2DYRH

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title Structures and physiological roles of 13 integral lipids of bovine heart cytochrome c oxidase
pubmed doi rcsb
total genus 26
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2006-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 2dyrH00
5IY5H 2EILH 3AG4H 2Y69H 5B1BH 1OCZH 2EIKH 2EIJH 2OCCH 2ZXWH 1V55H 3ASOH 3AG2H 3ABMH 3X2QH 5B3SH 3ABLH 3AG1H 1V54H 1OCCH 2EIMH 2DYRH 1OCRH 2DYSH 5B1AH 3WG7H 2EINH 3ASNH 3AG3H 3ABKH 1OCOH
chains in the Genus database with same CATH superfamily
1ON1A 2OQRA 3CQZJ 5HS7A 2M34A 3EYYA 5GPCA 1O7FA 1WQ2A 1Z05A 5K5QA 2X85A 1JJ8C 2P6SA 3PSFA 2F2EA 4L5EA 4PFOA 5D8LB 4BBRJ 3GZ6A 2AS5F 4ZYAA 3VEPA 2XIGA 4HG2A 3GVAA 5CLSA 2HGCA 3BG6A 3I5UA 1SD7A 1P9QC 3BJOA 2Q2EB 4FTHA 3H5RA 2EPFA 2XSJC 2Z99A 2J5OA 3BZ6A 3E5XA 4P96A 5B3SH 4J01A 1W5CC 1G3TA 2F48A 3RPUA 3O3KA 3FXQA 3AKZA 3RZDJ 5LRSA 4PJMA 3RKYA 4OINF 1HF0A 1ZG3A 2L5QA 4S04A 2EA2A 3H0DA 3CLOA 4V19K 2WAEA 1XN7A 2BW3A 1T08B 1HSJA 2EV6A 4XRSA 2M3AA 1FTZA 1UCRA 4I76A 2FD5A 2XKPA 3BTJA 2KFDA 5LFAA 2PI0A 2L9SA 3GTPJ 3HRTA 1YG2A 5KNLA 3R4KA 2NS0A 1J7KA 1P7IA 3QU3A 3LOCA 4ZYGA 1LDJA 3TW7A 1FSHA 5FLXK 4L18B 3G1MA 4ESBA 4XRSG 3W6VA 4YRVA 1IRFA 4HNUA 3L2UA 1U5TA 3ZMUA 4NNJA 5ICEA 2V1UA 3GCMA 1VQPI 4QTRA 1Z91A 5D4RA 2AHQA 3I3LA 3EUHC 2QBYB 3HZJA 4RMNA 4FQGA 2DQRA 1DUXC 1IRZA 2ELJA 2DT5A 4A6EA 4R79A 3CMYA 3SZTA 2WB1N 2R7SA 1P6RA 4RAZA 3VOEA 2YX7A 3ASNH 4L9JA 1R6RA 3RPUD 4M6VA 1W36D 4BY7J 3FK6A 1BW6A 1XSVA 2EH3A 3HRSA 5CVVA 2EZKA 1HDDC 4U88A 4A3IJ 1R4MB 1LFUP 1VQKI 3I64A 4PFPA 1Y1VJ 3E6DA 2QF7A 1RUOA 4LB5A 4N0BA 3FHZA 2XUBA 3WHBA 4XM3A 5F08A 2BVMA 3CO7C 2QZ8A 3K4KA 2K4JA 4ESFA 2WV1A 2CW8A 4ABZA 4BQQA 1I3QJ 2EILH 2K27A 1BR4A 1LUJB 5FGMA 1UAAA 3H9GA 3IWFA 3M7GA 4JYKA 2KPMA 1S8NA 1ZRFA 3KIOA 2AQFA 2KDZA 6PAXA 4ENMA 3OYJA 2V1DA 4KITB 2OZ6A 2VT2A 4M71A 3V8JA 3L2WA 4ZTFA 3FZVA 4O3MA 1KYWA 5DEQA 3TEDA 4KA4A 1ZK8A 5TISC 2XSDC 3AG1H 2EFPA 2KRHA 2NS7A 5ICFA 3OS2A 5CPRB 5JVGF 4AM3A 1ETWA 3OMYA 3EQLF 2TRTA 2H6BA 4JK1X 2EFWA 3TP3A 4A3KJ 4MIMA 1TWHJ 2X6XA 4FCYA 1L3LA 1ACIA 2LG4A 3KP4A 3JRCA 1QRYA 5HS9A 2E19A 3I59B 2ZFWA 3ULQB 2NVTJ 2FQ3A 5BMZA 3CCUI 4H4KC 4Q5SF 2NNYA 2EV0A 1IUFA 3ZQQA 5DUIA 1YTYA 5J3LA 2EFQA 3HOVJ 4B43A 3K1MA 1T33A 2DK5A 4P9FA 3TP0A 4C2TA 4HV5A 1WWXA 2DA3A 2FX0A 3FX3A 3L09A 2OCCH 2ZKZA 3DTIA 3V8KA 2ISZA 4DYRA 1I1GA 5J1YA 1HKTA 3DLAA 3RPQA 3NQOA 4HA8A 4DOZA 4U0VA 5AONA 1F9NA 2HVQA 4CCMA 2QQAA 5DS9A 1LE8B 4BXUA 4I6ZA 1OQYA 2V6EA 2K9MA 3F22A 2D2WA 4I02A 5HOOA 3MKWB 3F72A 4JOMA 3EETA 2C6YA 4UHTA 3F9KA 4RB1A 1IN8A 4A5MA 3F6VA 3P9CA 2AXTC 3TMOA 5IT9Z 3KX2A 1AOYA 2HDDA 2VKVA 4D7NA 2A5WA 1I39A 2K7LA 2D1VA 4HQMA 1OKRA 3GTGJ 1UZCA 1R1UA 3JRAA 2UV1A 2RQQA 2RGVA 1ONVA 3BT9A 3HRMA 1SAXA 1JT0A 4HYEA 2MC4A 2BVLA 3OYKA 1FX7A 3HG9A 3TGNA 1P4XA 3WODF 1USTA 3WTZA 4C3JJ 1I27A 3DP7A 3L1PA 3DPLC 3K4MA 1EH6A 4DZJA 3E6MA 3KP3A 3HXLA 3FMQA 4IL6C 1OCZH 4YFNF 5E3OA 1S7AA 4U0YA 4U0WA 3VYTB 4M3EA 3LL7A 4P9UA 2DA1A 2F4OB 2VQHA 3M9AA 1T0FA 2FUG2 2LY1A 3FXMA 1DDNA 2EWNA 2RVCA 2H09A 3R0AA 3JR9A 1OYWA 3K4LA 2A61A 3ZQIA 1S7OA 2DI3A 2VJ5A 2IT0A 3MEXA 4HLXA 4OIOF 3S2HJ 2IA1A 3V7CA 1F5TA 2QWWA 1A36A 4G9YA 3JSOA 1K7AA 3FKJA 3BR2A 3S1QJ 2KIQA 4Y13A 2R7DA 5BOXA 1R5GA 4BQOA 4QLCU 1P2FA 3HTSB 2CUZA 2ZSIB 3IHUA 5CVRA 3REOA 3LNQA 4LOCA 1V3FA 1XS9A 2MGQA 1U9NA 4IRGA 4RAFA 4CZZA 1Y8RB 4NBQA 1ZRDA 4GDFA 5DYMA 1TZLA 1QNTA 5DTDA 2EBIA 1QU3A 3NWTA 3DEWA 1SFEA 2RREA 1WH5A 1U78A 3W2VA 2X48A 2EIMH 1YFHA 2HPIA 3ESWB 3U1KA 2HDWA 2PMZA 3VFZA 1B59A 4XKCA 1UHSA 4Y15A 4DBQA 4L0ZB 5IT9K 4D7MA 2E2HJ 2F6CA 3WGIA 5D6FA 3C2HA 3KETA 4Y4RA 2NNNA 4LLLA 2G7UA 3PIOF 1D8KA 2L4MA 3CJNA 3E3VA 3GFIA 3IAM2 3E6BA 2Z33A 4F3QA 3BG7A 3QP5A 5FLMJ 4WXDA 2QVOA 2PMUA 1ZYRF 4XIDA 1FLIA 5DD8A 3MAJA 2G7HA 2DK8A 2F5CA 1OYYA 3DCFA 2VJ4A 3WTTC 4EM0B 1PUEE 3AG4H 2HVSA 1VQ6I 3JTGA 3LWFA 4PCQA 3E0JB 4XKWA 2XAUA 3LAJA 3OYNA 2DA5A 3QP6A 2P7CB 2Q1ZB 4PSXA 2JUGA 3OY9A 3IRRA 1T8IA 3HIFA 5HLTA 3I0TA 1OISA 3A0HC 1R1VA 5GTIC 4MQVA 2CQNA 5M5YJ 2JN6A 2OJED 1WKMA 3MN2A 1OCCH 4QPQA 3J7AO 1MIJA 1T95A 2ETHA 1WJDA 5L3CA 3S1MJ 1DP3A 3HOTA 1S6LA 3CCVI 2FNPA 2NYXA 3D5LA 1QHHD 1SVMA 2DBBA 4IHWA 1TWAJ 3LSPA 2XDVA 3H36A 4E6KG 3P7NA 2P81A 3OYAA 1K61A 2DXIA 1IN7A 3I4MJ 2Y31A 1HQCA 2HEOA 2HS5A 4O5VA 4EVIA 2IS2A 1HW2A 2DT7B 4UUTA 4CA0A 2AXLA 1F1ZA 3ZCOA 1PDNC 4EJOA 4KUMA 3H3ZA 1QQIA 1TL8A 5KAFC 5KVRA 2ID6A 3LQQA 2ICWG 4B44A 4BACA 1YRNA 3GLLA 4M74A 3TDUC 3HGYA 4Y7NJ 2R7QA 2MW8A 4MO7A 4AIHA 4UVAA 3FK7A 2GZWA 1QZEA 5IOYA 1IG7A 1A35A 2JSPA 1VQ7I 1BI0A 3FISA 3ZMSA 5IYBJ 3VYRB 1LVKA 2RNGA 3WU1B 2DW4A 4FHTA 4BYYA 3Q0WA 3GTJJ 1XDSA 1G6NA 1SFKA 4CYDA 2CS3A 5E79C 4DNCA 5J47A 3D1NI 2WWYA 4EATA 2JZYA 5B1BH 2XV4S 1KU7A 3ERED 3K2ZA 2HVRA 2R7VA 3S32A 3S93A 4XLCA 2DJIA 1KONA 5ILSA 2H1KA 1H9TA 3L2RA 2LOOA 1EJ9A 4BQNA 2VT3A 1E2XA 2GQQA 2R92J 4EJWA 3S3MA 1R9TJ 4ZYHA 4QIWN 4DYCA 1JGGA 4A93J 1HKQA 2DDBA 4HX4A 2DLLA 2VL8A 3MKZA 3C18A 2I8DA 1P4AA 2WC2A 2ACJA 1LVAA 5IY5H 2ADUA 1W0UA 4Q47A 4CO8A 1Q1VA 2GXGA 2HOEA 1SEUA 2UXXA 3CESA 1ZLJA 2MD5A 3KP7A 1U8RA 1U3EM 4WXCA 4ZYDA 1JKRC 3ELKA 2MD0A 4OOIA 2FOKA 5CVIA 3H1CA 3KYDB 4JBAA 2DMQA 2KIFA 4DGWB 3BQZA 2BHZA 4QPOA 2HTSA 2QLZA 2WV0A 2EV5A 2XRLA 3Q0UA 4PZJA 4BQAA 4NQWA 2O03A 3AG3H 5J8FA 1VQMI 5L3DA 1ZN2A 4ZC3A 5LHIA 4Q4ZF 1ENHA 2R7ZJ 1WJEA 2DFIA 3BCAA 4G6DA 4EV0A 1G2HA 3A01A 4I99C 2Z16A 5J1UA 2P5LC 3ZOBA 3M07A 1M1EB 3GXOA 4EQQA 1OCTC 3FBNB 3OV8A 4G7OF 2L3DA 1BW5A 3K70D 2L9RA 5GAEJ 4E7IA 2F4MB 2VE8A 3L2QA 4HNTA 1YJWI 4UV8A 3MFKA 3RYPA 1YOVB 4ETSA 1ZRCA 5FKMA 3FMRA 4LG3A 3MKYB 3GZNB 1ON2A 4RAGA 3CCQI 5C4JJ 5EG0A 3HKZA 3K1PA 3KEYA 2MFZA 3KFWX 2Q8KA 3U21A 2W25A 4BEHB 5FD6A 4IO9F 2X9DA 1GT0C 2IVMA 4BXFA 1F36A 5JHFA 2QSGX 3CD6I 1CF7B 2CMPA 5J4YA 3DU5A 3FXUA 1QPMA 1IXCA 1XMKA 2BY0A 3FHNA 1L0OC 3OR1C 5ILUA 2M9HA 1YW9A 3BTLA 2FJ1A 2F5VA 4U7DA 3CO6C 1NK2P 3ABTA 2QCOA 3K4BA 4KT6A 4MTEA 3K70C 4BE1A 2LD5A 2IGKA 3BWGA 2W4SA 2JPBA 5D5WB 4N4NB 1I6HJ 1UHMA 2O9LA 2CWEA 1QHGA 2DCEA 4I01A 2VIXA 1DP7P 5FFXA 1HW1A 4XLNF 3KP5A 1MMAA 4XL9A 4N9IA 2K4BA 4IHVA 3F8BA 4PUSA 1QZZA 2YPRA 5KHDA 2XROA 2OBPA 3FXOA 3F8MA 1MD0A 2EZHA 