2DYRH

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures and physiological roles of 13 integral lipids of bovine heart cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 26
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2006-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 2dyrH00
3X2QH 2ZXWH 3ABKH 2DYSH 3AG1H 3ASNH 3WG7H 2EIKH 3AG2H 2Y69H 1OCZH 3AG4H 2EILH 5B1BH 3ABMH 5B3SH 2EIMH 1V55H 3ABLH 2EINH 5IY5H 2DYRH 1OCRH 1OCCH 2OCCH 5B1AH 1OCOH 3ASOH 1V54H 2EIJH 3AG3H
chains in the Genus database with same CATH superfamily
3ZMDA 4ESBA 3L00A 4HEA2 2VJIA 3FKIJ 3HTSB 1TNSA 3S1RJ 1I50J 4D1QA 1XGNA 1U5TC 5IP6A 4UVAA 2LF7A 3JW4A 5EZHA 2CU7A 4GO1A 2IS2A 2EIMH 1ETQA 2K4BA 1XSXA 3LSTA 1SMTA 3PUFA 2PJPA 2R7UA 3A01A 2R7ZJ 3OSFA 2JJ7A 3P9CA 5LRRA 4KN4X 3J7AY 4UB6C 3FXLA 3PL8A 4RA2A 4HPQA 4Z6YA 4IHTA 4A3MJ 4M6YA 3RKYA 3VOEA 2WAFA 3TGNA 3ZQIA 5H20A 3LSJA 4PGGA 3L2CA 2A05A 1Z7LA 3F8CA 3V8LA 1YJNI 3JRIA 1TNTA 4GYIA 4HRIA 2JT1A 2VJ5A 2HYFA 2HKXA 4LG3A 5BPDA 1IG7A 2JUGA 2Y9ZA 4AIKA 4QWQA 1D1AA 2PN6A 1VQOI 3GFIA 3GTPJ 3GLLA 1DPUA 5K7HA 3WTZA 1LE8A 3FK7A 1JKPC 1ZRFA 4IHVA 2HYJA 4FHTA 1QNTA 1AKHA 4G6TB 4QPQA 3ZRGA 2HTSA 1IXRC 3ECOA 1HCRA 5KAFC 1G3TA 4LLNA 3N05A 4FE7A 1GXQA 1W1WE 4A3DJ 4PJLA 4CA0A 3LAJA 4XOTA 5D8KB 2DYRH 4UV9A 2B0LA 3LA7A 2I10A 3OY9A 4X1EA 1MSFC 2R7TA 5TGTA 2LY1A 2L5QA 3ZGKA 1HC8A 2CMPA 1FBUA 3SYTA 1RUNA 1V4RA 2FD5A 2ZB9A 1LVKA 3RQ4A 3PJRA 2Z16A 3ERED 4IF4A 1SFKA 2ETHA 5ICEA 3TP3A 3GFMA 3IAS2 3FMQA 4IXAA 4WWCA 5FLXZ 4XKWA 2E1OA 1Z3XA 3SEQA 5A2QK 3OYIA 2R92J 2VJ4A 5K1YA 1Y0UA 3H9QA 5IY5H 5J8CA 1IV6A 2DA7A 4FE4A 4LK0F 3CLQA 1BI1A 1SAUA 3LFUA 2N8GA 1WH5A 1Y56A 3FHNA 5B1AH 1ZGAA 3O8HA 1D8KA 4P55A 1ZR4A 2YU9J 1UMQA 2DOAA 1LVAA 4N9HA 2R4GA 2P8TA 4HG2A 4RMNA 4ZJZA 2JQ7A 4M9XA 2DK8A 1TP4A 4ENMA 2HQ5A 3I54A 4DJAA 1XS9A 2PLYA 4PJMA 3R0AA 1IF1A 2R7SA 2QVOA 4RDUA 1UZCA 4RB0A 1N77A 2W48A 1MMGA 3CUQA 1B9NA 1VQNI 4OAYA 3BJOA 4RGRA 4XSXF 1E0EA 2CUJA 1OFCX 2NNNA 3DBRB 2F4OB 1ZGWA 1MBHA 1UHSA 2O03A 1TZLA 4AVZA 4XICA 1T0FC 4A0XA 2QEXI 1TC3C 1O7LA 2DBBA 2P81A 1MMAA 4JBAA 2TDXA 1NG7A 3EYYA 2GA1A 1RR8C 1WSUA 1A5JA 3FMRA 4HBLA 5KCMA 1JE8A 2ME6A 1K83J 4JK1X 4RAGA 1Q1VA 3RYPA 4RB3C 2DPUA 3CD6I 1VQ4I 2VOPA 4XM3A 3OYHA 4NHJA 1KU9A 1DGWY 2GIVA 2QSFX 1ETYA 2Y9YA 3IH4A 4XQFA 2VQLA 1MZBA 3M8EA 3KP7A 3I71A 4ZTFA 3ZQHA 2RVCA 2COMA 1DU6A 1XPXA 3M1EA 1Y1VJ 2EV6A 2P7VB 3FM3A 1B72A 2V6CA 2A07F 5DV5A 1A04A 3FWEA 3K1NA 3DBLB 4YEJA 1SANA 3A02A 1FMWA 4LMYA 5E1XA 1MBGA 2NOJB 4D9JA 1A6IA 3B6CA 1OCOH 4ABZA 3WTWC 3DEWA 3E7LA 1LPQA 1KU7A 2X1CA 3BWGA 4BAYA 2JSCA 2KPMA 4CZZA 2R7XA 5IYBJ 1WJ5A 2CUZA 2IA1A 1D1BA 2GXAA 4F93B 1YITI 4HYEA 1TQPA 4P9UA 1Y0NA 1AOYA 4EV0A 1SFUA 2IW5A 2QUFA 4O3MA 4Y4RA 3LWFA 2O0YA 3GX4X 3E6DA 3BR2A 4IVNA 1JXSA 3HM5A 1IUFA 2IGNA 3G1OA 3J80K 2E2HJ 2KL4A 3ABKH 1YIOA 3N97A 2I8DA 3QAHA 5GTHC 2FNAA 2CW0F 1KONA 1IRZA 3MMYB 1HKTA 4WX9A 2IXSA 2WY7Q 2EILH 1J2XA 4CO8A 1QGPA 2CJJA 3ABTA 2VODA 1UJ8A 1R4MB 3I59B 2IJLA 2QWWA 4HX4A 2NVTJ 2DFFA 2NS7A 4BEHA 3C1DA 2ZXWH 1KQ9A 3OMYA 5L3BA 4XLAA 4BDYA 2NYXA 2VQCA 4L9NA 1IRGA 2HOTA 2V79A 2EFQA 3HOXJ 4DOZA 1YX3A 1FYMA 5HNFA 5M5XJ 1W7PA 4MTEA 1HKSA 1A36A 2ICWG 4L18B 4CHUA 3EDPA 5DM7F 2VC1A 3F8MA 2KRFA 3CCSI 4HF2A 1YHQI 4CCMA 5L3EA 2BY0A 1ZLKA 3HB9A 3E6CC 3S1NJ 3WE2A 3QU6A 3S2WA 3S15J 1DQUA 4K2EA 4M71A 3L2QA 4E7JA 4AM3A 5KK1A 2FOWA 1K79A 2YR2A 3FZVA 2F48A 3H9GA 1FP1D 1NHAA 5D4RA 2KJBA 3ZQFA 2YU3A 3HSEA 3BR0A 3IWZA 1BA5A 3N4MA 2FEZA 2UZKA 3M9AA 3SDGA 2ADUA 2VQHA 3OYMA 1Y1WJ 5LEJA 2G7UA 3PO3J 3ECHA 4EATA 2LTPA 5E8GA 2XHKA 2XAGA 2DYSH 3HKZA 1YX5A 1MKMA 2HS5A 4C3HJ 1S7EA 4XLFA 2ECBA 2ZNZA 4I0AA 1FIPA 4RB1A 4B09A 4PZJA 3VB2A 4LJZF 1O3SA 2GIZA 3FXJA 4XK4A 2R5YB 2HVSA 3K4LA 1V3FA 3BROA 2YX4A 3OIQA 4NC7A 3SZTA 4QTRA 3WGIA 1QPIA 1F5TA 3WTVC 1D0XA 4CDGA 3OIPA 3IRQA 1AKHB 1PJRA 1N78A 1XN7A 2I5UA 2XAHA 4BACA 1MJAA 3OYEA 4C3JJ 1PUFB 1I1SA 1S3JA 1ZG5A 2BXZA 1ZTRA 3KYLA 1MBKA 4CYDA 4XBFA 4XMYA 2D45A 1OLTA 3FBNB 2R5ZB 5TRDA 4DYCA 5LLQA 5J40A 4KFCA 5IYDJ 3J7AO 3BOQA 4FISA 1HQCA 4BKXA 1BM9A 3JRDA 5B3SH 1JTYA 3RKXA 4V2FA 3ZCOA 1VQ7I 2ZC2A 4IRGA 4AIJA 1T8IA 2XGDA 1VF9A 1TQIA 1ZAOA 2G9WA 2DA4A 1KU3A 2JPCA 2XAFA 4HNUA 2CSOA 1HOMA 5AIPA 4Y3OA 3OYJA 4I2OA 2DPDA 2DK5A 3KX2A 3MQ0A 2VLAA 3WTXC 2M8EA 2O61A 3KP6A 2ZCWA 3F22A 1MJBA 3GTGJ 4L9JA 4AYBN 2V1UA 1B8IB 4AC0A 1UAAA 4RGXA 2M4GA 2VKHA 3PNVA 3U1KA 1RC9A 2ESHA 5J6XA 2L9VA 4A5MA 3L2RA 5CQGA 3IH2A 2D1VA 4CCLA 2QQ8A 3T0YA 5LFAA 3I55I 1I39A 1Y6IA 2EZKA 4DGWB 1NK2P 4EJTA 3BZ6A 2RREA 3NRVA 1HKQA 1LEBA 5HS7A 1SVLA 3BP8A 1LDKB 3OL3A 3HTUA 2WAQN 2W00A 5IOYA 3GLXA 4KT5C 2RDPA 5DUIA 2WTEA 2WC2A 3NWTA 4N0BA 2L4AA 4B47A 2CRGA 2L54A 1G6NA 2F5FA 3KEYA 3W2VA 5F1RA 4BXUA 1WI9A 1K4TA 3OS1A 3ZN1A 3BG5A 3QPSA 1D8JA 1ZK8A 4RS8A 2QENA 3ZMZA 4UNOA 3F72A 2NVYJ 1E3OC 2KP6A 1J59A 1W5TA 4EQQA 4UUSA 1VFCA 4ZYHA 4I76A 4LITA 5H2FC 4F92B 2BVLA 4HF1A 2FBHA 1G3WA 2BEOA 2R7WA 1U3EM 4OWRB 1U5TA 4HDUA 2Y30A 3RSNA 3QWLA 3DKYA 4M6VA 4B8XA 2DTRA 3I56I 2DI3A 5FFXA 3BJ6A 3F8FA 1TT5B 1V5GA 5IPAA 1X1BA 3K1MA 1YW8A 4FQGA 1JHHA 1IDYA 4C3IJ 4HLYA 4A69C 3MWMA 1HSJA 4S05A 3K1PA 4LG0A 4BBRJ 1K6YA 3K70C 2DOFA 4KIGA 4A0ZA 4JX5A 2XGEA 4C30A 5BS6A 3LL7A 2FOKA 2HQAA 4A3JJ 3W2AA 4A6EA 5CPRB 1BR2A 1YJ9I 5EGOB 2ZXJA 3GEZA 1S5LC 2FUG2 2ID6A 2ZFWA 1ITYA 2H6BA 5ICFA 4AIHA 2QYOA 2O3FA 4LIUA 5DCFA 2XB0X 3UR3C 5J4YA 3M8JA 1NTCA 1W36D 3Q0VA 3ELKA 1MNMC 4H4KC 4HOBA 3X2QH 4PJ0C 2DA5A 1FOYA 1S8NA 2V9KA 3S93A 2JRTA 1BC7C 1H9GA 1ENHA 3BQZA 2K40A 4V19K 2BW3B 3UKGA 1H88C 5JLWA 2W4SA 2DO7A 3K4CA 4ON0A 2EWNA 2JZYA 3U2RA 1PVEA 4MQVA 4OMYA 2PMHA 4II2A 1ULYA 3L2WA 3DU6A 5JI6A 2X51A 1QHHD 3B6AA 5CLSA 4A93J 1LEAA 1R22A 2J5OA 2MFZA 1BJZA 4AWXB 1QQIA 1Z6TA 2FA5A 2FE3A 4PJNA 2OA4A 3K4BA 3HL2A 1BW6A 2RNGA 5D5XB 1ODDA 4I02A 1WKMA 2HDWA 5ILUA 2JVGA 1R71A 3C2HA 1FYLA 1D5YA 2DQRA 3ZMVA 4II3A 2RNJA 3R4KA 4A3FJ 1R1TA 2ZXIA 1GDTA 4AVPA 1Z6RA 4XOPA 4ZYGA 5HLGA 2XSDC 1U6GA 2R5YA 3JTGA 1A6QA 4GCVA 5L3CA 4BEHB 1R6RA 4M3GA 4J19A 4JQFA 2FMYA 3QODA 4XLCA 1H9TA 2CGPA 3CP2A 4UB8C 2ELKA 3PIPF 1XMXA 4A0YA 1X2NA 2X6OA 4HNTA 2HTJA 4E7IA 3AG3H 3TW7A 3ZOBA 2H6CA 2OQGA 1GV5A 1FY7A 2E1MB 5CKTA 