2DYRH

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Structures and physiological roles of 13 integral lipids of bovine heart cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 26
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2006-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 2dyrH00
3X2QH 1OCZH 1OCCH 1OCRH 5B1BH 5B1AH 3AG1H 3ASNH 5IY5H 1V54H 5B3SH 3ASOH 2EIKH 2DYSH 3WG7H 3AG3H 2EIJH 3AG4H 1V55H 1OCOH 2ZXWH 3ABLH 2Y69H 2EILH 3ABKH 2EIMH 2OCCH 2DYRH 3AG2H 3ABMH 2EINH
chains in the Genus database with same CATH superfamily
2L9VA 1XPXA 1XMAA 4BJ5C 4XLFA 1MH4A 3L09A 2FU4A 1LNWA 5E1XA 2ZJ2A 4M6XA 4XLEA 3FMRA 1LQ1A 1JUSA 1ZGJA 5HLGA 4A3EJ 3VB2A 3CMAI 3OYGA 3Q9SA 2VBZA 3N97A 2DMPA 2OU2A 3MD2A 1ZG5A 4ANJA 1J09A 3E0JB 4HF1A 3OSGA 1L3LA 1LFUP 2IAIA 4FX4A 4QIWN 3ISPA 3U21A 1RZ4A 3M9AA 2YR2A 3WTTC 4HG2A 4I01A 3OR1C 5HNHA 3IL2A 2IGKA 2K02A 4WF2A 3ASNH 3QOPA 3LSGA 4D7NA 4V19K 2QF7A 1T33A 1W0TA 2MC4A 4Y7NJ 2JA6J 4E7SA 1ZHFA 2GWRA 2E2HJ 4II2A 3VFZA 1X1AA 1HXDA 4LFUA 3KEQA 1EH8A 4UB6C 3FMQA 2EFNA 1LUJB 4LD5A 2RVCA 4RAGA 3OYNA 2AS5F 4HX8A 2IA0A 3ECOA 5EG0A 3QRFF 4EATA 2K86A 1FMWA 3CCUI 4Y4RA 5GADJ 2B0LA 5K5QA 2R5ZA 1A6IA 1HW5A 1KQ0A 2OCEA 4NUBA 2O7OA 2HOSA 4KMFA 1OR7C 4RLFA 3COAC 2F5CA 3DXJF 2HPMA 2LH9A 2A61A 2QM3A 3CUQA 3NWSA 3V7CA 4DOZA 1JUPA 4XKBA 2OTJI 4CCJA 1TWCJ 1I1GA 2PBIA 3V4GA 5LLQA 4RLQA 1USSA 1PYVA 1RKWA 4B8XA 3B02A 3PFIA 2L7FP 5HNFA 2R93J 4B09A 1AA7A 1QZZA 3BTJA 3BROA 3QP5A 4HQEA 3EQLF 1B8IB 1IXCA 2IEKA 3DU6A 4XSZF 3W2VA 2HQAA 2MYSA 4DJAA 1HW2A 2ZFUA 1YRNB 1FOYA 3SYTA 2LF7A 5GPAA 1FTZA 1H9TA 4UUVA 4JK1X 1AKHA 1FBUA 3BR2A 5CVRA 1X1PA 3IWZA 3TKYA 3FDYA 2QQAA 4YEJA 2VBXA 2RDPA 2J5PA 4IRIA 3TO6A 1D0ZA 1O7LA 5H20A 4AIHA 3MKWB 3IP4B 3G73A 2L54A 4LIUA 4BHBA 3BR3A 1IO2A 3BCBA 2O61A 3I54A 2LY2A 4ZTFA 4UNOA 5L3CA 1XGOA 4BBSJ 3HOSA 1MDMB 3F23A 3IKVA 3DTEA 5J47A 2MW8A 2H94A 1Z77A 2CQQA 5D4RA 1SEUA 1XX5A 3GUDA 2Q0OA 3HUGB 4LITA 5D8LB 4EJTA 2X6YA 4E7HA 5GAGJ 4LLLA 4LG0A 4HX7A 2L4MA 2A5YB 1FOKA 1PVEA 1WFXA 4I99C 2WTEA 3PNVA 2NOGA 2ZFWA 3ZXSA 5D8KB 2R7XA 2R7VA 2R7WA 4BUPA 1LB2A 3G2BA 2OPTA 3F6OA 4OWRB 5IP6A 3OIPA 3ABKH 4RBOA 1ZRFA 1ZELA 5IPAA 1I50J 2DFEA 4Q4ZF 2FBHA 3TQNA 1FT9A 3SDGA 3S14J 1XB4A 2PJPA 2IXSA 2JVHA 1PUEE 4DQ2A 3HRUA 1R22A 1X1BA 2HNHA 4NB5A 2DT6A 5GAHJ 2FQ4A 1E3OC 4A3CJ 1TNTA 1JGSA 3KP7A 2PMZA 3CQZJ 5F27A 5IT9K 4A3DJ 3QQAA 4N9HA 2DFHA 3HOTA 1SFKA 4AVZA 1JKPC 4JBAA 4HF2A 3CESA 5E1ZB 2ADUA 2MFZA 3RKYA 2BW3B 2R3SA 1NTCA 3S3MA 1UHWA 2EZKA 3UR3C 3DLLF 1B9MA 3HHHA 3M07A 2C6YA 2VE8A 3H3UA 3HXLA 2L2OA 3K1NA 4A0ZA 2L7MP 1EH7A 3LMMA 4I2OA 1ETVA 1RKTA 2M4KA 1YX5A 2FEZA 2YX4A 2NRAC 2O6GE 4NDLA 3LA3A 4AIKA 4CCOA 3S3NA 4AWXB 1HKTA 2JSCA 3KZYA 3RKWA 4C2TA 2HOAA 2WV0A 4KT5C 4M3DA 4BE1A 4AYBA 4B3AA 2DT7B 4YG2F 2X6XA 3E7LA 2H6BA 3DWLE 4QPOA 3F8NA 3OYMA 4NQWA 3LAPA 2CGPA 1O7FA 2H6CA 5BNGA 4RAZA 3A01B 4G94A 3JRBA 2KT0A 5DCMB 2JA2A 4BJ6C 2DK8A 2K9LA 5EEAA 1MJ9A 4L0ZB 3RQ4A 1S7EA 2L7ZA 1N77A 2B7EA 1NG7A 4OU0A 5J4YA 3HRSA 4F91B 3GLLA 2E1OA 5D5UB 3OYEA 2M7BA 2KRCA 4RAFA 2NXNB 4XSXF 2X48A 3PO3J 4UXNA 3KPHA 3ERMA 3TDUC 5ILVA 4DBRA 1G8XA 4RS8A 5H2FC 1YJ9I 2GA1A 2CO5A 3G1MA 4ZTJA 1K61A 2JA7J 2E7WA 1JTXA 3OOUA 1TNSA 2RV8A 4GRIA 3S32A 2K4JA 5K1YA 1IG7A 5ICEA 2DQLA 3GZ6A 2IA1A 1GXPA 5HLTA 1D0XA 4EM2A 2QA4I 4UHTA 1O3SA 1HKQA 2PFBA 1BW6A 4XICA 2L0KA 2XGDA 2FMLA 2N8GA 3NEUA 1BR1A 4FE7A 2K3PA 1GXQA 2W24A 1FMVA 5HDGA 1RPWA 1R7JA 2W85A 2GOXB 4HV6A 1MNDA 3BWGA 2VLAA 3QPTA 4DBQA 2IBDA 2CWEA 3FIWA 2ACJA 1B72A 4E7JA 1YFHA 3W2AA 4PJMA 4ZYGA 2M2EA 1IUYA 1ON1A 3WTYC 3GWZA 1YJWI 4IL6C 2HEOA 2ECBA 3BG9A 3K2ZA 3CMYA 3GO5A 2KPMA 1O3TA 2Y2ZA 2NYXA 2EIJH 3Q0UA 3MKLA 3GVAA 3DPUA 5E20A 3KP2A 1OYYA 2XPVA 5FGMA 4IRGA 2X51A 1Z9CA 2TRTA 1WZ2A 2ZSHB 3BR0A 1W7PD 3BR6A 1SFXA 1VF9A 3H5RA 3HB9A 3L2RA 1G2HA 1IV8A 4LK1F 4HLXA 4CYCA 3CC2I 2DO7A 1UHMA 3BG5A 4G7OF 2EINH 2HYJA 1SD5A 2ZO4A 3S15J 1I3AA 4PJ0C 2BXZA 3BJ6A 2LF8A 1ZLJA 4I02A 4HRIA 3VSLA 3K4MA 1REPC 1J59A 2ECCA 4HW0A 3UKGA 2A5WA 1EV7A 4PJLA 2AQFA 1L0OC 2K27A 2COMA 3H36A 2E1CA 2Z1DA 1KZHA 2LSOA 1WJEA 4M72A 3A1YA 3IC7A 3ERED 1TT0A 2LY9A 3BCAA 2QWWA 1YIJI 2QYOA 3EUAA 1D3YA 3BJOA 3JRAA 2V1UA 1V54H 1S7AA 3MFKA 2VBWA 2L7KA 1TT5B 1UG2A 3O8GA 4ZDPA 3LFKA 3GCMA 4XM3A 4CH7A 5KHDA 4AC0A 5EG0B 2EWNA 3ZPLA 2YX7A 1BOAA 4C30A 4S05A 2GLOA 1R23A 4BHCA 2K4BA 2D1VA 3CMMA 2VJIA 5F0HA 4J19A 2DPUA 4EJWA 1VQ8I 1GV2A 2AHQA 4LLGF 1MMNA 2KZGA 4FCYA 1WGXA 2R5ZB 3RIRA 3C2GA 3NWTA 1P4XA 3I3LA 4IVNA 3HPGA 3HOUJ 2UXNA 3CLOA 4EMSA 1FTTA 4PFPA 2O5RA 4OAZA 2E1NA 2DOFA 2MBFA 3W3CA 3CO7C 5E8GA 4M3BA 3SZTA 4XN0A 4BGDA 3PUFA 3ZQ7A 4BQOA 1JKQC 1WKMA 1VZ0A 3ZRGA 9ANTA 3D5LA 2ISYA 2F5FA 2BV6A 3F8BA 2ZJPF 2L02A 2L3DA 3K6GA 3WE3A 3GW2A 3K1PA 4HLYA 1F4KA 2W82A 3GTPJ 5IYBJ 1DUXC 1J9IA 2M87A 1UB9A 4Z2YA 4M73A 4ENMA 1XSVA 4CICA 1JJ8C 2RAEA 3M1CA 5K7HA 1MGTA 4JX6A 1YQAA 2OTLI 1W7PA 3GF2A 2FNAA 1E17A 2AXTC 2EK5A 4KJZA 5D6EA 1OKRA 1R1TA 1JT0A 1HW1A 1TP4A 2RN7A 5J1RA 3OV8A 1IAWA 1SD7A 3GYHX 5GTHC 3HIFA 1DGRM 2VXZA 1SFUA 4DNCA 3U1DA 5JI6A 5LHGA 2QSFX 3KZIC 4BU2A 3M7GA 3S1RJ 1R4NB 2Z16A 1T0FA 2OF7A 1YS7A 1LDJA 3CCJI 1BJAA 2V79A 3EUKL 3LSIA 2VQGA 1HA8A 4ZYDA 4L9NA 2CSOA 1Z05A 3DTIA 2HZDA 4RGSA 2O8KA 2PEXA 1SMTA 4ZC3A 3CCLI 4LG0B 1DGWY 2HYGD 5GTIC 2FA5A 2WB1A 3DEEA 5L3BA 5DD8A 2VL8A 1QHHD 3E5XA 3OIQA 3LSHA 1OCTC 1A04A 2DOEA 3WTZA 2LC2A 2Y9YA 3AG2H 2W1OA 2WA0A 3T8TA 4RGRA 3ZMDA 1IN5A 3U9GA 1IXSB 5M5XJ 4MNUA 4WX9A 3FISA 1T38A 3LSTA 3VYSB 2XC7A 2BXYA 4W97A 4OAYA 4L18B 2CQXA 1GHCA 4M9XA 1BC7C 4IX7A 4KUMA 3F9KA 3T5XA 2NAZA 5HS8A 3MVPA 2HVRA 2YU3A 1SVLA 1HLVA 4M3EA 2Z33A 3RKXA 1YYVA 1W5TA 2FE3A 2FSWA 2KKOA 1FYKA 2EV0A 4KITB 1TWFJ 3DKYA 2E19A 1X19A 4XLPF 4EJVA 4BQAA 1MMGA 1I39A 4R1HA 4NHJA 5IY5H 3QYFA 2R7FA 1VQLI 2G0EA 4A6DA 2QQBA 4HPQA 1WI9A 4WXDA 3R0JA 1V3FA 2Y0SN 4QSHA 4Z6YA 1PUFA 3W6VA 5IOYA 2R7DA 1IXRC 1W0UA 1Z21A 3FX3A 2LREA 3KYCB 3PNTA 4MTDA 1CQTA 1MSEC 2V9PA 2FMYA 3GTKJ 2X1DA 2STWA 1TW3A 3OL3A 2D1HA 5GPCA 1FNNA 1WJ5A 1J5YA 2K5CA 2DN0A 3IUOA 2W00A 1ETQA 3BDDA 2GA2A 1WJFA 3DKXA 4BQNA 4K2EA 4IXAA 3F8MA 1MSFC 4IHTA 5EZGA 4FE4A 3Q0WA 2JA8J 3GZ5A 1YG2A 2TDXA 3GLXA 2FXAA 4JOMA 