1ZG5A 3GWZA 3RQ4A 5DCMA 2YX4A 3GUDA 3DWLE 1DQUA 4OAZA 2O7OA 4ENNA 1EF4A 4LIUA 3ECOA 3EDPA 5HLHA 4GRIA 2XAJA 2MBFA 2LK2A 2R7FA 4C3IJ 3I53A 1Z77A 3WTWC 5L3EA 1P92A 3OYEA 5LGTA 3M8FA 4PJ0C 5ILVA 4MGRA 3M4OJ 2VBZA 4AYBA 3OL4A 3I4PA 2XAFA 2DTRA 3KE2A 3KYCB 4OIRF 1ZR2A 2FBKA 1XD7A 2JPCA 1OPCA 2LNBA 3QOEA 5EZHA 2R5YA 1VQLI 4ENKA 2XAQA 3ZXSA 1X2MA 4L0YB 4HF1A 3F8NA 2HKOA 3PJRA 3FMSA 2ZXHA 5J1RA 2M1BA 4JX5A 3ZMZA 1MBKA 3LSTA 2V26A 1XGOA 3ERMA 2LH9A 4AIDA 1HKSA 4FT8A 2Y9ZA 4BE2A 2HI3A 1JHFA 2LKXA 1Z7LA 3MKLA 4UVCA 3N4MA 2KRCA 3FM5A 1AHDP 2BGCA 4KICA 4D5CA 4IHYA 2F4IA 3M8EA 2G0EA 1QPIA 2KZVA 3IP4B 2ZCWA 4M9ZA 3NAUA 3IAS2 4LD5A 2R7WA 5JLXA 1SMTA 3LMMA 1V55H 3F23A 4L5JA 2XRNA 2OD5A 2Y48A 1Y1WJ 1A31A 1MJBA 2CFXA 1BJZA 3RYRA 4CYCA 2X6OA 4YELA 4BDZA 5JFRA 1H9GA 2VXDA 5ICGA 3Q5FA 2E5NA 3ONQA 5E3MA 2ZC2A 3E1SA 2FU4A 1IZ1A 1IN6A 2Y0MA 3S1NJ 2JT1A 1FY7A 1KQ0A 3OIQA 5CJ9A 1PVEA 4BNCA 3GLXA 3JRHA 3GTMJ 3UR3C 2PJPA 2O5RA 2X51A 1EKEA 1RNLA 4KIFA 5FO5A 4WK8F 2HTJA 3KYLA 4IJAA 5JHUA 1IF1A 1XSXA 1ERDA 2IGOA 1ZG1A 1U0JA 4F93B 2VJIA 2DPDA 1T2KA 4OIPF 4B8XA 3DTEA 1YRNB 5GP9A 1MKMA 3OYMA 1SC7A 4KNYA 2QGUA 4ZJZA 3WTXC 1BI1A 1TLHB 3G2BA 1ZREA 1FOXA 3S3OA 4HF2A 2LBFA 2W84A 2BOLA 2ZMEC 2NVXJ 1X3UA 3BY6A 3I54A 2V7FA 3JRGA 4XN0A 3DKXA 1W1WE 1ZARA 1IAWA 1X1BA 2VQCA 4UXNA 4U87A 4A3EJ 1HA8A 2DO7A 3U9GA 5HLGA 1ZGAA 5B5EC 4B47A 2KLOA 2KL4A 3MQ0A 4GYIA 3ZQ7A 2HOTA 3GTQJ 2FOWA 5FROA 5D5UB 5GTHC 2HNHA 2NVYJ 4NDLA 4A3GJ 2M0MA 3LSKA 2M8GX 2H94A 1O7LA 2CJJA 5DV5A 5FLVA 4IKFA 3DEEA 3K7AJ 1TW2A 2ZJPF 1BL0A 1BJAA 4EMSA 2VOOA 1WFXA 4ITVA 4RLQA 2VODA 4RB0A 5HDNA 1UHWA 2CQXA 2R5ZA 3HJEA 1YHQI 4C30A 4HLYA 3TO7A 2VOPA 4G6QA 1WGXA 2E7XA 5JI6A 1Y0NA 4A3JJ 1BN5A 2VUMJ 1O57A 2QQ8A 2HOAA 3J80Z 2IS4A 3PUBA 2R7UA 2W1OA 3B6AA 4UB8C 1YQAA 1FYLA 2W57A 4XICA 1TNSA 5HLIA 3D5SC 4BKXA 3G73A 1UFMA 1GLNA 4NQWB 1GUUA 1XMXA 3GZ5A 1A04A 4EJVA 3FXRA 1WRJA 1XTAA 2BE5F 2VI6A 3T1BA 4CCOA 2OTLI 3R0JA 2BHYA 1W36C 4A3BJ 2A68F 4QWQA 3A01B 1B72B 1IC8A 5FKKA 2X6WA 3V7SA 2E2IJ 3ML6A 3WE2A 3OWTA 5LGNA 4IZZA 1MBHA 2OZUA 2UUZA 2R3SA 5E8IA 3NARA 3OYGA 1FSEA 2OUMA 3A0BC 3QPLA 4FASD 4KYWA 2MG4A 5DDGA 1Z7UA 2CFOA 3H35A 4EGYA 4IQJA 1S5LC 2K86A 5IOZA 4XKBA 5EG0B 1R36A 1J5YA 1O3QA 3BLYA 1IRXA 4X0GA 1XMAA 2DQLA 3FM3A 5CYVA 2ZXJA 3VYSB 2E60A 4Y33A 1WJFA 3GTKJ 1BIBA 4NC6A 1ZAOA 5EZGA 4HW0A 2XGCA 2OTJI 3G4SI 3GW2A 1U5TC 1YIJI 1FNNA 1VQ9I 2CH0A 1SD6A 2L7KA 3PUFA 5J8CA 3QYEA 1I5ZA 1BR1A 2JTVA 5LHGA 1WVRA 3CUOA 2W48A 2Z5UA 5F0CA 3QODA 2X1DA 3U1DA 2LFBA 2V6CA 3LFKA 4GXOA 4E7HA 3HBLA 2L2OA 1LEAA 2JK3A 2GLOA 3DTKA 3JRBA 3IKVA 4E4HA 2L54A 1ETVA 3CF5F 4FX0A 4S05A 1TW3A 3O8HA 1J75A 1A6IA 3IKTA 4A3MJ 4PGHA 4NC7A 2CQ7A 2EZLA 1OR7A 1WPKA 3IL2A 4PK4A 2RKHA 3J80K 5J40A 2HXIA 4AC0A 1TP4A 2R4GA 3WHCA 4M6XA 5K7HA 3GTLJ 1G3YA 2BXZA 3EPZA 5H2FC 1P7JA 1X3ZB 1BR2A 4JX4A 3FKIJ 1Z3YA 4A69C 4OAYA 1IN5A 2IGMA 2LC2A 1X4OA 3PNTA 4C2UA 3X2QH 3ZQFA 3HOSA 4F55A 4I09A 2ZMEB 3N05A 3J81Z 3QPSA 1YJ9I 2DU9A 2VBXA 3SEQA 1CQTA 2DJNA 2R7XA 2L7FP 1WSUA 5LLQA 3WTUC 3DLLF 3LSGA 3IH4A 2STTA 2L7MP 4IPAA 3K1NA 3BQYA 2QEXI 2R5YB 1IGNA 2K85A 4LB6B 3PNVA 2FXAA 2A05A 2KISA 4B4CA 3H5NA 1YW7A 2E2JJ 4HDUA 1ZGJA 3HB9A 1U2WA 1XG1A 1D5VA 4N4OB 3IRQA 4G6TB 5D8KB 2I5UA 1J0RA 2ZNYA 3TQNA 1IRGA 1R58A 3T8TA 2VE9A 3BTIA 1NG7A 1CGPA 3ZMTA 2QA4I 2DOAA 2M5WA 3C1DA 3COAC 1IXSB 1AWCA 2COMA 4PSWA 1N77A 3JRFA 4M3FA 2PBIA 4ZDOA 1KQ8A 5IPAA 1Q1HA 3JAMZ 1MBEA 1OCPA 3F3XA 3WG9A 1N78A 5D4SA 4KFCA 5LEKA 2VKDA 2ECBA 2VKEA 3DEUA 1JGSA 3DPUA 3K2AA 2L9NA 3E97A 3LA3A 4AUXA 3SJMA 3JTHA 4ZTJA 2YU3A 2ZJQF 1K83J 5K7FA 2COBA 4CYCB 2FBIA 3ZRGA 3Q9SA 4A0ZA 2A6TA 1RETA 5D5XB 3PFIA 4EJUA 1YI2I 1YS6A 5M5WJ 3DFGA 4XBFA 2JSCA 2Y0SA 3OR2C 1ETKA 3KEQA 4I98B 1S72I 1F43A 2KJCA 4HV6A 3EUKL 2I10A 2BW3B 1MZBA 2RN7A 3I58A 3OS1A 1LEBA 5LGUA 1WJAA 2HYJA 3DKYA 3S2WA 5IT3A 2YS9A 2ZSHB 2XASA 4ZDLA 2V4JC 2Y30A 2KKOA 3TOBA 2O6GE 3OYHA 1R23A 3RKWA 4HNVA 1N25A 3J81K 1QVUA 2EB7A 1ZTRA 1O3TA 1MMGA 1DU0A 4RGRA 3ZP5A 2HOSA 4M72A 1D1CA 4PJJA 3QU6A 3G3ZA 1X1AA 2FQ4A 4KJZA 4PJLA 3CJQB 4MNUA 4BU2A 2IA2A 3C2BA 2FA5A 2MLKA 3CJTB 4DQ2A 4OWRB 3HUGA 2X4HA 1IN4A 1U5TB 4KIBA 4B3XA 4ANJA 1T38A 4XLFA 2QM3A 3H5AA 3WU0A 3FF5A 4GO1A 1PUFA 1PJRA 1UJ8A 3HC7A 2EJRA 3IUOA 1BOBA 3K4NA 2A5YB 3TDZC 2E34A 2X1CA 5E8GA 4BHCA 4JQFA 4I2OA 1BC8C 3VB2A 2XHKA 3QPHA 2ELKA 2KIMA 1V5GA 1B8IA 1BM9A 1T0FC 3MVPA 2XF7A 3I56I 1A5JA 3E6CC 1SD4A 1HSTA 2UXNA 5E20A 3S15J 4B3AA 3JAMK 2B9SA 5B66C 1RR7A 1TNTA 4RGUA 4M9XA 1U9OA 1MNDA 3VODA 1SVOA 1RRJA 4F92B 4HF0A 1VZ0A 4KISA 1MNEA 2MC3A 2JRTA 3DBHB 3QQAA 3MMYB 5LBQA 2E1NA 3OYLA 3A1YA 4G7ZF 4Z6YA 4XSZF 4A3FJ 5LHHA 2E35A 1RIOH 4KMUX 2DODA 1T39A 2CO5A 2R7OA 3SZPA 3KP2A 2RQPA 5FB2A 2QYOA 1TTYA 5F1RA 3LSMA 3UKGA 2L0KA 4CH7A 3WU2C 2K3FA 1GVJA 4DIQA 2XB5A 3BP8A 2CV2A 3GMEA 2Z1DA 4I0BA 3HSFA 2DOEA 1USSA 3BG5A 2MH9A 2FBHA 1ITYA 4RAYA 4HX8A 2QUFA 2HU9A 3RTRA 3CUQA 3KZZA 2MLGA 1JE8A 1MSFC 1W7PA 2W24A 3KEOA 5FD5A 2XAHA 1ZQ3P 2O8KA 2E1OA 3S1RJ 3JCUC 2OV7A 1ULYA 2DPUA 4ZYEA 3AG2H 3PSIA 1Y39A 4P55A 1UELB 3W2WA 3EUAA 2XAGA 4BH9A 3OYIA 1YX5A 2PX9A 5K5RA 1NK3P 1SMYF 1V5FA 3V4GA 3K0LA 2LP0A 2LMDA 2HZTA 4WF2A 1IXRC 5E3NA 1HCRA 5GAHJ 3FXKA 2DMUA 4MHGA 4XRFA 3OIPA 1MH4A 3WGHA 5A2QZ 2KMUA 2J5PA 2PEXA 3ISPA 2STWA 4FISA 4RGSA 2CRGA 1QBJA 3F21A 2EZIA 2NVQJ 9ANTA 3DU6A 3PNYA 5D5VB 1DGWY 1QZYA 2EK5A 3ABLH 2PMZN 5E1WA 3JSPA 1BI3A 1Z3XA 5KCMA 1K4SA 2DYRH 4CCNA 2VBYA 5EDNA 4L9NA 2LY2A 4CCKA 3CDIA 3SFIA 2MSYA 3D5RC 3ZMDA 1GVDA 4A3LJ 1IV6A 2XF5A 2HQAA 4AIKA 3MWMA 2K9QA 1WJBA 4RGXA 2DA2A 1R5ID 3JW4A 3QYBA 1MDMA 1NTCA 3BR1A 3TL4X 1KU2A 5GAGJ 3CC7I 5IYDJ 1YLFA 4CHUA 3CLQA 3DV8A 2HWVA 1MH3A 3R6SA 2M0CA 2JJ7A 1T98A 5DUKA 1J09A 3TO6A 3W3CA 2VASA 1XB4A 3DPTA 3CCYA 1FBSA 1Z21A 5C4XJ 3ABKH 1OCOH 4BJTA 4ON0A 3I71A 2Y69H 4BHBA 4PDKA 2H8RA 1STZA 1E3OC 4M6YA 3JRDA 4HAMA 3HOUJ 3MZYA 1G3WA 1AU7A 3CMMA 4FE4A 1Z67A 2D1HA 2K02A 1WCMJ 2CU7A 2W82A 4XN3A 1MBJA 1YJNI 4L9VA 5DM7F 1D3YA 1OYIA 1LB2A 2VN2A 1FBQA 4D9JA 3BR6A 1J2XA 2BZTA 2IXSA 4LK0F 2V1XA 2K9LA 3F6OA 5F27A 1KZHA 3IC7A 4XSXF 4U7BA 4XNFA 1OFCX 4XLEA 2A6HF 1VF9A 3F8FA 1O3SA 2NVUB 2M30A 4A5NA 2JA6J 3ZPLA 3WE3A 5A2QK 2LTPA 2WAFA 