2DYRH

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
b'KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Structures and physiological roles of 13 integral lipids of bovine heart cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 26
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2006-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 2dyrH00
3WG7H 3AG4H 3X2QH 3ABMH 1OCOH 3ABLH 2DYSH 1V55H 3ASOH 1OCZH 3AG3H 3ASNH 1V54H 1OCCH 2EIJH 5B3SH 2OCCH 2EIKH 5IY5H 3AG2H 1OCRH 2Y69H 2ZXWH 5B1AH 2EILH 2DYRH 3ABKH 2EIMH 3AG1H 5B1BH 2EINH
chains in the Genus database with same CATH superfamily
1AU7A 4I7HA 1SEUA 1LVKA 3HRSA 2RREA 1QVTA 3A03A 3GW2A 4IHVA 3I4NJ 2PX9A 2DMPA 4YIRX 2KRCA 3HL2A 1PDNC 3CC7I 3OS2A 2PEXA 1PUFB 3ZMZA 5GTHC 2XGCA 3S1MJ 1JKPC 5IP7J 2LFBA 1K79A 4D5CA 2DTZA 1I39A 3OYIA 3ROUA 2Z33A 3O2PE 1MSFC 4HX4A 4ZTJA 2J5OA 3WTXC 4BE2A 2VL8A 2FRHA 4ZZDA 4CDGA 3B02A 1MH4A 3CDHA 2ZSHB 3DLLF 5E79C 3V7CA 2I10A 1EKEA 4E7IA 2D2WA 3I59B 5TRDA 3AL0B 1HKSA 1MNEA 1Z0XA 4BL0B 5FLMJ 3MZYA 2RNGA 2HZDA 4RAGA 3M1CA 4JP0A 2VIXA 1Y1WJ 3VYSB 3ERED 3PO3J 2QLZA 5M3MJ 1YJ9I 1FP2A 4L0ZB 2FOKA 2A05A 1XX5A 2Z9OA 3SXYA 3DTKA 1B72A 1TP4A 1O3QA 3QYEA 1MW7A 1RUNA 2QBYB 2L7KA 4NC8A 2C6YA 4E6KG 1LEAA 2ZC2A 5C4JJ 1VQOI 3F22A 5F0CA 2GIVA 5IYBJ 5BPIA 3P9IA 1Y0UA 5D4RA 1MMNA 2HGCA 4ENMA 2VUMJ 2NAZA 4NDLA 1Z7LA 2FNPA 4G6TB 3H5NA 2GA2A 3GTOJ 3BR5A 1R1TA 5BMZA 1R4NB 4XKWA 1R5GA 1SD4A 2Q2EB 4N4OB 3IWFA 2EFWA 4BE1A 1Z77A 1S72I 1VQLI 3IL2A 2QSFX 3TOBA 2F5EA 5DUKA 2V9KA 3AG1H 3D5LA 3NAUA 2A69F 3DLAA 1IDYA 4A3MJ 2WAQA 2P5KA 1QPIA 1Y0NA 3KP3A 3ELKA 1Y6IA 4S04A 4KA4A 1ZHFA 1DP7P 2E1OA 1BJAA 2DJIA 2E7WA 3LAPA 3PNTA 1RRJA 2H8RA 4FCYA 3G2BA 1HF0A 4P9FA 2WA0A 5EG0A 2R7XA 2HFHA 3WG9A 2VN2A 1LB2A 3TOAA 2YU9J 4DJAA 4CYCA 3FHZA 4OAZA 3TDUC 3FXMA 1HW2A 3OV8A 1HBXG 3K4NA 1NG6A 2K9SA 2IA0A 4RM3A 3NWSA 3JTGA 2QM3A 3D5SC 2K7LA 3W6VA 2F5FA 3BROA 3ULQB 1J09A 1ETWA 2KIFA 1B9MA 4A0XA 2EIKH 3GZNB 4GFBA 5LRRA 3ZR8X 1D0YA 2KIQA 1VTNC 3KZIC 5CVJA 2P7CB 4GXOA 2R7RA 2PMZN 2PMHA 2IGOA 2NVUB 4IEJA 4UUVA 3RPUD 2CQXA 3QP6A 2NVXJ 5D6EA 2LK2A 1SFOJ 5CVUA 2BW3B 2DT7B 4Y4RA 2ZNYA 1D3YA 3GZ5A 5ILVA 1JTYA 1Y56A 1FIPA 2AXLA 2OUMA 4FTHA 2GM4A 2A5WA 2ELJA 1QRYA 4LMYA 2HWVA 2IGNA 4CCMA 2P6SA 5E8GA 4H0EA 2H1LA 3E1SA 3LNQA 1YW9A 1ZYRF 2M8EA 3RPQA 2DFFA 4PJ0C 2X9DA 3F0CA 1K61A 2MC4A 2L02A 5EEHA 4M3GA 3MKYB 3CCSI 1LPQA 1XGOA 3LQQA 2HR3A 2IW5A 2DYRH 4I09A 4UUSB 5HS7A 1P7JA 2ZCWA 1H9GA 2P0WA 3MVPA 4ABZA 1SFXA 2ICWG 2G7UA 4A12A 3NRVA 2ESNA 3VPRA 2YR2A 3EDPA 3DBRB 3BR2A 3WTUC 1TQPA 3CUQA 5LD2C 1DGRM 2JWTA 3B6CA 1TNSA 5K5QA 4CGZA 3RZOJ 3I58A 3L7WA 1GVDA 1U9NA 1U78A 1K4TA 2R7TA 5DD8A 1KU7A 3SEQA 2ZJQF 1UB9A 2M45A 2V1UA 1TWHJ 4F7ZA 2ZXHA 5DV5A 1LVAA 5KVRA 2V79A 2CJJA 4PJNA 1H9TA 2CG4A 3W6KB 2LY2A 1N75A 3GTQJ 3EYIA 1EA3A 5IP6A 1FYKA 5ILSA 4ZH4F 2JVGA 2KMUA 1JHFA 1F1ZA 1Y8RB 1XSXA 2W85A 3IHUA 1XCBA 4HSTA 5EF6A 4DW6A 5KAFC 1OCTC 4KJZA 1R5HA 5GPCA 2GOMA 1JT6A 3DWLE 2ZMEA 4ON0A 1Z1DA 1YIJI 4CZZA 3ABTA 5F04A 5IY5H 4AIJA 1TW2A 3OR1C 1ZH5A 1DPUA 4A3EJ 5DCMA 1BA5A 1K6OA 4BHPA 4XLPF 4ZYHA 2WB1A 1UFMA 1UZCA 1G4DA 3BP8A 3GX4X 5E3MA 3DCFA 2IPQX 2RQQA 3OYLA 5CVVA 1HKQA 2XC7A 1RESA 4LG0B 2UWMA 4JOMA 4BJ6C 2FNAA 3C3WA 4BYYA 2JZYA 1LFPA 5D5UB 3PQKA 2VOPA 4KIFA 4B47A 1Y1VJ 1XGSA 2XAJA 4MTEA 4LB5A 5J6XA 2KFDA 5HDGA 2CQKA 3BC8A 2EB7A 3HOYJ 3WTYC 4NC7A 1W36D 3BR3A 1STZA 1SAXA 3ZQHA 2E2HJ 3OYDA 1PUEE 3ZQCA 5HS9A 1GXPA 1RI7A 3TKYA 1XD7A 3JRDA 1OCOH 1MDMB 3BTLA 4BXUA 1AKHA 1XMAA 1KU3A 3DKWA 3IAM2 4ETSA 5BQTA 1T2KA 2MGQA 3FIWA 3VYUB 2PG4A 5DD4A 3MKZA 4BH9A 2A61A 4KYWA 2DA7A 4WF2A 5CPRB 3D1NI 3BJ6A 1I1GA 2EA2A 3PSFA 4RMNA 3CJRB 2PJRB 1W5CC 5D6FA 2DDBA 4HRIA 2YU3A 2DO7A 4GCVA 4O3MA 5F0FA 1SC7A 1YRNB 5D5VB 1YTYA 3ZGKA 1HW5A 4D9JA 2D5VA 1BR1A 2X1EA 1I6HJ 2E60A 5LLQA 2STTA 4YFXF 5H6QA 2AO9A 3AG3H 4PGHA 1SVOA 1KA8A 4A3CJ 3NEUA 1S8NA 3IH4A 1CQTA 1ZGAA 2F5DA 3BG9A 4MNUA 3JAMK 3WTVC 3V8KA 2FSWA 5CQGA 2DA1A 3RYRA 1OLTA 3CDLA 1HDPA 2DMQA 5D4SA 1WQ2A 1WI3A 3WE3A 5K5OA 4ZYEA 2IS6A 4JYKA 1WJDA 2VJJA 3OL3A 4RGSA 3AG4H 3HDDA 3NARA 4QWQA 3S2DJ 2QSHX 2A3SA 2VXDA 1EH7A 1FP1D 1SVMA 2CQNA 2E1MB 1BW6A 2KP6A 2G9WA 3L2UA 1W5TA 2R5YA 3JREA 4OMZA 5FROA 4O5VA 4U0VA 3HGYA 2XGEA 3FMQA 3OYCA 1J59A 4WCGA 5E1ZB 4KFCA 5L3BA 3DFGA 1ETKA 1I27A 1KYZA 4NNJA 1R71A 3RKYA 4G12A 2WBMA 2IP2A 2AQFA 4D7MA 2EFOA 3H9QA 3K6GA 1SD7A 1B8IB 3DXJF 5F0HA 4XMYA 2BEOA 3O6BB 1LJ9A 2CSOA 2MD0A 1S7AA 2LKPA 1WSUA 1OCZH 1TWCJ 2GBYA 3DKYA 2MD5A 4OINF 2X1DA 1ZRFA 2HTJA 3D0SA 2E71A 2CGPA 1X1BA 4JK1X 4W97A 3GMEA 1N78A 2HI3A 3TBIA 1D5YA 3C18A 1P4AA 2HQNA 2W00A 5KNLA 2CWEA 2MABA 1LUJB 2X6YA 1YW8A 1ZQ3P 4BQOA 4RB1A 4I0AA 2P4WA 3U21A 3WG7H 1HDDC 2E7XA 4BAYA 1ZGWA 5J1RA 5K7ZA 1ORKA 3ABLH 4U7BA 2LNBA 3HM5A 5HNFA 4EJTA 2DLLA 4KT6A 3CQZJ 1MBHA 3GTGJ 2E2IJ 3Q3SA 2ZXIA 2KHMA 1QHGA 3PSIA 4MFDA 1BIAA 3LSJA 4WWCA 3KP6A 3UR3C 1ZLKA 2Y69H 5LHIA 2MH9A 4DZPA 3FDYA 1LEBA 4ZDPA 3J7AO 2VBWA 3EUHC 2LKXA 2ZO4A 3OOUA 3IKTA 4I6ZA 3CCLI 1QHHD 4CXFA 5FRMA 4KN7X 5GP9A 4ITVA 1Z05A 3JRIA 2XSJC 3HOSA 2JA8J 2STWA 4E7JA 3CC4I 2HOTA 3OMYA 1P4WA 4L5JA 2VOOA 1DU6A 2B0LA 2D1HA 4RB2C 4E4HA 1T0FA 3SZTA 2ETHA 5F1RA 4BDZA 3KE2A 4ASNA 2DAOA 3BR1A 2KRHA 3E6BA 3GYHX 4BQAA 4R8HA 5DUIA 2R7SA 2Q2EA 3KETA 1OISA 3E5QA 5DM6F 4XR6A 4E70A 2VONA 4LLNA 3HOVJ 1KGSA 2L4AA 4KICA 1UCRA 1XDSA 3T1BA 2VKVA 1XGMA 3DF8A 3WODF 4LLGF 2ISZA 5ERIA 3W6JB 3FXKA 4B3AA 2VLAA 2DMNA 2HQ5A 2GZWA 3BOQA 1YOVB 1D8JA 2LLKA 3B73A 1TQMA 4AM3A 4RAYA 2BXZA 4AWXB 3A2KA 3E3VA 2QEXI 2ECCA 1BOAA 1MSEC 4BJTA 2LRDA 2NS0A 3HG9A 1FJLA 2KT0A 3OYNA 4PJLA 4F93B 3ZQGA 3KEOA 3NWTA 4A6EA 1O3TA 3Q0VA 1Z3XA 1IGNA 2ZJ2A 4OIQF 1V5GA 1TW3A 3V7SA 4P5OA 3PO2J 2L3DA 1GT0C 2GWRA 4A3KJ 1BC8C 1FNNA 1Z7UA 2D1VA 3QQAA 1EH8A 1F43A 2LF8A 4HAMA 2VI6A 4RS8A 3AAFA 2FD5A 5DEQA 2W48A 3G1OA 3K4LA 3FXJA 1ITYA 3K2ZA 9ANTA 2PMZA 4YELA 2X6WA 4M6YA 1FT9A 5LFAA 2ZJRF 3BR6A 2V9VA 4H4KC 1EJ9A 2BZTA 4UB6C 3K1PA 1EH6A 4LOCA 2JJ7A 2V1XA 2ZMEC 3J7AY 2EA4A 1I50J 4IRHA 2DK8A 3BZCA 3BCBA 5IPAA 1RZ4A 5GPAA 5JHFA 2HS5A 1D5VA 3QWLA 3AFHA 3L2QA 1K6YA 3CLOA 4UVAA 4ENNA 3FF5A 1WKMA 2QWWA 2WAFA 2IRFG 3HEFA 1FZPB 1BJZA 1FBUA 1ZN2A 