5F0HA 2W25A 2OBPA 3HRMA 4M3FA 4MEYF 3LSKA 1S29A 2V9PA 2CQQA 1OCZH 4WXCA 3FDYA 2HZTA 5FKKA 3QQAA 2VL8A 2KLOA 1S7AA 4LOCA 4I98B 2ISYA 1TLHB 4G6DA 2D1HA 1G4DA 4NQWA 5JLXA 2KRHA 3ABUA 2RGVA 2M9HA 2W1OA 3QYEA 1IUYA 1JTXA 2WWYA 1JT0A 2IBDA 2Q2EB 4UXNA 2OD5A 1I5ZA 1VQLI 4XRSA 3R61A 2VOOA 2Y75A 4Q48A 1VQKI 3K0LA 2E7XA 2EPFA 1EH7A 2KMUA 4A3EJ 1JUMA 2CO5A 3QPTA 1QA6A 5BQTA 4KMUX 5ICCA 4UUTA 4D0PA 1QHGA 1MSEC 1BIBA 1SVMA 2P7CB 3T5XA 3RPUD 3VYSB 4F52A 1W36C 1BI0A 4F91B 2E5NA 2FNPA 3ZR8X 3SJMA 2YSRA 1AA7A 1YW7A 2OQRA 2GLOA 1S7OA 3HRTA 3JSOA 2W85A 4BS9A 4YELA 2E36A 2HPIA 1LNWA 4IHWA 4E7LA 4DQ2A 4XR6A 3P9IA 3BR3A 4N9IA 5DYMA 3E1SA 2CFXA 2DT7B 3O2PE 2NXNB 2QGUA 3HGGA 2O8KA 1I6XA 2CQNA 2OUMA 4X6AJ 3KCCA 3Q9VA 1Z05A 3FISA 4OIQF 2CYYA 5IT3A 4OMZA 5E8IA 4A5NA 1QVUA 2AXLA 3P9KA 5F04A 3CMMA 2D2WA 3VWBA 2GM4A 3DF8A 4IX7A 2GA2A 1IJWC 1ZRDA 2OPTA 3ZMUA 2DAOA 1MMDA 4FCYA 2PI0A 1T0FA 2NS8A 1SVOA 1LDJA 4ASNA 2UXXA 5J4VA 4KN7X 2OTLI 2QF7A 4LB5A 2M45A 3V4GA 2JA7J 4V2GA 1FP2A 5GTIC 4BGDA 5D6FA 1ZKGA 2P6SA 3TOBA 4C2TA 1CGPA 3G4SI 1P4AA 3DPLC 4NC8A 4ZH4F 1F4KA 1T39A 4U7BA 3CP8A 2GOMA 5CJ9A 4B43A 2XAQA 2OF7A 1BOAA 1S9HA 2VE8A 1T56A 2COBA 4BXFA 1YG2A 1D0YA 3RJPA 4LFUA 4M9ZA 3WG9A 2JA2A 4S0HB 1OCCH 1ZH5A 2LSOA 4I01A 3A2KA 4Y13A 1Y8QB 3Q9SA 3TP0A 3G73A 1OISA 1TWCJ 1OCPA 2F4MB 1T6SA 1WCMJ 3CMAI 5DCMA 2LY2A 2V9VA 1BJAA 1ETXA 3ABMH 1OMIA 4I09A 5KNLA 4CYCB 5EZGA 3TBIA 1WJAA 2V1DA 2ELHA 2L02A 5IOZA 1ZG3A 3H36A 2W82A 3KLOA 1XMAA 3KFWX 4NUBA 3VYRB 2Y0SN 3LNQA 4J01A 3TO6A 1WWXA 2PQ8A 4UVBA 3VSLA 2LBFA 2Y0SA 1DUXC 3S1QJ 2Z2SB 2LY9A 1N75A 2CFOA 3GYHX 4A3LJ 5FO5A 1FTZA 2OU2A 2GWRA 2KRCA 3K7AJ 1EV7A 2LOOA 3JAMZ 1P6RA 4J00A 2JPBA 5HODA 2PMZA 5M5WJ 3EPZA 4IRIA 1XB4A 1B59A 1W5CC 4BXXJ 4EGZA 4LB6B 4RM2A 4MQ9F 3WTYC 2YX7A 4X0GA 3HIFA 2Y2ZA 1A35A 3FXKA 3NQOA 2XGCA 1DP7P 1VQPI 2WAEA 4OU0A 3FF5A 1FBSA 3H1CA 2XVCA 3DFGA 5C4JJ 2W57A 5FRMA 1CQTA 4CSWA 4MTDA 2XPVA 1F9NA 2R3SA 4BUPA 4GGGA 4G7ZF 2JUCA 3BR6A 4AD9A 1ZG1A 2XGXA 1Z3YA 3FMSA 3NEUA 3HDDA 3ML6A 2A5WA 2RQPA 1RR7A 3H3UA 2F5DA 1IN6A 4Q47A 3J7YJ 1P92A 1VTNC 1V55H 2L4MA 3KEOA 4ITVA 2X1DA 1FZPB 3HOWJ 1QO0D 3SHFA 2X9DA 3NARA 1SFEA 2V1NA 4BQNA 3WTSC 3RTRA 1I1GA 4KNYA 1YIJI 2DU9A 3AG2H 1MDMA 4G8XA 4XKVA 2VASA 4PSWA 1NG6A 3G3ZA 4CCKA 1OR7C 4HSTA 4ZDLA 1X3ZB 1MH4A 2HU9A 2VKVA 3HKZN 3KP5A 3FXQA 4XRSG 2ZFUA 3CCJI 1USSA 2YS9A 1TW2A 2LREA 4DBQA 2AQFA 2XDVA 1CF7B 1WJCA 3PSFA 1JKRC 3CUQB 4R8HA 4Q4ZF 2NRAC 3HSRA 4UY8I 1P7JA 3A01B 3C3WA 2HVRA 1I3QJ 3S1MJ 3C2GA 4KT6A 2DW4A 1O3RA 2IS6A 4CGZA 4EM1A 4H0EA 2M8GX 1TQMA 1NH3A 2ECCA 2EZIA 1X4PA 5JVGF 3OYFA 4PK4A 1LDDA 2O5RA 2ESNA 2FBIA 2HEOA 3IP4B 1SD6A 3F6VA 1E3PA 2L2OA 1UFMA 3Q3SA 4BNCA 5GP9A 2P6TA 2GBYA 1YS7A 3MVPA 2R7RA 2QLZA 2V1XA 4U0YA 4GRIA 2M1BA 3Q0WA 4L5JA 3S2DJ 4YRVA 3KPHA 5J1RA 4PSXA 3KP4A 3K4NA 1YW9A 4N4OB 3DLAA 3CCLI 1EA3A 1I3AA 1QZZA 3FXRA 3OYDA 3GFJA 3OYGA 2E35A 4Y33A 4BJTA 1VI0A 2H09A 1XCBA 1FWZA 3H5AA 1XSVA 3GUDA 2HR3A 4CH7A 1EKEA 3Q5FA 2DDAA 2Z1DA 2K27A 3HG9A 1KQ8A 2LD5A 2HI3A 6PAXA 2Z5UA 1ZRCA 4QSHA 3FKJA 3EUAA 3KIOA 4QLCU 1WI3A 1EH6A 3D0SA 2L7MP 1K61A 3OWTA 3KP3A 2X0LA 3MZ8A 4XLHA 4BL0B 3I3LA 4JX6A 5ICGA 4Q5SF 3M4OJ 1Y8RB 4U0WA 5JFRA 2CQXA 1FSHA 2V26A 2VUMJ 4I99C 4EJOA 5EYRA 5E17F 5E3MA 2X6XA 4XN0A 2MC3A 1IO2A 4PFPA 4AIDA 3BLYA 3CCMI 3H9JA 5GPAA 1IW7F 1POGA 3AL0C 1FSEA 3DKXA 5IT9K 1MMNA 4D7MA 4KJZA 1IV8A 4M74A 3HPGA 3SZPA 2XASA 1YE9A 3ZN0A 2M0MA 4ZDOA 2E1CA 2M3AA 4LIVA 1JGSA 4R79A 3CTAA 2EV0A 2HGCA 5FRNA 2L9RA 1SMYF 1ZLJA 3H35A 1APLC 3HEFA 2OTJI 1Z0XA 4M3BA 1Z91A 3F8BA 1R58A 5ILSA 5B5EC 2EZLA 2CV2A 1MD0A 3WTUC 4QIWN 1USTA 2ZMEB 4IZZA 3OSGA 2G0EA 3C18A 2O8XA 2QM3A 3QPLA 1GLNA 5K5OA 1FOKA 2BYVE 3J81Z 4HAMA 3JCUC 2ZNYA 4FT8A 4F3QA 4XN3A 3V7RA 5D5UB 3OOUA 1U78A 1H0MA 1UG2A 5GAHJ 3SXYA 2QQBA 1OCTC 5FB2A 1X2MA 1SFXA 3COAC 4XORA 1BOBA 1V5EA 3RZOJ 2LVSA 3BR1A 2KHMA 3GO5A 1BIAA 3AG4H 4F7ZA 1IDZA 3BTCA 2LFBA 3QYBA 4L0ZB 3CUOA 3GBGA 2UUZA 3BTJA 1J75A 4MO7A 1XC5A 4KUMA 2DMTA 4MNUA 3BJAA 3I5UA 3SZGA 2VN2A 1O57A 1YQAA 2QBYA 3CLOA 5DUKA 4DZPA 2JA8J 1C0WA 2VE9A 3PIOF 3JAMK 3OS2A 1F36A 1KGSA 3WU0A 3PQJA 4YFKF 2QKMB 2QSHX 2F6CA 2L7FP 2AXTC 3CJRB 5J8FA 3FX3A 3ASNH 4U0VA 2WV1A 3KZIC 5M5YJ 3K9TA 5DD8A 5E3NA 3CDHA 3RKWA 2OV7A 3DTIA 4BJ6C 3BTLA 4ZC3A 4RAZA 3L2VA 1OQYA 3CMEI 4Y7NJ 1UB9A 4ZZDA 2J5PA 3LSGA 2XAUA 3F3XA 3ONQA 1XD7A 3LAPA 3DEUA 3CF5F 1L0OC 2LR8A 3CCRI 2EQRA 2EZHA 2DA6A 3MKYB 4QPOA 2X4HA 2VT2A 2QZ8A 2OAZA 3ZQCA 3M7GA 3MN2A 2KKOA 2HVQA 3NWSA 3QP6A 2XIGA 4L9TA 5FKNA 1U9OA 5CVVA 3KZYA 3ROUA 4XLPF 3GZ6A 3L7WA 5E18F 2HNHA 1HF0A 2HQNA 3T8RA 3CJNA 2F4IA 2IS4A 2KIFA 4OIRF 1MNDA 3ZPLA 4BHPA 4MGRA 3I4NJ 2O9LA 1ZYRF 3HSFA 5GAGJ 3OYAA 2DXIA 2BXYA 3H0DA 1R5HA 2A68F 2KFDA 1SD5A 4B44A 3GTQJ 2R7FA 5GPCA 2KIQA 2X1EA 4JYKA 3HOTA 1QZYA 5CVUA 1B1BA 4ZYDA 4LGWA 4XKCA 2H8WA 2PJRB 3CDLA 2UXNA 4U88A 1IN5A 1IRXA 4HF0A 4DYRA 5EG0A 5E1ZB 3G1MA 1Q1HA 1WJDA 1JHFA 1LUJB 2P0WA 1O7FA 4W97A 5J47A 4XIDA 2HPMA 4G12A 1QU3A 4PFOA 2VBXA 3A1YA 2KIUA 1BN5A 2JRMA 2QBYB 3TEDA 5LGTA 1AU7A 3BZKA 2EIKH 3EUHA 3G1LA 4M3DA 3W6JB 3CESA 1P4WA 1X1AA 3CO6C 3KEQA 5J3LA 4AUXA 2XPUA 2F2EA 2XKPA 1R1UA 3HXLA 2NVQJ 1BI3A 2O7OA 4E70A 2A5YB 3RZDJ 2MBFA 1FNNA 2M2EA 2BGCA 2DA3A 1HXDA 2JVHA 2LRDA 5DS9A 1HA8A 2YPRA 2A3SA 5CVJA 3J7ZI 4U7DA 1B8IA 4E4HA 4L0YB 1U2WA 2LYCA 2EIJH 2DLLA 2M0CA 3F0CA 2L9NA 3MD2A 1ZR2A 3WU2C 2ZMEA 2MYSA 4GXOA 3BT9A 4ZYEA 2ZO4A 3S3OA 1T08B 3M07A 4UV8A 2GQQA 4HX7A 3IL2A 2WB1A 4ENNA 3K70D 2WAQA 3CZ6A 1U8RA 2EV5A 2Y48A 3DTKA 5FJ8J 2EH3A 2L01A 2E34A 1MJ9A 2ZSHB 2A61A 4IQ4A 1T33A 1U9NA 4XNFA 4UUVA 3DCFA 4XRFA 4ZZLA 1TWGJ 4OIOF 2OCCH 3GFLA 1IXCA 3FM5A 3VDXA 1QZEA 5E1WA 3T1BA 4GYGA 3F8NA 3DQVC 3Q0UA 1D0ZA 5FKMA 4WXHA 1MH3A 2P5VA 2DA2A 5D4SA 3ESWB 5M3MJ 2DMUA 3AAFA 4EM2A 3G2BA 3HC7A 2XC7A 4A6DA 1QVTA 2RC4A 2KISA 3OYCA 1OR7A 4HQMA 3WODF 4IRHA 1DGRM 1LJ9A 4Y15A 2IPQX 1B9MA 2G7HA 1FIAA 2VBWA 2JTVA 4BH9A 1HLVA 5ED4A 4A3IJ 2A6TA 2DJIA 2H1KA 2WB1N 3ZQGA 4EGYA 1X1CA 3HUGA 4IEJA 2IVMA 2A6EF 5FROA 3CCVI 4A3KJ 2RV8A 2WV0A 3L1PA 4YIFA 3DKWA 3R6SA 2XF7A 3GMEA 1RKWA 1S72I 1GT0C 3BG6A 3GCMA 1IN8A 3DWLE 5HDNA 5EGOA 2VKEA 3BQYA 3S3MA 1DDNA 1MGTA 5E3OA 5DEQA 