X A;  1S5L C;  2CG4 A;  1ZG5 A;  1AU7 A;  5K1Y A;  5FKM A;  4BQO A;  1X2N A;  2R7U A;  1AKH B;  5L3E A;  4RAF A;  5K5Q A;  3L2Q A;  4Q4Z F;  3V8J A;  4A3I J;  4YEL A;  5M5X J;  2VKH A;  2MC3 A;  4Z6Y A;  2FF4 A;  2VXZ A;  1Z3X A;  3FHZ A;  2PN6 A;  2W1O A;  2AXT C;  2R92 J;  3FX3 A;  4KNY A;  2ZME B;  3G1O A;  3LMM A;  3UNG C;  4E7I A;  3WTV C;  3KP4 A;  3B6C A;  4C3J J;  3PO3 J;  2Z99 A;  3OYD A;  1FNN A;  2XGD A;  5ICG A;  4OMZ A;  1LKX A;  3OYG A;  4XRM A;  2VQH A;  3CJN A;  3P9C A;  2G7H A;  1W1W E;  3SEQ A;  2B7E A;  2MFZ A;  3ZQL A;  2XPV A;  1G6N A;  4CZZ A;  2OC6 A;  3IHU A;  3DP7 A;  3JRE A;  1VQ8 I;  1I6H J;  4MO7 A;  3DF8 A;  1OCR H;  1HDD C;  3OYA A;  3LSI A;  3KLO A;  4DBR A;  3CO7 C;  4OIN F;  3HKZ A;  3T8T A;  1QRY A;  3OR2 C;  3FXU A;  4UVB A;  4BY7 J;  4RB3 C;  1SFO J;  4LIU A;  1XC5 A;  3V8L A;  4YFN F;  2EH3 A;  3QPT A;  2CW7 A;  2FBI A;  3CDI A;  1S7O A;  4B3A A;  2ELK A;  1AOY A;  1WJD A;  1VZ0 A;  3DBR B;  2HU9 A;  4NB5 A;  1QVT A;  1QBJ A;  4ENN A;  4G7Z F;  2ECC A;  1QPI A;  3G71 I;  5JHF A;  1XCB A;  3WGH A;  3H0D A;  1WSU A;  4PJM A;  3DEU A;  4EM2 A;  2JQ7 A;  2NOG A;  4JX4 A;  5KNL A;  1ZLK A;  2MW8 A;  3SXY A;  2CS3 A;  2DQL A;  3S1Q J;  4A3K J;  2GQQ A;  2WA0 A;  5ILS A;  2NVU B;  4PJ0 C;  1OPC A;  4S05 A;  2B63 J;  3RYP A;  2FNP A;  2CFO A;  1OR7 A;  3ZQQ A;  4D7M A;  4CYC A;  1MD0 A;  3K70 D;  2OAZ A;  2L7Z A;  4EJV A;  2EIN H;  2XIG A;  4DZJ A;  1YG2 A;  1LNW A;  3I3L A;  4A3F J;  4AIJ A;  1MMA A;  4IHS A;  3CME I;  4UVA A;  5CYV A;  3K10 A;  2JTV A;  1ZK8 A;  3NAU A;  5D6E A;  1OKR A;  4RAG A;  3OV8 A;  2E34 A;  3FXL A;  3IWF A;  4HF1 A;  4F92 B;  2Z3Y A;  3HKZ N;  1IF1 A;  1D5V A;  1T38 A;  2Q2E B;  2ZXJ A;  1SFU A;  3S16 J;  4XRF A;  4O6J A;  3A02 A;  4ZTJ A;  5D6F A;  4IRI A;  5J40 A;  2LKX A;  2V1U A;  2VIX A;  1WI9 A;  2VUM J;  3HOT A;  4BDZ A;  4Q5S F;  2JA7 J;  4XSZ F;  2FEZ A;  3DTE A;  1VI0 A;  1UMQ A;  1RET A;  1NG6 A;  3TW6 A;  2YU9 J;  3Q0V A;  3Q9V A;  4CA0 A;  3FIS A;  4HDU A;  3CMM A;  3WTX C;  4OIP F;  2WAF A;  3MKY B;  4A3M J;  2M7B A;  1E3H A;  4I7H A;  1CGP A;  2M9H A;  2GWR A;  2IAI A;  2E19 A;  3M3Y J;  3IC7 A;  2BYV E;  4A93 J;  2ZSI B;  4N9I A;  3BG7 A;  1FTZ A;  1JUM A;  4B43 A;  3PM1 A;  4A0Z A;  4XLH A;  3B73 A;  2STT A;  5DYM A;  1ITY A;  2OA4 A;  4M72 A;  1G59 A;  1Z21 A;  4HA8 A;  5F04 A;  1BIB A;  3JSO A;  2EBI A;  3K4C A;  2E2J J;  5HDG A;  3Q5F A;  3HOV J;  1X1A A;  2IVM A;  3H9Q A;  3R61 A;  2CSO A;  2P4W A;  2P7C B;  1X4P A;  1XMK A;  2ESN A;  4DOZ A;  4I76 A;  3EUK L;  5BNG A;  3HRS A;  3IKV A;  3I5U A;  2KPM A;  3JRI A;  4P1W A;  2M34 A;  4EGZ A;  2ZXI A;  1YIO A;  1K83 J;  3VYS B;  3LAP A;  1BL0 A;  2L4M A;  1X2M A;  4G9Y A;  3JRB A;  2XGX A;  1BN5 A;  1ON2 A;  1B8I B;  1QO0 D;  3VOE A;  1SAU A;  2YPR A;  4A3D J;  1B4A A;  3JAM K;  4QTR A;  4UVC A;  2Y48 A;  4HZF A;  4NHJ A;  2R7F A;  1SD6 A;  2X1D A;  1O7L A;  1IN4 A;  2A3S A;  1Z0X A;  2V1N A;  4BQQ A;  4ZYD A;  5HOO A;  1R36 A;  4IJA A;  1RIO H;  4B44 A;  3L2U A;  1Y0N A;  3ZMZ A;  1J9I A;  4GXO A;  2NS7 A;  2K3F A;  3WU1 B;  3CMA I;  2LP0 A;  4KDP A;  1UHM A;  4MQV A;  4LK1 F;  4CGZ A;  2JRT A;  5B66 C;  2G7U A;  4Y4R