5ERIA

Marr protein from peptoclostridium difficile da00132
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
153
Chain Sequence
b'RGSHMLIKTLDSNILREVGTLSRAVNSINDIKYKELKLQKGQFTFLTRICENPGINLVELSNMLKVDKATTTKAIQKLIKAGYVDKKQDKFDKRGYNLTPTDKSLEVYELIIEEENRSIEICFDNFTDEEKQVVTKLLEKMSKNVENEWFKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MarR family transcriptional regulator
publication title Crystal structure of the multiple antibiotic resistance regulator MarR from Clostridium difficile
doi rcsb
source organism Peptoclostridium difficile
molecule tags Transcription
total genus 55
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2015-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5eriA00
2F5DA 4LB5A 4ASNA 2O0YA 3ML6A 5CYVA 4HAMA 2Q8KA 2QZ8A 4KN4X 2A5YB 2ZXJA 1S8NA 1K7AA 2P5VA 1ZAOA 1H0MA 2ESHA 3ERED 2D2WA 2VBZA 2KIMA 3MZHA 3ECOA 1BI0A 4L5IA 5LRRA 2EFNA 5FD6A 2BEOA 2Z5UA 3C7JA 2QYOA 4KA4A 1S29A 4EM2A 5FFZA 5LHHA 2DTRA 2STTA 3TDZC 3BWGA 4RAZA 3HRMA 1DUXC 1BIBA 3IC7A 2X4HA 2GXGA 1XGNA 4E70A 1R7JA 2XKOA 2FEZA 3FZVA 4P55A 2FOKA 1KQ0A 4Z2YA 5ED4A 2FMYA 5D8LB 3TGNA 4A5MA 2D1VA 3MQ0A 4L9JA 2V1DA 1PUEE 2H27A 1F4KA 1SFUA 1LDKB 1K78B 2DW4A 1R1VA 3WGGA 1LNWA 5ILVA 4OU0A 2QBYA 5LRSA 4LLGF 3JAMK 3EETA 3FM3A 5A2QK 2KJBA 1YIOA 3M9AA 4L5JA 3W6KB 3U1DA 3G73A 2FXAA 3Q9VA 4BHPA 2HTSA 4BXUA 2GXBA 2PMUA 5LGNA 2XAHA 1QPMA 5CVUA 2K4BA 4L9NA 3H92A 3DP7A 1P4AA 4PCQA 3HIFA 3REOA 1KYWA 3LAPA 1I1SA 4WXDA 3VODA 2XV4S 4HW0A 4P9UA 2E1CA 2IJLA 1IRGA 2RQPA 3P9CA 5EEGA 2OAZA 2VC1A 3SFZA 4MEYF 3IL2A 3E6BA 5H20A 2OD5A 2RDPA 3PQJA 3BY6A 4KYWA 1EH6A 1GHCA 3KFWX 3GFJA 2W85A 3FXUA 3J80Z 4IRHA 1J75A 4S04A 2HR3A 2XGXA 4P9FA 2LSOA 4L9TA 3I4PA 2IA1A 3I0TA 3BJOA 2EFOA 3R0JA 4O6JA 1PDNC 5BPIA 3ZMZA 4AWXB 1J2XA 2WWYA 2KIUA 5K5QA 1ZH5A 5D4SA 2L4AA 2YSRA 3TOAA 5LHIA 1EH7A 3GO5A 2OZ6A 2CW0F 3L09A 4Q48A 1U5TB 4JBAA 4LG0B 5HOOA 2FNPA 3F6OA 1ZRCA 4KUMA 3FMSA 1FX7A 5F1RA 1KU9A 3TKYA 1O57A 4HV6A 1QO0D 3I59B 3WTUC 1FBUA 1T98A 2CQKA 3DEUA 3ABTA 4YIFA 2PI0A 1RIOH 2P5KA 5DCMB 2XUBA 1AWCA 1IN6A 4UHTA 1IN7A 2IPQX 3KP4A 3D5LA 3KP6A 2GWRA 1R5GA 1G3SA 2RVCA 1D5VA 2MLGA 3TDUC 3KETA 3WGHA 2MD5A 2M87A 4IF4A 4S05A 1TQPA 4IHSA 2FBIA 1UHMA 1I1GA 1P4WA 4WK8F 1YS7A 2ZMEB 4XSXF 5HLGA 1USSA 2XASA 4Y17A 4AIJA 3SZPA 2JPBA 1ZRFA 4CHUA 3F72A 1S7AA 4YFNF 3GVAA 2QQ9A 4BHBA 1FYKA 1J59A 2GQQA 2QLZA 3WU1B 1Z91A 3RI4A 4BHCA 2MA3A 4OINF 5TJJA 3S2WA 3V7SA 3IKVA 3I71A 3F8BA 2PBIA 2WV0A 4EGZA 4G7OF 5D5WB 5DYMA 1SD5A 2IW5A 2JSCA 3IRQA 1WKMA 3BZ6A 3FXRA 5DUKA 4PGHA 4BAYA 2DQLA 5HLHA 3EQLF 2STWA 2VBWA 2W25A 3GWZA 4RB3C 1H9GA 3PFIA 2FBKA 1U5TC 4OOIA 2GZWA 4IPAA 2DT5A 3P9IA 5HS7A 1P2FA 2C6YA 2HZTA 5DD8A 5FLXZ 5ICCA 2Z9OA 3OV8A 3KLNA 4TV7A 3KCCA 1XB4A 1QGPA 1MGTA 4WCGA 3CTAA 3DF8A 4OIRF 4PGGA 2DFIA 1U8RA 3HRTA 1IF1A 5KVRA 1XMAA 3PQKA 3DPTA 1ULYA 2DLLA 5LGUA 1V3FA 4HDVA 1JHHA 4G7ZF 1ZGAA 1YG2A 1FP2A 1K78A 2L02A 1XN7A 1GXPA 4BNCA 5LEKA 3V7CA 2H6BA 4LFUA 2ZJ2A 4GCVA 2VOPA 2BYVE 5JFRA 4I01A 1T38A 5DV5A 3LQQA 5ILUA 1D3YA 5H6RA 4ESJA 2NRAC 4KFCA 2PQ8A 4JK1X 3TQNA 3F8MA 2P6SA 3GXOA 3IRRA 2RC4A 2KKOA 4ZYGA 3KZYA 5H6QA 3WTXC 3FHZA 3K1PA 1UHWA 1TQIA 4EVIA 1RUOA 2ZCWA 2L01A 2HFHA 1XSXA 1B9NA 3P9KA 4O5VA 2VT3A 3MFKA 4U0WA 1MDMB 2MC3A 3LFKA 4LJZF 1R1TA 1DPRA 2HYFA 3LWFA 3TOBA 3RKWA 4Y13A 1XGOA 4MQ9F 4GGGA 4XSZF 2XAJA 3ZMUA 1ZREA 5L3CA 2DI3A 5DEQA 2FF4A 1XGSA 3ABUA 2M45A 2ZNZA 1KU3A 5DCFA 3ZQ7A 1ZLKA 3MWMA 4KT5C 2Q0OA 1NHAA 4HQMA 2DPUA 2WC2A 5CVVA 3GYHX 4OMYA 3WODF 3WU0A 2ELHA 3M8FA 4HQEA 4ETSA 1WQ2A 1ZGJA 4MTEA 3U9GA 2UXXA 2IA0A 4LG0A 1G3YA 2HGCA 3D0SA 3EUHA 5FO5A 4AIKA 1ZYRF 3I59A 1BJAA 2DO7A 4RB2C 2ISYA 3VB2A 4LMYA 1UFMA 3L00A 2O6GE 5BMZA 3FMQA 5DCMA 2IRFG 4R8HA 4G6DA 1OMIA 3J81Z 2EWNA 3K9TA 2UZKA 4KIFA 3CJNA 2OZUA 3TO7A 1IW7F 2P5LC 3QPTA 1BI1A 3BROA 4DNCA 4WXCA 1T0FA 2EJRA 1BOAA 1K6OA 1R22A 1YO5C 3RPQA 2Y48A 5BPDA 2NNNA 5JI6A 3ZP5A 3LA2A 4R79A 4FX4A 3GUDA 1HW1A 2NNYA 2VN2A 2OU2A 1KGSA 1HBXG 2ZMEA 1MJ9A 3E5UA 3MEXA 2XHKA 1S6LA 4F7ZA 2EV5A 1SMTA 4LK1F 3V7RA 4ESFA 1WSUA 4YFKF 4FT8A 1V4RA 5F6FA 2A3SA 4RS8A 1TNTA 3DQVC 1TNSA 4G94A 2JPCA 4BYYA 4L0ZB 4ENMA 4AIHA 2ISZA 2UXNA 5E18F 5LBQA 2CSOA 2HOEA 1B1BA 4G9YA 3J80K 4IRIA 4UV9A 2P8TA 2QM3A 2ESNA 2IVMA 2L4MA 3GZ6A 1SD4A 3RYRA 3O6BB 4QLCU 1E2XA 3F8CA 2VXZA 1QBJA 2DBBA 4HF1A 1XCVA 4A2UA 4HA8A 3WG9A 1AOYA 1E17A 1HKQA 1LEAA 2H6CA 1OYIA 2LNBA 3GZ5A 4PZJA 2NAZA 3E6MA 4N9HA 3JTGA 3O3KA 1YW7A 1G3WA 3M7GA 1YQAA 2DU9A 4WF2A 4EJOA 4A6EA 4RB1A 5ICFA 1Z7UA 2JZYA 1UB9A 2M1BA 4HOBA 2MH2A 2EK5A 3R0AA 4U0VA 2CGPA 1FC3A 3R4KA 6PAXA 1TW2A 2IP2A 3FF5A 1HQCA 5E8IA 1TBXA 1W7PD 2RN7A 3GF2A 4I7HA 3DKWA 3C1DA 4KIGA 3N97A 2R7DA 1CGPA 1R23A 3KLOA 5BQTA 4EJUA 3SHFA 4ENNA 1B4AA 4PDKA 3WE2A 1BIAA 3VEPA 2DK8A 5D6EA 3V4GA 3WTSC 5TRDA 4CXFA 1KQ9A 5E8GA 1FY7A 2JTVA 2W57A 3TO6A 2AS5F 4OIOF 1LJ9A 4UVBA 3KP3A 4KDPA 1U3EM 4GYIA 2JT1A 2FBHA 5D5UB 3CUQB 5LEJA 4A6DA 2FNAA 1ZG3A 2CFXA 2HTJA 5L3DA 2PMHA 2WTEA 1FSHA 1UCRA 5E20A 3QPHA 3KE2A 3FWEA 2MLKA 1IXCA 4AD9A 2FRHA 5IT3A 2YU3A 2DK5A 4XRFA 4RAYA 1P4XA 2J5OA 3Q9SA 2MBFA 1Z1DA 1JGSA 1F1ZA 2A6EF 4EM0B 2XIGA 3E97A 3SXYA 1XDUA 4N0BA 1EV7A 1W7PB 1TW3A 2ZFWA 4ZH4F 1SMYF 3WTZA 1FYMA 4LGWA 3K0LA 4MNUA 3SZTA 1T6SA 5FGMA 4A0YA 1MZBA 4GO1A 3BJ6A 3LA3A 1OR7A 2F5FA 5EEHA 1OKRA 4I0BA 4G8XA 5AIPA 3V8JA 2ACJA 4U7DA 5FLXK 2XROA 4A12A 4YFXF 1SD6A 4YG2F 4LLLA 4RGRA 3HSFA 2EFWA 2O3FA 1WI9A 1TLHB 4CDGA 3WTTC 4M71A 1FZPB 4FHTA 1RUNA 3QU6A 1U6GA 5DD4A 1FSEA 4XLNF 2K27A 1LB2A 3ZMTA 3HTSB 4HBLA 2NS0A 3IHUA 1FLIA 1KU2A 1FT9A 4O3MA 1ZRDA 4L18B 4I09A 1HKTA 2HKOA 2D1HA 4HF0A 3F23A 4UVCA 5JR3A 3BPVA 2KIFA 4EJTA 3QP5A 1O3SA 1DP7P 4UUVA 2QUFA 4IVNA 1IAWA 5D5XB 2RKHA 3TO9A 3RYPA 3VOEA 4OIQF 2UWMA 2XRNA 3N4MA 3CUQC 4M6XA 1F5TA 5HS8A 4KIBA 2EA4A 4KN7X 2YR2A 5D5VB 1YTYA 2AXLA 5FFXA 3LQRA 3CO7C 4M9ZA 2CG4A 1HXDA 1USTA 1Z9CA 2P6TA 4GXOA 5L3BA 4ZYDA 4IJAA 1J7KA 5CVJA 4HZFA 3I54A 2P7CB 4MGRA 5HS9A 4M74A 3GX4X 1QNTA 1R00A 5DUIA 4GYGA 2COMA 2QQAA 1C0WA 4I2OA 3I64A 3KEOA 2Y0MA 4UNOA 1IRFA 1O3TA 3HSRA 4A0ZA 4BQAA 2ZKZA 3HHHA 3DXJF 5BS6A 1HW5A 2PEXA 1ZHFA 3HOTA 3G3ZA 3RDIA 4M9XA 1B59A 2XKPA 1SFEA 2XAQA 4M6YA 3R6SA 4Q5SF 1TQMA 1LDJA 3M1EA 1XSVA 1REPC 4IXAA 1YYVA 1S7OA 5HDKA 2JRTA 5E17F 5CLSA 1FPQA 2X0LA 3HRSA 4B8XA 1IXSB 2DQRA 3GFLA 1HSJA 1XCBA 3SQNA 2V79A 2D45A 2G7UA 3EYYA 4ZYHA 3W6JB 2LF7A 2PN6A 5HDNA 4G7HF 2ADUA 1ZG5A 1Y0UA 1MD0A 1L0OC 4QWQA 3L2CA 3J7AO 1BBYA 1J5YA 2PFBA 2L3DA 1S3JA 1P92A 3ZN0A 1PP8F 2PJPA 4ZYEA 2A07F 5E1ZB 2EV6A 4A0XA 1R5HA 5D8KB 2ZBKA 1G6NA 1IXRC 3JTHA 3J81K 3B73A 1O3RA 1TTYA 3T8RA 5J8FA 1MJAA 4EQQA 4CGZA 2HWVA 4EV0A 5ILSA 1FYLA 5ICEA 2VBYA 2TDXA 2G9WA 3BOQA 4RGSA 2P4WA 1FNNA 1U5TA 4Y15A 2V9VA 3ZMSA 3CUQA 2RGVA 5KK1A 5D4RA 3MCZA 3IWZA 3CO6C 3B02A 1ZG1A 3HSEA 2IA2A 4Q4ZF 1YS6A 3DV8A 2EFPA 2VE8A 5IT9Z 2Q2EA 1KQ8A 1KU7A 3H3ZA 2FSWA 3IKTA 3KP2A 3GEZA 3C18A 4EM1A 1VTNC 3HYIA 3DPLC 4WXHA 2ZNYA 4CYDA 2FQ3A 2RV8A 1LEBA 3GFIA 1W7PA 2ETHA 1FBSA 2VBXA 3T5XA 2BE5F 2L54A 3HHGA 2CWEA 5ERIA 4UVAA 2VOOA 3CDHA 3ULQB 1T39A 4IRGA 1ON1A 2HKXA 4RGUA 1GXQA 1BI2A 1SFXA 3HRUA 2M8EA 2F5EA 2HDCA 1B9MA 5L3GA 1DDNA 3H3UA 2VE9A 1G3TA 3QRFF 3NEUA 4CICA 3BPXA 4RGXA 4HF2A 1Z05A 2R7FA 5CJ9A 5E1WA 1BI3A 2A61A 3GFMA 1W5TA 1IN5A 4ZZLA 1BN5A 1IN4A 2OBPA 1J9IA 2EFQA 3AAFA 3E5QA 5DDGA 5AIQA 4BH9A 1U78A 5D6FA 5K1YA 2BBYA 3I58A 1I6XA 2DPDA 4KNYA 2F5CA 4U88A 2OQGA 5BOXA 3CUOA 1BC7C 3K1MA 1XDSA 2QVOA 1YW9A 3I53A 4M72A 1XD7A 3T8TA 3WTWC 3FMRA 2LKPA 2P7VB 1FP1D 1CF7B 3U2RA 2O03A 1ODDA 2K7LA 3F6VA 1J0RA 2VT2A 1SD7A 4AVPA 5CVIA 2W24A 3E6CC 3M8EA 3ZMVA 3ECHA 1LVAA 3E6DA 2PG4A 4LD5A 3ZMDA 1OYWA 1LDDA 1ZARA 1MJBA 4WWCA 2CYYA 1R1UA 4WX9A 2G7HA 2H09A 3V8KA 4R1HA 2R3SA 5HVQC 2V6CA 3DFGA 3K69A 3LA7A 2E1NA 2OA4A 1A04A 1LQ1A 2VONA 2KJCA 3ZPLA 3WTVC 4MEXF 1B6AA 3L9FA 1G4DA 3COAC 1FWZA 1H9TA 1RNLA 3JAMZ 4I98B 4M73A 2GA1A 5A2QZ 5JVTA 1JE8A 3BDDA 3GW2A 5ICGA 2HQRA 3RKXA 3HUGA 2QENA 3VFZA 2HEOA 4OIPF 2K4JA 3JW4A 4P96A 1XGMA 1ZN2A 1R36A 1KA8A 4XBFA 1FBQA 5AONA 2ZO4A 1L3LA 4ENKA 2BV6A 4EGYA 3LSTA 3V8LA 5LLQA 2YPRA 3MZYA 4RB0A 4UXNA 4LB6B 2O8XA 3BP8A 2KRFA 1YW8A 4ESBA 1MDMA 3F8FA 1HW2A 5J6XA 1BC8C 4Q47A 3EDPA 3MAJA 4EMSA 1OPCA 1Z6RA 3HTUA 3HOSA 2EA2A 4JQFA 1X3UA 1I27A 4DQ2A 1T2KA 1Q1HA 1WWXA 2Z99A 4KMFA 3WGIA 4G6QA 4D0PA 1Z6TA 1WRJA 5CVRA 4HX4A 4N9IA 2O61A 4OMZA 2A68F 1QZYA 2Y75A 4EJWA 3BJAA 1EH8A 2M30A 4LK0F 4MHGA 1ONVA 3RKYA 3EYIA 1QQIA 3FM5A 4HX8A 3E3VA 2OQRA 2HYGD 3OOPA 3GLXA 4L9VA 4NHJA 3RJPA 2B0LA 3IWFA 2YX4A 2Z33A 3WTYC 4ON0A 1FOKA 4KMUX 2FMLA 2A6HF 5LGTA 3FXQA 3ISPA 5HLIA 1R58A 1ON2A 4K2EA 3K2ZA 3KEQA 3ROUA 4I0AA 2LF8A 4LLNA 3QAHA 2A69F 4HV5A 3C3WA 1MKMA 2V1UA 1OYYA 2QBYB 3T1BA 4HLXA 4A5NA 2Z3YA 2HS5A 1HSTA 3F3XA 4YIIA 1PP7U 2VODA 2CO5A 1YLFA 2J5PA 3RIRA 2K86A 4HLYA 3I5UA 4CO8A 5L3FA 2NYXA 3JSPA 1XSDA 2XVCA 2FE3A 4IHTA 2VC0A 3T0YA 3QU3A 1RI7A 1O3QA 1O7FA 4U0YA 5L3EA 1K79A 5K5RA 1HKSA 3R60A 1JHFA 2FA5A 1D8KA 3LAJA 2IT0A 1DPUA 3O2PE 1BM9A 4HDUA 4HX7A 1YFHA 3JSOA 1W5SA 5FB2A 4M9SA 2MH9A 3FX3A 2HQNA 1XMKA 1QZZA 1IZ1A 4ENJA 2E7XA 4NQWA 3K1NA 2F2EA 2V1XA 2E7WA 3Q5FA 2YX7A 1CF7A 3L7WA 3RTRA 3QOPA 5F64A 3WE3A 2M5WA 3E5XA 5E1XA 2RNJA 1KYZA 4KICA 4I02A 2EV0A 5JHUA 5IT9K 3RPUA 1O7LA 4NB5A 2DAOA 4XLPF 3KZZA 1F9NA 2PLYA 4MQVA 4FX0A 2LDUA 1D8JA 5HDGA 2XAGA 5FD5A 3KP7A 2QQBA 3CLOA 4H0EA 2GIVA 1JXSA 4EJVA 5LHGA 3F8NA 2H94A 1GVJA 1IUYA 1I5ZA 2W84A 4B09A 4HYEA 3KP5A 5K5OA 1U2WA 2XAFA 2FU4A 3NQOA 3P7NA 3R61A 3ELKA 2K02A 1SAXA 1W4MA 2GA2A 4ZZDA 3F22A 1ZLJA 1STZA 4UV8A 4MTDA 3NRVA 1P6RA 1RZ4A 5J8CA 4L0YB 3F21A 2GAUA 2EB7A 2BGCA 4U7BA 2QWWA 4P5OA 4CZZA 1IN8A 3ZN1A 3QP6A
chains in the Genus database with same CATH superfamily
2CUFA 2F5DA 4LB5A 3M07A 4ASNA 2O0YA 4IO9F 2BXZA 3ML6A 5CYVA 3PIOF 3EPZA 2KPMA 4HAMA 2DTZA 2Q8KA 3VSKA 2QZ8A 4KN4X 2A5YB 1G2HA 2ZXJA 3CMEI 1S8NA 5CPRB 3OYGA 2PMZN 1K7AA 1JUPA 3DEEA 2P5VA 3G4SI 2B7EA 1UMQA 1ZAOA 1PYVA 1H0MA 2AXTC 2ESHA 3CCYA 3ERED 3AG3H 2D2WA 2VQGA 4F52A 2VBZA 3W2AA 2KIMA 2XGEA 4EEFG 3CC7I 3MZHA 3ECOA 1BI0A 3KYCB 4AUXA 1EJ9A 1MSFC 4L5IA 5LRRA 3W6VA 2WV1A 2EFNA 5FD6A 4CZCA 2BEOA 2KDOA 2Z5UA 3C7JA 2XSDC 2WB1A 2QYOA 1QU3A 4KA4A 1S29A 4BDZA 4EM2A 5FFZA 5LHHA 2DTRA 2STTA 4QPQA 3TDZC 5J4YA 2KZVA 2K3PA 2DFEA 2KISA 3BWGA 3F0CA 4RAZA 5K7ZA 5KNLA 3GLLA 3HRMA 1WFXA 1DUXC 1BIBA 4HSTA 2OJED 4A3DJ 3IC7A 3U21A 3S1MJ 4HEA2 1BA5A 4XN3A 2X4HA 2XSJC 1OJLA 2GXGA 1XGNA 3QPLA 4E70A 1R7JA 2XKOA 2X51A 3ESWB 2FEZA 3FZVA 4P55A 4XOTA 3A01B 4ZDOA 2FOKA 1KQ0A 4Z2YA 2UV1A 5ED4A 3HOXJ 2L9NA 4QTRA 2MFZA 2FMYA 5D8LB 2HVSA 2M4KA 3TGNA 2NVXJ 4A5MA 5IYCJ 3HOWJ 2D1VA 3MQ0A 4L9JA 1WHUA 2V1DA 3M4OJ 2KLOA 1PUEE 2MYSA 2H27A 2K9QA 1F4KA 1SFUA 1LDKB 1K78B 5JLXA 1LE8B 2DW4A 1R1VA 2NVUB 1LNWA 3WGGA 1MMNA 5ILVA 4OU0A 3CC2I 2WADA 2R7RA 4H4KC 4ABZA 1QRYA 2QBYA 1K61A 5LRSA 1FTTA 4LLGF 1B72A 1WGXA 3JAMK 2EZIA 1XMXA 3CDIA 3EETA 3FM3A 5C4XJ 2GOXB 5A2QK 1RRJA 2KJBA 4UB8C 4M3DA 4S0HB 1XG1A 2XGDA 1YIOA 3M9AA 1UJ8A 1OR7C 3FXOA 4L5JA 3W6KB 4J19A 2AQEA 2E36A 3U1DA 3TP3A 3G73A 2FXAA 3Q9VA 4BHPA 4MLOA 2KRCA 2V7FA 4UUSA 2HTSA 3ZQCA 3S1NJ 4BXUA 2GXBA 2PMUA 3HGGA 5LGNA 2XAHA 3AKZA 1QPMA 3S3NA 3MKLA 5CVUA 2K4BA 4L9NA 4ZJZA 3H92A 1P9QC 3DP7A 5LFAA 4ZC3A 3DCFA 1P4AA 3G71I 4PCQA 3HIFA 3REOA 1KYWA 3LAPA 1I1SA 4WXDA 1BW6A 3VODA 2XV4S 3HXLA 4HW0A 5F04A 2R7UA 4P9UA 2E1CA 2IJLA 2BVMA 1IRGA 2RQPA 3P9CA 2JJ7A 5EEGA 2OAZA 4XN0A 3FK7A 2VC1A 1IDZA 3SFZA 2HVRA 4MEYF 3QODA 3IL2A 1NTCA 2ZC2A 3E6BA 4KT6A 5F0FA 3MN2A 1X3ZB 3DU6A 1YI2I 3IAM2 5H20A 4BXXJ 4KJZA 4BE2A 3S32A 2OD5A 2RDPA 4F3QA 3PQJA 3BY6A 4KYWA 1EH6A 1GHCA 2M0CA 2CUJA 3KFWX 3GFJA 2W85A 3FXUA 3J80Z 1Z0XA 1KONA 2GLOA 4IRHA 1J75A 4S04A 