3RPUD 4BDYA 3KETA 2CV0A 3VWBA 2CW8A 1I6XA 2HS5A 5DUKA 5LEKA 4NQWB 3ZN0A 2M5WA 3K70C 3RZOJ 3VEPA 1S5LC 4ASNA 1SANA 4R79A 4J00A 2E5NA 2QVOA 2A6HF 1ODDA 2UV1A 5IP9J 2DFIA 1YITI 1N25A 3A0HC 5ILSA 1XSXA 2M1BA 1GLNA 2XAUA 5DEQA 3CD6I 1MH3A 2QKLB 1I1SA 1FX7A 1Z1DA 2P7VB 3PL8A 1VFCA 2DLLA 2RNGA 5FROA 2K9QA 5K7FA 1POGA 3MAJA 4JX4A 4QPQA 2JN6A 4TV7A 5CVVA 4JYKA 2BHZA 4V2GA 2R0QC 4AVPA 2RKHA 2W4SA 2FD5A 2XPWA 2VKHA 1UFMA 3IH3A 1GVJA 2ELJA 3P9IA 5CVUA 3M8FA 1R4MB 3JW4A 2HPIA 2W48A 1MBJA 1TQIA 1I5ZA 4QWQA 1S9HA 1UHSA 2CFXA 5F1RA 2CUZA 2E7XA 3WTSC 1JKRC 1IRXA 3S16J 1HC8A 3JRIA 2OQRA 2MLKA 2QGUA 3K4KA 3J7AY 3VODA 2LR8A 2OAZA 2L9SA 4PGHA 1ACIA 3KYDB 2IPQX 3K4LA 3GTJJ 1B72B 3LA7A 4FX0A 1KU7A 5FKNA 2XGEA 2P5LC 1HCRA 2P4WA 3KIOA 5M5WJ 1SFOJ 1OCRH 3W6KB 3I56I 3V7SA 1AWCA 3V42A 1X3WB 2CV2A 4FHTA 5F6FA 5IYDJ 4M71A 4CYCB 1SVMA 1MJBA 4EJOA 4QLCU 3DBHB 3G1OA 3HEFA 3HSRA 3U1KA 3WTVC 3RPUA 4A12A 2RQPA 3RYRA 3KEYA 1WRJA 3JRFA 1JE8A 1H0MA 4ZJZA 2O03A 2H1KA 2Y30A 3LSKA 3L1PA 4WK8F 4HNVA 2PMHA 3EPZA 2JSPA 4GCVA 1IN4A 1PP7U 1LDKB 4EGYA 5E3OA 1ZGWA 1V55H 3GX4X 2GXGA 2EQRA 3P9KA 2DPDA 5K5OA 3S2DJ 2R7TA 3C2BA 5A2QZ 1KYZA 3I58A 1C0WA 2LD5A 1HOMA 5EZHA 2EPFA 2M9HA 1BL0A 2BYVE 5TGTA 1SVOA 4MIMA 2Y0MA 1QZYA 4F7ZA 2LKXA 3RSNA 3Q5FA 3RZDJ 4IPAA 4GGGA 4LMYA 3G6EI 3X2QH 1WVRA 4IQJA 5CVIA 5C4XJ 3H92A 2WY8Q 3GFLA 3IHUA 2XKOA 4FISA 1V5FA 1T98A 4O6JA 2GOMA 5F0CA 3OY9A 3HSEA 2XUBA 4F3QA 3BZ6A 5GAEJ 3JRDA 3Q3SA 4ZZLA 4B43A 2PMUA 3W2WA 1IJWC 2JK3A 1QBJA 2OBPA 2FUG2 3E5QA 5HDKA 3LOCA 3MKYB 1HF0A 4I6ZA 5LGTA 2V1DA 2R7SA 3LSMA 4BH9A 3CUOA 5HLIA 2FF4A 4NC6A 3DF8A 4XRFA 4N0BA 1YHQI 4GYGA 3JCUC 3J81K 3CP2A 3J7YJ 3QOEA 3MKZA 4Y17A 4DGWB 2VONA 3KP4A 3I9V2 4FT8A 2LKPA 3TW7A 4Y15A 2E1MB 2ZXWH 3K2AA 1IC8A 2HR3A 2NNYA 3FXKA 4PK4A 3A0BC 2DCEA 1TWHJ 1W7PB 2V1XA 2A3SA 1ZH5A 2PX9A 4A5MA 4F52A 3GTMJ 1VI0A 2O9LA 2HVQA 1W36D 2VOOA 2WC2A 3K4NA 4HOBA 2HU9A 3G4SI 3L2CA 2EFOA 2R7ZJ 5E1WA 1VQ9I 2W7NA 3DFGA 2DMQA 2LK2A 2ZNYA 1Y8RB 1WH5A 3CDIA 1R9TJ 2Q1ZB 3ZQLA 2WBMA 2V6EA 3ZQIA 1CF7A 1QO0D 2Z99A 3BR5A 4XR6A 3Q0VA 1G4DA 2MH9A 1P7IA 3DPLC 4DIQA 4LB5A 2RGVA 2XHKA 3TO9A 5K5RA 3FXUA 2VJJA 3ESWB 3CC4I 2XV4S 5FJ8J 5LBQA 4F93B 1Z6TA 2H1LA 5ICFA 1QU3A 4II3A 2BY3A 4MEXF 2DW4A 3I5UA 5FKMA 4XLHA 2AXLA 2A69F 3BOQA 4EJUA 2PLYA 1T08B 5HODA 3M8EA 2DYRH 3FK7A 2HFHA 1NK2P 3CCYA 3LFUA 2JRMA 2BY2A 4XLNF 1LE8A 5B1BH 5ICCA 5CKTA 1MNMC 4P9UA 1ZTRA 3CUQC 5ILUA 2DYSH 2Y9ZA 2DT5A 3T1BA 2KQRA 1X2NA 4XRSG 4M3FA 1R5HA 3JAMK 2PJRA 3ZQGA 3E5UA 4HSTA 4AU7A 1XN7A 2DFFA 1E3HA 2DA1A 1HSTA 3EUHA 3IKTA 2VT3A 1XGMA 5EDNA 3KFWX 1WSUA 2HI3A 1ZARA 1PUFB 2CQNA 1MZBA 1FZPB 2ZCWA 5BS6A 2W84A 1KQ9A 4BKXA 2CYYA 4GYIA 4WCGA 2IA2A 4AUXA 4UVCA 1FYLA 1BR2A 1S72I 3BG7A 3DKWA 1ZKGA 2CQ7A 1MJAA 1FYMA 4YIRX 4DZJA 1G3WA 1F36A 1AU7A 3SQNA 1WPKA 3HOZJ 5TJJA 3ZQFA 2ID6A 4IKFA 2DI3A 1MBEA 4ETSA 2CW0F 3CTAA 2NVXJ 3EYYA 2LFBA 2LDUA 5LHIA 4KNYA 3JRGA 1W4MA 2MA3A 1MNEA 3PNYA 4EM0B 1O57A 5DYMA 3E6CC 1OCZH 1YO5C 3CCMI 3GTOJ 3BG6A 5DCFA 5HDNA 2XDVA 3BPVA 3SFIA 3OS2A 1FP2A 3RPQA 2DTZA 4RDUA 4NC8A 2IGNA 3K69A 1ZAOA 4LGWA 5BOXA 4IOAF 2EILH 1I3QJ 1MBKA 1OCPA 3E6DA 4HAMA 1UJ8A 3K9TA 3O8HA 4XL9A 5ICGA 3SEZA 2FQ3A 3L2WA 3OYBA 1BJZA 3F0CA 2JZYA 3CJRB 4P9FA 3FHNA 4C3JJ 4G7HF 1Z6RA 2MABA 3KYLA 4I7HA 5FLXK 2VJ5A 2OD5A 1TWAJ 1FSHA 4KIBA 1AHDP 4HSRA 5JHUA 2HXIA 3KX2A 4S04A 3F21A 3SXYA 4XRSA 2XGCA 2IS1A 2BVLA 3B73A 3OYIA 1WWXA 1SMYF 1T95A 1Y0NA 5CQGA 2FNPA 4Q5SF 2UXXA 2VXDA 2OCCH 1A31A 2LVSA 4E7KA 4EQQA 5EGOB 4IHYA 1JTYA 2QBYA 5E17F 2HZTA 1RR7A 4Q48A 1FLIA 3PUBA 3T8RA 4MFEA 4LLNA 1WJBA 2H09A 3QODA 1P92A 4A3LJ 3D1NI 1D8JA 3M8JA 1WI3A 2CG4A 1OFCX 5FLVA 4IHSA 1F43A 1G3TA 3D5SC 1XD7A 4MFDA 5HLHA 1E2XA 1IF1A 3V8LA 1VQ4I 2X4HA 1ORKA 3TP0A 4WWCA 4D5FA 3QP6A 1JUMA 1LFBA 3FXLA 3B6AA 4XMYA 4X0GA 1IZ1A 3H0DA 1DU6A 3TP3A 2EJRA 1ENHA 2Z5UA 3TOBA 3HL2A 4YFNF 3OYCA 2CH0A 5EEGA 2XAJA 2NVTJ 2D45A 3H5NA 3JRCA 2X6WA 2NVQJ 4FTHA 4U0YA 2JUCA 5D4SA 3ZR8X 5L3FA 5JLWA 5FB2A 1TL8A 3RQIA 4IOCF 2WADA 1MMSA 2V9VA 5JFRA 2Z9OA 4ENNA 1ZK8A 1Z67A 2XAHA 4M6VA 2R4GA 2IJLA 5ED4A 4PCQA 5K7ZA 2X1CA 2VT2A 1WH7A 2HDWA 2VN2A 3HC7A 2H27A 2LP0A 5HVQC 2L5QA 2O3FA 2MD0A 2P6SA 2M3AA 2Q8KA 2DA6A 3BJAA 3EDPA 4OINF 3L2VA 2ZMEA 1LVAA 4A2UA 4RB0A 2GXAA 3GXOA 3FXRA 2DJIA 2XF7A 2Z2SB 4B1RA 2OC6A 1S7OA 3I71A 2KRFA 4U87A 3TMOA 1M1EB 4BYYA 1YX3A 2IW5A 2ESHA 2VASA 1AOYA 2KP6A 2CMPA 3FMSA 3IH4A 2K9NA 5CQEA 3FM3A 5AIQA 4IHXA 1YW7A 5E79C 4XN3A 5B3SH 3ASOH 1DDNA 4UV9A 3CUQB 1Y8QB 3JSOA 1MW7A 3GZNB 2CS3A 3HSFA 5HS7A 2CQKA 3WU2C 4OMYA 4NC7A 3M3YJ 2VKEA 2HKOA 2FX0A 2HGCA 2XIGA 1IN6A 3CJNA 3JTGA 2AO9A 2CFOA 5F04A 4OIPF 1X1DA 3HG9A 2GXBA 4XORA 4G6DA 2AQEA 2Y48A 4ESBA 1W1WE 2L4AA 3H9GA 3K10A 3TL4X 4Y13A 4N4OB 3CCSI 3MZHA 2KRHA 2OUMA 1S6LA 1MBGA 2K9SA 1AKHB 1IDYA 5LFAA 3ZCOA 3J80K 1TQMA 3I0TA 2XASA 5M5YJ 3HOXJ 1R36A 4UVBA 3BTCA 3PSFA 3H1CA 2A6TA 4FETA 4MQ9F 3ZQHA 4EV0A 2STTA 4O3MA 1GT0C 2FOKA 1QPMA 3CZ6A 2FBKA 2IS6A 2A05A 4XNFA 2UZKA 4XBFA 5IT9Z 2JVGA 3UNGC 3I59A 4UB8C 4F92B 3DTKA 3HZJA 3FHZA 1FOWA 2VIXA 4BEHA 5L3GA 3J7ZI 4KICA 1DPUA 4HNTA 1O3QA 3HM5A 3AG1H 3S2HJ 2RC4A 3AAFA 5M3MJ 1LDDA 4D5CA 4G6QA 2XVCA 3GFMA 3PIOF 1Z3YA 5F1JA 3ZQQA 5IYCJ 1MBFA 1XG1A 4B48A 3TDZC 5FRMA 5H6QA 1F5TA 1MIJA 2F5VA 1RIOH 3S1MJ 5EJCA 5J40A 4PFOA 3C18A 2ZMEC 3HOWJ 4B44A 3BZKA 2M0CA 1XDSA 4M6YA 3QPLA 3L2UA 5BQTA 3RTRA 1EA3A 4PZJA 4C2UA 2QQ8A 3K1MA 3O2PE 2MG4A 2XGXA 3NQOA 2DAOA 4BJTA 4D1QA 3QYBA 5FKLA 4DYQA 4XQFA 2K7LA 2EZLA 2ZKZA 2HQNA 1LE8B 4UY8I 4HF0A 4P1WA 5EYRA 4XLCA 2DMNA 4A6EA 5L3EA 3JREA 3DPTA 1J75A 2PJRB 1RC9A 4A3IJ 3ABMH 1Z7UA 1VQNI 2KJCA 2A68F 3OYFA 1YW9A 2QSGX 1J2XA 2GBYA 2HWVA 1U2WA 3WG7H 1VQ7I 3HBLA 5C44J 2ICWG 5KAFC 3R4KA 5FLMJ 2E1MC 2E71A 3F3XA 4M9ZA 1XCVA 4IZZA 1ETXA 3ABLH 3ABTA 5KK1A 5JVGF 3LSRA 4BDZA 3C7JA 3T0YA 4YIFA 4IHWA 1KQ8A 4FQGA 1OLTA 1U5TA 4HV5A 1PDNC 4EVIA 5FLXZ 1YS6A 1XTAA 2VC0A 5B1AH 2YU9J 1DPRA 3ECHA 1IRZA 1B59A 4XK4A 3S1NJ 1Q1VA 2DDAA 3KCCA 3QPHA 2X6OA 3K4CA 2FJ1A 1HSJA 1T0FC 3RKQA 2JRTA 3TW6A 5D5WB 1N78A 4Y33A 2HDDA 1JHFA 3ZGKA 4KDPA 3CF2A 2R7QA 3K4JA 3P7NA 4DZPA 2R7OA 5KNLA 2ELKA 3V8JA 2KHMA 2KIFA 1ETKA 2F4OB 5DS9A 3ZOBA 4CUGA 4G7ZF 3LAJA 