2DYRH

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Structures and physiological roles of 13 integral lipids of bovine heart cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 26
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2006-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 2dyrH00
2Y69H 3X2QH 5IY5H 1V54H 3WG7H 3AG3H 5B3SH 1OCRH 2DYSH 3AG1H 3ABLH 1OCCH 3ABMH 2EIMH 1OCOH 2OCCH 1OCZH 2EILH 2EINH 2ZXWH 2DYRH 3ASOH 3ABKH 3AG2H 5B1BH 2EIKH 1V55H 2EIJH 5B1AH 3ASNH 3AG4H
chains in the Genus database with same CATH superfamily
2LBFB 2DDAA 2AQFA 2L9SA 4Y17A 3KZYA 2LDUA 3RYRA 2M8GX 2EFPA 1QVUA 1G4DA 2KJBA 2WA0A 3TO6A 4QIWN 4A3FJ 2VB6A 1FIPA 2W1OA 4KN7X 2XAJA 1RKWA 1LFUP 2EBIA 3QQAA 1JUSA 3HPGA 3S17J 1BJAA 1BN5A 2XAQA 4M74A 4RAGA 3ZQQA 1FC3A 4IO9F 3MEXA 3MKWB 2MFZA 1LFPA 4DQ2A 1UG0A 2DJIA 2VQCA 1B4AA 3IV5A 4CCOA 1HKQA 2DA6A 4U0WA 3ZQFA 1DQUA 3HRSA 5D6EA 4YG2F 2Z9OA 1HW5A 5HODA 3OYJA 3K4MA 4TV7A 1UG2A 2LKPA 5E8GA 1ZKGA 3VPRA 2ZJPF 2UZKA 1IUFA 3CCRI 1QA6A 4Q47A 3AG3H 1Q1HA 3WGHA 3HL2A 2Q8KA 2H8WA 3PO2J 1OYIA 4XOTA 1BR4A 3SZPA 2Y2ZA 4QSHA 4IRGA 1R58A 2MW8A 4BY7J 1K78B 2XHKA 2EINH 4M9SA 3SDBA 1SMTA 2HU9A 4FX0A 1GVDA 3AG2H 2EIKH 2QYOA 4RB0A 3TL4X 2M34A 4BNCA 1FY7A 5E1WA 3BG7A 2YR2A 1Z91A 3JW4A 3M8EA 3FHZA 2IGKA 2V79A 1GDTA 3S1MJ 5D4RA 4RM2A 4OIPF 2DQRA 5FFZA 3ZQIA 4IRHA 3A01B 3JRGA 1E0EA 2X4HA 1SD6A 4AWXB 2M4GA 1PP8F 3FMSA 4A3BJ 2GZWA 3M1CA 3K70D 3SFIA 4CGZA 5E17F 3QOPA 1MSEC 3VB2A 1H0MA 1TP4A 1IXSB 1OKRA 4M9XA 2RQPA 4H4KC 4M3GA 5LRRA 3SFZA 1K61A 1LDDA 2GQQA 2DCEA 5LFAA 1JT0A 2Y31A 4LJZF 1WCMJ 5GTIC 3S93A 3F21A 4C30A 2TDXA 1LVKA 4KNYA 1IXRC 3TO7A 1M1EB 3BR6A 3PJRA 4CXFA 4II2A 1XN7A 2E1NA 3GVAA 2CS3A 1IG7A 3F3XA 2DPUA 4E6KG 1W0TA 1YQAA 3SZGA 4XN3A 2OBPA 1P9QC 2B0LA 3E6BA 5TGTA 1NHAA 4R1HA 2GM4A 2KJCA 3BOQA 1SVMA 1MJAA 1JUMA 1X1BA 4RA2A 5FKLA 3VEPA 2M45A 3CUQA 2F4OB 2ZSHB 2Z2SB 2IEKA 2FXAA 4AUXA 1IF1A 5CQGA 3UNGC 3C1DA 3IC7A 1SFXA 1HCRA 5K7ZA 4L0YB 2NVYJ 5K5QA 5HDKA 5ILVA 4PZJA 5E79C 1LKXA 4K2EA 4M72A 1E3OC 1PUFA 3ABKH 3RZOJ 1JUPA 5JLWA 1QZEA 1TW2A 1W36C 3JCUC 2VOPA 1GHCA 1J2XA 2EFOA 3M9AA 3ZMTA 1K83J 3OR2C 4A3CJ 1QPMA 3R0JA 1IV6A 1BA5A 1BR1A 3AL0B 2VONA 1R1TA 3JAMZ 2HKXA 2COMA 2VBWA 2XKPA 4MLOA 3NWTA 5LGTA 3DCFA 5CPRB 4CSWA 2X9DA 4BE1A 1D1CA 2DK5A 2VBXA 3HOUJ 4PJLA 3KZZA 3PNYA 4IOCF 4FX4A 2H27A 3BCBA 2FRHA 2M4KA 3H9GA 5B1AH 4B1RA 3E6CC 1IN6A 3VYUB 1WFXA 3ZRGA 2H94A 2FSWA 4HF2A 3O6BB 1YI2I 1O7LA 3GTMJ 3ZXSA 3LWFA 1R00A 1SD7A 4XLNF 4RB3C 3L2QA 4RDUA 2X6OA 3G73A 1X1AA 4YIFA 2MLGA 4IPAA 1IJWC 3D5SC 3OYGA 5L3BA 2E2JJ 4LLLA 3ABUA 3BG6A 3CMYA 3GLLA 1TQMA 1Z7LA 2PFBA 1QO0D 2GOXB 3HRUA 5CKTA 2H1LA 5E18F 3H5NA 1O7FA 2Z1DA 3J81Z 5IPAA 1F1ZA 2ZC2A 5E3NA 1AA7A 2IT0A 3FISA 4I0AA 4KFCA 1I3AA 3JSOA 1VQ9I 1SANA 1WH5A 3BPXA 2JA8J 3G4SI 3TQNA 1CF7A 3TDUC 2A3SA 4A3KJ 2VN2A 2BY1A 3G3ZA 4FTHA 2CQ7A 4B43A 4DZJA 2RQQA 2V4JC 2DO7A 2F5VA 2DA4A 2QA4I 3H5AA 4BJ5C 1IRGA 4BQAA 1TWCJ 4DZPA 1OCTC 2G7HA 2RKHA 3NARA 3H5RA 5DS9A 2NS0A 4MQ9F 5KAIC 3JREA 5BMZA 4KUMA 2CW7A 3DF8A 2JVGA 3AAFA 4Q4ZF 2FQ4A 5J1RA 1XDUA 1TBXA 4IQJA 3KETA 1I6XA 3TOBA 3CDLA 4Y33A 2EH3A 2R92J 1V5FA 2R7XA 4AD9A 2F4IA 4JX6A 5CVUA 2JUCA 2O7OA 3S8PA 1A6IA 1S6LA 3BTLA 3FDYA 1WJAA 2GWRA 3DBHB 1MBFA 2D2WA 3KX2A 3PM1A 2XRNA 4MGRA 4X1EA 2JVHA 1D5YA 1U9OA 2P4WA 5HVQC 5EEGA 1BI2A 3LSMA 3MN2A 2HZDA 4I02A 1KU7A 3S1NJ 4DBQA 2OTLI 3FXUA 4LB6B 4BEHA 4BS9A 3LSIA 3IHUA 4WXHA 1WSUA 2KMUA 1BC8C 2FD5A 2PMHA 4HSTA 3FKIJ 1YO5C 2QZ8A 4XN0A 3RDIA 2FNPA 1R1VA 4E7SA 4U0VA 5LD2C 3I9V2 3IP4B 1R49A 2NRAC 2XASA 3CMAI 2X1DA 1JXSA 3EUHA 2EFWA 4HW0A 4RGSA 3OYCA 5J1YA 2BY2A 1W7PB 2FE3A 4IF4A 4LOCA 3ZGKA 1J75A 3WHBA 1AKHA 2HYJA 4MIMA 2HEOA 1FBUA 4EGZA 5C44J 2XB5A 3WTWC 2B7EA 2JK3A 1FYKA 4DNCA 2QWWA 1JGSA 1OCOH 5HS9A 3E5XA 1TZLA 5ERIA 1N78A 2DMPA 2K85A 2CV0A 1NK3P 2DA1A 1A04A 5ILUA 4XLFA 1Z9CA 2K9SA 2OQGA 3H0GJ 5J3LA 2R5ZB 3AL0C 1R6RA 2Y0SN 4ETSA 3VSLA 3C2GA 4M9ZA 3SQNA 3K6GA 3TW6A 2IPQX 3F0CA 4HNVA 3RI4A 2E60A 3BT9A 3VYRB 3IL2A 1LPQA 4LIVA 5CVJA 4IHXA 4LK0F 1CGPA 3CUOA 2M3AA 1KQ9A 3PQKA 4V2FA 4P5OA 1Y1WJ 1RETA 3B6CA 4B48A 2Y0MA 1WWXA 5B5EC 1L3LA 2JT1A 4WXDA 2VXDA 1P4XA 3RIRA 4GCVA 3PUBA 3I5UA 2PN6A 3L00A 3FK7A 4PFPA 4XOPA 4AIDA 2ZFWA 3C7JA 5FKKA 4YFKF 3U1KA 3CCLI 2BY3A 2OAZA 3CJNA 4BH9A 4UVBA 2GLOA 3WODF 2R0QC 4PGGA 2BXZA 2PJRB 4MFDA 4EATA 5K5RA 3JRCA 3LFUA 1HBXG 2VKDA 3KE2A 5HNHA 3K0LA 1LE8A 2R7DA 4D5CA 3GXOA 3MZYA 2H1KA 4A5MA 3RKQA 1ZR2A 3NEUA 2EFQA 3BLYA 1R5GA 1R5HA 2EJRA 1A35A 2BXYA 5FLMJ 4PK4A 1T0FA 1HDDC 1I3QJ 5EZHA 4FE4A 2GAUA 3FBIB 3BTCA 3ZOBA 1SEUA 4N4OB 3DKXA 1T08B 3FM3A 4ZYEA 1DDNA 3L2CA 1ITYA 4NQWB 2L9VA 1RUNA 1ZH5A 3QU6A 5C4JJ 4YFNF 4A3MJ 1FIAA 2R3SA 2Q0OA 3QP5A 1GXPA 3W6VA 3MZ8A 4IRIA 3GCMA 2VQGA 1OCCH 2EIMH 4IHWA 4OMZA 4P9FA 2NNYA 4BE0A 3OYFA 2XPUA 1SD5A 3HOWJ 3OL4A 3FF5A 4O6JA 4UVCA 4Y52J 3WHCA 3IWZA 1HW1A 1BIAA 4NC7A 2QBYA 4XM3A 1BR2A 2AXTC 2M87A 4BBRJ 1Q1VA 2ZMEA 1ONVA 3GZNB 1MBGA 4F52A 2IBDA 3DU5A 2Y9YA 4HAMA 3R60A 2LREA 1R9TJ 4A93J 1B9MA 3MKYB 3S2DJ 1FMVA 3DKWA 1EA3A 4A3IJ 4EM0B 4Q5SF 1X3UA 3K69A 4GRIA 2ID3A 3M7GA 2IGOA 4GDFA 3OS2A 1WJBA 3DBLB 4MEXF 3KLOA 1XSVA 4IHTA 4I76A 4NBQA 4KT5C 4RGRA 2M8EA 4YELA 3ZQ7A 3NWSA 1OMIA 3R0AA 3I64A 2GIZA 2CQXA 1RIOH 4IHYA 1G3YA 2KRFA 2WTEA 3K9TA 2YX7A 3KEQA 2JN6A 1WJDA 3L2VA 2KPMA 3OYLA 5DDGA 2Y9ZA 3LAJA 2OCCH 1KQ8A 2W00A 1Y56A 3GFIA 3KP7A 2V1DA 1YJNI 3I59A 4M6VA 3PFYA 4AYBA 5EGOB 1Y8QB 3LSHA 3ASNH 3PUFA 3H92A 4F3QA 3LQQA 3HUGA 4B3AA 2L2OA 2A6HF 2O3FA 5DD8A 3F9KA 5L3EA 2ZSIB 4XNFA 1ZAOA 4CCNA 2R5YB 2DYSH 5JI6A 3IRRA 2QSHX 2E2IJ 3I55I 2VPLA 1ZELA 2H09A 5EEAA 2GBYA 3DLLF 1MD0A 3ZPLA 2MBFA 4LG0B 1IC8A 2FOKA 1FWZA 1T8IA 1F9NA 2DQLA 3HSRA 2IGNA 3KP5A 1IRZA 5D8LB 1ENHA 3ZMZA 1YIJI 1MZBA 1U2WA 2R93J 3FMQA 3HC7A 3ZCOA 5BPIA 1UCRA 5L3GA 1USSA 4E7JA 2WAEA 4BQOA 2HPMA 3KEOA 3ZQLA 2P5LC 3VDXA 4CYCB 2DTRA 3J7AO 3AG1H 3GZ6A 1IN7A 2UXNA 3LSPA 4BDZA 1B1BA 1BBYA 5KCMA 1XTAA 3FBNB 1VQMI 1R22A 3PFIA 3BQYA 1W5SA 3M07A 4WF2A 1SMYF 3C2HA 2F48A 1GV5A 3CJQB 1YIOA 4B47A 4I7HA 2DA2A 4ENMA 1U5TB 5E1XA 4AIHA 2XPWA 1HXDA 5HS8A 3TBIA 3HOVJ 3REOA 4DJAA 1IV8A 3GTGJ 4XKWA 1OYYA 2HQRA 4XLEA 5LHGA 