5F04A 1XSDA 2GWRA 3PO3J 1KA8A 4PJNA 3F8CA 1TBXA 3LSIA 4GYGA 2DFEA 3IH2A 2GIZA 4R8HA 4HX7A 2KT0A 4WCGA 3HDDA 5HNFA 1D8JA 2E71A 3T0YA 4GCVA 1B9MA 2Y9YA 1I50J 2B0LA 3ZGKA 2WB1A 2XC7A 5EF6A 4BJ6C 3OYFA 1ZKGA 4HZFA 4QSHA 4V2GA 1W5SA 1R71A 3TW6A 4OMYA 5LEJA 3L2VA 4D5FA 5HVQC 5IP7J 1J9IA 2V79A 2W85A 1VQ5I 5TRDA 2OU2A 2IS6A 2CV0A 5E3LA 1ETOA 2E7WA 4RS8A 1K78A 3E5QA 2CSOA 1VQOI 4RB3C 2XGEA 3GFMA 3WTVC 1LQ1A 3HEFA 5JR3A 4IHSA 2FE3A 4XQFA 2TCTA 5GPAA 4BUPA 2DA4A 2IP2A 2CG4A 3CCJI 1LDKB 4JX6A 1E0EA 3TOAA 2DFHA 2H27A 1OMIA 5E17F 4G8XA 4CUGA 1K6YA 4HDVA 2UZKA 1HXDA 4I0AA 2KDOA 1REPC 1LFPA 2XPUA 1E3PA 2ZNZA 3HTUA 2Y2ZA 2IW5A 3CP2A 2NOJB 4BE0A 2PN6A 1LJ9A 1H0MA 3EUHA 2XVCA 2ZO4A 2GA1A 2CQKA 3I9V2 1EH8A 2IJLA 3H92A 3C7JA 5J4VA 3HUGB 2M7AA 2HQNA 2VB6A 3OSFA 3HOZJ 2JA7J 4CCLA 1N75A 2GM4A 1OCRH 1RKWA 2M4KA 4F7ZA 2GAUA 1FMWA 4AWXB 1XDUA 4GFBA 3GBGA 4ENJA 3CCLI 3ZQCA 4A12A 1MSEC 4DZPA 4C9YA 1D1BA 4BAYA 4UUSA 1JKPC 2E1CA 2GOXB 1IJWC 4PGGA 4AD9A 1X1DA 1B8IB 1PYVA 5LRRA 5K1YA 4WWCA 2WAQN 3CF2A 4LLGF 3GFJA 3DBLB 2VPRA 2K5CA 4L5IA 1A6QA 4BS9A 4YEJA 2FRHA 2M7BA 1OLTA 5H20A 2FMYA 3IV5A 2BV6A 3BR3A 1JTXA 4BXXJ 1WH7A 4OU0A 4XRMA 1NHAA 5BS6A 2ELHA 4FX4A 3C2GA 2CQQA 2GOMA 1VI0A 2W00A 5IP9J 5FRMA 1DPUA 1E3HA 1IDZA 2OF7A 4B1RA 2ID3A 3AL0B 1QO0D 2VKHA 2DMNA 1AKHA 2LSOA 4II3A 4A0XA 2R93J 2HFHA 1KU3A 4RBOA 1EH7A 2AO9A 5HODA 1ZR4A 1FOKA 3I55I 5BPIA 2XGXA 3RJPA 3QOPA 3HKZN 3CTAA 3KCCA 1ETXA 3S8PA 2YU9J 2FNAA 3GO5A 5CVJA 5E18F 3ZN0A 3JREA 2BYVE 4E70A 1YW8A 4IRIA 1KQ9A 4G7HF 1GXQA 1SVLA 1R5HA 3TBIA 2G9WA 2AQEA 3BPVA 1TT0A 2ME0A 3CUQB 4MQ9F 3GYHX 2ZJRF 2ZJ2A 2F5FA 2WTEA 3MD2A 2P5KA 2H1LA 2OA4A 3K10A 4C3HJ 3GTOJ 3ABMH 1FT9A 3K4JA 3V7RA 2DTZA 3GF2A 1W7PB 3MZHA 3S16J 2VLAA 4IX7A 1JKOC 2HQ5A 2X6YA 4M73A 4UY8I 3FXLA 3M8JA 1ETYA 2Y75A 3J7YJ 4IOAF 3BG9A 1IO2A 2EQRA 2MYSA 3OOPA 2A6EF 2PG4A 3HL2A 4HSRA 4LMYA 1K79A 3BG3A 4J00A 2M2EA 3VWBA 4XR6A 4DYQA 3L2CA 2FEZA 4H0EA 3CJRB 5FFZA 4ESJA 3RIRA 5AIQA 2HYFA 5H6QA 1R49A 1FJLA 3QRFF 4NB5A 2P6TA 4RB2C 1TQPA 2VQLA 1D0ZA 2LY9A 3M1CA 4E7JA 4NC8A 1MJ9A 1TQIA 2N8GA 3L00A 2L4AA 4IEJA 2EINH 3R60A 4TV7A 3NWSA 3OIOA 3SQNA 1IW7F 5L3BA 3BC8A 1JTYA 4BHPA 1Z6RA 2LKPA 3AAFA 1V5EA 5M3FJ 1FPQA 2JA5J 1MBFA 5JLWA 1VTNC 4AYBN 4MTDA 3HM5A 3K4CA 1MMDA 4HRIA 2A3SA 2ZXIA 3HPGA 1FMVA 2XGDA 3K9TA 2TDXA 1MDMB 2EFOA 4E7LA 3CP8A 2GBYA 2EFNA 3M3YJ 3KPHA 3WG7H 1Z1DA 4ASNA 4LG0A 3ZQLA 1R22A 2BY2A 1I3AA 4FETA 4CZCA 1IUYA 2ZXWH 1ODDA 3BDDA 5HNHA 1FZPB 1PP8F 1GV5A 1LNWA 3Q9VA 2O8XA 1HDPA 2XKOA 2OPTA 3RDIA 3BZCA 4IRHA 1JKQC 1FEXA 3W6JB 2DMPA 2DT6A 2OAZA 2JMWA 2YUSA 1SFXA 3FIWA 1VQ4I 2XPWA 1FP1D 2L7ZA 3CZ6A 3H9JA 2X1EA 1JUSA 1TWFJ 4AU7A 2PJRA 2B63J 3P5JA 2A69F 2V9PA 2NXNB 4BGDA 2ZFUA 4YIRX 1FP2A 2VONA 2VJJA 2X0LA 4XKVA 4G12A 5ICCA 2M45A 3E5UA 1W0TA 2IGNA 4KT5C 3HGGA 1EV7A 3ZMVA 5HS8A 3DKWA 2R0QC 3HSEA 3GFLA 3S2DJ 3G1LA 3HYIA 2HZDA 3PM1A 1RKTA 3SHFA 1O4XA 1T56A 4Y52J 4KN4X 1D1AA 1U8BA 4HOBA 3CCRI 4BL0B 1J59A 1UB9A 3BZKA 3QYFA 3P9KA 4RLFA 1X4PA 2EIKH 3CC2I 1S29A 1K6OA 2Z3YA 4Y3OA 4XOPA 5CVUA 3LQRA 3WTSC 5C44J 2L9VA 5DCMB 4LFUA 2HQRA 2VPLA 4OIQF 3B73A 4MEYF 4M3GA 4LLNA 1W5TA 3BOQA 3L9FA 2VQGA 3ZQHA 3Q3SA 3E7LA 4W1UA 3CDLA 1AA7A 2WA0A 1XGNA 4ZZDA 1LPQA 1K78B 1RZ4A 4HEA2 1X2NA 4XOTA 3SXYA 4II2A 3QPTA 5TJJA 4XK4A 4A2UA 5EGOA 2R7RA 2VXZA 1BI2A 2F5EA 2MABA 1R7JA 2O0YA 4GGGA 4WXHA 4R1HA 1BBYA 1S3JA 4MFDA 1MNMC 4MLOA 1WI9A 2BBYA 1XPXA 5EEHA 2LF8A 1JUPA 4DW6A 1GDTA 2JRMA 3AFHA 1WJCA 2JWTA 2M4GA 3VSKA 1JT6A 2KQRA 4BEHA 1Y6IA 2QENA 5E1ZB 3OYBA 1QA6A 4LJZF 1MMNA 1XX5A 3Q0VA 5BNGA 4LIVA 4HSTA 1YS7A 3IH3A 4E7ZA 4UV9A 2IAIA 5C3EJ 4UB6C 1CF7A 1FBUA 1POGA 2JVGA 5FKOA 4C2MJ 5AIPA 4HQEA 2CW0F 1VFCA 5FRNA 4AIJA 2DA7A 1TT5B 1DPRA 4RA2A 1LDDA 4WX9A 4XLHA 1UG0A 1JI8A 1LKXA 2O3FA 2P4WA 2LLKA 3RCOA 3O2PE 3ZN1A 5M5XJ 1JXSA 2ISYA 1R4NB 4EGZA 3OL3A 3LAPA 2PFBA 4UUSB 2KZGA 3P9IA 2ECCA 1SFOJ 1I6XA 3NEUA 4O6JA 4E7KA 4N9HA 5FKLA 4M3DA 4XORA 3T5XA 3LSRA 1D0YA 3J7ZI 1G59A 1DGRM 1YE9A 4M3BA 4CSWA 3BJAA 1Z0XA 2CUJA 2QKMB 3H9QA 5EYRA 3LA7A 2ME6A 1K4TA 2MH2A 4IXAA 2JUCA 3KZYA 1BA5A 1Y56A 3S14J 1UMQA 2FSWA 4X6AJ 1AKHB 3S3NA 3K69A 1KU9A 3HHHA 1XCVA 3GEZA 1OR7C 2O61A 4XLPF 4NUBA 2LVSA 3V42A 1WI3A 3FWEA 4XLAA 3W6KB 5IYCJ 3CCSI 2HPMA 5BQTA 4KMFA 2JA8J 2PLYA 3HSRA 3PFYA 3RKQA 2VBWA 4YIIA 4IVNA 5IP6A 4F91B 1EA3A 2KP6A 3EYIA 3BPXA 1WJ5A 3OS0A 3OOUA 2LBFB 4KIGA 4A3DJ 4AVZA 2NS8A 3SFZA 2CUEA 1ETQA 1FIPA 1JJ6C 5CKTA 4S0HB 1X1CA 3HOXJ 2GA2A 4HBLA 5F1JA 3RZOJ 1V54H 2RC4A 3WGGA 3BJ6A 5TGTA 2CGPA 4LGWA 4CGZA 1SAUA 4EJTA 2DAOA 4X1EA 4BJ5C 1HLVA 1MGTA 3C3WA 5H6RA 2A07F 2JQ7A 3R61A 2CYYA 2UWMA 3RQIA 4IF4A 2F5DA 5D6EA 2WADA 2E36A 1Z6TA 3BR5A 3VDXA 4L9TA 2R5ZB 1R1TA 2M8EA 3H3UA 4B48A 2DYSH 4J19A 1HW5A 3G71I 5DCFA 2IRFG 3SDBA 3BTCA 3FXJA 3OYDA 3A02A 2B7EA 1G4DA 4RDUA 4ZDPA 4HPQA 2Q2EA 4B09A 3CCEI 4IHXA 2BY3A 2IS1A 1ZGWA 2D5VA 2GXAA 2KHMA 2P0WA 1T6SA 1TC3C 5K7ZA 4P5OA 1PP7U 4V2FA 3B02A 5LD2C 1NH3A 4M9SA 3I4NJ 3CMEI 2RNJA 1H89C 1MMSA 2QQBA 3DF8A 2OQGA 5K5OA 3TKYA 1SFUA 1RPWA 1ORKA 5ED4A 4KDPA 2ZB9A 4UVBA 2KJBA 1YO5C 3KZIC 1ZELA 5FKNA 4LK1F 2RDPA 4XONA 1APLC 2ZBKA 5L3GA 2Z9OA 4LG0B 1NG6A 2HR3A 2WY7Q 2IBDA 2R7TA 2XB0X 3VPRA 2E1MC 2XF6A 2IA0A 3M1EA 3SDGA 3KP6A 1FYMA 2PMHA 4ZZLA 2IPQX 4DJAA 1IV8A 1YX3A 3OSGA 3LA2A 5B1AH 1X58A 1JHHA 2LYCA 2OC6A 2LR8A 1P4WA 2QBYA 4K2EA 2EA4A 2K9SA 1RI7A 3A2KA 1XGMA 2K3PA 4Y17A 2E5ZA 2H8WA 2PJRB 3MZ8A 2WBMA 4D1QA 4IOCF 3HOYJ 3SYTA 2NRAC 4XMYA 1YITI 2FMLA 3CDHA 2LRDA 2CUFA 3PQJA 1ZH5A 5KK1A 1YYVA 1Y8QB 2BXYA 4OMZA 3HOWJ 3W2AA 2P8TA 2IEKA 1Z9CA 2GXBA 3QAHA 2ESNA 4I7HA 3DXJF 2YR2A 3ECHA 3PQKA 3ROUA 1FTTA 1OJLA 2Y0SN 3OYCA 2CV1A 1QGPA 5HDKA 1RR8C 1FIAA 1BIAA 4A0YA 5CQGA 4F52A 3BROA 4IQ4A 3A4CA 4NHJA 1B6AA 2LDUA 2NAZA 2QSHX 1W7PD 3JRIA 4IHTA 3RI4A 3G6EI 2JA2A 3K6GA 1MJAA 1RESA 1LFBA 2QQ9A 2MA3A 3AL0C 2WAQA 1O3RA 1WZ2A 3RKXA 3CMAI 4YFKF 4JP0A 1MW7A 2KIUA 2L01A 2L02A 4A3CJ 5DM6F 2JVHA 3UNGC 2M87A 2ESHA 1IDYA 4CCJA 1D5YA 4UNOA 2LKSA 1B72A 5EGOB 3GX4X 3QWLA 1VNDA 2LF7A 1BOAA 4BY1J 3ASOH 3PO2J 4E7SA 2DFFA 2K40A 4CXFA 1BC7C 2BEOA 4Q48A 2FF4A 3H0GJ 5CQEA 5F6FA 1GXPA 1RC9A 4MFEA 3O8GA 1FOWA 3CUQC 2YSRA 2QSFX 1FC3A 1Y0UA 