3OY9A 3I4NJ 2IGOA 2HR3A 5E3OA 3TW7A 2XGXA 4P9FA 2LSOA 4L9TA 3I4PA 2IA1A 3AFHA 1HA8A 3I0TA 1NH3A 3BJOA 1D0YA 3K70D 2PX9A 2EFOA 2LMDA 2M34A 3R0JA 4O6JA 1PDNC 3ZCOA 2HPMA 5BPIA 3ZMZA 4AWXB 4DYQA 4X6AJ 1J2XA 2ZXHA 3OYEA 2KIUA 2WWYA 3S3MA 1WJFA 5K5QA 1ZH5A 1QZEA 3A0BC 1MBEA 5D4SA 2L4AA 2UUZA 2Y30A 2DJIA 3OYNA 4V19K 2YSRA 3TOAA 3L1PA 5LHIA 3N05A 1EH7A 3GO5A 2OZ6A 2CW0F 4PJNA 5B1BH 1QPIA 3DTEA 1D5YA 3L09A 4LIVA 4Q48A 1U5TB 2GIZA 2EZLA 4YRVA 1GDTA 1IV6A 4JBAA 3BC8A 4LG0B 5HOOA 2OTJI 2FNPA 1A6IA 5F0CA 3F6OA 1ZRCA 4KUMA 3FMSA 1FX7A 5F1RA 1KU9A 1TT5B 4IX7A 2Q1ZB 2JMWA 3TKYA 1O57A 2LFBA 4HV6A 1QO0D 2VL8A 3RCOA 1N75A 3I59B 3HOVJ 3SJMA 3WTUC 1FBUA 1T98A 2CQKA 3DEUA 3ABTA 3K4BA 2VKHA 4YIFA 2E1MB 2PI0A 4N4NB 1RIOH 2P5KA 3SDBA 5DCMB 3CMAI 2XUBA 1AWCA 3CCSI 1VQNI 3AL0B 2WAQA 3CC4I 1IN6A 2L0KA 4UHTA 3OYCA 4IKFA 1IN7A 2DMPA 1Y1WJ 2NVTJ 2L7KA 3PL8A 2IPQX 3KP4A 2NS7A 2JUCA 4NUBA 3OYJA 3D5LA 3ZOBA 3KP6A 2GWRA 1R5GA 1G3SA 2RVCA 4RA2A 1D5VA 2MLGA 2VKVA 3TDUC 3KETA 3WGHA 2MD5A 2CQXA 2M87A 4W97A 4IF4A 2QSFX 4S05A 3BLYA 3DWLE 1TQPA 4IHSA 5TGTA 2FBIA 1UHMA 1I1GA 1P4WA 1E3PA 1T08B 1NK3P 4WK8F 1YS7A 2ZMEB 5F0HA 4XSXF 5HLGA 1USSA 2EIJH 3L2RA 1R4MB 2XASA 4Y17A 5E3LA 1I39A 4RM3A 3FXJA 4AIJA 3SZPA 5KAFC 2JPBA 4BJTA 1ZRFA 1M1EB 4CHUA 2WY8Q 3F72A 4CUGA 1S7AA 4YFNF 3H5RA 3OIOA 4LOCA 3GVAA 4NC7A 2QQ9A 4BHBA 4XLAA 2WAFA 4DBRA 3SEQA 2G0EA 1K4TA 2O8KA 1FYKA 1J59A 4A3FJ 2GQQA 4M3FA 2QLZA 3WU1B 3TL4X 2LP0A 5IYBJ 1Z91A 4A3LJ 3RI4A 4BHCA 2KRHA 4PSWA 1RPWA 2MA3A 4OINF 3A02A 5TJJA 3H36A 2BOLA 3S2WA 3FISA 1IUFA 3IKVA 3V7SA 5EEAA 3I71A 1Y39A 3S2DJ 4B3AA 1POGA 2PBIA 2WV0A 3F8BA 2K5CA 4EGZA 4G7OF 5D5WB 5DYMA 1SD5A 2K9NA 2BY3A 2IW5A 2JSCA 3IRQA 3CZ6A 1WKMA 3BZ6A 3FXRA 3DKXA 3J7YJ 5DUKA 4PGHA 1BJZA 2K85A 4BAYA 2DQLA 3DEWA 3FXKA 5HLHA 3EQLF 1QHGA 2STWA 1X19A 4UY8I 3HEFA 2VBWA 2W25A 5GAHJ 3GWZA 4RB3C 1FIPA 3FBNB 3DBRB 1Z3YA 2E71A 4XRSG 1H9GA 4HPQA 2VJ4A 3PFIA 4RLFA 2FBKA 1U5TC 4MIMA 3FK6A 4OOIA 2GZWA 4IPAA 5IP6A 2DT5A 1MH4A 1WVRA 2Y31A 3P9IA 5HS7A 1P2FA 4E7HA 2Y9ZA 1YOVB 2AO9A 2HZDA 2O5RA 2C6YA 2HZTA 4RM2A 5DD8A 3ZQHA 5FLXZ 4IOAF 2F4OB 5IP9J 4HG2A 5ICCA 3OS1A 1X1BA 4W1UA 2Z9OA 4BDYA 3OV8A 1DU6A 3KLNA 4TV7A 3KCCA 1VQKI 2Y0SA 4XRMA 3NARA 1XB4A 1QGPA 1MGTA 5FKOA 4WCGA 1OCZH 3CTAA 4J01A 3DF8A 4OIRF 3HKZN 2E1MC 4PGGA 4BBSJ 2DFIA 3SZGA 3A01A 1U8RA 3I3LA 5KCMA 3HRTA 1IF1A 5KVRA 1HOMA 1JKOC 1XMAA 3PQKA 3DPTA 3RKQA 3DKYA 1ULYA 2DLLA 5EJCA 5LGUA 1PUFA 3AL0C 3LSKA 3ABKH 4HNTA 5EYRA 1V3FA 4HDVA 3KX2A 4PUSA 4B3XA 4I99C 5FJ8J 4AU7A 5DM6F 1JHHA 1ZGAA 4G7ZF 4RBOA 2IS2A 1YG2A 1FP2A 1X2NA 2QQ8A 2ZJRF 1K78A 1GV5A 5M5XJ 2Y2ZA 1LE8A 2HOAA 2L02A 1U0JA 2LBFA 1XN7A 2L5QA 2LYCA 4AYBN 1GXPA 5GAGJ 3ONQA 4BNCA 3E7LA 1JUMA 3AG4H 5J40A 5LEKA 5EZHA 3V7CA 2H6BA 4LFUA 1A36A 3OOUA 2AHQA 2BHYA 2ZJ2A 4GCVA 1IRXA 1MNEA 2VOPA 2BYVE 2P81A 3G1OA 3NWSA 5JFRA 2QA4I 4I01A 5KHDA 2CV1A 1EKEA 1T38A 4V2FA 5DV5A 2ZSHB 3LQQA 5ILUA 1D3YA 1ZKGA 2JVGA 1ETKA 5H6RA 4XR6A 4ESJA 2NRAC 4JX4A 4KFCA 2PQ8A 3BG3A 4JK1X 3TQNA 1OCOH 4II3A 1MBHA 3F8MA 2P6SA 3GXOA 2ECBA 3DLAA 3IRRA 2RC4A 2KKOA 3BCAA 2FQ4A 4ZYGA 2H1LA 3KZYA 1PJRA 2M4GA 5H6QA 1D1CA 3WTXC 3FHZA 4NC8A 3K1PA 4PFOA 1UHWA 3JCUC 2X6OA 1HCRA 3L2WA 1TQIA 2EZHA 4FISA 4EVIA 1ZELA 1IO2A 3OYHA 3S8PA 2JA2A 1RUOA 1JTYA 2W82A 3LSHA 2ZCWA 5M3FJ 5GTHC 2L01A 2HFHA 1XSXA 3VYSB 1B9NA 3HC7A 3H35A 3P9KA 5C44J 2DA1A 4O5VA 2VT3A 3MFKA 4U0WA 1MDMB 2MC3A 2VJ5A 5GPAA 3ZR8X 3ZQIA 4AIDA 3LFKA 3ASOH 4LJZF 1R1TA 2DFFA 2CU7A 2ME0A 1MW7A 4J00A 4IQ4A 1JT0A 1DPRA 4XOPA 2HYFA 2KL4A 3GTMJ 3LWFA 5FKNA 3TOBA 5EDNA 4ZDLA 2XGCA 3RKWA 4CCNA 4Y13A 1XGOA 4MQ9F 3C2GA 1RR8C 2DN0A 4GGGA 4XSZF 4XLHA 1V5EA 2XAJA 3ZMUA 9ANTA 1ZREA 5L3CA 2DI3A 3H9GA 1VQ8I 3ERMA 2VJIA 2EQRA 5DEQA 2FF4A 1XGSA 3ABUA 2MW8A 3M8JA 2IGNA 1WJEA 2M45A 2ZNZA 1KU3A 3Q0VA 3BR6A 5DCFA 3ZQ7A 2M0MA 1ZLKA 3MWMA 4DOZA 2LG4A 4KT5C 2Q0OA 3BR1A 4PJ0C 3ABLH 1NHAA 4HQMA 2VIXA 2W00A 2VKDA 2DPUA 2WC2A 5CVVA 3GYHX 4OMYA 4CH7A 4QSHA 3WODF 3WU0A 5EF6A 1O4XA 2ELHA 3M8FA 2PMZA 4HQEA 3OYKA 4ETSA 3PIPF 1WQ2A 5DM7F 1ZGJA 1IDYA 4MTEA 4XKWA 3U9GA 4XIDA 2UXXA 3BR2A 5IP7J 2IA0A 3CCVI 4LG0A 4A3CJ 3KYLA 1YIJI 1G3YA 1SVMA 2HGCA 3D0SA 3EUHA 3HM5A 3HB9A 2R5YB 3IV5A 2L7ZA 4HRIA 3OWTA 5FO5A 1VQ6I 1TWFJ 3JRFA 4AIKA 1ZYRF 2L9VA 3I59A 1A35A 1BJAA 2DO7A 4RB2C 2ISYA 3QYFA 3VB2A 4LMYA 2QCOA 3OYIA 1UFMA 3L00A 2O6GE 1ZQ3P 5BMZA 3FMQA 5DCMA 1XS9A 2IRFG 4JX6A 4R8HA 3BQZA 4G6DA 1OMIA 1VQ4I 3J81Z 2EWNA 1BW5A 2PJRB 1T33A 3K9TA 2UZKA 4KIFA 1R9TJ 3CJNA 2OZUA 3TO7A 5K7HA 4CCOA 5J47A 2XF6A 1RKWA 1IW7F 2P5LC 2M8GX 1VZ0A 2DT6A 3QPTA 1BI1A 3BROA 4DNCA 5BNGA 1FOYA 1WJ5A 3CQZJ 4WXCA 4CYCB 1T0FA 2EJRA 3H9QA 2H8RA 1WJDA 1BOAA 1K6OA 1R22A 4B47A 1YO5C 4XNFA 3RPQA 1YRNB 3BG7A 2Y48A 5BPDA 3H9JA 2NNNA 5JI6A 3ZP5A 2NOJB 3LA2A 4R79A 4FX4A 3GUDA 1HW1A 2NNYA 2VN2A 4BY7J 2OU2A 1UAAA 2X85A 1KGSA 3L2QA 3K4MA 1HBXG 2ZMEA 1V5GA 1MJ9A 3E5UA 1TP4A 2IAIA 3MEXA 4V2GA 2EINH 2XHKA 4F55A 2F5VA 3OIQA 5B66C 1S6LA 2OTLI 1XC5A 1XX5A 4F7ZA 2EV5A 1SMTA 4LK1F 4YEJA 3V7RA 3LSJA 3ZRGA 4ESFA 2KDZA 1WSUA 4YFKF 2VI6A 3I9V2 3JRAA 2XB5A 2E2HJ 4FT8A 3ZQGA 1MBFA 1V4RA 3G1MA 3DBHB 4Y33A 1YX3A 5F6FA 2A3SA 4IHXA 4RS8A 2DODA 1TNTA 3DQVC 5FLVA 1TNSA 2R7VA 5F1JA 4G94A 2JPCA 4BYYA 1P7IA 4L0ZB 1Y8QB 3G6EI 4ENMA 4AIHA 1YJWI 2ISZA 2UXNA 4B1RA 3DTKA 5E18F 5LBQA 2CSOA 2HOEA 5E3MA 2K9LA 1B1BA 3BG5A 5CQGA 2EZKA 2LKSA 1AU7A 4D7MA 1MSEC 4G9YA 3J80K 4IRIA 2WB1N 3O8GA 4UV9A 3K4CA 2P8TA 2QM3A 5M3MJ 1OCPA 2DMUA 2ESNA 2QSHX 2IVMA 2L4MA 3A0HC 3GZ6A 1Z7LA 3JREA 3CF5F 1SD4A 3EUAA 3RYRA 2VPRA 3O6BB 4MFEA 4QLCU 1E2XA 3F8CA 2VXZA 3TW6A 1QBJA 2FOWA 2DBBA 1A31A 4FCYA 1XCVA 2VQCA 4A2UA 4HF1A 4HA8A 2V1NA 1LFUP 3WG9A 4BGDA 1AOYA 2COBA 1E17A 1HKQA 2KP6A 1LEAA 3BG6A 2H6CA 1OYIA 4PJJA 2XRLA 2LNBA 3GZNB 3KIOA 3GZ5A 4PZJA 2NAZA 1XTAA 3E6MA 4N9HA 2ID3A 4F93B 3JTGA 3O3KA 1YW7A 1G3WA 3M7GA 2ECCA 1YQAA 2DU9A 4WF2A 4EJOA 5JVGF 2ME6A 4A6EA 3VWBA 4RB1A 4E7SA 5ICFA 1Z7UA 2CW7A 5DS9A 2JZYA 1LFBA 1UB9A 2M1BA 4HOBA 1FTZA 4BUPA 2OF7A 4FTHA 2MH2A 3BTJA 2HQ5A 2V4JC 2M9HA 2EK5A 3R0AA 3IUOA 4U0VA 4IHWA 2DA4A 1FC3A 2CGPA 1X4OA 4DJAA 1APLC 2CQQA 3R4KA 6PAXA 3ZQQA 1TW2A 2IP2A 3FF5A 1HQCA 3FDYA 3PFYA 4BY1J 5E8IA 1E0EA 5HNHA 1TBXA 1W7PD 2RN7A 3GF2A 4I7HA 4A3BJ 3DKWA 3GBGA 1FEXA 3C1DA 4KIGA 1GUUA 3L2UA 3N97A 2R7DA 1G59A 1CGPA 1R23A 3DTIA 5HLTA 3E0JB 1FIAA 3ABMH 3KLOA 4C9YA 2DA2A 2HI3A 3PNTA 3D5RC 1MIJA 5BQTA 4E7ZA 4EJUA 2EH3A 4XLEA 3HBLA 3CCJI 1AHDP 3SHFA 2X6YA 2ZJPF 4G6TB 2LY1A 4ENNA 2BHZA 1B4AA 1U9OA 4PDKA 4HSRA 3WE2A 1BIAA 3VEPA 2DK8A 4D5FA 1DP3A 5D6EA 3V4GA 1MH3A 5IOZA 3WTSC 5TRDA 3Q0UA 3JRIA 4CXFA 4BJ6C 3I56I 2BZTA 1KQ9A 2DYRH 5E8GA 3M3YJ 3VDXA 1FY7A 2JTVA 2W57A 3TO6A 5EG0B 2AS5F 1BR4A 1UZCA 4OIOF 1FOWA 3DBLB 3FKIJ 1LJ9A 1B8IA 2BW3B 3K4KA 3FKJA 2X1CA 3G1LA 4BS9A 2XB0X 3CCRI 2XPUA 3U1KA 2LREA 4UVBA 2XPVA 2NVYJ 4IQJA 4E7JA 4ZYAA 3KP3A 2KT0A 4KDPA 1U3EM 4XRSA 4GYIA 2JT1A 2DA6A 2FBHA 4DYRA 5D5UB 1YITI 4DW6A 3CUQB 1TWCJ 2BVLA 5LEJA 2V26A 3HJEA 4A6DA 3DPUA 2EPFA 2FNAA 1ZG3A 3IH4A 2MD0A 1MBGA 3LSIA 2CFXA 1DU0A 2HTJA 4CCJA 5L3DA 4A3EJ 2PMHA 2VKEA 2WTEA 2LY2A 2V6EA 2Q2EB 1PVEA 1FSHA 4IEJA 1UCRA 2E5NA 3IP4B 5E20A 3QPHA 2QF7A 3I55I 3KE2A 3FWEA 2MLKA 2DDAA 5EGOB 1IXCA 3CF2A 2F4IA 4AD9A 2FRHA 5IT3A 2YU3A 5JHFA 2CFOA 2CUEA 2DK5A 2JWTA 2R7TA 4XRFA 4BKXA 2KQRA 2R93J 3OL3A 4RAYA 2KFDA 1P4XA 2J5OA 4XKVA 3AG1H 3Q9SA 2XDVA 3DU5A 2MBFA 1Z1DA 1JGSA 1F1ZA 2A6EF 2XIGA 3E97A 3SXYA 4B48A 1XDUA 4EM0B 4A3KJ 1HDPA 3RZDJ 1T95A 2DCEA 4N0BA 2LTPA 1EV7A 1W7PB 2A5WA 4PFPA 3VYRB 3OS2A 1TW3A 3JR9A 2ZFWA 4ZTFA 4ZH4F 1SMYF 3WTZA 1FYMA 4LGWA 4JX5A 2RREA 3K0LA 1IC8A 4MNUA 3SZTA 1T8IA 1T6SA 3WHBA 2LK2A 5FGMA 3W3CA 4A0YA 2E2JJ 1MZBA 4D1QA 4GO1A 1MBJA 4E4HA 3BJ6A 3LA3A 1OR7A 2F5FA 2JSPA 2WAEA 3IH3A 2FUG2 2LY9A 1OKRA 5EEHA 3S93A 1WCMJ 4G8XA 4I0BA 5AIPA 3V8JA 5HNFA 2ACJA 4U7DA 5FLXK 2A05A 2QKLB 2XROA 4A12A 3PSFA 4YFXF 3VYUB 5TISC 1LVKA 1Z67A 2LKXA 2LD5A 1SD6A 4YG2F 4LLLA 1TT0A 1W0UA 4RGRA 3HSFA 2EFWA 2O3FA 1BR2A 1WI9A 4LITA 1TLHB 4RLQA 1Z77A 4CDGA 2E19A 3WTTC 3S15J 2R5YA 4M71A 3MKYB 2RNGA 3B6CA 1LPQA 4FHTA 1FZPB 1RUNA 3QU6A 1U6GA 4FE7A 5DD4A 1FSEA 4XLNF 2K27A 3GTGJ 4JP0A 2YUSA 2I10A 3CCUI 3ZMTA 1LB2A 3HTSB 2AQFA 3M1CA 3IAS2 4HBLA 2NS0A 2X1DA 3IHUA 1FLIA 3BCBA 1KU2A 1FT9A 4C2TA 4O3MA 3D5SC 2CJJA 2E5ZA 4AC0A 1ZRDA 4L18B 1Y6IA 4I09A 1HKTA 3OS0A 2DMQA 2ICWG 2HKOA 2D1HA 4HF0A 3BT9A 3SYTA 3F23A 3E1SA 4UVCA 1I50J 1UG2A 3RSNA 5JR3A 3BPVA 1JKQC 2KIFA 4EJTA 3QP5A 1O3SA 3CCLI 3HKZA 1DP7P 4UUVA 2XAUA 1QHHD 2QUFA 1MMSA 1D0XA 4IVNA 4RAGA 4B43A 1IAWA 2HXOA 5D5XB 4C2MJ 4XORA 1X1PA 4I76A 4CYCA 2RKHA 3CCQI 3TO9A 2DA7A 3RYPA 3VOEA 4OIQF 2DOAA 2UWMA 1JJ8C 1IG7A 2TRTA 2XRNA 3OL4A 4JOMA 5J4VA 3N4MA 1X4PA 2ZXIA 2CMPA 1YRNA 2M3AA 1ETWA 3MMYB 1V55H 3CUQC 1WJAA 2FD5A 4M6XA 2ELJA 5HS8A 3NAUA 4KIBA 1F5TA 2EA4A 4KN7X 4A3MJ 2XC7A 2HYJA 4A93J 2YR2A 4B4CA 4YELA 5D5VB 1JT6A 1AA7A 1YTYA 2AXLA 1RC9A 5FFXA 3LQRA 1Y8RB 3QOEA 4E7KA 4P1WA 3CO7C 4AYBA 4M9ZA 2CG4A 1HXDA 2BY2A 4MFDA 1USTA 3WHCA 5IYDJ 1Z9CA 2P6TA 4GXOA 2L9SA 5H2FC 5L3BA 4ZYDA 4A69C 1TL8A 5FKMA 4IJAA 1J7KA 1DGRM 4HZFA 5CVJA 3I54A 2P7CB 4MGRA 1NK2P 5HS9A 1E3OC 1VI0A 3CJTB 4M74A 3CJRB 3GX4X 1QNTA 1R00A 3BZCA 5DUIA 2NVQJ 4GYGA 3CJQB 1ETYA 3VSLA 2COMA 2E34A 2QQAA 2VUMJ 1MMAA 5DTDA 2YS9A 1C0WA 4I2OA 1HLVA 4BU2A 4IOCF 2K9MA 3I64A 2O7OA 3KEOA 1VF9A 2Y0MA 2HU9A 4UNOA 1IRFA 1O3TA 3HSRA 4A0ZA 4BQAA 2ZKZA 2LRDA 3HHHA 3OYLA 3DXJF 5BS6A 1HW5A 4FASD 2PEXA 1ZHFA 2LH9A 3HOTA 5FROA 3G3ZA 3RDIA 4M9XA 3GTOJ 1B59A 2XKPA 2R0QC 2IS4A 1SFEA 2VQLA 2XAQA 4M6YA 4RAFA 4DYCA 2Y0SN 3R6SA 4Q5SF 1GV2A 1TQMA 1VQOI 1LDJA 3M1EA 2XPWA 1XSVA 4FQGA 3OYAA 3HUGB 1REPC 4IXAA 4BEHB 1YYVA 1S7OA 2F48A 2O9LA 2F4MB 4IZZA 5HDKA 3C2BA 2JRTA 2X9DA 4BJ5C 4HNUA 5GAEJ 5E17F 5CLSA 1FPQA 1P7JA 3RZOJ 3FXMA 2X0LA 3HRSA 4PJMA 3K4LA 3HOZJ 2GXAA 3LSPA 2B9SA 4BACA 4B8XA 1IXSB 2IXSA 2QGUA 2DQRA 3GFLA 1HSJA 1XCBA 3SQNA 2V79A 3TMOA 2D45A 2G7UA 4C3IJ 3EYYA 4ZYHA 1V5FA 2LF7A 2OV7A 2RQQA 1Y1VJ 2PN6A 3W6JB 4C2UA 2B63J 4I6ZA 4M3EA 1ERDA 5HDNA 1SC7A 3H5NA 4G7HF 2ADUA 1ZG5A 1Y0UA 4PJLA 2JK3A 1MD0A 4XMYA 1L0OC 4QWQA 1X1AA 2R92J 1W5CC 2MC4A 4KISA 1Q1VA 3L2CA 3J7AO 3KPHA 1BBYA 1J5YA 4D5CA 2HOTA 2PFBA 3GTLJ 2L3DA 1S3JA 1P92A 3ZN0A 1D1AA 4YIRX 1PP8F 1K4SA 2PJPA 4ZYEA 2A07F 1UELB 5E1ZB 2EV6A 4A0XA 1R5HA 5D8KB 2ZBKA 1G6NA 1IXRC 3JTHA 3J81K 3B73A 1O3RA 4RMNA 1TTYA 4CCLA 3PUFA 1G8XA 3PO2J 3T8RA 5C3EJ 3IH2A 4PK4A 1GLNA 3OIPA 4CSWA 1S72I 5J8FA 1MJAA 3B6AA 3QYEA 3JRBA 3GTKJ 2JA8J 2CUZA 2W4SA 2DXIA 4EQQA 2ZXWH 4CGZA 2HWVA 3K7AJ 5F27A 4EV0A 3KEYA 4MO7A 5ILSA 5EZGA 4XICA 2QEXI 1FYLA 5ICEA 2A6TA 5EG0A 3S2HJ 1Y0NA 2VBYA 2TDXA 2G9WA 3BOQA 2K40A 2WY7Q 4RGSA 4U87A 4AM3A 5JLWA 2KMUA 1S9HA 2P4WA 1FNNA 1U5TA 2M7AA 2V9PA 4Y15A 4CA0A 5B3SH 1HC8A 2V9VA 4GFBA 3PO3J 2WBMA 2JQ7A 3ZMSA 3CUQA 1UHSA 2RGVA 3NWTA 5KK1A 5D4RA 3MCZA 1FOXA 3IWZA 3CO6C 3B02A 1ZG1A 3HSEA 3CMMA 2IA2A 2JRMA 4D9JA 1YS6A 3DV8A 2EFPA 4HNVA 2VE8A 4Q4ZF 3D1NI 4C3HJ 4A3JJ 2DMNA 5LD2C 5IT9Z 2HNHA 3LNQA 1LKXA 2Q2EA 4L5EA 1KQ8A 4KITB 1H89C 5K7FA 2LVSA 4NNJA 2I8DA 1KU7A 1VQPI 5EGOA 1OISA 3H3ZA 2FSWA 3IKTA 1Z21A 3KP2A 3LOCA 3GEZA 3C18A 5FKLA 4EM1A 1YE9A 3BTIA 1VTNC 3HYIA 2X1EA 3DPLC 1R4NB 2R7OA 2CQNA 1V54H 1WH7A 4WXHA 1DGWY 2ZNYA 4CYDA 2FQ3A 2RV8A 1LEBA 1RKTA 1EF4A 3GTQJ 1NG6A 4A3GJ 3GFIA 5M5YJ 1TWHJ 1W7PA 4BL0B 1QVTA 3HOYJ 2ETHA 3CD6I 3CMYA 4ITVA 1FBSA 2DMTA 2VBXA 3T5XA 2BE5F 5GPCA 2L54A 3HHGA 2YU9J 2CWEA 3HG9A 3SDGA 3OYDA 3UKGA 3S16J 3FXLA 3HL2A 5ERIA 4UVAA 2VOOA 3CDHA 3CP2A 3ULQB 3RPUD 1T39A 4IRGA 1VQ5I 3KYDB 2DA3A 2MABA 3PJRA 1ON1A 2HKXA 4RGUA 2R5ZB 1GXQA 1S7EA 1BI2A 2DOFA 1SFXA 5KAIC 4X1EA 3HRUA 2M8EA 2F5EA 2HDCA 1B9MA 5L3GA 1K83J 