2O0YA 4I09A 4DBRA 2M5WA 3CCVI 2O8XA 2ESNA 5IP7J 5J8FA 2HR3A 2MH2A 2BHYA 3G2BA 2RC4A 3BJ6A 3HKZA 4RAZA 3KEYA 3KLNA 2DFFA 3OYBA 2WAFA 2W24A 3LQRA 1HSJA 4XRMA 3H9QA 1ZARA 1MMDA 2XF7A 3EUAA 1Z77A 1MMSA 1JTYA 3U1DA 2VKEA 1X1CA 3GYHX 4C9YA 3KFWX 4V19K 4M3FA 1O3TA 2EILH 2XGEA 2JRMA 1DPRA 1BOAA 4M73A 1BW5A 4OIQF 2ELJA 3SDGA 4BUPA 3ERMA 5F6FA 5L3DA 4CZZA 3A02A 4Z6YA 2KIFA 2L54A 3RPQA 4NC6A 2A68F 1RZ4A 2JMWA 4BHPA 4XSXF 1YRNA 4AIJA 3ZMSA 2K40A 4CO8A 1JKPC 1FSEA 5FRNA 2IS2A 5BNGA 2LK2A 3UR3C 1LFBA 3D5LA 4D1QA 2WC2A 2RN7A 2R7VA 3H3VK 4R8HA 2VXZA 1HC8A 1W4MA 1XGSA 4J19A 3OSGA 1IDYA 2V7FA 1CF7B 4M71A 2N8GA 4IQ4A 5LHIA 1NK2P 3JAMK 2Q2EA 1G8XA 3LA3A 5FLXZ 5EYRA 2V1XA 4P55A 3MD2A 2V9VA 5IOYA 4O3MA 1YTYA 3AKZA 2QKLB 4M6YA 2DW4A 1UHSA 4E7LA 3GWZA 2EWNA 1S29A 2CUFA 3RKYA 3HGGA 1IDZA 2XAUA 2BV6A 3ZMDA 4KYWA 2NVUB 1O4XA 3I53A 3IKVA 2KRCA 3S14J 1WJEA 1U78A 4XBFA 2QM3A 2QLZA 2K9QA 1FX7A 1X1DA 4L9NA 5LGNA 2BBYA 3L2UA 3H1CA 2LLKA 5KNLA 3CC7I 4IKFA 2IS6A 4BKXA 1V54H 4RM3A 3P7NA 2XIGA 3L1PA 2D45A 3F8NA 3A2KA 2DFHA 3HHHA 3L9FA 5AONA 1YJWI 1KYZA 3DLAA 3BQZA 3OS1A 1QVTA 1FJLA 1I39A 2HPIA 4E7IA 3J81K 2XB0X 3BG5A 3KIOA 1TTYA 2L02A 1DPUA 2VQLA 3K4JA 2HOTA 2GOMA 3EPZA 2YX4A 4CH7A 1Z3YA 5CVRA 4LGWA 1EH7A 1S7OA 4E7KA 2VKVA 4C2UA 3H35A 1AWCA 2ISZA 2LOOA 1JJ6C 3E3VA 1RNLA 4OMYA 2RV8A 2KZGA 4DGWB 4KN4X 3ROUA 5EG0B 5TRDA 1GLNA 3K70C 3T8TA 5GAGJ 4FASD 4E7ZA 4KA4A 2OV7A 1FYMA 4BQQA 4HNUA 3K4BA 1U5TC 4XRFA 1D0ZA 2GXGA 3CCYA 2ADUA 2PMZA 1Z0XA 2BY0A 3MAJA 5KK1A 3W6JB 4D0PA 2X0LA 3OYEA 4OU0A 2HVQA 1HF0A 3ZN0A 2L3DA 1WI9A 3K4CA 4BJTA 2VJIA 5EF6A 3CMMA 4EJVA 1JKOC 4G94A 3HTSB 1S3JA 2V26A 2WADA 1D3YA 2VOOA 3S32A 3SEZA 1DU0A 2ME0A 1FOWA 1V5GA 2P6SA 1J0RA 3BR0A 1JT6A 5TISC 3CCMI 4M6XA 1JJ8C 1MJ9A 2Z3YA 3H0DA 1T98A 1LB2A 3WE2A 3HM5A 2DT7B 2D1VA 3VFZA 4R79A 2BYVE 2ELHA 1ZG5A 4A3GJ 4RLFA 3EQLF 2QEXI 1H8AC 1ZLKA 1O57A 4Q48A 4XL9A 4ZZLA 2HI3A 1TW3A 5A2QZ 3BDDA 3U9GA 2FMYA 2M1BA 3WGGA 2HXIA 4JYKA 3H3UA 4PFOA 2JA6J 1D0XA 1R5ID 2R7FA 3CDHA 3E5QA 1ULYA 2OD5A 2CWEA 1QZZA 3F6OA 4G12A 1U8RA 4XONA 3MFKA 1MMAA 3E1SA 4UXNA 4AC0A 3F8CA 3OYKA 1QHGA 1WH7A 3RSNA 4A3JJ 1T38A 1JKRC 3VYSB 2FQ3A 1YITI 2CJJA 4HLYA 2P7VB 2XAGA 3ABTA 5FKMA 2CQKA 2LY1A 1YE9A 3PO3J 1VI0A 5J8CA 4S05A 1Y8RB 2NAZA 2X85A 1JGGA 4ENNA 4ZYHA 3IAM2 2DA3A 4W1UA 4B4CA 2AHQA 5K7HA 1XGNA 3V7RA 2CW8A 3FXQA 4ESJA 5B3SH 3FIWA 3G71I 3DEUA 4UUSB 2HQNA 3F23A 1TQIA 1K79A 3BWGA 2ISYA 1ON1A 2MD0A 5LEJA 4M3DA 1T39A 3M3YJ 2VIXA 1HQCA 2DODA 4HV6A 1O3QA 3QPHA 3OYHA 2CUJA 2K7LA 3H36A 2W4SA 4G7OF 1BI1A 2TCTA 3CF5F 1SVOA 4KIGA 3R4KA 4D7NA 1B8IA 4RLQA 2IW5A 1W36D 1MNMC 4NUBA 1ZRCA 1OYWA 3OYMA 4PCQA 4LMYA 1A31A 4ZJZA 3FXLA 2NOJB 2OCEA 3TP0A 2PI0A 3RKXA 1J59A 3GTOJ 3Q3SA 3PNTA 4HF1A 4ZTJA 1O3SA 1VF9A 2JA7J 2W85A 1VQ5I 5FFXA 2KT0A 1I1SA 2KRHA 2WY8Q 1GVJA 1HA8A 1VQKI 4IEJA 1MNDA 4RB1A 3VSKA 5HOOA 4PSWA 2ZCWA 3H9JA 3PL8A 1ERDA 2IS1A 2STWA 2KQRA 4UHTA 2HQ5A 1W5CC 2E1MB 1I27A 4Z2YA 4IZZA 3BCAA 2ICWG 3B6AA 2W84A 2UXXA 5D6FA 3OIOA 4FHTA 1J5YA 4BXXJ 1R4MB 1FMWA 4D7MA 4BQNA 3O2PE 3GTQJ 3PIPF 1G59A 2G7UA 5GAEJ 3COAC 3RZDJ 1P7IA 3IKTA 3HDDA 1UZCA 3VODA 4HX4A 1LQ1A 3BR1A 4UVAA 5DCMB 3P9CA 4YIIA 5JVGF 1YW9A 1EH8A 1ZN2A 2QUFA 4JOMA 1X2NA 1UAAA 2HOAA 3QAHA 1XC5A 3S3OA 3CCUI 4E7HA 2R7RA 5GPCA 2L7ZA 2BW3B 1MMGA 5CYVA 2AO9A 1ETVA 4CCLA 2IA1A 4BBSJ 3ML6A 3CTAA 2LBFA 4RAYA 4IX7A 2E36A 2HFHA 1X4PA 2DFIA 1MDMB 1B72B 3EYIA 1S7EA 3FKJA 3O8GA 4LITA 1G3SA 2HDCA 4A0YA 4UY8I 3WG7H 1ETKA 1P7JA 1IGNA 2LG4A 2R7UA 2COBA 2PLYA 2EB7A 3V42A 3GX4X 4X0GA 2M9HA 4DIQA 1PUEE 2O03A 2E34A 3WTYC 4C2MJ 1B9NA 2FJ1A 2CG4A 3ONQA 2X6WA 5J40A 3OIQA 2RNJA 1BL0A 3JRHA 1MW7A 2K3FA 3OYDA 1J7KA 2WWYA 4RAFA 2DOFA 3JRDA 2NXNB 1MH4A 3S15J 1UMQA 3JRIA 4DYCA 3I3LA 4Y13A 2A69F 3LA2A 4PJJA 1IN8A 3K10A 1SVLA 5E20A 3CESA 5IOZA 1K78A 1N75A 3BJOA 3F8FA 4HV5A 3P5JA 2LVSA 4EV0A 3JSPA 2P0WA 4MNUA 1RUOA 2D5VA 5ILSA 1QNTA 1DUXC 5F0HA 2AXLA 1O3RA 4UUTA 4A2UA 2X51A 2OC6A 5H6QA 1RC9A 2TRTA 2KIQA 1JHFA 1F5TA 1J09A 2UV1A 2EZKA 5HDGA 3A03A 3A01A 2IAIA 4P1WA 3CCSI 1VQ7I 1H89C 3DEEA 4F93B 3F6VA 2ME6A 2WAQN 3TDZC 2PBIA 4OIOF 4C3IJ 2EZHA 4XR6A 2I5UA 3PIOF 2E1CA 2KIUA 3MMYB 4HDUA 4HF0A 4GO1A 1D0YA 3F8BA 3CF2A 3CQZJ 1ZGWA 1P4AA 2NVXJ 1X3ZB 2QQ9A 4NNJA 3T8RA 3U21A 5LEKA 2GIVA 2W25A 2DT5A 3MVPA 3LNQA 4LD5A 2HZTA 1MSFC 3AG4H 4UV8A 1HLVA 4NC8A 3NRVA 3ZQGA 3I58A 4AM3A 1YJ9I 3HHGA 2OZ6A 3IAS2 1OR7C 4MTDA 3LA7A 1PJRA 3PSIA 1IO2A 5HLGA 1Y0NA 3M1EA 1BJZA 5K1YA 4HDVA 2JA2A 2HDWA 1X19A 4XQFA 3DFGA 3JRAA 3DPLC 1FOKA 2C6YA 3V4GA 2E1MC 2XGCA 2XAFA 5F0FA 4XLCA 1R7JA 1VQOI 1SFKA 1BM9A 1U3EM 3W2WA 1E3HA 2HOSA 1QU3A 2ZB9A 4J01A 3O3KA 1UFMA 1D1AA 2DT6A 3CO7C 3D1NI 2KIMA 3BZ6A 2Z33A 1Y1VJ 5DD4A 2K86A 3RQ4A 1I50J 1KYWA 1FP1D 4A6EA 1WI3A 2NOGA 2M7BA 4F92B 4KMFA 4MQVA 3CCJI 1U6GA 5E3OA 2KL4A 5M5XJ 1WKMA 5DEQA 3RTRA 2XC7A 5C3EJ 1AOYA 1IN4A 1ETWA 1SAXA 2X6XA 4BYYA 2DPDA 3D0SA 4NDLA 4XKVA 1U9NA 2LY2A 3I4MJ 1A36A 3CC4I 2DAOA 2F5FA 2VC1A 1VQ8I 2J5PA 1YS6A 4EMSA 4I6ZA 1TNSA 2IP2A 3TEDA 3F8MA 4JX4A 2LD5A 5FO5A 2KKOA 2ZKZA 2M7AA 1A6QA 3OS0A 5D5XB 1WRJA 3WTTC 3VWBA 2HWVA 4KITB 5FJ8J 5M5YJ 3DBRB 1ZK8A 2LH9A 1MIJA 4H0EA 2Y0SA 1I6HJ 1NTCA 3BG3A 3PSFA 1SFOJ 4NHJA 3IUOA 3M4OJ 3GUDA 4D9JA 3DKYA 5CLSA 1ZG3A 5FLXK 3LSTA 4E4HA 3GF2A 4A6DA 2FUG2 2JTVA 2I10A 3TOAA 2NS7A 5C4XJ 2K9LA 3JTHA 3OV8A 1ETXA 3MKZA 4BACA 1DGRM 2ZXHA 3HTUA 1SFEA 3WE3A 2JZYA 5FKOA 2F5CA 5KHDA 1RR8C 4UV9A 3FHNA 2VLAA 1EF4A 5F1RA 4JX5A 5FLVA 2A5YB 2R4GA 4Y7NJ 1OPCA 4C3HJ 2F2EA 4G6QA 1K4TA 2MC4A 1S5LC 5J4YA 1LJ9A 5F04A 2DMNA 4Y4RA 2XSJC 1YOVB 1ON2A 3P9KA 4BXUA 4DW6A 3P9IA 1Y39A 1W7PD 3RKWA 1VQ4I 2XRLA 1FBSA 2PEXA 2EFNA 1R1UA 3RCOA 5H2FC 5DUIA 2WB1N 2LF7A 1Z05A 2QGUA 2Z99A 3HZJA 3G1OA 2IA2A 5J47A 3FXMA 4LB5A 3V8KA 3CUQB 2E71A 2P8TA 4NB5A 3DEWA 2WV1A 1BIBA 2OU2A 2KISA 2QVOA 3BZCA 3M8JA 5D5VB 2HYFA 4XKCA 1FNNA 5IP9J 2R7SA 1V55H 3IH3A 4U7BA 2UUZA 3QPLA 2XGDA 1UHWA 1PUFB 2BVMA 3WTZA 1G3TA 2A05A 4CCKA 4RBOA 2XKOA 2JJ7A 2DN0A 3I71A 1FZPB 2EZIA 2L9NA 2R7WA 5JHFA 3ELKA 1QQIA 3PQJA 3RPUA 4V2GA 4G6TB 1UJ8A 2XF6A 2F4MB 3Q0UA 1Z1DA 2XAHA 1ETYA 2VE9A 2DTZA 2LFBA 1W0UA 2OZUA 2R7ZJ 5CVIA 3MWMA 2ZO4A 2ZJ2A 4C2TA 1W7PA 4CICA 