2V9KA 1WCMJ 3FKJA 4KFCA 1UAAA 1BM9A 1Y0UA 4ZYHA 4CZZA 5E3MA 2EZHA 2MSYA 1A36A 4XONA 4WXCA 4AD9A 2ZNZA 4BXFA 4F55A 1XGSA 2BY0A 4BNCA 1HKSA 3OYKA 4KYWA 3CF5F 4ESFA 1D5YA 3V8KA 4A0XA 3D0SA 1Y56A 1RUOA 4P96A 1Z7LA 5CLSA 2JTVA 2KFDA 2Y75A 1V4RA 3FM5A 4MO7A 2IGOA 3ML6A 5J4VA 2E2IJ 1GUUA 1ON2A 3I64A 5E8IA 4ZYEA 2W25A 5LRSA 2HQRA 4LOCA 4A0YA 1N75A 5D5XB 4AM3A 5FFZA 2QBYB 3BPXA 1LKXA 3BLYA 3WGHA 3I4PA 3WTUC 5LEJA 4A69C 2KMUA 3SZPA 4CZCA 1BC8C 1WHUA 1LVKA 4U0VA 3F6VA 3DCFA 3IH2A 4UV8A 1X2MA 2DDBA 2XPUA 1D8KA 4KIGA 2RQQA 1U8BA 3O3KA 4HYEA 5LGUA 1OR7A 2GAUA 1OMIA 2VE9A 3RYPA 1FPQA 3A02A 1XS9A 2UWMA 3VDXA 1YTYA 1B4AA 2K40A 4CGZA 2G9WA 1HDPA 4HNUA 3JSPA 1R1UA 3AG4H 4LIVA 3DQVC 4UUSA 1J7KA 2DODA 3OYAA 1GVDA 1BN5A 4A5NA 1NG6A 1I27A 1Z0XA 1QGPA 3AFHA 4XKWA 5HOOA 2Y69H 2ZC2A 2P8TA 4HDVA 2EIMH 4XOTA 1QA6A 5LHHA 1FIAA 3E6BA 2LBFA 2BE5F 3KP5A 1ERDA 2M8EA 3R61A 2KISA 2HQ5A 1GV5A 3QPSA 1T2KA 1UELB 1T39A 1U3EM 3L7WA 2VQCA 2D2WA 2DQRA 1IN8A 3JRHA 2V6CA 1F9NA 1JHHA 4GO1A 3IWFA 3CCVI 1JKOC 1DQUA 2I8DA 4YRVA 4RM2A 1OQYA 1U0JA 4B3XA 4LG3A 4XRMA 5KCMA 3JR9A 3E97A 4IF4A 4XKCA 2ZMEB 3MN2A 2KLOA 1FY7A 4RAYA 4MEYF 3J80Z 1R58A 4I76A 2HOEA 2BZTA 3VSKA 5JLXA 1USTA 6PAXA 2KIUA 1OCCH 1V5GA 4EGZA 4N9IA 4E4HA 4AYBN 2W57A 1TWGJ 1JJ6C 1R49A 4A3FJ 3C3WA 2O8XA 1LJ9A 1KONA 2BEOA 2Y0SA 4MGRA 1H9GA 1K79A 3S2WA 2OQGA 2F5DA 3H5AA 1X1CA 5J8CA 2P6TA 2V1NA 2M0MA 5FO5A 4M74A 3HGYA 1QNTA 4ZDLA 1MKMA 3GFIA 1D5VA 3KP6A 1BI2A 5KAIC 4BL0B 3MCZA 3E3VA 5TRDA 4X6AJ 2VKVA 3LA2A 4CA0A 2DBBA 3BC8A 1QRYA 1Y39A 4P5OA 1ETOA 4G12A 4M9SA 2B9SA 2DK5A 5C4JJ 2F5EA 3VYRB 3J7AO 2WV1A 5E3NA 4CSWA 4I09A 4PDKA 2ETHA 3IRRA 1VNDA 4U88A 3OYDA 2WAQN 3BG3A 1YE9A 3OOPA 1SFEA 3WHBA 3CDLA 3QWLA 3PFYA 2DTRA 2PI0A 4HX4A 3P9CA 1A35A 2DU9A 4A93J 3I59B 4BE2A 4JQFA 4BEHB 2MD5A 3BT9A 3L00A 3WGGA 1UG0A 4KISA 1P9QC 2DMUA 3HTUA 2PG4A 1TZLA 4CCNA 3B6CA 1IGNA 4RB2C 1A6QA 4XIDA 4L5IA 3E6MA 5J3LA 1KA8A 2ME6A 2EH3A 2ZSIB 4CXFA 1K6OA 3FBNB 4PGGA 4OIRF 3AL0B 4BY7J 4IHVA 4E7IA 2K85A 1RRJA 4HDUA 1B1BA 2L9RA 5DTDA 4G9YA 2OZ6A 3NRVA 2NS7A 4XOPA 2ID3A 3CLQA 2XKPA 3TBIA 1YI2I 2HVSA 3L9FA 2DOAA 1RNLA 5DV5A 2MC3A 3VYTB 1B9NA 3HGGA 2IVMA 4DW6A 1R1VA 2M34A 3QYEA 4CO8A 3A4CA 2ZJQF 3KP3A 4YFKF 2DA7A 3M4OJ 5CVJA 5F08A 1CGPA 2R7UA 1S3JA 3CJQB 1FJLA 3ZQCA 1BW5A 1RETA 2VQHA 2ZBKA 2PN6A 4L9TA 2R7RA 1IV6A 2M30A 2QLZA 1QZEA 2KIMA 4KT6A 2QEXI 1PP8F 2YPRA 1BIBA 2QKMB 3LSJA 4GDFA 3ULQB 1G59A 2XSJC 1T8IA 1G3YA 1YIOA 2QCOA 1JI8A 2WWYA 2YUSA 3S8PA 4A3KJ 4OMZA 1O3RA 4ZYAA 1QQIA 1BA5A 2BOLA 1R71A 1BI1A 2H8WA 2M45A 2LOOA 5FKKA 1R5GA 2CUJA 3HDDA 1IRGA 1D0YA 4AIJA 2VPLA 2JWTA 4NBQA 1X4OA 2Q2EA 1SD6A 1U78A 1T56A 2BHYA 3IRQA 1JXSA 1U5TB 1U6GA 1W5SA 2F6CA 3PSIA 3I4NJ 1XSDA 2HKXA 1K7AA 4B4CA 4PJNA 1X58A 2K9MA 4PUSA 1JT6A 3FK6A 2H8RA 1ZREA 3V7RA 3CDHA 4S0HB 2OZUA 3WU1B 4L9VA 1Y6IA 5FD6A 2IP2A 2Z3YA 4BXUA 3BR1A 1KGSA 3OYHA 4L0YB 2IS4A 1E3PA 3LQRA 3HYIA 1BI3A 1VTNC 2GQQA 3NARA 3H9QA 5AIPA 4LB6B 2HTSA 5E18F 2JJ7A 4YFXF 5IP7J 3BZCA 1X4PA 3KLNA 3ONQA 2XF6A 5J1YA 2VKDA 2VOPA 2I5UA 1K83J 1ETYA 2HYFA 3FZVA 1R6RA 2COBA 4UUTA 3RJPA 3E1SA 4H0EA 2FRHA 3IV5A 3TGNA 1RUNA 3BTLA 4CYDA 2GM4A 3GFJA 3KE2A 3S1QJ 3ABUA 3I55I 3F8CA 3H0GJ 2EA4A 2MH2A 5J1UA 3TEDA 5CPRB 4A3MJ 4OIQF 4UVAA 3CCEI 4G6TB 1QVUA 2G7HA 2L01A 1S29A 3DEUA 1G3SA 4MTEA 1HDDC 2KDOA 5D6FA 1P2FA 2WY7Q 3WGIA 2V4JC 4V2FA 3BQZA 1H8AC 1P7JA 1G6NA 1P4WA 2CV1A 2MGQA 3FKIJ 2P81A 4PSWA 3F22A 4QTRA 2ISZA 4GXOA 3EUHC 1FBQA 4G8XA 3U2RA 2WB1N 2EA2A 3SEQA 4HBLA 4IJAA 1K78A 2M4GA 2R92J 3HOYJ 2I10A 2WAQA 3MWMA 3FXJA 2GIZA 2F2EA 1T6SA 2XAFA 3DU5A 3H9JA 3VYUB 4BQQA 4EM1A 3PQKA 4RGUA 4X1EA 5H6RA 3ROUA 4YELA 5J8FA 1VQ6I 2EZIA 1IW7F 4AIDA 2D5VA 3FXMA 3TOAA 3WTWC 3WE2A 2HTJA 3P5JA 1W36C 2DA3A 3WTXC 5F64A 2YSRA 4UUSB 1APLC 3F72A 1X3ZB 5D5VB 2NS0A 5E3LA 1Q1HA 4CDGA 2IGMA 2R5YA 1OYWA 5B5EC 4M3GA 5J6XA 5DM6F 1J0RA 2LKSA 3FBIB 1V5EA 4DYCA 4PJJA 2M7AA 2OA4A 2GIVA 3SFZA 3HRMA 4R8HA 4CCLA 1Z91A 2LBFB 2RREA 3OS0A 1FC3A 4LJZF 3H3ZA 3WU0A 3MZYA 3HKZN 3IAS2 3VPRA 4ZDOA 1BBYA 1EKEA 3CP8A 3LL7A 4J01A 4DYRA 3RCOA 1TTYA 2CU7A 3QU3A 3CCRI 2ZXJA 1UCRA 3J81Z 3DV8A 1DP3A 3IAM2 4E70A 4ENKA 2DA4A 3REOA 1DU0A 3G71I 1IN7A 3S17J 4BHPA 2A6EF 5FKOA 3OMYA 2XRLA 4BXXJ 1QPIA 1H89C 1EJ9A 2DXIA 2TCTA 2LNBA 2LY1A 3LWFA 1ZG3A 3K70D 1MMDA 3OL4A 1OCOH 1W5CC 2P5KA 3Q9VA 1KU9A 1WQ2A 3QU6A 4JX5A 2YS9A 2JPCA 4NNJA 3ZMUA 4D9JA 5IOZA 5C3EJ 1ZR4A 1TC3C 3H3VK 1ZQ3P 3SDBA 1FEXA 2JQ7A 4HQMA 2P5VA 1STZA 2XRNA 1WJAA 1LPQA 3GBGA 1SC7A 3KEOA 2XROA 1WJCA 3DLAA 2QZ8A 1LFPA 4KN4X 4D7MA 4W1UA 2UUZA 4ON0A 1FWZA 4L5JA 4HA8A 3L2QA 4OIOF 2EIKH 2KZVA 5BPDA 2BVMA 1DP7P 3M1EA 2XB5A 2G7UA 2J5OA 2X85A 4L5EA 3ELKA 4L9JA 4WXHA 5JVTA 1HQCA 4ITVA 4RA2A 2OJED 5EEHA 4B47A 1NH3A 3ZN1A 2F4IA 3HOVJ 2NVUB 2DA5A 2E5ZA 2PQ8A 2HOTA 2FOWA 2K3FA 3R60A 4BY1J 3TO7A 2E36A 2ZXHA 4Q47A 2JPBA 1UMQA 4A3BJ 3DEWA 4CCKA 1U8RA 2EV6A 4IEJA 1WJDA 4KA4A 3A2KA 4D0PA 2JUGA 3PO2J 4C9YA 3W6JB 1IUFA 1SAUA 5HS9A 2KDZA 1GDTA 1ZLKA 5FRNA 4GFBA 3WHCA 5LGNA 1TLHB 3OR2C 1OYIA 3BP8A 4C3HJ 4FASD 2QUFA 4IRHA 3GTLJ 5FFXA 2ESNA 1D1BA 1HBXG 1NHAA 2CUEA 1FOXA 2VI6A 1VQMI 1YJNI 1VQKI 3WG9A 2IS2A 3BY6A 4Y3OA 5A2QK 1Y1WJ 1B8IA 2M8GX 3OS1A 1EH6A 1NK3P 1K6YA 4PSXA 1EF4A 2QENA 3JAMZ 1YRNA 1ONVA 4BAYA 5EF6A 1B6AA 2X9DA 1CF7B 4ZH4F 4MHGA 3H35A 5DD4A 1U9OA 3O6BB 2NS8A 4RM3A 2EFWA 3PM1A 1BR4A 3KZZA 4RB3C 2ZJRF 1IRFA 2E60A 3PQJA 3R6SA 3ZMVA 3DBRB 3F8FA 3SJMA 5LD2C 1VQPI 1BOBA 4A3JJ 5BMZA 3K4BA 2DJNA 3WODF 2EFPA 1MDMA 3R0AA 1ZG1A 3CO6C 3N4MA 2JT1A 1SAXA 1YOVB 1OPCA 4C2MJ 2OV7A 1IDZA 5BPIA 5CJ9A 1K4TA 3SZGA 3HUGA 2E2JJ 1Y1VJ 3DBLB 4Y52J 2XSDC 4XLAA 1Z3XA 5L3DA 1I6HJ 3CCQI 3HJEA 1JGGA 3HHGA 1KYWA 4RMNA 2LTPA 5M3FJ 1XC5A 2KIQA 2VODA 1ZN2A 2MLGA 3GMEA 2CW7A 2HDCA 1BIAA 2EFQA 3GTQJ 3PJRA 1ZYRF 4BACA 3LNQA 2BBYA 2LMDA 5B66C 2EBIA 4IO9F 3BTIA 2HXOA 3S3OA 3MMYB 1YW8A 1MMAA 2EB7A 4C3IJ 5GP9A 1RR8C 3AG3H 1MD0A 2XAGA 1QVTA 2LG4A 4I0BA 1ULYA 4ABZA 3I53A 4LK0F 3I4MJ 3CC7I 1X3UA 1TW2A 2QSHX 2NNNA 5FD5A 4E6KG 2BGCA 2CUFA 3N05A 3LQQA 2Q2EB 5ERIA 3HKZA 1SD4A 4MQVA 1TBXA 2B63J 2LLKA 2LYCA 2DA2A 1ZRDA 2BW3A 2O0YA 5TISC 5DM7F 3C2HA 3ZMZA 5JR3A 2P7CB 3DP7A 2E35A 1FP1D 2QQ9A 4CCMA 