3CD6I 4LFUA 4GYGA 4EATA 2Y2ZA 3KYLA 2VQHA 3V8JA 5JLWA 4I01A 4Q4ZF 3HOUJ 4OMYA 2HXIA 1VQKI 4IF4A 5BS6A 1WRJA 4ZZLA 2MSYA 2HVQA 4ESBA 4HA8A 2ACJA 3PNYA 1YE9A 1WJFA 4DBRA 3FWEA 1FBSA 1RIOH 3I64A 5EEAA 4Q5SF 3RQ4A 1LE8B 4IHXA 1RPWA 2QQAA 1FOWA 1YJWI 1Z67A 4KMUX 3MD2A 2M87A 3R60A 2RN7A 4OOIA 3HIFA 4AU7A 2FBIA 2P8TA 3FMRA 4CCOA 2ZXWH 3WGGA 4EJVA 3FXRA 4EGZA 1LDDA 4JBAA 4ZYAA 3F6OA 4RB3C 3LWFA 5AIQA 3BG5A 1MBGA 2DT6A 3BTCA 4XNFA 2AS5F 1IRZA 5GADJ 4OAYA 3RPUA 1K78B 4LITA 5CVRA 4EJUA 4I99C 1KQ8A 4S0HB 3L09A 4E7HA 3OSFA 4M73A 2PQ8A 5FB2A 3H3VK 1RC9A 3O8GA 2R7QA 5CVIA 4AYBN 4M74A 3CJQB 3MEXA 5HLHA 3BJOA 2HYFA 1WFXA 2MA3A 4UV9A 3LSIA 1M1EB 4UHTA 3JCUC 3CO6C 2LMDA 4RM2A 2FJ1A 2UXNA 5BPDA 4HPQA 3L00A 4YIFA 2VE8A 3ERMA 2P5LC 5F1JA 3K4JA 1X1AA 2CW0F 4KT5C 2Y9ZA 3Q0UA 1X58A 1DQUA 3CCJI 4UNOA 1VQ7I 2F4OB 1L0OC 2KPMA 4C3IJ 2WY8Q 2BBYA 4XKBA 4U0YA 1NH3A 2EK5A 3RI4A 3H1CA 2M8GX 1K7AA 1MJBA 1U5TC 1MDMA 2L7MP 3I3LA 2XB5A 5J4VA 1U8BA 2BY3A 4KITB 1UELB 2XV4S 2KJCA 2IGKA 3BCAA 4XLNF 2JRTA 3K4MA 5M5XJ 1HLVA 4F3QA 4XRSG 4AUXA 1U5TB 5F6FA 2EBIA 2PJRA 4HQMA 2HPIA 1D1CA 3BR0A 5BNGA 1BR4A 5L3EA 5L3DA 1PP8F 2W1OA 1P7IA 4CO8A 2DI3A 2DTRA 3MKLA 4QPQA 1VQMI 2H09A 3LSGA 2CS3A 1ZLJA 2ISYA 2F6CA 3JRGA 4F91B 3TO9A 4DZJA 4F52A 2Z16A 5DS9A 3J7ZI 4BXXJ 1IN8A 4Y33A 4J01A 2LVSA 1T56A 5HLGA 3DKXA 4HX7A 2VBZA 3LFUA 3GEZA 5JLXA 2CUFA 4G7ZF 3CDIA 2XPUA 3IRRA 1IUFA 2ZKZA 3I55I 4YIIA 1BI1A 1V4RA 2DOFA 3IWZA 3FXLA 2O6GE 1VQPI 4I02A 3CCEI 1KU2A 3E6DA 4MFEA 1R49A 1ETXA 1MMSA 2BVMA 2L7ZA 2YX7A 3BTIA 3V42A 2OBPA 3TW7A 4BUPA 3QYBA 4U87A 3T5XA 4WX9A 4CUGA 4NQWA 1TL8A 1T6SA 3E6CC 4UVBA 2M4GA 5IT9Z 3KPHA 3R4KA 4XLCA 1YW7A 5HOOA 1IC8A 1B9NA 3MN2A 2XRNA 3EPZA 2OZ6A 1XDUA 1X3WB 4HDVA 1J0RA 2MH2A 2LDUA 1B8IA 3L9FA 3KP7A 2VJ5A 3BPVA 1FOXA 2WY7Q 2KLOA 5HDNA 1Y39A 3W2VA 3HYIA 5GTIC 3ISPA 4M6XA 1HQCA 1XC5A 1FY7A 2M34A 4HNVA 1TZLA 2M7BA 2F48A 3VSLA 3RKQA 2NYXA 2R7UA 1G3YA 4L9VA 2OF7A 4N9HA 5KHDA 2RGVA 4HDUA 3MFKA 3FZVA 1OR7A 1G59A 2G0EA 3H3ZA 2HDDA 3ZQQA 2F4IA 2ZXJA 3BQYA 4C9YA 1O3SA 4BKXA 5IOYA 1MMDA 2QCOA 3E7LA 2K9MA 1VQ6I 4XQFA 2EQRA 3BWGA 3KIOA 4J00A 2LKSA 5ICGA 4BDYA 3KLOA 4G9YA 2HNHA 1OYIA 4S05A 5E3NA 3R6SA 4YG2F 2OTJI 1J9IA 2CH0A 2O0YA 4PDKA 2GQQA 2Y0MA 5F64A 1ZAOA 3HHHA 4QPOA 5ICEA 1MMAA 2KISA 4K2EA 1IAWA 1P2FA 4A6DA 2Z5UA 4QSHA 3VYTB 2RAEA 3HOZJ 3MMYB 4ANJA 4DGWB 1S3JA 4AD9A 1LFUP 5CQEA 2E2JJ 2DFHA 3K69A 1IXRC 3FKJA 1O3RA 3M4OJ 5J8FA 1SVLA 3LAJA 4ESJA 1JUSA 1W1WE 2K3FA 4ZC3A 2DCEA 3H5AA 3VOEA 2D45A 4G6DA 1Z9CA 4HF2A 1QU3A 2IBDA 1RETA 1WI9A 3F72A 1UJ8A 1R1VA 1XMKA 1IG7A 2VJIA 2KJBA 4BY1J 1UG0A 1E2XA 2HDWA 2VKHA 4N9IA 3CF2A 4PFPA 3DEWA 4R1HA 3BG3A 3KP5A 1MH3A 3L2RA 2W7NA 1X2NA 2L4MA 3LSRA 3QPHA 3N4MA 4M9XA 5F08A 4N0BA 1YS6A 1SFUA 2XGXA 1KU9A 4YFNF 3HHGA 2Y75A 1OKRA 2M0CA 1I5ZA 4XSXF 5K7FA 1FEXA 2O03A 3IH3A 2BXYA 2KL4A 3E0JB 5B1AH 3WTSC 4BACA 3HRTA 1IN7A 1FYLA 3QU6A 2X85A 2YPRA 5HDKA 1ZELA 2DK5A 1VI0A 2HDCA 4BBRJ 2K02A 1MKMA 4BJ5C 2VODA 1FC3A 2DW4A 2HVRA 4Y17A 1H88C 1T95A 2M30A 1Z6TA 1SAUA 3K7AJ 2GXAA 2LTPA 3MWMA 2XDVA 1R00A 2PJPA 1I1SA 4L9JA 2FBKA 2M4KA 2FU4A 3FBIB 2LR8A 2V6CA 2VC0A 2QQ9A 1C0WA 2V26A 3E5UA 3QPTA 5GAHJ 3PIPF 1GDTA 1WZ2A 2JA7J 4A3LJ 1MBEA 3HRMA 4OWRB 2DPUA 4L0YB 1PVEA 2P7VB 3RTRA 1A36A 3HKZN 2M2EA 1E17A 3GFJA 4CSWA 2NNNA 3F6VA 3WU2C 3CMAI 1XGNA 2AXTC 4II2A 3CO7C 2IT0A 2HVSA 3GFLA 1RUOA 2O3FA 5H20A 3F3XA 1IZ1A 3GTKJ 3D5RC 4DBQA 3UNGC 3V8LA 3IUOA 2XAGA 3PFIA 4BEHB 4J19A 2HTSA 1HW1A 3KP4A 5D5XB 4WXHA 2RC4A 4ENKA 2X4HA 4DYCA 3X2QH 2R7VA 1VZ0A 1PYVA 1R1UA 1R7JA 3SQNA 3MCZA 5EDNA 4XLHA 3TMOA 3HSRA 3ZCOA 3KX2A 1V3FA 3I54A 3SJMA 4Y15A 2JTVA 3HC7A 2CW7A 3S1NJ 2COBA 5AONA 2BYVE 2MBFA 4B44A 3HZJA 4MEXF 4IXAA 1R6RA 3CESA 2XROA 3M7GA 1JKOC 2XRLA 4D0PA 1WJCA 1JXSA 4KISA 2EIMH 2KDOA 1H89C 3K2AA 5FLXZ 4DIQA 3JRHA 1ZG5A 1JJ6C 2VXZA 1XN7A 2R7FA 4RLQA 1IUYA 4A93J 4E7LA 4U0WA 5J1UA 4DYQA 3DPTA 1K78A 1SANA 2Y31A 4HW0A 2B63J 5EYRA 4GO1A 4I0BA 5J40A 3OYHA 4Y7NJ 1XCVA 1X1PA 3DTEA 4D1QA 5FGMA 4AYBA 5EEGA 1IRXA 5FKNA 1D8KA 3V4GA 4KIBA 3I5UA 1YIOA 4OIRF 3CF5F 1ONVA 4HZFA 1ZARA 3GTMJ 3SZPA 1X2MA 1B59A 2ZBKA 2EINH 4L18B 2LF7A 3LQRA 3U9GA 3HOXJ 5CKTA 2KQRA 3WGHA 2EWNA 1A6IA 4XRSA 1HSJA 3CC2I 2WV1A 4MO7A 4HOBA 5LHHA 5ICFA 4ZYGA 2DU9A 1G3TA 2EH3A 3BLYA 1IO2A 3F8CA 4B8XA 5JVGF 2R93J 2COMA 2L2OA 3OYEA 2UUZA 3PQJA 4NHJA 1Y8QB 2VC1A 2V7FA 4NB5A 2HYJA 3T0YA 4IHYA 1B72B 2WC2A 2EJRA 3FXUA 1S5LC 5J1YA 3PL8A 3J80Z 2IGMA 2JUGA 2O61A 2GA1A 2PI0A 4LIVA 3H9GA 1MJ9A 1F36A 1UMQA 3UKGA 4PJJA 3RIRA 2EV0A 5E3LA 4PJMA 1H0MA 2ZNZA 1QO0D 1WVRA 5FD5A 2AHQA 1U2WA 1TQIA 2ECBA 3K1MA 1GUUA 2OCCH 4I98B 1PUFA 2P5VA 2FMLA 4Y3OA 1YO5C 3IC7A 2OC6A 1WH5A 2LYCA 1P4XA 3K4CA 3E5XA 4XKCA 1QBJA 4D5FA 3DEUA 5ED4A 5GAGJ 3GVAA 2YSRA 3I59A 1MBFA 3FK6A 3CCRI 5M3FJ 5EGOB 1REPC 1OCCH 4PZJA 4BU2A 2HZTA 3OR2C 2FX0A 1YJNI 3DTIA 3ZPLA 1OFCX 1FTZA 2LC2A 3WU1B 4HV6A 1JGGA 3DPLC 4PCQA 2R5ZB 5A2QZ 3DU6A 2L7FP 3TO6A 2K3PA 2QBYA 4L9NA 4CYCB 3LSMA 2R7OA 3SYTA 3K9TA 3CCMI 2CFOA 3U1DA 2HKXA 4EMSA 3OYBA 5FRNA 3HSEA 5L3CA 1R58A 5HLIA 3VFZA 2LP0A 3M9AA 3HTSB 3CJNA 3F8BA 2FMYA 3ZQIA 3HUGB 2RKHA 2JSPA 3G71I 1YI2I 2CW8A 1HSTA 2B7EA 3GF2A 4G6QA 2XIGA 2DA5A 1RKWA 2Y9YA 4HBLA 1JKRC 4FETA 2BVLA 2HPMA 3RYPA 4EJOA 2CQQA 4RGRA 3COAC 2RVCA 2HXOA 4BS9A 2F4MB 4Y52J 2BV6A 1YHQI 4CH7A 1V55H 3ONQA 1TC3C 4KNYA 4QIWN 1I6XA 2F5VA 4X0GA 1BI0A 5IYCJ 2HOSA 5IT9K 3C2BA 2XKOA 1ZR4A 1HCRA 1J5YA 3PUFA 1SD6A 4G8XA 2V1DA 1X3ZB 5B3SH 1UHWA 1TTYA 4FQGA 4Q48A 1IN6A 4RAFA 4B48A 4IO9F 1X4PA 1AWCA 1ERDA 2W4SA 2A6TA 3CUQC 4ZJZA 1V5EA 4IPAA 3U2RA 1T38A 4Q47A 1SMTA 2IA2A 6PAXA 4FE4A 3ECHA 1BR2A 2ZSIB 5IYDJ 3OWTA 2NNYA 2XGDA 4BQNA 1OQYA 4WK8F 2BOLA 2OA4A 2OQGA 5LEKA 4OU0A 4UVCA 5EZGA 1DGWY 1WJAA 2E19A 5DDGA 5KK1A 4XN0A 3LSKA 2WAEA 1JGSA 5IOZA 1E0EA 2W84A 4A5NA 4DOZA 1AOYA 2R92J 4CICA 2FOWA 3ZQ7A 1X1CA 5E8IA 3S3NA 2BW3A 5ILUA 2WV0A 1ACIA 2JN6A 3VODA 4EGYA 4BY7J 1JKQC 4HEA2 4RBOA 1OMIA 2VE9A 3ZMSA 3JR9A 4I76A 2ZMEB 4KUMA 4FASD 3CCUI 5FD6A 5FKMA 4HSRA 3ZMVA 3KFWX 2R7ZJ 4BXFA 3A1YA 2BY2A 2XF7A 3VB2A 1FTTA 3DBLB 4A3DJ 2I5UA 1YX5A 4HNTA 5J8CA 1ZG1A 4UUSA 4ENJA 3BY6A 5HNHA 2XF5A 1G2HA 2CUJA 2CUEA 4QTRA 2VBYA 3RQIA 