1DDNA 4M6VA 1R5ID 3H3UA 2VE9A 1G3TA 3QRFF 1WJCA 3NEUA 4NBQA 4CICA 3BPXA 4XKCA 4RGXA 1LUJB 5FKKA 4HF2A 1Z05A 2R7FA 3H3VK 1SFOJ 5CJ9A 5E1WA 2JA6J 1BI3A 2A61A 3S14J 1IV8A 1SVLA 3GFMA 1W5TA 2MSYA 2HOSA 1IN5A 3ZQLA 1TC3C 1GT0C 1X1DA 4ZZLA 1RESA 3PNVA 1BN5A 1IN4A 2OBPA 1ZTRA 1D0ZA 4XQFA 1PUFB 2VASA 1J9IA 1ZR4A 2EFQA 1VFCA 3J7AY 3AAFA 2TCTA 3E5QA 5DDGA 5AIQA 4BH9A 1U78A 2W7NA 4UUTA 5D6FA 1ACIA 1I3AA 1ETXA 5K1YA 2IBDA 2BBYA 4XKBA 2CV0A 3I58A 1I6XA 2DPDA 2H8WA 3GCMA 3VPRA 4KNYA 2F5CA 4U88A 2LBFB 2OQGA 5BOXA 3HDDA 1TWAJ 1R6RA 3CUOA 1BC7C 1AKHB 3K1MA 2JA5J 4NQWB 1XDSA 1E3HA 2QVOA 1YW9A 2R4GA 3I53A 4BXFA 4M72A 1XD7A 3T8TA 3WTWC 3FMRA 1KZHA 3K10A 4E7LA 2LKPA 2P7VB 1FP1D 3QYBA 1CF7B 3TBIA 1ZGWA 3U2RA 1YX5A 1ODDA 2O03A 2K7LA 2VXDA 3F6VA 1J0RA 2VT2A 2NS8A 1UG0A 3LFUA 1SD7A 2X48A 4AVPA 5CVIA 3ZXSA 2W24A 2D5VA 3E6CC 3M8EA 3L2VA 4OAZA 1FMWA 3ZMVA 3ECHA 2OCCH 2VPLA 3BG9A 1LVAA 3E6DA 1VQMI 3O8HA 2PG4A 1A5JA 4LD5A 1F36A 3FBIB 2ZJQF 1H88C 2HDWA 3ZMDA 4DZPA 1BOBA 1OYWA 2NXNB 2OCEA 1LDDA 2QSGX 3K4NA 1ZARA 3LSGA 1MJBA 3ZGKA 4WWCA 2HPIA 3OSGA 2EIMH 2CYYA 2IGKA 1R1UA 1MBKA 3K4JA 4WX9A 2G7HA 2H09A 1SANA 5CKTA 3V8KA 5C4JJ 1HDDC 2RAEA 4R1HA 2R3SA 5HVQC 5CQEA 2V6CA 3OR1C 3DFGA 2W1OA 1T56A 2GBYA 1LFPA 2HXIA 3A2KA 3K69A 3LA7A 2E1NA 3LSMA 4E6KG 2LR8A 2FX0A 2OA4A 3W2WA 1A04A 4C3JJ 5FRNA 1LQ1A 2VONA 2KJCA 3ZPLA 3WTVC 4MEXF 1B6AA 3L9FA 1G4DA 1ETQA 3COAC 1FWZA 2MG4A 1H9TA 3SEZA 1RNLA 3JAMZ 4I98B 1FJLA 4M73A 3CCMI 2GA1A 5A2QZ 5JVTA 1JE8A 4Y52J 1SEUA 3BDDA 3GW2A 1U8BA 1ETOA 5ICGA 3K2AA 4II2A 2HQRA 3RKXA 3HUGA 3LMMA 2CRGA 4BEHA 3QQAA 4Y7NJ 1X2MA 2QENA 3Q3SA 3VFZA 2CH0A 2HEOA 4OIPF 2K4JA 3JW4A 1JJ6C 4P96A 3OYFA 1XGMA 2VQHA 1ZN2A 2OPTA 1R36A 1KA8A 4XBFA 1FBQA 5AONA 2ZO4A 3BZKA 1L3LA 2L7FP 4ENKA 2BV6A 3RQ4A 4EGYA 3LSTA 3V8LA 4NDLA 5LLQA 1OCTC 4DIQA 2VJJA 2YPRA 3MZYA 4RB0A 1JKPC 4UXNA 3W2VA 4QPOA 4LB6B 2O8XA 3BP8A 4OWRB 1EA3A 2KRFA 1YW8A 4ESBA 1SFKA 4CCMA 2IGMA 5J3LA 4IHVA 2P0WA 1MDMA 3F8FA 4XK4A 3C2HA 2IEKA 1QVUA 2L2OA 3LL7A 4GRIA 1HW2A 5J6XA 3MKZA 2K9SA 4JYKA 1W36D 1BC8C 4Q47A 3EDPA 3HPGA 3MAJA 4EMSA 2DYSH 4BQQA 1OPCA 5B1AH 1Z6RA 3HTUA 3OSFA 3ASNH 2E60A 2LLKA 3HOUJ 3HOSA 2EA2A 4JQFA 1X3UA 3MD2A 4BE0A 4F91B 4LG3A 1I27A 4IL6C 4DQ2A 1T2KA 1Q1HA 1WWXA 1N78A 2Z99A 2NOGA 4KMFA 3P5JA 3WGIA 4G6QA 4M3GA 4ZDPA 4D0PA 1ENHA 5GTIC 1JKRC 1VQ9I 2DOEA 1Z6TA 4B44A 1WRJA 5CVRA 1VNDA 3RQIA 1XPXA 4PSXA 1S5LC 1X58A 4HX4A 4XL9A 2R7ZJ 1GVDA 2ZFUA 4E7IA 2EBIA 3OMYA 4N9IA 2O61A 4OMZA 3ZQFA 2A68F 3WG7H 1QZYA 2Y75A 2Y9YA 3BJAA 4UB6C 4EJWA 1EH8A 2M30A 4LIUA 1D1BA 2ZSIB 4LK0F 4MHGA 1ONVA 2OUMA 1VQ7I 3AG2H 2L7MP 3RKYA 3EYIA 1QQIA 3FM5A 4HX8A 3MVPA 4G12A 4EATA 4XONA 1A6QA 3CLQA 3OYMA 1FMVA 3E3VA 2OQRA 3HGYA 2HYGD 3OOPA 3GLXA 4L9VA 2WAQN 4NHJA 3WU2C 2EIKH 3RJPA 2B0LA 1ORKA 2YX4A 1BR1A 3IWFA 2Z33A 3UR3C 3QWLA 3BR0A 1TWGJ 3WTYC 4ON0A 4QIWN 5J1RA 1FOKA 1JTXA 1JGGA 2ID6A 2DT7B 4KMUX 2FMLA 4NC6A 2KHMA 2A6HF 5LGTA 3FXQA 3ISPA 5HLIA 1R58A 4FETA 1OQYA 1ON2A 4K2EA 3K2ZA 3KEQA 4BBRJ 1IGNA 3JRCA 3ROUA 4XM3A 5B5EC 3FHNA 1ETVA 5E79C 4I0AA 2LF8A 4FE4A 3S3OA 3K6GA 1ZR2A 1QA6A 2JN6A 1TZLA 2PJRA 3BTLA 4LLNA 3F9KA 3QAHA 2A69F 4HV5A 3X2QH 5FRMA 2F6CA 3A1YA 3C3WA 3TEDA 1MKMA 2V1UA 1OYYA 5J1UA 2I5UA 1W0TA 3FIWA 2QBYB 3T1BA 1WJBA 2BY0A 4HLXA 4A5NA 3J7ZI 2Z3YA 2HS5A 1B72B 3CP8A 1HSTA 3S1RJ 2R7SA 2DJNA 3F3XA 4N4OB 1MMDA 1WI3A 2CW8A 2R7QA 4YIIA 1WPKA 1PP7U 2VODA 2CO5A 2E35A 2E2IJ 3SFIA 5E3NA 5IOYA 1N25A 1YLFA 2J5PA 3RIRA 3MKWB 1DQUA 2CS3A 4UUSB 3CDLA 1R71A 2K86A 1HF0A 5GP9A 2K3FA 4HLYA 3I5UA 4CO8A 3BTCA 5L3FA 1JI8A 4XLCA 4OAYA 2HVQA 2NYXA 3JSPA 2H1KA 1XSDA 2XVCA 2R5ZA 4Y3OA 5HODA 2FE3A 4IHTA 2VC0A 4D7NA 3EUHC 3T0YA 2JA7J 1RR7A 3QU3A 4ZTJA 1RI7A 1O3QA 1O7FA 4RDUA 4U0YA 2QKMB 5L3EA 3JRGA 1IJWC 1K79A 2OC6A 5K5RA 1HKSA 3BQYA 3OYBA 3GTJJ 2JUGA 3R60A 1SAUA 1U9NA 2W48A 5IY5H 1JHFA 2FA5A 1D8KA 2N8GA 3LAJA 2IT0A 1DPUA 3O2PE 2MGQA 1BM9A 3HZJA 1MNDA 4C30A 4DZJA 5FLMJ 4HDUA 2ZB9A 3I4MJ 4Z6YA 1Y56A 3A03A 4HX7A 2LC2A 1MMGA 1YFHA 2LOOA 4ANJA 1K6YA 3JSOA 1W5SA 5FB2A 1MNMC 4M9SA 3UNGC 3PSIA 2MH9A 3MZ8A 1T0FC 3FX3A 2HQNA 1N77A 4GDFA 1XMKA 1QZZA 1IZ1A 1AKHA 3CESA 4ENJA 2E7XA 4NQWA 3HPHA 3K1NA 4BQNA 2F2EA 2V1XA 3H0DA 2E7WA 3PM1A 1YJNI 2CV2A 3Q5FA 2YX7A 4DGWB 1CF7A 3L7WA 1RETA 2ZMEC 3A4CA 3RTRA 1W1WE 3QOPA 2CQ7A 5F64A 3WE3A 3K70C 3TP0A 4IHYA 2WA0A 2M5WA 3E5XA 5E1XA 1Z3XA 2RNJA 1B8IB 3PNYA 1JUSA 2EILH 1KYZA 2L9RA 1WH5A 4XLFA 4KICA 4I02A 1ITYA 2EV0A 4BQOA 2IS6A 3EUKL 4A3IJ 1I6HJ 2GOMA 2VLAA 1OFCX 3VYTB 2IS1A 5JHUA 2VB6A 2XF5A 3RPUA 5IT9K 4AVZA 2KZGA 2KIQA 1O7LA 2E1OA 4NB5A 2DAOA 2X6XA 4XLPF 3KZZA 1F9NA 5M5WJ 2PLYA 4MQVA 3V42A 3GMEA 2HDDA 1YHQI 4FX0A 5F08A 3H5AA 2R7WA 2LDUA 1D8JA 5HDGA 2XAGA 5FD5A 5IPAA 1CQTA 2Y69H 3KP7A 2QQBA 3CLOA 1F43A 1W36C 3BR3A 4H0EA 3GTPJ 4BE1A 2GIVA 4F92B 1JXSA 1OCCH 4EJVA 5LHGA 1SVOA 2M7BA 3LSRA 3F8NA 2H94A 1GVJA 4M3BA 1OCRH 3H1CA 2X6WA 4Y4RA 1IUYA 1I5ZA 2W84A 4B09A 1R49A 4HYEA 3KP5A 1ZK8A 5K5OA 1U2WA 3KZIC 3G2BA 2XAFA 2ELKA 2FU4A 3PUBA 2R7XA 1OLTA 3NQOA 2HQAA 3P7NA 3R61A 2Z16A 2BW3A 3ELKA 2K02A 1YJ9I 3OR2C 3DLLF 1SAXA 1W4MA 2GM4A 2GA2A 2XF7A 5J1YA 4ZZDA 4X0GA 3F22A 1ZLJA 1STZA 4UV8A 4MTDA 3NRVA 4CCKA 1J09A 1P6RA 1RZ4A 5J8CA 2JVHA 2DA5A 2V9KA 4L0YB 1X3WB 3F21A 2BY1A 1X1CA 2GAUA 1BL0A 1WZ2A 2EB7A 2BGCA 3BR5A 2FJ1A 3QPSA 1VQLI 4U7BA 2DDBA 1NG7A 4DBQA 2M2EA 2QWWA 3Q0WA 1H8AC 5GADJ 3CCEI 1I3QJ 3H0GJ 4P5OA 4CZZA 3S1QJ 2Z1DA 2BXYA 1IN8A 1IRZA 2Z2SB 2DFHA 3ZN1A 3S17J 3JRDA 3JRHA 3QP6A
chains in the Genus database with same CATH topology
2F5DA 4LB5A 4ASNA 2O0YA 3ML6A 5CYVA 4HAMA 2Q8KA 2QZ8A 4KN4X 2A5YB 2ZXJA 1S8NA 1K7AA 2P5VA 1ZAOA 1H0MA 2ESHA 3ERED 2D2WA 2VBZA 2KIMA 3MZHA 3ECOA 1BI0A 4L5IA 5LRRA 2EFNA 5FD6A 2BEOA 2Z5UA 3C7JA 2QYOA 4KA4A 1S29A 4EM2A 5FFZA 5LHHA 2DTRA 2STTA 3TDZC 3BWGA 4RAZA 3HRMA 1DUXC 1BIBA 3IC7A 2X4HA 2GXGA 1XGNA 4E70A 1R7JA 2XKOA 2FEZA 3FZVA 4P55A 2FOKA 1KQ0A 4Z2YA 5ED4A 2FMYA 5D8LB 3TGNA 4A5MA 2D1VA 3MQ0A 4L9JA 2V1DA 1PUEE 2H27A 1F4KA 1SFUA 1LDKB 1K78B 2DW4A 1R1VA 3WGGA 1LNWA 5ILVA 4OU0A 2QBYA 5LRSA 4LLGF 3JAMK 3EETA 3FM3A 5A2QK 2KJBA 1YIOA 3M9AA 4L5JA 3W6KB 3U1DA 3G73A 2FXAA 3Q9VA 4BHPA 2HTSA 4BXUA 2GXBA 2PMUA 5LGNA 2XAHA 1QPMA 5CVUA 2K4BA 4L9NA 3H92A 3DP7A 1P4AA 4PCQA 3HIFA 3REOA 1KYWA 3LAPA 1I1SA 4WXDA 3VODA 2XV4S 4HW0A 4P9UA 2E1CA 2IJLA 1IRGA 2RQPA 3P9CA 5EEGA 2OAZA 2VC1A 3SFZA 4MEYF 3IL2A 3E6BA 5H20A 2OD5A 2RDPA 3PQJA 3BY6A 4KYWA 1EH6A 1GHCA 3KFWX 3GFJA 2W85A 3FXUA 3J80Z 4IRHA 1J75A 4S04A 2HR3A 2XGXA 4P9FA 2LSOA 4L9TA 3I4PA 2IA1A 3I0TA 3BJOA 2EFOA 3R0JA 4O6JA 1PDNC 5BPIA 3ZMZA 4AWXB 1J2XA 2WWYA 2KIUA 5K5QA 1ZH5A 5D4SA 2L4AA 2YSRA 3TOAA 5LHIA 1EH7A 3GO5A 2OZ6A 2CW0F 3L09A 4Q48A 1U5TB 4JBAA 4LG0B 5HOOA 2FNPA 3F6OA 1ZRCA 4KUMA 3FMSA 1FX7A 5F1RA 1KU9A 3TKYA 1O57A 4HV6A 1QO0D 3I59B 3WTUC 1FBUA 1T98A 2CQKA 3DEUA 3ABTA 4YIFA 2PI0A 1RIOH 2P5KA 5DCMB 2XUBA 1AWCA 1IN6A 4UHTA 1IN7A 2IPQX 3KP4A 3D5LA 3KP6A 2GWRA 1R5GA 1G3SA 2RVCA 1D5VA 2MLGA 3TDUC 3KETA 3WGHA 2MD5A 2M87A 4IF4A 4S05A 1TQPA 4IHSA 2FBIA 1UHMA 1I1GA 1P4WA 4WK8F 1YS7A 2ZMEB 4XSXF 5HLGA 1USSA 2XASA 4Y17A 4AIJA 3SZPA 2JPBA 1ZRFA 4CHUA 3F72A 1S7AA 4YFNF 3GVAA 2QQ9A 4BHBA 1FYKA 1J59A 2GQQA 2QLZA 3WU1B 1Z91A 3RI4A 4BHCA 2MA3A 4OINF 5TJJA 3S2WA 3V7SA 3IKVA 3I71A 3F8BA 2PBIA 2WV0A 4EGZA 4G7OF 5D5WB 5DYMA 1SD5A 2IW5A 2JSCA 3IRQA 1WKMA 3BZ6A 3FXRA 5DUKA 4PGHA 4BAYA 2DQLA 5HLHA 3EQLF 2STWA 2VBWA 2W25A 3GWZA 4RB3C 1H9GA 3PFIA 2FBKA 1U5TC 4OOIA 2GZWA 4IPAA 2DT5A 3P9IA 5HS7A 1P2FA 2C6YA 2HZTA 5DD8A 5FLXZ 5ICCA 2Z9OA 3OV8A 3KLNA 4TV7A 3KCCA 1XB4A 1QGPA 1MGTA 4WCGA 3CTAA 3DF8A 4OIRF 4PGGA 2DFIA 1U8RA 3HRTA 1IF1A 5KVRA 1XMAA 3PQKA 3DPTA 1ULYA 2DLLA 5LGUA 1V3FA 4HDVA 1JHHA 4G7ZF 1ZGAA 1YG2A 1FP2A 1K78A 2L02A 1XN7A 1GXPA 4BNCA 5LEKA 3V7CA 2H6BA 4LFUA 2ZJ2A 4GCVA 2VOPA 2BYVE 5JFRA 4I01A 1T38A 5DV5A 3LQQA 5ILUA 1D3YA 5H6RA 4ESJA 2NRAC 4KFCA 2PQ8A 4JK1X 3TQNA 3F8MA 2P6SA 3GXOA 3IRRA 2RC4A 2KKOA 4ZYGA 3KZYA 5H6QA 3WTXC 3FHZA 3K1PA 1UHWA 1TQIA 4EVIA 1RUOA 2ZCWA 2L01A 2HFHA 1XSXA 1B9NA 3P9KA 4O5VA 2VT3A 3MFKA 4U0WA 1MDMB 2MC3A 3LFKA 4LJZF 1R1TA 1DPRA 2HYFA 3LWFA 3TOBA 3RKWA 4Y13A 1XGOA 4MQ9F 4GGGA 4XSZF 2XAJA 3ZMUA 1ZREA 5L3CA 2DI3A 5DEQA 2FF4A 1XGSA 3ABUA 2M45A 2ZNZA 1KU3A 5DCFA 3ZQ7A 1ZLKA 3MWMA 4KT5C 2Q0OA 1NHAA 4HQMA 2DPUA 2WC2A 5CVVA 3GYHX 4OMYA 3WODF 3WU0A 2ELHA 3M8FA 4HQEA 4ETSA 1WQ2A 1ZGJA 4MTEA 3U9GA 2UXXA 2IA0A 4LG0A 1G3YA 2HGCA 3D0SA 3EUHA 5FO5A 4AIKA 1ZYRF 3I59A 1BJAA 2DO7A 4RB2C 2ISYA 3VB2A 4LMYA 1UFMA 3L00A 2O6GE 5BMZA 3FMQA 5DCMA 2IRFG 4R8HA 4G6DA 1OMIA 3J81Z 2EWNA 3K9TA 2UZKA 4KIFA 3CJNA 2OZUA 3TO7A 1IW7F 2P5LC 3QPTA 1BI1A 3BROA 4DNCA 4WXCA 1T0FA 2EJRA 1BOAA 1K6OA 1R22A 1YO5C 3RPQA 2Y48A 5BPDA 2NNNA 5JI6A 3ZP5A 3LA2A 4R79A 4FX4A 3GUDA 1HW1A 2NNYA 2VN2A 2OU2A 1KGSA 1HBXG 2ZMEA 1MJ9A 3E5UA 3MEXA 2XHKA 1S6LA 4F7ZA 2EV5A 1SMTA 4LK1F 3V7RA 4ESFA 1WSUA 4YFKF 4FT8A 1V4RA 5F6FA 2A3SA 4RS8A 1TNTA 3DQVC 1TNSA 4G94A 2JPCA 4BYYA 4L0ZB 4ENMA 4AIHA 2ISZA 2UXNA 5E18F 5LBQA 2CSOA 2HOEA 1B1BA 4G9YA 3J80K 4IRIA 4UV9A 2P8TA 2QM3A 2ESNA 2IVMA 2L4MA 3GZ6A 1SD4A 3RYRA 3O6BB 4QLCU 1E2XA 3F8CA 2VXZA 1QBJA 2DBBA 4HF1A 1XCVA 4A2UA 4HA8A 3WG9A 1AOYA 1E17A 1HKQA 1LEAA 2H6CA 1OYIA 2LNBA 3GZ5A 4PZJA 2NAZA 3E6MA 4N9HA 3JTGA 3O3KA 1YW7A 1G3WA 3M7GA 1YQAA 2DU9A 4WF2A 4EJOA 4A6EA 4RB1A 5ICFA 1Z7UA 2JZYA 1UB9A 2M1BA 4HOBA 2MH2A 2EK5A 3R0AA 4U0VA 2CGPA 1FC3A 3R4KA 6PAXA 1TW2A 2IP2A 3FF5A 1HQCA 5E8IA 1TBXA 1W7PD 2RN7A 3GF2A 4I7HA 3DKWA 3C1DA 4KIGA 3N97A 2R7DA 1CGPA 1R23A 3KLOA 5BQTA 4EJUA 3SHFA 4ENNA 1B4AA 4PDKA 3WE2A 1BIAA 3VEPA 2DK8A 5D6EA 3V4GA 3WTSC 5TRDA 4CXFA 1KQ9A 5E8GA 1FY7A 2JTVA 2W57A 3TO6A 2AS5F 4OIOF 1LJ9A 4UVBA 3KP3A 4KDPA 1U3EM 4GYIA 2JT1A 2FBHA 5D5UB 3CUQB 5LEJA 4A6DA 2FNAA 1ZG3A 2CFXA 2HTJA 5L3DA 2PMHA 2WTEA 1FSHA 1UCRA 5E20A 3QPHA 3KE2A 3FWEA 2MLKA 1IXCA 4AD9A 2FRHA 5IT3A 2YU3A 2DK5A 4XRFA 4RAYA 1P4XA 2J5OA 3Q9SA 2MBFA 1Z1DA 1JGSA 1F1ZA 2A6EF 4EM0B 2XIGA 3E97A 3SXYA 1XDUA 4N0BA 1EV7A 1W7PB 1TW3A 2ZFWA 4ZH4F 1SMYF 3WTZA 1FYMA 4LGWA 3K0LA 4MNUA 3SZTA 1T6SA 5FGMA 4A0YA 1MZBA 4GO1A 3BJ6A 3LA3A 1OR7A 2F5FA 5EEHA 1OKRA 4I0BA 4G8XA 5AIPA 3V8JA 2ACJA 4U7DA 5FLXK 2XROA 4A12A 4YFXF 1SD6A 4YG2F 4LLLA 4RGRA 3HSFA 2EFWA 2O3FA 1WI9A 1TLHB 4CDGA 3WTTC 4M71A 1FZPB 4FHTA 1RUNA 3QU6A 1U6GA 5DD4A 1FSEA 4XLNF 2K27A 1LB2A 3ZMTA 3HTSB 4HBLA 2NS0A 3IHUA 1FLIA 1KU2A 1FT9A 4O3MA 1ZRDA 4L18B 4I09A 1HKTA 2HKOA 2D1HA 4HF0A 3F23A 4UVCA 5JR3A 3BPVA 2KIFA 4EJTA 3QP5A 1O3SA 1DP7P 4UUVA 2QUFA 4IVNA 1IAWA 5D5XB 2RKHA 3TO9A 3RYPA 3VOEA 4OIQF 2UWMA 2XRNA 3N4MA 3CUQC 4M6XA 1F5TA 5HS8A 4KIBA 2EA4A 4KN7X 2YR2A 5D5VB 1YTYA 2AXLA 5FFXA 3LQRA 3CO7C 4M9ZA 2CG4A 1HXDA 1USTA 1Z9CA 2P6TA 4GXOA 5L3BA 4ZYDA 4IJAA 1J7KA 5CVJA 4HZFA 3I54A 2P7CB 4MGRA 5HS9A 4M74A 3GX4X 1QNTA 1R00A 5DUIA 4GYGA 2COMA 2QQAA 1C0WA 4I2OA 3I64A 3KEOA 2Y0MA 4UNOA 1IRFA 1O3TA 3HSRA 4A0ZA 4BQAA 2ZKZA 3HHHA 3DXJF 5BS6A 1HW5A 2PEXA 1ZHFA 3HOTA 3G3ZA 3RDIA 4M9XA 1B59A 2XKPA 1SFEA 2XAQA 4M6YA 3R6SA 4Q5SF 1TQMA 1LDJA 3M1EA 1XSVA 1REPC 4IXAA 1YYVA 1S7OA 5HDKA 2JRTA 5E17F 5CLSA 1FPQA 2X0LA 3HRSA 4B8XA 1IXSB 2DQRA 3GFLA 1HSJA 1XCBA 3SQNA 2V79A 2D45A 2G7UA 3EYYA 4ZYHA 3W6JB 2LF7A 2PN6A 5HDNA 4G7HF 2ADUA 1ZG5A 1Y0UA 1MD0A 1L0OC 4QWQA 3L2CA 3J7AO 1BBYA 1J5YA 2PFBA 2L3DA 1S3JA 1P92A 3ZN0A 1PP8F 2PJPA 4ZYEA 2A07F 5E1ZB 2EV6A 4A0XA 1R5HA 5D8KB 2ZBKA 1G6NA 1IXRC 3JTHA 3J81K 3B73A 1O3RA 1TTYA 3T8RA 5J8FA 1MJAA 4EQQA 4CGZA 2HWVA 4EV0A 5ILSA 1FYLA 5ICEA 2VBYA 2TDXA 2G9WA 3BOQA 4RGSA 2P4WA 1FNNA 1U5TA 4Y15A 2V9VA 3ZMSA 3CUQA 2RGVA 5KK1A 5D4RA 3MCZA 3IWZA 3CO6C 3B02A 1ZG1A 3HSEA 2IA2A 4Q4ZF 1YS6A 3DV8A 2EFPA 2VE8A 5IT9Z 2Q2EA 1KQ8A 1KU7A 3H3ZA 2FSWA 3IKTA 