1YX5A 4Y3OA 1LUJB 2BE5F 5IP6A 3DXJF 4ZC3A 2KDOA 3GO5A 2MYSA 5IY5H 5AIPA 4B44A 3SJMA 4HZFA 4MHGA 1FSHA 2EK5A 2D1HA 1OCRH 2FNAA 2O9LA 1B6AA 1XG1A 2IXSA 3HOZJ 2JPBA 4BDYA 3KYCB 5A2QK 4P9UA 1MMNA 4JK1X 5BS6A 4WCGA 2LNBA 1HKTA 3GZ5A 2QQBA 3TO9A 3BJAA 4QTRA 4XORA 2R5ZA 4GYGA 2ZXIA 3HOYJ 2B9SA 1Z3XA 2VQHA 3A0BC 2LY9A 3ASOH 3S16J 3ZQCA 3W3CA 3KP6A 4U88A 1IUYA 3GTKJ 1RKTA 3AFHA 3K1PA 3LMMA 3X2QH 4HLXA 2JUGA 2W48A 2FEZA 2ETHA 1VZ0A 3A0HC 2O6GE 1FBQA 1ZGAA 2E7XA 2JSPA 4ZDPA 1LVAA 1ETQA 1WVRA 4ASNA 4F55A 1QBJA 4AIKA 4A3DJ 5IT9K 1XCVA 2MG4A 1ZGJA 2E1OA 2EV0A 2V9PA 1YS7A 2M2EA 3HYIA 4UB6C 2UWMA 2PJRA 4IOAF 1ZTRA 5F27A 3LSKA 4C3JJ 2DI3A 1R23A 2EV5A 2VBYA 1YG2A 3O8HA 3TP3A 4RGXA 3EUKL 2H6CA 4S0HB 5GTHC 2IGMA 2CQQA 2BGCA 4N0BA 3QYBA 3A4CA 4XLPF 2IA0A 1BI0A 3E7LA 4FE7A 4ZYDA 1IAWA 5LRSA 3OWTA 2CW0F 3NQOA 2H8RA 4ENJA 1EKEA 2LF8A 3GW2A 3K1NA 2FA5A 1LEBA 4FQGA 4JP0A 4WX9A 4MFEA 2RREA 1X2MA 1J9IA 3SYTA 3OSFA 1BOBA 1FPQA 1ORKA 1VTNC 2ACJA 4ESFA 4NQWA 2L9RA 2B63J 4BL0B 3GEZA 1OCPA 2HVSA 3BG9A 3D5RC 3C2BA 2FU4A 3HGYA 3C18A 1MNEA 2QF7A 2DK8A 3W6KB 2DOAA 5FD5A 5M5WJ 3L09A 1POGA 2L01A 2MSYA 3B02A 5BOXA 2EQRA 1IRFA 5E8IA 4LLNA 3S2WA 1OFCX 3ZMVA 4W97A 1H88C 4LIUA 1Z6RA 1F4KA 3J7AY 4A0ZA 4BEHB 2RNGA 3B73A 2KP6A 2CYYA 1YFHA 4L0ZB 2A07F 4A69C 1E17A 1PDNC 3S2HJ 3C3WA 1C0WA 1TWGJ 1D5VA 1JTXA 3CUQC 2PQ8A 2ZJRF 1WJFA 3CJTB 2OQRA 4AU7A 3LL7A 3CZ6A 3E6DA 3N05A 4HSRA 4I98B 3IWFA 1WJ5A 1AHDP 1HKSA 3OMYA 3K2ZA 1AKHB 3KPHA 2K9NA 2O8KA 3Q0WA 1AU7A 4ENKA 5FD6A 1ETOA 4HX8A 4BJ6C 4EQQA 3WG9A 3LSRA 2K4JA 1VQ6I 1T6SA 2HOEA 2QQ8A 2RAEA 2NVQJ 1APLC 2LYCA 2L4AA 4LG3A 4G6DA 2RVCA 4DOZA 3HG9A 2FX0A 2ZJQF 1S72I 2MC3A 2P5VA 1NG7A 1X1PA 5JLXA 5JR3A 2QSFX 1Y6IA 2K3PA 3E6MA 3WU1B 2PX9A 1A5JA 2AS5F 5EGOA 1QPIA 3R61A 3GFLA 3WU2C 1ZG1A 5D8KB 1SAUA 2HGCA 1U8BA 4UB8C 1DP7P 5H20A 3I0TA 4FCYA 1KA8A 2EIJH 3EDPA 2HTJA 1WGXA 2R5YA 1MKMA 3SZTA 2NVTJ 3J80Z 1G6NA 1LNWA 3DU6A 3DTIA 2VKHA 1XD7A 1RI7A 1X4OA 3GTJJ 4HPQA 3JRBA 4L9JA 2ID6A 4LG0A 3CLQA 3RJPA 1F36A 2XSDC 1BW6A 1EH6A 2YS9A 1TT0A 2HS5A 1H9GA 1LE8B 1SFUA 2BZTA 4ZDOA 1OISA 1DU6A 3LAPA 2L7KA 4HEA2 3A1YA 2DFEA 3FWEA 5CVVA 1XGMA 2OTJI 2MLKA 4JQFA 4CYCA 5IT9Z 1GXQA 4HA8A 2AQEA 3E5UA 1KZHA 4PJNA 3GLXA 1Z67A 3L2RA 3ECHA 3GFMA 3CJRB 1FLIA 3F22A 2E2HJ 5F64A 4HQMA 4BXFA 1S7AA 2BEOA 5IT3A 2VJJA 4LLGF 4KICA 3WTSC 3EETA 2OF7A 3I56I 1ZRDA 3K1MA 5K5OA 3JTGA 4L18B 1V4RA 3QYFA 4F7ZA 4CHUA 1HDPA 2VJ4A 2YUSA 1U5TA 3WTUC 3DPUA 3E97A 5J6XA 4WXCA 1X3WB 2F5EA 3OYAA 4HQEA 3DQVC 1TC3C 4A3LJ 2BVLA 2E7WA 3BR3A 5ICGA 1KU3A 5DV5A 4YRVA 5B66C 3BR5A 2RDPA 2QBYB 4EM2A 1IN5A 2DMUA 1S8NA 2FBKA 2M30A 2ZMEB 2VODA 2CH0A 2Z16A 3LSGA 5IYCJ 3UKGA 5DM6F 2V1UA 2M0MA 3L7WA 4BHCA 2ZXWH 1ZR4A 2PG4A 3IH2A 2STTA 4KMUX 2G9WA 5HLIA 2L7MP 4L5EA 3FX3A 5HLTA 3BC8A 4L9VA 1N77A 4EGYA 1XX5A 1TWHJ 4B8XA 4XIDA 4ZH4F 2KFDA 3BY6A 3HXLA 3OOPA 5CQEA 3RYPA 1BI3A 1MBJA 4XKBA 1T2KA 2ESHA 4IJAA 3LSJA 3V8LA 2Y75A 4Y15A 3OY9A 4IHVA 4EVIA 4JBAA 3FK6A 2DJNA 2VI6A 1W1WE 1DGWY 3Q0VA 5EZGA 2WBMA 3HSFA 4PGHA 4HYEA 3G6EI 4PSXA 4J00A 2W82A 4KJZA 2J5OA 1JHHA 5D4SA 1P2FA 2F5DA 2R7TA 1LDJA 5HDNA 3EYYA 4I99C 4UUVA 4L5JA 2K5CA 3QWLA 5BPDA 1WZ2A 2H6BA 3EUHC 4IHSA 2HXOA 1EJ9A 2CFOA 3I59B 1KONA 1YHQI 1USTA 2R7OA 2ZFUA 3HUGB 2VPRA 4G7ZF 4E70A 1FP2A 4B3XA 4EJOA 4G7HF 1HOMA 3ZR8X 2ZNZA 3CDIA 2OPTA 1R71A 2CFXA 3OYIA 3K2AA 4FT8A 2CQNA 3HPHA 4LK1F 5KAFC 1H9TA 2KZVA 3MQ0A 5LHHA 4U7DA 2V1NA 3S1QJ 2WV0A 1E3PA 2XVCA 3F72A 1X58A 3IH4A 4OAYA 1K4SA 2EPFA 5EJCA 2OJED 5M3MJ 2LTPA 3QP6A 1MBEA 2VL8A 5K7FA 1ODDA 3JRFA 1FOXA 5DM7F 5F1JA 3N4MA 4IXAA 4XICA 3K4LA 1Z6TA 5LLQA 2FF4A 4ZYGA 3OOUA 2XDVA 5DUKA 2CU7A 4AVPA 2JWTA 1MJBA 3KYDB 4B09A 3Q5FA 1ZHFA 2ZBKA 4ANJA 1W5TA 1YW8A 4FISA 3HBLA 5ICEA 4KDPA 4RS8A 4QPQA 3M8FA 4KT6A 2V9KA 3LFKA 3QU3A 5E3LA 4BHBA 4OINF 5FRMA 4MEYF 3WGIA 4CYDA 5FROA 2XPVA 1YX3A 1P92A 1XCBA 2HTSA 4KIFA 2X6YA 3K7AJ 4G9YA 3OL3A 1TNTA 4M3EA 1D8JA 1T0FC 1Y0UA 3HRTA 5GPAA 1QRYA 2CUZA 2IRFG 1KU9A 2EA4A 3QODA 4HG2A 4MO7A 4ITVA 5EG0A 3IRQA 2V6EA 1XB4A 2GA1A 3HOSA 1D8KA 1E2XA 2DOEA 3ECOA 2P5KA 1QGPA 4ZYAA 5J1UA 1RRJA 1ZLJA 2DMTA 2YU3A 3GFJA 4OIRF 2IS4A 1RPWA 3BP8A 1SD4A 1XMAA 4ZTFA 3TKYA 3BR2A 1FYLA 2GA2A 2YSRA 2CRGA 1OQYA 1RESA 2HVRA 4OOIA 5FB2A 4HBLA 3S3MA 2QQAA 3GTLJ 1FEXA 2ECBA 2L4MA 4XLHA 3DTKA 1ZRFA 2R7QA 3SEQA 2HKOA 3G1MA 5E3MA 3WTXC 1OJLA 5IYDJ 2ZMEC 1PYVA 1KQ0A 4YFXF 1R36A 3FXKA 5J4VA 1XDSA 1V3FA 4F91B 2CGPA 2XGXA 2DXIA 3QPTA 1KU2A 1R4NB 2CO5A 3HIFA 1WPKA 1YRNB 3GBGA 4CZCA 4GGGA 3G1LA 1F43A 4KISA 4GXOA 2BHZA 1PVEA 2K02A 1KGSA 1S9HA 4CUGA 2QSGX 2L0KA 2LKSA 2Q1ZB 4RGUA 2ECCA 2EA2A 4BE2A 3HB9A 4AYBN 3BPVA 3MCZA 1LDKB 1ZQ3P 1FOYA 3ESWB 4CA0A 5HLHA 3ZQHA 2K27A 4WK8F 3TGNA 3TW7A 1ACIA 6PAXA 2DA7A 2Q2EB 5F0CA 2VT3A 3DWLE 2VJ5A 2P6TA 3BROA 1N25A 1YLFA 2QENA 5FKNA 3CP2A 5JFRA 2GXBA 3J7YJ 2OA4A 2EV6A 3ERED 4PJMA 3K4NA 3T5XA 5CJ9A 3BTJA 4PDKA 2ELKA 2DBBA 4KIBA 2DMQA 1TLHB 3CLOA 4ZZDA 3QOEA 4M3BA 2NNNA 2E5ZA 3HSEA 4UUSA 2KHMA 3QRFF 4YEJA 1WJCA 4HNTA 1JI8A 3OR1C 2VC0A 4LFUA 1GUUA 5GAHJ 1SC7A 4GYIA 4QWQA 3T1BA 3HEFA 1VQPI 2QCOA 1P4WA 3CP8A 2IJLA 1IRXA 1P6RA 2G0EA 4CCMA 4DYQA 2DA5A 2FMLA 2Z5UA 2KDZA 2CV2A 1FTTA 1OCZH 3W2VA 4PJ0C 1GT0C 3CD6I 2OUMA 1VNDA 3CCEI 2MD5A 4II3A 5BQTA 2JQ7A 1XMKA 5LGUA 3FXJA 3V8JA 1YW7A 4IVNA 4XK4A 3OIPA 1REPC 5ICCA 3BTIA 3DP7A 5DCFA 1VQLI 2O5RA 2X1EA 4L5IA 5LBQA 2NS8A 3LOCA 2WAQA 5HS7A 1OR7A 2DLLA 1MBKA 1UELB 5EEHA 5JVTA 2K9MA 3HKZN 1TL8A 2HDDA 5AIQA 5F08A 3T0YA 4I0BA 5DYMA 3U2RA 4O5VA 1TWAJ 4I2OA 3I4NJ 5B1BH 2YPRA 3FXRA 1IXCA 1LEAA 1T33A 1IZ1A 2E5NA 1K6OA 4HX7A 3I4PA 4IL6C 1JKQC 1B59A 1VFCA 2E19A 5E1ZB 1MGTA 5GP9A 1DP3A 2P7CB 5EDNA 1G3WA 4N9HA 4EJTA 3SXYA 3RQIA 3HOTA 3ABLH 4X6AJ 2X48A 4XRSA 1GV2A 3RPUD 2DDBA 2IVMA 2CSOA 4A12A 2NYXA 3FXOA 5DCMA 1XMXA 4U87A 2MH9A 1YYVA 1K7AA 2CUEA 2RGVA 2VBZA 2JA5J 1JE8A 1VQNI 4ON0A 4PUSA 3KYLA 2XV4S 3CMEI 4L9TA 2BW3A 2F6CA 1K6YA 2QKMB 4EEFG 4A3EJ 4S04A 4YIRX 3HJEA 2LMDA 4XRSG 3W2AA 1TQPA 1HW2A 2JPCA 1WHUA 3Q9SA 1I5ZA 1XSDA 2Y48A 1XSXA 3I54A 3SHFA 4I01A 2MGQA 4BAYA 3MZHA 1MDMA 3K4KA 3HRMA 2LKXA 1B72A 5IYBJ 2DYRH 3CO6C 4BY1J 4ESBA 4QLCU 4HRIA 9ANTA 1T95A 4P96A 3ISPA 1D1BA 2L5QA 