2CUEA 2MC4A 5JHFA 5EDNA 3IHUA 2QKLB 4RLQA 4Y17A 5GADJ 4KMFA 3H3ZA 4KIBA 3TOAA 2R0QC 1FEXA 2MLKA 4WXDA 5H6QA 3CF2A 1XGOA 3LSIA 3FIWA 3LQRA 4GDFA 4I7HA 1HDPA 5K5QA 1AWCA 3C2BA 4AU7A 4DZJA 1R5GA 1X58A 2HZDA 3GZ5A 1ETOA 1U5TB 1RI7A 2LG4A 1VZ0A 2ZBKA 1FPQA 5TISC 4LD5A 4E7SA 1FT9A 2VKDA 2M87A 2CH0A 3J80Z 2OZUA 2WA0A 3IC7A 1MBJA 3HOZJ 1TWHJ 3HPHA 3K69A 5BMZA 1F43A 1BR4A 2CUFA 2UV1A 2JMWA 1T38A 3T8TA 3GWZA 3TQNA 1LFUP 4JP0A 3PUBA 3M8FA 4M72A 4MFDA 2A6HF 5KAIC 2DTZA 1X1DA 3RPUA 2CV0A 1JUSA 4C2UA 3S16J 3PNTA 3FXUA 3TL4X 2EA2A 3MKLA 3ABLH 2CQ7A 1R7JA 2CWEA 1VQ6I 5K5RA 3BC8A 3W3CA 3GVAA 2XV4S 4MHGA 5LEKA 1SFOJ 2STTA 5F0FA 4MLOA 1FJLA 4LLLA 1G3YA 4YIIA 5HNHA 2MSYA 4HW0A 1K78A 4EEFG 3DPUA 4C9YA 4NNJA 1N25A 2IGKA 3BG9A 5JVTA 5CVRA 2P4WA 4IJAA 1IRFA 2MG4A 2NOGA 3IH3A 4BQQA 3CC7I 2TCTA 2V4JC 4BDZA 3LSRA 2VXDA 1Z9CA 1WQ2A 3V8KA 1WH7A 3QPHA 4JX4A 4KDPA 4LLGF 1WHUA 3PQKA 4HQEA 1BW5A 2R7DA 2XF5A 2R7OA 1H89C 5LGNA 2UWMA 3D5SC 3DBHB 4P5OA 2VPLA 1FOWA 2E1MC 3EETA 4I6ZA 2NAZA 5IP7J 3G71I 4BE2A 1SAXA 2FBKA 4XONA 4HX8A 5HLHA 4PCQA 3SFZA 3HHGA 2E5ZA 4U87A 3E5XA 1XG1A 2VIXA 2HFHA 5F27A 2FRHA 1X4OA 3QOPA 5HLTA 1ETWA 3DU5A 3S8PA 4DIQA 4KA4A 1HW2A 2H27A 2GXGA 1JGGA 3I58A 4B48A 5D8LB 3OYKA 3RCOA 1AHDP 5LHIA 2VB6A 2HXIA 3HUGB 2M7AA 1FC3A 1VQ5I 3DLLF 1KU2A 1G8XA 1EH8A 4NB5A 2FQ4A 5TJJA 3CCEI 2XAJA 3H0GJ 4IOCF 2QQAA 2EBIA 1JJ6C 3NAUA 3U21A 1LB2A 4L5EA 1S6LA 1W7PD 1X3WB 2IP2A 4G6QA 2R93J 4PGHA 2FU4A 1J0RA 2Q8KA 4YG2F 3GF2A 5C4XJ 3WHCA 1VQ9I 4ESJA 2FX0A 4XKBA 4HSRA 3CCUI 5HDKA 2K9MA 2DT6A 2XRLA 2H8RA 1K4SA 1UHMA 2VQGA 5CQEA 1IAWA 1WVRA 2PX9A 4LG0B 2RAEA 2DFHA 3BDDA 2W7NA 2EINH 4DBRA 2VONA 2H1LA 1SEUA 1ETKA 3MAJA 1CF7A 3K4JA 3JRAA 2HDCA 4GFBA 2H94A 2EFWA 4LK1F 2KZGA 3D5LA 4HA8A 3C7JA 3ZMSA 2AS5F 3GXOA 1QRYA 3A4CA 4EVIA 2MGQA 4TV7A 4CXFA 5J1YA 4BU2A 3QOEA 3MCZA 1HW5A 5EEGA 1YRNB 1TW3A 1ZGJA 2MLGA 3LA3A 5LRSA 4FX0A 2K4JA 1OPCA 1R9TJ 2STWA 5D5WB 1K6OA 2DOEA 4RM3A 5FD5A 3HOUJ 1MBEA 2GOXB 2LP0A 3DEEA 1WZ2A 3VODA 2QCOA 2LNBA 1F1ZA 2EFOA 4IOAF 3BPVA 2ID3A 3I64A 2MABA 1SC7A 1ZREA 3CDIA 1SD4A 1VNDA 3I0TA 3EUKL 3E6MA 3QRFF 3PSIA 2Q0OA 5JR3A 4E7HA 1PUEE 1TT0A 4P96A 3LFKA 2QQ9A 2CS3A 3HOYJ 4NDLA 3OOPA 3A03A 5LHGA 2X48A 2VI6A 4F55A 1NK3P 2FXAA 2YUSA 2K3PA 5EEAA 4RBOA 1B6AA 1HW1A 3FXMA 1IN4A 1YFHA 1VQMI 1KYWA 4CZCA 4RGSA 2ZJPF 3KLNA 1BC8C 5F6FA 2BY3A 3RQIA 4FASD 5EG0B 1KZHA 2MD5A 2DODA 2A69F 5H6RA 4XSZF 4JOMA 1FTTA 1RKTA 2JK3A 3E5UA 5DCMB 3MKZA 1E2XA 1P9QC 3BG7A 2DQLA 3TO7A 4KICA 1WRJA 3TW6A 1W0TA 4BBSJ 5DM6F 2BOLA 1HDDC 4BY1J 2FJ1A 1MBFA 2XKOA 1WFXA 1XX5A 3OL4A 3P7NA 3MFKA 2RKHA 2V7FA 3S2HJ 1FMVA 5DD4A 2OC6A 1V5FA 5HLIA 5L3DA 1OYIA 1OYYA 4CCOA 3O3KA 4A3BJ 4HNVA 5DDGA 1ZARA 4IHXA 3HHHA 3TO9A 3HBLA 1ETVA 3JTHA 1GV2A 3JRFA 2HXOA 3MKWB 4S04A 1YS6A 1Z67A 3JRHA 2AO9A 2E19A 3WHBA 3E5QA 4Y52J 3SEZA 4CICA 1FX7A 2LMDA 1U0JA 2MH2A 1FLIA 3FBIB 3AG1H 4B1RA 3F9KA 5F0CA 1L3LA 1YYVA 4OINF 3DPTA 4C2MJ 1UELB 5BOXA 1RUOA 1K7AA 4A12A 2K9NA 4P1WA 2Y0MA 4M73A 1XSDA 1UCRA 1Z77A 1RETA 2F5VA 1D3YA 4E7KA 5C3EJ 5HDGA 3L9FA 1VQ8I 2LLKA 1JI8A 1DP3A 3W6VA 4Z2YA 3UNGC 2XRNA 1X3UA 2XF6A 3K4MA 3GTOJ 2DMPA 3CUQC 1X1PA 1Z7UA 2XPWA 1P7IA 2BV6A 4MFEA 5E3LA 3F21A 3E3VA 3K2AA 3MEXA 2BBYA 3S32A 4B3XA 4DNCA 3BG3A 1ONVA 5C44J 2L7KA 1ZHFA 2HKOA 2LDUA 3K4KA 5D6EA 3J81K 3OYBA 2LC2A 2CW7A 4WCGA 3R0JA 2F5EA 3WE3A 1I27A 2HWVA 1YO5C 3I4MJ 4ZDPA 4G9YA 3QU3A 1OKRA 3TKYA 3MZHA 1XGMA 2ZJ2A 1DPRA 3ZQLA 1V54H 4IO9F 3CJTB 5FLXK 1Z1DA 3KE2A 2W24A 3A0BC 2ME0A 2MH9A 4IHSA 3O8GA 1ORKA 3JREA 2DMNA 1WGXA 4HV6A 3D1NI 1I6HJ 4MEXF 4BE1A 2B7EA 5IP9J 2L3DA 4BQAA 1XMKA 2EA4A 1GUUA 4IL6C 1SD7A 3OYNA 3BCAA 2K86A 2VJJA 2TRTA 3IKTA 2PMUA 1R49A 4IKFA 5KVRA 2P5LC 2KIMA 4PJJA 3LSMA 5GAEJ 2QSGX 4M6XA 4BHCA 4CYCA 1U8BA 3F23A 3ASOH 4BHBA 4A2UA 2LF8A 1YTYA 1T98A 3OIOA 2GAUA 4XRMA 3VYTB 2M5WA 3G6EI 3S3NA 1EJ9A 1T95A 3KZZA 4I0BA 3JR9A 3AKZA 4ZYAA 5B1BH 4RAYA 3H5RA 1HSTA 2E71A 3AL0B 2IAIA 3PNYA 2ELJA 2K9LA 3S17J 4WK8F 2X6YA 1G3SA 2E7WA 1XDUA 3KETA 1KA8A 3KYDB 3ZP5A 3U9GA 2E2IJ 2DJNA 2ZSIB 1UHWA 3PO2J 5FKOA 3KYCB 1MDMB 3H5NA 2KDZA 4G94A 2K9SA 1ON1A 4A3CJ 4ANJA 1X19A 2MD0A 2VBZA 2C6YA 1RRJA 2KT0A 4L5IA 5KHDA 1BR1A 2KZVA 3WTTC 1GXPA 1G2HA 2NVXJ 3JRBA 2VPRA 1FYKA 3M1CA 1J09A 3VPRA 4YIRX 1TWAJ 5LBQA 5B66C 3GTJJ 3HJEA 2R7VA 2IGMA 4XLEA 3U1DA 2ZMEC 2B9SA 3VYUB 2VXZA 1DU0A 1WJEA 3PFIA 4B3AA 2EFNA 1B72B 5BNGA 4CUGA 2ZXHA 4NC6A 1QPMA 2K5CA 3V8JA 2BW3A 1FBQA 3D5RC 1HBXG 5FFZA 1EF4A 3LOCA 4PUSA 1BI2A 4CCNA 4WF2A 2ACJA 2LK2A 2PFBA 2B63J 3S14J 5F64A 1MMSA 1RNLA 3A0HC 3ERMA 4N4NB 1ZN2A 3O6BB 2LBFB 3ZMTA 3FHZA 2M30A 1YOVB 3LA2A 2ISZA 2P5KA 2K85A 3SFIA 4DYQA 4OIPF 1MIJA 2L7ZA 3HRSA 3ZQQA 4IQJA 1W0UA 3E0JB 1REPC 5EF6A 4RGUA 3ULQB 3RI4A 5F1JA 2L0KA 1E17A 2WBMA 5HS9A 5HVQC 4HZFA 5IYCJ 4BYYA 2FSWA 2PMZN 3RDIA 3VFZA 2K9QA 5K7ZA 3LSPA 2NNYA 4YFNF 3GW2A 2BE5F 1LFPA 4BY7J 2Z33A 3EUHC 4OAZA 5M3FJ 1JKOC 1YRNA 2JN6A 2RQQA 2K02A 2IRFG 4EJUA 2AQEA 3BZCA 1IZ1A 3BY6A 1OYWA 3DV8A 3FK6A 2E60A 3OS0A 4XLNF 4D5FA 1Y39A 2PG4A 3EQLF 3CC4I 2X85A 1R5ID 3H3VK 1A31A 3DTEA 1BBYA 1R00A 1G59A 2K7LA 2ZKZA 3OR2C 2VT3A 4FETA 4ENJA 2Z9OA 3M3YJ 3LMMA 3CCQI 2BZTA 3V42A 1Z21A 2DN0A 1M1EB 3QP5A 1PDNC 3WGGA 1H8AC 4M3EA 2D5VA 1KQ0A 4FTHA 4RAFA 2HOEA 1ERDA 3K2ZA 5L3GA 3TMOA 3W6KB 4BE0A 2EJRA 2Z3YA 3CO7C 9ANTA 3MZYA 2OCEA 4A3GJ 2BHYA 3GZNB 5F08A 4G7HF 3BPXA 2Q1ZB 5ERIA 1ACIA 4KITB 4NQWB 4D7NA 2R7QA 1ZELA 3CQZJ 1W5SA 5DTDA 3TDUC 4OOIA 2BY1A 3HYIA 5EJCA 2HOSA 3HRUA 2IGOA 5E79C 3H92A 1WPKA 3RIRA 4BJ5C 1IGNA 2JA5J 5JHUA 4PDKA 5CYVA 2KQRA 3E6BA 4D5CA 2Q2EA 3DP7A 3ZXSA 1ON2A 3BCBA 3IKVA 4L9VA 4G7OF 2XSJC 1GVDA 2JWTA 4EJWA 2GXBA 1D1CA 3RKQA 4R1HA 1ZQ3P 4IPAA 5BPIA 2LH9A 3VSKA 1TBXA 1O3TA 4UUSB 1W4MA 4KYWA 1LFBA 3B02A 1IN7A 1MNEA 3DXJF 1LE8B 2IT0A 3GTLJ 2NS0A 2PJRA 3LQQA 1PYVA 2DFIA 2PEXA 4RLFA 3FXOA 3GTMJ 4B4CA 1R4NB 1STZA 4MIMA 1MW7A 3HZJA 1PUFA 3SQNA 4UVCA 4ENKA 1RPWA 5AIQA 2E1NA 4FX4A 3LSHA 3CJQB 3I53A 3IAM2 1RIOH 3RPQA 1R1VA 1KYZA 2IA2A 1WJFA 2BVMA 4HLXA 1J5YA 2FF4A 4XL9A 1TWFJ 3IWFA 2KDOA 3JRGA 1J7KA 5J1UA 3PFYA 2NVUB 3HGYA 1P4XA 3R60A 4HV5A 2R5ZA 1J9IA 4NBQA 3GTKJ 2HDDA 2VC0A 3HOVJ 3K10A 1YJWI 2M7BA 5FKLA 2MA3A 4E7ZA 