3KP2A 3GEZA 3C18A 4EM1A 1VTNC 3HYIA 3DPLC 4WXHA 2ZNYA 4CYDA 2FQ3A 2RV8A 1LEBA 3GFIA 1W7PA 2ETHA 1FBSA 2VBXA 3T5XA 2BE5F 2L54A 3HHGA 2CWEA 5ERIA 4UVAA 2VOOA 3CDHA 3ULQB 1T39A 4IRGA 1ON1A 2HKXA 4RGUA 1GXQA 1BI2A 1SFXA 3HRUA 2M8EA 2F5EA 2HDCA 1B9MA 5L3GA 1DDNA 3H3UA 2VE9A 1G3TA 3QRFF 3NEUA 4CICA 3BPXA 4RGXA 4HF2A 1Z05A 2R7FA 5CJ9A 5E1WA 1BI3A 2A61A 3GFMA 1W5TA 1IN5A 4ZZLA 1BN5A 1IN4A 2OBPA 1J9IA 2EFQA 3AAFA 3E5QA 5DDGA 5AIQA 4BH9A 1U78A 5D6FA 5K1YA 2BBYA 3I58A 1I6XA 2DPDA 4KNYA 2F5CA 4U88A 2OQGA 5BOXA 3CUOA 1BC7C 3K1MA 1XDSA 2QVOA 1YW9A 3I53A 4M72A 1XD7A 3T8TA 3WTWC 3FMRA 2LKPA 2P7VB 1FP1D 1CF7B 3U2RA 2O03A 1ODDA 2K7LA 3F6VA 1J0RA 2VT2A 1SD7A 4AVPA 5CVIA 2W24A 3E6CC 3M8EA 3ZMVA 3ECHA 1LVAA 3E6DA 2PG4A 4LD5A 3ZMDA 1OYWA 1LDDA 1ZARA 1MJBA 4WWCA 2CYYA 1R1UA 4WX9A 2G7HA 2H09A 3V8KA 4R1HA 2R3SA 5HVQC 2V6CA 3DFGA 3K69A 3LA7A 2E1NA 2OA4A 1A04A 1LQ1A 2VONA 2KJCA 3ZPLA 3WTVC 4MEXF 1B6AA 3L9FA 1G4DA 3COAC 1FWZA 1H9TA 1RNLA 3JAMZ 4I98B 4M73A 2GA1A 5A2QZ 5JVTA 1JE8A 3BDDA 3GW2A 5ICGA 2HQRA 3RKXA 3HUGA 2QENA 3VFZA 2HEOA 4OIPF 2K4JA 3JW4A 4P96A 1XGMA 1ZN2A 1R36A 1KA8A 4XBFA 1FBQA 5AONA 2ZO4A 1L3LA 4ENKA 2BV6A 4EGYA 3LSTA 3V8LA 5LLQA 2YPRA 3MZYA 4RB0A 4UXNA 4LB6B 2O8XA 3BP8A 2KRFA 1YW8A 4ESBA 1MDMA 3F8FA 1HW2A 5J6XA 1BC8C 4Q47A 3EDPA 3MAJA 4EMSA 1OPCA 1Z6RA 3HTUA 3HOSA 2EA2A 4JQFA 1X3UA 1I27A 4DQ2A 1T2KA 1Q1HA 1WWXA 2Z99A 4KMFA 3WGIA 4G6QA 4D0PA 1Z6TA 1WRJA 5CVRA 4HX4A 4N9IA 2O61A 4OMZA 2A68F 1QZYA 2Y75A 4EJWA 3BJAA 1EH8A 2M30A 4LK0F 4MHGA 1ONVA 3RKYA 3EYIA 1QQIA 3FM5A 4HX8A 3E3VA 2OQRA 2HYGD 3OOPA 3GLXA 4L9VA 4NHJA 3RJPA 2B0LA 3IWFA 2YX4A 2Z33A 3WTYC 4ON0A 1FOKA 4KMUX 2FMLA 2A6HF 5LGTA 3FXQA 3ISPA 5HLIA 1R58A 1ON2A 4K2EA 3K2ZA 3KEQA 3ROUA 4I0AA 2LF8A 4LLNA 3QAHA 2A69F 4HV5A 3C3WA 1MKMA 2V1UA 1OYYA 2QBYB 3T1BA 4HLXA 4A5NA 2Z3YA 2HS5A 1HSTA 3F3XA 4YIIA 1PP7U 2VODA 2CO5A 1YLFA 2J5PA 3RIRA 2K86A 4HLYA 3I5UA 4CO8A 5L3FA 2NYXA 3JSPA 1XSDA 2XVCA 2FE3A 4IHTA 2VC0A 3T0YA 3QU3A 1RI7A 1O3QA 1O7FA 4U0YA 5L3EA 1K79A 5K5RA 1HKSA 3R60A 1JHFA 2FA5A 1D8KA 3LAJA 2IT0A 1DPUA 3O2PE 1BM9A 4HDUA 4HX7A 1YFHA 3JSOA 1W5SA 5FB2A 4M9SA 2MH9A 3FX3A 2HQNA 1XMKA 1QZZA 1IZ1A 4ENJA 2E7XA 4NQWA 3K1NA 2F2EA 2V1XA 2E7WA 3Q5FA 2YX7A 1CF7A 3L7WA 3RTRA 3QOPA 5F64A 3WE3A 2M5WA 3E5XA 5E1XA 2RNJA 1KYZA 4KICA 4I02A 2EV0A 5JHUA 5IT9K 3RPUA 1O7LA 4NB5A 2DAOA 4XLPF 3KZZA 1F9NA 2PLYA 4MQVA 4FX0A 2LDUA 1D8JA 5HDGA 2XAGA 5FD5A 3KP7A 2QQBA 3CLOA 4H0EA 2GIVA 1JXSA 4EJVA 5LHGA 3F8NA 2H94A 1GVJA 1IUYA 1I5ZA 2W84A 4B09A 4HYEA 3KP5A 5K5OA 1U2WA 2XAFA 2FU4A 3NQOA 3P7NA 3R61A 3ELKA 2K02A 1SAXA 1W4MA 2GA2A 4ZZDA 3F22A 1ZLJA 1STZA 4UV8A 4MTDA 3NRVA 1P6RA 1RZ4A 5J8CA 4L0YB 3F21A 2GAUA 2EB7A 2BGCA 4U7BA 2QWWA 4P5OA 4CZZA 1IN8A 3ZN1A 3QP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5D A;  4LB5 A;  4ASN A;  2O0Y A;  3ML6 A;  5CYV A;  4HAM A;  2Q8K A;  2QZ8 A;  4KN4 X;  2A5Y B;  2ZXJ A;  1S8N A;  1K7A A;  2P5V A;  1ZAO A;  1H0M A;  2ESH A;  3ERE D;  2D2W A;  2VBZ A;  2KIM A;  3MZH A;  3ECO A;  1BI0 A;  4L5I A;  5LRR A;  2EFN A;  5FD6 A;  2BEO A;  2Z5U A;  3C7J A;  2QYO A;  4KA4 A;  1S29 A;  4EM2 A;  5FFZ A;  5LHH A;  2DTR A;  2STT A;  3TDZ C;  3BWG A;  4RAZ A;  3HRM A;  1DUX C;  1BIB A;  3IC7 A;  2X4H A;  2GXG A;  1XGN A;  4E70 A;  1R7J A;  2XKO A;  2FEZ A;  3FZV A;  4P55 A;  2FOK A;  1KQ0 A;  4Z2Y A;  5ED4 A;  2FMY A;  5D8L B;  3TGN A;  4A5M A;  2D1V A;  3MQ0 A;  4L9J A;  2V1D A;  1PUE E;  2H27 A;  1F4K A;  1SFU A;  1LDK B;  1K78 B;  2DW4 A;  1R1V A;  3WGG A;  1LNW A;  5ILV A;  4OU0 A;  2QBY A;  5LRS A;  4LLG F;  3JAM K;  3EET A;  3FM3 A;  5A2Q K;  2KJB A;  1YIO A;  3M9A A;  4L5J A;  3W6K B;  3U1D A;  3G73 A;  2FXA A;  3Q9V A;  4BHP A;  2HTS A;  4BXU A;  2GXB A;  2PMU A;  5LGN A;  2XAH A;  1QPM A;  5CVU A;  2K4B A;  4L9N A;  3H92 A;  3DP7 A;  1P4A A;  4PCQ A;  3HIF A;  3REO A;  1KYW A;  3LAP A;  1I1S A;  4WXD A;  3VOD A;  2XV4 S;  4HW0 A;  4P9U A;  2E1C A;  2IJL A;  1IRG A;  2RQP A;  3P9C A;  5EEG A;  2OAZ A;  2VC1 A;  3SFZ A;  4MEY F;  3IL2 A;  3E6B A;  5H20 A;  2OD5 A;  2RDP A;  3PQJ A;  3BY6 A;  4KYW A;  1EH6 A;  1GHC A;  3KFW X;  3GFJ A;  2W85 A;  3FXU A;  3J80 Z;  4IRH A;  1J75 A;  4S04 A;  2HR3 A;  2XGX A;  4P9F A;  2LSO A;  4L9T A;  3I4P A;  2IA1 A;  3I0T A;  3BJO A;  2EFO A;  3R0J A;  4O6J A;  1PDN C;  5BPI A;  3ZMZ A;  4AWX B;  1J2X A;  2WWY A;  2KIU A;  5K5Q A;  1ZH5 A;  5D4S A;  2L4A A;  2YSR A;  3TOA A;  5LHI A;  1EH7 A;  3GO5 A;  2OZ6 A;  2CW0 F;  3L09 A;  4Q48 A;  1U5T B;  4JBA A;  4LG0 B;  5HOO A;  2FNP A;  3F6O A;  1ZRC A;  4KUM A;  3FMS A;  1FX7 A;  5F1R A;  1KU9 A;  3TKY A;  1O57 A;  4HV6 A;  1QO0 D;  3I59 B;  3WTU C;  1FBU A;  1T98 A;  2CQK A;  3DEU A;  3ABT A;  4YIF A;  2PI0 A;  1RIO H;  2P5K A;  5DCM B;  2XUB A;  1AWC A;  1IN6 A;  4UHT A;  1IN7 A;  2IPQ X;  3KP4 A;  3D5L A;  3KP6 A;  2GWR A;  1R5G A;  1G3S A;  2RVC A;  1D5V A;  2MLG A;  3TDU C;  3KET A;  3WGH A;  2MD5 A;  2M87 A;  4IF4 A;  4S05 A;  1TQP A;  4IHS A;  2FBI A;  1UHM A;  1I1G A;  1P4W A;  4WK8 F;  1YS7 A;  2ZME B;  4XSX F;  5HLG A;  1USS A;  2XAS A;  4Y17 A;  4AIJ A;  3SZP A;  2JPB A;  1ZRF A;  4CHU A;  3F72 A;  1S7A A;  4YFN F;  3GVA A;  2QQ9 A;  4BHB A;  1FYK A;  1J59 A;  2GQQ A;  2QLZ A;  3WU1 B;  1Z91 A;  3RI4 A;  4BHC A;  2MA3 A;  4OIN F;  5TJJ A;  3S2W A;  3V7S A;  3IKV A;  3I71 A;  3F8B A;  2PBI A;  2WV0 A;  4EGZ A;  4G7O F;  5D5W B;  5DYM A;  1SD5 A;  2IW5 A;  2JSC A;  3IRQ A;  1WKM A;  3BZ6 A;  3FXR A;  5DUK A;  4PGH A;  4BAY A;  2DQL A;  5HLH A;  3EQL F;  2STW A;  2VBW A;  2W25 A;  3GWZ A;  4RB3 C;  1H9G A;  3PFI A;  2FBK A;  1U5T C;  4OOI A;  2GZW A;  4IPA A;  2DT5 A;  3P9I A;  5HS7 A;  1P2F A;  2C6Y A;  2HZT A;  5DD8 A;  5FLX Z;  5ICC A;  2Z9O A;  3OV8 A;  3KLN A;  4TV7 A;  3KCC A;  1XB4 A;  1QGP A;  1MGT A;  4WCG A;  3CTA A;  3DF8 A;  4OIR F;  4PGG A;  2DFI A;  1U8R A;  3HRT A;  1IF1 A;  5KVR A;  1XMA A;  3PQK A;  3DPT A;  1ULY A;  2DLL A;  5LGU A;  1V3F A;  4HDV A;  1JHH A;  4G7Z F;  1ZGA A;  1YG2 A;  1FP2 A;  1K78 A;  2L02 A;  1XN7 A;  1GXP A;  4BNC A;  5LEK A;  3V7C A;  2H6B A;  4LFU A;  2ZJ2 A;  4GCV A;  2VOP A;  2BYV E;  5JFR A;  4I01 A;  1T38 A;  5DV5 A;  3LQQ A;  5ILU A;  1D3Y A;  5H6R A;  4ESJ A;  2NRA C;  4KFC A;  2PQ8 A;  4JK1 X;  3TQN A;  3F8M A;  2P6S A;  3GXO A;  3IRR A;  2RC4 A;  2KKO A;  4ZYG A;  3KZY A;  5H6Q A;  3WTX C;  3FHZ A;  3K1P A;  1UHW A;  1TQI A;  4EVI A;  1RUO A;  2ZCW A;  2L01 A;  2HFH A;  1XSX A;  1B9N A;  3P9K A;  4O5V A;  2VT3 A;  3MFK A;  4U0W A;  1MDM B;  2MC3 A;  3LFK A;  4LJZ F;  1R1T A;  1DPR A;  2HYF A;  3LWF A;  3TOB A;  3RKW A;  4Y13 A;  1XGO A;  4MQ9 F;  4GGG A;  4XSZ F;  2XAJ A;  3ZMU A;  1ZRE A;  5L3C A;  2DI3 A;  5DEQ A;  2FF4 A;  1XGS A;  3ABU A;  2M45 A;  2ZNZ A;  1KU3 A;  5DCF A;  3ZQ7 A;  1ZLK A;  3MWM A;  4KT5 C;  2Q0O A;  1NHA A;  4HQM A;  2DPU A;  2WC2 A;  5CVV A;  3GYH X;  4OMY A;  3WOD F;  3WU0 A;  2ELH A;  3M8F A;  4HQE A;  4ETS A;  1WQ2 A;  1ZGJ A;  4MTE A;  3U9G A;  2UXX A;  2IA0 A;  4LG0 A;  1G3Y A;  2HGC A;  3D0S A;  3EUH A;  5FO5 A;  4AIK A;  1ZYR F;  3I59 A;  1BJA A;  2DO7 A;  4RB2 C;  2ISY A;  3VB2 A;  4LMY A;  1UFM A;  3L00 A;  2O6G E;  5BMZ A;  3FMQ A;  5DCM A;  2IRF G;  4R8H A;  4G6D A;  1OMI A;  3J81 Z;  2EWN A;  3K9T A;  2UZK A;  4KIF A;  3CJN A;  2OZU A;  3TO7 A;  1IW7 F;  2P5L C;  3QPT A;  1BI1 A;  3BRO A;  4DNC A;  4WXC A;  1T0F A;  2EJR A;  1BOA A;  1K6O A;  1R22 A;  1YO5 C;  3RPQ A;  2Y48 A;  5BPD A;  2NNN A;  5JI6 A;  3ZP5 A;  3LA2 A;  4R79 A;  4FX4 A;  3GUD A;  1HW1 A;  2NNY A;  2VN2 A;  2OU2 A;  1KGS A;  1HBX G;  2ZME A;  1MJ9 A;  3E5U A;  3MEX A;  2XHK A;  1S6L A;  4F7Z A;  2EV5 A;  1SMT A;  4LK1 F;  3V7R A;  4ESF A;  1WSU A;  4YFK F;  4FT8 A;  1V4R A;  5F6F A;  2A3S A;  4RS8 A;  1TNT A;  3DQV C;  1TNS A;  4G94 A;  2JPC A;  4BYY A;  4L0Z B;  4ENM A;  4AIH A;  2ISZ A;  2UXN A;  5E18 F;  5LBQ A;  2CSO A;  2HOE A;  1B1B A;  4G9Y A;  3J80 K;  4IRI A;  4UV9 A;  2P8T A;  2QM3 A;  2ESN A;  2IVM A;  2L4M A;  3GZ6 A;  1SD4 A;  3RYR A;  3O6B B;  4QLC U;  1E2X A;  3F8C A;  2VXZ A;  1QBJ A;  2DBB A;  4HF1 A;  1XCV A;  4A2U A;  4HA8 A;  3WG9 A;  1AOY A;  1E17 A;  1HKQ A;  1LEA A;  2H6C A;  1OYI A;  2LNB A;  3GZ5 A;  4PZJ A;  2NAZ A;  3E6M A;  4N9H A;  3JTG A;  3O3K A;  1YW7 A;  1G3W A;  3M7G A;  1YQA A;  2DU9 A;  4WF2 A;  4EJO A;  4A6E A;  4RB1 A;  5ICF A;  1Z7U A;  2JZY A;  1UB9 A;  2M1B A;  4HOB A;  2MH2 A;  2EK5 A;  3R0A A;  4U0V A;  2CGP A;  1FC3 A;  3R4K A;  6PAX A;  1TW2 A;  2IP2 A;  3FF5 A;  1HQC A;  5E8I A;  1TBX A;  1W7P D;  2RN7 A;  3GF2 A;  4I7H A;  3DKW A;  3C1D A;  4KIG A;  3N97 A;  2R7D A;  1CGP A;  1R23 A;  3KLO A;  5BQT A;  4EJU A;  3SHF A;  4ENN A;  1B4A A;  4PDK A;  3WE2 A;  1BIA A;  3VEP A;  2DK8 A;  5D6E A;  3V4G A;  3WTS C;  5TRD A;  4CXF A;  1KQ9 A;  5E8G A;  1FY7 A;  2JTV A;  2W57 A;  3TO6 A;  2AS5 F;  4OIO F;  1LJ9 A;  4UVB A;  3KP3 A;  4KDP A;  1U3E M;  4GYI A;  2JT1 A;  2FBH A;  5D5U B;  3CUQ B;  5LEJ A;  4A6D A;  2FNA A;  1ZG3 A;  2CFX A;  2HTJ A;  5L3D A;  2PMH A;  2WTE A;  1FSH A;  1UCR A;  5E20 A;  3QPH A;  3KE2 A;  3FWE A;  2MLK A;  1IXC A;  4AD9 A;  2FRH A;  5IT3 A;  2YU3 A;  2DK5 A;  4XRF A;  4RAY A;  1P4X A;  2J5O A;  3Q9S A;  2MBF A;  1Z1D A;  1JGS A;  1F1Z A;  2A6E F;  4EM0 B;  2XIG A;  3E97 A;  3SXY A;  1XDU A;  4N0B A;  1EV7 A;  1W7P B;  1TW3 A;  2ZFW A;  4ZH4 F;  1SMY F;  3WTZ A;  1FYM A;  4LGW A;  3K0L A;  4MNU A;  3SZT A;  1T6S A;  5FGM A;  4A0Y A;  1MZB A;  4GO1 A;  3BJ6 A;  3LA3 A;  1OR7 A;  2F5F A;  5EEH A;  1OKR A;  4I0B A;  4G8X A;  5AIP A;  3V8J A;  2ACJ A;  4U7D A;  5FLX K;  2XRO A;  4A12 A;  4YFX F;  1SD6 A;  4YG2 F;  4LLL A;  4RGR A;  3HSF A;  2EFW A;  2O3F A;  1WI9 A;  1TLH B;  4CDG A;  3WTT C;  4M71 A;  1FZP B;  4FHT A;  1RUN A;  3QU6 A;  1U6G A;  5DD4 A;  1FSE A;  4XLN F;  2K27 A;  1LB2 A;  3ZMT A;  3HTS B;  4HBL A;  2NS0 A;  3IHU A;  1FLI A;  1KU2 A;  1FT9 A;  4O3M A;  1ZRD A;  4L18 B;  4I09 A;  1HKT A;  2HKO A;  2D1H A;  4HF0 A;  3F23 A;  4UVC A;  5JR3 A;  3BPV A;  2KIF A;  4EJT A;  3QP5 A;  1O3S A;  1DP7 P;  4UUV A;  2QUF A;  4IVN A;  1IAW A;  5D5X B;  2RKH A;  3TO9 A;  3RYP A;  3VOE A;  4OIQ F;  2UWM A;  2XRN A;  3N4M A;  3CUQ C;  4M6X A;  1F5T A;  5HS8 A;  4KIB A;  2EA4 A;  4KN7 X;  2YR2 A;  5D5V B;  1YTY A;  2AXL A;  5FFX A;  3LQR A;  3CO7 C;  4M9Z A;  2CG4 A;  1HXD A;  1UST A;  1Z9C A;  2P6T A;  4GXO A;  5L3B A;  4ZYD A;  4IJA A;  1J7K A;  5CVJ A;  4HZF A;  3I54 A;  2P7C B;  4MGR A;  5HS9 A;  4M74 A;  3GX4 X;  1QNT A;  1R00 A;  5DUI A;  4GYG A;  2COM A;  2QQA A;  1C0W A;  4I2O A;  3I64 A;  3KEO A;  2Y0M A;  4UNO A;  1IRF A;  1O3T A;  3HSR A;  4A0Z A;  4BQA A;  2ZKZ A;  3HHH A;  3DXJ F;  5BS6 A;  1HW5 A;  2PEX A;  1ZHF A;  3HOT A;  3G3Z A;  3RDI A;  4M9X A;  1B59 A;  2XKP A;  1SFE A;  2XAQ A;  4M6Y A;  3R6S A;  4Q5S F;  1TQM A;  1LDJ A;  3M1E A;  1XSV A;  1REP C;  4IXA A;  1YYV A;  1S7O A;  5HDK A;  2JRT A;  5E17 F;  5CLS A;  1FPQ A;  2X0L A;  3HRS A;  4B8X A;  1IXS B;  2DQR A;  3GFL A;  1HSJ A;  1XCB A;  3SQN A;  2V79 A;  2D45 A;  2G7U A;  3EYY A;  4ZYH A;  3W6J B;  2LF7 A;  2PN6 A;  5HDN A;  4G7H F;  2ADU A;  1ZG5 A;  1Y0U A;  1MD0 A;  1L0O C;  4QWQ A;  3L2C A;  3J7A O;  1BBY A;  1J5Y A;  2PFB A;  2L3D A;  1S3J A;  1P92 A;  3ZN0 A;  1PP8 F;  2PJP A;  4ZYE A;  2A07 F;  5E1Z B;  2EV6 A;  4A0X A;  1R5H A;  5D8K B;  2ZBK A;  1G6N A;  1IXR C;  3JTH A;  3J81 K;  3B73 A;  1O3R A;  1TTY A;  3T8R A;  5J8F A;  1MJA A;  4EQQ A;  4CGZ A;  2HWV A;  4EV0 A;  5ILS A;  1FYL