A;  4AUX A;  4E70 A;  1XS9 A;  2CUJ A;  4BEH B;  2IA0 A;  3M8F A;  2MGQ A;  4GCV A;  3F8M A;  1OLT A;  4HNV A;  3KP2 A;  2M0M A;  1KU2 A;  2K9L A;  3HBL A;  4EVI A;  5DUI A;  4ZC3 A;  1D3Y A;  1IDY A;  1X3W B;  2M8G X;  1JKO C;  1LDD A;  4PGG A;  2F4I A;  1ZH5 A;  1I3A A;  2V9P A;  1ZGA A;  3EDP A;  6PAX A;  1VQ5 I;  4ZYA A;  2DBB A;  2VKD A;  2Z9O A;  1J09 A;  3GZN B;  2HKX A;  2JSP A;  5E18 F;  2JUC A;  3IH4 A;  2ELH A;  3K2A A;  1BC7 C;  2ZME C;  2CQ7 A;  4M9Z A;  2L7F P;  1MBH A;  4H0E A;  4A0X A;  4AIK A;  2M0C A;  3PQJ A;  3CCV I;  2R7T A;  4U0V A;  5BPD A;  1X3U A;  1TT5 B;  3FDY A;  2K9Q A;  2DDA A;  2FX0 A;  3BQZ A;  2BV6 A;  4HAM A;  2Y75 A;  2AS5 F;  1APL C;  1VQ6 I;  3N05 A;  4PZJ A;  1O3S A;  2P7V B;  1QZE A;  5DCM A;  3LST A;  4F3Q A;  1IN8 A;  1OIS A;  2KHM A;  4RAY A;  3TOA A;  3HC7 A;  3HOY J;  4BJ5 C;  3H3V K;  3E5U A;  3H3Z A;  3N4M A;  3GBG A;  1HA8 A;  3K69 A;  2DOF A;  2LY2 A;  1MSE C;  5LGT A;  1JJ6 C;  3KPH A;  3W3C A;  3B6A A;  2DA5 A;  2MH9 A;  1YW9 A;  4C2U A;  4EMS A;  3TDZ C;  3BR5 A;  1U6G A;  1X1C A;  2DN0 A;  3VPR A;  2KL4 A;  3DBL B;  2RAE A;  5A2Q K;  1QQI A;  1RRJ A;  1T8I A;  1DDN A;  1UST A;  2FNA A;  1J59 A;  4PJJ A;  1UEL B;  2L01 A;  1GV5 A;  1UB9 A;  4XRS A;  1SC7 A;  3H5N A;  1EH7 A;  1BI2 A;  2CQK A;  3M7G A;  1T95 A;  3E5Q A;  2ZC2 A;  4U0Y A;  1FYK A;  2R7Z J;  1FBQ A;  4OAY A;  1O3Q A;  2K7L A;  1FP2 A;  1IRG A;  2HXO A;  4KYW A;  3RSN A;  4B09 A;  3KP7 A;  2JVH A;  5JVT A;  2R7V A;  1FYM A;  2F5C A;  2QLZ A;  2R7O A;  3C18 A;  3HOU J;  4B3X A;  2E7W A;  3O8G A;  4GGG A;  4ESB A;  2DOE A;  1K4T A;  4ESJ A;  4NC8 A;  4IHY A;  1WI3 A;  4II2 A;  2R5Z A;  1MGT A;  1MNE A;  1PVE A;  2LNB A;  2XGC A;  1UZC A;  1NH3 A;  1IAW A;  1FJL A;  4U0W A;  3PSI A;  2EZK A;  3SJM A;  4DYQ A;  4FTH A;  3SZP A;  2M3A A;  4MTD A;  4CCO A;  3B02 A;  5JI6 A;  1MBK A;  2HYG D;  3RKX A;  1HC8 A;  3CP8 A;  3HJE A;  1Y39 A;  2VOP A;  2LY1 A;  5K7Z A;  3CF5 F;  3K4J A;  2VBX A;  2V1D A;  5DEQ A;  4BHP A;  2M8E A;  1DPU A;  1J0R A;  2QQA A;  3H9J A;  3VYU B;  2QGU A;  1VFC A;  2BXZ A;  3OYN A;  1ETY A;  4S04 A;  1ONV A;  2XHK A;  2P81 A;  2CGP A;  2WY7 Q;  3DEW A;  1ZLJ A;  5F08 A;  1Z3Y A;  2DFI A;  5LFA A;  3NWT A;  3FK7 A;  4UY8 I;  2VXD A;  3F8B A;  1N77 A;  4IQJ A;  3MAJ A;  3TP3 A;  2X6O A;  2QZ8 A;  4PSW A;  4MTE A;  2HPM A;  5C3E J;  4XOP A;  3GO5 A;  3SQN A;  2ID3 A;  1SFK A;  4M3E A;  5KK1 A;  3TL4 X;  1DP7 P;  1XDU A;  4JOM A;  1Y8R B;  2ICW G;  3G1M A;  4MFE A;  5FLM J;  4G7H F;  2CV1 A;  1XMX A;  4V19 K;  1TW2 A;  3BPX A;  2NS0 A;  1P4W A;  5JR3 A;  4ZDO A;  2DW4 A;  1QHH D;  3R0A A;  5EJC A;  2DOD A;  2BXY A;  2RQP A;  4QSH A;  1VQM I;  1P9Q C;  1UG2 A;  2EZL A;  2VT2 A;  3ZQI A;  1JHF A;  1P2F A;  2JJ7 A;  3E6B A;  3HRM A;  3HIF A;  2FRH A;  2K5C A;  3MCZ A;  2LF8 A;  1DGR M;  4HNU A;  1WGX A;  3F3X A;  1L0O C;  4BJ6 C;  1X3Z B;  4HW0 A;  3K1N A;  2E1M B;  2W85 A;  2F4O B;  2OPT A;  2BOL A;  1TWC J;  2XF7 A;  3K4B A;  4ZZL A;  2KP6 A;  1ACI A;  2V9V A;  4C2T A;  1SMY F;  3LWF A;  1KU9 A;  3HUG A;  3IH3 A;  1JT0 A;  2O9L A;  4C3I J;  4A5N A;  3S15 J;  2FBH A;  2GOX B;  3RQI A;  2QBY B;  3E6D A;  3LSP A;  4XID