3I9V2 1O4XA 2FMLA 2XB5A 1K78B 3IV5A 4O5VA 4EM0B 1R36A 2W84A 2KJCA 2ZJQF 3K6GA 4DW6A 1RESA 3VEPA 4EJVA 3PM1A 1T2KA 2DMQA 3WGHA 2DFEA 3CC2I 2Z99A 4E6KG 3ISPA 1JUPA 2HOAA 1OJLA 5CVIA 3KP2A 3WU1B 1YI2I 5IT9Z 1GVJA 2EFPA 5HS8A 3V7CA 1W7PB 1BL0A 3CCYA 2LKSA 1IC8A 3E97A 1UG0A 2CV1A 1XGSA 2XROA 3JRCA 4AYBA 5FLMJ 1JKQC 1P2FA 2BY2A 3F6OA 1TL8A 5AONA 1E3HA 3TDZC 5EEHA 3BTIA 1O3QA 5D5VB 1OCRH 2RN7A 2K3FA 4W1UA 3CMYA 1JT6A 4ETSA 2MW8A 3QYFA 2DA1A 2IA0A 3HOSA 1R23A 3V7SA 3P5JA 2F5CA 3IRRA 4P9FA 4KIFA 3AFHA 4ZTJA 3W2WA 4RB2C 1IXSB 3IUOA 2IEKA 2Y69H 5HOOA 1PP8F 2OJED 2M4KA 3BR5A 5LHHA 1WJBA 5K7FA 5LGUA 5L3FA 2JA6J 2V6EA 5FD6A 1RZ4A 1LQ1A 2EB7A 2O6GE 2CW8A 2LKXA 2M34A 1XDSA 5ILVA 1TTYA 5FLVA 4IHYA 1FOXA 5FGMA 2XUBA 3I59A 1YLFA 3REOA 3L09A 2PBIA 2HQRA 3I4PA 2DT5A 2EK5A 1LKXA 4KISA 2VBYA 3L2UA 1JJ8C 2AHQA 2DCEA 3WG7H 1D5VA 2JSPA 3OR1C 4O6JA 5E20A 1B4AA 2FQ3A 4M9SA 2CG4A 2CQKA 2L9SA 2Y31A 4EMSA 3OV8A 2WADA 4YFXF 2WY8Q 2GZWA 1QBJA 1XTAA 3B73A 5LD2C 1PP7U 3SDBA 3RYRA 1XCVA 2ZJRF 4HDVA 3EYIA 4UHTA 4CCJA 2IS1A 3JSPA 1GHCA 2HYGD 3ZQ7A 4ESFA 4BQOA 2OZ6A 2X6WA 3OYLA 2LKPA 2QA4I 5A2QZ 2BHZA 2E2JJ 2DDBA
chains in the Genus database with same CATH topology
3X2QH 2ZXWH 3ABKH 2DYSH 3AG1H 3ASNH 3WG7H 2EIKH 3AG2H 2Y69H 1OCZH 3AG4H 2EILH 5B1BH 3ABMH 5B3SH 2EIMH 1V55H 3ABLH 2EINH 5IY5H 2DYRH 1OCRH 1OCCH 2OCCH 5B1AH 1OCOH 3ASOH 1V54H 2EIJH 3AG3H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X2Q H;  2ZXW H;  3ABK H;  2DYS H;  3AG1 H;  3ASN H;  3WG7 H;  2EIK H;  3AG2 H;  2Y69 H;  1OCZ H;  3AG4 H;  2EIL H;  5B1B H;  3ABM H;  5B3S H;  2EIM H;  1V55 H;  3ABL H;  2EIN H;  5IY5 H;  2DYR H;  1OCR H;  1OCC H;  2OCC H;  5B1A H;  1OCO H;  3ASO H;  1V54 H;  2EIJ H;  3AG3 H; 
#chains in the Genus database with same CATH topology
 3ZMD A;  4ESB A;  3L00 A;  4HEA 2;  2VJI A;  3FKI J;  3HTS B;  1TNS A;  3S1R J;  1I50 J;  4D1Q A;  1XGN A;  1U5T C;  5IP6 A;  4UVA A;  2LF7 A;  3JW4 A;  5EZH A;  2CU7 A;  4GO1 A;  2IS2 A;  2EIM H;  1ETQ A;  2K4B A;  1XSX A;  3LST A;  1SMT A;  3PUF A;  2PJP A;  2R7U A;  3A01 A;  2R7Z J;  3OSF A;  2JJ7 A;  3P9C A;  5LRR A;  4KN4 X;  3J7A Y;  4UB6 C;  3FXL A;  3PL8 A;  4RA2 A;  4HPQ A;  4Z6Y A;  4IHT A;  4A3M J;  4M6Y A;  3RKY A;  3VOE A;  2WAF A;  3TGN A;  3ZQI A;  5H20 A;  3LSJ A;  4PGG A;  3L2C A;  2A05 A;  1Z7L A;  3F8C A;  3V8L A;  1YJN I;  3JRI A;  1TNT A;  4GYI A;  4HRI A;  2JT1 A;  2VJ5 A;  2HYF A;  2HKX A;  4LG3 A;  5BPD A;  1IG7 A;  2JUG A;  2Y9Z A;  4AIK A;  4QWQ A;  1D1A A;  2PN6 A;  1VQO I;  3GFI A;  3GTP J;  3GLL A;  1DPU A;  5K7H A;  3WTZ A;  1LE8 A;  3FK7 A;  1JKP C;  1ZRF A;  4IHV A;  2HYJ A;  4FHT A;  1QNT A;  1AKH A;  4G6T B;  4QPQ A;  3ZRG A;  2HTS A;  1IXR C;  3ECO A;  1HCR A;  5KAF C;  1G3T A;  4LLN A;  3N05 A;  4FE7 A;  1GXQ A;  1W1W E;  4A3D J;  4PJL A;  4CA0 A;  3LAJ A;  4XOT A;  5D8K B;  2DYR H;  4UV9 A;  2B0L A;  3LA7 A;  2I10 A;  3OY9 A;  4X1E A;  1MSF C;  2R7T A;  5TGT A;  2LY1 A;  2L5Q A;  3ZGK A;  1HC8 A;  2CMP A;  1FBU A;  3SYT A;  1RUN A;  1V4R A;  2FD5 A;  2ZB9 A;  1LVK A;  3RQ4 A;  3PJR A;  2Z16 A;  3ERE D;  4IF4 A;  1SFK A;  2ETH A;  5ICE A;  3TP3 A;  3GFM A;  3IAS 2;  3FMQ A;  4IXA A;  4WWC A;  5FLX Z;  4XKW A;  2E1O A;  1Z3X A;  3SEQ A;  5A2Q K;  3OYI A;  2R92 J;  2VJ4 A;  5K1Y A;  1Y0U A;  3H9Q A;  5IY5 H;  5J8C A;  1IV6 A;  2DA7 A;  4FE4 A;  4LK0 F;  3CLQ A;  1BI1 A;  1SAU A;  3LFU A;  2N8G A;  1WH5 A;  1Y56 A;  3FHN A;  5B1A H;  1ZGA A;  3O8H A;  1D8K A;  4P55 A;  1ZR4 A;  2YU9 J;  1UMQ A;  2DOA A;  1LVA A;  4N9H A;  2R4G A;  2P8T A;  4HG2 A;  4RMN A;  4ZJZ A;  2JQ7 A;  4M9X A;  2DK8 A;  1TP4 A;  4ENM A;  2HQ5 A;  3I54 A;  4DJA A;  1XS9 A;  2PLY A;  4PJM A;  3R0A A;  1IF1 A;  2R7S A;  2QVO A;  4RDU A;  1UZC A;  4RB0 A;  1N77 A;  2W48 A;  1MMG A;  3CUQ A;  1B9N A;  1VQN I;  4OAY A;  3BJO A;  4RGR A;  4XSX F;  1E0E A;  2CUJ A;  1OFC X;  2NNN A;  3DBR B;  2F4O B;  1ZGW A;  1MBH A;  1UHS A;  2O03 A;  1TZL A;  4AVZ A;  4XIC A;  1T0F C;  4A0X A;  2QEX I;  1TC3 C;  1O7L A;  2DBB A;  2P81 A;  1MMA A;  4JBA A;  2TDX A;  1NG7 A;  3EYY A;  2GA1 A;  1RR8 C;  1WSU A;  1A5J A;  3FMR A;  4HBL A;  5KCM A;  1JE8 A;  2ME6 A;  1K83 J;  4JK1 X;  4RAG A;  1Q1V A;  3RYP A;  4RB3 C;  2DPU A;  3CD6 I;  1VQ4 I;  2VOP A;  4XM3 A;  3OYH A;  4NHJ A;  1KU9 A;  1DGW Y;  2GIV A;  2QSF X;  1ETY A;  2Y9Y A;  3IH4 A;  4XQF A;  2VQL A;  1MZB A;  3M8E A;  3KP7 A;  3I71 A;  4ZTF A;  3ZQH A;  2RVC A;  2COM A;  1DU6 A;  1XPX A;  3M1E A;  1Y1V J;  2EV6 A;  2P7V B;  3FM3 A;  1B72 A;  2V6C A;  2A07 F;  5DV5 A;  1A04 A;  3FWE A;  3K1N A;  3DBL B;  4YEJ A;  1SAN A;  3A02 A;  1FMW A;  4LMY A;  5E1X A;  1MBG A;  2NOJ B;  4D9J A;  1A6I A;  3B6C A;  1OCO H;  4ABZ A;  3WTW C;  3DEW A;  3E7L A;  1LPQ A;  1KU7 A;  2X1C A;  3BWG A;  4BAY A;  2JSC A;  2KPM A;  4CZZ A;  2R7X A;  5IYB J;  1WJ5 A;  2CUZ A;  2IA1 A;  1D1B A;  2GXA A;  4F93 B;  1YIT I;  4HYE A;  1TQP A;  4P9U A;  1Y0N A;  1AOY A;  4EV0 A;  1SFU A;  2IW5 A;  2QUF A;  4O3M A;  4Y4R A;  3LWF A;  2O0Y A;  3GX4 X;  3E6D A;  3BR2 A;  4IVN A;  1JXS A;  3HM5 A;  1IUF A;  2IGN A;  3G1O A;  3J80 K;  2E2H J;  2KL4 A;  3ABK H;  1YIO A;  3N97 A;  2I8D A;  3QAH A;  5GTH C;  2FNA A;  2CW0 F;  1KON A;  1IRZ A;  3MMY B;  1HKT A;  4WX9 A;  2IXS A;  2WY7 Q;  2EIL H;  1J2X A;  4CO8 A;  1QGP A;  2CJJ A;  3ABT A;  2VOD A;  1UJ8 A;  1R4M B;  3I59 B;  2IJL A;  2QWW A;  4HX4 A;  2NVT J;  2DFF A;  2NS7 A;  4BEH A;  3C1D A;  2ZXW H;  1KQ9 A;  3OMY A;  5L3B A;  4XLA A;  4BDY A;  2NYX A;  2VQC A;  4L9N A;  1IRG A;  2HOT A;  2V79 A;  2EFQ A;  3HOX J;  4DOZ A;  1YX3 A;  1FYM A;  5HNF A;  5M5X J;  1W7P A;  4MTE A;  1HKS A;  1A36 A;  2ICW G;  4L18 B;  4CHU A;  3EDP A;  5DM7 F;  2VC1 A;  3F8M A;  2KRF A;  3CCS I;  4HF2 A;  1YHQ I;  4CCM A;  5L3E A;  2BY0 A;  1ZLK A;  3HB9 A;  3E6C C;  3S1N J;  3WE2 A;  3QU6 A;  3S2W A;  3S15 J;  1DQU A;  4K2E A;  4M71 A;  3L2Q A;  4E7J A;  4AM3 A;  5KK1 A;  2FOW A;  1K79 A;  2YR2 A;  3FZV A;  2F48 A;  3H9G A;  1FP1 D;  1NHA A;  5D4R A;  2KJB A;  3ZQF A;  2YU3 A;  3HSE A;  3BR0 A;  3IWZ A;  1BA5 A;  