3U1KA 2VT2A 3HOWJ 3ML6A 2OD5A 5DCFA 1A5JA 2EZIA 2DMTA 4UY8I 3M07A 2ELKA 2A68F 4CHUA 1EV7A 3H9JA 3BG7A 4IVNA 2V1NA 4RDUA 3KYDB 2DMUA 1UAAA 3K0LA 3CMYA 1QPMA 3EUAA 2JA2A 2E5NA 2CQ7A 4XICA 4E7KA 3QODA 2F2EA 4FT8A 5M5WJ 1R5ID 2TCTA 1ZRDA 2DBBA 4XSZF 3IV5A 5TJJA 1ETVA 1O7FA 4XORA 4II3A 4XRFA 3A01B 5JFRA 2QGUA 3HSFA 3DPUA 4N4NB 1AKHB 3TDZC 4BHBA 3GFMA 3RJPA 4BBSJ 2BY1A 1BM9A 5FKKA 1LDKB 3W2AA 1XTAA 4EJWA 2K5CA 5L3FA 3PFYA 3BT9A 4RGXA 3CCQI 3H92A 3QOPA 3WU0A 2ZFUA 4B1RA 3TL4X 2OTLI 3E6MA 4MHGA 2V4JC 3HTUA 2YX4A 3CMEI 1IJWC 1N25A 4CCNA 1FX7A 4LD5A 5B1BH 4W1UA 4FISA 3CCVI 3K70C 4PFOA 5CJ9A 3TGNA 3HKZA 4LG0A 3FM3A 4C2TA 3ESWB 4EM0B 5EJCA 1W0TA 1H8AC 2Z1DA 2ZFWA 1YS7A 1Z21A 3KZZA 4PSWA 1S7OA 1CGPA 1U8RA 1MD0A 2JT1A 4BEHA 4GGGA 3AKZA 4NBQA 4B4CA 1XB4A 2UZKA 2L0KA 4P96A 2CO5A 3L1PA 1T98A 4JX5A 2QZ8A 1YFHA 1YYVA 2HEOA 1SD5A 3H5RA 3KLNA 1QNTA 3EYYA 2DYSH 2R0QC 2IAIA 2R5YB 2HOAA 4ESFA 1U0JA 3VSKA 4AIKA 2WWYA 2KRFA 3DQVC 1IN5A 1IV8A 3MZ8A 4Z6YA 4PSXA 4IJAA 2DT5A 5B66C 1V5FA 5CLSA 1KZHA 1A04A 3JRCA 2LBFB 2HU9A 4JQFA 5HLTA 3ZN1A 1YRNA 2H27A 1XS9A 1FMWA 1DUXC 4R79A 2VQCA 2NOGA 3TP0A 1OYWA 3LFKA 2Z2SB 1YLFA 4IHTA 1B1BA 5H2FC 3L2VA 2A6EF 5JR3A 4IKFA 1E3PA 3M8EA 2RQPA 4IQ4A 4M9ZA 3SZGA 5LEJA 3H0GJ 3B6AA 4XBFA 3CUOA 1O4XA 1Z3YA 4CCKA 3M1EA 2GLOA 2IEKA 4XKVA 1GHCA 2LSOA 5FLXK 1L3LA 1LDJA 1NK2P 3AL0C 3E97A 1AA7A 4CYDA 2EZHA 4G7OF 1FSHA 2VT3A 2KZGA 4JX4A 4G7HF 5E20A 5FFZA 1WHUA 4CCLA 4EEFG 3BG6A 1YITI 1ZR2A 5HODA 1XSDA 4YFKF 3FKIJ 3HPHA 1BIBA 3OOPA 2LREA 3J7YJ 3C2HA 3W2WA 3LA7A 4IX7A 3QOEA 2H6CA 3SFIA 2MLKA 3EQLF 4OIPF 3FK7A 2M5WA 3CZ6A 1HOMA 1D1BA 1T0FC 3OL4A 4RA2A 1VF9A 1F4KA 2X6OA 1GVJA 1KQ9A 3F8MA 4IHWA 2GOXB 2KKOA 1NK3P 3JSPA 3IRQA 4RLFA 2FA5A 1IRGA 1ZGJA 2JPCA 3LSHA 4UV8A 1BC7C 2WTEA 4B3XA 1FIAA 4IOCF 1VQ8I 1CF7B 4AVZA 1FMVA 2X1CA 1IRFA 5ICCA 3DP7A 1XPXA 3OYFA 3G4SI 3EUKL 4LK0F 1BL0A 4M71A 2B9SA 3DU5A 4WXDA 4F55A 1U3EM 3A0HC 1QVUA 3J80K 3ABKH 2VKDA 3I0TA 1W0UA 3A02A 4YEJA 4HLXA 3HJEA 1FLIA 1R23A 4XIDA 2DXIA 2XKPA 1WPKA 2EPFA 5EGOA 2Y0SN 2MFZA 1D0ZA 2VB6A 1MZBA 1W7PD 2KIMA 1WJEA 3H35A 2JA5J 2ELHA 3BQZA 3OIOA 3C2GA 2V9PA 2R5ZA 2PLYA 1T33A 2DA2A 4HX8A 2Q8KA 1DU0A 1KONA 3FHNA 2EFQA 3ZQLA 2K86A 3HPGA 5J47A 3JRAA 2XHKA 3PNVA 4A3GJ 3MAJA 2OQRA 1I3AA 2VPRA 2M3AA 2LH9A 4XLFA 2DA6A 1BI3A 1I3QJ 1ZRCA 3TO7A 1WWXA 3EUHA 3FBNB 3ECOA 5TGTA 4AVPA 1F5TA 4KIGA 5C3EJ 4B43A 3ZN0A 1MMGA 2FQ4A 3G1LA 4HNUA 4O6JA 4M3FA 1Q1VA 1XMXA 3HUGA 2GAUA 2K9QA 1OCPA 3IAS2 5JVTA 3P9CA 5A2QK 3QP5A 2NVYJ 4D7NA 2WADA 4HF1A 3VDXA 1G6NA 1UHMA 4X6AJ 3S14J 1WJBA 1Z91A 2QYOA 3ABUA 1FOKA 3ZMTA 1X3UA 2X51A 3S15J 4C2UA 5D5WB 1QZZA 4X1EA 2KZVA 1V54H 2J5PA 3Q0WA 3N05A 1JUMA 3BZKA 4NUBA 3S16J 1G3SA 2IS4A 3J81Z 3OYGA 2E36A 2EIJH 1NHAA 2JUCA 2P81A 2W24A 4FHTA 1TT0A 3HRUA 1MGTA 3JRFA 1KYWA 2OAZA 2AQEA 1W7PB 4M6VA 2OZUA 1A35A 2K4JA 1LQ1A 4FE7A 4CA0A 3W3CA 1VQ4I 4IRIA 2LY9A 3LOCA 1YG2A 4P9UA 2XUBA 2E1CA 2E1NA 4HF0A 5FKLA 2MLGA 3SHFA 2R3SA 3FISA 1WGXA 3CJTB 2FF4A 3RDIA 3FXOA 2QA4I 2N8GA 5IP9J 1F9NA 3LL7A 5HVQC 3Q5FA 4A3IJ 4V2FA 3CTAA 4IZZA 3SEZA 1QA6A 3CCYA 3SDGA 4PGGA 4M3EA 4LLLA 2O7OA 2KIUA 2DJNA 1IXSB 1S9HA 2X0LA 1IW7F 3IP4B 1YX3A 3KCCA 5LRSA 3RKXA 1JUPA 5E1XA 4IOAF 1S6LA 2OU2A 3GO5A 1TNTA 1R9TJ 2DPDA 4M3DA 4FX0A 2TRTA 2CFXA 2HKOA 2LD5A 1E3OC 1A31A 3BPXA 4U88A 4BGDA 2NVTJ 3LA3A 3ZP5A 1R22A 4ZDLA 3K10A 2Q0OA 3T8RA 2RV8A 2CV1A 2QENA 1LKXA 2BHZA 4MGRA 5LBQA 3AG2H 3PJRA 1OCRH 2L9VA 2CUZA 1XG1A 1E3HA 2LY1A 3LA2A 4EV0A 3HOTA 3MZHA 1APLC 3GLXA 2GXGA 2DQLA 3QYFA 2ESHA 1WCMJ 3H3UA 5LGNA 2FE3A 3BTJA 2O9LA 3WHBA 3QRFF 1W5SA 1LE8A 1IN4A 4RAZA 1ETYA 3KZYA 3S1RJ 1BOBA 1UG2A 2XPWA 4DNCA 1P9QC 3PM1A 5K1YA 1LNWA 3FMSA 1FPQA 2FXAA 4LGWA 3GFIA 1JHHA 3S93A 3I56I 1G8XA 1NG7A 3Q9VA 4Z2YA 4I2OA 4L5IA 5E1WA 1B4AA 2FQ3A 3A01A 2BHYA 3ZXSA 1WJ5A 4BQQA 1BBYA 1SFKA 3K1NA 4M9SA 4A0ZA 4AC0A 1HA8A 3S3OA 2L54A 2JK3A 3CP2A 1DDNA 4LK1F 1PJRA 1HXDA 3H36A 3RSNA 2CV2A 2MC3A 3O8HA 3I53A 3G6EI 1U6GA 5B5EC 2L01A 2QUFA 1S7EA 3I71A 2MW8A 2TDXA 5M5YJ 3F23A 2YS9A 4BNCA 2W25A 2JA6J 3H0DA 2K85A 2LOOA 3REOA 1ZG3A 2FBHA 2NOJB 3CLQA 2Q1ZB 4HG2A 4DYRA 1JTXA 1K83J 4XLEA 1X1DA 1AHDP 2JRMA 2VASA 1VQ9I 2OCEA 3WTWC 3M3YJ 4C3JJ 3JTHA 5TISC 2I8DA 1MNMC 2BE5F 3JRBA 1P92A 2E1MC 4L5EA 1W36C 3BJAA 2VPLA 3DEEA 1J7KA 2QKMB 4XK4A 5FFXA 2L9SA 2CYYA 2DDAA 1HKTA 4ZTFA 1QZYA 4HYEA 2QQ8A 3QU3A 2ID6A 4LJZF 3SDBA 2RNJA 4A5MA 3CP8A 4XLAA 3PIOF 3DBHB 1TWAJ 2CU7A 3GTPJ 3OYJA 2H94A 4NC6A 1MBKA 3TW6A 3JW4A 1X19A 2UV1A 3R0AA 3OS0A 4NQWB 3Q9SA 5AIPA 1U5TA 1ULYA 1WH7A 3P5JA 4C3HJ 4BHCA 3KEQA 1YQAA 4MLOA 1DP3A 2NS7A 3MQ0A 2LBFA 3LSTA 4IL6C 3OS1A 1Z6RA 1KQ0A 1OPCA 3C7JA 1MJAA 1Q1HA 5FLVA 3GTJJ 2YUSA 2QSGX 1BI2A 1DPRA 3GCMA 2QF7A 1VQ5I 2Y48A 3ASOH 3OY9A 5FJ8J 2WAQN 1GLNA 2A5YB 2BY0A 5C44J 1O7LA 4A69C 3S8PA 2M9HA 2XPVA 4XN3A 1POGA 1OR7C 2JSCA 1ZTRA 2E34A 2XASA 3IH2A 1RR8C 5EG0B 2F5CA 4V19K 1OJLA 1A6QA 3G73A 4KDPA 2JPBA 3WE2A 5K5RA 1W4MA 5D8KB 5D8LB 5K7HA 1MBJA 2EZLA 2PMUA 3ZOBA 2K9NA 3G3ZA 4IRGA 5CYVA 1JT0A 3S2HJ 1IXCA 3A4CA 5FKOA 2DOAA 3SFZA 3M8FA 3QAHA 2IS1A 1HC8A 1TWGJ 3BDDA 2JVHA 3DV8A 4QLCU 4KN4X 3RZDJ 1GV5A 2E5ZA 4MQVA 2HOEA 2NXNB 4A3JJ 1VFCA 2PN6A 2XVCA 4GRIA 2IS2A 2DA3A 2R7DA 2H8WA 1QGPA 2JQ7A 3OSGA 2ME6A 4MIMA 1FOYA 3R0JA 2IXSA 4JX6A 2O8XA 4TV7A 5HS8A 2PBIA 2LG4A 1K4SA 2VKEA 3KP2A 2EV5A 3OYAA 3WTTC 4XOTA 1T8IA 3OIQA 3KEYA 3RCOA 2FEZA 2E35A 3PUBA 1O57A 4AIDA 1CF7A 2DFIA 5L3GA 1ODDA 1BN5A 4P55A 3LSPA 5LHGA 2XAFA 3WHCA 3L2WA 1XSVA 5E3OA 2R4GA 4A3BJ 3GWZA 2XAHA 4YRVA 1FBQA 4Y13A 3FM5A 3VEPA 4E7ZA 3P7NA 2H1KA 2XB0X 2L5QA 3FXQA 3IKVA 3S32A 2ADUA 2A6HF 2CRGA 2QQBA 1USTA 2Y0SA 5LGTA 1ETQA 4PK4A 5FO5A 5J3LA 2HQRA 2BGCA 3CUQB 3G1MA 4E7SA 1ETOA 1JE8A 2V6EA 1GV2A 2GIZA 2IVMA 3KYCB 3N97A 3K4BA 1TWFJ 2VJ4A 2OJED 4HLYA 2W57A 1RR7A 2G7HA 1T39A 1IDZA 1TT5B 1R4MB 2HQAA 1EF4A 3OYMA 4ZDOA 1QQIA 3ZRGA 1R36A 3LMMA 3F8NA 1ZKGA 4MTDA 3GLLA 4GYIA 4EVIA 2QVOA 3S2WA 3GTLJ 2KDZA 2ID3A 1NTCA 2L9NA 3HXLA 2M1BA 1OYYA 1ZK8A 3K4KA 3JSOA 2XAQA 3S17J 3GXOA 5E17F 2H6BA 3M8JA 5DCMB 1UHSA 2Z3YA 2W82A 4U7DA 1B6AA 1ON1A 4M3BA 2O8KA 2A07F 1P6RA 2WB1N 1J2XA 2GXBA 3WTZA 4UB8C 1FWZA 5LGUA 1JJ8C 5DTDA 1SFEA 4HV5A 5F27A 3QPLA 1MIJA 