3WTYC 3VYUB 1F4KA 1TQMA 5F0FA 3PL8A 3IWZA 3I59A 3V8LA 3ABUA 1X1PA 2V1NA 2NOGA 5ERIA 1G3SA 1C0WA 2P5VA 2Q0OA 1TWGJ 2QKLB 5F0HA 2CW7A 2LREA 1U6GA 5JVTA 4YFXF 3F0CA 2OCEA 4W97A 3HHGA 4KN7X 1B9NA 2K9NA 4CICA 1ZHFA 2HYGD 2P7VB 4EM2A 3L7WA 1KYZA 3HPHA 3VSLA 1GHCA 2H6CA 4ZH4F 1VQ8I 1SANA 1S7EA 2VC1A 4P1WA 1H8AC 5FJ8J 3B6CA 4RM2A 1WHUA 1B4AA 2W7NA 1JUMA 1W4MA 1LE8A 3U2RA 2RAEA 4YG2F 1B1BA 3SZGA 3LSJA 1XCBA 2Z2SB 1VQNI 3D0SA 3KLOA 1KGSA 3SEZA 4AVPA 2DN0A 1TWCJ 3HRUA 2HKXA 3LFUA 5J6XA 3TO9A 1ZLKA 1FWZA 1R00A 5HDGA 5GADJ 4Z2YA 5EEGA 4BDYA 1V4RA 5BPDA 4RM3A 4UUVA 1X3WB 2V9KA 2WY8Q 2DDAA 3NRVA 3O6BB 3KLNA 2HDCA 1I1SA 2EIJH 1SD5A 2DA6A 3J7AY 1H88C 2E1MB 4MEXF 1S9HA 1FOYA 2ZMEA 3ZR8X 5M3MJ 4DBRA 1XC5A 1G8XA 5FLXZ 3PIPF 2GIVA 2KRFA 1MBGA 3LSHA 1XGSA 5E1XA 2DOFA 2D45A 4FE7A 1E17A 5DD4A 2PQ8A 4G94A 2VC0A 4BBSJ 1D0XA 3BCBA 3CCMI 5EEAA 3DQVC 3T8RA 1FYKA 1HOMA 1X19A 5EJCA 3G1OA 1PUFB 2DMTA 2BY1A 4A6DA 1DU6A 3BR0A 3DBRB 3FBIB 1UG2A 3H3VK 2XPVA 1RUNA 1HC8A 1GV2A 2V9VA 3ZQGA 3S17J 4LITA 3CC4I 3A03A 5L3FA 5F64A 4EEFG 1QVTA 2HXOA 1HBXG 4YIFA 5KAIC 1YIOA 4CDGA 3N97A 3MCZA 2RV8A 3RSNA 4D0PA 4EM1A 3FDYA
chains in the Genus database with same CATH topology
5IY5H 2EILH 3AG4H 2Y69H 5B1BH 1OCZH 2EIKH 2EIJH 2OCCH 2ZXWH 1V55H 3ASOH 3AG2H 3ABMH 3X2QH 5B3SH 3ABLH 3AG1H 1V54H 1OCCH 2EIMH 2DYRH 1OCRH 2DYSH 5B1AH 3WG7H 2EINH 3ASNH 3AG3H 3ABKH 1OCOH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IY5 H;  2EIL H;  3AG4 H;  2Y69 H;  5B1B H;  1OCZ H;  2EIK H;  2EIJ H;  2OCC H;  2ZXW H;  1V55 H;  3ASO H;  3AG2 H;  3ABM H;  3X2Q H;  5B3S H;  3ABL H;  3AG1 H;  1V54 H;  1OCC H;  2EIM H;  2DYR H;  1OCR H;  2DYS H;  5B1A H;  3WG7 H;  2EIN H;  3ASN H;  3AG3 H;  3ABK H;  1OCO H; 
#chains in the Genus database with same CATH topology
 1ON1 A;  2OQR A;  3CQZ J;  5HS7 A;  2M34 A;  3EYY A;  5GPC A;  1O7F A;  1WQ2 A;  1Z05 A;  5K5Q A;  2X85 A;  1JJ8 C;  2P6S A;  3PSF A;  2F2E A;  4L5E A;  4PFO A;  5D8L B;  4BBR J;  3GZ6 A;  2AS5 F;  4ZYA A;  3VEP A;  2XIG A;  4HG2 A;  3GVA A;  5CLS A;  2HGC A;  3BG6 A;  3I5U A;  1SD7 A;  1P9Q C;  3BJO A;  2Q2E B;  4FTH A;  3H5R A;  2EPF A;  2XSJ C;  2Z99 A;  2J5O A;  3BZ6 A;  3E5X A;  4P96 A;  5B3S H;  4J01 A;  1W5C C;  1G3T A;  2F48 A;  3RPU A;  3O3K A;  3FXQ A;  3AKZ A;  3RZD J;  5LRS A;  4PJM A;  3RKY A;  4OIN F;  1HF0 A;  1ZG3 A;  2L5Q A;  4S04 A;  2EA2 A;  3H0D A;  3CLO A;  4V19 K;  2WAE A;  1XN7 A;  2BW3 A;  1T08 B;  1HSJ A;  2EV6 A;  4XRS A;  2M3A A;  1FTZ A;  1UCR A;  4I76 A;  2FD5 A;  2XKP A;  3BTJ A;  2KFD A;  5LFA A;  2PI0 A;  2L9S A;  3GTP J;  3HRT A;  1YG2 A;  5KNL A;  3R4K A;  2NS0 A;  1J7K A;  1P7I A;  3QU3 A;  3LOC A;  4ZYG A;  1LDJ A;  3TW7 A;  1FSH A;  5FLX K;  4L18 B;  3G1M A;  4ESB A;  4XRS G;  3W6V A;  4YRV A;  1IRF A;  4HNU A;  3L2U A;  1U5T A;  3ZMU A;  4NNJ A;  5ICE A;  2V1U A;  3GCM A;  1VQP I;  4QTR A;  1Z91 A;  5D4R A;  2AHQ A;  3I3L A;  3EUH C;  2QBY B;  3HZJ A;  4RMN A;  4FQG A;  2DQR A;  1DUX C;  1IRZ A;  2ELJ A;  2DT5 A;  4A6E A;  4R79 A;  3CMY A;  3SZT A;  2WB1 N;  2R7S A;  1P6R A;  4RAZ A;  3VOE A;  2YX7 A;  3ASN H;  4L9J A;  1R6R A;  3RPU D;  4M6V A;  1W36 D;  4BY7 J;  3FK6 A;  1BW6 A;  1XSV A;  2EH3 A;  3HRS A;  5CVV A;  2EZK A;  1HDD C;  4U88 A;  4A3I J;  1R4M B;  1LFU P;  1VQK I;  3I64 A;  4PFP A;  1Y1V J;  3E6D A;  2QF7 A;  1RUO A;  4LB5 A;  4N0B A;  3FHZ A;  2XUB A;  3WHB A;  4XM3 A;  5F08 A;  2BVM A;  3CO7 C;  2QZ8 A;  3K4K A;  2K4J A;  4ESF A;  2WV1 A;  2CW8 A;  4ABZ A;  4BQQ A;  1I3Q J;  2EIL H;  2K27 A;  1BR4 A;  1LUJ B;  5FGM A;  1UAA A;  3H9G A;  3IWF A;  3M7G A;  4JYK A;  2KPM A;  1S8N A;  1ZRF A;  3KIO A;  2AQF A;  2KDZ A;  6PAX A;  4ENM A;  3OYJ A;  2V1D A;  4KIT B;  2OZ6 A;  2VT2 A;  4M71 A;  3V8J A;  3L2W A;  4ZTF A;  3FZV A;  4O3M A;  1KYW A;  5DEQ A;  3TED A;  4KA4 A;  1ZK8 A;  5TIS C;  2XSD C;  3AG1 H;  2EFP A;  2KRH A;  2NS7 A;  5ICF A;  3OS2 A;  5CPR B;  5JVG F;  4AM3 A;  1ETW A;  3OMY A;  3EQL F;  2TRT A;  2H6B A;  4JK1 X;  2EFW A;  3TP3 A;  4A3K J;  4MIM A;  1TWH J;  2X6X A;  4FCY A;  1L3L A;  1ACI A;  2LG4 A;  3KP4 A;  3JRC A;  1QRY A;  5HS9 A;  2E19 A;  3I59 B;  2ZFW A;  3ULQ B;  2NVT J;  2FQ3 A;  5BMZ A;  3CCU I;  4H4K C;  4Q5S F;  2NNY A;  2EV0 A;  1IUF A;  3ZQQ A;  5DUI A;  1YTY A;  5J3L A;  2EFQ A;  3HOV J;  4B43 A;  3K1M A;  1T33 A;  2DK5 A;  4P9F A;  3TP0 A;  4C2T A;  4HV5 A;  1WWX A;  2DA3 A;  2FX0 A;  3FX3 A;  3L09 A;  2OCC H;  2ZKZ A;  3DTI A;  3V8K A;  2ISZ A;  4DYR A;  1I1G A;  5J1Y A;  1HKT A;  3DLA A;  3RPQ A;  3NQO A;  4HA8 A;  4DOZ A;  4U0V A;  5AON A;  1F9N A;  2HVQ A;  4CCM A;  2QQA A;  5DS9 A;  1LE8 B;  4BXU A;  4I6Z A;  1OQY A;  2V6E A;  2K9M A;  3F22 A;  2D2W A;  4I02 A;  5HOO A;  3MKW B;  3F72 A;  4JOM A;  3EET A;  2C6Y A;  4UHT A;  3F9K A;  4RB1 A;  1IN8 A;  4A5M A;  3F6V A;  3P9C A;  2AXT C;  3TMO A;  5IT9 Z;  3KX2 A;  1AOY A;  2HDD A;  2VKV A;  4D7N A;  2A5W A;  1I39 A;  2K7L A;  2D1V A;  4HQM A;  1OKR A;  3GTG J;  1UZC A;  1R1U A;  3JRA A;  2UV1 A;  2RQQ A;  2RGV A;  1ONV A;  3BT9 A;  3HRM A;  1SAX A;  1JT0 A;  4HYE A;  2MC4 A;  2BVL A;  3OYK A;  1FX7 A;  3HG9 A;  3TGN A;  1P4X A;  3WOD F;  1UST A;  3WTZ A;  4C3J J;  1I27 A;  3DP7 A;  3L1P A;  3DPL C;  3K4M A;  1EH6 A;  4DZJ A;  3E6M A;  3KP3 A;  3HXL A;  3FMQ A;  4IL6 C;  1OCZ H;  4YFN F;  5E3O A;  1S7A A;  4U0Y A;  4U0W A;  3VYT B;  4M3E A;  3LL7 A;  4P9U A;  2DA1 A;  2F4O B;  2VQH A;  3M9A A;  1T0F A;  2FUG 2;  2LY1 A;  3FXM A;  1DDN A;  2EWN A;  2RVC A;  2H09 A;  3R0A A;  3JR9 A;  1OYW A;  3K4L A;  2A61 A;  3ZQI A;  1S7O A;  2DI3 A;  2VJ5 A;  2IT0 A;  3MEX A;  4HLX A;  4OIO F;  3S2H J;  2IA1 A;  3V7C A;  1F5T A;  2QWW A;  1A36 A;  4G9Y A;  3JSO A;  1K7A A;  3FKJ A;  3BR2 A;  3S1Q J;  2KIQ A;  4Y13 A;  2R7D A;  5BOX A;  1R5G A;  4BQO A;  4QLC U;  1P2F A;  3HTS B;  2CUZ A;  2ZSI B;  3IHU A;  5CVR A;  3REO A;  3LNQ A;  4LOC A;  1V3F A;  1XS9 A;  2MGQ A;  1U9N A;  4IRG A;  4RAF A;  4CZZ A;  1Y8R B;  4NBQ A;  1ZRD A;  4GDF A;  5DYM A;  1TZL A;  1QNT A;  5DTD A;  2EBI A;  1QU3 A;  3NWT A;  3DEW A;  1SFE A;  2RRE