A;  5ICE A;  2VBY A;  2TDX A;  2G9W A;  3BOQ A;  4RGS A;  2P4W A;  1FNN A;  1U5T A;  4Y15 A;  2V9V A;  3ZMS A;  3CUQ A;  2RGV A;  5KK1 A;  5D4R A;  3MCZ A;  3IWZ A;  3CO6 C;  3B02 A;  1ZG1 A;  3HSE A;  2IA2 A;  4Q4Z F;  1YS6 A;  3DV8 A;  2EFP A;  2VE8 A;  5IT9 Z;  2Q2E A;  1KQ8 A;  1KU7 A;  3H3Z A;  2FSW A;  3IKT A;  3KP2 A;  3GEZ A;  3C18 A;  4EM1 A;  1VTN C;  3HYI A;  3DPL C;  4WXH A;  2ZNY A;  4CYD A;  2FQ3 A;  2RV8 A;  1LEB A;  3GFI A;  1W7P A;  2ETH A;  1FBS A;  2VBX A;  3T5X A;  2BE5 F;  2L54 A;  3HHG A;  2CWE A;  5ERI A;  4UVA A;  2VOO A;  3CDH A;  3ULQ B;  1T39 A;  4IRG A;  1ON1 A;  2HKX A;  4RGU A;  1GXQ A;  1BI2 A;  1SFX A;  3HRU A;  2M8E A;  2F5E A;  2HDC A;  1B9M A;  5L3G A;  1DDN A;  3H3U A;  2VE9 A;  1G3T A;  3QRF F;  3NEU A;  4CIC A;  3BPX A;  4RGX A;  4HF2 A;  1Z05 A;  2R7F A;  5CJ9 A;  5E1W A;  1BI3 A;  2A61 A;  3GFM A;  1W5T A;  1IN5 A;  4ZZL A;  1BN5 A;  1IN4 A;  2OBP A;  1J9I A;  2EFQ A;  3AAF A;  3E5Q A;  5DDG A;  5AIQ A;  4BH9 A;  1U78 A;  5D6F A;  5K1Y A;  2BBY A;  3I58 A;  1I6X A;  2DPD A;  4KNY A;  2F5C A;  4U88 A;  2OQG A;  5BOX A;  3CUO A;  1BC7 C;  3K1M A;  1XDS A;  2QVO A;  1YW9 A;  3I53 A;  4M72 A;  1XD7 A;  3T8T A;  3WTW C;  3FMR A;  2LKP A;  2P7V B;  1FP1 D;  1CF7 B;  3U2R A;  2O03 A;  1ODD A;  2K7L A;  3F6V A;  1J0R A;  2VT2 A;  1SD7 A;  4AVP A;  5CVI A;  2W24 A;  3E6C C;  3M8E A;  3ZMV A;  3ECH A;  1LVA A;  3E6D A;  2PG4 A;  4LD5 A;  3ZMD A;  1OYW A;  1LDD A;  1ZAR A;  1MJB A;  4WWC A;  2CYY A;  1R1U A;  4WX9 A;  2G7H A;  2H09 A;  3V8K A;  4R1H A;  2R3S A;  5HVQ C;  2V6C A;  3DFG A;  3K69 A;  3LA7 A;  2E1N A;  2OA4 A;  1A04 A;  1LQ1 A;  2VON A;  2KJC A;  3ZPL A;  3WTV C;  4MEX F;  1B6A A;  3L9F A;  1G4D A;  3COA C;  1FWZ A;  1H9T A;  1RNL A;  3JAM Z;  4I98 B;  4M73 A;  2GA1 A;  5A2Q Z;  5JVT A;  1JE8 A;  3BDD A;  3GW2 A;  5ICG A;  2HQR A;  3RKX A;  3HUG A;  2QEN A;  3VFZ A;  2HEO A;  4OIP F;  2K4J A;  3JW4 A;  4P96 A;  1XGM A;  1ZN2 A;  1R36 A;  1KA8 A;  4XBF A;  1FBQ A;  5AON A;  2ZO4 A;  1L3L A;  4ENK A;  2BV6 A;  4EGY A;  3LST A;  3V8L A;  5LLQ A;  2YPR A;  3MZY A;  4RB0 A;  4UXN A;  4LB6 B;  2O8X A;  3BP8 A;  2KRF A;  1YW8 A;  4ESB A;  1MDM A;  3F8F A;  1HW2 A;  5J6X A;  1BC8 C;  4Q47 A;  3EDP A;  3MAJ A;  4EMS A;  1OPC A;  1Z6R A;  3HTU A;  3HOS A;  2EA2 A;  4JQF A;  1X3U A;  1I27 A;  4DQ2 A;  1T2K A;  1Q1H A;  1WWX A;  2Z99 A;  4KMF A;  3WGI A;  4G6Q A;  4D0P A;  1Z6T A;  1WRJ A;  5CVR A;  4HX4 A;  4N9I A;  2O61 A;  4OMZ A;  2A68 F;  1QZY A;  2Y75 A;  4EJW A;  3BJA A;  1EH8 A;  2M30 A;  4LK0 F;  4MHG A;  1ONV A;  3RKY A;  3EYI A;  1QQI A;  3FM5 A;  4HX8 A;  3E3V A;  2OQR A;  2HYG D;  3OOP A;  3GLX A;  4L9V A;  4NHJ A;  3RJP A;  2B0L A;  3IWF A;  2YX4 A;  2Z33 A;  3WTY C;  4ON0 A;  1FOK A;  4KMU X;  2FML A;  2A6H F;  5LGT A;  3FXQ A;  3ISP A;  5HLI A;  1R58 A;  1ON2 A;  4K2E A;  3K2Z A;  3KEQ A;  3ROU A;  4I0A A;  2LF8 A;  4LLN A;  3QAH A;  2A69 F;  4HV5 A;  3C3W A;  1MKM A;  2V1U A;  1OYY A;  2QBY B;  3T1B A;  4HLX A;  4A5N A;  2Z3Y A;  2HS5 A;  1HST A;  3F3X A;  4YII A;  1PP7 U;  2VOD A;  2CO5 A;  1YLF A;  2J5P A;  3RIR A;  2K86 A;  4HLY A;  3I5U A;  4CO8 A;  5L3F A;  2NYX A;  3JSP A;  1XSD A;  2XVC A;  2FE3 A;  4IHT A;  2VC0 A;  3T0Y A;  3QU3 A;  1RI7 A;  1O3Q A;  1O7F A;  4U0Y A;  5L3E A;  1K79 A;  5K5R A;  1HKS A;  3R60 A;  1JHF A;  2FA5 A;  1D8K A;  3LAJ A;  2IT0 A;  1DPU A;  3O2P E;  1BM9 A;  4HDU A;  4HX7 A;  1YFH A;  3JSO A;  1W5S A;  5FB2 A;  4M9S A;  2MH9 A;  3FX3 A;  2HQN A;  1XMK A;  1QZZ A;  1IZ1 A;  4ENJ A;  2E7X A;  4NQW A;  3K1N A;  2F2E A;  2V1X A;  2E7W A;  3Q5F A;  2YX7 A;  1CF7 A;  3L7W A;  3RTR A;  3QOP A;  5F64 A;  3WE3 A;  2M5W A;  3E5X A;  5E1X A;  2RNJ A;  1KYZ A;  4KIC A;  4I02 A;  2EV0 A;  5JHU A;  5IT9 K;  3RPU A;  1O7L A;  4NB5 A;  2DAO A;  4XLP F;  3KZZ A;  1F9N A;  2PLY A;  4MQV A;  4FX0 A;  2LDU A;  1D8J A;  5HDG A;  2XAG A;  5FD5 A;  3KP7 A;  2QQB A;  3CLO A;  4H0E A;  2GIV A;  1JXS A;  4EJV A;  5LHG A;  3F8N A;  2H94 A;  1GVJ A;  1IUY A;  1I5Z A;  2W84 A;  4B09 A;  4HYE A;  3KP5 A;  5K5O A;  1U2W A;  2XAF A;  2FU4 A;  3NQO A;  3P7N A;  3R61 A;  3ELK A;  2K02 A;  1SAX A;  1W4M A;  2GA2 A;  4ZZD A;  3F22 A;  1ZLJ A;  1STZ A;  4UV8 A;  4MTD A;  3NRV A;  1P6R A;  1RZ4 A;  5J8C A;  4L0Y B;  3F21 A;  2GAU A;  2EB7 A;  2BGC A;  4U7B A;  2QWW A;  4P5O A;  4CZZ A;  1IN8 A;  3ZN1 A;  3QP6 A; 
#chains in the Genus database with same CATH topology
 2CUF A;  2F5D A;  4LB5 A;  3M07 A;  4ASN A;  2O0Y A;  4IO9 F;  2BXZ A;  3ML6 A;  5CYV A;  3PIO F;  3EPZ A;  2KPM A;  4HAM A;  2DTZ A;  2Q8K A;  3VSK A;  2QZ8 A;  4KN4 X;  2A5Y B;  1G2H A;  2ZXJ A;  3CME I;  1S8N A;  5CPR B;  3OYG A;  2PMZ N;  1K7A A;  1JUP A;  3DEE A;  2P5V A;  3G4S I;  2B7E A;  1UMQ A;  1ZAO A;  1PYV A;  1H0M A;  2AXT C;  2ESH A;  3CCY A;  3ERE D;  3AG3 H;  2D2W A;  2VQG A;  4F52 A;  2VBZ A;  3W2A A;  2KIM A;  2XGE A;  4EEF G;  3CC7 I;  3MZH A;  3ECO A;  1BI0 A;  3KYC B;  4AUX A;  1EJ9 A;  1MSF C;  4L5I A;  5LRR A;  3W6V A;  2WV1 A;  2EFN A;  5FD6 A;  4CZC A;  2BEO A;  2KDO A;  2Z5U A;  3C7J A;  2XSD C;  2WB1 A;  2QYO A;  1QU3 A;  4KA4 A;  1S29 A;  4BDZ A;  4EM2 A;  5FFZ A;  5LHH A;  2DTR A;  2STT A;  4QPQ A;  3TDZ C;  5J4Y A;  2KZV A;  2K3P A;  2DFE A;  2KIS A;  3BWG A;  3F0C A;  4RAZ A;  5K7Z A;  5KNL A;  3GLL A;  3HRM A;  1WFX A;  1DUX C;  1BIB A;  4HST A;  2OJE D;  4A3D J;  3IC7 A;  3U21 A;  3S1M J;  4HEA 2;  1BA5 A;  4XN3 A;  2X4H A;  2XSJ C;  1OJL A;  2GXG A;  1XGN A;  3QPL A;  4E70 A;  1R7J A;  2XKO A;  2X51 A;  3ESW B;  2FEZ A;  3FZV A;  4P55 A;  4XOT A;  3A01 B;  4ZDO A;  2FOK A;  1KQ0 A;  4Z2Y A;  2UV1 A;  5ED4 A;  3HOX J;  2L9N A;  4QTR A;  2MFZ A;  2FMY A;  5D8L B;  2HVS A;  2M4K A;  3TGN A;  2NVX J;  4A5M A;  5IYC J;  3HOW J;  2D1V A;  3MQ0 A;  4L9J A;  1WHU A;  2V1D A;  3M4O J;  2KLO A;  1PUE E;  2MYS A;  2H27 A;  2K9Q A;  1F4K A;  1SFU A;  1LDK B;  1K78 B;  5JLX A;  1LE8 B;  2DW4 A;  1R1V A;  2NVU B;  1LNW A;  3WGG A;  1MMN A;  5ILV A;  4OU0 A;  3CC2 I;  2WAD A;  2R7R A;  4H4K C;  4ABZ A;  1QRY A;  2QBY A;  1K61 A;  5LRS A;  1FTT A;  4LLG F;  1B72 A;  1WGX A;  3JAM K;  2EZI A;  1XMX A;  3CDI A;  3EET A;  3FM3 A;  5C4X J;  2GOX B;  5A2Q K;  1RRJ A;  2KJB A;  4UB8 C;  4M3D A;  4S0H B;  1XG1 A;  2XGD A;  1YIO A;  3M9A A;  1UJ8 A;  1OR7 C;  3FXO A;  4L5J A;  3W6K B;  4J19 A;  2AQE A;  2E36 A;  3U1D A;  3TP3 A;  3G73 A;  2FXA A;  3Q9V A;  4BHP A;  4MLO A;  2KRC A;  2V7F A;  4UUS A;  2HTS A;  3ZQC A;  3S1N J;  4BXU A;  2GXB A;  2PMU A;  3HGG A;  5LGN A;  2XAH A;  3AKZ A;  1QPM A;  3S3N A;  3MKL A;  5CVU A;  2K4B A;  4L9N A;  4ZJZ A;  3H92 A;  1P9Q C;  3DP7 A;  5LFA A;  4ZC3 A;  3DCF A;  1P4A A;  3G71 I;  4PCQ A;  3HIF A;  3REO A;  1KYW A;  3LAP A;  1I1S A;  4WXD A;  1BW6 A;  3VOD A;  2XV4 S;  3HXL A;  4HW0 A;  5F04 A;  2R7U A;  4P9U A;  2E1C A;  2IJL A;  2BVM A;  1IRG A;  2RQP A;  3P9C A;  2JJ7 A;  5EEG A;  2OAZ A;  4XN0 A;  3FK7 A;  2VC1 A;  1IDZ A;  3SFZ A;  2HVR A;  4MEY F;  3QOD A;  3IL2 A;  1NTC A;  2ZC2 A;  3E6B A;  4KT6 A;  5F0F A;  3MN2 A;  1X3Z B;  3DU6 A;  1YI2 I;  3IAM 2;  5H20 A;  4BXX J;  4KJZ A;  4BE2 A;  3S32 A;  2OD5 A;  2RDP A;  4F3Q A;  3PQJ A;  3BY6 A;  4KYW A;  1EH6 A;  1GHC A;  2M0C A;  2CUJ A;  3KFW X;  3GFJ A;  2W85 A;  3FXU A;  3J80 Z;  1Z0X A;  1KON A;  2GLO A;  4IRH A;  1J75 A;  4S04 A;  3OY9 A;  3I4N J;  2IGO A;  2HR3 A;  5E3O A;  3TW7 A;  2XGX A;  4P9F A;  2LSO A;  4L9T A;  3I4P A;  2IA1 A;  3AFH A;  1HA8 A;  3I0T A;  1NH3 A;  3BJO A;  1D0Y A;  3K70 D;  2PX9 A;  2EFO A;  2LMD A;  2M34 A;  3R0J A;  4O6J A;  1PDN C;  3ZCO A;  2HPM A;  5BPI A;  3ZMZ A;  4AWX B;  4DYQ A;  4X6A J;  1J2X A;  2ZXH A;  3OYE A;  2KIU A;  2WWY A;  3S3M A;  1WJF A;  5K5Q A;  1ZH5 A;  1QZE A;  3A0B C;  1MBE A;  5D4S A;  2L4A A;  2UUZ A;  2Y30 A;  2DJI A;  3OYN A;  4V19 K;  2YSR A;  3TOA A;  3L1P A;  5LHI A;  3N05 A;  1EH7 A;  3GO5 A;  2OZ6 A;  2CW0 F;  4PJN A;  5B1B H;  1QPI A;  3DTE A;  1D5Y A;  3L09 A;  4LIV A;  4Q48 A;  1U5T B;  2GIZ A;  2EZL A;  4YRV A;  1GDT A;  1IV6 A;  4JBA A;  3BC8 A;  4LG0 B;  5HOO A;  2OTJ I;  2FNP A;  1A6I A;  5F0C A;  3F6O A;  1ZRC A;  4KUM A;  3FMS A;  1FX7 A;  5F1R A;  1KU9 A;  1TT5 B;  4IX7 A;  2Q1Z B;  2JMW A;  3TKY A;  1O57 A;  2LFB A;  4HV6 A;  1QO0 D;  2VL8 A;  3RCO A;  1N75 A;  3I59 B;  3HOV J;  3SJM A;  3WTU C;  1FBU A;  1T98 A;  2CQK A;  3DEU A;  3ABT A;  3K4B A;  2VKH A;  4YIF A;  2E1M B;  2PI0 A;  4N4N B;  1RIO H;  2P5K A;  3SDB A;  5DCM B;  3CMA I;  2XUB A;  1AWC A;  3CCS I;  1VQN I;  3AL0 B;  2WAQ A;  3CC4 I;  1IN6 A;  2L0K A;  4UHT A;  3OYC A;  4IKF A;  1IN7 A;  2DMP A;  1Y1W J;  2NVT J;  2L7K A;  3PL8 A;  2IPQ X;  3KP4 A;  2NS7 A;  2JUC A;  4NUB A;  3OYJ A;  3D5L A;  3ZOB A;  3KP6 A;  2GWR A;  1R5G A;  1G3S A;  2RVC A;  4RA2 A;  1D5V A;  2MLG A;  2VKV A;  3TDU C;  3KET A;  3WGH A;  2MD5 A;  2CQX A;  2M87 A;  4W97 A;  4IF4 A;  2QSF X;  4S05 A;  3BLY A;  3DWL E;  1TQP A;  4IHS A;  5TGT A;  2FBI A;  1UHM A;  1I1G A;  1P4W A;  1E3P A;  1T08 B;  1NK3 P;  4WK8 F;  1YS7 A;  2ZME B;  5F0H A;  4XSX F;  5HLG A;  1USS A;  2EIJ H;  3L2R A;  1R4M B;  2XAS A;  4Y17 A;  5E3L A;  1I39 A;  4RM3 A;  3FXJ A;  4AIJ A;  3SZP A;  5KAF C;  2JPB A;  4BJT A;  1ZRF A;  1M1E B;  4CHU A;  2WY8 Q;  3F72 A;  4CUG A;  1S7A A;  4YFN F;  3H5R A;  3OIO A;  4LOC A;  3GVA A;  4NC7 A;  2QQ9 A;  4BHB A;  4XLA A;  2WAF A;  4DBR A;  3SEQ A;  2G0E A;  1K4T A;  2O8K A;  1FYK A;  1J59 A;  4A3F J;  2GQQ A;  4M3F A;  2QLZ A;  3WU1 B;  3TL4 X;  2LP0 A;  5IYB J;  1Z91 A;  4A3L J;  3RI4 A;  4BHC A;  2KRH A;  4PSW A;  1RPW A;  2MA3 A;  4OIN F;  3A02 A;  5TJJ A;  3H36 A;  2BOL A;  3S2W A;  3FIS A;  1IUF A;  3IKV A;  3V7S A;  5EEA A;  3I71 A;  1Y39 A;  3S2D J;  4B3A A;  1POG A;  2PBI A;  2WV0 A;  3F8B A;  2K5C A;  4EGZ A;  4G7O F;  5D5W B;  5DYM A;  1SD5 A;  2K9N A;  2BY3 A;  2IW5 A;  2JSC A;  3IRQ A;  3CZ6 A;  1WKM A;  3BZ6 A;  3FXR A;  3DKX A;  3J7Y J;  5DUK A;  4PGH A;  1BJZ A;  2K85 A;  4BAY A;  2DQL A;  3DEW A;  3FXK A;  5HLH A;  3EQL F;  1QHG A;  2STW A;  1X19 A;  4UY8 I;  3HEF A;  2VBW A;  2W25 A;  5GAH J;  3GWZ A;  4RB3 C;  1FIP A;  3FBN B;  3DBR B;  1Z3Y A;  2E71 A;  4XRS G;  1H9G A;  4HPQ A;  2VJ4 A;  3PFI A;  4RLF A;  2FBK A;  1U5T C;  4MIM A;  3FK6 A;  4OOI A;  2GZW A;  4IPA A;  5IP6 A;  2DT5 A;  1MH4 A;  1WVR A;  2Y31 A;  3P9I A;  5HS7 A;  1P2F A;  4E7H A;  2Y9Z A;  1YOV B;  2AO9 A;  2HZD A;  2O5R A;  2C6Y A;  2HZT A;  4RM2 A;  5DD8 A;  3ZQH A;  5FLX Z;  4IOA F;  2F4O B;  5IP9 J;  4HG2 A;  5ICC A;  3OS1 A;  1X1B A;  4W1U A;  2Z9O A;  4BDY A;  3OV8 A;  1DU6 A;  3KLN A;  4TV7 A;  3KCC A;  1VQK I;  2Y0S A;  4XRM A;  3NAR A;  1XB4 A;  1QGP A;  1MGT A;  5FKO A;  4WCG A;  1OCZ H;  3CTA A;  4J01 A;  3DF8 A;  4OIR F;  3HKZ N;  2E1M C;  4PGG A;  4BBS J;  2DFI A;  3SZG A;  3A01 A;  1U8R A;  3I3L A;  5KCM A;  3HRT A;  1IF1 A;  5KVR A;  1HOM A;  1JKO C;  1XMA A;  3PQK A;  3DPT A;  3RKQ A;  3DKY A;  1ULY A;  2DLL A;  5EJC A;  5LGU A;  1PUF A;  3AL0 C;  3LSK A;  3ABK H;  4HNT A;  5EYR A;  1V3F A;  4HDV A;  3KX2 A;  4PUS A;  4B3X A;  4I99 C;  5FJ8 J;  4AU7 A;  5DM6 F;  1JHH A;  1ZGA A;  4G7Z F;  4RBO A;  2IS2 A;  1YG2 A;  1FP2 A;  1X2N A;  2QQ8 A;  2ZJR F;  1K78 A;  1GV5 A;  5M5X J;  2Y2Z A;  1LE8 A;  2HOA A;  2L02 A;  1U0J A;  2LBF A;  1XN7 A;  2L5Q A;  2LYC A;  4AYB N;  1GXP A;  5GAG J;  3ONQ A;  4BNC A;  3E7L A;  1JUM A;  3AG4 H;  5J40 A;  5LEK A;  5EZH A;  3V7C A;  2H6B A;  4LFU