3N4M A;  2FEZ A;  2UZK A;  3M9A A;  3SDG A;  2ADU A;  2VQH A;  3OYM A;  1Y1W J;  5LEJ A;  2G7U A;  3PO3 J;  3ECH A;  4EAT A;  2LTP A;  5E8G A;  2XHK A;  2XAG A;  2DYS H;  3HKZ A;  1YX5 A;  1MKM A;  2HS5 A;  4C3H J;  1S7E A;  4XLF A;  2ECB A;  2ZNZ A;  4I0A A;  1FIP A;  4RB1 A;  4B09 A;  4PZJ A;  3VB2 A;  4LJZ F;  1O3S A;  2GIZ A;  3FXJ A;  4XK4 A;  2R5Y B;  2HVS A;  3K4L A;  1V3F A;  3BRO A;  2YX4 A;  3OIQ A;  4NC7 A;  3SZT A;  4QTR A;  3WGI A;  1QPI A;  1F5T A;  3WTV C;  1D0X A;  4CDG A;  3OIP A;  3IRQ A;  1AKH B;  1PJR A;  1N78 A;  1XN7 A;  2I5U A;  2XAH A;  4BAC A;  1MJA A;  3OYE A;  4C3J J;  1PUF B;  1I1S A;  1S3J A;  1ZG5 A;  2BXZ A;  1ZTR A;  3KYL A;  1MBK A;  4CYD A;  4XBF A;  4XMY A;  2D45 A;  1OLT A;  3FBN B;  2R5Z B;  5TRD A;  4DYC A;  5LLQ A;  5J40 A;  4KFC A;  5IYD J;  3J7A O;  3BOQ A;  4FIS A;  1HQC A;  4BKX A;  1BM9 A;  3JRD A;  5B3S H;  1JTY A;  3RKX A;  4V2F A;  3ZCO A;  1VQ7 I;  2ZC2 A;  4IRG A;  4AIJ A;  1T8I A;  2XGD A;  1VF9 A;  1TQI A;  1ZAO A;  2G9W A;  2DA4 A;  1KU3 A;  2JPC A;  2XAF A;  4HNU A;  2CSO A;  1HOM A;  5AIP A;  4Y3O A;  3OYJ A;  4I2O A;  2DPD A;  2DK5 A;  3KX2 A;  3MQ0 A;  2VLA A;  3WTX C;  2M8E A;  2O61 A;  3KP6 A;  2ZCW A;  3F22 A;  1MJB A;  3GTG J;  4L9J A;  4AYB N;  2V1U A;  1B8I B;  4AC0 A;  1UAA A;  4RGX A;  2M4G A;  2VKH A;  3PNV A;  3U1K A;  1RC9 A;  2ESH A;  5J6X A;  2L9V A;  4A5M A;  3L2R A;  5CQG A;  3IH2 A;  2D1V A;  4CCL A;  2QQ8 A;  3T0Y A;  5LFA A;  3I55 I;  1I39 A;  1Y6I A;  2EZK A;  4DGW B;  1NK2 P;  4EJT A;  3BZ6 A;  2RRE A;  3NRV A;  1HKQ A;  1LEB A;  5HS7 A;  1SVL A;  3BP8 A;  1LDK B;  3OL3 A;  3HTU A;  2WAQ N;  2W00 A;  5IOY A;  3GLX A;  4KT5 C;  2RDP A;  5DUI A;  2WTE A;  2WC2 A;  3NWT A;  4N0B A;  2L4A A;  4B47 A;  2CRG A;  2L54 A;  1G6N A;  2F5F A;  3KEY A;  3W2V A;  5F1R A;  4BXU A;  1WI9 A;  1K4T A;  3OS1 A;  3ZN1 A;  3BG5 A;  3QPS A;  1D8J A;  1ZK8 A;  4RS8 A;  2QEN A;  3ZMZ A;  4UNO A;  3F72 A;  2NVY J;  1E3O C;  2KP6 A;  1J59 A;  1W5T A;  4EQQ A;  4UUS A;  1VFC A;  4ZYH A;  4I76 A;  4LIT A;  5H2F C;  4F92 B;  2BVL A;  4HF1 A;  2FBH A;  1G3W A;  2BEO A;  2R7W A;  1U3E M;  4OWR B;  1U5T A;  4HDU A;  2Y30 A;  3RSN A;  3QWL A;  3DKY A;  4M6V A;  4B8X A;  2DTR A;  3I56 I;  2DI3 A;  5FFX A;  3BJ6 A;  3F8F A;  1TT5 B;  1V5G A;  5IPA A;  1X1B A;  3K1M A;  1YW8 A;  4FQG A;  1JHH A;  1IDY A;  4C3I J;  4HLY A;  4A69 C;  3MWM A;  1HSJ A;  4S05 A;  3K1P A;  4LG0 A;  4BBR J;  1K6Y A;  3K70 C;  2DOF A;  4KIG A;  4A0Z A;  4JX5 A;  2XGE A;  4C30 A;  5BS6 A;  3LL7 A;  2FOK A;  2HQA A;  4A3J J;  3W2A A;  4A6E A;  5CPR B;  1BR2 A;  1YJ9 I;  5EGO B;  2ZXJ A;  3GEZ A;  1S5L C;  2FUG 2;  2ID6 A;  2ZFW A;  1ITY A;  2H6B A;  5ICF A;  4AIH A;  2QYO A;  2O3F A;  4LIU A;  5DCF A;  2XB0 X;  3UR3 C;  5J4Y A;  3M8J A;  1NTC A;  1W36 D;  3Q0V A;  3ELK A;  1MNM C;  4H4K C;  4HOB A;  3X2Q H;  4PJ0 C;  2DA5 A;  1FOY A;  1S8N A;  2V9K A;  3S93 A;  2JRT A;  1BC7 C;  1H9G A;  1ENH A;  3BQZ A;  2K40 A;  4V19 K;  2BW3 B;  3UKG A;  1H88 C;  5JLW A;  2W4S A;  2DO7 A;  3K4C A;  4ON0 A;  2EWN A;  2JZY A;  3U2R A;  1PVE A;  4MQV A;  4OMY A;  2PMH A;  4II2 A;  1ULY A;  3L2W A;  3DU6 A;  5JI6 A;  2X51 A;  1QHH D;  3B6A A;  5CLS A;  4A93 J;  1LEA A;  1R22 A;  2J5O A;  2MFZ A;  1BJZ A;  4AWX B;  1QQI A;  1Z6T A;  2FA5 A;  2FE3 A;  4PJN A;  2OA4 A;  3K4B A;  3HL2 A;  1BW6 A;  2RNG A;  5D5X B;  1ODD A;  4I02 A;  1WKM A;  2HDW A;  5ILU A;  2JVG A;  1R71 A;  3C2H A;  1FYL A;  1D5Y A;  2DQR A;  3ZMV A;  4II3 A;  2RNJ A;  3R4K A;  4A3F J;  1R1T A;  2ZXI A;  1GDT A;  4AVP A;  1Z6R A;  4XOP A;  4ZYG A;  5HLG A;  2XSD C;  1U6G A;  2R5Y A;  3JTG A;  1A6Q A;  4GCV A;  5L3C A;  4BEH B;  1R6R A;  4M3G A;  4J19 A;  4JQF A;  2FMY A;  3QOD A;  4XLC A;  1H9T A;  2CGP A;  3CP2 A;  4UB8 C;  2ELK A;  3PIP F;  1XMX A;  4A0Y A;  1X2N A;  2X6O A;  4HNT A;  2HTJ A;  4E7I A;  3AG3 H;  3TW7 A;  3ZOB A;  2H6C A;  2OQG A;  1GV5 A;  1FY7 A;  2E1M B;  5CKT A;  5F0H A;  2W25 A;  2OBP A;  3HRM A;  4M3F A;  4MEY F;  3LSK A;  1S29 A;  2V9P A;  2CQQ A;  1OCZ H;  4WXC A;  3FDY A;  2HZT A;  5FKK A;  3QQA A;  2VL8 A;  2KLO A;  1S7A A;  4LOC A;  4I98 B;  2ISY A;  1TLH B;  4G6D A;  2D1H A;  1G4D A;  4NQW A;  5JLX A;  2KRH A;  3ABU A;  2RGV A;  2M9H A;  2W1O A;  3QYE A;  1IUY A;  1JTX A;  2WWY A;  1JT0 A;  2IBD A;  2Q2E B;  4UXN A;  2OD5 A;  1I5Z A;  1VQL I;  4XRS A;  3R61 A;  2VOO A;  2Y75 A;  4Q48 A;  1VQK I;  3K0L A;  2E7X A;  2EPF A;  1EH7 A;  2KMU A;  4A3E J;  1JUM A;  2CO5 A;  3QPT A;  1QA6 A;  5BQT A;  4KMU X;  5ICC A;  4UUT A;  4D0P A;  1QHG A;  1MSE C;  1BIB A;  1SVM A;  2P7C B;  3T5X A;  3RPU D;  3VYS B;  4F52 A;  1W36 C;  1BI0 A;  4F91 B;  2E5N A;  2FNP A;  3ZR8 X;  3SJM A;  2YSR A;  1AA7 A;  1YW7 A;  2OQR A;  2GLO A;  1S7O A;  3HRT A;  3JSO A;  2W85 A;  4BS9 A;  4YEL A;  2E36 A;  2HPI A;  1LNW A;  4IHW A;  4E7L A;  4DQ2 A;  4XR6 A;  3P9I A;  3BR3 A;  4N9I A;  5DYM A;  3E1S A;  2CFX A;  2DT7 B;  3O2P E;  2NXN B;  2QGU A;  3HGG A;  2O8K A;  1I6X A;  2CQN A;  2OUM A;  4X6A J;  3KCC A;  3Q9V A;  1Z05 A;  3FIS A;  4OIQ F;  2CYY A;  5IT3 A;  4OMZ A;  5E8I A;  4A5N A;  1QVU A;  2AXL A;  3P9K A;  5F04 A;  3CMM A;  2D2W A;  3VWB A;  2GM4 A;  3DF8 A;  4IX7 A;  2GA2 A;  1IJW C;  1ZRD A;  2OPT A;  3ZMU A;  2DAO A;  1MMD A;  4FCY A;  2PI0 A;  1T0F A;  2NS8 A;  1SVO A;  1LDJ A;  4ASN A;  2UXX A;  5J4V A;  4KN7 X;  2OTL I;  2QF7 A;  4LB5 A;  2M45 A;  3V4G A;  2JA7 J;  4V2G A;  1FP2 A;  5GTI C;  4BGD A;  5D6F A;  1ZKG A;  2P6S A;  3TOB A;  4C2T A;  1CGP A;  3G4S I;  1P4A A;  3DPL C;  4NC8 A;  4ZH4 F;  1F4K A;  1T39 A;  4U7B A;  3CP8 A;  2GOM A;  5CJ9 A;  4B43 A;  2XAQ A;  2OF7 A;  1BOA A;  1S9H A;  2VE8 A;  1T56 A;  2COB A;  4BXF A;  1YG2 A;  1D0Y A;  3RJP A;  4LFU A;  4M9Z A;  3WG9 A;  2JA2 A;  4S0H B;  1OCC H;  1ZH5 A;  2LSO A;  4I01 A;  3A2K A;  4Y13 A;  1Y8Q B;  3Q9S A;  3TP0 A;  3G73 A;  1OIS A;  1TWC J;  1OCP A;  2F4M B;  1T6S A;  1WCM J;  3CMA I;  5DCM A;  2LY2 A;  2V9V A;  1BJA A;  1ETX A;  3ABM H;  1OMI A;  4I09 A;  5KNL A;  4CYC B;  5EZG A;  3TBI