A;  2XSJ C;  3FF5 A;  3ECH A;  2EV5 A;  1G2H A;  1YOV B;  2IRF G;  2FJ1 A;  3GCM A;  4CZC A;  2IS4 A;  1F4K A;  1DPR A;  1IRX A;  2Y9Y A;  1GVD A;  5E3N A;  3L09 A;  4OWR B;  3M1C A;  1U9O A;  3FMQ A;  1U0J A;  2IS2 A;  5J8F A;  3TGN A;  3JR9 A;  1PUE E;  1EJ9 A;  3FWE A;  5B5E C;  3K7A J;  4EJO A;  1TWA J;  3WTT C;  4L5I A;  4I99 C;  2KRH A;  2X85 A;  2CUZ A;  4XK4 A;  2VE8 A;  2GZW A;  3OIP A;  4KIG A;  3VFZ A;  3L2R A;  2MLG A;  2XAG A;  1W36 D;  1YRN B;  2HOS A;  2BY0 A;  2DO7 A;  3BC8 A;  2E7X A;  1ETO A;  4HQM A;  4JBA A;  1IXS B;  4HNT A;  3WTS C;  1HW1 A;  1Z6R A;  1TP4 A;  2O0Y A;  4EM1 A;  3CF2 A;  3CUQ C;  3I53 A;  4XN0 A;  4F52 A;  1T0F A;  4HF2 A;  2KIM A;  1TW3 A;  4PJN A;  1TC3 C;  2L54 A;  3UR3 C;  1DP3 A;  1HXD A;  1LVK A;  4D0P A;  2E60 A;  3JCU C;  4MQ9 F;  1JHH A;  2COB A;  2LBF A;  2LH9 A;  4EJW A;  2VQL A;  2L2O A;  2HR3 A;  1HCR A;  2HQN A;  3G1L A;  2BBY A;  4CCN A;  3HGG A;  5L3B A;  3BDD A;  2QQB A;  3HSE A;  3GYH X;  4LG0 B;  2B0L A;  1KON A;  2CUF A;  4RGU A;  2HTJ A;  4AYB N;  2R7W A;  2R0Q C;  2MC4 A;  2QUF A;  5D4R A;  2V7F A;  1ZG3 A;  4KT6 A;  1FOY A;  1NTC A;  3I0T A;  1BR4 A;  1X1D A;  3OSF A;  3F23 A;  3ULQ B;  2R5Z B;  3GFJ A;  1ZRF A;  2VJ5 A;  2JSC A;  3ZP5 A;  2H09 A;  5LBQ A;  2NNY A;  2UXX A;  3BCB A;  3BR1 A;  5FJ8 J;  4CDG A;  1BOB A;  1UHS A;  3W2W A;  1Y0U A;  2Y0S N;  1XSV A;  1GUU A;  3BOQ A;  2ZJR F;  4FT8 A;  4HF0 A;  2QF7 A;  3F8N A;  4DJA A;  3OYI A;  2CYY A;  3K4L A;  1MJA A;  2Y0M A;  1IO2 A;  4ENM A;  2V1X A;  1I3Q J;  2UV1 A;  1XDS A;  4ZZD A;  4XON A;  3CCJ I;  1FSE A;  1ZEL A;  3ABM H;  1Z7U A;  2CMP A;  4ZH4 F;  4TV7 A;  3SHF A;  2PLY A;  2DMN A;  2LFB A;  3ML6 A;  4Y3O A;  1GXP A;  5DUK A;  1W36 C;  2FOW A;  2M45 A;  1FWZ A;  1ZTR A;  5LRR A;  1R9T J;  2VON A;  1Q1V A;  1VQ9 I;  1F5T A;  3H1C A;  1DQU A;  3FXO A;  3KE2 A;  4HX7 A;  2DPU A;  3CO6 C;  2ETH A;  4GYI A;  1FLI A;  4LGW A;  2XAJ A;  2FMY A;  2Y30 A;  4YRV A;  3R0J A;  3FKI J;  2HQR A;  3OR1 C;  2D2W A;  3GFI A;  4F55 A;  5KHD A;  1VQN I;  1S6L A;  1IRZ A;  2L9S A;  1J5Y A;  3CCY A;  1MNM C;  2RDP A;  1RES A;  1L3L A;  2LK2 A;  2P5L C;  3ABT A;  3CCS I;  3E5X A;  2XSD C;  3CMY A;  3UKG A;  2WBM A;  2K27 A;  2ISY A;  1XD7 A;  1G3T A;  5D8K B;  1VQ7 I;  2VAS A;  2ZB9 A;  1U5T A;  2N8G A;  4WCG A;  3MFK A;  2CU7 A;  1U9N A;  4G6T B;  2Y0S A;  4Y33 A;  2BE5 F;  5DD8 A;  1LUJ B;  3K9T A;  2NNN A;  3LFU A;  3RPQ A;  1RPW A;  4AU7 A;  1QHG A;  4KFC A;  2GA1 A;  1YJW I;  3VOD A;  3IL2 A;  2FE3 A;  5KCM A;  3DTI A;  5H6R A;  3QYE A;  3GWZ A;  4A69 C;  3QOD A;  3KET A;  3GUD A;  2CH0 A;  2CJJ A;  2K9M A;  1FZP B;  2YUS A;  4WXC A;  3HHG A;  3EUA A;  1ORK A;  2EZI A;  5CPR B;  4KN4 X;  3ABL H;  5FD5 A;  2P5V A;  2TDX A;  3A01 B;  3GF2 A;  5J47 A;  5FGM A;  4D5F A;  4U88 A;  3AAF A;  1DGW Y;  4B48 A;  3C2G A;  1I1S A;  1QZZ A;  3ABU A;  2IGN A;  3A0B C;  2W57 A;  3WTW C;  5EG0 B;  1W0T A;  1G3S A;  4UHT A;  5J6X A;  4L0Y B;  2NVY J;  2Y9Z A;  4UV8 A;  1SVL A;  3LQR A;  2DA3 A;  2HOT A;  1P7I A;  4BAY A;  4MNU A;  1B8I A;  1BJZ A;  3IH2 A;  1ZYR F;  3O8H A;  4XOR A;  4ETS A;  4QIW N;  3RTR A;  1I6X A;  4ANJ A;  5DV5 A;  2CV0 A;  1PP7 