2JRTA 1Z7UA 2W57A 4DYRA 1EV7A 2EZLA 2FOWA 5DTDA 2BOLA 2VASA 3JR9A 3GTPJ 4OAZA 1L0OC 3WU0A 1XPXA 3PNVA 3HOXJ 3KZIC 3TMOA 3KP4A 1T56A 4RB2C 2LR8A 1V5EA 2M0CA 5TJJA 3QPSA 4EJWA 3FM5A 3VOEA 4UNOA 4ABZA 3VYTB 5HNFA 3ZN1A 1OLTA 4AVZA 3L2WA 2FBIA 4MTEA 1Z21A 3DV8A 1MBHA 2PMUA 3H3ZA 3R6SA 1NH3A 5D5WB 2A61A 3CC2I 1ZYRF 2PJPA 1ZREA 2VUMJ 1B8IB 2P81A 4OWRB 3FZVA 1I1GA 1TT5B 3J80K 1FTZA 3J7ZI 3ABMH 1TWFJ 2LP0A 1G2HA 2ZXJA 4XSZF 2GXAA 4QPOA 2HNHA 3QYEA 3S1RJ 4FETA 2LSOA 4A0XA 2K4BA 4D5FA 3KCCA 2JSCA 4A5NA 5ED4A 2KLOA 3V7CA 1IW7F 1CQTA 2LC2A 2A6EF 2Y69H 3KP3A 3N97A 2HYGD 3DPTA 3KP2A 2W7NA 1WQ2A 4WWCA 3ULQB 2MA3A 2Y30A 1QHHD 4ZDLA 3OYNA 2X1CA 2VT2A 2E35A 3DTEA 1BC7C 2CMPA 2LRDA 3BZKA 5M3FJ 4CCJA 2XF5A 5JHUA 4BGDA 3S3NA 4N9IA 2PMZN 5H6RA 5ICFA 4EM1A 3CCQI 3ZMUA 2FBHA 2A5WA 1XS9A 4XMYA 4RMNA 1HSTA 2DU9A 2O61A 2I8DA 3ZP5A 2L7FP 1FT9A 3FMRA 4CDGA 1QZYA 2HQAA 1RR7A 4N4NB 1UHMA 3WTVC 4G8XA 3E0JB 4XLAA 3NAUA 3Q9VA 2WB1A 2MABA 5L3CA 2CV1A 4U0YA 1PP7U 4BU2A 1STZA 2V6CA 5KVRA 4HOBA 1XGOA 1MH3A 3MKLA 3V7SA 3GMEA 1NG6A 2A6TA 5GADJ 4GFBA 2WY7Q 1UB9A 2ZNYA 2XROA 4EJUA 2XUBA 2YU9J 1U0JA 5L3FA 5D5UB 5FGMA 2VE8A
chains in the Genus database with same CATH topology
2Y69H 3X2QH 5IY5H 1V54H 3WG7H 3AG3H 5B3SH 1OCRH 2DYSH 3AG1H 3ABLH 1OCCH 3ABMH 2EIMH 1OCOH 2OCCH 1OCZH 2EILH 2EINH 2ZXWH 2DYRH 3ASOH 3ABKH 3AG2H 5B1BH 2EIKH 1V55H 2EIJH 5B1AH 3ASNH 3AG4H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y69 H;  3X2Q H;  5IY5 H;  1V54 H;  3WG7 H;  3AG3 H;  5B3S H;  1OCR H;  2DYS H;  3AG1 H;  3ABL H;  1OCC H;  3ABM H;  2EIM H;  1OCO H;  2OCC H;  1OCZ H;  2EIL H;  2EIN H;  2ZXW H;  2DYR H;  3ASO H;  3ABK H;  3AG2 H;  5B1B H;  2EIK H;  1V55 H;  2EIJ H;  5B1A H;  3ASN H;  3AG4 H; 
#chains in the Genus database with same CATH topology
 2LBF B;  2DDA A;  2AQF A;  2L9S A;  4Y17 A;  3KZY A;  2LDU A;  3RYR A;  2M8G X;  2EFP A;  1QVU A;  1G4D A;  2KJB A;  2WA0 A;  3TO6 A;  4QIW N;  4A3F J;  2VB6 A;  1FIP A;  2W1O A;  4KN7 X;  2XAJ A;  1RKW A;  1LFU P;  2EBI A;  3QQA A;  1JUS A;  3HPG A;  3S17 J;  1BJA A;  1BN5 A;  2XAQ A;  4M74 A;  4RAG A;  3ZQQ A;  1FC3 A;  4IO9 F;  3MEX A;  3MKW B;  2MFZ A;  1LFP A;  4DQ2 A;  1UG0 A;  2DJI A;  2VQC A;  1B4A A;  3IV5 A;  4CCO A;  1HKQ A;  2DA6 A;  4U0W A;  3ZQF A;  1DQU A;  3HRS A;  5D6E A;  4YG2 F;  2Z9O A;  1HW5 A;  5HOD A;  3OYJ A;  3K4M A;  4TV7 A;  1UG2 A;  2LKP A;  5E8G A;  1ZKG A;  3VPR A;  2ZJP F;  2UZK A;  1IUF A;  3CCR I;  1QA6 A;  4Q47 A;  3AG3 H;  1Q1H A;  3WGH A;  3HL2 A;  2Q8K A;  2H8W A;  3PO2 J;  1OYI A;  4XOT A;  1BR4 A;  3SZP A;  2Y2Z A;  4QSH A;  4IRG A;  1R58 A;  2MW8 A;  4BY7 J;  1K78 B;  2XHK A;  2EIN H;  4M9S A;  3SDB A;  1SMT A;  2HU9 A;  4FX0 A;  1GVD A;  3AG2 H;  2EIK H;  2QYO A;  4RB0 A;  3TL4 X;  2M34 A;  4BNC A;  1FY7 A;  5E1W A;  3BG7 A;  2YR2 A;  1Z91 A;  3JW4 A;  3M8E A;  3FHZ A;  2IGK A;  2V79 A;  1GDT A;  3S1M J;  5D4R A;  4RM2 A;  4OIP F;  2DQR A;  5FFZ A;  3ZQI A;  4IRH A;  3A01 B;  3JRG A;  1E0E A;  2X4H A;  1SD6 A;  4AWX B;  2M4G A;  1PP8 F;  3FMS A;  4A3B J;  2GZW A;  3M1C A;  3K70 D;  3SFI A;  4CGZ A;  5E17 F;  3QOP A;  1MSE C;  3VB2 A;  1H0M A;  1TP4 A;  1IXS B;  1OKR A;  4M9X A;  2RQP A;  4H4K C;  4M3G A;  5LRR A;  3SFZ A;  1K61 A;  1LDD A;  2GQQ A;  2DCE A;  5LFA A;  1JT0 A;  2Y31 A;  4LJZ F;  1WCM J;  5GTI C;  3S93 A;  3F21 A;  4C30 A;  2TDX A;  1LVK A;  4KNY A;  1IXR C;  3TO7 A;  1M1E B;  3BR6 A;  3PJR A;  4CXF A;  4II2 A;  1XN7 A;  2E1N A;  3GVA A;  2CS3 A;  1IG7 A;  3F3X A;  2DPU A;  4E6K G;  1W0T A;  1YQA A;  3SZG A;  4XN3 A;  2OBP A;  1P9Q C;  2B0L A;  3E6B A;  5TGT A;  1NHA A;  4R1H A;  2GM4 A;  2KJC A;  3BOQ A;  1SVM A;  1MJA A;  1JUM A;  1X1B A;  4RA2 A;  5FKL A;  3VEP A;  2M45 A;  3CUQ A;  2F4O B;  2ZSH B;  2Z2S B;  2IEK A;  2FXA A;  4AUX A;  1IF1 A;  5CQG A;  3UNG C;  3C1D A;  3IC7 A;  1SFX A;  1HCR A;  5K7Z A;  4L0Y B;  2NVY J;  5K5Q A;  5HDK A;  5ILV A;  4PZJ A;  5E79 C;  1LKX A;  4K2E A;  4M72 A;  1E3O C;  1PUF A;  3ABK H;  3RZO J;  1JUP A;  5JLW A;  1QZE A;  1TW2 A;  1W36 C;  3JCU C;  2VOP A;  1GHC A;  1J2X A;  2EFO A;  3M9A A;  3ZMT A;  1K83 J;  3OR2 C;  4A3C J;  1QPM A;  3R0J A;  1IV6 A;  1BA5 A;  1BR1 A;  3AL0 B;  2VON A;  1R1T A;  3JAM Z;  2HKX A;  2COM A;  2VBW A;  2XKP A;  4MLO A;  3NWT A;  5LGT A;  3DCF A;  5CPR B;  4CSW A;  2X9D A;  4BE1 A;  1D1C A;  2DK5 A;  2VBX A;  3HOU J;  4PJL A;  3KZZ A;  3PNY A;  4IOC F;  4FX4 A;  2H27 A;  3BCB A;  2FRH A;  2M4K A;  3H9G A;  5B1A H;  4B1R A;  3E6C C;  1IN6 A;  3VYU B;  1WFX A;  3ZRG A;  2H94 A;  2FSW A;  4HF2 A;  3O6B B;  1YI2 I;  1O7L A;  3GTM J;  3ZXS A;  3LWF A;  1R00 A;  1SD7 A;  4XLN F;  4RB3 C;  3L2Q A;  4RDU A;  2X6O A;  3G73 A;  1X1A A;  4YIF A;  2MLG A;  4IPA A;  1IJW C;  3D5S C;  3OYG A;  5L3B A;  2E2J J;  4LLL A;  3ABU A;  3BG6 A;  3CMY A;  3GLL A;  1TQM A;  1Z7L A;  2PFB A;  1QO0 D;  2GOX B;  3HRU A;  5CKT A;  2H1L A;  5E18 F;  3H5N A;  1O7F A;  2Z1D A;  3J81 Z;  5IPA A;  1F1Z A;  2ZC2 A;  5E3N A;  1AA7 A;  2IT0 A;  3FIS A;  4I0A A;  4KFC A;  1I3A A;  3JSO A;  1VQ9 I;  1SAN A;  1WH5 A;  3BPX A;  2JA8 J;  3G4S I;  3TQN A;  1CF7 A;  3TDU C;  2A3S A;  4A3K J;  2VN2 A;  2BY1 A;  3G3Z A;  4FTH A;  2CQ7 A;  4B43 A;  4DZJ A;  2RQQ A;  2V4J C;  2DO7 A;  2F5V A;  2DA4 A;  2QA4 I;  3H5A A;  4BJ5 C;  1IRG A;  4BQA A;  1TWC J;  4DZP A;  1OCT C;  2G7H A;  2RKH A;  3NAR A;  3H5R A;  5DS9 A;  2NS0 A;  4MQ9 F;  5KAI C;  3JRE A;  5BMZ A;  4KUM A;  2CW7 A;  3DF8 A;  2JVG A;  3AAF A;  4Q4Z F;  2FQ4 A;  5J1R A;  1XDU A;  1TBX A;  4IQJ A;  3KET A;  1I6X A;  3TOB A;  3CDL A;  4Y33 A;  2EH3 A;  2R92 J;  1V5F A;  2R7X A;  4AD9 A;  2F4I A;  4JX6 A;  5CVU A;  2JUC A;  2O7O A;  3S8P A;  1A6I A;  1S6L A;  3BTL A;  3FDY A;  1WJA A;  2GWR A;  3DBH B;  1MBF A;  2D2W A;  3KX2 A;  3PM1 A;  2XRN A;  4MGR A;  4X1E A;  2JVH A;  1D5Y A;  1U9O A;  2P4W A;  5HVQ C;  5EEG A;  1BI2 A;  3LSM A;  3MN2 A;  2HZD A;  4I02 A;  1KU7 A;  3S1N J;  4DBQ A;  2OTL I;  3FXU A;  4LB6 B;  4BEH A;  4BS9 A;  3LSI A;  3IHU A;  4WXH A;  1WSU A;  2KMU A;  1BC8 C;  2FD5 A;  2PMH A;  4HST