A;  1A36 A;  3OOU A;  2AHQ A;  2BHY A;  2ZJ2 A;  4GCV A;  1IRX A;  1MNE A;  2VOP A;  2BYV E;  2P81 A;  3G1O A;  3NWS A;  5JFR A;  2QA4 I;  4I01 A;  5KHD A;  2CV1 A;  1EKE A;  1T38 A;  4V2F A;  5DV5 A;  2ZSH B;  3LQQ A;  5ILU A;  1D3Y A;  1ZKG A;  2JVG A;  1ETK A;  5H6R A;  4XR6 A;  4ESJ A;  2NRA C;  4JX4 A;  4KFC A;  2PQ8 A;  3BG3 A;  4JK1 X;  3TQN A;  1OCO H;  4II3 A;  1MBH A;  3F8M A;  2P6S A;  3GXO A;  2ECB A;  3DLA A;  3IRR A;  2RC4 A;  2KKO A;  3BCA A;  2FQ4 A;  4ZYG A;  2H1L A;  3KZY A;  1PJR A;  2M4G A;  5H6Q A;  1D1C A;  3WTX C;  3FHZ A;  4NC8 A;  3K1P A;  4PFO A;  1UHW A;  3JCU C;  2X6O A;  1HCR A;  3L2W A;  1TQI A;  2EZH A;  4FIS A;  4EVI A;  1ZEL A;  1IO2 A;  3OYH A;  3S8P A;  2JA2 A;  1RUO A;  1JTY A;  2W82 A;  3LSH A;  2ZCW A;  5M3F J;  5GTH C;  2L01 A;  2HFH A;  1XSX A;  3VYS B;  1B9N A;  3HC7 A;  3H35 A;  3P9K A;  5C44 J;  2DA1 A;  4O5V A;  2VT3 A;  3MFK A;  4U0W A;  1MDM B;  2MC3 A;  2VJ5 A;  5GPA A;  3ZR8 X;  3ZQI A;  4AID A;  3LFK A;  3ASO H;  4LJZ F;  1R1T A;  2DFF A;  2CU7 A;  2ME0 A;  1MW7 A;  4J00 A;  4IQ4 A;  1JT0 A;  1DPR A;  4XOP A;  2HYF A;  2KL4 A;  3GTM J;  3LWF A;  5FKN A;  3TOB A;  5EDN A;  4ZDL A;  2XGC A;  3RKW A;  4CCN A;  4Y13 A;  1XGO A;  4MQ9 F;  3C2G A;  1RR8 C;  2DN0 A;  4GGG A;  4XSZ F;  4XLH A;  1V5E A;  2XAJ A;  3ZMU A;  9ANT A;  1ZRE A;  5L3C A;  2DI3 A;  3H9G A;  1VQ8 I;  3ERM A;  2VJI A;  2EQR A;  5DEQ A;  2FF4 A;  1XGS A;  3ABU A;  2MW8 A;  3M8J A;  2IGN A;  1WJE A;  2M45 A;  2ZNZ A;  1KU3 A;  3Q0V A;  3BR6 A;  5DCF A;  3ZQ7 A;  2M0M A;  1ZLK A;  3MWM A;  4DOZ A;  2LG4 A;  4KT5 C;  2Q0O A;  3BR1 A;  4PJ0 C;  3ABL H;  1NHA A;  4HQM A;  2VIX A;  2W00 A;  2VKD A;  2DPU A;  2WC2 A;  5CVV A;  3GYH X;  4OMY A;  4CH7 A;  4QSH A;  3WOD F;  3WU0 A;  5EF6 A;  1O4X A;  2ELH A;  3M8F A;  2PMZ A;  4HQE A;  3OYK A;  4ETS A;  3PIP F;  1WQ2 A;  5DM7 F;  1ZGJ A;  1IDY A;  4MTE A;  4XKW A;  3U9G A;  4XID A;  2UXX A;  3BR2 A;  5IP7 J;  2IA0 A;  3CCV I;  4LG0 A;  4A3C J;  3KYL A;  1YIJ I;  1G3Y A;  1SVM A;  2HGC A;  3D0S A;  3EUH A;  3HM5 A;  3HB9 A;  2R5Y B;  3IV5 A;  2L7Z A;  4HRI A;  3OWT A;  5FO5 A;  1VQ6 I;  1TWF J;  3JRF A;  4AIK A;  1ZYR F;  2L9V A;  3I59 A;  1A35 A;  1BJA A;  2DO7 A;  4RB2 C;  2ISY A;  3QYF A;  3VB2 A;  4LMY A;  2QCO A;  3OYI A;  1UFM A;  3L00 A;  2O6G E;  1ZQ3 P;  5BMZ A;  3FMQ A;  5DCM A;  1XS9 A;  2IRF G;  4JX6 A;  4R8H A;  3BQZ A;  4G6D A;  1OMI A;  1VQ4 I;  3J81 Z;  2EWN A;  1BW5 A;  2PJR B;  1T33 A;  3K9T A;  2UZK A;  4KIF A;  1R9T J;  3CJN A;  2OZU A;  3TO7 A;  5K7H A;  4CCO A;  5J47 A;  2XF6 A;  1RKW A;  1IW7 F;  2P5L C;  2M8G X;  1VZ0 A;  2DT6 A;  3QPT A;  1BI1 A;  3BRO A;  4DNC A;  5BNG A;  1FOY A;  1WJ5 A;  3CQZ J;  4WXC A;  4CYC B;  1T0F A;  2EJR A;  3H9Q A;  2H8R A;  1WJD A;  1BOA A;  1K6O A;  1R22 A;  4B47 A;  1YO5 C;  4XNF A;  3RPQ A;  1YRN B;  3BG7 A;  2Y48 A;  5BPD A;  3H9J A;  2NNN A;  5JI6 A;  3ZP5 A;  2NOJ B;  3LA2 A;  4R79 A;  4FX4 A;  3GUD A;  1HW1 A;  2NNY A;  2VN2 A;  4BY7 J;  2OU2 A;  1UAA A;  2X85 A;  1KGS A;  3L2Q A;  3K4M A;  1HBX G;  2ZME A;  1V5G A;  1MJ9 A;  3E5U A;  1TP4 A;  2IAI A;  3MEX A;  4V2G A;  2EIN H;  2XHK A;  4F55 A;  2F5V A;  3OIQ A;  5B66 C;  1S6L A;  2OTL I;  1XC5 A;  1XX5 A;  4F7Z A;  2EV5 A;  1SMT A;  4LK1 F;  4YEJ A;  3V7R A;  3LSJ A;  3ZRG A;  4ESF A;  2KDZ A;  1WSU A;  4YFK F;  2VI6 A;  3I9V 2;  3JRA A;  2XB5 A;  2E2H J;  4FT8 A;  3ZQG A;  1MBF A;  1V4R A;  3G1M A;  3DBH B;  4Y33 A;  1YX3 A;  5F6F A;  2A3S A;  4IHX A;  4RS8 A;  2DOD A;  1TNT A;  3DQV C;  5FLV A;  1TNS A;  2R7V A;  5F1J A;  4G94 A;  2JPC A;  4BYY A;  1P7I A;  4L0Z B;  1Y8Q B;  3G6E I;  4ENM A;  4AIH A;  1YJW I;  2ISZ A;  2UXN A;  4B1R A;  3DTK A;  5E18 F;  5LBQ A;  2CSO A;  2HOE A;  5E3M A;  2K9L A;  1B1B A;  3BG5 A;  5CQG A;  2EZK A;  2LKS A;  1AU7 A;  4D7M A;  1MSE C;  4G9Y A;  3J80 K;  4IRI A;  2WB1 N;  3O8G A;  4UV9 A;  3K4C A;  2P8T A;  2QM3 A;  5M3M J;  1OCP A;  2DMU A;  2ESN A;  2QSH X;  2IVM A;  2L4M A;  3A0H C;  3GZ6 A;  1Z7L A;  3JRE A;  3CF5 F;  1SD4 A;  3EUA A;  3RYR A;  2VPR A;  3O6B B;  4MFE A;  4QLC U;  1E2X A;  3F8C A;  2VXZ A;  3TW6 A;  1QBJ A;  2FOW A;  2DBB A;  1A31 A;  4FCY A;  1XCV A;  2VQC A;  4A2U A;  4HF1 A;  4HA8 A;  2V1N A;  1LFU P;  3WG9 A;  4BGD A;  1AOY A;  2COB A;  1E17 A;  1HKQ A;  2KP6 A;  1LEA A;  3BG6 A;  2H6C A;  1OYI A;  4PJJ A;  2XRL A;  2LNB A;  3GZN B;  3KIO A;  3GZ5 A;  4PZJ A;  2NAZ A;  1XTA A;  3E6M A;  4N9H A;  2ID3 A;  4F93 B;  3JTG A;  3O3K A;  1YW7 A;  1G3W A;  3M7G A;  2ECC A;  1YQA A;  2DU9 A;  4WF2 A;  4EJO A;  5JVG F;  2ME6 A;  4A6E A;  3VWB A;  4RB1 A;  4E7S A;  5ICF A;  1Z7U A;  2CW7 A;  5DS9 A;  2JZY A;  1LFB A;  1UB9 A;  2M1B A;  4HOB A;  1FTZ A;  4BUP A;  2OF7 A;  4FTH A;  2MH2 A;  3BTJ A;  2HQ5 A;  2V4J C;  2M9H A;  2EK5 A;  3R0A A;  3IUO A;  4U0V A;  4IHW A;  2DA4 A;  1FC3 A;  2CGP A;  1X4O A;  4DJA A;  1APL C;  2CQQ A;  3R4K A;  6PAX A;  3ZQQ A;  1TW2 A;  2IP2 A;  3FF5 A;  1HQC A;  3FDY A;  3PFY A;  4BY1 J;  5E8I A;  1E0E A;  5HNH A;  1TBX A;  1W7P D;  2RN7 A;  3GF2 A;  4I7H A;  4A3B J;  3DKW A;  3GBG A;  1FEX A;  3C1D A;  4KIG A;  1GUU A;  3L2U A;  3N97 A;  2R7D A;  1G59 A;  1CGP A;  1R23 A;  3DTI A;  5HLT A;  3E0J B;  1FIA A;  3ABM H;  3KLO A;  4C9Y A;  2DA2 A;  2HI3 A;  3PNT A;  3D5R C;  1MIJ A;  5BQT A;  4E7Z A;  4EJU A;  2EH3 A;  4XLE A;  3HBL A;  3CCJ I;  1AHD P;  3SHF A;  2X6Y A;  2ZJP F;  4G6T B;  2LY1 A;  4ENN A;  2BHZ A;  1B4A A;  1U9O A;  4PDK A;  4HSR A;  3WE2 A;  1BIA A;  3VEP A;  2DK8 A;  4D5F A;  1DP3 A;  5D6E A;  3V4G A;  1MH3 A;  5IOZ A;  3WTS C;  5TRD A;  3Q0U A;  3JRI A;  4CXF A;  4BJ6 C;  3I56 I;  2BZT A;  1KQ9 A;  2DYR H;  5E8G A;  3M3Y J;  3VDX A;  1FY7 A;  2JTV A;  2W57 A;  3TO6 A;  5EG0 B;  2AS5 F;  1BR4 A;  1UZC A;  4OIO F;  1FOW A;  3DBL B;  3FKI J;  1LJ9 A;  1B8I A;  2BW3 B;  3K4K A;  3FKJ A;  2X1C A;  3G1L A;  4BS9 A;  2XB0 X;  3CCR I;  2XPU A;  3U1K A;  2LRE A;  4UVB A;  2XPV A;  2NVY J;  4IQJ A;  4E7J A;  4ZYA A;  3KP3 A;  2KT0 A;  4KDP A;  1U3E M;  4XRS A;  4GYI A;  2JT1 A;  2DA6 A;  2FBH A;  4DYR A;  5D5U B;  1YIT I;  4DW6 A;  3CUQ B;  1TWC J;  2BVL A;  5LEJ A;  2V26 A;  3HJE A;  4A6D A;  3DPU A;  2EPF A;  2FNA A;  1ZG3 A;  3IH4 A;  2MD0 A;  1MBG A;  3LSI A;  2CFX A;  1DU0 A;  2HTJ A;  4CCJ A;  5L3D A;  4A3E J;  2PMH A;  2VKE A;  2WTE A;  2LY2 A;  2V6E A;  2Q2E B;  1PVE A;  1FSH A;  4IEJ A;  1UCR A;  2E5N A;  3IP4 B;  5E20 A;  3QPH A;  2QF7 A;  3I55 I;  3KE2 A;  3FWE A;  2MLK A;  2DDA A;  5EGO B;  1IXC A;  3CF2 A;  2F4I A;  4AD9 A;  2FRH A;  5IT3 A;  2YU3 A;  5JHF A;  2CFO A;  2CUE A;  2DK5 A;  2JWT A;  2R7T A;  4XRF A;  4BKX A;  2KQR A;  2R93 J;  3OL3 A;  4RAY A;  2KFD A;  1P4X A;  2J5O A;  4XKV A;  3AG1 H;  3Q9S A;  2XDV A;  3DU5 A;  2MBF A;  1Z1D A;  1JGS A;  1F1Z A;  2A6E F;  2XIG A;  3E97 A;  3SXY A;  4B48 A;  1XDU A;  4EM0 B;  4A3K J;  1HDP A;  3RZD J;  1T95 A;  2DCE A;  4N0B A;  2LTP A;  1EV7 A;  1W7P B;  2A5W A;  4PFP A;  3VYR B;  3OS2 A;  1TW3 A;  3JR9 A;  2ZFW A;  4ZTF A;  4ZH4 F;  1SMY F;  3WTZ A;  1FYM A;  4LGW A;  4JX5 A;  2RRE A;  3K0L A;  1IC8 A;  4MNU A;  3SZT A;  1T8I A;  1T6S A;  3WHB A;  2LK2 A;  5FGM A;  3W3C A;  4A0Y A;  2E2J J;  1MZB A;  4D1Q A;  4GO1 A;  1MBJ A;  4E4H A;  3BJ6 A;  3LA3 A;  1OR7 A;  2F5F A;  2JSP A;  2WAE A;  3IH3 A;  2FUG 2;  2LY9 A;  1OKR A;  5EEH A;  3S93 A;  1WCM J;  4G8X A;  4I0B A;  5AIP A;  3V8J A;  5HNF A;  2ACJ A;  4U7D A;  5FLX K;  2A05 A;  2QKL B;  2XRO A;  4A12 A;  3PSF A;  4YFX F;  3VYU B;  5TIS C;  1LVK A;  1Z67 A;  2LKX A;  2LD5 A;  1SD6 A;  4YG2 F;  4LLL A;  1TT0 A;  1W0U A;  4RGR A;  3HSF A;  2EFW A;  2O3F A;  1BR2 A;  1WI9 A;  4LIT A;  1TLH B;  4RLQ A;  1Z77 A;  4CDG A;  2E19 A;  3WTT C;  3S15 J;  2R5Y A;  4M71 A;  3MKY B;  2RNG A;  3B6C A;  1LPQ A;  4FHT A;  1FZP B;  1RUN A;  3QU6 A;  1U6G A;  4FE7 A;  5DD4 A;  1FSE A;  4XLN F;  2K27 A;  3GTG J;  4JP0 A;  2YUS A;  2I10 A;  3CCU I;  3ZMT A;  1LB2 A;  3HTS B;  2AQF A;  3M1C A;  3IAS 2;  4HBL A;  2NS0 A;  2X1D A;  3IHU A;  1FLI A;  3BCB A;  1KU2 A;  1FT9 A;  4C2T A;  4O3M A;  3D5S C;  2CJJ A;  2E5Z A;  4AC0 A;  1ZRD A;  4L18 B;  1Y6I A;  4I09 A;  1HKT A;  3OS0 A;  2DMQ A;  2ICW G;  2HKO A;  2D1H A;  4HF0 A;  3BT9 A;  3SYT A;  3F23 A;  3E1S A;  4UVC A;  1I50 J;  1UG2 A;  3RSN A;  5JR3 A;  3BPV A;  1JKQ C;  2KIF A;  4EJT A;  3QP5 A;  1O3S A;  3CCL I;  3HKZ A;  1DP7 P;  4UUV A;  2XAU A;  1QHH D;  2QUF A;  1MMS A;  1D0X A;  4IVN A;  4RAG A;  4B43 A;  1IAW A;  2HXO A;  5D5X B;  4C2M J;  4XOR A;  1X1P A;  4I76 A;  4CYC A;  2RKH A;  3CCQ I;  3TO9 A;  2DA7 A;  3RYP A;  3VOE A;  4OIQ F;  2DOA A;  2UWM A;  1JJ8 C;  1IG7 A;  2TRT A;  2XRN A;  3OL4 A;  4JOM A;  5J4V A;  3N4M A;  1X4P A;  2ZXI A;  2CMP A;  1YRN A;  2M3A A;  1ETW A;  3MMY B;  1V55 H;  3CUQ C;  1WJA A;  2FD5 A;  4M6X A;  2ELJ A;  5HS8 A;  3NAU A;  4KIB A;  1F5T A;  2EA4 A;  4KN7 X;  4A3M J;  2XC7 A;  2HYJ A;  4A93 J;  2YR2 A;  4B4C A;  4YEL A;  5D5V B;  1JT6 A;  1AA7 A;  1YTY A;  2AXL A;  1RC9 A;  5FFX A;  3LQR A;  1Y8R B;  3QOE A;  4E7K A;  4P1W A;  3CO7 C;  4AYB A;  4M9Z A;  2CG4 A;  1HXD A;  2BY2 A;  4MFD A;  1UST A;  3WHC A;  5IYD J;  1Z9C A;  2P6T A;  4GXO A;  2L9S A;  5H2F C;  5L3B A;  4ZYD A;  4A69 C;  1TL8 A;  5FKM A;  4IJA A;  1J7K A;  1DGR M;  4HZF A;  5CVJ A;  3I54 A;  2P7C B;  4MGR A;  1NK2 P;  5HS9 A;  1E3O C;  1VI0 A;  3CJT B;  4M74 A;  3CJR B;  3GX4 X;  1QNT A;  1R00 A;  3BZC A;  5DUI A;  2NVQ J;  4GYG A;  3CJQ B;  1ETY A;  3VSL A;  2COM A;  2E34 A;  2QQA A;  2VUM J;  1MMA A;  5DTD A;  2YS9 A;  1C0W A;  4I2O A;  1HLV A;  4BU2 A;  4IOC F;  2K9M A;  3I64 A;  2O7O A;  3KEO A;  1VF9 A;  2Y0M A;  2HU9 A;  4UNO A;  1IRF A;  1O3T A;  3HSR A;  4A0Z A;  4BQA A;  2ZKZ A;  2LRD A;  3HHH A;  3OYL A;  3DXJ F;  5BS6 A;  1HW5 A;  4FAS D;  2PEX A;  1ZHF A;  2LH9 A;  3HOT A;  5FRO A;  3G3Z A;  3RDI A;  4M9X A;  3GTO J;  1B59 A;  2XKP A;  2R0Q C;  2IS4 A;  1SFE A;  2VQL A;  2XAQ A;  4M6Y A;  4RAF A;  4DYC A;  2Y0S N;  3R6S A;  4Q5S F;  1GV2 A;  1TQM A;  1VQO I;  1LDJ A;  3M1E A;  2XPW A;  1XSV A;  4FQG A;  3OYA A;  3HUG B;  1REP C;  4IXA A;  4BEH B;  1YYV A;  1S7O A;  2F48 A;  2O9L A;  2F4M B;  4IZZ A;  5HDK A;  3C2B A;  2JRT A;  2X9D A;  4BJ5 C;  4HNU A;  5GAE J;  5E17 F;  5CLS A;  1FPQ A;  1P7J A;  3RZO J;  3FXM A;  2X0L A;  3HRS A;  4PJM A;  3K4L A;  3HOZ J;  2GXA A;  3LSP A;  2B9S A;  4BAC A;  4B8X A;  1IXS B;  2IXS A;  2QGU A;  2DQR A;  3GFL A;  1HSJ A;  1XCB A;  3SQN A;  2V79 A;  3TMO A;  2D45 A;  2G7U A;  4C3I J;  3EYY A;  4ZYH A;  1V5F A;  2LF7 A;  2OV7 A;  2RQQ A;  1Y1V J;  2PN6 A;  3W6J B;  4C2U A;  2B63 J;  4I6Z A;  4M3E A;  1ERD A;  5HDN A;  1SC7 A;  3H5N A;  4G7H F;  2ADU A;  1ZG5 A;  1Y0U A;  4PJL A;  2JK3 A;  1MD0 A;  4XMY A;  1L0O C;  4QWQ A;  1X1A A;  2R92 J;  1W5C C;  2MC4 A;  4KIS A;  1Q1V A;  3L2C A;  3J7A O;  3KPH A;  1BBY A;  1J5Y A;  4D5C A;  2HOT A;  2PFB A;  3GTL J;  2L3D A;  1S3J A;  1P92 A;  3ZN0 A;  1D1A A;  4YIR X;  1PP8 F;  1K4S A;  2PJP A;  4ZYE A;  2A07 F;  1UEL B;  5E1Z B;  2EV6 A;  4A0X A;  1R5H A;  5D8K B;  2ZBK A;  1G6N A;  1IXR C;  3JTH A;  3J81 K;  3B73 A;  1O3R A;  4RMN A;  1TTY A;  4CCL A;  3PUF A;  1G8X A;  3PO2 J;  3T8R A;  5C3E J;  3IH2 A;  4PK4 A;  1GLN A;  3OIP A;  4CSW A;  1S72 I;  5J8F A;  1MJA A;  3B6A A;  3QYE A;  3JRB A;  3GTK J;  2JA8 J;  2CUZ A;  2W4S A;  2DXI A;  4EQQ A;  2ZXW H;  4CGZ A;  2HWV A;  3K7A J;  5F27 A;  4EV0 A;  3KEY A;  4MO7 A;  5ILS