U;  1G3Y A;  2DFF A;  2KDZ A;  5LEK A;  4E7K A;  2L9N A;  3I54 A;  5L3G A;  4JP0 A;  1FT9 A;  1F43 A;  2OUM A;  3RQ4 A;  5BPI A;  4KN7 X;  2E1M C;  2COM A;  4HST A;  4PGH A;  2LYC A;  5DS9 A;  4IX7 A;  2ZXH A;  5HLI A;  4RGR A;  1XGN A;  3D1N I;  2OZU A;  1Y8Q B;  3L00 A;  1JGG A;  4O5V A;  2K9S A;  2X51 A;  1SMT A;  4BEH A;  1K6O A;  4RGS A;  4WF2 A;  3TQN A;  2EB7 A;  4MLO A;  5M5W J;  5B1A H;  3TO7 A;  4AIH A;  2W84 A;  2DI3 A;  3LSG A;  1M1E B;  3V8K A;  3WU0 A;  2M1B A;  3DQV C;  5E1W A;  2ESH A;  1ETK A;  2V6E A;  4IHV A;  1S7A A;  4I0A A;  1HOM A;  4LLL A;  5CVJ A;  4HLY A;  2H1L A;  5E3M A;  3P7N A;  4HLX A;  1BC8 C;  2XAS A;  2IXS A;  1ERD A;  3TKY A;  2G9W A;  4N4O B;  2PX9 A;  4XLN F;  4M3G A;  4IOC F;  1ZKG A;  4FX0 A;  4F93 B;  2JVG A;  3DKW A;  3JTG A;  3LSM A;  3DWL E;  2XAU A;  1SFE A;  2ZKZ A;  1A31 A;  4A6D A;  3FMR A;  1WVR A;  3J80 K;  3QP6 A;  3RI4 A;  1PUF A;  3JRA A;  4NBQ A;  3GME A;  4MHG A;  3IKT A;  1B72 A;  3MZ8 A;  2KIU A;  2JA2 A;  4Y15 A;  2MAB A;  4BE0 A;  1IXC A;  3BJO A;  3BR6 A;  3DFG A;  1MH3 A;  3WG7 H;  1JI8 A;  3PJR A;  1IRF A;  3CUQ B;  4J01 A;  2IS6 A;  2QSG X;  4U7D A;  2HEO A;  1K78 B;  5ED4 A;  3GVA A;  2IEK A;  5GAG J;  1OYI A;  4CYC B;  3ROU A;  4HYE A;  3A4C A;  2ZSH B;  5HDK A;  4CXF A;  3WOD F;  1F9N A;  3BPV A;  4L9T A;  4D1Q A;  1Z6T A;  1IJW C;  5J3L A;  4D9J A;  5IP6 A;  2PJP A;  1R1U A;  5K7H A;  5K7F A;  2ACJ A;  3BG9 A;  5GAD J;  3J81 Z;  1FY7 A;  3CJR B;  1ZGW A;  1KU3 A;  4ASN A;  1WH7 A;  4RB2 C;  1T08 B;  1MW7 A;  1ZHF A;  2DYR H;  2ZME A;  1LFP A;  3PSF A;  4HDV A;  3EYI A;  1MJB A;  1BM9 A;  3VYT B;  3H0G J;  2OD5 A;  5DDG A;  4P55 A;  2HS5 A;  3HSF A;  5H6Q A;  2JN6 A;  5DM6 F;  1FP1 D;  2O7O A;  1PDN C;  2TCT A;  1MMN A;  1T56 A;  1R1V A;  5F6F A;  3TOB A;  3ZQ7 A;  1AWC A;  5HLG A;  3JRG A;  3ASN H;  3WHB A;  1HBX G;  3OIQ A;  3SDG A;  4ZYG A;  2RNJ A;  3GEZ A;  2OTL I;  2KIS A;  2VJJ A;  3OYB A;  4OOI A;  3RKY A;  5L3D A;  4ZTF A;  1XX5 A;  2X48 A;  5F0C A;  2KKO A;  5LGU A;  3L7W A;  3WU2 C;  4PDK A;  1MMG A;  4UUS A;  2UXN A;  4L9J A;  1JXS A;  1J7K A;  3L9F A;  4M73 A;  1V5F A;  2J5O A;  1D5Y A;  1OCT C;  3KYD B;  2E1N A;  4PFO A;  3KZZ A;  4C30 A;  2O03 A;  3DXJ F;  2GXG A;  2YSR A;  3CCR I;  1WH5 A;  2ELJ A;  2EFN A;  5KAI C;  2GIV A;  2LC2 A;  4WK8 F;  3VDX A;  4HX4 A;  4L9N A;  3S93 A;  5EG0 A;  4IOA F;  2LR8 A;  2VKE A;  2Q8K A;  3V7S A;  5D8L B;  2A5Y B;  4W1U A;  4EJT A;  2PEX A;  2GM4 A;  4HSR A;  2EA2 A;  2DA4 A;  2A5W A;  4ITV A;  5IOY A;  1JJ8 C;  2IS1 A;  4B8X A;  1ZR2 A;  2A6E F;  3P9I A;  1FOX A;  4NC6 A;  3HOZ J;  3C2B A;  1Z1D A;  1IGN A;  2H94 A;  1K7A A;  1WRJ A;  1ETW A;  5KVR A;  2Z33 A;  4IKF A;  2F5E A;  5ICE A;  2LKP A;  1K61 A;  2H6B A;  3DBH B;  2OQG A;  2Y2Z A;  5FB2 A;  2UUZ A;  1AHD P;  4BUP A;  4RM2 A;  5DTD A;  1E17 A;  3HTS B;  2DCE A; 
#chains in the Genus database with same CATH homology