A;  3FKI J;  1YO5 C;  2QZ8 A;  4XN0 A;  3RDI A;  2FNP A;  1R1V A;  4E7S A;  4U0V A;  5LD2 C;  3I9V 2;  3IP4 B;  1R49 A;  2NRA C;  2XAS A;  3CMA I;  2X1D A;  1JXS A;  3EUH A;  2EFW A;  4HW0 A;  4RGS A;  3OYC A;  5J1Y A;  2BY2 A;  1W7P B;  2FE3 A;  4IF4 A;  4LOC A;  3ZGK A;  1J75 A;  3WHB A;  1AKH A;  2HYJ A;  4MIM A;  2HEO A;  1FBU A;  4EGZ A;  5C44 J;  2XB5 A;  3WTW C;  2B7E A;  2JK3 A;  1FYK A;  4DNC A;  2QWW A;  1JGS A;  1OCO H;  5HS9 A;  3E5X A;  1TZL A;  5ERI A;  1N78 A;  2DMP A;  2K85 A;  2CV0 A;  1NK3 P;  2DA1 A;  1A04 A;  5ILU A;  4XLF A;  1Z9C A;  2K9S A;  2OQG A;  3H0G J;  5J3L A;  2R5Z B;  3AL0 C;  1R6R A;  2Y0S N;  4ETS A;  3VSL A;  3C2G A;  4M9Z A;  3SQN A;  3K6G A;  3TW6 A;  2IPQ X;  3F0C A;  4HNV A;  3RI4 A;  2E60 A;  3BT9 A;  3VYR B;  3IL2 A;  1LPQ A;  4LIV A;  5CVJ A;  4IHX A;  4LK0 F;  1CGP A;  3CUO A;  2M3A A;  1KQ9 A;  3PQK A;  4V2F A;  4P5O A;  1Y1W J;  1RET A;  3B6C A;  4B48 A;  2Y0M A;  1WWX A;  5B5E C;  1L3L A;  2JT1 A;  4WXD A;  2VXD A;  1P4X A;  3RIR A;  4GCV A;  3PUB A;  3I5U A;  2PN6 A;  3L00 A;  3FK7 A;  4PFP A;  4XOP A;  4AID A;  2ZFW A;  3C7J A;  5FKK A;  4YFK F;  3U1K A;  3CCL I;  2BY3 A;  2OAZ A;  3CJN A;  4BH9 A;  4UVB A;  2GLO A;  3WOD F;  2R0Q C;  4PGG A;  2BXZ A;  2PJR B;  4MFD A;  4EAT A;  5K5R A;  3JRC A;  3LFU A;  1HBX G;  2VKD A;  3KE2 A;  5HNH A;  3K0L A;  1LE8 A;  2R7D A;  4D5C A;  3GXO A;  3MZY A;  2H1K A;  4A5M A;  3RKQ A;  1ZR2 A;  3NEU A;  2EFQ A;  3BLY A;  1R5G A;  1R5H A;  2EJR A;  1A35 A;  2BXY A;  5FLM J;  4PK4 A;  1T0F A;  1HDD C;  1I3Q J;  5EZH A;  4FE4 A;  2GAU A;  3FBI B;  3BTC A;  3ZOB A;  1SEU A;  4N4O B;  3DKX A;  1T08 B;  3FM3 A;  4ZYE A;  1DDN A;  3L2C A;  1ITY A;  4NQW B;  2L9V A;  1RUN A;  1ZH5 A;  3QU6 A;  5C4J J;  4YFN F;  4A3M J;  1FIA A;  2R3S A;  2Q0O A;  3QP5 A;  1GXP A;  3W6V A;  3MZ8 A;  4IRI A;  3GCM A;  2VQG A;  1OCC H;  2EIM H;  4IHW A;  4OMZ A;  4P9F A;  2NNY A;  4BE0 A;  3OYF A;  2XPU A;  1SD5 A;  3HOW J;  3OL4 A;  3FF5 A;  4O6J A;  4UVC A;  4Y52 J;  3WHC A;  3IWZ A;  1HW1 A;  1BIA A;  4NC7 A;  2QBY A;  4XM3 A;  1BR2 A;  2AXT C;  2M87 A;  4BBR J;  1Q1V A;  2ZME A;  1ONV A;  3GZN B;  1MBG A;  4F52 A;  2IBD A;  3DU5 A;  2Y9Y A;  4HAM A;  3R60 A;  2LRE A;  1R9T J;  4A93 J;  1B9M A;  3MKY B;  3S2D J;  1FMV A;  3DKW A;  1EA3 A;  4A3I J;  4EM0 B;  4Q5S F;  1X3U A;  3K69 A;  4GRI A;  2ID3 A;  3M7G A;  2IGO A;  4GDF A;  3OS2 A;  1WJB A;  3DBL B;  4MEX F;  3KLO A;  1XSV A;  4IHT A;  4I76 A;  4NBQ A;  4KT5 C;  4RGR A;  2M8E A;  4YEL A;  3ZQ7 A;  3NWS A;  1OMI A;  3R0A A;  3I64 A;  2GIZ A;  2CQX A;  1RIO H;  4IHY A;  1G3Y A;  2KRF A;  2WTE A;  3K9T A;  2YX7 A;  3KEQ A;  2JN6 A;  1WJD A;  3L2V A;  2KPM A;  3OYL A;  5DDG A;  2Y9Z A;  3LAJ A;  2OCC H;  1KQ8 A;  2W00 A;  1Y56 A;  3GFI A;  3KP7 A;  2V1D A;  1YJN I;  3I59 A;  4M6V A;  3PFY A;  4AYB A;  5EGO B;  1Y8Q B;  3LSH A;  3ASN H;  3PUF A;  3H92 A;  4F3Q A;  3LQQ A;  3HUG A;  4B3A A;  2L2O A;  2A6H F;  2O3F A;  5DD8 A;  3F9K A;  5L3E A;  2ZSI B;  4XNF A;  1ZAO A;  4CCN A;  2R5Y B;  2DYS H;  5JI6 A;  3IRR A;  2QSH X;  2E2I J;  3I55 I;  2VPL A;  1ZEL A;  2H09 A;  5EEA A;  2GBY A;  3DLL F;  1MD0 A;  3ZPL A;  2MBF A;  4LG0 B;  1IC8 A;  2FOK A;  1FWZ A;  1T8I A;  1F9N A;  2DQL A;  3HSR A;  2IGN A;  3KP5 A;  1IRZ A;  5D8L B;  1ENH A;  3ZMZ A;  1YIJ I;  1MZB A;  1U2W A;  2R93 J;  3FMQ A;  3HC7 A;  3ZCO A;  5BPI A;  1UCR A;  5L3G A;  1USS A;  4E7J A;  2WAE A;  4BQO A;  2HPM A;  3KEO A;  3ZQL A;  2P5L C;  3VDX A;  4CYC B;  2DTR A;  3J7A O;  3AG1 H;  3GZ6 A;  1IN7 A;  2UXN A;  3LSP A;  4BDZ A;  1B1B A;  1BBY A;  5KCM A;  1XTA A;  3FBN B;  1VQM I;  1R22 A;  3PFI A;  3BQY A;  1W5S A;  3M07 A;  4WF2 A;  1SMY F;  3C2H A;  2F48 A;  1GV5 A;  3CJQ B;  1YIO A;  4B47 A;  4I7H A;  2DA2 A;  4ENM A;  1U5T B;  5E1X A;  4AIH A;  2XPW A;  1HXD A;  5HS8 A;  3TBI A;  3HOV J;  3REO A;  4DJA A;  1IV8 A;  3GTG J;  4XKW A;  1OYY A;  2HQR A;  4XLE A;  5LHG A;  2O0Y A;  4I09 A;  4DBR A;  2M5W A;  3CCV I;  2O8X A;  2ESN A;  5IP7 J;  5J8F A;  2HR3 A;  2MH2 A;  2BHY A;  3G2B A;  2RC4 A;  3BJ6 A;  3HKZ A;  4RAZ A;  3KEY A;  3KLN A;  2DFF A;  3OYB A;  2WAF A;  2W24 A;  3LQR A;  1HSJ A;  4XRM A;  3H9Q A;  1ZAR A;  1MMD A;  2XF7 A;  3EUA A;  1Z77 A;  1MMS A;  1JTY A;  3U1D A;  2VKE A;  1X1C A;  3GYH X;  4C9Y A;  3KFW X;  4V19 K;  4M3F A;  1O3T A;  2EIL H;  2XGE A;  2JRM A;  1DPR A;  1BOA A;  4M73 A;  1BW5 A;  4OIQ F;  2ELJ A;  3SDG A;  4BUP A;  3ERM A;  5F6F A;  5L3D A;  4CZZ A;  3A02 A;  4Z6Y A;  2KIF A;  2L54 A;  3RPQ A;  4NC6 A;  2A68 F;  1RZ4 A;  2JMW A;  4BHP A;  4XSX F;  1YRN A;  4AIJ A;  3ZMS A;  2K40 A;  4CO8 A;  1JKP C;  1FSE A;  5FRN A;  2IS2 A;  5BNG A;  2LK2 A;  3UR3 C;  1LFB A;  3D5L A;  4D1Q A;  2WC2 A;  2RN7 A;  2R7V A;  3H3V K;  4R8H A;  2VXZ A;  1HC8 A;  1W4M A;  1XGS A;  4J19 A;  3OSG A;  1IDY A;  2V7F A;  1CF7 B;  4M71 A;  2N8G A;  4IQ4 A;  5LHI A;  1NK2 P;  3JAM K;  2Q2E A;  1G8X A;  3LA3 A;  5FLX Z;  5EYR A;  2V1X A;  4P55 A;  3MD2 A;  2V9V A;  5IOY A;  4O3M A;  1YTY A;  3AKZ A;  2QKL B;  4M6Y A;  2DW4 A;  1UHS A;  4E7L A;  3GWZ A;  2EWN A;  1S29 A;  2CUF A;  3RKY A;  3HGG A;  1IDZ A;  2XAU A;  2BV6 A;  3ZMD A;  4KYW A;  2NVU B;  1O4X A;  3I53 A;  3IKV A;  2KRC A;  3S14 J;  1WJE A;  1U78 A;  4XBF A;  2QM3 A;  2QLZ A;  2K9Q A;  1FX7 A;  1X1D A;  4L9N A;  5LGN A;  2BBY A;  3L2U A;  3H1C A;  2LLK A;  5KNL A;  3CC7 I;  4IKF A;  2IS6 A;  4BKX A;  1V54 H;  4RM3 A;  3P7N A;  2XIG A;  3L1P A;  2D45 A;  3F8N A;  3A2K A;  2DFH A;  3HHH A;  3L9F A;  5AON A;  1YJW I;  1KYZ A;  3DLA A;  3BQZ A;  3OS1 A;  1QVT A;  1FJL A;  1I39 A;  2HPI A;  4E7I A;  3J81 K;  2XB0 X;  3BG5 A;  3KIO A;  1TTY A;  2L02 A;  1DPU A;  2VQL A;  3K4J A;  2HOT A;  2GOM A;  3EPZ A;  2YX4 A;  4CH7 A;  1Z3Y A;  5CVR A;  4LGW A;  1EH7 A;  1S7O A;  4E7K A;  2VKV A;  4C2U A;  3H35 A;  1AWC A;  2ISZ A;  2LOO A;  1JJ6 C;  3E3V A;  1RNL A;  4OMY A;  2RV8 A;  2KZG A;  4DGW B;  4KN4 X;  3ROU A;  5EG0 B;  5TRD A;  1GLN A;  3K70 C;  3T8T A;  5GAG J;  4FAS D;  4E7Z A;  4KA4 A;  2OV7 A;  