2P0WA 2VPRA 3C1DA 4YIIA 2Y31A 3MQ0A 3LSPA 1ETWA 3OIOA 3D5RC 1R00A 1OISA 5CYVA 3PIPF 4O5VA 4BS9A 1ZRCA 4U7DA 2L9NA 4ENJA 2ELHA 1P6RA 2WAFA 1ITYA 3G3ZA 1D1CA 3GEZA 3AKZA 4RB1A 4I98B 1BI0A 2VJ4A 3OSFA 5F0FA 2X1EA 1E0EA 3MZ8A 3K7AJ 3AL0C 4A3GJ 3BQYA 5JHFA 3A03A 4MLOA 5DDGA 4P55A 4E7ZA 2V26A 1F1ZA 4OOIA 3A01A 4KIFA 4U7BA 2XF5A 2JMWA 1RI7A 5DCMA 1VQOI 1A5JA 3JTHA 1D1AA 4HZFA 3FWEA 1UZCA 2ZXIA 2IT0A 4KN7X 3K0LA 3NAUA 2XAQA 2JA5J 2VC1A 3S93A 2VQLA 1O4XA 2XB0X 3VOEA 4BE0A 5KVRA 5AONA 3ZMSA 2GZWA 2ME0A 2F48A 5IT3A 3SHFA 3GTGJ 4ESJA 2X0LA 2LRDA 2NOJB 3RI4A 5DUIA 1U9NA 2DMTA 1XMXA 1MBHA 4CHUA 2WAEA 1H88C 2V7FA 1PJRA 4I0AA 4ZZDA 5LRRA 1FSEA 2VUMJ 3RDIA 3ZMTA 2CRGA 1K78B 2E34A 2RNJA 3G1LA 4JP0A 3HPHA 3CMEI 2VBYA 3HTSB 1QHGA 4RGXA 2IRFG 1R5ID 1YLFA 1ZGAA 4XKVA 2F4MB 1FIPA 1P4AA 3FXQA 1LEAA 2NVYJ 4EEFG 1RESA 3OWTA 1FBSA 2KJBA 2FBIA 3OYLA 1U5TC 4H4KC 4HEA2 4IQ4A 1VQ5I 1KU3A 2BY1A 1S8NA 3FF5A 5EGOA 1K4SA 4E7LA 2CJJA 2R5YB 1OJLA 3FXOA 3HRTA 1LEBA 3ZP5A 3EYIA 2ZB9A 3MEXA 4N4NB 1XGNA 1XMKA 2EV5A 1TQPA 2KL4A 3EETA 4U0WA 2VB6A 1XCBA 4BBRJ 2PMZN 3OYJA 1XDUA 3KLOA 3CJTB 3QAHA 1KU2A 1ZR2A 4KMUX 2A07F
chains in the Genus database with same CATH topology
3X2QH 1OCZH 1OCCH 1OCRH 5B1BH 5B1AH 3AG1H 3ASNH 5IY5H 1V54H 5B3SH 3ASOH 2EIKH 2DYSH 3WG7H 3AG3H 2EIJH 3AG4H 1V55H 1OCOH 2ZXWH 3ABLH 2Y69H 2EILH 3ABKH 2EIMH 2OCCH 2DYRH 3AG2H 3ABMH 2EINH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X2Q H;  1OCZ H;  1OCC H;  1OCR H;  5B1B H;  5B1A H;  3AG1 H;  3ASN H;  5IY5 H;  1V54 H;  5B3S H;  3ASO H;  2EIK H;  2DYS H;  3WG7 H;  3AG3 H;  2EIJ H;  3AG4 H;  1V55 H;  1OCO H;  2ZXW H;  3ABL H;  2Y69 H;  2EIL H;  3ABK H;  2EIM H;  2OCC H;  2DYR H;  3AG2 H;  3ABM H;  2EIN H; 
#chains in the Genus database with same CATH topology
 2L9V A;  1XPX A;  1XMA A;  4BJ5 C;  4XLF A;  1MH4 A;  3L09 A;  2FU4 A;  1LNW A;  5E1X A;  2ZJ2 A;  4M6X A;  4XLE A;  3FMR A;  1LQ1 A;  1JUS A;  1ZGJ A;  5HLG A;  4A3E J;  3VB2 A;  3CMA I;  3OYG A;  3Q9S A;  2VBZ A;  3N97 A;  2DMP A;  2OU2 A;  3MD2 A;  1ZG5 A;  4ANJ A;  1J09 A;  3E0J B;  4HF1 A;  3OSG A;  1L3L A;  1LFU P;  2IAI A;  4FX4 A;  4QIW N;  3ISP A;  3U21 A;  1RZ4 A;  3M9A A;  2YR2 A;  3WTT C;  4HG2 A;  4I01 A;  3OR1 C;  5HNH A;  3IL2 A;  2IGK A;  2K02 A;  4WF2 A;  3ASN H;  3QOP A;  3LSG A;  4D7N A;  4V19 K;  2QF7 A;  1T33 A;  1W0T A;  2MC4 A;  4Y7N J;  2JA6 J;  4E7S A;  1ZHF A;  2GWR A;  2E2H J;  4II2 A;  3VFZ A;  1X1A A;  1HXD A;  4LFU A;  3KEQ A;  1EH8 A;  4UB6 C;  3FMQ A;  2EFN A;  1LUJ B;  4LD5 A;  2RVC A;  4RAG A;  3OYN A;  2AS5 F;  4HX8 A;  2IA0 A;  3ECO A;  5EG0 A;  3QRF F;  4EAT A;  2K86 A;  1FMW A;  3CCU I;  4Y4R A;  5GAD J;  2B0L A;  5K5Q A;  2R5Z A;  1A6I A;  1HW5 A;  1KQ0 A;  2OCE A;  4NUB A;  2O7O A;  2HOS A;  4KMF A;  1OR7 C;  4RLF A;  3COA C;  2F5C A;  3DXJ F;  2HPM A;  2LH9 A;  2A61 A;  2QM3 A;  3CUQ A;  3NWS A;  3V7C A;  4DOZ A;  1JUP A;  4XKB A;  2OTJ I;  4CCJ A;  1TWC J;  1I1G A;  2PBI A;  3V4G A;  5LLQ A;  4RLQ A;  1USS A;  1PYV A;  1RKW A;  4B8X A;  3B02 A;  3PFI A;  2L7F P;  5HNF A;  2R93 J;  4B09 A;  1AA7 A;  1QZZ A;  3BTJ A;  3BRO A;  3QP5 A;  4HQE A;  3EQL F;  1B8I B;  1IXC A;  2IEK A;  3DU6 A;  4XSZ F;  3W2V A;  2HQA A;  2MYS A;  4DJA A;  1HW2 A;  2ZFU A;  1YRN B;  1FOY A;  3SYT A;  2LF7 A;  5GPA A;  1FTZ A;  1H9T A;  4UUV A;  4JK1 X;  1AKH A;  1FBU A;  3BR2 A;  5CVR A;  1X1P A;  3IWZ A;  3TKY A;  3FDY A;  2QQA A;  4YEJ A;  2VBX A;  2RDP A;  2J5P A;  4IRI A;  3TO6 A;  1D0Z A;  1O7L A;  5H20 A;  4AIH A;  3MKW B;  3IP4 B;  3G73 A;  2L54 A;  4LIU A;  4BHB A;  3BR3 A;  1IO2 A;  3BCB A;  2O61 A;  3I54 A;  2LY2 A;  4ZTF A;  4UNO A;  5L3C A;  1XGO A;  4BBS J;  3HOS A;  1MDM B;  3F23 A;  3IKV A;  3DTE A;  5J47 A;  2MW8 A;  2H94 A;  1Z77 A;  2CQQ A;  5D4R A;  1SEU A;  1XX5 A;  3GUD A;  2Q0O A;  3HUG B;  4LIT A;  5D8L B;  4EJT A;  2X6Y A;  4E7H A;  5GAG J;  4LLL A;  4LG0 A;  4HX7 A;  2L4M A;  2A5Y B;  1FOK A;  1PVE A;  1WFX A;  4I99 C;  2WTE A;  3PNV A;  2NOG A;  2ZFW A;  3ZXS A;  5D8K B;  2R7X A;  2R7V A;  2R7W A;  4BUP A;  1LB2 A;  3G2B A;  2OPT A;  3F6O A;  4OWR B;  5IP6 A;  3OIP A;  3ABK H;  4RBO A;  1ZRF A;  1ZEL A;  5IPA A;  1I50 J;  2DFE A;  4Q4Z F;  2FBH A;  3TQN A;  1FT9 A;  3SDG A;  3S14 J;  1XB4 A;  2PJP A;  2IXS A;  2JVH A;  1PUE E;  4DQ2 A;  3HRU A;  1R22 A;  1X1B A;  2HNH A;  4NB5 A;  2DT6 A;  5GAH J;  2FQ4 A;  1E3O C;  4A3C J;  1TNT A;  1JGS A;  3KP7 A;  2PMZ A;  3CQZ J;  5F27 A;  5IT9 K;  4A3D J;  3QQA A;  4N9H A;  2DFH A;  3HOT A;  1SFK A;  4AVZ A;  1JKP C;  4JBA A;  4HF2 A;  3CES A;  5E1Z B;  2ADU A;  2MFZ A;  3RKY A;  2BW3 B;  2R3S A;  1NTC A;  3S3M A;  1UHW A;  2EZK A;  3UR3 C;  3DLL F;  1B9M A;  3HHH A;  3M07 A;  2C6Y A;  2VE8 A;  3H3U A;  3HXL A;  2L2O A;  3K1N A;  4A0Z A;  2L7M P;  1EH7 A;  3LMM A;  4I2O A;  1ETV A;  1RKT A;  2M4K A;  1YX5 A;  2FEZ A;  2YX4 A;  2NRA C;  2O6G E;  4NDL A;  3LA3 A;  4AIK A;  4CCO A;  3S3N A;  4AWX B;  1HKT A;  2JSC A;  3KZY A;  3RKW A;  4C2T A;  2HOA A;  2WV0 A;  4KT5 C;  4M3D A;  4BE1 A;  4AYB A;  4B3A A;  2DT7 B;  4YG2 F;  2X6X A;  3E7L A;  2H6B A;  3DWL E;  4QPO A;  3F8N A;  3OYM A;  4NQW A;  3LAP A;  2CGP A;  1O7F A;  2H6C A;  5BNG A;  4RAZ A;  3A01 B;  4G94 A;  3JRB A;  2KT0 A;  5DCM B;  2JA2 A;  4BJ6 C;  2DK8 A;  2K9L A;  5EEA A;  1MJ9 A;  4L0Z B;  3RQ4 A;  1S7E A;  2L7Z A;  1N77 A;  2B7E A;  1NG7 A;  4OU0 A;  5J4Y A;  3HRS A;  4F91 B;  3GLL A;  2E1O A;  5D5U B;  3OYE A;  2M7B A;  2KRC A;  4RAF A;  2NXN B;  4XSX F;  2X48 A;  3PO3 J;  4UXN A;  3KPH A;  3ERM A;  3TDU C;  5ILV A;  4DBR A;  1G8X A;  4RS8 A;  5H2F C;  1YJ9 I;  2GA1 A;  2CO5 A;  3G1M A;  4ZTJ A;  1K61 A;  2JA7 J;  2E7W A;  1JTX A;  3OOU A;  1TNS A;  2RV8 A;  4GRI A;  3S32 A;  2K4J A;  5K1Y A;  1IG7 A;  5ICE A;  2DQL A;  3GZ6 A;  2IA1 A;  1GXP A;  5HLT A;  1D0X A;  4EM2 A;  2QA4 I;  4UHT A;  1O3S A;  1HKQ A;  2PFB A;  1BW6 A;  4XIC A;  2L0K A;  2XGD A;  2FML A;  2N8G A;  3NEU A;  1BR1 A;  4FE7 A;  2K3P A;  1GXQ A;  2W24 A;  1FMV A;  5HDG A;  1RPW A;  1R7J A;  2W85 A;  2GOX B;  4HV6 A;  1MND A;  3BWG