A;  1WH5 A;  1U78 A;  3W2V A;  2X48 A;  2EIM H;  1YFH A;  2HPI A;  3ESW B;  3U1K A;  2HDW A;  2PMZ A;  3VFZ A;  1B59 A;  4XKC A;  1UHS A;  4Y15 A;  4DBQ A;  4L0Z B;  5IT9 K;  4D7M A;  2E2H J;  2F6C A;  3WGI A;  5D6F A;  3C2H A;  3KET A;  4Y4R A;  2NNN A;  4LLL A;  2G7U A;  3PIO F;  1D8K A;  2L4M A;  3CJN A;  3E3V A;  3GFI A;  3IAM 2;  3E6B A;  2Z33 A;  4F3Q A;  3BG7 A;  3QP5 A;  5FLM J;  4WXD A;  2QVO A;  2PMU A;  1ZYR F;  4XID A;  1FLI A;  5DD8 A;  3MAJ A;  2G7H A;  2DK8 A;  2F5C A;  1OYY A;  3DCF A;  2VJ4 A;  3WTT C;  4EM0 B;  1PUE E;  3AG4 H;  2HVS A;  1VQ6 I;  3JTG A;  3LWF A;  4PCQ A;  3E0J B;  4XKW A;  2XAU A;  3LAJ A;  3OYN A;  2DA5 A;  3QP6 A;  2P7C B;  2Q1Z B;  4PSX A;  2JUG A;  3OY9 A;  3IRR A;  1T8I A;  3HIF A;  5HLT A;  3I0T A;  1OIS A;  3A0H C;  1R1V A;  5GTI C;  4MQV A;  2CQN A;  5M5Y J;  2JN6 A;  2OJE D;  1WKM A;  3MN2 A;  1OCC H;  4QPQ A;  3J7A O;  1MIJ A;  1T95 A;  2ETH A;  1WJD A;  5L3C A;  3S1M J;  1DP3 A;  3HOT A;  1S6L A;  3CCV I;  2FNP A;  2NYX A;  3D5L A;  1QHH D;  1SVM A;  2DBB A;  4IHW A;  1TWA J;  3LSP A;  2XDV A;  3H36 A;  4E6K G;  3P7N A;  2P81 A;  3OYA A;  1K61 A;  2DXI A;  1IN7 A;  3I4M J;  2Y31 A;  1HQC A;  2HEO A;  2HS5 A;  4O5V A;  4EVI A;  2IS2 A;  1HW2 A;  2DT7 B;  4UUT A;  4CA0 A;  2AXL A;  1F1Z A;  3ZCO A;  1PDN C;  4EJO A;  4KUM A;  3H3Z A;  1QQI A;  1TL8 A;  5KAF C;  5KVR A;  2ID6 A;  3LQQ A;  2ICW G;  4B44 A;  4BAC A;  1YRN A;  3GLL A;  4M74 A;  3TDU C;  3HGY A;  4Y7N J;  2R7Q A;  2MW8 A;  4MO7 A;  4AIH A;  4UVA A;  3FK7 A;  2GZW A;  1QZE A;  5IOY A;  1IG7 A;  1A35 A;  2JSP A;  1VQ7 I;  1BI0 A;  3FIS A;  3ZMS A;  5IYB J;  3VYR B;  1LVK A;  2RNG A;  3WU1 B;  2DW4 A;  4FHT A;  4BYY A;  3Q0W A;  3GTJ J;  1XDS A;  1G6N A;  1SFK A;  4CYD A;  2CS3 A;  5E79 C;  4DNC A;  5J47 A;  3D1N I;  2WWY A;  4EAT A;  2JZY A;  5B1B H;  2XV4 S;  1KU7 A;  3ERE D;  3K2Z A;  2HVR A;  2R7V A;  3S32 A;  3S93 A;  4XLC A;  2DJI A;  1KON A;  5ILS A;  2H1K A;  1H9T A;  3L2R A;  2LOO A;  1EJ9 A;  4BQN A;  2VT3 A;  1E2X A;  2GQQ A;  2R92 J;  4EJW A;  3S3M A;  1R9T J;  4ZYH A;  4QIW N;  4DYC A;  1JGG A;  4A93 J;  1HKQ A;  2DDB A;  4HX4 A;  2DLL A;  2VL8 A;  3MKZ A;  3C18 A;  2I8D A;  1P4A A;  2WC2 A;  2ACJ A;  1LVA A;  5IY5 H;  2ADU A;  1W0U A;  4Q47 A;  4CO8 A;  1Q1V A;  2GXG A;  2HOE A;  1SEU A;  2UXX A;  3CES A;  1ZLJ A;  2MD5 A;  3KP7 A;  1U8R A;  1U3E M;  4WXC A;  4ZYD A;  1JKR C;  3ELK A;  2MD0 A;  4OOI A;  2FOK A;  5CVI A;  3H1C A;  3KYD B;  4JBA A;  2DMQ A;  2KIF A;  4DGW B;  3BQZ A;  2BHZ A;  4QPO A;  2HTS A;  2QLZ A;  2WV0 A;  2EV5 A;  2XRL A;  3Q0U A;  4PZJ A;  4BQA A;  4NQW A;  2O03 A;  3AG3 H;  5J8F A;  1VQM I;  5L3D A;  1ZN2 A;  4ZC3 A;  5LHI A;  4Q4Z F;  1ENH A;  2R7Z J;  1WJE A;  2DFI A;  3BCA A;  4G6D A;  4EV0 A;  1G2H A;  3A01 A;  4I99 C;  2Z16 A;  5J1U A;  2P5L C;  3ZOB A;  3M07 A;  1M1E B;  3GXO A;  4EQQ A;  1OCT C;  3FBN B;  3OV8 A;  4G7O F;  2L3D A;  1BW5 A;  3K70 D;  2L9R A;  5GAE J;  4E7I A;  2F4M B;  2VE8 A;  3L2Q A;  4HNT A;  1YJW I;  4UV8 A;  3MFK A;  3RYP A;  1YOV B;  4ETS A;  1ZRC A;  5FKM A;  3FMR A;  4LG3 A;  3MKY B;  3GZN B;  1ON2 A;  4RAG A;  3CCQ I;  5C4J J;  5EG0 A;  3HKZ A;  3K1P A;  3KEY A;  2MFZ A;  3KFW X;  2Q8K A;  3U21 A;  2W25 A;  4BEH B;  5FD6 A;  4IO9 F;  2X9D A;  1GT0 C;  2IVM A;  4BXF A;  1F36 A;  5JHF A;  2QSG X;  3CD6 I;  1CF7 B;  2CMP A;  5J4Y A;  3DU5 A;  3FXU A;  1QPM A;  1IXC A;  1XMK A;  2BY0 A;  3FHN A;  1L0O C;  3OR1 C;  5ILU A;  2M9H A;  1YW9 A;  3BTL A;  2FJ1 A;  2F5V A;  4U7D A;  3CO6 C;  1NK2 P;  3ABT A;  2QCO A;  3K4B A;  4KT6 A;  4MTE A;  3K70 C;  4BE1 A;  2LD5 A;  2IGK A;  3BWG A;  2W4S A;  2JPB A;  5D5W B;  4N4N B;  1I6H J;  1UHM A;  2O9L A;  2CWE A;  1QHG A;  2DCE A;  4I01 A;  2VIX A;  1DP7 P;  5FFX A;  1HW1 A;  4XLN F;  3KP5 A;  1MMA A;  4XL9 A;  4N9I A;  2K4B A;  4IHV A;  3F8B A;  4PUS A;  1QZZ A;  2YPR A;  5KHD A;  2XRO A;  2OBP A;  3FXO A;  3F8M A;  1MD0 A;  2EZH A;  1ZG5 A;  3GWZ A;  3RQ4 A;  5DCM A;  2YX4 A;  3GUD A;  3DWL E;  1DQU A;  4OAZ A;  2O7O A;  4ENN A;  1EF4 A;  4LIU A;  3ECO A;  3EDP A;  5HLH A;  4GRI A;  2XAJ A;  2MBF A;  2LK2 A;  2R7F A;  4C3I J;  3I53 A;  1Z77 A;  3WTW C;  5L3E A;  1P92 A;  3OYE A;  5LGT A;  3M8F A;  4PJ0 C;  5ILV A;  4MGR A;  3M4O J;  2VBZ A;  4AYB A;  3OL4 A;  3I4P A;  2XAF A;  2DTR A;  3KE2 A;  3KYC B;  4OIR F;  1ZR2 A;  2FBK A;  1XD7 A;  2JPC A;  1OPC A;  2LNB A;  3QOE A;  5EZH A;  2R5Y A;  1VQL I;  4ENK A;  2XAQ A;  3ZXS A;  1X2M A;  4L0Y B;  4HF1 A;  3F8N A;  2HKO A;  3PJR A;  3FMS A;  2ZXH A;  5J1R A;  2M1B A;  4JX5 A;  3ZMZ A;  1MBK A;  3LST A;  2V26 A;  1XGO A;  3ERM A;  2LH9 A;  4AID A;  1HKS A;  4FT8 A;  2Y9Z A;  4BE2 A;  2HI3 A;  1JHF A;  2LKX A;  1Z7L A;  3MKL A;  4UVC A;  3N4M A;  2KRC A;  3FM5 A;  1AHD P;  2BGC A;  4KIC A;  4D5C A;  4IHY A;  2F4I A;  3M8E A;  2G0E A;  1QPI A;  2KZV A;  3IP4 B;  2ZCW A;  4M9Z A;  3NAU A;  3IAS 2;  4LD5 A;  2R7W A;  5JLX A;  1SMT A;  3LMM A;  1V55 H;  3F23 A;  4L5J A;  2XRN A;  2OD5 A;  2Y48 A;  1Y1W J;  1A31 A;  1MJB A;  2CFX A;  1BJZ A;  3RYR A;  4CYC A;  2X6O A;  4YEL A;  4BDZ A;  5JFR A;  1H9G A;  2VXD A;  5ICG A;  3Q5F A;  2E5N A;  3ONQ A;  5E3M A;  2ZC2 A;  3E1S A;  2FU4 A;  1IZ1 A;  1IN6 A;  2Y0M A;  3S1N J;  2JT1 A;  1FY7 A;  1KQ0 A;  3OIQ A;  5CJ9 A;  1PVE A;  4BNC A;  3GLX A;  3JRH A;  3GTM J;  3UR3 C;  2PJP A;  2O5R A;  2X51 A;  1EKE A;  1RNL A;  4KIF A;  5FO5 A;  4WK8 F;  2HTJ A;  3KYL A;  4IJA A;  5JHU A;  1IF1 A;  1XSX A;  1ERD A;  2IGO A;  1ZG1 A;  1U0J A;  4F93 B;  2VJI A;  2DPD A;  1T2K A;  4OIP F;  4B8X A;  3DTE A;  1YRN B;  5GP9 A;  1MKM A;  3OYM A;  1SC7 A;  4KNY A;  2QGU A;  4ZJZ A;  3WTX C;  1BI1 A;  1TLH B;  3G2B A;  1ZRE A;  1FOX A;  3S3O A;  4HF2 A;  2LBF A;  2W84 A;  2BOL A;  2ZME C;  2NVX J;  1X3U A;  3BY6 A;  3I54 A;  2V7F A;  3JRG A;  4XN0 A;  3DKX A;  1W1W E;  1ZAR A;  1IAW A;  1X1B A;  2VQC A;  4UXN A;  4U87 A;  4A3E J;  1HA8 A;  2DO7 A;  3U9G A;  5HLG A;  1ZGA A;  5B5E C;  4B47 A;  2KLO A;  2KL4 A;  3MQ0 A;  4GYI A;  3ZQ7 A;  2HOT A;  3GTQ J;  