1FYM A;  4BQQ A;  4HNU A;  3K4B A;  1U5T C;  4XRF A;  1D0Z A;  2GXG A;  3CCY A;  2ADU A;  2PMZ A;  1Z0X A;  2BY0 A;  3MAJ A;  5KK1 A;  3W6J B;  4D0P A;  2X0L A;  3OYE A;  4OU0 A;  2HVQ A;  1HF0 A;  3ZN0 A;  2L3D A;  1WI9 A;  3K4C A;  4BJT A;  2VJI A;  5EF6 A;  3CMM A;  4EJV A;  1JKO C;  4G94 A;  3HTS B;  1S3J A;  2V26 A;  2WAD A;  1D3Y A;  2VOO A;  3S32 A;  3SEZ A;  1DU0 A;  2ME0 A;  1FOW A;  1V5G A;  2P6S A;  1J0R A;  3BR0 A;  1JT6 A;  5TIS C;  3CCM I;  4M6X A;  1JJ8 C;  1MJ9 A;  2Z3Y A;  3H0D A;  1T98 A;  1LB2 A;  3WE2 A;  3HM5 A;  2DT7 B;  2D1V A;  3VFZ A;  4R79 A;  2BYV E;  2ELH A;  1ZG5 A;  4A3G J;  4RLF A;  3EQL F;  2QEX I;  1H8A C;  1ZLK A;  1O57 A;  4Q48 A;  4XL9 A;  4ZZL A;  2HI3 A;  1TW3 A;  5A2Q Z;  3BDD A;  3U9G A;  2FMY A;  2M1B A;  3WGG A;  2HXI A;  4JYK A;  3H3U A;  4PFO A;  2JA6 J;  1D0X A;  1R5I D;  2R7F A;  3CDH A;  3E5Q A;  1ULY A;  2OD5 A;  2CWE A;  1QZZ A;  3F6O A;  4G12 A;  1U8R A;  4XON A;  3MFK A;  1MMA A;  3E1S A;  4UXN A;  4AC0 A;  3F8C A;  3OYK A;  1QHG A;  1WH7 A;  3RSN A;  4A3J J;  1T38 A;  1JKR C;  3VYS B;  2FQ3 A;  1YIT I;  2CJJ A;  4HLY A;  2P7V B;  2XAG A;  3ABT A;  5FKM A;  2CQK A;  2LY1 A;  1YE9 A;  3PO3 J;  1VI0 A;  5J8C A;  4S05 A;  1Y8R B;  2NAZ A;  2X85 A;  1JGG A;  4ENN A;  4ZYH A;  3IAM 2;  2DA3 A;  4W1U A;  4B4C A;  2AHQ A;  5K7H A;  1XGN A;  3V7R A;  2CW8 A;  3FXQ A;  4ESJ A;  5B3S H;  3FIW A;  3G71 I;  3DEU A;  4UUS B;  2HQN A;  3F23 A;  1TQI A;  1K79 A;  3BWG A;  2ISY A;  1ON1 A;  2MD0 A;  5LEJ A;  4M3D A;  1T39 A;  3M3Y J;  2VIX A;  1HQC A;  2DOD A;  4HV6 A;  1O3Q A;  3QPH A;  3OYH A;  2CUJ A;  2K7L A;  3H36 A;  2W4S A;  4G7O F;  1BI1 A;  2TCT A;  3CF5 F;  1SVO A;  4KIG A;  3R4K A;  4D7N A;  1B8I A;  4RLQ A;  2IW5 A;  1W36 D;  1MNM C;  4NUB A;  1ZRC A;  1OYW A;  3OYM A;  4PCQ A;  4LMY A;  1A31 A;  4ZJZ A;  3FXL A;  2NOJ B;  2OCE A;  3TP0 A;  2PI0 A;  3RKX A;  1J59 A;  3GTO J;  3Q3S A;  3PNT A;  4HF1 A;  4ZTJ A;  1O3S A;  1VF9 A;  2JA7 J;  2W85 A;  1VQ5 I;  5FFX A;  2KT0 A;  1I1S A;  2KRH A;  2WY8 Q;  1GVJ A;  1HA8 A;  1VQK I;  4IEJ A;  1MND A;  4RB1 A;  3VSK A;  5HOO A;  4PSW A;  2ZCW A;  3H9J A;  3PL8 A;  1ERD A;  2IS1 A;  2STW A;  2KQR A;  4UHT A;  2HQ5 A;  1W5C C;  2E1M B;  1I27 A;  4Z2Y A;  4IZZ A;  3BCA A;  2ICW G;  3B6A A;  2W84 A;  2UXX A;  5D6F A;  3OIO A;  4FHT A;  1J5Y A;  4BXX J;  1R4M B;  1FMW A;  4D7M A;  4BQN A;  3O2P E;  3GTQ J;  3PIP F;  1G59 A;  2G7U A;  5GAE J;  3COA C;  3RZD J;  1P7I A;  3IKT A;  3HDD A;  1UZC A;  3VOD A;  4HX4 A;  1LQ1 A;  3BR1 A;  4UVA A;  5DCM B;  3P9C A;  4YII A;  5JVG F;  1YW9 A;  1EH8 A;  1ZN2 A;  2QUF A;  4JOM A;  1X2N A;  1UAA A;  2HOA A;  3QAH A;  1XC5 A;  3S3O A;  3CCU I;  4E7H A;  2R7R A;  5GPC A;  2L7Z A;  2BW3 B;  1MMG A;  5CYV A;  2AO9 A;  1ETV A;  4CCL A;  2IA1 A;  4BBS J;  3ML6 A;  3CTA A;  2LBF A;  4RAY A;  4IX7 A;  2E36 A;  2HFH A;  1X4P A;  2DFI A;  1MDM B;  1B72 B;  3EYI A;  1S7E A;  3FKJ A;  3O8G A;  4LIT A;  1G3S A;  2HDC A;  4A0Y A;  4UY8 I;  3WG7 H;  1ETK A;  1P7J A;  1IGN A;  2LG4 A;  2R7U A;  2COB A;  2PLY A;  2EB7 A;  3V42 A;  3GX4 X;  4X0G A;  2M9H A;  4DIQ A;  1PUE E;  2O03 A;  2E34 A;  3WTY C;  4C2M J;  1B9N A;  2FJ1 A;  2CG4 A;  3ONQ A;  2X6W A;  5J40 A;  3OIQ A;  2RNJ A;  1BL0 A;  3JRH A;  1MW7 A;  2K3F A;  3OYD A;  1J7K A;  2WWY A;  4RAF A;  2DOF A;  3JRD A;  2NXN B;  1MH4 A;  3S15 J;  1UMQ A;  3JRI A;  4DYC A;  3I3L A;  4Y13 A;  2A69 F;  3LA2 A;  4PJJ A;  1IN8 A;  3K10 A;  1SVL A;  5E20 A;  3CES A;  5IOZ A;  1K78 A;  1N75 A;  3BJO A;  3F8F A;  4HV5 A;  3P5J A;  2LVS A;  4EV0 A;  3JSP A;  2P0W A;  4MNU A;  1RUO A;  2D5V A;  5ILS A;  1QNT A;  1DUX C;  5F0H A;  2AXL A;  1O3R A;  4UUT A;  4A2U A;  2X51 A;  2OC6 A;  5H6Q A;  1RC9 A;  2TRT A;  2KIQ A;  1JHF A;  1F5T A;  1J09 A;  2UV1 A;  2EZK A;  5HDG A;  3A03 A;  3A01 A;  2IAI A;  4P1W A;  3CCS I;  1VQ7 I;  1H89 C;  3DEE A;  4F93 B;  3F6V A;  2ME6 A;  2WAQ N;  3TDZ C;  2PBI A;  4OIO F;  4C3I J;  2EZH A;  4XR6 A;  2I5U A;  3PIO F;  2E1C A;  2KIU A;  3MMY B;  4HDU A;  4HF0 A;  4GO1 A;  1D0Y A;  3F8B A;  3CF2 A;  3CQZ J;  1ZGW A;  1P4A A;  2NVX J;  1X3Z B;  2QQ9 A;  4NNJ A;  3T8R A;  3U21 A;  5LEK A;  2GIV A;  2W25 A;  2DT5 A;  3MVP A;  3LNQ A;  4LD5 A;  2HZT A;  1MSF C;  3AG4 H;  4UV8 A;  1HLV A;  4NC8 A;  3NRV A;  3ZQG A;  3I58 A;  4AM3 A;  1YJ9 I;  3HHG A;  2OZ6 A;  3IAS 2;  1OR7 C;  4MTD A;  3LA7 A;  1PJR A;  3PSI A;  1IO2 A;  5HLG A;  1Y0N A;  3M1E A;  1BJZ A;  5K1Y A;  4HDV A;  2JA2 A;  2HDW A;  1X19 A;  4XQF A;  3DFG A;  3JRA A;  3DPL C;  1FOK A;  2C6Y A;  3V4G A;  2E1M C;  2XGC A;  2XAF A;  5F0F A;  4XLC A;  1R7J A;  1VQO I;  1SFK A;  1BM9 A;  1U3E M;  3W2W A;  1E3H A;  2HOS A;  1QU3 A;  2ZB9 A;  4J01 A;  3O3K A;  1UFM A;  1D1A A;  2DT6 A;  3CO7 C;  3D1N I;  2KIM A;  3BZ6 A;  2Z33 A;  1Y1V J;  5DD4 A;  2K86 A;  3RQ4 A;  1I50 J;  1KYW A;  1FP1 D;  4A6E A;  1WI3 A;  2NOG A;  2M7B A;  4F92 B;  4KMF A;  4MQV A;  3CCJ I;  1U6G A;  5E3O A;  2KL4 A;  5M5X J;  1WKM A;  5DEQ A;  3RTR A;  2XC7 A;  5C3E J;  1AOY A;  1IN4 A;  1ETW A;  1SAX A;  2X6X A;  4BYY A;  2DPD A;  3D0S A;  4NDL A;  4XKV A;  1U9N A;  2LY2 A;  3I4M J;  1A36 A;  3CC4 I;  2DAO A;  2F5F A;  2VC1 A;  1VQ8 I;  2J5P A;  1YS6 A;  4EMS A;  4I6Z A;  1TNS A;  2IP2 A;  3TED A;  3F8M A;  4JX4 A;  2LD5 A;  5FO5 A;  2KKO A;  2ZKZ A;  2M7A A;  1A6Q A;  3OS0 A;  5D5X B;  1WRJ A;  3WTT C;  3VWB A;  2HWV A;  4KIT B;  5FJ8 J;  5M5Y J;  3DBR B;  1ZK8 A;  2LH9 A;  1MIJ A;  4H0E A;  2Y0S A;  1I6H J;  1NTC A;  3BG3 A;  3PSF A;  1SFO J;  4NHJ A;  3IUO A;  3M4O J;  3GUD A;  4D9J A;  3DKY A;  5CLS A;  1ZG3 A;  5FLX K;  3LST A;  4E4H A;  3GF2 A;  4A6D A;  2FUG 2;  2JTV A;  2I10 A;  3TOA A;  2NS7 A;  5C4X J;  2K9L A;  3JTH A;  3OV8 A;  1ETX A;  3MKZ A;  4BAC A;  1DGR M;  2ZXH A;  3HTU A;  1SFE A;  3WE3 A;  2JZY A;  5FKO A;  2F5C A;  5KHD A;  1RR8 C;  4UV9 A;  3FHN A;  2VLA A;  1EF4 A;  5F1R A;  4JX5 A;  5FLV A;  2A5Y B;  2R4G A;  4Y7N J;  1OPC A;  4C3H J;  2F2E A;  4G6Q A;  1K4T A;  2MC4 A;  1S5L C;  5J4Y A;  1LJ9 A;  5F04 A;  2DMN