A;  2VLA A;  3QPT A;  4DBQ A;  2IBD A;  2CWE A;  3FIW A;  2ACJ A;  1B72 A;  4E7J A;  1YFH A;  3W2A A;  4PJM A;  4ZYG A;  2M2E A;  1IUY A;  1ON1 A;  3WTY C;  3GWZ A;  1YJW I;  4IL6 C;  2HEO A;  2ECB A;  3BG9 A;  3K2Z A;  3CMY A;  3GO5 A;  2KPM A;  1O3T A;  2Y2Z A;  2NYX A;  2EIJ H;  3Q0U A;  3MKL A;  3GVA A;  3DPU A;  5E20 A;  3KP2 A;  1OYY A;  2XPV A;  5FGM A;  4IRG A;  2X51 A;  1Z9C A;  2TRT A;  1WZ2 A;  2ZSH B;  3BR0 A;  1W7P D;  3BR6 A;  1SFX A;  1VF9 A;  3H5R A;  3HB9 A;  3L2R A;  1G2H A;  1IV8 A;  4LK1 F;  4HLX A;  4CYC A;  3CC2 I;  2DO7 A;  1UHM A;  3BG5 A;  4G7O F;  2EIN H;  2HYJ A;  1SD5 A;  2ZO4 A;  3S15 J;  1I3A A;  4PJ0 C;  2BXZ A;  3BJ6 A;  2LF8 A;  1ZLJ A;  4I02 A;  4HRI A;  3VSL A;  3K4M A;  1REP C;  1J59 A;  2ECC A;  4HW0 A;  3UKG A;  2A5W A;  1EV7 A;  4PJL A;  2AQF A;  1L0O C;  2K27 A;  2COM A;  3H36 A;  2E1C A;  2Z1D A;  1KZH A;  2LSO A;  1WJE A;  4M72 A;  3A1Y A;  3IC7 A;  3ERE D;  1TT0 A;  2LY9 A;  3BCA A;  2QWW A;  1YIJ I;  2QYO A;  3EUA A;  1D3Y A;  3BJO A;  3JRA A;  2V1U A;  1V54 H;  1S7A A;  3MFK A;  2VBW A;  2L7K A;  1TT5 B;  1UG2 A;  3O8G A;  4ZDP A;  3LFK A;  3GCM A;  4XM3 A;  4CH7 A;  5KHD A;  4AC0 A;  5EG0 B;  2EWN A;  3ZPL A;  2YX7 A;  1BOA A;  4C30 A;  4S05 A;  2GLO A;  1R23 A;  4BHC A;  2K4B A;  2D1V A;  3CMM A;  2VJI A;  5F0H A;  4J19 A;  2DPU A;  4EJW A;  1VQ8 I;  1GV2 A;  2AHQ A;  4LLG F;  1MMN A;  2KZG A;  4FCY A;  1WGX A;  2R5Z B;  3RIR A;  3C2G A;  3NWT A;  1P4X A;  3I3L A;  4IVN A;  3HPG A;  3HOU J;  2UXN A;  3CLO A;  4EMS A;  1FTT A;  4PFP A;  2O5R A;  4OAZ A;  2E1N A;  2DOF A;  2MBF A;  3W3C A;  3CO7 C;  5E8G A;  4M3B A;  3SZT A;  4XN0 A;  4BGD A;  3PUF A;  3ZQ7 A;  4BQO A;  1JKQ C;  1WKM A;  1VZ0 A;  3ZRG A;  9ANT A;  3D5L A;  2ISY A;  2F5F A;  2BV6 A;  3F8B A;  2ZJP F;  2L02 A;  2L3D A;  3K6G A;  3WE3 A;  3GW2 A;  3K1P A;  4HLY A;  1F4K A;  2W82 A;  3GTP J;  5IYB J;  1DUX C;  1J9I A;  2M87 A;  1UB9 A;  4Z2Y A;  4M73 A;  4ENM A;  1XSV A;  4CIC A;  1JJ8 C;  2RAE A;  3M1C A;  5K7H A;  1MGT A;  4JX6 A;  1YQA A;  2OTL I;  1W7P A;  3GF2 A;  2FNA A;  1E17 A;  2AXT C;  2EK5 A;  4KJZ A;  5D6E A;  1OKR A;  1R1T A;  1JT0 A;  1HW1 A;  1TP4 A;  2RN7 A;  5J1R A;  3OV8 A;  1IAW A;  1SD7 A;  3GYH X;  5GTH C;  3HIF A;  1DGR M;  2VXZ A;  1SFU A;  4DNC A;  3U1D A;  5JI6 A;  5LHG A;  2QSF X;  3KZI C;  4BU2 A;  3M7G A;  3S1R J;  1R4N B;  2Z16 A;  1T0F A;  2OF7 A;  1YS7 A;  1LDJ A;  3CCJ I;  1BJA A;  2V79 A;  3EUK L;  3LSI A;  2VQG A;  1HA8 A;  4ZYD A;  4L9N A;  2CSO A;  1Z05 A;  3DTI A;  2HZD A;  4RGS A;  2O8K A;  2PEX A;  1SMT A;  4ZC3 A;  3CCL I;  4LG0 B;  1DGW Y;  2HYG D;  5GTI C;  2FA5 A;  2WB1 A;  3DEE A;  5L3B A;  5DD8 A;  2VL8 A;  1QHH D;  3E5X A;  3OIQ A;  3LSH A;  1OCT C;  1A04 A;  2DOE A;  3WTZ A;  2LC2 A;  2Y9Y A;  3AG2 H;  2W1O A;  2WA0 A;  3T8T A;  4RGR A;  3ZMD A;  1IN5 A;  3U9G A;  1IXS B;  5M5X J;  4MNU A;  4WX9 A;  3FIS A;  1T38 A;  3LST A;  3VYS B;  2XC7 A;  2BXY A;  4W97 A;  4OAY A;  4L18 B;  2CQX A;  1GHC A;  4M9X A;  1BC7 C;  4IX7 A;  4KUM A;  3F9K A;  3T5X A;  2NAZ A;  5HS8 A;  3MVP A;  2HVR A;  2YU3 A;  1SVL A;  1HLV A;  4M3E A;  2Z33 A;  3RKX A;  1YYV A;  1W5T A;  2FE3 A;  2FSW A;  2KKO A;  1FYK A;  2EV0 A;  4KIT B;  1TWF J;  3DKY A;  2E19 A;  1X19 A;  4XLP F;  4EJV A;  4BQA A;  1MMG A;  1I39 A;  4R1H A;  4NHJ A;  5IY5 H;  3QYF A;  2R7F A;  1VQL I;  2G0E A;  4A6D A;  2QQB A;  4HPQ A;  1WI9 A;  4WXD A;  3R0J A;  1V3F A;  2Y0S N;  4QSH A;  4Z6Y A;  1PUF A;  3W6V A;  5IOY A;  2R7D A;  1IXR C;  1W0U A;  1Z21 A;  3FX3 A;  2LRE A;  3KYC B;  3PNT A;  4MTD A;  1CQT A;  1MSE C;  2V9P A;  2FMY A;  3GTK J;  2X1D A;  2STW A;  1TW3 A;  3OL3 A;  2D1H A;  5GPC A;  1FNN A;  1WJ5 A;  1J5Y A;  2K5C A;  2DN0 A;  3IUO A;  2W00 A;  1ETQ A;  3BDD A;  2GA2 A;  1WJF A;  3DKX A;  4BQN A;  4K2E A;  4IXA A;  3F8M A;  1MSF C;  4IHT A;  5EZG A;  4FE4 A;  3Q0W A;  2JA8 J;  3GZ5 A;  1YG2 A;  2TDX A;  3GLX A;  2FXA A;  4JOM A;  3RPU D;  4BDY A;  3KET A;  2CV0 A;  3VWB A;  2CW8 A;  1I6X A;  2HS5 A;  5DUK A;  5LEK A;  4NQW B;  3ZN0 A;  2M5W A;  3K70 C;  3RZO J;  3VEP A;  1S5L C;  4ASN A;  1SAN A;  4R79 A;  4J00 A;  2E5N A;  2QVO A;  2A6H F;  1ODD A;  2UV1 A;  5IP9 J;  2DFI A;  1YIT I;  1N25 A;  3A0H C;  5ILS A;  1XSX A;  2M1B A;  1GLN A;  2XAU A;  5DEQ A;  3CD6 I;  1MH3 A;  2QKL B;  1I1S A;  1FX7 A;  1Z1D A;  2P7V B;  3PL8 A;  1VFC A;  2DLL A;  2RNG A;  5FRO A;  2K9Q A;  5K7F A;  1POG A;  3MAJ A;  4JX4 A;  4QPQ A;  2JN6 A;  4TV7 A;  5CVV A;  4JYK A;  2BHZ A;  4V2G A;  2R0Q C;  4AVP A;  2RKH A;  2W4S A;  2FD5 A;  2XPW A;  2VKH A;  1UFM A;  3IH3 A;  1GVJ A;  2ELJ A;  3P9I A;  5CVU A;  3M8F A;  1R4M B;  3JW4 A;  2HPI A;  2W48 A;  1MBJ A;  1TQI A;  1I5Z A;  4QWQ A;  1S9H A;  1UHS A;  2CFX A;  5F1R A;  2CUZ A;  2E7X A;  3WTS C;  1JKR C;  1IRX A;  3S16 J;  1HC8 A;  3JRI A;  2OQR A;  2MLK A;  2QGU A;  3K4K A;  3J7A Y;  3VOD A;  2LR8 A;  2OAZ A;  2L9S A;  4PGH A;  1ACI A;  3KYD B;  2IPQ X;  3K4L A;  3GTJ J;  1B72 B;  3LA7 A;  4FX0 A;  1KU7 A;  5FKN A;  2XGE A;  2P5L C;  1HCR A;  2P4W A;  3KIO A;  5M5W J;  1SFO J;  1OCR H;  3W6K B;  3I56 I;  3V7S A;  1AWC A;  3V42 A;  1X3W B;  2CV2 A;  4FHT A;  5F6F A;  5IYD J;  4M71 A;  4CYC B;  1SVM A;  1MJB A;  4EJO A;  4QLC U;  3DBH B;  3G1O A;  3HEF A;  3HSR A;  3U1K A;  3WTV C;  3RPU A;  4A12 A;  2RQP A;  3RYR A;  3KEY A;  1WRJ A;  3JRF A;  1JE8 A;  1H0M A;  4ZJZ A;  2O03 A;  2H1K A;  2Y30 A;  3LSK A;  3L1P A;  4WK8 F;  4HNV A;  2PMH A;  3EPZ A;  2JSP A;  4GCV A;  1IN4 A;  1PP7 U;  1LDK B;  4EGY A;  5E3O A;  1ZGW A;  1V55 H;  3GX4 X;  2GXG A;  2EQR A;  3P9K A;  2DPD A;  5K5O A;  3S2D J;  2R7T A;  3C2B A;  5A2Q Z;  1KYZ A;  3I58 A;  1C0W A;  2LD5 A;  1HOM A;  5EZH A;  2EPF A;  2M9H A;  1BL0 A;  2BYV E;  5TGT A;  1SVO A;  4MIM A;  2Y0M A;  1QZY A;  4F7Z A;  2LKX A;  3RSN A;  3Q5F A;  3RZD J;  4IPA A;  4GGG A;  4LMY A;  3G6E I;  3X2Q H;  1WVR A;  4IQJ A;  5CVI A;  5C4X J;  3H92 A;  2WY8 Q;  3GFL A;  3IHU A;  2XKO A;  4FIS A;  1V5F A;  1T98 A;  4O6J A;  2GOM A;  5F0C A;  3OY9 A;  3HSE A;  