1USSA 3K70D 4WXCA 2DOEA 1S29A 3ASNH 2IA1A 2Z99A 5BOXA 2CMPA 4F92B 4IQJA 3VYRB 3P9KA 3O3KA 1W7PA 1J75A 4ZYDA 5E18F 3F21A 4AIHA 1D0XA 2M0MA 4G94A 1VNDA 5JI6A 2X48A 2DN0A 4C2MJ 1RNLA 3VWBA 1ZREA 4XL9A 4LB6B 1GXQA 2MG4A 2UXXA 4UXNA 4HQEA 2EFPA 1G3WA 4OIOF 3EETA 1T08B 2DQRA 2K4BA 2QKLB 3C1DA 4PUSA 3RKWA 4BE0A 2NRAC 1VQNI 3J81K 1LFBA 2ME0A 3BZ6A 3F8FA 3TEDA 1D1AA 4IHSA 1RKTA 1IF1A 5J4YA 2XF6A 1U9OA 1ON2A 3CMMA 4RGUA 1QZEA 5JHUA 2CV0A 3ZMDA 3JAMZ 4C30A 2RDPA 2K27A 2EV6A 2K9LA 4XOPA 2VBXA 1TLHB 3I4MJ 2NVQJ 2R7WA 3TP3A 3S3MA 2Y30A 1FYMA 2OPTA 4P1WA 5EZHA 4A2UA 5GAEJ 3MKWB 5IT3A 2ZB9A 2EZKA 3ABMH 4EM2A 2PFBA 1ENHA 5C4XJ 3GZ6A 2L9RA 2M7AA 3GBGA 3HB9A 5H6RA 5KAIC 3TQNA 4EQQA 4A3FJ 2VQLA 2K40A 3GUDA 4MQ9F 4XRMA 4CCJA 4V2GA 3ZQFA 3OYKA 2IJLA 3I9V2 1IV6A 5KCMA 2JMWA 2X6XA 2EILH 3NQOA 2NS8A 1MNDA 2XSDC 1JI8A 4L9TA 4MEYF 5DM7F 1N77A 2O5RA 4XM3A 3F9KA 2ZJPF 5DYMA 4UUTA 2OV7A 2VQGA 2DFEA 4FX4A 3A0BC 1TBXA 2FUG2 2MYSA 1SMYF 4LIUA 3HGGA 4M72A 4LG3A 3V7RA 3R61A 1BW5A 3S1QJ 4B09A 1X4OA 4DQ2A 3QPSA 2HYGD 2P6TA 4GDFA 1FSEA 3I4PA 4XONA 4RB0A 3OIPA 3FX3A 3HBLA 1PP7U 2DODA 4EM1A 3ZMUA 4KMFA 2XAUA 3T8TA 2EFNA 4A0YA 3L2CA 4CZCA 3WGIA 2DA4A
chains in the Genus database with same CATH topology
3WG7H 3AG4H 3X2QH 3ABMH 1OCOH 3ABLH 2DYSH 1V55H 3ASOH 1OCZH 3AG3H 3ASNH 1V54H 1OCCH 2EIJH 5B3SH 2OCCH 2EIKH 5IY5H 3AG2H 1OCRH 2Y69H 2ZXWH 5B1AH 2EILH 2DYRH 3ABKH 2EIMH 3AG1H 5B1BH 2EINH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WG7 H;  3AG4 H;  3X2Q H;  3ABM H;  1OCO H;  3ABL H;  2DYS H;  1V55 H;  3ASO H;  1OCZ H;  3AG3 H;  3ASN H;  1V54 H;  1OCC H;  2EIJ H;  5B3S H;  2OCC H;  2EIK H;  5IY5 H;  3AG2 H;  1OCR H;  2Y69 H;  2ZXW H;  5B1A H;  2EIL H;  2DYR H;  3ABK H;  2EIM H;  3AG1 H;  5B1B H;  2EIN H; 
#chains in the Genus database with same CATH topology
 1AU7 A;  4I7H A;  1SEU A;  1LVK A;  3HRS A;  2RRE A;  1QVT A;  3A03 A;  3GW2 A;  4IHV A;  3I4N J;  2PX9 A;  2DMP A;  4YIR X;  2KRC A;  3HL2 A;  1PDN C;  3CC7 I;  3OS2 A;  2PEX A;  1PUF B;  3ZMZ A;  5GTH C;  2XGC A;  3S1M J;  1JKP C;  5IP7 J;  2LFB A;  1K79 A;  4D5C A;  2DTZ A;  1I39 A;  3OYI A;  3ROU A;  2Z33 A;  3O2P E;  1MSF C;  4HX4 A;  4ZTJ A;  2J5O A;  3WTX C;  4BE2 A;  2VL8 A;  2FRH A;  4ZZD A;  4CDG A;  3B02 A;  1MH4 A;  3CDH A;  2ZSH B;  3DLL F;  5E79 C;  3V7C A;  2I10 A;  1EKE A;  4E7I A;  2D2W A;  3I59 B;  5TRD A;  3AL0 B;  1HKS A;  1MNE A;  1Z0X A;  4BL0 B;  5FLM J;  3MZY A;  2RNG A;  2HZD A;  4RAG A;  3M1C A;  4JP0 A;  2VIX A;  1Y1W J;  3VYS B;  3ERE D;  3PO3 J;  2QLZ A;  5M3M J;  1YJ9 I;  1FP2 A;  4L0Z B;  2FOK A;  2A05 A;  1XX5 A;  2Z9O A;  3SXY A;  3DTK A;  1B72 A;  1TP4 A;  1O3Q A;  3QYE A;  1MW7 A;  1RUN A;  2QBY B;  2L7K A;  4NC8 A;  2C6Y A;  4E6K G;  1LEA A;  2ZC2 A;  5C4J J;  1VQO I;  3F22 A;  5F0C A;  2GIV A;  5IYB J;  5BPI A;  3P9I A;  1Y0U A;  5D4R A;  1MMN A;  2HGC A;  4ENM A;  2VUM J;  2NAZ A;  4NDL A;  1Z7L A;  2FNP A;  4G6T B;  3H5N A;  2GA2 A;  3GTO J;  3BR5 A;  1R1T A;  5BMZ A;  1R4N B;  4XKW A;  1R5G A;  1SD4 A;  2Q2E B;  4N4O B;  3IWF A;  2EFW A;  4BE1 A;  1Z77 A;  1S72 I;  1VQL I;  3IL2 A;  2QSF X;  3TOB A;  2F5E A;  5DUK A;  2V9K A;  3AG1 H;  3D5L A;  3NAU A;  2A69 F;  3DLA A;  1IDY A;  4A3M J;  2WAQ A;  2P5K A;  1QPI A;  1Y0N A;  3KP3 A;  3ELK A;  1Y6I A;  4S04 A;  4KA4 A;  1ZHF A;  1DP7 P;  2E1O A;  1BJA A;  2DJI A;  2E7W A;  3LAP A;  3PNT A;  1RRJ A;  2H8R A;  4FCY A;  3G2B A;  1HF0 A;  4P9F A;  2WA0 A;  5EG0 A;  2R7X A;  2HFH A;  3WG9 A;  2VN2 A;  1LB2 A;  3TOA A;  2YU9 J;  4DJA A;  4CYC A;  3FHZ A;  4OAZ A;  3TDU C;  3FXM A;  1HW2 A;  3OV8 A;  1HBX G;  3K4N A;  1NG6 A;  2K9S A;  2IA0 A;  4RM3 A;  3NWS A;  3JTG A;  2QM3 A;  3D5S C;  2K7L A;  3W6V A;  2F5F A;  3BRO A;  3ULQ B;  1J09 A;  1ETW A;  2KIF A;  1B9M A;  4A0X A;  2EIK H;  3GZN B;  4GFB A;  5LRR A;  3ZR8 X;  1D0Y A;  2KIQ A;  1VTN C;  3KZI C;  5CVJ A;  2P7C B;  4GXO A;  2R7R A;  2PMZ N;  2PMH A;  2IGO A;  2NVU B;  4IEJ A;  4UUV A;  3RPU D;  2CQX A;  3QP6 A;  2NVX J;  5D6E A;  2LK2 A;  1SFO J;  5CVU A;  2BW3 B;  2DT7 B;  4Y4R A;  2ZNY A;  1D3Y A;  3GZ5 A;  5ILV A;  1JTY A;  1Y56 A;  1FIP A;  2AXL A;  2OUM A;  4FTH A;  2GM4 A;  2A5W A;  2ELJ A;  1QRY A;  4LMY A;  2HWV A;  2IGN A;  4CCM A;  2P6S A;  5E8G A;  4H0E A;  2H1L A;  3E1S A;  3LNQ A;  1YW9 A;  1ZYR F;  2M8E A;  3RPQ A;  2DFF A;  4PJ0 C;  2X9D A;  3F0C A;  1K61 A;  2MC4 A;  2L02 A;  5EEH A;  4M3G A;  3MKY B;  3CCS I;  1LPQ A;  1XGO A;  3LQQ A;  2HR3 A;  2IW5 A;  2DYR H;  4I09 A;  4UUS B;  5HS7 A;  1P7J A;  2ZCW A;  1H9G A;  2P0W A;  3MVP A;  4ABZ A;  1SFX A;  2ICW G;  2G7U A;  4A12 A;  3NRV A;  2ESN A;  3VPR A;  2YR2 A;  3EDP A;  3DBR B;  3BR2 A;  3WTU C;  1TQP A;  3CUQ A;  5LD2 C;  1DGR M;  2JWT A;  3B6C A;  1TNS A;  5K5Q A;  4CGZ A;  3RZO J;  3I58 A;  3L7W A;  1GVD A;  1U9N A;  1U78 A;  1K4T A;  2R7T A;  5DD8 A;  1KU7 A;  3SEQ A;  2ZJQ F;  1UB9 A;  2M45 A;  2V1U A;  1TWH J;  4F7Z A;  2ZXH A;  5DV5 A;  1LVA A;  5KVR A;  2V79 A;  2CJJ A;  4PJN A;  1H9T A;  2CG4 A;  3W6K B;  2LY2 A;  1N75 A;  3GTQ J;  3EYI A;  1EA3 A;  5IP6 A;  1FYK A;  5ILS A;  4ZH4 F;  2JVG A;  2KMU A;  1JHF A;  1F1Z A;  1Y8R B;  1XSX A;  2W85 A;  3IHU A;  1XCB A;  4HST A;  5EF6 A;  4DW6 A;  5KAF C;  1OCT C;  4KJZ A;  1R5H A;  5GPC A;  2GOM A;  1JT6 A;  3DWL E;  2ZME A;  4ON0 A;  1Z1D A;  1YIJ I;  4CZZ A;  3ABT A;  5F04 A;  5IY5 H;  4AIJ A;  1TW2 A;  3OR1 C;  1ZH5 A;  1DPU A;  4A3E J;  5DCM A;  1BA5 A;  1K6O A;  4BHP A;  4XLP F;  4ZYH A;  2WB1 A;  1UFM A;  1UZC A;  1G4D A;  3BP8 A;  3GX4 X;  5E3M A;  3DCF A;  2IPQ X;  2RQQ A;  3OYL A;  5CVV A;  1HKQ A;  2XC7 A;  1RES A;  4LG0 B;  2UWM A;  4JOM A;  4BJ6 C;  2FNA A;  3C3W A;  4BYY A;  2JZY A;  1LFP A;  5D5U B;  3PQK A;  2VOP A;  4KIF A;  4B47 A;  1Y1V J;  1XGS A;  2XAJ A;  4MTE A;  4LB5 A;  5J6X A;  2KFD A;  5HDG A;  2CQK A;  3BC8 A;  2EB7 A;  3HOY J;  3WTY C;  4NC7 A;  1W36 D;  3BR3 A;  1STZ A;  1SAX A;  3ZQH A;  2E2H J;  3OYD A;  1PUE E;  3ZQC A;  5HS9 A;  1GXP A;  1RI7 A;  3TKY A;  1XD7 A;  3JRD A;  1OCO H;  1MDM B;  3BTL A;  4BXU A;  1AKH A;  1XMA