A;  4Y4R A;  2XSJ C;  1YOV B;  1ON2 A;  3P9K A;  4BXU A;  4DW6 A;  3P9I A;  1Y39 A;  1W7P D;  3RKW A;  1VQ4 I;  2XRL A;  1FBS A;  2PEX A;  2EFN A;  1R1U A;  3RCO A;  5H2F C;  5DUI A;  2WB1 N;  2LF7 A;  1Z05 A;  2QGU A;  2Z99 A;  3HZJ A;  3G1O A;  2IA2 A;  5J47 A;  3FXM A;  4LB5 A;  3V8K A;  3CUQ B;  2E71 A;  2P8T A;  4NB5 A;  3DEW A;  2WV1 A;  1BIB A;  2OU2 A;  2KIS A;  2QVO A;  3BZC A;  3M8J A;  5D5V B;  2HYF A;  4XKC A;  1FNN A;  5IP9 J;  2R7S A;  1V55 H;  3IH3 A;  4U7B A;  2UUZ A;  3QPL A;  2XGD A;  1UHW A;  1PUF B;  2BVM A;  3WTZ A;  1G3T A;  2A05 A;  4CCK A;  4RBO A;  2XKO A;  2JJ7 A;  2DN0 A;  3I71 A;  1FZP B;  2EZI A;  2L9N A;  2R7W A;  5JHF A;  3ELK A;  1QQI A;  3PQJ A;  3RPU A;  4V2G A;  4G6T B;  1UJ8 A;  2XF6 A;  2F4M B;  3Q0U A;  1Z1D A;  2XAH A;  1ETY A;  2VE9 A;  2DTZ A;  2LFB A;  1W0U A;  2OZU A;  2R7Z J;  5CVI A;  3MWM A;  2ZO4 A;  2ZJ2 A;  4C2T A;  1W7P A;  4CIC A;  1YX5 A;  4Y3O A;  1LUJ B;  2BE5 F;  5IP6 A;  3DXJ F;  4ZC3 A;  2KDO A;  3GO5 A;  2MYS A;  5IY5 H;  5AIP A;  4B44 A;  3SJM A;  4HZF A;  4MHG A;  1FSH A;  2EK5 A;  2D1H A;  1OCR H;  2FNA A;  2O9L A;  1B6A A;  1XG1 A;  2IXS A;  3HOZ J;  2JPB A;  4BDY A;  3KYC B;  5A2Q K;  4P9U A;  1MMN A;  4JK1 X;  5BS6 A;  4WCG A;  2LNB A;  1HKT A;  3GZ5 A;  2QQB A;  3TO9 A;  3BJA A;  4QTR A;  4XOR A;  2R5Z A;  4GYG A;  2ZXI A;  3HOY J;  2B9S A;  1Z3X A;  2VQH A;  3A0B C;  2LY9 A;  3ASO H;  3S16 J;  3ZQC A;  3W3C A;  3KP6 A;  4U88 A;  1IUY A;  3GTK J;  1RKT A;  3AFH A;  3K1P A;  3LMM A;  3X2Q H;  4HLX A;  2JUG A;  2W48 A;  2FEZ A;  2ETH A;  1VZ0 A;  3A0H C;  2O6G E;  1FBQ A;  1ZGA A;  2E7X A;  2JSP A;  4ZDP A;  1LVA A;  1ETQ A;  1WVR A;  4ASN A;  4F55 A;  1QBJ A;  4AIK A;  4A3D J;  5IT9 K;  1XCV A;  2MG4 A;  1ZGJ A;  2E1O A;  2EV0 A;  2V9P A;  1YS7 A;  2M2E A;  3HYI A;  4UB6 C;  2UWM A;  2PJR A;  4IOA F;  1ZTR A;  5F27 A;  3LSK A;  4C3J J;  2DI3 A;  1R23 A;  2EV5 A;  2VBY A;  1YG2 A;  3O8H A;  3TP3 A;  4RGX A;  3EUK L;  2H6C A;  4S0H B;  5GTH C;  2IGM A;  2CQQ A;  2BGC A;  4N0B A;  3QYB A;  3A4C A;  4XLP F;  2IA0 A;  1BI0 A;  3E7L A;  4FE7 A;  4ZYD A;  1IAW A;  5LRS A;  3OWT A;  2CW0 F;  3NQO A;  2H8R A;  4ENJ A;  1EKE A;  2LF8 A;  3GW2 A;  3K1N A;  2FA5 A;  1LEB A;  4FQG A;  4JP0 A;  4WX9 A;  4MFE A;  2RRE A;  1X2M A;  1J9I A;  3SYT A;  3OSF A;  1BOB A;  1FPQ A;  1ORK A;  1VTN C;  2ACJ A;  4ESF A;  4NQW A;  2L9R A;  2B63 J;  4BL0 B;  3GEZ A;  1OCP A;  2HVS A;  3BG9 A;  3D5R C;  3C2B A;  2FU4 A;  3HGY A;  3C18 A;  1MNE A;  2QF7 A;  2DK8 A;  3W6K B;  2DOA A;  5FD5 A;  5M5W J;  3L09 A;  1POG A;  2L01 A;  2MSY A;  3B02 A;  5BOX A;  2EQR A;  1IRF A;  5E8I A;  4LLN A;  3S2W A;  1OFC X;  3ZMV A;  4W97 A;  1H88 C;  4LIU A;  1Z6R A;  1F4K A;  3J7A Y;  4A0Z A;  4BEH B;  2RNG A;  3B73 A;  2KP6 A;  2CYY A;  1YFH A;  4L0Z B;  2A07 F;  4A69 C;  1E17 A;  1PDN C;  3S2H J;  3C3W A;  1C0W A;  1TWG J;  1D5V A;  1JTX A;  3CUQ C;  2PQ8 A;  2ZJR F;  1WJF A;  3CJT B;  2OQR A;  4AU7 A;  3LL7 A;  3CZ6 A;  3E6D A;  3N05 A;  4HSR A;  4I98 B;  3IWF A;  1WJ5 A;  1AHD P;  1HKS A;  3OMY A;  3K2Z A;  1AKH B;  3KPH A;  2K9N A;  2O8K A;  3Q0W A;  1AU7 A;  4ENK A;  5FD6 A;  1ETO A;  4HX8 A;  4BJ6 C;  4EQQ A;  3WG9 A;  3LSR A;  2K4J A;  1VQ6 I;  1T6S A;  2HOE A;  2QQ8 A;  2RAE A;  2NVQ J;  1APL C;  2LYC A;  2L4A A;  4LG3 A;  4G6D A;  2RVC A;  4DOZ A;  3HG9 A;  2FX0 A;  2ZJQ F;  1S72 I;  2MC3 A;  2P5V A;  1NG7 A;  1X1P A;  5JLX A;  5JR3 A;  2QSF X;  1Y6I A;  2K3P A;  3E6M A;  3WU1 B;  2PX9 A;  1A5J A;  2AS5 F;  5EGO A;  1QPI A;  3R61 A;  3GFL A;  3WU2 C;  1ZG1 A;  5D8K B;  1SAU A;  2HGC A;  1U8B A;  4UB8 C;  1DP7 P;  5H20 A;  3I0T A;  4FCY A;  1KA8 A;  2EIJ H;  3EDP A;  2HTJ A;  1WGX A;  2R5Y A;  1MKM A;  3SZT A;  2NVT J;  3J80 Z;  1G6N A;  1LNW A;  3DU6 A;  3DTI A;  2VKH A;  1XD7 A;  1RI7 A;  1X4O A;  3GTJ J;  4HPQ A;  3JRB A;  4L9J A;  2ID6 A;  4LG0 A;  3CLQ A;  3RJP A;  1F36 A;  2XSD C;  1BW6 A;  1EH6 A;  2YS9 A;  1TT0 A;  2HS5 A;  1H9G A;  1LE8 B;  1SFU A;  2BZT A;  4ZDO A;  1OIS A;  1DU6 A;  3LAP A;  2L7K A;  4HEA 2;  3A1Y A;  2DFE A;  3FWE A;  5CVV A;  1XGM A;  2OTJ I;  2MLK A;  4JQF A;  4CYC A;  5IT9 Z;  1GXQ A;  4HA8 A;  2AQE A;  3E5U A;  1KZH A;  4PJN A;  3GLX A;  1Z67 A;  3L2R A;  3ECH A;  3GFM A;  3CJR B;  1FLI A;  3F22 A;  2E2H J;  5F64 A;  4HQM A;  4BXF A;  1S7A A;  2BEO A;  5IT3 A;  2VJJ A;  4LLG F;  4KIC A;  3WTS C;  3EET A;  2OF7 A;  3I56 I;  1ZRD A;  3K1M A;  5K5O A;  3JTG A;  4L18 B;  1V4R A;  3QYF A;  4F7Z A;  4CHU A;  1HDP A;  2VJ4 A;  2YUS A;  1U5T A;  3WTU C;  3DPU A;  3E97 A;  5J6X A;  4WXC A;  1X3W B;  2F5E A;  3OYA A;  4HQE A;  3DQV C;  1TC3 C;  4A3L J;  2BVL A;  2E7W A;  3BR3 A;  5ICG A;  1KU3 A;  5DV5 A;  4YRV A;  5B66 C;  3BR5 A;  2RDP A;  2QBY B;  4EM2 A;  1IN5 A;  2DMU A;  1S8N A;  2FBK A;  2M30 A;  2ZME B;  2VOD A;  2CH0 A;  2Z16 A;  3LSG A;  5IYC J;  3UKG A;  5DM6 F;  2V1U A;  2M0M A;  3L7W A;  4BHC A;  2ZXW H;  1ZR4 A;  2PG4 A;  3IH2 A;  2STT A;  4KMU X;  2G9W A;  5HLI A;  2L7M P;  4L5E A;  3FX3 A;  5HLT A;  3BC8 A;  4L9V A;  1N77 A;  4EGY A;  1XX5 A;  1TWH J;  4B8X A;  4XID A;  4ZH4 F;  2KFD A;  3BY6 A;  3HXL A;  3OOP A;  5CQE A;  3RYP A;  1BI3 A;  1MBJ A;  4XKB A;  1T2K A;  2ESH A;  4IJA A;  3LSJ A;  3V8L A;  2Y75 A;  4Y15 A;  3OY9 A;  4IHV A;  4EVI A;  4JBA A;  3FK6 A;  2DJN A;  2VI6 A;  1W1W E;  1DGW Y;  3Q0V A;  5EZG A;  2WBM A;  3HSF A;  4PGH A;  4HYE A;  3G6E I;  4PSX A;  4J00 A;  2W82 A;  4KJZ A;  2J5O A;  1JHH A;  5D4S A;  1P2F A;  2F5D A;  2R7T A;  1LDJ A;  5HDN A;  3EYY A;  4I99 C;  4UUV A;  4L5J A;  2K5C A;  3QWL A;  5BPD A;  1WZ2 A;  2H6B A;  3EUH C;  4IHS A;  2HXO A;  1EJ9 A;  2CFO A;  3I59 B;  1KON A;  1YHQ I;  1UST A;  2R7O A;  2ZFU A;  3HUG B;  2VPR A;  4G7Z F;  4E70 A;  1FP2 A;  4B3X A;  4EJO A;  4G7H F;  1HOM A;  3ZR8 X;  2ZNZ A;  3CDI A;  2OPT A;  1R71 A;  2CFX A;  3OYI A;  3K2A A;  4FT8 A;  2CQN A;  3HPH A;  4LK1 F;  5KAF C;  1H9T A;  2KZV A;  3MQ0 A;  5LHH A;  4U7D A;  2V1N A;  3S1Q J;  2WV0 A;  1E3P A;  2XVC A;  3F72 A;  1X58 A;  3IH4 A;  4OAY A;  1K4S