A;  5EZG A;  4XIC A;  2QEX I;  1FYL A;  5ICE A;  2A6T A;  5EG0 A;  3S2H J;  1Y0N A;  2VBY A;  2TDX A;  2G9W A;  3BOQ A;  2K40 A;  2WY7 Q;  4RGS A;  4U87 A;  4AM3 A;  5JLW A;  2KMU A;  1S9H A;  2P4W A;  1FNN A;  1U5T A;  2M7A A;  2V9P A;  4Y15 A;  4CA0 A;  5B3S H;  1HC8 A;  2V9V A;  4GFB A;  3PO3 J;  2WBM A;  2JQ7 A;  3ZMS A;  3CUQ A;  1UHS A;  2RGV A;  3NWT A;  5KK1 A;  5D4R A;  3MCZ A;  1FOX A;  3IWZ A;  3CO6 C;  3B02 A;  1ZG1 A;  3HSE A;  3CMM A;  2IA2 A;  2JRM A;  4D9J A;  1YS6 A;  3DV8 A;  2EFP A;  4HNV A;  2VE8 A;  4Q4Z F;  3D1N I;  4C3H J;  4A3J J;  2DMN A;  5LD2 C;  5IT9 Z;  2HNH A;  3LNQ A;  1LKX A;  2Q2E A;  4L5E A;  1KQ8 A;  4KIT B;  1H89 C;  5K7F A;  2LVS A;  4NNJ A;  2I8D A;  1KU7 A;  1VQP I;  5EGO A;  1OIS A;  3H3Z A;  2FSW A;  3IKT A;  1Z21 A;  3KP2 A;  3LOC A;  3GEZ A;  3C18 A;  5FKL A;  4EM1 A;  1YE9 A;  3BTI A;  1VTN C;  3HYI A;  2X1E A;  3DPL C;  1R4N B;  2R7O A;  2CQN A;  1V54 H;  1WH7 A;  4WXH A;  1DGW Y;  2ZNY A;  4CYD A;  2FQ3 A;  2RV8 A;  1LEB A;  1RKT A;  1EF4 A;  3GTQ J;  1NG6 A;  4A3G J;  3GFI A;  5M5Y J;  1TWH J;  1W7P A;  4BL0 B;  1QVT A;  3HOY J;  2ETH A;  3CD6 I;  3CMY A;  4ITV A;  1FBS A;  2DMT A;  2VBX A;  3T5X A;  2BE5 F;  5GPC A;  2L54 A;  3HHG A;  2YU9 J;  2CWE A;  3HG9 A;  3SDG A;  3OYD A;  3UKG A;  3S16 J;  3FXL A;  3HL2 A;  5ERI A;  4UVA A;  2VOO A;  3CDH A;  3CP2 A;  3ULQ B;  3RPU D;  1T39 A;  4IRG A;  1VQ5 I;  3KYD B;  2DA3 A;  2MAB A;  3PJR A;  1ON1 A;  2HKX A;  4RGU A;  2R5Z B;  1GXQ A;  1S7E A;  1BI2 A;  2DOF A;  1SFX A;  5KAI C;  4X1E A;  3HRU A;  2M8E A;  2F5E A;  2HDC A;  1B9M A;  5L3G A;  1K83 J;  1DDN A;  4M6V A;  1R5I D;  3H3U A;  2VE9 A;  1G3T A;  3QRF F;  1WJC A;  3NEU A;  4NBQ A;  4CIC A;  3BPX A;  4XKC A;  4RGX A;  1LUJ B;  5FKK A;  4HF2 A;  1Z05 A;  2R7F A;  3H3V K;  1SFO J;  5CJ9 A;  5E1W A;  2JA6 J;  1BI3 A;  2A61 A;  3S14 J;  1IV8 A;  1SVL A;  3GFM A;  1W5T A;  2MSY A;  2HOS A;  1IN5 A;  3ZQL A;  1TC3 C;  1GT0 C;  1X1D A;  4ZZL A;  1RES A;  3PNV A;  1BN5 A;  1IN4 A;  2OBP A;  1ZTR A;  1D0Z A;  4XQF A;  1PUF B;  2VAS A;  1J9I A;  1ZR4 A;  2EFQ A;  1VFC A;  3J7A Y;  3AAF A;  2TCT A;  3E5Q A;  5DDG A;  5AIQ A;  4BH9 A;  1U78 A;  2W7N A;  4UUT A;  5D6F A;  1ACI A;  1I3A A;  1ETX A;  5K1Y A;  2IBD A;  2BBY A;  4XKB A;  2CV0 A;  3I58 A;  1I6X A;  2DPD A;  2H8W A;  3GCM A;  3VPR A;  4KNY A;  2F5C A;  4U88 A;  2LBF B;  2OQG A;  5BOX A;  3HDD A;  1TWA J;  1R6R A;  3CUO A;  1BC7 C;  1AKH B;  3K1M A;  2JA5 J;  4NQW B;  1XDS A;  1E3H A;  2QVO A;  1YW9 A;  2R4G A;  3I53 A;  4BXF A;  4M72 A;  1XD7 A;  3T8T A;  3WTW C;  3FMR A;  1KZH A;  3K10 A;  4E7L A;  2LKP A;  2P7V B;  1FP1 D;  3QYB A;  1CF7 B;  3TBI A;  1ZGW A;  3U2R A;  1YX5 A;  1ODD A;  2O03 A;  2K7L A;  2VXD A;  3F6V A;  1J0R A;  2VT2 A;  2NS8 A;  1UG0 A;  3LFU A;  1SD7 A;  2X48 A;  4AVP A;  5CVI A;  3ZXS A;  2W24 A;  2D5V A;  3E6C C;  3M8E A;  3L2V A;  4OAZ A;  1FMW A;  3ZMV A;  3ECH A;  2OCC H;  2VPL A;  3BG9 A;  1LVA A;  3E6D A;  1VQM I;  3O8H A;  2PG4 A;  1A5J A;  4LD5 A;  1F36 A;  3FBI B;  2ZJQ F;  1H88 C;  2HDW A;  3ZMD A;  4DZP A;  1BOB A;  1OYW A;  2NXN B;  2OCE A;  1LDD A;  2QSG X;  3K4N A;  1ZAR A;  3LSG A;  1MJB A;  3ZGK A;  4WWC A;  2HPI A;  3OSG A;  2EIM H;  2CYY A;  2IGK A;  1R1U A;  1MBK A;  3K4J A;  4WX9 A;  2G7H A;  2H09 A;  1SAN A;  5CKT A;  3V8K A;  5C4J J;  1HDD C;  2RAE A;  4R1H A;  2R3S A;  5HVQ C;  5CQE A;  2V6C A;  3OR1 C;  3DFG A;  2W1O A;  1T56 A;  2GBY A;  1LFP A;  2HXI A;  3A2K A;  3K69 A;  3LA7 A;  2E1N A;  3LSM A;  4E6K G;  2LR8 A;  2FX0 A;  2OA4 A;  3W2W A;  1A04 A;  4C3J J;  5FRN A;  1LQ1 A;  2VON A;  2KJC A;  3ZPL A;  3WTV C;  4MEX F;  1B6A A;  3L9F A;  1G4D A;  1ETQ A;  3COA C;  1FWZ A;  2MG4 A;  1H9T A;  3SEZ A;  1RNL A;  3JAM Z;  4I98 B;  1FJL A;  4M73 A;  3CCM I;  2GA1 A;  5A2Q Z;  5JVT A;  1JE8 A;  4Y52 J;  1SEU A;  3BDD A;  3GW2 A;  1U8B A;  1ETO A;  5ICG A;  3K2A A;  4II2 A;  2HQR A;  3RKX A;  3HUG A;  3LMM A;  2CRG A;  4BEH A;  3QQA A;  4Y7N J;  1X2M A;  2QEN A;  3Q3S A;  3VFZ A;  2CH0 A;  2HEO A;  4OIP F;  2K4J A;  3JW4 A;  1JJ6 C;  4P96 A;  3OYF A;  1XGM A;  2VQH A;  1ZN2 A;  2OPT A;  1R36 A;  1KA8 A;  4XBF A;  1FBQ A;  5AON A;  2ZO4 A;  3BZK A;  1L3L A;  2L7F P;  4ENK A;  2BV6 A;  3RQ4 A;  4EGY A;  3LST A;  3V8L A;  4NDL A;  5LLQ A;  1OCT C;  4DIQ A;  2VJJ A;  2YPR A;  3MZY A;  4RB0 A;  1JKP C;  4UXN A;  3W2V A;  4QPO A;  4LB6 B;  2O8X A;  3BP8 A;  4OWR B;  1EA3 A;  2KRF A;  1YW8 A;  4ESB A;  1SFK A;  4CCM A;  2IGM A;  5J3L A;  4IHV A;  2P0W A;  1MDM A;  3F8F A;  4XK4 A;  3C2H A;  2IEK A;  1QVU A;  2L2O A;  3LL7 A;  4GRI A;  1HW2 A;  5J6X A;  3MKZ A;  2K9S A;  4JYK A;  1W36 D;  1BC8 C;  4Q47 A;  3EDP A;  3HPG A;  3MAJ A;  4EMS A;  2DYS H;  4BQQ A;  1OPC A;  5B1A H;  1Z6R A;  3HTU A;  3OSF A;  3ASN H;  2E60 A;  2LLK A;  3HOU J;  3HOS A;  2EA2 A;  4JQF A;  1X3U A;  3MD2 A;  4BE0 A;  4F91 B;  4LG3 A;  1I27 A;  4IL6 C;  4DQ2 A;  1T2K A;  1Q1H A;  1WWX A;  1N78 A;  2Z99 A;  2NOG A;  4KMF A;  3P5J A;  3WGI A;  4G6Q A;  4M3G A;  4ZDP A;  4D0P A;  1ENH A;  5GTI C;  1JKR C;  1VQ9 I;  2DOE A;  1Z6T A;  4B44 A;  1WRJ A;  5CVR A;  1VND A;  3RQI A;  1XPX A;  4PSX A;  1S5L C;  1X58 A;  4HX4 A;  4XL9 A;  2R7Z J;  1GVD A;  2ZFU A;  4E7I A;  2EBI A;  3OMY A;  4N9I A;  2O61 A;  4OMZ A;  3ZQF A;  2A68 F;  3WG7 H;  1QZY A;  2Y75 A;  2Y9Y A;  3BJA A;  4UB6 C;  4EJW A;  1EH8 A;  2M30 A;  4LIU A;  1D1B A;  2ZSI B;  4LK0 F;  4MHG A;  1ONV A;  2OUM A;  1VQ7 I;  3AG2 H;  2L7M P;  3RKY A;  3EYI A;  1QQI A;  3FM5 A;  4HX8 A;  3MVP A;  4G12 A;  4EAT A;  4XON A;  1A6Q A;  3CLQ A;  3OYM A;  1FMV A;  3E3V A;  2OQR A;  3HGY A;  2HYG D;  3OOP A;  3GLX A;  4L9V A;  2WAQ N;  4NHJ A;  3WU2 C;  2EIK H;  3RJP A;  2B0L A;  1ORK A;  2YX4 A;  1BR1 A;  3IWF A;  2Z33 A;  3UR3 C;  3QWL A;  3BR0 A;  1TWG J;  3WTY C;  4ON0 A;  4QIW N;  5J1R A;  1FOK A;  1JTX A;  1JGG A;  2ID6 A;  2DT7 B;  4KMU X;  2FML A;  4NC6 A;  2KHM A;  2A6H F;  5LGT A;  3FXQ A;  3ISP A;  5HLI A;  1R58 A;  4FET A;  1OQY A;  1ON2 A;  4K2E A;  3K2Z A;  3KEQ A;  4BBR J;  1IGN A;  3JRC A;  3ROU A;  4XM3 A;  5B5E C;  3FHN A;  1ETV A;  5E79 C;  4I0A A;  2LF8 A;  4FE4 A;  3S3O A;  3K6G A;  1ZR2 A;  1QA6 A;  2JN6 A;  1TZL A;  2PJR A;  3BTL A;  4LLN A;  3F9K A;  3QAH A;  2A69 F;  4HV5 A;  3X2Q H;  5FRM A;  2F6C A;  3A1Y A;  3C3W A;  3TED A;  1MKM A;  2V1U A;  1OYY A;  5J1U A;  2I5U A;  1W0T A;  3FIW A;  2QBY B;  3T1B A;  1WJB A;  2BY0 A;  4HLX A;  4A5N A;  3J7Z I;  2Z3Y A;  2HS5 A;  1B72 B;  3CP8 A;  1HST A;  3S1R J;  2R7S A;  2DJN A;  3F3X A;  4N4O B;  1MMD A;  1WI3 A;  2CW8 A;  2R7Q A;  4YII A;  1WPK A;  1PP7 U;  2VOD A;  2CO5 A;  2E35 A;  2E2I J;  3SFI A;  5E3N A;  5IOY A;  1N25 A;  1YLF A;  2J5P A;  3RIR A;  3MKW B;  1DQU A;  2CS3 A;  4UUS B;  3CDL A;  1R71 A;  2K86 A;  1HF0 A;  5GP9 A;  2K3F A;  4HLY A;  3I5U A;  4CO8 A;  3BTC A;  5L3F A;  1JI8 A;  4XLC A;  4OAY A;  2HVQ A;  2NYX A;  3JSP A;  2H1K A;  1XSD A;  2XVC A;  2R5Z A;  4Y3O A;  5HOD A;  2FE3 A;  4IHT A;  2VC0 A;  4D7N A;  3EUH C;  3T0Y A;  2JA7 J;  1RR7 A;  3QU3 A;  4ZTJ A;  1RI7 A;  1O3Q A;  1O7F A;  4RDU A;  4U0Y A;  2QKM B;  5L3E A;  3JRG A;  1IJW C;  1K79 A;  2OC6 A;  5K5R A;  1HKS A;  3BQY A;  3OYB A;  3GTJ J;  2JUG A;  3R60 A;  1SAU A;  1U9N A;  2W48 A;  5IY5 H;  1JHF A;  2FA5 A;  1D8K A;  2N8G A;  3LAJ A;  2IT0 A;  1DPU A;  3O2P E;  2MGQ A;  1BM9 A;  3HZJ A;  1MND A;  4C30 A;  4DZJ A;  5FLM J;  4HDU A;  2ZB9 A;  3I4M J;  4Z6Y A;  1Y56 A;  3A03 A;  4HX7 A;  2LC2 A;  1MMG A;  1YFH A;  2LOO A;  4ANJ A;  1K6Y A;  3JSO A;  1W5S A;  5FB2 A;  1MNM C;  4M9S A;  3UNG C;  3PSI A;  2MH9 A;  3MZ8 A;  1T0F C;  3FX3 A;  2HQN A;  1N77 A;  4GDF A;  1XMK A;  1QZZ A;  1IZ1 A;  1AKH A;  3CES A;  4ENJ A;  2E7X A;  4NQW A;  3HPH A;  3K1N A;  4BQN A;  2F2E A;  2V1X A;  3H0D A;  2E7W A;  3PM1 A;  1YJN I;  2CV2 A;  3Q5F A;  2YX7 A;  4DGW B;  1CF7 A;  3L7W A;  1RET A;  2ZME C;  3A4C A;  3RTR A;  1W1W E;  3QOP A;  2CQ7 A;  5F64 A;  3WE3 A;  3K70 C;  3TP0 A;  4IHY A;  2WA0 A;  2M5W A;  3E5X A;  5E1X A;  1Z3X A;  2RNJ A;  1B8I B;  3PNY A;  1JUS A;  2EIL H;  1KYZ A;  2L9R A;  1WH5 A;  4XLF A;  4KIC A;  4I02 A;  1ITY A;  2EV0 A;  4BQO A;  2IS6 A;  3EUK L;  4A3I J;  1I6H J;  2GOM A;  2VLA A;  1OFC X;  3VYT B;  2IS1 A;  5JHU A;  2VB6 A;  2XF5 A;  3RPU A;  5IT9 K;  4AVZ A;  2KZG A;  2KIQ A;  1O7L A;  2E1O A;  4NB5 A;  2DAO A;  2X6X A;  4XLP F;  3KZZ A;  1F9N A;  5M5W J;  2PLY A;  4MQV A;  3V42 A;  3GME A;  2HDD A;  1YHQ I;  4FX0 A;  5F08 A;  3H5A A;  2R7W A;  2LDU A;  1D8J A;  5HDG A;  2XAG A;  5FD5 A;  5IPA A;  1CQT A;  2Y69 H;  3KP7 A;  2QQB A;  3CLO A;  1F43 A;  1W36 C;  3BR3 A;  4H0E A;  3GTP J;  4BE1 A;  2GIV A;  4F92 B;  1JXS A;  1OCC H;  4EJV A;  5LHG A;  1SVO A;  2M7B A;  3LSR A;  3F8N A;  2H94 A;  1GVJ A;  4M3B A;  1OCR H;  3H1C A;  2X6W A;  4Y4R A;  1IUY A;  1I5Z A;  2W84 A;  4B09 A;  1R49 A;  4HYE A;  3KP5 A;  1ZK8 A;  5K5O A;  1U2W A;  3KZI C;  3G2B A;  2XAF A;  2ELK A;  2FU4 A;  3PUB A;  2R7X A;  1OLT A;  3NQO A;  2HQA A;  3P7N A;  3R61 A;  2Z16 A;  2BW3 A;  3ELK A;  2K02 A;  1YJ9 I;  3OR2 C;  3DLL F;  1SAX A;  1W4M A;  2GM4 A;  2GA2 A;  2XF7 A;  5J1Y A;  4ZZD A;  4X0G A;  3F22 A;  1ZLJ A;  1STZ A;  4UV8 A;  4MTD A;  3NRV A;  4CCK A;  1J09 A;  1P6R A;  1RZ4 A;  5J8C A;  2JVH A;  2DA5 A;  2V9K A;  4L0Y B;  1X3W B;  3F21 A;  2BY1 A;  1X1C A;  2GAU A;  1BL0 A;  1WZ2 A;  2EB7 A;  2BGC A;  3BR5 A;  2FJ1 A;  3QPS A;  1VQL I;  4U7B A;  2DDB A;  1NG7 A;  4DBQ A;  2M2E A;  2QWW A;  3Q0W A;  1H8A C;  5GAD J;  3CCE I;  1I3Q J;  3H0G J;  4P5O A;  4CZZ A;  3S1Q J;  2Z1D A;  2BXY A;  1IN8 A;  1IRZ A;  2Z2S B;  2DFH A;  3ZN1 A;  3S17 J;  3JRD A;  3JRH A;  3QP6 A; 
#chains in the Genus database with same CATH homology