A;  1KU3 A;  3DKW A;  3IAM 2;  4ETS A;  5BQT A;  1T2K A;  2MGQ A;  3FIW A;  3VYU B;  2PG4 A;  5DD4 A;  3MKZ A;  4BH9 A;  2A61 A;  4KYW A;  2DA7 A;  4WF2 A;  5CPR B;  3D1N I;  3BJ6 A;  1I1G A;  2EA2 A;  3PSF A;  4RMN A;  3CJR B;  2PJR B;  1W5C C;  5D6F A;  2DDB A;  4HRI A;  2YU3 A;  2DO7 A;  4GCV A;  4O3M A;  5F0F A;  1SC7 A;  1YRN B;  5D5V B;  1YTY A;  3ZGK A;  1HW5 A;  4D9J A;  2D5V A;  1BR1 A;  2X1E A;  1I6H J;  2E60 A;  5LLQ A;  2STT A;  4YFX F;  5H6Q A;  2AO9 A;  3AG3 H;  4PGH A;  1SVO A;  1KA8 A;  4A3C J;  3NEU A;  1S8N A;  3IH4 A;  1CQT A;  1ZGA A;  2F5D A;  3BG9 A;  4MNU A;  3JAM K;  3WTV C;  3V8K A;  2FSW A;  5CQG A;  2DA1 A;  3RYR A;  1OLT A;  3CDL A;  1HDP A;  2DMQ A;  5D4S A;  1WQ2 A;  1WI3 A;  3WE3 A;  5K5O A;  4ZYE A;  2IS6 A;  4JYK A;  1WJD A;  2VJJ A;  3OL3 A;  4RGS A;  3AG4 H;  3HDD A;  3NAR A;  4QWQ A;  3S2D J;  2QSH X;  2A3S A;  2VXD A;  1EH7 A;  1FP1 D;  1SVM A;  2CQN A;  2E1M B;  1BW6 A;  2KP6 A;  2G9W A;  3L2U A;  1W5T A;  2R5Y A;  3JRE A;  4OMZ A;  5FRO A;  4O5V A;  4U0V A;  3HGY A;  2XGE A;  3FMQ A;  3OYC A;  1J59 A;  4WCG A;  5E1Z B;  4KFC A;  5L3B A;  3DFG A;  1ETK A;  1I27 A;  1KYZ A;  4NNJ A;  1R71 A;  3RKY A;  4G12 A;  2WBM A;  2IP2 A;  2AQF A;  4D7M A;  2EFO A;  3H9Q A;  3K6G A;  1SD7 A;  1B8I B;  3DXJ F;  5F0H A;  4XMY A;  2BEO A;  3O6B B;  1LJ9 A;  2CSO A;  2MD0 A;  1S7A A;  2LKP A;  1WSU A;  1OCZ H;  1TWC J;  2GBY A;  3DKY A;  2MD5 A;  4OIN F;  2X1D A;  1ZRF A;  2HTJ A;  3D0S A;  2E71 A;  2CGP A;  1X1B A;  4JK1 X;  4W97 A;  3GME A;  1N78 A;  2HI3 A;  3TBI A;  1D5Y A;  3C18 A;  1P4A A;  2HQN A;  2W00 A;  5KNL A;  2CWE A;  2MAB A;  1LUJ B;  2X6Y A;  1YW8 A;  1ZQ3 P;  4BQO A;  4RB1 A;  4I0A A;  2P4W A;  3U21 A;  3WG7 H;  1HDD C;  2E7X A;  4BAY A;  1ZGW A;  5J1R A;  5K7Z A;  1ORK A;  3ABL H;  4U7B A;  2LNB A;  3HM5 A;  5HNF A;  4EJT A;  2DLL A;  4KT6 A;  3CQZ J;  1MBH A;  3GTG J;  2E2I J;  3Q3S A;  2ZXI A;  2KHM A;  1QHG A;  3PSI A;  4MFD A;  1BIA A;  3LSJ A;  4WWC A;  3KP6 A;  3UR3 C;  1ZLK A;  2Y69 H;  5LHI A;  2MH9 A;  4DZP A;  3FDY A;  1LEB A;  4ZDP A;  3J7A O;  2VBW A;  3EUH C;  2LKX A;  2ZO4 A;  3OOU A;  3IKT A;  4I6Z A;  3CCL I;  1QHH D;  4CXF A;  5FRM A;  4KN7 X;  5GP9 A;  4ITV A;  1Z05 A;  3JRI A;  2XSJ C;  3HOS A;  2JA8 J;  2STW A;  4E7J A;  3CC4 I;  2HOT A;  3OMY A;  1P4W A;  4L5J A;  2VOO A;  1DU6 A;  2B0L A;  2D1H A;  4RB2 C;  4E4H A;  1T0F A;  3SZT A;  2ETH A;  5F1R A;  4BDZ A;  3KE2 A;  4ASN A;  2DAO A;  3BR1 A;  2KRH A;  3E6B A;  3GYH X;  4BQA A;  4R8H A;  5DUI A;  2R7S A;  2Q2E A;  3KET A;  1OIS A;  3E5Q A;  5DM6 F;  4XR6 A;  4E70 A;  2VON A;  4LLN A;  3HOV J;  1KGS A;  2L4A A;  4KIC A;  1UCR A;  1XDS A;  3T1B A;  2VKV A;  1XGM A;  3DF8 A;  3WOD F;  4LLG F;  2ISZ A;  5ERI A;  3W6J B;  3FXK A;  4B3A A;  2VLA A;  2DMN A;  2HQ5 A;  2GZW A;  3BOQ A;  1YOV B;  1D8J A;  2LLK A;  3B73 A;  1TQM A;  4AM3 A;  4RAY A;  2BXZ A;  4AWX B;  3A2K A;  3E3V A;  2QEX I;  2ECC A;  1BOA A;  1MSE C;  4BJT A;  2LRD A;  2NS0 A;  3HG9 A;  1FJL A;  2KT0 A;  3OYN A;  4PJL A;  4F93 B;  3ZQG A;  3KEO A;  3NWT A;  4A6E A;  1O3T A;  3Q0V A;  1Z3X A;  1IGN A;  2ZJ2 A;  4OIQ F;  1V5G A;  1TW3 A;  3V7S A;  4P5O A;  3PO2 J;  2L3D A;  1GT0 C;  2GWR A;  4A3K J;  1BC8 C;  1FNN A;  1Z7U A;  2D1V A;  3QQA A;  1EH8 A;  1F43 A;  2LF8 A;  4HAM A;  2VI6 A;  4RS8 A;  3AAF A;  2FD5 A;  5DEQ A;  2W48 A;  3G1O A;  3K4L A;  3FXJ A;  1ITY A;  3K2Z A;  9ANT A;  2PMZ A;  4YEL A;  2X6W A;  4M6Y A;  1FT9 A;  5LFA A;  2ZJR F;  3BR6 A;  2V9V A;  4H4K C;  1EJ9 A;  2BZT A;  4UB6 C;  3K1P A;  1EH6 A;  4LOC A;  2JJ7 A;  2V1X A;  2ZME C;  3J7A Y;  2EA4 A;  1I50 J;  4IRH A;  2DK8 A;  3BZC A;  3BCB A;  5IPA A;  1RZ4 A;  5GPA A;  5JHF A;  2HS5 A;  1D5V A;  3QWL A;  3AFH A;  3L2Q A;  1K6Y A;  3CLO A;  4UVA A;  4ENN A;  3FF5 A;  1WKM A;  2QWW A;  2WAF A;  2IRF G;  3HEF A;  1FZP B;  1BJZ A;  1FBU A;  1ZN2 A;  3CD6 I;  4LFU A;  4GYG A;  4EAT A;  2Y2Z A;  3KYL A;  2VQH A;  3V8J A;  5JLW A;  4I01 A;  4Q4Z F;  3HOU J;  4OMY A;  2HXI A;  1VQK I;  4IF4 A;  5BS6 A;  1WRJ A;  4ZZL A;  2MSY A;  2HVQ A;  4ESB A;  4HA8 A;  2ACJ A;  3PNY A;  1YE9 A;  1WJF A;  4DBR A;  3FWE A;  1FBS A;  1RIO H;  3I64 A;  5EEA A;  4Q5S F;  3RQ4 A;  1LE8 B;  4IHX A;  1RPW A;  2QQA A;  1FOW A;  1YJW I;  1Z67 A;  4KMU X;  3MD2 A;  2M87 A;  3R60 A;  2RN7 A;  4OOI A;  3HIF A;  4AU7 A;  2FBI A;  2P8T A;  3FMR A;  4CCO A;  2ZXW H;  3WGG A;  4EJV A;  3FXR A;  4EGZ A;  1LDD A;  4JBA A;  4ZYA A;  3F6O A;  4RB3 C;  3LWF A;  5AIQ A;  3BG5 A;  1MBG A;  2DT6 A;  3BTC A;  4XNF A;  2AS5 F;  1IRZ A;  5GAD J;  4OAY A;  3RPU A;  1K78 B;  4LIT A;  5CVR A;  4EJU A;  4I99 C;  1KQ8 A;  4S0H B;  3L09 A;  4E7H A;  3OSF A;  4M73 A;  2PQ8 A;  5FB2 A;  3H3V K;  1RC9 A;  3O8G A;  2R7Q A;  5CVI A;  4AYB N;  4M74 A;  3CJQ B;  3MEX A;  5HLH A;  3BJO A;  2HYF A;  1WFX A;  2MA3 A;  4UV9 A;  3LSI A;  1M1E B;  4UHT A;  3JCU C;  3CO6 C;  2LMD A;  4RM2 A;  2FJ1 A;  2UXN A;  5BPD A;  4HPQ A;  3L00 A;  4YIF A;  2VE8 A;  3ERM A;  2P5L C;  5F1J A;  3K4J A;  1X1A A;  2CW0 F;  4KT5 C;  2Y9Z A;  3Q0U A;  1X58 A;  1DQU A;  3CCJ I;  4UNO A;  1VQ7 I;  2F4O B;  1L0O C;  2KPM A;  4C3I J;  2WY8 Q;  2BBY A;  4XKB A;  4U0Y A;  1NH3 A;  2EK5 A;  3RI4 A;  3H1C A;  2M8G X;  1K7A A;  1MJB A;  1U5T C;  1MDM A;  2L7M P;  3I3L A;  2XB5 A;  5J4V A;  1U8B A;  2BY3 A;  4KIT B;  1UEL B;  2XV4 S;  2KJC A;  2IGK A;  3BCA A;  4XLN F;  2JRT A;  3K4M A;  5M5X J;  1HLV A;  4F3Q A;  4XRS G;  4AUX A;  1U5T B;  5F6F A;  2EBI A;  2PJR A;  4HQM A;  2HPI A;  1D1C A;  3BR0 A;  5BNG A;  1BR4 A;  5L3E A;  5L3D A;  1PP8 F;  2W1O A;  1P7I A;  4CO8 A;  2DI3 A;  2DTR A;  3MKL A;  4QPQ A;  1VQM I;  2H09 A;  3LSG A;  2CS3 A;  1ZLJ A;  2ISY A;  2F6C A;  3JRG A;  4F91 B;  3TO9 A;  4DZJ A;  4F52 A;  2Z16 A;  5DS9 A;  3J7Z I;  4BXX J;  1IN8 A;  4Y33 A;  4J01 A;  2LVS A;  1T56 A;  5HLG A;  3DKX A;  4HX7 A;  2VBZ A;  3LFU A;  3GEZ A;  5JLX A;  2CUF A;  4G7Z F;  3CDI A;  2XPU A;  3IRR A;  1IUF A;  2ZKZ A;  3I55 I;  4YII A;  1BI1 A;  1V4R A;  2DOF A;  3IWZ A;  3FXL A;  2O6G E;  