A;  1WJA A;  2V1D A;  2ELH A;  2L02 A;  5IOZ A;  1ZG3 A;  3H36 A;  2W82 A;  3KLO A;  1XMA A;  3KFW X;  4NUB A;  3VYR B;  2Y0S N;  3LNQ A;  4J01 A;  3TO6 A;  1WWX A;  2PQ8 A;  4UVB A;  3VSL A;  2LBF A;  2Y0S A;  1DUX C;  3S1Q J;  2Z2S B;  2LY9 A;  1N75 A;  2CFO A;  3GYH X;  4A3L J;  5FO5 A;  1FTZ A;  2OU2 A;  2GWR A;  2KRC A;  3K7A J;  1EV7 A;  2LOO A;  3JAM Z;  1P6R A;  4J00 A;  2JPB A;  5HOD A;  2PMZ A;  5M5W J;  3EPZ A;  4IRI A;  1XB4 A;  1B59 A;  1W5C C;  4BXX J;  4EGZ A;  4LB6 B;  4RM2 A;  4MQ9 F;  3WTY C;  2YX7 A;  4X0G A;  3HIF A;  2Y2Z A;  1A35 A;  3FXK A;  3NQO A;  2XGC A;  1DP7 P;  1VQP I;  2WAE A;  4OU0 A;  3FF5 A;  1FBS A;  3H1C A;  2XVC A;  3DFG A;  5C4J J;  2W57 A;  5FRM A;  1CQT A;  4CSW A;  4MTD A;  2XPV A;  1F9N A;  2R3S A;  4BUP A;  4GGG A;  4G7Z F;  2JUC A;  3BR6 A;  4AD9 A;  1ZG1 A;  2XGX A;  1Z3Y A;  3FMS A;  3NEU A;  3HDD A;  3ML6 A;  2A5W A;  2RQP A;  1RR7 A;  3H3U A;  2F5D A;  1IN6 A;  4Q47 A;  3J7Y J;  1P92 A;  1VTN C;  1V55 H;  2L4M A;  3KEO A;  4ITV A;  2X1D A;  1FZP B;  3HOW J;  1QO0 D;  3SHF A;  2X9D A;  3NAR A;  1SFE A;  2V1N A;  4BQN A;  3WTS C;  3RTR A;  1I1G A;  4KNY A;  1YIJ I;  2DU9 A;  3AG2 H;  1MDM A;  4G8X A;  4XKV A;  2VAS A;  4PSW A;  1NG6 A;  3G3Z A;  4CCK A;  1OR7 C;  4HST A;  4ZDL A;  1X3Z B;  1MH4 A;  2HU9 A;  2VKV A;  3HKZ N;  3KP5 A;  3FXQ A;  4XRS G;  2ZFU A;  3CCJ I;  1USS A;  2YS9 A;  1TW2 A;  2LRE A;  4DBQ A;  2AQF A;  2XDV A;  1CF7 B;  1WJC A;  3PSF A;  1JKR C;  3CUQ B;  4R8H A;  4Q4Z F;  2NRA C;  3HSR A;  4UY8 I;  1P7J A;  3A01 B;  3C3W A;  2HVR A;  1I3Q J;  3S1M J;  3C2G A;  4KT6 A;  2DW4 A;  1O3R A;  2IS6 A;  4CGZ A;  4EM1 A;  4H0E A;  2M8G X;  1TQM A;  1NH3 A;  2ECC A;  2EZI A;  1X4P A;  5JVG F;  3OYF A;  4PK4 A;  1LDD A;  2O5R A;  2ESN A;  2FBI A;  2HEO A;  3IP4 B;  1SD6 A;  3F6V A;  1E3P A;  2L2O A;  1UFM A;  3Q3S A;  4BNC A;  5GP9 A;  2P6T A;  2GBY A;  1YS7 A;  3MVP A;  2R7R A;  2QLZ A;  2V1X A;  4U0Y A;  4GRI A;  2M1B A;  3Q0W A;  4L5J A;  3S2D J;  4YRV A;  3KPH A;  5J1R A;  4PSX A;  3KP4 A;  3K4N A;  1YW9 A;  4N4O B;  3DLA A;  3CCL I;  1EA3 A;  1I3A A;  1QZZ A;  3FXR A;  3OYD A;  3GFJ A;  3OYG A;  2E35 A;  4Y33 A;  4BJT A;  1VI0 A;  2H09 A;  1XCB A;  1FWZ A;  3H5A A;  1XSV A;  3GUD A;  2HR3 A;  4CH7 A;  1EKE A;  3Q5F A;  2DDA A;  2Z1D A;  2K27 A;  3HG9 A;  1KQ8 A;  2LD5 A;  2HI3 A;  6PAX A;  2Z5U A;  1ZRC A;  4QSH A;  3FKJ A;  3EUA A;  3KIO A;  4QLC U;  1WI3 A;  1EH6 A;  3D0S A;  2L7M P;  1K61 A;  3OWT A;  3KP3 A;  2X0L A;  3MZ8 A;  4XLH A;  4BL0 B;  3I3L A;  4JX6 A;  5ICG A;  4Q5S F;  3M4O J;  1Y8R B;  4U0W A;  5JFR A;  2CQX A;  1FSH A;  2V26 A;  2VUM J;  4I99 C;  4EJO A;  5EYR A;  5E17 F;  5E3M A;  2X6X A;  4XN0 A;  2MC3 A;  1IO2 A;  4PFP A;  4AID A;  3BLY A;  3CCM I;  3H9J A;  5GPA A;  1IW7 F;  1POG A;  3AL0 C;  1FSE A;  3DKX A;  5IT9 K;  1MMN A;  4D7M A;  4KJZ A;  1IV8 A;  4M74 A;  3HPG A;  3SZP A;  2XAS A;  1YE9 A;  3ZN0 A;  2M0M A;  4ZDO A;  2E1C A;  2M3A A;  4LIV A;  1JGS A;  4R79 A;  3CTA A;  2EV0 A;  2HGC A;  5FRN A;  2L9R A;  1SMY F;  1ZLJ A;  3H35 A;  1APL C;  3HEF A;  2OTJ I;  1Z0X A;  4M3B A;  1Z91 A;  3F8B A;  1R58 A;  5ILS A;  5B5E C;  2EZL A;  2CV2 A;  1MD0 A;  3WTU C;  4QIW N;  1UST A;  2ZME B;  4IZZ A;  3OSG A;  2G0E A;  3C18 A;  2O8X A;  2QM3 A;  3QPL A;  1GLN A;  5K5O A;  1FOK A;  2BYV E;  3J81 Z;  4HAM A;  3JCU C;  2ZNY A;  4FT8 A;  4F3Q A;  4XN3 A;  3V7R A;  5D5U B;  3OOU A;  1U78 A;  1H0M A;  1UG2 A;  5GAH J;  3SXY A;  2QQB A;  1OCT C;  5FB2 A;  1X2M A;  1SFX A;  3COA C;  4XOR A;  1BOB A;  1V5E A;  3RZO J;  2LVS A;  3BR1 A;  2KHM A;  3GO5 A;  1BIA A;  3AG4 H;  4F7Z A;  1IDZ A;  3BTC A;  2LFB A;  3QYB A;  4L0Z B;  3CUO A;  3GBG A;  2UUZ A;  3BTJ A;  1J75 A;  4MO7 A;  1XC5 A;  4KUM A;  2DMT A;  4MNU A;  3BJA A;  3I5U A;  3SZG A;  2VN2 A;  1O57 A;  1YQA A;  2QBY A;  3CLO A;  5DUK A;  4DZP A;  2JA8 J;  1C0W A;  2VE9 A;  3PIO F;  3JAM K;  3OS2 A;  1F36 A;  1KGS A;  3WU0 A;  3PQJ A;  4YFK F;  2QKM B;  2QSH X;  2F6C A;  2L7F P;  2AXT C;  3CJR B;  5J8F A;  3FX3 A;  3ASN H;  4U0V A;  2WV1 A;  3KZI C;  5M5Y J;  3K9T A;  5DD8 A;  5E3N A;  3CDH A;  3RKW A;  2OV7 A;  3DTI A;  4BJ6 C;  3BTL A;  4ZC3 A;  4RAZ A;  3L2V A;  1OQY A;  3CME I;  4Y7N J;  1UB9 A;  4ZZD A;  2J5P A;  3LSG A;  2XAU A;  3F3X A;  3ONQ A;  1XD7 A;  3LAP A;  3DEU A;  3CF5 F;  1L0O C;  2LR8 A;  3CCR I;  2EQR A;  2EZH A;  2DA6 A;  3MKY B;  4QPO A;  2X4H A;  2VT2 A;  2QZ8 A;  2OAZ A;  3ZQC A;  3M7G A;  3MN2 A;  2KKO A;  2HVQ A;  3NWS A;  3QP6 A;  2XIG A;  4L9T A;  5FKN A;  1U9O A;  5CVV A;  3KZY A;  3ROU A;  4XLP F;  3GZ6 A;  3L7W A;  5E18 F;  2HNH A;  1HF0 A;  2HQN A;  3T8R A;  3CJN A;  2F4I A;  2IS4 A;  2KIF A;  4OIR F;  1MND A;  3ZPL A;  4BHP A;  4MGR A;  3I4N J;  2O9L A;  1ZYR F;  3HSF A;  5GAG J;  3OYA A;  2DXI A;  2BXY A;  3H0D A;  1R5H A;  2A68 F;  2KFD A;  1SD5 A;  4B44 A;  3GTQ J;  2R7F A;  5GPC A;  2KIQ A;  2X1E A;  4JYK A;  3HOT A;  1QZY A;  5CVU A;  1B1B A;  4ZYD A;  4LGW A;  4XKC A;  2H8W A;  2PJR B;  3CDL A;  2UXN A;  4U88 A;  1IN5 A;  1IRX A;  4HF0 A;  4DYR A;  5EG0 A;  5E1Z B;  3G1M A;  1Q1H A;  1WJD A;  1JHF A;  1LUJ B;  2P0W A;  1O7F A;  4W97 A;  5J47 A;  4XID A;  2HPM A;  4G12 A;  1QU3 A;  4PFO A;  2VBX A;  3A1Y A;  2KIU A;  1BN5 A;  2JRM A;  2QBY B;  3TED A;  5LGT A;  1AU7 A;  3BZK A;  2EIK H;  3EUH A;  3G1L A;  4M3D A;  3W6J B;  3CES A;  1P4W A;  1X1A A;  3CO6 C;  3KEQ A;  5J3L A;  4AUX A;  2XPU A;  2F2E A;  2XKP A;  1R1U A;  3HXL A;  2NVQ J;  1BI3 A;  2O7O A;  4E70 A;  2A5Y B;  3RZD J;  2MBF A;  1FNN A;  2M2E A;  2BGC A;  2DA3 A;  1HXD A;  2JVH A;  2LRD A;  5DS9 A;  1HA8 A;  2YPR A;  2A3S A;  5CVJ A;  3J7Z I;  4U7D A;  1B8I A;  4E4H A;  4L0Y B;  1U2W A;  2LYC A;  2EIJ H;  2DLL A;  2M0C A;  3F0C A;  2L9N A;  3MD2 A;  1ZR2 A;  3WU2 C;  2ZME A;  2MYS A;  4GXO A;  3BT9 A;  4ZYE A;  2ZO4 A;  3S3O A;  1T08 B;  3M07 A;  4UV8 A;  2GQQ A;  4HX7 A;  3IL2 A;  2WB1 A;  4ENN A;  3K70 D;  2WAQ A;  3CZ6 A;  1U8R A;  2EV5 A;  2Y48 A;  3DTK A;  5FJ8 J;  2EH3 A;  2L01 A;  2E34 A;  1MJ9 A;  