 3RJP A;  4WXD A;  3BJ6 A;  1Z91 A;  1XCV A;  3WTU C;  4LLG F;  3KEQ A;  2P6T A;  5TJJ A;  5CVV A;  5BOX A;  3IWZ A;  2IW5 A;  4A2U A;  1J75 A;  2Z5U A;  3WE2 A;  4A6E A;  4RGX A;  2EA4 A;  3ZMS A;  3KP3 A;  4IRG A;  5FO5 A;  3I59 B;  4HOB A;  5IT9 K;  1ZGJ A;  3KCC A;  2D1H A;  1V3F A;  4YIF A;  4EJU A;  4AWX B;  4Z2Y A;  3QPH A;  5K5R A;  1KGS A;  1HW5 A;  1IUY A;  3J81 K;  3H92 A;  4I01 A;  1FBS A;  4UXN A;  4NQW A;  3O3K A;  2EV6 A;  5JHU A;  1I1G A;  1MDM A;  2ZNY A;  2JPB A;  1CF7 A;  5ICF A;  4CIC A;  4I0B A;  4ZYH A;  4OIR F;  4LG0 A;  2H27 A;  2E1C A;  2WV0 A;  1RNL A;  2CWE A;  2MH2 A;  5FLX Z;  2FSW A;  1D8J A;  4YII A;  2ZBK A;  4EV0 A;  1KQ0 A;  1O3R A;  4Q48 A;  1ZN2 A;  5HS9 A;  2DPD A;  3BY6 A;  1I5Z A;  5HS7 A;  1U2W A;  1BI0 A;  4FX4 A;  5L3C A;  5E1Z B;  2WTE A;  1S8N A;  1FSH A;  1QPM A;  2UWM A;  1ZRD A;  2YX4 A;  5K5O A;  4GYG A;  1SD5 A;  1XGM A;  3BWG A;  1RUN A;  3I59 A;  2F5D A;  5BS6 A;  4A0Y A;  5AIP A;  3TO9 A;  4ON0 A;  4YG2 F;  3U1D A;  5FLX K;  3P9K A;  4K2E A;  3GXO A;  3C3W A;  3HTU A;  1ZAR A;  5ERI A;  1BI1 A;  1FBU A;  1XN7 A;  2FU4 A;  4EM0 B;  3O6B B;  4HV6 A;  1WWX A;  4AD9 A;  1KYZ A;  1OYW A;  4HV5 A;  4WWC A;  1CF7 B;  2QM3 A;  1LJ9 A;  4FHT A;  5J8C A;  2VN2 A;  2DK8 A;  1R5G A;  1W7P A;  1WQ2 A;  4DNC A;  1H0M A;  5DD4 A;  4I98 B;  3F22 A;  1QGP A;  3FM3 A;  5FFX A;  4LK0 F;  2O61 A;  1BIA A;  1HKT A;  5CVU A;  1Z9C A;  2VBW A;  4BXU A;  2ISZ A;  3DV8 A;  3F6V A;  5JFR A;  3OOP A;  2QQ9 A;  1XSX A;  3C1D A;  3FM5 A;  1EH6 A;  1P4A A;  1RI7 A;  5BMZ A;  1V4R A;  3KP6 A;  5EEG A;  5E17 F;  4N0B A;  2M87 A;  2IT0 A;  2HFH A;  2RGV A;  1LEB A;  2DQR A;  4YFK F;  3M8E A;  2XRO A;  1U8R A;  4Q47 A;  2VOD A;  1QNT A;  1OMI A;  5E8I A;  2HDC A;  4MEX F;  4RB1 A;  3WGG A;  1KYW A;  1JE8 A;  2W25 A;  2VE9 A;  2VT3 A;  3QP5 A;  4I02 A;  1GXQ A;  1OYY A;  1SD4 A;  5LLQ A;  1W7P D;  4EQQ A;  3VEP A;  5BQT A;  4KT5 C;  3RYR A;  5D5V B;  1RZ4 A;  2O6G E;  5E8G A;  1W5S A;  2HYF A;  4Y13 A;  1K78 A;  1PP8 F;  2F2E A;  1TNS A;  4OMY A;  1R00 A;  2QVO A;  2PG4 A;  4M9X A;  2DU9 A;  2O3F A;  3T5X A;  4M74 A;  3WGI A;  3R60 A;  1LEA A;  2QEN A;  3LFK A;  2D1V A;  1O57 A;  4MEY F;  3M1E A;  1I27 A;  4G6Q A;  5HVQ C;  5FFZ A;  1J2X A;  2HTS A;  3KP5 A;  1R7J A;  1IN7 A;  4R8H A;  2OBP A;  4U7B A;  2EFQ A;  4P5O A;  1MZB A;  5HDN A;  3IRQ A;  1ZG1 A;  1TNT A;  2NYX A;  5FD6 A;  2XVC A;  2A6H F;  3ZN1 A;  1S29 A;  4BYY A;  1GHC A;  2MA3 A;  5LHH A;  4CHU A;  2F5F A;  2CFX A;  1NHA A;  2XRN A;  3NQO A;  3FXQ A;  5EEH A;  1TQM A;  4LD5 A;  2VC0 A;  1ON1 A;  3BJA A;  5E20 A;  3ZPL A;  5D5W B;  3R6S A;  1TQP A;  3T8R A;  1TQI A;  2R7D A;  1T98 A;  2GA2 A;  5D5X B;  1BOA A;  3K0L A;  1HW2 A;  3FXR A;  2FQ3 A;  2BEO A;  1HKQ A;  4L0Z B;  3V7C A;  3QU3 A;  2RVC A;  3TO6 A;  3NRV A;  2EWN A;  4KUM A;  1H9G A;  3U2R A;  5H20 A;  3E6C C;  1G3W A;  1R22 A;  2K4B A;  3VB2 A;  2A61 A;  1SD7 A;  3SZT A;  4A5M A;  5CVI A;  3JTH A;  2LSO A;  2DLL A;  3CUO A;  3RKW A;  2PQ8 A;  2C6Y A;  1FC3 A;  1B59 A;  5LGN A;  5CJ9 A;  1KQ8 A;  3L2C A;  3ZMV A;  1HST A;  4R1H A;  2EFO A;  3F8C A;  1P6R A;  4LJZ F;  4QLC U;  4OIQ F;  1YO5 C;  3DPL C;  3MWM A;  2XUB A;  3MQ0 A;  2L02 A;  3EET A;  2FML A;  2A69 F;  4R79 A;  2JT1 A;  2NRA C;  4ZYE A;  4P96 A;  1KU7 A;  4UNO A;  3CLO A;  3KZY A;  3SFZ A;  2L4A A;  2J5P A;  2PBI A;  1ZAO A;  1P4X A;  2PMH A;  4LB6 B;  3GZ6 A;  1D8K A;  3RPU A;  5HLH A;  2EK5 