2XUB A;  4F3Q A;  3BZ6 A;  5GAE J;  3JRD A;  3Q3S A;  4ZZL A;  4B43 A;  2PMU A;  3W2W A;  1IJW C;  2JK3 A;  1QBJ A;  2OBP A;  2FUG 2;  3E5Q A;  5HDK A;  3LOC A;  3MKY B;  1HF0 A;  4I6Z A;  5LGT A;  2V1D A;  2R7S A;  3LSM A;  4BH9 A;  3CUO A;  5HLI A;  2FF4 A;  4NC6 A;  3DF8 A;  4XRF A;  4N0B A;  1YHQ I;  4GYG A;  3JCU C;  3J81 K;  3CP2 A;  3J7Y J;  3QOE A;  3MKZ A;  4Y17 A;  4DGW B;  2VON A;  3KP4 A;  3I9V 2;  4FT8 A;  2LKP A;  3TW7 A;  4Y15 A;  2E1M B;  2ZXW H;  3K2A A;  1IC8 A;  2HR3 A;  2NNY A;  3FXK A;  4PK4 A;  3A0B C;  2DCE A;  1TWH J;  1W7P B;  2V1X A;  2A3S A;  1ZH5 A;  2PX9 A;  4A5M A;  4F52 A;  3GTM J;  1VI0 A;  2O9L A;  2HVQ A;  1W36 D;  2VOO A;  2WC2 A;  3K4N A;  4HOB A;  2HU9 A;  3G4S I;  3L2C A;  2EFO A;  2R7Z J;  5E1W A;  1VQ9 I;  2W7N A;  3DFG A;  2DMQ A;  2LK2 A;  2ZNY A;  1Y8R B;  1WH5 A;  3CDI A;  1R9T J;  2Q1Z B;  3ZQL A;  2WBM A;  2V6E A;  3ZQI A;  1CF7 A;  1QO0 D;  2Z99 A;  3BR5 A;  4XR6 A;  3Q0V A;  1G4D A;  2MH9 A;  1P7I A;  3DPL C;  4DIQ A;  4LB5 A;  2RGV A;  2XHK A;  3TO9 A;  5K5R A;  3FXU A;  2VJJ A;  3ESW B;  3CC4 I;  2XV4 S;  5FJ8 J;  5LBQ A;  4F93 B;  1Z6T A;  2H1L A;  5ICF A;  1QU3 A;  4II3 A;  2BY3 A;  4MEX F;  2DW4 A;  3I5U A;  5FKM A;  4XLH A;  2AXL A;  2A69 F;  3BOQ A;  4EJU A;  2PLY A;  1T08 B;  5HOD A;  3M8E A;  2DYR H;  3FK7 A;  2HFH A;  1NK2 P;  3CCY A;  3LFU A;  2JRM A;  2BY2 A;  4XLN F;  1LE8 A;  5B1B H;  5ICC A;  5CKT A;  1MNM C;  4P9U A;  1ZTR A;  3CUQ C;  5ILU A;  2DYS H;  2Y9Z A;  2DT5 A;  3T1B A;  2KQR A;  1X2N A;  4XRS G;  4M3F A;  1R5H A;  3JAM K;  2PJR A;  3ZQG A;  3E5U A;  4HST A;  4AU7 A;  1XN7 A;  2DFF A;  1E3H A;  2DA1 A;  1HST A;  3EUH A;  3IKT A;  2VT3 A;  1XGM A;  5EDN A;  3KFW X;  1WSU A;  2HI3 A;  1ZAR A;  1PUF B;  2CQN A;  1MZB A;  1FZP B;  2ZCW A;  5BS6 A;  2W84 A;  1KQ9 A;  4BKX A;  2CYY A;  4GYI A;  4WCG A;  2IA2 A;  4AUX A;  4UVC A;  1FYL A;  1BR2 A;  1S72 I;  3BG7 A;  3DKW A;  1ZKG A;  2CQ7 A;  1MJA A;  1FYM A;  4YIR X;  4DZJ A;  1G3W A;  1F36 A;  1AU7 A;  3SQN A;  1WPK A;  3HOZ J;  5TJJ A;  3ZQF A;  2ID6 A;  4IKF A;  2DI3 A;  1MBE A;  4ETS A;  2CW0 F;  3CTA A;  2NVX J;  3EYY A;  2LFB A;  2LDU A;  5LHI A;  4KNY A;  3JRG A;  1W4M A;  2MA3 A;  1MNE A;  3PNY A;  4EM0 B;  1O57 A;  5DYM A;  3E6C C;  1OCZ H;  1YO5 C;  3CCM I;  3GTO J;  3BG6 A;  5DCF A;  5HDN A;  2XDV A;  3BPV A;  3SFI A;  3OS2 A;  1FP2 A;  3RPQ A;  2DTZ A;  4RDU A;  4NC8 A;  2IGN A;  3K69 A;  1ZAO A;  4LGW A;  5BOX A;  4IOA F;  2EIL H;  1I3Q J;  1MBK A;  1OCP A;  3E6D A;  4HAM A;  1UJ8 A;  3K9T A;  3O8H A;  4XL9 A;  5ICG A;  3SEZ A;  2FQ3 A;  3L2W A;  3OYB A;  1BJZ A;  3F0C A;  2JZY A;  3CJR B;  4P9F A;  3FHN A;  4C3J J;  4G7H F;  1Z6R A;  2MAB A;  3KYL A;  4I7H A;  5FLX K;  2VJ5 A;  2OD5 A;  1TWA J;  1FSH A;  4KIB A;  1AHD P;  4HSR A;  5JHU A;  2HXI A;  3KX2 A;  4S04 A;  3F21 A;  3SXY A;  4XRS A;  2XGC A;  2IS1 A;  2BVL A;  3B73 A;  3OYI A;  1WWX A;  1SMY F;  1T95 A;  1Y0N A;  5CQG A;  2FNP A;  4Q5S F;  2UXX A;  2VXD A;  2OCC H;  1A31 A;  2LVS A;  4E7K A;  4EQQ A;  5EGO B;  4IHY A;  1JTY A;  2QBY A;  5E17 F;  2HZT A;  1RR7 A;  4Q48 A;  1FLI A;  3PUB A;  3T8R A;  4MFE A;  4LLN A;  1WJB A;  2H09 A;  3QOD A;  1P92 A;  4A3L J;  3D1N I;  1D8J A;  3M8J A;  1WI3 A;  2CG4 A;  1OFC X;  5FLV A;  4IHS A;  1F43 A;  1G3T A;  3D5S C;  1XD7 A;  4MFD A;  5HLH A;  1E2X A;  1IF1 A;  3V8L A;  1VQ4 I;  2X4H A;  1ORK A;  3TP0 A;  4WWC A;  4D5F A;  3QP6 A;  1JUM A;  1LFB A;  3FXL A;  3B6A A;  4XMY A;  4X0G A;  1IZ1 A;  3H0D A;  1DU6 A;  3TP3 A;  2EJR A;  1ENH A;  2Z5U A;  3TOB A;  3HL2 A;  4YFN F;  3OYC A;  2CH0 A;  5EEG A;  2XAJ A;  2NVT J;  2D45 A;  3H5N A;  3JRC A;  2X6W A;  2NVQ J;  4FTH A;  4U0Y A;  2JUC A;  5D4S A;  3ZR8 X;  5L3F A;  5JLW A;  5FB2 A;  1TL8 A;  3RQI A;  4IOC F;  2WAD A;  1MMS A;  2V9V A;  5JFR A;  2Z9O A;  4ENN A;  1ZK8 A;  1Z67 A;  2XAH A;  4M6V A;  2R4G A;  2IJL A;  5ED4 A;  4PCQ A;  5K7Z A;  2X1C A;  2VT2 A;  1WH7 A;  2HDW A;  2VN2 A;  3HC7 A;  2H27 A;  2LP0 A;  5HVQ C;  2L5Q A;  2O3F A;  2MD0 A;  2P6S A;  2M3A A;  2Q8K A;  2DA6 A;  3BJA A;  3EDP A;  4OIN F;  3L2V A;  2ZME A;  1LVA A;  4A2U A;  4RB0 A;  2GXA A;  3GXO A;  3FXR A;  2DJI A;  2XF7 A;  2Z2S B;  4B1R A;  2OC6 A;  1S7O A;  3I71 A;  2KRF A;  4U87 A;  3TMO A;  1M1E B;  4BYY A;  1YX3 A;  2IW5 A;  2ESH A;  2VAS A;  1AOY A;  2KP6 A;  2CMP A;  3FMS A;  3IH4 A;  2K9N A;  5CQE A;  3FM3 A;  5AIQ A;  4IHX A;  1YW7 A;  5E79 C;  4XN3 A;  5B3S H;  3ASO H;  1DDN A;  4UV9 A;  3CUQ B;  1Y8Q B;  3JSO A;  1MW7 A;  3GZN B;  2CS3 A;  3HSF A;  5HS7 A;  2CQK A;  3WU2 C;  4OMY A;  4NC7 A;  3M3Y J;  2VKE A;  2HKO A;  2FX0 A;  2HGC A;  2XIG A;  1IN6 A;  3CJN A;  3JTG A;  2AO9 A;  2CFO A;  5F04 A;  4OIP F;  1X1D A;  3HG9 A;  2GXB A;  4XOR A;  4G6D A;  2AQE A;  2Y48 A;  4ESB A;  1W1W E;  2L4A A;  3H9G A;  3K10 A;  3TL4 X;  4Y13 A;  4N4O B;  3CCS I;  3MZH A;  2KRH A;  2OUM A;  1S6L A;  1MBG A;  2K9S A;  1AKH B;  1IDY A;  5LFA A;  3ZCO A;  3J80 K;  1TQM A;  3I0T A;  2XAS A;  5M5Y J;  3HOX J;  1R36 A;  4UVB A;  3BTC A;  3PSF A;  3H1C A;  2A6T A;  4FET A;  4MQ9 F;  3ZQH A;  4EV0 A;  2STT A;  4O3M A;  1GT0 C;  2FOK A;  1QPM A;  3CZ6 A;  2FBK A;  2IS6 A;  2A05 A;  4XNF A;  2UZK A;  4XBF A;  5IT9 Z;  2JVG A;  3UNG C;  3I59 A;  4UB8 C;  4F92 B;  3DTK A;  3HZJ A;  3FHZ A;  1FOW A;  2VIX A;  4BEH A;  5L3G A;  3J7Z I;  4KIC A;  1DPU A;  4HNT A;  1O3Q A;  3HM5 A;  3AG1 H;  3S2H J;  2RC4 A;  3AAF A;  5M3M J;  1LDD A;  4D5C A;  4G6Q A;  2XVC A;  3GFM A;  3PIO F;  1Z3Y A;  5F1J A;  3ZQQ A;  5IYC J;  1MBF A;  1XG1 A;  4B48 A;  3TDZ C;  5FRM A;  5H6Q A;  1F5T A;  1MIJ A;  2F5V A;  1RIO H;  3S1M J;  5EJC A;  5J40 A;  4PFO A;  3C18 A;  2ZME C;  3HOW J;  4B44 A;  3BZK A;  2M0C A;  1XDS A;  4M6Y A;  3QPL A;  3L2U A;  5BQT A;  3RTR A;  1EA3 A;  4PZJ A;  4C2U A;  2QQ8 A;  3K1M A;  3O2P E;  2MG4 A;  2XGX A;  3NQO A;  2DAO A;  4BJT A;  4D1Q A;  3QYB A;  5FKL A;  4DYQ A;  4XQF A;  2K7L A;  2EZL A;  2ZKZ A;  2HQN A;  1LE8 B;  4UY8 I;  4HF0 A;  4P1W A;  5EYR A;  4XLC A;  2DMN A;  4A6E A;  5L3E A;  