2FOW A;  5FRO A;  5D5U B;  5GTH C;  2HNH A;  2NVY J;  4NDL A;  4A3G J;  2M0M A;  3LSK A;  2M8G X;  2H94 A;  1O7L A;  2CJJ A;  5DV5 A;  5FLV A;  4IKF A;  3DEE A;  3K7A J;  1TW2 A;  2ZJP F;  1BL0 A;  1BJA A;  4EMS A;  2VOO A;  1WFX A;  4ITV A;  4RLQ A;  2VOD A;  4RB0 A;  5HDN A;  1UHW A;  2CQX A;  2R5Z A;  3HJE A;  1YHQ I;  4C30 A;  4HLY A;  3TO7 A;  2VOP A;  4G6Q A;  1WGX A;  2E7X A;  5JI6 A;  1Y0N A;  4A3J J;  1BN5 A;  2VUM J;  1O57 A;  2QQ8 A;  2HOA A;  3J80 Z;  2IS4 A;  3PUB A;  2R7U A;  2W1O A;  3B6A A;  4UB8 C;  1YQA A;  1FYL A;  2W57 A;  4XIC A;  1TNS A;  5HLI A;  3D5S C;  4BKX A;  3G73 A;  1UFM A;  1GLN A;  4NQW B;  1GUU A;  1XMX A;  3GZ5 A;  1A04 A;  4EJV A;  3FXR A;  1WRJ A;  1XTA A;  2BE5 F;  2VI6 A;  3T1B A;  4CCO A;  2OTL I;  3R0J A;  2BHY A;  1W36 C;  4A3B J;  2A68 F;  4QWQ A;  3A01 B;  1B72 B;  1IC8 A;  5FKK A;  2X6W A;  3V7S A;  2E2I J;  3ML6 A;  3WE2 A;  3OWT A;  5LGN A;  4IZZ A;  1MBH A;  2OZU A;  2UUZ A;  2R3S A;  5E8I A;  3NAR A;  3OYG A;  1FSE A;  2OUM A;  3A0B C;  3QPL A;  4FAS D;  4KYW A;  2MG4 A;  5DDG A;  1Z7U A;  2CFO A;  3H35 A;  4EGY A;  4IQJ A;  1S5L C;  2K86 A;  5IOZ A;  4XKB A;  5EG0 B;  1R36 A;  1J5Y A;  1O3Q A;  3BLY A;  1IRX A;  4X0G A;  1XMA A;  2DQL A;  3FM3 A;  5CYV A;  2ZXJ A;  3VYS B;  2E60 A;  4Y33 A;  1WJF A;  3GTK J;  1BIB A;  4NC6 A;  1ZAO A;  5EZG A;  4HW0 A;  2XGC A;  2OTJ I;  3G4S I;  3GW2 A;  1U5T C;  1YIJ I;  1FNN A;  1VQ9 I;  2CH0 A;  1SD6 A;  2L7K A;  3PUF A;  5J8C A;  3QYE A;  1I5Z A;  1BR1 A;  2JTV A;  5LHG A;  1WVR A;  3CUO A;  2W48 A;  2Z5U A;  5F0C A;  3QOD A;  2X1D A;  3U1D A;  2LFB A;  2V6C A;  3LFK A;  4GXO A;  4E7H A;  3HBL A;  2L2O A;  1LEA A;  2JK3 A;  2GLO A;  3DTK A;  3JRB A;  3IKV A;  4E4H A;  2L54 A;  1ETV A;  3CF5 F;  4FX0 A;  4S05 A;  1TW3 A;  3O8H A;  1J75 A;  1A6I A;  3IKT A;  4A3M J;  4PGH A;  4NC7 A;  2CQ7 A;  2EZL A;  1OR7 A;  1WPK A;  3IL2 A;  4PK4 A;  2RKH A;  3J80 K;  5J40 A;  2HXI A;  4AC0 A;  1TP4 A;  2R4G A;  3WHC A;  4M6X A;  5K7H A;  3GTL J;  1G3Y A;  2BXZ A;  3EPZ A;  5H2F C;  1P7J A;  1X3Z B;  1BR2 A;  4JX4 A;  3FKI J;  1Z3Y A;  4A69 C;  4OAY A;  1IN5 A;  2IGM A;  2LC2 A;  1X4O A;  3PNT A;  4C2U A;  3X2Q H;  3ZQF A;  3HOS A;  4F55 A;  4I09 A;  2ZME B;  3N05 A;  3J81 Z;  3QPS A;  1YJ9 I;  2DU9 A;  2VBX A;  3SEQ A;  1CQT A;  2DJN A;  2R7X A;  2L7F P;  1WSU A;  5LLQ A;  3WTU C;  3DLL F;  3LSG A;  3IH4 A;  2STT A;  2L7M P;  4IPA A;  3K1N A;  3BQY A;  2QEX I;  2R5Y B;  1IGN A;  2K85 A;  4LB6 B;  3PNV A;  2FXA A;  2A05 A;  2KIS A;  4B4C A;  3H5N A;  1YW7 A;  2E2J J;  4HDU A;  1ZGJ A;  3HB9 A;  1U2W A;  1XG1 A;  1D5V A;  4N4O B;  3IRQ A;  4G6T B;  5D8K B;  2I5U A;  1J0R A;  2ZNY A;  3TQN A;  1IRG A;  1R58 A;  3T8T A;  2VE9 A;  3BTI A;  1NG7 A;  1CGP A;  3ZMT A;  2QA4 I;  2DOA A;  2M5W A;  3C1D A;  3COA C;  1IXS B;  1AWC A;  2COM A;  4PSW A;  1N77 A;  3JRF A;  4M3F A;  2PBI A;  4ZDO A;  1KQ8 A;  5IPA A;  1Q1H A;  3JAM Z;  1MBE A;  1OCP A;  3F3X A;  3WG9 A;  1N78 A;  5D4S A;  4KFC A;  5LEK A;  2VKD A;  2ECB A;  2VKE A;  3DEU A;  1JGS A;  3DPU A;  3K2A A;  2L9N A;  3E97 A;  3LA3 A;  4AUX A;  3SJM A;  3JTH A;  4ZTJ A;  2YU3 A;  2ZJQ F;  1K83 J;  5K7F A;  2COB A;  4CYC B;  2FBI A;  3ZRG A;  3Q9S A;  4A0Z A;  2A6T A;  1RET A;  5D5X B;  3PFI A;  4EJU A;  1YI2 I;  1YS6 A;  5M5W J;  3DFG A;  4XBF A;  2JSC A;  2Y0S A;  3OR2 C;  1ETK A;  3KEQ A;  4I98 B;  1S72 I;  1F43 A;  2KJC A;  4HV6 A;  3EUK L;  2I10 A;  2BW3 B;  1MZB A;  2RN7 A;  3I58 A;  3OS1 A;  1LEB A;  5LGU A;  1WJA A;  2HYJ A;  3DKY A;  3S2W A;  5IT3 A;  2YS9 A;  2ZSH B;  2XAS A;  4ZDL A;  2V4J C;  2Y30 A;  2KKO A;  3TOB A;  2O6G E;  3OYH A;  1R23 A;  3RKW A;  4HNV A;  1N25 A;  3J81 K;  1QVU A;  2EB7 A;  1ZTR A;  1O3T A;  1MMG A;  1DU0 A;  4RGR A;  3ZP5 A;  2HOS A;  4M72 A;  1D1C A;  4PJJ A;  3QU6 A;  3G3Z A;  1X1A A;  2FQ4 A;  4KJZ A;  4PJL A;  3CJQ B;  4MNU A;  4BU2 A;  2IA2 A;  3C2B A;  2FA5 A;  2MLK A;  3CJT B;  4DQ2 A;  4OWR B;  3HUG A;  2X4H A;  1IN4 A;  1U5T B;  4KIB A;  4B3X A;  4ANJ A;  1T38 A;  4XLF A;  2QM3 A;  3H5A A;  3WU0 A;  3FF5 A;  4GO1 A;  1PUF A;  1PJR A;  1UJ8 A;  3HC7 A;  2EJR A;  3IUO A;  1BOB A;  3K4N A;  2A5Y B;  3TDZ C;  2E34 A;  2X1C A;  5E8G A;  4BHC A;  4JQF A;  4I2O A;  1BC8 C;  3VB2 A;  2XHK A;  3QPH A;  2ELK A;  2KIM A;  1V5G A;  1B8I A;  1BM9 A;  1T0F C;  3MVP A;  2XF7 A;  3I56 I;  1A5J A;  3E6C C;  1SD4 A;  1HST A;  2UXN A;  5E20 A;  3S15 J;  4B3A A;  3JAM K;  2B9S A;  5B66 C;  1RR7 A;  1TNT A;  4RGU A;  4M9X A;  1U9O A;  1MND A;  3VOD A;  1SVO A;  1RRJ A;  4F92 B;  4HF0 A;  1VZ0 A;  4KIS A;  1MNE A;  2MC3 A;  2JRT A;  3DBH B;  3QQA A;  3MMY B;  5LBQ A;  2E1N A;  3OYL A;  3A1Y A;  4G7Z F;  4Z6Y A;  4XSZ F;  4A3F J;  5LHH A;  2E35 A;  1RIO H;  4KMU X;  2DOD A;  1T39 A;  2CO5 A;  2R7O A;  3SZP A;  3KP2 A;  2RQP A;  5FB2 A;  2QYO A;  1TTY A;  5F1R A;  3LSM A;  3UKG A;  2L0K A;  4CH7 A;  3WU2 C;  2K3F A;  1GVJ A;  4DIQ A;  2XB5 A;  3BP8 A;  2CV2 A;  3GME A;  2Z1D A;  4I0B A;  3HSF A;  2DOE A;  1USS A;  3BG5 A;  2MH9 A;  2FBH A;  1ITY A;  4RAY A;  4HX8 A;  2QUF A;  2HU9 A;  3RTR A;  3CUQ A;  3KZZ A;  2MLG A;  1JE8 A;  1MSF C;  1W7P A;  2W24 A;  3KEO A;  5FD5 A;  2XAH A;  1ZQ3 P;  2O8K A;  2E1O A;  3S1R J;  3JCU C;  2OV7 A;  1ULY A;  2DPU A;  4ZYE A;  3AG2 H;  3PSI A;  1Y39 A;  4P55 A;  1UEL B;  3W2W A;  3EUA A;  2XAG A;  4BH9 A;  3OYI A;  1YX5 A;  2PX9 A;  5K5R A;  1NK3 P;  1SMY F;  1V5F A;  3V4G A;  3K0L A;  2LP0 A;  2LMD A;  2HZT A;  4WF2 A;  1IXR C;  5E3N A;  1HCR A;  5GAH J;  3FXK A;  2DMU A;  4MHG A;  4XRF A;  3OIP A;  1MH4 A;  3WGH A;  5A2Q Z;  2KMU A;  2J5P A;  2PEX A;  3ISP A;  2STW A;  4FIS A;  4RGS A;  2CRG A;  1QBJ A;  3F21 A;  2EZI A;  2NVQ J;  9ANT A;  3DU6 A;  3PNY A;  5D5V B;  1DGW Y;  1QZY A;  2EK5 A;  3ABL H;  2PMZ N;  5E1W A;  3JSP A;  1BI3 A;  1Z3X A;  5KCM A;  1K4S A;  2DYR H;  4CCN A;  2VBY A;  5EDN A;  4L9N A;  2LY2 A;  4CCK A;  3CDI A;  3SFI A;  2MSY A;  3D5R C;  3ZMD A;  1GVD A;  4A3L J;  1IV6 A;  2XF5 A;  2HQA A;  4AIK A;  3MWM A;  2K9Q A;  1WJB A;  4RGX A;  2DA2 A;  1R5I D;  3JW4 A;  3QYB A;  1MDM A;  1NTC A;  3BR1 A;  3TL4 X;  1KU2 A;  5GAG J;  3CC7 I;  5IYD J;  1YLF A;  4CHU A;  3CLQ A;  3DV8 A;  2HWV A;  1MH3 A;  3R6S A;  2M0C A;  2JJ7 A;  1T98 A;  5DUK A;  1J09 A;  3TO6 A;  3W3C A;  2VAS A;  1XB4 A;  3DPT A;  3CCY A;  1FBS A;  1Z21 A;  5C4X J;  3ABK H;  1OCO H;  4BJT A;  4ON0 A;  3I71 A;  2Y69 H;  4BHB A;  4PDK A;  2H8R A;  1STZ A;  1E3O C;  4M6Y A;  3JRD A;  4HAM A;  3HOU J;  3MZY A;  1G3W A;  1AU7 A;  3CMM A;  4FE4 A;  1Z67 A;  2D1H A;  2K02 A;  1WCM J;  2CU7 A;  2W82 A;  4XN3 A;  1MBJ A;  1YJN I;  4L9V A;  5DM7 F;  1D3Y A;  1OYI A;  1LB2 A;  2VN2 A;  1FBQ A;  4D9J A;  3BR6 A;  1J2X A;  2BZT A;  2IXS A;  4LK0 F;  2V1X A;  2K9L A;  3F6O A;  5F27 A;  1KZH A;  3IC7 A;  4XSX F;  4U7B A;  4XNF A;  1OFC X;  4XLE A;  2A6H F;  1VF9 A;  3F8F A;  1O3S A;  2NVU B;  2M30 A;  4A5N A;  2JA6 J;  3ZPL A;  3WE3 A;  5A2Q K;  2LTP A;  2WAF A;  5F04 A;  1XSD A;  2GWR A;  3PO3 J;  1KA8 A;  4PJN A;  3F8C A;  1TBX A;  3LSI A;  4GYG A;  2DFE A;  3IH2 A;  2GIZ A;  4R8H A;  4HX7 A;  2KT0 A;  4WCG A;  3HDD A;  5HNF A;  1D8J A;  2E71 A;  3T0Y A;  4GCV A;  1B9M A;  2Y9Y A;  1I50 J;  2B0L A;  3ZGK A;  2WB1 A;  2XC7 A;  5EF6 A;  4BJ6 C;  3OYF A;  1ZKG A;  4HZF A;  4QSH A;  4V2G A;  1W5S A;  1R71 A;  3TW6 A;  4OMY A;  5LEJ A;  3L2V A;  4D5F A;  5HVQ C;  5IP7 J;  1J9I A;  2V79 A;  2W85 A;  1VQ5 I;  5TRD A;  2OU2 A;  2IS6 A;  2CV0 A;  5E3L A;  1ETO A;  2E7W A;  4RS8 A;  1K78 A;  3E5Q A;  2CSO A;  1VQO I;  4RB3 C;  2XGE A;  3GFM A;  3WTV C;  1LQ1 A;  3HEF A;  5JR3 A;  4IHS A;  2FE3 A;  4XQF A;  2TCT A;  5GPA A;  4BUP A;  2DA4 A;  2IP2 A;  2CG4 A;  3CCJ I;  1LDK B;  4JX6 A;  1E0E A;  3TOA A;  2DFH A;  2H27 A;  1OMI A;  5E17 F;  4G8X A;  4CUG A;  1K6Y A;  4HDV A;  2UZK A;  1HXD A;  4I0A A;  2KDO A;  1REP C;  1LFP A;  2XPU A;  1E3P A;  2ZNZ A;  3HTU A;  2Y2Z A;  2IW5 A;  3CP2 A;  2NOJ B;  4BE0 A;  2PN6 A;  1LJ9 A;  1H0M A;  3EUH A;  2XVC A;  2ZO4 A;  2GA1 A;  2CQK A;  3I9V 2;  1EH8 A;  2IJL A;  3H92 A;  3C7J A;  5J4V A;  3HUG B;  2M7A A;  2HQN A;  2VB6 A;  3OSF A;  3HOZ J;  2JA7 J;  4CCL A;  1N75 A;  2GM4 A;  1OCR H;  1RKW A;  2M4K A;  4F7Z A;  2GAU A;  1FMW A;  4AWX B;  1XDU A;  4GFB A;  3GBG A;  4ENJ A;  3CCL I;  3ZQC A;  4A12 A;  1MSE C;  4DZP A;  4C9Y A;  1D1B A;  4BAY A;  4UUS A;  1JKP C;  2E1C A;  2GOX B;  1IJW C;  4PGG A;  4AD9 A;  1X1D A;  1B8I B;  1PYV A;  5LRR A;  5K1Y A;  4WWC A;  2WAQ N;  3CF2 A;  4LLG F;  3GFJ A;  3DBL B;  2VPR A;  2K5C A;  4L5I A;  1A6Q A;  4BS9 A;  4YEJ A;  2FRH A;  2M7B A;  1OLT A;  5H20 A;  2FMY A;  3IV5 A;  2BV6 A;  3BR3 A;  1JTX A;  4BXX J;  1WH7 A;  4OU0 A;  4XRM A;  1NHA A;  5BS6 A;  2ELH A;  4FX4 A;  3C2G A;  2CQQ A;  2GOM A;  1VI0 A;  2W00 A;  5IP9 J;  5FRM A;  1DPU A;  1E3H A;  1IDZ A;  2OF7 A;  4B1R A;  2ID3 A;  3AL0 B;  1QO0 D;  2VKH A;  2DMN A;  1AKH A;  2LSO A;  4II3 A;  4A0X A;  2R93 J;  2HFH A;  1KU3 A;  4RBO A;  1EH7 A;  2AO9 A;  5HOD A;  1ZR4 A;  1FOK A;  3I55 I;  5BPI A;  2XGX A;  3RJP A;  3QOP A;  3HKZ N;  3CTA A;  3KCC A;  1ETX A;  3S8P A;  2YU9 J;  2FNA A;  3GO5 A;  5CVJ A;  5E18 F;  3ZN0 A;  3JRE A;  2BYV E;  4E70 A;  1YW8 A;  4IRI A;  1KQ9 A;  4G7H F;  1GXQ A;  1SVL A;  1R5H A;  3TBI A;  2G9W A;  2AQE A;  3BPV A;  1TT0 A;  2ME0 A;  3CUQ B;  4MQ9 F;  3GYH X;  2ZJR F;  2ZJ2 A;  2F5F A;  2WTE A;  3MD2 A;  2P5K A;  2H1L A;  2OA4 A;  3K10 A;  4C3H J;  3GTO J;  3ABM H;  1FT9 A;  3K4J A;  3V7R A;  2DTZ A;  3GF2 A;  1W7P B;  3MZH A;  3S16 J;  2VLA A;  4IX7 A;  1JKO C;  2HQ5 A;  2X6Y A;  4M73 A;  4UY8 I;  3FXL A;  3M8J A;  1ETY A;  2Y75 A;  3J7Y J;  4IOA F;  3BG9 A;  1IO2 A;  2EQR A;  2MYS A;  3OOP A;  2A6E F;  2PG4 A;  3HL2 A;  4HSR A;  4LMY A;  1K79 A;  3BG3 A;  4J00 A;  2M2E A;  3VWB A;  4XR6 A;  4DYQ A;  3L2C A;  2FEZ A;  4H0E A;  3CJR B;  5FFZ A;  4ESJ A;  3RIR A;  5AIQ A;  2HYF A;  5H6Q A;  1R49 A;  1FJL A;  3QRF F;  4NB5 A;  2P6T A;  4RB2 C;  1TQP A;  2VQL A;  1D0Z A;  2LY9 A;  3M1C A;  4E7J A;  4NC8 A;  1MJ9 A;  1TQI A;  2N8G A;  3L00 A;  2L4A A;  4IEJ A;  2EIN H;  3R60 A;  4TV7 A;  3NWS A;  3OIO A;  3SQN A;  1IW7 F;  5L3B A;  3BC8 A;  1JTY A;  4BHP A;  1Z6R A;  2LKP A;  3AAF A;  1V5E A;  5M3F J;  1FPQ A;  2JA5 J;  1MBF A;  5JLW A;  1VTN C;  4AYB N;  4MTD A;  3HM5 A;  3K4C A;  1MMD A;  4HRI A;  2A3S A;  2ZXI A;  3HPG A;  1FMV A;  2XGD A;  3K9T A;  2TDX A;  1MDM B;  2EFO A;  4E7L A;  3CP8 A;  2GBY A;  2EFN A;  3M3Y J;  3KPH A;  3WG7 H;  1Z1D A;  4ASN A;  4LG0 A;  3ZQL A;  1R22 A;  2BY2 A;  1I3A A;  4FET A;  4CZC A;  1IUY A;  2ZXW H;  1ODD A;  3BDD A;  5HNH A;  1FZP B;  1PP8 F;  1GV5 A;  1LNW A;  3Q9V A;  2O8X A;  1HDP A;  2XKO A;  2OPT A;  3RDI A;  3BZC A;  4IRH A;  1JKQ C;  1FEX A;  3W6J B;  2DMP A;  2DT6 A;  2OAZ A;  2JMW A;  2YUS A;  1SFX A;  3FIW A;  1VQ4 I;  2XPW A;  1FP1 D;  2L7Z A;  3CZ6 A;  3H9J A;  2X1E A;  1JUS A;  1TWF J;  4AU7 A;  2PJR A;  2B63 J;  3P5J A;  2A69 F;  2V9P A;  2NXN B;  4BGD A;  2ZFU A;  4YIR X;  1FP2 A;  2VON A;  2VJJ A;  2X0L A;  4XKV A;  4G12 A;  5ICC A;  2M45 A;  3E5U A;  1W0T A;  2IGN A;  4KT5 C;  3HGG A;  1EV7 A;  3ZMV A;  5HS8 A;  3DKW A;  2R0Q C;  3HSE A;  3GFL A;  3S2D J;  3G1L A;  3HYI A;  2HZD A;  3PM1 A;  1RKT A;  3SHF A;  1O4X A;  1T56 A;  4Y52 J;  4KN4 X;  1D1A A;  1U8B A;  4HOB A;  3CCR I;  4BL0 B;  1J59 A;  1UB9 A;  3BZK A;  3QYF A;  3P9K A;  4RLF A;  1X4P A;  2EIK H;  3CC2 I;  1S29 A;  1K6O A;  2Z3Y A;  4Y3O A;  4XOP A;  5CVU A;  3LQR A;  3WTS C;  5C44 J;  2L9V A;  5DCM B;  4LFU A;  2HQR A;  2VPL A;  4OIQ F;  3B73 A;  4MEY F;  4M3G A;  4LLN A;  1W5T A;  3BOQ A;  3L9F A;  2VQG A;  3ZQH A;  3Q3S A;  3E7L A;  4W1U A;  3CDL A;  1AA7 A;  2WA0 A;  1XGN A;  4ZZD A;  1LPQ A;  1K78 B;  1RZ4 A;  4HEA 2;  1X2N A;  4XOT A;  3SXY A;  4II2 A;  3QPT A;  5TJJ A;  4XK4 A;  4A2U A;  5EGO A;  2R7R A;  2VXZ A;  1BI2 A;  2F5E A;  2MAB A;  1R7J A;  2O0Y A;  4GGG A;  4WXH A;  4R1H A;  1BBY A;  1S3J A;  4MFD A;  1MNM C;  4MLO A;  1WI9 A;  2BBY A;  1XPX A;  5EEH A;  2LF8 A;  1JUP A;  4DW6 A;  1GDT A;  2JRM A;  3AFH A;  1WJC A;  2JWT A;  2M4G