2ZSH B;  2A61 A;  4IQ4 A;  1T33 A;  1U9N A;  4XNF A;  4UUV A;  3DCF A;  4XRF A;  4ZZL A;  1TWG J;  4OIO F;  2OCC H;  3GFL A;  1IXC A;  3FM5 A;  3VDX A;  1QZE A;  5E1W A;  3T1B A;  4GYG A;  3F8N A;  3DQV C;  3Q0U A;  1D0Z A;  5FKM A;  4WXH A;  1MH3 A;  2P5V A;  2DA2 A;  5D4S A;  3ESW B;  5M3M J;  2DMU A;  3AAF A;  4EM2 A;  3G2B A;  3HC7 A;  2XC7 A;  4A6D A;  1QVT A;  2RC4 A;  2KIS A;  3OYC A;  1OR7 A;  4HQM A;  3WOD F;  4IRH A;  1DGR M;  1LJ9 A;  4Y15 A;  2IPQ X;  1B9M A;  2G7H A;  1FIA A;  2VBW A;  2JTV A;  4BH9 A;  1HLV A;  5ED4 A;  4A3I J;  2A6T A;  2DJI A;  2H1K A;  2WB1 N;  3ZQG A;  4EGY A;  1X1C A;  3HUG A;  4IEJ A;  2IVM A;  2A6E F;  5FRO A;  3CCV I;  4A3K J;  2RV8 A;  2WV0 A;  3L1P A;  4YIF A;  3DKW A;  3R6S A;  2XF7 A;  3GME A;  1RKW A;  1S72 I;  1GT0 C;  3BG6 A;  3GCM A;  1IN8 A;  3DWL E;  5HDN A;  5EGO A;  2VKE A;  3BQY A;  3S3M A;  1DDN A;  1MGT A;  5E3O A;  5DEQ A;  2CUE A;  2MC4 A;  5JHF A;  5EDN A;  3IHU A;  2QKL B;  4RLQ A;  4Y17 A;  5GAD J;  4KMF A;  3H3Z A;  4KIB A;  3TOA A;  2R0Q C;  1FEX A;  2MLK A;  4WXD A;  5H6Q A;  3CF2 A;  1XGO A;  3LSI A;  3FIW A;  3LQR A;  4GDF A;  4I7H A;  1HDP A;  5K5Q A;  1AWC A;  3C2B A;  4AU7 A;  4DZJ A;  1R5G A;  1X58 A;  2HZD A;  3GZ5 A;  1ETO A;  1U5T B;  1RI7 A;  2LG4 A;  1VZ0 A;  2ZBK A;  1FPQ A;  5TIS C;  4LD5 A;  4E7S A;  1FT9 A;  2VKD A;  2M87 A;  2CH0 A;  3J80 Z;  2OZU A;  2WA0 A;  3IC7 A;  1MBJ A;  3HOZ J;  1TWH J;  3HPH A;  3K69 A;  5BMZ A;  1F43 A;  1BR4 A;  2CUF A;  2UV1 A;  2JMW A;  1T38 A;  3T8T A;  3GWZ A;  3TQN A;  1LFU P;  4JP0 A;  3PUB A;  3M8F A;  4M72 A;  4MFD A;  2A6H F;  5KAI C;  2DTZ A;  1X1D A;  3RPU A;  2CV0 A;  1JUS A;  4C2U A;  3S16 J;  3PNT A;  3FXU A;  3TL4 X;  2EA2 A;  3MKL A;  3ABL H;  2CQ7 A;  1R7J A;  2CWE A;  1VQ6 I;  5K5R A;  3BC8 A;  3W3C A;  3GVA A;  2XV4 S;  4MHG A;  5LEK A;  1SFO J;  2STT A;  5F0F A;  4MLO A;  1FJL A;  4LLL A;  1G3Y A;  4YII A;  5HNH A;  2MSY A;  4HW0 A;  1K78 A;  4EEF G;  3DPU A;  4C9Y A;  4NNJ A;  1N25 A;  2IGK A;  3BG9 A;  5JVT A;  5CVR A;  2P4W A;  4IJA A;  1IRF A;  2MG4 A;  2NOG A;  3IH3 A;  4BQQ A;  3CC7 I;  2TCT A;  2V4J C;  4BDZ A;  3LSR A;  2VXD A;  1Z9C A;  1WQ2 A;  3V8K A;  1WH7 A;  3QPH A;  4JX4 A;  4KDP A;  4LLG F;  1WHU A;  3PQK A;  4HQE A;  1BW5 A;  2R7D A;  2XF5 A;  2R7O A;  1H89 C;  5LGN A;  2UWM A;  3D5S C;  3DBH B;  4P5O A;  2VPL A;  1FOW A;  2E1M C;  3EET A;  4I6Z A;  2NAZ A;  5IP7 J;  3G71 I;  4BE2 A;  1SAX A;  2FBK A;  4XON A;  4HX8 A;  5HLH A;  4PCQ A;  3SFZ A;  3HHG A;  2E5Z A;  4U87 A;  3E5X A;  1XG1 A;  2VIX A;  2HFH A;  5F27 A;  2FRH A;  1X4O A;  3QOP A;  5HLT A;  1ETW A;  3DU5 A;  3S8P A;  4DIQ A;  4KA4 A;  1HW2 A;  2H27 A;  2GXG A;  1JGG A;  3I58 A;  4B48 A;  5D8L B;  3OYK A;  3RCO A;  1AHD P;  5LHI A;  2VB6 A;  2HXI A;  3HUG B;  2M7A A;  1FC3 A;  1VQ5 I;  3DLL F;  1KU2 A;  1G8X A;  1EH8 A;  4NB5 A;  2FQ4 A;  5TJJ A;  3CCE I;  2XAJ A;  3H0G J;  4IOC F;  2QQA A;  2EBI A;  1JJ6 C;  3NAU A;  3U21 A;  1LB2 A;  4L5E A;  1S6L A;  1W7P D;  1X3W B;  2IP2 A;  4G6Q A;  2R93 J;  4PGH A;  2FU4 A;  1J0R A;  2Q8K A;  4YG2 F;  3GF2 A;  5C4X J;  3WHC A;  1VQ9 I;  4ESJ A;  2FX0 A;  4XKB A;  4HSR A;  3CCU I;  5HDK A;  2K9M A;  2DT6 A;  2XRL A;  2H8R A;  1K4S A;  1UHM A;  2VQG A;  5CQE A;  1IAW A;  1WVR A;  2PX9 A;  4LG0 B;  2RAE A;  2DFH A;  3BDD A;  2W7N A;  2EIN H;  4DBR A;  2VON A;  2H1L A;  1SEU A;  1ETK A;  3MAJ A;  1CF7 A;  3K4J A;  3JRA A;  2HDC A;  4GFB A;  2H94 A;  2EFW A;  4LK1 F;  2KZG A;  3D5L A;  4HA8 A;  3C7J A;  3ZMS A;  2AS5 F;  3GXO A;  1QRY A;  3A4C A;  4EVI A;  2MGQ A;  4TV7 A;  4CXF A;  5J1Y A;  4BU2 A;  3QOE A;  3MCZ A;  1HW5 A;  5EEG A;  1YRN B;  1TW3 A;  1ZGJ A;  2MLG A;  3LA3 A;  5LRS A;  4FX0 A;  2K4J A;  1OPC A;  1R9T J;  2STW A;  5D5W B;  1K6O A;  2DOE A;  4RM3 A;  5FD5 A;  3HOU J;  1MBE A;  2GOX B;  2LP0 A;  3DEE A;  1WZ2 A;  3VOD A;  2QCO A;  2LNB A;  1F1Z A;  2EFO A;  4IOA F;  3BPV A;  2ID3 A;  3I64 A;  2MAB A;  1SC7 A;  1ZRE A;  3CDI A;  1SD4 A;  1VND A;  3I0T A;  3EUK L;  3E6M A;  3QRF F;  3PSI A;  2Q0O A;  5JR3 A;  4E7H A;  1PUE E;  1TT0 A;  4P96 A;  3LFK A;  2QQ9 A;  2CS3 A;  3HOY J;  4NDL A;  3OOP A;  3A03 A;  5LHG A;  2X48 A;  2VI6 A;  4F55 A;  1NK3 P;  2FXA A;  2YUS A;  2K3P A;  5EEA A;  4RBO A;  1B6A A;  1HW1 A;  3FXM A;  1IN4 A;  1YFH A;  1VQM I;  1KYW A;  4CZC A;  4RGS A;  2ZJP F;  3KLN A;  1BC8 C;  5F6F A;  2BY3 A;  3RQI A;  4FAS D;  5EG0 B;  1KZH A;  2MD5 A;  2DOD A;  2A69 F;  5H6R A;  4XSZ F;  4JOM A;  1FTT A;  1RKT A;  2JK3 A;  3E5U A;  5DCM B;  3MKZ A;  1E2X A;  1P9Q C;  3BG7 A;  2DQL A;  3TO7 A;  4KIC A;  1WRJ A;  3TW6 A;  1W0T A;  4BBS J;  5DM6 F;  2BOL A;  1HDD C;  4BY1 J;  2FJ1 A;  1MBF A;  2XKO A;  1WFX A;  1XX5 A;  3OL4 A;  3P7N A;  3MFK A;  2RKH A;  2V7F A;  3S2H J;  1FMV A;  5DD4 A;  2OC6 A;  1V5F A;  5HLI A;  5L3D A;  1OYI A;  1OYY A;  4CCO A;  3O3K A;  4A3B J;  4HNV A;  5DDG A;  1ZAR A;  4IHX A;  3HHH A;  3TO9 A;  3HBL A;  1ETV A;  3JTH A;  1GV2 A;  3JRF A;  2HXO A;  3MKW B;  4S04 A;  1YS6 A;  1Z67 A;  3JRH A;  2AO9 A;  2E19 A;  3WHB A;  3E5Q A;  4Y52 J;  3SEZ A;  4CIC A;  1FX7 A;  2LMD A;  1U0J A;  2MH2 A;  1FLI A;  3FBI B;  3AG1 H;  4B1R A;  3F9K A;  5F0C A;  1L3L A;  1YYV A;  4OIN F;  3DPT A;  4C2M J;  1UEL B;  5BOX A;  1RUO A;  1K7A A;  4A12 A;  2K9N A;  4P1W A;  2Y0M A;  4M73 A;  1XSD A;  1UCR A;  1Z77 A;  1RET A;  2F5V A;  1D3Y A;  4E7K A;  5C3E J;  5HDG A;  3L9F A;  1VQ8 I;  2LLK A;  1JI8 A;  1DP3 A;  3W6V A;  4Z2Y A;  3UNG C;  2XRN A;  1X3U A;  2XF6 A;  3K4M A;  3GTO J;  2DMP A;  3CUQ C;  1X1P A;  1Z7U A;  2XPW A;  1P7I A;  2BV6 A;  4MFE A;  5E3L A;  3F21 A;  3E3V A;  3K2A A;  3MEX A;  2BBY A;  3S32 A;  4B3X A;  4DNC A;  3BG3 A;  1ONV A;  5C44 J;  2L7K A;  1ZHF A;  2HKO A;  2LDU A;  3K4K A;  5D6E A;  3J81 K;  3OYB A;  2LC2 A;  2CW7 A;  4WCG A;  3R0J A;  2F5E A;  3WE3 A;  1I27 A;  2HWV A;  1YO5 C;  3I4M J;  4ZDP A;  4G9Y A;  3QU3 A;  1OKR A;  3TKY A;  3MZH A;  1XGM A;  2ZJ2 A;  1DPR A;  3ZQL A;  1V54 H;  4IO9 F;  3CJT B;  5FLX K;  1Z1D A;  3KE2 A;  2W24 