A;  2EPF A;  5EJC A;  2OJE D;  5M3M J;  2LTP A;  3QP6 A;  1MBE A;  2VL8 A;  5K7F A;  1ODD A;  3JRF A;  1FOX A;  5DM7 F;  5F1J A;  3N4M A;  4IXA A;  4XIC A;  3K4L A;  1Z6T A;  5LLQ A;  2FF4 A;  4ZYG A;  3OOU A;  2XDV A;  5DUK A;  2CU7 A;  4AVP A;  2JWT A;  1MJB A;  3KYD B;  4B09 A;  3Q5F A;  1ZHF A;  2ZBK A;  4ANJ A;  1W5T A;  1YW8 A;  4FIS A;  3HBL A;  5ICE A;  4KDP A;  4RS8 A;  4QPQ A;  3M8F A;  4KT6 A;  2V9K A;  3LFK A;  3QU3 A;  5E3L A;  4BHB A;  4OIN F;  5FRM A;  4MEY F;  3WGI A;  4CYD A;  5FRO A;  2XPV A;  1YX3 A;  1P92 A;  1XCB A;  2HTS A;  4KIF A;  2X6Y A;  3K7A J;  4G9Y A;  3OL3 A;  1TNT A;  4M3E A;  1D8J A;  1T0F C;  1Y0U A;  3HRT A;  5GPA A;  1QRY A;  2CUZ A;  2IRF G;  1KU9 A;  2EA4 A;  3QOD A;  4HG2 A;  4MO7 A;  4ITV A;  5EG0 A;  3IRQ A;  2V6E A;  1XB4 A;  2GA1 A;  3HOS A;  1D8K A;  1E2X A;  2DOE A;  3ECO A;  2P5K A;  1QGP A;  4ZYA A;  5J1U A;  1RRJ A;  1ZLJ A;  2DMT A;  2YU3 A;  3GFJ A;  4OIR F;  2IS4 A;  1RPW A;  3BP8 A;  1SD4 A;  1XMA A;  4ZTF A;  3TKY A;  3BR2 A;  1FYL A;  2GA2 A;  2YSR A;  2CRG A;  1OQY A;  1RES A;  2HVR A;  4OOI A;  5FB2 A;  4HBL A;  3S3M A;  2QQA A;  3GTL J;  1FEX A;  2ECB A;  2L4M A;  4XLH A;  3DTK A;  1ZRF A;  2R7Q A;  3SEQ A;  2HKO A;  3G1M A;  5E3M A;  3WTX C;  1OJL A;  5IYD J;  2ZME C;  1PYV A;  1KQ0 A;  4YFX F;  1R36 A;  3FXK A;  5J4V A;  1XDS A;  1V3F A;  4F91 B;  2CGP A;  2XGX A;  2DXI A;  3QPT A;  1KU2 A;  1R4N B;  2CO5 A;  3HIF A;  1WPK A;  1YRN B;  3GBG A;  4CZC A;  4GGG A;  3G1L A;  1F43 A;  4KIS A;  4GXO A;  2BHZ A;  1PVE A;  2K02 A;  1KGS A;  1S9H A;  4CUG A;  2QSG X;  2L0K A;  2LKS A;  2Q1Z B;  4RGU A;  2ECC A;  2EA2 A;  4BE2 A;  3HB9 A;  4AYB N;  3BPV A;  3MCZ A;  1LDK B;  1ZQ3 P;  1FOY A;  3ESW B;  4CA0 A;  5HLH A;  3ZQH A;  2K27 A;  4WK8 F;  3TGN A;  3TW7 A;  1ACI A;  6PAX A;  2DA7 A;  2Q2E B;  5F0C A;  2VT3 A;  3DWL E;  2VJ5 A;  2P6T A;  3BRO A;  1N25 A;  1YLF A;  2QEN A;  5FKN A;  3CP2 A;  5JFR A;  2GXB A;  3J7Y J;  2OA4 A;  2EV6 A;  3ERE D;  4PJM A;  3K4N A;  3T5X A;  5CJ9 A;  3BTJ A;  4PDK A;  2ELK A;  2DBB A;  4KIB A;  2DMQ A;  1TLH B;  3CLO A;  4ZZD A;  3QOE A;  4M3B A;  2NNN A;  2E5Z A;  3HSE A;  4UUS A;  2KHM A;  3QRF F;  4YEJ A;  1WJC A;  4HNT A;  1JI8 A;  3OR1 C;  2VC0 A;  4LFU A;  1GUU A;  5GAH J;  1SC7 A;  4GYI A;  4QWQ A;  3T1B A;  3HEF A;  1VQP I;  2QCO A;  1P4W A;  3CP8 A;  2IJL A;  1IRX A;  1P6R A;  2G0E A;  4CCM A;  4DYQ A;  2DA5 A;  2FML A;  2Z5U A;  2KDZ A;  2CV2 A;  1FTT A;  1OCZ H;  3W2V A;  4PJ0 C;  1GT0 C;  3CD6 I;  2OUM A;  1VND A;  3CCE I;  2MD5 A;  4II3 A;  5BQT A;  2JQ7 A;  1XMK A;  5LGU A;  3FXJ A;  3V8J A;  1YW7 A;  4IVN A;  4XK4 A;  3OIP A;  1REP C;  5ICC A;  3BTI A;  3DP7 A;  5DCF A;  1VQL I;  2O5R A;  2X1E A;  4L5I A;  5LBQ A;  2NS8 A;  3LOC A;  2WAQ A;  5HS7 A;  1OR7 A;  2DLL A;  1MBK A;  1UEL B;  5EEH A;  5JVT A;  2K9M A;  3HKZ N;  1TL8 A;  2HDD A;  5AIQ A;  5F08 A;  3T0Y A;  4I0B A;  5DYM A;  3U2R A;  4O5V A;  1TWA J;  4I2O A;  3I4N J;  5B1B H;  2YPR A;  3FXR A;  1IXC A;  1LEA A;  1T33 A;  1IZ1 A;  2E5N A;  1K6O A;  4HX7 A;  3I4P A;  4IL6 C;  1JKQ C;  1B59 A;  1VFC A;  2E19 A;  5E1Z B;  1MGT A;  5GP9 A;  1DP3 A;  2P7C B;  5EDN A;  1G3W A;  4N9H A;  4EJT A;  3SXY A;  3RQI A;  3HOT A;  3ABL H;  4X6A J;  2X48 A;  4XRS A;  1GV2 A;  3RPU D;  2DDB A;  2IVM A;  2CSO A;  4A12 A;  2NYX A;  3FXO A;  5DCM A;  1XMX A;  4U87 A;  2MH9 A;  1YYV A;  1K7A A;  2CUE A;  2RGV A;  2VBZ A;  2JA5 J;  1JE8 A;  1VQN I;  4ON0 A;  4PUS A;  3KYL A;  2XV4 S;  3CME I;  4L9T A;  2BW3 A;  2F6C A;  1K6Y A;  2QKM B;  4EEF G;  4A3E J;  4S04 A;  4YIR X;  3HJE A;  2LMD A;  4XRS G;  3W2A A;  1TQP A;  1HW2 A;  2JPC A;  1WHU A;  3Q9S A;  1I5Z A;  1XSD A;  2Y48 A;  1XSX A;  3I54 A;  3SHF A;  4I01 A;  2MGQ A;  4BAY A;  3MZH A;  1MDM A;  3K4K A;  3HRM A;  2LKX A;  1B72 A;  5IYB J;  2DYR H;  3CO6 C;  4BY1 J;  4ESB A;  4QLC U;  4HRI A;  9ANT A;  1T95 A;  4P96 A;  3ISP A;  1D1B A;  2L5Q A;  2JRT A;  1Z7U A;  2W57 A;  4DYR A;  1EV7 A;  2EZL A;  2FOW A;  5DTD A;  2BOL A;  2VAS A;  3JR9 A;  3GTP J;  4OAZ A;  1L0O C;  3WU0 A;  1XPX A;  3PNV A;  3HOX J;  3KZI C;  3TMO A;  3KP4 A;  1T56 A;  4RB2 C;  2LR8 A;  1V5E A;  2M0C A;  5TJJ A;  3QPS A;  4EJW A;  3FM5 A;  3VOE A;  4UNO A;  4ABZ A;  3VYT B;  5HNF A;  3ZN1 A;  1OLT A;  4AVZ A;  3L2W A;  2FBI A;  4MTE A;  1Z21 A;  3DV8 A;  1MBH A;  2PMU A;  3H3Z A;  3R6S A;  1NH3 A;  5D5W B;  2A61 A;  3CC2 I;  1ZYR F;  2PJP A;  1ZRE A;  2VUM J;  1B8I B;  2P81 A;  4OWR B;  3FZV A;  1I1G A;  1TT5 B;  3J80 K;  1FTZ A;  3J7Z I;  3ABM H;  1TWF J;  2LP0 A;  1G2H A;  2ZXJ A;  4XSZ F;  2GXA A;  4QPO A;  2HNH A;  3QYE A;  3S1R J;  4FET A;  2LSO A;  4A0X A;  2K4B A;  4D5F A;  3KCC A;  2JSC A;  4A5N A;  5ED4 A;  2KLO A;  3V7C A;  1IW7 F;  1CQT A;  2LC2 A;  2A6E F;  2Y69 H;  3KP3 A;  3N97 A;  2HYG D;  3DPT A;  3KP2 A;  2W7N A;  1WQ2 A;  4WWC A;  3ULQ B;  2MA3 A;  2Y30 A;  1QHH D;  4ZDL A;  3OYN A;  2X1C A;  2VT2 A;  2E35 A;  3DTE A;  1BC7 C;  2CMP A;  2LRD A;  3BZK A;  5M3F J;  4CCJ A;  2XF5 A;  5JHU A;  4BGD A;  3S3N A;  4N9I A;  2PMZ N;  5H6R A;  5ICF A;  4EM1 A;  3CCQ I;  3ZMU A;  2FBH A;  2A5W A;  1XS9 A;  4XMY A;  4RMN A;  1HST A;  2DU9 A;  2O61 A;  2I8D A;  3ZP5 A;  2L7F P;  1FT9 A;  3FMR A;  4CDG A;  1QZY A;  2HQA A;  1RR7 A;  4N4N B;  1UHM A;  3WTV C;  4G8X A;  3E0J B;  4XLA A;  3NAU A;  3Q9V A;  2WB1 A;  2MAB A;  5L3C A;  2CV1 A;  4U0Y A;  1PP7 U;  4BU2 A;  1STZ A;  2V6C A;  5KVR A;  4HOB A;  1XGO A;  1MH3 A;  3MKL A;  3V7S A;  3GME A;  1NG6 A;  2A6T A;  5GAD J;  4GFB A;  2WY7 Q;  1UB9 A;  2ZNY A;  2XRO A;  4EJU A;  2XUB A;  2YU9 J;  1U0J A;  5L3F A;  5D5U B;  5FGM A;  2VE8 A; 
#chains in the Genus database with same CATH homology
 2Y69 H;  3X2Q H;  5IY5 H;  1V54 H;  3WG7 H;  3AG3 H;  5B3S H;  1OCR H;  2DYS H;  3AG1 H;  3ABL H;  1OCC H;  3ABM H;  2EIM H;  1OCO H;  2OCC H;  1OCZ H;  2EIL H;  2EIN H;  2ZXW H;  2DYR H;  3ASO H;  3ABK H;  3AG2 H;  5B1B H;  2EIK H;  1V55 H;  2EIJ H;  5B1A H;  3ASN H;  3AG4 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...