1VQP I;  4I02 A;  3CCE I;  1KU2 A;  3E6D A;  4MFE A;  1R49 A;  1ETX A;  1MMS A;  2BVM A;  2L7Z A;  2YX7 A;  3BTI A;  3V42 A;  2OBP A;  3TW7 A;  4BUP A;  3QYB A;  4U87 A;  3T5X A;  4WX9 A;  4CUG A;  4NQW A;  1TL8 A;  1T6S A;  3E6C C;  4UVB A;  2M4G A;  5IT9 Z;  3KPH A;  3R4K A;  4XLC A;  1YW7 A;  5HOO A;  1IC8 A;  1B9N A;  3MN2 A;  2XRN A;  3EPZ A;  2OZ6 A;  1XDU A;  1X3W B;  4HDV A;  1J0R A;  2MH2 A;  2LDU A;  1B8I A;  3L9F A;  3KP7 A;  2VJ5 A;  3BPV A;  1FOX A;  2WY7 Q;  2KLO A;  5HDN A;  1Y39 A;  3W2V A;  3HYI A;  5GTI C;  3ISP A;  4M6X A;  1HQC A;  1XC5 A;  1FY7 A;  2M34 A;  4HNV A;  1TZL A;  2M7B A;  2F48 A;  3VSL A;  3RKQ A;  2NYX A;  2R7U A;  1G3Y A;  4L9V A;  2OF7 A;  4N9H A;  5KHD A;  2RGV A;  4HDU A;  3MFK A;  3FZV A;  1OR7 A;  1G59 A;  2G0E A;  3H3Z A;  2HDD A;  3ZQQ A;  2F4I A;  2ZXJ A;  3BQY A;  4C9Y A;  1O3S A;  4BKX A;  5IOY A;  1MMD A;  2QCO A;  3E7L A;  2K9M A;  1VQ6 I;  4XQF A;  2EQR A;  3BWG A;  3KIO A;  4J00 A;  2LKS A;  5ICG A;  4BDY A;  3KLO A;  4G9Y A;  2HNH A;  1OYI A;  4S05 A;  5E3N A;  3R6S A;  4YG2 F;  2OTJ I;  1J9I A;  2CH0 A;  2O0Y A;  4PDK A;  2GQQ A;  2Y0M A;  5F64 A;  1ZAO A;  3HHH A;  4QPO A;  5ICE A;  1MMA A;  2KIS A;  4K2E A;  1IAW A;  1P2F A;  4A6D A;  2Z5U A;  4QSH A;  3VYT B;  2RAE A;  3HOZ J;  3MMY B;  4ANJ A;  4DGW B;  1S3J A;  4AD9 A;  1LFU P;  5CQE A;  2E2J J;  2DFH A;  3K69 A;  1IXR C;  3FKJ A;  1O3R A;  3M4O J;  5J8F A;  1SVL A;  3LAJ A;  4ESJ A;  1JUS A;  1W1W E;  2K3F A;  4ZC3 A;  2DCE A;  3H5A A;  3VOE A;  2D45 A;  4G6D A;  1Z9C A;  4HF2 A;  1QU3 A;  2IBD A;  1RET A;  1WI9 A;  3F72 A;  1UJ8 A;  1R1V A;  1XMK A;  1IG7 A;  2VJI A;  2KJB A;  4BY1 J;  1UG0 A;  1E2X A;  2HDW A;  2VKH A;  4N9I A;  3CF2 A;  4PFP A;  3DEW A;  4R1H A;  3BG3 A;  3KP5 A;  1MH3 A;  3L2R A;  2W7N A;  1X2N A;  2L4M A;  3LSR A;  3QPH A;  3N4M A;  4M9X A;  5F08 A;  4N0B A;  1YS6 A;  1SFU A;  2XGX A;  1KU9 A;  4YFN F;  3HHG A;  2Y75 A;  1OKR A;  2M0C A;  1I5Z A;  4XSX F;  5K7F A;  1FEX A;  2O03 A;  3IH3 A;  2BXY A;  2KL4 A;  3E0J B;  5B1A H;  3WTS C;  4BAC A;  3HRT A;  1IN7 A;  1FYL A;  3QU6 A;  2X85 A;  2YPR A;  5HDK A;  1ZEL A;  2DK5 A;  1VI0 A;  2HDC A;  4BBR J;  2K02 A;  1MKM A;  4BJ5 C;  2VOD A;  1FC3 A;  2DW4 A;  2HVR A;  4Y17 A;  1H88 C;  1T95 A;  2M30 A;  1Z6T A;  1SAU A;  3K7A J;  2GXA A;  2LTP A;  3MWM A;  2XDV A;  1R00 A;  2PJP A;  1I1S A;  4L9J A;  2FBK A;  2M4K A;  2FU4 A;  3FBI B;  2LR8 A;  2V6C A;  2VC0 A;  2QQ9 A;  1C0W A;  2V26 A;  3E5U A;  3QPT A;  5GAH J;  3PIP F;  1GDT A;  1WZ2 A;  2JA7 J;  4A3L J;  1MBE A;  3HRM A;  4OWR B;  2DPU A;  4L0Y B;  1PVE A;  2P7V B;  3RTR A;  1A36 A;  3HKZ N;  2M2E A;  1E17 A;  3GFJ A;  4CSW A;  2NNN A;  3F6V A;  3WU2 C;  3CMA I;  1XGN A;  2AXT C;  4II2 A;  3CO7 C;  2IT0 A;  2HVS A;  3GFL A;  1RUO A;  2O3F A;  5H20 A;  3F3X A;  1IZ1 A;  3GTK J;  3D5R C;  4DBQ A;  3UNG C;  3V8L A;  3IUO A;  2XAG A;  3PFI A;  4BEH B;  4J19 A;  2HTS A;  1HW1 A;  3KP4 A;  5D5X B;  4WXH A;  2RC4 A;  4ENK A;  2X4H A;  4DYC A;  3X2Q H;  2R7V A;  1VZ0 A;  1PYV A;  1R1U A;  1R7J A;  3SQN A;  3MCZ A;  5EDN A;  4XLH A;  3TMO A;  3HSR A;  3ZCO A;  3KX2 A;  1V3F A;  3I54 A;  3SJM A;  4Y15 A;  2JTV A;  3HC7 A;  2CW7 A;  3S1N J;  2COB A;  5AON A;  2BYV E;  2MBF A;  4B44 A;  3HZJ A;  4MEX F;  4IXA A;  1R6R A;  3CES A;  2XRO A;  3M7G A;  1JKO C;  2XRL A;  4D0P A;  1WJC A;  1JXS A;  4KIS A;  2EIM H;  2KDO A;  1H89 C;  3K2A A;  5FLX Z;  4DIQ A;  3JRH A;  1ZG5 A;  1JJ6 C;  2VXZ A;  1XN7 A;  2R7F A;  4RLQ A;  1IUY A;  4A93 J;  4E7L A;  4U0W A;  5J1U A;  4DYQ A;  3DPT A;  1K78 A;  1SAN A;  2Y31 A;  4HW0 A;  2B63 J;  5EYR A;  4GO1 A;  4I0B A;  5J40 A;  3OYH A;  4Y7N J;  1XCV A;  1X1P A;  3DTE A;  4D1Q A;  5FGM A;  4AYB A;  5EEG A;  1IRX A;  5FKN A;  1D8K A;  3V4G A;  4KIB A;  3I5U A;  1YIO A;  4OIR F;  3CF5 F;  1ONV A;  4HZF A;  1ZAR A;  3GTM J;  3SZP A;  1X2M A;  1B59 A;  2ZBK A;  2EIN H;  4L18 B;  2LF7 A;  3LQR A;  3U9G A;  3HOX J;  5CKT A;  2KQR A;  3WGH A;  2EWN A;  1A6I A;  4XRS A;  1HSJ A;  3CC2 I;  2WV1 A;  4MO7 A;  4HOB A;  5LHH A;  5ICF A;  4ZYG A;  2DU9 A;  1G3T A;  2EH3 A;  3BLY A;  1IO2 A;  3F8C A;  4B8X A;  5JVG F;  2R93 J;  2COM A;  2L2O A;  3OYE A;  2UUZ A;  3PQJ A;  4NHJ A;  1Y8Q B;  2VC1 A;  2V7F A;  4NB5 A;  2HYJ A;  3T0Y A;  4IHY A;  1B72 B;  2WC2 A;  2EJR A;  3FXU A;  1S5L C;  5J1Y A;  3PL8 A;  3J80 Z;  2IGM A;  2JUG A;  2O61 A;  2GA1 A;  2PI0 A;  4LIV A;  3H9G A;  1MJ9 A;  1F36 A;  1UMQ A;  3UKG A;  4PJJ A;  3RIR A;  2EV0 A;  5E3L A;  4PJM A;  1H0M A;  2ZNZ A;  1QO0 D;  1WVR A;  5FD5 A;  2AHQ A;  1U2W A;  1TQI A;  2ECB A;  3K1M A;  1GUU A;  2OCC H;  4I98 B;  1PUF A;  2P5V A;  2FML A;  4Y3O A;  1YO5 C;  3IC7 A;  2OC6 A;  1WH5 A;  2LYC A;  1P4X A;  3K4C A;  3E5X A;  4XKC A;  1QBJ A;  4D5F A;  3DEU A;  5ED4 A;  5GAG J;  3GVA A;  2YSR A;  3I59 A;  1MBF A;  3FK6 A;  3CCR I;  5M3F J;  5EGO B;  1REP C;  1OCC H;  4PZJ A;  4BU2 A;  2HZT A;  3OR2 C;  2FX0 A;  1YJN I;  3DTI A;  3ZPL A;  1OFC X;  1FTZ A;  2LC2 A;  3WU1 B;  4HV6 A;  1JGG A;  3DPL C;  4PCQ A;  2R5Z B;  5A2Q Z;  3DU6 A;  2L7F P;  3TO6 A;  2K3P A;  2QBY A;  4L9N A;  4CYC B;  3LSM A;  2R7O A;  3SYT A;  3K9T A;  3CCM I;  2CFO A;  3U1D A;  2HKX A;  4EMS A;  3OYB A;  5FRN A;  3HSE A;  5L3C A;  1R58 A;  5HLI A;  3VFZ A;  2LP0 A;  3M9A A;  3HTS B;  3CJN A;  3F8B A;  2FMY A;  3ZQI A;  3HUG B;  2RKH A;  2JSP A;  3G71 I;  1YI2 I;  2CW8 A;  1HST A;  2B7E A;  3GF2 A;  4G6Q A;  2XIG A;  2DA5 A;  1RKW A;  2Y9Y A;  4HBL A;  1JKR C;  4FET A;  2BVL A;  2HPM A;  3RYP A;  4EJO A;  2CQQ A;  4RGR A;  3COA C;  2RVC A;  2HXO A;  4BS9 A;  2F4M B;  4Y52 J;  2BV6 A;  1YHQ I;  4CH7 A;  1V55 H;  3ONQ A;  1TC3 C;  4KNY A;  4QIW N;  1I6X A;  2F5V A;  4X0G A;  1BI0 A;  5IYC J;  2HOS A;  5IT9 K;  3C2B A;  2XKO A;  1ZR4 A;  1HCR A;  1J5Y A;  3PUF A;  1SD6 A;  4G8X A;  2V1D A;  1X3Z B;  5B3S H;  1UHW A;  1TTY A;  4FQG A;  4Q48 A;  1IN6 A;  4RAF A;  4B48 A;  4IO9 F;  1X4P A;  1AWC A;  1ERD A;  2W4S A;  2A6T A;  3CUQ C;  4ZJZ A;  1V5E A;  4IPA A;  3U2R A;  1T38 A;  4Q47 A;  