A;  2V79 A;  1XMA A;  4KIF A;  1ULY A;  2MLK A;  4JQF A;  1BJA A;  1UFM A;  2VBZ A;  1YYV A;  2ZJ2 A;  2IP2 A;  1TBX A;  1TLH B;  1G4D A;  3TDU C;  2NAZ A;  1TTY A;  3LA7 A;  2VOO A;  2DAO A;  2IJL A;  1IW7 F;  5CLS A;  3D0S A;  2DK5 A;  1LQ1 A;  3JSP A;  4HQE A;  3Q9S A;  1JGS A;  2RN7 A;  4M6X A;  2OZ6 A;  1SFX A;  1FYL A;  4P9U A;  4KMF A;  1XSD A;  2FA5 A;  1KA8 A;  4XSX F;  3W6K B;  3V4G A;  3MEX A;  3MZY A;  2KIF A;  2XKP A;  2K4J A;  4KMU X;  3CDH A;  3F6O A;  5IT3 A;  1ZRE A;  5AON A;  5DCF A;  3I4P A;  3CUQ A;  3I64 A;  2X4H A;  3RIR A;  3F8F A;  4LMY A;  3U9G A;  2R3S A;  1U78 A;  3G3Z A;  4IRH A;  4M71 A;  4UV9 A;  2W24 A;  2A68 F;  2WC2 A;  4BHB A;  4RS8 A;  3E6M A;  2HOE A;  3K1M A;  1GVJ A;  4BQA A;  3GFL A;  2IA1 A;  2YX7 A;  1T39 A;  1MKM A;  1E2X A;  1UHW A;  2VC1 A;  3O2P E;  2DTR A;  4JK1 X;  3HOS A;  4G94 A;  4EGY A;  3F72 A;  3QU6 A;  2XAH A;  2ADU A;  3WE3 A;  3M9A A;  3J7A O;  2MD5 A;  1ZRC A;  1IN6 A;  4ENJ A;  1REP C;  4O3M A;  1YFH A;  3J80 Z;  1B6A A;  1P92 A;  4YFX F;  1LB2 A;  2CW0 F;  3GLX A;  4RAZ A;  1EH8 A;  1YS6 A;  2UZK A;  2HKO A;  2XAF A;  3ERE D;  3REO A;  4L18 B;  4IXA A;  4Y17 A;  2RKH A;  3LQQ A;  3WTZ A;  1W4M A;  1H9T A;  4QWQ A;  4I09 A;  1XGS A;  2KJC A;  4ESF A;  1YQA A;  1YS7 A;  1YW8 A;  3HYI A;  2KRF A;  5ILU A;  3JAM Z;  3H3U A;  1IZ1 A;  3N97 A;  5ICC A;  3I58 A;  2K02 A;  2VBY A;  2BGC A;  1A04 A;  4AVP A;  5LRS A;  4BNC A;  3C7J A;  4L5J A;  3F21 A;  2YU3 A;  1FPQ A;  1Z05 A;  3V7R A;  3KEO A;  4LB5 A;  2HGC A;  2M5W A;  2QBY A;  2O8X A;  2ZO4 A;  2Q2E A;  2HWV A;  5D4S A;  1DUX C;  1UCR A;  2EV0 A;  1WKM A;  2ZFW A;  1HKS A;  1FOK A;  1IN5 A;  5L3F A;  3EYY A;  3FMS A;  3PFI A;  3ZMD A;  1T6S A;  3R4K A;  2GXB A;  3PQK A;  4IF4 A;  1B9N A;  3DPT A;  1W5T A;  3HHH A;  1U3E M;  3LA3 A;  1K79 A;  2P5K A;  2XAQ A;  3E97 A;  5IT9 Z;  2V6C A;  3FZV A;  4M9S A;  2M30 A;  1HQC A;  2A07 F;  1R1T A;  3T1B A;  1FX7 A;  2EJR A;  2ZNZ A;  5E1X A;  3ISP A;  4RB0 A;  1IXR C;  4GO1 A;  3MZH A;  4I2O A;  2LDU A;  1YTY A;  5F1R A;  3LA2 A;  2H6C A;  2AXL A;  4LLN A;  3KFW X;  1U5T C;  5AIQ A;  1R23 A;  4L9V A;  4KIC A;  3BRO A;  1KQ9 A;  3D5L A;  3RDI A;  3CTA A;  3QAH A;  3W6J B;  5D5U B;  2P8T A;  4HX8 A;  2PMU A;  2X0L A;  3KLN A;  3GX4 X;  2XKO A;  4IPA A;  2XV4 S;  4DQ2 A;  4P9F A;  2PI0 A;  3ZMT A;  1ODD A;  3ZN0 A;  1R58 A;  1LDK B;  2CO5 A;  4KIB A;  3I71 A;  3HSR A;  4A12 A;  2GAU A;  2WWY A;  2Q0O A;  2D45 A;  2FBK A;  2L3D A;  1BI3 A;  4M6Y A;  1RUO A;  1U5T B;  1QZY A;  3COA C;  4BHC A;  3GFM A;  4CO8 A;  3T0Y A;  3IRR A;  1XB4 A;  3GZ5 A;  1USS A;  3LAJ A;  3HRT A;  1EV7 A;  5DCM B;  4N9H A;  4OU0 A;  4CYD A;  4BH9 A;  1VTN C;  4HBL A;  2P6S A;  3WG9 A;  2IA2 A;  2HZT A;  4G6D A;  2DT5 A;  5HS8 A;  5LHG A;  4UUV A;  1MDM B;  3S2W A;  3JW4 A;  3ECO A;  2FXA A;  2QWW A;  1STZ A;  2MBF A;  3QRF F;  1Q1H A;  4MGR A;  5LHI A;  2K86 A;  1S3J A;  3QOP A;  1LVA A;  5TRD A;  1F1Z A;  2QYO A;  1W7P B;  1B9M A;  5ILV A;  4G7O F;  2PFB A;  2KJB A;  4XBF A;  3HRU A;  1R5H A;  4IVN A;  2JZY A;  3G73 A;  1BBY A;  4WX9 A;  4G8X A;  5LEJ A;  3K1P A;  1HSJ A;  2JPC A;  3BZ6 A;  4F7Z A;  5CVR A;  1B1B A;  4PCQ A;  4KA4 A;  3EQL F;  1XGO A;  2EFP A;  2STW A;  3WTY C;  4OIO F;  1LDJ A;  1MJ9 A;  2LF7 A;  2ZCW A;  2FOK A;  2OQR A;  1SAX A;  5F64 A;  1C0W A;  3E3V A;  3GW2 A;  4IHT A;  2RC4 A;  1O3T A;  1O7F A;  4WXH A;  2OU2 A;  3BP8 A;  4LFU A;  2YR2 A;  1T2K A;  3EUH A;  3NEU A;  1YLF A;  2IPQ X;  2EFW A;  5A2Q Z;  1YW7 A;  3ELK A;  3K2Z A;  2RV8 A;  4ENK A;  3ZMU A;  4XLP F;  1ZG5 A;  2CG4 A;  5K1Y A;  5L3E A;  5K5Q A;  4Q4Z F;  3V8J A;  2MC3 A;  2FF4 A;  2VXZ A;  3FHZ A;  2PN6 A;  3FX3 A;  4KNY A;  2ZME B;  3WTV C;  3KP4 A;  2Z99 A;  1FNN A;  5ICG A;  4OMZ A;  3CJN A;  3P9C A;  2G7H A;  1G6N A;  4CZZ A;  3IHU A;  3DP7 A;  3DF8 A;  3KLO A;  3CO7 C;  4OIN F;  3T8T A;  3FXU A;  4UVB A;  4RB3 C;  3V8L A;  4YFN F;  3QPT A;  2FBI A;  1S7O A;  1AOY A;  4NB5 A;  1QBJ A;  4ENN A;  4G7Z F;  1XCB A;  3WGH A;  1WSU A;  3DEU A;  4EM2 A;  1ZLK A;  3SXY A;  2DQL A;  2GQQ A;  5ILS A;  1OPC A;  4S05 A;  3RYP A;  2FNP A;  1OR7 A;  1MD0 A;  2OAZ A;  4EJV A;  2XIG A;  1YG2 A;  1LNW A;  4AIJ A;  4IHS A;  4UVA A;  5CYV A;  2JTV A;  5D6E A;  1OKR A;  3OV8 A;  3IWF A;  4HF1 A;  2Z3Y A;  1IF1 A;  1D5V A;  1T38 A;  2ZXJ A;  1SFU A;  4XRF A;  4O6J A;  4IRI A;  5D6F A;  2V1U A;  1WI9 A;  3HOT A;  4Q5S F;  4XSZ F;  2FEZ A;  3Q9V A;  4HDU A;  3WTX C;  4OIP F;  4I7H A;  1CGP A;  2GWR A;  3IC7 A;  2BYV E;  4N9I A;  4A0Z A;  3B73 A;  2STT A;  5DYM A;  2OA4 A;  4M72 A;  4HA8 A;  1BIB A;  3JSO A;  5HDG A;  3Q5F A;  2IVM A;  3R61 A;  2CSO A;  2P4W A;  2P7C B;  2ESN A;  1XMK A;  3HRS A;  3IKV A;  3I5U A;  4EGZ A;  1YIO A;  3LAP A;  2L4M A;  4G9Y A;  2XGX A;  1BN5 A;  1ON2 A;  1QO0 D;  3VOE A;  2YPR A;  1B4A A;  3JAM K;  4UVC A;  4NHJ A;  2Y48 A;  4HZF A;  2R7F A;  1SD6 A;  1O7L A;  1IN4 A;  2A3S A;  4ZYD A;  5HOO A;  1R36 A;  4IJA A;  1RIO H;  3ZMZ A;  1J9I A;  4GXO A;  3WU1 B;  4KDP A;  1UHM A;  4CGZ A;  4LK1 F;  4MQV A;  2JRT A;  2G7U A;  4E70 A;  2IA0 A;  3M8F A;  4GCV A;  3F8M A;  3KP2 A;  1KU2 A;  4EVI A;  5DUI A;  1D3Y A;  1LDD A;  4PGG A;  1ZH5 A;  3EDP A;  1ZGA A;  6PAX A;  2DBB A;  2Z9O A;  2HKX A;  5E18 F;  2ELH A;  1BC7 C;  4M9Z A;  4H0E A;  4A0X A;  4AIK A;  3PQJ A;  4U0V A;  5BPD A;  1X3U A;  2BV6 A;  4HAM A;  2Y75 A;  2AS5 F;  4PZJ A;  1O3S A;  2P7V B;  5DCM A;  3LST A;  1IN8 A;  3TOA A;  4RAY A;  3E5U A;  3H3Z A;  3N4M A;  3K69 A;  5LGT A;  2MH9 A;  1YW9 A;  4EMS A;  3TDZ C;  1U6G A;  5A2Q K;  1QQI A;  1DDN A;  1UST A;  2FNA A;  1J59 A;  2L01 A;  1UB9 A;  1EH7 A;  1BI2 A;  2CQK A;  3M7G A;  3E5Q A;  1FYK A;  4U0Y A;  1FBQ A;  1O3Q A;  2K7L A;  1FP2 A;  1IRG A;  4KYW A;  4B09 A;  3KP7 A;  5JVT A;  1FYM A;  2F5C A;  2QLZ A;  3C18 A;  2E7W A;  4GGG A;  4ESB A;  4ESJ A;  1MGT A;  2LNB A;  1IAW A;  4U0W A;  3SZP A;  4MTD A;  3B02 A;  5JI6 A;  2HYG D;  3RKX A;  2VOP A;  2VBX A;  2V1D A;  5DEQ A;  4BHP A;  2M8E A;  1DPU A;  1J0R A;  2QQA A;  4S04 A;  1ONV A;  2XHK A;  2CGP A;  1ZLJ A;  2DFI A;  3F8B A;  3MAJ A;  2QZ8 A;  4MTE A;  3GO5 A;  3SQN A;  5KK1 A;  1DP7 P;  1XDU A;  4G7H F;  1TW2 A;  3BPX A;  2NS0 A;  1P4W A;  5JR3 A;  2DW4 A;  3R0A A;  2RQP A;  2VT2 A;  1JHF A;  1P2F A;  3E6B A;  3HRM A;  3HIF A;  2FRH A;  3MCZ A;  2LF8 A;  3F3X A;  1L0O C;  4HW0 A;  3K1N A;  2W85 