A;  3A0B C;  2ME0 A;  2MH9 A;  4IHS A;  3O8G A;  1ORK A;  3JRE A;  2DMN A;  1WGX A;  4HV6 A;  3D1N I;  1I6H J;  4MEX F;  4BE1 A;  2B7E A;  5IP9 J;  2L3D A;  4BQA A;  1XMK A;  2EA4 A;  1GUU A;  4IL6 C;  1SD7 A;  3OYN A;  3BCA A;  2K86 A;  2VJJ A;  2TRT A;  3IKT A;  2PMU A;  1R49 A;  4IKF A;  5KVR A;  2P5L C;  2KIM A;  4PJJ A;  3LSM A;  5GAE J;  2QSG X;  4M6X A;  4BHC A;  4CYC A;  1U8B A;  3F23 A;  3ASO H;  4BHB A;  4A2U A;  2LF8 A;  1YTY A;  1T98 A;  3OIO A;  2GAU A;  4XRM A;  3VYT B;  2M5W A;  3G6E I;  3S3N A;  1EJ9 A;  1T95 A;  3KZZ A;  4I0B A;  3JR9 A;  3AKZ A;  4ZYA A;  5B1B H;  4RAY A;  3H5R A;  1HST A;  2E71 A;  3AL0 B;  2IAI A;  3PNY A;  2ELJ A;  2K9L A;  3S17 J;  4WK8 F;  2X6Y A;  1G3S A;  2E7W A;  1XDU A;  3KET A;  1KA8 A;  3KYD B;  3ZP5 A;  3U9G A;  2E2I J;  2DJN A;  2ZSI B;  1UHW A;  3PO2 J;  5FKO A;  3KYC B;  1MDM B;  3H5N A;  2KDZ A;  4G94 A;  2K9S A;  1ON1 A;  4A3C J;  4ANJ A;  1X19 A;  2MD0 A;  2VBZ A;  2C6Y A;  1RRJ A;  2KT0 A;  4L5I A;  5KHD A;  1BR1 A;  2KZV A;  3WTT C;  1GXP A;  1G2H A;  2NVX J;  3JRB A;  2VPR A;  1FYK A;  3M1C A;  1J09 A;  3VPR A;  4YIR X;  1TWA J;  5LBQ A;  5B66 C;  3GTJ J;  3HJE A;  2R7V A;  2IGM A;  4XLE A;  3U1D A;  2ZME C;  2B9S A;  3VYU B;  2VXZ A;  1DU0 A;  1WJE A;  3PFI A;  4B3A A;  2EFN A;  1B72 B;  5BNG A;  4CUG A;  2ZXH A;  4NC6 A;  1QPM A;  2K5C A;  3V8J A;  2BW3 A;  1FBQ A;  3D5R C;  1HBX G;  5FFZ A;  1EF4 A;  3LOC A;  4PUS A;  1BI2 A;  4CCN A;  4WF2 A;  2ACJ A;  2LK2 A;  2PFB A;  2B63 J;  3S14 J;  5F64 A;  1MMS A;  1RNL A;  3A0H C;  3ERM A;  4N4N B;  1ZN2 A;  3O6B B;  2LBF B;  3ZMT A;  3FHZ A;  2M30 A;  1YOV B;  3LA2 A;  2ISZ A;  2P5K A;  2K85 A;  3SFI A;  4DYQ A;  4OIP F;  1MIJ A;  2L7Z A;  3HRS A;  3ZQQ A;  4IQJ A;  1W0U A;  3E0J B;  1REP C;  5EF6 A;  4RGU A;  3ULQ B;  3RI4 A;  5F1J A;  2L0K A;  1E17 A;  2WBM A;  5HS9 A;  5HVQ C;  4HZF A;  5IYC J;  4BYY A;  2FSW A;  2PMZ N;  3RDI A;  3VFZ A;  2K9Q A;  5K7Z A;  3LSP A;  2NNY A;  4YFN F;  3GW2 A;  2BE5 F;  1LFP A;  4BY7 J;  2Z33 A;  3EUH C;  4OAZ A;  5M3F J;  1JKO C;  1YRN A;  2JN6 A;  2RQQ A;  2K02 A;  2IRF G;  4EJU A;  2AQE A;  3BZC A;  1IZ1 A;  3BY6 A;  1OYW A;  3DV8 A;  3FK6 A;  2E60 A;  3OS0 A;  4XLN F;  4D5F A;  1Y39 A;  2PG4 A;  3EQL F;  3CC4 I;  2X85 A;  1R5I D;  3H3V K;  1A31 A;  3DTE A;  1BBY A;  1R00 A;  1G59 A;  2K7L A;  2ZKZ A;  3OR2 C;  2VT3 A;  4FET A;  4ENJ A;  2Z9O A;  3M3Y J;  3LMM A;  3CCQ I;  2BZT A;  3V42 A;  1Z21 A;  2DN0 A;  1M1E B;  3QP5 A;  1PDN C;  3WGG A;  1H8A C;  4M3E A;  2D5V A;  1KQ0 A;  4FTH A;  4RAF A;  2HOE A;  1ERD A;  3K2Z A;  5L3G A;  3TMO A;  3W6K B;  4BE0 A;  2EJR A;  2Z3Y A;  3CO7 C;  9ANT A;  3MZY A;  2OCE A;  4A3G J;  2BHY A;  3GZN B;  5F08 A;  4G7H F;  3BPX A;  2Q1Z B;  5ERI A;  1ACI A;  4KIT B;  4NQW B;  4D7N A;  2R7Q A;  1ZEL A;  3CQZ J;  1W5S A;  5DTD A;  3TDU C;  4OOI A;  2BY1 A;  3HYI A;  5EJC A;  2HOS A;  3HRU A;  2IGO A;  5E79 C;  3H92 A;  1WPK A;  3RIR A;  4BJ5 C;  1IGN A;  2JA5 J;  5JHU A;  4PDK A;  5CYV A;  2KQR A;  3E6B A;  4D5C A;  2Q2E A;  3DP7 A;  3ZXS A;  1ON2 A;  3BCB A;  3IKV A;  4L9V A;  4G7O F;  2XSJ C;  1GVD A;  2JWT A;  4EJW A;  2GXB A;  1D1C A;  3RKQ A;  4R1H A;  1ZQ3 P;  4IPA A;  5BPI A;  2LH9 A;  3VSK A;  1TBX A;  1O3T A;  4UUS B;  1W4M A;  4KYW A;  1LFB A;  3B02 A;  1IN7 A;  1MNE A;  3DXJ F;  1LE8 B;  2IT0 A;  3GTL J;  2NS0 A;  2PJR A;  3LQQ A;  1PYV A;  2DFI A;  2PEX A;  4RLF A;  3FXO A;  3GTM J;  4B4C A;  1R4N B;  1STZ A;  4MIM A;  1MW7 A;  3HZJ A;  1PUF A;  3SQN A;  4UVC A;  4ENK A;  1RPW A;  5AIQ A;  2E1N A;  4FX4 A;  3LSH A;  3CJQ B;  3I53 A;  3IAM 2;  1RIO H;  3RPQ A;  1R1V A;  1KYZ A;  2IA2 A;  1WJF A;  2BVM A;  4HLX A;  1J5Y A;  2FF4 A;  4XL9 A;  1TWF J;  3IWF A;  2KDO A;  3JRG A;  1J7K A;  5J1U A;  3PFY A;  2NVU B;  3HGY A;  1P4X A;  3R60 A;  4HV5 A;  2R5Z A;  1J9I A;  4NBQ A;  3GTK J;  2HDD A;  2VC0 A;  3HOV J;  3K10 A;  1YJW I;  2M7B A;  5FKL A;  2MA3 A;  4E7Z A;  3I9V 2;  1O4X A;  2FML A;  2XB5 A;  1K78 B;  3IV5 A;  4O5V A;  4EM0 B;  1R36 A;  2W84 A;  2KJC A;  2ZJQ F;  3K6G A;  4DW6 A;  1RES A;  3VEP A;  4EJV A;  3PM1 A;  1T2K A;  2DMQ A;  3WGH A;  2DFE A;  3CC2 I;  2Z99 A;  4E6K G;  3ISP A;  1JUP A;  2HOA A;  1OJL A;  5CVI A;  3KP2 A;  3WU1 B;  1YI2 I;  5IT9 Z;  1GVJ A;  2EFP A;  5HS8 A;  3V7C A;  1W7P B;  1BL0 A;  3CCY A;  2LKS A;  1IC8 A;  3E97 A;  1UG0 A;  2CV1 A;  1XGS A;  2XRO A;  3JRC A;  4AYB A;  5FLM J;  1JKQ C;  1P2F A;  2BY2 A;  3F6O A;  1TL8 A;  5AON A;  1E3H A;  3TDZ C;  5EEH A;  3BTI A;  1O3Q A;  5D5V B;  1OCR H;  2RN7 A;  2K3F A;  4W1U A;  3CMY A;  1JT6 A;  4ETS A;  2MW8 A;  3QYF A;  2DA1 A;  2IA0 A;  3HOS A;  1R23 A;  3V7S A;  3P5J A;  2F5C A;  3IRR A;  4P9F A;  4KIF A;  3AFH A;  4ZTJ A;  3W2W A;  4RB2 C;  1IXS B;  3IUO A;  2IEK A;  2Y69 H;  5HOO A;  1PP8 F;  2OJE D;  2M4K A;  3BR5 A;  5LHH A;  1WJB A;  5K7F A;  5LGU A;  5L3F A;  2JA6 J;  2V6E A;  5FD6 A;  1RZ4 A;  1LQ1 A;  2EB7 A;  2O6G E;  2CW8 A;  2LKX A;  2M34 A;  1XDS A;  5ILV A;  1TTY A;  5FLV A;  4IHY A;  1FOX A;  5FGM A;  2XUB A;  3I59 A;  1YLF A;  3REO A;  3L09 A;  2PBI A;  2HQR A;  3I4P A;  2DT5 A;  2EK5 A;  1LKX A;  4KIS A;  2VBY A;  3L2U A;  1JJ8 C;  2AHQ A;  2DCE A;  3WG7 H;  1D5V A;  2JSP A;  3OR1 C;  4O6J A;  5E20 A;  1B4A A;  2FQ3 A;  4M9S A;  2CG4 A;  2CQK A;  2L9S A;  2Y31 A;  4EMS A;  3OV8 A;  2WAD A;  4YFX F;  2WY8 Q;  2GZW A;  1QBJ A;  1XTA A;  3B73 A;  5LD2 C;  1PP7 U;  3SDB A;  3RYR A;  1XCV A;  2ZJR F;  4HDV A;  3EYI A;  4UHT A;  4CCJ A;  2IS1 A;  3JSP A;  1GHC A;  2HYG D;  3ZQ7 A;  4ESF A;  4BQO A;  2OZ6 A;  2X6W A;  3OYL A;  2LKP A;  2QA4 I;  5A2Q Z;  2BHZ A;  2E2J J;  2DDB A; 
#chains in the Genus database with same CATH homology
 3X2Q H;  2ZXW H;  3ABK H;  2DYS H;  3AG1 H;  3ASN H;  3WG7 H;  2EIK H;  3AG2 H;  2Y69 H;  1OCZ H;  3AG4 H;  2EIL H;  5B1B H;  3ABM H;  5B3S H;  2EIM H;  1V55 H;  3ABL H;  2EIN H;  5IY5 H;  2DYR H;  1OCR H;  1OCC H;  2OCC H;  5B1A H;  1OCO H;  3ASO H;  1V54 H;  2EIJ H;  3AG3 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...