1SMT A;  2IA2 A;  6PAX A;  4FE4 A;  3ECH A;  1BR2 A;  2ZSI B;  5IYD J;  3OWT A;  2NNY A;  2XGD A;  4BQN A;  1OQY A;  4WK8 F;  2BOL A;  2OA4 A;  2OQG A;  5LEK A;  4OU0 A;  4UVC A;  5EZG A;  1DGW Y;  1WJA A;  2E19 A;  5DDG A;  5KK1 A;  4XN0 A;  3LSK A;  2WAE A;  1JGS A;  5IOZ A;  1E0E A;  2W84 A;  4A5N A;  4DOZ A;  1AOY A;  2R92 J;  4CIC A;  2FOW A;  3ZQ7 A;  1X1C A;  5E8I A;  3S3N A;  2BW3 A;  5ILU A;  2WV0 A;  1ACI A;  2JN6 A;  3VOD A;  4EGY A;  4BY7 J;  1JKQ C;  4HEA 2;  4RBO A;  1OMI A;  2VE9 A;  3ZMS A;  3JR9 A;  4I76 A;  2ZME B;  4KUM A;  4FAS D;  3CCU I;  5FD6 A;  5FKM A;  4HSR A;  3ZMV A;  3KFW X;  2R7Z J;  4BXF A;  3A1Y A;  2BY2 A;  2XF7 A;  3VB2 A;  1FTT A;  3DBL B;  4A3D J;  2I5U A;  1YX5 A;  4HNT A;  5J8C A;  1ZG1 A;  4UUS A;  4ENJ A;  3BY6 A;  5HNH A;  2XF5 A;  1G2H A;  2CUJ A;  2CUE A;  4QTR A;  2VBY A;  3RQI A;  3U1K A;  2VT2 A;  3HOW J;  3ML6 A;  2OD5 A;  5DCF A;  1A5J A;  2EZI A;  2DMT A;  4UY8 I;  3M07 A;  2ELK A;  2A68 F;  4CHU A;  1EV7 A;  3H9J A;  3BG7 A;  4IVN A;  2V1N A;  4RDU A;  3KYD B;  2DMU A;  1UAA A;  3K0L A;  3CMY A;  1QPM A;  3EUA A;  2JA2 A;  2E5N A;  2CQ7 A;  4XIC A;  4E7K A;  3QOD A;  2F2E A;  4FT8 A;  5M5W J;  1R5I D;  2TCT A;  1ZRD A;  2DBB A;  4XSZ F;  3IV5 A;  5TJJ A;  1ETV A;  1O7F A;  4XOR A;  4II3 A;  4XRF A;  3A01 B;  5JFR A;  2QGU A;  3HSF A;  3DPU A;  4N4N B;  1AKH B;  3TDZ C;  4BHB A;  3GFM A;  3RJP A;  4BBS J;  2BY1 A;  1BM9 A;  5FKK A;  1LDK B;  3W2A A;  1XTA A;  4EJW A;  2K5C A;  5L3F A;  3PFY A;  3BT9 A;  4RGX A;  3CCQ I;  3H92 A;  3QOP A;  3WU0 A;  2ZFU A;  4B1R A;  3TL4 X;  2OTL I;  3E6M A;  4MHG A;  2V4J C;  3HTU A;  2YX4 A;  3CME I;  1IJW C;  1N25 A;  4CCN A;  1FX7 A;  4LD5 A;  5B1B H;  4W1U A;  4FIS A;  3CCV I;  3K70 C;  4PFO A;  5CJ9 A;  3TGN A;  3HKZ A;  4LG0 A;  3FM3 A;  4C2T A;  3ESW B;  4EM0 B;  5EJC A;  1W0T A;  1H8A C;  2Z1D A;  2ZFW A;  1YS7 A;  1Z21 A;  3KZZ A;  4PSW A;  1S7O A;  1CGP A;  1U8R A;  1MD0 A;  2JT1 A;  4BEH A;  4GGG A;  3AKZ A;  4NBQ A;  4B4C A;  1XB4 A;  2UZK A;  2L0K A;  4P96 A;  2CO5 A;  3L1P A;  1T98 A;  4JX5 A;  2QZ8 A;  1YFH A;  1YYV A;  2HEO A;  1SD5 A;  3H5R A;  3KLN A;  1QNT A;  3EYY A;  2DYS H;  2R0Q C;  2IAI A;  2R5Y B;  2HOA A;  4ESF A;  1U0J A;  3VSK A;  4AIK A;  2WWY A;  2KRF A;  3DQV C;  1IN5 A;  1IV8 A;  3MZ8 A;  4Z6Y A;  4PSX A;  4IJA A;  2DT5 A;  5B66 C;  1V5F A;  5CLS A;  1KZH A;  1A04 A;  3JRC A;  2LBF B;  2HU9 A;  4JQF A;  5HLT A;  3ZN1 A;  1YRN A;  2H27 A;  1XS9 A;  1FMW A;  1DUX C;  4R79 A;  2VQC A;  2NOG A;  3TP0 A;  1OYW A;  3LFK A;  2Z2S B;  1YLF A;  4IHT A;  1B1B A;  5H2F C;  3L2V A;  2A6E F;  5JR3 A;  4IKF A;  1E3P A;  3M8E A;  2RQP A;  4IQ4 A;  4M9Z A;  3SZG A;  5LEJ A;  3H0G J;  3B6A A;  4XBF A;  3CUO A;  1O4X A;  1Z3Y A;  4CCK A;  3M1E A;  2GLO A;  2IEK A;  4XKV A;  1GHC A;  2LSO A;  5FLX K;  1L3L A;  1LDJ A;  1NK2 P;  3AL0 C;  3E97 A;  1AA7 A;  4CYD A;  2EZH A;  4G7O F;  1FSH A;  2VT3 A;  2KZG A;  4JX4 A;  4G7H F;  5E20 A;  5FFZ A;  1WHU A;  4CCL A;  4EEF G;  3BG6 A;  1YIT I;  1ZR2 A;  5HOD A;  1XSD A;  4YFK F;  3FKI J;  3HPH A;  1BIB A;  3OOP A;  2LRE A;  3J7Y J;  3C2H A;  3W2W A;  3LA7 A;  4IX7 A;  3QOE A;  2H6C A;  3SFI A;  2MLK A;  3EQL F;  4OIP F;  3FK7 A;  2M5W A;  3CZ6 A;  1HOM A;  1D1B A;  1T0F C;  3OL4 A;  4RA2 A;  1VF9 A;  1F4K A;  2X6O A;  1GVJ A;  1KQ9 A;  3F8M A;  4IHW A;  2GOX B;  2KKO A;  1NK3 P;  3JSP A;  3IRQ A;  4RLF A;  2FA5 A;  1IRG A;  1ZGJ A;  2JPC A;  3LSH A;  4UV8 A;  1BC7 C;  2WTE A;  4B3X A;  1FIA A;  4IOC F;  1VQ8 I;  1CF7 B;  4AVZ A;  1FMV A;  2X1C A;  1IRF A;  5ICC A;  3DP7 A;  1XPX A;  3OYF A;  3G4S I;  3EUK L;  4LK0 F;  1BL0 A;  4M71 A;  2B9S A;  3DU5 A;  4WXD A;  4F55 A;  1U3E M;  3A0H C;  1QVU A;  3J80 K;  3ABK H;  2VKD A;  3I0T A;  1W0U A;  3A02 A;  4YEJ A;  4HLX A;  3HJE A;  1FLI A;  1R23 A;  4XID A;  2DXI A;  2XKP A;  1WPK A;  2EPF A;  5EGO A;  2Y0S N;  2MFZ A;  1D0Z A;  2VB6 A;  1MZB A;  1W7P D;  2KIM A;  1WJE A;  3H35 A;  2JA5 J;  2ELH A;  3BQZ A;  3OIO A;  3C2G A;  2V9P A;  2R5Z A;  2PLY A;  1T33 A;  2DA2 A;  4HX8 A;  2Q8K A;  1DU0 A;  1KON A;  3FHN A;  2EFQ A;  3ZQL A;  2K86 A;  3HPG A;  5J47 A;  3JRA A;  2XHK A;  3PNV A;  4A3G J;  3MAJ A;  2OQR A;  1I3A A;  2VPR A;  2M3A A;  2LH9 A;  4XLF A;  2DA6 A;  1BI3 A;  1I3Q J;  1ZRC A;  3TO7 A;  1WWX A;  3EUH A;  3FBN B;  3ECO A;  5TGT A;  4AVP A;  1F5T A;  4KIG A;  5C3E J;  4B43 A;  3ZN0 A;  1MMG A;  2FQ4 A;  3G1L A;  4HNU A;  4O6J A;  4M3F A;  1Q1V A;  1XMX A;  3HUG A;  2GAU A;  2K9Q A;  1OCP A;  3IAS 2;  5JVT A;  3P9C A;  5A2Q K;  3QP5 A;  2NVY J;  4D7N A;  2WAD A;  4HF1 A;  3VDX A;  1G6N A;  1UHM A;  4X6A J;  3S14 J;  1WJB A;  1Z91 A;  2QYO A;  3ABU A;  1FOK A;  3ZMT A;  1X3U A;  2X51 A;  3S15 J;  4C2U A;  5D5W B;  1QZZ A;  4X1E A;  2KZV A;  1V54 H;  2J5P A;  3Q0W A;  3N05 A;  1JUM A;  3BZK A;  4NUB A;  3S16 J;  1G3S A;  2IS4 A;  3J81 Z;  3OYG A;  2E36 A;  2EIJ H;  1NHA A;  2JUC A;  2P81 A;  2W24 A;  4FHT A;  1TT0 A;  3HRU A;  1MGT A;  3JRF A;  1KYW A;  2OAZ A;  2AQE A;  1W7P B;  4M6V A;  2OZU A;  1A35 A;  2K4J A;  1LQ1 A;  4FE7 A;  4CA0 A;  3W3C A;  1VQ4 I;  4IRI A;  2LY9 A;  3LOC A;  1YG2 A;  4P9U A;  2XUB A;  2E1C A;  2E1N A;  4HF0 A;  5FKL A;  2MLG A;  3SHF A;  2R3S A;  3FIS A;  1WGX A;  3CJT B;  2FF4 A;  3RDI A;  3FXO A;  2QA4 I;  2N8G A;  5IP9 J;  1F9N A;  3LL7 A;  5HVQ C;  3Q5F A;  4A3I J;  4V2F A;  3CTA A;  4IZZ A;  3SEZ A;  1QA6 A;  3CCY A;  3SDG A;  4PGG A;  4M3E A;  4LLL A;  2O7O A;  2KIU A;  2DJN A;  1IXS B;  1S9H A;  2X0L A;  1IW7 F;  3IP4 B;  1YX3 A;  3KCC A;  5LRS A;  3RKX A;  1JUP A;  5E1X A;  4IOA F;  1S6L A;  2OU2 A;  3GO5 A;  1TNT A;  1R9T J;  2DPD A;  4M3D A;  4FX0 A;  2TRT A;  2CFX A;  2HKO A;  2LD5 A;  1E3O C;  1A31 A;  3BPX A;  4U88 A;  4BGD A;  2NVT J;  3LA3 A;  3ZP5 A;  1R22 A;  4ZDL A;  3K10 A;  2Q0O A;  3T8R A;  2RV8 A;  2CV1 A;  2QEN A;  1LKX A;  2BHZ A;  4MGR A;  5LBQ A;  3AG2 H;  3PJR A;  1OCR H;  2L9V A;  2CUZ A;  1XG1 A;  1E3H A;  2LY1 A;  3LA2 A;  4EV0 A;  3HOT A;  3MZH A;  1APL C;  3GLX A;  2GXG A;  2DQL A;  3QYF