A;  4ZZL A;  2V9V A;  1SMY F;  3LWF A;  1KU9 A;  3HUG A;  4A5N A;  2FBH A;  2QBY B;  3E6D A;  3FF5 A;  3ECH A;  2EV5 A;  2IRF G;  1F4K A;  1DPR A;  3L09 A;  3FMQ A;  5J8F A;  3TGN A;  1PUE E;  3FWE A;  4EJO A;  3WTT C;  4L5I A;  2VE8 A;  2GZW A;  4KIG A;  3VFZ A;  2MLG A;  2XAG A;  2DO7 A;  2E7X A;  4HQM A;  4JBA A;  1IXS B;  3WTS C;  1HW1 A;  1Z6R A;  2O0Y A;  4EM1 A;  3CUQ C;  3I53 A;  4HF2 A;  1T0F A;  2KIM A;  1TW3 A;  2L54 A;  1HXD A;  4D0P A;  4MQ9 F;  1JHH A;  4EJW A;  2HR3 A;  2HQN A;  2BBY A;  5L3B A;  3BDD A;  2QQB A;  3HSE A;  3GYH X;  4LG0 B;  2B0L A;  4RGU A;  2HTJ A;  2QUF A;  5D4R A;  1ZG3 A;  3I0T A;  3F23 A;  3ULQ B;  3GFJ A;  1ZRF A;  2JSC A;  3ZP5 A;  2H09 A;  5LBQ A;  2NNY A;  2UXX A;  4CDG A;  1Y0U A;  3BOQ A;  1XSV A;  4FT8 A;  4HF0 A;  3F8N A;  2CYY A;  1MJA A;  2Y0M A;  4ENM A;  2V1X A;  1XDS A;  4ZZD A;  1FSE A;  1Z7U A;  4ZH4 F;  4TV7 A;  3SHF A;  2PLY A;  3ML6 A;  1GXP A;  5DUK A;  2M45 A;  1FWZ A;  5LRR A;  2VON A;  1F5T A;  3KE2 A;  4HX7 A;  2DPU A;  3CO6 C;  2ETH A;  4GYI A;  1FLI A;  4LGW A;  2XAJ A;  2FMY A;  3R0J A;  2HQR A;  2D2W A;  3GFI A;  1S6L A;  1J5Y A;  2RDP A;  1L3L A;  2P5L C;  3ABT A;  3E5X A;  2ISY A;  2K27 A;  1XD7 A;  1G3T A;  5D8K B;  1U5T A;  4WCG A;  3MFK A;  2BE5 F;  5DD8 A;  3K9T A;  2NNN A;  3RPQ A;  4KFC A;  2GA1 A;  3VOD A;  3IL2 A;  2FE3 A;  5H6R A;  3GWZ A;  3KET A;  3GUD A;  1FZP B;  4WXC A;  3HHG A;  4KN4 X;  5FD5 A;  2P5V A;  2TDX A;  3GF2 A;  5FGM A;  4U88 A;  3AAF A;  1I1S A;  1QZZ A;  3ABU A;  3WTW C;  2W57 A;  1G3S A;  4UHT A;  5J6X A;  4L0Y B;  4UV8 A;  3LQR A;  4BAY A;  4MNU A;  1ZYR F;  4ETS A;  3RTR A;  1I6X A;  5DV5 A;  1PP7 U;  1G3Y A;  5LEK A;  3I54 A;  5L3G A;  1FT9 A;  5BPI A;  4KN7 X;  2COM A;  4PGH A;  5HLI A;  4RGR A;  1XGN A;  2OZU A;  3L00 A;  4O5V A;  1SMT A;  1K6O A;  4RGS A;  4WF2 A;  3TQN A;  2EB7 A;  3TO7 A;  4AIH A;  2W84 A;  2DI3 A;  3V8K A;  3WU0 A;  2M1B A;  3DQV C;  5E1W A;  2ESH A;  1S7A A;  4I0A A;  4LLL A;  5CVJ A;  4HLY A;  3P7N A;  4HLX A;  1BC8 C;  2XAS A;  3TKY A;  2G9W A;  4XLN F;  4FX0 A;  3DKW A;  3JTG A;  1SFE A;  2ZKZ A;  4A6D A;  3FMR A;  3J80 K;  3QP6 A;  3RI4 A;  4MHG A;  3IKT A;  2KIU A;  4Y15 A;  1IXC A;  3BJO A;  3DFG A;  1IRF A;  3CUQ B;  4U7D A;  2HEO A;  1K78 B;  5ED4 A;  3GVA A;  1OYI A;  3ROU A;  4HYE A;  5HDK A;  4CXF A;  3WOD F;  1F9N A;  3BPV A;  4L9T A;  1Z6T A;  2PJP A;  1R1U A;  2ACJ A;  3J81 Z;  1FY7 A;  1KU3 A;  4ASN A;  4RB2 C;  1ZHF A;  2ZME A;  4HDV A;  3EYI A;  1MJB A;  1BM9 A;  5DDG A;  2OD5 A;  4P55 A;  2HS5 A;  3HSF A;  5H6Q A;  1FP1 D;  1PDN C;  5F6F A;  1R1V A;  3TOB A;  3ZQ7 A;  1AWC A;  5HLG A;  1HBX G;  4ZYG A;  2RNJ A;  3GEZ A;  4OOI A;  3RKY A;  5L3D A;  2KKO A;  5LGU A;  3L7W A;  4PDK A;  2UXN A;  4L9J A;  1JXS A;  1J7K A;  3L9F A;  4M73 A;  2J5O A;  2E1N A;  3KZZ A;  2O03 A;  3DXJ F;  2GXG A;  2YSR A;  2EFN A;  2GIV A;  4WK8 F;  4HX4 A;  4L9N A;  2Q8K A;  3V7S A;  5D8L B;  2A5Y B;  4EJT A;  2PEX A;  2EA2 A;  4B8X A;  2A6E F;  3P9I A;  1Z1D A;  2H94 A;  1K7A A;  1WRJ A;  5KVR A;  2Z33 A;  2F5E A;  5ICE A;  2LKP A;  2H6B A;  2OQG A;  5FB2 A;  1E17 A;  3HTS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...