A;  3VSK A;  1JT6 A;  2KQR A;  4BEH A;  1Y6I A;  2QEN A;  5E1Z B;  3OYB A;  1QA6 A;  4LJZ F;  1MMN A;  1XX5 A;  3Q0V A;  5BNG A;  4LIV A;  4HST A;  1YS7 A;  3IH3 A;  4E7Z A;  4UV9 A;  2IAI A;  5C3E J;  4UB6 C;  1CF7 A;  1FBU A;  1POG A;  2JVG A;  5FKO A;  4C2M J;  5AIP A;  4HQE A;  2CW0 F;  1VFC A;  5FRN A;  4AIJ A;  2DA7 A;  1TT5 B;  1DPR A;  4RA2 A;  1LDD A;  4WX9 A;  4XLH A;  1UG0 A;  1JI8 A;  1LKX A;  2O3F A;  2P4W A;  2LLK A;  3RCO A;  3O2P E;  3ZN1 A;  5M5X J;  1JXS A;  2ISY A;  1R4N B;  4EGZ A;  3OL3 A;  3LAP A;  2PFB A;  4UUS B;  2KZG A;  3P9I A;  2ECC A;  1SFO J;  1I6X A;  3NEU A;  4O6J A;  4E7K A;  4N9H A;  5FKL A;  4M3D A;  4XOR A;  3T5X A;  3LSR A;  1D0Y A;  3J7Z I;  1G59 A;  1DGR M;  1YE9 A;  4M3B A;  4CSW A;  3BJA A;  1Z0X A;  2CUJ A;  2QKM B;  3H9Q A;  5EYR A;  3LA7 A;  2ME6 A;  1K4T A;  2MH2 A;  4IXA A;  2JUC A;  3KZY A;  1BA5 A;  1Y56 A;  3S14 J;  1UMQ A;  2FSW A;  4X6A J;  1AKH B;  3S3N A;  3K69 A;  1KU9 A;  3HHH A;  1XCV A;  3GEZ A;  1OR7 C;  2O61 A;  4XLP F;  4NUB A;  2LVS A;  3V42 A;  1WI3 A;  3FWE A;  4XLA A;  3W6K B;  5IYC J;  3CCS I;  2HPM A;  5BQT A;  4KMF A;  2JA8 J;  2PLY A;  3HSR A;  3PFY A;  3RKQ A;  2VBW A;  4YII A;  4IVN A;  5IP6 A;  4F91 B;  1EA3 A;  2KP6 A;  3EYI A;  3BPX A;  1WJ5 A;  3OS0 A;  3OOU A;  2LBF B;  4KIG A;  4A3D J;  4AVZ A;  2NS8 A;  3SFZ A;  2CUE A;  1ETQ A;  1FIP A;  1JJ6 C;  5CKT A;  4S0H B;  1X1C A;  3HOX J;  2GA2 A;  4HBL A;  5F1J A;  3RZO J;  1V54 H;  2RC4 A;  3WGG A;  3BJ6 A;  5TGT A;  2CGP A;  4LGW A;  4CGZ A;  1SAU A;  4EJT A;  2DAO A;  4X1E A;  4BJ5 C;  1HLV A;  1MGT A;  3C3W A;  5H6R A;  2A07 F;  2JQ7 A;  3R61 A;  2CYY A;  2UWM A;  3RQI A;  4IF4 A;  2F5D A;  5D6E A;  2WAD A;  2E36 A;  1Z6T A;  3BR5 A;  3VDX A;  4L9T A;  2R5Z B;  1R1T A;  2M8E A;  3H3U A;  4B48 A;  2DYS H;  4J19 A;  1HW5 A;  3G71 I;  5DCF A;  2IRF G;  3SDB A;  3BTC A;  3FXJ A;  3OYD A;  3A02 A;  2B7E A;  1G4D A;  4RDU A;  4ZDP A;  4HPQ A;  2Q2E A;  4B09 A;  3CCE I;  4IHX A;  2BY3 A;  2IS1 A;  1ZGW A;  2D5V A;  2GXA A;  2KHM A;  2P0W A;  1T6S A;  1TC3 C;  5K7Z A;  4P5O A;  1PP7 U;  4V2F A;  3B02 A;  5LD2 C;  1NH3 A;  4M9S A;  3I4N J;  3CME I;  2RNJ A;  1H89 C;  1MMS A;  2QQB A;  3DF8 A;  2OQG A;  5K5O A;  3TKY A;  1SFU A;  1RPW A;  1ORK A;  5ED4 A;  4KDP A;  2ZB9 A;  4UVB A;  2KJB A;  1YO5 C;  3KZI C;  1ZEL A;  5FKN A;  4LK1 F;  2RDP A;  4XON A;  1APL C;  2ZBK A;  5L3G A;  2Z9O A;  4LG0 B;  1NG6 A;  2HR3 A;  2WY7 Q;  2IBD A;  2R7T A;  2XB0 X;  3VPR A;  2E1M C;  2XF6 A;  2IA0 A;  3M1E A;  3SDG A;  3KP6 A;  1FYM A;  2PMH A;  4ZZL A;  2IPQ X;  4DJA A;  1IV8 A;  1YX3 A;  3OSG A;  3LA2 A;  5B1A H;  1X58 A;  1JHH A;  2LYC A;  2OC6 A;  2LR8 A;  1P4W A;  2QBY A;  4K2E A;  2EA4 A;  2K9S A;  1RI7 A;  3A2K A;  1XGM A;  2K3P A;  4Y17 A;  2E5Z A;  2H8W A;  2PJR B;  3MZ8 A;  2WBM A;  4D1Q A;  4IOC F;  3HOY J;  3SYT A;  2NRA C;  4XMY A;  1YIT I;  2FML A;  3CDH A;  2LRD A;  2CUF A;  3PQJ A;  1ZH5 A;  5KK1 A;  1YYV A;  1Y8Q B;  2BXY A;  4OMZ A;  3HOW J;  3W2A A;  2P8T A;  2IEK A;  1Z9C A;  2GXB A;  3QAH A;  2ESN A;  4I7H A;  3DXJ F;  2YR2 A;  3ECH A;  3PQK A;  3ROU A;  1FTT A;  1OJL A;  2Y0S N;  3OYC A;  2CV1 A;  1QGP A;  5HDK A;  1RR8 C;  1FIA A;  1BIA A;  4A0Y A;  5CQG A;  4F52 A;  3BRO A;  4IQ4 A;  3A4C A;  4NHJ A;  1B6A A;  2LDU A;  2NAZ A;  2QSH X;  1W7P D;  3JRI A;  4IHT A;  3RI4 A;  3G6E I;  2JA2 A;  3K6G A;  1MJA A;  1RES A;  1LFB A;  2QQ9 A;  2MA3 A;  3AL0 C;  2WAQ A;  1O3R A;  1WZ2 A;  3RKX A;  3CMA I;  4YFK F;  4JP0 A;  1MW7 A;  2KIU A;  2L01 A;  2L02 A;  4A3C J;  5DM6 F;  2JVH A;  3UNG C;  2M87 A;  2ESH A;  1IDY A;  4CCJ A;  1D5Y A;  4UNO A;  2LKS A;  1B72 A;  5EGO B;  3GX4 X;  3QWL A;  1VND A;  2LF7 A;  1BOA A;  4BY1 J;  3ASO H;  3PO2 J;  4E7S A;  2DFF A;  2K40 A;  4CXF A;  1BC7 C;  2BEO A;  4Q48 A;  2FF4 A;  3H0G J;  5CQE A;  5F6F A;  1GXP A;  1RC9 A;  4MFE A;  3O8G A;  1FOW A;  3CUQ C;  2YSR A;  2QSF X;  1FC3 A;  1Y0U A;  3WTY C;  3VYU B;  1F4K A;  1TQM A;  5F0F A;  3PL8 A;  3IWZ A;  3I59 A;  3V8L A;  3ABU A;  1X1P A;  2V1N A;  2NOG A;  5ERI A;  1G3S A;  1C0W A;  2P5V A;  2Q0O A;  1TWG J;  2QKL B;  5F0H A;  2CW7 A;  2LRE A;  1U6G A;  5JVT A;  4YFX F;  3F0C A;  2OCE A;  4W97 A;  3HHG A;  4KN7 X;  1B9N A;  2K9N A;  4CIC A;  1ZHF A;  2HYG D;  2P7V B;  4EM2 A;  3L7W A;  1KYZ A;  3HPH A;  3VSL A;  1GHC A;  2H6C A;  4ZH4 F;  1VQ8 I;  1SAN A;  1S7E A;  2VC1 A;  4P1W A;  1H8A C;  5FJ8 J;  3B6C A;  4RM2 A;  1WHU A;  1B4A A;  2W7N A;  1JUM A;  1W4M A;  1LE8 A;  3U2R A;  2RAE A;  4YG2 F;  1B1B A;  3SZG A;  3LSJ A;  1XCB A;  2Z2S B;  1VQN I;  3D0S A;  3KLO A;  1KGS A;  3SEZ A;  4AVP A;  2DN0 A;  1TWC J;  3HRU A;  2HKX A;  3LFU A;  5J6X A;  3TO9 A;  1ZLK A;  1FWZ A;  1R00 A;  5HDG A;  5GAD J;  4Z2Y A;  5EEG A;  4BDY A;  1V4R A;  5BPD A;  4RM3 A;  4UUV A;  1X3W B;  2V9K A;  2WY8 Q;  2DDA A;  3NRV A;  3O6B B;  3KLN A;  2HDC A;  1I1S A;  2EIJ H;  1SD5 A;  2DA6 A;  3J7A Y;  1H88 C;  2E1M B;  4MEX F;  1S9H A;  1FOY A;  2ZME A;  3ZR8 X;  5M3M J;  4DBR A;  1XC5 A;  1G8X A;  5FLX Z;  3PIP F;  2GIV A;  2KRF A;  1MBG A;  3LSH A;  1XGS A;  5E1X A;  2DOF A;  2D45 A;  4FE7 A;  1E17 A;  5DD4 A;  2PQ8 A;  4G94 A;  2VC0 A;  4BBS J;  1D0X A;  3BCB A;  3CCM I;  5EEA A;  3DQV C;  3T8R A;  1FYK A;  1HOM A;  1X19 A;  5EJC A;  3G1O A;  1PUF B;  2DMT A;  2BY1 A;  4A6D A;  1DU6 A;  3BR0 A;  3DBR B;  3FBI B;  1UG2 A;  3H3V K;  2XPV A;  1RUN A;  1HC8 A;  1GV2 A;  2V9V A;  3ZQG A;  3S17 J;  4LIT A;  3CC4 I;  3A03 A;  5L3F A;  5F64 A;  4EEF G;  1QVT A;  2HXO A;  1HBX G;  4YIF A;  5KAI C;  1YIO A;  4CDG A;  3N97 A;  3MCZ A;  2RV8 A;  3RSN A;  4D0P A;  4EM1 A;  3FDY A; 
#chains in the Genus database with same CATH homology
 5IY5 H;  2EIL H;  3AG4 H;  2Y69 H;  5B1B H;  1OCZ H;  2EIK H;  2EIJ H;  2OCC H;  2ZXW H;  1V55 H;  3ASO H;  3AG2 H;  3ABM H;  3X2Q H;  5B3S H;  3ABL H;  3AG1 H;  1V54 H;  1OCC H;  2EIM H;  2DYR H;  1OCR H;  2DYS H;  5B1A H;  3WG7 H;  2EIN H;  3ASN H;  3AG3 H;  3ABK H;  1OCO H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...