A;  2ESH A;  1WCM J;  3H3U A;  5LGN A;  2FE3 A;  3BTJ A;  2O9L A;  3WHB A;  3QRF F;  1W5S A;  1LE8 A;  1IN4 A;  4RAZ A;  1ETY A;  3KZY A;  3S1R J;  1BOB A;  1UG2 A;  2XPW A;  4DNC A;  1P9Q C;  3PM1 A;  5K1Y A;  1LNW A;  3FMS A;  1FPQ A;  2FXA A;  4LGW A;  3GFI A;  1JHH A;  3S93 A;  3I56 I;  1G8X A;  1NG7 A;  3Q9V A;  4Z2Y A;  4I2O A;  4L5I A;  5E1W A;  1B4A A;  2FQ3 A;  3A01 A;  2BHY A;  3ZXS A;  1WJ5 A;  4BQQ A;  1BBY A;  1SFK A;  3K1N A;  4M9S A;  4A0Z A;  4AC0 A;  1HA8 A;  3S3O A;  2L54 A;  2JK3 A;  3CP2 A;  1DDN A;  4LK1 F;  1PJR A;  1HXD A;  3H36 A;  3RSN A;  2CV2 A;  2MC3 A;  3O8H A;  3I53 A;  3G6E I;  1U6G A;  5B5E C;  2L01 A;  2QUF A;  1S7E A;  3I71 A;  2MW8 A;  2TDX A;  5M5Y J;  3F23 A;  2YS9 A;  4BNC A;  2W25 A;  2JA6 J;  3H0D A;  2K85 A;  2LOO A;  3REO A;  1ZG3 A;  2FBH A;  2NOJ B;  3CLQ A;  2Q1Z B;  4HG2 A;  4DYR A;  1JTX A;  1K83 J;  4XLE A;  1X1D A;  1AHD P;  2JRM A;  2VAS A;  1VQ9 I;  2OCE A;  3WTW C;  3M3Y J;  4C3J J;  3JTH A;  5TIS C;  2I8D A;  1MNM C;  2BE5 F;  3JRB A;  1P92 A;  2E1M C;  4L5E A;  1W36 C;  3BJA A;  2VPL A;  3DEE A;  1J7K A;  2QKM B;  4XK4 A;  5FFX A;  2L9S A;  2CYY A;  2DDA A;  1HKT A;  4ZTF A;  1QZY A;  4HYE A;  2QQ8 A;  3QU3 A;  2ID6 A;  4LJZ F;  3SDB A;  2RNJ A;  4A5M A;  3CP8 A;  4XLA A;  3PIO F;  3DBH B;  1TWA J;  2CU7 A;  3GTP J;  3OYJ A;  2H94 A;  4NC6 A;  1MBK A;  3TW6 A;  3JW4 A;  1X19 A;  2UV1 A;  3R0A A;  3OS0 A;  4NQW B;  3Q9S A;  5AIP A;  1U5T A;  1ULY A;  1WH7 A;  3P5J A;  4C3H J;  4BHC A;  3KEQ A;  1YQA A;  4MLO A;  1DP3 A;  2NS7 A;  3MQ0 A;  2LBF A;  3LST A;  4IL6 C;  3OS1 A;  1Z6R A;  1KQ0 A;  1OPC A;  3C7J A;  1MJA A;  1Q1H A;  5FLV A;  3GTJ J;  2YUS A;  2QSG X;  1BI2 A;  1DPR A;  3GCM A;  2QF7 A;  1VQ5 I;  2Y48 A;  3ASO H;  3OY9 A;  5FJ8 J;  2WAQ N;  1GLN A;  2A5Y B;  2BY0 A;  5C44 J;  1O7L A;  4A69 C;  3S8P A;  2M9H A;  2XPV A;  4XN3 A;  1POG A;  1OR7 C;  2JSC A;  1ZTR A;  2E34 A;  2XAS A;  3IH2 A;  1RR8 C;  5EG0 B;  2F5C A;  4V19 K;  1OJL A;  1A6Q A;  3G73 A;  4KDP A;  2JPB A;  3WE2 A;  5K5R A;  1W4M A;  5D8K B;  5D8L B;  5K7H A;  1MBJ A;  2EZL A;  2PMU A;  3ZOB A;  2K9N A;  3G3Z A;  4IRG A;  5CYV A;  1JT0 A;  3S2H J;  1IXC A;  3A4C A;  5FKO A;  2DOA A;  3SFZ A;  3M8F A;  3QAH A;  2IS1 A;  1HC8 A;  1TWG J;  3BDD A;  2JVH A;  3DV8 A;  4QLC U;  4KN4 X;  3RZD J;  1GV5 A;  2E5Z A;  4MQV A;  2HOE A;  2NXN B;  4A3J J;  1VFC A;  2PN6 A;  2XVC A;  4GRI A;  2IS2 A;  2DA3 A;  2R7D A;  2H8W A;  1QGP A;  2JQ7 A;  3OSG A;  2ME6 A;  4MIM A;  1FOY A;  3R0J A;  2IXS A;  4JX6 A;  2O8X A;  4TV7 A;  5HS8 A;  2PBI A;  2LG4 A;  1K4S A;  2VKE A;  3KP2 A;  2EV5 A;  3OYA A;  3WTT C;  4XOT A;  1T8I A;  3OIQ A;  3KEY A;  3RCO A;  2FEZ A;  2E35 A;  3PUB A;  1O57 A;  4AID A;  1CF7 A;  2DFI A;  5L3G A;  1ODD A;  1BN5 A;  4P55 A;  3LSP A;  5LHG A;  2XAF A;  3WHC A;  3L2W A;  1XSV A;  5E3O A;  2R4G A;  4A3B J;  3GWZ A;  2XAH A;  4YRV A;  1FBQ A;  4Y13 A;  3FM5 A;  3VEP A;  4E7Z A;  3P7N A;  2H1K A;  2XB0 X;  2L5Q A;  3FXQ A;  3IKV A;  3S32 A;  2ADU A;  2A6H F;  2CRG A;  2QQB A;  1UST A;  2Y0S A;  5LGT A;  1ETQ A;  4PK4 A;  5FO5 A;  5J3L A;  2HQR A;  2BGC A;  3CUQ B;  3G1M A;  4E7S A;  1ETO A;  1JE8 A;  2V6E A;  1GV2 A;  2GIZ A;  2IVM A;  3KYC B;  3N97 A;  3K4B A;  1TWF J;  2VJ4 A;  2OJE D;  4HLY A;  2W57 A;  1RR7 A;  2G7H A;  1T39 A;  1IDZ A;  1TT5 B;  1R4M B;  2HQA A;  1EF4 A;  3OYM A;  4ZDO A;  1QQI A;  3ZRG A;  1R36 A;  3LMM A;  3F8N A;  1ZKG A;  4MTD A;  3GLL A;  4GYI A;  4EVI A;  2QVO A;  3S2W A;  3GTL J;  2KDZ A;  2ID3 A;  1NTC A;  2L9N A;  3HXL A;  2M1B A;  1OYY A;  1ZK8 A;  3K4K A;  3JSO A;  2XAQ A;  3S17 J;  3GXO A;  5E17 F;  2H6B A;  3M8J A;  5DCM B;  1UHS A;  2Z3Y A;  2W82 A;  4U7D A;  1B6A A;  1ON1 A;  4M3B A;  2O8K A;  2A07 F;  1P6R A;  2WB1 N;  1J2X A;  2GXB A;  3WTZ A;  4UB8 C;  1FWZ A;  5LGU A;  1JJ8 C;  5DTD A;  1SFE A;  4HV5 A;  5F27 A;  3QPL A;  1MIJ A;  1USS A;  3K70 D;  4WXC A;  2DOE A;  1S29 A;  3ASN H;  2IA1 A;  2Z99 A;  5BOX A;  2CMP A;  4F92 B;  4IQJ A;  3VYR B;  3P9K A;  3O3K A;  1W7P A;  1J75 A;  4ZYD A;  5E18 F;  3F21 A;  4AIH A;  1D0X A;  2M0M A;  4G94 A;  1VND A;  5JI6 A;  2X48 A;  2DN0 A;  4C2M J;  1RNL A;  3VWB A;  1ZRE A;  4XL9 A;  4LB6 B;  1GXQ A;  2MG4 A;  2UXX A;  4UXN A;  4HQE A;  2EFP A;  1G3W A;  4OIO F;  3EET A;  1T08 B;  2DQR A;  2K4B A;  2QKL B;  3C1D A;  4PUS A;  3RKW A;  4BE0 A;  2NRA C;  1VQN I;  3J81 K;  1LFB A;  2ME0 A;  3BZ6 A;  3F8F A;  3TED A;  1D1A A;  4IHS A;  1RKT A;  1IF1 A;  5J4Y A;  2XF6 A;  1U9O A;  1ON2 A;  3CMM A;  4RGU A;  1QZE A;  5JHU A;  2CV0 A;  3ZMD A;  3JAM Z;  4C30 A;  2RDP A;  2K27 A;  2EV6 A;  2K9L A;  4XOP A;  2VBX A;  1TLH B;  3I4M J;  2NVQ J;  2R7W A;  3TP3 A;  3S3M A;  2Y30 A;  1FYM A;  2OPT A;  4P1W A;  5EZH A;  4A2U A;  5GAE J;  3MKW B;  5IT3 A;  2ZB9 A;  2EZK A;  3ABM H;  4EM2 A;  2PFB A;  1ENH A;  5C4X J;  3GZ6 A;  2L9R A;  2M7A A;  3GBG A;  3HB9 A;  5H6R A;  5KAI C;  3TQN A;  4EQQ A;  4A3F J;  2VQL A;  2K40 A;  3GUD A;  4MQ9 F;  4XRM A;  4CCJ A;  4V2G A;  3ZQF A;  3OYK A;  2IJL A;  3I9V 2;  1IV6 A;  5KCM A;  2JMW A;  2X6X A;  2EIL H;  3NQO A;  2NS8 A;  1MND A;  2XSD C;  1JI8 A;  4L9T A;  4MEY F;  5DM7 F;  1N77 A;  2O5R A;  4XM3 A;  3F9K A;  2ZJP F;  5DYM A;  4UUT A;  2OV7 A;  2VQG A;  2DFE A;  4FX4 A;  3A0B C;  1TBX A;  2FUG 2;  2MYS A;  1SMY F;  4LIU A;  3HGG A;  4M72 A;  4LG3 A;  3V7R A;  3R61 A;  1BW5 A;  3S1Q J;  4B09 A;  1X4O A;  4DQ2 A;  3QPS A;  2HYG D;  2P6T A;  4GDF A;  1FSE A;  3I4P A;  4XON A;  4RB0 A;  3OIP A;  3FX3 A;  3HBL A;  1PP7 U;  2DOD A;  4EM1 A;  3ZMU A;  4KMF A;  2XAU A;  3T8T A;  2EFN A;  4A0Y A;  3L2C A;  4CZC A;  3WGI A;  2DA4 A; 
#chains in the Genus database with same CATH homology
 3WG7 H;  3AG4 H;  3X2Q H;  3ABM H;  1OCO H;  3ABL H;  2DYS H;  1V55 H;  3ASO H;  1OCZ H;  3AG3 H;  3ASN H;  1V54 H;  1OCC H;  2EIJ H;  5B3S H;  2OCC H;  2EIK H;  5IY5 H;  3AG2 H;  1OCR H;  2Y69 H;  2ZXW H;  5B1A H;  2EIL H;  2DYR H;  3ABK H;  2EIM H;  3AG1 H;  5B1B H;  2EIN H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...