 2F5D A;  4LB5 A;  4ASN A;  2O0Y A;  3ML6 A;  5CYV A;  4HAM A;  2Q8K A;  2QZ8 A;  4KN4 X;  2A5Y B;  2ZXJ A;  1S8N A;  1K7A A;  2P5V A;  1ZAO A;  1H0M A;  2ESH A;  3ERE D;  2D2W A;  2VBZ A;  2KIM A;  3MZH A;  3ECO A;  1BI0 A;  4L5I A;  5LRR A;  2EFN A;  5FD6 A;  2BEO A;  2Z5U A;  3C7J A;  2QYO A;  4KA4 A;  1S29 A;  4EM2 A;  5FFZ A;  5LHH A;  2DTR A;  2STT A;  3TDZ C;  3BWG A;  4RAZ A;  3HRM A;  1DUX C;  1BIB A;  3IC7 A;  2X4H A;  2GXG A;  1XGN A;  4E70 A;  1R7J A;  2XKO A;  2FEZ A;  3FZV A;  4P55 A;  2FOK A;  1KQ0 A;  4Z2Y A;  5ED4 A;  2FMY A;  5D8L B;  3TGN A;  4A5M A;  2D1V A;  3MQ0 A;  4L9J A;  2V1D A;  1PUE E;  2H27 A;  1F4K A;  1SFU A;  1LDK B;  1K78 B;  2DW4 A;  1R1V A;  3WGG A;  1LNW A;  5ILV A;  4OU0 A;  2QBY A;  5LRS A;  4LLG F;  3JAM K;  3EET A;  3FM3 A;  5A2Q K;  2KJB A;  1YIO A;  3M9A A;  4L5J A;  3W6K B;  3U1D A;  3G73 A;  2FXA A;  3Q9V A;  4BHP A;  2HTS A;  4BXU A;  2GXB A;  2PMU A;  5LGN A;  2XAH A;  1QPM A;  5CVU A;  2K4B A;  4L9N A;  3H92 A;  3DP7 A;  1P4A A;  4PCQ A;  3HIF A;  3REO A;  1KYW A;  3LAP A;  1I1S A;  4WXD A;  3VOD A;  2XV4 S;  4HW0 A;  4P9U A;  2E1C A;  2IJL A;  1IRG A;  2RQP A;  3P9C A;  5EEG A;  2OAZ A;  2VC1 A;  3SFZ A;  4MEY F;  3IL2 A;  3E6B A;  5H20 A;  2OD5 A;  2RDP A;  3PQJ A;  3BY6 A;  4KYW A;  1EH6 A;  1GHC A;  3KFW X;  3GFJ A;  2W85 A;  3FXU A;  3J80 Z;  4IRH A;  1J75 A;  4S04 A;  2HR3 A;  2XGX A;  4P9F A;  2LSO A;  4L9T A;  3I4P A;  2IA1 A;  3I0T A;  3BJO A;  2EFO A;  3R0J A;  4O6J A;  1PDN C;  5BPI A;  3ZMZ A;  4AWX B;  1J2X A;  2WWY A;  2KIU A;  5K5Q A;  1ZH5 A;  5D4S A;  2L4A A;  2YSR A;  3TOA A;  5LHI A;  1EH7 A;  3GO5 A;  2OZ6 A;  2CW0 F;  3L09 A;  4Q48 A;  1U5T B;  4JBA A;  4LG0 B;  5HOO A;  2FNP A;  3F6O A;  1ZRC A;  4KUM A;  3FMS A;  1FX7 A;  5F1R A;  1KU9 A;  3TKY A;  1O57 A;  4HV6 A;  1QO0 D;  3I59 B;  3WTU C;  1FBU A;  1T98 A;  2CQK A;  3DEU A;  3ABT A;  4YIF A;  2PI0 A;  1RIO H;  2P5K A;  5DCM B;  2XUB A;  1AWC A;  1IN6 A;  4UHT A;  1IN7 A;  2IPQ X;  3KP4 A;  3D5L A;  3KP6 A;  2GWR A;  1R5G A;  1G3S A;  2RVC A;  1D5V A;  2MLG A;  3TDU C;  3KET A;  3WGH A;  2MD5 A;  2M87 A;  4IF4 A;  4S05 A;  1TQP A;  4IHS A;  2FBI A;  1UHM A;  1I1G A;  1P4W A;  4WK8 F;  1YS7 A;  2ZME B;  4XSX F;  5HLG A;  1USS A;  2XAS A;  4Y17 A;  4AIJ A;  3SZP A;  2JPB A;  1ZRF A;  4CHU A;  3F72 A;  1S7A A;  4YFN F;  3GVA A;  2QQ9 A;  4BHB A;  1FYK A;  1J59 A;  2GQQ A;  2QLZ A;  3WU1 B;  1Z91 A;  3RI4 A;  4BHC A;  2MA3 A;  4OIN F;  5TJJ A;  3S2W A;  3V7S A;  3IKV A;  3I71 A;  3F8B A;  2PBI A;  2WV0 A;  4EGZ A;  4G7O F;  5D5W B;  5DYM A;  1SD5 A;  2IW5 A;  2JSC A;  3IRQ A;  1WKM A;  3BZ6 A;  3FXR A;  5DUK A;  4PGH A;  4BAY A;  2DQL A;  5HLH A;  3EQL F;  2STW A;  2VBW A;  2W25 A;  3GWZ A;  4RB3 C;  1H9G A;  3PFI A;  2FBK A;  1U5T C;  4OOI A;  2GZW A;  4IPA A;  2DT5 A;  3P9I A;  5HS7 A;  1P2F A;  2C6Y A;  2HZT A;  5DD8 A;  5FLX Z;  5ICC A;  2Z9O A;  3OV8 A;  3KLN A;  4TV7 A;  3KCC A;  1XB4 A;  1QGP A;  1MGT A;  4WCG A;  3CTA A;  3DF8 A;  4OIR F;  4PGG A;  2DFI A;  1U8R A;  3HRT A;  1IF1 A;  5KVR A;  1XMA A;  3PQK A;  3DPT A;  1ULY A;  2DLL A;  5LGU A;  1V3F A;  4HDV A;  1JHH A;  4G7Z F;  1ZGA A;  1YG2 A;  1FP2 A;  1K78 A;  2L02 A;  1XN7 A;  1GXP A;  4BNC A;  5LEK A;  3V7C A;  2H6B A;  4LFU A;  2ZJ2 A;  4GCV A;  2VOP A;  2BYV E;  5JFR A;  4I01 A;  1T38 A;  5DV5 A;  3LQQ A;  5ILU A;  1D3Y A;  5H6R A;  4ESJ A;  2NRA C;  4KFC A;  2PQ8 A;  4JK1 X;  3TQN A;  3F8M A;  2P6S A;  3GXO A;  3IRR A;  2RC4 A;  2KKO A;  4ZYG A;  3KZY A;  5H6Q A;  3WTX C;  3FHZ A;  3K1P A;  1UHW A;  1TQI A;  4EVI A;  1RUO A;  2ZCW A;  2L01 A;  2HFH A;  1XSX A;  1B9N A;  3P9K A;  4O5V A;  2VT3 A;  3MFK A;  4U0W A;  1MDM B;  2MC3 A;  3LFK A;  4LJZ F;  1R1T A;  1DPR A;  2HYF A;  3LWF A;  3TOB A;  3RKW A;  4Y13 A;  1XGO A;  4MQ9 F;  4GGG A;  4XSZ F;  2XAJ A;  3ZMU A;  1ZRE A;  5L3C A;  2DI3 A;  5DEQ A;  2FF4 A;  1XGS A;  3ABU A;  2M45 A;  2ZNZ A;  1KU3 A;  5DCF A;  3ZQ7 A;  1ZLK A;  3MWM A;  4KT5 C;  2Q0O A;  1NHA A;  4HQM A;  2DPU A;  2WC2 A;  5CVV A;  3GYH X;  4OMY A;  3WOD F;  3WU0 A;  2ELH A;  3M8F A;  4HQE A;  4ETS A;  1WQ2 A;  1ZGJ A;  4MTE A;  3U9G A;  2UXX A;  2IA0 A;  4LG0 A;  1G3Y A;  2HGC A;  3D0S A;  3EUH A;  5FO5 A;  4AIK A;  1ZYR F;  3I59 A;  1BJA A;  2DO7 A;  4RB2 C;  2ISY A;  3VB2 A;  4LMY A;  1UFM A;  3L00 A;  2O6G E;  5BMZ A;  3FMQ A;  5DCM A;  2IRF G;  4R8H A;  4G6D A;  1OMI A;  3J81 Z;  2EWN A;  3K9T A;  2UZK A;  4KIF A;  3CJN A;  2OZU A;  3TO7 A;  1IW7 F;  2P5L C;  3QPT A;  1BI1 A;  3BRO A;  4DNC A;  4WXC A;  1T0F A;  2EJR A;  1BOA A;  1K6O A;  1R22 A;  1YO5 C;  3RPQ A;  2Y48 A;  5BPD A;  2NNN A;  5JI6 A;  3ZP5 A;  3LA2 A;  4R79 A;  4FX4 A;  3GUD A;  1HW1 A;  2NNY A;  2VN2 A;  2OU2 A;  1KGS A;  1HBX G;  2ZME A;  1MJ9 A;  3E5U A;  3MEX A;  2XHK A;  1S6L A;  4F7Z A;  2EV5 A;  1SMT A;  4LK1 F;  3V7R A;  4ESF A;  1WSU A;  4YFK F;  4FT8 A;  1V4R A;  5F6F A;  2A3S A;  4RS8 A;  1TNT A;  3DQV C;  1TNS A;  4G94 A;  2JPC A;  4BYY A;  4L0Z B;  4ENM A;  4AIH A;  2ISZ A;  2UXN A;  5E18 F;  5LBQ A;  2CSO A;  2HOE A;  1B1B A;  4G9Y A;  3J80 K;  4IRI A;  4UV9 A;  2P8T A;  2QM3 A;  2ESN A;  2IVM A;  2L4M A;  3GZ6 A;  1SD4 A;  3RYR A;  3O6B B;  4QLC U;  1E2X A;  3F8C A;  2VXZ A;  1QBJ A;  2DBB A;  4HF1 A;  1XCV A;  4A2U A;  4HA8 A;  3WG9 A;  1AOY A;  1E17 A;  1HKQ A;  1LEA A;  2H6C A;  1OYI A;  2LNB A;  3GZ5 A;  4PZJ A;  2NAZ A;  3E6M A;  4N9H A;  3JTG A;  3O3K A;  1YW7 A;  1G3W A;  3M7G A;  1YQA A;  2DU9 A;  4WF2 A;  4EJO A;  4A6E A;  4RB1 A;  5ICF A;  1Z7U A;  2JZY A;  1UB9 A;  2M1B A;  4HOB A;  2MH2 A;  2EK5 A;  3R0A A;  4U0V A;  2CGP A;  1FC3 A;  3R4K A;  6PAX A;  1TW2 A;  2IP2 A;  3FF5 A;  1HQC A;  5E8I A;  1TBX A;  1W7P D;  2RN7 A;  3GF2 A;  4I7H A;  3DKW A;  3C1D A;  4KIG A;  3N97 A;  2R7D A;  1CGP A;  1R23 A;  3KLO A;  5BQT A;  4EJU A;  3SHF A;  4ENN A;  1B4A A;  4PDK A;  3WE2 A;  1BIA A;  3VEP A;  2DK8 A;  5D6E A;  3V4G A;  3WTS C;  5TRD A;  4CXF A;  1KQ9 A;  5E8G A;  1FY7 A;  2JTV A;  2W57 A;  3TO6 A;  2AS5 F;  4OIO F;  1LJ9 A;  4UVB A;  3KP3 A;  4KDP A;  1U3E M;  4GYI A;  2JT1 A;  2FBH A;  5D5U B;  3CUQ B;  5LEJ A;  4A6D A;  2FNA A;  1ZG3 A;  2CFX A;  2HTJ A;  5L3D A;  2PMH A;  2WTE A;  1FSH A;  1UCR A;  5E20 A;  3QPH A;  3KE2 A;  3FWE A;  2MLK A;  1IXC A;  4AD9 A;  2FRH A;  5IT3 A;  2YU3 A;  2DK5 A;  4XRF A;  4RAY A;  1P4X A;  2J5O A;  3Q9S A;  2MBF A;  1Z1D A;  1JGS A;  1F1Z A;  2A6E F;  4EM0 B;  2XIG A;  3E97 A;  3SXY A;  1XDU A;  4N0B A;  1EV7 A;  1W7P B;  1TW3 A;  2ZFW A;  4ZH4 F;  1SMY F;  3WTZ A;  1FYM A;  4LGW A;  3K0L A;  4MNU A;  3SZT A;  1T6S A;  5FGM A;  4A0Y A;  1MZB A;  4GO1 A;  3BJ6 A;  3LA3 A;  1OR7 A;  2F5F A;  5EEH A;  1OKR A;  4I0B A;  4G8X A;  5AIP A;  3V8J A;  2ACJ A;  4U7D A;  5FLX K;  2XRO A;  4A12 A;  4YFX F;  1SD6 A;  4YG2 F;  4LLL A;  4RGR A;  3HSF A;  2EFW A;  2O3F A;  1WI9 A;  1TLH B;  4CDG A;  3WTT C;  4M71 A;  1FZP B;  4FHT A;  1RUN A;  3QU6 A;  1U6G A;  5DD4 A;  1FSE A;  4XLN F;  2K27 A;  1LB2 A;  3ZMT A;  3HTS B;  4HBL A;  2NS0 A;  3IHU A;  1FLI A;  1KU2 A;  1FT9 A;  4O3M A;  1ZRD A;  4L18 B;  4I09 A;  1HKT A;  2HKO A;  2D1H A;  4HF0 A;  3F23 A;  4UVC A;  5JR3 A;  3BPV A;  2KIF A;  4EJT A;  3QP5 A;  1O3S A;  1DP7 P;  4UUV A;  2QUF A;  4IVN A;  1IAW A;  5D5X B;  2RKH A;  3TO9 A;  3RYP A;  3VOE A;  4OIQ F;  2UWM A;  2XRN A;  3N4M A;  3CUQ C;  4M6X A;  1F5T A;  5HS8 A;  4KIB A;  2EA4 A;  4KN7 X;  2YR2 A;  5D5V B;  1YTY A;  2AXL A;  5FFX A;  3LQR A;  3CO7 C;  4M9Z A;  2CG4 A;  1HXD A;  1UST A;  1Z9C A;  2P6T A;  4GXO A;  5L3B A;  4ZYD A;  4IJA A;  1J7K A;  5CVJ A;  4HZF A;  3I54 A;  2P7C B;  4MGR A;  5HS9 A;  4M74 A;  3GX4 X;  1QNT A;  1R00 A;  5DUI A;  4GYG A;  2COM A;  2QQA A;  1C0W A;  4I2O A;  3I64 A;  3KEO A;  2Y0M A;  4UNO A;  1IRF A;  1O3T A;  3HSR A;  4A0Z A;  4BQA A;  2ZKZ A;  3HHH A;  3DXJ F;  5BS6 A;  1HW5 A;  2PEX A;  1ZHF A;  3HOT A;  3G3Z A;  3RDI A;  4M9X A;  1B59 A;  2XKP A;  1SFE A;  2XAQ A;  4M6Y A;  3R6S A;  4Q5S F;  1TQM A;  1LDJ A;  3M1E A;  1XSV A;  1REP C;  4IXA A;  1YYV A;  1S7O A;  5HDK A;  2JRT A;  5E17 F;  5CLS A;  1FPQ A;  2X0L A;  3HRS A;  4B8X A;  1IXS B;  2DQR A;  3GFL A;  1HSJ A;  1XCB A;  3SQN A;  2V79 A;  2D45 A;  2G7U A;  3EYY A;  4ZYH A;  3W6J B;  2LF7 A;  2PN6 A;  5HDN A;  4G7H F;  2ADU A;  1ZG5 A;  1Y0U A;  1MD0 A;  1L0O C;  4QWQ A;  3L2C A;  3J7A O;  1BBY A;  1J5Y A;  2PFB A;  2L3D A;  1S3J A;  1P92 A;  3ZN0 A;  1PP8 F;  2PJP A;  4ZYE A;  2A07 F;  5E1Z B;  2EV6 A;  4A0X A;  1R5H A;  5D8K B;  2ZBK A;  1G6N A;  1IXR C;  3JTH A;  3J81 K;  3B73 A;  1O3R A;  1TTY A;  3T8R A;  5J8F A;  1MJA A;  4EQQ A;  4CGZ A;  2HWV A;  4EV0 A;  5ILS A;  1FYL A;  5ICE A;  2VBY A;  2TDX A;  2G9W A;  3BOQ A;  4RGS A;  2P4W A;  1FNN A;  1U5T A;  4Y15 A;  2V9V A;  3ZMS A;  3CUQ A;  2RGV A;  5KK1 A;  5D4R A;  3MCZ A;  3IWZ A;  3CO6 C;  3B02 A;  1ZG1 A;  3HSE A;  2IA2 A;  4Q4Z F;  1YS6 A;  3DV8 A;  2EFP A;  2VE8 A;  5IT9 Z;  2Q2E A;  1KQ8 A;  1KU7 A;  3H3Z A;  2FSW A;  3IKT A;  3KP2 A;  3GEZ A;  3C18 A;  4EM1 A;  1VTN C;  3HYI A;  3DPL C;  4WXH A;  2ZNY A;  4CYD A;  2FQ3 A;  2RV8 A;  1LEB A;  3GFI A;  1W7P A;  2ETH A;  1FBS A;  2VBX A;  3T5X A;  2BE5 F;  2L54 A;  3HHG A;  2CWE A;  5ERI A;  4UVA A;  2VOO A;  3CDH A;  3ULQ B;  1T39 A;  4IRG A;  1ON1 A;  2HKX A;  4RGU A;  1GXQ A;  1BI2 A;  1SFX A;  3HRU A;  2M8E A;  2F5E A;  2HDC A;  1B9M A;  5L3G A;  1DDN A;  3H3U A;  2VE9 A;  1G3T A;  3QRF F;  3NEU A;  4CIC A;  3BPX A;  4RGX A;  4HF2 A;  1Z05 A;  2R7F A;  5CJ9 A;  5E1W A;  1BI3 A;  2A61 A;  3GFM A;  1W5T A;  1IN5 A;  4ZZL A;  1BN5 A;  1IN4 A;  2OBP A;  1J9I A;  2EFQ A;  3AAF A;  3E5Q A;  5DDG A;  5AIQ A;  4BH9 A;  1U78 A;  5D6F A;  5K1Y A;  2BBY A;  3I58 A;  1I6X A;  2DPD A;  4KNY A;  2F5C A;  4U88 A;  2OQG A;  5BOX A;  3CUO A;  1BC7 C;  3K1M A;  1XDS A;  2QVO A;  1YW9 A;  3I53 A;  4M72 A;  1XD7 A;  3T8T A;  3WTW C;  3FMR A;  2LKP A;  2P7V B;  1FP1 D;  1CF7 B;  3U2R A;  2O03 A;  1ODD A;  2K7L A;  3F6V A;  1J0R A;  2VT2 A;  1SD7 A;  4AVP A;  5CVI A;  2W24 A;  3E6C C;  3M8E A;  3ZMV A;  3ECH A;  1LVA A;  3E6D A;  2PG4 A;  4LD5 A;  3ZMD A;  1OYW A;  1LDD A;  1ZAR A;  1MJB A;  4WWC A;  2CYY A;  1R1U A;  4WX9 A;  2G7H A;  2H09 A;  3V8K A;  4R1H A;  2R3S A;  5HVQ C;  2V6C A;  3DFG A;  3K69 A;  3LA7 A;  2E1N A;  2OA4 A;  1A04 A;  1LQ1 A;  2VON A;  2KJC A;  3ZPL A;  3WTV C;  4MEX F;  1B6A A;  3L9F A;  1G4D A;  3COA C;  1FWZ A;  1H9T A;  1RNL A;  3JAM Z;  4I98 B;  4M73 A;  2GA1 A;  5A2Q Z;  5JVT A;  1JE8 A;  3BDD A;  3GW2 A;  5ICG A;  2HQR A;  3RKX A;  3HUG A;  2QEN A;  3VFZ A;  2HEO A;  4OIP F;  2K4J A;  3JW4 A;  4P96 A;  1XGM A;  1ZN2 A;  1R36 A;  1KA8 A;  4XBF A;  1FBQ A;  5AON A;  2ZO4 A;  1L3L A;  4ENK A;  2BV6 A;  4EGY A;  3LST A;  3V8L A;  5LLQ A;  2YPR A;  3MZY A;  4RB0 A;  4UXN A;  4LB6 B;  2O8X A;  3BP8 A;  2KRF A;  1YW8 A;  4ESB A;  1MDM A;  3F8F A;  1HW2 A;  5J6X A;  1BC8 C;  4Q47 A;  3EDP A;  3MAJ A;  4EMS A;  1OPC A;  1Z6R A;  3HTU A;  3HOS A;  2EA2 A;  4JQF A;  1X3U A;  1I27 A;  4DQ2 A;  1T2K A;  1Q1H A;  1WWX A;  2Z99 A;  4KMF A;  3WGI A;  4G6Q A;  4D0P A;  1Z6T A;  1WRJ A;  5CVR A;  4HX4 A;  4N9I A;  2O61 A;  4OMZ A;  2A68 F;  1QZY A;  2Y75 A;  4EJW A;  3BJA A;  1EH8 A;  2M30 A;  4LK0 F;  4MHG A;  1ONV A;  3RKY A;  3EYI A;  1QQI A;  3FM5 A;  4HX8 A;  3E3V A;  2OQR A;  2HYG D;  3OOP A;  3GLX A;  4L9V A;  4NHJ A;  3RJP A;  2B0L A;  3IWF A;  2YX4 A;  2Z33 A;  3WTY C;  4ON0 A;  1FOK A;  4KMU X;  2FML A;  2A6H F;  5LGT A;  3FXQ A;  3ISP A;  5HLI A;  1R58 A;  1ON2 A;  4K2E A;  3K2Z A;  3KEQ A;  3ROU A;  4I0A A;  2LF8 A;  4LLN A;  3QAH A;  2A69 F;  4HV5 A;  3C3W A;  1MKM A;  2V1U A;  1OYY A;  2QBY B;  3T1B A;  4HLX A;  4A5N A;  2Z3Y A;  2HS5 A;  1HST A;  3F3X A;  4YII A;  1PP7 U;  2VOD A;  2CO5 A;  1YLF A;  2J5P A;  3RIR A;  2K86 A;  4HLY A;  3I5U A;  4CO8 A;  5L3F A;  2NYX A;  3JSP A;  1XSD A;  2XVC A;  2FE3 A;  4IHT A;  2VC0 A;  3T0Y A;  3QU3 A;  1RI7 A;  1O3Q A;  1O7F A;  4U0Y A;  5L3E A;  1K79 A;  5K5R A;  1HKS A;  3R60 A;  1JHF A;  2FA5 A;  1D8K A;  3LAJ A;  2IT0 A;  1DPU A;  3O2P E;  1BM9 A;  4HDU A;  4HX7 A;  1YFH A;  3JSO A;  1W5S A;  5FB2 A;  4M9S A;  2MH9 A;  3FX3 A;  2HQN A;  1XMK A;  1QZZ A;  1IZ1 A;  4ENJ A;  2E7X A;  4NQW A;  3K1N A;  2F2E A;  2V1X A;  2E7W A;  3Q5F A;  2YX7 A;  1CF7 A;  3L7W A;  3RTR A;  3QOP A;  5F64 A;  3WE3 A;  2M5W A;  3E5X A;  5E1X A;  2RNJ A;  1KYZ A;  4KIC A;  4I02 A;  2EV0 A;  5JHU A;  5IT9 K;  3RPU A;  1O7L A;  4NB5 A;  2DAO A;  4XLP F;  3KZZ A;  1F9N A;  2PLY A;  4MQV A;  4FX0 A;  2LDU A;  1D8J A;  5HDG A;  2XAG A;  5FD5 A;  3KP7 A;  2QQB A;  3CLO A;  4H0E A;  2GIV A;  1JXS A;  4EJV A;  5LHG A;  3F8N A;  2H94 A;  1GVJ A;  1IUY A;  1I5Z A;  2W84 A;  4B09 A;  4HYE A;  3KP5 A;  5K5O A;  1U2W A;  2XAF A;  2FU4 A;  3NQO A;  3P7N A;  3R61 A;  3ELK A;  2K02 A;  1SAX A;  1W4M A;  2GA2 A;  4ZZD A;  3F22 A;  1ZLJ A;  1STZ A;  4UV8 A;  4MTD A;  3NRV A;  1P6R A;  1RZ4 A;  5J8C A;  4L0Y B;  3F21 A;  2GAU A;  2EB7 A;  2BGC A;  4U7B A;  2QWW A;  4P5O A;  4CZZ A;  1IN8 A;  3ZN1 A;  3QP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...