3JRE A;  3DPT A;  1J75 A;  2PJR B;  1RC9 A;  4A3I J;  3ABM H;  1Z7U A;  1VQN I;  2KJC A;  2A68 F;  3OYF A;  1YW9 A;  2QSG X;  1J2X A;  2GBY A;  2HWV A;  1U2W A;  3WG7 H;  1VQ7 I;  3HBL A;  5C44 J;  2ICW G;  5KAF C;  3R4K A;  5FLM J;  2E1M C;  2E71 A;  3F3X A;  4M9Z A;  1XCV A;  4IZZ A;  1ETX A;  3ABL H;  3ABT A;  5KK1 A;  5JVG F;  3LSR A;  4BDZ A;  3C7J A;  3T0Y A;  4YIF A;  4IHW A;  1KQ8 A;  4FQG A;  1OLT A;  1U5T A;  4HV5 A;  1PDN C;  4EVI A;  5FLX Z;  1YS6 A;  1XTA A;  2VC0 A;  5B1A H;  2YU9 J;  1DPR A;  3ECH A;  1IRZ A;  1B59 A;  4XK4 A;  3S1N J;  1Q1V A;  2DDA A;  3KCC A;  3QPH A;  2X6O A;  3K4C A;  2FJ1 A;  1HSJ A;  1T0F C;  3RKQ A;  2JRT A;  3TW6 A;  5D5W B;  1N78 A;  4Y33 A;  2HDD A;  1JHF A;  3ZGK A;  4KDP A;  3CF2 A;  2R7Q A;  3K4J A;  3P7N A;  4DZP A;  2R7O A;  5KNL A;  2ELK A;  3V8J A;  2KHM A;  2KIF A;  1ETK A;  2F4O B;  5DS9 A;  3ZOB A;  4CUG A;  4G7Z F;  3LAJ A;  2V9K A;  1WCM J;  3FKJ A;  4KFC A;  1UAA A;  1BM9 A;  1Y0U A;  4ZYH A;  4CZZ A;  5E3M A;  2EZH A;  2MSY A;  1A36 A;  4XON A;  4WXC A;  4AD9 A;  2ZNZ A;  4BXF A;  4F55 A;  1XGS A;  2BY0 A;  4BNC A;  1HKS A;  3OYK A;  4KYW A;  3CF5 F;  4ESF A;  1D5Y A;  3V8K A;  4A0X A;  3D0S A;  1Y56 A;  1RUO A;  4P96 A;  1Z7L A;  5CLS A;  2JTV A;  2KFD A;  2Y75 A;  1V4R A;  3FM5 A;  4MO7 A;  2IGO A;  3ML6 A;  5J4V A;  2E2I J;  1GUU A;  1ON2 A;  3I64 A;  5E8I A;  4ZYE A;  2W25 A;  5LRS A;  2HQR A;  4LOC A;  4A0Y A;  1N75 A;  5D5X B;  4AM3 A;  5FFZ A;  2QBY B;  3BPX A;  1LKX A;  3BLY A;  3WGH A;  3I4P A;  3WTU C;  5LEJ A;  4A69 C;  2KMU A;  3SZP A;  4CZC A;  1BC8 C;  1WHU A;  1LVK A;  4U0V A;  3F6V A;  3DCF A;  3IH2 A;  4UV8 A;  1X2M A;  2DDB A;  2XPU A;  1D8K A;  4KIG A;  2RQQ A;  1U8B A;  3O3K A;  4HYE A;  5LGU A;  1OR7 A;  2GAU A;  1OMI A;  2VE9 A;  3RYP A;  1FPQ A;  3A02 A;  1XS9 A;  2UWM A;  3VDX A;  1YTY A;  1B4A A;  2K40 A;  4CGZ A;  2G9W A;  1HDP A;  4HNU A;  3JSP A;  1R1U A;  3AG4 H;  4LIV A;  3DQV C;  4UUS A;  1J7K A;  2DOD A;  3OYA A;  1GVD A;  1BN5 A;  4A5N A;  1NG6 A;  1I27 A;  1Z0X A;  1QGP A;  3AFH A;  4XKW A;  5HOO A;  2Y69 H;  2ZC2 A;  2P8T A;  4HDV A;  2EIM H;  4XOT A;  1QA6 A;  5LHH A;  1FIA A;  3E6B A;  2LBF A;  2BE5 F;  3KP5 A;  1ERD A;  2M8E A;  3R61 A;  2KIS A;  2HQ5 A;  1GV5 A;  3QPS A;  1T2K A;  1UEL B;  1T39 A;  1U3E M;  3L7W A;  2VQC A;  2D2W A;  2DQR A;  1IN8 A;  3JRH A;  2V6C A;  1F9N A;  1JHH A;  4GO1 A;  3IWF A;  3CCV I;  1JKO C;  1DQU A;  2I8D A;  4YRV A;  4RM2 A;  1OQY A;  1U0J A;  4B3X A;  4LG3 A;  4XRM A;  5KCM A;  3JR9 A;  3E97 A;  4IF4 A;  4XKC A;  2ZME B;  3MN2 A;  2KLO A;  1FY7 A;  4RAY A;  4MEY F;  3J80 Z;  1R58 A;  4I76 A;  2HOE A;  2BZT A;  3VSK A;  5JLX A;  1UST A;  6PAX A;  2KIU A;  1OCC H;  1V5G A;  4EGZ A;  4N9I A;  4E4H A;  4AYB N;  2W57 A;  1TWG J;  1JJ6 C;  1R49 A;  4A3F J;  3C3W A;  2O8X A;  1LJ9 A;  1KON A;  2BEO A;  2Y0S A;  4MGR A;  1H9G A;  1K79 A;  3S2W A;  2OQG A;  2F5D A;  3H5A A;  1X1C A;  5J8C A;  2P6T A;  2V1N A;  2M0M A;  5FO5 A;  4M74 A;  3HGY A;  1QNT A;  4ZDL A;  1MKM A;  3GFI A;  1D5V A;  3KP6 A;  1BI2 A;  5KAI C;  4BL0 B;  3MCZ A;  3E3V A;  5TRD A;  4X6A J;  2VKV A;  3LA2 A;  4CA0 A;  2DBB A;  3BC8 A;  1QRY A;  1Y39 A;  4P5O A;  1ETO A;  4G12 A;  4M9S A;  2B9S A;  2DK5 A;  5C4J J;  2F5E A;  3VYR B;  3J7A O;  2WV1 A;  5E3N A;  4CSW A;  4I09 A;  4PDK A;  2ETH A;  3IRR A;  1VND A;  4U88 A;  3OYD A;  2WAQ N;  3BG3 A;  1YE9 A;  3OOP A;  1SFE A;  3WHB A;  3CDL A;  3QWL A;  3PFY A;  2DTR A;  2PI0 A;  4HX4 A;  3P9C A;  1A35 A;  2DU9 A;  4A93 J;  3I59 B;  4BE2 A;  4JQF A;  4BEH B;  2MD5 A;  3BT9 A;  3L00 A;  3WGG A;  1UG0 A;  4KIS A;  1P9Q C;  2DMU A;  3HTU A;  2PG4 A;  1TZL A;  4CCN A;  3B6C A;  1IGN A;  4RB2 C;  1A6Q A;  4XID A;  4L5I A;  3E6M A;  5J3L A;  1KA8 A;  2ME6 A;  2EH3 A;  2ZSI B;  4CXF A;  1K6O A;  3FBN B;  4PGG A;  4OIR F;  3AL0 B;  4BY7 J;  4IHV A;  4E7I A;  2K85 A;  1RRJ A;  4HDU A;  1B1B A;  2L9R A;  5DTD A;  4G9Y A;  2OZ6 A;  3NRV A;  2NS7 A;  4XOP A;  2ID3 A;  3CLQ A;  2XKP A;  3TBI A;  1YI2 I;  2HVS A;  3L9F A;  2DOA A;  1RNL A;  5DV5 A;  2MC3 A;  3VYT B;  1B9N A;  3HGG A;  2IVM A;  4DW6 A;  1R1V A;  2M34 A;  3QYE A;  4CO8 A;  3A4C A;  2ZJQ F;  3KP3 A;  4YFK F;  2DA7 A;  3M4O J;  5CVJ A;  5F08 A;  1CGP A;  2R7U A;  1S3J A;  3CJQ B;  1FJL A;  3ZQC A;  1BW5 A;  1RET A;  2VQH A;  2ZBK A;  2PN6 A;  4L9T A;  2R7R A;  1IV6 A;  2M30 A;  2QLZ A;  1QZE A;  2KIM A;  4KT6 A;  2QEX I;  1PP8 F;  2YPR A;  1BIB A;  2QKM B;  3LSJ A;  4GDF A;  3ULQ B;  1G59 A;  2XSJ C;  1T8I A;  1G3Y A;  1YIO A;  2QCO A;  1JI8 A;  2WWY A;  2YUS A;  3S8P A;  4A3K J;  4OMZ A;  1O3R A;  4ZYA A;  1QQI A;  1BA5 A;  2BOL A;  1R71 A;  1BI1 A;  2H8W A;  2M45 A;  2LOO A;  5FKK A;  1R5G A;  2CUJ A;  3HDD A;  1IRG A;  1D0Y A;  4AIJ A;  2VPL A;  2JWT A;  4NBQ A;  1X4O A;  2Q2E A;  1SD6 A;  1U78 A;  1T56 A;  2BHY A;  3IRQ A;  1JXS A;  1U5T B;  1U6G A;  1W5S A;  2F6C A;  3PSI A;  3I4N J;  1XSD A;  2HKX A;  1K7A A;  4B4C A;  4PJN A;  1X58 A;  2K9M A;  4PUS A;  1JT6 A;  3FK6 A;  2H8R A;  1ZRE A;  3V7R A;  3CDH A;  4S0H B;  2OZU A;  3WU1 B;  4L9V A;  1Y6I A;  5FD6 A;  2IP2 A;  2Z3Y A;  4BXU A;  3BR1 A;  1KGS A;  3OYH A;  4L0Y B;  2IS4 A;  1E3P A;  3LQR A;  3HYI A;  1BI3 A;  1VTN C;  2GQQ A;  3NAR A;  3H9Q A;  5AIP A;  4LB6 B;  2HTS A;  5E18 F;  2JJ7 A;  4YFX F;  5IP7 J;  3BZC A;  1X4P A;  3KLN A;  3ONQ A;  2XF6 A;  5J1Y A;  2VKD A;  2VOP A;  2I5U A;  1K83 J;  1ETY A;  2HYF A;  3FZV A;  1R6R A;  2COB A;  4UUT A;  3RJP A;  3E1S A;  4H0E A;  2FRH A;  3IV5 A;  3TGN A;  1RUN A;  3BTL A;  4CYD A;  2GM4 A;  3GFJ A;  3KE2 A;  3S1Q J;  3ABU A;  3I55 I;  3F8C A;  3H0G J;  2EA4 A;  2MH2 A;  5J1U A;  3TED A;  5CPR B;  4A3M J;  4OIQ F;  4UVA A;  3CCE I;  4G6T B;  1QVU A;  2G7H A;  2L01 A;  1S29 A;  3DEU A;  1G3S A;  4MTE A;  1HDD C;  2KDO A;  5D6F A;  1P2F A;  2WY7 Q;  3WGI A;  2V4J C;  4V2F A;  3BQZ A;  1H8A C;  1P7J A;  1G6N A;  1P4W A;  2CV1 A;  2MGQ A;  3FKI J;  2P81 A;  4PSW A;  3F22 A;  4QTR A;  2ISZ A;  4GXO A;  3EUH C;  1FBQ A;  4G8X A;  3U2R A;  2WB1 N;  2EA2 A;  3SEQ A;  4HBL A;  4IJA A;  1K78 A;  2M4G A;  2R92 J;  3HOY J;  2I10 A;  2WAQ A;  3MWM A;  3FXJ A;  2GIZ A;  2F2E A;  1T6S A;  2XAF A;  3DU5 A;  3H9J A;  3VYU B;  4BQQ A;  4EM1 A;  3PQK A;  4RGU A;  4X1E A;  5H6R A;  3ROU A;  4YEL A;  5J8F A;  1VQ6 I;  2EZI A;  1IW7 F;  4AID A;  2D5V A;  3FXM A;  3TOA A;  3WTW C;  3WE2 A;  2HTJ A;  3P5J A;  1W36 C;  2DA3 A;  3WTX C;  5F64 A;  2YSR A;  4UUS B;  1APL C;  3F72 A;  1X3Z B;  5D5V B;  2NS0 A;  5E3L A;  1Q1H A;  4CDG A;  2IGM A;  2R5Y A;  1OYW A;  5B5E C;  4M3G A;  5J6X A;  5DM6 F;  1J0R A;  2LKS A;  3FBI B;  1V5E A;  4DYC A;  4PJJ A;  2M7A A;  2OA4 A;  2GIV A;  3SFZ A;  3HRM A;  4R8H A;  4CCL A;  1Z91 A;  2LBF B;  2RRE A;  3OS0 A;  1FC3 A;  4LJZ F;  3H3Z A;  3WU0 A;  3MZY A;  3HKZ N;  3IAS 2;  3VPR A;  4ZDO A;  1BBY A;  1EKE A;  3CP8 A;  3LL7 A;  4J01 A;  4DYR A;  3RCO A;  1TTY A;  2CU7 A;  3QU3 A;  3CCR I;  2ZXJ A;  1UCR A;  3J81 Z;  3DV8 A;  1DP3 A;  3IAM 2;  4E70 A;  4ENK A;  2DA4 A;  3REO A;  1DU0 A;  3G71 I;  1IN7 A;  3S17 J;  4BHP A;  2A6E F;  5FKO A;  3OMY A;  2XRL A;  4BXX J;  1QPI A;  1H89 C;  1EJ9 A;  2DXI A;  2TCT A;  2LNB A;  2LY1 A;  3LWF A;  1ZG3 A;  3K70 D;  1MMD A;  3OL4 A;  1OCO H;  1W5C C;  2P5K A;  3Q9V A;  1KU9 A;  1WQ2 A;  3QU6 A;  4JX5 A;  2YS9 A;  2JPC A;  4NNJ A;  3ZMU A;  4D9J A;  5IOZ A;  5C3E J;  1ZR4 A;  1TC3 C;  3H3V K;  1ZQ3 P;  3SDB A;  1FEX A;  2JQ7 A;  4HQM A;  2P5V A;  1STZ A;  2XRN A;  1WJA A;  1LPQ A;  3GBG A;  1SC7 A;  3KEO A;  2XRO A;  1WJC A;  3DLA A;  2QZ8 A;  1LFP A;  4KN4 X;  4D7M A;  4W1U A;  2UUZ A;  4ON0 A;  1FWZ A;  4L5J A;  4HA8 A;  3L2Q A;  4OIO F;  2EIK H;  2KZV A;  5BPD A;  2BVM A;  1DP7 P;  3M1E A;  2XB5 A;  2G7U A;  2J5O A;  2X85 A;  4L5E A;  3ELK A;  4L9J A;  4WXH A;  5JVT A;  1HQC A;  4ITV A;  4RA2 A;  2OJE D;  5EEH A;  4B47 A;  1NH3 A;  3ZN1 A;  2F4I A;  3HOV J;  2NVU B;  2DA5 A;  2E5Z A;  2PQ8 A;  2HOT A;  2FOW A;  2K3F A;  3R60 A;  4BY1 J;  3TO7 A;  2E36 A;  2ZXH A;  4Q47 A;  2JPB A;  1UMQ A;  4A3B J;  3DEW A;  4CCK A;  1U8R A;  2EV6 A;  4IEJ A;  1WJD A;  4KA4 A;  3A2K A;  4D0P A;  2JUG A;  3PO2 J;  4C9Y A;  3W6J B;  1IUF A;  1SAU A;  5HS9 A;  2KDZ A;  1GDT A;  1ZLK A;  5FRN A;  4GFB A;  3WHC A;  5LGN A;  1TLH B;  3OR2 C;  1OYI A;  3BP8 A;  4C3H J;  4FAS D;  2QUF A;  4IRH A;  3GTL J;  5FFX A;  2ESN A;  1D1B A;  1HBX G;  1NHA A;  2CUE A;  1FOX A;  2VI6 A;  1VQM I;  1YJN I;  1VQK I;  3WG9 A;  2IS2 A;  3BY6 A;  4Y3O A;  5A2Q K;  1Y1W J;  1B8I A;  2M8G X;  3OS1 A;  1EH6 A;  1NK3 P;  1K6Y A;  4PSX A;  1EF4 A;  2QEN A;  3JAM Z;  1YRN A;  1ONV A;  4BAY A;  5EF6 A;  1B6A A;  2X9D A;  1CF7 B;  4ZH4 F;  4MHG A;  3H35 A;  5DD4 A;  1U9O A;  3O6B B;  2NS8 A;  4RM3 A;  2EFW A;  3PM1 A;  1BR4 A;  3KZZ A;  4RB3 C;  2ZJR F;  1IRF A;  2E60 A;  3PQJ A;  3R6S A;  3ZMV A;  3DBR B;  3F8F A;  3SJM A;  5LD2 C;  1VQP I;  1BOB A;  4A3J J;  5BMZ A;  3K4B A;  2DJN A;  3WOD F;  2EFP A;  1MDM A;  3R0A A;  1ZG1 A;  3CO6 C;  3N4M A;  2JT1 A;  1SAX A;  1YOV B;  1OPC A;  4C2M J;  2OV7 A;  1IDZ A;  5BPI A;  5CJ9 A;  1K4T A;  3SZG A;  3HUG A;  2E2J J;  1Y1V J;  3DBL B;  4Y52 J;  2XSD C;  4XLA A;  1Z3X A;  5L3D A;  1I6H J;  3CCQ I;  3HJE A;  1JGG A;  3HHG A;  1KYW A;  4RMN A;  2LTP A;  5M3F J;  1XC5 A;  2KIQ A;  2VOD A;  1ZN2 A;  2MLG A;  3GME A;  2CW7 A;  2HDC A;  1BIA A;  2EFQ A;  3GTQ J;  3PJR A;  1ZYR F;  4BAC A;  3LNQ A;  2BBY A;  2LMD A;  5B66 C;  2EBI A;  4IO9 F;  3BTI A;  2HXO A;  3S3O A;  3MMY B;  1YW8 A;  1MMA A;  2EB7 A;  4C3I J;  5GP9 A;  1RR8 C;  3AG3 H;  1MD0 A;  2XAG A;  1QVT A;  2LG4 A;  4I0B A;  1ULY A;  4ABZ A;  3I53 A;  4LK0 F;  3I4M J;  3CC7 I;  1X3U A;  1TW2 A;  2QSH X;  2NNN A;  5FD5 A;  4E6K G;  2BGC A;  2CUF A;  3N05 A;  3LQQ A;  2Q2E B;  5ERI A;  3HKZ A;  1SD4 A;  4MQV A;  1TBX A;  2B63 J;  2LLK A;  2LYC A;  2DA2 A;  1ZRD A;  2BW3 A;  2O0Y A;  5TIS C;  5DM7 F;  3C2H A;  3ZMZ A;  5JR3 A;  2P7C B;  3DP7 A;  2E35 A;  1FP1 D;  2QQ9 A;  4CCM A;  2P0W A;  2VPR A;  3C1D A;  4YII A;  2Y31 A;  3MQ0 A;  3LSP A;  1ETW A;  3OIO A;  3D5R C;  1R00 A;  1OIS A;  5CYV A;  3PIP F;  4O5V A;  4BS9 A;  1ZRC A;  4U7D A;  2L9N A;  4ENJ A;  2ELH A;  1P6R A;  2WAF A;  1ITY A;  3G3Z A;  1D1C A;  3GEZ A;  3AKZ A;  4RB1 A;  4I98 B;  1BI0 A;  2VJ4 A;  3OSF A;  5F0F A;  2X1E A;  1E0E A;  3MZ8 A;  3K7A J;  3AL0 C;  4A3G J;  3BQY A;  5JHF A;  3A03 A;  4MLO A;  5DDG A;  4P55 A;  4E7Z A;  2V26 A;  1F1Z A;  4OOI A;  3A01 A;  4KIF A;  4U7B A;  2XF5 A;  2JMW A;  1RI7 A;  5DCM A;  1VQO I;  1A5J A;  3JTH A;  1D1A A;  4HZF A;  3FWE A;  1UZC A;  2ZXI A;  2IT0 A;  4KN7 X;  3K0L A;  3NAU A;  2XAQ A;  2JA5 J;  2VC1 A;  3S93 A;  2VQL A;  1O4X A;  2XB0 X;  3VOE A;  4BE0 A;  5KVR A;  5AON A;  3ZMS A;  2GZW A;  2ME0 A;  2F48 A;  5IT3 A;  3SHF A;  3GTG J;  4ESJ A;  2X0L A;  2LRD A;  2NOJ B;  3RI4 A;  5DUI A;  1U9N A;  2DMT A;  1XMX A;  1MBH A;  4CHU A;  2WAE A;  1H88 C;  2V7F A;  1PJR A;  4I0A A;  4ZZD A;  5LRR A;  1FSE A;  2VUM J;  3RDI A;  3ZMT A;  2CRG A;  1K78 B;  2E34 A;  2RNJ A;  3G1L A;  4JP0 A;  3HPH A;  3CME I;  2VBY A;  3HTS B;  1QHG A;  4RGX A;  2IRF G;  1R5I D;  1YLF A;  1ZGA A;  4XKV A;  2F4M B;  1FIP A;  1P4A A;  3FXQ A;  1LEA A;  2NVY J;  4EEF G;  1RES A;  3OWT A;  1FBS A;  2KJB A;  2FBI A;  3OYL A;  1U5T C;  4H4K C;  4HEA 2;  4IQ4 A;  1VQ5 I;  1KU3 A;  2BY1 A;  1S8N A;  3FF5 A;  5EGO A;  1K4S A;  4E7L A;  2CJJ A;  2R5Y B;  1OJL A;  3FXO A;  3HRT A;  1LEB A;  3ZP5 A;  3EYI A;  2ZB9 A;  3MEX A;  4N4N B;  1XGN A;  1XMK A;  2EV5 A;  1TQP A;  2KL4 A;  3EET A;  4U0W A;  2VB6 A;  1XCB A;  4BBR J;  2PMZ N;  3OYJ A;  1XDU A;  3KLO A;  3CJT B;  3QAH A;  1KU2 A;  1ZR2 A;  4KMU X;  2A07 F; 
#chains in the Genus database with same CATH homology
 3X2Q H;  1OCZ H;  1OCC H;  1OCR H;  5B1B H;  5B1A H;  3AG1 H;  3ASN H;  5IY5 H;  1V54 H;  5B3S H;  3ASO H;  2EIK H;  2DYS H;  3WG7 H;  3AG3 H;  2EIJ H;  3AG4 H;  1V55 H;  1OCO H;  2ZXW H;  3ABL H;  2Y69 H;  2EIL H;  3ABK H;  2EIM H;  2OCC H;  2DYR H;  3AG2 H;  3ABM H;  2EIN H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...